4BRAA

Legionella pneumophila ntpdase1 crystal form ii, closed, mg amppnp complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
358
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 114
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4braA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4braA02
1KAXA 3WT0A 4CZLA 2FF6A 2J4RA 3BEXA 4I6MA 4GNIA 3ZETB 4BQZA 4HTLA 5ELZA 5AQPA 4IZ9A 1TYQA 1XQSC 5EOYA 2E88A 2I7PA 2QWLA 1NGDA 2QWMA 4B1VA 5FPEA 5JMVA 4FO0A 3CJ7A 4JHDB 2CH6A 3M3ZA 1SAZA 3KHYA 2AA4A 4NO7A 5BRHA 3ID8A 2FSNA 2HF4A 5F2RA 1Z05A 3A5MC 4PL8A 5BN8A 3VEWA 4BRCA 3QFUA 5AQFA 3VGLA 5AQYA 3KZBA 3ATUA 3LL3A 5BPLA 2P9UA 2P9LA 3EL2A 3DAWA 4BROA 1HX1A 4KBOA 3FGUA 5BPMA 4EIAA 4WYBA 5FPDA 5KPRA 3AAQA 3R6MA 1NM1A 1NGFA 4DB3A 1EQYA 2IVOA 4M7XA 3C7NA 4FWPA 4BRDA 2CGJA 1NGJA 2YHYA 4WQ5C 5KPZA 2Q97A 4CZKA 2CGLA 4C23A 2F9TA 1GLLO 1BDGA 3BP8A 2FF3B 1ZXOA 3WQTA 5JLHA 4K25A 4IWVA 5BR9A 1LCUA 4IJAA 1U2VA 1G99A 3ULEA 4JD2B 4A2AA 4YDUC 1NMDA 1U6ZA 1ZBSA 3CJBA 3QFPA 4BR0A 4CZJA 2YI1A 1MWMA 4FOEA 3FZLA 4H5VA 1GLBG 1NGHA 5JLFA 3O08A 4K43A 3B8AX 2A42A 3ATVA 4WQ4C 3BF3A 3VEZA 1GLFO 2ASMA 4O8KA 3LDPA 3ZEUA 4BRAA 4CD3A 5FPMA 4FWNA 3CQYA 2BTFA 4RCHA 2BUPA 2YCHA 5TKYA 3UKUA 2P9IA 3GG4A 4EHTA 1NGIA 4LC9B 3VESA 3F9MA 1T6CA 1DKGD 2CGKA 1HKGA 4CZMA 1NGEA 1Z6RA 4BR4A 1QQNA 4RTFD 5BREA 4FOIA 1JCEA 1S22A 2QM1A 3VF2A 3AARA 1V4SA 3C0BA 3CI5A 3WXIA 3A0IX 4MLEA 5AQWA 3MN7A 4AM7A 2CH5A 3GDQA 5AQHA 3VGKA 4E1JA 2P9SB 1J6ZA 4K42A 4DQ8A 5AQXA 2NZTA 3BUZB 1BO5O 4IO8A 1BWFO 1K8KB 3GBTA 3VF4A 1R59O 3JS6A 4BC2A 1BA0A 1TUUA 2HMPA 4M63C 2ZF5O 1ATSA 1BG3A 2ZWHA 3WUHA 1NGCA 1BOTO 1BU6O 4CZEA 1NBWA 5AZJB 3UKRA 1XC3A 4H0YB 3VEYA 3WEEB 1GLAG 5AQOA 3D2EB 3A5NC 3ZETA 3DWLA 5AQKA 2GELA 5ADXA 2KHOA 2E2PA 3SJHA 4PKGA 5B8HA 3O5BA 2A3ZA 1ATNA 2E1ZA 2A40A 5KQ8A 3VGMA 3IMXA 3TPQA 3LDNA 2YJFA 4JHDA 5BPNA 2GUPA 3U9DA 2P9KB 3QDKA 3LM2A 2GEMA 1V4TA 5LY3A 3AAPA 3G25A 4J8FA 5BN9A 3EN9A 3I33A 3EKUA 2HF3A 4XH4A 1YAGA 4FWSA 2FLOA 4CZGA 1IG8A 2V7ZA 4FWRA 3QMLA 4H0OA 1DEJA 3VPZA 2E2OA 2IIRA 4BRGA 3DXKB 3H46O 4JN4A 1YXQA 2Q2RA 1SZ2A 4H5TA 4F9OA 4CZHA 1LOTB 1MDUB 3L0QA 4B1UB 4BRFA 4L3QA 1D4XA 2P9NB 2E8AA 3L4IA 3HTVA 2Q1NA 3H6EA 2QWPA 4MLHA 4QS7A 2DPNA 2GWKA 1C0FA 3GL1A 5EXWA 1IJJA 1QQMA 5CE3A 3BF1A 1X3MA 2P9PB 1X9JA 4JD2A 2PBDA 3HSCA 2IVPA 2H3GX 2UYTA 1C0GA 3FZHA 3O1WA 1TUYA 3M6GA 2W41A 3RSEB 5AQNA 5AQZA 1OKJA 3MMVA 3D2FB 4FWLA 4BR5A 1JCGA 3CQXA 1YUWA 3TU5A 5AQUA 2VYPA 2E1YA 4PKHA 2QXLA 1KAYA 1MWKA 1BUPA 4BG8A 4BRMA 3W0LA 4FL9A 3O1BA 5AZIB 3VF6A 2PAVA 4IXCA 3D7EO 1E4FT 3H45C 4BREA 4BQLA 1QZ6A 3SK3A 1KXPA 5EY4A 3GE1A 3WQUA 3FFKB 1NLVA 4H0PA 4ISFA 4EAHD 2ITMA 2D0OA 2P9SA 5AQGA 4QS8A 4WQ5A 3IDHA 2Q31A 4EHUA 4PL7A 1HLUA 1K8KA 3M1FA 3A5LC 5AR0A 1NGBA 5EVZA 3FZFA 3VEXA 4H0VB 3MK6A 5AQTA 3EKSA 5AZJA 4B1YB 4FWOA 3WEEA 2QW9A 3UE5A 3D2EA 1T6DA 4BC4A 3P4IA 3MDQA 4YDUA 4BRLA 4CBUA 3WXKA 4A62A 3ENHA 2A41A 4CZFA 2NRHA 3CJCA 5KQDA 3WXJA 1SQKA 4H0XB 4BRHA 4BG9A 1JCFA 1NGGA 3EO3A 3I8BA 4GY2B 4QS9A 4WQ4A 1RGIA 1HUXA 2FSJA 5F0XA 2P9KA 2FXUA 4FWMA 5AQSA 4JAXA 4BRQA 5LJWA 3DXMB 3U9ZA 3WXLA 3ZX3A 1WUAA 2Q0RA 4FPAA 2E20A 5EX5A 3H3OB 1HKBA 2E2QA 3CERA 5AQIA 1GLJO 3DXKA 1NWKA 4M7YA 4BR2A 3U4LA 4BVPA 4BR7A 2HOEA 2ASPA 3LDLA 2A6AA 2IVNA 1GLDG 4H5NA 2D0PA 4CBXA 4I6MB 3H3NO 4XH1A 3J8AA 3O6WA 2Q36A 1TYQB 2P9NA 4ISGA 4AM6A 4BVOA 5BRDA 5I9EB 2D1KA 1E4GT 2E2NA 3CJAA 3MN5A 3EZWA 5AQLA 3O80A 3R8EA 2D4WA 3SLCA 4BR9A 3VEVA 2P9PA 5FPNA 1RFQA 4HWIA 3VETA 3LM9A 5BRFA 3SMPA 4BRPA 2YJEA 4B9QA 1QHAA 2P9UB 3FZKA 1XUPO 2P9LB 2QWQA 3QICA 4H0TB 4PKIA 4BGBA 2EWSA 3CETA 3RSEA 3VEOA 4MO4A 3HI0A 5F1XA 1ZC6A 1MA9B 2QWNA 3D2FA 3VOVA 2AP1A 3KVGA 4CBWA 3S41A 3QBWA 3C7NB 3O8MA 1GLEG 3L6QA 4H03B 2WUSA 2GWJA 4BRNA 5AFUH 4CD1A 1HJOA 3JXUA 3QB0A 5KPTA 5AQRA 5AZIA 1HPMA 4BC3A 5AFUA 1ATRA 2FSKA 2OANA 1X3NA 2V51B 3ZX0A 4BC5A 4XH5A 4DHYA 5JICA 1HKCA 1U2VB 3ULEB 2Q0UA 4IJNA 3LDQA 3FZMA 4BRIA 4NB4A 4XEIA 3O4WA 2F9WA 3LDOA 4CJ7A 4FWQA 2V7YA 2ASOA 1BA1A 1Y64A 3IUCA 4FSVA 2ZGZA 3GOIA 4H5WA 3ENOA 3U8XA 4BGAA 1H1VA 3DJCA 4FWKA 4Y0WA 3A8YA 3OHRA 1P8ZA 2W40A 1QZ5A 5AQMA 3UB5A 3VERA 5AQQA 3MN9A 1WOQA 2YHWA 4A61A 2NLXA 3ZEUB 4CI6A 2QWOA 1ESVA 3UKUB 3FR0A 2P9IB 5AQVA 3QBXA 3SMSA 4B1ZA 1QQOA 3HM8A 5LJVA 3R9PA 2ZGYA 1NGAA 4MO5A 1S3XA 4Z94A 2I7NA 1T44A 5E84A 4H5RA 3CJ1A 4K41A 4RWTA 1DGKN 3HZ6A 2V52B 3MN6A 3CHWA 1YVNA 5AQJA 3FLCO 4ISEA 3DXMA 1KAZA 3FE1A 3H1QA 4A2BA 4JNEA 1CZAN 2A5XA 3CIPA 4EFHA 1Q18A 3AY9A 3VENA 4O5FA 5ADXH 3W3DA 4BRKA 3A5OC 3HBTA 4CZIA 2YHXA 2QWRA 4DCHA 1GLCG 3H1VX 3MCPA 2GTDA 4B1XB 5E26A 4FPBA 2VWBA 4B1WB 3IFRA 2VCPA 3ZX2A 3UKRB 1RDWX 3CJ9A
chains in the Genus database with same CATH superfamily
1KAXA 2FF6A 2J4RA 4DSKA 3DLKA 4FM2A 5AQPA 3CD6N 5EOYA 2E88A 2I7PA 2QWLA 4OLBA 5HBMA 3WNFA 2O8EB 1NGDA 2QWMA 5FPEA 3M8PA 4M3TA 5MLCQ 4CEDA 3L3UA 5SWMA 2OCEA 3ID8A 3OYLA 2PFUA 5F2RA 3CCLN 4AHTA 3MEEA 3A5MC 4CJFA 4E0DA 5BN8A 3QFUA 3VGLA 3LL3A 1W97L 2ITGA 2P9UA 3AVIA 2P9LA 3DRSA 1TK5A 4BROA 4KBOA 3MEDA 1HQEA 4M3ZA 4EIAA 3AAQA 3CC7N 4FWPA 2O8CA 5CZ1A 3DRPA 2YHYA 4WQ5C 2Q97A 4CZKA 4F2SA 1NKCA 4C23A 1GLLO 3BP8A 2FF3B 5GIOA 4EP5A 3WQTA 2HBJA 3TAPA 4JKCA 3P83D 1YTAA 3PX4A 5BR9A 2E6MA 1LCUA 3TAGA 1HNIA 1YVUA 4DTSA 2IS3A 5DM6L 2JWLA 4KB1A 4FZZA 4JD2B 4YDUC 1NMDA 1U6ZA 4CZJA 4NYFA 2YI1A 1UA0A 3FZLA 2RPIA 1OH6A 1GLBG 1NGHA 3K59A 4Z4HA 4KHNA 4DR6K 1B92A 3AVNA 3KLHA 3VEZA 3AGKA 4MDBA 1LWCA 4O8KA 3O9UA 3HL8A 3LDPA 4FVMA 3ULDA 4FWNA 1ZBUA 1DT9A 2BUPA 2YCHA 3UKUA 5TKYA 2P9IA 3GG4A 5C15A 4CHQA 1RTIA 3P38A 4E19A 1DKGD 1W2BM 4FCYA 1Z6RA 4BR4A 1M90O 1VQ7N 2X6SA 4FJ8A 3ZT3A 2O8DA 1S22A 4H4MA 3U6FA 4X62K 3T1AA 3VF2A 3HPOA 3C0BA 2D0BA 1ZYQA 3VGKA 3HPHA 2OA8A 3K5NA 1K73O 4CFDA 4IG0A 3E66A 3L2VA 4Z4CA 4DV6K 1BCOA 3HOTA 1ASUA 1K8KB 3VF4A 1EXQA 3JS6A 4BC2A 1RBSA 1TUUA 3DMJA 2ZF5O 1XNQK 4Z0UA 4CECA 1BG3A 5GAHP 4ZHRA 1JLBA 1RDAA 2X74A 3TABA 2QI2A 5AZJB 3WEEB 4ZTJA 1VSJA 3DWLA 5AQKA 4JI8K 1NK9A 1IKVA 3O5BA 1Q81O 2EX3A 3KWGA 2O8EA 2Y1JA 3VGMA 3KWIA 3KKRA 1QS4A 3LM2A 5LY3A 1JL1A 3DLGA 4U7BA 5GAEP 3I33A 1SKSA 3V9SA 3QIOA 4IFEA 1NJXA 4CZGA 2V7ZA 2DY4A 4H0OA 4JKGB 1W9HA 1VSKA 4X65K 4IEEA 4IEIA 3ZSWA 2D0AA 4M3RA 3A2FA 1MDUB 1RBTA 5DMRA 1NG9A 1NOZA 4L3QA 1SL0A 1EO1A 4KRFA 3L4IA 2OTLN 2Q1NA 3V1QA 3H6EA 1J53A 3MX2A 2E4LA 4MDAA 3ZSRA 2ATQA 4IOCL 3ZSYA 5CE3A 3CFRA 1SS6A 2WOMA 3ASMA 4JD2A 4K0KK 5K14A 1C0GA 2IC3A 1HNWK 4FJIA 3MWTA 4YNQA 3RSEB 2HVHA 4ID5A 3DYAA 3MMVA 3D2FB 4AHRA 1YUWA 3TU5A 2UUBK 2VG6A 5GIPA 1GOAA 1K6YA 3OJSA 4DTNA 4IXCA 4B9UA 1QVFM 4DTPA 3H45C 4BREA 1L3SA 1QZ6A 3SK3A 1RCHA 3V1OA 1VQ6N 4H0PA 3O9TA 3HJFA 3LPUA 4EAHD 4B08A 1JLCA 3E01A 3K9KA 4RW9A 3IDHA 1K9MO 4KAZA 1K8KA 4KH6A 4KHUA 4LF6K 4JK8A 5HLFA 3FZFA 3MCAB 3HP6A 3MK6A 5AQTA 1WSEA 3BZKA 1WSJA 4OJRA 3QETA 5KGWA 4G9ZA 5AZJA 3WEEA 4C8MA 5CHIA 1RT4A 3AVBA 1IKYA 4ELUA 3P4IA 2RHKA 4CBUA 4AHCA 4CZFA 2NRHA 3L4QA 5FRMA 1SQKA 1IO2A 4H0XB 4FLYA 4GW6A 4BRHA 1A5WA 3PIOL 1JCFA 1C1AA 3I8BA 4ILJA 4ELVA 2VQEK 3NGIA 4CJUA 4PWDA 3I56N 4W5NA 2FSJA 5AQSA 4WCEL 2FC0A 1TKDA 4FPAA 4LFBK 4NYNA 1RDBA 1GLJO 1WBDA 1NWKA 3ZSOA 4Y1CA 3QEIA 5M1NA 4RW7A 4BR7A 2HOEA 5C10A 3RRGA 3NFAA 4EZ9A 4QOZB 4J2BA 3OVNA 1GLDG 2DTUA 4JI6K 3WNHA 3H3NO 3O6WA 2Q3SA 4ISGA 3NCIA 3ZSZA 1S1UA 5I9EB 2E2NA 4W5TA 3CJAA 3CXCM 4O5BA 4HCBA 4DUZK 2VG5A 1NK8A 4NCGA 4KKOA 3HVTA 3HXMA 3I55N 3VETA 3SJJA 3THVA 3PX6A 4H0TB 1XUPO 2EWSA 3RSEA 4DQIA 3HI0A 4JI4K 5F1XA 2F8TA 2UU9K 1MA9B 3D2FA 3NHGA 3VOVA 3S41A 4LFCK 2NRVA 4CJEA 3O8MA 5DM7L 5AFUH 4R5PA 2FBXA 1LW0A 1HJOA 4JI1K 5AQRA 1HPMA 4H8KA 3SAHA 5JICA 2V51B 4I9LA 4DHYA 3T1HK 1HKCA 4JRQA 1VQKN 1TAQA 2Q0UA 4IJNA 4JKHA 4NB4A 3ITHA 3O4WA 4CJ7A 4IDKA 2XO7A 2QEXN 4FWQA 4DQPA 1Y64A 3IUCA 4YY3K 3S3MA 2QTDA 2QKKA 3PY8A 4CJQA 4Y0WA 5M1QA 4JKEA 1QZ5A 4YOXA 4YOVA 3VERA 3OW2M 3MN9A 4EZ6A 4PY5A 4CI6A 2NLXA 1XHXA 4RW8A 4FLWA 4B3MK 5FRNA 4A57A 1ILYA 5C12A 4C8NA 4CGIA 3KLEA 4FVUA 3CF5L 3QBXA 3SMSA 4LF5K 3PV8A 3HM8A 1WSFA 3KD5E 2ZGYA 1S3XA 2RE2A 4M3UA 5E84A 4H5RA 3AGRA 3CJ1A 4K41A 4DV3K 3THWB 1DGKN 2O8BB 4FLTA 4IDHA 5AQJA 4ISEA 1RTHA 2ZQBA 4A59A 3F9KA 4JNEA 3IKMA 3G10A 1ZBFA 3OYGA 4Z4IA 4DR3K 3C65A 3T1YK 4DSLA 3TSQA 4O5FA 1NKEA 5ADXH 4DR2K 3W3DA 1HR0K 1A5VA 4CZIA 3LP3A 4GKKK 3TTCA 2KZZA 3MCPA 2GTDA 1OH7A 2OYQA 2VWBA 4CIFA 4CJRA 4W5QA 1QQCA 1JXBA 1HPZA 2YV0X 3ZETB 4GNIA 4BQZA 4L8RB 1JKHA 4A5BA 4YOTA 3OBYA 1VQ4N 3MWPA 2PZSA 2X6NA 3C6UA 4KO0A 4WFBL 4E89A 4WF9L 5BR8K 1GOCA 3V1RA 1JL2A 1J9AA 2F7TA 4AHVA 2FSNA 4BRCA 2DFFA 1BHLA 3VTHA 3CM6A 3ZT0A 3OYNA 5IWAK 4M42A 1HX1A 1YHQN 5BPMA 3SNNA 1NOYA 2B5JA 4OPHA 4DSIA 5FPDA 5KPRA 2IDOA 3R6MA 1NM1A 3T7ZA 4DB3A 2KZMA 1EQYA 2F4VK 4M7XA 1IKXA 5M1KA 4DV4K 1F21A 2G8IA 1NMNA 3G4SN 3KJVA 4I9QA 4CJSA 4DTJA 4FJ5A 1UWBA 1HQUA 5JLHA 1EWRA 5T7BA 2YKMA 3AVCA 5J2QA 1G99A 4CF8A 1Y97A 4DLEA 1LAVA 1JLFA 2G8UA 5J2NA 4M3WA 4YOYA 4A2AA 3KLFA 4DQQA 4BR0A 4O55A 1FKOA 4K43A 4B9VA 1UAXA 1LAWA 2ZJQL 4WQ4C 1TGOA 3VTIA 1KLNA 4BRAA 4M3XA 4F3TA 1RT6A 4QAGA 3LDSA 2WBNA 5CYQA 4BY9C 1T6CA 3ZT4A 4WFNL 1NGEA 1NK5A 3M8SA 4JI7K 1RILA 3EE9A 2QM1A 4FLUA 4N5SA 3KK7A 3SQ0A 3LPTA 1V4SA 3CI5A 3G0ZA 3THYB 4MLEA 2O8BA 4GV6A 2E6LA 3HRGA 5AQHA 3GDQA 3LANA 4E1JA 3NH1A 3VQ8A 1J6ZA 4HTUA 2O8FB 5FLXO 5HL7L 1KFDA 3GBTA 2PYLA 1R59O 1L3TA 3K2PA 4CJKA 1U45A 1NJYA 2XHBA 4BDPA 3NVMA 1S9EA 4CEAA 1SV5A 4CGGA 3VEYA 1VRTA 3O4QA 4U67L 4PHTX 3A5NC 3ZETA 2GELA 4DTOA 1JLGA 5B8HA 4PKGA 4DWIA 1GOBA 1ATNA 4FJXA 2HNDA 4LF4K 2WFBA 3NF7A 3MEGA 1T3VA 1SKRA 2DFHA 3VA0A 1HYSA 1KTQA 2GUPA 3LAMA 3U9DA 3LALA 3AAPA 5HRPA 3G25A 5BN9A 3M8QA 3EN9A 2HF3A 4FWSA 2FLOA 2HNYA 3LAKA 4CJLA 1YJ9N 2P51A 5C25A 2QKBA 3QMLA 1VSDA 2FBTA 4FXDA 3EEQA 3SI6A 4OPKA 2YHAA 1YXQA 4Z4FA 4DSEA 2UXCK 4B1UB 4BRFA 1D4XA 1IG9A 4Q5VA 2P9NB 3AVGA 5A2QO 4FM1A 4MFBA 2VG7A 3AVMA 5KI6A 1KD1O 4MLHA 4QS7A 1S72N 1BCMA 5C2DA 1MU2A 4DSFA 4J2DA 2ETJA 4B9MA 4LH5A 3DRRA 4W5RA 3E1YA 2HB5A 3BF1A 2G8KA 4NCBA 2HHWA 4FK2A 4OO1J 4BWJA 3E9PA 2H3GX 3K5MA 1TUYA 1NJZA 4AILC 1J5EK 2W41A 1OKJA 3DM2A 4CHNA 1EWQA 4ICLA 4FWLA 1X9MA 3QEXA 2VYPA 4KTWA 4DV2K 2E1YA 4YORA 3OYHA 1S1TA 3AA3A 3HVRA 1BUPA 4OGEA 4BRMA 2YKNA 5AZIB 3PSFA 3VF6A 2PAVA 4FK0A 3D45A 5HRNA 4DF8A 4BQLA 1KXPA 5EY4A 1VSIA 3FFKB 1NLVA 3THYA 4ISFA 3OY9A 2ITMA 1C1CA 1FK9A 4KV8A 1Q82O 5AQGA 4QS8A 4WQ5A 1SL1A 2O8FA 2Q31A 4CE9A 3LP2A 3M1FA 5CY4A 3A5LC 5AR0A 3RWUA 3TSPA 3OS2A 3U3YA 3HYFA 4B1YB 4FWOA 3JSMA 1TV6A 2QW9A 1T6DA 4ILHA 4CEEA 3MDQA 4YDUA 4FJ9A 1J54A 2A41A 3I0SA 3CJCA 4IBNA 3SQ2A 5KRSA 1N36K 2KQ2A 1W7AA 1NGGA 1RBUA 4GY2B 2BGGA 1RGIA 3L3VA 1HMVA 5F0XA 4JAXA 3ZLJA 5LJWA 3MAQA 4CK3A 3ZX3A 2YX6A 2E20A 4DSJA 1VSEA 3NH0A 2RF2A 2HBKA 4CK1A 1HKBA 3CERA 4KHPK 4B9LA 4DQSA 2P5OA 1S1XA 3U4LA 3NBPA 3L8BA 1U47A 1A5XA 3WNGA 3ZT1A 3LWMA 3SUOA 4I6MB 3CCSN 4E7KA 2Q36A 1TYQB 2P9NA 4JV5K 4KFBA 3TAQA 5BRDA 1CXUA 1Q8IA 1N32K 4AF1A 3OYJA 5AQLA 3MN5A 3EZWA 3O80A 3VQBA 4CERA 2D4WA 4B3TK 3SUQA 3NF8A 4DKWA 2Z1JA 4DS4A 1YI2N 2VQFK 2RKIA 4B9NA 4B9QA 1QHAA 1L3VA 2QWQA 3F73A 4WE1A 3MXJA 4DQRA 4MO4A 1ZC6A 4F8RA 1EETA 3QESA 2YNHA 4NLBA 1NU0A 3C95A 3QBWA 3AO2A 4B3OA 3N4QA 4KHQA 2VWKA 4DFJA 4CD1A 4BE0A 5AJ3K 2WONA 1O13A 4KHWA 2G8WA 1FKPA 5AZIA 4BC3A 3NAEA 5AFUA 3PO5A 4BC5A 1VK0A 1X3NA 4CHPA 4XH5A 2B6AA 1RT3A 3D0PA 3UIQA 3G6EN 1VSLA 3ULEB 1HYVA 1QSLA 3WXMB 3S3NA 3C94A 4BRIA 5I3UA 4JEPA 4GVEA 3O9RA 1RDDA 3DLRA 4FJ7A 1L5UA 1I3AA 2V7YA 2ASOA 1BA1A 4FSVA 4CHYA 4FZXC 2ZGZA 3GOIA 3U8XA 2HHTA 3HT3A 1SUQA 2W40A 5I42A 3UB5A 3PX0A 1D9DA 4DV5K 3BGRA 1ESVA 2E5LK 1NK4A 4Y1DA 3ALYA 2JLEA 4JK7A 4HUEA 2KKZA 1QTMA 2BE2A 3CFOA 2Y1IA 3CCJN 1FXXA 1CXQA 5LJVA 3CCEN 5GINA 4MO5A 1T44A 5JVGL 3HZ6A 4JKFA 3CHWA 3IRXA 5CR4A 1YVNA 1KAZA 3H1QA 4A2BA 4DR5K 4KB0A 1C0MA 4CJ4A 2NRWA 3CIPA 3SQ4A 4AH9A 3BDPA 3AVHA 2BANA 3PO4A 3H1VX 4B1WB 4B3SK 4LF7K 3IFRA 3ZX2A 3UKRB 4OVLA 1VRUA 3CJ9A 2I7NA 4I6MA 3BEXA 3PIPL 4MQ3A 4HTLA 4V19S 1TYQA 1S5JA 1TKZA 3J7AP 4B1VA 4CJVA 5JVHL 4KTQA 3CJ7A 4ZTFA 3H08A 1O1WA 1T03A 1SAZA 4LSNA 3KHYA 1J5OA 4Z4GA 3NVKA 4PL8A 4CJ3A 4LFAK 5AQFA 1YJNN 2NRZA 1S6PA 3ATUA 3KZBA 5AQYA 2LSNA 4DU4A 5C0YA 2FBVA 3EL2A 3DAWA 4UQGA 3FGUA 1NK0A 4WYBA 3FFIA 4CGFA 3I0RA 3IAYA 2IVOA 1NGJA 1CZBA 4CF1A 4IKFA 1JXEA 2GBZA 3OJUA 4AQYK 3QEPA 5HOOA 2CGLA 1OVQA 5SZTA 1ZXOA 3VQEA 1K8AO 1TK8A 3V9ZA 3ULEA 1HRHA 1WSHA 3NH2A 5CYMA 4KI4A 1C0UA 3OYCA 1NJIO 3K58A 2G8VA 1ZBSA 3KK2A 4M45A 5M1FA 4FOEA 1JJ2M 2HHSA 5JLFA 2QA4N 4CIGA 3O08A 3B8AX 2A42A 3ATVA 3RRHA 4K8XA 3BF3A 1FW6A 3OYIA 5FPMA 3CQYA 1EP4A 4RCHA 1RT7A 4EHTA 1NGIA 1HJRA 4LC9B 3VESA 3AO3A 3F9MA 3P31A 4CW7B 1RBRA 1VQLN 1QQNA 5BREA 2ZM6K 3VQ9A 4JKAA 3DLBA 3O9SA 3A0IX 1REVA 3MN7A 2CH5A 3QO9A 2P9SB 1KLMA 3K9JA 5AQXA 1Q9XA 4KH5A 4DLGA 3SUNA 3JAMO 1BWFO 4M41A 1U04A 4EP4A 1WAFA 4YHHK 4I7FA 1ATSA 1WAJA 2ZWHA 3O3FA 3QINA 4C8KA 1NGCA 5CZ2A 5LMUK 4CZEA 1NBWA 3UKRA 3SV3A 1BIUA 4H0YB 1GLAG 4F4KA 4BWMA 1YTUA 3TAMA 2E2PA 4O0IA 4IFYA 2E1ZA 5KQ8A 1QE1A 3IMXA 3TPQA 1X1PA 2YJFA 4FLVA 3QEVA 5BPNA 1YJWN 1V4TA 3RMCA 3J81O 2G8HA 3P5JA 4J8FA 4XH4A 3EKUA 1YAGA 1IG8A 3QEWA 4B9TA 4FWRA 2ZJPL 1DEJA 2E2OA 1XWLA 4FW2A 3AO4A 3DXKB 3H46O 5HP1A 2Q2RA 3ID6A 4CFAA 2NRRA 1D5AA 4BACA 3HSTB 4E7JA 1LOTB 2WTUA 1EKEA 3L0QA 1U48A 3DI6A 3TTFA 3QIPA 3JYTA 1XC9A 3C6AA 3CPEA 2UUCK 2QWPA 3VA3A 4B9SA 3ZCMA 2DPNA 1TL1A 1RT5A 1C0FA 4NLCA 1Z25A 3SPZA 3D6RA 1NK6A 3DLHA 1JLAA 4OGCA 2KFZA 2XRIA 2PY5A 1QQMA 4OKKA 3LP1A 1X9JA 4FLXA 3VQAA 4FZYA 2YNIA 2IVPA 2UYTA 5J2PA 3M6GA 1OVYA 1D9FA 5AQZA 3AVLA 4DV0K 4CEOA 3CYMA 1JCGA 3KKSA 1BIZA 5AQUA 4ELTA 3T19A 2QXLA 3AA2A 3W0LA 3OS1A 1IV0A 3D7EO 1TK0A 1E4FT 1U49A 3OS0A 4H4OA 1RBVA 1N5YA 2NUBA 2D0CA 3O4NA 2D0OA 2P9SA 4J2AA 3AVJA 4EHUA 4PL7A 1HLUA 1UOCA 3NF6A 3RR7A 4OLAA 2WC9A 4F3OA 3VQ4A 4NCAA 3VEXA 3BZCA 1IBMK 4NXNK 3IG1A 4CIEA 1IBLK 3OYAA 1VQNN 3UE5A 4BDZA 1WNSA 3AVKA 4J2EA 1TL3A 3WXKA 1ZBIA 4E1NA 3VQ5A 4FJLA 3EO3A 2GV9A 4O4GA 4QS9A 4WQ4A 3VQ6A 1XMOK 4BRQA 4QCLA 3WXLA 3OTOK 1WUAA 4I2QA 3OYMA 4DG1A 4DFPA 3HOSA 2VGMA 2E2QA 3DXKA 4HHTA 2HVIA 4BR2A 3DLEA 3Q7CA 2UXBK 4IO9L 2P1JA 4DTXA 4DTUA 1UA1A 3OBWA 1CZ9A 4DUYK 3LDLA 2F96A 3MECA 2A6AA 4Q0BA 1W0HA 4H5NA 4CFBA 4CBXA 4E3SA 4N76A 5M1PA 1D8YA 1HNXK 2BDPA 2ZD1A 3CCVN 2D1KA 1E4GT 3SV4A 2OZSA 3R8EA 3SLCA 4CF0A 1B9FA 3VEVA 3OA9A 4HUGA 3RMBA 1OH8A 5FPNA 3U3GA 4X64K 1LW2A 4OKEA 1RFQA 4HWIA 5BRFA 1TVRA 4BRPA 4FJHA 3FZKA 4BGBA 4PKIA 4CESA 4KREA 1KCFA 1TAUA 4DTRA 4FJKA 4ILGB 4CGHA 1XHZA 2AP1A 3KVGA 3NGYA 3N4PA 1ASWA 3C7NB 1GLEG 3L6QA 3EY1A 4GMJB 2WUSA 2GWJA 4TSXA 3VQ7A 3JXUA 3QB0A 4CVNE 3K5LA 2GUIA 3P1GA 5GAGP 1LV5A 2PYJA 2FSKA 3M8RA 3ZX0A 5E41A 4JS4A 1U2VB 3TANA 4KHYA 4HVJA 3KLIA 3LDQA 1BGXT 1RT1A 3LDOA 4UY8O 1X9WA 4CJTA 4GKJK 3ENOA 4BGAA 1H1VA 5M1OA 3CMAN 3DJCA 4FWKA 3A8YA 5FDLA 3ZSVA 1P8ZA 1IKWA 1BQMA 5KGXA 3NGZA 2EHGA 2W6LA 5AQQA 4GV3A 1TKTA 1WOQA 4A61A 3ZEUB 2A1SA 3FR0A 3CCQN 1NKBA 1S6QA 3SAGA 3HK2A 4G1QA 4B1ZA 1U4BA 3V9UA 4OX9K 2VGNA 4YFUA 1KRPA 3VQPA 1Q7YO 1QVGM 4Z94A 4KH4A 4CJPA 4JS5A 3PUFA 1M1KO 4KHSA 2V52B 3MN6A 4AHUA 4DF4A 1NJWA 3FLCO 4O8UA 1YIJN 3CMEN 4JLHA 2IAJA 1KVBA 4DTMA 3ZYYX 1VAZA 1Q18A 3SUPA 3AY9A 1KVAA 3A5OC 2YHXA 5LMNK 3SQ1A 2Z1HA 3OYBA 3L2RA 1QSSA 2YNFA 4CK2A 2Z1IA 1SL2A 3WT0A 4C1NI 4CZLA 3LZJA 2HMIA 5ELZA 3HO1A 4IZ9A 2UUAK 4N56A 1HNZK 1XQSC 4RG8A 3J7ZO 4CEQA 1XMQK 3NMUA 5JMVA 1LWFA 4CJWA 4FO0A 3DLLL 4JHDB 2CH6A 4HCCA 4IFVA 4CF9A 2FBYA 4CFCA 3M3ZA 2AA4A 4NO7A 5BRHA 2HF4A 4AHSA 1Z05A 2I5JA 3NF9A 4DR1K 2O4GA 3VEWA 1WSIA 5BPLA 4FJGA 1G15A 1LWEA 3LZIA 4C8OA 3V81A 1RDCA 2HHHK 4E7LA 3CCUN 3NE6A 1Q86O 1NGFA 3KIOA 4JI2K 3C7NA 4BRDA 3EZ5A 2CGJA 1IBKK 1BQNA 3QLHA 1XNRK 5C2FA 5KPZA 2KFNA 2DFEA 3SZ2A 2F9TA 1KFSA 3THXB 1BDGA 3KTQA 4KTZA 4K25A 4DS5A 4IWVA 3CFPA 4IJAA 1U2VA 1QSYA 4C8LA 4DV7K 1YF5L 4M3YA 1RNHA 5J2MA 1VQ8N 3E9LA 3CJBA 3QFPA 1C6VA 1MWMA 4H5VA 5KRTA 2Z1GA 1BISA 2QXFA 4FLZA 1DTTA 4NXMK 3HM9A 4O0JA 1GLFO 2ASMA 3ZEUA 3RR8A 4FW1A 3VQCA 2AJQA 2BTFA 3CC4N 1QHTA 4LSLA 2XY5A 4BDYA 2CGKA 1HKGA 3K57A 3CC2N 4JKBA 3AVAA 4RTFD 4FOIA 4A5AA 4BE1A 1JCEA 3QNNA 2OTJN 2HSTA 3AARA 1C1BA 4LF9K 5JS1A 3WXIA 5AQWA 1RTJA 4AM7A 1VSHA 3OYFA 3MX5A 2HBMA 4CEFA 4K42A 4DQ8A 4E7HA 2JWKA 2OPRA 4WFAL 1WSGA 1N8RO 2NZTA 3BUZB 1BO5O 4IO8A 4DU3A 3EYZA 4JKDA 2OPQA 1BA0A 3O9QA 2HMPA 4M63C 1RT2A 3WUHA 1BOTO 3K0SA 1BU6O 1Z26A 4CJ5A 1XC3A 4K8ZA 5AQOA 3ISNC 3V9WA 3D2EB 4FJJA 3J80O 5ADXA 2KHOA 3SJHA 3F2KA 3KK3A 3V6DA 2A3ZA 3AA4A 1S1VA 2A40A 2IGIA 1L3UA 1CLQA 3LDNA 4JHDA 2P9KB 3B6OA 3QDKA 1Q9YA 3QERA 2GEMA 4JK9A 3O3GA 5TKWA 3CPWM 3LWLA 4JKGA 3SAFA 3AVFA 3HP9A 5DK5A 3VPZA 3AO5A 2IIRA 4BRGA 1ZBLA 3TARA 2A1RA 4JN4A 1N6QA 3TSUA 3K5OA 1SZ2A 1BL3A 4H5TA 4F9OA 1HNVA 4CZHA 1ZBHA 1EX4A 2KW4A 2HHVA 2F8SA 1C0TA 1X9SA 5D3GA 1ITGA 1FJGK 4DFMA 2OZMA 4Z4EA 2GX9A 5GADP 2E8AA 1I94K 3HTVA 1T05A 3THXA 1WLJA 3L2WA 2BH1A 1RTDA 3CCMN 2GWKA 4FYDA 2G8FA 3GL1A 5EXWA 2IOCA 1IJJA 1X3MA 3ZSXA 2P9PB 1WBBA 2XY7A 2PBDA 3HSCA 4YOUA 2P5GA 3FZHA 3O1WA 3RMAA 3RVCA 3L2UA 5AQNA 4X66K 3C6HA 4OKJA 1HYZA 4YOWA 1YT3A 4BR5A 3CQXA 4IOXA 4N47A 3TWHA 2D5RA 5LL6Z 5FROA 4FM0A 4PKHA 1KAYA 1MWKA 1VQPN 4PA1A 1VHXA 4BG8A 4FL9A 3O1BA 1WB9A 4CCHA 4FJMA 3VQDA 3AV9A 2B4JA 2NRTA 3M5RA 1WN7A 3TTDA 1N34K 2HBLA 3GE1A 3WQUA 1OH5A 4PQUA 3SBGA 1JLEA 4C1NK 4RW4A 3ENBA 4DU1A 4JI3K 3C6TA 1JLQA 3Q7BA 3OYDA 4E1MA 3TR8A 4PUOA 3PLAA 3QNOA 1NGBA 5EVZA 4H0VB 4LH4A 1KQSM 3V9XA 3NDKA 1IH7A 2NNWA 2OPPA 3EKSA 3PSIA 4DMNA 3D2EA 4OPAA 4CGJA 4BC4A 3O3HA 1VQ5N 4R79A 4BRLA 3VN5A 3TAEA 1BI4B 4A62A 3ENHA 3KD1E 4E7IA 5KQDA 4F2RA 3WXJA 1S9GA 1S1WA 5EU7A 2KLAA 4BG9A 3EE8A 3CM5A 4CF2A 1HUXA 2OPSA 2P9KA 2FXUA 4FWMA 1I39A 4CHZA 3CCRN 3TI0A 4CGDA 4IOAL 3ZSQA 3DXMB 1T8EA 3U9ZA 2KTQA 2Q0RA 5EX5A 3H3OB 4DR4K 5AQIA 4JI5K 4JYAK 2QK9A 3IS9A 4DV1K 4M7YA 4DFKA 2O4IA 1VQ9N 4BVPA 1YITN 2JGUA 2ASPA 1VSFA 2IVNA 4FJNA 3VMFB 2D0PA 3MXMA 4XH1A 3E9OA 3J8AA 1KVCA 4XIUA 2YNGA 4AM6A 3OYKA 1ASVA 3TAFA 3DOKA 4BVOA 1B9DA 1TKXA 3T69A 4CEZA 3CQ8A 4BR9A 5H1SQ 5HROA 5IT9O 1VQON 2P9PA 2HHUA 3LM9A 4CEBA 3DOLA 4HUFA 3SMPA 2YJEA 4CZMA 2P9UB 3QICA 3OYEA 2P9LB 3HPGA 2HHQA 1XI1A 3CETA 3VEOA 4ID1A 3J7YP 3LP0A 5J1EA 2XY6A 1DTQA 5C24A 2QWNA 4CBWA 1NNEA 4LY7A 4CHOA 3KK1A 4H03B 3SCXA 2W6KA 4BRNA 4GVMA 2O8CB 4GV9A 1VQMN 1KSPA 2XY8A 5KTQA 1N33K 3CG7A 3AO1A 3R1XA 4O44A 5KPTA 3SYZA 2VWJA 3BY5A 3RTVA 1P90A 5HRRA 3I8DA 1ATRA 2OANA 2RN2A 2ZE2A 2NRXA 4LF8K 3FZMA 4XEIA 2F9WA 4W5OA 3V4IA 1E3MA 2YHBA 4H5WA 4CD3A 2HW3A 5C42A 3R3LA 4B3RK 3KLGA 3SPYA 3OHRA 3ZT2A 5AQMA 3S9HA 4LD0A 1DLOA 2YHWA 2QWOA 3G71N 3UKUB 2UXDK 2P9IB 4B8CA 4BE2A 5AQVA 1BI4A 5HRSA 2HNZA 1NK7A 4JRPA 1QQOA 4DR7K 2W42A 1SKWA 3T3FA 3THWA 3R9PA 2O8DB 1NGAA 2R7YA 4B8AB 2X78A 1KC8O 4RWTA 3RMDA 4I2PA 4KI6A 2ZJRL 4FK4A 3DXMA 3FE1A 3WNEA 1CZAN 2A5XA 4RW6A 3MXIA 4EFHA 3VENA 4IG3A 3F5TA 1VSMA 4KPYA 4BRKA 1T7PA 3B6PA 3P39A 3VQQA 1RDUA 3HBTA 2QWRA 3S3OA 2HHXA 4DCHA 1GLCG 4B1XB 4JI0K 3SBTA 4OPJA 3AA5X 5E26A 4FPBA 3L2QA 4N41A 1R0AA 2VCPA 5JS2A 1RDWX
chains in the Genus database with same CATH topology
1KAXA 3WT0A 4C1NI 4CZLA 2FF6A 2J4RA 3BEXA 4I6MA 4GNIA 3ZETB 4BQZA 3PIPL 4HTLA 5ELZA 5AQPA 4IZ9A 4A5BA 4YOTA 3OBYA 1VQ4N 3CD6N 1TYQA 3MWPA 1XQSC 5EOYA 3J7ZO 4WFBL 2E88A 2I7PA 2QWLA 4WF9L 1NGDA 3NMUA 2QWMA 4B1VA 5FPEA 5JVHL 5JMVA 4FO0A 3DLLL 3CJ7A 4JHDB 2CH6A 5MLCQ 2F7TA 3M3ZA 1SAZA 3KHYA 2AA4A 4NO7A 5BRHA 3ID8A 2FSNA 3NVKA 3CCLN 2HF4A 2PFUA 5F2RA 1Z05A 3A5MC 4PL8A 5BN8A 3VEWA 4BRCA 3QFUA 5AQFA 1YJNN 3VGLA 2NRZA 3KZBA 3ATUA 3LL3A 5AQYA 5BPLA 5C0YA 1W97L 3VTHA 2P9UA 2P9LA 3EL2A 3DAWA 4BROA 1HX1A 4KBOA 1YHQN 3FGUA 5BPMA 3CCUN 1Q86O 4EIAA 4OPHA 4WYBA 5FPDA 5KPRA 3AAQA 3R6MA 1NM1A 3CC7N 1NGFA 3T7ZA 4DB3A 1EQYA 2IVOA 4M7XA 3C7NA 4FWPA 4BRDA 2CGJA 1NGJA 5M1KA 5C2FA 2YHYA 4WQ5C 5KPZA 2Q97A 4CZKA 5HOOA 3G4SN 2CGLA 4C23A 2F9TA 1GLLO 1BDGA 3BP8A 2FF3B 5GIOA 1ZXOA 3WQTA 2HBJA 4JKCA 5JLHA 1K8AO 4K25A 4IWVA 5BR9A 1LCUA 4IJAA 1U2VA 1G99A 3ULEA 1YF5L 5DM6L 2JWLA 4YOYA 4JD2B 4A2AA 1VQ8N 1NJIO 3E9LA 4YDUC 1NMDA 1U6ZA 1ZBSA 3CJBA 3QFPA 4BR0A 4CZJA 2YI1A 5M1FA 1MWMA 4FOEA 3FZLA 4H5VA 1JJ2M 1GLBG 1NGHA 5JLFA 2QA4N 3O08A 4K43A 3B8AX 2A42A 2ZJQL 3ATVA 4WQ4C 3AGKA 3BF3A 4MDBA 3VEZA 1GLFO 2ASMA 3VTIA 4O8KA 3O9UA 3LDPA 3ZEUA 4BRAA 4CD3A 5FPMA 4FWNA 3CQYA 2BTFA 3CC4N 1DT9A 4RCHA 2BUPA 2YCHA 5TKYA 3UKUA 2P9IA 3GG4A 5C15A 4EHTA 3P38A 1NGIA 4LC9B 3VESA 2WBNA 3F9MA 3P31A 4BY9C 1T6CA 1DKGD 2CGKA 1HKGA 4CZMA 4WFNL 1NGEA 1W2BM 1Z6RA 4BR4A 1M90O 1VQ7N 1QQNA 1VQLN 3CC2N 4JKBA 4RTFD 5BREA 4FOIA 4A5AA 1JCEA 1S22A 2QM1A 3EE9A 4JKAA 3KK7A 2OTJN 2HSTA 3VF2A 3AARA 1V4SA 3C0BA 3CI5A 3O9SA 3WXIA 3A0IX 4MLEA 5AQWA 3MN7A 3HRGA 4AM7A 4GV6A 2CH5A 3GDQA 5AQHA 3VGKA 4E1JA 2P9SB 3MX5A 1J6ZA 2HBMA 1K73O 4K42A 4DQ8A 2JWKA 3E66A 3K9JA 4WFAL 5AQXA 1N8RO 4KH5A 2NZTA 3BUZB 1BO5O 4IO8A 5HL7L 1BWFO 1K8KB 3GBTA 3VF4A 3HOTA 4JKDA 1R59O 3JS6A 4BC2A 1BA0A 3O9QA 1TUUA 2HMPA 4M63C 2ZF5O 1ATSA 1BG3A 2ZWHA 3NVMA 5GAHP 3WUHA 1NGCA 1BOTO 1BU6O 4CZEA 2QI2A 1NBWA 5AZJB 3UKRA 1XC3A 4H0YB 3VEYA 3WEEB 4U67L 1GLAG 4PHTX 5AQOA 3D2EB 3A5NC 3ZETA 3DWLA 5AQKA 2GELA 5ADXA 2KHOA 2E2PA 3SJHA 4PKGA 5B8HA 3F2KA 3O5BA 2A3ZA 1ATNA 1Q81O 2E1ZA 3CCEN 3KWGA 2A40A 5KQ8A 2WFBA 3VGMA 3IMXA 3KWIA 3TPQA 3LDNA 2YJFA 1T3VA 4JHDA 5BPNA 2GUPA 3U9DA 1YJWN 2P9KB 3QDKA 3LM2A 2GEMA 1V4TA 4JK9A 5LY3A 5TKWA 3AAPA 3CPWM 3G25A 4J8FA 5BN9A 4U7BA 5GAEP 3EN9A 3I33A 3EKUA 2HF3A 4JKGA 4XH4A 1YAGA 4FWSA 2FLOA 4IFEA 3SAFA 1YJ9N 4CZGA 1IG8A 2V7ZA 4FWRA 3QMLA 2ZJPL 4H0OA 1DEJA 3VPZA 2E2OA 4JKGB 4IEEA 2IIRA 4BRGA 3DXKB 3H46O 4JN4A 4IEIA 3TSUA 1YXQA 2Q2RA 3ID6A 1SZ2A 4H5TA 2NRRA 4F9OA 4CZHA 1LOTB 1MDUB 3L0QA 4B1UB 4BRFA 4L3QA 3TTFA 1D4XA 2GX9A 1EO1A 5GADP 3C6AA 2P9NB 2E8AA 3L4IA 3CPEA 3HTVA 2OTLN 2Q1NA 3H6EA 2QWPA 1KD1O 3MX2A 4MLHA 4QS7A 2BH1A 1S72N 2DPNA 3CCMN 2GWKA 5C2DA 4MDAA 3CJ9A 1C0FA 4NLCA 3D6RA 3GL1A 5EXWA 4IOCL 1IJJA 1QQMA 5CE3A 3E1YA 1SS6A 3BF1A 1X3MA 2P9PB 1X9JA 4JD2A 2PBDA 3HSCA 4YOUA 2IVPA 4OO1J 3E9PA 2H3GX 2UYTA 1C0GA 3FZHA 3O1WA 1TUYA 3RVCA 3M6GA 3MWTA 1OVYA 2W41A 3RSEB 5AQNA 5AQZA 1OKJA 3C6HA 3MMVA 3D2FB 4YOWA 4FWLA 4BR5A 1JCGA 3CQXA 1YUWA 4IOXA 3TU5A 5AQUA 5GIPA 2VYPA 2E1YA 4YORA 4PKHA 2QXLA 1KAYA 1MWKA 1VQPN 1BUPA 4BG8A 4BRMA 3W0LA 4FL9A 3O1BA 5AZIB 3VF6A 2PAVA 4IXCA 3D7EO 1QVFM 1E4FT 3H45C 3M5RA 2NRTA 4BREA 4BQLA 1QZ6A 3SK3A 1KXPA 5EY4A 3TTDA 1VQ6N 2HBLA 3GE1A 3WQUA 3FFKB 1NLVA 4H0PA 4ISFA 3O9TA 3SBGA 4EAHD 2ITMA 4C1NK 3K9KA 2D0OA 2P9SA 1Q82O 3ENBA 5AQGA 4QS8A 4WQ5A 3IDHA 2Q31A 4EHUA 4PL7A 3Q7BA 1K9MO 1HLUA 1K8KA 4KH6A 3M1FA 2WC9A 3A5LC 4JK8A 5AR0A 3PLAA 1NGBA 5EVZA 3FZFA 3MCAB 3VEXA 4H0VB 3TSPA 3MK6A 5AQTA 1KQSM 2NNWA 4G9ZA 3EKSA 5AZJA 1VQNN 4B1YB 4FWOA 3WEEA 2QW9A 3UE5A 5CHIA 3D2EA 1T6DA 4ILHA 4OPAA 4BC4A 3P4IA 3MDQA 4YDUA 2RHKA 1VQ5N 4R79A 4BRLA 4CBUA 3WXKA 4A62A 3ENHA 2A41A 4CZFA 2NRHA 3CJCA 3L4QA 5KQDA 3WXJA 1SQKA 4H0XB 2KLAA 4BG9A 4BRHA 1JCFA 3EE8A 1NGGA 3EO3A 3I8BA 4GY2B 4ILJA 3PIOL 4QS9A 4WQ4A 3I56N 1RGIA 1HUXA 2FSJA 5F0XA 2P9KA 2FXUA 4FWMA 5AQSA 3CCRN 4JAXA 4BRQA 4WCEL 4IOAL 5LJWA 3DXMB 3U9ZA 3WXLA 3ZX3A 2YX6A 1WUAA 2Q0RA 4FPAA 2E20A 5EX5A 2HBKA 3H3OB 3HOSA 1HKBA 2VGMA 2E2QA 3CERA 5AQIA 1GLJO 3DXKA 1NWKA 4M7YA 4BR2A 3U4LA 3Q7CA 1VQ9N 4IO9L 5M1NA 4BVPA 4BR7A 2HOEA 3OBWA 5C10A 1YITN 2ASPA 3LDLA 2A6AA 2IVNA 1GLDG 4H5NA 3VMFB 2D0PA 4CBXA 4I6MB 3CCSN 3H3NO 4XH1A 3E9OA 3J8AA 5M1PA 3O6WA 2Q36A 2P9NA 1TYQB 4ISGA 4AM6A 4BVOA 5BRDA 3CCVN 5I9EB 4AF1A 2D1KA 1E4GT 2E2NA 3CXCM 3CJAA 3MN5A 3EZWA 5AQLA 3T69A 3O80A 3R8EA 2D4WA 3SLCA 4BR9A 5H1SQ 3VEVA 3OA9A 1VQON 2P9PA 5FPNA 4DKWA 1YI2N 1RFQA 4HWIA 3I55N 3VETA 3LM9A 5BRFA 3SMPA 4BRPA 2YJEA 4B9QA 1QHAA 2P9UB 3FZKA 1XUPO 2P9LB 2QWQA 3QICA 4H0TB 4PKIA 4BGBA 2EWSA 3CETA 3RSEA 3VEOA 4MO4A 3HI0A 5F1XA 1ZC6A 1MA9B 4ILGB 2QWNA 3D2FA 3VOVA 2AP1A 3KVGA 4NLBA 4CBWA 3S41A 3N4PA 3QBWA 2NRVA 3C7NB 3O8MA 1GLEG 3L6QA 3N4QA 4H03B 2WUSA 2GWJA 4BRNA 5DM7L 5AFUH 4GV9A 1VQMN 4CD1A 1HJOA 3JXUA 3R1XA 3QB0A 5KPTA 1O13A 5AQRA 5AZIA 1HPMA 3SAHA 5GAGP 1P90A 4BC3A 5AFUA 1ATRA 2FSKA 2OANA 1X3NA 2V51B 3ZX0A 4BC5A 4XH5A 4DHYA 5JICA 3G6EN 1HKCA 1U2VB 2NRXA 1VQKN 3ULEB 2Q0UA 3WXMB 4IJNA 3LDQA 3FZMA 4JKHA 4BRIA 4NB4A 4XEIA 3O4WA 2F9WA 4JEPA 4GVEA 3LDOA 4CJ7A 3O9RA 2QEXN 4FWQA 4UY8O 2V7YA 2ASOA 1BA1A 1Y64A 3IUCA 4FSVA 2ZGZA 3GOIA 4H5WA 3ENOA 3U8XA 4BGAA 1H1VA 5M1OA 2QTDA 3CMAN 3DJCA 3R3LA 4FWKA 4Y0WA 5M1QA 3A8YA 3OHRA 4JKEA 1P8ZA 2W40A 1QZ5A 4YOXA 5AQMA 3UB5A 4YOVA 3VERA 5AQQA 3OW2M 3MN9A 4GV3A 1WOQA 2YHWA 4A61A 2NLXA 3ZEUB 4CI6A 2QWOA 1ESVA 3G71N 3UKUB 3FR0A 2P9IB 3CCQN 4A57A 4JK7A 3SAGA 5C12A 1ILYA 2KKZA 4FVUA 3CF5L 5AQVA 3QBXA 3SMSA 4B1ZA 3CCJN 1QQOA 3HM8A 2VGNA 5LJVA 3R9PA 1Q7YO 2ZGYA 1NGAA 5GINA 4MO5A 1S3XA 1QVGM 4Z94A 4KH4A 2RE2A 1T44A 5E84A 1KC8O 4H5RA 3AGRA 3CJ1A 4K41A 5JVGL 1M1KO 4RWTA 1DGKN 3HZ6A 2V52B 3MN6A 4JKFA 3CHWA 5CR4A 2ZJRL 4IDHA 1YVNA 5AQJA 3FLCO 4ISEA 3DXMA 4O8UA 1KAZA 3FE1A 3H1QA 4A2BA 4A59A 1YIJN 3CMEN 4JNEA 3IKMA 2NRWA 1CZAN 2A5XA 3CIPA 4EFHA 3C65A 3ZYYX 1VAZA 3TSQA 1Q18A 3AY9A 3VENA 4O5FA 3F5TA 5ADXH 3W3DA 4BRKA 3A5OC 3P39A 1RDUA 3HBTA 4CZIA 2YHXA 2QWRA 3TTCA 4DCHA 1GLCG 3H1VX 3MCPA 2GTDA 3SBTA 4B1XB 5E26A 4FPBA 2VWBA 4B1WB 3IFRA 2VCPA 3ZX2A 3UKRB 1RDWX 2I7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAX A;  3WT0 A;  4CZL A;  2FF6 A;  2J4R A;  3BEX A;  4I6M A;  4GNI A;  3ZET B;  4BQZ A;  4HTL A;  5ELZ A;  5AQP A;  4IZ9 A;  1TYQ A;  1XQS C;  5EOY A;  2E88 A;  2I7P A;  2QWL A;  1NGD A;  2QWM A;  4B1V A;  5FPE A;  5JMV A;  4FO0 A;  3CJ7 A;  4JHD B;  2CH6 A;  3M3Z A;  1SAZ A;  3KHY A;  2AA4 A;  4NO7 A;  5BRH A;  3ID8 A;  2FSN A;  2HF4 A;  5F2R A;  1Z05 A;  3A5M C;  4PL8 A;  5BN8 A;  3VEW A;  4BRC A;  3QFU A;  5AQF A;  3VGL A;  5AQY A;  3KZB A;  3ATU A;  3LL3 A;  5BPL A;  2P9U A;  2P9L A;  3EL2 A;  3DAW A;  4BRO A;  1HX1 A;  4KBO A;  3FGU A;  5BPM A;  4EIA A;  4WYB A;  5FPD A;  5KPR A;  3AAQ A;  3R6M A;  1NM1 A;  1NGF A;  4DB3 A;  1EQY A;  2IVO A;  4M7X A;  3C7N A;  4FWP A;  4BRD A;  2CGJ A;  1NGJ A;  2YHY A;  4WQ5 C;  5KPZ A;  2Q97 A;  4CZK A;  2CGL A;  4C23 A;  2F9T A;  1GLL O;  1BDG A;  3BP8 A;  2FF3 B;  1ZXO A;  3WQT A;  5JLH A;  4K25 A;  4IWV A;  5BR9 A;  1LCU A;  4IJA A;  1U2V A;  1G99 A;  3ULE A;  4JD2 B;  4A2A A;  4YDU C;  1NMD A;  1U6Z A;  1ZBS A;  3CJB A;  3QFP A;  4BR0 A;  4CZJ A;  2YI1 A;  1MWM A;  4FOE A;  3FZL A;  4H5V A;  1GLB G;  1NGH A;  5JLF A;  3O08 A;  4K43 A;  3B8A X;  2A42 A;  3ATV A;  4WQ4 C;  3BF3 A;  3VEZ A;  1GLF O;  2ASM A;  4O8K A;  3LDP A;  3ZEU A;  4BRA A;  4CD3 A;  5FPM A;  4FWN A;  3CQY A;  2BTF A;  4RCH A;  2BUP A;  2YCH A;  5TKY A;  3UKU A;  2P9I A;  3GG4 A;  4EHT A;  1NGI A;  4LC9 B;  3VES A;  3F9M A;  1T6C A;  1DKG D;  2CGK A;  1HKG A;  4CZM A;  1NGE A;  1Z6R A;  4BR4 A;  1QQN A;  4RTF D;  5BRE A;  4FOI A;  1JCE A;  1S22 A;  2QM1 A;  3VF2 A;  3AAR A;  1V4S A;  3C0B A;  3CI5 A;  3WXI A;  3A0I X;  4MLE A;  5AQW A;  3MN7 A;  4AM7 A;  2CH5 A;  3GDQ A;  5AQH A;  3VGK A;  4E1J A;  2P9S B;  1J6Z A;  4K42 A;  4DQ8 A;  5AQX A;  2NZT A;  3BUZ B;  1BO5 O;  4IO8 A;  1BWF O;  1K8K B;  3GBT A;  3VF4 A;  1R59 O;  3JS6 A;  4BC2 A;  1BA0 A;  1TUU A;  2HMP A;  4M63 C;  2ZF5 O;  1ATS A;  1BG3 A;  2ZWH A;  3WUH A;  1NGC A;  1BOT O;  1BU6 O;  4CZE A;  1NBW A;  5AZJ B;  3UKR A;  1XC3 A;  4H0Y B;  3VEY A;  3WEE B;  1GLA G;  5AQO A;  3D2E B;  3A5N C;  3ZET A;  3DWL A;  5AQK A;  2GEL A;  5ADX A;  2KHO A;  2E2P A;  3SJH A;  4PKG A;  5B8H A;  3O5B A;  2A3Z A;  1ATN A;  2E1Z A;  2A40 A;  5KQ8 A;  3VGM A;  3IMX A;  3TPQ A;  3LDN A;  2YJF A;  4JHD A;  5BPN A;  2GUP A;  3U9D A;  2P9K B;  3QDK A;  3LM2 A;  2GEM A;  1V4T A;  5LY3 A;  3AAP A;  3G25 A;  4J8F A;  5BN9 A;  3EN9 A;  3I33 A;  3EKU A;  2HF3 A;  4XH4 A;  1YAG A;  4FWS A;  2FLO A;  4CZG A;  1IG8 A;  2V7Z A;  4FWR A;  3QML A;  4H0O A;  1DEJ A;  3VPZ A;  2E2O A;  2IIR A;  4BRG A;  3DXK B;  3H46 O;  4JN4 A;  1YXQ A;  2Q2R A;  1SZ2 A;  4H5T A;  4F9O A;  4CZH A;  1LOT B;  1MDU B;  3L0Q A;  4B1U B;  4BRF A;  4L3Q A;  1D4X A;  2P9N B;  2E8A A;  3L4I A;  3HTV A;  2Q1N A;  3H6E A;  2QWP A;  4MLH A;  4QS7 A;  2DPN A;  2GWK A;  1C0F A;  3GL1 A;  5EXW A;  1IJJ A;  1QQM A;  5CE3 A;  3BF1 A;  1X3M A;  2P9P B;  1X9J A;  4JD2 A;  2PBD A;  3HSC A;  2IVP A;  2H3G X;  2UYT A;  1C0G A;  3FZH A;  3O1W A;  1TUY A;  3M6G A;  2W41 A;  3RSE B;  5AQN A;  5AQZ A;  1OKJ A;  3MMV A;  3D2F B;  4FWL A;  4BR5 A;  1JCG A;  3CQX A;  1YUW A;  3TU5 A;  5AQU A;  2VYP A;  2E1Y A;  4PKH A;  2QXL A;  1KAY A;  1MWK A;  1BUP A;  4BG8 A;  4BRM A;  3W0L A;  4FL9 A;  3O1B A;  5AZI B;  3VF6 A;  2PAV A;  4IXC A;  3D7E O;  1E4F T;  3H45 C;  4BRE A;  4BQL A;  1QZ6 A;  3SK3 A;  1KXP A;  5EY4 A;  3GE1 A;  3WQU A;  3FFK B;  1NLV A;  4H0P A;  4ISF A;  4EAH D;  2ITM A;  2D0O A;  2P9S A;  5AQG A;  4QS8 A;  4WQ5 A;  3IDH A;  2Q31 A;  4EHU A;  4PL7 A;  1HLU A;  1K8K A;  3M1F A;  3A5L C;  5AR0 A;  1NGB A;  5EVZ A;  3FZF A;  3VEX A;  4H0V B;  3MK6 A;  5AQT A;  3EKS A;  5AZJ A;  4B1Y B;  4FWO A;  3WEE A;  2QW9 A;  3UE5 A;  3D2E A;  1T6D A;  4BC4 A;  3P4I A;  3MDQ A;  4YDU A;  4BRL A;  4CBU A;  3WXK A;  4A62 A;  3ENH A;  2A41 A;  4CZF A;  2NRH A;  3CJC A;  5KQD A;  3WXJ A;  1SQK A;  4H0X B;  4BRH A;  4BG9 A;  1JCF A;  1NGG A;  3EO3 A;  3I8B A;  4GY2 B;  4QS9 A;  4WQ4 A;  1RGI A;  1HUX A;  2FSJ A;  5F0X A;  2P9K A;  2FXU A;  4FWM A;  5AQS A;  4JAX A;  4BRQ A;  5LJW A;  3DXM B;  3U9Z A;  3WXL A;  3ZX3 A;  1WUA A;  2Q0R A;  4FPA A;  2E20 A;  5EX5 A;  3H3O B;  1HKB A;  2E2Q A;  3CER A;  5AQI A;  1GLJ O;  3DXK A;  1NWK A;  4M7Y A;  4BR2 A;  3U4L A;  4BVP A;  4BR7 A;  2HOE A;  2ASP A;  3LDL A;  2A6A A;  2IVN A;  1GLD G;  4H5N A;  2D0P A;  4CBX A;  4I6M B;  3H3N O;  4XH1 A;  3J8A A;  3O6W A;  2Q36 A;  1TYQ B;  2P9N A;  4ISG A;  4AM6 A;  4BVO A;  5BRD A;  5I9E B;  2D1K A;  1E4G T;  2E2N A;  3CJA A;  3MN5 A;  3EZW A;  5AQL A;  3O80 A;  3R8E A;  2D4W A;  3SLC A;  4BR9 A;  3VEV A;  2P9P A;  5FPN A;  1RFQ A;  4HWI A;  3VET A;  3LM9 A;  5BRF A;  3SMP A;  4BRP A;  2YJE A;  4B9Q A;  1QHA A;  2P9U B;  3FZK A;  1XUP O;  2P9L B;  2QWQ A;  3QIC A;  4H0T B;  4PKI A;  4BGB A;  2EWS A;  3CET A;  3RSE A;  3VEO A;  4MO4 A;  3HI0 A;  5F1X A;  1ZC6 A;  1MA9 B;  2QWN A;  3D2F A;  3VOV A;  2AP1 A;  3KVG A;  4CBW A;  3S41 A;  3QBW A;  3C7N B;  3O8M A;  1GLE G;  3L6Q A;  4H03 B;  2WUS A;  2GWJ A;  4BRN A;  5AFU H;  4CD1 A;  1HJO A;  3JXU A;  3QB0 A;  5KPT A;  5AQR A;  5AZI A;  1HPM A;  4BC3 A;  5AFU A;  1ATR A;  2FSK A;  2OAN A;  1X3N A;  2V51 B;  3ZX0 A;  4BC5 A;  4XH5 A;  4DHY A;  5JIC A;  1HKC A;  1U2V B;  3ULE B;  2Q0U A;  4IJN A;  3LDQ A;  3FZM A;  4BRI A;  4NB4 A;  4XEI A;  3O4W A;  2F9W A;  3LDO A;  4CJ7 A;  4FWQ A;  2V7Y A;  2ASO A;  1BA1 A;  1Y64 A;  3IUC A;  4FSV A;  2ZGZ A;  3GOI A;  4H5W A;  3ENO A;  3U8X A;  4BGA A;  1H1V A;  3DJC A;  4FWK A;  4Y0W A;  3A8Y A;  3OHR A;  1P8Z A;  2W40 A;  1QZ5 A;  5AQM A;  3UB5 A;  3VER A;  5AQQ A;  3MN9 A;  1WOQ A;  2YHW A;  4A61 A;  2NLX A;  3ZEU B;  4CI6 A;  2QWO A;  1ESV A;  3UKU B;  3FR0 A;  2P9I B;  5AQV A;  3QBX A;  3SMS A;  4B1Z A;  1QQO A;  3HM8 A;  5LJV A;  3R9P A;  2ZGY A;  1NGA A;  4MO5 A;  1S3X A;  4Z94 A;  2I7N A;  1T44 A;  5E84 A;  4H5R A;  3CJ1 A;  4K41 A;  4RWT A;  1DGK N;  3HZ6 A;  2V52 B;  3MN6 A;  3CHW A;  1YVN A;  5AQJ A;  3FLC O;  4ISE A;  3DXM A;  1KAZ A;  3FE1 A;  3H1Q A;  4A2B A;  4JNE A;  1CZA N;  2A5X A;  3CIP A;  4EFH A;  1Q18 A;  3AY9 A;  3VEN A;  4O5F A;  5ADX H;  3W3D A;  4BRK A;  3A5O C;  3HBT A;  4CZI A;  2YHX A;  2QWR A;  4DCH A;  1GLC G;  3H1V X;  3MCP A;  2GTD A;  4B1X B;  5E26 A;  4FPB A;  2VWB A;  4B1W B;  3IFR A;  2VCP A;  3ZX2 A;  3UKR B;  1RDW X;  3CJ9 A; 
#chains in the Genus database with same CATH topology
 1KAX A;  2FF6 A;  2J4R A;  4DSK A;  3DLK A;  4FM2 A;  5AQP A;  3CD6 N;  5EOY A;  2E88 A;  2I7P A;  2QWL A;  4OLB A;  5HBM A;  3WNF A;  2O8E B;  1NGD A;  2QWM A;  5FPE A;  3M8P A;  4M3T A;  5MLC Q;  4CED A;  3L3U A;  5SWM A;  2OCE A;  3ID8 A;  3OYL A;  2PFU A;  5F2R A;  3CCL N;  4AHT A;  3MEE A;  3A5M C;  4CJF A;  4E0D A;  5BN8 A;  3QFU A;  3VGL A;  3LL3 A;  1W97 L;  2ITG A;  2P9U A;  3AVI A;  2P9L A;  3DRS A;  1TK5 A;  4BRO A;  4KBO A;  3MED A;  1HQE A;  4M3Z A;  4EIA A;  3AAQ A;  3CC7 N;  4FWP A;  2O8C A;  5CZ1 A;  3DRP A;  2YHY A;  4WQ5 C;  2Q97 A;  4CZK A;  4F2S A;  1NKC A;  4C23 A;  1GLL O;  3BP8 A;  2FF3 B;  5GIO A;  4EP5 A;  3WQT A;  2HBJ A;  3TAP A;  4JKC A;  3P83 D;  1YTA A;  3PX4 A;  5BR9 A;  2E6M A;  1LCU A;  3TAG A;  1HNI A;  1YVU A;  4DTS A;  2IS3 A;  5DM6 L;  2JWL A;  4KB1 A;  4FZZ A;  4JD2 B;  4YDU C;  1NMD A;  1U6Z A;  4CZJ A;  4NYF A;  2YI1 A;  1UA0 A;  3FZL A;  2RPI A;  1OH6 A;  1GLB G;  1NGH A;  3K59 A;  4Z4H A;  4KHN A;  4DR6 K;  1B92 A;  3AVN A;  3KLH A;  3VEZ A;  3AGK A;  4MDB A;  1LWC A;  4O8K A;  3O9U A;  3HL8 A;  3LDP A;  4FVM A;  3ULD A;  4FWN A;  1ZBU A;  1DT9 A;  2BUP A;  2YCH A;  3UKU A;  5TKY A;  2P9I A;  3GG4 A;  5C15 A;  4CHQ A;  1RTI A;  3P38 A;  4E19 A;  1DKG D;  1W2B M;  4FCY A;  1Z6R A;  4BR4 A;  1M90 O;  1VQ7 N;  2X6S A;  4FJ8 A;  3ZT3 A;  2O8D A;  1S22 A;  4H4M A;  3U6F A;  4X62 K;  3T1A A;  3VF2 A;  3HPO A;  3C0B A;  2D0B A;  1ZYQ A;  3VGK A;  3HPH A;  2OA8 A;  3K5N A;  1K73 O;  4CFD A;  4IG0 A;  3E66 A;  3L2V A;  4Z4C A;  4DV6 K;  1BCO A;  3HOT A;  1ASU A;  1K8K B;  3VF4 A;  1EXQ A;  3JS6 A;  4BC2 A;  1RBS A;  1TUU A;  3DMJ A;  2ZF5 O;  1XNQ K;  4Z0U A;  4CEC A;  1BG3 A;  5GAH P;  4ZHR A;  1JLB A;  1RDA A;  2X74 A;  3TAB A;  2QI2 A;  5AZJ B;  3WEE B;  4ZTJ A;  1VSJ A;  3DWL A;  5AQK A;  4JI8 K;  1NK9 A;  1IKV A;  3O5B A;  1Q81 O;  2EX3 A;  3KWG A;  2O8E A;  2Y1J A;  3VGM A;  3KWI A;  3KKR A;  1QS4 A;  3LM2 A;  5LY3 A;  1JL1 A;  3DLG A;  4U7B A;  5GAE P;  3I33 A;  1SKS A;  3V9S A;  3QIO A;  4IFE A;  1NJX A;  4CZG A;  2V7Z A;  2DY4 A;  4H0O A;  4JKG B;  1W9H A;  1VSK A;  4X65 K;  4IEE A;  4IEI A;  3ZSW A;  2D0A A;  4M3R A;  3A2F A;  1MDU B;  1RBT A;  5DMR A;  1NG9 A;  1NOZ A;  4L3Q A;  1SL0 A;  1EO1 A;  4KRF A;  3L4I A;  2OTL N;  2Q1N A;  3V1Q A;  3H6E A;  1J53 A;  3MX2 A;  2E4L A;  4MDA A;  3ZSR A;  2ATQ A;  4IOC L;  3ZSY A;  5CE3 A;  3CFR A;  1SS6 A;  2WOM A;  3ASM A;  4JD2 A;  4K0K K;  5K14 A;  1C0G A;  2IC3 A;  1HNW K;  4FJI A;  3MWT A;  4YNQ A;  3RSE B;  2HVH A;  4ID5 A;  3DYA A;  3MMV A;  3D2F B;  4AHR A;  1YUW A;  3TU5 A;  2UUB K;  2VG6 A;  5GIP A;  1GOA A;  1K6Y A;  3OJS A;  4DTN A;  4IXC A;  4B9U A;  1QVF M;  4DTP A;  3H45 C;  4BRE A;  1L3S A;  1QZ6 A;  3SK3 A;  1RCH A;  3V1O A;  1VQ6 N;  4H0P A;  3O9T A;  3HJF A;  3LPU A;  4EAH D;  4B08 A;  1JLC A;  3E01 A;  3K9K A;  4RW9 A;  3IDH A;  1K9M O;  4KAZ A;  1K8K A;  4KH6 A;  4KHU A;  4LF6 K;  4JK8 A;  5HLF A;  3FZF A;  3MCA B;  3HP6 A;  3MK6 A;  5AQT A;  1WSE A;  3BZK A;  1WSJ A;  4OJR A;  3QET A;  5KGW A;  4G9Z A;  5AZJ A;  3WEE A;  4C8M A;  5CHI A;  1RT4 A;  3AVB A;  1IKY A;  4ELU A;  3P4I A;  2RHK A;  4CBU A;  4AHC A;  4CZF A;  2NRH A;  3L4Q A;  5FRM A;  1SQK A;  1IO2 A;  4H0X B;  4FLY A;  4GW6 A;  4BRH A;  1A5W A;  3PIO L;  1JCF A;  1C1A A;  3I8B A;  4ILJ A;  4ELV A;  2VQE K;  3NGI A;  4CJU A;  4PWD A;  3I56 N;  4W5N A;  2FSJ A;  5AQS A;  4WCE L;  2FC0 A;  1TKD A;  4FPA A;  4LFB K;  4NYN A;  1RDB A;  1GLJ O;  1WBD A;  1NWK A;  3ZSO A;  4Y1C A;  3QEI A;  5M1N A;  4RW7 A;  4BR7 A;  2HOE A;  5C10 A;  3RRG A;  3NFA A;  4EZ9 A;  4QOZ B;  4J2B A;  3OVN A;  1GLD G;  2DTU A;  4JI6 K;  3WNH A;  3H3N O;  3O6W A;  2Q3S A;  4ISG A;  3NCI A;  3ZSZ A;  1S1U A;  5I9E B;  2E2N A;  4W5T A;  3CJA A;  3CXC M;  4O5B A;  4HCB A;  4DUZ K;  2VG5 A;  1NK8 A;  4NCG A;  4KKO A;  3HVT A;  3HXM A;  3I55 N;  3VET A;  3SJJ A;  3THV A;  3PX6 A;  4H0T B;  1XUP O;  2EWS A;  3RSE A;  4DQI A;  3HI0 A;  4JI4 K;  5F1X A;  2F8T A;  2UU9 K;  1MA9 B;  3D2F A;  3NHG A;  3VOV A;  3S41 A;  4LFC K;  2NRV A;  4CJE A;  3O8M A;  5DM7 L;  5AFU H;  4R5P A;  2FBX A;  1LW0 A;  1HJO A;  4JI1 K;  5AQR A;  1HPM A;  4H8K A;  3SAH A;  5JIC A;  2V51 B;  4I9L A;  4DHY A;  3T1H K;  1HKC A;  4JRQ A;  1VQK N;  1TAQ A;  2Q0U A;  4IJN A;  4JKH A;  4NB4 A;  3ITH A;  3O4W A;  4CJ7 A;  4IDK A;  2XO7 A;  2QEX N;  4FWQ A;  4DQP A;  1Y64 A;  3IUC A;  4YY3 K;  3S3M A;  2QTD A;  2QKK A;  3PY8 A;  4CJQ A;  4Y0W A;  5M1Q A;  4JKE A;  1QZ5 A;  4YOX A;  4YOV A;  3VER A;  3OW2 M;  3MN9 A;  4EZ6 A;  4PY5 A;  4CI6 A;  2NLX A;  1XHX A;  4RW8 A;  4FLW A;  4B3M K;  5FRN A;  4A57 A;  1ILY A;  5C12 A;  4C8N A;  4CGI A;  3KLE A;  4FVU A;  3CF5 L;  3QBX A;  3SMS A;  4LF5 K;  3PV8 A;  3HM8 A;  1WSF A;  3KD5 E;  2ZGY A;  1S3X A;  2RE2 A;  4M3U A;  5E84 A;  4H5R A;  3AGR A;  3CJ1 A;  4K41 A;  4DV3 K;  3THW B;  1DGK N;  2O8B B;  4FLT A;  4IDH A;  5AQJ A;  4ISE A;  1RTH A;  2ZQB A;  4A59 A;  3F9K A;  4JNE A;  3IKM A;  3G10 A;  1ZBF A;  3OYG A;  4Z4I A;  4DR3 K;  3C65 A;  3T1Y K;  4DSL A;  3TSQ A;  4O5F A;  1NKE A;  5ADX H;  4DR2 K;  3W3D A;  1HR0 K;  1A5V A;  4CZI A;  3LP3 A;  4GKK K;  3TTC A;  2KZZ A;  3MCP A;  2GTD A;  1OH7 A;  2OYQ A;  2VWB A;  4CIF A;  4CJR A;  4W5Q A;  1QQC A;  1JXB A;  1HPZ A;  2YV0 X;  3ZET B;  4GNI A;  4BQZ A;  4L8R B;  1JKH A;  4A5B A;  4YOT A;  3OBY A;  1VQ4 N;  3MWP A;  2PZS A;  2X6N A;  3C6U A;  4KO0 A;  4WFB L;  4E89 A;  4WF9 L;  5BR8 K;  1GOC A;  3V1R A;  1JL2 A;  1J9A A;  2F7T A;  4AHV A;  2FSN A;  4BRC A;  2DFF A;  1BHL A;  3VTH A;  3CM6 A;  3ZT0 A;  3OYN A;  5IWA K;  4M42 A;  1HX1 A;  1YHQ N;  5BPM A;  3SNN A;  1NOY A;  2B5J A;  4OPH A;  4DSI A;  5FPD A;  5KPR A;  2IDO A;  3R6M A;  1NM1 A;  3T7Z A;  4DB3 A;  2KZM A;  1EQY A;  2F4V K;  4M7X A;  1IKX A;  5M1K A;  4DV4 K;  1F21 A;  2G8I A;  1NMN A;  3G4S N;  3KJV A;  4I9Q A;  4CJS A;  4DTJ A;  4FJ5 A;  1UWB A;  1HQU A;  5JLH A;  1EWR A;  5T7B A;  2YKM A;  3AVC A;  5J2Q A;  1G99 A;  4CF8 A;  1Y97 A;  4DLE A;  1LAV A;  1JLF A;  2G8U A;  5J2N A;  4M3W A;  4YOY A;  4A2A A;  3KLF A;  4DQQ A;  4BR0 A;  4O55 A;  1FKO A;  4K43 A;  4B9V A;  1UAX A;  1LAW A;  2ZJQ L;  4WQ4 C;  1TGO A;  3VTI A;  1KLN A;  4BRA A;  4M3X A;  4F3T A;  1RT6 A;  4QAG A;  3LDS A;  2WBN A;  5CYQ A;  4BY9 C;  1T6C A;  3ZT4 A;  4WFN L;  1NGE A;  1NK5 A;  3M8S A;  4JI7 K;  1RIL A;  3EE9 A;  2QM1 A;  4FLU A;  4N5S A;  3KK7 A;  3SQ0 A;  3LPT A;  1V4S A;  3CI5 A;  3G0Z A;  3THY B;  4MLE A;  2O8B A;  4GV6 A;  2E6L A;  3HRG A;  5AQH A;  3GDQ A;  3LAN A;  4E1J A;  3NH1 A;  3VQ8 A;  1J6Z A;  4HTU A;  2O8F B;  5FLX O;  5HL7 L;  1KFD A;  3GBT A;  2PYL A;  1R59 O;  1L3T A;  3K2P A;  4CJK A;  1U45 A;  1NJY A;  2XHB A;  4BDP A;  3NVM A;  1S9E A;  4CEA A;  1SV5 A;  4CGG A;  3VEY A;  1VRT A;  3O4Q A;  4U67 L;  4PHT X;  3A5N C;  3ZET A;  2GEL A;  4DTO A;  1JLG A;  5B8H A;  4PKG A;  4DWI A;  1GOB A;  1ATN A;  4FJX A;  2HND A;  4LF4 K;  2WFB A;  3NF7 A;  3MEG A;  1T3V A;  1SKR A;  2DFH A;  3VA0 A;  1HYS A;  1KTQ A;  2GUP A;  3LAM A;  3U9D A;  3LAL A;  3AAP A;  5HRP A;  3G25 A;  5BN9 A;  3M8Q A;  3EN9 A;  2HF3 A;  4FWS A;  2FLO A;  2HNY A;  3LAK A;  4CJL A;  1YJ9 N;  2P51 A;  5C25 A;  2QKB A;  3QML A;  1VSD A;  2FBT A;  4FXD A;  3EEQ A;  3SI6 A;  4OPK A;  2YHA A;  1YXQ A;  4Z4F A;  4DSE A;  2UXC K;  4B1U B;  4BRF A;  1D4X A;  1IG9 A;  4Q5V A;  2P9N B;  3AVG A;  5A2Q O;  4FM1 A;  4MFB A;  2VG7 A;  3AVM A;  5KI6 A;  1KD1 O;  4MLH A;  4QS7 A;  1S72 N;  1BCM A;  5C2D A;  1MU2 A;  4DSF A;  4J2D A;  2ETJ A;  4B9M A;  4LH5 A;  3DRR A;  4W5R A;  3E1Y A;  2HB5 A;  3BF1 A;  2G8K A;  4NCB A;  2HHW A;  4FK2 A;  4OO1 J;  4BWJ A;  3E9P A;  2H3G X;  3K5M A;  1TUY A;  1NJZ A;  4AIL C;  1J5E K;  2W41 A;  1OKJ A;  3DM2 A;  4CHN A;  1EWQ A;  4ICL A;  4FWL A;  1X9M A;  3QEX A;  2VYP A;  4KTW A;  4DV2 K;  2E1Y A;  4YOR A;  3OYH A;  1S1T A;  3AA3 A;  3HVR A;  1BUP A;  4OGE A;  4BRM A;  2YKN A;  5AZI B;  3PSF A;  3VF6 A;  2PAV A;  4FK0 A;  3D45 A;  5HRN A;  4DF8 A;  4BQL A;  1KXP A;  5EY4 A;  1VSI A;  3FFK B;  1NLV A;  3THY A;  4ISF A;  3OY9 A;  2ITM A;  1C1C A;  1FK9 A;  4KV8 A;  1Q82 O;  5AQG A;  4QS8 A;  4WQ5 A;  1SL1 A;  2O8F A;  2Q31 A;  4CE9 A;  3LP2 A;  3M1F A;  5CY4 A;  3A5L C;  5AR0 A;  3RWU A;  3TSP A;  3OS2 A;  3U3Y A;  3HYF A;  4B1Y B;  4FWO A;  3JSM A;  1TV6 A;  2QW9 A;  1T6D A;  4ILH A;  4CEE A;  3MDQ A;  4YDU A;  4FJ9 A;  1J54 A;  2A41 A;  3I0S A;  3CJC A;  4IBN A;  3SQ2 A;  5KRS A;  1N36 K;  2KQ2 A;  1W7A A;  1NGG A;  1RBU A;  4GY2 B;  2BGG A;  1RGI A;  3L3V A;  1HMV A;  5F0X A;  4JAX A;  3ZLJ A;  5LJW A;  3MAQ A;  4CK3 A;  3ZX3 A;  2YX6 A;  2E20 A;  4DSJ A;  1VSE A;  3NH0 A;  2RF2 A;  2HBK A;  4CK1 A;  1HKB A;  3CER A;  4KHP K;  4B9L A;  4DQS A;  2P5O A;  1S1X A;  3U4L A;  3NBP A;  3L8B A;  1U47 A;  1A5X A;  3WNG A;  3ZT1 A;  3LWM A;  3SUO A;  4I6M B;  3CCS N;  4E7K A;  2Q36 A;  1TYQ B;  2P9N A;  4JV5 K;  4KFB A;  3TAQ A;  5BRD A;  1CXU A;  1Q8I A;  1N32 K;  4AF1 A;  3OYJ A;  5AQL A;  3MN5 A;  3EZW A;  3O80 A;  3VQB A;  4CER A;  2D4W A;  4B3T K;  3SUQ A;  3NF8 A;  4DKW A;  2Z1J A;  4DS4 A;  1YI2 N;  2VQF K;  2RKI A;  4B9N A;  4B9Q A;  1QHA A;  1L3V A;  2QWQ A;  3F73 A;  4WE1 A;  3MXJ A;  4DQR A;  4MO4 A;  1ZC6 A;  4F8R A;  1EET A;  3QES A;  2YNH A;  4NLB A;  1NU0 A;  3C95 A;  3QBW A;  3AO2 A;  4B3O A;  3N4Q A;  4KHQ A;  2VWK A;  4DFJ A;  4CD1 A;  4BE0 A;  5AJ3 K;  2WON A;  1O13 A;  4KHW A;  2G8W A;  1FKP A;  5AZI A;  4BC3 A;  3NAE A;  5AFU A;  3PO5 A;  4BC5 A;  1VK0 A;  1X3N A;  4CHP A;  4XH5 A;  2B6A A;  1RT3 A;  3D0P A;  3UIQ A;  3G6E N;  1VSL A;  3ULE B;  1HYV A;  1QSL A;  3WXM B;  3S3N A;  3C94 A;  4BRI A;  5I3U A;  4JEP A;  4GVE A;  3O9R A;  1RDD A;  3DLR A;  4FJ7 A;  1L5U A;  1I3A A;  2V7Y A;  2ASO A;  1BA1 A;  4FSV A;  4CHY A;  4FZX C;  2ZGZ A;  3GOI A;  3U8X A;  2HHT A;  3HT3 A;  1SUQ A;  2W40 A;  5I42 A;  3UB5 A;  3PX0 A;  1D9D A;  4DV5 K;  3BGR A;  1ESV A;  2E5L K;  1NK4 A;  4Y1D A;  3ALY A;  2JLE A;  4JK7 A;  4HUE A;  2KKZ A;  1QTM A;  2BE2 A;  3CFO A;  2Y1I A;  3CCJ N;  1FXX A;  1CXQ A;  5LJV A;  3CCE N;  5GIN A;  4MO5 A;  1T44 A;  5JVG L;  3HZ6 A;  4JKF A;  3CHW A;  3IRX A;  5CR4 A;  1YVN A;  1KAZ A;  3H1Q A;  4A2B A;  4DR5 K;  4KB0 A;  1C0M A;  4CJ4 A;  2NRW A;  3CIP A;  3SQ4 A;  4AH9 A;  3BDP A;  3AVH A;  2BAN A;  3PO4 A;  3H1V X;  4B1W B;  4B3S K;  4LF7 K;  3IFR A;  3ZX2 A;  3UKR B;  4OVL A;  1VRU A;  3CJ9 A;  2I7N A;  4I6M A;  3BEX A;  3PIP L;  4MQ3 A;  4HTL A;  4V19 S;  1TYQ A;  1S5J A;  1TKZ A;  3J7A P;  4B1V A;  4CJV A;  5JVH L;  4KTQ A;  3CJ7 A;  4ZTF A;  3H08 A;  1O1W A;  1T03 A;  1SAZ A;  4LSN A;  3KHY A;  1J5O A;  4Z4G A;  3NVK A;  4PL8 A;  4CJ3 A;  4LFA K;  5AQF A;  1YJN N;  2NRZ A;  1S6P A;  3ATU A;  3KZB A;  5AQY A;  2LSN A;  4DU4 A;  5C0Y A;  2FBV A;  3EL2 A;  3DAW A;  4UQG A;  3FGU A;  1NK0 A;  4WYB A;  3FFI A;  4CGF A;  3I0R A;  3IAY A;  2IVO A;  1NGJ A;  1CZB A;  4CF1 A;  4IKF A;  1JXE A;  2GBZ A;  3OJU A;  4AQY K;  3QEP A;  5HOO A;  2CGL A;  1OVQ A;  5SZT A;  1ZXO A;  3VQE A;  1K8A O;  1TK8 A;  3V9Z A;  3ULE A;  1HRH A;  1WSH A;  3NH2 A;  5CYM A;  4KI4 A;  1C0U A;  3OYC A;  1NJI O;  3K58 A;  2G8V A;  1ZBS A;  3KK2 A;  4M45 A;  5M1F A;  4FOE A;  1JJ2 M;  2HHS A;  5JLF A;  2QA4 N;  4CIG A;  3O08 A;  3B8A X;  2A42 A;  3ATV A;  3RRH A;  4K8X A;  3BF3 A;  1FW6 A;  3OYI A;  5FPM A;  3CQY A;  1EP4 A;  4RCH A;  1RT7 A;  4EHT A;  1NGI A;  1HJR A;  4LC9 B;  3VES A;  3AO3 A;  3F9M A;  3P31 A;  4CW7 B;  1RBR A;  1VQL N;  1QQN A;  5BRE A;  2ZM6 K;  3VQ9 A;  4JKA A;  3DLB A;  3O9S A;  3A0I X;  1REV A;  3MN7 A;  2CH5 A;  3QO9 A;  2P9S B;  1KLM A;  3K9J A;  5AQX A;  1Q9X A;  4KH5 A;  4DLG A;  3SUN A;  3JAM O;  1BWF O;  4M41 A;  1U04 A;  4EP4 A;  1WAF A;  4YHH K;  4I7F A;  1ATS A;  1WAJ A;  2ZWH A;  3O3F A;  3QIN A;  4C8K A;  1NGC A;  5CZ2 A;  5LMU K;  4CZE A;  1NBW A;  3UKR A;  3SV3 A;  1BIU A;  4H0Y B;  1GLA G;  4F4K A;  4BWM A;  1YTU A;  3TAM A;  2E2P A;  4O0I A;  4IFY A;  2E1Z A;  5KQ8 A;  1QE1 A;  3IMX A;  3TPQ A;  1X1P A;  2YJF A;  4FLV A;  3QEV A;  5BPN A;  1YJW N;  1V4T A;  3RMC A;  3J81 O;  2G8H A;  3P5J A;  4J8F A;  4XH4 A;  3EKU A;  1YAG A;  1IG8 A;  3QEW A;  4B9T A;  4FWR A;  2ZJP L;  1DEJ A;  2E2O A;  1XWL A;  4FW2 A;  3AO4 A;  3DXK B;  3H46 O;  5HP1 A;  2Q2R A;  3ID6 A;  4CFA A;  2NRR A;  1D5A A;  4BAC A;  3HST B;  4E7J A;  1LOT B;  2WTU A;  1EKE A;  3L0Q A;  1U48 A;  3DI6 A;  3TTF A;  3QIP A;  3JYT A;  1XC9 A;  3C6A A;  3CPE A;  2UUC K;  2QWP A;  3VA3 A;  4B9S A;  3ZCM A;  2DPN A;  1TL1 A;  1RT5 A;  1C0F A;  4NLC A;  1Z25 A;  3SPZ A;  3D6R A;  1NK6 A;  3DLH A;  1JLA A;  4OGC A;  2KFZ A;  2XRI A;  2PY5 A;  1QQM A;  4OKK A;  3LP1 A;  1X9J A;  4FLX A;  3VQA A;  4FZY A;  2YNI A;  2IVP A;  2UYT A;  5J2P A;  3M6G A;  1OVY A;  1D9F A;  5AQZ A;  3AVL A;  4DV0 K;  4CEO A;  3CYM A;  1JCG A;  3KKS A;  1BIZ A;  5AQU A;  4ELT A;  3T19 A;  2QXL A;  3AA2 A;  3W0L A;  3OS1 A;  1IV0 A;  3D7E O;  1TK0 A;  1E4F T;  1U49 A;  3OS0 A;  4H4O A;  1RBV A;  1N5Y A;  2NUB A;  2D0C A;  3O4N A;  2D0O A;  2P9S A;  4J2A A;  3AVJ A;  4EHU A;  4PL7 A;  1HLU A;  1UOC A;  3NF6 A;  3RR7 A;  4OLA A;  2WC9 A;  4F3O A;  3VQ4 A;  4NCA A;  3VEX A;  3BZC A;  1IBM K;  4NXN K;  3IG1 A;  4CIE A;  1IBL K;  3OYA A;  1VQN N;  3UE5 A;  4BDZ A;  1WNS A;  3AVK A;  4J2E A;  1TL3 A;  3WXK A;  1ZBI A;  4E1N A;  3VQ5 A;  4FJL A;  3EO3 A;  2GV9 A;  4O4G A;  4QS9 A;  4WQ4 A;  3VQ6 A;  1XMO K;  4BRQ A;  4QCL A;  3WXL A;  3OTO K;  1WUA A;  4I2Q A;  3OYM A;  4DG1 A;  4DFP A;  3HOS A;  2VGM A;  2E2Q A;  3DXK A;  4HHT A;  2HVI A;  4BR2 A;  3DLE A;  3Q7C A;  2UXB K;  4IO9 L;  2P1J A;  4DTX A;  4DTU A;  1UA1 A;  3OBW A;  1CZ9 A;  4DUY K;  3LDL A;  2F96 A;  3MEC A;  2A6A A;  4Q0B A;  1W0H A;  4H5N A;  4CFB A;  4CBX A;  4E3S A;  4N76 A;  5M1P A;  1D8Y A;  1HNX K;  2BDP A;  2ZD1 A;  3CCV N;  2D1K A;  1E4G T;  3SV4 A;  2OZS A;  3R8E A;  3SLC A;  4CF0 A;  1B9F A;  3VEV A;  3OA9 A;  4HUG A;  3RMB A;  1OH8 A;  5FPN A;  3U3G A;  4X64 K;  1LW2 A;  4OKE A;  1RFQ A;  4HWI A;  5BRF A;  1TVR A;  4BRP A;  4FJH A;  3FZK A;  4BGB A;  4PKI A;  4CES A;  4KRE A;  1KCF A;  1TAU A;  4DTR A;  4FJK A;  4ILG B;  4CGH A;  1XHZ A;  2AP1 A;  3KVG A;  3NGY A;  3N4P A;  1ASW A;  3C7N B;  1GLE G;  3L6Q A;  3EY1 A;  4GMJ B;  2WUS A;  2GWJ A;  4TSX A;  3VQ7 A;  3JXU A;  3QB0 A;  4CVN E;  3K5L A;  2GUI A;  3P1G A;  5GAG P;  1LV5 A;  2PYJ A;  2FSK A;  3M8R A;  3ZX0 A;  5E41 A;  4JS4 A;  1U2V B;  3TAN A;  4KHY A;  4HVJ A;  3KLI A;  3LDQ A;  1BGX T;  1RT1 A;  3LDO A;  4UY8 O;  1X9W A;  4CJT A;  4GKJ K;  3ENO A;  4BGA A;  1H1V A;  5M1O A;  3CMA N;  3DJC A;  4FWK A;  3A8Y A;  5FDL A;  3ZSV A;  1P8Z A;  1IKW A;  1BQM A;  5KGX A;  3NGZ A;  2EHG A;  2W6L A;  5AQQ A;  4GV3 A;  1TKT A;  1WOQ A;  4A61 A;  3ZEU B;  2A1S A;  3FR0 A;  3CCQ N;  1NKB A;  1S6Q A;  3SAG A;  3HK2 A;  4G1Q A;  4B1Z A;  1U4B A;  3V9U A;  4OX9 K;  2VGN A;  4YFU A;  1KRP A;  3VQP A;  1Q7Y O;  1QVG M;  4Z94 A;  4KH4 A;  4CJP A;  4JS5 A;  3PUF A;  1M1K O;  4KHS A;  2V52 B;  3MN6 A;  4AHU A;  4DF4 A;  1NJW A;  3FLC O;  4O8U A;  1YIJ N;  3CME N;  4JLH A;  2IAJ A;  1KVB A;  4DTM A;  3ZYY X;  1VAZ A;  1Q18 A;  3SUP A;  3AY9 A;  1KVA A;  3A5O C;  2YHX A;  5LMN K;  3SQ1 A;  2Z1H A;  3OYB A;  3L2R A;  1QSS A;  2YNF A;  4CK2 A;  2Z1I A;  1SL2 A;  3WT0 A;  4C1N I;  4CZL A;  3LZJ A;  2HMI A;  5ELZ A;  3HO1 A;  4IZ9 A;  2UUA K;  4N56 A;  1HNZ K;  1XQS C;  4RG8 A;  3J7Z O;  4CEQ A;  1XMQ K;  3NMU A;  5JMV A;  1LWF A;  4CJW A;  4FO0 A;  3DLL L;  4JHD B;  2CH6 A;  4HCC A;  4IFV A;  4CF9 A;  2FBY A;  4CFC A;  3M3Z A;  2AA4 A;  4NO7 A;  5BRH A;  2HF4 A;  4AHS A;  1Z05 A;  2I5J A;  3NF9 A;  4DR1 K;  2O4G A;  3VEW A;  1WSI A;  5BPL A;  4FJG A;  1G15 A;  1LWE A;  3LZI A;  4C8O A;  3V81 A;  1RDC A;  2HHH K;  4E7L A;  3CCU N;  3NE6 A;  1Q86 O;  1NGF A;  3KIO A;  4JI2 K;  3C7N A;  4BRD A;  3EZ5 A;  2CGJ A;  1IBK K;  1BQN A;  3QLH A;  1XNR K;  5C2F A;  5KPZ A;  2KFN A;  2DFE A;  3SZ2 A;  2F9T A;  1KFS A;  3THX B;  1BDG A;  3KTQ A;  4KTZ A;  4K25 A;  4DS5 A;  4IWV A;  3CFP A;  4IJA A;  1U2V A;  1QSY A;  4C8L A;  4DV7 K;  1YF5 L;  4M3Y A;  1RNH A;  5J2M A;  1VQ8 N;  3E9L A;  3CJB A;  3QFP A;  1C6V A;  1MWM A;  4H5V A;  5KRT A;  2Z1G A;  1BIS A;  2QXF A;  4FLZ A;  1DTT A;  4NXM K;  3HM9 A;  4O0J A;  1GLF O;  2ASM A;  3ZEU A;  3RR8 A;  4FW1 A;  3VQC A;  2AJQ A;  2BTF A;  3CC4 N;  1QHT A;  4LSL A;  2XY5 A;  4BDY A;  2CGK A;  1HKG A;  3K57 A;  3CC2 N;  4JKB A;  3AVA A;  4RTF D;  4FOI A;  4A5A A;  4BE1 A;  1JCE A;  3QNN A;  2OTJ N;  2HST A;  3AAR A;  1C1B A;  4LF9 K;  5JS1 A;  3WXI A;  5AQW A;  1RTJ A;  4AM7 A;  1VSH A;  3OYF A;  3MX5 A;  2HBM A;  4CEF A;  4K42 A;  4DQ8 A;  4E7H A;  2JWK A;  2OPR A;  4WFA L;  1WSG A;  1N8R O;  2NZT A;  3BUZ B;  1BO5 O;  4IO8 A;  4DU3 A;  3EYZ A;  4JKD A;  2OPQ A;  1BA0 A;  3O9Q A;  2HMP A;  4M63 C;  1RT2 A;  3WUH A;  1BOT O;  3K0S A;  1BU6 O;  1Z26 A;  4CJ5 A;  1XC3 A;  4K8Z A;  5AQO A;  3ISN C;  3V9W A;  3D2E B;  4FJJ A;  3J80 O;  5ADX A;  2KHO A;  3SJH A;  3F2K A;  3KK3 A;  3V6D A;  2A3Z A;  3AA4 A;  1S1V A;  2A40 A;  2IGI A;  1L3U A;  1CLQ A;  3LDN A;  4JHD A;  2P9K B;  3B6O A;  3QDK A;  1Q9Y A;  3QER A;  2GEM A;  4JK9 A;  3O3G A;  5TKW A;  3CPW M;  3LWL A;  4JKG A;  3SAF A;  3AVF A;  3HP9 A;  5DK5 A;  3VPZ A;  3AO5 A;  2IIR A;  4BRG A;  1ZBL A;  3TAR A;  2A1R A;  4JN4 A;  1N6Q A;  3TSU A;  3K5O A;  1SZ2 A;  1BL3 A;  4H5T A;  4F9O A;  1HNV A;  4CZH A;  1ZBH A;  1EX4 A;  2KW4 A;  2HHV A;  2F8S A;  1C0T A;  1X9S A;  5D3G A;  1ITG A;  1FJG K;  4DFM A;  2OZM A;  4Z4E A;  2GX9 A;  5GAD P;  2E8A A;  1I94 K;  3HTV A;  1T05 A;  3THX A;  1WLJ A;  3L2W A;  2BH1 A;  1RTD A;  3CCM N;  2GWK A;  4FYD A;  2G8F A;  3GL1 A;  5EXW A;  2IOC A;  1IJJ A;  1X3M A;  3ZSX A;  2P9P B;  1WBB A;  2XY7 A;  2PBD A;  3HSC A;  4YOU A;  2P5G A;  3FZH A;  3O1W A;  3RMA A;  3RVC A;  3L2U A;  5AQN A;  4X66 K;  3C6H A;  4OKJ A;  1HYZ A;  4YOW A;  1YT3 A;  4BR5 A;  3CQX A;  4IOX A;  4N47 A;  3TWH A;  2D5R A;  5LL6 Z;  5FRO A;  4FM0 A;  4PKH A;  1KAY A;  1MWK A;  1VQP N;  4PA1 A;  1VHX A;  4BG8 A;  4FL9 A;  3O1B A;  1WB9 A;  4CCH A;  4FJM A;  3VQD A;  3AV9 A;  2B4J A;  2NRT A;  3M5R A;  1WN7 A;  3TTD A;  1N34 K;  2HBL A;  3GE1 A;  3WQU A;  1OH5 A;  4PQU A;  3SBG A;  1JLE A;  4C1N K;  4RW4 A;  3ENB A;  4DU1 A;  4JI3 K;  3C6T A;  1JLQ A;  3Q7B A;  3OYD A;  4E1M A;  3TR8 A;  4PUO A;  3PLA A;  3QNO A;  1NGB A;  5EVZ A;  4H0V B;  4LH4 A;  1KQS M;  3V9X A;  3NDK A;  1IH7 A;  2NNW A;  2OPP A;  3EKS A;  3PSI A;  4DMN A;  3D2E A;  4OPA A;  4CGJ A;  4BC4 A;  3O3H A;  1VQ5 N;  4R79 A;  4BRL A;  3VN5 A;  3TAE A;  1BI4 B;  4A62 A;  3ENH A;  3KD1 E;  4E7I A;  5KQD A;  4F2R A;  3WXJ A;  1S9G A;  1S1W A;  5EU7 A;  2KLA A;  4BG9 A;  3EE8 A;  3CM5 A;  4CF2 A;  1HUX A;  2OPS A;  2P9K A;  2FXU A;  4FWM A;  1I39 A;  4CHZ A;  3CCR N;  3TI0 A;  4CGD A;  4IOA L;  3ZSQ A;  3DXM B;  1T8E A;  3U9Z A;  2KTQ A;  2Q0R A;  5EX5 A;  3H3O B;  4DR4 K;  5AQI A;  4JI5 K;  4JYA K;  2QK9 A;  3IS9 A;  4DV1 K;  4M7Y A;  4DFK A;  2O4I A;  1VQ9 N;  4BVP A;  1YIT N;  2JGU A;  2ASP A;  1VSF A;  2IVN A;  4FJN A;  3VMF B;  2D0P A;  3MXM A;  4XH1 A;  3E9O A;  3J8A A;  1KVC A;  4XIU A;  2YNG A;  4AM6 A;  3OYK A;  1ASV A;  3TAF A;  3DOK A;  4BVO A;  1B9D A;  1TKX A;  3T69 A;  4CEZ A;  3CQ8 A;  4BR9 A;  5H1S Q;  5HRO A;  5IT9 O;  1VQO N;  2P9P A;  2HHU A;  3LM9 A;  4CEB A;  3DOL A;  4HUF A;  3SMP A;  2YJE A;  4CZM A;  2P9U B;  3QIC A;  3OYE A;  2P9L B;  3HPG A;  2HHQ A;  1XI1 A;  3CET A;  3VEO A;  4ID1 A;  3J7Y P;  3LP0 A;  5J1E A;  2XY6 A;  1DTQ A;  5C24 A;  2QWN A;  4CBW A;  1NNE A;  4LY7 A;  4CHO A;  3KK1 A;  4H03 B;  3SCX A;  2W6K A;  4BRN A;  4GVM A;  2O8C B;  4GV9 A;  1VQM N;  1KSP A;  2XY8 A;  5KTQ A;  1N33 K;  3CG7 A;  3AO1 A;  3R1X A;  4O44 A;  5KPT A;  3SYZ A;  2VWJ A;  3BY5 A;  3RTV A;  1P90 A;  5HRR A;  3I8D A;  1ATR A;  2OAN A;  2RN2 A;  2ZE2 A;  2NRX A;  4LF8 K;  3FZM A;  4XEI A;  2F9W A;  4W5O A;  3V4I A;  1E3M A;  2YHB A;  4H5W A;  4CD3 A;  2HW3 A;  5C42 A;  3R3L A;  4B3R K;  3KLG A;  3SPY A;  3OHR A;  3ZT2 A;  5AQM A;  3S9H A;  4LD0 A;  1DLO A;  2YHW A;  2QWO A;  3G71 N;  3UKU B;  2UXD K;  2P9I B;  4B8C A;  4BE2 A;  5AQV A;  1BI4 A;  5HRS A;  2HNZ A;  1NK7 A;  4JRP A;  1QQO A;  4DR7 K;  2W42 A;  1SKW A;  3T3F A;  3THW A;  3R9P A;  2O8D B;  1NGA A;  2R7Y A;  4B8A B;  2X78 A;  1KC8 O;  4RWT A;  3RMD A;  4I2P A;  4KI6 A;  2ZJR L;  4FK4 A;  3DXM A;  3FE1 A;  3WNE A;  1CZA N;  2A5X A;  4RW6 A;  3MXI A;  4EFH A;  3VEN A;  4IG3 A;  3F5T A;  1VSM A;  4KPY A;  4BRK A;  1T7P A;  3B6P A;  3P39 A;  3VQQ A;  1RDU A;  3HBT A;  2QWR A;  3S3O A;  2HHX A;  4DCH A;  1GLC G;  4B1X B;  4JI0 K;  3SBT A;  4OPJ A;  3AA5 X;  5E26 A;  4FPB A;  3L2Q A;  4N41 A;  1R0A A;  2VCP A;  5JS2 A;  1RDW X; 
#chains in the Genus database with same CATH homology
 1KAX A;  3WT0 A;  4C1N I;  4CZL A;  2FF6 A;  2J4R A;  3BEX A;  4I6M A;  4GNI A;  3ZET B;  4BQZ A;  3PIP L;  4HTL A;  5ELZ A;  5AQP A;  4IZ9 A;  4A5B A;  4YOT A;  3OBY A;  1VQ4 N;  3CD6 N;  1TYQ A;  3MWP A;  1XQS C;  5EOY A;  3J7Z O;  4WFB L;  2E88 A;  2I7P A;  2QWL A;  4WF9 L;  1NGD A;  3NMU A;  2QWM A;  4B1V A;  5FPE A;  5JVH L;  5JMV A;  4FO0 A;  3DLL L;  3CJ7 A;  4JHD B;  2CH6 A;  5MLC Q;  2F7T A;  3M3Z A;  1SAZ A;  3KHY A;  2AA4 A;  4NO7 A;  5BRH A;  3ID8 A;  2FSN A;  3NVK A;  3CCL N;  2HF4 A;  2PFU A;  5F2R A;  1Z05 A;  3A5M C;  4PL8 A;  5BN8 A;  3VEW A;  4BRC A;  3QFU A;  5AQF A;  1YJN N;  3VGL A;  2NRZ A;  3KZB A;  3ATU A;  3LL3 A;  5AQY A;  5BPL A;  5C0Y A;  1W97 L;  3VTH A;  2P9U A;  2P9L A;  3EL2 A;  3DAW A;  4BRO A;  1HX1 A;  4KBO A;  1YHQ N;  3FGU A;  5BPM A;  3CCU N;  1Q86 O;  4EIA A;  4OPH A;  4WYB A;  5FPD A;  5KPR A;  3AAQ A;  3R6M A;  1NM1 A;  3CC7 N;  1NGF A;  3T7Z A;  4DB3 A;  1EQY A;  2IVO A;  4M7X A;  3C7N A;  4FWP A;  4BRD A;  2CGJ A;  1NGJ A;  5M1K A;  5C2F A;  2YHY A;  4WQ5 C;  5KPZ A;  2Q97 A;  4CZK A;  5HOO A;  3G4S N;  2CGL A;  4C23 A;  2F9T A;  1GLL O;  1BDG A;  3BP8 A;  2FF3 B;  5GIO A;  1ZXO A;  3WQT A;  2HBJ A;  4JKC A;  5JLH A;  1K8A O;  4K25 A;  4IWV A;  5BR9 A;  1LCU A;  4IJA A;  1U2V A;  1G99 A;  3ULE A;  1YF5 L;  5DM6 L;  2JWL A;  4YOY A;  4JD2 B;  4A2A A;  1VQ8 N;  1NJI O;  3E9L A;  4YDU C;  1NMD A;  1U6Z A;  1ZBS A;  3CJB A;  3QFP A;  4BR0 A;  4CZJ A;  2YI1 A;  5M1F A;  1MWM A;  4FOE A;  3FZL A;  4H5V A;  1JJ2 M;  1GLB G;  1NGH A;  5JLF A;  2QA4 N;  3O08 A;  4K43 A;  3B8A X;  2A42 A;  2ZJQ L;  3ATV A;  4WQ4 C;  3AGK A;  3BF3 A;  4MDB A;  3VEZ A;  1GLF O;  2ASM A;  3VTI A;  4O8K A;  3O9U A;  3LDP A;  3ZEU A;  4BRA A;  4CD3 A;  5FPM A;  4FWN A;  3CQY A;  2BTF A;  3CC4 N;  1DT9 A;  4RCH A;  2BUP A;  2YCH A;  5TKY A;  3UKU A;  2P9I A;  3GG4 A;  5C15 A;  4EHT A;  3P38 A;  1NGI A;  4LC9 B;  3VES A;  2WBN A;  3F9M A;  3P31 A;  4BY9 C;  1T6C A;  1DKG D;  2CGK A;  1HKG A;  4CZM A;  4WFN L;  1NGE A;  1W2B M;  1Z6R A;  4BR4 A;  1M90 O;  1VQ7 N;  1QQN A;  1VQL N;  3CC2 N;  4JKB A;  4RTF D;  5BRE A;  4FOI A;  4A5A A;  1JCE A;  1S22 A;  2QM1 A;  3EE9 A;  4JKA A;  3KK7 A;  2OTJ N;  2HST A;  3VF2 A;  3AAR A;  1V4S A;  3C0B A;  3CI5 A;  3O9S A;  3WXI A;  3A0I X;  4MLE A;  5AQW A;  3MN7 A;  3HRG A;  4AM7 A;  4GV6 A;  2CH5 A;  3GDQ A;  5AQH A;  3VGK A;  4E1J A;  2P9S B;  3MX5 A;  1J6Z A;  2HBM A;  1K73 O;  4K42 A;  4DQ8 A;  2JWK A;  3E66 A;  3K9J A;  4WFA L;  5AQX A;  1N8R O;  4KH5 A;  2NZT A;  3BUZ B;  1BO5 O;  4IO8 A;  5HL7 L;  1BWF O;  1K8K B;  3GBT A;  3VF4 A;  3HOT A;  4JKD A;  1R59 O;  3JS6 A;  4BC2 A;  1BA0 A;  3O9Q A;  1TUU A;  2HMP A;  4M63 C;  2ZF5 O;  1ATS A;  1BG3 A;  2ZWH A;  3NVM A;  5GAH P;  3WUH A;  1NGC A;  1BOT O;  1BU6 O;  4CZE A;  2QI2 A;  1NBW A;  5AZJ B;  3UKR A;  1XC3 A;  4H0Y B;  3VEY A;  3WEE B;  4U67 L;  1GLA G;  4PHT X;  5AQO A;  3D2E B;  3A5N C;  3ZET A;  3DWL A;  5AQK A;  2GEL A;  5ADX A;  2KHO A;  2E2P A;  3SJH A;  4PKG A;  5B8H A;  3F2K A;  3O5B A;  2A3Z A;  1ATN A;  1Q81 O;  2E1Z A;  3CCE N;  3KWG A;  2A40 A;  5KQ8 A;  2WFB A;  3VGM A;  3IMX A;  3KWI A;  3TPQ A;  3LDN A;  2YJF A;  1T3V A;  4JHD A;  5BPN A;  2GUP A;  3U9D A;  1YJW N;  2P9K B;  3QDK A;  3LM2 A;  2GEM A;  1V4T A;  4JK9 A;  5LY3 A;  5TKW A;  3AAP A;  3CPW M;  3G25 A;  4J8F A;  5BN9 A;  4U7B A;  5GAE P;  3EN9 A;  3I33 A;  3EKU A;  2HF3 A;  4JKG A;  4XH4 A;  1YAG A;  4FWS A;  2FLO A;  4IFE A;  3SAF A;  1YJ9 N;  4CZG A;  1IG8 A;  2V7Z A;  4FWR A;  3QML A;  2ZJP L;  4H0O A;  1DEJ A;  3VPZ A;  2E2O A;  4JKG B;  4IEE A;  2IIR A;  4BRG A;  3DXK B;  3H46 O;  4JN4 A;  4IEI A;  3TSU A;  1YXQ A;  2Q2R A;  3ID6 A;  1SZ2 A;  4H5T A;  2NRR A;  4F9O A;  4CZH A;  1LOT B;  1MDU B;  3L0Q A;  4B1U B;  4BRF A;  4L3Q A;  3TTF A;  1D4X A;  2GX9 A;  1EO1 A;  5GAD P;  3C6A A;  2P9N B;  2E8A A;  3L4I A;  3CPE A;  3HTV A;  2OTL N;  2Q1N A;  3H6E A;  2QWP A;  1KD1 O;  3MX2 A;  4MLH A;  4QS7 A;  2BH1 A;  1S72 N;  2DPN A;  3CCM N;  2GWK A;  5C2D A;  4MDA A;  3CJ9 A;  1C0F A;  4NLC A;  3D6R A;  3GL1 A;  5EXW A;  4IOC L;  1IJJ A;  1QQM A;  5CE3 A;  3E1Y A;  1SS6 A;  3BF1 A;  1X3M A;  2P9P B;  1X9J A;  4JD2 A;  2PBD A;  3HSC A;  4YOU A;  2IVP A;  4OO1 J;  3E9P A;  2H3G X;  2UYT A;  1C0G A;  3FZH A;  3O1W A;  1TUY A;  3RVC A;  3M6G A;  3MWT A;  1OVY A;  2W41 A;  3RSE B;  5AQN A;  5AQZ A;  1OKJ A;  3C6H A;  3MMV A;  3D2F B;  4YOW A;  4FWL A;  4BR5 A;  1JCG A;  3CQX A;  1YUW A;  4IOX A;  3TU5 A;  5AQU A;  5GIP A;  2VYP A;  2E1Y A;  4YOR A;  4PKH A;  2QXL A;  1KAY A;  1MWK A;  1VQP N;  1BUP A;  4BG8 A;  4BRM A;  3W0L A;  4FL9 A;  3O1B A;  5AZI B;  3VF6 A;  2PAV A;  4IXC A;  3D7E O;  1QVF M;  1E4F T;  3H45 C;  3M5R A;  2NRT A;  4BRE A;  4BQL A;  1QZ6 A;  3SK3 A;  1KXP A;  5EY4 A;  3TTD A;  1VQ6 N;  2HBL A;  3GE1 A;  3WQU A;  3FFK B;  1NLV A;  4H0P A;  4ISF A;  3O9T A;  3SBG A;  4EAH D;  2ITM A;  4C1N K;  3K9K A;  2D0O A;  2P9S A;  1Q82 O;  3ENB A;  5AQG A;  4QS8 A;  4WQ5 A;  3IDH A;  2Q31 A;  4EHU A;  4PL7 A;  3Q7B A;  1K9M O;  1HLU A;  1K8K A;  4KH6 A;  3M1F A;  2WC9 A;  3A5L C;  4JK8 A;  5AR0 A;  3PLA A;  1NGB A;  5EVZ A;  3FZF A;  3MCA B;  3VEX A;  4H0V B;  3TSP A;  3MK6 A;  5AQT A;  1KQS M;  2NNW A;  4G9Z A;  3EKS A;  5AZJ A;  1VQN N;  4B1Y B;  4FWO A;  3WEE A;  2QW9 A;  3UE5 A;  5CHI A;  3D2E A;  1T6D A;  4ILH A;  4OPA A;  4BC4 A;  3P4I A;  3MDQ A;  4YDU A;  2RHK A;  1VQ5 N;  4R79 A;  4BRL A;  4CBU A;  3WXK A;  4A62 A;  3ENH A;  2A41 A;  4CZF A;  2NRH A;  3CJC A;  3L4Q A;  5KQD A;  3WXJ A;  1SQK A;  4H0X B;  2KLA A;  4BG9 A;  4BRH A;  1JCF A;  3EE8 A;  1NGG A;  3EO3 A;  3I8B A;  4GY2 B;  4ILJ A;  3PIO L;  4QS9 A;  4WQ4 A;  3I56 N;  1RGI A;  1HUX A;  2FSJ A;  5F0X A;  2P9K A;  2FXU A;  4FWM A;  5AQS A;  3CCR N;  4JAX A;  4BRQ A;  4WCE L;  4IOA L;  5LJW A;  3DXM B;  3U9Z A;  3WXL A;  3ZX3 A;  2YX6 A;  1WUA A;  2Q0R A;  4FPA A;  2E20 A;  5EX5 A;  2HBK A;  3H3O B;  3HOS A;  1HKB A;  2VGM A;  2E2Q A;  3CER A;  5AQI A;  1GLJ O;  3DXK A;  1NWK A;  4M7Y A;  4BR2 A;  3U4L A;  3Q7C A;  1VQ9 N;  4IO9 L;  5M1N A;  4BVP A;  4BR7 A;  2HOE A;  3OBW A;  5C10 A;  1YIT N;  2ASP A;  3LDL A;  2A6A A;  2IVN A;  1GLD G;  4H5N A;  3VMF B;  2D0P A;  4CBX A;  4I6M B;  3CCS N;  3H3N O;  4XH1 A;  3E9O A;  3J8A A;  5M1P A;  3O6W A;  2Q36 A;  2P9N A;  1TYQ B;  4ISG A;  4AM6 A;  4BVO A;  5BRD A;  3CCV N;  5I9E B;  4AF1 A;  2D1K A;  1E4G T;  2E2N A;  3CXC M;  3CJA A;  3MN5 A;  3EZW A;  5AQL A;  3T69 A;  3O80 A;  3R8E A;  2D4W A;  3SLC A;  4BR9 A;  5H1S Q;  3VEV A;  3OA9 A;  1VQO N;  2P9P A;  5FPN A;  4DKW A;  1YI2 N;  1RFQ A;  4HWI A;  3I55 N;  3VET A;  3LM9 A;  5BRF A;  3SMP A;  4BRP A;  2YJE A;  4B9Q A;  1QHA A;  2P9U B;  3FZK A;  1XUP O;  2P9L B;  2QWQ A;  3QIC A;  4H0T B;  4PKI A;  4BGB A;  2EWS A;  3CET A;  3RSE A;  3VEO A;  4MO4 A;  3HI0 A;  5F1X A;  1ZC6 A;  1MA9 B;  4ILG B;  2QWN A;  3D2F A;  3VOV A;  2AP1 A;  3KVG A;  4NLB A;  4CBW A;  3S41 A;  3N4P A;  3QBW A;  2NRV A;  3C7N B;  3O8M A;  1GLE G;  3L6Q A;  3N4Q A;  4H03 B;  2WUS A;  2GWJ A;  4BRN A;  5DM7 L;  5AFU H;  4GV9 A;  1VQM N;  4CD1 A;  1HJO A;  3JXU A;  3R1X A;  3QB0 A;  5KPT A;  1O13 A;  5AQR A;  5AZI A;  1HPM A;  3SAH A;  5GAG P;  1P90 A;  4BC3 A;  5AFU A;  1ATR A;  2FSK A;  2OAN A;  1X3N A;  2V51 B;  3ZX0 A;  4BC5 A;  4XH5 A;  4DHY A;  5JIC A;  3G6E N;  1HKC A;  1U2V B;  2NRX A;  1VQK N;  3ULE B;  2Q0U A;  3WXM B;  4IJN A;  3LDQ A;  3FZM A;  4JKH A;  4BRI A;  4NB4 A;  4XEI A;  3O4W A;  2F9W A;  4JEP A;  4GVE A;  3LDO A;  4CJ7 A;  3O9R A;  2QEX N;  4FWQ A;  4UY8 O;  2V7Y A;  2ASO A;  1BA1 A;  1Y64 A;  3IUC A;  4FSV A;  2ZGZ A;  3GOI A;  4H5W A;  3ENO A;  3U8X A;  4BGA A;  1H1V A;  5M1O A;  2QTD A;  3CMA N;  3DJC A;  3R3L A;  4FWK A;  4Y0W A;  5M1Q A;  3A8Y A;  3OHR A;  4JKE A;  1P8Z A;  2W40 A;  1QZ5 A;  4YOX A;  5AQM A;  3UB5 A;  4YOV A;  3VER A;  5AQQ A;  3OW2 M;  3MN9 A;  4GV3 A;  1WOQ A;  2YHW A;  4A61 A;  2NLX A;  3ZEU B;  4CI6 A;  2QWO A;  1ESV A;  3G71 N;  3UKU B;  3FR0 A;  2P9I B;  3CCQ N;  4A57 A;  4JK7 A;  3SAG A;  5C12 A;  1ILY A;  2KKZ A;  4FVU A;  3CF5 L;  5AQV A;  3QBX A;  3SMS A;  4B1Z A;  3CCJ N;  1QQO A;  3HM8 A;  2VGN A;  5LJV A;  3R9P A;  1Q7Y O;  2ZGY A;  1NGA A;  5GIN A;  4MO5 A;  1S3X A;  1QVG M;  4Z94 A;  4KH4 A;  2RE2 A;  1T44 A;  5E84 A;  1KC8 O;  4H5R A;  3AGR A;  3CJ1 A;  4K41 A;  5JVG L;  1M1K O;  4RWT A;  1DGK N;  3HZ6 A;  2V52 B;  3MN6 A;  4JKF A;  3CHW A;  5CR4 A;  2ZJR L;  4IDH A;  1YVN A;  5AQJ A;  3FLC O;  4ISE A;  3DXM A;  4O8U A;  1KAZ A;  3FE1 A;  3H1Q A;  4A2B A;  4A59 A;  1YIJ N;  3CME N;  4JNE A;  3IKM A;  2NRW A;  1CZA N;  2A5X A;  3CIP A;  4EFH A;  3C65 A;  3ZYY X;  1VAZ A;  3TSQ A;  1Q18 A;  3AY9 A;  3VEN A;  4O5F A;  3F5T A;  5ADX H;  3W3D A;  4BRK A;  3A5O C;  3P39 A;  1RDU A;  3HBT A;  4CZI A;  2YHX A;  2QWR A;  3TTC A;  4DCH A;  1GLC G;  3H1V X;  3MCP A;  2GTD A;  3SBT A;  4B1X B;  5E26 A;  4FPB A;  2VWB A;  4B1W B;  3IFR A;  2VCP A;  3ZX2 A;  3UKR B;  1RDW X;  2I7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...