4GVMA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
148
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTACWWAGIKQEFGIPYNPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
total genus 44
structure length 148
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gvmA00
4AHUA 2VWKA 3OYKA 3L2QA 3ZSXA 3AVLA 3NH2A 1KFSA 1VK0A 3OYEA 4Q0BA 3K5MA 1B9FA 4QOZB 2HHQA 4DTPA 1XI1A 4AHTA 1T03A 1U47A 3T19A 3O4NA 4E3SA 3ZSRA 1QTMA 1UA0A 2GBZA 4GVMA 5KRTA 1NJXA 1L3TA 4OGEA 2D5RA 3G0ZA 3RWUA 4KPYA 1HQUA 2X78A 4F3TA 1BISA 3BGRA 1ZYQA 1JLGA 2YHAA 1Y97A 4IG0A 3O3FA 2NUBA 3K5NA 3QEVA 3SPZA 4NYFA 3QEWA 3LP3A 4FJMA 4E7LA 4M3WA 1C1CA 3G10A 1EKEA 4CJTA 3HPOA 3V9SA 4FJXA 2PYLA 3ZT4A 5DK5A 2O4GA 5KRSA 3KLEA 1RDCA 1IH7A 1RBRA 4AILC 2Y1IA 1TAUA 5JS2A 4FXDA 4AHRA 3K59A 3TABA 4J2EA 1HQEA 1N5YA 1IO2A 4CERA 2G8WA 2OZMA 4N41A 4CJLA 1CXUA 1L3VA 1J5OA 1LW0A 1RDAA 3HSTB 1C1BA 3QINA 2A1RA 4IFYA 4LH4A 1BI4B 3U3YA 3M8QA 4B8AB 1CZ9A 3RTVA 1EETA 3LPTA 4FLXA 4WE1A 4DQSA 1XHZA 1LAWA 4NCGA 4F2RA 2OZSA 5DMRA 1RT7A 3IRXA 3OS2A 4I2PA 2HB5A 4E1MA 1C1AA 4KHWA 1HRHA 4KHSA 4DWIA 3CQ8A 4PUOA 1S9GA 3F9KA 3WNHA 4KTQA 4M42A 1TK5A 3D0PA 3NBPA 4JS4A 4C8KA 2X6SA 3A2FA 4TSXA 2KW4A 2QXFA 2E6MA 1RT6A 4R5PA 3AVAA 1JL1A 2P5OA 4DTUA 1MU2A 1BIUA 2OPPA 4ID1A 4DSIA 3O3HA 4CGHA 1ITGA 1I39A 1JLFA 1LWFA 2F96A 1DTTA 2JLEA 3LP0A 3ZT1A 4CESA 3OYAA 4QCLA 1D5AA 3OYNA 2KZMA 2R7YA 1CXQA 3OYJA 2PY5A 2OPSA 4FJLA 1D8YA 4J2AA 4PWDA 4CFBA 3KD1E 2DTUA 4F8RA 1VSJA 3AO2A 1ASWA 3ZSWA 4RW8A 4CEZA 4FK2A 1SL0A 3CYMA 3AVNA 3NFAA 1RTDA 4J2DA 2HHVA 2EX3A 4KO0A 3SI6A 1LAVA 1IKWA 3AA5X 3VQPA 1HNIA 5KI6A 5T7BA 4W5TA 1S1VA 1N6QA 2AJQA 1TGOA 3AVMA 4DSKA 3D45A 1S5JA 4FZYA 1BCMA 4OLBA 5KGXA 1JLBA 3AV9A 3MXMA 4LSLA 3KK2A 4FK4A 3PX4A 3DRRA 4B3OA 4M3RA 3ZT3A 3V9UA 4Z4IA 4CJKA 3AVFA 4FLVA 3OYIA 1X9MA 1QSSA 1RT3A 1LWCA 3KK3A 2E6LA 3HVRA 1WSIA 1A5XA 3KJVA 1S1UA 4FLTA 2IGIA 4O0IA 4E1NA 2YKMA 2W42A 1HMVA 4K8ZA 1GOCA 4CHQA 3I8DA 1RDBA 1WN7A 1JXBA 3KLIA 1HJRA 3LAKA 4CF9A 4Z4GA 3PV8A 1NJYA 5C24A 4E7KA 3NGZA 3MXIA 3PO5A 3QEIA 3TAQA 3VN5A 1RT5A 1JLCA 3RRGA 3OYDA 4FJHA 4N76A 1CLQA 1WSEA 2D0BA 3LAMA 3SUNA 4C8LA 3SPYA 3QIPA 3L3UA 1QHTA 3NF8A 3AO3A 4HVJA 3TAFA 4NYNA 1TK0A 2HNDA 3L8BA 2XY8A 4FJGA 4KI4A 4CGGA 2QK9A 4CFDA 3WNFA 1D9FA 3ZSYA 4I9QA 4FM2A 2OPQA 3PO4A 4ELTA 1G15A 1SKWA 2P51A 3EY1A 4DTMA 5HLFA 2HHSA 4BDPA 4ID5A 4HCCA 1XC9A 3NGYA 1K6YA 1J9AA 3VQBA 1S1TA 2Z1HA 2G8FA 1BI4A 5KGWA 3OJUA 3L2VA 4CF0A 1VSHA 4BWMA 2VG5A 4DSFA 3DOKA 4CCHA 2XY7A 2FBVA 1KVAA 4M3UA 4E7JA 4CFCA 2YNFA 3TAGA 3AVIA 3QERA 4C8OA 4DLGA 4W5RA 2XY5A 4O4GA 4DTRA 3CFPA 4KHUA 2ITGA 3OS1A 3SCXA 4BDYA 4BE1A 1B92A 1R0AA 4CHNA 1WLJA 1JXEA 4B08A 4KKOA 4FCYA 3T3FA 3LZJA 1VRTA 1ASUA 3KD5E 3TAEA 4N56A 4DFPA 2JGUA 3TWHA 4E0DA 3VA0A 1VSFA 2DFHA 2O4IA 4DU1A 4ZTFA 4JRPA 1KLMA 1J53A 4H4OA 3V1OA 2DFEA 3C95A 1YTAA 2LSNA 4GMJB 4LSNA 4IKFA 2KFZA 4PY5A 2KFNA 1RT4A 1UA1A 4I9LA 3EYZA 3QEXA 1HPZA 1RBTA 3P5JA 1SKRA 1IG9A 1Z26A 4Z0UA 1EX4A 4C8MA 5CY4A 1VSKA 3LDSA 4M3YA 4W5NA 1WSHA 3VQ9A 3HPGA 3L2RA 3TAPA 1YT3A 4MQ3A 4Y1DA 1L5UA 4N5SA 3RMCA 4CHPA 3NH1A 2X6NA 1XHXA 1NOZA 3PUFA 5EU7A 3OYLA 3EZ5A 4DS5A 4F3OA 1FXXA 4ZHRA 3LP1A 1UOCA 4W5QA 4Q5VA 1QQCA 3V9WA 1ZBLA 1NK9A 4KHYA 3ALYA 3VQ8A 3SZ2A 2DY4A 1TKTA 2XRIA 3VQ7A 3VQQA 1L3UA 4OKEA 4DF8A 4FM1A 5D3GA 3DLGA 4KV8A 4UQGA 4DG1A 1T05A 4DSEA 4CF1A 4CGJA 4FVMA 4CGIA 3K5LA 4B8CA 3OVNA 4CHOA 4PQUA 4OPJA 1RILA 2B4JA 5HRNA 3OYFA 4XIUA 4CJ4A 3MXJA 3TARA 1TL1A 4BWJA 1ASVA 2RN2A 1S9EA 1FKPA 4PA1A 3U3GA 4Z4CA 3ISNC 4W5OA 3KIOA 4FJIA 4FLWA 4JRQA 4E7IA 3M8SA 1Q9XA 2HHUA 1S6PA 4FK0A 5J2MA 1ZBIA 2GUIA 3SUOA 2BGGA 4KREA 1VSMA 3MEEA 4LD0A 3CM6A 1NK4A 3HO1A 3KKSA 4CIFA 3VQ6A 4RW7A 3QIOA 1BHLA 3KLHA 2XY6A 2HVHA 3VQ5A 4DQPA 1BQMA 3THVA 3L2WA 1WSJA 5J2NA 1ZBUA 3NHGA 4Y1CA 1TKXA 4L8RB 5I3UA 1QS4A 4DLEA 4FW1A 4G1QA 3RR8A 3VQ4A 1RBSA 4CHZA 4CJSA 1RDDA 4CF8A 1B9DA 4DTNA 3RMBA 4DSLA 1TV6A 3AVCA 3I0SA 1ZBFA 4CK1A 3U6FA 3E01A 2G8KA 1IKYA 3ASMA 4M45A 1SL1A 1RT2A 3O3GA 4CJPA 4B9SA 2X74A 1RTHA 3NAEA 1DLOA 1WNSA 3HJFA 4CGDA 3F73A 2FBYA 4FLYA 1WAFA 3IS9A 4N47A 2FBTA 1NKCA 1TAQA 1VSEA 1W0HA 4O0JA 3CG7A 3LZIA 4JS5A 4DTXA 3QETA 1RTIA 2FBXA 3PX6A 4FJ7A 4Z4EA 4OPKA 3IAYA 2VWJA 4KI6A 1C0UA 4DQQA 3V1QA 1X1PA 3K2PA 2D0AA 2YNHA 4AHVA 3VQCA 3NGIA 5KTQA 3C94A 2KQ2A 3V4IA 3LWMA 3JSMA 4FJ5A 3H08A 2IC3A 1NK0A 3TANA 4RW6A 1LW2A 2RKIA 3AVGA 1KTQA 1VRUA 3DLRA 1X9WA 2GV9A 4HHTA 4HUGA 1NJWA 1UWBA 2RPIA 4CE9A 4CHYA 3TI0A 2OYQA 3OJSA 3AVBA 1NJZA 1KFDA 3LP2A 2PZSA 2ZE2A 1JLAA 4M3XA 1KRPA 1U4BA 3PX0A 4CIGA 1NKBA 1T8EA 1HNVA 4CECA 1NK8A 2IAJA 3V81A 3B6PA 4IBNA 4CJUA 1ZBHA 3P83D 1F21A 2ZD1A 5C25A 3HK2A 3ZT0A 4KB1A 4DQRA 5I42A 1KCFA 3V6DA 3HXMA 1QE1A 3OYBA 1Q9YA 5SZTA 2HHXA 4OLAA 3ZSZA 2Z1GA 4DFJA 2YHBA 3HP6A 3HT3A 3KLGA 3KLFA 4CEBA 4BE0A 4IG3A 1S1WA 3QEPA 4DTOA 3DI6A 4DMNA 1BL3A 5E41A 5J1EA 1BCOA 2QKKA 4AH9A 3AO1A 2DFFA 2F8TA 1REVA 4OGCA 3CM5A 3AO4A 3CFOA 2BANA 1RBUA 3HYFA 1JL2A 2QKBA 4M3TA 3LANA 2G8IA 4OVLA 2B6AA 4DTJA 2G8UA 4FJ8A 3SYZA 3UIQA 3FFIA 4CFAA 3O4QA 2ZQBA 3AVKA 4M3ZA 3P1GA 2Z1JA 3AO5A 4GW6A 3S3NA 2I5JA 4KFBA 2P5GA 1Q8IA 4LH5A 4CEOA 1D9DA 4HCBA 1JLEA 4H4MA 1C0MA 5HBMA 4DS4A 4CJ3A 3KTQA 4FJNA 1NOYA 3AA4A 2ETJA 3HP9A 4EP4A 2KZZA 2A1SA 4HUEA 1BIZA 4FLUA 4EZ6A 3AVHA 4HTUA 3V9ZA 2P1JA 2YNGA 3L3VA 5FDLA 4CEEA 4DFKA 1NK6A 4BE2A 1A5WA 1QSYA 3RMDA 5CZ1A 3SJJA 3OYMA 4DU3A 3QLHA 1SUQA 1TVRA 4CJRA 1KLNA 4HUFA 2VG6A 3DM2A 2YNIA 2WOMA 4AHCA 3DRSA 1SKSA 3DLBA 5HROA 3S3OA 2XO7A 3RR7A 1RT1A 2Q3SA 4FZXC 4CEAA 3LPUA 5CYMA 2KTQA 5K14A 4CEDA 3K58A 3TAMA 1HYSA 2F8SA 3ZT2A 4CIEA 4B9MA 3NF7A 5FRMA 3ZSOA 2YV0X 3V9XA 3PY8A 4LY7A 1A5VA 3AVJA 4CJ5A 1UAXA 4B9VA 4KTZA 4RW4A 4NCBA 4FW2A 4RW9A 2IDOA 1JLQA 1HYVA 4RG8A 3OY9A 3HM9A 1NK5A 1QSLA 5JS1A 1U49A 3KKRA 4OJRA 3ZSVA 4J2BA 3SV3A 4BDZA 1YTUA 1WSFA 4DSJA 2IS3A 1GOAA 4FLZA 4Z4FA 4ZTJA 2OA8A 4BACA 5HRPA 4KAZA 2HHWA 4H8KA 2WONA 3HVTA 1LV5A 3NDKA 3VQAA 5CYQA 4CJFA 3OYCA 1XWLA 4IFVA 1VSIA 4ICLA 1HYZA 3T1AA 3QO9A 5SWMA 1U48A 1TL3A 2D0CA 4O55A 3AA2A 1FKOA 1VSLA 4DQIA 1L3SA 2YKNA 1IKVA 3WNGA 2VG7A 4EP5A 5HP1A 2G8VA 3NF6A 5FRNA 3RRHA 4KHNA 5CZ2A 4OKKA 4CEQA 2Y1JA 2IOCA 2HW3A 4DTSA 3SNNA 1NK7A 1X9SA 3MEGA 3HPHA 4NCAA 2E4LA 4I7FA 3LALA 4O44A 1WAJA 4CGFA 3M8RA 5FROA 3ULDA 4DF4A 3SQ0A 4I2QA 1C0TA 5J2PA 3DMJA 2HNZA 4M41A 3K57A 1JKHA 4FJKA 4F2SA 4CJQA 3WNEA 4JLHA 2B5JA 3NE6A 4F4KA 2EHGA 4K8XA 1KVBA 1RNHA 1YVUA 2G8HA 4B9UA 1EXQA 3NCIA 4OKJA 3S9HA 3NH0A 4B9NA 3S3MA 3K5OA 1U04A 4KTWA 4EZ9A 4C8NA 3RMAA 1C6VA 4FM0A 3I0RA 2ATQA 3C6TA 4E19A 3C6UA 1NKEA 3MAQA 1IKXA 3HL8A 3SUPA 4KRFA 1BQNA 3QNNA 3JYTA 2HMIA 1SV5A 3ITHA 5J2QA 3SQ1A 1BGXT 4MFBA 3L2UA 3SUQA 1WSGA 4KHQA 3LWLA 2HHTA 1CZBA 3NF9A 3TR8A 4YNQA 4CJWA 3OYGA 4E7HA 4KB0A 1KSPA 1TK8A 3DRPA 4ELVA 3IG1A 4DFMA 4YFUA 3OYHA 4Z4HA 1O1WA 5HRRA 3VA3A 4AHSA 4B9TA 3VQDA 3QESA 3ZSQA 1GOBA 2BDPA 4CK3A 1DTQA 4B9LA 1SL2A 3V1RA 1U45A 4CJEA 4FZZA 1TKZA 1KVCA 3DYAA 4CJVA 2RF2A 1W9HA 1Z25A 4CEFA 3OS0A 1I3AA 3MEDA 3KK1A 2PYJA 4CK2A 3SQ4A 1EP4A 1FK9A 1RCHA 1RTJA 2OPRA 3DLEA 3DOLA 4E89A 4IDKA 5HRSA 1T7PA 4FJJA 4ELUA 1RBVA 3DLKA 4O5BA 2HVIA 3M8PA 1J54A 3BDPA 2BE2A 2Z1IA 3SV4A 1VSDA 1S1XA 4CF2A 3ZCMA 5C42A 4FYDA 3AA3A 1LWEA 4DU4A 3SQ2A 3VQEA 2FC0A 1S6QA 3CFRA 4QAGA 3MECA 4FJ9A 3QNOA 2XHBA 2HNYA 1TKDA 3DLHA 3B6OA
chains in the Genus database with same CATH superfamily
4AHUA 3OYKA 4YDUA 2QWPA 3OYEA 4Q0BA 1B9FA 2HHQA 3MK6A 1U47A 1QTMA 4GVMA 4MDAA 4K25A 3RWUA 4YHHK 1ZYQA 4IG0A 2YHAA 4FJMA 4M3WA 4E7LA 1N32K 3G10A 2PYLA 4JEPA 4AILC 1QQNA 2UUBK 4FXDA 2VGMA 2OZMA 4N41A 4CJLA 3J7YP 4IEEA 3O4WA 4B3TK 2P9KA 3QINA 2A1RA 4IFYA 4LH4A 1WUAA 5AQMA 5AQLA 1EETA 5TKYA 4A5AA 3IRXA 4I2PA 1WBDA 3BUZB 4KHWA 1NMNA 4MO5A 4KHSA 3CQ8A 3O9UA 4PUOA 1S9GA 3WNHA 3K0SA 2P9PA 2BTFA 1TK5A 2X6SA 4EIAA 2E6MA 1RT6A 5AZIB 1DGKN 1JL1A 2O8FB 4O5FA 1BIUA 4DSIA 3P38A 3O3HA 5BPNA 3VMFB 1LWFA 2F96A 1DTTA 4IJAA 3OYNA 4O8KA 2R7YA 1CXQA 3OYJA 4F8RA 4NXNK 5AQPA 1BOTO 2EX3A 1DEJA 1IKWA 2AJQA 1XMQK 5KI6A 2NRZA 1S1VA 3FLCO 2E88A 2NRTA 4FZYA 1NWKA 1JLBA 3AV9A 3O08A 2DPNA 3PX4A 3HTVA 3DRRA 3CQYA 4EHTA 4QS7A 3ZT3A 4Z4IA 1A5XA 2YKMA 4C1NI 3I8DA 1RDBA 3ULEA 1WN7A 1JXBA 5MLCQ 4CF9A 4Z4GA 1NJYA 3NGZA 5KPTA 3MXIA 5JLHA 3QEIA 1CLQA 4N76A 3OYDA 1WSEA 2D0BA 3A0IX 3AO3A 4LF8K 3ENOA 3L8BA 5JMVA 4FJGA 2QK9A 4EAHD 3DXKA 4CFDA 1D9FA 3ZSYA 1VHXA 1JCGA 1G99A 5HLFA 4ID5A 4BQLA 1V4SA 1J9AA 1ZC6A 1XNQK 3DXMB 3D2FA 4CF0A 3CXCM 2P9SB 2XY7A 4FOEA 2VGNA 2YCHA 3AVIA 3QERA 1VQ7N 4W5RA 2XY5A 3GG4A 2ITGA 3WQTA 1NU0A 4BE1A 1JXEA 4B08A 4L3QA 3T3FA 3PSFA 3LZJA 3K9KA 3VENA 2ZM6K 4DFPA 2JGUA 1VSFA 3N4QA 4H4OA 5BPLA 4BR9A 1YTAA 2LSNA 4GMJB 2KKZA 2KFNA 3O9RA 1J5EK 4IO8A 1SKRA 1IG9A 3CJBA 4Z0UA 5CY4A 4JI3K 3MCAB 4M3YA 3L2RA 4IO9L 1YT3A 3VEOA 3IMXA 3RMCA 5AQHA 2X6NA 1XHXA 3FZKA 2AA4A 4W5QA 1GLEG 5ADXA 1NK9A 1YXQA 4KHYA 3SZ2A 1VQ8N 4DF8A 4OO1J 4CGJA 4FVMA 4AF1A 3OVNA 4PQUA 1RILA 5HRNA 3OYFA 3O1WA 4JHDB 1ASVA 2RN2A 1DT9A 4FLWA 1Q9XA 3M8SA 1S6PA 1ZBIA 3SUOA 2GWJA 4LF9K 1QZ5A 1VSMA 4LD0A 3R9PA 3HO1A 3BZKA 4DV5K 3VQ6A 4UY8O 3W0LA 1T3VA 3KLHA 1X9JA 2XY6A 3VQ5A 1MDUB 1ZBUA 4L8RB 5I3UA 1RDUA 4FW1A 4CJSA 1GLDG 1TV6A 5M1KA 5ADXH 4CK1A 3E01A 3DAWA 5AJ3K 3L4IA 3ASMA 4M45A 1MWMA 1NGJA 3G25A 5E26A 1SL1A 1K8KB 1RT2A 3O3GA 4BRAA 1VQ6N 4FLYA 4U7BA 3HRGA 1ATNA 1VSEA 4O0JA 4JI4K 1RTIA 1HNXK 5FPEA 4KI6A 1W7AA 4DQQA 1NG9A 2ZGZA 1X1PA 5TKWA 2ZJRL 4AHVA 2VYPA 5KTQA 2D0PA 1GLAG 2HBMA 4RW6A 3AVGA 2P9LA 1KTQA 1FW6A 1MWKA 4HHTA 4HUGA 1KC8O 1UWBA 3TU5A 2OYQA 4K0KK 4BC2A 3LP2A 2PZSA 4M3XA 1JLAA 1KRPA 5LJWA 3LM2A 1U4BA 2GTDA 5B8HA 1F21A 4KBOA 4JV5K 1CZAN 2OCEA 3OYBA 2HHXA 1T44A 4OLAA 2Z1GA 3HP6A 3TPQA 2P9SA 3QEPA 3DI6A 1BL3A 4FWMA 2F8TA 3DXMA 2DFFA 3TSQA 2P9IA 3SBGA 3CFOA 2BANA 1BG3A 2QA4N 3EN9A 2QKBA 1QHAA 2G8IA 4BVPA 4FJ8A 2Q31A 4CFAA 2ZQBA 3P1GA 2Z1JA 1MA9B 1NMDA 3GL1A 4GW6A 3VF2A 4BRFA 3S3NA 2P5GA 4OPHA 4HCBA 1JLEA 2Q0RA 3AA4A 2ETJA 3HP9A 3LDNA 2IVNA 4EP4A 3AVHA 4DFKA 3F9MA 2HHHK 5CZ1A 3OYMA 4IFEA 3HM8A 3QLHA 3DJCA 3VEZA 2VG6A 4CW7B 1XUPO 1T6CA 3S3OA 2XO7A 5CYMA 5K14A 4CEDA 3ZSOA 2D1KA 4CJ5A 4B9VA 3A5OC 1NBWA 3JS6A 3NVMA 2FSJA 1QSLA 4RG8A 3OY9A 5JS1A 1U49A 3ENHA 1HNZK 3ZSVA 4J2BA 3SV3A 4H0YB 3SAFA 3SMSA 4PL8A 4DSJA 3ZEUB 4YOYA 1E4GT 4FLZA 4J8FA 2HF4A 4ZTJA 3H3OB 4FO0A 5M1QA 5LL6Z 3QFPA 1XWLA 5JVGL 2P9NB 1QQOA 4DR7K 4XH5A 1IKVA 2VG7A 5AQXA 3C65A 4CZGA 3NF6A 3DLLL 5C12A 4BQZA 4DTSA 2E1YA 3LALA 1WAJA 2WC9A 3ULDA 4B1UB 3SQ0A 4I2QA 5J2PA 3DMJA 4M41A 3U9ZA 1JKHA 4F2SA 3WNEA 3SK3A 2ZJPL 3UB5A 1R59O 2UXBK 1KVBA 1YVUA 4BY9C 4B9NA 3NCIA 4OKJA 3S9HA 3AY9A 4KTWA 4C8NA 4YY3K 3CCRN 4FM0A 3U8XA 3PIOL 1YITN 4YORA 3HL8A 5F1XA 5J2QA 3L2UA 1WSGA 3LWLA 1QVFM 2NNWA 5BRDA 4E7HA 3WEEB 4ELVA 3IG1A 4DFMA 2OTJN 4YFUA 3OYHA 4Z4HA 1KAZA 1GOBA 1VQMN 3V1RA 1NGGA 4CJEA 4H0OA 3DYAA 1Z25A 3OS0A 1I3AA 2PYJA 3KK1A 2PAVA 4CK2A 5FPDA 1RCHA 1FK9A 1RTJA 4CZHA 2O8CA 5HRSA 3F2KA 4IDKA 5AQIA 1RBVA 3DLKA 4O5BA 1J54A 2E2PA 3J7ZO 2BE2A 2Z1IA 3CCSN 4PHTX 3ZCMA 1S6QA 2RHKA 3CFRA 3UE5A 2A41A 2QTDA 1BA1A 3O1BA 3QNOA 2HNYA 4ISFA 3BF3A 4FWSA 3L2QA 2VWKA 3ZSXA 3NH2A 3ZETA 2YX6A 4DTPA 1XI1A 1UA0A 5BR8K 1NJXA 3G0ZA 3H1QA 4KPYA 3MMVA 1JLGA 1X9MA 1Y97A 3QEVA 1P8ZA 3HPOA 3V9SA 3ZT4A 5KRSA 1IH7A 5JS2A 4BROA 4AHRA 4J2EA 1VQ5N 5AQYA 2G8WA 4RCHA 3G4SN 4CZIA 1J5OA 1RDAA 3HSTB 1BI4B 3QMLA 3VGKA 3U3YA 2YI1A 1CZ9A 3DWLA 4DCHA 2V52B 1XHZA 4JYAK 4ISEA 2OZSA 5DMRA 3OS2A 3SLCA 1VQLN 4K42A 3WUHA 3L4QA 5M1FA 4M42A 4C8KA 4JS4A 3R1XA 2KW4A 5C2DA 4FL9A 4R5PA 2KLAA 1MU2A 4DV6K 2OPPA 1HR0K 3H3NO 3CCMN 4CGHA 1ITGA 3R8EA 4QCLA 5M1NA 2PY5A 2YHWA 4PWDA 3KD1E 1ASWA 4RW8A 1RTDA 3CYMA 4J2DA 4NLBA 1NGEA 3L6QA 3QICA 4W5TA 1HNIA 1N6QA 1ESVA 1K9MO 3NVKA 3AVMA 5C15A 3D45A 4CVNE 1BCMA 3O6WA 3T1HK 4LSLA 5AQVA 2HMPA 5M1PA 4B3OA 4CJKA 3OYIA 3KJVA 4JKDA 2E1ZA 1P90A 4JI2K 2W42A 1GOCA 4BGBA 3CERA 4CZKA 3PV8A 4BC5A 4E7KA 4ILGB 2D4WA 3RRGA 4FJHA 4IDHA 4X66K 3LDQA 5LMUK 4HVJA 2QWMA 1K8KA 4NYNA 1TK0A 2HNDA 2GELA 4GV3A 2JWLA 1HUXA 3WNFA 5M1OA 4CZMA 4FM2A 3EZWA 3EY1A 4DTMA 4GVEA 2HHSA 3VQBA 3J81O 2G8FA 1BI4A 5KGWA 3OJUA 3L2VA 1VSHA 4BWMA 2VG5A 4E7JA 3ULEB 4ILHA 4DLGA 4IOXA 3A5MC 4BRCA 1B92A 3JAMO 5GAHP 1YUWA 2V7ZA 2O8EA 1ASUA 2HF3A 3TAEA 1S3XA 1GLFO 3CETA 4ZTFA 4JK8A 5EX5A 4BR5A 3AAQA 2KFZA 1IJJA 5C10A 2I7NA 4C8MA 3ZX3A 1VSKA 3LDSA 4W5NA 4BR0A 2Q2RA 3LL3A 4MQ3A 4GKKK 3R3LA 4DV7K 3NH1A 3PUFA 1NGHA 5EU7A 3RSEB 3EZ5A 1FXXA 3CPEA 1QQCA 3VQ8A 2DY4A 3VQ7A 2W6KA 3TSPA 1L3UA 3CCQN 4OKEA 5D3GA 2O8CB 4DG1A 4DSEA 4CF1A 4WYBA 5A2QO 4B8CA 4JI7K 4OPJA 2B4JA 4A62A 5AQUA 2WTUA 4PA1A 1FKPA 3U3GA 4Z4CA 3ISNC 4W5OA 5BREA 3CC2N 4E7IA 3MX2A 2HHUA 3O9QA 5J2MA 1QQMA 3AGRA 3CM6A 4JK7A 1BQMA 1FJGK 3L2WA 1HX1A 4E1JA 3NHGA 5J2NA 1TKXA 3SJHA 1TUUA 4FWPA 3VQ4A 1RBSA 1RDDA 4DSLA 1HLUA 5AQWA 3AVCA 3O5BA 4DR3K 1ZBFA 2G8KA 2QWRA 3OTOK 4CD3A 4CZJA 4B1YB 2QXLA 2X74A 3HJFA 2FBYA 2ASOA 4N47A 4H0PA 1VQPN 5KQ8A 4GKJK 1TAQA 3QETA 3CG7A 4Z4EA 1C0UA 2VWBA 2YNHA 4WFAL 3VQCA 3IFRA 3EE8A 4ILJA 3V4IA 3N4PA 3LWMA 1LW2A 5IWAK 4A57A 3G6EN 1HKBA 2GV9A 3ZEUA 1NJZA 1EQYA 3AVBA 3T1YK 1NKBA 1T8EA 4CECA 2IAJA 4AQYK 4FSVA 3V81A 3B6PA 3CHWA 4IBNA 4BRIA 4CJUA 1ZBSA 2QWNA 3FZFA 4WQ4A 5DM6L 1Q9YA 5SZTA 4GV6A 4DFJA 3HT3A 3M5RA 4BE0A 2IIRA 1XNRK 1S1WA 4DMNA 3QBXA 5J1EA 4AH9A 3AO1A 3LDLA 3AO4A 3CC7N 4BRDA 2F7TA 2FXUA 1BA0A 1RBUA 5JLFA 1GLCG 4JI8K 4OVLA 4DTJA 2Q0UA 3SYZA 3UIQA 3FFIA 4DUZK 3O4QA 4DUYK 3AO5A 4KFBA 4LH5A 3CPWM 1IBMK 2Q97A 5HBMA 1C0MA 4CJ3A 2P9KB 3SMPA 2A1SA 2H3GX 1VQKN 2WBNA 4CEEA 1HNWK 2D0OA 3RMDA 5FPNA 1WOQA 1KLNA 3B8AX 2CGJA 4AHCA 3DLBA 2CGLA 4YOTA 4B1ZA 3RR7A 4NLCA 4B9QA 4CIEA 1A5VA 1UAXA 4KTZA 4NCBA 4YOWA 4DR2K 5CE3A 2IDOA 1JLQA 4JI0K 4OJRA 5BN8A 4CZEA 3OA9A 1NGFA 2WONA 3HVTA 1KQSM 3NDKA 4CBWA 5AQSA 3OYCA 4DR4K 1HYZA 4OPAA 4CJ7A 4NO7A 3QO9A 3SAHA 1U48A 4NB4A 4OX9K 2D0CA 2FSNA 3AA2A 3UKUB 4DQIA 2YKNA 3WXIA 5BN9A 3WNGA 3MWTA 5HOOA 2G8VA 3CCVN 2Q36A 4KHNA 4MDBA 3SNNA 1X9SA 2NRXA 4NCAA 4I6MA 4I7FA 3M8RA 3IKMA 3NE6A 4NXMK 1EXQA 3NH0A 1U04A 3KVGA 2JWKA 1WB9A 4KH5A 1C6VA 3RMAA 4DHYA 3MAQA 1IBLK 3JYTA 2HMIA 3CCEN 1BGXT 4MFBA 3SUQA 3IUCA 3M3ZA 2HHTA 5CHIA 5EVZA 4YNQA 4CJWA 4KB0A 1KSPA 3MN9A 1TK8A 3CIPA 3DRPA 3D2FB 1O1WA 5ELZA 3VQDA 2WFBA 3MN7A 1LOTB 4B9LA 3VTHA 4FZZA 3ZETB 4JKBA 4WQ5A 3UKRA 4CEFA 3DLEA 2OPRA 3DOLA 4E89A 1T7PA 2HVIA 3SV4A 3J7AP 3CF5L 3ENBA 4FYDA 3AA3A 3SQ2A 2FC0A 3GOIA 3MECA 3VERA 4BR4A 1OH8A 4DV3K 3ZYYX 1TKDA 3DLHA 4H5RA 4CJFA 4MLHA 4FPBA 4QOZB 5GINA 2FF3B 4AHTA 4RWTA 3T19A 1D4XA 3CCJN 2UXDK 2GBZA 5KRTA 1L3TA 2D5RA 1HQUA 2X78A 3VEWA 1BISA 4F3TA 3A8YA 3O3FA 2NUBA 3K5NA 4CI6A 4NYFA 3VTIA 4U67L 3WXKA 2HSTA 3O9TA 4FJXA 4CJTA 1EKEA 2GUPA 3D2EB 1KAXA 1U2VB 3TABA 1IO2A 2YHYA 1CXUA 4I6MB 1K8AO 1LW0A 4FVUA 1C1BA 4A2BA 4B8AB 4IWVA 3RTVA 4QS8A 2O8BA 4NCGA 5AZIA 4LF6K 5F2RA 1OH5A 2UYTA 3GE1A 1YJ9N 3BF1A 3NBPA 3EKSA 4TSXA 3BY5A 5DM7L 3AVAA 4JKCA 4R79A 4ID1A 4A5BA 1JJ2M 3ZT1A 1SZ2A 3LP0A 3FR0A 2V51B 3OYAA 2KZMA 1GLBG 4FJLA 2OPSA 3GDQA 2DTUA 2ZGYA 1VSJA 5BRHA 5KPRA 4CEZA 4CZFA 4FK2A 3AVNA 1VQNN 4KO0A 5T7BA 4B3SK 1TGOA 4DSKA 4OLBA 1S5JA 5LY3A 5KGXA 5LJVA 4X64K 2BH1A 3R6MA 4PKIA 3KK2A 4JI5K 5C2FA 3V9UA 3AVFA 1QSSA 1LWCA 4M7YA 2E6LA 1Z6RA 4JK9A 1S1UA 4FLTA 3Q7CA 4O0IA 4E1NA 1HMVA 3CC4N 2EWSA 4DV4K 1BUPA 4CHQA 4JKFA 3KLIA 1HJRA 4BGAA 5C24A 3PO5A 3TAQA 3VN5A 5BR9A 4C8LA 5IT9O 3SPYA 3QIPA 3L3UA 1QHTA 4BG9A 3TAFA 1N36K 1JCFA 2XY8A 4KI4A 4CGGA 3D7EO 3EEQA 4ELTA 1SKWA 3HI0A 5AQRA 1XC9A 1K6YA 1S1TA 2Z1HA 2E2NA 4EHUA 4BRNA 4DSFA 5CR4A 3THYA 3O80A 3MWPA 2YNFA 3TAGA 1IBKK 1OH6A 3A5LC 4K43A 4DTRA 3D2EA 3OS1A 1S22A 2ASMA 3ATVA 4FWNA 3VEVA 4CHNA 2OANA 4FCYA 3I8BA 1VRTA 3QB0A 4FWRA 4DV0K 4N56A 3VGMA 3ATUA 3I33A 3TWHA 1SAZA 3VA0A 2DFHA 2O4IA 3MDQA 4DU1A 4LC9B 4KH6A 3E9LA 4JRPA 1J53A 3V1OA 3C95A 4JNEA 5KQDA 1XMOK 1U6ZA 3THXB 1UA1A 4I9LA 1X3NA 3MN5A 3EYZA 1RBTA 3P5JA 3O8MA 1EX4A 3E9PA 2QWOA 3VQ9A 3P31A 3TAPA 4Y1DA 4MLEA 5AZJA 5C0YA 3OYLA 4F3OA 4ZHRA 3LP1A 1UOCA 4Q5VA 1YAGA 3DXKB 3ALYA 3C7NB 4B1WB 4LF4K 4UQGA 1T05A 1HKGA 4CGIA 2UXCK 2P9LB 3SBTA 4XIUA 4CJ4A 3MXJA 1TL1A 1Q81O 3GBTA 1S9EA 2O8DA 4FJIA 4FWKA 5GADP 4Y0WA 3MEEA 1NK4A 4CIFA 4DR6K 2F9WA 5GAEP 4DQPA 3WEEA 3THVA 3E66A 1E3MA 1QS4A 4CHZA 3I0SA 4LFCK 1NGBA 1NNEA 3KHYA 1M90O 1IKYA 4JKGA 3KK7A 4CJPA 4B9SA 3NAEA 4BRPA 1WNSA 3VESA 3ZLJA 4CGDA 3CQXA 1WAFA 3IS9A 4CZLA 2YHXA 3CJCA 3ZX2A 2W41A 3EO3A 4PL7A 4DTXA 3QBWA 4JS5A 2FBXA 4FJ7A 1YI2N 3V1QA 2D0AA 3NGIA 3C94A 2P9PB 4K41A 4FJ5A 2O8DB 2E8AA 1NK0A 3TANA 4DV1K 3JXUA 3C6AA 1X9WA 2F4VK 2RPIA 3TI0A 4CE9A 3A5NC 4CHYA 1TUYA 3OJSA 2ZJQL 1KFDA 1NGIA 2ZE2A 5AQTA 2CH6A 4DR5K 1HNVA 3AGKA 5AFUH 2PBDA 4X62K 5AZJB 2ZD1A 3HK2A 5C25A 4KB1A 4B1XB 1E4FT 2GEMA 1KCFA 5I42A 3HXMA 2A3ZA 1QE1A 1KXPA 4PKHA 3ZSZA 2YHBA 4IG3A 4DTOA 1REVA 3WXLA 5AQNA 2P9IB 1LCUA 1H1VA 4M3TA 3VEXA 2B6AA 2FF6A 4FWQA 2I5JA 1Q8IA 1D9DA 4FJNA 3KTQA 1VQ9N 1NOYA 4HUEA 3BP8A 4EZ6A 3V9ZA 2P1JA 2P9UB 5FDLA 4BE2A 1A5WA 1QSYA 4DU3A 3THXA 5AQQA 1SUQA 1TVRA 2VCPA 4CJRA 4FOIA 4FPAA 5BRFA 4HUFA 3DM2A 2YNIA 3DRSA 1SKSA 5HROA 2OTLN 3FFKB 3HSCA 1RT1A 2Q3SA 4CEAA 3LPUA 3U4LA 2KTQA 3K58A 1HYSA 3TAMA 3PIPL 3L0QA 3ZT2A 3NF7A 2HBJA 5FRMA 2YV0X 4LY7A 4H0TB 4BRKA 1EWQA 3HM9A 4JAXA 5KPZA 1NK5A 2A5XA 3TSUA 1IG8A 3KKRA 5GIPA 1YTUA 4MO4A 2IS3A 1GOAA 4GV9A 4GNIA 4Z4FA 4KAZA 4BACA 5HRPA 2HHWA 1LV5A 5AQOA 4IFVA 4JKHA 5GAGP 1VSIA 3I56N 1TYQB 5SWMA 5F0XA 2WUSA 4O55A 4A59A 4QS9A 1FKOA 2VQFK 1L3SA 5AQJA 1GLLO 4EP5A 1OVQA 5AFUA 2CH5A 5AQZA 5CZ2A 4OKKA 1J6ZA 2IOCA 5H1SQ 2HW3A 3MEGA 3P4IA 3HPHA 3HOSA 2E4LA 4O44A 4CGFA 3TTCA 4DF4A 3FZLA 1C0TA 2E2OA 2HNZA 3K57A 4CJQA 2FSKA 3CD6N 4F4KA 1RNHA 4B9UA 4CD1A 4WF9L 4B3MK 3NMUA 3M1FA 4EZ9A 4JKAA 3TTFA 2ATQA 4E19A 3C6UA 1IKXA 3SUPA 4KRFA 1BQNA 3MCPA 3QNNA 4BREA 3Q7BA 1OKJA 1YHQN 3TR8A 2NRRA 3CMAN 3I55N 3CJ1A 1W97L 3VA3A 3K9JA 4AHSA 1YVNA 3ZSQA 2BDPA 4CBUA 4CK3A 1DTQA 3HOTA 1SL2A 1U45A 1TKZA 4CJVA 5I9EB 2RF2A 4AM7A 3MEDA 1ILYA 4KH4A 5BPMA 4ELUA 3D6RA 3BDPA 1NGCA 4CF2A 5AR0A 2QWLA 3VQEA 4FWOA 4QAGA 2E20A 3CI5A 1NJIO 3OW2M 2XHBA 1ATSA 1XQSC 1Q18A 1ZXOA 1XC3A 3B6OA 4BR7A 3AVLA 1KFSA 2UUCK 1VK0A 3K5MA 3PLAA 3H1VX 1T03A 3O4NA 4E3SA 3ZSRA 4OGEA 2VQEK 3OBYA 3BGRA 4A61A 3SPZA 3QEWA 3LP3A 1TYQA 1C1CA 1Z05A 4IEIA 4XH1A 5DK5A 2O4GA 3KLEA 1V4TA 1RDCA 1RBRA 1TAUA 2Y1IA 1HPMA 3K59A 1HQEA 1N5YA 2P9UA 3S41A 4CERA 2FLOA 1L3VA 4C1NK 2NRHA 3ID6A 3KWIA 3M8QA 3EKUA 3SAGA 2QM1A 3LPTA 4FLXA 4WE1A 4DQSA 1LAWA 4JN4A 4F2RA 1RT7A 1EO1A 2HB5A 4E1MA 1C1AA 3WQUA 1HRHA 4DWIA 4YOXA 3F9KA 4KTQA 1RGIA 4DKWA 2HBLA 2KHOA 4LF5K 4JI6K 3D0PA 3A2FA 4KHPK 2QXFA 1VQ4N 3RVCA 4G9ZA 2P5OA 4DTUA 3H46O 4PKGA 1BO5O 4DB3A 1I39A 3MN6A 1JLFA 2JLEA 5EY4A 4CESA 3KWGA 1D5AA 4J2AA 1D8YA 4CFBA 3AO2A 3THWB 2HOEA 3CCUN 4DV2K 1I94K 3ZSWA 3FGUA 1SL0A 3NFAA 2HHVA 3SI6A 1LAVA 3AA5X 3VQPA 3G71N 2O8FA 2P9NA 4V19S 2UU9K 3FE1A 3MXMA 4IZ9A 2GWKA 3VETA 4LFBK 4FK4A 4M3RA 1M1KO 4JKEA 4FLVA 2V7YA 1RT3A 3THWA 3KK3A 3HVRA 3T69A 1WSIA 2IGIA 4K8ZA 1OVYA 3BEXA 3LAKA 5GIOA 1RT5A 1JLCA 3HBTA 3LAMA 3SUNA 3MX5A 3NF8A 1Q7YO 4JKGB 3EL2A 3OHRA 4YOVA 2A40A 3UKUA 1K73O 1Y64A 4I9QA 2F9TA 2OPQA 3PO4A 1G15A 1RDWX 2P51A 4IOCL 4BDPA 4HCCA 3NGYA 4DR1K 4LFAK 1C0FA 2A42A 2O8EB 4CCHA 3DOKA 4H03B 2FBVA 1KVAA 4M3UA 2ITMA 4CFCA 3E1YA 4C8OA 3WXMB 3IDHA 1X3MA 4O4GA 3CFPA 4KHUA 3SCXA 4BDYA 1R0AA 3LM9A 1WLJA 4KKOA 4BRLA 5E84A 4JD2B 4H5TA 3KD5E 1NLVA 3P39A 4E0DA 3C6HA 4FWLA 2HBKA 3O9SA 1SS6A 1KLMA 4BC4A 1GLJO 2DFEA 4HTLA 4LSNA 4IKFA 2NRWA 4WCEL 4PY5A 1YF5L 1RT4A 2O8BB 3QEXA 1HPZA 2ZF5O 1QVGM 1Z26A 1EWRA 3H45C 5FPMA 1WSHA 2QW9A 3HPGA 1L5UA 4N5SA 4CHPA 1NOZA 4DS5A 3VGLA 3VPZA 1U2VA 1ZBLA 3V9WA 5AQKA 3QFUA 1TKTA 2XRIA 3VQQA 4FM1A 3E9OA 3DLGA 4KV8A 3VF6A 3PSIA 3K5LA 4CHOA 3WT0A 3CMEN 3KZBA 2GX9A 3TARA 4BWJA 3FZHA 3KIOA 3C0BA 4JRQA 2W40A 1NM1A 4FK0A 2GUIA 4KREA 2BGGA 3KKSA 4RW7A 3QIOA 1BU6O 1BHLA 2HVHA 4JHDA 1WSJA 4Y1CA 1YJNN 3EE9A 4DLEA 2QWQA 3RR8A 4G1QA 3J80O 4X65K 4DTNA 3RMBA 4CF8A 1B9DA 1QZ6A 3U6FA 4AM6A 2E5LK 4EFHA 2YJEA 5AQFA 4BRQA 4BR2A 4Z94A 1RTHA 1DLOA 3F73A 5FLXO 3CCLN 2FBTA 1NKCA 1NGDA 1KD1O 1W0HA 3LZIA 3PX6A 4OPKA 3THYB 2VWJA 3IAYA 2PFUA 3K2PA 2CGKA 1Q82O 4WFNL 2QEXN 1RFQA 4BVOA 1Q86O 2KQ2A 4BG8A 3LDOA 3JSMA 3H08A 2IC3A 3FZMA 1OH7A 2RKIA 3VF4A 1VRUA 3DLRA 4ISGA 1NJWA 1HKCA 3LDPA 2ASPA 4H5WA 1N8RO 3W3DA 3PX0A 4B3RK 4CIGA 2UUAK 4JD2A 2E2QA 1HJOA 4BRMA 1NK8A 3VOVA 1ZBHA 3P83D 4HWIA 4IJNA 3ZT0A 4DQRA 3V6DA 5EXWA 4DQ8A 4JI1K 5EOYA 3KLGA 3KLFA 4CEBA 1N34K 4WQ5C 5E41A 1BCOA 2QKKA 5AQGA 4OGCA 2YJFA 3CM5A 3HYFA 1JL2A 3LANA 1T6DA 2G8UA 2A6AA 1JCEA 3AVKA 4M3ZA 2Q1NA 4CEOA 4H4MA 4DS4A 4IOAL 3CJ9A 3CJ7A 2KZZA 1BIZA 4FLUA 4HTUA 1NK6A 2YNGA 3L3VA 4H5NA 1S72N 3H6EA 1VQON 5LMNK 3SJJA 4GY2B 1C0GA 1VAZA 1W2BM 3U9DA 4LF7K 2WOMA 2ZWHA 4XEIA 4YDUC 4FZXC 1YIJN 2QI2A 2F8SA 4BRGA 4B9MA 3V9XA 3PY8A 4BRHA 3AVJA 1DKGD 4RW4A 4FW2A 4RW9A 1HYVA 2W6LA 2NZTA 3WXJA 4BDZA 4BC3A 4XH4A 2J4RA 1WSFA 4H5VA 4B1VA 5JICA 4CBXA 2OA8A 4H8KA 4WQ4C 4H0VB 2NLXA 3VQAA 4M63C 5CYQA 3T7ZA 1IV0A 1YJWN 4ICLA 3J8AA 3C7NA 3T1AA 1SQKA 4WFBL 1TL3A 1VSLA 3ZX0A 4A2AA 5HL7L 5HP1A 4M7XA 5FRNA 4O8UA 3RRHA 4CEQA 2Y1JA 1NK7A 1O13A 1KAYA 4RTFD 5FROA 3HZ6A 4FJKA 5JVHL 3M6GA 4JLHA 2B5JA 2EHGA 4K8XA 2AP1A 2G8HA 1WBBA 3S3MA 3K5OA 3AARA 3I0RA 3C6TA 3BZCA 1NKEA 1NGAA 3CJAA 1SV5A 1BDGA 3ITHA 3SQ1A 4KHQA 1CZBA 3NF9A 1BWFO 3OYGA 3RSEA 4IXCA 2I7PA 5HRRA 4B9TA 3F5TA 3QESA 1ATRA 4H0XB 1KVCA 1W9HA 2IVOA 4C23A 1EP4A 3SQ4A 4FJJA 3TTDA 2IVPA 3M8PA 3ID8A 3QDKA 1VSDA 1S1XA 5C42A 1LWEA 4DU4A 3AAPA 1N33K 4YOUA 2NRVA 3UKRB 2BUPA 3OBWA 4FJ9A 2RE2A 3VEYA 4F9OA
chains in the Genus database with same CATH topology
4AHUA 2VWKA 3OYKA 3L2QA 3ZSXA 3AVLA 3NH2A 1KFSA 1VK0A 3OYEA 4Q0BA 3K5MA 1B9FA 4QOZB 2HHQA 4DTPA 1XI1A 4AHTA 1T03A 1U47A 3T19A 3O4NA 4E3SA 3ZSRA 1QTMA 1UA0A 2GBZA 4GVMA 5KRTA 1NJXA 1L3TA 4OGEA 2D5RA 3G0ZA 3RWUA 4KPYA 1HQUA 2X78A 4F3TA 1BISA 3BGRA 1ZYQA 1JLGA 2YHAA 1Y97A 4IG0A 3O3FA 2NUBA 3K5NA 3QEVA 3SPZA 4NYFA 3QEWA 3LP3A 4FJMA 4E7LA 4M3WA 1C1CA 3G10A 1EKEA 4CJTA 3HPOA 3V9SA 4FJXA 2PYLA 3ZT4A 5DK5A 2O4GA 5KRSA 3KLEA 1RDCA 1IH7A 1RBRA 4AILC 2Y1IA 1TAUA 5JS2A 4FXDA 4AHRA 3K59A 3TABA 4J2EA 1HQEA 1N5YA 1IO2A 4CERA 2G8WA 2OZMA 4N41A 4CJLA 1CXUA 1L3VA 1J5OA 1LW0A 1RDAA 3HSTB 1C1BA 3QINA 2A1RA 4IFYA 4LH4A 1BI4B 3U3YA 3M8QA 4B8AB 1CZ9A 3RTVA 1EETA 3LPTA 4FLXA 4WE1A 4DQSA 1XHZA 1LAWA 4NCGA 4F2RA 2OZSA 5DMRA 1RT7A 3IRXA 3OS2A 4I2PA 2HB5A 4E1MA 1C1AA 4KHWA 1HRHA 4KHSA 4DWIA 3CQ8A 4PUOA 1S9GA 3F9KA 3WNHA 4KTQA 4M42A 1TK5A 3D0PA 3NBPA 4JS4A 4C8KA 2X6SA 3A2FA 4TSXA 2KW4A 2QXFA 2E6MA 1RT6A 4R5PA 3AVAA 1JL1A 2P5OA 4DTUA 1MU2A 1BIUA 2OPPA 4ID1A 4DSIA 3O3HA 4CGHA 1ITGA 1I39A 1JLFA 1LWFA 2F96A 1DTTA 2JLEA 3LP0A 3ZT1A 4CESA 3OYAA 4QCLA 1D5AA 3OYNA 2KZMA 2R7YA 1CXQA 3OYJA 2PY5A 2OPSA 4FJLA 1D8YA 4J2AA 4PWDA 4CFBA 3KD1E 2DTUA 4F8RA 1VSJA 3AO2A 1ASWA 3ZSWA 4RW8A 4CEZA 4FK2A 1SL0A 3CYMA 3AVNA 3NFAA 1RTDA 4J2DA 2HHVA 2EX3A 4KO0A 3SI6A 1LAVA 1IKWA 3AA5X 3VQPA 1HNIA 5KI6A 5T7BA 4W5TA 1S1VA 1N6QA 2AJQA 1TGOA 3AVMA 4DSKA 3D45A 1S5JA 4FZYA 1BCMA 4OLBA 5KGXA 1JLBA 3AV9A 3MXMA 4LSLA 3KK2A 4FK4A 3PX4A 3DRRA 4B3OA 4M3RA 3ZT3A 3V9UA 4Z4IA 4CJKA 3AVFA 4FLVA 3OYIA 1X9MA 1QSSA 1RT3A 1LWCA 3KK3A 2E6LA 3HVRA 1WSIA 1A5XA 3KJVA 1S1UA 4FLTA 2IGIA 4O0IA 4E1NA 2YKMA 2W42A 1HMVA 4K8ZA 1GOCA 4CHQA 3I8DA 1RDBA 1WN7A 1JXBA 3KLIA 1HJRA 3LAKA 4CF9A 4Z4GA 3PV8A 1NJYA 5C24A 4E7KA 3NGZA 3MXIA 3PO5A 3QEIA 3TAQA 3VN5A 1RT5A 1JLCA 3RRGA 3OYDA 4FJHA 4N76A 1CLQA 1WSEA 2D0BA 3LAMA 3SUNA 4C8LA 3SPYA 3QIPA 3L3UA 1QHTA 3NF8A 3AO3A 4HVJA 3TAFA 4NYNA 1TK0A 2HNDA 3L8BA 2XY8A 4FJGA 4KI4A 4CGGA 2QK9A 4CFDA 3WNFA 1D9FA 3ZSYA 4I9QA 4FM2A 2OPQA 3PO4A 4ELTA 1G15A 1SKWA 2P51A 3EY1A 4DTMA 5HLFA 2HHSA 4BDPA 4ID5A 4HCCA 1XC9A 3NGYA 1K6YA 1J9AA 3VQBA 1S1TA 2Z1HA 2G8FA 1BI4A 5KGWA 3OJUA 3L2VA 4CF0A 1VSHA 4BWMA 2VG5A 4DSFA 3DOKA 4CCHA 2XY7A 2FBVA 1KVAA 4M3UA 4E7JA 4CFCA 2YNFA 3TAGA 3AVIA 3QERA 4C8OA 4DLGA 4W5RA 2XY5A 4O4GA 4DTRA 3CFPA 4KHUA 2ITGA 3OS1A 3SCXA 4BDYA 4BE1A 1B92A 1R0AA 4CHNA 1WLJA 1JXEA 4B08A 4KKOA 4FCYA 3T3FA 3LZJA 1VRTA 1ASUA 3KD5E 3TAEA 4N56A 4DFPA 2JGUA 3TWHA 4E0DA 3VA0A 1VSFA 2DFHA 2O4IA 4DU1A 4ZTFA 4JRPA 1KLMA 1J53A 4H4OA 3V1OA 2DFEA 3C95A 1YTAA 2LSNA 4GMJB 4LSNA 4IKFA 2KFZA 4PY5A 2KFNA 1RT4A 1UA1A 4I9LA 3EYZA 3QEXA 1HPZA 1RBTA 3P5JA 1SKRA 1IG9A 1Z26A 4Z0UA 1EX4A 4C8MA 5CY4A 1VSKA 3LDSA 4M3YA 4W5NA 1WSHA 3VQ9A 3HPGA 3L2RA 3TAPA 1YT3A 4MQ3A 4Y1DA 1L5UA 4N5SA 3RMCA 4CHPA 3NH1A 2X6NA 1XHXA 1NOZA 3PUFA 5EU7A 3OYLA 3EZ5A 4DS5A 4F3OA 1FXXA 4ZHRA 3LP1A 1UOCA 4W5QA 4Q5VA 1QQCA 3V9WA 1ZBLA 1NK9A 4KHYA 3ALYA 3VQ8A 3SZ2A 2DY4A 1TKTA 2XRIA 3VQ7A 3VQQA 1L3UA 4OKEA 4DF8A 4FM1A 5D3GA 3DLGA 4KV8A 4UQGA 4DG1A 1T05A 4DSEA 4CF1A 4CGJA 4FVMA 4CGIA 3K5LA 4B8CA 3OVNA 4CHOA 4PQUA 4OPJA 1RILA 2B4JA 5HRNA 3OYFA 4XIUA 4CJ4A 3MXJA 3TARA 1TL1A 4BWJA 1ASVA 2RN2A 1S9EA 1FKPA 4PA1A 3U3GA 4Z4CA 3ISNC 4W5OA 3KIOA 4FJIA 4FLWA 4JRQA 4E7IA 3M8SA 1Q9XA 2HHUA 1S6PA 4FK0A 5J2MA 1ZBIA 2GUIA 3SUOA 2BGGA 4KREA 1VSMA 3MEEA 4LD0A 3CM6A 1NK4A 3HO1A 3KKSA 4CIFA 3VQ6A 4RW7A 3QIOA 1BHLA 3KLHA 2XY6A 2HVHA 3VQ5A 4DQPA 1BQMA 3THVA 3L2WA 1WSJA 5J2NA 1ZBUA 3NHGA 4Y1CA 1TKXA 4L8RB 5I3UA 1QS4A 4DLEA 4FW1A 4G1QA 3RR8A 3VQ4A 1RBSA 4CHZA 4CJSA 1RDDA 4CF8A 1B9DA 4DTNA 3RMBA 4DSLA 1TV6A 3AVCA 3I0SA 1ZBFA 4CK1A 3U6FA 3E01A 2G8KA 1IKYA 3ASMA 4M45A 1SL1A 1RT2A 3O3GA 4CJPA 4B9SA 2X74A 1RTHA 3NAEA 1DLOA 1WNSA 3HJFA 4CGDA 3F73A 2FBYA 4FLYA 1WAFA 3IS9A 4N47A 2FBTA 1NKCA 1TAQA 1VSEA 1W0HA 4O0JA 3CG7A 3LZIA 4JS5A 4DTXA 3QETA 1RTIA 2FBXA 3PX6A 4FJ7A 4Z4EA 4OPKA 3IAYA 2VWJA 4KI6A 1C0UA 4DQQA 3V1QA 1X1PA 3K2PA 2D0AA 2YNHA 4AHVA 3VQCA 3NGIA 5KTQA 3C94A 2KQ2A 3V4IA 3LWMA 3JSMA 4FJ5A 3H08A 2IC3A 1NK0A 3TANA 4RW6A 1LW2A 2RKIA 3AVGA 1KTQA 1VRUA 3DLRA 1X9WA 2GV9A 4HHTA 4HUGA 1NJWA 1UWBA 2RPIA 4CE9A 4CHYA 3TI0A 2OYQA 3OJSA 3AVBA 1NJZA 1KFDA 3LP2A 2PZSA 2ZE2A 1JLAA 4M3XA 1KRPA 1U4BA 3PX0A 4CIGA 1NKBA 1T8EA 1HNVA 4CECA 1NK8A 2IAJA 3V81A 3B6PA 4IBNA 4CJUA 1ZBHA 3P83D 1F21A 2ZD1A 5C25A 3HK2A 3ZT0A 4KB1A 4DQRA 5I42A 1KCFA 3V6DA 3HXMA 1QE1A 3OYBA 1Q9YA 5SZTA 2HHXA 4OLAA 3ZSZA 2Z1GA 4DFJA 2YHBA 3HP6A 3HT3A 3KLGA 3KLFA 4CEBA 4BE0A 4IG3A 1S1WA 3QEPA 4DTOA 3DI6A 4DMNA 1BL3A 5E41A 5J1EA 1BCOA 2QKKA 4AH9A 3AO1A 2DFFA 2F8TA 1REVA 4OGCA 3CM5A 3AO4A 3CFOA 2BANA 1RBUA 3HYFA 1JL2A 2QKBA 4M3TA 3LANA 2G8IA 4OVLA 2B6AA 4DTJA 2G8UA 4FJ8A 3SYZA 3UIQA 3FFIA 4CFAA 3O4QA 2ZQBA 3AVKA 4M3ZA 3P1GA 2Z1JA 3AO5A 4GW6A 3S3NA 2I5JA 4KFBA 2P5GA 1Q8IA 4LH5A 4CEOA 1D9DA 4HCBA 1JLEA 4H4MA 1C0MA 5HBMA 4DS4A 4CJ3A 3KTQA 4FJNA 1NOYA 3AA4A 2ETJA 3HP9A 4EP4A 2KZZA 2A1SA 4HUEA 1BIZA 4FLUA 4EZ6A 3AVHA 4HTUA 3V9ZA 2P1JA 2YNGA 3L3VA 5FDLA 4CEEA 4DFKA 1NK6A 4BE2A 1A5WA 1QSYA 3RMDA 5CZ1A 3SJJA 3OYMA 4DU3A 3QLHA 1SUQA 1TVRA 4CJRA 1KLNA 4HUFA 2VG6A 3DM2A 2YNIA 2WOMA 4AHCA 3DRSA 1SKSA 3DLBA 5HROA 3S3OA 2XO7A 3RR7A 1RT1A 2Q3SA 4FZXC 4CEAA 3LPUA 5CYMA 2KTQA 5K14A 4CEDA 3K58A 3TAMA 1HYSA 2F8SA 3ZT2A 4CIEA 4B9MA 3NF7A 5FRMA 3ZSOA 2YV0X 3V9XA 3PY8A 4LY7A 1A5VA 3AVJA 4CJ5A 1UAXA 4B9VA 4KTZA 4RW4A 4NCBA 4FW2A 4RW9A 2IDOA 1JLQA 1HYVA 4RG8A 3OY9A 3HM9A 1NK5A 1QSLA 5JS1A 1U49A 3KKRA 4OJRA 3ZSVA 4J2BA 3SV3A 4BDZA 1YTUA 1WSFA 4DSJA 2IS3A 1GOAA 4FLZA 4Z4FA 4ZTJA 2OA8A 4BACA 5HRPA 4KAZA 2HHWA 4H8KA 2WONA 3HVTA 1LV5A 3NDKA 3VQAA 5CYQA 4CJFA 3OYCA 1XWLA 4IFVA 1VSIA 4ICLA 1HYZA 3T1AA 3QO9A 5SWMA 1U48A 1TL3A 2D0CA 4O55A 3AA2A 1FKOA 1VSLA 4DQIA 1L3SA 2YKNA 1IKVA 3WNGA 2VG7A 4EP5A 5HP1A 2G8VA 3NF6A 5FRNA 3RRHA 4KHNA 5CZ2A 4OKKA 4CEQA 2Y1JA 2IOCA 2HW3A 4DTSA 3SNNA 1NK7A 1X9SA 3MEGA 3HPHA 4NCAA 2E4LA 4I7FA 3LALA 4O44A 1WAJA 4CGFA 3M8RA 5FROA 3ULDA 4DF4A 3SQ0A 4I2QA 1C0TA 5J2PA 3DMJA 2HNZA 4M41A 3K57A 1JKHA 4FJKA 4F2SA 4CJQA 3WNEA 4JLHA 2B5JA 3NE6A 4F4KA 2EHGA 4K8XA 1KVBA 1RNHA 1YVUA 2G8HA 4B9UA 1EXQA 3NCIA 4OKJA 3S9HA 3NH0A 4B9NA 3S3MA 3K5OA 1U04A 4KTWA 4EZ9A 4C8NA 3RMAA 1C6VA 4FM0A 3I0RA 2ATQA 3C6TA 4E19A 3C6UA 1NKEA 3MAQA 1IKXA 3HL8A 3SUPA 4KRFA 1BQNA 3QNNA 3JYTA 2HMIA 1SV5A 3ITHA 5J2QA 3SQ1A 1BGXT 4MFBA 3L2UA 3SUQA 1WSGA 4KHQA 3LWLA 2HHTA 1CZBA 3NF9A 3TR8A 4YNQA 4CJWA 3OYGA 4E7HA 4KB0A 1KSPA 1TK8A 3DRPA 4ELVA 3IG1A 4DFMA 4YFUA 3OYHA 4Z4HA 1O1WA 5HRRA 3VA3A 4AHSA 4B9TA 3VQDA 3QESA 3ZSQA 1GOBA 2BDPA 4CK3A 1DTQA 4B9LA 1SL2A 3V1RA 1U45A 4CJEA 4FZZA 1TKZA 1KVCA 3DYAA 4CJVA 2RF2A 1W9HA 1Z25A 4CEFA 3OS0A 1I3AA 3MEDA 3KK1A 2PYJA 4CK2A 3SQ4A 1EP4A 1FK9A 1RCHA 1RTJA 2OPRA 3DLEA 3DOLA 4E89A 4IDKA 5HRSA 1T7PA 4FJJA 4ELUA 1RBVA 3DLKA 4O5BA 2HVIA 3M8PA 1J54A 3BDPA 2BE2A 2Z1IA 3SV4A 1VSDA 1S1XA 4CF2A 3ZCMA 5C42A 4FYDA 3AA3A 1LWEA 4DU4A 3SQ2A 3VQEA 2FC0A 1S6QA 3CFRA 4QAGA 3MECA 4FJ9A 3QNOA 2XHBA 2HNYA 1TKDA 3DLHA 3B6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AHU A;  2VWK A;  3OYK A;  3L2Q A;  3ZSX A;  3AVL A;  3NH2 A;  1KFS A;  1VK0 A;  3OYE A;  4Q0B A;  3K5M A;  1B9F A;  4QOZ B;  2HHQ A;  4DTP A;  1XI1 A;  4AHT A;  1T03 A;  1U47 A;  3T19 A;  3O4N A;  4E3S A;  3ZSR A;  1QTM A;  1UA0 A;  2GBZ A;  4GVM A;  5KRT A;  1NJX A;  1L3T A;  4OGE A;  2D5R A;  3G0Z A;  3RWU A;  4KPY A;  1HQU A;  2X78 A;  4F3T A;  1BIS A;  3BGR A;  1ZYQ A;  1JLG A;  2YHA A;  1Y97 A;  4IG0 A;  3O3F A;  2NUB A;  3K5N A;  3QEV A;  3SPZ A;  4NYF A;  3QEW A;  3LP3 A;  4FJM A;  4E7L A;  4M3W A;  1C1C A;  3G10 A;  1EKE A;  4CJT A;  3HPO A;  3V9S A;  4FJX A;  2PYL A;  3ZT4 A;  5DK5 A;  2O4G A;  5KRS A;  3KLE A;  1RDC A;  1IH7 A;  1RBR A;  4AIL C;  2Y1I A;  1TAU A;  5JS2 A;  4FXD A;  4AHR A;  3K59 A;  3TAB A;  4J2E A;  1HQE A;  1N5Y A;  1IO2 A;  4CER A;  2G8W A;  2OZM A;  4N41 A;  4CJL A;  1CXU A;  1L3V A;  1J5O A;  1LW0 A;  1RDA A;  3HST B;  1C1B A;  3QIN A;  2A1R A;  4IFY A;  4LH4 A;  1BI4 B;  3U3Y A;  3M8Q A;  4B8A B;  1CZ9 A;  3RTV A;  1EET A;  3LPT A;  4FLX A;  4WE1 A;  4DQS A;  1XHZ A;  1LAW A;  4NCG A;  4F2R A;  2OZS A;  5DMR A;  1RT7 A;  3IRX A;  3OS2 A;  4I2P A;  2HB5 A;  4E1M A;  1C1A A;  4KHW A;  1HRH A;  4KHS A;  4DWI A;  3CQ8 A;  4PUO A;  1S9G A;  3F9K A;  3WNH A;  4KTQ A;  4M42 A;  1TK5 A;  3D0P A;  3NBP A;  4JS4 A;  4C8K A;  2X6S A;  3A2F A;  4TSX A;  2KW4 A;  2QXF A;  2E6M A;  1RT6 A;  4R5P A;  3AVA A;  1JL1 A;  2P5O A;  4DTU A;  1MU2 A;  1BIU A;  2OPP A;  4ID1 A;  4DSI A;  3O3H A;  4CGH A;  1ITG A;  1I39 A;  1JLF A;  1LWF A;  2F96 A;  1DTT A;  2JLE A;  3LP0 A;  3ZT1 A;  4CES A;  3OYA A;  4QCL A;  1D5A A;  3OYN A;  2KZM A;  2R7Y A;  1CXQ A;  3OYJ A;  2PY5 A;  2OPS A;  4FJL A;  1D8Y A;  4J2A A;  4PWD A;  4CFB A;  3KD1 E;  2DTU A;  4F8R A;  1VSJ A;  3AO2 A;  1ASW A;  3ZSW A;  4RW8 A;  4CEZ A;  4FK2 A;  1SL0 A;  3CYM A;  3AVN A;  3NFA A;  1RTD A;  4J2D A;  2HHV A;  2EX3 A;  4KO0 A;  3SI6 A;  1LAV A;  1IKW A;  3AA5 X;  3VQP A;  1HNI A;  5KI6 A;  5T7B A;  4W5T A;  1S1V A;  1N6Q A;  2AJQ A;  1TGO A;  3AVM A;  4DSK A;  3D45 A;  1S5J A;  4FZY A;  1BCM A;  4OLB A;  5KGX A;  1JLB A;  3AV9 A;  3MXM A;  4LSL A;  3KK2 A;  4FK4 A;  3PX4 A;  3DRR A;  4B3O A;  4M3R A;  3ZT3 A;  3V9U A;  4Z4I A;  4CJK A;  3AVF A;  4FLV A;  3OYI A;  1X9M A;  1QSS A;  1RT3 A;  1LWC A;  3KK3 A;  2E6L A;  3HVR A;  1WSI A;  1A5X A;  3KJV A;  1S1U A;  4FLT A;  2IGI A;  4O0I A;  4E1N A;  2YKM A;  2W42 A;  1HMV A;  4K8Z A;  1GOC A;  4CHQ A;  3I8D A;  1RDB A;  1WN7 A;  1JXB A;  3KLI A;  1HJR A;  3LAK A;  4CF9 A;  4Z4G A;  3PV8 A;  1NJY A;  5C24 A;  4E7K A;  3NGZ A;  3MXI A;  3PO5 A;  3QEI A;  3TAQ A;  3VN5 A;  1RT5 A;  1JLC A;  3RRG A;  3OYD A;  4FJH A;  4N76 A;  1CLQ A;  1WSE A;  2D0B A;  3LAM A;  3SUN A;  4C8L A;  3SPY A;  3QIP A;  3L3U A;  1QHT A;  3NF8 A;  3AO3 A;  4HVJ A;  3TAF A;  4NYN A;  1TK0 A;  2HND A;  3L8B A;  2XY8 A;  4FJG A;  4KI4 A;  4CGG A;  2QK9 A;  4CFD A;  3WNF A;  1D9F A;  3ZSY A;  4I9Q A;  4FM2 A;  2OPQ A;  3PO4 A;  4ELT A;  1G15 A;  1SKW A;  2P51 A;  3EY1 A;  4DTM A;  5HLF A;  2HHS A;  4BDP A;  4ID5 A;  4HCC A;  1XC9 A;  3NGY A;  1K6Y A;  1J9A A;  3VQB A;  1S1T A;  2Z1H A;  2G8F A;  1BI4 A;  5KGW A;  3OJU A;  3L2V A;  4CF0 A;  1VSH A;  4BWM A;  2VG5 A;  4DSF A;  3DOK A;  4CCH A;  2XY7 A;  2FBV A;  1KVA A;  4M3U A;  4E7J A;  4CFC A;  2YNF A;  3TAG A;  3AVI A;  3QER A;  4C8O A;  4DLG A;  4W5R A;  2XY5 A;  4O4G A;  4DTR A;  3CFP A;  4KHU A;  2ITG A;  3OS1 A;  3SCX A;  4BDY A;  4BE1 A;  1B92 A;  1R0A A;  4CHN A;  1WLJ A;  1JXE A;  4B08 A;  4KKO A;  4FCY A;  3T3F A;  3LZJ A;  1VRT A;  1ASU A;  3KD5 E;  3TAE A;  4N56 A;  4DFP A;  2JGU A;  3TWH A;  4E0D A;  3VA0 A;  1VSF A;  2DFH A;  2O4I A;  4DU1 A;  4ZTF A;  4JRP A;  1KLM A;  1J53 A;  4H4O A;  3V1O A;  2DFE A;  3C95 A;  1YTA A;  2LSN A;  4GMJ B;  4LSN A;  4IKF A;  2KFZ A;  4PY5 A;  2KFN A;  1RT4 A;  1UA1 A;  4I9L A;  3EYZ A;  3QEX A;  1HPZ A;  1RBT A;  3P5J A;  1SKR A;  1IG9 A;  1Z26 A;  4Z0U A;  1EX4 A;  4C8M A;  5CY4 A;  1VSK A;  3LDS A;  4M3Y A;  4W5N A;  1WSH A;  3VQ9 A;  3HPG A;  3L2R A;  3TAP A;  1YT3 A;  4MQ3 A;  4Y1D A;  1L5U A;  4N5S A;  3RMC A;  4CHP A;  3NH1 A;  2X6N A;  1XHX A;  1NOZ A;  3PUF A;  5EU7 A;  3OYL A;  3EZ5 A;  4DS5 A;  4F3O A;  1FXX A;  4ZHR A;  3LP1 A;  1UOC A;  4W5Q A;  4Q5V A;  1QQC A;  3V9W A;  1ZBL A;  1NK9 A;  4KHY A;  3ALY A;  3VQ8 A;  3SZ2 A;  2DY4 A;  1TKT A;  2XRI A;  3VQ7 A;  3VQQ A;  1L3U A;  4OKE A;  4DF8 A;  4FM1 A;  5D3G A;  3DLG A;  4KV8 A;  4UQG A;  4DG1 A;  1T05 A;  4DSE A;  4CF1 A;  4CGJ A;  4FVM A;  4CGI A;  3K5L A;  4B8C A;  3OVN A;  4CHO A;  4PQU A;  4OPJ A;  1RIL A;  2B4J A;  5HRN A;  3OYF A;  4XIU A;  4CJ4 A;  3MXJ A;  3TAR A;  1TL1 A;  4BWJ A;  1ASV A;  2RN2 A;  1S9E A;  1FKP A;  4PA1 A;  3U3G A;  4Z4C A;  3ISN C;  4W5O A;  3KIO A;  4FJI A;  4FLW A;  4JRQ A;  4E7I A;  3M8S A;  1Q9X A;  2HHU A;  1S6P A;  4FK0 A;  5J2M A;  1ZBI A;  2GUI A;  3SUO A;  2BGG A;  4KRE A;  1VSM A;  3MEE A;  4LD0 A;  3CM6 A;  1NK4 A;  3HO1 A;  3KKS A;  4CIF A;  3VQ6 A;  4RW7 A;  3QIO A;  1BHL A;  3KLH A;  2XY6 A;  2HVH A;  3VQ5 A;  4DQP A;  1BQM A;  3THV A;  3L2W A;  1WSJ A;  5J2N A;  1ZBU A;  3NHG A;  4Y1C A;  1TKX A;  4L8R B;  5I3U A;  1QS4 A;  4DLE A;  4FW1 A;  4G1Q A;  3RR8 A;  3VQ4 A;  1RBS A;  4CHZ A;  4CJS A;  1RDD A;  4CF8 A;  1B9D A;  4DTN A;  3RMB A;  4DSL A;  1TV6 A;  3AVC A;  3I0S A;  1ZBF A;  4CK1 A;  3U6F A;  3E01 A;  2G8K A;  1IKY A;  3ASM A;  4M45 A;  1SL1 A;  1RT2 A;  3O3G A;  4CJP A;  4B9S A;  2X74 A;  1RTH A;  3NAE A;  1DLO A;  1WNS A;  3HJF A;  4CGD A;  3F73 A;  2FBY A;  4FLY A;  1WAF A;  3IS9 A;  4N47 A;  2FBT A;  1NKC A;  1TAQ A;  1VSE A;  1W0H A;  4O0J A;  3CG7 A;  3LZI A;  4JS5 A;  4DTX A;  3QET A;  1RTI A;  2FBX A;  3PX6 A;  4FJ7 A;  4Z4E A;  4OPK A;  3IAY A;  2VWJ A;  4KI6 A;  1C0U A;  4DQQ A;  3V1Q A;  1X1P A;  3K2P A;  2D0A A;  2YNH A;  4AHV A;  3VQC A;  3NGI A;  5KTQ A;  3C94 A;  2KQ2 A;  3V4I A;  3LWM A;  3JSM A;  4FJ5 A;  3H08 A;  2IC3 A;  1NK0 A;  3TAN A;  4RW6 A;  1LW2 A;  2RKI A;  3AVG A;  1KTQ A;  1VRU A;  3DLR A;  1X9W A;  2GV9 A;  4HHT A;  4HUG A;  1NJW A;  1UWB A;  2RPI A;  4CE9 A;  4CHY A;  3TI0 A;  2OYQ A;  3OJS A;  3AVB A;  1NJZ A;  1KFD A;  3LP2 A;  2PZS A;  2ZE2 A;  1JLA A;  4M3X A;  1KRP A;  1U4B A;  3PX0 A;  4CIG A;  1NKB A;  1T8E A;  1HNV A;  4CEC A;  1NK8 A;  2IAJ A;  3V81 A;  3B6P A;  4IBN A;  4CJU A;  1ZBH A;  3P83 D;  1F21 A;  2ZD1 A;  5C25 A;  3HK2 A;  3ZT0 A;  4KB1 A;  4DQR A;  5I42 A;  1KCF A;  3V6D A;  3HXM A;  1QE1 A;  3OYB A;  1Q9Y A;  5SZT A;  2HHX A;  4OLA A;  3ZSZ A;  2Z1G A;  4DFJ A;  2YHB A;  3HP6 A;  3HT3 A;  3KLG A;  3KLF A;  4CEB A;  4BE0 A;  4IG3 A;  1S1W A;  3QEP A;  4DTO A;  3DI6 A;  4DMN A;  1BL3 A;  5E41 A;  5J1E A;  1BCO A;  2QKK A;  4AH9 A;  3AO1 A;  2DFF A;  2F8T A;  1REV A;  4OGC A;  3CM5 A;  3AO4 A;  3CFO A;  2BAN A;  1RBU A;  3HYF A;  1JL2 A;  2QKB A;  4M3T A;  3LAN A;  2G8I A;  4OVL A;  2B6A A;  4DTJ A;  2G8U A;  4FJ8 A;  3SYZ A;  3UIQ A;  3FFI A;  4CFA A;  3O4Q A;  2ZQB A;  3AVK A;  4M3Z A;  3P1G A;  2Z1J A;  3AO5 A;  4GW6 A;  3S3N A;  2I5J A;  4KFB A;  2P5G A;  1Q8I A;  4LH5 A;  4CEO A;  1D9D A;  4HCB A;  1JLE A;  4H4M A;  1C0M A;  5HBM A;  4DS4 A;  4CJ3 A;  3KTQ A;  4FJN A;  1NOY A;  3AA4 A;  2ETJ A;  3HP9 A;  4EP4 A;  2KZZ A;  2A1S A;  4HUE A;  1BIZ A;  4FLU A;  4EZ6 A;  3AVH A;  4HTU A;  3V9Z A;  2P1J A;  2YNG A;  3L3V A;  5FDL A;  4CEE A;  4DFK A;  1NK6 A;  4BE2 A;  1A5W A;  1QSY A;  3RMD A;  5CZ1 A;  3SJJ A;  3OYM A;  4DU3 A;  3QLH A;  1SUQ A;  1TVR A;  4CJR A;  1KLN A;  4HUF A;  2VG6 A;  3DM2 A;  2YNI A;  2WOM A;  4AHC A;  3DRS A;  1SKS A;  3DLB A;  5HRO A;  3S3O A;  2XO7 A;  3RR7 A;  1RT1 A;  2Q3S A;  4FZX C;  4CEA A;  3LPU A;  5CYM A;  2KTQ A;  5K14 A;  4CED A;  3K58 A;  3TAM A;  1HYS A;  2F8S A;  3ZT2 A;  4CIE A;  4B9M A;  3NF7 A;  5FRM A;  3ZSO A;  2YV0 X;  3V9X A;  3PY8 A;  4LY7 A;  1A5V A;  3AVJ A;  4CJ5 A;  1UAX A;  4B9V A;  4KTZ A;  4RW4 A;  4NCB A;  4FW2 A;  4RW9 A;  2IDO A;  1JLQ A;  1HYV A;  4RG8 A;  3OY9 A;  3HM9 A;  1NK5 A;  1QSL A;  5JS1 A;  1U49 A;  3KKR A;  4OJR A;  3ZSV A;  4J2B A;  3SV3 A;  4BDZ A;  1YTU A;  1WSF A;  4DSJ A;  2IS3 A;  1GOA A;  4FLZ A;  4Z4F A;  4ZTJ A;  2OA8 A;  4BAC A;  5HRP A;  4KAZ A;  2HHW A;  4H8K A;  2WON A;  3HVT A;  1LV5 A;  3NDK A;  3VQA A;  5CYQ A;  4CJF A;  3OYC A;  1XWL A;  4IFV A;  1VSI A;  4ICL A;  1HYZ A;  3T1A A;  3QO9 A;  5SWM A;  1U48 A;  1TL3 A;  2D0C A;  4O55 A;  3AA2 A;  1FKO A;  1VSL A;  4DQI A;  1L3S A;  2YKN A;  1IKV A;  3WNG A;  2VG7 A;  4EP5 A;  5HP1 A;  2G8V A;  3NF6 A;  5FRN A;  3RRH A;  4KHN A;  5CZ2 A;  4OKK A;  4CEQ A;  2Y1J A;  2IOC A;  2HW3 A;  4DTS A;  3SNN A;  1NK7 A;  1X9S A;  3MEG A;  3HPH A;  4NCA A;  2E4L A;  4I7F A;  3LAL A;  4O44 A;  1WAJ A;  4CGF A;  3M8R A;  5FRO A;  3ULD A;  4DF4 A;  3SQ0 A;  4I2Q A;  1C0T A;  5J2P A;  3DMJ A;  2HNZ A;  4M41 A;  3K57 A;  1JKH A;  4FJK A;  4F2S A;  4CJQ A;  3WNE A;  4JLH A;  2B5J A;  3NE6 A;  4F4K A;  2EHG A;  4K8X A;  1KVB A;  1RNH A;  1YVU A;  2G8H A;  4B9U A;  1EXQ A;  3NCI A;  4OKJ A;  3S9H A;  3NH0 A;  4B9N A;  3S3M A;  3K5O A;  1U04 A;  4KTW A;  4EZ9 A;  4C8N A;  3RMA A;  1C6V A;  4FM0 A;  3I0R A;  2ATQ A;  3C6T A;  4E19 A;  3C6U A;  1NKE A;  3MAQ A;  1IKX A;  3HL8 A;  3SUP A;  4KRF A;  1BQN A;  3QNN A;  3JYT A;  2HMI A;  1SV5 A;  3ITH A;  5J2Q A;  3SQ1 A;  1BGX T;  4MFB A;  3L2U A;  3SUQ A;  1WSG A;  4KHQ A;  3LWL A;  2HHT A;  1CZB A;  3NF9 A;  3TR8 A;  4YNQ A;  4CJW A;  3OYG A;  4E7H A;  4KB0 A;  1KSP A;  1TK8 A;  3DRP A;  4ELV A;  3IG1 A;  4DFM A;  4YFU A;  3OYH A;  4Z4H A;  1O1W A;  5HRR A;  3VA3 A;  4AHS A;  4B9T A;  3VQD A;  3QES A;  3ZSQ A;  1GOB A;  2BDP A;  4CK3 A;  1DTQ A;  4B9L A;  1SL2 A;  3V1R A;  1U45 A;  4CJE A;  4FZZ A;  1TKZ A;  1KVC A;  3DYA A;  4CJV A;  2RF2 A;  1W9H A;  1Z25 A;  4CEF A;  3OS0 A;  1I3A A;  3MED A;  3KK1 A;  2PYJ A;  4CK2 A;  3SQ4 A;  1EP4 A;  1FK9 A;  1RCH A;  1RTJ A;  2OPR A;  3DLE A;  3DOL A;  4E89 A;  4IDK A;  5HRS A;  1T7P A;  4FJJ A;  4ELU A;  1RBV A;  3DLK A;  4O5B A;  2HVI A;  3M8P A;  1J54 A;  3BDP A;  2BE2 A;  2Z1I A;  3SV4 A;  1VSD A;  1S1X A;  4CF2 A;  3ZCM A;  5C42 A;  4FYD A;  3AA3 A;  1LWE A;  4DU4 A;  3SQ2 A;  3VQE A;  2FC0 A;  1S6Q A;  3CFR A;  4QAG A;  3MEC A;  4FJ9 A;  3QNO A;  2XHB A;  2HNY A;  1TKD A;  3DLH A;  3B6O A; 
#chains in the Genus database with same CATH topology
 4AHU A;  3OYK A;  4YDU A;  2QWP A;  3OYE A;  4Q0B A;  1B9F A;  2HHQ A;  3MK6 A;  1U47 A;  1QTM A;  4GVM A;  4MDA A;  4K25 A;  3RWU A;  4YHH K;  1ZYQ A;  4IG0 A;  2YHA A;  4FJM A;  4M3W A;  4E7L A;  1N32 K;  3G10 A;  2PYL A;  4JEP A;  4AIL C;  1QQN A;  2UUB K;  4FXD A;  2VGM A;  2OZM A;  4N41 A;  4CJL A;  3J7Y P;  4IEE A;  3O4W A;  4B3T K;  2P9K A;  3QIN A;  2A1R A;  4IFY A;  4LH4 A;  1WUA A;  5AQM A;  5AQL A;  1EET A;  5TKY A;  4A5A A;  3IRX A;  4I2P A;  1WBD A;  3BUZ B;  4KHW A;  1NMN A;  4MO5 A;  4KHS A;  3CQ8 A;  3O9U A;  4PUO A;  1S9G A;  3WNH A;  3K0S A;  2P9P A;  2BTF A;  1TK5 A;  2X6S A;  4EIA A;  2E6M A;  1RT6 A;  5AZI B;  1DGK N;  1JL1 A;  2O8F B;  4O5F A;  1BIU A;  4DSI A;  3P38 A;  3O3H A;  5BPN A;  3VMF B;  1LWF A;  2F96 A;  1DTT A;  4IJA A;  3OYN A;  4O8K A;  2R7Y A;  1CXQ A;  3OYJ A;  4F8R A;  4NXN K;  5AQP A;  1BOT O;  2EX3 A;  1DEJ A;  1IKW A;  2AJQ A;  1XMQ K;  5KI6 A;  2NRZ A;  1S1V A;  3FLC O;  2E88 A;  2NRT A;  4FZY A;  1NWK A;  1JLB A;  3AV9 A;  3O08 A;  2DPN A;  3PX4 A;  3HTV A;  3DRR A;  3CQY A;  4EHT A;  4QS7 A;  3ZT3 A;  4Z4I A;  1A5X A;  2YKM A;  4C1N I;  3I8D A;  1RDB A;  3ULE A;  1WN7 A;  1JXB A;  5MLC Q;  4CF9 A;  4Z4G A;  1NJY A;  3NGZ A;  5KPT A;  3MXI A;  5JLH A;  3QEI A;  1CLQ A;  4N76 A;  3OYD A;  1WSE A;  2D0B A;  3A0I X;  3AO3 A;  4LF8 K;  3ENO A;  3L8B A;  5JMV A;  4FJG A;  2QK9 A;  4EAH D;  3DXK A;  4CFD A;  1D9F A;  3ZSY A;  1VHX A;  1JCG A;  1G99 A;  5HLF A;  4ID5 A;  4BQL A;  1V4S A;  1J9A A;  1ZC6 A;  1XNQ K;  3DXM B;  3D2F A;  4CF0 A;  3CXC M;  2P9S B;  2XY7 A;  4FOE A;  2VGN A;  2YCH A;  3AVI A;  3QER A;  1VQ7 N;  4W5R A;  2XY5 A;  3GG4 A;  2ITG A;  3WQT A;  1NU0 A;  4BE1 A;  1JXE A;  4B08 A;  4L3Q A;  3T3F A;  3PSF A;  3LZJ A;  3K9K A;  3VEN A;  2ZM6 K;  4DFP A;  2JGU A;  1VSF A;  3N4Q A;  4H4O A;  5BPL A;  4BR9 A;  1YTA A;  2LSN A;  4GMJ B;  2KKZ A;  2KFN A;  3O9R A;  1J5E K;  4IO8 A;  1SKR A;  1IG9 A;  3CJB A;  4Z0U A;  5CY4 A;  4JI3 K;  3MCA B;  4M3Y A;  3L2R A;  4IO9 L;  1YT3 A;  3VEO A;  3IMX A;  3RMC A;  5AQH A;  2X6N A;  1XHX A;  3FZK A;  2AA4 A;  4W5Q A;  1GLE G;  5ADX A;  1NK9 A;  1YXQ A;  4KHY A;  3SZ2 A;  1VQ8 N;  4DF8 A;  4OO1 J;  4CGJ A;  4FVM A;  4AF1 A;  3OVN A;  4PQU A;  1RIL A;  5HRN A;  3OYF A;  3O1W A;  4JHD B;  1ASV A;  2RN2 A;  1DT9 A;  4FLW A;  1Q9X A;  3M8S A;  1S6P A;  1ZBI A;  3SUO A;  2GWJ A;  4LF9 K;  1QZ5 A;  1VSM A;  4LD0 A;  3R9P A;  3HO1 A;  3BZK A;  4DV5 K;  3VQ6 A;  4UY8 O;  3W0L A;  1T3V A;  3KLH A;  1X9J A;  2XY6 A;  3VQ5 A;  1MDU B;  1ZBU A;  4L8R B;  5I3U A;  1RDU A;  4FW1 A;  4CJS A;  1GLD G;  1TV6 A;  5M1K A;  5ADX H;  4CK1 A;  3E01 A;  3DAW A;  5AJ3 K;  3L4I A;  3ASM A;  4M45 A;  1MWM A;  1NGJ A;  3G25 A;  5E26 A;  1SL1 A;  1K8K B;  1RT2 A;  3O3G A;  4BRA A;  1VQ6 N;  4FLY A;  4U7B A;  3HRG A;  1ATN A;  1VSE A;  4O0J A;  4JI4 K;  1RTI A;  1HNX K;  5FPE A;  4KI6 A;  1W7A A;  4DQQ A;  1NG9 A;  2ZGZ A;  1X1P A;  5TKW A;  2ZJR L;  4AHV A;  2VYP A;  5KTQ A;  2D0P A;  1GLA G;  2HBM A;  4RW6 A;  3AVG A;  2P9L A;  1KTQ A;  1FW6 A;  1MWK A;  4HHT A;  4HUG A;  1KC8 O;  1UWB A;  3TU5 A;  2OYQ A;  4K0K K;  4BC2 A;  3LP2 A;  2PZS A;  4M3X A;  1JLA A;  1KRP A;  5LJW A;  3LM2 A;  1U4B A;  2GTD A;  5B8H A;  1F21 A;  4KBO A;  4JV5 K;  1CZA N;  2OCE A;  3OYB A;  2HHX A;  1T44 A;  4OLA A;  2Z1G A;  3HP6 A;  3TPQ A;  2P9S A;  3QEP A;  3DI6 A;  1BL3 A;  4FWM A;  2F8T A;  3DXM A;  2DFF A;  3TSQ A;  2P9I A;  3SBG A;  3CFO A;  2BAN A;  1BG3 A;  2QA4 N;  3EN9 A;  2QKB A;  1QHA A;  2G8I A;  4BVP A;  4FJ8 A;  2Q31 A;  4CFA A;  2ZQB A;  3P1G A;  2Z1J A;  1MA9 B;  1NMD A;  3GL1 A;  4GW6 A;  3VF2 A;  4BRF A;  3S3N A;  2P5G A;  4OPH A;  4HCB A;  1JLE A;  2Q0R A;  3AA4 A;  2ETJ A;  3HP9 A;  3LDN A;  2IVN A;  4EP4 A;  3AVH A;  4DFK A;  3F9M A;  2HHH K;  5CZ1 A;  3OYM A;  4IFE A;  3HM8 A;  3QLH A;  3DJC A;  3VEZ A;  2VG6 A;  4CW7 B;  1XUP O;  1T6C A;  3S3O A;  2XO7 A;  5CYM A;  5K14 A;  4CED A;  3ZSO A;  2D1K A;  4CJ5 A;  4B9V A;  3A5O C;  1NBW A;  3JS6 A;  3NVM A;  2FSJ A;  1QSL A;  4RG8 A;  3OY9 A;  5JS1 A;  1U49 A;  3ENH A;  1HNZ K;  3ZSV A;  4J2B A;  3SV3 A;  4H0Y B;  3SAF A;  3SMS A;  4PL8 A;  4DSJ A;  3ZEU B;  4YOY A;  1E4G T;  4FLZ A;  4J8F A;  2HF4 A;  4ZTJ A;  3H3O B;  4FO0 A;  5M1Q A;  5LL6 Z;  3QFP A;  1XWL A;  5JVG L;  2P9N B;  1QQO A;  4DR7 K;  4XH5 A;  1IKV A;  2VG7 A;  5AQX A;  3C65 A;  4CZG A;  3NF6 A;  3DLL L;  5C12 A;  4BQZ A;  4DTS A;  2E1Y A;  3LAL A;  1WAJ A;  2WC9 A;  3ULD A;  4B1U B;  3SQ0 A;  4I2Q A;  5J2P A;  3DMJ A;  4M41 A;  3U9Z A;  1JKH A;  4F2S A;  3WNE A;  3SK3 A;  2ZJP L;  3UB5 A;  1R59 O;  2UXB K;  1KVB A;  1YVU A;  4BY9 C;  4B9N A;  3NCI A;  4OKJ A;  3S9H A;  3AY9 A;  4KTW A;  4C8N A;  4YY3 K;  3CCR N;  4FM0 A;  3U8X A;  3PIO L;  1YIT N;  4YOR A;  3HL8 A;  5F1X A;  5J2Q A;  3L2U A;  1WSG A;  3LWL A;  1QVF M;  2NNW A;  5BRD A;  4E7H A;  3WEE B;  4ELV A;  3IG1 A;  4DFM A;  2OTJ N;  4YFU A;  3OYH A;  4Z4H A;  1KAZ A;  1GOB A;  1VQM N;  3V1R A;  1NGG A;  4CJE A;  4H0O A;  3DYA A;  1Z25 A;  3OS0 A;  1I3A A;  2PYJ A;  3KK1 A;  2PAV A;  4CK2 A;  5FPD A;  1RCH A;  1FK9 A;  1RTJ A;  4CZH A;  2O8C A;  5HRS A;  3F2K A;  4IDK A;  5AQI A;  1RBV A;  3DLK A;  4O5B A;  1J54 A;  2E2P A;  3J7Z O;  2BE2 A;  2Z1I A;  3CCS N;  4PHT X;  3ZCM A;  1S6Q A;  2RHK A;  3CFR A;  3UE5 A;  2A41 A;  2QTD A;  1BA1 A;  3O1B A;  3QNO A;  2HNY A;  4ISF A;  3BF3 A;  4FWS A;  3L2Q A;  2VWK A;  3ZSX A;  3NH2 A;  3ZET A;  2YX6 A;  4DTP A;  1XI1 A;  1UA0 A;  5BR8 K;  1NJX A;  3G0Z A;  3H1Q A;  4KPY A;  3MMV A;  1JLG A;  1X9M A;  1Y97 A;  3QEV A;  1P8Z A;  3HPO A;  3V9S A;  3ZT4 A;  5KRS A;  1IH7 A;  5JS2 A;  4BRO A;  4AHR A;  4J2E A;  1VQ5 N;  5AQY A;  2G8W A;  4RCH A;  3G4S N;  4CZI A;  1J5O A;  1RDA A;  3HST B;  1BI4 B;  3QML A;  3VGK A;  3U3Y A;  2YI1 A;  1CZ9 A;  3DWL A;  4DCH A;  2V52 B;  1XHZ A;  4JYA K;  4ISE A;  2OZS A;  5DMR A;  3OS2 A;  3SLC A;  1VQL N;  4K42 A;  3WUH A;  3L4Q A;  5M1F A;  4M42 A;  4C8K A;  4JS4 A;  3R1X A;  2KW4 A;  5C2D A;  4FL9 A;  4R5P A;  2KLA A;  1MU2 A;  4DV6 K;  2OPP A;  1HR0 K;  3H3N O;  3CCM N;  4CGH A;  1ITG A;  3R8E A;  4QCL A;  5M1N A;  2PY5 A;  2YHW A;  4PWD A;  3KD1 E;  1ASW A;  4RW8 A;  1RTD A;  3CYM A;  4J2D A;  4NLB A;  1NGE A;  3L6Q A;  3QIC A;  4W5T A;  1HNI A;  1N6Q A;  1ESV A;  1K9M O;  3NVK A;  3AVM A;  5C15 A;  3D45 A;  4CVN E;  1BCM A;  3O6W A;  3T1H K;  4LSL A;  5AQV A;  2HMP A;  5M1P A;  4B3O A;  4CJK A;  3OYI A;  3KJV A;  4JKD A;  2E1Z A;  1P90 A;  4JI2 K;  2W42 A;  1GOC A;  4BGB A;  3CER A;  4CZK A;  3PV8 A;  4BC5 A;  4E7K A;  4ILG B;  2D4W A;  3RRG A;  4FJH A;  4IDH A;  4X66 K;  3LDQ A;  5LMU K;  4HVJ A;  2QWM A;  1K8K A;  4NYN A;  1TK0 A;  2HND A;  2GEL A;  4GV3 A;  2JWL A;  1HUX A;  3WNF A;  5M1O A;  4CZM A;  4FM2 A;  3EZW A;  3EY1 A;  4DTM A;  4GVE A;  2HHS A;  3VQB A;  3J81 O;  2G8F A;  1BI4 A;  5KGW A;  3OJU A;  3L2V A;  1VSH A;  4BWM A;  2VG5 A;  4E7J A;  3ULE B;  4ILH A;  4DLG A;  4IOX A;  3A5M C;  4BRC A;  1B92 A;  3JAM O;  5GAH P;  1YUW A;  2V7Z A;  2O8E A;  1ASU A;  2HF3 A;  3TAE A;  1S3X A;  1GLF O;  3CET A;  4ZTF A;  4JK8 A;  5EX5 A;  4BR5 A;  3AAQ A;  2KFZ A;  1IJJ A;  5C10 A;  2I7N A;  4C8M A;  3ZX3 A;  1VSK A;  3LDS A;  4W5N A;  4BR0 A;  2Q2R A;  3LL3 A;  4MQ3 A;  4GKK K;  3R3L A;  4DV7 K;  3NH1 A;  3PUF A;  1NGH A;  5EU7 A;  3RSE B;  3EZ5 A;  1FXX A;  3CPE A;  1QQC A;  3VQ8 A;  2DY4 A;  3VQ7 A;  2W6K A;  3TSP A;  1L3U A;  3CCQ N;  4OKE A;  5D3G A;  2O8C B;  4DG1 A;  4DSE A;  4CF1 A;  4WYB A;  5A2Q O;  4B8C A;  4JI7 K;  4OPJ A;  2B4J A;  4A62 A;  5AQU A;  2WTU A;  4PA1 A;  1FKP A;  3U3G A;  4Z4C A;  3ISN C;  4W5O A;  5BRE A;  3CC2 N;  4E7I A;  3MX2 A;  2HHU A;  3O9Q A;  5J2M A;  1QQM A;  3AGR A;  3CM6 A;  4JK7 A;  1BQM A;  1FJG K;  3L2W A;  1HX1 A;  4E1J A;  3NHG A;  5J2N A;  1TKX A;  3SJH A;  1TUU A;  4FWP A;  3VQ4 A;  1RBS A;  1RDD A;  4DSL A;  1HLU A;  5AQW A;  3AVC A;  3O5B A;  4DR3 K;  1ZBF A;  2G8K A;  2QWR A;  3OTO K;  4CD3 A;  4CZJ A;  4B1Y B;  2QXL A;  2X74 A;  3HJF A;  2FBY A;  2ASO A;  4N47 A;  4H0P A;  1VQP N;  5KQ8 A;  4GKJ K;  1TAQ A;  3QET A;  3CG7 A;  4Z4E A;  1C0U A;  2VWB A;  2YNH A;  4WFA L;  3VQC A;  3IFR A;  3EE8 A;  4ILJ A;  3V4I A;  3N4P A;  3LWM A;  1LW2 A;  5IWA K;  4A57 A;  3G6E N;  1HKB A;  2GV9 A;  3ZEU A;  1NJZ A;  1EQY A;  3AVB A;  3T1Y K;  1NKB A;  1T8E A;  4CEC A;  2IAJ A;  4AQY K;  4FSV A;  3V81 A;  3B6P A;  3CHW A;  4IBN A;  4BRI A;  4CJU A;  1ZBS A;  2QWN A;  3FZF A;  4WQ4 A;  5DM6 L;  1Q9Y A;  5SZT A;  4GV6 A;  4DFJ A;  3HT3 A;  3M5R A;  4BE0 A;  2IIR A;  1XNR K;  1S1W A;  4DMN A;  3QBX A;  5J1E A;  4AH9 A;  3AO1 A;  3LDL A;  3AO4 A;  3CC7 N;  4BRD A;  2F7T A;  2FXU A;  1BA0 A;  1RBU A;  5JLF A;  1GLC G;  4JI8 K;  4OVL A;  4DTJ A;  2Q0U A;  3SYZ A;  3UIQ A;  3FFI A;  4DUZ K;  3O4Q A;  4DUY K;  3AO5 A;  4KFB A;  4LH5 A;  3CPW M;  1IBM K;  2Q97 A;  5HBM A;  1C0M A;  4CJ3 A;  2P9K B;  3SMP A;  2A1S A;  2H3G X;  1VQK N;  2WBN A;  4CEE A;  1HNW K;  2D0O A;  3RMD A;  5FPN A;  1WOQ A;  1KLN A;  3B8A X;  2CGJ A;  4AHC A;  3DLB A;  2CGL A;  4YOT A;  4B1Z A;  3RR7 A;  4NLC A;  4B9Q A;  4CIE A;  1A5V A;  1UAX A;  4KTZ A;  4NCB A;  4YOW A;  4DR2 K;  5CE3 A;  2IDO A;  1JLQ A;  4JI0 K;  4OJR A;  5BN8 A;  4CZE A;  3OA9 A;  1NGF A;  2WON A;  3HVT A;  1KQS M;  3NDK A;  4CBW A;  5AQS A;  3OYC A;  4DR4 K;  1HYZ A;  4OPA A;  4CJ7 A;  4NO7 A;  3QO9 A;  3SAH A;  1U48 A;  4NB4 A;  4OX9 K;  2D0C A;  2FSN A;  3AA2 A;  3UKU B;  4DQI A;  2YKN A;  3WXI A;  5BN9 A;  3WNG A;  3MWT A;  5HOO A;  2G8V A;  3CCV N;  2Q36 A;  4KHN A;  4MDB A;  3SNN A;  1X9S A;  2NRX A;  4NCA A;  4I6M A;  4I7F A;  3M8R A;  3IKM A;  3NE6 A;  4NXM K;  1EXQ A;  3NH0 A;  1U04 A;  3KVG A;  2JWK A;  1WB9 A;  4KH5 A;  1C6V A;  3RMA A;  4DHY A;  3MAQ A;  1IBL K;  3JYT A;  2HMI A;  3CCE N;  1BGX T;  4MFB A;  3SUQ A;  3IUC A;  3M3Z A;  2HHT A;  5CHI A;  5EVZ A;  4YNQ A;  4CJW A;  4KB0 A;  1KSP A;  3MN9 A;  1TK8 A;  3CIP A;  3DRP A;  3D2F B;  1O1W A;  5ELZ A;  3VQD A;  2WFB A;  3MN7 A;  1LOT B;  4B9L A;  3VTH A;  4FZZ A;  3ZET B;  4JKB A;  4WQ5 A;  3UKR A;  4CEF A;  3DLE A;  2OPR A;  3DOL A;  4E89 A;  1T7P A;  2HVI A;  3SV4 A;  3J7A P;  3CF5 L;  3ENB A;  4FYD A;  3AA3 A;  3SQ2 A;  2FC0 A;  3GOI A;  3MEC A;  3VER A;  4BR4 A;  1OH8 A;  4DV3 K;  3ZYY X;  1TKD A;  3DLH A;  4H5R A;  4CJF A;  4MLH A;  4FPB A;  4QOZ B;  5GIN A;  2FF3 B;  4AHT A;  4RWT A;  3T19 A;  1D4X A;  3CCJ N;  2UXD K;  2GBZ A;  5KRT A;  1L3T A;  2D5R A;  1HQU A;  2X78 A;  3VEW A;  1BIS A;  4F3T A;  3A8Y A;  3O3F A;  2NUB A;  3K5N A;  4CI6 A;  4NYF A;  3VTI A;  4U67 L;  3WXK A;  2HST A;  3O9T A;  4FJX A;  4CJT A;  1EKE A;  2GUP A;  3D2E B;  1KAX A;  1U2V B;  3TAB A;  1IO2 A;  2YHY A;  1CXU A;  4I6M B;  1K8A O;  1LW0 A;  4FVU A;  1C1B A;  4A2B A;  4B8A B;  4IWV A;  3RTV A;  4QS8 A;  2O8B A;  4NCG A;  5AZI A;  4LF6 K;  5F2R A;  1OH5 A;  2UYT A;  3GE1 A;  1YJ9 N;  3BF1 A;  3NBP A;  3EKS A;  4TSX A;  3BY5 A;  5DM7 L;  3AVA A;  4JKC A;  4R79 A;  4ID1 A;  4A5B A;  1JJ2 M;  3ZT1 A;  1SZ2 A;  3LP0 A;  3FR0 A;  2V51 B;  3OYA A;  2KZM A;  1GLB G;  4FJL A;  2OPS A;  3GDQ A;  2DTU A;  2ZGY A;  1VSJ A;  5BRH A;  5KPR A;  4CEZ A;  4CZF A;  4FK2 A;  3AVN A;  1VQN N;  4KO0 A;  5T7B A;  4B3S K;  1TGO A;  4DSK A;  4OLB A;  1S5J A;  5LY3 A;  5KGX A;  5LJV A;  4X64 K;  2BH1 A;  3R6M A;  4PKI A;  3KK2 A;  4JI5 K;  5C2F A;  3V9U A;  3AVF A;  1QSS A;  1LWC A;  4M7Y A;  2E6L A;  1Z6R A;  4JK9 A;  1S1U A;  4FLT A;  3Q7C A;  4O0I A;  4E1N A;  1HMV A;  3CC4 N;  2EWS A;  4DV4 K;  1BUP A;  4CHQ A;  4JKF A;  3KLI A;  1HJR A;  4BGA A;  5C24 A;  3PO5 A;  3TAQ A;  3VN5 A;  5BR9 A;  4C8L A;  5IT9 O;  3SPY A;  3QIP A;  3L3U A;  1QHT A;  4BG9 A;  3TAF A;  1N36 K;  1JCF A;  2XY8 A;  4KI4 A;  4CGG A;  3D7E O;  3EEQ A;  4ELT A;  1SKW A;  3HI0 A;  5AQR A;  1XC9 A;  1K6Y A;  1S1T A;  2Z1H A;  2E2N A;  4EHU A;  4BRN A;  4DSF A;  5CR4 A;  3THY A;  3O80 A;  3MWP A;  2YNF A;  3TAG A;  1IBK K;  1OH6 A;  3A5L C;  4K43 A;  4DTR A;  3D2E A;  3OS1 A;  1S22 A;  2ASM A;  3ATV A;  4FWN A;  3VEV A;  4CHN A;  2OAN A;  4FCY A;  3I8B A;  1VRT A;  3QB0 A;  4FWR A;  4DV0 K;  4N56 A;  3VGM A;  3ATU A;  3I33 A;  3TWH A;  1SAZ A;  3VA0 A;  2DFH A;  2O4I A;  3MDQ A;  4DU1 A;  4LC9 B;  4KH6 A;  3E9L A;  4JRP A;  1J53 A;  3V1O A;  3C95 A;  4JNE A;  5KQD A;  1XMO K;  1U6Z A;  3THX B;  1UA1 A;  4I9L A;  1X3N A;  3MN5 A;  3EYZ A;  1RBT A;  3P5J A;  3O8M A;  1EX4 A;  3E9P A;  2QWO A;  3VQ9 A;  3P31 A;  3TAP A;  4Y1D A;  4MLE A;  5AZJ A;  5C0Y A;  3OYL A;  4F3O A;  4ZHR A;  3LP1 A;  1UOC A;  4Q5V A;  1YAG A;  3DXK B;  3ALY A;  3C7N B;  4B1W B;  4LF4 K;  4UQG A;  1T05 A;  1HKG A;  4CGI A;  2UXC K;  2P9L B;  3SBT A;  4XIU A;  4CJ4 A;  3MXJ A;  1TL1 A;  1Q81 O;  3GBT A;  1S9E A;  2O8D A;  4FJI A;  4FWK A;  5GAD P;  4Y0W A;  3MEE A;  1NK4 A;  4CIF A;  4DR6 K;  2F9W A;  5GAE P;  4DQP A;  3WEE A;  3THV A;  3E66 A;  1E3M A;  1QS4 A;  4CHZ A;  3I0S A;  4LFC K;  1NGB A;  1NNE A;  3KHY A;  1M90 O;  1IKY A;  4JKG A;  3KK7 A;  4CJP A;  4B9S A;  3NAE A;  4BRP A;  1WNS A;  3VES A;  3ZLJ A;  4CGD A;  3CQX A;  1WAF A;  3IS9 A;  4CZL A;  2YHX A;  3CJC A;  3ZX2 A;  2W41 A;  3EO3 A;  4PL7 A;  4DTX A;  3QBW A;  4JS5 A;  2FBX A;  4FJ7 A;  1YI2 N;  3V1Q A;  2D0A A;  3NGI A;  3C94 A;  2P9P B;  4K41 A;  4FJ5 A;  2O8D B;  2E8A A;  1NK0 A;  3TAN A;  4DV1 K;  3JXU A;  3C6A A;  1X9W A;  2F4V K;  2RPI A;  3TI0 A;  4CE9 A;  3A5N C;  4CHY A;  1TUY A;  3OJS A;  2ZJQ L;  1KFD A;  1NGI A;  2ZE2 A;  5AQT A;  2CH6 A;  4DR5 K;  1HNV A;  3AGK A;  5AFU H;  2PBD A;  4X62 K;  5AZJ B;  2ZD1 A;  3HK2 A;  5C25 A;  4KB1 A;  4B1X B;  1E4F T;  2GEM A;  1KCF A;  5I42 A;  3HXM A;  2A3Z A;  1QE1 A;  1KXP A;  4PKH A;  3ZSZ A;  2YHB A;  4IG3 A;  4DTO A;  1REV A;  3WXL A;  5AQN A;  2P9I B;  1LCU A;  1H1V A;  4M3T A;  3VEX A;  2B6A A;  2FF6 A;  4FWQ A;  2I5J A;  1Q8I A;  1D9D A;  4FJN A;  3KTQ A;  1VQ9 N;  1NOY A;  4HUE A;  3BP8 A;  4EZ6 A;  3V9Z A;  2P1J A;  2P9U B;  5FDL A;  4BE2 A;  1A5W A;  1QSY A;  4DU3 A;  3THX A;  5AQQ A;  1SUQ A;  1TVR A;  2VCP A;  4CJR A;  4FOI A;  4FPA A;  5BRF A;  4HUF A;  3DM2 A;  2YNI A;  3DRS A;  1SKS A;  5HRO A;  2OTL N;  3FFK B;  3HSC A;  1RT1 A;  2Q3S A;  4CEA A;  3LPU A;  3U4L A;  2KTQ A;  3K58 A;  1HYS A;  3TAM A;  3PIP L;  3L0Q A;  3ZT2 A;  3NF7 A;  2HBJ A;  5FRM A;  2YV0 X;  4LY7 A;  4H0T B;  4BRK A;  1EWQ A;  3HM9 A;  4JAX A;  5KPZ A;  1NK5 A;  2A5X A;  3TSU A;  1IG8 A;  3KKR A;  5GIP A;  1YTU A;  4MO4 A;  2IS3 A;  1GOA A;  4GV9 A;  4GNI A;  4Z4F A;  4KAZ A;  4BAC A;  5HRP A;  2HHW A;  1LV5 A;  5AQO A;  4IFV A;  4JKH A;  5GAG P;  1VSI A;  3I56 N;  1TYQ B;  5SWM A;  5F0X A;  2WUS A;  4O55 A;  4A59 A;  4QS9 A;  1FKO A;  2VQF K;  1L3S A;  5AQJ A;  1GLL O;  4EP5 A;  1OVQ A;  5AFU A;  2CH5 A;  5AQZ A;  5CZ2 A;  4OKK A;  1J6Z A;  2IOC A;  5H1S Q;  2HW3 A;  3MEG A;  3P4I A;  3HPH A;  3HOS A;  2E4L A;  4O44 A;  4CGF A;  3TTC A;  4DF4 A;  3FZL A;  1C0T A;  2E2O A;  2HNZ A;  3K57 A;  4CJQ A;  2FSK A;  3CD6 N;  4F4K A;  1RNH A;  4B9U A;  4CD1 A;  4WF9 L;  4B3M K;  3NMU A;  3M1F A;  4EZ9 A;  4JKA A;  3TTF A;  2ATQ A;  4E19 A;  3C6U A;  1IKX A;  3SUP A;  4KRF A;  1BQN A;  3MCP A;  3QNN A;  4BRE A;  3Q7B A;  1OKJ A;  1YHQ N;  3TR8 A;  2NRR A;  3CMA N;  3I55 N;  3CJ1 A;  1W97 L;  3VA3 A;  3K9J A;  4AHS A;  1YVN A;  3ZSQ A;  2BDP A;  4CBU A;  4CK3 A;  1DTQ A;  3HOT A;  1SL2 A;  1U45 A;  1TKZ A;  4CJV A;  5I9E B;  2RF2 A;  4AM7 A;  3MED A;  1ILY A;  4KH4 A;  5BPM A;  4ELU A;  3D6R A;  3BDP A;  1NGC A;  4CF2 A;  5AR0 A;  2QWL A;  3VQE A;  4FWO A;  4QAG A;  2E20 A;  3CI5 A;  1NJI O;  3OW2 M;  2XHB A;  1ATS A;  1XQS C;  1Q18 A;  1ZXO A;  1XC3 A;  3B6O A;  4BR7 A;  3AVL A;  1KFS A;  2UUC K;  1VK0 A;  3K5M A;  3PLA A;  3H1V X;  1T03 A;  3O4N A;  4E3S A;  3ZSR A;  4OGE A;  2VQE K;  3OBY A;  3BGR A;  4A61 A;  3SPZ A;  3QEW A;  3LP3 A;  1TYQ A;  1C1C A;  1Z05 A;  4IEI A;  4XH1 A;  5DK5 A;  2O4G A;  3KLE A;  1V4T A;  1RDC A;  1RBR A;  1TAU A;  2Y1I A;  1HPM A;  3K59 A;  1HQE A;  1N5Y A;  2P9U A;  3S41 A;  4CER A;  2FLO A;  1L3V A;  4C1N K;  2NRH A;  3ID6 A;  3KWI A;  3M8Q A;  3EKU A;  3SAG A;  2QM1 A;  3LPT A;  4FLX A;  4WE1 A;  4DQS A;  1LAW A;  4JN4 A;  4F2R A;  1RT7 A;  1EO1 A;  2HB5 A;  4E1M A;  1C1A A;  3WQU A;  1HRH A;  4DWI A;  4YOX A;  3F9K A;  4KTQ A;  1RGI A;  4DKW A;  2HBL A;  2KHO A;  4LF5 K;  4JI6 K;  3D0P A;  3A2F A;  4KHP K;  2QXF A;  1VQ4 N;  3RVC A;  4G9Z A;  2P5O A;  4DTU A;  3H46 O;  4PKG A;  1BO5 O;  4DB3 A;  1I39 A;  3MN6 A;  1JLF A;  2JLE A;  5EY4 A;  4CES A;  3KWG A;  1D5A A;  4J2A A;  1D8Y A;  4CFB A;  3AO2 A;  3THW B;  2HOE A;  3CCU N;  4DV2 K;  1I94 K;  3ZSW A;  3FGU A;  1SL0 A;  3NFA A;  2HHV A;  3SI6 A;  1LAV A;  3AA5 X;  3VQP A;  3G71 N;  2O8F A;  2P9N A;  4V19 S;  2UU9 K;  3FE1 A;  3MXM A;  4IZ9 A;  2GWK A;  3VET A;  4LFB K;  4FK4 A;  4M3R A;  1M1K O;  4JKE A;  4FLV A;  2V7Y A;  1RT3 A;  3THW A;  3KK3 A;  3HVR A;  3T69 A;  1WSI A;  2IGI A;  4K8Z A;  1OVY A;  3BEX A;  3LAK A;  5GIO A;  1RT5 A;  1JLC A;  3HBT A;  3LAM A;  3SUN A;  3MX5 A;  3NF8 A;  1Q7Y O;  4JKG B;  3EL2 A;  3OHR A;  4YOV A;  2A40 A;  3UKU A;  1K73 O;  1Y64 A;  4I9Q A;  2F9T A;  2OPQ A;  3PO4 A;  1G15 A;  1RDW X;  2P51 A;  4IOC L;  4BDP A;  4HCC A;  3NGY A;  4DR1 K;  4LFA K;  1C0F A;  2A42 A;  2O8E B;  4CCH A;  3DOK A;  4H03 B;  2FBV A;  1KVA A;  4M3U A;  2ITM A;  4CFC A;  3E1Y A;  4C8O A;  3WXM B;  3IDH A;  1X3M A;  4O4G A;  3CFP A;  4KHU A;  3SCX A;  4BDY A;  1R0A A;  3LM9 A;  1WLJ A;  4KKO A;  4BRL A;  5E84 A;  4JD2 B;  4H5T A;  3KD5 E;  1NLV A;  3P39 A;  4E0D A;  3C6H A;  4FWL A;  2HBK A;  3O9S A;  1SS6 A;  1KLM A;  4BC4 A;  1GLJ O;  2DFE A;  4HTL A;  4LSN A;  4IKF A;  2NRW A;  4WCE L;  4PY5 A;  1YF5 L;  1RT4 A;  2O8B B;  3QEX A;  1HPZ A;  2ZF5 O;  1QVG M;  1Z26 A;  1EWR A;  3H45 C;  5FPM A;  1WSH A;  2QW9 A;  3HPG A;  1L5U A;  4N5S A;  4CHP A;  1NOZ A;  4DS5 A;  3VGL A;  3VPZ A;  1U2V A;  1ZBL A;  3V9W A;  5AQK A;  3QFU A;  1TKT A;  2XRI A;  3VQQ A;  4FM1 A;  3E9O A;  3DLG A;  4KV8 A;  3VF6 A;  3PSI A;  3K5L A;  4CHO A;  3WT0 A;  3CME N;  3KZB A;  2GX9 A;  3TAR A;  4BWJ A;  3FZH A;  3KIO A;  3C0B A;  4JRQ A;  2W40 A;  1NM1 A;  4FK0 A;  2GUI A;  4KRE A;  2BGG A;  3KKS A;  4RW7 A;  3QIO A;  1BU6 O;  1BHL A;  2HVH A;  4JHD A;  1WSJ A;  4Y1C A;  1YJN N;  3EE9 A;  4DLE A;  2QWQ A;  3RR8 A;  4G1Q A;  3J80 O;  4X65 K;  4DTN A;  3RMB A;  4CF8 A;  1B9D A;  1QZ6 A;  3U6F A;  4AM6 A;  2E5L K;  4EFH A;  2YJE A;  5AQF A;  4BRQ A;  4BR2 A;  4Z94 A;  1RTH A;  1DLO A;  3F73 A;  5FLX O;  3CCL N;  2FBT A;  1NKC A;  1NGD A;  1KD1 O;  1W0H A;  3LZI A;  3PX6 A;  4OPK A;  3THY B;  2VWJ A;  3IAY A;  2PFU A;  3K2P A;  2CGK A;  1Q82 O;  4WFN L;  2QEX N;  1RFQ A;  4BVO A;  1Q86 O;  2KQ2 A;  4BG8 A;  3LDO A;  3JSM A;  3H08 A;  2IC3 A;  3FZM A;  1OH7 A;  2RKI A;  3VF4 A;  1VRU A;  3DLR A;  4ISG A;  1NJW A;  1HKC A;  3LDP A;  2ASP A;  4H5W A;  1N8R O;  3W3D A;  3PX0 A;  4B3R K;  4CIG A;  2UUA K;  4JD2 A;  2E2Q A;  1HJO A;  4BRM A;  1NK8 A;  3VOV A;  1ZBH A;  3P83 D;  4HWI A;  4IJN A;  3ZT0 A;  4DQR A;  3V6D A;  5EXW A;  4DQ8 A;  4JI1 K;  5EOY A;  3KLG A;  3KLF A;  4CEB A;  1N34 K;  4WQ5 C;  5E41 A;  1BCO A;  2QKK A;  5AQG A;  4OGC A;  2YJF A;  3CM5 A;  3HYF A;  1JL2 A;  3LAN A;  1T6D A;  2G8U A;  2A6A A;  1JCE A;  3AVK A;  4M3Z A;  2Q1N A;  4CEO A;  4H4M A;  4DS4 A;  4IOA L;  3CJ9 A;  3CJ7 A;  2KZZ A;  1BIZ A;  4FLU A;  4HTU A;  1NK6 A;  2YNG A;  3L3V A;  4H5N A;  1S72 N;  3H6E A;  1VQO N;  5LMN K;  3SJJ A;  4GY2 B;  1C0G A;  1VAZ A;  1W2B M;  3U9D A;  4LF7 K;  2WOM A;  2ZWH A;  4XEI A;  4YDU C;  4FZX C;  1YIJ N;  2QI2 A;  2F8S A;  4BRG A;  4B9M A;  3V9X A;  3PY8 A;  4BRH A;  3AVJ A;  1DKG D;  4RW4 A;  4FW2 A;  4RW9 A;  1HYV A;  2W6L A;  2NZT A;  3WXJ A;  4BDZ A;  4BC3 A;  4XH4 A;  2J4R A;  1WSF A;  4H5V A;  4B1V A;  5JIC A;  4CBX A;  2OA8 A;  4H8K A;  4WQ4 C;  4H0V B;  2NLX A;  3VQA A;  4M63 C;  5CYQ A;  3T7Z A;  1IV0 A;  1YJW N;  4ICL A;  3J8A A;  3C7N A;  3T1A A;  1SQK A;  4WFB L;  1TL3 A;  1VSL A;  3ZX0 A;  4A2A A;  5HL7 L;  5HP1 A;  4M7X A;  5FRN A;  4O8U A;  3RRH A;  4CEQ A;  2Y1J A;  1NK7 A;  1O13 A;  1KAY A;  4RTF D;  5FRO A;  3HZ6 A;  4FJK A;  5JVH L;  3M6G A;  4JLH A;  2B5J A;  2EHG A;  4K8X A;  2AP1 A;  2G8H A;  1WBB A;  3S3M A;  3K5O A;  3AAR A;  3I0R A;  3C6T A;  3BZC A;  1NKE A;  1NGA A;  3CJA A;  1SV5 A;  1BDG A;  3ITH A;  3SQ1 A;  4KHQ A;  1CZB A;  3NF9 A;  1BWF O;  3OYG A;  3RSE A;  4IXC A;  2I7P A;  5HRR A;  4B9T A;  3F5T A;  3QES A;  1ATR A;  4H0X B;  1KVC A;  1W9H A;  2IVO A;  4C23 A;  1EP4 A;  3SQ4 A;  4FJJ A;  3TTD A;  2IVP A;  3M8P A;  3ID8 A;  3QDK A;  1VSD A;  1S1X A;  5C42 A;  1LWE A;  4DU4 A;  3AAP A;  1N33 K;  4YOU A;  2NRV A;  3UKR B;  2BUP A;  3OBW A;  4FJ9 A;  2RE2 A;  3VEY A;  4F9O A; 
#chains in the Genus database with same CATH homology
 4AHU A;  2VWK A;  3OYK A;  3L2Q A;  3ZSX A;  3AVL A;  3NH2 A;  1KFS A;  1VK0 A;  3OYE A;  4Q0B A;  3K5M A;  1B9F A;  4QOZ B;  2HHQ A;  4DTP A;  1XI1 A;  4AHT A;  1T03 A;  1U47 A;  3T19 A;  3O4N A;  4E3S A;  3ZSR A;  1QTM A;  1UA0 A;  2GBZ A;  4GVM A;  5KRT A;  1NJX A;  1L3T A;  4OGE A;  2D5R A;  3G0Z A;  3RWU A;  4KPY A;  1HQU A;  2X78 A;  4F3T A;  1BIS A;  3BGR A;  1ZYQ A;  1JLG A;  2YHA A;  1Y97 A;  4IG0 A;  3O3F A;  2NUB A;  3K5N A;  3QEV A;  3SPZ A;  4NYF A;  3QEW A;  3LP3 A;  4FJM A;  4E7L A;  4M3W A;  1C1C A;  3G10 A;  1EKE A;  4CJT A;  3HPO A;  3V9S A;  4FJX A;  2PYL A;  3ZT4 A;  5DK5 A;  2O4G A;  5KRS A;  3KLE A;  1RDC A;  1IH7 A;  1RBR A;  4AIL C;  2Y1I A;  1TAU A;  5JS2 A;  4FXD A;  4AHR A;  3K59 A;  3TAB A;  4J2E A;  1HQE A;  1N5Y A;  1IO2 A;  4CER A;  2G8W A;  2OZM A;  4N41 A;  4CJL A;  1CXU A;  1L3V A;  1J5O A;  1LW0 A;  1RDA A;  3HST B;  1C1B A;  3QIN A;  2A1R A;  4IFY A;  4LH4 A;  1BI4 B;  3U3Y A;  3M8Q A;  4B8A B;  1CZ9 A;  3RTV A;  1EET A;  3LPT A;  4FLX A;  4WE1 A;  4DQS A;  1XHZ A;  1LAW A;  4NCG A;  4F2R A;  2OZS A;  5DMR A;  1RT7 A;  3IRX A;  3OS2 A;  4I2P A;  2HB5 A;  4E1M A;  1C1A A;  4KHW A;  1HRH A;  4KHS A;  4DWI A;  3CQ8 A;  4PUO A;  1S9G A;  3F9K A;  3WNH A;  4KTQ A;  4M42 A;  1TK5 A;  3D0P A;  3NBP A;  4JS4 A;  4C8K A;  2X6S A;  3A2F A;  4TSX A;  2KW4 A;  2QXF A;  2E6M A;  1RT6 A;  4R5P A;  3AVA A;  1JL1 A;  2P5O A;  4DTU A;  1MU2 A;  1BIU A;  2OPP A;  4ID1 A;  4DSI A;  3O3H A;  4CGH A;  1ITG A;  1I39 A;  1JLF A;  1LWF A;  2F96 A;  1DTT A;  2JLE A;  3LP0 A;  3ZT1 A;  4CES A;  3OYA A;  4QCL A;  1D5A A;  3OYN A;  2KZM A;  2R7Y A;  1CXQ A;  3OYJ A;  2PY5 A;  2OPS A;  4FJL A;  1D8Y A;  4J2A A;  4PWD A;  4CFB A;  3KD1 E;  2DTU A;  4F8R A;  1VSJ A;  3AO2 A;  1ASW A;  3ZSW A;  4RW8 A;  4CEZ A;  4FK2 A;  1SL0 A;  3CYM A;  3AVN A;  3NFA A;  1RTD A;  4J2D A;  2HHV A;  2EX3 A;  4KO0 A;  3SI6 A;  1LAV A;  1IKW A;  3AA5 X;  3VQP A;  1HNI A;  5KI6 A;  5T7B A;  4W5T A;  1S1V A;  1N6Q A;  2AJQ A;  1TGO A;  3AVM A;  4DSK A;  3D45 A;  1S5J A;  4FZY A;  1BCM A;  4OLB A;  5KGX A;  1JLB A;  3AV9 A;  3MXM A;  4LSL A;  3KK2 A;  4FK4 A;  3PX4 A;  3DRR A;  4B3O A;  4M3R A;  3ZT3 A;  3V9U A;  4Z4I A;  4CJK A;  3AVF A;  4FLV A;  3OYI A;  1X9M A;  1QSS A;  1RT3 A;  1LWC A;  3KK3 A;  2E6L A;  3HVR A;  1WSI A;  1A5X A;  3KJV A;  1S1U A;  4FLT A;  2IGI A;  4O0I A;  4E1N A;  2YKM A;  2W42 A;  1HMV A;  4K8Z A;  1GOC A;  4CHQ A;  3I8D A;  1RDB A;  1WN7 A;  1JXB A;  3KLI A;  1HJR A;  3LAK A;  4CF9 A;  4Z4G A;  3PV8 A;  1NJY A;  5C24 A;  4E7K A;  3NGZ A;  3MXI A;  3PO5 A;  3QEI A;  3TAQ A;  3VN5 A;  1RT5 A;  1JLC A;  3RRG A;  3OYD A;  4FJH A;  4N76 A;  1CLQ A;  1WSE A;  2D0B A;  3LAM A;  3SUN A;  4C8L A;  3SPY A;  3QIP A;  3L3U A;  1QHT A;  3NF8 A;  3AO3 A;  4HVJ A;  3TAF A;  4NYN A;  1TK0 A;  2HND A;  3L8B A;  2XY8 A;  4FJG A;  4KI4 A;  4CGG A;  2QK9 A;  4CFD A;  3WNF A;  1D9F A;  3ZSY A;  4I9Q A;  4FM2 A;  2OPQ A;  3PO4 A;  4ELT A;  1G15 A;  1SKW A;  2P51 A;  3EY1 A;  4DTM A;  5HLF A;  2HHS A;  4BDP A;  4ID5 A;  4HCC A;  1XC9 A;  3NGY A;  1K6Y A;  1J9A A;  3VQB A;  1S1T A;  2Z1H A;  2G8F A;  1BI4 A;  5KGW A;  3OJU A;  3L2V A;  4CF0 A;  1VSH A;  4BWM A;  2VG5 A;  4DSF A;  3DOK A;  4CCH A;  2XY7 A;  2FBV A;  1KVA A;  4M3U A;  4E7J A;  4CFC A;  2YNF A;  3TAG A;  3AVI A;  3QER A;  4C8O A;  4DLG A;  4W5R A;  2XY5 A;  4O4G A;  4DTR A;  3CFP A;  4KHU A;  2ITG A;  3OS1 A;  3SCX A;  4BDY A;  4BE1 A;  1B92 A;  1R0A A;  4CHN A;  1WLJ A;  1JXE A;  4B08 A;  4KKO A;  4FCY A;  3T3F A;  3LZJ A;  1VRT A;  1ASU A;  3KD5 E;  3TAE A;  4N56 A;  4DFP A;  2JGU A;  3TWH A;  4E0D A;  3VA0 A;  1VSF A;  2DFH A;  2O4I A;  4DU1 A;  4ZTF A;  4JRP A;  1KLM A;  1J53 A;  4H4O A;  3V1O A;  2DFE A;  3C95 A;  1YTA A;  2LSN A;  4GMJ B;  4LSN A;  4IKF A;  2KFZ A;  4PY5 A;  2KFN A;  1RT4 A;  1UA1 A;  4I9L A;  3EYZ A;  3QEX A;  1HPZ A;  1RBT A;  3P5J A;  1SKR A;  1IG9 A;  1Z26 A;  4Z0U A;  1EX4 A;  4C8M A;  5CY4 A;  1VSK A;  3LDS A;  4M3Y A;  4W5N A;  1WSH A;  3VQ9 A;  3HPG A;  3L2R A;  3TAP A;  1YT3 A;  4MQ3 A;  4Y1D A;  1L5U A;  4N5S A;  3RMC A;  4CHP A;  3NH1 A;  2X6N A;  1XHX A;  1NOZ A;  3PUF A;  5EU7 A;  3OYL A;  3EZ5 A;  4DS5 A;  4F3O A;  1FXX A;  4ZHR A;  3LP1 A;  1UOC A;  4W5Q A;  4Q5V A;  1QQC A;  3V9W A;  1ZBL A;  1NK9 A;  4KHY A;  3ALY A;  3VQ8 A;  3SZ2 A;  2DY4 A;  1TKT A;  2XRI A;  3VQ7 A;  3VQQ A;  1L3U A;  4OKE A;  4DF8 A;  4FM1 A;  5D3G A;  3DLG A;  4KV8 A;  4UQG A;  4DG1 A;  1T05 A;  4DSE A;  4CF1 A;  4CGJ A;  4FVM A;  4CGI A;  3K5L A;  4B8C A;  3OVN A;  4CHO A;  4PQU A;  4OPJ A;  1RIL A;  2B4J A;  5HRN A;  3OYF A;  4XIU A;  4CJ4 A;  3MXJ A;  3TAR A;  1TL1 A;  4BWJ A;  1ASV A;  2RN2 A;  1S9E A;  1FKP A;  4PA1 A;  3U3G A;  4Z4C A;  3ISN C;  4W5O A;  3KIO A;  4FJI A;  4FLW A;  4JRQ A;  4E7I A;  3M8S A;  1Q9X A;  2HHU A;  1S6P A;  4FK0 A;  5J2M A;  1ZBI A;  2GUI A;  3SUO A;  2BGG A;  4KRE A;  1VSM A;  3MEE A;  4LD0 A;  3CM6 A;  1NK4 A;  3HO1 A;  3KKS A;  4CIF A;  3VQ6 A;  4RW7 A;  3QIO A;  1BHL A;  3KLH A;  2XY6 A;  2HVH A;  3VQ5 A;  4DQP A;  1BQM A;  3THV A;  3L2W A;  1WSJ A;  5J2N A;  1ZBU A;  3NHG A;  4Y1C A;  1TKX A;  4L8R B;  5I3U A;  1QS4 A;  4DLE A;  4FW1 A;  4G1Q A;  3RR8 A;  3VQ4 A;  1RBS A;  4CHZ A;  4CJS A;  1RDD A;  4CF8 A;  1B9D A;  4DTN A;  3RMB A;  4DSL A;  1TV6 A;  3AVC A;  3I0S A;  1ZBF A;  4CK1 A;  3U6F A;  3E01 A;  2G8K A;  1IKY A;  3ASM A;  4M45 A;  1SL1 A;  1RT2 A;  3O3G A;  4CJP A;  4B9S A;  2X74 A;  1RTH A;  3NAE A;  1DLO A;  1WNS A;  3HJF A;  4CGD A;  3F73 A;  2FBY A;  4FLY A;  1WAF A;  3IS9 A;  4N47 A;  2FBT A;  1NKC A;  1TAQ A;  1VSE A;  1W0H A;  4O0J A;  3CG7 A;  3LZI A;  4JS5 A;  4DTX A;  3QET A;  1RTI A;  2FBX A;  3PX6 A;  4FJ7 A;  4Z4E A;  4OPK A;  3IAY A;  2VWJ A;  4KI6 A;  1C0U A;  4DQQ A;  3V1Q A;  1X1P A;  3K2P A;  2D0A A;  2YNH A;  4AHV A;  3VQC A;  3NGI A;  5KTQ A;  3C94 A;  2KQ2 A;  3V4I A;  3LWM A;  3JSM A;  4FJ5 A;  3H08 A;  2IC3 A;  1NK0 A;  3TAN A;  4RW6 A;  1LW2 A;  2RKI A;  3AVG A;  1KTQ A;  1VRU A;  3DLR A;  1X9W A;  2GV9 A;  4HHT A;  4HUG A;  1NJW A;  1UWB A;  2RPI A;  4CE9 A;  4CHY A;  3TI0 A;  2OYQ A;  3OJS A;  3AVB A;  1NJZ A;  1KFD A;  3LP2 A;  2PZS A;  2ZE2 A;  1JLA A;  4M3X A;  1KRP A;  1U4B A;  3PX0 A;  4CIG A;  1NKB A;  1T8E A;  1HNV A;  4CEC A;  1NK8 A;  2IAJ A;  3V81 A;  3B6P A;  4IBN A;  4CJU A;  1ZBH A;  3P83 D;  1F21 A;  2ZD1 A;  5C25 A;  3HK2 A;  3ZT0 A;  4KB1 A;  4DQR A;  5I42 A;  1KCF A;  3V6D A;  3HXM A;  1QE1 A;  3OYB A;  1Q9Y A;  5SZT A;  2HHX A;  4OLA A;  3ZSZ A;  2Z1G A;  4DFJ A;  2YHB A;  3HP6 A;  3HT3 A;  3KLG A;  3KLF A;  4CEB A;  4BE0 A;  4IG3 A;  1S1W A;  3QEP A;  4DTO A;  3DI6 A;  4DMN A;  1BL3 A;  5E41 A;  5J1E A;  1BCO A;  2QKK A;  4AH9 A;  3AO1 A;  2DFF A;  2F8T A;  1REV A;  4OGC A;  3CM5 A;  3AO4 A;  3CFO A;  2BAN A;  1RBU A;  3HYF A;  1JL2 A;  2QKB A;  4M3T A;  3LAN A;  2G8I A;  4OVL A;  2B6A A;  4DTJ A;  2G8U A;  4FJ8 A;  3SYZ A;  3UIQ A;  3FFI A;  4CFA A;  3O4Q A;  2ZQB A;  3AVK A;  4M3Z A;  3P1G A;  2Z1J A;  3AO5 A;  4GW6 A;  3S3N A;  2I5J A;  4KFB A;  2P5G A;  1Q8I A;  4LH5 A;  4CEO A;  1D9D A;  4HCB A;  1JLE A;  4H4M A;  1C0M A;  5HBM A;  4DS4 A;  4CJ3 A;  3KTQ A;  4FJN A;  1NOY A;  3AA4 A;  2ETJ A;  3HP9 A;  4EP4 A;  2KZZ A;  2A1S A;  4HUE A;  1BIZ A;  4FLU A;  4EZ6 A;  3AVH A;  4HTU A;  3V9Z A;  2P1J A;  2YNG A;  3L3V A;  5FDL A;  4CEE A;  4DFK A;  1NK6 A;  4BE2 A;  1A5W A;  1QSY A;  3RMD A;  5CZ1 A;  3SJJ A;  3OYM A;  4DU3 A;  3QLH A;  1SUQ A;  1TVR A;  4CJR A;  1KLN A;  4HUF A;  2VG6 A;  3DM2 A;  2YNI A;  2WOM A;  4AHC A;  3DRS A;  1SKS A;  3DLB A;  5HRO A;  3S3O A;  2XO7 A;  3RR7 A;  1RT1 A;  2Q3S A;  4FZX C;  4CEA A;  3LPU A;  5CYM A;  2KTQ A;  5K14 A;  4CED A;  3K58 A;  3TAM A;  1HYS A;  2F8S A;  3ZT2 A;  4CIE A;  4B9M A;  3NF7 A;  5FRM A;  3ZSO A;  2YV0 X;  3V9X A;  3PY8 A;  4LY7 A;  1A5V A;  3AVJ A;  4CJ5 A;  1UAX A;  4B9V A;  4KTZ A;  4RW4 A;  4NCB A;  4FW2 A;  4RW9 A;  2IDO A;  1JLQ A;  1HYV A;  4RG8 A;  3OY9 A;  3HM9 A;  1NK5 A;  1QSL A;  5JS1 A;  1U49 A;  3KKR A;  4OJR A;  3ZSV A;  4J2B A;  3SV3 A;  4BDZ A;  1YTU A;  1WSF A;  4DSJ A;  2IS3 A;  1GOA A;  4FLZ A;  4Z4F A;  4ZTJ A;  2OA8 A;  4BAC A;  5HRP A;  4KAZ A;  2HHW A;  4H8K A;  2WON A;  3HVT A;  1LV5 A;  3NDK A;  3VQA A;  5CYQ A;  4CJF A;  3OYC A;  1XWL A;  4IFV A;  1VSI A;  4ICL A;  1HYZ A;  3T1A A;  3QO9 A;  5SWM A;  1U48 A;  1TL3 A;  2D0C A;  4O55 A;  3AA2 A;  1FKO A;  1VSL A;  4DQI A;  1L3S A;  2YKN A;  1IKV A;  3WNG A;  2VG7 A;  4EP5 A;  5HP1 A;  2G8V A;  3NF6 A;  5FRN A;  3RRH A;  4KHN A;  5CZ2 A;  4OKK A;  4CEQ A;  2Y1J A;  2IOC A;  2HW3 A;  4DTS A;  3SNN A;  1NK7 A;  1X9S A;  3MEG A;  3HPH A;  4NCA A;  2E4L A;  4I7F A;  3LAL A;  4O44 A;  1WAJ A;  4CGF A;  3M8R A;  5FRO A;  3ULD A;  4DF4 A;  3SQ0 A;  4I2Q A;  1C0T A;  5J2P A;  3DMJ A;  2HNZ A;  4M41 A;  3K57 A;  1JKH A;  4FJK A;  4F2S A;  4CJQ A;  3WNE A;  4JLH A;  2B5J A;  3NE6 A;  4F4K A;  2EHG A;  4K8X A;  1KVB A;  1RNH A;  1YVU A;  2G8H A;  4B9U A;  1EXQ A;  3NCI A;  4OKJ A;  3S9H A;  3NH0 A;  4B9N A;  3S3M A;  3K5O A;  1U04 A;  4KTW A;  4EZ9 A;  4C8N A;  3RMA A;  1C6V A;  4FM0 A;  3I0R A;  2ATQ A;  3C6T A;  4E19 A;  3C6U A;  1NKE A;  3MAQ A;  1IKX A;  3HL8 A;  3SUP A;  4KRF A;  1BQN A;  3QNN A;  3JYT A;  2HMI A;  1SV5 A;  3ITH A;  5J2Q A;  3SQ1 A;  1BGX T;  4MFB A;  3L2U A;  3SUQ A;  1WSG A;  4KHQ A;  3LWL A;  2HHT A;  1CZB A;  3NF9 A;  3TR8 A;  4YNQ A;  4CJW A;  3OYG A;  4E7H A;  4KB0 A;  1KSP A;  1TK8 A;  3DRP A;  4ELV A;  3IG1 A;  4DFM A;  4YFU A;  3OYH A;  4Z4H A;  1O1W A;  5HRR A;  3VA3 A;  4AHS A;  4B9T A;  3VQD A;  3QES A;  3ZSQ A;  1GOB A;  2BDP A;  4CK3 A;  1DTQ A;  4B9L A;  1SL2 A;  3V1R A;  1U45 A;  4CJE A;  4FZZ A;  1TKZ A;  1KVC A;  3DYA A;  4CJV A;  2RF2 A;  1W9H A;  1Z25 A;  4CEF A;  3OS0 A;  1I3A A;  3MED A;  3KK1 A;  2PYJ A;  4CK2 A;  3SQ4 A;  1EP4 A;  1FK9 A;  1RCH A;  1RTJ A;  2OPR A;  3DLE A;  3DOL A;  4E89 A;  4IDK A;  5HRS A;  1T7P A;  4FJJ A;  4ELU A;  1RBV A;  3DLK A;  4O5B A;  2HVI A;  3M8P A;  1J54 A;  3BDP A;  2BE2 A;  2Z1I A;  3SV4 A;  1VSD A;  1S1X A;  4CF2 A;  3ZCM A;  5C42 A;  4FYD A;  3AA3 A;  1LWE A;  4DU4 A;  3SQ2 A;  3VQE A;  2FC0 A;  1S6Q A;  3CFR A;  4QAG A;  3MEC A;  4FJ9 A;  3QNO A;  2XHB A;  2HNY A;  1TKD A;  3DLH A;  3B6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...