2XRIA

Crystal structure of human eri1 exoribonuclease 3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
206
Chain Sequence
NLYFQSMSFPPQRYHYFLVLDFEATCDKQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERI1 EXORIBONUCLEASE 3
publication title Crystal Structure of Human Eri1 Exoribonuclease 3
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 206
sequence length 207
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xriA01
3PUFA 3K2PA 2ITGA 4RW6A 1RBVA 4ICLA 1S6QA 1MU2A 4FLUA 5I42A 4F4KA 4Z4CA 4FK4A 1QQCA 3SQ0A 4E1NA 4OLBA 1FK9A 3LP3A 4O5BA 3HT3A 4DTOA 1JLCA 4M41A 1GOAA 3AVAA 2B6AA 4Z0UA 3JSMA 3T19A 3OS0A 1B92A 1C0MA 4CEDA 4E7IA 2ZD1A 4I2QA 4IFVA 3SJJA 3QIOA 1C1BA 3MXMA 4R5PA 4FXDA 4CEEA 3FFIA 3TWHA 3ZT3A 2P5GA 4BWMA 3L2RA 1KVBA 4JS5A 4CJEA 4KHWA 3CFOA 4B8AB 3K5OA 2HNDA 4JRPA 4N56A 1HQUA 1S1VA 4CECA 3ZT2A 4IG3A 1LW2A 3AO2A 2HHTA 3RR8A 2G8IA 4KI4A 4E1MA 3OYFA 4PQUA 1SV5A 3M8PA 3ALYA 1VSJA 3MEGA 3MECA 4AH9A 4HHTA 3SCXA 1W0HA 4QAGA 1BCMA 3B6OA 1A5XA 4KB0A 4IDKA 1XHZA 1JLFA 3KLEA 3SI6A 2VG6A 1VRUA 4CEQA 2P1JA 1ITGA 3K5LA 3HXMA 4CCHA 1C1CA 1QSLA 3OJSA 4CF8A 4FJJA 4CGHA 2HHSA 2D0BA 4CGGA 3PX6A 3TI0A 2PYLA 4AHUA 1O1WA 2Z1HA 2FBYA 3NCIA 3KK3A 1VSHA 3CQ8A 2IDOA 3QLHA 4CHQA 1TGOA 1U47A 1GOCA 4M3WA 3OYKA 4BDPA 4OKJA 2IGIA 4OPJA 1NKBA 2PYJA 3BDPA 3VA0A 1NK9A 1LV5A 1WSIA 1RDCA 3OYAA 3QEVA 4CJQA 3SPYA 1YVUA 3V9WA 1ZYQA 1T8EA 3KK2A 3CFRA 1RNHA 2YHAA 4CJLA 4O55A 2R7YA 1D9DA 2EX3A 3WNGA 3OVNA 2JGUA 1BIUA 4DQRA 1YTUA 4RW8A 2VG7A 2JLEA 3DRRA 4NCBA 4Z4FA 4G1QA 2HHXA 4FLYA 2DTUA 3MAQA 3KD5E 1XI1A 1X9MA 4FLXA 1NK7A 3F73A 5E41A 1BQNA 3C6UA 4CFDA 1N5YA 4IFYA 1KVAA 3ZSVA 3KLHA 1X1PA 4AHRA 2KFNA 3M8QA 1CXQA 3SQ1A 3NHGA 1FXXA 2OPRA 2Z1GA 4FZZA 2HHQA 1FKPA 5DMRA 5CZ2A 4HUGA 2FBVA 1XWLA 1SKWA 4N41A 1NOZA 4NYNA 4FLZA 1XHXA 1KSPA 2IAJA 1CLQA 4O0JA 4C8LA 3A2FA 4LY7A 4FLTA 3SYZA 4ZHRA 3AVHA 3ZSQA 4CJTA 3OYNA 4CJSA 1IH7A 1ZBUA 3QEPA 2X6NA 4RW7A 2HW3A 1NJWA 3AVBA 1UWBA 1S1WA 3DLBA 3E01A 3AO5A 4FJMA 3WNFA 3EY1A 2YNHA 1VSKA 3LAMA 1S9GA 1RDBA 2OPQA 4DTSA 1JLEA 5DK5A 3QEXA 2W42A 1VSEA 4OKKA 3VQBA 3AA4A 3HJFA 1VSMA 1IO2A 3DOKA 1WSJA 4LH5A 1C1AA 3MEEA 4ID5A 3VQ9A 4CEFA 4DFKA 4EZ6A 4FJ7A 3QEWA 5K14A 4E7HA 4K8XA 5HROA 3HPHA 3TAGA 1U48A 3K58A 3PY8A 4FW1A 4ID1A 3NFAA 4FCYA 3LPUA 4DFJA 4CEZA 2F96A 3C95A 3VA3A 2G8FA 1RT2A 4J2AA 1HQEA 1RCHA 1U04A 1Q9YA 4B9SA 2YNFA 3OYBA 4GMJB 2D0AA 4FJNA 1ZBHA 4AHCA 2DFEA 2YNGA 1HRHA 4I9LA 4DTUA 1JL1A 1HYZA 1RT1A 2RPIA 3OJUA 2HVHA 2PY5A 4CGJA 1RT6A 1XC9A 1WN7A 4E7KA 1WNSA 1S6PA 2YV0X 3TR8A 4AILC 3HYFA 1LAVA 4DTJA 3KTQA 4CF1A 4I9QA 4PWDA 2KTQA 4KTZA 4KREA 3PO5A 3VQPA 3ZSXA 3ZSYA 2YKMA 4HUFA 3OS1A 1RTHA 1C0TA 5KGWA 3U3YA 4KTWA 3CM6A 3AA5X 3PX4A 4CHYA 3SUQA 3NH1A 3MXIA 2BGGA 3ZSWA 2VG5A 4PY5A 3IG1A 1WSHA 2O4GA 4CFBA 3IRXA 3TAFA 2DFFA 4J2BA 4M3UA 4GW6A 4FZYA 2G8VA 3HM9A 4EP4A 3VQDA 4KFBA 4OPKA 4W5RA 4HVJA 4CJVA 4E7LA 1KVCA 3AVFA 1G15A 3WNEA 5KTQA 4DTNA 3TARA 2HVIA 1NKCA 1TK5A 3P1GA 4KRFA 3CFPA 4RW9A 2F8SA 3ZSZA 1YT3A 4DU3A 1RTIA 3RMBA 1RDAA 3AV9A 4CIEA 2Q3SA 3C94A 2Z1IA 4CEOA 2Y1JA 3MEDA 4OGCA 1BIZA 4ELUA 4OVLA 3H08A 3ISNC 3QINA 3I0SA 3SV4A 1WSFA 4DS5A 1C0UA 1DTQA 1KLMA 1ASUA 2IC3A 4DMNA 4CK3A 3QNNA 5HLFA 1D9FA 3CM5A 1EX4A 3QIPA 4C8MA 3IAYA 3QESA 4DLGA 3V9UA 4LD0A 4M45A 4E3SA 3DOLA 1JXBA 4DSLA 4CK2A 5C25A 2G8KA 4M3XA 2P51A 4FW2A 3QNOA 1A5WA 1LW0A 1BGXT 3T3FA 1NK4A 3CG7A 3AVLA 3LPTA 4CF2A 2GBZA 1L3UA 4NCGA 1SKRA 4F2RA 4DFPA 4FJIA 1UA1A 3O4QA 3OYHA 3AVMA 1NJXA 1KFDA 4FJ8A 1X9WA 1KFSA 1BHLA 2VWKA 3SZ2A 4Z4IA 4B8CA 4CIFA 4BE0A 1RBUA 4CJ4A 5D3GA 1HYSA 1VSLA 3HO1A 3QERA 2KFZA 1JL2A 3LWMA 2E6LA 2HNYA 4DSIA 4CHZA 4HTUA 2DFHA 4ZTJA 1N6QA 4AHTA 3O3GA 4RG8A 1RDDA 4CERA 5KRTA 1TAUA 1X9SA 2Y1IA 4UQGA 3TAPA 3I8DA 3TAMA 4Z4EA 3LWLA 1SL2A 4DF4A 3KKSA 3VQCA 3EZ5A 2FBXA 1LWEA 3NGYA 5HRSA 1QHTA 5JS2A 1R0AA 4M3TA 4BWJA 1SL0A 3DLRA 2XY6A 4IG0A 4LSNA 3NDKA 4DQIA 3S3NA 1TL1A 4BDZA 3AO4A 3VQEA 4QCLA 3I0RA 2QK9A 4O44A 3LALA 3QO9A 4B9LA 1UOCA 1WAJA 4CK1A 4KHSA 3V1RA 3LAKA 1NK0A 1C6VA 2HB5A 4FJGA 3RRGA 5KI6A 1B9FA 3OYLA 4DQPA 2YHBA 4W5TA 4JLHA 5HBMA 5I3UA 1NJYA 3SUNA 4DTMA 2E4LA 1ASWA 3OYGA 3AVNA 1D8YA 4B9UA 1BQMA 1HYVA 3NF6A 4DG1A 4CE9A 4Y1CA 1ZBFA 4W5OA 1LAWA 3V4IA 3PO4A 4EZ9A 3NH0A 3ITHA 3ASMA 3SNNA 2X78A 4FM1A 1Z26A 4KO0A 4CJUA 4DQQA 3AVJA 5T7BA 4OJRA 3CYMA 3KLIA 1WAFA 1NKEA 2ATQA 4BE2A 3QETA 3RMDA 4F8RA 4N76A 4CHPA 2YKNA 4FJKA 3JYTA 2KZMA 1S1TA 1U4BA 3SQ2A 4I7FA 4B08A 4K8ZA 4DU1A 2F8TA 2OPSA 3IS9A 4H4MA 4CF0A 4KKOA 5J2PA 1NOYA 3VQAA 1TL3A 2XO7A 4BDYA 5KGXA 2QKKA 3KD1E 1TVRA 4IKFA 3DRSA 3D0PA 3TAQA 2DY4A 2B5JA 4F3TA 3KLFA 1VK0A 3THVA 2RKIA 4W5NA 4KV8A 5CYQA 3S3OA 1QSSA 3DYAA 3RTVA 3B6PA 1T03A 3AO1A 4E0DA 2WOMA 1JKHA 2HNZA 3KJVA 3NH2A 3SPZA 3DLEA 1FKOA 1D5AA 5J2QA 1RBRA 3LZJA 4HUEA 4DLEA 2A1RA 5C42A 2HHVA 1BISA 2I5JA 4HCCA 3AVCA 3L2QA 3L8BA 3V81A 4FK2A 4KB1A 3AVGA 3VQQA 4DFMA 5KRSA 1HPZA 5FRNA 4DSEA 4KHUA 3S3MA 2ETJA 1DTTA 4OLAA 2RN2A 3RMCA 4I2PA 1U45A 4OGEA 3ZT4A 2OA8A 2QKBA 4EP5A 3OYCA 2VWJA 2WONA 3DLHA 4NCAA 1BI4A 3AVIA 5J2MA 3SUOA 1J9AA 3RWUA 4E19A 1UAXA 3VQ7A 4N5SA 4W5QA 1EP4A 1BI4B 1HJRA 3L3UA 4BE1A 1JLQA 4Z4GA 4CJWA 1F21A 3NE6A 5EU7A 1RTJA 4C8NA 3VQ4A 3V1OA 4CHNA 1KRPA 1L3VA 1U49A 4J2DA 1ZBIA 3BGRA 3KIOA 3SQ4A 3G10A 3NF8A 4CGDA 5CY4A 2KW4A 3EYZA 1TAQA 2G8WA 1TK0A 3NGIA 4GVMA 4DTRA 1J5OA 5J1EA 1VSDA 1T05A 5HP1A 1KTQA 4IBNA 1ASVA 4ELVA 4Q0BA 3OYIA 4FM2A 1WLJA 4FLWA 1CZBA 4CF9A 2X74A 4E7JA 4CJKA 3LANA 1HNVA 3QEIA 1S5JA 4CGIA 4O0IA 1NJZA 4QOZB 4KAZA 3ZCMA 3D45A 1A5VA 4CFCA 1UA0A 4C8KA 1J54A 1J53A 4DF8A 3L2VA 4Q5VA 3K5NA 4CGFA 1NK8A 2HHUA 2Z1JA 3TAEA 1KLNA 3ZT0A 4CJ5A 3NAEA 2B4JA 1TV6A 2PZSA 4FJ9A 3OYMA 2OZSA 1TKZA 2QXFA 1RT4A 2D0CA 3LP2A 1RILA 4DSFA 1WSEA 3KKRA 3NF7A 4CEBA 1ZBLA 4FK0A 3O4NA 1Q9XA 1QE1A 2FC0A 1CXUA 3LZIA 1Q8IA 3C6TA 1S9EA 1IKYA 1VSIA 3AVKA 1NK6A 4JRQA 3U6FA 2G8HA 4B9NA 4C8OA 1BL3A 1LWCA 4E89A 1K6YA 3HP6A 1T7PA 4MFBA 2P5OA 2LSNA 2IS3A 3LP0A 3DM2A 3DMJA 4AHVA 5SWMA 1WSGA 1QTMA 3OYEA 3ZT1A 2AJQA 1VRTA 4MQ3A 2OYQA 4HCBA 5FRMA 4O4GA 5CZ1A 3KK1A 4YNQA 1RBTA 4RW4A 3K59A 2O4IA 1B9DA 4KHQA 3L2UA 2KQ2A 3OY9A 3HSTB 2ZQBA 1EKEA 3HK2A 3T1AA 2XHBA 4M3RA 4J2EA 4FJ5A 4DS4A 4M3YA 1L3SA 4B9MA 1EXQA 3P5JA 4CHOA 3AA2A 1JXEA 2EHGA 3DLGA 4LSLA 4FYDA 3M8SA 2X6SA 1JLBA 1SUQA 5JS1A 4FVMA 4CESA 5C24A 3OYDA 5CYMA 3M8RA 2XY8A 4TSXA 3P83D 4Y1DA 3HVTA 4PA1A 4M42A 2ZE2A 3SUPA 2HMIA 3F9KA 3MXJA 4FJHA 1QS4A 1Y97A 4KHNA 1LWFA 3VQ5A 4CJ3A 3HP9A 1BCOA 5SZTA 3ULDA 2XY7A 3U3GA 3O3FA 2IOCA 1EETA 2OPPA 5HRNA 3DI6A 4CJPA 3NGZA 4BACA 3V9ZA 3O3HA 1JLGA 2FBTA 3S9HA 2BE2A 4XIUA 2KZZA 4CJRA 1L3TA 4H4OA 4CIGA 4DQSA 3SV3A 1RT5A 1TKDA 4DSJA 3G0ZA 1IKVA 3ZSRA 3TANA 2D5RA 4L8RB 4AHSA 1RTDA 4DTXA 3WNHA 3L3VA 4DSKA 3PX0A 3AA3A 3DLKA 1GOBA 3TABA 4FJLA 2YNIA 1REVA 4Z4HA 4FJXA 2BDPA 4FZXC 3HPOA 1SKSA 1JLAA 3LDSA 1TKTA 2XY5A 2E6MA 5J2NA 3V9SA 2HHWA 1I3AA 3PV8A 4B9TA 3NF9A 4H8KA 4F3OA 1CZ9A 1DLOA 3UIQA 4B3OA 3DRPA 4CEAA 2RF2A 3RRHA 4B9VA 1IKXA 3K5MA 4M3ZA 4YFUA 1YTAA 3ZSOA 3HVRA 1Z25A 1HMVA 4DTPA 4JS4A 1RT3A 4OKEA 4FLVA 3RMAA 2XRIA 1NK5A 3VQ8A 3VN5A 4ELTA 4KHYA 4CJFA 4N47A 1TKXA 4WE1A 5FDLA 1S1UA 1VSFA 4NYFA 3OS2A 3RR7A 5HRPA 1KCFA 2NUBA 2GUIA 1HNIA 3K57A 1QSYA 2G8UA 1IG9A 3KLGA 4DU4A 2OZMA 4DWIA 1IKWA 4KPYA 4LH4A 1S1XA 2BANA 3HL8A 4KTQA 4PUOA 3AO3A 1RBSA 2GV9A 3LP1A 1RT7A 4F2SA 4KI6A 1I39A 1SL1A 3HPGA 3NBPA 3L2WA 3OYJA 3V9XA 1L5UA 3V6DA 4ZTFA 3VQ6A 1TK8A 5HRRA 5FROA 1W9HA 4CFAA 2A1SA 4FM0A 3V1QA
chains in the Genus database with same CATH superfamily
3VTHA 3LDOA 3PUFA 3K2PA 4ICLA 3NVMA 3CMAN 4FLUA 4F4KA 4IJNA 4GKJK 1QQCA 2GWKA 3G4SN 1FK9A 3LP3A 2D0PA 5AQRA 4AF1A 3LDQA 2B6AA 3OS0A 2A41A 4E7IA 4DV4K 3MXMA 4CZLA 5AQFA 5AQPA 3ZT3A 4BWMA 1KVBA 1K8KA 3CFOA 1YIJN 1JJ2M 3FFKB 2HNDA 3H46O 3SAFA 5BRDA 2QWNA 3RR8A 3OYFA 4PQUA 1RFQA 2F9WA 1VSJA 4HHTA 4AH9A 3SCXA 1IBKK 1W0HA 1BCMA 3H1VX 4KB0A 4DR4K 1XHZA 3KLEA 3J7AP 4CEQA 2P1JA 3DWLA 4YOYA 5AQUA 3K5LA 4BRLA 3J81O 3OJSA 4FJJA 2VGMA 1O1WA 1VSHA 1ATRA 2IDOA 4ISEA 3SLCA 4EAHD 3A0IX 3T7ZA 3BDPA 2NRWA 4QOZB 4H0XB 1YVUA 1T8EA 2ZGZA 3MWPA 4CJLA 2EX3A 3WNGA 3OVNA 2JGUA 4RW8A 2VG7A 3DRRA 3DXKA 4DHYA 1U2VA 4Z4FA 3WXJA 4CBXA 3KD5E 3F73A 3VENA 5AQIA 1KVAA 5FLXO 3O1BA 4CD1A 3M8QA 1CXQA 3SQ1A 2OPRA 2HHQA 1IBLK 5DMRA 5LMUK 1XWLA 4N41A 4FLZA 4BR2A 3P31A 5JVGL 2QI2A 1CLQA 2W6LA 3MMVA 3SYZA 3ZSQA 2HW3A 2UXBK 3K0SA 1S1WA 1WUAA 3E9PA 3FZKA 3DLBA 2YNHA 1RDBA 1Q7YO 3AAPA 5JMVA 1TYQB 3WQTA 3VQBA 2ZJQL 3DOKA 5JLFA 3N4PA 4LH5A 2NRHA 2HMPA 2YJEA 4EZ6A 3CHWA 4IZ9A 4WFAL 4CEZA 3FGUA 4CZKA 4EFHA 1ZBHA 3IDHA 2DFEA 2YNGA 4I6MB 4X64K 2BUPA 4GV3A 1EQYA 5BREA 3C0BA 1S6PA 3MN9A 3HYFA 1LAVA 4DTJA 4CF1A 4I9QA 4KTZA 3H3OB 3VQPA 1CZAN 3OS1A 1C0TA 4KTWA 3AA5X 3SUQA 3NH1A 2BGGA 3IG1A 4CFBA 3BZKA 4M3UA 1C0FA 4LF4K 4FVUA 1KVCA 3AVFA 4GY2B 4CJ7A 4H0OA 2FLOA 4CZHA 3CFPA 4RW9A 1YT3A 4DU3A 3FZHA 1RDAA 4CIEA 1V4SA 4GV9A 3VF4A 2Z1IA 3SV4A 1C0UA 1DTQA 1KLMA 4DMNA 4CK3A 4DV7K 4PL7A 3SK3A 5HLFA 3CM5A 3IAYA 4C8MA 3V9UA 3TTFA 1R59O 4CK2A 2OCEA 3KWGA 2W40A 1A5WA 3T3FA 2ASMA 3THXA 3WQUA 5LY3A 1GLCG 3ZX2A 1L3UA 4U7BA 4DFPA 2Q0UA 2KKZA 3AVMA 1KFDA 5AQWA 4Z4IA 4B8CA 1HYSA 3QERA 3HBTA 2E6LA 4OPAA 4OO1J 3O3GA 1TAUA 5KQDA 1XMQK 1C0GA 4DF4A 3KKSA 3HRGA 4B1VA 1VQLN 5HRSA 1LWEA 1NGAA 4PKIA 1R0AA 3PIOL 3VF2A 4B3TK 1QQNA 3R6MA 3C65A 1TL1A 4BDZA 5GAEP 4QCLA 2QK9A 1UOCA 1N34K 4FWOA 5GIOA 4WQ5A 5KI6A 3OYLA 4DQPA 5E84A 3A8YA 2Q97A 4JLHA 4JI3K 4V19S 3SUNA 4DTMA 1HYVA 4NO7A 3ITHA 3SNNA 4DQQA 1BOTO 4OJRA 1WAFA 1NKEA 2ATQA 3QETA 4C1NI 3CXCM 4CHPA 1T3VA 3E66A 4BR5A 3JYTA 4FJKA 4C23A 3FR0A 4CF0A 4MO4A 2GWJA 4KKOA 5J2PA 1NOYA 1N33K 5KGXA 1TVRA 3DRSA 4F3TA 3KLFA 2RKIA 4WQ4C 4KV8A 3S3OA 5ADXH 3B6PA 3KJVA 3NH2A 2O8DA 2JWLA 1D5AA 3CIPA 1BISA 3AVCA 3D2EA 4GKKK 3M5RA 1HPZA 4DSEA 3S3MA 1HLUA 1TUYA 1U45A 2OA8A 3OYCA 4BR0A 3ENHA 3DLHA 5J2MA 3SUOA 1J9AA 3HOTA 1V4TA 4W5QA 2A5XA 4IOXA 4Y0WA 1XNQK 5BN9A 3NE6A 1RTJA 3ZEUB 4CHNA 3N4QA 3THYB 3KIOA 2GX9A 4LF9K 3HSCA 2HHHK 3NF8A 2KW4A 5LJWA 3EYZA 2G8WA 5KPRA 3TSPA 1SQKA 3A5LC 1VSDA 5J1EA 1T05A 1KTQA 4FM2A 1N32K 1CZBA 4CF9A 4DCHA 2ZF5O 3QEIA 4DUYK 1OH7A 1JCFA 4C8KA 3SBGA 5LJVA 3L2VA 3K5NA 1KLNA 1YHQN 3NAEA 4FJ9A 1TKZA 2PY5A 5KQ8A 1NGHA 3NF7A 4DSFA 3O4NA 3D2FA 1S9EA 1IKYA 1VSIA 4C8OA 3M3ZA 1LWCA 3HP6A 4MFBA 3DM2A 3DMJA 2AJQA 4BC2A 4BY9C 4MQ3A 2YI1A 2OYQA 4RTFD 3BF1A 5M1PA 2RHKA 5C12A 4BGBA 3OY9A 3HSTB 4BC3A 3VGLA 3ZX3A 3QFUA 5EOYA 3AA2A 3I56N 4FYDA 1SUQA 4EHUA 3OYDA 4AQYK 3SUPA 3FE1A 3F9KA 3MXJA 2Q1NA 4BC5A 1LWFA 5SZTA 1YF5L 1BO5O 4A57A 5H1SQ 3U3GA 3O3FA 3DXMA 4BACA 3DI6A 2Q0RA 2YX6A 3WEEB 4FO0A 2BE2A 4XIUA 2KZZA 3UKUA 4DSJA 1RT5A 1IKVA 1ATSA 3ZSRA 3TANA 5AQVA 2D5RA 4DB3A 3F2KA 4AHSA 3L3VA 3PX0A 3AA3A 3DJCA 5F0XA 2PFUA 5C10A 2I7PA 4BRAA 4NLCA 1SKSA 3LDSA 3E9OA 4H8KA 1DLOA 4CEAA 1BWFO 1YTAA 3ZSOA 2HBMA 4JS4A 5M1OA 3RMAA 2ZJPL 4N47A 4DQ8A 4WYBA 1KCFA 2NUBA 3O8MA 5C2FA 1IG9A 4JEPA 4IOCL 1OVQA 2BANA 4PUOA 2FSJA 5BPLA 4KI6A 1X3MA 1I39A 5AQGA 1YUWA 3HPGA 3NBPA 4IWVA 3OBWA 1HJOA 3V9XA 3CJ7A 3O1WA 3UE5A 4ZTFA 4JI2K 5LMNK 4B9QA 4CFAA 4MLHA 3VA0A 3CCMN 3GE1A 4ISFA 2WC9A 4RW6A 4FK4A 4DR1K 1FW6A 1ZXOA 2W6KA 4OLBA 3CJAA 4FL9A 4BRQA 1JLCA 3M6GA 4Z94A 1C0MA 3O9RA 4IFVA 3QIOA 1ATNA 3I8BA 4BRHA 3TWHA 2P5GA 4JS5A 4CJEA 4KHWA 1XNRK 4LC9B 3BZCA 1VQ6N 5BRHA 4CECA 1HX1A 4MDAA 2HHTA 3MDQA 2G8IA 1SV5A 3MEGA 4MO5A 3EL2A 4QAGA 3EEQA 1JLFA 4NXNK 2AA4A 1VRUA 1ITGA 3DAWA 3PX6A 2PYLA 4DR2K 4JI5K 1TGOA 4M3WA 3OYKA 4BDPA 5CE3A 3H6EA 4H5NA 4OPJA 1NKBA 1LV5A 1NK9A 3CD6N 1RDCA 2NLXA 3SPYA 4LFCK 5AQMA 3PY8A 2R7YA 1RNHA 2YHAA 4NLBA 4JI1K 1YTUA 4FLYA 2O8BA 1YAGA 3C6UA 4CFDA 3THWB 4IFYA 4AHRA 3ZLJA 3NHGA 1FXXA 2Z1GA 4ISGA 2W41A 3VEVA 4HUGA 2FBVA 1SKWA 1NOZA 3G25A 2GUPA 2QWMA 5F2RA 4BG9A 1XHXA 1NGBA 2IAJA 1MDUB 5EX5A 4O0JA 4CBWA 1Z6RA 4LY7A 4FLTA 2F7TA 4ZHRA 3AVHA 2HHXA 3QEPA 4CJSA 2X6NA 2YJFA 1VAZA 3AVBA 1DEJA 3WNFA 1LCUA 4JKGA 1VSKA 5DK5A 3AGKA 3HJFA 1IO2A 1RDWX 4JYAK 4A5AA 4H0VB 3MEEA 3VQ9A 3SJHA 4E7HA 4K8XA 5HROA 3TAGA 4O8KA 3H3NO 1JCEA 3LPUA 2F96A 3C95A 3D7EO 2KHOA 1HQEA 3OW2M 4B9SA 3LL3A 1Q9YA 1KAXA 3CJ9A 1HYZA 2RPIA 3HI0A 3CCRN 1XC9A 1RT6A 2O8EB 1WN7A 1BUPA 1WNSA 2YV0X 4E7KA 3TR8A 1EWRA 5AQHA 2KTQA 3KTQA 1NM1A 1ILYA 1KC8O 3HTVA 5KGWA 4BGAA 1OH6A 3MXIA 5FPEA 3TTDA 2G8VA 4EP4A 3VEOA 3VQDA 1HNZK 4BRFA 4HVJA 1X9JA 4CJVA 4MDBA 3ZETB 2YHXA 4FWPA 4BRKA 2DPNA 4KRFA 1OH8A 4G9ZA 1Q18A 2QWPA 2Q3SA 3H45C 1YJNN 4OGCA 1BIZA 4OVLA 3H08A 4JHDA 4FXDA 2VWBA 2IC3A 3M1FA 1BG3A 3QIPA 5AR0A 4B3SK 4M45A 4DSLA 2G8KA 4M3XA 4FW2A 1NK4A 1BGXT 3CG7A 3VPZA 1SKRA 3OYHA 1NJXA 4DV2K 4FJ8A 2VWKA 4BE0A 4CIFA 4R79A 3R9PA 3EO3A 3HO1A 3A5NC 2FSKA 5F1XA 3LWMA 3UKRB 2DFHA 1RDDA 4CERA 1X9SA 3O6WA 3TAPA 5AZJB 3TAMA 2Q31A 1NGIA 1SL2A 1WBBA 4EHTA 2O8CB 3NGYA 1QHTA 1OKJA 3ENBA 4MLEA 1EWQA 2XY6A 3R8EA 3RSEA 4A61A 2V52B 1M90O 2WBNA 3QO9A 4B9LA 1WAJA 4DV6K 4CK1A 3V1RA 3LAKA 1NK0A 2WTUA 4FJGA 3RRGA 2E2QA 4BR4A 5I3UA 3AVNA 1HKBA 4CVNE 3PO4A 3V4IA 3ID8A 3VEWA 3ASMA 1E3MA 1Z26A 4CJUA 2NRZA 3AVJA 3IKMA 4F8RA 3B8AX 1S1TA 4DU1A 2F8TA 2OPSA 4H4MA 4H5WA 1WBDA 2XO7A 4JKAA 2DY4A 2B5JA 3R3LA 4DV3K 3AO1A 1NU0A 1JKHA 2HNZA 3DLEA 4PHTX 3LZJA 4DLEA 1Q82O 4BROA 2QWLA 3L2QA 4FK2A 1P8ZA 1QQOA 4KB1A 4KHUA 2ETJA 1DTTA 1XMOK 3RMCA 3VGKA 2WONA 1BI4A 3AVIA 3RWUA 1UAXA 3TTCA 1EP4A 1HJRA 3MN6A 3L3UA 4BE1A 4Z4GA 3VQ4A 3V1OA 1MA9B 3CPEA 4JD2A 2QM1A 1ZBIA 2QWQA 3SQ4A 3CC7N 4CGDA 4BVPA 2P9SB 3CI5A 1TAQA 1Y64A 3L4QA 4DR7K 4GVMA 5HP1A 5AFUH 3G71N 4IBNA 3OHRA 3OYIA 4IO8A 1IBMK 3BEXA 1S5JA 2ZM6K 4O0IA 1NJZA 2VQFK 3D45A 2UUAK 1A5VA 2Z1JA 5FPNA 4CJ5A 3CJBA 2B4JA 2PZSA 3OYMA 2OZSA 3LP2A 3WXMB 1WSEA 1ZBLA 1Q9XA 1K9MO 3LZIA 1NK6A 4JRQA 4B9NA 3AGRA 1K6YA 4JKHA 1QTMA 2IS3A 4K43A 4AHVA 2GELA 2P9PB 3OYEA 5IT9O 1VRTA 4HCBA 2E5LK 1YVNA 4O4GA 3C7NB 1RBTA 3K59A 2P9IA 2P9UA 2A42A 3ULEB 2V7YA 2KQ2A 2O8FB 3T1AA 2XHBA 4J2EA 1NWKA 1L3SA 3HZ6A 3P5JA 3DLGA 3KZBA 2X6SA 5CYMA 4TSXA 3CMEN 3P83D 4Y1DA 4M42A 2ZE2A 3E1YA 3CCLN 2P9LB 1QS4A 3SAGA 2CH6A 3P38A 4CJ3A 4WQ5C 1BCOA 4NB4A 1WB9A 3ULDA 4IDHA 2OPPA 1EETA 3O08A 1JLGA 2P9KB 1VQ8N 4CJRA 4H4OA 4DQSA 5C2DA 1GLLO 1XC3A 4L8RB 1RTDA 1I94K 2IVNA 2E88A 1GOBA 1S72N 4BQZA 2BDPA 4JNEA 5GAGP 1TKTA 3V9SA 1CZ9A 3KWIA 3R1XA 3RRHA 1M1KO 1IKXA 4YFUA 2FSNA 1Z25A 3O4WA 4DTPA 2UUBK 1HKGA 3J80O 1RT3A 2AP1A 3CF5L 1NK5A 2E20A 5BPNA 4KHYA 5IWAK 1TKXA 4B3MK 5FDLA 1S1UA 5I9EB 3OBYA 1QSYA 2V7ZA 3ZX0A 3KLGA 2QW9A 4KPYA 4LH4A 4BVOA 4HWIA 1RBSA 3AO3A 1RT7A 2E1ZA 1P90A 3L2WA 4J8FA 1L5UA 1TUUA 5BN8A 3EKSA 3E9LA 5AQSA 5TKWA 2P9NB 3G6EN 1RBVA 3IUCA 5I42A 3F9MA 4Z4CA 3WXIA 3SQ0A 4E1NA 4O5BA 3HT3A 1NGFA 2BTFA 1GOAA 2VYPA 3MX2A 4Z0UA 3JSMA 3EE9A 3T19A 1B92A 4CEDA 2ZD1A 4JKEA 3SJJA 1C1BA 3FFIA 3DLLL 2CH5A 3L2RA 4QS9A 3K5OA 1NBWA 4XEIA 1VQKN 4NXMK 1K8KB 4N56A 3ZT2A 4A5BA 4FWLA 4KI4A 3SAHA 1NGGA 3M8PA 4XH5A 1A5XA 4KH6A 3SI6A 2VG6A 4FSVA 1KAYA 4L3QA 4CCHA 4DV5K 1HUXA 4H5RA 1BDGA 3TI0A 1RDUA 2FBYA 3NCIA 3KK3A 3CQ8A 4A2BA 3QLHA 4CHQA 1U47A 2D4WA 4OKJA 2IGIA 4K0KK 1WSIA 3OYAA 3QEVA 1ZYQA 3V9WA 3KK2A 3CFRA 1YI2N 2HF4A 4BRIA 1XQSC 1BIUA 4DQRA 1N36K 2IIRA 2JLEA 4NCBA 4JK7A 3RVCA 3DXKB 1HR0K 1U2VB 2DTUA 3MAQA 1XI1A 1NK7A 3GDQA 1N5YA 4JKCA 2A40A 3ZSVA 4YDUA 4FOIA 5EY4A 4FZZA 1FKPA 2ASPA 4OX9K 2VCPA 4B1YB 4NYNA 1KSPA 1KXPA 4CJTA 1IH7A 1ZBUA 4RW7A 4DUZK 1NJWA 1J6ZA 1NMNA 2OTLN 3E01A 4BR7A 4FJMA 3WT0A 1QZ6A 1TYQA 3IMXA 2OPQA 2WFBA 3C6HA 1T6CA 2W42A 4XH1A 5HOOA 4DKWA 1WSJA 1C1AA 3L0QA 4FJ7A 5K14A 4JKFA 4H0PA 2UXDK 3NFAA 2G8FA 5AZIB 1RT2A 4J2AA 4I6MA 1RCHA 4X62K 4GMJB 1W7AA 3EKUA 1GLDG 1HRHA 4K25A 4I9LA 1J5EK 2YCHA 2RE2A 2A6AA 1NGDA 4KREA 4BC4A 4HUFA 1RTHA 3O9SA 2HOEA 3U3YA 4PY5A 4CHYA 2FXUA 4J2BA 4GW6A 3CQYA 4RCHA 3HM9A 3W0LA 2FF3B 4JKBA 4YOUA 5BRFA 4E7LA 3MN7A 3WNEA 1G15A 3TARA 2PBDA 1NKCA 1E4GT 2F8SA 1RTIA 3RMBA 5AQQA 3AV9A 5AFUA 3C94A 3MEDA 3TSQA 1KQSM 3ISNC 3I0SA 3P39A 5M1NA 3QESA 4DLGA 4LD0A 5AQLA 2E2PA 1JXBA 2E8AA 3AY9A 5C25A 3K9KA 3O9UA 4GNIA 1X3NA 1HNXK 4M63C 3LPTA 4M7XA 1VQON 4F9OA 2GBZA 1NG9A 3THXB 4F2RA 4FJIA 1UA1A 3O4QA 3MK6A 1FJGK 1BHLA 3SZ2A 4H0YB 4CJ4A 5D3GA 4IFEA 2KFZA 4GVEA 4FWNA 2ZWHA 4CHZA 4HTUA 1N6QA 2UUCK 4AHTA 3SMSA 4UQGA 4JI4K 5TKYA 4B1XB 2FBXA 1BA1A 5JS2A 4M3TA 1SL0A 3NMUA 2ITMA 3S3NA 5JLHA 3AO4A 3VQEA 3I0RA 3LALA 4HTLA 3VEXA 4H03B 1KAZA 2QWOA 3Q7BA 2P9KA 4FWMA 3JAMO 5HBMA 2E2OA 1ASWA 4B9UA 1BQMA 4LF7K 3ATVA 1LAWA 4FWSA 5AQZA 3NH0A 4FM1A 1EO1A 3KLIA 3CCQN 1QVFM 4CW7B 3RMDA 2YKNA 1U4BA 4JK9A 3QBWA 5AQJA 3SQ2A 4B08A 4K8ZA 3IS9A 1GLBG 3VQAA 1TL3A 4IEEA 2QKKA 1N8RO 3D0PA 3TAQA 1VQ4N 4W5NA 1U6ZA 5CYQA 3DYAA 2WOMA 3CERA 2QWRA 5J2QA 1RBRA 4HUEA 2A1RA 2HF3A 3WXLA 4HCCA 2O8DB 5MLCQ 1K73O 3L8BA 3V81A 4CZGA 3AVGA 3VQQA 4DFMA 5KRSA 3D2EB 4LFAK 2RN2A 4I2PA 4YY3K 4OGEA 2QKBA 3S41A 4N5SA 3QMLA 2NZTA 5AQTA 3ZEUA 4C8NA 3THYA 1KRPA 4FWRA 1D4XA 4JI6K 4YOTA 1U49A 4J2DA 1BA0A 1HPMA 3CCUN 4YOVA 3WXKA 1ASVA 4ELVA 4E7JA 4FLWA 1HNVA 1NNEA 3ZCMA 2NRXA 4CGFA 4BRMA 3ZT0A 3VERA 3NVKA 2QXFA 2HHUA 1RILA 4FK0A 1W2BM 5CR4A 1QE1A 3AARA 2G8HA 4IOAL 3U6FA 3GBTA 1SAZA 3D2FB 4E89A 2P5OA 5A2QO 1WSGA 3J7YP 3PSIA 4H5VA 3KK1A 5AQKA 3GG4A 4DR6K 4RW4A 2O4IA 1G99A 2H3GX 3UB5A 3KK7A 3HK2A 4LF5K 3IFRA 4M3RA 4FJ5A 4DS4A 1EXQA 4CHOA 1JXEA 2EHGA 4LSLA 4X66K 1HKCA 3M8SA 1JLBA 5JS1A 4CBUA 5C24A 3CCJN 5DM7L 2I7NA 1ESVA 2XY8A 4PA1A 3TSUA 2HMIA 3HOSA 4FJHA 5FPMA 2CGKA 3TU5A 3WEEA 4BREA 3O3HA 2FBTA 1BU6O 1S22A 3DXMB 3S9HA 5GINA 4CZFA 3T1HK 3SMPA 1L3TA 4CIGA 3SV3A 3G0ZA 3OA9A 5AQYA 3UKUB 3LDPA 4O8UA 4DTXA 5EVZA 4BR9A 4QS8A 4B1UB 2YNIA 1REVA 4Z4HA 4FZXC 1JLAA 2E6MA 5J2NA 1NJIO 2HHWA 1I3AA 4F3OA 3NF9A 2E1YA 3UIQA 3DRPA 4B9VA 2RF2A 3K5MA 4M3ZA 1GLJO 3HM8A 3HVRA 2F4VK 1HMVA 4OKEA 4FLVA 4YORA 5C15A 4IJAA 3VQ8A 3VN5A 3O9TA 4ELTA 4BG8A 4KHPK 3P4IA 3CJ1A 1NMDA 2A3ZA 2WUSA 4O5FA 2HBKA 3OS2A 4LF6K 5HRPA 1VQ7N 3K57A 1HNIA 2G8UA 4DU4A 5AZIA 4H5TA 1IKWA 2KLAA 5EXWA 3HL8A 4KTQA 3LP1A 2Q36A 3VOVA 1QQMA 2NRRA 3W3DA 3VQ6A 3CYMA 1KD1O 4FM0A 1ZBSA 2ITGA 4FPAA 2QA4N 1S6QA 1MU2A 4PL8A 4JAXA 1GLEG 3FZMA 3WUHA 4DTOA 4U67L 4M41A 3AVAA 5M1KA 4IO9L 4I2QA 1HNWK 4E1JA 4R5PA 2J4RA 4CEEA 1LOTB 4YOWA 4B8AB 4JRPA 1HQUA 1S1VA 4WF9L 4IG3A 1LW2A 3AO2A 4E1MA 3ALYA 3MECA 3BF3A 3B6OA 4IDKA 3FLCO 3VESA 2IVOA 3HXMA 1C1CA 1QSLA 4CF8A 4CGHA 2HHSA 2D0BA 4CGGA 4XH4A 2Z1HA 4AHUA 1GOCA 3MWTA 2PYJA 5C0YA 4BRPA 5GIPA 4CJQA 4Q0BA 1O13A 2NNWA 3VGMA 1D9DA 4O55A 5AQOA 2YHYA 1QZ5A 1SS6A 4JI8K 5ELZA 4G1QA 4ILJA 4X65K 4ILGB 3THWA 1X9MA 4FLXA 2O8BB 3VMFB 1BQNA 4B1WB 5E41A 4WFBL 3AAQA 4B1ZA 3C6AA 4C1NK 1X1PA 3KLHA 2KFNA 1Z05A 4A59A 5CZ2A 2OTJN 3GOIA 2VGNA 1IG8A 5DM6L 5HL7L 4C8LA 1E4FT 3A2FA 3OYNA 5B8HA 2BH1A 3MCAB 1UWBA 4BRCA 3AO5A 3EY1A 4BRDA 3I55N 2FF6A 1S9GA 3LAMA 1YXQA 4DTSA 4JI7K 4YHHK 1JLEA 4JKGB 3QEXA 5BPMA 1VSEA 4OKKA 4BQLA 3AA4A 1VSMA 3QICA 4YOXA 4ID5A 4ILHA 4CEFA 4DFKA 1S3XA 3QEWA 1NGEA 3HPHA 1VQ9N 1U48A 3K58A 4FW1A 4ID1A 1NGJA 4FCYA 4DFJA 3VA3A 4FWQA 3U8XA 1DGKN 1U04A 4WQ4A 2YNFA 3LM9A 3OYBA 2D0AA 4FJNA 4AHCA 4FOEA 4DTUA 1JL1A 1RT1A 3OJUA 2O8EA 2HVHA 4CGJA 2GTDA 3CCEN 4AILC 1VQ5N 3O80A 4PWDA 3PO5A 3ZSXA 3ZSYA 2HBJA 5FPDA 2YKMA 3VETA 3ID6A 1QVGM 3LM2A 3D6RA 3CM6A 3PX4A 1OVYA 3ZSWA 2VG5A 2EWSA 1WSHA 2O4GA 3IRXA 2CGJA 2DFFA 3TAFA 4FZYA 3ENOA 4KFBA 4OPKA 3ZETA 4W5RA 3MX5A 3CQXA 5GADP 2HVIA 4JN4A 5KTQA 3QBXA 5BR8K 4DTNA 1NLVA 5BR9A 1W97L 1TK5A 3BUZB 3P1GA 3K9JA 3MCPA 2OANA 5KPZA 3ZSZA 3VEYA 3FZFA 3EZWA 1MWMA 4CEOA 2Y1JA 4ELUA 3QINA 4RWTA 5M1QA 1WSFA 4DS5A 1ZC6A 1ASUA 3QNNA 4JHDB 1D9FA 1EX4A 4K42A 2F9TA 1WOQA 3VEZA 3ZYYX 4E3SA 3DOLA 2P51A 3SBTA 3QNOA 1LW0A 2JWKA 1DT9A 3AVLA 4LF8K 4CF2A 4NCGA 1GLFO 1H1VA 1X9WA 1KFSA 1GLAG 3CC2N 1Q81O 3EE8A 4IEIA 2VQEK 1RBUA 4DR3K 4K41A 1VSLA 3UKRA 4DV0K 1JL2A 4DSIA 2HNYA 2HSTA 5AJ3K 4ZTJA 3CJCA 4CZEA 5AZJA 4RG8A 3CCSN 5KRTA 5GAHP 2Y1IA 3A5OC 4JI0K 3I8DA 4Z4EA 2O8CA 3QB0A 3LWLA 1T44A 3VQCA 3L6QA 3EZ5A 4UY8O 4CZMA 1T6DA 3U4LA 4CD3A 4QS7A 5AQXA 5KPTA 4BWJA 4YDUC 3DLRA 4IG0A 1VHXA 4LSNA 2UYTA 3NDKA 4CZJA 4JV5K 4DQIA 2Q2RA 1NGCA 3MN5A 3RSEB 4O44A 3VTIA 4KHSA 5AQNA 1C6VA 2HB5A 5LL6Z 1B9FA 1IV0A 2YHBA 4W5TA 1NJYA 2PAVA 3LDNA 2E4LA 3OYGA 2YHWA 1D8YA 3NF6A 4DG1A 4CE9A 4Y1CA 1ZBFA 4W5OA 4EZ9A 1DKGD 4CZIA 2X78A 2NRVA 4KO0A 3O5BA 4FWKA 5T7BA 1JCGA 4BE2A 4N76A 2KZMA 3ATUA 4WFNL 3CC4N 4I7FA 1VQPN 1SZ2A 1OH5A 3BY5A 4BDYA 4IKFA 3JS6A 3KD1E 3KHYA 1VK0A 3THVA 3OTOK 3QDKA 1QSSA 3RTVA 1T03A 4E0DA 3FZLA 3SPZA 1FKOA 2HHVA 5C42A 5E26A 2I5JA 1K8AO 2ZJRL 4KH5A 5M1FA 4EIAA 5FRNA 4OLAA 3ZT4A 2E2NA 3U9ZA 4EP5A 3O9QA 2VWJA 4NCAA 4AM6A 4E19A 3VQ7A 3L4IA 3CPWM 3VF6A 1BI4B 1JLQA 4CJWA 1F21A 5EU7A 1L3VA 4WCEL 3BGRA 3JXUA 4JD2B 2P9SA 3G10A 4CI6A 3J8AA 5CY4A 2ZGYA 1TK0A 3NGIA 4DTRA 1J5OA 4A62A 1WLJA 2X74A 4CJKA 3LANA 4CGIA 2GEMA 4KAZA 4CFCA 1UA0A 3KVGA 1J54A 1J53A 4DF8A 4Q5VA 3QFPA 3CETA 1NK8A 3TAEA 3J7ZO 1TV6A 2UU9K 2IVPA 3A5MC 1RT4A 2D0CA 3KKRA 4CEBA 4AM7A 2V51B 2FC0A 3EN9A 1CXUA 1Q8IA 3C6TA 3AVKA 1XUPO 4KBOA 1BL3A 2P9PA 1T7PA 2LSNA 3LP0A 5SWMA 3PLAA 3H1QA 3ZT1A 1VQMN 3C7NA 5FRMA 4KH4A 5CZ1A 4BRNA 4YNQA 4OPHA 3ULEA 3U9DA 5CHIA 2QEXN 1B9DA 2O8FA 1IJJA 4KHQA 3L2UA 2QTDA 2ZQBA 1EKEA 2P9IB 2P9UB 3PSFA 4M3YA 4B9MA 4DR5K 5JICA 4FVMA 4CESA 1VQNN 3M8RA 4GV6A 3HVTA 2P9LA 4IXCA 1YITN 2NRTA 4JKDA 4LFBK 1Y97A 4KHNA 3VQ5A 3HP9A 2XY7A 1MWKA 2IOCA 5HRNA 3NGZA 3V9ZA 4CJPA 2HBLA 5JVHL 3I33A 1TKDA 4A2AA 4FPBA 2ASOA 3WNHA 4DSKA 1Q86O 3DLKA 1YJWN 3TABA 4FJLA 4FJXA 3PIPL 3HPOA 2QXLA 3TPQA 2CGLA 3BP8A 2XY5A 3PV8A 4B9TA 4B3OA 3Q7CA 4BRGA 3F5TA 2XRIA 4B3RK 4M7YA 4DV1K 4CJFA 4WE1A 2D0OA 1VSFA 4NYFA 3RR7A 3LDLA 2GUIA 3T69A 2OZMA 4DWIA 4PKHA 4JK8A 1S1XA 1QHAA 1YJ9N 2GV9A 4H0TB 5ADXA 4F2SA 1SL1A 3CCVN 2UXCK 3OYJA 4PKGA 3T1YK 3V6DA 2P9NA 3GL1A 1RGIA 1TK8A 5HRRA 5FROA 1W9HA 2A1SA 2D1KA 3V1QA
chains in the Genus database with same CATH topology
3PUFA 3K2PA 2ITGA 4RW6A 1RBVA 4ICLA 1S6QA 1MU2A 4FLUA 5I42A 4F4KA 4Z4CA 4FK4A 1QQCA 3SQ0A 4E1NA 4OLBA 1FK9A 3LP3A 4O5BA 3HT3A 4DTOA 1JLCA 4M41A 1GOAA 3AVAA 2B6AA 4Z0UA 3JSMA 3T19A 3OS0A 1B92A 1C0MA 4CEDA 4E7IA 2ZD1A 4I2QA 4IFVA 3SJJA 3QIOA 1C1BA 3MXMA 4R5PA 4FXDA 4CEEA 3FFIA 3TWHA 3ZT3A 2P5GA 4BWMA 3L2RA 1KVBA 4JS5A 4CJEA 4KHWA 3CFOA 4B8AB 3K5OA 2HNDA 4JRPA 4N56A 1HQUA 1S1VA 4CECA 3ZT2A 4IG3A 1LW2A 3AO2A 2HHTA 3RR8A 2G8IA 4KI4A 4E1MA 3OYFA 4PQUA 1SV5A 3M8PA 3ALYA 1VSJA 3MEGA 3MECA 4AH9A 4HHTA 3SCXA 1W0HA 4QAGA 1BCMA 3B6OA 1A5XA 4KB0A 4IDKA 1XHZA 1JLFA 3KLEA 3SI6A 2VG6A 1VRUA 4CEQA 2P1JA 1ITGA 3K5LA 3HXMA 4CCHA 1C1CA 1QSLA 3OJSA 4CF8A 4FJJA 4CGHA 2HHSA 2D0BA 4CGGA 3PX6A 3TI0A 2PYLA 4AHUA 1O1WA 2Z1HA 2FBYA 3NCIA 3KK3A 1VSHA 3CQ8A 2IDOA 3QLHA 4CHQA 1TGOA 1U47A 1GOCA 4M3WA 3OYKA 4BDPA 4OKJA 2IGIA 4OPJA 1NKBA 2PYJA 3BDPA 3VA0A 1NK9A 1LV5A 1WSIA 1RDCA 3OYAA 3QEVA 4CJQA 3SPYA 1YVUA 3V9WA 1ZYQA 1T8EA 3KK2A 3CFRA 1RNHA 2YHAA 4CJLA 4O55A 2R7YA 1D9DA 2EX3A 3WNGA 3OVNA 2JGUA 1BIUA 4DQRA 1YTUA 4RW8A 2VG7A 2JLEA 3DRRA 4NCBA 4Z4FA 4G1QA 2HHXA 4FLYA 2DTUA 3MAQA 3KD5E 1XI1A 1X9MA 4FLXA 1NK7A 3F73A 5E41A 1BQNA 3C6UA 4CFDA 1N5YA 4IFYA 1KVAA 3ZSVA 3KLHA 1X1PA 4AHRA 2KFNA 3M8QA 1CXQA 3SQ1A 3NHGA 1FXXA 2OPRA 2Z1GA 4FZZA 2HHQA 1FKPA 5DMRA 5CZ2A 4HUGA 2FBVA 1XWLA 1SKWA 4N41A 1NOZA 4NYNA 4FLZA 1XHXA 1KSPA 2IAJA 1CLQA 4O0JA 4C8LA 3A2FA 4LY7A 4FLTA 3SYZA 4ZHRA 3AVHA 3ZSQA 4CJTA 3OYNA 4CJSA 1IH7A 1ZBUA 3QEPA 2X6NA 4RW7A 2HW3A 1NJWA 3AVBA 1UWBA 1S1WA 3DLBA 3E01A 3AO5A 4FJMA 3WNFA 3EY1A 2YNHA 1VSKA 3LAMA 1S9GA 1RDBA 2OPQA 4DTSA 1JLEA 5DK5A 3QEXA 2W42A 1VSEA 4OKKA 3VQBA 3AA4A 3HJFA 1VSMA 1IO2A 3DOKA 1WSJA 4LH5A 1C1AA 3MEEA 4ID5A 3VQ9A 4CEFA 4DFKA 4EZ6A 4FJ7A 3QEWA 5K14A 4E7HA 4K8XA 5HROA 3HPHA 3TAGA 1U48A 3K58A 3PY8A 4FW1A 4ID1A 3NFAA 4FCYA 3LPUA 4DFJA 4CEZA 2F96A 3C95A 3VA3A 2G8FA 1RT2A 4J2AA 1HQEA 1RCHA 1U04A 1Q9YA 4B9SA 2YNFA 3OYBA 4GMJB 2D0AA 4FJNA 1ZBHA 4AHCA 2DFEA 2YNGA 1HRHA 4I9LA 4DTUA 1JL1A 1HYZA 1RT1A 2RPIA 3OJUA 2HVHA 2PY5A 4CGJA 1RT6A 1XC9A 1WN7A 4E7KA 1WNSA 1S6PA 2YV0X 3TR8A 4AILC 3HYFA 1LAVA 4DTJA 3KTQA 4CF1A 4I9QA 4PWDA 2KTQA 4KTZA 4KREA 3PO5A 3VQPA 3ZSXA 3ZSYA 2YKMA 4HUFA 3OS1A 1RTHA 1C0TA 5KGWA 3U3YA 4KTWA 3CM6A 3AA5X 3PX4A 4CHYA 3SUQA 3NH1A 3MXIA 2BGGA 3ZSWA 2VG5A 4PY5A 3IG1A 1WSHA 2O4GA 4CFBA 3IRXA 3TAFA 2DFFA 4J2BA 4M3UA 4GW6A 4FZYA 2G8VA 3HM9A 4EP4A 3VQDA 4KFBA 4OPKA 4W5RA 4HVJA 4CJVA 4E7LA 1KVCA 3AVFA 1G15A 3WNEA 5KTQA 4DTNA 3TARA 2HVIA 1NKCA 1TK5A 3P1GA 4KRFA 3CFPA 4RW9A 2F8SA 3ZSZA 1YT3A 4DU3A 1RTIA 3RMBA 1RDAA 3AV9A 4CIEA 2Q3SA 3C94A 2Z1IA 4CEOA 2Y1JA 3MEDA 4OGCA 1BIZA 4ELUA 4OVLA 3H08A 3ISNC 3QINA 3I0SA 3SV4A 1WSFA 4DS5A 1C0UA 1DTQA 1KLMA 1ASUA 2IC3A 4DMNA 4CK3A 3QNNA 5HLFA 1D9FA 3CM5A 1EX4A 3QIPA 4C8MA 3IAYA 3QESA 4DLGA 3V9UA 4LD0A 4M45A 4E3SA 3DOLA 1JXBA 4DSLA 4CK2A 5C25A 2G8KA 4M3XA 2P51A 4FW2A 3QNOA 1A5WA 1LW0A 1BGXT 3T3FA 1NK4A 3CG7A 3AVLA 3LPTA 4CF2A 2GBZA 1L3UA 4NCGA 1SKRA 4F2RA 4DFPA 4FJIA 1UA1A 3O4QA 3OYHA 3AVMA 1NJXA 1KFDA 4FJ8A 1X9WA 1KFSA 1BHLA 2VWKA 3SZ2A 4Z4IA 4B8CA 4CIFA 4BE0A 1RBUA 4CJ4A 5D3GA 1HYSA 1VSLA 3HO1A 3QERA 2KFZA 1JL2A 3LWMA 2E6LA 2HNYA 4DSIA 4CHZA 4HTUA 2DFHA 4ZTJA 1N6QA 4AHTA 3O3GA 4RG8A 1RDDA 4CERA 5KRTA 1TAUA 1X9SA 2Y1IA 4UQGA 3TAPA 3I8DA 3TAMA 4Z4EA 3LWLA 1SL2A 4DF4A 3KKSA 3VQCA 3EZ5A 2FBXA 1LWEA 3NGYA 5HRSA 1QHTA 5JS2A 1R0AA 4M3TA 4BWJA 1SL0A 3DLRA 2XY6A 4IG0A 4LSNA 3NDKA 4DQIA 3S3NA 1TL1A 4BDZA 3AO4A 3VQEA 4QCLA 3I0RA 2QK9A 4O44A 3LALA 3QO9A 4B9LA 1UOCA 1WAJA 4CK1A 4KHSA 3V1RA 3LAKA 1NK0A 1C6VA 2HB5A 4FJGA 3RRGA 5KI6A 1B9FA 3OYLA 4DQPA 2YHBA 4W5TA 4JLHA 5HBMA 5I3UA 1NJYA 3SUNA 4DTMA 2E4LA 1ASWA 3OYGA 3AVNA 1D8YA 4B9UA 1BQMA 1HYVA 3NF6A 4DG1A 4CE9A 4Y1CA 1ZBFA 4W5OA 1LAWA 3V4IA 3PO4A 4EZ9A 3NH0A 3ITHA 3ASMA 3SNNA 2X78A 4FM1A 1Z26A 4KO0A 4CJUA 4DQQA 3AVJA 5T7BA 4OJRA 3CYMA 3KLIA 1WAFA 1NKEA 2ATQA 4BE2A 3QETA 3RMDA 4F8RA 4N76A 4CHPA 2YKNA 4FJKA 3JYTA 2KZMA 1S1TA 1U4BA 3SQ2A 4I7FA 4B08A 4K8ZA 4DU1A 2F8TA 2OPSA 3IS9A 4H4MA 4CF0A 4KKOA 5J2PA 1NOYA 3VQAA 1TL3A 2XO7A 4BDYA 5KGXA 2QKKA 3KD1E 1TVRA 4IKFA 3DRSA 3D0PA 3TAQA 2DY4A 2B5JA 4F3TA 3KLFA 1VK0A 3THVA 2RKIA 4W5NA 4KV8A 5CYQA 3S3OA 1QSSA 3DYAA 3RTVA 3B6PA 1T03A 3AO1A 4E0DA 2WOMA 1JKHA 2HNZA 3KJVA 3NH2A 3SPZA 3DLEA 1FKOA 1D5AA 5J2QA 1RBRA 3LZJA 4HUEA 4DLEA 2A1RA 5C42A 2HHVA 1BISA 2I5JA 4HCCA 3AVCA 3L2QA 3L8BA 3V81A 4FK2A 4KB1A 3AVGA 3VQQA 4DFMA 5KRSA 1HPZA 5FRNA 4DSEA 4KHUA 3S3MA 2ETJA 1DTTA 4OLAA 2RN2A 3RMCA 4I2PA 1U45A 4OGEA 3ZT4A 2OA8A 2QKBA 4EP5A 3OYCA 2VWJA 2WONA 3DLHA 4NCAA 1BI4A 3AVIA 5J2MA 3SUOA 1J9AA 3RWUA 4E19A 1UAXA 3VQ7A 4N5SA 4W5QA 1EP4A 1BI4B 1HJRA 3L3UA 4BE1A 1JLQA 4Z4GA 4CJWA 1F21A 3NE6A 5EU7A 1RTJA 4C8NA 3VQ4A 3V1OA 4CHNA 1KRPA 1L3VA 1U49A 4J2DA 1ZBIA 3BGRA 3KIOA 3SQ4A 3G10A 3NF8A 4CGDA 5CY4A 2KW4A 3EYZA 1TAQA 2G8WA 1TK0A 3NGIA 4GVMA 4DTRA 1J5OA 5J1EA 1VSDA 1T05A 5HP1A 1KTQA 4IBNA 1ASVA 4ELVA 4Q0BA 3OYIA 4FM2A 1WLJA 4FLWA 1CZBA 4CF9A 2X74A 4E7JA 4CJKA 3LANA 1HNVA 3QEIA 1S5JA 4CGIA 4O0IA 1NJZA 4QOZB 4KAZA 3ZCMA 3D45A 1A5VA 4CFCA 1UA0A 4C8KA 1J54A 1J53A 4DF8A 3L2VA 4Q5VA 3K5NA 4CGFA 1NK8A 2HHUA 2Z1JA 3TAEA 1KLNA 3ZT0A 4CJ5A 3NAEA 2B4JA 1TV6A 2PZSA 4FJ9A 3OYMA 2OZSA 1TKZA 2QXFA 1RT4A 2D0CA 3LP2A 1RILA 4DSFA 1WSEA 3KKRA 3NF7A 4CEBA 1ZBLA 4FK0A 3O4NA 1Q9XA 1QE1A 2FC0A 1CXUA 3LZIA 1Q8IA 3C6TA 1S9EA 1IKYA 1VSIA 3AVKA 1NK6A 4JRQA 3U6FA 2G8HA 4B9NA 4C8OA 1BL3A 1LWCA 4E89A 1K6YA 3HP6A 1T7PA 4MFBA 2P5OA 2LSNA 2IS3A 3LP0A 3DM2A 3DMJA 4AHVA 5SWMA 1WSGA 1QTMA 3OYEA 3ZT1A 2AJQA 1VRTA 4MQ3A 2OYQA 4HCBA 5FRMA 4O4GA 5CZ1A 3KK1A 4YNQA 1RBTA 4RW4A 3K59A 2O4IA 1B9DA 4KHQA 3L2UA 2KQ2A 3OY9A 3HSTB 2ZQBA 1EKEA 3HK2A 3T1AA 2XHBA 4M3RA 4J2EA 4FJ5A 4DS4A 4M3YA 1L3SA 4B9MA 1EXQA 3P5JA 4CHOA 3AA2A 1JXEA 2EHGA 3DLGA 4LSLA 4FYDA 3M8SA 2X6SA 1JLBA 1SUQA 5JS1A 4FVMA 4CESA 5C24A 3OYDA 5CYMA 3M8RA 2XY8A 4TSXA 3P83D 4Y1DA 3HVTA 4PA1A 4M42A 2ZE2A 3SUPA 2HMIA 3F9KA 3MXJA 4FJHA 1QS4A 1Y97A 4KHNA 1LWFA 3VQ5A 4CJ3A 3HP9A 1BCOA 5SZTA 3ULDA 2XY7A 3U3GA 3O3FA 2IOCA 1EETA 2OPPA 5HRNA 3DI6A 4CJPA 3NGZA 4BACA 3V9ZA 3O3HA 1JLGA 2FBTA 3S9HA 2BE2A 4XIUA 2KZZA 4CJRA 1L3TA 4H4OA 4CIGA 4DQSA 3SV3A 1RT5A 1TKDA 4DSJA 3G0ZA 1IKVA 3ZSRA 3TANA 2D5RA 4L8RB 4AHSA 1RTDA 4DTXA 3WNHA 3L3VA 4DSKA 3PX0A 3AA3A 3DLKA 1GOBA 3TABA 4FJLA 2YNIA 1REVA 4Z4HA 4FJXA 2BDPA 4FZXC 3HPOA 1SKSA 1JLAA 3LDSA 1TKTA 2XY5A 2E6MA 5J2NA 3V9SA 2HHWA 1I3AA 3PV8A 4B9TA 3NF9A 4H8KA 4F3OA 1CZ9A 1DLOA 3UIQA 4B3OA 3DRPA 4CEAA 2RF2A 3RRHA 4B9VA 1IKXA 3K5MA 4M3ZA 4YFUA 1YTAA 3ZSOA 3HVRA 1Z25A 1HMVA 4DTPA 4JS4A 1RT3A 4OKEA 4FLVA 3RMAA 2XRIA 1NK5A 3VQ8A 3VN5A 4ELTA 4KHYA 4CJFA 4N47A 1TKXA 4WE1A 5FDLA 1S1UA 1VSFA 4NYFA 3OS2A 3RR7A 5HRPA 1KCFA 2NUBA 2GUIA 1HNIA 3K57A 1QSYA 2G8UA 1IG9A 3KLGA 4DU4A 2OZMA 4DWIA 1IKWA 4KPYA 4LH4A 1S1XA 2BANA 3HL8A 4KTQA 4PUOA 3AO3A 1RBSA 2GV9A 3LP1A 1RT7A 4F2SA 4KI6A 1I39A 1SL1A 3HPGA 3NBPA 3L2WA 3OYJA 3V9XA 1L5UA 3V6DA 4ZTFA 3VQ6A 1TK8A 5HRRA 5FROA 1W9HA 4CFAA 2A1SA 4FM0A 3V1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUF A;  3K2P A;  2ITG A;  4RW6 A;  1RBV A;  4ICL A;  1S6Q A;  1MU2 A;  4FLU A;  5I42 A;  4F4K A;  4Z4C A;  4FK4 A;  1QQC A;  3SQ0 A;  4E1N A;  4OLB A;  1FK9 A;  3LP3 A;  4O5B A;  3HT3 A;  4DTO A;  1JLC A;  4M41 A;  1GOA A;  3AVA A;  2B6A A;  4Z0U A;  3JSM A;  3T19 A;  3OS0 A;  1B92 A;  1C0M A;  4CED A;  4E7I A;  2ZD1 A;  4I2Q A;  4IFV A;  3SJJ A;  3QIO A;  1C1B A;  3MXM A;  4R5P A;  4FXD A;  4CEE A;  3FFI A;  3TWH A;  3ZT3 A;  2P5G A;  4BWM A;  3L2R A;  1KVB A;  4JS5 A;  4CJE A;  4KHW A;  3CFO A;  4B8A B;  3K5O A;  2HND A;  4JRP A;  4N56 A;  1HQU A;  1S1V A;  4CEC A;  3ZT2 A;  4IG3 A;  1LW2 A;  3AO2 A;  2HHT A;  3RR8 A;  2G8I A;  4KI4 A;  4E1M A;  3OYF A;  4PQU A;  1SV5 A;  3M8P A;  3ALY A;  1VSJ A;  3MEG A;  3MEC A;  4AH9 A;  4HHT A;  3SCX A;  1W0H A;  4QAG A;  1BCM A;  3B6O A;  1A5X A;  4KB0 A;  4IDK A;  1XHZ A;  1JLF A;  3KLE A;  3SI6 A;  2VG6 A;  1VRU A;  4CEQ A;  2P1J A;  1ITG A;  3K5L A;  3HXM A;  4CCH A;  1C1C A;  1QSL A;  3OJS A;  4CF8 A;  4FJJ A;  4CGH A;  2HHS A;  2D0B A;  4CGG A;  3PX6 A;  3TI0 A;  2PYL A;  4AHU A;  1O1W A;  2Z1H A;  2FBY A;  3NCI A;  3KK3 A;  1VSH A;  3CQ8 A;  2IDO A;  3QLH A;  4CHQ A;  1TGO A;  1U47 A;  1GOC A;  4M3W A;  3OYK A;  4BDP A;  4OKJ A;  2IGI A;  4OPJ A;  1NKB A;  2PYJ A;  3BDP A;  3VA0 A;  1NK9 A;  1LV5 A;  1WSI A;  1RDC A;  3OYA A;  3QEV A;  4CJQ A;  3SPY A;  1YVU A;  3V9W A;  1ZYQ A;  1T8E A;  3KK2 A;  3CFR A;  1RNH A;  2YHA A;  4CJL A;  4O55 A;  2R7Y A;  1D9D A;  2EX3 A;  3WNG A;  3OVN A;  2JGU A;  1BIU A;  4DQR A;  1YTU A;  4RW8 A;  2VG7 A;  2JLE A;  3DRR A;  4NCB A;  4Z4F A;  4G1Q A;  2HHX A;  4FLY A;  2DTU A;  3MAQ A;  3KD5 E;  1XI1 A;  1X9M A;  4FLX A;  1NK7 A;  3F73 A;  5E41 A;  1BQN A;  3C6U A;  4CFD A;  1N5Y A;  4IFY A;  1KVA A;  3ZSV A;  3KLH A;  1X1P A;  4AHR A;  2KFN A;  3M8Q A;  1CXQ A;  3SQ1 A;  3NHG A;  1FXX A;  2OPR A;  2Z1G A;  4FZZ A;  2HHQ A;  1FKP A;  5DMR A;  5CZ2 A;  4HUG A;  2FBV A;  1XWL A;  1SKW A;  4N41 A;  1NOZ A;  4NYN A;  4FLZ A;  1XHX A;  1KSP A;  2IAJ A;  1CLQ A;  4O0J A;  4C8L A;  3A2F A;  4LY7 A;  4FLT A;  3SYZ A;  4ZHR A;  3AVH A;  3ZSQ A;  4CJT A;  3OYN A;  4CJS A;  1IH7 A;  1ZBU A;  3QEP A;  2X6N A;  4RW7 A;  2HW3 A;  1NJW A;  3AVB A;  1UWB A;  1S1W A;  3DLB A;  3E01 A;  3AO5 A;  4FJM A;  3WNF A;  3EY1 A;  2YNH A;  1VSK A;  3LAM A;  1S9G A;  1RDB A;  2OPQ A;  4DTS A;  1JLE A;  5DK5 A;  3QEX A;  2W42 A;  1VSE A;  4OKK A;  3VQB A;  3AA4 A;  3HJF A;  1VSM A;  1IO2 A;  3DOK A;  1WSJ A;  4LH5 A;  1C1A A;  3MEE A;  4ID5 A;  3VQ9 A;  4CEF A;  4DFK A;  4EZ6 A;  4FJ7 A;  3QEW A;  5K14 A;  4E7H A;  4K8X A;  5HRO A;  3HPH A;  3TAG A;  1U48 A;  3K58 A;  3PY8 A;  4FW1 A;  4ID1 A;  3NFA A;  4FCY A;  3LPU A;  4DFJ A;  4CEZ A;  2F96 A;  3C95 A;  3VA3 A;  2G8F A;  1RT2 A;  4J2A A;  1HQE A;  1RCH A;  1U04 A;  1Q9Y A;  4B9S A;  2YNF A;  3OYB A;  4GMJ B;  2D0A A;  4FJN A;  1ZBH A;  4AHC A;  2DFE A;  2YNG A;  1HRH A;  4I9L A;  4DTU A;  1JL1 A;  1HYZ A;  1RT1 A;  2RPI A;  3OJU A;  2HVH A;  2PY5 A;  4CGJ A;  1RT6 A;  1XC9 A;  1WN7 A;  4E7K A;  1WNS A;  1S6P A;  2YV0 X;  3TR8 A;  4AIL C;  3HYF A;  1LAV A;  4DTJ A;  3KTQ A;  4CF1 A;  4I9Q A;  4PWD A;  2KTQ A;  4KTZ A;  4KRE A;  3PO5 A;  3VQP A;  3ZSX A;  3ZSY A;  2YKM A;  4HUF A;  3OS1 A;  1RTH A;  1C0T A;  5KGW A;  3U3Y A;  4KTW A;  3CM6 A;  3AA5 X;  3PX4 A;  4CHY A;  3SUQ A;  3NH1 A;  3MXI A;  2BGG A;  3ZSW A;  2VG5 A;  4PY5 A;  3IG1 A;  1WSH A;  2O4G A;  4CFB A;  3IRX A;  3TAF A;  2DFF A;  4J2B A;  4M3U A;  4GW6 A;  4FZY A;  2G8V A;  3HM9 A;  4EP4 A;  3VQD A;  4KFB A;  4OPK A;  4W5R A;  4HVJ A;  4CJV A;  4E7L A;  1KVC A;  3AVF A;  1G15 A;  3WNE A;  5KTQ A;  4DTN A;  3TAR A;  2HVI A;  1NKC A;  1TK5 A;  3P1G A;  4KRF A;  3CFP A;  4RW9 A;  2F8S A;  3ZSZ A;  1YT3 A;  4DU3 A;  1RTI A;  3RMB A;  1RDA A;  3AV9 A;  4CIE A;  2Q3S A;  3C94 A;  2Z1I A;  4CEO A;  2Y1J A;  3MED A;  4OGC A;  1BIZ A;  4ELU A;  4OVL A;  3H08 A;  3ISN C;  3QIN A;  3I0S A;  3SV4 A;  1WSF A;  4DS5 A;  1C0U A;  1DTQ A;  1KLM A;  1ASU A;  2IC3 A;  4DMN A;  4CK3 A;  3QNN A;  5HLF A;  1D9F A;  3CM5 A;  1EX4 A;  3QIP A;  4C8M A;  3IAY A;  3QES A;  4DLG A;  3V9U A;  4LD0 A;  4M45 A;  4E3S A;  3DOL A;  1JXB A;  4DSL A;  4CK2 A;  5C25 A;  2G8K A;  4M3X A;  2P51 A;  4FW2 A;  3QNO A;  1A5W A;  1LW0 A;  1BGX T;  3T3F A;  1NK4 A;  3CG7 A;  3AVL A;  3LPT A;  4CF2 A;  2GBZ A;  1L3U A;  4NCG A;  1SKR A;  4F2R A;  4DFP A;  4FJI A;  1UA1 A;  3O4Q A;  3OYH A;  3AVM A;  1NJX A;  1KFD A;  4FJ8 A;  1X9W A;  1KFS A;  1BHL A;  2VWK A;  3SZ2 A;  4Z4I A;  4B8C A;  4CIF A;  4BE0 A;  1RBU A;  4CJ4 A;  5D3G A;  1HYS A;  1VSL A;  3HO1 A;  3QER A;  2KFZ A;  1JL2 A;  3LWM A;  2E6L A;  2HNY A;  4DSI A;  4CHZ A;  4HTU A;  2DFH A;  4ZTJ A;  1N6Q A;  4AHT A;  3O3G A;  4RG8 A;  1RDD A;  4CER A;  5KRT A;  1TAU A;  1X9S A;  2Y1I A;  4UQG A;  3TAP A;  3I8D A;  3TAM A;  4Z4E A;  3LWL A;  1SL2 A;  4DF4 A;  3KKS A;  3VQC A;  3EZ5 A;  2FBX A;  1LWE A;  3NGY A;  5HRS A;  1QHT A;  5JS2 A;  1R0A A;  4M3T A;  4BWJ A;  1SL0 A;  3DLR A;  2XY6 A;  4IG0 A;  4LSN A;  3NDK A;  4DQI A;  3S3N A;  1TL1 A;  4BDZ A;  3AO4 A;  3VQE A;  4QCL A;  3I0R A;  2QK9 A;  4O44 A;  3LAL A;  3QO9 A;  4B9L A;  1UOC A;  1WAJ A;  4CK1 A;  4KHS A;  3V1R A;  3LAK A;  1NK0 A;  1C6V A;  2HB5 A;  4FJG A;  3RRG A;  5KI6 A;  1B9F A;  3OYL A;  4DQP A;  2YHB A;  4W5T A;  4JLH A;  5HBM A;  5I3U A;  1NJY A;  3SUN A;  4DTM A;  2E4L A;  1ASW A;  3OYG A;  3AVN A;  1D8Y A;  4B9U A;  1BQM A;  1HYV A;  3NF6 A;  4DG1 A;  4CE9 A;  4Y1C A;  1ZBF A;  4W5O A;  1LAW A;  3V4I A;  3PO4 A;  4EZ9 A;  3NH0 A;  3ITH A;  3ASM A;  3SNN A;  2X78 A;  4FM1 A;  1Z26 A;  4KO0 A;  4CJU A;  4DQQ A;  3AVJ A;  5T7B A;  4OJR A;  3CYM A;  3KLI A;  1WAF A;  1NKE A;  2ATQ A;  4BE2 A;  3QET A;  3RMD A;  4F8R A;  4N76 A;  4CHP A;  2YKN A;  4FJK A;  3JYT A;  2KZM A;  1S1T A;  1U4B A;  3SQ2 A;  4I7F A;  4B08 A;  4K8Z A;  4DU1 A;  2F8T A;  2OPS A;  3IS9 A;  4H4M A;  4CF0 A;  4KKO A;  5J2P A;  1NOY A;  3VQA A;  1TL3 A;  2XO7 A;  4BDY A;  5KGX A;  2QKK A;  3KD1 E;  1TVR A;  4IKF A;  3DRS A;  3D0P A;  3TAQ A;  2DY4 A;  2B5J A;  4F3T A;  3KLF A;  1VK0 A;  3THV A;  2RKI A;  4W5N A;  4KV8 A;  5CYQ A;  3S3O A;  1QSS A;  3DYA A;  3RTV A;  3B6P A;  1T03 A;  3AO1 A;  4E0D A;  2WOM A;  1JKH A;  2HNZ A;  3KJV A;  3NH2 A;  3SPZ A;  3DLE A;  1FKO A;  1D5A A;  5J2Q A;  1RBR A;  3LZJ A;  4HUE A;  4DLE A;  2A1R A;  5C42 A;  2HHV A;  1BIS A;  2I5J A;  4HCC A;  3AVC A;  3L2Q A;  3L8B A;  3V81 A;  4FK2 A;  4KB1 A;  3AVG A;  3VQQ A;  4DFM A;  5KRS A;  1HPZ A;  5FRN A;  4DSE A;  4KHU A;  3S3M A;  2ETJ A;  1DTT A;  4OLA A;  2RN2 A;  3RMC A;  4I2P A;  1U45 A;  4OGE A;  3ZT4 A;  2OA8 A;  2QKB A;  4EP5 A;  3OYC A;  2VWJ A;  2WON A;  3DLH A;  4NCA A;  1BI4 A;  3AVI A;  5J2M A;  3SUO A;  1J9A A;  3RWU A;  4E19 A;  1UAX A;  3VQ7 A;  4N5S A;  4W5Q A;  1EP4 A;  1BI4 B;  1HJR A;  3L3U A;  4BE1 A;  1JLQ A;  4Z4G A;  4CJW A;  1F21 A;  3NE6 A;  5EU7 A;  1RTJ A;  4C8N A;  3VQ4 A;  3V1O A;  4CHN A;  1KRP A;  1L3V A;  1U49 A;  4J2D A;  1ZBI A;  3BGR A;  3KIO A;  3SQ4 A;  3G10 A;  3NF8 A;  4CGD A;  5CY4 A;  2KW4 A;  3EYZ A;  1TAQ A;  2G8W A;  1TK0 A;  3NGI A;  4GVM A;  4DTR A;  1J5O A;  5J1E A;  1VSD A;  1T05 A;  5HP1 A;  1KTQ A;  4IBN A;  1ASV A;  4ELV A;  4Q0B A;  3OYI A;  4FM2 A;  1WLJ A;  4FLW A;  1CZB A;  4CF9 A;  2X74 A;  4E7J A;  4CJK A;  3LAN A;  1HNV A;  3QEI A;  1S5J A;  4CGI A;  4O0I A;  1NJZ A;  4QOZ B;  4KAZ A;  3ZCM A;  3D45 A;  1A5V A;  4CFC A;  1UA0 A;  4C8K A;  1J54 A;  1J53 A;  4DF8 A;  3L2V A;  4Q5V A;  3K5N A;  4CGF A;  1NK8 A;  2HHU A;  2Z1J A;  3TAE A;  1KLN A;  3ZT0 A;  4CJ5 A;  3NAE A;  2B4J A;  1TV6 A;  2PZS A;  4FJ9 A;  3OYM A;  2OZS A;  1TKZ A;  2QXF A;  1RT4 A;  2D0C A;  3LP2 A;  1RIL A;  4DSF A;  1WSE A;  3KKR A;  3NF7 A;  4CEB A;  1ZBL A;  4FK0 A;  3O4N A;  1Q9X A;  1QE1 A;  2FC0 A;  1CXU A;  3LZI A;  1Q8I A;  3C6T A;  1S9E A;  1IKY A;  1VSI A;  3AVK A;  1NK6 A;  4JRQ A;  3U6F A;  2G8H A;  4B9N A;  4C8O A;  1BL3 A;  1LWC A;  4E89 A;  1K6Y A;  3HP6 A;  1T7P A;  4MFB A;  2P5O A;  2LSN A;  2IS3 A;  3LP0 A;  3DM2 A;  3DMJ A;  4AHV A;  5SWM A;  1WSG A;  1QTM A;  3OYE A;  3ZT1 A;  2AJQ A;  1VRT A;  4MQ3 A;  2OYQ A;  4HCB A;  5FRM A;  4O4G A;  5CZ1 A;  3KK1 A;  4YNQ A;  1RBT A;  4RW4 A;  3K59 A;  2O4I A;  1B9D A;  4KHQ A;  3L2U A;  2KQ2 A;  3OY9 A;  3HST B;  2ZQB A;  1EKE A;  3HK2 A;  3T1A A;  2XHB A;  4M3R A;  4J2E A;  4FJ5 A;  4DS4 A;  4M3Y A;  1L3S A;  4B9M A;  1EXQ A;  3P5J A;  4CHO A;  3AA2 A;  1JXE A;  2EHG A;  3DLG A;  4LSL A;  4FYD A;  3M8S A;  2X6S A;  1JLB A;  1SUQ A;  5JS1 A;  4FVM A;  4CES A;  5C24 A;  3OYD A;  5CYM A;  3M8R A;  2XY8 A;  4TSX A;  3P83 D;  4Y1D A;  3HVT A;  4PA1 A;  4M42 A;  2ZE2 A;  3SUP A;  2HMI A;  3F9K A;  3MXJ A;  4FJH A;  1QS4 A;  1Y97 A;  4KHN A;  1LWF A;  3VQ5 A;  4CJ3 A;  3HP9 A;  1BCO A;  5SZT A;  3ULD A;  2XY7 A;  3U3G A;  3O3F A;  2IOC A;  1EET A;  2OPP A;  5HRN A;  3DI6 A;  4CJP A;  3NGZ A;  4BAC A;  3V9Z A;  3O3H A;  1JLG A;  2FBT A;  3S9H A;  2BE2 A;  4XIU A;  2KZZ A;  4CJR A;  1L3T A;  4H4O A;  4CIG A;  4DQS A;  3SV3 A;  1RT5 A;  1TKD A;  4DSJ A;  3G0Z A;  1IKV A;  3ZSR A;  3TAN A;  2D5R A;  4L8R B;  4AHS A;  1RTD A;  4DTX A;  3WNH A;  3L3V A;  4DSK A;  3PX0 A;  3AA3 A;  3DLK A;  1GOB A;  3TAB A;  4FJL A;  2YNI A;  1REV A;  4Z4H A;  4FJX A;  2BDP A;  4FZX C;  3HPO A;  1SKS A;  1JLA A;  3LDS A;  1TKT A;  2XY5 A;  2E6M A;  5J2N A;  3V9S A;  2HHW A;  1I3A A;  3PV8 A;  4B9T A;  3NF9 A;  4H8K A;  4F3O A;  1CZ9 A;  1DLO A;  3UIQ A;  4B3O A;  3DRP A;  4CEA A;  2RF2 A;  3RRH A;  4B9V A;  1IKX A;  3K5M A;  4M3Z A;  4YFU A;  1YTA A;  3ZSO A;  3HVR A;  1Z25 A;  1HMV A;  4DTP A;  4JS4 A;  1RT3 A;  4OKE A;  4FLV A;  3RMA A;  2XRI A;  1NK5 A;  3VQ8 A;  3VN5 A;  4ELT A;  4KHY A;  4CJF A;  4N47 A;  1TKX A;  4WE1 A;  5FDL A;  1S1U A;  1VSF A;  4NYF A;  3OS2 A;  3RR7 A;  5HRP A;  1KCF A;  2NUB A;  2GUI A;  1HNI A;  3K57 A;  1QSY A;  2G8U A;  1IG9 A;  3KLG A;  4DU4 A;  2OZM A;  4DWI A;  1IKW A;  4KPY A;  4LH4 A;  1S1X A;  2BAN A;  3HL8 A;  4KTQ A;  4PUO A;  3AO3 A;  1RBS A;  2GV9 A;  3LP1 A;  1RT7 A;  4F2S A;  4KI6 A;  1I39 A;  1SL1 A;  3HPG A;  3NBP A;  3L2W A;  3OYJ A;  3V9X A;  1L5U A;  3V6D A;  4ZTF A;  3VQ6 A;  1TK8 A;  5HRR A;  5FRO A;  1W9H A;  4CFA A;  2A1S A;  4FM0 A;  3V1Q A; 
#chains in the Genus database with same CATH topology
 3VTH A;  3LDO A;  3PUF A;  3K2P A;  4ICL A;  3NVM A;  3CMA N;  4FLU A;  4F4K A;  4IJN A;  4GKJ K;  1QQC A;  2GWK A;  3G4S N;  1FK9 A;  3LP3 A;  2D0P A;  5AQR A;  4AF1 A;  3LDQ A;  2B6A A;  3OS0 A;  2A41 A;  4E7I A;  4DV4 K;  3MXM A;  4CZL A;  5AQF A;  5AQP A;  3ZT3 A;  4BWM A;  1KVB A;  1K8K A;  3CFO A;  1YIJ N;  1JJ2 M;  3FFK B;  2HND A;  3H46 O;  3SAF A;  5BRD A;  2QWN A;  3RR8 A;  3OYF A;  4PQU A;  1RFQ A;  2F9W A;  1VSJ A;  4HHT A;  4AH9 A;  3SCX A;  1IBK K;  1W0H A;  1BCM A;  3H1V X;  4KB0 A;  4DR4 K;  1XHZ A;  3KLE A;  3J7A P;  4CEQ A;  2P1J A;  3DWL A;  4YOY A;  5AQU A;  3K5L A;  4BRL A;  3J81 O;  3OJS A;  4FJJ A;  2VGM A;  1O1W A;  1VSH A;  1ATR A;  2IDO A;  4ISE A;  3SLC A;  4EAH D;  3A0I X;  3T7Z A;  3BDP A;  2NRW A;  4QOZ B;  4H0X B;  1YVU A;  1T8E A;  2ZGZ A;  3MWP A;  4CJL A;  2EX3 A;  3WNG A;  3OVN A;  2JGU A;  4RW8 A;  2VG7 A;  3DRR A;  3DXK A;  4DHY A;  1U2V A;  4Z4F A;  3WXJ A;  4CBX A;  3KD5 E;  3F73 A;  3VEN A;  5AQI A;  1KVA A;  5FLX O;  3O1B A;  4CD1 A;  3M8Q A;  1CXQ A;  3SQ1 A;  2OPR A;  2HHQ A;  1IBL K;  5DMR A;  5LMU K;  1XWL A;  4N41 A;  4FLZ A;  4BR2 A;  3P31 A;  5JVG L;  2QI2 A;  1CLQ A;  2W6L A;  3MMV A;  3SYZ A;  3ZSQ A;  2HW3 A;  2UXB K;  3K0S A;  1S1W A;  1WUA A;  3E9P A;  3FZK A;  3DLB A;  2YNH A;  1RDB A;  1Q7Y O;  3AAP A;  5JMV A;  1TYQ B;  3WQT A;  3VQB A;  2ZJQ L;  3DOK A;  5JLF A;  3N4P A;  4LH5 A;  2NRH A;  2HMP A;  2YJE A;  4EZ6 A;  3CHW A;  4IZ9 A;  4WFA L;  4CEZ A;  3FGU A;  4CZK A;  4EFH A;  1ZBH A;  3IDH A;  2DFE A;  2YNG A;  4I6M B;  4X64 K;  2BUP A;  4GV3 A;  1EQY A;  5BRE A;  3C0B A;  1S6P A;  3MN9 A;  3HYF A;  1LAV A;  4DTJ A;  4CF1 A;  4I9Q A;  4KTZ A;  3H3O B;  3VQP A;  1CZA N;  3OS1 A;  1C0T A;  4KTW A;  3AA5 X;  3SUQ A;  3NH1 A;  2BGG A;  3IG1 A;  4CFB A;  3BZK A;  4M3U A;  1C0F A;  4LF4 K;  4FVU A;  1KVC A;  3AVF A;  4GY2 B;  4CJ7 A;  4H0O A;  2FLO A;  4CZH A;  3CFP A;  4RW9 A;  1YT3 A;  4DU3 A;  3FZH A;  1RDA A;  4CIE A;  1V4S A;  4GV9 A;  3VF4 A;  2Z1I A;  3SV4 A;  1C0U A;  1DTQ A;  1KLM A;  4DMN A;  4CK3 A;  4DV7 K;  4PL7 A;  3SK3 A;  5HLF A;  3CM5 A;  3IAY A;  4C8M A;  3V9U A;  3TTF A;  1R59 O;  4CK2 A;  2OCE A;  3KWG A;  2W40 A;  1A5W A;  3T3F A;  2ASM A;  3THX A;  3WQU A;  5LY3 A;  1GLC G;  3ZX2 A;  1L3U A;  4U7B A;  4DFP A;  2Q0U A;  2KKZ A;  3AVM A;  1KFD A;  5AQW A;  4Z4I A;  4B8C A;  1HYS A;  3QER A;  3HBT A;  2E6L A;  4OPA A;  4OO1 J;  3O3G A;  1TAU A;  5KQD A;  1XMQ K;  1C0G A;  4DF4 A;  3KKS A;  3HRG A;  4B1V A;  1VQL N;  5HRS A;  1LWE A;  1NGA A;  4PKI A;  1R0A A;  3PIO L;  3VF2 A;  4B3T K;  1QQN A;  3R6M A;  3C65 A;  1TL1 A;  4BDZ A;  5GAE P;  4QCL A;  2QK9 A;  1UOC A;  1N34 K;  4FWO A;  5GIO A;  4WQ5 A;  5KI6 A;  3OYL A;  4DQP A;  5E84 A;  3A8Y A;  2Q97 A;  4JLH A;  4JI3 K;  4V19 S;  3SUN A;  4DTM A;  1HYV A;  4NO7 A;  3ITH A;  3SNN A;  4DQQ A;  1BOT O;  4OJR A;  1WAF A;  1NKE A;  2ATQ A;  3QET A;  4C1N I;  3CXC M;  4CHP A;  1T3V A;  3E66 A;  4BR5 A;  3JYT A;  4FJK A;  4C23 A;  3FR0 A;  4CF0 A;  4MO4 A;  2GWJ A;  4KKO A;  5J2P A;  1NOY A;  1N33 K;  5KGX A;  1TVR A;  3DRS A;  4F3T A;  3KLF A;  2RKI A;  4WQ4 C;  4KV8 A;  3S3O A;  5ADX H;  3B6P A;  3KJV A;  3NH2 A;  2O8D A;  2JWL A;  1D5A A;  3CIP A;  1BIS A;  3AVC A;  3D2E A;  4GKK K;  3M5R A;  1HPZ A;  4DSE A;  3S3M A;  1HLU A;  1TUY A;  1U45 A;  2OA8 A;  3OYC A;  4BR0 A;  3ENH A;  3DLH A;  5J2M A;  3SUO A;  1J9A A;  3HOT A;  1V4T A;  4W5Q A;  2A5X A;  4IOX A;  4Y0W A;  1XNQ K;  5BN9 A;  3NE6 A;  1RTJ A;  3ZEU B;  4CHN A;  3N4Q A;  3THY B;  3KIO A;  2GX9 A;  4LF9 K;  3HSC A;  2HHH K;  3NF8 A;  2KW4 A;  5LJW A;  3EYZ A;  2G8W A;  5KPR A;  3TSP A;  1SQK A;  3A5L C;  1VSD A;  5J1E A;  1T05 A;  1KTQ A;  4FM2 A;  1N32 K;  1CZB A;  4CF9 A;  4DCH A;  2ZF5 O;  3QEI A;  4DUY K;  1OH7 A;  1JCF A;  4C8K A;  3SBG A;  5LJV A;  3L2V A;  3K5N A;  1KLN A;  1YHQ N;  3NAE A;  4FJ9 A;  1TKZ A;  2PY5 A;  5KQ8 A;  1NGH A;  3NF7 A;  4DSF A;  3O4N A;  3D2F A;  1S9E A;  1IKY A;  1VSI A;  4C8O A;  3M3Z A;  1LWC A;  3HP6 A;  4MFB A;  3DM2 A;  3DMJ A;  2AJQ A;  4BC2 A;  4BY9 C;  4MQ3 A;  2YI1 A;  2OYQ A;  4RTF D;  3BF1 A;  5M1P A;  2RHK A;  5C12 A;  4BGB A;  3OY9 A;  3HST B;  4BC3 A;  3VGL A;  3ZX3 A;  3QFU A;  5EOY A;  3AA2 A;  3I56 N;  4FYD A;  1SUQ A;  4EHU A;  3OYD A;  4AQY K;  3SUP A;  3FE1 A;  3F9K A;  3MXJ A;  2Q1N A;  4BC5 A;  1LWF A;  5SZT A;  1YF5 L;  1BO5 O;  4A57 A;  5H1S Q;  3U3G A;  3O3F A;  3DXM A;  4BAC A;  3DI6 A;  2Q0R A;  2YX6 A;  3WEE B;  4FO0 A;  2BE2 A;  4XIU A;  2KZZ A;  3UKU A;  4DSJ A;  1RT5 A;  1IKV A;  1ATS A;  3ZSR A;  3TAN A;  5AQV A;  2D5R A;  4DB3 A;  3F2K A;  4AHS A;  3L3V A;  3PX0 A;  3AA3 A;  3DJC A;  5F0X A;  2PFU A;  5C10 A;  2I7P A;  4BRA A;  4NLC A;  1SKS A;  3LDS A;  3E9O A;  4H8K A;  1DLO A;  4CEA A;  1BWF O;  1YTA A;  3ZSO A;  2HBM A;  4JS4 A;  5M1O A;  3RMA A;  2ZJP L;  4N47 A;  4DQ8 A;  4WYB A;  1KCF A;  2NUB A;  3O8M A;  5C2F A;  1IG9 A;  4JEP A;  4IOC L;  1OVQ A;  2BAN A;  4PUO A;  2FSJ A;  5BPL A;  4KI6 A;  1X3M A;  1I39 A;  5AQG A;  1YUW A;  3HPG A;  3NBP A;  4IWV A;  3OBW A;  1HJO A;  3V9X A;  3CJ7 A;  3O1W A;  3UE5 A;  4ZTF A;  4JI2 K;  5LMN K;  4B9Q A;  4CFA A;  4MLH A;  3VA0 A;  3CCM N;  3GE1 A;  4ISF A;  2WC9 A;  4RW6 A;  4FK4 A;  4DR1 K;  1FW6 A;  1ZXO A;  2W6K A;  4OLB A;  3CJA A;  4FL9 A;  4BRQ A;  1JLC A;  3M6G A;  4Z94 A;  1C0M A;  3O9R A;  4IFV A;  3QIO A;  1ATN A;  3I8B A;  4BRH A;  3TWH A;  2P5G A;  4JS5 A;  4CJE A;  4KHW A;  1XNR K;  4LC9 B;  3BZC A;  1VQ6 N;  5BRH A;  4CEC A;  1HX1 A;  4MDA A;  2HHT A;  3MDQ A;  2G8I A;  1SV5 A;  3MEG A;  4MO5 A;  3EL2 A;  4QAG A;  3EEQ A;  1JLF A;  4NXN K;  2AA4 A;  1VRU A;  1ITG A;  3DAW A;  3PX6 A;  2PYL A;  4DR2 K;  4JI5 K;  1TGO A;  4M3W A;  3OYK A;  4BDP A;  5CE3 A;  3H6E A;  4H5N A;  4OPJ A;  1NKB A;  1LV5 A;  1NK9 A;  3CD6 N;  1RDC A;  2NLX A;  3SPY A;  4LFC K;  5AQM A;  3PY8 A;  2R7Y A;  1RNH A;  2YHA A;  4NLB A;  4JI1 K;  1YTU A;  4FLY A;  2O8B A;  1YAG A;  3C6U A;  4CFD A;  3THW B;  4IFY A;  4AHR A;  3ZLJ A;  3NHG A;  1FXX A;  2Z1G A;  4ISG A;  2W41 A;  3VEV A;  4HUG A;  2FBV A;  1SKW A;  1NOZ A;  3G25 A;  2GUP A;  2QWM A;  5F2R A;  4BG9 A;  1XHX A;  1NGB A;  2IAJ A;  1MDU B;  5EX5 A;  4O0J A;  4CBW A;  1Z6R A;  4LY7 A;  4FLT A;  2F7T A;  4ZHR A;  3AVH A;  2HHX A;  3QEP A;  4CJS A;  2X6N A;  2YJF A;  1VAZ A;  3AVB A;  1DEJ A;  3WNF A;  1LCU A;  4JKG A;  1VSK A;  5DK5 A;  3AGK A;  3HJF A;  1IO2 A;  1RDW X;  4JYA K;  4A5A A;  4H0V B;  3MEE A;  3VQ9 A;  3SJH A;  4E7H A;  4K8X A;  5HRO A;  3TAG A;  4O8K A;  3H3N O;  1JCE A;  3LPU A;  2F96 A;  3C95 A;  3D7E O;  2KHO A;  1HQE A;  3OW2 M;  4B9S A;  3LL3 A;  1Q9Y A;  1KAX A;  3CJ9 A;  1HYZ A;  2RPI A;  3HI0 A;  3CCR N;  1XC9 A;  1RT6 A;  2O8E B;  1WN7 A;  1BUP A;  1WNS A;  2YV0 X;  4E7K A;  3TR8 A;  1EWR A;  5AQH A;  2KTQ A;  3KTQ A;  1NM1 A;  1ILY A;  1KC8 O;  3HTV A;  5KGW A;  4BGA A;  1OH6 A;  3MXI A;  5FPE A;  3TTD A;  2G8V A;  4EP4 A;  3VEO A;  3VQD A;  1HNZ K;  4BRF A;  4HVJ A;  1X9J A;  4CJV A;  4MDB A;  3ZET B;  2YHX A;  4FWP A;  4BRK A;  2DPN A;  4KRF A;  1OH8 A;  4G9Z A;  1Q18 A;  2QWP A;  2Q3S A;  3H45 C;  1YJN N;  4OGC A;  1BIZ A;  4OVL A;  3H08 A;  4JHD A;  4FXD A;  2VWB A;  2IC3 A;  3M1F A;  1BG3 A;  3QIP A;  5AR0 A;  4B3S K;  4M45 A;  4DSL A;  2G8K A;  4M3X A;  4FW2 A;  1NK4 A;  1BGX T;  3CG7 A;  3VPZ A;  1SKR A;  3OYH A;  1NJX A;  4DV2 K;  4FJ8 A;  2VWK A;  4BE0 A;  4CIF A;  4R79 A;  3R9P A;  3EO3 A;  3HO1 A;  3A5N C;  2FSK A;  5F1X A;  3LWM A;  3UKR B;  2DFH A;  1RDD A;  4CER A;  1X9S A;  3O6W A;  3TAP A;  5AZJ B;  3TAM A;  2Q31 A;  1NGI A;  1SL2 A;  1WBB A;  4EHT A;  2O8C B;  3NGY A;  1QHT A;  1OKJ A;  3ENB A;  4MLE A;  1EWQ A;  2XY6 A;  3R8E A;  3RSE A;  4A61 A;  2V52 B;  1M90 O;  2WBN A;  3QO9 A;  4B9L A;  1WAJ A;  4DV6 K;  4CK1 A;  3V1R A;  3LAK A;  1NK0 A;  2WTU A;  4FJG A;  3RRG A;  2E2Q A;  4BR4 A;  5I3U A;  3AVN A;  1HKB A;  4CVN E;  3PO4 A;  3V4I A;  3ID8 A;  3VEW A;  3ASM A;  1E3M A;  1Z26 A;  4CJU A;  2NRZ A;  3AVJ A;  3IKM A;  4F8R A;  3B8A X;  1S1T A;  4DU1 A;  2F8T A;  2OPS A;  4H4M A;  4H5W A;  1WBD A;  2XO7 A;  4JKA A;  2DY4 A;  2B5J A;  3R3L A;  4DV3 K;  3AO1 A;  1NU0 A;  1JKH A;  2HNZ A;  3DLE A;  4PHT X;  3LZJ A;  4DLE A;  1Q82 O;  4BRO A;  2QWL A;  3L2Q A;  4FK2 A;  1P8Z A;  1QQO A;  4KB1 A;  4KHU A;  2ETJ A;  1DTT A;  1XMO K;  3RMC A;  3VGK A;  2WON A;  1BI4 A;  3AVI A;  3RWU A;  1UAX A;  3TTC A;  1EP4 A;  1HJR A;  3MN6 A;  3L3U A;  4BE1 A;  4Z4G A;  3VQ4 A;  3V1O A;  1MA9 B;  3CPE A;  4JD2 A;  2QM1 A;  1ZBI A;  2QWQ A;  3SQ4 A;  3CC7 N;  4CGD A;  4BVP A;  2P9S B;  3CI5 A;  1TAQ A;  1Y64 A;  3L4Q A;  4DR7 K;  4GVM A;  5HP1 A;  5AFU H;  3G71 N;  4IBN A;  3OHR A;  3OYI A;  4IO8 A;  1IBM K;  3BEX A;  1S5J A;  2ZM6 K;  4O0I A;  1NJZ A;  2VQF K;  3D45 A;  2UUA K;  1A5V A;  2Z1J A;  5FPN A;  4CJ5 A;  3CJB A;  2B4J A;  2PZS A;  3OYM A;  2OZS A;  3LP2 A;  3WXM B;  1WSE A;  1ZBL A;  1Q9X A;  1K9M O;  3LZI A;  1NK6 A;  4JRQ A;  4B9N A;  3AGR A;  1K6Y A;  4JKH A;  1QTM A;  2IS3 A;  4K43 A;  4AHV A;  2GEL A;  2P9P B;  3OYE A;  5IT9 O;  1VRT A;  4HCB A;  2E5L K;  1YVN A;  4O4G A;  3C7N B;  1RBT A;  3K59 A;  2P9I A;  2P9U A;  2A42 A;  3ULE B;  2V7Y A;  2KQ2 A;  2O8F B;  3T1A A;  2XHB A;  4J2E A;  1NWK A;  1L3S A;  3HZ6 A;  3P5J A;  3DLG A;  3KZB A;  2X6S A;  5CYM A;  4TSX A;  3CME N;  3P83 D;  4Y1D A;  4M42 A;  2ZE2 A;  3E1Y A;  3CCL N;  2P9L B;  1QS4 A;  3SAG A;  2CH6 A;  3P38 A;  4CJ3 A;  4WQ5 C;  1BCO A;  4NB4 A;  1WB9 A;  3ULD A;  4IDH A;  2OPP A;  1EET A;  3O08 A;  1JLG A;  2P9K B;  1VQ8 N;  4CJR A;  4H4O A;  4DQS A;  5C2D A;  1GLL O;  1XC3 A;  4L8R B;  1RTD A;  1I94 K;  2IVN A;  2E88 A;  1GOB A;  1S72 N;  4BQZ A;  2BDP A;  4JNE A;  5GAG P;  1TKT A;  3V9S A;  1CZ9 A;  3KWI A;  3R1X A;  3RRH A;  1M1K O;  1IKX A;  4YFU A;  2FSN A;  1Z25 A;  3O4W A;  4DTP A;  2UUB K;  1HKG A;  3J80 O;  1RT3 A;  2AP1 A;  3CF5 L;  1NK5 A;  2E20 A;  5BPN A;  4KHY A;  5IWA K;  1TKX A;  4B3M K;  5FDL A;  1S1U A;  5I9E B;  3OBY A;  1QSY A;  2V7Z A;  3ZX0 A;  3KLG A;  2QW9 A;  4KPY A;  4LH4 A;  4BVO A;  4HWI A;  1RBS A;  3AO3 A;  1RT7 A;  2E1Z A;  1P90 A;  3L2W A;  4J8F A;  1L5U A;  1TUU A;  5BN8 A;  3EKS A;  3E9L A;  5AQS A;  5TKW A;  2P9N B;  3G6E N;  1RBV A;  3IUC A;  5I42 A;  3F9M A;  4Z4C A;  3WXI A;  3SQ0 A;  4E1N A;  4O5B A;  3HT3 A;  1NGF A;  2BTF A;  1GOA A;  2VYP A;  3MX2 A;  4Z0U A;  3JSM A;  3EE9 A;  3T19 A;  1B92 A;  4CED A;  2ZD1 A;  4JKE A;  3SJJ A;  1C1B A;  3FFI A;  3DLL L;  2CH5 A;  3L2R A;  4QS9 A;  3K5O A;  1NBW A;  4XEI A;  1VQK N;  4NXM K;  1K8K B;  4N56 A;  3ZT2 A;  4A5B A;  4FWL A;  4KI4 A;  3SAH A;  1NGG A;  3M8P A;  4XH5 A;  1A5X A;  4KH6 A;  3SI6 A;  2VG6 A;  4FSV A;  1KAY A;  4L3Q A;  4CCH A;  4DV5 K;  1HUX A;  4H5R A;  1BDG A;  3TI0 A;  1RDU A;  2FBY A;  3NCI A;  3KK3 A;  3CQ8 A;  4A2B A;  3QLH A;  4CHQ A;  1U47 A;  2D4W A;  4OKJ A;  2IGI A;  4K0K K;  1WSI A;  3OYA A;  3QEV A;  1ZYQ A;  3V9W A;  3KK2 A;  3CFR A;  1YI2 N;  2HF4 A;  4BRI A;  1XQS C;  1BIU A;  4DQR A;  1N36 K;  2IIR A;  2JLE A;  4NCB A;  4JK7 A;  3RVC A;  3DXK B;  1HR0 K;  1U2V B;  2DTU A;  3MAQ A;  1XI1 A;  1NK7 A;  3GDQ A;  1N5Y A;  4JKC A;  2A40 A;  3ZSV A;  4YDU A;  4FOI A;  5EY4 A;  4FZZ A;  1FKP A;  2ASP A;  4OX9 K;  2VCP A;  4B1Y B;  4NYN A;  1KSP A;  1KXP A;  4CJT A;  1IH7 A;  1ZBU A;  4RW7 A;  4DUZ K;  1NJW A;  1J6Z A;  1NMN A;  2OTL N;  3E01 A;  4BR7 A;  4FJM A;  3WT0 A;  1QZ6 A;  1TYQ A;  3IMX A;  2OPQ A;  2WFB A;  3C6H A;  1T6C A;  2W42 A;  4XH1 A;  5HOO A;  4DKW A;  1WSJ A;  1C1A A;  3L0Q A;  4FJ7 A;  5K14 A;  4JKF A;  4H0P A;  2UXD K;  3NFA A;  2G8F A;  5AZI B;  1RT2 A;  4J2A A;  4I6M A;  1RCH A;  4X62 K;  4GMJ B;  1W7A A;  3EKU A;  1GLD G;  1HRH A;  4K25 A;  4I9L A;  1J5E K;  2YCH A;  2RE2 A;  2A6A A;  1NGD A;  4KRE A;  4BC4 A;  4HUF A;  1RTH A;  3O9S A;  2HOE A;  3U3Y A;  4PY5 A;  4CHY A;  2FXU A;  4J2B A;  4GW6 A;  3CQY A;  4RCH A;  3HM9 A;  3W0L A;  2FF3 B;  4JKB A;  4YOU A;  5BRF A;  4E7L A;  3MN7 A;  3WNE A;  1G15 A;  3TAR A;  2PBD A;  1NKC A;  1E4G T;  2F8S A;  1RTI A;  3RMB A;  5AQQ A;  3AV9 A;  5AFU A;  3C94 A;  3MED A;  3TSQ A;  1KQS M;  3ISN C;  3I0S A;  3P39 A;  5M1N A;  3QES A;  4DLG A;  4LD0 A;  5AQL A;  2E2P A;  1JXB A;  2E8A A;  3AY9 A;  5C25 A;  3K9K A;  3O9U A;  4GNI A;  1X3N A;  1HNX K;  4M63 C;  3LPT A;  4M7X A;  1VQO N;  4F9O A;  2GBZ A;  1NG9 A;  3THX B;  4F2R A;  4FJI A;  1UA1 A;  3O4Q A;  3MK6 A;  1FJG K;  1BHL A;  3SZ2 A;  4H0Y B;  4CJ4 A;  5D3G A;  4IFE A;  2KFZ A;  4GVE A;  4FWN A;  2ZWH A;  4CHZ A;  4HTU A;  1N6Q A;  2UUC K;  4AHT A;  3SMS A;  4UQG A;  4JI4 K;  5TKY A;  4B1X B;  2FBX A;  1BA1 A;  5JS2 A;  4M3T A;  1SL0 A;  3NMU A;  2ITM A;  3S3N A;  5JLH A;  3AO4 A;  3VQE A;  3I0R A;  3LAL A;  4HTL A;  3VEX A;  4H03 B;  1KAZ A;  2QWO A;  3Q7B A;  2P9K A;  4FWM A;  3JAM O;  5HBM A;  2E2O A;  1ASW A;  4B9U A;  1BQM A;  4LF7 K;  3ATV A;  1LAW A;  4FWS A;  5AQZ A;  3NH0 A;  4FM1 A;  1EO1 A;  3KLI A;  3CCQ N;  1QVF M;  4CW7 B;  3RMD A;  2YKN A;  1U4B A;  4JK9 A;  3QBW A;  5AQJ A;  3SQ2 A;  4B08 A;  4K8Z A;  3IS9 A;  1GLB G;  3VQA A;  1TL3 A;  4IEE A;  2QKK A;  1N8R O;  3D0P A;  3TAQ A;  1VQ4 N;  4W5N A;  1U6Z A;  5CYQ A;  3DYA A;  2WOM A;  3CER A;  2QWR A;  5J2Q A;  1RBR A;  4HUE A;  2A1R A;  2HF3 A;  3WXL A;  4HCC A;  2O8D B;  5MLC Q;  1K73 O;  3L8B A;  3V81 A;  4CZG A;  3AVG A;  3VQQ A;  4DFM A;  5KRS A;  3D2E B;  4LFA K;  2RN2 A;  4I2P A;  4YY3 K;  4OGE A;  2QKB A;  3S41 A;  4N5S A;  3QML A;  2NZT A;  5AQT A;  3ZEU A;  4C8N A;  3THY A;  1KRP A;  4FWR A;  1D4X A;  4JI6 K;  4YOT A;  1U49 A;  4J2D A;  1BA0 A;  1HPM A;  3CCU N;  4YOV A;  3WXK A;  1ASV A;  4ELV A;  4E7J A;  4FLW A;  1HNV A;  1NNE A;  3ZCM A;  2NRX A;  4CGF A;  4BRM A;  3ZT0 A;  3VER A;  3NVK A;  2QXF A;  2HHU A;  1RIL A;  4FK0 A;  1W2B M;  5CR4 A;  1QE1 A;  3AAR A;  2G8H A;  4IOA L;  3U6F A;  3GBT A;  1SAZ A;  3D2F B;  4E89 A;  2P5O A;  5A2Q O;  1WSG A;  3J7Y P;  3PSI A;  4H5V A;  3KK1 A;  5AQK A;  3GG4 A;  4DR6 K;  4RW4 A;  2O4I A;  1G99 A;  2H3G X;  3UB5 A;  3KK7 A;  3HK2 A;  4LF5 K;  3IFR A;  4M3R A;  4FJ5 A;  4DS4 A;  1EXQ A;  4CHO A;  1JXE A;  2EHG A;  4LSL A;  4X66 K;  1HKC A;  3M8S A;  1JLB A;  5JS1 A;  4CBU A;  5C24 A;  3CCJ N;  5DM7 L;  2I7N A;  1ESV A;  2XY8 A;  4PA1 A;  3TSU A;  2HMI A;  3HOS A;  4FJH A;  5FPM A;  2CGK A;  3TU5 A;  3WEE A;  4BRE A;  3O3H A;  2FBT A;  1BU6 O;  1S22 A;  3DXM B;  3S9H A;  5GIN A;  4CZF A;  3T1H K;  3SMP A;  1L3T A;  4CIG A;  3SV3 A;  3G0Z A;  3OA9 A;  5AQY A;  3UKU B;  3LDP A;  4O8U A;  4DTX A;  5EVZ A;  4BR9 A;  4QS8 A;  4B1U B;  2YNI A;  1REV A;  4Z4H A;  4FZX C;  1JLA A;  2E6M A;  5J2N A;  1NJI O;  2HHW A;  1I3A A;  4F3O A;  3NF9 A;  2E1Y A;  3UIQ A;  3DRP A;  4B9V A;  2RF2 A;  3K5M A;  4M3Z A;  1GLJ O;  3HM8 A;  3HVR A;  2F4V K;  1HMV A;  4OKE A;  4FLV A;  4YOR A;  5C15 A;  4IJA A;  3VQ8 A;  3VN5 A;  3O9T A;  4ELT A;  4BG8 A;  4KHP K;  3P4I A;  3CJ1 A;  1NMD A;  2A3Z A;  2WUS A;  4O5F A;  2HBK A;  3OS2 A;  4LF6 K;  5HRP A;  1VQ7 N;  3K57 A;  1HNI A;  2G8U A;  4DU4 A;  5AZI A;  4H5T A;  1IKW A;  2KLA A;  5EXW A;  3HL8 A;  4KTQ A;  3LP1 A;  2Q36 A;  3VOV A;  1QQM A;  2NRR A;  3W3D A;  3VQ6 A;  3CYM A;  1KD1 O;  4FM0 A;  1ZBS A;  2ITG A;  4FPA A;  2QA4 N;  1S6Q A;  1MU2 A;  4PL8 A;  4JAX A;  1GLE G;  3FZM A;  3WUH A;  4DTO A;  4U67 L;  4M41 A;  3AVA A;  5M1K A;  4IO9 L;  4I2Q A;  1HNW K;  4E1J A;  4R5P A;  2J4R A;  4CEE A;  1LOT B;  4YOW A;  4B8A B;  4JRP A;  1HQU A;  1S1V A;  4WF9 L;  4IG3 A;  1LW2 A;  3AO2 A;  4E1M A;  3ALY A;  3MEC A;  3BF3 A;  3B6O A;  4IDK A;  3FLC O;  3VES A;  2IVO A;  3HXM A;  1C1C A;  1QSL A;  4CF8 A;  4CGH A;  2HHS A;  2D0B A;  4CGG A;  4XH4 A;  2Z1H A;  4AHU A;  1GOC A;  3MWT A;  2PYJ A;  5C0Y A;  4BRP A;  5GIP A;  4CJQ A;  4Q0B A;  1O13 A;  2NNW A;  3VGM A;  1D9D A;  4O55 A;  5AQO A;  2YHY A;  1QZ5 A;  1SS6 A;  4JI8 K;  5ELZ A;  4G1Q A;  4ILJ A;  4X65 K;  4ILG B;  3THW A;  1X9M A;  4FLX A;  2O8B B;  3VMF B;  1BQN A;  4B1W B;  5E41 A;  4WFB L;  3AAQ A;  4B1Z A;  3C6A A;  4C1N K;  1X1P A;  3KLH A;  2KFN A;  1Z05 A;  4A59 A;  5CZ2 A;  2OTJ N;  3GOI A;  2VGN A;  1IG8 A;  5DM6 L;  5HL7 L;  4C8L A;  1E4F T;  3A2F A;  3OYN A;  5B8H A;  2BH1 A;  3MCA B;  1UWB A;  4BRC A;  3AO5 A;  3EY1 A;  4BRD A;  3I55 N;  2FF6 A;  1S9G A;  3LAM A;  1YXQ A;  4DTS A;  4JI7 K;  4YHH K;  1JLE A;  4JKG B;  3QEX A;  5BPM A;  1VSE A;  4OKK A;  4BQL A;  3AA4 A;  1VSM A;  3QIC A;  4YOX A;  4ID5 A;  4ILH A;  4CEF A;  4DFK A;  1S3X A;  3QEW A;  1NGE A;  3HPH A;  1VQ9 N;  1U48 A;  3K58 A;  4FW1 A;  4ID1 A;  1NGJ A;  4FCY A;  4DFJ A;  3VA3 A;  4FWQ A;  3U8X A;  1DGK N;  1U04 A;  4WQ4 A;  2YNF A;  3LM9 A;  3OYB A;  2D0A A;  4FJN A;  4AHC A;  4FOE A;  4DTU A;  1JL1 A;  1RT1 A;  3OJU A;  2O8E A;  2HVH A;  4CGJ A;  2GTD A;  3CCE N;  4AIL C;  1VQ5 N;  3O80 A;  4PWD A;  3PO5 A;  3ZSX A;  3ZSY A;  2HBJ A;  5FPD A;  2YKM A;  3VET A;  3ID6 A;  1QVG M;  3LM2 A;  3D6R A;  3CM6 A;  3PX4 A;  1OVY A;  3ZSW A;  2VG5 A;  2EWS A;  1WSH A;  2O4G A;  3IRX A;  2CGJ A;  2DFF A;  3TAF A;  4FZY A;  3ENO A;  4KFB A;  4OPK A;  3ZET A;  4W5R A;  3MX5 A;  3CQX A;  5GAD P;  2HVI A;  4JN4 A;  5KTQ A;  3QBX A;  5BR8 K;  4DTN A;  1NLV A;  5BR9 A;  1W97 L;  1TK5 A;  3BUZ B;  3P1G A;  3K9J A;  3MCP A;  2OAN A;  5KPZ A;  3ZSZ A;  3VEY A;  3FZF A;  3EZW A;  1MWM A;  4CEO A;  2Y1J A;  4ELU A;  3QIN A;  4RWT A;  5M1Q A;  1WSF A;  4DS5 A;  1ZC6 A;  1ASU A;  3QNN A;  4JHD B;  1D9F A;  1EX4 A;  4K42 A;  2F9T A;  1WOQ A;  3VEZ A;  3ZYY X;  4E3S A;  3DOL A;  2P51 A;  3SBT A;  3QNO A;  1LW0 A;  2JWK A;  1DT9 A;  3AVL A;  4LF8 K;  4CF2 A;  4NCG A;  1GLF O;  1H1V A;  1X9W A;  1KFS A;  1GLA G;  3CC2 N;  1Q81 O;  3EE8 A;  4IEI A;  2VQE K;  1RBU A;  4DR3 K;  4K41 A;  1VSL A;  3UKR A;  4DV0 K;  1JL2 A;  4DSI A;  2HNY A;  2HST A;  5AJ3 K;  4ZTJ A;  3CJC A;  4CZE A;  5AZJ A;  4RG8 A;  3CCS N;  5KRT A;  5GAH P;  2Y1I A;  3A5O C;  4JI0 K;  3I8D A;  4Z4E A;  2O8C A;  3QB0 A;  3LWL A;  1T44 A;  3VQC A;  3L6Q A;  3EZ5 A;  4UY8 O;  4CZM A;  1T6D A;  3U4L A;  4CD3 A;  4QS7 A;  5AQX A;  5KPT A;  4BWJ A;  4YDU C;  3DLR A;  4IG0 A;  1VHX A;  4LSN A;  2UYT A;  3NDK A;  4CZJ A;  4JV5 K;  4DQI A;  2Q2R A;  1NGC A;  3MN5 A;  3RSE B;  4O44 A;  3VTI A;  4KHS A;  5AQN A;  1C6V A;  2HB5 A;  5LL6 Z;  1B9F A;  1IV0 A;  2YHB A;  4W5T A;  1NJY A;  2PAV A;  3LDN A;  2E4L A;  3OYG A;  2YHW A;  1D8Y A;  3NF6 A;  4DG1 A;  4CE9 A;  4Y1C A;  1ZBF A;  4W5O A;  4EZ9 A;  1DKG D;  4CZI A;  2X78 A;  2NRV A;  4KO0 A;  3O5B A;  4FWK A;  5T7B A;  1JCG A;  4BE2 A;  4N76 A;  2KZM A;  3ATU A;  4WFN L;  3CC4 N;  4I7F A;  1VQP N;  1SZ2 A;  1OH5 A;  3BY5 A;  4BDY A;  4IKF A;  3JS6 A;  3KD1 E;  3KHY A;  1VK0 A;  3THV A;  3OTO K;  3QDK A;  1QSS A;  3RTV A;  1T03 A;  4E0D A;  3FZL A;  3SPZ A;  1FKO A;  2HHV A;  5C42 A;  5E26 A;  2I5J A;  1K8A O;  2ZJR L;  4KH5 A;  5M1F A;  4EIA A;  5FRN A;  4OLA A;  3ZT4 A;  2E2N A;  3U9Z A;  4EP5 A;  3O9Q A;  2VWJ A;  4NCA A;  4AM6 A;  4E19 A;  3VQ7 A;  3L4I A;  3CPW M;  3VF6 A;  1BI4 B;  1JLQ A;  4CJW A;  1F21 A;  5EU7 A;  1L3V A;  4WCE L;  3BGR A;  3JXU A;  4JD2 B;  2P9S A;  3G10 A;  4CI6 A;  3J8A A;  5CY4 A;  2ZGY A;  1TK0 A;  3NGI A;  4DTR A;  1J5O A;  4A62 A;  1WLJ A;  2X74 A;  4CJK A;  3LAN A;  4CGI A;  2GEM A;  4KAZ A;  4CFC A;  1UA0 A;  3KVG A;  1J54 A;  1J53 A;  4DF8 A;  4Q5V A;  3QFP A;  3CET A;  1NK8 A;  3TAE A;  3J7Z O;  1TV6 A;  2UU9 K;  2IVP A;  3A5M C;  1RT4 A;  2D0C A;  3KKR A;  4CEB A;  4AM7 A;  2V51 B;  2FC0 A;  3EN9 A;  1CXU A;  1Q8I A;  3C6T A;  3AVK A;  1XUP O;  4KBO A;  1BL3 A;  2P9P A;  1T7P A;  2LSN A;  3LP0 A;  5SWM A;  3PLA A;  3H1Q A;  3ZT1 A;  1VQM N;  3C7N A;  5FRM A;  4KH4 A;  5CZ1 A;  4BRN A;  4YNQ A;  4OPH A;  3ULE A;  3U9D A;  5CHI A;  2QEX N;  1B9D A;  2O8F A;  1IJJ A;  4KHQ A;  3L2U A;  2QTD A;  2ZQB A;  1EKE A;  2P9I B;  2P9U B;  3PSF A;  4M3Y A;  4B9M A;  4DR5 K;  5JIC A;  4FVM A;  4CES A;  1VQN N;  3M8R A;  4GV6 A;  3HVT A;  2P9L A;  4IXC A;  1YIT N;  2NRT A;  4JKD A;  4LFB K;  1Y97 A;  4KHN A;  3VQ5 A;  3HP9 A;  2XY7 A;  1MWK A;  2IOC A;  5HRN A;  3NGZ A;  3V9Z A;  4CJP A;  2HBL A;  5JVH L;  3I33 A;  1TKD A;  4A2A A;  4FPB A;  2ASO A;  3WNH A;  4DSK A;  1Q86 O;  3DLK A;  1YJW N;  3TAB A;  4FJL A;  4FJX A;  3PIP L;  3HPO A;  2QXL A;  3TPQ A;  2CGL A;  3BP8 A;  2XY5 A;  3PV8 A;  4B9T A;  4B3O A;  3Q7C A;  4BRG A;  3F5T A;  2XRI A;  4B3R K;  4M7Y A;  4DV1 K;  4CJF A;  4WE1 A;  2D0O A;  1VSF A;  4NYF A;  3RR7 A;  3LDL A;  2GUI A;  3T69 A;  2OZM A;  4DWI A;  4PKH A;  4JK8 A;  1S1X A;  1QHA A;  1YJ9 N;  2GV9 A;  4H0T B;  5ADX A;  4F2S A;  1SL1 A;  3CCV N;  2UXC K;  3OYJ A;  4PKG A;  3T1Y K;  3V6D A;  2P9N A;  3GL1 A;  1RGI A;  1TK8 A;  5HRR A;  5FRO A;  1W9H A;  2A1S A;  2D1K A;  3V1Q A; 
#chains in the Genus database with same CATH homology
 3PUF A;  3K2P A;  2ITG A;  4RW6 A;  1RBV A;  4ICL A;  1S6Q A;  1MU2 A;  4FLU A;  5I42 A;  4F4K A;  4Z4C A;  4FK4 A;  1QQC A;  3SQ0 A;  4E1N A;  4OLB A;  1FK9 A;  3LP3 A;  4O5B A;  3HT3 A;  4DTO A;  1JLC A;  4M41 A;  1GOA A;  3AVA A;  2B6A A;  4Z0U A;  3JSM A;  3T19 A;  3OS0 A;  1B92 A;  1C0M A;  4CED A;  4E7I A;  2ZD1 A;  4I2Q A;  4IFV A;  3SJJ A;  3QIO A;  1C1B A;  3MXM A;  4R5P A;  4FXD A;  4CEE A;  3FFI A;  3TWH A;  3ZT3 A;  2P5G A;  4BWM A;  3L2R A;  1KVB A;  4JS5 A;  4CJE A;  4KHW A;  3CFO A;  4B8A B;  3K5O A;  2HND A;  4JRP A;  4N56 A;  1HQU A;  1S1V A;  4CEC A;  3ZT2 A;  4IG3 A;  1LW2 A;  3AO2 A;  2HHT A;  3RR8 A;  2G8I A;  4KI4 A;  4E1M A;  3OYF A;  4PQU A;  1SV5 A;  3M8P A;  3ALY A;  1VSJ A;  3MEG A;  3MEC A;  4AH9 A;  4HHT A;  3SCX A;  1W0H A;  4QAG A;  1BCM A;  3B6O A;  1A5X A;  4KB0 A;  4IDK A;  1XHZ A;  1JLF A;  3KLE A;  3SI6 A;  2VG6 A;  1VRU A;  4CEQ A;  2P1J A;  1ITG A;  3K5L A;  3HXM A;  4CCH A;  1C1C A;  1QSL A;  3OJS A;  4CF8 A;  4FJJ A;  4CGH A;  2HHS A;  2D0B A;  4CGG A;  3PX6 A;  3TI0 A;  2PYL A;  4AHU A;  1O1W A;  2Z1H A;  2FBY A;  3NCI A;  3KK3 A;  1VSH A;  3CQ8 A;  2IDO A;  3QLH A;  4CHQ A;  1TGO A;  1U47 A;  1GOC A;  4M3W A;  3OYK A;  4BDP A;  4OKJ A;  2IGI A;  4OPJ A;  1NKB A;  2PYJ A;  3BDP A;  3VA0 A;  1NK9 A;  1LV5 A;  1WSI A;  1RDC A;  3OYA A;  3QEV A;  4CJQ A;  3SPY A;  1YVU A;  3V9W A;  1ZYQ A;  1T8E A;  3KK2 A;  3CFR A;  1RNH A;  2YHA A;  4CJL A;  4O55 A;  2R7Y A;  1D9D A;  2EX3 A;  3WNG A;  3OVN A;  2JGU A;  1BIU A;  4DQR A;  1YTU A;  4RW8 A;  2VG7 A;  2JLE A;  3DRR A;  4NCB A;  4Z4F A;  4G1Q A;  2HHX A;  4FLY A;  2DTU A;  3MAQ A;  3KD5 E;  1XI1 A;  1X9M A;  4FLX A;  1NK7 A;  3F73 A;  5E41 A;  1BQN A;  3C6U A;  4CFD A;  1N5Y A;  4IFY A;  1KVA A;  3ZSV A;  3KLH A;  1X1P A;  4AHR A;  2KFN A;  3M8Q A;  1CXQ A;  3SQ1 A;  3NHG A;  1FXX A;  2OPR A;  2Z1G A;  4FZZ A;  2HHQ A;  1FKP A;  5DMR A;  5CZ2 A;  4HUG A;  2FBV A;  1XWL A;  1SKW A;  4N41 A;  1NOZ A;  4NYN A;  4FLZ A;  1XHX A;  1KSP A;  2IAJ A;  1CLQ A;  4O0J A;  4C8L A;  3A2F A;  4LY7 A;  4FLT A;  3SYZ A;  4ZHR A;  3AVH A;  3ZSQ A;  4CJT A;  3OYN A;  4CJS A;  1IH7 A;  1ZBU A;  3QEP A;  2X6N A;  4RW7 A;  2HW3 A;  1NJW A;  3AVB A;  1UWB A;  1S1W A;  3DLB A;  3E01 A;  3AO5 A;  4FJM A;  3WNF A;  3EY1 A;  2YNH A;  1VSK A;  3LAM A;  1S9G A;  1RDB A;  2OPQ A;  4DTS A;  1JLE A;  5DK5 A;  3QEX A;  2W42 A;  1VSE A;  4OKK A;  3VQB A;  3AA4 A;  3HJF A;  1VSM A;  1IO2 A;  3DOK A;  1WSJ A;  4LH5 A;  1C1A A;  3MEE A;  4ID5 A;  3VQ9 A;  4CEF A;  4DFK A;  4EZ6 A;  4FJ7 A;  3QEW A;  5K14 A;  4E7H A;  4K8X A;  5HRO A;  3HPH A;  3TAG A;  1U48 A;  3K58 A;  3PY8 A;  4FW1 A;  4ID1 A;  3NFA A;  4FCY A;  3LPU A;  4DFJ A;  4CEZ A;  2F96 A;  3C95 A;  3VA3 A;  2G8F A;  1RT2 A;  4J2A A;  1HQE A;  1RCH A;  1U04 A;  1Q9Y A;  4B9S A;  2YNF A;  3OYB A;  4GMJ B;  2D0A A;  4FJN A;  1ZBH A;  4AHC A;  2DFE A;  2YNG A;  1HRH A;  4I9L A;  4DTU A;  1JL1 A;  1HYZ A;  1RT1 A;  2RPI A;  3OJU A;  2HVH A;  2PY5 A;  4CGJ A;  1RT6 A;  1XC9 A;  1WN7 A;  4E7K A;  1WNS A;  1S6P A;  2YV0 X;  3TR8 A;  4AIL C;  3HYF A;  1LAV A;  4DTJ A;  3KTQ A;  4CF1 A;  4I9Q A;  4PWD A;  2KTQ A;  4KTZ A;  4KRE A;  3PO5 A;  3VQP A;  3ZSX A;  3ZSY A;  2YKM A;  4HUF A;  3OS1 A;  1RTH A;  1C0T A;  5KGW A;  3U3Y A;  4KTW A;  3CM6 A;  3AA5 X;  3PX4 A;  4CHY A;  3SUQ A;  3NH1 A;  3MXI A;  2BGG A;  3ZSW A;  2VG5 A;  4PY5 A;  3IG1 A;  1WSH A;  2O4G A;  4CFB A;  3IRX A;  3TAF A;  2DFF A;  4J2B A;  4M3U A;  4GW6 A;  4FZY A;  2G8V A;  3HM9 A;  4EP4 A;  3VQD A;  4KFB A;  4OPK A;  4W5R A;  4HVJ A;  4CJV A;  4E7L A;  1KVC A;  3AVF A;  1G15 A;  3WNE A;  5KTQ A;  4DTN A;  3TAR A;  2HVI A;  1NKC A;  1TK5 A;  3P1G A;  4KRF A;  3CFP A;  4RW9 A;  2F8S A;  3ZSZ A;  1YT3 A;  4DU3 A;  1RTI A;  3RMB A;  1RDA A;  3AV9 A;  4CIE A;  2Q3S A;  3C94 A;  2Z1I A;  4CEO A;  2Y1J A;  3MED A;  4OGC A;  1BIZ A;  4ELU A;  4OVL A;  3H08 A;  3ISN C;  3QIN A;  3I0S A;  3SV4 A;  1WSF A;  4DS5 A;  1C0U A;  1DTQ A;  1KLM A;  1ASU A;  2IC3 A;  4DMN A;  4CK3 A;  3QNN A;  5HLF A;  1D9F A;  3CM5 A;  1EX4 A;  3QIP A;  4C8M A;  3IAY A;  3QES A;  4DLG A;  3V9U A;  4LD0 A;  4M45 A;  4E3S A;  3DOL A;  1JXB A;  4DSL A;  4CK2 A;  5C25 A;  2G8K A;  4M3X A;  2P51 A;  4FW2 A;  3QNO A;  1A5W A;  1LW0 A;  1BGX T;  3T3F A;  1NK4 A;  3CG7 A;  3AVL A;  3LPT A;  4CF2 A;  2GBZ A;  1L3U A;  4NCG A;  1SKR A;  4F2R A;  4DFP A;  4FJI A;  1UA1 A;  3O4Q A;  3OYH A;  3AVM A;  1NJX A;  1KFD A;  4FJ8 A;  1X9W A;  1KFS A;  1BHL A;  2VWK A;  3SZ2 A;  4Z4I A;  4B8C A;  4CIF A;  4BE0 A;  1RBU A;  4CJ4 A;  5D3G A;  1HYS A;  1VSL A;  3HO1 A;  3QER A;  2KFZ A;  1JL2 A;  3LWM A;  2E6L A;  2HNY A;  4DSI A;  4CHZ A;  4HTU A;  2DFH A;  4ZTJ A;  1N6Q A;  4AHT A;  3O3G A;  4RG8 A;  1RDD A;  4CER A;  5KRT A;  1TAU A;  1X9S A;  2Y1I A;  4UQG A;  3TAP A;  3I8D A;  3TAM A;  4Z4E A;  3LWL A;  1SL2 A;  4DF4 A;  3KKS A;  3VQC A;  3EZ5 A;  2FBX A;  1LWE A;  3NGY A;  5HRS A;  1QHT A;  5JS2 A;  1R0A A;  4M3T A;  4BWJ A;  1SL0 A;  3DLR A;  2XY6 A;  4IG0 A;  4LSN A;  3NDK A;  4DQI A;  3S3N A;  1TL1 A;  4BDZ A;  3AO4 A;  3VQE A;  4QCL A;  3I0R A;  2QK9 A;  4O44 A;  3LAL A;  3QO9 A;  4B9L A;  1UOC A;  1WAJ A;  4CK1 A;  4KHS A;  3V1R A;  3LAK A;  1NK0 A;  1C6V A;  2HB5 A;  4FJG A;  3RRG A;  5KI6 A;  1B9F A;  3OYL A;  4DQP A;  2YHB A;  4W5T A;  4JLH A;  5HBM A;  5I3U A;  1NJY A;  3SUN A;  4DTM A;  2E4L A;  1ASW A;  3OYG A;  3AVN A;  1D8Y A;  4B9U A;  1BQM A;  1HYV A;  3NF6 A;  4DG1 A;  4CE9 A;  4Y1C A;  1ZBF A;  4W5O A;  1LAW A;  3V4I A;  3PO4 A;  4EZ9 A;  3NH0 A;  3ITH A;  3ASM A;  3SNN A;  2X78 A;  4FM1 A;  1Z26 A;  4KO0 A;  4CJU A;  4DQQ A;  3AVJ A;  5T7B A;  4OJR A;  3CYM A;  3KLI A;  1WAF A;  1NKE A;  2ATQ A;  4BE2 A;  3QET A;  3RMD A;  4F8R A;  4N76 A;  4CHP A;  2YKN A;  4FJK A;  3JYT A;  2KZM A;  1S1T A;  1U4B A;  3SQ2 A;  4I7F A;  4B08 A;  4K8Z A;  4DU1 A;  2F8T A;  2OPS A;  3IS9 A;  4H4M A;  4CF0 A;  4KKO A;  5J2P A;  1NOY A;  3VQA A;  1TL3 A;  2XO7 A;  4BDY A;  5KGX A;  2QKK A;  3KD1 E;  1TVR A;  4IKF A;  3DRS A;  3D0P A;  3TAQ A;  2DY4 A;  2B5J A;  4F3T A;  3KLF A;  1VK0 A;  3THV A;  2RKI A;  4W5N A;  4KV8 A;  5CYQ A;  3S3O A;  1QSS A;  3DYA A;  3RTV A;  3B6P A;  1T03 A;  3AO1 A;  4E0D A;  2WOM A;  1JKH A;  2HNZ A;  3KJV A;  3NH2 A;  3SPZ A;  3DLE A;  1FKO A;  1D5A A;  5J2Q A;  1RBR A;  3LZJ A;  4HUE A;  4DLE A;  2A1R A;  5C42 A;  2HHV A;  1BIS A;  2I5J A;  4HCC A;  3AVC A;  3L2Q A;  3L8B A;  3V81 A;  4FK2 A;  4KB1 A;  3AVG A;  3VQQ A;  4DFM A;  5KRS A;  1HPZ A;  5FRN A;  4DSE A;  4KHU A;  3S3M A;  2ETJ A;  1DTT A;  4OLA A;  2RN2 A;  3RMC A;  4I2P A;  1U45 A;  4OGE A;  3ZT4 A;  2OA8 A;  2QKB A;  4EP5 A;  3OYC A;  2VWJ A;  2WON A;  3DLH A;  4NCA A;  1BI4 A;  3AVI A;  5J2M A;  3SUO A;  1J9A A;  3RWU A;  4E19 A;  1UAX A;  3VQ7 A;  4N5S A;  4W5Q A;  1EP4 A;  1BI4 B;  1HJR A;  3L3U A;  4BE1 A;  1JLQ A;  4Z4G A;  4CJW A;  1F21 A;  3NE6 A;  5EU7 A;  1RTJ A;  4C8N A;  3VQ4 A;  3V1O A;  4CHN A;  1KRP A;  1L3V A;  1U49 A;  4J2D A;  1ZBI A;  3BGR A;  3KIO A;  3SQ4 A;  3G10 A;  3NF8 A;  4CGD A;  5CY4 A;  2KW4 A;  3EYZ A;  1TAQ A;  2G8W A;  1TK0 A;  3NGI A;  4GVM A;  4DTR A;  1J5O A;  5J1E A;  1VSD A;  1T05 A;  5HP1 A;  1KTQ A;  4IBN A;  1ASV A;  4ELV A;  4Q0B A;  3OYI A;  4FM2 A;  1WLJ A;  4FLW A;  1CZB A;  4CF9 A;  2X74 A;  4E7J A;  4CJK A;  3LAN A;  1HNV A;  3QEI A;  1S5J A;  4CGI A;  4O0I A;  1NJZ A;  4QOZ B;  4KAZ A;  3ZCM A;  3D45 A;  1A5V A;  4CFC A;  1UA0 A;  4C8K A;  1J54 A;  1J53 A;  4DF8 A;  3L2V A;  4Q5V A;  3K5N A;  4CGF A;  1NK8 A;  2HHU A;  2Z1J A;  3TAE A;  1KLN A;  3ZT0 A;  4CJ5 A;  3NAE A;  2B4J A;  1TV6 A;  2PZS A;  4FJ9 A;  3OYM A;  2OZS A;  1TKZ A;  2QXF A;  1RT4 A;  2D0C A;  3LP2 A;  1RIL A;  4DSF A;  1WSE A;  3KKR A;  3NF7 A;  4CEB A;  1ZBL A;  4FK0 A;  3O4N A;  1Q9X A;  1QE1 A;  2FC0 A;  1CXU A;  3LZI A;  1Q8I A;  3C6T A;  1S9E A;  1IKY A;  1VSI A;  3AVK A;  1NK6 A;  4JRQ A;  3U6F A;  2G8H A;  4B9N A;  4C8O A;  1BL3 A;  1LWC A;  4E89 A;  1K6Y A;  3HP6 A;  1T7P A;  4MFB A;  2P5O A;  2LSN A;  2IS3 A;  3LP0 A;  3DM2 A;  3DMJ A;  4AHV A;  5SWM A;  1WSG A;  1QTM A;  3OYE A;  3ZT1 A;  2AJQ A;  1VRT A;  4MQ3 A;  2OYQ A;  4HCB A;  5FRM A;  4O4G A;  5CZ1 A;  3KK1 A;  4YNQ A;  1RBT A;  4RW4 A;  3K59 A;  2O4I A;  1B9D A;  4KHQ A;  3L2U A;  2KQ2 A;  3OY9 A;  3HST B;  2ZQB A;  1EKE A;  3HK2 A;  3T1A A;  2XHB A;  4M3R A;  4J2E A;  4FJ5 A;  4DS4 A;  4M3Y A;  1L3S A;  4B9M A;  1EXQ A;  3P5J A;  4CHO A;  3AA2 A;  1JXE A;  2EHG A;  3DLG A;  4LSL A;  4FYD A;  3M8S A;  2X6S A;  1JLB A;  1SUQ A;  5JS1 A;  4FVM A;  4CES A;  5C24 A;  3OYD A;  5CYM A;  3M8R A;  2XY8 A;  4TSX A;  3P83 D;  4Y1D A;  3HVT A;  4PA1 A;  4M42 A;  2ZE2 A;  3SUP A;  2HMI A;  3F9K A;  3MXJ A;  4FJH A;  1QS4 A;  1Y97 A;  4KHN A;  1LWF A;  3VQ5 A;  4CJ3 A;  3HP9 A;  1BCO A;  5SZT A;  3ULD A;  2XY7 A;  3U3G A;  3O3F A;  2IOC A;  1EET A;  2OPP A;  5HRN A;  3DI6 A;  4CJP A;  3NGZ A;  4BAC A;  3V9Z A;  3O3H A;  1JLG A;  2FBT A;  3S9H A;  2BE2 A;  4XIU A;  2KZZ A;  4CJR A;  1L3T A;  4H4O A;  4CIG A;  4DQS A;  3SV3 A;  1RT5 A;  1TKD A;  4DSJ A;  3G0Z A;  1IKV A;  3ZSR A;  3TAN A;  2D5R A;  4L8R B;  4AHS A;  1RTD A;  4DTX A;  3WNH A;  3L3V A;  4DSK A;  3PX0 A;  3AA3 A;  3DLK A;  1GOB A;  3TAB A;  4FJL A;  2YNI A;  1REV A;  4Z4H A;  4FJX A;  2BDP A;  4FZX C;  3HPO A;  1SKS A;  1JLA A;  3LDS A;  1TKT A;  2XY5 A;  2E6M A;  5J2N A;  3V9S A;  2HHW A;  1I3A A;  3PV8 A;  4B9T A;  3NF9 A;  4H8K A;  4F3O A;  1CZ9 A;  1DLO A;  3UIQ A;  4B3O A;  3DRP A;  4CEA A;  2RF2 A;  3RRH A;  4B9V A;  1IKX A;  3K5M A;  4M3Z A;  4YFU A;  1YTA A;  3ZSO A;  3HVR A;  1Z25 A;  1HMV A;  4DTP A;  4JS4 A;  1RT3 A;  4OKE A;  4FLV A;  3RMA A;  2XRI A;  1NK5 A;  3VQ8 A;  3VN5 A;  4ELT A;  4KHY A;  4CJF A;  4N47 A;  1TKX A;  4WE1 A;  5FDL A;  1S1U A;  1VSF A;  4NYF A;  3OS2 A;  3RR7 A;  5HRP A;  1KCF A;  2NUB A;  2GUI A;  1HNI A;  3K57 A;  1QSY A;  2G8U A;  1IG9 A;  3KLG A;  4DU4 A;  2OZM A;  4DWI A;  1IKW A;  4KPY A;  4LH4 A;  1S1X A;  2BAN A;  3HL8 A;  4KTQ A;  4PUO A;  3AO3 A;  1RBS A;  2GV9 A;  3LP1 A;  1RT7 A;  4F2S A;  4KI6 A;  1I39 A;  1SL1 A;  3HPG A;  3NBP A;  3L2W A;  3OYJ A;  3V9X A;  1L5U A;  3V6D A;  4ZTF A;  3VQ6 A;  1TK8 A;  5HRR A;  5FRO A;  1W9H A;  4CFA A;  2A1S A;  4FM0 A;  3V1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...