2XRIA

Crystal structure of human eri1 exoribonuclease 3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
206
Chain Sequence
NLYFQSMSFPPQRYHYFLVLDFEATCDKQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERI1 EXORIBONUCLEASE 3
publication title Crystal Structure of Human Eri1 Exoribonuclease 3
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 206
sequence length 207
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xriA01
3CFOA 3RMCA 1L3TA 4AHVA 4CGGA 2NUBA 1L3SA 4FZXC 4FJJA 1KVAA 2G8IA 2HHUA 2DFHA 3KK3A 4N41A 2AJQA 2RPIA 3LP1A 3HPGA 1FKPA 3HVTA 1RDCA 4CERA 3HM9A 3K5OA 2KFNA 1JXBA 2RN2A 3PY8A 1SUQA 2P5GA 2B4JA 3V9UA 2BDPA 2ZQBA 2GUIA 3NBPA 1TVRA 3LP2A 4B8CA 3NCIA 3RMAA 1IKVA 3DOKA 3U6FA 3V9WA 1LW2A 4I2QA 3DOLA 4ID1A 2IOCA 1WLJA 2EX3A 3T1AA 1R0AA 3T19A 4E7LA 3ZT4A 4KO0A 3TANA 4KHUA 4CK2A 4CGFA 2B6AA 1XHXA 4HUEA 5J2NA 3TAEA 4FJ9A 4DWIA 3LDSA 3LP3A 4RW6A 4W5NA 1WSHA 4OPJA 3PX4A 3OYCA 1VRTA 5HP1A 4LD0A 1JL1A 2X6NA 2VG5A 5D3GA 4F4KA 3SNNA 1WN7A 3K59A 3V9SA 4CEEA 1VSEA 4O4GA 5EU7A 4CF8A 4ELTA 2F8SA 4CK1A 3KKSA 1IH7A 1KCFA 4BACA 1RT3A 5FROA 4FJIA 4E89A 2YV0X 3VQ4A 2P1JA 3O3FA 1BI4A 4FLVA 3OYEA 3C6UA 3QLHA 1QSSA 4EZ9A 2DY4A 1EKEA 4FW2A 1HYVA 2ZD1A 3ZSRA 3HVRA 1YT3A 1X9MA 1UA1A 4E19A 2IDOA 1TK8A 2KZMA 4CF9A 3PV8A 4Z4FA 3QINA 3RR7A 4FZYA 1TKZA 5C25A 1RCHA 1B9DA 3TI0A 1S6PA 3ZSZA 3ZT2A 1VSDA 3AO3A 1D5AA 3LP0A 4B3OA 4CK3A 3KLIA 3OYHA 3HK2A 3DRPA 5CZ1A 4QOZB 2Y1IA 4DLEA 4CFDA 4E0DA 3ZSQA 1XC9A 4M3ZA 1BI4B 3V1OA 1JLFA 1GOCA 3K57A 4HUFA 3HJFA 3AVCA 1TL3A 3ZSVA 3EY1A 3AO5A 3JYTA 1VRUA 2DFFA 4MQ3A 3NGIA 4FLWA 3IRXA 3OYFA 3CFPA 1O1WA 4RW8A 1L3UA 4FJXA 4KPYA 1WAJA 1VSMA 1ASVA 1J5OA 4FLUA 3KTQA 2XO7A 2A1RA 4OLAA 4CEOA 4FW1A 2OPQA 4CFBA 4EP4A 3DLHA 4I7FA 2FBXA 1IKWA 3QIPA 4RW9A 1ZYQA 2JLEA 1XI1A 1XWLA 1ZBIA 2Z1HA 2ETJA 2XHBA 2HNZA 1U45A 1S1VA 3AO2A 3V6DA 1I3AA 1BCMA 3VQ8A 1JL2A 4DS4A 2OZSA 4FJLA 1WSEA 2YKMA 4DTMA 3TAGA 3AVLA 5K14A 3B6PA 4BWJA 3DRSA 4AHSA 4Z4GA 4GW6A 4Z4EA 3SPZA 1HNVA 3RR8A 2QKBA 3K2PA 3S9HA 2F96A 1KVCA 4DF8A 3MEGA 1QE1A 1RBVA 5I42A 2F8TA 3HO1A 4CJWA 1SV5A 1LV5A 1CXQA 3SYZA 1IKYA 4G1QA 1S9EA 3SPYA 3S3NA 3M8QA 4BE1A 1KTQA 3T3FA 3AVBA 1NK9A 4KB1A 1CLQA 1UOCA 3O4NA 4Z4CA 3K5NA 4H4OA 3VQ9A 4PA1A 3JSMA 1BHLA 4PQUA 4YNQA 4ZHRA 4CHYA 2R7YA 1A5VA 2G8VA 1EX4A 1ASWA 2IS3A 4RW4A 3WNHA 1U04A 3ASMA 4B08A 4E7JA 3RRGA 1ZBLA 4F3OA 1HPZA 3EZ5A 4JS4A 1KLNA 4B9TA 1GOBA 4AHCA 1B92A 3G0ZA 1LWEA 4CFCA 4B8AB 4C8KA 2BANA 1LWCA 2XRIA 4BWMA 3QNOA 4BDZA 1D9FA 3MEDA 4Z4IA 2QK9A 1JKHA 3C94A 4CJ3A 3TAPA 1EP4A 4Y1CA 1W9HA 3SUNA 1K6YA 2VWKA 4CHOA 1SL2A 4KHWA 3K5LA 3HT3A 1TAUA 3V9ZA 2OA8A 3VN5A 3VQ5A 2G8UA 1VSKA 2GV9A 1F21A 2HW3A 4M3UA 1BL3A 2XY6A 2G8WA 1L5UA 1RILA 3HPHA 5HLFA 2HHQA 1HQEA 3OYDA 1C1AA 5KI6A 3DRRA 3F73A 4J2AA 4FJ8A 4BE2A 1L3VA 4CHQA 3SV3A 2W42A 4JRPA 1RT5A 1S9GA 4AHRA 3OYAA 4UQGA 3VQAA 1TKTA 2HNDA 3O3GA 4AILC 1NK8A 4B9LA 1JLEA 3I0RA 4KTWA 4IG0A 4LY7A 4CJLA 1D8YA 4O44A 1XHZA 4DSJA 3NFAA 1X9WA 4W5TA 3LWLA 1U49A 3CG7A 4CEDA 1HJRA 4FJ5A 3CYMA 3HSTB 3OYIA 3MXMA 2XY8A 2O4IA 4B9UA 2O4GA 4KTZA 3BGRA 4MFBA 3ITHA 3NH0A 1D9DA 4KRFA 2YNIA 2KQ2A 4DSIA 2YNHA 3ISNC 3VQQA 1X1PA 4FJKA 2X6SA 4KTQA 3DM2A 1J53A 3K5MA 2Z1JA 4YFUA 2HHTA 2P5OA 4GVMA 3DI6A 2G8KA 3AVJA 4CEQA 4CJUA 2PZSA 4DTJA 2RF2A 4DFPA 5DK5A 3TAFA 1JLGA 4DTRA 4M45A 3NF7A 1CZ9A 3LWMA 4AH9A 4F8RA 4DSFA 3L3UA 4H4MA 1VSHA 4FLYA 4CEAA 1C0UA 3AVFA 1MU2A 4CIEA 1JLQA 1ZBHA 2IAJA 4M3TA 4DSLA 4F2SA 4RG8A 3U3GA 4W5QA 4ELUA 1ZBFA 4PWDA 4KKOA 2HVHA 4IDKA 3WNGA 1LAVA 4CJ4A 4KHSA 4FLZA 4DFKA 2YNGA 2Z1IA 2X78A 4DTPA 3AVKA 1YVUA 1C1CA 3AVIA 3VA0A 2OPPA 3HP6A 4HTUA 3NH2A 2KZZA 3LZJA 4N76A 2HHVA 1RT2A 4ZTJA 4B9SA 1RTDA 3ZSWA 2KTQA 4DTOA 5CZ2A 1SKWA 1UAXA 2DTUA 1NJWA 1FXXA 4NCGA 3QEPA 3ZCMA 3AA4A 4NYNA 2E4LA 2Q3SA 4DTSA 1C0MA 4DQRA 4DU4A 3AA2A 4FM1A 1Z25A 4FVMA 3QEVA 2Z1GA 5T7BA 3NAEA 1W0HA 3HP9A 1JLAA 1KFSA 3L2VA 1S6QA 4DTXA 3QETA 1UA0A 3P1GA 1CXUA 4M42A 4M3YA 4HVJA 3P5JA 3OS2A 1IG9A 4ZTFA 1EETA 3QESA 3SUOA 3AVGA 4KREA 2I5JA 3DLKA 1VSFA 1BIUA 3ZSOA 3AVNA 3MEEA 1NKCA 4Q5VA 4KAZA 4DSEA 2PYLA 2VG6A 1N6QA 5C24A 2E6MA 2OPSA 1JLCA 3DYAA 3VQBA 4BDPA 4CESA 2OZMA 3C6TA 3OYGA 2DFEA 3OJSA 2OYQA 5KRTA 3KD1E 2G8HA 3TAQA 1Q9YA 3CFRA 4IKFA 4DF4A 3AVHA 1IKXA 3A2FA 4CEBA 3SUPA 1Q9XA 1QTMA 4J2BA 4DMNA 1C1BA 1RTJA 3LPTA 1S5JA 1VSIA 1KFDA 5CYQA 3V1QA 4CFAA 2YHBA 2YHAA 3SQ4A 3ZT1A 1RT4A 2LSNA 1RNHA 3QNNA 3V4IA 3KD5E 3LANA 4O0JA 3LAMA 3SV4A 3OS0A 4FYDA 4KI4A 1RDBA 4H8KA 1U48A 2YKNA 5C42A 1NK0A 4E7IA 1NK4A 3SQ1A 1QQCA 4CE9A 2HNYA 3AO1A 4FLXA 1KRPA 4B9VA 4EZ6A 2VWJA 5E41A 5KGWA 3RTVA 5JS1A 1TV6A 1WNSA 1GOAA 4DS5A 1RT6A 4NCBA 4CEZA 2KFZA 1B9FA 4CECA 4CGHA 4CHZA 3SCXA 1NKBA 5I3UA 2WOMA 5HRNA 3K58A 2IGIA 1T8EA 4M3WA 4OGEA 3VQ7A 1UWBA 3MAQA 4XIUA 4FJHA 1BISA 4L8RB 2D0CA 3MECA 4HCBA 3O3HA 5DMRA 5FDLA 2QKKA 4KFBA 1NK6A 1WAFA 2A1SA 5CY4A 1IO2A 1RTIA 3CQ8A 3QO9A 3OYLA 3L2UA 3HYFA 4O55A 5CYMA 3NHGA 3DLBA 4N47A 4FZZA 3H08A 2FBYA 4KHYA 3TAMA 4CCHA 4PY5A 1TK0A 3V1RA 3V9XA 3DLEA 4DQPA 2HHSA 2HVIA 1FKOA 1WSFA 1I39A 3D0PA 1VSJA 2FBTA 4WE1A 2IC3A 3TR8A 5HRSA 4LH5A 3TWHA 4Y1DA 3L2RA 4JRQA 3WNFA 1CZBA 4RW7A 1KLMA 3AA3A 3NDKA 3ULDA 3TABA 1TKXA 3S3OA 4NCAA 2Y1JA 1RBRA 3ZT0A 1J9AA 4AHTA 4N56A 4DSKA 4DQSA 3VQ6A 2FC0A 4N5SA 1TL1A 1KSPA 1G15A 1J54A 3OVNA 3AVAA 4I2PA 1NJYA 1SKSA 3DMJA 2HMIA 3KK2A 2B5JA 1ITGA 2BE2A 4M3RA 4DTUA 4FK2A 3MXIA 1RBUA 4B9MA 3VQEA 2KW4A 4B9NA 3UIQA 5JS2A 1S1WA 3AV9A 3NF8A 1NOYA 2HB5A 1HNIA 2OPRA 1WSJA 4C8MA 1SL1A 4Z4HA 3RMDA 3WNEA 4FJ7A 3L8BA 4E1MA 4DQIA 1LW0A 3OS1A 5SWMA 3KJVA 4CGIA 3SQ2A 3NGYA 5FRNA 1HYZA 1WSIA 4IBNA 2PYJA 5HROA 1NJXA 4EP5A 2ATQA 1ASUA 1S1TA 3KLGA 3KLEA 3QEWA 1TK5A 4C8LA 3KKRA 1NK7A 1NKEA 4KHNA 3IG1A 4JLHA 3S3MA 3THVA 3OJUA 1A5XA 1A5WA 2ZE2A 4OKKA 4CF2A 4OGCA 1Q8IA 4LSNA 3PUFA 1RDAA 4FCYA 4DFJA 4HUGA 3ZSXA 2EHGA 3OYBA 3I0SA 1TGOA 4Z0UA 3L2QA 4JS5A 1HYSA 3F9KA 1T7PA 3QIOA 3ZT3A 3SI6A 3KK1A 1RBSA 3M8PA 4FJNA 3AA5X 2WONA 4C8OA 3KLHA 4E3SA 4K8ZA 4OJRA 1BGXT 1VK0A 3PX0A 1QS4A 4AHUA 3NF6A 3LAKA 5J2MA 4FXDA 1QHTA 1WSGA 4ELVA 1C0TA 2YNFA 4OKJA 4CJRA 3LZIA 4E7HA 1X9SA 5FRMA 1LAWA 2D0BA 1RT7A 4OLBA 1JLBA 5HBMA 3NE6A 5HRRA 4TSXA 3OYJA 3M8SA 3EYZA 4OPKA 4E7KA 4DFMA 4DLGA 3VQDA 4CJKA 2G8FA 1RDDA 4I9LA 1BQMA 3HL8A 3CM6A 5J2QA 4CHPA 5HRPA 4O0IA 3OYMA 1S1UA 1HRHA 3SJJA 4OKEA 5J1EA 2QXFA 4CJ5A 1T03A 4CJVA 4CJTA 4DTNA 3C95A 1U4BA 3OYNA 1Y97A 4LH4A 3U3YA 1DTQA 1BQNA 1Z26A 1DLOA 3L3VA 1RTHA 2FBVA 4ID5A 4CEFA 3NGZA 4J2EA 4BE0A 4FJMA 4OVLA 4KI6A 4QCLA 4QAGA 5KGXA 4CGJA 3PO5A 2HHXA 3L2WA 3OYKA 1QSYA 4HCCA 2GBZA 4DG1A 4CHNA 1RT1A 3ZSYA 3B6OA 3SZ2A 1NK5A 3VA3A 4CJEA 5KRSA 1RBTA 3PO4A 1NJZA 4F3TA 4CJSA 4FK4A 3P83D 3DLGA 1JXEA 3IS9A 2VG7A 3SUQA 1SKRA 2JGUA 3HPOA 4FM2A 3E01A 4F2RA 3KLFA 3FFIA 5J2PA 3M8RA 2ITGA 3RMBA 4M3XA 3LPUA 1TAQA 4HHTA 1N5YA 3NF9A 1SL0A 4M41A 4W5RA 4GMJB 4KHQA 4KB0A 4DQQA 2X74A 3PX6A 4PUOA 2PY5A 1ZBUA 3SQ0A 4CJQA 4CF0A 3AVMA 4CF1A 4Q0BA 1HMVA 3ALYA 1YTUA 1BCOA 3RRHA 2XY5A 1U47A 1C6VA 4CIGA 3OY9A 2E6LA 4E1NA 4DU3A 3KIOA 3QEIA 3CM5A 3LALA 1HQUA 3IAYA 2HHWA 4IFYA 1KVBA 4NYFA 3NH1A 2D5RA 3TARA 4FJGA 1QSLA 4FK0A 4J2DA 1S1XA 4C8NA 1BIZA 4DU1A 4R5PA 3DLRA 2RKIA 3I8DA 4CGDA 2D0AA 4IFVA 4W5OA 3QERA 3QEXA 3V81A 1LWFA 3D45A 1T05A 3VQPA 1DTTA 4LSLA 2XY7A 3G10A 5KTQA 4KV8A 1VSLA 1EXQA 1FK9A 3AO4A 3MXJA 3O4QA 4O5BA 4IG3A 5SZTA 3HXMA 4FLTA 3VQCA 4CJFA 3BDPA 3RWUA 4I9QA 1REVA 1NOZA 2P51A 2BGGA 1YTAA 4BDYA 4CIFA 4FM0A 4CJPA 4ICLA 1TKDA 4K8XA
chains in the Genus database with same CATH superfamily
4JV5K 4GKJK 4BG8A 1XUPO 5GIPA 4FZXC 1KVAA 1BU6O 2HHUA 4FPBA 3KK3A 3FE1A 3LP1A 3T1HK 4BRIA 1P8ZA 5AQHA 4BVPA 3HM9A 1JXBA 2B4JA 3V9UA 3A5NC 1BUPA 4RCHA 1LCUA 2NZTA 3NBPA 4B8CA 4X65K 3NCIA 3RMAA 4BR9A 1LW2A 1WUAA 4DSJA 2EX3A 2E8AA 3LDSA 2P9LB 3BUZB 3SMSA 4W5NA 4OPJA 4A57A 4LD0A 3U8XA 5D3GA 1QQNA 3CERA 4CZKA 4CEEA 1VSEA 4CF8A 3KKSA 1ZBSA 3PIPL 1OH6A 2P1JA 5JLFA 4ISGA 2OTLN 4GVEA 2DY4A 1EKEA 4FW2A 2ZD1A 3ZSRA 3AGRA 1K73O 4A62A 4O8UA 1TK8A 3QINA 4FZYA 1RCHA 2YCHA 3TI0A 4JKGB 1D5AA 3D7EO 1WBBA 3RVCA 3THYA 1YJWN 4B3OA 3KLIA 5CZ1A 5JLHA 4M3ZA 2F8TA 4AQYK 1XC9A 1BI4B 3HJFA 4HUFA 5AQXA 3NGIA 3EY1A 3MN7A 3AO5A 3JYTA 4DV6K 3EEQA 4FLWA 3CFPA 4ISEA 3VESA 1VQLN 1ATNA 3O4WA 3FZHA 1VSMA 2W41A 3FR0A 1J5OA 1IV0A 3KTQA 2XO7A 4CEOA 2OPQA 4CFBA 2FBXA 3L4QA 3FZFA 1XWLA 1NGHA 2ETJA 1U45A 1JL2A 1WSEA 4A5AA 4DTMA 3MCAB 4BWJA 3ZEUB 3HTVA 2W40A 5M1PA 3CJBA 4Z4EA 3SPZA 1HNVA 3S9HA 2YX6A 4DF8A 3MEGA 1QE1A 3HO1A 4CJWA 1CXQA 4G1QA 3D2EB 4IEIA 3S3NA 3M8QA 3R9PA 3GOIA 3AVBA 1W2BM 4YOUA 4Z4CA 4OPAA 4EIAA 1WOQA 3AAQA 1NMDA 4CHYA 2IS3A 1QVGM 4FOEA 1HPZA 2BANA 1LWCA 3QNOA 1GLCG 3I55N 1U2VB 4CJ3A 3CC7N 2P9SB 4KHWA 3DJCA 3K5LA 4K41A 3THXA 1VSKA 2G8WA 3O9TA 3HPHA 5GAHP 1ATSA 5TKWA 1RT5A 1EQYA 3ZX2A 4AILC 3I0RA 4IG0A 2NRHA 1X9WA 1EO1A 2Q2RA 3LWLA 2A5XA 4JI2K 5CR4A 1HJRA 3OYIA 3MXMA 3O9QA 4B9UA 2YNIA 2KQ2A 1J5EK 2HBKA 4FJKA 1X1PA 4JKBA 2WTUA 3K5MA 3N4QA 4YFUA 3J81O 2GTDA 2HHTA 3F5TA 4GVMA 1BWFO 4DTJA 2UXCK 3LWMA 4DSFA 3L3UA 4H4MA 5AQFA 3H1QA 1C0UA 1MU2A 2P9KB 4W5QA 3Q7BA 1T44A 3CMAN 5AZJA 4IXCA 4DFKA 2FSJA 2X78A 3VMFB 4DV3K 1J6ZA 2E1ZA 3AVIA 1IBLK 3I56N 4HTUA 1BA1A 3NH2A 3LZJA 4N76A 1RT2A 4B9SA 1RTDA 3ZSWA 1OKJA 3GDQA 4U7BA 3QEPA 3AA4A 3H6EA 4NYNA 1C0MA 4YDUA 4DQRA 4DU4A 4FVMA 3THYB 4HTLA 5T7BA 2UUAK 4BGBA 1S6QA 3P1GA 1CXUA 5AQPA 3P5JA 4YHHK 3AVGA 1VSFA 4OO1J 4IOCL 3EE8A 2VG6A 2E6MA 2OPSA 4BDPA 2OZMA 3C6TA 3OYGA 3OJSA 2OYQA 5CHIA 1E4FT 3EKSA 3TAQA 1Q9YA 5BPMA 1NLVA 2CGLA 2E88A 5ADXH 4DMNA 1RTJA 1S5JA 1VSIA 4YOXA 3V1QA 3SQ4A 3QNNA 3V4IA 3G71N 2ZJRL 3LAMA 4KI4A 4H8KA 5C42A 4BR7A 3SAFA 3WXMB 3WXIA 2HNYA 3AO1A 4FLXA 1KRPA 2D4WA 4B9VA 5E41A 5JS1A 1TV6A 2F9TA 3EE9A 1GOAA 4CEZA 1K8KA 1KQSM 2YHXA 5HRNA 1H1VA 1GLLO 4WYBA 5AR0A 4L8RB 1IBMK 2HMPA 2YHWA 4KFBA 2A1SA 3L2UA 4JK9A 1NGFA 4KHYA 3TAMA 4PY5A 3V9XA 1VSJA 3E9OA 3TR8A 4Y1DA 3THXB 3WNFA 4RW7A 1NGIA 3ULDA 3TABA 2YJEA 3ZT0A 3O9RA 3SLCA 2UYTA 4DSKA 4DQSA 3L4IA 4N5SA 2O8CA 3AVAA 3WQUA 2B5JA 4B9MA 5BPLA 1DT9A 4JI7K 2KW4A 4B9NA 1S1WA 3LDLA 1NOYA 3GG4A 1W7AA 4ILJA 4C8MA 2AA4A 4DCHA 3L8BA 1LW0A 2GELA 5EX5A 5FRNA 2PYJA 1ASUA 1S1TA 1YAGA 5AQRA 3KKRA 5JMVA 4KHNA 3S3MA 3THVA 3CCQN 1A5WA 2ZE2A 4CZGA 4OKKA 4OGCA 1NG9A 3PUFA 4QS8A 4DFJA 4HUGA 2EHGA 3I0SA 3VEVA 3L2QA 4JS5A 2VGNA 3QIOA 4UY8O 4FJNA 4C8OA 5AZJB 4K8ZA 2HBMA 5BN8A 2Q0RA 3NF6A 1QHTA 1WSGA 4CJRA 3LZIA 4GKKK 4WQ4C 1KAZA 4AM7A 1LAWA 5M1KA 5LL6Z 5HRRA 3EYZA 2G8FA 1ILYA 4IOAL 5AQQA 5B8HA 3OA9A 4JD2A 2D0PA 3C95A 2KLAA 3OYNA 3U3YA 4BC5A 1BDGA 2V7YA 4DR7K 3L2WA 1QSYA 4LC9B 3ZSYA 3VA3A 3PO4A 1ATRA 4FK4A 3P83D 3DLGA 1JXEA 3IS9A 4IFEA 4F9OA 2ZM6K 3SUQA 2ZGZA 5LJWA 4FM2A 3E01A 4F2RA 1VAZA 4DR5K 3ID8A 1YJNN 3M8RA 2E2NA 4JI4K 1N5YA 5KQDA 1SL0A 3DWLA 4W5RA 4GMJB 3QBWA 3PX6A 1ZBUA 1GLJO 4CF0A 3AVMA 4B3MK 2GWJA 4Q0BA 2KHOA 1YTUA 1BCOA 1N34K 3DLLL 4JN4A 3HZ6A 2E6LA 4DU3A 1C0FA 5BREA 2HHWA 3C6HA 4NB4A 1K8KB 4CGDA 2D0AA 3QEXA 5LMNK 1Q7YO 2F4VK 4IDHA 4KV8A 1FK9A 1RDWX 3O4QA 5SZTA 3RWUA 3VQCA 1REVA 1ESVA 5AQYA 1BOTO 1N8RO 4WQ5A 3LM9A 2CGJA 3CFOA 3RMCA 4BRLA 1L3TA 3CCVN 4M63C 1Z05A 2NUBA 4CGGA 3SBGA 2DFHA 2RPIA 4BRDA 3PIOL 4CERA 2KFNA 3RSEA 1SUQA 2VCPA 2ZGYA 4MDBA 4DR1K 1IKVA 3U6FA 5MLCQ 3DOLA 4PKIA 2O8CB 1R0AA 2IOCA 4B1YB 5AQLA 4E7LA 3F2KA 4CK2A 3CXCM 3H3OB 5J2NA 4HUEA 4FJ9A 3ATUA 1YJ9N 4H5NA 3NMUA 4RW6A 4JAXA 1GLFO 1G99A 1WSHA 2W6LA 5JICA 1JL1A 2X6NA 4B9QA 3V9SA 4O4GA 2F8SA 5EU7A 1QHAA 2A41A 2NRVA 4CK1A 3G4SN 1RT3A 3EL2A 4A59A 3VQ4A 1BI4A 3K9JA 3C6UA 3QLHA 4PL8A 1QSSA 1HYVA 2KZMA 2IDOA 5F1XA 1JCEA 3ENBA 1QQMA 2RHKA 1GLEG 1B9DA 1S6PA 3UKUA 3HI0A 4FWNA 4GV6A 3DRPA 3HRGA 2Y1IA 4E0DA 1Y64A 1JLFA 1GOCA 3ZSVA 3VGKA 4B3SK 1O1WA 4QS7A 4KPYA 1S72N 2A1RA 1NMNA 2P9UB 2YI1A 2JLEA 2Z1HA 1VQ7N 2XHBA 2HNZA 1XNQK 1S1VA 1YUWA 3V6DA 3I33A 3VQ8A 4DS4A 3BF1A 2O8FA 2YKMA 1FJGK 3TAGA 3DRSA 4Z4GA 4GV9A 5AFUA 4JD2B 3K2PA 1KVCA 3A5MC 5DM7L 4CZJA 1S9EA 3SPYA 2Q31A 1KTQA 1CLQA 1UOCA 4H4OA 3VQ9A 4PQUA 3JSMA 4YNQA 3UB5A 2G8VA 1A5VA 3MCPA 3HSCA 3ASMA 3WXKA 3EZ5A 4B3RK 4KH5A 1GOBA 3ENOA 4JKCA 4C8KA 1D9FA 4BDZA 3MEDA 4BROA 3TAPA 4CHOA 3R6MA 3HT3A 3V9ZA 2OA8A 1VQKN 3VN5A 3VQ5A 1P90A 2GV9A 1QVFM 1F21A 1BL3A 5KQ8A 5HLFA 1C1AA 3SK3A 5KI6A 2ASMA 4J2AA 4FJ8A 3U9DA 4CHQA 4LF9K 3JAMO 1S9GA 5KPRA 5IWAK 3OYAA 4UQGA 3VQAA 1SS6A 2HNDA 3CC2N 1S22A 1JLEA 4LY7A 4CJLA 1Q82O 4O44A 3NFAA 5BRFA 1HKCA 4EHUA 3IUCA 2F9WA 4FJ5A 3CYMA 3HSTB 2O4IA 4KTZA 3NH0A 4XH1A 5FPEA 3QB0A 3RSEB 2VQFK 4JI1K 2P9KA 2X6SA 3DM2A 1J53A 4G9ZA 4BR5A 4ILHA 4H5RA 3T1YK 2Z1JA 3QMLA 1BA0A 4BRPA 1HPMA 2UXBK 4DFPA 1NGGA 1JLGA 2VWBA 1VSHA 4CEAA 1KAYA 4CIEA 1JLQA 4B1VA 5LJVA 3O9UA 4F2SA 1ZBHA 4RG8A 3CETA 4L3QA 5KPTA 1ZBFA 4JKEA 1HR0K 1LAVA 4IEEA 4KHSA 4LF6K 2NLXA 3M5RA 4YOYA 3O80A 3AARA 4BRKA 2HHVA 5AQOA 3H3NO 1MDUB 4CJ7A 1NJWA 1FXXA 4NCGA 3ZCMA 3SAHA 1JCGA 3UKUB 2PFUA 4FM1A 4OX9K 2Z1GA 5BR9A 3HP9A 1JLAA 1KFSA 3R1XA 4CZIA 4ZTFA 3SUOA 3AVNA 2PYLA 3CCMN 5C24A 3NVKA 2DFEA 2G8HA 4IKFA 3BF3A 5AQGA 2DPNA 4DF4A 3AVHA 1IKXA 3A2FA 3SUPA 1QTMA 5AZIA 2O8FB 2QEXN 4J2BA 1C1BA 3LPTA 4Y0WA 2YHBA 3ZT1A 2LSNA 3E9LA 4O0JA 4FYDA 1XQSC 3MN5A 1RDBA 4JEPA 2YKNA 5BN9A 4CE9A 5FPMA 1TYQA 5KGWA 3RTVA 4K43A 1WNSA 5TKYA 3HM8A 1RT6A 2QI2A 4CECA 2ZJQL 5I3UA 4M3WA 3ZETA 4CZEA 3O3HA 4DV1K 3QO9A 4O55A 4X64K 1Q81O 3P38A 1WB9A 4FL9A 3A8YA 3H08A 2E5LK 4CCHA 1TK0A 3DLEA 3IDHA 3MWPA 3P31A 4DQPA 1FKOA 3D0PA 1I39A 2HHSA 3SMPA 4CVNE 5AQWA 4FO0A 3E66A 3TWHA 3L2RA 1CZBA 4NXMK 3AA3A 3KVGA 4AHTA 4BR0A 1Q18A 4BC4A 1KSPA 2ASOA 2FC0A 4EFHA 4K42A 4I2PA 3FZMA 1SKSA 2HMIA 3KK2A 1ITGA 4YDUC 4DTUA 3C0BA 3VQEA 3UIQA 3AV9A 3NF8A 2HB5A 1HNIA 1SL1A 1VHXA 4NXNK 3KJVA 1HYZA 1WSIA 5HROA 3J7AP 4H0XB 4JI8K 4FWMA 4CI6A 2QWMA 3KLEA 3QEWA 5FPDA 1NKEA 5FPNA 3CJ1A 3IG1A 4JLHA 3OJUA 3MN9A 4CF2A 3OHRA 1RDAA 5AQNA 4DHYA 5AQSA 1YITN 1HYSA 3SI6A 3WQTA 1N36K 3FGUA 1RBSA 3M8PA 5M1NA 3AA5X 2ZF5O 5BPNA 5EOYA 4OJRA 3VEWA 3QBXA 1QS4A 4AHUA 3LAKA 2YNFA 4OKJA 4E7HA 1X9SA 5AQMA 1NNEA 3VGMA 3LDOA 4DV4K 1RT7A 5AQUA 1HNXK 3OYJA 3M8SA 4OPKA 4J8FA 1VQNN 4I9LA 3N4PA 4CHPA 3OYMA 3ZLJA 4WFNL 4CJ5A 3VEXA 3L3VA 4YOWA 2FBVA 4QCLA 4BQLA 4KI6A 3PO5A 3OYKA 4BQZA 5CE3A 1RT1A 3B6OA 3SZ2A 2WUSA 1NJZA 2VG7A 3JXUA 5H1SQ 2JGUA 3FFIA 2O8BA 4M3XA 5EXWA 1TAQA 3LL3A 2QWNA 2D1KA 5AZIB 4DQQA 2X74A 2HBLA 4PUOA 4R79A 2ASPA 4CF1A 2F7TA 2XY5A 4XH5A 4HWIA 1U47A 1C6VA 4CIGA 3OY9A 5AQJA 3KIOA 4I6MA 1TYQB 3TARA 4NYFA 4FJGA 1QSLA 4RTFD 4J2DA 3ID6A 4V19S 1S1XA 2JWLA 4DU1A 5AJ3K 3J7YP 1I94K 3ZETB 3V81A 3D2FA 4ILGB 2YJFA 2NRXA 2XY7A 2FSNA 3AO4A 4BRGA 2OCEA 4O5BA 4IG3A 3BDPA 3H45C 3HXMA 4CBWA 2BGGA 1NOZA 1YTAA 1IJJA 4FM0A 3VGLA 1V4SA 4AHVA 1KC8O 2A3ZA 4H0TB 1L3SA 1NJIO 2AJQA 3HPGA 1FKPA 4DKWA 3K5OA 3R3LA 2RN2A 3VEYA 2ZQBA 5M1QA 3DOKA 2E2PA 4M7XA 4I2QA 3VF2A 3V9WA 1JJ2M 4ID1A 3T1AA 2HHQA 3ZT4A 4KHUA 4CGFA 2B6AA 1XHXA 3TAEA 5M1FA 4ISFA 4DWIA 4CBXA 3LP3A 4FSVA 2AP1A 1C0GA 3OYCA 1VRTA 2IVNA 5AQZA 2NRWA 3D6RA 3SNNA 3K59A 2BUPA 4ELTA 1KCFA 4BACA 4JK7A 5FROA 4FJIA 4E89A 2YV0X 3OYEA 3CJAA 4BRAA 3T7ZA 1K9MO 3HVRA 4IWVA 1YT3A 2QXLA 3RR7A 1TKZA 5C25A 3ZT2A 1FW6A 3EKUA 4BR4A 2VQEK 2P9UA 4CK3A 4QOZB 1NGJA 4DLEA 2P9NA 4KBOA 3ZSQA 3V1OA 1CZAN 5AQIA 3AVCA 1TL3A 4H03B 4LF7K 1NGAA 1VRUA 2QKBA 4FJXA 3DXMA 1OVQA 1VQ8N 4JYAK 1WBDA 4FLUA 4OLAA 4FW1A 3DLHA 4I7FA 1DEJA 4RW9A 1IKWA 3CPWM 1XI1A 4QS9A 1ZBIA 3CF5L 3AO2A 1I3AA 4FJLA 3CQXA 3AVLA 4H5VA 5K14A 1ZC6A 4GW6A 4WQ5C 5HL7L 3WEEA 3SYZA 1IKYA 1QQOA 4EHTA 1XMQK 4PA1A 1BHLA 5A2QO 1T6CA 4ZHRA 2O8BB 3VETA 2R7YA 1EX4A 1ASWA 4RW4A 3WNHA 4E7JA 3RRGA 1ZBLA 4JS4A 4BGAA 4AHCA 1B92A 4YY3K 1LWEA 4CFCA 5C0YA 3Q7CA 4B8AB 4MDAA 2XRIA 3EN9A 4Z4IA 4IZ9A 1JKHA 4KHPK 1SL2A 4Y1CA 4IO8A 2QWQA 1TAUA 4I6MB 3F9MA 2G8UA 3CJ7A 4IOXA 4CBUA 2QWOA 1RILA 3CCEN 3C6AA 4KH6A 1HQEA 3OYDA 3DRRA 3F73A 4BE2A 2OANA 3VENA 3SV3A 3D2FB 1VQ5N 5EVZA 3QDKA 4NLBA 4AHRA 3A0IX 4K0KK 4JNEA 3CCLN 1TKTA 1NK8A 4B9LA 4KTWA 1D8YA 1XHZA 2E1YA 4W5TA 4WFAL 4GY2B 2XY8A 1XNRK 5E26A 2O4GA 3BGRA 5E84A 4MFBA 3ITHA 1D9DA 2IVOA 2Q36A 4FWOA 2YNHA 2FF3B 3ISNC 3VQQA 4JI6K 1HJOA 4BG9A 3WT0A 2BTFA 3J7ZO 3DI6A 2G8KA 4LF8K 4CEQA 4YORA 2PZSA 4DQ8A 1RFQA 5GINA 5JVHL 2RF2A 5DK5A 3TAFA 4DTRA 3NF7A 3OBWA 4AH9A 3FZKA 3S41A 2EWSA 2IAJA 4DSLA 4DV7K 4XEIA 3U3GA 4KKOA 4IDKA 3WNGA 2QA4N 4CJ4A 1E4GT 2YNGA 2Z1IA 3AVKA 1YVUA 2A6AA 3VA0A 2OPPA 3VTHA 4JI0K 3B8AX 2KTQA 4DTOA 5CZ2A 1GLAG 2DTUA 1SZ2A 5AFUH 2E4LA 2GUPA 1Z25A 3QEVA 1W0HA 1JCFA 2P9NB 3L2VA 5BRDA 3QETA 4HVJA 4FWKA 1MWMA 1YVNA 4KREA 2I5JA 3DXMB 1BIUA 2HHHK 3OTOK 5C12A 1NKCA 4Q5VA 3ULEA 3DYAA 1JLCA 5KRTA 3CFRA 2QW9A 4CEBA 4LF5K 1K8AO 2E2QA 2WFBA 3VPZA 1KFDA 5CYQA 4CFAA 2O8DA 3FFKB 4LF4K 1RNHA 3SV4A 3OS0A 4FWRA 1U48A 1NK0A 2NRRA 4E7IA 3BEXA 3WEEB 4EZ6A 3MDQA 2KFZA 4DS5A 1TUUA 1VQMN 4NCBA 1NKBA 3SCXA 3W3DA 2WOMA 2V52B 1BISA 2D0CA 3MECA 3TTDA 5DMRA 1HX1A 2QKKA 2PAVA 1WAFA 3C65A 5CY4A 1NK6A 1IO2A 1RTIA 3CQ8A 3HYFA 3NHGA 3DLBA 2FXUA 4FZZA 1VQ9N 2Q0UA 5GIOA 1MA9B 3UKRA 2HOEA 4JI3K 4JRQA 1KLMA 1TKXA 4NCAA 4MLEA 2FSKA 3TPQA 3QFPA 4N56A 3GL1A 5EY4A 1NJYA 1HKGA 3GE1A 2BE2A 3UE5A 3LDPA 4M3RA 3MXIA 4FK2A 2P9PA 4PKHA 3IFRA 5JS2A 5GADP 4CD1A 2HF4A 1TUYA 3RMDA 3WNEA 4FPAA 5SWMA 3QICA 4CGIA 3SQ2A 3NGYA 2P9IA 1NJXA 1KXPA 4H5WA 3VEOA 4JKFA 1TK5A 2WBNA 4JKAA 4DR2K 1A5XA 3ZX0A 5F2RA 1Q8IA 4LSNA 4GV3A 4LFAK 4FCYA 3ZSXA 1M1KO 3O1WA 2V7ZA 3ENHA 1T7PA 4C23A 3ZT3A 3KK1A 2QWPA 4BC2A 1KAXA 3KLHA 5BRHA 1M90O 2HSTA 1NGBA 1Z6RA 2GWKA 1YI2N 3MN6A 5J2MA 1U6ZA 2D0OA 2W6KA 3VF6A 4BC3A 5FRMA 4MLHA 2E20A 3K0SA 4JKDA 3AGKA 4FWPA 4TSXA 4DFMA 3O08A 5ELZA 3VQDA 4CJKA 1RDDA 3HL8A 4CZMA 2HF3A 5HRPA 4O0IA 3SJJA 2QM1A 5J1EA 1T03A 2QXFA 1T3VA 4CJTA 1X3NA 4KH4A 1Y97A 4LH4A 1IG9A 1DTQA 1DLOA 3GBTA 4ID5A 3FLCO 4BE0A 4OVLA 5KGXA 3HOSA 2GBZA 4CHNA 1LV5A 1NK5A 4JKHA 4CJEA 1O13A 1RBTA 1EWQA 4FWQA 3ULEB 1SKRA 3HPOA 1X9JA 2ITGA 3LPUA 5IT9O 3A5LC 3NF9A 4KHQA 4Z94A 2I7NA 1BG3A 2PY5A 1R59O 4C1NI 4CJQA 2O8DB 4LFCK 3ALYA 1HNWK 2IIRA 5C10A 4E1NA 5FLXO 3LALA 3IAYA 4IFYA 1KVBA 4A61A 4FK0A 3CPEA 4BY9C 1BIZA 1XC3A 2I7PA 3QFUA 4H0OA 4R5PA 2ZWHA 1DKGD 4DV0K 4IFVA 3QERA 2RE2A 3D45A 3VQPA 4LSLA 3CC4N 3G10A 1OH5A 1VSLA 1EXQA 5HOOA 2G8IA 1D4XA 4FLTA 4I9QA 2P51A 3HBTA 3BY5A 4CIFA 1TKDA 3VEZA 4CZFA 3PSFA 3O5BA 4FJJA 3UKRB 4M7YA 4N41A 3KK7A 3VTIA 3HVTA 1RDCA 3PY8A 2P5GA 3CCRN 2BDPA 2GUIA 1TVRA 3LP2A 4DUYK 2QWRA 2WC9A 1WLJA 2NNWA 3T19A 3ATVA 4KO0A 3TANA 4PHTX 4A5BA 3KZBA 3H46O 2P9PB 3PX4A 5GAGP 1IG8A 4A2BA 5HP1A 3KHYA 2VG5A 4F4KA 1VQ6N 2O8EA 3CI5A 1WN7A 1IH7A 3KWIA 4DUZK 2P9IB 2ITMA 3ZX3A 5BR8K 3G25A 3O3FA 4FLVA 4B1ZA 4EZ9A 3CHWA 3E9PA 3ZYYX 1X9MA 3O1BA 1UA1A 4E19A 1NGDA 4PKGA 1GLBG 4CF9A 3PV8A 4Z4FA 3U4LA 3ZSZA 4XH4A 3CCSN 1VSDA 3AO3A 1HNZK 2QWLA 3LP0A 3OYHA 3HK2A 3PSIA 4CFDA 3PLAA 3K57A 2DFFA 1DGKN 4MQ3A 3IRXA 3OYFA 1L3UA 4RW8A 1WAJA 4RWTA 1ASVA 4DB3A 4EP4A 3A5OC 2BH1A 3QIPA 1ZYQA 5C15A 4JI5K 3L6QA 4CZHA 1BCMA 2OZSA 3B6PA 3FZLA 1W97L 4AHSA 3RR8A 2F96A 1S3XA 1HKBA 1RBVA 5I42A 1MWKA 3TTCA 3CD6N 1SV5A 4CD3A 1VQ4N 4B3TK 4KB1A 4BE1A 3T3FA 1NK9A 4B1UB 3O4NA 3K5NA 3IKMA 1YF5L 2CH5A 5GAEP 4X66K 4B08A 2UUCK 1U04A 1E3MA 3L0QA 4FWSA 5AQVA 4PL7A 1VQPN 1KLNA 4F3OA 4B9TA 3NVMA 2V51B 3G0ZA 5ADXA 4BWMA 2QK9A 4BRFA 3C94A 3TSPA 3MX2A 1EP4A 1W9HA 3SUNA 1K6YA 2VWKA 4BR2A 2IVPA 4O5FA 4B1XB 4M3UA 2XY6A 1L5UA 1RGIA 3O6WA 3VF4A 3AY9A 4C1NK 1L3VA 2CGKA 2VYPA 3LM2A 1BO5O 2W42A 3CCUN 4WFBL 4JRPA 4H5TA 3O3GA 4BVOA 4NLCA 1LOTB 3IMXA 5M1OA 2Q97A 1U49A 3CG7A 4BRNA 1OH8A 4CEDA 4AF1A 5I9EB 3OW2M 3SAGA 2JWKA 4KRFA 4DSIA 1YIJN 3MX5A 4KTQA 3OBYA 2P5OA 3AVJA 4CJUA 4U67L 3H1VX 4M45A 1CZ9A 4F8RA 3LDNA 1KD1O 2KKZA 1RDUA 4FLYA 3AVFA 4M3TA 4ELUA 2HVHA 1YHQN 4PWDA 5KPZA 2O8EB 4FLZA 4DTPA 1OH7A 1N32K 1C1CA 3U9ZA 3HP6A 2KZZA 1VQON 3DXKA 4ZTJA 4JK8A 1SKWA 1UAXA 3THWA 2PBDA 3WXLA 3C7NA 4DTSA 2Q3SA 2A40A 4CZLA 3AA2A 3NAEA 2GX9A 4DR3K 1EWRA 4DTXA 1UA0A 4M42A 4M3YA 3OS2A 4EAHD 1IBKK 1EETA 3QESA 1YXQA 3DLKA 1GLDG 2HBJA 3ZSOA 4FWLA 3MEEA 4YOTA 4KAZA 4DSEA 1N6QA 3VQBA 4BREA 4CESA 3KD1E 1T6DA 4X62K 3CIPA 2OTJN 4A2AA 1Q9XA 3LDQA 3BP8A 1HLUA 3EZWA 2YHAA 3KD5E 1RT4A 3LANA 3SBTA 5JVGL 2Q1NA 4BRMA 1NK4A 3SQ1A 1QQCA 1V4TA 2CH6A 2VWJA 1B9FA 4CGHA 4CHZA 4O8KA 4WQ4A 3K58A 2IGIA 1T8EA 4BRQA 4DR4K 2FLOA 4OGEA 3VQ7A 1UWBA 3E1YA 4XIUA 3MAQA 4FJHA 4HCBA 1N33K 4FVUA 5FDLA 3TSQA 4H0YB 2UU9K 3AAPA 4JHDA 3OYLA 5CYMA 3CJ9A 3G6EN 4N47A 2FBYA 3V1RA 3JS6A 3BZKA 4BRHA 3O8MA 1QZ6A 2HVIA 1WSFA 2FBTA 4WE1A 2IC3A 5HRSA 1NGEA 4LH5A 3NDKA 3S3OA 2Y1JA 1RBRA 3MMVA 1J9AA 4H0VB 2E2OA 3VQ6A 1TL1A 1G15A 1J54A 3OVNA 3CQYA 3DMJA 3R8EA 3W0LA 3J80O 4DV2K 1RBUA 2GEMA 3T69A 3TSUA 2P9LA 4LFBK 2OPRA 1WSJA 1HUXA 3MK6A 4Z4HA 4FJ7A 4DR6K 4E1MA 4DQIA 3OS1A 3K9KA 4H0PA 5LY3A 4IBNA 2NRZA 2VGMA 1ZXOA 4EP5A 2ATQA 1Q86O 3I8BA 3KLGA 4C8LA 4WCEL 1NK7A 3KWGA 4OPHA 2UXDK 4JKGA 3TU5A 4E1JA 4BRCA 3SJHA 2A42A 3OYBA 1TGOA 4IJAA 4Z0UA 3F9KA 4B1WB 2WONA 2ZJPL 4E3SA 3P39A 1BGXT 1VK0A 2QTDA 3TTFA 3PX0A 5F0XA 4ELVA 1C0TA 3VERA 1NU0A 3DXKB 2D0BA 4OLBA 1SAZA 1JLBA 5HBMA 3NE6A 4IJNA 5C2DA 3HOTA 1NWKA 3THWB 4E7KA 4DLGA 1BQMA 3CM6A 3C7NB 5J2QA 3ZEUA 4GNIA 3MWTA 1OVYA 1S1UA 1HRHA 3WXJA 4OKEA 3CMEN 4CJVA 4DTNA 2FF6A 1U4BA 3EO3A 1Z26A 1BQNA 4CEFA 3NGZA 1RTHA 4FOIA 3BZCA 4J2EA 4FJMA 2HW3A 2HHXA 4QAGA 4CGJA 3O9SA 5LMUK 3D2EA 4HCCA 4DG1A 1XMOK 1QZ5A 5KRSA 4F3TA 4CJSA 5AQKA 5DM6L 3KLFA 5J2PA 4NO7A 3RMBA 4HHTA 2UUBK 4AM6A 3M3ZA 4M41A 3DAWA 3WUHA 4CW7B 4DV5K 4KB0A 4MO4A 1NGCA 5AQTA 4IO9L 3SQ0A 1U2VA 1HMVA 5C2FA 2P9SA 3RRHA 3QEIA 1X3MA 3CM5A 1NBWA 1HQUA 3CCJN 3CJCA 3NH1A 2D5RA 3M1FA 3P4IA 4C8NA 3J8AA 4K25A 3DLRA 2RKIA 3I8DA 1NM1A 2J4RA 4W5OA 4MO5A 4YOVA 1LWFA 4WF9L 1T05A 1DTTA 2H3GX 1SQKA 2NRTA 5KTQA 3MXJA 3M6GA 4FXDA 2YHYA 4CJFA 4JHDB 3VOVA 4BDYA 4CJPA 4ICLA 4K8XA
chains in the Genus database with same CATH topology
3CFOA 3RMCA 1L3TA 4AHVA 4CGGA 2NUBA 1L3SA 4FZXC 4FJJA 1KVAA 2G8IA 2HHUA 2DFHA 3KK3A 4N41A 2AJQA 2RPIA 3LP1A 3HPGA 1FKPA 3HVTA 1RDCA 4CERA 3HM9A 3K5OA 2KFNA 1JXBA 2RN2A 3PY8A 1SUQA 2P5GA 2B4JA 3V9UA 2BDPA 2ZQBA 2GUIA 3NBPA 1TVRA 3LP2A 4B8CA 3NCIA 3RMAA 1IKVA 3DOKA 3U6FA 3V9WA 1LW2A 4I2QA 3DOLA 4ID1A 2IOCA 1WLJA 2EX3A 3T1AA 1R0AA 3T19A 4E7LA 3ZT4A 4KO0A 3TANA 4KHUA 4CK2A 4CGFA 2B6AA 1XHXA 4HUEA 5J2NA 3TAEA 4FJ9A 4DWIA 3LDSA 3LP3A 4RW6A 4W5NA 1WSHA 4OPJA 3PX4A 3OYCA 1VRTA 5HP1A 4LD0A 1JL1A 2X6NA 2VG5A 5D3GA 4F4KA 3SNNA 1WN7A 3K59A 3V9SA 4CEEA 1VSEA 4O4GA 5EU7A 4CF8A 4ELTA 2F8SA 4CK1A 3KKSA 1IH7A 1KCFA 4BACA 1RT3A 5FROA 4FJIA 4E89A 2YV0X 3VQ4A 2P1JA 3O3FA 1BI4A 4FLVA 3OYEA 3C6UA 3QLHA 1QSSA 4EZ9A 2DY4A 1EKEA 4FW2A 1HYVA 2ZD1A 3ZSRA 3HVRA 1YT3A 1X9MA 1UA1A 4E19A 2IDOA 1TK8A 2KZMA 4CF9A 3PV8A 4Z4FA 3QINA 3RR7A 4FZYA 1TKZA 5C25A 1RCHA 1B9DA 3TI0A 1S6PA 3ZSZA 3ZT2A 1VSDA 3AO3A 1D5AA 3LP0A 4B3OA 4CK3A 3KLIA 3OYHA 3HK2A 3DRPA 5CZ1A 4QOZB 2Y1IA 4DLEA 4CFDA 4E0DA 3ZSQA 1XC9A 4M3ZA 1BI4B 3V1OA 1JLFA 1GOCA 3K57A 4HUFA 3HJFA 3AVCA 1TL3A 3ZSVA 3EY1A 3AO5A 3JYTA 1VRUA 2DFFA 4MQ3A 3NGIA 4FLWA 3IRXA 3OYFA 3CFPA 1O1WA 4RW8A 1L3UA 4FJXA 4KPYA 1WAJA 1VSMA 1ASVA 1J5OA 4FLUA 3KTQA 2XO7A 2A1RA 4OLAA 4CEOA 4FW1A 2OPQA 4CFBA 4EP4A 3DLHA 4I7FA 2FBXA 1IKWA 3QIPA 4RW9A 1ZYQA 2JLEA 1XI1A 1XWLA 1ZBIA 2Z1HA 2ETJA 2XHBA 2HNZA 1U45A 1S1VA 3AO2A 3V6DA 1I3AA 1BCMA 3VQ8A 1JL2A 4DS4A 2OZSA 4FJLA 1WSEA 2YKMA 4DTMA 3TAGA 3AVLA 5K14A 3B6PA 4BWJA 3DRSA 4AHSA 4Z4GA 4GW6A 4Z4EA 3SPZA 1HNVA 3RR8A 2QKBA 3K2PA 3S9HA 2F96A 1KVCA 4DF8A 3MEGA 1QE1A 1RBVA 5I42A 2F8TA 3HO1A 4CJWA 1SV5A 1LV5A 1CXQA 3SYZA 1IKYA 4G1QA 1S9EA 3SPYA 3S3NA 3M8QA 4BE1A 1KTQA 3T3FA 3AVBA 1NK9A 4KB1A 1CLQA 1UOCA 3O4NA 4Z4CA 3K5NA 4H4OA 3VQ9A 4PA1A 3JSMA 1BHLA 4PQUA 4YNQA 4ZHRA 4CHYA 2R7YA 1A5VA 2G8VA 1EX4A 1ASWA 2IS3A 4RW4A 3WNHA 1U04A 3ASMA 4B08A 4E7JA 3RRGA 1ZBLA 4F3OA 1HPZA 3EZ5A 4JS4A 1KLNA 4B9TA 1GOBA 4AHCA 1B92A 3G0ZA 1LWEA 4CFCA 4B8AB 4C8KA 2BANA 1LWCA 2XRIA 4BWMA 3QNOA 4BDZA 1D9FA 3MEDA 4Z4IA 2QK9A 1JKHA 3C94A 4CJ3A 3TAPA 1EP4A 4Y1CA 1W9HA 3SUNA 1K6YA 2VWKA 4CHOA 1SL2A 4KHWA 3K5LA 3HT3A 1TAUA 3V9ZA 2OA8A 3VN5A 3VQ5A 2G8UA 1VSKA 2GV9A 1F21A 2HW3A 4M3UA 1BL3A 2XY6A 2G8WA 1L5UA 1RILA 3HPHA 5HLFA 2HHQA 1HQEA 3OYDA 1C1AA 5KI6A 3DRRA 3F73A 4J2AA 4FJ8A 4BE2A 1L3VA 4CHQA 3SV3A 2W42A 4JRPA 1RT5A 1S9GA 4AHRA 3OYAA 4UQGA 3VQAA 1TKTA 2HNDA 3O3GA 4AILC 1NK8A 4B9LA 1JLEA 3I0RA 4KTWA 4IG0A 4LY7A 4CJLA 1D8YA 4O44A 1XHZA 4DSJA 3NFAA 1X9WA 4W5TA 3LWLA 1U49A 3CG7A 4CEDA 1HJRA 4FJ5A 3CYMA 3HSTB 3OYIA 3MXMA 2XY8A 2O4IA 4B9UA 2O4GA 4KTZA 3BGRA 4MFBA 3ITHA 3NH0A 1D9DA 4KRFA 2YNIA 2KQ2A 4DSIA 2YNHA 3ISNC 3VQQA 1X1PA 4FJKA 2X6SA 4KTQA 3DM2A 1J53A 3K5MA 2Z1JA 4YFUA 2HHTA 2P5OA 4GVMA 3DI6A 2G8KA 3AVJA 4CEQA 4CJUA 2PZSA 4DTJA 2RF2A 4DFPA 5DK5A 3TAFA 1JLGA 4DTRA 4M45A 3NF7A 1CZ9A 3LWMA 4AH9A 4F8RA 4DSFA 3L3UA 4H4MA 1VSHA 4FLYA 4CEAA 1C0UA 3AVFA 1MU2A 4CIEA 1JLQA 1ZBHA 2IAJA 4M3TA 4DSLA 4F2SA 4RG8A 3U3GA 4W5QA 4ELUA 1ZBFA 4PWDA 4KKOA 2HVHA 4IDKA 3WNGA 1LAVA 4CJ4A 4KHSA 4FLZA 4DFKA 2YNGA 2Z1IA 2X78A 4DTPA 3AVKA 1YVUA 1C1CA 3AVIA 3VA0A 2OPPA 3HP6A 4HTUA 3NH2A 2KZZA 3LZJA 4N76A 2HHVA 1RT2A 4ZTJA 4B9SA 1RTDA 3ZSWA 2KTQA 4DTOA 5CZ2A 1SKWA 1UAXA 2DTUA 1NJWA 1FXXA 4NCGA 3QEPA 3ZCMA 3AA4A 4NYNA 2E4LA 2Q3SA 4DTSA 1C0MA 4DQRA 4DU4A 3AA2A 4FM1A 1Z25A 4FVMA 3QEVA 2Z1GA 5T7BA 3NAEA 1W0HA 3HP9A 1JLAA 1KFSA 3L2VA 1S6QA 4DTXA 3QETA 1UA0A 3P1GA 1CXUA 4M42A 4M3YA 4HVJA 3P5JA 3OS2A 1IG9A 4ZTFA 1EETA 3QESA 3SUOA 3AVGA 4KREA 2I5JA 3DLKA 1VSFA 1BIUA 3ZSOA 3AVNA 3MEEA 1NKCA 4Q5VA 4KAZA 4DSEA 2PYLA 2VG6A 1N6QA 5C24A 2E6MA 2OPSA 1JLCA 3DYAA 3VQBA 4BDPA 4CESA 2OZMA 3C6TA 3OYGA 2DFEA 3OJSA 2OYQA 5KRTA 3KD1E 2G8HA 3TAQA 1Q9YA 3CFRA 4IKFA 4DF4A 3AVHA 1IKXA 3A2FA 4CEBA 3SUPA 1Q9XA 1QTMA 4J2BA 4DMNA 1C1BA 1RTJA 3LPTA 1S5JA 1VSIA 1KFDA 5CYQA 3V1QA 4CFAA 2YHBA 2YHAA 3SQ4A 3ZT1A 1RT4A 2LSNA 1RNHA 3QNNA 3V4IA 3KD5E 3LANA 4O0JA 3LAMA 3SV4A 3OS0A 4FYDA 4KI4A 1RDBA 4H8KA 1U48A 2YKNA 5C42A 1NK0A 4E7IA 1NK4A 3SQ1A 1QQCA 4CE9A 2HNYA 3AO1A 4FLXA 1KRPA 4B9VA 4EZ6A 2VWJA 5E41A 5KGWA 3RTVA 5JS1A 1TV6A 1WNSA 1GOAA 4DS5A 1RT6A 4NCBA 4CEZA 2KFZA 1B9FA 4CECA 4CGHA 4CHZA 3SCXA 1NKBA 5I3UA 2WOMA 5HRNA 3K58A 2IGIA 1T8EA 4M3WA 4OGEA 3VQ7A 1UWBA 3MAQA 4XIUA 4FJHA 1BISA 4L8RB 2D0CA 3MECA 4HCBA 3O3HA 5DMRA 5FDLA 2QKKA 4KFBA 1NK6A 1WAFA 2A1SA 5CY4A 1IO2A 1RTIA 3CQ8A 3QO9A 3OYLA 3L2UA 3HYFA 4O55A 5CYMA 3NHGA 3DLBA 4N47A 4FZZA 3H08A 2FBYA 4KHYA 3TAMA 4CCHA 4PY5A 1TK0A 3V1RA 3V9XA 3DLEA 4DQPA 2HHSA 2HVIA 1FKOA 1WSFA 1I39A 3D0PA 1VSJA 2FBTA 4WE1A 2IC3A 3TR8A 5HRSA 4LH5A 3TWHA 4Y1DA 3L2RA 4JRQA 3WNFA 1CZBA 4RW7A 1KLMA 3AA3A 3NDKA 3ULDA 3TABA 1TKXA 3S3OA 4NCAA 2Y1JA 1RBRA 3ZT0A 1J9AA 4AHTA 4N56A 4DSKA 4DQSA 3VQ6A 2FC0A 4N5SA 1TL1A 1KSPA 1G15A 1J54A 3OVNA 3AVAA 4I2PA 1NJYA 1SKSA 3DMJA 2HMIA 3KK2A 2B5JA 1ITGA 2BE2A 4M3RA 4DTUA 4FK2A 3MXIA 1RBUA 4B9MA 3VQEA 2KW4A 4B9NA 3UIQA 5JS2A 1S1WA 3AV9A 3NF8A 1NOYA 2HB5A 1HNIA 2OPRA 1WSJA 4C8MA 1SL1A 4Z4HA 3RMDA 3WNEA 4FJ7A 3L8BA 4E1MA 4DQIA 1LW0A 3OS1A 5SWMA 3KJVA 4CGIA 3SQ2A 3NGYA 5FRNA 1HYZA 1WSIA 4IBNA 2PYJA 5HROA 1NJXA 4EP5A 2ATQA 1ASUA 1S1TA 3KLGA 3KLEA 3QEWA 1TK5A 4C8LA 3KKRA 1NK7A 1NKEA 4KHNA 3IG1A 4JLHA 3S3MA 3THVA 3OJUA 1A5XA 1A5WA 2ZE2A 4OKKA 4CF2A 4OGCA 1Q8IA 4LSNA 3PUFA 1RDAA 4FCYA 4DFJA 4HUGA 3ZSXA 2EHGA 3OYBA 3I0SA 1TGOA 4Z0UA 3L2QA 4JS5A 1HYSA 3F9KA 1T7PA 3QIOA 3ZT3A 3SI6A 3KK1A 1RBSA 3M8PA 4FJNA 3AA5X 2WONA 4C8OA 3KLHA 4E3SA 4K8ZA 4OJRA 1BGXT 1VK0A 3PX0A 1QS4A 4AHUA 3NF6A 3LAKA 5J2MA 4FXDA 1QHTA 1WSGA 4ELVA 1C0TA 2YNFA 4OKJA 4CJRA 3LZIA 4E7HA 1X9SA 5FRMA 1LAWA 2D0BA 1RT7A 4OLBA 1JLBA 5HBMA 3NE6A 5HRRA 4TSXA 3OYJA 3M8SA 3EYZA 4OPKA 4E7KA 4DFMA 4DLGA 3VQDA 4CJKA 2G8FA 1RDDA 4I9LA 1BQMA 3HL8A 3CM6A 5J2QA 4CHPA 5HRPA 4O0IA 3OYMA 1S1UA 1HRHA 3SJJA 4OKEA 5J1EA 2QXFA 4CJ5A 1T03A 4CJVA 4CJTA 4DTNA 3C95A 1U4BA 3OYNA 1Y97A 4LH4A 3U3YA 1DTQA 1BQNA 1Z26A 1DLOA 3L3VA 1RTHA 2FBVA 4ID5A 4CEFA 3NGZA 4J2EA 4BE0A 4FJMA 4OVLA 4KI6A 4QCLA 4QAGA 5KGXA 4CGJA 3PO5A 2HHXA 3L2WA 3OYKA 1QSYA 4HCCA 2GBZA 4DG1A 4CHNA 1RT1A 3ZSYA 3B6OA 3SZ2A 1NK5A 3VA3A 4CJEA 5KRSA 1RBTA 3PO4A 1NJZA 4F3TA 4CJSA 4FK4A 3P83D 3DLGA 1JXEA 3IS9A 2VG7A 3SUQA 1SKRA 2JGUA 3HPOA 4FM2A 3E01A 4F2RA 3KLFA 3FFIA 5J2PA 3M8RA 2ITGA 3RMBA 4M3XA 3LPUA 1TAQA 4HHTA 1N5YA 3NF9A 1SL0A 4M41A 4W5RA 4GMJB 4KHQA 4KB0A 4DQQA 2X74A 3PX6A 4PUOA 2PY5A 1ZBUA 3SQ0A 4CJQA 4CF0A 3AVMA 4CF1A 4Q0BA 1HMVA 3ALYA 1YTUA 1BCOA 3RRHA 2XY5A 1U47A 1C6VA 4CIGA 3OY9A 2E6LA 4E1NA 4DU3A 3KIOA 3QEIA 3CM5A 3LALA 1HQUA 3IAYA 2HHWA 4IFYA 1KVBA 4NYFA 3NH1A 2D5RA 3TARA 4FJGA 1QSLA 4FK0A 4J2DA 1S1XA 4C8NA 1BIZA 4DU1A 4R5PA 3DLRA 2RKIA 3I8DA 4CGDA 2D0AA 4IFVA 4W5OA 3QERA 3QEXA 3V81A 1LWFA 3D45A 1T05A 3VQPA 1DTTA 4LSLA 2XY7A 3G10A 5KTQA 4KV8A 1VSLA 1EXQA 1FK9A 3AO4A 3MXJA 3O4QA 4O5BA 4IG3A 5SZTA 3HXMA 4FLTA 3VQCA 4CJFA 3BDPA 3RWUA 4I9QA 1REVA 1NOZA 2P51A 2BGGA 1YTAA 4BDYA 4CIFA 4FM0A 4CJPA 4ICLA 1TKDA 4K8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFO A;  3RMC A;  1L3T A;  4AHV A;  4CGG A;  2NUB A;  1L3S A;  4FZX C;  4FJJ A;  1KVA A;  2G8I A;  2HHU A;  2DFH A;  3KK3 A;  4N41 A;  2AJQ A;  2RPI A;  3LP1 A;  3HPG A;  1FKP A;  3HVT A;  1RDC A;  4CER A;  3HM9 A;  3K5O A;  2KFN A;  1JXB A;  2RN2 A;  3PY8 A;  1SUQ A;  2P5G A;  2B4J A;  3V9U A;  2BDP A;  2ZQB A;  2GUI A;  3NBP A;  1TVR A;  3LP2 A;  4B8C A;  3NCI A;  3RMA A;  1IKV A;  3DOK A;  3U6F A;  3V9W A;  1LW2 A;  4I2Q A;  3DOL A;  4ID1 A;  2IOC A;  1WLJ A;  2EX3 A;  3T1A A;  1R0A A;  3T19 A;  4E7L A;  3ZT4 A;  4KO0 A;  3TAN A;  4KHU A;  4CK2 A;  4CGF A;  2B6A A;  1XHX A;  4HUE A;  5J2N A;  3TAE A;  4FJ9 A;  4DWI A;  3LDS A;  3LP3 A;  4RW6 A;  4W5N A;  1WSH A;  4OPJ A;  3PX4 A;  3OYC A;  1VRT A;  5HP1 A;  4LD0 A;  1JL1 A;  2X6N A;  2VG5 A;  5D3G A;  4F4K A;  3SNN A;  1WN7 A;  3K59 A;  3V9S A;  4CEE A;  1VSE A;  4O4G A;  5EU7 A;  4CF8 A;  4ELT A;  2F8S A;  4CK1 A;  3KKS A;  1IH7 A;  1KCF A;  4BAC A;  1RT3 A;  5FRO A;  4FJI A;  4E89 A;  2YV0 X;  3VQ4 A;  2P1J A;  3O3F A;  1BI4 A;  4FLV A;  3OYE A;  3C6U A;  3QLH A;  1QSS A;  4EZ9 A;  2DY4 A;  1EKE A;  4FW2 A;  1HYV A;  2ZD1 A;  3ZSR A;  3HVR A;  1YT3 A;  1X9M A;  1UA1 A;  4E19 A;  2IDO A;  1TK8 A;  2KZM A;  4CF9 A;  3PV8 A;  4Z4F A;  3QIN A;  3RR7 A;  4FZY A;  1TKZ A;  5C25 A;  1RCH A;  1B9D A;  3TI0 A;  1S6P A;  3ZSZ A;  3ZT2 A;  1VSD A;  3AO3 A;  1D5A A;  3LP0 A;  4B3O A;  4CK3 A;  3KLI A;  3OYH A;  3HK2 A;  3DRP A;  5CZ1 A;  4QOZ B;  2Y1I A;  4DLE A;  4CFD A;  4E0D A;  3ZSQ A;  1XC9 A;  4M3Z A;  1BI4 B;  3V1O A;  1JLF A;  1GOC A;  3K57 A;  4HUF A;  3HJF A;  3AVC A;  1TL3 A;  3ZSV A;  3EY1 A;  3AO5 A;  3JYT A;  1VRU A;  2DFF A;  4MQ3 A;  3NGI A;  4FLW A;  3IRX A;  3OYF A;  3CFP A;  1O1W A;  4RW8 A;  1L3U A;  4FJX A;  4KPY A;  1WAJ A;  1VSM A;  1ASV A;  1J5O A;  4FLU A;  3KTQ A;  2XO7 A;  2A1R A;  4OLA A;  4CEO A;  4FW1 A;  2OPQ A;  4CFB A;  4EP4 A;  3DLH A;  4I7F A;  2FBX A;  1IKW A;  3QIP A;  4RW9 A;  1ZYQ A;  2JLE A;  1XI1 A;  1XWL A;  1ZBI A;  2Z1H A;  2ETJ A;  2XHB A;  2HNZ A;  1U45 A;  1S1V A;  3AO2 A;  3V6D A;  1I3A A;  1BCM A;  3VQ8 A;  1JL2 A;  4DS4 A;  2OZS A;  4FJL A;  1WSE A;  2YKM A;  4DTM A;  3TAG A;  3AVL A;  5K14 A;  3B6P A;  4BWJ A;  3DRS A;  4AHS A;  4Z4G A;  4GW6 A;  4Z4E A;  3SPZ A;  1HNV A;  3RR8 A;  2QKB A;  3K2P A;  3S9H A;  2F96 A;  1KVC A;  4DF8 A;  3MEG A;  1QE1 A;  1RBV A;  5I42 A;  2F8T A;  3HO1 A;  4CJW A;  1SV5 A;  1LV5 A;  1CXQ A;  3SYZ A;  1IKY A;  4G1Q A;  1S9E A;  3SPY A;  3S3N A;  3M8Q A;  4BE1 A;  1KTQ A;  3T3F A;  3AVB A;  1NK9 A;  4KB1 A;  1CLQ A;  1UOC A;  3O4N A;  4Z4C A;  3K5N A;  4H4O A;  3VQ9 A;  4PA1 A;  3JSM A;  1BHL A;  4PQU A;  4YNQ A;  4ZHR A;  4CHY A;  2R7Y A;  1A5V A;  2G8V A;  1EX4 A;  1ASW A;  2IS3 A;  4RW4 A;  3WNH A;  1U04 A;  3ASM A;  4B08 A;  4E7J A;  3RRG A;  1ZBL A;  4F3O A;  1HPZ A;  3EZ5 A;  4JS4 A;  1KLN A;  4B9T A;  1GOB A;  4AHC A;  1B92 A;  3G0Z A;  1LWE A;  4CFC A;  4B8A B;  4C8K A;  2BAN A;  1LWC A;  2XRI A;  4BWM A;  3QNO A;  4BDZ A;  1D9F A;  3MED A;  4Z4I A;  2QK9 A;  1JKH A;  3C94 A;  4CJ3 A;  3TAP A;  1EP4 A;  4Y1C A;  1W9H A;  3SUN A;  1K6Y A;  2VWK A;  4CHO A;  1SL2 A;  4KHW A;  3K5L A;  3HT3 A;  1TAU A;  3V9Z A;  2OA8 A;  3VN5 A;  3VQ5 A;  2G8U A;  1VSK A;  2GV9 A;  1F21 A;  2HW3 A;  4M3U A;  1BL3 A;  2XY6 A;  2G8W A;  1L5U A;  1RIL A;  3HPH A;  5HLF A;  2HHQ A;  1HQE A;  3OYD A;  1C1A A;  5KI6 A;  3DRR A;  3F73 A;  4J2A A;  4FJ8 A;  4BE2 A;  1L3V A;  4CHQ A;  3SV3 A;  2W42 A;  4JRP A;  1RT5 A;  1S9G A;  4AHR A;  3OYA A;  4UQG A;  3VQA A;  1TKT A;  2HND A;  3O3G A;  4AIL C;  1NK8 A;  4B9L A;  1JLE A;  3I0R A;  4KTW A;  4IG0 A;  4LY7 A;  4CJL A;  1D8Y A;  4O44 A;  1XHZ A;  4DSJ A;  3NFA A;  1X9W A;  4W5T A;  3LWL A;  1U49 A;  3CG7 A;  4CED A;  1HJR A;  4FJ5 A;  3CYM A;  3HST B;  3OYI A;  3MXM A;  2XY8 A;  2O4I A;  4B9U A;  2O4G A;  4KTZ A;  3BGR A;  4MFB A;  3ITH A;  3NH0 A;  1D9D A;  4KRF A;  2YNI A;  2KQ2 A;  4DSI A;  2YNH A;  3ISN C;  3VQQ A;  1X1P A;  4FJK A;  2X6S A;  4KTQ A;  3DM2 A;  1J53 A;  3K5M A;  2Z1J A;  4YFU A;  2HHT A;  2P5O A;  4GVM A;  3DI6 A;  2G8K A;  3AVJ A;  4CEQ A;  4CJU A;  2PZS A;  4DTJ A;  2RF2 A;  4DFP A;  5DK5 A;  3TAF A;  1JLG A;  4DTR A;  4M45 A;  3NF7 A;  1CZ9 A;  3LWM A;  4AH9 A;  4F8R A;  4DSF A;  3L3U A;  4H4M A;  1VSH A;  4FLY A;  4CEA A;  1C0U A;  3AVF A;  1MU2 A;  4CIE A;  1JLQ A;  1ZBH A;  2IAJ A;  4M3T A;  4DSL A;  4F2S A;  4RG8 A;  3U3G A;  4W5Q A;  4ELU A;  1ZBF A;  4PWD A;  4KKO A;  2HVH A;  4IDK A;  3WNG A;  1LAV A;  4CJ4 A;  4KHS A;  4FLZ A;  4DFK A;  2YNG A;  2Z1I A;  2X78 A;  4DTP A;  3AVK A;  1YVU A;  1C1C A;  3AVI A;  3VA0 A;  2OPP A;  3HP6 A;  4HTU A;  3NH2 A;  2KZZ A;  3LZJ A;  4N76 A;  2HHV A;  1RT2 A;  4ZTJ A;  4B9S A;  1RTD A;  3ZSW A;  2KTQ A;  4DTO A;  5CZ2 A;  1SKW A;  1UAX A;  2DTU A;  1NJW A;  1FXX A;  4NCG A;  3QEP A;  3ZCM A;  3AA4 A;  4NYN A;  2E4L A;  2Q3S A;  4DTS A;  1C0M A;  4DQR A;  4DU4 A;  3AA2 A;  4FM1 A;  1Z25 A;  4FVM A;  3QEV A;  2Z1G A;  5T7B A;  3NAE A;  1W0H A;  3HP9 A;  1JLA A;  1KFS A;  3L2V A;  1S6Q A;  4DTX A;  3QET A;  1UA0 A;  3P1G A;  1CXU A;  4M42 A;  4M3Y A;  4HVJ A;  3P5J A;  3OS2 A;  1IG9 A;  4ZTF A;  1EET A;  3QES A;  3SUO A;  3AVG A;  4KRE A;  2I5J A;  3DLK A;  1VSF A;  1BIU A;  3ZSO A;  3AVN A;  3MEE A;  1NKC A;  4Q5V A;  4KAZ A;  4DSE A;  2PYL A;  2VG6 A;  1N6Q A;  5C24 A;  2E6M A;  2OPS A;  1JLC A;  3DYA A;  3VQB A;  4BDP A;  4CES A;  2OZM A;  3C6T A;  3OYG A;  2DFE A;  3OJS A;  2OYQ A;  5KRT A;  3KD1 E;  2G8H A;  3TAQ A;  1Q9Y A;  3CFR A;  4IKF A;  4DF4 A;  3AVH A;  1IKX A;  3A2F A;  4CEB A;  3SUP A;  1Q9X A;  1QTM A;  4J2B A;  4DMN A;  1C1B A;  1RTJ A;  3LPT A;  1S5J A;  1VSI A;  1KFD A;  5CYQ A;  3V1Q A;  4CFA A;  2YHB A;  2YHA A;  3SQ4 A;  3ZT1 A;  1RT4 A;  2LSN A;  1RNH A;  3QNN A;  3V4I A;  3KD5 E;  3LAN A;  4O0J A;  3LAM A;  3SV4 A;  3OS0 A;  4FYD A;  4KI4 A;  1RDB A;  4H8K A;  1U48 A;  2YKN A;  5C42 A;  1NK0 A;  4E7I A;  1NK4 A;  3SQ1 A;  1QQC A;  4CE9 A;  2HNY A;  3AO1 A;  4FLX A;  1KRP A;  4B9V A;  4EZ6 A;  2VWJ A;  5E41 A;  5KGW A;  3RTV A;  5JS1 A;  1TV6 A;  1WNS A;  1GOA A;  4DS5 A;  1RT6 A;  4NCB A;  4CEZ A;  2KFZ A;  1B9F A;  4CEC A;  4CGH A;  4CHZ A;  3SCX A;  1NKB A;  5I3U A;  2WOM A;  5HRN A;  3K58 A;  2IGI A;  1T8E A;  4M3W A;  4OGE A;  3VQ7 A;  1UWB A;  3MAQ A;  4XIU A;  4FJH A;  1BIS A;  4L8R B;  2D0C A;  3MEC A;  4HCB A;  3O3H A;  5DMR A;  5FDL A;  2QKK A;  4KFB A;  1NK6 A;  1WAF A;  2A1S A;  5CY4 A;  1IO2 A;  1RTI A;  3CQ8 A;  3QO9 A;  3OYL A;  3L2U A;  3HYF A;  4O55 A;  5CYM A;  3NHG A;  3DLB A;  4N47 A;  4FZZ A;  3H08 A;  2FBY A;  4KHY A;  3TAM A;  4CCH A;  4PY5 A;  1TK0 A;  3V1R A;  3V9X A;  3DLE A;  4DQP A;  2HHS A;  2HVI A;  1FKO A;  1WSF A;  1I39 A;  3D0P A;  1VSJ A;  2FBT A;  4WE1 A;  2IC3 A;  3TR8 A;  5HRS A;  4LH5 A;  3TWH A;  4Y1D A;  3L2R A;  4JRQ A;  3WNF A;  1CZB A;  4RW7 A;  1KLM A;  3AA3 A;  3NDK A;  3ULD A;  3TAB A;  1TKX A;  3S3O A;  4NCA A;  2Y1J A;  1RBR A;  3ZT0 A;  1J9A A;  4AHT A;  4N56 A;  4DSK A;  4DQS A;  3VQ6 A;  2FC0 A;  4N5S A;  1TL1 A;  1KSP A;  1G15 A;  1J54 A;  3OVN A;  3AVA A;  4I2P A;  1NJY A;  1SKS A;  3DMJ A;  2HMI A;  3KK2 A;  2B5J A;  1ITG A;  2BE2 A;  4M3R A;  4DTU A;  4FK2 A;  3MXI A;  1RBU A;  4B9M A;  3VQE A;  2KW4 A;  4B9N A;  3UIQ A;  5JS2 A;  1S1W A;  3AV9 A;  3NF8 A;  1NOY A;  2HB5 A;  1HNI A;  2OPR A;  1WSJ A;  4C8M A;  1SL1 A;  4Z4H A;  3RMD A;  3WNE A;  4FJ7 A;  3L8B A;  4E1M A;  4DQI A;  1LW0 A;  3OS1 A;  5SWM A;  3KJV A;  4CGI A;  3SQ2 A;  3NGY A;  5FRN A;  1HYZ A;  1WSI A;  4IBN A;  2PYJ A;  5HRO A;  1NJX A;  4EP5 A;  2ATQ A;  1ASU A;  1S1T A;  3KLG A;  3KLE A;  3QEW A;  1TK5 A;  4C8L A;  3KKR A;  1NK7 A;  1NKE A;  4KHN A;  3IG1 A;  4JLH A;  3S3M A;  3THV A;  3OJU A;  1A5X A;  1A5W A;  2ZE2 A;  4OKK A;  4CF2 A;  4OGC A;  1Q8I A;  4LSN A;  3PUF A;  1RDA A;  4FCY A;  4DFJ A;  4HUG A;  3ZSX A;  2EHG A;  3OYB A;  3I0S A;  1TGO A;  4Z0U A;  3L2Q A;  4JS5 A;  1HYS A;  3F9K A;  1T7P A;  3QIO A;  3ZT3 A;  3SI6 A;  3KK1 A;  1RBS A;  3M8P A;  4FJN A;  3AA5 X;  2WON A;  4C8O A;  3KLH A;  4E3S A;  4K8Z A;  4OJR A;  1BGX T;  1VK0 A;  3PX0 A;  1QS4 A;  4AHU A;  3NF6 A;  3LAK A;  5J2M A;  4FXD A;  1QHT A;  1WSG A;  4ELV A;  1C0T A;  2YNF A;  4OKJ A;  4CJR A;  3LZI A;  4E7H A;  1X9S A;  5FRM A;  1LAW A;  2D0B A;  1RT7 A;  4OLB A;  1JLB A;  5HBM A;  3NE6 A;  5HRR A;  4TSX A;  3OYJ A;  3M8S A;  3EYZ A;  4OPK A;  4E7K A;  4DFM A;  4DLG A;  3VQD A;  4CJK A;  2G8F A;  1RDD A;  4I9L A;  1BQM A;  3HL8 A;  3CM6 A;  5J2Q A;  4CHP A;  5HRP A;  4O0I A;  3OYM A;  1S1U A;  1HRH A;  3SJJ A;  4OKE A;  5J1E A;  2QXF A;  4CJ5 A;  1T03 A;  4CJV A;  4CJT A;  4DTN A;  3C95 A;  1U4B A;  3OYN A;  1Y97 A;  4LH4 A;  3U3Y A;  1DTQ A;  1BQN A;  1Z26 A;  1DLO A;  3L3V A;  1RTH A;  2FBV A;  4ID5 A;  4CEF A;  3NGZ A;  4J2E A;  4BE0 A;  4FJM A;  4OVL A;  4KI6 A;  4QCL A;  4QAG A;  5KGX A;  4CGJ A;  3PO5 A;  2HHX A;  3L2W A;  3OYK A;  1QSY A;  4HCC A;  2GBZ A;  4DG1 A;  4CHN A;  1RT1 A;  3ZSY A;  3B6O A;  3SZ2 A;  1NK5 A;  3VA3 A;  4CJE A;  5KRS A;  1RBT A;  3PO4 A;  1NJZ A;  4F3T A;  4CJS A;  4FK4 A;  3P83 D;  3DLG A;  1JXE A;  3IS9 A;  2VG7 A;  3SUQ A;  1SKR A;  2JGU A;  3HPO A;  4FM2 A;  3E01 A;  4F2R A;  3KLF A;  3FFI A;  5J2P A;  3M8R A;  2ITG A;  3RMB A;  4M3X A;  3LPU A;  1TAQ A;  4HHT A;  1N5Y A;  3NF9 A;  1SL0 A;  4M41 A;  4W5R A;  4GMJ B;  4KHQ A;  4KB0 A;  4DQQ A;  2X74 A;  3PX6 A;  4PUO A;  2PY5 A;  1ZBU A;  3SQ0 A;  4CJQ A;  4CF0 A;  3AVM A;  4CF1 A;  4Q0B A;  1HMV A;  3ALY A;  1YTU A;  1BCO A;  3RRH A;  2XY5 A;  1U47 A;  1C6V A;  4CIG A;  3OY9 A;  2E6L A;  4E1N A;  4DU3 A;  3KIO A;  3QEI A;  3CM5 A;  3LAL A;  1HQU A;  3IAY A;  2HHW A;  4IFY A;  1KVB A;  4NYF A;  3NH1 A;  2D5R A;  3TAR A;  4FJG A;  1QSL A;  4FK0 A;  4J2D A;  1S1X A;  4C8N A;  1BIZ A;  4DU1 A;  4R5P A;  3DLR A;  2RKI A;  3I8D A;  4CGD A;  2D0A A;  4IFV A;  4W5O A;  3QER A;  3QEX A;  3V81 A;  1LWF A;  3D45 A;  1T05 A;  3VQP A;  1DTT A;  4LSL A;  2XY7 A;  3G10 A;  5KTQ A;  4KV8 A;  1VSL A;  1EXQ A;  1FK9 A;  3AO4 A;  3MXJ A;  3O4Q A;  4O5B A;  4IG3 A;  5SZT A;  3HXM A;  4FLT A;  3VQC A;  4CJF A;  3BDP A;  3RWU A;  4I9Q A;  1REV A;  1NOZ A;  2P51 A;  2BGG A;  1YTA A;  4BDY A;  4CIF A;  4FM0 A;  4CJP A;  4ICL A;  1TKD A;  4K8X A; 
#chains in the Genus database with same CATH topology
 4JV5 K;  4GKJ K;  4BG8 A;  1XUP O;  5GIP A;  4FZX C;  1KVA A;  1BU6 O;  2HHU A;  4FPB A;  3KK3 A;  3FE1 A;  3LP1 A;  3T1H K;  4BRI A;  1P8Z A;  5AQH A;  4BVP A;  3HM9 A;  1JXB A;  2B4J A;  3V9U A;  3A5N C;  1BUP A;  4RCH A;  1LCU A;  2NZT A;  3NBP A;  4B8C A;  4X65 K;  3NCI A;  3RMA A;  4BR9 A;  1LW2 A;  1WUA A;  4DSJ A;  2EX3 A;  2E8A A;  3LDS A;  2P9L B;  3BUZ B;  3SMS A;  4W5N A;  4OPJ A;  4A57 A;  4LD0 A;  3U8X A;  5D3G A;  1QQN A;  3CER A;  4CZK A;  4CEE A;  1VSE A;  4CF8 A;  3KKS A;  1ZBS A;  3PIP L;  1OH6 A;  2P1J A;  5JLF A;  4ISG A;  2OTL N;  4GVE A;  2DY4 A;  1EKE A;  4FW2 A;  2ZD1 A;  3ZSR A;  3AGR A;  1K73 O;  4A62 A;  4O8U A;  1TK8 A;  3QIN A;  4FZY A;  1RCH A;  2YCH A;  3TI0 A;  4JKG B;  1D5A A;  3D7E O;  1WBB A;  3RVC A;  3THY A;  1YJW N;  4B3O A;  3KLI A;  5CZ1 A;  5JLH A;  4M3Z A;  2F8T A;  4AQY K;  1XC9 A;  1BI4 B;  3HJF A;  4HUF A;  5AQX A;  3NGI A;  3EY1 A;  3MN7 A;  3AO5 A;  3JYT A;  4DV6 K;  3EEQ A;  4FLW A;  3CFP A;  4ISE A;  3VES A;  1VQL N;  1ATN A;  3O4W A;  3FZH A;  1VSM A;  2W41 A;  3FR0 A;  1J5O A;  1IV0 A;  3KTQ A;  2XO7 A;  4CEO A;  2OPQ A;  4CFB A;  2FBX A;  3L4Q A;  3FZF A;  1XWL A;  1NGH A;  2ETJ A;  1U45 A;  1JL2 A;  1WSE A;  4A5A A;  4DTM A;  3MCA B;  4BWJ A;  3ZEU B;  3HTV A;  2W40 A;  5M1P A;  3CJB A;  4Z4E A;  3SPZ A;  1HNV A;  3S9H A;  2YX6 A;  4DF8 A;  3MEG A;  1QE1 A;  3HO1 A;  4CJW A;  1CXQ A;  4G1Q A;  3D2E B;  4IEI A;  3S3N A;  3M8Q A;  3R9P A;  3GOI A;  3AVB A;  1W2B M;  4YOU A;  4Z4C A;  4OPA A;  4EIA A;  1WOQ A;  3AAQ A;  1NMD A;  4CHY A;  2IS3 A;  1QVG M;  4FOE A;  1HPZ A;  2BAN A;  1LWC A;  3QNO A;  1GLC G;  3I55 N;  1U2V B;  4CJ3 A;  3CC7 N;  2P9S B;  4KHW A;  3DJC A;  3K5L A;  4K41 A;  3THX A;  1VSK A;  2G8W A;  3O9T A;  3HPH A;  5GAH P;  1ATS A;  5TKW A;  1RT5 A;  1EQY A;  3ZX2 A;  4AIL C;  3I0R A;  4IG0 A;  2NRH A;  1X9W A;  1EO1 A;  2Q2R A;  3LWL A;  2A5X A;  4JI2 K;  5CR4 A;  1HJR A;  3OYI A;  3MXM A;  3O9Q A;  4B9U A;  2YNI A;  2KQ2 A;  1J5E K;  2HBK A;  4FJK A;  1X1P A;  4JKB A;  2WTU A;  3K5M A;  3N4Q A;  4YFU A;  3J81 O;  2GTD A;  2HHT A;  3F5T A;  4GVM A;  1BWF O;  4DTJ A;  2UXC K;  3LWM A;  4DSF A;  3L3U A;  4H4M A;  5AQF A;  3H1Q A;  1C0U A;  1MU2 A;  2P9K B;  4W5Q A;  3Q7B A;  1T44 A;  3CMA N;  5AZJ A;  4IXC A;  4DFK A;  2FSJ A;  2X78 A;  3VMF B;  4DV3 K;  1J6Z A;  2E1Z A;  3AVI A;  1IBL K;  3I56 N;  4HTU A;  1BA1 A;  3NH2 A;  3LZJ A;  4N76 A;  1RT2 A;  4B9S A;  1RTD A;  3ZSW A;  1OKJ A;  3GDQ A;  4U7B A;  3QEP A;  3AA4 A;  3H6E A;  4NYN A;  1C0M A;  4YDU A;  4DQR A;  4DU4 A;  4FVM A;  3THY B;  4HTL A;  5T7B A;  2UUA K;  4BGB A;  1S6Q A;  3P1G A;  1CXU A;  5AQP A;  3P5J A;  4YHH K;  3AVG A;  1VSF A;  4OO1 J;  4IOC L;  3EE8 A;  2VG6 A;  2E6M A;  2OPS A;  4BDP A;  2OZM A;  3C6T A;  3OYG A;  3OJS A;  2OYQ A;  5CHI A;  1E4F T;  3EKS A;  3TAQ A;  1Q9Y A;  5BPM A;  1NLV A;  2CGL A;  2E88 A;  5ADX H;  4DMN A;  1RTJ A;  1S5J A;  1VSI A;  4YOX A;  3V1Q A;  3SQ4 A;  3QNN A;  3V4I A;  3G71 N;  2ZJR L;  3LAM A;  4KI4 A;  4H8K A;  5C42 A;  4BR7 A;  3SAF A;  3WXM B;  3WXI A;  2HNY A;  3AO1 A;  4FLX A;  1KRP A;  2D4W A;  4B9V A;  5E41 A;  5JS1 A;  1TV6 A;  2F9T A;  3EE9 A;  1GOA A;  4CEZ A;  1K8K A;  1KQS M;  2YHX A;  5HRN A;  1H1V A;  1GLL O;  4WYB A;  5AR0 A;  4L8R B;  1IBM K;  2HMP A;  2YHW A;  4KFB A;  2A1S A;  3L2U A;  4JK9 A;  1NGF A;  4KHY A;  3TAM A;  4PY5 A;  3V9X A;  1VSJ A;  3E9O A;  3TR8 A;  4Y1D A;  3THX B;  3WNF A;  4RW7 A;  1NGI A;  3ULD A;  3TAB A;  2YJE A;  3ZT0 A;  3O9R A;  3SLC A;  2UYT A;  4DSK A;  4DQS A;  3L4I A;  4N5S A;  2O8C A;  3AVA A;  3WQU A;  2B5J A;  4B9M A;  5BPL A;  1DT9 A;  4JI7 K;  2KW4 A;  4B9N A;  1S1W A;  3LDL A;  1NOY A;  3GG4 A;  1W7A A;  4ILJ A;  4C8M A;  2AA4 A;  4DCH A;  3L8B A;  1LW0 A;  2GEL A;  5EX5 A;  5FRN A;  2PYJ A;  1ASU A;  1S1T A;  1YAG A;  5AQR A;  3KKR A;  5JMV A;  4KHN A;  3S3M A;  3THV A;  3CCQ N;  1A5W A;  2ZE2 A;  4CZG A;  4OKK A;  4OGC A;  1NG9 A;  3PUF A;  4QS8 A;  4DFJ A;  4HUG A;  2EHG A;  3I0S A;  3VEV A;  3L2Q A;  4JS5 A;  2VGN A;  3QIO A;  4UY8 O;  4FJN A;  4C8O A;  5AZJ B;  4K8Z A;  2HBM A;  5BN8 A;  2Q0R A;  3NF6 A;  1QHT A;  1WSG A;  4CJR A;  3LZI A;  4GKK K;  4WQ4 C;  1KAZ A;  4AM7 A;  1LAW A;  5M1K A;  5LL6 Z;  5HRR A;  3EYZ A;  2G8F A;  1ILY A;  4IOA L;  5AQQ A;  5B8H A;  3OA9 A;  4JD2 A;  2D0P A;  3C95 A;  2KLA A;  3OYN A;  3U3Y A;  4BC5 A;  1BDG A;  2V7Y A;  4DR7 K;  3L2W A;  1QSY A;  4LC9 B;  3ZSY A;  3VA3 A;  3PO4 A;  1ATR A;  4FK4 A;  3P83 D;  3DLG A;  1JXE A;  3IS9 A;  4IFE A;  4F9O A;  2ZM6 K;  3SUQ A;  2ZGZ A;  5LJW A;  4FM2 A;  3E01 A;  4F2R A;  1VAZ A;  4DR5 K;  3ID8 A;  1YJN N;  3M8R A;  2E2N A;  4JI4 K;  1N5Y A;  5KQD A;  1SL0 A;  3DWL A;  4W5R A;  4GMJ B;  3QBW A;  3PX6 A;  1ZBU A;  1GLJ O;  4CF0 A;  3AVM A;  4B3M K;  2GWJ A;  4Q0B A;  2KHO A;  1YTU A;  1BCO A;  1N34 K;  3DLL L;  4JN4 A;  3HZ6 A;  2E6L A;  4DU3 A;  1C0F A;  5BRE A;  2HHW A;  3C6H A;  4NB4 A;  1K8K B;  4CGD A;  2D0A A;  3QEX A;  5LMN K;  1Q7Y O;  2F4V K;  4IDH A;  4KV8 A;  1FK9 A;  1RDW X;  3O4Q A;  5SZT A;  3RWU A;  3VQC A;  1REV A;  1ESV A;  5AQY A;  1BOT O;  1N8R O;  4WQ5 A;  3LM9 A;  2CGJ A;  3CFO A;  3RMC A;  4BRL A;  1L3T A;  3CCV N;  4M63 C;  1Z05 A;  2NUB A;  4CGG A;  3SBG A;  2DFH A;  2RPI A;  4BRD A;  3PIO L;  4CER A;  2KFN A;  3RSE A;  1SUQ A;  2VCP A;  2ZGY A;  4MDB A;  4DR1 K;  1IKV A;  3U6F A;  5MLC Q;  3DOL A;  4PKI A;  2O8C B;  1R0A A;  2IOC A;  4B1Y B;  5AQL A;  4E7L A;  3F2K A;  4CK2 A;  3CXC M;  3H3O B;  5J2N A;  4HUE A;  4FJ9 A;  3ATU A;  1YJ9 N;  4H5N A;  3NMU A;  4RW6 A;  4JAX A;  1GLF O;  1G99 A;  1WSH A;  2W6L A;  5JIC A;  1JL1 A;  2X6N A;  4B9Q A;  3V9S A;  4O4G A;  2F8S A;  5EU7 A;  1QHA A;  2A41 A;  2NRV A;  4CK1 A;  3G4S N;  1RT3 A;  3EL2 A;  4A59 A;  3VQ4 A;  1BI4 A;  3K9J A;  3C6U A;  3QLH A;  4PL8 A;  1QSS A;  1HYV A;  2KZM A;  2IDO A;  5F1X A;  1JCE A;  3ENB A;  1QQM A;  2RHK A;  1GLE G;  1B9D A;  1S6P A;  3UKU A;  3HI0 A;  4FWN A;  4GV6 A;  3DRP A;  3HRG A;  2Y1I A;  4E0D A;  1Y64 A;  1JLF A;  1GOC A;  3ZSV A;  3VGK A;  4B3S K;  1O1W A;  4QS7 A;  4KPY A;  1S72 N;  2A1R A;  1NMN A;  2P9U B;  2YI1 A;  2JLE A;  2Z1H A;  1VQ7 N;  2XHB A;  2HNZ A;  1XNQ K;  1S1V A;  1YUW A;  3V6D A;  3I33 A;  3VQ8 A;  4DS4 A;  3BF1 A;  2O8F A;  2YKM A;  1FJG K;  3TAG A;  3DRS A;  4Z4G A;  4GV9 A;  5AFU A;  4JD2 B;  3K2P A;  1KVC A;  3A5M C;  5DM7 L;  4CZJ A;  1S9E A;  3SPY A;  2Q31 A;  1KTQ A;  1CLQ A;  1UOC A;  4H4O A;  3VQ9 A;  4PQU A;  3JSM A;  4YNQ A;  3UB5 A;  2G8V A;  1A5V A;  3MCP A;  3HSC A;  3ASM A;  3WXK A;  3EZ5 A;  4B3R K;  4KH5 A;  1GOB A;  3ENO A;  4JKC A;  4C8K A;  1D9F A;  4BDZ A;  3MED A;  4BRO A;  3TAP A;  4CHO A;  3R6M A;  3HT3 A;  3V9Z A;  2OA8 A;  1VQK N;  3VN5 A;  3VQ5 A;  1P90 A;  2GV9 A;  1QVF M;  1F21 A;  1BL3 A;  5KQ8 A;  5HLF A;  1C1A A;  3SK3 A;  5KI6 A;  2ASM A;  4J2A A;  4FJ8 A;  3U9D A;  4CHQ A;  4LF9 K;  3JAM O;  1S9G A;  5KPR A;  5IWA K;  3OYA A;  4UQG A;  3VQA A;  1SS6 A;  2HND A;  3CC2 N;  1S22 A;  1JLE A;  4LY7 A;  4CJL A;  1Q82 O;  4O44 A;  3NFA A;  5BRF A;  1HKC A;  4EHU A;  3IUC A;  2F9W A;  4FJ5 A;  3CYM A;  3HST B;  2O4I A;  4KTZ A;  3NH0 A;  4XH1 A;  5FPE A;  3QB0 A;  3RSE B;  2VQF K;  4JI1 K;  2P9K A;  2X6S A;  3DM2 A;  1J53 A;  4G9Z A;  4BR5 A;  4ILH A;  4H5R A;  3T1Y K;  2Z1J A;  3QML A;  1BA0 A;  4BRP A;  1HPM A;  2UXB K;  4DFP A;  1NGG A;  1JLG A;  2VWB A;  1VSH A;  4CEA A;  1KAY A;  4CIE A;  1JLQ A;  4B1V A;  5LJV A;  3O9U A;  4F2S A;  1ZBH A;  4RG8 A;  3CET A;  4L3Q A;  5KPT A;  1ZBF A;  4JKE A;  1HR0 K;  1LAV A;  4IEE A;  4KHS A;  4LF6 K;  2NLX A;  3M5R A;  4YOY A;  3O80 A;  3AAR A;  4BRK A;  2HHV A;  5AQO A;  3H3N O;  1MDU B;  4CJ7 A;  1NJW A;  1FXX A;  4NCG A;  3ZCM A;  3SAH A;  1JCG A;  3UKU B;  2PFU A;  4FM1 A;  4OX9 K;  2Z1G A;  5BR9 A;  3HP9 A;  1JLA A;  1KFS A;  3R1X A;  4CZI A;  4ZTF A;  3SUO A;  3AVN A;  2PYL A;  3CCM N;  5C24 A;  3NVK A;  2DFE A;  2G8H A;  4IKF A;  3BF3 A;  5AQG A;  2DPN A;  4DF4 A;  3AVH A;  1IKX A;  3A2F A;  3SUP A;  1QTM A;  5AZI A;  2O8F B;  2QEX N;  4J2B A;  1C1B A;  3LPT A;  4Y0W A;  2YHB A;  3ZT1 A;  2LSN A;  3E9L A;  4O0J A;  4FYD A;  1XQS C;  3MN5 A;  1RDB A;  4JEP A;  2YKN A;  5BN9 A;  4CE9 A;  5FPM A;  1TYQ A;  5KGW A;  3RTV A;  4K43 A;  1WNS A;  5TKY A;  3HM8 A;  1RT6 A;  2QI2 A;  4CEC A;  2ZJQ L;  5I3U A;  4M3W A;  3ZET A;  4CZE A;  3O3H A;  4DV1 K;  3QO9 A;  4O55 A;  4X64 K;  1Q81 O;  3P38 A;  1WB9 A;  4FL9 A;  3A8Y A;  3H08 A;  2E5L K;  4CCH A;  1TK0 A;  3DLE A;  3IDH A;  3MWP A;  3P31 A;  4DQP A;  1FKO A;  3D0P A;  1I39 A;  2HHS A;  3SMP A;  4CVN E;  5AQW A;  4FO0 A;  3E66 A;  3TWH A;  3L2R A;  1CZB A;  4NXM K;  3AA3 A;  3KVG A;  4AHT A;  4BR0 A;  1Q18 A;  4BC4 A;  1KSP A;  2ASO A;  2FC0 A;  4EFH A;  4K42 A;  4I2P A;  3FZM A;  1SKS A;  2HMI A;  3KK2 A;  1ITG A;  4YDU C;  4DTU A;  3C0B A;  3VQE A;  3UIQ A;  3AV9 A;  3NF8 A;  2HB5 A;  1HNI A;  1SL1 A;  1VHX A;  4NXN K;  3KJV A;  1HYZ A;  1WSI A;  5HRO A;  3J7A P;  4H0X B;  4JI8 K;  4FWM A;  4CI6 A;  2QWM A;  3KLE A;  3QEW A;  5FPD A;  1NKE A;  5FPN A;  3CJ1 A;  3IG1 A;  4JLH A;  3OJU A;  3MN9 A;  4CF2 A;  3OHR A;  1RDA A;  5AQN A;  4DHY A;  5AQS A;  1YIT N;  1HYS A;  3SI6 A;  3WQT A;  1N36 K;  3FGU A;  1RBS A;  3M8P A;  5M1N A;  3AA5 X;  2ZF5 O;  5BPN A;  5EOY A;  4OJR A;  3VEW A;  3QBX A;  1QS4 A;  4AHU A;  3LAK A;  2YNF A;  4OKJ A;  4E7H A;  1X9S A;  5AQM A;  1NNE A;  3VGM A;  3LDO A;  4DV4 K;  1RT7 A;  5AQU A;  1HNX K;  3OYJ A;  3M8S A;  4OPK A;  4J8F A;  1VQN N;  4I9L A;  3N4P A;  4CHP A;  3OYM A;  3ZLJ A;  4WFN L;  4CJ5 A;  3VEX A;  3L3V A;  4YOW A;  2FBV A;  4QCL A;  4BQL A;  4KI6 A;  3PO5 A;  3OYK A;  4BQZ A;  5CE3 A;  1RT1 A;  3B6O A;  3SZ2 A;  2WUS A;  1NJZ A;  2VG7 A;  3JXU A;  5H1S Q;  2JGU A;  3FFI A;  2O8B A;  4M3X A;  5EXW A;  1TAQ A;  3LL3 A;  2QWN A;  2D1K A;  5AZI B;  4DQQ A;  2X74 A;  2HBL A;  4PUO A;  4R79 A;  2ASP A;  4CF1 A;  2F7T A;  2XY5 A;  4XH5 A;  4HWI A;  1U47 A;  1C6V A;  4CIG A;  3OY9 A;  5AQJ A;  3KIO A;  4I6M A;  1TYQ B;  3TAR A;  4NYF A;  4FJG A;  1QSL A;  4RTF D;  4J2D A;  3ID6 A;  4V19 S;  1S1X A;  2JWL A;  4DU1 A;  5AJ3 K;  3J7Y P;  1I94 K;  3ZET B;  3V81 A;  3D2F A;  4ILG B;  2YJF A;  2NRX A;  2XY7 A;  2FSN A;  3AO4 A;  4BRG A;  2OCE A;  4O5B A;  4IG3 A;  3BDP A;  3H45 C;  3HXM A;  4CBW A;  2BGG A;  1NOZ A;  1YTA A;  1IJJ A;  4FM0 A;  3VGL A;  1V4S A;  4AHV A;  1KC8 O;  2A3Z A;  4H0T B;  1L3S A;  1NJI O;  2AJQ A;  3HPG A;  1FKP A;  4DKW A;  3K5O A;  3R3L A;  2RN2 A;  3VEY A;  2ZQB A;  5M1Q A;  3DOK A;  2E2P A;  4M7X A;  4I2Q A;  3VF2 A;  3V9W A;  1JJ2 M;  4ID1 A;  3T1A A;  2HHQ A;  3ZT4 A;  4KHU A;  4CGF A;  2B6A A;  1XHX A;  3TAE A;  5M1F A;  4ISF A;  4DWI A;  4CBX A;  3LP3 A;  4FSV A;  2AP1 A;  1C0G A;  3OYC A;  1VRT A;  2IVN A;  5AQZ A;  2NRW A;  3D6R A;  3SNN A;  3K59 A;  2BUP A;  4ELT A;  1KCF A;  4BAC A;  4JK7 A;  5FRO A;  4FJI A;  4E89 A;  2YV0 X;  3OYE A;  3CJA A;  4BRA A;  3T7Z A;  1K9M O;  3HVR A;  4IWV A;  1YT3 A;  2QXL A;  3RR7 A;  1TKZ A;  5C25 A;  3ZT2 A;  1FW6 A;  3EKU A;  4BR4 A;  2VQE K;  2P9U A;  4CK3 A;  4QOZ B;  1NGJ A;  4DLE A;  2P9N A;  4KBO A;  3ZSQ A;  3V1O A;  1CZA N;  5AQI A;  3AVC A;  1TL3 A;  4H03 B;  4LF7 K;  1NGA A;  1VRU A;  2QKB A;  4FJX A;  3DXM A;  1OVQ A;  1VQ8 N;  4JYA K;  1WBD A;  4FLU A;  4OLA A;  4FW1 A;  3DLH A;  4I7F A;  1DEJ A;  4RW9 A;  1IKW A;  3CPW M;  1XI1 A;  4QS9 A;  1ZBI A;  3CF5 L;  3AO2 A;  1I3A A;  4FJL A;  3CQX A;  3AVL A;  4H5V A;  5K14 A;  1ZC6 A;  4GW6 A;  4WQ5 C;  5HL7 L;  3WEE A;  3SYZ A;  1IKY A;  1QQO A;  4EHT A;  1XMQ K;  4PA1 A;  1BHL A;  5A2Q O;  1T6C A;  4ZHR A;  2O8B B;  3VET A;  2R7Y A;  1EX4 A;  1ASW A;  4RW4 A;  3WNH A;  4E7J A;  3RRG A;  1ZBL A;  4JS4 A;  4BGA A;  4AHC A;  1B92 A;  4YY3 K;  1LWE A;  4CFC A;  5C0Y A;  3Q7C A;  4B8A B;  4MDA A;  2XRI A;  3EN9 A;  4Z4I A;  4IZ9 A;  1JKH A;  4KHP K;  1SL2 A;  4Y1C A;  4IO8 A;  2QWQ A;  1TAU A;  4I6M B;  3F9M A;  2G8U A;  3CJ7 A;  4IOX A;  4CBU A;  2QWO A;  1RIL A;  3CCE N;  3C6A A;  4KH6 A;  1HQE A;  3OYD A;  3DRR A;  3F73 A;  4BE2 A;  2OAN A;  3VEN A;  3SV3 A;  3D2F B;  1VQ5 N;  5EVZ A;  3QDK A;  4NLB A;  4AHR A;  3A0I X;  4K0K K;  4JNE A;  3CCL N;  1TKT A;  1NK8 A;  4B9L A;  4KTW A;  1D8Y A;  1XHZ A;  2E1Y A;  4W5T A;  4WFA L;  4GY2 B;  2XY8 A;  1XNR K;  5E26 A;  2O4G A;  3BGR A;  5E84 A;  4MFB A;  3ITH A;  1D9D A;  2IVO A;  2Q36 A;  4FWO A;  2YNH A;  2FF3 B;  3ISN C;  3VQQ A;  4JI6 K;  1HJO A;  4BG9 A;  3WT0 A;  2BTF A;  3J7Z O;  3DI6 A;  2G8K A;  4LF8 K;  4CEQ A;  4YOR A;  2PZS A;  4DQ8 A;  1RFQ A;  5GIN A;  5JVH L;  2RF2 A;  5DK5 A;  3TAF A;  4DTR A;  3NF7 A;  3OBW A;  4AH9 A;  3FZK A;  3S41 A;  2EWS A;  2IAJ A;  4DSL A;  4DV7 K;  4XEI A;  3U3G A;  4KKO A;  4IDK A;  3WNG A;  2QA4 N;  4CJ4 A;  1E4G T;  2YNG A;  2Z1I A;  3AVK A;  1YVU A;  2A6A A;  3VA0 A;  2OPP A;  3VTH A;  4JI0 K;  3B8A X;  2KTQ A;  4DTO A;  5CZ2 A;  1GLA G;  2DTU A;  1SZ2 A;  5AFU H;  2E4L A;  2GUP A;  1Z25 A;  3QEV A;  1W0H A;  1JCF A;  2P9N B;  3L2V A;  5BRD A;  3QET A;  4HVJ A;  4FWK A;  1MWM A;  1YVN A;  4KRE A;  2I5J A;  3DXM B;  1BIU A;  2HHH K;  3OTO K;  5C12 A;  1NKC A;  4Q5V A;  3ULE A;  3DYA A;  1JLC A;  5KRT A;  3CFR A;  2QW9 A;  4CEB A;  4LF5 K;  1K8A O;  2E2Q A;  2WFB A;  3VPZ A;  1KFD A;  5CYQ A;  4CFA A;  2O8D A;  3FFK B;  4LF4 K;  1RNH A;  3SV4 A;  3OS0 A;  4FWR A;  1U48 A;  1NK0 A;  2NRR A;  4E7I A;  3BEX A;  3WEE B;  4EZ6 A;  3MDQ A;  2KFZ A;  4DS5 A;  1TUU A;  1VQM N;  4NCB A;  1NKB A;  3SCX A;  3W3D A;  2WOM A;  2V52 B;  1BIS A;  2D0C A;  3MEC A;  3TTD A;  5DMR A;  1HX1 A;  2QKK A;  2PAV A;  1WAF A;  3C65 A;  5CY4 A;  1NK6 A;  1IO2 A;  1RTI A;  3CQ8 A;  3HYF A;  3NHG A;  3DLB A;  2FXU A;  4FZZ A;  1VQ9 N;  2Q0U A;  5GIO A;  1MA9 B;  3UKR A;  2HOE A;  4JI3 K;  4JRQ A;  1KLM A;  1TKX A;  4NCA A;  4MLE A;  2FSK A;  3TPQ A;  3QFP A;  4N56 A;  3GL1 A;  5EY4 A;  1NJY A;  1HKG A;  3GE1 A;  2BE2 A;  3UE5 A;  3LDP A;  4M3R A;  3MXI A;  4FK2 A;  2P9P A;  4PKH A;  3IFR A;  5JS2 A;  5GAD P;  4CD1 A;  2HF4 A;  1TUY A;  3RMD A;  3WNE A;  4FPA A;  5SWM A;  3QIC A;  4CGI A;  3SQ2 A;  3NGY A;  2P9I A;  1NJX A;  1KXP A;  4H5W A;  3VEO A;  4JKF A;  1TK5 A;  2WBN A;  4JKA A;  4DR2 K;  1A5X A;  3ZX0 A;  5F2R A;  1Q8I A;  4LSN A;  4GV3 A;  4LFA K;  4FCY A;  3ZSX A;  1M1K O;  3O1W A;  2V7Z A;  3ENH A;  1T7P A;  4C23 A;  3ZT3 A;  3KK1 A;  2QWP A;  4BC2 A;  1KAX A;  3KLH A;  5BRH A;  1M90 O;  2HST A;  1NGB A;  1Z6R A;  2GWK A;  1YI2 N;  3MN6 A;  5J2M A;  1U6Z A;  2D0O A;  2W6K A;  3VF6 A;  4BC3 A;  5FRM A;  4MLH A;  2E20 A;  3K0S A;  4JKD A;  3AGK A;  4FWP A;  4TSX A;  4DFM A;  3O08 A;  5ELZ A;  3VQD A;  4CJK A;  1RDD A;  3HL8 A;  4CZM A;  2HF3 A;  5HRP A;  4O0I A;  3SJJ A;  2QM1 A;  5J1E A;  1T03 A;  2QXF A;  1T3V A;  4CJT A;  1X3N A;  4KH4 A;  1Y97 A;  4LH4 A;  1IG9 A;  1DTQ A;  1DLO A;  3GBT A;  4ID5 A;  3FLC O;  4BE0 A;  4OVL A;  5KGX A;  3HOS A;  2GBZ A;  4CHN A;  1LV5 A;  1NK5 A;  4JKH A;  4CJE A;  1O13 A;  1RBT A;  1EWQ A;  4FWQ A;  3ULE B;  1SKR A;  3HPO A;  1X9J A;  2ITG A;  3LPU A;  5IT9 O;  3A5L C;  3NF9 A;  4KHQ A;  4Z94 A;  2I7N A;  1BG3 A;  2PY5 A;  1R59 O;  4C1N I;  4CJQ A;  2O8D B;  4LFC K;  3ALY A;  1HNW K;  2IIR A;  5C10 A;  4E1N A;  5FLX O;  3LAL A;  3IAY A;  4IFY A;  1KVB A;  4A61 A;  4FK0 A;  3CPE A;  4BY9 C;  1BIZ A;  1XC3 A;  2I7P A;  3QFU A;  4H0O A;  4R5P A;  2ZWH A;  1DKG D;  4DV0 K;  4IFV A;  3QER A;  2RE2 A;  3D45 A;  3VQP A;  4LSL A;  3CC4 N;  3G10 A;  1OH5 A;  1VSL A;  1EXQ A;  5HOO A;  2G8I A;  1D4X A;  4FLT A;  4I9Q A;  2P51 A;  3HBT A;  3BY5 A;  4CIF A;  1TKD A;  3VEZ A;  4CZF A;  3PSF A;  3O5B A;  4FJJ A;  3UKR B;  4M7Y A;  4N41 A;  3KK7 A;  3VTI A;  3HVT A;  1RDC A;  3PY8 A;  2P5G A;  3CCR N;  2BDP A;  2GUI A;  1TVR A;  3LP2 A;  4DUY K;  2QWR A;  2WC9 A;  1WLJ A;  2NNW A;  3T19 A;  3ATV A;  4KO0 A;  3TAN A;  4PHT X;  4A5B A;  3KZB A;  3H46 O;  2P9P B;  3PX4 A;  5GAG P;  1IG8 A;  4A2B A;  5HP1 A;  3KHY A;  2VG5 A;  4F4K A;  1VQ6 N;  2O8E A;  3CI5 A;  1WN7 A;  1IH7 A;  3KWI A;  4DUZ K;  2P9I B;  2ITM A;  3ZX3 A;  5BR8 K;  3G25 A;  3O3F A;  4FLV A;  4B1Z A;  4EZ9 A;  3CHW A;  3E9P A;  3ZYY X;  1X9M A;  3O1B A;  1UA1 A;  4E19 A;  1NGD A;  4PKG A;  1GLB G;  4CF9 A;  3PV8 A;  4Z4F A;  3U4L A;  3ZSZ A;  4XH4 A;  3CCS N;  1VSD A;  3AO3 A;  1HNZ K;  2QWL A;  3LP0 A;  3OYH A;  3HK2 A;  3PSI A;  4CFD A;  3PLA A;  3K57 A;  2DFF A;  1DGK N;  4MQ3 A;  3IRX A;  3OYF A;  1L3U A;  4RW8 A;  1WAJ A;  4RWT A;  1ASV A;  4DB3 A;  4EP4 A;  3A5O C;  2BH1 A;  3QIP A;  1ZYQ A;  5C15 A;  4JI5 K;  3L6Q A;  4CZH A;  1BCM A;  2OZS A;  3B6P A;  3FZL A;  1W97 L;  4AHS A;  3RR8 A;  2F96 A;  1S3X A;  1HKB A;  1RBV A;  5I42 A;  1MWK A;  3TTC A;  3CD6 N;  1SV5 A;  4CD3 A;  1VQ4 N;  4B3T K;  4KB1 A;  4BE1 A;  3T3F A;  1NK9 A;  4B1U B;  3O4N A;  3K5N A;  3IKM A;  1YF5 L;  2CH5 A;  5GAE P;  4X66 K;  4B08 A;  2UUC K;  1U04 A;  1E3M A;  3L0Q A;  4FWS A;  5AQV A;  4PL7 A;  1VQP N;  1KLN A;  4F3O A;  4B9T A;  3NVM A;  2V51 B;  3G0Z A;  5ADX A;  4BWM A;  2QK9 A;  4BRF A;  3C94 A;  3TSP A;  3MX2 A;  1EP4 A;  1W9H A;  3SUN A;  1K6Y A;  2VWK A;  4BR2 A;  2IVP A;  4O5F A;  4B1X B;  4M3U A;  2XY6 A;  1L5U A;  1RGI A;  3O6W A;  3VF4 A;  3AY9 A;  4C1N K;  1L3V A;  2CGK A;  2VYP A;  3LM2 A;  1BO5 O;  2W42 A;  3CCU N;  4WFB L;  4JRP A;  4H5T A;  3O3G A;  4BVO A;  4NLC A;  1LOT B;  3IMX A;  5M1O A;  2Q97 A;  1U49 A;  3CG7 A;  4BRN A;  1OH8 A;  4CED A;  4AF1 A;  5I9E B;  3OW2 M;  3SAG A;  2JWK A;  4KRF A;  4DSI A;  1YIJ N;  3MX5 A;  4KTQ A;  3OBY A;  2P5O A;  3AVJ A;  4CJU A;  4U67 L;  3H1V X;  4M45 A;  1CZ9 A;  4F8R A;  3LDN A;  1KD1 O;  2KKZ A;  1RDU A;  4FLY A;  3AVF A;  4M3T A;  4ELU A;  2HVH A;  1YHQ N;  4PWD A;  5KPZ A;  2O8E B;  4FLZ A;  4DTP A;  1OH7 A;  1N32 K;  1C1C A;  3U9Z A;  3HP6 A;  2KZZ A;  1VQO N;  3DXK A;  4ZTJ A;  4JK8 A;  1SKW A;  1UAX A;  3THW A;  2PBD A;  3WXL A;  3C7N A;  4DTS A;  2Q3S A;  2A40 A;  4CZL A;  3AA2 A;  3NAE A;  2GX9 A;  4DR3 K;  1EWR A;  4DTX A;  1UA0 A;  4M42 A;  4M3Y A;  3OS2 A;  4EAH D;  1IBK K;  1EET A;  3QES A;  1YXQ A;  3DLK A;  1GLD G;  2HBJ A;  3ZSO A;  4FWL A;  3MEE A;  4YOT A;  4KAZ A;  4DSE A;  1N6Q A;  3VQB A;  4BRE A;  4CES A;  3KD1 E;  1T6D A;  4X62 K;  3CIP A;  2OTJ N;  4A2A A;  1Q9X A;  3LDQ A;  3BP8 A;  1HLU A;  3EZW A;  2YHA A;  3KD5 E;  1RT4 A;  3LAN A;  3SBT A;  5JVG L;  2Q1N A;  4BRM A;  1NK4 A;  3SQ1 A;  1QQC A;  1V4T A;  2CH6 A;  2VWJ A;  1B9F A;  4CGH A;  4CHZ A;  4O8K A;  4WQ4 A;  3K58 A;  2IGI A;  1T8E A;  4BRQ A;  4DR4 K;  2FLO A;  4OGE A;  3VQ7 A;  1UWB A;  3E1Y A;  4XIU A;  3MAQ A;  4FJH A;  4HCB A;  1N33 K;  4FVU A;  5FDL A;  3TSQ A;  4H0Y B;  2UU9 K;  3AAP A;  4JHD A;  3OYL A;  5CYM A;  3CJ9 A;  3G6E N;  4N47 A;  2FBY A;  3V1R A;  3JS6 A;  3BZK A;  4BRH A;  3O8M A;  1QZ6 A;  2HVI A;  1WSF A;  2FBT A;  4WE1 A;  2IC3 A;  5HRS A;  1NGE A;  4LH5 A;  3NDK A;  3S3O A;  2Y1J A;  1RBR A;  3MMV A;  1J9A A;  4H0V B;  2E2O A;  3VQ6 A;  1TL1 A;  1G15 A;  1J54 A;  3OVN A;  3CQY A;  3DMJ A;  3R8E A;  3W0L A;  3J80 O;  4DV2 K;  1RBU A;  2GEM A;  3T69 A;  3TSU A;  2P9L A;  4LFB K;  2OPR A;  1WSJ A;  1HUX A;  3MK6 A;  4Z4H A;  4FJ7 A;  4DR6 K;  4E1M A;  4DQI A;  3OS1 A;  3K9K A;  4H0P A;  5LY3 A;  4IBN A;  2NRZ A;  2VGM A;  1ZXO A;  4EP5 A;  2ATQ A;  1Q86 O;  3I8B A;  3KLG A;  4C8L A;  4WCE L;  1NK7 A;  3KWG A;  4OPH A;  2UXD K;  4JKG A;  3TU5 A;  4E1J A;  4BRC A;  3SJH A;  2A42 A;  3OYB A;  1TGO A;  4IJA A;  4Z0U A;  3F9K A;  4B1W B;  2WON A;  2ZJP L;  4E3S A;  3P39 A;  1BGX T;  1VK0 A;  2QTD A;  3TTF A;  3PX0 A;  5F0X A;  4ELV A;  1C0T A;  3VER A;  1NU0 A;  3DXK B;  2D0B A;  4OLB A;  1SAZ A;  1JLB A;  5HBM A;  3NE6 A;  4IJN A;  5C2D A;  3HOT A;  1NWK A;  3THW B;  4E7K A;  4DLG A;  1BQM A;  3CM6 A;  3C7N B;  5J2Q A;  3ZEU A;  4GNI A;  3MWT A;  1OVY A;  1S1U A;  1HRH A;  3WXJ A;  4OKE A;  3CME N;  4CJV A;  4DTN A;  2FF6 A;  1U4B A;  3EO3 A;  1Z26 A;  1BQN A;  4CEF A;  3NGZ A;  1RTH A;  4FOI A;  3BZC A;  4J2E A;  4FJM A;  2HW3 A;  2HHX A;  4QAG A;  4CGJ A;  3O9S A;  5LMU K;  3D2E A;  4HCC A;  4DG1 A;  1XMO K;  1QZ5 A;  5KRS A;  4F3T A;  4CJS A;  5AQK A;  5DM6 L;  3KLF A;  5J2P A;  4NO7 A;  3RMB A;  4HHT A;  2UUB K;  4AM6 A;  3M3Z A;  4M41 A;  3DAW A;  3WUH A;  4CW7 B;  4DV5 K;  4KB0 A;  4MO4 A;  1NGC A;  5AQT A;  4IO9 L;  3SQ0 A;  1U2V A;  1HMV A;  5C2F A;  2P9S A;  3RRH A;  3QEI A;  1X3M A;  3CM5 A;  1NBW A;  1HQU A;  3CCJ N;  3CJC A;  3NH1 A;  2D5R A;  3M1F A;  3P4I A;  4C8N A;  3J8A A;  4K25 A;  3DLR A;  2RKI A;  3I8D A;  1NM1 A;  2J4R A;  4W5O A;  4MO5 A;  4YOV A;  1LWF A;  4WF9 L;  1T05 A;  1DTT A;  2H3G X;  1SQK A;  2NRT A;  5KTQ A;  3MXJ A;  3M6G A;  4FXD A;  2YHY A;  4CJF A;  4JHD B;  3VOV A;  4BDY A;  4CJP A;  4ICL A;  4K8X A; 
#chains in the Genus database with same CATH homology
 3CFO A;  3RMC A;  1L3T A;  4AHV A;  4CGG A;  2NUB A;  1L3S A;  4FZX C;  4FJJ A;  1KVA A;  2G8I A;  2HHU A;  2DFH A;  3KK3 A;  4N41 A;  2AJQ A;  2RPI A;  3LP1 A;  3HPG A;  1FKP A;  3HVT A;  1RDC A;  4CER A;  3HM9 A;  3K5O A;  2KFN A;  1JXB A;  2RN2 A;  3PY8 A;  1SUQ A;  2P5G A;  2B4J A;  3V9U A;  2BDP A;  2ZQB A;  2GUI A;  3NBP A;  1TVR A;  3LP2 A;  4B8C A;  3NCI A;  3RMA A;  1IKV A;  3DOK A;  3U6F A;  3V9W A;  1LW2 A;  4I2Q A;  3DOL A;  4ID1 A;  2IOC A;  1WLJ A;  2EX3 A;  3T1A A;  1R0A A;  3T19 A;  4E7L A;  3ZT4 A;  4KO0 A;  3TAN A;  4KHU A;  4CK2 A;  4CGF A;  2B6A A;  1XHX A;  4HUE A;  5J2N A;  3TAE A;  4FJ9 A;  4DWI A;  3LDS A;  3LP3 A;  4RW6 A;  4W5N A;  1WSH A;  4OPJ A;  3PX4 A;  3OYC A;  1VRT A;  5HP1 A;  4LD0 A;  1JL1 A;  2X6N A;  2VG5 A;  5D3G A;  4F4K A;  3SNN A;  1WN7 A;  3K59 A;  3V9S A;  4CEE A;  1VSE A;  4O4G A;  5EU7 A;  4CF8 A;  4ELT A;  2F8S A;  4CK1 A;  3KKS A;  1IH7 A;  1KCF A;  4BAC A;  1RT3 A;  5FRO A;  4FJI A;  4E89 A;  2YV0 X;  3VQ4 A;  2P1J A;  3O3F A;  1BI4 A;  4FLV A;  3OYE A;  3C6U A;  3QLH A;  1QSS A;  4EZ9 A;  2DY4 A;  1EKE A;  4FW2 A;  1HYV A;  2ZD1 A;  3ZSR A;  3HVR A;  1YT3 A;  1X9M A;  1UA1 A;  4E19 A;  2IDO A;  1TK8 A;  2KZM A;  4CF9 A;  3PV8 A;  4Z4F A;  3QIN A;  3RR7 A;  4FZY A;  1TKZ A;  5C25 A;  1RCH A;  1B9D A;  3TI0 A;  1S6P A;  3ZSZ A;  3ZT2 A;  1VSD A;  3AO3 A;  1D5A A;  3LP0 A;  4B3O A;  4CK3 A;  3KLI A;  3OYH A;  3HK2 A;  3DRP A;  5CZ1 A;  4QOZ B;  2Y1I A;  4DLE A;  4CFD A;  4E0D A;  3ZSQ A;  1XC9 A;  4M3Z A;  1BI4 B;  3V1O A;  1JLF A;  1GOC A;  3K57 A;  4HUF A;  3HJF A;  3AVC A;  1TL3 A;  3ZSV A;  3EY1 A;  3AO5 A;  3JYT A;  1VRU A;  2DFF A;  4MQ3 A;  3NGI A;  4FLW A;  3IRX A;  3OYF A;  3CFP A;  1O1W A;  4RW8 A;  1L3U A;  4FJX A;  4KPY A;  1WAJ A;  1VSM A;  1ASV A;  1J5O A;  4FLU A;  3KTQ A;  2XO7 A;  2A1R A;  4OLA A;  4CEO A;  4FW1 A;  2OPQ A;  4CFB A;  4EP4 A;  3DLH A;  4I7F A;  2FBX A;  1IKW A;  3QIP A;  4RW9 A;  1ZYQ A;  2JLE A;  1XI1 A;  1XWL A;  1ZBI A;  2Z1H A;  2ETJ A;  2XHB A;  2HNZ A;  1U45 A;  1S1V A;  3AO2 A;  3V6D A;  1I3A A;  1BCM A;  3VQ8 A;  1JL2 A;  4DS4 A;  2OZS A;  4FJL A;  1WSE A;  2YKM A;  4DTM A;  3TAG A;  3AVL A;  5K14 A;  3B6P A;  4BWJ A;  3DRS A;  4AHS A;  4Z4G A;  4GW6 A;  4Z4E A;  3SPZ A;  1HNV A;  3RR8 A;  2QKB A;  3K2P A;  3S9H A;  2F96 A;  1KVC A;  4DF8 A;  3MEG A;  1QE1 A;  1RBV A;  5I42 A;  2F8T A;  3HO1 A;  4CJW A;  1SV5 A;  1LV5 A;  1CXQ A;  3SYZ A;  1IKY A;  4G1Q A;  1S9E A;  3SPY A;  3S3N A;  3M8Q A;  4BE1 A;  1KTQ A;  3T3F A;  3AVB A;  1NK9 A;  4KB1 A;  1CLQ A;  1UOC A;  3O4N A;  4Z4C A;  3K5N A;  4H4O A;  3VQ9 A;  4PA1 A;  3JSM A;  1BHL A;  4PQU A;  4YNQ A;  4ZHR A;  4CHY A;  2R7Y A;  1A5V A;  2G8V A;  1EX4 A;  1ASW A;  2IS3 A;  4RW4 A;  3WNH A;  1U04 A;  3ASM A;  4B08 A;  4E7J A;  3RRG A;  1ZBL A;  4F3O A;  1HPZ A;  3EZ5 A;  4JS4 A;  1KLN A;  4B9T A;  1GOB A;  4AHC A;  1B92 A;  3G0Z A;  1LWE A;  4CFC A;  4B8A B;  4C8K A;  2BAN A;  1LWC A;  2XRI A;  4BWM A;  3QNO A;  4BDZ A;  1D9F A;  3MED A;  4Z4I A;  2QK9 A;  1JKH A;  3C94 A;  4CJ3 A;  3TAP A;  1EP4 A;  4Y1C A;  1W9H A;  3SUN A;  1K6Y A;  2VWK A;  4CHO A;  1SL2 A;  4KHW A;  3K5L A;  3HT3 A;  1TAU A;  3V9Z A;  2OA8 A;  3VN5 A;  3VQ5 A;  2G8U A;  1VSK A;  2GV9 A;  1F21 A;  2HW3 A;  4M3U A;  1BL3 A;  2XY6 A;  2G8W A;  1L5U A;  1RIL A;  3HPH A;  5HLF A;  2HHQ A;  1HQE A;  3OYD A;  1C1A A;  5KI6 A;  3DRR A;  3F73 A;  4J2A A;  4FJ8 A;  4BE2 A;  1L3V A;  4CHQ A;  3SV3 A;  2W42 A;  4JRP A;  1RT5 A;  1S9G A;  4AHR A;  3OYA A;  4UQG A;  3VQA A;  1TKT A;  2HND A;  3O3G A;  4AIL C;  1NK8 A;  4B9L A;  1JLE A;  3I0R A;  4KTW A;  4IG0 A;  4LY7 A;  4CJL A;  1D8Y A;  4O44 A;  1XHZ A;  4DSJ A;  3NFA A;  1X9W A;  4W5T A;  3LWL A;  1U49 A;  3CG7 A;  4CED A;  1HJR A;  4FJ5 A;  3CYM A;  3HST B;  3OYI A;  3MXM A;  2XY8 A;  2O4I A;  4B9U A;  2O4G A;  4KTZ A;  3BGR A;  4MFB A;  3ITH A;  3NH0 A;  1D9D A;  4KRF A;  2YNI A;  2KQ2 A;  4DSI A;  2YNH A;  3ISN C;  3VQQ A;  1X1P A;  4FJK A;  2X6S A;  4KTQ A;  3DM2 A;  1J53 A;  3K5M A;  2Z1J A;  4YFU A;  2HHT A;  2P5O A;  4GVM A;  3DI6 A;  2G8K A;  3AVJ A;  4CEQ A;  4CJU A;  2PZS A;  4DTJ A;  2RF2 A;  4DFP A;  5DK5 A;  3TAF A;  1JLG A;  4DTR A;  4M45 A;  3NF7 A;  1CZ9 A;  3LWM A;  4AH9 A;  4F8R A;  4DSF A;  3L3U A;  4H4M A;  1VSH A;  4FLY A;  4CEA A;  1C0U A;  3AVF A;  1MU2 A;  4CIE A;  1JLQ A;  1ZBH A;  2IAJ A;  4M3T A;  4DSL A;  4F2S A;  4RG8 A;  3U3G A;  4W5Q A;  4ELU A;  1ZBF A;  4PWD A;  4KKO A;  2HVH A;  4IDK A;  3WNG A;  1LAV A;  4CJ4 A;  4KHS A;  4FLZ A;  4DFK A;  2YNG A;  2Z1I A;  2X78 A;  4DTP A;  3AVK A;  1YVU A;  1C1C A;  3AVI A;  3VA0 A;  2OPP A;  3HP6 A;  4HTU A;  3NH2 A;  2KZZ A;  3LZJ A;  4N76 A;  2HHV A;  1RT2 A;  4ZTJ A;  4B9S A;  1RTD A;  3ZSW A;  2KTQ A;  4DTO A;  5CZ2 A;  1SKW A;  1UAX A;  2DTU A;  1NJW A;  1FXX A;  4NCG A;  3QEP A;  3ZCM A;  3AA4 A;  4NYN A;  2E4L A;  2Q3S A;  4DTS A;  1C0M A;  4DQR A;  4DU4 A;  3AA2 A;  4FM1 A;  1Z25 A;  4FVM A;  3QEV A;  2Z1G A;  5T7B A;  3NAE A;  1W0H A;  3HP9 A;  1JLA A;  1KFS A;  3L2V A;  1S6Q A;  4DTX A;  3QET A;  1UA0 A;  3P1G A;  1CXU A;  4M42 A;  4M3Y A;  4HVJ A;  3P5J A;  3OS2 A;  1IG9 A;  4ZTF A;  1EET A;  3QES A;  3SUO A;  3AVG A;  4KRE A;  2I5J A;  3DLK A;  1VSF A;  1BIU A;  3ZSO A;  3AVN A;  3MEE A;  1NKC A;  4Q5V A;  4KAZ A;  4DSE A;  2PYL A;  2VG6 A;  1N6Q A;  5C24 A;  2E6M A;  2OPS A;  1JLC A;  3DYA A;  3VQB A;  4BDP A;  4CES A;  2OZM A;  3C6T A;  3OYG A;  2DFE A;  3OJS A;  2OYQ A;  5KRT A;  3KD1 E;  2G8H A;  3TAQ A;  1Q9Y A;  3CFR A;  4IKF A;  4DF4 A;  3AVH A;  1IKX A;  3A2F A;  4CEB A;  3SUP A;  1Q9X A;  1QTM A;  4J2B A;  4DMN A;  1C1B A;  1RTJ A;  3LPT A;  1S5J A;  1VSI A;  1KFD A;  5CYQ A;  3V1Q A;  4CFA A;  2YHB A;  2YHA A;  3SQ4 A;  3ZT1 A;  1RT4 A;  2LSN A;  1RNH A;  3QNN A;  3V4I A;  3KD5 E;  3LAN A;  4O0J A;  3LAM A;  3SV4 A;  3OS0 A;  4FYD A;  4KI4 A;  1RDB A;  4H8K A;  1U48 A;  2YKN A;  5C42 A;  1NK0 A;  4E7I A;  1NK4 A;  3SQ1 A;  1QQC A;  4CE9 A;  2HNY A;  3AO1 A;  4FLX A;  1KRP A;  4B9V A;  4EZ6 A;  2VWJ A;  5E41 A;  5KGW A;  3RTV A;  5JS1 A;  1TV6 A;  1WNS A;  1GOA A;  4DS5 A;  1RT6 A;  4NCB A;  4CEZ A;  2KFZ A;  1B9F A;  4CEC A;  4CGH A;  4CHZ A;  3SCX A;  1NKB A;  5I3U A;  2WOM A;  5HRN A;  3K58 A;  2IGI A;  1T8E A;  4M3W A;  4OGE A;  3VQ7 A;  1UWB A;  3MAQ A;  4XIU A;  4FJH A;  1BIS A;  4L8R B;  2D0C A;  3MEC A;  4HCB A;  3O3H A;  5DMR A;  5FDL A;  2QKK A;  4KFB A;  1NK6 A;  1WAF A;  2A1S A;  5CY4 A;  1IO2 A;  1RTI A;  3CQ8 A;  3QO9 A;  3OYL A;  3L2U A;  3HYF A;  4O55 A;  5CYM A;  3NHG A;  3DLB A;  4N47 A;  4FZZ A;  3H08 A;  2FBY A;  4KHY A;  3TAM A;  4CCH A;  4PY5 A;  1TK0 A;  3V1R A;  3V9X A;  3DLE A;  4DQP A;  2HHS A;  2HVI A;  1FKO A;  1WSF A;  1I39 A;  3D0P A;  1VSJ A;  2FBT A;  4WE1 A;  2IC3 A;  3TR8 A;  5HRS A;  4LH5 A;  3TWH A;  4Y1D A;  3L2R A;  4JRQ A;  3WNF A;  1CZB A;  4RW7 A;  1KLM A;  3AA3 A;  3NDK A;  3ULD A;  3TAB A;  1TKX A;  3S3O A;  4NCA A;  2Y1J A;  1RBR A;  3ZT0 A;  1J9A A;  4AHT A;  4N56 A;  4DSK A;  4DQS A;  3VQ6 A;  2FC0 A;  4N5S A;  1TL1 A;  1KSP A;  1G15 A;  1J54 A;  3OVN A;  3AVA A;  4I2P A;  1NJY A;  1SKS A;  3DMJ A;  2HMI A;  3KK2 A;  2B5J A;  1ITG A;  2BE2 A;  4M3R A;  4DTU A;  4FK2 A;  3MXI A;  1RBU A;  4B9M A;  3VQE A;  2KW4 A;  4B9N A;  3UIQ A;  5JS2 A;  1S1W A;  3AV9 A;  3NF8 A;  1NOY A;  2HB5 A;  1HNI A;  2OPR A;  1WSJ A;  4C8M A;  1SL1 A;  4Z4H A;  3RMD A;  3WNE A;  4FJ7 A;  3L8B A;  4E1M A;  4DQI A;  1LW0 A;  3OS1 A;  5SWM A;  3KJV A;  4CGI A;  3SQ2 A;  3NGY A;  5FRN A;  1HYZ A;  1WSI A;  4IBN A;  2PYJ A;  5HRO A;  1NJX A;  4EP5 A;  2ATQ A;  1ASU A;  1S1T A;  3KLG A;  3KLE A;  3QEW A;  1TK5 A;  4C8L A;  3KKR A;  1NK7 A;  1NKE A;  4KHN A;  3IG1 A;  4JLH A;  3S3M A;  3THV A;  3OJU A;  1A5X A;  1A5W A;  2ZE2 A;  4OKK A;  4CF2 A;  4OGC A;  1Q8I A;  4LSN A;  3PUF A;  1RDA A;  4FCY A;  4DFJ A;  4HUG A;  3ZSX A;  2EHG A;  3OYB A;  3I0S A;  1TGO A;  4Z0U A;  3L2Q A;  4JS5 A;  1HYS A;  3F9K A;  1T7P A;  3QIO A;  3ZT3 A;  3SI6 A;  3KK1 A;  1RBS A;  3M8P A;  4FJN A;  3AA5 X;  2WON A;  4C8O A;  3KLH A;  4E3S A;  4K8Z A;  4OJR A;  1BGX T;  1VK0 A;  3PX0 A;  1QS4 A;  4AHU A;  3NF6 A;  3LAK A;  5J2M A;  4FXD A;  1QHT A;  1WSG A;  4ELV A;  1C0T A;  2YNF A;  4OKJ A;  4CJR A;  3LZI A;  4E7H A;  1X9S A;  5FRM A;  1LAW A;  2D0B A;  1RT7 A;  4OLB A;  1JLB A;  5HBM A;  3NE6 A;  5HRR A;  4TSX A;  3OYJ A;  3M8S A;  3EYZ A;  4OPK A;  4E7K A;  4DFM A;  4DLG A;  3VQD A;  4CJK A;  2G8F A;  1RDD A;  4I9L A;  1BQM A;  3HL8 A;  3CM6 A;  5J2Q A;  4CHP A;  5HRP A;  4O0I A;  3OYM A;  1S1U A;  1HRH A;  3SJJ A;  4OKE A;  5J1E A;  2QXF A;  4CJ5 A;  1T03 A;  4CJV A;  4CJT A;  4DTN A;  3C95 A;  1U4B A;  3OYN A;  1Y97 A;  4LH4 A;  3U3Y A;  1DTQ A;  1BQN A;  1Z26 A;  1DLO A;  3L3V A;  1RTH A;  2FBV A;  4ID5 A;  4CEF A;  3NGZ A;  4J2E A;  4BE0 A;  4FJM A;  4OVL A;  4KI6 A;  4QCL A;  4QAG A;  5KGX A;  4CGJ A;  3PO5 A;  2HHX A;  3L2W A;  3OYK A;  1QSY A;  4HCC A;  2GBZ A;  4DG1 A;  4CHN A;  1RT1 A;  3ZSY A;  3B6O A;  3SZ2 A;  1NK5 A;  3VA3 A;  4CJE A;  5KRS A;  1RBT A;  3PO4 A;  1NJZ A;  4F3T A;  4CJS A;  4FK4 A;  3P83 D;  3DLG A;  1JXE A;  3IS9 A;  2VG7 A;  3SUQ A;  1SKR A;  2JGU A;  3HPO A;  4FM2 A;  3E01 A;  4F2R A;  3KLF A;  3FFI A;  5J2P A;  3M8R A;  2ITG A;  3RMB A;  4M3X A;  3LPU A;  1TAQ A;  4HHT A;  1N5Y A;  3NF9 A;  1SL0 A;  4M41 A;  4W5R A;  4GMJ B;  4KHQ A;  4KB0 A;  4DQQ A;  2X74 A;  3PX6 A;  4PUO A;  2PY5 A;  1ZBU A;  3SQ0 A;  4CJQ A;  4CF0 A;  3AVM A;  4CF1 A;  4Q0B A;  1HMV A;  3ALY A;  1YTU A;  1BCO A;  3RRH A;  2XY5 A;  1U47 A;  1C6V A;  4CIG A;  3OY9 A;  2E6L A;  4E1N A;  4DU3 A;  3KIO A;  3QEI A;  3CM5 A;  3LAL A;  1HQU A;  3IAY A;  2HHW A;  4IFY A;  1KVB A;  4NYF A;  3NH1 A;  2D5R A;  3TAR A;  4FJG A;  1QSL A;  4FK0 A;  4J2D A;  1S1X A;  4C8N A;  1BIZ A;  4DU1 A;  4R5P A;  3DLR A;  2RKI A;  3I8D A;  4CGD A;  2D0A A;  4IFV A;  4W5O A;  3QER A;  3QEX A;  3V81 A;  1LWF A;  3D45 A;  1T05 A;  3VQP A;  1DTT A;  4LSL A;  2XY7 A;  3G10 A;  5KTQ A;  4KV8 A;  1VSL A;  1EXQ A;  1FK9 A;  3AO4 A;  3MXJ A;  3O4Q A;  4O5B A;  4IG3 A;  5SZT A;  3HXM A;  4FLT A;  3VQC A;  4CJF A;  3BDP A;  3RWU A;  4I9Q A;  1REV A;  1NOZ A;  2P51 A;  2BGG A;  1YTA A;  4BDY A;  4CIF A;  4FM0 A;  4CJP A;  4ICL A;  1TKD A;  4K8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...