2XRIA

Crystal structure of human eri1 exoribonuclease 3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
206
Chain Sequence
b'NLYFQSMSFPPQRYHYFLVLDFEATCDKQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERI1 EXORIBONUCLEASE 3
publication title Crystal Structure of Human Eri1 Exoribonuclease 3
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 206
sequence length 207
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xriA01
4CHOA 5JS1A 2HHXA 3O3GA 1TVRA 3H08A 4PWDA 4KFBA 3KD5E 4O0IA 2IGIA 4JLHA 2KZZA 1NK6A 4CK2A 4FXDA 4CHPA 1CZBA 1C0UA 4OPJA 3WNEA 2P5OA 4HUFA 3NF7A 4J2AA 4W5OA 1NK4A 1RTHA 2OZSA 1J53A 2P51A 2OPPA 3KLIA 1YTUA 3VQ8A 1NKBA 3K5MA 3ZSYA 4I7FA 1D9FA 4N5SA 3SV4A 5CZ1A 3CYMA 2XO7A 3C6UA 1NJZA 4HUEA 1DTQA 4ZHRA 4CE9A 3SNNA 3PO4A 1EP4A 2G8KA 2DY4A 2YV0X 1CZ9A 3DRRA 3S9HA 1T8EA 2A1SA 5HRPA 4DTUA 3QIPA 1S1WA 2IAJA 4E7HA 4E7IA 1GOBA 2VG7A 3KJVA 1LV5A 2ZE2A 1R0AA 2G8IA 2DFFA 4RW8A 3V81A 3AO1A 1BI4A 4ZTJA 3AV9A 2KW4A 4XIUA 3U3YA 1KVAA 2RKIA 2HMIA 4CJKA 4FM0A 4E0DA 4OLBA 4LSLA 4KHYA 1Q9YA 2BGGA 1MU2A 3OYKA 3QNOA 1C0MA 2GUIA 4CEAA 4CF0A 1HYVA 4CF1A 4AHSA 3B6OA 4B9MA 3QLHA 3P5JA 2O4IA 1C1CA 3QETA 1S6QA 3HP9A 3L8BA 4AHVA 2PYLA 4IFYA 1VSHA 4FJ5A 2FBTA 3K5NA 3LP0A 3LALA 4TSXA 2XY6A 4F2RA 4DFMA 3HO1A 3CG7A 3SPYA 4FJ9A 1RBRA 3I0SA 3IS9A 4CECA 1REVA 3BDPA 4KI6A 4CJFA 1C6VA 5C24A 5J2NA 3AVMA 1JXEA 4DLGA 3L2QA 1FKPA 2IOCA 2XY7A 3CFOA 1EKEA 2KZMA 3LPTA 3NHGA 4AHTA 3L2UA 2G8FA 4DSKA 2F8TA 2IS3A 3DOKA 2EHGA 5C42A 3EY1A 3DI6A 1HJRA 1B92A 2ZQBA 3HPOA 3MXJA 4OLAA 2G8WA 3G10A 4FJXA 4E7JA 4KI4A 4I2PA 4CHZA 4Z4CA 1BIUA 3QEWA 4W5QA 4RW9A 3NAEA 1WLJA 3MEDA 5HRRA 4IBNA 2X6SA 4ID1A 3ULDA 4DF8A 4DU3A 4EZ9A 2DFEA 4CGGA 3K2PA 4M3TA 2I5JA 3AA3A 3DLRA 3V1OA 3VQBA 3WNGA 3HT3A 4DQSA 3G0ZA 1TK5A 5CY4A 4BDZA 3SJJA 2HHQA 2FBYA 3WNHA 1LWFA 3NH1A 1RTIA 3OYJA 4FK4A 5FROA 4DF4A 4M45A 1NK0A 3CFRA 3L3VA 5J2PA 4CJ3A 5C25A 1Q8IA 4IG0A 2OPSA 4EP4A 4IG3A 3KK1A 2W42A 3AO3A 3QEVA 1VSFA 3A2FA 4H8KA 5J2MA 2DTUA 1RBTA 2KQ2A 2YKNA 3VQ5A 4DTSA 4Z4GA 3AO2A 5EU7A 1IKYA 1KCFA 3NGIA 1X1PA 3PX0A 2Z1IA 3VQ6A 1NK5A 1B9DA 1RT7A 3DLGA 4J2BA 4CF8A 4M3WA 2VG5A 2D0AA 3OS0A 4KHWA 4CK1A 4KRFA 1N6QA 4YFUA 1S1TA 3UIQA 1S1VA 2E6LA 1BQMA 4K8XA 4CIEA 3QERA 3VQEA 4RW7A 1WN7A 1HQEA 2YNIA 4CHNA 4OKJA 3ZSOA 4N47A 4E7LA 4KHNA 4BDPA 2O4GA 4CFDA 4LY7A 1KSPA 5KRTA 4B08A 1L3SA 3OYMA 4KAZA 1LW2A 5T7BA 4C8OA 1Y97A 3O3FA 3KLEA 4B9NA 4C8LA 3OJSA 3RRHA 1WAJA 2XY8A 4ID5A 4NCBA 3SYZA 3AA5X 1IH7A 1NOZA 4AHRA 1WAFA 2B5JA 3NH2A 1T03A 3OS1A 3V9XA 1RCHA 4M3RA 3LP1A 2P5GA 4FJMA 1U04A 5HP1A 1JLQA 3O4NA 3EYZA 4OKKA 4FJJA 1Q9XA 4MFBA 3VQPA 3ZT0A 4DMNA 3SQ1A 3OYHA 1SUQA 3QO9A 4DG1A 3TAFA 4J2EA 1KLMA 3L2WA 4Z4HA 4FLYA 2A1RA 1JLAA 3AVKA 3THVA 3V1QA 4DU1A 1D9DA 3D45A 1UOCA 2QKBA 1TKXA 3OYIA 1SV5A 4HVJA 4DQIA 2HHTA 1A5XA 3AVBA 3CM6A 3NBPA 3KKRA 4H4MA 5HBMA 3L2RA 3RMBA 4AH9A 1HYSA 3LZIA 1JKHA 4O0JA 3CM5A 1X9MA 4Q0BA 3SV3A 4E19A 3LANA 2BANA 3QESA 4B8AB 4B9VA 3O3HA 2X74A 3IAYA 1VRUA 4DWIA 4DTPA 4FW1A 5K14A 1LAVA 3HSTB 4H4OA 4F8RA 3O4QA 3I8DA 4DTOA 3U3GA 4PUOA 2JGUA 4GW6A 4CGDA 4FCYA 3SUNA 5HRSA 1JXBA 3V9UA 4CEOA 1C1AA 5KI6A 4DFKA 4B9LA 2WONA 2IC3A 3RRGA 4CEFA 2D0BA 3SQ2A 1BGXT 1S6PA 3BGRA 4Y1CA 4Z0UA 4QAGA 4FJ8A 1UA1A 4CEDA 1HYZA 3AA2A 3RWUA 1NJXA 4M3XA 2RF2A 4CGFA 4CIFA 1JLFA 4Q5VA 3KTQA 2OZMA 4FJ7A 3DLEA 4CJUA 4FK0A 1QS4A 1RBVA 3NDKA 2XHBA 2F96A 4PQUA 3K5OA 3KLHA 1VSIA 4BACA 3HPGA 3T19A 3HP6A 2YKMA 1U4BA 4AHCA 1NK7A 3F73A 1IKVA 2KFZA 3OYGA 1W0HA 1RT4A 2NUBA 4O44A 5KTQA 4WE1A 4JRPA 4LSNA 1RBSA 4M3UA 1SL0A 4PA1A 3VQCA 2HNYA 4CHYA 5HRNA 3LP2A 1RTDA 4MQ3A 4Z4EA 2HHWA 1QSSA 2Q3SA 3DLKA 1ZBFA 1C0TA 3M8PA 4KHQA 4I9LA 3CQ8A 3E01A 1TKDA 1A5VA 3M8RA 4CGIA 4E1NA 4CJVA 3OY9A 4E89A 4FW2A 1WSFA 2RN2A 1JLCA 3C6TA 2HVIA 3HYFA 3ZT1A 4ELVA 4CJSA 3OYEA 2WOMA 3RR7A 4FZXC 1SKWA 1TKZA 4FZYA 2HHSA 4DQRA 2OYQA 2YNFA 4CESA 3AVAA 1UAXA 1JLGA 3ZSVA 1TL1A 1VSDA 1TK8A 4HCCA 2KFNA 3AVGA 4KO0A 4FJLA 3DRSA 2FC0A 4HHTA 3S3MA 1JL2A 1RT3A 1NK9A 3DLBA 4N56A 3NH0A 4LD0A 3SPZA 4F4KA 1VSMA 4E7KA 1RT1A 2D0CA 3M8QA 3ZSXA 1RT6A 3V9SA 2LSNA 4DFJA 3MXIA 1BI4B 1U49A 1LAWA 4I2QA 2Y1IA 1G15A 4CFBA 3ZSWA 3JYTA 1VSJA 3FFIA 3AVHA 4C8MA 3L2VA 5SWMA 2AJQA 2YHAA 4CF9A 1ITGA 1TAUA 1QHTA 1L5UA 4CEZA 5FRMA 4KV8A 4L8RB 4W5TA 2HB5A 4OJRA 1N5YA 1RBUA 1RDBA 4JRQA 4QOZB 4ELTA 2XY5A 2HHUA 4FJHA 1ASWA 4CHQA 1I39A 4M41A 3HVRA 2GV9A 2Z1HA 3RR8A 3KIOA 4YNQA 3TANA 1SL2A 1KRPA 5D3GA 1RILA 4NCGA 4M3YA 2G8UA 1DLOA 1CXUA 4FLXA 1U45A 1ZBIA 4KHUA 3C94A 1D8YA 5E41A 1O1WA 1W9HA 2R7YA 1WSJA 1QSLA 2EX3A 2FBVA 1KFSA 1Z26A 4ELUA 1TV6A 1J9AA 4OGEA 3LWMA 4B3OA 4CEBA 4CJ5A 1T05A 4O55A 1RDAA 3OYCA 2ITGA 4Y1DA 3AVNA 4FJGA 1L3VA 3VN5A 2RPIA 4RG8A 2YNGA 1T7PA 3SI6A 3KLGA 2F8SA 3KLFA 5KGXA 2HNDA 3ASMA 3LZJA 4B9UA 3HVTA 5SZTA 3KD1E 3SUQA 4DSFA 4O4GA 2HHVA 2B4JA 4OKEA 4IDKA 3LAKA 3V1RA 3SQ0A 5J1EA 4FLVA 5I3UA 4JS4A 3OYNA 1ASVA 4DTNA 4OVLA 3QEXA 1VSEA 4CCHA 4KTZA 3TAMA 1D5AA 1IKXA 1BIZA 3ZT4A 4B8CA 4FZZA 1QE1A 3ISNC 4CGHA 3C95A 3MXMA 1L3TA 3OVNA 1XI1A 3HK2A 1QSYA 3HPHA 4FM1A 3K57A 4DLEA 1Z25A 1TGOA 2OPQA 3AA4A 3ZSQA 4KTWA 3VA0A 2OPRA 3ALYA 4HUGA 4M42A 5CZ2A 1CLQA 4E1MA 3IRXA 4DTJA 2P1JA 2QXFA 3SCXA 3AO5A 3SUPA 4F3OA 1S1UA 1EXQA 3NF6A 4DTMA 4LH4A 3RMDA 3IG1A 3VA3A 2FBXA 4DS5A 4FJIA 1QQCA 1WSEA 1I3AA 1JL1A 2XRIA 3DM2A 3OYDA 3TABA 2GBZA 1U47A 1TL3A 1RT2A 1BQNA 1S1XA 4Z4IA 1F21A 2PYJA 4GMJB 1BISA 2BE2A 4Z4FA 3M8SA 4DTXA 3OYAA 5CYQA 4FYDA 1XC9A 3VQQA 3VQ9A 1RDCA 3QINA 3VQ4A 3DOLA 4RW6A 4BE0A 2ETJA 4DSEA 2HW3A 1LWEA 3DYAA 2X78A 2OA8A 1S9GA 2BDPA 4DSIA 4CF2A 4AILC 3HL8A 5KRSA 3AVCA 4NYNA 3EZ5A 1HMVA 3VQAA 3SUOA 3DLHA 1ZBUA 4DFPA 1U48A 4CEQA 4FM2A 4CJ4A 4CJQA 3V9ZA 3OYBA 2D5RA 2HVHA 4KKOA 4C8NA 1XWLA 1WSIA 2VWJA 3P83D 4F3TA 4KB0A 2G8HA 2B6AA 4OGCA 1VSKA 1GOAA 4BE1A 4FLZA 1LWCA 5HLFA 4DSJA 3NCIA 4CJRA 3V4IA 2ZD1A 2ATQA 3ZSZA 1XHXA 1TAQA 3ITHA 3QEIA 3DMJA 3TI0A 4B9TA 1SL1A 3TAPA 3NGZA 4F2SA 3PY8A 3P1GA 3LWLA 1EETA 4FLUA 3OJUA 1YT3A 3TAEA 1S9EA 1CXQA 1NJWA 3WNFA 1WNSA 4BWJA 3SZ2A 1NOYA 1TK0A 1IG9A 4FLTA 4HCBA 5DMRA 4NCAA 1NKCA 4NYFA 4EP5A 5J2QA 3TWHA 3RMCA 5HROA 3LAMA 4O5BA 4DS4A 3K58A 4EZ6A 4DTRA 3V9WA 3OYLA 3NF9A 3ZCMA 1BHLA 1HPZA 3AVFA 1KVBA 4HTUA 1HRHA 2VWKA 1X9WA 1QTMA 3HJFA 1HNVA 4KREA 3S3OA 3MEGA 4K8ZA 4QCLA 1VSLA 1YVUA 4W5NA 2Y1JA 1BCMA 2QKKA 4CEEA 1RT5A 2JLEA 3OYFA 3AVJA 4CFAA 1HQUA 3ZT2A 4FLWA 3QNNA 3MECA 1TKTA 4CJEA 3V6DA 3TAGA 1XHZA 1ZYQA 4W5RA 3K5LA 2IDOA 3TARA 3NGYA 5FDLA 1WSGA 4BWMA 3NF8A 1UA0A 3VQ7A 1EX4A 1JLEA 5JS2A 3VQDA 3ZSRA 3D0PA 3PX4A 2HNZA 1K6YA 4E3SA 3QEPA 4N76A 3TR8A 1RDDA 3LPUA 2YHBA 4I9QA 4KPYA 3T1AA 3MAQA 1IO2A 3ZT3A 3PUFA 3AVIA 3SQ4A 2PY5A 4B9SA 2PZSA 4KB1A 2VG6A 3NE6A 2E4LA 4DQQA 1YTAA 3HXMA 4KHSA 4FK2A 1S5JA 1KVCA 4CJPA 3CFPA 4R5PA 1NKEA 4AHUA 1KLNA 1B9FA 4CFCA 4FVMA 4JS5A 1HNIA 4M3ZA 5FRNA 1ZBLA 4IKFA 3RTVA 1IKWA 3NFAA 2X6NA 4UQGA 4DQPA 1NJYA 5CYMA 1KFDA 1J54A 1WSHA 2Z1JA 3DRPA 4J2DA 5I42A 1ASUA 3OS2A 3JSMA 3PO5A 3F9KA 1RTJA 4CK3A 4FJKA 4GVMA 3QIOA 4CJLA 3U6FA 4PY5A 2DFHA 3KK3A 3LDSA 1FXXA 3AO4A 1BL3A 1VK0A 1FK9A 3LP3A 3T3FA 4CERA 1L3UA 2KTQA 1NK8A 4IFVA 3K59A 2YNHA 3S3NA 3TAQA 3KKSA 1JLBA 4OPKA 4ICLA 1SKRA 3L3UA 4CJTA 3RMAA 4CGJA 4ZTFA 1RNHA 4DSLA 4LH5A 3PX6A 2G8VA 4BDYA 1KTQA 3PV8A 1A5WA 1VRTA 2Z1GA 4C8KA 4KTQA 1SKSA 1J5OA 2E6MA 1ZBHA 4CIGA 1X9SA 1UWBA 3B6PA 4G1QA 1GOCA 3KK2A 1C1BA 3HM9A 1FKOA 3AVLA 4CJWA 3I0RA 2QK9A 4BE2A 5KGWA 4N41A 1DTTA 4FJNA 1LW0A 1BCOA 5DK5A 3MEEA 4RW4A 4DU4A
chains in the Genus database with same CATH superfamily
4CHOA 4BRNA 5JS1A 2A5XA 1BA0A 3MN9A 2IVOA 4KFBA 4PWDA 4JLHA 4IOCL 4FXDA 2NRRA 1VHXA 2Q0RA 4WFNL 3MX2A 3CHWA 4J2AA 4KH4A 5FPEA 2VYPA 1YTUA 2V7YA 4I7FA 3U9ZA 3I56N 3CYMA 3G25A 2UYTA 1EP4A 1T8EA 5HRPA 2ASOA 4YOUA 4DTUA 3QIPA 2E2OA 2IAJA 4E7HA 1GOBA 3VF4A 3VESA 3VERA 2DFFA 3AO1A 4BR5A 4L3QA 4OLBA 4BR7A 1C0MA 2GUIA 4CF1A 2OTJN 1C0GA 4R79A 3ATUA 3QLHA 5AZJA 3CJCA 1S6QA 3P38A 1V4SA 2A6AA 3K5NA 4F2RA 2XY6A 2D4WA 3D2EB 3GE1A 3DJCA 2FSJA 3IS9A 1VQ8N 3BDPA 4KI6A 1C6VA 1JXEA 4AHTA 1BDGA 2F8TA 2IS3A 3DOKA 5C42A 4XH5A 2ZQBA 3MXJA 4KI4A 1HPMA 1NJIO 4CHZA 4Z4CA 1BIUA 3SLCA 4RW9A 3NAEA 1WLJA 4H0OA 5HRRA 3ULDA 1ZBSA 2DFEA 1LWFA 3M1FA 3O9QA 1RTIA 5FROA 1NK0A 3L3VA 2YHWA 1D4XA 2OPSA 2E20A 3LDQA 1Q82O 4O8KA 3A2FA 1OKJA 2KQ2A 2YKNA 3VQ5A 4DTSA 3FE1A 1Q18A 4IOAL 1NK5A 3DLGA 4M3WA 4KHWA 4KRFA 3A5MC 1S1TA 3UIQA 5HL7L 1HQEA 3LM9A 4CI6A 3ZSOA 4BDPA 3VENA 4C8LA 4WQ4A 3RRHA 1ATRA 4BGBA 1MWKA 4ID5A 3SYZA 4HWIA 3AA5X 3NH2A 2B5JA 3QBWA 1QQNA 3V9XA 4BRPA 4RCHA 4GNIA 1KLMA 4I6MA 3ZEUA 4IEEA 4Z4HA 4FLYA 3THVA 4AM6A 2QKBA 3I33A 1U2VB 4O0JA 1X9MA 2O8DA 4ILGB 5AQPA 3ZX0A 3O08A 4FPAA 4JKDA 2X74A 1VRUA 3ENHA 1MWMA 2O8CB 5HRSA 1C1AA 1NLVA 3RRGA 4BRDA 1WBDA 5BPNA 4BQZA 4Y1CA 3H45C 3MMVA 4EIAA 3AA2A 1HKCA 1YVNA 3FZMA 2RF2A 1EO1A 4FJ7A 1QS4A 3WXIA 1NK7A 3HP6A 3M3ZA 4H0YB 4GV6A 5KTQA 4LSNA 4M3UA 4JD2A 3VQCA 4CHYA 4YOVA 2HHWA 3DXMB 3M8PA 4CBUA 1OVYA 1VQPN 4KHQA 4WQ5A 1TKDA 4FWKA 4CJVA 4BR4A 1MDUB 1WSFA 3T1YK 1YF5L 1E4FT 5GADP 2WOMA 3RR7A 4DQRA 2AA4A 2YNFA 4B3MK 1QHAA 1JLGA 2KFNA 1NGJA 3AVGA 4KO0A 5F2RA 4FJLA 2FC0A 1NK9A 3DLBA 4LD0A 2JWLA 4E7KA 3MWPA 3M8QA 2LSNA 4I2QA 2Y1IA 3CPEA 1X3NA 4MO4A 3L2VA 5BRFA 5SWMA 5FRMA 4W5TA 4OJRA 3SBGA 4ELTA 2CGJA 1NGHA 4CHQA 2IIRA 5LMNK 2Z1HA 5ELZA 1KRPA 5D3GA 1U45A 4BVPA 3CC7N 4KHUA 2HOEA 4CBXA 2E2QA 5EOYA 4BRMA 1QQMA 3UB5A 4CEBA 1T05A 4O55A 3OYCA 1WUAA 4NLCA 4RG8A 3SI6A 3KLGA 4JHDB 4BC4A 2VGMA 4X64K 1W2BM 2HBMA 4O4GA 4OKEA 4IDKA 3D7EO 5J1EA 4JS4A 3OYNA 2O8BA 3QEXA 1VSEA 1S22A 3JXUA 4FZZA 3MXMA 5AQSA 1VQKN 4H0TB 3ZSQA 2Q97A 2OPRA 4HUGA 4M42A 5CZ2A 1QZ5A 2BUPA 4F3OA 1S1UA 3O9RA 3FGUA 3VA3A 2FBXA 3W0LA 3THYA 1WSEA 1JL1A 1U6ZA 2XRIA 2ZGYA 3DM2A 3TABA 1U47A 1TL3A 1RT2A 5FPDA 3FZLA 1EQYA 4H5WA 1DKGD 3R1XA 3QFUA 3VQQA 2P9NB 3L0QA 2HW3A 4DSIA 4AILC 3DLLL 3PLAA 3EZ5A 3VQAA 2OTLN 3D2FB 4FM2A 4QS7A 1W97L 2GEMA 4KKOA 1XWLA 4KB0A 4K41A 3ID6A 4BE1A 4JKAA 2GUPA 4DSJA 3O9SA 2ATQA 1DGKN 3CCSN 1SL1A 3OJUA 1T6CA 1NJWA 1WNSA 1NOYA 4NCAA 4U67L 2VCPA 1K8KA 3O1BA 3EKSA 4EZ6A 4DTRA 3GL1A 4CD1A 3KZBA 3NF9A 3ZCMA 1SS6A 1S3XA 4F9OA 5JLHA 3C6HA 2VWKA 3BZKA 1NU0A 4KREA 3MEGA 4K8ZA 2FF3B 3G71N 3T69A 5AQWA 3QNNA 3MECA 4LF8K 4RWTA 1HNZK 5FLXO 4JK7A 3K5LA 3TARA 1YUWA 1WSGA 3NF8A 1YIJN 2HNZA 3FZHA 5GAEP 2ITMA 3TR8A 4KPYA 3PUFA 4KB1A 4MDBA 2VG6A 4DV0K 1YTAA 1OH8A 4FK2A 4CJPA 1KVCA 4DB3A 3MCPA 4LFCK 4AHUA 1NGAA 1B9FA 5AQVA 4B3TK 4JKGB 3RTVA 1IKWA 3NFAA 4DQPA 4UQGA 1J54A 2Z1JA 5AQYA 3OS2A 3PO5A 2QA4N 1RTJA 4CJLA 5AQOA 2Q0UA 3KK3A 3NVKA 1N32K 3T3FA 4CERA 3K9JA 5M1OA 1HKGA 1NGIA 1WBBA 1JLBA 2UXDK 4ICLA 3U4LA 5DM6L 1X3MA 3PX6A 2G8VA 3KHYA 4JKEA 1Q7YO 4CIGA 1SAZA 3KK2A 4G1QA 1GOCA 1C1BA 3HM9A 3AVLA 3CCMN 4N41A 3CJ7A 3ULEB 1LW0A 1BCOA 3MEEA 4RW4A 4DU4A 4BR9A 4YDUC 3OA9A 3O3GA 4PL7A 4G9ZA 4Z94A 2QWOA 1XNQK 2ZJQL 4CHPA 5M1KA 2O8FB 4OPJA 4HUFA 3NF7A 4W5OA 1J53A 4FWLA 2OPPA 1NKBA 3K5MA 1M1KO 2XO7A 4FSVA 1NGDA 4HUEA 4CE9A 3SNNA 3PO4A 2G8KA 3DRRA 2UUAK 1YJWN 3RSEB 5M1QA 3KJVA 3O80A 2F9TA 3BZCA 4J8FA 3MK6A 3OW2M 2G8IA 2ZM6K 2FLOA 2RKIA 4FM0A 4JI0K 2WTUA 4LSLA 4KHYA 4PKHA 3VEWA 1ZC6A 3OYKA 4CEAA 1Y64A 3QNOA 1ILYA 3QBXA 4CF0A 3B6OA 2O4IA 3CJ1A 1C1CA 2D0OA 3QETA 1SQKA 4AHVA 4IFYA 4FJ5A 2FBTA 2GELA 4DFMA 3VOVA 3CG7A 3I0SA 2FSNA 1BU6O 4CJFA 2XY7A 3L2QA 3CFOA 1EKEA 4CZGA 3UKUA 3N4QA 3EY1A 2EHGA 5AZIA 4DR4K 4MDAA 2NRHA 4DKWA 4IBNA 2Q31A 3DLRA 3V1OA 3WNGA 3HT3A 3LM2A 5CY4A 4HTLA 4BDZA 1HJOA 3OYJA 4FK4A 1NM1A 4M45A 2RE2A 2P9UB 1N34K 3AY9A 4AF1A 3KK1A 2W42A 3AO3A 4H8KA 3A5LC 3NGIA 1RT7A 4J2BA 2QI2A 2VG5A 3D6RA 2F9WA 3OS0A 3MCAB 1OH7A 4DUYK 4LF5K 1NMNA 3AARA 2HHHK 2E6LA 4ISGA 4K8XA 4CIEA 3IUCA 5LJVA 4RW7A 3THXA 4OKJA 4E7LA 3JS6A 2O4GA 3TTCA 4LY7A 4KAZA 4XEIA 1FJGK 1HR0K 5T7BA 4C8OA 1Y97A 2Q1NA 5GIOA 3U9DA 3CI5A 4CZLA 2WBNA 4AHRA 1WAFA 5AQXA 3OS1A 2P9SA 1RCHA 4M3RA 2P5GA 1U04A 4DR5K 5HP1A 2P9PA 3O4NA 3CMAN 1IV0A 4MFBA 3VQPA 3ZT0A 3SQ1A 1SUQA 5EVZA 4DG1A 3WUHA 1D9DA 3O1WA 3D45A 1TKXA 3OYIA 4WFAL 2GX9A 1XQSC 2HHTA 3AVBA 5HBMA 2HSTA 1HYSA 2VQEK 3LZIA 3CM5A 2HMPA 4E19A 4UY8O 1YI2N 4PHTX 4B8AB 4B9VA 3O3HA 3IAYA 4FW1A 5K14A 3HSTB 4H4OA 3U3GA 5BR8K 4H0XB 3PSFA 5AQTA 3V9UA 4CEOA 1WOQA 2WONA 2D0BA 4FWQA 1GLDG 4M7XA 4NXNK 4K42A 4CEDA 5BREA 1HYZA 4A5AA 1BWFO 1JLFA 4Q5VA 3KTQA 4PKGA 4FK0A 3K9KA 3NDKA 2P9IB 3K5OA 3KLHA 1VSIA 4JN4A 2YKMA 3GDQA 3EE9A 1W0HA 3EN9A 5CE3A 4WE1A 4YHHK 4PA1A 1XMOK 1YJ9N 1RTDA 5KQ8A 4MQ3A 4IJAA 1ZBFA 1C0TA 5E84A 2QEXN 3O6WA 3E01A 3M8RA 4CGIA 4H0VB 1VAZA 1GLLO 3ZT1A 5C2FA 3OYEA 3H1VX 4FZXC 2GWKA 4YDUA 2HHSA 2NRWA 2OYQA 3TPQA 3ZSVA 1VSDA 4HCCA 4B3RK 3DRSA 5C12A 1IBLK 4B1UB 1VQ6N 1RT1A 2D0CA 3MXIA 1U49A 1HNWK 3ZSWA 3JYTA 4CZEA 3AVHA 4C8MA 2YHAA 1QHTA 1DT9A 5AZJB 1EWQA 1RDBA 3BP8A 4JRQA 4QOZB 2HHUA 3O9TA 5C2DA 3KK7A 3TSUA 5KQDA 2YI1A 5GAHP 2W6KA 3EZWA 4DR2K 1SL2A 3VF2A 5MLCQ 2G8UA 1DLOA 1ZBIA 1YJNN 5M1NA 4ISFA 1WSJA 3G4SN 2FBVA 3PIOL 1KFSA 1Z26A 1TV6A 1J9AA 4OGEA 3CF5L 1RDAA 4X62K 5A2QO 4FJGA 3AVNA 1K9MO 3VN5A 1T7PA 2F8SA 1YXQA 3KLFA 3ASMA 2QXLA 3HVTA 5AQHA 3KD1E 4DR1K 4FWRA 5I3UA 2O8EA 4DHYA 4IWVA 4CCHA 4B8CA 3ZT4A 1QE1A 1XI1A 1EWRA 3HPHA 2NRTA 4CBWA 1P8ZA 1NGEA 5KPZA 3AA4A 2QTDA 2PBDA 4DV4K 4E1MA 3IRXA 4BR0A 2P1JA 4GV3A 2QXFA 3ENBA 4DTMA 4LH4A 3O5BA 3J7YP 1KQSM 1I3AA 2GBZA 3PSIA 1BQNA 1S1XA 4IFEA 4KBOA 1BISA 3M8SA 4FWPA 4BE0A 3J81O 2P9KA 1LWEA 1Q81O 4CF2A 3HL8A 3DLHA 1JJ2M 4I6MB 3VTIA 3ZEUB 4CEQA 4CJQA 3OYBA 5AQLA 2HVHA 2OCEA 1WSIA 3C6AA 5JMVA 1JCFA 2O8DB 2ZD1A 1XHXA 1TAQA 3ITHA 3QEIA 3AAQA 3TAPA 2HBJA 3KVGA 5AFUA 2D1KA 1P90A 4A61A 1TK0A 4AM7A 4A2BA 4O8UA 5DMRA 3HOTA 1NKCA 1WB9A 3H3NO 4NYFA 2E1YA 4EP5A 3I8BA 1T6DA 2IVNA 4JKHA 5EY4A 3EE8A 4DR6K 3GOIA 3UE5A 1HPZA 1X9WA 1QTMA 4JYAK 4WCEL 4QCLA 4B1YB 4W5NA 2Y1JA 1BCMA 2YHXA 3OYFA 2V52B 4CFAA 3TAGA 1TKTA 1ZYQA 2IDOA 3KWIA 3NGYA 2QW9A 4JD2B 5M1FA 3EL2A 1EX4A 1K6YA 4E3SA 1VQ4N 5GIPA 1IO2A 4FWOA 4H0PA 3TSPA 3SQ4A 2PY5A 4B9SA 3A0IX 3CFPA 4R5PA 5HOOA 4FWNA 4FVMA 3MX5A 4JS5A 1HNIA 4M3ZA 5FRNA 1ZBLA 1NJYA 1KFDA 1TYQA 5AQZA 3FZFA 4JI8K 5I42A 1ASUA 3JSMA 4B3SK 3U6FA 2FSKA 4PY5A 4M63C 2ZJRL 3LP3A 3CCEN 1L3UA 4JAXA 3N4PA 1NK8A 4IFVA 2KTQA 3QDKA 1Z05A 3H46O 4DSLA 1KTQA 1A5WA 4A59A 4C8KA 1ZBHA 4WF9L 1X9SA 4FOEA 2BTFA 5I9EB 3VF6A 3CETA 4CJWA 2QK9A 4MO5A 5KGWA 4IO8A 3C0BA 3LP1A 4QS9A 1RDUA 1EXQA 5DK5A 4FJNA 2HHXA 4O0IA 2IGIA 4NXMK 1NK6A 1C0UA 1J5EK 3WNEA 4IOXA 5C15A 1OH5A 2OZSA 3KLIA 5AFUH 2F4VK 1HUXA 3ZSYA 5CZ1A 3RVCA 3C6UA 1LCUA 1DTQA 2P9LA 2DY4A 4B9QA 4WYBA 3GG4A 3S9HA 3HBTA 3O8MA 4FOIA 3ZETA 3H1QA 4E7IA 2VG7A 1Z6RA 5B8HA 2ZE2A 3LL3A 4BRLA 1R0AA 4RW8A 3V81A 1BI4A 4XIUA 2KW4A 3U3YA 2HMIA 4CJKA 3THYB 4E0DA 1Q9YA 1HYVA 1NMDA 3P5JA 4BRKA 4DCHA 3SMPA 1CZAN 2PYLA 3UKRA 1VSHA 2QWQA 3LALA 4B1XB 5EX5A 3HO1A 3SPYA 4BR2A 1RBRA 1KC8O 1REVA 2V7ZA 5J2NA 3U8XA 5E26A 4DLGA 3VETA 2IOCA 4YOXA 3NHGA 2PFUA 4DSKA 3DI6A 1B92A 3BF1A 3SAGA 2G8WA 3G10A 4FJXA 4E7JA 2CGLA 3QEWA 3QMLA 2X6SA 4ID1A 3VEOA 4DF8A 4DU3A 4EZ9A 2NLXA 4CGGA 2I5JA 2HHQA 3WNHA 3DWLA 4JI7K 4DF4A 3CQYA 3CFRA 5C25A 4IG0A 1GLEG 4EP4A 4IG3A 3QEVA 1TUYA 5J2MA 1K8KB 2IVPA 1RBTA 4IJNA 4BRIA 2DTUA 5JVHL 4Z4GA 4JNEA 1IKYA 1X1PA 3PX0A 3VQ6A 4CF8A 4WFBL 3CPWM 2D0AA 1OH6A 4CK1A 5BR9A 4K0KK 1N6QA 4YFUA 4B1VA 3LDLA 3VQEA 2W41A 5AQFA 1WN7A 4CHNA 2RHKA 2KLAA 3ULEA 1KSPA 4B08A 3OYMA 1LW2A 2VWBA 1NGCA 3KLEA 4B9NA 2WFBA 4FWSA 2XY8A 2NZTA 3ENOA 1N33K 4NCBA 4IZ9A 3HZ6A 1NOZA 4FL9A 1T03A 5M1PA 4FJMA 4OKKA 3EEQA 1R59O 3OYHA 3IFRA 5CHIA 3FR0A 2A3ZA 4EHTA 1QZ6A 2HBKA 4AQYK 1SV5A 3NVMA 4DQIA 1A5XA 3CM6A 3KKRA 4AH9A 4XH1A 4Q0BA 2NNWA 3AGRA 3LANA 2BANA 4EAHD 4JI4K 1BUPA 4F8RA 4OX9K 1LAVA 1T3VA 3ID8A 3WEEA 3MWTA 3O4QA 3I8DA 4PUOA 4GW6A 3SUNA 3B8AX 4DV1K 1JXBA 4GY2B 5KI6A 4CEFA 5H1SQ 1BGXT 1S6PA 2UXBK 3OTOK 3RWUA 4CGFA 1VQ9N 2JWKA 3THWB 2OZMA 1GLAG 4BREA 1RBVA 4JKBA 2XHBA 2F96A 3SAHA 1K8AO 3E9OA 4E1JA 4AHCA 3P4IA 1IKVA 3OYGA 1RT4A 4O44A 4JRPA 2WC9A 1RBSA 5HRNA 3LP2A 3SJHA 3VPZA 2Q3SA 1QVFM 4I9LA 3CQ8A 2ASMA 3E9PA 4LF6K 5AQKA 4JI1K 4CJ7A 4E89A 4FW2A 4JKFA 2VQFK 2RN2A 2QWMA 3C6TA 3HYFA 4OPAA 3VTHA 2E2NA 3C7NA 1SKWA 3HOSA 4FZYA 1RDWX 4BC2A 1BG3A 3AVAA 1TK8A 4JEPA 1TL1A 3I55N 2UUBK 3S3MA 4HHTA 1JL2A 4H5VA 4N56A 3NH0A 3SPZA 4F4KA 4FO0A 1BOTO 1X9JA 1LAWA 1XC3A 1ATNA 4PKIA 2HF4A 1E3MA 1JCGA 2AJQA 1JCEA 4IDHA 1ITGA 1TAUA 4ILHA 3Q7BA 4KV8A 4L8RB 5BRHA 2HB5A 3A5NC 3HVRA 1NWKA 3AAPA 3KIOA 3TANA 4NCGA 4M3YA 3LDNA 3WXJA 3C94A 1D8YA 3T7ZA 3DXKA 1W9HA 4DUZK 2R7YA 1QSLA 1J6ZA 2EX3A 4YOTA 2ITGA 3MN7A 4Y1DA 5AQUA 1IJJA 5LMUK 2HNDA 4B9UA 1BA1A 4LF7K 3LDPA 4DSFA 2B4JA 4LFAK 3V1RA 3LAKA 4YOWA 1I94K 4FLVA 4JK9A 3TTDA 4LFBK 4OVLA 3CC4N 1D5AA 1IKXA 1BIZA 4DV3K 3WXMB 1NBWA 2OANA 3E1YA 1QSYA 2VGNA 4FM1A 3K57A 4DLEA 2E8AA 5JLFA 2OPQA 3IDHA 3HM8A 1CLQA 1XUPO 1ATSA 4H5RA 4BY9C 3MN6A 5GAGP 3AO5A 3SUPA 3NF6A 4FJIA 2P9IA 3THXB 4KH6A 4Z4IA 2E88A 5ADXA 1F21A 3M5RA 3ATVA 4H5TA 2BE2A 4Z4FA 4DTXA 3WXKA 3OYAA 5CYQA 4FYDA 1VQLN 1RDCA 3VQ4A 5KPRA 1HNXK 4LF4K 3DOLA 4RW6A 2P9SB 1N36K 3D2EA 4B1ZA 2ETJA 3DYAA 3HI0A 2OA8A 2P9PB 2BDPA 3AVCA 3C65A 4NO7A 1HMVA 2ZF5O 3SUOA 3W3DA 1ZBUA 2W6LA 3MN5A 4CJ4A 4DV5K 4MLEA 3G6EN 4Y0WA 2VWJA 3P83D 2CGKA 2B6AA 4BROA 5C10A 4OGCA 1VSKA 4JI2K 4FLZA 5HLFA 1LWCA 4CJRA 3V4IA 2QWPA 2QM1A 3TI0A 4LC9B 3NGZA 3PY8A 3P1GA 1YT3A 1S9EA 1LOTB 1RGIA 1CXQA 3F9MA 3SZ2A 1IG9A 4FLTA 4HCBA 5BN9A 5J2QA 3RMCA 5HROA 3LAMA 4O5BA 3EKUA 3K58A 3V9WA 3VMFB 3OYLA 3E9LA 1DEJA 4PL8A 3R9PA 1KAYA 3CCQN 1KVBA 4BRHA 1HRHA 3WXLA 1HNVA 2V51B 1YVUA 2HBLA 4CEEA 4U7BA 3ZT2A 4FLWA 4CJEA 1XHZA 1H1VA 1GLFO 5FDLA 4BWMA 1VQ7N 5JS2A 3PX4A 3QEPA 1RDDA 1KAZA 4I9QA 5FPMA 4KH5A 3LDOA 3ZT3A 3AVIA 3VGKA 1BO5O 5AJ3K 4ILJA 3HXMA 4KHSA 4GVEA 3VGLA 2ZJPL 3SAFA 4A2AA 1U2VA 4C23A 1N8RO 1NG9A 4DR7K 4CK3A 4FJKA 4GVMA 2BH1A 3IKMA 3TU5A 1FXXA 3AO4A 1BL3A 1VK0A 2AP1A 4CZFA 3NMUA 2W40A 4CVNE 3J80O 4JV5K 3K59A 2O8CA 2YNHA 3HRGA 3S3NA 3KKSA 1NNEA 4OPKA 5ADXH 1SKRA 1G99A 4CJTA 3RMAA 4CGJA 4LH5A 3CERA 3CCUN 1VRTA 3O4WA 1SKSA 2E6MA 4GKKK 1UWBA 2NRZA 1MA9B 3B6PA 3HTVA 4NB4A 5CR4A 4X66K 3RMBA 3R8EA 4CZIA 1TVRA 1YAGA 3H08A 3KD5E 3J7ZO 2KZZA 4CK2A 3DXMA 1CZBA 3EO3A 2GWJA 2P5OA 2ZGZA 1KAXA 1NK4A 5AQQA 1RTHA 4BQLA 2P51A 3VQ8A 3VEYA 3F2KA 2O8EB 1D9FA 4N5SA 3SV4A 4IEIA 3E66A 1NJZA 3OHRA 1HLUA 4ZHRA 2YV0X 1CZ9A 2A1SA 4CW7B 3OBWA 1Q86O 3J7AP 1S1WA 1LV5A 5AQNA 4YORA 4ZTJA 3AV9A 1KVAA 1IBKK 4NLBA 3CCJN 2BGGA 1MU2A 4GV9A 4FPBA 2KKZA 2YJFA 5BPMA 3WQUA 3A5OC 4AHSA 4B9MA 3HP9A 3L8BA 4O5FA 3LP0A 4TSXA 4FJ9A 2P9KB 4CECA 1IG8A 4JK8A 5C24A 3BY5A 4YOYA 4DV2K 3AVMA 1FKPA 2KZMA 3LPTA 3L2UA 2G8FA 2WUSA 1O13A 1HJRA 3HPOA 4OLAA 4A5BA 3JAMO 4I2PA 4W5QA 3MEDA 4JHDA 4M3TA 3K2PA 3AA3A 3VQBA 4DQSA 1TK5A 3G0ZA 4C1NK 3SJJA 2FBYA 2YX6A 3NH1A 4H5NA 5AQGA 4X65K 5J2PA 4CJ3A 2UUCK 1Q8IA 3CCRN 4IXCA 1VSFA 4EFHA 1S72N 3QB0A 2NRXA 3AO2A 5EU7A 2QWNA 1KCFA 2Z1IA 1B9DA 3TSQA 2E5LK 3SBTA 1OVQA 1YHQN 1S1VA 1BQMA 1GLJO 4DQ8A 3QERA 1YITN 2YNIA 5LY3A 1ESVA 4KHNA 4N47A 4CFDA 2YJEA 5KRTA 1L3SA 5TKWA 3P39A 3O3FA 5GINA 5BN8A 3ZX2A 3OJSA 4OO1J 2CH6A 1WAJA 3KWGA 4CZJA 3FZKA 5JICA 1IH7A 4FVUA 2P9NA 1VQON 1T44A 3IMXA 1JLQA 4FJJA 3EYZA 1Q9XA 4DMNA 4BG9A 4GKJK 3QO9A 3TAFA 4J2EA 3L2WA 3D2FA 2A1RA 2H3GX 1JLAA 3AVKA 2ASPA 3V1QA 4DU1A 5C0YA 1UOCA 4HVJA 3NBPA 3L2RA 4H4MA 1JKHA 3FFKB 4DR3K 1TYQB 2F7TA 3VEVA 3QFPA 3SV3A 4JKCA 3QESA 4B1WB 4DWIA 4DTPA 4YY3K 1W7AA 3QICA 2O8BB 4ISEA 4DTOA 2JGUA 4CGDA 4FCYA 5TKYA 3VGMA 4DFKA 4B9LA 4LF9K 2IC3A 3SQ2A 1VQ5N 3A8YA 3BGRA 4Z0UA 4QAGA 4FJ8A 4BVOA 1UA1A 5KPTA 1NJXA 4M3XA 4CIFA 5BRDA 1K73O 3DLEA 2J4RA 4BRFA 4CJUA 4PQUA 5IWAK 4BACA 1U4BA 3HPGA 3T19A 2UU9K 3F73A 2KFZA 3K0SA 3Q7CA 2NUBA 3HSCA 3CD6N 2E2PA 1SL0A 2HNYA 2QWRA 4KHPK 4Z4EA 3CQXA 1QSSA 5JVGL 3DLKA 2PAVA 1KXPA 1A5VA 4A57A 4E1NA 3OY9A 2HVIA 1JLCA 4DV7K 4ELVA 4CJSA 1TKZA 2P9LB 4CESA 2EWSA 4IO9L 1UAXA 3H6EA 4JKGA 3ZETB 1RT3A 4BRQA 1VSMA 1XNRK 3ZSXA 3V9SA 1RT6A 4CD3A 4DFJA 1BI4B 5FPNA 2ZWHA 3MDQA 2NRVA 3SMSA 1G15A 4CFBA 3OBYA 1VSJA 3FFIA 4BRGA 5IT9O 4CF9A 5F1XA 4CEZA 1L5UA 3BUZB 4V19S 1N5YA 4H03B 1RBUA 2XY5A 4FJHA 1ASWA 1I39A 3UKRB 4M41A 1TUUA 2GV9A 2D0PA 3RR8A 4YNQA 1VQNN 1RILA 2E1ZA 2FXUA 4FLXA 1CXUA 1M90O 5LL6Z 5E41A 3WQTA 1O1WA 1XMQK 4K25A 4ELUA 4B3OA 3LWMA 1NGGA 4M7YA 4CJ5A 1L3VA 2RPIA 2YNGA 5KGXA 2O8FA 3LZJA 2YCHA 5SZTA 3TTFA 3SUQA 1VQMN 2HHVA 4K43A 3SQ0A 4BRCA 1NGBA 1KD1O 1ASVA 4DTNA 4KTZA 3TAMA 2CH5A 3ISNC 4CGHA 3C95A 3CJAA 1L3TA 3OVNA 3ZLJA 3HK2A 4CZKA 3RSEA 1Z25A 1TGOA 4KTWA 4BRAA 3J8AA 3VA0A 3ALYA 2HF3A 2I7PA 3BEXA 4DTJA 3SCXA 3THWA 5F0XA 3RMDA 3IG1A 3ZYYX 4DS5A 1QQCA 4OPHA 3OYDA 3PIPL 3F5TA 2PYJA 4GMJB 2KHOA 3R3LA 5LJWA 4RTFD 1XC9A 3VQ9A 3CXCM 3QINA 3M6GA 4BC3A 4DSEA 1V4TA 1ZXOA 5AQJA 2X78A 1S9GA 4CZMA 5KRSA 1IBMK 4NYNA 4DFPA 1U48A 3V9ZA 2D5RA 2DPNA 4JI3K 4C8NA 3SK3A 4F3TA 3CMEN 3CJBA 3S41A 2G8HA 1GOAA 3NCIA 4JI5K 3WT0A 3ZSZA 3AGKA 3DMJA 3ZX3A 4DV6K 1GLCG 5AR0A 4B9TA 4F2SA 3CCVN 3LWLA 1EETA 4FLUA 3TAEA 2P9UA 3H3OB 3WEEB 3WNFA 4BWJA 3VEXA 3TWHA 4DS4A 4WQ4C 2A40A 1QQOA 3FLCO 5BPLA 1BHLA 3AVFA 4HTUA 1FW6A 3BF3A 4A62A 1NGFA 4BGAA 3L4QA 3HJFA 3S3OA 1GLBG 1VSLA 4EHUA 2QKKA 1RT5A 2JLEA 3AVJA 4C1NI 1HQUA 3O9UA 3V6DA 4W5RA 1RFQA 4CZHA 3DAWA 2Q2RA 1UA0A 3VQ7A 1QVGM 2A42A 3ZSRA 1JLEA 3VQDA 3D0PA 1HX1A 4N76A 3LPUA 2YHBA 5AQIA 2UXCK 3T1AA 4BC5A 3MAQA 4XH4A 2PZSA 3C7NB 3NE6A 2E4LA 4DQQA 3UKUB 3CC2N 3R6MA 1S5JA 5AZIB 1NKEA 2GTDA 1KLNA 4CFCA 4IKFA 2X6NA 2FF6A 5DM7L 4JI6K 5CYMA 5EXWA 1WSHA 4J2DA 3DRPA 3GBTA 4MLHA 3F9KA 1E4GT 2YHYA 3QIOA 2DFHA 3LDSA 3T1HK 1FK9A 4FWMA 3CJ9A 2A41A 3P31A 3CIPA 4BG8A 2I7NA 3TAQA 3VEZA 3L3UA 3CCLN 4ZTFA 1RNHA 4QS8A 5AQRA 2QWLA 3L6QA 4BDYA 3PV8A 1HKBA 2Z1GA 4KTQA 1J5OA 4WQ5C 2Q36A 1FKOA 3L4IA 5AQMA 3I0RA 1SZ2A 3DXKB 4BE2A 1DTTA 1C0FA
chains in the Genus database with same CATH topology
4CHOA 5JS1A 2HHXA 3O3GA 1TVRA 3H08A 4PWDA 4KFBA 3KD5E 4O0IA 2IGIA 4JLHA 2KZZA 1NK6A 4CK2A 4FXDA 4CHPA 1CZBA 1C0UA 4OPJA 3WNEA 2P5OA 4HUFA 3NF7A 4J2AA 4W5OA 1NK4A 1RTHA 2OZSA 1J53A 2P51A 2OPPA 3KLIA 1YTUA 3VQ8A 1NKBA 3K5MA 3ZSYA 4I7FA 1D9FA 4N5SA 3SV4A 5CZ1A 3CYMA 2XO7A 3C6UA 1NJZA 4HUEA 1DTQA 4ZHRA 4CE9A 3SNNA 3PO4A 1EP4A 2G8KA 2DY4A 2YV0X 1CZ9A 3DRRA 3S9HA 1T8EA 2A1SA 5HRPA 4DTUA 3QIPA 1S1WA 2IAJA 4E7HA 4E7IA 1GOBA 2VG7A 3KJVA 1LV5A 2ZE2A 1R0AA 2G8IA 2DFFA 4RW8A 3V81A 3AO1A 1BI4A 4ZTJA 3AV9A 2KW4A 4XIUA 3U3YA 1KVAA 2RKIA 2HMIA 4CJKA 4FM0A 4E0DA 4OLBA 4LSLA 4KHYA 1Q9YA 2BGGA 1MU2A 3OYKA 3QNOA 1C0MA 2GUIA 4CEAA 4CF0A 1HYVA 4CF1A 4AHSA 3B6OA 4B9MA 3QLHA 3P5JA 2O4IA 1C1CA 3QETA 1S6QA 3HP9A 3L8BA 4AHVA 2PYLA 4IFYA 1VSHA 4FJ5A 2FBTA 3K5NA 3LP0A 3LALA 4TSXA 2XY6A 4F2RA 4DFMA 3HO1A 3CG7A 3SPYA 4FJ9A 1RBRA 3I0SA 3IS9A 4CECA 1REVA 3BDPA 4KI6A 4CJFA 1C6VA 5C24A 5J2NA 3AVMA 1JXEA 4DLGA 3L2QA 1FKPA 2IOCA 2XY7A 3CFOA 1EKEA 2KZMA 3LPTA 3NHGA 4AHTA 3L2UA 2G8FA 4DSKA 2F8TA 2IS3A 3DOKA 2EHGA 5C42A 3EY1A 3DI6A 1HJRA 1B92A 2ZQBA 3HPOA 3MXJA 4OLAA 2G8WA 3G10A 4FJXA 4E7JA 4KI4A 4I2PA 4CHZA 4Z4CA 1BIUA 3QEWA 4W5QA 4RW9A 3NAEA 1WLJA 3MEDA 5HRRA 4IBNA 2X6SA 4ID1A 3ULDA 4DF8A 4DU3A 4EZ9A 2DFEA 4CGGA 3K2PA 4M3TA 2I5JA 3AA3A 3DLRA 3V1OA 3VQBA 3WNGA 3HT3A 4DQSA 3G0ZA 1TK5A 5CY4A 4BDZA 3SJJA 2HHQA 2FBYA 3WNHA 1LWFA 3NH1A 1RTIA 3OYJA 4FK4A 5FROA 4DF4A 4M45A 1NK0A 3CFRA 3L3VA 5J2PA 4CJ3A 5C25A 1Q8IA 4IG0A 2OPSA 4EP4A 4IG3A 3KK1A 2W42A 3AO3A 3QEVA 1VSFA 3A2FA 4H8KA 5J2MA 2DTUA 1RBTA 2KQ2A 2YKNA 3VQ5A 4DTSA 4Z4GA 3AO2A 5EU7A 1IKYA 1KCFA 3NGIA 1X1PA 3PX0A 2Z1IA 3VQ6A 1NK5A 1B9DA 1RT7A 3DLGA 4J2BA 4CF8A 4M3WA 2VG5A 2D0AA 3OS0A 4KHWA 4CK1A 4KRFA 1N6QA 4YFUA 1S1TA 3UIQA 1S1VA 2E6LA 1BQMA 4K8XA 4CIEA 3QERA 3VQEA 4RW7A 1WN7A 1HQEA 2YNIA 4CHNA 4OKJA 3ZSOA 4N47A 4E7LA 4KHNA 4BDPA 2O4GA 4CFDA 4LY7A 1KSPA 5KRTA 4B08A 1L3SA 3OYMA 4KAZA 1LW2A 5T7BA 4C8OA 1Y97A 3O3FA 3KLEA 4B9NA 4C8LA 3OJSA 3RRHA 1WAJA 2XY8A 4ID5A 4NCBA 3SYZA 3AA5X 1IH7A 1NOZA 4AHRA 1WAFA 2B5JA 3NH2A 1T03A 3OS1A 3V9XA 1RCHA 4M3RA 3LP1A 2P5GA 4FJMA 1U04A 5HP1A 1JLQA 3O4NA 3EYZA 4OKKA 4FJJA 1Q9XA 4MFBA 3VQPA 3ZT0A 4DMNA 3SQ1A 3OYHA 1SUQA 3QO9A 4DG1A 3TAFA 4J2EA 1KLMA 3L2WA 4Z4HA 4FLYA 2A1RA 1JLAA 3AVKA 3THVA 3V1QA 4DU1A 1D9DA 3D45A 1UOCA 2QKBA 1TKXA 3OYIA 1SV5A 4HVJA 4DQIA 2HHTA 1A5XA 3AVBA 3CM6A 3NBPA 3KKRA 4H4MA 5HBMA 3L2RA 3RMBA 4AH9A 1HYSA 3LZIA 1JKHA 4O0JA 3CM5A 1X9MA 4Q0BA 3SV3A 4E19A 3LANA 2BANA 3QESA 4B8AB 4B9VA 3O3HA 2X74A 3IAYA 1VRUA 4DWIA 4DTPA 4FW1A 5K14A 1LAVA 3HSTB 4H4OA 4F8RA 3O4QA 3I8DA 4DTOA 3U3GA 4PUOA 2JGUA 4GW6A 4CGDA 4FCYA 3SUNA 5HRSA 1JXBA 3V9UA 4CEOA 1C1AA 5KI6A 4DFKA 4B9LA 2WONA 2IC3A 3RRGA 4CEFA 2D0BA 3SQ2A 1BGXT 1S6PA 3BGRA 4Y1CA 4Z0UA 4QAGA 4FJ8A 1UA1A 4CEDA 1HYZA 3AA2A 3RWUA 1NJXA 4M3XA 2RF2A 4CGFA 4CIFA 1JLFA 4Q5VA 3KTQA 2OZMA 4FJ7A 3DLEA 4CJUA 4FK0A 1QS4A 1RBVA 3NDKA 2XHBA 2F96A 4PQUA 3K5OA 3KLHA 1VSIA 4BACA 3HPGA 3T19A 3HP6A 2YKMA 1U4BA 4AHCA 1NK7A 3F73A 1IKVA 2KFZA 3OYGA 1W0HA 1RT4A 2NUBA 4O44A 5KTQA 4WE1A 4JRPA 4LSNA 1RBSA 4M3UA 1SL0A 4PA1A 3VQCA 2HNYA 4CHYA 5HRNA 3LP2A 1RTDA 4MQ3A 4Z4EA 2HHWA 1QSSA 2Q3SA 3DLKA 1ZBFA 1C0TA 3M8PA 4KHQA 4I9LA 3CQ8A 3E01A 1TKDA 1A5VA 3M8RA 4CGIA 4E1NA 4CJVA 3OY9A 4E89A 4FW2A 1WSFA 2RN2A 1JLCA 3C6TA 2HVIA 3HYFA 3ZT1A 4ELVA 4CJSA 3OYEA 2WOMA 3RR7A 4FZXC 1SKWA 1TKZA 4FZYA 2HHSA 4DQRA 2OYQA 2YNFA 4CESA 3AVAA 1UAXA 1JLGA 3ZSVA 1TL1A 1VSDA 1TK8A 4HCCA 2KFNA 3AVGA 4KO0A 4FJLA 3DRSA 2FC0A 4HHTA 3S3MA 1JL2A 1RT3A 1NK9A 3DLBA 4N56A 3NH0A 4LD0A 3SPZA 4F4KA 1VSMA 4E7KA 1RT1A 2D0CA 3M8QA 3ZSXA 1RT6A 3V9SA 2LSNA 4DFJA 3MXIA 1BI4B 1U49A 1LAWA 4I2QA 2Y1IA 1G15A 4CFBA 3ZSWA 3JYTA 1VSJA 3FFIA 3AVHA 4C8MA 3L2VA 5SWMA 2AJQA 2YHAA 4CF9A 1ITGA 1TAUA 1QHTA 1L5UA 4CEZA 5FRMA 4KV8A 4L8RB 4W5TA 2HB5A 4OJRA 1N5YA 1RBUA 1RDBA 4JRQA 4QOZB 4ELTA 2XY5A 2HHUA 4FJHA 1ASWA 4CHQA 1I39A 4M41A 3HVRA 2GV9A 2Z1HA 3RR8A 3KIOA 4YNQA 3TANA 1SL2A 1KRPA 5D3GA 1RILA 4NCGA 4M3YA 2G8UA 1DLOA 1CXUA 4FLXA 1U45A 1ZBIA 4KHUA 3C94A 1D8YA 5E41A 1O1WA 1W9HA 2R7YA 1WSJA 1QSLA 2EX3A 2FBVA 1KFSA 1Z26A 4ELUA 1TV6A 1J9AA 4OGEA 3LWMA 4B3OA 4CEBA 4CJ5A 1T05A 4O55A 1RDAA 3OYCA 2ITGA 4Y1DA 3AVNA 4FJGA 1L3VA 3VN5A 2RPIA 4RG8A 2YNGA 1T7PA 3SI6A 3KLGA 2F8SA 3KLFA 5KGXA 2HNDA 3ASMA 3LZJA 4B9UA 3HVTA 5SZTA 3KD1E 3SUQA 4DSFA 4O4GA 2HHVA 2B4JA 4OKEA 4IDKA 3LAKA 3V1RA 3SQ0A 5J1EA 4FLVA 5I3UA 4JS4A 3OYNA 1ASVA 4DTNA 4OVLA 3QEXA 1VSEA 4CCHA 4KTZA 3TAMA 1D5AA 1IKXA 1BIZA 3ZT4A 4B8CA 4FZZA 1QE1A 3ISNC 4CGHA 3C95A 3MXMA 1L3TA 3OVNA 1XI1A 3HK2A 1QSYA 3HPHA 4FM1A 3K57A 4DLEA 1Z25A 1TGOA 2OPQA 3AA4A 3ZSQA 4KTWA 3VA0A 2OPRA 3ALYA 4HUGA 4M42A 5CZ2A 1CLQA 4E1MA 3IRXA 4DTJA 2P1JA 2QXFA 3SCXA 3AO5A 3SUPA 4F3OA 1S1UA 1EXQA 3NF6A 4DTMA 4LH4A 3RMDA 3IG1A 3VA3A 2FBXA 4DS5A 4FJIA 1QQCA 1WSEA 1I3AA 1JL1A 2XRIA 3DM2A 3OYDA 3TABA 2GBZA 1U47A 1TL3A 1RT2A 1BQNA 1S1XA 4Z4IA 1F21A 2PYJA 4GMJB 1BISA 2BE2A 4Z4FA 3M8SA 4DTXA 3OYAA 5CYQA 4FYDA 1XC9A 3VQQA 3VQ9A 1RDCA 3QINA 3VQ4A 3DOLA 4RW6A 4BE0A 2ETJA 4DSEA 2HW3A 1LWEA 3DYAA 2X78A 2OA8A 1S9GA 2BDPA 4DSIA 4CF2A 4AILC 3HL8A 5KRSA 3AVCA 4NYNA 3EZ5A 1HMVA 3VQAA 3SUOA 3DLHA 1ZBUA 4DFPA 1U48A 4CEQA 4FM2A 4CJ4A 4CJQA 3V9ZA 3OYBA 2D5RA 2HVHA 4KKOA 4C8NA 1XWLA 1WSIA 2VWJA 3P83D 4F3TA 4KB0A 2G8HA 2B6AA 4OGCA 1VSKA 1GOAA 4BE1A 4FLZA 1LWCA 5HLFA 4DSJA 3NCIA 4CJRA 3V4IA 2ZD1A 2ATQA 3ZSZA 1XHXA 1TAQA 3ITHA 3QEIA 3DMJA 3TI0A 4B9TA 1SL1A 3TAPA 3NGZA 4F2SA 3PY8A 3P1GA 3LWLA 1EETA 4FLUA 3OJUA 1YT3A 3TAEA 1S9EA 1CXQA 1NJWA 3WNFA 1WNSA 4BWJA 3SZ2A 1NOYA 1TK0A 1IG9A 4FLTA 4HCBA 5DMRA 4NCAA 1NKCA 4NYFA 4EP5A 5J2QA 3TWHA 3RMCA 5HROA 3LAMA 4O5BA 4DS4A 3K58A 4EZ6A 4DTRA 3V9WA 3OYLA 3NF9A 3ZCMA 1BHLA 1HPZA 3AVFA 1KVBA 4HTUA 1HRHA 2VWKA 1X9WA 1QTMA 3HJFA 1HNVA 4KREA 3S3OA 3MEGA 4K8ZA 4QCLA 1VSLA 1YVUA 4W5NA 2Y1JA 1BCMA 2QKKA 4CEEA 1RT5A 2JLEA 3OYFA 3AVJA 4CFAA 1HQUA 3ZT2A 4FLWA 3QNNA 3MECA 1TKTA 4CJEA 3V6DA 3TAGA 1XHZA 1ZYQA 4W5RA 3K5LA 2IDOA 3TARA 3NGYA 5FDLA 1WSGA 4BWMA 3NF8A 1UA0A 3VQ7A 1EX4A 1JLEA 5JS2A 3VQDA 3ZSRA 3D0PA 3PX4A 2HNZA 1K6YA 4E3SA 3QEPA 4N76A 3TR8A 1RDDA 3LPUA 2YHBA 4I9QA 4KPYA 3T1AA 3MAQA 1IO2A 3ZT3A 3PUFA 3AVIA 3SQ4A 2PY5A 4B9SA 2PZSA 4KB1A 2VG6A 3NE6A 2E4LA 4DQQA 1YTAA 3HXMA 4KHSA 4FK2A 1S5JA 1KVCA 4CJPA 3CFPA 4R5PA 1NKEA 4AHUA 1KLNA 1B9FA 4CFCA 4FVMA 4JS5A 1HNIA 4M3ZA 5FRNA 1ZBLA 4IKFA 3RTVA 1IKWA 3NFAA 2X6NA 4UQGA 4DQPA 1NJYA 5CYMA 1KFDA 1J54A 1WSHA 2Z1JA 3DRPA 4J2DA 5I42A 1ASUA 3OS2A 3JSMA 3PO5A 3F9KA 1RTJA 4CK3A 4FJKA 4GVMA 3QIOA 4CJLA 3U6FA 4PY5A 2DFHA 3KK3A 3LDSA 1FXXA 3AO4A 1BL3A 1VK0A 1FK9A 3LP3A 3T3FA 4CERA 1L3UA 2KTQA 1NK8A 4IFVA 3K59A 2YNHA 3S3NA 3TAQA 3KKSA 1JLBA 4OPKA 4ICLA 1SKRA 3L3UA 4CJTA 3RMAA 4CGJA 4ZTFA 1RNHA 4DSLA 4LH5A 3PX6A 2G8VA 4BDYA 1KTQA 3PV8A 1A5WA 1VRTA 2Z1GA 4C8KA 4KTQA 1SKSA 1J5OA 2E6MA 1ZBHA 4CIGA 1X9SA 1UWBA 3B6PA 4G1QA 1GOCA 3KK2A 1C1BA 3HM9A 1FKOA 3AVLA 4CJWA 3I0RA 2QK9A 4BE2A 5KGWA 4N41A 1DTTA 4FJNA 1LW0A 1BCOA 5DK5A 3MEEA 4RW4A 4DU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHO A;  5JS1 A;  2HHX A;  3O3G A;  1TVR A;  3H08 A;  4PWD A;  4KFB A;  3KD5 E;  4O0I A;  2IGI A;  4JLH A;  2KZZ A;  1NK6 A;  4CK2 A;  4FXD A;  4CHP A;  1CZB A;  1C0U A;  4OPJ A;  3WNE A;  2P5O A;  4HUF A;  3NF7 A;  4J2A A;  4W5O A;  1NK4 A;  1RTH A;  2OZS A;  1J53 A;  2P51 A;  2OPP A;  3KLI A;  1YTU A;  3VQ8 A;  1NKB A;  3K5M A;  3ZSY A;  4I7F A;  1D9F A;  4N5S A;  3SV4 A;  5CZ1 A;  3CYM A;  2XO7 A;  3C6U A;  1NJZ A;  4HUE A;  1DTQ A;  4ZHR A;  4CE9 A;  3SNN A;  3PO4 A;  1EP4 A;  2G8K A;  2DY4 A;  2YV0 X;  1CZ9 A;  3DRR A;  3S9H A;  1T8E A;  2A1S A;  5HRP A;  4DTU A;  3QIP A;  1S1W A;  2IAJ A;  4E7H A;  4E7I A;  1GOB A;  2VG7 A;  3KJV A;  1LV5 A;  2ZE2 A;  1R0A A;  2G8I A;  2DFF A;  4RW8 A;  3V81 A;  3AO1 A;  1BI4 A;  4ZTJ A;  3AV9 A;  2KW4 A;  4XIU A;  3U3Y A;  1KVA A;  2RKI A;  2HMI A;  4CJK A;  4FM0 A;  4E0D A;  4OLB A;  4LSL A;  4KHY A;  1Q9Y A;  2BGG A;  1MU2 A;  3OYK A;  3QNO A;  1C0M A;  2GUI A;  4CEA A;  4CF0 A;  1HYV A;  4CF1 A;  4AHS A;  3B6O A;  4B9M A;  3QLH A;  3P5J A;  2O4I A;  1C1C A;  3QET A;  1S6Q A;  3HP9 A;  3L8B A;  4AHV A;  2PYL A;  4IFY A;  1VSH A;  4FJ5 A;  2FBT A;  3K5N A;  3LP0 A;  3LAL A;  4TSX A;  2XY6 A;  4F2R A;  4DFM A;  3HO1 A;  3CG7 A;  3SPY A;  4FJ9 A;  1RBR A;  3I0S A;  3IS9 A;  4CEC A;  1REV A;  3BDP A;  4KI6 A;  4CJF A;  1C6V A;  5C24 A;  5J2N A;  3AVM A;  1JXE A;  4DLG A;  3L2Q A;  1FKP A;  2IOC A;  2XY7 A;  3CFO A;  1EKE A;  2KZM A;  3LPT A;  3NHG A;  4AHT A;  3L2U A;  2G8F A;  4DSK A;  2F8T A;  2IS3 A;  3DOK A;  2EHG A;  5C42 A;  3EY1 A;  3DI6 A;  1HJR A;  1B92 A;  2ZQB A;  3HPO A;  3MXJ A;  4OLA A;  2G8W A;  3G10 A;  4FJX A;  4E7J A;  4KI4 A;  4I2P A;  4CHZ A;  4Z4C A;  1BIU A;  3QEW A;  4W5Q A;  4RW9 A;  3NAE A;  1WLJ A;  3MED A;  5HRR A;  4IBN A;  2X6S A;  4ID1 A;  3ULD A;  4DF8 A;  4DU3 A;  4EZ9 A;  2DFE A;  4CGG A;  3K2P A;  4M3T A;  2I5J A;  3AA3 A;  3DLR A;  3V1O A;  3VQB A;  3WNG A;  3HT3 A;  4DQS A;  3G0Z A;  1TK5 A;  5CY4 A;  4BDZ A;  3SJJ A;  2HHQ A;  2FBY A;  3WNH A;  1LWF A;  3NH1 A;  1RTI A;  3OYJ A;  4FK4 A;  5FRO A;  4DF4 A;  4M45 A;  1NK0 A;  3CFR A;  3L3V A;  5J2P A;  4CJ3 A;  5C25 A;  1Q8I A;  4IG0 A;  2OPS A;  4EP4 A;  4IG3 A;  3KK1 A;  2W42 A;  3AO3 A;  3QEV A;  1VSF A;  3A2F A;  4H8K A;  5J2M A;  2DTU A;  1RBT A;  2KQ2 A;  2YKN A;  3VQ5 A;  4DTS A;  4Z4G A;  3AO2 A;  5EU7 A;  1IKY A;  1KCF A;  3NGI A;  1X1P A;  3PX0 A;  2Z1I A;  3VQ6 A;  1NK5 A;  1B9D A;  1RT7 A;  3DLG A;  4J2B A;  4CF8 A;  4M3W A;  2VG5 A;  2D0A A;  3OS0 A;  4KHW A;  4CK1 A;  4KRF A;  1N6Q A;  4YFU A;  1S1T A;  3UIQ A;  1S1V A;  2E6L A;  1BQM A;  4K8X A;  4CIE A;  3QER A;  3VQE A;  4RW7 A;  1WN7 A;  1HQE A;  2YNI A;  4CHN A;  4OKJ A;  3ZSO A;  4N47 A;  4E7L A;  4KHN A;  4BDP A;  2O4G A;  4CFD A;  4LY7 A;  1KSP A;  5KRT A;  4B08 A;  1L3S A;  3OYM A;  4KAZ A;  1LW2 A;  5T7B A;  4C8O A;  1Y97 A;  3O3F A;  3KLE A;  4B9N A;  4C8L A;  3OJS A;  3RRH A;  1WAJ A;  2XY8 A;  4ID5 A;  4NCB A;  3SYZ A;  3AA5 X;  1IH7 A;  1NOZ A;  4AHR A;  1WAF A;  2B5J A;  3NH2 A;  1T03 A;  3OS1 A;  3V9X A;  1RCH A;  4M3R A;  3LP1 A;  2P5G A;  4FJM A;  1U04 A;  5HP1 A;  1JLQ A;  3O4N A;  3EYZ A;  4OKK A;  4FJJ A;  1Q9X A;  4MFB A;  3VQP A;  3ZT0 A;  4DMN A;  3SQ1 A;  3OYH A;  1SUQ A;  3QO9 A;  4DG1 A;  3TAF A;  4J2E A;  1KLM A;  3L2W A;  4Z4H A;  4FLY A;  2A1R A;  1JLA A;  3AVK A;  3THV A;  3V1Q A;  4DU1 A;  1D9D A;  3D45 A;  1UOC A;  2QKB A;  1TKX A;  3OYI A;  1SV5 A;  4HVJ A;  4DQI A;  2HHT A;  1A5X A;  3AVB A;  3CM6 A;  3NBP A;  3KKR A;  4H4M A;  5HBM A;  3L2R A;  3RMB A;  4AH9 A;  1HYS A;  3LZI A;  1JKH A;  4O0J A;  3CM5 A;  1X9M A;  4Q0B A;  3SV3 A;  4E19 A;  3LAN A;  2BAN A;  3QES A;  4B8A B;  4B9V A;  3O3H A;  2X74 A;  3IAY A;  1VRU A;  4DWI A;  4DTP A;  4FW1 A;  5K14 A;  1LAV A;  3HST B;  4H4O A;  4F8R A;  3O4Q A;  3I8D A;  4DTO A;  3U3G A;  4PUO A;  2JGU A;  4GW6 A;  4CGD A;  4FCY A;  3SUN A;  5HRS A;  1JXB A;  3V9U A;  4CEO A;  1C1A A;  5KI6 A;  4DFK A;  4B9L A;  2WON A;  2IC3 A;  3RRG A;  4CEF A;  2D0B A;  3SQ2 A;  1BGX T;  1S6P A;  3BGR A;  4Y1C A;  4Z0U A;  4QAG A;  4FJ8 A;  1UA1 A;  4CED A;  1HYZ A;  3AA2 A;  3RWU A;  1NJX A;  4M3X A;  2RF2 A;  4CGF A;  4CIF A;  1JLF A;  4Q5V A;  3KTQ A;  2OZM A;  4FJ7 A;  3DLE A;  4CJU A;  4FK0 A;  1QS4 A;  1RBV A;  3NDK A;  2XHB A;  2F96 A;  4PQU A;  3K5O A;  3KLH A;  1VSI A;  4BAC A;  3HPG A;  3T19 A;  3HP6 A;  2YKM A;  1U4B A;  4AHC A;  1NK7 A;  3F73 A;  1IKV A;  2KFZ A;  3OYG A;  1W0H A;  1RT4 A;  2NUB A;  4O44 A;  5KTQ A;  4WE1 A;  4JRP A;  4LSN A;  1RBS A;  4M3U A;  1SL0 A;  4PA1 A;  3VQC A;  2HNY A;  4CHY A;  5HRN A;  3LP2 A;  1RTD A;  4MQ3 A;  4Z4E A;  2HHW A;  1QSS A;  2Q3S A;  3DLK A;  1ZBF A;  1C0T A;  3M8P A;  4KHQ A;  4I9L A;  3CQ8 A;  3E01 A;  1TKD A;  1A5V A;  3M8R A;  4CGI A;  4E1N A;  4CJV A;  3OY9 A;  4E89 A;  4FW2 A;  1WSF A;  2RN2 A;  1JLC A;  3C6T A;  2HVI A;  3HYF A;  3ZT1 A;  4ELV A;  4CJS A;  3OYE A;  2WOM A;  3RR7 A;  4FZX C;  1SKW A;  1TKZ A;  4FZY A;  2HHS A;  4DQR A;  2OYQ A;  2YNF A;  4CES A;  3AVA A;  1UAX A;  1JLG A;  3ZSV A;  1TL1 A;  1VSD A;  1TK8 A;  4HCC A;  2KFN A;  3AVG A;  4KO0 A;  4FJL A;  3DRS A;  2FC0 A;  4HHT A;  3S3M A;  1JL2 A;  1RT3 A;  1NK9 A;  3DLB A;  4N56 A;  3NH0 A;  4LD0 A;  3SPZ A;  4F4K A;  1VSM A;  4E7K A;  1RT1 A;  2D0C A;  3M8Q A;  3ZSX A;  1RT6 A;  3V9S A;  2LSN A;  4DFJ A;  3MXI A;  1BI4 B;  1U49 A;  1LAW A;  4I2Q A;  2Y1I A;  1G15 A;  4CFB A;  3ZSW A;  3JYT A;  1VSJ A;  3FFI A;  3AVH A;  4C8M A;  3L2V A;  5SWM A;  2AJQ A;  2YHA A;  4CF9 A;  1ITG A;  1TAU A;  1QHT A;  1L5U A;  4CEZ A;  5FRM A;  4KV8 A;  4L8R B;  4W5T A;  2HB5 A;  4OJR A;  1N5Y A;  1RBU A;  1RDB A;  4JRQ A;  4QOZ B;  4ELT A;  2XY5 A;  2HHU A;  4FJH A;  1ASW A;  4CHQ A;  1I39 A;  4M41 A;  3HVR A;  2GV9 A;  2Z1H A;  3RR8 A;  3KIO A;  4YNQ A;  3TAN A;  1SL2 A;  1KRP A;  5D3G A;  1RIL A;  4NCG A;  4M3Y A;  2G8U A;  1DLO A;  1CXU A;  4FLX A;  1U45 A;  1ZBI A;  4KHU A;  3C94 A;  1D8Y A;  5E41 A;  1O1W A;  1W9H A;  2R7Y A;  1WSJ A;  1QSL A;  2EX3 A;  2FBV A;  1KFS A;  1Z26 A;  4ELU A;  1TV6 A;  1J9A A;  4OGE A;  3LWM A;  4B3O A;  4CEB A;  4CJ5 A;  1T05 A;  4O55 A;  1RDA A;  3OYC A;  2ITG A;  4Y1D A;  3AVN A;  4FJG A;  1L3V A;  3VN5 A;  2RPI A;  4RG8 A;  2YNG A;  1T7P A;  3SI6 A;  3KLG A;  2F8S A;  3KLF A;  5KGX A;  2HND A;  3ASM A;  3LZJ A;  4B9U A;  3HVT A;  5SZT A;  3KD1 E;  3SUQ A;  4DSF A;  4O4G A;  2HHV A;  2B4J A;  4OKE A;  4IDK A;  3LAK A;  3V1R A;  3SQ0 A;  5J1E A;  4FLV A;  5I3U A;  4JS4 A;  3OYN A;  1ASV A;  4DTN A;  4OVL A;  3QEX A;  1VSE A;  4CCH A;  4KTZ A;  3TAM A;  1D5A A;  1IKX A;  1BIZ A;  3ZT4 A;  4B8C A;  4FZZ A;  1QE1 A;  3ISN C;  4CGH A;  3C95 A;  3MXM A;  1L3T A;  3OVN A;  1XI1 A;  3HK2 A;  1QSY A;  3HPH A;  4FM1 A;  3K57 A;  4DLE A;  1Z25 A;  1TGO A;  2OPQ A;  3AA4 A;  3ZSQ A;  4KTW A;  3VA0 A;  2OPR A;  3ALY A;  4HUG A;  4M42 A;  5CZ2 A;  1CLQ A;  4E1M A;  3IRX A;  4DTJ A;  2P1J A;  2QXF A;  3SCX A;  3AO5 A;  3SUP A;  4F3O A;  1S1U A;  1EXQ A;  3NF6 A;  4DTM A;  4LH4 A;  3RMD A;  3IG1 A;  3VA3 A;  2FBX A;  4DS5 A;  4FJI A;  1QQC A;  1WSE A;  1I3A A;  1JL1 A;  2XRI A;  3DM2 A;  3OYD A;  3TAB A;  2GBZ A;  1U47 A;  1TL3 A;  1RT2 A;  1BQN A;  1S1X A;  4Z4I A;  1F21 A;  2PYJ A;  4GMJ B;  1BIS A;  2BE2 A;  4Z4F A;  3M8S A;  4DTX A;  3OYA A;  5CYQ A;  4FYD A;  1XC9 A;  3VQQ A;  3VQ9 A;  1RDC A;  3QIN A;  3VQ4 A;  3DOL A;  4RW6 A;  4BE0 A;  2ETJ A;  4DSE A;  2HW3 A;  1LWE A;  3DYA A;  2X78 A;  2OA8 A;  1S9G A;  2BDP A;  4DSI A;  4CF2 A;  4AIL C;  3HL8 A;  5KRS A;  3AVC A;  4NYN A;  3EZ5 A;  1HMV A;  3VQA A;  3SUO A;  3DLH A;  1ZBU A;  4DFP A;  1U48 A;  4CEQ A;  4FM2 A;  4CJ4 A;  4CJQ A;  3V9Z A;  3OYB A;  2D5R A;  2HVH A;  4KKO A;  4C8N A;  1XWL A;  1WSI A;  2VWJ A;  3P83 D;  4F3T A;  4KB0 A;  2G8H A;  2B6A A;  4OGC A;  1VSK A;  1GOA A;  4BE1 A;  4FLZ A;  1LWC A;  5HLF A;  4DSJ A;  3NCI A;  4CJR A;  3V4I A;  2ZD1 A;  2ATQ A;  3ZSZ A;  1XHX A;  1TAQ A;  3ITH A;  3QEI A;  3DMJ A;  3TI0 A;  4B9T A;  1SL1 A;  3TAP A;  3NGZ A;  4F2S A;  3PY8 A;  3P1G A;  3LWL A;  1EET A;  4FLU A;  3OJU A;  1YT3 A;  3TAE A;  1S9E A;  1CXQ A;  1NJW A;  3WNF A;  1WNS A;  4BWJ A;  3SZ2 A;  1NOY A;  1TK0 A;  1IG9 A;  4FLT A;  4HCB A;  5DMR A;  4NCA A;  1NKC A;  4NYF A;  4EP5 A;  5J2Q A;  3TWH A;  3RMC A;  5HRO A;  3LAM A;  4O5B A;  4DS4 A;  3K58 A;  4EZ6 A;  4DTR A;  3V9W A;  3OYL A;  3NF9 A;  3ZCM A;  1BHL A;  1HPZ A;  3AVF A;  1KVB A;  4HTU A;  1HRH A;  2VWK A;  1X9W A;  1QTM A;  3HJF A;  1HNV A;  4KRE A;  3S3O A;  3MEG A;  4K8Z A;  4QCL A;  1VSL A;  1YVU A;  4W5N A;  2Y1J A;  1BCM A;  2QKK A;  4CEE A;  1RT5 A;  2JLE A;  3OYF A;  3AVJ A;  4CFA A;  1HQU A;  3ZT2 A;  4FLW A;  3QNN A;  3MEC A;  1TKT A;  4CJE A;  3V6D A;  3TAG A;  1XHZ A;  1ZYQ A;  4W5R A;  3K5L A;  2IDO A;  3TAR A;  3NGY A;  5FDL A;  1WSG A;  4BWM A;  3NF8 A;  1UA0 A;  3VQ7 A;  1EX4 A;  1JLE A;  5JS2 A;  3VQD A;  3ZSR A;  3D0P A;  3PX4 A;  2HNZ A;  1K6Y A;  4E3S A;  3QEP A;  4N76 A;  3TR8 A;  1RDD A;  3LPU A;  2YHB A;  4I9Q A;  4KPY A;  3T1A A;  3MAQ A;  1IO2 A;  3ZT3 A;  3PUF A;  3AVI A;  3SQ4 A;  2PY5 A;  4B9S A;  2PZS A;  4KB1 A;  2VG6 A;  3NE6 A;  2E4L A;  4DQQ A;  1YTA A;  3HXM A;  4KHS A;  4FK2 A;  1S5J A;  1KVC A;  4CJP A;  3CFP A;  4R5P A;  1NKE A;  4AHU A;  1KLN A;  1B9F A;  4CFC A;  4FVM A;  4JS5 A;  1HNI A;  4M3Z A;  5FRN A;  1ZBL A;  4IKF A;  3RTV A;  1IKW A;  3NFA A;  2X6N A;  4UQG A;  4DQP A;  1NJY A;  5CYM A;  1KFD A;  1J54 A;  1WSH A;  2Z1J A;  3DRP A;  4J2D A;  5I42 A;  1ASU A;  3OS2 A;  3JSM A;  3PO5 A;  3F9K A;  1RTJ A;  4CK3 A;  4FJK A;  4GVM A;  3QIO A;  4CJL A;  3U6F A;  4PY5 A;  2DFH A;  3KK3 A;  3LDS A;  1FXX A;  3AO4 A;  1BL3 A;  1VK0 A;  1FK9 A;  3LP3 A;  3T3F A;  4CER A;  1L3U A;  2KTQ A;  1NK8 A;  4IFV A;  3K59 A;  2YNH A;  3S3N A;  3TAQ A;  3KKS A;  1JLB A;  4OPK A;  4ICL A;  1SKR A;  3L3U A;  4CJT A;  3RMA A;  4CGJ A;  4ZTF A;  1RNH A;  4DSL A;  4LH5 A;  3PX6 A;  2G8V A;  4BDY A;  1KTQ A;  3PV8 A;  1A5W A;  1VRT A;  2Z1G A;  4C8K A;  4KTQ A;  1SKS A;  1J5O A;  2E6M A;  1ZBH A;  4CIG A;  1X9S A;  1UWB A;  3B6P A;  4G1Q A;  1GOC A;  3KK2 A;  1C1B A;  3HM9 A;  1FKO A;  3AVL A;  4CJW A;  3I0R A;  2QK9 A;  4BE2 A;  5KGW A;  4N41 A;  1DTT A;  4FJN A;  1LW0 A;  1BCO A;  5DK5 A;  3MEE A;  4RW4 A;  4DU4 A; 
#chains in the Genus database with same CATH topology
 4CHO A;  4BRN A;  5JS1 A;  2A5X A;  1BA0 A;  3MN9 A;  2IVO A;  4KFB A;  4PWD A;  4JLH A;  4IOC L;  4FXD A;  2NRR A;  1VHX A;  2Q0R A;  4WFN L;  3MX2 A;  3CHW A;  4J2A A;  4KH4 A;  5FPE A;  2VYP A;  1YTU A;  2V7Y A;  4I7F A;  3U9Z A;  3I56 N;  3CYM A;  3G25 A;  2UYT A;  1EP4 A;  1T8E A;  5HRP A;  2ASO A;  4YOU A;  4DTU A;  3QIP A;  2E2O A;  2IAJ A;  4E7H A;  1GOB A;  3VF4 A;  3VES A;  3VER A;  2DFF A;  3AO1 A;  4BR5 A;  4L3Q A;  4OLB A;  4BR7 A;  1C0M A;  2GUI A;  4CF1 A;  2OTJ N;  1C0G A;  4R79 A;  3ATU A;  3QLH A;  5AZJ A;  3CJC A;  1S6Q A;  3P38 A;  1V4S A;  2A6A A;  3K5N A;  4F2R A;  2XY6 A;  2D4W A;  3D2E B;  3GE1 A;  3DJC A;  2FSJ A;  3IS9 A;  1VQ8 N;  3BDP A;  4KI6 A;  1C6V A;  1JXE A;  4AHT A;  1BDG A;  2F8T A;  2IS3 A;  3DOK A;  5C42 A;  4XH5 A;  2ZQB A;  3MXJ A;  4KI4 A;  1HPM A;  1NJI O;  4CHZ A;  4Z4C A;  1BIU A;  3SLC A;  4RW9 A;  3NAE A;  1WLJ A;  4H0O A;  5HRR A;  3ULD A;  1ZBS A;  2DFE A;  1LWF A;  3M1F A;  3O9Q A;  1RTI A;  5FRO A;  1NK0 A;  3L3V A;  2YHW A;  1D4X A;  2OPS A;  2E20 A;  3LDQ A;  1Q82 O;  4O8K A;  3A2F A;  1OKJ A;  2KQ2 A;  2YKN A;  3VQ5 A;  4DTS A;  3FE1 A;  1Q18 A;  4IOA L;  1NK5 A;  3DLG A;  4M3W A;  4KHW A;  4KRF A;  3A5M C;  1S1T A;  3UIQ A;  5HL7 L;  1HQE A;  3LM9 A;  4CI6 A;  3ZSO A;  4BDP A;  3VEN A;  4C8L A;  4WQ4 A;  3RRH A;  1ATR A;  4BGB A;  1MWK A;  4ID5 A;  3SYZ A;  4HWI A;  3AA5 X;  3NH2 A;  2B5J A;  3QBW A;  1QQN A;  3V9X A;  4BRP A;  4RCH A;  4GNI A;  1KLM A;  4I6M A;  3ZEU A;  4IEE A;  4Z4H A;  4FLY A;  3THV A;  4AM6 A;  2QKB A;  3I33 A;  1U2V B;  4O0J A;  1X9M A;  2O8D A;  4ILG B;  5AQP A;  3ZX0 A;  3O08 A;  4FPA A;  4JKD A;  2X74 A;  1VRU A;  3ENH A;  1MWM A;  2O8C B;  5HRS A;  1C1A A;  1NLV A;  3RRG A;  4BRD A;  1WBD A;  5BPN A;  4BQZ A;  4Y1C A;  3H45 C;  3MMV A;  4EIA A;  3AA2 A;  1HKC A;  1YVN A;  3FZM A;  2RF2 A;  1EO1 A;  4FJ7 A;  1QS4 A;  3WXI A;  1NK7 A;  3HP6 A;  3M3Z A;  4H0Y B;  4GV6 A;  5KTQ A;  4LSN A;  4M3U A;  4JD2 A;  3VQC A;  4CHY A;  4YOV A;  2HHW A;  3DXM B;  3M8P A;  4CBU A;  1OVY A;  1VQP N;  4KHQ A;  4WQ5 A;  1TKD A;  4FWK A;  4CJV A;  4BR4 A;  1MDU B;  1WSF A;  3T1Y K;  1YF5 L;  1E4F T;  5GAD P;  2WOM A;  3RR7 A;  4DQR A;  2AA4 A;  2YNF A;  4B3M K;  1QHA A;  1JLG A;  2KFN A;  1NGJ A;  3AVG A;  4KO0 A;  5F2R A;  4FJL A;  2FC0 A;  1NK9 A;  3DLB A;  4LD0 A;  2JWL A;  4E7K A;  3MWP A;  3M8Q A;  2LSN A;  4I2Q A;  2Y1I A;  3CPE A;  1X3N A;  4MO4 A;  3L2V A;  5BRF A;  5SWM A;  5FRM A;  4W5T A;  4OJR A;  3SBG A;  4ELT A;  2CGJ A;  1NGH A;  4CHQ A;  2IIR A;  5LMN K;  2Z1H A;  5ELZ A;  1KRP A;  5D3G A;  1U45 A;  4BVP A;  3CC7 N;  4KHU A;  2HOE A;  4CBX A;  2E2Q A;  5EOY A;  4BRM A;  1QQM A;  3UB5 A;  4CEB A;  1T05 A;  4O55 A;  3OYC A;  1WUA A;  4NLC A;  4RG8 A;  3SI6 A;  3KLG A;  4JHD B;  4BC4 A;  2VGM A;  4X64 K;  1W2B M;  2HBM A;  4O4G A;  4OKE A;  4IDK A;  3D7E O;  5J1E A;  4JS4 A;  3OYN A;  2O8B A;  3QEX A;  1VSE A;  1S22 A;  3JXU A;  4FZZ A;  3MXM A;  5AQS A;  1VQK N;  4H0T B;  3ZSQ A;  2Q97 A;  2OPR A;  4HUG A;  4M42 A;  5CZ2 A;  1QZ5 A;  2BUP A;  4F3O A;  1S1U A;  3O9R A;  3FGU A;  3VA3 A;  2FBX A;  3W0L A;  3THY A;  1WSE A;  1JL1 A;  1U6Z A;  2XRI A;  2ZGY A;  3DM2 A;  3TAB A;  1U47 A;  1TL3 A;  1RT2 A;  5FPD A;  3FZL A;  1EQY A;  4H5W A;  1DKG D;  3R1X A;  3QFU A;  3VQQ A;  2P9N B;  3L0Q A;  2HW3 A;  4DSI A;  4AIL C;  3DLL L;  3PLA A;  3EZ5 A;  3VQA A;  2OTL N;  3D2F B;  4FM2 A;  4QS7 A;  1W97 L;  2GEM A;  4KKO A;  1XWL A;  4KB0 A;  4K41 A;  3ID6 A;  4BE1 A;  4JKA A;  2GUP A;  4DSJ A;  3O9S A;  2ATQ A;  1DGK N;  3CCS N;  1SL1 A;  3OJU A;  1T6C A;  1NJW A;  1WNS A;  1NOY A;  4NCA A;  4U67 L;  2VCP A;  1K8K A;  3O1B A;  3EKS A;  4EZ6 A;  4DTR A;  3GL1 A;  4CD1 A;  3KZB A;  3NF9 A;  3ZCM A;  1SS6 A;  1S3X A;  4F9O A;  5JLH A;  3C6H A;  2VWK A;  3BZK A;  1NU0 A;  4KRE A;  3MEG A;  4K8Z A;  2FF3 B;  3G71 N;  3T69 A;  5AQW A;  3QNN A;  3MEC A;  4LF8 K;  4RWT A;  1HNZ K;  5FLX O;  4JK7 A;  3K5L A;  3TAR A;  1YUW A;  1WSG A;  3NF8 A;  1YIJ N;  2HNZ A;  3FZH A;  5GAE P;  2ITM A;  3TR8 A;  4KPY A;  3PUF A;  4KB1 A;  4MDB A;  2VG6 A;  4DV0 K;  1YTA A;  1OH8 A;  4FK2 A;  4CJP A;  1KVC A;  4DB3 A;  3MCP A;  4LFC K;  4AHU A;  1NGA A;  1B9F A;  5AQV A;  4B3T K;  4JKG B;  3RTV A;  1IKW A;  3NFA A;  4DQP A;  4UQG A;  1J54 A;  2Z1J A;  5AQY A;  3OS2 A;  3PO5 A;  2QA4 N;  1RTJ A;  4CJL A;  5AQO A;  2Q0U A;  3KK3 A;  3NVK A;  1N32 K;  3T3F A;  4CER A;  3K9J A;  5M1O A;  1HKG A;  1NGI A;  1WBB A;  1JLB A;  2UXD K;  4ICL A;  3U4L A;  5DM6 L;  1X3M A;  3PX6 A;  2G8V A;  3KHY A;  4JKE A;  1Q7Y O;  4CIG A;  1SAZ A;  3KK2 A;  4G1Q A;  1GOC A;  1C1B A;  3HM9 A;  3AVL A;  3CCM N;  4N41 A;  3CJ7 A;  3ULE B;  1LW0 A;  1BCO A;  3MEE A;  4RW4 A;  4DU4 A;  4BR9 A;  4YDU C;  3OA9 A;  3O3G A;  4PL7 A;  4G9Z A;  4Z94 A;  2QWO A;  1XNQ K;  2ZJQ L;  4CHP A;  5M1K A;  2O8F B;  4OPJ A;  4HUF A;  3NF7 A;  4W5O A;  1J53 A;  4FWL A;  2OPP A;  1NKB A;  3K5M A;  1M1K O;  2XO7 A;  4FSV A;  1NGD A;  4HUE A;  4CE9 A;  3SNN A;  3PO4 A;  2G8K A;  3DRR A;  2UUA K;  1YJW N;  3RSE B;  5M1Q A;  3KJV A;  3O80 A;  2F9T A;  3BZC A;  4J8F A;  3MK6 A;  3OW2 M;  2G8I A;  2ZM6 K;  2FLO A;  2RKI A;  4FM0 A;  4JI0 K;  2WTU A;  4LSL A;  4KHY A;  4PKH A;  3VEW A;  1ZC6 A;  3OYK A;  4CEA A;  1Y64 A;  3QNO A;  1ILY A;  3QBX A;  4CF0 A;  3B6O A;  2O4I A;  3CJ1 A;  1C1C A;  2D0O A;  3QET A;  1SQK A;  4AHV A;  4IFY A;  4FJ5 A;  2FBT A;  2GEL A;  4DFM A;  3VOV A;  3CG7 A;  3I0S A;  2FSN A;  1BU6 O;  4CJF A;  2XY7 A;  3L2Q A;  3CFO A;  1EKE A;  4CZG A;  3UKU A;  3N4Q A;  3EY1 A;  2EHG A;  5AZI A;  4DR4 K;  4MDA A;  2NRH A;  4DKW A;  4IBN A;  2Q31 A;  3DLR A;  3V1O A;  3WNG A;  3HT3 A;  3LM2 A;  5CY4 A;  4HTL A;  4BDZ A;  1HJO A;  3OYJ A;  4FK4 A;  1NM1 A;  4M45 A;  2RE2 A;  2P9U B;  1N34 K;  3AY9 A;  4AF1 A;  3KK1 A;  2W42 A;  3AO3 A;  4H8K A;  3A5L C;  3NGI A;  1RT7 A;  4J2B A;  2QI2 A;  2VG5 A;  3D6R A;  2F9W A;  3OS0 A;  3MCA B;  1OH7 A;  4DUY K;  4LF5 K;  1NMN A;  3AAR A;  2HHH K;  2E6L A;  4ISG A;  4K8X A;  4CIE A;  3IUC A;  5LJV A;  4RW7 A;  3THX A;  4OKJ A;  4E7L A;  3JS6 A;  2O4G A;  3TTC A;  4LY7 A;  4KAZ A;  4XEI A;  1FJG K;  1HR0 K;  5T7B A;  4C8O A;  1Y97 A;  2Q1N A;  5GIO A;  3U9D A;  3CI5 A;  4CZL A;  2WBN A;  4AHR A;  1WAF A;  5AQX A;  3OS1 A;  2P9S A;  1RCH A;  4M3R A;  2P5G A;  1U04 A;  4DR5 K;  5HP1 A;  2P9P A;  3O4N A;  3CMA N;  1IV0 A;  4MFB A;  3VQP A;  3ZT0 A;  3SQ1 A;  1SUQ A;  5EVZ A;  4DG1 A;  3WUH A;  1D9D A;  3O1W A;  3D45 A;  1TKX A;  3OYI A;  4WFA L;  2GX9 A;  1XQS C;  2HHT A;  3AVB A;  5HBM A;  2HST A;  1HYS A;  2VQE K;  3LZI A;  3CM5 A;  2HMP A;  4E19 A;  4UY8 O;  1YI2 N;  4PHT X;  4B8A B;  4B9V A;  3O3H A;  3IAY A;  4FW1 A;  5K14 A;  3HST B;  4H4O A;  3U3G A;  5BR8 K;  4H0X B;  3PSF A;  5AQT A;  3V9U A;  4CEO A;  1WOQ A;  2WON A;  2D0B A;  4FWQ A;  1GLD G;  4M7X A;  4NXN K;  4K42 A;  4CED A;  5BRE A;  1HYZ A;  4A5A A;  1BWF O;  1JLF A;  4Q5V A;  3KTQ A;  4PKG A;  4FK0 A;  3K9K A;  3NDK A;  2P9I B;  3K5O A;  3KLH A;  1VSI A;  4JN4 A;  2YKM A;  3GDQ A;  3EE9 A;  1W0H A;  3EN9 A;  5CE3 A;  4WE1 A;  4YHH K;  4PA1 A;  1XMO K;  1YJ9 N;  1RTD A;  5KQ8 A;  4MQ3 A;  4IJA A;  1ZBF A;  1C0T A;  5E84 A;  2QEX N;  3O6W A;  3E01 A;  3M8R A;  4CGI A;  4H0V B;  1VAZ A;  1GLL O;  3ZT1 A;  5C2F A;  3OYE A;  3H1V X;  4FZX C;  2GWK A;  4YDU A;  2HHS A;  2NRW A;  2OYQ A;  3TPQ A;  3ZSV A;  1VSD A;  4HCC A;  4B3R K;  3DRS A;  5C12 A;  1IBL K;  4B1U B;  1VQ6 N;  1RT1 A;  2D0C A;  3MXI A;  1U49 A;  1HNW K;  3ZSW A;  3JYT A;  4CZE A;  3AVH A;  4C8M A;  2YHA A;  1QHT A;  1DT9 A;  5AZJ B;  1EWQ A;  1RDB A;  3BP8 A;  4JRQ A;  4QOZ B;  2HHU A;  3O9T A;  5C2D A;  3KK7 A;  3TSU A;  5KQD A;  2YI1 A;  5GAH P;  2W6K A;  3EZW A;  4DR2 K;  1SL2 A;  3VF2 A;  5MLC Q;  2G8U A;  1DLO A;  1ZBI A;  1YJN N;  5M1N A;  4ISF A;  1WSJ A;  3G4S N;  2FBV A;  3PIO L;  1KFS A;  1Z26 A;  1TV6 A;  1J9A A;  4OGE A;  3CF5 L;  1RDA A;  4X62 K;  5A2Q O;  4FJG A;  3AVN A;  1K9M O;  3VN5 A;  1T7P A;  2F8S A;  1YXQ A;  3KLF A;  3ASM A;  2QXL A;  3HVT A;  5AQH A;  3KD1 E;  4DR1 K;  4FWR A;  5I3U A;  2O8E A;  4DHY A;  4IWV A;  4CCH A;  4B8C A;  3ZT4 A;  1QE1 A;  1XI1 A;  1EWR A;  3HPH A;  2NRT A;  4CBW A;  1P8Z A;  1NGE A;  5KPZ A;  3AA4 A;  2QTD A;  2PBD A;  4DV4 K;  4E1M A;  3IRX A;  4BR0 A;  2P1J A;  4GV3 A;  2QXF A;  3ENB A;  4DTM A;  4LH4 A;  3O5B A;  3J7Y P;  1KQS M;  1I3A A;  2GBZ A;  3PSI A;  1BQN A;  1S1X A;  4IFE A;  4KBO A;  1BIS A;  3M8S A;  4FWP A;  4BE0 A;  3J81 O;  2P9K A;  1LWE A;  1Q81 O;  4CF2 A;  3HL8 A;  3DLH A;  1JJ2 M;  4I6M B;  3VTI A;  3ZEU B;  4CEQ A;  4CJQ A;  3OYB A;  5AQL A;  2HVH A;  2OCE A;  1WSI A;  3C6A A;  5JMV A;  1JCF A;  2O8D B;  2ZD1 A;  1XHX A;  1TAQ A;  3ITH A;  3QEI A;  3AAQ A;  3TAP A;  2HBJ A;  3KVG A;  5AFU A;  2D1K A;  1P90 A;  4A61 A;  1TK0 A;  4AM7 A;  4A2B A;  4O8U A;  5DMR A;  3HOT A;  1NKC A;  1WB9 A;  3H3N O;  4NYF A;  2E1Y A;  4EP5 A;  3I8B A;  1T6D A;  2IVN A;  4JKH A;  5EY4 A;  3EE8 A;  4DR6 K;  3GOI A;  3UE5 A;  1HPZ A;  1X9W A;  1QTM A;  4JYA K;  4WCE L;  4QCL A;  4B1Y B;  4W5N A;  2Y1J A;  1BCM A;  2YHX A;  3OYF A;  2V52 B;  4CFA A;  3TAG A;  1TKT A;  1ZYQ A;  2IDO A;  3KWI A;  3NGY A;  2QW9 A;  4JD2 B;  5M1F A;  3EL2 A;  1EX4 A;  1K6Y A;  4E3S A;  1VQ4 N;  5GIP A;  1IO2 A;  4FWO A;  4H0P A;  3TSP A;  3SQ4 A;  2PY5 A;  4B9S A;  3A0I X;  3CFP A;  4R5P A;  5HOO A;  4FWN A;  4FVM A;  3MX5 A;  4JS5 A;  1HNI A;  4M3Z A;  5FRN A;  1ZBL A;  1NJY A;  1KFD A;  1TYQ A;  5AQZ A;  3FZF A;  4JI8 K;  5I42 A;  1ASU A;  3JSM A;  4B3S K;  3U6F A;  2FSK A;  4PY5 A;  4M63 C;  2ZJR L;  3LP3 A;  3CCE N;  1L3U A;  4JAX A;  3N4P A;  1NK8 A;  4IFV A;  2KTQ A;  3QDK A;  1Z05 A;  3H46 O;  4DSL A;  1KTQ A;  1A5W A;  4A59 A;  4C8K A;  1ZBH A;  4WF9 L;  1X9S A;  4FOE A;  2BTF A;  5I9E B;  3VF6 A;  3CET A;  4CJW A;  2QK9 A;  4MO5 A;  5KGW A;  4IO8 A;  3C0B A;  3LP1 A;  4QS9 A;  1RDU A;  1EXQ A;  5DK5 A;  4FJN A;  2HHX A;  4O0I A;  2IGI A;  4NXM K;  1NK6 A;  1C0U A;  1J5E K;  3WNE A;  4IOX A;  5C15 A;  1OH5 A;  2OZS A;  3KLI A;  5AFU H;  2F4V K;  1HUX A;  3ZSY A;  5CZ1 A;  3RVC A;  3C6U A;  1LCU A;  1DTQ A;  2P9L A;  2DY4 A;  4B9Q A;  4WYB A;  3GG4 A;  3S9H A;  3HBT A;  3O8M A;  4FOI A;  3ZET A;  3H1Q A;  4E7I A;  2VG7 A;  1Z6R A;  5B8H A;  2ZE2 A;  3LL3 A;  4BRL A;  1R0A A;  4RW8 A;  3V81 A;  1BI4 A;  4XIU A;  2KW4 A;  3U3Y A;  2HMI A;  4CJK A;  3THY B;  4E0D A;  1Q9Y A;  1HYV A;  1NMD A;  3P5J A;  4BRK A;  4DCH A;  3SMP A;  1CZA N;  2PYL A;  3UKR A;  1VSH A;  2QWQ A;  3LAL A;  4B1X B;  5EX5 A;  3HO1 A;  3SPY A;  4BR2 A;  1RBR A;  1KC8 O;  1REV A;  2V7Z A;  5J2N A;  3U8X A;  5E26 A;  4DLG A;  3VET A;  2IOC A;  4YOX A;  3NHG A;  2PFU A;  4DSK A;  3DI6 A;  1B92 A;  3BF1 A;  3SAG A;  2G8W A;  3G10 A;  4FJX A;  4E7J A;  2CGL A;  3QEW A;  3QML A;  2X6S A;  4ID1 A;  3VEO A;  4DF8 A;  4DU3 A;  4EZ9 A;  2NLX A;  4CGG A;  2I5J A;  2HHQ A;  3WNH A;  3DWL A;  4JI7 K;  4DF4 A;  3CQY A;  3CFR A;  5C25 A;  4IG0 A;  1GLE G;  4EP4 A;  4IG3 A;  3QEV A;  1TUY A;  5J2M A;  1K8K B;  2IVP A;  1RBT A;  4IJN A;  4BRI A;  2DTU A;  5JVH L;  4Z4G A;  4JNE A;  1IKY A;  1X1P A;  3PX0 A;  3VQ6 A;  4CF8 A;  4WFB L;  3CPW M;  2D0A A;  1OH6 A;  4CK1 A;  5BR9 A;  4K0K K;  1N6Q A;  4YFU A;  4B1V A;  3LDL A;  3VQE A;  2W41 A;  5AQF A;  1WN7 A;  4CHN A;  2RHK A;  2KLA A;  3ULE A;  1KSP A;  4B08 A;  3OYM A;  1LW2 A;  2VWB A;  1NGC A;  3KLE A;  4B9N A;  2WFB A;  4FWS A;  2XY8 A;  2NZT A;  3ENO A;  1N33 K;  4NCB A;  4IZ9 A;  3HZ6 A;  1NOZ A;  4FL9 A;  1T03 A;  5M1P A;  4FJM A;  4OKK A;  3EEQ A;  1R59 O;  3OYH A;  3IFR A;  5CHI A;  3FR0 A;  2A3Z A;  4EHT A;  1QZ6 A;  2HBK A;  4AQY K;  1SV5 A;  3NVM A;  4DQI A;  1A5X A;  3CM6 A;  3KKR A;  4AH9 A;  4XH1 A;  4Q0B A;  2NNW A;  3AGR A;  3LAN A;  2BAN A;  4EAH D;  4JI4 K;  1BUP A;  4F8R A;  4OX9 K;  1LAV A;  1T3V A;  3ID8 A;  3WEE A;  3MWT A;  3O4Q A;  3I8D A;  4PUO A;  4GW6 A;  3SUN A;  3B8A X;  4DV1 K;  1JXB A;  4GY2 B;  5KI6 A;  4CEF A;  5H1S Q;  1BGX T;  1S6P A;  2UXB K;  3OTO K;  3RWU A;  4CGF A;  1VQ9 N;  2JWK A;  3THW B;  2OZM A;  1GLA G;  4BRE A;  1RBV A;  4JKB A;  2XHB A;  2F96 A;  3SAH A;  1K8A O;  3E9O A;  4E1J A;  4AHC A;  3P4I A;  1IKV A;  3OYG A;  1RT4 A;  4O44 A;  4JRP A;  2WC9 A;  1RBS A;  5HRN A;  3LP2 A;  3SJH A;  3VPZ A;  2Q3S A;  1QVF M;  4I9L A;  3CQ8 A;  2ASM A;  3E9P A;  4LF6 K;  5AQK A;  4JI1 K;  4CJ7 A;  4E89 A;  4FW2 A;  4JKF A;  2VQF K;  2RN2 A;  2QWM A;  3C6T A;  3HYF A;  4OPA A;  3VTH A;  2E2N A;  3C7N A;  1SKW A;  3HOS A;  4FZY A;  1RDW X;  4BC2 A;  1BG3 A;  3AVA A;  1TK8 A;  4JEP A;  1TL1 A;  3I55 N;  2UUB K;  3S3M A;  4HHT A;  1JL2 A;  4H5V A;  4N56 A;  3NH0 A;  3SPZ A;  4F4K A;  4FO0 A;  1BOT O;  1X9J A;  1LAW A;  1XC3 A;  1ATN A;  4PKI A;  2HF4 A;  1E3M A;  1JCG A;  2AJQ A;  1JCE A;  4IDH A;  1ITG A;  1TAU A;  4ILH A;  3Q7B A;  4KV8 A;  4L8R B;  5BRH A;  2HB5 A;  3A5N C;  3HVR A;  1NWK A;  3AAP A;  3KIO A;  3TAN A;  4NCG A;  4M3Y A;  3LDN A;  3WXJ A;  3C94 A;  1D8Y A;  3T7Z A;  3DXK A;  1W9H A;  4DUZ K;  2R7Y A;  1QSL A;  1J6Z A;  2EX3 A;  4YOT A;  2ITG A;  3MN7 A;  4Y1D A;  5AQU A;  1IJJ A;  5LMU K;  2HND A;  4B9U A;  1BA1 A;  4LF7 K;  3LDP A;  4DSF A;  2B4J A;  4LFA K;  3V1R A;  3LAK A;  4YOW A;  1I94 K;  4FLV A;  4JK9 A;  3TTD A;  4LFB K;  4OVL A;  3CC4 N;  1D5A A;  1IKX A;  1BIZ A;  4DV3 K;  3WXM B;  1NBW A;  2OAN A;  3E1Y A;  1QSY A;  2VGN A;  4FM1 A;  3K57 A;  4DLE A;  2E8A A;  5JLF A;  2OPQ A;  3IDH A;  3HM8 A;  1CLQ A;  1XUP O;  1ATS A;  4H5R A;  4BY9 C;  3MN6 A;  5GAG P;  3AO5 A;  3SUP A;  3NF6 A;  4FJI A;  2P9I A;  3THX B;  4KH6 A;  4Z4I A;  2E88 A;  5ADX A;  1F21 A;  3M5R A;  3ATV A;  4H5T A;  2BE2 A;  4Z4F A;  4DTX A;  3WXK A;  3OYA A;  5CYQ A;  4FYD A;  1VQL N;  1RDC A;  3VQ4 A;  5KPR A;  1HNX K;  4LF4 K;  3DOL A;  4RW6 A;  2P9S B;  1N36 K;  3D2E A;  4B1Z A;  2ETJ A;  3DYA A;  3HI0 A;  2OA8 A;  2P9P B;  2BDP A;  3AVC A;  3C65 A;  4NO7 A;  1HMV A;  2ZF5 O;  3SUO A;  3W3D A;  1ZBU A;  2W6L A;  3MN5 A;  4CJ4 A;  4DV5 K;  4MLE A;  3G6E N;  4Y0W A;  2VWJ A;  3P83 D;  2CGK A;  2B6A A;  4BRO A;  5C10 A;  4OGC A;  1VSK A;  4JI2 K;  4FLZ A;  5HLF A;  1LWC A;  4CJR A;  3V4I A;  2QWP A;  2QM1 A;  3TI0 A;  4LC9 B;  3NGZ A;  3PY8 A;  3P1G A;  1YT3 A;  1S9E A;  1LOT B;  1RGI A;  1CXQ A;  3F9M A;  3SZ2 A;  1IG9 A;  4FLT A;  4HCB A;  5BN9 A;  5J2Q A;  3RMC A;  5HRO A;  3LAM A;  4O5B A;  3EKU A;  3K58 A;  3V9W A;  3VMF B;  3OYL A;  3E9L A;  1DEJ A;  4PL8 A;  3R9P A;  1KAY A;  3CCQ N;  1KVB A;  4BRH A;  1HRH A;  3WXL A;  1HNV A;  2V51 B;  1YVU A;  2HBL A;  4CEE A;  4U7B A;  3ZT2 A;  4FLW A;  4CJE A;  1XHZ A;  1H1V A;  1GLF O;  5FDL A;  4BWM A;  1VQ7 N;  5JS2 A;  3PX4 A;  3QEP A;  1RDD A;  1KAZ A;  4I9Q A;  5FPM A;  4KH5 A;  3LDO A;  3ZT3 A;  3AVI A;  3VGK A;  1BO5 O;  5AJ3 K;  4ILJ A;  3HXM A;  4KHS A;  4GVE A;  3VGL A;  2ZJP L;  3SAF A;  4A2A A;  1U2V A;  4C23 A;  1N8R O;  1NG9 A;  4DR7 K;  4CK3 A;  4FJK A;  4GVM A;  2BH1 A;  3IKM A;  3TU5 A;  1FXX A;  3AO4 A;  1BL3 A;  1VK0 A;  2AP1 A;  4CZF A;  3NMU A;  2W40 A;  4CVN E;  3J80 O;  4JV5 K;  3K59 A;  2O8C A;  2YNH A;  3HRG A;  3S3N A;  3KKS A;  1NNE A;  4OPK A;  5ADX H;  1SKR A;  1G99 A;  4CJT A;  3RMA A;  4CGJ A;  4LH5 A;  3CER A;  3CCU N;  1VRT A;  3O4W A;  1SKS A;  2E6M A;  4GKK K;  1UWB A;  2NRZ A;  1MA9 B;  3B6P A;  3HTV A;  4NB4 A;  5CR4 A;  4X66 K;  3RMB A;  3R8E A;  4CZI A;  1TVR A;  1YAG A;  3H08 A;  3KD5 E;  3J7Z O;  2KZZ A;  4CK2 A;  3DXM A;  1CZB A;  3EO3 A;  2GWJ A;  2P5O A;  2ZGZ A;  1KAX A;  1NK4 A;  5AQQ A;  1RTH A;  4BQL A;  2P51 A;  3VQ8 A;  3VEY A;  3F2K A;  2O8E B;  1D9F A;  4N5S A;  3SV4 A;  4IEI A;  3E66 A;  1NJZ A;  3OHR A;  1HLU A;  4ZHR A;  2YV0 X;  1CZ9 A;  2A1S A;  4CW7 B;  3OBW A;  1Q86 O;  3J7A P;  1S1W A;  1LV5 A;  5AQN A;  4YOR A;  4ZTJ A;  3AV9 A;  1KVA A;  1IBK K;  4NLB A;  3CCJ N;  2BGG A;  1MU2 A;  4GV9 A;  4FPB A;  2KKZ A;  2YJF A;  5BPM A;  3WQU A;  3A5O C;  4AHS A;  4B9M A;  3HP9 A;  3L8B A;  4O5F A;  3LP0 A;  4TSX A;  4FJ9 A;  2P9K B;  4CEC A;  1IG8 A;  4JK8 A;  5C24 A;  3BY5 A;  4YOY A;  4DV2 K;  3AVM A;  1FKP A;  2KZM A;  3LPT A;  3L2U A;  2G8F A;  2WUS A;  1O13 A;  1HJR A;  3HPO A;  4OLA A;  4A5B A;  3JAM O;  4I2P A;  4W5Q A;  3MED A;  4JHD A;  4M3T A;  3K2P A;  3AA3 A;  3VQB A;  4DQS A;  1TK5 A;  3G0Z A;  4C1N K;  3SJJ A;  2FBY A;  2YX6 A;  3NH1 A;  4H5N A;  5AQG A;  4X65 K;  5J2P A;  4CJ3 A;  2UUC K;  1Q8I A;  3CCR N;  4IXC A;  1VSF A;  4EFH A;  1S72 N;  3QB0 A;  2NRX A;  3AO2 A;  5EU7 A;  2QWN A;  1KCF A;  2Z1I A;  1B9D A;  3TSQ A;  2E5L K;  3SBT A;  1OVQ A;  1YHQ N;  1S1V A;  1BQM A;  1GLJ O;  4DQ8 A;  3QER A;  1YIT N;  2YNI A;  5LY3 A;  1ESV A;  4KHN A;  4N47 A;  4CFD A;  2YJE A;  5KRT A;  1L3S A;  5TKW A;  3P39 A;  3O3F A;  5GIN A;  5BN8 A;  3ZX2 A;  3OJS A;  4OO1 J;  2CH6 A;  1WAJ A;  3KWG A;  4CZJ A;  3FZK A;  5JIC A;  1IH7 A;  4FVU A;  2P9N A;  1VQO N;  1T44 A;  3IMX A;  1JLQ A;  4FJJ A;  3EYZ A;  1Q9X A;  4DMN A;  4BG9 A;  4GKJ K;  3QO9 A;  3TAF A;  4J2E A;  3L2W A;  3D2F A;  2A1R A;  2H3G X;  1JLA A;  3AVK A;  2ASP A;  3V1Q A;  4DU1 A;  5C0Y A;  1UOC A;  4HVJ A;  3NBP A;  3L2R A;  4H4M A;  1JKH A;  3FFK B;  4DR3 K;  1TYQ B;  2F7T A;  3VEV A;  3QFP A;  3SV3 A;  4JKC A;  3QES A;  4B1W B;  4DWI A;  4DTP A;  4YY3 K;  1W7A A;  3QIC A;  2O8B B;  4ISE A;  4DTO A;  2JGU A;  4CGD A;  4FCY A;  5TKY A;  3VGM A;  4DFK A;  4B9L A;  4LF9 K;  2IC3 A;  3SQ2 A;  1VQ5 N;  3A8Y A;  3BGR A;  4Z0U A;  4QAG A;  4FJ8 A;  4BVO A;  1UA1 A;  5KPT A;  1NJX A;  4M3X A;  4CIF A;  5BRD A;  1K73 O;  3DLE A;  2J4R A;  4BRF A;  4CJU A;  4PQU A;  5IWA K;  4BAC A;  1U4B A;  3HPG A;  3T19 A;  2UU9 K;  3F73 A;  2KFZ A;  3K0S A;  3Q7C A;  2NUB A;  3HSC A;  3CD6 N;  2E2P A;  1SL0 A;  2HNY A;  2QWR A;  4KHP K;  4Z4E A;  3CQX A;  1QSS A;  5JVG L;  3DLK A;  2PAV A;  1KXP A;  1A5V A;  4A57 A;  4E1N A;  3OY9 A;  2HVI A;  1JLC A;  4DV7 K;  4ELV A;  4CJS A;  1TKZ A;  2P9L B;  4CES A;  2EWS A;  4IO9 L;  1UAX A;  3H6E A;  4JKG A;  3ZET B;  1RT3 A;  4BRQ A;  1VSM A;  1XNR K;  3ZSX A;  3V9S A;  1RT6 A;  4CD3 A;  4DFJ A;  1BI4 B;  5FPN A;  2ZWH A;  3MDQ A;  2NRV A;  3SMS A;  1G15 A;  4CFB A;  3OBY A;  1VSJ A;  3FFI A;  4BRG A;  5IT9 O;  4CF9 A;  5F1X A;  4CEZ A;  1L5U A;  3BUZ B;  4V19 S;  1N5Y A;  4H03 B;  1RBU A;  2XY5 A;  4FJH A;  1ASW A;  1I39 A;  3UKR B;  4M41 A;  1TUU A;  2GV9 A;  2D0P A;  3RR8 A;  4YNQ A;  1VQN N;  1RIL A;  2E1Z A;  2FXU A;  4FLX A;  1CXU A;  1M90 O;  5LL6 Z;  5E41 A;  3WQT A;  1O1W A;  1XMQ K;  4K25 A;  4ELU A;  4B3O A;  3LWM A;  1NGG A;  4M7Y A;  4CJ5 A;  1L3V A;  2RPI A;  2YNG A;  5KGX A;  2O8F A;  3LZJ A;  2YCH A;  5SZT A;  3TTF A;  3SUQ A;  1VQM N;  2HHV A;  4K43 A;  3SQ0 A;  4BRC A;  1NGB A;  1KD1 O;  1ASV A;  4DTN A;  4KTZ A;  3TAM A;  2CH5 A;  3ISN C;  4CGH A;  3C95 A;  3CJA A;  1L3T A;  3OVN A;  3ZLJ A;  3HK2 A;  4CZK A;  3RSE A;  1Z25 A;  1TGO A;  4KTW A;  4BRA A;  3J8A A;  3VA0 A;  3ALY A;  2HF3 A;  2I7P A;  3BEX A;  4DTJ A;  3SCX A;  3THW A;  5F0X A;  3RMD A;  3IG1 A;  3ZYY X;  4DS5 A;  1QQC A;  4OPH A;  3OYD A;  3PIP L;  3F5T A;  2PYJ A;  4GMJ B;  2KHO A;  3R3L A;  5LJW A;  4RTF D;  1XC9 A;  3VQ9 A;  3CXC M;  3QIN A;  3M6G A;  4BC3 A;  4DSE A;  1V4T A;  1ZXO A;  5AQJ A;  2X78 A;  1S9G A;  4CZM A;  5KRS A;  1IBM K;  4NYN A;  4DFP A;  1U48 A;  3V9Z A;  2D5R A;  2DPN A;  4JI3 K;  4C8N A;  3SK3 A;  4F3T A;  3CME N;  3CJB A;  3S41 A;  2G8H A;  1GOA A;  3NCI A;  4JI5 K;  3WT0 A;  3ZSZ A;  3AGK A;  3DMJ A;  3ZX3 A;  4DV6 K;  1GLC G;  5AR0 A;  4B9T A;  4F2S A;  3CCV N;  3LWL A;  1EET A;  4FLU A;  3TAE A;  2P9U A;  3H3O B;  3WEE B;  3WNF A;  4BWJ A;  3VEX A;  3TWH A;  4DS4 A;  4WQ4 C;  2A40 A;  1QQO A;  3FLC O;  5BPL A;  1BHL A;  3AVF A;  4HTU A;  1FW6 A;  3BF3 A;  4A62 A;  1NGF A;  4BGA A;  3L4Q A;  3HJF A;  3S3O A;  1GLB G;  1VSL A;  4EHU A;  2QKK A;  1RT5 A;  2JLE A;  3AVJ A;  4C1N I;  1HQU A;  3O9U A;  3V6D A;  4W5R A;  1RFQ A;  4CZH A;  3DAW A;  2Q2R A;  1UA0 A;  3VQ7 A;  1QVG M;  2A42 A;  3ZSR A;  1JLE A;  3VQD A;  3D0P A;  1HX1 A;  4N76 A;  3LPU A;  2YHB A;  5AQI A;  2UXC K;  3T1A A;  4BC5 A;  3MAQ A;  4XH4 A;  2PZS A;  3C7N B;  3NE6 A;  2E4L A;  4DQQ A;  3UKU B;  3CC2 N;  3R6M A;  1S5J A;  5AZI B;  1NKE A;  2GTD A;  1KLN A;  4CFC A;  4IKF A;  2X6N A;  2FF6 A;  5DM7 L;  4JI6 K;  5CYM A;  5EXW A;  1WSH A;  4J2D A;  3DRP A;  3GBT A;  4MLH A;  3F9K A;  1E4G T;  2YHY A;  3QIO A;  2DFH A;  3LDS A;  3T1H K;  1FK9 A;  4FWM A;  3CJ9 A;  2A41 A;  3P31 A;  3CIP A;  4BG8 A;  2I7N A;  3TAQ A;  3VEZ A;  3L3U A;  3CCL N;  4ZTF A;  1RNH A;  4QS8 A;  5AQR A;  2QWL A;  3L6Q A;  4BDY A;  3PV8 A;  1HKB A;  2Z1G A;  4KTQ A;  1J5O A;  4WQ5 C;  2Q36 A;  1FKO A;  3L4I A;  5AQM A;  3I0R A;  1SZ2 A;  3DXK B;  4BE2 A;  1DTT A;  1C0F A; 
#chains in the Genus database with same CATH homology
 4CHO A;  5JS1 A;  2HHX A;  3O3G A;  1TVR A;  3H08 A;  4PWD A;  4KFB A;  3KD5 E;  4O0I A;  2IGI A;  4JLH A;  2KZZ A;  1NK6 A;  4CK2 A;  4FXD A;  4CHP A;  1CZB A;  1C0U A;  4OPJ A;  3WNE A;  2P5O A;  4HUF A;  3NF7 A;  4J2A A;  4W5O A;  1NK4 A;  1RTH A;  2OZS A;  1J53 A;  2P51 A;  2OPP A;  3KLI A;  1YTU A;  3VQ8 A;  1NKB A;  3K5M A;  3ZSY A;  4I7F A;  1D9F A;  4N5S A;  3SV4 A;  5CZ1 A;  3CYM A;  2XO7 A;  3C6U A;  1NJZ A;  4HUE A;  1DTQ A;  4ZHR A;  4CE9 A;  3SNN A;  3PO4 A;  1EP4 A;  2G8K A;  2DY4 A;  2YV0 X;  1CZ9 A;  3DRR A;  3S9H A;  1T8E A;  2A1S A;  5HRP A;  4DTU A;  3QIP A;  1S1W A;  2IAJ A;  4E7H A;  4E7I A;  1GOB A;  2VG7 A;  3KJV A;  1LV5 A;  2ZE2 A;  1R0A A;  2G8I A;  2DFF A;  4RW8 A;  3V81 A;  3AO1 A;  1BI4 A;  4ZTJ A;  3AV9 A;  2KW4 A;  4XIU A;  3U3Y A;  1KVA A;  2RKI A;  2HMI A;  4CJK A;  4FM0 A;  4E0D A;  4OLB A;  4LSL A;  4KHY A;  1Q9Y A;  2BGG A;  1MU2 A;  3OYK A;  3QNO A;  1C0M A;  2GUI A;  4CEA A;  4CF0 A;  1HYV A;  4CF1 A;  4AHS A;  3B6O A;  4B9M A;  3QLH A;  3P5J A;  2O4I A;  1C1C A;  3QET A;  1S6Q A;  3HP9 A;  3L8B A;  4AHV A;  2PYL A;  4IFY A;  1VSH A;  4FJ5 A;  2FBT A;  3K5N A;  3LP0 A;  3LAL A;  4TSX A;  2XY6 A;  4F2R A;  4DFM A;  3HO1 A;  3CG7 A;  3SPY A;  4FJ9 A;  1RBR A;  3I0S A;  3IS9 A;  4CEC A;  1REV A;  3BDP A;  4KI6 A;  4CJF A;  1C6V A;  5C24 A;  5J2N A;  3AVM A;  1JXE A;  4DLG A;  3L2Q A;  1FKP A;  2IOC A;  2XY7 A;  3CFO A;  1EKE A;  2KZM A;  3LPT A;  3NHG A;  4AHT A;  3L2U A;  2G8F A;  4DSK A;  2F8T A;  2IS3 A;  3DOK A;  2EHG A;  5C42 A;  3EY1 A;  3DI6 A;  1HJR A;  1B92 A;  2ZQB A;  3HPO A;  3MXJ A;  4OLA A;  2G8W A;  3G10 A;  4FJX A;  4E7J A;  4KI4 A;  4I2P A;  4CHZ A;  4Z4C A;  1BIU A;  3QEW A;  4W5Q A;  4RW9 A;  3NAE A;  1WLJ A;  3MED A;  5HRR A;  4IBN A;  2X6S A;  4ID1 A;  3ULD A;  4DF8 A;  4DU3 A;  4EZ9 A;  2DFE A;  4CGG A;  3K2P A;  4M3T A;  2I5J A;  3AA3 A;  3DLR A;  3V1O A;  3VQB A;  3WNG A;  3HT3 A;  4DQS A;  3G0Z A;  1TK5 A;  5CY4 A;  4BDZ A;  3SJJ A;  2HHQ A;  2FBY A;  3WNH A;  1LWF A;  3NH1 A;  1RTI A;  3OYJ A;  4FK4 A;  5FRO A;  4DF4 A;  4M45 A;  1NK0 A;  3CFR A;  3L3V A;  5J2P A;  4CJ3 A;  5C25 A;  1Q8I A;  4IG0 A;  2OPS A;  4EP4 A;  4IG3 A;  3KK1 A;  2W42 A;  3AO3 A;  3QEV A;  1VSF A;  3A2F A;  4H8K A;  5J2M A;  2DTU A;  1RBT A;  2KQ2 A;  2YKN A;  3VQ5 A;  4DTS A;  4Z4G A;  3AO2 A;  5EU7 A;  1IKY A;  1KCF A;  3NGI A;  1X1P A;  3PX0 A;  2Z1I A;  3VQ6 A;  1NK5 A;  1B9D A;  1RT7 A;  3DLG A;  4J2B A;  4CF8 A;  4M3W A;  2VG5 A;  2D0A A;  3OS0 A;  4KHW A;  4CK1 A;  4KRF A;  1N6Q A;  4YFU A;  1S1T A;  3UIQ A;  1S1V A;  2E6L A;  1BQM A;  4K8X A;  4CIE A;  3QER A;  3VQE A;  4RW7 A;  1WN7 A;  1HQE A;  2YNI A;  4CHN A;  4OKJ A;  3ZSO A;  4N47 A;  4E7L A;  4KHN A;  4BDP A;  2O4G A;  4CFD A;  4LY7 A;  1KSP A;  5KRT A;  4B08 A;  1L3S A;  3OYM A;  4KAZ A;  1LW2 A;  5T7B A;  4C8O A;  1Y97 A;  3O3F A;  3KLE A;  4B9N A;  4C8L A;  3OJS A;  3RRH A;  1WAJ A;  2XY8 A;  4ID5 A;  4NCB A;  3SYZ A;  3AA5 X;  1IH7 A;  1NOZ A;  4AHR A;  1WAF A;  2B5J A;  3NH2 A;  1T03 A;  3OS1 A;  3V9X A;  1RCH A;  4M3R A;  3LP1 A;  2P5G A;  4FJM A;  1U04 A;  5HP1 A;  1JLQ A;  3O4N A;  3EYZ A;  4OKK A;  4FJJ A;  1Q9X A;  4MFB A;  3VQP A;  3ZT0 A;  4DMN A;  3SQ1 A;  3OYH A;  1SUQ A;  3QO9 A;  4DG1 A;  3TAF A;  4J2E A;  1KLM A;  3L2W A;  4Z4H A;  4FLY A;  2A1R A;  1JLA A;  3AVK A;  3THV A;  3V1Q A;  4DU1 A;  1D9D A;  3D45 A;  1UOC A;  2QKB A;  1TKX A;  3OYI A;  1SV5 A;  4HVJ A;  4DQI A;  2HHT A;  1A5X A;  3AVB A;  3CM6 A;  3NBP A;  3KKR A;  4H4M A;  5HBM A;  3L2R A;  3RMB A;  4AH9 A;  1HYS A;  3LZI A;  1JKH A;  4O0J A;  3CM5 A;  1X9M A;  4Q0B A;  3SV3 A;  4E19 A;  3LAN A;  2BAN A;  3QES A;  4B8A B;  4B9V A;  3O3H A;  2X74 A;  3IAY A;  1VRU A;  4DWI A;  4DTP A;  4FW1 A;  5K14 A;  1LAV A;  3HST B;  4H4O A;  4F8R A;  3O4Q A;  3I8D A;  4DTO A;  3U3G A;  4PUO A;  2JGU A;  4GW6 A;  4CGD A;  4FCY A;  3SUN A;  5HRS A;  1JXB A;  3V9U A;  4CEO A;  1C1A A;  5KI6 A;  4DFK A;  4B9L A;  2WON A;  2IC3 A;  3RRG A;  4CEF A;  2D0B A;  3SQ2 A;  1BGX T;  1S6P A;  3BGR A;  4Y1C A;  4Z0U A;  4QAG A;  4FJ8 A;  1UA1 A;  4CED A;  1HYZ A;  3AA2 A;  3RWU A;  1NJX A;  4M3X A;  2RF2 A;  4CGF A;  4CIF A;  1JLF A;  4Q5V A;  3KTQ A;  2OZM A;  4FJ7 A;  3DLE A;  4CJU A;  4FK0 A;  1QS4 A;  1RBV A;  3NDK A;  2XHB A;  2F96 A;  4PQU A;  3K5O A;  3KLH A;  1VSI A;  4BAC A;  3HPG A;  3T19 A;  3HP6 A;  2YKM A;  1U4B A;  4AHC A;  1NK7 A;  3F73 A;  1IKV A;  2KFZ A;  3OYG A;  1W0H A;  1RT4 A;  2NUB A;  4O44 A;  5KTQ A;  4WE1 A;  4JRP A;  4LSN A;  1RBS A;  4M3U A;  1SL0 A;  4PA1 A;  3VQC A;  2HNY A;  4CHY A;  5HRN A;  3LP2 A;  1RTD A;  4MQ3 A;  4Z4E A;  2HHW A;  1QSS A;  2Q3S A;  3DLK A;  1ZBF A;  1C0T A;  3M8P A;  4KHQ A;  4I9L A;  3CQ8 A;  3E01 A;  1TKD A;  1A5V A;  3M8R A;  4CGI A;  4E1N A;  4CJV A;  3OY9 A;  4E89 A;  4FW2 A;  1WSF A;  2RN2 A;  1JLC A;  3C6T A;  2HVI A;  3HYF A;  3ZT1 A;  4ELV A;  4CJS A;  3OYE A;  2WOM A;  3RR7 A;  4FZX C;  1SKW A;  1TKZ A;  4FZY A;  2HHS A;  4DQR A;  2OYQ A;  2YNF A;  4CES A;  3AVA A;  1UAX A;  1JLG A;  3ZSV A;  1TL1 A;  1VSD A;  1TK8 A;  4HCC A;  2KFN A;  3AVG A;  4KO0 A;  4FJL A;  3DRS A;  2FC0 A;  4HHT A;  3S3M A;  1JL2 A;  1RT3 A;  1NK9 A;  3DLB A;  4N56 A;  3NH0 A;  4LD0 A;  3SPZ A;  4F4K A;  1VSM A;  4E7K A;  1RT1 A;  2D0C A;  3M8Q A;  3ZSX A;  1RT6 A;  3V9S A;  2LSN A;  4DFJ A;  3MXI A;  1BI4 B;  1U49 A;  1LAW A;  4I2Q A;  2Y1I A;  1G15 A;  4CFB A;  3ZSW A;  3JYT A;  1VSJ A;  3FFI A;  3AVH A;  4C8M A;  3L2V A;  5SWM A;  2AJQ A;  2YHA A;  4CF9 A;  1ITG A;  1TAU A;  1QHT A;  1L5U A;  4CEZ A;  5FRM A;  4KV8 A;  4L8R B;  4W5T A;  2HB5 A;  4OJR A;  1N5Y A;  1RBU A;  1RDB A;  4JRQ A;  4QOZ B;  4ELT A;  2XY5 A;  2HHU A;  4FJH A;  1ASW A;  4CHQ A;  1I39 A;  4M41 A;  3HVR A;  2GV9 A;  2Z1H A;  3RR8 A;  3KIO A;  4YNQ A;  3TAN A;  1SL2 A;  1KRP A;  5D3G A;  1RIL A;  4NCG A;  4M3Y A;  2G8U A;  1DLO A;  1CXU A;  4FLX A;  1U45 A;  1ZBI A;  4KHU A;  3C94 A;  1D8Y A;  5E41 A;  1O1W A;  1W9H A;  2R7Y A;  1WSJ A;  1QSL A;  2EX3 A;  2FBV A;  1KFS A;  1Z26 A;  4ELU A;  1TV6 A;  1J9A A;  4OGE A;  3LWM A;  4B3O A;  4CEB A;  4CJ5 A;  1T05 A;  4O55 A;  1RDA A;  3OYC A;  2ITG A;  4Y1D A;  3AVN A;  4FJG A;  1L3V A;  3VN5 A;  2RPI A;  4RG8 A;  2YNG A;  1T7P A;  3SI6 A;  3KLG A;  2F8S A;  3KLF A;  5KGX A;  2HND A;  3ASM A;  3LZJ A;  4B9U A;  3HVT A;  5SZT A;  3KD1 E;  3SUQ A;  4DSF A;  4O4G A;  2HHV A;  2B4J A;  4OKE A;  4IDK A;  3LAK A;  3V1R A;  3SQ0 A;  5J1E A;  4FLV A;  5I3U A;  4JS4 A;  3OYN A;  1ASV A;  4DTN A;  4OVL A;  3QEX A;  1VSE A;  4CCH A;  4KTZ A;  3TAM A;  1D5A A;  1IKX A;  1BIZ A;  3ZT4 A;  4B8C A;  4FZZ A;  1QE1 A;  3ISN C;  4CGH A;  3C95 A;  3MXM A;  1L3T A;  3OVN A;  1XI1 A;  3HK2 A;  1QSY A;  3HPH A;  4FM1 A;  3K57 A;  4DLE A;  1Z25 A;  1TGO A;  2OPQ A;  3AA4 A;  3ZSQ A;  4KTW A;  3VA0 A;  2OPR A;  3ALY A;  4HUG A;  4M42 A;  5CZ2 A;  1CLQ A;  4E1M A;  3IRX A;  4DTJ A;  2P1J A;  2QXF A;  3SCX A;  3AO5 A;  3SUP A;  4F3O A;  1S1U A;  1EXQ A;  3NF6 A;  4DTM A;  4LH4 A;  3RMD A;  3IG1 A;  3VA3 A;  2FBX A;  4DS5 A;  4FJI A;  1QQC A;  1WSE A;  1I3A A;  1JL1 A;  2XRI A;  3DM2 A;  3OYD A;  3TAB A;  2GBZ A;  1U47 A;  1TL3 A;  1RT2 A;  1BQN A;  1S1X A;  4Z4I A;  1F21 A;  2PYJ A;  4GMJ B;  1BIS A;  2BE2 A;  4Z4F A;  3M8S A;  4DTX A;  3OYA A;  5CYQ A;  4FYD A;  1XC9 A;  3VQQ A;  3VQ9 A;  1RDC A;  3QIN A;  3VQ4 A;  3DOL A;  4RW6 A;  4BE0 A;  2ETJ A;  4DSE A;  2HW3 A;  1LWE A;  3DYA A;  2X78 A;  2OA8 A;  1S9G A;  2BDP A;  4DSI A;  4CF2 A;  4AIL C;  3HL8 A;  5KRS A;  3AVC A;  4NYN A;  3EZ5 A;  1HMV A;  3VQA A;  3SUO A;  3DLH A;  1ZBU A;  4DFP A;  1U48 A;  4CEQ A;  4FM2 A;  4CJ4 A;  4CJQ A;  3V9Z A;  3OYB A;  2D5R A;  2HVH A;  4KKO A;  4C8N A;  1XWL A;  1WSI A;  2VWJ A;  3P83 D;  4F3T A;  4KB0 A;  2G8H A;  2B6A A;  4OGC A;  1VSK A;  1GOA A;  4BE1 A;  4FLZ A;  1LWC A;  5HLF A;  4DSJ A;  3NCI A;  4CJR A;  3V4I A;  2ZD1 A;  2ATQ A;  3ZSZ A;  1XHX A;  1TAQ A;  3ITH A;  3QEI A;  3DMJ A;  3TI0 A;  4B9T A;  1SL1 A;  3TAP A;  3NGZ A;  4F2S A;  3PY8 A;  3P1G A;  3LWL A;  1EET A;  4FLU A;  3OJU A;  1YT3 A;  3TAE A;  1S9E A;  1CXQ A;  1NJW A;  3WNF A;  1WNS A;  4BWJ A;  3SZ2 A;  1NOY A;  1TK0 A;  1IG9 A;  4FLT A;  4HCB A;  5DMR A;  4NCA A;  1NKC A;  4NYF A;  4EP5 A;  5J2Q A;  3TWH A;  3RMC A;  5HRO A;  3LAM A;  4O5B A;  4DS4 A;  3K58 A;  4EZ6 A;  4DTR A;  3V9W A;  3OYL A;  3NF9 A;  3ZCM A;  1BHL A;  1HPZ A;  3AVF A;  1KVB A;  4HTU A;  1HRH A;  2VWK A;  1X9W A;  1QTM A;  3HJF A;  1HNV A;  4KRE A;  3S3O A;  3MEG A;  4K8Z A;  4QCL A;  1VSL A;  1YVU A;  4W5N A;  2Y1J A;  1BCM A;  2QKK A;  4CEE A;  1RT5 A;  2JLE A;  3OYF A;  3AVJ A;  4CFA A;  1HQU A;  3ZT2 A;  4FLW A;  3QNN A;  3MEC A;  1TKT A;  4CJE A;  3V6D A;  3TAG A;  1XHZ A;  1ZYQ A;  4W5R A;  3K5L A;  2IDO A;  3TAR A;  3NGY A;  5FDL A;  1WSG A;  4BWM A;  3NF8 A;  1UA0 A;  3VQ7 A;  1EX4 A;  1JLE A;  5JS2 A;  3VQD A;  3ZSR A;  3D0P A;  3PX4 A;  2HNZ A;  1K6Y A;  4E3S A;  3QEP A;  4N76 A;  3TR8 A;  1RDD A;  3LPU A;  2YHB A;  4I9Q A;  4KPY A;  3T1A A;  3MAQ A;  1IO2 A;  3ZT3 A;  3PUF A;  3AVI A;  3SQ4 A;  2PY5 A;  4B9S A;  2PZS A;  4KB1 A;  2VG6 A;  3NE6 A;  2E4L A;  4DQQ A;  1YTA A;  3HXM A;  4KHS A;  4FK2 A;  1S5J A;  1KVC A;  4CJP A;  3CFP A;  4R5P A;  1NKE A;  4AHU A;  1KLN A;  1B9F A;  4CFC A;  4FVM A;  4JS5 A;  1HNI A;  4M3Z A;  5FRN A;  1ZBL A;  4IKF A;  3RTV A;  1IKW A;  3NFA A;  2X6N A;  4UQG A;  4DQP A;  1NJY A;  5CYM A;  1KFD A;  1J54 A;  1WSH A;  2Z1J A;  3DRP A;  4J2D A;  5I42 A;  1ASU A;  3OS2 A;  3JSM A;  3PO5 A;  3F9K A;  1RTJ A;  4CK3 A;  4FJK A;  4GVM A;  3QIO A;  4CJL A;  3U6F A;  4PY5 A;  2DFH A;  3KK3 A;  3LDS A;  1FXX A;  3AO4 A;  1BL3 A;  1VK0 A;  1FK9 A;  3LP3 A;  3T3F A;  4CER A;  1L3U A;  2KTQ A;  1NK8 A;  4IFV A;  3K59 A;  2YNH A;  3S3N A;  3TAQ A;  3KKS A;  1JLB A;  4OPK A;  4ICL A;  1SKR A;  3L3U A;  4CJT A;  3RMA A;  4CGJ A;  4ZTF A;  1RNH A;  4DSL A;  4LH5 A;  3PX6 A;  2G8V A;  4BDY A;  1KTQ A;  3PV8 A;  1A5W A;  1VRT A;  2Z1G A;  4C8K A;  4KTQ A;  1SKS A;  1J5O A;  2E6M A;  1ZBH A;  4CIG A;  1X9S A;  1UWB A;  3B6P A;  4G1Q A;  1GOC A;  3KK2 A;  1C1B A;  3HM9 A;  1FKO A;  3AVL A;  4CJW A;  3I0R A;  2QK9 A;  4BE2 A;  5KGW A;  4N41 A;  1DTT A;  4FJN A;  1LW0 A;  1BCO A;  5DK5 A;  3MEE A;  4RW4 A;  4DU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...