4GVMA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
148
Chain Sequence
b'DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTACWWAGIKQEFGIPYNPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 148
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gvmA00
5I3UA 4KTQA 3PO4A 3CFPA 3KD5E 4FK0A 4KTZA 1X9MA 1IKYA 2GV9A 2FBVA 3OYLA 3NDKA 2KQ2A 1HQEA 4CHOA 3VQ5A 4DS5A 3LP1A 1TV6A 3O4NA 2HNDA 4CJTA 3SUQA 2VWJA 1JL1A 4MQ3A 2ETJA 3LPTA 3V9UA 3LAKA 1T8EA 5J2QA 1BI4A 4FJNA 4HUFA 4DFMA 3TAFA 1TK5A 4CEFA 1JLGA 3L2UA 1RT6A 1NJZA 1CXQA 4BDZA 2B4JA 1C0UA 1RBVA 4CJSA 4DTUA 2HHVA 4RW8A 3SUPA 3O3GA 3CG7A 4DTMA 1CZ9A 2QXFA 4CGGA 3QEVA 2DTUA 4NYFA 2RKIA 4HUEA 3IG1A 1EKEA 4BDPA 1NK5A 4FJHA 4K8XA 2OZSA 3MEGA 5HBMA 1U47A 4DG1A 4CFAA 4CIEA 4IG0A 4LD0A 2YNFA 4ID1A 3SYZA 3LP2A 1NKCA 1J54A 4AHUA 4B9SA 4OKJA 2XRIA 3IAYA 3NF7A 4JRPA 4FJ9A 3TR8A 1BGXT 3K2PA 4C8MA 3KLEA 1ASVA 2HHWA 2Z1GA 3HPGA 4DTXA 2HMIA 4PY5A 3NHGA 5C25A 4FLWA 1TKTA 3TAGA 3NGYA 3CYMA 4FM1A 3HP9A 4DF8A 5I42A 1QTMA 3U6FA 1JLAA 5HRNA 3OJSA 2G8HA 1BI4B 4ID5A 3LAMA 3DOLA 4IFYA 1L5UA 1W9HA 3K5NA 3KLFA 4YFUA 1QSSA 3AVJA 4FLVA 3SV4A 2G8WA 2HHTA 3ZSZA 4EP5A 2ITGA 4KREA 1VRTA 1S6PA 2YNHA 3FFIA 3V1QA 1QQCA 3VQ6A 2PYJA 1TGOA 5C24A 3LP0A 1WSFA 5CYMA 3I0RA 3V1OA 3OJUA 4KHSA 4DSKA 2HHUA 1VSFA 4BWMA 1RT4A 2X6SA 3NF9A 4H8KA 4IKFA 4GMJB 2I5JA 4TSXA 3L2VA 4DU1A 4CJUA 2HHSA 4FCYA 5KTQA 3KK2A 3LZIA 3AVKA 1I39A 1TVRA 2YHBA 1CXUA 3PUFA 3DLRA 3KLIA 3NBPA 1RBSA 1NKBA 3VA3A 4C8KA 4NYNA 1IH7A 3HXMA 4CGHA 4CJ3A 4AHVA 3TARA 1A5VA 1LW2A 4L8RB 3I0SA 3QLHA 4FW1A 2HW3A 4CIGA 3RMAA 3P1GA 3UIQA 3HPOA 1CZBA 3L2RA 5KRSA 1WNSA 3V9WA 4KHWA 3DLEA 1CLQA 1L3UA 3I8DA 4O0IA 1NJYA 1C1BA 1EXQA 3AO2A 2FC0A 1DLOA 1GOAA 1QSLA 4Z4FA 2VWKA 1XHXA 4RG8A 2WOMA 2F96A 1LWEA 3JSMA 1S6QA 4FJ7A 3AVNA 1SKRA 2AJQA 4J2BA 4LH5A 4CEZA 4AHRA 1HYSA 5DMRA 1JLEA 1UOCA 4KRFA 4I9LA 4RW4A 4Z0UA 3OYBA 1FKOA 5J2NA 3OVNA 3DLGA 1BISA 1S1VA 1G15A 1RTJA 4CESA 2E4LA 2NUBA 3HL8A 4K8ZA 4IFVA 3KJVA 5JS2A 3L2WA 3EZ5A 1Y97A 4Z4IA 3KK1A 3DMJA 4FLTA 4AH9A 1TAQA 2Y1JA 1NJWA 2IS3A 1FK9A 1B9FA 3K5LA 3AVCA 5HLFA 4F3OA 3PX0A 3VQAA 2BE2A 2KFNA 4OLAA 4W5QA 4DTRA 1KLNA 3ZT4A 2D5RA 1HNIA 3QERA 1XI1A 2HVHA 3LWLA 4CHZA 4FJMA 3NH0A 2Z1IA 4Q0BA 1RCHA 1ZBHA 5EU7A 3E01A 1RILA 3ASMA 4F3TA 5C42A 3KKRA 3RTVA 1KVBA 3B6PA 2PY5A 2W42A 4I2QA 1JXEA 3V4IA 3TABA 3OYFA 2VG5A 1IKVA 4CJFA 4CF0A 1IO2A 1YTAA 4FLYA 3OS0A 4DSIA 1NOZA 1RT1A 4DTOA 2QKKA 1ASWA 3CM6A 4CF9A 4QOZB 3NH1A 1WAJA 2B6AA 1YT3A 2Y1IA 4F2RA 3KIOA 4NCGA 4FLXA 5CYQA 1RT3A 1UA0A 4CCHA 4WE1A 4HTUA 1NOYA 2DFHA 4CEOA 4Q5VA 4G1QA 4AILC 4KHQA 3DRSA 4DSJA 4DF4A 3BDPA 2P5OA 2DFEA 1FXXA 3MXIA 3M8QA 1WAFA 1QS4A 3O4QA 4LSLA 3EYZA 4ICLA 1SL1A 1BIZA 1K6YA 3A2FA 4HCCA 3QO9A 3U3YA 3PV8A 1HNVA 2FBTA 2DFFA 1JLCA 3NF8A 2G8IA 3C95A 1NKEA 4CJWA 2X6NA 1NK0A 4J2DA 4OJRA 1C6VA 3ZT2A 3MXMA 1KFSA 2LSNA 4ZTFA 3OYMA 4OPKA 3K57A 1RBUA 2HVIA 2OPPA 2Q3SA 1Q8IA 3MXJA 4IG3A 4E3SA 1W0HA 1N6QA 4B8AB 4CGIA 2OA8A 4NCAA 5FRMA 5DK5A 4CIFA 4HHTA 4C8OA 1XC9A 1SUQA 1WSJA 1U48A 4M45A 1UA1A 4E7HA 1ZBLA 4FJJA 4M3XA 2O4IA 3LZJA 2XHBA 1KCFA 1TAUA 3V9XA 1IKXA 4OPJA 4H4MA 1Z25A 1BCMA 3K58A 3NAEA 1RTHA 4LSNA 4FK4A 3VN5A 3WNFA 4FLUA 4F2SA 4HVJA 1ASUA 1D5AA 2YKNA 4CJVA 4XIUA 1VSKA 4KAZA 1NJXA 4M3YA 1HJRA 2OYQA 1VSHA 4GW6A 2IAJA 2ZQBA 5CY4A 5K14A 4CHYA 3BGRA 3OYDA 4DU4A 3S3OA 4M3RA 3K59A 2VG7A 4M42A 4YNQA 2O4GA 1U49A 4DTSA 3SQ1A 1IG9A 3QIOA 4OKKA 4O4GA 4B9TA 3B6OA 4DSEA 3VQ7A 3DLBA 1J53A 1DTTA 2IDOA 3LALA 1Z26A 1O1WA 1B9DA 3SZ2A 3V9SA 1N5YA 2QKBA 4ELVA 4FW2A 3SQ0A 1S9EA 4B9VA 2FBXA 3MEDA 4R5PA 1S9GA 2X78A 5JS1A 2PZSA 4FK2A 4FZXC 3QEPA 3RMDA 1LAWA 4ZHRA 4B9UA 2OPQA 2WONA 4Y1CA 1RT7A 2P51A 4E7KA 4QCLA 2X74A 3DYAA 4DQRA 1HRHA 2XY7A 1S5JA 1HQUA 3LWMA 4Z4CA 4FLZA 2BGGA 1KVAA 3JYTA 4CJQA 3HK2A 4M3WA 4CJKA 3NCIA 2A1RA 3AVLA 1S1TA 4KPYA 1GOCA 2OPSA 2HHXA 3IS9A 3ZSWA 4E89A 4DS4A 2HNZA 3OYNA 4E7LA 3VQ9A 3RWUA 1VRUA 4DFJA 1RT2A 3L8BA 1F21A 4CF8A 1TL3A 1RT5A 3KTQA 4E7IA 2E6LA 1HMVA 4B8CA 3DRRA 4KV8A 3CM5A 5HRPA 3G10A 3V81A 1VSLA 1VK0A 3KKSA 4RW6A 2BANA 4MFBA 4BE0A 4CJPA 4GVMA 3HT3A 4JS5A 1VSIA 1EP4A 4DSFA 4B3OA 3KK3A 4CE9A 3VA0A 3V6DA 4FJ5A 4J2EA 4O55A 4Z4HA 4I7FA 4DMNA 3OYCA 3V9ZA 3M8SA 5D3GA 4IDKA 4EZ9A 1RDCA 5HP1A 1WSHA 4FXDA 5KI6A 1C1AA 4DQIA 3MECA 5FROA 1BQNA 3ZSYA 4H4OA 4KFBA 4J2AA 1D9FA 4Z4EA 3D0PA 2D0AA 4DTJA 3G0ZA 4Y1DA 4F8RA 4KI6A 3VQ4A 4DU3A 3ZT1A 2PYLA 4KHYA 1NK4A 3AVIA 3QEIA 4PA1A 5KGWA 4Z4GA 4E0DA 3ZCMA 3KLHA 4ZTJA 4N56A 4DQPA 4PQUA 3ULDA 1VSEA 3NH2A 4CFBA 4FYDA 4E7JA 5CZ1A 1VSJA 3S9HA 1TKZA 5T7BA 1JKHA 3HJFA 5J1EA 3EY1A 1NK6A 3AO1A 4KO0A 4OKEA 1JLFA 5FDLA 5E41A 4DLEA 3QIPA 4I2PA 4CK3A 1R0AA 1QHTA 1FKPA 1TK0A 3S3MA 1ZBIA 3SNNA 3O3HA 2EX3A 5HRSA 1S1WA 2EHGA 3T19A 4CGJA 3ITHA 1JLBA 2FBYA 1C1CA 1A5XA 3AV9A 3LPUA 4AHSA 4HUGA 5HROA 3AVBA 5SZTA 3SUNA 3IRXA 3LANA 4CHNA 4CECA 4HCBA 3DI6A 3M8RA 2BDPA 3MAQA 1HYVA 2D0CA 3AA5X 3AVFA 1UAXA 2P1JA 1A5WA 2XY8A 4KKOA 4O44A 3V1RA 4AHCA 1NK7A 1NK8A 1U04A 4KHUA 2YKMA 3RRHA 4M3ZA 3H08A 3TAPA 1IKWA 2F8SA 4PWDA 4W5TA 3AA4A 1C0TA 3SPYA 1WN7A 4W5OA 3QEWA 4CGFA 1DTQA 3NGIA 4CHPA 4DSLA 4N41A 4M41A 4NCBA 1WSIA 5KRTA 1ITGA 1KRPA 1L3VA 3AVAA 5SWMA 1JL2A 4BDYA 3AA2A 4B9LA 4W5RA 1Q9YA 4W5NA 3VQBA 3KLGA 3PY8A 5J2MA 3QINA 3OYKA 3U3GA 2Z1HA 4E1MA 3OY9A 1YTUA 4DQSA 2Z1JA 1U4BA 1X9WA 1U45A 2ZD1A 4JLHA 4CGDA 3S3NA 3QEXA 3SQ4A 3K5OA 3DLKA 1XHZA 1TK8A 5FRNA 4M3UA 4DTPA 2YV0X 4KB0A 1KFDA 1JXBA 3WNEA 2A1SA 4JS4A 3PO5A 4FJKA 4BWJA 3VQEA 4FM0A 2YNGA 3ISNC 4CEEA 3SV3A 4C8LA 3NFAA 2YHAA 4F4KA 3LP3A 1LW0A 2ZE2A 1T05A 2P5GA 3ZT0A 2RN2A 1JLQA 1LAVA 3VQCA 5KGXA 3ZSVA 3AVMA 3OYGA 2G8FA 3OS1A 1RDDA 1KLMA 3P5JA 4N5SA 1BQMA 1D9DA 2G8VA 1B92A 4N47A 4CJLA 1WSEA 3SUOA 4KB1A 4FJGA 4DLGA 1BL3A 3C6UA 3OYJA 3O3FA 2D0BA 1ZYQA 3ZSOA 3RMBA 4CF1A 4FJIA 4JRQA 1LV5A 1SL0A 3RMCA 3SI6A 3TAMA 4OVLA 4BE2A 3HVTA 4CJ4A 2HHQA 1WLJA 1KSPA 4QAGA 4CK2A 2IOCA 3CFOA 3OYHA 2KZZA 3HSTB 1EETA 3ALYA 1SV5A 3RRGA 2ATQA 4KTWA 3HM9A 2XY6A 2IC3A 1LWFA 3DOKA 2IGIA 1T7PA 4FVMA 3TWHA 2HB5A 3NF6A 2B5JA 1MU2A 1Q9XA 3HYFA 4RW9A 1RBTA 1J9AA 4B9NA 2G8UA 3HPHA 3HO1A 3QESA 4FZYA 1TL1A 5J2PA 3OYEA 4I9QA 2R7YA 1KVCA 4O0JA 3VQQA 2G8KA 2JGUA 1VSDA 1ZBUA 1RBRA 3T3FA 3ZT3A 4EP4A 1UWBA 3QNNA 3AO5A 1REVA 3DLHA 4O5BA 3T1AA 3HP6A 2QK9A 2GBZA 2KFZA 1SKWA 1KTQA 4EZ6A 5HRRA 1I3AA 1BHLA 4DWIA 2XO7A 3P83D 1YVUA 4LH4A 3ZSQA 4ELUA 2KZMA 3AVGA 1X9SA 1RDAA 3OS2A 3WNGA 2KTQA 3NGZA 2F8TA 4OGCA 3RR7A 2JLEA 1L3TA 4CEQA 4FZZA 1HYZA 4CJRA 2YNIA 4IBNA 4RW7A 3TAQA 3TI0A 1SKSA 4OLBA 3QETA 1EX4A 4UQGA 3WNHA 3VQ8A 3OYAA 3L2QA 4N76A 4DFKA 2KW4A 3C94A 3CQ8A 3TAEA 3TANA 1C0MA 4CJ5A 1S1UA 3OYIA 1T03A 1XWLA 4BACA 1SL2A 1RDBA 2RPIA 3C6TA 1TKDA 2HNYA 3L3VA 4CF2A 1WSGA 3VQPA 4DTNA 3DM2A 1BCOA 3THVA 4B08A 4B9MA 4FJXA 1BIUA 3SJJA 1TKXA 3ZSRA 1QE1A 3AVHA 1QSYA 4C8NA 2OPRA 4CERA 3M8PA 4BE1A 4DFPA 3AO4A 4KHNA 4AHTA 3D45A 4CHQA 3PX6A 3VQDA 3SQ2A 4FJLA 2XY5A 1S1XA 4KI4A 1L3SA 3RR8A 4CFCA 4CFDA 3MEEA 2E6MA 3DRPA 5CZ2A 2OZMA 1GOBA 4ELTA 1HPZA 3HVRA 3NE6A 4CK1A 1RTIA 2RF2A 4PUOA 2VG6A 4LY7A 1ZBFA 3AA3A 1VSMA 4CEAA 1RNHA 4OGEA 4E19A 4E1NA 3QNOA 1RTDA 3SCXA 4FM2A 1NK9A 1D8YA 1J5OA 2DY4A 4M3TA 3F9KA 1LWCA 3CFRA 3F73A 2GUIA 4CJEA 3KD1E 3L3UA 3K5MA 3PX4A 3AO3A 4CEDA 1X1PA 3LDSA 4FJ8A 4DQQA 3SPZA 4CEBA 3ZSXA
chains in the Genus database with same CATH superfamily
1QQOA 3H3NO 4BG9A 3ZEUB 4CD1A 4BC2A 1IKYA 2GV9A 2FBVA 3NDKA 1K9MO 1VQ6N 3LP1A 2HNDA 4CJTA 1WBBA 2VWJA 4MQ3A 1T8EA 3ID8A 4CEFA 1JLGA 1HLUA 3L2UA 1CXQA 3AGKA 1C0UA 3CJ9A 2QWOA 2HHVA 4RW8A 3O3GA 3EO3A 5AQYA 3CJBA 4IDHA 4GNIA 4K8XA 3FFKB 1U47A 4DG1A 4JD2B 2IVPA 2ZWHA 1J54A 4AHUA 2AP1A 3AAQA 3NF7A 2IVNA 4K41A 1ASVA 5BN8A 3A5NC 3U9ZA 4PY5A 1OH7A 4JKCA 3QMLA 4FLWA 1TKTA 4O8UA 4H0PA 5LJWA 1Q82O 3ZYYX 1JLAA 2W6KA 3OJSA 4JKGB 1W9HA 4FLVA 1QVFM 2ITGA 1S6PA 2YNHA 5C24A 3LP0A 1NGEA 4DR5K 2WTUA 3KHYA 1VSFA 3BP8A 3MX5A 4TSXA 2I5JA 3P39A 5AQMA 2HHSA 5KTQA 1CXUA 2F9WA 3NBPA 1MWKA 4JKBA 3CPEA 3VA3A 4NYNA 3HXMA 4CJ3A 5AQWA 3QBWA 4DCHA 3I0SA 4CIGA 3RMAA 3UIQA 1VQ8N 2Q97A 3LL3A 3L2RA 1NGAA 3WXKA 4O0IA 1EXQA 1WBDA 4B1VA 2VWKA 2F96A 5CE3A 4FJ7A 1SKRA 1W97L 4AHRA 2VCPA 1DEJA 4Z94A 1MDUB 3OVNA 1BISA 4CESA 3VTIA 2E4LA 4IFVA 3KJVA 5JS2A 3L2WA 4Z4IA 5FPDA 5HL7L 3DMJA 4FLTA 2Y1JA 4LFAK 4BREA 4EAHD 1C0FA 5HLFA 4WFBL 3J80O 3H3OB 1KLNA 4IJAA 2D5RA 2P9SA 4FJMA 1ZBHA 5EU7A 1N36K 3VF4A 5C42A 4B1ZA 4I2QA 5JLFA 4XH1A 3CC2N 4LF6K 3OS0A 4BRPA 5A2QO 1X3NA 1ASWA 4QOZB 2B6AA 2E88A 2Y1IA 1UA0A 1RT3A 4CCHA 2O8EA 4PKHA 1VQ9N 5FPEA 1NMDA 3DXKA 3DRSA 4JI0K 1G99A 1V4SA 4ISFA 5AQGA 4L3QA 4ICLA 2GWKA 1K6YA 3A2FA 3VPZA 3CJ7A 1VQNN 2FBTA 3C95A 2X6NA 1NK0A 1GLDG 5BRFA 4DV6K 1C6VA 3ZT2A 1KAXA 2I7NA 2GELA 3K57A 1RBUA 4IJNA 2Q3SA 1N6QA 1W0HA 4B8AB 4FVUA 2Q1NA 1ZBLA 4FJJA 5E26A 4ILHA 1RTHA 4LSNA 4ILGB 3VEWA 4YOVA 1NJXA 2OYQA 2IAJA 1U48A 3TTCA 3BGRA 1QZ6A 4M3RA 2O4GA 4MO5A 5FLXO 4OKKA 3RSEB 4DSEA 3DLLL 1J53A 3TSQA 3SMSA 1QHAA 2QKBA 1S9EA 4B9VA 4R5PA 2X78A 3BF3A 4FK2A 4BRHA 4CVNE 3MN6A 1NGDA 2X74A 4DQRA 1HRHA 2XY7A 1S5JA 3CCRN 5GAHP 3L6QA 3T1HK 2BGGA 1ATNA 1P90A 4DR1K 2ZF5O 4CJKA 4V19S 2A1RA 3AVLA 1S1TA 3A5LC 4M63C 4KPYA 4X62K 3IS9A 4E89A 3CQXA 4PL7A 4DFJA 1MWMA 4CF8A 1RT5A 4E7IA 4LC9B 3VGMA 5GIPA 4MLEA 3SBGA 4JS5A 4BR7A 4DSFA 4A61A 4J2EA 3CETA 5BN9A 4DMNA 3OYCA 2CH5A 1K8KB 5D3GA 4FXDA 4YDUA 5FROA 2W40A 3VEYA 2UUCK 4DTJA 1RFQA 3G0ZA 3VQ4A 3ZT1A 3THWB 2PYLA 5BR8K 4ZTJA 4N56A 4DQPA 1SAZA 4EIAA 4BRFA 2P9PA 3CCLN 1U6ZA 3O8MA 1JLFA 4DR7K 1R0AA 1QHTA 2VWBA 2Q36A 3O3HA 2EX3A 4QS8A 5H1SQ 2O8CA 1K73O 1HKCA 5CHIA 2EHGA 2JWLA 3ITHA 3AV9A 1A5XA 3FZHA 3LPUA 4AHSA 4DKWA 1HX1A 3FZMA 1HKBA 3U4LA 3ZX2A 3M8RA 1QZ5A 1Q86O 3CCUN 3AA5X 1NK7A 4KKOA 4O44A 4B3TK 4KHUA 3RRHA 3TAPA 4W5TA 3AA4A 1V4TA 2F7TA 1DTQA 4LF5K 2E8AA 2FF3B 5KRTA 1ITGA 1KRPA 1JCGA 4DB3A 3AVAA 5SWMA 1HJOA 4BDYA 3AA2A 4W5NA 3KLGA 3THXA 3U3GA 2Z1HA 4E1MA 1YTUA 4FWOA 4DQSA 2Z1JA 1S3XA 1U4BA 1U45A 2ZD1A 3QEXA 3EKSA 1XHZA 4O8KA 4BGAA 3CC7N 2YV0X 2CH6A 4YOXA 1KFDA 1Z05A 3TU5A 5B8HA 4YOYA 4JS4A 3PO5A 3J81O 3EZWA 4FJKA 2YNGA 4F4KA 1NM1A 4FPAA 1EQYA 4MDBA 2ZE2A 4FJ9A 2RN2A 3VQCA 1DT9A 4X66K 4FWQA 1B92A 4DLGA 2P9NB 4JN4A 3C6UA 3D2FA 2D0BA 3C7NA 3O9RA 3TAMA 4BE2A 5F2RA 4IO9L 3ZX0A 3HSTB 1EETA 2HBLA 2ATQA 4KTWA 2XY6A 2YHXA 5IWAK 2HOEA 4FVMA 1BOTO 2HB5A 3TWHA 5ELZA 4B9NA 4RW9A 1J9AA 2G8UA 1SQKA 2NZTA 3HO1A 2JGUA 3ZT3A 4EP4A 4PKGA 3D2FB 4O5BA 3D2EA 1H1VA 1YJNN 3C7NB 3O1WA 1BHLA 3ZSQA 5AZJA 5LY3A 5AQIA 3IUCA 3OS2A 3MN5A 3RR7A 3A5MC 1LCUA 4IBNA 3TI0A 2Q0RA 3QETA 4X64K 1EX4A 4N76A 4AF1A 2FXUA 2KW4A 4JNEA 2WC9A 1OH6A 3TAEA 1C0MA 1T03A 2QW9A 1XWLA 4BACA 3LDNA 1RDBA 1SL2A 2UU9K 2PY5A 2HNYA 3L3VA 4LF7K 1WSGA 4QS9A 3DM2A 2ZM6K 1BCOA 3SJJA 1TKXA 4MDAA 1QSYA 4KHNA 4CERA 4BE1A 3AO4A 4NLBA 2NRXA 3SQ2A 3D2EB 4BR9A 1S1XA 2QM1A 3NVKA 4CZKA 4IEEA 5CZ2A 4ELTA 5GADP 1ZBFA 3CERA 4CEAA 1NNEA 2A41A 1NK9A 3F9KA 4BQZA 1YIJN 3L3UA 3AO3A 2E5LK 4JHDB 4H0YB 3P4IA 5I3UA 4KTQA 3CFPA 3KD5E 1X9MA 1I94K 5AQUA 1HQEA 4DS5A 1TV6A 2DPNA 3SUQA 1JL1A 2ETJA 3V9UA 3LAKA 4CZLA 1BI4A 5AQKA 4A62A 1NJZA 2B4JA 4CJSA 4JI7K 3SUPA 2P9UA 4CBUA 3CG7A 2QA4N 1KD1O 3G6EN 4FJHA 5AFUA 4BROA 3SYZA 2YNFA 4ID1A 3LP2A 4OKJA 2XRIA 3IAYA 3OHRA 2WBNA 2HHWA 2Z1GA 1ATSA 3HPGA 4DTXA 1NGJA 3NHGA 5DM6L 1DKGD 3TAGA 3FZFA 4FM1A 5I42A 1IG8A 5HRNA 3M5RA 1BI4B 4ID5A 1L5UA 3K5NA 2G8WA 2HHTA 4CZJA 4F9OA 3VQ6A 3FFIA 2PYJA 3OJUA 4CZGA 5CYMA 4DV2K 4KHSA 3I0RA 3V1OA 3NF9A 2GWJA 1GLFO 3ZX3A 1WOQA 4H8KA 4IKFA 5M1OA 3N4PA 3CQYA 3B8AX 1W2BM 4FCYA 2P9KA 3KK2A 4C8KA 3PUFA 1NKBA 1IH7A 4AM6A 4H03B 1GLAG 1QQMA 2HBMA 4GV3A 3HPOA 3KK7A 3JAMO 4BR5A 2UXCK 1C1BA 3SJHA 1QSLA 1EWRA 4JI6K 5LJVA 2WOMA 1LWEA 2IIRA 3I55N 1NGFA 2VGMA 2PAVA 1JLEA 1UOCA 3OYBA 1FKOA 5J2NA 3VERA 2QI2A 1RTJA 3W0LA 3EZ5A 1FK9A 1B9FA 3AVCA 4K25A 4UY8O 3VQAA 2BE2A 2KFNA 3FR0A 5EVZA 4OLAA 4DTRA 3ZT4A 3QERA 1HNIA 2D0OA 2I7PA 3SBTA 1XI1A 1C0GA 4JI4K 4CHZA 4DV5K 5KQDA 2Z1IA 2Q31A 3HI0A 1RILA 3WXMB 4B9QA 3DAWA 1K8AO 3RTVA 3LDPA 3SK3A 3V4IA 4O5FA 4CJFA 4FLYA 3HBTA 1IO2A 4BR4A 3WXIA 3CM6A 4NCGA 4WE1A 1NOYA 3C6HA 3VF2A 3BDPA 1FXXA 4JKHA 3EYZA 4A59A 1SL1A 4JKGA 1X9JA 4HCCA 1TUUA 2EWSA 4WFAL 3THYB 3PV8A 2DFFA 2G8IA 5F1XA 1HKGA 5JLHA 4NLCA 3MXMA 1YVNA 4OPKA 3IMXA 2HVIA 4XEIA 4BRLA 4JKAA 4CZMA 4CIFA 1SUQA 3CJ1A 5AQTA 4E7HA 2VYPA 3CD6N 2UUBK 4MLHA 3A5OC 3K58A 2E1ZA 4F2SA 4HVJA 2NRVA 1D5AA 1J6ZA 1NBWA 5AQXA 3R6MA 4XIUA 1VSHA 3MX2A 5K14A 4FWRA 3S3OA 2O8DB 4YNQA 5EY4A 3SQ1A 1IG9A 4B9TA 3ENOA 3B6OA 3VQ7A 1DTTA 2IDOA 3PSIA 1Z26A 1O1WA 1N5YA 3CI5A 4CI6A 4ELVA 4FW2A 3MEDA 4E7KA 4QCLA 4H5RA 1HQUA 2FSJA 1EO1A 1KVAA 5M1NA 3NCIA 3LDQA 1EWQA 1GOCA 2OPSA 3U9DA 4DS4A 4E7LA 1WUAA 3L8BA 3T69A 4KV8A 3CM5A 3H1VX 3G10A 3V81A 3TSUA 3MN7A 4WCEL 1YJ9N 3KKSA 4BE0A 3E9OA 4O55A 5AQRA 3CCSN 4M7XA 3I33A 3G25A 4RCHA 5KI6A 3ZSYA 1BQNA 4BC5A 4PKIA 4BRMA 3D0PA 4KHYA 3QEIA 2ZGZA 4PA1A 1OH5A 3ZCMA 4YOUA 4ISGA 4PQUA 5LL6Z 4BQLA 1VSEA 4CFBA 4FYDA 1VSJA 3S9HA 4PHTX 5T7BA 2A6AA 3HJFA 3EE9A 4KO0A 1KAZA 4OKEA 5FDLA 4OO1J 4YOTA 3QIPA 1ZBIA 3SNNA 1BA1A 4J8FA 5HRSA 4DV1K 3VMFB 2VQEK 1C1CA 3KWIA 5HROA 3H46O 2VQFK 5BPLA 2WUSA 3SUNA 4BRAA 4CECA 1M1KO 3AVFA 4WQ4C 1U04A 2YKMA 4JI8K 3UE5A 1NGBA 2Q0UA 3RSEA 1ILYA 4A57A 3SPYA 4W5OA 4CHPA 3WXLA 4N41A 4NCBA 1WSIA 5I9EB 1L3VA 1JL2A 3GG4A 3O9TA 4B9LA 4W5RA 3PY8A 5J2MA 3L0QA 3S3NA 4JLHA 3SQ4A 4JV5K 3DLKA 5FRNA 1NWKA 1ATRA 2FLOA 3WNEA 1Z6RA 5M1KA 2NRTA 4FM0A 4CEEA 1BDGA 3LP3A 3KZBA 4FWNA 3IFRA 3G71N 2QWQA 5KGXA 1LAVA 2G8FA 1RDDA 1KLMA 3P5JA 1D9DA 5BRDA 4N47A 4CJLA 3O9SA 4KB1A 3OYJA 1K8KA 4CF1A 3NVMA 4FJIA 4JRQA 2ZJPL 5GAGP 1IV0A 4B1WB 4CJ4A 1YF5L 4IOCL 3PIOL 4U67L 1WB9A 2A5XA 3THWA 3J7YP 1SV5A 3RRGA 3CCQN 5GINA 3DOKA 2IGIA 3NF6A 2B5JA 1MU2A 1Q9XA 3CHWA 4E1JA 3P31A 1OVQA 3FZLA 3OYEA 1TYQB 4DV3K 4O0JA 1MA9B 1ZBUA 3T3FA 3QNNA 4B1XB 2OTJN 4CEBA 3DJCA 4IEIA 1SKWA 2V7YA 5AR0A 4M7YA 5HRRA 4EZ6A 1I3AA 4DWIA 1YVUA 2CGLA 3WEEB 2P9IB 4MO4A 4KH6A 3SLCA 3F2KA 4IXCA 4CEQA 1GLLO 4CJRA 1SKSA 3L2QA 3VQ8A 3OYAA 3CQ8A 1S1UA 4CD3A 3OYIA 2RPIA 1TKDA 3P38A 2HBKA 3O1BA 3THVA 3ZSRA 1QE1A 2QWLA 3M8PA 3Q7BA 3VQDA 4OX9K 4CFCA 2QWNA 1GOBA 3A8YA 3HVRA 3VOVA 3I8BA 3AA3A 2W41A 4E1NA 1RTDA 3SCXA 3OA9A 3O80A 1D8YA 1J5OA 3VENA 4M3TA 5C15A 1LWCA 4CJEA 1ZC6A 3K5MA 3LDSA 4YY3K 5TKYA 3PO4A 2QXLA 3H45C 4KTZA 1YAGA 3E9LA 4FL9A 3OYLA 4CHOA 2P9NA 3H1QA 4FJNA 2F4VK 4HUFA 3TAFA 1RT6A 5AQHA 4WFNL 4BDZA 1O13A 5BREA 1RBVA 4JEPA 5JVGL 1JCEA 1CZ9A 3QEVA 4CGGA 3CF5L 4NYFA 2DTUA 3CXCM 3N4QA 1EKEA 4BDPA 1NK5A 4DV0K 2OZSA 1CZAN 5HBMA 1W7AA 4IG0A 4LD0A 2NRZA 4A2AA 4B9SA 2A3ZA 1BGXT 3K2PA 4C8MA 3KLEA 5AFUH 3T7ZA 5C25A 2D1KA 1YI2N 3HP9A 4DF8A 1QTMA 5E84A 3WXJA 1BA0A 1NGHA 2FF6A 4A2BA 3LAMA 4CZEA 3TTDA 3S41A 3KLFA 3AVJA 1VAZA 3ZSZA 1BO5O 4EP5A 1VRTA 3V1QA 1TGOA 4FOIA 1WSFA 2HHUA 1RT4A 1DGKN 4GMJB 3L2VA 3ULEA 3QDKA 3AVKA 1TVRA 4Y0WA 3AGRA 3TARA 1A5VA 1LW2A 3QLHA 3P1GA 3CMAN 1WNSA 3DLEA 3PLAA 1L3UA 4BRCA 3AO2A 2FC0A 5M1QA 1QVGM 2YJFA 3MDQA 1YITN 3AVNA 4BRKA 2AJQA 3VEOA 4LH5A 2NRHA 3CC4N 5AQFA 1HYSA 3EN9A 4I9LA 4RW4A 4Z0UA 4JHDA 4CJ7A 3HOTA 1VQ7N 2OTLN 4B3MK 5AQZA 1TUYA 1VQ4N 2NUBA 3HL8A 4LF4K 3HRGA 3ULEB 1VHXA 3TTFA 3R8EA 5JICA 1Q7YO 1TAQA 1NJWA 2D4WA 3PX0A 3C0BA 4W5QA 4OPHA 5AQOA 3UKUB 3LWLA 4ISEA 1RCHA 4LFBK 4BGBA 1D4XA 1T44A 4F3TA 2WFBA 1ZXOA 3B6PA 1JXEA 3TABA 1IKVA 2QEXN 1GLJO 1NOZA 3C65A 2YHWA 1RT1A 4DTOA 4DR3K 1N8RO 4CF9A 3NH1A 1WAJA 3VTHA 1YT3A 1KXPA 3KIOA 4H0TB 1XUPO 4GVEA 2DFHA 4EHUA 4Q5VA 4KHQA 4DSJA 4DF4A 2P5OA 1NGIA 1NLVA 3MXIA 2HF4A 3M8QA 5AQPA 1QS4A 4B1UB 5C12A 1BIZA 3QO9A 2D0PA 3U3YA 1HNVA 1JLCA 5AQJA 4CJWA 4J2DA 3W3DA 4WYBA 3VGKA 2LSNA 4ZTFA 3OYMA 2OPPA 3MXJA 4IG3A 4E3SA 2NRRA 3GE1A 4NCAA 4C23A 4C8OA 5FRMA 3UKRA 1Q18A 1WSJA 5C0YA 3E66A 3VEXA 1ZBSA 1UA1A 2O4IA 2XHBA 1KCFA 2H3GX 4BC3A 1TAUA 3V9XA 4OPJA 4H4MA 4WQ4A 4FK4A 4FLUA 4CJVA 1VSKA 1HJRA 4DU4A 2ZQBA 3E1YA 5CY4A 4CHYA 3OYDA 3L4QA 4M42A 4BRDA 4DTSA 4O4GA 1BU6O 3F9MA 3DLBA 3SZ2A 3LALA 4NXNK 3R3LA 3V9SA 4B3SK 5JS1A 3SQ0A 5AQLA 3O9UA 3RMDA 5AJ3K 3O5BA 1LAWA 3UKRB 4A5AA 2ITMA 3C6AA 1N33K 3CIPA 4FLZA 2O8BB 4FWKA 4KH4A 4CZIA 1T6CA 1U2VB 2BH1A 1HNZK 3IKMA 1Q81O 3VQ9A 2YI1A 3GBTA 1N34K 3WQUA 1F21A 2YJEA 1TL3A 4K42A 3KTQA 1VQON 2E2OA 3FZKA 3ENBA 3DRRA 3VGLA 5HRPA 1N32K 1OH8A 1VK0A 4RW6A 4MFBA 2JWKA 4IOXA 4CJPA 1VSIA 1EP4A 3M1FA 4QS7A 5BPMA 2OANA 4B3OA 4FJ5A 3VA0A 4Z4HA 4I7FA 3V9ZA 2O8FA 3IDHA 4IDKA 3LDLA 4EZ9A 1RDCA 1Y64A 5AZIA 4HTLA 3MMVA 4JI2K 4KFBA 2ZJRL 1XQSC 4Z4EA 4C1NI 3BEXA 4F8RA 3THYA 3BF1A 3AVIA 2ZGYA 5KGWA 3KLHA 4IFEA 3ULDA 5KQ8A 1S72N 1JKHA 3PIPL 4IOAL 5J1EA 3EY1A 1NK6A 3AO1A 1E3MA 5E41A 4DLEA 4I2PA 4CK3A 4YOWA 3Q7CA 3S3MA 3QB0A 3QFUA 1S1WA 2QWMA 3QBXA 3T19A 4CGJA 2O8FB 1JLBA 1M90O 5MLCQ 4H0VB 5AZIB 5SZTA 1X3MA 3LANA 4H5WA 4U7BA 3GL1A 2V51B 1HYVA 2D0CA 1HPMA 4AHCA 1NK8A 2O8DA 1A5WA 3V1RA 4OPAA 1NG9A 5ADXA 1BUPA 2F8SA 4PWDA 3HZ6A 4KHPK 4GV6A 1C0TA 4YORA 1VQLN 4BR2A 4DSLA 4M41A 3OTOK 2RHKA 4JK8A 1FW6A 3AARA 1GLEG 3OYKA 5C2FA 3OY9A 1S22A 1KQSM 4CGDA 2BTFA 3K5OA 1TK8A 3CCJN 4JYAK 4DTPA 1OVYA 4JI5K 1JXBA 2PFUA 4WQ5A 3VQEA 5KPTA 3ISNC 1YHQN 3NFAA 3D7EO 3K9JA 4DUYK 5CR4A 1LW0A 2P9LB 1T05A 4Q0BA 3ZT0A 2BDPA 3ZSVA 4N5SA 2G8VA 1GLBG 1WSEA 1E4FT 1VQ5N 4GKKK 3ZSOA 4JK7A 5BPNA 3GOIA 1LV5A 1SL0A 3RMCA 2HMPA 3FLCO 1WLJA 3R1XA 4QAGA 2IOCA 4BR0A 1HNWK 3ALYA 4IWVA 2IC3A 1NMNA 1LWFA 1NU0A 3L4IA 3HYFA 3QESA 2UUAK 3NMUA 4G9ZA 4I9QA 3VQQA 4BG8A 1VSDA 1RBRA 4JKFA 3DLHA 1REVA 2E20A 1YUWA 5C2DA 3HP6A 2GBZA 1VQKN 2E2NA 4NO7A 4B3RK 2IVOA 2KKZA 3MCAB 3EKUA 2KLAA 3P83D 2XO7A 4JI1K 1X9SA 1RDAA 3O4WA 1HUXA 4ILJA 2F8TA 4OGCA 2JLEA 4FZZA 3DWLA 3JS6A 4BVOA 3TAQA 4UQGA 3WNHA 3WQTA 4DFKA 3TANA 4H5TA 4CJ5A 2GX9A 4LFCK 3C6TA 3VQPA 4B08A 2A40A 3F5TA 5BR9A 3VF6A 3HM8A 3JXUA 4DFPA 3EEQA 3I56N 4AHTA 4WF9L 5TKWA 2XY5A 4KI4A 3MWTA 2HSTA 2E6MA 4CZHA 3ID6A 3NE6A 4PUOA 1RTIA 2VG6A 4LY7A 4E19A 1RNHA 4OGEA 3QNOA 2ASMA 2DY4A 3WT0A 3F73A 2GUIA 3KD1E 4KAZA 4CEDA 3SPZA 3ZSXA 3ENHA 4FOEA 4FK0A 4DR4K 2KQ2A 3VQ5A 3O4NA 3LPTA 4JI3K 5J2QA 4DFMA 1TK5A 2P9SB 1KAYA 4H0XB 4FWSA 3VEVA 2Q2RA 4DTUA 4DTMA 3J8AA 2QXFA 2RKIA 2ASPA 4HUEA 3IG1A 4BRQA 3MEGA 4K0KK 4CFAA 1ESVA 4CIEA 3CCVN 1NKCA 3MWPA 4GV9A 1TYQA 4JRPA 3TR8A 3KWGA 4RWTA 2UYTA 2O8EB 1RGIA 3DXKB 1KC8O 3J7ZO 2HMIA 3ATVA 5JVHL 3NGYA 3CYMA 3BY5A 3U6FA 2G8HA 4CBXA 4AQYK 4IFYA 3DOLA 4DR6K 2HW3A 1QSSA 4YFUA 3WEEA 3SV4A 2P9IA 1VQPN 3QICA 5DM7L 1QQCA 2E2PA 4DSKA 2GTDA 4BWMA 2X6SA 1RDUA 3EE8A 3SAFA 4DU1A 4CJUA 5C10A 4NXMK 4KBOA 3LZIA 1YJWN 1I39A 2YHYA 3OBWA 2YHBA 2F9TA 3DLRA 3KLIA 1RBSA 4CGHA 3E9PA 4AHVA 4L8RB 5F0XA 4FW1A 1GLCG 2KHOA 3VEZA 2UXDK 4FWPA 1CZBA 5KRSA 3V9WA 4X65K 4KHWA 1CLQA 5JMVA 1JJ2M 1E4GT 3I8DA 1NJYA 4Z4FA 1DLOA 1GOAA 2FSKA 1XHXA 4RG8A 4LF8K 3JSMA 1S6QA 4JK9A 4J2BA 1XMOK 3ZETA 4CEZA 1J5EK 5DMRA 4KRFA 3DLGA 1S1VA 2J4RA 1G15A 4K8ZA 1Y97A 3KK1A 4AH9A 2IS3A 3QFPA 3K5LA 4F3OA 2V7ZA 2PBDA 5BRHA 2HVHA 4FWMA 3NH0A 3E01A 2NNWA 3ASMA 3J7AP 3KKRA 1KVBA 3LDOA 2W42A 3OYFA 2VG5A 4CF0A 1YTAA 4DSIA 3G4SN 3ZETB 2QKKA 4CZFA 3VESA 4F2RA 2W6LA 4FLXA 5CYQA 3O08A 1NGGA 4HTUA 4WQ5C 4CEOA 2NRWA 4G1QA 4AILC 1OKJA 2DFEA 3MN9A 1WAFA 3O4QA 4LSLA 2BUPA 2HBJA 5KPZA 3PSFA 3NF8A 4R79A 1NKEA 3O9QA 3DXMA 3MK6A 4OJRA 1KFSA 1IBMK 2P9PB 1Q8IA 4XH4A 5AQSA 1BWFO 4CGIA 2OA8A 4KREA 2RE2A 5DK5A 4HHTA 4K43A 1XC9A 4M45A 5M1FA 4M3XA 3LZJA 2O8CB 1NGCA 3HTVA 1IKXA 1Z25A 1BCMA 3NAEA 3VN5A 3WNFA 3AY9A 1ASUA 4PL8A 2YKNA 5EOYA 4M3YA 4GW6A 4BC4A 3K59A 2VG7A 1U49A 5FPNA 3QIOA 3K0SA 3DXMB 1T6DA 4NB4A 3U8XA 1B9DA 4FWLA 2FBXA 1S9GA 2PZSA 1XMQK 4FZXC 3QEPA 4JKDA 5AQQA 2CGJA 4DUZK 4ZHRA 4B9UA 2OPQA 2WONA 4Y1CA 1RT7A 2P51A 4CBWA 2HHHK 3DYAA 3LWMA 4Z4CA 3THXB 2UXBK 3JYTA 4CJQA 4DQ8A 3HK2A 4M3WA 3GDQA 4BY9C 2NLXA 2HHXA 3UKUA 3ZSWA 1XC3A 2HNZA 3OYNA 1SS6A 3RWUA 1VRUA 1RT2A 1JCFA 4H0OA 2E6LA 1HMVA 1HNXK 4B8CA 3CJAA 1VSLA 4LF9K 2BANA 4FO0A 3WUHA 4GVMA 3HT3A 4GKJK 5M1PA 5HOOA 3KK3A 4CE9A 3V6DA 3CMEN 4IO8A 3M8SA 5HP1A 3SAGA 1WSHA 5AQVA 4DR2K 1C1AA 4DQIA 3MECA 4H4OA 4J2AA 5KPRA 1D9FA 3CJCA 2D0AA 2ZJQL 4Y1DA 4KI6A 4DU3A 1NK4A 2OCEA 4Z4GA 4E0DA 3M3ZA 3NH2A 3R9PA 3SAHA 4E7JA 5CZ1A 1IBKK 1TKZA 4H5VA 3AAPA 4CW7B 2V52B 1FKPA 1TK0A 1T3VA 2ASOA 5GAEP 3T1YK 1LOTB 4KH5A 2FBYA 4B1YB 4HUGA 3AVBA 3IRXA 1QQNA 4IZ9A 4CHNA 4HCBA 3DI6A 5AZJB 3M6GA 3MAQA 3UB5A 4BRIA 1UAXA 2P1JA 2XY8A 3VETA 2YX6A 4XH5A 1XNRK 4M3ZA 3H08A 1IKWA 1WN7A 3QEWA 4CGFA 3NGIA 3CCEN 1HR0K 2GUPA 5ADXH 2QWRA 1NJIO 2HF3A 2E2QA 1Q9YA 3VQBA 3FE1A 2CGKA 4A5BA 3QINA 2O8BA 1IJJA 1RDWX 1VQMN 1X9WA 4DV4K 1U2VA 2QTDA 4M3UA 4AM7A 4FSVA 4KB0A 1BG3A 2A1SA 3LM9A 4I6MA 4BWJA 3SV3A 3TSPA 4C8LA 2VGNA 2YHAA 3O6WA 2P5GA 3OYGA 1JLQA 4RTFD 3AVMA 3OS1A 1XNQK 4EHTA 1BQMA 3SUOA 4FJGA 4JAXA 3HSCA 1BL3A 3O3FA 1ZYQA 4C1NK 3RMBA 2GEMA 3SI6A 4OVLA 4H5NA 3RVCA 3HVTA 2HHQA 1KSPA 4HWIA 3ZLJA 4CK2A 3CFOA 3OYHA 2P9UB 3D6RA 2KZZA 3HM9A 5FPMA 3KVGA 3OW2M 4BRNA 4YDUC 4I6MB 1T7PA 1R59O 5LMUK 1RBTA 4EFHA 3HPHA 4FZYA 1TL1A 5J2PA 3EL2A 1FJGK 2R7YA 1KVCA 2G8KA 1UWBA 3K9KA 5GIOA 3CCMN 3AO5A 3T1AA 1P8ZA 2QK9A 4YHHK 2KFZA 4FPBA 1KTQA 4GY2B 1YXQA 4BVPA 4LH4A 4ELUA 3LM2A 2KZMA 3AVGA 5IT9O 3ATUA 3SMPA 3WNGA 5AQNA 2KTQA 3NGZA 3A0IX 3HOSA 4DV7K 1L3TA 3FGUA 1HYZA 4JKEA 2YNIA 4RW7A 4OLBA 5EXWA 4BRGA 2YCHA 2QWPA 3C94A 3ZEUA 5LMNK 2P9KB 3OBYA 4CF2A 3MCPA 4DTNA 4B9MA 3BZCA 4FJXA 1BIUA 3BUZB 3AVHA 4C8NA 2OPRA 3TPQA 2FSNA 3D45A 4DHYA 1SZ2A 4CHQA 3PX6A 4FJLA 1L3SA 3RR8A 4CFDA 3MEEA 3DRPA 2OZMA 1HPZA 4CK1A 2RF2A 2AA4A 1IBLK 1VSMA 5EX5A 2A42A 4FM2A 4JD2A 3H6EA 2E1YA 3CFRA 3PX4A 2P9LA 1X1PA 4FJ8A 4DQQA 3BZKA 3CPWM
chains in the Genus database with same CATH topology
5I3UA 4KTQA 3PO4A 3CFPA 3KD5E 4FK0A 4KTZA 1X9MA 1IKYA 2GV9A 2FBVA 3OYLA 3NDKA 2KQ2A 1HQEA 4CHOA 3VQ5A 4DS5A 3LP1A 1TV6A 3O4NA 2HNDA 4CJTA 3SUQA 2VWJA 1JL1A 4MQ3A 2ETJA 3LPTA 3V9UA 3LAKA 1T8EA 5J2QA 1BI4A 4FJNA 4HUFA 4DFMA 3TAFA 1TK5A 4CEFA 1JLGA 3L2UA 1RT6A 1NJZA 1CXQA 4BDZA 2B4JA 1C0UA 1RBVA 4CJSA 4DTUA 2HHVA 4RW8A 3SUPA 3O3GA 3CG7A 4DTMA 1CZ9A 2QXFA 4CGGA 3QEVA 2DTUA 4NYFA 2RKIA 4HUEA 3IG1A 1EKEA 4BDPA 1NK5A 4FJHA 4K8XA 2OZSA 3MEGA 5HBMA 1U47A 4DG1A 4CFAA 4CIEA 4IG0A 4LD0A 2YNFA 4ID1A 3SYZA 3LP2A 1NKCA 1J54A 4AHUA 4B9SA 4OKJA 2XRIA 3IAYA 3NF7A 4JRPA 4FJ9A 3TR8A 1BGXT 3K2PA 4C8MA 3KLEA 1ASVA 2HHWA 2Z1GA 3HPGA 4DTXA 2HMIA 4PY5A 3NHGA 5C25A 4FLWA 1TKTA 3TAGA 3NGYA 3CYMA 4FM1A 3HP9A 4DF8A 5I42A 1QTMA 3U6FA 1JLAA 5HRNA 3OJSA 2G8HA 1BI4B 4ID5A 3LAMA 3DOLA 4IFYA 1L5UA 1W9HA 3K5NA 3KLFA 4YFUA 1QSSA 3AVJA 4FLVA 3SV4A 2G8WA 2HHTA 3ZSZA 4EP5A 2ITGA 4KREA 1VRTA 1S6PA 2YNHA 3FFIA 3V1QA 1QQCA 3VQ6A 2PYJA 1TGOA 5C24A 3LP0A 1WSFA 5CYMA 3I0RA 3V1OA 3OJUA 4KHSA 4DSKA 2HHUA 1VSFA 4BWMA 1RT4A 2X6SA 3NF9A 4H8KA 4IKFA 4GMJB 2I5JA 4TSXA 3L2VA 4DU1A 4CJUA 2HHSA 4FCYA 5KTQA 3KK2A 3LZIA 3AVKA 1I39A 1TVRA 2YHBA 1CXUA 3PUFA 3DLRA 3KLIA 3NBPA 1RBSA 1NKBA 3VA3A 4C8KA 4NYNA 1IH7A 3HXMA 4CGHA 4CJ3A 4AHVA 3TARA 1A5VA 1LW2A 4L8RB 3I0SA 3QLHA 4FW1A 2HW3A 4CIGA 3RMAA 3P1GA 3UIQA 3HPOA 1CZBA 3L2RA 5KRSA 1WNSA 3V9WA 4KHWA 3DLEA 1CLQA 1L3UA 3I8DA 4O0IA 1NJYA 1C1BA 1EXQA 3AO2A 2FC0A 1DLOA 1GOAA 1QSLA 4Z4FA 2VWKA 1XHXA 4RG8A 2WOMA 2F96A 1LWEA 3JSMA 1S6QA 4FJ7A 3AVNA 1SKRA 2AJQA 4J2BA 4LH5A 4CEZA 4AHRA 1HYSA 5DMRA 1JLEA 1UOCA 4KRFA 4I9LA 4RW4A 4Z0UA 3OYBA 1FKOA 5J2NA 3OVNA 3DLGA 1BISA 1S1VA 1G15A 1RTJA 4CESA 2E4LA 2NUBA 3HL8A 4K8ZA 4IFVA 3KJVA 5JS2A 3L2WA 3EZ5A 1Y97A 4Z4IA 3KK1A 3DMJA 4FLTA 4AH9A 1TAQA 2Y1JA 1NJWA 2IS3A 1FK9A 1B9FA 3K5LA 3AVCA 5HLFA 4F3OA 3PX0A 3VQAA 2BE2A 2KFNA 4OLAA 4W5QA 4DTRA 1KLNA 3ZT4A 2D5RA 1HNIA 3QERA 1XI1A 2HVHA 3LWLA 4CHZA 4FJMA 3NH0A 2Z1IA 4Q0BA 1RCHA 1ZBHA 5EU7A 3E01A 1RILA 3ASMA 4F3TA 5C42A 3KKRA 3RTVA 1KVBA 3B6PA 2PY5A 2W42A 4I2QA 1JXEA 3V4IA 3TABA 3OYFA 2VG5A 1IKVA 4CJFA 4CF0A 1IO2A 1YTAA 4FLYA 3OS0A 4DSIA 1NOZA 1RT1A 4DTOA 2QKKA 1ASWA 3CM6A 4CF9A 4QOZB 3NH1A 1WAJA 2B6AA 1YT3A 2Y1IA 4F2RA 3KIOA 4NCGA 4FLXA 5CYQA 1RT3A 1UA0A 4CCHA 4WE1A 4HTUA 1NOYA 2DFHA 4CEOA 4Q5VA 4G1QA 4AILC 4KHQA 3DRSA 4DSJA 4DF4A 3BDPA 2P5OA 2DFEA 1FXXA 3MXIA 3M8QA 1WAFA 1QS4A 3O4QA 4LSLA 3EYZA 4ICLA 1SL1A 1BIZA 1K6YA 3A2FA 4HCCA 3QO9A 3U3YA 3PV8A 1HNVA 2FBTA 2DFFA 1JLCA 3NF8A 2G8IA 3C95A 1NKEA 4CJWA 2X6NA 1NK0A 4J2DA 4OJRA 1C6VA 3ZT2A 3MXMA 1KFSA 2LSNA 4ZTFA 3OYMA 4OPKA 3K57A 1RBUA 2HVIA 2OPPA 2Q3SA 1Q8IA 3MXJA 4IG3A 4E3SA 1W0HA 1N6QA 4B8AB 4CGIA 2OA8A 4NCAA 5FRMA 5DK5A 4CIFA 4HHTA 4C8OA 1XC9A 1SUQA 1WSJA 1U48A 4M45A 1UA1A 4E7HA 1ZBLA 4FJJA 4M3XA 2O4IA 3LZJA 2XHBA 1KCFA 1TAUA 3V9XA 1IKXA 4OPJA 4H4MA 1Z25A 1BCMA 3K58A 3NAEA 1RTHA 4LSNA 4FK4A 3VN5A 3WNFA 4FLUA 4F2SA 4HVJA 1ASUA 1D5AA 2YKNA 4CJVA 4XIUA 1VSKA 4KAZA 1NJXA 4M3YA 1HJRA 2OYQA 1VSHA 4GW6A 2IAJA 2ZQBA 5CY4A 5K14A 4CHYA 3BGRA 3OYDA 4DU4A 3S3OA 4M3RA 3K59A 2VG7A 4M42A 4YNQA 2O4GA 1U49A 4DTSA 3SQ1A 1IG9A 3QIOA 4OKKA 4O4GA 4B9TA 3B6OA 4DSEA 3VQ7A 3DLBA 1J53A 1DTTA 2IDOA 3LALA 1Z26A 1O1WA 1B9DA 3SZ2A 3V9SA 1N5YA 2QKBA 4ELVA 4FW2A 3SQ0A 1S9EA 4B9VA 2FBXA 3MEDA 4R5PA 1S9GA 2X78A 5JS1A 2PZSA 4FK2A 4FZXC 3QEPA 3RMDA 1LAWA 4ZHRA 4B9UA 2OPQA 2WONA 4Y1CA 1RT7A 2P51A 4E7KA 4QCLA 2X74A 3DYAA 4DQRA 1HRHA 2XY7A 1S5JA 1HQUA 3LWMA 4Z4CA 4FLZA 2BGGA 1KVAA 3JYTA 4CJQA 3HK2A 4M3WA 4CJKA 3NCIA 2A1RA 3AVLA 1S1TA 4KPYA 1GOCA 2OPSA 2HHXA 3IS9A 3ZSWA 4E89A 4DS4A 2HNZA 3OYNA 4E7LA 3VQ9A 3RWUA 1VRUA 4DFJA 1RT2A 3L8BA 1F21A 4CF8A 1TL3A 1RT5A 3KTQA 4E7IA 2E6LA 1HMVA 4B8CA 3DRRA 4KV8A 3CM5A 5HRPA 3G10A 3V81A 1VSLA 1VK0A 3KKSA 4RW6A 2BANA 4MFBA 4BE0A 4CJPA 4GVMA 3HT3A 4JS5A 1VSIA 1EP4A 4DSFA 4B3OA 3KK3A 4CE9A 3VA0A 3V6DA 4FJ5A 4J2EA 4O55A 4Z4HA 4I7FA 4DMNA 3OYCA 3V9ZA 3M8SA 5D3GA 4IDKA 4EZ9A 1RDCA 5HP1A 1WSHA 4FXDA 5KI6A 1C1AA 4DQIA 3MECA 5FROA 1BQNA 3ZSYA 4H4OA 4KFBA 4J2AA 1D9FA 4Z4EA 3D0PA 2D0AA 4DTJA 3G0ZA 4Y1DA 4F8RA 4KI6A 3VQ4A 4DU3A 3ZT1A 2PYLA 4KHYA 1NK4A 3AVIA 3QEIA 4PA1A 5KGWA 4Z4GA 4E0DA 3ZCMA 3KLHA 4ZTJA 4N56A 4DQPA 4PQUA 3ULDA 1VSEA 3NH2A 4CFBA 4FYDA 4E7JA 5CZ1A 1VSJA 3S9HA 1TKZA 5T7BA 1JKHA 3HJFA 5J1EA 3EY1A 1NK6A 3AO1A 4KO0A 4OKEA 1JLFA 5FDLA 5E41A 4DLEA 3QIPA 4I2PA 4CK3A 1R0AA 1QHTA 1FKPA 1TK0A 3S3MA 1ZBIA 3SNNA 3O3HA 2EX3A 5HRSA 1S1WA 2EHGA 3T19A 4CGJA 3ITHA 1JLBA 2FBYA 1C1CA 1A5XA 3AV9A 3LPUA 4AHSA 4HUGA 5HROA 3AVBA 5SZTA 3SUNA 3IRXA 3LANA 4CHNA 4CECA 4HCBA 3DI6A 3M8RA 2BDPA 3MAQA 1HYVA 2D0CA 3AA5X 3AVFA 1UAXA 2P1JA 1A5WA 2XY8A 4KKOA 4O44A 3V1RA 4AHCA 1NK7A 1NK8A 1U04A 4KHUA 2YKMA 3RRHA 4M3ZA 3H08A 3TAPA 1IKWA 2F8SA 4PWDA 4W5TA 3AA4A 1C0TA 3SPYA 1WN7A 4W5OA 3QEWA 4CGFA 1DTQA 3NGIA 4CHPA 4DSLA 4N41A 4M41A 4NCBA 1WSIA 5KRTA 1ITGA 1KRPA 1L3VA 3AVAA 5SWMA 1JL2A 4BDYA 3AA2A 4B9LA 4W5RA 1Q9YA 4W5NA 3VQBA 3KLGA 3PY8A 5J2MA 3QINA 3OYKA 3U3GA 2Z1HA 4E1MA 3OY9A 1YTUA 4DQSA 2Z1JA 1U4BA 1X9WA 1U45A 2ZD1A 4JLHA 4CGDA 3S3NA 3QEXA 3SQ4A 3K5OA 3DLKA 1XHZA 1TK8A 5FRNA 4M3UA 4DTPA 2YV0X 4KB0A 1KFDA 1JXBA 3WNEA 2A1SA 4JS4A 3PO5A 4FJKA 4BWJA 3VQEA 4FM0A 2YNGA 3ISNC 4CEEA 3SV3A 4C8LA 3NFAA 2YHAA 4F4KA 3LP3A 1LW0A 2ZE2A 1T05A 2P5GA 3ZT0A 2RN2A 1JLQA 1LAVA 3VQCA 5KGXA 3ZSVA 3AVMA 3OYGA 2G8FA 3OS1A 1RDDA 1KLMA 3P5JA 4N5SA 1BQMA 1D9DA 2G8VA 1B92A 4N47A 4CJLA 1WSEA 3SUOA 4KB1A 4FJGA 4DLGA 1BL3A 3C6UA 3OYJA 3O3FA 2D0BA 1ZYQA 3ZSOA 3RMBA 4CF1A 4FJIA 4JRQA 1LV5A 1SL0A 3RMCA 3SI6A 3TAMA 4OVLA 4BE2A 3HVTA 4CJ4A 2HHQA 1WLJA 1KSPA 4QAGA 4CK2A 2IOCA 3CFOA 3OYHA 2KZZA 3HSTB 1EETA 3ALYA 1SV5A 3RRGA 2ATQA 4KTWA 3HM9A 2XY6A 2IC3A 1LWFA 3DOKA 2IGIA 1T7PA 4FVMA 3TWHA 2HB5A 3NF6A 2B5JA 1MU2A 1Q9XA 3HYFA 4RW9A 1RBTA 1J9AA 4B9NA 2G8UA 3HPHA 3HO1A 3QESA 4FZYA 1TL1A 5J2PA 3OYEA 4I9QA 2R7YA 1KVCA 4O0JA 3VQQA 2G8KA 2JGUA 1VSDA 1ZBUA 1RBRA 3T3FA 3ZT3A 4EP4A 1UWBA 3QNNA 3AO5A 1REVA 3DLHA 4O5BA 3T1AA 3HP6A 2QK9A 2GBZA 2KFZA 1SKWA 1KTQA 4EZ6A 5HRRA 1I3AA 1BHLA 4DWIA 2XO7A 3P83D 1YVUA 4LH4A 3ZSQA 4ELUA 2KZMA 3AVGA 1X9SA 1RDAA 3OS2A 3WNGA 2KTQA 3NGZA 2F8TA 4OGCA 3RR7A 2JLEA 1L3TA 4CEQA 4FZZA 1HYZA 4CJRA 2YNIA 4IBNA 4RW7A 3TAQA 3TI0A 1SKSA 4OLBA 3QETA 1EX4A 4UQGA 3WNHA 3VQ8A 3OYAA 3L2QA 4N76A 4DFKA 2KW4A 3C94A 3CQ8A 3TAEA 3TANA 1C0MA 4CJ5A 1S1UA 3OYIA 1T03A 1XWLA 4BACA 1SL2A 1RDBA 2RPIA 3C6TA 1TKDA 2HNYA 3L3VA 4CF2A 1WSGA 3VQPA 4DTNA 3DM2A 1BCOA 3THVA 4B08A 4B9MA 4FJXA 1BIUA 3SJJA 1TKXA 3ZSRA 1QE1A 3AVHA 1QSYA 4C8NA 2OPRA 4CERA 3M8PA 4BE1A 4DFPA 3AO4A 4KHNA 4AHTA 3D45A 4CHQA 3PX6A 3VQDA 3SQ2A 4FJLA 2XY5A 1S1XA 4KI4A 1L3SA 3RR8A 4CFCA 4CFDA 3MEEA 2E6MA 3DRPA 5CZ2A 2OZMA 1GOBA 4ELTA 1HPZA 3HVRA 3NE6A 4CK1A 1RTIA 2RF2A 4PUOA 2VG6A 4LY7A 1ZBFA 3AA3A 1VSMA 4CEAA 1RNHA 4OGEA 4E19A 4E1NA 3QNOA 1RTDA 3SCXA 4FM2A 1NK9A 1D8YA 1J5OA 2DY4A 4M3TA 3F9KA 1LWCA 3CFRA 3F73A 2GUIA 4CJEA 3KD1E 3L3UA 3K5MA 3PX4A 3AO3A 4CEDA 1X1PA 3LDSA 4FJ8A 4DQQA 3SPZA 4CEBA 3ZSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I3U A;  4KTQ A;  3PO4 A;  3CFP A;  3KD5 E;  4FK0 A;  4KTZ A;  1X9M A;  1IKY A;  2GV9 A;  2FBV A;  3OYL A;  3NDK A;  2KQ2 A;  1HQE A;  4CHO A;  3VQ5 A;  4DS5 A;  3LP1 A;  1TV6 A;  3O4N A;  2HND A;  4CJT A;  3SUQ A;  2VWJ A;  1JL1 A;  4MQ3 A;  2ETJ A;  3LPT A;  3V9U A;  3LAK A;  1T8E A;  5J2Q A;  1BI4 A;  4FJN A;  4HUF A;  4DFM A;  3TAF A;  1TK5 A;  4CEF A;  1JLG A;  3L2U A;  1RT6 A;  1NJZ A;  1CXQ A;  4BDZ A;  2B4J A;  1C0U A;  1RBV A;  4CJS A;  4DTU A;  2HHV A;  4RW8 A;  3SUP A;  3O3G A;  3CG7 A;  4DTM A;  1CZ9 A;  2QXF A;  4CGG A;  3QEV A;  2DTU A;  4NYF A;  2RKI A;  4HUE A;  3IG1 A;  1EKE A;  4BDP A;  1NK5 A;  4FJH A;  4K8X A;  2OZS A;  3MEG A;  5HBM A;  1U47 A;  4DG1 A;  4CFA A;  4CIE A;  4IG0 A;  4LD0 A;  2YNF A;  4ID1 A;  3SYZ A;  3LP2 A;  1NKC A;  1J54 A;  4AHU A;  4B9S A;  4OKJ A;  2XRI A;  3IAY A;  3NF7 A;  4JRP A;  4FJ9 A;  3TR8 A;  1BGX T;  3K2P A;  4C8M A;  3KLE A;  1ASV A;  2HHW A;  2Z1G A;  3HPG A;  4DTX A;  2HMI A;  4PY5 A;  3NHG A;  5C25 A;  4FLW A;  1TKT A;  3TAG A;  3NGY A;  3CYM A;  4FM1 A;  3HP9 A;  4DF8 A;  5I42 A;  1QTM A;  3U6F A;  1JLA A;  5HRN A;  3OJS A;  2G8H A;  1BI4 B;  4ID5 A;  3LAM A;  3DOL A;  4IFY A;  1L5U A;  1W9H A;  3K5N A;  3KLF A;  4YFU A;  1QSS A;  3AVJ A;  4FLV A;  3SV4 A;  2G8W A;  2HHT A;  3ZSZ A;  4EP5 A;  2ITG A;  4KRE A;  1VRT A;  1S6P A;  2YNH A;  3FFI A;  3V1Q A;  1QQC A;  3VQ6 A;  2PYJ A;  1TGO A;  5C24 A;  3LP0 A;  1WSF A;  5CYM A;  3I0R A;  3V1O A;  3OJU A;  4KHS A;  4DSK A;  2HHU A;  1VSF A;  4BWM A;  1RT4 A;  2X6S A;  3NF9 A;  4H8K A;  4IKF A;  4GMJ B;  2I5J A;  4TSX A;  3L2V A;  4DU1 A;  4CJU A;  2HHS A;  4FCY A;  5KTQ A;  3KK2 A;  3LZI A;  3AVK A;  1I39 A;  1TVR A;  2YHB A;  1CXU A;  3PUF A;  3DLR A;  3KLI A;  3NBP A;  1RBS A;  1NKB A;  3VA3 A;  4C8K A;  4NYN A;  1IH7 A;  3HXM A;  4CGH A;  4CJ3 A;  4AHV A;  3TAR A;  1A5V A;  1LW2 A;  4L8R B;  3I0S A;  3QLH A;  4FW1 A;  2HW3 A;  4CIG A;  3RMA A;  3P1G A;  3UIQ A;  3HPO A;  1CZB A;  3L2R A;  5KRS A;  1WNS A;  3V9W A;  4KHW A;  3DLE A;  1CLQ A;  1L3U A;  3I8D A;  4O0I A;  1NJY A;  1C1B A;  1EXQ A;  3AO2 A;  2FC0 A;  1DLO A;  1GOA A;  1QSL A;  4Z4F A;  2VWK A;  1XHX A;  4RG8 A;  2WOM A;  2F96 A;  1LWE A;  3JSM A;  1S6Q A;  4FJ7 A;  3AVN A;  1SKR A;  2AJQ A;  4J2B A;  4LH5 A;  4CEZ A;  4AHR A;  1HYS A;  5DMR A;  1JLE A;  1UOC A;  4KRF A;  4I9L A;  4RW4 A;  4Z0U A;  3OYB A;  1FKO A;  5J2N A;  3OVN A;  3DLG A;  1BIS A;  1S1V A;  1G15 A;  1RTJ A;  4CES A;  2E4L A;  2NUB A;  3HL8 A;  4K8Z A;  4IFV A;  3KJV A;  5JS2 A;  3L2W A;  3EZ5 A;  1Y97 A;  4Z4I A;  3KK1 A;  3DMJ A;  4FLT A;  4AH9 A;  1TAQ A;  2Y1J A;  1NJW A;  2IS3 A;  1FK9 A;  1B9F A;  3K5L A;  3AVC A;  5HLF A;  4F3O A;  3PX0 A;  3VQA A;  2BE2 A;  2KFN A;  4OLA A;  4W5Q A;  4DTR A;  1KLN A;  3ZT4 A;  2D5R A;  1HNI A;  3QER A;  1XI1 A;  2HVH A;  3LWL A;  4CHZ A;  4FJM A;  3NH0 A;  2Z1I A;  4Q0B A;  1RCH A;  1ZBH A;  5EU7 A;  3E01 A;  1RIL A;  3ASM A;  4F3T A;  5C42 A;  3KKR A;  3RTV A;  1KVB A;  3B6P A;  2PY5 A;  2W42 A;  4I2Q A;  1JXE A;  3V4I A;  3TAB A;  3OYF A;  2VG5 A;  1IKV A;  4CJF A;  4CF0 A;  1IO2 A;  1YTA A;  4FLY A;  3OS0 A;  4DSI A;  1NOZ A;  1RT1 A;  4DTO A;  2QKK A;  1ASW A;  3CM6 A;  4CF9 A;  4QOZ B;  3NH1 A;  1WAJ A;  2B6A A;  1YT3 A;  2Y1I A;  4F2R A;  3KIO A;  4NCG A;  4FLX A;  5CYQ A;  1RT3 A;  1UA0 A;  4CCH A;  4WE1 A;  4HTU A;  1NOY A;  2DFH A;  4CEO A;  4Q5V A;  4G1Q A;  4AIL C;  4KHQ A;  3DRS A;  4DSJ A;  4DF4 A;  3BDP A;  2P5O A;  2DFE A;  1FXX A;  3MXI A;  3M8Q A;  1WAF A;  1QS4 A;  3O4Q A;  4LSL A;  3EYZ A;  4ICL A;  1SL1 A;  1BIZ A;  1K6Y A;  3A2F A;  4HCC A;  3QO9 A;  3U3Y A;  3PV8 A;  1HNV A;  2FBT A;  2DFF A;  1JLC A;  3NF8 A;  2G8I A;  3C95 A;  1NKE A;  4CJW A;  2X6N A;  1NK0 A;  4J2D A;  4OJR A;  1C6V A;  3ZT2 A;  3MXM A;  1KFS A;  2LSN A;  4ZTF A;  3OYM A;  4OPK A;  3K57 A;  1RBU A;  2HVI A;  2OPP A;  2Q3S A;  1Q8I A;  3MXJ A;  4IG3 A;  4E3S A;  1W0H A;  1N6Q A;  4B8A B;  4CGI A;  2OA8 A;  4NCA A;  5FRM A;  5DK5 A;  4CIF A;  4HHT A;  4C8O A;  1XC9 A;  1SUQ A;  1WSJ A;  1U48 A;  4M45 A;  1UA1 A;  4E7H A;  1ZBL A;  4FJJ A;  4M3X A;  2O4I A;  3LZJ A;  2XHB A;  1KCF A;  1TAU A;  3V9X A;  1IKX A;  4OPJ A;  4H4M A;  1Z25 A;  1BCM A;  3K58 A;  3NAE A;  1RTH A;  4LSN A;  4FK4 A;  3VN5 A;  3WNF A;  4FLU A;  4F2S A;  4HVJ A;  1ASU A;  1D5A A;  2YKN A;  4CJV A;  4XIU A;  1VSK A;  4KAZ A;  1NJX A;  4M3Y A;  1HJR A;  2OYQ A;  1VSH A;  4GW6 A;  2IAJ A;  2ZQB A;  5CY4 A;  5K14 A;  4CHY A;  3BGR A;  3OYD A;  4DU4 A;  3S3O A;  4M3R A;  3K59 A;  2VG7 A;  4M42 A;  4YNQ A;  2O4G A;  1U49 A;  4DTS A;  3SQ1 A;  1IG9 A;  3QIO A;  4OKK A;  4O4G A;  4B9T A;  3B6O A;  4DSE A;  3VQ7 A;  3DLB A;  1J53 A;  1DTT A;  2IDO A;  3LAL A;  1Z26 A;  1O1W A;  1B9D A;  3SZ2 A;  3V9S A;  1N5Y A;  2QKB A;  4ELV A;  4FW2 A;  3SQ0 A;  1S9E A;  4B9V A;  2FBX A;  3MED A;  4R5P A;  1S9G A;  2X78 A;  5JS1 A;  2PZS A;  4FK2 A;  4FZX C;  3QEP A;  3RMD A;  1LAW A;  4ZHR A;  4B9U A;  2OPQ A;  2WON A;  4Y1C A;  1RT7 A;  2P51 A;  4E7K A;  4QCL A;  2X74 A;  3DYA A;  4DQR A;  1HRH A;  2XY7 A;  1S5J A;  1HQU A;  3LWM A;  4Z4C A;  4FLZ A;  2BGG A;  1KVA A;  3JYT A;  4CJQ A;  3HK2 A;  4M3W A;  4CJK A;  3NCI A;  2A1R A;  3AVL A;  1S1T A;  4KPY A;  1GOC A;  2OPS A;  2HHX A;  3IS9 A;  3ZSW A;  4E89 A;  4DS4 A;  2HNZ A;  3OYN A;  4E7L A;  3VQ9 A;  3RWU A;  1VRU A;  4DFJ A;  1RT2 A;  3L8B A;  1F21 A;  4CF8 A;  1TL3 A;  1RT5 A;  3KTQ A;  4E7I A;  2E6L A;  1HMV A;  4B8C A;  3DRR A;  4KV8 A;  3CM5 A;  5HRP A;  3G10 A;  3V81 A;  1VSL A;  1VK0 A;  3KKS A;  4RW6 A;  2BAN A;  4MFB A;  4BE0 A;  4CJP A;  4GVM A;  3HT3 A;  4JS5 A;  1VSI A;  1EP4 A;  4DSF A;  4B3O A;  3KK3 A;  4CE9 A;  3VA0 A;  3V6D A;  4FJ5 A;  4J2E A;  4O55 A;  4Z4H A;  4I7F A;  4DMN A;  3OYC A;  3V9Z A;  3M8S A;  5D3G A;  4IDK A;  4EZ9 A;  1RDC A;  5HP1 A;  1WSH A;  4FXD A;  5KI6 A;  1C1A A;  4DQI A;  3MEC A;  5FRO A;  1BQN A;  3ZSY A;  4H4O A;  4KFB A;  4J2A A;  1D9F A;  4Z4E A;  3D0P A;  2D0A A;  4DTJ A;  3G0Z A;  4Y1D A;  4F8R A;  4KI6 A;  3VQ4 A;  4DU3 A;  3ZT1 A;  2PYL A;  4KHY A;  1NK4 A;  3AVI A;  3QEI A;  4PA1 A;  5KGW A;  4Z4G A;  4E0D A;  3ZCM A;  3KLH A;  4ZTJ A;  4N56 A;  4DQP A;  4PQU A;  3ULD A;  1VSE A;  3NH2 A;  4CFB A;  4FYD A;  4E7J A;  5CZ1 A;  1VSJ A;  3S9H A;  1TKZ A;  5T7B A;  1JKH A;  3HJF A;  5J1E A;  3EY1 A;  1NK6 A;  3AO1 A;  4KO0 A;  4OKE A;  1JLF A;  5FDL A;  5E41 A;  4DLE A;  3QIP A;  4I2P A;  4CK3 A;  1R0A A;  1QHT A;  1FKP A;  1TK0 A;  3S3M A;  1ZBI A;  3SNN A;  3O3H A;  2EX3 A;  5HRS A;  1S1W A;  2EHG A;  3T19 A;  4CGJ A;  3ITH A;  1JLB A;  2FBY A;  1C1C A;  1A5X A;  3AV9 A;  3LPU A;  4AHS A;  4HUG A;  5HRO A;  3AVB A;  5SZT A;  3SUN A;  3IRX A;  3LAN A;  4CHN A;  4CEC A;  4HCB A;  3DI6 A;  3M8R A;  2BDP A;  3MAQ A;  1HYV A;  2D0C A;  3AA5 X;  3AVF A;  1UAX A;  2P1J A;  1A5W A;  2XY8 A;  4KKO A;  4O44 A;  3V1R A;  4AHC A;  1NK7 A;  1NK8 A;  1U04 A;  4KHU A;  2YKM A;  3RRH A;  4M3Z A;  3H08 A;  3TAP A;  1IKW A;  2F8S A;  4PWD A;  4W5T A;  3AA4 A;  1C0T A;  3SPY A;  1WN7 A;  4W5O A;  3QEW A;  4CGF A;  1DTQ A;  3NGI A;  4CHP A;  4DSL A;  4N41 A;  4M41 A;  4NCB A;  1WSI A;  5KRT A;  1ITG A;  1KRP A;  1L3V A;  3AVA A;  5SWM A;  1JL2 A;  4BDY A;  3AA2 A;  4B9L A;  4W5R A;  1Q9Y A;  4W5N A;  3VQB A;  3KLG A;  3PY8 A;  5J2M A;  3QIN A;  3OYK A;  3U3G A;  2Z1H A;  4E1M A;  3OY9 A;  1YTU A;  4DQS A;  2Z1J A;  1U4B A;  1X9W A;  1U45 A;  2ZD1 A;  4JLH A;  4CGD A;  3S3N A;  3QEX A;  3SQ4 A;  3K5O A;  3DLK A;  1XHZ A;  1TK8 A;  5FRN A;  4M3U A;  4DTP A;  2YV0 X;  4KB0 A;  1KFD A;  1JXB A;  3WNE A;  2A1S A;  4JS4 A;  3PO5 A;  4FJK A;  4BWJ A;  3VQE A;  4FM0 A;  2YNG A;  3ISN C;  4CEE A;  3SV3 A;  4C8L A;  3NFA A;  2YHA A;  4F4K A;  3LP3 A;  1LW0 A;  2ZE2 A;  1T05 A;  2P5G A;  3ZT0 A;  2RN2 A;  1JLQ A;  1LAV A;  3VQC A;  5KGX A;  3ZSV A;  3AVM A;  3OYG A;  2G8F A;  3OS1 A;  1RDD A;  1KLM A;  3P5J A;  4N5S A;  1BQM A;  1D9D A;  2G8V A;  1B92 A;  4N47 A;  4CJL A;  1WSE A;  3SUO A;  4KB1 A;  4FJG A;  4DLG A;  1BL3 A;  3C6U A;  3OYJ A;  3O3F A;  2D0B A;  1ZYQ A;  3ZSO A;  3RMB A;  4CF1 A;  4FJI A;  4JRQ A;  1LV5 A;  1SL0 A;  3RMC A;  3SI6 A;  3TAM A;  4OVL A;  4BE2 A;  3HVT A;  4CJ4 A;  2HHQ A;  1WLJ A;  1KSP A;  4QAG A;  4CK2 A;  2IOC A;  3CFO A;  3OYH A;  2KZZ A;  3HST B;  1EET A;  3ALY A;  1SV5 A;  3RRG A;  2ATQ A;  4KTW A;  3HM9 A;  2XY6 A;  2IC3 A;  1LWF A;  3DOK A;  2IGI A;  1T7P A;  4FVM A;  3TWH A;  2HB5 A;  3NF6 A;  2B5J A;  1MU2 A;  1Q9X A;  3HYF A;  4RW9 A;  1RBT A;  1J9A A;  4B9N A;  2G8U A;  3HPH A;  3HO1 A;  3QES A;  4FZY A;  1TL1 A;  5J2P A;  3OYE A;  4I9Q A;  2R7Y A;  1KVC A;  4O0J A;  3VQQ A;  2G8K A;  2JGU A;  1VSD A;  1ZBU A;  1RBR A;  3T3F A;  3ZT3 A;  4EP4 A;  1UWB A;  3QNN A;  3AO5 A;  1REV A;  3DLH A;  4O5B A;  3T1A A;  3HP6 A;  2QK9 A;  2GBZ A;  2KFZ A;  1SKW A;  1KTQ A;  4EZ6 A;  5HRR A;  1I3A A;  1BHL A;  4DWI A;  2XO7 A;  3P83 D;  1YVU A;  4LH4 A;  3ZSQ A;  4ELU A;  2KZM A;  3AVG A;  1X9S A;  1RDA A;  3OS2 A;  3WNG A;  2KTQ A;  3NGZ A;  2F8T A;  4OGC A;  3RR7 A;  2JLE A;  1L3T A;  4CEQ A;  4FZZ A;  1HYZ A;  4CJR A;  2YNI A;  4IBN A;  4RW7 A;  3TAQ A;  3TI0 A;  1SKS A;  4OLB A;  3QET A;  1EX4 A;  4UQG A;  3WNH A;  3VQ8 A;  3OYA A;  3L2Q A;  4N76 A;  4DFK A;  2KW4 A;  3C94 A;  3CQ8 A;  3TAE A;  3TAN A;  1C0M A;  4CJ5 A;  1S1U A;  3OYI A;  1T03 A;  1XWL A;  4BAC A;  1SL2 A;  1RDB A;  2RPI A;  3C6T A;  1TKD A;  2HNY A;  3L3V A;  4CF2 A;  1WSG A;  3VQP A;  4DTN A;  3DM2 A;  1BCO A;  3THV A;  4B08 A;  4B9M A;  4FJX A;  1BIU A;  3SJJ A;  1TKX A;  3ZSR A;  1QE1 A;  3AVH A;  1QSY A;  4C8N A;  2OPR A;  4CER A;  3M8P A;  4BE1 A;  4DFP A;  3AO4 A;  4KHN A;  4AHT A;  3D45 A;  4CHQ A;  3PX6 A;  3VQD A;  3SQ2 A;  4FJL A;  2XY5 A;  1S1X A;  4KI4 A;  1L3S A;  3RR8 A;  4CFC A;  4CFD A;  3MEE A;  2E6M A;  3DRP A;  5CZ2 A;  2OZM A;  1GOB A;  4ELT A;  1HPZ A;  3HVR A;  3NE6 A;  4CK1 A;  1RTI A;  2RF2 A;  4PUO A;  2VG6 A;  4LY7 A;  1ZBF A;  3AA3 A;  1VSM A;  4CEA A;  1RNH A;  4OGE A;  4E19 A;  4E1N A;  3QNO A;  1RTD A;  3SCX A;  4FM2 A;  1NK9 A;  1D8Y A;  1J5O A;  2DY4 A;  4M3T A;  3F9K A;  1LWC A;  3CFR A;  3F73 A;  2GUI A;  4CJE A;  3KD1 E;  3L3U A;  3K5M A;  3PX4 A;  3AO3 A;  4CED A;  1X1P A;  3LDS A;  4FJ8 A;  4DQQ A;  3SPZ A;  4CEB A;  3ZSX A; 
#chains in the Genus database with same CATH topology
 1QQO A;  3H3N O;  4BG9 A;  3ZEU B;  4CD1 A;  4BC2 A;  1IKY A;  2GV9 A;  2FBV A;  3NDK A;  1K9M O;  1VQ6 N;  3LP1 A;  2HND A;  4CJT A;  1WBB A;  2VWJ A;  4MQ3 A;  1T8E A;  3ID8 A;  4CEF A;  1JLG A;  1HLU A;  3L2U A;  1CXQ A;  3AGK A;  1C0U A;  3CJ9 A;  2QWO A;  2HHV A;  4RW8 A;  3O3G A;  3EO3 A;  5AQY A;  3CJB A;  4IDH A;  4GNI A;  4K8X A;  3FFK B;  1U47 A;  4DG1 A;  4JD2 B;  2IVP A;  2ZWH A;  1J54 A;  4AHU A;  2AP1 A;  3AAQ A;  3NF7 A;  2IVN A;  4K41 A;  1ASV A;  5BN8 A;  3A5N C;  3U9Z A;  4PY5 A;  1OH7 A;  4JKC A;  3QML A;  4FLW A;  1TKT A;  4O8U A;  4H0P A;  5LJW A;  1Q82 O;  3ZYY X;  1JLA A;  2W6K A;  3OJS A;  4JKG B;  1W9H A;  4FLV A;  1QVF M;  2ITG A;  1S6P A;  2YNH A;  5C24 A;  3LP0 A;  1NGE A;  4DR5 K;  2WTU A;  3KHY A;  1VSF A;  3BP8 A;  3MX5 A;  4TSX A;  2I5J A;  3P39 A;  5AQM A;  2HHS A;  5KTQ A;  1CXU A;  2F9W A;  3NBP A;  1MWK A;  4JKB A;  3CPE A;  3VA3 A;  4NYN A;  3HXM A;  4CJ3 A;  5AQW A;  3QBW A;  4DCH A;  3I0S A;  4CIG A;  3RMA A;  3UIQ A;  1VQ8 N;  2Q97 A;  3LL3 A;  3L2R A;  1NGA A;  3WXK A;  4O0I A;  1EXQ A;  1WBD A;  4B1V A;  2VWK A;  2F96 A;  5CE3 A;  4FJ7 A;  1SKR A;  1W97 L;  4AHR A;  2VCP A;  1DEJ A;  4Z94 A;  1MDU B;  3OVN A;  1BIS A;  4CES A;  3VTI A;  2E4L A;  4IFV A;  3KJV A;  5JS2 A;  3L2W A;  4Z4I A;  5FPD A;  5HL7 L;  3DMJ A;  4FLT A;  2Y1J A;  4LFA K;  4BRE A;  4EAH D;  1C0F A;  5HLF A;  4WFB L;  3J80 O;  3H3O B;  1KLN A;  4IJA A;  2D5R A;  2P9S A;  4FJM A;  1ZBH A;  5EU7 A;  1N36 K;  3VF4 A;  5C42 A;  4B1Z A;  4I2Q A;  5JLF A;  4XH1 A;  3CC2 N;  4LF6 K;  3OS0 A;  4BRP A;  5A2Q O;  1X3N A;  1ASW A;  4QOZ B;  2B6A A;  2E88 A;  2Y1I A;  1UA0 A;  1RT3 A;  4CCH A;  2O8E A;  4PKH A;  1VQ9 N;  5FPE A;  1NMD A;  3DXK A;  3DRS A;  4JI0 K;  1G99 A;  1V4S A;  4ISF A;  5AQG A;  4L3Q A;  4ICL A;  2GWK A;  1K6Y A;  3A2F A;  3VPZ A;  3CJ7 A;  1VQN N;  2FBT A;  3C95 A;  2X6N A;  1NK0 A;  1GLD G;  5BRF A;  4DV6 K;  1C6V A;  3ZT2 A;  1KAX A;  2I7N A;  2GEL A;  3K57 A;  1RBU A;  4IJN A;  2Q3S A;  1N6Q A;  1W0H A;  4B8A B;  4FVU A;  2Q1N A;  1ZBL A;  4FJJ A;  5E26 A;  4ILH A;  1RTH A;  4LSN A;  4ILG B;  3VEW A;  4YOV A;  1NJX A;  2OYQ A;  2IAJ A;  1U48 A;  3TTC A;  3BGR A;  1QZ6 A;  4M3R A;  2O4G A;  4MO5 A;  5FLX O;  4OKK A;  3RSE B;  4DSE A;  3DLL L;  1J53 A;  3TSQ A;  3SMS A;  1QHA A;  2QKB A;  1S9E A;  4B9V A;  4R5P A;  2X78 A;  3BF3 A;  4FK2 A;  4BRH A;  4CVN E;  3MN6 A;  1NGD A;  2X74 A;  4DQR A;  1HRH A;  2XY7 A;  1S5J A;  3CCR N;  5GAH P;  3L6Q A;  3T1H K;  2BGG A;  1ATN A;  1P90 A;  4DR1 K;  2ZF5 O;  4CJK A;  4V19 S;  2A1R A;  3AVL A;  1S1T A;  3A5L C;  4M63 C;  4KPY A;  4X62 K;  3IS9 A;  4E89 A;  3CQX A;  4PL7 A;  4DFJ A;  1MWM A;  4CF8 A;  1RT5 A;  4E7I A;  4LC9 B;  3VGM A;  5GIP A;  4MLE A;  3SBG A;  4JS5 A;  4BR7 A;  4DSF A;  4A61 A;  4J2E A;  3CET A;  5BN9 A;  4DMN A;  3OYC A;  2CH5 A;  1K8K B;  5D3G A;  4FXD A;  4YDU A;  5FRO A;  2W40 A;  3VEY A;  2UUC K;  4DTJ A;  1RFQ A;  3G0Z A;  3VQ4 A;  3ZT1 A;  3THW B;  2PYL A;  5BR8 K;  4ZTJ A;  4N56 A;  4DQP A;  1SAZ A;  4EIA A;  4BRF A;  2P9P A;  3CCL N;  1U6Z A;  3O8M A;  1JLF A;  4DR7 K;  1R0A A;  1QHT A;  2VWB A;  2Q36 A;  3O3H A;  2EX3 A;  4QS8 A;  5H1S Q;  2O8C A;  1K73 O;  1HKC A;  5CHI A;  2EHG A;  2JWL A;  3ITH A;  3AV9 A;  1A5X A;  3FZH A;  3LPU A;  4AHS A;  4DKW A;  1HX1 A;  3FZM A;  1HKB A;  3U4L A;  3ZX2 A;  3M8R A;  1QZ5 A;  1Q86 O;  3CCU N;  3AA5 X;  1NK7 A;  4KKO A;  4O44 A;  4B3T K;  4KHU A;  3RRH A;  3TAP A;  4W5T A;  3AA4 A;  1V4T A;  2F7T A;  1DTQ A;  4LF5 K;  2E8A A;  2FF3 B;  5KRT A;  1ITG A;  1KRP A;  1JCG A;  4DB3 A;  3AVA A;  5SWM A;  1HJO A;  4BDY A;  3AA2 A;  4W5N A;  3KLG A;  3THX A;  3U3G A;  2Z1H A;  4E1M A;  1YTU A;  4FWO A;  4DQS A;  2Z1J A;  1S3X A;  1U4B A;  1U45 A;  2ZD1 A;  3QEX A;  3EKS A;  1XHZ A;  4O8K A;  4BGA A;  3CC7 N;  2YV0 X;  2CH6 A;  4YOX A;  1KFD A;  1Z05 A;  3TU5 A;  5B8H A;  4YOY A;  4JS4 A;  3PO5 A;  3J81 O;  3EZW A;  4FJK A;  2YNG A;  4F4K A;  1NM1 A;  4FPA A;  1EQY A;  4MDB A;  2ZE2 A;  4FJ9 A;  2RN2 A;  3VQC A;  1DT9 A;  4X66 K;  4FWQ A;  1B92 A;  4DLG A;  2P9N B;  4JN4 A;  3C6U A;  3D2F A;  2D0B A;  3C7N A;  3O9R A;  3TAM A;  4BE2 A;  5F2R A;  4IO9 L;  3ZX0 A;  3HST B;  1EET A;  2HBL A;  2ATQ A;  4KTW A;  2XY6 A;  2YHX A;  5IWA K;  2HOE A;  4FVM A;  1BOT O;  2HB5 A;  3TWH A;  5ELZ A;  4B9N A;  4RW9 A;  1J9A A;  2G8U A;  1SQK A;  2NZT A;  3HO1 A;  2JGU A;  3ZT3 A;  4EP4 A;  4PKG A;  3D2F B;  4O5B A;  3D2E A;  1H1V A;  1YJN N;  3C7N B;  3O1W A;  1BHL A;  3ZSQ A;  5AZJ A;  5LY3 A;  5AQI A;  3IUC A;  3OS2 A;  3MN5 A;  3RR7 A;  3A5M C;  1LCU A;  4IBN A;  3TI0 A;  2Q0R A;  3QET A;  4X64 K;  1EX4 A;  4N76 A;  4AF1 A;  2FXU A;  2KW4 A;  4JNE A;  2WC9 A;  1OH6 A;  3TAE A;  1C0M A;  1T03 A;  2QW9 A;  1XWL A;  4BAC A;  3LDN A;  1RDB A;  1SL2 A;  2UU9 K;  2PY5 A;  2HNY A;  3L3V A;  4LF7 K;  1WSG A;  4QS9 A;  3DM2 A;  2ZM6 K;  1BCO A;  3SJJ A;  1TKX A;  4MDA A;  1QSY A;  4KHN A;  4CER A;  4BE1 A;  3AO4 A;  4NLB A;  2NRX A;  3SQ2 A;  3D2E B;  4BR9 A;  1S1X A;  2QM1 A;  3NVK A;  4CZK A;  4IEE A;  5CZ2 A;  4ELT A;  5GAD P;  1ZBF A;  3CER A;  4CEA A;  1NNE A;  2A41 A;  1NK9 A;  3F9K A;  4BQZ A;  1YIJ N;  3L3U A;  3AO3 A;  2E5L K;  4JHD B;  4H0Y B;  3P4I A;  5I3U A;  4KTQ A;  3CFP A;  3KD5 E;  1X9M A;  1I94 K;  5AQU A;  1HQE A;  4DS5 A;  1TV6 A;  2DPN A;  3SUQ A;  1JL1 A;  2ETJ A;  3V9U A;  3LAK A;  4CZL A;  1BI4 A;  5AQK A;  4A62 A;  1NJZ A;  2B4J A;  4CJS A;  4JI7 K;  3SUP A;  2P9U A;  4CBU A;  3CG7 A;  2QA4 N;  1KD1 O;  3G6E N;  4FJH A;  5AFU A;  4BRO A;  3SYZ A;  2YNF A;  4ID1 A;  3LP2 A;  4OKJ A;  2XRI A;  3IAY A;  3OHR A;  2WBN A;  2HHW A;  2Z1G A;  1ATS A;  3HPG A;  4DTX A;  1NGJ A;  3NHG A;  5DM6 L;  1DKG D;  3TAG A;  3FZF A;  4FM1 A;  5I42 A;  1IG8 A;  5HRN A;  3M5R A;  1BI4 B;  4ID5 A;  1L5U A;  3K5N A;  2G8W A;  2HHT A;  4CZJ A;  4F9O A;  3VQ6 A;  3FFI A;  2PYJ A;  3OJU A;  4CZG A;  5CYM A;  4DV2 K;  4KHS A;  3I0R A;  3V1O A;  3NF9 A;  2GWJ A;  1GLF O;  3ZX3 A;  1WOQ A;  4H8K A;  4IKF A;  5M1O A;  3N4P A;  3CQY A;  3B8A X;  1W2B M;  4FCY A;  2P9K A;  3KK2 A;  4C8K A;  3PUF A;  1NKB A;  1IH7 A;  4AM6 A;  4H03 B;  1GLA G;  1QQM A;  2HBM A;  4GV3 A;  3HPO A;  3KK7 A;  3JAM O;  4BR5 A;  2UXC K;  1C1B A;  3SJH A;  1QSL A;  1EWR A;  4JI6 K;  5LJV A;  2WOM A;  1LWE A;  2IIR A;  3I55 N;  1NGF A;  2VGM A;  2PAV A;  1JLE A;  1UOC A;  3OYB A;  1FKO A;  5J2N A;  3VER A;  2QI2 A;  1RTJ A;  3W0L A;  3EZ5 A;  1FK9 A;  1B9F A;  3AVC A;  4K25 A;  4UY8 O;  3VQA A;  2BE2 A;  2KFN A;  3FR0 A;  5EVZ A;  4OLA A;  4DTR A;  3ZT4 A;  3QER A;  1HNI A;  2D0O A;  2I7P A;  3SBT A;  1XI1 A;  1C0G A;  4JI4 K;  4CHZ A;  4DV5 K;  5KQD A;  2Z1I A;  2Q31 A;  3HI0 A;  1RIL A;  3WXM B;  4B9Q A;  3DAW A;  1K8A O;  3RTV A;  3LDP A;  3SK3 A;  3V4I A;  4O5F A;  4CJF A;  4FLY A;  3HBT A;  1IO2 A;  4BR4 A;  3WXI A;  3CM6 A;  4NCG A;  4WE1 A;  1NOY A;  3C6H A;  3VF2 A;  3BDP A;  1FXX A;  4JKH A;  3EYZ A;  4A59 A;  1SL1 A;  4JKG A;  1X9J A;  4HCC A;  1TUU A;  2EWS A;  4WFA L;  3THY B;  3PV8 A;  2DFF A;  2G8I A;  5F1X A;  1HKG A;  5JLH A;  4NLC A;  3MXM A;  1YVN A;  4OPK A;  3IMX A;  2HVI A;  4XEI A;  4BRL A;  4JKA A;  4CZM A;  4CIF A;  1SUQ A;  3CJ1 A;  5AQT A;  4E7H A;  2VYP A;  3CD6 N;  2UUB K;  4MLH A;  3A5O C;  3K58 A;  2E1Z A;  4F2S A;  4HVJ A;  2NRV A;  1D5A A;  1J6Z A;  1NBW A;  5AQX A;  3R6M A;  4XIU A;  1VSH A;  3MX2 A;  5K14 A;  4FWR A;  3S3O A;  2O8D B;  4YNQ A;  5EY4 A;  3SQ1 A;  1IG9 A;  4B9T A;  3ENO A;  3B6O A;  3VQ7 A;  1DTT A;  2IDO A;  3PSI A;  1Z26 A;  1O1W A;  1N5Y A;  3CI5 A;  4CI6 A;  4ELV A;  4FW2 A;  3MED A;  4E7K A;  4QCL A;  4H5R A;  1HQU A;  2FSJ A;  1EO1 A;  1KVA A;  5M1N A;  3NCI A;  3LDQ A;  1EWQ A;  1GOC A;  2OPS A;  3U9D A;  4DS4 A;  4E7L A;  1WUA A;  3L8B A;  3T69 A;  4KV8 A;  3CM5 A;  3H1V X;  3G10 A;  3V81 A;  3TSU A;  3MN7 A;  4WCE L;  1YJ9 N;  3KKS A;  4BE0 A;  3E9O A;  4O55 A;  5AQR A;  3CCS N;  4M7X A;  3I33 A;  3G25 A;  4RCH A;  5KI6 A;  3ZSY A;  1BQN A;  4BC5 A;  4PKI A;  4BRM A;  3D0P A;  4KHY A;  3QEI A;  2ZGZ A;  4PA1 A;  1OH5 A;  3ZCM A;  4YOU A;  4ISG A;  4PQU A;  5LL6 Z;  4BQL A;  1VSE A;  4CFB A;  4FYD A;  1VSJ A;  3S9H A;  4PHT X;  5T7B A;  2A6A A;  3HJF A;  3EE9 A;  4KO0 A;  1KAZ A;  4OKE A;  5FDL A;  4OO1 J;  4YOT A;  3QIP A;  1ZBI A;  3SNN A;  1BA1 A;  4J8F A;  5HRS A;  4DV1 K;  3VMF B;  2VQE K;  1C1C A;  3KWI A;  5HRO A;  3H46 O;  2VQF K;  5BPL A;  2WUS A;  3SUN A;  4BRA A;  4CEC A;  1M1K O;  3AVF A;  4WQ4 C;  1U04 A;  2YKM A;  4JI8 K;  3UE5 A;  1NGB A;  2Q0U A;  3RSE A;  1ILY A;  4A57 A;  3SPY A;  4W5O A;  4CHP A;  3WXL A;  4N41 A;  4NCB A;  1WSI A;  5I9E B;  1L3V A;  1JL2 A;  3GG4 A;  3O9T A;  4B9L A;  4W5R A;  3PY8 A;  5J2M A;  3L0Q A;  3S3N A;  4JLH A;  3SQ4 A;  4JV5 K;  3DLK A;  5FRN A;  1NWK A;  1ATR A;  2FLO A;  3WNE A;  1Z6R A;  5M1K A;  2NRT A;  4FM0 A;  4CEE A;  1BDG A;  3LP3 A;  3KZB A;  4FWN A;  3IFR A;  3G71 N;  2QWQ A;  5KGX A;  1LAV A;  2G8F A;  1RDD A;  1KLM A;  3P5J A;  1D9D A;  5BRD A;  4N47 A;  4CJL A;  3O9S A;  4KB1 A;  3OYJ A;  1K8K A;  4CF1 A;  3NVM A;  4FJI A;  4JRQ A;  2ZJP L;  5GAG P;  1IV0 A;  4B1W B;  4CJ4 A;  1YF5 L;  4IOC L;  3PIO L;  4U67 L;  1WB9 A;  2A5X A;  3THW A;  3J7Y P;  1SV5 A;  3RRG A;  3CCQ N;  5GIN A;  3DOK A;  2IGI A;  3NF6 A;  2B5J A;  1MU2 A;  1Q9X A;  3CHW A;  4E1J A;  3P31 A;  1OVQ A;  3FZL A;  3OYE A;  1TYQ B;  4DV3 K;  4O0J A;  1MA9 B;  1ZBU A;  3T3F A;  3QNN A;  4B1X B;  2OTJ N;  4CEB A;  3DJC A;  4IEI A;  1SKW A;  2V7Y A;  5AR0 A;  4M7Y A;  5HRR A;  4EZ6 A;  1I3A A;  4DWI A;  1YVU A;  2CGL A;  3WEE B;  2P9I B;  4MO4 A;  4KH6 A;  3SLC A;  3F2K A;  4IXC A;  4CEQ A;  1GLL O;  4CJR A;  1SKS A;  3L2Q A;  3VQ8 A;  3OYA A;  3CQ8 A;  1S1U A;  4CD3 A;  3OYI A;  2RPI A;  1TKD A;  3P38 A;  2HBK A;  3O1B A;  3THV A;  3ZSR A;  1QE1 A;  2QWL A;  3M8P A;  3Q7B A;  3VQD A;  4OX9 K;  4CFC A;  2QWN A;  1GOB A;  3A8Y A;  3HVR A;  3VOV A;  3I8B A;  3AA3 A;  2W41 A;  4E1N A;  1RTD A;  3SCX A;  3OA9 A;  3O80 A;  1D8Y A;  1J5O A;  3VEN A;  4M3T A;  5C15 A;  1LWC A;  4CJE A;  1ZC6 A;  3K5M A;  3LDS A;  4YY3 K;  5TKY A;  3PO4 A;  2QXL A;  3H45 C;  4KTZ A;  1YAG A;  3E9L A;  4FL9 A;  3OYL A;  4CHO A;  2P9N A;  3H1Q A;  4FJN A;  2F4V K;  4HUF A;  3TAF A;  1RT6 A;  5AQH A;  4WFN L;  4BDZ A;  1O13 A;  5BRE A;  1RBV A;  4JEP A;  5JVG L;  1JCE A;  1CZ9 A;  3QEV A;  4CGG A;  3CF5 L;  4NYF A;  2DTU A;  3CXC M;  3N4Q A;  1EKE A;  4BDP A;  1NK5 A;  4DV0 K;  2OZS A;  1CZA N;  5HBM A;  1W7A A;  4IG0 A;  4LD0 A;  2NRZ A;  4A2A A;  4B9S A;  2A3Z A;  1BGX T;  3K2P A;  4C8M A;  3KLE A;  5AFU H;  3T7Z A;  5C25 A;  2D1K A;  1YI2 N;  3HP9 A;  4DF8 A;  1QTM A;  5E84 A;  3WXJ A;  1BA0 A;  1NGH A;  2FF6 A;  4A2B A;  3LAM A;  4CZE A;  3TTD A;  3S41 A;  3KLF A;  3AVJ A;  1VAZ A;  3ZSZ A;  1BO5 O;  4EP5 A;  1VRT A;  3V1Q A;  1TGO A;  4FOI A;  1WSF A;  2HHU A;  1RT4 A;  1DGK N;  4GMJ B;  3L2V A;  3ULE A;  3QDK A;  3AVK A;  1TVR A;  4Y0W A;  3AGR A;  3TAR A;  1A5V A;  1LW2 A;  3QLH A;  3P1G A;  3CMA N;  1WNS A;  3DLE A;  3PLA A;  1L3U A;  4BRC A;  3AO2 A;  2FC0 A;  5M1Q A;  1QVG M;  2YJF A;  3MDQ A;  1YIT N;  3AVN A;  4BRK A;  2AJQ A;  3VEO A;  4LH5 A;  2NRH A;  3CC4 N;  5AQF A;  1HYS A;  3EN9 A;  4I9L A;  4RW4 A;  4Z0U A;  4JHD A;  4CJ7 A;  3HOT A;  1VQ7 N;  2OTL N;  4B3M K;  5AQZ A;  1TUY A;  1VQ4 N;  2NUB A;  3HL8 A;  4LF4 K;  3HRG A;  3ULE B;  1VHX A;  3TTF A;  3R8E A;  5JIC A;  1Q7Y O;  1TAQ A;  1NJW A;  2D4W A;  3PX0 A;  3C0B A;  4W5Q A;  4OPH A;  5AQO A;  3UKU B;  3LWL A;  4ISE A;  1RCH A;  4LFB K;  4BGB A;  1D4X A;  1T44 A;  4F3T A;  2WFB A;  1ZXO A;  3B6P A;  1JXE A;  3TAB A;  1IKV A;  2QEX N;  1GLJ O;  1NOZ A;  3C65 A;  2YHW A;  1RT1 A;  4DTO A;  4DR3 K;  1N8R O;  4CF9 A;  3NH1 A;  1WAJ A;  3VTH A;  1YT3 A;  1KXP A;  3KIO A;  4H0T B;  1XUP O;  4GVE A;  2DFH A;  4EHU A;  4Q5V A;  4KHQ A;  4DSJ A;  4DF4 A;  2P5O A;  1NGI A;  1NLV A;  3MXI A;  2HF4 A;  3M8Q A;  5AQP A;  1QS4 A;  4B1U B;  5C12 A;  1BIZ A;  3QO9 A;  2D0P A;  3U3Y A;  1HNV A;  1JLC A;  5AQJ A;  4CJW A;  4J2D A;  3W3D A;  4WYB A;  3VGK A;  2LSN A;  4ZTF A;  3OYM A;  2OPP A;  3MXJ A;  4IG3 A;  4E3S A;  2NRR A;  3GE1 A;  4NCA A;  4C23 A;  4C8O A;  5FRM A;  3UKR A;  1Q18 A;  1WSJ A;  5C0Y A;  3E66 A;  3VEX A;  1ZBS A;  1UA1 A;  2O4I A;  2XHB A;  1KCF A;  2H3G X;  4BC3 A;  1TAU A;  3V9X A;  4OPJ A;  4H4M A;  4WQ4 A;  4FK4 A;  4FLU A;  4CJV A;  1VSK A;  1HJR A;  4DU4 A;  2ZQB A;  3E1Y A;  5CY4 A;  4CHY A;  3OYD A;  3L4Q A;  4M42 A;  4BRD A;  4DTS A;  4O4G A;  1BU6 O;  3F9M A;  3DLB A;  3SZ2 A;  3LAL A;  4NXN K;  3R3L A;  3V9S A;  4B3S K;  5JS1 A;  3SQ0 A;  5AQL A;  3O9U A;  3RMD A;  5AJ3 K;  3O5B A;  1LAW A;  3UKR B;  4A5A A;  2ITM A;  3C6A A;  1N33 K;  3CIP A;  4FLZ A;  2O8B B;  4FWK A;  4KH4 A;  4CZI A;  1T6C A;  1U2V B;  2BH1 A;  1HNZ K;  3IKM A;  1Q81 O;  3VQ9 A;  2YI1 A;  3GBT A;  1N34 K;  3WQU A;  1F21 A;  2YJE A;  1TL3 A;  4K42 A;  3KTQ A;  1VQO N;  2E2O A;  3FZK A;  3ENB A;  3DRR A;  3VGL A;  5HRP A;  1N32 K;  1OH8 A;  1VK0 A;  4RW6 A;  4MFB A;  2JWK A;  4IOX A;  4CJP A;  1VSI A;  1EP4 A;  3M1F A;  4QS7 A;  5BPM A;  2OAN A;  4B3O A;  4FJ5 A;  3VA0 A;  4Z4H A;  4I7F A;  3V9Z A;  2O8F A;  3IDH A;  4IDK A;  3LDL A;  4EZ9 A;  1RDC A;  1Y64 A;  5AZI A;  4HTL A;  3MMV A;  4JI2 K;  4KFB A;  2ZJR L;  1XQS C;  4Z4E A;  4C1N I;  3BEX A;  4F8R A;  3THY A;  3BF1 A;  3AVI A;  2ZGY A;  5KGW A;  3KLH A;  4IFE A;  3ULD A;  5KQ8 A;  1S72 N;  1JKH A;  3PIP L;  4IOA L;  5J1E A;  3EY1 A;  1NK6 A;  3AO1 A;  1E3M A;  5E41 A;  4DLE A;  4I2P A;  4CK3 A;  4YOW A;  3Q7C A;  3S3M A;  3QB0 A;  3QFU A;  1S1W A;  2QWM A;  3QBX A;  3T19 A;  4CGJ A;  2O8F B;  1JLB A;  1M90 O;  5MLC Q;  4H0V B;  5AZI B;  5SZT A;  1X3M A;  3LAN A;  4H5W A;  4U7B A;  3GL1 A;  2V51 B;  1HYV A;  2D0C A;  1HPM A;  4AHC A;  1NK8 A;  2O8D A;  1A5W A;  3V1R A;  4OPA A;  1NG9 A;  5ADX A;  1BUP A;  2F8S A;  4PWD A;  3HZ6 A;  4KHP K;  4GV6 A;  1C0T A;  4YOR A;  1VQL N;  4BR2 A;  4DSL A;  4M41 A;  3OTO K;  2RHK A;  4JK8 A;  1FW6 A;  3AAR A;  1GLE G;  3OYK A;  5C2F A;  3OY9 A;  1S22 A;  1KQS M;  4CGD A;  2BTF A;  3K5O A;  1TK8 A;  3CCJ N;  4JYA K;  4DTP A;  1OVY A;  4JI5 K;  1JXB A;  2PFU A;  4WQ5 A;  3VQE A;  5KPT A;  3ISN C;  1YHQ N;  3NFA A;  3D7E O;  3K9J A;  4DUY K;  5CR4 A;  1LW0 A;  2P9L B;  1T05 A;  4Q0B A;  3ZT0 A;  2BDP A;  3ZSV A;  4N5S A;  2G8V A;  1GLB G;  1WSE A;  1E4F T;  1VQ5 N;  4GKK K;  3ZSO A;  4JK7 A;  5BPN A;  3GOI A;  1LV5 A;  1SL0 A;  3RMC A;  2HMP A;  3FLC O;  1WLJ A;  3R1X A;  4QAG A;  2IOC A;  4BR0 A;  1HNW K;  3ALY A;  4IWV A;  2IC3 A;  1NMN A;  1LWF A;  1NU0 A;  3L4I A;  3HYF A;  3QES A;  2UUA K;  3NMU A;  4G9Z A;  4I9Q A;  3VQQ A;  4BG8 A;  1VSD A;  1RBR A;  4JKF A;  3DLH A;  1REV A;  2E20 A;  1YUW A;  5C2D A;  3HP6 A;  2GBZ A;  1VQK N;  2E2N A;  4NO7 A;  4B3R K;  2IVO A;  2KKZ A;  3MCA B;  3EKU A;  2KLA A;  3P83 D;  2XO7 A;  4JI1 K;  1X9S A;  1RDA A;  3O4W A;  1HUX A;  4ILJ A;  2F8T A;  4OGC A;  2JLE A;  4FZZ A;  3DWL A;  3JS6 A;  4BVO A;  3TAQ A;  4UQG A;  3WNH A;  3WQT A;  4DFK A;  3TAN A;  4H5T A;  4CJ5 A;  2GX9 A;  4LFC K;  3C6T A;  3VQP A;  4B08 A;  2A40 A;  3F5T A;  5BR9 A;  3VF6 A;  3HM8 A;  3JXU A;  4DFP A;  3EEQ A;  3I56 N;  4AHT A;  4WF9 L;  5TKW A;  2XY5 A;  4KI4 A;  3MWT A;  2HST A;  2E6M A;  4CZH A;  3ID6 A;  3NE6 A;  4PUO A;  1RTI A;  2VG6 A;  4LY7 A;  4E19 A;  1RNH A;  4OGE A;  3QNO A;  2ASM A;  2DY4 A;  3WT0 A;  3F73 A;  2GUI A;  3KD1 E;  4KAZ A;  4CED A;  3SPZ A;  3ZSX A;  3ENH A;  4FOE A;  4FK0 A;  4DR4 K;  2KQ2 A;  3VQ5 A;  3O4N A;  3LPT A;  4JI3 K;  5J2Q A;  4DFM A;  1TK5 A;  2P9S B;  1KAY A;  4H0X B;  4FWS A;  3VEV A;  2Q2R A;  4DTU A;  4DTM A;  3J8A A;  2QXF A;  2RKI A;  2ASP A;  4HUE A;  3IG1 A;  4BRQ A;  3MEG A;  4K0K K;  4CFA A;  1ESV A;  4CIE A;  3CCV N;  1NKC A;  3MWP A;  4GV9 A;  1TYQ A;  4JRP A;  3TR8 A;  3KWG A;  4RWT A;  2UYT A;  2O8E B;  1RGI A;  3DXK B;  1KC8 O;  3J7Z O;  2HMI A;  3ATV A;  5JVH L;  3NGY A;  3CYM A;  3BY5 A;  3U6F A;  2G8H A;  4CBX A;  4AQY K;  4IFY A;  3DOL A;  4DR6 K;  2HW3 A;  1QSS A;  4YFU A;  3WEE A;  3SV4 A;  2P9I A;  1VQP N;  3QIC A;  5DM7 L;  1QQC A;  2E2P A;  4DSK A;  2GTD A;  4BWM A;  2X6S A;  1RDU A;  3EE8 A;  3SAF A;  4DU1 A;  4CJU A;  5C10 A;  4NXM K;  4KBO A;  3LZI A;  1YJW N;  1I39 A;  2YHY A;  3OBW A;  2YHB A;  2F9T A;  3DLR A;  3KLI A;  1RBS A;  4CGH A;  3E9P A;  4AHV A;  4L8R B;  5F0X A;  4FW1 A;  1GLC G;  2KHO A;  3VEZ A;  2UXD K;  4FWP A;  1CZB A;  5KRS A;  3V9W A;  4X65 K;  4KHW A;  1CLQ A;  5JMV A;  1JJ2 M;  1E4G T;  3I8D A;  1NJY A;  4Z4F A;  1DLO A;  1GOA A;  2FSK A;  1XHX A;  4RG8 A;  4LF8 K;  3JSM A;  1S6Q A;  4JK9 A;  4J2B A;  1XMO K;  3ZET A;  4CEZ A;  1J5E K;  5DMR A;  4KRF A;  3DLG A;  1S1V A;  2J4R A;  1G15 A;  4K8Z A;  1Y97 A;  3KK1 A;  4AH9 A;  2IS3 A;  3QFP A;  3K5L A;  4F3O A;  2V7Z A;  2PBD A;  5BRH A;  2HVH A;  4FWM A;  3NH0 A;  3E01 A;  2NNW A;  3ASM A;  3J7A P;  3KKR A;  1KVB A;  3LDO A;  2W42 A;  3OYF A;  2VG5 A;  4CF0 A;  1YTA A;  4DSI A;  3G4S N;  3ZET B;  2QKK A;  4CZF A;  3VES A;  4F2R A;  2W6L A;  4FLX A;  5CYQ A;  3O08 A;  1NGG A;  4HTU A;  4WQ5 C;  4CEO A;  2NRW A;  4G1Q A;  4AIL C;  1OKJ A;  2DFE A;  3MN9 A;  1WAF A;  3O4Q A;  4LSL A;  2BUP A;  2HBJ A;  5KPZ A;  3PSF A;  3NF8 A;  4R79 A;  1NKE A;  3O9Q A;  3DXM A;  3MK6 A;  4OJR A;  1KFS A;  1IBM K;  2P9P B;  1Q8I A;  4XH4 A;  5AQS A;  1BWF O;  4CGI A;  2OA8 A;  4KRE A;  2RE2 A;  5DK5 A;  4HHT A;  4K43 A;  1XC9 A;  4M45 A;  5M1F A;  4M3X A;  3LZJ A;  2O8C B;  1NGC A;  3HTV A;  1IKX A;  1Z25 A;  1BCM A;  3NAE A;  3VN5 A;  3WNF A;  3AY9 A;  1ASU A;  4PL8 A;  2YKN A;  5EOY A;  4M3Y A;  4GW6 A;  4BC4 A;  3K59 A;  2VG7 A;  1U49 A;  5FPN A;  3QIO A;  3K0S A;  3DXM B;  1T6D A;  4NB4 A;  3U8X A;  1B9D A;  4FWL A;  2FBX A;  1S9G A;  2PZS A;  1XMQ K;  4FZX C;  3QEP A;  4JKD A;  5AQQ A;  2CGJ A;  4DUZ K;  4ZHR A;  4B9U A;  2OPQ A;  2WON A;  4Y1C A;  1RT7 A;  2P51 A;  4CBW A;  2HHH K;  3DYA A;  3LWM A;  4Z4C A;  3THX B;  2UXB K;  3JYT A;  4CJQ A;  4DQ8 A;  3HK2 A;  4M3W A;  3GDQ A;  4BY9 C;  2NLX A;  2HHX A;  3UKU A;  3ZSW A;  1XC3 A;  2HNZ A;  3OYN A;  1SS6 A;  3RWU A;  1VRU A;  1RT2 A;  1JCF A;  4H0O A;  2E6L A;  1HMV A;  1HNX K;  4B8C A;  3CJA A;  1VSL A;  4LF9 K;  2BAN A;  4FO0 A;  3WUH A;  4GVM A;  3HT3 A;  4GKJ K;  5M1P A;  5HOO A;  3KK3 A;  4CE9 A;  3V6D A;  3CME N;  4IO8 A;  3M8S A;  5HP1 A;  3SAG A;  1WSH A;  5AQV A;  4DR2 K;  1C1A A;  4DQI A;  3MEC A;  4H4O A;  4J2A A;  5KPR A;  1D9F A;  3CJC A;  2D0A A;  2ZJQ L;  4Y1D A;  4KI6 A;  4DU3 A;  1NK4 A;  2OCE A;  4Z4G A;  4E0D A;  3M3Z A;  3NH2 A;  3R9P A;  3SAH A;  4E7J A;  5CZ1 A;  1IBK K;  1TKZ A;  4H5V A;  3AAP A;  4CW7 B;  2V52 B;  1FKP A;  1TK0 A;  1T3V A;  2ASO A;  5GAE P;  3T1Y K;  1LOT B;  4KH5 A;  2FBY A;  4B1Y B;  4HUG A;  3AVB A;  3IRX A;  1QQN A;  4IZ9 A;  4CHN A;  4HCB A;  3DI6 A;  5AZJ B;  3M6G A;  3MAQ A;  3UB5 A;  4BRI A;  1UAX A;  2P1J A;  2XY8 A;  3VET A;  2YX6 A;  4XH5 A;  1XNR K;  4M3Z A;  3H08 A;  1IKW A;  1WN7 A;  3QEW A;  4CGF A;  3NGI A;  3CCE N;  1HR0 K;  2GUP A;  5ADX H;  2QWR A;  1NJI O;  2HF3 A;  2E2Q A;  1Q9Y A;  3VQB A;  3FE1 A;  2CGK A;  4A5B A;  3QIN A;  2O8B A;  1IJJ A;  1RDW X;  1VQM N;  1X9W A;  4DV4 K;  1U2V A;  2QTD A;  4M3U A;  4AM7 A;  4FSV A;  4KB0 A;  1BG3 A;  2A1S A;  3LM9 A;  4I6M A;  4BWJ A;  3SV3 A;  3TSP A;  4C8L A;  2VGN A;  2YHA A;  3O6W A;  2P5G A;  3OYG A;  1JLQ A;  4RTF D;  3AVM A;  3OS1 A;  1XNQ K;  4EHT A;  1BQM A;  3SUO A;  4FJG A;  4JAX A;  3HSC A;  1BL3 A;  3O3F A;  1ZYQ A;  4C1N K;  3RMB A;  2GEM A;  3SI6 A;  4OVL A;  4H5N A;  3RVC A;  3HVT A;  2HHQ A;  1KSP A;  4HWI A;  3ZLJ A;  4CK2 A;  3CFO A;  3OYH A;  2P9U B;  3D6R A;  2KZZ A;  3HM9 A;  5FPM A;  3KVG A;  3OW2 M;  4BRN A;  4YDU C;  4I6M B;  1T7P A;  1R59 O;  5LMU K;  1RBT A;  4EFH A;  3HPH A;  4FZY A;  1TL1 A;  5J2P A;  3EL2 A;  1FJG K;  2R7Y A;  1KVC A;  2G8K A;  1UWB A;  3K9K A;  5GIO A;  3CCM N;  3AO5 A;  3T1A A;  1P8Z A;  2QK9 A;  4YHH K;  2KFZ A;  4FPB A;  1KTQ A;  4GY2 B;  1YXQ A;  4BVP A;  4LH4 A;  4ELU A;  3LM2 A;  2KZM A;  3AVG A;  5IT9 O;  3ATU A;  3SMP A;  3WNG A;  5AQN A;  2KTQ A;  3NGZ A;  3A0I X;  3HOS A;  4DV7 K;  1L3T A;  3FGU A;  1HYZ A;  4JKE A;  2YNI A;  4RW7 A;  4OLB A;  5EXW A;  4BRG A;  2YCH A;  2QWP A;  3C94 A;  3ZEU A;  5LMN K;  2P9K B;  3OBY A;  4CF2 A;  3MCP A;  4DTN A;  4B9M A;  3BZC A;  4FJX A;  1BIU A;  3BUZ B;  3AVH A;  4C8N A;  2OPR A;  3TPQ A;  2FSN A;  3D45 A;  4DHY A;  1SZ2 A;  4CHQ A;  3PX6 A;  4FJL A;  1L3S A;  3RR8 A;  4CFD A;  3MEE A;  3DRP A;  2OZM A;  1HPZ A;  4CK1 A;  2RF2 A;  2AA4 A;  1IBL K;  1VSM A;  5EX5 A;  2A42 A;  4FM2 A;  4JD2 A;  3H6E A;  2E1Y A;  3CFR A;  3PX4 A;  2P9L A;  1X1P A;  4FJ8 A;  4DQQ A;  3BZK A;  3CPW M; 
#chains in the Genus database with same CATH homology
 5I3U A;  4KTQ A;  3PO4 A;  3CFP A;  3KD5 E;  4FK0 A;  4KTZ A;  1X9M A;  1IKY A;  2GV9 A;  2FBV A;  3OYL A;  3NDK A;  2KQ2 A;  1HQE A;  4CHO A;  3VQ5 A;  4DS5 A;  3LP1 A;  1TV6 A;  3O4N A;  2HND A;  4CJT A;  3SUQ A;  2VWJ A;  1JL1 A;  4MQ3 A;  2ETJ A;  3LPT A;  3V9U A;  3LAK A;  1T8E A;  5J2Q A;  1BI4 A;  4FJN A;  4HUF A;  4DFM A;  3TAF A;  1TK5 A;  4CEF A;  1JLG A;  3L2U A;  1RT6 A;  1NJZ A;  1CXQ A;  4BDZ A;  2B4J A;  1C0U A;  1RBV A;  4CJS A;  4DTU A;  2HHV A;  4RW8 A;  3SUP A;  3O3G A;  3CG7 A;  4DTM A;  1CZ9 A;  2QXF A;  4CGG A;  3QEV A;  2DTU A;  4NYF A;  2RKI A;  4HUE A;  3IG1 A;  1EKE A;  4BDP A;  1NK5 A;  4FJH A;  4K8X A;  2OZS A;  3MEG A;  5HBM A;  1U47 A;  4DG1 A;  4CFA A;  4CIE A;  4IG0 A;  4LD0 A;  2YNF A;  4ID1 A;  3SYZ A;  3LP2 A;  1NKC A;  1J54 A;  4AHU A;  4B9S A;  4OKJ A;  2XRI A;  3IAY A;  3NF7 A;  4JRP A;  4FJ9 A;  3TR8 A;  1BGX T;  3K2P A;  4C8M A;  3KLE A;  1ASV A;  2HHW A;  2Z1G A;  3HPG A;  4DTX A;  2HMI A;  4PY5 A;  3NHG A;  5C25 A;  4FLW A;  1TKT A;  3TAG A;  3NGY A;  3CYM A;  4FM1 A;  3HP9 A;  4DF8 A;  5I42 A;  1QTM A;  3U6F A;  1JLA A;  5HRN A;  3OJS A;  2G8H A;  1BI4 B;  4ID5 A;  3LAM A;  3DOL A;  4IFY A;  1L5U A;  1W9H A;  3K5N A;  3KLF A;  4YFU A;  1QSS A;  3AVJ A;  4FLV A;  3SV4 A;  2G8W A;  2HHT A;  3ZSZ A;  4EP5 A;  2ITG A;  4KRE A;  1VRT A;  1S6P A;  2YNH A;  3FFI A;  3V1Q A;  1QQC A;  3VQ6 A;  2PYJ A;  1TGO A;  5C24 A;  3LP0 A;  1WSF A;  5CYM A;  3I0R A;  3V1O A;  3OJU A;  4KHS A;  4DSK A;  2HHU A;  1VSF A;  4BWM A;  1RT4 A;  2X6S A;  3NF9 A;  4H8K A;  4IKF A;  4GMJ B;  2I5J A;  4TSX A;  3L2V A;  4DU1 A;  4CJU A;  2HHS A;  4FCY A;  5KTQ A;  3KK2 A;  3LZI A;  3AVK A;  1I39 A;  1TVR A;  2YHB A;  1CXU A;  3PUF A;  3DLR A;  3KLI A;  3NBP A;  1RBS A;  1NKB A;  3VA3 A;  4C8K A;  4NYN A;  1IH7 A;  3HXM A;  4CGH A;  4CJ3 A;  4AHV A;  3TAR A;  1A5V A;  1LW2 A;  4L8R B;  3I0S A;  3QLH A;  4FW1 A;  2HW3 A;  4CIG A;  3RMA A;  3P1G A;  3UIQ A;  3HPO A;  1CZB A;  3L2R A;  5KRS A;  1WNS A;  3V9W A;  4KHW A;  3DLE A;  1CLQ A;  1L3U A;  3I8D A;  4O0I A;  1NJY A;  1C1B A;  1EXQ A;  3AO2 A;  2FC0 A;  1DLO A;  1GOA A;  1QSL A;  4Z4F A;  2VWK A;  1XHX A;  4RG8 A;  2WOM A;  2F96 A;  1LWE A;  3JSM A;  1S6Q A;  4FJ7 A;  3AVN A;  1SKR A;  2AJQ A;  4J2B A;  4LH5 A;  4CEZ A;  4AHR A;  1HYS A;  5DMR A;  1JLE A;  1UOC A;  4KRF A;  4I9L A;  4RW4 A;  4Z0U A;  3OYB A;  1FKO A;  5J2N A;  3OVN A;  3DLG A;  1BIS A;  1S1V A;  1G15 A;  1RTJ A;  4CES A;  2E4L A;  2NUB A;  3HL8 A;  4K8Z A;  4IFV A;  3KJV A;  5JS2 A;  3L2W A;  3EZ5 A;  1Y97 A;  4Z4I A;  3KK1 A;  3DMJ A;  4FLT A;  4AH9 A;  1TAQ A;  2Y1J A;  1NJW A;  2IS3 A;  1FK9 A;  1B9F A;  3K5L A;  3AVC A;  5HLF A;  4F3O A;  3PX0 A;  3VQA A;  2BE2 A;  2KFN A;  4OLA A;  4W5Q A;  4DTR A;  1KLN A;  3ZT4 A;  2D5R A;  1HNI A;  3QER A;  1XI1 A;  2HVH A;  3LWL A;  4CHZ A;  4FJM A;  3NH0 A;  2Z1I A;  4Q0B A;  1RCH A;  1ZBH A;  5EU7 A;  3E01 A;  1RIL A;  3ASM A;  4F3T A;  5C42 A;  3KKR A;  3RTV A;  1KVB A;  3B6P A;  2PY5 A;  2W42 A;  4I2Q A;  1JXE A;  3V4I A;  3TAB A;  3OYF A;  2VG5 A;  1IKV A;  4CJF A;  4CF0 A;  1IO2 A;  1YTA A;  4FLY A;  3OS0 A;  4DSI A;  1NOZ A;  1RT1 A;  4DTO A;  2QKK A;  1ASW A;  3CM6 A;  4CF9 A;  4QOZ B;  3NH1 A;  1WAJ A;  2B6A A;  1YT3 A;  2Y1I A;  4F2R A;  3KIO A;  4NCG A;  4FLX A;  5CYQ A;  1RT3 A;  1UA0 A;  4CCH A;  4WE1 A;  4HTU A;  1NOY A;  2DFH A;  4CEO A;  4Q5V A;  4G1Q A;  4AIL C;  4KHQ A;  3DRS A;  4DSJ A;  4DF4 A;  3BDP A;  2P5O A;  2DFE A;  1FXX A;  3MXI A;  3M8Q A;  1WAF A;  1QS4 A;  3O4Q A;  4LSL A;  3EYZ A;  4ICL A;  1SL1 A;  1BIZ A;  1K6Y A;  3A2F A;  4HCC A;  3QO9 A;  3U3Y A;  3PV8 A;  1HNV A;  2FBT A;  2DFF A;  1JLC A;  3NF8 A;  2G8I A;  3C95 A;  1NKE A;  4CJW A;  2X6N A;  1NK0 A;  4J2D A;  4OJR A;  1C6V A;  3ZT2 A;  3MXM A;  1KFS A;  2LSN A;  4ZTF A;  3OYM A;  4OPK A;  3K57 A;  1RBU A;  2HVI A;  2OPP A;  2Q3S A;  1Q8I A;  3MXJ A;  4IG3 A;  4E3S A;  1W0H A;  1N6Q A;  4B8A B;  4CGI A;  2OA8 A;  4NCA A;  5FRM A;  5DK5 A;  4CIF A;  4HHT A;  4C8O A;  1XC9 A;  1SUQ A;  1WSJ A;  1U48 A;  4M45 A;  1UA1 A;  4E7H A;  1ZBL A;  4FJJ A;  4M3X A;  2O4I A;  3LZJ A;  2XHB A;  1KCF A;  1TAU A;  3V9X A;  1IKX A;  4OPJ A;  4H4M A;  1Z25 A;  1BCM A;  3K58 A;  3NAE A;  1RTH A;  4LSN A;  4FK4 A;  3VN5 A;  3WNF A;  4FLU A;  4F2S A;  4HVJ A;  1ASU A;  1D5A A;  2YKN A;  4CJV A;  4XIU A;  1VSK A;  4KAZ A;  1NJX A;  4M3Y A;  1HJR A;  2OYQ A;  1VSH A;  4GW6 A;  2IAJ A;  2ZQB A;  5CY4 A;  5K14 A;  4CHY A;  3BGR A;  3OYD A;  4DU4 A;  3S3O A;  4M3R A;  3K59 A;  2VG7 A;  4M42 A;  4YNQ A;  2O4G A;  1U49 A;  4DTS A;  3SQ1 A;  1IG9 A;  3QIO A;  4OKK A;  4O4G A;  4B9T A;  3B6O A;  4DSE A;  3VQ7 A;  3DLB A;  1J53 A;  1DTT A;  2IDO A;  3LAL A;  1Z26 A;  1O1W A;  1B9D A;  3SZ2 A;  3V9S A;  1N5Y A;  2QKB A;  4ELV A;  4FW2 A;  3SQ0 A;  1S9E A;  4B9V A;  2FBX A;  3MED A;  4R5P A;  1S9G A;  2X78 A;  5JS1 A;  2PZS A;  4FK2 A;  4FZX C;  3QEP A;  3RMD A;  1LAW A;  4ZHR A;  4B9U A;  2OPQ A;  2WON A;  4Y1C A;  1RT7 A;  2P51 A;  4E7K A;  4QCL A;  2X74 A;  3DYA A;  4DQR A;  1HRH A;  2XY7 A;  1S5J A;  1HQU A;  3LWM A;  4Z4C A;  4FLZ A;  2BGG A;  1KVA A;  3JYT A;  4CJQ A;  3HK2 A;  4M3W A;  4CJK A;  3NCI A;  2A1R A;  3AVL A;  1S1T A;  4KPY A;  1GOC A;  2OPS A;  2HHX A;  3IS9 A;  3ZSW A;  4E89 A;  4DS4 A;  2HNZ A;  3OYN A;  4E7L A;  3VQ9 A;  3RWU A;  1VRU A;  4DFJ A;  1RT2 A;  3L8B A;  1F21 A;  4CF8 A;  1TL3 A;  1RT5 A;  3KTQ A;  4E7I A;  2E6L A;  1HMV A;  4B8C A;  3DRR A;  4KV8 A;  3CM5 A;  5HRP A;  3G10 A;  3V81 A;  1VSL A;  1VK0 A;  3KKS A;  4RW6 A;  2BAN A;  4MFB A;  4BE0 A;  4CJP A;  4GVM A;  3HT3 A;  4JS5 A;  1VSI A;  1EP4 A;  4DSF A;  4B3O A;  3KK3 A;  4CE9 A;  3VA0 A;  3V6D A;  4FJ5 A;  4J2E A;  4O55 A;  4Z4H A;  4I7F A;  4DMN A;  3OYC A;  3V9Z A;  3M8S A;  5D3G A;  4IDK A;  4EZ9 A;  1RDC A;  5HP1 A;  1WSH A;  4FXD A;  5KI6 A;  1C1A A;  4DQI A;  3MEC A;  5FRO A;  1BQN A;  3ZSY A;  4H4O A;  4KFB A;  4J2A A;  1D9F A;  4Z4E A;  3D0P A;  2D0A A;  4DTJ A;  3G0Z A;  4Y1D A;  4F8R A;  4KI6 A;  3VQ4 A;  4DU3 A;  3ZT1 A;  2PYL A;  4KHY A;  1NK4 A;  3AVI A;  3QEI A;  4PA1 A;  5KGW A;  4Z4G A;  4E0D A;  3ZCM A;  3KLH A;  4ZTJ A;  4N56 A;  4DQP A;  4PQU A;  3ULD A;  1VSE A;  3NH2 A;  4CFB A;  4FYD A;  4E7J A;  5CZ1 A;  1VSJ A;  3S9H A;  1TKZ A;  5T7B A;  1JKH A;  3HJF A;  5J1E A;  3EY1 A;  1NK6 A;  3AO1 A;  4KO0 A;  4OKE A;  1JLF A;  5FDL A;  5E41 A;  4DLE A;  3QIP A;  4I2P A;  4CK3 A;  1R0A A;  1QHT A;  1FKP A;  1TK0 A;  3S3M A;  1ZBI A;  3SNN A;  3O3H A;  2EX3 A;  5HRS A;  1S1W A;  2EHG A;  3T19 A;  4CGJ A;  3ITH A;  1JLB A;  2FBY A;  1C1C A;  1A5X A;  3AV9 A;  3LPU A;  4AHS A;  4HUG A;  5HRO A;  3AVB A;  5SZT A;  3SUN A;  3IRX A;  3LAN A;  4CHN A;  4CEC A;  4HCB A;  3DI6 A;  3M8R A;  2BDP A;  3MAQ A;  1HYV A;  2D0C A;  3AA5 X;  3AVF A;  1UAX A;  2P1J A;  1A5W A;  2XY8 A;  4KKO A;  4O44 A;  3V1R A;  4AHC A;  1NK7 A;  1NK8 A;  1U04 A;  4KHU A;  2YKM A;  3RRH A;  4M3Z A;  3H08 A;  3TAP A;  1IKW A;  2F8S A;  4PWD A;  4W5T A;  3AA4 A;  1C0T A;  3SPY A;  1WN7 A;  4W5O A;  3QEW A;  4CGF A;  1DTQ A;  3NGI A;  4CHP A;  4DSL A;  4N41 A;  4M41 A;  4NCB A;  1WSI A;  5KRT A;  1ITG A;  1KRP A;  1L3V A;  3AVA A;  5SWM A;  1JL2 A;  4BDY A;  3AA2 A;  4B9L A;  4W5R A;  1Q9Y A;  4W5N A;  3VQB A;  3KLG A;  3PY8 A;  5J2M A;  3QIN A;  3OYK A;  3U3G A;  2Z1H A;  4E1M A;  3OY9 A;  1YTU A;  4DQS A;  2Z1J A;  1U4B A;  1X9W A;  1U45 A;  2ZD1 A;  4JLH A;  4CGD A;  3S3N A;  3QEX A;  3SQ4 A;  3K5O A;  3DLK A;  1XHZ A;  1TK8 A;  5FRN A;  4M3U A;  4DTP A;  2YV0 X;  4KB0 A;  1KFD A;  1JXB A;  3WNE A;  2A1S A;  4JS4 A;  3PO5 A;  4FJK A;  4BWJ A;  3VQE A;  4FM0 A;  2YNG A;  3ISN C;  4CEE A;  3SV3 A;  4C8L A;  3NFA A;  2YHA A;  4F4K A;  3LP3 A;  1LW0 A;  2ZE2 A;  1T05 A;  2P5G A;  3ZT0 A;  2RN2 A;  1JLQ A;  1LAV A;  3VQC A;  5KGX A;  3ZSV A;  3AVM A;  3OYG A;  2G8F A;  3OS1 A;  1RDD A;  1KLM A;  3P5J A;  4N5S A;  1BQM A;  1D9D A;  2G8V A;  1B92 A;  4N47 A;  4CJL A;  1WSE A;  3SUO A;  4KB1 A;  4FJG A;  4DLG A;  1BL3 A;  3C6U A;  3OYJ A;  3O3F A;  2D0B A;  1ZYQ A;  3ZSO A;  3RMB A;  4CF1 A;  4FJI A;  4JRQ A;  1LV5 A;  1SL0 A;  3RMC A;  3SI6 A;  3TAM A;  4OVL A;  4BE2 A;  3HVT A;  4CJ4 A;  2HHQ A;  1WLJ A;  1KSP A;  4QAG A;  4CK2 A;  2IOC A;  3CFO A;  3OYH A;  2KZZ A;  3HST B;  1EET A;  3ALY A;  1SV5 A;  3RRG A;  2ATQ A;  4KTW A;  3HM9 A;  2XY6 A;  2IC3 A;  1LWF A;  3DOK A;  2IGI A;  1T7P A;  4FVM A;  3TWH A;  2HB5 A;  3NF6 A;  2B5J A;  1MU2 A;  1Q9X A;  3HYF A;  4RW9 A;  1RBT A;  1J9A A;  4B9N A;  2G8U A;  3HPH A;  3HO1 A;  3QES A;  4FZY A;  1TL1 A;  5J2P A;  3OYE A;  4I9Q A;  2R7Y A;  1KVC A;  4O0J A;  3VQQ A;  2G8K A;  2JGU A;  1VSD A;  1ZBU A;  1RBR A;  3T3F A;  3ZT3 A;  4EP4 A;  1UWB A;  3QNN A;  3AO5 A;  1REV A;  3DLH A;  4O5B A;  3T1A A;  3HP6 A;  2QK9 A;  2GBZ A;  2KFZ A;  1SKW A;  1KTQ A;  4EZ6 A;  5HRR A;  1I3A A;  1BHL A;  4DWI A;  2XO7 A;  3P83 D;  1YVU A;  4LH4 A;  3ZSQ A;  4ELU A;  2KZM A;  3AVG A;  1X9S A;  1RDA A;  3OS2 A;  3WNG A;  2KTQ A;  3NGZ A;  2F8T A;  4OGC A;  3RR7 A;  2JLE A;  1L3T A;  4CEQ A;  4FZZ A;  1HYZ A;  4CJR A;  2YNI A;  4IBN A;  4RW7 A;  3TAQ A;  3TI0 A;  1SKS A;  4OLB A;  3QET A;  1EX4 A;  4UQG A;  3WNH A;  3VQ8 A;  3OYA A;  3L2Q A;  4N76 A;  4DFK A;  2KW4 A;  3C94 A;  3CQ8 A;  3TAE A;  3TAN A;  1C0M A;  4CJ5 A;  1S1U A;  3OYI A;  1T03 A;  1XWL A;  4BAC A;  1SL2 A;  1RDB A;  2RPI A;  3C6T A;  1TKD A;  2HNY A;  3L3V A;  4CF2 A;  1WSG A;  3VQP A;  4DTN A;  3DM2 A;  1BCO A;  3THV A;  4B08 A;  4B9M A;  4FJX A;  1BIU A;  3SJJ A;  1TKX A;  3ZSR A;  1QE1 A;  3AVH A;  1QSY A;  4C8N A;  2OPR A;  4CER A;  3M8P A;  4BE1 A;  4DFP A;  3AO4 A;  4KHN A;  4AHT A;  3D45 A;  4CHQ A;  3PX6 A;  3VQD A;  3SQ2 A;  4FJL A;  2XY5 A;  1S1X A;  4KI4 A;  1L3S A;  3RR8 A;  4CFC A;  4CFD A;  3MEE A;  2E6M A;  3DRP A;  5CZ2 A;  2OZM A;  1GOB A;  4ELT A;  1HPZ A;  3HVR A;  3NE6 A;  4CK1 A;  1RTI A;  2RF2 A;  4PUO A;  2VG6 A;  4LY7 A;  1ZBF A;  3AA3 A;  1VSM A;  4CEA A;  1RNH A;  4OGE A;  4E19 A;  4E1N A;  3QNO A;  1RTD A;  3SCX A;  4FM2 A;  1NK9 A;  1D8Y A;  1J5O A;  2DY4 A;  4M3T A;  3F9K A;  1LWC A;  3CFR A;  3F73 A;  2GUI A;  4CJE A;  3KD1 E;  3L3U A;  3K5M A;  3PX4 A;  3AO3 A;  4CED A;  1X1P A;  3LDS A;  4FJ8 A;  4DQQ A;  3SPZ A;  4CEB A;  3ZSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...