4GVMA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
148
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTACWWAGIKQEFGIPYNPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
total genus 44
structure length 148
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gvmA00
4B9MA 3RMCA 4KTQA 2XY8A 3QEVA 4BDZA 4FLZA 1RDBA 3P1GA 1YVUA 4CFCA 5KGXA 2O4GA 4BDPA 4CEAA 3NH0A 3ZSVA 3HYFA 3DLRA 3VQ6A 1NKCA 1RTDA 5CZ2A 3VQBA 1N6QA 4CHNA 1C1CA 1LAWA 3OYHA 1Z25A 2P5OA 4M3ZA 3AA5X 1S1VA 4CJ3A 4CF0A 3K5MA 2G8UA 3AVKA 1U49A 3SYZA 1KCFA 1RBRA 3AVJA 4I7FA 4N56A 3OS1A 3PX0A 1KVAA 3EY1A 3AA3A 3TAFA 1SKSA 2XRIA 3MEGA 1ZBFA 2PY5A 4E0DA 1B9FA 1GOBA 3HVTA 1VRUA 3OYBA 2OZSA 3K5NA 1NK9A 3HK2A 4F3TA 4Q0BA 4OKEA 3AVCA 1BIZA 2ZE2A 2EHGA 2FBXA 3SV3A 2BDPA 1I3AA 3SV4A 2KZZA 1BCMA 1C0UA 3QEPA 3MAQA 1WSGA 1REVA 3C6UA 1TGOA 4HHTA 1B9DA 3WNGA 1RCHA 3V9SA 2QK9A 4E7JA 4PWDA 3PV8A 1JKHA 4BE0A 1BQNA 3AA4A 1TK0A 1HMVA 4IFYA 1C0MA 2X6SA 4ICLA 2JLEA 4N47A 1LWFA 4Z0UA 3L2WA 2KZMA 4CGHA 5HRPA 3LANA 3DLKA 4OPKA 4DF8A 3IS9A 3THVA 1XI1A 1YTAA 4AHUA 3DLHA 1LV5A 3QESA 4I9QA 3G0ZA 3OYIA 4FLYA 2FBTA 4CGFA 1RT6A 2PZSA 4RW6A 4I9LA 2FC0A 4KO0A 5HRRA 4B9TA 3LP2A 4DTNA 4DFJA 3SI6A 5DK5A 1J9AA 1VSHA 3HM9A 3LZJA 4CHPA 5KI6A 1RBSA 1BI4B 3ASMA 3CM5A 4R5PA 3OYDA 1NK8A 3TI0A 1NK0A 2PYJA 3OYMA 4DTXA 3VQDA 1RBVA 4AHTA 4CJWA 3VQ8A 1Q9XA 1CLQA 1RT7A 3D0PA 3RMDA 1U4BA 4KRFA 3MECA 3VA3A 3L3VA 3KLGA 1KRPA 2QKKA 2HHSA 3KD5E 3LPUA 4OKKA 1B92A 3OJUA 3EZ5A 4FW2A 3SJJA 4AHRA 2VG5A 1WSIA 4CERA 4DS5A 1TV6A 3WNHA 3L8BA 3U3YA 1EP4A 2GUIA 3HVRA 3ZSWA 4M3WA 1ASWA 3O4QA 2OPSA 2HHUA 4LH4A 1CZBA 3HPOA 4C8MA 2YNGA 4M41A 4FLUA 2KFNA 4FW1A 1N5YA 3RR8A 2F8TA 1BISA 4OLBA 3KK2A 4QCLA 4IKFA 4CHZA 4W5OA 1LWEA 4GVMA 3NF7A 2I5JA 4B08A 3K58A 3TWHA 4B9UA 4QOZB 4DFKA 4CK1A 4BE2A 4DQIA 3WNFA 4CESA 3JYTA 1WSEA 1QTMA 3TAMA 1KVCA 1L3TA 4OJRA 1RT5A 1BHLA 4F3OA 3C6TA 1NK6A 4PY5A 1W0HA 4FXDA 3ALYA 2GBZA 4FYDA 1JXBA 2YNIA 3SQ2A 4OPJA 4J2EA 3KKRA 4JRPA 4RG8A 4LD0A 1A5WA 2QXFA 2IC3A 4CGJA 3NF8A 4DTPA 3S3OA 1S1TA 4FLXA 1NJWA 4O5BA 3LWLA 3KIOA 3QIPA 3TANA 4ID1A 4CJQA 3ZT1A 2BE2A 4CHYA 3F73A 4FZYA 3NE6A 3OYNA 4CJ4A 3SUNA 4AH9A 2IOCA 4IDKA 1S5JA 3U6FA 2HVIA 3NF6A 1NK5A 1DTTA 4CJUA 1QSLA 3M8PA 4DTRA 2IAJA 3AO3A 3ZCMA 5J2QA 1O1WA 4W5TA 4B9VA 1SKRA 3OYFA 5KRSA 3QO9A 4Z4CA 1UA1A 4NCGA 4CK2A 1X9MA 4RW9A 4OLAA 3I8DA 4KHWA 2HHQA 2KQ2A 3AVLA 3DRSA 1HNIA 1VSIA 3VQPA 4CGIA 2P5GA 2OPQA 4FJ5A 1YT3A 4DSIA 2OPRA 4CJTA 3PY8A 2HHTA 2P51A 2KTQA 4FZZA 2WONA 3LP1A 3QIOA 4DTJA 1BL3A 1VK0A 1DLOA 3SQ4A 1L5UA 1NK4A 4JS5A 4FLTA 1BIUA 4O4GA 1HJRA 4J2BA 2DFHA 1HQEA 1S1WA 3NBPA 4LY7A 3TAGA 3MXMA 4G1QA 2RN2A 4DSFA 4M3RA 3RMBA 2F8SA 3V9WA 3V81A 3TABA 4NYFA 3RTVA 5EU7A 1D5AA 2XHBA 4DSKA 3HL8A 3B6PA 2PYLA 2YNHA 1LW2A 1RT1A 3AVHA 4BACA 1T7PA 1JXEA 3RR7A 3RWUA 2HNZA 3ZT3A 4B8AB 3VQ4A 2HMIA 3HO1A 2VG6A 1KLMA 4NYNA 3QEXA 1R0AA 3V6DA 3O3GA 4B3OA 4DS4A 3DLEA 3T1AA 3CG7A 1J53A 3ZSYA 3KLEA 4N76A 3DM2A 1KFDA 1GOCA 4CJKA 3S3MA 5KRTA 2DFFA 1UWBA 1C1BA 1WSJA 4KB1A 1BI4A 1NOYA 4FK0A 3K2PA 1TVRA 4OVLA 3CFPA 1ASUA 1S9GA 2XY6A 3LALA 3SUQA 1HPZA 1UOCA 4FLWA 3NAEA 4W5RA 3S3NA 3LP0A 3KK3A 1RILA 1VSDA 1JLAA 4O44A 2R7YA 3AVIA 2Y1IA 1Q8IA 3DOLA 3AO4A 1XWLA 4HCCA 4KHSA 4KFBA 4LSLA 4CJEA 5E41A 1IKVA 3NH2A 1TK8A 3KK1A 4M42A 3ZSQA 1WNSA 2D0CA 1IO2A 3PO4A 1RNHA 1QE1A 4AHCA 4BWMA 3AVGA 3HP6A 3RRHA 1T03A 4Z4EA 4DG1A 3HP9A 4PA1A 3SQ0A 3VQ9A 5J2MA 4C8LA 2B6AA 4GMJB 4CIGA 4DU3A 4I2QA 4EZ9A 4DMNA 4E7KA 5I42A 3M8RA 5FDLA 4E1NA 4JRQA 3KLIA 1G15A 4O0IA 1VRTA 4DFPA 4DF4A 4B9NA 5J1EA 3DYAA 3K5OA 1RBTA 4CEEA 1SL0A 3IG1A 3PUFA 3QNOA 2HHWA 3NGYA 3OYJA 4C8OA 4H8KA 2Z1JA 3CQ8A 4RW4A 4B8CA 3RRGA 3V4IA 2W42A 1QHTA 2ATQA 2D0BA 3OY9A 4ELUA 4KTZA 1WAJA 1TKZA 1RTJA 1RTIA 1ZYQA 1ZBLA 3ITHA 4KI4A 1L3SA 2HHXA 4CJFA 2X6NA 2Y1JA 2ETJA 3OYKA 4KTWA 4UQGA 1NOZA 1IKXA 3AVBA 4CEDA 4N41A 1LW0A 4KKOA 1NK7A 3QEIA 2B5JA 2HVHA 4DLGA 3PO5A 1JL1A 4PUOA 1JLCA 1TL1A 1WSHA 4CJLA 5KTQA 1SL1A 4EP5A 3K59A 3LAKA 3HSTB 2AJQA 1VSFA 4FM0A 4FJIA 1IKYA 2HW3A 1EETA 3M8SA 4M45A 4H4OA 4CIEA 2OPPA 2WOMA 3AA2A 3CM6A 3F9KA 1JLFA 4CJPA 4AILC 2RPIA 3EYZA 1IG9A 3LDSA 5DMRA 2IGIA 3NGZA 3DRRA 2HHVA 2QKBA 1EXQA 4KHQA 3DI6A 1GOAA 3DRPA 2KW4A 3HXMA 4DTSA 1VSKA 2E6MA 1D8YA 1VSMA 3AO5A 4M3TA 3OYCA 2DY4A 4CJ5A 2YKMA 2XY5A 5C25A 3SQ1A 1T8EA 1JL2A 1Z26A 1RT3A 4O55A 3CFRA 4MQ3A 4CEQA 3TAQA 3D45A 1X1PA 3P83D 1ZBHA 2G8VA 3MEEA 1TAUA 3OYAA 2ZD1A 2YV0X 1X9SA 2X74A 1CZ9A 1DTQA 3L2RA 1CXQA 4E19A 4DTOA 1C0TA 1QSSA 1HNVA 3MXIA 4BWJA 4IG0A 4OGEA 4CFDA 4FM1A 4E89A 4CE9A 3CFOA 3O4NA 3RMAA 5J2PA 3AVMA 2D5RA 2Q3SA 4DQPA 3E01A 5FROA 4J2DA 5K14A 1NJZA 4FJXA 4FK2A 4W5QA 1SUQA 4RW7A 4ELTA 4Z4IA 3QEWA 4N5SA 3OS0A 1RDDA 3UIQA 1HRHA 2O4IA 5J2NA 4NCAA 1WAFA 5JS2A 4FM2A 1NJXA 1BQMA 1VSJA 3T19A 1RBUA 3VA0A 5SWMA 4F2SA 3OYGA 3LPTA 2HB5A 2NUBA 1TKXA 3NHGA 4PQUA 4EP4A 3DLGA 4F2RA 1TKTA 4Z4FA 3BDPA 2YHAA 5HRSA 4B9SA 2DFEA 3VQCA 1TK5A 4CEFA 3ZT2A 5HBMA 2XY7A 3V1QA 3LZIA 1JLEA 2LSNA 3FFIA 5C24A 3DOKA 3OS2A 2G8WA 4KREA 4CK3A 3NCIA 2RF2A 1LWCA 4K8XA 4HVJA 2IDOA 3G10A 4CFAA 5HROA 1ZBUA 3L2QA 3DMJA 4MFBA 1U47A 4C8NA 2KFZA 2IS3A 4I2PA 4DSLA 4LSNA 3ZSRA 3BGRA 3SPYA 4DQQA 4Y1CA 5FRMA 4CECA 3LP3A 1D9FA 4KB0A 4DSJA 4BE1A 4F4KA 1WN7A 1UAXA 4DFMA 4FK4A 4E7IA 2VG7A 4NCBA 4CEBA 5CZ1A 4CIFA 3QLHA 1IKWA 5I3UA 2HNYA 1FK9A 4TSXA 4FCYA 2F96A 3U3GA 4HCBA 2YHBA 1XHXA 4CFBA 3V9UA 5FRNA 2FBYA 4FJNA 3VQEA 3JSMA 1QS4A 1I39A 4CGDA 3HT3A 2Z1GA 4CF8A 4KI6A 4ZTJA 4IFVA 3SPZA 4BDYA 3KTQA 3ISNC 3WNEA 3V1OA 3AVAA 2E6LA 5JS1A 3SZ2A 2VWKA 4FJ9A 3TAEA 1C1AA 4CJRA 1S6QA 4H4MA 2HNDA 4QAGA 3HPHA 1L3UA 3NGIA 1FKOA 1JLQA 3CYMA 1KSPA 3KLFA 1BCOA 5CYMA 3L2UA 5C42A 3T3FA 4L8RB 4FJ7A 4Z4GA 2GV9A 1RDCA 2EX3A 4HUFA 2OA8A 1ITGA 1LAVA 1VSLA 2Z1IA 3OYEA 3ULDA 1NKEA 4AHVA 3AO1A 4EZ6A 3SCXA 4XIUA 2G8FA 3H08A 3SNNA 4DTMA 3B6OA 1HYVA 1C6VA 4IBNA 2FBVA 3QETA 4M3XA 1L3VA 4FJKA 1ASVA 2OYQA 3MXJA 4WE1A 3PX4A 2XO7A 4HUEA 3V9ZA 4ZHRA 3VQ5A 1VSEA 3MEDA 3OJSA 3AO2A 3KJVA 1EX4A 1KLNA 4CHOA 3ZSOA 1Y97A 4FLVA 5CY4A 4OGCA 2G8KA 4DU1A 4ELVA 1MU2A 4E1MA 2P1JA 4CF9A 2RKIA 3LWMA 1U45A 1HYZA 1K6YA 3O3HA 2YNFA 5SZTA 4FZXC 1U48A 1D9DA 4FJJA 1T05A 3TAPA 3L3UA 3QINA 4M3UA 2JGUA 3QNNA 4O0JA 1TL3A 1UA0A 1J5OA 4DQSA 4E7LA 3AVFA 3SUOA 2G8IA 4F8RA 4CCHA 3M8QA 2BGGA 1S9EA 4E3SA 1WLJA 4CEZA 2D0AA 1QSYA 3ZSZA 1IH7A 3KKSA 1QQCA 1YTUA 3C94A 5KGWA 3VQQA 4CF2A 2X78A 5HLFA 1W9HA 1S6PA 4JS4A 3V1RA 1Q9YA 3IRXA 3LAMA 3P5JA 3TR8A 1RDAA 4CJVA 5HRNA 4YNQA 1NKBA 1KFSA 4FJLA 1A5XA 4J2AA 4CEOA 2E4LA 4YFUA 4OKJA 1KTQA 3QERA 4ID5A 4CHQA 1FKPA 5CYQA 1XC9A 4K8ZA 3V9XA 4KV8A 3ZSXA 3I0RA 4KHYA 1EKEA 4Z4HA 1F21A 1S1XA 1SV5A 2G8HA 4KPYA 1NJYA 3AVNA 3IAYA 4KHUA 1HQUA 4FVMA 4DSEA 3A2FA 3VQAA 2ITGA 3KD1E 1CXUA 3SUPA 4ZTFA 3O3FA 2VWJA 3VQ7A 4E7HA 1RTHA 4FJMA 3I0SA 1RT2A 5HP1A 5T7BA 4LH5A 4IG3A 3VN5A 2A1RA 1KVBA 1JLBA 3HPGA 1HYSA 4W5NA 4HTUA 1SL2A 4DTUA 4C8KA 4CGGA 3DLBA 1XHZA 4FJGA 1ZBIA 1WSFA 1S1UA 3NFAA 1J54A 4KHNA 4FJ8A 1A5VA 1RT4A 4DQRA 3ZT0A 4JLHA 3TARA 1BGXT 1SKWA 5D3GA 3HJFA 1U04A 4HUGA 4DLEA 1FXXA 4GW6A 3L2VA 1JLGA 1TAQA 4CF1A 3OVNA 4Y1DA 2YKNA 4M3YA 4DWIA 3PX6A 2ZQBA 2B4JA 2Z1HA 3NF9A 4RW8A 4DU4A 3KLHA 3NH1A 3K57A 1X9WA 2A1SA 3AV9A 3OYLA 3ZT4A 3S9HA 2OZMA 2DTUA 4FJHA 3K5LA 1TKDA 4CJSA 4Q5VA 3C95A 4KAZA 2BANA 4B9LA 3NDKA 4AHSA
chains in the Genus database with same CATH superfamily
2NRRA 3MX5A 3N4PA 4H5WA 4FLZA 1NG9A 4CFCA 5KGXA 3DLRA 3VQ6A 3S41A 1V4SA 3AA5X 2HSTA 3AVJA 4I7FA 1KVAA 1SKSA 2XRIA 3L6QA 3MEGA 3A5MC 3C0BA 3HVTA 3PIOL 2OZSA 3K5NA 4F3TA 4Q0BA 4OKEA 3AARA 3CC4N 4NXMK 4A2AA 2YI1A 3CIPA 4YOVA 2FBXA 3TTFA 2BUPA 5H1SQ 4RCHA 2IVOA 4BRPA 1QQOA 1B9DA 1RCHA 3MN9A 3PV8A 2O8CB 1C0MA 4OPKA 4DF8A 2E1ZA 4LF8K 2QI2A 5GINA 4JKDA 3CXCM 3QESA 3G0ZA 5AQJA 1RT6A 4RW6A 4BC5A 5AQQA 4DTNA 4DFJA 3SI6A 5C2FA 1BI4B 3OYDA 4AHTA 3VQ8A 4XH1A 1CLQA 3RMDA 3SJHA 1U4BA 3H1VX 3VA3A 1YHQN 2P9SB 3KLGA 5LL6Z 2HHSA 4H0PA 1DT9A 3OJUA 3VEWA 3EZ5A 1WSIA 4CERA 1TV6A 4IJNA 3WNHA 2GUIA 5AQNA 3LL3A 3O9TA 4BR5A 1ASWA 3M6GA 3O9SA 2OPSA 2HBKA 3THXA 2QTDA 4C8MA 3IDHA 5KQDA 4M41A 2KLAA 4DV6K 2FF6A 4W5OA 3NF7A 2P9NB 1OVQA 4BE2A 4BRCA 4DQIA 3J7ZO 4CESA 4J8FA 3JYTA 4DV7K 1L3TA 4B3RK 4WFNL 4DHYA 4F3OA 4LF6K 4FXDA 1KAZA 2NRVA 3ULEA 2GBZA 4BRLA 2YNIA 4OPJA 2O8BB 1NWKA 4JRPA 3P31A 4RG8A 2ZWHA 2QXFA 1YI2N 4CGJA 4JV5K 1S1TA 3LWLA 2WC9A 4ID1A 3F73A 3FLCO 3VEZA 4AH9A 4IDKA 5FLXO 1BDGA 3O1WA 3LDNA 3I56N 1NK5A 4A5BA 2E2QA 4DTRA 4KH6A 3ZCMA 4B9VA 1O1WA 4LFBK 4RTFD 1X9MA 3I8DA 3I33A 5C12A 1HNIA 4CGIA 2OPQA 1YT3A 4DSIA 4DV4K 1NGIA 2WONA 3LP1A 1BL3A 1VK0A 1NK4A 1BIUA 4J2BA 1S1WA 3MXMA 3OA9A 4G1QA 3ZLJA 3L0QA 4M3RA 1RGIA 4FSVA 4DUYK 3V9WA 3RTVA 1IBMK 2XHBA 3HL8A 2YNHA 1JXEA 3RWUA 3FE1A 3VF4A 3ZT3A 3HO1A 5AJ3K 1YIJN 4B3OA 4DS4A 3DLEA 3ENOA 3CG7A 4ILHA 1KFDA 1GOCA 5BRFA 4LF5K 5KRTA 2DFFA 1UWBA 4KB1A 4A5AA 4FK0A 3K2PA 3SUQA 4FLWA 4BGBA 4GKKK 1E4FT 4O44A 3AVIA 3P38A 4B9QA 3L4QA 4KFBA 4LSLA 4CJEA 1IKVA 1DKGD 3PIPL 1K8KB 3O1BA 1WNSA 4WQ5A 4JKFA 4DG1A 3U4LA 4PKGA 4GMJB 4CIGA 4I2QA 2YJFA 3E9OA 3SAGA 3VF2A 4CZGA 4YDUA 5J1EA 3DYAA 5LMUK 1SL0A 1GLDG 3IG1A 5EVZA 3NGYA 2Q97A 3OYJA 1Q81O 3HTVA 3V4IA 4BR7A 2HHXA 3VOVA 4DR4K 1NOZA 1LW0A 3VESA 1NK7A 2A40A 3QEIA 4CW7B 4DLGA 3DXMB 4PUOA 4YOTA 2OCEA 4IEEA 4EP5A 3HSTB 5M1QA 4FM0A 4FJIA 4RWTA 4CIEA 3EYZA 2VCPA 4B1XB 3DRRA 3SAFA 4KHQA 1D8YA 1VSKA 4NB4A 2JWKA 3M3ZA 1JL2A 5KPZA 4CZKA 2Q36A 3BUZB 3MEEA 3OYAA 4Z94A 4M7XA 2VGMA 1HNVA 4KH5A 4BWJA 4IG0A 2P9IB 4E89A 4YY3K 3O6WA 2FSNA 4LF7K 4BR0A 2ZJPL 3LDQA 1NJZA 1HX1A 4ELTA 5AZIB 3ZETA 1RDDA 2P9KB 4JYAK 1BU6O 2AP1A 3KHYA 5J2NA 5JS2A 2ASMA 4DR6K 3LPTA 2HB5A 1TKXA 4BC2A 4C23A 4WQ4A 4EP4A 3CPWM 1NNEA 5BPLA 4Z4FA 3BDPA 2YHAA 2DFEA 3D7EO 4CEFA 5HBMA 3RVCA 1N36K 1JLEA 3FFIA 3OS2A 4KREA 3O5BA 5IT9O 2NRWA 3QFUA 4C8NA 2KFZA 1D9FA 4DSJA 1WN7A 1N8RO 5AR0A 1FK9A 4FCYA 3TSQA 2F9WA 1T44A 2F96A 3U3GA 1XHXA 3WXIA 5FRNA 2CH5A 4JNEA 1QS4A 1I39A 4KI6A 4IFVA 4AQYK 3ISNC 3V1OA 2E6LA 3SK3A 3SZ2A 2GX9A 3TAEA 1S6QA 4H4MA 2ZGZA 1C0GA 4FWOA 4A57A 3ZEUA 1BCOA 4L8RB 2GV9A 2EX3A 2OA8A 3ZX0A 1E3MA 2O8EA 1ITGA 1LAVA 1NKEA 4DR1K 4XIUA 2G8FA 2NZTA 3H08A 3M1FA 3SNNA 4DTMA 1KXPA 4GV6A 2I7PA 4WE1A 3PX4A 3V9ZA 3D2EA 4JD2B 3VQ5A 4OX9K 1VQ5N 1EX4A 1EWQA 3ZSOA 2Q0UA 3CMEN 1RFQA 3ATUA 4GV9A 4BR4A 1G99A 1MU2A 2UXCK 4CF9A 4MO5A 1K6YA 2UUAK 2JGUA 1TL3A 3QFPA 4DQSA 4E7LA 3SUOA 3CCEN 2G8IA 4AF1A 1WOQA 3M8QA 2E2PA 4CEZA 3KKSA 2X78A 4JS4A 3LAMA 3AAPA 3THYA 1KFSA 4BQLA 1A5XA 5BPMA 4YFUA 1JCGA 4L3QA 4ID5A 5CYQA 3V9XA 3R3LA 1IBKK 1F21A 4KPYA 1NJYA 3AVNA 4KHUA 4LF4K 1HQUA 4FVMA 4QS8A 4YHHK 2WFBA 3THXB 3SUPA 2QW9A 3D2FA 3I0SA 4LH5A 1JLBA 5ADXA 4HTUA 4DTUA 4FJGA 1WSFA 2I7NA 4JLHA 3HJFA 1BGXT 3R6MA 4HUGA 1FXXA 4GW6A 3WT0A 2OANA 4DKWA 4M3YA 4DWIA 3MX2A 4RW8A 4DU4A 4OPHA 5AQUA 3TTDA 1X9WA 2A1SA 3ZT4A 4DV5K 1JCFA 4Q5VA 3C95A 5ELZA 3CHWA 3OYFA 4B9MA 2WUSA 3DXKA 4BDZA 1Q7YO 1RDBA 2QWOA 2PFUA 2A5XA 1N6QA 4CHNA 3UKUA 1C1CA 3OYHA 4H0VB 2V52B 1JJ2M 3T7ZA 1VQLN 3K5MA 3CMAN 3SYZA 1YAGA 2HHHK 3OS1A 2P9LA 3AA3A 3CC2N 2PY5A 5AQFA 1B9FA 1VRUA 3CC7N 2BH1A 2QA4N 2VWBA 3AVCA 1OH7A 2EHGA 3SV3A 2BDPA 1I3AA 1ZBSA 3SV4A 3QEPA 1ATNA 1REVA 2FSJA 2QXLA 4OPAA 4JI5K 5EXWA 1WBBA 3AA4A 1TK0A 2GWJA 4IFYA 2X6SA 4ICLA 2JLEA 1LWFA 4Z0UA 5HRPA 3IS9A 4O8UA 3MN7A 3OYIA 3CCUN 4CGFA 4XH4A 3T1YK 2E8AA 2PZSA 4JK8A 2FC0A 4KO0A 5E26A 3VEVA 3LP2A 1VSHA 3SBTA 2E2OA 1VQNN 4JI4K 3CM5A 1KQSM 2UXDK 4QS9A 3OYMA 3CCMN 1JCEA 1HJOA 3MECA 2BTFA 1KRPA 4JKCA 1B92A 3GG4A 3SJJA 3HRGA 4AHRA 1NGEA 3FZFA 3VGKA 3ZSWA 4M3WA 4MDAA 1M1KO 4JKEA 1CZBA 3FZLA 2KFNA 4IXCA 3KK2A 4IKFA 2VGNA 3E66A 4GVMA 2I5JA 4QOZB 4DFKA 1ATRA 4B1ZA 5AQPA 3TAMA 4PY5A 3C6TA 2QEXN 3VGMA 3ALYA 1VQ8N 1JXBA 3VETA 3CCLN 4LD0A 2IC3A 4JK7A 3NF8A 1NJWA 4O5BA 3KIOA 3TANA 4CJQA 3ZT1A 5AQMA 4FZYA 4IEIA 2OTLN 3NVMA 2IOCA 3U6FA 1DTTA 4CJUA 3M8PA 1U2VA 2IAJA 1E4GT 4W5TA 3I55N 1SKRA 2YCHA 4NCGA 4CZMA 1YITN 4KHWA 2KQ2A 3AVLA 3DRSA 2YHYA 1RDWX 3FZKA 4JHDA 2OPRA 2GUPA 3L4IA 5BN8A 2P51A 3AGRA 1EO1A 4FZZA 3BF3A 4Y0WA 1L5UA 1K73O 2JWLA 4O4GA 3W0LA 4JK9A 4XH5A 3TAGA 4IDHA 3RSEA 1TYQB 2V7YA 4AM7A 3QB0A 3HI0A 4F9OA 5EU7A 1D4XA 1D5AA 4E1JA 1LW2A 5MLCQ 5JICA 1T7PA 4B1UB 3ZX3A 3E9PA 5LJWA 2HMIA 1KLMA 3V6DA 5GAHP 3ZSYA 4N76A 3ZETB 1WSJA 3TPQA 2XY6A 3CFPA 1ASUA 3LDOA 1HPZA 3NAEA 1ILYA 3K9KA 3CJ1A 3J7YP 1Q8IA 4HCCA 3AO4A 1XWLA 1N32K 3CCJN 3KK1A 4M42A 3WXMB 2D0CA 5E84A 3PO4A 3DAWA 1RNHA 3WEEB 4AHCA 3AVGA 4O5FA 4PA1A 3VQ9A 3JXUA 3OBWA 5J2MA 2QWLA 2B6AA 2HBMA 4DU3A 3M8RA 5FDLA 3F5TA 1SQKA 3J80O 3A5OC 1VQ9N 2HHWA 2UUBK 4FWRA 4BRHA 2NRHA 2A6AA 2W42A 2ATQA 4KTZA 1TKZA 5BREA 1VQKN 1U6ZA 4CJFA 2X6NA 2ETJA 3OYKA 1XNQK 4KTWA 4LFAK 3HSCA 4CEDA 4NXNK 5JVHL 4JI1K 1JL1A 1JLCA 1IJJA 4EHTA 5AQTA 5KTQA 2YHXA 1GLLO 3MWTA 3MWPA 3ZEUB 2AJQA 1IKYA 3EN9A 2HW3A 3Q7CA 2O8EB 4I6MB 4K25A 1S3XA 2OPPA 2RPIA 5M1KA 2ITMA 5DMRA 4M63C 4BRGA 3IMXA 3NGZA 3U9DA 2HHVA 2QKBA 1NGJA 3CJ9A 3DI6A 2FXUA 5BR8K 4DTSA 1VSMA 1OH5A 4M3TA 3D2EB 3OYCA 2YKMA 2XY5A 3SQ1A 5C2DA 3KVGA 1RT3A 3CFRA 3TAQA 1ZBHA 5AQWA 1TAUA 4FWQA 2ZD1A 2X74A 2F4VK 1NGBA 4DTOA 4H5VA 4OGEA 4CFDA 4CE9A 3Q7BA 3RMAA 5J2PA 3A0IX 3AVMA 1YUWA 4DQPA 1H1VA 2W6KA 1IG8A 4MDBA 4FK2A 4Z4IA 4RW7A 2AA4A 3QEWA 3UIQA 1BQMA 1VSJA 3DWLA 4CZLA 5SWMA 2NUBA 3NHGA 4F2RA 5HRSA 3M5RA 3AGKA 3C6AA 3ZT2A 3F9MA 2P9PA 2XY7A 1HNXK 1YXQA 2LSNA 2G8WA 3NCIA 2H3GX 2PBDA 3W3DA 4HVJA 3D2FB 5B8HA 2IDOA 5HROA 3IUCA 4AM6A 1R59O 4DQQA 1NGCA 2E5LK 4IOAL 4DFMA 4CEBA 5CZ1A 4CD1A 3N4QA 1IKWA 3K9JA 2YHBA 5M1FA 1YJWN 1NMNA 5FPEA 3CCQN 2FLOA 4BDYA 2O8FA 3DXKB 3AVAA 4GY2B 1C1AA 4CJRA 2HNDA 5GAEP 3UKUB 4JI0K 5CYMA 5C42A 3T3FA 4DQ8A 1NBWA 1RDCA 1VSLA 3MN5A 3SCXA 3G6EN 2FBVA 1K8AO 3WXKA 1CZAN 1NLVA 2NRTA 1L3VA 3EE9A 3MXJA 2CGKA 4BRMA 4CBWA 4HUEA 4ZHRA 4IJAA 4IWVA 3KJVA 4CHOA 4FLVA 4OGCA 4PL7A 3QMLA 4KHPK 4DCHA 3O3HA 2YNFA 4H0XB 4FZXC 4BRAA 4JN4A 3TAPA 4O0JA 1J5OA 3U8XA 3OW2M 3AVFA 4LFCK 4F8RA 3WXLA 1S9EA 3JAMO 3K0SA 3ZSZA 3KWGA 4CBUA 1FJGK 3VQQA 5M1OA 4GVEA 4U7BA 5LJVA 5HRNA 2E4LA 1GLBG 4OKJA 3QERA 3ZSXA 4KHYA 1ZC6A 3A8YA 4K42A 4LF9K 2G8HA 3GOIA 2W41A 2VYPA 3IAYA 1W7AA 2RE2A 3O3FA 3H3NO 4E7HA 2O8DA 2GWKA 4FJMA 1RT2A 1T3VA 5HP1A 3VN5A 1KVBA 3PLAA 3FZHA 4MLEA 4CGGA 1XHZA 1N33K 1S1UA 3R9PA 1J54A 1A5VA 1SKWA 3TARA 3ZT0A 1U04A 4DLEA 2E20A 2NLXA 5DM6L 2YKNA 2B4JA 4EHUA 4H5NA 3K5LA 4CJSA 3GL1A 2BANA 4CZFA 3PY8A 4B9LA 3RMCA 4KTQA 4F4KA 3QEVA 1NMDA 4PHTX 4BDPA 4CEAA 5AFUA 3HYFA 1NU0A 1RTDA 5CZ2A 4BGAA 5AZJB 2P5OA 1U2VB 4NO7A 4DV0K 4CJ3A 4CF0A 2G8UA 3AVKA 1RBRA 4N56A 3EY1A 3TAFA 3TU5A 1BA0A 1ZBFA 3SMSA 4JHDB 5ADXH 5LMNK 3J8AA 3HK2A 4JKGA 4BRDA 2UU9K 4BROA 2WBNA 1T6DA 2ZE2A 3MCAB 1BCMA 1C0UA 4NLCA 3MAQA 4XEIA 1TGOA 2YX6A 4M7YA 3WNGA 3V9SA 4E7JA 4PWDA 4X62K 1BQNA 3L2WA 4A59A 2D0PA 2KZMA 3DLHA 1XI1A 1YTAA 4AHUA 4K0KK 5JMVA 1O13A 4EIAA 4I9QA 1IV0A 3CJAA 4DV1K 4CZHA 2A42A 3AAQA 4CHPA 1DEJA 1GLJO 5KI6A 1RBSA 4ISGA 3TI0A 4DTXA 1RBVA 4CJWA 4FWNA 3D0PA 4KRFA 4MLHA 3KD5E 4OKKA 4BC3A 4DR5K 3O9RA 4FW2A 4BREA 3NMUA 2VG5A 1QQNA 3ENBA 4DS5A 3L8BA 3HVRA 3THWA 2HHUA 1XC3A 3HPOA 2YNGA 5FPNA 3RR8A 4OLBA 4CHZA 3LDPA 3QDKA 3IKMA 4B08A 3K58A 3H3OB 4X64K 3WNFA 1WSEA 4WFBL 4X66K 2F9TA 1RT5A 1BHLA 1W0HA 3VTHA 4YOWA 4JI7K 4FYDA 3SQ2A 3OBYA 3KKRA 1A5WA 4FOIA 3S3OA 2NRZA 4IO9L 2ZJRL 1J5EK 3BZCA 3T69A 4CJ4A 3SUNA 1S5JA 2HVIA 3KK7A 5J2QA 2WTUA 4H0TB 4H0OA 3QO9A 4Z4CA 1UA1A 4QS7A 4RW9A 3O8MA 4CD3A 4OLAA 3OTOK 3GBTA 2HHQA 3ULEB 3VQPA 2P5GA 4WF9L 4CJTA 1OVYA 3NVKA 3QIOA 3SQ4A 4JS5A 3CCSN 3O9QA 2DFHA 3NBPA 3P39A 4LY7A 2VQEK 3ZX2A 3AY9A 3C65A 3MDQA 2F8SA 3V81A 3TABA 3MN6A 3B6PA 2PYLA 1RT1A 4WYBA 2EWSA 4BACA 2VQFK 4B8AB 3VQ4A 5GAGP 2VG6A 1R0AA 3QEXA 3O3GA 4B3MK 3T1AA 1M90O 1ZXOA 3CF5L 3TSUA 4CJKA 4BR9A 1SAZA 3R8EA 3G71N 1TVRA 2UUCK 3U9ZA 3LALA 5AQIA 3S3NA 3LP0A 3KK3A 1RILA 4FPAA 1VSDA 1JLAA 2Y1IA 5AQLA 4BRFA 3CERA 3DOLA 4DUZK 5E41A 1KD1O 3ZSQA 1OH6A 1YF5L 3B8AX 1IO2A 2P9PB 1QE1A 3RRHA 4BWMA 1T03A 3HP9A 3VF6A 4EZ9A 5M1PA 2IVNA 1S72N 1G15A 1VRTA 5AQVA 4BRIA 4DFPA 4DF4A 1RBTA 3QNOA 4C8OA 4H8KA 4KBOA 4RW4A 4B8CA 4BRNA 2D0BA 4ELUA 1GLFO 1WAJA 2QWMA 4BVOA 1ZYQA 4KI4A 1L3SA 4G9ZA 3A5NC 3AVBA 2GTDA 4KKOA 5KPRA 2GELA 5C10A 3SAHA 2B5JA 5AQXA 2O8FB 2HVHA 3MCPA 3VTIA 4JAXA 5JLHA 4C1NI 1RDUA 3BF1A 1SL1A 3K59A 4FWPA 4C1NK 4BY9C 1C0FA 5AQHA 4IZ9A 5KPTA 2WOMA 3AA2A 3F9KA 3CM6A 4CJPA 2P9IA 4H5TA 2CGLA 2IVPA 3LDSA 1EWRA 2IGIA 1ESVA 1K9MO 1EXQA 4CBXA 2CH6A 3HOSA 1GOAA 4IFEA 3H1QA 1T8EA 2HF4A 5EY4A 3EKUA 4FWLA 3D45A 1X1PA 3P83D 2G8VA 5JLFA 3T1HK 1X9SA 2A41A 1DTQA 3L2RA 1CXQA 4E19A 1C0TA 1QSSA 3MXIA 3LDLA 5AQZA 5I9EB 3WXJA 4JKBA 3CFOA 2D5RA 2Q3SA 4CVNE 5FROA 4FJXA 4W5QA 1OKJA 4MO4A 4N5SA 4FPBA 4KH4A 3OS0A 1Q82O 4DR7K 2O4IA 1WAFA 1NJXA 1RBUA 3LM9A 1LCUA 3ATVA 4PQUA 2E2NA 1TKTA 4B9SA 3VQCA 3CQXA 1TK5A 1Q86O 3LZIA 5C24A 3SBGA 3R1XA 1NGAA 2RF2A 5JVGL 1LWCA 2O8DB 3G10A 1ZBUA 1HNZK 3L2QA 3DMJA 3ZSRA 4Y1CA 5FRMA 3LP3A 1KAXA 4KB0A 2Q0RA 4BE1A 3BP8A 1UAXA 4FK4A 4IOCL 4NCBA 4CIFA 3FZMA 4IO8A 5I3UA 3C6HA 5F0XA 4DV2K 2FBYA 4FJNA 3E1YA 4BR2A 3ID8A 4CGDA 2Z1GA 4ZTJA 2RHKA 4NLBA 3SPZA 1ATSA 3KTQA 1HKCA 4JD2A 4FOEA 2HF3A 1MWMA 4QAGA 5BPNA 1L3UA 1FKOA 4V19S 4FJ7A 4Z4GA 5HL7L 4HUFA 2Z1IA 3IFRA 2ZGYA 1QZ5A 5KQ8A 3BY5A 5DM7L 1EQYA 4JI2K 3B6OA 4IBNA 4JKGB 4M3XA 4FJKA 2OYQA 4ILJA 5F1XA 5FPDA 2XO7A 3OJSA 1KLNA 1XUPO 1Y97A 5CY4A 5TKWA 3OHRA 3D6RA 5GADP 3C7NA 1U48A 2Q1NA 3HZ6A 3L3UA 4M3UA 4CZJA 1MWKA 3VENA 2ZJQL 4E3SA 1WLJA 4HTLA 2D0AA 1QSYA 3CPEA 1QQCA 1YTUA 3C94A 5KGWA 2YJEA 4CF2A 3O9UA 5HLFA 1W9HA 1N34K 3V1RA 3J81O 3IRXA 3P5JA 1Q9YA 1RDAA 4CJVA 4YNQA 3BEXA 1NKBA 4FJLA 1VQON 4CEOA 2KKZA 1KTQA 1FKPA 2P9UA 1XC9A 5IWAK 4KV8A 3CCRN 3I0RA 1S1XA 1SV5A 1HPMA 3THWB 4DSEA 3KZBA 3VQAA 4UY8O 4ZTFA 2HMPA 2VWJA 1Z6RA 3VQ7A 4WQ5C 3HBTA 2A1RA 2ASOA 5T7BA 3QICA 1VQPN 3HPGA 1HYSA 4W5NA 4C8KA 1ZBIA 3DLBA 2UXBK 2W40A 3JS6A 4FJ8A 1RT4A 4DQRA 5D3GA 3THYB 5BRDA 3FGUA 1JLGA 1TAQA 4U67L 1NGHA 3OVNA 4YDUC 2D0OA 2ZQBA 3NF9A 3KWIA 3NH1A 4EFHA 3K57A 1W2BM 2OTJN 4JKAA 4B3SK 2OZMA 2DTUA 4FJHA 5M1NA 1TKDA 3WUHA 2E1YA 5AQGA 4FWSA 4CEEA 3G4SN 1MA9B 4AHSA 3RMBA 2XY8A 4BRQA 5FPMA 2ASPA 3P1GA 1YVUA 3TTCA 2O4GA 3NH0A 3ZSVA 3TSPA 1XMOK 1NKCA 3VQBA 1LAWA 4M3ZA 1Z25A 1S1VA 3UKRA 1U49A 3CJ7A 1KCFA 4B1WB 3PX0A 1SZ2A 4ISFA 1GLEG 4E0DA 5AQKA 1GOBA 3OYBA 3VEXA 1NK9A 4FWKA 4PL8A 1BIZA 4GKJK 2KZZA 1QQMA 1WSGA 3C6UA 4HHTA 4BQZA 2QK9A 4ILGB 1JKHA 4BE0A 3H45C 1HMVA 1V4TA 1HLUA 4N47A 1I94K 3H6EA 4CGHA 3LANA 3DLKA 2CGJA 5A2QO 3THVA 2P9LB 1LV5A 4FLYA 2FBTA 5AFUH 4I9LA 5HRRA 4B9TA 5DK5A 2ZM6K 1J9AA 3HM9A 1KAYA 3GDQA 3WQUA 3LZJA 3O4WA 1Q18A 1NK8A 1MDUB 3ASMA 4R5PA 1NK0A 2PYJA 3DLLL 5CE3A 3VQDA 1Q9XA 1RT7A 3QBWA 3L3VA 2QKKA 3LPUA 1OH8A 4FL9A 2GEMA 3U3YA 5BN9A 1EP4A 3SMPA 1X3NA 4WQ4C 3O4QA 3J7AP 3LM2A 2QWNA 4LH4A 5LY3A 4FLUA 4B3TK 4FW1A 1N5YA 2F8TA 1BISA 4QCLA 2HBJA 1LWEA 3TWHA 4B9UA 4CK1A 4H5RA 1QTMA 1KVCA 4OJRA 1XNRK 1NK6A 4J2EA 4YORA 4WFAL 5C0YA 2HOEA 4DTPA 4FLXA 4WCEL 3QIPA 2BE2A 4CHYA 3NE6A 3OYNA 1TYQA 3VEOA 4B1VA 3NF6A 1QSLA 3AO3A 3A5LC 4O8KA 5KRSA 4CK2A 1T6CA 1VSIA 3CD6N 1P90A 3DJCA 4FJ5A 2HHTA 2KTQA 4FVUA 4JI8K 4DTJA 3I8BA 1DLOA 2QWRA 1FW6A 4FLTA 1HJRA 1HQEA 1J6ZA 3CQYA 1HKBA 2RN2A 4DSFA 4NYFA 2O8CA 2J4RA 4DSKA 3AVHA 3RR7A 2HNZA 4NYNA 3WEEA 3KLEA 1J53A 4DR3K 3DM2A 1BWFO 3S3MA 1C1BA 4K41A 1BI4A 1NOYA 2A3ZA 5EX5A 4OVLA 3HOTA 1S9GA 4IOXA 3RSEB 4DR2K 1UOCA 2FF3B 1HNWK 4W5RA 1LOTB 1X3MA 2P9SA 2QWQA 2R7YA 1X9JA 4KHSA 1TK8A 3NH2A 5TKYA 2V7ZA 1VQMN 5C15A 1S22A 1QVFM 3HP6A 4Z4EA 1QVGM 3SQ0A 3P4IA 4C8LA 1WBDA 4H03B 4DMNA 3HM8A 4E7KA 5I42A 3CJBA 4EAHD 4E1NA 4JRQA 3KLIA 4O0IA 1XMQK 4B9NA 2P9NA 3EE8A 3K5OA 4ISEA 3PUFA 3PSIA 4OO1J 2Z1JA 3O80A 3CQ8A 4I6MA 3RRGA 5GIOA 2UYTA 1QHTA 5HOOA 3OY9A 5F2RA 3VEYA 3FR0A 4DV3K 3ID6A 1RTJA 1RTIA 1ZBLA 3ITHA 2Y1JA 2QM1A 4YOUA 2HBLA 4UQGA 2O8BA 1IKXA 3MMVA 4N41A 3VGLA 3PO5A 1TL1A 2KHOA 1NJIO 1NGDA 1Z05A 1WSHA 4CJLA 5AQSA 3LAKA 1VSFA 1EETA 3M8SA 4M45A 1TUUA 3WQTA 1TUYA 4H4OA 1JLFA 4AILC 1IG9A 2PAVA 3H46O 4B1YB 4CI6A 1DGKN 1GLCG 1VHXA 4CJ7A 4YOXA 3DRPA 2KW4A 3HXMA 2E6MA 3AO5A 3GE1A 2DY4A 4CJ5A 5C25A 1Z26A 2DPNA 4O55A 4MQ3A 2ZF5O 4CEQA 3CJCA 4BG9A 1NM1A 2YV0X 1CZ9A 5BR9A 3C7NB 5CR4A 4A2BA 1HKGA 4HWIA 4FM1A 3O4NA 4A62A 3E01A 4J2DA 5K14A 5BRHA 2YHWA 1SUQA 4DB3A 1VQ7N 3SLCA 1YVNA 1HRHA 4NCAA 4FM2A 3T19A 3VA0A 1WUAA 4F2SA 3OYGA 2P9UB 3DLGA 1K8KA 3V1QA 3DOKA 4CK3A 3EEQA 4K8XA 3EL2A 4R79A 4PKIA 4CFAA 2Q31A 1U47A 4MFBA 4JEPA 3CI5A 2IS3A 4CZIA 4FO0A 4I2PA 4BG8A 4LSNA 4DSLA 3BGRA 3SPYA 4CECA 4A61A 4E7IA 2VG7A 3F2KA 3QLHA 2W6LA 2HNYA 3G25A 4TSXA 3E9LA 3MK6A 4HCBA 4CFBA 3V9UA 3VQEA 3JSMA 4PKHA 3HT3A 1BG3A 4CF8A 3DXMA 3VPZA 3WNEA 5JS1A 4CZEA 4FJ9A 2VWKA 1BA1A 3HPHA 3NGIA 1JLQA 3CYMA 1KSPA 3KLFA 3L2UA 1VQ6N 3UKRB 5AQRA 4BC4A 3EZWA 2F7TA 3OYEA 1W97L 1WB9A 1IBLK 3ULDA 4JKHA 4AHVA 3AO1A 4EZ6A 1VAZA 1QHAA 2D1KA 5EOYA 2FSKA 1HYVA 1C6VA 2E88A 3QETA 4BRKA 4LC9B 1ASVA 5AQOA 4YOYA 1VSEA 3CETA 3MEDA 3AO2A 2G8KA 4DU1A 1QZ6A 1SS6A 4ELVA 4E1MA 2P1JA 3ZYYX 2RKIA 3LWMA 1U45A 1BUPA 1HYZA 5SZTA 3QBXA 1D9DA 4FJJA 1T05A 3ENHA 3QINA 4K43A 3QNNA 3PSFA 1UA0A 5GIPA 3EO3A 4GNIA 3VMFB 4CCHA 2BGGA 1YJNN 5AZIA 1IH7A 1BOTO 1P8ZA 1Y64A 2P9KA 1S6PA 4H0YB 1HUXA 3TR8A 4J2AA 2IIRA 2Q2RA 3BZKA 4JI6K 4CHQA 4K8ZA 1GLAG 1EKEA 4Z4HA 3O08A 5AQYA 3A2FA 2NRXA 3EKSA 2ITGA 3KD1E 1VQ4N 1CXUA 4X65K 1HR0K 2V51B 3CCVN 1RTHA 3FFKB 4IG3A 1XQSC 3UE5A 1SL2A 3VERA 4FWMA 4GV3A 2D4WA 3NFAA 5AZJA 1NGFA 4KHNA 3UB5A 2NNWA 5CHIA 3L2VA 1YJ9N 4CF1A 4BVPA 4JI3K 4Y1DA 1NGGA 1BO5O 3PX6A 2Z1HA 3KLHA 3AV9A 3OYLA 3S9HA 2QWPA 1KC8O 4KAZA 3NDKA
chains in the Genus database with same CATH topology
4B9MA 3RMCA 4KTQA 2XY8A 3QEVA 4BDZA 4FLZA 1RDBA 3P1GA 1YVUA 4CFCA 5KGXA 2O4GA 4BDPA 4CEAA 3NH0A 3ZSVA 3HYFA 3DLRA 3VQ6A 1NKCA 1RTDA 5CZ2A 3VQBA 1N6QA 4CHNA 1C1CA 1LAWA 3OYHA 1Z25A 2P5OA 4M3ZA 3AA5X 1S1VA 4CJ3A 4CF0A 3K5MA 2G8UA 3AVKA 1U49A 3SYZA 1KCFA 1RBRA 3AVJA 4I7FA 4N56A 3OS1A 3PX0A 1KVAA 3EY1A 3AA3A 3TAFA 1SKSA 2XRIA 3MEGA 1ZBFA 2PY5A 4E0DA 1B9FA 1GOBA 3HVTA 1VRUA 3OYBA 2OZSA 3K5NA 1NK9A 3HK2A 4F3TA 4Q0BA 4OKEA 3AVCA 1BIZA 2ZE2A 2EHGA 2FBXA 3SV3A 2BDPA 1I3AA 3SV4A 2KZZA 1BCMA 1C0UA 3QEPA 3MAQA 1WSGA 1REVA 3C6UA 1TGOA 4HHTA 1B9DA 3WNGA 1RCHA 3V9SA 2QK9A 4E7JA 4PWDA 3PV8A 1JKHA 4BE0A 1BQNA 3AA4A 1TK0A 1HMVA 4IFYA 1C0MA 2X6SA 4ICLA 2JLEA 4N47A 1LWFA 4Z0UA 3L2WA 2KZMA 4CGHA 5HRPA 3LANA 3DLKA 4OPKA 4DF8A 3IS9A 3THVA 1XI1A 1YTAA 4AHUA 3DLHA 1LV5A 3QESA 4I9QA 3G0ZA 3OYIA 4FLYA 2FBTA 4CGFA 1RT6A 2PZSA 4RW6A 4I9LA 2FC0A 4KO0A 5HRRA 4B9TA 3LP2A 4DTNA 4DFJA 3SI6A 5DK5A 1J9AA 1VSHA 3HM9A 3LZJA 4CHPA 5KI6A 1RBSA 1BI4B 3ASMA 3CM5A 4R5PA 3OYDA 1NK8A 3TI0A 1NK0A 2PYJA 3OYMA 4DTXA 3VQDA 1RBVA 4AHTA 4CJWA 3VQ8A 1Q9XA 1CLQA 1RT7A 3D0PA 3RMDA 1U4BA 4KRFA 3MECA 3VA3A 3L3VA 3KLGA 1KRPA 2QKKA 2HHSA 3KD5E 3LPUA 4OKKA 1B92A 3OJUA 3EZ5A 4FW2A 3SJJA 4AHRA 2VG5A 1WSIA 4CERA 4DS5A 1TV6A 3WNHA 3L8BA 3U3YA 1EP4A 2GUIA 3HVRA 3ZSWA 4M3WA 1ASWA 3O4QA 2OPSA 2HHUA 4LH4A 1CZBA 3HPOA 4C8MA 2YNGA 4M41A 4FLUA 2KFNA 4FW1A 1N5YA 3RR8A 2F8TA 1BISA 4OLBA 3KK2A 4QCLA 4IKFA 4CHZA 4W5OA 1LWEA 4GVMA 3NF7A 2I5JA 4B08A 3K58A 3TWHA 4B9UA 4QOZB 4DFKA 4CK1A 4BE2A 4DQIA 3WNFA 4CESA 3JYTA 1WSEA 1QTMA 3TAMA 1KVCA 1L3TA 4OJRA 1RT5A 1BHLA 4F3OA 3C6TA 1NK6A 4PY5A 1W0HA 4FXDA 3ALYA 2GBZA 4FYDA 1JXBA 2YNIA 3SQ2A 4OPJA 4J2EA 3KKRA 4JRPA 4RG8A 4LD0A 1A5WA 2QXFA 2IC3A 4CGJA 3NF8A 4DTPA 3S3OA 1S1TA 4FLXA 1NJWA 4O5BA 3LWLA 3KIOA 3QIPA 3TANA 4ID1A 4CJQA 3ZT1A 2BE2A 4CHYA 3F73A 4FZYA 3NE6A 3OYNA 4CJ4A 3SUNA 4AH9A 2IOCA 4IDKA 1S5JA 3U6FA 2HVIA 3NF6A 1NK5A 1DTTA 4CJUA 1QSLA 3M8PA 4DTRA 2IAJA 3AO3A 3ZCMA 5J2QA 1O1WA 4W5TA 4B9VA 1SKRA 3OYFA 5KRSA 3QO9A 4Z4CA 1UA1A 4NCGA 4CK2A 1X9MA 4RW9A 4OLAA 3I8DA 4KHWA 2HHQA 2KQ2A 3AVLA 3DRSA 1HNIA 1VSIA 3VQPA 4CGIA 2P5GA 2OPQA 4FJ5A 1YT3A 4DSIA 2OPRA 4CJTA 3PY8A 2HHTA 2P51A 2KTQA 4FZZA 2WONA 3LP1A 3QIOA 4DTJA 1BL3A 1VK0A 1DLOA 3SQ4A 1L5UA 1NK4A 4JS5A 4FLTA 1BIUA 4O4GA 1HJRA 4J2BA 2DFHA 1HQEA 1S1WA 3NBPA 4LY7A 3TAGA 3MXMA 4G1QA 2RN2A 4DSFA 4M3RA 3RMBA 2F8SA 3V9WA 3V81A 3TABA 4NYFA 3RTVA 5EU7A 1D5AA 2XHBA 4DSKA 3HL8A 3B6PA 2PYLA 2YNHA 1LW2A 1RT1A 3AVHA 4BACA 1T7PA 1JXEA 3RR7A 3RWUA 2HNZA 3ZT3A 4B8AB 3VQ4A 2HMIA 3HO1A 2VG6A 1KLMA 4NYNA 3QEXA 1R0AA 3V6DA 3O3GA 4B3OA 4DS4A 3DLEA 3T1AA 3CG7A 1J53A 3ZSYA 3KLEA 4N76A 3DM2A 1KFDA 1GOCA 4CJKA 3S3MA 5KRTA 2DFFA 1UWBA 1C1BA 1WSJA 4KB1A 1BI4A 1NOYA 4FK0A 3K2PA 1TVRA 4OVLA 3CFPA 1ASUA 1S9GA 2XY6A 3LALA 3SUQA 1HPZA 1UOCA 4FLWA 3NAEA 4W5RA 3S3NA 3LP0A 3KK3A 1RILA 1VSDA 1JLAA 4O44A 2R7YA 3AVIA 2Y1IA 1Q8IA 3DOLA 3AO4A 1XWLA 4HCCA 4KHSA 4KFBA 4LSLA 4CJEA 5E41A 1IKVA 3NH2A 1TK8A 3KK1A 4M42A 3ZSQA 1WNSA 2D0CA 1IO2A 3PO4A 1RNHA 1QE1A 4AHCA 4BWMA 3AVGA 3HP6A 3RRHA 1T03A 4Z4EA 4DG1A 3HP9A 4PA1A 3SQ0A 3VQ9A 5J2MA 4C8LA 2B6AA 4GMJB 4CIGA 4DU3A 4I2QA 4EZ9A 4DMNA 4E7KA 5I42A 3M8RA 5FDLA 4E1NA 4JRQA 3KLIA 1G15A 4O0IA 1VRTA 4DFPA 4DF4A 4B9NA 5J1EA 3DYAA 3K5OA 1RBTA 4CEEA 1SL0A 3IG1A 3PUFA 3QNOA 2HHWA 3NGYA 3OYJA 4C8OA 4H8KA 2Z1JA 3CQ8A 4RW4A 4B8CA 3RRGA 3V4IA 2W42A 1QHTA 2ATQA 2D0BA 3OY9A 4ELUA 4KTZA 1WAJA 1TKZA 1RTJA 1RTIA 1ZYQA 1ZBLA 3ITHA 4KI4A 1L3SA 2HHXA 4CJFA 2X6NA 2Y1JA 2ETJA 3OYKA 4KTWA 4UQGA 1NOZA 1IKXA 3AVBA 4CEDA 4N41A 1LW0A 4KKOA 1NK7A 3QEIA 2B5JA 2HVHA 4DLGA 3PO5A 1JL1A 4PUOA 1JLCA 1TL1A 1WSHA 4CJLA 5KTQA 1SL1A 4EP5A 3K59A 3LAKA 3HSTB 2AJQA 1VSFA 4FM0A 4FJIA 1IKYA 2HW3A 1EETA 3M8SA 4M45A 4H4OA 4CIEA 2OPPA 2WOMA 3AA2A 3CM6A 3F9KA 1JLFA 4CJPA 4AILC 2RPIA 3EYZA 1IG9A 3LDSA 5DMRA 2IGIA 3NGZA 3DRRA 2HHVA 2QKBA 1EXQA 4KHQA 3DI6A 1GOAA 3DRPA 2KW4A 3HXMA 4DTSA 1VSKA 2E6MA 1D8YA 1VSMA 3AO5A 4M3TA 3OYCA 2DY4A 4CJ5A 2YKMA 2XY5A 5C25A 3SQ1A 1T8EA 1JL2A 1Z26A 1RT3A 4O55A 3CFRA 4MQ3A 4CEQA 3TAQA 3D45A 1X1PA 3P83D 1ZBHA 2G8VA 3MEEA 1TAUA 3OYAA 2ZD1A 2YV0X 1X9SA 2X74A 1CZ9A 1DTQA 3L2RA 1CXQA 4E19A 4DTOA 1C0TA 1QSSA 1HNVA 3MXIA 4BWJA 4IG0A 4OGEA 4CFDA 4FM1A 4E89A 4CE9A 3CFOA 3O4NA 3RMAA 5J2PA 3AVMA 2D5RA 2Q3SA 4DQPA 3E01A 5FROA 4J2DA 5K14A 1NJZA 4FJXA 4FK2A 4W5QA 1SUQA 4RW7A 4ELTA 4Z4IA 3QEWA 4N5SA 3OS0A 1RDDA 3UIQA 1HRHA 2O4IA 5J2NA 4NCAA 1WAFA 5JS2A 4FM2A 1NJXA 1BQMA 1VSJA 3T19A 1RBUA 3VA0A 5SWMA 4F2SA 3OYGA 3LPTA 2HB5A 2NUBA 1TKXA 3NHGA 4PQUA 4EP4A 3DLGA 4F2RA 1TKTA 4Z4FA 3BDPA 2YHAA 5HRSA 4B9SA 2DFEA 3VQCA 1TK5A 4CEFA 3ZT2A 5HBMA 2XY7A 3V1QA 3LZIA 1JLEA 2LSNA 3FFIA 5C24A 3DOKA 3OS2A 2G8WA 4KREA 4CK3A 3NCIA 2RF2A 1LWCA 4K8XA 4HVJA 2IDOA 3G10A 4CFAA 5HROA 1ZBUA 3L2QA 3DMJA 4MFBA 1U47A 4C8NA 2KFZA 2IS3A 4I2PA 4DSLA 4LSNA 3ZSRA 3BGRA 3SPYA 4DQQA 4Y1CA 5FRMA 4CECA 3LP3A 1D9FA 4KB0A 4DSJA 4BE1A 4F4KA 1WN7A 1UAXA 4DFMA 4FK4A 4E7IA 2VG7A 4NCBA 4CEBA 5CZ1A 4CIFA 3QLHA 1IKWA 5I3UA 2HNYA 1FK9A 4TSXA 4FCYA 2F96A 3U3GA 4HCBA 2YHBA 1XHXA 4CFBA 3V9UA 5FRNA 2FBYA 4FJNA 3VQEA 3JSMA 1QS4A 1I39A 4CGDA 3HT3A 2Z1GA 4CF8A 4KI6A 4ZTJA 4IFVA 3SPZA 4BDYA 3KTQA 3ISNC 3WNEA 3V1OA 3AVAA 2E6LA 5JS1A 3SZ2A 2VWKA 4FJ9A 3TAEA 1C1AA 4CJRA 1S6QA 4H4MA 2HNDA 4QAGA 3HPHA 1L3UA 3NGIA 1FKOA 1JLQA 3CYMA 1KSPA 3KLFA 1BCOA 5CYMA 3L2UA 5C42A 3T3FA 4L8RB 4FJ7A 4Z4GA 2GV9A 1RDCA 2EX3A 4HUFA 2OA8A 1ITGA 1LAVA 1VSLA 2Z1IA 3OYEA 3ULDA 1NKEA 4AHVA 3AO1A 4EZ6A 3SCXA 4XIUA 2G8FA 3H08A 3SNNA 4DTMA 3B6OA 1HYVA 1C6VA 4IBNA 2FBVA 3QETA 4M3XA 1L3VA 4FJKA 1ASVA 2OYQA 3MXJA 4WE1A 3PX4A 2XO7A 4HUEA 3V9ZA 4ZHRA 3VQ5A 1VSEA 3MEDA 3OJSA 3AO2A 3KJVA 1EX4A 1KLNA 4CHOA 3ZSOA 1Y97A 4FLVA 5CY4A 4OGCA 2G8KA 4DU1A 4ELVA 1MU2A 4E1MA 2P1JA 4CF9A 2RKIA 3LWMA 1U45A 1HYZA 1K6YA 3O3HA 2YNFA 5SZTA 4FZXC 1U48A 1D9DA 4FJJA 1T05A 3TAPA 3L3UA 3QINA 4M3UA 2JGUA 3QNNA 4O0JA 1TL3A 1UA0A 1J5OA 4DQSA 4E7LA 3AVFA 3SUOA 2G8IA 4F8RA 4CCHA 3M8QA 2BGGA 1S9EA 4E3SA 1WLJA 4CEZA 2D0AA 1QSYA 3ZSZA 1IH7A 3KKSA 1QQCA 1YTUA 3C94A 5KGWA 3VQQA 4CF2A 2X78A 5HLFA 1W9HA 1S6PA 4JS4A 3V1RA 1Q9YA 3IRXA 3LAMA 3P5JA 3TR8A 1RDAA 4CJVA 5HRNA 4YNQA 1NKBA 1KFSA 4FJLA 1A5XA 4J2AA 4CEOA 2E4LA 4YFUA 4OKJA 1KTQA 3QERA 4ID5A 4CHQA 1FKPA 5CYQA 1XC9A 4K8ZA 3V9XA 4KV8A 3ZSXA 3I0RA 4KHYA 1EKEA 4Z4HA 1F21A 1S1XA 1SV5A 2G8HA 4KPYA 1NJYA 3AVNA 3IAYA 4KHUA 1HQUA 4FVMA 4DSEA 3A2FA 3VQAA 2ITGA 3KD1E 1CXUA 3SUPA 4ZTFA 3O3FA 2VWJA 3VQ7A 4E7HA 1RTHA 4FJMA 3I0SA 1RT2A 5HP1A 5T7BA 4LH5A 4IG3A 3VN5A 2A1RA 1KVBA 1JLBA 3HPGA 1HYSA 4W5NA 4HTUA 1SL2A 4DTUA 4C8KA 4CGGA 3DLBA 1XHZA 4FJGA 1ZBIA 1WSFA 1S1UA 3NFAA 1J54A 4KHNA 4FJ8A 1A5VA 1RT4A 4DQRA 3ZT0A 4JLHA 3TARA 1BGXT 1SKWA 5D3GA 3HJFA 1U04A 4HUGA 4DLEA 1FXXA 4GW6A 3L2VA 1JLGA 1TAQA 4CF1A 3OVNA 4Y1DA 2YKNA 4M3YA 4DWIA 3PX6A 2ZQBA 2B4JA 2Z1HA 3NF9A 4RW8A 4DU4A 3KLHA 3NH1A 3K57A 1X9WA 2A1SA 3AV9A 3OYLA 3ZT4A 3S9HA 2OZMA 2DTUA 4FJHA 3K5LA 1TKDA 4CJSA 4Q5VA 3C95A 4KAZA 2BANA 4B9LA 3NDKA 4AHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9M A;  3RMC A;  4KTQ A;  2XY8 A;  3QEV A;  4BDZ A;  4FLZ A;  1RDB A;  3P1G A;  1YVU A;  4CFC A;  5KGX A;  2O4G A;  4BDP A;  4CEA A;  3NH0 A;  3ZSV A;  3HYF A;  3DLR A;  3VQ6 A;  1NKC A;  1RTD A;  5CZ2 A;  3VQB A;  1N6Q A;  4CHN A;  1C1C A;  1LAW A;  3OYH A;  1Z25 A;  2P5O A;  4M3Z A;  3AA5 X;  1S1V A;  4CJ3 A;  4CF0 A;  3K5M A;  2G8U A;  3AVK A;  1U49 A;  3SYZ A;  1KCF A;  1RBR A;  3AVJ A;  4I7F A;  4N56 A;  3OS1 A;  3PX0 A;  1KVA A;  3EY1 A;  3AA3 A;  3TAF A;  1SKS A;  2XRI A;  3MEG A;  1ZBF A;  2PY5 A;  4E0D A;  1B9F A;  1GOB A;  3HVT A;  1VRU A;  3OYB A;  2OZS A;  3K5N A;  1NK9 A;  3HK2 A;  4F3T A;  4Q0B A;  4OKE A;  3AVC A;  1BIZ A;  2ZE2 A;  2EHG A;  2FBX A;  3SV3 A;  2BDP A;  1I3A A;  3SV4 A;  2KZZ A;  1BCM A;  1C0U A;  3QEP A;  3MAQ A;  1WSG A;  1REV A;  3C6U A;  1TGO A;  4HHT A;  1B9D A;  3WNG A;  1RCH A;  3V9S A;  2QK9 A;  4E7J A;  4PWD A;  3PV8 A;  1JKH A;  4BE0 A;  1BQN A;  3AA4 A;  1TK0 A;  1HMV A;  4IFY A;  1C0M A;  2X6S A;  4ICL A;  2JLE A;  4N47 A;  1LWF A;  4Z0U A;  3L2W A;  2KZM A;  4CGH A;  5HRP A;  3LAN A;  3DLK A;  4OPK A;  4DF8 A;  3IS9 A;  3THV A;  1XI1 A;  1YTA A;  4AHU A;  3DLH A;  1LV5 A;  3QES A;  4I9Q A;  3G0Z A;  3OYI A;  4FLY A;  2FBT A;  4CGF A;  1RT6 A;  2PZS A;  4RW6 A;  4I9L A;  2FC0 A;  4KO0 A;  5HRR A;  4B9T A;  3LP2 A;  4DTN A;  4DFJ A;  3SI6 A;  5DK5 A;  1J9A A;  1VSH A;  3HM9 A;  3LZJ A;  4CHP A;  5KI6 A;  1RBS A;  1BI4 B;  3ASM A;  3CM5 A;  4R5P A;  3OYD A;  1NK8 A;  3TI0 A;  1NK0 A;  2PYJ A;  3OYM A;  4DTX A;  3VQD A;  1RBV A;  4AHT A;  4CJW A;  3VQ8 A;  1Q9X A;  1CLQ A;  1RT7 A;  3D0P A;  3RMD A;  1U4B A;  4KRF A;  3MEC A;  3VA3 A;  3L3V A;  3KLG A;  1KRP A;  2QKK A;  2HHS A;  3KD5 E;  3LPU A;  4OKK A;  1B92 A;  3OJU A;  3EZ5 A;  4FW2 A;  3SJJ A;  4AHR A;  2VG5 A;  1WSI A;  4CER A;  4DS5 A;  1TV6 A;  3WNH A;  3L8B A;  3U3Y A;  1EP4 A;  2GUI A;  3HVR A;  3ZSW A;  4M3W A;  1ASW A;  3O4Q A;  2OPS A;  2HHU A;  4LH4 A;  1CZB A;  3HPO A;  4C8M A;  2YNG A;  4M41 A;  4FLU A;  2KFN A;  4FW1 A;  1N5Y A;  3RR8 A;  2F8T A;  1BIS A;  4OLB A;  3KK2 A;  4QCL A;  4IKF A;  4CHZ A;  4W5O A;  1LWE A;  4GVM A;  3NF7 A;  2I5J A;  4B08 A;  3K58 A;  3TWH A;  4B9U A;  4QOZ B;  4DFK A;  4CK1 A;  4BE2 A;  4DQI A;  3WNF A;  4CES A;  3JYT A;  1WSE A;  1QTM A;  3TAM A;  1KVC A;  1L3T A;  4OJR A;  1RT5 A;  1BHL A;  4F3O A;  3C6T A;  1NK6 A;  4PY5 A;  1W0H A;  4FXD A;  3ALY A;  2GBZ A;  4FYD A;  1JXB A;  2YNI A;  3SQ2 A;  4OPJ A;  4J2E A;  3KKR A;  4JRP A;  4RG8 A;  4LD0 A;  1A5W A;  2QXF A;  2IC3 A;  4CGJ A;  3NF8 A;  4DTP A;  3S3O A;  1S1T A;  4FLX A;  1NJW A;  4O5B A;  3LWL A;  3KIO A;  3QIP A;  3TAN A;  4ID1 A;  4CJQ A;  3ZT1 A;  2BE2 A;  4CHY A;  3F73 A;  4FZY A;  3NE6 A;  3OYN A;  4CJ4 A;  3SUN A;  4AH9 A;  2IOC A;  4IDK A;  1S5J A;  3U6F A;  2HVI A;  3NF6 A;  1NK5 A;  1DTT A;  4CJU A;  1QSL A;  3M8P A;  4DTR A;  2IAJ A;  3AO3 A;  3ZCM A;  5J2Q A;  1O1W A;  4W5T A;  4B9V A;  1SKR A;  3OYF A;  5KRS A;  3QO9 A;  4Z4C A;  1UA1 A;  4NCG A;  4CK2 A;  1X9M A;  4RW9 A;  4OLA A;  3I8D A;  4KHW A;  2HHQ A;  2KQ2 A;  3AVL A;  3DRS A;  1HNI A;  1VSI A;  3VQP A;  4CGI A;  2P5G A;  2OPQ A;  4FJ5 A;  1YT3 A;  4DSI A;  2OPR A;  4CJT A;  3PY8 A;  2HHT A;  2P51 A;  2KTQ A;  4FZZ A;  2WON A;  3LP1 A;  3QIO A;  4DTJ A;  1BL3 A;  1VK0 A;  1DLO A;  3SQ4 A;  1L5U A;  1NK4 A;  4JS5 A;  4FLT A;  1BIU A;  4O4G A;  1HJR A;  4J2B A;  2DFH A;  1HQE A;  1S1W A;  3NBP A;  4LY7 A;  3TAG A;  3MXM A;  4G1Q A;  2RN2 A;  4DSF A;  4M3R A;  3RMB A;  2F8S A;  3V9W A;  3V81 A;  3TAB A;  4NYF A;  3RTV A;  5EU7 A;  1D5A A;  2XHB A;  4DSK A;  3HL8 A;  3B6P A;  2PYL A;  2YNH A;  1LW2 A;  1RT1 A;  3AVH A;  4BAC A;  1T7P A;  1JXE A;  3RR7 A;  3RWU A;  2HNZ A;  3ZT3 A;  4B8A B;  3VQ4 A;  2HMI A;  3HO1 A;  2VG6 A;  1KLM A;  4NYN A;  3QEX A;  1R0A A;  3V6D A;  3O3G A;  4B3O A;  4DS4 A;  3DLE A;  3T1A A;  3CG7 A;  1J53 A;  3ZSY A;  3KLE A;  4N76 A;  3DM2 A;  1KFD A;  1GOC A;  4CJK A;  3S3M A;  5KRT A;  2DFF A;  1UWB A;  1C1B A;  1WSJ A;  4KB1 A;  1BI4 A;  1NOY A;  4FK0 A;  3K2P A;  1TVR A;  4OVL A;  3CFP A;  1ASU A;  1S9G A;  2XY6 A;  3LAL A;  3SUQ A;  1HPZ A;  1UOC A;  4FLW A;  3NAE A;  4W5R A;  3S3N A;  3LP0 A;  3KK3 A;  1RIL A;  1VSD A;  1JLA A;  4O44 A;  2R7Y A;  3AVI A;  2Y1I A;  1Q8I A;  3DOL A;  3AO4 A;  1XWL A;  4HCC A;  4KHS A;  4KFB A;  4LSL A;  4CJE A;  5E41 A;  1IKV A;  3NH2 A;  1TK8 A;  3KK1 A;  4M42 A;  3ZSQ A;  1WNS A;  2D0C A;  1IO2 A;  3PO4 A;  1RNH A;  1QE1 A;  4AHC A;  4BWM A;  3AVG A;  3HP6 A;  3RRH A;  1T03 A;  4Z4E A;  4DG1 A;  3HP9 A;  4PA1 A;  3SQ0 A;  3VQ9 A;  5J2M A;  4C8L A;  2B6A A;  4GMJ B;  4CIG A;  4DU3 A;  4I2Q A;  4EZ9 A;  4DMN A;  4E7K A;  5I42 A;  3M8R A;  5FDL A;  4E1N A;  4JRQ A;  3KLI A;  1G15 A;  4O0I A;  1VRT A;  4DFP A;  4DF4 A;  4B9N A;  5J1E A;  3DYA A;  3K5O A;  1RBT A;  4CEE A;  1SL0 A;  3IG1 A;  3PUF A;  3QNO A;  2HHW A;  3NGY A;  3OYJ A;  4C8O A;  4H8K A;  2Z1J A;  3CQ8 A;  4RW4 A;  4B8C A;  3RRG A;  3V4I A;  2W42 A;  1QHT A;  2ATQ A;  2D0B A;  3OY9 A;  4ELU A;  4KTZ A;  1WAJ A;  1TKZ A;  1RTJ A;  1RTI A;  1ZYQ A;  1ZBL A;  3ITH A;  4KI4 A;  1L3S A;  2HHX A;  4CJF A;  2X6N A;  2Y1J A;  2ETJ A;  3OYK A;  4KTW A;  4UQG A;  1NOZ A;  1IKX A;  3AVB A;  4CED A;  4N41 A;  1LW0 A;  4KKO A;  1NK7 A;  3QEI A;  2B5J A;  2HVH A;  4DLG A;  3PO5 A;  1JL1 A;  4PUO A;  1JLC A;  1TL1 A;  1WSH A;  4CJL A;  5KTQ A;  1SL1 A;  4EP5 A;  3K59 A;  3LAK A;  3HST B;  2AJQ A;  1VSF A;  4FM0 A;  4FJI A;  1IKY A;  2HW3 A;  1EET A;  3M8S A;  4M45 A;  4H4O A;  4CIE A;  2OPP A;  2WOM A;  3AA2 A;  3CM6 A;  3F9K A;  1JLF A;  4CJP A;  4AIL C;  2RPI A;  3EYZ A;  1IG9 A;  3LDS A;  5DMR A;  2IGI A;  3NGZ A;  3DRR A;  2HHV A;  2QKB A;  1EXQ A;  4KHQ A;  3DI6 A;  1GOA A;  3DRP A;  2KW4 A;  3HXM A;  4DTS A;  1VSK A;  2E6M A;  1D8Y A;  1VSM A;  3AO5 A;  4M3T A;  3OYC A;  2DY4 A;  4CJ5 A;  2YKM A;  2XY5 A;  5C25 A;  3SQ1 A;  1T8E A;  1JL2 A;  1Z26 A;  1RT3 A;  4O55 A;  3CFR A;  4MQ3 A;  4CEQ A;  3TAQ A;  3D45 A;  1X1P A;  3P83 D;  1ZBH A;  2G8V A;  3MEE A;  1TAU A;  3OYA A;  2ZD1 A;  2YV0 X;  1X9S A;  2X74 A;  1CZ9 A;  1DTQ A;  3L2R A;  1CXQ A;  4E19 A;  4DTO A;  1C0T A;  1QSS A;  1HNV A;  3MXI A;  4BWJ A;  4IG0 A;  4OGE A;  4CFD A;  4FM1 A;  4E89 A;  4CE9 A;  3CFO A;  3O4N A;  3RMA A;  5J2P A;  3AVM A;  2D5R A;  2Q3S A;  4DQP A;  3E01 A;  5FRO A;  4J2D A;  5K14 A;  1NJZ A;  4FJX A;  4FK2 A;  4W5Q A;  1SUQ A;  4RW7 A;  4ELT A;  4Z4I A;  3QEW A;  4N5S A;  3OS0 A;  1RDD A;  3UIQ A;  1HRH A;  2O4I A;  5J2N A;  4NCA A;  1WAF A;  5JS2 A;  4FM2 A;  1NJX A;  1BQM A;  1VSJ A;  3T19 A;  1RBU A;  3VA0 A;  5SWM A;  4F2S A;  3OYG A;  3LPT A;  2HB5 A;  2NUB A;  1TKX A;  3NHG A;  4PQU A;  4EP4 A;  3DLG A;  4F2R A;  1TKT A;  4Z4F A;  3BDP A;  2YHA A;  5HRS A;  4B9S A;  2DFE A;  3VQC A;  1TK5 A;  4CEF A;  3ZT2 A;  5HBM A;  2XY7 A;  3V1Q A;  3LZI A;  1JLE A;  2LSN A;  3FFI A;  5C24 A;  3DOK A;  3OS2 A;  2G8W A;  4KRE A;  4CK3 A;  3NCI A;  2RF2 A;  1LWC A;  4K8X A;  4HVJ A;  2IDO A;  3G10 A;  4CFA A;  5HRO A;  1ZBU A;  3L2Q A;  3DMJ A;  4MFB A;  1U47 A;  4C8N A;  2KFZ A;  2IS3 A;  4I2P A;  4DSL A;  4LSN A;  3ZSR A;  3BGR A;  3SPY A;  4DQQ A;  4Y1C A;  5FRM A;  4CEC A;  3LP3 A;  1D9F A;  4KB0 A;  4DSJ A;  4BE1 A;  4F4K A;  1WN7 A;  1UAX A;  4DFM A;  4FK4 A;  4E7I A;  2VG7 A;  4NCB A;  4CEB A;  5CZ1 A;  4CIF A;  3QLH A;  1IKW A;  5I3U A;  2HNY A;  1FK9 A;  4TSX A;  4FCY A;  2F96 A;  3U3G A;  4HCB A;  2YHB A;  1XHX A;  4CFB A;  3V9U A;  5FRN A;  2FBY A;  4FJN A;  3VQE A;  3JSM A;  1QS4 A;  1I39 A;  4CGD A;  3HT3 A;  2Z1G A;  4CF8 A;  4KI6 A;  4ZTJ A;  4IFV A;  3SPZ A;  4BDY A;  3KTQ A;  3ISN C;  3WNE A;  3V1O A;  3AVA A;  2E6L A;  5JS1 A;  3SZ2 A;  2VWK A;  4FJ9 A;  3TAE A;  1C1A A;  4CJR A;  1S6Q A;  4H4M A;  2HND A;  4QAG A;  3HPH A;  1L3U A;  3NGI A;  1FKO A;  1JLQ A;  3CYM A;  1KSP A;  3KLF A;  1BCO A;  5CYM A;  3L2U A;  5C42 A;  3T3F A;  4L8R B;  4FJ7 A;  4Z4G A;  2GV9 A;  1RDC A;  2EX3 A;  4HUF A;  2OA8 A;  1ITG A;  1LAV A;  1VSL A;  2Z1I A;  3OYE A;  3ULD A;  1NKE A;  4AHV A;  3AO1 A;  4EZ6 A;  3SCX A;  4XIU A;  2G8F A;  3H08 A;  3SNN A;  4DTM A;  3B6O A;  1HYV A;  1C6V A;  4IBN A;  2FBV A;  3QET A;  4M3X A;  1L3V A;  4FJK A;  1ASV A;  2OYQ A;  3MXJ A;  4WE1 A;  3PX4 A;  2XO7 A;  4HUE A;  3V9Z A;  4ZHR A;  3VQ5 A;  1VSE A;  3MED A;  3OJS A;  3AO2 A;  3KJV A;  1EX4 A;  1KLN A;  4CHO A;  3ZSO A;  1Y97 A;  4FLV A;  5CY4 A;  4OGC A;  2G8K A;  4DU1 A;  4ELV A;  1MU2 A;  4E1M A;  2P1J A;  4CF9 A;  2RKI A;  3LWM A;  1U45 A;  1HYZ A;  1K6Y A;  3O3H A;  2YNF A;  5SZT A;  4FZX C;  1U48 A;  1D9D A;  4FJJ A;  1T05 A;  3TAP A;  3L3U A;  3QIN A;  4M3U A;  2JGU A;  3QNN A;  4O0J A;  1TL3 A;  1UA0 A;  1J5O A;  4DQS A;  4E7L A;  3AVF A;  3SUO A;  2G8I A;  4F8R A;  4CCH A;  3M8Q A;  2BGG A;  1S9E A;  4E3S A;  1WLJ A;  4CEZ A;  2D0A A;  1QSY A;  3ZSZ A;  1IH7 A;  3KKS A;  1QQC A;  1YTU A;  3C94 A;  5KGW A;  3VQQ A;  4CF2 A;  2X78 A;  5HLF A;  1W9H A;  1S6P A;  4JS4 A;  3V1R A;  1Q9Y A;  3IRX A;  3LAM A;  3P5J A;  3TR8 A;  1RDA A;  4CJV A;  5HRN A;  4YNQ A;  1NKB A;  1KFS A;  4FJL A;  1A5X A;  4J2A A;  4CEO A;  2E4L A;  4YFU A;  4OKJ A;  1KTQ A;  3QER A;  4ID5 A;  4CHQ A;  1FKP A;  5CYQ A;  1XC9 A;  4K8Z A;  3V9X A;  4KV8 A;  3ZSX A;  3I0R A;  4KHY A;  1EKE A;  4Z4H A;  1F21 A;  1S1X A;  1SV5 A;  2G8H A;  4KPY A;  1NJY A;  3AVN A;  3IAY A;  4KHU A;  1HQU A;  4FVM A;  4DSE A;  3A2F A;  3VQA A;  2ITG A;  3KD1 E;  1CXU A;  3SUP A;  4ZTF A;  3O3F A;  2VWJ A;  3VQ7 A;  4E7H A;  1RTH A;  4FJM A;  3I0S A;  1RT2 A;  5HP1 A;  5T7B A;  4LH5 A;  4IG3 A;  3VN5 A;  2A1R A;  1KVB A;  1JLB A;  3HPG A;  1HYS A;  4W5N A;  4HTU A;  1SL2 A;  4DTU A;  4C8K A;  4CGG A;  3DLB A;  1XHZ A;  4FJG A;  1ZBI A;  1WSF A;  1S1U A;  3NFA A;  1J54 A;  4KHN A;  4FJ8 A;  1A5V A;  1RT4 A;  4DQR A;  3ZT0 A;  4JLH A;  3TAR A;  1BGX T;  1SKW A;  5D3G A;  3HJF A;  1U04 A;  4HUG A;  4DLE A;  1FXX A;  4GW6 A;  3L2V A;  1JLG A;  1TAQ A;  4CF1 A;  3OVN A;  4Y1D A;  2YKN A;  4M3Y A;  4DWI A;  3PX6 A;  2ZQB A;  2B4J A;  2Z1H A;  3NF9 A;  4RW8 A;  4DU4 A;  3KLH A;  3NH1 A;  3K57 A;  1X9W A;  2A1S A;  3AV9 A;  3OYL A;  3ZT4 A;  3S9H A;  2OZM A;  2DTU A;  4FJH A;  3K5L A;  1TKD A;  4CJS A;  4Q5V A;  3C95 A;  4KAZ A;  2BAN A;  4B9L A;  3NDK A;  4AHS A; 
#chains in the Genus database with same CATH topology
 2NRR A;  3MX5 A;  3N4P A;  4H5W A;  4FLZ A;  1NG9 A;  4CFC A;  5KGX A;  3DLR A;  3VQ6 A;  3S41 A;  1V4S A;  3AA5 X;  2HST A;  3AVJ A;  4I7F A;  1KVA A;  1SKS A;  2XRI A;  3L6Q A;  3MEG A;  3A5M C;  3C0B A;  3HVT A;  3PIO L;  2OZS A;  3K5N A;  4F3T A;  4Q0B A;  4OKE A;  3AAR A;  3CC4 N;  4NXM K;  4A2A A;  2YI1 A;  3CIP A;  4YOV A;  2FBX A;  3TTF A;  2BUP A;  5H1S Q;  4RCH A;  2IVO A;  4BRP A;  1QQO A;  1B9D A;  1RCH A;  3MN9 A;  3PV8 A;  2O8C B;  1C0M A;  4OPK A;  4DF8 A;  2E1Z A;  4LF8 K;  2QI2 A;  5GIN A;  4JKD A;  3CXC M;  3QES A;  3G0Z A;  5AQJ A;  1RT6 A;  4RW6 A;  4BC5 A;  5AQQ A;  4DTN A;  4DFJ A;  3SI6 A;  5C2F A;  1BI4 B;  3OYD A;  4AHT A;  3VQ8 A;  4XH1 A;  1CLQ A;  3RMD A;  3SJH A;  1U4B A;  3H1V X;  3VA3 A;  1YHQ N;  2P9S B;  3KLG A;  5LL6 Z;  2HHS A;  4H0P A;  1DT9 A;  3OJU A;  3VEW A;  3EZ5 A;  1WSI A;  4CER A;  1TV6 A;  4IJN A;  3WNH A;  2GUI A;  5AQN A;  3LL3 A;  3O9T A;  4BR5 A;  1ASW A;  3M6G A;  3O9S A;  2OPS A;  2HBK A;  3THX A;  2QTD A;  4C8M A;  3IDH A;  5KQD A;  4M41 A;  2KLA A;  4DV6 K;  2FF6 A;  4W5O A;  3NF7 A;  2P9N B;  1OVQ A;  4BE2 A;  4BRC A;  4DQI A;  3J7Z O;  4CES A;  4J8F A;  3JYT A;  4DV7 K;  1L3T A;  4B3R K;  4WFN L;  4DHY A;  4F3O A;  4LF6 K;  4FXD A;  1KAZ A;  2NRV A;  3ULE A;  2GBZ A;  4BRL A;  2YNI A;  4OPJ A;  2O8B B;  1NWK A;  4JRP A;  3P31 A;  4RG8 A;  2ZWH A;  2QXF A;  1YI2 N;  4CGJ A;  4JV5 K;  1S1T A;  3LWL A;  2WC9 A;  4ID1 A;  3F73 A;  3FLC O;  3VEZ A;  4AH9 A;  4IDK A;  5FLX O;  1BDG A;  3O1W A;  3LDN A;  3I56 N;  1NK5 A;  4A5B A;  2E2Q A;  4DTR A;  4KH6 A;  3ZCM A;  4B9V A;  1O1W A;  4LFB K;  4RTF D;  1X9M A;  3I8D A;  3I33 A;  5C12 A;  1HNI A;  4CGI A;  2OPQ A;  1YT3 A;  4DSI A;  4DV4 K;  1NGI A;  2WON A;  3LP1 A;  1BL3 A;  1VK0 A;  1NK4 A;  1BIU A;  4J2B A;  1S1W A;  3MXM A;  3OA9 A;  4G1Q A;  3ZLJ A;  3L0Q A;  4M3R A;  1RGI A;  4FSV A;  4DUY K;  3V9W A;  3RTV A;  1IBM K;  2XHB A;  3HL8 A;  2YNH A;  1JXE A;  3RWU A;  3FE1 A;  3VF4 A;  3ZT3 A;  3HO1 A;  5AJ3 K;  1YIJ N;  4B3O A;  4DS4 A;  3DLE A;  3ENO A;  3CG7 A;  4ILH A;  1KFD A;  1GOC A;  5BRF A;  4LF5 K;  5KRT A;  2DFF A;  1UWB A;  4KB1 A;  4A5A A;  4FK0 A;  3K2P A;  3SUQ A;  4FLW A;  4BGB A;  4GKK K;  1E4F T;  4O44 A;  3AVI A;  3P38 A;  4B9Q A;  3L4Q A;  4KFB A;  4LSL A;  4CJE A;  1IKV A;  1DKG D;  3PIP L;  1K8K B;  3O1B A;  1WNS A;  4WQ5 A;  4JKF A;  4DG1 A;  3U4L A;  4PKG A;  4GMJ B;  4CIG A;  4I2Q A;  2YJF A;  3E9O A;  3SAG A;  3VF2 A;  4CZG A;  4YDU A;  5J1E A;  3DYA A;  5LMU K;  1SL0 A;  1GLD G;  3IG1 A;  5EVZ A;  3NGY A;  2Q97 A;  3OYJ A;  1Q81 O;  3HTV A;  3V4I A;  4BR7 A;  2HHX A;  3VOV A;  4DR4 K;  1NOZ A;  1LW0 A;  3VES A;  1NK7 A;  2A40 A;  3QEI A;  4CW7 B;  4DLG A;  3DXM B;  4PUO A;  4YOT A;  2OCE A;  4IEE A;  4EP5 A;  3HST B;  5M1Q A;  4FM0 A;  4FJI A;  4RWT A;  4CIE A;  3EYZ A;  2VCP A;  4B1X B;  3DRR A;  3SAF A;  4KHQ A;  1D8Y A;  1VSK A;  4NB4 A;  2JWK A;  3M3Z A;  1JL2 A;  5KPZ A;  4CZK A;  2Q36 A;  3BUZ B;  3MEE A;  3OYA A;  4Z94 A;  4M7X A;  2VGM A;  1HNV A;  4KH5 A;  4BWJ A;  4IG0 A;  2P9I B;  4E89 A;  4YY3 K;  3O6W A;  2FSN A;  4LF7 K;  4BR0 A;  2ZJP L;  3LDQ A;  1NJZ A;  1HX1 A;  4ELT A;  5AZI B;  3ZET A;  1RDD A;  2P9K B;  4JYA K;  1BU6 O;  2AP1 A;  3KHY A;  5J2N A;  5JS2 A;  2ASM A;  4DR6 K;  3LPT A;  2HB5 A;  1TKX A;  4BC2 A;  4C23 A;  4WQ4 A;  4EP4 A;  3CPW M;  1NNE A;  5BPL A;  4Z4F A;  3BDP A;  2YHA A;  2DFE A;  3D7E O;  4CEF A;  5HBM A;  3RVC A;  1N36 K;  1JLE A;  3FFI A;  3OS2 A;  4KRE A;  3O5B A;  5IT9 O;  2NRW A;  3QFU A;  4C8N A;  2KFZ A;  1D9F A;  4DSJ A;  1WN7 A;  1N8R O;  5AR0 A;  1FK9 A;  4FCY A;  3TSQ A;  2F9W A;  1T44 A;  2F96 A;  3U3G A;  1XHX A;  3WXI A;  5FRN A;  2CH5 A;  4JNE A;  1QS4 A;  1I39 A;  4KI6 A;  4IFV A;  4AQY K;  3ISN C;  3V1O A;  2E6L A;  3SK3 A;  3SZ2 A;  2GX9 A;  3TAE A;  1S6Q A;  4H4M A;  2ZGZ A;  1C0G A;  4FWO A;  4A57 A;  3ZEU A;  1BCO A;  4L8R B;  2GV9 A;  2EX3 A;  2OA8 A;  3ZX0 A;  1E3M A;  2O8E A;  1ITG A;  1LAV A;  1NKE A;  4DR1 K;  4XIU A;  2G8F A;  2NZT A;  3H08 A;  3M1F A;  3SNN A;  4DTM A;  1KXP A;  4GV6 A;  2I7P A;  4WE1 A;  3PX4 A;  3V9Z A;  3D2E A;  4JD2 B;  3VQ5 A;  4OX9 K;  1VQ5 N;  1EX4 A;  1EWQ A;  3ZSO A;  2Q0U A;  3CME N;  1RFQ A;  3ATU A;  4GV9 A;  4BR4 A;  1G99 A;  1MU2 A;  2UXC K;  4CF9 A;  4MO5 A;  1K6Y A;  2UUA K;  2JGU A;  1TL3 A;  3QFP A;  4DQS A;  4E7L A;  3SUO A;  3CCE N;  2G8I A;  4AF1 A;  1WOQ A;  3M8Q A;  2E2P A;  4CEZ A;  3KKS A;  2X78 A;  4JS4 A;  3LAM A;  3AAP A;  3THY A;  1KFS A;  4BQL A;  1A5X A;  5BPM A;  4YFU A;  1JCG A;  4L3Q A;  4ID5 A;  5CYQ A;  3V9X A;  3R3L A;  1IBK K;  1F21 A;  4KPY A;  1NJY A;  3AVN A;  4KHU A;  4LF4 K;  1HQU A;  4FVM A;  4QS8 A;  4YHH K;  2WFB A;  3THX B;  3SUP A;  2QW9 A;  3D2F A;  3I0S A;  4LH5 A;  1JLB A;  5ADX A;  4HTU A;  4DTU A;  4FJG A;  1WSF A;  2I7N A;  4JLH A;  3HJF A;  1BGX T;  3R6M A;  4HUG A;  1FXX A;  4GW6 A;  3WT0 A;  2OAN A;  4DKW A;  4M3Y A;  4DWI A;  3MX2 A;  4RW8 A;  4DU4 A;  4OPH A;  5AQU A;  3TTD A;  1X9W A;  2A1S A;  3ZT4 A;  4DV5 K;  1JCF A;  4Q5V A;  3C95 A;  5ELZ A;  3CHW A;  3OYF A;  4B9M A;  2WUS A;  3DXK A;  4BDZ A;  1Q7Y O;  1RDB A;  2QWO A;  2PFU A;  2A5X A;  1N6Q A;  4CHN A;  3UKU A;  1C1C A;  3OYH A;  4H0V B;  2V52 B;  1JJ2 M;  3T7Z A;  1VQL N;  3K5M A;  3CMA N;  3SYZ A;  1YAG A;  2HHH K;  3OS1 A;  2P9L A;  3AA3 A;  3CC2 N;  2PY5 A;  5AQF A;  1B9F A;  1VRU A;  3CC7 N;  2BH1 A;  2QA4 N;  2VWB A;  3AVC A;  1OH7 A;  2EHG A;  3SV3 A;  2BDP A;  1I3A A;  1ZBS A;  3SV4 A;  3QEP A;  1ATN A;  1REV A;  2FSJ A;  2QXL A;  4OPA A;  4JI5 K;  5EXW A;  1WBB A;  3AA4 A;  1TK0 A;  2GWJ A;  4IFY A;  2X6S A;  4ICL A;  2JLE A;  1LWF A;  4Z0U A;  5HRP A;  3IS9 A;  4O8U A;  3MN7 A;  3OYI A;  3CCU N;  4CGF A;  4XH4 A;  3T1Y K;  2E8A A;  2PZS A;  4JK8 A;  2FC0 A;  4KO0 A;  5E26 A;  3VEV A;  3LP2 A;  1VSH A;  3SBT A;  2E2O A;  1VQN N;  4JI4 K;  3CM5 A;  1KQS M;  2UXD K;  4QS9 A;  3OYM A;  3CCM N;  1JCE A;  1HJO A;  3MEC A;  2BTF A;  1KRP A;  4JKC A;  1B92 A;  3GG4 A;  3SJJ A;  3HRG A;  4AHR A;  1NGE A;  3FZF A;  3VGK A;  3ZSW A;  4M3W A;  4MDA A;  1M1K O;  4JKE A;  1CZB A;  3FZL A;  2KFN A;  4IXC A;  3KK2 A;  4IKF A;  2VGN A;  3E66 A;  4GVM A;  2I5J A;  4QOZ B;  4DFK A;  1ATR A;  4B1Z A;  5AQP A;  3TAM A;  4PY5 A;  3C6T A;  2QEX N;  3VGM A;  3ALY A;  1VQ8 N;  1JXB A;  3VET A;  3CCL N;  4LD0 A;  2IC3 A;  4JK7 A;  3NF8 A;  1NJW A;  4O5B A;  3KIO A;  3TAN A;  4CJQ A;  3ZT1 A;  5AQM A;  4FZY A;  4IEI A;  2OTL N;  3NVM A;  2IOC A;  3U6F A;  1DTT A;  4CJU A;  3M8P A;  1U2V A;  2IAJ A;  1E4G T;  4W5T A;  3I55 N;  1SKR A;  2YCH A;  4NCG A;  4CZM A;  1YIT N;  4KHW A;  2KQ2 A;  3AVL A;  3DRS A;  2YHY A;  1RDW X;  3FZK A;  4JHD A;  2OPR A;  2GUP A;  3L4I A;  5BN8 A;  2P51 A;  3AGR A;  1EO1 A;  4FZZ A;  3BF3 A;  4Y0W A;  1L5U A;  1K73 O;  2JWL A;  4O4G A;  3W0L A;  4JK9 A;  4XH5 A;  3TAG A;  4IDH A;  3RSE A;  1TYQ B;  2V7Y A;  4AM7 A;  3QB0 A;  3HI0 A;  4F9O A;  5EU7 A;  1D4X A;  1D5A A;  4E1J A;  1LW2 A;  5MLC Q;  5JIC A;  1T7P A;  4B1U B;  3ZX3 A;  3E9P A;  5LJW A;  2HMI A;  1KLM A;  3V6D A;  5GAH P;  3ZSY A;  4N76 A;  3ZET B;  1WSJ A;  3TPQ A;  2XY6 A;  3CFP A;  1ASU A;  3LDO A;  1HPZ A;  3NAE A;  1ILY A;  3K9K A;  3CJ1 A;  3J7Y P;  1Q8I A;  4HCC A;  3AO4 A;  1XWL A;  1N32 K;  3CCJ N;  3KK1 A;  4M42 A;  3WXM B;  2D0C A;  5E84 A;  3PO4 A;  3DAW A;  1RNH A;  3WEE B;  4AHC A;  3AVG A;  4O5F A;  4PA1 A;  3VQ9 A;  3JXU A;  3OBW A;  5J2M A;  2QWL A;  2B6A A;  2HBM A;  4DU3 A;  3M8R A;  5FDL A;  3F5T A;  1SQK A;  3J80 O;  3A5O C;  1VQ9 N;  2HHW A;  2UUB K;  4FWR A;  4BRH A;  2NRH A;  2A6A A;  2W42 A;  2ATQ A;  4KTZ A;  1TKZ A;  5BRE A;  1VQK N;  1U6Z A;  4CJF A;  2X6N A;  2ETJ A;  3OYK A;  1XNQ K;  4KTW A;  4LFA K;  3HSC A;  4CED A;  4NXN K;  5JVH L;  4JI1 K;  1JL1 A;  1JLC A;  1IJJ A;  4EHT A;  5AQT A;  5KTQ A;  2YHX A;  1GLL O;  3MWT A;  3MWP A;  3ZEU B;  2AJQ A;  1IKY A;  3EN9 A;  2HW3 A;  3Q7C A;  2O8E B;  4I6M B;  4K25 A;  1S3X A;  2OPP A;  2RPI A;  5M1K A;  2ITM A;  5DMR A;  4M63 C;  4BRG A;  3IMX A;  3NGZ A;  3U9D A;  2HHV A;  2QKB A;  1NGJ A;  3CJ9 A;  3DI6 A;  2FXU A;  5BR8 K;  4DTS A;  1VSM A;  1OH5 A;  4M3T A;  3D2E B;  3OYC A;  2YKM A;  2XY5 A;  3SQ1 A;  5C2D A;  3KVG A;  1RT3 A;  3CFR A;  3TAQ A;  1ZBH A;  5AQW A;  1TAU A;  4FWQ A;  2ZD1 A;  2X74 A;  2F4V K;  1NGB A;  4DTO A;  4H5V A;  4OGE A;  4CFD A;  4CE9 A;  3Q7B A;  3RMA A;  5J2P A;  3A0I X;  3AVM A;  1YUW A;  4DQP A;  1H1V A;  2W6K A;  1IG8 A;  4MDB A;  4FK2 A;  4Z4I A;  4RW7 A;  2AA4 A;  3QEW A;  3UIQ A;  1BQM A;  1VSJ A;  3DWL A;  4CZL A;  5SWM A;  2NUB A;  3NHG A;  4F2R A;  5HRS A;  3M5R A;  3AGK A;  3C6A A;  3ZT2 A;  3F9M A;  2P9P A;  2XY7 A;  1HNX K;  1YXQ A;  2LSN A;  2G8W A;  3NCI A;  2H3G X;  2PBD A;  3W3D A;  4HVJ A;  3D2F B;  5B8H A;  2IDO A;  5HRO A;  3IUC A;  4AM6 A;  1R59 O;  4DQQ A;  1NGC A;  2E5L K;  4IOA L;  4DFM A;  4CEB A;  5CZ1 A;  4CD1 A;  3N4Q A;  1IKW A;  3K9J A;  2YHB A;  5M1F A;  1YJW N;  1NMN A;  5FPE A;  3CCQ N;  2FLO A;  4BDY A;  2O8F A;  3DXK B;  3AVA A;  4GY2 B;  1C1A A;  4CJR A;  2HND A;  5GAE P;  3UKU B;  4JI0 K;  5CYM A;  5C42 A;  3T3F A;  4DQ8 A;  1NBW A;  1RDC A;  1VSL A;  3MN5 A;  3SCX A;  3G6E N;  2FBV A;  1K8A O;  3WXK A;  1CZA N;  1NLV A;  2NRT A;  1L3V A;  3EE9 A;  3MXJ A;  2CGK A;  4BRM A;  4CBW A;  4HUE A;  4ZHR A;  4IJA A;  4IWV A;  3KJV A;  4CHO A;  4FLV A;  4OGC A;  4PL7 A;  3QML A;  4KHP K;  4DCH A;  3O3H A;  2YNF A;  4H0X B;  4FZX C;  4BRA A;  4JN4 A;  3TAP A;  4O0J A;  1J5O A;  3U8X A;  3OW2 M;  3AVF A;  4LFC K;  4F8R A;  3WXL A;  1S9E A;  3JAM O;  3K0S A;  3ZSZ A;  3KWG A;  4CBU A;  1FJG K;  3VQQ A;  5M1O A;  4GVE A;  4U7B A;  5LJV A;  5HRN A;  2E4L A;  1GLB G;  4OKJ A;  3QER A;  3ZSX A;  4KHY A;  1ZC6 A;  3A8Y A;  4K42 A;  4LF9 K;  2G8H A;  3GOI A;  2W41 A;  2VYP A;  3IAY A;  1W7A A;  2RE2 A;  3O3F A;  3H3N O;  4E7H A;  2O8D A;  2GWK A;  4FJM A;  1RT2 A;  1T3V A;  5HP1 A;  3VN5 A;  1KVB A;  3PLA A;  3FZH A;  4MLE A;  4CGG A;  1XHZ A;  1N33 K;  1S1U A;  3R9P A;  1J54 A;  1A5V A;  1SKW A;  3TAR A;  3ZT0 A;  1U04 A;  4DLE A;  2E20 A;  2NLX A;  5DM6 L;  2YKN A;  2B4J A;  4EHU A;  4H5N A;  3K5L A;  4CJS A;  3GL1 A;  2BAN A;  4CZF A;  3PY8 A;  4B9L A;  3RMC A;  4KTQ A;  4F4K A;  3QEV A;  1NMD A;  4PHT X;  4BDP A;  4CEA A;  5AFU A;  3HYF A;  1NU0 A;  1RTD A;  5CZ2 A;  4BGA A;  5AZJ B;  2P5O A;  1U2V B;  4NO7 A;  4DV0 K;  4CJ3 A;  4CF0 A;  2G8U A;  3AVK A;  1RBR A;  4N56 A;  3EY1 A;  3TAF A;  3TU5 A;  1BA0 A;  1ZBF A;  3SMS A;  4JHD B;  5ADX H;  5LMN K;  3J8A A;  3HK2 A;  4JKG A;  4BRD A;  2UU9 K;  4BRO A;  2WBN A;  1T6D A;  2ZE2 A;  3MCA B;  1BCM A;  1C0U A;  4NLC A;  3MAQ A;  4XEI A;  1TGO A;  2YX6 A;  4M7Y A;  3WNG A;  3V9S A;  4E7J A;  4PWD A;  4X62 K;  1BQN A;  3L2W A;  4A59 A;  2D0P A;  2KZM A;  3DLH A;  1XI1 A;  1YTA A;  4AHU A;  4K0K K;  5JMV A;  1O13 A;  4EIA A;  4I9Q A;  1IV0 A;  3CJA A;  4DV1 K;  4CZH A;  2A42 A;  3AAQ A;  4CHP A;  1DEJ A;  1GLJ O;  5KI6 A;  1RBS A;  4ISG A;  3TI0 A;  4DTX A;  1RBV A;  4CJW A;  4FWN A;  3D0P A;  4KRF A;  4MLH A;  3KD5 E;  4OKK A;  4BC3 A;  4DR5 K;  3O9R A;  4FW2 A;  4BRE A;  3NMU A;  2VG5 A;  1QQN A;  3ENB A;  4DS5 A;  3L8B A;  3HVR A;  3THW A;  2HHU A;  1XC3 A;  3HPO A;  2YNG A;  5FPN A;  3RR8 A;  4OLB A;  4CHZ A;  3LDP A;  3QDK A;  3IKM A;  4B08 A;  3K58 A;  3H3O B;  4X64 K;  3WNF A;  1WSE A;  4WFB L;  4X66 K;  2F9T A;  1RT5 A;  1BHL A;  1W0H A;  3VTH A;  4YOW A;  4JI7 K;  4FYD A;  3SQ2 A;  3OBY A;  3KKR A;  1A5W A;  4FOI A;  3S3O A;  2NRZ A;  4IO9 L;  2ZJR L;  1J5E K;  3BZC A;  3T69 A;  4CJ4 A;  3SUN A;  1S5J A;  2HVI A;  3KK7 A;  5J2Q A;  2WTU A;  4H0T B;  4H0O A;  3QO9 A;  4Z4C A;  1UA1 A;  4QS7 A;  4RW9 A;  3O8M A;  4CD3 A;  4OLA A;  3OTO K;  3GBT A;  2HHQ A;  3ULE B;  3VQP A;  2P5G A;  4WF9 L;  4CJT A;  1OVY A;  3NVK A;  3QIO A;  3SQ4 A;  4JS5 A;  3CCS N;  3O9Q A;  2DFH A;  3NBP A;  3P39 A;  4LY7 A;  2VQE K;  3ZX2 A;  3AY9 A;  3C65 A;  3MDQ A;  2F8S A;  3V81 A;  3TAB A;  3MN6 A;  3B6P A;  2PYL A;  1RT1 A;  4WYB A;  2EWS A;  4BAC A;  2VQF K;  4B8A B;  3VQ4 A;  5GAG P;  2VG6 A;  1R0A A;  3QEX A;  3O3G A;  4B3M K;  3T1A A;  1M90 O;  1ZXO A;  3CF5 L;  3TSU A;  4CJK A;  4BR9 A;  1SAZ A;  3R8E A;  3G71 N;  1TVR A;  2UUC K;  3U9Z A;  3LAL A;  5AQI A;  3S3N A;  3LP0 A;  3KK3 A;  1RIL A;  4FPA A;  1VSD A;  1JLA A;  2Y1I A;  5AQL A;  4BRF A;  3CER A;  3DOL A;  4DUZ K;  5E41 A;  1KD1 O;  3ZSQ A;  1OH6 A;  1YF5 L;  3B8A X;  1IO2 A;  2P9P B;  1QE1 A;  3RRH A;  4BWM A;  1T03 A;  3HP9 A;  3VF6 A;  4EZ9 A;  5M1P A;  2IVN A;  1S72 N;  1G15 A;  1VRT A;  5AQV A;  4BRI A;  4DFP A;  4DF4 A;  1RBT A;  3QNO A;  4C8O A;  4H8K A;  4KBO A;  4RW4 A;  4B8C A;  4BRN A;  2D0B A;  4ELU A;  1GLF O;  1WAJ A;  2QWM A;  4BVO A;  1ZYQ A;  4KI4 A;  1L3S A;  4G9Z A;  3A5N C;  3AVB A;  2GTD A;  4KKO A;  5KPR A;  2GEL A;  5C10 A;  3SAH A;  2B5J A;  5AQX A;  2O8F B;  2HVH A;  3MCP A;  3VTI A;  4JAX A;  5JLH A;  4C1N I;  1RDU A;  3BF1 A;  1SL1 A;  3K59 A;  4FWP A;  4C1N K;  4BY9 C;  1C0F A;  5AQH A;  4IZ9 A;  5KPT A;  2WOM A;  3AA2 A;  3F9K A;  3CM6 A;  4CJP A;  2P9I A;  4H5T A;  2CGL A;  2IVP A;  3LDS A;  1EWR A;  2IGI A;  1ESV A;  1K9M O;  1EXQ A;  4CBX A;  2CH6 A;  3HOS A;  1GOA A;  4IFE A;  3H1Q A;  1T8E A;  2HF4 A;  5EY4 A;  3EKU A;  4FWL A;  3D45 A;  1X1P A;  3P83 D;  2G8V A;  5JLF A;  3T1H K;  1X9S A;  2A41 A;  1DTQ A;  3L2R A;  1CXQ A;  4E19 A;  1C0T A;  1QSS A;  3MXI A;  3LDL A;  5AQZ A;  5I9E B;  3WXJ A;  4JKB A;  3CFO A;  2D5R A;  2Q3S A;  4CVN E;  5FRO A;  4FJX A;  4W5Q A;  1OKJ A;  4MO4 A;  4N5S A;  4FPB A;  4KH4 A;  3OS0 A;  1Q82 O;  4DR7 K;  2O4I A;  1WAF A;  1NJX A;  1RBU A;  3LM9 A;  1LCU A;  3ATV A;  4PQU A;  2E2N A;  1TKT A;  4B9S A;  3VQC A;  3CQX A;  1TK5 A;  1Q86 O;  3LZI A;  5C24 A;  3SBG A;  3R1X A;  1NGA A;  2RF2 A;  5JVG L;  1LWC A;  2O8D B;  3G10 A;  1ZBU A;  1HNZ K;  3L2Q A;  3DMJ A;  3ZSR A;  4Y1C A;  5FRM A;  3LP3 A;  1KAX A;  4KB0 A;  2Q0R A;  4BE1 A;  3BP8 A;  1UAX A;  4FK4 A;  4IOC L;  4NCB A;  4CIF A;  3FZM A;  4IO8 A;  5I3U A;  3C6H A;  5F0X A;  4DV2 K;  2FBY A;  4FJN A;  3E1Y A;  4BR2 A;  3ID8 A;  4CGD A;  2Z1G A;  4ZTJ A;  2RHK A;  4NLB A;  3SPZ A;  1ATS A;  3KTQ A;  1HKC A;  4JD2 A;  4FOE A;  2HF3 A;  1MWM A;  4QAG A;  5BPN A;  1L3U A;  1FKO A;  4V19 S;  4FJ7 A;  4Z4G A;  5HL7 L;  4HUF A;  2Z1I A;  3IFR A;  2ZGY A;  1QZ5 A;  5KQ8 A;  3BY5 A;  5DM7 L;  1EQY A;  4JI2 K;  3B6O A;  4IBN A;  4JKG B;  4M3X A;  4FJK A;  2OYQ A;  4ILJ A;  5F1X A;  5FPD A;  2XO7 A;  3OJS A;  1KLN A;  1XUP O;  1Y97 A;  5CY4 A;  5TKW A;  3OHR A;  3D6R A;  5GAD P;  3C7N A;  1U48 A;  2Q1N A;  3HZ6 A;  3L3U A;  4M3U A;  4CZJ A;  1MWK A;  3VEN A;  2ZJQ L;  4E3S A;  1WLJ A;  4HTL A;  2D0A A;  1QSY A;  3CPE A;  1QQC A;  1YTU A;  3C94 A;  5KGW A;  2YJE A;  4CF2 A;  3O9U A;  5HLF A;  1W9H A;  1N34 K;  3V1R A;  3J81 O;  3IRX A;  3P5J A;  1Q9Y A;  1RDA A;  4CJV A;  4YNQ A;  3BEX A;  1NKB A;  4FJL A;  1VQO N;  4CEO A;  2KKZ A;  1KTQ A;  1FKP A;  2P9U A;  1XC9 A;  5IWA K;  4KV8 A;  3CCR N;  3I0R A;  1S1X A;  1SV5 A;  1HPM A;  3THW B;  4DSE A;  3KZB A;  3VQA A;  4UY8 O;  4ZTF A;  2HMP A;  2VWJ A;  1Z6R A;  3VQ7 A;  4WQ5 C;  3HBT A;  2A1R A;  2ASO A;  5T7B A;  3QIC A;  1VQP N;  3HPG A;  1HYS A;  4W5N A;  4C8K A;  1ZBI A;  3DLB A;  2UXB K;  2W40 A;  3JS6 A;  4FJ8 A;  1RT4 A;  4DQR A;  5D3G A;  3THY B;  5BRD A;  3FGU A;  1JLG A;  1TAQ A;  4U67 L;  1NGH A;  3OVN A;  4YDU C;  2D0O A;  2ZQB A;  3NF9 A;  3KWI A;  3NH1 A;  4EFH A;  3K57 A;  1W2B M;  2OTJ N;  4JKA A;  4B3S K;  2OZM A;  2DTU A;  4FJH A;  5M1N A;  1TKD A;  3WUH A;  2E1Y A;  5AQG A;  4FWS A;  4CEE A;  3G4S N;  1MA9 B;  4AHS A;  3RMB A;  2XY8 A;  4BRQ A;  5FPM A;  2ASP A;  3P1G A;  1YVU A;  3TTC A;  2O4G A;  3NH0 A;  3ZSV A;  3TSP A;  1XMO K;  1NKC A;  3VQB A;  1LAW A;  4M3Z A;  1Z25 A;  1S1V A;  3UKR A;  1U49 A;  3CJ7 A;  1KCF A;  4B1W B;  3PX0 A;  1SZ2 A;  4ISF A;  1GLE G;  4E0D A;  5AQK A;  1GOB A;  3OYB A;  3VEX A;  1NK9 A;  4FWK A;  4PL8 A;  1BIZ A;  4GKJ K;  2KZZ A;  1QQM A;  1WSG A;  3C6U A;  4HHT A;  4BQZ A;  2QK9 A;  4ILG B;  1JKH A;  4BE0 A;  3H45 C;  1HMV A;  1V4T A;  1HLU A;  4N47 A;  1I94 K;  3H6E A;  4CGH A;  3LAN A;  3DLK A;  2CGJ A;  5A2Q O;  3THV A;  2P9L B;  1LV5 A;  4FLY A;  2FBT A;  5AFU H;  4I9L A;  5HRR A;  4B9T A;  5DK5 A;  2ZM6 K;  1J9A A;  3HM9 A;  1KAY A;  3GDQ A;  3WQU A;  3LZJ A;  3O4W A;  1Q18 A;  1NK8 A;  1MDU B;  3ASM A;  4R5P A;  1NK0 A;  2PYJ A;  3DLL L;  5CE3 A;  3VQD A;  1Q9X A;  1RT7 A;  3QBW A;  3L3V A;  2QKK A;  3LPU A;  1OH8 A;  4FL9 A;  2GEM A;  3U3Y A;  5BN9 A;  1EP4 A;  3SMP A;  1X3N A;  4WQ4 C;  3O4Q A;  3J7A P;  3LM2 A;  2QWN A;  4LH4 A;  5LY3 A;  4FLU A;  4B3T K;  4FW1 A;  1N5Y A;  2F8T A;  1BIS A;  4QCL A;  2HBJ A;  1LWE A;  3TWH A;  4B9U A;  4CK1 A;  4H5R A;  1QTM A;  1KVC A;  4OJR A;  1XNR K;  1NK6 A;  4J2E A;  4YOR A;  4WFA L;  5C0Y A;  2HOE A;  4DTP A;  4FLX A;  4WCE L;  3QIP A;  2BE2 A;  4CHY A;  3NE6 A;  3OYN A;  1TYQ A;  3VEO A;  4B1V A;  3NF6 A;  1QSL A;  3AO3 A;  3A5L C;  4O8K A;  5KRS A;  4CK2 A;  1T6C A;  1VSI A;  3CD6 N;  1P90 A;  3DJC A;  4FJ5 A;  2HHT A;  2KTQ A;  4FVU A;  4JI8 K;  4DTJ A;  3I8B A;  1DLO A;  2QWR A;  1FW6 A;  4FLT A;  1HJR A;  1HQE A;  1J6Z A;  3CQY A;  1HKB A;  2RN2 A;  4DSF A;  4NYF A;  2O8C A;  2J4R A;  4DSK A;  3AVH A;  3RR7 A;  2HNZ A;  4NYN A;  3WEE A;  3KLE A;  1J53 A;  4DR3 K;  3DM2 A;  1BWF O;  3S3M A;  1C1B A;  4K41 A;  1BI4 A;  1NOY A;  2A3Z A;  5EX5 A;  4OVL A;  3HOT A;  1S9G A;  4IOX A;  3RSE B;  4DR2 K;  1UOC A;  2FF3 B;  1HNW K;  4W5R A;  1LOT B;  1X3M A;  2P9S A;  2QWQ A;  2R7Y A;  1X9J A;  4KHS A;  1TK8 A;  3NH2 A;  5TKY A;  2V7Z A;  1VQM N;  5C15 A;  1S22 A;  1QVF M;  3HP6 A;  4Z4E A;  1QVG M;  3SQ0 A;  3P4I A;  4C8L A;  1WBD A;  4H03 B;  4DMN A;  3HM8 A;  4E7K A;  5I42 A;  3CJB A;  4EAH D;  4E1N A;  4JRQ A;  3KLI A;  4O0I A;  1XMQ K;  4B9N A;  2P9N A;  3EE8 A;  3K5O A;  4ISE A;  3PUF A;  3PSI A;  4OO1 J;  2Z1J A;  3O80 A;  3CQ8 A;  4I6M A;  3RRG A;  5GIO A;  2UYT A;  1QHT A;  5HOO A;  3OY9 A;  5F2R A;  3VEY A;  3FR0 A;  4DV3 K;  3ID6 A;  1RTJ A;  1RTI A;  1ZBL A;  3ITH A;  2Y1J A;  2QM1 A;  4YOU A;  2HBL A;  4UQG A;  2O8B A;  1IKX A;  3MMV A;  4N41 A;  3VGL A;  3PO5 A;  1TL1 A;  2KHO A;  1NJI O;  1NGD A;  1Z05 A;  1WSH A;  4CJL A;  5AQS A;  3LAK A;  1VSF A;  1EET A;  3M8S A;  4M45 A;  1TUU A;  3WQT A;  1TUY A;  4H4O A;  1JLF A;  4AIL C;  1IG9 A;  2PAV A;  3H46 O;  4B1Y B;  4CI6 A;  1DGK N;  1GLC G;  1VHX A;  4CJ7 A;  4YOX A;  3DRP A;  2KW4 A;  3HXM A;  2E6M A;  3AO5 A;  3GE1 A;  2DY4 A;  4CJ5 A;  5C25 A;  1Z26 A;  2DPN A;  4O55 A;  4MQ3 A;  2ZF5 O;  4CEQ A;  3CJC A;  4BG9 A;  1NM1 A;  2YV0 X;  1CZ9 A;  5BR9 A;  3C7N B;  5CR4 A;  4A2B A;  1HKG A;  4HWI A;  4FM1 A;  3O4N A;  4A62 A;  3E01 A;  4J2D A;  5K14 A;  5BRH A;  2YHW A;  1SUQ A;  4DB3 A;  1VQ7 N;  3SLC A;  1YVN A;  1HRH A;  4NCA A;  4FM2 A;  3T19 A;  3VA0 A;  1WUA A;  4F2S A;  3OYG A;  2P9U B;  3DLG A;  1K8K A;  3V1Q A;  3DOK A;  4CK3 A;  3EEQ A;  4K8X A;  3EL2 A;  4R79 A;  4PKI A;  4CFA A;  2Q31 A;  1U47 A;  4MFB A;  4JEP A;  3CI5 A;  2IS3 A;  4CZI A;  4FO0 A;  4I2P A;  4BG8 A;  4LSN A;  4DSL A;  3BGR A;  3SPY A;  4CEC A;  4A61 A;  4E7I A;  2VG7 A;  3F2K A;  3QLH A;  2W6L A;  2HNY A;  3G25 A;  4TSX A;  3E9L A;  3MK6 A;  4HCB A;  4CFB A;  3V9U A;  3VQE A;  3JSM A;  4PKH A;  3HT3 A;  1BG3 A;  4CF8 A;  3DXM A;  3VPZ A;  3WNE A;  5JS1 A;  4CZE A;  4FJ9 A;  2VWK A;  1BA1 A;  3HPH A;  3NGI A;  1JLQ A;  3CYM A;  1KSP A;  3KLF A;  3L2U A;  1VQ6 N;  3UKR B;  5AQR A;  4BC4 A;  3EZW A;  2F7T A;  3OYE A;  1W97 L;  1WB9 A;  1IBL K;  3ULD A;  4JKH A;  4AHV A;  3AO1 A;  4EZ6 A;  1VAZ A;  1QHA A;  2D1K A;  5EOY A;  2FSK A;  1HYV A;  1C6V A;  2E88 A;  3QET A;  4BRK A;  4LC9 B;  1ASV A;  5AQO A;  4YOY A;  1VSE A;  3CET A;  3MED A;  3AO2 A;  2G8K A;  4DU1 A;  1QZ6 A;  1SS6 A;  4ELV A;  4E1M A;  2P1J A;  3ZYY X;  2RKI A;  3LWM A;  1U45 A;  1BUP A;  1HYZ A;  5SZT A;  3QBX A;  1D9D A;  4FJJ A;  1T05 A;  3ENH A;  3QIN A;  4K43 A;  3QNN A;  3PSF A;  1UA0 A;  5GIP A;  3EO3 A;  4GNI A;  3VMF B;  4CCH A;  2BGG A;  1YJN N;  5AZI A;  1IH7 A;  1BOT O;  1P8Z A;  1Y64 A;  2P9K A;  1S6P A;  4H0Y B;  1HUX A;  3TR8 A;  4J2A A;  2IIR A;  2Q2R A;  3BZK A;  4JI6 K;  4CHQ A;  4K8Z A;  1GLA G;  1EKE A;  4Z4H A;  3O08 A;  5AQY A;  3A2F A;  2NRX A;  3EKS A;  2ITG A;  3KD1 E;  1VQ4 N;  1CXU A;  4X65 K;  1HR0 K;  2V51 B;  3CCV N;  1RTH A;  3FFK B;  4IG3 A;  1XQS C;  3UE5 A;  1SL2 A;  3VER A;  4FWM A;  4GV3 A;  2D4W A;  3NFA A;  5AZJ A;  1NGF A;  4KHN A;  3UB5 A;  2NNW A;  5CHI A;  3L2V A;  1YJ9 N;  4CF1 A;  4BVP A;  4JI3 K;  4Y1D A;  1NGG A;  1BO5 O;  3PX6 A;  2Z1H A;  3KLH A;  3AV9 A;  3OYL A;  3S9H A;  2QWP A;  1KC8 O;  4KAZ A;  3NDK A; 
#chains in the Genus database with same CATH homology
 4B9M A;  3RMC A;  4KTQ A;  2XY8 A;  3QEV A;  4BDZ A;  4FLZ A;  1RDB A;  3P1G A;  1YVU A;  4CFC A;  5KGX A;  2O4G A;  4BDP A;  4CEA A;  3NH0 A;  3ZSV A;  3HYF A;  3DLR A;  3VQ6 A;  1NKC A;  1RTD A;  5CZ2 A;  3VQB A;  1N6Q A;  4CHN A;  1C1C A;  1LAW A;  3OYH A;  1Z25 A;  2P5O A;  4M3Z A;  3AA5 X;  1S1V A;  4CJ3 A;  4CF0 A;  3K5M A;  2G8U A;  3AVK A;  1U49 A;  3SYZ A;  1KCF A;  1RBR A;  3AVJ A;  4I7F A;  4N56 A;  3OS1 A;  3PX0 A;  1KVA A;  3EY1 A;  3AA3 A;  3TAF A;  1SKS A;  2XRI A;  3MEG A;  1ZBF A;  2PY5 A;  4E0D A;  1B9F A;  1GOB A;  3HVT A;  1VRU A;  3OYB A;  2OZS A;  3K5N A;  1NK9 A;  3HK2 A;  4F3T A;  4Q0B A;  4OKE A;  3AVC A;  1BIZ A;  2ZE2 A;  2EHG A;  2FBX A;  3SV3 A;  2BDP A;  1I3A A;  3SV4 A;  2KZZ A;  1BCM A;  1C0U A;  3QEP A;  3MAQ A;  1WSG A;  1REV A;  3C6U A;  1TGO A;  4HHT A;  1B9D A;  3WNG A;  1RCH A;  3V9S A;  2QK9 A;  4E7J A;  4PWD A;  3PV8 A;  1JKH A;  4BE0 A;  1BQN A;  3AA4 A;  1TK0 A;  1HMV A;  4IFY A;  1C0M A;  2X6S A;  4ICL A;  2JLE A;  4N47 A;  1LWF A;  4Z0U A;  3L2W A;  2KZM A;  4CGH A;  5HRP A;  3LAN A;  3DLK A;  4OPK A;  4DF8 A;  3IS9 A;  3THV A;  1XI1 A;  1YTA A;  4AHU A;  3DLH A;  1LV5 A;  3QES A;  4I9Q A;  3G0Z A;  3OYI A;  4FLY A;  2FBT A;  4CGF A;  1RT6 A;  2PZS A;  4RW6 A;  4I9L A;  2FC0 A;  4KO0 A;  5HRR A;  4B9T A;  3LP2 A;  4DTN A;  4DFJ A;  3SI6 A;  5DK5 A;  1J9A A;  1VSH A;  3HM9 A;  3LZJ A;  4CHP A;  5KI6 A;  1RBS A;  1BI4 B;  3ASM A;  3CM5 A;  4R5P A;  3OYD A;  1NK8 A;  3TI0 A;  1NK0 A;  2PYJ A;  3OYM A;  4DTX A;  3VQD A;  1RBV A;  4AHT A;  4CJW A;  3VQ8 A;  1Q9X A;  1CLQ A;  1RT7 A;  3D0P A;  3RMD A;  1U4B A;  4KRF A;  3MEC A;  3VA3 A;  3L3V A;  3KLG A;  1KRP A;  2QKK A;  2HHS A;  3KD5 E;  3LPU A;  4OKK A;  1B92 A;  3OJU A;  3EZ5 A;  4FW2 A;  3SJJ A;  4AHR A;  2VG5 A;  1WSI A;  4CER A;  4DS5 A;  1TV6 A;  3WNH A;  3L8B A;  3U3Y A;  1EP4 A;  2GUI A;  3HVR A;  3ZSW A;  4M3W A;  1ASW A;  3O4Q A;  2OPS A;  2HHU A;  4LH4 A;  1CZB A;  3HPO A;  4C8M A;  2YNG A;  4M41 A;  4FLU A;  2KFN A;  4FW1 A;  1N5Y A;  3RR8 A;  2F8T A;  1BIS A;  4OLB A;  3KK2 A;  4QCL A;  4IKF A;  4CHZ A;  4W5O A;  1LWE A;  4GVM A;  3NF7 A;  2I5J A;  4B08 A;  3K58 A;  3TWH A;  4B9U A;  4QOZ B;  4DFK A;  4CK1 A;  4BE2 A;  4DQI A;  3WNF A;  4CES A;  3JYT A;  1WSE A;  1QTM A;  3TAM A;  1KVC A;  1L3T A;  4OJR A;  1RT5 A;  1BHL A;  4F3O A;  3C6T A;  1NK6 A;  4PY5 A;  1W0H A;  4FXD A;  3ALY A;  2GBZ A;  4FYD A;  1JXB A;  2YNI A;  3SQ2 A;  4OPJ A;  4J2E A;  3KKR A;  4JRP A;  4RG8 A;  4LD0 A;  1A5W A;  2QXF A;  2IC3 A;  4CGJ A;  3NF8 A;  4DTP A;  3S3O A;  1S1T A;  4FLX A;  1NJW A;  4O5B A;  3LWL A;  3KIO A;  3QIP A;  3TAN A;  4ID1 A;  4CJQ A;  3ZT1 A;  2BE2 A;  4CHY A;  3F73 A;  4FZY A;  3NE6 A;  3OYN A;  4CJ4 A;  3SUN A;  4AH9 A;  2IOC A;  4IDK A;  1S5J A;  3U6F A;  2HVI A;  3NF6 A;  1NK5 A;  1DTT A;  4CJU A;  1QSL A;  3M8P A;  4DTR A;  2IAJ A;  3AO3 A;  3ZCM A;  5J2Q A;  1O1W A;  4W5T A;  4B9V A;  1SKR A;  3OYF A;  5KRS A;  3QO9 A;  4Z4C A;  1UA1 A;  4NCG A;  4CK2 A;  1X9M A;  4RW9 A;  4OLA A;  3I8D A;  4KHW A;  2HHQ A;  2KQ2 A;  3AVL A;  3DRS A;  1HNI A;  1VSI A;  3VQP A;  4CGI A;  2P5G A;  2OPQ A;  4FJ5 A;  1YT3 A;  4DSI A;  2OPR A;  4CJT A;  3PY8 A;  2HHT A;  2P51 A;  2KTQ A;  4FZZ A;  2WON A;  3LP1 A;  3QIO A;  4DTJ A;  1BL3 A;  1VK0 A;  1DLO A;  3SQ4 A;  1L5U A;  1NK4 A;  4JS5 A;  4FLT A;  1BIU A;  4O4G A;  1HJR A;  4J2B A;  2DFH A;  1HQE A;  1S1W A;  3NBP A;  4LY7 A;  3TAG A;  3MXM A;  4G1Q A;  2RN2 A;  4DSF A;  4M3R A;  3RMB A;  2F8S A;  3V9W A;  3V81 A;  3TAB A;  4NYF A;  3RTV A;  5EU7 A;  1D5A A;  2XHB A;  4DSK A;  3HL8 A;  3B6P A;  2PYL A;  2YNH A;  1LW2 A;  1RT1 A;  3AVH A;  4BAC A;  1T7P A;  1JXE A;  3RR7 A;  3RWU A;  2HNZ A;  3ZT3 A;  4B8A B;  3VQ4 A;  2HMI A;  3HO1 A;  2VG6 A;  1KLM A;  4NYN A;  3QEX A;  1R0A A;  3V6D A;  3O3G A;  4B3O A;  4DS4 A;  3DLE A;  3T1A A;  3CG7 A;  1J53 A;  3ZSY A;  3KLE A;  4N76 A;  3DM2 A;  1KFD A;  1GOC A;  4CJK A;  3S3M A;  5KRT A;  2DFF A;  1UWB A;  1C1B A;  1WSJ A;  4KB1 A;  1BI4 A;  1NOY A;  4FK0 A;  3K2P A;  1TVR A;  4OVL A;  3CFP A;  1ASU A;  1S9G A;  2XY6 A;  3LAL A;  3SUQ A;  1HPZ A;  1UOC A;  4FLW A;  3NAE A;  4W5R A;  3S3N A;  3LP0 A;  3KK3 A;  1RIL A;  1VSD A;  1JLA A;  4O44 A;  2R7Y A;  3AVI A;  2Y1I A;  1Q8I A;  3DOL A;  3AO4 A;  1XWL A;  4HCC A;  4KHS A;  4KFB A;  4LSL A;  4CJE A;  5E41 A;  1IKV A;  3NH2 A;  1TK8 A;  3KK1 A;  4M42 A;  3ZSQ A;  1WNS A;  2D0C A;  1IO2 A;  3PO4 A;  1RNH A;  1QE1 A;  4AHC A;  4BWM A;  3AVG A;  3HP6 A;  3RRH A;  1T03 A;  4Z4E A;  4DG1 A;  3HP9 A;  4PA1 A;  3SQ0 A;  3VQ9 A;  5J2M A;  4C8L A;  2B6A A;  4GMJ B;  4CIG A;  4DU3 A;  4I2Q A;  4EZ9 A;  4DMN A;  4E7K A;  5I42 A;  3M8R A;  5FDL A;  4E1N A;  4JRQ A;  3KLI A;  1G15 A;  4O0I A;  1VRT A;  4DFP A;  4DF4 A;  4B9N A;  5J1E A;  3DYA A;  3K5O A;  1RBT A;  4CEE A;  1SL0 A;  3IG1 A;  3PUF A;  3QNO A;  2HHW A;  3NGY A;  3OYJ A;  4C8O A;  4H8K A;  2Z1J A;  3CQ8 A;  4RW4 A;  4B8C A;  3RRG A;  3V4I A;  2W42 A;  1QHT A;  2ATQ A;  2D0B A;  3OY9 A;  4ELU A;  4KTZ A;  1WAJ A;  1TKZ A;  1RTJ A;  1RTI A;  1ZYQ A;  1ZBL A;  3ITH A;  4KI4 A;  1L3S A;  2HHX A;  4CJF A;  2X6N A;  2Y1J A;  2ETJ A;  3OYK A;  4KTW A;  4UQG A;  1NOZ A;  1IKX A;  3AVB A;  4CED A;  4N41 A;  1LW0 A;  4KKO A;  1NK7 A;  3QEI A;  2B5J A;  2HVH A;  4DLG A;  3PO5 A;  1JL1 A;  4PUO A;  1JLC A;  1TL1 A;  1WSH A;  4CJL A;  5KTQ A;  1SL1 A;  4EP5 A;  3K59 A;  3LAK A;  3HST B;  2AJQ A;  1VSF A;  4FM0 A;  4FJI A;  1IKY A;  2HW3 A;  1EET A;  3M8S A;  4M45 A;  4H4O A;  4CIE A;  2OPP A;  2WOM A;  3AA2 A;  3CM6 A;  3F9K A;  1JLF A;  4CJP A;  4AIL C;  2RPI A;  3EYZ A;  1IG9 A;  3LDS A;  5DMR A;  2IGI A;  3NGZ A;  3DRR A;  2HHV A;  2QKB A;  1EXQ A;  4KHQ A;  3DI6 A;  1GOA A;  3DRP A;  2KW4 A;  3HXM A;  4DTS A;  1VSK A;  2E6M A;  1D8Y A;  1VSM A;  3AO5 A;  4M3T A;  3OYC A;  2DY4 A;  4CJ5 A;  2YKM A;  2XY5 A;  5C25 A;  3SQ1 A;  1T8E A;  1JL2 A;  1Z26 A;  1RT3 A;  4O55 A;  3CFR A;  4MQ3 A;  4CEQ A;  3TAQ A;  3D45 A;  1X1P A;  3P83 D;  1ZBH A;  2G8V A;  3MEE A;  1TAU A;  3OYA A;  2ZD1 A;  2YV0 X;  1X9S A;  2X74 A;  1CZ9 A;  1DTQ A;  3L2R A;  1CXQ A;  4E19 A;  4DTO A;  1C0T A;  1QSS A;  1HNV A;  3MXI A;  4BWJ A;  4IG0 A;  4OGE A;  4CFD A;  4FM1 A;  4E89 A;  4CE9 A;  3CFO A;  3O4N A;  3RMA A;  5J2P A;  3AVM A;  2D5R A;  2Q3S A;  4DQP A;  3E01 A;  5FRO A;  4J2D A;  5K14 A;  1NJZ A;  4FJX A;  4FK2 A;  4W5Q A;  1SUQ A;  4RW7 A;  4ELT A;  4Z4I A;  3QEW A;  4N5S A;  3OS0 A;  1RDD A;  3UIQ A;  1HRH A;  2O4I A;  5J2N A;  4NCA A;  1WAF A;  5JS2 A;  4FM2 A;  1NJX A;  1BQM A;  1VSJ A;  3T19 A;  1RBU A;  3VA0 A;  5SWM A;  4F2S A;  3OYG A;  3LPT A;  2HB5 A;  2NUB A;  1TKX A;  3NHG A;  4PQU A;  4EP4 A;  3DLG A;  4F2R A;  1TKT A;  4Z4F A;  3BDP A;  2YHA A;  5HRS A;  4B9S A;  2DFE A;  3VQC A;  1TK5 A;  4CEF A;  3ZT2 A;  5HBM A;  2XY7 A;  3V1Q A;  3LZI A;  1JLE A;  2LSN A;  3FFI A;  5C24 A;  3DOK A;  3OS2 A;  2G8W A;  4KRE A;  4CK3 A;  3NCI A;  2RF2 A;  1LWC A;  4K8X A;  4HVJ A;  2IDO A;  3G10 A;  4CFA A;  5HRO A;  1ZBU A;  3L2Q A;  3DMJ A;  4MFB A;  1U47 A;  4C8N A;  2KFZ A;  2IS3 A;  4I2P A;  4DSL A;  4LSN A;  3ZSR A;  3BGR A;  3SPY A;  4DQQ A;  4Y1C A;  5FRM A;  4CEC A;  3LP3 A;  1D9F A;  4KB0 A;  4DSJ A;  4BE1 A;  4F4K A;  1WN7 A;  1UAX A;  4DFM A;  4FK4 A;  4E7I A;  2VG7 A;  4NCB A;  4CEB A;  5CZ1 A;  4CIF A;  3QLH A;  1IKW A;  5I3U A;  2HNY A;  1FK9 A;  4TSX A;  4FCY A;  2F96 A;  3U3G A;  4HCB A;  2YHB A;  1XHX A;  4CFB A;  3V9U A;  5FRN A;  2FBY A;  4FJN A;  3VQE A;  3JSM A;  1QS4 A;  1I39 A;  4CGD A;  3HT3 A;  2Z1G A;  4CF8 A;  4KI6 A;  4ZTJ A;  4IFV A;  3SPZ A;  4BDY A;  3KTQ A;  3ISN C;  3WNE A;  3V1O A;  3AVA A;  2E6L A;  5JS1 A;  3SZ2 A;  2VWK A;  4FJ9 A;  3TAE A;  1C1A A;  4CJR A;  1S6Q A;  4H4M A;  2HND A;  4QAG A;  3HPH A;  1L3U A;  3NGI A;  1FKO A;  1JLQ A;  3CYM A;  1KSP A;  3KLF A;  1BCO A;  5CYM A;  3L2U A;  5C42 A;  3T3F A;  4L8R B;  4FJ7 A;  4Z4G A;  2GV9 A;  1RDC A;  2EX3 A;  4HUF A;  2OA8 A;  1ITG A;  1LAV A;  1VSL A;  2Z1I A;  3OYE A;  3ULD A;  1NKE A;  4AHV A;  3AO1 A;  4EZ6 A;  3SCX A;  4XIU A;  2G8F A;  3H08 A;  3SNN A;  4DTM A;  3B6O A;  1HYV A;  1C6V A;  4IBN A;  2FBV A;  3QET A;  4M3X A;  1L3V A;  4FJK A;  1ASV A;  2OYQ A;  3MXJ A;  4WE1 A;  3PX4 A;  2XO7 A;  4HUE A;  3V9Z A;  4ZHR A;  3VQ5 A;  1VSE A;  3MED A;  3OJS A;  3AO2 A;  3KJV A;  1EX4 A;  1KLN A;  4CHO A;  3ZSO A;  1Y97 A;  4FLV A;  5CY4 A;  4OGC A;  2G8K A;  4DU1 A;  4ELV A;  1MU2 A;  4E1M A;  2P1J A;  4CF9 A;  2RKI A;  3LWM A;  1U45 A;  1HYZ A;  1K6Y A;  3O3H A;  2YNF A;  5SZT A;  4FZX C;  1U48 A;  1D9D A;  4FJJ A;  1T05 A;  3TAP A;  3L3U A;  3QIN A;  4M3U A;  2JGU A;  3QNN A;  4O0J A;  1TL3 A;  1UA0 A;  1J5O A;  4DQS A;  4E7L A;  3AVF A;  3SUO A;  2G8I A;  4F8R A;  4CCH A;  3M8Q A;  2BGG A;  1S9E A;  4E3S A;  1WLJ A;  4CEZ A;  2D0A A;  1QSY A;  3ZSZ A;  1IH7 A;  3KKS A;  1QQC A;  1YTU A;  3C94 A;  5KGW A;  3VQQ A;  4CF2 A;  2X78 A;  5HLF A;  1W9H A;  1S6P A;  4JS4 A;  3V1R A;  1Q9Y A;  3IRX A;  3LAM A;  3P5J A;  3TR8 A;  1RDA A;  4CJV A;  5HRN A;  4YNQ A;  1NKB A;  1KFS A;  4FJL A;  1A5X A;  4J2A A;  4CEO A;  2E4L A;  4YFU A;  4OKJ A;  1KTQ A;  3QER A;  4ID5 A;  4CHQ A;  1FKP A;  5CYQ A;  1XC9 A;  4K8Z A;  3V9X A;  4KV8 A;  3ZSX A;  3I0R A;  4KHY A;  1EKE A;  4Z4H A;  1F21 A;  1S1X A;  1SV5 A;  2G8H A;  4KPY A;  1NJY A;  3AVN A;  3IAY A;  4KHU A;  1HQU A;  4FVM A;  4DSE A;  3A2F A;  3VQA A;  2ITG A;  3KD1 E;  1CXU A;  3SUP A;  4ZTF A;  3O3F A;  2VWJ A;  3VQ7 A;  4E7H A;  1RTH A;  4FJM A;  3I0S A;  1RT2 A;  5HP1 A;  5T7B A;  4LH5 A;  4IG3 A;  3VN5 A;  2A1R A;  1KVB A;  1JLB A;  3HPG A;  1HYS A;  4W5N A;  4HTU A;  1SL2 A;  4DTU A;  4C8K A;  4CGG A;  3DLB A;  1XHZ A;  4FJG A;  1ZBI A;  1WSF A;  1S1U A;  3NFA A;  1J54 A;  4KHN A;  4FJ8 A;  1A5V A;  1RT4 A;  4DQR A;  3ZT0 A;  4JLH A;  3TAR A;  1BGX T;  1SKW A;  5D3G A;  3HJF A;  1U04 A;  4HUG A;  4DLE A;  1FXX A;  4GW6 A;  3L2V A;  1JLG A;  1TAQ A;  4CF1 A;  3OVN A;  4Y1D A;  2YKN A;  4M3Y A;  4DWI A;  3PX6 A;  2ZQB A;  2B4J A;  2Z1H A;  3NF9 A;  4RW8 A;  4DU4 A;  3KLH A;  3NH1 A;  3K57 A;  1X9W A;  2A1S A;  3AV9 A;  3OYL A;  3ZT4 A;  3S9H A;  2OZM A;  2DTU A;  4FJH A;  3K5L A;  1TKD A;  4CJS A;  4Q5V A;  3C95 A;  4KAZ A;  2BAN A;  4B9L A;  3NDK A;  4AHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...