4GVMA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
148
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTACWWAGIKQEFGIPYNPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
total genus 44
structure length 148
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gvmA00
4B3OA 3ASMA 4PA1A 1LWFA 3KK2A 3DOLA 2BGGA 3DMJA 4BE1A 2E6LA 1BISA 3CM5A 3NGYA 3LALA 3QNOA 3RWUA 3LP0A 3A2FA 4G1QA 4N47A 5J2NA 4CJKA 4FJ5A 1S1WA 3KTQA 3I0RA 4DTUA 4GMJB 3LP1A 4CF2A 4B9VA 4FJMA 3I0SA 2HHQA 4DQSA 4B8CA 2X6SA 3AVCA 1IO2A 4CJ4A 5FRMA 4FZZA 3KKRA 1CXQA 3ZT2A 4NCGA 4DQRA 2P5OA 1KFSA 4GVMA 4FM1A 3MXJA 5CZ2A 1XWLA 4FJJA 3OYBA 3HT3A 3O4QA 4CJFA 2QKKA 5CY4A 3ZSXA 4BWMA 4FLTA 1CZ9A 4DTXA 1RDAA 4CK1A 3JYTA 4FLXA 4DQPA 5I42A 3OYEA 3K59A 3C95A 3SQ0A 1VSKA 3NH1A 3AVHA 4AH9A 4Y1DA 1CXUA 4I7FA 3RTVA 4MFBA 4Z4FA 4CHOA 3AVIA 2G8WA 2RKIA 4LSNA 1BIZA 4DMNA 1T05A 4KHSA 1KCFA 4XIUA 3VQCA 4DLGA 4J2EA 3OS1A 4J2AA 3V1RA 3K2PA 1UWBA 2BE2A 4CF9A 1QSSA 4B9MA 3T3FA 4B9TA 4KB1A 4DS5A 4FCYA 3MXMA 5HLFA 1C6VA 3V9SA 3U3GA 1RILA 1NKBA 4FZYA 3RMBA 4E3SA 3HP9A 4CEAA 2YNGA 3TAMA 3S9HA 1S5JA 2GUIA 4DSLA 1DTTA 4TSXA 4HCCA 2YV0X 3WNFA 4UQGA 3OS0A 4B08A 2YNIA 4Y1CA 1YTAA 4NYNA 4Z4CA 2X6NA 4AHUA 4H8KA 4AHSA 4N5SA 1RDBA 1JXBA 2GBZA 4OJRA 3ITHA 3V9UA 4E7LA 4CHQA 4DU3A 4N56A 1RT6A 1I39A 3AA3A 4AHRA 4DTNA 3OYIA 3QETA 4Z4EA 3VQ5A 3VQ7A 1NJZA 1GOAA 1BI4B 3AA2A 1WSGA 4KFBA 3NGZA 1KLMA 1N6QA 4PQUA 1C0TA 5CZ1A 1NK4A 2Z1JA 4CEQA 4FLZA 4OGCA 3SUQA 4OKEA 3IS9A 4IFYA 4RW9A 1KSPA 1B92A 5KTQA 3DRRA 4IFVA 1T03A 5EU7A 4FJKA 2O4IA 3QERA 4HVJA 4RG8A 1SL2A 1ZBHA 1LW2A 3DLGA 1L3SA 1TKZA 4BDZA 4QCLA 3AO1A 2XO7A 1TK0A 1HMVA 3L2RA 3FFIA 4CECA 3M8QA 3CFRA 1ZYQA 4CF1A 4O5BA 4Z4HA 4N76A 3MAQA 4BE2A 3HO1A 1TAQA 4E1MA 1X1PA 3QEPA 1N5YA 3SUPA 2YHBA 4HHTA 3ZT4A 1HRHA 1TGOA 5HRPA 3TR8A 3OYDA 1FKOA 4KHWA 1X9SA 2P1JA 3CFOA 3QLHA 1JL2A 2JGUA 1S6PA 4CIFA 1JLCA 2IAJA 2OZSA 3PX4A 2AJQA 3AVMA 2YNFA 2XHBA 1WSIA 3TAQA 4IG0A 1JLBA 3MECA 1HYSA 1C1CA 4B8AB 4L8RB 3SYZA 4FLVA 1KRPA 3OYNA 3OYGA 1SV5A 2PZSA 4DU4A 2NUBA 3F9KA 3QIOA 4RW7A 1BL3A 4CEZA 4C8KA 4J2DA 3RMAA 3PY8A 4ID5A 3ZSRA 3VQBA 4EZ9A 4M3YA 1TAUA 3HJFA 2HVIA 4MQ3A 2W42A 3K5MA 3MXIA 4CK3A 1KFDA 4F2RA 3TAFA 1VK0A 3AVAA 4E19A 3HK2A 3AA5X 1RTDA 1J53A 4KAZA 1VSHA 4Q0BA 1G15A 3AO5A 3L3UA 3OYHA 2OYQA 3VQAA 1XI1A 1RBUA 4ZHRA 1J5OA 4M3ZA 1RBVA 1SUQA 1DLOA 2G8VA 2P5GA 2DFEA 3O3HA 3AVLA 4R5PA 4OKKA 2DTUA 3OYFA 3K5NA 4EP5A 4BACA 4CESA 4CGIA 2D0CA 5DK5A 3WNGA 4CJ3A 3O3FA 3PX6A 3LP3A 2B5JA 3L2VA 1I3AA 4DF8A 3SCXA 1TK8A 3VQ8A 3D0PA 1RTHA 4BWJA 1Y97A 1QSLA 1O1WA 3P83D 3LP2A 1X9MA 3P5JA 3ZCMA 2HW3A 3QEIA 4CHYA 1TK5A 3PO5A 1REVA 5SZTA 3MEDA 3TABA 1S1VA 1SL0A 4CCHA 1UA1A 5KRSA 4W5RA 3RR8A 2RF2A 3AO4A 1BQMA 4OPKA 2YNHA 4CJQA 3HVRA 3LANA 4AHCA 4DLEA 3G0ZA 2Y1JA 4AHVA 4E7JA 1CLQA 4CIGA 4IG3A 3V1QA 4W5OA 1RTIA 4YNQA 3AVNA 2WONA 4C8NA 5SWMA 4PWDA 4LD0A 4DF4A 5J1EA 4DTSA 1QE1A 3OVNA 1F21A 4LH5A 4ZTFA 5CYQA 4E7HA 4M42A 3LWLA 3AVGA 4E7IA 3OYJA 1NK6A 3LPUA 4DFPA 3I8DA 3L2WA 1A5VA 2OPQA 3TAPA 2HHWA 2ZD1A 1VSLA 4CK2A 3T19A 1XHZA 3KK1A 3HXMA 4DFKA 1NOZA 4M3TA 4CJSA 1RT3A 3H08A 5HRSA 4CJWA 4FXDA 2X74A 3B6OA 4DG1A 5KRTA 3JSMA 3F73A 1WN7A 3DLHA 4FJ7A 1U49A 4KHYA 2P51A 3HYFA 1JLEA 1HQEA 5KGXA 4K8XA 4O0JA 3IRXA 1KTQA 1U47A 2ZE2A 3DM2A 4O44A 3B6PA 4KKOA 5HRRA 4OGEA 3ULDA 4FLWA 3SV4A 1NKCA 4IKFA 4KREA 4CHNA 1VSMA 1W9HA 4JLHA 3DOKA 4CJLA 1C1BA 4F2SA 4CGFA 1HPZA 1YT3A 4H4OA 4LY7A 2YHAA 1TL3A 3NH2A 4HUGA 2F8TA 4O0IA 3VN5A 5C42A 4Z0UA 3ALYA 1JXEA 3KLGA 3PX0A 3VQ9A 3HVTA 3OJSA 4F8RA 1BQNA 3HPGA 3EZ5A 3QNNA 4FZXC 4QAGA 3TANA 1XHXA 3QEXA 4ID1A 4CJUA 1VSDA 2G8KA 1S1XA 4B9NA 3G10A 2DFFA 5HBMA 2B6AA 3ZT1A 1BGXT 4OVLA 4OPJA 1NJWA 4KO0A 5JS1A 4CGHA 5KGWA 1A5WA 1QS4A 2D0AA 3NH0A 1RBSA 3SJJA 4FJ9A 1NKEA 3VQDA 2KTQA 4DQQA 4PUOA 3CYMA 2VG5A 4CHPA 3QINA 3AVKA 3OYCA 2D0BA 2R7YA 4JS5A 4CEOA 3U3YA 4KPYA 1D8YA 4CEBA 4DTRA 1QHTA 2OPSA 1FK9A 3RMDA 3VA0A 3V4IA 4EZ6A 3UIQA 2A1SA 4CGJA 3OYAA 3ZT3A 4HTUA 1NJXA 5J2PA 1JKHA 4M45A 1T8EA 1WAJA 1Z25A 4CFCA 3K58A 4DFMA 4Z4IA 3L8BA 1C0MA 2XRIA 1ASWA 1HQUA 1RDCA 4B9LA 4DSEA 4ELTA 4DS4A 3VQEA 1QSYA 1RBTA 3HM9A 4AILC 3SV3A 2KZZA 1RCHA 1A5XA 1U04A 1BCMA 5K14A 3SQ1A 4KRFA 1S1TA 4CEDA 1JLFA 4FJIA 4B9SA 2XY5A 1EETA 1RTJA 5I3UA 3M8RA 4I9QA 2VWKA 1YVUA 1TV6A 1RT5A 3DLEA 3NF8A 4RW8A 5HRNA 4DTMA 2ITGA 4M41A 5HP1A 3TI0A 2EHGA 5C25A 5J2MA 3NDKA 1SKWA 1IKWA 3DLRA 3PV8A 1UA0A 3NGIA 4HUEA 4DFJA 4KTWA 2XY8A 3ZSOA 2BANA 4KTQA 1J9AA 1WNSA 2F96A 4DTPA 1U48A 1GOCA 1ZBFA 4CGDA 2F8SA 1K6YA 4DU1A 4B9UA 3OYMA 3PUFA 3MEEA 3K5LA 3SI6A 1U45A 2OA8A 2JLEA 2DY4A 1NK8A 4JS4A 1VSIA 4DTJA 1EXQA 3S3NA 4HUFA 1HYZA 1S9GA 4FW1A 3C94A 3K5OA 2ZQBA 4HCBA 2X78A 3NF7A 3AVJA 2QK9A 1VRUA 3L3VA 1ASVA 1TKDA 2HNYA 1X9WA 1ASUA 1JL1A 2EX3A 2FBXA 3KK3A 2RN2A 2G8UA 1WSEA 3DYAA 3KKSA 3WNEA 4I2PA 4W5QA 5J2QA 3RR7A 4FK2A 4FK4A 2LSNA 2Z1HA 3VQPA 1IKVA 1D9FA 3EYZA 3CFPA 1IKXA 2A1RA 1SKSA 1BI4A 2HNDA 1T7PA 4I9LA 4CFBA 3ZSVA 2Z1GA 1S1UA 4EP4A 4DSIA 3V81A 4RW6A 3NAEA 3HP6A 3ZT0A 3SUOA 2HNZA 2IC3A 2GV9A 4CEFA 3EY1A 1D9DA 2PYLA 4M3UA 4W5NA 3RRGA 3V9XA 3NCIA 3V6DA 1TVRA 4NCBA 3QO9A 3OY9A 4BDPA 1RT7A 2KQ2A 3LAKA 2HVHA 4CJRA 3ZSYA 3U6FA 1SKRA 1WLJA 1JLAA 4NCAA 4KHNA 1UAXA 2IS3A 4CFAA 3HPOA 1TKTA 2VG7A 4OLAA 3V1OA 3NF6A 4DQIA 4FJXA 4FJHA 3KLHA 3TAEA 3T1AA 4KI4A 4IDKA 4AHTA 1VSFA 4DSJA 2XY7A 5C24A 4CJTA 1HNVA 4IBNA 3NFAA 3O4NA 1KVAA 4F3TA 3LZIA 2B4JA 1EP4A 4J2BA 2HHUA 4FJLA 4H4MA 1ZBUA 4FJGA 2VG6A 5CYMA 1GOBA 1FKPA 4E89A 2IDOA 3LZJA 1RT2A 2ATQA 3KLIA 1Q8IA 5DMRA 4DWIA 1QTMA 3NE6A 4KB0A 3ISNC 5JS2A 1RDDA 1ZBLA 1S9EA 3QESA 3M8PA 1ITGA 3M8SA 1B9DA 2G8IA 3KLFA 1U4BA 3AV9A 3CQ8A 3KJVA 3L2UA 3BGRA 4F3OA 4M3XA 4CFDA 1JLQA 3C6TA 4JRQA 1ZBIA 3DLBA 3C6UA 5FROA 3V9WA 4C8LA 1C1AA 4DTOA 3DRPA 1L3TA 3DLKA 3QEWA 1IKYA 3SUNA 2HHTA 2VWJA 3TARA 3VQ4A 3SPZA 1NOYA 3KD5E 1WSHA 3S3OA 3CM6A 4DSKA 4Z4GA 3NBPA 3AVFA 3OS2A 4ZTJA 3NF9A 3VQQA 4E1NA 4QOZB 2FBVA 4KHUA 3QIPA 3WNHA 1KVBA 3D45A 1Q9YA 1LWCA 2KFNA 2I5JA 1HYVA 3SQ2A 4ICLA 4I2QA 3SNNA 1LW0A 3DRSA 4YFUA 4E0DA 4LSLA 4CHZA 4KHQA 2XY6A 3S3MA 3THVA 1D5AA 4BDYA 1FXXA 1L3VA 2QXFA 3QEVA 4ELVA 2YKNA 3E01A 4FJNA 4O4GA 1NK0A 1JLGA 4WE1A 1RNHA 4BE0A 4ELUA 4M3RA 3LWMA 4GW6A 3ZSWA 4N41A 2OZMA 1EX4A 2KW4A 1Z26A 3KD1E 5D3GA 2Y1IA 5FRNA 1QQCA 1RBRA 1NK9A 4OLBA 4CJVA 1VSEA 2E4LA 1RT4A 1UOCA 3SQ4A 1L3UA 2HHSA 2Q3SA 1YTUA 1EKEA 3TWHA 4CJ5A 3RMCA 2IOCA 4W5TA 5HROA 4FYDA 1RT1A 2G8FA 3KLEA 2HMIA 4KI6A 3VA3A 2IGIA 1NJYA 3O3GA 3PO4A 3HL8A 2HB5A 1BCOA 1HJRA 2D5RA 3AVBA 5T7BA 4Q5VA 4RW4A 2YKMA 1S6QA 4DSFA 3CG7A 1L5UA 1WSFA 4JRPA 3IAYA 2KZMA 3DI6A 4FM2A 1BIUA 3L2QA 1VRTA 1NK7A 1DTQA 4CGGA 1WSJA 4LH4A 1XC9A 4M3WA 3LDSA 1LAWA 2Z1IA 4FVMA 5E41A 3OYLA 1KLNA 3OJUA 3VQ6A 3HPHA 3HSTB 3AA4A 3BDPA 1LWEA 3KIOA 1IG9A 4CERA 1B9FA 5KI6A 2G8HA 2FC0A 4CEEA 1WAFA 4FM0A 4CIEA 2OPPA 2WOMA 3AO2A 4FJ8A 4CJEA 1TL1A 1C0UA 4K8ZA 4CE9A 4E7KA 2FBYA 3LAMA 3MEGA 4CF8A 1NK5A 1LV5A 2RPIA 1LAVA 2DFHA 2FBTA 3OYKA 4FW2A 2QKBA 3ZSQA 2O4GA 3SPYA 1CZBA 4F4KA 1J54A 1TKXA 3LPTA 1KVCA 3IG1A 3RRHA 4PY5A 4FLUA 4KTZA 1R0AA 2HHXA 4FK0A 2E6MA 3NHGA 3SZ2A 4KV8A 2BDPA 3V9ZA 4FLYA 3ZSZA 2PY5A 1W0HA 2OPRA 4NYFA 4C8MA 3AO3A 4O55A 3TAGA 5FDLA 1SL1A 1Q9XA 2PYJA 2HHVA 4CJPA 2KFZA 1VSJA 1IH7A 4CF0A 4C8OA 2ETJA 4OKJA 1HNIA 1BHLA 3K57A 1MU2A 3P1GA
chains in the Genus database with same CATH superfamily
2RHKA 3ASMA 3DXMB 1LWFA 4BRAA 3KK2A 3DOLA 3CMAN 3CM5A 4FWSA 3QNOA 3RWUA 5M1FA 4CJKA 4FJ5A 3VF4A 4FJMA 3I0SA 4H0VB 4B8CA 3AVCA 2BUPA 4FZZA 3KKRA 2ZJPL 1VQ6N 3D2EA 4JD2A 1N33K 4UY8O 3BZKA 4CJFA 1S22A 2P9KA 3K59A 1VSKA 2NRVA 4AH9A 1TUYA 4I7FA 3RTVA 4JKHA 3AVIA 3H3OB 3H46O 1M1KO 4ILJA 2HSTA 4J2EA 3OS1A 2E5LK 4J2AA 4CF9A 4FPBA 5AQFA 3T3FA 3OA9A 4JHDA 3MWPA 1BUPA 1DGKN 1C6VA 4DV0K 3MK6A 3HP9A 2HMPA 5H1SQ 3H3NO 5AQPA 1VQPN 3WNFA 3D6RA 1FJGK 3FZHA 2YNIA 1YTAA 1CZAN 4Z4CA 5AFUA 4H8KA 3OHRA 1JXBA 1XUPO 3V9UA 4E7LA 4CHQA 1I39A 3OYIA 3VQ7A 1W7AA 1NJZA 2FSJA 3O5BA 1P8ZA 1BG3A 4MDAA 4B1WB 5GINA 5AQZA 4DV5K 4JI6K 4CZEA 3IS9A 1B92A 3CQXA 4IFVA 4DR5K 2O4IA 3QERA 4HVJA 5EX5A 3DLGA 4QCLA 1GLAG 1HMVA 3FFIA 3KK7A 4Z4HA 2W6KA 5M1OA 4CVNE 3SUPA 1QZ5A 3U9DA 2YHBA 4HHTA 1TGOA 3OYDA 3D7EO 1FKOA 2NNWA 1S6PA 4CIFA 2OZSA 2YNFA 3CCLN 3O08A 2XHBA 3EE9A 3MECA 5LMNK 3TPQA 2PBDA 5FPNA 2FLOA 1SV5A 3CC7N 4J2DA 3PY8A 3ZSRA 3KWIA 3R8EA 3Q7CA 3CCMN 4F9OA 3TAFA 4DV4K 3AVAA 3AA5X 2V52B 1VSHA 1G15A 4BC3A 3J7AP 3HOTA 1N8RO 1RBUA 4IJNA 4O5FA 2G8VA 2QW9A 2YI1A 2DFEA 1VQ4N 4R5PA 4OKKA 1N34K 3CIPA 4XH4A 2B5JA 3CPEA 1TK8A 3VQ8A 4BGBA 4FWMA 3D0PA 1RTHA 2QEXN 4IO8A 4CHYA 5DM7L 3PO5A 3ATVA 1UA1A 4W5RA 3AO4A 3HVRA 2YNHA 4YDUA 3GDQA 2Y1JA 4AHVA 4BR9A 4CIGA 3V1QA 3E9OA 1HJOA 2WONA 3ATUA 5EVZA 4JK7A 4LD0A 5BPNA 5J1EA 1EWQA 1FW6A 4K42A 1F21A 1SS6A 1XNRK 5CYQA 3OYJA 5LJVA 1HX1A 4B1YB 3C6AA 3L2WA 2OPQA 1GLFO 2HHHK 1OH5A 2ASMA 2A41A 5HRSA 2Q2RA 3F73A 1YJWN 1KXPA 3CJ7A 3ULDA 5HRRA 3SV4A 3ENOA 4JLHA 2GX9A 4NLCA 5AQYA 3NH2A 4JKDA 1TL3A 1LCUA 2F8TA 3VN5A 1Z05A 3LDLA 3TTDA 3VQ9A 3HVTA 3SMSA 4A5AA 1BQNA 3HPGA 4QAGA 3TANA 4JKGB 5HBMA 3C7NA 2ZGYA 4H5RA 2O8CB 1GLEG 4H0TB 3QFPA 3J80O 1RBSA 4JKAA 2QWQA 2WTUA 2VG5A 3VENA 2R7YA 4JS5A 4CEOA 4KPYA 4CEBA 4DTRA 3RMDA 3BF3A 2UYTA 3UIQA 4CGJA 1NJXA 5J2PA 2UUAK 3ID8A 1WAJA 1Z25A 4Z4IA 3QFUA 1E4GT 1ASWA 1IBKK 4BG8A 3VQEA 3HM9A 3D2EB 4JD2B 1W2BM 1N32K 1MA9B 1S1TA 4CEDA 3CF5L 1EETA 4H0OA 1TV6A 4DTMA 3FZFA 5HP1A 1SKWA 3NDKA 1IKWA 1YUWA 4DR2K 4DFJA 4KTWA 3ZSOA 1VQLN 2E2QA 3FZKA 4IWVA 4DTPA 1ZBFA 1NBWA 4JHDB 4DU1A 3SI6A 4BRLA 3K5LA 4JS4A 4DTJA 1EXQA 2ZGZA 3K5OA 4DR6K 3NF7A 3D2FA 3IDHA 2EX3A 1JL1A 2FBXA 3RVCA 4B9LA 3CCEN 2A6AA 1IKVA 1BOTO 5BPMA 1IKXA 2A1RA 1SKSA 2HNDA 3GG4A 4CFBA 4AQYK 1X3NA 1S1UA 4EP4A 2NLXA 4RW6A 3L4IA 2P9PA 2HNZA 2IC3A 3EY1A 3RRGA 3NCIA 3OY9A 1RT7A 1QHAA 1NWKA 4CZKA 3U6FA 1WLJA 1JLAA 4KHNA 4FWQA 2IS3A 3BF1A 4WQ4C 2KKZA 3HPOA 4DQ8A 3KLHA 4IDKA 2GEMA 3K9KA 3HRGA 1M90O 1HNVA 1P90A 4F3TA 2NRTA 2QWOA 2V7ZA 2VGMA 3U8XA 5AQSA 1GOBA 1FKPA 1ZXOA 4E89A 1RT2A 1Q8IA 3NE6A 2AA4A 3QDKA 4WQ4A 5KQ8A 5AQNA 3M5RA 3VEWA 1VQ9N 1O13A 2G8IA 3MX5A 4CFDA 3C6TA 1XMQK 1ZBIA 4MO4A 5TKWA 3V9WA 1BO5O 4AM7A 2QA4N 3SPZA 3CM6A 3DJCA 2V51B 3OS2A 4ZTJA 4E1NA 4QOZB 5GAEP 3SAFA 3VGLA 1KVBA 1LWCA 3SQ2A 4LSLA 4MO5A 3SLCA 1VQNN 4ELVA 3CJ1A 5AQKA 3ZETB 4BQLA 1JLGA 1RNHA 4ELUA 4GVEA 3ZSWA 1EX4A 2KW4A 4LF4K 2Y1IA 4GV3A 1Q82O 1RBRA 3I8BA 1U2VA 2E4LA 3SQ4A 1L3UA 2IOCA 4W5TA 1WB9A 2NRXA 2IGIA 5I9EB 2WBNA 3TSQA 2HB5A 3AVBA 4DSFA 3CG7A 4NO7A 2IVPA 4JRPA 3LM2A 1BWFO 2QWPA 5JVHL 1BIUA 3I55N 1VRTA 3L2QA 4CGGA 2CGKA 3LDSA 2Z1IA 3OJUA 3HPHA 3HSTB 4IOAL 4PKGA 3I33A 1IG9A 5AQMA 3JXUA 5KI6A 3P31A 2FC0A 5C10A 4CIEA 2WOMA 3O6WA 4GV9A 2V7YA 1TL1A 2P9SA 3MEGA 1NK5A 1LAVA 4WFBL 2DFHA 3OYKA 4FW2A 4A2AA 4FVUA 4F4KA 4X65K 3IG1A 4FK0A 2KLAA 1YVNA 2PY5A 2OPRA 4C8MA 3AO3A 4CJ7A 4IJAA 4O55A 5BRFA 5FDLA 1SL1A 2PYJA 4FL9A 3VTIA 4CJPA 2KFZA 1VSJA 4CF0A 5AFUH 3TSPA 3VESA 1BHLA 3O9UA 1MU2A 4A61A 1Z6RA 3G4SN 2H3GX 3DMJA 4BE1A 3NGYA 4A5BA 2HBJA 1S1WA 3B8AX 4CF2A 4B9VA 4CZIA 3H6EA 1IO2A 4CJ4A 1OKJA 1CXQA 4NCGA 4DQRA 2P5OA 1KFSA 4A57A 1KAYA 1XWLA 4FJJA 3HT3A 1JCEA 2QKKA 4FWRA 1CZ9A 5C15A 1NGGA 1RDAA 3JYTA 4DTXA 5I42A 3OYEA 1WBBA 3SQ0A 3AVHA 4CZGA 4MFBA 4GKJK 4YOVA 2E1YA 4MLHA 4DLGA 1W97L 2BE2A 3O4WA 4IXCA 4DS5A 4FCYA 1JJ2M 3DAWA 3L0QA 5HLFA 1NKBA 1RILA 3RMBA 4OPAA 2GUIA 4TSXA 3J7YP 4B08A 3D2FB 1VAZA 1GLBG 2X6NA 4AHUA 4AHSA 1C0GA 3ITHA 4N56A 1RT6A 3QETA 4Z4EA 2ASPA 4DTNA 1YXQA 3O9TA 3AA2A 4KFBA 1WSGA 3NGZA 1KLMA 1N6QA 1C0TA 5C2DA 4WQ5A 3CQYA 1NK4A 2Z1JA 3SUQA 2P9PB 4IFYA 4RW9A 1KSPA 3L4QA 3DRRA 1VQ8N 1T03A 1QVGM 5EU7A 3MN6A 1OH6A 4RG8A 1SL2A 1ZBHA 1LW2A 1NMNA 1L3SA 4PKHA 4BDZA 3AO1A 2XO7A 1TK0A 1E3MA 3R6MA 4O5BA 1NGFA 3MAQA 4BE2A 3O80A 1S3XA 3QEPA 1N5YA 3ZT4A 3HM8A 3ENBA 1X9SA 3QLHA 2E2PA 3IFRA 3TAQA 4IG0A 1HYSA 4U67L 4FLVA 1KRPA 3KVGA 2NUBA 3QIOA 1T6DA 1BL3A 4LC9B 4ID5A 4PKIA 3HJFA 2HVIA 3UE5A 4MQ3A 2W42A 4HWIA 4X62K 4CK3A 4BC2A 3BP8A 2OTLN 1VK0A 4CZMA 4B1VA 1J53A 4JI0K 3AO5A 4XH5A 1J5OA 4ZHRA 1SUQA 4DV2K 3C0BA 1SQKA 4EP5A 4CGIA 2D0CA 2HBLA 3WNGA 3H1VX 3SCXA 3L2VA 1I3AA 4ISFA 4DV1K 5JMVA 1T6CA 3ZETA 1QSLA 3P83D 4BRGA 5LJWA 3LP2A 3G71N 3QEIA 1KAZA 1EQYA 5SZTA 3MEDA 3TABA 1S1VA 4JAXA 5KRSA 2VQEK 1BQMA 1VQ5N 4DLEA 1U2VB 2D0PA 4W5OA 1RTIA 4BR4A 4DF4A 3VETA 4DTSA 3OVNA 3AAPA 4E7HA 2VGNA 3VGKA 3AVGA 5EY4A 3ZX2A 1K73O 3TAPA 3THYA 5CE3A 1NJIO 3MX2A 4CK2A 3T19A 3KK1A 1NOZA 3QBXA 4M3TA 1RT3A 3WQTA 3A5NC 1WN7A 3DLHA 3LDPA 4KHYA 1HQEA 4K8XA 4O0JA 1V4TA 1IJJA 1KTQA 3IRXA 3IUCA 4FO0A 1U47A 2P9SB 3EZWA 4KREA 4EIAA 4DV7K 1VSMA 4CJLA 2YHAA 2EWSA 4Z0UA 3KLGA 1JXEA 2FSNA 4B3RK 4EHTA 4FZXC 1JCGA 1JCFA 4ID1A 4CJUA 1GLJO 4B9NA 2DFFA 2B6AA 1BA1A 2IIRA 5JS1A 1QS4A 3NH0A 4FJ9A 3SJJA 2KTQA 1YF5L 4PUOA 2O8DB 1HR0K 4ILHA 3CYMA 2E2OA 3AVKA 5C12A 1D8YA 4BRQA 2OPSA 2GTDA 3VA0A 3V4IA 4O8UA 3OYAA 4IDHA 2F9WA 2Q0RA 4BRNA 2CH5A 2OCEA 3TU5A 4CFCA 4DFMA 1C0MA 2QWRA 2F8SA 1RBTA 2FF3B 2ASOA 2NZTA 1ATRA 4B9SA 1Y64A 4IZ9A 3A5LC 4I9QA 4LF6K 3NF8A 4RW8A 5BREA 2CGLA 3TI0A 3M1FA 5C25A 4PHTX 1UA0A 4B3MK 4HUEA 4U7BA 2F96A 1GOCA 4CGDA 3CMEN 1Q18A 3WXJA 3IMXA 3OYMA 2DY4A 1NK8A 1VSIA 2QI2A 3C94A 4E1JA 4YOWA 1NGDA 2X78A 3N4QA 4HCBA 2QK9A 3L3VA 1ASVA 1TKDA 4ISGA 4BDPA 5M1NA 3KK3A 3HO1A 3KKSA 4BREA 4FK4A 2Z1HA 2YHXA 1D9FA 3EYZA 3CFPA 3CCQN 3ZSVA 4DSIA 3V81A 4AF1A 4CEFA 4QS9A 3V9XA 2YCHA 1DKGD 3V6DA 4NCBA 5AQWA 2KQ2A 3CJCA 1SKRA 3DLLL 3JS6A 4M63C 4CFAA 4FWPA 2VG7A 4OLAA 3V1OA 3NF6A 1NG9A 1NGEA 5AR0A 3T1AA 4CW7B 1VSFA 2QM1A 1V4SA 5BR9A 3O4NA 1KVAA 3LZIA 4GY2B 1K9MO 4GKKK 1VQ7N 2HHUA 5AQVA 2VG6A 1XC3A 5CYMA 4DR4K 5F2RA 4JKEA 5DMRA 3NVMA 4KB0A 5GAGP 5JS2A 1RDDA 3VEYA 2VQFK 1ZBLA 3QESA 3M8PA 1ITGA 5C2FA 3KLFA 4CZLA 3MN5A 3KJVA 3L2UA 1JLQA 1ATNA 2YJEA 5FROA 5AQTA 3KZBA 4DTOA 1VHXA 3DLKA 3HSCA 3TARA 3OBYA 1NOYA 3KD5E 3S3OA 3NMUA 3NBPA 3NF9A 2I7PA 2UXBK 3THXA 1Q9YA 2KFNA 3HTVA 2I5JA 1LW0A 3DRSA 4YFUA 2Q31A 4CHZA 4CZJA 2XY6A 4GV6A 1D5AA 1L3VA 2QXFA 1ILYA 4J8FA 3E01A 4FJNA 2A40A 4BRPA 1EWRA 1D4XA 2PAVA 1YAGA 4M3RA 3ZX3A 2GELA 3KD1E 3WQUA 1QQCA 4OLBA 4QS8A 1VSEA 2F4VK 1RT4A 3LL3A 2HHSA 4CZFA 1EKEA 2HOEA 4CJ5A 3CHWA 1RT1A 3DWLA 4JK9A 4KI6A 3VA3A 3O3GA 3PIPL 1BCOA 1HJRA 3O1BA 4YOYA 1S6QA 1L5UA 1WSFA 4JEPA 3DI6A 3LDQA 1NK7A 1DTQA 3THYB 1WSJA 1XC9A 1LAWA 4BRCA 2W40A 2D1KA 1X3MA 3AA4A 3BDPA 5AQOA 3VEXA 4CERA 4KH4A 5IT9O 3WXKA 4FM0A 2OPPA 2UU9K 1BU6O 1RDWX 1BA0A 3AY9A 1C0UA 4JKCA 2FBYA 2ZF5O 4C23A 2RPIA 2J4RA 4B1UB 1OH7A 4BGAA 4H5NA 3RRHA 4FLUA 3W3DA 2O8EA 4BRKA 2FF6A 4FLYA 2Q36A 4BRDA 4NYFA 3R1XA 3OW2M 1Q9XA 1R59O 1KC8O 1SZ2A 4JV5K 5FPDA 4OKJA 3SAHA 2O8DA 2QWNA 1HNIA 1A5XA 1JLEA 4NB4A 3VEZA 4LFBK 4PA1A 2P9NB 3AGRA 2UUCK 2E6LA 2CH6A 4G1QA 3A2FA 5TKYA 4N47A 5MLCQ 4GMJB 3LP1A 2HHQA 3QBWA 3UKRB 3ZT2A 3FE1A 3E9PA 4GVMA 3MXJA 5CZ2A 3OYBA 3O4QA 3ZSXA 4BWMA 5F1XA 2ZM6K 4BC5A 4FLXA 3C95A 3NH1A 4Y1DA 4Z4FA 3PSFA 2UXCK 3CCSN 2RKIA 4LSNA 1BIZA 1T05A 3CERA 3L6QA 4XIUA 5AQRA 2UXDK 4CD1A 1QSSA 3CC4N 4B9TA 4KB1A 3MXMA 4CI6A 1VQMN 4FZYA 4WFNL 1QQNA 4FWLA 2YNGA 2W6LA 3TAMA 2D4WA 4DSLA 4Y1CA 3SMPA 3SBTA 4IO9L 4DCHA 2GBZA 3TSUA 4DU3A 3AA3A 2FXUA 1DEJA 3VOVA 4CEQA 1MWKA 4FLZA 4OGCA 4WQ5C 3TTCA 4OKEA 4DUZK 4DR1K 4X64K 4FJKA 4B3TK 4RTFD 4A59A 5B8HA 3L2RA 4CECA 4RWTA 3CFRA 4CF1A 4N76A 1TAQA 4FSVA 3WXMB 1X1PA 3FR0A 2JWKA 1S72N 2BH1A 5HRPA 4NXMK 1HUXA 3VEOA 2AJQA 1JLCA 2IAJA 3PX4A 3OTOK 3MWTA 3THWA 1C1CA 4B8AB 4L8RB 3SYZA 1XQSC 3EL2A 1NMDA 3OYNA 3OYGA 1IBLK 4DU4A 3F9KA 4RW7A 5ADXA 4C8KA 3CCJN 4M7XA 4M3YA 4CD3A 1TAUA 3ENHA 5A2QO 2D0OA 1NGHA 1OVYA 3HK2A 4E19A 1RTDA 1NGCA 3L3UA 3OYHA 2OYQA 3VQAA 1HKCA 1XI1A 1DLOA 3THXB 3GOIA 3H45C 3O3HA 3AVLA 3OYFA 4BACA 3K0SA 4CESA 4CJ3A 1EO1A 3LP3A 4DF8A 4BWJA 5LMUK 1Y97A 4LF8K 1X9MA 2HW3A 5KPTA 1TK5A 1SL0A 3RR8A 2RF2A 5BRDA 3LANA 3C65A 4AM6A 4AHCA 4E7JA 4CZHA 3AVNA 4ISEA 2P9UA 3P39A 4DFPA 5JLFA 5JVGL 3I8DA 1A5VA 4KBOA 3S41A 2ZD1A 1XHZA 3AGKA 4DFKA 4CJSA 3H08A 1KAXA 5AZIA 4DR3K 4B1XB 3B6OA 4DG1A 5KRTA 1U49A 2P51A 5KGXA 3PIOL 4R79A 3WUHA 3F2KA 3GBTA 4KKOA 5CHIA 1NKCA 4IKFA 4JI4K 3CCRN 4CHNA 4H5VA 3DOKA 3TTFA 4A2BA 4CGFA 2KHOA 4LY7A 4H4OA 3WXIA 3ALYA 2Q97A 3PX0A 3OJSA 4BRFA 1GLLO 3QNNA 2WC9A 1XHXA 2O8EB 3QEXA 1VSDA 1S1XA 3G10A 4C1NI 4H5TA 3PLAA 4OPJA 4OVLA 5AQUA 1NJWA 4CGHA 3N4PA 3SJHA 1H1VA 4NLBA 1NKEA 3VQDA 4CHPA 4LFAK 3U3YA 2P9NA 3QICA 5AQHA 3A0IX 1ESVA 3GL1A 3UKRA 4JI8K 3L8BA 2XRIA 4ELTA 3RSEB 1QSYA 4AILC 3SV3A 2KZZA 4H03B 5K14A 3SQ1A 1JLFA 5M1QA 4FJIA 2XY5A 1RTJA 5C0YA 3MCAB 3VEVA 3M8RA 2VWKA 1NM1A 1YVUA 3DLEA 1U6ZA 1NU0A 2ITGA 4Y0WA 2QTDA 2EHGA 5J2MA 2VWBA 5BRHA 3CI5A 3DLRA 3PV8A 3NGIA 3WXLA 2BANA 4DHYA 3FGUA 1K6YA 1HKGA 3I56N 4B9UA 3BEXA 4RCHA 1DT9A 3QMLA 2OA8A 3EKSA 4HUFA 1S9GA 4FW1A 2ZQBA 2HNYA 1ASUA 3R9PA 3RR7A 5AQJA 3VQPA 1IG8A 4H0YB 1BI4A 2Z1GA 1VQON 3HP6A 2GV9A 2OANA 1XMOK 4M3UA 2ZJQL 4DUYK 5FPEA 4WF9L 4YOUA 3QO9A 2HVHA 4CJRA 3ZSYA 3VTHA 5BPLA 4DR7K 3HI0A 1RGIA 4NCAA 4YOTA 1TKTA 1KD1O 2BTFA 4DQIA 3EN9A 4FJXA 5FPMA 1HLUA 4FJHA 4DB3A 3TAEA 4KI4A 4AHTA 2ZJRL 2XY7A 2CGJA 1G99A 2B4JA 1EP4A 4J2BA 4FJLA 3H1QA 1ZBUA 4H4MA 3QB0A 4BQZA 1YIJN 3FZLA 2IDOA 4GNIA 5ADXH 3LZJA 5AZJB 1NGIA 3THWB 2UUBK 1QTMA 3VGMA 3ISNC 1S9EA 2YJFA 4B9QA 3M8SA 3AV9A 5AQGA 4C1NK 3BGRA 4F3OA 2VCPA 5F0XA 3C6UA 3EEQA 4C8LA 1C1AA 3J8AA 5JLHA 1L3TA 2F7TA 2VWJA 3F5TA 4IEEA 4DSKA 4Z4GA 3AVFA 4JK8A 4FPAA 1YJ9N 3VQQA 1N36K 3EO3A 3QIPA 3WNHA 4B3SK 3U4LA 4ICLA 2E20A 4I2QA 3SBGA 3CXCM 3SNNA 4JN4A 4KHQA 4JYAK 3UKUA 5KPRA 1NK0A 2FSKA 4N41A 3LWMA 1X9JA 2OZMA 1Z26A 3BUZB 4PL8A 3VERA 1MDUB 5D3GA 5FRNA 3A5OC 4CJVA 2Q3SA 1YTUA 4K41A 3ZEUA 3EKUA 3WEEA 5HROA 3SK3A 4FYDA 3KLEA 2HMIA 2F9TA 5BR8K 2P9UB 3HL8A 5T7BA 3PO4A 2D5RA 4Q5VA 1QQMA 2YKMA 3CCVN 3IAYA 2KZMA 4LH4A 4M3WA 3O8MA 2VYPA 3OYLA 3O9QA 4K0KK 4WFAL 5AZIB 2GWJA 1LWEA 2G8HA 1ATSA 2NRZA 2PFUA 4CEEA 1WAFA 5AQQA 1NLVA 2A3ZA 3AO2A 5GIPA 1YI2N 3NVKA 1YITN 4K8ZA 4G9ZA 1LV5A 3LAMA 3T7ZA 4CF8A 4DV6K 2FBTA 3KWGA 2QXLA 5JICA 4JI1K 2QKBA 2O4GA 3SPYA 1CZBA 1J54A 4OX9K 3LPTA 4YDUC 1NGAA 3ZX0A 1TYQB 3V9ZA 1Q86O 3TAGA 3O9SA 4BVPA 2O8FA 1IH7A 2ETJA 3ZYYX 3K57A 3P1GA 4B3OA 1RDUA 2E88A 4QS7A 2BGGA 1BISA 5IWAK 3LALA 3G25A 3LP0A 5J2NA 1J6ZA 3KTQA 3I0RA 4DTUA 3LDNA 4HTLA 4DQSA 4XH1A 2X6SA 5FRMA 3RSEA 3O9RA 4FM1A 3VPZA 4BY9C 4H0PA 5CY4A 3J7ZO 4Z94A 1HNXK 4FLTA 4LF7K 4DQPA 2YHYA 4CK1A 4LF9K 1CXUA 4CHOA 2G8WA 4DMNA 2YX6A 4KHSA 1KCFA 3VQCA 3DXKB 3V1RA 3K2PA 4BRHA 1UWBA 3JAMO 4B9MA 5LY3A 3A5MC 3V9SA 3U3GA 4E3SA 4CEAA 3FFKB 2P9IA 3S9HA 1S5JA 1DTTA 4HCCA 2YV0X 4UQGA 3OS0A 4NYNA 2RE2A 5E84A 4N5SA 1RDBA 4OJRA 3M6GA 4DV3K 4AHRA 3VQ5A 1GOAA 1QVFM 1BI4B 2E1ZA 5CZ1A 3FLCO 4EFHA 5KTQA 1LOTB 3M3ZA 4MLEA 5AQLA 4BRIA 3MN7A 5CR4A 3T1YK 4H5WA 1NGBA 1TKZA 3KHYA 3ID6A 3LM9A 2O8BB 1ZYQA 3M8QA 1HKBA 4IOXA 4E1MA 3VF2A 1HRHA 3TR8A 3CD6N 4KHWA 2P9LB 2P1JA 3CFOA 5GAHP 1JL2A 2JGUA 3AVMA 1HNWK 4YORA 4WYBA 1WSIA 1JLBA 1WUAA 4YOXA 1MWMA 4BR7A 5AZJA 3MMVA 3OBWA 2PZSA 3IKMA 4CEZA 2GUPA 3RMAA 4BR5A 1QZ6A 3VQBA 5EXWA 4EZ9A 3PSIA 3K5MA 3MXIA 1KFDA 4KH5A 4F2RA 4KAZA 4Q0BA 3K9JA 3CJ9A 1TUUA 2HF3A 1I94K 2OTJN 1RFQA 4M3ZA 5GADP 1RBVA 2P5GA 2DTUA 3K5NA 5DK5A 3O3FA 3PX6A 3BZCA 3CPWM 3UKUB 1O1WA 3P5JA 3ZCMA 1REVA 4CCHA 1Q7YO 1WOQA 4OPKA 4CJQA 4BR0A 3G0ZA 1CLQA 4IG3A 3ZEUB 3WEEB 4YNQA 4C8NA 4O8KA 5SWMA 4PWDA 3T69A 1OVQA 1QE1A 5LL6Z 4B1ZA 4LH5A 4BC4A 4ZTFA 3MDQA 2AP1A 4M42A 3LWLA 2NRRA 4E7IA 1NK6A 2E2NA 3LPUA 4I6MB 2HHWA 3EE8A 5ELZA 4BG9A 1VSLA 4PL7A 3G6EN 3HXMA 4CJWA 4FXDA 2Q0UA 2X74A 3JSMA 4FJ7A 2QWLA 3HYFA 1C0FA 1NNEA 3Q7BA 4L3QA 2ZE2A 3DM2A 4O44A 3B6PA 3HZ6A 4FLWA 4OGEA 1W9HA 4F2SA 1C1BA 1HPZA 1YT3A 4HUGA 4O0IA 5C42A 4F8RA 3EZ5A 1TYQA 2G8KA 3ULEB 1K8KA 1BGXT 3ZT1A 4KO0A 4YHHK 5KGWA 1A5WA 3F9MA 2D0AA 2O8FB 5BN8A 4DQQA 4FOEA 3OYCA 2QWMA 3QINA 2D0BA 3DXMA 1QHTA 1FK9A 4A62A 5AJ3K 4EZ6A 2A1SA 4HTUA 3ZT3A 2HF4A 1JKHA 4M45A 4XEIA 1T8EA 3K58A 2HBKA 5M1PA 1HQUA 4PQUA 1RDCA 4DSEA 4DS4A 4IFEA 2IVNA 1RCHA 1BDGA 1U04A 1BCMA 4OO1J 4KRFA 3LDOA 4JI5K 5I3UA 2P9KB 3VMFB 1RT5A 5HRNA 5HOOA 4MDBA 4M41A 4JKBA 1IBMK 1KQSM 4FOIA 4CBXA 1GLCG 2XY8A 3DXKA 4KTQA 1J9AA 1WNSA 4FWOA 4K25A 1U48A 4V19S 4IEIA 3PUFA 3MEEA 1U45A 2JLEA 5FLXO 4JKFA 5BN9A 2NRWA 3S3NA 1QQOA 1HYZA 2P9IB 1XNQK 1E4FT 3AVJA 3O1WA 4H0XB 1VRUA 5M1KA 1YJNN 1X9WA 4EHUA 1VQKN 2RN2A 2A42A 1WSEA 2A5XA 3DYAA 3WNEA 4I2PA 4W5QA 5J2QA 2G8UA 4FK2A 4JNEA 2LSNA 3CC2N 5AQIA 3CJAA 1T7PA 4LF5K 4I9LA 3P38A 3NAEA 3ZT0A 3AAQA 3SUOA 4W5NA 3GE1A 3UB5A 1D9DA 3AARA 2PYLA 1NGJA 1TVRA 3R3LA 1YHQN 3LAKA 2GWKA 1UAXA 3HBTA 2O8BA 2Q1NA 4ILGB 5EOYA 3T1HK 4YY3K 3E66A 4DSJA 1HPMA 5C24A 4CJTA 4IBNA 3NFAA 4FWKA 4LFCK 2P9LA 1K8AO 4FJGA 2NRHA 3P4IA 4DKWA 4CBWA 3KLIA 2ATQA 3CETA 2WFBA 4CBUA 1IV0A 3CJBA 2DPNA 1B9DA 3A8YA 1U4BA 3CQ8A 3ZLJA 4M3XA 1ZBSA 3FZMA 4JRQA 4OPHA 3DLBA 1OH8A 3DRPA 2HHTA 3QEWA 1IKYA 3SUNA 3VQ4A 1T44A 1WSHA 2IVOA 4FWNA 3MCPA 2FBVA 4KHUA 1WBDA 3D45A 1HYVA 1T3VA 4E0DA 2JWLA 3HOSA 3S3MA 3THVA 4BDYA 1FXXA 3QEVA 2YKNA 4O4GA 4WE1A 4BE0A 4GW6A 5E26A 3CCUN 4BVOA 2E8AA 4JI3K 5KQDA 3E9LA 1NK9A 5KPZA 4KHPK 1UOCA 3J81O 3TWHA 3RMCA 1ZC6A 2G8FA 1NJYA 4RW4A 1HNZK 2ZWHA 4K43A 2ITMA 3C6HA 4I6MA 4FM2A 3SAGA 1GLDG 4EAHD 4JI7K 5E41A 4FVMA 3U9ZA 1KLNA 3VQ6A 5HL7L 3KIOA 1B9FA 2YHWA 4KH6A 3VF6A 2I7NA 4FJ8A 4CJEA 4M7YA 4BR2A 4WCEL 4CE9A 3E1YA 4E7KA 4JI2K 3ZSQA 3MN9A 1J5EK 1TKXA 4BRMA 4IOCL 1KVCA 4PY5A 5AQXA 1Q81O 4KTZA 1R0AA 2HHXA 3W0LA 4JKGA 2E6MA 5GIOA 3NHGA 4BROA 3SZ2A 4KV8A 2BDPA 3ZSZA 1SAZA 3ULEA 1W0HA 3C7NB 1K8KB 2WUSA 2W41A 3WT0A 2O8CA 2HHVA 2HBMA 4C8OA 4NXNK 3BY5A 5DM6L 4X66K 4DWIA
chains in the Genus database with same CATH topology
4B3OA 3ASMA 4PA1A 1LWFA 3KK2A 3DOLA 2BGGA 3DMJA 4BE1A 2E6LA 1BISA 3CM5A 3NGYA 3LALA 3QNOA 3RWUA 3LP0A 3A2FA 4G1QA 4N47A 5J2NA 4CJKA 4FJ5A 1S1WA 3KTQA 3I0RA 4DTUA 4GMJB 3LP1A 4CF2A 4B9VA 4FJMA 3I0SA 2HHQA 4DQSA 4B8CA 2X6SA 3AVCA 1IO2A 4CJ4A 5FRMA 4FZZA 3KKRA 1CXQA 3ZT2A 4NCGA 4DQRA 2P5OA 1KFSA 4GVMA 4FM1A 3MXJA 5CZ2A 1XWLA 4FJJA 3OYBA 3HT3A 3O4QA 4CJFA 2QKKA 5CY4A 3ZSXA 4BWMA 4FLTA 1CZ9A 4DTXA 1RDAA 4CK1A 3JYTA 4FLXA 4DQPA 5I42A 3OYEA 3K59A 3C95A 3SQ0A 1VSKA 3NH1A 3AVHA 4AH9A 4Y1DA 1CXUA 4I7FA 3RTVA 4MFBA 4Z4FA 4CHOA 3AVIA 2G8WA 2RKIA 4LSNA 1BIZA 4DMNA 1T05A 4KHSA 1KCFA 4XIUA 3VQCA 4DLGA 4J2EA 3OS1A 4J2AA 3V1RA 3K2PA 1UWBA 2BE2A 4CF9A 1QSSA 4B9MA 3T3FA 4B9TA 4KB1A 4DS5A 4FCYA 3MXMA 5HLFA 1C6VA 3V9SA 3U3GA 1RILA 1NKBA 4FZYA 3RMBA 4E3SA 3HP9A 4CEAA 2YNGA 3TAMA 3S9HA 1S5JA 2GUIA 4DSLA 1DTTA 4TSXA 4HCCA 2YV0X 3WNFA 4UQGA 3OS0A 4B08A 2YNIA 4Y1CA 1YTAA 4NYNA 4Z4CA 2X6NA 4AHUA 4H8KA 4AHSA 4N5SA 1RDBA 1JXBA 2GBZA 4OJRA 3ITHA 3V9UA 4E7LA 4CHQA 4DU3A 4N56A 1RT6A 1I39A 3AA3A 4AHRA 4DTNA 3OYIA 3QETA 4Z4EA 3VQ5A 3VQ7A 1NJZA 1GOAA 1BI4B 3AA2A 1WSGA 4KFBA 3NGZA 1KLMA 1N6QA 4PQUA 1C0TA 5CZ1A 1NK4A 2Z1JA 4CEQA 4FLZA 4OGCA 3SUQA 4OKEA 3IS9A 4IFYA 4RW9A 1KSPA 1B92A 5KTQA 3DRRA 4IFVA 1T03A 5EU7A 4FJKA 2O4IA 3QERA 4HVJA 4RG8A 1SL2A 1ZBHA 1LW2A 3DLGA 1L3SA 1TKZA 4BDZA 4QCLA 3AO1A 2XO7A 1TK0A 1HMVA 3L2RA 3FFIA 4CECA 3M8QA 3CFRA 1ZYQA 4CF1A 4O5BA 4Z4HA 4N76A 3MAQA 4BE2A 3HO1A 1TAQA 4E1MA 1X1PA 3QEPA 1N5YA 3SUPA 2YHBA 4HHTA 3ZT4A 1HRHA 1TGOA 5HRPA 3TR8A 3OYDA 1FKOA 4KHWA 1X9SA 2P1JA 3CFOA 3QLHA 1JL2A 2JGUA 1S6PA 4CIFA 1JLCA 2IAJA 2OZSA 3PX4A 2AJQA 3AVMA 2YNFA 2XHBA 1WSIA 3TAQA 4IG0A 1JLBA 3MECA 1HYSA 1C1CA 4B8AB 4L8RB 3SYZA 4FLVA 1KRPA 3OYNA 3OYGA 1SV5A 2PZSA 4DU4A 2NUBA 3F9KA 3QIOA 4RW7A 1BL3A 4CEZA 4C8KA 4J2DA 3RMAA 3PY8A 4ID5A 3ZSRA 3VQBA 4EZ9A 4M3YA 1TAUA 3HJFA 2HVIA 4MQ3A 2W42A 3K5MA 3MXIA 4CK3A 1KFDA 4F2RA 3TAFA 1VK0A 3AVAA 4E19A 3HK2A 3AA5X 1RTDA 1J53A 4KAZA 1VSHA 4Q0BA 1G15A 3AO5A 3L3UA 3OYHA 2OYQA 3VQAA 1XI1A 1RBUA 4ZHRA 1J5OA 4M3ZA 1RBVA 1SUQA 1DLOA 2G8VA 2P5GA 2DFEA 3O3HA 3AVLA 4R5PA 4OKKA 2DTUA 3OYFA 3K5NA 4EP5A 4BACA 4CESA 4CGIA 2D0CA 5DK5A 3WNGA 4CJ3A 3O3FA 3PX6A 3LP3A 2B5JA 3L2VA 1I3AA 4DF8A 3SCXA 1TK8A 3VQ8A 3D0PA 1RTHA 4BWJA 1Y97A 1QSLA 1O1WA 3P83D 3LP2A 1X9MA 3P5JA 3ZCMA 2HW3A 3QEIA 4CHYA 1TK5A 3PO5A 1REVA 5SZTA 3MEDA 3TABA 1S1VA 1SL0A 4CCHA 1UA1A 5KRSA 4W5RA 3RR8A 2RF2A 3AO4A 1BQMA 4OPKA 2YNHA 4CJQA 3HVRA 3LANA 4AHCA 4DLEA 3G0ZA 2Y1JA 4AHVA 4E7JA 1CLQA 4CIGA 4IG3A 3V1QA 4W5OA 1RTIA 4YNQA 3AVNA 2WONA 4C8NA 5SWMA 4PWDA 4LD0A 4DF4A 5J1EA 4DTSA 1QE1A 3OVNA 1F21A 4LH5A 4ZTFA 5CYQA 4E7HA 4M42A 3LWLA 3AVGA 4E7IA 3OYJA 1NK6A 3LPUA 4DFPA 3I8DA 3L2WA 1A5VA 2OPQA 3TAPA 2HHWA 2ZD1A 1VSLA 4CK2A 3T19A 1XHZA 3KK1A 3HXMA 4DFKA 1NOZA 4M3TA 4CJSA 1RT3A 3H08A 5HRSA 4CJWA 4FXDA 2X74A 3B6OA 4DG1A 5KRTA 3JSMA 3F73A 1WN7A 3DLHA 4FJ7A 1U49A 4KHYA 2P51A 3HYFA 1JLEA 1HQEA 5KGXA 4K8XA 4O0JA 3IRXA 1KTQA 1U47A 2ZE2A 3DM2A 4O44A 3B6PA 4KKOA 5HRRA 4OGEA 3ULDA 4FLWA 3SV4A 1NKCA 4IKFA 4KREA 4CHNA 1VSMA 1W9HA 4JLHA 3DOKA 4CJLA 1C1BA 4F2SA 4CGFA 1HPZA 1YT3A 4H4OA 4LY7A 2YHAA 1TL3A 3NH2A 4HUGA 2F8TA 4O0IA 3VN5A 5C42A 4Z0UA 3ALYA 1JXEA 3KLGA 3PX0A 3VQ9A 3HVTA 3OJSA 4F8RA 1BQNA 3HPGA 3EZ5A 3QNNA 4FZXC 4QAGA 3TANA 1XHXA 3QEXA 4ID1A 4CJUA 1VSDA 2G8KA 1S1XA 4B9NA 3G10A 2DFFA 5HBMA 2B6AA 3ZT1A 1BGXT 4OVLA 4OPJA 1NJWA 4KO0A 5JS1A 4CGHA 5KGWA 1A5WA 1QS4A 2D0AA 3NH0A 1RBSA 3SJJA 4FJ9A 1NKEA 3VQDA 2KTQA 4DQQA 4PUOA 3CYMA 2VG5A 4CHPA 3QINA 3AVKA 3OYCA 2D0BA 2R7YA 4JS5A 4CEOA 3U3YA 4KPYA 1D8YA 4CEBA 4DTRA 1QHTA 2OPSA 1FK9A 3RMDA 3VA0A 3V4IA 4EZ6A 3UIQA 2A1SA 4CGJA 3OYAA 3ZT3A 4HTUA 1NJXA 5J2PA 1JKHA 4M45A 1T8EA 1WAJA 1Z25A 4CFCA 3K58A 4DFMA 4Z4IA 3L8BA 1C0MA 2XRIA 1ASWA 1HQUA 1RDCA 4B9LA 4DSEA 4ELTA 4DS4A 3VQEA 1QSYA 1RBTA 3HM9A 4AILC 3SV3A 2KZZA 1RCHA 1A5XA 1U04A 1BCMA 5K14A 3SQ1A 4KRFA 1S1TA 4CEDA 1JLFA 4FJIA 4B9SA 2XY5A 1EETA 1RTJA 5I3UA 3M8RA 4I9QA 2VWKA 1YVUA 1TV6A 1RT5A 3DLEA 3NF8A 4RW8A 5HRNA 4DTMA 2ITGA 4M41A 5HP1A 3TI0A 2EHGA 5C25A 5J2MA 3NDKA 1SKWA 1IKWA 3DLRA 3PV8A 1UA0A 3NGIA 4HUEA 4DFJA 4KTWA 2XY8A 3ZSOA 2BANA 4KTQA 1J9AA 1WNSA 2F96A 4DTPA 1U48A 1GOCA 1ZBFA 4CGDA 2F8SA 1K6YA 4DU1A 4B9UA 3OYMA 3PUFA 3MEEA 3K5LA 3SI6A 1U45A 2OA8A 2JLEA 2DY4A 1NK8A 4JS4A 1VSIA 4DTJA 1EXQA 3S3NA 4HUFA 1HYZA 1S9GA 4FW1A 3C94A 3K5OA 2ZQBA 4HCBA 2X78A 3NF7A 3AVJA 2QK9A 1VRUA 3L3VA 1ASVA 1TKDA 2HNYA 1X9WA 1ASUA 1JL1A 2EX3A 2FBXA 3KK3A 2RN2A 2G8UA 1WSEA 3DYAA 3KKSA 3WNEA 4I2PA 4W5QA 5J2QA 3RR7A 4FK2A 4FK4A 2LSNA 2Z1HA 3VQPA 1IKVA 1D9FA 3EYZA 3CFPA 1IKXA 2A1RA 1SKSA 1BI4A 2HNDA 1T7PA 4I9LA 4CFBA 3ZSVA 2Z1GA 1S1UA 4EP4A 4DSIA 3V81A 4RW6A 3NAEA 3HP6A 3ZT0A 3SUOA 2HNZA 2IC3A 2GV9A 4CEFA 3EY1A 1D9DA 2PYLA 4M3UA 4W5NA 3RRGA 3V9XA 3NCIA 3V6DA 1TVRA 4NCBA 3QO9A 3OY9A 4BDPA 1RT7A 2KQ2A 3LAKA 2HVHA 4CJRA 3ZSYA 3U6FA 1SKRA 1WLJA 1JLAA 4NCAA 4KHNA 1UAXA 2IS3A 4CFAA 3HPOA 1TKTA 2VG7A 4OLAA 3V1OA 3NF6A 4DQIA 4FJXA 4FJHA 3KLHA 3TAEA 3T1AA 4KI4A 4IDKA 4AHTA 1VSFA 4DSJA 2XY7A 5C24A 4CJTA 1HNVA 4IBNA 3NFAA 3O4NA 1KVAA 4F3TA 3LZIA 2B4JA 1EP4A 4J2BA 2HHUA 4FJLA 4H4MA 1ZBUA 4FJGA 2VG6A 5CYMA 1GOBA 1FKPA 4E89A 2IDOA 3LZJA 1RT2A 2ATQA 3KLIA 1Q8IA 5DMRA 4DWIA 1QTMA 3NE6A 4KB0A 3ISNC 5JS2A 1RDDA 1ZBLA 1S9EA 3QESA 3M8PA 1ITGA 3M8SA 1B9DA 2G8IA 3KLFA 1U4BA 3AV9A 3CQ8A 3KJVA 3L2UA 3BGRA 4F3OA 4M3XA 4CFDA 1JLQA 3C6TA 4JRQA 1ZBIA 3DLBA 3C6UA 5FROA 3V9WA 4C8LA 1C1AA 4DTOA 3DRPA 1L3TA 3DLKA 3QEWA 1IKYA 3SUNA 2HHTA 2VWJA 3TARA 3VQ4A 3SPZA 1NOYA 3KD5E 1WSHA 3S3OA 3CM6A 4DSKA 4Z4GA 3NBPA 3AVFA 3OS2A 4ZTJA 3NF9A 3VQQA 4E1NA 4QOZB 2FBVA 4KHUA 3QIPA 3WNHA 1KVBA 3D45A 1Q9YA 1LWCA 2KFNA 2I5JA 1HYVA 3SQ2A 4ICLA 4I2QA 3SNNA 1LW0A 3DRSA 4YFUA 4E0DA 4LSLA 4CHZA 4KHQA 2XY6A 3S3MA 3THVA 1D5AA 4BDYA 1FXXA 1L3VA 2QXFA 3QEVA 4ELVA 2YKNA 3E01A 4FJNA 4O4GA 1NK0A 1JLGA 4WE1A 1RNHA 4BE0A 4ELUA 4M3RA 3LWMA 4GW6A 3ZSWA 4N41A 2OZMA 1EX4A 2KW4A 1Z26A 3KD1E 5D3GA 2Y1IA 5FRNA 1QQCA 1RBRA 1NK9A 4OLBA 4CJVA 1VSEA 2E4LA 1RT4A 1UOCA 3SQ4A 1L3UA 2HHSA 2Q3SA 1YTUA 1EKEA 3TWHA 4CJ5A 3RMCA 2IOCA 4W5TA 5HROA 4FYDA 1RT1A 2G8FA 3KLEA 2HMIA 4KI6A 3VA3A 2IGIA 1NJYA 3O3GA 3PO4A 3HL8A 2HB5A 1BCOA 1HJRA 2D5RA 3AVBA 5T7BA 4Q5VA 4RW4A 2YKMA 1S6QA 4DSFA 3CG7A 1L5UA 1WSFA 4JRPA 3IAYA 2KZMA 3DI6A 4FM2A 1BIUA 3L2QA 1VRTA 1NK7A 1DTQA 4CGGA 1WSJA 4LH4A 1XC9A 4M3WA 3LDSA 1LAWA 2Z1IA 4FVMA 5E41A 3OYLA 1KLNA 3OJUA 3VQ6A 3HPHA 3HSTB 3AA4A 3BDPA 1LWEA 3KIOA 1IG9A 4CERA 1B9FA 5KI6A 2G8HA 2FC0A 4CEEA 1WAFA 4FM0A 4CIEA 2OPPA 2WOMA 3AO2A 4FJ8A 4CJEA 1TL1A 1C0UA 4K8ZA 4CE9A 4E7KA 2FBYA 3LAMA 3MEGA 4CF8A 1NK5A 1LV5A 2RPIA 1LAVA 2DFHA 2FBTA 3OYKA 4FW2A 2QKBA 3ZSQA 2O4GA 3SPYA 1CZBA 4F4KA 1J54A 1TKXA 3LPTA 1KVCA 3IG1A 3RRHA 4PY5A 4FLUA 4KTZA 1R0AA 2HHXA 4FK0A 2E6MA 3NHGA 3SZ2A 4KV8A 2BDPA 3V9ZA 4FLYA 3ZSZA 2PY5A 1W0HA 2OPRA 4NYFA 4C8MA 3AO3A 4O55A 3TAGA 5FDLA 1SL1A 1Q9XA 2PYJA 2HHVA 4CJPA 2KFZA 1VSJA 1IH7A 4CF0A 4C8OA 2ETJA 4OKJA 1HNIA 1BHLA 3K57A 1MU2A 3P1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3O A;  3ASM A;  4PA1 A;  1LWF A;  3KK2 A;  3DOL A;  2BGG A;  3DMJ A;  4BE1 A;  2E6L A;  1BIS A;  3CM5 A;  3NGY A;  3LAL A;  3QNO A;  3RWU A;  3LP0 A;  3A2F A;  4G1Q A;  4N47 A;  5J2N A;  4CJK A;  4FJ5 A;  1S1W A;  3KTQ A;  3I0R A;  4DTU A;  4GMJ B;  3LP1 A;  4CF2 A;  4B9V A;  4FJM A;  3I0S A;  2HHQ A;  4DQS A;  4B8C A;  2X6S A;  3AVC A;  1IO2 A;  4CJ4 A;  5FRM A;  4FZZ A;  3KKR A;  1CXQ A;  3ZT2 A;  4NCG A;  4DQR A;  2P5O A;  1KFS A;  4GVM A;  4FM1 A;  3MXJ A;  5CZ2 A;  1XWL A;  4FJJ A;  3OYB A;  3HT3 A;  3O4Q A;  4CJF A;  2QKK A;  5CY4 A;  3ZSX A;  4BWM A;  4FLT A;  1CZ9 A;  4DTX A;  1RDA A;  4CK1 A;  3JYT A;  4FLX A;  4DQP A;  5I42 A;  3OYE A;  3K59 A;  3C95 A;  3SQ0 A;  1VSK A;  3NH1 A;  3AVH A;  4AH9 A;  4Y1D A;  1CXU A;  4I7F A;  3RTV A;  4MFB A;  4Z4F A;  4CHO A;  3AVI A;  2G8W A;  2RKI A;  4LSN A;  1BIZ A;  4DMN A;  1T05 A;  4KHS A;  1KCF A;  4XIU A;  3VQC A;  4DLG A;  4J2E A;  3OS1 A;  4J2A A;  3V1R A;  3K2P A;  1UWB A;  2BE2 A;  4CF9 A;  1QSS A;  4B9M A;  3T3F A;  4B9T A;  4KB1 A;  4DS5 A;  4FCY A;  3MXM A;  5HLF A;  1C6V A;  3V9S A;  3U3G A;  1RIL A;  1NKB A;  4FZY A;  3RMB A;  4E3S A;  3HP9 A;  4CEA A;  2YNG A;  3TAM A;  3S9H A;  1S5J A;  2GUI A;  4DSL A;  1DTT A;  4TSX A;  4HCC A;  2YV0 X;  3WNF A;  4UQG A;  3OS0 A;  4B08 A;  2YNI A;  4Y1C A;  1YTA A;  4NYN A;  4Z4C A;  2X6N A;  4AHU A;  4H8K A;  4AHS A;  4N5S A;  1RDB A;  1JXB A;  2GBZ A;  4OJR A;  3ITH A;  3V9U A;  4E7L A;  4CHQ A;  4DU3 A;  4N56 A;  1RT6 A;  1I39 A;  3AA3 A;  4AHR A;  4DTN A;  3OYI A;  3QET A;  4Z4E A;  3VQ5 A;  3VQ7 A;  1NJZ A;  1GOA A;  1BI4 B;  3AA2 A;  1WSG A;  4KFB A;  3NGZ A;  1KLM A;  1N6Q A;  4PQU A;  1C0T A;  5CZ1 A;  1NK4 A;  2Z1J A;  4CEQ A;  4FLZ A;  4OGC A;  3SUQ A;  4OKE A;  3IS9 A;  4IFY A;  4RW9 A;  1KSP A;  1B92 A;  5KTQ A;  3DRR A;  4IFV A;  1T03 A;  5EU7 A;  4FJK A;  2O4I A;  3QER A;  4HVJ A;  4RG8 A;  1SL2 A;  1ZBH A;  1LW2 A;  3DLG A;  1L3S A;  1TKZ A;  4BDZ A;  4QCL A;  3AO1 A;  2XO7 A;  1TK0 A;  1HMV A;  3L2R A;  3FFI A;  4CEC A;  3M8Q A;  3CFR A;  1ZYQ A;  4CF1 A;  4O5B A;  4Z4H A;  4N76 A;  3MAQ A;  4BE2 A;  3HO1 A;  1TAQ A;  4E1M A;  1X1P A;  3QEP A;  1N5Y A;  3SUP A;  2YHB A;  4HHT A;  3ZT4 A;  1HRH A;  1TGO A;  5HRP A;  3TR8 A;  3OYD A;  1FKO A;  4KHW A;  1X9S A;  2P1J A;  3CFO A;  3QLH A;  1JL2 A;  2JGU A;  1S6P A;  4CIF A;  1JLC A;  2IAJ A;  2OZS A;  3PX4 A;  2AJQ A;  3AVM A;  2YNF A;  2XHB A;  1WSI A;  3TAQ A;  4IG0 A;  1JLB A;  3MEC A;  1HYS A;  1C1C A;  4B8A B;  4L8R B;  3SYZ A;  4FLV A;  1KRP A;  3OYN A;  3OYG A;  1SV5 A;  2PZS A;  4DU4 A;  2NUB A;  3F9K A;  3QIO A;  4RW7 A;  1BL3 A;  4CEZ A;  4C8K A;  4J2D A;  3RMA A;  3PY8 A;  4ID5 A;  3ZSR A;  3VQB A;  4EZ9 A;  4M3Y A;  1TAU A;  3HJF A;  2HVI A;  4MQ3 A;  2W42 A;  3K5M A;  3MXI A;  4CK3 A;  1KFD A;  4F2R A;  3TAF A;  1VK0 A;  3AVA A;  4E19 A;  3HK2 A;  3AA5 X;  1RTD A;  1J53 A;  4KAZ A;  1VSH A;  4Q0B A;  1G15 A;  3AO5 A;  3L3U A;  3OYH A;  2OYQ A;  3VQA A;  1XI1 A;  1RBU A;  4ZHR A;  1J5O A;  4M3Z A;  1RBV A;  1SUQ A;  1DLO A;  2G8V A;  2P5G A;  2DFE A;  3O3H A;  3AVL A;  4R5P A;  4OKK A;  2DTU A;  3OYF A;  3K5N A;  4EP5 A;  4BAC A;  4CES A;  4CGI A;  2D0C A;  5DK5 A;  3WNG A;  4CJ3 A;  3O3F A;  3PX6 A;  3LP3 A;  2B5J A;  3L2V A;  1I3A A;  4DF8 A;  3SCX A;  1TK8 A;  3VQ8 A;  3D0P A;  1RTH A;  4BWJ A;  1Y97 A;  1QSL A;  1O1W A;  3P83 D;  3LP2 A;  1X9M A;  3P5J A;  3ZCM A;  2HW3 A;  3QEI A;  4CHY A;  1TK5 A;  3PO5 A;  1REV A;  5SZT A;  3MED A;  3TAB A;  1S1V A;  1SL0 A;  4CCH A;  1UA1 A;  5KRS A;  4W5R A;  3RR8 A;  2RF2 A;  3AO4 A;  1BQM A;  4OPK A;  2YNH A;  4CJQ A;  3HVR A;  3LAN A;  4AHC A;  4DLE A;  3G0Z A;  2Y1J A;  4AHV A;  4E7J A;  1CLQ A;  4CIG A;  4IG3 A;  3V1Q A;  4W5O A;  1RTI A;  4YNQ A;  3AVN A;  2WON A;  4C8N A;  5SWM A;  4PWD A;  4LD0 A;  4DF4 A;  5J1E A;  4DTS A;  1QE1 A;  3OVN A;  1F21 A;  4LH5 A;  4ZTF A;  5CYQ A;  4E7H A;  4M42 A;  3LWL A;  3AVG A;  4E7I A;  3OYJ A;  1NK6 A;  3LPU A;  4DFP A;  3I8D A;  3L2W A;  1A5V A;  2OPQ A;  3TAP A;  2HHW A;  2ZD1 A;  1VSL A;  4CK2 A;  3T19 A;  1XHZ A;  3KK1 A;  3HXM A;  4DFK A;  1NOZ A;  4M3T A;  4CJS A;  1RT3 A;  3H08 A;  5HRS A;  4CJW A;  4FXD A;  2X74 A;  3B6O A;  4DG1 A;  5KRT A;  3JSM A;  3F73 A;  1WN7 A;  3DLH A;  4FJ7 A;  1U49 A;  4KHY A;  2P51 A;  3HYF A;  1JLE A;  1HQE A;  5KGX A;  4K8X A;  4O0J A;  3IRX A;  1KTQ A;  1U47 A;  2ZE2 A;  3DM2 A;  4O44 A;  3B6P A;  4KKO A;  5HRR A;  4OGE A;  3ULD A;  4FLW A;  3SV4 A;  1NKC A;  4IKF A;  4KRE A;  4CHN A;  1VSM A;  1W9H A;  4JLH A;  3DOK A;  4CJL A;  1C1B A;  4F2S A;  4CGF A;  1HPZ A;  1YT3 A;  4H4O A;  4LY7 A;  2YHA A;  1TL3 A;  3NH2 A;  4HUG A;  2F8T A;  4O0I A;  3VN5 A;  5C42 A;  4Z0U A;  3ALY A;  1JXE A;  3KLG A;  3PX0 A;  3VQ9 A;  3HVT A;  3OJS A;  4F8R A;  1BQN A;  3HPG A;  3EZ5 A;  3QNN A;  4FZX C;  4QAG A;  3TAN A;  1XHX A;  3QEX A;  4ID1 A;  4CJU A;  1VSD A;  2G8K A;  1S1X A;  4B9N A;  3G10 A;  2DFF A;  5HBM A;  2B6A A;  3ZT1 A;  1BGX T;  4OVL A;  4OPJ A;  1NJW A;  4KO0 A;  5JS1 A;  4CGH A;  5KGW A;  1A5W A;  1QS4 A;  2D0A A;  3NH0 A;  1RBS A;  3SJJ A;  4FJ9 A;  1NKE A;  3VQD A;  2KTQ A;  4DQQ A;  4PUO A;  3CYM A;  2VG5 A;  4CHP A;  3QIN A;  3AVK A;  3OYC A;  2D0B A;  2R7Y A;  4JS5 A;  4CEO A;  3U3Y A;  4KPY A;  1D8Y A;  4CEB A;  4DTR A;  1QHT A;  2OPS A;  1FK9 A;  3RMD A;  3VA0 A;  3V4I A;  4EZ6 A;  3UIQ A;  2A1S A;  4CGJ A;  3OYA A;  3ZT3 A;  4HTU A;  1NJX A;  5J2P A;  1JKH A;  4M45 A;  1T8E A;  1WAJ A;  1Z25 A;  4CFC A;  3K58 A;  4DFM A;  4Z4I A;  3L8B A;  1C0M A;  2XRI A;  1ASW A;  1HQU A;  1RDC A;  4B9L A;  4DSE A;  4ELT A;  4DS4 A;  3VQE A;  1QSY A;  1RBT A;  3HM9 A;  4AIL C;  3SV3 A;  2KZZ A;  1RCH A;  1A5X A;  1U04 A;  1BCM A;  5K14 A;  3SQ1 A;  4KRF A;  1S1T A;  4CED A;  1JLF A;  4FJI A;  4B9S A;  2XY5 A;  1EET A;  1RTJ A;  5I3U A;  3M8R A;  4I9Q A;  2VWK A;  1YVU A;  1TV6 A;  1RT5 A;  3DLE A;  3NF8 A;  4RW8 A;  5HRN A;  4DTM A;  2ITG A;  4M41 A;  5HP1 A;  3TI0 A;  2EHG A;  5C25 A;  5J2M A;  3NDK A;  1SKW A;  1IKW A;  3DLR A;  3PV8 A;  1UA0 A;  3NGI A;  4HUE A;  4DFJ A;  4KTW A;  2XY8 A;  3ZSO A;  2BAN A;  4KTQ A;  1J9A A;  1WNS A;  2F96 A;  4DTP A;  1U48 A;  1GOC A;  1ZBF A;  4CGD A;  2F8S A;  1K6Y A;  4DU1 A;  4B9U A;  3OYM A;  3PUF A;  3MEE A;  3K5L A;  3SI6 A;  1U45 A;  2OA8 A;  2JLE A;  2DY4 A;  1NK8 A;  4JS4 A;  1VSI A;  4DTJ A;  1EXQ A;  3S3N A;  4HUF A;  1HYZ A;  1S9G A;  4FW1 A;  3C94 A;  3K5O A;  2ZQB A;  4HCB A;  2X78 A;  3NF7 A;  3AVJ A;  2QK9 A;  1VRU A;  3L3V A;  1ASV A;  1TKD A;  2HNY A;  1X9W A;  1ASU A;  1JL1 A;  2EX3 A;  2FBX A;  3KK3 A;  2RN2 A;  2G8U A;  1WSE A;  3DYA A;  3KKS A;  3WNE A;  4I2P A;  4W5Q A;  5J2Q A;  3RR7 A;  4FK2 A;  4FK4 A;  2LSN A;  2Z1H A;  3VQP A;  1IKV A;  1D9F A;  3EYZ A;  3CFP A;  1IKX A;  2A1R A;  1SKS A;  1BI4 A;  2HND A;  1T7P A;  4I9L A;  4CFB A;  3ZSV A;  2Z1G A;  1S1U A;  4EP4 A;  4DSI A;  3V81 A;  4RW6 A;  3NAE A;  3HP6 A;  3ZT0 A;  3SUO A;  2HNZ A;  2IC3 A;  2GV9 A;  4CEF A;  3EY1 A;  1D9D A;  2PYL A;  4M3U A;  4W5N A;  3RRG A;  3V9X A;  3NCI A;  3V6D A;  1TVR A;  4NCB A;  3QO9 A;  3OY9 A;  4BDP A;  1RT7 A;  2KQ2 A;  3LAK A;  2HVH A;  4CJR A;  3ZSY A;  3U6F A;  1SKR A;  1WLJ A;  1JLA A;  4NCA A;  4KHN A;  1UAX A;  2IS3 A;  4CFA A;  3HPO A;  1TKT A;  2VG7 A;  4OLA A;  3V1O A;  3NF6 A;  4DQI A;  4FJX A;  4FJH A;  3KLH A;  3TAE A;  3T1A A;  4KI4 A;  4IDK A;  4AHT A;  1VSF A;  4DSJ A;  2XY7 A;  5C24 A;  4CJT A;  1HNV A;  4IBN A;  3NFA A;  3O4N A;  1KVA A;  4F3T A;  3LZI A;  2B4J A;  1EP4 A;  4J2B A;  2HHU A;  4FJL A;  4H4M A;  1ZBU A;  4FJG A;  2VG6 A;  5CYM A;  1GOB A;  1FKP A;  4E89 A;  2IDO A;  3LZJ A;  1RT2 A;  2ATQ A;  3KLI A;  1Q8I A;  5DMR A;  4DWI A;  1QTM A;  3NE6 A;  4KB0 A;  3ISN C;  5JS2 A;  1RDD A;  1ZBL A;  1S9E A;  3QES A;  3M8P A;  1ITG A;  3M8S A;  1B9D A;  2G8I A;  3KLF A;  1U4B A;  3AV9 A;  3CQ8 A;  3KJV A;  3L2U A;  3BGR A;  4F3O A;  4M3X A;  4CFD A;  1JLQ A;  3C6T A;  4JRQ A;  1ZBI A;  3DLB A;  3C6U A;  5FRO A;  3V9W A;  4C8L A;  1C1A A;  4DTO A;  3DRP A;  1L3T A;  3DLK A;  3QEW A;  1IKY A;  3SUN A;  2HHT A;  2VWJ A;  3TAR A;  3VQ4 A;  3SPZ A;  1NOY A;  3KD5 E;  1WSH A;  3S3O A;  3CM6 A;  4DSK A;  4Z4G A;  3NBP A;  3AVF A;  3OS2 A;  4ZTJ A;  3NF9 A;  3VQQ A;  4E1N A;  4QOZ B;  2FBV A;  4KHU A;  3QIP A;  3WNH A;  1KVB A;  3D45 A;  1Q9Y A;  1LWC A;  2KFN A;  2I5J A;  1HYV A;  3SQ2 A;  4ICL A;  4I2Q A;  3SNN A;  1LW0 A;  3DRS A;  4YFU A;  4E0D A;  4LSL A;  4CHZ A;  4KHQ A;  2XY6 A;  3S3M A;  3THV A;  1D5A A;  4BDY A;  1FXX A;  1L3V A;  2QXF A;  3QEV A;  4ELV A;  2YKN A;  3E01 A;  4FJN A;  4O4G A;  1NK0 A;  1JLG A;  4WE1 A;  1RNH A;  4BE0 A;  4ELU A;  4M3R A;  3LWM A;  4GW6 A;  3ZSW A;  4N41 A;  2OZM A;  1EX4 A;  2KW4 A;  1Z26 A;  3KD1 E;  5D3G A;  2Y1I A;  5FRN A;  1QQC A;  1RBR A;  1NK9 A;  4OLB A;  4CJV A;  1VSE A;  2E4L A;  1RT4 A;  1UOC A;  3SQ4 A;  1L3U A;  2HHS A;  2Q3S A;  1YTU A;  1EKE A;  3TWH A;  4CJ5 A;  3RMC A;  2IOC A;  4W5T A;  5HRO A;  4FYD A;  1RT1 A;  2G8F A;  3KLE A;  2HMI A;  4KI6 A;  3VA3 A;  2IGI A;  1NJY A;  3O3G A;  3PO4 A;  3HL8 A;  2HB5 A;  1BCO A;  1HJR A;  2D5R A;  3AVB A;  5T7B A;  4Q5V A;  4RW4 A;  2YKM A;  1S6Q A;  4DSF A;  3CG7 A;  1L5U A;  1WSF A;  4JRP A;  3IAY A;  2KZM A;  3DI6 A;  4FM2 A;  1BIU A;  3L2Q A;  1VRT A;  1NK7 A;  1DTQ A;  4CGG A;  1WSJ A;  4LH4 A;  1XC9 A;  4M3W A;  3LDS A;  1LAW A;  2Z1I A;  4FVM A;  5E41 A;  3OYL A;  1KLN A;  3OJU A;  3VQ6 A;  3HPH A;  3HST B;  3AA4 A;  3BDP A;  1LWE A;  3KIO A;  1IG9 A;  4CER A;  1B9F A;  5KI6 A;  2G8H A;  2FC0 A;  4CEE A;  1WAF A;  4FM0 A;  4CIE A;  2OPP A;  2WOM A;  3AO2 A;  4FJ8 A;  4CJE A;  1TL1 A;  1C0U A;  4K8Z A;  4CE9 A;  4E7K A;  2FBY A;  3LAM A;  3MEG A;  4CF8 A;  1NK5 A;  1LV5 A;  2RPI A;  1LAV A;  2DFH A;  2FBT A;  3OYK A;  4FW2 A;  2QKB A;  3ZSQ A;  2O4G A;  3SPY A;  1CZB A;  4F4K A;  1J54 A;  1TKX A;  3LPT A;  1KVC A;  3IG1 A;  3RRH A;  4PY5 A;  4FLU A;  4KTZ A;  1R0A A;  2HHX A;  4FK0 A;  2E6M A;  3NHG A;  3SZ2 A;  4KV8 A;  2BDP A;  3V9Z A;  4FLY A;  3ZSZ A;  2PY5 A;  1W0H A;  2OPR A;  4NYF A;  4C8M A;  3AO3 A;  4O55 A;  3TAG A;  5FDL A;  1SL1 A;  1Q9X A;  2PYJ A;  2HHV A;  4CJP A;  2KFZ A;  1VSJ A;  1IH7 A;  4CF0 A;  4C8O A;  2ETJ A;  4OKJ A;  1HNI A;  1BHL A;  3K57 A;  1MU2 A;  3P1G A; 
#chains in the Genus database with same CATH topology
 2RHK A;  3ASM A;  3DXM B;  1LWF A;  4BRA A;  3KK2 A;  3DOL A;  3CMA N;  3CM5 A;  4FWS A;  3QNO A;  3RWU A;  5M1F A;  4CJK A;  4FJ5 A;  3VF4 A;  4FJM A;  3I0S A;  4H0V B;  4B8C A;  3AVC A;  2BUP A;  4FZZ A;  3KKR A;  2ZJP L;  1VQ6 N;  3D2E A;  4JD2 A;  1N33 K;  4UY8 O;  3BZK A;  4CJF A;  1S22 A;  2P9K A;  3K59 A;  1VSK A;  2NRV A;  4AH9 A;  1TUY A;  4I7F A;  3RTV A;  4JKH A;  3AVI A;  3H3O B;  3H46 O;  1M1K O;  4ILJ A;  2HST A;  4J2E A;  3OS1 A;  2E5L K;  4J2A A;  4CF9 A;  4FPB A;  5AQF A;  3T3F A;  3OA9 A;  4JHD A;  3MWP A;  1BUP A;  1DGK N;  1C6V A;  4DV0 K;  3MK6 A;  3HP9 A;  2HMP A;  5H1S Q;  3H3N O;  5AQP A;  1VQP N;  3WNF A;  3D6R A;  1FJG K;  3FZH A;  2YNI A;  1YTA A;  1CZA N;  4Z4C A;  5AFU A;  4H8K A;  3OHR A;  1JXB A;  1XUP O;  3V9U A;  4E7L A;  4CHQ A;  1I39 A;  3OYI A;  3VQ7 A;  1W7A A;  1NJZ A;  2FSJ A;  3O5B A;  1P8Z A;  1BG3 A;  4MDA A;  4B1W B;  5GIN A;  5AQZ A;  4DV5 K;  4JI6 K;  4CZE A;  3IS9 A;  1B92 A;  3CQX A;  4IFV A;  4DR5 K;  2O4I A;  3QER A;  4HVJ A;  5EX5 A;  3DLG A;  4QCL A;  1GLA G;  1HMV A;  3FFI A;  3KK7 A;  4Z4H A;  2W6K A;  5M1O A;  4CVN E;  3SUP A;  1QZ5 A;  3U9D A;  2YHB A;  4HHT A;  1TGO A;  3OYD A;  3D7E O;  1FKO A;  2NNW A;  1S6P A;  4CIF A;  2OZS A;  2YNF A;  3CCL N;  3O08 A;  2XHB A;  3EE9 A;  3MEC A;  5LMN K;  3TPQ A;  2PBD A;  5FPN A;  2FLO A;  1SV5 A;  3CC7 N;  4J2D A;  3PY8 A;  3ZSR A;  3KWI A;  3R8E A;  3Q7C A;  3CCM N;  4F9O A;  3TAF A;  4DV4 K;  3AVA A;  3AA5 X;  2V52 B;  1VSH A;  1G15 A;  4BC3 A;  3J7A P;  3HOT A;  1N8R O;  1RBU A;  4IJN A;  4O5F A;  2G8V A;  2QW9 A;  2YI1 A;  2DFE A;  1VQ4 N;  4R5P A;  4OKK A;  1N34 K;  3CIP A;  4XH4 A;  2B5J A;  3CPE A;  1TK8 A;  3VQ8 A;  4BGB A;  4FWM A;  3D0P A;  1RTH A;  2QEX N;  4IO8 A;  4CHY A;  5DM7 L;  3PO5 A;  3ATV A;  1UA1 A;  4W5R A;  3AO4 A;  3HVR A;  2YNH A;  4YDU A;  3GDQ A;  2Y1J A;  4AHV A;  4BR9 A;  4CIG A;  3V1Q A;  3E9O A;  1HJO A;  2WON A;  3ATU A;  5EVZ A;  4JK7 A;  4LD0 A;  5BPN A;  5J1E A;  1EWQ A;  1FW6 A;  4K42 A;  1F21 A;  1SS6 A;  1XNR K;  5CYQ A;  3OYJ A;  5LJV A;  1HX1 A;  4B1Y B;  3C6A A;  3L2W A;  2OPQ A;  1GLF O;  2HHH K;  1OH5 A;  2ASM A;  2A41 A;  5HRS A;  2Q2R A;  3F73 A;  1YJW N;  1KXP A;  3CJ7 A;  3ULD A;  5HRR A;  3SV4 A;  3ENO A;  4JLH A;  2GX9 A;  4NLC A;  5AQY A;  3NH2 A;  4JKD A;  1TL3 A;  1LCU A;  2F8T A;  3VN5 A;  1Z05 A;  3LDL A;  3TTD A;  3VQ9 A;  3HVT A;  3SMS A;  4A5A A;  1BQN A;  3HPG A;  4QAG A;  3TAN A;  4JKG B;  5HBM A;  3C7N A;  2ZGY A;  4H5R A;  2O8C B;  1GLE G;  4H0T B;  3QFP A;  3J80 O;  1RBS A;  4JKA A;  2QWQ A;  2WTU A;  2VG5 A;  3VEN A;  2R7Y A;  4JS5 A;  4CEO A;  4KPY A;  4CEB A;  4DTR A;  3RMD A;  3BF3 A;  2UYT A;  3UIQ A;  4CGJ A;  1NJX A;  5J2P A;  2UUA K;  3ID8 A;  1WAJ A;  1Z25 A;  4Z4I A;  3QFU A;  1E4G T;  1ASW A;  1IBK K;  4BG8 A;  3VQE A;  3HM9 A;  3D2E B;  4JD2 B;  1W2B M;  1N32 K;  1MA9 B;  1S1T A;  4CED A;  3CF5 L;  1EET A;  4H0O A;  1TV6 A;  4DTM A;  3FZF A;  5HP1 A;  1SKW A;  3NDK A;  1IKW A;  1YUW A;  4DR2 K;  4DFJ A;  4KTW A;  3ZSO A;  1VQL N;  2E2Q A;  3FZK A;  4IWV A;  4DTP A;  1ZBF A;  1NBW A;  4JHD B;  4DU1 A;  3SI6 A;  4BRL A;  3K5L A;  4JS4 A;  4DTJ A;  1EXQ A;  2ZGZ A;  3K5O A;  4DR6 K;  3NF7 A;  3D2F A;  3IDH A;  2EX3 A;  1JL1 A;  2FBX A;  3RVC A;  4B9L A;  3CCE N;  2A6A A;  1IKV A;  1BOT O;  5BPM A;  1IKX A;  2A1R A;  1SKS A;  2HND A;  3GG4 A;  4CFB A;  4AQY K;  1X3N A;  1S1U A;  4EP4 A;  2NLX A;  4RW6 A;  3L4I A;  2P9P A;  2HNZ A;  2IC3 A;  3EY1 A;  3RRG A;  3NCI A;  3OY9 A;  1RT7 A;  1QHA A;  1NWK A;  4CZK A;  3U6F A;  1WLJ A;  1JLA A;  4KHN A;  4FWQ A;  2IS3 A;  3BF1 A;  4WQ4 C;  2KKZ A;  3HPO A;  4DQ8 A;  3KLH A;  4IDK A;  2GEM A;  3K9K A;  3HRG A;  1M90 O;  1HNV A;  1P90 A;  4F3T A;  2NRT A;  2QWO A;  2V7Z A;  2VGM A;  3U8X A;  5AQS A;  1GOB A;  1FKP A;  1ZXO A;  4E89 A;  1RT2 A;  1Q8I A;  3NE6 A;  2AA4 A;  3QDK A;  4WQ4 A;  5KQ8 A;  5AQN A;  3M5R A;  3VEW A;  1VQ9 N;  1O13 A;  2G8I A;  3MX5 A;  4CFD A;  3C6T A;  1XMQ K;  1ZBI A;  4MO4 A;  5TKW A;  3V9W A;  1BO5 O;  4AM7 A;  2QA4 N;  3SPZ A;  3CM6 A;  3DJC A;  2V51 B;  3OS2 A;  4ZTJ A;  4E1N A;  4QOZ B;  5GAE P;  3SAF A;  3VGL A;  1KVB A;  1LWC A;  3SQ2 A;  4LSL A;  4MO5 A;  3SLC A;  1VQN N;  4ELV A;  3CJ1 A;  5AQK A;  3ZET B;  4BQL A;  1JLG A;  1RNH A;  4ELU A;  4GVE A;  3ZSW A;  1EX4 A;  2KW4 A;  4LF4 K;  2Y1I A;  4GV3 A;  1Q82 O;  1RBR A;  3I8B A;  1U2V A;  2E4L A;  3SQ4 A;  1L3U A;  2IOC A;  4W5T A;  1WB9 A;  2NRX A;  2IGI A;  5I9E B;  2WBN A;  3TSQ A;  2HB5 A;  3AVB A;  4DSF A;  3CG7 A;  4NO7 A;  2IVP A;  4JRP A;  3LM2 A;  1BWF O;  2QWP A;  5JVH L;  1BIU A;  3I55 N;  1VRT A;  3L2Q A;  4CGG A;  2CGK A;  3LDS A;  2Z1I A;  3OJU A;  3HPH A;  3HST B;  4IOA L;  4PKG A;  3I33 A;  1IG9 A;  5AQM A;  3JXU A;  5KI6 A;  3P31 A;  2FC0 A;  5C10 A;  4CIE A;  2WOM A;  3O6W A;  4GV9 A;  2V7Y A;  1TL1 A;  2P9S A;  3MEG A;  1NK5 A;  1LAV A;  4WFB L;  2DFH A;  3OYK A;  4FW2 A;  4A2A A;  4FVU A;  4F4K A;  4X65 K;  3IG1 A;  4FK0 A;  2KLA A;  1YVN A;  2PY5 A;  2OPR A;  4C8M A;  3AO3 A;  4CJ7 A;  4IJA A;  4O55 A;  5BRF A;  5FDL A;  1SL1 A;  2PYJ A;  4FL9 A;  3VTI A;  4CJP A;  2KFZ A;  1VSJ A;  4CF0 A;  5AFU H;  3TSP A;  3VES A;  1BHL A;  3O9U A;  1MU2 A;  4A61 A;  1Z6R A;  3G4S N;  2H3G X;  3DMJ A;  4BE1 A;  3NGY A;  4A5B A;  2HBJ A;  1S1W A;  3B8A X;  4CF2 A;  4B9V A;  4CZI A;  3H6E A;  1IO2 A;  4CJ4 A;  1OKJ A;  1CXQ A;  4NCG A;  4DQR A;  2P5O A;  1KFS A;  4A57 A;  1KAY A;  1XWL A;  4FJJ A;  3HT3 A;  1JCE A;  2QKK A;  4FWR A;  1CZ9 A;  5C15 A;  1NGG A;  1RDA A;  3JYT A;  4DTX A;  5I42 A;  3OYE A;  1WBB A;  3SQ0 A;  3AVH A;  4CZG A;  4MFB A;  4GKJ K;  4YOV A;  2E1Y A;  4MLH A;  4DLG A;  1W97 L;  2BE2 A;  3O4W A;  4IXC A;  4DS5 A;  4FCY A;  1JJ2 M;  3DAW A;  3L0Q A;  5HLF A;  1NKB A;  1RIL A;  3RMB A;  4OPA A;  2GUI A;  4TSX A;  3J7Y P;  4B08 A;  3D2F B;  1VAZ A;  1GLB G;  2X6N A;  4AHU A;  4AHS A;  1C0G A;  3ITH A;  4N56 A;  1RT6 A;  3QET A;  4Z4E A;  2ASP A;  4DTN A;  1YXQ A;  3O9T A;  3AA2 A;  4KFB A;  1WSG A;  3NGZ A;  1KLM A;  1N6Q A;  1C0T A;  5C2D A;  4WQ5 A;  3CQY A;  1NK4 A;  2Z1J A;  3SUQ A;  2P9P B;  4IFY A;  4RW9 A;  1KSP A;  3L4Q A;  3DRR A;  1VQ8 N;  1T03 A;  1QVG M;  5EU7 A;  3MN6 A;  1OH6 A;  4RG8 A;  1SL2 A;  1ZBH A;  1LW2 A;  1NMN A;  1L3S A;  4PKH A;  4BDZ A;  3AO1 A;  2XO7 A;  1TK0 A;  1E3M A;  3R6M A;  4O5B A;  1NGF A;  3MAQ A;  4BE2 A;  3O80 A;  1S3X A;  3QEP A;  1N5Y A;  3ZT4 A;  3HM8 A;  3ENB A;  1X9S A;  3QLH A;  2E2P A;  3IFR A;  3TAQ A;  4IG0 A;  1HYS A;  4U67 L;  4FLV A;  1KRP A;  3KVG A;  2NUB A;  3QIO A;  1T6D A;  1BL3 A;  4LC9 B;  4ID5 A;  4PKI A;  3HJF A;  2HVI A;  3UE5 A;  4MQ3 A;  2W42 A;  4HWI A;  4X62 K;  4CK3 A;  4BC2 A;  3BP8 A;  2OTL N;  1VK0 A;  4CZM A;  4B1V A;  1J53 A;  4JI0 K;  3AO5 A;  4XH5 A;  1J5O A;  4ZHR A;  1SUQ A;  4DV2 K;  3C0B A;  1SQK A;  4EP5 A;  4CGI A;  2D0C A;  2HBL A;  3WNG A;  3H1V X;  3SCX A;  3L2V A;  1I3A A;  4ISF A;  4DV1 K;  5JMV A;  1T6C A;  3ZET A;  1QSL A;  3P83 D;  4BRG A;  5LJW A;  3LP2 A;  3G71 N;  3QEI A;  1KAZ A;  1EQY A;  5SZT A;  3MED A;  3TAB A;  1S1V A;  4JAX A;  5KRS A;  2VQE K;  1BQM A;  1VQ5 N;  4DLE A;  1U2V B;  2D0P A;  4W5O A;  1RTI A;  4BR4 A;  4DF4 A;  3VET A;  4DTS A;  3OVN A;  3AAP A;  4E7H A;  2VGN A;  3VGK A;  3AVG A;  5EY4 A;  3ZX2 A;  1K73 O;  3TAP A;  3THY A;  5CE3 A;  1NJI O;  3MX2 A;  4CK2 A;  3T19 A;  3KK1 A;  1NOZ A;  3QBX A;  4M3T A;  1RT3 A;  3WQT A;  3A5N C;  1WN7 A;  3DLH A;  3LDP A;  4KHY A;  1HQE A;  4K8X A;  4O0J A;  1V4T A;  1IJJ A;  1KTQ A;  3IRX A;  3IUC A;  4FO0 A;  1U47 A;  2P9S B;  3EZW A;  4KRE A;  4EIA A;  4DV7 K;  1VSM A;  4CJL A;  2YHA A;  2EWS A;  4Z0U A;  3KLG A;  1JXE A;  2FSN A;  4B3R K;  4EHT A;  4FZX C;  1JCG A;  1JCF A;  4ID1 A;  4CJU A;  1GLJ O;  4B9N A;  2DFF A;  2B6A A;  1BA1 A;  2IIR A;  5JS1 A;  1QS4 A;  3NH0 A;  4FJ9 A;  3SJJ A;  2KTQ A;  1YF5 L;  4PUO A;  2O8D B;  1HR0 K;  4ILH A;  3CYM A;  2E2O A;  3AVK A;  5C12 A;  1D8Y A;  4BRQ A;  2OPS A;  2GTD A;  3VA0 A;  3V4I A;  4O8U A;  3OYA A;  4IDH A;  2F9W A;  2Q0R A;  4BRN A;  2CH5 A;  2OCE A;  3TU5 A;  4CFC A;  4DFM A;  1C0M A;  2QWR A;  2F8S A;  1RBT A;  2FF3 B;  2ASO A;  2NZT A;  1ATR A;  4B9S A;  1Y64 A;  4IZ9 A;  3A5L C;  4I9Q A;  4LF6 K;  3NF8 A;  4RW8 A;  5BRE A;  2CGL A;  3TI0 A;  3M1F A;  5C25 A;  4PHT X;  1UA0 A;  4B3M K;  4HUE A;  4U7B A;  2F96 A;  1GOC A;  4CGD A;  3CME N;  1Q18 A;  3WXJ A;  3IMX A;  3OYM A;  2DY4 A;  1NK8 A;  1VSI A;  2QI2 A;  3C94 A;  4E1J A;  4YOW A;  1NGD A;  2X78 A;  3N4Q A;  4HCB A;  2QK9 A;  3L3V A;  1ASV A;  1TKD A;  4ISG A;  4BDP A;  5M1N A;  3KK3 A;  3HO1 A;  3KKS A;  4BRE A;  4FK4 A;  2Z1H A;  2YHX A;  1D9F A;  3EYZ A;  3CFP A;  3CCQ N;  3ZSV A;  4DSI A;  3V81 A;  4AF1 A;  4CEF A;  4QS9 A;  3V9X A;  2YCH A;  1DKG D;  3V6D A;  4NCB A;  5AQW A;  2KQ2 A;  3CJC A;  1SKR A;  3DLL L;  3JS6 A;  4M63 C;  4CFA A;  4FWP A;  2VG7 A;  4OLA A;  3V1O A;  3NF6 A;  1NG9 A;  1NGE A;  5AR0 A;  3T1A A;  4CW7 B;  1VSF A;  2QM1 A;  1V4S A;  5BR9 A;  3O4N A;  1KVA A;  3LZI A;  4GY2 B;  1K9M O;  4GKK K;  1VQ7 N;  2HHU A;  5AQV A;  2VG6 A;  1XC3 A;  5CYM A;  4DR4 K;  5F2R A;  4JKE A;  5DMR A;  3NVM A;  4KB0 A;  5GAG P;  5JS2 A;  1RDD A;  3VEY A;  2VQF K;  1ZBL A;  3QES A;  3M8P A;  1ITG A;  5C2F A;  3KLF A;  4CZL A;  3MN5 A;  3KJV A;  3L2U A;  1JLQ A;  1ATN A;  2YJE A;  5FRO A;  5AQT A;  3KZB A;  4DTO A;  1VHX A;  3DLK A;  3HSC A;  3TAR A;  3OBY A;  1NOY A;  3KD5 E;  3S3O A;  3NMU A;  3NBP A;  3NF9 A;  2I7P A;  2UXB K;  3THX A;  1Q9Y A;  2KFN A;  3HTV A;  2I5J A;  1LW0 A;  3DRS A;  4YFU A;  2Q31 A;  4CHZ A;  4CZJ A;  2XY6 A;  4GV6 A;  1D5A A;  1L3V A;  2QXF A;  1ILY A;  4J8F A;  3E01 A;  4FJN A;  2A40 A;  4BRP A;  1EWR A;  1D4X A;  2PAV A;  1YAG A;  4M3R A;  3ZX3 A;  2GEL A;  3KD1 E;  3WQU A;  1QQC A;  4OLB A;  4QS8 A;  1VSE A;  2F4V K;  1RT4 A;  3LL3 A;  2HHS A;  4CZF A;  1EKE A;  2HOE A;  4CJ5 A;  3CHW A;  1RT1 A;  3DWL A;  4JK9 A;  4KI6 A;  3VA3 A;  3O3G A;  3PIP L;  1BCO A;  1HJR A;  3O1B A;  4YOY A;  1S6Q A;  1L5U A;  1WSF A;  4JEP A;  3DI6 A;  3LDQ A;  1NK7 A;  1DTQ A;  3THY B;  1WSJ A;  1XC9 A;  1LAW A;  4BRC A;  2W40 A;  2D1K A;  1X3M A;  3AA4 A;  3BDP A;  5AQO A;  3VEX A;  4CER A;  4KH4 A;  5IT9 O;  3WXK A;  4FM0 A;  2OPP A;  2UU9 K;  1BU6 O;  1RDW X;  1BA0 A;  3AY9 A;  1C0U A;  4JKC A;  2FBY A;  2ZF5 O;  4C23 A;  2RPI A;  2J4R A;  4B1U B;  1OH7 A;  4BGA A;  4H5N A;  3RRH A;  4FLU A;  3W3D A;  2O8E A;  4BRK A;  2FF6 A;  4FLY A;  2Q36 A;  4BRD A;  4NYF A;  3R1X A;  3OW2 M;  1Q9X A;  1R59 O;  1KC8 O;  1SZ2 A;  4JV5 K;  5FPD A;  4OKJ A;  3SAH A;  2O8D A;  2QWN A;  1HNI A;  1A5X A;  1JLE A;  4NB4 A;  3VEZ A;  4LFB K;  4PA1 A;  2P9N B;  3AGR A;  2UUC K;  2E6L A;  2CH6 A;  4G1Q A;  3A2F A;  5TKY A;  4N47 A;  5MLC Q;  4GMJ B;  3LP1 A;  2HHQ A;  3QBW A;  3UKR B;  3ZT2 A;  3FE1 A;  3E9P A;  4GVM A;  3MXJ A;  5CZ2 A;  3OYB A;  3O4Q A;  3ZSX A;  4BWM A;  5F1X A;  2ZM6 K;  4BC5 A;  4FLX A;  3C95 A;  3NH1 A;  4Y1D A;  4Z4F A;  3PSF A;  2UXC K;  3CCS N;  2RKI A;  4LSN A;  1BIZ A;  1T05 A;  3CER A;  3L6Q A;  4XIU A;  5AQR A;  2UXD K;  4CD1 A;  1QSS A;  3CC4 N;  4B9T A;  4KB1 A;  3MXM A;  4CI6 A;  1VQM N;  4FZY A;  4WFN L;  1QQN A;  4FWL A;  2YNG A;  2W6L A;  3TAM A;  2D4W A;  4DSL A;  4Y1C A;  3SMP A;  3SBT A;  4IO9 L;  4DCH A;  2GBZ A;  3TSU A;  4DU3 A;  3AA3 A;  2FXU A;  1DEJ A;  3VOV A;  4CEQ A;  1MWK A;  4FLZ A;  4OGC A;  4WQ5 C;  3TTC A;  4OKE A;  4DUZ K;  4DR1 K;  4X64 K;  4FJK A;  4B3T K;  4RTF D;  4A59 A;  5B8H A;  3L2R A;  4CEC A;  4RWT A;  3CFR A;  4CF1 A;  4N76 A;  1TAQ A;  4FSV A;  3WXM B;  1X1P A;  3FR0 A;  2JWK A;  1S72 N;  2BH1 A;  5HRP A;  4NXM K;  1HUX A;  3VEO A;  2AJQ A;  1JLC A;  2IAJ A;  3PX4 A;  3OTO K;  3MWT A;  3THW A;  1C1C A;  4B8A B;  4L8R B;  3SYZ A;  1XQS C;  3EL2 A;  1NMD A;  3OYN A;  3OYG A;  1IBL K;  4DU4 A;  3F9K A;  4RW7 A;  5ADX A;  4C8K A;  3CCJ N;  4M7X A;  4M3Y A;  4CD3 A;  1TAU A;  3ENH A;  5A2Q O;  2D0O A;  1NGH A;  1OVY A;  3HK2 A;  4E19 A;  1RTD A;  1NGC A;  3L3U A;  3OYH A;  2OYQ A;  3VQA A;  1HKC A;  1XI1 A;  1DLO A;  3THX B;  3GOI A;  3H45 C;  3O3H A;  3AVL A;  3OYF A;  4BAC A;  3K0S A;  4CES A;  4CJ3 A;  1EO1 A;  3LP3 A;  4DF8 A;  4BWJ A;  5LMU K;  1Y97 A;  4LF8 K;  1X9M A;  2HW3 A;  5KPT A;  1TK5 A;  1SL0 A;  3RR8 A;  2RF2 A;  5BRD A;  3LAN A;  3C65 A;  4AM6 A;  4AHC A;  4E7J A;  4CZH A;  3AVN A;  4ISE A;  2P9U A;  3P39 A;  4DFP A;  5JLF A;  5JVG L;  3I8D A;  1A5V A;  4KBO A;  3S41 A;  2ZD1 A;  1XHZ A;  3AGK A;  4DFK A;  4CJS A;  3H08 A;  1KAX A;  5AZI A;  4DR3 K;  4B1X B;  3B6O A;  4DG1 A;  5KRT A;  1U49 A;  2P51 A;  5KGX A;  3PIO L;  4R79 A;  3WUH A;  3F2K A;  3GBT A;  4KKO A;  5CHI A;  1NKC A;  4IKF A;  4JI4 K;  3CCR N;  4CHN A;  4H5V A;  3DOK A;  3TTF A;  4A2B A;  4CGF A;  2KHO A;  4LY7 A;  4H4O A;  3WXI A;  3ALY A;  2Q97 A;  3PX0 A;  3OJS A;  4BRF A;  1GLL O;  3QNN A;  2WC9 A;  1XHX A;  2O8E B;  3QEX A;  1VSD A;  1S1X A;  3G10 A;  4C1N I;  4H5T A;  3PLA A;  4OPJ A;  4OVL A;  5AQU A;  1NJW A;  4CGH A;  3N4P A;  3SJH A;  1H1V A;  4NLB A;  1NKE A;  3VQD A;  4CHP A;  4LFA K;  3U3Y A;  2P9N A;  3QIC A;  5AQH A;  3A0I X;  1ESV A;  3GL1 A;  3UKR A;  4JI8 K;  3L8B A;  2XRI A;  4ELT A;  3RSE B;  1QSY A;  4AIL C;  3SV3 A;  2KZZ A;  4H03 B;  5K14 A;  3SQ1 A;  1JLF A;  5M1Q A;  4FJI A;  2XY5 A;  1RTJ A;  5C0Y A;  3MCA B;  3VEV A;  3M8R A;  2VWK A;  1NM1 A;  1YVU A;  3DLE A;  1U6Z A;  1NU0 A;  2ITG A;  4Y0W A;  2QTD A;  2EHG A;  5J2M A;  2VWB A;  5BRH A;  3CI5 A;  3DLR A;  3PV8 A;  3NGI A;  3WXL A;  2BAN A;  4DHY A;  3FGU A;  1K6Y A;  1HKG A;  3I56 N;  4B9U A;  3BEX A;  4RCH A;  1DT9 A;  3QML A;  2OA8 A;  3EKS A;  4HUF A;  1S9G A;  4FW1 A;  2ZQB A;  2HNY A;  1ASU A;  3R9P A;  3RR7 A;  5AQJ A;  3VQP A;  1IG8 A;  4H0Y B;  1BI4 A;  2Z1G A;  1VQO N;  3HP6 A;  2GV9 A;  2OAN A;  1XMO K;  4M3U A;  2ZJQ L;  4DUY K;  5FPE A;  4WF9 L;  4YOU A;  3QO9 A;  2HVH A;  4CJR A;  3ZSY A;  3VTH A;  5BPL A;  4DR7 K;  3HI0 A;  1RGI A;  4NCA A;  4YOT A;  1TKT A;  1KD1 O;  2BTF A;  4DQI A;  3EN9 A;  4FJX A;  5FPM A;  1HLU A;  4FJH A;  4DB3 A;  3TAE A;  4KI4 A;  4AHT A;  2ZJR L;  2XY7 A;  2CGJ A;  1G99 A;  2B4J A;  1EP4 A;  4J2B A;  4FJL A;  3H1Q A;  1ZBU A;  4H4M A;  3QB0 A;  4BQZ A;  1YIJ N;  3FZL A;  2IDO A;  4GNI A;  5ADX H;  3LZJ A;  5AZJ B;  1NGI A;  3THW B;  2UUB K;  1QTM A;  3VGM A;  3ISN C;  1S9E A;  2YJF A;  4B9Q A;  3M8S A;  3AV9 A;  5AQG A;  4C1N K;  3BGR A;  4F3O A;  2VCP A;  5F0X A;  3C6U A;  3EEQ A;  4C8L A;  1C1A A;  3J8A A;  5JLH A;  1L3T A;  2F7T A;  2VWJ A;  3F5T A;  4IEE A;  4DSK A;  4Z4G A;  3AVF A;  4JK8 A;  4FPA A;  1YJ9 N;  3VQQ A;  1N36 K;  3EO3 A;  3QIP A;  3WNH A;  4B3S K;  3U4L A;  4ICL A;  2E20 A;  4I2Q A;  3SBG A;  3CXC M;  3SNN A;  4JN4 A;  4KHQ A;  4JYA K;  3UKU A;  5KPR A;  1NK0 A;  2FSK A;  4N41 A;  3LWM A;  1X9J A;  2OZM A;  1Z26 A;  3BUZ B;  4PL8 A;  3VER A;  1MDU B;  5D3G A;  5FRN A;  3A5O C;  4CJV A;  2Q3S A;  1YTU A;  4K41 A;  3ZEU A;  3EKU A;  3WEE A;  5HRO A;  3SK3 A;  4FYD A;  3KLE A;  2HMI A;  2F9T A;  5BR8 K;  2P9U B;  3HL8 A;  5T7B A;  3PO4 A;  2D5R A;  4Q5V A;  1QQM A;  2YKM A;  3CCV N;  3IAY A;  2KZM A;  4LH4 A;  4M3W A;  3O8M A;  2VYP A;  3OYL A;  3O9Q A;  4K0K K;  4WFA L;  5AZI B;  2GWJ A;  1LWE A;  2G8H A;  1ATS A;  2NRZ A;  2PFU A;  4CEE A;  1WAF A;  5AQQ A;  1NLV A;  2A3Z A;  3AO2 A;  5GIP A;  1YI2 N;  3NVK A;  1YIT N;  4K8Z A;  4G9Z A;  1LV5 A;  3LAM A;  3T7Z A;  4CF8 A;  4DV6 K;  2FBT A;  3KWG A;  2QXL A;  5JIC A;  4JI1 K;  2QKB A;  2O4G A;  3SPY A;  1CZB A;  1J54 A;  4OX9 K;  3LPT A;  4YDU C;  1NGA A;  3ZX0 A;  1TYQ B;  3V9Z A;  1Q86 O;  3TAG A;  3O9S A;  4BVP A;  2O8F A;  1IH7 A;  2ETJ A;  3ZYY X;  3K57 A;  3P1G A;  4B3O A;  1RDU A;  2E88 A;  4QS7 A;  2BGG A;  1BIS A;  5IWA K;  3LAL A;  3G25 A;  3LP0 A;  5J2N A;  1J6Z A;  3KTQ A;  3I0R A;  4DTU A;  3LDN A;  4HTL A;  4DQS A;  4XH1 A;  2X6S A;  5FRM A;  3RSE A;  3O9R A;  4FM1 A;  3VPZ A;  4BY9 C;  4H0P A;  5CY4 A;  3J7Z O;  4Z94 A;  1HNX K;  4FLT A;  4LF7 K;  4DQP A;  2YHY A;  4CK1 A;  4LF9 K;  1CXU A;  4CHO A;  2G8W A;  4DMN A;  2YX6 A;  4KHS A;  1KCF A;  3VQC A;  3DXK B;  3V1R A;  3K2P A;  4BRH A;  1UWB A;  3JAM O;  4B9M A;  5LY3 A;  3A5M C;  3V9S A;  3U3G A;  4E3S A;  4CEA A;  3FFK B;  2P9I A;  3S9H A;  1S5J A;  1DTT A;  4HCC A;  2YV0 X;  4UQG A;  3OS0 A;  4NYN A;  2RE2 A;  5E84 A;  4N5S A;  1RDB A;  4OJR A;  3M6G A;  4DV3 K;  4AHR A;  3VQ5 A;  1GOA A;  1QVF M;  1BI4 B;  2E1Z A;  5CZ1 A;  3FLC O;  4EFH A;  5KTQ A;  1LOT B;  3M3Z A;  4MLE A;  5AQL A;  4BRI A;  3MN7 A;  5CR4 A;  3T1Y K;  4H5W A;  1NGB A;  1TKZ A;  3KHY A;  3ID6 A;  3LM9 A;  2O8B B;  1ZYQ A;  3M8Q A;  1HKB A;  4IOX A;  4E1M A;  3VF2 A;  1HRH A;  3TR8 A;  3CD6 N;  4KHW A;  2P9L B;  2P1J A;  3CFO A;  5GAH P;  1JL2 A;  2JGU A;  3AVM A;  1HNW K;  4YOR A;  4WYB A;  1WSI A;  1JLB A;  1WUA A;  4YOX A;  1MWM A;  4BR7 A;  5AZJ A;  3MMV A;  3OBW A;  2PZS A;  3IKM A;  4CEZ A;  2GUP A;  3RMA A;  4BR5 A;  1QZ6 A;  3VQB A;  5EXW A;  4EZ9 A;  3PSI A;  3K5M A;  3MXI A;  1KFD A;  4KH5 A;  4F2R A;  4KAZ A;  4Q0B A;  3K9J A;  3CJ9 A;  1TUU A;  2HF3 A;  1I94 K;  2OTJ N;  1RFQ A;  4M3Z A;  5GAD P;  1RBV A;  2P5G A;  2DTU A;  3K5N A;  5DK5 A;  3O3F A;  3PX6 A;  3BZC A;  3CPW M;  3UKU B;  1O1W A;  3P5J A;  3ZCM A;  1REV A;  4CCH A;  1Q7Y O;  1WOQ A;  4OPK A;  4CJQ A;  4BR0 A;  3G0Z A;  1CLQ A;  4IG3 A;  3ZEU B;  3WEE B;  4YNQ A;  4C8N A;  4O8K A;  5SWM A;  4PWD A;  3T69 A;  1OVQ A;  1QE1 A;  5LL6 Z;  4B1Z A;  4LH5 A;  4BC4 A;  4ZTF A;  3MDQ A;  2AP1 A;  4M42 A;  3LWL A;  2NRR A;  4E7I A;  1NK6 A;  2E2N A;  3LPU A;  4I6M B;  2HHW A;  3EE8 A;  5ELZ A;  4BG9 A;  1VSL A;  4PL7 A;  3G6E N;  3HXM A;  4CJW A;  4FXD A;  2Q0U A;  2X74 A;  3JSM A;  4FJ7 A;  2QWL A;  3HYF A;  1C0F A;  1NNE A;  3Q7B A;  4L3Q A;  2ZE2 A;  3DM2 A;  4O44 A;  3B6P A;  3HZ6 A;  4FLW A;  4OGE A;  1W9H A;  4F2S A;  1C1B A;  1HPZ A;  1YT3 A;  4HUG A;  4O0I A;  5C42 A;  4F8R A;  3EZ5 A;  1TYQ A;  2G8K A;  3ULE B;  1K8K A;  1BGX T;  3ZT1 A;  4KO0 A;  4YHH K;  5KGW A;  1A5W A;  3F9M A;  2D0A A;  2O8F B;  5BN8 A;  4DQQ A;  4FOE A;  3OYC A;  2QWM A;  3QIN A;  2D0B A;  3DXM A;  1QHT A;  1FK9 A;  4A62 A;  5AJ3 K;  4EZ6 A;  2A1S A;  4HTU A;  3ZT3 A;  2HF4 A;  1JKH A;  4M45 A;  4XEI A;  1T8E A;  3K58 A;  2HBK A;  5M1P A;  1HQU A;  4PQU A;  1RDC A;  4DSE A;  4DS4 A;  4IFE A;  2IVN A;  1RCH A;  1BDG A;  1U04 A;  1BCM A;  4OO1 J;  4KRF A;  3LDO A;  4JI5 K;  5I3U A;  2P9K B;  3VMF B;  1RT5 A;  5HRN A;  5HOO A;  4MDB A;  4M41 A;  4JKB A;  1IBM K;  1KQS M;  4FOI A;  4CBX A;  1GLC G;  2XY8 A;  3DXK A;  4KTQ A;  1J9A A;  1WNS A;  4FWO A;  4K25 A;  1U48 A;  4V19 S;  4IEI A;  3PUF A;  3MEE A;  1U45 A;  2JLE A;  5FLX O;  4JKF A;  5BN9 A;  2NRW A;  3S3N A;  1QQO A;  1HYZ A;  2P9I B;  1XNQ K;  1E4F T;  3AVJ A;  3O1W A;  4H0X B;  1VRU A;  5M1K A;  1YJN N;  1X9W A;  4EHU A;  1VQK N;  2RN2 A;  2A42 A;  1WSE A;  2A5X A;  3DYA A;  3WNE A;  4I2P A;  4W5Q A;  5J2Q A;  2G8U A;  4FK2 A;  4JNE A;  2LSN A;  3CC2 N;  5AQI A;  3CJA A;  1T7P A;  4LF5 K;  4I9L A;  3P38 A;  3NAE A;  3ZT0 A;  3AAQ A;  3SUO A;  4W5N A;  3GE1 A;  3UB5 A;  1D9D A;  3AAR A;  2PYL A;  1NGJ A;  1TVR A;  3R3L A;  1YHQ N;  3LAK A;  2GWK A;  1UAX A;  3HBT A;  2O8B A;  2Q1N A;  4ILG B;  5EOY A;  3T1H K;  4YY3 K;  3E66 A;  4DSJ A;  1HPM A;  5C24 A;  4CJT A;  4IBN A;  3NFA A;  4FWK A;  4LFC K;  2P9L A;  1K8A O;  4FJG A;  2NRH A;  3P4I A;  4DKW A;  4CBW A;  3KLI A;  2ATQ A;  3CET A;  2WFB A;  4CBU A;  1IV0 A;  3CJB A;  2DPN A;  1B9D A;  3A8Y A;  1U4B A;  3CQ8 A;  3ZLJ A;  4M3X A;  1ZBS A;  3FZM A;  4JRQ A;  4OPH A;  3DLB A;  1OH8 A;  3DRP A;  2HHT A;  3QEW A;  1IKY A;  3SUN A;  3VQ4 A;  1T44 A;  1WSH A;  2IVO A;  4FWN A;  3MCP A;  2FBV A;  4KHU A;  1WBD A;  3D45 A;  1HYV A;  1T3V A;  4E0D A;  2JWL A;  3HOS A;  3S3M A;  3THV A;  4BDY A;  1FXX A;  3QEV A;  2YKN A;  4O4G A;  4WE1 A;  4BE0 A;  4GW6 A;  5E26 A;  3CCU N;  4BVO A;  2E8A A;  4JI3 K;  5KQD A;  3E9L A;  1NK9 A;  5KPZ A;  4KHP K;  1UOC A;  3J81 O;  3TWH A;  3RMC A;  1ZC6 A;  2G8F A;  1NJY A;  4RW4 A;  1HNZ K;  2ZWH A;  4K43 A;  2ITM A;  3C6H A;  4I6M A;  4FM2 A;  3SAG A;  1GLD G;  4EAH D;  4JI7 K;  5E41 A;  4FVM A;  3U9Z A;  1KLN A;  3VQ6 A;  5HL7 L;  3KIO A;  1B9F A;  2YHW A;  4KH6 A;  3VF6 A;  2I7N A;  4FJ8 A;  4CJE A;  4M7Y A;  4BR2 A;  4WCE L;  4CE9 A;  3E1Y A;  4E7K A;  4JI2 K;  3ZSQ A;  3MN9 A;  1J5E K;  1TKX A;  4BRM A;  4IOC L;  1KVC A;  4PY5 A;  5AQX A;  1Q81 O;  4KTZ A;  1R0A A;  2HHX A;  3W0L A;  4JKG A;  2E6M A;  5GIO A;  3NHG A;  4BRO A;  3SZ2 A;  4KV8 A;  2BDP A;  3ZSZ A;  1SAZ A;  3ULE A;  1W0H A;  3C7N B;  1K8K B;  2WUS A;  2W41 A;  3WT0 A;  2O8C A;  2HHV A;  2HBM A;  4C8O A;  4NXN K;  3BY5 A;  5DM6 L;  4X66 K;  4DWI A; 
#chains in the Genus database with same CATH homology
 4B3O A;  3ASM A;  4PA1 A;  1LWF A;  3KK2 A;  3DOL A;  2BGG A;  3DMJ A;  4BE1 A;  2E6L A;  1BIS A;  3CM5 A;  3NGY A;  3LAL A;  3QNO A;  3RWU A;  3LP0 A;  3A2F A;  4G1Q A;  4N47 A;  5J2N A;  4CJK A;  4FJ5 A;  1S1W A;  3KTQ A;  3I0R A;  4DTU A;  4GMJ B;  3LP1 A;  4CF2 A;  4B9V A;  4FJM A;  3I0S A;  2HHQ A;  4DQS A;  4B8C A;  2X6S A;  3AVC A;  1IO2 A;  4CJ4 A;  5FRM A;  4FZZ A;  3KKR A;  1CXQ A;  3ZT2 A;  4NCG A;  4DQR A;  2P5O A;  1KFS A;  4GVM A;  4FM1 A;  3MXJ A;  5CZ2 A;  1XWL A;  4FJJ A;  3OYB A;  3HT3 A;  3O4Q A;  4CJF A;  2QKK A;  5CY4 A;  3ZSX A;  4BWM A;  4FLT A;  1CZ9 A;  4DTX A;  1RDA A;  4CK1 A;  3JYT A;  4FLX A;  4DQP A;  5I42 A;  3OYE A;  3K59 A;  3C95 A;  3SQ0 A;  1VSK A;  3NH1 A;  3AVH A;  4AH9 A;  4Y1D A;  1CXU A;  4I7F A;  3RTV A;  4MFB A;  4Z4F A;  4CHO A;  3AVI A;  2G8W A;  2RKI A;  4LSN A;  1BIZ A;  4DMN A;  1T05 A;  4KHS A;  1KCF A;  4XIU A;  3VQC A;  4DLG A;  4J2E A;  3OS1 A;  4J2A A;  3V1R A;  3K2P A;  1UWB A;  2BE2 A;  4CF9 A;  1QSS A;  4B9M A;  3T3F A;  4B9T A;  4KB1 A;  4DS5 A;  4FCY A;  3MXM A;  5HLF A;  1C6V A;  3V9S A;  3U3G A;  1RIL A;  1NKB A;  4FZY A;  3RMB A;  4E3S A;  3HP9 A;  4CEA A;  2YNG A;  3TAM A;  3S9H A;  1S5J A;  2GUI A;  4DSL A;  1DTT A;  4TSX A;  4HCC A;  2YV0 X;  3WNF A;  4UQG A;  3OS0 A;  4B08 A;  2YNI A;  4Y1C A;  1YTA A;  4NYN A;  4Z4C A;  2X6N A;  4AHU A;  4H8K A;  4AHS A;  4N5S A;  1RDB A;  1JXB A;  2GBZ A;  4OJR A;  3ITH A;  3V9U A;  4E7L A;  4CHQ A;  4DU3 A;  4N56 A;  1RT6 A;  1I39 A;  3AA3 A;  4AHR A;  4DTN A;  3OYI A;  3QET A;  4Z4E A;  3VQ5 A;  3VQ7 A;  1NJZ A;  1GOA A;  1BI4 B;  3AA2 A;  1WSG A;  4KFB A;  3NGZ A;  1KLM A;  1N6Q A;  4PQU A;  1C0T A;  5CZ1 A;  1NK4 A;  2Z1J A;  4CEQ A;  4FLZ A;  4OGC A;  3SUQ A;  4OKE A;  3IS9 A;  4IFY A;  4RW9 A;  1KSP A;  1B92 A;  5KTQ A;  3DRR A;  4IFV A;  1T03 A;  5EU7 A;  4FJK A;  2O4I A;  3QER A;  4HVJ A;  4RG8 A;  1SL2 A;  1ZBH A;  1LW2 A;  3DLG A;  1L3S A;  1TKZ A;  4BDZ A;  4QCL A;  3AO1 A;  2XO7 A;  1TK0 A;  1HMV A;  3L2R A;  3FFI A;  4CEC A;  3M8Q A;  3CFR A;  1ZYQ A;  4CF1 A;  4O5B A;  4Z4H A;  4N76 A;  3MAQ A;  4BE2 A;  3HO1 A;  1TAQ A;  4E1M A;  1X1P A;  3QEP A;  1N5Y A;  3SUP A;  2YHB A;  4HHT A;  3ZT4 A;  1HRH A;  1TGO A;  5HRP A;  3TR8 A;  3OYD A;  1FKO A;  4KHW A;  1X9S A;  2P1J A;  3CFO A;  3QLH A;  1JL2 A;  2JGU A;  1S6P A;  4CIF A;  1JLC A;  2IAJ A;  2OZS A;  3PX4 A;  2AJQ A;  3AVM A;  2YNF A;  2XHB A;  1WSI A;  3TAQ A;  4IG0 A;  1JLB A;  3MEC A;  1HYS A;  1C1C A;  4B8A B;  4L8R B;  3SYZ A;  4FLV A;  1KRP A;  3OYN A;  3OYG A;  1SV5 A;  2PZS A;  4DU4 A;  2NUB A;  3F9K A;  3QIO A;  4RW7 A;  1BL3 A;  4CEZ A;  4C8K A;  4J2D A;  3RMA A;  3PY8 A;  4ID5 A;  3ZSR A;  3VQB A;  4EZ9 A;  4M3Y A;  1TAU A;  3HJF A;  2HVI A;  4MQ3 A;  2W42 A;  3K5M A;  3MXI A;  4CK3 A;  1KFD A;  4F2R A;  3TAF A;  1VK0 A;  3AVA A;  4E19 A;  3HK2 A;  3AA5 X;  1RTD A;  1J53 A;  4KAZ A;  1VSH A;  4Q0B A;  1G15 A;  3AO5 A;  3L3U A;  3OYH A;  2OYQ A;  3VQA A;  1XI1 A;  1RBU A;  4ZHR A;  1J5O A;  4M3Z A;  1RBV A;  1SUQ A;  1DLO A;  2G8V A;  2P5G A;  2DFE A;  3O3H A;  3AVL A;  4R5P A;  4OKK A;  2DTU A;  3OYF A;  3K5N A;  4EP5 A;  4BAC A;  4CES A;  4CGI A;  2D0C A;  5DK5 A;  3WNG A;  4CJ3 A;  3O3F A;  3PX6 A;  3LP3 A;  2B5J A;  3L2V A;  1I3A A;  4DF8 A;  3SCX A;  1TK8 A;  3VQ8 A;  3D0P A;  1RTH A;  4BWJ A;  1Y97 A;  1QSL A;  1O1W A;  3P83 D;  3LP2 A;  1X9M A;  3P5J A;  3ZCM A;  2HW3 A;  3QEI A;  4CHY A;  1TK5 A;  3PO5 A;  1REV A;  5SZT A;  3MED A;  3TAB A;  1S1V A;  1SL0 A;  4CCH A;  1UA1 A;  5KRS A;  4W5R A;  3RR8 A;  2RF2 A;  3AO4 A;  1BQM A;  4OPK A;  2YNH A;  4CJQ A;  3HVR A;  3LAN A;  4AHC A;  4DLE A;  3G0Z A;  2Y1J A;  4AHV A;  4E7J A;  1CLQ A;  4CIG A;  4IG3 A;  3V1Q A;  4W5O A;  1RTI A;  4YNQ A;  3AVN A;  2WON A;  4C8N A;  5SWM A;  4PWD A;  4LD0 A;  4DF4 A;  5J1E A;  4DTS A;  1QE1 A;  3OVN A;  1F21 A;  4LH5 A;  4ZTF A;  5CYQ A;  4E7H A;  4M42 A;  3LWL A;  3AVG A;  4E7I A;  3OYJ A;  1NK6 A;  3LPU A;  4DFP A;  3I8D A;  3L2W A;  1A5V A;  2OPQ A;  3TAP A;  2HHW A;  2ZD1 A;  1VSL A;  4CK2 A;  3T19 A;  1XHZ A;  3KK1 A;  3HXM A;  4DFK A;  1NOZ A;  4M3T A;  4CJS A;  1RT3 A;  3H08 A;  5HRS A;  4CJW A;  4FXD A;  2X74 A;  3B6O A;  4DG1 A;  5KRT A;  3JSM A;  3F73 A;  1WN7 A;  3DLH A;  4FJ7 A;  1U49 A;  4KHY A;  2P51 A;  3HYF A;  1JLE A;  1HQE A;  5KGX A;  4K8X A;  4O0J A;  3IRX A;  1KTQ A;  1U47 A;  2ZE2 A;  3DM2 A;  4O44 A;  3B6P A;  4KKO A;  5HRR A;  4OGE A;  3ULD A;  4FLW A;  3SV4 A;  1NKC A;  4IKF A;  4KRE A;  4CHN A;  1VSM A;  1W9H A;  4JLH A;  3DOK A;  4CJL A;  1C1B A;  4F2S A;  4CGF A;  1HPZ A;  1YT3 A;  4H4O A;  4LY7 A;  2YHA A;  1TL3 A;  3NH2 A;  4HUG A;  2F8T A;  4O0I A;  3VN5 A;  5C42 A;  4Z0U A;  3ALY A;  1JXE A;  3KLG A;  3PX0 A;  3VQ9 A;  3HVT A;  3OJS A;  4F8R A;  1BQN A;  3HPG A;  3EZ5 A;  3QNN A;  4FZX C;  4QAG A;  3TAN A;  1XHX A;  3QEX A;  4ID1 A;  4CJU A;  1VSD A;  2G8K A;  1S1X A;  4B9N A;  3G10 A;  2DFF A;  5HBM A;  2B6A A;  3ZT1 A;  1BGX T;  4OVL A;  4OPJ A;  1NJW A;  4KO0 A;  5JS1 A;  4CGH A;  5KGW A;  1A5W A;  1QS4 A;  2D0A A;  3NH0 A;  1RBS A;  3SJJ A;  4FJ9 A;  1NKE A;  3VQD A;  2KTQ A;  4DQQ A;  4PUO A;  3CYM A;  2VG5 A;  4CHP A;  3QIN A;  3AVK A;  3OYC A;  2D0B A;  2R7Y A;  4JS5 A;  4CEO A;  3U3Y A;  4KPY A;  1D8Y A;  4CEB A;  4DTR A;  1QHT A;  2OPS A;  1FK9 A;  3RMD A;  3VA0 A;  3V4I A;  4EZ6 A;  3UIQ A;  2A1S A;  4CGJ A;  3OYA A;  3ZT3 A;  4HTU A;  1NJX A;  5J2P A;  1JKH A;  4M45 A;  1T8E A;  1WAJ A;  1Z25 A;  4CFC A;  3K58 A;  4DFM A;  4Z4I A;  3L8B A;  1C0M A;  2XRI A;  1ASW A;  1HQU A;  1RDC A;  4B9L A;  4DSE A;  4ELT A;  4DS4 A;  3VQE A;  1QSY A;  1RBT A;  3HM9 A;  4AIL C;  3SV3 A;  2KZZ A;  1RCH A;  1A5X A;  1U04 A;  1BCM A;  5K14 A;  3SQ1 A;  4KRF A;  1S1T A;  4CED A;  1JLF A;  4FJI A;  4B9S A;  2XY5 A;  1EET A;  1RTJ A;  5I3U A;  3M8R A;  4I9Q A;  2VWK A;  1YVU A;  1TV6 A;  1RT5 A;  3DLE A;  3NF8 A;  4RW8 A;  5HRN A;  4DTM A;  2ITG A;  4M41 A;  5HP1 A;  3TI0 A;  2EHG A;  5C25 A;  5J2M A;  3NDK A;  1SKW A;  1IKW A;  3DLR A;  3PV8 A;  1UA0 A;  3NGI A;  4HUE A;  4DFJ A;  4KTW A;  2XY8 A;  3ZSO A;  2BAN A;  4KTQ A;  1J9A A;  1WNS A;  2F96 A;  4DTP A;  1U48 A;  1GOC A;  1ZBF A;  4CGD A;  2F8S A;  1K6Y A;  4DU1 A;  4B9U A;  3OYM A;  3PUF A;  3MEE A;  3K5L A;  3SI6 A;  1U45 A;  2OA8 A;  2JLE A;  2DY4 A;  1NK8 A;  4JS4 A;  1VSI A;  4DTJ A;  1EXQ A;  3S3N A;  4HUF A;  1HYZ A;  1S9G A;  4FW1 A;  3C94 A;  3K5O A;  2ZQB A;  4HCB A;  2X78 A;  3NF7 A;  3AVJ A;  2QK9 A;  1VRU A;  3L3V A;  1ASV A;  1TKD A;  2HNY A;  1X9W A;  1ASU A;  1JL1 A;  2EX3 A;  2FBX A;  3KK3 A;  2RN2 A;  2G8U A;  1WSE A;  3DYA A;  3KKS A;  3WNE A;  4I2P A;  4W5Q A;  5J2Q A;  3RR7 A;  4FK2 A;  4FK4 A;  2LSN A;  2Z1H A;  3VQP A;  1IKV A;  1D9F A;  3EYZ A;  3CFP A;  1IKX A;  2A1R A;  1SKS A;  1BI4 A;  2HND A;  1T7P A;  4I9L A;  4CFB A;  3ZSV A;  2Z1G A;  1S1U A;  4EP4 A;  4DSI A;  3V81 A;  4RW6 A;  3NAE A;  3HP6 A;  3ZT0 A;  3SUO A;  2HNZ A;  2IC3 A;  2GV9 A;  4CEF A;  3EY1 A;  1D9D A;  2PYL A;  4M3U A;  4W5N A;  3RRG A;  3V9X A;  3NCI A;  3V6D A;  1TVR A;  4NCB A;  3QO9 A;  3OY9 A;  4BDP A;  1RT7 A;  2KQ2 A;  3LAK A;  2HVH A;  4CJR A;  3ZSY A;  3U6F A;  1SKR A;  1WLJ A;  1JLA A;  4NCA A;  4KHN A;  1UAX A;  2IS3 A;  4CFA A;  3HPO A;  1TKT A;  2VG7 A;  4OLA A;  3V1O A;  3NF6 A;  4DQI A;  4FJX A;  4FJH A;  3KLH A;  3TAE A;  3T1A A;  4KI4 A;  4IDK A;  4AHT A;  1VSF A;  4DSJ A;  2XY7 A;  5C24 A;  4CJT A;  1HNV A;  4IBN A;  3NFA A;  3O4N A;  1KVA A;  4F3T A;  3LZI A;  2B4J A;  1EP4 A;  4J2B A;  2HHU A;  4FJL A;  4H4M A;  1ZBU A;  4FJG A;  2VG6 A;  5CYM A;  1GOB A;  1FKP A;  4E89 A;  2IDO A;  3LZJ A;  1RT2 A;  2ATQ A;  3KLI A;  1Q8I A;  5DMR A;  4DWI A;  1QTM A;  3NE6 A;  4KB0 A;  3ISN C;  5JS2 A;  1RDD A;  1ZBL A;  1S9E A;  3QES A;  3M8P A;  1ITG A;  3M8S A;  1B9D A;  2G8I A;  3KLF A;  1U4B A;  3AV9 A;  3CQ8 A;  3KJV A;  3L2U A;  3BGR A;  4F3O A;  4M3X A;  4CFD A;  1JLQ A;  3C6T A;  4JRQ A;  1ZBI A;  3DLB A;  3C6U A;  5FRO A;  3V9W A;  4C8L A;  1C1A A;  4DTO A;  3DRP A;  1L3T A;  3DLK A;  3QEW A;  1IKY A;  3SUN A;  2HHT A;  2VWJ A;  3TAR A;  3VQ4 A;  3SPZ A;  1NOY A;  3KD5 E;  1WSH A;  3S3O A;  3CM6 A;  4DSK A;  4Z4G A;  3NBP A;  3AVF A;  3OS2 A;  4ZTJ A;  3NF9 A;  3VQQ A;  4E1N A;  4QOZ B;  2FBV A;  4KHU A;  3QIP A;  3WNH A;  1KVB A;  3D45 A;  1Q9Y A;  1LWC A;  2KFN A;  2I5J A;  1HYV A;  3SQ2 A;  4ICL A;  4I2Q A;  3SNN A;  1LW0 A;  3DRS A;  4YFU A;  4E0D A;  4LSL A;  4CHZ A;  4KHQ A;  2XY6 A;  3S3M A;  3THV A;  1D5A A;  4BDY A;  1FXX A;  1L3V A;  2QXF A;  3QEV A;  4ELV A;  2YKN A;  3E01 A;  4FJN A;  4O4G A;  1NK0 A;  1JLG A;  4WE1 A;  1RNH A;  4BE0 A;  4ELU A;  4M3R A;  3LWM A;  4GW6 A;  3ZSW A;  4N41 A;  2OZM A;  1EX4 A;  2KW4 A;  1Z26 A;  3KD1 E;  5D3G A;  2Y1I A;  5FRN A;  1QQC A;  1RBR A;  1NK9 A;  4OLB A;  4CJV A;  1VSE A;  2E4L A;  1RT4 A;  1UOC A;  3SQ4 A;  1L3U A;  2HHS A;  2Q3S A;  1YTU A;  1EKE A;  3TWH A;  4CJ5 A;  3RMC A;  2IOC A;  4W5T A;  5HRO A;  4FYD A;  1RT1 A;  2G8F A;  3KLE A;  2HMI A;  4KI6 A;  3VA3 A;  2IGI A;  1NJY A;  3O3G A;  3PO4 A;  3HL8 A;  2HB5 A;  1BCO A;  1HJR A;  2D5R A;  3AVB A;  5T7B A;  4Q5V A;  4RW4 A;  2YKM A;  1S6Q A;  4DSF A;  3CG7 A;  1L5U A;  1WSF A;  4JRP A;  3IAY A;  2KZM A;  3DI6 A;  4FM2 A;  1BIU A;  3L2Q A;  1VRT A;  1NK7 A;  1DTQ A;  4CGG A;  1WSJ A;  4LH4 A;  1XC9 A;  4M3W A;  3LDS A;  1LAW A;  2Z1I A;  4FVM A;  5E41 A;  3OYL A;  1KLN A;  3OJU A;  3VQ6 A;  3HPH A;  3HST B;  3AA4 A;  3BDP A;  1LWE A;  3KIO A;  1IG9 A;  4CER A;  1B9F A;  5KI6 A;  2G8H A;  2FC0 A;  4CEE A;  1WAF A;  4FM0 A;  4CIE A;  2OPP A;  2WOM A;  3AO2 A;  4FJ8 A;  4CJE A;  1TL1 A;  1C0U A;  4K8Z A;  4CE9 A;  4E7K A;  2FBY A;  3LAM A;  3MEG A;  4CF8 A;  1NK5 A;  1LV5 A;  2RPI A;  1LAV A;  2DFH A;  2FBT A;  3OYK A;  4FW2 A;  2QKB A;  3ZSQ A;  2O4G A;  3SPY A;  1CZB A;  4F4K A;  1J54 A;  1TKX A;  3LPT A;  1KVC A;  3IG1 A;  3RRH A;  4PY5 A;  4FLU A;  4KTZ A;  1R0A A;  2HHX A;  4FK0 A;  2E6M A;  3NHG A;  3SZ2 A;  4KV8 A;  2BDP A;  3V9Z A;  4FLY A;  3ZSZ A;  2PY5 A;  1W0H A;  2OPR A;  4NYF A;  4C8M A;  3AO3 A;  4O55 A;  3TAG A;  5FDL A;  1SL1 A;  1Q9X A;  2PYJ A;  2HHV A;  4CJP A;  2KFZ A;  1VSJ A;  1IH7 A;  4CF0 A;  4C8O A;  2ETJ A;  4OKJ A;  1HNI A;  1BHL A;  3K57 A;  1MU2 A;  3P1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...