5C15A

K428a muntant nuclease domain of the large terminase subunit gp2 of bacterial virus sf6 with manganese
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
224
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
total genus 80
structure length 224
sequence length 241
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c15A00
5M1FA 5C15A 5C2FA 3C6HA 4IDHA 5M1KA 4IEEA 5C10A 5C2DA 5M1NA 3C6AA 5M1OA 5M1QA 3CPEA 5M1PA 5C12A 4IEIA 4IFEA
chains in the Genus database with same CATH superfamily
3DRPA 3C6HA 4JKBA 1L3SA 4IOAL 1YVNA 4IJAA 3D0PA 1VSMA 1C1AA 3H46O 5AZIA 4IWVA 5KPZA 4KAZA 3PLAA 4MLEA 5LL6Z 3O4NA 5AQNA 2ZJPL 4CJVA 3V9WA 3F9MA 2RPIA 4DF8A 2GUIA 2A40A 1WNSA 3FLCO 4JS4A 3GOIA 5EXWA 3M8QA 3ZT1A 5JICA 4Y1CA 3HSCA 1HJOA 5SZTA 4BY9C 4CD1A 3VA3A 1KVAA 2KW4A 4CJQA 1HR0K 1YAGA 3ZSQA 4FWSA 5SWMA 4JLHA 2IDOA 1U45A 3A5MC 4QAGA 4CECA 4BG8A 2WUSA 5BRFA 3WXLA 1X3NA 4A2BA 4R79A 1KAXA 1D9DA 3CQYA 4FM2A 3LP1A 4FJMA 3A8YA 4W5TA 1MDUB 2IIRA 2PYJA 3ZT0A 4O0JA 2NRWA 3AA2A 4ICLA 3CF5L 4AH9A 1IKVA 4FK2A 5A2QO 3CCUN 5HLFA 3S3OA 4DSFA 1X9WA 3E9OA 1RDDA 3OBWA 1XMOK 1WSFA 3V9SA 1SS6A 3T3FA 2KHOA 4JI2K 1XI1A 1NBWA 1K8KA 4EFHA 5AQLA 1HX1A 5AQWA 4OO1J 3P83D 4BR4A 3SV3A 5JVHL 1JLCA 4IXCA 2JGUA 4KH5A 4JKDA 2FBVA 3TWHA 3ID6A 1WUAA 3I8BA 3NH0A 2VWJA 1QQCA 1NGDA 1VSFA 2X6NA 2KQ2A 4LD0A 1YTUA 4KRFA 4DU3A 1K73O 3U9ZA 3FZFA 4DV2K 4OKKA 2OPSA 5BN8A 2DFEA 1GLBG 3QBWA 1GLDG 3KKSA 4JKAA 3QNOA 3THXA 3FFKB 2ZWHA 3RSEB 1MU2A 3M6GA 2HBJA 1A5VA 1LWCA 4CEQA 1IBLK 4M3XA 3QEXA 4BRCA 3THWB 3I56N 4M3YA 1GLJO 1LV5A 3W0LA 1RTDA 3WNEA 1HLUA 3QBXA 4DLEA 4ZTJA 4FLVA 3HJFA 3OYKA 3EE9A 3LDOA 1JLBA 1JLQA 3IFRA 4CFDA 4B08A 3TR8A 1BG3A 4DV3K 4BGAA 3DLRA 2I7PA 1WAFA 4M63C 1OH8A 2HHUA 3HOTA 1ZBUA 4A59A 4E7HA 3ASMA 3RMDA 4IFYA 2ATQA 3VQAA 1P90A 2P9NB 1RFQA 4AHUA 3NGIA 1J53A 1HNIA 1ASUA 1RT4A 3CJCA 4B9QA 2G8FA 1YTAA 3IDHA 2G8HA 3VEYA 2YNHA 2NRVA 2Z1GA 4O8UA 3HTVA 4FW2A 4DG1A 1WSIA 4C8NA 3QLHA 4BVOA 3TI0A 4CFAA 3OTOK 2VG5A 4I2QA 4CEAA 3C6UA 4B1ZA 4CZGA 2OPQA 4DR7K 5M1KA 2CH5A 3BP8A 4H5RA 5AFUH 5C10A 3LDQA 1XQSC 1QVGM 4DV0K 3SCXA 3DXKB 2UUCK 2RF2A 1D4XA 3R9PA 3SK3A 4OLAA 2E1ZA 1S6QA 2HBLA 2E6LA 1VSEA 3NH1A 3VQ4A 4O8KA 2KZZA 4FPAA 2P5OA 1VQ6N 3FZLA 2HHHK 4CEOA 4MFBA 1J5EK 3ATUA 5FPMA 1QSSA 3QO9A 3ZX0A 1RDUA 4TSXA 3QERA 1LAWA 3M3ZA 3R1XA 3L2UA 2DTUA 2E88A 1ATNA 2AP1A 2OTJN 1BQNA 5AQXA 2UXDK 4NYNA 2E4LA 1TV6A 2A5XA 2YCHA 2D0CA 2YX6A 3QFUA 4PA1A 2CGJA 2E8AA 3AGRA 4KHSA 3M8RA 4DS5A 4QS7A 3KK1A 4E89A 2YJFA 5AQQA 3G25A 3SLCA 4DFJA 1GOCA 4HVJA 4F9OA 1D9FA 3FZHA 4DCHA 4B9MA 4CD3A 2IVNA 5CR4A 3LZIA 3V9XA 3GDQA 5AQFA 2QTDA 3O5BA 3WXMB 4B9SA 4DQIA 3AA3A 5HP1A 4HCCA 5KRTA 3U9DA 5GIOA 1W97L 2PZSA 3TAEA 3RSEA 4JD2B 4ISGA 3AVNA 1YT3A 2DFHA 4DTOA 3THWA 4KI4A 4PKGA 3MEGA 4OVLA 1LWEA 3MXMA 3BDPA 4BR5A 3ITHA 1KQSM 4J2EA 3NFAA 4EAHD 4KTQA 1N6QA 2FF6A 4FWPA 3LPTA 3SUQA 2P5GA 3BEXA 3THYB 4M42A 4QOZB 4KHWA 4H4MA 1BQMA 1CZ9A 1NOZA 5M1NA 3QEIA 2BTFA 2P9NA 4WQ4C 4BDPA 2B4JA 1YF5L 5KPRA 4FJ7A 4JI3K 1S9EA 4BRIA 3VA0A 4A62A 2V51B 4KTWA 1V4SA 3MDQA 3WUHA 5J2NA 1NJZA 4FJIA 1VQ5N 4BR7A 4FWNA 3JS6A 3VETA 1VHXA 1H1VA 3V81A 3KKRA 3ZX3A 2WFBA 5KI6A 4DTMA 1WOQA 3CYMA 1XNQK 3TPQA 1ZC6A 3ZSRA 4MO4A 3J81O 3DXMB 1TKDA 1IBKK 3DLGA 4N5SA 3KHYA 3FZMA 1EQYA 1BHLA 1RGIA 4O55A 5BRHA 3O1WA 5HRRA 2HHSA 4CEFA 4F4KA 4KPYA 3DXKA 1RT2A 3WNGA 4DTUA 3AVGA 4DU4A 4Z4EA 5KGWA 3V4IA 3EYZA 3CC2N 4H0TB 1OVYA 4DR5K 4C8KA 4CI6A 2FC0A 4CW7B 3KWGA 1Q18A 4B1YB 4E3SA 3ZT2A 1KLMA 5CE3A 1J54A 2W6LA 1UA0A 5EX5A 1T3VA 4FWLA 4DSKA 4ELTA 1NMNA 4B1UB 1QQMA 1BCMA 4DTRA 4HCBA 5BPLA 5JLHA 1OH5A 2Q3SA 3WNFA 4ELVA 3IAYA 1JLEA 1NOYA 2HBKA 4HUFA 5DMRA 3CQ8A 1VRTA 2YKNA 4A2AA 5CZ2A 4DFMA 5TKWA 3PO4A 2QKBA 3QEVA 2XY8A 4CJEA 3CCQN 4N41A 3SQ2A 4Z4IA 2O8EB 2CGLA 3CCSN 1NJWA 4XH4A 4B9UA 4C8MA 1JLGA 1FK9A 3OS2A 4JD2A 5FPEA 3PX6A 2YHXA 4QCLA 3ZSOA 3I55N 1ZBSA 3WT0A 4DUYK 1NU0A 3AVIA 4ISEA 3VTIA 3G6EN 3TU5A 4H4OA 3DOKA 2BH1A 2D5RA 5JS1A 4OGCA 4HTUA 1UAXA 4WFNL 2B6AA 2Z1JA 4H0XB 3VEZA 2O8DB 5M1PA 4JEPA 4E7IA 1RDBA 4QS8A 3THYA 2G8VA 3MN5A 1NGBA 4FJJA 4V19S 1NGCA 1JLFA 4I7FA 3AV9A 3EN9A 5CZ1A 3HPOA 2YJEA 1BIUA 3CXCM 4CJ7A 3L2VA 2Q36A 1B9FA 3HPGA 3IMXA 2JWKA 3EKUA 3D45A 3AVLA 4JI7K 1GLEG 1SL2A 3DXMA 3SPZA 1JL1A 2NLXA 2P9LB 4NCBA 1U04A 2D1KA 3OS0A 2VQEK 3ZSYA 4DTPA 4PKHA 2HNYA 4JS5A 5JLFA 4R5PA 3SUOA 4CJKA 4LF6K 4KREA 5KGXA 4BC5A 2QWPA 1JLAA 4A61A 1S1XA 2H3GX 3VQ7A 3CMEN 3C6TA 3DLHA 5DM6L 3ID8A 3CFRA 4FK4A 1XNRK 3B8AX 3MXJA 3VQQA 3OHRA 3VERA 4BQLA 3AO1A 1HKCA 3VN5A 3KLEA 1SAZA 3OYGA 1BO5O 3SJJA 1NNEA 3ZSXA 1WB9A 4GY2B 1ATSA 1HQEA 4LSLA 1U48A 4MQ3A 5FRMA 3CCMN 4FM1A 3DM2A 4DU1A 3TAQA 2O8CB 3NAEA 4JI8K 2ITGA 2QWNA 5LMUK 1NK8A 1VRUA 1ZBHA 3VQDA 2O8EA 1P8ZA 3B6OA 3DOLA 4CJ3A 4JI4K 1GLCG 3A5LC 2YHYA 4IEEA 4NLCA 5B8HA 1GLFO 1FKPA 4C8OA 2V52B 1TKTA 5AQPA 4C8LA 1KVBA 2KLAA 1VK0A 1T6DA 3SUPA 4N56A 1NM1A 1O13A 4CK3A 4H5TA 4FCYA 4CGJA 1JCGA 3MN7A 4UQGA 2O8DA 1DLOA 3SQ0A 2GEMA 2Y1JA 4K43A 1TYQA 2QWMA 2ZGZA 1WN7A 4W5RA 3C65A 5DM7L 4OLBA 5TKYA 3VTHA 3W3DA 4ZHRA 3SAFA 4BWJA 2VWBA 3OYHA 2OPRA 4CGDA 4FW1A 1KFSA 4K25A 3ZT4A 3R3LA 4A57A 3HOSA 1G15A 5BREA 2F7TA 4WFBL 3AAPA 3AVFA 4M3ZA 3L3UA 1DTTA 1ZBIA 2P9SB 4WQ5C 3T69A 4O5FA 4FL9A 1DKGD 2BE2A 2GV9A 2RN2A 5E26A 3EKSA 4M3WA 3PX0A 4BRLA 3TARA 1XUPO 3H45C 4LF4K 1SKWA 2OZMA 3P4IA 2P9LA 3QETA 1MWMA 4M41A 1KTQA 3RR8A 1D5AA 5AQRA 1TVRA 3O80A 3OYEA 2ASMA 3J8AA 2JWLA 2VWKA 4DSLA 2ZGYA 4GVEA 4G9ZA 4CVNE 1NMDA 1NGIA 4K41A 1S72N 2CH6A 1C0GA 4FLWA 3ZSWA 3U6FA 3CFOA 5AJ3K 3E9PA 4O4GA 4FXDA 4CFBA 3QINA 2HOEA 2NZTA 1BIZA 3EY1A 2A41A 3CC7N 1T03A 2PY5A 4IDHA 4YOYA 3H3NO 1BWFO 1HYZA 3LZJA 3NGYA 4GKJK 2WOMA 3JAMO 2A1RA 4AF1A 4ID5A 3O9SA 3EO3A 3O9UA 4Z4HA 4IEIA 1A5WA 3GL1A 4BRKA 1NK0A 4AHRA 4YOWA 1L5UA 3UKUB 2X6SA 4EP4A 3VESA 2G8WA 4MO5A 2R7YA 3NMUA 2O8CA 5AQUA 4CGHA 4JRPA 1QSYA 3NVMA 3CI5A 2A1SA 3HBTA 1FW6A 1SZ2A 3CM5A 1BA0A 3QFPA 3RR7A 2Z1IA 3TSUA 4HTLA 4NLBA 3AVKA 3V1QA 1NK5A 4FJKA 2YHWA 3SAGA 1C6VA 4I9LA 4BVPA 1S9GA 5DK5A 4H0OA 4BRDA 4J2DA 1QS4A 2E2OA 3J7ZO 2HHWA 4H8KA 2E5LK 4HUGA 4FM0A 4GNIA 2EX3A 3DJCA 1XC3A 1JCEA 4KHPK 2HHQA 2FSNA 3K5MA 2NNWA 4FLXA 3HK2A 3SQ1A 3E1YA 1KD1O 1W9HA 1HJRA 3IS9A 5FLXO 4CHPA 1SL1A 4FJXA 4Z4FA 4DR3K 4PUOA 5AQGA 5KTQA 4CE9A 1NKBA 2HVIA 2CGKA 3QICA 2W6KA 5BR9A 2O4GA 4LSNA 4C23A 4NXNK 4PY5A 2IOCA 3CD6N 3LWLA 5C42A 1L3TA 1NLVA 3O08A 1WBDA 3VQ5A 3TAFA 1X1PA 5J2PA 3LDNA 3E66A 4YOXA 1K8AO 5J1EA 4L8RB 4DV1K 2P9SA 4AM7A 3I8DA 4KKOA 4DTSA 2AA4A 4H5NA 5HBMA 3EE8A 4A5BA 3K2PA 4KV8A 3VF6A 2RE2A 1CZAN 2GWKA 4KHNA 1BUPA 4DQRA 3VENA 2NRZA 4JKHA 1S1WA 1X3MA 3VQBA 2UXBK 3C95A 4BR0A 4J2AA 4YHHK 1VQMN 3UKRB 1I3AA 2V7YA 3ZLJA 3MAQA 4N76A 4HWIA 4F3OA 1IV0A 5HROA 3BF3A 4CEEA 3AO2A 1VQ7N 5BR8K 5H1SQ 1HYVA 2JLEA 3KD5E 4NO7A 3N4QA 4IO9L 1SQKA 3FZKA 2LSNA 4BRQA 1CXQA 3NDKA 3M8SA 4DHYA 1ESVA 3MECA 3JYTA 4AHSA 3OJSA 2GTDA 3OBYA 4NB4A 2G8KA 2I7NA 4JK8A 3HI0A 1YVUA 1HRHA 5C2FA 4FSVA 4DMNA 3KLHA 2OZSA 3RVCA 1S22A 1L3VA 4CHNA 4YORA 4Q0BA 4A5AA 3UKUA 4IFVA 2G8IA 3I0RA 2FBXA 3NCIA 2KZMA 5BRDA 3OY9A 3U4LA 3WXKA 3CETA 3SZ2A 3GG4A 2RHKA 1S6PA 5HRNA 1WAJA 3EZWA 2ETJA 4M7YA 2V7ZA 3TAPA 2VQFK 3S41A 2XY7A 4OX9K 1RTIA 2XY6A 3NHGA 4XIUA 4XH5A 4ELUA 5AQIA 1EKEA 3VQ8A 3L2WA 1RTHA 2HBMA 5F2RA 4YDUC 1B9DA 1VSJA 1HNXK 5C24A 2KFZA 4JI1K 1QZ6A 3LAKA 1HQUA 4JK9A 3ENBA 1YI2N 1JXBA 1UWBA 2E6MA 2ZM6K 2Q0UA 3KLGA 2AJQA 4BACA 3IUCA 4CJLA 4F2RA 3L4IA 5AZJB 1Y97A 3DAWA 1T6CA 4JV5K 1REVA 3LALA 1SUQA 2X78A 2P9UA 4BGBA 4NYFA 4MDBA 4FJ8A 2P51A 1KVCA 4AHTA 2FBTA 5HRSA 3CCRN 4LH5A 3LPUA 1KSPA 3K9JA 3ZCMA 2Q97A 3LP2A 3RTVA 3SAHA 4EP5A 4RW9A 2GX9A 3A5NC 3UB5A 4JK7A 2QK9A 4FJLA 2QW9A 1JXEA 2NRRA 3KLIA 4KH4A 5C25A 5HOOA 4K8XA 2D0BA 2F96A 4B8CA 5LMNK 4WE1A 3MMVA 5AQMA 4C1NI 4BRAA 1RT7A 3DMJA 1HYSA 3AVCA 3T19A 4DR1K 3UE5A 4RWTA 1C0UA 4N47A 3L2RA 3OW2M 2P1JA 3FE1A 5FDLA 3ALYA 1RT1A 4FWRA 3UKRA 4K8ZA 3DLBA 2PAVA 1ASWA 4CIFA 3CERA 4OKJA 3AGKA 2VG7A 3C0BA 1TK8A 3ZSZA 4CIEA 3M5RA 4E1NA 3NF9A 3NF7A 1IKXA 2QI2A 3PIPL 2W42A 3T1AA 3F9KA 2VYPA 2QWQA 1FJGK 3K58A 4JKFA 2ZE2A 3OYIA 2VCPA 3L4QA 3CG7A 3CJ7A 5AQYA 1T7PA 2FLOA 1ZYQA 5HRPA 3PY8A 4PQUA 4DQPA 4BDYA 5AQSA 3AVAA 2GBZA 1VQKN 2HNZA 3O9RA 3TSPA 2XO7A 3I33A 2A6AA 1TL3A 4AILC 4H5VA 4KHQA 4LFBK 4CK2A 3O6WA 3EZ5A 4LFCK 4CZIA 1RNHA 3QEWA 3MXIA 3CCJN 1NK9A 2OYQA 1VQPN 2YI1A 3SPYA 3HVTA 3O3HA 4WYBA 5IWAK 1JL2A 3L3VA 3P31A 2OTLN 3TANA 2VGMA 3BUZB 2GWJA 4M3RA 3G4SN 5ADXA 5EY4A 1SKRA 1BI4B 3ENHA 4JKGA 1GLAG 3Q7CA 2BGGA 4DF4A 2E2PA 4Q5VA 2IAJA 3K5NA 1LWFA 3NF6A 4B9NA 4LC9B 1YITN 3KZBA 3DLKA 1FKOA 3KJVA 3D2EB 4BRPA 1A5XA 4XH1A 1TYQB 2BANA 4IBNA 3CCVN 2O8FB 5JMVA 4CJ4A 4FLZA 3N4PA 3OJUA 1KAZA 4E7KA 4GVMA 3CJBA 5AZJA 1RBTA 3ULEB 4RCHA 1YXQA 4FJ9A 4EHUA 4NCAA 2EHGA 4DKWA 4CJRA 5I9EB 3ZETB 3PSFA 4CGGA 4WFAL 5E84A 2VGNA 2ZJRL 4E1JA 3NGZA 4CHOA 4FOEA 1N5YA 3LANA 4FOIA 5LJWA 4LFAK 3TABA 3DYAA 4WQ4A 4XEIA 1EXQA 3GBTA 1HKGA 4JNEA 3VQCA 4YY3K 1HKBA 1S1TA 2E20A 2GUPA 4H0VB 2GELA 4B9LA 2I5JA 2IVPA 3AA4A 1EWQA 4FJNA 3LAMA 4AHCA 1BL3A 3SMPA 4F8RA 1E3MA 1Z6RA 1NGJA 4DFPA 4OPAA 3NVKA 3F2KA 1IBMK 1S1UA 1U2VA 1YJ9N 1C1BA 3TAMA 4BRHA 1HNVA 3O9QA 2HVHA 4JN4A 1Q81O 1QZ5A 1W7AA 1BCOA 3S3NA 3O4WA 3VF2A 4M3TA 3K0SA 4ILJA 3F5TA 4H5WA 1Q7YO 2XY5A 1RDAA 4E7JA 4ZTFA 4FJ5A 4FYDA 1L3UA 2NRHA 1NGGA 5GINA 4I9QA 4GKKK 3CC4N 3A5OC 3HXMA 3PO5A 3ULDA 1RTJA 5LY3A 1ILYA 1VAZA 1BA1A 3TSQA 4CEZA 3VEWA 3LM2A 3BZCA 3KK7A 4BG9A 1TK0A 5CYQA 4MDAA 5KPTA 3MX5A 5M1FA 4BE1A 3KLFA 1ZBLA 2UUAK 3H1VX 5AQJA 1HPZA 4UY8O 1NGAA 4JI0K 4ILGB 4PWDA 3U8XA 2KTQA 3OYJA 3S9HA 2OANA 4KI6A 3J7AP 1YUWA 2FXUA 4AHVA 5JVGL 4YOVA 1U49A 4O5BA 4B8AB 4DQ8A 4RW8A 4H0PA 5BPNA 4YNQA 4EIAA 4CF9A 4Z94A 4BE0A 4FZXC 1FXXA 3VQPA 4IOCL 3WEEB 2WBNA 2FSKA 2Q2RA 3CIPA 1BI4A 4KHYA 4E1MA 3NH2A 4X66K 3O8MA 4FVMA 5LJVA 3P5JA 4RW7A 3PX4A 2OPPA 5AQVA 2OCEA 1VSHA 4U7BA 5C15A 4E7LA 3QNNA 3D2EA 5AR0A 2HHXA 2WTUA 3OYCA 4W5NA 5CY4A 3H3OB 3M8PA 2O8FA 3QIPA 3T1HK 4BROA 2J4RA 4IJNA 4GMJB 3AO4A 4CBUA 3ULEA 2FBYA 4B1XB 1Q82O 4DSIA 4IG3A 3D7EO 4I6MB 4CJTA 3ZETA 4BQZA 1HNWK 1I39A 3HT3A 3VEVA 5IT9O 1QE1A 3D2FB 1QHTA 4KHUA 1XMQK 1U6ZA 2WONA 2X74A 4G1QA 3O4QA 1OVQA 1C0FA 2YV0X 4WF9L 3CJ1A 3KTQA 1S1VA 3OYDA 3SYZA 4DV5K 3EEQA 3NBPA 1TAQA 3ZYYX 4DR6K 3OYNA 2D0PA 4RTFD 1QQOA 2E2NA 4JYAK 5J2MA 3CPEA 3SQ4A 3VEXA 3BGRA 4CZLA 1DT9A 5KQDA 3WQTA 2ASOA 5F1XA 4FLUA 4CJUA 2FSJA 2KFNA 1I94K 3V1OA 4DSJA 3OYBA 5AQZA 3U3GA 1XC9A 4W5OA 1TAUA 3LDPA 4HUEA 1RT6A 1J6ZA 2P9KB 3VEOA 1CZBA 5C0YA 4JRQA 2ZD1A 5MLCQ 3AVMA 4J2BA 3J7YP 3CCEN 1NJXA 3ZEUB 1YIJN 3CPWM 4RW6A 4M45A 4LF5K 4DFKA 2IVOA 2VG6A 3AA5X 5CYMA 3HZ6A 2ZQBA 4BR2A 4PL7A 3MEEA 4NCGA 4M3UA 4PL8A 2WC9A 5AFUA 3VQEA 1LW0A 4BR9A 3AVHA 1SKSA 3ZT3A 3CJAA 3DLEA 4BC4A 3PUFA 3ZX2A 2NUBA 4IDKA 2ZJQL 1XWLA 2P9IB 4LF9K 1RDWX 1NGHA 1EWRA 2HNDA 3KD1E 4Z0UA 2HMIA 1LCUA 5FPDA 3G0ZA 3VOVA 1S3XA 4NXMK 1V4TA 3CMAN 3HSTB 1R0AA 2DFFA 1NGEA 4KH6A 5C12A 5CHIA 4LY7A 1IG9A 3DRRA 1NKCA 3OA9A 4FWQA 4PKIA 3WEEA 4YOUA 3J80O 2QWLA 1GOBA 1GLLO 3JXUA 2Q1NA 2QXLA 3SBTA 1YJNN 1MWKA 4L3QA 1RILA 1OKJA 1JKHA 4JAXA 4BRMA 4DR4K 2HW3A 4B1WB 4AQYK 2QXFA 2F9TA 4CZMA 3V6DA 2KKZA 5BPMA 3HVRA 2HB5A 1BISA 2P9UB 5AQHA 1TUYA 4HHTA 2QKKA 4B3SK 2QWOA 4FPBA 1QQNA 4CESA 1OH7A 4I6MA 1EO1A 1VQ9N 1EP4A 2F4VK 2HF4A 1NJYA 3D2FA 1HUXA 4RG8A 3SJHA 1NK4A 5M1QA 5D3GA 4Y1DA 2G8UA 2HHVA 4PHTX 2RKIA 3BF1A 4CIGA 1NJIO 3TAGA 2UXCK 2O8BB 1RT5A 1TGOA 4EZ9A 1D8YA 3OVNA 3FGUA 2QWRA 1QHAA 3FFIA 4E19A 3HP6A 3F73A 1J5OA 1VQ4N 4OPJA 1WLJA 3CM6A 1NK6A 1C0TA 3MCPA 3O1BA 3VGKA 5HL7L 3QESA 3THVA 4EZ6A 2FF3B 3S3MA 3AARA 4Z4CA 4OKEA 3H6EA 4WQ5A 4CBXA 1VSIA 3AO5A 3T7ZA 4U67L 1Z05A 4CZEA 2ASPA 1B92A 3QB0A 4LH4A 4BREA 2P9KA 3IG1A 3ZSVA 5ELZA 5JS2A 4FJGA 2YNFA 4DB3A 4YOTA 1BDGA 1YJWN 3OYLA 3MCAB 3MK6A 4CZJA 5I3UA 3K5LA 3ZEUA 3G10A 5KQ8A 4O44A 2Y1IA 4KTZA 3VGLA 3OS1A 4CZHA 3HYFA 3FR0A 3K59A 3KWIA 3MN6A 4GW6A 4CJ5A 5FRNA 2P9PB 3R8EA 1UA1A 2D0AA 3LWMA 5KRSA 2NRTA 4CF1A 2P9IA 4KB1A 1VQ8N 3V9UA 2HF3A 1C1CA 4CHZA 4CHYA 2E1YA 1QTMA 3K57A 2YHAA 4FZYA 1ATRA 4JKCA 1MA9B 4DS4A 1VSLA 1LW2A 1N33K 2OA8A 3ISNC 1K9MO 4JKGB 4JI6K 3L2QA 3R6MA 3G71N 3I0SA 3TTDA 2YHBA 3DLLL 3LL3A 4QS9A 5FROA 3L8BA 4DR2K 4CCHA 1XHZA 1KLNA 4B3MK 4GV3A 4BE2A 1N8RO 4CEDA 1W2BM 5AQOA 4CZKA 1BU6O 1E4FT 1IKWA 3DWLA 5BN9A 4FVUA 4CJFA 2PFUA 2W40A 3AAQA 4BRFA 1Q9YA 2XRIA 4B9VA 3U3YA 1KFDA 4CF8A 3MX2A 1RBUA 3P1GA 3TTFA 3WQUA 3V1RA 4OGEA 3BY5A 3K9KA 3VGMA 1WSHA 3O9TA 4DWIA 4JI5K 1Z25A 4IZ9A 3ATVA 2DY4A 3HP9A 1K6YA 1R59O 2HSTA 5GAHP 5EVZA 2ZF5O 3IRXA 4BC3A 4Y0WA 3VPZA 4MLHA 4LF7K 3RWUA 3VQ9A 3A0IX 1JCFA 1KAYA 4DQQA 4BWMA 1DGKN 2BUPA 1QVFM 4RW4A 4C1NK 1RBRA 1WSJA 4CBWA 1S5JA 4KB0A 4B3RK 4OJRA 2HMPA 4B3TK 2O8BA 4DV4K 1VQNN 4DV6K 2O4IA 2A42A 3OYFA 2IS3A 4DTNA 1J9AA 4FJHA 1IKYA 2QA4N 3SNNA 4O0IA 1X9MA 1U2VB 4X62K 4CGFA 1LOTB 4CGIA 3P39A 1IJJA 4BDZA 3HL8A 3M1FA 4X64K 2EWSA 1VQON 1Q8IA 2NRXA 1NWKA 2D0OA 3QDKA 1SL0A 3C7NB 5J2QA 1NKEA 3RMCA 3AVBA 3MEDA 1YHQN 3CCLN 3NF8A 3T1YK 4BRGA 2UUBK 4F3TA 4JKEA 1WSEA 2Q0RA 4OPKA 3C6AA 4CERA 3UIQA 3AVJA 3CFPA 2XHBA 3OYMA 1KRPA 4IKFA 3KIOA 4ILHA 1CLQA 1ASVA 3Q7BA 3WXJA 5FPNA 4EHTA 1GOAA 3QEPA 3VQ6A 1IG8A 1LAVA 2P9PA 1TL1A 3WNHA 1RBSA 3PSIA 2UYTA 4CJPA 1X9JA 2Z1HA 1G99A 3CQXA 3OYAA 3DI6A 2B5JA 1IO2A 2ITMA 3RRGA 1KXPA 3SBGA 4IO8A 2F9WA 3GE1A 2PYLA 4GV9A 1DEJA 1ZBFA 4LF8K 1Q9XA 3P38A 4CJWA 4DV7K 1N34K 4F2SA 2UU9K 1DTQA 2IC3A 3AO3A 1OH6A 3RMBA 2Q31A 3MWTA 4CEBA 3LDLA 3HO1A 4B3OA 1M90O 3KK3A 1BOTO 1NGFA 3D6RA 4DTXA 1VSKA 2F8TA 4ISFA 4CF0A 1JJ2M 4K42A 3JSMA 3IKMA 3RRHA 3NE6A 4BRNA 4K0KK 1F21A 5EOYA 4FWOA 1KC8O 2F8SA 3H1QA 1O1WA 4YDUA 4KBOA 4JHDB 5K14A 3E01A 5M1OA 1NK7A 1TUUA 4I2PA 4CF2A 1VQLN 4J8FA 3LM9A 5AZIB 4DTJA 1N32K 3HPHA 1U47A 4WCEL 1QSLA 1CXUA 4FZZA 3AY9A 1W0HA 2QEXN 5GAGP 5AQKA 3HRGA 4YFUA 3SI6A 2HHTA 4FWMA 1SV5A 5T7BA 3V9ZA 1HPMA 1U4BA 3E9LA 3VF4A 1HMVA 3C94A 4CZFA 4IG0A 2A3ZA 3CHWA 3LDSA 1M1KO 4CHQA 3VMFB 4FO0A 2PBDA 1NG9A 1Y64A 5GADP 1X9SA 3H08A 3C7NA 3BZKA 3RMAA 4Z4GA 4FWKA 4ID1A 1T05A 3K5OA 3B6PA 4DSEA 4X65K 4M7XA 1UOCA 5I42A 4OPHA 1TKZA 1WSGA 4KFBA 2D4WA 4DUZK 3A2FA 3L0QA 1ITGA 3EL2A 1WBBA 1ZXOA 3L6QA 1Q86O 3O3FA 1EETA 3PIOL 2E2QA 3QMLA 1HNZK 1KCFA 4W5QA 3ENOA 1C0MA 5ADXH 1RCHA 3SV4A 5E41A 1TKXA 3SUNA 1K8KB 3HM8A 3KK2A 2IGIA 4FLTA 4KO0A 3QIOA 4CFCA 2BDPA 4BC2A 2W41A 4DLGA 4DQSA 1EX4A 1BGXT 3WXIA 1XHXA 2YKMA 3O3GA 2DPNA 1RDCA 1T44A 5F0XA 1Z26A 2QM1A 1VSDA 4FK0A 4IOXA 3PV8A 4IFEA 4E0DA 4AM6A 3THXB 4B9TA 4B1VA 1RBVA 5GIPA 1N36K 3LP3A 4GV6A 5GAEP 3CJ9A 3KVGA 4H03B 3HM9A 3DRSA 1T8EA 1IH7A 3TTCA 1E4GT 4FLYA 5AQTA 3MWPA 5C2DA 2YNIA 1RT3A 3LP0A 1TK5A 3MN9A 4CJSA 5EU7A 2YNGA 4H0YB 4JHDA 3SMSA 4CK1A
chains in the Genus database with same CATH topology
3C6HA 2QWOA 4QS8A 4JKBA 4FPBA 1QQNA 2P9UA 4BGBA 1YVNA 4IJAA 3MN5A 1NGBA 4MDBA 3H46O 5AZIA 4I6MA 4IWVA 1NGCA 1VQ9N 1EO1A 5KPZA 3PLAA 4MLEA 5AQNA 3CCRN 2ZJPL 2HF4A 3D2FA 1HUXA 3F9MA 3SJHA 3EN9A 3K9JA 2Q97A 5M1QA 4PHTX 2YJEA 3SAHA 3BF1A 1NJIO 3CXCM 2A40A 2GX9A 3A5NC 4CJ7A 3UB5A 3FGUA 4JK7A 2QWRA 3FLCO 2Q36A 1QHAA 2QW9A 3GOIA 3IMXA 5EXWA 5JICA 2JWKA 2NRRA 3HSCA 1VQ4N 1HJOA 3EKUA 4KH4A 5HOOA 4BY9C 4CD1A 3MCPA 1GLEG 3O1BA 3VGKA 5HL7L 3MMVA 5AQMA 3DXMA 4BRAA 4C1NI 2FF3B 1YAGA 3AARA 2NLXA 2P9LB 4FWSA 3H6EA 4WQ5A 4JHDA 4CBXA 3UE5A 4RWTA 2D1KA 3A5MC 4BG8A 2WUSA 3T7ZA 5BRFA 3WXLA 1Z05A 4CZEA 4U67L 1X3NA 3OW2M 4PKHA 3FE1A 4A2BA 4R79A 2ASPA 5JLFA 3QB0A 1KAXA 3CQYA 4FWRA 3UKRA 4BREA 2P9KA 2PAVA 5ELZA 3A8YA 4DB3A 4BC5A 1MDUB 2QWPA 3CERA 1BDGA 4YOTA 3AGKA 2IIRA 3C0BA 4A61A 2H3GX 3CMEN 1YJWN 2NRWA 3M5RA 3CF5L 3MCAB 5DM6L 3ID8A 3MK6A 4IOAL 2QI2A 3PIPL 4CZJA 3CCUN 5AZJB 3ZEUA 5KQ8A 2VYPA 2QWQA 3B8AX 3VGLA 3OHRA 3E9OA 3VERA 4BQLA 4JKFA 1HKCA 3OBWA 4CZHA 3FR0A 2VCPA 3L4QA 1SS6A 3CJ7A 1SAZA 5AQYA 3KWIA 3MN6A 2FLOA 1BO5O 2P9PB 2KHOA 1NBWA 3R8EA 1K8KA 4EFHA 5AQLA 5AQSA 1HX1A 2NRTA 5AQWA 2P9IA 1VQKN 4OO1J 3O9RA 4GY2B 4BR4A 3TSPA 1VQ8N 1ATSA 2A6AA 2HF3A 3I33A 5JVHL 2E1YA 4H5VA 4IXCA 3O6WA 4KH5A 3CCMN 4JKDA 4CZIA 3SMSA 1ATRA 3ID6A 4JKCA 1MA9B 1WUAA 3I8BA 3CCJN 1VQPN 1NGDA 2YI1A 4WYBA 2QWNA 3P31A 1K73O 3U9ZA 3FZFA 4JKGB 1K9MO 2OTLN 3R6MA 2VGMA 3QBWA 1GLBG 5BN8A 1GLDG 3G71N 3BUZB 4JKAA 1P8ZA 3FFKB 2GWJA 3TTDA 3G4SN 3DLLL 3LL3A 4QS9A 5ADXA 5EY4A 2ZWHA 3RSEB 3ENHA 4GV3A 4JKGA 1GLCG 1N8RO 1GLAG 3Q7CA 3A5LC 3M6GA 1W2BM 2HBJA 2E2PA 5AQOA 4CZKA 1BU6O 1E4FT 3DWLA 2YHYA 4IEEA 5BN9A 4NLCA 4LC9B 4BRCA 5B8HA 4FVUA 2PFUA 1GLFO 2W40A 3KZBA 1YITN 3AAQA 3I56N 1GLJO 3W0LA 2V52B 5AQPA 1HLUA 3QBXA 4BRFA 3D2EB 2KLAA 1T6DA 4BRPA 4XH1A 3MX2A 1O13A 1NM1A 4H5TA 3TTFA 1TYQB 3WQUA 3EE9A 3CCVN 1JCGA 5JMVA 3K9KA 3MN7A 3N4PA 3LDOA 3VGMA 1KAZA 3O9TA 3CJBA 2GEMA 3IFRA 5AZJA 4IZ9A 3ULEB 4K43A 1TYQA 1YXQA 3ATVA 1BG3A 4RCHA 4BGAA 2QWMA 2ZGZA 2I7PA 4M63C 1R59O 3C65A 4EHUA 5DM7L 3HOTA 2HSTA 5GAHP 4A59A 5TKYA 5EVZA 4DKWA 5I9EB 3ZETB 3VTHA 2ZF5O 3W3DA 4BC3A 3SAFA 4Y0WA 3VPZA 1P90A 4MLHA 2P9NB 4WFAL 1RFQA 5E84A 2VGNA 2ZJRL 4E1JA 2VWBA 3A0IX 1JCFA 1KAYA 4FOEA 1DGKN 2BUPA 1QVFM 3CJCA 4FOIA 4B9QA 4C1NK 4CBWA 5LJWA 3IDHA 4K25A 2HMPA 3VEYA 3R3LA 4WQ4A 4XEIA 4A57A 3GBTA 2NRVA 1HKGA 4JNEA 3HOSA 5BREA 2F7TA 1HKBA 2GUPA 2E20A 3AAPA 4O8UA 4WFBL 3HTVA 1VQNN 4H0VB 2GELA 2A42A 4BVOA 2IVPA 2P9SB 4WQ5C 3T69A 2QA4N 4O5FA 3SMPA 4FL9A 1DKGD 1U2VB 1Z6RA 1NGJA 5E26A 3EKSA 1LOTB 4BRLA 1XUPO 3P39A 3H45C 1IJJA 4B1ZA 4OPAA 3NVKA 4CZGA 3F2KA 3P4IA 2P9LA 3M1FA 1U2VA 1YJ9N 5M1KA 2CH5A 2EWSA 3BP8A 1MWMA 1VQON 2NRXA 3QDKA 1NWKA 2D0OA 4H5RA 5AFUH 4BRHA 5C10A 3C7NB 1XQSC 3LDQA 5AQRA 3O80A 1QVGM 3O9QA 2ASMA 3J8AA 4JN4A 1Q81O 3DXKB 1QZ5A 1YHQN 1D4XA 3R9PA 3SK3A 3CCLN 3O4WA 3VF2A 2E1ZA 2HBLA 4BRGA 2JWLA 4JKEA 4ILJA 2ZGYA 3F5TA 2Q0RA 4GVEA 4G9ZA 4H5WA 4O8KA 3C6AA 4FPAA 1NMDA 1NGIA 4K41A 1S72N 2CH6A 1Q7YO 1VQ6N 1C0GA 3FZLA 4ILHA 3ATUA 5FPMA 3E9PA 3ZX0A 1RDUA 2NRHA 2HOEA 2NZTA 1NGGA 3M3ZA 3R1XA 3Q7BA 5GINA 2E88A 3WXJA 1ATNA 2AP1A 3CC4N 2OTJN 2A41A 3A5OC 5FPNA 3CC7N 4EHTA 5AQXA 5LY3A 4IDHA 4YOYA 1ILYA 3H3NO 1BWFO 1VAZA 1BA1A 3TSQA 3LM2A 3VEWA 1IG8A 2P9PA 2A5XA 3KK7A 4BG9A 2YCHA 5KPTA 4MDAA 2YX6A 3MX5A 5M1FA 4AF1A 3H1VX 5AQJA 3O9SA 3QFUA 1NGAA 4UY8O 2CGJA 3EO3A 4ILGB 3O9UA 2E8AA 3U8XA 3AGRA 4IEIA 2OANA 3GL1A 2UYTA 4QS7A 4BRKA 1X9JA 2YJFA 4YOWA 5AQQA 1G99A 1YUWA 3CQXA 3UKUB 3G25A 3SLCA 2FXUA 5JVGL 4F9OA 2ITMA 3VESA 4MO5A 1KXPA 3SBGA 3FZHA 4IO8A 4DCHA 4YOVA 3NMUA 2F9WA 3GE1A 5AQUA 4DQ8A 4CD3A 4H0PA 3NVMA 1DEJA 3CI5A 5BPNA 4GV9A 3HBTA 2IVNA 3P38A 4EIAA 5CR4A 4Z94A 1SZ2A 1BA0A 3QFPA 3GDQA 5AQFA 2QTDA 3O5BA 3WXMB 2Q31A 3MWTA 3LDLA 3TSUA 4HTLA 3WEEB 4IOCL 2WBNA 2FSKA 4NLBA 2Q2RA 3U9DA 5GIOA 1W97L 1M90O 3RSEA 3CIPA 4JD2B 1BOTO 2YHWA 4ISGA 3SAGA 1NGFA 3D6RA 3O8MA 5LJVA 4BVPA 4ISFA 1JJ2M 5AQVA 4H0OA 4K42A 4BRDA 4U7BA 2E2OA 3IKMA 5C15A 3J7ZO 4PKGA 4GNIA 4BRNA 3D2EA 5AR0A 4BR5A 5EOYA 1KQSM 3DJCA 1XC3A 4FWOA 1JCEA 1KC8O 2FSNA 2NNWA 3H1QA 4EAHD 3E1YA 1KD1O 4YDUA 3H3OB 4KBOA 4BROA 2FF6A 2J4RA 4FWPA 4IJNA 4JHDB 5M1OA 4CBUA 3BEXA 5AQGA 3ULEA 1TUUA 4B1XB 1VQLN 1Q82O 4J8FA 3LM9A 5AZIB 2CGKA 3D7EO 4I6MB 5M1NA 3ZETA 4BQZA 3QICA 5BR9A 2BTFA 4C23A 2P9NA 4WQ4C 3VEVA 1YF5L 4WCEL 5KPRA 3CD6N 3D2FB 1U6ZA 1NLVA 4BRIA 3O08A 4A62A 2V51B 3AY9A 1V4SA 3MDQA 3WUHA 1C0FA 3LDNA 1VQ5N 4BR7A 4FWNA 5GAGP 4WF9L 3CJ1A 2QEXN 3E66A 3JS6A 5AQKA 3VETA 4YOXA 3HRGA 1H1VA 3ZX3A 1K8AO 2WFBA 3ZYYX 4FWMA 2D0PA 4RTFD 1WOQA 1QQOA 2E2NA 2P9SA 4AM7A 3CPEA 3TPQA 1ZC6A 2AA4A 1HPMA 4H5NA 3VEXA 4CZLA 4MO4A 3EE8A 1DT9A 5KQDA 3E9LA 3DXMB 4A5BA 3VF4A 3WQTA 2ASOA 2RE2A 3VF6A 5F1XA 4CZFA 3KHYA 3FZMA 1EQYA 2A3ZA 2FSJA 3CHWA 1M1KO 1CZAN 3VMFB 4FO0A 2PBDA 2GWKA 1BUPA 1Y64A 2NRZA 4JKHA 1X3MA 3VENA 3C7NA 1RGIA 5BRHA 5GADP 3O1WA 4BR0A 4FWKA 5AQZA 3DXKA 1VQMN 3UKRB 2V7YA 3LDPA 1J6ZA 2P9KB 4HWIA 3VEOA 5C0YA 3BF3A 4M7XA 3CC2N 1VQ7N 5MLCQ 4H0TB 4OPHA 1OVYA 2D4WA 3L0QA 5H1SQ 4CI6A 3CCEN 3EL2A 1ZXOA 4NO7A 3N4QA 3ZEUB 3KWGA 1SQKA 3CPWM 3FZKA 4IO9L 3L6QA 1YIJN 1Q86O 1Q18A 4BRQA 4B1YB 2IVOA 3HZ6A 5CE3A 4BR2A 4DHYA 4PL7A 1ESVA 5EX5A 3PIOL 2E2QA 3QMLA 4PL8A 2WC9A 1T3VA 5AFUA 4FWLA 2GTDA 3OBYA 3ENOA 4NB4A 4BR9A 2I7NA 4B1UB 1QQMA 4JK8A 3HI0A 5ADXH 5C2FA 1K8KB 4FSVA 3CJAA 4BC4A 3HM8A 5BPLA 5JLHA 3ZX2A 2ZJQL 3RVCA 1S22A 2P9IB 1RDWX 4YORA 1NGHA 4BC2A 2W41A 4A5AA 3UKUA 2HBKA 3WXIA 1LCUA 2DPNA 5FPDA 1T44A 1S3XA 2QM1A 3VOVA 1V4TA 5BRDA 5F0XA 4A2AA 3U4LA 3CMAN 4IOXA 3WXKA 3CETA 3GG4A 1NGEA 2RHKA 4KH6A 5TKWA 5C12A 4IFEA 5CHIA 3EZWA 3CCQN 4M7YA 4AM6A 3OA9A 2CGLA 4FWQA 4PKIA 3CCSN 2V7ZA 3WEEA 4B1VA 4XH4A 4YOUA 2QWLA 3S41A 5GIPA 1GLLO 3JXUA 4JD2A 2Q1NA 5FPEA 2YHXA 2QXLA 3SBTA 4XH5A 3I55N 5AQIA 5GAEP 4GV6A 1YJNN 1MWKA 1ZBSA 3CJ9A 4L3QA 2HBMA 3KVGA 5F2RA 3WT0A 4YDUC 1OKJA 4H03B 4ISEA 3VTIA 3G6EN 4JAXA 3TU5A 4BRMA 4B1WB 2BH1A 3TTCA 1E4GT 1QZ6A 5AQTA 3MWPA 5C2DA 2F9TA 4JK9A 4CZMA 3ENBA 1YI2N 2KKZA 5BPMA 2Q0UA 4WFNL 3MN9A 2P9UB 4H0XB 3VEZA 5AQHA 3IUCA 3L4IA 4H0YB 1TUYA 5M1PA 3DAWA 4JEPA 1T6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1F A;  5C15 A;  5C2F A;  3C6H A;  4IDH A;  5M1K A;  4IEE A;  5C10 A;  5C2D A;  5M1N A;  3C6A A;  5M1O A;  5M1Q A;  3CPE A;  5M1P A;  5C12 A;  4IEI A;  4IFE A; 
#chains in the Genus database with same CATH topology
 3DRP A;  3C6H A;  4JKB A;  1L3S A;  4IOA L;  1YVN A;  4IJA A;  3D0P A;  1VSM A;  1C1A A;  3H46 O;  5AZI A;  4IWV A;  5KPZ A;  4KAZ A;  3PLA A;  4MLE A;  5LL6 Z;  3O4N A;  5AQN A;  2ZJP L;  4CJV A;  3V9W A;  3F9M A;  2RPI A;  4DF8 A;  2GUI A;  2A40 A;  1WNS A;  3FLC O;  4JS4 A;  3GOI A;  5EXW A;  3M8Q A;  3ZT1 A;  5JIC A;  4Y1C A;  3HSC A;  1HJO A;  5SZT A;  4BY9 C;  4CD1 A;  3VA3 A;  1KVA A;  2KW4 A;  4CJQ A;  1HR0 K;  1YAG A;  3ZSQ A;  4FWS A;  5SWM A;  4JLH A;  2IDO A;  1U45 A;  3A5M C;  4QAG A;  4CEC A;  4BG8 A;  2WUS A;  5BRF A;  3WXL A;  1X3N A;  4A2B A;  4R79 A;  1KAX A;  1D9D A;  3CQY A;  4FM2 A;  3LP1 A;  4FJM A;  3A8Y A;  4W5T A;  1MDU B;  2IIR A;  2PYJ A;  3ZT0 A;  4O0J A;  2NRW A;  3AA2 A;  4ICL A;  3CF5 L;  4AH9 A;  1IKV A;  4FK2 A;  5A2Q O;  3CCU N;  5HLF A;  3S3O A;  4DSF A;  1X9W A;  3E9O A;  1RDD A;  3OBW A;  1XMO K;  1WSF A;  3V9S A;  1SS6 A;  3T3F A;  2KHO A;  4JI2 K;  1XI1 A;  1NBW A;  1K8K A;  4EFH A;  5AQL A;  1HX1 A;  5AQW A;  4OO1 J;  3P83 D;  4BR4 A;  3SV3 A;  5JVH L;  1JLC A;  4IXC A;  2JGU A;  4KH5 A;  4JKD A;  2FBV A;  3TWH A;  3ID6 A;  1WUA A;  3I8B A;  3NH0 A;  2VWJ A;  1QQC A;  1NGD A;  1VSF A;  2X6N A;  2KQ2 A;  4LD0 A;  1YTU A;  4KRF A;  4DU3 A;  1K73 O;  3U9Z A;  3FZF A;  4DV2 K;  4OKK A;  2OPS A;  5BN8 A;  2DFE A;  1GLB G;  3QBW A;  1GLD G;  3KKS A;  4JKA A;  3QNO A;  3THX A;  3FFK B;  2ZWH A;  3RSE B;  1MU2 A;  3M6G A;  2HBJ A;  1A5V A;  1LWC A;  4CEQ A;  1IBL K;  4M3X A;  3QEX A;  4BRC A;  3THW B;  3I56 N;  4M3Y A;  1GLJ O;  1LV5 A;  3W0L A;  1RTD A;  3WNE A;  1HLU A;  3QBX A;  4DLE A;  4ZTJ A;  4FLV A;  3HJF A;  3OYK A;  3EE9 A;  3LDO A;  1JLB A;  1JLQ A;  3IFR A;  4CFD A;  4B08 A;  3TR8 A;  1BG3 A;  4DV3 K;  4BGA A;  3DLR A;  2I7P A;  1WAF A;  4M63 C;  1OH8 A;  2HHU A;  3HOT A;  1ZBU A;  4A59 A;  4E7H A;  3ASM A;  3RMD A;  4IFY A;  2ATQ A;  3VQA A;  1P90 A;  2P9N B;  1RFQ A;  4AHU A;  3NGI A;  1J53 A;  1HNI A;  1ASU A;  1RT4 A;  3CJC A;  4B9Q A;  2G8F A;  1YTA A;  3IDH A;  2G8H A;  3VEY A;  2YNH A;  2NRV A;  2Z1G A;  4O8U A;  3HTV A;  4FW2 A;  4DG1 A;  1WSI A;  4C8N A;  3QLH A;  4BVO A;  3TI0 A;  4CFA A;  3OTO K;  2VG5 A;  4I2Q A;  4CEA A;  3C6U A;  4B1Z A;  4CZG A;  2OPQ A;  4DR7 K;  5M1K A;  2CH5 A;  3BP8 A;  4H5R A;  5AFU H;  5C10 A;  3LDQ A;  1XQS C;  1QVG M;  4DV0 K;  3SCX A;  3DXK B;  2UUC K;  2RF2 A;  1D4X A;  3R9P A;  3SK3 A;  4OLA A;  2E1Z A;  1S6Q A;  2HBL A;  2E6L A;  1VSE A;  3NH1 A;  3VQ4 A;  4O8K A;  2KZZ A;  4FPA A;  2P5O A;  1VQ6 N;  3FZL A;  2HHH K;  4CEO A;  4MFB A;  1J5E K;  3ATU A;  5FPM A;  1QSS A;  3QO9 A;  3ZX0 A;  1RDU A;  4TSX A;  3QER A;  1LAW A;  3M3Z A;  3R1X A;  3L2U A;  2DTU A;  2E88 A;  1ATN A;  2AP1 A;  2OTJ N;  1BQN A;  5AQX A;  2UXD K;  4NYN A;  2E4L A;  1TV6 A;  2A5X A;  2YCH A;  2D0C A;  2YX6 A;  3QFU A;  4PA1 A;  2CGJ A;  2E8A A;  3AGR A;  4KHS A;  3M8R A;  4DS5 A;  4QS7 A;  3KK1 A;  4E89 A;  2YJF A;  5AQQ A;  3G25 A;  3SLC A;  4DFJ A;  1GOC A;  4HVJ A;  4F9O A;  1D9F A;  3FZH A;  4DCH A;  4B9M A;  4CD3 A;  2IVN A;  5CR4 A;  3LZI A;  3V9X A;  3GDQ A;  5AQF A;  2QTD A;  3O5B A;  3WXM B;  4B9S A;  4DQI A;  3AA3 A;  5HP1 A;  4HCC A;  5KRT A;  3U9D A;  5GIO A;  1W97 L;  2PZS A;  3TAE A;  3RSE A;  4JD2 B;  4ISG A;  3AVN A;  1YT3 A;  2DFH A;  4DTO A;  3THW A;  4KI4 A;  4PKG A;  3MEG A;  4OVL A;  1LWE A;  3MXM A;  3BDP A;  4BR5 A;  3ITH A;  1KQS M;  4J2E A;  3NFA A;  4EAH D;  4KTQ A;  1N6Q A;  2FF6 A;  4FWP A;  3LPT A;  3SUQ A;  2P5G A;  3BEX A;  3THY B;  4M42 A;  4QOZ B;  4KHW A;  4H4M A;  1BQM A;  1CZ9 A;  1NOZ A;  5M1N A;  3QEI A;  2BTF A;  2P9N A;  4WQ4 C;  4BDP A;  2B4J A;  1YF5 L;  5KPR A;  4FJ7 A;  4JI3 K;  1S9E A;  4BRI A;  3VA0 A;  4A62 A;  2V51 B;  4KTW A;  1V4S A;  3MDQ A;  3WUH A;  5J2N A;  1NJZ A;  4FJI A;  1VQ5 N;  4BR7 A;  4FWN A;  3JS6 A;  3VET A;  1VHX A;  1H1V A;  3V81 A;  3KKR A;  3ZX3 A;  2WFB A;  5KI6 A;  4DTM A;  1WOQ A;  3CYM A;  1XNQ K;  3TPQ A;  1ZC6 A;  3ZSR A;  4MO4 A;  3J81 O;  3DXM B;  1TKD A;  1IBK K;  3DLG A;  4N5S A;  3KHY A;  3FZM A;  1EQY A;  1BHL A;  1RGI A;  4O55 A;  5BRH A;  3O1W A;  5HRR A;  2HHS A;  4CEF A;  4F4K A;  4KPY A;  3DXK A;  1RT2 A;  3WNG A;  4DTU A;  3AVG A;  4DU4 A;  4Z4E A;  5KGW A;  3V4I A;  3EYZ A;  3CC2 N;  4H0T B;  1OVY A;  4DR5 K;  4C8K A;  4CI6 A;  2FC0 A;  4CW7 B;  3KWG A;  1Q18 A;  4B1Y B;  4E3S A;  3ZT2 A;  1KLM A;  5CE3 A;  1J54 A;  2W6L A;  1UA0 A;  5EX5 A;  1T3V A;  4FWL A;  4DSK A;  4ELT A;  1NMN A;  4B1U B;  1QQM A;  1BCM A;  4DTR A;  4HCB A;  5BPL A;  5JLH A;  1OH5 A;  2Q3S A;  3WNF A;  4ELV A;  3IAY A;  1JLE A;  1NOY A;  2HBK A;  4HUF A;  5DMR A;  3CQ8 A;  1VRT A;  2YKN A;  4A2A A;  5CZ2 A;  4DFM A;  5TKW A;  3PO4 A;  2QKB A;  3QEV A;  2XY8 A;  4CJE A;  3CCQ N;  4N41 A;  3SQ2 A;  4Z4I A;  2O8E B;  2CGL A;  3CCS N;  1NJW A;  4XH4 A;  4B9U A;  4C8M A;  1JLG A;  1FK9 A;  3OS2 A;  4JD2 A;  5FPE A;  3PX6 A;  2YHX A;  4QCL A;  3ZSO A;  3I55 N;  1ZBS A;  3WT0 A;  4DUY K;  1NU0 A;  3AVI A;  4ISE A;  3VTI A;  3G6E N;  3TU5 A;  4H4O A;  3DOK A;  2BH1 A;  2D5R A;  5JS1 A;  4OGC A;  4HTU A;  1UAX A;  4WFN L;  2B6A A;  2Z1J A;  4H0X B;  3VEZ A;  2O8D B;  5M1P A;  4JEP A;  4E7I A;  1RDB A;  4QS8 A;  3THY A;  2G8V A;  3MN5 A;  1NGB A;  4FJJ A;  4V19 S;  1NGC A;  1JLF A;  4I7F A;  3AV9 A;  3EN9 A;  5CZ1 A;  3HPO A;  2YJE A;  1BIU A;  3CXC M;  4CJ7 A;  3L2V A;  2Q36 A;  1B9F A;  3HPG A;  3IMX A;  2JWK A;  3EKU A;  3D45 A;  3AVL A;  4JI7 K;  1GLE G;  1SL2 A;  3DXM A;  3SPZ A;  1JL1 A;  2NLX A;  2P9L B;  4NCB A;  1U04 A;  2D1K A;  3OS0 A;  2VQE K;  3ZSY A;  4DTP A;  4PKH A;  2HNY A;  4JS5 A;  5JLF A;  4R5P A;  3SUO A;  4CJK A;  4LF6 K;  4KRE A;  5KGX A;  4BC5 A;  2QWP A;  1JLA A;  4A61 A;  1S1X A;  2H3G X;  3VQ7 A;  3CME N;  3C6T A;  3DLH A;  5DM6 L;  3ID8 A;  3CFR A;  4FK4 A;  1XNR K;  3B8A X;  3MXJ A;  3VQQ A;  3OHR A;  3VER A;  4BQL A;  3AO1 A;  1HKC A;  3VN5 A;  3KLE A;  1SAZ A;  3OYG A;  1BO5 O;  3SJJ A;  1NNE A;  3ZSX A;  1WB9 A;  4GY2 B;  1ATS A;  1HQE A;  4LSL A;  1U48 A;  4MQ3 A;  5FRM A;  3CCM N;  4FM1 A;  3DM2 A;  4DU1 A;  3TAQ A;  2O8C B;  3NAE A;  4JI8 K;  2ITG A;  2QWN A;  5LMU K;  1NK8 A;  1VRU A;  1ZBH A;  3VQD A;  2O8E A;  1P8Z A;  3B6O A;  3DOL A;  4CJ3 A;  4JI4 K;  1GLC G;  3A5L C;  2YHY A;  4IEE A;  4NLC A;  5B8H A;  1GLF O;  1FKP A;  4C8O A;  2V52 B;  1TKT A;  5AQP A;  4C8L A;  1KVB A;  2KLA A;  1VK0 A;  1T6D A;  3SUP A;  4N56 A;  1NM1 A;  1O13 A;  4CK3 A;  4H5T A;  4FCY A;  4CGJ A;  1JCG A;  3MN7 A;  4UQG A;  2O8D A;  1DLO A;  3SQ0 A;  2GEM A;  2Y1J A;  4K43 A;  1TYQ A;  2QWM A;  2ZGZ A;  1WN7 A;  4W5R A;  3C65 A;  5DM7 L;  4OLB A;  5TKY A;  3VTH A;  3W3D A;  4ZHR A;  3SAF A;  4BWJ A;  2VWB A;  3OYH A;  2OPR A;  4CGD A;  4FW1 A;  1KFS A;  4K25 A;  3ZT4 A;  3R3L A;  4A57 A;  3HOS A;  1G15 A;  5BRE A;  2F7T A;  4WFB L;  3AAP A;  3AVF A;  4M3Z A;  3L3U A;  1DTT A;  1ZBI A;  2P9S B;  4WQ5 C;  3T69 A;  4O5F A;  4FL9 A;  1DKG D;  2BE2 A;  2GV9 A;  2RN2 A;  5E26 A;  3EKS A;  4M3W A;  3PX0 A;  4BRL A;  3TAR A;  1XUP O;  3H45 C;  4LF4 K;  1SKW A;  2OZM A;  3P4I A;  2P9L A;  3QET A;  1MWM A;  4M41 A;  1KTQ A;  3RR8 A;  1D5A A;  5AQR A;  1TVR A;  3O80 A;  3OYE A;  2ASM A;  3J8A A;  2JWL A;  2VWK A;  4DSL A;  2ZGY A;  4GVE A;  4G9Z A;  4CVN E;  1NMD A;  1NGI A;  4K41 A;  1S72 N;  2CH6 A;  1C0G A;  4FLW A;  3ZSW A;  3U6F A;  3CFO A;  5AJ3 K;  3E9P A;  4O4G A;  4FXD A;  4CFB A;  3QIN A;  2HOE A;  2NZT A;  1BIZ A;  3EY1 A;  2A41 A;  3CC7 N;  1T03 A;  2PY5 A;  4IDH A;  4YOY A;  3H3N O;  1BWF O;  1HYZ A;  3LZJ A;  3NGY A;  4GKJ K;  2WOM A;  3JAM O;  2A1R A;  4AF1 A;  4ID5 A;  3O9S A;  3EO3 A;  3O9U A;  4Z4H A;  4IEI A;  1A5W A;  3GL1 A;  4BRK A;  1NK0 A;  4AHR A;  4YOW A;  1L5U A;  3UKU B;  2X6S A;  4EP4 A;  3VES A;  2G8W A;  4MO5 A;  2R7Y A;  3NMU A;  2O8C A;  5AQU A;  4CGH A;  4JRP A;  1QSY A;  3NVM A;  3CI5 A;  2A1S A;  3HBT A;  1FW6 A;  1SZ2 A;  3CM5 A;  1BA0 A;  3QFP A;  3RR7 A;  2Z1I A;  3TSU A;  4HTL A;  4NLB A;  3AVK A;  3V1Q A;  1NK5 A;  4FJK A;  2YHW A;  3SAG A;  1C6V A;  4I9L A;  4BVP A;  1S9G A;  5DK5 A;  4H0O A;  4BRD A;  4J2D A;  1QS4 A;  2E2O A;  3J7Z O;  2HHW A;  4H8K A;  2E5L K;  4HUG A;  4FM0 A;  4GNI A;  2EX3 A;  3DJC A;  1XC3 A;  1JCE A;  4KHP K;  2HHQ A;  2FSN A;  3K5M A;  2NNW A;  4FLX A;  3HK2 A;  3SQ1 A;  3E1Y A;  1KD1 O;  1W9H A;  1HJR A;  3IS9 A;  5FLX O;  4CHP A;  1SL1 A;  4FJX A;  4Z4F A;  4DR3 K;  4PUO A;  5AQG A;  5KTQ A;  4CE9 A;  1NKB A;  2HVI A;  2CGK A;  3QIC A;  2W6K A;  5BR9 A;  2O4G A;  4LSN A;  4C23 A;  4NXN K;  4PY5 A;  2IOC A;  3CD6 N;  3LWL A;  5C42 A;  1L3T A;  1NLV A;  3O08 A;  1WBD A;  3VQ5 A;  3TAF A;  1X1P A;  5J2P A;  3LDN A;  3E66 A;  4YOX A;  1K8A O;  5J1E A;  4L8R B;  4DV1 K;  2P9S A;  4AM7 A;  3I8D A;  4KKO A;  4DTS A;  2AA4 A;  4H5N A;  5HBM A;  3EE8 A;  4A5B A;  3K2P A;  4KV8 A;  3VF6 A;  2RE2 A;  1CZA N;  2GWK A;  4KHN A;  1BUP A;  4DQR A;  3VEN A;  2NRZ A;  4JKH A;  1S1W A;  1X3M A;  3VQB A;  2UXB K;  3C95 A;  4BR0 A;  4J2A A;  4YHH K;  1VQM N;  3UKR B;  1I3A A;  2V7Y A;  3ZLJ A;  3MAQ A;  4N76 A;  4HWI A;  4F3O A;  1IV0 A;  5HRO A;  3BF3 A;  4CEE A;  3AO2 A;  1VQ7 N;  5BR8 K;  5H1S Q;  1HYV A;  2JLE A;  3KD5 E;  4NO7 A;  3N4Q A;  4IO9 L;  1SQK A;  3FZK A;  2LSN A;  4BRQ A;  1CXQ A;  3NDK A;  3M8S A;  4DHY A;  1ESV A;  3MEC A;  3JYT A;  4AHS A;  3OJS A;  2GTD A;  3OBY A;  4NB4 A;  2G8K A;  2I7N A;  4JK8 A;  3HI0 A;  1YVU A;  1HRH A;  5C2F A;  4FSV A;  4DMN A;  3KLH A;  2OZS A;  3RVC A;  1S22 A;  1L3V A;  4CHN A;  4YOR A;  4Q0B A;  4A5A A;  3UKU A;  4IFV A;  2G8I A;  3I0R A;  2FBX A;  3NCI A;  2KZM A;  5BRD A;  3OY9 A;  3U4L A;  3WXK A;  3CET A;  3SZ2 A;  3GG4 A;  2RHK A;  1S6P A;  5HRN A;  1WAJ A;  3EZW A;  2ETJ A;  4M7Y A;  2V7Z A;  3TAP A;  2VQF K;  3S41 A;  2XY7 A;  4OX9 K;  1RTI A;  2XY6 A;  3NHG A;  4XIU A;  4XH5 A;  4ELU A;  5AQI A;  1EKE A;  3VQ8 A;  3L2W A;  1RTH A;  2HBM A;  5F2R A;  4YDU C;  1B9D A;  1VSJ A;  1HNX K;  5C24 A;  2KFZ A;  4JI1 K;  1QZ6 A;  3LAK A;  1HQU A;  4JK9 A;  3ENB A;  1YI2 N;  1JXB A;  1UWB A;  2E6M A;  2ZM6 K;  2Q0U A;  3KLG A;  2AJQ A;  4BAC A;  3IUC A;  4CJL A;  4F2R A;  3L4I A;  5AZJ B;  1Y97 A;  3DAW A;  1T6C A;  4JV5 K;  1REV A;  3LAL A;  1SUQ A;  2X78 A;  2P9U A;  4BGB A;  4NYF A;  4MDB A;  4FJ8 A;  2P51 A;  1KVC A;  4AHT A;  2FBT A;  5HRS A;  3CCR N;  4LH5 A;  3LPU A;  1KSP A;  3K9J A;  3ZCM A;  2Q97 A;  3LP2 A;  3RTV A;  3SAH A;  4EP5 A;  4RW9 A;  2GX9 A;  3A5N C;  3UB5 A;  4JK7 A;  2QK9 A;  4FJL A;  2QW9 A;  1JXE A;  2NRR A;  3KLI A;  4KH4 A;  5C25 A;  5HOO A;  4K8X A;  2D0B A;  2F96 A;  4B8C A;  5LMN K;  4WE1 A;  3MMV A;  5AQM A;  4C1N I;  4BRA A;  1RT7 A;  3DMJ A;  1HYS A;  3AVC A;  3T19 A;  4DR1 K;  3UE5 A;  4RWT A;  1C0U A;  4N47 A;  3L2R A;  3OW2 M;  2P1J A;  3FE1 A;  5FDL A;  3ALY A;  1RT1 A;  4FWR A;  3UKR A;  4K8Z A;  3DLB A;  2PAV A;  1ASW A;  4CIF A;  3CER A;  4OKJ A;  3AGK A;  2VG7 A;  3C0B A;  1TK8 A;  3ZSZ A;  4CIE A;  3M5R A;  4E1N A;  3NF9 A;  3NF7 A;  1IKX A;  2QI2 A;  3PIP L;  2W42 A;  3T1A A;  3F9K A;  2VYP A;  2QWQ A;  1FJG K;  3K58 A;  4JKF A;  2ZE2 A;  3OYI A;  2VCP A;  3L4Q A;  3CG7 A;  3CJ7 A;  5AQY A;  1T7P A;  2FLO A;  1ZYQ A;  5HRP A;  3PY8 A;  4PQU A;  4DQP A;  4BDY A;  5AQS A;  3AVA A;  2GBZ A;  1VQK N;  2HNZ A;  3O9R A;  3TSP A;  2XO7 A;  3I33 A;  2A6A A;  1TL3 A;  4AIL C;  4H5V A;  4KHQ A;  4LFB K;  4CK2 A;  3O6W A;  3EZ5 A;  4LFC K;  4CZI A;  1RNH A;  3QEW A;  3MXI A;  3CCJ N;  1NK9 A;  2OYQ A;  1VQP N;  2YI1 A;  3SPY A;  3HVT A;  3O3H A;  4WYB A;  5IWA K;  1JL2 A;  3L3V A;  3P31 A;  2OTL N;  3TAN A;  2VGM A;  3BUZ B;  2GWJ A;  4M3R A;  3G4S N;  5ADX A;  5EY4 A;  1SKR A;  1BI4 B;  3ENH A;  4JKG A;  1GLA G;  3Q7C A;  2BGG A;  4DF4 A;  2E2P A;  4Q5V A;  2IAJ A;  3K5N A;  1LWF A;  3NF6 A;  4B9N A;  4LC9 B;  1YIT N;  3KZB A;  3DLK A;  1FKO A;  3KJV A;  3D2E B;  4BRP A;  1A5X A;  4XH1 A;  1TYQ B;  2BAN A;  4IBN A;  3CCV N;  2O8F B;  5JMV A;  4CJ4 A;  4FLZ A;  3N4P A;  3OJU A;  1KAZ A;  4E7K A;  4GVM A;  3CJB A;  5AZJ A;  1RBT A;  3ULE B;  4RCH A;  1YXQ A;  4FJ9 A;  4EHU A;  4NCA A;  2EHG A;  4DKW A;  4CJR A;  5I9E B;  3ZET B;  3PSF A;  4CGG A;  4WFA L;  5E84 A;  2VGN A;  2ZJR L;  4E1J A;  3NGZ A;  4CHO A;  4FOE A;  1N5Y A;  3LAN A;  4FOI A;  5LJW A;  4LFA K;  3TAB A;  3DYA A;  4WQ4 A;  4XEI A;  1EXQ A;  3GBT A;  1HKG A;  4JNE A;  3VQC A;  4YY3 K;  1HKB A;  1S1T A;  2E20 A;  2GUP A;  4H0V B;  2GEL A;  4B9L A;  2I5J A;  2IVP A;  3AA4 A;  1EWQ A;  4FJN A;  3LAM A;  4AHC A;  1BL3 A;  3SMP A;  4F8R A;  1E3M A;  1Z6R A;  1NGJ A;  4DFP A;  4OPA A;  3NVK A;  3F2K A;  1IBM K;  1S1U A;  1U2V A;  1YJ9 N;  1C1B A;  3TAM A;  4BRH A;  1HNV A;  3O9Q A;  2HVH A;  4JN4 A;  1Q81 O;  1QZ5 A;  1W7A A;  1BCO A;  3S3N A;  3O4W A;  3VF2 A;  4M3T A;  3K0S A;  4ILJ A;  3F5T A;  4H5W A;  1Q7Y O;  2XY5 A;  1RDA A;  4E7J A;  4ZTF A;  4FJ5 A;  4FYD A;  1L3U A;  2NRH A;  1NGG A;  5GIN A;  4I9Q A;  4GKK K;  3CC4 N;  3A5O C;  3HXM A;  3PO5 A;  3ULD A;  1RTJ A;  5LY3 A;  1ILY A;  1VAZ A;  1BA1 A;  3TSQ A;  4CEZ A;  3VEW A;  3LM2 A;  3BZC A;  3KK7 A;  4BG9 A;  1TK0 A;  5CYQ A;  4MDA A;  5KPT A;  3MX5 A;  5M1F A;  4BE1 A;  3KLF A;  1ZBL A;  2UUA K;  3H1V X;  5AQJ A;  1HPZ A;  4UY8 O;  1NGA A;  4JI0 K;  4ILG B;  4PWD A;  3U8X A;  2KTQ A;  3OYJ A;  3S9H A;  2OAN A;  4KI6 A;  3J7A P;  1YUW A;  2FXU A;  4AHV A;  5JVG L;  4YOV A;  1U49 A;  4O5B A;  4B8A B;  4DQ8 A;  4RW8 A;  4H0P A;  5BPN A;  4YNQ A;  4EIA A;  4CF9 A;  4Z94 A;  4BE0 A;  4FZX C;  1FXX A;  3VQP A;  4IOC L;  3WEE B;  2WBN A;  2FSK A;  2Q2R A;  3CIP A;  1BI4 A;  4KHY A;  4E1M A;  3NH2 A;  4X66 K;  3O8M A;  4FVM A;  5LJV A;  3P5J A;  4RW7 A;  3PX4 A;  2OPP A;  5AQV A;  2OCE A;  1VSH A;  4U7B A;  5C15 A;  4E7L A;  3QNN A;  3D2E A;  5AR0 A;  2HHX A;  2WTU A;  3OYC A;  4W5N A;  5CY4 A;  3H3O B;  3M8P A;  2O8F A;  3QIP A;  3T1H K;  4BRO A;  2J4R A;  4IJN A;  4GMJ B;  3AO4 A;  4CBU A;  3ULE A;  2FBY A;  4B1X B;  1Q82 O;  4DSI A;  4IG3 A;  3D7E O;  4I6M B;  4CJT A;  3ZET A;  4BQZ A;  1HNW K;  1I39 A;  3HT3 A;  3VEV A;  5IT9 O;  1QE1 A;  3D2F B;  1QHT A;  4KHU A;  1XMQ K;  1U6Z A;  2WON A;  2X74 A;  4G1Q A;  3O4Q A;  1OVQ A;  1C0F A;  2YV0 X;  4WF9 L;  3CJ1 A;  3KTQ A;  1S1V A;  3OYD A;  3SYZ A;  4DV5 K;  3EEQ A;  3NBP A;  1TAQ A;  3ZYY X;  4DR6 K;  3OYN A;  2D0P A;  4RTF D;  1QQO A;  2E2N A;  4JYA K;  5J2M A;  3CPE A;  3SQ4 A;  3VEX A;  3BGR A;  4CZL A;  1DT9 A;  5KQD A;  3WQT A;  2ASO A;  5F1X A;  4FLU A;  4CJU A;  2FSJ A;  2KFN A;  1I94 K;  3V1O A;  4DSJ A;  3OYB A;  5AQZ A;  3U3G A;  1XC9 A;  4W5O A;  1TAU A;  3LDP A;  4HUE A;  1RT6 A;  1J6Z A;  2P9K B;  3VEO A;  1CZB A;  5C0Y A;  4JRQ A;  2ZD1 A;  5MLC Q;  3AVM A;  4J2B A;  3J7Y P;  3CCE N;  1NJX A;  3ZEU B;  1YIJ N;  3CPW M;  4RW6 A;  4M45 A;  4LF5 K;  4DFK A;  2IVO A;  2VG6 A;  3AA5 X;  5CYM A;  3HZ6 A;  2ZQB A;  4BR2 A;  4PL7 A;  3MEE A;  4NCG A;  4M3U A;  4PL8 A;  2WC9 A;  5AFU A;  3VQE A;  1LW0 A;  4BR9 A;  3AVH A;  1SKS A;  3ZT3 A;  3CJA A;  3DLE A;  4BC4 A;  3PUF A;  3ZX2 A;  2NUB A;  4IDK A;  2ZJQ L;  1XWL A;  2P9I B;  4LF9 K;  1RDW X;  1NGH A;  1EWR A;  2HND A;  3KD1 E;  4Z0U A;  2HMI A;  1LCU A;  5FPD A;  3G0Z A;  3VOV A;  1S3X A;  4NXM K;  1V4T A;  3CMA N;  3HST B;  1R0A A;  2DFF A;  1NGE A;  4KH6 A;  5C12 A;  5CHI A;  4LY7 A;  1IG9 A;  3DRR A;  1NKC A;  3OA9 A;  4FWQ A;  4PKI A;  3WEE A;  4YOU A;  3J80 O;  2QWL A;  1GOB A;  1GLL O;  3JXU A;  2Q1N A;  2QXL A;  3SBT A;  1YJN N;  1MWK A;  4L3Q A;  1RIL A;  1OKJ A;  1JKH A;  4JAX A;  4BRM A;  4DR4 K;  2HW3 A;  4B1W B;  4AQY K;  2QXF A;  2F9T A;  4CZM A;  3V6D A;  2KKZ A;  5BPM A;  3HVR A;  2HB5 A;  1BIS A;  2P9U B;  5AQH A;  1TUY A;  4HHT A;  2QKK A;  4B3S K;  2QWO A;  4FPB A;  1QQN A;  4CES A;  1OH7 A;  4I6M A;  1EO1 A;  1VQ9 N;  1EP4 A;  2F4V K;  2HF4 A;  1NJY A;  3D2F A;  1HUX A;  4RG8 A;  3SJH A;  1NK4 A;  5M1Q A;  5D3G A;  4Y1D A;  2G8U A;  2HHV A;  4PHT X;  2RKI A;  3BF1 A;  4CIG A;  1NJI O;  3TAG A;  2UXC K;  2O8B B;  1RT5 A;  1TGO A;  4EZ9 A;  1D8Y A;  3OVN A;  3FGU A;  2QWR A;  1QHA A;  3FFI A;  4E19 A;  3HP6 A;  3F73 A;  1J5O A;  1VQ4 N;  4OPJ A;  1WLJ A;  3CM6 A;  1NK6 A;  1C0T A;  3MCP A;  3O1B A;  3VGK A;  5HL7 L;  3QES A;  3THV A;  4EZ6 A;  2FF3 B;  3S3M A;  3AAR A;  4Z4C A;  4OKE A;  3H6E A;  4WQ5 A;  4CBX A;  1VSI A;  3AO5 A;  3T7Z A;  4U67 L;  1Z05 A;  4CZE A;  2ASP A;  1B92 A;  3QB0 A;  4LH4 A;  4BRE A;  2P9K A;  3IG1 A;  3ZSV A;  5ELZ A;  5JS2 A;  4FJG A;  2YNF A;  4DB3 A;  4YOT A;  1BDG A;  1YJW N;  3OYL A;  3MCA B;  3MK6 A;  4CZJ A;  5I3U A;  3K5L A;  3ZEU A;  3G10 A;  5KQ8 A;  4O44 A;  2Y1I A;  4KTZ A;  3VGL A;  3OS1 A;  4CZH A;  3HYF A;  3FR0 A;  3K59 A;  3KWI A;  3MN6 A;  4GW6 A;  4CJ5 A;  5FRN A;  2P9P B;  3R8E A;  1UA1 A;  2D0A A;  3LWM A;  5KRS A;  2NRT A;  4CF1 A;  2P9I A;  4KB1 A;  1VQ8 N;  3V9U A;  2HF3 A;  1C1C A;  4CHZ A;  4CHY A;  2E1Y A;  1QTM A;  3K57 A;  2YHA A;  4FZY A;  1ATR A;  4JKC A;  1MA9 B;  4DS4 A;  1VSL A;  1LW2 A;  1N33 K;  2OA8 A;  3ISN C;  1K9M O;  4JKG B;  4JI6 K;  3L2Q A;  3R6M A;  3G71 N;  3I0S A;  3TTD A;  2YHB A;  3DLL L;  3LL3 A;  4QS9 A;  5FRO A;  3L8B A;  4DR2 K;  4CCH A;  1XHZ A;  1KLN A;  4B3M K;  4GV3 A;  4BE2 A;  1N8R O;  4CED A;  1W2B M;  5AQO A;  4CZK A;  1BU6 O;  1E4F T;  1IKW A;  3DWL A;  5BN9 A;  4FVU A;  4CJF A;  2PFU A;  2W40 A;  3AAQ A;  4BRF A;  1Q9Y A;  2XRI A;  4B9V A;  3U3Y A;  1KFD A;  4CF8 A;  3MX2 A;  1RBU A;  3P1G A;  3TTF A;  3WQU A;  3V1R A;  4OGE A;  3BY5 A;  3K9K A;  3VGM A;  1WSH A;  3O9T A;  4DWI A;  4JI5 K;  1Z25 A;  4IZ9 A;  3ATV A;  2DY4 A;  3HP9 A;  1K6Y A;  1R59 O;  2HST A;  5GAH P;  5EVZ A;  2ZF5 O;  3IRX A;  4BC3 A;  4Y0W A;  3VPZ A;  4MLH A;  4LF7 K;  3RWU A;  3VQ9 A;  3A0I X;  1JCF A;  1KAY A;  4DQQ A;  4BWM A;  1DGK N;  2BUP A;  1QVF M;  4RW4 A;  4C1N K;  1RBR A;  1WSJ A;  4CBW A;  1S5J A;  4KB0 A;  4B3R K;  4OJR A;  2HMP A;  4B3T K;  2O8B A;  4DV4 K;  1VQN N;  4DV6 K;  2O4I A;  2A42 A;  3OYF A;  2IS3 A;  4DTN A;  1J9A A;  4FJH A;  1IKY A;  2QA4 N;  3SNN A;  4O0I A;  1X9M A;  1U2V B;  4X62 K;  4CGF A;  1LOT B;  4CGI A;  3P39 A;  1IJJ A;  4BDZ A;  3HL8 A;  3M1F A;  4X64 K;  2EWS A;  1VQO N;  1Q8I A;  2NRX A;  1NWK A;  2D0O A;  3QDK A;  1SL0 A;  3C7N B;  5J2Q A;  1NKE A;  3RMC A;  3AVB A;  3MED A;  1YHQ N;  3CCL N;  3NF8 A;  3T1Y K;  4BRG A;  2UUB K;  4F3T A;  4JKE A;  1WSE A;  2Q0R A;  4OPK A;  3C6A A;  4CER A;  3UIQ A;  3AVJ A;  3CFP A;  2XHB A;  3OYM A;  1KRP A;  4IKF A;  3KIO A;  4ILH A;  1CLQ A;  1ASV A;  3Q7B A;  3WXJ A;  5FPN A;  4EHT A;  1GOA A;  3QEP A;  3VQ6 A;  1IG8 A;  1LAV A;  2P9P A;  1TL1 A;  3WNH A;  1RBS A;  3PSI A;  2UYT A;  4CJP A;  1X9J A;  2Z1H A;  1G99 A;  3CQX A;  3OYA A;  3DI6 A;  2B5J A;  1IO2 A;  2ITM A;  3RRG A;  1KXP A;  3SBG A;  4IO8 A;  2F9W A;  3GE1 A;  2PYL A;  4GV9 A;  1DEJ A;  1ZBF A;  4LF8 K;  1Q9X A;  3P38 A;  4CJW A;  4DV7 K;  1N34 K;  4F2S A;  2UU9 K;  1DTQ A;  2IC3 A;  3AO3 A;  1OH6 A;  3RMB A;  2Q31 A;  3MWT A;  4CEB A;  3LDL A;  3HO1 A;  4B3O A;  1M90 O;  3KK3 A;  1BOT O;  1NGF A;  3D6R A;  4DTX A;  1VSK A;  2F8T A;  4ISF A;  4CF0 A;  1JJ2 M;  4K42 A;  3JSM A;  3IKM A;  3RRH A;  3NE6 A;  4BRN A;  4K0K K;  1F21 A;  5EOY A;  4FWO A;  1KC8 O;  2F8S A;  3H1Q A;  1O1W A;  4YDU A;  4KBO A;  4JHD B;  5K14 A;  3E01 A;  5M1O A;  1NK7 A;  1TUU A;  4I2P A;  4CF2 A;  1VQL N;  4J8F A;  3LM9 A;  5AZI B;  4DTJ A;  1N32 K;  3HPH A;  1U47 A;  4WCE L;  1QSL A;  1CXU A;  4FZZ A;  3AY9 A;  1W0H A;  2QEX N;  5GAG P;  5AQK A;  3HRG A;  4YFU A;  3SI6 A;  2HHT A;  4FWM A;  1SV5 A;  5T7B A;  3V9Z A;  1HPM A;  1U4B A;  3E9L A;  3VF4 A;  1HMV A;  3C94 A;  4CZF A;  4IG0 A;  2A3Z A;  3CHW A;  3LDS A;  1M1K O;  4CHQ A;  3VMF B;  4FO0 A;  2PBD A;  1NG9 A;  1Y64 A;  5GAD P;  1X9S A;  3H08 A;  3C7N A;  3BZK A;  3RMA A;  4Z4G A;  4FWK A;  4ID1 A;  1T05 A;  3K5O A;  3B6P A;  4DSE A;  4X65 K;  4M7X A;  1UOC A;  5I42 A;  4OPH A;  1TKZ A;  1WSG A;  4KFB A;  2D4W A;  4DUZ K;  3A2F A;  3L0Q A;  1ITG A;  3EL2 A;  1WBB A;  1ZXO A;  3L6Q A;  1Q86 O;  3O3F A;  1EET A;  3PIO L;  2E2Q A;  3QML A;  1HNZ K;  1KCF A;  4W5Q A;  3ENO A;  1C0M A;  5ADX H;  1RCH A;  3SV4 A;  5E41 A;  1TKX A;  3SUN A;  1K8K B;  3HM8 A;  3KK2 A;  2IGI A;  4FLT A;  4KO0 A;  3QIO A;  4CFC A;  2BDP A;  4BC2 A;  2W41 A;  4DLG A;  4DQS A;  1EX4 A;  1BGX T;  3WXI A;  1XHX A;  2YKM A;  3O3G A;  2DPN A;  1RDC A;  1T44 A;  5F0X A;  1Z26 A;  2QM1 A;  1VSD A;  4FK0 A;  4IOX A;  3PV8 A;  4IFE A;  4E0D A;  4AM6 A;  3THX B;  4B9T A;  4B1V A;  1RBV A;  5GIP A;  1N36 K;  3LP3 A;  4GV6 A;  5GAE P;  3CJ9 A;  3KVG A;  4H03 B;  3HM9 A;  3DRS A;  1T8E A;  1IH7 A;  3TTC A;  1E4G T;  4FLY A;  5AQT A;  3MWP A;  5C2D A;  2YNI A;  1RT3 A;  3LP0 A;  1TK5 A;  3MN9 A;  4CJS A;  5EU7 A;  2YNG A;  4H0Y B;  4JHD A;  3SMS A;  4CK1 A; 
#chains in the Genus database with same CATH homology
 3C6H A;  2QWO A;  4QS8 A;  4JKB A;  4FPB A;  1QQN A;  2P9U A;  4BGB A;  1YVN A;  4IJA A;  3MN5 A;  1NGB A;  4MDB A;  3H46 O;  5AZI A;  4I6M A;  4IWV A;  1NGC A;  1VQ9 N;  1EO1 A;  5KPZ A;  3PLA A;  4MLE A;  5AQN A;  3CCR N;  2ZJP L;  2HF4 A;  3D2F A;  1HUX A;  3F9M A;  3SJH A;  3EN9 A;  3K9J A;  2Q97 A;  5M1Q A;  4PHT X;  2YJE A;  3SAH A;  3BF1 A;  1NJI O;  3CXC M;  2A40 A;  2GX9 A;  3A5N C;  4CJ7 A;  3UB5 A;  3FGU A;  4JK7 A;  2QWR A;  3FLC O;  2Q36 A;  1QHA A;  2QW9 A;  3GOI A;  3IMX A;  5EXW A;  5JIC A;  2JWK A;  2NRR A;  3HSC A;  1VQ4 N;  1HJO A;  3EKU A;  4KH4 A;  5HOO A;  4BY9 C;  4CD1 A;  3MCP A;  1GLE G;  3O1B A;  3VGK A;  5HL7 L;  3MMV A;  5AQM A;  3DXM A;  4BRA A;  4C1N I;  2FF3 B;  1YAG A;  3AAR A;  2NLX A;  2P9L B;  4FWS A;  3H6E A;  4WQ5 A;  4JHD A;  4CBX A;  3UE5 A;  4RWT A;  2D1K A;  3A5M C;  4BG8 A;  2WUS A;  3T7Z A;  5BRF A;  3WXL A;  1Z05 A;  4CZE A;  4U67 L;  1X3N A;  3OW2 M;  4PKH A;  3FE1 A;  4A2B A;  4R79 A;  2ASP A;  5JLF A;  3QB0 A;  1KAX A;  3CQY A;  4FWR A;  3UKR A;  4BRE A;  2P9K A;  2PAV A;  5ELZ A;  3A8Y A;  4DB3 A;  4BC5 A;  1MDU B;  2QWP A;  3CER A;  1BDG A;  4YOT A;  3AGK A;  2IIR A;  3C0B A;  4A61 A;  2H3G X;  3CME N;  1YJW N;  2NRW A;  3M5R A;  3CF5 L;  3MCA B;  5DM6 L;  3ID8 A;  3MK6 A;  4IOA L;  2QI2 A;  3PIP L;  4CZJ A;  3CCU N;  5AZJ B;  3ZEU A;  5KQ8 A;  2VYP A;  2QWQ A;  3B8A X;  3VGL A;  3OHR A;  3E9O A;  3VER A;  4BQL A;  4JKF A;  1HKC A;  3OBW A;  4CZH A;  3FR0 A;  2VCP A;  3L4Q A;  1SS6 A;  3CJ7 A;  1SAZ A;  5AQY A;  3KWI A;  3MN6 A;  2FLO A;  1BO5 O;  2P9P B;  2KHO A;  1NBW A;  3R8E A;  1K8K A;  4EFH A;  5AQL A;  5AQS A;  1HX1 A;  2NRT A;  5AQW A;  2P9I A;  1VQK N;  4OO1 J;  3O9R A;  4GY2 B;  4BR4 A;  3TSP A;  1VQ8 N;  1ATS A;  2A6A A;  2HF3 A;  3I33 A;  5JVH L;  2E1Y A;  4H5V A;  4IXC A;  3O6W A;  4KH5 A;  3CCM N;  4JKD A;  4CZI A;  3SMS A;  1ATR A;  3ID6 A;  4JKC A;  1MA9 B;  1WUA A;  3I8B A;  3CCJ N;  1VQP N;  1NGD A;  2YI1 A;  4WYB A;  2QWN A;  3P31 A;  1K73 O;  3U9Z A;  3FZF A;  4JKG B;  1K9M O;  2OTL N;  3R6M A;  2VGM A;  3QBW A;  1GLB G;  5BN8 A;  1GLD G;  3G71 N;  3BUZ B;  4JKA A;  1P8Z A;  3FFK B;  2GWJ A;  3TTD A;  3G4S N;  3DLL L;  3LL3 A;  4QS9 A;  5ADX A;  5EY4 A;  2ZWH A;  3RSE B;  3ENH A;  4GV3 A;  4JKG A;  1GLC G;  1N8R O;  1GLA G;  3Q7C A;  3A5L C;  3M6G A;  1W2B M;  2HBJ A;  2E2P A;  5AQO A;  4CZK A;  1BU6 O;  1E4F T;  3DWL A;  2YHY A;  4IEE A;  5BN9 A;  4NLC A;  4LC9 B;  4BRC A;  5B8H A;  4FVU A;  2PFU A;  1GLF O;  2W40 A;  3KZB A;  1YIT N;  3AAQ A;  3I56 N;  1GLJ O;  3W0L A;  2V52 B;  5AQP A;  1HLU A;  3QBX A;  4BRF A;  3D2E B;  2KLA A;  1T6D A;  4BRP A;  4XH1 A;  3MX2 A;  1O13 A;  1NM1 A;  4H5T A;  3TTF A;  1TYQ B;  3WQU A;  3EE9 A;  3CCV N;  1JCG A;  5JMV A;  3K9K A;  3MN7 A;  3N4P A;  3LDO A;  3VGM A;  1KAZ A;  3O9T A;  3CJB A;  2GEM A;  3IFR A;  5AZJ A;  4IZ9 A;  3ULE B;  4K43 A;  1TYQ A;  1YXQ A;  3ATV A;  1BG3 A;  4RCH A;  4BGA A;  2QWM A;  2ZGZ A;  2I7P A;  4M63 C;  1R59 O;  3C65 A;  4EHU A;  5DM7 L;  3HOT A;  2HST A;  5GAH P;  4A59 A;  5TKY A;  5EVZ A;  4DKW A;  5I9E B;  3ZET B;  3VTH A;  2ZF5 O;  3W3D A;  4BC3 A;  3SAF A;  4Y0W A;  3VPZ A;  1P90 A;  4MLH A;  2P9N B;  4WFA L;  1RFQ A;  5E84 A;  2VGN A;  2ZJR L;  4E1J A;  2VWB A;  3A0I X;  1JCF A;  1KAY A;  4FOE A;  1DGK N;  2BUP A;  1QVF M;  3CJC A;  4FOI A;  4B9Q A;  4C1N K;  4CBW A;  5LJW A;  3IDH A;  4K25 A;  2HMP A;  3VEY A;  3R3L A;  4WQ4 A;  4XEI A;  4A57 A;  3GBT A;  2NRV A;  1HKG A;  4JNE A;  3HOS A;  5BRE A;  2F7T A;  1HKB A;  2GUP A;  2E20 A;  3AAP A;  4O8U A;  4WFB L;  3HTV A;  1VQN N;  4H0V B;  2GEL A;  2A42 A;  4BVO A;  2IVP A;  2P9S B;  4WQ5 C;  3T69 A;  2QA4 N;  4O5F A;  3SMP A;  4FL9 A;  1DKG D;  1U2V B;  1Z6R A;  1NGJ A;  5E26 A;  3EKS A;  1LOT B;  4BRL A;  1XUP O;  3P39 A;  3H45 C;  1IJJ A;  4B1Z A;  4OPA A;  3NVK A;  4CZG A;  3F2K A;  3P4I A;  2P9L A;  3M1F A;  1U2V A;  1YJ9 N;  5M1K A;  2CH5 A;  2EWS A;  3BP8 A;  1MWM A;  1VQO N;  2NRX A;  3QDK A;  1NWK A;  2D0O A;  4H5R A;  5AFU H;  4BRH A;  5C10 A;  3C7N B;  1XQS C;  3LDQ A;  5AQR A;  3O80 A;  1QVG M;  3O9Q A;  2ASM A;  3J8A A;  4JN4 A;  1Q81 O;  3DXK B;  1QZ5 A;  1YHQ N;  1D4X A;  3R9P A;  3SK3 A;  3CCL N;  3O4W A;  3VF2 A;  2E1Z A;  2HBL A;  4BRG A;  2JWL A;  4JKE A;  4ILJ A;  2ZGY A;  3F5T A;  2Q0R A;  4GVE A;  4G9Z A;  4H5W A;  4O8K A;  3C6A A;  4FPA A;  1NMD A;  1NGI A;  4K41 A;  1S72 N;  2CH6 A;  1Q7Y O;  1VQ6 N;  1C0G A;  3FZL A;  4ILH A;  3ATU A;  5FPM A;  3E9P A;  3ZX0 A;  1RDU A;  2NRH A;  2HOE A;  2NZT A;  1NGG A;  3M3Z A;  3R1X A;  3Q7B A;  5GIN A;  2E88 A;  3WXJ A;  1ATN A;  2AP1 A;  3CC4 N;  2OTJ N;  2A41 A;  3A5O C;  5FPN A;  3CC7 N;  4EHT A;  5AQX A;  5LY3 A;  4IDH A;  4YOY A;  1ILY A;  3H3N O;  1BWF O;  1VAZ A;  1BA1 A;  3TSQ A;  3LM2 A;  3VEW A;  1IG8 A;  2P9P A;  2A5X A;  3KK7 A;  4BG9 A;  2YCH A;  5KPT A;  4MDA A;  2YX6 A;  3MX5 A;  5M1F A;  4AF1 A;  3H1V X;  5AQJ A;  3O9S A;  3QFU A;  1NGA A;  4UY8 O;  2CGJ A;  3EO3 A;  4ILG B;  3O9U A;  2E8A A;  3U8X A;  3AGR A;  4IEI A;  2OAN A;  3GL1 A;  2UYT A;  4QS7 A;  4BRK A;  1X9J A;  2YJF A;  4YOW A;  5AQQ A;  1G99 A;  1YUW A;  3CQX A;  3UKU B;  3G25 A;  3SLC A;  2FXU A;  5JVG L;  4F9O A;  2ITM A;  3VES A;  4MO5 A;  1KXP A;  3SBG A;  3FZH A;  4IO8 A;  4DCH A;  4YOV A;  3NMU A;  2F9W A;  3GE1 A;  5AQU A;  4DQ8 A;  4CD3 A;  4H0P A;  3NVM A;  1DEJ A;  3CI5 A;  5BPN A;  4GV9 A;  3HBT A;  2IVN A;  3P38 A;  4EIA A;  5CR4 A;  4Z94 A;  1SZ2 A;  1BA0 A;  3QFP A;  3GDQ A;  5AQF A;  2QTD A;  3O5B A;  3WXM B;  2Q31 A;  3MWT A;  3LDL A;  3TSU A;  4HTL A;  3WEE B;  4IOC L;  2WBN A;  2FSK A;  4NLB A;  2Q2R A;  3U9D A;  5GIO A;  1W97 L;  1M90 O;  3RSE A;  3CIP A;  4JD2 B;  1BOT O;  2YHW A;  4ISG A;  3SAG A;  1NGF A;  3D6R A;  3O8M A;  5LJV A;  4BVP A;  4ISF A;  1JJ2 M;  5AQV A;  4H0O A;  4K42 A;  4BRD A;  4U7B A;  2E2O A;  3IKM A;  5C15 A;  3J7Z O;  4PKG A;  4GNI A;  4BRN A;  3D2E A;  5AR0 A;  4BR5 A;  5EOY A;  1KQS M;  3DJC A;  1XC3 A;  4FWO A;  1JCE A;  1KC8 O;  2FSN A;  2NNW A;  3H1Q A;  4EAH D;  3E1Y A;  1KD1 O;  4YDU A;  3H3O B;  4KBO A;  4BRO A;  2FF6 A;  2J4R A;  4FWP A;  4IJN A;  4JHD B;  5M1O A;  4CBU A;  3BEX A;  5AQG A;  3ULE A;  1TUU A;  4B1X B;  1VQL N;  1Q82 O;  4J8F A;  3LM9 A;  5AZI B;  2CGK A;  3D7E O;  4I6M B;  5M1N A;  3ZET A;  4BQZ A;  3QIC A;  5BR9 A;  2BTF A;  4C23 A;  2P9N A;  4WQ4 C;  3VEV A;  1YF5 L;  4WCE L;  5KPR A;  3CD6 N;  3D2F B;  1U6Z A;  1NLV A;  4BRI A;  3O08 A;  4A62 A;  2V51 B;  3AY9 A;  1V4S A;  3MDQ A;  3WUH A;  1C0F A;  3LDN A;  1VQ5 N;  4BR7 A;  4FWN A;  5GAG P;  4WF9 L;  3CJ1 A;  2QEX N;  3E66 A;  3JS6 A;  5AQK A;  3VET A;  4YOX A;  3HRG A;  1H1V A;  3ZX3 A;  1K8A O;  2WFB A;  3ZYY X;  4FWM A;  2D0P A;  4RTF D;  1WOQ A;  1QQO A;  2E2N A;  2P9S A;  4AM7 A;  3CPE A;  3TPQ A;  1ZC6 A;  2AA4 A;  1HPM A;  4H5N A;  3VEX A;  4CZL A;  4MO4 A;  3EE8 A;  1DT9 A;  5KQD A;  3E9L A;  3DXM B;  4A5B A;  3VF4 A;  3WQT A;  2ASO A;  2RE2 A;  3VF6 A;  5F1X A;  4CZF A;  3KHY A;  3FZM A;  1EQY A;  2A3Z A;  2FSJ A;  3CHW A;  1M1K O;  1CZA N;  3VMF B;  4FO0 A;  2PBD A;  2GWK A;  1BUP A;  1Y64 A;  2NRZ A;  4JKH A;  1X3M A;  3VEN A;  3C7N A;  1RGI A;  5BRH A;  5GAD P;  3O1W A;  4BR0 A;  4FWK A;  5AQZ A;  3DXK A;  1VQM N;  3UKR B;  2V7Y A;  3LDP A;  1J6Z A;  2P9K B;  4HWI A;  3VEO A;  5C0Y A;  3BF3 A;  4M7X A;  3CC2 N;  1VQ7 N;  5MLC Q;  4H0T B;  4OPH A;  1OVY A;  2D4W A;  3L0Q A;  5H1S Q;  4CI6 A;  3CCE N;  3EL2 A;  1ZXO A;  4NO7 A;  3N4Q A;  3ZEU B;  3KWG A;  1SQK A;  3CPW M;  3FZK A;  4IO9 L;  3L6Q A;  1YIJ N;  1Q86 O;  1Q18 A;  4BRQ A;  4B1Y B;  2IVO A;  3HZ6 A;  5CE3 A;  4BR2 A;  4DHY A;  4PL7 A;  1ESV A;  5EX5 A;  3PIO L;  2E2Q A;  3QML A;  4PL8 A;  2WC9 A;  1T3V A;  5AFU A;  4FWL A;  2GTD A;  3OBY A;  3ENO A;  4NB4 A;  4BR9 A;  2I7N A;  4B1U B;  1QQM A;  4JK8 A;  3HI0 A;  5ADX H;  5C2F A;  1K8K B;  4FSV A;  3CJA A;  4BC4 A;  3HM8 A;  5BPL A;  5JLH A;  3ZX2 A;  2ZJQ L;  3RVC A;  1S22 A;  2P9I B;  1RDW X;  4YOR A;  1NGH A;  4BC2 A;  2W41 A;  4A5A A;  3UKU A;  2HBK A;  3WXI A;  1LCU A;  2DPN A;  5FPD A;  1T44 A;  1S3X A;  2QM1 A;  3VOV A;  1V4T A;  5BRD A;  5F0X A;  4A2A A;  3U4L A;  3CMA N;  4IOX A;  3WXK A;  3CET A;  3GG4 A;  1NGE A;  2RHK A;  4KH6 A;  5TKW A;  5C12 A;  4IFE A;  5CHI A;  3EZW A;  3CCQ N;  4M7Y A;  4AM6 A;  3OA9 A;  2CGL A;  4FWQ A;  4PKI A;  3CCS N;  2V7Z A;  3WEE A;  4B1V A;  4XH4 A;  4YOU A;  2QWL A;  3S41 A;  5GIP A;  1GLL O;  3JXU A;  4JD2 A;  2Q1N A;  5FPE A;  2YHX A;  2QXL A;  3SBT A;  4XH5 A;  3I55 N;  5AQI A;  5GAE P;  4GV6 A;  1YJN N;  1MWK A;  1ZBS A;  3CJ9 A;  4L3Q A;  2HBM A;  3KVG A;  5F2R A;  3WT0 A;  4YDU C;  1OKJ A;  4H03 B;  4ISE A;  3VTI A;  3G6E N;  4JAX A;  3TU5 A;  4BRM A;  4B1W B;  2BH1 A;  3TTC A;  1E4G T;  1QZ6 A;  5AQT A;  3MWP A;  5C2D A;  2F9T A;  4JK9 A;  4CZM A;  3ENB A;  1YI2 N;  2KKZ A;  5BPM A;  2Q0U A;  4WFN L;  3MN9 A;  2P9U B;  4H0X B;  3VEZ A;  5AQH A;  3IUC A;  3L4I A;  4H0Y B;  1TUY A;  5M1P A;  3DAW A;  4JEP A;  1T6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...