4GVMA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
148
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTACWWAGIKQEFGIPYNPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 148
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gvmA00
3C94A 4HUGA 3P5JA 4FLZA 4I9LA 1J53A 4B8AB 1VSMA 1IKVA 2OPPA 3AVFA 1ASUA 1S1VA 4RG8A 2XO7A 4DG1A 3RMCA 1D8YA 4E89A 3LWMA 4Z4GA 2W42A 1NKCA 5CYQA 2FC0A 4QAGA 4OKKA 4Q5VA 3LP3A 4I9QA 4W5RA 1CZ9A 3S3MA 1FXXA 1UWBA 4BDYA 4ELUA 1TK5A 4CF1A 3TAMA 1UA1A 5D3GA 4CF9A 3T19A 4CEQA 3RWUA 3ZT4A 2HHWA 4BWMA 3VQDA 2AJQA 1RT3A 1ZBUA 2DFHA 5J1EA 4B9LA 3VN5A 4CCHA 3AA3A 3PX4A 4CK3A 4O5BA 4PQUA 3DLHA 4KREA 4DF8A 1RT2A 4BE2A 1CZBA 3ZSVA 1RBTA 4DQQA 4F3TA 1KSPA 3ZT0A 4KB0A 5HRSA 1EXQA 3WNFA 2VWJA 1O1WA 4FLXA 4FZXC 1KFSA 1T7PA 3AVBA 4DLGA 1RBVA 4CK1A 3NGZA 3VA3A 1S1UA 1D5AA 3MECA 4M41A 4EP4A 3QEPA 3SQ0A 4E1MA 2Y1JA 3LPUA 3DLRA 3ZSRA 4JLHA 3L3UA 3VQ9A 2PY5A 1WSEA 2A1RA 1DTQA 1U4BA 3SQ2A 1UA0A 1QSLA 4N5SA 1BQNA 3V1QA 3HP9A 2G8VA 4BDPA 1U45A 2JLEA 3NF7A 3NFAA 3ZSQA 5HROA 1SKRA 4FYDA 3QLHA 4I2QA 4KI6A 1RILA 1B9FA 1RTHA 3VQ4A 2P5OA 3LZJA 1KVAA 4CECA 3KLHA 3L2WA 3SV4A 4K8ZA 4CJ5A 3NDKA 2GUIA 4O44A 4FLYA 4FJ9A 1DLOA 1UAXA 3QNNA 3L2QA 1S1XA 3S3OA 4J2EA 5I42A 3SUNA 3OYEA 1SKWA 3TI0A 5CYMA 3K5MA 2X6NA 3DYAA 4LSLA 3D45A 2HNYA 5EU7A 3NAEA 2IDOA 3U6FA 4KTZA 2VWKA 2ATQA 4RW8A 2Z1IA 1D9DA 4CEFA 1NK7A 4IDKA 1IH7A 3JSMA 3VQ6A 4B9SA 4DQIA 4AHVA 3ALYA 3L8BA 3DLEA 1JLCA 4H4OA 1J54A 3QO9A 1K6YA 4IBNA 3NBPA 4O4GA 5KGXA 1GOCA 3K59A 3SYZA 1FKPA 4Z4EA 1HJRA 4FM1A 1NKEA 4CIEA 5CZ2A 5HRNA 1RBSA 4CJTA 3M8RA 3TR8A 1KFDA 4OPKA 1TL1A 3T1AA 3K57A 3KD5E 4B08A 4MQ3A 1N6QA 4B9UA 2QKKA 2Q3SA 4B9MA 4CJQA 3HM9A 1KVCA 2WONA 3OJSA 4FLVA 1WSHA 4DQRA 1NOZA 3QERA 1LWEA 4KKOA 4DSIA 4W5QA 1VRTA 1GOAA 3KK1A 3QESA 3KLIA 3DOKA 4TSXA 4OJRA 1EP4A 4CFBA 3SPZA 3DRPA 3L3VA 1U48A 4EP5A 1JKHA 1RDBA 3VQBA 1RTJA 4BACA 1BISA 1Q9YA 3CFPA 1IG9A 1XC9A 1D9FA 4KFBA 4C8LA 5KRSA 3HJFA 1KTQA 3TAPA 1RNHA 5HBMA 3V1OA 3KD1E 1F21A 3C6UA 4CJUA 3RMBA 2F96A 4M3RA 4B9VA 1EKEA 1HYSA 5I3UA 3AVGA 4FJNA 3CYMA 2P5GA 1L3TA 1C0TA 1QS4A 3OYMA 3HK2A 2YKMA 4CFCA 3AO3A 4RW6A 2G8WA 4AHCA 4C8KA 1NJXA 3SV3A 4DFJA 3RR7A 1S9GA 4FJJA 1XHXA 1BI4B 2OPQA 1Y97A 4FM0A 1KRPA 3U3GA 3K58A 2X78A 1JXBA 4B3OA 4DF4A 5FRNA 4I2PA 1N5YA 4QOZB 4KO0A 4E7KA 1RBUA 5J2MA 5HRPA 3AO5A 1WLJA 3OYAA 2XRIA 4R5PA 3SNNA 3OS0A 1Z25A 3V9ZA 1B9DA 1HMVA 2E4LA 3S3NA 2HVHA 5K14A 3ITHA 2DFFA 3DRSA 3LWLA 4CK2A 3D0PA 4KHUA 4AHSA 4CF0A 3LALA 3B6PA 3E01A 1C0MA 3HP6A 4DQSA 3NCIA 3T3FA 1R0AA 4B9TA 3ZSOA 4PWDA 1BCMA 4CEOA 2EX3A 3QEIA 1Q8IA 1A5XA 4CIGA 3AA2A 3OYGA 4CJSA 2P1JA 3AVJA 2KFZA 1NK9A 3RMDA 1W9HA 2PYLA 3LP1A 3QIOA 4F2SA 3V9UA 4CHNA 2DTUA 3LPTA 5HLFA 1NJZA 3V9XA 2HW3A 2FBYA 4IKFA 4LSNA 2G8IA 1L5UA 1IO2A 2RKIA 4IFVA 3QEVA 1TV6A 3CM5A 4DFMA 4N41A 4OLAA 3LP0A 3VA0A 2HHQA 2OZMA 3MEDA 1KLMA 3OYLA 2B6AA 4FVMA 1BHLA 2HMIA 4HTUA 3SQ4A 1CXQA 3AVAA 4AHUA 4DFPA 3THVA 3ASMA 1S9EA 2Z1JA 4CJKA 4CGHA 4JRPA 1NKBA 4DTPA 4EZ9A 4E7JA 3RRHA 1XHZA 4RW4A 4BDZA 3AA4A 1JXEA 3AA5X 1RCHA 2BANA 2LSNA 4Z4CA 3KJVA 2X6SA 2YNGA 2D0BA 3EZ5A 4E7LA 3BGRA 3MXIA 1REVA 1NK0A 2HHTA 4H4MA 4CJPA 4CEZA 1RDCA 2IOCA 1BL3A 4E19A 4C8NA 2G8UA 4M3ZA 3ZT2A 5HP1A 4GVMA 4JS4A 3AVCA 2KZMA 1TKXA 1L3UA 4FJLA 3O3HA 1S5JA 1VSEA 3AVKA 4RW9A 4DS4A 1TKDA 2QK9A 3HPGA 1SL2A 3OYJA 1RT6A 4CGDA 2D5RA 3OYDA 3U3YA 1ASVA 3PUFA 3I0RA 2HVIA 2ZE2A 3K5OA 1TK0A 3QEWA 4DU1A 3K5LA 2KW4A 4M42A 4FW2A 1SV5A 2FBVA 3ZSWA 1WN7A 1EETA 4CEEA 2R7YA 3NF8A 3MAQA 1YTAA 3OY9A 4KV8A 4CJLA 2F8SA 3HT3A 4AHTA 1VSIA 1SUQA 4OKEA 4HCBA 4FJ8A 3DMJA 1WAJA 1SL1A 2ETJA 2Y1IA 3QIPA 4Z0UA 1X9WA 3DLBA 4CJFA 1U49A 3VQ8A 3NGIA 5FDLA 4DQPA 4NCBA 3V1RA 1NK6A 1HRHA 4KAZA 4CFAA 4CHOA 2OPRA 3PV8A 1C1CA 3IG1A 4LD0A 4XIUA 4DTXA 4KHQA 1TAUA 1FK9A 4C8MA 2KFNA 4CF8A 2HNZA 3TAGA 4JRQA 4F3OA 3VQQA 2YHAA 1A5WA 1VSKA 3B6OA 4PUOA 1LW0A 4ZHRA 4CGJA 4JS5A 3AVMA 2HHVA 1VRUA 1QSSA 3NHGA 4FJIA 5DK5A 4YFUA 4Y1DA 1QTMA 1ZBFA 4ID1A 1RT5A 1RT1A 2D0CA 4FK0A 3IAYA 3ZSZA 4W5OA 4DSFA 4FK2A 5DMRA 1G15A 4FXDA 3P1GA 4CJRA 4CERA 4B8CA 4HHTA 5JS2A 2HB5A 3NF6A 3HPOA 3MXMA 3O3FA 4L8RB 4GW6A 4J2DA 3L2RA 1ZBHA 4OGCA 2HHSA 1W0HA 2ITGA 4W5TA 3QETA 3SI6A 1LWFA 4HVJA 4NCGA 4M3XA 2FBXA 4OGEA 4CJVA 2OZSA 3M8PA 1A5VA 4CEDA 4Z4HA 1NK8A 2B4JA 4G1QA 5C42A 2Z1HA 4KHWA 2O4GA 1RDDA 1IKWA 1S6PA 3DM2A 3AVHA 4CFDA 2XY7A 2G8HA 1MU2A 1BIUA 4FJHA 1VSLA 4DTNA 4Z4IA 4C8OA 4DTOA 5SWMA 1T05A 3QNOA 4OKJA 3SJJA 1SL0A 4CHQA 1VSDA 4GMJB 1HQEA 1U04A 1VSHA 4E1NA 1HQUA 3LANA 1C0UA 3OJUA 3I8DA 4BE0A 4N47A 5KI6A 4EZ6A 4DTJA 4BE1A 1HYVA 4CEBA 2O4IA 4AHRA 3DLGA 4CGIA 4K8XA 5T7BA 3CFRA 3KIOA 2DFEA 5FRMA 5J2NA 2QKBA 3JYTA 4CHYA 3NE6A 1WAFA 3HSTB 4DU4A 2OA8A 3C95A 2XY5A 1Q9XA 2HHXA 3V6DA 4KTQA 3O4QA 1JLEA 5E41A 2G8KA 4WE1A 2RF2A 1LV5A 3SUPA 1RTIA 4B9NA 3ZSYA 1B92A 3M8QA 4O55A 4M45A 4FJMA 3PY8A 5KTQA 3MXJA 3WNEA 4N56A 5C24A 3SCXA 3AO2A 1TVRA 3SPYA 1TKZA 2DY4A 1IKYA 2GV9A 1RBRA 4HUFA 1KLNA 4LH4A 4E7HA 1J5OA 4DU3A 4FJ7A 3HYFA 1C1BA 2VG7A 2PZSA 1VK0A 3CFOA 5J2QA 2GBZA 3MEGA 4PA1A 5KGWA 5SZTA 3LDSA 1ZYQA 1L3SA 1JLGA 4HCCA 3ZCMA 4IG3A 1X9SA 4DTMA 4I7FA 3NH2A 5HRRA 2VG5A 4LH5A 1XI1A 4CHZA 4OPJA 2HNDA 1BI4A 3O4NA 4Y1CA 3ULDA 3AV9A 3DLKA 1JLAA 3HVTA 3KK2A 3EY1A 2A1SA 4DTRA 4KHYA 3ZT3A 3LZIA 1RT4A 3NH0A 3HVRA 4YNQA 2XY8A 1BQMA 1I3AA 2VG6A 1YT3A 4KPYA 3UIQA 3IS9A 2I5JA 4CEAA 1BIZA 3NH1A 4DTSA 3LP2A 2FBTA 3C6TA 4CGGA 2IGIA 3KLFA 4DSKA 3KTQA 4ICLA 3VQPA 3RMAA 1QQCA 2RPIA 2YNHA 1JL2A 5C25A 1S1WA 2BDPA 3H08A 4FCYA 4CE9A 4FLUA 4RW7A 1C1AA 1GOBA 1HNIA 2ZQBA 2YHBA 4NYNA 1X9MA 1IKXA 1L3VA 2PYJA 4J2BA 4ZTJA 4UQGA 1EX4A 4H8KA 4J2AA 2XHBA 3K2PA 3V81A 2P51A 4DSJA 3KKSA 4NCAA 2XY6A 1ZBIA 1WNSA 4M3YA 1S1TA 4LY7A 4AILC 3MEEA 2E6MA 2YNFA 1BCOA 1LAVA 2D0AA 1LW2A 5CZ1A 1JL1A 1WSFA 2YKNA 3DOLA 3SZ2A 3HL8A 4DS5A 4FK4A 1C6VA 4CF2A 1HNVA 3KKRA 3ZT1A 2QXFA 4FJXA 1YTUA 1Z26A 2NUBA 3KK3A 4KI4A 1VSFA 1YVUA 3K5NA 4CJEA 4DLEA 2IS3A 2YNIA 3F9KA 3CQ8A 3QEXA 4FW1A 4M3TA 2JGUA 2Z1GA 4O0JA 3OYHA 3OYIA 3RR8A 1KCFA 3OVNA 3PO4A 3VQAA 4Q0BA 4AH9A 1XWLA 4CIFA 3AO4A 2X74A 1TL3A 2YV0X 1QSYA 1NJWA 2ZD1A 4FJKA 2F8TA 1UOCA 1T03A 3DI6A 3AO1A 4FLTA 3LAMA 1NK5A 2IAJA 3KLGA 3RRGA 4ID5A 4NYFA 4E7IA 5FROA 4FJ5A 4KHNA 3HO1A 3EYZA 1NOYA 1RT7A 3AVNA 4MFBA 3RTVA 3OYFA 3HPHA 4ELTA 1CLQA 1SKSA 2BE2A 1QHTA 4E0DA 3BDPA 3CG7A 4HUEA 3VQCA 1NK4A 1T8EA 3WNGA 1ITGA 1HYZA 4Z4FA 4KHSA 3OYBA 3V9SA 4QCLA 2EHGA 3TWHA 3NGYA 4E3SA 3PO5A 2KZZA 4PY5A 2RN2A 2KQ2A 3O3GA 3OS2A 1RDAA 4KTWA 3V9WA 2E6LA 3LAKA 1RTDA 3VQ7A 3S9HA 4O0IA 1I39A 3P83D 4DWIA 1FKOA 1NJYA 1HPZA 3CM6A 3DRRA 1TAQA 1KVBA 4CJ3A 4CHPA 3TAEA 1J9AA 1WSJA 4OVLA 3VQEA 4DSLA 4F8RA 3AVIA 4M3WA 4CESA 4F2RA 4BWJA 3FFIA 3I0SA 3SUQA 1DTTA 4CJWA 4ZTFA 3V4IA 2G8FA 3PX0A 3OYCA 2KTQA 2OPSA 1BGXT 3QINA 3OS1A 3L2UA 1WSIA 3F73A 3IRXA 4M3UA 1TK8A 2HHUA 1LWCA 3PX6A 3G0ZA 1U47A 1JLFA 4DSEA 4OLBA 3TAFA 4FZYA 1X1PA 1ASWA 3M8SA 2OYQA 3KLEA 1VSJA 5KRTA 1TKTA 3TABA 3OYKA 4FLWA 4KB1A 2BGGA 5CY4A 2B5JA 4CGFA 1LAWA 1JLBA 1S6QA 3WNHA 3ZSXA 3AVLA 2IC3A 4CJ4A 3A2FA 1ZBLA 4ELVA 4KRFA 1JLQA 3G10A 4DTUA 1TGOA 3TANA 3TAQA 3HXMA 2WOMA 4FJGA 3TARA 3OYNA 5J2PA 1WSGA 4DMNA 4IFYA 4F4KA 3SUOA 4FM2A 4IG0A 1CXUA 4DFKA 3VQ5A 4W5NA 3SQ1A 3ISNC 4FZZA 5JS1A 1QE1A 3L2VA 4N76A 3NF9A
chains in the Genus database with same CATH superfamily
3BUZB 3KVGA 3P5JA 4FLZA 1IKVA 3AVFA 3E9OA 1ASUA 3LDPA 3EZWA 2W42A 4LF4K 2FSNA 4FOEA 3S3MA 3TAMA 4DR7K 2HOEA 3M3ZA 3MMVA 3T19A 3ZT4A 2HHWA 4BWMA 3TSQA 4CCHA 3AA3A 3PX4A 3WXIA 1HPMA 4F3TA 1RBTA 3C65A 4QS8A 4BREA 1O1WA 5ADXH 4FLXA 3M1FA 3AVBA 1XC9A 4CK1A 1VQKN 3QEPA 4EP4A 4J8FA 2YJEA 3VOVA 4BRGA 4JLHA 3VQ9A 2EWSA 3SBGA 1U45A 1FW6A 2JLEA 3NFAA 1SKRA 4CZKA 5HROA 2QWOA 4I2QA 1T44A 1B9FA 3LZJA 1KD1O 2KKZA 3VF2A 4CJ5A 4FLYA 3S3OA 3L2QA 3OYEA 3UKRB 3NAEA 2HNYA 2P9PA 1XQSC 3BY5A 4KTZA 1N32K 4MDBA 4C23A 3ATUA 3VGLA 4BR7A 4IDKA 1IH7A 4DQIA 4DUYK 2ASPA 3ALYA 4PL8A 3DLEA 4IEIA 4H4OA 1EWRA 2HSTA 4BVOA 3K59A 1GOCA 1NKEA 4OPHA 3L4QA 5HRNA 1NGGA 3TR8A 2V51B 3K57A 4B08A 3C0BA 1VRTA 5GAEP 5TKYA 3SPZA 1EP4A 4BRPA 1JKHA 3CCUN 4BR2A 1RTJA 1XMQK 4C8LA 4ISEA 1IG9A 5KRSA 5LMUK 2YJFA 5HBMA 3O08A 4M3RA 4B9VA 2VCPA 1L3TA 3HK2A 4JKFA 1V4TA 1NJXA 3FZFA 4BRQA 1S9GA 2E20A 1Y97A 4FM0A 4B3MK 2YX6A 3FGUA 5AZIA 2FF6A 3CXCM 1JXBA 5LJVA 1N5YA 2E1YA 1GLEG 1MDUB 2BH1A 4E7KA 4NLCA 1YAGA 3OYAA 2ASMA 3ZETA 4BR9A 4R5PA 3V9ZA 4B3TK 3S3NA 1IJJA 2DFFA 5JVHL 4AHSA 3LALA 1C0MA 2P9LA 3A0IX 4AM7A 4CEOA 1A5XA 4G9ZA 3AA2A 4CJSA 2P9SA 1NK9A 4CZJA 3RMDA 3O8MA 3QIOA 2QWLA 2HW3A 4KH6A 3VEWA 3CCEN 3OTOK 4DFMA 4N41A 2HHQA 5EOYA 2B6AA 1NBWA 2HMIA 1NWKA 4AHUA 4DFPA 4EZ9A 4O5FA 1HR0K 4A2BA 1W97L 2LSNA 3KJVA 2HBJA 3CJCA 2Q2RA 1RDCA 2O8BA 3ZT2A 4BR0A 2OANA 3O3HA 5AQMA 4RW9A 2QK9A 4DV5K 5B8HA 3HPGA 3P31A 1RT6A 4KH5A 4CGDA 4JHDA 5MLCQ 1EQYA 1TK0A 1J5EK 2QWNA 4DU1A 3K5LA 4IEEA 5C12A 4FW2A 2FBVA 1WN7A 2R7YA 3NF8A 1DGKN 1K8KB 3OA9A 4DR5K 3DMJA 1WAJA 3E66A 2Y1IA 1QQMA 4Z0UA 3I55N 3NGIA 5FDLA 4CZLA 3N4PA 2O8DB 4DQPA 4NCBA 4KAZA 4CFAA 4B1UB 1C1CA 4KHQA 4BY9C 3CI5A 1FK9A 4C8MA 2HNZA 4A61A 4JRQA 4CZFA 1A5WA 5GADP 3AVMA 1Q7YO 3G71N 3A5LC 4FWSA 4IJNA 3AARA 1QSSA 3TPQA 5DK5A 4K25A 4BVPA 1QTMA 4BG8A 2D0CA 3O5BA 3IAYA 1N36K 1G15A 3NVMA 4CZGA 3NF6A 3O3FA 1W0HA 3CQXA 4W5TA 3C7NA 1ATRA 1N8RO 4M3XA 4CJVA 4CEDA 4G1QA 3E1YA 2O4GA 1RDDA 3DM2A 2G8HA 4V19S 3WXJA 3EL2A 1MU2A 1BIUA 3CD6N 2HF4A 4C8OA 4WFAL 4RTFD 3QNOA 3SJJA 1VSDA 4GMJB 1VSHA 4E1NA 3OJUA 2A3ZA 1C0UA 3LANA 4BE0A 3RSEA 4N47A 3T7ZA 3G6EN 1U6ZA 5JLHA 3H1VX 4BE1A 3DLGA 3CPWM 2O8EA 2QKBA 3R6MA 1WAFA 2UUCK 1Z05A 2O8FA 2XY5A 1Q9XA 4DV4K 2HMPA 3LDQA 3QFPA 3MCPA 4IOXA 4B9NA 1RTIA 4KHPK 5BRDA 3M8QA 4M45A 3G4SN 1RDUA 3M6GA 3MXJA 4HTLA 1MWMA 3AO2A 1TKZA 2ZJQL 3O4WA 4JK7A 3UKUA 5A2QO 4DKWA 3DJCA 2Q97A 4JI7K 1R59O 3CQYA 1OH8A 4PA1A 5GINA 4BC4A 1L3SA 1ZYQA 1JLGA 5AQNA 3ZCMA 4HCCA 4DTMA 4I7FA 3NH2A 5HRRA 3W0LA 4LH5A 1XI1A 2E5LK 1VQ5N 1JLAA 5F1XA 3CCLN 2GWJA 3QMLA 3NH0A 2P9KB 4YNQA 1YT3A 4JI1K 4KPYA 1U2VB 3LP2A 5I9EB 1HX1A 3CCSN 4A2AA 3VQPA 2HBKA 4BROA 2BDPA 1S1WA 3H08A 2IVNA 1HNIA 2YHBA 1VQ4N 4NYNA 1X9MA 3A5OC 4GNIA 1HKGA 4H8KA 3FE1A 5AZJB 2XHBA 3K2PA 4CBXA 3WEEB 3H3NO 5C2FA 3IUCA 1IG8A 1N33K 4CVNE 2E2OA 1LAVA 3VEYA 4K0KK 1WSFA 2YKNA 2E1ZA 1RFQA 3CJ1A 4CF2A 1LOTB 2QXFA 4FJXA 1YTUA 1Z26A 3KK3A 1YVUA 2P9NA 1N34K 5IT9O 3DXMA 4FW1A 4DQ8A 5EXWA 3OYIA 1ATNA 4AH9A 1XWLA 4DV1K 4U67L 4DR6K 1NJWA 3J81O 3ZEUA 4FJKA 2F8TA 4BRLA 3DI6A 3L4IA 3MWTA 1KAYA 3KLGA 4E7IA 3RRGA 1MA9B 4WQ4A 5FROA 1RT7A 4U7BA 3HPHA 4ELTA 1CLQA 5BRFA 3HI0A 3CG7A 1XMOK 3VQCA 1KQSM 1ITGA 1HYZA 4KHSA 3C6HA 3TWHA 1NU0A 4E3SA 2KZZA 2KQ2A 3V9WA 3S9HA 4O0IA 1I39A 3P83D 4ISFA 3ZX2A 2GELA 3GOIA 1TAQA 1KVBA 4CJ3A 4RWTA 4DV2K 4DSLA 3AVIA 4F2RA 3FFIA 2WUSA 1DTTA 3VMFB 2G8FA 4FWMA 4B3RK 2ZF5O 3QINA 4M3UA 1LWCA 3THWA 4OLBA 3HM8A 3TAFA 2OYQA 2NZTA 2D1KA 3TABA 4FLWA 5CY4A 1LAWA 4ELVA 1TYQA 3D2FB 4KRFA 3A2FA 2AP1A 1EWQA 3G10A 3UB5A 3TANA 3HXMA 5AQZA 4DMNA 4F4KA 1KC8O 3CMAN 3I8BA 1NGAA 3D2EA 2F4VK 4BC2A 5C0YA 3VQ5A 3EKSA 3SQ1A 4W5NA 3NVKA 3CIPA 4CBUA 5JS1A 1QE1A 3L2VA 2CGJA 4RG8A 1KAXA 2QXLA 3VEOA 2XO7A 1D8YA 4Z4GA 4E89A 4WQ5A 1X3NA 5ELZA 1YVNA 3A5NC 3LP3A 5AQLA 3CCVN 4I9QA 1UWBA 4BDYA 1WUAA 4CF1A 4JD2A 4JYAK 4PKIA 1K73O 5J1EA 4GY2B 1YJ9N 4PQUA 3F5TA 1ESVA 4EAHD 3PIPL 3EN9A 3ZSVA 3KK7A 2CGKA 3HSCA 4DLGA 1RBVA 1GLDG 3NGZA 1S1UA 1D5AA 4M41A 3SQ0A 2QM1A 3DLRA 3ZSRA 1GLLO 1WSEA 3J80O 1U4BA 4JKAA 1GLCG 5C2DA 1HNXK 3SQ2A 5JMVA 1BQNA 3V1QA 4BDPA 3GE1A 3NF7A 4FYDA 3T69A 4BRKA 1RILA 1WOQA 3QB0A 4H5NA 2P5OA 1KVAA 4EIAA 4HWIA 2QEXN 3TI0A 5CYMA 2X6NA 3DYAA 4LSLA 5EU7A 2VWKA 2NRHA 5AFUH 1YITN 4O8UA 3VEVA 1D9DA 2FSKA 1QHAA 3L8BA 2VYPA 1QQOA 4YDUA 4O4GA 3NBPA 3L0QA 1HJRA 2CH6A 2FLOA 4DHYA 3T1AA 3KD5E 1N6QA 4MQ3A 4B9UA 3OJSA 1W7AA 1WSHA 4DQRA 1NOZA 3QERA 1LWEA 4JI3K 4JK8A 3O9QA 1GOAA 3TU5A 3KK1A 3KLIA 2NRVA 4CFBA 1U48A 3L3VA 4EP5A 4LC9B 3J8AA 4MDAA 1BISA 3HJFA 1W2BM 1KTQA 3V1OA 4H0YB 3EEQA 3TTFA 5I3UA 2AA4A 3CYMA 2P5GA 1QS4A 4CFCA 4RW6A 3O9TA 3ZLJA 3IMXA 4BR4A 3SMPA 4DFJA 3RR7A 1GLFO 1HNWK 2OPQA 2JWLA 1KRPA 4IDHA 3U3GA 2E2NA 1M90O 2IVOA 3OW2M 2FSJA 2E2PA 4QOZB 4KO0A 4ILHA 3VF4A 2Q1NA 3ULEB 1S22A 1WLJA 1ATSA 3SNNA 3OS0A 1Z25A 1HMVA 3ITHA 1R0AA 3T3FA 5AQPA 4CIGA 3OYGA 5M1OA 4FL9A 3AVJA 4WFNL 4F2SA 3V9UA 2PBDA 5HLFA 1VQ8N 2FBYA 4LSNA 1Q81O 2G8IA 1IO2A 3QEVA 3CM5A 3VA0A 4JKGA 3MEDA 4FVMA 1BHLA 4JRPA 3AY9A 2GTDA 4DTPA 4BGBA 3RRHA 1XHZA 4JV5K 4RW4A 4MLEA 3SK3A 1JXEA 4IJAA 4Z4CA 1NK0A 4E7LA 3MXIA 3BGRA 2PAVA 4H4MA 1BA0A 4CJPA 4DUZK 4CEZA 4FPAA 5HP1A 3AVCA 4I6MB 4PKHA 1TKXA 1VSEA 1TKDA 1BUPA 4EFHA 3MN7A 2D5RA 3U3YA 1ASVA 3PUFA 2ZE2A 4X64K 5DM6L 3QEWA 4YOVA 2KW4A 5AQXA 4CZIA 2F9WA 2YCHA 4KV8A 4CJLA 1SUQA 4FJ8A 1T6DA 1X9WA 1U49A 3VENA 3R8EA 3AGKA 3V1RA 4DV7K 1HRHA 3O1BA 2OPRA 3IG1A 1TAUA 4DTXA 4A57A 2O8CB 1Z6RA 4LF7K 4AF1A 3JXUA 2YHAA 5AQQA 5M1QA 4PUOA 3ZX3A 4FVUA 2PFUA 4M63C 3VTIA 2QI2A 1ZBFA 3CCQN 5DMRA 4CERA 1OKJA 3THYA 3MXMA 4L8RB 4GW6A 1ZBHA 4H03B 2ITGA 3SI6A 2NNWA 2VGMA 3HRGA 1LWFA 4H0XB 1ZXOA 2FBXA 2WFBA 4NXMK 2UXBK 1HLUA 4KHWA 2Z1HA 1S6PA 2XY7A 3AVHA 1VSLA 5HOOA 1SL0A 1K8KA 1HQEA 1T7PA 3I8DA 4DV3K 4BC5A 3LDNA 1HYVA 4CGIA 5J2NA 4CHYA 2UU9K 4DU4A 2OA8A 3C95A 1IV0A 2HHXA 4FWKA 4KTQA 3O4QA 1IBMK 3QFUA 2RF2A 1LV5A 1OH6A 5C24A 5TKWA 1TVRA 3SCXA 1IKYA 2GV9A 1Q82O 4LH4A 2D0PA 4FJ7A 2VG7A 3MX2A 4WF9L 4ILGB 3MEGA 4CD3A 4E1JA 2ZGYA 4ILJA 2VG5A 4CHZA 1BI4A 2P9PB 3BZKA 3ENHA 2A1SA 1RT4A 1BQMA 1GLAG 2XY8A 5F0XA 2E88A 3UE5A 2VQFK 1BIZA 5AR0A 1K8AO 4YY3K 3C6TA 4DSKA 3KLFA 3KTQA 4ICLA 1BA1A 4ISGA 2KHOA 1JL2A 2A6AA 2ZQBA 4BGAA 2QWPA 1IKXA 2KLAA 4J2BA 3R3LA 4LF8K 3VEZA 2P51A 2CH5A 4MO5A 2W41A 4EHTA 4NCAA 4M3YA 2YHXA 1P8ZA 1JL1A 2A42A 4FK4A 4DS5A 1HNVA 1QVGM 1XNQK 3O6WA 1KAZA 4KI4A 4LF5K 4M3TA 2IS3A 3CQ8A 3LDOA 3HZ6A 4JI8K 4UY8O 5KPRA 3K9JA 2Z1GA 1NGBA 1NGJA 4YOXA 1KCFA 3VQAA 5BR9A 5M1KA 5AZIB 3CC2N 3AO4A 2YHYA 4H0PA 5BREA 2P9KA 4H0TB 1U2VA 3ZETB 3AVNA 4MFBA 1SKSA 1NGDA 1QHTA 2JWKA 1OH5A 3BDPA 1T8EA 5KQDA 3D6RA 1VQ9N 2OCEA 3V9SA 5AZJA 2YHWA 3O1WA 4WQ4C 3OS2A 2P9SB 3H46O 3T1HK 3OBWA 1HKCA 1NJYA 3DRRA 5AQKA 1J9AA 4OVLA 3VQEA 4F8RA 2Q0UA 3DLLL 4M3WA 4CESA 2OTJN 3DXKB 5M1FA 3CC7N 3VESA 3V4IA 3PX0A 1NG9A 3HOSA 4JAXA 3L2UA 4B1VA 4CJ7A 3F73A 4DB3A 4JI5K 5ADXA 4DSEA 4WFBL 3PIOL 3KLEA 5KRTA 4KB1A 2NRXA 2B5JA 4CGFA 4O8KA 4CJ4A 3VETA 1XNRK 1JLQA 3G25A 3TAQA 2QWRA 4NLBA 4FM2A 2QWQA 3HBTA 4JHDB 1TUUA 4JI6K 4FZZA 3CERA 4FWOA 1QVFM 3DWLA 3C94A 4HUGA 3EO3A 4B8AB 1S1VA 3MCAB 1NKCA 4QAGA 3VPZA 3FZMA 1CZ9A 1FXXA 4B9QA 3TTDA 4ELUA 3F9MA 5LMNK 1UA1A 5AQFA 3SAHA 4CEQA 3RWUA 3O9UA 3LM9A 2AJQA 3KWGA 5AQVA 4FOIA 2BUPA 3PSFA 4B9LA 3VN5A 1VAZA 2D0OA 4CK3A 4O5BA 3DLHA 4KREA 4DF8A 4GKJK 1RT2A 4IOAL 1CZBA 4WQ5C 1KSPA 3WNFA 2VWJA 4GVEA 3CCMN 3FZHA 3MECA 4JI0K 1VQPN 2HBLA 2Y1JA 3D2FA 1DTQA 1RGIA 4H5VA 1UA0A 1QSLA 4N5SA 3HP9A 3CJBA 4DR4K 3ZSQA 3CCRN 3QLHA 4KI6A 1NGCA 3VQ4A 3C7NB 3L2WA 2ZWHA 3EE9A 1X3MA 3ID6A 4K8ZA 1D4XA 3NDKA 5GIOA 2GUIA 3E9LA 4J2EA 1UAXA 3QNNA 1S1XA 3O9SA 5AQJA 2IDOA 3U6FA 4RW8A 2Z1IA 2UXDK 4CEFA 3RSEB 3ENOA 1NK7A 1E4GT 3VQ6A 4AHVA 1JLCA 1VQ6N 3FZLA 1J54A 5KGXA 1E3MA 2O8EB 4FM1A 2F9TA 3THXA 3CMEN 4BRAA 4CJTA 3GG4A 4A5BA 1KFDA 1Q18A 1TL1A 3FZKA 2QKKA 2Q3SA 4CI6A 4B9MA 1VQON 2WONA 4FLVA 4IXCA 4KKOA 4W5QA 2HHHK 1IBKK 4FWRA 3DOKA 4TSXA 4OJRA 4YDUC 1KXPA 3UKUB 1RDBA 4BACA 2P9UB 4KFBA 3NMUA 1RNHA 1F21A 4CJUA 2F96A 1EKEA 4PKGA 4FJNA 3AAPA 5M1PA 1C0TA 2YKMA 4JI4K 3AO3A 4AHCA 4C8KA 3SV3A 2NRZA 1XHXA 3U9DA 4LF6K 3VTHA 2X78A 3CPEA 4B3OA 4I2PA 1RBUA 5HRPA 3TSUA 2HVHA 5K14A 3D0PA 3S41A 3HP6A 4CF0A 1YF5L 3NCIA 4WYBA 4DQSA 1BCMA 3O9RA 2EX3A 3QEIA 4CD1A 2Q31A 1YIJN 2P1JA 3VGMA 3LP1A 1JJ2M 2DTUA 4AM6A 1NJZA 4IKFA 3ENBA 4JI2K 2RKIA 4IFVA 2J4RA 4WCEL 1SZ2A 4OLAA 4LFAK 2P9NB 3OYLA 1IBLK 1OH7A 1CXQA 5CR4A 3THVA 1S9EA 2Z1JA 4CJKA 3R9PA 4XH4A 4OPAA 4E7JA 5EVZA 5EY4A 4BDZA 3ZEUB 3AA4A 3AA5X 3EZ5A 2YNGA 4FSVA 2IOCA 4E19A 3QBXA 4JKEA 4C8NA 4M3ZA 4GVMA 2KZMA 4JKCA 1VQLN 1DEJA 1L3UA 3AVKA 1ZBSA 1SL2A 3WXMB 3OYJA 1X9JA 3I0RA 2HVIA 3K5OA 3WXLA 4M42A 1SV5A 4IZ9A 1EETA 1YTAA 4KH4A 3SJHA 2F8SA 3HT3A 4AHTA 3P39A 4OKEA 4HCBA 2V7ZA 5AQTA 3QIPA 4DR3K 4CJFA 4GV9A 3VQ8A 5BRHA 5AQOA 1J6ZA 3R1XA 4LD0A 3EE8A 1T3VA 5KQ8A 4GV6A 2KFNA 4CF8A 3TAGA 3B6OA 4M7YA 1LW0A 1S72N 4C1NK 1VRUA 4M7XA 3I56N 1TYQB 3TSPA 1RT5A 3D7EO 3P38A 3ZSZA 4FXDA 3P1GA 4CJRA 4MLHA 4B8CA 4HHTA 2HB5A 3D2EB 4J2DA 3L2RA 3PSIA 2ITMA 3QETA 3VGKA 3MN9A 4HVJA 4NCGA 2BTFA 2OZSA 3M8PA 4Z4HA 5FPMA 2ASOA 1IKWA 4CFDA 4FJHA 5JVGL 3UKRA 3LDLA 4DTNA 4DTOA 4DR2K 4CHQA 4A59A 1NM1A 1HQUA 5AQUA 2UUAK 3U8XA 4JD2B 2QW9A 5BPLA 4CEBA 2O4IA 4AHRA 4XH1A 3MN5A 4K8XA 5FRMA 5T7BA 3KIOA 2DFEA 3GDQA 2I7PA 3JYTA 1YI2N 4LFCK 2O8CA 3V6DA 1JLEA 3BEXA 5E41A 2G8KA 2Q0RA 4WE1A 5AQWA 4O55A 4FJMA 1T6CA 4QS9A 3PY8A 5KTQA 1SQKA 3AGRA 3SPYA 1RBRA 4HUFA 1KLNA 3OBYA 4DU3A 3T1YK 1C0GA 2PZSA 5AQHA 1VQNN 5J2QA 4OO1J 4NXNK 5KGWA 5SZTA 2H3GX 4IG3A 1X9SA 3H3OB 3K9KA 4Y1CA 3ULDA 3AV9A 3EY1A 3HVTA 4YOUA 4R79A 3KK2A 4DTRA 3ZT3A 4CBWA 2GEMA 2I5JA 3GL1A 1NJIO 4CEAA 3NH1A 4DTSA 2E8AA 5E26A 1G99A 2P9IB 2RPIA 4CE9A 1E4FT 2UYTA 4ZTJA 4UQGA 4J2AA 4FWNA 3V81A 3KKSA 4IO8A 4CW7B 2I7NA 4A62A 2XY6A 1ZBIA 1WNSA 4F9OA 4LY7A 4AILC 2ZM6K 5CZ1A 3SZ2A 3DOLA 3KZBA 3HL8A 3ZT1A 4CZMA 3U9ZA 2NUBA 1OVYA 1VSFA 4DLEA 3K5NA 4CJEA 3F9KA 5HL7L 3VERA 4FWPA 4O0JA 3OYHA 3CF5L 1BO5O 1OVQA 5AQYA 4CZEA 4CIFA 1TL3A 2YV0X 5C10A 2ZD1A 4FLTA 3LAMA 1NK5A 4OX9K 3F2KA 5FLXO 4FJ5A 4KHNA 3EYZA 3FLCO 1NOYA 3MX5A 4BQLA 1RDWX 4E0DA 3AAQA 1M1KO 1NK4A 4Z4FA 4QCLA 5BN9A 2EHGA 3NGYA 3PO5A 2NRTA 4B1YB 3L6QA 1RDAA 2E6LA 3LAKA 3VQ7A 3H6EA 4DWIA 1FKOA 3CJAA 5GAGP 1HPZA 1WSJA 1C0FA 4BWJA 1FJGK 4JKGB 3SUQA 4ZTFA 2YI1A 2O8DA 2KTQA 1CZAN 1WSIA 3PX6A 3G0ZA 4BRMA 3IFRA 4BRFA 1X1PA 3M5RA 1VSJA 2HBMA 5BR8K 2FXUA 3OYKA 2BGGA 1JLBA 1LCUA 3WNHA 3AVLA 1TGOA 1QZ6A 2IIRA 3TARA 3IDHA 1WSGA 4A5AA 5LY3A 4IFYA 1NNEA 1GLBG 4H0OA 2WBNA 3ISNC 1XC3A 4N76A 4I9LA 1J53A 1VSMA 2OPPA 4JKDA 5F2RA 5AFUA 4DG1A 4EHUA 3RMCA 1GLJO 3LWMA 3SLCA 5CYQA 2FC0A 4Q5VA 4OKKA 4W5RA 2VGNA 1QQNA 1TK5A 5D3GA 4CF9A 3DXKA 1VQMN 4MO4A 2DPNA 3VQDA 4BC3A 1RT3A 1ZBUA 2DFHA 4JKHA 1VHXA 3QBWA 4BE2A 4DQQA 1S3XA 3ZT0A 4KB0A 5HRSA 5CE3A 1MWKA 1EXQA 4Y0WA 4FZXC 1KFSA 3VA3A 4Q0BA 4PHTX 1VQ7N 4E1MA 1YJWN 3LPUA 3ZYYX 3WQTA 5GAHP 2PY5A 3L3UA 4C1NI 2A1RA 3QICA 3E9PA 5AQRA 2G8VA 1YHQN 2NRRA 3THYB 3A5MC 3ATVA 1I94K 1SS6A 4PL7A 1RTHA 1K9MO 3GBTA 4CECA 3KLHA 4IOCL 3SV4A 1JCFA 4O44A 4FJ9A 1DLOA 5I42A 3SUNA 1SKWA 3K5MA 3D45A 3VEXA 3P4IA 2ATQA 3JSMA 4B9SA 5JLFA 3BF3A 4FPBA 3QO9A 1K6YA 4IBNA 3SYZA 4Z4EA 1FKPA 1WBDA 4CIEA 5CZ2A 1RBSA 3CHWA 3M8RA 4OPKA 3C6AA 4FWQA 1BU6O 3CJ7A 4JNEA 5M1NA 2P9LB 4CJQA 3HM9A 1KVCA 4DSIA 3SMSA 4K43A 3QESA 3WEEA 3DRPA 4KBOA 3H1QA 3VQBA 1Q9YA 4B3SK 3CFPA 1D9FA 1P90A 4H5TA 3CJ9A 3TAPA 3KD1E 3C6UA 3RMBA 4JKBA 1HYSA 1XUPO 3AVGA 3J7AP 2V52B 3OYMA 2G8WA 3MK6A 3SAGA 5AQSA 4FJJA 1BI4B 5FPEA 3K58A 2VQEK 3WQUA 2D4WA 3WXKA 4DF4A 5FRNA 2CGLA 2WTUA 4DV6K 5J2MA 1H1VA 3AO5A 3MN6A 2XRIA 1NGFA 4Z94A 1B9DA 2E4LA 2O8BB 1ZC6A 3LWLA 3DRSA 4KHUA 4CK2A 4YOYA 3B6PA 3E01A 3BF1A 3ZSOA 4PWDA 4IWVA 1Q8IA 3HOTA 4GV3A 5KPZA 4DR1K 1NGHA 2KFZA 1W9HA 2PYLA 4CHNA 2P9UA 3LPTA 3V9XA 4BG9A 3DAWA 1L5UA 1SAZA 1TV6A 3LP0A 2OZMA 1KLMA 3EKUA 4HTUA 3SQ4A 3AVAA 3ASMA 3HTVA 4CGHA 1NKBA 2GX9A 2WC9A 4LFBK 1RCHA 2BANA 4B9TA 2X6SA 2D0BA 3CC4N 1REVA 2HHTA 5EX5A 1BL3A 1NGEA 1ILYA 2G8UA 2W6LA 3LM2A 4JS4A 3Q7BA 1V4SA 4CZHA 4FJLA 1S5JA 2W6KA 4DS4A 1HKBA 4X62K 1BWFO 5FPDA 3OYDA 2RHKA 2UUBK 1BG3A 5JICA 3ZSWA 4CEEA 3MAQA 3OY9A 2IVPA 3W3DA 1VSIA 1SL1A 2ETJA 4NO7A 1DKGD 4IFEA 3DLBA 3RVCA 1WBBA 2UXCK 3J7ZO 1NK6A 4CHOA 2QA4N 3PV8A 4XIUA 3BP8A 2ZJPL 2A5XA 2A40A 2O8FB 4F3OA 3VQQA 1DT9A 1VSKA 4ZHRA 4CGJA 4JS5A 3H45C 1Y64A 4H5RA 2HHVA 3NHGA 4QS7A 4FJIA 4BRCA 5BPMA 4YFUA 4Y1DA 4ID1A 1RT1A 4FK0A 4W5OA 4DSFA 4DV0K 4FK2A 4GKKK 2Q36A 5JS2A 3HPOA 2HHSA 4OGCA 3WT0A 4BRHA 4OGEA 1A5VA 3MWPA 1NK8A 2B4JA 4H0VB 4K42A 5C42A 3CETA 3KHYA 5DM7L 2QWMA 4Z4IA 5SWMA 1T05A 4OKJA 4FO0A 1U04A 4DCHA 5KI6A 4EZ6A 4DTJA 1NMDA 4JK9A 3CFRA 2A41A 3KWIA 3NE6A 3HSTB 2NRWA 3O80A 4BRNA 4BRDA 3FR0A 5AQIA 3QDKA 3SUPA 3ZSYA 5E84A 1B92A 3OHRA 4RCHA 5CHIA 4LF9K 3WNEA 4N56A 2DY4A 2ZJRL 3PLAA 4YOTA 4E7HA 1J5OA 2V7YA 3HYFA 1C1BA 5FPNA 4B1WB 1VK0A 3CFOA 4IO9L 2GBZA 3LDSA 4B1XB 2RE2A 3DXMB 3FFKB 2F7TA 3SBTA 1TUYA 2HF3A 2GUPA 4OPJA 2HNDA 3K0SA 3O4NA 5LL6Z 3DLKA 3J7YP 4KHYA 1NMNA 3LZIA 3HVRA 4XH5A 4K41A 1I3AA 2VG6A 2OTLN 3UIQA 3IS9A 1NLVA 3ULEA 2FBTA 4CGGA 2IGIA 3JAMO 5H1SQ 3RMAA 1QQCA 2YNHA 3THXB 5C25A 4FCYA 4FLUA 4RW7A 1C1AA 1GOBA 1L3VA 2PYJA 3JS6A 1YUWA 1EX4A 3B8AX 3U4LA 5KPTA 1HJOA 3TTCA 4DSJA 3CCJN 1S1TA 4BQZA 1HUXA 3MEEA 2E6MA 2YNFA 1BCOA 2D0AA 1LW2A 4B1ZA 4YORA 5C15A 1C6VA 3KKRA 4BR5A 2YNIA 4H5WA 4L3QA 3QEXA 1NGIA 2JGUA 1O13A 3I33A 4AQYK 2QTDA 3RR8A 3A8YA 3OVNA 3PO4A 3WUHA 2X74A 3THWB 1QSYA 4X66K 1UOCA 1T03A 1HNZK 3AO1A 3BZCA 2ZGZA 2IAJA 5AJ3K 4ID5A 4NYFA 4NB4A 3MDQA 3HO1A 3RTVA 3OYFA 2P9IA 4BRIA 2BE2A 1EO1A 1BDGA 5GIPA 4I6MA 3LL3A 4HUEA 2NLXA 3WNGA 4JEPA 1WB9A 4FWLA 3OYBA 4XEIA 4PY5A 2RN2A 3ID8A 3O3GA 2W40A 4KTWA 1RTDA 3ZX0A 1QZ5A 2VWBA 2E2QA 5BN8A 3CM6A 3VF6A 3Q7CA 4CHPA 3TAEA 3SAFA 3I0SA 4CJWA 1JCGA 1JCEA 4X65K 3OYCA 2OPSA 1BGXT 3OS1A 3N4QA 3IRXA 5LJWA 1TK8A 5BPNA 2HHUA 2GWKA 1U47A 1JLFA 4FZYA 1ASWA 3M8SA 1TKTA 4YHHK 1S6QA 3ZSXA 1ZBLA 2IC3A 1Q86O 4DTUA 5AQGA 4YOWA 2FF3B 2WOMA 4FJGA 1YJNN 3OYNA 5J2PA 3SUOA 4IG0A 1CXUA 4DFKA 4JN4A 1YXQA 1BOTO 5IWAK 3IKMA 3NF9A
chains in the Genus database with same CATH topology
3C94A 4HUGA 3P5JA 4FLZA 4I9LA 1J53A 4B8AB 1VSMA 1IKVA 2OPPA 3AVFA 1ASUA 1S1VA 4RG8A 2XO7A 4DG1A 3RMCA 1D8YA 4E89A 3LWMA 4Z4GA 2W42A 1NKCA 5CYQA 2FC0A 4QAGA 4OKKA 4Q5VA 3LP3A 4I9QA 4W5RA 1CZ9A 3S3MA 1FXXA 1UWBA 4BDYA 4ELUA 1TK5A 4CF1A 3TAMA 1UA1A 5D3GA 4CF9A 3T19A 4CEQA 3RWUA 3ZT4A 2HHWA 4BWMA 3VQDA 2AJQA 1RT3A 1ZBUA 2DFHA 5J1EA 4B9LA 3VN5A 4CCHA 3AA3A 3PX4A 4CK3A 4O5BA 4PQUA 3DLHA 4KREA 4DF8A 1RT2A 4BE2A 1CZBA 3ZSVA 1RBTA 4DQQA 4F3TA 1KSPA 3ZT0A 4KB0A 5HRSA 1EXQA 3WNFA 2VWJA 1O1WA 4FLXA 4FZXC 1KFSA 1T7PA 3AVBA 4DLGA 1RBVA 4CK1A 3NGZA 3VA3A 1S1UA 1D5AA 3MECA 4M41A 4EP4A 3QEPA 3SQ0A 4E1MA 2Y1JA 3LPUA 3DLRA 3ZSRA 4JLHA 3L3UA 3VQ9A 2PY5A 1WSEA 2A1RA 1DTQA 1U4BA 3SQ2A 1UA0A 1QSLA 4N5SA 1BQNA 3V1QA 3HP9A 2G8VA 4BDPA 1U45A 2JLEA 3NF7A 3NFAA 3ZSQA 5HROA 1SKRA 4FYDA 3QLHA 4I2QA 4KI6A 1RILA 1B9FA 1RTHA 3VQ4A 2P5OA 3LZJA 1KVAA 4CECA 3KLHA 3L2WA 3SV4A 4K8ZA 4CJ5A 3NDKA 2GUIA 4O44A 4FLYA 4FJ9A 1DLOA 1UAXA 3QNNA 3L2QA 1S1XA 3S3OA 4J2EA 5I42A 3SUNA 3OYEA 1SKWA 3TI0A 5CYMA 3K5MA 2X6NA 3DYAA 4LSLA 3D45A 2HNYA 5EU7A 3NAEA 2IDOA 3U6FA 4KTZA 2VWKA 2ATQA 4RW8A 2Z1IA 1D9DA 4CEFA 1NK7A 4IDKA 1IH7A 3JSMA 3VQ6A 4B9SA 4DQIA 4AHVA 3ALYA 3L8BA 3DLEA 1JLCA 4H4OA 1J54A 3QO9A 1K6YA 4IBNA 3NBPA 4O4GA 5KGXA 1GOCA 3K59A 3SYZA 1FKPA 4Z4EA 1HJRA 4FM1A 1NKEA 4CIEA 5CZ2A 5HRNA 1RBSA 4CJTA 3M8RA 3TR8A 1KFDA 4OPKA 1TL1A 3T1AA 3K57A 3KD5E 4B08A 4MQ3A 1N6QA 4B9UA 2QKKA 2Q3SA 4B9MA 4CJQA 3HM9A 1KVCA 2WONA 3OJSA 4FLVA 1WSHA 4DQRA 1NOZA 3QERA 1LWEA 4KKOA 4DSIA 4W5QA 1VRTA 1GOAA 3KK1A 3QESA 3KLIA 3DOKA 4TSXA 4OJRA 1EP4A 4CFBA 3SPZA 3DRPA 3L3VA 1U48A 4EP5A 1JKHA 1RDBA 3VQBA 1RTJA 4BACA 1BISA 1Q9YA 3CFPA 1IG9A 1XC9A 1D9FA 4KFBA 4C8LA 5KRSA 3HJFA 1KTQA 3TAPA 1RNHA 5HBMA 3V1OA 3KD1E 1F21A 3C6UA 4CJUA 3RMBA 2F96A 4M3RA 4B9VA 1EKEA 1HYSA 5I3UA 3AVGA 4FJNA 3CYMA 2P5GA 1L3TA 1C0TA 1QS4A 3OYMA 3HK2A 2YKMA 4CFCA 3AO3A 4RW6A 2G8WA 4AHCA 4C8KA 1NJXA 3SV3A 4DFJA 3RR7A 1S9GA 4FJJA 1XHXA 1BI4B 2OPQA 1Y97A 4FM0A 1KRPA 3U3GA 3K58A 2X78A 1JXBA 4B3OA 4DF4A 5FRNA 4I2PA 1N5YA 4QOZB 4KO0A 4E7KA 1RBUA 5J2MA 5HRPA 3AO5A 1WLJA 3OYAA 2XRIA 4R5PA 3SNNA 3OS0A 1Z25A 3V9ZA 1B9DA 1HMVA 2E4LA 3S3NA 2HVHA 5K14A 3ITHA 2DFFA 3DRSA 3LWLA 4CK2A 3D0PA 4KHUA 4AHSA 4CF0A 3LALA 3B6PA 3E01A 1C0MA 3HP6A 4DQSA 3NCIA 3T3FA 1R0AA 4B9TA 3ZSOA 4PWDA 1BCMA 4CEOA 2EX3A 3QEIA 1Q8IA 1A5XA 4CIGA 3AA2A 3OYGA 4CJSA 2P1JA 3AVJA 2KFZA 1NK9A 3RMDA 1W9HA 2PYLA 3LP1A 3QIOA 4F2SA 3V9UA 4CHNA 2DTUA 3LPTA 5HLFA 1NJZA 3V9XA 2HW3A 2FBYA 4IKFA 4LSNA 2G8IA 1L5UA 1IO2A 2RKIA 4IFVA 3QEVA 1TV6A 3CM5A 4DFMA 4N41A 4OLAA 3LP0A 3VA0A 2HHQA 2OZMA 3MEDA 1KLMA 3OYLA 2B6AA 4FVMA 1BHLA 2HMIA 4HTUA 3SQ4A 1CXQA 3AVAA 4AHUA 4DFPA 3THVA 3ASMA 1S9EA 2Z1JA 4CJKA 4CGHA 4JRPA 1NKBA 4DTPA 4EZ9A 4E7JA 3RRHA 1XHZA 4RW4A 4BDZA 3AA4A 1JXEA 3AA5X 1RCHA 2BANA 2LSNA 4Z4CA 3KJVA 2X6SA 2YNGA 2D0BA 3EZ5A 4E7LA 3BGRA 3MXIA 1REVA 1NK0A 2HHTA 4H4MA 4CJPA 4CEZA 1RDCA 2IOCA 1BL3A 4E19A 4C8NA 2G8UA 4M3ZA 3ZT2A 5HP1A 4GVMA 4JS4A 3AVCA 2KZMA 1TKXA 1L3UA 4FJLA 3O3HA 1S5JA 1VSEA 3AVKA 4RW9A 4DS4A 1TKDA 2QK9A 3HPGA 1SL2A 3OYJA 1RT6A 4CGDA 2D5RA 3OYDA 3U3YA 1ASVA 3PUFA 3I0RA 2HVIA 2ZE2A 3K5OA 1TK0A 3QEWA 4DU1A 3K5LA 2KW4A 4M42A 4FW2A 1SV5A 2FBVA 3ZSWA 1WN7A 1EETA 4CEEA 2R7YA 3NF8A 3MAQA 1YTAA 3OY9A 4KV8A 4CJLA 2F8SA 3HT3A 4AHTA 1VSIA 1SUQA 4OKEA 4HCBA 4FJ8A 3DMJA 1WAJA 1SL1A 2ETJA 2Y1IA 3QIPA 4Z0UA 1X9WA 3DLBA 4CJFA 1U49A 3VQ8A 3NGIA 5FDLA 4DQPA 4NCBA 3V1RA 1NK6A 1HRHA 4KAZA 4CFAA 4CHOA 2OPRA 3PV8A 1C1CA 3IG1A 4LD0A 4XIUA 4DTXA 4KHQA 1TAUA 1FK9A 4C8MA 2KFNA 4CF8A 2HNZA 3TAGA 4JRQA 4F3OA 3VQQA 2YHAA 1A5WA 1VSKA 3B6OA 4PUOA 1LW0A 4ZHRA 4CGJA 4JS5A 3AVMA 2HHVA 1VRUA 1QSSA 3NHGA 4FJIA 5DK5A 4YFUA 4Y1DA 1QTMA 1ZBFA 4ID1A 1RT5A 1RT1A 2D0CA 4FK0A 3IAYA 3ZSZA 4W5OA 4DSFA 4FK2A 5DMRA 1G15A 4FXDA 3P1GA 4CJRA 4CERA 4B8CA 4HHTA 5JS2A 2HB5A 3NF6A 3HPOA 3MXMA 3O3FA 4L8RB 4GW6A 4J2DA 3L2RA 1ZBHA 4OGCA 2HHSA 1W0HA 2ITGA 4W5TA 3QETA 3SI6A 1LWFA 4HVJA 4NCGA 4M3XA 2FBXA 4OGEA 4CJVA 2OZSA 3M8PA 1A5VA 4CEDA 4Z4HA 1NK8A 2B4JA 4G1QA 5C42A 2Z1HA 4KHWA 2O4GA 1RDDA 1IKWA 1S6PA 3DM2A 3AVHA 4CFDA 2XY7A 2G8HA 1MU2A 1BIUA 4FJHA 1VSLA 4DTNA 4Z4IA 4C8OA 4DTOA 5SWMA 1T05A 3QNOA 4OKJA 3SJJA 1SL0A 4CHQA 1VSDA 4GMJB 1HQEA 1U04A 1VSHA 4E1NA 1HQUA 3LANA 1C0UA 3OJUA 3I8DA 4BE0A 4N47A 5KI6A 4EZ6A 4DTJA 4BE1A 1HYVA 4CEBA 2O4IA 4AHRA 3DLGA 4CGIA 4K8XA 5T7BA 3CFRA 3KIOA 2DFEA 5FRMA 5J2NA 2QKBA 3JYTA 4CHYA 3NE6A 1WAFA 3HSTB 4DU4A 2OA8A 3C95A 2XY5A 1Q9XA 2HHXA 3V6DA 4KTQA 3O4QA 1JLEA 5E41A 2G8KA 4WE1A 2RF2A 1LV5A 3SUPA 1RTIA 4B9NA 3ZSYA 1B92A 3M8QA 4O55A 4M45A 4FJMA 3PY8A 5KTQA 3MXJA 3WNEA 4N56A 5C24A 3SCXA 3AO2A 1TVRA 3SPYA 1TKZA 2DY4A 1IKYA 2GV9A 1RBRA 4HUFA 1KLNA 4LH4A 4E7HA 1J5OA 4DU3A 4FJ7A 3HYFA 1C1BA 2VG7A 2PZSA 1VK0A 3CFOA 5J2QA 2GBZA 3MEGA 4PA1A 5KGWA 5SZTA 3LDSA 1ZYQA 1L3SA 1JLGA 4HCCA 3ZCMA 4IG3A 1X9SA 4DTMA 4I7FA 3NH2A 5HRRA 2VG5A 4LH5A 1XI1A 4CHZA 4OPJA 2HNDA 1BI4A 3O4NA 4Y1CA 3ULDA 3AV9A 3DLKA 1JLAA 3HVTA 3KK2A 3EY1A 2A1SA 4DTRA 4KHYA 3ZT3A 3LZIA 1RT4A 3NH0A 3HVRA 4YNQA 2XY8A 1BQMA 1I3AA 2VG6A 1YT3A 4KPYA 3UIQA 3IS9A 2I5JA 4CEAA 1BIZA 3NH1A 4DTSA 3LP2A 2FBTA 3C6TA 4CGGA 2IGIA 3KLFA 4DSKA 3KTQA 4ICLA 3VQPA 3RMAA 1QQCA 2RPIA 2YNHA 1JL2A 5C25A 1S1WA 2BDPA 3H08A 4FCYA 4CE9A 4FLUA 4RW7A 1C1AA 1GOBA 1HNIA 2ZQBA 2YHBA 4NYNA 1X9MA 1IKXA 1L3VA 2PYJA 4J2BA 4ZTJA 4UQGA 1EX4A 4H8KA 4J2AA 2XHBA 3K2PA 3V81A 2P51A 4DSJA 3KKSA 4NCAA 2XY6A 1ZBIA 1WNSA 4M3YA 1S1TA 4LY7A 4AILC 3MEEA 2E6MA 2YNFA 1BCOA 1LAVA 2D0AA 1LW2A 5CZ1A 1JL1A 1WSFA 2YKNA 3DOLA 3SZ2A 3HL8A 4DS5A 4FK4A 1C6VA 4CF2A 1HNVA 3KKRA 3ZT1A 2QXFA 4FJXA 1YTUA 1Z26A 2NUBA 3KK3A 4KI4A 1VSFA 1YVUA 3K5NA 4CJEA 4DLEA 2IS3A 2YNIA 3F9KA 3CQ8A 3QEXA 4FW1A 4M3TA 2JGUA 2Z1GA 4O0JA 3OYHA 3OYIA 3RR8A 1KCFA 3OVNA 3PO4A 3VQAA 4Q0BA 4AH9A 1XWLA 4CIFA 3AO4A 2X74A 1TL3A 2YV0X 1QSYA 1NJWA 2ZD1A 4FJKA 2F8TA 1UOCA 1T03A 3DI6A 3AO1A 4FLTA 3LAMA 1NK5A 2IAJA 3KLGA 3RRGA 4ID5A 4NYFA 4E7IA 5FROA 4FJ5A 4KHNA 3HO1A 3EYZA 1NOYA 1RT7A 3AVNA 4MFBA 3RTVA 3OYFA 3HPHA 4ELTA 1CLQA 1SKSA 2BE2A 1QHTA 4E0DA 3BDPA 3CG7A 4HUEA 3VQCA 1NK4A 1T8EA 3WNGA 1ITGA 1HYZA 4Z4FA 4KHSA 3OYBA 3V9SA 4QCLA 2EHGA 3TWHA 3NGYA 4E3SA 3PO5A 2KZZA 4PY5A 2RN2A 2KQ2A 3O3GA 3OS2A 1RDAA 4KTWA 3V9WA 2E6LA 3LAKA 1RTDA 3VQ7A 3S9HA 4O0IA 1I39A 3P83D 4DWIA 1FKOA 1NJYA 1HPZA 3CM6A 3DRRA 1TAQA 1KVBA 4CJ3A 4CHPA 3TAEA 1J9AA 1WSJA 4OVLA 3VQEA 4DSLA 4F8RA 3AVIA 4M3WA 4CESA 4F2RA 4BWJA 3FFIA 3I0SA 3SUQA 1DTTA 4CJWA 4ZTFA 3V4IA 2G8FA 3PX0A 3OYCA 2KTQA 2OPSA 1BGXT 3QINA 3OS1A 3L2UA 1WSIA 3F73A 3IRXA 4M3UA 1TK8A 2HHUA 1LWCA 3PX6A 3G0ZA 1U47A 1JLFA 4DSEA 4OLBA 3TAFA 4FZYA 1X1PA 1ASWA 3M8SA 2OYQA 3KLEA 1VSJA 5KRTA 1TKTA 3TABA 3OYKA 4FLWA 4KB1A 2BGGA 5CY4A 2B5JA 4CGFA 1LAWA 1JLBA 1S6QA 3WNHA 3ZSXA 3AVLA 2IC3A 4CJ4A 3A2FA 1ZBLA 4ELVA 4KRFA 1JLQA 3G10A 4DTUA 1TGOA 3TANA 3TAQA 3HXMA 2WOMA 4FJGA 3TARA 3OYNA 5J2PA 1WSGA 4DMNA 4IFYA 4F4KA 3SUOA 4FM2A 4IG0A 1CXUA 4DFKA 3VQ5A 4W5NA 3SQ1A 3ISNC 4FZZA 5JS1A 1QE1A 3L2VA 4N76A 3NF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C94 A;  4HUG A;  3P5J A;  4FLZ A;  4I9L A;  1J53 A;  4B8A B;  1VSM A;  1IKV A;  2OPP A;  3AVF A;  1ASU A;  1S1V A;  4RG8 A;  2XO7 A;  4DG1 A;  3RMC A;  1D8Y A;  4E89 A;  3LWM A;  4Z4G A;  2W42 A;  1NKC A;  5CYQ A;  2FC0 A;  4QAG A;  4OKK A;  4Q5V A;  3LP3 A;  4I9Q A;  4W5R A;  1CZ9 A;  3S3M A;  1FXX A;  1UWB A;  4BDY A;  4ELU A;  1TK5 A;  4CF1 A;  3TAM A;  1UA1 A;  5D3G A;  4CF9 A;  3T19 A;  4CEQ A;  3RWU A;  3ZT4 A;  2HHW A;  4BWM A;  3VQD A;  2AJQ A;  1RT3 A;  1ZBU A;  2DFH A;  5J1E A;  4B9L A;  3VN5 A;  4CCH A;  3AA3 A;  3PX4 A;  4CK3 A;  4O5B A;  4PQU A;  3DLH A;  4KRE A;  4DF8 A;  1RT2 A;  4BE2 A;  1CZB A;  3ZSV A;  1RBT A;  4DQQ A;  4F3T A;  1KSP A;  3ZT0 A;  4KB0 A;  5HRS A;  1EXQ A;  3WNF A;  2VWJ A;  1O1W A;  4FLX A;  4FZX C;  1KFS A;  1T7P A;  3AVB A;  4DLG A;  1RBV A;  4CK1 A;  3NGZ A;  3VA3 A;  1S1U A;  1D5A A;  3MEC A;  4M41 A;  4EP4 A;  3QEP A;  3SQ0 A;  4E1M A;  2Y1J A;  3LPU A;  3DLR A;  3ZSR A;  4JLH A;  3L3U A;  3VQ9 A;  2PY5 A;  1WSE A;  2A1R A;  1DTQ A;  1U4B A;  3SQ2 A;  1UA0 A;  1QSL A;  4N5S A;  1BQN A;  3V1Q A;  3HP9 A;  2G8V A;  4BDP A;  1U45 A;  2JLE A;  3NF7 A;  3NFA A;  3ZSQ A;  5HRO A;  1SKR A;  4FYD A;  3QLH A;  4I2Q A;  4KI6 A;  1RIL A;  1B9F A;  1RTH A;  3VQ4 A;  2P5O A;  3LZJ A;  1KVA A;  4CEC A;  3KLH A;  3L2W A;  3SV4 A;  4K8Z A;  4CJ5 A;  3NDK A;  2GUI A;  4O44 A;  4FLY A;  4FJ9 A;  1DLO A;  1UAX A;  3QNN A;  3L2Q A;  1S1X A;  3S3O A;  4J2E A;  5I42 A;  3SUN A;  3OYE A;  1SKW A;  3TI0 A;  5CYM A;  3K5M A;  2X6N A;  3DYA A;  4LSL A;  3D45 A;  2HNY A;  5EU7 A;  3NAE A;  2IDO A;  3U6F A;  4KTZ A;  2VWK A;  2ATQ A;  4RW8 A;  2Z1I A;  1D9D A;  4CEF A;  1NK7 A;  4IDK A;  1IH7 A;  3JSM A;  3VQ6 A;  4B9S A;  4DQI A;  4AHV A;  3ALY A;  3L8B A;  3DLE A;  1JLC A;  4H4O A;  1J54 A;  3QO9 A;  1K6Y A;  4IBN A;  3NBP A;  4O4G A;  5KGX A;  1GOC A;  3K59 A;  3SYZ A;  1FKP A;  4Z4E A;  1HJR A;  4FM1 A;  1NKE A;  4CIE A;  5CZ2 A;  5HRN A;  1RBS A;  4CJT A;  3M8R A;  3TR8 A;  1KFD A;  4OPK A;  1TL1 A;  3T1A A;  3K57 A;  3KD5 E;  4B08 A;  4MQ3 A;  1N6Q A;  4B9U A;  2QKK A;  2Q3S A;  4B9M A;  4CJQ A;  3HM9 A;  1KVC A;  2WON A;  3OJS A;  4FLV A;  1WSH A;  4DQR A;  1NOZ A;  3QER A;  1LWE A;  4KKO A;  4DSI A;  4W5Q A;  1VRT A;  1GOA A;  3KK1 A;  3QES A;  3KLI A;  3DOK A;  4TSX A;  4OJR A;  1EP4 A;  4CFB A;  3SPZ A;  3DRP A;  3L3V A;  1U48 A;  4EP5 A;  1JKH A;  1RDB A;  3VQB A;  1RTJ A;  4BAC A;  1BIS A;  1Q9Y A;  3CFP A;  1IG9 A;  1XC9 A;  1D9F A;  4KFB A;  4C8L A;  5KRS A;  3HJF A;  1KTQ A;  3TAP A;  1RNH A;  5HBM A;  3V1O A;  3KD1 E;  1F21 A;  3C6U A;  4CJU A;  3RMB A;  2F96 A;  4M3R A;  4B9V A;  1EKE A;  1HYS A;  5I3U A;  3AVG A;  4FJN A;  3CYM A;  2P5G A;  1L3T A;  1C0T A;  1QS4 A;  3OYM A;  3HK2 A;  2YKM A;  4CFC A;  3AO3 A;  4RW6 A;  2G8W A;  4AHC A;  4C8K A;  1NJX A;  3SV3 A;  4DFJ A;  3RR7 A;  1S9G A;  4FJJ A;  1XHX A;  1BI4 B;  2OPQ A;  1Y97 A;  4FM0 A;  1KRP A;  3U3G A;  3K58 A;  2X78 A;  1JXB A;  4B3O A;  4DF4 A;  5FRN A;  4I2P A;  1N5Y A;  4QOZ B;  4KO0 A;  4E7K A;  1RBU A;  5J2M A;  5HRP A;  3AO5 A;  1WLJ A;  3OYA A;  2XRI A;  4R5P A;  3SNN A;  3OS0 A;  1Z25 A;  3V9Z A;  1B9D A;  1HMV A;  2E4L A;  3S3N A;  2HVH A;  5K14 A;  3ITH A;  2DFF A;  3DRS A;  3LWL A;  4CK2 A;  3D0P A;  4KHU A;  4AHS A;  4CF0 A;  3LAL A;  3B6P A;  3E01 A;  1C0M A;  3HP6 A;  4DQS A;  3NCI A;  3T3F A;  1R0A A;  4B9T A;  3ZSO A;  4PWD A;  1BCM A;  4CEO A;  2EX3 A;  3QEI A;  1Q8I A;  1A5X A;  4CIG A;  3AA2 A;  3OYG A;  4CJS A;  2P1J A;  3AVJ A;  2KFZ A;  1NK9 A;  3RMD A;  1W9H A;  2PYL A;  3LP1 A;  3QIO A;  4F2S A;  3V9U A;  4CHN A;  2DTU A;  3LPT A;  5HLF A;  1NJZ A;  3V9X A;  2HW3 A;  2FBY A;  4IKF A;  4LSN A;  2G8I A;  1L5U A;  1IO2 A;  2RKI A;  4IFV A;  3QEV A;  1TV6 A;  3CM5 A;  4DFM A;  4N41 A;  4OLA A;  3LP0 A;  3VA0 A;  2HHQ A;  2OZM A;  3MED A;  1KLM A;  3OYL A;  2B6A A;  4FVM A;  1BHL A;  2HMI A;  4HTU A;  3SQ4 A;  1CXQ A;  3AVA A;  4AHU A;  4DFP A;  3THV A;  3ASM A;  1S9E A;  2Z1J A;  4CJK A;  4CGH A;  4JRP A;  1NKB A;  4DTP A;  4EZ9 A;  4E7J A;  3RRH A;  1XHZ A;  4RW4 A;  4BDZ A;  3AA4 A;  1JXE A;  3AA5 X;  1RCH A;  2BAN A;  2LSN A;  4Z4C A;  3KJV A;  2X6S A;  2YNG A;  2D0B A;  3EZ5 A;  4E7L A;  3BGR A;  3MXI A;  1REV A;  1NK0 A;  2HHT A;  4H4M A;  4CJP A;  4CEZ A;  1RDC A;  2IOC A;  1BL3 A;  4E19 A;  4C8N A;  2G8U A;  4M3Z A;  3ZT2 A;  5HP1 A;  4GVM A;  4JS4 A;  3AVC A;  2KZM A;  1TKX A;  1L3U A;  4FJL A;  3O3H A;  1S5J A;  1VSE A;  3AVK A;  4RW9 A;  4DS4 A;  1TKD A;  2QK9 A;  3HPG A;  1SL2 A;  3OYJ A;  1RT6 A;  4CGD A;  2D5R A;  3OYD A;  3U3Y A;  1ASV A;  3PUF A;  3I0R A;  2HVI A;  2ZE2 A;  3K5O A;  1TK0 A;  3QEW A;  4DU1 A;  3K5L A;  2KW4 A;  4M42 A;  4FW2 A;  1SV5 A;  2FBV A;  3ZSW A;  1WN7 A;  1EET A;  4CEE A;  2R7Y A;  3NF8 A;  3MAQ A;  1YTA A;  3OY9 A;  4KV8 A;  4CJL A;  2F8S A;  3HT3 A;  4AHT A;  1VSI A;  1SUQ A;  4OKE A;  4HCB A;  4FJ8 A;  3DMJ A;  1WAJ A;  1SL1 A;  2ETJ A;  2Y1I A;  3QIP A;  4Z0U A;  1X9W A;  3DLB A;  4CJF A;  1U49 A;  3VQ8 A;  3NGI A;  5FDL A;  4DQP A;  4NCB A;  3V1R A;  1NK6 A;  1HRH A;  4KAZ A;  4CFA A;  4CHO A;  2OPR A;  3PV8 A;  1C1C A;  3IG1 A;  4LD0 A;  4XIU A;  4DTX A;  4KHQ A;  1TAU A;  1FK9 A;  4C8M A;  2KFN A;  4CF8 A;  2HNZ A;  3TAG A;  4JRQ A;  4F3O A;  3VQQ A;  2YHA A;  1A5W A;  1VSK A;  3B6O A;  4PUO A;  1LW0 A;  4ZHR A;  4CGJ A;  4JS5 A;  3AVM A;  2HHV A;  1VRU A;  1QSS A;  3NHG A;  4FJI A;  5DK5 A;  4YFU A;  4Y1D A;  1QTM A;  1ZBF A;  4ID1 A;  1RT5 A;  1RT1 A;  2D0C A;  4FK0 A;  3IAY A;  3ZSZ A;  4W5O A;  4DSF A;  4FK2 A;  5DMR A;  1G15 A;  4FXD A;  3P1G A;  4CJR A;  4CER A;  4B8C A;  4HHT A;  5JS2 A;  2HB5 A;  3NF6 A;  3HPO A;  3MXM A;  3O3F A;  4L8R B;  4GW6 A;  4J2D A;  3L2R A;  1ZBH A;  4OGC A;  2HHS A;  1W0H A;  2ITG A;  4W5T A;  3QET A;  3SI6 A;  1LWF A;  4HVJ A;  4NCG A;  4M3X A;  2FBX A;  4OGE A;  4CJV A;  2OZS A;  3M8P A;  1A5V A;  4CED A;  4Z4H A;  1NK8 A;  2B4J A;  4G1Q A;  5C42 A;  2Z1H A;  4KHW A;  2O4G A;  1RDD A;  1IKW A;  1S6P A;  3DM2 A;  3AVH A;  4CFD A;  2XY7 A;  2G8H A;  1MU2 A;  1BIU A;  4FJH A;  1VSL A;  4DTN A;  4Z4I A;  4C8O A;  4DTO A;  5SWM A;  1T05 A;  3QNO A;  4OKJ A;  3SJJ A;  1SL0 A;  4CHQ A;  1VSD A;  4GMJ B;  1HQE A;  1U04 A;  1VSH A;  4E1N A;  1HQU A;  3LAN A;  1C0U A;  3OJU A;  3I8D A;  4BE0 A;  4N47 A;  5KI6 A;  4EZ6 A;  4DTJ A;  4BE1 A;  1HYV A;  4CEB A;  2O4I A;  4AHR A;  3DLG A;  4CGI A;  4K8X A;  5T7B A;  3CFR A;  3KIO A;  2DFE A;  5FRM A;  5J2N A;  2QKB A;  3JYT A;  4CHY A;  3NE6 A;  1WAF A;  3HST B;  4DU4 A;  2OA8 A;  3C95 A;  2XY5 A;  1Q9X A;  2HHX A;  3V6D A;  4KTQ A;  3O4Q A;  1JLE A;  5E41 A;  2G8K A;  4WE1 A;  2RF2 A;  1LV5 A;  3SUP A;  1RTI A;  4B9N A;  3ZSY A;  1B92 A;  3M8Q A;  4O55 A;  4M45 A;  4FJM A;  3PY8 A;  5KTQ A;  3MXJ A;  3WNE A;  4N56 A;  5C24 A;  3SCX A;  3AO2 A;  1TVR A;  3SPY A;  1TKZ A;  2DY4 A;  1IKY A;  2GV9 A;  1RBR A;  4HUF A;  1KLN A;  4LH4 A;  4E7H A;  1J5O A;  4DU3 A;  4FJ7 A;  3HYF A;  1C1B A;  2VG7 A;  2PZS A;  1VK0 A;  3CFO A;  5J2Q A;  2GBZ A;  3MEG A;  4PA1 A;  5KGW A;  5SZT A;  3LDS A;  1ZYQ A;  1L3S A;  1JLG A;  4HCC A;  3ZCM A;  4IG3 A;  1X9S A;  4DTM A;  4I7F A;  3NH2 A;  5HRR A;  2VG5 A;  4LH5 A;  1XI1 A;  4CHZ A;  4OPJ A;  2HND A;  1BI4 A;  3O4N A;  4Y1C A;  3ULD A;  3AV9 A;  3DLK A;  1JLA A;  3HVT A;  3KK2 A;  3EY1 A;  2A1S A;  4DTR A;  4KHY A;  3ZT3 A;  3LZI A;  1RT4 A;  3NH0 A;  3HVR A;  4YNQ A;  2XY8 A;  1BQM A;  1I3A A;  2VG6 A;  1YT3 A;  4KPY A;  3UIQ A;  3IS9 A;  2I5J A;  4CEA A;  1BIZ A;  3NH1 A;  4DTS A;  3LP2 A;  2FBT A;  3C6T A;  4CGG A;  2IGI A;  3KLF A;  4DSK A;  3KTQ A;  4ICL A;  3VQP A;  3RMA A;  1QQC A;  2RPI A;  2YNH A;  1JL2 A;  5C25 A;  1S1W A;  2BDP A;  3H08 A;  4FCY A;  4CE9 A;  4FLU A;  4RW7 A;  1C1A A;  1GOB A;  1HNI A;  2ZQB A;  2YHB A;  4NYN A;  1X9M A;  1IKX A;  1L3V A;  2PYJ A;  4J2B A;  4ZTJ A;  4UQG A;  1EX4 A;  4H8K A;  4J2A A;  2XHB A;  3K2P A;  3V81 A;  2P51 A;  4DSJ A;  3KKS A;  4NCA A;  2XY6 A;  1ZBI A;  1WNS A;  4M3Y A;  1S1T A;  4LY7 A;  4AIL C;  3MEE A;  2E6M A;  2YNF A;  1BCO A;  1LAV A;  2D0A A;  1LW2 A;  5CZ1 A;  1JL1 A;  1WSF A;  2YKN A;  3DOL A;  3SZ2 A;  3HL8 A;  4DS5 A;  4FK4 A;  1C6V A;  4CF2 A;  1HNV A;  3KKR A;  3ZT1 A;  2QXF A;  4FJX A;  1YTU A;  1Z26 A;  2NUB A;  3KK3 A;  4KI4 A;  1VSF A;  1YVU A;  3K5N A;  4CJE A;  4DLE A;  2IS3 A;  2YNI A;  3F9K A;  3CQ8 A;  3QEX A;  4FW1 A;  4M3T A;  2JGU A;  2Z1G A;  4O0J A;  3OYH A;  3OYI A;  3RR8 A;  1KCF A;  3OVN A;  3PO4 A;  3VQA A;  4Q0B A;  4AH9 A;  1XWL A;  4CIF A;  3AO4 A;  2X74 A;  1TL3 A;  2YV0 X;  1QSY A;  1NJW A;  2ZD1 A;  4FJK A;  2F8T A;  1UOC A;  1T03 A;  3DI6 A;  3AO1 A;  4FLT A;  3LAM A;  1NK5 A;  2IAJ A;  3KLG A;  3RRG A;  4ID5 A;  4NYF A;  4E7I A;  5FRO A;  4FJ5 A;  4KHN A;  3HO1 A;  3EYZ A;  1NOY A;  1RT7 A;  3AVN A;  4MFB A;  3RTV A;  3OYF A;  3HPH A;  4ELT A;  1CLQ A;  1SKS A;  2BE2 A;  1QHT A;  4E0D A;  3BDP A;  3CG7 A;  4HUE A;  3VQC A;  1NK4 A;  1T8E A;  3WNG A;  1ITG A;  1HYZ A;  4Z4F A;  4KHS A;  3OYB A;  3V9S A;  4QCL A;  2EHG A;  3TWH A;  3NGY A;  4E3S A;  3PO5 A;  2KZZ A;  4PY5 A;  2RN2 A;  2KQ2 A;  3O3G A;  3OS2 A;  1RDA A;  4KTW A;  3V9W A;  2E6L A;  3LAK A;  1RTD A;  3VQ7 A;  3S9H A;  4O0I A;  1I39 A;  3P83 D;  4DWI A;  1FKO A;  1NJY A;  1HPZ A;  3CM6 A;  3DRR A;  1TAQ A;  1KVB A;  4CJ3 A;  4CHP A;  3TAE A;  1J9A A;  1WSJ A;  4OVL A;  3VQE A;  4DSL A;  4F8R A;  3AVI A;  4M3W A;  4CES A;  4F2R A;  4BWJ A;  3FFI A;  3I0S A;  3SUQ A;  1DTT A;  4CJW A;  4ZTF A;  3V4I A;  2G8F A;  3PX0 A;  3OYC A;  2KTQ A;  2OPS A;  1BGX T;  3QIN A;  3OS1 A;  3L2U A;  1WSI A;  3F73 A;  3IRX A;  4M3U A;  1TK8 A;  2HHU A;  1LWC A;  3PX6 A;  3G0Z A;  1U47 A;  1JLF A;  4DSE A;  4OLB A;  3TAF A;  4FZY A;  1X1P A;  1ASW A;  3M8S A;  2OYQ A;  3KLE A;  1VSJ A;  5KRT A;  1TKT A;  3TAB A;  3OYK A;  4FLW A;  4KB1 A;  2BGG A;  5CY4 A;  2B5J A;  4CGF A;  1LAW A;  1JLB A;  1S6Q A;  3WNH A;  3ZSX A;  3AVL A;  2IC3 A;  4CJ4 A;  3A2F A;  1ZBL A;  4ELV A;  4KRF A;  1JLQ A;  3G10 A;  4DTU A;  1TGO A;  3TAN A;  3TAQ A;  3HXM A;  2WOM A;  4FJG A;  3TAR A;  3OYN A;  5J2P A;  1WSG A;  4DMN A;  4IFY A;  4F4K A;  3SUO A;  4FM2 A;  4IG0 A;  1CXU A;  4DFK A;  3VQ5 A;  4W5N A;  3SQ1 A;  3ISN C;  4FZZ A;  5JS1 A;  1QE1 A;  3L2V A;  4N76 A;  3NF9 A; 
#chains in the Genus database with same CATH topology
 3BUZ B;  3KVG A;  3P5J A;  4FLZ A;  1IKV A;  3AVF A;  3E9O A;  1ASU A;  3LDP A;  3EZW A;  2W42 A;  4LF4 K;  2FSN A;  4FOE A;  3S3M A;  3TAM A;  4DR7 K;  2HOE A;  3M3Z A;  3MMV A;  3T19 A;  3ZT4 A;  2HHW A;  4BWM A;  3TSQ A;  4CCH A;  3AA3 A;  3PX4 A;  3WXI A;  1HPM A;  4F3T A;  1RBT A;  3C65 A;  4QS8 A;  4BRE A;  1O1W A;  5ADX H;  4FLX A;  3M1F A;  3AVB A;  1XC9 A;  4CK1 A;  1VQK N;  3QEP A;  4EP4 A;  4J8F A;  2YJE A;  3VOV A;  4BRG A;  4JLH A;  3VQ9 A;  2EWS A;  3SBG A;  1U45 A;  1FW6 A;  2JLE A;  3NFA A;  1SKR A;  4CZK A;  5HRO A;  2QWO A;  4I2Q A;  1T44 A;  1B9F A;  3LZJ A;  1KD1 O;  2KKZ A;  3VF2 A;  4CJ5 A;  4FLY A;  3S3O A;  3L2Q A;  3OYE A;  3UKR B;  3NAE A;  2HNY A;  2P9P A;  1XQS C;  3BY5 A;  4KTZ A;  1N32 K;  4MDB A;  4C23 A;  3ATU A;  3VGL A;  4BR7 A;  4IDK A;  1IH7 A;  4DQI A;  4DUY K;  2ASP A;  3ALY A;  4PL8 A;  3DLE A;  4IEI A;  4H4O A;  1EWR A;  2HST A;  4BVO A;  3K59 A;  1GOC A;  1NKE A;  4OPH A;  3L4Q A;  5HRN A;  1NGG A;  3TR8 A;  2V51 B;  3K57 A;  4B08 A;  3C0B A;  1VRT A;  5GAE P;  5TKY A;  3SPZ A;  1EP4 A;  4BRP A;  1JKH A;  3CCU N;  4BR2 A;  1RTJ A;  1XMQ K;  4C8L A;  4ISE A;  1IG9 A;  5KRS A;  5LMU K;  2YJF A;  5HBM A;  3O08 A;  4M3R A;  4B9V A;  2VCP A;  1L3T A;  3HK2 A;  4JKF A;  1V4T A;  1NJX A;  3FZF A;  4BRQ A;  1S9G A;  2E20 A;  1Y97 A;  4FM0 A;  4B3M K;  2YX6 A;  3FGU A;  5AZI A;  2FF6 A;  3CXC M;  1JXB A;  5LJV A;  1N5Y A;  2E1Y A;  1GLE G;  1MDU B;  2BH1 A;  4E7K A;  4NLC A;  1YAG A;  3OYA A;  2ASM A;  3ZET A;  4BR9 A;  4R5P A;  3V9Z A;  4B3T K;  3S3N A;  1IJJ A;  2DFF A;  5JVH L;  4AHS A;  3LAL A;  1C0M A;  2P9L A;  3A0I X;  4AM7 A;  4CEO A;  1A5X A;  4G9Z A;  3AA2 A;  4CJS A;  2P9S A;  1NK9 A;  4CZJ A;  3RMD A;  3O8M A;  3QIO A;  2QWL A;  2HW3 A;  4KH6 A;  3VEW A;  3CCE N;  3OTO K;  4DFM A;  4N41 A;  2HHQ A;  5EOY A;  2B6A A;  1NBW A;  2HMI A;  1NWK A;  4AHU A;  4DFP A;  4EZ9 A;  4O5F A;  1HR0 K;  4A2B A;  1W97 L;  2LSN A;  3KJV A;  2HBJ A;  3CJC A;  2Q2R A;  1RDC A;  2O8B A;  3ZT2 A;  4BR0 A;  2OAN A;  3O3H A;  5AQM A;  4RW9 A;  2QK9 A;  4DV5 K;  5B8H A;  3HPG A;  3P31 A;  1RT6 A;  4KH5 A;  4CGD A;  4JHD A;  5MLC Q;  1EQY A;  1TK0 A;  1J5E K;  2QWN A;  4DU1 A;  3K5L A;  4IEE A;  5C12 A;  4FW2 A;  2FBV A;  1WN7 A;  2R7Y A;  3NF8 A;  1DGK N;  1K8K B;  3OA9 A;  4DR5 K;  3DMJ A;  1WAJ A;  3E66 A;  2Y1I A;  1QQM A;  4Z0U A;  3I55 N;  3NGI A;  5FDL A;  4CZL A;  3N4P A;  2O8D B;  4DQP A;  4NCB A;  4KAZ A;  4CFA A;  4B1U B;  1C1C A;  4KHQ A;  4BY9 C;  3CI5 A;  1FK9 A;  4C8M A;  2HNZ A;  4A61 A;  4JRQ A;  4CZF A;  1A5W A;  5GAD P;  3AVM A;  1Q7Y O;  3G71 N;  3A5L C;  4FWS A;  4IJN A;  3AAR A;  1QSS A;  3TPQ A;  5DK5 A;  4K25 A;  4BVP A;  1QTM A;  4BG8 A;  2D0C A;  3O5B A;  3IAY A;  1N36 K;  1G15 A;  3NVM A;  4CZG A;  3NF6 A;  3O3F A;  1W0H A;  3CQX A;  4W5T A;  3C7N A;  1ATR A;  1N8R O;  4M3X A;  4CJV A;  4CED A;  4G1Q A;  3E1Y A;  2O4G A;  1RDD A;  3DM2 A;  2G8H A;  4V19 S;  3WXJ A;  3EL2 A;  1MU2 A;  1BIU A;  3CD6 N;  2HF4 A;  4C8O A;  4WFA L;  4RTF D;  3QNO A;  3SJJ A;  1VSD A;  4GMJ B;  1VSH A;  4E1N A;  3OJU A;  2A3Z A;  1C0U A;  3LAN A;  4BE0 A;  3RSE A;  4N47 A;  3T7Z A;  3G6E N;  1U6Z A;  5JLH A;  3H1V X;  4BE1 A;  3DLG A;  3CPW M;  2O8E A;  2QKB A;  3R6M A;  1WAF A;  2UUC K;  1Z05 A;  2O8F A;  2XY5 A;  1Q9X A;  4DV4 K;  2HMP A;  3LDQ A;  3QFP A;  3MCP A;  4IOX A;  4B9N A;  1RTI A;  4KHP K;  5BRD A;  3M8Q A;  4M45 A;  3G4S N;  1RDU A;  3M6G A;  3MXJ A;  4HTL A;  1MWM A;  3AO2 A;  1TKZ A;  2ZJQ L;  3O4W A;  4JK7 A;  3UKU A;  5A2Q O;  4DKW A;  3DJC A;  2Q97 A;  4JI7 K;  1R59 O;  3CQY A;  1OH8 A;  4PA1 A;  5GIN A;  4BC4 A;  1L3S A;  1ZYQ A;  1JLG A;  5AQN A;  3ZCM A;  4HCC A;  4DTM A;  4I7F A;  3NH2 A;  5HRR A;  3W0L A;  4LH5 A;  1XI1 A;  2E5L K;  1VQ5 N;  1JLA A;  5F1X A;  3CCL N;  2GWJ A;  3QML A;  3NH0 A;  2P9K B;  4YNQ A;  1YT3 A;  4JI1 K;  4KPY A;  1U2V B;  3LP2 A;  5I9E B;  1HX1 A;  3CCS N;  4A2A A;  3VQP A;  2HBK A;  4BRO A;  2BDP A;  1S1W A;  3H08 A;  2IVN A;  1HNI A;  2YHB A;  1VQ4 N;  4NYN A;  1X9M A;  3A5O C;  4GNI A;  1HKG A;  4H8K A;  3FE1 A;  5AZJ B;  2XHB A;  3K2P A;  4CBX A;  3WEE B;  3H3N O;  5C2F A;  3IUC A;  1IG8 A;  1N33 K;  4CVN E;  2E2O A;  1LAV A;  3VEY A;  4K0K K;  1WSF A;  2YKN A;  2E1Z A;  1RFQ A;  3CJ1 A;  4CF2 A;  1LOT B;  2QXF A;  4FJX A;  1YTU A;  1Z26 A;  3KK3 A;  1YVU A;  2P9N A;  1N34 K;  5IT9 O;  3DXM A;  4FW1 A;  4DQ8 A;  5EXW A;  3OYI A;  1ATN A;  4AH9 A;  1XWL A;  4DV1 K;  4U67 L;  4DR6 K;  1NJW A;  3J81 O;  3ZEU A;  4FJK A;  2F8T A;  4BRL A;  3DI6 A;  3L4I A;  3MWT A;  1KAY A;  3KLG A;  4E7I A;  3RRG A;  1MA9 B;  4WQ4 A;  5FRO A;  1RT7 A;  4U7B A;  3HPH A;  4ELT A;  1CLQ A;  5BRF A;  3HI0 A;  3CG7 A;  1XMO K;  3VQC A;  1KQS M;  1ITG A;  1HYZ A;  4KHS A;  3C6H A;  3TWH A;  1NU0 A;  4E3S A;  2KZZ A;  2KQ2 A;  3V9W A;  3S9H A;  4O0I A;  1I39 A;  3P83 D;  4ISF A;  3ZX2 A;  2GEL A;  3GOI A;  1TAQ A;  1KVB A;  4CJ3 A;  4RWT A;  4DV2 K;  4DSL A;  3AVI A;  4F2R A;  3FFI A;  2WUS A;  1DTT A;  3VMF B;  2G8F A;  4FWM A;  4B3R K;  2ZF5 O;  3QIN A;  4M3U A;  1LWC A;  3THW A;  4OLB A;  3HM8 A;  3TAF A;  2OYQ A;  2NZT A;  2D1K A;  3TAB A;  4FLW A;  5CY4 A;  1LAW A;  4ELV A;  1TYQ A;  3D2F B;  4KRF A;  3A2F A;  2AP1 A;  1EWQ A;  3G10 A;  3UB5 A;  3TAN A;  3HXM A;  5AQZ A;  4DMN A;  4F4K A;  1KC8 O;  3CMA N;  3I8B A;  1NGA A;  3D2E A;  2F4V K;  4BC2 A;  5C0Y A;  3VQ5 A;  3EKS A;  3SQ1 A;  4W5N A;  3NVK A;  3CIP A;  4CBU A;  5JS1 A;  1QE1 A;  3L2V A;  2CGJ A;  4RG8 A;  1KAX A;  2QXL A;  3VEO A;  2XO7 A;  1D8Y A;  4Z4G A;  4E89 A;  4WQ5 A;  1X3N A;  5ELZ A;  1YVN A;  3A5N C;  3LP3 A;  5AQL A;  3CCV N;  4I9Q A;  1UWB A;  4BDY A;  1WUA A;  4CF1 A;  4JD2 A;  4JYA K;  4PKI A;  1K73 O;  5J1E A;  4GY2 B;  1YJ9 N;  4PQU A;  3F5T A;  1ESV A;  4EAH D;  3PIP L;  3EN9 A;  3ZSV A;  3KK7 A;  2CGK A;  3HSC A;  4DLG A;  1RBV A;  1GLD G;  3NGZ A;  1S1U A;  1D5A A;  4M41 A;  3SQ0 A;  2QM1 A;  3DLR A;  3ZSR A;  1GLL O;  1WSE A;  3J80 O;  1U4B A;  4JKA A;  1GLC G;  5C2D A;  1HNX K;  3SQ2 A;  5JMV A;  1BQN A;  3V1Q A;  4BDP A;  3GE1 A;  3NF7 A;  4FYD A;  3T69 A;  4BRK A;  1RIL A;  1WOQ A;  3QB0 A;  4H5N A;  2P5O A;  1KVA A;  4EIA A;  4HWI A;  2QEX N;  3TI0 A;  5CYM A;  2X6N A;  3DYA A;  4LSL A;  5EU7 A;  2VWK A;  2NRH A;  5AFU H;  1YIT N;  4O8U A;  3VEV A;  1D9D A;  2FSK A;  1QHA A;  3L8B A;  2VYP A;  1QQO A;  4YDU A;  4O4G A;  3NBP A;  3L0Q A;  1HJR A;  2CH6 A;  2FLO A;  4DHY A;  3T1A A;  3KD5 E;  1N6Q A;  4MQ3 A;  4B9U A;  3OJS A;  1W7A A;  1WSH A;  4DQR A;  1NOZ A;  3QER A;  1LWE A;  4JI3 K;  4JK8 A;  3O9Q A;  1GOA A;  3TU5 A;  3KK1 A;  3KLI A;  2NRV A;  4CFB A;  1U48 A;  3L3V A;  4EP5 A;  4LC9 B;  3J8A A;  4MDA A;  1BIS A;  3HJF A;  1W2B M;  1KTQ A;  3V1O A;  4H0Y B;  3EEQ A;  3TTF A;  5I3U A;  2AA4 A;  3CYM A;  2P5G A;  1QS4 A;  4CFC A;  4RW6 A;  3O9T A;  3ZLJ A;  3IMX A;  4BR4 A;  3SMP A;  4DFJ A;  3RR7 A;  1GLF O;  1HNW K;  2OPQ A;  2JWL A;  1KRP A;  4IDH A;  3U3G A;  2E2N A;  1M90 O;  2IVO A;  3OW2 M;  2FSJ A;  2E2P A;  4QOZ B;  4KO0 A;  4ILH A;  3VF4 A;  2Q1N A;  3ULE B;  1S22 A;  1WLJ A;  1ATS A;  3SNN A;  3OS0 A;  1Z25 A;  1HMV A;  3ITH A;  1R0A A;  3T3F A;  5AQP A;  4CIG A;  3OYG A;  5M1O A;  4FL9 A;  3AVJ A;  4WFN L;  4F2S A;  3V9U A;  2PBD A;  5HLF A;  1VQ8 N;  2FBY A;  4LSN A;  1Q81 O;  2G8I A;  1IO2 A;  3QEV A;  3CM5 A;  3VA0 A;  4JKG A;  3MED A;  4FVM A;  1BHL A;  4JRP A;  3AY9 A;  2GTD A;  4DTP A;  4BGB A;  3RRH A;  1XHZ A;  4JV5 K;  4RW4 A;  4MLE A;  3SK3 A;  1JXE A;  4IJA A;  4Z4C A;  1NK0 A;  4E7L A;  3MXI A;  3BGR A;  2PAV A;  4H4M A;  1BA0 A;  4CJP A;  4DUZ K;  4CEZ A;  4FPA A;  5HP1 A;  3AVC A;  4I6M B;  4PKH A;  1TKX A;  1VSE A;  1TKD A;  1BUP A;  4EFH A;  3MN7 A;  2D5R A;  3U3Y A;  1ASV A;  3PUF A;  2ZE2 A;  4X64 K;  5DM6 L;  3QEW A;  4YOV A;  2KW4 A;  5AQX A;  4CZI A;  2F9W A;  2YCH A;  4KV8 A;  4CJL A;  1SUQ A;  4FJ8 A;  1T6D A;  1X9W A;  1U49 A;  3VEN A;  3R8E A;  3AGK A;  3V1R A;  4DV7 K;  1HRH A;  3O1B A;  2OPR A;  3IG1 A;  1TAU A;  4DTX A;  4A57 A;  2O8C B;  1Z6R A;  4LF7 K;  4AF1 A;  3JXU A;  2YHA A;  5AQQ A;  5M1Q A;  4PUO A;  3ZX3 A;  4FVU A;  2PFU A;  4M63 C;  3VTI A;  2QI2 A;  1ZBF A;  3CCQ N;  5DMR A;  4CER A;  1OKJ A;  3THY A;  3MXM A;  4L8R B;  4GW6 A;  1ZBH A;  4H03 B;  2ITG A;  3SI6 A;  2NNW A;  2VGM A;  3HRG A;  1LWF A;  4H0X B;  1ZXO A;  2FBX A;  2WFB A;  4NXM K;  2UXB K;  1HLU A;  4KHW A;  2Z1H A;  1S6P A;  2XY7 A;  3AVH A;  1VSL A;  5HOO A;  1SL0 A;  1K8K A;  1HQE A;  1T7P A;  3I8D A;  4DV3 K;  4BC5 A;  3LDN A;  1HYV A;  4CGI A;  5J2N A;  4CHY A;  2UU9 K;  4DU4 A;  2OA8 A;  3C95 A;  1IV0 A;  2HHX A;  4FWK A;  4KTQ A;  3O4Q A;  1IBM K;  3QFU A;  2RF2 A;  1LV5 A;  1OH6 A;  5C24 A;  5TKW A;  1TVR A;  3SCX A;  1IKY A;  2GV9 A;  1Q82 O;  4LH4 A;  2D0P A;  4FJ7 A;  2VG7 A;  3MX2 A;  4WF9 L;  4ILG B;  3MEG A;  4CD3 A;  4E1J A;  2ZGY A;  4ILJ A;  2VG5 A;  4CHZ A;  1BI4 A;  2P9P B;  3BZK A;  3ENH A;  2A1S A;  1RT4 A;  1BQM A;  1GLA G;  2XY8 A;  5F0X A;  2E88 A;  3UE5 A;  2VQF K;  1BIZ A;  5AR0 A;  1K8A O;  4YY3 K;  3C6T A;  4DSK A;  3KLF A;  3KTQ A;  4ICL A;  1BA1 A;  4ISG A;  2KHO A;  1JL2 A;  2A6A A;  2ZQB A;  4BGA A;  2QWP A;  1IKX A;  2KLA A;  4J2B A;  3R3L A;  4LF8 K;  3VEZ A;  2P51 A;  2CH5 A;  4MO5 A;  2W41 A;  4EHT A;  4NCA A;  4M3Y A;  2YHX A;  1P8Z A;  1JL1 A;  2A42 A;  4FK4 A;  4DS5 A;  1HNV A;  1QVG M;  1XNQ K;  3O6W A;  1KAZ A;  4KI4 A;  4LF5 K;  4M3T A;  2IS3 A;  3CQ8 A;  3LDO A;  3HZ6 A;  4JI8 K;  4UY8 O;  5KPR A;  3K9J A;  2Z1G A;  1NGB A;  1NGJ A;  4YOX A;  1KCF A;  3VQA A;  5BR9 A;  5M1K A;  5AZI B;  3CC2 N;  3AO4 A;  2YHY A;  4H0P A;  5BRE A;  2P9K A;  4H0T B;  1U2V A;  3ZET B;  3AVN A;  4MFB A;  1SKS A;  1NGD A;  1QHT A;  2JWK A;  1OH5 A;  3BDP A;  1T8E A;  5KQD A;  3D6R A;  1VQ9 N;  2OCE A;  3V9S A;  5AZJ A;  2YHW A;  3O1W A;  4WQ4 C;  3OS2 A;  2P9S B;  3H46 O;  3T1H K;  3OBW A;  1HKC A;  1NJY A;  3DRR A;  5AQK A;  1J9A A;  4OVL A;  3VQE A;  4F8R A;  2Q0U A;  3DLL L;  4M3W A;  4CES A;  2OTJ N;  3DXK B;  5M1F A;  3CC7 N;  3VES A;  3V4I A;  3PX0 A;  1NG9 A;  3HOS A;  4JAX A;  3L2U A;  4B1V A;  4CJ7 A;  3F73 A;  4DB3 A;  4JI5 K;  5ADX A;  4DSE A;  4WFB L;  3PIO L;  3KLE A;  5KRT A;  4KB1 A;  2NRX A;  2B5J A;  4CGF A;  4O8K A;  4CJ4 A;  3VET A;  1XNR K;  1JLQ A;  3G25 A;  3TAQ A;  2QWR A;  4NLB A;  4FM2 A;  2QWQ A;  3HBT A;  4JHD B;  1TUU A;  4JI6 K;  4FZZ A;  3CER A;  4FWO A;  1QVF M;  3DWL A;  3C94 A;  4HUG A;  3EO3 A;  4B8A B;  1S1V A;  3MCA B;  1NKC A;  4QAG A;  3VPZ A;  3FZM A;  1CZ9 A;  1FXX A;  4B9Q A;  3TTD A;  4ELU A;  3F9M A;  5LMN K;  1UA1 A;  5AQF A;  3SAH A;  4CEQ A;  3RWU A;  3O9U A;  3LM9 A;  2AJQ A;  3KWG A;  5AQV A;  4FOI A;  2BUP A;  3PSF A;  4B9L A;  3VN5 A;  1VAZ A;  2D0O A;  4CK3 A;  4O5B A;  3DLH A;  4KRE A;  4DF8 A;  4GKJ K;  1RT2 A;  4IOA L;  1CZB A;  4WQ5 C;  1KSP A;  3WNF A;  2VWJ A;  4GVE A;  3CCM N;  3FZH A;  3MEC A;  4JI0 K;  1VQP N;  2HBL A;  2Y1J A;  3D2F A;  1DTQ A;  1RGI A;  4H5V A;  1UA0 A;  1QSL A;  4N5S A;  3HP9 A;  3CJB A;  4DR4 K;  3ZSQ A;  3CCR N;  3QLH A;  4KI6 A;  1NGC A;  3VQ4 A;  3C7N B;  3L2W A;  2ZWH A;  3EE9 A;  1X3M A;  3ID6 A;  4K8Z A;  1D4X A;  3NDK A;  5GIO A;  2GUI A;  3E9L A;  4J2E A;  1UAX A;  3QNN A;  1S1X A;  3O9S A;  5AQJ A;  2IDO A;  3U6F A;  4RW8 A;  2Z1I A;  2UXD K;  4CEF A;  3RSE B;  3ENO A;  1NK7 A;  1E4G T;  3VQ6 A;  4AHV A;  1JLC A;  1VQ6 N;  3FZL A;  1J54 A;  5KGX A;  1E3M A;  2O8E B;  4FM1 A;  2F9T A;  3THX A;  3CME N;  4BRA A;  4CJT A;  3GG4 A;  4A5B A;  1KFD A;  1Q18 A;  1TL1 A;  3FZK A;  2QKK A;  2Q3S A;  4CI6 A;  4B9M A;  1VQO N;  2WON A;  4FLV A;  4IXC A;  4KKO A;  4W5Q A;  2HHH K;  1IBK K;  4FWR A;  3DOK A;  4TSX A;  4OJR A;  4YDU C;  1KXP A;  3UKU B;  1RDB A;  4BAC A;  2P9U B;  4KFB A;  3NMU A;  1RNH A;  1F21 A;  4CJU A;  2F96 A;  1EKE A;  4PKG A;  4FJN A;  3AAP A;  5M1P A;  1C0T A;  2YKM A;  4JI4 K;  3AO3 A;  4AHC A;  4C8K A;  3SV3 A;  2NRZ A;  1XHX A;  3U9D A;  4LF6 K;  3VTH A;  2X78 A;  3CPE A;  4B3O A;  4I2P A;  1RBU A;  5HRP A;  3TSU A;  2HVH A;  5K14 A;  3D0P A;  3S41 A;  3HP6 A;  4CF0 A;  1YF5 L;  3NCI A;  4WYB A;  4DQS A;  1BCM A;  3O9R A;  2EX3 A;  3QEI A;  4CD1 A;  2Q31 A;  1YIJ N;  2P1J A;  3VGM A;  3LP1 A;  1JJ2 M;  2DTU A;  4AM6 A;  1NJZ A;  4IKF A;  3ENB A;  4JI2 K;  2RKI A;  4IFV A;  2J4R A;  4WCE L;  1SZ2 A;  4OLA A;  4LFA K;  2P9N B;  3OYL A;  1IBL K;  1OH7 A;  1CXQ A;  5CR4 A;  3THV A;  1S9E A;  2Z1J A;  4CJK A;  3R9P A;  4XH4 A;  4OPA A;  4E7J A;  5EVZ A;  5EY4 A;  4BDZ A;  3ZEU B;  3AA4 A;  3AA5 X;  3EZ5 A;  2YNG A;  4FSV A;  2IOC A;  4E19 A;  3QBX A;  4JKE A;  4C8N A;  4M3Z A;  4GVM A;  2KZM A;  4JKC A;  1VQL N;  1DEJ A;  1L3U A;  3AVK A;  1ZBS A;  1SL2 A;  3WXM B;  3OYJ A;  1X9J A;  3I0R A;  2HVI A;  3K5O A;  3WXL A;  4M42 A;  1SV5 A;  4IZ9 A;  1EET A;  1YTA A;  4KH4 A;  3SJH A;  2F8S A;  3HT3 A;  4AHT A;  3P39 A;  4OKE A;  4HCB A;  2V7Z A;  5AQT A;  3QIP A;  4DR3 K;  4CJF A;  4GV9 A;  3VQ8 A;  5BRH A;  5AQO A;  1J6Z A;  3R1X A;  4LD0 A;  3EE8 A;  1T3V A;  5KQ8 A;  4GV6 A;  2KFN A;  4CF8 A;  3TAG A;  3B6O A;  4M7Y A;  1LW0 A;  1S72 N;  4C1N K;  1VRU A;  4M7X A;  3I56 N;  1TYQ B;  3TSP A;  1RT5 A;  3D7E O;  3P38 A;  3ZSZ A;  4FXD A;  3P1G A;  4CJR A;  4MLH A;  4B8C A;  4HHT A;  2HB5 A;  3D2E B;  4J2D A;  3L2R A;  3PSI A;  2ITM A;  3QET A;  3VGK A;  3MN9 A;  4HVJ A;  4NCG A;  2BTF A;  2OZS A;  3M8P A;  4Z4H A;  5FPM A;  2ASO A;  1IKW A;  4CFD A;  4FJH A;  5JVG L;  3UKR A;  3LDL A;  4DTN A;  4DTO A;  4DR2 K;  4CHQ A;  4A59 A;  1NM1 A;  1HQU A;  5AQU A;  2UUA K;  3U8X A;  4JD2 B;  2QW9 A;  5BPL A;  4CEB A;  2O4I A;  4AHR A;  4XH1 A;  3MN5 A;  4K8X A;  5FRM A;  5T7B A;  3KIO A;  2DFE A;  3GDQ A;  2I7P A;  3JYT A;  1YI2 N;  4LFC K;  2O8C A;  3V6D A;  1JLE A;  3BEX A;  5E41 A;  2G8K A;  2Q0R A;  4WE1 A;  5AQW A;  4O55 A;  4FJM A;  1T6C A;  4QS9 A;  3PY8 A;  5KTQ A;  1SQK A;  3AGR A;  3SPY A;  1RBR A;  4HUF A;  1KLN A;  3OBY A;  4DU3 A;  3T1Y K;  1C0G A;  2PZS A;  5AQH A;  1VQN N;  5J2Q A;  4OO1 J;  4NXN K;  5KGW A;  5SZT A;  2H3G X;  4IG3 A;  1X9S A;  3H3O B;  3K9K A;  4Y1C A;  3ULD A;  3AV9 A;  3EY1 A;  3HVT A;  4YOU A;  4R79 A;  3KK2 A;  4DTR A;  3ZT3 A;  4CBW A;  2GEM A;  2I5J A;  3GL1 A;  1NJI O;  4CEA A;  3NH1 A;  4DTS A;  2E8A A;  5E26 A;  1G99 A;  2P9I B;  2RPI A;  4CE9 A;  1E4F T;  2UYT A;  4ZTJ A;  4UQG A;  4J2A A;  4FWN A;  3V81 A;  3KKS A;  4IO8 A;  4CW7 B;  2I7N A;  4A62 A;  2XY6 A;  1ZBI A;  1WNS A;  4F9O A;  4LY7 A;  4AIL C;  2ZM6 K;  5CZ1 A;  3SZ2 A;  3DOL A;  3KZB A;  3HL8 A;  3ZT1 A;  4CZM A;  3U9Z A;  2NUB A;  1OVY A;  1VSF A;  4DLE A;  3K5N A;  4CJE A;  3F9K A;  5HL7 L;  3VER A;  4FWP A;  4O0J A;  3OYH A;  3CF5 L;  1BO5 O;  1OVQ A;  5AQY A;  4CZE A;  4CIF A;  1TL3 A;  2YV0 X;  5C10 A;  2ZD1 A;  4FLT A;  3LAM A;  1NK5 A;  4OX9 K;  3F2K A;  5FLX O;  4FJ5 A;  4KHN A;  3EYZ A;  3FLC O;  1NOY A;  3MX5 A;  4BQL A;  1RDW X;  4E0D A;  3AAQ A;  1M1K O;  1NK4 A;  4Z4F A;  4QCL A;  5BN9 A;  2EHG A;  3NGY A;  3PO5 A;  2NRT A;  4B1Y B;  3L6Q A;  1RDA A;  2E6L A;  3LAK A;  3VQ7 A;  3H6E A;  4DWI A;  1FKO A;  3CJA A;  5GAG P;  1HPZ A;  1WSJ A;  1C0F A;  4BWJ A;  1FJG K;  4JKG B;  3SUQ A;  4ZTF A;  2YI1 A;  2O8D A;  2KTQ A;  1CZA N;  1WSI A;  3PX6 A;  3G0Z A;  4BRM A;  3IFR A;  4BRF A;  1X1P A;  3M5R A;  1VSJ A;  2HBM A;  5BR8 K;  2FXU A;  3OYK A;  2BGG A;  1JLB A;  1LCU A;  3WNH A;  3AVL A;  1TGO A;  1QZ6 A;  2IIR A;  3TAR A;  3IDH A;  1WSG A;  4A5A A;  5LY3 A;  4IFY A;  1NNE A;  1GLB G;  4H0O A;  2WBN A;  3ISN C;  1XC3 A;  4N76 A;  4I9L A;  1J53 A;  1VSM A;  2OPP A;  4JKD A;  5F2R A;  5AFU A;  4DG1 A;  4EHU A;  3RMC A;  1GLJ O;  3LWM A;  3SLC A;  5CYQ A;  2FC0 A;  4Q5V A;  4OKK A;  4W5R A;  2VGN A;  1QQN A;  1TK5 A;  5D3G A;  4CF9 A;  3DXK A;  1VQM N;  4MO4 A;  2DPN A;  3VQD A;  4BC3 A;  1RT3 A;  1ZBU A;  2DFH A;  4JKH A;  1VHX A;  3QBW A;  4BE2 A;  4DQQ A;  1S3X A;  3ZT0 A;  4KB0 A;  5HRS A;  5CE3 A;  1MWK A;  1EXQ A;  4Y0W A;  4FZX C;  1KFS A;  3VA3 A;  4Q0B A;  4PHT X;  1VQ7 N;  4E1M A;  1YJW N;  3LPU A;  3ZYY X;  3WQT A;  5GAH P;  2PY5 A;  3L3U A;  4C1N I;  2A1R A;  3QIC A;  3E9P A;  5AQR A;  2G8V A;  1YHQ N;  2NRR A;  3THY B;  3A5M C;  3ATV A;  1I94 K;  1SS6 A;  4PL7 A;  1RTH A;  1K9M O;  3GBT A;  4CEC A;  3KLH A;  4IOC L;  3SV4 A;  1JCF A;  4O44 A;  4FJ9 A;  1DLO A;  5I42 A;  3SUN A;  1SKW A;  3K5M A;  3D45 A;  3VEX A;  3P4I A;  2ATQ A;  3JSM A;  4B9S A;  5JLF A;  3BF3 A;  4FPB A;  3QO9 A;  1K6Y A;  4IBN A;  3SYZ A;  4Z4E A;  1FKP A;  1WBD A;  4CIE A;  5CZ2 A;  1RBS A;  3CHW A;  3M8R A;  4OPK A;  3C6A A;  4FWQ A;  1BU6 O;  3CJ7 A;  4JNE A;  5M1N A;  2P9L B;  4CJQ A;  3HM9 A;  1KVC A;  4DSI A;  3SMS A;  4K43 A;  3QES A;  3WEE A;  3DRP A;  4KBO A;  3H1Q A;  3VQB A;  1Q9Y A;  4B3S K;  3CFP A;  1D9F A;  1P90 A;  4H5T A;  3CJ9 A;  3TAP A;  3KD1 E;  3C6U A;  3RMB A;  4JKB A;  1HYS A;  1XUP O;  3AVG A;  3J7A P;  2V52 B;  3OYM A;  2G8W A;  3MK6 A;  3SAG A;  5AQS A;  4FJJ A;  1BI4 B;  5FPE A;  3K58 A;  2VQE K;  3WQU A;  2D4W A;  3WXK A;  4DF4 A;  5FRN A;  2CGL A;  2WTU A;  4DV6 K;  5J2M A;  1H1V A;  3AO5 A;  3MN6 A;  2XRI A;  1NGF A;  4Z94 A;  1B9D A;  2E4L A;  2O8B B;  1ZC6 A;  3LWL A;  3DRS A;  4KHU A;  4CK2 A;  4YOY A;  3B6P A;  3E01 A;  3BF1 A;  3ZSO A;  4PWD A;  4IWV A;  1Q8I A;  3HOT A;  4GV3 A;  5KPZ A;  4DR1 K;  1NGH A;  2KFZ A;  1W9H A;  2PYL A;  4CHN A;  2P9U A;  3LPT A;  3V9X A;  4BG9 A;  3DAW A;  1L5U A;  1SAZ A;  1TV6 A;  3LP0 A;  2OZM A;  1KLM A;  3EKU A;  4HTU A;  3SQ4 A;  3AVA A;  3ASM A;  3HTV A;  4CGH A;  1NKB A;  2GX9 A;  2WC9 A;  4LFB K;  1RCH A;  2BAN A;  4B9T A;  2X6S A;  2D0B A;  3CC4 N;  1REV A;  2HHT A;  5EX5 A;  1BL3 A;  1NGE A;  1ILY A;  2G8U A;  2W6L A;  3LM2 A;  4JS4 A;  3Q7B A;  1V4S A;  4CZH A;  4FJL A;  1S5J A;  2W6K A;  4DS4 A;  1HKB A;  4X62 K;  1BWF O;  5FPD A;  3OYD A;  2RHK A;  2UUB K;  1BG3 A;  5JIC A;  3ZSW A;  4CEE A;  3MAQ A;  3OY9 A;  2IVP A;  3W3D A;  1VSI A;  1SL1 A;  2ETJ A;  4NO7 A;  1DKG D;  4IFE A;  3DLB A;  3RVC A;  1WBB A;  2UXC K;  3J7Z O;  1NK6 A;  4CHO A;  2QA4 N;  3PV8 A;  4XIU A;  3BP8 A;  2ZJP L;  2A5X A;  2A40 A;  2O8F B;  4F3O A;  3VQQ A;  1DT9 A;  1VSK A;  4ZHR A;  4CGJ A;  4JS5 A;  3H45 C;  1Y64 A;  4H5R A;  2HHV A;  3NHG A;  4QS7 A;  4FJI A;  4BRC A;  5BPM A;  4YFU A;  4Y1D A;  4ID1 A;  1RT1 A;  4FK0 A;  4W5O A;  4DSF A;  4DV0 K;  4FK2 A;  4GKK K;  2Q36 A;  5JS2 A;  3HPO A;  2HHS A;  4OGC A;  3WT0 A;  4BRH A;  4OGE A;  1A5V A;  3MWP A;  1NK8 A;  2B4J A;  4H0V B;  4K42 A;  5C42 A;  3CET A;  3KHY A;  5DM7 L;  2QWM A;  4Z4I A;  5SWM A;  1T05 A;  4OKJ A;  4FO0 A;  1U04 A;  4DCH A;  5KI6 A;  4EZ6 A;  4DTJ A;  1NMD A;  4JK9 A;  3CFR A;  2A41 A;  3KWI A;  3NE6 A;  3HST B;  2NRW A;  3O80 A;  4BRN A;  4BRD A;  3FR0 A;  5AQI A;  3QDK A;  3SUP A;  3ZSY A;  5E84 A;  1B92 A;  3OHR A;  4RCH A;  5CHI A;  4LF9 K;  3WNE A;  4N56 A;  2DY4 A;  2ZJR L;  3PLA A;  4YOT A;  4E7H A;  1J5O A;  2V7Y A;  3HYF A;  1C1B A;  5FPN A;  4B1W B;  1VK0 A;  3CFO A;  4IO9 L;  2GBZ A;  3LDS A;  4B1X B;  2RE2 A;  3DXM B;  3FFK B;  2F7T A;  3SBT A;  1TUY A;  2HF3 A;  2GUP A;  4OPJ A;  2HND A;  3K0S A;  3O4N A;  5LL6 Z;  3DLK A;  3J7Y P;  4KHY A;  1NMN A;  3LZI A;  3HVR A;  4XH5 A;  4K41 A;  1I3A A;  2VG6 A;  2OTL N;  3UIQ A;  3IS9 A;  1NLV A;  3ULE A;  2FBT A;  4CGG A;  2IGI A;  3JAM O;  5H1S Q;  3RMA A;  1QQC A;  2YNH A;  3THX B;  5C25 A;  4FCY A;  4FLU A;  4RW7 A;  1C1A A;  1GOB A;  1L3V A;  2PYJ A;  3JS6 A;  1YUW A;  1EX4 A;  3B8A X;  3U4L A;  5KPT A;  1HJO A;  3TTC A;  4DSJ A;  3CCJ N;  1S1T A;  4BQZ A;  1HUX A;  3MEE A;  2E6M A;  2YNF A;  1BCO A;  2D0A A;  1LW2 A;  4B1Z A;  4YOR A;  5C15 A;  1C6V A;  3KKR A;  4BR5 A;  2YNI A;  4H5W A;  4L3Q A;  3QEX A;  1NGI A;  2JGU A;  1O13 A;  3I33 A;  4AQY K;  2QTD A;  3RR8 A;  3A8Y A;  3OVN A;  3PO4 A;  3WUH A;  2X74 A;  3THW B;  1QSY A;  4X66 K;  1UOC A;  1T03 A;  1HNZ K;  3AO1 A;  3BZC A;  2ZGZ A;  2IAJ A;  5AJ3 K;  4ID5 A;  4NYF A;  4NB4 A;  3MDQ A;  3HO1 A;  3RTV A;  3OYF A;  2P9I A;  4BRI A;  2BE2 A;  1EO1 A;  1BDG A;  5GIP A;  4I6M A;  3LL3 A;  4HUE A;  2NLX A;  3WNG A;  4JEP A;  1WB9 A;  4FWL A;  3OYB A;  4XEI A;  4PY5 A;  2RN2 A;  3ID8 A;  3O3G A;  2W40 A;  4KTW A;  1RTD A;  3ZX0 A;  1QZ5 A;  2VWB A;  2E2Q A;  5BN8 A;  3CM6 A;  3VF6 A;  3Q7C A;  4CHP A;  3TAE A;  3SAF A;  3I0S A;  4CJW A;  1JCG A;  1JCE A;  4X65 K;  3OYC A;  2OPS A;  1BGX T;  3OS1 A;  3N4Q A;  3IRX A;  5LJW A;  1TK8 A;  5BPN A;  2HHU A;  2GWK A;  1U47 A;  1JLF A;  4FZY A;  1ASW A;  3M8S A;  1TKT A;  4YHH K;  1S6Q A;  3ZSX A;  1ZBL A;  2IC3 A;  1Q86 O;  4DTU A;  5AQG A;  4YOW A;  2FF3 B;  2WOM A;  4FJG A;  1YJN N;  3OYN A;  5J2P A;  3SUO A;  4IG0 A;  1CXU A;  4DFK A;  4JN4 A;  1YXQ A;  1BOT O;  5IWA K;  3IKM A;  3NF9 A; 
#chains in the Genus database with same CATH homology
 3C94 A;  4HUG A;  3P5J A;  4FLZ A;  4I9L A;  1J53 A;  4B8A B;  1VSM A;  1IKV A;  2OPP A;  3AVF A;  1ASU A;  1S1V A;  4RG8 A;  2XO7 A;  4DG1 A;  3RMC A;  1D8Y A;  4E89 A;  3LWM A;  4Z4G A;  2W42 A;  1NKC A;  5CYQ A;  2FC0 A;  4QAG A;  4OKK A;  4Q5V A;  3LP3 A;  4I9Q A;  4W5R A;  1CZ9 A;  3S3M A;  1FXX A;  1UWB A;  4BDY A;  4ELU A;  1TK5 A;  4CF1 A;  3TAM A;  1UA1 A;  5D3G A;  4CF9 A;  3T19 A;  4CEQ A;  3RWU A;  3ZT4 A;  2HHW A;  4BWM A;  3VQD A;  2AJQ A;  1RT3 A;  1ZBU A;  2DFH A;  5J1E A;  4B9L A;  3VN5 A;  4CCH A;  3AA3 A;  3PX4 A;  4CK3 A;  4O5B A;  4PQU A;  3DLH A;  4KRE A;  4DF8 A;  1RT2 A;  4BE2 A;  1CZB A;  3ZSV A;  1RBT A;  4DQQ A;  4F3T A;  1KSP A;  3ZT0 A;  4KB0 A;  5HRS A;  1EXQ A;  3WNF A;  2VWJ A;  1O1W A;  4FLX A;  4FZX C;  1KFS A;  1T7P A;  3AVB A;  4DLG A;  1RBV A;  4CK1 A;  3NGZ A;  3VA3 A;  1S1U A;  1D5A A;  3MEC A;  4M41 A;  4EP4 A;  3QEP A;  3SQ0 A;  4E1M A;  2Y1J A;  3LPU A;  3DLR A;  3ZSR A;  4JLH A;  3L3U A;  3VQ9 A;  2PY5 A;  1WSE A;  2A1R A;  1DTQ A;  1U4B A;  3SQ2 A;  1UA0 A;  1QSL A;  4N5S A;  1BQN A;  3V1Q A;  3HP9 A;  2G8V A;  4BDP A;  1U45 A;  2JLE A;  3NF7 A;  3NFA A;  3ZSQ A;  5HRO A;  1SKR A;  4FYD A;  3QLH A;  4I2Q A;  4KI6 A;  1RIL A;  1B9F A;  1RTH A;  3VQ4 A;  2P5O A;  3LZJ A;  1KVA A;  4CEC A;  3KLH A;  3L2W A;  3SV4 A;  4K8Z A;  4CJ5 A;  3NDK A;  2GUI A;  4O44 A;  4FLY A;  4FJ9 A;  1DLO A;  1UAX A;  3QNN A;  3L2Q A;  1S1X A;  3S3O A;  4J2E A;  5I42 A;  3SUN A;  3OYE A;  1SKW A;  3TI0 A;  5CYM A;  3K5M A;  2X6N A;  3DYA A;  4LSL A;  3D45 A;  2HNY A;  5EU7 A;  3NAE A;  2IDO A;  3U6F A;  4KTZ A;  2VWK A;  2ATQ A;  4RW8 A;  2Z1I A;  1D9D A;  4CEF A;  1NK7 A;  4IDK A;  1IH7 A;  3JSM A;  3VQ6 A;  4B9S A;  4DQI A;  4AHV A;  3ALY A;  3L8B A;  3DLE A;  1JLC A;  4H4O A;  1J54 A;  3QO9 A;  1K6Y A;  4IBN A;  3NBP A;  4O4G A;  5KGX A;  1GOC A;  3K59 A;  3SYZ A;  1FKP A;  4Z4E A;  1HJR A;  4FM1 A;  1NKE A;  4CIE A;  5CZ2 A;  5HRN A;  1RBS A;  4CJT A;  3M8R A;  3TR8 A;  1KFD A;  4OPK A;  1TL1 A;  3T1A A;  3K57 A;  3KD5 E;  4B08 A;  4MQ3 A;  1N6Q A;  4B9U A;  2QKK A;  2Q3S A;  4B9M A;  4CJQ A;  3HM9 A;  1KVC A;  2WON A;  3OJS A;  4FLV A;  1WSH A;  4DQR A;  1NOZ A;  3QER A;  1LWE A;  4KKO A;  4DSI A;  4W5Q A;  1VRT A;  1GOA A;  3KK1 A;  3QES A;  3KLI A;  3DOK A;  4TSX A;  4OJR A;  1EP4 A;  4CFB A;  3SPZ A;  3DRP A;  3L3V A;  1U48 A;  4EP5 A;  1JKH A;  1RDB A;  3VQB A;  1RTJ A;  4BAC A;  1BIS A;  1Q9Y A;  3CFP A;  1IG9 A;  1XC9 A;  1D9F A;  4KFB A;  4C8L A;  5KRS A;  3HJF A;  1KTQ A;  3TAP A;  1RNH A;  5HBM A;  3V1O A;  3KD1 E;  1F21 A;  3C6U A;  4CJU A;  3RMB A;  2F96 A;  4M3R A;  4B9V A;  1EKE A;  1HYS A;  5I3U A;  3AVG A;  4FJN A;  3CYM A;  2P5G A;  1L3T A;  1C0T A;  1QS4 A;  3OYM A;  3HK2 A;  2YKM A;  4CFC A;  3AO3 A;  4RW6 A;  2G8W A;  4AHC A;  4C8K A;  1NJX A;  3SV3 A;  4DFJ A;  3RR7 A;  1S9G A;  4FJJ A;  1XHX A;  1BI4 B;  2OPQ A;  1Y97 A;  4FM0 A;  1KRP A;  3U3G A;  3K58 A;  2X78 A;  1JXB A;  4B3O A;  4DF4 A;  5FRN A;  4I2P A;  1N5Y A;  4QOZ B;  4KO0 A;  4E7K A;  1RBU A;  5J2M A;  5HRP A;  3AO5 A;  1WLJ A;  3OYA A;  2XRI A;  4R5P A;  3SNN A;  3OS0 A;  1Z25 A;  3V9Z A;  1B9D A;  1HMV A;  2E4L A;  3S3N A;  2HVH A;  5K14 A;  3ITH A;  2DFF A;  3DRS A;  3LWL A;  4CK2 A;  3D0P A;  4KHU A;  4AHS A;  4CF0 A;  3LAL A;  3B6P A;  3E01 A;  1C0M A;  3HP6 A;  4DQS A;  3NCI A;  3T3F A;  1R0A A;  4B9T A;  3ZSO A;  4PWD A;  1BCM A;  4CEO A;  2EX3 A;  3QEI A;  1Q8I A;  1A5X A;  4CIG A;  3AA2 A;  3OYG A;  4CJS A;  2P1J A;  3AVJ A;  2KFZ A;  1NK9 A;  3RMD A;  1W9H A;  2PYL A;  3LP1 A;  3QIO A;  4F2S A;  3V9U A;  4CHN A;  2DTU A;  3LPT A;  5HLF A;  1NJZ A;  3V9X A;  2HW3 A;  2FBY A;  4IKF A;  4LSN A;  2G8I A;  1L5U A;  1IO2 A;  2RKI A;  4IFV A;  3QEV A;  1TV6 A;  3CM5 A;  4DFM A;  4N41 A;  4OLA A;  3LP0 A;  3VA0 A;  2HHQ A;  2OZM A;  3MED A;  1KLM A;  3OYL A;  2B6A A;  4FVM A;  1BHL A;  2HMI A;  4HTU A;  3SQ4 A;  1CXQ A;  3AVA A;  4AHU A;  4DFP A;  3THV A;  3ASM A;  1S9E A;  2Z1J A;  4CJK A;  4CGH A;  4JRP A;  1NKB A;  4DTP A;  4EZ9 A;  4E7J A;  3RRH A;  1XHZ A;  4RW4 A;  4BDZ A;  3AA4 A;  1JXE A;  3AA5 X;  1RCH A;  2BAN A;  2LSN A;  4Z4C A;  3KJV A;  2X6S A;  2YNG A;  2D0B A;  3EZ5 A;  4E7L A;  3BGR A;  3MXI A;  1REV A;  1NK0 A;  2HHT A;  4H4M A;  4CJP A;  4CEZ A;  1RDC A;  2IOC A;  1BL3 A;  4E19 A;  4C8N A;  2G8U A;  4M3Z A;  3ZT2 A;  5HP1 A;  4GVM A;  4JS4 A;  3AVC A;  2KZM A;  1TKX A;  1L3U A;  4FJL A;  3O3H A;  1S5J A;  1VSE A;  3AVK A;  4RW9 A;  4DS4 A;  1TKD A;  2QK9 A;  3HPG A;  1SL2 A;  3OYJ A;  1RT6 A;  4CGD A;  2D5R A;  3OYD A;  3U3Y A;  1ASV A;  3PUF A;  3I0R A;  2HVI A;  2ZE2 A;  3K5O A;  1TK0 A;  3QEW A;  4DU1 A;  3K5L A;  2KW4 A;  4M42 A;  4FW2 A;  1SV5 A;  2FBV A;  3ZSW A;  1WN7 A;  1EET A;  4CEE A;  2R7Y A;  3NF8 A;  3MAQ A;  1YTA A;  3OY9 A;  4KV8 A;  4CJL A;  2F8S A;  3HT3 A;  4AHT A;  1VSI A;  1SUQ A;  4OKE A;  4HCB A;  4FJ8 A;  3DMJ A;  1WAJ A;  1SL1 A;  2ETJ A;  2Y1I A;  3QIP A;  4Z0U A;  1X9W A;  3DLB A;  4CJF A;  1U49 A;  3VQ8 A;  3NGI A;  5FDL A;  4DQP A;  4NCB A;  3V1R A;  1NK6 A;  1HRH A;  4KAZ A;  4CFA A;  4CHO A;  2OPR A;  3PV8 A;  1C1C A;  3IG1 A;  4LD0 A;  4XIU A;  4DTX A;  4KHQ A;  1TAU A;  1FK9 A;  4C8M A;  2KFN A;  4CF8 A;  2HNZ A;  3TAG A;  4JRQ A;  4F3O A;  3VQQ A;  2YHA A;  1A5W A;  1VSK A;  3B6O A;  4PUO A;  1LW0 A;  4ZHR A;  4CGJ A;  4JS5 A;  3AVM A;  2HHV A;  1VRU A;  1QSS A;  3NHG A;  4FJI A;  5DK5 A;  4YFU A;  4Y1D A;  1QTM A;  1ZBF A;  4ID1 A;  1RT5 A;  1RT1 A;  2D0C A;  4FK0 A;  3IAY A;  3ZSZ A;  4W5O A;  4DSF A;  4FK2 A;  5DMR A;  1G15 A;  4FXD A;  3P1G A;  4CJR A;  4CER A;  4B8C A;  4HHT A;  5JS2 A;  2HB5 A;  3NF6 A;  3HPO A;  3MXM A;  3O3F A;  4L8R B;  4GW6 A;  4J2D A;  3L2R A;  1ZBH A;  4OGC A;  2HHS A;  1W0H A;  2ITG A;  4W5T A;  3QET A;  3SI6 A;  1LWF A;  4HVJ A;  4NCG A;  4M3X A;  2FBX A;  4OGE A;  4CJV A;  2OZS A;  3M8P A;  1A5V A;  4CED A;  4Z4H A;  1NK8 A;  2B4J A;  4G1Q A;  5C42 A;  2Z1H A;  4KHW A;  2O4G A;  1RDD A;  1IKW A;  1S6P A;  3DM2 A;  3AVH A;  4CFD A;  2XY7 A;  2G8H A;  1MU2 A;  1BIU A;  4FJH A;  1VSL A;  4DTN A;  4Z4I A;  4C8O A;  4DTO A;  5SWM A;  1T05 A;  3QNO A;  4OKJ A;  3SJJ A;  1SL0 A;  4CHQ A;  1VSD A;  4GMJ B;  1HQE A;  1U04 A;  1VSH A;  4E1N A;  1HQU A;  3LAN A;  1C0U A;  3OJU A;  3I8D A;  4BE0 A;  4N47 A;  5KI6 A;  4EZ6 A;  4DTJ A;  4BE1 A;  1HYV A;  4CEB A;  2O4I A;  4AHR A;  3DLG A;  4CGI A;  4K8X A;  5T7B A;  3CFR A;  3KIO A;  2DFE A;  5FRM A;  5J2N A;  2QKB A;  3JYT A;  4CHY A;  3NE6 A;  1WAF A;  3HST B;  4DU4 A;  2OA8 A;  3C95 A;  2XY5 A;  1Q9X A;  2HHX A;  3V6D A;  4KTQ A;  3O4Q A;  1JLE A;  5E41 A;  2G8K A;  4WE1 A;  2RF2 A;  1LV5 A;  3SUP A;  1RTI A;  4B9N A;  3ZSY A;  1B92 A;  3M8Q A;  4O55 A;  4M45 A;  4FJM A;  3PY8 A;  5KTQ A;  3MXJ A;  3WNE A;  4N56 A;  5C24 A;  3SCX A;  3AO2 A;  1TVR A;  3SPY A;  1TKZ A;  2DY4 A;  1IKY A;  2GV9 A;  1RBR A;  4HUF A;  1KLN A;  4LH4 A;  4E7H A;  1J5O A;  4DU3 A;  4FJ7 A;  3HYF A;  1C1B A;  2VG7 A;  2PZS A;  1VK0 A;  3CFO A;  5J2Q A;  2GBZ A;  3MEG A;  4PA1 A;  5KGW A;  5SZT A;  3LDS A;  1ZYQ A;  1L3S A;  1JLG A;  4HCC A;  3ZCM A;  4IG3 A;  1X9S A;  4DTM A;  4I7F A;  3NH2 A;  5HRR A;  2VG5 A;  4LH5 A;  1XI1 A;  4CHZ A;  4OPJ A;  2HND A;  1BI4 A;  3O4N A;  4Y1C A;  3ULD A;  3AV9 A;  3DLK A;  1JLA A;  3HVT A;  3KK2 A;  3EY1 A;  2A1S A;  4DTR A;  4KHY A;  3ZT3 A;  3LZI A;  1RT4 A;  3NH0 A;  3HVR A;  4YNQ A;  2XY8 A;  1BQM A;  1I3A A;  2VG6 A;  1YT3 A;  4KPY A;  3UIQ A;  3IS9 A;  2I5J A;  4CEA A;  1BIZ A;  3NH1 A;  4DTS A;  3LP2 A;  2FBT A;  3C6T A;  4CGG A;  2IGI A;  3KLF A;  4DSK A;  3KTQ A;  4ICL A;  3VQP A;  3RMA A;  1QQC A;  2RPI A;  2YNH A;  1JL2 A;  5C25 A;  1S1W A;  2BDP A;  3H08 A;  4FCY A;  4CE9 A;  4FLU A;  4RW7 A;  1C1A A;  1GOB A;  1HNI A;  2ZQB A;  2YHB A;  4NYN A;  1X9M A;  1IKX A;  1L3V A;  2PYJ A;  4J2B A;  4ZTJ A;  4UQG A;  1EX4 A;  4H8K A;  4J2A A;  2XHB A;  3K2P A;  3V81 A;  2P51 A;  4DSJ A;  3KKS A;  4NCA A;  2XY6 A;  1ZBI A;  1WNS A;  4M3Y A;  1S1T A;  4LY7 A;  4AIL C;  3MEE A;  2E6M A;  2YNF A;  1BCO A;  1LAV A;  2D0A A;  1LW2 A;  5CZ1 A;  1JL1 A;  1WSF A;  2YKN A;  3DOL A;  3SZ2 A;  3HL8 A;  4DS5 A;  4FK4 A;  1C6V A;  4CF2 A;  1HNV A;  3KKR A;  3ZT1 A;  2QXF A;  4FJX A;  1YTU A;  1Z26 A;  2NUB A;  3KK3 A;  4KI4 A;  1VSF A;  1YVU A;  3K5N A;  4CJE A;  4DLE A;  2IS3 A;  2YNI A;  3F9K A;  3CQ8 A;  3QEX A;  4FW1 A;  4M3T A;  2JGU A;  2Z1G A;  4O0J A;  3OYH A;  3OYI A;  3RR8 A;  1KCF A;  3OVN A;  3PO4 A;  3VQA A;  4Q0B A;  4AH9 A;  1XWL A;  4CIF A;  3AO4 A;  2X74 A;  1TL3 A;  2YV0 X;  1QSY A;  1NJW A;  2ZD1 A;  4FJK A;  2F8T A;  1UOC A;  1T03 A;  3DI6 A;  3AO1 A;  4FLT A;  3LAM A;  1NK5 A;  2IAJ A;  3KLG A;  3RRG A;  4ID5 A;  4NYF A;  4E7I A;  5FRO A;  4FJ5 A;  4KHN A;  3HO1 A;  3EYZ A;  1NOY A;  1RT7 A;  3AVN A;  4MFB A;  3RTV A;  3OYF A;  3HPH A;  4ELT A;  1CLQ A;  1SKS A;  2BE2 A;  1QHT A;  4E0D A;  3BDP A;  3CG7 A;  4HUE A;  3VQC A;  1NK4 A;  1T8E A;  3WNG A;  1ITG A;  1HYZ A;  4Z4F A;  4KHS A;  3OYB A;  3V9S A;  4QCL A;  2EHG A;  3TWH A;  3NGY A;  4E3S A;  3PO5 A;  2KZZ A;  4PY5 A;  2RN2 A;  2KQ2 A;  3O3G A;  3OS2 A;  1RDA A;  4KTW A;  3V9W A;  2E6L A;  3LAK A;  1RTD A;  3VQ7 A;  3S9H A;  4O0I A;  1I39 A;  3P83 D;  4DWI A;  1FKO A;  1NJY A;  1HPZ A;  3CM6 A;  3DRR A;  1TAQ A;  1KVB A;  4CJ3 A;  4CHP A;  3TAE A;  1J9A A;  1WSJ A;  4OVL A;  3VQE A;  4DSL A;  4F8R A;  3AVI A;  4M3W A;  4CES A;  4F2R A;  4BWJ A;  3FFI A;  3I0S A;  3SUQ A;  1DTT A;  4CJW A;  4ZTF A;  3V4I A;  2G8F A;  3PX0 A;  3OYC A;  2KTQ A;  2OPS A;  1BGX T;  3QIN A;  3OS1 A;  3L2U A;  1WSI A;  3F73 A;  3IRX A;  4M3U A;  1TK8 A;  2HHU A;  1LWC A;  3PX6 A;  3G0Z A;  1U47 A;  1JLF A;  4DSE A;  4OLB A;  3TAF A;  4FZY A;  1X1P A;  1ASW A;  3M8S A;  2OYQ A;  3KLE A;  1VSJ A;  5KRT A;  1TKT A;  3TAB A;  3OYK A;  4FLW A;  4KB1 A;  2BGG A;  5CY4 A;  2B5J A;  4CGF A;  1LAW A;  1JLB A;  1S6Q A;  3WNH A;  3ZSX A;  3AVL A;  2IC3 A;  4CJ4 A;  3A2F A;  1ZBL A;  4ELV A;  4KRF A;  1JLQ A;  3G10 A;  4DTU A;  1TGO A;  3TAN A;  3TAQ A;  3HXM A;  2WOM A;  4FJG A;  3TAR A;  3OYN A;  5J2P A;  1WSG A;  4DMN A;  4IFY A;  4F4K A;  3SUO A;  4FM2 A;  4IG0 A;  1CXU A;  4DFK A;  3VQ5 A;  4W5N A;  3SQ1 A;  3ISN C;  4FZZ A;  5JS1 A;  1QE1 A;  3L2V A;  4N76 A;  3NF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...