4GVMA

Hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
148
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTACWWAGIKQEFGIPYNPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 148
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gvmA00
4LD0A 2X74A 2RKIA 2R7YA 3TAPA 1JXBA 1Q9XA 1Y97A 2HHUA 1TAQA 1SV5A 3V9SA 3TANA 3TAMA 4J2AA 1VSDA 1ZYQA 3OS1A 4LH4A 4B3OA 4C8MA 1TAUA 1C0MA 1FKOA 1I3AA 3MEGA 3S3NA 4CJWA 4CJQA 1T05A 3OYBA 3C94A 3HL8A 2OYQA 4FK0A 2VG6A 3ZSZA 4DLEA 4CJFA 1RDDA 1EXQA 1U04A 1HYZA 3VQ4A 3LPTA 1YTUA 2OZSA 2DY4A 4ELUA 4FJLA 3NHGA 4CJLA 4Q0BA 1T7PA 3IAYA 1NK7A 2ZE2A 4FK2A 3L8BA 2XY6A 3KKSA 4IFYA 3AVIA 1LAVA 2HW3A 1DTTA 1RBTA 3HJFA 4FLZA 1NKEA 4FLVA 4DS4A 4FM1A 2G8WA 3BDPA 1KVCA 5DK5A 1TKXA 4JRQA 4DTUA 4FJ9A 4BE1A 1MU2A 4CK1A 4CGIA 4DFKA 2HHSA 3VQ7A 3QINA 4CEZA 3BGRA 1W9HA 4CJUA 3K57A 1KTQA 1LW0A 1RBVA 1KLNA 1JLFA 5J2PA 4HTUA 3RRHA 3QEVA 3PUFA 3PX0A 1S1TA 4DQPA 2D0BA 4M3RA 4E19A 1IH7A 5KRTA 1TV6A 3OYEA 4CGDA 3ZSRA 1CXUA 2O4GA 3VQ9A 3OYMA 4J2EA 4CEFA 1RCHA 2F96A 3MEEA 1S9GA 4KKOA 1QHTA 4Z0UA 1X1PA 4FJNA 4FLTA 3L2QA 1RDCA 3MEDA 5HRRA 4Z4CA 4DU4A 2Z1JA 5E41A 3M8QA 4KHSA 4DTMA 1RTIA 1A5WA 5J2MA 3PX4A 4NCBA 1WN7A 4DWIA 2HHQA 4IFVA 1J54A 1FKPA 4CJTA 4CK3A 1WAFA 3NFAA 3DM2A 3EYZA 3KD1E 3VQCA 4AH9A 3NF8A 4B9VA 3O4NA 2YNGA 3OYNA 3NE6A 1S1XA 1TK5A 5JS1A 4PQUA 4KB1A 4LSLA 3TR8A 3OYKA 2BGGA 1GOAA 3HSTB 1RTDA 3SV4A 4CIFA 2VWKA 2G8KA 1C0TA 2OPPA 3KK1A 4CEOA 1VSIA 3V9WA 3OYJA 2PY5A 4F2RA 1ITGA 2JLEA 5T7BA 4CIGA 3RMDA 1RT3A 4CJRA 2FBYA 3PV8A 3G10A 3HVTA 4Z4FA 2E6MA 2YKMA 4JRPA 4AILC 1NJZA 1NKBA 4NCAA 4ID1A 3OYCA 3EZ5A 4E7KA 3QERA 1HNIA 1L3VA 4FJMA 1RDAA 2G8UA 2X78A 1L3UA 3SNNA 3AVMA 4RW9A 4M3TA 4CF2A 3RTVA 3AA3A 3OS2A 3QNOA 3ZT1A 5CYQA 3K58A 4DTXA 3S3OA 4DU3A 4N41A 2G8IA 3CG7A 3AVJA 1W0HA 2BANA 4E89A 1VSEA 1S9EA 4DSKA 2HNDA 3T3FA 2BE2A 1RT5A 4B9NA 4LY7A 4ZHRA 3KLIA 3SV3A 1IKWA 4AHUA 3VQ8A 1VSFA 3DLRA 1IO2A 1HPZA 4FLYA 5HRPA 2DFFA 1C1BA 1JL1A 3V9XA 3MXJA 1LW2A 5JS2A 2XO7A 3L2RA 3HYFA 3C95A 5HBMA 1R0AA 1U49A 4BWJA 1KSPA 1XHZA 4C8OA 4CERA 1TKTA 4AHSA 4CF0A 4FJ5A 5CYMA 4BDZA 4CEAA 4CCHA 3AVHA 3FFIA 5SWMA 2Y1JA 1L3SA 1QSLA 2ZD1A 4HUFA 3ASMA 3OYFA 4AHRA 3V9UA 1EX4A 3NH0A 3NGYA 4M3XA 3OYIA 4LH5A 4DF8A 2HMIA 4BE2A 1UA1A 3CFOA 4O5BA 3WNEA 1D9DA 3C6UA 4B9MA 1G15A 3VQPA 3P83D 1S6PA 3DRRA 4DLGA 4Z4IA 4DTRA 4FW2A 1ASWA 3DOLA 4FLXA 1KRPA 4EP4A 4FJIA 3S9HA 1S1VA 1ZBLA 2PYJA 3CYMA 4W5OA 4B9SA 4CJ5A 1J5OA 4E1MA 4KPYA 1RT4A 3DLEA 3VQ6A 4I9LA 3ZSOA 4C8KA 1BIUA 3NGIA 3SUQA 3F9KA 1NJYA 4CFCA 2QK9A 1XHXA 2B6AA 2ZQBA 4RG8A 4I7FA 2KFNA 1L3TA 3QEXA 3NGZA 4W5NA 4IBNA 3V1QA 1RTJA 1CLQA 2Z1HA 4HUGA 5J2NA 3PO4A 1LWEA 2ETJA 3AA2A 3QIOA 3TI0A 5SZTA 1JLCA 3K5MA 1KVBA 1A5VA 1SKWA 3KJVA 4PWDA 3MXIA 1JXEA 1WSGA 4B9UA 3LPUA 4E0DA 1C6VA 1FXXA 5KGXA 3LZJA 4E3SA 3V4IA 1TK0A 2A1SA 3NBPA 3KLFA 3QEWA 4QOZB 2X6NA 1KCFA 3L2VA 4JLHA 1XWLA 1I39A 4RW7A 1NJWA 1U4BA 4NYFA 1Z25A 4DSLA 1BCOA 4KHYA 1RT1A 4GW6A 3M8RA 3K59A 3AVLA 3DYAA 2YNFA 3KK3A 4M41A 3PO5A 2DTUA 3P5JA 3TAFA 1VSLA 1JLEA 2HB5A 4CGFA 4CEQA 3OY9A 3U6FA 1B9DA 2OPSA 3KIOA 3A2FA 3SUOA 2VG5A 4F2SA 1SL2A 4EZ9A 1F21A 1O1WA 3AVNA 1CZBA 3V6DA 3I8DA 5KGWA 5J1EA 4ELVA 4O0JA 5DMRA 1HRHA 5HRSA 1N5YA 4O55A 4FJHA 1SUQA 1Q9YA 4KV8A 4DSFA 3AVGA 3ZSYA 4OPJA 5I42A 3ZSQA 1D8YA 1IKYA 4FW1A 2FBTA 4MFBA 3RRGA 1YT3A 1QSSA 1NOZA 1S6QA 2RPIA 4CJEA 1UA0A 2D5RA 4DG1A 3NF7A 3O4QA 3LP3A 2G8VA 2P5OA 4CHPA 1QSYA 5KTQA 2HHXA 4KI4A 1VRUA 1L5UA 3VQAA 4IDKA 3IRXA 4AHVA 5KRSA 3K5NA 4KRFA 2XY7A 2VG7A 4KTZA 3CFRA 3U3YA 4B9LA 3I0SA 3AVCA 1T8EA 1CZ9A 3CM5A 1JLBA 1ZBIA 3HVRA 1VSHA 2PZSA 5HLFA 2DFEA 2WONA 4ID5A 2IGIA 5KI6A 3WNGA 1NK9A 4DF4A 3KKRA 1QS4A 3VQQA 3HPGA 4KTQA 1D5AA 4QAGA 4EZ6A 1NK5A 1U47A 4I9QA 1HJRA 3HT3A 2FBXA 4CJ3A 3B6OA 2FC0A 5D3GA 1REVA 2YKNA 3G0ZA 1VSKA 2HHVA 2HHWA 2GV9A 2X6SA 3C6TA 1C1AA 4ICLA 3ITHA 3NF6A 1RDBA 4NYNA 4AHTA 1X9SA 3I0RA 3VN5A 4Z4EA 2A1RA 2E6LA 1WNSA 3OYHA 3WNHA 2YNHA 3AVFA 3DRSA 3LDSA 2GBZA 3AA4A 4FLWA 4DTJA 3QESA 1K6YA 1Z26A 4CEBA 4CHQA 3V81A 4DSJA 4FZXC 5FRNA 4BE0A 1HQUA 3TWHA 4O0IA 4HHTA 1EP4A 4E1NA 3SQ0A 1BI4A 3NAEA 1WSIA 2YNIA 3SQ4A 3LANA 1KLMA 4HCCA 3ZSXA 3TAGA 4FLUA 1JLQA 4FM2A 3AO3A 4N47A 2KZZA 1LWFA 3DI6A 3O3FA 2HVIA 3MAQA 3SQ1A 1NK6A 3K5LA 2VWJA 3NH1A 1UOCA 5I3UA 4CFBA 3SZ2A 3JSMA 3LWMA 2YHBA 4KHQA 4J2BA 3LALA 2QKBA 1J9AA 1Q8IA 5CZ1A 4CIEA 3L2UA 4DFPA 5EU7A 4LSNA 1BHLA 3HO1A 3HK2A 4FJJA 3D45A 3OVNA 1TGOA 2HNYA 1BCMA 1FK9A 4N5SA 1KFDA 2WOMA 2XY8A 1RBRA 2I5JA 3DOKA 3ZT4A 4B08A 3KLGA 3UIQA 4W5RA 4M3UA 4CE9A 1LV5A 3VA0A 3T1AA 4PY5A 4FJ8A 2G8HA 4CF8A 3VQEA 1GOCA 2KZMA 4KAZA 1RT6A 2P1JA 1C0UA 5C25A 3SI6A 3MXMA 4F3OA 5C42A 3NH2A 2P5GA 1JLAA 1EKEA 1YTAA 2QXFA 3L3UA 1HYVA 1VSMA 4FM0A 4FZYA 4N56A 2Y1IA 2HHTA 4O44A 4HUEA 4CJPA 3O3GA 4F4KA 4YFUA 4QCLA 4BDYA 2EX3A 5J2QA 3DLGA 1BL3A 3RMAA 1LWCA 3EY1A 3HM9A 4W5TA 1UAXA 3PY8A 4DQQA 4C8LA 4XIUA 4FYDA 4KFBA 4CESA 3ALYA 4NCGA 4CJKA 1WLJA 4JS4A 4ZTFA 1A5XA 4DQIA 4F3TA 4TSXA 1TL1A 4FJKA 1KFSA 4H8KA 2F8TA 4KB0A 4OLBA 3VQ5A 4FZZA 3HPHA 4CECA 1SL1A 2B4JA 2RN2A 4DQRA 4CGGA 3QETA 3MECA 4CHOA 3TARA 2OZMA 1GOBA 1DTQA 1JLGA 4OKJA 4BACA 3KLEA 4Q5VA 4CEDA 3DRPA 1T03A 2NUBA 1BGXT 3SUNA 2YHAA 2G8FA 2FBVA 4OPKA 3LWLA 3DLBA 2PYLA 4Z4HA 3KTQA 1VK0A 5CY4A 2EHGA 2HNZA 4I2PA 3RR8A 1BISA 4H4MA 4ELTA 3SQ2A 1BI4B 1HQEA 4G1QA 4DU1A 3OYGA 3LAKA 3M8SA 4DSEA 4DS5A 2D0CA 1S1WA 1UWBA 4CF1A 4UQGA 4FCYA 4OKEA 1TL3A 5FROA 1IKXA 4H4OA 2OA8A 1C1CA 4PUOA 4R5PA 1NOYA 1EETA 4JS5A 4KO0A 3DLHA 5FRMA 4OGEA 3DLKA 3V9ZA 2Z1GA 4OVLA 3SUPA 1NK4A 3AO1A 1D9FA 1WSJA 5CZ2A 4CHZA 3RMBA 1N6QA 4IG3A 3L3VA 3H08A 3NF9A 3JYTA 4DTPA 2XHBA 3QNNA 1NK0A 3K2PA 2BDPA 3RR7A 3CQ8A 1U45A 4I2QA 4J2DA 4E7LA 4K8XA 1NJXA 4W5QA 1BQMA 3HXMA 4FVMA 2KQ2A 4O4GA 3F73A 4E7HA 1TKDA 3TAEA 4KHWA 4Y1CA 4IG0A 1HYSA 3QO9A 3NDKA 1VRTA 5HROA 3KK2A 4F8RA 3CFPA 3AO2A 1QQCA 4CJVA 3ZT0A 4DTSA 1SL0A 3HP9A 3LP2A 4KTWA 1RT2A 2HVHA 3K5OA 5HP1A 3KD5E 4K8ZA 2IAJA 3V1RA 2DFHA 4YNQA 1X9WA 1TVRA 2LSNA 3QEPA 4DTOA 4RW4A 3QEIA 1RBSA 4OLAA 5K14A 1DLOA 1JKHA 4DMNA 5C24A 3ISNC 2B5JA 4BWMA 2XY5A 4RW6A 1HNVA 3WNFA 3AO4A 4M3WA 4M3ZA 4DFMA 4CHYA 1ZBHA 4CJSA 4FJGA 2KTQA 1RBUA 3AO5A 3AVBA 3OJUA 3ZT2A 5HRNA 4AHCA 1X9MA 3ZCMA 3OJSA 1WSHA 3SPZA 3RWUA 4CF9A 3OYAA 4DTNA 1S5JA 2E4LA 1BQNA 4OKKA 4BDPA 2O4IA 1NKCA 2IS3A 1QTMA 4N76A 4KREA 1KVAA 3LAMA 4CK2A 4Y1DA 3T19A 3L2WA 3S3MA 4CFDA 4M3YA 4B8CA 4CJ4A 4PA1A 2P51A 1SKRA 4CEEA 4KHUA 3D0PA 4HVJA 1NK8A 4DSIA 1ZBUA 4IKFA 3OYDA 4GMJB 4FK4A 3KLHA 1LAWA 3ULDA 1SKSA 2QKKA 1WSFA 5FDLA 3SYZA 1WSEA 3O3HA 3RMCA 4L8RB 4CHNA 3E01A 4OJRA 1RT7A 3AA5X 1S1UA 2Z1IA 3NCIA 3PX6A 3SCXA 3AV9A 2YV0X 4FJ7A 2AJQA 3IS9A 1CXQA 1TKZA 1RILA 2D0AA 3ZSVA 2XRIA 3OYLA 3VA3A 4CFAA 2JGUA 4OGCA 4MQ3A 4CGHA 4M42A 1JL2A 2Q3SA 4KI6A 4KHNA 3CM6A 3HP6A 2W42A 3U3GA 4FJXA 4FXDA 2RF2A 4GVMA 4EP5A 4DQSA 1WAJA 4CGJA 2KW4A 3B6PA 1ASVA 1J53A 4E7JA 3AVAA 2GUIA 1VSJA 3LZIA 4DFJA 1XC9A 4M45A 1U48A 3SPYA 3M8PA 2OPRA 1RTHA 3QIPA 3TAQA 3ZSWA 1ASUA 1IG9A 4HCBA 2F8SA 4WE1A 3LP0A 3THVA 3QLHA 1IKVA 1RNHA 2OPQA 3AVKA 4B8AB 3P1GA 1TK8A 4ZTJA 4E7IA 2KFZA 1XI1A 3DMJA 2IOCA 1QE1A 1ZBFA 3IG1A 4C8NA 1B9FA 3OS0A 1HMVA 3TABA 1YVUA 4RW8A 3ZT3A 1BIZA 2ITGA 3V1OA 1B92A 4B9TA 3LP1A 3HPOA 3VQBA 3SJJA 2ATQA 3VQDA 4Z4GA 2IC3A 2IDOA
chains in the Genus database with same CATH superfamily
4XH1A 4LD0A 2HHUA 1Q9XA 1TAQA 3CCJN 3I55N 3TANA 3D2FB 4B3OA 5GAEP 1HNXK 4FK0A 3OYBA 3HL8A 2GX9A 4DLEA 1U04A 3CETA 1HUXA 3R8EA 1OVQA 1P8ZA 4KBOA 1YTUA 3K0SA 3R9PA 2CGKA 4PL8A 2VGNA 1NK7A 2ZE2A 5AQYA 5ELZA 2XY6A 5E26A 1QZ5A 3HJFA 4FLZA 2D4WA 3C7NA 4JYAK 2G8WA 1KVCA 4FJ9A 1TKXA 4DTUA 1XUPO 4JD2A 4DV7K 3O9RA 4FWRA 4WCEL 3KVGA 4CGIA 4CEZA 2FSKA 3QMLA 3K57A 4DR2K 4DKWA 4EFHA 5J2PA 3E9LA 4HTUA 3QEVA 2D0BA 3ZEUB 3OYEA 2O4GA 4J2EA 1VQNN 4CEFA 4FWMA 4LFCK 1X1PA 3L2QA 5C15A 3MEDA 3M8QA 4KHSA 4DTMA 3P4IA 4RTFD 4CK3A 3NFAA 4WFBL 1VQPN 3DXMA 1KC8O 4B9VA 3NE6A 4B9QA 5JS1A 3ENBA 3TR8A 2BGGA 1GOAA 2NRRA 4KH4A 4DR6K 5JICA 1MDUB 4OPHA 3V9WA 2PY5A 4F2RA 1ITGA 3RMDA 3BF3A 2FBYA 1E4FT 1OKJA 2YKMA 3LM2A 3QERA 3EE8A 3MWPA 1L3VA 3SAHA 4DQ8A 4OPAA 3AVMA 3QNOA 3EZWA 4N41A 3C7NB 3AVJA 1W0HA 4JD2B 1VSEA 5AQNA 3LDQA 4DV0K 3QBXA 4DR5K 2BE2A 2GEMA 3O4WA 3T7ZA 3K9KA 4ZHRA 3SV3A 3RSEA 5IT9O 1BUPA 2QW9A 5I9EB 1HPZA 1NWKA 5M1KA 1QZ6A 4H0YB 3V9XA 3MXJA 1LW2A 2V7ZA 5HBMA 3WQTA 1U49A 4C8OA 1EWRA 3PIOL 2RHKA 4CF0A 5KQ8A 3HI0A 5SWMA 1MA9B 4JI2K 1L3SA 3FFKB 5LY3A 3FE1A 2P9NA 4M3XA 3V9UA 2O8EA 3UKRB 2HMIA 3WXLA 4JKDA 3CFOA 3CCEN 4LF4K 4O5BA 3MN6A 2Q31A 4B9MA 3GG4A 4NO7A 1S6PA 3DRRA 4FW2A 3ID6A 4EHTA 1S1VA 5AQQA 4W5OA 3VGLA 4E1MA 4YOVA 1BIUA 1XHXA 3NGZA 4IBNA 1RTJA 2KHOA 2Z1HA 4HUGA 3ZX3A 3O08A 1JLCA 3K5MA 1KVBA 1A5VA 2A40A 1J6ZA 3KJVA 4PWDA 3OW2M 4BRIA 1C6VA 3V4IA 1TK0A 2X6NA 1KCFA 4QS8A 1I39A 1RT1A 4GW6A 3M8RA 3K59A 2YNFA 1IBKK 4RWTA 3IKMA 3BP8A 1VSLA 4CGFA 4CEQA 3A2FA 3DAWA 4EZ9A 3L4IA 1F21A 1O1WA 3AVNA 1KQSM 4Y0WA 1HRHA 3MN9A 5FPNA 3ZSQA 1Q86O 3CCVN 1IV0A 2FBTA 4JHDA 1QSSA 1NOZA 1S6QA 1UA0A 4HWIA 2YX6A 4R79A 4YY3K 3LP3A 1NMNA 4BRLA 4CHPA 3EKSA 2BTFA 5AQKA 3VQAA 4AHVA 2DPNA 5EX5A 4B3MK 3I0SA 1CZ9A 4YDUC 1ZBIA 3HVRA 5KI6A 3VOVA 4CW7B 1U47A 4I9QA 2FLOA 1DT9A 4IO9L 1VSKA 3LDNA 1E4GT 4NYNA 3QDKA 3I0RA 4Z4EA 1WNSA 3M1FA 2JWLA 2QWPA 4CEBA 2NRHA 4BR2A 4DSJA 3J7ZO 3V81A 4FZXC 4BE0A 2UUCK 4O0IA 4HHTA 1KAZA 4O5FA 1BI4A 1SAZA 3NAEA 3ZSXA 4JI5K 1GLCG 2OTJN 3PSIA 4N47A 3DI6A 3MAQA 1NK6A 4IOXA 1R59O 1UOCA 4CFBA 3MK6A 3JSMA 2YHBA 3L2UA 4JN4A 4FWPA 5CR4A 3D45A 3OVNA 4K42A 3D2EB 1TYQB 2XY8A 1RBRA 3FZLA 4B08A 4WFNL 4PKIA 2YI1A 1VQON 3VQEA 4KAZA 1C0UA 3LDPA 4FWLA 2ZGZA 3CJ9A 1JCEA 2Y1IA 4LFBK 4BQZA 4YFUA 1P90A 2EX3A 2GUPA 3DLGA 1BL3A 1K8KA 1LWCA 4U67L 3PY8A 1YI2N 4BRGA 4EIAA 4CJKA 1WLJA 4F3TA 4TSXA 3TSUA 5TKWA 1NGFA 3A0IX 2F8TA 3J8AA 3SK3A 2B4JA 3HZ6A 3QETA 4H0OA 1GOBA 4YOXA 2P9IB 4Q5VA 4U7BA 4YOWA 3VERA 3KTQA 5CY4A 3RR8A 4ELTA 1BI4B 3OYGA 3P39A 3M8SA 4DSEA 2QEXN 2D0CA 4B1YB 1BWFO 4CF1A 4FCYA 1TL3A 2OA8A 4ISEA 1C1CA 1BU6O 4R5PA 1NOYA 1EETA 3DLHA 3V9ZA 4OVLA 5AJ3K 3RMBA 4CHZA 4CD3A 3NF9A 4K43A 3K2PA 3RR7A 1U45A 1IBMK 4K8XA 3HRGA 3HXMA 3F73A 4KHWA 4GNIA 3VTHA 4YDUA 1HNWK 5BRDA 1HYSA 3KK2A 4F8RA 1GLBG 5FPMA 1QQCA 5TKYA 4KTWA 3WEEA 2VQFK 4K8ZA 1X9WA 2O8BB 1TVRA 2LSNA 3QEPA 1RBSA 3H46O 3AY9A 2B5JA 2DTUA 4RW6A 5AFUH 3AO4A 2KTQA 1BA1A 1RBUA 1H1VA 4CZKA 4JK7A 5HRNA 1NG9A 3OYAA 4DTNA 1JCFA 3TSQA 4C1NK 1KVAA 3WT0A 1N36K 3CI5A 5AQSA 1ZC6A 5KQDA 1M1KO 2P51A 4B3TK 2ZM6K 4KHUA 1NK8A 2ZWHA 1ZBUA 3OYDA 2P9SB 1XNQK 4FK4A 1U2VA 4CZFA 4GV3A 3SYZA 1WSEA 3O3HA 4A2BA 3AA5X 2FF6A 2AJQA 3UE5A 1QQOA 1TKZA 2D0AA 3CQYA 4CFAA 4NXMK 4LC9B 4MQ3A 4KI6A 3SLCA 2W42A 4IO8A 1GLFO 4EP5A 3QFUA 4DQSA 4ILHA 2KW4A 1ASVA 3O8MA 3AVAA 4M45A 5M1PA 2NNWA 1Z05A 3M8PA 3F2KA 4JK9A 2F8SA 4B3RK 3CERA 3QLHA 3KZBA 4PHTX 3AVKA 1DKGD 4B8AB 5AQXA 4E7IA 3W0LA 2KFZA 3IG1A 4F9OA 5AQIA 1WB9A 1B92A 3A5OC 3VQBA 5GINA 2ATQA 3VQDA 2X74A 2RKIA 4IEIA 4FWOA 4LH4A 1TAUA 1C0MA 1WBBA 3C94A 1K8AO 2OYQA 2VG6A 3ZSZA 4CJFA 1RDDA 1EXQA 4FWNA 3CC4N 1HYZA 2OZSA 4ELUA 4Q0BA 2ZGYA 4H0TB 3WXJA 4IFYA 2HW3A 4BRQA 2QWQA 2OCEA 4DS4A 2E2QA 4JRQA 2O8DB 4BE1A 3I8BA 4CK1A 4MLHA 4FJ5A 1W9HA 1LW0A 4B1ZA 4BROA 4JV5K 5HL7L 3PX0A 3DXKB 2HBKA 4M3RA 4CGDA 2PBDA 3MEEA 1S9GA 1QHTA 2WFBA 2NRVA 3FZHA 4Z4CA 3H1QA 5C12A 1A5WA 5J2MA 1WN7A 4BRPA 2HHQA 1J54A 1FKPA 4JI8K 1TUUA 3DM2A 2P9PB 3MN5A 3SMSA 4AH9A 4JKBA 3KD1E 1ILYA 1RDUA 4KB1A 5M1NA 3OYKA 3ATUA 2IVOA 5AQVA 1C0TA 1SQKA 4BR4A 3D2FA 3G10A 2E6MA 2P9UB 4ID1A 2QWMA 4BRHA 1HNIA 3SJHA 4FJMA 1RDAA 4G9ZA 2X78A 3ENHA 5B8HA 4M3TA 4B1VA 4DU3A 2G8IA 3CG7A 1NGCA 2BANA 4E89A 1S9EA 4CZMA 5BR8K 4WQ5C 2HF3A 3O9UA 5JVGL 4I6MB 1KD1O 1IKWA 3VQ8A 1VSFA 4JEPA 4K25A 4BRAA 5HRPA 2DFFA 3H3OB 2XO7A 3K9JA 3HYFA 4BVPA 3ZEUA 4CERA 2HMPA 3CJBA 3MX5A 5CYMA 4CEAA 4CCHA 4JKGB 2WC9A 4HUFA 4BR5A 4AHRA 2UYTA 4DF8A 1T6DA 4CZGA 4LF8K 3WNEA 1KAXA 4IOAL 1GLAG 2IVNA 5AR0A 3DOLA 1RDWX 1VQ8N 4BRDA 3S9HA 1ZBLA 2W6LA 3THWB 1D4XA 3VENA 1J5OA 4KPYA 4I9LA 3VGMA 3F9KA 2QK9A 2KFNA 2ZQBA 3DLLL 3QEXA 5FPDA 1CLQA 1IBLK 5J2NA 1LWEA 3J81O 1C0FA 4JAXA 3MWTA 1S72N 1FXXA 3LZJA 4E3SA 3NBPA 4QOZB 3CJCA 3Q7BA 5GAHP 3H6EA 4JLHA 1HPMA 1U4BA 1Z25A 3DYAA 4YOYA 4M41A 3P5JA 2W40A 2HB5A 1JLEA 3U6FA 4B1WB 1B9DA 2OPSA 3O5BA 1SL2A 3VGKA 1CZBA 4CD1A 5KGWA 4B3SK 4H03B 5DMRA 3WXIA 2IVPA 1N5YA 4FJHA 3UB5A 1D8YA 3UKRA 4H5VA 1RGIA 1YT3A 4CJEA 3GBTA 3NF7A 1WOQA 5FLXO 1HKCA 5KTQA 2HHXA 3O80A 3ZX0A 1BA0A 4IDKA 3IRXA 3K5NA 2CH6A 2CGLA 2D0OA 4FWKA 4ILGB 4DCHA 1T8EA 4OX9K 1JLBA 1OVYA 2PZSA 1VSHA 4WQ5A 2WONA 4ID5A 2IGIA 2YHWA 1QS4A 3AAPA 4KTQA 1D5AA 3C65A 1HJRA 1REVA 2YKNA 3ID8A 2HHWA 2HHVA 2GV9A 3ITHA 4FWQA 1X9SA 5ADXA 3VN5A 1VQ6N 4JKAA 3AVFA 2HBJA 3DRSA 3LDSA 4DTJA 2VCPA 4MLEA 5F0XA 3CJAA 2AP1A 2UUBK 1WSIA 3D7EO 4FLUA 1JLQA 3F9MA 3AO3A 1VQMN 2KZZA 1C0GA 1LWFA 3O3FA 3SQ1A 1NJIO 4JI0K 3R6MA 3TSPA 3SZ2A 4J2BA 4CIEA 3H3NO 3CC7N 4FJJA 3ZETB 1TGOA 1BCMA 1FK9A 2E8AA 4M3UA 2I5JA 3DOKA 3ZT4A 3MCPA 4W5RA 1HNZK 1V4TA 3T1AA 4FJ8A 2G8HA 3ENOA 4CF8A 1GOCA 2P1JA 3MXMA 3ULEA 5C42A 3NH2A 3JS6A 2P5GA 1EKEA 4JKHA 2QXFA 4IDHA 4QS7A 1KAYA 4HUEA 3J7AP 3O3GA 5ADXH 1YIJN 5EVZA 1RFQA 3F5TA 3EY1A 2PAVA 1UAXA 1HR0K 4C8LA 1T44A 4FYDA 2GTDA 4ZTFA 1TL1A 2NRTA 3VQ5A 1SL1A 3TARA 1GLDG 3MECA 2OZMA 5BRHA 5AZJB 3L4QA 4LF9K 1I94K 4H5WA 3SUNA 2YHAA 2FBVA 4OPKA 3VF2A 2HNZA 3SQ2A 1HQEA 3FGUA 4DU1A 4DS5A 1S1WA 1UWBA 1NMDA 5LJWA 1IKXA 4H0VB 2ZJRL 3THXB 4JS5A 3DLKA 3AGRA 4XEIA 3SUPA 3AO1A 1WSJA 1N6QA 4IG3A 2P9KB 2XHBA 4GKJK 5AQJA 1LCUA 4JK8A 3CQ8A 1XMQK 4BRFA 4E7LA 4WFAL 2E1ZA 1NJXA 4W5QA 5H1SQ 4PKHA 1TKDA 3D2EA 1TYQA 4IG0A 5BREA 3NDKA 3CFPA 3ULEB 2Q0UA 3HP9A 3K5OA 3CF5L 4MDBA 2DFHA 4YNQA 4A61A 4DTOA 3QEIA 3PSFA 1GLLO 5AQLA 1DLOA 3L0QA 4DMNA 1NU0A 4BWMA 4M3WA 4EHUA 1HNVA 5F1XA 4FJGA 4BR9A 3OJUA 4AHCA 3ZCMA 3OJSA 2O8FA 4BR0A 4CF9A 1S5JA 2OANA 5AQRA 4BC5A 1NKCA 2IS3A 1N33K 2P9IA 3LAMA 4Y1DA 3S3MA 3L2WA 3BF1A 4CFDA 2GWKA 4M3YA 4CJ4A 1ESVA 2OTLN 4CEEA 4IKFA 3KWIA 4H5NA 3P38A 4GMJB 2F4VK 3KLHA 4ISFA 3ULDA 1SKSA 2QKKA 3SBGA 4OJRA 3NCIA 3SCXA 2YV0X 3IS9A 2A5XA 2XRIA 3OYLA 4B1UB 3CCMN 3VA3A 2JGUA 2Q3SA 4FJXA 5EXWA 4WYBA 1S22A 3TTFA 3KHYA 4E7JA 1DGKN 1U48A 1VSJA 3OTOK 4DFJA 1XC9A 4H5RA 2OPRA 4KH6A 4BGBA 1IKVA 1RNHA 4EAHD 4BC4A 1BO5O 3P1GA 2O8BA 4FPBA 1OH6A 1XI1A 4C8NA 4K0KK 1VQ9N 1B9FA 1W2BM 1BIZA 2ITGA 1HX1A 1XMOK 3HPOA 2O8FB 3SJJA 2IC3A 2QTDA 3VF4A 2WTUA 1JXBA 1Y97A 1SV5A 3TAMA 4AM6A 1YXQA 1ZYQA 3VESA 4C8MA 3S3NA 1VAZA 4CJQA 4CJWA 4DV6K 2QI2A 3A5MC 3LPTA 4BR7A 4FJLA 3OBYA 5JLFA 2P9SA 1QHAA 1RBTA 3CCSN 3OBWA 2YHXA 1NKEA 4FM1A 4FPAA 3BDPA 5DK5A 5LMNK 2HF4A 2A6AA 2HHSA 3FZKA 4PKGA 3VQ7A 3BGRA 1KTQA 3HOSA 2KLAA 3RRHA 3PUFA 1S1TA 3M3ZA 4BRKA 4E19A 1TV6A 1CXUA 3OYMA 4YORA 1RCHA 4KKOA 3C6HA 4FJNA 1RDCA 5HRRA 2Q0RA 5E41A 4BY9C 4AM7A 3S41A 1RTIA 3PX4A 4NCBA 4DWIA 4IFVA 1WAFA 5C0YA 2CGJA 3NF8A 3CPWM 3O4NA 2YNGA 4CBWA 4PQUA 2ASPA 3JAMO 3JXUA 1RTDA 3SV4A 4CIFA 2VWKA 2G8KA 3VEXA 3GOIA 3OYJA 5T7BA 5E84A 4CJRA 3MMVA 4Z4FA 1BDGA 3H45C 4NCAA 1NJZA 2NLXA 3M6GA 3CJ1A 4E7KA 2G8UA 1L3UA 3SNNA 4CF2A 3RTVA 4B1XB 3ZT1A 3K58A 2W41A 2ZF5O 1NGEA 3SMPA 1HLUA 3U4LA 3UKUB 3R3LA 4DSKA 4IOCL 2HNDA 2VWBA 2HHHK 1QQMA 2O8DA 3T3FA 1HKGA 3T69A 4B9NA 4LY7A 4AHUA 4GV6A 4FLYA 1JL1A 1C1BA 5MLCQ 5JS2A 2BH1A 3L2RA 1KSPA 3C95A 4HCCA 3DXKA 1XHZA 3CD6N 1TKTA 4AHSA 4BDZA 4CZJA 2Y1JA 3GE1A 1T6CA 1QSLA 3HSCA 3ASMA 4PL7A 4E1JA 3NGYA 3OYIA 1OH7A 3SAFA 2P9PA 4BE2A 4JI7K 2FXUA 1D9DA 1G15A 3P83D 4Z4IA 4DTRA 1ASWA 3SAGA 2VQEK 5CHIA 4FJIA 4B9SA 4JI4K 3CYMA 3DLEA 3ZSOA 1YF5L 4C8KA 3SUQA 1NJYA 4CFCA 1OH5A 1L3TA 3OA9A 2P9UA 3VPZA 3V1QA 3BEXA 3AGKA 4LFAK 3PO4A 3QIOA 4M7XA 3TI0A 3DWLA 2RE2A 3O6WA 3MXIA 3FZMA 2NRWA 3LPUA 2V51B 2QWOA 2A1SA 3CJ7A 3KLFA 3QEWA 5BR9A 3C0BA 3G25A 1N34K 1NGBA 3E66A 4IJNA 4X64K 1NJWA 4NYFA 1BCOA 4I6MA 4CBXA 3OY9A 5C2FA 1ZBSA 1YVNA 3W3DA 3SUOA 5JVHL 4F2SA 1LOTB 3V6DA 3I8DA 5F2RA 1DEJA 3GDQA 4O0JA 5HRSA 4JKGA 4O55A 1SUQA 4KV8A 3AVGA 3E1YA 1YITN 5I42A 1IKYA 4FW1A 1EQYA 4MFBA 3RRGA 4JI1K 4A57A 2QXLA 3FLCO 4DG1A 3L6QA 3U9DA 1J5EK 2G8VA 2P5OA 1QSYA 1M90O 4KI4A 1VRUA 1L5UA 3KK7A 5GAGP 5KRSA 2BUPA 2VG7A 2I7NA 3THWA 4B9LA 1G99A 3AVCA 3LDOA 3CM5A 2DFEA 3WNGA 3A8YA 3KKRA 3NVMA 1NK5A 2FBXA 4CJ3A 2FC0A 5D3GA 4L3QA 1EO1A 3IUCA 4ICLA 1C1AA 3O1WA 1HKBA 3NF6A 4X65K 1RDBA 4AHTA 3VTIA 3WNHA 2YNHA 3AA4A 4Z94A 1JCGA 1K6YA 1MWMA 5GIPA 3MCAB 3WUHA 3SQ0A 1VQKN 4NLCA 3SQ4A 3TAGA 4FM2A 2HVIA 3K5LA 4AQYK 3WXMB 3NH1A 3LWMA 3LALA 1J9AA 5CZ1A 4DFPA 5EU7A 4LSNA 1X3NA 1JJ2M 3WQUA 3HK2A 3O9TA 4ISGA 4CZLA 2HNYA 4N5SA 1VHXA 1KFDA 2WOMA 3UIQA 4CE9A 1LV5A 2KZMA 4M63C 2QWLA 3SI6A 4F3OA 1JLAA 1YTAA 2D0PA 3THYB 4FZYA 1VSMA 4JKCA 4FM0A 4O44A 4QCLA 4BREA 1QVGM 2I7PA 3RMAA 3HM9A 4W5TA 4DUYK 4DQQA 3E9PA 4XIUA 5KPRA 4CESA 4NCGA 4GV9A 1A5XA 4CZEA 2O8CB 2QA4N 4FJKA 1FW6A 4H8KA 4OLBA 4FZZA 3HPHA 1JLGA 4OKJA 4J8FA 1T03A 2G8FA 3LWLA 3DLBA 4Z4HA 2YCHA 4I2PA 1BISA 4H4MA 3ZLJA 4WQ4C 4BC3A 3LAKA 2Q2RA 1ATSA 5FROA 4H4OA 4PUOA 4QS9A 3CPEA 4KO0A 3N4PA 2Z1GA 3IDHA 4AF1A 3T1HK 2V7YA 3QBWA 5AZIB 1EWQA 1GLEG 3H08A 3QNNA 1NK0A 4DR7K 2BDPA 4J2DA 5EY4A 5DM7L 4LF6K 3QB0A 1BQMA 2KQ2A 4O4GA 3TU5A 3ZETA 3TAEA 3A5LC 4Y1CA 4IEEA 3CCRN 3AO2A 5GADP 4LF5K 4DTSA 2P9LB 3B8AX 1RT2A 2HVHA 5HP1A 3EO3A 3KD5E 2IAJA 1X3MA 2ZJPL 4CVNE 3P31A 4RW4A 4NXNK 4OLAA 5AQOA 2XY5A 3WNFA 4DFMA 4CHYA 1VQ7N 1ZBHA 1WUAA 4O8KA 3AVBA 4IJAA 4BRNA 1WSHA 4H5TA 1BQNA 4BG9A 2O4IA 5JMVA 3QICA 1QTMA 2FSNA 5AZJA 3CXCM 4KREA 2YJFA 4PA1A 4KH5A 3O1BA 4HVJA 4DSIA 1VQ5N 4DV5K 2HOEA 3CQXA 1TUYA 1QQNA 1LAWA 4A5BA 1WSFA 2VYPA 3THXA 1E3MA 4L8RB 1BG3A 4CHNA 1RT7A 1KXPA 4DV4K 4CBUA 2P9KA 3ZSVA 5BPNA 3MN7A 4K41A 3D6RA 4C23A 4OGCA 4CGHA 4NLBA 4CZHA 3CM6A 3U3GA 5AQPA 3NMUA 3EKUA 3VEWA 4CGJA 3WXKA 2E88A 1J53A 1K73O 3AARA 3LZIA 2A41A 1RTHA 3QIPA 1IG9A 3ZSWA 1XNRK 4WE1A 3LP0A 4UY8O 2OPQA 1TK8A 4DUZK 3DXMB 4HTLA 4XH5A 2IOCA 1QE1A 1ZBFA 2UXDK 3TABA 1YVUA 4RW8A 3ZT3A 4GKKK 4B9TA 4FO0A 3BZKA 4V19S 3EL2A 4OO1J 4Z4GA 2IDOA 2R7YA 3TAPA 2PFUA 4WQ4A 3V9SA 4J2AA 1VSDA 3M5RA 5AQFA 3OS1A 4X66K 1FKOA 3LDLA 1I3AA 3MEGA 1T05A 2E5LK 2Q36A 2QWRA 3LM9A 3VQ4A 2DY4A 4ILJA 3NHGA 4CJLA 1T7PA 2E2OA 3IAYA 4FK2A 3L8BA 3KKSA 5C2DA 3AVIA 1LAVA 1DTTA 1FJGK 4FLVA 2QWNA 4JKEA 1MU2A 4DFKA 2NRXA 3QINA 4M7YA 4CJUA 1KLNA 1RBVA 3RSEB 1JLFA 1Q81O 3ZX2A 1SS6A 4JKFA 4DQPA 4A62A 1IH7A 5KRTA 3ZSRA 4CI6A 2ITMA 3VQ9A 2IIRA 1N8RO 2F96A 5KPZA 2F9TA 4Z0UA 1X9JA 4FLTA 4JI6K 4DU4A 3AAQA 2Z1JA 2P9NB 1QVFM 2O8EB 4CJTA 3EYZA 3VQCA 4CZIA 1XQSC 1XC3A 3OYNA 1NNEA 1S1XA 1TK5A 4DR3K 2Q1NA 4LSLA 1GLJO 1SZ2A 3HSTB 2ZJQL 2OPPA 3KK1A 3E9OA 4CEOA 1VSIA 2JLEA 5JLHA 4CIGA 4MDAA 1RT3A 3PV8A 3HVTA 1O13A 2FF3B 3PIPL 4JRPA 4AILC 1NKBA 3OYCA 3EZ5A 2GELA 3J7YP 1VQLN 5LL6Z 4RW9A 3AA3A 3OS2A 5CYQA 4IXCA 4DTXA 3S3OA 2E2NA 3PLAA 3N4QA 1NGJA 1RT5A 5LJVA 5AQZA 3KLIA 3DLRA 1IO2A 4KHPK 1R0AA 4BWJA 1ATNA 3FZFA 2YHYA 4C1NI 3CHWA 3VEVA 4MO5A 3AVHA 3FFIA 5AQHA 1K9MO 3VMFB 1Y64A 1NLVA 2ZD1A 3I56N 3OYFA 2F7TA 1EX4A 3NH0A 4LH5A 4JHDB 4A5AA 1UA1A 1NGHA 3C6UA 3QFPA 3VQPA 5IWAK 4DLGA 4DHYA 1KRPA 4FLXA 4EP4A 2YJEA 2PYJA 2ASOA 4CJ5A 3IMXA 1RT4A 3VQ6A 3NGIA 4BQLA 2B6AA 4RG8A 4I7FA 3DJCA 3CCUN 4W5NA 3Q7CA 5BPLA 1NGAA 5BN8A 2ETJA 3AA2A 5SZTA 1SKWA 1JXEA 1WSGA 4B9UA 4E0DA 5KGXA 3UKUA 4YHHK 4XH4A 3G4SN 5C10A 3L2VA 1XWLA 2GWJA 4RW7A 2EWSA 4DSLA 5AFUA 4KHYA 4O8UA 5KPTA 3AVLA 3KK3A 5M1OA 3PO5A 3TAFA 3KIOA 3HBTA 1BOTO 2VG5A 5J1EA 4ELVA 3OHRA 3R1XA 2HSTA 1Q9YA 4DSFA 3U8XA 3ZSYA 2H3GX 4OPJA 4MO4A 2D1KA 3TTCA 2RPIA 2D5RA 3CC2N 4FL9A 4X62K 3O4QA 3NVKA 1IG8A 1Q82O 2V52B 4KRFA 2XY7A 4BRCA 2E20A 4KTZA 3CFRA 3U3YA 4FSVA 1K8KB 5HLFA 1IJJA 4YOUA 1NK9A 2ASMA 4DF4A 1NBWA 3VQQA 3HPGA 2A3ZA 4H0PA 1OH8A 4QAGA 2E2PA 4EZ6A 3HT3A 3B6OA 1VQ4N 3G6EN 3G0ZA 2X6SA 3C6TA 2JWKA 2W6KA 4H0XB 2J4RA 2A1RA 2E6LA 3ATVA 3OYHA 3IFRA 5DM6L 2GBZA 3QESA 4FLWA 3CIPA 1Z26A 4CHQA 2KKZA 3CMEN 5FRNA 1HQUA 5EOYA 3TWHA 2HBLA 3TPQA 1EP4A 3H1VX 4E1NA 2YNIA 3LANA 1KLMA 2VWJA 5I3UA 3HOTA 2QKBA 4KHQA 1Q8IA 1NGDA 4GVEA 1BHLA 3HO1A 3EN9A 3LL3A 3VEZA 4IZ9A 1NGGA 3KLGA 3VA0A 1YJWN 1YUWA 4BG8A 3T1YK 1RT6A 5C25A 3WEEB 1YJNN 3L3UA 1HYVA 4DR1K 2UXCK 4N56A 2HHTA 3CCQN 3EEQA 4CJPA 4F4KA 3U9ZA 4BDYA 3CMAN 5J2QA 2F9WA 5M1FA 4KFBA 3ALYA 4JS4A 4DQIA 4DV1K 3O9QA 1KFSA 4BC2A 4KB0A 4CECA 4DQRA 2RN2A 4CGGA 4CHOA 1ATRA 1DTQA 1V4SA 4RCHA 5AQTA 1WBDA 5FPEA 1ZXOA 3KLEA 4BACA 3MDQA 3ZYYX 3A5NC 3DRPA 4CEDA 2NUBA 1BGXT 1N32K 2HBMA 2PYLA 1VK0A 2FSJA 2EHGA 4JI3K 2NRZA 4YOTA 4G1QA 4GY2B 1HJOA 3EE9A 1Q7YO 3TTDA 4UQGA 1U2VB 4OKEA 4DV2K 4FWSA 4BVOA 3BY5A 2NZTA 5FRMA 4OGEA 5BRFA 1NK4A 1Z6RA 1D9FA 5CZ2A 3L3VA 4DTPA 3JYTA 4BRMA 4WF9L 1W7AA 4I2QA 4LF7K 1YAGA 2E1YA 1YJ9N 2UXBK 4FVMA 4IWVA 3VF6A 4E7HA 2WUSA 3I33A 3QO9A 1VRTA 5AQMA 5HROA 2WBNA 4CJVA 3ZT0A 1SL0A 3LP2A 4JNEA 3HM8A 3RVCA 3C6AA 3V1RA 3THYA 2VGMA 5M1QA 5K14A 1JKHA 5C24A 3ISNC 3CCLN 3SBTA 4M3ZA 2CH5A 4PY5A 1YHQN 2Q97A 1NM1A 4CJSA 3AO5A 4FOEA 3VETA 4DR4K 3GL1A 4FVUA 3ZT2A 2O8CA 5CE3A 1X9MA 3RWUA 5HOOA 3SPZA 3FR0A 2E4LA 4OKKA 4BDPA 4N76A 4A59A 3MX2A 4CK2A 3T19A 1NGIA 4B8CA 1SKRA 1T3VA 2AA4A 2UUAK 1U6ZA 3D0PA 5AQGA 3VEOA 1CZAN 3G71N 3VEYA 5BN9A 5FDLA 3BUZB 5LMUK 5A2QO 3RMCA 3KWGA 3E01A 1S1UA 2Z1IA 3PX6A 5AZIA 3AV9A 4FJ7A 1CXQA 1W97L 1RILA 4IFEA 3J80O 4CJ7A 4M42A 1JL2A 4NB4A 4KHNA 3HP6A 4FXDA 2RF2A 4GVMA 4DB3A 1WAJA 2QM1A 3B6PA 3HTVA 4BGAA 2GUIA 3BZCA 3SPYA 2A42A 5AQUA 2P9LA 4A2AA 3TAQA 1ASUA 4HCBA 1S3XA 4DV3K 3THVA 4FOIA 4ZTJA 3DMJA 5GIOA 1Q18A 3OS0A 5AQWA 1HMVA 3O9SA 1MWKA 3V1OA 5BPMA 3LP1A 2UU9K
chains in the Genus database with same CATH topology
4LD0A 2X74A 2RKIA 2R7YA 3TAPA 1JXBA 1Q9XA 1Y97A 2HHUA 1TAQA 1SV5A 3V9SA 3TANA 3TAMA 4J2AA 1VSDA 1ZYQA 3OS1A 4LH4A 4B3OA 4C8MA 1TAUA 1C0MA 1FKOA 1I3AA 3MEGA 3S3NA 4CJWA 4CJQA 1T05A 3OYBA 3C94A 3HL8A 2OYQA 4FK0A 2VG6A 3ZSZA 4DLEA 4CJFA 1RDDA 1EXQA 1U04A 1HYZA 3VQ4A 3LPTA 1YTUA 2OZSA 2DY4A 4ELUA 4FJLA 3NHGA 4CJLA 4Q0BA 1T7PA 3IAYA 1NK7A 2ZE2A 4FK2A 3L8BA 2XY6A 3KKSA 4IFYA 3AVIA 1LAVA 2HW3A 1DTTA 1RBTA 3HJFA 4FLZA 1NKEA 4FLVA 4DS4A 4FM1A 2G8WA 3BDPA 1KVCA 5DK5A 1TKXA 4JRQA 4DTUA 4FJ9A 4BE1A 1MU2A 4CK1A 4CGIA 4DFKA 2HHSA 3VQ7A 3QINA 4CEZA 3BGRA 1W9HA 4CJUA 3K57A 1KTQA 1LW0A 1RBVA 1KLNA 1JLFA 5J2PA 4HTUA 3RRHA 3QEVA 3PUFA 3PX0A 1S1TA 4DQPA 2D0BA 4M3RA 4E19A 1IH7A 5KRTA 1TV6A 3OYEA 4CGDA 3ZSRA 1CXUA 2O4GA 3VQ9A 3OYMA 4J2EA 4CEFA 1RCHA 2F96A 3MEEA 1S9GA 4KKOA 1QHTA 4Z0UA 1X1PA 4FJNA 4FLTA 3L2QA 1RDCA 3MEDA 5HRRA 4Z4CA 4DU4A 2Z1JA 5E41A 3M8QA 4KHSA 4DTMA 1RTIA 1A5WA 5J2MA 3PX4A 4NCBA 1WN7A 4DWIA 2HHQA 4IFVA 1J54A 1FKPA 4CJTA 4CK3A 1WAFA 3NFAA 3DM2A 3EYZA 3KD1E 3VQCA 4AH9A 3NF8A 4B9VA 3O4NA 2YNGA 3OYNA 3NE6A 1S1XA 1TK5A 5JS1A 4PQUA 4KB1A 4LSLA 3TR8A 3OYKA 2BGGA 1GOAA 3HSTB 1RTDA 3SV4A 4CIFA 2VWKA 2G8KA 1C0TA 2OPPA 3KK1A 4CEOA 1VSIA 3V9WA 3OYJA 2PY5A 4F2RA 1ITGA 2JLEA 5T7BA 4CIGA 3RMDA 1RT3A 4CJRA 2FBYA 3PV8A 3G10A 3HVTA 4Z4FA 2E6MA 2YKMA 4JRPA 4AILC 1NJZA 1NKBA 4NCAA 4ID1A 3OYCA 3EZ5A 4E7KA 3QERA 1HNIA 1L3VA 4FJMA 1RDAA 2G8UA 2X78A 1L3UA 3SNNA 3AVMA 4RW9A 4M3TA 4CF2A 3RTVA 3AA3A 3OS2A 3QNOA 3ZT1A 5CYQA 3K58A 4DTXA 3S3OA 4DU3A 4N41A 2G8IA 3CG7A 3AVJA 1W0HA 2BANA 4E89A 1VSEA 1S9EA 4DSKA 2HNDA 3T3FA 2BE2A 1RT5A 4B9NA 4LY7A 4ZHRA 3KLIA 3SV3A 1IKWA 4AHUA 3VQ8A 1VSFA 3DLRA 1IO2A 1HPZA 4FLYA 5HRPA 2DFFA 1C1BA 1JL1A 3V9XA 3MXJA 1LW2A 5JS2A 2XO7A 3L2RA 3HYFA 3C95A 5HBMA 1R0AA 1U49A 4BWJA 1KSPA 1XHZA 4C8OA 4CERA 1TKTA 4AHSA 4CF0A 4FJ5A 5CYMA 4BDZA 4CEAA 4CCHA 3AVHA 3FFIA 5SWMA 2Y1JA 1L3SA 1QSLA 2ZD1A 4HUFA 3ASMA 3OYFA 4AHRA 3V9UA 1EX4A 3NH0A 3NGYA 4M3XA 3OYIA 4LH5A 4DF8A 2HMIA 4BE2A 1UA1A 3CFOA 4O5BA 3WNEA 1D9DA 3C6UA 4B9MA 1G15A 3VQPA 3P83D 1S6PA 3DRRA 4DLGA 4Z4IA 4DTRA 4FW2A 1ASWA 3DOLA 4FLXA 1KRPA 4EP4A 4FJIA 3S9HA 1S1VA 1ZBLA 2PYJA 3CYMA 4W5OA 4B9SA 4CJ5A 1J5OA 4E1MA 4KPYA 1RT4A 3DLEA 3VQ6A 4I9LA 3ZSOA 4C8KA 1BIUA 3NGIA 3SUQA 3F9KA 1NJYA 4CFCA 2QK9A 1XHXA 2B6AA 2ZQBA 4RG8A 4I7FA 2KFNA 1L3TA 3QEXA 3NGZA 4W5NA 4IBNA 3V1QA 1RTJA 1CLQA 2Z1HA 4HUGA 5J2NA 3PO4A 1LWEA 2ETJA 3AA2A 3QIOA 3TI0A 5SZTA 1JLCA 3K5MA 1KVBA 1A5VA 1SKWA 3KJVA 4PWDA 3MXIA 1JXEA 1WSGA 4B9UA 3LPUA 4E0DA 1C6VA 1FXXA 5KGXA 3LZJA 4E3SA 3V4IA 1TK0A 2A1SA 3NBPA 3KLFA 3QEWA 4QOZB 2X6NA 1KCFA 3L2VA 4JLHA 1XWLA 1I39A 4RW7A 1NJWA 1U4BA 4NYFA 1Z25A 4DSLA 1BCOA 4KHYA 1RT1A 4GW6A 3M8RA 3K59A 3AVLA 3DYAA 2YNFA 3KK3A 4M41A 3PO5A 2DTUA 3P5JA 3TAFA 1VSLA 1JLEA 2HB5A 4CGFA 4CEQA 3OY9A 3U6FA 1B9DA 2OPSA 3KIOA 3A2FA 3SUOA 2VG5A 4F2SA 1SL2A 4EZ9A 1F21A 1O1WA 3AVNA 1CZBA 3V6DA 3I8DA 5KGWA 5J1EA 4ELVA 4O0JA 5DMRA 1HRHA 5HRSA 1N5YA 4O55A 4FJHA 1SUQA 1Q9YA 4KV8A 4DSFA 3AVGA 3ZSYA 4OPJA 5I42A 3ZSQA 1D8YA 1IKYA 4FW1A 2FBTA 4MFBA 3RRGA 1YT3A 1QSSA 1NOZA 1S6QA 2RPIA 4CJEA 1UA0A 2D5RA 4DG1A 3NF7A 3O4QA 3LP3A 2G8VA 2P5OA 4CHPA 1QSYA 5KTQA 2HHXA 4KI4A 1VRUA 1L5UA 3VQAA 4IDKA 3IRXA 4AHVA 5KRSA 3K5NA 4KRFA 2XY7A 2VG7A 4KTZA 3CFRA 3U3YA 4B9LA 3I0SA 3AVCA 1T8EA 1CZ9A 3CM5A 1JLBA 1ZBIA 3HVRA 1VSHA 2PZSA 5HLFA 2DFEA 2WONA 4ID5A 2IGIA 5KI6A 3WNGA 1NK9A 4DF4A 3KKRA 1QS4A 3VQQA 3HPGA 4KTQA 1D5AA 4QAGA 4EZ6A 1NK5A 1U47A 4I9QA 1HJRA 3HT3A 2FBXA 4CJ3A 3B6OA 2FC0A 5D3GA 1REVA 2YKNA 3G0ZA 1VSKA 2HHVA 2HHWA 2GV9A 2X6SA 3C6TA 1C1AA 4ICLA 3ITHA 3NF6A 1RDBA 4NYNA 4AHTA 1X9SA 3I0RA 3VN5A 4Z4EA 2A1RA 2E6LA 1WNSA 3OYHA 3WNHA 2YNHA 3AVFA 3DRSA 3LDSA 2GBZA 3AA4A 4FLWA 4DTJA 3QESA 1K6YA 1Z26A 4CEBA 4CHQA 3V81A 4DSJA 4FZXC 5FRNA 4BE0A 1HQUA 3TWHA 4O0IA 4HHTA 1EP4A 4E1NA 3SQ0A 1BI4A 3NAEA 1WSIA 2YNIA 3SQ4A 3LANA 1KLMA 4HCCA 3ZSXA 3TAGA 4FLUA 1JLQA 4FM2A 3AO3A 4N47A 2KZZA 1LWFA 3DI6A 3O3FA 2HVIA 3MAQA 3SQ1A 1NK6A 3K5LA 2VWJA 3NH1A 1UOCA 5I3UA 4CFBA 3SZ2A 3JSMA 3LWMA 2YHBA 4KHQA 4J2BA 3LALA 2QKBA 1J9AA 1Q8IA 5CZ1A 4CIEA 3L2UA 4DFPA 5EU7A 4LSNA 1BHLA 3HO1A 3HK2A 4FJJA 3D45A 3OVNA 1TGOA 2HNYA 1BCMA 1FK9A 4N5SA 1KFDA 2WOMA 2XY8A 1RBRA 2I5JA 3DOKA 3ZT4A 4B08A 3KLGA 3UIQA 4W5RA 4M3UA 4CE9A 1LV5A 3VA0A 3T1AA 4PY5A 4FJ8A 2G8HA 4CF8A 3VQEA 1GOCA 2KZMA 4KAZA 1RT6A 2P1JA 1C0UA 5C25A 3SI6A 3MXMA 4F3OA 5C42A 3NH2A 2P5GA 1JLAA 1EKEA 1YTAA 2QXFA 3L3UA 1HYVA 1VSMA 4FM0A 4FZYA 4N56A 2Y1IA 2HHTA 4O44A 4HUEA 4CJPA 3O3GA 4F4KA 4YFUA 4QCLA 4BDYA 2EX3A 5J2QA 3DLGA 1BL3A 3RMAA 1LWCA 3EY1A 3HM9A 4W5TA 1UAXA 3PY8A 4DQQA 4C8LA 4XIUA 4FYDA 4KFBA 4CESA 3ALYA 4NCGA 4CJKA 1WLJA 4JS4A 4ZTFA 1A5XA 4DQIA 4F3TA 4TSXA 1TL1A 4FJKA 1KFSA 4H8KA 2F8TA 4KB0A 4OLBA 3VQ5A 4FZZA 3HPHA 4CECA 1SL1A 2B4JA 2RN2A 4DQRA 4CGGA 3QETA 3MECA 4CHOA 3TARA 2OZMA 1GOBA 1DTQA 1JLGA 4OKJA 4BACA 3KLEA 4Q5VA 4CEDA 3DRPA 1T03A 2NUBA 1BGXT 3SUNA 2YHAA 2G8FA 2FBVA 4OPKA 3LWLA 3DLBA 2PYLA 4Z4HA 3KTQA 1VK0A 5CY4A 2EHGA 2HNZA 4I2PA 3RR8A 1BISA 4H4MA 4ELTA 3SQ2A 1BI4B 1HQEA 4G1QA 4DU1A 3OYGA 3LAKA 3M8SA 4DSEA 4DS5A 2D0CA 1S1WA 1UWBA 4CF1A 4UQGA 4FCYA 4OKEA 1TL3A 5FROA 1IKXA 4H4OA 2OA8A 1C1CA 4PUOA 4R5PA 1NOYA 1EETA 4JS5A 4KO0A 3DLHA 5FRMA 4OGEA 3DLKA 3V9ZA 2Z1GA 4OVLA 3SUPA 1NK4A 3AO1A 1D9FA 1WSJA 5CZ2A 4CHZA 3RMBA 1N6QA 4IG3A 3L3VA 3H08A 3NF9A 3JYTA 4DTPA 2XHBA 3QNNA 1NK0A 3K2PA 2BDPA 3RR7A 3CQ8A 1U45A 4I2QA 4J2DA 4E7LA 4K8XA 1NJXA 4W5QA 1BQMA 3HXMA 4FVMA 2KQ2A 4O4GA 3F73A 4E7HA 1TKDA 3TAEA 4KHWA 4Y1CA 4IG0A 1HYSA 3QO9A 3NDKA 1VRTA 5HROA 3KK2A 4F8RA 3CFPA 3AO2A 1QQCA 4CJVA 3ZT0A 4DTSA 1SL0A 3HP9A 3LP2A 4KTWA 1RT2A 2HVHA 3K5OA 5HP1A 3KD5E 4K8ZA 2IAJA 3V1RA 2DFHA 4YNQA 1X9WA 1TVRA 2LSNA 3QEPA 4DTOA 4RW4A 3QEIA 1RBSA 4OLAA 5K14A 1DLOA 1JKHA 4DMNA 5C24A 3ISNC 2B5JA 4BWMA 2XY5A 4RW6A 1HNVA 3WNFA 3AO4A 4M3WA 4M3ZA 4DFMA 4CHYA 1ZBHA 4CJSA 4FJGA 2KTQA 1RBUA 3AO5A 3AVBA 3OJUA 3ZT2A 5HRNA 4AHCA 1X9MA 3ZCMA 3OJSA 1WSHA 3SPZA 3RWUA 4CF9A 3OYAA 4DTNA 1S5JA 2E4LA 1BQNA 4OKKA 4BDPA 2O4IA 1NKCA 2IS3A 1QTMA 4N76A 4KREA 1KVAA 3LAMA 4CK2A 4Y1DA 3T19A 3L2WA 3S3MA 4CFDA 4M3YA 4B8CA 4CJ4A 4PA1A 2P51A 1SKRA 4CEEA 4KHUA 3D0PA 4HVJA 1NK8A 4DSIA 1ZBUA 4IKFA 3OYDA 4GMJB 4FK4A 3KLHA 1LAWA 3ULDA 1SKSA 2QKKA 1WSFA 5FDLA 3SYZA 1WSEA 3O3HA 3RMCA 4L8RB 4CHNA 3E01A 4OJRA 1RT7A 3AA5X 1S1UA 2Z1IA 3NCIA 3PX6A 3SCXA 3AV9A 2YV0X 4FJ7A 2AJQA 3IS9A 1CXQA 1TKZA 1RILA 2D0AA 3ZSVA 2XRIA 3OYLA 3VA3A 4CFAA 2JGUA 4OGCA 4MQ3A 4CGHA 4M42A 1JL2A 2Q3SA 4KI6A 4KHNA 3CM6A 3HP6A 2W42A 3U3GA 4FJXA 4FXDA 2RF2A 4GVMA 4EP5A 4DQSA 1WAJA 4CGJA 2KW4A 3B6PA 1ASVA 1J53A 4E7JA 3AVAA 2GUIA 1VSJA 3LZIA 4DFJA 1XC9A 4M45A 1U48A 3SPYA 3M8PA 2OPRA 1RTHA 3QIPA 3TAQA 3ZSWA 1ASUA 1IG9A 4HCBA 2F8SA 4WE1A 3LP0A 3THVA 3QLHA 1IKVA 1RNHA 2OPQA 3AVKA 4B8AB 3P1GA 1TK8A 4ZTJA 4E7IA 2KFZA 1XI1A 3DMJA 2IOCA 1QE1A 1ZBFA 3IG1A 4C8NA 1B9FA 3OS0A 1HMVA 3TABA 1YVUA 4RW8A 3ZT3A 1BIZA 2ITGA 3V1OA 1B92A 4B9TA 3LP1A 3HPOA 3VQBA 3SJJA 2ATQA 3VQDA 4Z4GA 2IC3A 2IDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD0 A;  2X74 A;  2RKI A;  2R7Y A;  3TAP A;  1JXB A;  1Q9X A;  1Y97 A;  2HHU A;  1TAQ A;  1SV5 A;  3V9S A;  3TAN A;  3TAM A;  4J2A A;  1VSD A;  1ZYQ A;  3OS1 A;  4LH4 A;  4B3O A;  4C8M A;  1TAU A;  1C0M A;  1FKO A;  1I3A A;  3MEG A;  3S3N A;  4CJW A;  4CJQ A;  1T05 A;  3OYB A;  3C94 A;  3HL8 A;  2OYQ A;  4FK0 A;  2VG6 A;  3ZSZ A;  4DLE A;  4CJF A;  1RDD A;  1EXQ A;  1U04 A;  1HYZ A;  3VQ4 A;  3LPT A;  1YTU A;  2OZS A;  2DY4 A;  4ELU A;  4FJL A;  3NHG A;  4CJL A;  4Q0B A;  1T7P A;  3IAY A;  1NK7 A;  2ZE2 A;  4FK2 A;  3L8B A;  2XY6 A;  3KKS A;  4IFY A;  3AVI A;  1LAV A;  2HW3 A;  1DTT A;  1RBT A;  3HJF A;  4FLZ A;  1NKE A;  4FLV A;  4DS4 A;  4FM1 A;  2G8W A;  3BDP A;  1KVC A;  5DK5 A;  1TKX A;  4JRQ A;  4DTU A;  4FJ9 A;  4BE1 A;  1MU2 A;  4CK1 A;  4CGI A;  4DFK A;  2HHS A;  3VQ7 A;  3QIN A;  4CEZ A;  3BGR A;  1W9H A;  4CJU A;  3K57 A;  1KTQ A;  1LW0 A;  1RBV A;  1KLN A;  1JLF A;  5J2P A;  4HTU A;  3RRH A;  3QEV A;  3PUF A;  3PX0 A;  1S1T A;  4DQP A;  2D0B A;  4M3R A;  4E19 A;  1IH7 A;  5KRT A;  1TV6 A;  3OYE A;  4CGD A;  3ZSR A;  1CXU A;  2O4G A;  3VQ9 A;  3OYM A;  4J2E A;  4CEF A;  1RCH A;  2F96 A;  3MEE A;  1S9G A;  4KKO A;  1QHT A;  4Z0U A;  1X1P A;  4FJN A;  4FLT A;  3L2Q A;  1RDC A;  3MED A;  5HRR A;  4Z4C A;  4DU4 A;  2Z1J A;  5E41 A;  3M8Q A;  4KHS A;  4DTM A;  1RTI A;  1A5W A;  5J2M A;  3PX4 A;  4NCB A;  1WN7 A;  4DWI A;  2HHQ A;  4IFV A;  1J54 A;  1FKP A;  4CJT A;  4CK3 A;  1WAF A;  3NFA A;  3DM2 A;  3EYZ A;  3KD1 E;  3VQC A;  4AH9 A;  3NF8 A;  4B9V A;  3O4N A;  2YNG A;  3OYN A;  3NE6 A;  1S1X A;  1TK5 A;  5JS1 A;  4PQU A;  4KB1 A;  4LSL A;  3TR8 A;  3OYK A;  2BGG A;  1GOA A;  3HST B;  1RTD A;  3SV4 A;  4CIF A;  2VWK A;  2G8K A;  1C0T A;  2OPP A;  3KK1 A;  4CEO A;  1VSI A;  3V9W A;  3OYJ A;  2PY5 A;  4F2R A;  1ITG A;  2JLE A;  5T7B A;  4CIG A;  3RMD A;  1RT3 A;  4CJR A;  2FBY A;  3PV8 A;  3G10 A;  3HVT A;  4Z4F A;  2E6M A;  2YKM A;  4JRP A;  4AIL C;  1NJZ A;  1NKB A;  4NCA A;  4ID1 A;  3OYC A;  3EZ5 A;  4E7K A;  3QER A;  1HNI A;  1L3V A;  4FJM A;  1RDA A;  2G8U A;  2X78 A;  1L3U A;  3SNN A;  3AVM A;  4RW9 A;  4M3T A;  4CF2 A;  3RTV A;  3AA3 A;  3OS2 A;  3QNO A;  3ZT1 A;  5CYQ A;  3K58 A;  4DTX A;  3S3O A;  4DU3 A;  4N41 A;  2G8I A;  3CG7 A;  3AVJ A;  1W0H A;  2BAN A;  4E89 A;  1VSE A;  1S9E A;  4DSK A;  2HND A;  3T3F A;  2BE2 A;  1RT5 A;  4B9N A;  4LY7 A;  4ZHR A;  3KLI A;  3SV3 A;  1IKW A;  4AHU A;  3VQ8 A;  1VSF A;  3DLR A;  1IO2 A;  1HPZ A;  4FLY A;  5HRP A;  2DFF A;  1C1B A;  1JL1 A;  3V9X A;  3MXJ A;  1LW2 A;  5JS2 A;  2XO7 A;  3L2R A;  3HYF A;  3C95 A;  5HBM A;  1R0A A;  1U49 A;  4BWJ A;  1KSP A;  1XHZ A;  4C8O A;  4CER A;  1TKT A;  4AHS A;  4CF0 A;  4FJ5 A;  5CYM A;  4BDZ A;  4CEA A;  4CCH A;  3AVH A;  3FFI A;  5SWM A;  2Y1J A;  1L3S A;  1QSL A;  2ZD1 A;  4HUF A;  3ASM A;  3OYF A;  4AHR A;  3V9U A;  1EX4 A;  3NH0 A;  3NGY A;  4M3X A;  3OYI A;  4LH5 A;  4DF8 A;  2HMI A;  4BE2 A;  1UA1 A;  3CFO A;  4O5B A;  3WNE A;  1D9D A;  3C6U A;  4B9M A;  1G15 A;  3VQP A;  3P83 D;  1S6P A;  3DRR A;  4DLG A;  4Z4I A;  4DTR A;  4FW2 A;  1ASW A;  3DOL A;  4FLX A;  1KRP A;  4EP4 A;  4FJI A;  3S9H A;  1S1V A;  1ZBL A;  2PYJ A;  3CYM A;  4W5O A;  4B9S A;  4CJ5 A;  1J5O A;  4E1M A;  4KPY A;  1RT4 A;  3DLE A;  3VQ6 A;  4I9L A;  3ZSO A;  4C8K A;  1BIU A;  3NGI A;  3SUQ A;  3F9K A;  1NJY A;  4CFC A;  2QK9 A;  1XHX A;  2B6A A;  2ZQB A;  4RG8 A;  4I7F A;  2KFN A;  1L3T A;  3QEX A;  3NGZ A;  4W5N A;  4IBN A;  3V1Q A;  1RTJ A;  1CLQ A;  2Z1H A;  4HUG A;  5J2N A;  3PO4 A;  1LWE A;  2ETJ A;  3AA2 A;  3QIO A;  3TI0 A;  5SZT A;  1JLC A;  3K5M A;  1KVB A;  1A5V A;  1SKW A;  3KJV A;  4PWD A;  3MXI A;  1JXE A;  1WSG A;  4B9U A;  3LPU A;  4E0D A;  1C6V A;  1FXX A;  5KGX A;  3LZJ A;  4E3S A;  3V4I A;  1TK0 A;  2A1S A;  3NBP A;  3KLF A;  3QEW A;  4QOZ B;  2X6N A;  1KCF A;  3L2V A;  4JLH A;  1XWL A;  1I39 A;  4RW7 A;  1NJW A;  1U4B A;  4NYF A;  1Z25 A;  4DSL A;  1BCO A;  4KHY A;  1RT1 A;  4GW6 A;  3M8R A;  3K59 A;  3AVL A;  3DYA A;  2YNF A;  3KK3 A;  4M41 A;  3PO5 A;  2DTU A;  3P5J A;  3TAF A;  1VSL A;  1JLE A;  2HB5 A;  4CGF A;  4CEQ A;  3OY9 A;  3U6F A;  1B9D A;  2OPS A;  3KIO A;  3A2F A;  3SUO A;  2VG5 A;  4F2S A;  1SL2 A;  4EZ9 A;  1F21 A;  1O1W A;  3AVN A;  1CZB A;  3V6D A;  3I8D A;  5KGW A;  5J1E A;  4ELV A;  4O0J A;  5DMR A;  1HRH A;  5HRS A;  1N5Y A;  4O55 A;  4FJH A;  1SUQ A;  1Q9Y A;  4KV8 A;  4DSF A;  3AVG A;  3ZSY A;  4OPJ A;  5I42 A;  3ZSQ A;  1D8Y A;  1IKY A;  4FW1 A;  2FBT A;  4MFB A;  3RRG A;  1YT3 A;  1QSS A;  1NOZ A;  1S6Q A;  2RPI A;  4CJE A;  1UA0 A;  2D5R A;  4DG1 A;  3NF7 A;  3O4Q A;  3LP3 A;  2G8V A;  2P5O A;  4CHP A;  1QSY A;  5KTQ A;  2HHX A;  4KI4 A;  1VRU A;  1L5U A;  3VQA A;  4IDK A;  3IRX A;  4AHV A;  5KRS A;  3K5N A;  4KRF A;  2XY7 A;  2VG7 A;  4KTZ A;  3CFR A;  3U3Y A;  4B9L A;  3I0S A;  3AVC A;  1T8E A;  1CZ9 A;  3CM5 A;  1JLB A;  1ZBI A;  3HVR A;  1VSH A;  2PZS A;  5HLF A;  2DFE A;  2WON A;  4ID5 A;  2IGI A;  5KI6 A;  3WNG A;  1NK9 A;  4DF4 A;  3KKR A;  1QS4 A;  3VQQ A;  3HPG A;  4KTQ A;  1D5A A;  4QAG A;  4EZ6 A;  1NK5 A;  1U47 A;  4I9Q A;  1HJR A;  3HT3 A;  2FBX A;  4CJ3 A;  3B6O A;  2FC0 A;  5D3G A;  1REV A;  2YKN A;  3G0Z A;  1VSK A;  2HHV A;  2HHW A;  2GV9 A;  2X6S A;  3C6T A;  1C1A A;  4ICL A;  3ITH A;  3NF6 A;  1RDB A;  4NYN A;  4AHT A;  1X9S A;  3I0R A;  3VN5 A;  4Z4E A;  2A1R A;  2E6L A;  1WNS A;  3OYH A;  3WNH A;  2YNH A;  3AVF A;  3DRS A;  3LDS A;  2GBZ A;  3AA4 A;  4FLW A;  4DTJ A;  3QES A;  1K6Y A;  1Z26 A;  4CEB A;  4CHQ A;  3V81 A;  4DSJ A;  4FZX C;  5FRN A;  4BE0 A;  1HQU A;  3TWH A;  4O0I A;  4HHT A;  1EP4 A;  4E1N A;  3SQ0 A;  1BI4 A;  3NAE A;  1WSI A;  2YNI A;  3SQ4 A;  3LAN A;  1KLM A;  4HCC A;  3ZSX A;  3TAG A;  4FLU A;  1JLQ A;  4FM2 A;  3AO3 A;  4N47 A;  2KZZ A;  1LWF A;  3DI6 A;  3O3F A;  2HVI A;  3MAQ A;  3SQ1 A;  1NK6 A;  3K5L A;  2VWJ A;  3NH1 A;  1UOC A;  5I3U A;  4CFB A;  3SZ2 A;  3JSM A;  3LWM A;  2YHB A;  4KHQ A;  4J2B A;  3LAL A;  2QKB A;  1J9A A;  1Q8I A;  5CZ1 A;  4CIE A;  3L2U A;  4DFP A;  5EU7 A;  4LSN A;  1BHL A;  3HO1 A;  3HK2 A;  4FJJ A;  3D45 A;  3OVN A;  1TGO A;  2HNY A;  1BCM A;  1FK9 A;  4N5S A;  1KFD A;  2WOM A;  2XY8 A;  1RBR A;  2I5J A;  3DOK A;  3ZT4 A;  4B08 A;  3KLG A;  3UIQ A;  4W5R A;  4M3U A;  4CE9 A;  1LV5 A;  3VA0 A;  3T1A A;  4PY5 A;  4FJ8 A;  2G8H A;  4CF8 A;  3VQE A;  1GOC A;  2KZM A;  4KAZ A;  1RT6 A;  2P1J A;  1C0U A;  5C25 A;  3SI6 A;  3MXM A;  4F3O A;  5C42 A;  3NH2 A;  2P5G A;  1JLA A;  1EKE A;  1YTA A;  2QXF A;  3L3U A;  1HYV A;  1VSM A;  4FM0 A;  4FZY A;  4N56 A;  2Y1I A;  2HHT A;  4O44 A;  4HUE A;  4CJP A;  3O3G A;  4F4K A;  4YFU A;  4QCL A;  4BDY A;  2EX3 A;  5J2Q A;  3DLG A;  1BL3 A;  3RMA A;  1LWC A;  3EY1 A;  3HM9 A;  4W5T A;  1UAX A;  3PY8 A;  4DQQ A;  4C8L A;  4XIU A;  4FYD A;  4KFB A;  4CES A;  3ALY A;  4NCG A;  4CJK A;  1WLJ A;  4JS4 A;  4ZTF A;  1A5X A;  4DQI A;  4F3T A;  4TSX A;  1TL1 A;  4FJK A;  1KFS A;  4H8K A;  2F8T A;  4KB0 A;  4OLB A;  3VQ5 A;  4FZZ A;  3HPH A;  4CEC A;  1SL1 A;  2B4J A;  2RN2 A;  4DQR A;  4CGG A;  3QET A;  3MEC A;  4CHO A;  3TAR A;  2OZM A;  1GOB A;  1DTQ A;  1JLG A;  4OKJ A;  4BAC A;  3KLE A;  4Q5V A;  4CED A;  3DRP A;  1T03 A;  2NUB A;  1BGX T;  3SUN A;  2YHA A;  2G8F A;  2FBV A;  4OPK A;  3LWL A;  3DLB A;  2PYL A;  4Z4H A;  3KTQ A;  1VK0 A;  5CY4 A;  2EHG A;  2HNZ A;  4I2P A;  3RR8 A;  1BIS A;  4H4M A;  4ELT A;  3SQ2 A;  1BI4 B;  1HQE A;  4G1Q A;  4DU1 A;  3OYG A;  3LAK A;  3M8S A;  4DSE A;  4DS5 A;  2D0C A;  1S1W A;  1UWB A;  4CF1 A;  4UQG A;  4FCY A;  4OKE A;  1TL3 A;  5FRO A;  1IKX A;  4H4O A;  2OA8 A;  1C1C A;  4PUO A;  4R5P A;  1NOY A;  1EET A;  4JS5 A;  4KO0 A;  3DLH A;  5FRM A;  4OGE A;  3DLK A;  3V9Z A;  2Z1G A;  4OVL A;  3SUP A;  1NK4 A;  3AO1 A;  1D9F A;  1WSJ A;  5CZ2 A;  4CHZ A;  3RMB A;  1N6Q A;  4IG3 A;  3L3V A;  3H08 A;  3NF9 A;  3JYT A;  4DTP A;  2XHB A;  3QNN A;  1NK0 A;  3K2P A;  2BDP A;  3RR7 A;  3CQ8 A;  1U45 A;  4I2Q A;  4J2D A;  4E7L A;  4K8X A;  1NJX A;  4W5Q A;  1BQM A;  3HXM A;  4FVM A;  2KQ2 A;  4O4G A;  3F73 A;  4E7H A;  1TKD A;  3TAE A;  4KHW A;  4Y1C A;  4IG0 A;  1HYS A;  3QO9 A;  3NDK A;  1VRT A;  5HRO A;  3KK2 A;  4F8R A;  3CFP A;  3AO2 A;  1QQC A;  4CJV A;  3ZT0 A;  4DTS A;  1SL0 A;  3HP9 A;  3LP2 A;  4KTW A;  1RT2 A;  2HVH A;  3K5O A;  5HP1 A;  3KD5 E;  4K8Z A;  2IAJ A;  3V1R A;  2DFH A;  4YNQ A;  1X9W A;  1TVR A;  2LSN A;  3QEP A;  4DTO A;  4RW4 A;  3QEI A;  1RBS A;  4OLA A;  5K14 A;  1DLO A;  1JKH A;  4DMN A;  5C24 A;  3ISN C;  2B5J A;  4BWM A;  2XY5 A;  4RW6 A;  1HNV A;  3WNF A;  3AO4 A;  4M3W A;  4M3Z A;  4DFM A;  4CHY A;  1ZBH A;  4CJS A;  4FJG A;  2KTQ A;  1RBU A;  3AO5 A;  3AVB A;  3OJU A;  3ZT2 A;  5HRN A;  4AHC A;  1X9M A;  3ZCM A;  3OJS A;  1WSH A;  3SPZ A;  3RWU A;  4CF9 A;  3OYA A;  4DTN A;  1S5J A;  2E4L A;  1BQN A;  4OKK A;  4BDP A;  2O4I A;  1NKC A;  2IS3 A;  1QTM A;  4N76 A;  4KRE A;  1KVA A;  3LAM A;  4CK2 A;  4Y1D A;  3T19 A;  3L2W A;  3S3M A;  4CFD A;  4M3Y A;  4B8C A;  4CJ4 A;  4PA1 A;  2P51 A;  1SKR A;  4CEE A;  4KHU A;  3D0P A;  4HVJ A;  1NK8 A;  4DSI A;  1ZBU A;  4IKF A;  3OYD A;  4GMJ B;  4FK4 A;  3KLH A;  1LAW A;  3ULD A;  1SKS A;  2QKK A;  1WSF A;  5FDL A;  3SYZ A;  1WSE A;  3O3H A;  3RMC A;  4L8R B;  4CHN A;  3E01 A;  4OJR A;  1RT7 A;  3AA5 X;  1S1U A;  2Z1I A;  3NCI A;  3PX6 A;  3SCX A;  3AV9 A;  2YV0 X;  4FJ7 A;  2AJQ A;  3IS9 A;  1CXQ A;  1TKZ A;  1RIL A;  2D0A A;  3ZSV A;  2XRI A;  3OYL A;  3VA3 A;  4CFA A;  2JGU A;  4OGC A;  4MQ3 A;  4CGH A;  4M42 A;  1JL2 A;  2Q3S A;  4KI6 A;  4KHN A;  3CM6 A;  3HP6 A;  2W42 A;  3U3G A;  4FJX A;  4FXD A;  2RF2 A;  4GVM A;  4EP5 A;  4DQS A;  1WAJ A;  4CGJ A;  2KW4 A;  3B6P A;  1ASV A;  1J53 A;  4E7J A;  3AVA A;  2GUI A;  1VSJ A;  3LZI A;  4DFJ A;  1XC9 A;  4M45 A;  1U48 A;  3SPY A;  3M8P A;  2OPR A;  1RTH A;  3QIP A;  3TAQ A;  3ZSW A;  1ASU A;  1IG9 A;  4HCB A;  2F8S A;  4WE1 A;  3LP0 A;  3THV A;  3QLH A;  1IKV A;  1RNH A;  2OPQ A;  3AVK A;  4B8A B;  3P1G A;  1TK8 A;  4ZTJ A;  4E7I A;  2KFZ A;  1XI1 A;  3DMJ A;  2IOC A;  1QE1 A;  1ZBF A;  3IG1 A;  4C8N A;  1B9F A;  3OS0 A;  1HMV A;  3TAB A;  1YVU A;  4RW8 A;  3ZT3 A;  1BIZ A;  2ITG A;  3V1O A;  1B92 A;  4B9T A;  3LP1 A;  3HPO A;  3VQB A;  3SJJ A;  2ATQ A;  3VQD A;  4Z4G A;  2IC3 A;  2IDO A; 
#chains in the Genus database with same CATH topology
 4XH1 A;  4LD0 A;  2HHU A;  1Q9X A;  1TAQ A;  3CCJ N;  3I55 N;  3TAN A;  3D2F B;  4B3O A;  5GAE P;  1HNX K;  4FK0 A;  3OYB A;  3HL8 A;  2GX9 A;  4DLE A;  1U04 A;  3CET A;  1HUX A;  3R8E A;  1OVQ A;  1P8Z A;  4KBO A;  1YTU A;  3K0S A;  3R9P A;  2CGK A;  4PL8 A;  2VGN A;  1NK7 A;  2ZE2 A;  5AQY A;  5ELZ A;  2XY6 A;  5E26 A;  1QZ5 A;  3HJF A;  4FLZ A;  2D4W A;  3C7N A;  4JYA K;  2G8W A;  1KVC A;  4FJ9 A;  1TKX A;  4DTU A;  1XUP O;  4JD2 A;  4DV7 K;  3O9R A;  4FWR A;  4WCE L;  3KVG A;  4CGI A;  4CEZ A;  2FSK A;  3QML A;  3K57 A;  4DR2 K;  4DKW A;  4EFH A;  5J2P A;  3E9L A;  4HTU A;  3QEV A;  2D0B A;  3ZEU B;  3OYE A;  2O4G A;  4J2E A;  1VQN N;  4CEF A;  4FWM A;  4LFC K;  1X1P A;  3L2Q A;  5C15 A;  3MED A;  3M8Q A;  4KHS A;  4DTM A;  3P4I A;  4RTF D;  4CK3 A;  3NFA A;  4WFB L;  1VQP N;  3DXM A;  1KC8 O;  4B9V A;  3NE6 A;  4B9Q A;  5JS1 A;  3ENB A;  3TR8 A;  2BGG A;  1GOA A;  2NRR A;  4KH4 A;  4DR6 K;  5JIC A;  1MDU B;  4OPH A;  3V9W A;  2PY5 A;  4F2R A;  1ITG A;  3RMD A;  3BF3 A;  2FBY A;  1E4F T;  1OKJ A;  2YKM A;  3LM2 A;  3QER A;  3EE8 A;  3MWP A;  1L3V A;  3SAH A;  4DQ8 A;  4OPA A;  3AVM A;  3QNO A;  3EZW A;  4N41 A;  3C7N B;  3AVJ A;  1W0H A;  4JD2 B;  1VSE A;  5AQN A;  3LDQ A;  4DV0 K;  3QBX A;  4DR5 K;  2BE2 A;  2GEM A;  3O4W A;  3T7Z A;  3K9K A;  4ZHR A;  3SV3 A;  3RSE A;  5IT9 O;  1BUP A;  2QW9 A;  5I9E B;  1HPZ A;  1NWK A;  5M1K A;  1QZ6 A;  4H0Y B;  3V9X A;  3MXJ A;  1LW2 A;  2V7Z A;  5HBM A;  3WQT A;  1U49 A;  4C8O A;  1EWR A;  3PIO L;  2RHK A;  4CF0 A;  5KQ8 A;  3HI0 A;  5SWM A;  1MA9 B;  4JI2 K;  1L3S A;  3FFK B;  5LY3 A;  3FE1 A;  2P9N A;  4M3X A;  3V9U A;  2O8E A;  3UKR B;  2HMI A;  3WXL A;  4JKD A;  3CFO A;  3CCE N;  4LF4 K;  4O5B A;  3MN6 A;  2Q31 A;  4B9M A;  3GG4 A;  4NO7 A;  1S6P A;  3DRR A;  4FW2 A;  3ID6 A;  4EHT A;  1S1V A;  5AQQ A;  4W5O A;  3VGL A;  4E1M A;  4YOV A;  1BIU A;  1XHX A;  3NGZ A;  4IBN A;  1RTJ A;  2KHO A;  2Z1H A;  4HUG A;  3ZX3 A;  3O08 A;  1JLC A;  3K5M A;  1KVB A;  1A5V A;  2A40 A;  1J6Z A;  3KJV A;  4PWD A;  3OW2 M;  4BRI A;  1C6V A;  3V4I A;  1TK0 A;  2X6N A;  1KCF A;  4QS8 A;  1I39 A;  1RT1 A;  4GW6 A;  3M8R A;  3K59 A;  2YNF A;  1IBK K;  4RWT A;  3IKM A;  3BP8 A;  1VSL A;  4CGF A;  4CEQ A;  3A2F A;  3DAW A;  4EZ9 A;  3L4I A;  1F21 A;  1O1W A;  3AVN A;  1KQS M;  4Y0W A;  1HRH A;  3MN9 A;  5FPN A;  3ZSQ A;  1Q86 O;  3CCV N;  1IV0 A;  2FBT A;  4JHD A;  1QSS A;  1NOZ A;  1S6Q A;  1UA0 A;  4HWI A;  2YX6 A;  4R79 A;  4YY3 K;  3LP3 A;  1NMN A;  4BRL A;  4CHP A;  3EKS A;  2BTF A;  5AQK A;  3VQA A;  4AHV A;  2DPN A;  5EX5 A;  4B3M K;  3I0S A;  1CZ9 A;  4YDU C;  1ZBI A;  3HVR A;  5KI6 A;  3VOV A;  4CW7 B;  1U47 A;  4I9Q A;  2FLO A;  1DT9 A;  4IO9 L;  1VSK A;  3LDN A;  1E4G T;  4NYN A;  3QDK A;  3I0R A;  4Z4E A;  1WNS A;  3M1F A;  2JWL A;  2QWP A;  4CEB A;  2NRH A;  4BR2 A;  4DSJ A;  3J7Z O;  3V81 A;  4FZX C;  4BE0 A;  2UUC K;  4O0I A;  4HHT A;  1KAZ A;  4O5F A;  1BI4 A;  1SAZ A;  3NAE A;  3ZSX A;  4JI5 K;  1GLC G;  2OTJ N;  3PSI A;  4N47 A;  3DI6 A;  3MAQ A;  1NK6 A;  4IOX A;  1R59 O;  1UOC A;  4CFB A;  3MK6 A;  3JSM A;  2YHB A;  3L2U A;  4JN4 A;  4FWP A;  5CR4 A;  3D45 A;  3OVN A;  4K42 A;  3D2E B;  1TYQ B;  2XY8 A;  1RBR A;  3FZL A;  4B08 A;  4WFN L;  4PKI A;  2YI1 A;  1VQO N;  3VQE A;  4KAZ A;  1C0U A;  3LDP A;  4FWL A;  2ZGZ A;  3CJ9 A;  1JCE A;  2Y1I A;  4LFB K;  4BQZ A;  4YFU A;  1P90 A;  2EX3 A;  2GUP A;  3DLG A;  1BL3 A;  1K8K A;  1LWC A;  4U67 L;  3PY8 A;  1YI2 N;  4BRG A;  4EIA A;  4CJK A;  1WLJ A;  4F3T A;  4TSX A;  3TSU A;  5TKW A;  1NGF A;  3A0I X;  2F8T A;  3J8A A;  3SK3 A;  2B4J A;  3HZ6 A;  3QET A;  4H0O A;  1GOB A;  4YOX A;  2P9I B;  4Q5V A;  4U7B A;  4YOW A;  3VER A;  3KTQ A;  5CY4 A;  3RR8 A;  4ELT A;  1BI4 B;  3OYG A;  3P39 A;  3M8S A;  4DSE A;  2QEX N;  2D0C A;  4B1Y B;  1BWF O;  4CF1 A;  4FCY A;  1TL3 A;  2OA8 A;  4ISE A;  1C1C A;  1BU6 O;  4R5P A;  1NOY A;  1EET A;  3DLH A;  3V9Z A;  4OVL A;  5AJ3 K;  3RMB A;  4CHZ A;  4CD3 A;  3NF9 A;  4K43 A;  3K2P A;  3RR7 A;  1U45 A;  1IBM K;  4K8X A;  3HRG A;  3HXM A;  3F73 A;  4KHW A;  4GNI A;  3VTH A;  4YDU A;  1HNW K;  5BRD A;  1HYS A;  3KK2 A;  4F8R A;  1GLB G;  5FPM A;  1QQC A;  5TKY A;  4KTW A;  3WEE A;  2VQF K;  4K8Z A;  1X9W A;  2O8B B;  1TVR A;  2LSN A;  3QEP A;  1RBS A;  3H46 O;  3AY9 A;  2B5J A;  2DTU A;  4RW6 A;  5AFU H;  3AO4 A;  2KTQ A;  1BA1 A;  1RBU A;  1H1V A;  4CZK A;  4JK7 A;  5HRN A;  1NG9 A;  3OYA A;  4DTN A;  1JCF A;  3TSQ A;  4C1N K;  1KVA A;  3WT0 A;  1N36 K;  3CI5 A;  5AQS A;  1ZC6 A;  5KQD A;  1M1K O;  2P51 A;  4B3T K;  2ZM6 K;  4KHU A;  1NK8 A;  2ZWH A;  1ZBU A;  3OYD A;  2P9S B;  1XNQ K;  4FK4 A;  1U2V A;  4CZF A;  4GV3 A;  3SYZ A;  1WSE A;  3O3H A;  4A2B A;  3AA5 X;  2FF6 A;  2AJQ A;  3UE5 A;  1QQO A;  1TKZ A;  2D0A A;  3CQY A;  4CFA A;  4NXM K;  4LC9 B;  4MQ3 A;  4KI6 A;  3SLC A;  2W42 A;  4IO8 A;  1GLF O;  4EP5 A;  3QFU A;  4DQS A;  4ILH A;  2KW4 A;  1ASV A;  3O8M A;  3AVA A;  4M45 A;  5M1P A;  2NNW A;  1Z05 A;  3M8P A;  3F2K A;  4JK9 A;  2F8S A;  4B3R K;  3CER A;  3QLH A;  3KZB A;  4PHT X;  3AVK A;  1DKG D;  4B8A B;  5AQX A;  4E7I A;  3W0L A;  2KFZ A;  3IG1 A;  4F9O A;  5AQI A;  1WB9 A;  1B92 A;  3A5O C;  3VQB A;  5GIN A;  2ATQ A;  3VQD A;  2X74 A;  2RKI A;  4IEI A;  4FWO A;  4LH4 A;  1TAU A;  1C0M A;  1WBB A;  3C94 A;  1K8A O;  2OYQ A;  2VG6 A;  3ZSZ A;  4CJF A;  1RDD A;  1EXQ A;  4FWN A;  3CC4 N;  1HYZ A;  2OZS A;  4ELU A;  4Q0B A;  2ZGY A;  4H0T B;  3WXJ A;  4IFY A;  2HW3 A;  4BRQ A;  2QWQ A;  2OCE A;  4DS4 A;  2E2Q A;  4JRQ A;  2O8D B;  4BE1 A;  3I8B A;  4CK1 A;  4MLH A;  4FJ5 A;  1W9H A;  1LW0 A;  4B1Z A;  4BRO A;  4JV5 K;  5HL7 L;  3PX0 A;  3DXK B;  2HBK A;  4M3R A;  4CGD A;  2PBD A;  3MEE A;  1S9G A;  1QHT A;  2WFB A;  2NRV A;  3FZH A;  4Z4C A;  3H1Q A;  5C12 A;  1A5W A;  5J2M A;  1WN7 A;  4BRP A;  2HHQ A;  1J54 A;  1FKP A;  4JI8 K;  1TUU A;  3DM2 A;  2P9P B;  3MN5 A;  3SMS A;  4AH9 A;  4JKB A;  3KD1 E;  1ILY A;  1RDU A;  4KB1 A;  5M1N A;  3OYK A;  3ATU A;  2IVO A;  5AQV A;  1C0T A;  1SQK A;  4BR4 A;  3D2F A;  3G10 A;  2E6M A;  2P9U B;  4ID1 A;  2QWM A;  4BRH A;  1HNI A;  3SJH A;  4FJM A;  1RDA A;  4G9Z A;  2X78 A;  3ENH A;  5B8H A;  4M3T A;  4B1V A;  4DU3 A;  2G8I A;  3CG7 A;  1NGC A;  2BAN A;  4E89 A;  1S9E A;  4CZM A;  5BR8 K;  4WQ5 C;  2HF3 A;  3O9U A;  5JVG L;  4I6M B;  1KD1 O;  1IKW A;  3VQ8 A;  1VSF A;  4JEP A;  4K25 A;  4BRA A;  5HRP A;  2DFF A;  3H3O B;  2XO7 A;  3K9J A;  3HYF A;  4BVP A;  3ZEU A;  4CER A;  2HMP A;  3CJB A;  3MX5 A;  5CYM A;  4CEA A;  4CCH A;  4JKG B;  2WC9 A;  4HUF A;  4BR5 A;  4AHR A;  2UYT A;  4DF8 A;  1T6D A;  4CZG A;  4LF8 K;  3WNE A;  1KAX A;  4IOA L;  1GLA G;  2IVN A;  5AR0 A;  3DOL A;  1RDW X;  1VQ8 N;  4BRD A;  3S9H A;  1ZBL A;  2W6L A;  3THW B;  1D4X A;  3VEN A;  1J5O A;  4KPY A;  4I9L A;  3VGM A;  3F9K A;  2QK9 A;  2KFN A;  2ZQB A;  3DLL L;  3QEX A;  5FPD A;  1CLQ A;  1IBL K;  5J2N A;  1LWE A;  3J81 O;  1C0F A;  4JAX A;  3MWT A;  1S72 N;  1FXX A;  3LZJ A;  4E3S A;  3NBP A;  4QOZ B;  3CJC A;  3Q7B A;  5GAH P;  3H6E A;  4JLH A;  1HPM A;  1U4B A;  1Z25 A;  3DYA A;  4YOY A;  4M41 A;  3P5J A;  2W40 A;  2HB5 A;  1JLE A;  3U6F A;  4B1W B;  1B9D A;  2OPS A;  3O5B A;  1SL2 A;  3VGK A;  1CZB A;  4CD1 A;  5KGW A;  4B3S K;  4H03 B;  5DMR A;  3WXI A;  2IVP A;  1N5Y A;  4FJH A;  3UB5 A;  1D8Y A;  3UKR A;  4H5V A;  1RGI A;  1YT3 A;  4CJE A;  3GBT A;  3NF7 A;  1WOQ A;  5FLX O;  1HKC A;  5KTQ A;  2HHX A;  3O80 A;  3ZX0 A;  1BA0 A;  4IDK A;  3IRX A;  3K5N A;  2CH6 A;  2CGL A;  2D0O A;  4FWK A;  4ILG B;  4DCH A;  1T8E A;  4OX9 K;  1JLB A;  1OVY A;  2PZS A;  1VSH A;  4WQ5 A;  2WON A;  4ID5 A;  2IGI A;  2YHW A;  1QS4 A;  3AAP A;  4KTQ A;  1D5A A;  3C65 A;  1HJR A;  1REV A;  2YKN A;  3ID8 A;  2HHW A;  2HHV A;  2GV9 A;  3ITH A;  4FWQ A;  1X9S A;  5ADX A;  3VN5 A;  1VQ6 N;  4JKA A;  3AVF A;  2HBJ A;  3DRS A;  3LDS A;  4DTJ A;  2VCP A;  4MLE A;  5F0X A;  3CJA A;  2AP1 A;  2UUB K;  1WSI A;  3D7E O;  4FLU A;  1JLQ A;  3F9M A;  3AO3 A;  1VQM N;  2KZZ A;  1C0G A;  1LWF A;  3O3F A;  3SQ1 A;  1NJI O;  4JI0 K;  3R6M A;  3TSP A;  3SZ2 A;  4J2B A;  4CIE A;  3H3N O;  3CC7 N;  4FJJ A;  3ZET B;  1TGO A;  1BCM A;  1FK9 A;  2E8A A;  4M3U A;  2I5J A;  3DOK A;  3ZT4 A;  3MCP A;  4W5R A;  1HNZ K;  1V4T A;  3T1A A;  4FJ8 A;  2G8H A;  3ENO A;  4CF8 A;  1GOC A;  2P1J A;  3MXM A;  3ULE A;  5C42 A;  3NH2 A;  3JS6 A;  2P5G A;  1EKE A;  4JKH A;  2QXF A;  4IDH A;  4QS7 A;  1KAY A;  4HUE A;  3J7A P;  3O3G A;  5ADX H;  1YIJ N;  5EVZ A;  1RFQ A;  3F5T A;  3EY1 A;  2PAV A;  1UAX A;  1HR0 K;  4C8L A;  1T44 A;  4FYD A;  2GTD A;  4ZTF A;  1TL1 A;  2NRT A;  3VQ5 A;  1SL1 A;  3TAR A;  1GLD G;  3MEC A;  2OZM A;  5BRH A;  5AZJ B;  3L4Q A;  4LF9 K;  1I94 K;  4H5W A;  3SUN A;  2YHA A;  2FBV A;  4OPK A;  3VF2 A;  2HNZ A;  3SQ2 A;  1HQE A;  3FGU A;  4DU1 A;  4DS5 A;  1S1W A;  1UWB A;  1NMD A;  5LJW A;  1IKX A;  4H0V B;  2ZJR L;  3THX B;  4JS5 A;  3DLK A;  3AGR A;  4XEI A;  3SUP A;  3AO1 A;  1WSJ A;  1N6Q A;  4IG3 A;  2P9K B;  2XHB A;  4GKJ K;  5AQJ A;  1LCU A;  4JK8 A;  3CQ8 A;  1XMQ K;  4BRF A;  4E7L A;  4WFA L;  2E1Z A;  1NJX A;  4W5Q A;  5H1S Q;  4PKH A;  1TKD A;  3D2E A;  1TYQ A;  4IG0 A;  5BRE A;  3NDK A;  3CFP A;  3ULE B;  2Q0U A;  3HP9 A;  3K5O A;  3CF5 L;  4MDB A;  2DFH A;  4YNQ A;  4A61 A;  4DTO A;  3QEI A;  3PSF A;  1GLL O;  5AQL A;  1DLO A;  3L0Q A;  4DMN A;  1NU0 A;  4BWM A;  4M3W A;  4EHU A;  1HNV A;  5F1X A;  4FJG A;  4BR9 A;  3OJU A;  4AHC A;  3ZCM A;  3OJS A;  2O8F A;  4BR0 A;  4CF9 A;  1S5J A;  2OAN A;  5AQR A;  4BC5 A;  1NKC A;  2IS3 A;  1N33 K;  2P9I A;  3LAM A;  4Y1D A;  3S3M A;  3L2W A;  3BF1 A;  4CFD A;  2GWK A;  4M3Y A;  4CJ4 A;  1ESV A;  2OTL N;  4CEE A;  4IKF A;  3KWI A;  4H5N A;  3P38 A;  4GMJ B;  2F4V K;  3KLH A;  4ISF A;  3ULD A;  1SKS A;  2QKK A;  3SBG A;  4OJR A;  3NCI A;  3SCX A;  2YV0 X;  3IS9 A;  2A5X A;  2XRI A;  3OYL A;  4B1U B;  3CCM N;  3VA3 A;  2JGU A;  2Q3S A;  4FJX A;  5EXW A;  4WYB A;  1S22 A;  3TTF A;  3KHY A;  4E7J A;  1DGK N;  1U48 A;  1VSJ A;  3OTO K;  4DFJ A;  1XC9 A;  4H5R A;  2OPR A;  4KH6 A;  4BGB A;  1IKV A;  1RNH A;  4EAH D;  4BC4 A;  1BO5 O;  3P1G A;  2O8B A;  4FPB A;  1OH6 A;  1XI1 A;  4C8N A;  4K0K K;  1VQ9 N;  1B9F A;  1W2B M;  1BIZ A;  2ITG A;  1HX1 A;  1XMO K;  3HPO A;  2O8F B;  3SJJ A;  2IC3 A;  2QTD A;  3VF4 A;  2WTU A;  1JXB A;  1Y97 A;  1SV5 A;  3TAM A;  4AM6 A;  1YXQ A;  1ZYQ A;  3VES A;  4C8M A;  3S3N A;  1VAZ A;  4CJQ A;  4CJW A;  4DV6 K;  2QI2 A;  3A5M C;  3LPT A;  4BR7 A;  4FJL A;  3OBY A;  5JLF A;  2P9S A;  1QHA A;  1RBT A;  3CCS N;  3OBW A;  2YHX A;  1NKE A;  4FM1 A;  4FPA A;  3BDP A;  5DK5 A;  5LMN K;  2HF4 A;  2A6A A;  2HHS A;  3FZK A;  4PKG A;  3VQ7 A;  3BGR A;  1KTQ A;  3HOS A;  2KLA A;  3RRH A;  3PUF A;  1S1T A;  3M3Z A;  4BRK A;  4E19 A;  1TV6 A;  1CXU A;  3OYM A;  4YOR A;  1RCH A;  4KKO A;  3C6H A;  4FJN A;  1RDC A;  5HRR A;  2Q0R A;  5E41 A;  4BY9 C;  4AM7 A;  3S41 A;  1RTI A;  3PX4 A;  4NCB A;  4DWI A;  4IFV A;  1WAF A;  5C0Y A;  2CGJ A;  3NF8 A;  3CPW M;  3O4N A;  2YNG A;  4CBW A;  4PQU A;  2ASP A;  3JAM O;  3JXU A;  1RTD A;  3SV4 A;  4CIF A;  2VWK A;  2G8K A;  3VEX A;  3GOI A;  3OYJ A;  5T7B A;  5E84 A;  4CJR A;  3MMV A;  4Z4F A;  1BDG A;  3H45 C;  4NCA A;  1NJZ A;  2NLX A;  3M6G A;  3CJ1 A;  4E7K A;  2G8U A;  1L3U A;  3SNN A;  4CF2 A;  3RTV A;  4B1X B;  3ZT1 A;  3K58 A;  2W41 A;  2ZF5 O;  1NGE A;  3SMP A;  1HLU A;  3U4L A;  3UKU B;  3R3L A;  4DSK A;  4IOC L;  2HND A;  2VWB A;  2HHH K;  1QQM A;  2O8D A;  3T3F A;  1HKG A;  3T69 A;  4B9N A;  4LY7 A;  4AHU A;  4GV6 A;  4FLY A;  1JL1 A;  1C1B A;  5MLC Q;  5JS2 A;  2BH1 A;  3L2R A;  1KSP A;  3C95 A;  4HCC A;  3DXK A;  1XHZ A;  3CD6 N;  1TKT A;  4AHS A;  4BDZ A;  4CZJ A;  2Y1J A;  3GE1 A;  1T6C A;  1QSL A;  3HSC A;  3ASM A;  4PL7 A;  4E1J A;  3NGY A;  3OYI A;  1OH7 A;  3SAF A;  2P9P A;  4BE2 A;  4JI7 K;  2FXU A;  1D9D A;  1G15 A;  3P83 D;  4Z4I A;  4DTR A;  1ASW A;  3SAG A;  2VQE K;  5CHI A;  4FJI A;  4B9S A;  4JI4 K;  3CYM A;  3DLE A;  3ZSO A;  1YF5 L;  4C8K A;  3SUQ A;  1NJY A;  4CFC A;  1OH5 A;  1L3T A;  3OA9 A;  2P9U A;  3VPZ A;  3V1Q A;  3BEX A;  3AGK A;  4LFA K;  3PO4 A;  3QIO A;  4M7X A;  3TI0 A;  3DWL A;  2RE2 A;  3O6W A;  3MXI A;  3FZM A;  2NRW A;  3LPU A;  2V51 B;  2QWO A;  2A1S A;  3CJ7 A;  3KLF A;  3QEW A;  5BR9 A;  3C0B A;  3G25 A;  1N34 K;  1NGB A;  3E66 A;  4IJN A;  4X64 K;  1NJW A;  4NYF A;  1BCO A;  4I6M A;  4CBX A;  3OY9 A;  5C2F A;  1ZBS A;  1YVN A;  3W3D A;  3SUO A;  5JVH L;  4F2S A;  1LOT B;  3V6D A;  3I8D A;  5F2R A;  1DEJ A;  3GDQ A;  4O0J A;  5HRS A;  4JKG A;  4O55 A;  1SUQ A;  4KV8 A;  3AVG A;  3E1Y A;  1YIT N;  5I42 A;  1IKY A;  4FW1 A;  1EQY A;  4MFB A;  3RRG A;  4JI1 K;  4A57 A;  2QXL A;  3FLC O;  4DG1 A;  3L6Q A;  3U9D A;  1J5E K;  2G8V A;  2P5O A;  1QSY A;  1M90 O;  4KI4 A;  1VRU A;  1L5U A;  3KK7 A;  5GAG P;  5KRS A;  2BUP A;  2VG7 A;  2I7N A;  3THW A;  4B9L A;  1G99 A;  3AVC A;  3LDO A;  3CM5 A;  2DFE A;  3WNG A;  3A8Y A;  3KKR A;  3NVM A;  1NK5 A;  2FBX A;  4CJ3 A;  2FC0 A;  5D3G A;  4L3Q A;  1EO1 A;  3IUC A;  4ICL A;  1C1A A;  3O1W A;  1HKB A;  3NF6 A;  4X65 K;  1RDB A;  4AHT A;  3VTI A;  3WNH A;  2YNH A;  3AA4 A;  4Z94 A;  1JCG A;  1K6Y A;  1MWM A;  5GIP A;  3MCA B;  3WUH A;  3SQ0 A;  1VQK N;  4NLC A;  3SQ4 A;  3TAG A;  4FM2 A;  2HVI A;  3K5L A;  4AQY K;  3WXM B;  3NH1 A;  3LWM A;  3LAL A;  1J9A A;  5CZ1 A;  4DFP A;  5EU7 A;  4LSN A;  1X3N A;  1JJ2 M;  3WQU A;  3HK2 A;  3O9T A;  4ISG A;  4CZL A;  2HNY A;  4N5S A;  1VHX A;  1KFD A;  2WOM A;  3UIQ A;  4CE9 A;  1LV5 A;  2KZM A;  4M63 C;  2QWL A;  3SI6 A;  4F3O A;  1JLA A;  1YTA A;  2D0P A;  3THY B;  4FZY A;  1VSM A;  4JKC A;  4FM0 A;  4O44 A;  4QCL A;  4BRE A;  1QVG M;  2I7P A;  3RMA A;  3HM9 A;  4W5T A;  4DUY K;  4DQQ A;  3E9P A;  4XIU A;  5KPR A;  4CES A;  4NCG A;  4GV9 A;  1A5X A;  4CZE A;  2O8C B;  2QA4 N;  4FJK A;  1FW6 A;  4H8K A;  4OLB A;  4FZZ A;  3HPH A;  1JLG A;  4OKJ A;  4J8F A;  1T03 A;  2G8F A;  3LWL A;  3DLB A;  4Z4H A;  2YCH A;  4I2P A;  1BIS A;  4H4M A;  3ZLJ A;  4WQ4 C;  4BC3 A;  3LAK A;  2Q2R A;  1ATS A;  5FRO A;  4H4O A;  4PUO A;  4QS9 A;  3CPE A;  4KO0 A;  3N4P A;  2Z1G A;  3IDH A;  4AF1 A;  3T1H K;  2V7Y A;  3QBW A;  5AZI B;  1EWQ A;  1GLE G;  3H08 A;  3QNN A;  1NK0 A;  4DR7 K;  2BDP A;  4J2D A;  5EY4 A;  5DM7 L;  4LF6 K;  3QB0 A;  1BQM A;  2KQ2 A;  4O4G A;  3TU5 A;  3ZET A;  3TAE A;  3A5L C;  4Y1C A;  4IEE A;  3CCR N;  3AO2 A;  5GAD P;  4LF5 K;  4DTS A;  2P9L B;  3B8A X;  1RT2 A;  2HVH A;  5HP1 A;  3EO3 A;  3KD5 E;  2IAJ A;  1X3M A;  2ZJP L;  4CVN E;  3P31 A;  4RW4 A;  4NXN K;  4OLA A;  5AQO A;  2XY5 A;  3WNF A;  4DFM A;  4CHY A;  1VQ7 N;  1ZBH A;  1WUA A;  4O8K A;  3AVB A;  4IJA A;  4BRN A;  1WSH A;  4H5T A;  1BQN A;  4BG9 A;  2O4I A;  5JMV A;  3QIC A;  1QTM A;  2FSN A;  5AZJ A;  3CXC M;  4KRE A;  2YJF A;  4PA1 A;  4KH5 A;  3O1B A;  4HVJ A;  4DSI A;  1VQ5 N;  4DV5 K;  2HOE A;  3CQX A;  1TUY A;  1QQN A;  1LAW A;  4A5B A;  1WSF A;  2VYP A;  3THX A;  1E3M A;  4L8R B;  1BG3 A;  4CHN A;  1RT7 A;  1KXP A;  4DV4 K;  4CBU A;  2P9K A;  3ZSV A;  5BPN A;  3MN7 A;  4K41 A;  3D6R A;  4C23 A;  4OGC A;  4CGH A;  4NLB A;  4CZH A;  3CM6 A;  3U3G A;  5AQP A;  3NMU A;  3EKU A;  3VEW A;  4CGJ A;  3WXK A;  2E88 A;  1J53 A;  1K73 O;  3AAR A;  3LZI A;  2A41 A;  1RTH A;  3QIP A;  1IG9 A;  3ZSW A;  1XNR K;  4WE1 A;  3LP0 A;  4UY8 O;  2OPQ A;  1TK8 A;  4DUZ K;  3DXM B;  4HTL A;  4XH5 A;  2IOC A;  1QE1 A;  1ZBF A;  2UXD K;  3TAB A;  1YVU A;  4RW8 A;  3ZT3 A;  4GKK K;  4B9T A;  4FO0 A;  3BZK A;  4V19 S;  3EL2 A;  4OO1 J;  4Z4G A;  2IDO A;  2R7Y A;  3TAP A;  2PFU A;  4WQ4 A;  3V9S A;  4J2A A;  1VSD A;  3M5R A;  5AQF A;  3OS1 A;  4X66 K;  1FKO A;  3LDL A;  1I3A A;  3MEG A;  1T05 A;  2E5L K;  2Q36 A;  2QWR A;  3LM9 A;  3VQ4 A;  2DY4 A;  4ILJ A;  3NHG A;  4CJL A;  1T7P A;  2E2O A;  3IAY A;  4FK2 A;  3L8B A;  3KKS A;  5C2D A;  3AVI A;  1LAV A;  1DTT A;  1FJG K;  4FLV A;  2QWN A;  4JKE A;  1MU2 A;  4DFK A;  2NRX A;  3QIN A;  4M7Y A;  4CJU A;  1KLN A;  1RBV A;  3RSE B;  1JLF A;  1Q81 O;  3ZX2 A;  1SS6 A;  4JKF A;  4DQP A;  4A62 A;  1IH7 A;  5KRT A;  3ZSR A;  4CI6 A;  2ITM A;  3VQ9 A;  2IIR A;  1N8R O;  2F96 A;  5KPZ A;  2F9T A;  4Z0U A;  1X9J A;  4FLT A;  4JI6 K;  4DU4 A;  3AAQ A;  2Z1J A;  2P9N B;  1QVF M;  2O8E B;  4CJT A;  3EYZ A;  3VQC A;  4CZI A;  1XQS C;  1XC3 A;  3OYN A;  1NNE A;  1S1X A;  1TK5 A;  4DR3 K;  2Q1N A;  4LSL A;  1GLJ O;  1SZ2 A;  3HST B;  2ZJQ L;  2OPP A;  3KK1 A;  3E9O A;  4CEO A;  1VSI A;  2JLE A;  5JLH A;  4CIG A;  4MDA A;  1RT3 A;  3PV8 A;  3HVT A;  1O13 A;  2FF3 B;  3PIP L;  4JRP A;  4AIL C;  1NKB A;  3OYC A;  3EZ5 A;  2GEL A;  3J7Y P;  1VQL N;  5LL6 Z;  4RW9 A;  3AA3 A;  3OS2 A;  5CYQ A;  4IXC A;  4DTX A;  3S3O A;  2E2N A;  3PLA A;  3N4Q A;  1NGJ A;  1RT5 A;  5LJV A;  5AQZ A;  3KLI A;  3DLR A;  1IO2 A;  4KHP K;  1R0A A;  4BWJ A;  1ATN A;  3FZF A;  2YHY A;  4C1N I;  3CHW A;  3VEV A;  4MO5 A;  3AVH A;  3FFI A;  5AQH A;  1K9M O;  3VMF B;  1Y64 A;  1NLV A;  2ZD1 A;  3I56 N;  3OYF A;  2F7T A;  1EX4 A;  3NH0 A;  4LH5 A;  4JHD B;  4A5A A;  1UA1 A;  1NGH A;  3C6U A;  3QFP A;  3VQP A;  5IWA K;  4DLG A;  4DHY A;  1KRP A;  4FLX A;  4EP4 A;  2YJE A;  2PYJ A;  2ASO A;  4CJ5 A;  3IMX A;  1RT4 A;  3VQ6 A;  3NGI A;  4BQL A;  2B6A A;  4RG8 A;  4I7F A;  3DJC A;  3CCU N;  4W5N A;  3Q7C A;  5BPL A;  1NGA A;  5BN8 A;  2ETJ A;  3AA2 A;  5SZT A;  1SKW A;  1JXE A;  1WSG A;  4B9U A;  4E0D A;  5KGX A;  3UKU A;  4YHH K;  4XH4 A;  3G4S N;  5C10 A;  3L2V A;  1XWL A;  2GWJ A;  4RW7 A;  2EWS A;  4DSL A;  5AFU A;  4KHY A;  4O8U A;  5KPT A;  3AVL A;  3KK3 A;  5M1O A;  3PO5 A;  3TAF A;  3KIO A;  3HBT A;  1BOT O;  2VG5 A;  5J1E A;  4ELV A;  3OHR A;  3R1X A;  2HST A;  1Q9Y A;  4DSF A;  3U8X A;  3ZSY A;  2H3G X;  4OPJ A;  4MO4 A;  2D1K A;  3TTC A;  2RPI A;  2D5R A;  3CC2 N;  4FL9 A;  4X62 K;  3O4Q A;  3NVK A;  1IG8 A;  1Q82 O;  2V52 B;  4KRF A;  2XY7 A;  4BRC A;  2E20 A;  4KTZ A;  3CFR A;  3U3Y A;  4FSV A;  1K8K B;  5HLF A;  1IJJ A;  4YOU A;  1NK9 A;  2ASM A;  4DF4 A;  1NBW A;  3VQQ A;  3HPG A;  2A3Z A;  4H0P A;  1OH8 A;  4QAG A;  2E2P A;  4EZ6 A;  3HT3 A;  3B6O A;  1VQ4 N;  3G6E N;  3G0Z A;  2X6S A;  3C6T A;  2JWK A;  2W6K A;  4H0X B;  2J4R A;  2A1R A;  2E6L A;  3ATV A;  3OYH A;  3IFR A;  5DM6 L;  2GBZ A;  3QES A;  4FLW A;  3CIP A;  1Z26 A;  4CHQ A;  2KKZ A;  3CME N;  5FRN A;  1HQU A;  5EOY A;  3TWH A;  2HBL A;  3TPQ A;  1EP4 A;  3H1V X;  4E1N A;  2YNI A;  3LAN A;  1KLM A;  2VWJ A;  5I3U A;  3HOT A;  2QKB A;  4KHQ A;  1Q8I A;  1NGD A;  4GVE A;  1BHL A;  3HO1 A;  3EN9 A;  3LL3 A;  3VEZ A;  4IZ9 A;  1NGG A;  3KLG A;  3VA0 A;  1YJW N;  1YUW A;  4BG8 A;  3T1Y K;  1RT6 A;  5C25 A;  3WEE B;  1YJN N;  3L3U A;  1HYV A;  4DR1 K;  2UXC K;  4N56 A;  2HHT A;  3CCQ N;  3EEQ A;  4CJP A;  4F4K A;  3U9Z A;  4BDY A;  3CMA N;  5J2Q A;  2F9W A;  5M1F A;  4KFB A;  3ALY A;  4JS4 A;  4DQI A;  4DV1 K;  3O9Q A;  1KFS A;  4BC2 A;  4KB0 A;  4CEC A;  4DQR A;  2RN2 A;  4CGG A;  4CHO A;  1ATR A;  1DTQ A;  1V4S A;  4RCH A;  5AQT A;  1WBD A;  5FPE A;  1ZXO A;  3KLE A;  4BAC A;  3MDQ A;  3ZYY X;  3A5N C;  3DRP A;  4CED A;  2NUB A;  1BGX T;  1N32 K;  2HBM A;  2PYL A;  1VK0 A;  2FSJ A;  2EHG A;  4JI3 K;  2NRZ A;  4YOT A;  4G1Q A;  4GY2 B;  1HJO A;  3EE9 A;  1Q7Y O;  3TTD A;  4UQG A;  1U2V B;  4OKE A;  4DV2 K;  4FWS A;  4BVO A;  3BY5 A;  2NZT A;  5FRM A;  4OGE A;  5BRF A;  1NK4 A;  1Z6R A;  1D9F A;  5CZ2 A;  3L3V A;  4DTP A;  3JYT A;  4BRM A;  4WF9 L;  1W7A A;  4I2Q A;  4LF7 K;  1YAG A;  2E1Y A;  1YJ9 N;  2UXB K;  4FVM A;  4IWV A;  3VF6 A;  4E7H A;  2WUS A;  3I33 A;  3QO9 A;  1VRT A;  5AQM A;  5HRO A;  2WBN A;  4CJV A;  3ZT0 A;  1SL0 A;  3LP2 A;  4JNE A;  3HM8 A;  3RVC A;  3C6A A;  3V1R A;  3THY A;  2VGM A;  5M1Q A;  5K14 A;  1JKH A;  5C24 A;  3ISN C;  3CCL N;  3SBT A;  4M3Z A;  2CH5 A;  4PY5 A;  1YHQ N;  2Q97 A;  1NM1 A;  4CJS A;  3AO5 A;  4FOE A;  3VET A;  4DR4 K;  3GL1 A;  4FVU A;  3ZT2 A;  2O8C A;  5CE3 A;  1X9M A;  3RWU A;  5HOO A;  3SPZ A;  3FR0 A;  2E4L A;  4OKK A;  4BDP A;  4N76 A;  4A59 A;  3MX2 A;  4CK2 A;  3T19 A;  1NGI A;  4B8C A;  1SKR A;  1T3V A;  2AA4 A;  2UUA K;  1U6Z A;  3D0P A;  5AQG A;  3VEO A;  1CZA N;  3G71 N;  3VEY A;  5BN9 A;  5FDL A;  3BUZ B;  5LMU K;  5A2Q O;  3RMC A;  3KWG A;  3E01 A;  1S1U A;  2Z1I A;  3PX6 A;  5AZI A;  3AV9 A;  4FJ7 A;  1CXQ A;  1W97 L;  1RIL A;  4IFE A;  3J80 O;  4CJ7 A;  4M42 A;  1JL2 A;  4NB4 A;  4KHN A;  3HP6 A;  4FXD A;  2RF2 A;  4GVM A;  4DB3 A;  1WAJ A;  2QM1 A;  3B6P A;  3HTV A;  4BGA A;  2GUI A;  3BZC A;  3SPY A;  2A42 A;  5AQU A;  2P9L A;  4A2A A;  3TAQ A;  1ASU A;  4HCB A;  1S3X A;  4DV3 K;  3THV A;  4FOI A;  4ZTJ A;  3DMJ A;  5GIO A;  1Q18 A;  3OS0 A;  5AQW A;  1HMV A;  3O9S A;  1MWK A;  3V1O A;  5BPM A;  3LP1 A;  2UU9 K; 
#chains in the Genus database with same CATH homology
 4LD0 A;  2X74 A;  2RKI A;  2R7Y A;  3TAP A;  1JXB A;  1Q9X A;  1Y97 A;  2HHU A;  1TAQ A;  1SV5 A;  3V9S A;  3TAN A;  3TAM A;  4J2A A;  1VSD A;  1ZYQ A;  3OS1 A;  4LH4 A;  4B3O A;  4C8M A;  1TAU A;  1C0M A;  1FKO A;  1I3A A;  3MEG A;  3S3N A;  4CJW A;  4CJQ A;  1T05 A;  3OYB A;  3C94 A;  3HL8 A;  2OYQ A;  4FK0 A;  2VG6 A;  3ZSZ A;  4DLE A;  4CJF A;  1RDD A;  1EXQ A;  1U04 A;  1HYZ A;  3VQ4 A;  3LPT A;  1YTU A;  2OZS A;  2DY4 A;  4ELU A;  4FJL A;  3NHG A;  4CJL A;  4Q0B A;  1T7P A;  3IAY A;  1NK7 A;  2ZE2 A;  4FK2 A;  3L8B A;  2XY6 A;  3KKS A;  4IFY A;  3AVI A;  1LAV A;  2HW3 A;  1DTT A;  1RBT A;  3HJF A;  4FLZ A;  1NKE A;  4FLV A;  4DS4 A;  4FM1 A;  2G8W A;  3BDP A;  1KVC A;  5DK5 A;  1TKX A;  4JRQ A;  4DTU A;  4FJ9 A;  4BE1 A;  1MU2 A;  4CK1 A;  4CGI A;  4DFK A;  2HHS A;  3VQ7 A;  3QIN A;  4CEZ A;  3BGR A;  1W9H A;  4CJU A;  3K57 A;  1KTQ A;  1LW0 A;  1RBV A;  1KLN A;  1JLF A;  5J2P A;  4HTU A;  3RRH A;  3QEV A;  3PUF A;  3PX0 A;  1S1T A;  4DQP A;  2D0B A;  4M3R A;  4E19 A;  1IH7 A;  5KRT A;  1TV6 A;  3OYE A;  4CGD A;  3ZSR A;  1CXU A;  2O4G A;  3VQ9 A;  3OYM A;  4J2E A;  4CEF A;  1RCH A;  2F96 A;  3MEE A;  1S9G A;  4KKO A;  1QHT A;  4Z0U A;  1X1P A;  4FJN A;  4FLT A;  3L2Q A;  1RDC A;  3MED A;  5HRR A;  4Z4C A;  4DU4 A;  2Z1J A;  5E41 A;  3M8Q A;  4KHS A;  4DTM A;  1RTI A;  1A5W A;  5J2M A;  3PX4 A;  4NCB A;  1WN7 A;  4DWI A;  2HHQ A;  4IFV A;  1J54 A;  1FKP A;  4CJT A;  4CK3 A;  1WAF A;  3NFA A;  3DM2 A;  3EYZ A;  3KD1 E;  3VQC A;  4AH9 A;  3NF8 A;  4B9V A;  3O4N A;  2YNG A;  3OYN A;  3NE6 A;  1S1X A;  1TK5 A;  5JS1 A;  4PQU A;  4KB1 A;  4LSL A;  3TR8 A;  3OYK A;  2BGG A;  1GOA A;  3HST B;  1RTD A;  3SV4 A;  4CIF A;  2VWK A;  2G8K A;  1C0T A;  2OPP A;  3KK1 A;  4CEO A;  1VSI A;  3V9W A;  3OYJ A;  2PY5 A;  4F2R A;  1ITG A;  2JLE A;  5T7B A;  4CIG A;  3RMD A;  1RT3 A;  4CJR A;  2FBY A;  3PV8 A;  3G10 A;  3HVT A;  4Z4F A;  2E6M A;  2YKM A;  4JRP A;  4AIL C;  1NJZ A;  1NKB A;  4NCA A;  4ID1 A;  3OYC A;  3EZ5 A;  4E7K A;  3QER A;  1HNI A;  1L3V A;  4FJM A;  1RDA A;  2G8U A;  2X78 A;  1L3U A;  3SNN A;  3AVM A;  4RW9 A;  4M3T A;  4CF2 A;  3RTV A;  3AA3 A;  3OS2 A;  3QNO A;  3ZT1 A;  5CYQ A;  3K58 A;  4DTX A;  3S3O A;  4DU3 A;  4N41 A;  2G8I A;  3CG7 A;  3AVJ A;  1W0H A;  2BAN A;  4E89 A;  1VSE A;  1S9E A;  4DSK A;  2HND A;  3T3F A;  2BE2 A;  1RT5 A;  4B9N A;  4LY7 A;  4ZHR A;  3KLI A;  3SV3 A;  1IKW A;  4AHU A;  3VQ8 A;  1VSF A;  3DLR A;  1IO2 A;  1HPZ A;  4FLY A;  5HRP A;  2DFF A;  1C1B A;  1JL1 A;  3V9X A;  3MXJ A;  1LW2 A;  5JS2 A;  2XO7 A;  3L2R A;  3HYF A;  3C95 A;  5HBM A;  1R0A A;  1U49 A;  4BWJ A;  1KSP A;  1XHZ A;  4C8O A;  4CER A;  1TKT A;  4AHS A;  4CF0 A;  4FJ5 A;  5CYM A;  4BDZ A;  4CEA A;  4CCH A;  3AVH A;  3FFI A;  5SWM A;  2Y1J A;  1L3S A;  1QSL A;  2ZD1 A;  4HUF A;  3ASM A;  3OYF A;  4AHR A;  3V9U A;  1EX4 A;  3NH0 A;  3NGY A;  4M3X A;  3OYI A;  4LH5 A;  4DF8 A;  2HMI A;  4BE2 A;  1UA1 A;  3CFO A;  4O5B A;  3WNE A;  1D9D A;  3C6U A;  4B9M A;  1G15 A;  3VQP A;  3P83 D;  1S6P A;  3DRR A;  4DLG A;  4Z4I A;  4DTR A;  4FW2 A;  1ASW A;  3DOL A;  4FLX A;  1KRP A;  4EP4 A;  4FJI A;  3S9H A;  1S1V A;  1ZBL A;  2PYJ A;  3CYM A;  4W5O A;  4B9S A;  4CJ5 A;  1J5O A;  4E1M A;  4KPY A;  1RT4 A;  3DLE A;  3VQ6 A;  4I9L A;  3ZSO A;  4C8K A;  1BIU A;  3NGI A;  3SUQ A;  3F9K A;  1NJY A;  4CFC A;  2QK9 A;  1XHX A;  2B6A A;  2ZQB A;  4RG8 A;  4I7F A;  2KFN A;  1L3T A;  3QEX A;  3NGZ A;  4W5N A;  4IBN A;  3V1Q A;  1RTJ A;  1CLQ A;  2Z1H A;  4HUG A;  5J2N A;  3PO4 A;  1LWE A;  2ETJ A;  3AA2 A;  3QIO A;  3TI0 A;  5SZT A;  1JLC A;  3K5M A;  1KVB A;  1A5V A;  1SKW A;  3KJV A;  4PWD A;  3MXI A;  1JXE A;  1WSG A;  4B9U A;  3LPU A;  4E0D A;  1C6V A;  1FXX A;  5KGX A;  3LZJ A;  4E3S A;  3V4I A;  1TK0 A;  2A1S A;  3NBP A;  3KLF A;  3QEW A;  4QOZ B;  2X6N A;  1KCF A;  3L2V A;  4JLH A;  1XWL A;  1I39 A;  4RW7 A;  1NJW A;  1U4B A;  4NYF A;  1Z25 A;  4DSL A;  1BCO A;  4KHY A;  1RT1 A;  4GW6 A;  3M8R A;  3K59 A;  3AVL A;  3DYA A;  2YNF A;  3KK3 A;  4M41 A;  3PO5 A;  2DTU A;  3P5J A;  3TAF A;  1VSL A;  1JLE A;  2HB5 A;  4CGF A;  4CEQ A;  3OY9 A;  3U6F A;  1B9D A;  2OPS A;  3KIO A;  3A2F A;  3SUO A;  2VG5 A;  4F2S A;  1SL2 A;  4EZ9 A;  1F21 A;  1O1W A;  3AVN A;  1CZB A;  3V6D A;  3I8D A;  5KGW A;  5J1E A;  4ELV A;  4O0J A;  5DMR A;  1HRH A;  5HRS A;  1N5Y A;  4O55 A;  4FJH A;  1SUQ A;  1Q9Y A;  4KV8 A;  4DSF A;  3AVG A;  3ZSY A;  4OPJ A;  5I42 A;  3ZSQ A;  1D8Y A;  1IKY A;  4FW1 A;  2FBT A;  4MFB A;  3RRG A;  1YT3 A;  1QSS A;  1NOZ A;  1S6Q A;  2RPI A;  4CJE A;  1UA0 A;  2D5R A;  4DG1 A;  3NF7 A;  3O4Q A;  3LP3 A;  2G8V A;  2P5O A;  4CHP A;  1QSY A;  5KTQ A;  2HHX A;  4KI4 A;  1VRU A;  1L5U A;  3VQA A;  4IDK A;  3IRX A;  4AHV A;  5KRS A;  3K5N A;  4KRF A;  2XY7 A;  2VG7 A;  4KTZ A;  3CFR A;  3U3Y A;  4B9L A;  3I0S A;  3AVC A;  1T8E A;  1CZ9 A;  3CM5 A;  1JLB A;  1ZBI A;  3HVR A;  1VSH A;  2PZS A;  5HLF A;  2DFE A;  2WON A;  4ID5 A;  2IGI A;  5KI6 A;  3WNG A;  1NK9 A;  4DF4 A;  3KKR A;  1QS4 A;  3VQQ A;  3HPG A;  4KTQ A;  1D5A A;  4QAG A;  4EZ6 A;  1NK5 A;  1U47 A;  4I9Q A;  1HJR A;  3HT3 A;  2FBX A;  4CJ3 A;  3B6O A;  2FC0 A;  5D3G A;  1REV A;  2YKN A;  3G0Z A;  1VSK A;  2HHV A;  2HHW A;  2GV9 A;  2X6S A;  3C6T A;  1C1A A;  4ICL A;  3ITH A;  3NF6 A;  1RDB A;  4NYN A;  4AHT A;  1X9S A;  3I0R A;  3VN5 A;  4Z4E A;  2A1R A;  2E6L A;  1WNS A;  3OYH A;  3WNH A;  2YNH A;  3AVF A;  3DRS A;  3LDS A;  2GBZ A;  3AA4 A;  4FLW A;  4DTJ A;  3QES A;  1K6Y A;  1Z26 A;  4CEB A;  4CHQ A;  3V81 A;  4DSJ A;  4FZX C;  5FRN A;  4BE0 A;  1HQU A;  3TWH A;  4O0I A;  4HHT A;  1EP4 A;  4E1N A;  3SQ0 A;  1BI4 A;  3NAE A;  1WSI A;  2YNI A;  3SQ4 A;  3LAN A;  1KLM A;  4HCC A;  3ZSX A;  3TAG A;  4FLU A;  1JLQ A;  4FM2 A;  3AO3 A;  4N47 A;  2KZZ A;  1LWF A;  3DI6 A;  3O3F A;  2HVI A;  3MAQ A;  3SQ1 A;  1NK6 A;  3K5L A;  2VWJ A;  3NH1 A;  1UOC A;  5I3U A;  4CFB A;  3SZ2 A;  3JSM A;  3LWM A;  2YHB A;  4KHQ A;  4J2B A;  3LAL A;  2QKB A;  1J9A A;  1Q8I A;  5CZ1 A;  4CIE A;  3L2U A;  4DFP A;  5EU7 A;  4LSN A;  1BHL A;  3HO1 A;  3HK2 A;  4FJJ A;  3D45 A;  3OVN A;  1TGO A;  2HNY A;  1BCM A;  1FK9 A;  4N5S A;  1KFD A;  2WOM A;  2XY8 A;  1RBR A;  2I5J A;  3DOK A;  3ZT4 A;  4B08 A;  3KLG A;  3UIQ A;  4W5R A;  4M3U A;  4CE9 A;  1LV5 A;  3VA0 A;  3T1A A;  4PY5 A;  4FJ8 A;  2G8H A;  4CF8 A;  3VQE A;  1GOC A;  2KZM A;  4KAZ A;  1RT6 A;  2P1J A;  1C0U A;  5C25 A;  3SI6 A;  3MXM A;  4F3O A;  5C42 A;  3NH2 A;  2P5G A;  1JLA A;  1EKE A;  1YTA A;  2QXF A;  3L3U A;  1HYV A;  1VSM A;  4FM0 A;  4FZY A;  4N56 A;  2Y1I A;  2HHT A;  4O44 A;  4HUE A;  4CJP A;  3O3G A;  4F4K A;  4YFU A;  4QCL A;  4BDY A;  2EX3 A;  5J2Q A;  3DLG A;  1BL3 A;  3RMA A;  1LWC A;  3EY1 A;  3HM9 A;  4W5T A;  1UAX A;  3PY8 A;  4DQQ A;  4C8L A;  4XIU A;  4FYD A;  4KFB A;  4CES A;  3ALY A;  4NCG A;  4CJK A;  1WLJ A;  4JS4 A;  4ZTF A;  1A5X A;  4DQI A;  4F3T A;  4TSX A;  1TL1 A;  4FJK A;  1KFS A;  4H8K A;  2F8T A;  4KB0 A;  4OLB A;  3VQ5 A;  4FZZ A;  3HPH A;  4CEC A;  1SL1 A;  2B4J A;  2RN2 A;  4DQR A;  4CGG A;  3QET A;  3MEC A;  4CHO A;  3TAR A;  2OZM A;  1GOB A;  1DTQ A;  1JLG A;  4OKJ A;  4BAC A;  3KLE A;  4Q5V A;  4CED A;  3DRP A;  1T03 A;  2NUB A;  1BGX T;  3SUN A;  2YHA A;  2G8F A;  2FBV A;  4OPK A;  3LWL A;  3DLB A;  2PYL A;  4Z4H A;  3KTQ A;  1VK0 A;  5CY4 A;  2EHG A;  2HNZ A;  4I2P A;  3RR8 A;  1BIS A;  4H4M A;  4ELT A;  3SQ2 A;  1BI4 B;  1HQE A;  4G1Q A;  4DU1 A;  3OYG A;  3LAK A;  3M8S A;  4DSE A;  4DS5 A;  2D0C A;  1S1W A;  1UWB A;  4CF1 A;  4UQG A;  4FCY A;  4OKE A;  1TL3 A;  5FRO A;  1IKX A;  4H4O A;  2OA8 A;  1C1C A;  4PUO A;  4R5P A;  1NOY A;  1EET A;  4JS5 A;  4KO0 A;  3DLH A;  5FRM A;  4OGE A;  3DLK A;  3V9Z A;  2Z1G A;  4OVL A;  3SUP A;  1NK4 A;  3AO1 A;  1D9F A;  1WSJ A;  5CZ2 A;  4CHZ A;  3RMB A;  1N6Q A;  4IG3 A;  3L3V A;  3H08 A;  3NF9 A;  3JYT A;  4DTP A;  2XHB A;  3QNN A;  1NK0 A;  3K2P A;  2BDP A;  3RR7 A;  3CQ8 A;  1U45 A;  4I2Q A;  4J2D A;  4E7L A;  4K8X A;  1NJX A;  4W5Q A;  1BQM A;  3HXM A;  4FVM A;  2KQ2 A;  4O4G A;  3F73 A;  4E7H A;  1TKD A;  3TAE A;  4KHW A;  4Y1C A;  4IG0 A;  1HYS A;  3QO9 A;  3NDK A;  1VRT A;  5HRO A;  3KK2 A;  4F8R A;  3CFP A;  3AO2 A;  1QQC A;  4CJV A;  3ZT0 A;  4DTS A;  1SL0 A;  3HP9 A;  3LP2 A;  4KTW A;  1RT2 A;  2HVH A;  3K5O A;  5HP1 A;  3KD5 E;  4K8Z A;  2IAJ A;  3V1R A;  2DFH A;  4YNQ A;  1X9W A;  1TVR A;  2LSN A;  3QEP A;  4DTO A;  4RW4 A;  3QEI A;  1RBS A;  4OLA A;  5K14 A;  1DLO A;  1JKH A;  4DMN A;  5C24 A;  3ISN C;  2B5J A;  4BWM A;  2XY5 A;  4RW6 A;  1HNV A;  3WNF A;  3AO4 A;  4M3W A;  4M3Z A;  4DFM A;  4CHY A;  1ZBH A;  4CJS A;  4FJG A;  2KTQ A;  1RBU A;  3AO5 A;  3AVB A;  3OJU A;  3ZT2 A;  5HRN A;  4AHC A;  1X9M A;  3ZCM A;  3OJS A;  1WSH A;  3SPZ A;  3RWU A;  4CF9 A;  3OYA A;  4DTN A;  1S5J A;  2E4L A;  1BQN A;  4OKK A;  4BDP A;  2O4I A;  1NKC A;  2IS3 A;  1QTM A;  4N76 A;  4KRE A;  1KVA A;  3LAM A;  4CK2 A;  4Y1D A;  3T19 A;  3L2W A;  3S3M A;  4CFD A;  4M3Y A;  4B8C A;  4CJ4 A;  4PA1 A;  2P51 A;  1SKR A;  4CEE A;  4KHU A;  3D0P A;  4HVJ A;  1NK8 A;  4DSI A;  1ZBU A;  4IKF A;  3OYD A;  4GMJ B;  4FK4 A;  3KLH A;  1LAW A;  3ULD A;  1SKS A;  2QKK A;  1WSF A;  5FDL A;  3SYZ A;  1WSE A;  3O3H A;  3RMC A;  4L8R B;  4CHN A;  3E01 A;  4OJR A;  1RT7 A;  3AA5 X;  1S1U A;  2Z1I A;  3NCI A;  3PX6 A;  3SCX A;  3AV9 A;  2YV0 X;  4FJ7 A;  2AJQ A;  3IS9 A;  1CXQ A;  1TKZ A;  1RIL A;  2D0A A;  3ZSV A;  2XRI A;  3OYL A;  3VA3 A;  4CFA A;  2JGU A;  4OGC A;  4MQ3 A;  4CGH A;  4M42 A;  1JL2 A;  2Q3S A;  4KI6 A;  4KHN A;  3CM6 A;  3HP6 A;  2W42 A;  3U3G A;  4FJX A;  4FXD A;  2RF2 A;  4GVM A;  4EP5 A;  4DQS A;  1WAJ A;  4CGJ A;  2KW4 A;  3B6P A;  1ASV A;  1J53 A;  4E7J A;  3AVA A;  2GUI A;  1VSJ A;  3LZI A;  4DFJ A;  1XC9 A;  4M45 A;  1U48 A;  3SPY A;  3M8P A;  2OPR A;  1RTH A;  3QIP A;  3TAQ A;  3ZSW A;  1ASU A;  1IG9 A;  4HCB A;  2F8S A;  4WE1 A;  3LP0 A;  3THV A;  3QLH A;  1IKV A;  1RNH A;  2OPQ A;  3AVK A;  4B8A B;  3P1G A;  1TK8 A;  4ZTJ A;  4E7I A;  2KFZ A;  1XI1 A;  3DMJ A;  2IOC A;  1QE1 A;  1ZBF A;  3IG1 A;  4C8N A;  1B9F A;  3OS0 A;  1HMV A;  3TAB A;  1YVU A;  4RW8 A;  3ZT3 A;  1BIZ A;  2ITG A;  3V1O A;  1B92 A;  4B9T A;  3LP1 A;  3HPO A;  3VQB A;  3SJJ A;  2ATQ A;  3VQD A;  4Z4G A;  2IC3 A;  2IDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...