4BRAA

Legionella pneumophila ntpdase1 crystal form ii, closed, mg amppnp complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
358
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 114
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4braA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4braA02
5BPNA 1NGJA 3UB5A 1MWKA 4B1WB 3RSEA 2A41A 3VF2A 3UKUA 2VCPA 3D2EB 3M3ZA 4PKGA 1ZBSA 4H0XB 5E26A 4BRGA 3ATUA 1NGIA 3L0QA 5CE3A 1TUUA 2E1ZA 4FPAA 2QM1A 3DXKB 3IUCA 1EQYA 5AQYA 3H1VX 4ISFA 3UKRA 1DEJA 1H1VA 2IVNA 3DWLA 4MO5A 4BC4A 3ZX3A 4BQZA 3VESA 4FWPA 1QZ5A 2V51B 3A8YA 2CGKA 4RCHA 4BGAA 3O1BA 3C7NA 4DHYA 4DQ8A 3A5MC 1BU6O 2P9IA 2Q97A 3H3NO 2QW9A 4B1ZA 4BQLA 4H03B 1TYQA 4EHTA 4I6MA 3ID8A 3WEEA 2A5XA 3GE1A 3HBTA 4CI6A 5FPNA 2D0OA 3QICA 2Q36A 3GOIA 1GLLO 2FXUA 2V7ZA 3MN6A 2E1YA 1IG8A 3O1WA 5FPEA 1HLUA 5BPLA 4H0OA 2P9PB 3UE5A 3H3OB 3BF3A 3HSCA 3O8MA 3VERA 5AQFA 3CIPA 4JHDB 4BREA 3ATVA 2P9SB 2DPNA 3QDKA 3U9ZA 2J4RA 3QFUA 4CZEA 4ISEA 3MN5A 3HI0A 4BROA 2QWNA 5AZJB 3M6GA 4H5NA 3SMPA 3WXLA 4BGBA 4E1JA 4YDUA 2ZGZA 3BF1A 4CBUA 2Q31A 3FGUA 3DJCA 3G25A 2IIRA 3LL3A 3LDLA 3HM8A 4CZKA 1DGKN 5AQGA 2FLOA 3D2EA 4H0VB 3GDQA 4H0PA 5F1XA 3SK3A 4BC5A 4FPBA 1NGEA 3VEZA 4BRFA 3DXKA 3I8BA 2VWBA 1IJJA 4CZMA 3I33A 3KVGA 4WQ4A 4IO8A 1J6ZA 4Z94A 1ATSA 5AQKA 3VOVA 4C23A 3ZEUB 3ZX2A 3CJ1A 2PBDA 2V52B 3EO3A 4O5FA 4RTFD 3FZKA 3VF6A 2I7PA 4BRQA 1Q18A 3WXJA 4BG9A 1KAZA 3CJ7A 4IJNA 2P9NB 1BUPA 1YAGA 4XH1A 4O8KA 5AQLA 3S41A 2HOEA 1RFQA 1T6CA 4BR4A 2P9KB 1Y64A 5AR0A 3EKUA 2A40A 3KHYA 3O80A 2E2QA 2BTFA 2P9PA 3GBTA 3ZETB 3VEWA 4K25A 1C0FA 2E8AA 3GL1A 2FF6A 4IZ9A 4XH4A 2ZF5O 2FSKA 2Q0UA 5ELZA 3A0IX 3MCPA 4JHDA 1S22A 2P9SA 4XH5A 3QFPA 1Z6RA 2HMPA 2QWOA 2UYTA 4BR0A 5FPMA 1QQNA 2F9TA 2D0PA 1KAYA 3CJAA 4K41A 5EOYA 5AZJA 3D2FB 1DKGD 5JLFA 2ITMA 4JAXA 5BRHA 4FSVA 5TKYA 4CD1A 5I9EB 1ESVA 5ADXH 1NGCA 4FL9A 3SJHA 1BWFO 1RGIA 4FOEA 1U6ZA 5KPTA 1XUPO 3MDQA 3WQTA 3SLCA 3O4WA 4B1YB 4EHUA 3LM2A 1NMDA 2AP1A 3ULEB 3IMXA 3ZX0A 3IDHA 5KPZA 4FWNA 1CZAN 2YJEA 4BR5A 2IVPA 4RWTA 2FF3B 3H46O 3FFKB 2Q0RA 3LDOA 4IJAA 5AFUH 3TU5A 2I7NA 4A2BA 4BRLA 3ZEUA 4BRHA 2E2NA 4BRCA 4FWSA 1NBWA 5AQTA 4XEIA 1KAXA 4ISGA 4AM7A 3U9DA 4B9QA 2W40A 3HZ6A 1BO5O 2P9NA 3CJ9A 3LM9A 3W0LA 1K8KA 2P9KA 3VENA 4JNEA 3VGMA 2FSNA 4H0TB 1KXPA 4B1XB 1V4SA 4DB3A 4H5VA 4GNIA 3U4LA 1HX1A 4FWKA 3ENOA 4CZFA 3A5NC 3FZLA 5JICA 2VYPA 2QXLA 4KBOA 5AQIA 1V4TA 2YHXA 3MN7A 4DCHA 3VEXA 2BUPA 1S3XA 4CBXA 4QS8A 3WT0A 2E2PA 5AFUA 4BC2A 1NGDA 4FOIA 4H5WA 2D4WA 3D2FA 3P4IA 4HTLA 4BR7A 4BR2A 2EWSA 4BG8A 5F2RA 4FO0A 3CETA 3EKSA 4B1UB 4AM6A 2YCHA 2E2OA 3CJBA 5AQMA 1GLFO 4MLEA 1E4FT 3QB0A 2NLXA 3ULEA 2ZGYA 2D1KA 3DXMB 1BA1A 1LCUA 1JCFA 1YXQA 4QS7A 3UKRB 1GLDG 4NO7A 5AQZA 4BRPA 1NGAA 1QQOA 2E88A 4FWLA 3ENHA 4JN4A 3VPZA 4EIAA 1LOTB 3R8EA 5AQPA 3O08A 1YUWA 4BRNA 3LDQA 5JLHA 2HF3A 1BG3A 5LJVA 5AQVA 5JMVA 3CQYA 4PL7A 4MO4A 4M7XA 3L4IA 4H5RA 3CERA 4JD2B 1XC3A 3VGKA 3BP8A 3H6EA 3CI5A 4WQ5C 2GWJA 3VETA 3OHRA 2PAVA 4CZHA 2GUPA 1QHAA 4WYBA 1SQKA 5AQQA 1WOQA 1YVNA 2P9LB 3TPQA 2NZTA 1T6DA 2A42A 3WXIA 1R59O 1HKCA 4FWOA 5AZIB 1E4GT 2IVOA 2A6AA 2Q1NA 1WUAA 4MLHA 3R9PA 3AY9A 3F9MA 2KHOA 4BC3A 2HF4A 2ZWHA 4LC9B 3CQXA 1MDUB 1T44A 2AA4A 1X9JA 5KPRA 1ZXOA 4FWRA 4CZGA 2P9UB 2ASOA 4M63C 3O5BA 3MN9A 3DAWA 4CZLA 1JCEA 5F0XA 1U2VB 2ASPA 3QBXA 1ATRA 1NGBA 4QS9A 3FZHA 2GWKA 5BRDA 2CGJA 3VF4A 1MA9B 4H0YB 4NB4A 4BRAA 5AQRA 3DXMA 5BR9A 4BRDA 3CHWA 2YI1A 4HWIA 3VEVA 1OKJA 1X3MA 2QWLA 3O6WA 2A3ZA 3J8AA 5ADXA 2W41A 5AQXA 3GG4A 4CJ7A 1HJOA 1P8ZA 4F9OA 1NWKA 4CBWA 2GTDA 5BPMA 3EL2A 3QMLA 2CH6A 4IXCA 3D7EO 3LDNA 3H1QA 1QQMA 2Q2RA 3ZETA 1BA0A 1GLJO 5AQWA 1XQSC 4JD2A 4CZJA 4FWMA 3SMSA 4Y0WA 3C0BA 3U8XA 3HTVA 2YHYA 1HKBA 5KQDA 5AQNA 2P9LA 3B8AX 1NLVA 1X3NA 2GEMA 1QZ6A 5AQUA 3IFRA 5EY4A 3KZBA 5AZIA 4A2AA 4BVPA 5BN9A 2YHWA 4L3QA 3EN9A 4CZIA 3EZWA 1C0GA 1HKGA 3MMVA 1TUYA 4IWVA 1HPMA 3RSEB 1GLBG 4K43A 3UKUB 4PKIA 4BRIA 5EX5A 2F9WA 3H45C 1ATNA 4GY2B 4K42A 2P9UA 4PKHA 4BR9A 5BN8A 3WQUA 4A62A 4CD3A 5B8HA 3A5OC 4J8FA 3BEXA 3W3DA 1ZC6A 3VEYA 4BRMA 4EAHD 1D4XA 2QWMA 1JCGA 3BUZB 1SZ2A 3VEOA 4WQ5A 1U2VA 5AQSA 3AAPA 2QWRA 3C7NB 3A5LC 5EVZA 3L6QA 3AAQA 3CJCA 3JXUA 2H3GX 5AQJA 2P9IB 2QWQA 5AQOA 1GLEG 3FLCO 3JS6A 4YDUC 1SAZA 5EXWA 2FSJA 3LDPA 3VGLA 4B1VA 2CH5A 1Z05A 5BRFA 1TYQB 4I6MB 3FZFA 1RDWX 3AARA 3WEEB 2GELA 4A61A 2CGLA 5AQHA 1G99A 5BREA 1NGFA 2OANA 3QBWA 2YJFA 1BDGA 3R6MA 4M7YA 5FPDA 2E20A 1NM1A 5KQ8A 4BVOA 1K8KB 5E84A 3FR0A 4H5TA 4BRKA 2V7YA 4WQ4C 1GLAG 1NGGA 2NRHA 1BOTO 3M1FA 2QWPA 3WUHA 3WXKA 1MWMA 2WUSA 4FWQA 1GLCG 3MK6A 1NGHA 4PL8A 4EFHA 3FZMA 5LJWA 2ASMA 5LY3A 3FE1A 1HUXA
chains in the Genus database with same CATH superfamily
4KFBA 1VQ8N 1WSJA 2A41A 2VCPA 3HXMA 4KKOA 1ZBHA 4CFCA 4JKHA 4DV3K 2DTUA 1JLFA 1TUUA 2E1ZA 5FLXO 3DLRA 1WNSA 5AQYA 3DLEA 3SCXA 3ZSRA 4KV8A 3OS1A 4DUZK 3T1YK 4MO5A 3A8YA 4RCHA 3O1BA 3C7NA 3A5MC 2VQFK 1BU6O 4A59A 1VQON 2P9IA 2G8WA 1JJ2M 3IG1A 2QW9A 1VRUA 1GOCA 4LFAK 4BQLA 2UU9K 4BACA 2A5XA 3GE1A 5FPNA 3RMAA 3J7AP 1YF5L 2V7ZA 3CCMN 4LH5A 1IG8A 1L3SA 3NF8A 3O1WA 5C42A 4JI0K 1MU2A 2NRXA 3KWGA 3LZJA 4KTQA 3SBGA 3UE5A 3HSCA 5M1NA 4OKEA 5LMUK 4QOZB 1VQ6N 4YHHK 4K0KK 3AVKA 1YIJN 4BREA 1YVUA 3QDKA 3U9ZA 3LPUA 2HNDA 3QEPA 4CVNE 4ISEA 2DFHA 2UXDK 5AZJB 4YY3K 3DLBA 1X9MA 4E1JA 1KLNA 3SQ2A 4YDUA 2ZGZA 3BF1A 3AGKA 3CM5A 3DJCA 4O0JA 4DS5A 3LDLA 4CJ3A 4IDHA 1HRHA 1WBBA 1X1PA 5AQGA 2E6LA 3D2EA 4CF1A 1J54A 2QA4N 2RHKA 4IFYA 1LV5A 4JI6K 1NGEA 4CF8A 3VQAA 2BDPA 1RT2A 4CZMA 4CESA 1HQUA 1ATSA 1TK0A 4QAGA 4RW6A 3OYMA 4KHYA 4KHQA 2YNGA 5AQKA 3AVMA 3S3NA 3MXJA 1BI4B 3ZX2A 2V52B 3EO3A 4RTFD 2I7PA 1Q18A 3MXMA 1KAZA 5HRPA 2P9NB 1BUPA 3K57A 1YAGA 4XH1A 4O8KA 2KKZA 4FJ5A 4OJRA 1QVFM 4NCAA 4FLUA 3QETA 1N32K 2P9KB 2NNWA 1Y64A 1YTUA 4B8AB 4M3TA 4KTZA 1S1XA 3O80A 3DRSA 4W5QA 2E2QA 3T7ZA 4KRFA 2DFFA 3QEIA 1VSKA 2FF6A 4AHUA 4O55A 2FSKA 3ZYYX 3MCPA 2HBKA 4Z4HA 4RW4A 5FRNA 4Y1CA 2HMPA 2F9TA 3N4PA 1KAYA 4JKDA 3KTQA 4AF1A 1DKGD 5JLFA 4RG8A 1XI1A 3IAYA 4DLEA 5TKYA 4B9UA 1ESVA 3SNNA 3ASMA 3CCVN 3H08A 4LF8K 4DV7K 1RGIA 1U6ZA 2VG6A 3ZSYA 3O3GA 3SLCA 3CCEN 4IBNA 2HBMA 4DTSA 3I56N 4LF4K 3V1OA 4WCEL 4DTUA 1SS6A 5CZ1A 3TABA 1CLQA 1SL1A 2IDOA 3SPZA 1L3TA 3H46O 3LDOA 4IJAA 4ZHRA 2I7NA 4IG3A 2Z1GA 4BRCA 4CF0A 2RN2A 1KAXA 4ISGA 3S9HA 3U9DA 2EX3A 3HZ6A 3CJ9A 3W0LA 3RMDA 1KFSA 5JVHL 1C1BA 5GAGP 2FSNA 4H0TB 4DR1K 4GNIA 3ZT3A 2G8VA 2Z1HA 4CZFA 2QXLA 2Q3SA 3DM2A 3CF5L 5AQIA 1V4TA 4OPKA 3VTHA 4DCHA 3VEXA 1WAJA 3KK2A 1S3XA 4QS8A 4JRPA 4K8ZA 3WT0A 4BC2A 5HRNA 4FM1A 3OYKA 3OA9A 3OBWA 4DG1A 4BR2A 1EX4A 3CC2N 4X66K 3C6HA 3HL8A 5HLFA 4ELVA 1KRPA 3QINA 3CETA 3EKSA 4B1UB 3OY9A 3CD6N 2YCHA 4Z4GA 4MLEA 4JKGB 2D1KA 3OYFA 4GV3A 1VRTA 2NUBA 2P1JA 4YOUA 2IOCA 1QQOA 3R8EA 3TAMA 5FDLA 1NMNA 4BRNA 4OKJA 3LALA 5JLHA 2HHSA 1BG3A 3CQYA 4DS4A 5KRSA 3MX5A 2F96A 4YOXA 4NLCA 3VGKA 4I2QA 3KLFA 3CI5A 3SBTA 3VA0A 4WQ5C 5DM7L 3AA5X 3RWUA 3THWA 4DSIA 1OH8A 4CJTA 4Q5VA 4FWOA 2Q1NA 3EZ5A 1RBTA 4LSNA 4RW7A 2KHOA 4FYDA 1UOCA 4BC3A 1LAVA 1WSEA 4LC9B 4DR7K 1VQ4N 4J2EA 1X9JA 5KPRA 1ZXOA 3M5RA 3O5BA 2ZJPL 4W5TA 1VSDA 2KW4A 1QS4A 1XMQK 2B6AA 4CHOA 4O8UA 2W42A 4QS9A 1TGOA 5BRDA 3FZHA 1WLJA 2CGJA 2YX6A 3SJJA 3PO5A 5AQRA 1QE1A 3IS9A 4BRDA 3VQ7A 3L2VA 1U4BA 3A2FA 3AO1A 3PX6A 3CHWA 3VEVA 3ZLJA 1X3MA 1U45A 2A3ZA 3LZIA 4CF9A 3DLGA 4ELUA 5IWAK 1BQNA 3J8AA 3V81A 4JKCA 2E5LK 4CBWA 4KPYA 1QQCA 2D0AA 2E6MA 3AVAA 1VSIA 3H1QA 2NRTA 3ZT4A 3ZETA 1BA0A 1GLJO 1RNHA 1XQSC 1W97L 4CZJA 4ICLA 3SMSA 4Y0WA 3U8XA 4U7BA 3AA2A 1HNZK 3K59A 1HKBA 4DV5K 3KKRA 4KI4A 1X3NA 2GEMA 1QZ6A 4AHCA 1SKWA 4CJ4A 2GUIA 5BN9A 3EZWA 1C0GA 1NJXA 4M41A 2O8BA 3O9RA 3P83D 1HPMA 4WFNL 1GLBG 3UKUB 3MWPA 4PKIA 3OJUA 2HNYA 3KLIA 4OO1J 3EE9A 1ATNA 4GY2B 2P9UA 3WQUA 4A62A 3K9JA 5B8HA 3P31A 3PO4A 3ID6A 4DLGA 4DSKA 4J8FA 4DTPA 3CXCM 3KK1A 3W3DA 1ZC6A 4EAHD 3O9SA 2WFBA 4CIFA 4FLXA 1JLCA 4RW9A 1JCGA 1S1TA 1SZ2A 1W0HA 5JS2A 4RW8A 3AAPA 3LDSA 3CPWM 4OGCA 2QWRA 3L6QA 3MCAB 3JXUA 5AQJA 4DV4K 4I2PA 4N56A 2X6NA 1NK7A 1NK4A 1Z05A 1OVQA 4FM2A 1ASWA 3AO2A 3WEEB 4A5AA 1YJ9N 2GELA 3LWMA 2XY5A 1SL0A 1NK9A 3TANA 4A61A 4IEEA 1CZ9A 3C6AA 5AQHA 4OPHA 4X64K 5KQ8A 1BDGA 1NJIO 3E1YA 1YI2N 4DTJA 3TAPA 4C8LA 3FR0A 1NK5A 1KVCA 4Y1DA 4E7LA 4YOVA 4FLVA 3V9UA 3TAEA 1TK8A 4EP5A 3N4QA 2NRHA 3OS2A 2X78A 3WUHA 4JV5K 1MWMA 1GLCG 3MK6A 3K5MA 4Q0BA 1Q82O 2ASMA 3P1GA 3THXA 4FXDA 4TSXA 2ZE2A 1NGJA 3UB5A 1IKXA 2Y1IA 4PKGA 1ZBSA 5E26A 4BRGA 3VQ9A 3ATUA 5E41A 1VSMA 4FLYA 1NG9A 3IUCA 3SQ4A 3EEQA 3CFRA 1P90A 4CJKA 2HW3A 1NJYA 4ISFA 4B08A 1DEJA 4BC4A 3VESA 1C1CA 1QZ5A 3I55N 2CGKA 3O9UA 2ZM6K 4IOXA 5J2QA 4E7IA 1RDAA 1XHZA 3O3HA 2KFZA 1J53A 3CYMA 4NCGA 3ZSOA 3ID8A 4CI6A 3AVBA 3QICA 1XMOK 3GOIA 1GLLO 2PY5A 4JI8K 3MN6A 2E1YA 5BPLA 4H0OA 2P9PB 3U3YA 3P38A 2P5GA 3O8MA 2YHBA 3VERA 3CIPA 2O8CA 1Q8IA 3ATVA 3SPYA 2P9SB 4FK0A 3R1XA 4FJKA 3QFUA 4CZEA 3MN5A 3HI0A 3OYHA 2QWNA 3M6GA 4H5NA 3THYB 4BGBA 2IC3A 4CECA 4DV0K 4DTMA 2Q31A 1TKTA 3FGUA 3G25A 4CZKA 4DF4A 1N33K 1DGKN 1O1WA 2FLOA 3OS0A 3MWTA 3SK3A 3ZSWA 4J2DA 3VEZA 3DXKA 3I8BA 2VG7A 3MXIA 2PYJA 3ZT0A 1IJJA 1VSHA 2FBVA 1TKXA 1ZBLA 4E1MA 4CFDA 2VGMA 1N8RO 2A1SA 2ATQA 2KLAA 4HUGA 4KHSA 3L8BA 3ZEUB 1SUQA 4DFPA 4BRQA 4BG9A 1A5VA 2YNHA 5AQLA 1S6QA 5BR8K 5J2PA 1HYSA 4BWMA 4BDPA 2XO7A 2OA8A 3ZETB 4O4GA 4FLWA 3AVCA 1C0FA 2E8AA 3GL1A 5C2FA 5ELZA 3A0IX 4FJGA 4JHDA 1RILA 4GMJB 2QWOA 2UYTA 3CG7A 1BL3A 2D0PA 2GV9A 3E01A 1Y97A 3VA3A 1HMVA 5DMRA 3CJAA 4DSJA 4KAZA 4KHNA 4EZ9A 4DU4A 1B9DA 3RVCA 1FJGK 5ADXH 1BWFO 3T69A 1XUPO 3NF6A 3MDQA 3OYGA 5KGWA 3DRRA 4CEZA 3TSQA 3QEVA 3LP0A 1NMDA 1JXEA 4JKEA 4LY7A 5HOOA 3SAFA 1ASVA 3ZX0A 5CZ2A 1U48A 3RRHA 4FWNA 1DTQA 4FJLA 3VQQA 1CZAN 2YJEA 3DI6A 3M8SA 1J9AA 4DV6K 3HT3A 2FF3B 5AFUH 2Q0RA 3TU5A 2O8FA 4BRLA 4BRHA 4MQ3A 4WF9L 1X9WA 1DT9A 1NKEA 4CJLA 2W40A 3QESA 1K8KA 5HL7L 2DY4A 4UQGA 3SI6A 3SV3A 2PYLA 3VENA 4JNEA 3VGMA 4FJ9A 1KXPA 4B1XB 1V4SA 4DB3A 1HR0K 4FJ7A 3ENOA 1J5EK 2NRZA 1RBSA 5C10A 3FZLA 5JICA 4DTXA 3MN7A 3LANA 3ITHA 2BUPA 4NYFA 5K14A 3AV9A 2FBTA 3CCSN 1NGDA 4CHNA 4Z0UA 2WTUA 3D2FA 3P4IA 4LF7K 2HMIA 5M1FA 3V9ZA 5LMNK 4PQUA 3P5JA 1XNQK 5F2RA 4B9NA 1REVA 3CJBA 5AQMA 1Q7YO 2O8EA 1GLFO 4AHTA 1E4FT 1EETA 3JSMA 4GV9A 3ULEA 3MEDA 1NK8A 1JCFA 1W2BM 4B3TK 2A1RA 4GKKK 2YKMA 5CR4A 3ENHA 3VPZA 4JI1K 5AQPA 3QIOA 3ZSZA 1HPZA 1JLAA 3LDQA 3V1RA 5AQVA 4HUEA 5JMVA 1C0UA 4E1NA 3TTCA 4OGEA 4M7XA 3NVKA 4H5RA 1QSLA 4CJWA 3HJFA 3G0ZA 3VETA 4CZHA 5AQQA 3DMJA 3QNOA 3NH0A 2A42A 3WXIA 3THVA 1VQLN 1HKCA 4F3OA 5AZIB 3O9QA 1HJRA 3NDKA 3VQ8A 3F9KA 4HCCA 2HF4A 2G8UA 3CQXA 4EZ6A 1CXUA 3V9SA 4YOYA 3HSTB 3M8RA 1YTAA 4W5RA 3T1AA 4FJ8A 3MN9A 5KTQA 1JL2A 4CZLA 1JCEA 1WSFA 3OBYA 1IBKK 3LP3A 4DSFA 1U2VB 3QBXA 1ATRA 3K5LA 2GWKA 3VF4A 1T03A 2G8FA 1MA9B 4CK2A 4H0YB 1RT5A 3DXMA 5BR9A 4AHRA 1IBLK 3T1HK 1KVAA 3CCUN 3OYNA 2QEXN 1IO2A 4KH6A 2IGIA 2YKNA 1S5JA 3QLHA 4JI7K 4DF8A 4IO9L 5AQXA 1XWLA 3GG4A 4CJ7A 1HJOA 1TAUA 1NWKA 5C12A 1CXQA 5BPMA 3EL2A 3QMLA 2CH6A 1M1KO 3D7EO 2WOMA 5M1QA 1K8AO 1EWRA 5GADP 5AQWA 4JD2A 2G8IA 1YT3A 3C0BA 3TR8A 1OH5A 1VK0A 3C94A 5SWMA 1RT6A 5AQNA 2P9LA 3B8AX 3B6OA 3C65A 1K9MO 3I8DA 5EY4A 4DQRA 1JLBA 3SYZA 4CZIA 3MMVA 4DQQA 4N5SA 1L3UA 4YNQA 4B8CA 4F3TA 2F9WA 3VQ6A 4K42A 3PIOL 2QXFA 4BR9A 1TKDA 3LPTA 4CD3A 3A5OC 4IFVA 3BEXA 2HB5A 1WSHA 3VEYA 4BRMA 4M42A 1D4XA 3BUZB 1SKSA 2YV0X 1D9FA 4BE1A 4M3ZA 3O3FA 2WONA 1RT7A 2RF2A 3C7NB 3TARA 3AVJA 2P9IB 4YOTA 3AA3A 4JK8A 4PHTX 4YDUC 3LP2A 3MX2A 3CC4N 2FSJA 4CGDA 3LDPA 4LFCK 1KC8O 4PA1A 1RDWX 3AARA 4M3XA 1RT4A 1IV0A 3HVRA 1BHLA 1G99A 1K73O 4M7YA 3R6MA 1J5OA 2RE2A 1NM1A 3IRXA 4OPAA 1K8KB 5E84A 1T7PA 4JYAK 3SUOA 1NOZA 3VMFB 1M90O 5TKWA 3PV8A 1S72N 1VQPN 3C6TA 2G8HA 4F4KA 4H8KA 2HHQA 2QWPA 3WXKA 2WUSA 3NH1A 3G10A 1Q9XA 3PIPL 4EFHA 1BCOA 3EE8A 3WNHA 4ID5A 4CEEA 3D45A 1WAFA 2QK9A 3NGIA 3QEWA 3NF9A 3ZSXA 4M3YA 5CYMA 4B1WB 3RSEA 3VF2A 4C1NK 4ZTFA 3D2EB 3M3ZA 2QI2A 3SV4A 4H0XB 4E7KA 1N6QA 4NYNA 1NGIA 4M45A 5IT9O 2KFNA 1EQYA 3OYEA 4N47A 2IVNA 3U3GA 1VQKN 3MEGA 3ZX3A 4BQZA 4FWPA 3SAGA 4CJVA 4GKJK 3TTDA 4CJ5A 3OYLA 4DHYA 4DQ8A 1T3VA 4CF2A 3SUQA 1S1UA 3RMCA 4OKKA 4IOCL 2O8DA 4PWDA 2ETJA 3LP1A 4YOWA 4H03B 1TYQA 4EHTA 4I6MA 5CYQA 4FLZA 3FFIA 2Q36A 1ZBIA 1NK6A 1A5WA 1HLUA 4OLBA 1RDCA 5EU7A 4LFBK 2BANA 3H3OB 3OYJA 2OPQA 4DFJA 3SAHA 3G71N 3SUNA 2J4RA 2HHXA 2YNFA 1U49A 1A5XA 3WXLA 2HHHK 2QTDA 4LH4A 4CBUA 2OCEA 3LWLA 3CCLN 4E19A 4ILJA 2IIRA 4E7JA 1B92A 4CHYA 4Z4IA 4FM0A 3GDQA 4H0PA 4NLBA 3DOLA 4BC5A 4FPBA 4ID1A 1IG9A 4DR4K 1VQ7N 4DQSA 2FBXA 3I33A 1NJWA 4XIUA 4WQ4A 4IG0A 1J6ZA 1EP4A 4Z94A 1HNVA 1Q86O 4H4OA 3VOVA 4C23A 3AVHA 2GX9A 3TAGA 3J81O 2P51A 4DUYK 4G9ZA 5M1KA 2XY8A 1RCHA 3WXJA 3BGRA 4CEOA 1FKOA 1RDUA 3S41A 1RFQA 4NXNK 4CHPA 1YHQN 1UAXA 3ZSVA 4AH9A 1TK5A 4F2SA 3F5TA 2JWKA 2A40A 3KHYA 4FJMA 1T8EA 3BZCA 4O5BA 3EYZA 4J2BA 3VEWA 3V9XA 4E7HA 1JLGA 5H1SQ 4IZ9A 3HO1A 4XH4A 1S22A 3PSFA 1Z6RA 5C24A 5FPMA 4B9SA 4Z4CA 4DV1K 4B3RK 4K41A 5AZJA 3UIQA 3BZKA 1VSFA 4JAXA 3ISNC 4FSVA 4AQYK 4X62K 3D0PA 1NGCA 4FL9A 3SJHA 5KI6A 1ZYQA 1WSGA 1NKBA 4CK1A 4B1YB 1RBVA 3LM2A 4KTWA 1D8YA 1T05A 4I7FA 2NRRA 1Z25A 3ALYA 4JKAA 3IDHA 5KPZA 5SZTA 4KH4A 3L2UA 4ELTA 3R3LA 3J7ZO 4JI5K 3L2WA 4RWTA 4A2BA 1BI4A 1U04A 2E2NA 4FWSA 1KD1O 1L5UA 4GVEA 5J2NA 1BISA 3KIOA 4B9QA 1BO5O 2P9NA 3NH2A 3NGZA 3DLLL 1NK0A 3QIPA 1ZBFA 1EKEA 3U6FA 3L3VA 4F2RA 4CE9A 3BY5A 2P9KA 4QCLA 4B3SK 4WE1A 3RR8A 1HX1A 1VQ9N 2B5JA 3T19A 4CERA 4FZZA 3THWB 3A5NC 2VYPA 4CGGA 2ZQBA 4JI3K 1FW6A 2HHVA 2XRIA 2F8TA 4CBXA 3NAEA 3WNFA 3LAMA 5AFUA 2E2PA 2W6LA 2D5RA 3TSUA 3O4QA 4H5WA 1YJWN 4A5BA 3HM9A 1TAQA 3DYAA 4BR7A 2EWSA 5HP1A 4JS4A 4BWJA 3PUFA 1KSPA 3KLGA 3SQ1A 4AHVA 3P39A 3NHGA 2OPRA 4C8MA 2YHAA 4A57A 2ZGYA 2VQEK 4B3MK 2OZMA 2OZSA 1LCUA 2KZZA 4NO7A 5AQZA 4DR2K 4BRPA 3CC7N 3RRGA 1FK9A 1QSSA 1N5YA 4C8OA 4CEAA 5GIPA 5HBMA 3OYIA 1YUWA 5C15A 2KTQA 1VSJA 2KQ2A 1S1VA 2HF3A 1UA0A 5LJVA 4FVMA 5A2QO 3SZ2A 1IKYA 4PL7A 1W9HA 3V6DA 3E9LA 3O9TA 2UUBK 4HTUA 1GOAA 4JRQA 4W5NA 3BP8A 3H6EA 4CJEA 4DMNA 3CMEN 1WN7A 1C0MA 3OHRA 2PAVA 4JK7A 2GUPA 1QHAA 3T3FA 1SQKA 3CCQN 1S1WA 1KTQA 2O4GA 3TPQA 1QVGM 4R79A 1R59O 3AO3A 1E4GT 2IVOA 2A6AA 1WUAA 4MLHA 3R9PA 4C1NI 3OYCA 3CQ8A 2LSNA 3F9MA 4CJSA 2O8BB 5GINA 2UXCK 1O13A 2ZWHA 3L3UA 1HNIA 1MDUB 4JEPA 4IDKA 1LWCA 2P9UB 4M63C 2F7TA 4E3SA 2HVIA 1VQMN 4IEIA 5F0XA 2QKBA 1EWQA 2WC9A 2ASPA 4B9LA 4JKGA 4ILHA 3PX4A 2PZSA 2W6KA 3E9OA 1YJNN 3S3MA 1WSIA 1F21A 1IBMK 1RTJA 4FJXA 4F9OA 1P8ZA 3PY8A 4DV2K 4CIEA 1UA1A 5D3GA 2GTDA 4IXCA 3NFAA 3LDNA 1QQMA 4LF6K 2Q2RA 3F2KA 1HNWK 1G15A 4U67L 2YNIA 4B9TA 1WBDA 3HTVA 2YHYA 3SQ0A 3OYDA 3O4NA 5KQDA 2G8KA 2GBZA 4DU1A 1QTMA 1KLMA 3KLHA 3C95A 3DOKA 5AQUA 2Z1IA 1LW0A 3IFRA 4A2AA 3THXB 1VQ5N 2YHWA 5JVGL 1R0AA 2HBLA 3NCIA 3RMBA 1TUYA 2UUCK 4K43A 4BY9C 5EX5A 4CGFA 1HQEA 3H45C 3KD5E 4PKHA 5BN8A 4CJQA 1RTHA 3TWHA 4JS5A 3OYAA 3V1QA 2QWMA 3TAQA 4WQ5A 1C0TA 4KI6A 1RTIA 5AQSA 1SKRA 5DM6L 1I94K 1FXXA 2RPIA 1GLEG 3FLCO 3JS6A 3KJVA 1I3AA 1QSYA 3E66A 4YORA 2UXBK 4B1VA 2CH5A 3OW2M 5BRFA 4DKWA 5HRRA 2XHBA 2D0BA 3AO4A 4O0IA 5BREA 1NGFA 2OANA 5FPDA 1JKHA 5AJ3K 2F4VK 1ASUA 3AGRA 4PY5A 1UWBA 4H5TA 2FC0A 1N34K 1I39A 4L8RB 4FJNA 3HPOA 3RR7A 2O8CB 2JGUA 4IKFA 1LW2A 4JI2K 3HVTA 3VQ5A 4DR5K 4WFAL 1RT1A 3AVLA 4CEDA 4PL8A 3Q7CA 3FZMA 5LJWA 5LY3A 1CZBA 3FE1A 3F73A 4CFBA 4HHTA 5BPNA 4KO0A 3BDPA 1MWKA 3ZT2A 3UKUA 4CHQA 2D0CA 2XY7A 3HOTA 3L0QA 5CE3A 4DR3K 3HPHA 4FPAA 2QM1A 3DXKB 4YFUA 4R5PA 3PLAA 3AVFA 4OVLA 3H1VX 1GOBA 3UKRA 3VQ4A 1H1VA 3DWLA 3ZCMA 2E4LA 3TAFA 4UY8O 2V51B 4NXMK 4BGAA 4DQIA 3DLKA 3V9WA 2P5OA 1OH7A 4CEBA 1FKPA 2Q97A 3NBPA 3TI0A 3H3NO 4B1ZA 4PUOA 4B3OA 3WEEA 4M3UA 3HBTA 2D0OA 2FXUA 3NGYA 1L3VA 1XC9A 3AVGA 4GW6A 5FPEA 2ZJRL 1N36K 3OYBA 3CCJN 2ITGA 3VQDA 4BDZA 3BF3A 1DLOA 3HP6A 5AQFA 3DLHA 4JHDB 2DPNA 3HP9A 3AVNA 4CJPA 3C6UA 4I9LA 2HHWA 4BROA 3SMPA 3L2RA 5CY4A 2OTLN 4KB1A 4CFAA 2R7YA 3ZSQA 1K6YA 4B9VA 3LL3A 3WNEA 3HM8A 4H0VB 2UUAK 4M3RA 5F1XA 3L4QA 1B9FA 4BRFA 1RDBA 2OTJN 2VWBA 3S3OA 4KHWA 3KVGA 2HSTA 3VTIA 1VHXA 4IO8A 4E0DA 4FLTA 3K2PA 4O44A 4MDBA 2O8FB 3CJ1A 2PBDA 2IS3A 3L2QA 1TV6A 3MECA 3VF6A 2NRVA 3FZKA 4O5FA 4W5OA 1HYVA 4DFMA 3CJ7A 3EY1A 4H4MA 4KREA 4IJNA 2OPSA 2HOEA 2JLEA 1EO1A 1T6CA 4BR4A 3G4SN 5HROA 1QHTA 4G1QA 3CFOA 5AR0A 3EKUA 4NCBA 2O4IA 1RBRA 4FVUA 2BTFA 1NJZA 2P9PA 3GBTA 3HOSA 3VQPA 3QERA 4K25A 2X6SA 4HUFA 1BIUA 2ZF5O 2Q0UA 4DTRA 4CHZA 2ZD1A 2P9SA 4XH5A 2VGNA 3QFPA 4BR0A 1YITN 1QQNA 4DSEA 3KWIA 5EOYA 3THYA 2HNZA 4DU3A 3D2FB 4Z4FA 1XNRK 4BE0A 2ITMA 5BRHA 4CD1A 5I9EB 2AJQA 3JYTA 5C25A 5KPTA 3AO5A 3CCRN 4FOEA 1RT3A 5HRSA 4N41A 1KVBA 2O8EB 3WQTA 4DTNA 4BDYA 3O4WA 4EHUA 5M1OA 4ILGB 1TL3A 2AP1A 3B6PA 1HNXK 3ULEB 2PFUA 3IMXA 4CCHA 1ILYA 4DWIA 1JLQA 1S9EA 4BR5A 2I5JA 2IVPA 3FFKB 3KD1E 3KKSA 3ZEUA 3NE6A 1D9DA 4IOAL 1NBWA 5AQTA 3K0SA 4XEIA 4LSLA 4AM7A 4C8NA 3LM9A 4IFEA 4CW7B 4KHPK 5C0YA 1BQMA 4CIGA 3I0RA 3OVNA 4H5VA 2EHGA 4B9MA 1ZBUA 3U4LA 4CGHA 4FWKA 5C2DA 3ENBA 4M3WA 3CMAN 1Q81O 4KBOA 2YHXA 4OPJA 2VG5A 3K58A 4EP4A 5CHIA 4FW2A 5I42A 1VSEA 4HVJA 2OYQA 4K8XA 2BH1A 5GIOA 3NVMA 4FOIA 3D6RA 2D4WA 1IKVA 4HTLA 4CK3A 4LF9K 3PSIA 4FZXC 3KLEA 3I0SA 4BG8A 4FO0A 4DFKA 4JKBA 4AM6A 3QEXA 2E2OA 5GAEP 3VQBA 4MFBA 3QB0A 2HBJA 2NLXA 1SL2A 4JKFA 3HYFA 3HPGA 4OX9K 3DXMB 1BA1A 4CEQA 1YXQA 4QS7A 3UKRB 1GLDG 1NGAA 2NRWA 1KCFA 5T7BA 1JXBA 2E88A 4FWLA 4JN4A 4CEFA 1LAWA 1LOTB 4EIAA 5KRTA 5FRMA 1KQSM 1BGXT 3O08A 2Y1JA 1NNEA 3K5OA 1RBUA 3VN5A 2Z1JA 2VWJA 2BE2A 1S6PA 3ZT1A 4MO4A 4CGIA 3L4IA 1IKWA 1BIZA 3CERA 4FCYA 4JD2B 5KGXA 1XC3A 4CJUA 2GWJA 5M1PA 4WFBL 5MLCQ 4WYBA 1WOQA 1YVNA 2P9LB 3MAQA 2IAJA 1T6DA 2NZTA 3HRGA 3G6EN 1VAZA 4KHUA 3AY9A 4V19S 3JAMO 5GAHP 4I9QA 4DR6K 3TSPA 3K9KA 1JL1A 1T44A 5FROA 2AA4A 3NF7A 3DRPA 4FWRA 4CZGA 2ASOA 3AA4A 3WNGA 3QNNA 3VQCA 3DAWA 3KK3A 4JLHA 4N76A 2JWLA 1NGBA 1NKCA 4BE2A 4NB4A 4BRAA 2ZJQL 2KZMA 4CJFA 2YI1A 4LF5K 4HWIA 3ULDA 4AHSA 1OKJA 2QWLA 3V4IA 3O6WA 4MDAA 1BCMA 3NMUA 5ADXA 2W41A 5I3UA 1EXQA 3CM6A 1DTTA 3J80O 1XHXA 1Z26A 3M8PA 4FWMA 4FZYA 2B4JA 1IH7A 2OPPA 3M8QA 1ITGA 2BGGA 2VWKA 3HK2A 2HHTA 1NLVA 2HVHA 1SV5A 3TTFA 3KK7A 4J2AA 3KZBA 1RDDA 5AZIA 3Q7BA 4BVPA 4GV6A 4L3QA 1S9GA 3EN9A 3J7YP 1OH6A 1HKGA 1U47A 1NOYA 4DSLA 4FK2A 1VSLA 4IWVA 4Z4EA 3IKMA 4ZTJA 2RKIA 3RSEB 4BRIA 3PX0A 5LL6Z 2DFEA 3K5NA 2WBNA 3MEEA 4LD0A 1NU0A 3AVIA 1OVYA 3LAKA 3CFPA 1X9SA 1C6VA 4JK9A 3OJSA 1HYZA 1W7AA 5JS1A 2XY6A 3VEOA 2FBYA 1U2VA 1D5AA 3CPEA 1TVRA 3OTOK 1Q9YA 3A5LC 5EVZA 3AAQA 1TKZA 3CJCA 2H3GX 4E89A 2QWQA 5AQOA 4GVMA 4FJIA 1SAZA 5EXWA 1KFDA 4FW1A 4F8RA 2O8DB 3VGLA 4HCBA 1TYQB 4I6MB 1LWEA 3FZFA 4DTOA 4FJHA 1E3MA 2CGLA 4OLAA 3QBWA 2X74A 2YJFA 2E20A 4BVOA 3RTVA 4DQPA 1VQNN 2QKKA 4FK4A 4KH5A 4BRKA 3WXMB 4CGJA 1WB9A 2V7YA 4WQ4C 1LWFA 1GLAG 1NGGA 5DK5A 3VQEA 4C8KA 1RTDA 4KB0A 1BOTO 3M1FA 1C1AA 4JI4K 5J1EA 5J2MA 4FWQA 2F8SA 1JLEA 1NGHA 4X65K 4AILC 3SUPA 4FJJA 3QO9A 3E9PA 2HHUA 1TL1A 1HUXA 4CJRA
chains in the Genus database with same CATH topology
5BPNA 1NGJA 1VQ8N 3UB5A 1MWKA 4B1WB 3RSEA 2A41A 3VF2A 3UKUA 2VCPA 4C1NK 3D2EB 3M3ZA 4PKGA 1ZBSA 2QI2A 4H0XB 5E26A 4BRGA 4JKHA 3ATUA 1NGIA 3HOTA 3L0QA 5CE3A 1TUUA 2E1ZA 4FPAA 2QM1A 3DXKB 3IUCA 3PLAA 1EQYA 5AQYA 1P90A 3H1VX 4ISFA 3UKRA 1DEJA 1H1VA 2IVNA 3DWLA 1VQKN 4MO5A 4BC4A 3ZX3A 4BQZA 3VESA 4UY8O 4FWPA 1QZ5A 3SAGA 3I55N 2V51B 3A8YA 2CGKA 3O9UA 4RCHA 3TTDA 4BGAA 3O1BA 3C7NA 4IOXA 4DHYA 4DQ8A 3A5MC 1BU6O 4A59A 1VQON 2P9IA 1T3VA 2Q97A 1JJ2M 3H3NO 2QW9A 4IOCL 4B1ZA 4BQLA 4YOWA 4H03B 1TYQA 4EHTA 4I6MA 3ID8A 3WEEA 2A5XA 3GE1A 3HBTA 4CI6A 5FPNA 2D0OA 3QICA 2Q36A 3GOIA 1GLLO 1YF5L 2FXUA 2V7ZA 3MN6A 2E1YA 3CCMN 1IG8A 3O1WA 5FPEA 2ZJRL 1HLUA 5BPLA 4H0OA 2NRXA 2P9PB 3KWGA 3SBGA 3P38A 3UE5A 3CCJN 3H3OB 3BF3A 3HSCA 5M1NA 3O8MA 1VQ6N 3VERA 5AQFA 3CIPA 1YIJN 4JHDB 4BREA 3ATVA 2P9SB 2DPNA 3SAHA 3R1XA 3G71N 3QDKA 3U9ZA 2J4RA 3QFUA 4CZEA 4ISEA 3MN5A 3HI0A 4BROA 2QWNA 5AZJB 3M6GA 4H5NA 3SMPA 3WXLA 4BGBA 2QTDA 4E1JA 4YDUA 2ZGZA 3BF1A 4CBUA 3CCLN 2Q31A 3AGKA 2OTLN 3FGUA 3DJCA 3G25A 2IIRA 3LL3A 3LDLA 3HM8A 4ILJA 4CZKA 1DGKN 4IDHA 5AQGA 2FLOA 3D2EA 4H0VB 3GDQA 4H0PA 3MWTA 5F1XA 3L4QA 4NLBA 3SK3A 5KQ8A 2QA4N 2RHKA 4BC5A 4FPBA 1NGEA 3VEZA 4BRFA 2OTJN 3DXKA 3I8BA 2VWBA 1VQ7N 1IJJA 4CZMA 3I33A 3KVGA 2HSTA 4WQ4A 3VTIA 4IO8A 1J6ZA 4Z94A 1ATSA 4M7YA 2VGMA 1N8RO 1Q86O 4MDBA 5AQKA 3VOVA 4C23A 2KLAA 2GX9A 3ZEUB 3ZX2A 3CJ1A 2PBDA 2V52B 4G9ZA 3EO3A 4O5FA 2NRVA 3FZKA 4RTFD 3VF6A 2I7PA 4BRQA 5M1KA 1Q18A 3WXJA 4BG9A 1KAZA 3CJ7A 4IJNA 2P9NB 1BUPA 1YAGA 4XH1A 4O8KA 2KKZA 5AQLA 1QVFM 1RDUA 3S41A 2HOEA 1EO1A 1RFQA 1T6CA 4BR4A 1YHQN 3G4SN 2P9KB 2NNWA 1Y64A 5AR0A 3EKUA 3F5TA 2JWKA 4FVUA 2A40A 3KHYA 3O80A 2E2QA 2BTFA 3T7ZA 2P9PA 3GBTA 3ZETB 3VEWA 3HOSA 4K25A 1C0FA 2E8AA 3GL1A 5H1SQ 2FF6A 4IZ9A 4XH4A 2ZF5O 2FSKA 2Q0UA 5C2FA 5ELZA 3A0IX 3ZYYX 3MCPA 2HBKA 4JHDA 1S22A 2P9SA 4XH5A 2VGNA 3QFPA 1Z6RA 2HMPA 2QWOA 2UYTA 4BR0A 5FPMA 1YITN 1QQNA 2F9TA 3N4PA 3KWIA 2D0PA 1KAYA 3CJAA 4JKDA 4K41A 5EOYA 5AZJA 4AF1A 3D2FB 1DKGD 5JLFA 2ITMA 4JAXA 5BRHA 4FSVA 3RVCA 5TKYA 4CD1A 5I9EB 1ESVA 5ADXH 3CCVN 1NGCA 4FL9A 3SJHA 1BWFO 1RGIA 4FOEA 1U6ZA 3T69A 1XUPO 5KPTA 3MDQA 3WQTA 3SLCA 3TSQA 3O4WA 4B1YB 4EHUA 3LM2A 3CCEN 1NMDA 5M1OA 4ILGB 4JKEA 2AP1A 5HOOA 2HBMA 2PFUA 2NRRA 3IMXA 4JKAA 3ULEB 3ZX0A 3IDHA 3SAFA 3I56N 5KPZA 4WCEL 1ILYA 1SS6A 4FWNA 4KH4A 3R3LA 1CZAN 2YJEA 4BR5A 3J7ZO 2IVPA 4RWTA 2FF3B 3H46O 3FFKB 2Q0RA 3LDOA 4IJAA 5AFUH 3TU5A 2I7NA 4A2BA 4BRLA 3ZEUA 4IOAL 4BRHA 2E2NA 4BRCA 4FWSA 1NBWA 4WF9L 5AQTA 1KD1O 4XEIA 4GVEA 1DT9A 1KAXA 4ISGA 4AM7A 3U9DA 4B9QA 2W40A 3HZ6A 1BO5O 2P9NA 3CJ9A 3DLLL 3LM9A 4IFEA 3W0LA 1K8KA 5HL7L 5C0YA 5JVHL 2P9KA 3VENA 4JNEA 3VGMA 2FSNA 5GAGP 4H0TB 1KXPA 4B1XB 1V4SA 4DB3A 4H5VA 4GNIA 3U4LA 1HX1A 4FWKA 3ENOA 5C2DA 1VQ9N 3ENBA 2NRZA 5C10A 4CZFA 3A5NC 3FZLA 5JICA 2VYPA 3CMAN 1Q81O 2QXLA 4KBOA 3CF5L 5AQIA 1V4TA 2YHXA 3MN7A 3VTHA 4DCHA 3VEXA 5CHIA 2BUPA 1S3XA 4CBXA 4QS8A 2BH1A 5GIOA 3NVMA 2E2PA 3WT0A 4BC2A 5AFUA 3CCSN 1NGDA 3TSUA 4FOIA 3D6RA 4H5WA 1YJWN 3OA9A 3OBWA 2D4WA 4A5BA 3D2FA 3P4IA 4HTLA 5M1FA 4BR7A 4BR2A 3CC2N 3C6HA 2EWSA 4BG8A 5F2RA 4FO0A 3CETA 3EKSA 4JKBA 4B1UB 4AM6A 3CD6N 2YCHA 2E2OA 3CJBA 5GAEP 5AQMA 1Q7YO 1GLFO 4MLEA 1E4FT 3QB0A 3P39A 2HBJA 2NLXA 4JKFA 4JKGB 4GV9A 3ULEA 4A57A 2ZGYA 2D1KA 3DXMB 1BA1A 1LCUA 4GV3A 1JCFA 1YXQA 4QS7A 3UKRB 1W2BM 1GLDG 4NO7A 5AQZA 4BRPA 3CC7N 1NGAA 2NRWA 4YOUA 5CR4A 1QQOA 2E88A 4FWLA 3ENHA 4JN4A 3VPZA 4EIAA 1LOTB 5GIPA 3R8EA 1KQSM 5AQPA 3O08A 1YUWA 4BRNA 5C15A 3LDQA 5JLHA 2HF3A 1BG3A 5LJVA 5AQVA 5JMVA 3CQYA 4PL7A 3TTCA 4MO4A 3MX5A 4YOXA 3E9LA 3O9TA 4M7XA 3L4IA 4H5RA 3CERA 3NVKA 4NLCA 4JD2B 1XC3A 3VGKA 3BP8A 3H6EA 3CI5A 3SBTA 4WQ5C 2GWJA 5DM7L 3VETA 5M1PA 3CMEN 3OHRA 2PAVA 4JK7A 2GUPA 1QHAA 4WYBA 1SQKA 5AQQA 1WOQA 4CZHA 5MLCQ 3CCQN 1YVNA 2P9LB 1QVGM 3TPQA 2NZTA 1T6DA 4R79A 2A42A 3WXIA 1R59O 3HRGA 3G6EN 1VQLN 1HKCA 4FWOA 5AZIB 1E4GT 1VAZA 2A6AA 2IVOA 2Q1NA 3O9QA 1WUAA 4MLHA 3R9PA 3AY9A 4C1NI 3F9MA 5GINA 2KHOA 5GAHP 1O13A 4BC3A 2HF4A 2ZWHA 3TSPA 3K9KA 4LC9B 3CQXA 1MDUB 1T44A 4JEPA 1VQ4N 2AA4A 1X9JA 5KPRA 4YOYA 1ZXOA 3M5RA 4FWRA 4CZGA 2P9UB 2ASOA 4M63C 3O5BA 3MN9A 2F7TA 2ZJPL 3DAWA 4CZLA 1JCEA 1VQMN 4IEIA 5F0XA 3OBYA 2WC9A 2JWLA 4O8UA 1U2VB 2ASPA 3QBXA 1ATRA 1NGBA 4QS9A 3FZHA 2GWKA 5BRDA 2CGJA 4JKGA 3VF4A 1MA9B 4ILHA 2YX6A 4H0YB 4NB4A 4BRAA 2ZJQL 5AQRA 3DXMA 5BR9A 4BRDA 3CHWA 3CCUN 2YI1A 4HWIA 3VEVA 2QEXN 3E9OA 1YJNN 4KH6A 1OKJA 1X3MA 2QWLA 3O6WA 2A3ZA 4MDAA 3J8AA 5ADXA 4IO9L 2W41A 3NMUA 5AQXA 4JKCA 3GG4A 4CJ7A 1HJOA 1P8ZA 4F9OA 1NWKA 4CBWA 5C12A 2GTDA 5BPMA 3EL2A 3QMLA 2CH6A 4IXCA 3D7EO 3LDNA 5M1QA 1M1KO 3H1QA 2NRTA 1QQMA 1K8AO 2Q2RA 3F2KA 3ZETA 5GADP 1BA0A 1GLJO 5AQWA 1XQSC 1W97L 4JD2A 4U67L 4CZJA 4FWMA 3SMSA 4Y0WA 3C0BA 3U8XA 4U7BA 3HTVA 2YHYA 1HKBA 5KQDA 5AQNA 2P9LA 3B8AX 1NLVA 1X3NA 2GEMA 1QZ6A 5AQUA 3C65A 1K9MO 3IFRA 5EY4A 3KK7A 3TTFA 3KZBA 5AZIA 4A2AA 3Q7BA 1VQ5N 4BVPA 4GV6A 5BN9A 2YHWA 4L3QA 3EN9A 2HBLA 3EZWA 1C0GA 1HKGA 3MMVA 4CZIA 5JVGL 3O9RA 1TUYA 4IWVA 3IKMA 1HPMA 4WFNL 3RSEB 1GLBG 4K43A 3UKUB 3MWPA 4PKIA 4BRIA 4BY9C 5EX5A 4OO1J 3EE9A 2F9WA 3H45C 1ATNA 4GY2B 2WBNA 4K42A 2P9UA 4PKHA 4BR9A 3PIOL 5BN8A 3WQUA 4A62A 3K9JA 4CD3A 5B8HA 1OVYA 3P31A 3A5OC 3ID6A 4J8FA 3BEXA 4JK9A 3CXCM 3W3DA 1ZC6A 3VEYA 4BRMA 3O9SA 2WFBA 4EAHD 1D4XA 2QWMA 1JCGA 3BUZB 1SZ2A 3VEOA 4WQ5A 1U2VA 5AQSA 3AAPA 3CPEA 3CPWM 5DM6L 2QWRA 3C7NB 3A5LC 5EVZA 3L6QA 3AAQA 3MCAB 3CJCA 3JXUA 2H3GX 5AQJA 2P9IB 4YOTA 4JK8A 2QWQA 5AQOA 4PHTX 1GLEG 3FLCO 3JS6A 4YDUC 3CC4N 3MX2A 1SAZA 5EXWA 2FSJA 3E66A 4YORA 3LDPA 3VGLA 4B1VA 2CH5A 1KC8O 3OW2M 1Z05A 5BRFA 4DKWA 1TYQB 4I6MB 3FZFA 1YJ9N 1RDWX 3AARA 3WEEB 4A5AA 2GELA 4A61A 2CGLA 4IEEA 3C6AA 5AQHA 1G99A 1K73O 4OPHA 5BREA 1NGFA 2OANA 3QBWA 2YJFA 1BDGA 2RE2A 3R6MA 3E1YA 2E20A 1NM1A 5FPDA 4BVOA 1NJIO 1YI2N 3AGRA 4OPAA 1K8KB 1VQNN 5E84A 3FR0A 4H5TA 4KH5A 4BRKA 3WXMB 2V7YA 4WQ4C 1GLAG 4YOVA 3VMFB 1M90O 5TKWA 1NGGA 1S72N 1VQPN 3N4QA 2NRHA 1BOTO 3M1FA 2QWPA 3WUHA 3WXKA 1MWMA 2WUSA 4FWQA 1GLCG 3MK6A 4WFAL 1NGHA 3PIPL 3CCRN 1Q82O 4PL8A 3Q7CA 4EFHA 3FZMA 4WFBL 3EE8A 5LJWA 2ASMA 5LY3A 3E9PA 3FE1A 1HUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPN A;  1NGJ A;  3UB5 A;  1MWK A;  4B1W B;  3RSE A;  2A41 A;  3VF2 A;  3UKU A;  2VCP A;  3D2E B;  3M3Z A;  4PKG A;  1ZBS A;  4H0X B;  5E26 A;  4BRG A;  3ATU A;  1NGI A;  3L0Q A;  5CE3 A;  1TUU A;  2E1Z A;  4FPA A;  2QM1 A;  3DXK B;  3IUC A;  1EQY A;  5AQY A;  3H1V X;  4ISF A;  3UKR A;  1DEJ A;  1H1V A;  2IVN A;  3DWL A;  4MO5 A;  4BC4 A;  3ZX3 A;  4BQZ A;  3VES A;  4FWP A;  1QZ5 A;  2V51 B;  3A8Y A;  2CGK A;  4RCH A;  4BGA A;  3O1B A;  3C7N A;  4DHY A;  4DQ8 A;  3A5M C;  1BU6 O;  2P9I A;  2Q97 A;  3H3N O;  2QW9 A;  4B1Z A;  4BQL A;  4H03 B;  1TYQ A;  4EHT A;  4I6M A;  3ID8 A;  3WEE A;  2A5X A;  3GE1 A;  3HBT A;  4CI6 A;  5FPN A;  2D0O A;  3QIC A;  2Q36 A;  3GOI A;  1GLL O;  2FXU A;  2V7Z A;  3MN6 A;  2E1Y A;  1IG8 A;  3O1W A;  5FPE A;  1HLU A;  5BPL A;  4H0O A;  2P9P B;  3UE5 A;  3H3O B;  3BF3 A;  3HSC A;  3O8M A;  3VER A;  5AQF A;  3CIP A;  4JHD B;  4BRE A;  3ATV A;  2P9S B;  2DPN A;  3QDK A;  3U9Z A;  2J4R A;  3QFU A;  4CZE A;  4ISE A;  3MN5 A;  3HI0 A;  4BRO A;  2QWN A;  5AZJ B;  3M6G A;  4H5N A;  3SMP A;  3WXL A;  4BGB A;  4E1J A;  4YDU A;  2ZGZ A;  3BF1 A;  4CBU A;  2Q31 A;  3FGU A;  3DJC A;  3G25 A;  2IIR A;  3LL3 A;  3LDL A;  3HM8 A;  4CZK A;  1DGK N;  5AQG A;  2FLO A;  3D2E A;  4H0V B;  3GDQ A;  4H0P A;  5F1X A;  3SK3 A;  4BC5 A;  4FPB A;  1NGE A;  3VEZ A;  4BRF A;  3DXK A;  3I8B A;  2VWB A;  1IJJ A;  4CZM A;  3I33 A;  3KVG A;  4WQ4 A;  4IO8 A;  1J6Z A;  4Z94 A;  1ATS A;  5AQK A;  3VOV A;  4C23 A;  3ZEU B;  3ZX2 A;  3CJ1 A;  2PBD A;  2V52 B;  3EO3 A;  4O5F A;  4RTF D;  3FZK A;  3VF6 A;  2I7P A;  4BRQ A;  1Q18 A;  3WXJ A;  4BG9 A;  1KAZ A;  3CJ7 A;  4IJN A;  2P9N B;  1BUP A;  1YAG A;  4XH1 A;  4O8K A;  5AQL A;  3S41 A;  2HOE A;  1RFQ A;  1T6C A;  4BR4 A;  2P9K B;  1Y64 A;  5AR0 A;  3EKU A;  2A40 A;  3KHY A;  3O80 A;  2E2Q A;  2BTF A;  2P9P A;  3GBT A;  3ZET B;  3VEW A;  4K25 A;  1C0F A;  2E8A A;  3GL1 A;  2FF6 A;  4IZ9 A;  4XH4 A;  2ZF5 O;  2FSK A;  2Q0U A;  5ELZ A;  3A0I X;  3MCP A;  4JHD A;  1S22 A;  2P9S A;  4XH5 A;  3QFP A;  1Z6R A;  2HMP A;  2QWO A;  2UYT A;  4BR0 A;  5FPM A;  1QQN A;  2F9T A;  2D0P A;  1KAY A;  3CJA A;  4K41 A;  5EOY A;  5AZJ A;  3D2F B;  1DKG D;  5JLF A;  2ITM A;  4JAX A;  5BRH A;  4FSV A;  5TKY A;  4CD1 A;  5I9E B;  1ESV A;  5ADX H;  1NGC A;  4FL9 A;  3SJH A;  1BWF O;  1RGI A;  4FOE A;  1U6Z A;  5KPT A;  1XUP O;  3MDQ A;  3WQT A;  3SLC A;  3O4W A;  4B1Y B;  4EHU A;  3LM2 A;  1NMD A;  2AP1 A;  3ULE B;  3IMX A;  3ZX0 A;  3IDH A;  5KPZ A;  4FWN A;  1CZA N;  2YJE A;  4BR5 A;  2IVP A;  4RWT A;  2FF3 B;  3H46 O;  3FFK B;  2Q0R A;  3LDO A;  4IJA A;  5AFU H;  3TU5 A;  2I7N A;  4A2B A;  4BRL A;  3ZEU A;  4BRH A;  2E2N A;  4BRC A;  4FWS A;  1NBW A;  5AQT A;  4XEI A;  1KAX A;  4ISG A;  4AM7 A;  3U9D A;  4B9Q A;  2W40 A;  3HZ6 A;  1BO5 O;  2P9N A;  3CJ9 A;  3LM9 A;  3W0L A;  1K8K A;  2P9K A;  3VEN A;  4JNE A;  3VGM A;  2FSN A;  4H0T B;  1KXP A;  4B1X B;  1V4S A;  4DB3 A;  4H5V A;  4GNI A;  3U4L A;  1HX1 A;  4FWK A;  3ENO A;  4CZF A;  3A5N C;  3FZL A;  5JIC A;  2VYP A;  2QXL A;  4KBO A;  5AQI A;  1V4T A;  2YHX A;  3MN7 A;  4DCH A;  3VEX A;  2BUP A;  1S3X A;  4CBX A;  4QS8 A;  3WT0 A;  2E2P A;  5AFU A;  4BC2 A;  1NGD A;  4FOI A;  4H5W A;  2D4W A;  3D2F A;  3P4I A;  4HTL A;  4BR7 A;  4BR2 A;  2EWS A;  4BG8 A;  5F2R A;  4FO0 A;  3CET A;  3EKS A;  4B1U B;  4AM6 A;  2YCH A;  2E2O A;  3CJB A;  5AQM A;  1GLF O;  4MLE A;  1E4F T;  3QB0 A;  2NLX A;  3ULE A;  2ZGY A;  2D1K A;  3DXM B;  1BA1 A;  1LCU A;  1JCF A;  1YXQ A;  4QS7 A;  3UKR B;  1GLD G;  4NO7 A;  5AQZ A;  4BRP A;  1NGA A;  1QQO A;  2E88 A;  4FWL A;  3ENH A;  4JN4 A;  3VPZ A;  4EIA A;  1LOT B;  3R8E A;  5AQP A;  3O08 A;  1YUW A;  4BRN A;  3LDQ A;  5JLH A;  2HF3 A;  1BG3 A;  5LJV A;  5AQV A;  5JMV A;  3CQY A;  4PL7 A;  4MO4 A;  4M7X A;  3L4I A;  4H5R A;  3CER A;  4JD2 B;  1XC3 A;  3VGK A;  3BP8 A;  3H6E A;  3CI5 A;  4WQ5 C;  2GWJ A;  3VET A;  3OHR A;  2PAV A;  4CZH A;  2GUP A;  1QHA A;  4WYB A;  1SQK A;  5AQQ A;  1WOQ A;  1YVN A;  2P9L B;  3TPQ A;  2NZT A;  1T6D A;  2A42 A;  3WXI A;  1R59 O;  1HKC A;  4FWO A;  5AZI B;  1E4G T;  2IVO A;  2A6A A;  2Q1N A;  1WUA A;  4MLH A;  3R9P A;  3AY9 A;  3F9M A;  2KHO A;  4BC3 A;  2HF4 A;  2ZWH A;  4LC9 B;  3CQX A;  1MDU B;  1T44 A;  2AA4 A;  1X9J A;  5KPR A;  1ZXO A;  4FWR A;  4CZG A;  2P9U B;  2ASO A;  4M63 C;  3O5B A;  3MN9 A;  3DAW A;  4CZL A;  1JCE A;  5F0X A;  1U2V B;  2ASP A;  3QBX A;  1ATR A;  1NGB A;  4QS9 A;  3FZH A;  2GWK A;  5BRD A;  2CGJ A;  3VF4 A;  1MA9 B;  4H0Y B;  4NB4 A;  4BRA A;  5AQR A;  3DXM A;  5BR9 A;  4BRD A;  3CHW A;  2YI1 A;  4HWI A;  3VEV A;  1OKJ A;  1X3M A;  2QWL A;  3O6W A;  2A3Z A;  3J8A A;  5ADX A;  2W41 A;  5AQX A;  3GG4 A;  4CJ7 A;  1HJO A;  1P8Z A;  4F9O A;  1NWK A;  4CBW A;  2GTD A;  5BPM A;  3EL2 A;  3QML A;  2CH6 A;  4IXC A;  3D7E O;  3LDN A;  3H1Q A;  1QQM A;  2Q2R A;  3ZET A;  1BA0 A;  1GLJ O;  5AQW A;  1XQS C;  4JD2 A;  4CZJ A;  4FWM A;  3SMS A;  4Y0W A;  3C0B A;  3U8X A;  3HTV A;  2YHY A;  1HKB A;  5KQD A;  5AQN A;  2P9L A;  3B8A X;  1NLV A;  1X3N A;  2GEM A;  1QZ6 A;  5AQU A;  3IFR A;  5EY4 A;  3KZB A;  5AZI A;  4A2A A;  4BVP A;  5BN9 A;  2YHW A;  4L3Q A;  3EN9 A;  4CZI A;  3EZW A;  1C0G A;  1HKG A;  3MMV A;  1TUY A;  4IWV A;  1HPM A;  3RSE B;  1GLB G;  4K43 A;  3UKU B;  4PKI A;  4BRI A;  5EX5 A;  2F9W A;  3H45 C;  1ATN A;  4GY2 B;  4K42 A;  2P9U A;  4PKH A;  4BR9 A;  5BN8 A;  3WQU A;  4A62 A;  4CD3 A;  5B8H A;  3A5O C;  4J8F A;  3BEX A;  3W3D A;  1ZC6 A;  3VEY A;  4BRM A;  4EAH D;  1D4X A;  2QWM A;  1JCG A;  3BUZ B;  1SZ2 A;  3VEO A;  4WQ5 A;  1U2V A;  5AQS A;  3AAP A;  2QWR A;  3C7N B;  3A5L C;  5EVZ A;  3L6Q A;  3AAQ A;  3CJC A;  3JXU A;  2H3G X;  5AQJ A;  2P9I B;  2QWQ A;  5AQO A;  1GLE G;  3FLC O;  3JS6 A;  4YDU C;  1SAZ A;  5EXW A;  2FSJ A;  3LDP A;  3VGL A;  4B1V A;  2CH5 A;  1Z05 A;  5BRF A;  1TYQ B;  4I6M B;  3FZF A;  1RDW X;  3AAR A;  3WEE B;  2GEL A;  4A61 A;  2CGL A;  5AQH A;  1G99 A;  5BRE A;  1NGF A;  2OAN A;  3QBW A;  2YJF A;  1BDG A;  3R6M A;  4M7Y A;  5FPD A;  2E20 A;  1NM1 A;  5KQ8 A;  4BVO A;  1K8K B;  5E84 A;  3FR0 A;  4H5T A;  4BRK A;  2V7Y A;  4WQ4 C;  1GLA G;  1NGG A;  2NRH A;  1BOT O;  3M1F A;  2QWP A;  3WUH A;  3WXK A;  1MWM A;  2WUS A;  4FWQ A;  1GLC G;  3MK6 A;  1NGH A;  4PL8 A;  4EFH A;  3FZM A;  5LJW A;  2ASM A;  5LY3 A;  3FE1 A;  1HUX A; 
#chains in the Genus database with same CATH topology
 4KFB A;  1VQ8 N;  1WSJ A;  2A41 A;  2VCP A;  3HXM A;  4KKO A;  1ZBH A;  4CFC A;  4JKH A;  4DV3 K;  2DTU A;  1JLF A;  1TUU A;  2E1Z A;  5FLX O;  3DLR A;  1WNS A;  5AQY A;  3DLE A;  3SCX A;  3ZSR A;  4KV8 A;  3OS1 A;  4DUZ K;  3T1Y K;  4MO5 A;  3A8Y A;  4RCH A;  3O1B A;  3C7N A;  3A5M C;  2VQF K;  1BU6 O;  4A59 A;  1VQO N;  2P9I A;  2G8W A;  1JJ2 M;  3IG1 A;  2QW9 A;  1VRU A;  1GOC A;  4LFA K;  4BQL A;  2UU9 K;  4BAC A;  2A5X A;  3GE1 A;  5FPN A;  3RMA A;  3J7A P;  1YF5 L;  2V7Z A;  3CCM N;  4LH5 A;  1IG8 A;  1L3S A;  3NF8 A;  3O1W A;  5C42 A;  4JI0 K;  1MU2 A;  2NRX A;  3KWG A;  3LZJ A;  4KTQ A;  3SBG A;  3UE5 A;  3HSC A;  5M1N A;  4OKE A;  5LMU K;  4QOZ B;  1VQ6 N;  4YHH K;  4K0K K;  3AVK A;  1YIJ N;  4BRE A;  1YVU A;  3QDK A;  3U9Z A;  3LPU A;  2HND A;  3QEP A;  4CVN E;  4ISE A;  2DFH A;  2UXD K;  5AZJ B;  4YY3 K;  3DLB A;  1X9M A;  4E1J A;  1KLN A;  3SQ2 A;  4YDU A;  2ZGZ A;  3BF1 A;  3AGK A;  3CM5 A;  3DJC A;  4O0J A;  4DS5 A;  3LDL A;  4CJ3 A;  4IDH A;  1HRH A;  1WBB A;  1X1P A;  5AQG A;  2E6L A;  3D2E A;  4CF1 A;  1J54 A;  2QA4 N;  2RHK A;  4IFY A;  1LV5 A;  4JI6 K;  1NGE A;  4CF8 A;  3VQA A;  2BDP A;  1RT2 A;  4CZM A;  4CES A;  1HQU A;  1ATS A;  1TK0 A;  4QAG A;  4RW6 A;  3OYM A;  4KHY A;  4KHQ A;  2YNG A;  5AQK A;  3AVM A;  3S3N A;  3MXJ A;  1BI4 B;  3ZX2 A;  2V52 B;  3EO3 A;  4RTF D;  2I7P A;  1Q18 A;  3MXM A;  1KAZ A;  5HRP A;  2P9N B;  1BUP A;  3K57 A;  1YAG A;  4XH1 A;  4O8K A;  2KKZ A;  4FJ5 A;  4OJR A;  1QVF M;  4NCA A;  4FLU A;  3QET A;  1N32 K;  2P9K B;  2NNW A;  1Y64 A;  1YTU A;  4B8A B;  4M3T A;  4KTZ A;  1S1X A;  3O80 A;  3DRS A;  4W5Q A;  2E2Q A;  3T7Z A;  4KRF A;  2DFF A;  3QEI A;  1VSK A;  2FF6 A;  4AHU A;  4O55 A;  2FSK A;  3ZYY X;  3MCP A;  2HBK A;  4Z4H A;  4RW4 A;  5FRN A;  4Y1C A;  2HMP A;  2F9T A;  3N4P A;  1KAY A;  4JKD A;  3KTQ A;  4AF1 A;  1DKG D;  5JLF A;  4RG8 A;  1XI1 A;  3IAY A;  4DLE A;  5TKY A;  4B9U A;  1ESV A;  3SNN A;  3ASM A;  3CCV N;  3H08 A;  4LF8 K;  4DV7 K;  1RGI A;  1U6Z A;  2VG6 A;  3ZSY A;  3O3G A;  3SLC A;  3CCE N;  4IBN A;  2HBM A;  4DTS A;  3I56 N;  4LF4 K;  3V1O A;  4WCE L;  4DTU A;  1SS6 A;  5CZ1 A;  3TAB A;  1CLQ A;  1SL1 A;  2IDO A;  3SPZ A;  1L3T A;  3H46 O;  3LDO A;  4IJA A;  4ZHR A;  2I7N A;  4IG3 A;  2Z1G A;  4BRC A;  4CF0 A;  2RN2 A;  1KAX A;  4ISG A;  3S9H A;  3U9D A;  2EX3 A;  3HZ6 A;  3CJ9 A;  3W0L A;  3RMD A;  1KFS A;  5JVH L;  1C1B A;  5GAG P;  2FSN A;  4H0T B;  4DR1 K;  4GNI A;  3ZT3 A;  2G8V A;  2Z1H A;  4CZF A;  2QXL A;  2Q3S A;  3DM2 A;  3CF5 L;  5AQI A;  1V4T A;  4OPK A;  3VTH A;  4DCH A;  3VEX A;  1WAJ A;  3KK2 A;  1S3X A;  4QS8 A;  4JRP A;  4K8Z A;  3WT0 A;  4BC2 A;  5HRN A;  4FM1 A;  3OYK A;  3OA9 A;  3OBW A;  4DG1 A;  4BR2 A;  1EX4 A;  3CC2 N;  4X66 K;  3C6H A;  3HL8 A;  5HLF A;  4ELV A;  1KRP A;  3QIN A;  3CET A;  3EKS A;  4B1U B;  3OY9 A;  3CD6 N;  2YCH A;  4Z4G A;  4MLE A;  4JKG B;  2D1K A;  3OYF A;  4GV3 A;  1VRT A;  2NUB A;  2P1J A;  4YOU A;  2IOC A;  1QQO A;  3R8E A;  3TAM A;  5FDL A;  1NMN A;  4BRN A;  4OKJ A;  3LAL A;  5JLH A;  2HHS A;  1BG3 A;  3CQY A;  4DS4 A;  5KRS A;  3MX5 A;  2F96 A;  4YOX A;  4NLC A;  3VGK A;  4I2Q A;  3KLF A;  3CI5 A;  3SBT A;  3VA0 A;  4WQ5 C;  5DM7 L;  3AA5 X;  3RWU A;  3THW A;  4DSI A;  1OH8 A;  4CJT A;  4Q5V A;  4FWO A;  2Q1N A;  3EZ5 A;  1RBT A;  4LSN A;  4RW7 A;  2KHO A;  4FYD A;  1UOC A;  4BC3 A;  1LAV A;  1WSE A;  4LC9 B;  4DR7 K;  1VQ4 N;  4J2E A;  1X9J A;  5KPR A;  1ZXO A;  3M5R A;  3O5B A;  2ZJP L;  4W5T A;  1VSD A;  2KW4 A;  1QS4 A;  1XMQ K;  2B6A A;  4CHO A;  4O8U A;  2W42 A;  4QS9 A;  1TGO A;  5BRD A;  3FZH A;  1WLJ A;  2CGJ A;  2YX6 A;  3SJJ A;  3PO5 A;  5AQR A;  1QE1 A;  3IS9 A;  4BRD A;  3VQ7 A;  3L2V A;  1U4B A;  3A2F A;  3AO1 A;  3PX6 A;  3CHW A;  3VEV A;  3ZLJ A;  1X3M A;  1U45 A;  2A3Z A;  3LZI A;  4CF9 A;  3DLG A;  4ELU A;  5IWA K;  1BQN A;  3J8A A;  3V81 A;  4JKC A;  2E5L K;  4CBW A;  4KPY A;  1QQC A;  2D0A A;  2E6M A;  3AVA A;  1VSI A;  3H1Q A;  2NRT A;  3ZT4 A;  3ZET A;  1BA0 A;  1GLJ O;  1RNH A;  1XQS C;  1W97 L;  4CZJ A;  4ICL A;  3SMS A;  4Y0W A;  3U8X A;  4U7B A;  3AA2 A;  1HNZ K;  3K59 A;  1HKB A;  4DV5 K;  3KKR A;  4KI4 A;  1X3N A;  2GEM A;  1QZ6 A;  4AHC A;  1SKW A;  4CJ4 A;  2GUI A;  5BN9 A;  3EZW A;  1C0G A;  1NJX A;  4M41 A;  2O8B A;  3O9R A;  3P83 D;  1HPM A;  4WFN L;  1GLB G;  3UKU B;  3MWP A;  4PKI A;  3OJU A;  2HNY A;  3KLI A;  4OO1 J;  3EE9 A;  1ATN A;  4GY2 B;  2P9U A;  3WQU A;  4A62 A;  3K9J A;  5B8H A;  3P31 A;  3PO4 A;  3ID6 A;  4DLG A;  4DSK A;  4J8F A;  4DTP A;  3CXC M;  3KK1 A;  3W3D A;  1ZC6 A;  4EAH D;  3O9S A;  2WFB A;  4CIF A;  4FLX A;  1JLC A;  4RW9 A;  1JCG A;  1S1T A;  1SZ2 A;  1W0H A;  5JS2 A;  4RW8 A;  3AAP A;  3LDS A;  3CPW M;  4OGC A;  2QWR A;  3L6Q A;  3MCA B;  3JXU A;  5AQJ A;  4DV4 K;  4I2P A;  4N56 A;  2X6N A;  1NK7 A;  1NK4 A;  1Z05 A;  1OVQ A;  4FM2 A;  1ASW A;  3AO2 A;  3WEE B;  4A5A A;  1YJ9 N;  2GEL A;  3LWM A;  2XY5 A;  1SL0 A;  1NK9 A;  3TAN A;  4A61 A;  4IEE A;  1CZ9 A;  3C6A A;  5AQH A;  4OPH A;  4X64 K;  5KQ8 A;  1BDG A;  1NJI O;  3E1Y A;  1YI2 N;  4DTJ A;  3TAP A;  4C8L A;  3FR0 A;  1NK5 A;  1KVC A;  4Y1D A;  4E7L A;  4YOV A;  4FLV A;  3V9U A;  3TAE A;  1TK8 A;  4EP5 A;  3N4Q A;  2NRH A;  3OS2 A;  2X78 A;  3WUH A;  4JV5 K;  1MWM A;  1GLC G;  3MK6 A;  3K5M A;  4Q0B A;  1Q82 O;  2ASM A;  3P1G A;  3THX A;  4FXD A;  4TSX A;  2ZE2 A;  1NGJ A;  3UB5 A;  1IKX A;  2Y1I A;  4PKG A;  1ZBS A;  5E26 A;  4BRG A;  3VQ9 A;  3ATU A;  5E41 A;  1VSM A;  4FLY A;  1NG9 A;  3IUC A;  3SQ4 A;  3EEQ A;  3CFR A;  1P90 A;  4CJK A;  2HW3 A;  1NJY A;  4ISF A;  4B08 A;  1DEJ A;  4BC4 A;  3VES A;  1C1C A;  1QZ5 A;  3I55 N;  2CGK A;  3O9U A;  2ZM6 K;  4IOX A;  5J2Q A;  4E7I A;  1RDA A;  1XHZ A;  3O3H A;  2KFZ A;  1J53 A;  3CYM A;  4NCG A;  3ZSO A;  3ID8 A;  4CI6 A;  3AVB A;  3QIC A;  1XMO K;  3GOI A;  1GLL O;  2PY5 A;  4JI8 K;  3MN6 A;  2E1Y A;  5BPL A;  4H0O A;  2P9P B;  3U3Y A;  3P38 A;  2P5G A;  3O8M A;  2YHB A;  3VER A;  3CIP A;  2O8C A;  1Q8I A;  3ATV A;  3SPY A;  2P9S B;  4FK0 A;  3R1X A;  4FJK A;  3QFU A;  4CZE A;  3MN5 A;  3HI0 A;  3OYH A;  2QWN A;  3M6G A;  4H5N A;  3THY B;  4BGB A;  2IC3 A;  4CEC A;  4DV0 K;  4DTM A;  2Q31 A;  1TKT A;  3FGU A;  3G25 A;  4CZK A;  4DF4 A;  1N33 K;  1DGK N;  1O1W A;  2FLO A;  3OS0 A;  3MWT A;  3SK3 A;  3ZSW A;  4J2D A;  3VEZ A;  3DXK A;  3I8B A;  2VG7 A;  3MXI A;  2PYJ A;  3ZT0 A;  1IJJ A;  1VSH A;  2FBV A;  1TKX A;  1ZBL A;  4E1M A;  4CFD A;  2VGM A;  1N8R O;  2A1S A;  2ATQ A;  2KLA A;  4HUG A;  4KHS A;  3L8B A;  3ZEU B;  1SUQ A;  4DFP A;  4BRQ A;  4BG9 A;  1A5V A;  2YNH A;  5AQL A;  1S6Q A;  5BR8 K;  5J2P A;  1HYS A;  4BWM A;  4BDP A;  2XO7 A;  2OA8 A;  3ZET B;  4O4G A;  4FLW A;  3AVC A;  1C0F A;  2E8A A;  3GL1 A;  5C2F A;  5ELZ A;  3A0I X;  4FJG A;  4JHD A;  1RIL A;  4GMJ B;  2QWO A;  2UYT A;  3CG7 A;  1BL3 A;  2D0P A;  2GV9 A;  3E01 A;  1Y97 A;  3VA3 A;  1HMV A;  5DMR A;  3CJA A;  4DSJ A;  4KAZ A;  4KHN A;  4EZ9 A;  4DU4 A;  1B9D A;  3RVC A;  1FJG K;  5ADX H;  1BWF O;  3T69 A;  1XUP O;  3NF6 A;  3MDQ A;  3OYG A;  5KGW A;  3DRR A;  4CEZ A;  3TSQ A;  3QEV A;  3LP0 A;  1NMD A;  1JXE A;  4JKE A;  4LY7 A;  5HOO A;  3SAF A;  1ASV A;  3ZX0 A;  5CZ2 A;  1U48 A;  3RRH A;  4FWN A;  1DTQ A;  4FJL A;  3VQQ A;  1CZA N;  2YJE A;  3DI6 A;  3M8S A;  1J9A A;  4DV6 K;  3HT3 A;  2FF3 B;  5AFU H;  2Q0R A;  3TU5 A;  2O8F A;  4BRL A;  4BRH A;  4MQ3 A;  4WF9 L;  1X9W A;  1DT9 A;  1NKE A;  4CJL A;  2W40 A;  3QES A;  1K8K A;  5HL7 L;  2DY4 A;  4UQG A;  3SI6 A;  3SV3 A;  2PYL A;  3VEN A;  4JNE A;  3VGM A;  4FJ9 A;  1KXP A;  4B1X B;  1V4S A;  4DB3 A;  1HR0 K;  4FJ7 A;  3ENO A;  1J5E K;  2NRZ A;  1RBS A;  5C10 A;  3FZL A;  5JIC A;  4DTX A;  3MN7 A;  3LAN A;  3ITH A;  2BUP A;  4NYF A;  5K14 A;  3AV9 A;  2FBT A;  3CCS N;  1NGD A;  4CHN A;  4Z0U A;  2WTU A;  3D2F A;  3P4I A;  4LF7 K;  2HMI A;  5M1F A;  3V9Z A;  5LMN K;  4PQU A;  3P5J A;  1XNQ K;  5F2R A;  4B9N A;  1REV A;  3CJB A;  5AQM A;  1Q7Y O;  2O8E A;  1GLF O;  4AHT A;  1E4F T;  1EET A;  3JSM A;  4GV9 A;  3ULE A;  3MED A;  1NK8 A;  1JCF A;  1W2B M;  4B3T K;  2A1R A;  4GKK K;  2YKM A;  5CR4 A;  3ENH A;  3VPZ A;  4JI1 K;  5AQP A;  3QIO A;  3ZSZ A;  1HPZ A;  1JLA A;  3LDQ A;  3V1R A;  5AQV A;  4HUE A;  5JMV A;  1C0U A;  4E1N A;  3TTC A;  4OGE A;  4M7X A;  3NVK A;  4H5R A;  1QSL A;  4CJW A;  3HJF A;  3G0Z A;  3VET A;  4CZH A;  5AQQ A;  3DMJ A;  3QNO A;  3NH0 A;  2A42 A;  3WXI A;  3THV A;  1VQL N;  1HKC A;  4F3O A;  5AZI B;  3O9Q A;  1HJR A;  3NDK A;  3VQ8 A;  3F9K A;  4HCC A;  2HF4 A;  2G8U A;  3CQX A;  4EZ6 A;  1CXU A;  3V9S A;  4YOY A;  3HST B;  3M8R A;  1YTA A;  4W5R A;  3T1A A;  4FJ8 A;  3MN9 A;  5KTQ A;  1JL2 A;  4CZL A;  1JCE A;  1WSF A;  3OBY A;  1IBK K;  3LP3 A;  4DSF A;  1U2V B;  3QBX A;  1ATR A;  3K5L A;  2GWK A;  3VF4 A;  1T03 A;  2G8F A;  1MA9 B;  4CK2 A;  4H0Y B;  1RT5 A;  3DXM A;  5BR9 A;  4AHR A;  1IBL K;  3T1H K;  1KVA A;  3CCU N;  3OYN A;  2QEX N;  1IO2 A;  4KH6 A;  2IGI A;  2YKN A;  1S5J A;  3QLH A;  4JI7 K;  4DF8 A;  4IO9 L;  5AQX A;  1XWL A;  3GG4 A;  4CJ7 A;  1HJO A;  1TAU A;  1NWK A;  5C12 A;  1CXQ A;  5BPM A;  3EL2 A;  3QML A;  2CH6 A;  1M1K O;  3D7E O;  2WOM A;  5M1Q A;  1K8A O;  1EWR A;  5GAD P;  5AQW A;  4JD2 A;  2G8I A;  1YT3 A;  3C0B A;  3TR8 A;  1OH5 A;  1VK0 A;  3C94 A;  5SWM A;  1RT6 A;  5AQN A;  2P9L A;  3B8A X;  3B6O A;  3C65 A;  1K9M O;  3I8D A;  5EY4 A;  4DQR A;  1JLB A;  3SYZ A;  4CZI A;  3MMV A;  4DQQ A;  4N5S A;  1L3U A;  4YNQ A;  4B8C A;  4F3T A;  2F9W A;  3VQ6 A;  4K42 A;  3PIO L;  2QXF A;  4BR9 A;  1TKD A;  3LPT A;  4CD3 A;  3A5O C;  4IFV A;  3BEX A;  2HB5 A;  1WSH A;  3VEY A;  4BRM A;  4M42 A;  1D4X A;  3BUZ B;  1SKS A;  2YV0 X;  1D9F A;  4BE1 A;  4M3Z A;  3O3F A;  2WON A;  1RT7 A;  2RF2 A;  3C7N B;  3TAR A;  3AVJ A;  2P9I B;  4YOT A;  3AA3 A;  4JK8 A;  4PHT X;  4YDU C;  3LP2 A;  3MX2 A;  3CC4 N;  2FSJ A;  4CGD A;  3LDP A;  4LFC K;  1KC8 O;  4PA1 A;  1RDW X;  3AAR A;  4M3X A;  1RT4 A;  1IV0 A;  3HVR A;  1BHL A;  1G99 A;  1K73 O;  4M7Y A;  3R6M A;  1J5O A;  2RE2 A;  1NM1 A;  3IRX A;  4OPA A;  1K8K B;  5E84 A;  1T7P A;  4JYA K;  3SUO A;  1NOZ A;  3VMF B;  1M90 O;  5TKW A;  3PV8 A;  1S72 N;  1VQP N;  3C6T A;  2G8H A;  4F4K A;  4H8K A;  2HHQ A;  2QWP A;  3WXK A;  2WUS A;  3NH1 A;  3G10 A;  1Q9X A;  3PIP L;  4EFH A;  1BCO A;  3EE8 A;  3WNH A;  4ID5 A;  4CEE A;  3D45 A;  1WAF A;  2QK9 A;  3NGI A;  3QEW A;  3NF9 A;  3ZSX A;  4M3Y A;  5CYM A;  4B1W B;  3RSE A;  3VF2 A;  4C1N K;  4ZTF A;  3D2E B;  3M3Z A;  2QI2 A;  3SV4 A;  4H0X B;  4E7K A;  1N6Q A;  4NYN A;  1NGI A;  4M45 A;  5IT9 O;  2KFN A;  1EQY A;  3OYE A;  4N47 A;  2IVN A;  3U3G A;  1VQK N;  3MEG A;  3ZX3 A;  4BQZ A;  4FWP A;  3SAG A;  4CJV A;  4GKJ K;  3TTD A;  4CJ5 A;  3OYL A;  4DHY A;  4DQ8 A;  1T3V A;  4CF2 A;  3SUQ A;  1S1U A;  3RMC A;  4OKK A;  4IOC L;  2O8D A;  4PWD A;  2ETJ A;  3LP1 A;  4YOW A;  4H03 B;  1TYQ A;  4EHT A;  4I6M A;  5CYQ A;  4FLZ A;  3FFI A;  2Q36 A;  1ZBI A;  1NK6 A;  1A5W A;  1HLU A;  4OLB A;  1RDC A;  5EU7 A;  4LFB K;  2BAN A;  3H3O B;  3OYJ A;  2OPQ A;  4DFJ A;  3SAH A;  3G71 N;  3SUN A;  2J4R A;  2HHX A;  2YNF A;  1U49 A;  1A5X A;  3WXL A;  2HHH K;  2QTD A;  4LH4 A;  4CBU A;  2OCE A;  3LWL A;  3CCL N;  4E19 A;  4ILJ A;  2IIR A;  4E7J A;  1B92 A;  4CHY A;  4Z4I A;  4FM0 A;  3GDQ A;  4H0P A;  4NLB A;  3DOL A;  4BC5 A;  4FPB A;  4ID1 A;  1IG9 A;  4DR4 K;  1VQ7 N;  4DQS A;  2FBX A;  3I33 A;  1NJW A;  4XIU A;  4WQ4 A;  4IG0 A;  1J6Z A;  1EP4 A;  4Z94 A;  1HNV A;  1Q86 O;  4H4O A;  3VOV A;  4C23 A;  3AVH A;  2GX9 A;  3TAG A;  3J81 O;  2P51 A;  4DUY K;  4G9Z A;  5M1K A;  2XY8 A;  1RCH A;  3WXJ A;  3BGR A;  4CEO A;  1FKO A;  1RDU A;  3S41 A;  1RFQ A;  4NXN K;  4CHP A;  1YHQ N;  1UAX A;  3ZSV A;  4AH9 A;  1TK5 A;  4F2S A;  3F5T A;  2JWK A;  2A40 A;  3KHY A;  4FJM A;  1T8E A;  3BZC A;  4O5B A;  3EYZ A;  4J2B A;  3VEW A;  3V9X A;  4E7H A;  1JLG A;  5H1S Q;  4IZ9 A;  3HO1 A;  4XH4 A;  1S22 A;  3PSF A;  1Z6R A;  5C24 A;  5FPM A;  4B9S A;  4Z4C A;  4DV1 K;  4B3R K;  4K41 A;  5AZJ A;  3UIQ A;  3BZK A;  1VSF A;  4JAX A;  3ISN C;  4FSV A;  4AQY K;  4X62 K;  3D0P A;  1NGC A;  4FL9 A;  3SJH A;  5KI6 A;  1ZYQ A;  1WSG A;  1NKB A;  4CK1 A;  4B1Y B;  1RBV A;  3LM2 A;  4KTW A;  1D8Y A;  1T05 A;  4I7F A;  2NRR A;  1Z25 A;  3ALY A;  4JKA A;  3IDH A;  5KPZ A;  5SZT A;  4KH4 A;  3L2U A;  4ELT A;  3R3L A;  3J7Z O;  4JI5 K;  3L2W A;  4RWT A;  4A2B A;  1BI4 A;  1U04 A;  2E2N A;  4FWS A;  1KD1 O;  1L5U A;  4GVE A;  5J2N A;  1BIS A;  3KIO A;  4B9Q A;  1BO5 O;  2P9N A;  3NH2 A;  3NGZ A;  3DLL L;  1NK0 A;  3QIP A;  1ZBF A;  1EKE A;  3U6F A;  3L3V A;  4F2R A;  4CE9 A;  3BY5 A;  2P9K A;  4QCL A;  4B3S K;  4WE1 A;  3RR8 A;  1HX1 A;  1VQ9 N;  2B5J A;  3T19 A;  4CER A;  4FZZ A;  3THW B;  3A5N C;  2VYP A;  4CGG A;  2ZQB A;  4JI3 K;  1FW6 A;  2HHV A;  2XRI A;  2F8T A;  4CBX A;  3NAE A;  3WNF A;  3LAM A;  5AFU A;  2E2P A;  2W6L A;  2D5R A;  3TSU A;  3O4Q A;  4H5W A;  1YJW N;  4A5B A;  3HM9 A;  1TAQ A;  3DYA A;  4BR7 A;  2EWS A;  5HP1 A;  4JS4 A;  4BWJ A;  3PUF A;  1KSP A;  3KLG A;  3SQ1 A;  4AHV A;  3P39 A;  3NHG A;  2OPR A;  4C8M A;  2YHA A;  4A57 A;  2ZGY A;  2VQE K;  4B3M K;  2OZM A;  2OZS A;  1LCU A;  2KZZ A;  4NO7 A;  5AQZ A;  4DR2 K;  4BRP A;  3CC7 N;  3RRG A;  1FK9 A;  1QSS A;  1N5Y A;  4C8O A;  4CEA A;  5GIP A;  5HBM A;  3OYI A;  1YUW A;  5C15 A;  2KTQ A;  1VSJ A;  2KQ2 A;  1S1V A;  2HF3 A;  1UA0 A;  5LJV A;  4FVM A;  5A2Q O;  3SZ2 A;  1IKY A;  4PL7 A;  1W9H A;  3V6D A;  3E9L A;  3O9T A;  2UUB K;  4HTU A;  1GOA A;  4JRQ A;  4W5N A;  3BP8 A;  3H6E A;  4CJE A;  4DMN A;  3CME N;  1WN7 A;  1C0M A;  3OHR A;  2PAV A;  4JK7 A;  2GUP A;  1QHA A;  3T3F A;  1SQK A;  3CCQ N;  1S1W A;  1KTQ A;  2O4G A;  3TPQ A;  1QVG M;  4R79 A;  1R59 O;  3AO3 A;  1E4G T;  2IVO A;  2A6A A;  1WUA A;  4MLH A;  3R9P A;  4C1N I;  3OYC A;  3CQ8 A;  2LSN A;  3F9M A;  4CJS A;  2O8B B;  5GIN A;  2UXC K;  1O13 A;  2ZWH A;  3L3U A;  1HNI A;  1MDU B;  4JEP A;  4IDK A;  1LWC A;  2P9U B;  4M63 C;  2F7T A;  4E3S A;  2HVI A;  1VQM N;  4IEI A;  5F0X A;  2QKB A;  1EWQ A;  2WC9 A;  2ASP A;  4B9L A;  4JKG A;  4ILH A;  3PX4 A;  2PZS A;  2W6K A;  3E9O A;  1YJN N;  3S3M A;  1WSI A;  1F21 A;  1IBM K;  1RTJ A;  4FJX A;  4F9O A;  1P8Z A;  3PY8 A;  4DV2 K;  4CIE A;  1UA1 A;  5D3G A;  2GTD A;  4IXC A;  3NFA A;  3LDN A;  1QQM A;  4LF6 K;  2Q2R A;  3F2K A;  1HNW K;  1G15 A;  4U67 L;  2YNI A;  4B9T A;  1WBD A;  3HTV A;  2YHY A;  3SQ0 A;  3OYD A;  3O4N A;  5KQD A;  2G8K A;  2GBZ A;  4DU1 A;  1QTM A;  1KLM A;  3KLH A;  3C95 A;  3DOK A;  5AQU A;  2Z1I A;  1LW0 A;  3IFR A;  4A2A A;  3THX B;  1VQ5 N;  2YHW A;  5JVG L;  1R0A A;  2HBL A;  3NCI A;  3RMB A;  1TUY A;  2UUC K;  4K43 A;  4BY9 C;  5EX5 A;  4CGF A;  1HQE A;  3H45 C;  3KD5 E;  4PKH A;  5BN8 A;  4CJQ A;  1RTH A;  3TWH A;  4JS5 A;  3OYA A;  3V1Q A;  2QWM A;  3TAQ A;  4WQ5 A;  1C0T A;  4KI6 A;  1RTI A;  5AQS A;  1SKR A;  5DM6 L;  1I94 K;  1FXX A;  2RPI A;  1GLE G;  3FLC O;  3JS6 A;  3KJV A;  1I3A A;  1QSY A;  3E66 A;  4YOR A;  2UXB K;  4B1V A;  2CH5 A;  3OW2 M;  5BRF A;  4DKW A;  5HRR A;  2XHB A;  2D0B A;  3AO4 A;  4O0I A;  5BRE A;  1NGF A;  2OAN A;  5FPD A;  1JKH A;  5AJ3 K;  2F4V K;  1ASU A;  3AGR A;  4PY5 A;  1UWB A;  4H5T A;  2FC0 A;  1N34 K;  1I39 A;  4L8R B;  4FJN A;  3HPO A;  3RR7 A;  2O8C B;  2JGU A;  4IKF A;  1LW2 A;  4JI2 K;  3HVT A;  3VQ5 A;  4DR5 K;  4WFA L;  1RT1 A;  3AVL A;  4CED A;  4PL8 A;  3Q7C A;  3FZM A;  5LJW A;  5LY3 A;  1CZB A;  3FE1 A;  3F73 A;  4CFB A;  4HHT A;  5BPN A;  4KO0 A;  3BDP A;  1MWK A;  3ZT2 A;  3UKU A;  4CHQ A;  2D0C A;  2XY7 A;  3HOT A;  3L0Q A;  5CE3 A;  4DR3 K;  3HPH A;  4FPA A;  2QM1 A;  3DXK B;  4YFU A;  4R5P A;  3PLA A;  3AVF A;  4OVL A;  3H1V X;  1GOB A;  3UKR A;  3VQ4 A;  1H1V A;  3DWL A;  3ZCM A;  2E4L A;  3TAF A;  4UY8 O;  2V51 B;  4NXM K;  4BGA A;  4DQI A;  3DLK A;  3V9W A;  2P5O A;  1OH7 A;  4CEB A;  1FKP A;  2Q97 A;  3NBP A;  3TI0 A;  3H3N O;  4B1Z A;  4PUO A;  4B3O A;  3WEE A;  4M3U A;  3HBT A;  2D0O A;  2FXU A;  3NGY A;  1L3V A;  1XC9 A;  3AVG A;  4GW6 A;  5FPE A;  2ZJR L;  1N36 K;  3OYB A;  3CCJ N;  2ITG A;  3VQD A;  4BDZ A;  3BF3 A;  1DLO A;  3HP6 A;  5AQF A;  3DLH A;  4JHD B;  2DPN A;  3HP9 A;  3AVN A;  4CJP A;  3C6U A;  4I9L A;  2HHW A;  4BRO A;  3SMP A;  3L2R A;  5CY4 A;  2OTL N;  4KB1 A;  4CFA A;  2R7Y A;  3ZSQ A;  1K6Y A;  4B9V A;  3LL3 A;  3WNE A;  3HM8 A;  4H0V B;  2UUA K;  4M3R A;  5F1X A;  3L4Q A;  1B9F A;  4BRF A;  1RDB A;  2OTJ N;  2VWB A;  3S3O A;  4KHW A;  3KVG A;  2HST A;  3VTI A;  1VHX A;  4IO8 A;  4E0D A;  4FLT A;  3K2P A;  4O44 A;  4MDB A;  2O8F B;  3CJ1 A;  2PBD A;  2IS3 A;  3L2Q A;  1TV6 A;  3MEC A;  3VF6 A;  2NRV A;  3FZK A;  4O5F A;  4W5O A;  1HYV A;  4DFM A;  3CJ7 A;  3EY1 A;  4H4M A;  4KRE A;  4IJN A;  2OPS A;  2HOE A;  2JLE A;  1EO1 A;  1T6C A;  4BR4 A;  3G4S N;  5HRO A;  1QHT A;  4G1Q A;  3CFO A;  5AR0 A;  3EKU A;  4NCB A;  2O4I A;  1RBR A;  4FVU A;  2BTF A;  1NJZ A;  2P9P A;  3GBT A;  3HOS A;  3VQP A;  3QER A;  4K25 A;  2X6S A;  4HUF A;  1BIU A;  2ZF5 O;  2Q0U A;  4DTR A;  4CHZ A;  2ZD1 A;  2P9S A;  4XH5 A;  2VGN A;  3QFP A;  4BR0 A;  1YIT N;  1QQN A;  4DSE A;  3KWI A;  5EOY A;  3THY A;  2HNZ A;  4DU3 A;  3D2F B;  4Z4F A;  1XNR K;  4BE0 A;  2ITM A;  5BRH A;  4CD1 A;  5I9E B;  2AJQ A;  3JYT A;  5C25 A;  5KPT A;  3AO5 A;  3CCR N;  4FOE A;  1RT3 A;  5HRS A;  4N41 A;  1KVB A;  2O8E B;  3WQT A;  4DTN A;  4BDY A;  3O4W A;  4EHU A;  5M1O A;  4ILG B;  1TL3 A;  2AP1 A;  3B6P A;  1HNX K;  3ULE B;  2PFU A;  3IMX A;  4CCH A;  1ILY A;  4DWI A;  1JLQ A;  1S9E A;  4BR5 A;  2I5J A;  2IVP A;  3FFK B;  3KD1 E;  3KKS A;  3ZEU A;  3NE6 A;  1D9D A;  4IOA L;  1NBW A;  5AQT A;  3K0S A;  4XEI A;  4LSL A;  4AM7 A;  4C8N A;  3LM9 A;  4IFE A;  4CW7 B;  4KHP K;  5C0Y A;  1BQM A;  4CIG A;  3I0R A;  3OVN A;  4H5V A;  2EHG A;  4B9M A;  1ZBU A;  3U4L A;  4CGH A;  4FWK A;  5C2D A;  3ENB A;  4M3W A;  3CMA N;  1Q81 O;  4KBO A;  2YHX A;  4OPJ A;  2VG5 A;  3K58 A;  4EP4 A;  5CHI A;  4FW2 A;  5I42 A;  1VSE A;  4HVJ A;  2OYQ A;  4K8X A;  2BH1 A;  5GIO A;  3NVM A;  4FOI A;  3D6R A;  2D4W A;  1IKV A;  4HTL A;  4CK3 A;  4LF9 K;  3PSI A;  4FZX C;  3KLE A;  3I0S A;  4BG8 A;  4FO0 A;  4DFK A;  4JKB A;  4AM6 A;  3QEX A;  2E2O A;  5GAE P;  3VQB A;  4MFB A;  3QB0 A;  2HBJ A;  2NLX A;  1SL2 A;  4JKF A;  3HYF A;  3HPG A;  4OX9 K;  3DXM B;  1BA1 A;  4CEQ A;  1YXQ A;  4QS7 A;  3UKR B;  1GLD G;  1NGA A;  2NRW A;  1KCF A;  5T7B A;  1JXB A;  2E88 A;  4FWL A;  4JN4 A;  4CEF A;  1LAW A;  1LOT B;  4EIA A;  5KRT A;  5FRM A;  1KQS M;  1BGX T;  3O08 A;  2Y1J A;  1NNE A;  3K5O A;  1RBU A;  3VN5 A;  2Z1J A;  2VWJ A;  2BE2 A;  1S6P A;  3ZT1 A;  4MO4 A;  4CGI A;  3L4I A;  1IKW A;  1BIZ A;  3CER A;  4FCY A;  4JD2 B;  5KGX A;  1XC3 A;  4CJU A;  2GWJ A;  5M1P A;  4WFB L;  5MLC Q;  4WYB A;  1WOQ A;  1YVN A;  2P9L B;  3MAQ A;  2IAJ A;  1T6D A;  2NZT A;  3HRG A;  3G6E N;  1VAZ A;  4KHU A;  3AY9 A;  4V19 S;  3JAM O;  5GAH P;  4I9Q A;  4DR6 K;  3TSP A;  3K9K A;  1JL1 A;  1T44 A;  5FRO A;  2AA4 A;  3NF7 A;  3DRP A;  4FWR A;  4CZG A;  2ASO A;  3AA4 A;  3WNG A;  3QNN A;  3VQC A;  3DAW A;  3KK3 A;  4JLH A;  4N76 A;  2JWL A;  1NGB A;  1NKC A;  4BE2 A;  4NB4 A;  4BRA A;  2ZJQ L;  2KZM A;  4CJF A;  2YI1 A;  4LF5 K;  4HWI A;  3ULD A;  4AHS A;  1OKJ A;  2QWL A;  3V4I A;  3O6W A;  4MDA A;  1BCM A;  3NMU A;  5ADX A;  2W41 A;  5I3U A;  1EXQ A;  3CM6 A;  1DTT A;  3J80 O;  1XHX A;  1Z26 A;  3M8P A;  4FWM A;  4FZY A;  2B4J A;  1IH7 A;  2OPP A;  3M8Q A;  1ITG A;  2BGG A;  2VWK A;  3HK2 A;  2HHT A;  1NLV A;  2HVH A;  1SV5 A;  3TTF A;  3KK7 A;  4J2A A;  3KZB A;  1RDD A;  5AZI A;  3Q7B A;  4BVP A;  4GV6 A;  4L3Q A;  1S9G A;  3EN9 A;  3J7Y P;  1OH6 A;  1HKG A;  1U47 A;  1NOY A;  4DSL A;  4FK2 A;  1VSL A;  4IWV A;  4Z4E A;  3IKM A;  4ZTJ A;  2RKI A;  3RSE B;  4BRI A;  3PX0 A;  5LL6 Z;  2DFE A;  3K5N A;  2WBN A;  3MEE A;  4LD0 A;  1NU0 A;  3AVI A;  1OVY A;  3LAK A;  3CFP A;  1X9S A;  1C6V A;  4JK9 A;  3OJS A;  1HYZ A;  1W7A A;  5JS1 A;  2XY6 A;  3VEO A;  2FBY A;  1U2V A;  1D5A A;  3CPE A;  1TVR A;  3OTO K;  1Q9Y A;  3A5L C;  5EVZ A;  3AAQ A;  1TKZ A;  3CJC A;  2H3G X;  4E89 A;  2QWQ A;  5AQO A;  4GVM A;  4FJI A;  1SAZ A;  5EXW A;  1KFD A;  4FW1 A;  4F8R A;  2O8D B;  3VGL A;  4HCB A;  1TYQ B;  4I6M B;  1LWE A;  3FZF A;  4DTO A;  4FJH A;  1E3M A;  2CGL A;  4OLA A;  3QBW A;  2X74 A;  2YJF A;  2E20 A;  4BVO A;  3RTV A;  4DQP A;  1VQN N;  2QKK A;  4FK4 A;  4KH5 A;  4BRK A;  3WXM B;  4CGJ A;  1WB9 A;  2V7Y A;  4WQ4 C;  1LWF A;  1GLA G;  1NGG A;  5DK5 A;  3VQE A;  4C8K A;  1RTD A;  4KB0 A;  1BOT O;  3M1F A;  1C1A A;  4JI4 K;  5J1E A;  5J2M A;  4FWQ A;  2F8S A;  1JLE A;  1NGH A;  4X65 K;  4AIL C;  3SUP A;  4FJJ A;  3QO9 A;  3E9P A;  2HHU A;  1TL1 A;  1HUX A;  4CJR A; 
#chains in the Genus database with same CATH homology
 5BPN A;  1NGJ A;  1VQ8 N;  3UB5 A;  1MWK A;  4B1W B;  3RSE A;  2A41 A;  3VF2 A;  3UKU A;  2VCP A;  4C1N K;  3D2E B;  3M3Z A;  4PKG A;  1ZBS A;  2QI2 A;  4H0X B;  5E26 A;  4BRG A;  4JKH A;  3ATU A;  1NGI A;  3HOT A;  3L0Q A;  5CE3 A;  1TUU A;  2E1Z A;  4FPA A;  2QM1 A;  3DXK B;  3IUC A;  3PLA A;  1EQY A;  5AQY A;  1P90 A;  3H1V X;  4ISF A;  3UKR A;  1DEJ A;  1H1V A;  2IVN A;  3DWL A;  1VQK N;  4MO5 A;  4BC4 A;  3ZX3 A;  4BQZ A;  3VES A;  4UY8 O;  4FWP A;  1QZ5 A;  3SAG A;  3I55 N;  2V51 B;  3A8Y A;  2CGK A;  3O9U A;  4RCH A;  3TTD A;  4BGA A;  3O1B A;  3C7N A;  4IOX A;  4DHY A;  4DQ8 A;  3A5M C;  1BU6 O;  4A59 A;  1VQO N;  2P9I A;  1T3V A;  2Q97 A;  1JJ2 M;  3H3N O;  2QW9 A;  4IOC L;  4B1Z A;  4BQL A;  4YOW A;  4H03 B;  1TYQ A;  4EHT A;  4I6M A;  3ID8 A;  3WEE A;  2A5X A;  3GE1 A;  3HBT A;  4CI6 A;  5FPN A;  2D0O A;  3QIC A;  2Q36 A;  3GOI A;  1GLL O;  1YF5 L;  2FXU A;  2V7Z A;  3MN6 A;  2E1Y A;  3CCM N;  1IG8 A;  3O1W A;  5FPE A;  2ZJR L;  1HLU A;  5BPL A;  4H0O A;  2NRX A;  2P9P B;  3KWG A;  3SBG A;  3P38 A;  3UE5 A;  3CCJ N;  3H3O B;  3BF3 A;  3HSC A;  5M1N A;  3O8M A;  1VQ6 N;  3VER A;  5AQF A;  3CIP A;  1YIJ N;  4JHD B;  4BRE A;  3ATV A;  2P9S B;  2DPN A;  3SAH A;  3R1X A;  3G71 N;  3QDK A;  3U9Z A;  2J4R A;  3QFU A;  4CZE A;  4ISE A;  3MN5 A;  3HI0 A;  4BRO A;  2QWN A;  5AZJ B;  3M6G A;  4H5N A;  3SMP A;  3WXL A;  4BGB A;  2QTD A;  4E1J A;  4YDU A;  2ZGZ A;  3BF1 A;  4CBU A;  3CCL N;  2Q31 A;  3AGK A;  2OTL N;  3FGU A;  3DJC A;  3G25 A;  2IIR A;  3LL3 A;  3LDL A;  3HM8 A;  4ILJ A;  4CZK A;  1DGK N;  4IDH A;  5AQG A;  2FLO A;  3D2E A;  4H0V B;  3GDQ A;  4H0P A;  3MWT A;  5F1X A;  3L4Q A;  4NLB A;  3SK3 A;  5KQ8 A;  2QA4 N;  2RHK A;  4BC5 A;  4FPB A;  1NGE A;  3VEZ A;  4BRF A;  2OTJ N;  3DXK A;  3I8B A;  2VWB A;  1VQ7 N;  1IJJ A;  4CZM A;  3I33 A;  3KVG A;  2HST A;  4WQ4 A;  3VTI A;  4IO8 A;  1J6Z A;  4Z94 A;  1ATS A;  4M7Y A;  2VGM A;  1N8R O;  1Q86 O;  4MDB A;  5AQK A;  3VOV A;  4C23 A;  2KLA A;  2GX9 A;  3ZEU B;  3ZX2 A;  3CJ1 A;  2PBD A;  2V52 B;  4G9Z A;  3EO3 A;  4O5F A;  2NRV A;  3FZK A;  4RTF D;  3VF6 A;  2I7P A;  4BRQ A;  5M1K A;  1Q18 A;  3WXJ A;  4BG9 A;  1KAZ A;  3CJ7 A;  4IJN A;  2P9N B;  1BUP A;  1YAG A;  4XH1 A;  4O8K A;  2KKZ A;  5AQL A;  1QVF M;  1RDU A;  3S41 A;  2HOE A;  1EO1 A;  1RFQ A;  1T6C A;  4BR4 A;  1YHQ N;  3G4S N;  2P9K B;  2NNW A;  1Y64 A;  5AR0 A;  3EKU A;  3F5T A;  2JWK A;  4FVU A;  2A40 A;  3KHY A;  3O80 A;  2E2Q A;  2BTF A;  3T7Z A;  2P9P A;  3GBT A;  3ZET B;  3VEW A;  3HOS A;  4K25 A;  1C0F A;  2E8A A;  3GL1 A;  5H1S Q;  2FF6 A;  4IZ9 A;  4XH4 A;  2ZF5 O;  2FSK A;  2Q0U A;  5C2F A;  5ELZ A;  3A0I X;  3ZYY X;  3MCP A;  2HBK A;  4JHD A;  1S22 A;  2P9S A;  4XH5 A;  2VGN A;  3QFP A;  1Z6R A;  2HMP A;  2QWO A;  2UYT A;  4BR0 A;  5FPM A;  1YIT N;  1QQN A;  2F9T A;  3N4P A;  3KWI A;  2D0P A;  1KAY A;  3CJA A;  4JKD A;  4K41 A;  5EOY A;  5AZJ A;  4AF1 A;  3D2F B;  1DKG D;  5JLF A;  2ITM A;  4JAX A;  5BRH A;  4FSV A;  3RVC A;  5TKY A;  4CD1 A;  5I9E B;  1ESV A;  5ADX H;  3CCV N;  1NGC A;  4FL9 A;  3SJH A;  1BWF O;  1RGI A;  4FOE A;  1U6Z A;  3T69 A;  1XUP O;  5KPT A;  3MDQ A;  3WQT A;  3SLC A;  3TSQ A;  3O4W A;  4B1Y B;  4EHU A;  3LM2 A;  3CCE N;  1NMD A;  5M1O A;  4ILG B;  4JKE A;  2AP1 A;  5HOO A;  2HBM A;  2PFU A;  2NRR A;  3IMX A;  4JKA A;  3ULE B;  3ZX0 A;  3IDH A;  3SAF A;  3I56 N;  5KPZ A;  4WCE L;  1ILY A;  1SS6 A;  4FWN A;  4KH4 A;  3R3L A;  1CZA N;  2YJE A;  4BR5 A;  3J7Z O;  2IVP A;  4RWT A;  2FF3 B;  3H46 O;  3FFK B;  2Q0R A;  3LDO A;  4IJA A;  5AFU H;  3TU5 A;  2I7N A;  4A2B A;  4BRL A;  3ZEU A;  4IOA L;  4BRH A;  2E2N A;  4BRC A;  4FWS A;  1NBW A;  4WF9 L;  5AQT A;  1KD1 O;  4XEI A;  4GVE A;  1DT9 A;  1KAX A;  4ISG A;  4AM7 A;  3U9D A;  4B9Q A;  2W40 A;  3HZ6 A;  1BO5 O;  2P9N A;  3CJ9 A;  3DLL L;  3LM9 A;  4IFE A;  3W0L A;  1K8K A;  5HL7 L;  5C0Y A;  5JVH L;  2P9K A;  3VEN A;  4JNE A;  3VGM A;  2FSN A;  5GAG P;  4H0T B;  1KXP A;  4B1X B;  1V4S A;  4DB3 A;  4H5V A;  4GNI A;  3U4L A;  1HX1 A;  4FWK A;  3ENO A;  5C2D A;  1VQ9 N;  3ENB A;  2NRZ A;  5C10 A;  4CZF A;  3A5N C;  3FZL A;  5JIC A;  2VYP A;  3CMA N;  1Q81 O;  2QXL A;  4KBO A;  3CF5 L;  5AQI A;  1V4T A;  2YHX A;  3MN7 A;  3VTH A;  4DCH A;  3VEX A;  5CHI A;  2BUP A;  1S3X A;  4CBX A;  4QS8 A;  2BH1 A;  5GIO A;  3NVM A;  2E2P A;  3WT0 A;  4BC2 A;  5AFU A;  3CCS N;  1NGD A;  3TSU A;  4FOI A;  3D6R A;  4H5W A;  1YJW N;  3OA9 A;  3OBW A;  2D4W A;  4A5B A;  3D2F A;  3P4I A;  4HTL A;  5M1F A;  4BR7 A;  4BR2 A;  3CC2 N;  3C6H A;  2EWS A;  4BG8 A;  5F2R A;  4FO0 A;  3CET A;  3EKS A;  4JKB A;  4B1U B;  4AM6 A;  3CD6 N;  2YCH A;  2E2O A;  3CJB A;  5GAE P;  5AQM A;  1Q7Y O;  1GLF O;  4MLE A;  1E4F T;  3QB0 A;  3P39 A;  2HBJ A;  2NLX A;  4JKF A;  4JKG B;  4GV9 A;  3ULE A;  4A57 A;  2ZGY A;  2D1K A;  3DXM B;  1BA1 A;  1LCU A;  4GV3 A;  1JCF A;  1YXQ A;  4QS7 A;  3UKR B;  1W2B M;  1GLD G;  4NO7 A;  5AQZ A;  4BRP A;  3CC7 N;  1NGA A;  2NRW A;  4YOU A;  5CR4 A;  1QQO A;  2E88 A;  4FWL A;  3ENH A;  4JN4 A;  3VPZ A;  4EIA A;  1LOT B;  5GIP A;  3R8E A;  1KQS M;  5AQP A;  3O08 A;  1YUW A;  4BRN A;  5C15 A;  3LDQ A;  5JLH A;  2HF3 A;  1BG3 A;  5LJV A;  5AQV A;  5JMV A;  3CQY A;  4PL7 A;  3TTC A;  4MO4 A;  3MX5 A;  4YOX A;  3E9L A;  3O9T A;  4M7X A;  3L4I A;  4H5R A;  3CER A;  3NVK A;  4NLC A;  4JD2 B;  1XC3 A;  3VGK A;  3BP8 A;  3H6E A;  3CI5 A;  3SBT A;  4WQ5 C;  2GWJ A;  5DM7 L;  3VET A;  5M1P A;  3CME N;  3OHR A;  2PAV A;  4JK7 A;  2GUP A;  1QHA A;  4WYB A;  1SQK A;  5AQQ A;  1WOQ A;  4CZH A;  5MLC Q;  3CCQ N;  1YVN A;  2P9L B;  1QVG M;  3TPQ A;  2NZT A;  1T6D A;  4R79 A;  2A42 A;  3WXI A;  1R59 O;  3HRG A;  3G6E N;  1VQL N;  1HKC A;  4FWO A;  5AZI B;  1E4G T;  1VAZ A;  2A6A A;  2IVO A;  2Q1N A;  3O9Q A;  1WUA A;  4MLH A;  3R9P A;  3AY9 A;  4C1N I;  3F9M A;  5GIN A;  2KHO A;  5GAH P;  1O13 A;  4BC3 A;  2HF4 A;  2ZWH A;  3TSP A;  3K9K A;  4LC9 B;  3CQX A;  1MDU B;  1T44 A;  4JEP A;  1VQ4 N;  2AA4 A;  1X9J A;  5KPR A;  4YOY A;  1ZXO A;  3M5R A;  4FWR A;  4CZG A;  2P9U B;  2ASO A;  4M63 C;  3O5B A;  3MN9 A;  2F7T A;  2ZJP L;  3DAW A;  4CZL A;  1JCE A;  1VQM N;  4IEI A;  5F0X A;  3OBY A;  2WC9 A;  2JWL A;  4O8U A;  1U2V B;  2ASP A;  3QBX A;  1ATR A;  1NGB A;  4QS9 A;  3FZH A;  2GWK A;  5BRD A;  2CGJ A;  4JKG A;  3VF4 A;  1MA9 B;  4ILH A;  2YX6 A;  4H0Y B;  4NB4 A;  4BRA A;  2ZJQ L;  5AQR A;  3DXM A;  5BR9 A;  4BRD A;  3CHW A;  3CCU N;  2YI1 A;  4HWI A;  3VEV A;  2QEX N;  3E9O A;  1YJN N;  4KH6 A;  1OKJ A;  1X3M A;  2QWL A;  3O6W A;  2A3Z A;  4MDA A;  3J8A A;  5ADX A;  4IO9 L;  2W41 A;  3NMU A;  5AQX A;  4JKC A;  3GG4 A;  4CJ7 A;  1HJO A;  1P8Z A;  4F9O A;  1NWK A;  4CBW A;  5C12 A;  2GTD A;  5BPM A;  3EL2 A;  3QML A;  2CH6 A;  4IXC A;  3D7E O;  3LDN A;  5M1Q A;  1M1K O;  3H1Q A;  2NRT A;  1QQM A;  1K8A O;  2Q2R A;  3F2K A;  3ZET A;  5GAD P;  1BA0 A;  1GLJ O;  5AQW A;  1XQS C;  1W97 L;  4JD2 A;  4U67 L;  4CZJ A;  4FWM A;  3SMS A;  4Y0W A;  3C0B A;  3U8X A;  4U7B A;  3HTV A;  2YHY A;  1HKB A;  5KQD A;  5AQN A;  2P9L A;  3B8A X;  1NLV A;  1X3N A;  2GEM A;  1QZ6 A;  5AQU A;  3C65 A;  1K9M O;  3IFR A;  5EY4 A;  3KK7 A;  3TTF A;  3KZB A;  5AZI A;  4A2A A;  3Q7B A;  1VQ5 N;  4BVP A;  4GV6 A;  5BN9 A;  2YHW A;  4L3Q A;  3EN9 A;  2HBL A;  3EZW A;  1C0G A;  1HKG A;  3MMV A;  4CZI A;  5JVG L;  3O9R A;  1TUY A;  4IWV A;  3IKM A;  1HPM A;  4WFN L;  3RSE B;  1GLB G;  4K43 A;  3UKU B;  3MWP A;  4PKI A;  4BRI A;  4BY9 C;  5EX5 A;  4OO1 J;  3EE9 A;  2F9W A;  3H45 C;  1ATN A;  4GY2 B;  2WBN A;  4K42 A;  2P9U A;  4PKH A;  4BR9 A;  3PIO L;  5BN8 A;  3WQU A;  4A62 A;  3K9J A;  4CD3 A;  5B8H A;  1OVY A;  3P31 A;  3A5O C;  3ID6 A;  4J8F A;  3BEX A;  4JK9 A;  3CXC M;  3W3D A;  1ZC6 A;  3VEY A;  4BRM A;  3O9S A;  2WFB A;  4EAH D;  1D4X A;  2QWM A;  1JCG A;  3BUZ B;  1SZ2 A;  3VEO A;  4WQ5 A;  1U2V A;  5AQS A;  3AAP A;  3CPE A;  3CPW M;  5DM6 L;  2QWR A;  3C7N B;  3A5L C;  5EVZ A;  3L6Q A;  3AAQ A;  3MCA B;  3CJC A;  3JXU A;  2H3G X;  5AQJ A;  2P9I B;  4YOT A;  4JK8 A;  2QWQ A;  5AQO A;  4PHT X;  1GLE G;  3FLC O;  3JS6 A;  4YDU C;  3CC4 N;  3MX2 A;  1SAZ A;  5EXW A;  2FSJ A;  3E66 A;  4YOR A;  3LDP A;  3VGL A;  4B1V A;  2CH5 A;  1KC8 O;  3OW2 M;  1Z05 A;  5BRF A;  4DKW A;  1TYQ B;  4I6M B;  3FZF A;  1YJ9 N;  1RDW X;  3AAR A;  3WEE B;  4A5A A;  2GEL A;  4A61 A;  2CGL A;  4IEE A;  3C6A A;  5AQH A;  1G99 A;  1K73 O;  4OPH A;  5BRE A;  1NGF A;  2OAN A;  3QBW A;  2YJF A;  1BDG A;  2RE2 A;  3R6M A;  3E1Y A;  2E20 A;  1NM1 A;  5FPD A;  4BVO A;  1NJI O;  1YI2 N;  3AGR A;  4OPA A;  1K8K B;  1VQN N;  5E84 A;  3FR0 A;  4H5T A;  4KH5 A;  4BRK A;  3WXM B;  2V7Y A;  4WQ4 C;  1GLA G;  4YOV A;  3VMF B;  1M90 O;  5TKW A;  1NGG A;  1S72 N;  1VQP N;  3N4Q A;  2NRH A;  1BOT O;  3M1F A;  2QWP A;  3WUH A;  3WXK A;  1MWM A;  2WUS A;  4FWQ A;  1GLC G;  3MK6 A;  4WFA L;  1NGH A;  3PIP L;  3CCR N;  1Q82 O;  4PL8 A;  3Q7C A;  4EFH A;  3FZM A;  4WFB L;  3EE8 A;  5LJW A;  2ASM A;  5LY3 A;  3E9P A;  3FE1 A;  1HUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...