2XRIA

Crystal structure of human eri1 exoribonuclease 3
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
207
structure length
206
Chain Sequence
NLYFQSMSFPPQRYHYFLVLDFEATCDKQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ERI1 EXORIBONUCLEASE 3
publication title Crystal Structure of Human Eri1 Exoribonuclease 3
rcsb
source organism Homo sapiens
total genus 66
structure length 206
sequence length 207
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2xriA01
4Z4GA 5FROA 3TANA 1D9FA 4FM1A 1SKSA 1C0TA 4DLEA 1S9EA 2RF2A 3NFAA 1NKBA 5KTQA 4JRQA 1JL2A 4NCGA 4FM2A 1SL1A 3TAQA 3SQ2A 3LZIA 4EP4A 3L2WA 3NHGA 2F96A 3LZJA 1J54A 1RILA 2D0CA 3DLRA 3NH2A 4N47A 4DU3A 3OJSA 4M3WA 3OY9A 3I8DA 2OPPA 1A5XA 2EHGA 2KFZA 4FJGA 3SUNA 2LSNA 3B6PA 3ZSXA 3LAMA 1GOCA 4CJRA 1ITGA 2I5JA 4CHZA 5DK5A 5J2PA 4FVMA 2X74A 3VQBA 1T7PA 1GOAA 3NF8A 2HW3A 4FCYA 3QEXA 3HO1A 3M8SA 1VSIA 3HK2A 4ICLA 4DTNA 3QERA 3I0RA 1T03A 3LP2A 4CE9A 1SKWA 1L3TA 5FRNA 4HCCA 2O4IA 4CJ3A 3PO4A 4FLXA 3AA3A 4BACA 5KGXA 4PUOA 1WN7A 4OPJA 1VSDA 1U48A 3WNHA 4CJSA 3QEPA 4Y1CA 4CJVA 1HNVA 2KW4A 5HRPA 4IBNA 1B9FA 4CEFA 4KKOA 3MEDA 3K59A 4C8KA 4B9VA 1FKOA 4CEOA 4Q5VA 2RKIA 3K5OA 2X6SA 4FLWA 3V9ZA 5I3UA 1NK9A 5HRNA 3OYAA 2QK9A 1BHLA 4DQSA 2OPSA 4M3TA 1LWEA 3KLIA 1QSYA 1VRUA 2ITGA 1NK8A 3EZ5A 3F73A 4RW4A 1BCOA 3KLGA 4OLBA 2DFFA 3L2RA 4IFVA 1FXXA 3KIOA 3O4QA 4KHYA 3AA5X 3K5LA 1BI4A 3VQ4A 1EKEA 1RT4A 1QQCA 2FBTA 4GMJB 3OYHA 3ZSOA 5HP1A 1NKEA 3L2UA 1WAJA 2VWJA 1HNIA 4N5SA 2F8TA 1L3SA 1FK9A 4B9SA 4ZTFA 3SV3A 3K2PA 4F8RA 3L3UA 4Z0UA 3NF6A 4AHSA 1KLNA 1RTJA 3RTVA 4FJIA 4J2EA 4CJPA 4KHSA 1YTAA 4O0JA 4BWMA 3L2VA 2GUIA 1S6QA 1WAFA 1RTHA 1HYVA 1TGOA 4CJ4A 3NGIA 4DSLA 1KVAA 1IKXA 3RMBA 4OKKA 3P83D 2G8KA 3IAYA 3AVFA 4Z4CA 3SJJA 4CJFA 2P5GA 3ZSRA 4CJLA 1VSFA 4DTPA 3S9HA 1S5JA 1XHXA 2FBVA 4LD0A 4CGDA 3P5JA 1LWFA 1RT3A 4FJMA 2Y1IA 3VQDA 4C8LA 2YNFA 1BCMA 4DTJA 3WNFA 1D9DA 4F2RA 4FK2A 3HL8A 4R5PA 2RN2A 1Z25A 1I3AA 4FYDA 1KVCA 2HHUA 4FJXA 4I9LA 4NCBA 1YVUA 1EX4A 3RRGA 4FZYA 1S1VA 4AHTA 4E19A 2Q3SA 2YNHA 4Z4HA 4DSFA 2HHTA 5KI6A 4E7HA 3MXJA 1CZBA 3BDPA 2QXFA 1ASUA 3LANA 4CGFA 4E1MA 4DSKA 2HHWA 4M42A 4OGCA 1X9WA 1C1AA 2WOMA 3SNNA 4DU4A 3QEIA 1IKVA 1RBSA 2PYLA 5CYQA 3VQ5A 4KTWA 1B9DA 2BE2A 1LV5A 4I7FA 3PX0A 2YHAA 3K57A 4RW8A 2G8IA 2B6AA 2FC0A 4CF8A 4DF8A 4CK3A 1IH7A 4PWDA 2KTQA 1CXQA 3ZCMA 4CEQA 4MQ3A 4DFJA 3DLKA 4ID5A 3MXMA 1BISA 1VSEA 4CGIA 5HLFA 4DS4A 3DLBA 4OPKA 3RMCA 3CFPA 4N41A 1WSIA 3HP9A 2YV0X 4RG8A 1C1BA 4IG3A 3ITHA 1VRTA 1ZBFA 3DOLA 3AA2A 5SZTA 3KK3A 1UOCA 3T3FA 4KHWA 1QHTA 5K14A 3ZSWA 4CK1A 2P5OA 3VQCA 4EP5A 1W9HA 2AJQA 1DTQA 4FW1A 2HB5A 4LH5A 3HP6A 2OA8A 4WE1A 2OZSA 1RNHA 1S9GA 3QETA 3NGZA 1WSEA 1RBUA 3KKRA 5J2NA 3TAFA 4KHUA 3THVA 1WSGA 4CIEA 4W5TA 4FW2A 3AO2A 4JS5A 1L3VA 4F4KA 4CJUA 1A5VA 4BE2A 2B5JA 1J9AA 4FJ7A 3O3FA 3A2FA 1T05A 1C6VA 4B8AB 2BGGA 4F3TA 4PY5A 3SUOA 1ZYQA 1KCFA 3EYZA 1D8YA 1VSKA 4CGHA 5JS1A 2PZSA 4CHYA 1YT3A 4C8MA 3S3MA 1RT5A 4W5RA 3MEGA 3SYZA 3BGRA 2XO7A 1XI1A 1RTDA 1LAWA 4FJKA 4KHQA 1UWBA 4CJTA 1SL0A 1WLJA 1TKZA 3KJVA 1HYZA 1UAXA 1NKCA 3JSMA 3DYAA 2G8UA 4KRFA 4OKEA 5FDLA 3TAMA 5HRRA 2G8FA 4FJLA 4GVMA 3D0PA 4DWIA 4FM0A 3V6DA 4IKFA 2XRIA 3K5NA 1A5WA 5HROA 1JLEA 1TVRA 4AHUA 4KHNA 4NCAA 4H4MA 3ISNC 1Q9XA 4OVLA 3C95A 2Z1JA 2IC3A 3VQ7A 4IFYA 4DTMA 3TI0A 2QKKA 3HM9A 3SQ1A 4CCHA 3UIQA 4GW6A 1U04A 3IS9A 1GOBA 2Z1GA 1RDBA 4HUEA 4J2AA 3SPZA 4JS4A 1TKDA 1N5YA 3LPTA 3NF9A 3VQEA 3ULDA 2PY5A 4CEZA 4KI4A 3P1GA 3HYFA 3ZSQA 1ZBHA 3V1OA 1HQEA 3ZT0A 1Q9YA 4ELTA 3KLHA 3EY1A 2Y1JA 4HUGA 2XY5A 3AVNA 3KKSA 2XHBA 3RMAA 2OPQA 3AVJA 4JLHA 4IDKA 1DLOA 4M41A 3SZ2A 2KZMA 1N6QA 4JRPA 4LH4A 3V4IA 1VSMA 2DFHA 2YKMA 3QLHA 3QO9A 3CM5A 4CF2A 1LWCA 4CHQA 4IG0A 1U45A 2G8VA 3OYNA 2YNIA 3FFIA 1KRPA 4XIUA 4CEEA 4DLGA 4M3ZA 4CJEA 4CEBA 4DSEA 3RMDA 1UA1A 1NK0A 3RR7A 4FJNA 2P1JA 3OYMA 4FZXC 3NF7A 4OGEA 1Z26A 2P51A 3DRSA 3ASMA 3OYEA 4FLTA 4FK4A 1FKPA 1RBRA 2YNGA 3LP1A 4FLZA 3PX6A 1NJXA 4KAZA 4UQGA 4PQUA 4W5QA 4E89A 1KTQA 4DFPA 1QTMA 2KZZA 1RBVA 4FXDA 4BDZA 3SUPA 1R0AA 2E6LA 3KTQA 3ZT2A 3U3YA 3RR8A 1EP4A 4ELVA 2HVHA 1RDDA 2XY6A 1TKTA 1TAQA 3WNGA 4CGJA 3VA0A 4E7LA 1SL2A 2OYQA 5KGWA 3T1AA 3VQPA 3TABA 3KD5E 3LAKA 1TAUA 1JKHA 4CF0A 5C42A 1CLQA 1SUQA 1HRHA 4CERA 4Z4IA 1BL3A 4HTUA 5CZ1A 4FZZA 1K6YA 2HHVA 1S1WA 4CHNA 4DFKA 1BI4B 4FLYA 4B9UA 3MECA 4ID1A 3U3GA 2Z1IA 1W0HA 2FBXA 3DMJA 4LSNA 4CHOA 4ZHRA 4DTSA 3KK1A 1NJWA 3U6FA 4C8NA 1ASVA 3RWUA 3NE6A 3M8QA 3V9XA 1HJRA 2OPRA 4CFCA 1RDCA 4CIGA 2HHXA 3PO5A 5CZ2A 1NJYA 5CY4A 4MFBA 4N76A 5D3GA 1KLMA 1L3UA 3AVAA 3OYGA 3V9UA 2VG7A 1HYSA 2ATQA 1DTTA 2GV9A 3AVGA 3ZT4A 3L8BA 2IDOA 4KB0A 1ZBLA 3AVIA 4OKJA 3OYBA 1JLCA 3OYDA 3RRHA 4B9LA 2DTUA 4FK0A 4E0DA 3AVCA 3K58A 1S1XA 3CFRA 1TK0A 3H08A 2WONA 4DQPA 4CJKA 5HRSA 5E41A 4AH9A 4KREA 4DF4A 3TARA 3S3NA 3O3GA 2E6MA 4NYNA 3VQQA 1RT1A 2VG5A 3CM6A 3OJUA 4HUFA 3OS2A 2ZD1A 4E7KA 1VK0A 4BWJA 4M45A 3KK2A 4HCBA 1EXQA 1LW2A 3AO5A 4EZ9A 4CK2A 1WSHA 5SWMA 4AHCA 4G1QA 4HVJA 4O44A 4B8CA 4FJ5A 4DG1A 3IG1A 4DMNA 4DU1A 4B3OA 1IKWA 1X9SA 5EU7A 4Z4FA 4FJ9A 4KTZA 3C94A 5T7BA 4DS5A 2YHBA 4DTXA 2BANA 4O55A 4DQIA 3HT3A 4KO0A 2QKBA 1KSPA 2IGIA 3C6TA 3MEEA 3NBPA 3NAEA 4J2DA 4QOZB 2HHQA 1LAVA 4DQQA 3SUQA 2IS3A 3MXIA 3CG7A 4CFAA 2RPIA 3AO4A 3T19A 3LPUA 4CIFA 1TL1A 1BGXT 1LW0A 3AA4A 3B6OA 3M8PA 4DTOA 4ELUA 3L3VA 5C24A 2X78A 2HHSA 3D45A 3PY8A 2HVIA 3OS1A 2NUBA 3AV9A 3TAEA 5DMRA 4KTQA 4H4OA 1IKYA 1XWLA 3LWMA 1QSSA 1NK5A 2DFEA 5J1EA 3AVMA 3OYCA 3NH1A 4O0IA 4FLUA 4E7IA 3QIOA 3SCXA 4KPYA 1XHZA 1MU2A 3K5MA 4CJWA 5I42A 4B9TA 4F2SA 5JS2A 3TR8A 1TV6A 4L8RB 1IG9A 3O4NA 2PYJA 1T8EA 2IOCA 3HSTB 1TK5A 1U4BA 2A1SA 1WSFA 4BE0A 4K8XA 4HHTA 1VSJA 1JLQA 3G0ZA 4CHPA 3DLGA 3ZT3A 3S3OA 2A1RA 1NK4A 3CQ8A 4CECA 3OYLA 4CJ5A 5J2MA 2HNDA 1KFSA 2F8SA 1ASWA 4M3RA 1Y97A 2YKNA 1QE1A 4KI6A 3HVTA 4Q0BA 2BDPA 1JXEA 3MAQA 3ZSZA 3C6UA 4PA1A 4J2BA 2X6NA 2D5RA 3KD1E 3LP3A 2XY8A 1S1TA 3QINA 3JYTA 4KB1A 3VQ8A 4CESA 3NH0A 3SQ0A 2KQ2A 3SPYA 1NOZA 3AVBA 4BDYA 4DFMA 4B08A 2G8HA 1Q8IA 3I0SA 3E01A 3TWHA 5J2QA 1ZBUA 3F9KA 3TAGA 4OLAA 1WNSA 4YNQA 3M8RA 4FJHA 4DTUA 4K8ZA 4M3XA 4E3SA 2GBZA 1SV5A 4RW6A 1U47A 1C1CA 1BIZA 1RCHA 1JL1A 3AVHA 4I2QA 3ALYA 3QEVA 1YTUA 2O4GA 4C8OA 1ZBIA 4NYFA 3AO3A 1S1UA 4AILC 1X1PA 3V81A 1F21A 4CFBA 4DQRA 2E4LA 4O4GA 4DSJA 2VG6A 3DI6A 2JLEA 5KRSA 4LSLA 4LY7A 1J5OA 3HXMA 4H8KA 4W5OA 4W5NA 3DRRA 2ZQBA 3KLFA 2IAJA 4KFBA 4B9NA 3V1QA 4BDPA 1TL3A 1QS4A 4O5BA 4FLVA 2HMIA 3DLHA 1KVBA 3QEWA 3V1RA 1KFDA 4CFDA 4E1NA 4F3OA 4AHVA 4I9QA 2R7YA 2OZMA 3CYMA 4CJQA 3SQ4A 5CYMA 2EX3A 1VSHA 2B4JA 1C0MA 3DRPA 1JLFA 3DLEA 2XY7A 5C25A 1JLBA 1D5AA 1CZ9A 3LDSA 4KV8A 1HMVA 3AVLA 4E7JA 1BQMA 1WSJA 5KRTA 1XC9A 3HPOA 3VQ9A 1EETA 4FJ8A 2HNZA 1NOYA 4YFUA 3L2QA 3HPHA 1C0UA 1I39A 4RW9A 1HPZA 3VA3A 1NK6A 1L5UA 1HQUA 1JLAA 4DTRA 2KFNA 4Y1DA 2Z1HA 1RT6A 3VN5A 3VQ6A 2ZE2A 3HJFA 3NDKA 3LWLA 1RDAA 3NGYA 4M3YA 4CEDA 4CF9A 1NJZA 5HBMA 3SV4A 2D0AA 1G15A 2D0BA 2ETJA 4BE1A 4DSIA 5FRMA 3QESA 1UA0A 3PUFA 4AHRA 4QCLA 3VQAA 1O1WA 1BIUA 3AO1A 1TKXA 3LALA 3ZT1A 3O3HA 3HVRA 1B92A 4QAGA 3V9SA 1CXUA 3DM2A 3IRXA 4RW7A 3PX4A 3NCIA 1NK7A 1X9MA 4Z4EA 4I2PA 3OYKA 1REVA 3OS0A 4FJJA 2FBYA 1RT7A 1QSLA 4N56A 3PV8A 1S6PA 3ZSYA 4M3UA 2VWKA 3OYIA 4ZTJA 3G10A 1RBTA 2JGUA 1J53A 3LP0A 3KLEA 4TSXA 3WNEA 3OYFA 2HNYA 1JLGA 1BQNA 4CF1A 1VSLA 3OYJA 4CGGA 4CEAA 2W42A 3V9WA 1U49A 1SKRA 3OVNA 3TAPA 1TK8A 3QIPA 1JXBA 3ZSVA 3QNNA 3AVKA 3SI6A 1IO2A 3QNOA 3HPGA 4B9MA 4EZ6A 3CFOA 1RT2A 2G8WA 3DOKA 4OJRA 2DY4A 1RTIA
chains in the Genus database with same CATH superfamily
3TANA 2P9NA 1SKSA 3P39A 1S9EA 2RF2A 3NFAA 1NKBA 5EVZA 4FM2A 4H5NA 1HPMA 5AQPA 1YJNN 3FFKB 4EP4A 3NHGA 2F96A 3D2FA 3LZJA 3A5NC 4A5AA 3N4QA 3OY9A 5EXWA 3SMSA 3SUNA 2NRZA 1JCGA 3LAMA 1N36K 5A2QO 1T7PA 2X74A 2V52B 3WQTA 3LDQA 3HO1A 4BVOA 3QERA 2O4IA 3LP2A 1L3TA 3MDQA 4FPBA 5F1XA 3E66A 5KGXA 3THYA 1U48A 1N6QA 1ILYA 5ELZA 4IBNA 4CEFA 4WFNL 4KKOA 3K59A 1FW6A 4WCEL 4C8KA 2RKIA 1NM1A 4MO4A 4M3TA 2OPSA 3KLIA 4X66K 2ITGA 3EZ5A 4RW4A 1BCOA 2DFFA 4DV6K 3J8AA 1FXXA 1NMNA 3KIOA 3LM9A 4X62K 5AQRA 2Q97A 2FXUA 3VQ4A 4ZTFA 1RT4A 1QQCA 3OYHA 1NKEA 3SV3A 4Z0UA 4CJPA 4BWMA 4O0JA 2GUIA 1S6QA 2V7YA 1WUAA 1HYVA 4OKKA 2G8KA 3IAYA 2FBVA 4CGDA 1YJWN 1LWFA 4YDUC 1EQYA 1BCMA 2ASMA 2UYTA 3WNFA 1I3AA 5LMNK 1KVCA 4GV3A 2HHUA 1QVGM 1YVUA 2DPNA 5AQZA 2EWSA 4AHTA 4E19A 3O9SA 4DSFA 2HHTA 3MXJA 3BDPA 3LANA 4K0KK 1BO5O 4DR7K 4OGCA 4LF4K 1GLBG 5BR9A 1IKVA 2PYLA 4KTWA 3K9KA 3CCEN 4RW8A 3M6GA 2FC0A 4PWDA 4WQ4C 4MQ3A 4DFJA 1VSEA 4CGIA 1VQPN 4OPKA 3R1XA 2ZGZA 4IG3A 3CCQN 1VRTA 3KK3A 1T3VA 2RE2A 1UOCA 2P5OA 5JVHL 1HUXA 2AJQA 4LH5A 4FW1A 4CBWA 1S9GA 3KKRA 4B3MK 3NVKA 3AO2A 1W7AA 4F4KA 1A5VA 4BE2A 2B5JA 1T05A 4F3TA 1C6VA 4BQZA 1ZYQA 1VSKA 4ILGB 4CGHA 1YT3A 1K9MO 4C8MA 3S3MA 1RT5A 1MWKA 4W5RA 5H1SQ 1RTDA 2O8DB 3VGKA 4JI3K 1TKZA 4LF5K 1HR0K 5HRRA 3FZKA 4FJLA 4IEIA 4GVMA 4LFAK 2XRIA 3J7YP 1OVQA 4H4MA 1Q9XA 3VQ7A 4DTMA 2QKKA 3TI0A 3UIQA 3SQ1A 3VF6A 4GW6A 1U04A 3KK7A 2Z1GA 4CI6A 2P9LA 3SPZA 3QFUA 3NF9A 4HWIA 4WQ4A 4KI4A 3HYFA 3V1OA 3CETA 3KLHA 5LJVA 1NGCA 2XY5A 4B3RK 3CJ1A 4MLEA 1W2BM 3AVJA 5AQOA 2DFHA 3G25A 2YKMA 3QLHA 4BG8A 3E9PA 2W6KA 3JXUA 4DR6K 3CERA 1DT9A 3OYNA 4XIUA 4BGBA 2FSKA 4FJNA 3TPQA 5AQMA 2P1JA 5GINA 4FZXC 1Z26A 4H0TB 5M1KA 4DV3K 4FLZA 3PX6A 1VQ9N 3A5MC 4PQUA 4W5QA 1KTQA 1QTMA 2HMPA 1QVFM 3FZLA 2UUBK 3ZT2A 2W6LA 4ELVA 2HVHA 1TKTA 4A5BA 3WNGA 4CGJA 5AQWA 4DV2K 3VQPA 3KD5E 3LAKA 1JKHA 1U2VB 1RFQA 1CZAN 4CERA 4Z4IA 1BA0A 4B1WB 4HTUA 4FZZA 2NRVA 4BRIA 3I56N 4KH5A 4A62A 4CHNA 1VQ6N 4B9UA 2Z1IA 1W0HA 3VERA 4DTSA 3K9JA 1KAZA 1NJWA 4C8NA 3RWUA 2VGMA 1N32K 3V9XA 3BZKA 5CZ2A 5CY4A 1HYSA 2ATQA 1DTTA 2YHWA 4OKJA 2IVNA 1JLCA 3PIPL 1J5EK 2WONA 1VQ4N 5E41A 4B3SK 4YOYA 4WF9L 4KREA 3DXKB 3IFRA 3S3NA 4OO1J 3ZLJA 3OS2A 5AQNA 1SZ2A 3MN9A 1EXQA 4EZ9A 4FJ5A 1G99A 3IG1A 4DMNA 4DV0K 2VQFK 3WT0A 4BRCA 2IGIA 3C6TA 4QOZB 2HHQA 2O8EA 2IS3A 3MXIA 4DV4K 3CG7A 2QEXN 3AO4A 4K25A 3T19A 3VGMA 3AA4A 3D2EA 5AZJA 3PY8A 3ATUA 5AJ3K 2F9WA 1VQ8N 1IKYA 2ITMA 4IO9L 1NK5A 4K41A 2DFEA 3AVMA 4ISEA 2A42A 4FLUA 3SCXA 2JWKA 3C7NA 1XHZA 4CJWA 1TV6A 1ZBSA 3VEOA 4BRFA 1IG9A 3O4NA 4L8RB 2IOCA 1IV0A 1IJJA 1TYQB 1WSFA 4BE0A 1HNZK 3I33A 4OX9K 3DLGA 3ZT3A 5AQKA 2A1RA 3CQ8A 1KFSA 2HNDA 2F8SA 1YF5L 1YITN 3HVTA 4Q0BA 3ZSZA 4WFBL 4YHHK 3MWTA 2XY8A 3QINA 4DB3A 4YOXA 5GIOA 3SPYA 4BDYA 4B08A 3I0SA 4KHPK 3TWHA 5J2QA 1WNSA 3MMVA 3U9ZA 1E3MA 5AQLA 4K8ZA 4IJAA 2GBZA 1SV5A 4H5WA 3AVHA 3ALYA 5AFUH 1YTUA 3C0BA 4C8OA 5AQJA 4A57A 1X1PA 3MCPA 3V81A 2GX9A 4CFBA 2JLEA 4NB4A 5KRSA 3CI5A 4LY7A 2FF6A 3HXMA 4FL9A 4H8KA 3JAMO 2QWNA 3DRRA 3O80A 4FO0A 3KLFA 4KFBA 4OPAA 4DR3K 1Q18A 3H6EA 1DGKN 4FLVA 1MWMA 1KVBA 4F3OA 2CGLA 3TSQA 3CYMA 3SQ4A 1VQNN 2QXLA 1VSHA 3FZFA 4ISGA 4BR5A 1D5AA 3AVLA 3WUHA 1BQMA 5KRTA 4FJ8A 1EETA 4YFUA 3L2QA 1C0UA 4DTRA 2KFNA 3WXIA 4Y1DA 2BH1A 4FSVA 3HJFA 4DV7K 3LWLA 1HKCA 3NGYA 2A5XA 5M1QA 2IVOA 1NJZA 3SV4A 2D0BA 4BE1A 4CW7B 1C0FA 1ATNA 2P9PB 4QCLA 1O1WA 2P9SB 2HOEA 3AO1A 3R9PA 4DUYK 3FE1A 3HVRA 3SAHA 4Z4EA 3IRXA 4RW7A 3PX4A 3NCIA 4I2PA 3OYKA 3IKMA 1REVA 3OS0A 4FJJA 3VF4A 2FBYA 2E2NA 4KH4A 3SLCA 2BTFA 4ZTJA 4TSXA 3WNEA 1VSLA 1SKRA 2W42A 3TAPA 4DCHA 2E2PA 1RTIA 3ULEA 3ID8A 4FM1A 4QS8A 4CJ7A 1C0TA 3QB0A 4B1VA 4NCGA 3MN5A 1WBBA 3L2WA 3A0IX 3UKUB 2D0CA 3DLRA 2J4RA 3THWA 4M3WA 2KFZA 2OPPA 1A5XA 3LDPA 2QWQA 3ZSXA 3MN7A 1ITGA 2I5JA 4FVMA 1GOAA 3KWIA 5BPMA 1SKWA 3I0RA 4IXCA 1T03A 4CE9A 4HCCA 2E1ZA 4CJ3A 4BACA 3VTIA 4CJSA 3QEPA 4Y1CA 2KW4A 4OPHA 4B9VA 2GTDA 3K5OA 3ID6A 4JKEA 2QK9A 2KZMA 3CXCM 1BHLA 1LWEA 1QSYA 2P9KB 1VRUA 4EAHD 1GLEG 2O8BA 2RHKA 4YORA 5FPDA 3L2RA 5LMUK 4IFVA 5BPNA 4KHYA 4FPAA 1BI4A 5HP1A 3LM2A 4JV5K 3L2UA 1WAJA 1P8ZA 5JICA 1L3SA 3K2PA 4F8RA 4AHSA 4J2EA 3GOIA 4EIAA 3RTVA 1WAFA 4Z94A 4CJ4A 4DSLA 2QA4N 1IKXA 4H5TA 3UKRB 4CJFA 1VSFA 1S5JA 1XHXA 3P5JA 2Y1IA 4C8LA 3U9DA 1SQKA 1E4FT 3ZX3A 1ATRA 5AZIA 1Z6RA 1HKBA 5ADXH 3CCMN 4CZJA 3VTHA 3CHWA 1E4GT 1C1AA 2WOMA 1GLDG 1RBSA 5CYQA 3VQ5A 4BRAA 2OANA 4RCHA 4DR2K 4CK3A 2KTQA 4M7YA 3ZCMA 3DLKA 5HLFA 3DXMB 4DS4A 1T44A 1NLVA 3GL1A 4CVNE 1HJOA 3DLBA 3QDKA 1WSIA 2YV0X 2F7TA 1NGJA 1TUYA 1ZBFA 4H0YB 1XUPO 4BR2A 5AQQA 4WE1A 3H1VX 4IEEA 1RBUA 5AFUA 5J2NA 4YOUA 1BUPA 3A2FA 2BGGA 4B8AB 5DM7L 2PZSA 4IOAL 2NRRA 3BGRA 4KHQA 5KPZA 4JKDA 3PIOL 1WLJA 4NO7A 1HYZA 3IDHA 3JSMA 4KRFA 2CGJA 4M7XA 5AQUA 3P38A 4DWIA 3K5NA 1A5WA 5HROA 1JLEA 1TVRA 4H5RA 3ISNC 3NVMA 2AA4A 2KLAA 4C1NI 3U8XA 4WQ5A 4FWQA 2Q0UA 3IS9A 1YIJN 4HUEA 3A5OC 2D1KA 2PY5A 4CEZA 2V51B 4HUGA 2P9NB 2UXBK 3AVNA 4A2AA 2XHBA 3THXA 1EWQA 2O8FA 3F2KA 4JRPA 3O9QA 3D2FB 2YNIA 3FFIA 4DLGA 4M3ZA 4CJEA 1NK0A 1UA1A 1DKGD 2GWJA 5BN8A 4PKGA 1NGIA 3EE9A 3HSCA 4KAZA 1IBMK 4DFPA 4BDZA 3THYB 1R0AA 2E6LA 3KTQA 3CQXA 3U3YA 1RDDA 2XY6A 4BRNA 1SL2A 3CF5L 5KGWA 3TABA 3L4QA 5M1OA 1CLQA 1HRHA 3OHRA 3WQUA 1JCFA 1S1WA 4DFKA 3MECA 4JD2B 1QQMA 2FBXA 1YJ9N 3DMJA 4ZHRA 5F0XA 3NE6A 4B1XB 1HJRA 2OPRA 4CIGA 1RDCA 4IJNA 3PO5A 3WEEA 4N76A 4U67L 5BRHA 3O5BA 4GNIA 3MX5A 3AVAA 3OYGA 3V9UA 4IDHA 4B3TK 2GV9A 1ZBLA 5BN9A 3AVIA 2DTUA 4B9LA 1NGGA 3EKUA 4BRKA 4FK0A 4E0DA 1NGHA 3CFRA 3CC2N 4CJKA 4PL7A 2A41A 4CZIA 3TARA 4H0PA 4FWPA 4NYNA 3ENHA 3VQQA 3CM6A 1GLCG 4HCBA 4ISFA 4CK2A 5SWMA 4AHCA 5AQTA 4DG1A 1RGIA 3ZX2A 4DU1A 1IKWA 2NLXA 4Z4FA 4JHDA 4DS5A 4BR9A 4DTXA 4DQIA 2QKBA 3HT3A 3I55N 4MLHA 3MEEA 3NAEA 4J2DA 1LAVA 2QWRA 4HTLA 4DQQA 3SUQA 4CFAA 1YXQA 2RPIA 4JKGA 4CIFA 4ELUA 3M8PA 4JN4A 3L3VA 5C24A 2HHSA 2Q31A 2NUBA 1KC8O 5DMRA 1NNEA 1XWLA 1K8KA 4IZ9A 4BRMA 3LWMA 5AQVA 3NH1A 1MU2A 5ADXA 5I42A 4FWKA 5FPMA 2V7ZA 3U4LA 2PYJA 1T8EA 3BF3A 2VQEK 1IG8A 1V4TA 3SAGA 2HF3A 4HHTA 1JLQA 1BOTO 4CHPA 1EO1A 3OTOK 4O5FA 4CJ5A 1DEJA 3H45C 1ASWA 1Y97A 2YKNA 2BDPA 3ENOA 4FWOA 3LDNA 5FPNA 4J2BA 1W97L 2D5RA 4KB1A 3PLAA 3JYTA 3VQ8A 3NH0A 3RSEA 1NOZA 4OLAA 3TAGA 5JVGL 4YNQA 3M8RA 4DTUA 1U2VA 1I94K 1Q86O 3TTCA 1BIZA 4I2QA 2O8CA 1Q81O 4DR5K 1ZBIA 2QWLA 1S1UA 3VEYA 3HM8A 1F21A 3OBYA 2E4LA 5HL7L 4XH5A 2VG6A 3G71N 4LF7K 4LSLA 5KPTA 5AQIA 4W5OA 4W5NA 2ZQBA 4B9NA 4IWVA 1GLJO 4BDPA 4O5BA 3QEWA 4BR0A 1SAZA 4YOTA 4CFDA 2HF4A 4EHTA 4AHVA 3WXJA 2R7YA 1P90A 2OZMA 5CYMA 2EX3A 4AF1A 1C0MA 2NRHA 4B1UB 3DRPA 1JLFA 3DLEA 3MWPA 5E26A 4E7JA 3LDSA 1HMVA 4LC9B 1Q82O 2HNZA 4JNEA 2HHHK 4RW9A 1HPZA 2D0OA 1NK6A 2I7NA 2PBDA 2ZE2A 3NDKA 4M3YA 4CEDA 4BREA 2HSTA 3PSIA 1KAYA 5FRMA 2FSNA 2YJEA 3ZETA 3J7ZO 1VQKN 3O3HA 1B92A 3DM2A 1X9MA 4H03B 3VEWA 4H0OA 2E88A 4N56A 3PV8A 3SMPA 1IBLK 4M3UA 3EZWA 3G10A 4I6MA 1NGBA 3LP0A 1QZ5A 1MDUB 1JLGA 3OYJA 3J7AP 3V9WA 1JXBA 3SI6A 3QNNA 4FXDA 3D7EO 3HPGA 4FWLA 4EZ6A 1RT2A 5EOYA 3TTFA 4OJRA 4BGAA 3N4PA 2Q0RA 3T69A 5FPEA 1D9FA 3W0LA 4LFCK 4DLEA 5KTQA 4JRQA 1JL2A 3TAQA 3SQ2A 3LZIA 5GIPA 3L6QA 4N47A 4DU3A 3OJSA 4JI5K 2A6AA 4BC4A 3TTDA 5C0YA 2QWOA 1GOCA 5TKWA 4CHZA 1RDWX 3KVGA 3F9MA 3NF8A 2HW3A 4FCYA 3SK3A 4ICLA 5FRNA 1T6DA 1YI2N 3PO4A 4EHUA 4PUOA 1WN7A 1X3MA 1VSDA 3WNHA 5HRPA 1HNVA 5AQHA 1OH8A 1FKOA 4MO5A 4Q5VA 3D2EB 2W41A 3V9ZA 5I3UA 5AZJB 1NK9A 5HRNA 3OYAA 4M63C 3MN6A 1NK8A 3F73A 3C7NB 3O4QA 4H0XB 3AA5X 3K5LA 1OVYA 5B8HA 4WYBA 4MDAA 2OTLN 1HNIA 4N5SA 2F8TA 4FJIA 3NF6A 1KLNA 4CBUA 3TU5A 1YTAA 2ASOA 4IOCL 3P4IA 4BRLA 2ASPA 1RTHA 2GELA 4H0VB 1TGOA 1KVAA 3RMBA 4CBXA 3AVFA 2P9UA 4Z4CA 3SJJA 2P5GA 4DTPA 4CJLA 3S9HA 4NLCA 4LD0A 1XMOK 4FJMA 1XNQK 2YNFA 1D9DA 4F2RA 3AARA 4FK2A 3HL8A 2RN2A 4KH6A 4I9LA 1NBWA 5JLHA 4NCBA 5GAEP 2WUSA 4F9OA 2KKZA 3RRGA 3EE8A 4FZYA 4H5VA 4Z4HA 3D6RA 2YNHA 4J8FA 4E7HA 3ZEUB 1CZBA 1ASUA 4DSKA 2HHWA 1X9WA 3SNNA 3MK6A 4JI7K 5TKYA 1B9DA 1LV5A 4ILJA 4PKHA 1BG3A 4I7FA 3PX0A 4L3QA 3K57A 2G8IA 2B6AA 3VMFB 4CF8A 4CZFA 1CXQA 4IFEA 4CEQA 2OTJN 5C2FA 3MXMA 1BISA 3RMCA 4N41A 3E9LA 3HP9A 4JAXA 4RG8A 3PSFA 3ITHA 2QWPA 3O9UA 5AQSA 3AA2A 5JLFA 3T3FA 2AP1A 1QHTA 4CK1A 3VQCA 1S22A 3CMAN 2VGNA 1K8AO 1W9HA 2OZSA 1RNHA 3QETA 1WSEA 1VHXA 4KHUA 3CJ7A 3AGKA 3AGRA 1WSGA 4CIEA 3P31A 4JS5A 1L3VA 4CJUA 4Y0WA 1XNRK 1R59O 1J9AA 3GG4A 3O9TA 3O3FA 3O6WA 4PY5A 3EYZA 2E2QA 5JS1A 4CHYA 4DUZK 1S72N 3MEGA 3SYZA 2XO7A 4JKFA 4FJKA 3CJBA 1SL0A 1UAXA 1NKCA 3KHYA 3R6MA 2E2OA 1GLFO 4FWSA 3D0PA 4FM0A 3V6DA 4X64K 4BVPA 4DQ8A 3AAPA 4NCAA 3NMUA 3WXLA 3C95A 4IFYA 1NGEA 3H3OB 4BC3A 1GOBA 4J2AA 4O8KA 4JS4A 2IIRA 3LPTA 4YOWA 4XH1A 5LJWA 1N8RO 1WOQA 3ULDA 3QBXA 2WFBA 3P1GA 1ZBHA 3B8AX 3ZT0A 4LF6K 3ULEB 2IVPA 4JI1K 1Q9YA 3DAWA 3EY1A 2Y1JA 3RMAA 2OPQA 4JLHA 4EFHA 1DLOA 4M41A 2HBMA 4LH4A 3V4IA 1VSMA 4FWMA 4BRGA 1LWCA 4QS7A 3THWB 4CHQA 1U45A 2G8VA 3SAFA 3BUZB 1KRPA 4CEEA 2BUPA 2Q1NA 2D4WA 3RMDA 1ATSA 3OYMA 4B1YB 5KPRA 1JCEA 1X9JA 2Q36A 2A40A 3ASMA 5C2DA 4FLTA 1RBRA 3LP1A 1U6ZA 4UQGA 4CZMA 4E89A 2GWKA 1N33K 4B9QA 1YVNA 3UE5A 3CC4N 4QS9A 3RR8A 1EP4A 3EO3A 3VA0A 4JKHA 1QHAA 4E7LA 2OCEA 2OYQA 4JKCA 1TAUA 5C42A 4CF0A 3L0QA 3H1QA 2O8BB 3CJAA 3BEXA 5CZ1A 5EX5A 1K6YA 4WQ5C 2ZJRL 2HHVA 1BI4B 3CCSN 4LSNA 4CHOA 3HOSA 2P9IA 3EL2A 1ASVA 4ILHA 5C15A 2HHXA 3LDOA 1KLMA 3VETA 1L3UA 3HRGA 3M1FA 3BY5A 3ZT4A 4KB0A 2IDOA 5CR4A 3OYBA 5C10A 4BC5A 3SBGA 3H08A 4DQPA 5KQDA 4DF4A 4DV5K 3O3GA 2E6MA 3G4SN 3KWGA 3OJUA 4HUFA 2NRTA 1LCUA 5AZIB 4E7KA 1OH5A 1VK0A 4BWJA 4M45A 1LOTB 4BC2A 1LW2A 3AO5A 3J81O 4G1QA 4O44A 4B3OA 1X9SA 5EU7A 4JI4K 2BANA 3C6AA 4O55A 4KO0A 1KSPA 3NBPA 4CD3A 1HX1A 4AM6A 5GAGP 1TL1A 1BGXT 3B6OA 4LF9K 3FZHA 4DTOA 3K0SA 3G6EN 3D45A 3AV9A 4KTQA 3HI0A 4H4OA 1T6CA 3FGUA 3T7ZA 2E1YA 4KPYA 3QIOA 3TSPA 4B9TA 3O08A 3QBWA 3HSTB 3CCLN 1TK5A 4K8XA 2I7PA 5F2RA 3S3OA 3H3NO 4CECA 5J2MA 3CD6N 1EWRA 1QE1A 4NXNK 3MAQA 1VAZA 3VEZA 5GADP 2X6NA 1V4SA 3LP3A 1NMDA 2YI1A 4U7BA 3AVBA 4DFMA 1Q8IA 3E01A 1ZBUA 2YCHA 1NGDA 4FJHA 4M3XA 1BWFO 4E3SA 3SBTA 1C1CA 1RCHA 5MLCQ 4NYFA 2CH5A 4JD2A 2PFUA 4DSJA 2W40A 3DI6A 4A61A 1J5OA 1FJGK 5C12A 1M90O 2ZF5O 3VPZA 2UUAK 2IAJA 3V1QA 1TL3A 2HMIA 3THXB 3V1RA 1KFDA 4E1NA 4BRDA 4I9QA 2O8FB 2F4VK 2NRXA 3O9RA 2CGKA 2HBLA 3O1WA 1JLBA 3R3LA 3I8BA 4KV8A 1NGFA 3VQ9A 1I39A 3VA3A 1L5UA 2Z1HA 1RT6A 3VN5A 3VQ6A 1RDAA 3JS6A 4K43A 1NWKA 4KBOA 4CF9A 5HBMA 4GY2B 1G15A 2ETJA 1QZ6A 3QESA 2O8DA 1UA0A 3Q7CA 4AHRA 3VQAA 1BIUA 4FVUA 1XQSC 3ZT1A 1O13A 1NK7A 3VF2A 5DM6L 4PL8A 3DLLL 2VCPA 4FWRA 4MDBA 4BROA 1S6PA 5AQGA 1RBTA 1J53A 3CIPA 3OYFA 1VQ7N 1BQNA 4CF1A 4CGGA 4CEAA 4DR4K 1U49A 3OVNA 3ZSVA 4CZLA 3WEEB 4Z4GA 5FROA 1GLLO 5E84A 1SL1A 4CZEA 4JI6K 1VQLN 2E20A 2QWMA 4YDUA 3R8EA 3FR0A 1J54A 1RILA 3NH2A 4DKWA 3W3DA 3I8DA 2EHGA 4FJGA 2LSNA 3B6PA 1BA1A 4CJRA 5J2PA 5DK5A 3VQBA 4V19S 5CE3A 3QEXA 3M8SA 1VSIA 4YY3K 3HK2A 4DTNA 4JHDB 2KHOA 4JK7A 4FLXA 3AA3A 4JKBA 3AY9A 5LY3A 4OPJA 3J80O 3ZYYX 1K73O 2YHYA 4CJVA 4IO8A 1B9FA 4JKGB 3MEDA 1C0GA 4CEOA 3O1BA 5M1FA 2X6SA 4FLWA 3A5LC 4DQSA 3VOVA 5FLXO 2FLOA 1K8KB 2F9TA 3KLGA 4OLBA 1EKEA 2FBTA 4GMJB 2P9LB 3ZSOA 1NG9A 4BRQA 2VWJA 4JI0K 1FK9A 4B9SA 1QQOA 3L3UA 2H3GX 3QICA 1RTJA 4KHSA 4CZGA 3MX2A 3L2VA 1D4XA 2HBJA 3H46O 3OBWA 2ZM6K 3NGIA 1JJ2M 2QI2A 5BRDA 3P83D 3WXKA 3ZSRA 5M1PA 4B1ZA 5AQXA 1RT3A 1VQON 3VQDA 1XC3A 4DTJA 3DWLA 2UU9K 4O8UA 3RSEB 4R5PA 1XMQK 1Z25A 3DXKA 4FYDA 3BP8A 1NGAA 4C23A 4FJXA 1EX4A 3ATVA 2VWBA 1S1VA 4A59A 4GKKK 2Q3SA 5KI6A 1NJIO 2QXFA 3S41A 4E1MA 4CGFA 2O8CB 1M1KO 4M42A 2ZWHA 4G9ZA 4DU4A 3QEIA 1OKJA 2BE2A 1MA9B 1OH6A 2YHAA 4DR1K 4DF8A 1IH7A 1HLUA 1KXPA 4ID5A 3WXMB 4DV1K 4X65K 3CFPA 2JWLA 2A3ZA 1C1BA 1YAGA 3DOLA 5SZTA 3DJCA 2E8AA 4LFBK 1SS6A 3CJ9A 4KHWA 2FF3B 5K14A 3ZSWA 1IBKK 4EP5A 1DTQA 2HB5A 3BF1A 3HP6A 2OA8A 3CQYA 3NGZA 3TAFA 1TYQA 3THVA 1NU0A 4W5TA 4FW2A 4JI8K 4GV6A 2VYPA 4FJ7A 1X3NA 5BPLA 3T1HK 3SUOA 1D8YA 1KCFA 4BY9C 1XI1A 1LAWA 4GV9A 1UWBA 4CJTA 3ZETB 3KJVA 3TSUA 3IUCA 2YJFA 2G8UA 3DYAA 4OKEA 5FDLA 3TAMA 2G8FA 4IKFA 2QTDA 4AHUA 4KHNA 2Q2RA 4OVLA 3E1YA 4JEPA 2Z1JA 2IC3A 3Q7BA 4JYAK 3HM9A 4I6MB 4CCHA 4PHTX 5EY4A 5KQ8A 1RDBA 2YX6A 3O8MA 1TKDA 1N5YA 1ZXOA 3QFPA 2O8EB 5BREA 3VQEA 3ZSQA 3CCVN 1HQEA 1YUWA 4ELTA 5AQYA 3OA9A 3KKSA 2D0PA 3C6HA 3EKSA 4IDKA 5M1NA 3SZ2A 2UXCK 1WBDA 4JK9A 3UB5A 3QO9A 3CM5A 4CF2A 4IG0A 4YOVA 3CCRN 4LF8K 2ZJPL 4NLBA 1BDGA 4CEBA 4DSEA 3RR7A 4BG9A 2WBNA 1Z05A 5AQFA 5LL6Z 3OW2M 3NF7A 4OGEA 2ZJQL 2P51A 3DRSA 4GVEA 3ZEUA 3FLCO 3OYEA 3QMLA 2NNWA 1FKPA 2YNGA 4FK4A 1NJXA 3CPWM 4XH4A 3F5TA 4RTFD 5BRFA 2KZZA 1RBVA 3SUPA 3EEQA 2P9PA 4JKAA 5BR8K 3HZ6A 2P9SA 2NZTA 4FWNA 1TAQA 3GE1A 2GEMA 3VEXA 3T1AA 4IOXA 1N34K 4RWTA 1SUQA 1BL3A 1KAXA 3GDQA 3CCJN 1GLAG 3RVCA 4AM7A 1KQSM 4BRHA 4FLYA 4ID1A 3U3GA 5HOOA 3KK1A 3U6FA 3M8QA 1ESVA 1BU6O 2WTUA 1KD1O 4CFCA 1NJYA 5D3GA 4MFBA 3VGLA 3EN9A 2FSJA 1S3XA 1H1VA 2VG7A 3BZCA 3AVGA 3L8BA 4A2BA 1HNXK 2P9UB 3OYDA 3RRHA 2CH6A 3ENBA 3CC7N 3L4IA 3AVCA 4BRPA 1S1XA 3CPEA 3K58A 3AAQA 1TK0A 4K42A 3KZBA 5HRSA 3UKUA 4AH9A 3SJHA 1RT1A 2VG5A 2PAVA 3VEVA 5AR0A 1VQMN 2ZD1A 3KK2A 3MCAB 1WSHA 4HVJA 4B8CA 2YHXA 2HBKA 3O4WA 4FJ9A 4KTZA 3C94A 5T7BA 2YHBA 1WB9A 4CZHA 4WFAL 5JMVA 4DHYA 3LPUA 1LW0A 2X78A 3A8YA 2HVIA 3OS1A 1J6ZA 3GBTA 3TAEA 2P9KA 1QSSA 4C1NK 5J1EA 3VENA 3HOTA 3OYCA 4O0IA 4E7IA 3K5MA 4F2SA 2GUPA 5JS2A 3TR8A 1U4BA 2A1SA 1VSJA 3G0ZA 1NK4A 3OYLA 1ZC6A 4M3RA 1TUUA 4KI6A 3CJCA 3UKRA 1JXEA 3C6UA 4PA1A 3KD1E 3LDLA 1S1TA 3T1YK 1OH7A 3HTVA 5GAHP 4NXMK 4CESA 3SQ0A 2KQ2A 2WC9A 2QM1A 2G8HA 3F9KA 5CHIA 2QW9A 5IWAK 4CZKA 4RW6A 4JI2K 1U47A 3QEVA 1JL1A 4GKJK 2O4GA 3AO3A 4AILC 1QQNA 3VESA 4DQRA 3C65A 4O4GA 4BR4A 1RDUA 3E9OA 2NRWA 1VQ5N 3DXMA 3DLHA 1QS4A 4AQYK 4JK8A 3HBTA 2E5LK 4CD1A 4CJQA 3M5RA 2B4JA 2XY7A 5C25A 1CZ9A 4R79A 1WSJA 1XC9A 3IMXA 3HPOA 4BR7A 1NOYA 3HPHA 4PKIA 1HQUA 1JLAA 5I9EB 4E1JA 2UXDK 1HKGA 3ZX0A 2D0AA 1HNWK 3FZMA 3LL3A 4DSIA 4XEIA 1YHQN 3PUFA 4FOEA 1TKXA 3LALA 4QAGA 3V9SA 1CXUA 1Q7YO 4BQLA 3CCUN 1QSLA 1RT7A 5IT9O 3ZSYA 2VWKA 2ZGYA 3OYIA 2JGUA 3KLEA 2HNYA 2UUCK 1Y64A 2P9IB 3M3ZA 4UY8O 4FOIA 1TK8A 3QIPA 3AVKA 1IO2A 3QNOA 4B9MA 3CMEN 3CFOA 2G8WA 3DOKA 2DY4A
chains in the Genus database with same CATH topology
4Z4GA 5FROA 3TANA 1D9FA 4FM1A 1SKSA 1C0TA 4DLEA 1S9EA 2RF2A 3NFAA 1NKBA 5KTQA 4JRQA 1JL2A 4NCGA 4FM2A 1SL1A 3TAQA 3SQ2A 3LZIA 4EP4A 3L2WA 3NHGA 2F96A 3LZJA 1J54A 1RILA 2D0CA 3DLRA 3NH2A 4N47A 4DU3A 3OJSA 4M3WA 3OY9A 3I8DA 2OPPA 1A5XA 2EHGA 2KFZA 4FJGA 3SUNA 2LSNA 3B6PA 3ZSXA 3LAMA 1GOCA 4CJRA 1ITGA 2I5JA 4CHZA 5DK5A 5J2PA 4FVMA 2X74A 3VQBA 1T7PA 1GOAA 3NF8A 2HW3A 4FCYA 3QEXA 3HO1A 3M8SA 1VSIA 3HK2A 4ICLA 4DTNA 3QERA 3I0RA 1T03A 3LP2A 4CE9A 1SKWA 1L3TA 5FRNA 4HCCA 2O4IA 4CJ3A 3PO4A 4FLXA 3AA3A 4BACA 5KGXA 4PUOA 1WN7A 4OPJA 1VSDA 1U48A 3WNHA 4CJSA 3QEPA 4Y1CA 4CJVA 1HNVA 2KW4A 5HRPA 4IBNA 1B9FA 4CEFA 4KKOA 3MEDA 3K59A 4C8KA 4B9VA 1FKOA 4CEOA 4Q5VA 2RKIA 3K5OA 2X6SA 4FLWA 3V9ZA 5I3UA 1NK9A 5HRNA 3OYAA 2QK9A 1BHLA 4DQSA 2OPSA 4M3TA 1LWEA 3KLIA 1QSYA 1VRUA 2ITGA 1NK8A 3EZ5A 3F73A 4RW4A 1BCOA 3KLGA 4OLBA 2DFFA 3L2RA 4IFVA 1FXXA 3KIOA 3O4QA 4KHYA 3AA5X 3K5LA 1BI4A 3VQ4A 1EKEA 1RT4A 1QQCA 2FBTA 4GMJB 3OYHA 3ZSOA 5HP1A 1NKEA 3L2UA 1WAJA 2VWJA 1HNIA 4N5SA 2F8TA 1L3SA 1FK9A 4B9SA 4ZTFA 3SV3A 3K2PA 4F8RA 3L3UA 4Z0UA 3NF6A 4AHSA 1KLNA 1RTJA 3RTVA 4FJIA 4J2EA 4CJPA 4KHSA 1YTAA 4O0JA 4BWMA 3L2VA 2GUIA 1S6QA 1WAFA 1RTHA 1HYVA 1TGOA 4CJ4A 3NGIA 4DSLA 1KVAA 1IKXA 3RMBA 4OKKA 3P83D 2G8KA 3IAYA 3AVFA 4Z4CA 3SJJA 4CJFA 2P5GA 3ZSRA 4CJLA 1VSFA 4DTPA 3S9HA 1S5JA 1XHXA 2FBVA 4LD0A 4CGDA 3P5JA 1LWFA 1RT3A 4FJMA 2Y1IA 3VQDA 4C8LA 2YNFA 1BCMA 4DTJA 3WNFA 1D9DA 4F2RA 4FK2A 3HL8A 4R5PA 2RN2A 1Z25A 1I3AA 4FYDA 1KVCA 2HHUA 4FJXA 4I9LA 4NCBA 1YVUA 1EX4A 3RRGA 4FZYA 1S1VA 4AHTA 4E19A 2Q3SA 2YNHA 4Z4HA 4DSFA 2HHTA 5KI6A 4E7HA 3MXJA 1CZBA 3BDPA 2QXFA 1ASUA 3LANA 4CGFA 4E1MA 4DSKA 2HHWA 4M42A 4OGCA 1X9WA 1C1AA 2WOMA 3SNNA 4DU4A 3QEIA 1IKVA 1RBSA 2PYLA 5CYQA 3VQ5A 4KTWA 1B9DA 2BE2A 1LV5A 4I7FA 3PX0A 2YHAA 3K57A 4RW8A 2G8IA 2B6AA 2FC0A 4CF8A 4DF8A 4CK3A 1IH7A 4PWDA 2KTQA 1CXQA 3ZCMA 4CEQA 4MQ3A 4DFJA 3DLKA 4ID5A 3MXMA 1BISA 1VSEA 4CGIA 5HLFA 4DS4A 3DLBA 4OPKA 3RMCA 3CFPA 4N41A 1WSIA 3HP9A 2YV0X 4RG8A 1C1BA 4IG3A 3ITHA 1VRTA 1ZBFA 3DOLA 3AA2A 5SZTA 3KK3A 1UOCA 3T3FA 4KHWA 1QHTA 5K14A 3ZSWA 4CK1A 2P5OA 3VQCA 4EP5A 1W9HA 2AJQA 1DTQA 4FW1A 2HB5A 4LH5A 3HP6A 2OA8A 4WE1A 2OZSA 1RNHA 1S9GA 3QETA 3NGZA 1WSEA 1RBUA 3KKRA 5J2NA 3TAFA 4KHUA 3THVA 1WSGA 4CIEA 4W5TA 4FW2A 3AO2A 4JS5A 1L3VA 4F4KA 4CJUA 1A5VA 4BE2A 2B5JA 1J9AA 4FJ7A 3O3FA 3A2FA 1T05A 1C6VA 4B8AB 2BGGA 4F3TA 4PY5A 3SUOA 1ZYQA 1KCFA 3EYZA 1D8YA 1VSKA 4CGHA 5JS1A 2PZSA 4CHYA 1YT3A 4C8MA 3S3MA 1RT5A 4W5RA 3MEGA 3SYZA 3BGRA 2XO7A 1XI1A 1RTDA 1LAWA 4FJKA 4KHQA 1UWBA 4CJTA 1SL0A 1WLJA 1TKZA 3KJVA 1HYZA 1UAXA 1NKCA 3JSMA 3DYAA 2G8UA 4KRFA 4OKEA 5FDLA 3TAMA 5HRRA 2G8FA 4FJLA 4GVMA 3D0PA 4DWIA 4FM0A 3V6DA 4IKFA 2XRIA 3K5NA 1A5WA 5HROA 1JLEA 1TVRA 4AHUA 4KHNA 4NCAA 4H4MA 3ISNC 1Q9XA 4OVLA 3C95A 2Z1JA 2IC3A 3VQ7A 4IFYA 4DTMA 3TI0A 2QKKA 3HM9A 3SQ1A 4CCHA 3UIQA 4GW6A 1U04A 3IS9A 1GOBA 2Z1GA 1RDBA 4HUEA 4J2AA 3SPZA 4JS4A 1TKDA 1N5YA 3LPTA 3NF9A 3VQEA 3ULDA 2PY5A 4CEZA 4KI4A 3P1GA 3HYFA 3ZSQA 1ZBHA 3V1OA 1HQEA 3ZT0A 1Q9YA 4ELTA 3KLHA 3EY1A 2Y1JA 4HUGA 2XY5A 3AVNA 3KKSA 2XHBA 3RMAA 2OPQA 3AVJA 4JLHA 4IDKA 1DLOA 4M41A 3SZ2A 2KZMA 1N6QA 4JRPA 4LH4A 3V4IA 1VSMA 2DFHA 2YKMA 3QLHA 3QO9A 3CM5A 4CF2A 1LWCA 4CHQA 4IG0A 1U45A 2G8VA 3OYNA 2YNIA 3FFIA 1KRPA 4XIUA 4CEEA 4DLGA 4M3ZA 4CJEA 4CEBA 4DSEA 3RMDA 1UA1A 1NK0A 3RR7A 4FJNA 2P1JA 3OYMA 4FZXC 3NF7A 4OGEA 1Z26A 2P51A 3DRSA 3ASMA 3OYEA 4FLTA 4FK4A 1FKPA 1RBRA 2YNGA 3LP1A 4FLZA 3PX6A 1NJXA 4KAZA 4UQGA 4PQUA 4W5QA 4E89A 1KTQA 4DFPA 1QTMA 2KZZA 1RBVA 4FXDA 4BDZA 3SUPA 1R0AA 2E6LA 3KTQA 3ZT2A 3U3YA 3RR8A 1EP4A 4ELVA 2HVHA 1RDDA 2XY6A 1TKTA 1TAQA 3WNGA 4CGJA 3VA0A 4E7LA 1SL2A 2OYQA 5KGWA 3T1AA 3VQPA 3TABA 3KD5E 3LAKA 1TAUA 1JKHA 4CF0A 5C42A 1CLQA 1SUQA 1HRHA 4CERA 4Z4IA 1BL3A 4HTUA 5CZ1A 4FZZA 1K6YA 2HHVA 1S1WA 4CHNA 4DFKA 1BI4B 4FLYA 4B9UA 3MECA 4ID1A 3U3GA 2Z1IA 1W0HA 2FBXA 3DMJA 4LSNA 4CHOA 4ZHRA 4DTSA 3KK1A 1NJWA 3U6FA 4C8NA 1ASVA 3RWUA 3NE6A 3M8QA 3V9XA 1HJRA 2OPRA 4CFCA 1RDCA 4CIGA 2HHXA 3PO5A 5CZ2A 1NJYA 5CY4A 4MFBA 4N76A 5D3GA 1KLMA 1L3UA 3AVAA 3OYGA 3V9UA 2VG7A 1HYSA 2ATQA 1DTTA 2GV9A 3AVGA 3ZT4A 3L8BA 2IDOA 4KB0A 1ZBLA 3AVIA 4OKJA 3OYBA 1JLCA 3OYDA 3RRHA 4B9LA 2DTUA 4FK0A 4E0DA 3AVCA 3K58A 1S1XA 3CFRA 1TK0A 3H08A 2WONA 4DQPA 4CJKA 5HRSA 5E41A 4AH9A 4KREA 4DF4A 3TARA 3S3NA 3O3GA 2E6MA 4NYNA 3VQQA 1RT1A 2VG5A 3CM6A 3OJUA 4HUFA 3OS2A 2ZD1A 4E7KA 1VK0A 4BWJA 4M45A 3KK2A 4HCBA 1EXQA 1LW2A 3AO5A 4EZ9A 4CK2A 1WSHA 5SWMA 4AHCA 4G1QA 4HVJA 4O44A 4B8CA 4FJ5A 4DG1A 3IG1A 4DMNA 4DU1A 4B3OA 1IKWA 1X9SA 5EU7A 4Z4FA 4FJ9A 4KTZA 3C94A 5T7BA 4DS5A 2YHBA 4DTXA 2BANA 4O55A 4DQIA 3HT3A 4KO0A 2QKBA 1KSPA 2IGIA 3C6TA 3MEEA 3NBPA 3NAEA 4J2DA 4QOZB 2HHQA 1LAVA 4DQQA 3SUQA 2IS3A 3MXIA 3CG7A 4CFAA 2RPIA 3AO4A 3T19A 3LPUA 4CIFA 1TL1A 1BGXT 1LW0A 3AA4A 3B6OA 3M8PA 4DTOA 4ELUA 3L3VA 5C24A 2X78A 2HHSA 3D45A 3PY8A 2HVIA 3OS1A 2NUBA 3AV9A 3TAEA 5DMRA 4KTQA 4H4OA 1IKYA 1XWLA 3LWMA 1QSSA 1NK5A 2DFEA 5J1EA 3AVMA 3OYCA 3NH1A 4O0IA 4FLUA 4E7IA 3QIOA 3SCXA 4KPYA 1XHZA 1MU2A 3K5MA 4CJWA 5I42A 4B9TA 4F2SA 5JS2A 3TR8A 1TV6A 4L8RB 1IG9A 3O4NA 2PYJA 1T8EA 2IOCA 3HSTB 1TK5A 1U4BA 2A1SA 1WSFA 4BE0A 4K8XA 4HHTA 1VSJA 1JLQA 3G0ZA 4CHPA 3DLGA 3ZT3A 3S3OA 2A1RA 1NK4A 3CQ8A 4CECA 3OYLA 4CJ5A 5J2MA 2HNDA 1KFSA 2F8SA 1ASWA 4M3RA 1Y97A 2YKNA 1QE1A 4KI6A 3HVTA 4Q0BA 2BDPA 1JXEA 3MAQA 3ZSZA 3C6UA 4PA1A 4J2BA 2X6NA 2D5RA 3KD1E 3LP3A 2XY8A 1S1TA 3QINA 3JYTA 4KB1A 3VQ8A 4CESA 3NH0A 3SQ0A 2KQ2A 3SPYA 1NOZA 3AVBA 4BDYA 4DFMA 4B08A 2G8HA 1Q8IA 3I0SA 3E01A 3TWHA 5J2QA 1ZBUA 3F9KA 3TAGA 4OLAA 1WNSA 4YNQA 3M8RA 4FJHA 4DTUA 4K8ZA 4M3XA 4E3SA 2GBZA 1SV5A 4RW6A 1U47A 1C1CA 1BIZA 1RCHA 1JL1A 3AVHA 4I2QA 3ALYA 3QEVA 1YTUA 2O4GA 4C8OA 1ZBIA 4NYFA 3AO3A 1S1UA 4AILC 1X1PA 3V81A 1F21A 4CFBA 4DQRA 2E4LA 4O4GA 4DSJA 2VG6A 3DI6A 2JLEA 5KRSA 4LSLA 4LY7A 1J5OA 3HXMA 4H8KA 4W5OA 4W5NA 3DRRA 2ZQBA 3KLFA 2IAJA 4KFBA 4B9NA 3V1QA 4BDPA 1TL3A 1QS4A 4O5BA 4FLVA 2HMIA 3DLHA 1KVBA 3QEWA 3V1RA 1KFDA 4CFDA 4E1NA 4F3OA 4AHVA 4I9QA 2R7YA 2OZMA 3CYMA 4CJQA 3SQ4A 5CYMA 2EX3A 1VSHA 2B4JA 1C0MA 3DRPA 1JLFA 3DLEA 2XY7A 5C25A 1JLBA 1D5AA 1CZ9A 3LDSA 4KV8A 1HMVA 3AVLA 4E7JA 1BQMA 1WSJA 5KRTA 1XC9A 3HPOA 3VQ9A 1EETA 4FJ8A 2HNZA 1NOYA 4YFUA 3L2QA 3HPHA 1C0UA 1I39A 4RW9A 1HPZA 3VA3A 1NK6A 1L5UA 1HQUA 1JLAA 4DTRA 2KFNA 4Y1DA 2Z1HA 1RT6A 3VN5A 3VQ6A 2ZE2A 3HJFA 3NDKA 3LWLA 1RDAA 3NGYA 4M3YA 4CEDA 4CF9A 1NJZA 5HBMA 3SV4A 2D0AA 1G15A 2D0BA 2ETJA 4BE1A 4DSIA 5FRMA 3QESA 1UA0A 3PUFA 4AHRA 4QCLA 3VQAA 1O1WA 1BIUA 3AO1A 1TKXA 3LALA 3ZT1A 3O3HA 3HVRA 1B92A 4QAGA 3V9SA 1CXUA 3DM2A 3IRXA 4RW7A 3PX4A 3NCIA 1NK7A 1X9MA 4Z4EA 4I2PA 3OYKA 1REVA 3OS0A 4FJJA 2FBYA 1RT7A 1QSLA 4N56A 3PV8A 1S6PA 3ZSYA 4M3UA 2VWKA 3OYIA 4ZTJA 3G10A 1RBTA 2JGUA 1J53A 3LP0A 3KLEA 4TSXA 3WNEA 3OYFA 2HNYA 1JLGA 1BQNA 4CF1A 1VSLA 3OYJA 4CGGA 4CEAA 2W42A 3V9WA 1U49A 1SKRA 3OVNA 3TAPA 1TK8A 3QIPA 1JXBA 3ZSVA 3QNNA 3AVKA 3SI6A 1IO2A 3QNOA 3HPGA 4B9MA 4EZ6A 3CFOA 1RT2A 2G8WA 3DOKA 4OJRA 2DY4A 1RTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4G A;  5FRO A;  3TAN A;  1D9F A;  4FM1 A;  1SKS A;  1C0T A;  4DLE A;  1S9E A;  2RF2 A;  3NFA A;  1NKB A;  5KTQ A;  4JRQ A;  1JL2 A;  4NCG A;  4FM2 A;  1SL1 A;  3TAQ A;  3SQ2 A;  3LZI A;  4EP4 A;  3L2W A;  3NHG A;  2F96 A;  3LZJ A;  1J54 A;  1RIL A;  2D0C A;  3DLR A;  3NH2 A;  4N47 A;  4DU3 A;  3OJS A;  4M3W A;  3OY9 A;  3I8D A;  2OPP A;  1A5X A;  2EHG A;  2KFZ A;  4FJG A;  3SUN A;  2LSN A;  3B6P A;  3ZSX A;  3LAM A;  1GOC A;  4CJR A;  1ITG A;  2I5J A;  4CHZ A;  5DK5 A;  5J2P A;  4FVM A;  2X74 A;  3VQB A;  1T7P A;  1GOA A;  3NF8 A;  2HW3 A;  4FCY A;  3QEX A;  3HO1 A;  3M8S A;  1VSI A;  3HK2 A;  4ICL A;  4DTN A;  3QER A;  3I0R A;  1T03 A;  3LP2 A;  4CE9 A;  1SKW A;  1L3T A;  5FRN A;  4HCC A;  2O4I A;  4CJ3 A;  3PO4 A;  4FLX A;  3AA3 A;  4BAC A;  5KGX A;  4PUO A;  1WN7 A;  4OPJ A;  1VSD A;  1U48 A;  3WNH A;  4CJS A;  3QEP A;  4Y1C A;  4CJV A;  1HNV A;  2KW4 A;  5HRP A;  4IBN A;  1B9F A;  4CEF A;  4KKO A;  3MED A;  3K59 A;  4C8K A;  4B9V A;  1FKO A;  4CEO A;  4Q5V A;  2RKI A;  3K5O A;  2X6S A;  4FLW A;  3V9Z A;  5I3U A;  1NK9 A;  5HRN A;  3OYA A;  2QK9 A;  1BHL A;  4DQS A;  2OPS A;  4M3T A;  1LWE A;  3KLI A;  1QSY A;  1VRU A;  2ITG A;  1NK8 A;  3EZ5 A;  3F73 A;  4RW4 A;  1BCO A;  3KLG A;  4OLB A;  2DFF A;  3L2R A;  4IFV A;  1FXX A;  3KIO A;  3O4Q A;  4KHY A;  3AA5 X;  3K5L A;  1BI4 A;  3VQ4 A;  1EKE A;  1RT4 A;  1QQC A;  2FBT A;  4GMJ B;  3OYH A;  3ZSO A;  5HP1 A;  1NKE A;  3L2U A;  1WAJ A;  2VWJ A;  1HNI A;  4N5S A;  2F8T A;  1L3S A;  1FK9 A;  4B9S A;  4ZTF A;  3SV3 A;  3K2P A;  4F8R A;  3L3U A;  4Z0U A;  3NF6 A;  4AHS A;  1KLN A;  1RTJ A;  3RTV A;  4FJI A;  4J2E A;  4CJP A;  4KHS A;  1YTA A;  4O0J A;  4BWM A;  3L2V A;  2GUI A;  1S6Q A;  1WAF A;  1RTH A;  1HYV A;  1TGO A;  4CJ4 A;  3NGI A;  4DSL A;  1KVA A;  1IKX A;  3RMB A;  4OKK A;  3P83 D;  2G8K A;  3IAY A;  3AVF A;  4Z4C A;  3SJJ A;  4CJF A;  2P5G A;  3ZSR A;  4CJL A;  1VSF A;  4DTP A;  3S9H A;  1S5J A;  1XHX A;  2FBV A;  4LD0 A;  4CGD A;  3P5J A;  1LWF A;  1RT3 A;  4FJM A;  2Y1I A;  3VQD A;  4C8L A;  2YNF A;  1BCM A;  4DTJ A;  3WNF A;  1D9D A;  4F2R A;  4FK2 A;  3HL8 A;  4R5P A;  2RN2 A;  1Z25 A;  1I3A A;  4FYD A;  1KVC A;  2HHU A;  4FJX A;  4I9L A;  4NCB A;  1YVU A;  1EX4 A;  3RRG A;  4FZY A;  1S1V A;  4AHT A;  4E19 A;  2Q3S A;  2YNH A;  4Z4H A;  4DSF A;  2HHT A;  5KI6 A;  4E7H A;  3MXJ A;  1CZB A;  3BDP A;  2QXF A;  1ASU A;  3LAN A;  4CGF A;  4E1M A;  4DSK A;  2HHW A;  4M42 A;  4OGC A;  1X9W A;  1C1A A;  2WOM A;  3SNN A;  4DU4 A;  3QEI A;  1IKV A;  1RBS A;  2PYL A;  5CYQ A;  3VQ5 A;  4KTW A;  1B9D A;  2BE2 A;  1LV5 A;  4I7F A;  3PX0 A;  2YHA A;  3K57 A;  4RW8 A;  2G8I A;  2B6A A;  2FC0 A;  4CF8 A;  4DF8 A;  4CK3 A;  1IH7 A;  4PWD A;  2KTQ A;  1CXQ A;  3ZCM A;  4CEQ A;  4MQ3 A;  4DFJ A;  3DLK A;  4ID5 A;  3MXM A;  1BIS A;  1VSE A;  4CGI A;  5HLF A;  4DS4 A;  3DLB A;  4OPK A;  3RMC A;  3CFP A;  4N41 A;  1WSI A;  3HP9 A;  2YV0 X;  4RG8 A;  1C1B A;  4IG3 A;  3ITH A;  1VRT A;  1ZBF A;  3DOL A;  3AA2 A;  5SZT A;  3KK3 A;  1UOC A;  3T3F A;  4KHW A;  1QHT A;  5K14 A;  3ZSW A;  4CK1 A;  2P5O A;  3VQC A;  4EP5 A;  1W9H A;  2AJQ A;  1DTQ A;  4FW1 A;  2HB5 A;  4LH5 A;  3HP6 A;  2OA8 A;  4WE1 A;  2OZS A;  1RNH A;  1S9G A;  3QET A;  3NGZ A;  1WSE A;  1RBU A;  3KKR A;  5J2N A;  3TAF A;  4KHU A;  3THV A;  1WSG A;  4CIE A;  4W5T A;  4FW2 A;  3AO2 A;  4JS5 A;  1L3V A;  4F4K A;  4CJU A;  1A5V A;  4BE2 A;  2B5J A;  1J9A A;  4FJ7 A;  3O3F A;  3A2F A;  1T05 A;  1C6V A;  4B8A B;  2BGG A;  4F3T A;  4PY5 A;  3SUO A;  1ZYQ A;  1KCF A;  3EYZ A;  1D8Y A;  1VSK A;  4CGH A;  5JS1 A;  2PZS A;  4CHY A;  1YT3 A;  4C8M A;  3S3M A;  1RT5 A;  4W5R A;  3MEG A;  3SYZ A;  3BGR A;  2XO7 A;  1XI1 A;  1RTD A;  1LAW A;  4FJK A;  4KHQ A;  1UWB A;  4CJT A;  1SL0 A;  1WLJ A;  1TKZ A;  3KJV A;  1HYZ A;  1UAX A;  1NKC A;  3JSM A;  3DYA A;  2G8U A;  4KRF A;  4OKE A;  5FDL A;  3TAM A;  5HRR A;  2G8F A;  4FJL A;  4GVM A;  3D0P A;  4DWI A;  4FM0 A;  3V6D A;  4IKF A;  2XRI A;  3K5N A;  1A5W A;  5HRO A;  1JLE A;  1TVR A;  4AHU A;  4KHN A;  4NCA A;  4H4M A;  3ISN C;  1Q9X A;  4OVL A;  3C95 A;  2Z1J A;  2IC3 A;  3VQ7 A;  4IFY A;  4DTM A;  3TI0 A;  2QKK A;  3HM9 A;  3SQ1 A;  4CCH A;  3UIQ A;  4GW6 A;  1U04 A;  3IS9 A;  1GOB A;  2Z1G A;  1RDB A;  4HUE A;  4J2A A;  3SPZ A;  4JS4 A;  1TKD A;  1N5Y A;  3LPT A;  3NF9 A;  3VQE A;  3ULD A;  2PY5 A;  4CEZ A;  4KI4 A;  3P1G A;  3HYF A;  3ZSQ A;  1ZBH A;  3V1O A;  1HQE A;  3ZT0 A;  1Q9Y A;  4ELT A;  3KLH A;  3EY1 A;  2Y1J A;  4HUG A;  2XY5 A;  3AVN A;  3KKS A;  2XHB A;  3RMA A;  2OPQ A;  3AVJ A;  4JLH A;  4IDK A;  1DLO A;  4M41 A;  3SZ2 A;  2KZM A;  1N6Q A;  4JRP A;  4LH4 A;  3V4I A;  1VSM A;  2DFH A;  2YKM A;  3QLH A;  3QO9 A;  3CM5 A;  4CF2 A;  1LWC A;  4CHQ A;  4IG0 A;  1U45 A;  2G8V A;  3OYN A;  2YNI A;  3FFI A;  1KRP A;  4XIU A;  4CEE A;  4DLG A;  4M3Z A;  4CJE A;  4CEB A;  4DSE A;  3RMD A;  1UA1 A;  1NK0 A;  3RR7 A;  4FJN A;  2P1J A;  3OYM A;  4FZX C;  3NF7 A;  4OGE A;  1Z26 A;  2P51 A;  3DRS A;  3ASM A;  3OYE A;  4FLT A;  4FK4 A;  1FKP A;  1RBR A;  2YNG A;  3LP1 A;  4FLZ A;  3PX6 A;  1NJX A;  4KAZ A;  4UQG A;  4PQU A;  4W5Q A;  4E89 A;  1KTQ A;  4DFP A;  1QTM A;  2KZZ A;  1RBV A;  4FXD A;  4BDZ A;  3SUP A;  1R0A A;  2E6L A;  3KTQ A;  3ZT2 A;  3U3Y A;  3RR8 A;  1EP4 A;  4ELV A;  2HVH A;  1RDD A;  2XY6 A;  1TKT A;  1TAQ A;  3WNG A;  4CGJ A;  3VA0 A;  4E7L A;  1SL2 A;  2OYQ A;  5KGW A;  3T1A A;  3VQP A;  3TAB A;  3KD5 E;  3LAK A;  1TAU A;  1JKH A;  4CF0 A;  5C42 A;  1CLQ A;  1SUQ A;  1HRH A;  4CER A;  4Z4I A;  1BL3 A;  4HTU A;  5CZ1 A;  4FZZ A;  1K6Y A;  2HHV A;  1S1W A;  4CHN A;  4DFK A;  1BI4 B;  4FLY A;  4B9U A;  3MEC A;  4ID1 A;  3U3G A;  2Z1I A;  1W0H A;  2FBX A;  3DMJ A;  4LSN A;  4CHO A;  4ZHR A;  4DTS A;  3KK1 A;  1NJW A;  3U6F A;  4C8N A;  1ASV A;  3RWU A;  3NE6 A;  3M8Q A;  3V9X A;  1HJR A;  2OPR A;  4CFC A;  1RDC A;  4CIG A;  2HHX A;  3PO5 A;  5CZ2 A;  1NJY A;  5CY4 A;  4MFB A;  4N76 A;  5D3G A;  1KLM A;  1L3U A;  3AVA A;  3OYG A;  3V9U A;  2VG7 A;  1HYS A;  2ATQ A;  1DTT A;  2GV9 A;  3AVG A;  3ZT4 A;  3L8B A;  2IDO A;  4KB0 A;  1ZBL A;  3AVI A;  4OKJ A;  3OYB A;  1JLC A;  3OYD A;  3RRH A;  4B9L A;  2DTU A;  4FK0 A;  4E0D A;  3AVC A;  3K58 A;  1S1X A;  3CFR A;  1TK0 A;  3H08 A;  2WON A;  4DQP A;  4CJK A;  5HRS A;  5E41 A;  4AH9 A;  4KRE A;  4DF4 A;  3TAR A;  3S3N A;  3O3G A;  2E6M A;  4NYN A;  3VQQ A;  1RT1 A;  2VG5 A;  3CM6 A;  3OJU A;  4HUF A;  3OS2 A;  2ZD1 A;  4E7K A;  1VK0 A;  4BWJ A;  4M45 A;  3KK2 A;  4HCB A;  1EXQ A;  1LW2 A;  3AO5 A;  4EZ9 A;  4CK2 A;  1WSH A;  5SWM A;  4AHC A;  4G1Q A;  4HVJ A;  4O44 A;  4B8C A;  4FJ5 A;  4DG1 A;  3IG1 A;  4DMN A;  4DU1 A;  4B3O A;  1IKW A;  1X9S A;  5EU7 A;  4Z4F A;  4FJ9 A;  4KTZ A;  3C94 A;  5T7B A;  4DS5 A;  2YHB A;  4DTX A;  2BAN A;  4O55 A;  4DQI A;  3HT3 A;  4KO0 A;  2QKB A;  1KSP A;  2IGI A;  3C6T A;  3MEE A;  3NBP A;  3NAE A;  4J2D A;  4QOZ B;  2HHQ A;  1LAV A;  4DQQ A;  3SUQ A;  2IS3 A;  3MXI A;  3CG7 A;  4CFA A;  2RPI A;  3AO4 A;  3T19 A;  3LPU A;  4CIF A;  1TL1 A;  1BGX T;  1LW0 A;  3AA4 A;  3B6O A;  3M8P A;  4DTO A;  4ELU A;  3L3V A;  5C24 A;  2X78 A;  2HHS A;  3D45 A;  3PY8 A;  2HVI A;  3OS1 A;  2NUB A;  3AV9 A;  3TAE A;  5DMR A;  4KTQ A;  4H4O A;  1IKY A;  1XWL A;  3LWM A;  1QSS A;  1NK5 A;  2DFE A;  5J1E A;  3AVM A;  3OYC A;  3NH1 A;  4O0I A;  4FLU A;  4E7I A;  3QIO A;  3SCX A;  4KPY A;  1XHZ A;  1MU2 A;  3K5M A;  4CJW A;  5I42 A;  4B9T A;  4F2S A;  5JS2 A;  3TR8 A;  1TV6 A;  4L8R B;  1IG9 A;  3O4N A;  2PYJ A;  1T8E A;  2IOC A;  3HST B;  1TK5 A;  1U4B A;  2A1S A;  1WSF A;  4BE0 A;  4K8X A;  4HHT A;  1VSJ A;  1JLQ A;  3G0Z A;  4CHP A;  3DLG A;  3ZT3 A;  3S3O A;  2A1R A;  1NK4 A;  3CQ8 A;  4CEC A;  3OYL A;  4CJ5 A;  5J2M A;  2HND A;  1KFS A;  2F8S A;  1ASW A;  4M3R A;  1Y97 A;  2YKN A;  1QE1 A;  4KI6 A;  3HVT A;  4Q0B A;  2BDP A;  1JXE A;  3MAQ A;  3ZSZ A;  3C6U A;  4PA1 A;  4J2B A;  2X6N A;  2D5R A;  3KD1 E;  3LP3 A;  2XY8 A;  1S1T A;  3QIN A;  3JYT A;  4KB1 A;  3VQ8 A;  4CES A;  3NH0 A;  3SQ0 A;  2KQ2 A;  3SPY A;  1NOZ A;  3AVB A;  4BDY A;  4DFM A;  4B08 A;  2G8H A;  1Q8I A;  3I0S A;  3E01 A;  3TWH A;  5J2Q A;  1ZBU A;  3F9K A;  3TAG A;  4OLA A;  1WNS A;  4YNQ A;  3M8R A;  4FJH A;  4DTU A;  4K8Z A;  4M3X A;  4E3S A;  2GBZ A;  1SV5 A;  4RW6 A;  1U47 A;  1C1C A;  1BIZ A;  1RCH A;  1JL1 A;  3AVH A;  4I2Q A;  3ALY A;  3QEV A;  1YTU A;  2O4G A;  4C8O A;  1ZBI A;  4NYF A;  3AO3 A;  1S1U A;  4AIL C;  1X1P A;  3V81 A;  1F21 A;  4CFB A;  4DQR A;  2E4L A;  4O4G A;  4DSJ A;  2VG6 A;  3DI6 A;  2JLE A;  5KRS A;  4LSL A;  4LY7 A;  1J5O A;  3HXM A;  4H8K A;  4W5O A;  4W5N A;  3DRR A;  2ZQB A;  3KLF A;  2IAJ A;  4KFB A;  4B9N A;  3V1Q A;  4BDP A;  1TL3 A;  1QS4 A;  4O5B A;  4FLV A;  2HMI A;  3DLH A;  1KVB A;  3QEW A;  3V1R A;  1KFD A;  4CFD A;  4E1N A;  4F3O A;  4AHV A;  4I9Q A;  2R7Y A;  2OZM A;  3CYM A;  4CJQ A;  3SQ4 A;  5CYM A;  2EX3 A;  1VSH A;  2B4J A;  1C0M A;  3DRP A;  1JLF A;  3DLE A;  2XY7 A;  5C25 A;  1JLB A;  1D5A A;  1CZ9 A;  3LDS A;  4KV8 A;  1HMV A;  3AVL A;  4E7J A;  1BQM A;  1WSJ A;  5KRT A;  1XC9 A;  3HPO A;  3VQ9 A;  1EET A;  4FJ8 A;  2HNZ A;  1NOY A;  4YFU A;  3L2Q A;  3HPH A;  1C0U A;  1I39 A;  4RW9 A;  1HPZ A;  3VA3 A;  1NK6 A;  1L5U A;  1HQU A;  1JLA A;  4DTR A;  2KFN A;  4Y1D A;  2Z1H A;  1RT6 A;  3VN5 A;  3VQ6 A;  2ZE2 A;  3HJF A;  3NDK A;  3LWL A;  1RDA A;  3NGY A;  4M3Y A;  4CED A;  4CF9 A;  1NJZ A;  5HBM A;  3SV4 A;  2D0A A;  1G15 A;  2D0B A;  2ETJ A;  4BE1 A;  4DSI A;  5FRM A;  3QES A;  1UA0 A;  3PUF A;  4AHR A;  4QCL A;  3VQA A;  1O1W A;  1BIU A;  3AO1 A;  1TKX A;  3LAL A;  3ZT1 A;  3O3H A;  3HVR A;  1B92 A;  4QAG A;  3V9S A;  1CXU A;  3DM2 A;  3IRX A;  4RW7 A;  3PX4 A;  3NCI A;  1NK7 A;  1X9M A;  4Z4E A;  4I2P A;  3OYK A;  1REV A;  3OS0 A;  4FJJ A;  2FBY A;  1RT7 A;  1QSL A;  4N56 A;  3PV8 A;  1S6P A;  3ZSY A;  4M3U A;  2VWK A;  3OYI A;  4ZTJ A;  3G10 A;  1RBT A;  2JGU A;  1J53 A;  3LP0 A;  3KLE A;  4TSX A;  3WNE A;  3OYF A;  2HNY A;  1JLG A;  1BQN A;  4CF1 A;  1VSL A;  3OYJ A;  4CGG A;  4CEA A;  2W42 A;  3V9W A;  1U49 A;  1SKR A;  3OVN A;  3TAP A;  1TK8 A;  3QIP A;  1JXB A;  3ZSV A;  3QNN A;  3AVK A;  3SI6 A;  1IO2 A;  3QNO A;  3HPG A;  4B9M A;  4EZ6 A;  3CFO A;  1RT2 A;  2G8W A;  3DOK A;  4OJR A;  2DY4 A;  1RTI A; 
#chains in the Genus database with same CATH topology
 3TAN A;  2P9N A;  1SKS A;  3P39 A;  1S9E A;  2RF2 A;  3NFA A;  1NKB A;  5EVZ A;  4FM2 A;  4H5N A;  1HPM A;  5AQP A;  1YJN N;  3FFK B;  4EP4 A;  3NHG A;  2F96 A;  3D2F A;  3LZJ A;  3A5N C;  4A5A A;  3N4Q A;  3OY9 A;  5EXW A;  3SMS A;  3SUN A;  2NRZ A;  1JCG A;  3LAM A;  1N36 K;  5A2Q O;  1T7P A;  2X74 A;  2V52 B;  3WQT A;  3LDQ A;  3HO1 A;  4BVO A;  3QER A;  2O4I A;  3LP2 A;  1L3T A;  3MDQ A;  4FPB A;  5F1X A;  3E66 A;  5KGX A;  3THY A;  1U48 A;  1N6Q A;  1ILY A;  5ELZ A;  4IBN A;  4CEF A;  4WFN L;  4KKO A;  3K59 A;  1FW6 A;  4WCE L;  4C8K A;  2RKI A;  1NM1 A;  4MO4 A;  4M3T A;  2OPS A;  3KLI A;  4X66 K;  2ITG A;  3EZ5 A;  4RW4 A;  1BCO A;  2DFF A;  4DV6 K;  3J8A A;  1FXX A;  1NMN A;  3KIO A;  3LM9 A;  4X62 K;  5AQR A;  2Q97 A;  2FXU A;  3VQ4 A;  4ZTF A;  1RT4 A;  1QQC A;  3OYH A;  1NKE A;  3SV3 A;  4Z0U A;  4CJP A;  4BWM A;  4O0J A;  2GUI A;  1S6Q A;  2V7Y A;  1WUA A;  1HYV A;  4OKK A;  2G8K A;  3IAY A;  2FBV A;  4CGD A;  1YJW N;  1LWF A;  4YDU C;  1EQY A;  1BCM A;  2ASM A;  2UYT A;  3WNF A;  1I3A A;  5LMN K;  1KVC A;  4GV3 A;  2HHU A;  1QVG M;  1YVU A;  2DPN A;  5AQZ A;  2EWS A;  4AHT A;  4E19 A;  3O9S A;  4DSF A;  2HHT A;  3MXJ A;  3BDP A;  3LAN A;  4K0K K;  1BO5 O;  4DR7 K;  4OGC A;  4LF4 K;  1GLB G;  5BR9 A;  1IKV A;  2PYL A;  4KTW A;  3K9K A;  3CCE N;  4RW8 A;  3M6G A;  2FC0 A;  4PWD A;  4WQ4 C;  4MQ3 A;  4DFJ A;  1VSE A;  4CGI A;  1VQP N;  4OPK A;  3R1X A;  2ZGZ A;  4IG3 A;  3CCQ N;  1VRT A;  3KK3 A;  1T3V A;  2RE2 A;  1UOC A;  2P5O A;  5JVH L;  1HUX A;  2AJQ A;  4LH5 A;  4FW1 A;  4CBW A;  1S9G A;  3KKR A;  4B3M K;  3NVK A;  3AO2 A;  1W7A A;  4F4K A;  1A5V A;  4BE2 A;  2B5J A;  1T05 A;  4F3T A;  1C6V A;  4BQZ A;  1ZYQ A;  1VSK A;  4ILG B;  4CGH A;  1YT3 A;  1K9M O;  4C8M A;  3S3M A;  1RT5 A;  1MWK A;  4W5R A;  5H1S Q;  1RTD A;  2O8D B;  3VGK A;  4JI3 K;  1TKZ A;  4LF5 K;  1HR0 K;  5HRR A;  3FZK A;  4FJL A;  4IEI A;  4GVM A;  4LFA K;  2XRI A;  3J7Y P;  1OVQ A;  4H4M A;  1Q9X A;  3VQ7 A;  4DTM A;  2QKK A;  3TI0 A;  3UIQ A;  3SQ1 A;  3VF6 A;  4GW6 A;  1U04 A;  3KK7 A;  2Z1G A;  4CI6 A;  2P9L A;  3SPZ A;  3QFU A;  3NF9 A;  4HWI A;  4WQ4 A;  4KI4 A;  3HYF A;  3V1O A;  3CET A;  3KLH A;  5LJV A;  1NGC A;  2XY5 A;  4B3R K;  3CJ1 A;  4MLE A;  1W2B M;  3AVJ A;  5AQO A;  2DFH A;  3G25 A;  2YKM A;  3QLH A;  4BG8 A;  3E9P A;  2W6K A;  3JXU A;  4DR6 K;  3CER A;  1DT9 A;  3OYN A;  4XIU A;  4BGB A;  2FSK A;  4FJN A;  3TPQ A;  5AQM A;  2P1J A;  5GIN A;  4FZX C;  1Z26 A;  4H0T B;  5M1K A;  4DV3 K;  4FLZ A;  3PX6 A;  1VQ9 N;  3A5M C;  4PQU A;  4W5Q A;  1KTQ A;  1QTM A;  2HMP A;  1QVF M;  3FZL A;  2UUB K;  3ZT2 A;  2W6L A;  4ELV A;  2HVH A;  1TKT A;  4A5B A;  3WNG A;  4CGJ A;  5AQW A;  4DV2 K;  3VQP A;  3KD5 E;  3LAK A;  1JKH A;  1U2V B;  1RFQ A;  1CZA N;  4CER A;  4Z4I A;  1BA0 A;  4B1W B;  4HTU A;  4FZZ A;  2NRV A;  4BRI A;  3I56 N;  4KH5 A;  4A62 A;  4CHN A;  1VQ6 N;  4B9U A;  2Z1I A;  1W0H A;  3VER A;  4DTS A;  3K9J A;  1KAZ A;  1NJW A;  4C8N A;  3RWU A;  2VGM A;  1N32 K;  3V9X A;  3BZK A;  5CZ2 A;  5CY4 A;  1HYS A;  2ATQ A;  1DTT A;  2YHW A;  4OKJ A;  2IVN A;  1JLC A;  3PIP L;  1J5E K;  2WON A;  1VQ4 N;  5E41 A;  4B3S K;  4YOY A;  4WF9 L;  4KRE A;  3DXK B;  3IFR A;  3S3N A;  4OO1 J;  3ZLJ A;  3OS2 A;  5AQN A;  1SZ2 A;  3MN9 A;  1EXQ A;  4EZ9 A;  4FJ5 A;  1G99 A;  3IG1 A;  4DMN A;  4DV0 K;  2VQF K;  3WT0 A;  4BRC A;  2IGI A;  3C6T A;  4QOZ B;  2HHQ A;  2O8E A;  2IS3 A;  3MXI A;  4DV4 K;  3CG7 A;  2QEX N;  3AO4 A;  4K25 A;  3T19 A;  3VGM A;  3AA4 A;  3D2E A;  5AZJ A;  3PY8 A;  3ATU A;  5AJ3 K;  2F9W A;  1VQ8 N;  1IKY A;  2ITM A;  4IO9 L;  1NK5 A;  4K41 A;  2DFE A;  3AVM A;  4ISE A;  2A42 A;  4FLU A;  3SCX A;  2JWK A;  3C7N A;  1XHZ A;  4CJW A;  1TV6 A;  1ZBS A;  3VEO A;  4BRF A;  1IG9 A;  3O4N A;  4L8R B;  2IOC A;  1IV0 A;  1IJJ A;  1TYQ B;  1WSF A;  4BE0 A;  1HNZ K;  3I33 A;  4OX9 K;  3DLG A;  3ZT3 A;  5AQK A;  2A1R A;  3CQ8 A;  1KFS A;  2HND A;  2F8S A;  1YF5 L;  1YIT N;  3HVT A;  4Q0B A;  3ZSZ A;  4WFB L;  4YHH K;  3MWT A;  2XY8 A;  3QIN A;  4DB3 A;  4YOX A;  5GIO A;  3SPY A;  4BDY A;  4B08 A;  3I0S A;  4KHP K;  3TWH A;  5J2Q A;  1WNS A;  3MMV A;  3U9Z A;  1E3M A;  5AQL A;  4K8Z A;  4IJA A;  2GBZ A;  1SV5 A;  4H5W A;  3AVH A;  3ALY A;  5AFU H;  1YTU A;  3C0B A;  4C8O A;  5AQJ A;  4A57 A;  1X1P A;  3MCP A;  3V81 A;  2GX9 A;  4CFB A;  2JLE A;  4NB4 A;  5KRS A;  3CI5 A;  4LY7 A;  2FF6 A;  3HXM A;  4FL9 A;  4H8K A;  3JAM O;  2QWN A;  3DRR A;  3O80 A;  4FO0 A;  3KLF A;  4KFB A;  4OPA A;  4DR3 K;  1Q18 A;  3H6E A;  1DGK N;  4FLV A;  1MWM A;  1KVB A;  4F3O A;  2CGL A;  3TSQ A;  3CYM A;  3SQ4 A;  1VQN N;  2QXL A;  1VSH A;  3FZF A;  4ISG A;  4BR5 A;  1D5A A;  3AVL A;  3WUH A;  1BQM A;  5KRT A;  4FJ8 A;  1EET A;  4YFU A;  3L2Q A;  1C0U A;  4DTR A;  2KFN A;  3WXI A;  4Y1D A;  2BH1 A;  4FSV A;  3HJF A;  4DV7 K;  3LWL A;  1HKC A;  3NGY A;  2A5X A;  5M1Q A;  2IVO A;  1NJZ A;  3SV4 A;  2D0B A;  4BE1 A;  4CW7 B;  1C0F A;  1ATN A;  2P9P B;  4QCL A;  1O1W A;  2P9S B;  2HOE A;  3AO1 A;  3R9P A;  4DUY K;  3FE1 A;  3HVR A;  3SAH A;  4Z4E A;  3IRX A;  4RW7 A;  3PX4 A;  3NCI A;  4I2P A;  3OYK A;  3IKM A;  1REV A;  3OS0 A;  4FJJ A;  3VF4 A;  2FBY A;  2E2N A;  4KH4 A;  3SLC A;  2BTF A;  4ZTJ A;  4TSX A;  3WNE A;  1VSL A;  1SKR A;  2W42 A;  3TAP A;  4DCH A;  2E2P A;  1RTI A;  3ULE A;  3ID8 A;  4FM1 A;  4QS8 A;  4CJ7 A;  1C0T A;  3QB0 A;  4B1V A;  4NCG A;  3MN5 A;  1WBB A;  3L2W A;  3A0I X;  3UKU B;  2D0C A;  3DLR A;  2J4R A;  3THW A;  4M3W A;  2KFZ A;  2OPP A;  1A5X A;  3LDP A;  2QWQ A;  3ZSX A;  3MN7 A;  1ITG A;  2I5J A;  4FVM A;  1GOA A;  3KWI A;  5BPM A;  1SKW A;  3I0R A;  4IXC A;  1T03 A;  4CE9 A;  4HCC A;  2E1Z A;  4CJ3 A;  4BAC A;  3VTI A;  4CJS A;  3QEP A;  4Y1C A;  2KW4 A;  4OPH A;  4B9V A;  2GTD A;  3K5O A;  3ID6 A;  4JKE A;  2QK9 A;  2KZM A;  3CXC M;  1BHL A;  1LWE A;  1QSY A;  2P9K B;  1VRU A;  4EAH D;  1GLE G;  2O8B A;  2RHK A;  4YOR A;  5FPD A;  3L2R A;  5LMU K;  4IFV A;  5BPN A;  4KHY A;  4FPA A;  1BI4 A;  5HP1 A;  3LM2 A;  4JV5 K;  3L2U A;  1WAJ A;  1P8Z A;  5JIC A;  1L3S A;  3K2P A;  4F8R A;  4AHS A;  4J2E A;  3GOI A;  4EIA A;  3RTV A;  1WAF A;  4Z94 A;  4CJ4 A;  4DSL A;  2QA4 N;  1IKX A;  4H5T A;  3UKR B;  4CJF A;  1VSF A;  1S5J A;  1XHX A;  3P5J A;  2Y1I A;  4C8L A;  3U9D A;  1SQK A;  1E4F T;  3ZX3 A;  1ATR A;  5AZI A;  1Z6R A;  1HKB A;  5ADX H;  3CCM N;  4CZJ A;  3VTH A;  3CHW A;  1E4G T;  1C1A A;  2WOM A;  1GLD G;  1RBS A;  5CYQ A;  3VQ5 A;  4BRA A;  2OAN A;  4RCH A;  4DR2 K;  4CK3 A;  2KTQ A;  4M7Y A;  3ZCM A;  3DLK A;  5HLF A;  3DXM B;  4DS4 A;  1T44 A;  1NLV A;  3GL1 A;  4CVN E;  1HJO A;  3DLB A;  3QDK A;  1WSI A;  2YV0 X;  2F7T A;  1NGJ A;  1TUY A;  1ZBF A;  4H0Y B;  1XUP O;  4BR2 A;  5AQQ A;  4WE1 A;  3H1V X;  4IEE A;  1RBU A;  5AFU A;  5J2N A;  4YOU A;  1BUP A;  3A2F A;  2BGG A;  4B8A B;  5DM7 L;  2PZS A;  4IOA L;  2NRR A;  3BGR A;  4KHQ A;  5KPZ A;  4JKD A;  3PIO L;  1WLJ A;  4NO7 A;  1HYZ A;  3IDH A;  3JSM A;  4KRF A;  2CGJ A;  4M7X A;  5AQU A;  3P38 A;  4DWI A;  3K5N A;  1A5W A;  5HRO A;  1JLE A;  1TVR A;  4H5R A;  3ISN C;  3NVM A;  2AA4 A;  2KLA A;  4C1N I;  3U8X A;  4WQ5 A;  4FWQ A;  2Q0U A;  3IS9 A;  1YIJ N;  4HUE A;  3A5O C;  2D1K A;  2PY5 A;  4CEZ A;  2V51 B;  4HUG A;  2P9N B;  2UXB K;  3AVN A;  4A2A A;  2XHB A;  3THX A;  1EWQ A;  2O8F A;  3F2K A;  4JRP A;  3O9Q A;  3D2F B;  2YNI A;  3FFI A;  4DLG A;  4M3Z A;  4CJE A;  1NK0 A;  1UA1 A;  1DKG D;  2GWJ A;  5BN8 A;  4PKG A;  1NGI A;  3EE9 A;  3HSC A;  4KAZ A;  1IBM K;  4DFP A;  4BDZ A;  3THY B;  1R0A A;  2E6L A;  3KTQ A;  3CQX A;  3U3Y A;  1RDD A;  2XY6 A;  4BRN A;  1SL2 A;  3CF5 L;  5KGW A;  3TAB A;  3L4Q A;  5M1O A;  1CLQ A;  1HRH A;  3OHR A;  3WQU A;  1JCF A;  1S1W A;  4DFK A;  3MEC A;  4JD2 B;  1QQM A;  2FBX A;  1YJ9 N;  3DMJ A;  4ZHR A;  5F0X A;  3NE6 A;  4B1X B;  1HJR A;  2OPR A;  4CIG A;  1RDC A;  4IJN A;  3PO5 A;  3WEE A;  4N76 A;  4U67 L;  5BRH A;  3O5B A;  4GNI A;  3MX5 A;  3AVA A;  3OYG A;  3V9U A;  4IDH A;  4B3T K;  2GV9 A;  1ZBL A;  5BN9 A;  3AVI A;  2DTU A;  4B9L A;  1NGG A;  3EKU A;  4BRK A;  4FK0 A;  4E0D A;  1NGH A;  3CFR A;  3CC2 N;  4CJK A;  4PL7 A;  2A41 A;  4CZI A;  3TAR A;  4H0P A;  4FWP A;  4NYN A;  3ENH A;  3VQQ A;  3CM6 A;  1GLC G;  4HCB A;  4ISF A;  4CK2 A;  5SWM A;  4AHC A;  5AQT A;  4DG1 A;  1RGI A;  3ZX2 A;  4DU1 A;  1IKW A;  2NLX A;  4Z4F A;  4JHD A;  4DS5 A;  4BR9 A;  4DTX A;  4DQI A;  2QKB A;  3HT3 A;  3I55 N;  4MLH A;  3MEE A;  3NAE A;  4J2D A;  1LAV A;  2QWR A;  4HTL A;  4DQQ A;  3SUQ A;  4CFA A;  1YXQ A;  2RPI A;  4JKG A;  4CIF A;  4ELU A;  3M8P A;  4JN4 A;  3L3V A;  5C24 A;  2HHS A;  2Q31 A;  2NUB A;  1KC8 O;  5DMR A;  1NNE A;  1XWL A;  1K8K A;  4IZ9 A;  4BRM A;  3LWM A;  5AQV A;  3NH1 A;  1MU2 A;  5ADX A;  5I42 A;  4FWK A;  5FPM A;  2V7Z A;  3U4L A;  2PYJ A;  1T8E A;  3BF3 A;  2VQE K;  1IG8 A;  1V4T A;  3SAG A;  2HF3 A;  4HHT A;  1JLQ A;  1BOT O;  4CHP A;  1EO1 A;  3OTO K;  4O5F A;  4CJ5 A;  1DEJ A;  3H45 C;  1ASW A;  1Y97 A;  2YKN A;  2BDP A;  3ENO A;  4FWO A;  3LDN A;  5FPN A;  4J2B A;  1W97 L;  2D5R A;  4KB1 A;  3PLA A;  3JYT A;  3VQ8 A;  3NH0 A;  3RSE A;  1NOZ A;  4OLA A;  3TAG A;  5JVG L;  4YNQ A;  3M8R A;  4DTU A;  1U2V A;  1I94 K;  1Q86 O;  3TTC A;  1BIZ A;  4I2Q A;  2O8C A;  1Q81 O;  4DR5 K;  1ZBI A;  2QWL A;  1S1U A;  3VEY A;  3HM8 A;  1F21 A;  3OBY A;  2E4L A;  5HL7 L;  4XH5 A;  2VG6 A;  3G71 N;  4LF7 K;  4LSL A;  5KPT A;  5AQI A;  4W5O A;  4W5N A;  2ZQB A;  4B9N A;  4IWV A;  1GLJ O;  4BDP A;  4O5B A;  3QEW A;  4BR0 A;  1SAZ A;  4YOT A;  4CFD A;  2HF4 A;  4EHT A;  4AHV A;  3WXJ A;  2R7Y A;  1P90 A;  2OZM A;  5CYM A;  2EX3 A;  4AF1 A;  1C0M A;  2NRH A;  4B1U B;  3DRP A;  1JLF A;  3DLE A;  3MWP A;  5E26 A;  4E7J A;  3LDS A;  1HMV A;  4LC9 B;  1Q82 O;  2HNZ A;  4JNE A;  2HHH K;  4RW9 A;  1HPZ A;  2D0O A;  1NK6 A;  2I7N A;  2PBD A;  2ZE2 A;  3NDK A;  4M3Y A;  4CED A;  4BRE A;  2HST A;  3PSI A;  1KAY A;  5FRM A;  2FSN A;  2YJE A;  3ZET A;  3J7Z O;  1VQK N;  3O3H A;  1B92 A;  3DM2 A;  1X9M A;  4H03 B;  3VEW A;  4H0O A;  2E88 A;  4N56 A;  3PV8 A;  3SMP A;  1IBL K;  4M3U A;  3EZW A;  3G10 A;  4I6M A;  1NGB A;  3LP0 A;  1QZ5 A;  1MDU B;  1JLG A;  3OYJ A;  3J7A P;  3V9W A;  1JXB A;  3SI6 A;  3QNN A;  4FXD A;  3D7E O;  3HPG A;  4FWL A;  4EZ6 A;  1RT2 A;  5EOY A;  3TTF A;  4OJR A;  4BGA A;  3N4P A;  2Q0R A;  3T69 A;  5FPE A;  1D9F A;  3W0L A;  4LFC K;  4DLE A;  5KTQ A;  4JRQ A;  1JL2 A;  3TAQ A;  3SQ2 A;  3LZI A;  5GIP A;  3L6Q A;  4N47 A;  4DU3 A;  3OJS A;  4JI5 K;  2A6A A;  4BC4 A;  3TTD A;  5C0Y A;  2QWO A;  1GOC A;  5TKW A;  4CHZ A;  1RDW X;  3KVG A;  3F9M A;  3NF8 A;  2HW3 A;  4FCY A;  3SK3 A;  4ICL A;  5FRN A;  1T6D A;  1YI2 N;  3PO4 A;  4EHU A;  4PUO A;  1WN7 A;  1X3M A;  1VSD A;  3WNH A;  5HRP A;  1HNV A;  5AQH A;  1OH8 A;  1FKO A;  4MO5 A;  4Q5V A;  3D2E B;  2W41 A;  3V9Z A;  5I3U A;  5AZJ B;  1NK9 A;  5HRN A;  3OYA A;  4M63 C;  3MN6 A;  1NK8 A;  3F73 A;  3C7N B;  3O4Q A;  4H0X B;  3AA5 X;  3K5L A;  1OVY A;  5B8H A;  4WYB A;  4MDA A;  2OTL N;  1HNI A;  4N5S A;  2F8T A;  4FJI A;  3NF6 A;  1KLN A;  4CBU A;  3TU5 A;  1YTA A;  2ASO A;  4IOC L;  3P4I A;  4BRL A;  2ASP A;  1RTH A;  2GEL A;  4H0V B;  1TGO A;  1KVA A;  3RMB A;  4CBX A;  3AVF A;  2P9U A;  4Z4C A;  3SJJ A;  2P5G A;  4DTP A;  4CJL A;  3S9H A;  4NLC A;  4LD0 A;  1XMO K;  4FJM A;  1XNQ K;  2YNF A;  1D9D A;  4F2R A;  3AAR A;  4FK2 A;  3HL8 A;  2RN2 A;  4KH6 A;  4I9L A;  1NBW A;  5JLH A;  4NCB A;  5GAE P;  2WUS A;  4F9O A;  2KKZ A;  3RRG A;  3EE8 A;  4FZY A;  4H5V A;  4Z4H A;  3D6R A;  2YNH A;  4J8F A;  4E7H A;  3ZEU B;  1CZB A;  1ASU A;  4DSK A;  2HHW A;  1X9W A;  3SNN A;  3MK6 A;  4JI7 K;  5TKY A;  1B9D A;  1LV5 A;  4ILJ A;  4PKH A;  1BG3 A;  4I7F A;  3PX0 A;  4L3Q A;  3K57 A;  2G8I A;  2B6A A;  3VMF B;  4CF8 A;  4CZF A;  1CXQ A;  4IFE A;  4CEQ A;  2OTJ N;  5C2F A;  3MXM A;  1BIS A;  3RMC A;  4N41 A;  3E9L A;  3HP9 A;  4JAX A;  4RG8 A;  3PSF A;  3ITH A;  2QWP A;  3O9U A;  5AQS A;  3AA2 A;  5JLF A;  3T3F A;  2AP1 A;  1QHT A;  4CK1 A;  3VQC A;  1S22 A;  3CMA N;  2VGN A;  1K8A O;  1W9H A;  2OZS A;  1RNH A;  3QET A;  1WSE A;  1VHX A;  4KHU A;  3CJ7 A;  3AGK A;  3AGR A;  1WSG A;  4CIE A;  3P31 A;  4JS5 A;  1L3V A;  4CJU A;  4Y0W A;  1XNR K;  1R59 O;  1J9A A;  3GG4 A;  3O9T A;  3O3F A;  3O6W A;  4PY5 A;  3EYZ A;  2E2Q A;  5JS1 A;  4CHY A;  4DUZ K;  1S72 N;  3MEG A;  3SYZ A;  2XO7 A;  4JKF A;  4FJK A;  3CJB A;  1SL0 A;  1UAX A;  1NKC A;  3KHY A;  3R6M A;  2E2O A;  1GLF O;  4FWS A;  3D0P A;  4FM0 A;  3V6D A;  4X64 K;  4BVP A;  4DQ8 A;  3AAP A;  4NCA A;  3NMU A;  3WXL A;  3C95 A;  4IFY A;  1NGE A;  3H3O B;  4BC3 A;  1GOB A;  4J2A A;  4O8K A;  4JS4 A;  2IIR A;  3LPT A;  4YOW A;  4XH1 A;  5LJW A;  1N8R O;  1WOQ A;  3ULD A;  3QBX A;  2WFB A;  3P1G A;  1ZBH A;  3B8A X;  3ZT0 A;  4LF6 K;  3ULE B;  2IVP A;  4JI1 K;  1Q9Y A;  3DAW A;  3EY1 A;  2Y1J A;  3RMA A;  2OPQ A;  4JLH A;  4EFH A;  1DLO A;  4M41 A;  2HBM A;  4LH4 A;  3V4I A;  1VSM A;  4FWM A;  4BRG A;  1LWC A;  4QS7 A;  3THW B;  4CHQ A;  1U45 A;  2G8V A;  3SAF A;  3BUZ B;  1KRP A;  4CEE A;  2BUP A;  2Q1N A;  2D4W A;  3RMD A;  1ATS A;  3OYM A;  4B1Y B;  5KPR A;  1JCE A;  1X9J A;  2Q36 A;  2A40 A;  3ASM A;  5C2D A;  4FLT A;  1RBR A;  3LP1 A;  1U6Z A;  4UQG A;  4CZM A;  4E89 A;  2GWK A;  1N33 K;  4B9Q A;  1YVN A;  3UE5 A;  3CC4 N;  4QS9 A;  3RR8 A;  1EP4 A;  3EO3 A;  3VA0 A;  4JKH A;  1QHA A;  4E7L A;  2OCE A;  2OYQ A;  4JKC A;  1TAU A;  5C42 A;  4CF0 A;  3L0Q A;  3H1Q A;  2O8B B;  3CJA A;  3BEX A;  5CZ1 A;  5EX5 A;  1K6Y A;  4WQ5 C;  2ZJR L;  2HHV A;  1BI4 B;  3CCS N;  4LSN A;  4CHO A;  3HOS A;  2P9I A;  3EL2 A;  1ASV A;  4ILH A;  5C15 A;  2HHX A;  3LDO A;  1KLM A;  3VET A;  1L3U A;  3HRG A;  3M1F A;  3BY5 A;  3ZT4 A;  4KB0 A;  2IDO A;  5CR4 A;  3OYB A;  5C10 A;  4BC5 A;  3SBG A;  3H08 A;  4DQP A;  5KQD A;  4DF4 A;  4DV5 K;  3O3G A;  2E6M A;  3G4S N;  3KWG A;  3OJU A;  4HUF A;  2NRT A;  1LCU A;  5AZI B;  4E7K A;  1OH5 A;  1VK0 A;  4BWJ A;  4M45 A;  1LOT B;  4BC2 A;  1LW2 A;  3AO5 A;  3J81 O;  4G1Q A;  4O44 A;  4B3O A;  1X9S A;  5EU7 A;  4JI4 K;  2BAN A;  3C6A A;  4O55 A;  4KO0 A;  1KSP A;  3NBP A;  4CD3 A;  1HX1 A;  4AM6 A;  5GAG P;  1TL1 A;  1BGX T;  3B6O A;  4LF9 K;  3FZH A;  4DTO A;  3K0S A;  3G6E N;  3D45 A;  3AV9 A;  4KTQ A;  3HI0 A;  4H4O A;  1T6C A;  3FGU A;  3T7Z A;  2E1Y A;  4KPY A;  3QIO A;  3TSP A;  4B9T A;  3O08 A;  3QBW A;  3HST B;  3CCL N;  1TK5 A;  4K8X A;  2I7P A;  5F2R A;  3S3O A;  3H3N O;  4CEC A;  5J2M A;  3CD6 N;  1EWR A;  1QE1 A;  4NXN K;  3MAQ A;  1VAZ A;  3VEZ A;  5GAD P;  2X6N A;  1V4S A;  3LP3 A;  1NMD A;  2YI1 A;  4U7B A;  3AVB A;  4DFM A;  1Q8I A;  3E01 A;  1ZBU A;  2YCH A;  1NGD A;  4FJH A;  4M3X A;  1BWF O;  4E3S A;  3SBT A;  1C1C A;  1RCH A;  5MLC Q;  4NYF A;  2CH5 A;  4JD2 A;  2PFU A;  4DSJ A;  2W40 A;  3DI6 A;  4A61 A;  1J5O A;  1FJG K;  5C12 A;  1M90 O;  2ZF5 O;  3VPZ A;  2UUA K;  2IAJ A;  3V1Q A;  1TL3 A;  2HMI A;  3THX B;  3V1R A;  1KFD A;  4E1N A;  4BRD A;  4I9Q A;  2O8F B;  2F4V K;  2NRX A;  3O9R A;  2CGK A;  2HBL A;  3O1W A;  1JLB A;  3R3L A;  3I8B A;  4KV8 A;  1NGF A;  3VQ9 A;  1I39 A;  3VA3 A;  1L5U A;  2Z1H A;  1RT6 A;  3VN5 A;  3VQ6 A;  1RDA A;  3JS6 A;  4K43 A;  1NWK A;  4KBO A;  4CF9 A;  5HBM A;  4GY2 B;  1G15 A;  2ETJ A;  1QZ6 A;  3QES A;  2O8D A;  1UA0 A;  3Q7C A;  4AHR A;  3VQA A;  1BIU A;  4FVU A;  1XQS C;  3ZT1 A;  1O13 A;  1NK7 A;  3VF2 A;  5DM6 L;  4PL8 A;  3DLL L;  2VCP A;  4FWR A;  4MDB A;  4BRO A;  1S6P A;  5AQG A;  1RBT A;  1J53 A;  3CIP A;  3OYF A;  1VQ7 N;  1BQN A;  4CF1 A;  4CGG A;  4CEA A;  4DR4 K;  1U49 A;  3OVN A;  3ZSV A;  4CZL A;  3WEE B;  4Z4G A;  5FRO A;  1GLL O;  5E84 A;  1SL1 A;  4CZE A;  4JI6 K;  1VQL N;  2E20 A;  2QWM A;  4YDU A;  3R8E A;  3FR0 A;  1J54 A;  1RIL A;  3NH2 A;  4DKW A;  3W3D A;  3I8D A;  2EHG A;  4FJG A;  2LSN A;  3B6P A;  1BA1 A;  4CJR A;  5J2P A;  5DK5 A;  3VQB A;  4V19 S;  5CE3 A;  3QEX A;  3M8S A;  1VSI A;  4YY3 K;  3HK2 A;  4DTN A;  4JHD B;  2KHO A;  4JK7 A;  4FLX A;  3AA3 A;  4JKB A;  3AY9 A;  5LY3 A;  4OPJ A;  3J80 O;  3ZYY X;  1K73 O;  2YHY A;  4CJV A;  4IO8 A;  1B9F A;  4JKG B;  3MED A;  1C0G A;  4CEO A;  3O1B A;  5M1F A;  2X6S A;  4FLW A;  3A5L C;  4DQS A;  3VOV A;  5FLX O;  2FLO A;  1K8K B;  2F9T A;  3KLG A;  4OLB A;  1EKE A;  2FBT A;  4GMJ B;  2P9L B;  3ZSO A;  1NG9 A;  4BRQ A;  2VWJ A;  4JI0 K;  1FK9 A;  4B9S A;  1QQO A;  3L3U A;  2H3G X;  3QIC A;  1RTJ A;  4KHS A;  4CZG A;  3MX2 A;  3L2V A;  1D4X A;  2HBJ A;  3H46 O;  3OBW A;  2ZM6 K;  3NGI A;  1JJ2 M;  2QI2 A;  5BRD A;  3P83 D;  3WXK A;  3ZSR A;  5M1P A;  4B1Z A;  5AQX A;  1RT3 A;  1VQO N;  3VQD A;  1XC3 A;  4DTJ A;  3DWL A;  2UU9 K;  4O8U A;  3RSE B;  4R5P A;  1XMQ K;  1Z25 A;  3DXK A;  4FYD A;  3BP8 A;  1NGA A;  4C23 A;  4FJX A;  1EX4 A;  3ATV A;  2VWB A;  1S1V A;  4A59 A;  4GKK K;  2Q3S A;  5KI6 A;  1NJI O;  2QXF A;  3S41 A;  4E1M A;  4CGF A;  2O8C B;  1M1K O;  4M42 A;  2ZWH A;  4G9Z A;  4DU4 A;  3QEI A;  1OKJ A;  2BE2 A;  1MA9 B;  1OH6 A;  2YHA A;  4DR1 K;  4DF8 A;  1IH7 A;  1HLU A;  1KXP A;  4ID5 A;  3WXM B;  4DV1 K;  4X65 K;  3CFP A;  2JWL A;  2A3Z A;  1C1B A;  1YAG A;  3DOL A;  5SZT A;  3DJC A;  2E8A A;  4LFB K;  1SS6 A;  3CJ9 A;  4KHW A;  2FF3 B;  5K14 A;  3ZSW A;  1IBK K;  4EP5 A;  1DTQ A;  2HB5 A;  3BF1 A;  3HP6 A;  2OA8 A;  3CQY A;  3NGZ A;  3TAF A;  1TYQ A;  3THV A;  1NU0 A;  4W5T A;  4FW2 A;  4JI8 K;  4GV6 A;  2VYP A;  4FJ7 A;  1X3N A;  5BPL A;  3T1H K;  3SUO A;  1D8Y A;  1KCF A;  4BY9 C;  1XI1 A;  1LAW A;  4GV9 A;  1UWB A;  4CJT A;  3ZET B;  3KJV A;  3TSU A;  3IUC A;  2YJF A;  2G8U A;  3DYA A;  4OKE A;  5FDL A;  3TAM A;  2G8F A;  4IKF A;  2QTD A;  4AHU A;  4KHN A;  2Q2R A;  4OVL A;  3E1Y A;  4JEP A;  2Z1J A;  2IC3 A;  3Q7B A;  4JYA K;  3HM9 A;  4I6M B;  4CCH A;  4PHT X;  5EY4 A;  5KQ8 A;  1RDB A;  2YX6 A;  3O8M A;  1TKD A;  1N5Y A;  1ZXO A;  3QFP A;  2O8E B;  5BRE A;  3VQE A;  3ZSQ A;  3CCV N;  1HQE A;  1YUW A;  4ELT A;  5AQY A;  3OA9 A;  3KKS A;  2D0P A;  3C6H A;  3EKS A;  4IDK A;  5M1N A;  3SZ2 A;  2UXC K;  1WBD A;  4JK9 A;  3UB5 A;  3QO9 A;  3CM5 A;  4CF2 A;  4IG0 A;  4YOV A;  3CCR N;  4LF8 K;  2ZJP L;  4NLB A;  1BDG A;  4CEB A;  4DSE A;  3RR7 A;  4BG9 A;  2WBN A;  1Z05 A;  5AQF A;  5LL6 Z;  3OW2 M;  3NF7 A;  4OGE A;  2ZJQ L;  2P51 A;  3DRS A;  4GVE A;  3ZEU A;  3FLC O;  3OYE A;  3QML A;  2NNW A;  1FKP A;  2YNG A;  4FK4 A;  1NJX A;  3CPW M;  4XH4 A;  3F5T A;  4RTF D;  5BRF A;  2KZZ A;  1RBV A;  3SUP A;  3EEQ A;  2P9P A;  4JKA A;  5BR8 K;  3HZ6 A;  2P9S A;  2NZT A;  4FWN A;  1TAQ A;  3GE1 A;  2GEM A;  3VEX A;  3T1A A;  4IOX A;  1N34 K;  4RWT A;  1SUQ A;  1BL3 A;  1KAX A;  3GDQ A;  3CCJ N;  1GLA G;  3RVC A;  4AM7 A;  1KQS M;  4BRH A;  4FLY A;  4ID1 A;  3U3G A;  5HOO A;  3KK1 A;  3U6F A;  3M8Q A;  1ESV A;  1BU6 O;  2WTU A;  1KD1 O;  4CFC A;  1NJY A;  5D3G A;  4MFB A;  3VGL A;  3EN9 A;  2FSJ A;  1S3X A;  1H1V A;  2VG7 A;  3BZC A;  3AVG A;  3L8B A;  4A2B A;  1HNX K;  2P9U B;  3OYD A;  3RRH A;  2CH6 A;  3ENB A;  3CC7 N;  3L4I A;  3AVC A;  4BRP A;  1S1X A;  3CPE A;  3K58 A;  3AAQ A;  1TK0 A;  4K42 A;  3KZB A;  5HRS A;  3UKU A;  4AH9 A;  3SJH A;  1RT1 A;  2VG5 A;  2PAV A;  3VEV A;  5AR0 A;  1VQM N;  2ZD1 A;  3KK2 A;  3MCA B;  1WSH A;  4HVJ A;  4B8C A;  2YHX A;  2HBK A;  3O4W A;  4FJ9 A;  4KTZ A;  3C94 A;  5T7B A;  2YHB A;  1WB9 A;  4CZH A;  4WFA L;  5JMV A;  4DHY A;  3LPU A;  1LW0 A;  2X78 A;  3A8Y A;  2HVI A;  3OS1 A;  1J6Z A;  3GBT A;  3TAE A;  2P9K A;  1QSS A;  4C1N K;  5J1E A;  3VEN A;  3HOT A;  3OYC A;  4O0I A;  4E7I A;  3K5M A;  4F2S A;  2GUP A;  5JS2 A;  3TR8 A;  1U4B A;  2A1S A;  1VSJ A;  3G0Z A;  1NK4 A;  3OYL A;  1ZC6 A;  4M3R A;  1TUU A;  4KI6 A;  3CJC A;  3UKR A;  1JXE A;  3C6U A;  4PA1 A;  3KD1 E;  3LDL A;  1S1T A;  3T1Y K;  1OH7 A;  3HTV A;  5GAH P;  4NXM K;  4CES A;  3SQ0 A;  2KQ2 A;  2WC9 A;  2QM1 A;  2G8H A;  3F9K A;  5CHI A;  2QW9 A;  5IWA K;  4CZK A;  4RW6 A;  4JI2 K;  1U47 A;  3QEV A;  1JL1 A;  4GKJ K;  2O4G A;  3AO3 A;  4AIL C;  1QQN A;  3VES A;  4DQR A;  3C65 A;  4O4G A;  4BR4 A;  1RDU A;  3E9O A;  2NRW A;  1VQ5 N;  3DXM A;  3DLH A;  1QS4 A;  4AQY K;  4JK8 A;  3HBT A;  2E5L K;  4CD1 A;  4CJQ A;  3M5R A;  2B4J A;  2XY7 A;  5C25 A;  1CZ9 A;  4R79 A;  1WSJ A;  1XC9 A;  3IMX A;  3HPO A;  4BR7 A;  1NOY A;  3HPH A;  4PKI A;  1HQU A;  1JLA A;  5I9E B;  4E1J A;  2UXD K;  1HKG A;  3ZX0 A;  2D0A A;  1HNW K;  3FZM A;  3LL3 A;  4DSI A;  4XEI A;  1YHQ N;  3PUF A;  4FOE A;  1TKX A;  3LAL A;  4QAG A;  3V9S A;  1CXU A;  1Q7Y O;  4BQL A;  3CCU N;  1QSL A;  1RT7 A;  5IT9 O;  3ZSY A;  2VWK A;  2ZGY A;  3OYI A;  2JGU A;  3KLE A;  2HNY A;  2UUC K;  1Y64 A;  2P9I B;  3M3Z A;  4UY8 O;  4FOI A;  1TK8 A;  3QIP A;  3AVK A;  1IO2 A;  3QNO A;  4B9M A;  3CME N;  3CFO A;  2G8W A;  3DOK A;  2DY4 A; 
#chains in the Genus database with same CATH homology
 4Z4G A;  5FRO A;  3TAN A;  1D9F A;  4FM1 A;  1SKS A;  1C0T A;  4DLE A;  1S9E A;  2RF2 A;  3NFA A;  1NKB A;  5KTQ A;  4JRQ A;  1JL2 A;  4NCG A;  4FM2 A;  1SL1 A;  3TAQ A;  3SQ2 A;  3LZI A;  4EP4 A;  3L2W A;  3NHG A;  2F96 A;  3LZJ A;  1J54 A;  1RIL A;  2D0C A;  3DLR A;  3NH2 A;  4N47 A;  4DU3 A;  3OJS A;  4M3W A;  3OY9 A;  3I8D A;  2OPP A;  1A5X A;  2EHG A;  2KFZ A;  4FJG A;  3SUN A;  2LSN A;  3B6P A;  3ZSX A;  3LAM A;  1GOC A;  4CJR A;  1ITG A;  2I5J A;  4CHZ A;  5DK5 A;  5J2P A;  4FVM A;  2X74 A;  3VQB A;  1T7P A;  1GOA A;  3NF8 A;  2HW3 A;  4FCY A;  3QEX A;  3HO1 A;  3M8S A;  1VSI A;  3HK2 A;  4ICL A;  4DTN A;  3QER A;  3I0R A;  1T03 A;  3LP2 A;  4CE9 A;  1SKW A;  1L3T A;  5FRN A;  4HCC A;  2O4I A;  4CJ3 A;  3PO4 A;  4FLX A;  3AA3 A;  4BAC A;  5KGX A;  4PUO A;  1WN7 A;  4OPJ A;  1VSD A;  1U48 A;  3WNH A;  4CJS A;  3QEP A;  4Y1C A;  4CJV A;  1HNV A;  2KW4 A;  5HRP A;  4IBN A;  1B9F A;  4CEF A;  4KKO A;  3MED A;  3K59 A;  4C8K A;  4B9V A;  1FKO A;  4CEO A;  4Q5V A;  2RKI A;  3K5O A;  2X6S A;  4FLW A;  3V9Z A;  5I3U A;  1NK9 A;  5HRN A;  3OYA A;  2QK9 A;  1BHL A;  4DQS A;  2OPS A;  4M3T A;  1LWE A;  3KLI A;  1QSY A;  1VRU A;  2ITG A;  1NK8 A;  3EZ5 A;  3F73 A;  4RW4 A;  1BCO A;  3KLG A;  4OLB A;  2DFF A;  3L2R A;  4IFV A;  1FXX A;  3KIO A;  3O4Q A;  4KHY A;  3AA5 X;  3K5L A;  1BI4 A;  3VQ4 A;  1EKE A;  1RT4 A;  1QQC A;  2FBT A;  4GMJ B;  3OYH A;  3ZSO A;  5HP1 A;  1NKE A;  3L2U A;  1WAJ A;  2VWJ A;  1HNI A;  4N5S A;  2F8T A;  1L3S A;  1FK9 A;  4B9S A;  4ZTF A;  3SV3 A;  3K2P A;  4F8R A;  3L3U A;  4Z0U A;  3NF6 A;  4AHS A;  1KLN A;  1RTJ A;  3RTV A;  4FJI A;  4J2E A;  4CJP A;  4KHS A;  1YTA A;  4O0J A;  4BWM A;  3L2V A;  2GUI A;  1S6Q A;  1WAF A;  1RTH A;  1HYV A;  1TGO A;  4CJ4 A;  3NGI A;  4DSL A;  1KVA A;  1IKX A;  3RMB A;  4OKK A;  3P83 D;  2G8K A;  3IAY A;  3AVF A;  4Z4C A;  3SJJ A;  4CJF A;  2P5G A;  3ZSR A;  4CJL A;  1VSF A;  4DTP A;  3S9H A;  1S5J A;  1XHX A;  2FBV A;  4LD0 A;  4CGD A;  3P5J A;  1LWF A;  1RT3 A;  4FJM A;  2Y1I A;  3VQD A;  4C8L A;  2YNF A;  1BCM A;  4DTJ A;  3WNF A;  1D9D A;  4F2R A;  4FK2 A;  3HL8 A;  4R5P A;  2RN2 A;  1Z25 A;  1I3A A;  4FYD A;  1KVC A;  2HHU A;  4FJX A;  4I9L A;  4NCB A;  1YVU A;  1EX4 A;  3RRG A;  4FZY A;  1S1V A;  4AHT A;  4E19 A;  2Q3S A;  2YNH A;  4Z4H A;  4DSF A;  2HHT A;  5KI6 A;  4E7H A;  3MXJ A;  1CZB A;  3BDP A;  2QXF A;  1ASU A;  3LAN A;  4CGF A;  4E1M A;  4DSK A;  2HHW A;  4M42 A;  4OGC A;  1X9W A;  1C1A A;  2WOM A;  3SNN A;  4DU4 A;  3QEI A;  1IKV A;  1RBS A;  2PYL A;  5CYQ A;  3VQ5 A;  4KTW A;  1B9D A;  2BE2 A;  1LV5 A;  4I7F A;  3PX0 A;  2YHA A;  3K57 A;  4RW8 A;  2G8I A;  2B6A A;  2FC0 A;  4CF8 A;  4DF8 A;  4CK3 A;  1IH7 A;  4PWD A;  2KTQ A;  1CXQ A;  3ZCM A;  4CEQ A;  4MQ3 A;  4DFJ A;  3DLK A;  4ID5 A;  3MXM A;  1BIS A;  1VSE A;  4CGI A;  5HLF A;  4DS4 A;  3DLB A;  4OPK A;  3RMC A;  3CFP A;  4N41 A;  1WSI A;  3HP9 A;  2YV0 X;  4RG8 A;  1C1B A;  4IG3 A;  3ITH A;  1VRT A;  1ZBF A;  3DOL A;  3AA2 A;  5SZT A;  3KK3 A;  1UOC A;  3T3F A;  4KHW A;  1QHT A;  5K14 A;  3ZSW A;  4CK1 A;  2P5O A;  3VQC A;  4EP5 A;  1W9H A;  2AJQ A;  1DTQ A;  4FW1 A;  2HB5 A;  4LH5 A;  3HP6 A;  2OA8 A;  4WE1 A;  2OZS A;  1RNH A;  1S9G A;  3QET A;  3NGZ A;  1WSE A;  1RBU A;  3KKR A;  5J2N A;  3TAF A;  4KHU A;  3THV A;  1WSG A;  4CIE A;  4W5T A;  4FW2 A;  3AO2 A;  4JS5 A;  1L3V A;  4F4K A;  4CJU A;  1A5V A;  4BE2 A;  2B5J A;  1J9A A;  4FJ7 A;  3O3F A;  3A2F A;  1T05 A;  1C6V A;  4B8A B;  2BGG A;  4F3T A;  4PY5 A;  3SUO A;  1ZYQ A;  1KCF A;  3EYZ A;  1D8Y A;  1VSK A;  4CGH A;  5JS1 A;  2PZS A;  4CHY A;  1YT3 A;  4C8M A;  3S3M A;  1RT5 A;  4W5R A;  3MEG A;  3SYZ A;  3BGR A;  2XO7 A;  1XI1 A;  1RTD A;  1LAW A;  4FJK A;  4KHQ A;  1UWB A;  4CJT A;  1SL0 A;  1WLJ A;  1TKZ A;  3KJV A;  1HYZ A;  1UAX A;  1NKC A;  3JSM A;  3DYA A;  2G8U A;  4KRF A;  4OKE A;  5FDL A;  3TAM A;  5HRR A;  2G8F A;  4FJL A;  4GVM A;  3D0P A;  4DWI A;  4FM0 A;  3V6D A;  4IKF A;  2XRI A;  3K5N A;  1A5W A;  5HRO A;  1JLE A;  1TVR A;  4AHU A;  4KHN A;  4NCA A;  4H4M A;  3ISN C;  1Q9X A;  4OVL A;  3C95 A;  2Z1J A;  2IC3 A;  3VQ7 A;  4IFY A;  4DTM A;  3TI0 A;  2QKK A;  3HM9 A;  3SQ1 A;  4CCH A;  3UIQ A;  4GW6 A;  1U04 A;  3IS9 A;  1GOB A;  2Z1G A;  1RDB A;  4HUE A;  4J2A A;  3SPZ A;  4JS4 A;  1TKD A;  1N5Y A;  3LPT A;  3NF9 A;  3VQE A;  3ULD A;  2PY5 A;  4CEZ A;  4KI4 A;  3P1G A;  3HYF A;  3ZSQ A;  1ZBH A;  3V1O A;  1HQE A;  3ZT0 A;  1Q9Y A;  4ELT A;  3KLH A;  3EY1 A;  2Y1J A;  4HUG A;  2XY5 A;  3AVN A;  3KKS A;  2XHB A;  3RMA A;  2OPQ A;  3AVJ A;  4JLH A;  4IDK A;  1DLO A;  4M41 A;  3SZ2 A;  2KZM A;  1N6Q A;  4JRP A;  4LH4 A;  3V4I A;  1VSM A;  2DFH A;  2YKM A;  3QLH A;  3QO9 A;  3CM5 A;  4CF2 A;  1LWC A;  4CHQ A;  4IG0 A;  1U45 A;  2G8V A;  3OYN A;  2YNI A;  3FFI A;  1KRP A;  4XIU A;  4CEE A;  4DLG A;  4M3Z A;  4CJE A;  4CEB A;  4DSE A;  3RMD A;  1UA1 A;  1NK0 A;  3RR7 A;  4FJN A;  2P1J A;  3OYM A;  4FZX C;  3NF7 A;  4OGE A;  1Z26 A;  2P51 A;  3DRS A;  3ASM A;  3OYE A;  4FLT A;  4FK4 A;  1FKP A;  1RBR A;  2YNG A;  3LP1 A;  4FLZ A;  3PX6 A;  1NJX A;  4KAZ A;  4UQG A;  4PQU A;  4W5Q A;  4E89 A;  1KTQ A;  4DFP A;  1QTM A;  2KZZ A;  1RBV A;  4FXD A;  4BDZ A;  3SUP A;  1R0A A;  2E6L A;  3KTQ A;  3ZT2 A;  3U3Y A;  3RR8 A;  1EP4 A;  4ELV A;  2HVH A;  1RDD A;  2XY6 A;  1TKT A;  1TAQ A;  3WNG A;  4CGJ A;  3VA0 A;  4E7L A;  1SL2 A;  2OYQ A;  5KGW A;  3T1A A;  3VQP A;  3TAB A;  3KD5 E;  3LAK A;  1TAU A;  1JKH A;  4CF0 A;  5C42 A;  1CLQ A;  1SUQ A;  1HRH A;  4CER A;  4Z4I A;  1BL3 A;  4HTU A;  5CZ1 A;  4FZZ A;  1K6Y A;  2HHV A;  1S1W A;  4CHN A;  4DFK A;  1BI4 B;  4FLY A;  4B9U A;  3MEC A;  4ID1 A;  3U3G A;  2Z1I A;  1W0H A;  2FBX A;  3DMJ A;  4LSN A;  4CHO A;  4ZHR A;  4DTS A;  3KK1 A;  1NJW A;  3U6F A;  4C8N A;  1ASV A;  3RWU A;  3NE6 A;  3M8Q A;  3V9X A;  1HJR A;  2OPR A;  4CFC A;  1RDC A;  4CIG A;  2HHX A;  3PO5 A;  5CZ2 A;  1NJY A;  5CY4 A;  4MFB A;  4N76 A;  5D3G A;  1KLM A;  1L3U A;  3AVA A;  3OYG A;  3V9U A;  2VG7 A;  1HYS A;  2ATQ A;  1DTT A;  2GV9 A;  3AVG A;  3ZT4 A;  3L8B A;  2IDO A;  4KB0 A;  1ZBL A;  3AVI A;  4OKJ A;  3OYB A;  1JLC A;  3OYD A;  3RRH A;  4B9L A;  2DTU A;  4FK0 A;  4E0D A;  3AVC A;  3K58 A;  1S1X A;  3CFR A;  1TK0 A;  3H08 A;  2WON A;  4DQP A;  4CJK A;  5HRS A;  5E41 A;  4AH9 A;  4KRE A;  4DF4 A;  3TAR A;  3S3N A;  3O3G A;  2E6M A;  4NYN A;  3VQQ A;  1RT1 A;  2VG5 A;  3CM6 A;  3OJU A;  4HUF A;  3OS2 A;  2ZD1 A;  4E7K A;  1VK0 A;  4BWJ A;  4M45 A;  3KK2 A;  4HCB A;  1EXQ A;  1LW2 A;  3AO5 A;  4EZ9 A;  4CK2 A;  1WSH A;  5SWM A;  4AHC A;  4G1Q A;  4HVJ A;  4O44 A;  4B8C A;  4FJ5 A;  4DG1 A;  3IG1 A;  4DMN A;  4DU1 A;  4B3O A;  1IKW A;  1X9S A;  5EU7 A;  4Z4F A;  4FJ9 A;  4KTZ A;  3C94 A;  5T7B A;  4DS5 A;  2YHB A;  4DTX A;  2BAN A;  4O55 A;  4DQI A;  3HT3 A;  4KO0 A;  2QKB A;  1KSP A;  2IGI A;  3C6T A;  3MEE A;  3NBP A;  3NAE A;  4J2D A;  4QOZ B;  2HHQ A;  1LAV A;  4DQQ A;  3SUQ A;  2IS3 A;  3MXI A;  3CG7 A;  4CFA A;  2RPI A;  3AO4 A;  3T19 A;  3LPU A;  4CIF A;  1TL1 A;  1BGX T;  1LW0 A;  3AA4 A;  3B6O A;  3M8P A;  4DTO A;  4ELU A;  3L3V A;  5C24 A;  2X78 A;  2HHS A;  3D45 A;  3PY8 A;  2HVI A;  3OS1 A;  2NUB A;  3AV9 A;  3TAE A;  5DMR A;  4KTQ A;  4H4O A;  1IKY A;  1XWL A;  3LWM A;  1QSS A;  1NK5 A;  2DFE A;  5J1E A;  3AVM A;  3OYC A;  3NH1 A;  4O0I A;  4FLU A;  4E7I A;  3QIO A;  3SCX A;  4KPY A;  1XHZ A;  1MU2 A;  3K5M A;  4CJW A;  5I42 A;  4B9T A;  4F2S A;  5JS2 A;  3TR8 A;  1TV6 A;  4L8R B;  1IG9 A;  3O4N A;  2PYJ A;  1T8E A;  2IOC A;  3HST B;  1TK5 A;  1U4B A;  2A1S A;  1WSF A;  4BE0 A;  4K8X A;  4HHT A;  1VSJ A;  1JLQ A;  3G0Z A;  4CHP A;  3DLG A;  3ZT3 A;  3S3O A;  2A1R A;  1NK4 A;  3CQ8 A;  4CEC A;  3OYL A;  4CJ5 A;  5J2M A;  2HND A;  1KFS A;  2F8S A;  1ASW A;  4M3R A;  1Y97 A;  2YKN A;  1QE1 A;  4KI6 A;  3HVT A;  4Q0B A;  2BDP A;  1JXE A;  3MAQ A;  3ZSZ A;  3C6U A;  4PA1 A;  4J2B A;  2X6N A;  2D5R A;  3KD1 E;  3LP3 A;  2XY8 A;  1S1T A;  3QIN A;  3JYT A;  4KB1 A;  3VQ8 A;  4CES A;  3NH0 A;  3SQ0 A;  2KQ2 A;  3SPY A;  1NOZ A;  3AVB A;  4BDY A;  4DFM A;  4B08 A;  2G8H A;  1Q8I A;  3I0S A;  3E01 A;  3TWH A;  5J2Q A;  1ZBU A;  3F9K A;  3TAG A;  4OLA A;  1WNS A;  4YNQ A;  3M8R A;  4FJH A;  4DTU A;  4K8Z A;  4M3X A;  4E3S A;  2GBZ A;  1SV5 A;  4RW6 A;  1U47 A;  1C1C A;  1BIZ A;  1RCH A;  1JL1 A;  3AVH A;  4I2Q A;  3ALY A;  3QEV A;  1YTU A;  2O4G A;  4C8O A;  1ZBI A;  4NYF A;  3AO3 A;  1S1U A;  4AIL C;  1X1P A;  3V81 A;  1F21 A;  4CFB A;  4DQR A;  2E4L A;  4O4G A;  4DSJ A;  2VG6 A;  3DI6 A;  2JLE A;  5KRS A;  4LSL A;  4LY7 A;  1J5O A;  3HXM A;  4H8K A;  4W5O A;  4W5N A;  3DRR A;  2ZQB A;  3KLF A;  2IAJ A;  4KFB A;  4B9N A;  3V1Q A;  4BDP A;  1TL3 A;  1QS4 A;  4O5B A;  4FLV A;  2HMI A;  3DLH A;  1KVB A;  3QEW A;  3V1R A;  1KFD A;  4CFD A;  4E1N A;  4F3O A;  4AHV A;  4I9Q A;  2R7Y A;  2OZM A;  3CYM A;  4CJQ A;  3SQ4 A;  5CYM A;  2EX3 A;  1VSH A;  2B4J A;  1C0M A;  3DRP A;  1JLF A;  3DLE A;  2XY7 A;  5C25 A;  1JLB A;  1D5A A;  1CZ9 A;  3LDS A;  4KV8 A;  1HMV A;  3AVL A;  4E7J A;  1BQM A;  1WSJ A;  5KRT A;  1XC9 A;  3HPO A;  3VQ9 A;  1EET A;  4FJ8 A;  2HNZ A;  1NOY A;  4YFU A;  3L2Q A;  3HPH A;  1C0U A;  1I39 A;  4RW9 A;  1HPZ A;  3VA3 A;  1NK6 A;  1L5U A;  1HQU A;  1JLA A;  4DTR A;  2KFN A;  4Y1D A;  2Z1H A;  1RT6 A;  3VN5 A;  3VQ6 A;  2ZE2 A;  3HJF A;  3NDK A;  3LWL A;  1RDA A;  3NGY A;  4M3Y A;  4CED A;  4CF9 A;  1NJZ A;  5HBM A;  3SV4 A;  2D0A A;  1G15 A;  2D0B A;  2ETJ A;  4BE1 A;  4DSI A;  5FRM A;  3QES A;  1UA0 A;  3PUF A;  4AHR A;  4QCL A;  3VQA A;  1O1W A;  1BIU A;  3AO1 A;  1TKX A;  3LAL A;  3ZT1 A;  3O3H A;  3HVR A;  1B92 A;  4QAG A;  3V9S A;  1CXU A;  3DM2 A;  3IRX A;  4RW7 A;  3PX4 A;  3NCI A;  1NK7 A;  1X9M A;  4Z4E A;  4I2P A;  3OYK A;  1REV A;  3OS0 A;  4FJJ A;  2FBY A;  1RT7 A;  1QSL A;  4N56 A;  3PV8 A;  1S6P A;  3ZSY A;  4M3U A;  2VWK A;  3OYI A;  4ZTJ A;  3G10 A;  1RBT A;  2JGU A;  1J53 A;  3LP0 A;  3KLE A;  4TSX A;  3WNE A;  3OYF A;  2HNY A;  1JLG A;  1BQN A;  4CF1 A;  1VSL A;  3OYJ A;  4CGG A;  4CEA A;  2W42 A;  3V9W A;  1U49 A;  1SKR A;  3OVN A;  3TAP A;  1TK8 A;  3QIP A;  1JXB A;  3ZSV A;  3QNN A;  3AVK A;  3SI6 A;  1IO2 A;  3QNO A;  3HPG A;  4B9M A;  4EZ6 A;  3CFO A;  1RT2 A;  2G8W A;  3DOK A;  4OJR A;  2DY4 A;  1RTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...