4BRAA

Legionella pneumophila ntpdase1 crystal form ii, closed, mg amppnp complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
358
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 114
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4braA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4braA02
4BC3A 1MA9B 3RSEB 1GLEG 3M6GA 3G25A 2A40A 3FZMA 4YDUC 3WUHA 4BGAA 1NGBA 1GLFO 3BF1A 3RSEA 3TPQA 3M3ZA 4JHDA 3VF6A 4CD1A 5AQTA 4NO7A 3VGKA 1MDUB 3EO3A 3ID8A 3HTVA 3MMVA 4RWTA 2E2QA 1EQYA 5EXWA 3BEXA 2HF3A 1RDWX 4BRGA 1NGEA 1NGAA 2V51B 4CJ7A 3FZHA 1G99A 1RGIA 3EZWA 4M63C 2V52B 3LM9A 3U8XA 2FSNA 1HKCA 4WQ5C 3O1BA 1LCUA 3GG4A 3B8AX 3C0BA 1X9JA 4BC2A 2CH6A 4BGBA 4BVPA 2IIRA 3AAQA 4FOIA 5BPMA 2BTFA 3VOVA 1D4XA 3CI5A 4CZEA 1NGDA 4H0OA 2E20A 4DCHA 1DEJA 1HX1A 1CZAN 1XQSC 5EVZA 4BR7A 4CI6A 3DXMB 4H0PA 3C7NA 2OANA 1ESVA 5AQSA 2P9LB 3DXMA 4FWKA 3SMPA 1BDGA 4L3QA 3WXKA 1ATNA 1GLLO 3QB0A 4CBXA 4K41A 4DQ8A 3VEYA 3CJCA 2P9LA 3WT0A 4JAXA 3SK3A 3BF3A 3ZETB 2QWRA 5AQWA 4CBWA 4BRIA 3VENA 3ZEUB 3AAPA 4PL8A 3MDQA 3WEEB 3LM2A 3H6EA 4XH4A 5KPTA 1MWKA 4PL7A 3ZEUA 1BWFO 5AQQA 3WEEA 5AQHA 1Z6RA 2YJEA 2AA4A 3JS6A 2QW9A 3R8EA 3VEOA 1YAGA 4H5WA 1NGGA 3GOIA 3CQYA 3DWLA 4BC4A 2E1YA 1XUPO 2E8AA 4IO8A 3ULEB 2P9IA 1NGJA 2P9NB 2NLXA 2IVNA 1NGHA 2V7YA 4YDUA 1GLBG 5E84A 4MLHA 3ULEA 3ZX3A 5F0XA 3A8YA 2QXLA 2P9NA 4RTFD 3CJ9A 2A3ZA 2Q97A 1KAYA 2CGLA 1HPMA 4H0VB 3FFKB 3VEXA 3JXUA 4DHYA 2HMPA 3VGLA 3O80A 4H0YB 3HI0A 5AQOA 2HF4A 2VYPA 1ATSA 2A41A 2YHYA 2WUSA 2IVPA 3HM8A 3W0LA 5AQLA 3R9PA 1JCEA 1QHAA 2QWPA 1YUWA 1NLVA 5LJVA 4GY2B 3TU5A 3L6QA 3O1WA 4WQ4A 3CHWA 3H3NO 2YI1A 4A62A 2P9KB 1BOTO 3UE5A 5AFUH 3GBTA 4MO4A 4JHDB 3HSCA 5BRFA 5AR0A 3WQTA 4F9OA 2P9KA 2FF3B 3BP8A 2VWBA 3H1VX 5FPMA 1T6CA 3VEZA 2QWQA 3HBTA 5AQYA 2F9WA 2D1KA 3QFUA 4B1ZA 5KPRA 5ADXH 1YXQA 4FSVA 2YHXA 4FWPA 3O4WA 1IG8A 1Q18A 4CZMA 3ENOA 3O8MA 1GLCG 4FOEA 5AQJA 4BRQA 4BRAA 1S22A 5F1XA 5AQVA 1HKBA 4H5VA 4CZJA 2HOEA 4CZGA 4B1YB 2GTDA 5EOYA 5JLHA 4B1UB 4MLEA 4O5FA 4FPBA 1NMDA 4H5NA 1NGIA 2E1ZA 3A5LC 3LDLA 1NGFA 4ISEA 3C7NB 3GE1A 5AFUA 5JLFA 4FWSA 2F9TA 1JCFA 1KAZA 2ZGZA 3M1FA 4QS7A 1LOTB 3LDQA 1C0FA 3LDOA 3VF2A 5BREA 3QMLA 2CH5A 4KBOA 5KQDA 5LJWA 4NB4A 5JICA 1BO5O 1BU6O 3CERA 1V4SA 3MN5A 3H45C 3H3OB 4O8KA 3UKRB 3SJHA 4MO5A 4EAHD 3F9MA 3U9ZA 3VEWA 4QS8A 3A5MC 3P4IA 4BQLA 3UKRA 3S41A 1WUAA 3U4LA 5AZJB 3VEVA 4BR4A 1BA0A 1ATRA 1HLUA 4CZIA 4EHUA 3CJ7A 3H1QA 2IVOA 5AZJA 3SMSA 4E1JA 2P9IB 4BR9A 5BR9A 1OKJA 3WXLA 4GNIA 3MN6A 4RCHA 3AY9A 1P8ZA 1ZBSA 3EKUA 4IZ9A 2NRHA 1HJOA 4IWVA 3ZX2A 5LY3A 4J8FA 3WQUA 3IFRA 2CGKA 2ASOA 5E26A 1GLAG 2PAVA 5FPEA 4JN4A 1YVNA 2QWNA 3KZBA 4BR5A 2E2NA 2FSKA 3H46O 4FWNA 4BC5A 5FPNA 5AQGA 2P9UA 2Q31A 4PKIA 4DB3A 2GELA 1J6ZA 5BRDA 1KAXA 4Z94A 1DGKN 2GUPA 1TYQB 4BRLA 3D7EO 4BRMA 4B1VA 4JD2B 4ISGA 1GLDG 1ZC6A 3O6WA 3QDKA 4CZLA 4CZHA 4BQZA 3DXKB 3D2FB 1TYQA 2GWKA 1Z05A 2EWSA 3BUZB 3O08A 4I6MB 4WQ5A 5AQKA 1GLJO 4JD2A 1HKGA 1HUXA 2BUPA 3FE1A 4CD3A 3I8BA 2QM1A 5BPLA 1QQMA 2PBDA 3MCPA 4A61A 4FWQA 3DXKA 3DJCA 3D2FA 3U9DA 4I6MA 3L4IA 5BRHA 3VESA 1QZ5A 2I7PA 3QICA 2W41A 4PKGA 4BG8A 4BRCA 4H0XB 2FSJA 5ELZA 2VCPA 2D0OA 4K43A 1NWKA 1S3XA 2ZF5O 1U6ZA 3FLCO 5AQUA 1T44A 1X3MA 1QQOA 4BRFA 4HWIA 1BUPA 2ASMA 4WYBA 3LDNA 3ZX0A 4BRKA 1SZ2A 1U2VB 4QS9A 3EL2A 4CZFA 4K25A 4FPAA 3LDPA 3D2EB 4IXCA 2AP1A 3CJAA 4FL9A 4AM6A 1U2VA 5AQIA 1NBWA 2KHOA 3D2EA 2D4WA 3VPZA 3ATVA 3ENHA 1E4FT 2QWOA 5B8HA 2P9SB 3R6MA 1H1VA 3CJBA 5AQRA 1JCGA 1TUYA 3KHYA 2E2PA 2FF6A 2P9SA 4K42A 4B1WB 4EHTA 3FZLA 4H5RA 4FWOA 5TKYA 5BN8A 2FLOA 1XC3A 5JMVA 2YCHA 2V7ZA 1WOQA 3FR0A 2Q0RA 2ZWHA 4H03B 1C0GA 5EX5A 4H0TB 3QFPA 4FO0A 3MK6A 1KXPA 1RFQA 2H3GX 5AQZA 4BROA 1SQKA 2I7NA 2Q0UA 2Q2RA 1K8KB 2CGJA 2YJFA 2ZGYA 2QWLA 3EN9A 5ADXA 1R59O 4WQ4C 5KQ8A 1ZXOA 2A5XA 4BVOA 4FWMA 1K8KA 4EFHA 1NGCA 5AQNA 4BRDA 3L0QA 3UB5A 3CIPA 1T6DA 3CETA 3A5OC 4PKHA 3QBWA 2E88A 4BR0A 2GEMA 3VF4A 3LL3A 4M7YA 4BRPA 3ATUA 5AQXA 1V4TA 2A42A 1DKGD 3IDHA 3IMXA 2E2OA 4JNEA 3A5NC 4H5TA 4BREA 3UKUB 4HTLA 4BRHA 1NM1A 5I9EB 2D0PA 4XH5A 3KVGA 3UKUA 5KPZA 5AZIB 3FZFA 3ZETA 3MN9A 2ITMA 2A6AA 4XH1A 4LC9B 2P9UB 2FXUA 5AZIA 4BRNA 2QWMA 4ISFA 3VERA 4IJNA 4B9QA 3WXIA 3EKSA 5EY4A 2GWJA 4A2BA 4IJAA 4Y0WA 3AARA 1E4GT 5F2RA 2J4RA 4A2AA 5AQMA 3OHRA 1MWMA 1QQNA 4XEIA 4BR2A 4EIAA 3GDQA 1X3NA 3MN7A 3DAWA 2P9PB 3QBXA 1QZ6A 5CE3A 4B1XB 5FPDA 3W3DA 1TUUA 3FGUA 3HZ6A 3CQXA 1BA1A 3CJ1A 2P9PA 2Q36A 2NZTA 3GL1A 3WXJA 1IJJA 1Y64A 4FWLA 5AQPA 4FWRA 2Q1NA 3VETA 4C23A 4M7XA 1BG3A 5AQFA 2ASPA 4CZKA 3I33A 4AM7A 3VGMA 2UYTA 1SAZA 2DPNA 4CBUA 5BN9A 3IUCA 3A0IX 3FZKA 3SLCA 5BPNA 4BG9A 3O5BA 3J8AA 2W40A 2YHWA
chains in the Genus database with same CATH superfamily
3ENBA 1GLEG 1CZ9A 2P51A 1VQ8N 5A2QO 3TTFA 3BF1A 3O3FA 3TPQA 3M3ZA 5HRSA 2QI2A 3VF6A 1KVCA 3CPEA 5FRMA 3OYIA 3O9SA 4JK9A 1TL3A 3EO3A 3HTVA 4B9SA 3O3HA 3MMVA 1K6YA 4RWTA 4BWMA 5EXWA 3OYAA 2HF3A 4BRGA 3LAKA 1VSIA 1NK7A 1NGAA 3K59A 3LALA 1VK0A 4MDAA 4OX9K 4LF7K 3SI6A 4WF9L 1HKCA 4WQ5C 4B8CA 3OYBA 3G6EN 2VWJA 1LCUA 5J2NA 1SL1A 4BVPA 1YIJN 3OA9A 4FOIA 3VOVA 1D9DA 1D4XA 3CI5A 5I3UA 1NGDA 1CXUA 1XQSC 5E41A 3DXMB 1N33K 3IAYA 1YI2N 4LH5A 4FJKA 3T1HK 4DSJA 3L3UA 1KTQA 1DTTA 3J7ZO 3QB0A 4CEOA 2UUBK 3CJCA 2P9LA 3SK3A 1S6QA 1HQUA 3OY9A 1KRPA 3PLAA 3AAPA 3ITHA 4CFAA 2XY8A 5TKWA 3K5MA 3WEEA 4OKEA 5AQHA 1S1WA 3VEOA 4OPHA 1YAGA 1RTJA 2X74A 1NGGA 3GOIA 1VSDA 3DWLA 2JLEA 3AO1A 3NVKA 3C65A 4J2DA 2P9NB 4IDKA 4M3XA 3ULEA 3NDKA 3K5OA 2QXLA 3SBTA 3NGIA 3CJ9A 3WNEA 4KAZA 4DV4K 2A3ZA 2Q97A 2CGLA 3ISNC 4I2QA 3JXUA 4F2SA 2R7YA 2HMPA 3VGLA 3OJSA 4JYAK 3IKMA 3VQ7A 1BI4A 1Q9XA 3NVMA 1R0AA 1MU2A 2VYPA 3UIQA 4M3ZA 2YHYA 1OH7A 4ELTA 1GOBA 3R9PA 3QINA 1YUWA 1NLVA 4CESA 1N5YA 3M8PA 3L6QA 1WAJA 1JL1A 3CHWA 3H3NO 4DR7K 4A62A 1T8EA 1BCOA 4JKDA 4DSFA 1J5OA 4DS4A 3WQTA 3HPHA 3CQ8A 4TSXA 1Q86O 1JLEA 3P83D 4RW8A 5FPMA 3T69A 2PY5A 3VEZA 3L4QA 3HBTA 5AQYA 2F9WA 5AJ3K 4ELUA 4FCYA 1EWRA 4DR5K 4M3WA 1YVUA 3KWIA 3NH2A 2W6KA 2LSNA 3NFAA 3VN5A 4B08A 2KKZA 4ELVA 3CXCM 3V9WA 3ZSOA 4CZMA 1GLCG 1BIUA 4BRQA 3SAHA 1IKXA 4KHQA 3L3VA 3P1GA 1TK5A 4CZGA 4YOYA 4W5QA 4MFBA 2HVHA 4O55A 4DG1A 4FLUA 4BACA 4DTUA 4KHNA 4FK2A 4GV9A 5C2DA 4FPBA 5K14A 4F3TA 1N32K 1C1BA 1NGFA 5AFUA 2E5LK 3CCRN 2VG6A 4FJGA 2F9TA 3LANA 3VQEA 4QS7A 5BREA 5SZTA 3PSIA 2B4JA 1VHXA 2DFHA 1BO5O 3G71N 2P1JA 1S6PA 2HHWA 2NRRA 3H3OB 4BDYA 3UKRB 4YOWA 3F2KA 1VQNN 3LP2A 3VEWA 4QS8A 2XRIA 3A5MC 1A5WA 3F5TA 4CGGA 3S41A 1WUAA 4CERA 2XO7A 2HHVA 5AZJB 1XC9A 1KC8O 1HLUA 5GADP 1XHXA 1CXQA 3MX2A 3SMSA 4E1JA 4KH5A 4DFPA 3AGRA 3VQ4A 4EZ6A 3MN6A 4LF9K 3E9LA 3AY9A 2YX6A 1KVBA 4JKGA 4KHSA 1S1XA 1HJOA 4KH4A 3ZX2A 4PWDA 3VQCA 4J8FA 3IFRA 1GLAG 2HBKA 2WTUA 5FPEA 4AHUA 3DLHA 2E2NA 4OO1J 2ZE2A 1BI4B 4BE2A 2B5JA 3IRXA 4FWNA 1WSEA 4E7KA 4DB3A 3MEDA 1X1PA 4Z94A 3OBWA 4DLEA 5M1FA 3TARA 1OH6A 4BRLA 3D7EO 2BE2A 1ZC6A 3VQ6A 4CE9A 4CCHA 1Z05A 4KTZA 4CGFA 2BUPA 4CD3A 2QM1A 1B92A 2QA4N 4DQPA 3D2FA 1QZ5A 1TKDA 4BG8A 4FK0A 3NGZA 4H0XB 1OH5A 4K43A 2D0OA 3RMCA 3NMUA 2HNYA 2KW4A 3FLCO 1QQOA 4DSEA 4HWIA 2IS3A 1BUPA 4BRKA 3MEGA 4CZFA 4K25A 3V81A 3LDPA 3KKSA 4R79A 2WONA 1D9FA 1JLCA 2OPSA 4HTUA 3AO3A 5CR4A 4IO9L 3CC2N 1EP4A 4KB0A 3O3GA 3ENHA 2QWOA 3V9SA 3CJBA 3KHYA 4DFKA 5J2QA 3O4NA 2P9SA 3SPZA 1IV0A 2HNZA 2X6SA 4H5RA 3T3FA 4FWOA 1C0TA 1HYSA 4CHPA 4E0DA 3PIOL 2A1RA 1BQMA 1RT6A 1WOQA 1DTQA 3M8QA 2IDOA 3PO4A 1S5JA 2ZWHA 4H03B 1C0GA 3QFPA 4O44A 2YHAA 2QTDA 5C42A 1KXPA 1RFQA 2H3GX 4CJLA 4KV8A 2Z1JA 5CYMA 2ZGYA 3EN9A 3OYCA 1R59O 4WQ4C 5KQ8A 1LWEA 4FWMA 1K8KA 4C8KA 3KK1A 4BRDA 5AQNA 3OJUA 2XY7A 2O8FB 1T6DA 3CETA 1T7PA 3A5OC 3QBWA 5GINA 1ZBLA 3ULDA 3LL3A 1JLFA 2A42A 1VQ4N 4E7IA 4CGJA 1C1CA 3L2WA 3A5NC 3T1AA 2BDPA 3ZT0A 3RVCA 5IWAK 1NM1A 2P5GA 4CGHA 3J7YP 3UKUA 5AZIB 1A5XA 3ZETA 4OVLA 3DI6A 1YJNN 4CJSA 1LWFA 4CHOA 4PY5A 3QNNA 5KRSA 1RT4A 3ZSRA 4Z4HA 2X78A 3AVNA 3SV3A 3EKSA 2UUCK 2B6AA 2XY5A 3LP0A 1NKEA 1VSMA 1BIZA 1NMNA 2RF2A 1SV5A 1CLQA 1E4GT 5F2RA 2OYQA 4W5RA 3GDQA 4DQQA 2P9PB 3QBXA 1Z26A 2GUIA 2I5JA 1JKHA 3BZKA 3CJ1A 4DQSA 4C8MA 1W9HA 4FWRA 4KI4A 1NKBA 4M7XA 1IBMK 4RW4A 5AQFA 2ASPA 1T3VA 4JRQA 3AV9A 2DPNA 3NHGA 2GV9A 3A0IX 1YHQN 5BPNA 3CMEN 4BG9A 4X62K 3KJVA 4RW6A 4KHPK 2QEXN 4HUEA 4BC3A 1MA9B 4M45A 2O8CB 3G25A 3TR8A 3OYLA 5HL7L 3V1RA 3NE6A 1NGBA 4CIEA 1J54A 4B9LA 4W5NA 2DFFA 1IKWA 3J80O 4EP5A 3NCIA 1M1KO 1LAWA 2G8UA 1NJYA 3ZT1A 4DQIA 1OH8A 3B6OA 4V19S 4I7FA 3FZHA 2F96A 4MDBA 1YT3A 1G99A 2KTQA 1NK6A 2FBYA 1IBKK 4CK3A 2AJQA 3LM9A 3DOLA 3U8XA 3R1XA 4CW7B 4FXDA 3ZSVA 4BC2A 4BGBA 1WBDA 3LPTA 3AAQA 5BPMA 3TTCA 4H0OA 4CJWA 4O5BA 4B3OA 1DEJA 2F7TA 4BR7A 4Q5VA 4H0PA 4DTRA 5KI6A 3C7NA 4FYDA 3TSPA 2OZMA 3CCLN 1ESVA 3AVBA 4FVMA 3DXMA 5AQSA 1HRHA 3RMAA 1K73O 4N56A 4L3QA 3WXKA 1ATNA 4OGCA 3O9QA 3Q7CA 1YITN 3WT0A 3ZETB 1RDUA 2QWRA 4BRIA 2JGUA 4CFDA 3ZEUB 4FJ7A 4C8LA 5IT9O 4DTNA 4XH4A 1VRUA 5AQQA 1X9WA 2YJEA 4YOUA 2QW9A 3SPYA 3OTOK 1RBUA 4OPJA 1QSLA 1XUPO 4IO8A 3ZT2A 4A5BA 2IVNA 1NGHA 2OTLN 1GLBG 5E84A 1KFSA 2Y1JA 1JXEA 3ZX3A 4HCCA 2GBZA 3QIOA 2P9NA 1BGXT 4B9MA 3OYFA 5C10A 1EX4A 1KAYA 3OVNA 4H0VB 5SWMA 4J2EA 4DHYA 3ZCMA 4DV5K 1RTDA 4H0YB 1F21A 4ILGB 5AQOA 3PSFA 3QNOA 4CF9A 1FXXA 3PO5A 4LFAK 1RT1A 3W0LA 5AQLA 4AILC 2QWPA 4CF2A 1NJWA 3AO2A 1REVA 3CCJN 3O1WA 2HHUA 3T19A 2YI1A 2P9KB 1BOTO 5AFUH 4B3SK 1WLJA 5AR0A 2E6LA 4F9OA 4DUYK 4NYNA 4U67L 2JWLA 4C8OA 3OYEA 2FF3B 1ITGA 3H1VX 3HP6A 3K9KA 3THWB 1W97L 1TAUA 3CG7A 1JJ2M 3OS2A 1LW0A 3O4WA 1IG8A 5EU7A 4AHTA 4QCLA 5DMRA 1BL3A 5M1OA 4JI0K 1S22A 1P90A 3MWPA 4CEEA 4H5VA 2HOEA 1N6QA 1DLOA 3SYZA 5C25A 4KHYA 1EO1A 3NF6A 4B1UB 1IH7A 2HMIA 2QXFA 3SQ1A 1NMDA 4YY3K 1U45A 2O8BA 2FBTA 3A5LC 3LZJA 3AVIA 4QOZB 3C7NB 5JLFA 1TK8A 3M1FA 1C1AA 4B9NA 3TANA 1KLMA 4WFBL 3QMLA 4KBOA 3ASMA 3AGKA 3V1QA 5JICA 3P31A 1BU6O 5T7BA 1V4SA 3H45C 4O8KA 1WNSA 4EAHD 3F9MA 5C2FA 3U9ZA 1HMVA 4NCGA 3MEEA 4YHHK 4K8XA 2VGNA 3THYB 3UKRA 1Q81O 1XWLA 4CFCA 3T7ZA 3U4LA 3ZSYA 3VEVA 1QSYA 4DR3K 2P5OA 3HOSA 3RRGA 3IS9A 3OYNA 2IVOA 5AZJA 1D5AA 1VSLA 1HNIA 5GIPA 5CZ1A 2NRHA 5HROA 4QAGA 2UUAK 1TGOA 1TV6A 1KD1O 4JI7K 2ZJRL 4GKJK 4BR5A 3EE8A 2OTJN 4L8RB 2FSKA 4IG3A 1QE1A 3H46O 4B9UA 3EEQA 4A57A 1UA0A 1Q82O 4LF8K 4HUGA 1RBTA 1KAXA 3NF8A 4DR1K 2IOCA 4KHWA 1TYQB 1GOCA 1GLDG 2VG5A 3QDKA 2Z1IA 4DV6K 3DXKB 3O08A 1JLAA 4LFCK 4WQ5A 1GLJO 1WAFA 1HKGA 2E4LA 3FE1A 5KGXA 1RDBA 1QQMA 4LF4K 2PBDA 4JK8A 4FWQA 4CF0A 4CGIA 2EHGA 3L4IA 5BRHA 3QLHA 4NLBA 3KLHA 1JL2A 1JLBA 2W41A 3QESA 4B9VA 5DM6L 5LL6Z 4CJPA 2VCPA 3THXA 1A5VA 3RMDA 2G8VA 4CK1A 1VQ7N 4JI3K 2NRZA 5AQUA 3U6FA 3EZ5A 1RBVA 4DUZK 1RDAA 4WYBA 3EY1A 5HP1A 4QS9A 2OPPA 3TAEA 3M5RA 2WC9A 3D2EB 1VQLN 3CJAA 4FL9A 3ZSXA 5AQIA 3VPZA 5B8HA 1RILA 3G10A 1H1VA 2G8HA 4JEPA 2FBXA 2VQFK 3D45A 2E2PA 3HVTA 1NG9A 2O8BB 4CF1A 3V6DA 2D0AA 4B1WB 5HRNA 3FZLA 4CJEA 3TSQA 4JLHA 3TAGA 5TKYA 5BN8A 1XC3A 5JMVA 4FW2A 1QSSA 3ZSWA 4IBNA 4E7JA 1NK4A 2Q0RA 3HO1A 1VQ6N 5GAHP 4CJ5A 3I56N 1Q8IA 4FJ8A 4CEBA 3MK6A 1KFDA 3SAFA 4UQGA 2I7NA 4I9QA 2Q2RA 4Y1DA 4GMJB 3HPOA 1OVYA 1M90O 1NK9A 2QWLA 1NKCA 3DLKA 2A5XA 4BVOA 1NGCA 1S72N 4DFJA 3CIPA 4CJUA 4BR0A 2E88A 3E9PA 4CJKA 3SQ2A 2O8FA 4CJTA 4BRPA 3ATUA 1IO2A 1V4TA 3KKRA 4JI1K 4O4GA 4FJJA 2O4IA 3MXJA 4OPAA 3N4PA 3RMBA 3HSTB 3IMXA 4DR6K 4HTLA 3LAMA 1Q9YA 3M8SA 3JYTA 4PA1A 3KVGA 1EWQA 2PYLA 1VSHA 3FZFA 1VSJA 4FM0A 2A6AA 3B6PA 4IKFA 3HXMA 5AZIA 3TAQA 3OYHA 3JAMO 4EZ9A 4IJNA 3WXIA 4CECA 2GWJA 4LF6K 4N41A 4IJAA 3AARA 2Z1HA 4A2AA 3CPWM 5AQMA 5C0YA 4BR2A 3DMJA 1NJZA 4YORA 5FPDA 4B1XB 4KO0A 2X6NA 1TUUA 1RT3A 4DTOA 3CQXA 1BA1A 3THXB 2P9PA 2NZTA 3GL1A 1Y64A 4CFBA 1NJIO 2Q1NA 1S1UA 3CMAN 2NNWA 1N8RO 3O4QA 2IC3A 3I33A 4JKEA 3VGMA 3WXMB 1SL0A 1ZBIA 4CBUA 5BN9A 4C1NI 3FZKA 3OYJA 3J8AA 2W40A 2YHWA 2FBVA 2VWKA 3WNGA 1QHTA 3QETA 1VQKN 3RSEB 4F8RA 3KTQA 2HW3A 2DFEA 2A40A 3DYAA 4DSLA 1Q7YO 4A5AA 1GLFO 4KH6A 2O8CA 4CJ3A 5KTQA 4CD1A 3JSMA 3VGKA 1UOCA 3A2FA 4DV2K 1EQYA 3MXIA 2HSTA 3NF7A 4M3RA 4X64K 4HUFA 1U48A 1KQSM 4KTWA 1B9DA 2V51B 4LSLA 4CJ7A 1RGIA 3EZWA 4DTPA 2V52B 3AO4A 1VRTA 4W5OA 3O1BA 1FW6A 5J2PA 1VQMN 4DR4K 3N4QA 3B8AX 4NXMK 1X9JA 2IIRA 1L5UA 3QEVA 2ATQA 2BTFA 4NXNK 4CZEA 4ILJA 2E20A 3DLBA 5EVZA 1CZAN 1ASVA 4CI6A 4IFYA 3I0RA 3MAQA 2OANA 5C15A 3SMPA 4FWKA 1BDGA 1EKEA 3QEIA 3C6TA 1GLLO 2ITGA 4CBXA 3QIPA 4F4KA 3L2QA 3R3LA 4JAXA 1JLGA 3VENA 1IG9A 5KRTA 1KLNA 3KK3A 3TABA 3MDQA 4K8ZA 1ASWA 5C12A 3ZEUA 2ZD1A 3V1OA 5MLCQ 2G8FA 4N5SA 2Y1IA 3S3OA 3JS6A 3VQ8A 4FJNA 3LZIA 5H1SQ 4JKAA 3ZT3A 3CM6A 2E1YA 4DKWA 2NRXA 5CHIA 3PX0A 2NLXA 4YFUA 1S9EA 5F0XA 3A8YA 4BDZA 3SAGA 3CC4N 2OA8A 4LH4A 1D8YA 1NOYA 4BDPA 4GKKK 2HHSA 1HNZK 2YKMA 3OS0A 3VEXA 4JI5K 1EXQA 1I39A 3O80A 1RBSA 4GVMA 4FZZA 2HF4A 1C0UA 3G4SN 3K0SA 1VSKA 3HRGA 1BCMA 3HM8A 1I94K 3SUPA 2ZJQL 1UAXA 1WSIA 4WQ4A 1RDCA 3OBYA 3UE5A 1QTMA 3GBTA 2Q3SA 1J53A 3HSCA 5BRFA 1IKVA 4KB1A 2P9KA 3MCAB 3BP8A 3K9JA 5JVHL 4C1NK 2D1KA 1O13A 4JKBA 4N47A 3HL8A 1HPZA 2XHBA 3THWA 3QEWA 5D3GA 2YHXA 4B8AB 3AVCA 4E89A 4J2AA 4FWPA 4LY7A 3BY5A 5I42A 1Y97A 3DRRA 4FJIA 5AQJA 4BRAA 1HKBA 3KWGA 4AQYK 4CZJA 1NK0A 4B1YB 3SNNA 3TAPA 2GTDA 3L8BA 4OLAA 5EOYA 3CCQN 3KLFA 5JLHA 1DT9A 1Z25A 2GX9A 3C94A 3AVAA 2HB5A 4U7BA 3D0PA 4IDHA 1NGIA 3LDLA 4GV6A 4ISEA 4LF5K 2OZSA 3VQQA 4DV7K 4JKHA 2RKIA 1VSEA 1KAZA 3VA0A 1SKSA 4DV3K 4YNQA 3VF2A 3PX6A 1FJGK 5LJWA 4NB4A 1XHZA 3CERA 3MN5A 4J2BA 4MO5A 2UXDK 4Z4IA 3QEXA 4Z4GA 3CCUN 3P4IA 3OYKA 4BQLA 4FJHA 4M3YA 3V4IA 4CEDA 3S3MA 3L2UA 3CD6N 4B9TA 4Y1CA 3CCVN 3THYA 2BGGA 3LWMA 3ZYYX 4BR9A 1ASUA 1OKJA 2ZJPL 4OGEA 3ZSZA 4RCHA 4IEEA 1TL1A 2D5RA 1P8ZA 2PFUA 1ZBSA 4IWVA 4WCEL 5HBMA 1KSPA 3WQUA 2CGKA 3QEPA 3V9ZA 3F9KA 3PY8A 4FJXA 1S1TA 4ZHRA 5FDLA 3S9HA 4JN4A 1YVNA 2QWNA 3KZBA 4EP4A 3NBPA 2HNDA 3AA2A 1ZBFA 4BC5A 5FPNA 1YTAA 1E3MA 3K2PA 4OKJA 2GELA 1J6ZA 5BRDA 4LD0A 3IG1A 4FLZA 1HNVA 2GUPA 4RG8A 4BRMA 4Z4CA 3DRPA 4JD2B 4ISGA 3QO9A 3I0SA 4CZLA 2YNGA 4CZHA 4BQZA 4CJQA 1TYQA 5HRRA 3BUZB 2EWSA 4I6MB 1TKZA 1HUXA 3I8BA 3DXKA 3DJCA 2NUBA 3VESA 3AVFA 3VMFB 2IGIA 4BRCA 3K57A 1VQ5N 4UY8O 1S3XA 2WFBA 3CCMN 4PHTX 5LMUK 4FLXA 3NAEA 3KIOA 1X3MA 3U3GA 3PIPL 1SZ2A 1U2VB 1O1WA 5M1QA 2O4GA 4IXCA 2AP1A 3KLGA 4H4OA 4KFBA 4DWIA 2O8EA 1RBRA 3RR8A 1NBWA 1VQPN 1ZYQA 4ID1A 2PZSA 3D2EA 2D4WA 4IOXA 2O8DB 5AQRA 1JCGA 1WSJA 3O9RA 4JS5A 4KTQA 1TUYA 1YJ9N 1W0HA 2FF6A 5KGWA 1JLQA 3DLEA 3EYZA 4RW7A 4IEIA 4NYFA 4KPYA 1N34K 5HOOA 1XMOK 3AVHA 4FJ5A 2V7ZA 4NCAA 3VQ5A 1LW2A 3FR0A 3T1YK 3BDPA 1NU0A 3HM9A 3PUFA 3AA3A 1RDDA 4FO0A 4FLVA 1HYZA 4BROA 5AQZA 4YOVA 3SUQA 1L3SA 1WN7A 3BGRA 1ZXOA 2KLAA 1NOZA 2RN2A 3ALYA 3UB5A 1RT5A 1HQEA 4JKFA 1QVFM 4O0JA 3VF4A 3I55N 3EE9A 2KZMA 4CK2A 1BHLA 3DRSA 4H5TA 4BREA 3MECA 1T05A 1NJXA 1J9AA 3J7AP 2WOMA 4G9ZA 5I9EB 4XH5A 4FLTA 3PX4A 5KPZA 5M1PA 3AVKA 3KD1E 1NK8A 3MN9A 3C6AA 2ITMA 2HHHK 4AHVA 1HNXK 2QWMA 4ISFA 2KFZA 3O9UA 3WNFA 5EY4A 3OYGA 2HHXA 3ZLJA 3AVGA 4JKCA 2HBMA 5M1NA 1HYVA 4DTSA 5LMNK 3C95A 3OHRA 4B3MK 4FJLA 2OCEA 2VGMA 2W6LA 3VQBA 3CFRA 4DTJA 1QZ6A 2E6MA 5CE3A 4DF4A 4B3RK 3P5JA 3FGUA 5JS2A 3SBGA 2OPRA 3VQDA 2OPQA 3WXJA 4FWLA 5GAGP 3CFPA 1UA1A 1YJWN 3MXMA 4C23A 4FZXC 4BWJA 1J5EK 1BG3A 3AVMA 3CCEN 4A59A 4CZKA 1S9GA 2KFNA 3ZSQA 2XY6A 2QKKA 4ICLA 1NNEA 2ETJA 3IUCA 2JWKA 3SLCA 1W7AA 2NRTA 2O8EB 3O5BA 4DF8A 4AHRA 4O8UA 3O9TA 4RW9A 1X9MA 4KHUA 3M6GA 2HHQA 1FK9A 3FZMA 4YDUC 3SCXA 3WUHA 4BGAA 1G15A 3RSEA 4JHDA 1XMQK 5AQTA 4NO7A 1TKTA 3HVRA 1MDUB 4FJMA 4DLGA 3ID8A 1JXBA 3E66A 2NRVA 2E2QA 4WFNL 1VSFA 3BEXA 1ZBUA 1RDWX 2NRWA 1NGEA 4FLWA 4LSNA 3MWTA 1WSHA 2WBNA 4M63C 4DQRA 2FSNA 4KI6A 5GIOA 3P38A 3HP9A 2HBJA 3GG4A 3ID6A 3C0BA 3NH0A 4M42A 2CH6A 1TK0A 3LP3A 1ILYA 2UXBK 4H4MA 1WSGA 3PV8A 1L3TA 5GAEP 1KVAA 1HJRA 1RCHA 4DCHA 4CJ4A 1HX1A 3I8DA 4H8KA 5DM7L 2FC0A 4JS4A 2P9LB 4DMNA 4CHQA 4DV1K 4E1NA 3V9XA 4K41A 4DQ8A 3VEYA 5C24A 2IAJA 3BF3A 2F8SA 1S1VA 4CEZA 5AQWA 4CBWA 4F3OA 1YTUA 4PL8A 3RTVA 3WEEB 3LM2A 3LPUA 3WNHA 3TAFA 3HT3A 3CFOA 3H6EA 1SKWA 5KPTA 3NH1A 1MWKA 4FK4A 1XI1A 4PL7A 5BR8K 4HHTA 2DY4A 1BWFO 1U49A 4OLBA 1Z6RA 3DM2A 2AA4A 3R8EA 1BQNA 1WB9A 4H5WA 3G0ZA 3SQ0A 4FM2A 3CQYA 4BC4A 2E8AA 3ULEB 3ZT4A 4F2RA 2P9IA 3RWUA 1NGJA 4DR2K 4YDUA 2V7YA 5J2MA 1L3UA 4FM1A 3CYMA 2RPIA 4DU4A 4MLHA 5CZ2A 2RE2A 3L2RA 4RTFD 4YOXA 1OVQA 4Z0UA 1HPMA 3FFKB 1TVRA 3M8RA 4E3SA 3E1YA 1LWCA 3HI0A 5CY4A 3OW2M 1ATSA 2G8WA 4XIUA 2A41A 2WUSA 2IVPA 1IBLK 3SUOA 1JCEA 1QHAA 5LJVA 4GY2B 3TU5A 4CF8A 1HNWK 2W42A 3OYDA 5CYQA 4M3TA 4FVUA 1W2BM 1K9MO 1VAZA 3AVJA 2F4VK 4MO4A 4JHDB 4AH9A 4WFAL 1QS4A 3SV4A 4AF1A 2VWBA 1KCFA 1T6CA 2QWQA 3RRHA 4FW1A 3SQ4A 3QFUA 2RHKA 4B1ZA 5KPRA 5ADXH 1YXQA 4FSVA 3FFIA 2YHBA 3H08A 4ILHA 4CGDA 2G8KA 4M3UA 1SS6A 4CJFA 1Q18A 3E01A 3ENOA 3O8MA 4FOEA 4CVNE 5HRPA 5F1XA 3F73A 5AQVA 4DSKA 1LV5A 4DTXA 1VQON 1C6VA 4CEFA 1SUQA 5FROA 4KREA 4MLEA 4G1QA 3K58A 4O5FA 2BANA 4H5NA 2E1ZA 3QERA 4E7LA 3GE1A 1XNQK 4JI2K 4FWSA 1X9SA 3V9UA 3VQPA 4IOCL 1JCFA 2BH1A 4KRFA 2ZGZA 3SUNA 1EETA 1LOTB 3HOTA 3LDQA 1C0FA 3LDOA 4C8NA 2CH5A 3BZCA 2ZM6K 5KQDA 4X65K 1UWBA 4ZTFA 1RTHA 2YKNA 3SJHA 2KZZA 4DS5A 1N36K 3VTIA 1QQCA 1L3VA 4I2PA 3TAMA 4BR4A 1BA0A 1ATRA 4DTMA 4CIFA 4CZIA 3J81O 3KLIA 4EHUA 4CJVA 3CJ7A 3H1QA 4CEQA 1K8AO 2P9IB 5BR9A 4JKGB 4DSIA 1C0MA 3WXLA 3LDSA 4GNIA 4PUOA 3TTDA 3RR7A 1QVGM 2KQ2A 3EKUA 4IZ9A 3CC7N 3VTHA 5LY3A 5M1KA 2ASOA 5E26A 2PAVA 4N76A 3CM5A 4YOTA 2UXCK 5FLXO 4FJ9A 3S3NA 2PYJA 2QKBA 5AQGA 2P9UA 2Q31A 4PKIA 4BY9C 3THVA 5JS1A 4GV3A 1DGKN 4NCBA 1RT7A 4B1VA 3O6WA 3HK2A 4BE1A 3OYMA 1GOAA 3D2FB 3KK2A 1SL2A 2GWKA 5AQKA 4FLYA 4JD2A 3AO5A 5BPLA 4CHNA 3MCPA 4A61A 3U9DA 4I6MA 2I7PA 4W5TA 3QICA 4PKGA 2F8TA 2FSJA 5ELZA 4X66K 4PQUA 1YF5L 1NWKA 2ZF5O 4FZYA 2D0BA 1U6ZA 1WSFA 3AA5X 2ZQBA 1T44A 3DOKA 4OJRA 4BRFA 4CIGA 4O0IA 1ZBHA 2YV0X 3AA4A 2ASMA 2YNFA 3LDNA 3ZX0A 1B9FA 2DTUA 3EL2A 4FPAA 3MX5A 4DFMA 4Z4EA 3OS1A 4ID5A 2G8IA 1FKPA 3HPGA 1U2VA 3VQ9A 1FKOA 4AM6A 1TAQA 2KHOA 3NF9A 1U47A 1HR0K 3ATVA 1E4FT 1I3AA 2P9SB 3R6MA 4JI8K 4GW6A 3DLLL 1BISA 1TKXA 3E9OA 4Q0BA 2YNIA 5JVGL 4HVJA 2VG7A 3DLGA 4AHSA 2O8DA 4K42A 4EHTA 4Z4FA 2FLOA 3SZ2A 3TI0A 3AVLA 4CEAA 2YCHA 4CJRA 4DV0K 1NK5A 4JV5K 5EX5A 4H0TB 2HHTA 4NLCA 3LP1A 4ZTJA 3C6HA 4OPKA 1SQKA 2Q0UA 1K8KB 4I9LA 2CGJA 2YJFA 1VQ9N 5ADXA 4CHZA 2EX3A 4EFHA 3L0QA 1XNRK 4DU3A 4PKHA 2GEMA 3CF5L 4M7YA 4E19A 4E1MA 5AQXA 4OKKA 4M41A 5FRNA 3HJFA 4IFVA 3VQAA 3P39A 5HLFA 1DKGD 3IDHA 5DK5A 4CHYA 4K0KK 2E2OA 4JNEA 4IOAL 2HBLA 3SJJA 1T03A 3TSUA 3UKUB 4BRHA 2D0PA 3L2VA 1RTIA 4R5PA 4XH1A 1CZBA 1U04A 4LC9B 2P9UB 2FXUA 4BRNA 3LWLA 4JRPA 3K5NA 2UU9K 3KK7A 2A1SA 4MQ3A 4AHCA 3VA3A 3NGYA 1LAVA 3VERA 4B9QA 4DU1A 2YNHA 4WE1A 2QK9A 4A2BA 4JI6K 3DLRA 4E7HA 1WBBA 4Y0WA 2J4RA 1SKRA 4IG0A 1MWMA 3K5LA 1QQNA 4JK7A 4XEIA 4JI4K 4EIAA 3U3YA 1X3NA 3MN7A 4LFBK 3DAWA 1U4BA 3W3DA 3HZ6A 3D6RA 2Q36A 1IJJA 5AQPA 3KLEA 3VETA 4KKOA 1IKYA 2VQEK 4HCBA 1RNHA 3C6UA 4AM7A 3CCSN 4GVEA 2UYTA 1SAZA 3Q7BA 4BE0A 3KD5E 2D0CA 3HYFA 3TWHA 1RT2A 5J1EA 4IFEA 2HVIA 4B3TK 2Z1GA
chains in the Genus database with same CATH topology
4BC3A 1VQKN 1MA9B 3ENBA 4O8UA 3O9TA 1GLEG 3RSEB 3M6GA 3G25A 1VQ8N 2A40A 3FZMA 4YDUC 5HL7L 3WUHA 4A5AA 3TTFA 4BGAA 1NGBA 1GLFO 3BF1A 3RSEA 3TPQA 3M3ZA 4JHDA 4KH6A 2QI2A 3VF6A 4CD1A 3CPEA 5AQTA 4NO7A 3VGKA 1MDUB 3O9SA 4JK9A 3EO3A 3ID8A 3HTVA 3E66A 3MMVA 2NRVA 4RWTA 2E2QA 1EQYA 5EXWA 4WFNL 1M1KO 2HSTA 2HF3A 3BEXA 1RDWX 2NRWA 4BRGA 1NGEA 1KQSM 3MWTA 1NGAA 2V51B 4CJ7A 3FZHA 4MDBA 4MDAA 1G99A 1RGIA 3EZWA 2WBNA 4M63C 2V52B 3LM9A 3U8XA 2FSNA 3R1XA 1HKCA 4WF9L 4WQ5C 3O1BA 5GIOA 3G6EN 3P38A 1VQMN 1LCUA 2HBJA 3GG4A 3ID6A 3N4QA 3B8AX 3C0BA 1X9JA 4BC2A 2CH6A 4BGBA 4BVPA 2IIRA 1YIJN 1ILYA 3OA9A 3AAQA 4FOIA 5BPMA 3TTCA 2BTFA 3VOVA 5GAEP 1D4XA 3CI5A 4CZEA 1NGDA 4H0OA 4ILJA 2E20A 4DCHA 1DEJA 1HX1A 1CZAN 1XQSC 2F7TA 5EVZA 4BR7A 4CI6A 3DXMB 4H0PA 3C7NA 1YI2N 3TSPA 5DM7L 2OANA 5C15A 3CCLN 1ESVA 5AQSA 2P9LB 3DXMA 4FWKA 3SMPA 1BDGA 1K73O 4L3QA 3WXKA 1ATNA 3J7ZO 3O9QA 1GLLO 3QB0A 4CBXA 4K41A 4DQ8A 3Q7CA 3VEYA 3CJCA 2P9LA 3R3LA 3WT0A 4JAXA 1YITN 3SK3A 3BF3A 3ZETB 1RDUA 2QWRA 5AQWA 4CBWA 4BRIA 3VENA 3ZEUB 3PLAA 3AAPA 4PL8A 3MDQA 3WEEB 3LM2A 3H6EA 4XH4A 5KPTA 1MWKA 5TKWA 5C12A 4PL7A 3ZEUA 5MLCQ 1BWFO 5AQQA 3WEEA 5AQHA 1Z6RA 2YJEA 2AA4A 3JS6A 2QW9A 4YOUA 4OPHA 3R8EA 3VEOA 1YAGA 5H1SQ 4H5WA 4JKAA 1NGGA 3GOIA 3CQYA 3DWLA 4BC4A 2E1YA 1XUPO 2E8AA 4IO8A 3ULEB 3NVKA 2P9IA 4A5BA 4DKWA 3C65A 1NGJA 2NRXA 2P9NB 2NLXA 2IVNA 1NGHA 2V7YA 4YDUA 2OTLN 1GLBG 5E84A 4MLHA 3ULEA 3ZX3A 5F0XA 3A8YA 2QXLA 2RE2A 2P9NA 3SBTA 4RTFD 3SAGA 4YOXA 3CC4N 5C10A 3CJ9A 2A3ZA 2Q97A 1KAYA 2CGLA 1HPMA 4H0VB 3FFKB 3VEXA 3JXUA 4DHYA 2HMPA 3VGLA 3O80A 3E1YA 3IKMA 4H0YB 4ILGB 3HI0A 3NVMA 5AQOA 2HF4A 3OW2M 2VYPA 1ATSA 3G4SN 2A41A 2YHYA 3HRGA 2WUSA 2IVPA 3HM8A 3W0LA 5AQLA 3R9PA 1JCEA 1QHAA 2QWPA 2ZJQL 1YUWA 1NLVA 5LJVA 4GY2B 3TU5A 3CCJN 3L6QA 3O1WA 4WQ4A 4FVUA 3CHWA 3H3NO 2YI1A 1W2BM 1K9MO 3OBYA 2P9KB 1BOTO 1VAZA 5AFUH 3UE5A 4A62A 3GBTA 4MO4A 4JKDA 3HSCA 4JHDB 5BRFA 5AR0A 4WFAL 3WQTA 4F9OA 4U67L 2JWLA 2P9KA 3MCAB 1Q86O 2FF3B 3BP8A 2VWBA 3H1VX 4AF1A 3K9JA 5FPMA 1T6CA 3K9KA 3T69A 3VEZA 3L4QA 5JVHL 2QWQA 3HBTA 4C1NK 5AQYA 1W97L 2D1KA 2F9WA 1O13A 1JJ2M 4JKBA 3QFUA 2RHKA 4B1ZA 5KPRA 5ADXH 1YXQA 4FSVA 3KWIA 2YHXA 4ILHA 4FWPA 1SS6A 2KKZA 3O4WA 1IG8A 1Q18A 3CXCM 4CZMA 3ENOA 3O8MA 1GLCG 4FOEA 5M1OA 5AQJA 4BRQA 4BRAA 1S22A 1P90A 5F1XA 3SAHA 5AQVA 1HKBA 3KWGA 3MWPA 4H5VA 4CZJA 2HOEA 4CZGA 4B1YB 1VQON 2GTDA 4YOYA 5EOYA 3CCQN 5JLHA 1DT9A 1EO1A 4B1UB 4MLEA 2GX9A 4O5FA 4GV9A 5C2DA 4FPBA 1NMDA 4U7BA 4H5NA 4IDHA 1NGIA 2E1ZA 3A5LC 3LDLA 4GV6A 1NGFA 4ISEA 3C7NB 3GE1A 5AFUA 5JLFA 3CCRN 4FWSA 2F9TA 4IOCL 1JCFA 2BH1A 4JKHA 1KAZA 2ZGZA 3M1FA 4QS7A 1LOTB 3HOTA 3LDQA 1C0FA 3LDOA 3VF2A 5BREA 4WFBL 3QMLA 2CH5A 4KBOA 3AGKA 5KQDA 5LJWA 4NB4A 5JICA 1BO5O 3P31A 1BU6O 3CERA 1V4SA 3G71N 3MN5A 2NRRA 3H3OB 3H45C 4O8KA 3UKRB 3SJHA 4MO5A 4EAHD 3F9MA 5C2FA 3F2KA 4YOWA 1VQNN 3U9ZA 3VEWA 4QS8A 3VTIA 3CCUN 3A5MC 3P4IA 3F5TA 4BQLA 2VGNA 3UKRA 3S41A 1Q81O 1WUAA 3T7ZA 3U4LA 5AZJB 3VEVA 4BR4A 1KC8O 1BA0A 1ATRA 1HLUA 3CD6N 3HOSA 4CZIA 3CCVN 4EHUA 3CJ7A 3H1QA 5GADP 2IVOA 5AZJA 1K8AO 3SMSA 3MX2A 2P9IB 3ZYYX 4KH5A 4JKGB 1OKJA 4BR9A 3WXLA 4E1JA 5BR9A 2ZJPL 3AGRA 4GNIA 3MN6A 4RCHA 4IEEA 3TTDA 5GIPA 1QVGM 3E9LA 3AY9A 1P8ZA 2PFUA 1ZBSA 2YX6A 3EKUA 4IZ9A 2NRHA 4JKGA 3CC7N 1HJOA 3VTHA 4IWVA 4KH4A 3ZX2A 4WCEL 5LY3A 4J8FA 3WQUA 3IFRA 2CGKA 5M1KA 2ASOA 5E26A 1GLAG 2HBKA 2PAVA 1KD1O 5FPEA 4YOTA 2ZJRL 4JN4A 1YVNA 2QWNA 3EE8A 3KZBA 4BR5A 2OTJN 2E2NA 2FSKA 4OO1J 3H46O 4FWNA 4BC5A 5FPNA 4A57A 5AQGA 2P9UA 2Q31A 4PKIA 4DB3A 1Q82O 2GELA 4BY9C 1J6ZA 5BRDA 1KAXA 4Z94A 4GV3A 3OBWA 5M1FA 1DGKN 2GUPA 1TYQB 4BRLA 3D7EO 4BRMA 4B1VA 4JD2B 4ISGA 1GLDG 1ZC6A 3O6WA 3QDKA 4CZLA 4CZHA 4BQZA 3DXKB 3D2FB 1TYQA 2GWKA 1Z05A 2EWSA 3BUZB 3O08A 4I6MB 4WQ5A 5AQKA 1GLJO 4JD2A 1HKGA 1HUXA 2BUPA 3FE1A 4CD3A 3I8BA 2QM1A 5BPLA 1QQMA 2PBDA 3MCPA 4JK8A 4FWQA 3DXKA 3DJCA 4A61A 3D2FA 2QA4N 3U9DA 4I6MA 3L4IA 5BRHA 3VESA 4NLBA 1QZ5A 2I7PA 3QICA 2W41A 4PKGA 4BG8A 5DM6L 3VMFB 4BRCA 4H0XB 2FSJA 5ELZA 2VCPA 2D0OA 4K43A 1YF5L 1VQ5N 1NWKA 4UY8O 1S3XA 3NMUA 2WFBA 1VQ7N 2ZF5O 3CCMN 2NRZA 1U6ZA 3FLCO 4PHTX 5AQUA 1T44A 1X3MA 1QQOA 4BRFA 4HWIA 1BUPA 2ASMA 4WYBA 3LDNA 3ZX0A 4BRKA 3PIPL 1SZ2A 1U2VB 4QS9A 3EL2A 4CZFA 4K25A 4FPAA 3M5RA 2WC9A 3LDPA 3D2EB 3MX5A 5M1QA 4R79A 4IXCA 2AP1A 1VQLN 3CJAA 4FL9A 5CR4A 4AM6A 1U2VA 5AQIA 4IO9L 1NBWA 1VQPN 2KHOA 3CC2N 3D2EA 2D4WA 4IOXA 3VPZA 3ATVA 3ENHA 1E4FT 2QWOA 5B8HA 2P9SB 3R6MA 1H1VA 3CJBA 5AQRA 1JCGA 4JEPA 3DLLL 3O9RA 3E9OA 1TUYA 3KHYA 5JVGL 2E2PA 1YJ9N 2FF6A 2P9SA 4K42A 4B1WB 4EHTA 3FZLA 3TSQA 4H5RA 4IEIA 4FWOA 5TKYA 5BN8A 5HOOA 2FLOA 3PIOL 1XC3A 5JMVA 2YCHA 2V7ZA 1WOQA 3FR0A 2Q0RA 2ZWHA 4H03B 1C0GA 5EX5A 1VQ6N 5GAHP 3I56N 4H0TB 3QFPA 4NLCA 2QTDA 4FO0A 3MK6A 3C6HA 3SAFA 1KXPA 1RFQA 2H3GX 5AQZA 4BROA 4YOVA 1SQKA 2I7NA 2Q0UA 2Q2RA 1K8KB 1OVYA 5CHIA 2CGJA 2YJFA 1M90O 2ZGYA 2QWLA 3EN9A 1VQ9N 5ADXA 1R59O 4WQ4C 5KQ8A 1ZXOA 2A5XA 4BVOA 2KLAA 4FWMA 1K8KA 4EFHA 1NGCA 5AQNA 4BRDA 3L0QA 3UB5A 1S72N 3CIPA 1T6DA 3CETA 4JKFA 3A5OC 4PKHA 3QBWA 2E88A 4BR0A 3E9PA 5GINA 1QVFM 2GEMA 3VF4A 3I55N 3CF5L 3LL3A 3EE9A 4M7YA 4BRPA 3ATUA 5AQXA 1V4TA 2A42A 1VQ4N 4OPAA 3P39A 3N4PA 1DKGD 3IDHA 3IMXA 2E2OA 4JNEA 3A5NC 4IOAL 2HBLA 4H5TA 3TSUA 4BREA 3UKUB 4HTLA 3RVCA 4BRHA 1NM1A 4G9ZA 5I9EB 2D0PA 4XH5A 3KVGA 3UKUA 5KPZA 5AZIB 5M1PA 3FZFA 3ZETA 1YJNN 3MN9A 3C6AA 2ITMA 2A6AA 4XH1A 4LC9B 2P9UB 2FXUA 5AZIA 4BRNA 3KK7A 2QWMA 4ISFA 1Q7YO 3O9UA 3VERA 4IJNA 4B9QA 3WXIA 3EKSA 5EY4A 2GWJA 4A2BA 4IJAA 4JKCA 2HBMA 4Y0WA 3AARA 5M1NA 1E4GT 5F2RA 2J4RA 4A2AA 3CPWM 5AQMA 3OHRA 1MWMA 5C0YA 1QQNA 4JK7A 4XEIA 4BR2A 4EIAA 3GDQA 1X3NA 3MN7A 3DAWA 4YORA 2P9PB 2VGMA 3QBXA 1QZ6A 5CE3A 4B1XB 5FPDA 3W3DA 1TUUA 3FGUA 3HZ6A 3D6RA 3CQXA 3SBGA 1BA1A 3CJ1A 2P9PA 2Q36A 2NZTA 3GL1A 3WXJA 1IJJA 1Y64A 4FWLA 5AQPA 5GAGP 1NJIO 1YJWN 4FWRA 2Q1NA 3VETA 4C23A 4M7XA 1BG3A 3CCEN 4A59A 5AQFA 3CMAN 2ASPA 1T3VA 2NNWA 1N8RO 4CZKA 3I33A 4AM7A 3CCSN 4JKEA 4GVEA 3VGMA 2UYTA 1SAZA 3Q7BA 3WXMB 2DPNA 4CBUA 5BN9A 3IUCA 2JWKA 3A0IX 3FZKA 3SLCA 4C1NI 2NRTA 5BPNA 4IFEA 1YHQN 3CMEN 4BG9A 3O5BA 3J8AA 2W40A 2YHWA 2QEXN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BC3 A;  1MA9 B;  3RSE B;  1GLE G;  3M6G A;  3G25 A;  2A40 A;  3FZM A;  4YDU C;  3WUH A;  4BGA A;  1NGB A;  1GLF O;  3BF1 A;  3RSE A;  3TPQ A;  3M3Z A;  4JHD A;  3VF6 A;  4CD1 A;  5AQT A;  4NO7 A;  3VGK A;  1MDU B;  3EO3 A;  3ID8 A;  3HTV A;  3MMV A;  4RWT A;  2E2Q A;  1EQY A;  5EXW A;  3BEX A;  2HF3 A;  1RDW X;  4BRG A;  1NGE A;  1NGA A;  2V51 B;  4CJ7 A;  3FZH A;  1G99 A;  1RGI A;  3EZW A;  4M63 C;  2V52 B;  3LM9 A;  3U8X A;  2FSN A;  1HKC A;  4WQ5 C;  3O1B A;  1LCU A;  3GG4 A;  3B8A X;  3C0B A;  1X9J A;  4BC2 A;  2CH6 A;  4BGB A;  4BVP A;  2IIR A;  3AAQ A;  4FOI A;  5BPM A;  2BTF A;  3VOV A;  1D4X A;  3CI5 A;  4CZE A;  1NGD A;  4H0O A;  2E20 A;  4DCH A;  1DEJ A;  1HX1 A;  1CZA N;  1XQS C;  5EVZ A;  4BR7 A;  4CI6 A;  3DXM B;  4H0P A;  3C7N A;  2OAN A;  1ESV A;  5AQS A;  2P9L B;  3DXM A;  4FWK A;  3SMP A;  1BDG A;  4L3Q A;  3WXK A;  1ATN A;  1GLL O;  3QB0 A;  4CBX A;  4K41 A;  4DQ8 A;  3VEY A;  3CJC A;  2P9L A;  3WT0 A;  4JAX A;  3SK3 A;  3BF3 A;  3ZET B;  2QWR A;  5AQW A;  4CBW A;  4BRI A;  3VEN A;  3ZEU B;  3AAP A;  4PL8 A;  3MDQ A;  3WEE B;  3LM2 A;  3H6E A;  4XH4 A;  5KPT A;  1MWK A;  4PL7 A;  3ZEU A;  1BWF O;  5AQQ A;  3WEE A;  5AQH A;  1Z6R A;  2YJE A;  2AA4 A;  3JS6 A;  2QW9 A;  3R8E A;  3VEO A;  1YAG A;  4H5W A;  1NGG A;  3GOI A;  3CQY A;  3DWL A;  4BC4 A;  2E1Y A;  1XUP O;  2E8A A;  4IO8 A;  3ULE B;  2P9I A;  1NGJ A;  2P9N B;  2NLX A;  2IVN A;  1NGH A;  2V7Y A;  4YDU A;  1GLB G;  5E84 A;  4MLH A;  3ULE A;  3ZX3 A;  5F0X A;  3A8Y A;  2QXL A;  2P9N A;  4RTF D;  3CJ9 A;  2A3Z A;  2Q97 A;  1KAY A;  2CGL A;  1HPM A;  4H0V B;  3FFK B;  3VEX A;  3JXU A;  4DHY A;  2HMP A;  3VGL A;  3O80 A;  4H0Y B;  3HI0 A;  5AQO A;  2HF4 A;  2VYP A;  1ATS A;  2A41 A;  2YHY A;  2WUS A;  2IVP A;  3HM8 A;  3W0L A;  5AQL A;  3R9P A;  1JCE A;  1QHA A;  2QWP A;  1YUW A;  1NLV A;  5LJV A;  4GY2 B;  3TU5 A;  3L6Q A;  3O1W A;  4WQ4 A;  3CHW A;  3H3N O;  2YI1 A;  4A62 A;  2P9K B;  1BOT O;  3UE5 A;  5AFU H;  3GBT A;  4MO4 A;  4JHD B;  3HSC A;  5BRF A;  5AR0 A;  3WQT A;  4F9O A;  2P9K A;  2FF3 B;  3BP8 A;  2VWB A;  3H1V X;  5FPM A;  1T6C A;  3VEZ A;  2QWQ A;  3HBT A;  5AQY A;  2F9W A;  2D1K A;  3QFU A;  4B1Z A;  5KPR A;  5ADX H;  1YXQ A;  4FSV A;  2YHX A;  4FWP A;  3O4W A;  1IG8 A;  1Q18 A;  4CZM A;  3ENO A;  3O8M A;  1GLC G;  4FOE A;  5AQJ A;  4BRQ A;  4BRA A;  1S22 A;  5F1X A;  5AQV A;  1HKB A;  4H5V A;  4CZJ A;  2HOE A;  4CZG A;  4B1Y B;  2GTD A;  5EOY A;  5JLH A;  4B1U B;  4MLE A;  4O5F A;  4FPB A;  1NMD A;  4H5N A;  1NGI A;  2E1Z A;  3A5L C;  3LDL A;  1NGF A;  4ISE A;  3C7N B;  3GE1 A;  5AFU A;  5JLF A;  4FWS A;  2F9T A;  1JCF A;  1KAZ A;  2ZGZ A;  3M1F A;  4QS7 A;  1LOT B;  3LDQ A;  1C0F A;  3LDO A;  3VF2 A;  5BRE A;  3QML A;  2CH5 A;  4KBO A;  5KQD A;  5LJW A;  4NB4 A;  5JIC A;  1BO5 O;  1BU6 O;  3CER A;  1V4S A;  3MN5 A;  3H45 C;  3H3O B;  4O8K A;  3UKR B;  3SJH A;  4MO5 A;  4EAH D;  3F9M A;  3U9Z A;  3VEW A;  4QS8 A;  3A5M C;  3P4I A;  4BQL A;  3UKR A;  3S41 A;  1WUA A;  3U4L A;  5AZJ B;  3VEV A;  4BR4 A;  1BA0 A;  1ATR A;  1HLU A;  4CZI A;  4EHU A;  3CJ7 A;  3H1Q A;  2IVO A;  5AZJ A;  3SMS A;  4E1J A;  2P9I B;  4BR9 A;  5BR9 A;  1OKJ A;  3WXL A;  4GNI A;  3MN6 A;  4RCH A;  3AY9 A;  1P8Z A;  1ZBS A;  3EKU A;  4IZ9 A;  2NRH A;  1HJO A;  4IWV A;  3ZX2 A;  5LY3 A;  4J8F A;  3WQU A;  3IFR A;  2CGK A;  2ASO A;  5E26 A;  1GLA G;  2PAV A;  5FPE A;  4JN4 A;  1YVN A;  2QWN A;  3KZB A;  4BR5 A;  2E2N A;  2FSK A;  3H46 O;  4FWN A;  4BC5 A;  5FPN A;  5AQG A;  2P9U A;  2Q31 A;  4PKI A;  4DB3 A;  2GEL A;  1J6Z A;  5BRD A;  1KAX A;  4Z94 A;  1DGK N;  2GUP A;  1TYQ B;  4BRL A;  3D7E O;  4BRM A;  4B1V A;  4JD2 B;  4ISG A;  1GLD G;  1ZC6 A;  3O6W A;  3QDK A;  4CZL A;  4CZH A;  4BQZ A;  3DXK B;  3D2F B;  1TYQ A;  2GWK A;  1Z05 A;  2EWS A;  3BUZ B;  3O08 A;  4I6M B;  4WQ5 A;  5AQK A;  1GLJ O;  4JD2 A;  1HKG A;  1HUX A;  2BUP A;  3FE1 A;  4CD3 A;  3I8B A;  2QM1 A;  5BPL A;  1QQM A;  2PBD A;  3MCP A;  4A61 A;  4FWQ A;  3DXK A;  3DJC A;  3D2F A;  3U9D A;  4I6M A;  3L4I A;  5BRH A;  3VES A;  1QZ5 A;  2I7P A;  3QIC A;  2W41 A;  4PKG A;  4BG8 A;  4BRC A;  4H0X B;  2FSJ A;  5ELZ A;  2VCP A;  2D0O A;  4K43 A;  1NWK A;  1S3X A;  2ZF5 O;  1U6Z A;  3FLC O;  5AQU A;  1T44 A;  1X3M A;  1QQO A;  4BRF A;  4HWI A;  1BUP A;  2ASM A;  4WYB A;  3LDN A;  3ZX0 A;  4BRK A;  1SZ2 A;  1U2V B;  4QS9 A;  3EL2 A;  4CZF A;  4K25 A;  4FPA A;  3LDP A;  3D2E B;  4IXC A;  2AP1 A;  3CJA A;  4FL9 A;  4AM6 A;  1U2V A;  5AQI A;  1NBW A;  2KHO A;  3D2E A;  2D4W A;  3VPZ A;  3ATV A;  3ENH A;  1E4F T;  2QWO A;  5B8H A;  2P9S B;  3R6M A;  1H1V A;  3CJB A;  5AQR A;  1JCG A;  1TUY A;  3KHY A;  2E2P A;  2FF6 A;  2P9S A;  4K42 A;  4B1W B;  4EHT A;  3FZL A;  4H5R A;  4FWO A;  5TKY A;  5BN8 A;  2FLO A;  1XC3 A;  5JMV A;  2YCH A;  2V7Z A;  1WOQ A;  3FR0 A;  2Q0R A;  2ZWH A;  4H03 B;  1C0G A;  5EX5 A;  4H0T B;  3QFP A;  4FO0 A;  3MK6 A;  1KXP A;  1RFQ A;  2H3G X;  5AQZ A;  4BRO A;  1SQK A;  2I7N A;  2Q0U A;  2Q2R A;  1K8K B;  2CGJ A;  2YJF A;  2ZGY A;  2QWL A;  3EN9 A;  5ADX A;  1R59 O;  4WQ4 C;  5KQ8 A;  1ZXO A;  2A5X A;  4BVO A;  4FWM A;  1K8K A;  4EFH A;  1NGC A;  5AQN A;  4BRD A;  3L0Q A;  3UB5 A;  3CIP A;  1T6D A;  3CET A;  3A5O C;  4PKH A;  3QBW A;  2E88 A;  4BR0 A;  2GEM A;  3VF4 A;  3LL3 A;  4M7Y A;  4BRP A;  3ATU A;  5AQX A;  1V4T A;  2A42 A;  1DKG D;  3IDH A;  3IMX A;  2E2O A;  4JNE A;  3A5N C;  4H5T A;  4BRE A;  3UKU B;  4HTL A;  4BRH A;  1NM1 A;  5I9E B;  2D0P A;  4XH5 A;  3KVG A;  3UKU A;  5KPZ A;  5AZI B;  3FZF A;  3ZET A;  3MN9 A;  2ITM A;  2A6A A;  4XH1 A;  4LC9 B;  2P9U B;  2FXU A;  5AZI A;  4BRN A;  2QWM A;  4ISF A;  3VER A;  4IJN A;  4B9Q A;  3WXI A;  3EKS A;  5EY4 A;  2GWJ A;  4A2B A;  4IJA A;  4Y0W A;  3AAR A;  1E4G T;  5F2R A;  2J4R A;  4A2A A;  5AQM A;  3OHR A;  1MWM A;  1QQN A;  4XEI A;  4BR2 A;  4EIA A;  3GDQ A;  1X3N A;  3MN7 A;  3DAW A;  2P9P B;  3QBX A;  1QZ6 A;  5CE3 A;  4B1X B;  5FPD A;  3W3D A;  1TUU A;  3FGU A;  3HZ6 A;  3CQX A;  1BA1 A;  3CJ1 A;  2P9P A;  2Q36 A;  2NZT A;  3GL1 A;  3WXJ A;  1IJJ A;  1Y64 A;  4FWL A;  5AQP A;  4FWR A;  2Q1N A;  3VET A;  4C23 A;  4M7X A;  1BG3 A;  5AQF A;  2ASP A;  4CZK A;  3I33 A;  4AM7 A;  3VGM A;  2UYT A;  1SAZ A;  2DPN A;  4CBU A;  5BN9 A;  3IUC A;  3A0I X;  3FZK A;  3SLC A;  5BPN A;  4BG9 A;  3O5B A;  3J8A A;  2W40 A;  2YHW A; 
#chains in the Genus database with same CATH topology
 3ENB A;  1GLE G;  1CZ9 A;  2P51 A;  1VQ8 N;  5A2Q O;  3TTF A;  3BF1 A;  3O3F A;  3TPQ A;  3M3Z A;  5HRS A;  2QI2 A;  3VF6 A;  1KVC A;  3CPE A;  5FRM A;  3OYI A;  3O9S A;  4JK9 A;  1TL3 A;  3EO3 A;  3HTV A;  4B9S A;  3O3H A;  3MMV A;  1K6Y A;  4RWT A;  4BWM A;  5EXW A;  3OYA A;  2HF3 A;  4BRG A;  3LAK A;  1VSI A;  1NK7 A;  1NGA A;  3K59 A;  3LAL A;  1VK0 A;  4MDA A;  4OX9 K;  4LF7 K;  3SI6 A;  4WF9 L;  1HKC A;  4WQ5 C;  4B8C A;  3OYB A;  3G6E N;  2VWJ A;  1LCU A;  5J2N A;  1SL1 A;  4BVP A;  1YIJ N;  3OA9 A;  4FOI A;  3VOV A;  1D9D A;  1D4X A;  3CI5 A;  5I3U A;  1NGD A;  1CXU A;  1XQS C;  5E41 A;  3DXM B;  1N33 K;  3IAY A;  1YI2 N;  4LH5 A;  4FJK A;  3T1H K;  4DSJ A;  3L3U A;  1KTQ A;  1DTT A;  3J7Z O;  3QB0 A;  4CEO A;  2UUB K;  3CJC A;  2P9L A;  3SK3 A;  1S6Q A;  1HQU A;  3OY9 A;  1KRP A;  3PLA A;  3AAP A;  3ITH A;  4CFA A;  2XY8 A;  5TKW A;  3K5M A;  3WEE A;  4OKE A;  5AQH A;  1S1W A;  3VEO A;  4OPH A;  1YAG A;  1RTJ A;  2X74 A;  1NGG A;  3GOI A;  1VSD A;  3DWL A;  2JLE A;  3AO1 A;  3NVK A;  3C65 A;  4J2D A;  2P9N B;  4IDK A;  4M3X A;  3ULE A;  3NDK A;  3K5O A;  2QXL A;  3SBT A;  3NGI A;  3CJ9 A;  3WNE A;  4KAZ A;  4DV4 K;  2A3Z A;  2Q97 A;  2CGL A;  3ISN C;  4I2Q A;  3JXU A;  4F2S A;  2R7Y A;  2HMP A;  3VGL A;  3OJS A;  4JYA K;  3IKM A;  3VQ7 A;  1BI4 A;  1Q9X A;  3NVM A;  1R0A A;  1MU2 A;  2VYP A;  3UIQ A;  4M3Z A;  2YHY A;  1OH7 A;  4ELT A;  1GOB A;  3R9P A;  3QIN A;  1YUW A;  1NLV A;  4CES A;  1N5Y A;  3M8P A;  3L6Q A;  1WAJ A;  1JL1 A;  3CHW A;  3H3N O;  4DR7 K;  4A62 A;  1T8E A;  1BCO A;  4JKD A;  4DSF A;  1J5O A;  4DS4 A;  3WQT A;  3HPH A;  3CQ8 A;  4TSX A;  1Q86 O;  1JLE A;  3P83 D;  4RW8 A;  5FPM A;  3T69 A;  2PY5 A;  3VEZ A;  3L4Q A;  3HBT A;  5AQY A;  2F9W A;  5AJ3 K;  4ELU A;  4FCY A;  1EWR A;  4DR5 K;  4M3W A;  1YVU A;  3KWI A;  3NH2 A;  2W6K A;  2LSN A;  3NFA A;  3VN5 A;  4B08 A;  2KKZ A;  4ELV A;  3CXC M;  3V9W A;  3ZSO A;  4CZM A;  1GLC G;  1BIU A;  4BRQ A;  3SAH A;  1IKX A;  4KHQ A;  3L3V A;  3P1G A;  1TK5 A;  4CZG A;  4YOY A;  4W5Q A;  4MFB A;  2HVH A;  4O55 A;  4DG1 A;  4FLU A;  4BAC A;  4DTU A;  4KHN A;  4FK2 A;  4GV9 A;  5C2D A;  4FPB A;  5K14 A;  4F3T A;  1N32 K;  1C1B A;  1NGF A;  5AFU A;  2E5L K;  3CCR N;  2VG6 A;  4FJG A;  2F9T A;  3LAN A;  3VQE A;  4QS7 A;  5BRE A;  5SZT A;  3PSI A;  2B4J A;  1VHX A;  2DFH A;  1BO5 O;  3G71 N;  2P1J A;  1S6P A;  2HHW A;  2NRR A;  3H3O B;  4BDY A;  3UKR B;  4YOW A;  3F2K A;  1VQN N;  3LP2 A;  3VEW A;  4QS8 A;  2XRI A;  3A5M C;  1A5W A;  3F5T A;  4CGG A;  3S41 A;  1WUA A;  4CER A;  2XO7 A;  2HHV A;  5AZJ B;  1XC9 A;  1KC8 O;  1HLU A;  5GAD P;  1XHX A;  1CXQ A;  3MX2 A;  3SMS A;  4E1J A;  4KH5 A;  4DFP A;  3AGR A;  3VQ4 A;  4EZ6 A;  3MN6 A;  4LF9 K;  3E9L A;  3AY9 A;  2YX6 A;  1KVB A;  4JKG A;  4KHS A;  1S1X A;  1HJO A;  4KH4 A;  3ZX2 A;  4PWD A;  3VQC A;  4J8F A;  3IFR A;  1GLA G;  2HBK A;  2WTU A;  5FPE A;  4AHU A;  3DLH A;  2E2N A;  4OO1 J;  2ZE2 A;  1BI4 B;  4BE2 A;  2B5J A;  3IRX A;  4FWN A;  1WSE A;  4E7K A;  4DB3 A;  3MED A;  1X1P A;  4Z94 A;  3OBW A;  4DLE A;  5M1F A;  3TAR A;  1OH6 A;  4BRL A;  3D7E O;  2BE2 A;  1ZC6 A;  3VQ6 A;  4CE9 A;  4CCH A;  1Z05 A;  4KTZ A;  4CGF A;  2BUP A;  4CD3 A;  2QM1 A;  1B92 A;  2QA4 N;  4DQP A;  3D2F A;  1QZ5 A;  1TKD A;  4BG8 A;  4FK0 A;  3NGZ A;  4H0X B;  1OH5 A;  4K43 A;  2D0O A;  3RMC A;  3NMU A;  2HNY A;  2KW4 A;  3FLC O;  1QQO A;  4DSE A;  4HWI A;  2IS3 A;  1BUP A;  4BRK A;  3MEG A;  4CZF A;  4K25 A;  3V81 A;  3LDP A;  3KKS A;  4R79 A;  2WON A;  1D9F A;  1JLC A;  2OPS A;  4HTU A;  3AO3 A;  5CR4 A;  4IO9 L;  3CC2 N;  1EP4 A;  4KB0 A;  3O3G A;  3ENH A;  2QWO A;  3V9S A;  3CJB A;  3KHY A;  4DFK A;  5J2Q A;  3O4N A;  2P9S A;  3SPZ A;  1IV0 A;  2HNZ A;  2X6S A;  4H5R A;  3T3F A;  4FWO A;  1C0T A;  1HYS A;  4CHP A;  4E0D A;  3PIO L;  2A1R A;  1BQM A;  1RT6 A;  1WOQ A;  1DTQ A;  3M8Q A;  2IDO A;  3PO4 A;  1S5J A;  2ZWH A;  4H03 B;  1C0G A;  3QFP A;  4O44 A;  2YHA A;  2QTD A;  5C42 A;  1KXP A;  1RFQ A;  2H3G X;  4CJL A;  4KV8 A;  2Z1J A;  5CYM A;  2ZGY A;  3EN9 A;  3OYC A;  1R59 O;  4WQ4 C;  5KQ8 A;  1LWE A;  4FWM A;  1K8K A;  4C8K A;  3KK1 A;  4BRD A;  5AQN A;  3OJU A;  2XY7 A;  2O8F B;  1T6D A;  3CET A;  1T7P A;  3A5O C;  3QBW A;  5GIN A;  1ZBL A;  3ULD A;  3LL3 A;  1JLF A;  2A42 A;  1VQ4 N;  4E7I A;  4CGJ A;  1C1C A;  3L2W A;  3A5N C;  3T1A A;  2BDP A;  3ZT0 A;  3RVC A;  5IWA K;  1NM1 A;  2P5G A;  4CGH A;  3J7Y P;  3UKU A;  5AZI B;  1A5X A;  3ZET A;  4OVL A;  3DI6 A;  1YJN N;  4CJS A;  1LWF A;  4CHO A;  4PY5 A;  3QNN A;  5KRS A;  1RT4 A;  3ZSR A;  4Z4H A;  2X78 A;  3AVN A;  3SV3 A;  3EKS A;  2UUC K;  2B6A A;  2XY5 A;  3LP0 A;  1NKE A;  1VSM A;  1BIZ A;  1NMN A;  2RF2 A;  1SV5 A;  1CLQ A;  1E4G T;  5F2R A;  2OYQ A;  4W5R A;  3GDQ A;  4DQQ A;  2P9P B;  3QBX A;  1Z26 A;  2GUI A;  2I5J A;  1JKH A;  3BZK A;  3CJ1 A;  4DQS A;  4C8M A;  1W9H A;  4FWR A;  4KI4 A;  1NKB A;  4M7X A;  1IBM K;  4RW4 A;  5AQF A;  2ASP A;  1T3V A;  4JRQ A;  3AV9 A;  2DPN A;  3NHG A;  2GV9 A;  3A0I X;  1YHQ N;  5BPN A;  3CME N;  4BG9 A;  4X62 K;  3KJV A;  4RW6 A;  4KHP K;  2QEX N;  4HUE A;  4BC3 A;  1MA9 B;  4M45 A;  2O8C B;  3G25 A;  3TR8 A;  3OYL A;  5HL7 L;  3V1R A;  3NE6 A;  1NGB A;  4CIE A;  1J54 A;  4B9L A;  4W5N A;  2DFF A;  1IKW A;  3J80 O;  4EP5 A;  3NCI A;  1M1K O;  1LAW A;  2G8U A;  1NJY A;  3ZT1 A;  4DQI A;  1OH8 A;  3B6O A;  4V19 S;  4I7F A;  3FZH A;  2F96 A;  4MDB A;  1YT3 A;  1G99 A;  2KTQ A;  1NK6 A;  2FBY A;  1IBK K;  4CK3 A;  2AJQ A;  3LM9 A;  3DOL A;  3U8X A;  3R1X A;  4CW7 B;  4FXD A;  3ZSV A;  4BC2 A;  4BGB A;  1WBD A;  3LPT A;  3AAQ A;  5BPM A;  3TTC A;  4H0O A;  4CJW A;  4O5B A;  4B3O A;  1DEJ A;  2F7T A;  4BR7 A;  4Q5V A;  4H0P A;  4DTR A;  5KI6 A;  3C7N A;  4FYD A;  3TSP A;  2OZM A;  3CCL N;  1ESV A;  3AVB A;  4FVM A;  3DXM A;  5AQS A;  1HRH A;  3RMA A;  1K73 O;  4N56 A;  4L3Q A;  3WXK A;  1ATN A;  4OGC A;  3O9Q A;  3Q7C A;  1YIT N;  3WT0 A;  3ZET B;  1RDU A;  2QWR A;  4BRI A;  2JGU A;  4CFD A;  3ZEU B;  4FJ7 A;  4C8L A;  5IT9 O;  4DTN A;  4XH4 A;  1VRU A;  5AQQ A;  1X9W A;  2YJE A;  4YOU A;  2QW9 A;  3SPY A;  3OTO K;  1RBU A;  4OPJ A;  1QSL A;  1XUP O;  4IO8 A;  3ZT2 A;  4A5B A;  2IVN A;  1NGH A;  2OTL N;  1GLB G;  5E84 A;  1KFS A;  2Y1J A;  1JXE A;  3ZX3 A;  4HCC A;  2GBZ A;  3QIO A;  2P9N A;  1BGX T;  4B9M A;  3OYF A;  5C10 A;  1EX4 A;  1KAY A;  3OVN A;  4H0V B;  5SWM A;  4J2E A;  4DHY A;  3ZCM A;  4DV5 K;  1RTD A;  4H0Y B;  1F21 A;  4ILG B;  5AQO A;  3PSF A;  3QNO A;  4CF9 A;  1FXX A;  3PO5 A;  4LFA K;  1RT1 A;  3W0L A;  5AQL A;  4AIL C;  2QWP A;  4CF2 A;  1NJW A;  3AO2 A;  1REV A;  3CCJ N;  3O1W A;  2HHU A;  3T19 A;  2YI1 A;  2P9K B;  1BOT O;  5AFU H;  4B3S K;  1WLJ A;  5AR0 A;  2E6L A;  4F9O A;  4DUY K;  4NYN A;  4U67 L;  2JWL A;  4C8O A;  3OYE A;  2FF3 B;  1ITG A;  3H1V X;  3HP6 A;  3K9K A;  3THW B;  1W97 L;  1TAU A;  3CG7 A;  1JJ2 M;  3OS2 A;  1LW0 A;  3O4W A;  1IG8 A;  5EU7 A;  4AHT A;  4QCL A;  5DMR A;  1BL3 A;  5M1O A;  4JI0 K;  1S22 A;  1P90 A;  3MWP A;  4CEE A;  4H5V A;  2HOE A;  1N6Q A;  1DLO A;  3SYZ A;  5C25 A;  4KHY A;  1EO1 A;  3NF6 A;  4B1U B;  1IH7 A;  2HMI A;  2QXF A;  3SQ1 A;  1NMD A;  4YY3 K;  1U45 A;  2O8B A;  2FBT A;  3A5L C;  3LZJ A;  3AVI A;  4QOZ B;  3C7N B;  5JLF A;  1TK8 A;  3M1F A;  1C1A A;  4B9N A;  3TAN A;  1KLM A;  4WFB L;  3QML A;  4KBO A;  3ASM A;  3AGK A;  3V1Q A;  5JIC A;  3P31 A;  1BU6 O;  5T7B A;  1V4S A;  3H45 C;  4O8K A;  1WNS A;  4EAH D;  3F9M A;  5C2F A;  3U9Z A;  1HMV A;  4NCG A;  3MEE A;  4YHH K;  4K8X A;  2VGN A;  3THY B;  3UKR A;  1Q81 O;  1XWL A;  4CFC A;  3T7Z A;  3U4L A;  3ZSY A;  3VEV A;  1QSY A;  4DR3 K;  2P5O A;  3HOS A;  3RRG A;  3IS9 A;  3OYN A;  2IVO A;  5AZJ A;  1D5A A;  1VSL A;  1HNI A;  5GIP A;  5CZ1 A;  2NRH A;  5HRO A;  4QAG A;  2UUA K;  1TGO A;  1TV6 A;  1KD1 O;  4JI7 K;  2ZJR L;  4GKJ K;  4BR5 A;  3EE8 A;  2OTJ N;  4L8R B;  2FSK A;  4IG3 A;  1QE1 A;  3H46 O;  4B9U A;  3EEQ A;  4A57 A;  1UA0 A;  1Q82 O;  4LF8 K;  4HUG A;  1RBT A;  1KAX A;  3NF8 A;  4DR1 K;  2IOC A;  4KHW A;  1TYQ B;  1GOC A;  1GLD G;  2VG5 A;  3QDK A;  2Z1I A;  4DV6 K;  3DXK B;  3O08 A;  1JLA A;  4LFC K;  4WQ5 A;  1GLJ O;  1WAF A;  1HKG A;  2E4L A;  3FE1 A;  5KGX A;  1RDB A;  1QQM A;  4LF4 K;  2PBD A;  4JK8 A;  4FWQ A;  4CF0 A;  4CGI A;  2EHG A;  3L4I A;  5BRH A;  3QLH A;  4NLB A;  3KLH A;  1JL2 A;  1JLB A;  2W41 A;  3QES A;  4B9V A;  5DM6 L;  5LL6 Z;  4CJP A;  2VCP A;  3THX A;  1A5V A;  3RMD A;  2G8V A;  4CK1 A;  1VQ7 N;  4JI3 K;  2NRZ A;  5AQU A;  3U6F A;  3EZ5 A;  1RBV A;  4DUZ K;  1RDA A;  4WYB A;  3EY1 A;  5HP1 A;  4QS9 A;  2OPP A;  3TAE A;  3M5R A;  2WC9 A;  3D2E B;  1VQL N;  3CJA A;  4FL9 A;  3ZSX A;  5AQI A;  3VPZ A;  5B8H A;  1RIL A;  3G10 A;  1H1V A;  2G8H A;  4JEP A;  2FBX A;  2VQF K;  3D45 A;  2E2P A;  3HVT A;  1NG9 A;  2O8B B;  4CF1 A;  3V6D A;  2D0A A;  4B1W B;  5HRN A;  3FZL A;  4CJE A;  3TSQ A;  4JLH A;  3TAG A;  5TKY A;  5BN8 A;  1XC3 A;  5JMV A;  4FW2 A;  1QSS A;  3ZSW A;  4IBN A;  4E7J A;  1NK4 A;  2Q0R A;  3HO1 A;  1VQ6 N;  5GAH P;  4CJ5 A;  3I56 N;  1Q8I A;  4FJ8 A;  4CEB A;  3MK6 A;  1KFD A;  3SAF A;  4UQG A;  2I7N A;  4I9Q A;  2Q2R A;  4Y1D A;  4GMJ B;  3HPO A;  1OVY A;  1M90 O;  1NK9 A;  2QWL A;  1NKC A;  3DLK A;  2A5X A;  4BVO A;  1NGC A;  1S72 N;  4DFJ A;  3CIP A;  4CJU A;  4BR0 A;  2E88 A;  3E9P A;  4CJK A;  3SQ2 A;  2O8F A;  4CJT A;  4BRP A;  3ATU A;  1IO2 A;  1V4T A;  3KKR A;  4JI1 K;  4O4G A;  4FJJ A;  2O4I A;  3MXJ A;  4OPA A;  3N4P A;  3RMB A;  3HST B;  3IMX A;  4DR6 K;  4HTL A;  3LAM A;  1Q9Y A;  3M8S A;  3JYT A;  4PA1 A;  3KVG A;  1EWQ A;  2PYL A;  1VSH A;  3FZF A;  1VSJ A;  4FM0 A;  2A6A A;  3B6P A;  4IKF A;  3HXM A;  5AZI A;  3TAQ A;  3OYH A;  3JAM O;  4EZ9 A;  4IJN A;  3WXI A;  4CEC A;  2GWJ A;  4LF6 K;  4N41 A;  4IJA A;  3AAR A;  2Z1H A;  4A2A A;  3CPW M;  5AQM A;  5C0Y A;  4BR2 A;  3DMJ A;  1NJZ A;  4YOR A;  5FPD A;  4B1X B;  4KO0 A;  2X6N A;  1TUU A;  1RT3 A;  4DTO A;  3CQX A;  1BA1 A;  3THX B;  2P9P A;  2NZT A;  3GL1 A;  1Y64 A;  4CFB A;  1NJI O;  2Q1N A;  1S1U A;  3CMA N;  2NNW A;  1N8R O;  3O4Q A;  2IC3 A;  3I33 A;  4JKE A;  3VGM A;  3WXM B;  1SL0 A;  1ZBI A;  4CBU A;  5BN9 A;  4C1N I;  3FZK A;  3OYJ A;  3J8A A;  2W40 A;  2YHW A;  2FBV A;  2VWK A;  3WNG A;  1QHT A;  3QET A;  1VQK N;  3RSE B;  4F8R A;  3KTQ A;  2HW3 A;  2DFE A;  2A40 A;  3DYA A;  4DSL A;  1Q7Y O;  4A5A A;  1GLF O;  4KH6 A;  2O8C A;  4CJ3 A;  5KTQ A;  4CD1 A;  3JSM A;  3VGK A;  1UOC A;  3A2F A;  4DV2 K;  1EQY A;  3MXI A;  2HST A;  3NF7 A;  4M3R A;  4X64 K;  4HUF A;  1U48 A;  1KQS M;  4KTW A;  1B9D A;  2V51 B;  4LSL A;  4CJ7 A;  1RGI A;  3EZW A;  4DTP A;  2V52 B;  3AO4 A;  1VRT A;  4W5O A;  3O1B A;  1FW6 A;  5J2P A;  1VQM N;  4DR4 K;  3N4Q A;  3B8A X;  4NXM K;  1X9J A;  2IIR A;  1L5U A;  3QEV A;  2ATQ A;  2BTF A;  4NXN K;  4CZE A;  4ILJ A;  2E20 A;  3DLB A;  5EVZ A;  1CZA N;  1ASV A;  4CI6 A;  4IFY A;  3I0R A;  3MAQ A;  2OAN A;  5C15 A;  3SMP A;  4FWK A;  1BDG A;  1EKE A;  3QEI A;  3C6T A;  1GLL O;  2ITG A;  4CBX A;  3QIP A;  4F4K A;  3L2Q A;  3R3L A;  4JAX A;  1JLG A;  3VEN A;  1IG9 A;  5KRT A;  1KLN A;  3KK3 A;  3TAB A;  3MDQ A;  4K8Z A;  1ASW A;  5C12 A;  3ZEU A;  2ZD1 A;  3V1O A;  5MLC Q;  2G8F A;  4N5S A;  2Y1I A;  3S3O A;  3JS6 A;  3VQ8 A;  4FJN A;  3LZI A;  5H1S Q;  4JKA A;  3ZT3 A;  3CM6 A;  2E1Y A;  4DKW A;  2NRX A;  5CHI A;  3PX0 A;  2NLX A;  4YFU A;  1S9E A;  5F0X A;  3A8Y A;  4BDZ A;  3SAG A;  3CC4 N;  2OA8 A;  4LH4 A;  1D8Y A;  1NOY A;  4BDP A;  4GKK K;  2HHS A;  1HNZ K;  2YKM A;  3OS0 A;  3VEX A;  4JI5 K;  1EXQ A;  1I39 A;  3O80 A;  1RBS A;  4GVM A;  4FZZ A;  2HF4 A;  1C0U A;  3G4S N;  3K0S A;  1VSK A;  3HRG A;  1BCM A;  3HM8 A;  1I94 K;  3SUP A;  2ZJQ L;  1UAX A;  1WSI A;  4WQ4 A;  1RDC A;  3OBY A;  3UE5 A;  1QTM A;  3GBT A;  2Q3S A;  1J53 A;  3HSC A;  5BRF A;  1IKV A;  4KB1 A;  2P9K A;  3MCA B;  3BP8 A;  3K9J A;  5JVH L;  4C1N K;  2D1K A;  1O13 A;  4JKB A;  4N47 A;  3HL8 A;  1HPZ A;  2XHB A;  3THW A;  3QEW A;  5D3G A;  2YHX A;  4B8A B;  3AVC A;  4E89 A;  4J2A A;  4FWP A;  4LY7 A;  3BY5 A;  5I42 A;  1Y97 A;  3DRR A;  4FJI A;  5AQJ A;  4BRA A;  1HKB A;  3KWG A;  4AQY K;  4CZJ A;  1NK0 A;  4B1Y B;  3SNN A;  3TAP A;  2GTD A;  3L8B A;  4OLA A;  5EOY A;  3CCQ N;  3KLF A;  5JLH A;  1DT9 A;  1Z25 A;  2GX9 A;  3C94 A;  3AVA A;  2HB5 A;  4U7B A;  3D0P A;  4IDH A;  1NGI A;  3LDL A;  4GV6 A;  4ISE A;  4LF5 K;  2OZS A;  3VQQ A;  4DV7 K;  4JKH A;  2RKI A;  1VSE A;  1KAZ A;  3VA0 A;  1SKS A;  4DV3 K;  4YNQ A;  3VF2 A;  3PX6 A;  1FJG K;  5LJW A;  4NB4 A;  1XHZ A;  3CER A;  3MN5 A;  4J2B A;  4MO5 A;  2UXD K;  4Z4I A;  3QEX A;  4Z4G A;  3CCU N;  3P4I A;  3OYK A;  4BQL A;  4FJH A;  4M3Y A;  3V4I A;  4CED A;  3S3M A;  3L2U A;  3CD6 N;  4B9T A;  4Y1C A;  3CCV N;  3THY A;  2BGG A;  3LWM A;  3ZYY X;  4BR9 A;  1ASU A;  1OKJ A;  2ZJP L;  4OGE A;  3ZSZ A;  4RCH A;  4IEE A;  1TL1 A;  2D5R A;  1P8Z A;  2PFU A;  1ZBS A;  4IWV A;  4WCE L;  5HBM A;  1KSP A;  3WQU A;  2CGK A;  3QEP A;  3V9Z A;  3F9K A;  3PY8 A;  4FJX A;  1S1T A;  4ZHR A;  5FDL A;  3S9H A;  4JN4 A;  1YVN A;  2QWN A;  3KZB A;  4EP4 A;  3NBP A;  2HND A;  3AA2 A;  1ZBF A;  4BC5 A;  5FPN A;  1YTA A;  1E3M A;  3K2P A;  4OKJ A;  2GEL A;  1J6Z A;  5BRD A;  4LD0 A;  3IG1 A;  4FLZ A;  1HNV A;  2GUP A;  4RG8 A;  4BRM A;  4Z4C A;  3DRP A;  4JD2 B;  4ISG A;  3QO9 A;  3I0S A;  4CZL A;  2YNG A;  4CZH A;  4BQZ A;  4CJQ A;  1TYQ A;  5HRR A;  3BUZ B;  2EWS A;  4I6M B;  1TKZ A;  1HUX A;  3I8B A;  3DXK A;  3DJC A;  2NUB A;  3VES A;  3AVF A;  3VMF B;  2IGI A;  4BRC A;  3K57 A;  1VQ5 N;  4UY8 O;  1S3X A;  2WFB A;  3CCM N;  4PHT X;  5LMU K;  4FLX A;  3NAE A;  3KIO A;  1X3M A;  3U3G A;  3PIP L;  1SZ2 A;  1U2V B;  1O1W A;  5M1Q A;  2O4G A;  4IXC A;  2AP1 A;  3KLG A;  4H4O A;  4KFB A;  4DWI A;  2O8E A;  1RBR A;  3RR8 A;  1NBW A;  1VQP N;  1ZYQ A;  4ID1 A;  2PZS A;  3D2E A;  2D4W A;  4IOX A;  2O8D B;  5AQR A;  1JCG A;  1WSJ A;  3O9R A;  4JS5 A;  4KTQ A;  1TUY A;  1YJ9 N;  1W0H A;  2FF6 A;  5KGW A;  1JLQ A;  3DLE A;  3EYZ A;  4RW7 A;  4IEI A;  4NYF A;  4KPY A;  1N34 K;  5HOO A;  1XMO K;  3AVH A;  4FJ5 A;  2V7Z A;  4NCA A;  3VQ5 A;  1LW2 A;  3FR0 A;  3T1Y K;  3BDP A;  1NU0 A;  3HM9 A;  3PUF A;  3AA3 A;  1RDD A;  4FO0 A;  4FLV A;  1HYZ A;  4BRO A;  5AQZ A;  4YOV A;  3SUQ A;  1L3S A;  1WN7 A;  3BGR A;  1ZXO A;  2KLA A;  1NOZ A;  2RN2 A;  3ALY A;  3UB5 A;  1RT5 A;  1HQE A;  4JKF A;  1QVF M;  4O0J A;  3VF4 A;  3I55 N;  3EE9 A;  2KZM A;  4CK2 A;  1BHL A;  3DRS A;  4H5T A;  4BRE A;  3MEC A;  1T05 A;  1NJX A;  1J9A A;  3J7A P;  2WOM A;  4G9Z A;  5I9E B;  4XH5 A;  4FLT A;  3PX4 A;  5KPZ A;  5M1P A;  3AVK A;  3KD1 E;  1NK8 A;  3MN9 A;  3C6A A;  2ITM A;  2HHH K;  4AHV A;  1HNX K;  2QWM A;  4ISF A;  2KFZ A;  3O9U A;  3WNF A;  5EY4 A;  3OYG A;  2HHX A;  3ZLJ A;  3AVG A;  4JKC A;  2HBM A;  5M1N A;  1HYV A;  4DTS A;  5LMN K;  3C95 A;  3OHR A;  4B3M K;  4FJL A;  2OCE A;  2VGM A;  2W6L A;  3VQB A;  3CFR A;  4DTJ A;  1QZ6 A;  2E6M A;  5CE3 A;  4DF4 A;  4B3R K;  3P5J A;  3FGU A;  5JS2 A;  3SBG A;  2OPR A;  3VQD A;  2OPQ A;  3WXJ A;  4FWL A;  5GAG P;  3CFP A;  1UA1 A;  1YJW N;  3MXM A;  4C23 A;  4FZX C;  4BWJ A;  1J5E K;  1BG3 A;  3AVM A;  3CCE N;  4A59 A;  4CZK A;  1S9G A;  2KFN A;  3ZSQ A;  2XY6 A;  2QKK A;  4ICL A;  1NNE A;  2ETJ A;  3IUC A;  2JWK A;  3SLC A;  1W7A A;  2NRT A;  2O8E B;  3O5B A;  4DF8 A;  4AHR A;  4O8U A;  3O9T A;  4RW9 A;  1X9M A;  4KHU A;  3M6G A;  2HHQ A;  1FK9 A;  3FZM A;  4YDU C;  3SCX A;  3WUH A;  4BGA A;  1G15 A;  3RSE A;  4JHD A;  1XMQ K;  5AQT A;  4NO7 A;  1TKT A;  3HVR A;  1MDU B;  4FJM A;  4DLG A;  3ID8 A;  1JXB A;  3E66 A;  2NRV A;  2E2Q A;  4WFN L;  1VSF A;  3BEX A;  1ZBU A;  1RDW X;  2NRW A;  1NGE A;  4FLW A;  4LSN A;  3MWT A;  1WSH A;  2WBN A;  4M63 C;  4DQR A;  2FSN A;  4KI6 A;  5GIO A;  3P38 A;  3HP9 A;  2HBJ A;  3GG4 A;  3ID6 A;  3C0B A;  3NH0 A;  4M42 A;  2CH6 A;  1TK0 A;  3LP3 A;  1ILY A;  2UXB K;  4H4M A;  1WSG A;  3PV8 A;  1L3T A;  5GAE P;  1KVA A;  1HJR A;  1RCH A;  4DCH A;  4CJ4 A;  1HX1 A;  3I8D A;  4H8K A;  5DM7 L;  2FC0 A;  4JS4 A;  2P9L B;  4DMN A;  4CHQ A;  4DV1 K;  4E1N A;  3V9X A;  4K41 A;  4DQ8 A;  3VEY A;  5C24 A;  2IAJ A;  3BF3 A;  2F8S A;  1S1V A;  4CEZ A;  5AQW A;  4CBW A;  4F3O A;  1YTU A;  4PL8 A;  3RTV A;  3WEE B;  3LM2 A;  3LPU A;  3WNH A;  3TAF A;  3HT3 A;  3CFO A;  3H6E A;  1SKW A;  5KPT A;  3NH1 A;  1MWK A;  4FK4 A;  1XI1 A;  4PL7 A;  5BR8 K;  4HHT A;  2DY4 A;  1BWF O;  1U49 A;  4OLB A;  1Z6R A;  3DM2 A;  2AA4 A;  3R8E A;  1BQN A;  1WB9 A;  4H5W A;  3G0Z A;  3SQ0 A;  4FM2 A;  3CQY A;  4BC4 A;  2E8A A;  3ULE B;  3ZT4 A;  4F2R A;  2P9I A;  3RWU A;  1NGJ A;  4DR2 K;  4YDU A;  2V7Y A;  5J2M A;  1L3U A;  4FM1 A;  3CYM A;  2RPI A;  4DU4 A;  4MLH A;  5CZ2 A;  2RE2 A;  3L2R A;  4RTF D;  4YOX A;  1OVQ A;  4Z0U A;  1HPM A;  3FFK B;  1TVR A;  3M8R A;  4E3S A;  3E1Y A;  1LWC A;  3HI0 A;  5CY4 A;  3OW2 M;  1ATS A;  2G8W A;  4XIU A;  2A41 A;  2WUS A;  2IVP A;  1IBL K;  3SUO A;  1JCE A;  1QHA A;  5LJV A;  4GY2 B;  3TU5 A;  4CF8 A;  1HNW K;  2W42 A;  3OYD A;  5CYQ A;  4M3T A;  4FVU A;  1W2B M;  1K9M O;  1VAZ A;  3AVJ A;  2F4V K;  4MO4 A;  4JHD B;  4AH9 A;  4WFA L;  1QS4 A;  3SV4 A;  4AF1 A;  2VWB A;  1KCF A;  1T6C A;  2QWQ A;  3RRH A;  4FW1 A;  3SQ4 A;  3QFU A;  2RHK A;  4B1Z A;  5KPR A;  5ADX H;  1YXQ A;  4FSV A;  3FFI A;  2YHB A;  3H08 A;  4ILH A;  4CGD A;  2G8K A;  4M3U A;  1SS6 A;  4CJF A;  1Q18 A;  3E01 A;  3ENO A;  3O8M A;  4FOE A;  4CVN E;  5HRP A;  5F1X A;  3F73 A;  5AQV A;  4DSK A;  1LV5 A;  4DTX A;  1VQO N;  1C6V A;  4CEF A;  1SUQ A;  5FRO A;  4KRE A;  4MLE A;  4G1Q A;  3K58 A;  4O5F A;  2BAN A;  4H5N A;  2E1Z A;  3QER A;  4E7L A;  3GE1 A;  1XNQ K;  4JI2 K;  4FWS A;  1X9S A;  3V9U A;  3VQP A;  4IOC L;  1JCF A;  2BH1 A;  4KRF A;  2ZGZ A;  3SUN A;  1EET A;  1LOT B;  3HOT A;  3LDQ A;  1C0F A;  3LDO A;  4C8N A;  2CH5 A;  3BZC A;  2ZM6 K;  5KQD A;  4X65 K;  1UWB A;  4ZTF A;  1RTH A;  2YKN A;  3SJH A;  2KZZ A;  4DS5 A;  1N36 K;  3VTI A;  1QQC A;  1L3V A;  4I2P A;  3TAM A;  4BR4 A;  1BA0 A;  1ATR A;  4DTM A;  4CIF A;  4CZI A;  3J81 O;  3KLI A;  4EHU A;  4CJV A;  3CJ7 A;  3H1Q A;  4CEQ A;  1K8A O;  2P9I B;  5BR9 A;  4JKG B;  4DSI A;  1C0M A;  3WXL A;  3LDS A;  4GNI A;  4PUO A;  3TTD A;  3RR7 A;  1QVG M;  2KQ2 A;  3EKU A;  4IZ9 A;  3CC7 N;  3VTH A;  5LY3 A;  5M1K A;  2ASO A;  5E26 A;  2PAV A;  4N76 A;  3CM5 A;  4YOT A;  2UXC K;  5FLX O;  4FJ9 A;  3S3N A;  2PYJ A;  2QKB A;  5AQG A;  2P9U A;  2Q31 A;  4PKI A;  4BY9 C;  3THV A;  5JS1 A;  4GV3 A;  1DGK N;  4NCB A;  1RT7 A;  4B1V A;  3O6W A;  3HK2 A;  4BE1 A;  3OYM A;  1GOA A;  3D2F B;  3KK2 A;  1SL2 A;  2GWK A;  5AQK A;  4FLY A;  4JD2 A;  3AO5 A;  5BPL A;  4CHN A;  3MCP A;  4A61 A;  3U9D A;  4I6M A;  2I7P A;  4W5T A;  3QIC A;  4PKG A;  2F8T A;  2FSJ A;  5ELZ A;  4X66 K;  4PQU A;  1YF5 L;  1NWK A;  2ZF5 O;  4FZY A;  2D0B A;  1U6Z A;  1WSF A;  3AA5 X;  2ZQB A;  1T44 A;  3DOK A;  4OJR A;  4BRF A;  4CIG A;  4O0I A;  1ZBH A;  2YV0 X;  3AA4 A;  2ASM A;  2YNF A;  3LDN A;  3ZX0 A;  1B9F A;  2DTU A;  3EL2 A;  4FPA A;  3MX5 A;  4DFM A;  4Z4E A;  3OS1 A;  4ID5 A;  2G8I A;  1FKP A;  3HPG A;  1U2V A;  3VQ9 A;  1FKO A;  4AM6 A;  1TAQ A;  2KHO A;  3NF9 A;  1U47 A;  1HR0 K;  3ATV A;  1E4F T;  1I3A A;  2P9S B;  3R6M A;  4JI8 K;  4GW6 A;  3DLL L;  1BIS A;  1TKX A;  3E9O A;  4Q0B A;  2YNI A;  5JVG L;  4HVJ A;  2VG7 A;  3DLG A;  4AHS A;  2O8D A;  4K42 A;  4EHT A;  4Z4F A;  2FLO A;  3SZ2 A;  3TI0 A;  3AVL A;  4CEA A;  2YCH A;  4CJR A;  4DV0 K;  1NK5 A;  4JV5 K;  5EX5 A;  4H0T B;  2HHT A;  4NLC A;  3LP1 A;  4ZTJ A;  3C6H A;  4OPK A;  1SQK A;  2Q0U A;  1K8K B;  4I9L A;  2CGJ A;  2YJF A;  1VQ9 N;  5ADX A;  4CHZ A;  2EX3 A;  4EFH A;  3L0Q A;  1XNR K;  4DU3 A;  4PKH A;  2GEM A;  3CF5 L;  4M7Y A;  4E19 A;  4E1M A;  5AQX A;  4OKK A;  4M41 A;  5FRN A;  3HJF A;  4IFV A;  3VQA A;  3P39 A;  5HLF A;  1DKG D;  3IDH A;  5DK5 A;  4CHY A;  4K0K K;  2E2O A;  4JNE A;  4IOA L;  2HBL A;  3SJJ A;  1T03 A;  3TSU A;  3UKU B;  4BRH A;  2D0P A;  3L2V A;  1RTI A;  4R5P A;  4XH1 A;  1CZB A;  1U04 A;  4LC9 B;  2P9U B;  2FXU A;  4BRN A;  3LWL A;  4JRP A;  3K5N A;  2UU9 K;  3KK7 A;  2A1S A;  4MQ3 A;  4AHC A;  3VA3 A;  3NGY A;  1LAV A;  3VER A;  4B9Q A;  4DU1 A;  2YNH A;  4WE1 A;  2QK9 A;  4A2B A;  4JI6 K;  3DLR A;  4E7H A;  1WBB A;  4Y0W A;  2J4R A;  1SKR A;  4IG0 A;  1MWM A;  3K5L A;  1QQN A;  4JK7 A;  4XEI A;  4JI4 K;  4EIA A;  3U3Y A;  1X3N A;  3MN7 A;  4LFB K;  3DAW A;  1U4B A;  3W3D A;  3HZ6 A;  3D6R A;  2Q36 A;  1IJJ A;  5AQP A;  3KLE A;  3VET A;  4KKO A;  1IKY A;  2VQE K;  4HCB A;  1RNH A;  3C6U A;  4AM7 A;  3CCS N;  4GVE A;  2UYT A;  1SAZ A;  3Q7B A;  4BE0 A;  3KD5 E;  2D0C A;  3HYF A;  3TWH A;  1RT2 A;  5J1E A;  4IFE A;  2HVI A;  4B3T K;  2Z1G A; 
#chains in the Genus database with same CATH homology
 4BC3 A;  1VQK N;  1MA9 B;  3ENB A;  4O8U A;  3O9T A;  1GLE G;  3RSE B;  3M6G A;  3G25 A;  1VQ8 N;  2A40 A;  3FZM A;  4YDU C;  5HL7 L;  3WUH A;  4A5A A;  3TTF A;  4BGA A;  1NGB A;  1GLF O;  3BF1 A;  3RSE A;  3TPQ A;  3M3Z A;  4JHD A;  4KH6 A;  2QI2 A;  3VF6 A;  4CD1 A;  3CPE A;  5AQT A;  4NO7 A;  3VGK A;  1MDU B;  3O9S A;  4JK9 A;  3EO3 A;  3ID8 A;  3HTV A;  3E66 A;  3MMV A;  2NRV A;  4RWT A;  2E2Q A;  1EQY A;  5EXW A;  4WFN L;  1M1K O;  2HST A;  2HF3 A;  3BEX A;  1RDW X;  2NRW A;  4BRG A;  1NGE A;  1KQS M;  3MWT A;  1NGA A;  2V51 B;  4CJ7 A;  3FZH A;  4MDB A;  4MDA A;  1G99 A;  1RGI A;  3EZW A;  2WBN A;  4M63 C;  2V52 B;  3LM9 A;  3U8X A;  2FSN A;  3R1X A;  1HKC A;  4WF9 L;  4WQ5 C;  3O1B A;  5GIO A;  3G6E N;  3P38 A;  1VQM N;  1LCU A;  2HBJ A;  3GG4 A;  3ID6 A;  3N4Q A;  3B8A X;  3C0B A;  1X9J A;  4BC2 A;  2CH6 A;  4BGB A;  4BVP A;  2IIR A;  1YIJ N;  1ILY A;  3OA9 A;  3AAQ A;  4FOI A;  5BPM A;  3TTC A;  2BTF A;  3VOV A;  5GAE P;  1D4X A;  3CI5 A;  4CZE A;  1NGD A;  4H0O A;  4ILJ A;  2E20 A;  4DCH A;  1DEJ A;  1HX1 A;  1CZA N;  1XQS C;  2F7T A;  5EVZ A;  4BR7 A;  4CI6 A;  3DXM B;  4H0P A;  3C7N A;  1YI2 N;  3TSP A;  5DM7 L;  2OAN A;  5C15 A;  3CCL N;  1ESV A;  5AQS A;  2P9L B;  3DXM A;  4FWK A;  3SMP A;  1BDG A;  1K73 O;  4L3Q A;  3WXK A;  1ATN A;  3J7Z O;  3O9Q A;  1GLL O;  3QB0 A;  4CBX A;  4K41 A;  4DQ8 A;  3Q7C A;  3VEY A;  3CJC A;  2P9L A;  3R3L A;  3WT0 A;  4JAX A;  1YIT N;  3SK3 A;  3BF3 A;  3ZET B;  1RDU A;  2QWR A;  5AQW A;  4CBW A;  4BRI A;  3VEN A;  3ZEU B;  3PLA A;  3AAP A;  4PL8 A;  3MDQ A;  3WEE B;  3LM2 A;  3H6E A;  4XH4 A;  5KPT A;  1MWK A;  5TKW A;  5C12 A;  4PL7 A;  3ZEU A;  5MLC Q;  1BWF O;  5AQQ A;  3WEE A;  5AQH A;  1Z6R A;  2YJE A;  2AA4 A;  3JS6 A;  2QW9 A;  4YOU A;  4OPH A;  3R8E A;  3VEO A;  1YAG A;  5H1S Q;  4H5W A;  4JKA A;  1NGG A;  3GOI A;  3CQY A;  3DWL A;  4BC4 A;  2E1Y A;  1XUP O;  2E8A A;  4IO8 A;  3ULE B;  3NVK A;  2P9I A;  4A5B A;  4DKW A;  3C65 A;  1NGJ A;  2NRX A;  2P9N B;  2NLX A;  2IVN A;  1NGH A;  2V7Y A;  4YDU A;  2OTL N;  1GLB G;  5E84 A;  4MLH A;  3ULE A;  3ZX3 A;  5F0X A;  3A8Y A;  2QXL A;  2RE2 A;  2P9N A;  3SBT A;  4RTF D;  3SAG A;  4YOX A;  3CC4 N;  5C10 A;  3CJ9 A;  2A3Z A;  2Q97 A;  1KAY A;  2CGL A;  1HPM A;  4H0V B;  3FFK B;  3VEX A;  3JXU A;  4DHY A;  2HMP A;  3VGL A;  3O80 A;  3E1Y A;  3IKM A;  4H0Y B;  4ILG B;  3HI0 A;  3NVM A;  5AQO A;  2HF4 A;  3OW2 M;  2VYP A;  1ATS A;  3G4S N;  2A41 A;  2YHY A;  3HRG A;  2WUS A;  2IVP A;  3HM8 A;  3W0L A;  5AQL A;  3R9P A;  1JCE A;  1QHA A;  2QWP A;  2ZJQ L;  1YUW A;  1NLV A;  5LJV A;  4GY2 B;  3TU5 A;  3CCJ N;  3L6Q A;  3O1W A;  4WQ4 A;  4FVU A;  3CHW A;  3H3N O;  2YI1 A;  1W2B M;  1K9M O;  3OBY A;  2P9K B;  1BOT O;  1VAZ A;  5AFU H;  3UE5 A;  4A62 A;  3GBT A;  4MO4 A;  4JKD A;  3HSC A;  4JHD B;  5BRF A;  5AR0 A;  4WFA L;  3WQT A;  4F9O A;  4U67 L;  2JWL A;  2P9K A;  3MCA B;  1Q86 O;  2FF3 B;  3BP8 A;  2VWB A;  3H1V X;  4AF1 A;  3K9J A;  5FPM A;  1T6C A;  3K9K A;  3T69 A;  3VEZ A;  3L4Q A;  5JVH L;  2QWQ A;  3HBT A;  4C1N K;  5AQY A;  1W97 L;  2D1K A;  2F9W A;  1O13 A;  1JJ2 M;  4JKB A;  3QFU A;  2RHK A;  4B1Z A;  5KPR A;  5ADX H;  1YXQ A;  4FSV A;  3KWI A;  2YHX A;  4ILH A;  4FWP A;  1SS6 A;  2KKZ A;  3O4W A;  1IG8 A;  1Q18 A;  3CXC M;  4CZM A;  3ENO A;  3O8M A;  1GLC G;  4FOE A;  5M1O A;  5AQJ A;  4BRQ A;  4BRA A;  1S22 A;  1P90 A;  5F1X A;  3SAH A;  5AQV A;  1HKB A;  3KWG A;  3MWP A;  4H5V A;  4CZJ A;  2HOE A;  4CZG A;  4B1Y B;  1VQO N;  2GTD A;  4YOY A;  5EOY A;  3CCQ N;  5JLH A;  1DT9 A;  1EO1 A;  4B1U B;  4MLE A;  2GX9 A;  4O5F A;  4GV9 A;  5C2D A;  4FPB A;  1NMD A;  4U7B A;  4H5N A;  4IDH A;  1NGI A;  2E1Z A;  3A5L C;  3LDL A;  4GV6 A;  1NGF A;  4ISE A;  3C7N B;  3GE1 A;  5AFU A;  5JLF A;  3CCR N;  4FWS A;  2F9T A;  4IOC L;  1JCF A;  2BH1 A;  4JKH A;  1KAZ A;  2ZGZ A;  3M1F A;  4QS7 A;  1LOT B;  3HOT A;  3LDQ A;  1C0F A;  3LDO A;  3VF2 A;  5BRE A;  4WFB L;  3QML A;  2CH5 A;  4KBO A;  3AGK A;  5KQD A;  5LJW A;  4NB4 A;  5JIC A;  1BO5 O;  3P31 A;  1BU6 O;  3CER A;  1V4S A;  3G71 N;  3MN5 A;  2NRR A;  3H3O B;  3H45 C;  4O8K A;  3UKR B;  3SJH A;  4MO5 A;  4EAH D;  3F9M A;  5C2F A;  3F2K A;  4YOW A;  1VQN N;  3U9Z A;  3VEW A;  4QS8 A;  3VTI A;  3CCU N;  3A5M C;  3P4I A;  3F5T A;  4BQL A;  2VGN A;  3UKR A;  3S41 A;  1Q81 O;  1WUA A;  3T7Z A;  3U4L A;  5AZJ B;  3VEV A;  4BR4 A;  1KC8 O;  1BA0 A;  1ATR A;  1HLU A;  3CD6 N;  3HOS A;  4CZI A;  3CCV N;  4EHU A;  3CJ7 A;  3H1Q A;  5GAD P;  2IVO A;  5AZJ A;  1K8A O;  3SMS A;  3MX2 A;  2P9I B;  3ZYY X;  4KH5 A;  4JKG B;  1OKJ A;  4BR9 A;  3WXL A;  4E1J A;  5BR9 A;  2ZJP L;  3AGR A;  4GNI A;  3MN6 A;  4RCH A;  4IEE A;  3TTD A;  5GIP A;  1QVG M;  3E9L A;  3AY9 A;  1P8Z A;  2PFU A;  1ZBS A;  2YX6 A;  3EKU A;  4IZ9 A;  2NRH A;  4JKG A;  3CC7 N;  1HJO A;  3VTH A;  4IWV A;  4KH4 A;  3ZX2 A;  4WCE L;  5LY3 A;  4J8F A;  3WQU A;  3IFR A;  2CGK A;  5M1K A;  2ASO A;  5E26 A;  1GLA G;  2HBK A;  2PAV A;  1KD1 O;  5FPE A;  4YOT A;  2ZJR L;  4JN4 A;  1YVN A;  2QWN A;  3EE8 A;  3KZB A;  4BR5 A;  2OTJ N;  2E2N A;  2FSK A;  4OO1 J;  3H46 O;  4FWN A;  4BC5 A;  5FPN A;  4A57 A;  5AQG A;  2P9U A;  2Q31 A;  4PKI A;  4DB3 A;  1Q82 O;  2GEL A;  4BY9 C;  1J6Z A;  5BRD A;  1KAX A;  4Z94 A;  4GV3 A;  3OBW A;  5M1F A;  1DGK N;  2GUP A;  1TYQ B;  4BRL A;  3D7E O;  4BRM A;  4B1V A;  4JD2 B;  4ISG A;  1GLD G;  1ZC6 A;  3O6W A;  3QDK A;  4CZL A;  4CZH A;  4BQZ A;  3DXK B;  3D2F B;  1TYQ A;  2GWK A;  1Z05 A;  2EWS A;  3BUZ B;  3O08 A;  4I6M B;  4WQ5 A;  5AQK A;  1GLJ O;  4JD2 A;  1HKG A;  1HUX A;  2BUP A;  3FE1 A;  4CD3 A;  3I8B A;  2QM1 A;  5BPL A;  1QQM A;  2PBD A;  3MCP A;  4JK8 A;  4FWQ A;  3DXK A;  3DJC A;  4A61 A;  3D2F A;  2QA4 N;  3U9D A;  4I6M A;  3L4I A;  5BRH A;  3VES A;  4NLB A;  1QZ5 A;  2I7P A;  3QIC A;  2W41 A;  4PKG A;  4BG8 A;  5DM6 L;  3VMF B;  4BRC A;  4H0X B;  2FSJ A;  5ELZ A;  2VCP A;  2D0O A;  4K43 A;  1YF5 L;  1VQ5 N;  1NWK A;  4UY8 O;  1S3X A;  3NMU A;  2WFB A;  1VQ7 N;  2ZF5 O;  3CCM N;  2NRZ A;  1U6Z A;  3FLC O;  4PHT X;  5AQU A;  1T44 A;  1X3M A;  1QQO A;  4BRF A;  4HWI A;  1BUP A;  2ASM A;  4WYB A;  3LDN A;  3ZX0 A;  4BRK A;  3PIP L;  1SZ2 A;  1U2V B;  4QS9 A;  3EL2 A;  4CZF A;  4K25 A;  4FPA A;  3M5R A;  2WC9 A;  3LDP A;  3D2E B;  3MX5 A;  5M1Q A;  4R79 A;  4IXC A;  2AP1 A;  1VQL N;  3CJA A;  4FL9 A;  5CR4 A;  4AM6 A;  1U2V A;  5AQI A;  4IO9 L;  1NBW A;  1VQP N;  2KHO A;  3CC2 N;  3D2E A;  2D4W A;  4IOX A;  3VPZ A;  3ATV A;  3ENH A;  1E4F T;  2QWO A;  5B8H A;  2P9S B;  3R6M A;  1H1V A;  3CJB A;  5AQR A;  1JCG A;  4JEP A;  3DLL L;  3O9R A;  3E9O A;  1TUY A;  3KHY A;  5JVG L;  2E2P A;  1YJ9 N;  2FF6 A;  2P9S A;  4K42 A;  4B1W B;  4EHT A;  3FZL A;  3TSQ A;  4H5R A;  4IEI A;  4FWO A;  5TKY A;  5BN8 A;  5HOO A;  2FLO A;  3PIO L;  1XC3 A;  5JMV A;  2YCH A;  2V7Z A;  1WOQ A;  3FR0 A;  2Q0R A;  2ZWH A;  4H03 B;  1C0G A;  5EX5 A;  1VQ6 N;  5GAH P;  3I56 N;  4H0T B;  3QFP A;  4NLC A;  2QTD A;  4FO0 A;  3MK6 A;  3C6H A;  3SAF A;  1KXP A;  1RFQ A;  2H3G X;  5AQZ A;  4BRO A;  4YOV A;  1SQK A;  2I7N A;  2Q0U A;  2Q2R A;  1K8K B;  1OVY A;  5CHI A;  2CGJ A;  2YJF A;  1M90 O;  2ZGY A;  2QWL A;  3EN9 A;  1VQ9 N;  5ADX A;  1R59 O;  4WQ4 C;  5KQ8 A;  1ZXO A;  2A5X A;  4BVO A;  2KLA A;  4FWM A;  1K8K A;  4EFH A;  1NGC A;  5AQN A;  4BRD A;  3L0Q A;  3UB5 A;  1S72 N;  3CIP A;  1T6D A;  3CET A;  4JKF A;  3A5O C;  4PKH A;  3QBW A;  2E88 A;  4BR0 A;  3E9P A;  5GIN A;  1QVF M;  2GEM A;  3VF4 A;  3I55 N;  3CF5 L;  3LL3 A;  3EE9 A;  4M7Y A;  4BRP A;  3ATU A;  5AQX A;  1V4T A;  2A42 A;  1VQ4 N;  4OPA A;  3P39 A;  3N4P A;  1DKG D;  3IDH A;  3IMX A;  2E2O A;  4JNE A;  3A5N C;  4IOA L;  2HBL A;  4H5T A;  3TSU A;  4BRE A;  3UKU B;  4HTL A;  3RVC A;  4BRH A;  1NM1 A;  4G9Z A;  5I9E B;  2D0P A;  4XH5 A;  3KVG A;  3UKU A;  5KPZ A;  5AZI B;  5M1P A;  3FZF A;  3ZET A;  1YJN N;  3MN9 A;  3C6A A;  2ITM A;  2A6A A;  4XH1 A;  4LC9 B;  2P9U B;  2FXU A;  5AZI A;  4BRN A;  3KK7 A;  2QWM A;  4ISF A;  1Q7Y O;  3O9U A;  3VER A;  4IJN A;  4B9Q A;  3WXI A;  3EKS A;  5EY4 A;  2GWJ A;  4A2B A;  4IJA A;  4JKC A;  2HBM A;  4Y0W A;  3AAR A;  5M1N A;  1E4G T;  5F2R A;  2J4R A;  4A2A A;  3CPW M;  5AQM A;  3OHR A;  1MWM A;  5C0Y A;  1QQN A;  4JK7 A;  4XEI A;  4BR2 A;  4EIA A;  3GDQ A;  1X3N A;  3MN7 A;  3DAW A;  4YOR A;  2P9P B;  2VGM A;  3QBX A;  1QZ6 A;  5CE3 A;  4B1X B;  5FPD A;  3W3D A;  1TUU A;  3FGU A;  3HZ6 A;  3D6R A;  3CQX A;  3SBG A;  1BA1 A;  3CJ1 A;  2P9P A;  2Q36 A;  2NZT A;  3GL1 A;  3WXJ A;  1IJJ A;  1Y64 A;  4FWL A;  5AQP A;  5GAG P;  1NJI O;  1YJW N;  4FWR A;  2Q1N A;  3VET A;  4C23 A;  4M7X A;  1BG3 A;  3CCE N;  4A59 A;  5AQF A;  3CMA N;  2ASP A;  1T3V A;  2NNW A;  1N8R O;  4CZK A;  3I33 A;  4AM7 A;  3CCS N;  4JKE A;  4GVE A;  3VGM A;  2UYT A;  1SAZ A;  3Q7B A;  3WXM B;  2DPN A;  4CBU A;  5BN9 A;  3IUC A;  2JWK A;  3A0I X;  3FZK A;  3SLC A;  4C1N I;  2NRT A;  5BPN A;  4IFE A;  1YHQ N;  3CME N;  4BG9 A;  3O5B A;  3J8A A;  2W40 A;  2YHW A;  2QEX N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...