5C15A

K428a muntant nuclease domain of the large terminase subunit gp2 of bacterial virus sf6 with manganese
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
224
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
molecule keywords Gene 2 protein
total genus 80
structure length 224
sequence length 241
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c15A00
4IEEA 5M1NA 4IDHA 5C10A 5M1OA 5C12A 5M1QA 3C6HA 3CPEA 5C2DA 4IFEA 5C2FA 5M1FA 5M1PA 5C15A 3C6AA 5M1KA 4IEIA
chains in the Genus database with same CATH superfamily
3U3GA 3CFOA 3VQQA 4OLAA 1XMOK 1SAZA 1JKHA 1U48A 3ZT3A 4AHTA 2YHXA 3K9KA 3KHYA 3DOKA 4DMNA 3TARA 1WB9A 4M45A 3QNOA 3VEXA 3OY9A 3ID6A 4M3TA 4W5RA 3AO3A 1QVGM 5AQYA 3E01A 4FLZA 4NCAA 2G8IA 4G9ZA 4A5AA 4DF8A 4CBXA 4HVJA 1RBUA 2O4IA 3B8AX 1WSIA 2VG7A 4YDUA 2O8CA 5BRDA 3N4QA 4CEEA 1GOCA 2WC9A 3OJSA 5AFUH 4N41A 3NH2A 2WUSA 3VTIA 1RTDA 1K73O 1M90O 2Z1IA 3LDSA 3E1YA 1TK5A 3M8RA 2E2OA 3QBWA 2ZF5O 4FM2A 2BE2A 1BQMA 1WUAA 4Z94A 5FDLA 2IVOA 5CYMA 3SQ1A 4FVUA 3NH1A 4AHUA 4M3ZA 1VSHA 3ZSWA 3UKUA 3HXMA 4CCHA 3CCVN 3BY5A 3THVA 1ZYQA 4DSEA 4O0IA 4BROA 1IBKK 3NE6A 4CD1A 3SQ2A 4KREA 1ESVA 1NGEA 3AO4A 5SZTA 4FJLA 2YJEA 4BGAA 5DM7L 3D0PA 1L3SA 3SQ4A 3SCXA 3LANA 3RMAA 1S1UA 1NK5A 4RW6A 4FJ5A 4Z4HA 5M1NA 3P39A 4M41A 1BI4B 5EXWA 4E3SA 1IG8A 1R59O 4C8KA 3CFRA 4DSIA 4KTZA 5FPMA 3QNNA 3G10A 4YOVA 3VQ6A 3U9DA 4RTFD 4RW4A 1VSEA 3V9UA 3KLIA 5CR4A 2P9LB 3WEEB 1U2VB 3QFPA 1NGHA 2Q2RA 2QKKA 3E66A 3VF4A 3CC7N 4IFVA 3VA3A 5AZIB 4CGHA 2DY4A 4BG9A 2X74A 4ILHA 3J7ZO 5GIOA 4CF9A 4K0KK 2OCEA 3NGYA 4U7BA 1S1WA 1QE1A 1BQNA 3BZKA 2AJQA 2HHVA 1QQMA 5BRFA 2UUCK 4LF9K 3OS0A 2P9KB 1NK4A 3O9QA 3FGUA 3KD1E 3LDQA 1YAGA 1SKSA 2OA8A 2E8AA 4R79A 4JRQA 3CCEN 1TAUA 2P9IA 4FJ7A 1VSDA 2NRHA 3PY8A 2PBDA 3AARA 4MFBA 1KVBA 4IBNA 1NGIA 5KGXA 5AQQA 3VQBA 1VRTA 4KFBA 3DXMB 4WF9L 5AQPA 1RDCA 4JKEA 3O4WA 4JK8A 3TAPA 2VWKA 4IG3A 1HNXK 3SUQA 4LH5A 2QWMA 4HTLA 4MO5A 3VQAA 4CGJA 3S3NA 3I8BA 1RBTA 4I6MB 1WSHA 1M1KO 1J54A 2OPPA 3HO1A 4FWMA 3M6GA 5M1PA 1SZ2A 5LJVA 4LY7A 5C0YA 1KFDA 3SJHA 1HJRA 4CF1A 5MLCQ 2F8TA 4B9TA 1JLGA 1GLBG 5KQ8A 1EKEA 4JD2A 5AQIA 3SV4A 2CGKA 4O5FA 3L2RA 3QERA 4A57A 1I39A 4PY5A 1NGDA 3V9WA 2UXCK 3KK2A 4DTRA 3CYMA 1NMDA 4BC5A 5DMRA 1EETA 3WT0A 4B08A 3AVAA 2YI1A 4DSKA 3NMUA 1NK8A 3UIQA 3T7ZA 4KHPK 4W5NA 5FPEA 3CCMN 2HNDA 1S6QA 1S3XA 1TYQA 3F9KA 2FBVA 4CZJA 3MDQA 2D1KA 1TKDA 4JV5K 4BRFA 4DS5A 4QS7A 1VK0A 3QEVA 3V1RA 4I7FA 3LAMA 2E6MA 3G25A 1G99A 4IO8A 2O8BB 4JEPA 3R6MA 1KQSM 4B3SK 4IOCL 2V7ZA 3O9RA 2FBXA 3SUOA 3QEPA 3SMSA 3V1OA 4JYAK 3ZSOA 2EWSA 1IKYA 4CGGA 4Z4EA 2O8DA 3I0RA 1NLVA 4FLTA 3PLAA 4CW7B 2JWKA 5CY4A 4DSFA 1A5VA 4JRPA 2OPRA 4FZYA 1SS6A 4Y1DA 1RDDA 2P9UA 5SWMA 4BC4A 4B9NA 3DLRA 3TTFA 3ZEUA 3TAEA 2YX6A 4DV0K 4OPKA 2A6AA 4BQZA 4LF7K 1JL2A 2QWPA 1DTQA 3KKSA 3KD5E 4CF8A 1NGCA 1RBSA 3MN9A 2Q31A 1S6PA 2E5LK 4YOXA 2YHAA 2GELA 3EE8A 3SQ0A 3HSCA 1HKCA 1GLCG 4QS9A 2QA4N 3PO4A 4IFEA 2BH1A 1W7AA 2G8UA 1HNVA 4H0VB 4DFMA 3CXCM 1TUYA 2HNZA 5AQVA 4CGFA 4Z4CA 4DV6K 1OH8A 3TPQA 3DLGA 3U3YA 2VGNA 4JKHA 2PYJA 3WQUA 2A42A 1LW2A 3I0SA 3QFUA 3EL2A 4O8UA 5FROA 5IWAK 4FJHA 2KW4A 4E89A 1LAVA 2ASOA 1WOQA 2D0PA 1YI2N 1WBDA 3PX4A 4Z0UA 3F73A 3A5MC 2NUBA 3F2KA 1V4SA 4CK2A 1OVQA 3VQCA 4IWVA 3BEXA 5JS2A 3CJAA 2ZGYA 1EXQA 2CH5A 2HOEA 5AQHA 5LJWA 3TSQA 1T44A 4A2AA 4BRKA 2G8WA 4CK3A 4OPJA 4KTWA 4E7JA 3FFKB 4OPAA 1HJOA 2W6LA 4FJMA 1IKVA 3MEDA 2NZTA 1VAZA 2ITMA 1Q81O 1IV0A 4WQ5C 3N4PA 2KZMA 5C15A 3CETA 3NCIA 4CESA 4CFCA 1KC8O 1WNSA 4BR2A 1N33K 1D5AA 3P83D 4C8NA 5HRRA 3MWTA 2IDOA 4IOAL 1T6CA 4C8LA 4DR1K 2A1SA 4BR7A 4H5WA 4CZMA 4I9QA 1HPZA 1S1TA 3C7NB 3FLCO 4YOUA 3WXIA 4JI0K 3VQDA 4ISFA 3QEWA 2HSTA 3TI0A 1I3AA 3M1FA 1KLNA 4ELTA 1HUXA 1VSMA 3LAKA 5LMNK 1YTUA 3IMXA 3ZCMA 4ID5A 5ELZA 3VGKA 4A2BA 3ULEB 1P8ZA 4HTUA 4AM6A 3S9HA 4L8RB 4MQ3A 3BF1A 1MU2A 4EHTA 4AHVA 3AVNA 1LW0A 3NF9A 3K5NA 3WNGA 1RT4A 3IAYA 4FWKA 3CJBA 3L4QA 4GV9A 4BRMA 4CHZA 4M3XA 1GLAG 3AV9A 2AP1A 5GAGP 4UY8O 4J8FA 3FE1A 4OGEA 4JKBA 2Z1JA 3DLKA 1NKBA 4CIEA 1QHAA 3H08A 3QBXA 3ENOA 2W42A 5C2DA 4O4GA 3CJ7A 3VETA 4IO9L 1MWKA 5AFUA 2YHBA 4JAXA 2XY5A 2D0BA 3THXA 4CJWA 1NWKA 1YITN 4OPHA 3KK3A 3FZFA 5I3UA 1VQ6N 3CPEA 2V7YA 5ADXH 3L8BA 3ULEA 3EZWA 3ULDA 1JXEA 3KKRA 4CEFA 3U8XA 3ATUA 3KTQA 1HQEA 2IAJA 3NDKA 1EP4A 1DKGD 1YJWN 2HBJA 5HRPA 4AHRA 2XHBA 4CEOA 1NK0A 3EKSA 2D0AA 1VSJA 2F96A 5HBMA 4BE0A 2YJFA 4BVOA 3R3LA 1LV5A 2HBKA 1Z6RA 1NGAA 5JVHL 5JVGL 4FYDA 4JI7K 4KHUA 1KAZA 2Y1JA 2D0OA 3ZX3A 3MWPA 1S9GA 2XO7A 4OLBA 4BRHA 3C65A 4K43A 3QESA 4B9LA 4FK2A 3VMFB 4BGBA 2O8EB 4B3TK 2HHTA 4NXNK 1KCFA 3OYJA 2HHWA 4I9LA 4BC3A 3HBTA 4KI4A 4CJSA 4RW8A 3H45C 4KH4A 3LDOA 4JI1K 3TABA 3K2PA 3NGIA 2BGGA 5AZJB 2O8CB 4X64K 2FC0A 4H0OA 4FOIA 5J2MA 1F21A 4CHNA 3EO3A 4DQRA 4JHDB 5CYQA 4CBUA 5AJ3K 3OYMA 4B9MA 1SQKA 1BGXT 3MK6A 1UA0A 3ZSQA 4FW1A 1Q9XA 3OYDA 1IO2A 4DF4A 4IOXA 3RVCA 5KPTA 4XH4A 4FK4A 1KFSA 1JL1A 2P9PA 4E1JA 4I2PA 1DTTA 1DLOA 4A59A 4MO4A 4CZKA 4FLYA 4GW6A 1L3TA 3WNFA 2RE2A 3ZT2A 4FXDA 4FCYA 1RBRA 3ZETA 5C12A 2OZSA 3DLLL 3AVJA 3OBYA 5JMVA 4HUGA 2PZSA 5H1SQ 5FRMA 3EEQA 3HM8A 3PV8A 3THWA 4HCCA 3AA5X 1WBBA 1IKXA 3CCUN 3T3FA 1ATSA 1BG3A 3HRGA 2NRZA 4KAZA 4KH6A 4FW2A 3F5TA 1YJ9N 1FJGK 2DTUA 4QS8A 3AVBA 2XY7A 1S1XA 3ZT1A 5M1OA 3WUHA 4QCLA 3OTOK 2D4WA 4BR5A 2A40A 3HL8A 1OKJA 5EVZA 3I56N 4KHNA 4N76A 1TVRA 4N47A 3QEXA 3B6PA 4FLVA 3MAQA 1GLJO 1IKWA 4NLBA 3OYGA 3P4IA 4QAGA 4WQ4C 3TSUA 3UB5A 1S72N 3C94A 4C1NK 3M8SA 1XNRK 3SAFA 2GX9A 3AVKA 3SLCA 4H5VA 4FPAA 3VQ8A 4H5TA 3DLEA 3V1QA 2I5JA 4JHDA 4BDZA 5E84A 1BCMA 5E26A 4JI4K 2P9PB 1JXBA 2QWLA 3E9OA 5B8HA 4BRGA 4EP4A 5GINA 1H1VA 1VSKA 4E0DA 3J8AA 4C23A 2GWKA 4C8OA 4YHHK 3MEGA 1ZBLA 4M42A 3DLBA 1ZBIA 3RTVA 2YKMA 2UXDK 2GUIA 4LF6K 3L2WA 3C6UA 1OH5A 4J2DA 1ZXOA 3HOSA 3NHGA 4RCHA 3DOLA 1VRUA 3Q7BA 3GE1A 1E4GT 4GV3A 2VQFK 3IFRA 3T69A 2PFUA 2PAVA 2YNIA 1NJYA 3HOTA 4DTSA 5AQJA 3M8PA 4OVLA 3DRSA 4BRQA 2YHWA 4OKEA 3LP1A 3CQYA 2HHXA 4IKFA 1C1BA 4GV6A 1SL0A 3CM6A 5BPNA 4ID1A 1SKWA 1MA9B 3GOIA 3FZMA 2Q36A 3MN7A 1BOTO 4JKDA 3V4IA 4FLWA 3QICA 2O4GA 3P1GA 3IS9A 4CGDA 3AA4A 4CIFA 2HMPA 5AQOA 1NJXA 3TTDA 5FRNA 4DQPA 4CIGA 3MXIA 3HZ6A 3U4LA 5CZ2A 1K8KB 4GMJB 3JSMA 4H0XB 2UUAK 2G8KA 3C6HA 3RR7A 1NK6A 3LDPA 3OYFA 4OJRA 4J2BA 5J1EA 5C25A 3V6DA 4DQSA 1RT5A 2OZMA 3QB0A 3DRPA 4FJXA 3LWLA 4CJTA 5ADXA 1HMVA 1SKRA 1T3VA 4KHYA 2DPNA 2E4LA 2HBMA 3G6EN 3FZLA 2D0CA 3PX0A 4PKGA 3OYCA 3SMPA 2PY5A 5EOYA 2QEXN 1TYQB 4AH9A 3NBPA 2VCPA 2XRIA 4GKKK 5F0XA 4LFBK 2HHQA 3W3DA 4FZZA 1VQON 2ETJA 1HPMA 3GL1A 4I6MA 4B1XB 5M1QA 4DTJA 1TKZA 1KVCA 3QINA 3TAGA 1VQ9N 3THYA 3VQPA 3HYFA 4DHYA 3QO9A 1YUWA 4B9SA 4JS4A 4H8KA 3EY1A 4M3RA 3DRRA 4GKJK 4CJRA 1VQPN 1XMQK 3A8YA 3O1BA 3VGMA 4KH5A 3VF2A 3KLEA 4EP5A 2E2PA 2F4VK 3PSIA 1YF5L 4OO1J 4H4OA 1YT3A 4FJNA 3ZEUB 3LWMA 5F1XA 4EAHD 4MLHA 1VQNN 4CEAA 5HOOA 3WNEA 1W0HA 2Q97A 3L2UA 1XC9A 3CCLN 3VQ5A 2OTLN 3UE5A 4ELUA 1B92A 5AQWA 3AVLA 4B8CA 4CI6A 4GVEA 4IJNA 3QEIA 1RNHA 4DQIA 3A0IX 3Q7CA 1MWMA 2NLXA 4IZ9A 1JLFA 4JKGA 4FPBA 3HJFA 3AA3A 4CJQA 4JK7A 3IUCA 1QS4A 3AVIA 3LP2A 1S9EA 1RT6A 2E1YA 4I2QA 4O8KA 5CHIA 3VEZA 3O5BA 4A61A 1RGIA 1CXQA 4F8RA 2O8BA 1RT2A 3H46O 3AVHA 2Q0UA 1NGJA 1U49A 1JCFA 1XHZA 3O9UA 3LPUA 3RWUA 1B9DA 3I8DA 3ZSVA 2CH6A 3MX5A 5TKYA 3ZT4A 4YOWA 2ZE2A 3RRGA 4B1VA 1YVNA 3D7EO 3O4NA 4V19S 4FZXC 3TANA 4PUOA 3C6AA 3O4QA 2YNHA 2Q1NA 3O80A 1LOTB 3D2EA 4M3WA 1JCEA 3E9LA 2A41A 1WSEA 2VYPA 4LF4K 3MMVA 1BI4A 1D4XA 2WTUA 1QZ5A 4FWLA 1L3VA 1VQLN 4YORA 4WCEL 2RPIA 3VPZA 4CF0A 3ENHA 4DTPA 3WEEA 4JKGB 2VWBA 3VERA 4NYNA 5AQUA 3WXJA 4ZTFA 2HVHA 3DI6A 4ILJA 3SYZA 3VEWA 2KKZA 3D2FA 3HTVA 2P9SB 4BACA 1FKPA 3KWGA 3DMJA 3QLHA 4NXMK 1CZ9A 4R5PA 1IBMK 2X78A 4DTNA 1A5XA 4F2RA 3LZIA 3OYIA 3C7NA 5CZ1A 1ZBSA 5AZIA 2ITGA 1J6ZA 5M1FA 2EX3A 3V9SA 4DFPA 4DV2K 4DU3A 3G0ZA 1NG9A 1IG9A 4M63C 3T1YK 3RMBA 1BISA 1TKXA 3C0BA 1S1VA 4CZFA 4N56A 3AGRA 2NRVA 1E4FT 4DLGA 3K9JA 4JI5K 3ZETB 4FWOA 4BE1A 1QSSA 1NGBA 4M7XA 4PHTX 5FPDA 1NJIO 1KXPA 2QW9A 3LDNA 3VENA 4CHPA 3FR0A 5AQZA 3ENBA 2FF3B 3WNHA 3OA9A 4KPYA 1KAXA 5BPMA 5AQTA 1VQKN 2P9KA 3OS1A 3OS2A 3OYKA 4DTMA 3TAFA 3AO2A 1C0TA 4IG0A 3OHRA 5AQGA 3ZYYX 2ATQA 4O0JA 5GAEP 3V9XA 4XIUA 1ASVA 4EIAA 3HPGA 2G8VA 1K9MO 1X1PA 3KZBA 3ATVA 2BTFA 4DFJA 3OYHA 4BRNA 2QTDA 3VQ7A 3NVKA 3TR8A 1VSLA 2E2QA 4BR0A 1RT3A 4WQ5A 1KTQA 1CXUA 2QK9A 1WAJA 4OGCA 5LMUK 3HVRA 2HHSA 2Z1GA 3BZCA 3HI0A 2FF6A 5BN9A 3L3UA 4E7KA 4BQLA 3GG4A 4DWIA 1MDUB 1KLMA 4FLUA 3CMEN 3A5NC 4F4KA 1ATNA 4MDAA 3THXB 3UKRB 4B1WB 2P9SA 5AQRA 4FL9A 4CJ4A 4RW7A 4HWIA 5HRSA 4AHCA 1G15A 4CZLA 1XC3A 2B6AA 1U4BA 5C24A 2E2NA 4O55A 3SZ2A 1BUPA 2ASMA 3PIPL 2GBZA 4W5OA 5J2QA 5BREA 3I55N 1GLDG 4IEEA 1DT9A 4FSVA 1ATRA 2B4JA 4H03B 1NJWA 4LFAK 1NKCA 1C0MA 2QI2A 3OVNA 1T05A 2WONA 3CQXA 5KTQA 3V9ZA 1XHXA 3EYZA 1Q9YA 3OYNA 2Q0RA 2Q3SA 1Y64A 4ICLA 4JNEA 3K58A 5KQDA 1LWFA 4IEIA 2HMIA 4M3UA 3VQEA 5J2PA 4BY9C 1P90A 4LD0A 1RTHA 1QSYA 1LCUA 1LWCA 3K5LA 1RDUA 4DR5K 1RDBA 4JKAA 1VHXA 5D3GA 3SK3A 1BA1A 3RMDA 2BANA 2QWRA 5LL6Z 1X9JA 4FLXA 1O1WA 4F3TA 5AQNA 4KV8A 4FM1A 2VG6A 2E20A 1OH6A 4PQUA 1HNZK 4KI6A 4E1NA 1QQNA 4OX9K 1K8AO 1TAQA 1WSJA 4H5RA 4KHQA 1RDWX 4BC2A 4Y0WA 2NRXA 4BWMA 4JS5A 2EHGA 2OPSA 2ZQBA 3MN6A 2ZJRL 1XWLA 4K8ZA 4JKCA 3O3HA 2KZZA 1ITGA 3JS6A 3RRHA 4KHWA 4B9VA 3VOVA 1CZBA 1SL1A 1YXQA 4CJLA 4DR4K 4DUYK 3HPHA 2F9WA 2JGUA 3NF6A 3O8MA 3D45A 3SPZA 1HQUA 1IBLK 2LSNA 3SAGA 4DV4K 2UYTA 3H1VX 4DB3A 3OJUA 1LWEA 3ZSZA 4X65K 4CJEA 3TAQA 1Y97A 2V51B 2E1ZA 3BUZB 2X6SA 3ITHA 3CPWM 4CVNE 2OTJN 1JLCA 2IOCA 1HYVA 3AVCA 4CJUA 1O13A 3LPTA 1WAFA 4FJ9A 2YNFA 3AAPA 3AVFA 5FPNA 2GV9A 2J4RA 1VSFA 3RR8A 1Z25A 3A5OC 3OW2M 3L2VA 3H1QA 1QQCA 4HCBA 1X9WA 2ZM6K 3HT3A 1NNEA 3TU5A 1N6QA 1LAWA 4H5NA 1TGOA 4BRCA 3CC4N 1VQ7N 1BWFO 4EZ9A 4LF8K 3V81A 1Q8IA 2P9NA 3QDKA 2HNYA 3EKUA 2IVPA 1A5WA 3TAMA 1U2VA 3UKRA 1JLAA 3JAMO 2ZWHA 2KQ2A 1VQ4N 3MCPA 5KRSA 3NAEA 1HKGA 1WSGA 3KK1A 3ZLJA 1C1CA 1NOZA 4CHYA 3IDHA 3PIOL 4WFAL 2YHYA 3HVTA 1NK9A 2P5OA 1GLLO 3K5MA 3FFIA 4CECA 4BRIA 5AQXA 4BDYA 4O44A 2HB5A 4FM0A 4CFBA 4BR4A 4BRAA 2A3ZA 1DEJA 4DTOA 3CD6N 2QXLA 3SPYA 4JK9A 4KB1A 1UAXA 3D2EB 3THWB 1R0AA 4BDPA 4BREA 4KKOA 5I9EB 1JLQA 3VA0A 2KTQA 4KBOA 5GIPA 5DM6L 4LSLA 3DXKA 3L3VA 4IDKA 3S3OA 1REVA 3ASMA 2P5GA 1RBVA 3ZX2A 1S5JA 3H6EA 3AY9A 4BWJA 2KFZA 5FLXO 4JI8K 2I7NA 4CBWA 1W2BM 4YDUC 4W5TA 2CGLA 1X3NA 4LH4A 1VQ5N 3VESA 3RSEA 4DS4A 4FJGA 4Z4GA 3UKUB 4DUZK 1YTAA 3MN5A 3O3FA 3LZJA 2F9TA 4HHTA 2VGMA 3AVMA 3K5OA 4Q0BA 3S41A 3FZKA 2DFHA 4CK1A 1NGGA 2OPQA 4FOEA 2FSJA 5BR9A 2A1RA 3EE9A 3WQTA 3E9PA 4AILC 4CJFA 1RTJA 5JLHA 1D9DA 3DWLA 1U47A 3CFPA 1BCOA 5C42A 4WFBL 4CFAA 3AO5A 4H4MA 3MX2A 3CCQN 5E41A 1JCGA 3OBWA 5CE3A 1KSPA 4XH5A 3BF3A 1QSLA 2F8SA 3BGRA 1QHTA 1EQYA 5HROA 4QOZB 3BDPA 2GEMA 1D8YA 4YY3K 3A5LC 5BN8A 1K6YA 3RSEB 1UOCA 3NFAA 3A2FA 5AQLA 3L4IA 2P9UB 2ZD1A 4B8AB 1T03A 3CF5L 1QZ6A 3P31A 4DTUA 3DXKB 3EN9A 1I94K 4DLEA 4JI2K 4MDBA 4DR7K 3GDQA 5C2FA 3THYB 1WLJA 2AA4A 1UWBA 3VN5A 3KIOA 4FWRA 4O5BA 2GTDA 3JXUA 5BPLA 3F9MA 1K8KA 4FJ8A 2P1JA 5EY4A 3ZSXA 2XY6A 4WFNL 3HK2A 1XNQK 3IKMA 1C6VA 4NO7A 1YVUA 4ILGB 4DTXA 2WOMA 4YFUA 5HP1A 5AZJA 4CJ7A 4DFKA 2W41A 2ASPA 4YNQA 2YCHA 4Z4FA 2ZJPL 1U6ZA 1HRHA 4CJ3A 1XUPO 4NYFA 3VEOA 4CZHA 3TSPA 1S22A 4E19A 2ZJQL 4LSNA 4WYBA 3LALA 4JKFA 1GLFO 3VGLA 5KGWA 1BDGA 3KLHA 5GAHP 3D6RA 3VEVA 4BVPA 1FW6A 2JLEA 5AR0A 4BRDA 1EX4A 1J5EK 4DQQA 3KLGA 4H0TB 2FSKA 3LM2A 3M5RA 2RHKA 1RT7A 3C95A 4XH1A 3ZSRA 1N32K 3TTCA 3J80O 1KVAA 2UU9K 1NGFA 1Z05A 1IH7A 1DGKN 2D5RA 1YHQN 3SUPA 1XQSC 3T19A 4JD2B 3K59A 3D2FB 4E7HA 2FBYA 4ISGA 2W6KA 3CCSN 3KLFA 3P38A 5TKWA 1VQMN 4X62K 4CHOA 1C1AA 4WE1A 5IT9O 4C8MA 4JN4A 1Q18A 3DM2A 4K25A 2QWNA 3R9PA 5KI6A 1IJJA 4EZ6A 1NMNA 4FWNA 1NK7A 5K14A 3CIPA 4J2EA 4B3MK 4FJIA 1KD1O 4CEBA 1RILA 3SAHA 4HUFA 1RFQA 5AQFA 3EZ5A 1HX1A 4W5QA 4JLHA 4B1ZA 1HKBA 3CJ9A 2YNGA 5GADP 4E7IA 4B9QA 2P9LA 3I33A 2RKIA 3PO5A 1BL3A 1BIZA 2KHOA 1TL1A 2FLOA 4CJVA 4TSXA 4M3YA 3ALYA 1WSFA 2GWJA 3NF8A 2IGIA 4BRPA 3MEEA 3MXJA 2NRRA 4DR6K 1BA0A 3SV3A 1FK9A 1NKEA 1U45A 2W40A 3O3GA 4IFYA 5LY3A 1X9SA 5A2QO 2X6NA 2H3GX 3LM9A 4U67L 3O9TA 4AQYK 2WBNA 5HL7L 2RN2A 1BO5O 1TK0A 3SI6A 1L3UA 3J7YP 4EHUA 5J2NA 1N5YA 4GVMA 1NBWA 2P9IB 3JYTA 4CD3A 2OANA 3ZSYA 1TL3A 5F2RA 1ZC6A 2UUBK 2E6LA 2Y1IA 2G8HA 3SBGA 3OYEA 4B3OA 1QQOA 3KK7A 2HVIA 4Z4IA 5KPRA 3CMAN 3TWHA 3O08A 4FJKA 2HW3A 3O1WA 4KTQA 1HLUA 4DKWA 4DR3K 4LF5K 2BDPA 2I7PA 3LP0A 1J9AA 3J81O 1HNWK 3J7AP 3H3OB 3CCRN 2ZGZA 2YKNA 1QVFM 3LL3A 1E3MA 4E1MA 1QTMA 4CHQA 4OKJA 3M8QA 3ID8A 2QWQA 4YOYA 2GUPA 4H0PA 4CZEA 4G1QA 3HPOA 2HHHK 3VQ9A 1ILYA 4ISEA 4DCHA 2NRTA 4F9OA 1T7PA 3OYLA 4AF1A 5M1KA 3IG1A 1HYSA 2O8EA 4FWQA 2P9NB 1C0GA 4BE2A 5JS1A 3G71N 1X9MA 2P51A 4MLEA 2QXFA 4UQGA 4PL8A 3DAWA 3K57A 1YJNN 1TV6A 2QWOA 4DU1A 4IDHA 3IRXA 4ELVA 4KRFA 2FBTA 3NH0A 4DR2K 3SNNA 4Y1CA 2UXBK 1ZBFA 2R7YA 2NNWA 4PL7A 3PUFA 4ZTJA 3C6TA 3AA2A 4CF2A 4YOTA 2QM1A 4CZIA 1Q86O 3HSTB 4CJPA 1NOYA 5EU7A 3CQ8A 2QKBA 4XEIA 3KVGA 3CCJN 3H3NO 1GOAA 2YV0X 5KRTA 1ZBHA 4FWPA 4RG8A 3O6WA 4FO0A 1GLEG 1N36K 3M3ZA 3WXLA 5BR8K 1UA1A 4B3RK 1SV5A 5BRHA 4NB4A 3MXMA 1V4TA 4IXCA 4L3QA 4K42A 1XI1A 1L5UA 1T8EA 4DU4A 2VWJA 3DYAA 1Q7YO 1NM1A 5AQSA 4B1UB 4EFHA 1EWQA 3GBTA 3QIPA 2HBLA 3AAQA 2NRWA 3VEYA 4NCBA 3AO1A 1BU6O 1VQ8N 2IIRA 2DFEA 2KLAA 1HNIA 5JLFA 2IS3A 4GNIA 2CGJA 3W0LA 1C0FA 3K0SA 4RWTA 4HUEA 2IVNA 1W9HA 1X3MA 2HF4A 1ASUA 3ZT0A 2E88A 1J5OA 1SUQA 3MECA 2VQEK 4GY2B 3SBTA 5DK5A 4DG1A 3L2QA 3SJJA 3DXMA 4NCGA 1SL2A 1OVYA 3CG7A 4FK0A 5HLFA 3CC2N 1WN7A 4B1YB 4K41A 4NLCA 4E7LA 1KAYA 4BR9A 3QMLA 3QETA 1TKTA 1TUUA 3AGKA 3U6FA 4LFCK 1N8RO 2BUPA 3HP9A 3CJ1A 3NVMA 1TK8A 2JWLA 4DQ8A 3ZX0A 2RF2A 3NF7A 3L0QA 1JLEA 4K8XA 4CEZA 3VQ4A 3U9ZA 4PA1A 1JJ2M 3LP3A 1U04A 2O8FA 1Q82O 2XY8A 1W97L 3OYBA 1NU0A 4DV5K 3QIOA 4FWSA 1GOBA 2IC3A 4LC9B 4CJ5A 3PX6A 4CZGA 1T6DA 3CJCA 1EO1A 4C1NI 1CLQA 2WFBA 3ISNC 3DLHA 1BIUA 3P5JA 2DFFA 1J53A 1HR0K 1D9FA 1NJZA 3T1AA 4CE9A 2OYQA 1BHLA 3PSFA 3T1HK 3DJCA 5C10A 4F2SA 3S3MA 3MCAB 1EWRA 2KFNA 3R1XA 4ZHRA 4KO0A 4Q5VA 4AM7A 4H0YB 1YIJN 1B9FA 3VF6A 2V52B 4CFDA 2PYLA 4BRLA 3CI5A 3VTHA 1RTIA 2G8FA 1OH7A 4CERA 3HM9A 5HRNA 4KHSA 2O8DB 4M7YA 2O8FB 4CEDA 3L6QA 2FSNA 4X66K 4DV1K 5EX5A 3CHWA 3HP6A 4CJKA 3NGZA 2B5JA 4RW9A 3G4SN 2Z1HA 2VG5A 4OKKA 1KRPA 3SUNA 4JI3K 4CEQA 4BG8A 3CM5A 5AQMA 4B9UA 3WXMB 1ASWA 4IJAA 1FKOA 4DSLA 2HHUA 4KB0A 1RT1A 1Z26A 1RDAA 2FXUA 1N34K 3OYAA 5JICA 4DV7K 3KJVA 4AHSA 4DV3K 1HYZA 3FZHA 4A62A 1JLBA 4WQ4A 3CERA 3B6OA 4F3OA 3O9SA 1ZBUA 4PWDA 3BP8A 1CZAN 3AVGA 3R8EA 1C0UA 3WXKA 4JI6K 4J2AA 4DSJA 5I42A 4PKIA 1FXXA 1RCHA 4FJJA 2HF3A 5AQKA 3KWIA 4A5BA 5T7BA 4N5SA 2A5XA 1VSIA 4CGIA 4PKHA 2F7TA 3RMCA 4FVMA 3LDLA 5KPZA
chains in the Genus database with same CATH topology
4FWKA 3CJBA 3L4QA 4GV9A 1S22A 4BRMA 2ZJQL 1GLAG 4WYBA 3C7NA 1SAZA 4JKFA 1ZBSA 2AP1A 5AZIA 5GAGP 1GLFO 4J8FA 4UY8O 1J6ZA 5M1FA 3FE1A 3VGLA 1BDGA 2YHXA 3K9KA 3KHYA 4JKBA 5GAHP 3D6RA 3VEVA 1QHAA 3VEXA 4BVPA 5AR0A 3ID6A 4BRDA 4M63C 1QVGM 3QBXA 5AQYA 3ENOA 3C0BA 4CZFA 4H0TB 5C2DA 2FSKA 3LM2A 3AGRA 2NRVA 3CJ7A 2RHKA 3M5RA 4G9ZA 1E4FT 4A5AA 4XH1A 3VETA 4IO9L 1MWKA 3K9JA 4CBXA 5AFUA 4JAXA 3TTCA 3ZETB 1NGFA 1Z05A 1DGKN 1NWKA 3B8AX 4FWOA 4OPHA 3FZFA 1YITN 1YHQN 1VQ6N 1NGBA 4M7XA 4PHTX 3VEOA 5FPDA 3CPEA 1NJIO 2V7YA 4YDUA 1KXPA 5ADXH 5BRDA 3N4QA 3ULEA 1XQSC 2QW9A 3EZWA 3LDNA 3VENA 2WC9A 3FR0A 3ATUA 4JD2B 3U8XA 5AQZA 3ENBA 2FF3B 5AFUH 3D2FB 2WUSA 3VTIA 1DKGD 1YJWN 4ISGA 1K73O 3OA9A 1M90O 2HBJA 3CCSN 1KAXA 5BPMA 3E1YA 5AQTA 3P38A 5TKWA 1VQMN 2P9KA 3EKSA 1VQKN 2E2OA 3QBWA 2ZF5O 2YJFA 4BVOA 4JN4A 3R3LA 1Q18A 2HBKA 1Z6RA 4K25A 1WUAA 2QWNA 1NGAA 4Z94A 5JVHL 3ZYYX 3OHRA 5AQGA 3R9PA 1IJJA 5JVGL 2IVOA 4FVUA 1KAZA 2D0OA 4FWNA 3ZX3A 3MWPA 3CIPA 3UKUA 1KD1O 5GAEP 3SAHA 4BRHA 3C65A 4K43A 1RFQA 4EIAA 5AQFA 3CCVN 1HX1A 4B1ZA 3VMFB 4BGBA 1HKBA 3KZBA 1K9MO 3CJ9A 3ATVA 4BROA 5GADP 2BTFA 4B9QA 2P9LA 3I33A 4BRNA 4BC3A 2QTDA 3HBTA 2KHOA 4CD1A 3NVKA 2FLOA 2E2QA 1ESVA 4BR0A 1NGEA 3H45C 4WQ5A 2GWJA 4KH4A 3LDOA 2YJEA 4BGAA 4BRPA 3HI0A 2FF6A 2NRRA 5AZJB 5BN9A 5DM7L 1BA0A 4BQLA 4H0OA 3GG4A 4FOIA 2W40A 1MDUB 3EO3A 5M1NA 3P39A 5LY3A 4JHDB 4CBUA 2H3GX 3LM9A 4U67L 3O9TA 3CMEN 2WBNA 5HL7L 3A5NC 1SQKA 1ATNA 5EXWA 4MDAA 1IG8A 1BO5O 1R59O 3MK6A 3UKRB 5FPMA 4B1WB 2P9SA 4YOVA 4EHUA 5AQRA 4FL9A 4HWIA 1NBWA 2P9IB 3U9DA 4RTFD 4IOXA 4CZLA 1XC3A 4CD3A 3RVCA 2OANA 5KPTA 4XH4A 2E2NA 5F2RA 5CR4A 2P9PA 1BUPA 2P9LB 3WEEB 1ZC6A 4E1JA 1U2VB 2ASMA 3QFPA 3PIPL 1NGHA 2Q2RA 3SBGA 5BREA 3I55N 1GLDG 4IEEA 1DT9A 4A59A 3E66A 4FSVA 3VF4A 4MO4A 3CC7N 1QQOA 3KK7A 1ATRA 4CZKA 5KPRA 2RE2A 4H03B 3CMAN 5AZIB 3O08A 4BG9A 2QI2A 3O1WA 3ZETA 5C12A 1HLUA 3CQXA 3DLLL 4DKWA 3OBYA 5JMVA 4ILHA 5H1SQ 3J7ZO 3HM8A 5GIOA 2I7PA 2Q0RA 3H3OB 3CCRN 4U7BA 1Y64A 4JNEA 3CCUN 5KQDA 4IEIA 2ZGZA 1ATSA 1BG3A 1QVFM 3LL3A 1QQMA 3HRGA 5BRFA 2NRZA 4BY9C 1P90A 2P9KB 3O9QA 4KH6A 3F5TA 3ID8A 2QWQA 3FGUA 1YJ9N 1LCUA 3LDQA 1RDUA 1YAGA 4JKAA 4QS8A 2E8AA 3SK3A 4R79A 1BA1A 3CCEN 4YOYA 2GUPA 2QWRA 4H0PA 1X9JA 2P9IA 5M1OA 3WUHA 2NRHA 4CZEA 2PBDA 2D4WA 3AARA 1ILYA 4ISEA 2A40A 4BR5A 4DCHA 2NRTA 5AQNA 1OKJA 5EVZA 4F9OA 3I56N 1NGIA 5AQQA 4AF1A 2E20A 5M1KA 1GLJO 4NLBA 4FWQA 3DXMB 2P9NB 3P4IA 1C0GA 4WQ4C 3TSUA 3UB5A 1QQNA 1S72N 1K8AO 4C1NK 4WF9L 3G71N 5AQPA 3SAFA 2GX9A 4H5RA 4JKEA 3O4WA 4JK8A 4MLEA 3SLCA 4H5VA 1RDWX 4PL8A 3DAWA 4FPAA 2QWMA 4H5TA 4BC2A 4Y0WA 1YJNN 2NRXA 4HTLA 4MO5A 4JHDA 5E84A 2QWOA 3I8BA 3MN6A 4I6MB 2ZJRL 4IDHA 1M1KO 4FWMA 3M6GA 5E26A 4JKCA 2P9PB 1SZ2A 2QWLA 5M1PA 3E9OA 5LJVA 5C0YA 5B8HA 3JS6A 3SJHA 4BRGA 5GINA 5MLCQ 1H1VA 3J8AA 4C23A 2GWKA 3VOVA 2NNWA 4PL7A 1GLBG 1YXQA 4YOTA 2QM1A 5KQ8A 4JD2A 5AQIA 4CZIA 2CGKA 2F9WA 4O5FA 1Q86O 4A57A 1NGDA 1ZXOA 3O8MA 3HOSA 4RCHA 4XEIA 3KVGA 3Q7BA 3CCJN 3H3NO 1NMDA 4BC5A 4FWPA 3GE1A 3SAGA 3O6WA 3WT0A 4FO0A 1E4GT 1GLEG 2YI1A 2UYTA 3M3ZA 4GV3A 3H1VX 3NMUA 3WXLA 3T7ZA 4DB3A 3IFRA 5BRHA 3T69A 2PFUA 2PAVA 4NB4A 5FPEA 3HOTA 1V4TA 3CCMN 1S3XA 2E1ZA 2V51B 1TYQA 5AQJA 4IXCA 3BUZB 4L3QA 4K42A 4BRQA 3CPWM 2OTJN 2YHWA 4CZJA 3MDQA 3CQYA 1O13A 2D1KA 1Q7YO 4GV6A 1NM1A 4BRFA 3AAPA 5AQSA 5FPNA 4QS7A 2J4RA 4B1UB 4EFHA 3GBTA 5BPNA 3A5OC 2HBLA 3AAQA 3OW2M 2NRWA 1MA9B 3H1QA 3GOIA 3G25A 1G99A 4IO8A 3FZMA 4JEPA 2Q36A 3MN7A 1BOTO 4JKDA 3VEYA 3R6MA 1KQSM 1VQ8N 1BU6O 3TU5A 4IOCL 2IIRA 3QICA 4H5NA 2V7ZA 3O9RA 4BRCA 3CC4N 1VQ7N 2KLAA 1BWFO 3SMSA 5JLFA 2EWSA 2HMPA 5AQOA 4GNIA 2CGJA 1C0FA 3TTDA 1NLVA 2P9NA 3QDKA 3W0LA 4RWTA 3PLAA 2JWKA 3EKUA 2IVPA 2IVNA 1U2VA 3UKRA 1X3MA 2HF4A 2ZWHA 2E88A 3HZ6A 3U4LA 1K8KB 1VQ4N 1SS6A 4GY2B 2P9UA 3MCPA 4H0XB 3SBTA 3C6HA 1HKGA 3LDPA 4BC4A 3IDHA 3PIOL 4WFAL 2YHYA 3DXMA 3TTFA 3ZEUA 3QB0A 2YX6A 1GLLO 1OVYA 2A6AA 4BQZA 3CC2N 4BRIA 2QWPA 5ADXA 1NGCA 4B1YB 5AQXA 3MN9A 1T3VA 4K41A 4NLCA 2DPNA 2HBMA 1KAYA 3G6EN 3FZLA 4BR9A 3QMLA 4PKGA 2Q31A 3SMPA 4BR4A 1TUUA 2A3ZA 3AGKA 4BRAA 1DEJA 3CD6N 5EOYA 2QEXN 4YOXA 1TYQB 2BUPA 2GELA 2QXLA 3CJ1A 3EE8A 3NVMA 4JK9A 1N8RO 3HSCA 1HKCA 2JWLA 1GLCG 2VCPA 4QS9A 2QA4N 4DQ8A 3D2EB 4IFEA 5F0XA 3ZX0A 2BH1A 4BREA 5I9EB 3W3DA 3L0QA 4H0VB 3CXCM 1VQON 4KBOA 1HPMA 3GL1A 4I6MA 5M1QA 3U9ZA 1TUYA 4B1XB 5GIPA 3DXKA 5DM6L 1JJ2M 5AQVA 1VQ9N 4DHYA 3ZX2A 1YUWA 1Q82O 3H6EA 3AY9A 3TPQA 1W97L 2I7NA 4CBWA 1W2BM 4YDUC 2VGNA 4FWSA 4JKHA 2CGLA 2A42A 3WQUA 4LC9B 1VQPN 1X3NA 1VQ5N 3A8YA 3O1BA 3VGMA 3VESA 3RSEA 4KH5A 3VF2A 3UKUB 4CZGA 1T6DA 3CJCA 1EO1A 3QFUA 3EL2A 4O8UA 3MN5A 2WFBA 4C1NI 2E2PA 1YF5L 2F9TA 4OO1J 2VGMA 2ASOA 1WOQA 2D0PA 3ZEUB 1YI2N 5F1XA 4EAHD 4MLHA 3S41A 3A5MC 1VQNN 3F2KA 3FZKA 1NGGA 1V4SA 4IWVA 4FOEA 2FSJA 3BEXA 5BR9A 5HOOA 3DJCA 5C10A 3CJAA 2Q97A 3EE9A 2ZGYA 3CCLN 2CH5A 2HOEA 5AQHA 5LJWA 3WQTA 3TSQA 1T44A 3E9PA 3MCAB 4A2AA 3UE5A 2OTLN 3R1XA 4BRKA 5AQWA 5JLHA 3DWLA 4CI6A 4AM7A 4GVEA 4H0YB 4WFBL 1YIJN 4IJNA 3FFKB 4OPAA 3A0IX 2V52B 3Q7CA 1MWMA 2NLXA 4IZ9A 1HJOA 4JKGA 3VF6A 4BRLA 3CI5A 4FPBA 3VTHA 3MX2A 4JK7A 2NZTA 3IUCA 1VAZA 3CCQN 2ITMA 1Q81O 4O8KA 1JCGA 2E1YA 5CHIA 4WQ5C 3OBWA 5CE3A 3N4PA 3O5BA 3VEZA 1RGIA 3CETA 4A61A 4XH5A 5C15A 3BF3A 4M7YA 1EQYA 3L6QA 5KPZA 1KC8O 2FSNA 4BR2A 2GEMA 3H46O 3A5LC 5BN8A 2Q0UA 5EX5A 3CHWA 3MWTA 3RSEB 1NGJA 4IOAL 3L4IA 1JCFA 2P9UB 5AQLA 3G4SN 1T6CA 3CF5L 3O9UA 1QZ6A 3P31A 4H5WA 4BR7A 4CZMA 3DXKB 3EN9A 5AQMA 4BG8A 2CH6A 3MX5A 4MDBA 3C7NB 3WXMB 3GDQA 5TKYA 5C2FA 3FLCO 4YOWA 4YOUA 4IJAA 3WXIA 4B1VA 1YVNA 2AA4A 3D7EO 4FWRA 2FXUA 2GTDA 3JXUA 4ISFA 3C6AA 5BPLA 3O80A 2Q1NA 1LOTB 3D2EA 2HSTA 3F9MA 5JICA 1K8KA 1JCEA 5EY4A 3E9LA 2A41A 3FZHA 2VYPA 3MMVA 4A62A 3M1FA 4WFNL 1D4XA 1QZ5A 1HUXA 4FWLA 4WQ4A 1VQLN 3IKMA 3CERA 4YORA 4WCEL 3VPZA 3O9SA 3ENHA 3WEEA 4JKGB 3BP8A 4NO7A 1CZAN 4ILGB 2VWBA 3R8EA 3IMXA 5AQUA 3VERA 3WXJA 3WXKA 5AZJA 4CJ7A 2W41A 2ASPA 4PKIA 2HF3A 2YCHA 5ELZA 5AQKA 3VGKA 4A2BA 3ULEB 1P8ZA 3KWIA 4ILJA 4AM6A 2ZJPL 4A5BA 3BF1A 3VEWA 2KKZA 4EHTA 3D2FA 1U6ZA 2A5XA 3HTVA 2P9SB 1XUPO 4PKHA 2F7TA 3KWGA 3LDLA 4CZHA 3TSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEE A;  5M1N A;  4IDH A;  5C10 A;  5M1O A;  5C12 A;  5M1Q A;  3C6H A;  3CPE A;  5C2D A;  4IFE A;  5C2F A;  5M1F A;  5M1P A;  5C15 A;  3C6A A;  5M1K A;  4IEI A; 
#chains in the Genus database with same CATH topology
 3U3G A;  3CFO A;  3VQQ A;  4OLA A;  1XMO K;  1SAZ A;  1JKH A;  1U48 A;  3ZT3 A;  4AHT A;  2YHX A;  3K9K A;  3KHY A;  3DOK A;  4DMN A;  3TAR A;  1WB9 A;  4M45 A;  3QNO A;  3VEX A;  3OY9 A;  3ID6 A;  4M3T A;  4W5R A;  3AO3 A;  1QVG M;  5AQY A;  3E01 A;  4FLZ A;  4NCA A;  2G8I A;  4G9Z A;  4A5A A;  4DF8 A;  4CBX A;  4HVJ A;  1RBU A;  2O4I A;  3B8A X;  1WSI A;  2VG7 A;  4YDU A;  2O8C A;  5BRD A;  3N4Q A;  4CEE A;  1GOC A;  2WC9 A;  3OJS A;  5AFU H;  4N41 A;  3NH2 A;  2WUS A;  3VTI A;  1RTD A;  1K73 O;  1M90 O;  2Z1I A;  3LDS A;  3E1Y A;  1TK5 A;  3M8R A;  2E2O A;  3QBW A;  2ZF5 O;  4FM2 A;  2BE2 A;  1BQM A;  1WUA A;  4Z94 A;  5FDL A;  2IVO A;  5CYM A;  3SQ1 A;  4FVU A;  3NH1 A;  4AHU A;  4M3Z A;  1VSH A;  3ZSW A;  3UKU A;  3HXM A;  4CCH A;  3CCV N;  3BY5 A;  3THV A;  1ZYQ A;  4DSE A;  4O0I A;  4BRO A;  1IBK K;  3NE6 A;  4CD1 A;  3SQ2 A;  4KRE A;  1ESV A;  1NGE A;  3AO4 A;  5SZT A;  4FJL A;  2YJE A;  4BGA A;  5DM7 L;  3D0P A;  1L3S A;  3SQ4 A;  3SCX A;  3LAN A;  3RMA A;  1S1U A;  1NK5 A;  4RW6 A;  4FJ5 A;  4Z4H A;  5M1N A;  3P39 A;  4M41 A;  1BI4 B;  5EXW A;  4E3S A;  1IG8 A;  1R59 O;  4C8K A;  3CFR A;  4DSI A;  4KTZ A;  5FPM A;  3QNN A;  3G10 A;  4YOV A;  3VQ6 A;  3U9D A;  4RTF D;  4RW4 A;  1VSE A;  3V9U A;  3KLI A;  5CR4 A;  2P9L B;  3WEE B;  1U2V B;  3QFP A;  1NGH A;  2Q2R A;  2QKK A;  3E66 A;  3VF4 A;  3CC7 N;  4IFV A;  3VA3 A;  5AZI B;  4CGH A;  2DY4 A;  4BG9 A;  2X74 A;  4ILH A;  3J7Z O;  5GIO A;  4CF9 A;  4K0K K;  2OCE A;  3NGY A;  4U7B A;  1S1W A;  1QE1 A;  1BQN A;  3BZK A;  2AJQ A;  2HHV A;  1QQM A;  5BRF A;  2UUC K;  4LF9 K;  3OS0 A;  2P9K B;  1NK4 A;  3O9Q A;  3FGU A;  3KD1 E;  3LDQ A;  1YAG A;  1SKS A;  2OA8 A;  2E8A A;  4R79 A;  4JRQ A;  3CCE N;  1TAU A;  2P9I A;  4FJ7 A;  1VSD A;  2NRH A;  3PY8 A;  2PBD A;  3AAR A;  4MFB A;  1KVB A;  4IBN A;  1NGI A;  5KGX A;  5AQQ A;  3VQB A;  1VRT A;  4KFB A;  3DXM B;  4WF9 L;  5AQP A;  1RDC A;  4JKE A;  3O4W A;  4JK8 A;  3TAP A;  2VWK A;  4IG3 A;  1HNX K;  3SUQ A;  4LH5 A;  2QWM A;  4HTL A;  4MO5 A;  3VQA A;  4CGJ A;  3S3N A;  3I8B A;  1RBT A;  4I6M B;  1WSH A;  1M1K O;  1J54 A;  2OPP A;  3HO1 A;  4FWM A;  3M6G A;  5M1P A;  1SZ2 A;  5LJV A;  4LY7 A;  5C0Y A;  1KFD A;  3SJH A;  1HJR A;  4CF1 A;  5MLC Q;  2F8T A;  4B9T A;  1JLG A;  1GLB G;  5KQ8 A;  1EKE A;  4JD2 A;  5AQI A;  3SV4 A;  2CGK A;  4O5F A;  3L2R A;  3QER A;  4A57 A;  1I39 A;  4PY5 A;  1NGD A;  3V9W A;  2UXC K;  3KK2 A;  4DTR A;  3CYM A;  1NMD A;  4BC5 A;  5DMR A;  1EET A;  3WT0 A;  4B08 A;  3AVA A;  2YI1 A;  4DSK A;  3NMU A;  1NK8 A;  3UIQ A;  3T7Z A;  4KHP K;  4W5N A;  5FPE A;  3CCM N;  2HND A;  1S6Q A;  1S3X A;  1TYQ A;  3F9K A;  2FBV A;  4CZJ A;  3MDQ A;  2D1K A;  1TKD A;  4JV5 K;  4BRF A;  4DS5 A;  4QS7 A;  1VK0 A;  3QEV A;  3V1R A;  4I7F A;  3LAM A;  2E6M A;  3G25 A;  1G99 A;  4IO8 A;  2O8B B;  4JEP A;  3R6M A;  1KQS M;  4B3S K;  4IOC L;  2V7Z A;  3O9R A;  2FBX A;  3SUO A;  3QEP A;  3SMS A;  3V1O A;  4JYA K;  3ZSO A;  2EWS A;  1IKY A;  4CGG A;  4Z4E A;  2O8D A;  3I0R A;  1NLV A;  4FLT A;  3PLA A;  4CW7 B;  2JWK A;  5CY4 A;  4DSF A;  1A5V A;  4JRP A;  2OPR A;  4FZY A;  1SS6 A;  4Y1D A;  1RDD A;  2P9U A;  5SWM A;  4BC4 A;  4B9N A;  3DLR A;  3TTF A;  3ZEU A;  3TAE A;  2YX6 A;  4DV0 K;  4OPK A;  2A6A A;  4BQZ A;  4LF7 K;  1JL2 A;  2QWP A;  1DTQ A;  3KKS A;  3KD5 E;  4CF8 A;  1NGC A;  1RBS A;  3MN9 A;  2Q31 A;  1S6P A;  2E5L K;  4YOX A;  2YHA A;  2GEL A;  3EE8 A;  3SQ0 A;  3HSC A;  1HKC A;  1GLC G;  4QS9 A;  2QA4 N;  3PO4 A;  4IFE A;  2BH1 A;  1W7A A;  2G8U A;  1HNV A;  4H0V B;  4DFM A;  3CXC M;  1TUY A;  2HNZ A;  5AQV A;  4CGF A;  4Z4C A;  4DV6 K;  1OH8 A;  3TPQ A;  3DLG A;  3U3Y A;  2VGN A;  4JKH A;  2PYJ A;  3WQU A;  2A42 A;  1LW2 A;  3I0S A;  3QFU A;  3EL2 A;  4O8U A;  5FRO A;  5IWA K;  4FJH A;  2KW4 A;  4E89 A;  1LAV A;  2ASO A;  1WOQ A;  2D0P A;  1YI2 N;  1WBD A;  3PX4 A;  4Z0U A;  3F73 A;  3A5M C;  2NUB A;  3F2K A;  1V4S A;  4CK2 A;  1OVQ A;  3VQC A;  4IWV A;  3BEX A;  5JS2 A;  3CJA A;  2ZGY A;  1EXQ A;  2CH5 A;  2HOE A;  5AQH A;  5LJW A;  3TSQ A;  1T44 A;  4A2A A;  4BRK A;  2G8W A;  4CK3 A;  4OPJ A;  4KTW A;  4E7J A;  3FFK B;  4OPA A;  1HJO A;  2W6L A;  4FJM A;  1IKV A;  3MED A;  2NZT A;  1VAZ A;  2ITM A;  1Q81 O;  1IV0 A;  4WQ5 C;  3N4P A;  2KZM A;  5C15 A;  3CET A;  3NCI A;  4CES A;  4CFC A;  1KC8 O;  1WNS A;  4BR2 A;  1N33 K;  1D5A A;  3P83 D;  4C8N A;  5HRR A;  3MWT A;  2IDO A;  4IOA L;  1T6C A;  4C8L A;  4DR1 K;  2A1S A;  4BR7 A;  4H5W A;  4CZM A;  4I9Q A;  1HPZ A;  1S1T A;  3C7N B;  3FLC O;  4YOU A;  3WXI A;  4JI0 K;  3VQD A;  4ISF A;  3QEW A;  2HST A;  3TI0 A;  1I3A A;  3M1F A;  1KLN A;  4ELT A;  1HUX A;  1VSM A;  3LAK A;  5LMN K;  1YTU A;  3IMX A;  3ZCM A;  4ID5 A;  5ELZ A;  3VGK A;  4A2B A;  3ULE B;  1P8Z A;  4HTU A;  4AM6 A;  3S9H A;  4L8R B;  4MQ3 A;  3BF1 A;  1MU2 A;  4EHT A;  4AHV A;  3AVN A;  1LW0 A;  3NF9 A;  3K5N A;  3WNG A;  1RT4 A;  3IAY A;  4FWK A;  3CJB A;  3L4Q A;  4GV9 A;  4BRM A;  4CHZ A;  4M3X A;  1GLA G;  3AV9 A;  2AP1 A;  5GAG P;  4UY8 O;  4J8F A;  3FE1 A;  4OGE A;  4JKB A;  2Z1J A;  3DLK A;  1NKB A;  4CIE A;  1QHA A;  3H08 A;  3QBX A;  3ENO A;  2W42 A;  5C2D A;  4O4G A;  3CJ7 A;  3VET A;  4IO9 L;  1MWK A;  5AFU A;  2YHB A;  4JAX A;  2XY5 A;  2D0B A;  3THX A;  4CJW A;  1NWK A;  1YIT N;  4OPH A;  3KK3 A;  3FZF A;  5I3U A;  1VQ6 N;  3CPE A;  2V7Y A;  5ADX H;  3L8B A;  3ULE A;  3EZW A;  3ULD A;  1JXE A;  3KKR A;  4CEF A;  3U8X A;  3ATU A;  3KTQ A;  1HQE A;  2IAJ A;  3NDK A;  1EP4 A;  1DKG D;  1YJW N;  2HBJ A;  5HRP A;  4AHR A;  2XHB A;  4CEO A;  1NK0 A;  3EKS A;  2D0A A;  1VSJ A;  2F96 A;  5HBM A;  4BE0 A;  2YJF A;  4BVO A;  3R3L A;  1LV5 A;  2HBK A;  1Z6R A;  1NGA A;  5JVH L;  5JVG L;  4FYD A;  4JI7 K;  4KHU A;  1KAZ A;  2Y1J A;  2D0O A;  3ZX3 A;  3MWP A;  1S9G A;  2XO7 A;  4OLB A;  4BRH A;  3C65 A;  4K43 A;  3QES A;  4B9L A;  4FK2 A;  3VMF B;  4BGB A;  2O8E B;  4B3T K;  2HHT A;  4NXN K;  1KCF A;  3OYJ A;  2HHW A;  4I9L A;  4BC3 A;  3HBT A;  4KI4 A;  4CJS A;  4RW8 A;  3H45 C;  4KH4 A;  3LDO A;  4JI1 K;  3TAB A;  3K2P A;  3NGI A;  2BGG A;  5AZJ B;  2O8C B;  4X64 K;  2FC0 A;  4H0O A;  4FOI A;  5J2M A;  1F21 A;  4CHN A;  3EO3 A;  4DQR A;  4JHD B;  5CYQ A;  4CBU A;  5AJ3 K;  3OYM A;  4B9M A;  1SQK A;  1BGX T;  3MK6 A;  1UA0 A;  3ZSQ A;  4FW1 A;  1Q9X A;  3OYD A;  1IO2 A;  4DF4 A;  4IOX A;  3RVC A;  5KPT A;  4XH4 A;  4FK4 A;  1KFS A;  1JL1 A;  2P9P A;  4E1J A;  4I2P A;  1DTT A;  1DLO A;  4A59 A;  4MO4 A;  4CZK A;  4FLY A;  4GW6 A;  1L3T A;  3WNF A;  2RE2 A;  3ZT2 A;  4FXD A;  4FCY A;  1RBR A;  3ZET A;  5C12 A;  2OZS A;  3DLL L;  3AVJ A;  3OBY A;  5JMV A;  4HUG A;  2PZS A;  5H1S Q;  5FRM A;  3EEQ A;  3HM8 A;  3PV8 A;  3THW A;  4HCC A;  3AA5 X;  1WBB A;  1IKX A;  3CCU N;  3T3F A;  1ATS A;  1BG3 A;  3HRG A;  2NRZ A;  4KAZ A;  4KH6 A;  4FW2 A;  3F5T A;  1YJ9 N;  1FJG K;  2DTU A;  4QS8 A;  3AVB A;  2XY7 A;  1S1X A;  3ZT1 A;  5M1O A;  3WUH A;  4QCL A;  3OTO K;  2D4W A;  4BR5 A;  2A40 A;  3HL8 A;  1OKJ A;  5EVZ A;  3I56 N;  4KHN A;  4N76 A;  1TVR A;  4N47 A;  3QEX A;  3B6P A;  4FLV A;  3MAQ A;  1GLJ O;  1IKW A;  4NLB A;  3OYG A;  3P4I A;  4QAG A;  4WQ4 C;  3TSU A;  3UB5 A;  1S72 N;  3C94 A;  4C1N K;  3M8S A;  1XNR K;  3SAF A;  2GX9 A;  3AVK A;  3SLC A;  4H5V A;  4FPA A;  3VQ8 A;  4H5T A;  3DLE A;  3V1Q A;  2I5J A;  4JHD A;  4BDZ A;  5E84 A;  1BCM A;  5E26 A;  4JI4 K;  2P9P B;  1JXB A;  2QWL A;  3E9O A;  5B8H A;  4BRG A;  4EP4 A;  5GIN A;  1H1V A;  1VSK A;  4E0D A;  3J8A A;  4C23 A;  2GWK A;  4C8O A;  4YHH K;  3MEG A;  1ZBL A;  4M42 A;  3DLB A;  1ZBI A;  3RTV A;  2YKM A;  2UXD K;  2GUI A;  4LF6 K;  3L2W A;  3C6U A;  1OH5 A;  4J2D A;  1ZXO A;  3HOS A;  3NHG A;  4RCH A;  3DOL A;  1VRU A;  3Q7B A;  3GE1 A;  1E4G T;  4GV3 A;  2VQF K;  3IFR A;  3T69 A;  2PFU A;  2PAV A;  2YNI A;  1NJY A;  3HOT A;  4DTS A;  5AQJ A;  3M8P A;  4OVL A;  3DRS A;  4BRQ A;  2YHW A;  4OKE A;  3LP1 A;  3CQY A;  2HHX A;  4IKF A;  1C1B A;  4GV6 A;  1SL0 A;  3CM6 A;  5BPN A;  4ID1 A;  1SKW A;  1MA9 B;  3GOI A;  3FZM A;  2Q36 A;  3MN7 A;  1BOT O;  4JKD A;  3V4I A;  4FLW A;  3QIC A;  2O4G A;  3P1G A;  3IS9 A;  4CGD A;  3AA4 A;  4CIF A;  2HMP A;  5AQO A;  1NJX A;  3TTD A;  5FRN A;  4DQP A;  4CIG A;  3MXI A;  3HZ6 A;  3U4L A;  5CZ2 A;  1K8K B;  4GMJ B;  3JSM A;  4H0X B;  2UUA K;  2G8K A;  3C6H A;  3RR7 A;  1NK6 A;  3LDP A;  3OYF A;  4OJR A;  4J2B A;  5J1E A;  5C25 A;  3V6D A;  4DQS A;  1RT5 A;  2OZM A;  3QB0 A;  3DRP A;  4FJX A;  3LWL A;  4CJT A;  5ADX A;  1HMV A;  1SKR A;  1T3V A;  4KHY A;  2DPN A;  2E4L A;  2HBM A;  3G6E N;  3FZL A;  2D0C A;  3PX0 A;  4PKG A;  3OYC A;  3SMP A;  2PY5 A;  5EOY A;  2QEX N;  1TYQ B;  4AH9 A;  3NBP A;  2VCP A;  2XRI A;  4GKK K;  5F0X A;  4LFB K;  2HHQ A;  3W3D A;  4FZZ A;  1VQO N;  2ETJ A;  1HPM A;  3GL1 A;  4I6M A;  4B1X B;  5M1Q A;  4DTJ A;  1TKZ A;  1KVC A;  3QIN A;  3TAG A;  1VQ9 N;  3THY A;  3VQP A;  3HYF A;  4DHY A;  3QO9 A;  1YUW A;  4B9S A;  4JS4 A;  4H8K A;  3EY1 A;  4M3R A;  3DRR A;  4GKJ K;  4CJR A;  1VQP N;  1XMQ K;  3A8Y A;  3O1B A;  3VGM A;  4KH5 A;  3VF2 A;  3KLE A;  4EP5 A;  2E2P A;  2F4V K;  3PSI A;  1YF5 L;  4OO1 J;  4H4O A;  1YT3 A;  4FJN A;  3ZEU B;  3LWM A;  5F1X A;  4EAH D;  4MLH A;  1VQN N;  4CEA A;  5HOO A;  3WNE A;  1W0H A;  2Q97 A;  3L2U A;  1XC9 A;  3CCL N;  3VQ5 A;  2OTL N;  3UE5 A;  4ELU A;  1B92 A;  5AQW A;  3AVL A;  4B8C A;  4CI6 A;  4GVE A;  4IJN A;  3QEI A;  1RNH A;  4DQI A;  3A0I X;  3Q7C A;  1MWM A;  2NLX A;  4IZ9 A;  1JLF A;  4JKG A;  4FPB A;  3HJF A;  3AA3 A;  4CJQ A;  4JK7 A;  3IUC A;  1QS4 A;  3AVI A;  3LP2 A;  1S9E A;  1RT6 A;  2E1Y A;  4I2Q A;  4O8K A;  5CHI A;  3VEZ A;  3O5B A;  4A61 A;  1RGI A;  1CXQ A;  4F8R A;  2O8B A;  1RT2 A;  3H46 O;  3AVH A;  2Q0U A;  1NGJ A;  1U49 A;  1JCF A;  1XHZ A;  3O9U A;  3LPU A;  3RWU A;  1B9D A;  3I8D A;  3ZSV A;  2CH6 A;  3MX5 A;  5TKY A;  3ZT4 A;  4YOW A;  2ZE2 A;  3RRG A;  4B1V A;  1YVN A;  3D7E O;  3O4N A;  4V19 S;  4FZX C;  3TAN A;  4PUO A;  3C6A A;  3O4Q A;  2YNH A;  2Q1N A;  3O80 A;  1LOT B;  3D2E A;  4M3W A;  1JCE A;  3E9L A;  2A41 A;  1WSE A;  2VYP A;  4LF4 K;  3MMV A;  1BI4 A;  1D4X A;  2WTU A;  1QZ5 A;  4FWL A;  1L3V A;  1VQL N;  4YOR A;  4WCE L;  2RPI A;  3VPZ A;  4CF0 A;  3ENH A;  4DTP A;  3WEE A;  4JKG B;  2VWB A;  3VER A;  4NYN A;  5AQU A;  3WXJ A;  4ZTF A;  2HVH A;  3DI6 A;  4ILJ A;  3SYZ A;  3VEW A;  2KKZ A;  3D2F A;  3HTV A;  2P9S B;  4BAC A;  1FKP A;  3KWG A;  3DMJ A;  3QLH A;  4NXM K;  1CZ9 A;  4R5P A;  1IBM K;  2X78 A;  4DTN A;  1A5X A;  4F2R A;  3LZI A;  3OYI A;  3C7N A;  5CZ1 A;  1ZBS A;  5AZI A;  2ITG A;  1J6Z A;  5M1F A;  2EX3 A;  3V9S A;  4DFP A;  4DV2 K;  4DU3 A;  3G0Z A;  1NG9 A;  1IG9 A;  4M63 C;  3T1Y K;  3RMB A;  1BIS A;  1TKX A;  3C0B A;  1S1V A;  4CZF A;  4N56 A;  3AGR A;  2NRV A;  1E4F T;  4DLG A;  3K9J A;  4JI5 K;  3ZET B;  4FWO A;  4BE1 A;  1QSS A;  1NGB A;  4M7X A;  4PHT X;  5FPD A;  1NJI O;  1KXP A;  2QW9 A;  3LDN A;  3VEN A;  4CHP A;  3FR0 A;  5AQZ A;  3ENB A;  2FF3 B;  3WNH A;  3OA9 A;  4KPY A;  1KAX A;  5BPM A;  5AQT A;  1VQK N;  2P9K A;  3OS1 A;  3OS2 A;  3OYK A;  4DTM A;  3TAF A;  3AO2 A;  1C0T A;  4IG0 A;  3OHR A;  5AQG A;  3ZYY X;  2ATQ A;  4O0J A;  5GAE P;  3V9X A;  4XIU A;  1ASV A;  4EIA A;  3HPG A;  2G8V A;  1K9M O;  1X1P A;  3KZB A;  3ATV A;  2BTF A;  4DFJ A;  3OYH A;  4BRN A;  2QTD A;  3VQ7 A;  3NVK A;  3TR8 A;  1VSL A;  2E2Q A;  4BR0 A;  1RT3 A;  4WQ5 A;  1KTQ A;  1CXU A;  2QK9 A;  1WAJ A;  4OGC A;  5LMU K;  3HVR A;  2HHS A;  2Z1G A;  3BZC A;  3HI0 A;  2FF6 A;  5BN9 A;  3L3U A;  4E7K A;  4BQL A;  3GG4 A;  4DWI A;  1MDU B;  1KLM A;  4FLU A;  3CME N;  3A5N C;  4F4K A;  1ATN A;  4MDA A;  3THX B;  3UKR B;  4B1W B;  2P9S A;  5AQR A;  4FL9 A;  4CJ4 A;  4RW7 A;  4HWI A;  5HRS A;  4AHC A;  1G15 A;  4CZL A;  1XC3 A;  2B6A A;  1U4B A;  5C24 A;  2E2N A;  4O55 A;  3SZ2 A;  1BUP A;  2ASM A;  3PIP L;  2GBZ A;  4W5O A;  5J2Q A;  5BRE A;  3I55 N;  1GLD G;  4IEE A;  1DT9 A;  4FSV A;  1ATR A;  2B4J A;  4H03 B;  1NJW A;  4LFA K;  1NKC A;  1C0M A;  2QI2 A;  3OVN A;  1T05 A;  2WON A;  3CQX A;  5KTQ A;  3V9Z A;  1XHX A;  3EYZ A;  1Q9Y A;  3OYN A;  2Q0R A;  2Q3S A;  1Y64 A;  4ICL A;  4JNE A;  3K58 A;  5KQD A;  1LWF A;  4IEI A;  2HMI A;  4M3U A;  3VQE A;  5J2P A;  4BY9 C;  1P90 A;  4LD0 A;  1RTH A;  1QSY A;  1LCU A;  1LWC A;  3K5L A;  1RDU A;  4DR5 K;  1RDB A;  4JKA A;  1VHX A;  5D3G A;  3SK3 A;  1BA1 A;  3RMD A;  2BAN A;  2QWR A;  5LL6 Z;  1X9J A;  4FLX A;  1O1W A;  4F3T A;  5AQN A;  4KV8 A;  4FM1 A;  2VG6 A;  2E20 A;  1OH6 A;  4PQU A;  1HNZ K;  4KI6 A;  4E1N A;  1QQN A;  4OX9 K;  1K8A O;  1TAQ A;  1WSJ A;  4H5R A;  4KHQ A;  1RDW X;  4BC2 A;  4Y0W A;  2NRX A;  4BWM A;  4JS5 A;  2EHG A;  2OPS A;  2ZQB A;  3MN6 A;  2ZJR L;  1XWL A;  4K8Z A;  4JKC A;  3O3H A;  2KZZ A;  1ITG A;  3JS6 A;  3RRH A;  4KHW A;  4B9V A;  3VOV A;  1CZB A;  1SL1 A;  1YXQ A;  4CJL A;  4DR4 K;  4DUY K;  3HPH A;  2F9W A;  2JGU A;  3NF6 A;  3O8M A;  3D45 A;  3SPZ A;  1HQU A;  1IBL K;  2LSN A;  3SAG A;  4DV4 K;  2UYT A;  3H1V X;  4DB3 A;  3OJU A;  1LWE A;  3ZSZ A;  4X65 K;  4CJE A;  3TAQ A;  1Y97 A;  2V51 B;  2E1Z A;  3BUZ B;  2X6S A;  3ITH A;  3CPW M;  4CVN E;  2OTJ N;  1JLC A;  2IOC A;  1HYV A;  3AVC A;  4CJU A;  1O13 A;  3LPT A;  1WAF A;  4FJ9 A;  2YNF A;  3AAP A;  3AVF A;  5FPN A;  2GV9 A;  2J4R A;  1VSF A;  3RR8 A;  1Z25 A;  3A5O C;  3OW2 M;  3L2V A;  3H1Q A;  1QQC A;  4HCB A;  1X9W A;  2ZM6 K;  3HT3 A;  1NNE A;  3TU5 A;  1N6Q A;  1LAW A;  4H5N A;  1TGO A;  4BRC A;  3CC4 N;  1VQ7 N;  1BWF O;  4EZ9 A;  4LF8 K;  3V81 A;  1Q8I A;  2P9N A;  3QDK A;  2HNY A;  3EKU A;  2IVP A;  1A5W A;  3TAM A;  1U2V A;  3UKR A;  1JLA A;  3JAM O;  2ZWH A;  2KQ2 A;  1VQ4 N;  3MCP A;  5KRS A;  3NAE A;  1HKG A;  1WSG A;  3KK1 A;  3ZLJ A;  1C1C A;  1NOZ A;  4CHY A;  3IDH A;  3PIO L;  4WFA L;  2YHY A;  3HVT A;  1NK9 A;  2P5O A;  1GLL O;  3K5M A;  3FFI A;  4CEC A;  4BRI A;  5AQX A;  4BDY A;  4O44 A;  2HB5 A;  4FM0 A;  4CFB A;  4BR4 A;  4BRA A;  2A3Z A;  1DEJ A;  4DTO A;  3CD6 N;  2QXL A;  3SPY A;  4JK9 A;  4KB1 A;  1UAX A;  3D2E B;  3THW B;  1R0A A;  4BDP A;  4BRE A;  4KKO A;  5I9E B;  1JLQ A;  3VA0 A;  2KTQ A;  4KBO A;  5GIP A;  5DM6 L;  4LSL A;  3DXK A;  3L3V A;  4IDK A;  3S3O A;  1REV A;  3ASM A;  2P5G A;  1RBV A;  3ZX2 A;  1S5J A;  3H6E A;  3AY9 A;  4BWJ A;  2KFZ A;  5FLX O;  4JI8 K;  2I7N A;  4CBW A;  1W2B M;  4YDU C;  4W5T A;  2CGL A;  1X3N A;  4LH4 A;  1VQ5 N;  3VES A;  3RSE A;  4DS4 A;  4FJG A;  4Z4G A;  3UKU B;  4DUZ K;  1YTA A;  3MN5 A;  3O3F A;  3LZJ A;  2F9T A;  4HHT A;  2VGM A;  3AVM A;  3K5O A;  4Q0B A;  3S41 A;  3FZK A;  2DFH A;  4CK1 A;  1NGG A;  2OPQ A;  4FOE A;  2FSJ A;  5BR9 A;  2A1R A;  3EE9 A;  3WQT A;  3E9P A;  4AIL C;  4CJF A;  1RTJ A;  5JLH A;  1D9D A;  3DWL A;  1U47 A;  3CFP A;  1BCO A;  5C42 A;  4WFB L;  4CFA A;  3AO5 A;  4H4M A;  3MX2 A;  3CCQ N;  5E41 A;  1JCG A;  3OBW A;  5CE3 A;  1KSP A;  4XH5 A;  3BF3 A;  1QSL A;  2F8S A;  3BGR A;  1QHT A;  1EQY A;  5HRO A;  4QOZ B;  3BDP A;  2GEM A;  1D8Y A;  4YY3 K;  3A5L C;  5BN8 A;  1K6Y A;  3RSE B;  1UOC A;  3NFA A;  3A2F A;  5AQL A;  3L4I A;  2P9U B;  2ZD1 A;  4B8A B;  1T03 A;  3CF5 L;  1QZ6 A;  3P31 A;  4DTU A;  3DXK B;  3EN9 A;  1I94 K;  4DLE A;  4JI2 K;  4MDB A;  4DR7 K;  3GDQ A;  5C2F A;  3THY B;  1WLJ A;  2AA4 A;  1UWB A;  3VN5 A;  3KIO A;  4FWR A;  4O5B A;  2GTD A;  3JXU A;  5BPL A;  3F9M A;  1K8K A;  4FJ8 A;  2P1J A;  5EY4 A;  3ZSX A;  2XY6 A;  4WFN L;  3HK2 A;  1XNQ K;  3IKM A;  1C6V A;  4NO7 A;  1YVU A;  4ILG B;  4DTX A;  2WOM A;  4YFU A;  5HP1 A;  5AZJ A;  4CJ7 A;  4DFK A;  2W41 A;  2ASP A;  4YNQ A;  2YCH A;  4Z4F A;  2ZJP L;  1U6Z A;  1HRH A;  4CJ3 A;  1XUP O;  4NYF A;  3VEO A;  4CZH A;  3TSP A;  1S22 A;  4E19 A;  2ZJQ L;  4LSN A;  4WYB A;  3LAL A;  4JKF A;  1GLF O;  3VGL A;  5KGW A;  1BDG A;  3KLH A;  5GAH P;  3D6R A;  3VEV A;  4BVP A;  1FW6 A;  2JLE A;  5AR0 A;  4BRD A;  1EX4 A;  1J5E K;  4DQQ A;  3KLG A;  4H0T B;  2FSK A;  3LM2 A;  3M5R A;  2RHK A;  1RT7 A;  3C95 A;  4XH1 A;  3ZSR A;  1N32 K;  3TTC A;  3J80 O;  1KVA A;  2UU9 K;  1NGF A;  1Z05 A;  1IH7 A;  1DGK N;  2D5R A;  1YHQ N;  3SUP A;  1XQS C;  3T19 A;  4JD2 B;  3K59 A;  3D2F B;  4E7H A;  2FBY A;  4ISG A;  2W6K A;  3CCS N;  3KLF A;  3P38 A;  5TKW A;  1VQM N;  4X62 K;  4CHO A;  1C1A A;  4WE1 A;  5IT9 O;  4C8M A;  4JN4 A;  1Q18 A;  3DM2 A;  4K25 A;  2QWN A;  3R9P A;  5KI6 A;  1IJJ A;  4EZ6 A;  1NMN A;  4FWN A;  1NK7 A;  5K14 A;  3CIP A;  4J2E A;  4B3M K;  4FJI A;  1KD1 O;  4CEB A;  1RIL A;  3SAH A;  4HUF A;  1RFQ A;  5AQF A;  3EZ5 A;  1HX1 A;  4W5Q A;  4JLH A;  4B1Z A;  1HKB A;  3CJ9 A;  2YNG A;  5GAD P;  4E7I A;  4B9Q A;  2P9L A;  3I33 A;  2RKI A;  3PO5 A;  1BL3 A;  1BIZ A;  2KHO A;  1TL1 A;  2FLO A;  4CJV A;  4TSX A;  4M3Y A;  3ALY A;  1WSF A;  2GWJ A;  3NF8 A;  2IGI A;  4BRP A;  3MEE A;  3MXJ A;  2NRR A;  4DR6 K;  1BA0 A;  3SV3 A;  1FK9 A;  1NKE A;  1U45 A;  2W40 A;  3O3G A;  4IFY A;  5LY3 A;  1X9S A;  5A2Q O;  2X6N A;  2H3G X;  3LM9 A;  4U67 L;  3O9T A;  4AQY K;  2WBN A;  5HL7 L;  2RN2 A;  1BO5 O;  1TK0 A;  3SI6 A;  1L3U A;  3J7Y P;  4EHU A;  5J2N A;  1N5Y A;  4GVM A;  1NBW A;  2P9I B;  3JYT A;  4CD3 A;  2OAN A;  3ZSY A;  1TL3 A;  5F2R A;  1ZC6 A;  2UUB K;  2E6L A;  2Y1I A;  2G8H A;  3SBG A;  3OYE A;  4B3O A;  1QQO A;  3KK7 A;  2HVI A;  4Z4I A;  5KPR A;  3CMA N;  3TWH A;  3O08 A;  4FJK A;  2HW3 A;  3O1W A;  4KTQ A;  1HLU A;  4DKW A;  4DR3 K;  4LF5 K;  2BDP A;  2I7P A;  3LP0 A;  1J9A A;  3J81 O;  1HNW K;  3J7A P;  3H3O B;  3CCR N;  2ZGZ A;  2YKN A;  1QVF M;  3LL3 A;  1E3M A;  4E1M A;  1QTM A;  4CHQ A;  4OKJ A;  3M8Q A;  3ID8 A;  2QWQ A;  4YOY A;  2GUP A;  4H0P A;  4CZE A;  4G1Q A;  3HPO A;  2HHH K;  3VQ9 A;  1ILY A;  4ISE A;  4DCH A;  2NRT A;  4F9O A;  1T7P A;  3OYL A;  4AF1 A;  5M1K A;  3IG1 A;  1HYS A;  2O8E A;  4FWQ A;  2P9N B;  1C0G A;  4BE2 A;  5JS1 A;  3G71 N;  1X9M A;  2P51 A;  4MLE A;  2QXF A;  4UQG A;  4PL8 A;  3DAW A;  3K57 A;  1YJN N;  1TV6 A;  2QWO A;  4DU1 A;  4IDH A;  3IRX A;  4ELV A;  4KRF A;  2FBT A;  3NH0 A;  4DR2 K;  3SNN A;  4Y1C A;  2UXB K;  1ZBF A;  2R7Y A;  2NNW A;  4PL7 A;  3PUF A;  4ZTJ A;  3C6T A;  3AA2 A;  4CF2 A;  4YOT A;  2QM1 A;  4CZI A;  1Q86 O;  3HST B;  4CJP A;  1NOY A;  5EU7 A;  3CQ8 A;  2QKB A;  4XEI A;  3KVG A;  3CCJ N;  3H3N O;  1GOA A;  2YV0 X;  5KRT A;  1ZBH A;  4FWP A;  4RG8 A;  3O6W A;  4FO0 A;  1GLE G;  1N36 K;  3M3Z A;  3WXL A;  5BR8 K;  1UA1 A;  4B3R K;  1SV5 A;  5BRH A;  4NB4 A;  3MXM A;  1V4T A;  4IXC A;  4L3Q A;  4K42 A;  1XI1 A;  1L5U A;  1T8E A;  4DU4 A;  2VWJ A;  3DYA A;  1Q7Y O;  1NM1 A;  5AQS A;  4B1U B;  4EFH A;  1EWQ A;  3GBT A;  3QIP A;  2HBL A;  3AAQ A;  2NRW A;  3VEY A;  4NCB A;  3AO1 A;  1BU6 O;  1VQ8 N;  2IIR A;  2DFE A;  2KLA A;  1HNI A;  5JLF A;  2IS3 A;  4GNI A;  2CGJ A;  3W0L A;  1C0F A;  3K0S A;  4RWT A;  4HUE A;  2IVN A;  1W9H A;  1X3M A;  2HF4 A;  1ASU A;  3ZT0 A;  2E88 A;  1J5O A;  1SUQ A;  3MEC A;  2VQE K;  4GY2 B;  3SBT A;  5DK5 A;  4DG1 A;  3L2Q A;  3SJJ A;  3DXM A;  4NCG A;  1SL2 A;  1OVY A;  3CG7 A;  4FK0 A;  5HLF A;  3CC2 N;  1WN7 A;  4B1Y B;  4K41 A;  4NLC A;  4E7L A;  1KAY A;  4BR9 A;  3QML A;  3QET A;  1TKT A;  1TUU A;  3AGK A;  3U6F A;  4LFC K;  1N8R O;  2BUP A;  3HP9 A;  3CJ1 A;  3NVM A;  1TK8 A;  2JWL A;  4DQ8 A;  3ZX0 A;  2RF2 A;  3NF7 A;  3L0Q A;  1JLE A;  4K8X A;  4CEZ A;  3VQ4 A;  3U9Z A;  4PA1 A;  1JJ2 M;  3LP3 A;  1U04 A;  2O8F A;  1Q82 O;  2XY8 A;  1W97 L;  3OYB A;  1NU0 A;  4DV5 K;  3QIO A;  4FWS A;  1GOB A;  2IC3 A;  4LC9 B;  4CJ5 A;  3PX6 A;  4CZG A;  1T6D A;  3CJC A;  1EO1 A;  4C1N I;  1CLQ A;  2WFB A;  3ISN C;  3DLH A;  1BIU A;  3P5J A;  2DFF A;  1J53 A;  1HR0 K;  1D9F A;  1NJZ A;  3T1A A;  4CE9 A;  2OYQ A;  1BHL A;  3PSF A;  3T1H K;  3DJC A;  5C10 A;  4F2S A;  3S3M A;  3MCA B;  1EWR A;  2KFN A;  3R1X A;  4ZHR A;  4KO0 A;  4Q5V A;  4AM7 A;  4H0Y B;  1YIJ N;  1B9F A;  3VF6 A;  2V52 B;  4CFD A;  2PYL A;  4BRL A;  3CI5 A;  3VTH A;  1RTI A;  2G8F A;  1OH7 A;  4CER A;  3HM9 A;  5HRN A;  4KHS A;  2O8D B;  4M7Y A;  2O8F B;  4CED A;  3L6Q A;  2FSN A;  4X66 K;  4DV1 K;  5EX5 A;  3CHW A;  3HP6 A;  4CJK A;  3NGZ A;  2B5J A;  4RW9 A;  3G4S N;  2Z1H A;  2VG5 A;  4OKK A;  1KRP A;  3SUN A;  4JI3 K;  4CEQ A;  4BG8 A;  3CM5 A;  5AQM A;  4B9U A;  3WXM B;  1ASW A;  4IJA A;  1FKO A;  4DSL A;  2HHU A;  4KB0 A;  1RT1 A;  1Z26 A;  1RDA A;  2FXU A;  1N34 K;  3OYA A;  5JIC A;  4DV7 K;  3KJV A;  4AHS A;  4DV3 K;  1HYZ A;  3FZH A;  4A62 A;  1JLB A;  4WQ4 A;  3CER A;  3B6O A;  4F3O A;  3O9S A;  1ZBU A;  4PWD A;  3BP8 A;  1CZA N;  3AVG A;  3R8E A;  1C0U A;  3WXK A;  4JI6 K;  4J2A A;  4DSJ A;  5I42 A;  4PKI A;  1FXX A;  1RCH A;  4FJJ A;  2HF3 A;  5AQK A;  3KWI A;  4A5B A;  5T7B A;  4N5S A;  2A5X A;  1VSI A;  4CGI A;  4PKH A;  2F7T A;  3RMC A;  4FVM A;  3LDL A;  5KPZ A; 
#chains in the Genus database with same CATH homology
 4FWK A;  3CJB A;  3L4Q A;  4GV9 A;  1S22 A;  4BRM A;  2ZJQ L;  1GLA G;  4WYB A;  3C7N A;  1SAZ A;  4JKF A;  1ZBS A;  2AP1 A;  5AZI A;  5GAG P;  1GLF O;  4J8F A;  4UY8 O;  1J6Z A;  5M1F A;  3FE1 A;  3VGL A;  1BDG A;  2YHX A;  3K9K A;  3KHY A;  4JKB A;  5GAH P;  3D6R A;  3VEV A;  1QHA A;  3VEX A;  4BVP A;  5AR0 A;  3ID6 A;  4BRD A;  4M63 C;  1QVG M;  3QBX A;  5AQY A;  3ENO A;  3C0B A;  4CZF A;  4H0T B;  5C2D A;  2FSK A;  3LM2 A;  3AGR A;  2NRV A;  3CJ7 A;  2RHK A;  3M5R A;  4G9Z A;  1E4F T;  4A5A A;  4XH1 A;  3VET A;  4IO9 L;  1MWK A;  3K9J A;  4CBX A;  5AFU A;  4JAX A;  3TTC A;  3ZET B;  1NGF A;  1Z05 A;  1DGK N;  1NWK A;  3B8A X;  4FWO A;  4OPH A;  3FZF A;  1YIT N;  1YHQ N;  1VQ6 N;  1NGB A;  4M7X A;  4PHT X;  3VEO A;  5FPD A;  3CPE A;  1NJI O;  2V7Y A;  4YDU A;  1KXP A;  5ADX H;  5BRD A;  3N4Q A;  3ULE A;  1XQS C;  2QW9 A;  3EZW A;  3LDN A;  3VEN A;  2WC9 A;  3FR0 A;  3ATU A;  4JD2 B;  3U8X A;  5AQZ A;  3ENB A;  2FF3 B;  5AFU H;  3D2F B;  2WUS A;  3VTI A;  1DKG D;  1YJW N;  4ISG A;  1K73 O;  3OA9 A;  1M90 O;  2HBJ A;  3CCS N;  1KAX A;  5BPM A;  3E1Y A;  5AQT A;  3P38 A;  5TKW A;  1VQM N;  2P9K A;  3EKS A;  1VQK N;  2E2O A;  3QBW A;  2ZF5 O;  2YJF A;  4BVO A;  4JN4 A;  3R3L A;  1Q18 A;  2HBK A;  1Z6R A;  4K25 A;  1WUA A;  2QWN A;  1NGA A;  4Z94 A;  5JVH L;  3ZYY X;  3OHR A;  5AQG A;  3R9P A;  1IJJ A;  5JVG L;  2IVO A;  4FVU A;  1KAZ A;  2D0O A;  4FWN A;  3ZX3 A;  3MWP A;  3CIP A;  3UKU A;  1KD1 O;  5GAE P;  3SAH A;  4BRH A;  3C65 A;  4K43 A;  1RFQ A;  4EIA A;  5AQF A;  3CCV N;  1HX1 A;  4B1Z A;  3VMF B;  4BGB A;  1HKB A;  3KZB A;  1K9M O;  3CJ9 A;  3ATV A;  4BRO A;  5GAD P;  2BTF A;  4B9Q A;  2P9L A;  3I33 A;  4BRN A;  4BC3 A;  2QTD A;  3HBT A;  2KHO A;  4CD1 A;  3NVK A;  2FLO A;  2E2Q A;  1ESV A;  4BR0 A;  1NGE A;  3H45 C;  4WQ5 A;  2GWJ A;  4KH4 A;  3LDO A;  2YJE A;  4BGA A;  4BRP A;  3HI0 A;  2FF6 A;  2NRR A;  5AZJ B;  5BN9 A;  5DM7 L;  1BA0 A;  4BQL A;  4H0O A;  3GG4 A;  4FOI A;  2W40 A;  1MDU B;  3EO3 A;  5M1N A;  3P39 A;  5LY3 A;  4JHD B;  4CBU A;  2H3G X;  3LM9 A;  4U67 L;  3O9T A;  3CME N;  2WBN A;  5HL7 L;  3A5N C;  1SQK A;  1ATN A;  5EXW A;  4MDA A;  1IG8 A;  1BO5 O;  1R59 O;  3MK6 A;  3UKR B;  5FPM A;  4B1W B;  2P9S A;  4YOV A;  4EHU A;  5AQR A;  4FL9 A;  4HWI A;  1NBW A;  2P9I B;  3U9D A;  4RTF D;  4IOX A;  4CZL A;  1XC3 A;  4CD3 A;  3RVC A;  2OAN A;  5KPT A;  4XH4 A;  2E2N A;  5F2R A;  5CR4 A;  2P9P A;  1BUP A;  2P9L B;  3WEE B;  1ZC6 A;  4E1J A;  1U2V B;  2ASM A;  3QFP A;  3PIP L;  1NGH A;  2Q2R A;  3SBG A;  5BRE A;  3I55 N;  1GLD G;  4IEE A;  1DT9 A;  4A59 A;  3E66 A;  4FSV A;  3VF4 A;  4MO4 A;  3CC7 N;  1QQO A;  3KK7 A;  1ATR A;  4CZK A;  5KPR A;  2RE2 A;  4H03 B;  3CMA N;  5AZI B;  3O08 A;  4BG9 A;  2QI2 A;  3O1W A;  3ZET A;  5C12 A;  1HLU A;  3CQX A;  3DLL L;  4DKW A;  3OBY A;  5JMV A;  4ILH A;  5H1S Q;  3J7Z O;  3HM8 A;  5GIO A;  2I7P A;  2Q0R A;  3H3O B;  3CCR N;  4U7B A;  1Y64 A;  4JNE A;  3CCU N;  5KQD A;  4IEI A;  2ZGZ A;  1ATS A;  1BG3 A;  1QVF M;  3LL3 A;  1QQM A;  3HRG A;  5BRF A;  2NRZ A;  4BY9 C;  1P90 A;  2P9K B;  3O9Q A;  4KH6 A;  3F5T A;  3ID8 A;  2QWQ A;  3FGU A;  1YJ9 N;  1LCU A;  3LDQ A;  1RDU A;  1YAG A;  4JKA A;  4QS8 A;  2E8A A;  3SK3 A;  4R79 A;  1BA1 A;  3CCE N;  4YOY A;  2GUP A;  2QWR A;  4H0P A;  1X9J A;  2P9I A;  5M1O A;  3WUH A;  2NRH A;  4CZE A;  2PBD A;  2D4W A;  3AAR A;  1ILY A;  4ISE A;  2A40 A;  4BR5 A;  4DCH A;  2NRT A;  5AQN A;  1OKJ A;  5EVZ A;  4F9O A;  3I56 N;  1NGI A;  5AQQ A;  4AF1 A;  2E20 A;  5M1K A;  1GLJ O;  4NLB A;  4FWQ A;  3DXM B;  2P9N B;  3P4I A;  1C0G A;  4WQ4 C;  3TSU A;  3UB5 A;  1QQN A;  1S72 N;  1K8A O;  4C1N K;  4WF9 L;  3G71 N;  5AQP A;  3SAF A;  2GX9 A;  4H5R A;  4JKE A;  3O4W A;  4JK8 A;  4MLE A;  3SLC A;  4H5V A;  1RDW X;  4PL8 A;  3DAW A;  4FPA A;  2QWM A;  4H5T A;  4BC2 A;  4Y0W A;  1YJN N;  2NRX A;  4HTL A;  4MO5 A;  4JHD A;  5E84 A;  2QWO A;  3I8B A;  3MN6 A;  4I6M B;  2ZJR L;  4IDH A;  1M1K O;  4FWM A;  3M6G A;  5E26 A;  4JKC A;  2P9P B;  1SZ2 A;  2QWL A;  5M1P A;  3E9O A;  5LJV A;  5C0Y A;  5B8H A;  3JS6 A;  3SJH A;  4BRG A;  5GIN A;  5MLC Q;  1H1V A;  3J8A A;  4C23 A;  2GWK A;  3VOV A;  2NNW A;  4PL7 A;  1GLB G;  1YXQ A;  4YOT A;  2QM1 A;  5KQ8 A;  4JD2 A;  5AQI A;  4CZI A;  2CGK A;  2F9W A;  4O5F A;  1Q86 O;  4A57 A;  1NGD A;  1ZXO A;  3O8M A;  3HOS A;  4RCH A;  4XEI A;  3KVG A;  3Q7B A;  3CCJ N;  3H3N O;  1NMD A;  4BC5 A;  4FWP A;  3GE1 A;  3SAG A;  3O6W A;  3WT0 A;  4FO0 A;  1E4G T;  1GLE G;  2YI1 A;  2UYT A;  3M3Z A;  4GV3 A;  3H1V X;  3NMU A;  3WXL A;  3T7Z A;  4DB3 A;  3IFR A;  5BRH A;  3T69 A;  2PFU A;  2PAV A;  4NB4 A;  5FPE A;  3HOT A;  1V4T A;  3CCM N;  1S3X A;  2E1Z A;  2V51 B;  1TYQ A;  5AQJ A;  4IXC A;  3BUZ B;  4L3Q A;  4K42 A;  4BRQ A;  3CPW M;  2OTJ N;  2YHW A;  4CZJ A;  3MDQ A;  3CQY A;  1O13 A;  2D1K A;  1Q7Y O;  4GV6 A;  1NM1 A;  4BRF A;  3AAP A;  5AQS A;  5FPN A;  4QS7 A;  2J4R A;  4B1U B;  4EFH A;  3GBT A;  5BPN A;  3A5O C;  2HBL A;  3AAQ A;  3OW2 M;  2NRW A;  1MA9 B;  3H1Q A;  3GOI A;  3G25 A;  1G99 A;  4IO8 A;  3FZM A;  4JEP A;  2Q36 A;  3MN7 A;  1BOT O;  4JKD A;  3VEY A;  3R6M A;  1KQS M;  1VQ8 N;  1BU6 O;  3TU5 A;  4IOC L;  2IIR A;  3QIC A;  4H5N A;  2V7Z A;  3O9R A;  4BRC A;  3CC4 N;  1VQ7 N;  2KLA A;  1BWF O;  3SMS A;  5JLF A;  2EWS A;  2HMP A;  5AQO A;  4GNI A;  2CGJ A;  1C0F A;  3TTD A;  1NLV A;  2P9N A;  3QDK A;  3W0L A;  4RWT A;  3PLA A;  2JWK A;  3EKU A;  2IVP A;  2IVN A;  1U2V A;  3UKR A;  1X3M A;  2HF4 A;  2ZWH A;  2E88 A;  3HZ6 A;  3U4L A;  1K8K B;  1VQ4 N;  1SS6 A;  4GY2 B;  2P9U A;  3MCP A;  4H0X B;  3SBT A;  3C6H A;  1HKG A;  3LDP A;  4BC4 A;  3IDH A;  3PIO L;  4WFA L;  2YHY A;  3DXM A;  3TTF A;  3ZEU A;  3QB0 A;  2YX6 A;  1GLL O;  1OVY A;  2A6A A;  4BQZ A;  3CC2 N;  4BRI A;  2QWP A;  5ADX A;  1NGC A;  4B1Y B;  5AQX A;  3MN9 A;  1T3V A;  4K41 A;  4NLC A;  2DPN A;  2HBM A;  1KAY A;  3G6E N;  3FZL A;  4BR9 A;  3QML A;  4PKG A;  2Q31 A;  3SMP A;  4BR4 A;  1TUU A;  2A3Z A;  3AGK A;  4BRA A;  1DEJ A;  3CD6 N;  5EOY A;  2QEX N;  4YOX A;  1TYQ B;  2BUP A;  2GEL A;  2QXL A;  3CJ1 A;  3EE8 A;  3NVM A;  4JK9 A;  1N8R O;  3HSC A;  1HKC A;  2JWL A;  1GLC G;  2VCP A;  4QS9 A;  2QA4 N;  4DQ8 A;  3D2E B;  4IFE A;  5F0X A;  3ZX0 A;  2BH1 A;  4BRE A;  5I9E B;  3W3D A;  3L0Q A;  4H0V B;  3CXC M;  1VQO N;  4KBO A;  1HPM A;  3GL1 A;  4I6M A;  5M1Q A;  3U9Z A;  1TUY A;  4B1X B;  5GIP A;  3DXK A;  5DM6 L;  1JJ2 M;  5AQV A;  1VQ9 N;  4DHY A;  3ZX2 A;  1YUW A;  1Q82 O;  3H6E A;  3AY9 A;  3TPQ A;  1W97 L;  2I7N A;  4CBW A;  1W2B M;  4YDU C;  2VGN A;  4FWS A;  4JKH A;  2CGL A;  2A42 A;  3WQU A;  4LC9 B;  1VQP N;  1X3N A;  1VQ5 N;  3A8Y A;  3O1B A;  3VGM A;  3VES A;  3RSE A;  4KH5 A;  3VF2 A;  3UKU B;  4CZG A;  1T6D A;  3CJC A;  1EO1 A;  3QFU A;  3EL2 A;  4O8U A;  3MN5 A;  2WFB A;  4C1N I;  2E2P A;  1YF5 L;  2F9T A;  4OO1 J;  2VGM A;  2ASO A;  1WOQ A;  2D0P A;  3ZEU B;  1YI2 N;  5F1X A;  4EAH D;  4MLH A;  3S41 A;  3A5M C;  1VQN N;  3F2K A;  3FZK A;  1NGG A;  1V4S A;  4IWV A;  4FOE A;  2FSJ A;  3BEX A;  5BR9 A;  5HOO A;  3DJC A;  5C10 A;  3CJA A;  2Q97 A;  3EE9 A;  2ZGY A;  3CCL N;  2CH5 A;  2HOE A;  5AQH A;  5LJW A;  3WQT A;  3TSQ A;  1T44 A;  3E9P A;  3MCA B;  4A2A A;  3UE5 A;  2OTL N;  3R1X A;  4BRK A;  5AQW A;  5JLH A;  3DWL A;  4CI6 A;  4AM7 A;  4GVE A;  4H0Y B;  4WFB L;  1YIJ N;  4IJN A;  3FFK B;  4OPA A;  3A0I X;  2V52 B;  3Q7C A;  1MWM A;  2NLX A;  4IZ9 A;  1HJO A;  4JKG A;  3VF6 A;  4BRL A;  3CI5 A;  4FPB A;  3VTH A;  3MX2 A;  4JK7 A;  2NZT A;  3IUC A;  1VAZ A;  3CCQ N;  2ITM A;  1Q81 O;  4O8K A;  1JCG A;  2E1Y A;  5CHI A;  4WQ5 C;  3OBW A;  5CE3 A;  3N4P A;  3O5B A;  3VEZ A;  1RGI A;  3CET A;  4A61 A;  4XH5 A;  5C15 A;  3BF3 A;  4M7Y A;  1EQY A;  3L6Q A;  5KPZ A;  1KC8 O;  2FSN A;  4BR2 A;  2GEM A;  3H46 O;  3A5L C;  5BN8 A;  2Q0U A;  5EX5 A;  3CHW A;  3MWT A;  3RSE B;  1NGJ A;  4IOA L;  3L4I A;  1JCF A;  2P9U B;  5AQL A;  3G4S N;  1T6C A;  3CF5 L;  3O9U A;  1QZ6 A;  3P31 A;  4H5W A;  4BR7 A;  4CZM A;  3DXK B;  3EN9 A;  5AQM A;  4BG8 A;  2CH6 A;  3MX5 A;  4MDB A;  3C7N B;  3WXM B;  3GDQ A;  5TKY A;  5C2F A;  3FLC O;  4YOW A;  4YOU A;  4IJA A;  3WXI A;  4B1V A;  1YVN A;  2AA4 A;  3D7E O;  4FWR A;  2FXU A;  2GTD A;  3JXU A;  4ISF A;  3C6A A;  5BPL A;  3O80 A;  2Q1N A;  1LOT B;  3D2E A;  2HST A;  3F9M A;  5JIC A;  1K8K A;  1JCE A;  5EY4 A;  3E9L A;  2A41 A;  3FZH A;  2VYP A;  3MMV A;  4A62 A;  3M1F A;  4WFN L;  1D4X A;  1QZ5 A;  1HUX A;  4FWL A;  4WQ4 A;  1VQL N;  3IKM A;  3CER A;  4YOR A;  4WCE L;  3VPZ A;  3O9S A;  3ENH A;  3WEE A;  4JKG B;  3BP8 A;  4NO7 A;  1CZA N;  4ILG B;  2VWB A;  3R8E A;  3IMX A;  5AQU A;  3VER A;  3WXJ A;  3WXK A;  5AZJ A;  4CJ7 A;  2W41 A;  2ASP A;  4PKI A;  2HF3 A;  2YCH A;  5ELZ A;  5AQK A;  3VGK A;  4A2B A;  3ULE B;  1P8Z A;  3KWI A;  4ILJ A;  4AM6 A;  2ZJP L;  4A5B A;  3BF1 A;  3VEW A;  2KKZ A;  4EHT A;  3D2F A;  1U6Z A;  2A5X A;  3HTV A;  2P9S B;  1XUP O;  4PKH A;  2F7T A;  3KWG A;  3LDL A;  4CZH A;  3TSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...