4BRAA

Legionella pneumophila ntpdase1 crystal form ii, closed, mg amppnp complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
358
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 114
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4braA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4braA02
3DJCA 2HF3A 3UKUB 2P9LA 3HM8A 4K42A 3BEXA 1RFQA 5JLHA 1GLDG 4B1YB 4FPBA 5AQKA 4CZHA 2YI1A 4A2BA 1NGEA 5AZJB 4JNEA 3IDHA 3QBWA 2A40A 4BC2A 4BROA 2F9TA 2QW9A 4YDUC 3TU5A 1V4TA 1C0GA 3MDQA 3GG4A 2AP1A 4K41A 1BU6O 1HLUA 3TPQA 4H03B 1G99A 4BR4A 1HJOA 4WQ4A 4K25A 3U4LA 4CZKA 1XQSC 5AQIA 4RTFD 2QXLA 1BA1A 4FWSA 3HBTA 4I6MA 3LM9A 3ZX3A 4BG8A 5KPZA 4JAXA 3GE1A 3H45C 1HKCA 4JHDB 2P9UB 5BPLA 1RGIA 2GEMA 4CZJA 3CERA 3LDOA 2QWQA 2QWLA 4H5NA 5BREA 1HUXA 1ZXOA 2QWMA 5ELZA 2YHWA 4O5FA 1GLBG 3BF3A 4Z94A 2Q31A 3DWLA 3ZEUB 2FLOA 2HF4A 3FZHA 2W40A 3DXMB 4M7XA 3A5LC 5BPMA 4FWQA 1KAYA 1NGGA 2CGJA 2IVPA 3VEWA 1U6ZA 5BR9A 4XEIA 3IFRA 2W41A 3IUCA 2P9UA 2VWBA 4IO8A 3D2EA 4WQ5A 2E1ZA 3WXJA 3F9MA 3CJ7A 2KHOA 1BA0A 4A2AA 2D0OA 3GL1A 1YVNA 3O1WA 3MN7A 3QICA 3I33A 3EL2A 3FFKB 3DXKB 5AQVA 5AZIA 3JXUA 4IJNA 2CGKA 1GLFO 2ASOA 2QM1A 3W3DA 3SMSA 5KPRA 1MWMA 1NWKA 4BRHA 3WXLA 3U8XA 5F0XA 3CHWA 3VGKA 4MLEA 1X9JA 4FL9A 4B1UB 2E2OA 1HKGA 3B8AX 4IZ9A 5AQTA 4CZGA 2BTFA 2P9KA 1Q18A 3C0BA 1Y64A 1SZ2A 2YCHA 4XH5A 2IVOA 1NGHA 2E8AA 4O8KA 4BR9A 1NGJA 1XUPO 4PKHA 4BRAA 5BRFA 3D2FA 3GDQA 3C7NA 1HPMA 1U2VB 2CH6A 4H0TB 3CJ1A 4IWVA 5AQPA 3ZETA 3CI5A 5AQJA 3ZX2A 2QWPA 3KVGA 2GTDA 1IJJA 5F1XA 5AQGA 4DQ8A 1WOQA 3HSCA 4BGBA 4H0PA 1KXPA 4L3QA 3QBXA 5BPNA 1K8KB 3HI0A 4DHYA 4CZIA 3RSEB 2E2QA 3FE1A 2CH5A 4CZLA 4CBXA 1CZAN 3WXIA 2HOEA 3MN5A 4K43A 1MDUB 1HKBA 5ADXH 2NZTA 3D7EO 3MCPA 5EOYA 5AR0A 3VGMA 2FSJA 4XH1A 4EFHA 4CZMA 1BUPA 5EXWA 3WT0A 4BRGA 3VEZA 1YXQA 3LDPA 1ZBSA 5JICA 5BRDA 4B1XB 2Q0UA 5KQDA 4BR7A 4FWPA 1BO5O 3FLCO 1NGCA 2FF6A 3O4WA 4BRFA 1TYQB 2YJEA 4JD2A 4NB4A 1NMDA 3AARA 1C0FA 2AA4A 5TKYA 1NLVA 1MWKA 1SAZA 5E26A 5EX5A 4BR0A 2QWOA 5FPNA 2WUSA 5LJWA 4FOIA 2QWNA 4FO0A 3A0IX 2UYTA 3EN9A 1ATRA 3FGUA 1JCFA 2YJFA 3CQYA 3CIPA 3VETA 1GLEG 3O6WA 3CJAA 2E20A 3CJBA 4BVPA 5BRHA 3O80A 4DCHA 2ZGZA 5AQSA 2A42A 4EAHD 2E1YA 3LDLA 5AQQA 5ADXA 4HTLA 1E4GT 2P9PA 2YHYA 1YUWA 5AQOA 3SJHA 2ZF5O 3FZLA 4BRDA 3R9PA 4FOEA 4XH4A 2GWJA 4FWKA 3SLCA 3O1BA 3UKRA 5FPDA 4FWOA 4IXCA 2V51B 3J8AA 4H0YB 1BG3A 2P9IA 4LC9B 3ZX0A 2ZGYA 3WQUA 2Q1NA 1XC3A 3ENHA 2YHXA 4AM6A 5FPEA 2GELA 1ATNA 3VESA 3M3ZA 3JS6A 4I6MB 3MN9A 2ASPA 2FSKA 5AZIB 5E84A 3I8BA 5AQYA 5F2RA 3WXKA 1T6CA 4B1ZA 5JMVA 2A6AA 5JLFA 2A5XA 3D2EB 1QQMA 3WUHA 1X3NA 1KAZA 3ATVA 4JN4A 4BC5A 3MK6A 4BRMA 1P8ZA 3VGLA 2FF3B 1GLAG 3FZMA 2PBDA 5KQ8A 1Z05A 4J8FA 3VF6A 2D1KA 4FWRA 4BRNA 4BRCA 1HX1A 2P9SA 1T44A 5EVZA 4CBUA 2NRHA 2VCPA 4B1VA 2PAVA 3EKUA 1ATSA 4FWMA 3VPZA 4BGAA 2ASMA 2BUPA 3H1VX 3VF4A 5AQZA 3L0QA 3IMXA 3ENOA 2P9PB 4BQLA 3BP8A 1ESVA 2E2NA 2P9KB 1OKJA 5KPTA 3R6MA 1JCEA 2NLXA 3G25A 4BRKA 2A41A 2Q0RA 1QQOA 2P9SB 4ISFA 5B8HA 3CQXA 3UB5A 1GLJO 2D0PA 5LY3A 3M1FA 4A61A 5I9EB 3DXKA 1DGKN 1QZ5A 3VOVA 4CI6A 4GNIA 5AFUH 1H1VA 3KHYA 4FSVA 5LJVA 2P9LB 2P9NA 5AQUA 4AM7A 1RDWX 2ZWHA 5AQRA 3C7NB 3ID8A 3AAQA 1S22A 3W0LA 1Z6RA 3ATUA 1TYQA 3FR0A 1EQYA 4BC4A 2V52B 2HMPA 4BRPA 4CBWA 4BRLA 5EY4A 5CE3A 2H3GX 4E1JA 2P9NB 2D4WA 5FPMA 4PL7A 2ITMA 1YAGA 3A5OC 1DKGD 4BRQA 3VERA 4B1WB 1WUAA 4BVOA 3ZEUA 1NM1A 4HWIA 2I7NA 1SQKA 1BOTO 3LDQA 3RSEA 4A62A 3WEEB 1IG8A 1TUUA 4H5VA 5AQNA 2CGLA 2FXUA 4CZFA 2DPNA 2OANA 4QS8A 4DB3A 2QWRA 3EZWA 1QQNA 1NGDA 1JCGA 1E4FT 4NO7A 4H0OA 2FSNA 3VEXA 3U9ZA 3L6QA 4QS7A 3QFUA 3S41A 3WQTA 3DAWA 5AQMA 3ULEA 2J4RA 1S3XA 3VEOA 4FWNA 4ISGA 4BC3A 3H3NO 3MMVA 4MLHA 3U9DA 4BRIA 4RWTA 3ULEB 3L4IA 4H5TA 4IJAA 1MA9B 4YDUA 4KBOA 3H3OB 2EWSA 4CZEA 3CETA 3HZ6A 3H46O 2E2PA 3UKUA 4H0XB 2V7ZA 4PKIA 3SK3A 2P9IB 3LDNA 2I7PA 1ZC6A 3A5NC 3P4IA 4H5RA 1V4SA 5AZJA 2V7YA 2A3ZA 4WQ5C 3BF1A 3QFPA 3A8YA 3O08A 1BDGA 4PL8A 3O8MA 3A5MC 4Y0WA 4CJ7A 3H1QA 3ZETB 1BWFO 4WYBA 4MO5A 3QMLA 3VEVA 3LL3A 1DEJA 2E88A 3CJCA 3VENA 4CD1A 3WEEA 1T6DA 3AY9A 3D2FB 3UKRB 3DXMA 3R8EA 4BR2A 4F9OA 3SMPA 1NGAA 2Q97A 4ISEA 1NBWA 1QZ6A 3CJ9A 5BN9A 1GLLO 1LOTB 1QHAA 4MO4A 5AQXA 3AAPA 1J6ZA 4QS9A 3FZKA 1X3MA 5AQLA 4EHTA 3VEYA 3QB0A 3EO3A 4JHDA 4BR5A 3GBTA 5AFUA 3EKSA 3OHRA 4BREA 4WQ4C 4BG9A 4RCHA 1KAXA 2Q36A 4EIAA 2GUPA 5BN8A 4FPAA 3QDKA 5AQFA 2Q2RA 3H6EA 3LM2A 1R59O 5AQHA 3HTVA 1NGIA 1D4XA 2IVNA 3VF2A 4B9QA 1GLCG 4C23A 3UE5A 1K8KA 4M63C 4GY2B 5AQWA 3O5BA 3M6GA 2GWKA 1NGFA 1TUYA 2F9WA 1NGBA 3GOIA 4JD2B 4H5WA 4PKGA 4FWLA 3FZFA 2IIRA 3KZBA 1LCUA 3BUZB 4CD3A 3MN6A 4M7YA 4BQZA 1U2VA 2VYPA 4EHUA 4H0VB
chains in the Genus database with same CATH superfamily
4DSIA 1HQUA 1D8YA 4NCBA 1RFQA 5HROA 1RDUA 4FPBA 5CYMA 2GBZA 3IDHA 3QBWA 2QW9A 3EE8A 3JYTA 3TU5A 1M90O 3GG4A 2RHKA 3MECA 2E5LK 3L3VA 4DSJA 1HLUA 4OKJA 4FZYA 3OVNA 3K57A 3U4LA 1VSLA 3RMDA 3QEPA 3LP0A 4DSEA 2VGNA 4M3WA 3OBWA 3NCIA 2D0AA 3ZX3A 2W6LA 4BG8A 1NOZA 1FKPA 4FJHA 3H45C 3DRRA 3E1YA 3KKRA 3Q7CA 4Y1DA 3NH2A 4E7KA 3I8DA 4C8LA 1SV5A 3ZEUB 2HF4A 3FZHA 4M7XA 4YOVA 3A5LC 1KAYA 1NGGA 2CGJA 3C94A 4XEIA 3IFRA 4KHNA 4DQSA 4IO8A 4WQ5A 2E1ZA 1U04A 4E19A 3F9MA 3O3FA 5H1SQ 2KHOA 1LWFA 2XY8A 2BDPA 4FLYA 1EP4A 2HNZA 1X1PA 3GL1A 3G10A 3HYFA 5AZIA 2XRIA 3DYAA 4KTZA 2QM1A 2ASOA 3W3DA 1BQMA 1W0HA 3QEWA 1NWKA 1TKXA 3TAEA 4JKFA 4NYNA 3A2FA 4FL9A 3AA4A 4MDAA 1HKGA 1WSFA 4IZ9A 5AQTA 2P9KA 3O9TA 4FJ7A 1Y64A 3QETA 3MEDA 2BH1A 2QTDA 4XH5A 3TWHA 1IG9A 1KQSM 3VQ5A 2E8AA 1G15A 1RTDA 3SCXA 2F8TA 1XUPO 3V1OA 5BRFA 5KRTA 3GDQA 4J2DA 2O8BB 4IDKA 3MXJA 1TK0A 1SKWA 5AQPA 1DTQA 3DRPA 3ZX2A 4AILC 1A5XA 3KK7A 3CD6N 2GTDA 3CMEN 4DQ8A 1IKVA 1BI4A 4BGBA 1YJ9N 3OJUA 4DF4A 3DM2A 3THYA 4B9MA 3V9UA 3RSEB 2E2QA 3QEVA 4DTMA 3KIOA 2W6KA 5GINA 4CBXA 3RRHA 2HOEA 3OA9A 1GOCA 4CHPA 1X9MA 4DWIA 1U48A 1YHQN 3CXCM 4DV7K 3O9SA 4ELUA 3D7EO 1NJWA 4EFHA 5GIOA 1BUPA 3E9OA 4OGEA 4Z4HA 4GMJB 3TAMA 5HL7L 1IBMK 1BI4B 1J9AA 2Q0UA 2F8SA 1SKSA 2KZZA 1BO5O 3U6FA 5FRNA 1XNRK 1I3AA 1DLOA 3ZSXA 3TAQA 1C0FA 5TKYA 1NLVA 1MWKA 1SAZA 2YV0X 2Z1HA 5E26A 3CYMA 1C0TA 4JYAK 1NKEA 2WUSA 4G9ZA 4RW7A 3VA3A 3EN9A 1ATRA 4X66K 5C12A 4DFKA 3DRSA 4ICLA 3CQYA 3KJVA 1N5YA 4CGIA 3VETA 1BGXT 1GLEG 1WBBA 4QOZB 4FLZA 3CJAA 3WXMB 5BRHA 2UUBK 1N8RO 2IAJA 1L3VA 3RRGA 3KWGA 5AQQA 4DSKA 4JRPA 2P9PA 2G8KA 1VQKN 3FZLA 3R9PA 4ID1A 4XH4A 2GWJA 3NE6A 4JS5A 4H0YB 1BG3A 1TVRA 2E6MA 3SAGA 1EXQA 3OYDA 4AM6A 4FJIA 1ATNA 1YJWN 4ILJA 2ASPA 2FSKA 2ZD1A 3CPWM 5F2RA 3HO1A 4CJQA 4KB0A 2O8FA 3IG1A 1U4BA 1LWCA 3P31A 1T6CA 5JLFA 1QQCA 1RBRA 2A5XA 2FBVA 3TTDA 4X64K 1XMQK 4FJMA 1LV5A 3M8QA 1P8ZA 4FVMA 3OYJA 1BCMA 4M42A 1S1XA 3VF6A 2KLAA 1KSPA 1XNQK 4CEFA 5CZ1A 4CF0A 3VQDA 4NCAA 4BRCA 4E1MA 1RT3A 5C0YA 4U7BA 4IOXA 1BISA 1VHXA 2VCPA 2PAVA 2WBNA 2HHTA 3AO5A 1JLGA 1REVA 4FWMA 2UUAK 3H1VX 1Q9XA 3VF4A 3N4PA 1N33K 3ENOA 3MWPA 4LH5A 1ESVA 2DFEA 1OKJA 3K5NA 3O3GA 3G25A 4JK8A 1WB9A 4EZ6A 2FBYA 2IDOA 2A41A 1KD1O 4ISFA 1KRPA 2HBMA 4HUGA 1FXXA 2QK9A 4HVJA 2IGIA 4CEBA 4JI6K 1T03A 2DTUA 2FC0A 1OVQA 4CESA 1SL0A 1UAXA 4FSVA 3IAYA 3DLLL 2P9NA 1SS6A 5AQUA 4WE1A 3K2PA 1LWEA 3C7NB 3ID8A 4CEEA 1CXQA 4FW1A 3KD1E 3ATUA 1TYQA 1C6VA 1EQYA 4OJRA 1WAJA 4BE1A 1IKWA 1JLEA 2HMPA 4CBWA 4BRLA 4YOXA 4IO9L 3PSFA 4CHYA 3SUPA 1BHLA 4KHYA 2ITMA 4F2SA 1N6QA 2X6NA 3BGRA 3ZEUA 4E7JA 2YNFA 3K0SA 4N76A 5KGXA 1BOTO 3LDQA 3HVTA 3RSEA 2UXDK 4H5VA 5AQNA 2CGLA 4QS8A 2VG7A 4DS5A 1ZBLA 2QWRA 2RPIA 1QQNA 3NH0A 3F9KA 1FW6A 5AQMA 1O13A 2ZM6K 1S3XA 1JXEA 4FWNA 3B6PA 4CEDA 3ZSVA 3V9ZA 1YJNN 3MMVA 3QEXA 4JKGA 4BRIA 4RWTA 5E41A 3L4IA 4FJKA 4EP4A 2RE2A 4NLBA 3LDSA 2QXFA 1NK5A 2O8EB 3QINA 1J5OA 4FM1A 2EWSA 1SKRA 3HZ6A 4KHSA 3UKUA 4CJLA 4MFBA 2V7ZA 4OPKA 2P9IB 1QS4A 1ZBUA 2I7PA 4RW6A 2NRVA 3A5NC 3VQEA 1V4SA 5AZJA 4AQYK 2V7YA 3N4QA 3TARA 4YOWA 2BANA 3O8MA 4FYDA 3PIOL 4CJ7A 5DM7L 3OYBA 3C65A 3H1QA 3ZSQA 1OH7A 4CJ5A 1BWFO 4CJSA 4Q5VA 1NG9A 3L4QA 4HTUA 4CIGA 3O9RA 5HBMA 3VENA 3OYMA 1VSFA 3WEEA 3L3UA 3DXMA 3R8EA 3SMPA 1GOBA 1NGAA 3KLIA 1YT3A 4J2BA 1QZ6A 1ZBHA 1LOTB 2JGUA 5AQXA 1U45A 1J6ZA 4M3XA 4MDBA 5AQLA 3L8BA 1XWLA 5FRMA 1J5EK 2NRTA 2X78A 3AVMA 3WNHA 1KCFA 2HHWA 5AQHA 2G8WA 3HTVA 1RTJA 2HHUA 2VWKA 1CLQA 1GLCG 4M63C 1C0UA 2GWKA 2F9WA 4GW6A 3VMFB 3KK1A 4KB1A 4PKGA 3KLGA 1LW0A 1KTQA 3O9QA 4CJEA 1VQ7N 4JI8K 3CCMN 3THXA 4M7YA 3NBPA 2GUIA 2P9LA 1BCOA 2OCEA 3VQ4A 4NYFA 1TKZA 1K6YA 3CCJN 4B1YB 1VRTA 4CZHA 2YI1A 4IG3A 4JNEA 2A40A 1JL2A 4YDUC 4CIEA 3HPOA 3ULDA 3OS0A 1JJ2M 2AP1A 4K41A 1BU6O 1RBTA 4B8CA 1S9GA 4H03B 5KI6A 1HJOA 4WQ4A 3ZYYX 4K25A 4Z0UA 1X9WA 4X65K 4RTFD 1BA1A 4IDHA 3HK2A 4I6MA 4DSFA 1VSKA 3GE1A 3HP9A 4I2PA 5SWMA 4DV3K 3KLFA 1HKCA 4JHDB 2P9UB 4CJ3A 3BDPA 2GEMA 3ZT1A 3CCRN 4JI4K 2QWLA 4H5NA 1HUXA 3DMJA 2YHWA 3KWIA 4Z94A 3DWLA 3AO4A 1D9FA 2DY4A 2W40A 2IVPA 5BR9A 2W41A 2P9UA 2VWBA 3WXJA 4DR1K 4LF9K 4CK2A 1OVYA 3F73A 3RR7A 4KH5A 1YVNA 3QICA 3I33A 3DXKB 1NJXA 2O4IA 4ZHRA 4UY8O 4AF1A 3SNNA 1MWMA 3WXLA 4CFBA 3OS1A 4MLEA 1X9JA 4YNQA 3B8AX 2RKIA 1OH8A 1W97L 5HRSA 1Q18A 4WFBL 3IRXA 2IVOA 3E9LA 3HM9A 4JI0K 1HNXK 3RR8A 1TV6A 1NGJA 4BR9A 1VQ5N 2ZQBA 4DQPA 3D2FA 3C7NA 1HPMA 4H0TB 1QVGM 4KHPK 3NGZA 3HP6A 3OYKA 4IKFA 3ZETA 5AQJA 3SYZA 3K5MA 3KVGA 5F1XA 3EE9A 2KFZA 3IKMA 4DF8A 3V9SA 4CJRA 4L3QA 3K9JA 3QBXA 4L8RB 1K8KB 1BQNA 4JKGB 3CF5L 3CMAN 3D6RA 4W5TA 2CH5A 4KHUA 3I56N 5LMUK 1K73O 3SI6A 4F3TA 4K43A 1MDUB 3ASMA 3MCPA 5AR0A 2B5JA 3VGMA 2QI2A 4N56A 3LDPA 4DS4A 4CFCA 4KFBA 4X62K 4FWPA 3FLCO 4LFCK 1YF5L 3O4WA 3SJJA 1I39A 1LW2A 3RMBA 3B6OA 4B9LA 4NB4A 5C24A 1K8AO 4DU3A 1NMDA 4BE0A 1HYZA 3AGRA 3ZT4A 4CGJA 4LF7K 2HVIA 4BR0A 1Q8IA 1QTMA 4FOIA 2QWNA 1S72N 4N47A 3FGUA 2YJFA 4CCHA 1C1CA 2P5OA 2Z1IA 5D3GA 2IOCA 4KAZA 4YORA 1TL1A 3O6WA 4BVPA 3O80A 1NK9A 2HHVA 3G4SN 2E1YA 3LDLA 1WN7A 3NF7A 1B9FA 4FJ8A 3SJHA 5AQOA 1BIZA 4M3RA 1CZBA 4BRDA 4FOEA 4FWKA 1RBVA 2UXCK 4F2RA 4CHZA 5FPDA 4FWOA 2UXBK 3DLKA 1JLFA 3CM6A 1HYVA 2Q1NA 1XC3A 3S3OA 5FPEA 4OLBA 3M3ZA 3EEQA 3MN9A 3CPEA 3CCUN 5AZIB 5E84A 3I8BA 4O0IA 1Q81O 4PY5A 2HNYA 4OPJA 3O3HA 3OTOK 4YOTA 3LAKA 2HHSA 1RT1A 1ASWA 2A6AA 1RBSA 3WUHA 1QQMA 1X3NA 4BRMA 4CJWA 5M1FA 4FM0A 4DFJA 2XY5A 4B3OA 2VG6A 2PBDA 4B8AB 4CIFA 2KFNA 1Z26A 3I55N 4FJNA 1S9EA 5MLCQ 1KLNA 5HRRA 1VQPN 2D1KA 1NKCA 4DTSA 4FWRA 1NU0A 4Z4FA 3SBGA 1RNHA 2O8BA 1HX1A 3OYLA 3PSIA 3KLHA 3CCEN 4CBUA 2NRHA 1L3SA 4B1VA 3SUOA 4O55A 2ASMA 2BUPA 3G6EN 4IFYA 1JLQA 5AQZA 3L0QA 3MEGA 3J81O 1C1BA 4R5PA 1VQMN 3K59A 5KPTA 3OYNA 2Z1GA 4GVMA 1QQOA 4ZTFA 1HNIA 1UOCA 5B8HA 4DU1A 3T1AA 1GLJO 1S6QA 3M1FA 1VSIA 4AH9A 3C6UA 2R7YA 4QCLA 3DXKA 3TABA 3MX2A 4PHTX 2HW3A 3PUFA 2HBJA 1NJYA 1H1VA 1RT2A 2Q3SA 4CGDA 4N41A 2ZWHA 4DR7K 3TAPA 4WF9L 3W0LA 4I9LA 3SQ2A 3ISNC 2NUBA 3SQ1A 4JKBA 3VQ9A 2V52B 3EZ5A 3ZT0A 3CFPA 2BE2A 4JI1K 1K9MO 4R79A 4FLTA 1W7AA 4M41A 4C8MA 4BACA 1HYSA 4PL7A 3A5OC 4BRQA 4B1WB 5C25A 3MX5A 1NM1A 4HWIA 1SQKA 5GADP 4CEOA 1QSLA 4ELTA 3NHGA 4FJGA 3MWTA 1IH7A 2VQEK 1NJIO 1IG8A 1TUUA 1UWBA 1JXBA 3SPZA 2G8HA 3VQ8A 3LAMA 3EZWA 1NGDA 1E4FT 4H0OA 4LF6K 3J7AP 4CJKA 3EYZA 4DMNA 1RDCA 3L6QA 4QS7A 4CJTA 3S41A 3DAWA 3NDKA 1ZYQA 3ULEA 3SZ2A 5KRSA 2DFHA 3NF6A 4FM2A 3V1RA 3J7YP 5CYQA 3SUQA 5C2FA 1ASUA 1T8EA 2E4LA 3CFRA 1L3TA 1BL3A 4IJAA 3KD5E 5C10A 1HNZK 4KBOA 4CZEA 1A5WA 3HPGA 4OGCA 1NK0A 1JL1A 3CQ8A 2HHHK 3JAMO 1ZC6A 4DTOA 1L5UA 1WSEA 2XY7A 4W5QA 3O08A 4PL8A 3SBTA 5HLFA 3P83D 4Y0WA 4FLUA 3ZETB 1SUQA 2HNDA 4CECA 2NRRA 4MO5A 5DMRA 4IG0A 4Z4IA 5FROA 4I2QA 1HR0K 3TR8A 3AY9A 3THYB 5TKWA 1YITN 1DTTA 4F9OA 1Q7YO 4C8NA 2Q97A 2NRZA 4ISEA 4RW8A 5BN9A 1WLJA 1GLLO 3QNOA 3FZKA 2GX9A 4B3RK 1IV0A 3QB0A 3SAHA 4JHDA 4BR5A 4G1QA 3SAFA 4BG9A 1VQLN 4RCHA 1P90A 1VSMA 3SV4A 3NAEA 3H6EA 1OH5A 1R59O 1S5JA 4A57A 4BWMA 1WSGA 1NGIA 4C23A 3UE5A 1W9HA 3O5BA 3M6GA 4QAGA 4CK3A 4PWDA 2HSTA 3GOIA 4KTQA 1YTUA 4W5NA 3LP3A 4XIUA 3ID6A 1FJGK 3QESA 1Q82O 3BUZB 4CD3A 4BQZA 1U2VA 1U47A 4DUYK 4H0VB 1KLMA 2HF3A 3CM5A 3UKUB 3HM8A 4CGHA 1RTIA 1JKHA 4ILGB 4K42A 3BEXA 1IO2A 2HB5A 3AVFA 4DTUA 4DFMA 5JLHA 1GLDG 5AQKA 1VQNN 1VSHA 4A2BA 3OW2M 1S1UA 5AZJB 4B9NA 2I5JA 1KFSA 1I94K 2X74A 4H8KA 1EWRA 1Q9YA 4JI2K 4BR4A 3T69A 3AVAA 1NOYA 3LP2A 4AHRA 4DKWA 5AQIA 4KPYA 4FWSA 3HBTA 3P39A 2O8CA 4JAXA 1RT7A 2WFBA 2PFUA 5BPLA 4DTJA 3VQAA 3CERA 4CZJA 3LDOA 2QWQA 4K0KK 3VTHA 4WFAL 2KW4A 5J2MA 4O5FA 1GLBG 4DQRA 3AO3A 4O8UA 3DXMB 3P5JA 3K5OA 3ZCMA 5BPMA 3AO1A 3ALYA 5CR4A 1U6ZA 3L2VA 3I0RA 3IUCA 4DU4A 3D2EA 1BA0A 4KTWA 1DT9A 1XHZA 5HRNA 3RMCA 2ATQA 3FFKB 5AQVA 1IKYA 2CGKA 1GLFO 5M1PA 1VRUA 3O4NA 2VQFK 4E3SA 4BY9C 4JI5K 3U8XA 4KV8A 3WNFA 3VQQA 3CHWA 4B1UB 3AO2A 3U3YA 3LWMA 4DUZK 5IWAK 4HUFA 1NGHA 4FJXA 3LZIA 4BRAA 2F7TA 3K58A 2D0CA 3MCAB 3M8RA 4DV6K 3CJ1A 4IWVA 4LY7A 4WFNL 3CCVN 2JLEA 5AJ3K 3QIPA 2QWPA 1IJJA 1BIUA 1WOQA 4YOYA 4M3YA 2P5GA 3HSCA 4E7IA 1S1WA 1XMOK 1KXPA 4M3UA 2KKZA 4FK0A 5BPNA 2B6AA 3HI0A 4F8RA 4DHYA 4FJJA 4DR3K 3MXMA 4C1NK 1N34K 5GAHP 3S9HA 4OVLA 4CZLA 2O8CB 2O8DA 2VGMA 1D9DA 3PY8A 3WXIA 3MN5A 1HKBA 4LFBK 2NZTA 4CJUA 4DFPA 4OX9K 1HJRA 4CERA 4AHCA 5HOOA 2EX3A 4CZMA 4OPAA 3VEZA 1YXQA 3OYCA 5JICA 1S6PA 3SQ4A 4B1XB 2WC9A 4CHOA 3ZSZA 4KKOA 3HJFA 4BR7A 4DV4K 2NRXA 5GAGP 4BRFA 1TYQB 3DLHA 2YJEA 4JD2A 4CE9A 3AARA 3M8SA 5EX5A 2OPRA 3AVLA 2QWOA 5FPNA 3A0IX 1EKEA 1TGOA 1JCFA 3V9XA 1JLBA 3VQ7A 2Y1JA 3C6HA 1WNSA 4ID5A 3OY9A 4O4GA 4DCHA 2ZGZA 3LWLA 4K8ZA 3D45A 3TSPA 3WNEA 5AQSA 2A42A 3ZSYA 4CK1A 3TI0A 4HTLA 4FXDA 1E4GT 2YHYA 4CGFA 1YUWA 4NLCA 2ZF5O 1Q86O 3AVIA 2YNHA 3ENBA 2B4JA 4IXCA 3M8PA 3J8AA 3AVGA 4LC9B 4KI6A 3ZX0A 4JI3K 3LP1A 1YTAA 3ENHA 2YHXA 3PO5A 2RF2A 3VA0A 3LANA 5AQYA 1RDBA 3WXKA 4A5AA 1NK8A 4FZXC 4B1ZA 3OYFA 1VAZA 3R1XA 4BWJA 1KAZA 3ATVA 4K8XA 5GAEP 3MK6A 3VGLA 2IS3A 3FZMA 2G8IA 5K14A 4KHWA 2HHQA 1Z05A 5EU7A 3SUNA 4BRNA 2VG5A 5EVZA 4DLEA 1JLCA 5SZTA 3EKUA 1ATSA 3VPZA 3G0ZA 1WSHA 4AHSA 4FCYA 1ITGA 2P9PB 1WAFA 4BQLA 3BP8A 1NMNA 2E2NA 2OPSA 2P9KB 5M1OA 4CEAA 3R6MA 1JCEA 5J2QA 1IBLK 4BRKA 3V1QA 4JKHA 4J2AA 4KO0A 5JS1A 5LY3A 4A61A 4Z4CA 1ZBIA 4HCBA 3VOVA 1CZ9A 4CI6A 4GNIA 2VWJA 5AFUH 5C15A 5LJVA 3OYGA 2P9LB 3E9PA 3HT3A 1RDWX 3AAQA 4A5BA 2OPQA 3C6AA 1X9SA 4CFDA 4YFUA 4B08A 4BC4A 4BRPA 4CJVA 5JS2A 3LZJA 4PUOA 1IKXA 2W42A 5CE3A 1L3UA 1RTHA 2BGGA 1YAGA 5J2PA 3HXMA 1DKGD 3OYAA 4CFAA 1KVBA 1WUAA 2P51A 4BVOA 3OJSA 1FK9A 2I7NA 3HOSA 2G8UA 1S1TA 3AA2A 1T7PA 4W5RA 4Z4EA 4JV5K 3WEEB 1M1KO 3QERA 3MAQA 2FXUA 3CG7A 3J80O 2WTUA 4HUEA 2F96A 2OANA 3RTVA 4ZTJA 2A1RA 3AVBA 4DB3A 4DTRA 1UA1A 4E0DA 3OYHA 4OKEA 3WQTA 3MEEA 4B3TK 4JK7A 4KH4A 5M1KA 4Z4GA 4BC3A 3H3NO 3K5LA 2QA4N 4MLHA 3KKSA 2XHBA 1CXUA 3BY5A 4O0JA 3CCSN 1QSYA 4H5TA 4UQGA 4FW2A 3AVJA 4YDUA 3H3OB 1KVCA 3T1YK 4H0XB 4E89A 1A5VA 4PKIA 2Y1IA 5C42A 3LDNA 4M45A 3L2UA 3HOTA 3P4IA 3NH1A 3DOLA 3VQCA 4CJFA 2A3ZA 1N32K 3BF1A 3QFPA 1QSSA 4KH6A 1D5AA 3A5MC 3NF8A 4WYBA 3KTQA 4OO1J 5J2NA 3VEVA 1DEJA 4CD1A 4LF5K 3D2FB 3UKRB 2OPPA 3L2RA 1EWQA 4BR2A 3E66A 1WBDA 1NBWA 2Z1JA 4MO4A 5LL6Z 4IOCL 4Y1CA 4WCEL 2YNIA 3EO3A 5AFUA 1VSDA 4WQ4C 2Q36A 4EIAA 4H4OA 3CCQN 1TAQA 2GUPA 4FPAA 2YNGA 3CCLN 4NXNK 2Q2RA 3ZT2A 4W5OA 3NFAA 3LM2A 4FLWA 2HVHA 1VSEA 4CHQA 3QNNA 4IFVA 4JKEA 4B3MK 2IVNA 5JVGL 1K8KA 4GY2B 5BR8K 4B9SA 2FBXA 1NGFA 1TUYA 1TKTA 4GV6A 3UIQA 5IT9O 1YVUA 2UUCK 4FWLA 3FZFA 1LCUA 4DTPA 3MN6A 4IEEA 4GVEA 3K9KA 2VYPA 4EHUA 3DJCA 4RW9A 4FZZA 3DLRA 3TSUA 2OZSA 1XHXA 3THWB 1B9DA 3LPTA 1NGEA 4BC2A 1TL3A 4BROA 2F9TA 1ILYA 4AHTA 2UU9K 1V4TA 1C0GA 5JVHL 3MDQA 4N5SA 3HSTB 3TPQA 3T1HK 1G99A 3NVMA 2LSNA 3TSQA 4CZKA 1XQSC 1EX4A 2QXLA 1J53A 2ZJPL 3LM9A 1MU2A 3S3NA 5KPZA 1EETA 5KTQA 4M3TA 3KK2A 1RT4A 1RGIA 3KK3A 3JSMA 2D0BA 5BREA 4JRQA 4GV9A 1ZXOA 2QWMA 5ELZA 3BF3A 4CF1A 2Q31A 2FLOA 2NRWA 4HCCA 1WSJA 2ETJA 3CC4N 3AVHA 4FWQA 4KREA 1WSIA 3VEWA 1T3VA 3THXB 1Z25A 4CF8A 3CJ7A 5CZ2A 4YY3K 4A2AA 2D0OA 3VQBA 3O1WA 3MN7A 4DV5K 1KC8O 4CF9A 3EL2A 3DLGA 4LSLA 3JXUA 4IJNA 5A2QO 1XI1A 4U67L 1SL2A 3SMSA 5KPRA 4BRHA 4DQIA 4BDZA 5F0XA 1E3MA 4DV1K 3VGKA 4F3OA 5I3UA 2YKNA 1HNVA 2E2OA 3CC2N 4CZGA 2YKMA 2IC3A 2BTFA 1NJZA 4FK2A 2GV9A 2O8EA 3PLAA 1LAVA 3C0BA 1YI2N 5M1NA 1SZ2A 2YCHA 3HL8A 5I42A 3DOKA 3V6DA 3G71N 4O8KA 1J54A 2YHBA 1VQ4N 4PKHA 3DLEA 2HHXA 1U2VB 2OA8A 2CH6A 2HMIA 2QEXN 1W2BM 4DV0K 3AV9A 4B9VA 3CI5A 3PX4A 4C1NI 1VQ6N 4FLVA 3WNGA 3SQ0A 5AQGA 4H0PA 1B92A 1KFDA 3ITHA 4JKCA 1VK0A 2OTLN 4CZIA 4AHUA 2D5RA 4M3ZA 3FE1A 1GOAA 2O8FB 3RVCA 1CZAN 5M1QA 3PIPL 2ZE2A 4CW7B 5ADXH 3QEIA 5EOYA 2FSJA 4XH1A 2PYJA 4CEZA 3D0PA 5EXWA 3WT0A 4BRGA 3THVA 1ZBSA 5BRDA 2G8FA 5KQDA 3AA5X 4C8OA 3TAGA 4NXMK 3HRGA 1NGCA 2FF6A 3V81A 2AA4A 1HRHA 5KGWA 4DQQA 3KLEA 2NNWA 5LJWA 4KI4A 3QO9A 4FO0A 4DLGA 2E6LA 2UYTA 3DLBA 2G8VA 1SL1A 1TK8A 4TSXA 1KVAA 3CIPA 2PY5A 4E7HA 2E20A 3CJBA 3T19A 3HVRA 4CVNE 1O1WA 4EAHD 3V9WA 5ADXA 4H4MA 4LSNA 4EZ9A 1NK6A 1F21A 3OBYA 4I7FA 1R0AA 3P38A 3O4QA 4DSLA 3SLCA 3O1BA 3UKRA 4E7LA 1VQON 4BDPA 2V51B 3SPYA 4EP5A 2P9IA 1NKBA 2ZGYA 3WQUA 2ZJQL 1QE1A 2GELA 3VESA 4I6MB 3JS6A 3E01A 4C8KA 4JI7K 5FDLA 2QKKA 5JMVA 3EY1A 1TKDA 3D2EB 2P1JA 4JKAA 4FVUA 2DFFA 4JN4A 3NF9A 4BC5A 3CC7N 4BDYA 2FF3B 1GLAG 4NCGA 5KQ8A 2A1SA 4KHQA 3BZKA 4J8FA 1RILA 1VSJA 2P9SA 1T44A 5GIPA 3R3LA 2KZMA 3LALA 3AVNA 4FJ5A 4BGAA 1EO1A 4FJ9A 4LH4A 3IMXA 1XC9A 3HPHA 4B9UA 4HHTA 3RWUA 4RW4A 4DTNA 2NLXA 3TANA 3BZCA 1LAWA 2Q0RA 2P9SB 4IEIA 2KTQA 4Q0BA 4ILHA 1VQ8N 3PX0A 3CQXA 3UB5A 3PO4A 3TTCA 4KRFA 1QVFM 3ZLJA 2D0PA 3ZSWA 3NMUA 5I9EB 4F4KA 1DGKN 1QZ5A 2OZMA 4LF8K 4AHVA 3ZT3A 4IFEA 4FLXA 3KHYA 1NK4A 3TTFA 3VQ6A 4YHHK 1ZBFA 4JKDA 4AM7A 5AQRA 4BE2A 1S22A 1Z6RA 1TAUA 4PQUA 3FR0A 4A59A 2HBLA 3M5RA 4DG1A 3VQPA 1U49A 2RN2A 5LMNK 2XY6A 4DR4K 2YX6A 1ASVA 5EY4A 4GKJK 4PA1A 2H3GX 5DK5A 4E1JA 3CFOA 2P9NB 2D4WA 5FPMA 4LD0A 2WONA 4CHNA 3VERA 4CJ4A 3C6TA 1C0MA 2KQ2A 3L2WA 3ZSOA 3OS2A 1HPZA 4IBNA 4I9QA 3QIOA 4O5BA 3T7ZA 4A62A 2PZSA 4DR6K 1FKOA 4FJLA 3J7ZO 4RG8A 4CZFA 2DPNA 4B9TA 3OYIA 2YHAA 3DI6A 1JCGA 4NO7A 5CY4A 1RDDA 2FSNA 2HBKA 3VEXA 3NGYA 3U9ZA 5DM6L 1VQ9N 1IBKK 3QFUA 4CGGA 3AVCA 4J2EA 4OLAA 2J4RA 1HNWK 4DV2K 3VEOA 3RMAA 4FK4A 4ISGA 1TK5A 1JLAA 3V4IA 1N36K 3U9DA 2F4VK 3U3GA 3ULEB 1Y97A 3NVKA 1HQEA 3F2KA 3T3FA 4YOUA 1UA0A 3FFIA 5C2DA 1MA9B 3MXIA 2ITGA 3CETA 3O9UA 3H46O 5CHIA 2E2PA 3AVKA 4DTXA 3SK3A 1RT5A 4CJPA 1QHTA 4V19S 2X6SA 3TAFA 4H5RA 4DR5K 4OKKA 4WQ5C 1HMVA 3A8YA 3THWA 1BDGA 2QKBA 3AGKA 2AJQA 1S1VA 3AA3A 2FBTA 3QMLA 3P1GA 3I0SA 3LL3A 2E88A 3CJCA 3NGIA 1T6DA 2O4GA 2PYLA 3IS9A 5HP1A 1RDAA 2OYQA 1T05A 4CF2A 5HRPA 3CJ9A 5J1EA 1QHAA 3L2QA 1NK7A 4B3SK 3QLHA 3AAPA 4OPHA 4QS9A 4DR2K 3H08A 1X3MA 4EHTA 4ELVA 3VEYA 1C1AA 3GBTA 3EKSA 4JLHA 3OHRA 4BREA 4JS4A 4LFAK 1KAXA 5FLXO 3PX6A 3F5TA 2JWKA 4GV3A 5BN8A 5AQFA 3QDKA 1OH6A 1RT6A 4CEQA 3OYEA 3SV3A 3S3MA 1D4XA 2XO7A 3VF2A 4B9QA 5T7BA 5AQWA 4O44A 3C95A 1NGBA 1RCHA 4IOAL 4JD2B 2JWLA 4E1NA 4H5WA 3LPUA 3Q7BA 2O8DB 3VN5A 1NNEA 2IIRA 3KZBA 2OTJN 4JK9A 4LF4K 3PV8A 1RBUA 3ZSRA 4GKKK 1YIJN 3VTIA 4MQ3A 2ZJRL 2EHGA 4JEPA 2WOMA
chains in the Genus database with same CATH topology
3DJCA 2HF3A 3UKUB 2P9LA 3HM8A 3TSUA 4ILGB 4K42A 3BEXA 1RFQA 5JLHA 1GLDG 3CCJN 4B1YB 1RDUA 4FPBA 5AQKA 1VQNN 4CZHA 2YI1A 4A2BA 1NGEA 3OW2M 5AZJB 4JNEA 3IDHA 3QBWA 2A40A 4BC2A 4BROA 2F9TA 2QW9A 3EE8A 4YDUC 3TU5A 1ILYA 1M90O 1V4TA 1C0GA 5JVHL 3MDQA 3GG4A 1JJ2M 2RHKA 2AP1A 4K41A 1BU6O 1HLUA 3TPQA 4H03B 1G99A 3NVMA 1HJOA 3T69A 3TSQA 4BR4A 4WQ4A 3ZYYX 4K25A 3U4LA 4CZKA 1XQSC 2VGNA 4DKWA 5AQIA 4RTFD 2QXLA 3OBWA 1BA1A 4FWSA 4IDHA 3HBTA 2ZJPL 3P39A 3LM9A 4I6MA 3ZX3A 4BG8A 5KPZA 4JAXA 2WFBA 3GE1A 3H45C 1HKCA 2PFUA 3E1YA 4JHDB 3Q7CA 2P9UB 5BPLA 1RGIA 2GEMA 4CZJA 3CERA 3CCRN 3LDOA 2QWQA 2QWLA 4H5NA 3VTHA 5BREA 4WFAL 1HUXA 1ZXOA 2QWMA 5ELZA 4GV9A 2YHWA 3KWIA 4O5FA 1GLBG 3BF3A 4Z94A 2Q31A 3DWLA 3ZEUB 2FLOA 2NRWA 2HF4A 4O8UA 3FZHA 2W40A 3DXMB 4M7XA 3CC4N 4YOVA 3A5LC 5BPMA 4FWQA 1KAYA 1NGGA 2CGJA 2IVPA 3VEWA 5CR4A 1U6ZA 5BR9A 4XEIA 3IFRA 2W41A 1T3VA 2P9UA 3IUCA 2VWBA 4IO8A 3D2EA 4WQ5A 2E1ZA 3WXJA 3F9MA 3CJ7A 5H1SQ 2KHOA 1OVYA 1BA0A 4A2AA 2D0OA 4KH5A 1DT9A 3GL1A 1YVNA 3O1WA 3MN7A 3QICA 1KC8O 3I33A 3EL2A 3FFKB 3DXKB 5AQVA 5AZIA 3JXUA 4IJNA 2CGKA 1GLFO 2ASOA 2QM1A 3W3DA 4AF1A 4U67L 4UY8O 5M1PA 3SMSA 4BY9C 5KPRA 1MWMA 1NWKA 4BRHA 3WXLA 3U8XA 5F0XA 3CHWA 4JKFA 3VGKA 4MLEA 1X9JA 4FL9A 4B1UB 2E2OA 4MDAA 1HKGA 3B8AX 4IZ9A 5AQTA 4CZGA 3CC2N 2BTFA 2P9KA 3O9TA 1W97L 3PLAA 1Q18A 3C0BA 1Y64A 5M1NA 4WFBL 1YI2N 1SZ2A 2YCHA 2BH1A 2QTDA 4XH5A 2IVOA 3E9LA 1KQSM 1NGHA 2E8AA 3G71N 4O8KA 4BR9A 1NGJA 1XUPO 1VQ5N 1VQ4N 4PKHA 4BRAA 5BRFA 2F7TA 3D2FA 3MCAB 3GDQA 3C7NA 1HPMA 1U2VB 2CH6A 2QEXN 1W2BM 4H0TB 3CJ1A 1QVGM 4IWVA 5AQPA 3ZETA 4WFNL 3CI5A 5AQJA 3CCVN 3ZX2A 4C1NI 1VQ6N 3KK7A 2QWPA 3CD6N 3KVGA 2GTDA 1IJJA 3CMEN 5F1XA 5AQGA 4DQ8A 1WOQA 3EE9A 4YOYA 3HSCA 1YJ9N 4BGBA 4H0PA 3IKMA 1KXPA 2KKZA 4JKCA 3K9JA 3QBXA 4L3QA 5BPNA 1K8KB 3HI0A 2OTLN 4DHYA 4CZIA 4JKGB 3CF5L 3CMAN 4C1NK 3RSEB 2E2QA 3FE1A 3D6RA 5GAHP 2CH5A 4CZLA 5GINA 3RVCA 4CBXA 1CZAN 3I56N 2VGMA 5M1QA 3WXIA 1K73O 2HOEA 3OA9A 3MN5A 3PIPL 4K43A 1MDUB 3CXCM 1YHQN 1HKBA 5ADXH 2NZTA 3O9SA 3D7EO 3MCPA 5EOYA 5AR0A 3VGMA 2FSJA 4XH1A 5HOOA 4EFHA 5GIOA 2QI2A 1BUPA 4OPAA 3E9OA 4CZMA 5EXWA 3WT0A 4BRGA 3VEZA 1YXQA 3LDPA 1ZBSA 5JICA 5BRDA 4B1XB 2WC9A 5HL7L 2Q0UA 5KQDA 4BR7A 4FWPA 1BO5O 3FLCO 3HRGA 2NRXA 1NGCA 5GAGP 1YF5L 2FF6A 3O4WA 4BRFA 1TYQB 2YJEA 4JD2A 4NB4A 1K8AO 1NMDA 3AGRA 3AARA 1C0FA 2AA4A 5TKYA 1NLVA 1MWKA 1SAZA 5E26A 5EX5A 4BR0A 2NNWA 2QWOA 5FPNA 2WUSA 5LJWA 4FOIA 2QWNA 1S72N 4FO0A 4G9ZA 3A0IX 2UYTA 3EN9A 1ATRA 3FGUA 1JCFA 2YJFA 5C12A 3CQYA 3CIPA 4YORA 3VETA 1GLEG 3O6WA 3CJAA 2E20A 3C6HA 3CJBA 3WXMB 4BVPA 5BRHA 3O80A 4DCHA 1N8RO 2ZGZA 3TSPA 5AQSA 2A42A 4EAHD 3KWGA 3G4SN 2E1YA 3LDLA 5AQQA 5ADXA 4HTLA 1E4GT 2P9PA 2YHYA 3OBYA 1YUWA 4NLCA 5AQOA 3SJHA 1VQKN 2ZF5O 1Q86O 3FZLA 3P38A 4BRDA 3R9PA 4FOEA 4XH4A 2GWJA 4FWKA 3ENBA 3SLCA 3O1BA 3UKRA 5FPDA 4FWOA 1VQON 4IXCA 2V51B 3J8AA 4H0YB 1BG3A 2P9IA 4LC9B 3ZX0A 2ZGYA 3WQUA 2Q1NA 3SAGA 2ZJQL 1XC3A 3ENHA 2YHXA 4AM6A 5FPEA 2GELA 1ATNA 3VESA 3M3ZA 3JS6A 4I6MB 3MN9A 1YJWN 4ILJA 2ASPA 2FSKA 3CPEA 3CPWM 3CCUN 5AZIB 5E84A 3I8BA 5AQYA 5F2RA 1Q81O 3WXKA 4A5AA 3P31A 1T6CA 4YOTA 4B1ZA 1VAZA 5JMVA 2A6AA 5JLFA 2A5XA 3D2EB 1QQMA 3R1XA 4JKAA 3WUHA 3TTDA 1X3NA 4FVUA 1KAZA 3ATVA 4JN4A 4BC5A 5GAEP 3MK6A 4BRMA 5M1FA 3CC7N 1P8ZA 3VGLA 2FF3B 1GLAG 3FZMA 2PBDA 5KQ8A 3I55N 5MLCQ 1Z05A 4J8FA 1VQPN 3VF6A 2D1KA 2KLAA 4FWRA 4BRNA 3SBGA 4BRCA 1HX1A 2P9SA 1T44A 5EVZA 3CCEN 4CBUA 2NRHA 4IOXA 5GIPA 4U7BA 3R3LA 2VCPA 4B1VA 5C0YA 2PAVA 2WBNA 3EKUA 1ATSA 4FWMA 3VPZA 4BGAA 1EO1A 2ASMA 2BUPA 3H1VX 3G6EN 3N4PA 5AQZA 3L0QA 3VF4A 3IMXA 3ENOA 3MWPA 2P9PB 1VQMN 4BQLA 3BP8A 1ESVA 2E2NA 2P9KB 1OKJA 5M1OA 5KPTA 3R6MA 1JCEA 2NLXA 3G25A 4JK8A 4BRKA 4JKHA 2A41A 1KD1O 2Q0RA 1QQOA 2P9SB 4ISFA 2HBMA 4IEIA 5B8HA 4ILHA 1VQ8N 3CQXA 3UB5A 1GLJO 3TTCA 1QVFM 2D0PA 5LY3A 3NMUA 3M1FA 4A61A 5I9EB 3DXKA 1DGKN 1QZ5A 3VOVA 3MX2A 4PHTX 4CI6A 2HBJA 4IFEA 4GNIA 5AFUH 1H1VA 5C15A 3KHYA 4FSVA 5LJVA 2P9LB 3DLLL 3TTFA 2P9NA 1SS6A 3E9PA 5AQUA 4JKDA 4AM7A 1RDWX 2ZWHA 5AQRA 3C7NB 3ID8A 3AAQA 4WF9L 1S22A 3W0LA 4A5BA 1Z6RA 3ATUA 3C6AA 1TYQA 3FR0A 1EQYA 4A59A 2HBLA 4BC4A 4JKBA 2V52B 2HMPA 3M5RA 4BRPA 4CBWA 4BRLA 1K9MO 4YOXA 2YX6A 4IO9L 5EY4A 4R79A 5CE3A 2H3GX 4E1JA 2P9NB 2D4WA 5FPMA 4PL7A 2ITMA 1YAGA 3A5OC 1DKGD 4BRQA 3VERA 4B1WB 1WUAA 3MX5A 4BVOA 3ZEUA 1NM1A 4HWIA 2I7NA 1SQKA 5GADP 1BOTO 3LDQA 3HOSA 3MWTA 3RSEA 3T7ZA 4A62A 3WEEB 1NJIO 1IG8A 1TUUA 4H5VA 5AQNA 2CGLA 2FXUA 1M1KO 3J7ZO 4CZFA 2DPNA 2OANA 4QS8A 4DB3A 2QWRA 3EZWA 1QQNA 1NGDA 1JCGA 1E4FT 4NO7A 4H0OA 2FSNA 2HBKA 3VEXA 3U9ZA 5DM6L 1VQ9N 3L6QA 4QS7A 3QFUA 3S41A 3WQTA 3DAWA 5AQMA 3ULEA 1O13A 2J4RA 1S3XA 4JK7A 4KH4A 3VEOA 5M1KA 4FWNA 4ISGA 4BC3A 3H3NO 1YJNN 2QA4N 3MMVA 4MLHA 4JKGA 3U9DA 5C2FA 4BRIA 4RWTA 3ULEB 3NVKA 3L4IA 3F2KA 4YOUA 2RE2A 4NLBA 3CCSN 4H5TA 4IJAA 5C2DA 1MA9B 5C10A 4YDUA 4KBOA 3H3OB 2EWSA 4CZEA 3CETA 3O9UA 3HZ6A 3H46O 5CHIA 2E2PA 3UKUA 4H0XB 2V7ZA 4PKIA 3SK3A 2P9IB 3LDNA 2I7PA 1ZC6A 2NRVA 3A5NC 3HOTA 3P4IA 4H5RA 1V4SA 5AZJA 2V7YA 3N4QA 2A3ZA 4YOWA 4WQ5C 3BF1A 3QFPA 3A8YA 3O08A 1BDGA 4KH6A 3AGKA 4PL8A 3SBTA 3O8MA 3A5MC 4Y0WA 4CJ7A 5DM7L 3C65A 3H1QA 3PIOL 3ZETB 1BWFO 4WYBA 4OO1J 3L4QA 2NRRA 4MO5A 3O9RA 3QMLA 3VEVA 3LL3A 1DEJA 2E88A 3CJCA 3VENA 4CD1A 3WEEA 1T6DA 3AY9A 3D2FB 5TKWA 3UKRB 3DXMA 3R8EA 4BR2A 1YITN 4F9OA 1Q7YO 3E66A 3SMPA 1NGAA 2Q97A 2NRZA 4ISEA 1NBWA 1QZ6A 3CJ9A 5BN9A 1GLLO 1LOTB 1QHAA 4MO4A 5AQXA 4IOCL 3AAPA 1J6ZA 4OPHA 4MDBA 3FZKA 4QS9A 1X3MA 2GX9A 5AQLA 4EHTA 4WCEL 3VEYA 3QB0A 3EO3A 4JHDA 4BR5A 3GBTA 5AFUA 3EKSA 3SAHA 3OHRA 4BREA 3SAFA 4WQ4C 4BG9A 1VQLN 4RCHA 1KAXA 2Q36A 4EIAA 1P90A 3F5TA 2JWKA 3CCQN 4GV3A 2GUPA 2NRTA 5BN8A 4FPAA 3QDKA 5AQFA 3CCLN 2Q2RA 3H6EA 3LM2A 1R59O 5AQHA 4A57A 3HTVA 1NGIA 1D4XA 4JKEA 2IVNA 3VF2A 4B9QA 1GLCG 5JVGL 4C23A 3UE5A 1K8KA 4M63C 4GY2B 5AQWA 3O5BA 3M6GA 2GWKA 1NGFA 1TUYA 2HSTA 2F9WA 1NGBA 3GOIA 3VMFB 4GV6A 4IOAL 4JD2B 2JWLA 4H5WA 3ID6A 4PKGA 3O9QA 4FWLA 3FZFA 3Q7BA 2IIRA 3KZBA 1Q82O 4JK9A 1LCUA 2OTJN 1VQ7N 3BUZB 3CCMN 4CD3A 3MN6A 1YIJN 4M7YA 4IEEA 3VTIA 4GVEA 4BQZA 2ZJRL 1U2VA 2VYPA 3K9KA 4JEPA 4EHUA 4H0VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJC A;  2HF3 A;  3UKU B;  2P9L A;  3HM8 A;  4K42 A;  3BEX A;  1RFQ A;  5JLH A;  1GLD G;  4B1Y B;  4FPB A;  5AQK A;  4CZH A;  2YI1 A;  4A2B A;  1NGE A;  5AZJ B;  4JNE A;  3IDH A;  3QBW A;  2A40 A;  4BC2 A;  4BRO A;  2F9T A;  2QW9 A;  4YDU C;  3TU5 A;  1V4T A;  1C0G A;  3MDQ A;  3GG4 A;  2AP1 A;  4K41 A;  1BU6 O;  1HLU A;  3TPQ A;  4H03 B;  1G99 A;  4BR4 A;  1HJO A;  4WQ4 A;  4K25 A;  3U4L A;  4CZK A;  1XQS C;  5AQI A;  4RTF D;  2QXL A;  1BA1 A;  4FWS A;  3HBT A;  4I6M A;  3LM9 A;  3ZX3 A;  4BG8 A;  5KPZ A;  4JAX A;  3GE1 A;  3H45 C;  1HKC A;  4JHD B;  2P9U B;  5BPL A;  1RGI A;  2GEM A;  4CZJ A;  3CER A;  3LDO A;  2QWQ A;  2QWL A;  4H5N A;  5BRE A;  1HUX A;  1ZXO A;  2QWM A;  5ELZ A;  2YHW A;  4O5F A;  1GLB G;  3BF3 A;  4Z94 A;  2Q31 A;  3DWL A;  3ZEU B;  2FLO A;  2HF4 A;  3FZH A;  2W40 A;  3DXM B;  4M7X A;  3A5L C;  5BPM A;  4FWQ A;  1KAY A;  1NGG A;  2CGJ A;  2IVP A;  3VEW A;  1U6Z A;  5BR9 A;  4XEI A;  3IFR A;  2W41 A;  3IUC A;  2P9U A;  2VWB A;  4IO8 A;  3D2E A;  4WQ5 A;  2E1Z A;  3WXJ A;  3F9M A;  3CJ7 A;  2KHO A;  1BA0 A;  4A2A A;  2D0O A;  3GL1 A;  1YVN A;  3O1W A;  3MN7 A;  3QIC A;  3I33 A;  3EL2 A;  3FFK B;  3DXK B;  5AQV A;  5AZI A;  3JXU A;  4IJN A;  2CGK A;  1GLF O;  2ASO A;  2QM1 A;  3W3D A;  3SMS A;  5KPR A;  1MWM A;  1NWK A;  4BRH A;  3WXL A;  3U8X A;  5F0X A;  3CHW A;  3VGK A;  4MLE A;  1X9J A;  4FL9 A;  4B1U B;  2E2O A;  1HKG A;  3B8A X;  4IZ9 A;  5AQT A;  4CZG A;  2BTF A;  2P9K A;  1Q18 A;  3C0B A;  1Y64 A;  1SZ2 A;  2YCH A;  4XH5 A;  2IVO A;  1NGH A;  2E8A A;  4O8K A;  4BR9 A;  1NGJ A;  1XUP O;  4PKH A;  4BRA A;  5BRF A;  3D2F A;  3GDQ A;  3C7N A;  1HPM A;  1U2V B;  2CH6 A;  4H0T B;  3CJ1 A;  4IWV A;  5AQP A;  3ZET A;  3CI5 A;  5AQJ A;  3ZX2 A;  2QWP A;  3KVG A;  2GTD A;  1IJJ A;  5F1X A;  5AQG A;  4DQ8 A;  1WOQ A;  3HSC A;  4BGB A;  4H0P A;  1KXP A;  4L3Q A;  3QBX A;  5BPN A;  1K8K B;  3HI0 A;  4DHY A;  4CZI A;  3RSE B;  2E2Q A;  3FE1 A;  2CH5 A;  4CZL A;  4CBX A;  1CZA N;  3WXI A;  2HOE A;  3MN5 A;  4K43 A;  1MDU B;  1HKB A;  5ADX H;  2NZT A;  3D7E O;  3MCP A;  5EOY A;  5AR0 A;  3VGM A;  2FSJ A;  4XH1 A;  4EFH A;  4CZM A;  1BUP A;  5EXW A;  3WT0 A;  4BRG A;  3VEZ A;  1YXQ A;  3LDP A;  1ZBS A;  5JIC A;  5BRD A;  4B1X B;  2Q0U A;  5KQD A;  4BR7 A;  4FWP A;  1BO5 O;  3FLC O;  1NGC A;  2FF6 A;  3O4W A;  4BRF A;  1TYQ B;  2YJE A;  4JD2 A;  4NB4 A;  1NMD A;  3AAR A;  1C0F A;  2AA4 A;  5TKY A;  1NLV A;  1MWK A;  1SAZ A;  5E26 A;  5EX5 A;  4BR0 A;  2QWO A;  5FPN A;  2WUS A;  5LJW A;  4FOI A;  2QWN A;  4FO0 A;  3A0I X;  2UYT A;  3EN9 A;  1ATR A;  3FGU A;  1JCF A;  2YJF A;  3CQY A;  3CIP A;  3VET A;  1GLE G;  3O6W A;  3CJA A;  2E20 A;  3CJB A;  4BVP A;  5BRH A;  3O80 A;  4DCH A;  2ZGZ A;  5AQS A;  2A42 A;  4EAH D;  2E1Y A;  3LDL A;  5AQQ A;  5ADX A;  4HTL A;  1E4G T;  2P9P A;  2YHY A;  1YUW A;  5AQO A;  3SJH A;  2ZF5 O;  3FZL A;  4BRD A;  3R9P A;  4FOE A;  4XH4 A;  2GWJ A;  4FWK A;  3SLC A;  3O1B A;  3UKR A;  5FPD A;  4FWO A;  4IXC A;  2V51 B;  3J8A A;  4H0Y B;  1BG3 A;  2P9I A;  4LC9 B;  3ZX0 A;  2ZGY A;  3WQU A;  2Q1N A;  1XC3 A;  3ENH A;  2YHX A;  4AM6 A;  5FPE A;  2GEL A;  1ATN A;  3VES A;  3M3Z A;  3JS6 A;  4I6M B;  3MN9 A;  2ASP A;  2FSK A;  5AZI B;  5E84 A;  3I8B A;  5AQY A;  5F2R A;  3WXK A;  1T6C A;  4B1Z A;  5JMV A;  2A6A A;  5JLF A;  2A5X A;  3D2E B;  1QQM A;  3WUH A;  1X3N A;  1KAZ A;  3ATV A;  4JN4 A;  4BC5 A;  3MK6 A;  4BRM A;  1P8Z A;  3VGL A;  2FF3 B;  1GLA G;  3FZM A;  2PBD A;  5KQ8 A;  1Z05 A;  4J8F A;  3VF6 A;  2D1K A;  4FWR A;  4BRN A;  4BRC A;  1HX1 A;  2P9S A;  1T44 A;  5EVZ A;  4CBU A;  2NRH A;  2VCP A;  4B1V A;  2PAV A;  3EKU A;  1ATS A;  4FWM A;  3VPZ A;  4BGA A;  2ASM A;  2BUP A;  3H1V X;  3VF4 A;  5AQZ A;  3L0Q A;  3IMX A;  3ENO A;  2P9P B;  4BQL A;  3BP8 A;  1ESV A;  2E2N A;  2P9K B;  1OKJ A;  5KPT A;  3R6M A;  1JCE A;  2NLX A;  3G25 A;  4BRK A;  2A41 A;  2Q0R A;  1QQO A;  2P9S B;  4ISF A;  5B8H A;  3CQX A;  3UB5 A;  1GLJ O;  2D0P A;  5LY3 A;  3M1F A;  4A61 A;  5I9E B;  3DXK A;  1DGK N;  1QZ5 A;  3VOV A;  4CI6 A;  4GNI A;  5AFU H;  1H1V A;  3KHY A;  4FSV A;  5LJV A;  2P9L B;  2P9N A;  5AQU A;  4AM7 A;  1RDW X;  2ZWH A;  5AQR A;  3C7N B;  3ID8 A;  3AAQ A;  1S22 A;  3W0L A;  1Z6R A;  3ATU A;  1TYQ A;  3FR0 A;  1EQY A;  4BC4 A;  2V52 B;  2HMP A;  4BRP A;  4CBW A;  4BRL A;  5EY4 A;  5CE3 A;  2H3G X;  4E1J A;  2P9N B;  2D4W A;  5FPM A;  4PL7 A;  2ITM A;  1YAG A;  3A5O C;  1DKG D;  4BRQ A;  3VER A;  4B1W B;  1WUA A;  4BVO A;  3ZEU A;  1NM1 A;  4HWI A;  2I7N A;  1SQK A;  1BOT O;  3LDQ A;  3RSE A;  4A62 A;  3WEE B;  1IG8 A;  1TUU A;  4H5V A;  5AQN A;  2CGL A;  2FXU A;  4CZF A;  2DPN A;  2OAN A;  4QS8 A;  4DB3 A;  2QWR A;  3EZW A;  1QQN A;  1NGD A;  1JCG A;  1E4F T;  4NO7 A;  4H0O A;  2FSN A;  3VEX A;  3U9Z A;  3L6Q A;  4QS7 A;  3QFU A;  3S41 A;  3WQT A;  3DAW A;  5AQM A;  3ULE A;  2J4R A;  1S3X A;  3VEO A;  4FWN A;  4ISG A;  4BC3 A;  3H3N O;  3MMV A;  4MLH A;  3U9D A;  4BRI A;  4RWT A;  3ULE B;  3L4I A;  4H5T A;  4IJA A;  1MA9 B;  4YDU A;  4KBO A;  3H3O B;  2EWS A;  4CZE A;  3CET A;  3HZ6 A;  3H46 O;  2E2P A;  3UKU A;  4H0X B;  2V7Z A;  4PKI A;  3SK3 A;  2P9I B;  3LDN A;  2I7P A;  1ZC6 A;  3A5N C;  3P4I A;  4H5R A;  1V4S A;  5AZJ A;  2V7Y A;  2A3Z A;  4WQ5 C;  3BF1 A;  3QFP A;  3A8Y A;  3O08 A;  1BDG A;  4PL8 A;  3O8M A;  3A5M C;  4Y0W A;  4CJ7 A;  3H1Q A;  3ZET B;  1BWF O;  4WYB A;  4MO5 A;  3QML A;  3VEV A;  3LL3 A;  1DEJ A;  2E88 A;  3CJC A;  3VEN A;  4CD1 A;  3WEE A;  1T6D A;  3AY9 A;  3D2F B;  3UKR B;  3DXM A;  3R8E A;  4BR2 A;  4F9O A;  3SMP A;  1NGA A;  2Q97 A;  4ISE A;  1NBW A;  1QZ6 A;  3CJ9 A;  5BN9 A;  1GLL O;  1LOT B;  1QHA A;  4MO4 A;  5AQX A;  3AAP A;  1J6Z A;  4QS9 A;  3FZK A;  1X3M A;  5AQL A;  4EHT A;  3VEY A;  3QB0 A;  3EO3 A;  4JHD A;  4BR5 A;  3GBT A;  5AFU A;  3EKS A;  3OHR A;  4BRE A;  4WQ4 C;  4BG9 A;  4RCH A;  1KAX A;  2Q36 A;  4EIA A;  2GUP A;  5BN8 A;  4FPA A;  3QDK A;  5AQF A;  2Q2R A;  3H6E A;  3LM2 A;  1R59 O;  5AQH A;  3HTV A;  1NGI A;  1D4X A;  2IVN A;  3VF2 A;  4B9Q A;  1GLC G;  4C23 A;  3UE5 A;  1K8K A;  4M63 C;  4GY2 B;  5AQW A;  3O5B A;  3M6G A;  2GWK A;  1NGF A;  1TUY A;  2F9W A;  1NGB A;  3GOI A;  4JD2 B;  4H5W A;  4PKG A;  4FWL A;  3FZF A;  2IIR A;  3KZB A;  1LCU A;  3BUZ B;  4CD3 A;  3MN6 A;  4M7Y A;  4BQZ A;  1U2V A;  2VYP A;  4EHU A;  4H0V B; 
#chains in the Genus database with same CATH topology
 4DSI A;  1HQU A;  1D8Y A;  4NCB A;  1RFQ A;  5HRO A;  1RDU A;  4FPB A;  5CYM A;  2GBZ A;  3IDH A;  3QBW A;  2QW9 A;  3EE8 A;  3JYT A;  3TU5 A;  1M90 O;  3GG4 A;  2RHK A;  3MEC A;  2E5L K;  3L3V A;  4DSJ A;  1HLU A;  4OKJ A;  4FZY A;  3OVN A;  3K57 A;  3U4L A;  1VSL A;  3RMD A;  3QEP A;  3LP0 A;  4DSE A;  2VGN A;  4M3W A;  3OBW A;  3NCI A;  2D0A A;  3ZX3 A;  2W6L A;  4BG8 A;  1NOZ A;  1FKP A;  4FJH A;  3H45 C;  3DRR A;  3E1Y A;  3KKR A;  3Q7C A;  4Y1D A;  3NH2 A;  4E7K A;  3I8D A;  4C8L A;  1SV5 A;  3ZEU B;  2HF4 A;  3FZH A;  4M7X A;  4YOV A;  3A5L C;  1KAY A;  1NGG A;  2CGJ A;  3C94 A;  4XEI A;  3IFR A;  4KHN A;  4DQS A;  4IO8 A;  4WQ5 A;  2E1Z A;  1U04 A;  4E19 A;  3F9M A;  3O3F A;  5H1S Q;  2KHO A;  1LWF A;  2XY8 A;  2BDP A;  4FLY A;  1EP4 A;  2HNZ A;  1X1P A;  3GL1 A;  3G10 A;  3HYF A;  5AZI A;  2XRI A;  3DYA A;  4KTZ A;  2QM1 A;  2ASO A;  3W3D A;  1BQM A;  1W0H A;  3QEW A;  1NWK A;  1TKX A;  3TAE A;  4JKF A;  4NYN A;  3A2F A;  4FL9 A;  3AA4 A;  4MDA A;  1HKG A;  1WSF A;  4IZ9 A;  5AQT A;  2P9K A;  3O9T A;  4FJ7 A;  1Y64 A;  3QET A;  3MED A;  2BH1 A;  2QTD A;  4XH5 A;  3TWH A;  1IG9 A;  1KQS M;  3VQ5 A;  2E8A A;  1G15 A;  1RTD A;  3SCX A;  2F8T A;  1XUP O;  3V1O A;  5BRF A;  5KRT A;  3GDQ A;  4J2D A;  2O8B B;  4IDK A;  3MXJ A;  1TK0 A;  1SKW A;  5AQP A;  1DTQ A;  3DRP A;  3ZX2 A;  4AIL C;  1A5X A;  3KK7 A;  3CD6 N;  2GTD A;  3CME N;  4DQ8 A;  1IKV A;  1BI4 A;  4BGB A;  1YJ9 N;  3OJU A;  4DF4 A;  3DM2 A;  3THY A;  4B9M A;  3V9U A;  3RSE B;  2E2Q A;  3QEV A;  4DTM A;  3KIO A;  2W6K A;  5GIN A;  4CBX A;  3RRH A;  2HOE A;  3OA9 A;  1GOC A;  4CHP A;  1X9M A;  4DWI A;  1U48 A;  1YHQ N;  3CXC M;  4DV7 K;  3O9S A;  4ELU A;  3D7E O;  1NJW A;  4EFH A;  5GIO A;  1BUP A;  3E9O A;  4OGE A;  4Z4H A;  4GMJ B;  3TAM A;  5HL7 L;  1IBM K;  1BI4 B;  1J9A A;  2Q0U A;  2F8S A;  1SKS A;  2KZZ A;  1BO5 O;  3U6F A;  5FRN A;  1XNR K;  1I3A A;  1DLO A;  3ZSX A;  3TAQ A;  1C0F A;  5TKY A;  1NLV A;  1MWK A;  1SAZ A;  2YV0 X;  2Z1H A;  5E26 A;  3CYM A;  1C0T A;  4JYA K;  1NKE A;  2WUS A;  4G9Z A;  4RW7 A;  3VA3 A;  3EN9 A;  1ATR A;  4X66 K;  5C12 A;  4DFK A;  3DRS A;  4ICL A;  3CQY A;  3KJV A;  1N5Y A;  4CGI A;  3VET A;  1BGX T;  1GLE G;  1WBB A;  4QOZ B;  4FLZ A;  3CJA A;  3WXM B;  5BRH A;  2UUB K;  1N8R O;  2IAJ A;  1L3V A;  3RRG A;  3KWG A;  5AQQ A;  4DSK A;  4JRP A;  2P9P A;  2G8K A;  1VQK N;  3FZL A;  3R9P A;  4ID1 A;  4XH4 A;  2GWJ A;  3NE6 A;  4JS5 A;  4H0Y B;  1BG3 A;  1TVR A;  2E6M A;  3SAG A;  1EXQ A;  3OYD A;  4AM6 A;  4FJI A;  1ATN A;  1YJW N;  4ILJ A;  2ASP A;  2FSK A;  2ZD1 A;  3CPW M;  5F2R A;  3HO1 A;  4CJQ A;  4KB0 A;  2O8F A;  3IG1 A;  1U4B A;  1LWC A;  3P31 A;  1T6C A;  5JLF A;  1QQC A;  1RBR A;  2A5X A;  2FBV A;  3TTD A;  4X64 K;  1XMQ K;  4FJM A;  1LV5 A;  3M8Q A;  1P8Z A;  4FVM A;  3OYJ A;  1BCM A;  4M42 A;  1S1X A;  3VF6 A;  2KLA A;  1KSP A;  1XNQ K;  4CEF A;  5CZ1 A;  4CF0 A;  3VQD A;  4NCA A;  4BRC A;  4E1M A;  1RT3 A;  5C0Y A;  4U7B A;  4IOX A;  1BIS A;  1VHX A;  2VCP A;  2PAV A;  2WBN A;  2HHT A;  3AO5 A;  1JLG A;  1REV A;  4FWM A;  2UUA K;  3H1V X;  1Q9X A;  3VF4 A;  3N4P A;  1N33 K;  3ENO A;  3MWP A;  4LH5 A;  1ESV A;  2DFE A;  1OKJ A;  3K5N A;  3O3G A;  3G25 A;  4JK8 A;  1WB9 A;  4EZ6 A;  2FBY A;  2IDO A;  2A41 A;  1KD1 O;  4ISF A;  1KRP A;  2HBM A;  4HUG A;  1FXX A;  2QK9 A;  4HVJ A;  2IGI A;  4CEB A;  4JI6 K;  1T03 A;  2DTU A;  2FC0 A;  1OVQ A;  4CES A;  1SL0 A;  1UAX A;  4FSV A;  3IAY A;  3DLL L;  2P9N A;  1SS6 A;  5AQU A;  4WE1 A;  3K2P A;  1LWE A;  3C7N B;  3ID8 A;  4CEE A;  1CXQ A;  4FW1 A;  3KD1 E;  3ATU A;  1TYQ A;  1C6V A;  1EQY A;  4OJR A;  1WAJ A;  4BE1 A;  1IKW A;  1JLE A;  2HMP A;  4CBW A;  4BRL A;  4YOX A;  4IO9 L;  3PSF A;  4CHY A;  3SUP A;  1BHL A;  4KHY A;  2ITM A;  4F2S A;  1N6Q A;  2X6N A;  3BGR A;  3ZEU A;  4E7J A;  2YNF A;  3K0S A;  4N76 A;  5KGX A;  1BOT O;  3LDQ A;  3HVT A;  3RSE A;  2UXD K;  4H5V A;  5AQN A;  2CGL A;  4QS8 A;  2VG7 A;  4DS5 A;  1ZBL A;  2QWR A;  2RPI A;  1QQN A;  3NH0 A;  3F9K A;  1FW6 A;  5AQM A;  1O13 A;  2ZM6 K;  1S3X A;  1JXE A;  4FWN A;  3B6P A;  4CED A;  3ZSV A;  3V9Z A;  1YJN N;  3MMV A;  3QEX A;  4JKG A;  4BRI A;  4RWT A;  5E41 A;  3L4I A;  4FJK A;  4EP4 A;  2RE2 A;  4NLB A;  3LDS A;  2QXF A;  1NK5 A;  2O8E B;  3QIN A;  1J5O A;  4FM1 A;  2EWS A;  1SKR A;  3HZ6 A;  4KHS A;  3UKU A;  4CJL A;  4MFB A;  2V7Z A;  4OPK A;  2P9I B;  1QS4 A;  1ZBU A;  2I7P A;  4RW6 A;  2NRV A;  3A5N C;  3VQE A;  1V4S A;  5AZJ A;  4AQY K;  2V7Y A;  3N4Q A;  3TAR A;  4YOW A;  2BAN A;  3O8M A;  4FYD A;  3PIO L;  4CJ7 A;  5DM7 L;  3OYB A;  3C65 A;  3H1Q A;  3ZSQ A;  1OH7 A;  4CJ5 A;  1BWF O;  4CJS A;  4Q5V A;  1NG9 A;  3L4Q A;  4HTU A;  4CIG A;  3O9R A;  5HBM A;  3VEN A;  3OYM A;  1VSF A;  3WEE A;  3L3U A;  3DXM A;  3R8E A;  3SMP A;  1GOB A;  1NGA A;  3KLI A;  1YT3 A;  4J2B A;  1QZ6 A;  1ZBH A;  1LOT B;  2JGU A;  5AQX A;  1U45 A;  1J6Z A;  4M3X A;  4MDB A;  5AQL A;  3L8B A;  1XWL A;  5FRM A;  1J5E K;  2NRT A;  2X78 A;  3AVM A;  3WNH A;  1KCF A;  2HHW A;  5AQH A;  2G8W A;  3HTV A;  1RTJ A;  2HHU A;  2VWK A;  1CLQ A;  1GLC G;  4M63 C;  1C0U A;  2GWK A;  2F9W A;  4GW6 A;  3VMF B;  3KK1 A;  4KB1 A;  4PKG A;  3KLG A;  1LW0 A;  1KTQ A;  3O9Q A;  4CJE A;  1VQ7 N;  4JI8 K;  3CCM N;  3THX A;  4M7Y A;  3NBP A;  2GUI A;  2P9L A;  1BCO A;  2OCE A;  3VQ4 A;  4NYF A;  1TKZ A;  1K6Y A;  3CCJ N;  4B1Y B;  1VRT A;  4CZH A;  2YI1 A;  4IG3 A;  4JNE A;  2A40 A;  1JL2 A;  4YDU C;  4CIE A;  3HPO A;  3ULD A;  3OS0 A;  1JJ2 M;  2AP1 A;  4K41 A;  1BU6 O;  1RBT A;  4B8C A;  1S9G A;  4H03 B;  5KI6 A;  1HJO A;  4WQ4 A;  3ZYY X;  4K25 A;  4Z0U A;  1X9W A;  4X65 K;  4RTF D;  1BA1 A;  4IDH A;  3HK2 A;  4I6M A;  4DSF A;  1VSK A;  3GE1 A;  3HP9 A;  4I2P A;  5SWM A;  4DV3 K;  3KLF A;  1HKC A;  4JHD B;  2P9U B;  4CJ3 A;  3BDP A;  2GEM A;  3ZT1 A;  3CCR N;  4JI4 K;  2QWL A;  4H5N A;  1HUX A;  3DMJ A;  2YHW A;  3KWI A;  4Z94 A;  3DWL A;  3AO4 A;  1D9F A;  2DY4 A;  2W40 A;  2IVP A;  5BR9 A;  2W41 A;  2P9U A;  2VWB A;  3WXJ A;  4DR1 K;  4LF9 K;  4CK2 A;  1OVY A;  3F73 A;  3RR7 A;  4KH5 A;  1YVN A;  3QIC A;  3I33 A;  3DXK B;  1NJX A;  2O4I A;  4ZHR A;  4UY8 O;  4AF1 A;  3SNN A;  1MWM A;  3WXL A;  4CFB A;  3OS1 A;  4MLE A;  1X9J A;  4YNQ A;  3B8A X;  2RKI A;  1OH8 A;  1W97 L;  5HRS A;  1Q18 A;  4WFB L;  3IRX A;  2IVO A;  3E9L A;  3HM9 A;  4JI0 K;  1HNX K;  3RR8 A;  1TV6 A;  1NGJ A;  4BR9 A;  1VQ5 N;  2ZQB A;  4DQP A;  3D2F A;  3C7N A;  1HPM A;  4H0T B;  1QVG M;  4KHP K;  3NGZ A;  3HP6 A;  3OYK A;  4IKF A;  3ZET A;  5AQJ A;  3SYZ A;  3K5M A;  3KVG A;  5F1X A;  3EE9 A;  2KFZ A;  3IKM A;  4DF8 A;  3V9S A;  4CJR A;  4L3Q A;  3K9J A;  3QBX A;  4L8R B;  1K8K B;  1BQN A;  4JKG B;  3CF5 L;  3CMA N;  3D6R A;  4W5T A;  2CH5 A;  4KHU A;  3I56 N;  5LMU K;  1K73 O;  3SI6 A;  4F3T A;  4K43 A;  1MDU B;  3ASM A;  3MCP A;  5AR0 A;  2B5J A;  3VGM A;  2QI2 A;  4N56 A;  3LDP A;  4DS4 A;  4CFC A;  4KFB A;  4X62 K;  4FWP A;  3FLC O;  4LFC K;  1YF5 L;  3O4W A;  3SJJ A;  1I39 A;  1LW2 A;  3RMB A;  3B6O A;  4B9L A;  4NB4 A;  5C24 A;  1K8A O;  4DU3 A;  1NMD A;  4BE0 A;  1HYZ A;  3AGR A;  3ZT4 A;  4CGJ A;  4LF7 K;  2HVI A;  4BR0 A;  1Q8I A;  1QTM A;  4FOI A;  2QWN A;  1S72 N;  4N47 A;  3FGU A;  2YJF A;  4CCH A;  1C1C A;  2P5O A;  2Z1I A;  5D3G A;  2IOC A;  4KAZ A;  4YOR A;  1TL1 A;  3O6W A;  4BVP A;  3O80 A;  1NK9 A;  2HHV A;  3G4S N;  2E1Y A;  3LDL A;  1WN7 A;  3NF7 A;  1B9F A;  4FJ8 A;  3SJH A;  5AQO A;  1BIZ A;  4M3R A;  1CZB A;  4BRD A;  4FOE A;  4FWK A;  1RBV A;  2UXC K;  4F2R A;  4CHZ A;  5FPD A;  4FWO A;  2UXB K;  3DLK A;  1JLF A;  3CM6 A;  1HYV A;  2Q1N A;  1XC3 A;  3S3O A;  5FPE A;  4OLB A;  3M3Z A;  3EEQ A;  3MN9 A;  3CPE A;  3CCU N;  5AZI B;  5E84 A;  3I8B A;  4O0I A;  1Q81 O;  4PY5 A;  2HNY A;  4OPJ A;  3O3H A;  3OTO K;  4YOT A;  3LAK A;  2HHS A;  1RT1 A;  1ASW A;  2A6A A;  1RBS A;  3WUH A;  1QQM A;  1X3N A;  4BRM A;  4CJW A;  5M1F A;  4FM0 A;  4DFJ A;  2XY5 A;  4B3O A;  2VG6 A;  2PBD A;  4B8A B;  4CIF A;  2KFN A;  1Z26 A;  3I55 N;  4FJN A;  1S9E A;  5MLC Q;  1KLN A;  5HRR A;  1VQP N;  2D1K A;  1NKC A;  4DTS A;  4FWR A;  1NU0 A;  4Z4F A;  3SBG A;  1RNH A;  2O8B A;  1HX1 A;  3OYL A;  3PSI A;  3KLH A;  3CCE N;  4CBU A;  2NRH A;  1L3S A;  4B1V A;  3SUO A;  4O55 A;  2ASM A;  2BUP A;  3G6E N;  4IFY A;  1JLQ A;  5AQZ A;  3L0Q A;  3MEG A;  3J81 O;  1C1B A;  4R5P A;  1VQM N;  3K59 A;  5KPT A;  3OYN A;  2Z1G A;  4GVM A;  1QQO A;  4ZTF A;  1HNI A;  1UOC A;  5B8H A;  4DU1 A;  3T1A A;  1GLJ O;  1S6Q A;  3M1F A;  1VSI A;  4AH9 A;  3C6U A;  2R7Y A;  4QCL A;  3DXK A;  3TAB A;  3MX2 A;  4PHT X;  2HW3 A;  3PUF A;  2HBJ A;  1NJY A;  1H1V A;  1RT2 A;  2Q3S A;  4CGD A;  4N41 A;  2ZWH A;  4DR7 K;  3TAP A;  4WF9 L;  3W0L A;  4I9L A;  3SQ2 A;  3ISN C;  2NUB A;  3SQ1 A;  4JKB A;  3VQ9 A;  2V52 B;  3EZ5 A;  3ZT0 A;  3CFP A;  2BE2 A;  4JI1 K;  1K9M O;  4R79 A;  4FLT A;  1W7A A;  4M41 A;  4C8M A;  4BAC A;  1HYS A;  4PL7 A;  3A5O C;  4BRQ A;  4B1W B;  5C25 A;  3MX5 A;  1NM1 A;  4HWI A;  1SQK A;  5GAD P;  4CEO A;  1QSL A;  4ELT A;  3NHG A;  4FJG A;  3MWT A;  1IH7 A;  2VQE K;  1NJI O;  1IG8 A;  1TUU A;  1UWB A;  1JXB A;  3SPZ A;  2G8H A;  3VQ8 A;  3LAM A;  3EZW A;  1NGD A;  1E4F T;  4H0O A;  4LF6 K;  3J7A P;  4CJK A;  3EYZ A;  4DMN A;  1RDC A;  3L6Q A;  4QS7 A;  4CJT A;  3S41 A;  3DAW A;  3NDK A;  1ZYQ A;  3ULE A;  3SZ2 A;  5KRS A;  2DFH A;  3NF6 A;  4FM2 A;  3V1R A;  3J7Y P;  5CYQ A;  3SUQ A;  5C2F A;  1ASU A;  1T8E A;  2E4L A;  3CFR A;  1L3T A;  1BL3 A;  4IJA A;  3KD5 E;  5C10 A;  1HNZ K;  4KBO A;  4CZE A;  1A5W A;  3HPG A;  4OGC A;  1NK0 A;  1JL1 A;  3CQ8 A;  2HHH K;  3JAM O;  1ZC6 A;  4DTO A;  1L5U A;  1WSE A;  2XY7 A;  4W5Q A;  3O08 A;  4PL8 A;  3SBT A;  5HLF A;  3P83 D;  4Y0W A;  4FLU A;  3ZET B;  1SUQ A;  2HND A;  4CEC A;  2NRR A;  4MO5 A;  5DMR A;  4IG0 A;  4Z4I A;  5FRO A;  4I2Q A;  1HR0 K;  3TR8 A;  3AY9 A;  3THY B;  5TKW A;  1YIT N;  1DTT A;  4F9O A;  1Q7Y O;  4C8N A;  2Q97 A;  2NRZ A;  4ISE A;  4RW8 A;  5BN9 A;  1WLJ A;  1GLL O;  3QNO A;  3FZK A;  2GX9 A;  4B3R K;  1IV0 A;  3QB0 A;  3SAH A;  4JHD A;  4BR5 A;  4G1Q A;  3SAF A;  4BG9 A;  1VQL N;  4RCH A;  1P90 A;  1VSM A;  3SV4 A;  3NAE A;  3H6E A;  1OH5 A;  1R59 O;  1S5J A;  4A57 A;  4BWM A;  1WSG A;  1NGI A;  4C23 A;  3UE5 A;  1W9H A;  3O5B A;  3M6G A;  4QAG A;  4CK3 A;  4PWD A;  2HST A;  3GOI A;  4KTQ A;  1YTU A;  4W5N A;  3LP3 A;  4XIU A;  3ID6 A;  1FJG K;  3QES A;  1Q82 O;  3BUZ B;  4CD3 A;  4BQZ A;  1U2V A;  1U47 A;  4DUY K;  4H0V B;  1KLM A;  2HF3 A;  3CM5 A;  3UKU B;  3HM8 A;  4CGH A;  1RTI A;  1JKH A;  4ILG B;  4K42 A;  3BEX A;  1IO2 A;  2HB5 A;  3AVF A;  4DTU A;  4DFM A;  5JLH A;  1GLD G;  5AQK A;  1VQN N;  1VSH A;  4A2B A;  3OW2 M;  1S1U A;  5AZJ B;  4B9N A;  2I5J A;  1KFS A;  1I94 K;  2X74 A;  4H8K A;  1EWR A;  1Q9Y A;  4JI2 K;  4BR4 A;  3T69 A;  3AVA A;  1NOY A;  3LP2 A;  4AHR A;  4DKW A;  5AQI A;  4KPY A;  4FWS A;  3HBT A;  3P39 A;  2O8C A;  4JAX A;  1RT7 A;  2WFB A;  2PFU A;  5BPL A;  4DTJ A;  3VQA A;  3CER A;  4CZJ A;  3LDO A;  2QWQ A;  4K0K K;  3VTH A;  4WFA L;  2KW4 A;  5J2M A;  4O5F A;  1GLB G;  4DQR A;  3AO3 A;  4O8U A;  3DXM B;  3P5J A;  3K5O A;  3ZCM A;  5BPM A;  3AO1 A;  3ALY A;  5CR4 A;  1U6Z A;  3L2V A;  3I0R A;  3IUC A;  4DU4 A;  3D2E A;  1BA0 A;  4KTW A;  1DT9 A;  1XHZ A;  5HRN A;  3RMC A;  2ATQ A;  3FFK B;  5AQV A;  1IKY A;  2CGK A;  1GLF O;  5M1P A;  1VRU A;  3O4N A;  2VQF K;  4E3S A;  4BY9 C;  4JI5 K;  3U8X A;  4KV8 A;  3WNF A;  3VQQ A;  3CHW A;  4B1U B;  3AO2 A;  3U3Y A;  3LWM A;  4DUZ K;  5IWA K;  4HUF A;  1NGH A;  4FJX A;  3LZI A;  4BRA A;  2F7T A;  3K58 A;  2D0C A;  3MCA B;  3M8R A;  4DV6 K;  3CJ1 A;  4IWV A;  4LY7 A;  4WFN L;  3CCV N;  2JLE A;  5AJ3 K;  3QIP A;  2QWP A;  1IJJ A;  1BIU A;  1WOQ A;  4YOY A;  4M3Y A;  2P5G A;  3HSC A;  4E7I A;  1S1W A;  1XMO K;  1KXP A;  4M3U A;  2KKZ A;  4FK0 A;  5BPN A;  2B6A A;  3HI0 A;  4F8R A;  4DHY A;  4FJJ A;  4DR3 K;  3MXM A;  4C1N K;  1N34 K;  5GAH P;  3S9H A;  4OVL A;  4CZL A;  2O8C B;  2O8D A;  2VGM A;  1D9D A;  3PY8 A;  3WXI A;  3MN5 A;  1HKB A;  4LFB K;  2NZT A;  4CJU A;  4DFP A;  4OX9 K;  1HJR A;  4CER A;  4AHC A;  5HOO A;  2EX3 A;  4CZM A;  4OPA A;  3VEZ A;  1YXQ A;  3OYC A;  5JIC A;  1S6P A;  3SQ4 A;  4B1X B;  2WC9 A;  4CHO A;  3ZSZ A;  4KKO A;  3HJF A;  4BR7 A;  4DV4 K;  2NRX A;  5GAG P;  4BRF A;  1TYQ B;  3DLH A;  2YJE A;  4JD2 A;  4CE9 A;  3AAR A;  3M8S A;  5EX5 A;  2OPR A;  3AVL A;  2QWO A;  5FPN A;  3A0I X;  1EKE A;  1TGO A;  1JCF A;  3V9X A;  1JLB A;  3VQ7 A;  2Y1J A;  3C6H A;  1WNS A;  4ID5 A;  3OY9 A;  4O4G A;  4DCH A;  2ZGZ A;  3LWL A;  4K8Z A;  3D45 A;  3TSP A;  3WNE A;  5AQS A;  2A42 A;  3ZSY A;  4CK1 A;  3TI0 A;  4HTL A;  4FXD A;  1E4G T;  2YHY A;  4CGF A;  1YUW A;  4NLC A;  2ZF5 O;  1Q86 O;  3AVI A;  2YNH A;  3ENB A;  2B4J A;  4IXC A;  3M8P A;  3J8A A;  3AVG A;  4LC9 B;  4KI6 A;  3ZX0 A;  4JI3 K;  3LP1 A;  1YTA A;  3ENH A;  2YHX A;  3PO5 A;  2RF2 A;  3VA0 A;  3LAN A;  5AQY A;  1RDB A;  3WXK A;  4A5A A;  1NK8 A;  4FZX C;  4B1Z A;  3OYF A;  1VAZ A;  3R1X A;  4BWJ A;  1KAZ A;  3ATV A;  4K8X A;  5GAE P;  3MK6 A;  3VGL A;  2IS3 A;  3FZM A;  2G8I A;  5K14 A;  4KHW A;  2HHQ A;  1Z05 A;  5EU7 A;  3SUN A;  4BRN A;  2VG5 A;  5EVZ A;  4DLE A;  1JLC A;  5SZT A;  3EKU A;  1ATS A;  3VPZ A;  3G0Z A;  1WSH A;  4AHS A;  4FCY A;  1ITG A;  2P9P B;  1WAF A;  4BQL A;  3BP8 A;  1NMN A;  2E2N A;  2OPS A;  2P9K B;  5M1O A;  4CEA A;  3R6M A;  1JCE A;  5J2Q A;  1IBL K;  4BRK A;  3V1Q A;  4JKH A;  4J2A A;  4KO0 A;  5JS1 A;  5LY3 A;  4A61 A;  4Z4C A;  1ZBI A;  4HCB A;  3VOV A;  1CZ9 A;  4CI6 A;  4GNI A;  2VWJ A;  5AFU H;  5C15 A;  5LJV A;  3OYG A;  2P9L B;  3E9P A;  3HT3 A;  1RDW X;  3AAQ A;  4A5B A;  2OPQ A;  3C6A A;  1X9S A;  4CFD A;  4YFU A;  4B08 A;  4BC4 A;  4BRP A;  4CJV A;  5JS2 A;  3LZJ A;  4PUO A;  1IKX A;  2W42 A;  5CE3 A;  1L3U A;  1RTH A;  2BGG A;  1YAG A;  5J2P A;  3HXM A;  1DKG D;  3OYA A;  4CFA A;  1KVB A;  1WUA A;  2P51 A;  4BVO A;  3OJS A;  1FK9 A;  2I7N A;  3HOS A;  2G8U A;  1S1T A;  3AA2 A;  1T7P A;  4W5R A;  4Z4E A;  4JV5 K;  3WEE B;  1M1K O;  3QER A;  3MAQ A;  2FXU A;  3CG7 A;  3J80 O;  2WTU A;  4HUE A;  2F96 A;  2OAN A;  3RTV A;  4ZTJ A;  2A1R A;  3AVB A;  4DB3 A;  4DTR A;  1UA1 A;  4E0D A;  3OYH A;  4OKE A;  3WQT A;  3MEE A;  4B3T K;  4JK7 A;  4KH4 A;  5M1K A;  4Z4G A;  4BC3 A;  3H3N O;  3K5L A;  2QA4 N;  4MLH A;  3KKS A;  2XHB A;  1CXU A;  3BY5 A;  4O0J A;  3CCS N;  1QSY A;  4H5T A;  4UQG A;  4FW2 A;  3AVJ A;  4YDU A;  3H3O B;  1KVC A;  3T1Y K;  4H0X B;  4E89 A;  1A5V A;  4PKI A;  2Y1I A;  5C42 A;  3LDN A;  4M45 A;  3L2U A;  3HOT A;  3P4I A;  3NH1 A;  3DOL A;  3VQC A;  4CJF A;  2A3Z A;  1N32 K;  3BF1 A;  3QFP A;  1QSS A;  4KH6 A;  1D5A A;  3A5M C;  3NF8 A;  4WYB A;  3KTQ A;  4OO1 J;  5J2N A;  3VEV A;  1DEJ A;  4CD1 A;  4LF5 K;  3D2F B;  3UKR B;  2OPP A;  3L2R A;  1EWQ A;  4BR2 A;  3E66 A;  1WBD A;  1NBW A;  2Z1J A;  4MO4 A;  5LL6 Z;  4IOC L;  4Y1C A;  4WCE L;  2YNI A;  3EO3 A;  5AFU A;  1VSD A;  4WQ4 C;  2Q36 A;  4EIA A;  4H4O A;  3CCQ N;  1TAQ A;  2GUP A;  4FPA A;  2YNG A;  3CCL N;  4NXN K;  2Q2R A;  3ZT2 A;  4W5O A;  3NFA A;  3LM2 A;  4FLW A;  2HVH A;  1VSE A;  4CHQ A;  3QNN A;  4IFV A;  4JKE A;  4B3M K;  2IVN A;  5JVG L;  1K8K A;  4GY2 B;  5BR8 K;  4B9S A;  2FBX A;  1NGF A;  1TUY A;  1TKT A;  4GV6 A;  3UIQ A;  5IT9 O;  1YVU A;  2UUC K;  4FWL A;  3FZF A;  1LCU A;  4DTP A;  3MN6 A;  4IEE A;  4GVE A;  3K9K A;  2VYP A;  4EHU A;  3DJC A;  4RW9 A;  4FZZ A;  3DLR A;  3TSU A;  2OZS A;  1XHX A;  3THW B;  1B9D A;  3LPT A;  1NGE A;  4BC2 A;  1TL3 A;  4BRO A;  2F9T A;  1ILY A;  4AHT A;  2UU9 K;  1V4T A;  1C0G A;  5JVH L;  3MDQ A;  4N5S A;  3HST B;  3TPQ A;  3T1H K;  1G99 A;  3NVM A;  2LSN A;  3TSQ A;  4CZK A;  1XQS C;  1EX4 A;  2QXL A;  1J53 A;  2ZJP L;  3LM9 A;  1MU2 A;  3S3N A;  5KPZ A;  1EET A;  5KTQ A;  4M3T A;  3KK2 A;  1RT4 A;  1RGI A;  3KK3 A;  3JSM A;  2D0B A;  5BRE A;  4JRQ A;  4GV9 A;  1ZXO A;  2QWM A;  5ELZ A;  3BF3 A;  4CF1 A;  2Q31 A;  2FLO A;  2NRW A;  4HCC A;  1WSJ A;  2ETJ A;  3CC4 N;  3AVH A;  4FWQ A;  4KRE A;  1WSI A;  3VEW A;  1T3V A;  3THX B;  1Z25 A;  4CF8 A;  3CJ7 A;  5CZ2 A;  4YY3 K;  4A2A A;  2D0O A;  3VQB A;  3O1W A;  3MN7 A;  4DV5 K;  1KC8 O;  4CF9 A;  3EL2 A;  3DLG A;  4LSL A;  3JXU A;  4IJN A;  5A2Q O;  1XI1 A;  4U67 L;  1SL2 A;  3SMS A;  5KPR A;  4BRH A;  4DQI A;  4BDZ A;  5F0X A;  1E3M A;  4DV1 K;  3VGK A;  4F3O A;  5I3U A;  2YKN A;  1HNV A;  2E2O A;  3CC2 N;  4CZG A;  2YKM A;  2IC3 A;  2BTF A;  1NJZ A;  4FK2 A;  2GV9 A;  2O8E A;  3PLA A;  1LAV A;  3C0B A;  1YI2 N;  5M1N A;  1SZ2 A;  2YCH A;  3HL8 A;  5I42 A;  3DOK A;  3V6D A;  3G71 N;  4O8K A;  1J54 A;  2YHB A;  1VQ4 N;  4PKH A;  3DLE A;  2HHX A;  1U2V B;  2OA8 A;  2CH6 A;  2HMI A;  2QEX N;  1W2B M;  4DV0 K;  3AV9 A;  4B9V A;  3CI5 A;  3PX4 A;  4C1N I;  1VQ6 N;  4FLV A;  3WNG A;  3SQ0 A;  5AQG A;  4H0P A;  1B92 A;  1KFD A;  3ITH A;  4JKC A;  1VK0 A;  2OTL N;  4CZI A;  4AHU A;  2D5R A;  4M3Z A;  3FE1 A;  1GOA A;  2O8F B;  3RVC A;  1CZA N;  5M1Q A;  3PIP L;  2ZE2 A;  4CW7 B;  5ADX H;  3QEI A;  5EOY A;  2FSJ A;  4XH1 A;  2PYJ A;  4CEZ A;  3D0P A;  5EXW A;  3WT0 A;  4BRG A;  3THV A;  1ZBS A;  5BRD A;  2G8F A;  5KQD A;  3AA5 X;  4C8O A;  3TAG A;  4NXM K;  3HRG A;  1NGC A;  2FF6 A;  3V81 A;  2AA4 A;  1HRH A;  5KGW A;  4DQQ A;  3KLE A;  2NNW A;  5LJW A;  4KI4 A;  3QO9 A;  4FO0 A;  4DLG A;  2E6L A;  2UYT A;  3DLB A;  2G8V A;  1SL1 A;  1TK8 A;  4TSX A;  1KVA A;  3CIP A;  2PY5 A;  4E7H A;  2E20 A;  3CJB A;  3T19 A;  3HVR A;  4CVN E;  1O1W A;  4EAH D;  3V9W A;  5ADX A;  4H4M A;  4LSN A;  4EZ9 A;  1NK6 A;  1F21 A;  3OBY A;  4I7F A;  1R0A A;  3P38 A;  3O4Q A;  4DSL A;  3SLC A;  3O1B A;  3UKR A;  4E7L A;  1VQO N;  4BDP A;  2V51 B;  3SPY A;  4EP5 A;  2P9I A;  1NKB A;  2ZGY A;  3WQU A;  2ZJQ L;  1QE1 A;  2GEL A;  3VES A;  4I6M B;  3JS6 A;  3E01 A;  4C8K A;  4JI7 K;  5FDL A;  2QKK A;  5JMV A;  3EY1 A;  1TKD A;  3D2E B;  2P1J A;  4JKA A;  4FVU A;  2DFF A;  4JN4 A;  3NF9 A;  4BC5 A;  3CC7 N;  4BDY A;  2FF3 B;  1GLA G;  4NCG A;  5KQ8 A;  2A1S A;  4KHQ A;  3BZK A;  4J8F A;  1RIL A;  1VSJ A;  2P9S A;  1T44 A;  5GIP A;  3R3L A;  2KZM A;  3LAL A;  3AVN A;  4FJ5 A;  4BGA A;  1EO1 A;  4FJ9 A;  4LH4 A;  3IMX A;  1XC9 A;  3HPH A;  4B9U A;  4HHT A;  3RWU A;  4RW4 A;  4DTN A;  2NLX A;  3TAN A;  3BZC A;  1LAW A;  2Q0R A;  2P9S B;  4IEI A;  2KTQ A;  4Q0B A;  4ILH A;  1VQ8 N;  3PX0 A;  3CQX A;  3UB5 A;  3PO4 A;  3TTC A;  4KRF A;  1QVF M;  3ZLJ A;  2D0P A;  3ZSW A;  3NMU A;  5I9E B;  4F4K A;  1DGK N;  1QZ5 A;  2OZM A;  4LF8 K;  4AHV A;  3ZT3 A;  4IFE A;  4FLX A;  3KHY A;  1NK4 A;  3TTF A;  3VQ6 A;  4YHH K;  1ZBF A;  4JKD A;  4AM7 A;  5AQR A;  4BE2 A;  1S22 A;  1Z6R A;  1TAU A;  4PQU A;  3FR0 A;  4A59 A;  2HBL A;  3M5R A;  4DG1 A;  3VQP A;  1U49 A;  2RN2 A;  5LMN K;  2XY6 A;  4DR4 K;  2YX6 A;  1ASV A;  5EY4 A;  4GKJ K;  4PA1 A;  2H3G X;  5DK5 A;  4E1J A;  3CFO A;  2P9N B;  2D4W A;  5FPM A;  4LD0 A;  2WON A;  4CHN A;  3VER A;  4CJ4 A;  3C6T A;  1C0M A;  2KQ2 A;  3L2W A;  3ZSO A;  3OS2 A;  1HPZ A;  4IBN A;  4I9Q A;  3QIO A;  4O5B A;  3T7Z A;  4A62 A;  2PZS A;  4DR6 K;  1FKO A;  4FJL A;  3J7Z O;  4RG8 A;  4CZF A;  2DPN A;  4B9T A;  3OYI A;  2YHA A;  3DI6 A;  1JCG A;  4NO7 A;  5CY4 A;  1RDD A;  2FSN A;  2HBK A;  3VEX A;  3NGY A;  3U9Z A;  5DM6 L;  1VQ9 N;  1IBK K;  3QFU A;  4CGG A;  3AVC A;  4J2E A;  4OLA A;  2J4R A;  1HNW K;  4DV2 K;  3VEO A;  3RMA A;  4FK4 A;  4ISG A;  1TK5 A;  1JLA A;  3V4I A;  1N36 K;  3U9D A;  2F4V K;  3U3G A;  3ULE B;  1Y97 A;  3NVK A;  1HQE A;  3F2K A;  3T3F A;  4YOU A;  1UA0 A;  3FFI A;  5C2D A;  1MA9 B;  3MXI A;  2ITG A;  3CET A;  3O9U A;  3H46 O;  5CHI A;  2E2P A;  3AVK A;  4DTX A;  3SK3 A;  1RT5 A;  4CJP A;  1QHT A;  4V19 S;  2X6S A;  3TAF A;  4H5R A;  4DR5 K;  4OKK A;  4WQ5 C;  1HMV A;  3A8Y A;  3THW A;  1BDG A;  2QKB A;  3AGK A;  2AJQ A;  1S1V A;  3AA3 A;  2FBT A;  3QML A;  3P1G A;  3I0S A;  3LL3 A;  2E88 A;  3CJC A;  3NGI A;  1T6D A;  2O4G A;  2PYL A;  3IS9 A;  5HP1 A;  1RDA A;  2OYQ A;  1T05 A;  4CF2 A;  5HRP A;  3CJ9 A;  5J1E A;  1QHA A;  3L2Q A;  1NK7 A;  4B3S K;  3QLH A;  3AAP A;  4OPH A;  4QS9 A;  4DR2 K;  3H08 A;  1X3M A;  4EHT A;  4ELV A;  3VEY A;  1C1A A;  3GBT A;  3EKS A;  4JLH A;  3OHR A;  4BRE A;  4JS4 A;  4LFA K;  1KAX A;  5FLX O;  3PX6 A;  3F5T A;  2JWK A;  4GV3 A;  5BN8 A;  5AQF A;  3QDK A;  1OH6 A;  1RT6 A;  4CEQ A;  3OYE A;  3SV3 A;  3S3M A;  1D4X A;  2XO7 A;  3VF2 A;  4B9Q A;  5T7B A;  5AQW A;  4O44 A;  3C95 A;  1NGB A;  1RCH A;  4IOA L;  4JD2 B;  2JWL A;  4E1N A;  4H5W A;  3LPU A;  3Q7B A;  2O8D B;  3VN5 A;  1NNE A;  2IIR A;  3KZB A;  2OTJ N;  4JK9 A;  4LF4 K;  3PV8 A;  1RBU A;  3ZSR A;  4GKK K;  1YIJ N;  3VTI A;  4MQ3 A;  2ZJR L;  2EHG A;  4JEP A;  2WOM A; 
#chains in the Genus database with same CATH homology
 3DJC A;  2HF3 A;  3UKU B;  2P9L A;  3HM8 A;  3TSU A;  4ILG B;  4K42 A;  3BEX A;  1RFQ A;  5JLH A;  1GLD G;  3CCJ N;  4B1Y B;  1RDU A;  4FPB A;  5AQK A;  1VQN N;  4CZH A;  2YI1 A;  4A2B A;  1NGE A;  3OW2 M;  5AZJ B;  4JNE A;  3IDH A;  3QBW A;  2A40 A;  4BC2 A;  4BRO A;  2F9T A;  2QW9 A;  3EE8 A;  4YDU C;  3TU5 A;  1ILY A;  1M90 O;  1V4T A;  1C0G A;  5JVH L;  3MDQ A;  3GG4 A;  1JJ2 M;  2RHK A;  2AP1 A;  4K41 A;  1BU6 O;  1HLU A;  3TPQ A;  4H03 B;  1G99 A;  3NVM A;  1HJO A;  3T69 A;  3TSQ A;  4BR4 A;  4WQ4 A;  3ZYY X;  4K25 A;  3U4L A;  4CZK A;  1XQS C;  2VGN A;  4DKW A;  5AQI A;  4RTF D;  2QXL A;  3OBW A;  1BA1 A;  4FWS A;  4IDH A;  3HBT A;  2ZJP L;  3P39 A;  3LM9 A;  4I6M A;  3ZX3 A;  4BG8 A;  5KPZ A;  4JAX A;  2WFB A;  3GE1 A;  3H45 C;  1HKC A;  2PFU A;  3E1Y A;  4JHD B;  3Q7C A;  2P9U B;  5BPL A;  1RGI A;  2GEM A;  4CZJ A;  3CER A;  3CCR N;  3LDO A;  2QWQ A;  2QWL A;  4H5N A;  3VTH A;  5BRE A;  4WFA L;  1HUX A;  1ZXO A;  2QWM A;  5ELZ A;  4GV9 A;  2YHW A;  3KWI A;  4O5F A;  1GLB G;  3BF3 A;  4Z94 A;  2Q31 A;  3DWL A;  3ZEU B;  2FLO A;  2NRW A;  2HF4 A;  4O8U A;  3FZH A;  2W40 A;  3DXM B;  4M7X A;  3CC4 N;  4YOV A;  3A5L C;  5BPM A;  4FWQ A;  1KAY A;  1NGG A;  2CGJ A;  2IVP A;  3VEW A;  5CR4 A;  1U6Z A;  5BR9 A;  4XEI A;  3IFR A;  2W41 A;  1T3V A;  2P9U A;  3IUC A;  2VWB A;  4IO8 A;  3D2E A;  4WQ5 A;  2E1Z A;  3WXJ A;  3F9M A;  3CJ7 A;  5H1S Q;  2KHO A;  1OVY A;  1BA0 A;  4A2A A;  2D0O A;  4KH5 A;  1DT9 A;  3GL1 A;  1YVN A;  3O1W A;  3MN7 A;  3QIC A;  1KC8 O;  3I33 A;  3EL2 A;  3FFK B;  3DXK B;  5AQV A;  5AZI A;  3JXU A;  4IJN A;  2CGK A;  1GLF O;  2ASO A;  2QM1 A;  3W3D A;  4AF1 A;  4U67 L;  4UY8 O;  5M1P A;  3SMS A;  4BY9 C;  5KPR A;  1MWM A;  1NWK A;  4BRH A;  3WXL A;  3U8X A;  5F0X A;  3CHW A;  4JKF A;  3VGK A;  4MLE A;  1X9J A;  4FL9 A;  4B1U B;  2E2O A;  4MDA A;  1HKG A;  3B8A X;  4IZ9 A;  5AQT A;  4CZG A;  3CC2 N;  2BTF A;  2P9K A;  3O9T A;  1W97 L;  3PLA A;  1Q18 A;  3C0B A;  1Y64 A;  5M1N A;  4WFB L;  1YI2 N;  1SZ2 A;  2YCH A;  2BH1 A;  2QTD A;  4XH5 A;  2IVO A;  3E9L A;  1KQS M;  1NGH A;  2E8A A;  3G71 N;  4O8K A;  4BR9 A;  1NGJ A;  1XUP O;  1VQ5 N;  1VQ4 N;  4PKH A;  4BRA A;  5BRF A;  2F7T A;  3D2F A;  3MCA B;  3GDQ A;  3C7N A;  1HPM A;  1U2V B;  2CH6 A;  2QEX N;  1W2B M;  4H0T B;  3CJ1 A;  1QVG M;  4IWV A;  5AQP A;  3ZET A;  4WFN L;  3CI5 A;  5AQJ A;  3CCV N;  3ZX2 A;  4C1N I;  1VQ6 N;  3KK7 A;  2QWP A;  3CD6 N;  3KVG A;  2GTD A;  1IJJ A;  3CME N;  5F1X A;  5AQG A;  4DQ8 A;  1WOQ A;  3EE9 A;  4YOY A;  3HSC A;  1YJ9 N;  4BGB A;  4H0P A;  3IKM A;  1KXP A;  2KKZ A;  4JKC A;  3K9J A;  3QBX A;  4L3Q A;  5BPN A;  1K8K B;  3HI0 A;  2OTL N;  4DHY A;  4CZI A;  4JKG B;  3CF5 L;  3CMA N;  4C1N K;  3RSE B;  2E2Q A;  3FE1 A;  3D6R A;  5GAH P;  2CH5 A;  4CZL A;  5GIN A;  3RVC A;  4CBX A;  1CZA N;  3I56 N;  2VGM A;  5M1Q A;  3WXI A;  1K73 O;  2HOE A;  3OA9 A;  3MN5 A;  3PIP L;  4K43 A;  1MDU B;  3CXC M;  1YHQ N;  1HKB A;  5ADX H;  2NZT A;  3O9S A;  3D7E O;  3MCP A;  5EOY A;  5AR0 A;  3VGM A;  2FSJ A;  4XH1 A;  5HOO A;  4EFH A;  5GIO A;  2QI2 A;  1BUP A;  4OPA A;  3E9O A;  4CZM A;  5EXW A;  3WT0 A;  4BRG A;  3VEZ A;  1YXQ A;  3LDP A;  1ZBS A;  5JIC A;  5BRD A;  4B1X B;  2WC9 A;  5HL7 L;  2Q0U A;  5KQD A;  4BR7 A;  4FWP A;  1BO5 O;  3FLC O;  3HRG A;  2NRX A;  1NGC A;  5GAG P;  1YF5 L;  2FF6 A;  3O4W A;  4BRF A;  1TYQ B;  2YJE A;  4JD2 A;  4NB4 A;  1K8A O;  1NMD A;  3AGR A;  3AAR A;  1C0F A;  2AA4 A;  5TKY A;  1NLV A;  1MWK A;  1SAZ A;  5E26 A;  5EX5 A;  4BR0 A;  2NNW A;  2QWO A;  5FPN A;  2WUS A;  5LJW A;  4FOI A;  2QWN A;  1S72 N;  4FO0 A;  4G9Z A;  3A0I X;  2UYT A;  3EN9 A;  1ATR A;  3FGU A;  1JCF A;  2YJF A;  5C12 A;  3CQY A;  3CIP A;  4YOR A;  3VET A;  1GLE G;  3O6W A;  3CJA A;  2E20 A;  3C6H A;  3CJB A;  3WXM B;  4BVP A;  5BRH A;  3O80 A;  4DCH A;  1N8R O;  2ZGZ A;  3TSP A;  5AQS A;  2A42 A;  4EAH D;  3KWG A;  3G4S N;  2E1Y A;  3LDL A;  5AQQ A;  5ADX A;  4HTL A;  1E4G T;  2P9P A;  2YHY A;  3OBY A;  1YUW A;  4NLC A;  5AQO A;  3SJH A;  1VQK N;  2ZF5 O;  1Q86 O;  3FZL A;  3P38 A;  4BRD A;  3R9P A;  4FOE A;  4XH4 A;  2GWJ A;  4FWK A;  3ENB A;  3SLC A;  3O1B A;  3UKR A;  5FPD A;  4FWO A;  1VQO N;  4IXC A;  2V51 B;  3J8A A;  4H0Y B;  1BG3 A;  2P9I A;  4LC9 B;  3ZX0 A;  2ZGY A;  3WQU A;  2Q1N A;  3SAG A;  2ZJQ L;  1XC3 A;  3ENH A;  2YHX A;  4AM6 A;  5FPE A;  2GEL A;  1ATN A;  3VES A;  3M3Z A;  3JS6 A;  4I6M B;  3MN9 A;  1YJW N;  4ILJ A;  2ASP A;  2FSK A;  3CPE A;  3CPW M;  3CCU N;  5AZI B;  5E84 A;  3I8B A;  5AQY A;  5F2R A;  1Q81 O;  3WXK A;  4A5A A;  3P31 A;  1T6C A;  4YOT A;  4B1Z A;  1VAZ A;  5JMV A;  2A6A A;  5JLF A;  2A5X A;  3D2E B;  1QQM A;  3R1X A;  4JKA A;  3WUH A;  3TTD A;  1X3N A;  4FVU A;  1KAZ A;  3ATV A;  4JN4 A;  4BC5 A;  5GAE P;  3MK6 A;  4BRM A;  5M1F A;  3CC7 N;  1P8Z A;  3VGL A;  2FF3 B;  1GLA G;  3FZM A;  2PBD A;  5KQ8 A;  3I55 N;  5MLC Q;  1Z05 A;  4J8F A;  1VQP N;  3VF6 A;  2D1K A;  2KLA A;  4FWR A;  4BRN A;  3SBG A;  4BRC A;  1HX1 A;  2P9S A;  1T44 A;  5EVZ A;  3CCE N;  4CBU A;  2NRH A;  4IOX A;  5GIP A;  4U7B A;  3R3L A;  2VCP A;  4B1V A;  5C0Y A;  2PAV A;  2WBN A;  3EKU A;  1ATS A;  4FWM A;  3VPZ A;  4BGA A;  1EO1 A;  2ASM A;  2BUP A;  3H1V X;  3G6E N;  3N4P A;  5AQZ A;  3L0Q A;  3VF4 A;  3IMX A;  3ENO A;  3MWP A;  2P9P B;  1VQM N;  4BQL A;  3BP8 A;  1ESV A;  2E2N A;  2P9K B;  1OKJ A;  5M1O A;  5KPT A;  3R6M A;  1JCE A;  2NLX A;  3G25 A;  4JK8 A;  4BRK A;  4JKH A;  2A41 A;  1KD1 O;  2Q0R A;  1QQO A;  2P9S B;  4ISF A;  2HBM A;  4IEI A;  5B8H A;  4ILH A;  1VQ8 N;  3CQX A;  3UB5 A;  1GLJ O;  3TTC A;  1QVF M;  2D0P A;  5LY3 A;  3NMU A;  3M1F A;  4A61 A;  5I9E B;  3DXK A;  1DGK N;  1QZ5 A;  3VOV A;  3MX2 A;  4PHT X;  4CI6 A;  2HBJ A;  4IFE A;  4GNI A;  5AFU H;  1H1V A;  5C15 A;  3KHY A;  4FSV A;  5LJV A;  2P9L B;  3DLL L;  3TTF A;  2P9N A;  1SS6 A;  3E9P A;  5AQU A;  4JKD A;  4AM7 A;  1RDW X;  2ZWH A;  5AQR A;  3C7N B;  3ID8 A;  3AAQ A;  4WF9 L;  1S22 A;  3W0L A;  4A5B A;  1Z6R A;  3ATU A;  3C6A A;  1TYQ A;  3FR0 A;  1EQY A;  4A59 A;  2HBL A;  4BC4 A;  4JKB A;  2V52 B;  2HMP A;  3M5R A;  4BRP A;  4CBW A;  4BRL A;  1K9M O;  4YOX A;  2YX6 A;  4IO9 L;  5EY4 A;  4R79 A;  5CE3 A;  2H3G X;  4E1J A;  2P9N B;  2D4W A;  5FPM A;  4PL7 A;  2ITM A;  1YAG A;  3A5O C;  1DKG D;  4BRQ A;  3VER A;  4B1W B;  1WUA A;  3MX5 A;  4BVO A;  3ZEU A;  1NM1 A;  4HWI A;  2I7N A;  1SQK A;  5GAD P;  1BOT O;  3LDQ A;  3HOS A;  3MWT A;  3RSE A;  3T7Z A;  4A62 A;  3WEE B;  1NJI O;  1IG8 A;  1TUU A;  4H5V A;  5AQN A;  2CGL A;  2FXU A;  1M1K O;  3J7Z O;  4CZF A;  2DPN A;  2OAN A;  4QS8 A;  4DB3 A;  2QWR A;  3EZW A;  1QQN A;  1NGD A;  1JCG A;  1E4F T;  4NO7 A;  4H0O A;  2FSN A;  2HBK A;  3VEX A;  3U9Z A;  5DM6 L;  1VQ9 N;  3L6Q A;  4QS7 A;  3QFU A;  3S41 A;  3WQT A;  3DAW A;  5AQM A;  3ULE A;  1O13 A;  2J4R A;  1S3X A;  4JK7 A;  4KH4 A;  3VEO A;  5M1K A;  4FWN A;  4ISG A;  4BC3 A;  3H3N O;  1YJN N;  2QA4 N;  3MMV A;  4MLH A;  4JKG A;  3U9D A;  5C2F A;  4BRI A;  4RWT A;  3ULE B;  3NVK A;  3L4I A;  3F2K A;  4YOU A;  2RE2 A;  4NLB A;  3CCS N;  4H5T A;  4IJA A;  5C2D A;  1MA9 B;  5C10 A;  4YDU A;  4KBO A;  3H3O B;  2EWS A;  4CZE A;  3CET A;  3O9U A;  3HZ6 A;  3H46 O;  5CHI A;  2E2P A;  3UKU A;  4H0X B;  2V7Z A;  4PKI A;  3SK3 A;  2P9I B;  3LDN A;  2I7P A;  1ZC6 A;  2NRV A;  3A5N C;  3HOT A;  3P4I A;  4H5R A;  1V4S A;  5AZJ A;  2V7Y A;  3N4Q A;  2A3Z A;  4YOW A;  4WQ5 C;  3BF1 A;  3QFP A;  3A8Y A;  3O08 A;  1BDG A;  4KH6 A;  3AGK A;  4PL8 A;  3SBT A;  3O8M A;  3A5M C;  4Y0W A;  4CJ7 A;  5DM7 L;  3C65 A;  3H1Q A;  3PIO L;  3ZET B;  1BWF O;  4WYB A;  4OO1 J;  3L4Q A;  2NRR A;  4MO5 A;  3O9R A;  3QML A;  3VEV A;  3LL3 A;  1DEJ A;  2E88 A;  3CJC A;  3VEN A;  4CD1 A;  3WEE A;  1T6D A;  3AY9 A;  3D2F B;  5TKW A;  3UKR B;  3DXM A;  3R8E A;  4BR2 A;  1YIT N;  4F9O A;  1Q7Y O;  3E66 A;  3SMP A;  1NGA A;  2Q97 A;  2NRZ A;  4ISE A;  1NBW A;  1QZ6 A;  3CJ9 A;  5BN9 A;  1GLL O;  1LOT B;  1QHA A;  4MO4 A;  5AQX A;  4IOC L;  3AAP A;  1J6Z A;  4OPH A;  4MDB A;  3FZK A;  4QS9 A;  1X3M A;  2GX9 A;  5AQL A;  4EHT A;  4WCE L;  3VEY A;  3QB0 A;  3EO3 A;  4JHD A;  4BR5 A;  3GBT A;  5AFU A;  3EKS A;  3SAH A;  3OHR A;  4BRE A;  3SAF A;  4WQ4 C;  4BG9 A;  1VQL N;  4RCH A;  1KAX A;  2Q36 A;  4EIA A;  1P90 A;  3F5T A;  2JWK A;  3CCQ N;  4GV3 A;  2GUP A;  2NRT A;  5BN8 A;  4FPA A;  3QDK A;  5AQF A;  3CCL N;  2Q2R A;  3H6E A;  3LM2 A;  1R59 O;  5AQH A;  4A57 A;  3HTV A;  1NGI A;  1D4X A;  4JKE A;  2IVN A;  3VF2 A;  4B9Q A;  1GLC G;  5JVG L;  4C23 A;  3UE5 A;  1K8K A;  4M63 C;  4GY2 B;  5AQW A;  3O5B A;  3M6G A;  2GWK A;  1NGF A;  1TUY A;  2HST A;  2F9W A;  1NGB A;  3GOI A;  3VMF B;  4GV6 A;  4IOA L;  4JD2 B;  2JWL A;  4H5W A;  3ID6 A;  4PKG A;  3O9Q A;  4FWL A;  3FZF A;  3Q7B A;  2IIR A;  3KZB A;  1Q82 O;  4JK9 A;  1LCU A;  2OTJ N;  1VQ7 N;  3BUZ B;  3CCM N;  4CD3 A;  3MN6 A;  1YIJ N;  4M7Y A;  4IEE A;  3VTI A;  4GVE A;  4BQZ A;  2ZJR L;  1U2V A;  2VYP A;  3K9K A;  4JEP A;  4EHU A;  4H0V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...