1QE1A

Crystal structure of 3tc-resistant m184i mutant of hiv-1 reverse transcriptase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
556
structure length
556
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE, SUBUNIT P66
molecule tags Transferase
source organism Human immunodeficiency virus type 1 bh10
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
total genus 121
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1qe1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qe1A05
4BDPA 4RW4B 3M9NB 3KMSA 2A1SA 2DY4A 3OLBA 3KJVB 4Y34A 5J2PA 3I5BA 4ED0A 3KLIA 5EDWA 1FK9A 2G8IA 5KFFA 4N5SA 4E3SA 4CJ5A 5DK5A 3K2PA 1RTJB 3E51A 3DLEB 3H5UA 3D0PA 1ZYQA 2OPSA 5KT3A 5EUHA 4KHYA 2HMIA 4KFBA 1KLNA 1UOCA 4ECTA 2IJFA 4E1MA 3RAQA 4B3OB 3OSPA 3DMJA 2FVPA 4Z4IA 4M3RA 1QSLA 2IJNA 4RW7A 2F96A 3UDLA 4KPYA 3LZJA 4KTWA 4FJKA 4Q44A 2W42A 3NAHA 4FK2A 4K50A 3OLAA 4F3OA 4Z0UA 1JLCA 1J5OA 4H54A 1XR6A 5KG3A 3KKRA 2X6SA 3SPYA 5KFNA 4K4TA 3QEPA 3BGRA 3VN5A 2ATQA 3GIMA 2XCAA 2RKIA 3AO2A 5CY4A 4GW6A 4O3NA 4I9QA 2JEGA 2UVRA 1RDAA 1GOAA 3H5YA 1QE1A 4G1QB 3ZT3A 1NK6A 3FSIA 4QWEA 4C8KA 1TV6B 5KFHA 4CJRA 1QS4A 3TABA 2D3UA 2QK9A 3ULDA 4QCLA 4LQ9A 1RYSA 5HROA 4IG3B 2AJQA 3LP1A 3DLHA 5KGWA 4J2BA 1Z26A 4R8UB 3OYJA 5KRTA 1QSYA 1N56A 3AA4A 4CJVA 3LP0B 3OYEA 1WSIA 2XI3A 2D0BA 3ALYA 1B9FA 3V1QA 3NH0A 4R0EA 1I39A 3DRRB 4NCGA 1S4FA 1RTDB 3HHKA 4K4ZA 1EP4A 5KFUA 2A1RA 2OPQB 1ZBUA 5EWGA 1XC9A 3SUQA 1BISA 4J2DA 2D0AA 4IFYA 3NGYA 2GUIA 5F8JA 4I9LA 3UIQA 4TQRA 3T3FA 4WXWA 4BE2A 4KAIA 3AVNA 4YFUA 4LSNA 1NKCA 1K6YA 1S10A 3N6MA 3VA0A 4TY8B 5FDLB 4M95A 3NBPB 2Y1IA 2GBZA 2XGQA 1Z4UA 1SKRA 4E7LA 1S1XA 1A5VA 3FQKA 2B6AB 1RTHA 4Q5VA 1C1CB 5KFTA 4ED7A 4EYIB 4DL3A 4DSJA 4IKFA 4KO0B 4TYBA 4ECUA 1ZBLA 4PWDB 4AHCA 1IKVA 3H59A 2BR0A 1TL3B 3NGZA 3I0RB 4CEZA 3IRXA 4CF8A 4CK3A 4IDKA 1S9GA 4JV0A 3NH1A 1RT5B 4EZ6A 2W9CA 2J6TA 1RT3B 4ZP9A 2JLEA 1ZTTA 2BE2B 2E6LA 1JLFA 4M3YA 3KHHA 4U7CA 3K59A 3L8BA 1I3AA 2YNGB 5C24A 5F8GA 4OL8A 3BSOA 1VSIA 2OPPA 4RW9B 3T5HA 1VSKA 5KT5A 2Z1HA 3LZIA 2UUTA 1TVRA 1RT2B 4L8RB 4IFVA 3BQ0A 4FM2A 3O4NA 5F8HA 3GV7B 3MR6A 4WE1B 1HPZA 4B8AB 2FJVA 4DQQA 2F8EX 3QLHB 4Q0BA 2ZE2A 4TN2A 4U6PA 2IA6A 3K5OA 4NLSA 4KHNA 3MEDB 1R0AB 1WSGA 4CF1A 1HYSB 3EZUA 5C5JA 1VRTA 3A2FA 3Q8PB 3UR0A 3M9MB 4PUOB 3N6NA 4F3TA 4O44A 2XY7A 3OYHA 4G3IA 2XY5A 2B5JB 3HP6A 1JL2A 3DM2B 4URQU 1D5AA 1FKOB 4J9QA 5KFIA 3BSAA 1S1WB 3L2UA 2XRIA 4CFBA 3OYIA 2HW3A 4H4MB 3L3VA 1UA1A 4DSLA 4M3UA 3NDKA 3OYNA 2HHTA 2YNHB 3MAQA 1TK0A 1X9WA 2X6NA 1KHWA 3GV8B 5CYQA 3H4BA 4K4SA 2G8FA 4OGCA 3QESA 5C42B 5KFQA 1CXQA 2VA2A 3RB3A 4I2PB 3QO9B 3NAIA 4CJUA 1DTTB 2HNZA 2VG7A 1WSJA 2YNFA 4IH7A 2BDPA 3HPGA 2IGIA 4TQSA 1HQEB 5HLFA 3IG1B 4QWCA 4ICLA 3ZSWA 4DF8A 1N6QB 5KFXA 2RPIA 1HQEA 5HLFB 3V6HA 2XGPA 4RZRA 4QW8A 4ECYA 3SI8A 2R2TA 2BRLA 1TKDA 2FJWA 2VG7B 3OYGA 1BI4B 1KFSA 4B9MA 3BSCA 2FJXA 1NK0A 3S3OA 3SUPA 2QE5A 3RAXA 2HNDA 5KRSA 1ZTWA 1U45A 4TY9A 3GYNA 2OA8A 1C2PA 3V9SA 4BACA 3VQ6A 2EHGA 2YNHA 1HMVA 3LP2A 2KFZA 3M8QB 4EO8A 4FJ5A 3TAEA 3SZ2A 3ZT2A 2FC0A 1HRHA 4DFJA 1FKOA 5J2MB 2YNIA 3KLEB 2YV0X 4MFBA 1RT4B 3PX4A 2HNYA 4PUOA 2JC1A 3OYDA 2B43A 1VRTB 4YP3A 4J9KA 1YVUA 1TKZA 3ZSXA 1IKYA 4ZPDA 3LAKA 5KFMA 1JKHA 3MEDA 3GV5B 3ITHA 4CJ3A 2WOMB 4MK7A 4Q0BB 2YKNA 3PR5B 3RMCA 5C25A 4WE1A 1S1TA 4QWDA 3G86A 1CZ9A 1RT2A 2R8KA 4ZTFA 3C6UA 2Z1JA 3L2QA 4NRTA 4MK9A 1IG9A 1T05A 4JRPA 4B9LA 3O4QA 1RDBA 2Y1JA 4ELVA 2WHOA 4KB1A 4CGIA 4ED6A 1Z25A 4HCBA 4BDZA 4FJIA 3T5JA 4HUFA 1JLGB 4ECWA 3M8PA 4HHTA 1S9GB 4ZVHA 4DQRA 3ZSYA 4CHQA 3CM6A 3NGIA 2IM2A 3HKWA 4IOBA 1EETB 3T1AA 4JS5A 3TAPA 3ASMA 4AHSA 4DTMA 3AV9A 4ZP8A 4DTUA 3AO4A 4CF0A 3QNOA 1WNSA 2VWJA 2P5OA 1L3TA 5FRMA 3GIKA 4ZP7A 2O4GA 3DDKA 1NK9A 4NZ0A 1S9FA 1SH3A 1S9EB 4ID1A 1S48A 1XI1A 2JC0A 4NLGA 4ECXA 1ASWA 4TLRA 5F8NA 1YVFA 4PA1A 3HYFA 4N41A 3LALA 1C1AA 4GC7A 3V9UA 3CFPA 4IFYB 3FDSA 3VQQA 5D3GA 4EBDA 1JIHA 3VQ9A 4LQ3A 4TSXA 5F8LA 1EP4B 4DL4A 3CJ4A 5KG0A 4CE9A 4Y2AA 4FBUA 1LWCB 5KI6A 2W9BB 4CEDA 1IKWB 4CJPA 1IM4A 2I1RA 2RN2A 4R8UA 3DLGB 1DLOB 5KFLA 1WNEA 2AX1A 1F21A 2FVRA 3MEGB 4DL6A 3KNAA 4DFMA 1JLQB 2JGUA 3I0SB 4HYKA 3V9WA 3KLHB 1IH7A 5DG8A 5KT7A 3G10A 3QGGA 2JEJA 1X9MA 4NLWA 4BE0A 3MXJA 1L3UA 2BRKA 5J1EA 4CFCA 4URSA 3H98A 1J54A 1UWBA 3LPTA 1KCFA 4E19A 4MKBA 3QGHA 3MFHA 3T5LA 4FZYA 1ZBIA 2WOMA 1KRPA 4OLBA 3S3NA 1ITGA 4O3OA 4I2QA 2XY6A 5JS2A 4CERA 4AHVA 3T19A 1K1QA 3KLFA 3V81A 5DQGA 4IRDA 2HNYB 3ISNC 1X1PA 4FLYA 1RT4A 3ZCMA 3KKSA 4E7JA 2YNIB 3KD5E 3DMJB 4B9TA 3OY9A 2FBXA 1QTMA 4KAZA 3PW2A 4LSLB 2R8JA 1EXQA 3PW7A 1HNIB 4CEAA 3SQ1A 2D7SA 1RTJA 2I5JB 4ECSA 3SUOA 4Z4EA 1XHXA 4MQ3A 2D5RA 3O3FA 4C8NA 3KD1E 3SFGA 4DFKA 2HNDB 1SKSA 1NJZA 1XR7A 1ASUA 2QKKA 5F9NA 2V9WA 1W9HA 4WZMA 1LWEB 3CQ8A 1S1UA 3S3MA 1BI4A 5J2QA 4KRFA 2Q3SA 4ECVA 3KK1B 3EZ5A 3OYCA 3NFAA 5EWFA 2VG5B 1NK4A 1MMLA 1BQNA 1JXLA 4ED1A 2KZMA 1SH0A 3HT3A 4FZZA 3IG1A 3KHGA 4IRKA 3EPGA 2HVIA 5HRNA 2YNFB 4ELTA 4M45A 4ZHRB 4F4ZA 3CDUA 1JL1A 4CEOA 2KTQA 4JV2A 1DTTA 2HNZB 4NLRA 4DLEA 3VQ5A 2GIQA 2FBYA 2WB4A 1LAWA 4F4KA 3UPFA 1VRUB 1I6JA 1GOBA 4IG0A 3CDWA 3JYTB 2DPJA 2R8HA 1RCHA 3SFUA 4CGJA 1D9FA 2E9TA 1FKPA 1RDCA 3SCXA 4ID5A 4RW8B 2VA3A 3IGVA 1LWFA 4WXOA 3UQSA 1U04A 4HCCA 1S1WA 2R8GA 2RDIA 1LV5A 4Z4FA 4J9PA 4C8MA 4OPJA 1VSLA 1BHLA 4XPCA 3RRHA 1KFDA 2PZSA 3PHEA 4O44B 5K14A 4O0IA 4MH8A 4KHRA 4CJTA 5L1LA 3NCIA 4CHOA 1FXXA 4J9MA 1HYSA 1RTIB 4NYFA 2R2RA 1RYRA 5J2NB 2ZE2B 4NYZA 1LWFB 4ID5B 4RW8A 3PV8A 3NE6A 3AVBA 5DMRA 4IFVB 3LWMA 3QERA 3ZSVA 3ZSOA 3VQAA 3JYTA 1RT6B 2IM1A 5KG1A 3VQPA 3S9HA 5KFZA 4JV1A 4DTJA 5C24B 1CLQA 2FLPA 3DRSA 2ZQBA 2YNGA 2P5GA 3CFOA 3VQEA 2W7PA 3DLBA 4Y1CA 1D0EA 3NGDA 3BREA 4CJ4A 2D3ZA 5HP1B 2BE2A 2WRMA 3NMAA 5HRPA 4J2EA 2W9CB 1A5WA 3DOLB 4IDKB 3MR2A 4N56A 3OL8A 1TL3A 2IAJB 5KFSA 5KFAA 3PVXA 4PWDA 3SV3A 1BQNB 2RDJA 3HJFA 4KKOB 4RG8A 4CHNA 2DTUA 1IO2A 2VG6B 4KO0A 4EEYA 4FLUA 2C2EA 2ASLA 3AVLA 1T03B 2UVWA 1NK8A 4WZQA 3DLKA 3H4DA 4DLGA 4QWBA 2IMWP 1RTHB 5L1JA 3OYFA 2AQ4A 1ASVA 1VSEA 2FLNA 2IBKA 4EP5A 4HVJA 3OHAA 3NBPA 4K4XA 5FDLA 4DTSA 2YHBA 2V4RA 3RBDA 2ASJA 4K4VA 2E4LA 1J9AA 2XY8A 4BDYA 3OL9A 4QWAA 3CO9A 4MKAA 2I5JA 1BCOA 3LP3A 4F2SA 4RNFA 3VQBA 1W0HA 2OPQA 3QZ8A 1HNIA 3DRPB 4CGDA 2PYJA 3C95A 1S6QB 3LPUA 4LSLA 4NCGB 2E9ZA 1TL1A 5KG5A 4FJXA 3SQ0A 1WSFA 1NHVA 5KG7A 2HHQA 3CJ3A 4IR9A 4H8KA 3V81B 4H4OB 4F50A 4DQIA 4BWJA 4F4XA 3D45A 4I2QB 1SUQB 3KLGA 3HPOA 1TV6A 4KTZA 4WFZA 1C6VA 4DL2A 3SUNA 4PQUA 4DEZA 4QOZB 1UWBB 4FYDA 1QE1B 2KZZA 5J1EB 1JLBA 1LW0A 2QXFA 1Q9XA 4FW2A 1JLQA 4Q45A 3VQ8A 1J5OB 1SUQA 1JLCB 3LDSA 3ZSRA 2XCPA 4NLPA 4YMEA 3AVHA 4CIEA 4M3TA 4DTXA 4H4OA 4DTPA 3PO5A 3DLGA 5JXSA 1L5UA 4FM1A 4RW7B 4ZVFA 4CJSA 1RA7A 3P1GA 4GC6A 2W9BA 2YKMB 4B3OA 2AGQA 4M94A 2FVSA 3CVKA 3GIJA 2HMIB 4IRCA 2V4QA 3TVKA 4DSKA 3RB4A 2B4JA 2AGOA 1Q9YA 3DLEA 5T14A 1C1BB 3ICLA 3P83D 5L1IA 3KK3B 3PW0A 2X78A 4CJEA 2RF2B 2G8HA 5DQIA 4C8LA 3KLIB 4O3QA 3OYMA 3QIDA 4K4WA 5J2PB 4KHSA 1D1UA 3AA5X 1GX5A 3HVRA 4M3WA 2ZKUA 3RMBA 4FJGA 1QHTA 3PJXA 3C6TA 1S5JA 2JEFA 4OLAA 4E7HA 1C0TB 4CHYA 3THVA 3DLKB 1TP7A 1LW2A 4DL7A 1EX4A 3DOKB 3TAGA 2VG6A 5KFEA 3V6DA 1RT1B 3PZPA 3ZSQA 1REVB 3JSMA 4C8OA 3PW5A 1JLEA 5F8MA 3RR8A 2ZD1A 1CSJA 3TAMB 2W9AA 5DLFA 4TXSA 4MIBA 5JS1A 1S1VB 3TQ1A 1S6PA 4EBEA 3M8PB 4ZVGA 1U47A 3OS1A 4DSEA 3I5AA 2C2RA 1TQLA 4NLDA 3H5XA 4RW6A 5HP1A 4BWMA 3HPHA 4BE1A 3AVFA 4Z4HA 3CIZA 4NLTA 1NHUA 1TKXA 3DRSB 4J9NA 2OZMA 4KI4A 5CZ1A 2OZSA 5FRNA 1RT6A 4IH6A 3PW4A 4KHQA 4KHUA 3RB0A 1S1TB 5C25B 3AO5A 1W25A 2YKNB 3IN5A 3V6JA 1TGOA 5I42A 4OKJA 5L1KA 2DFFA 3ITHB 1RTIA 1JKHB 3CDEA 3P5JA 1TKZB 4W5NA 3NL0A 2CKWA 3NHGA 2AU0A 4CHPA 5DGBA 2UVUA 3V4IB 4QW9A 3SQ4A 3OJUA 3CG7A 4F4YA 1KTQA 2WCXA 1NOZA 1HNVB 3KLEA 4HTUA 3AVKA 2R2SA 4AHRA 3H40A 3SPZA 4CIFA 4DS5A 4K4YA 1QSSA 4FLTA 3VQ4A 1MU2B 3OVNA 3VQ7A 5KFCA 1NJWA 1FKPB 3U3GA 2AX0A 3M8QA 2G8KA 4FJLA 4OGEA 2C28A 2ETJA 3CJ0A 3VA3A 4IG0B 4KBIA 3L2RA 3QEVA 4B9NA 2IOCA 2QKBA 3RMAA 3KK2B 3MXIA 1S0OA 3M8RA 3OSNA 5JUMA 2Z1GA 4LY7A 1WN7A 3OYLA 3QNNA 3AVGA 2QV6A 3MEEB 1QAIA 2WONA 4B9SA 1GOCA 1SL2A 2P1JA 4CGGA 1T3NA 5KFDA 1S97A 2DFHA 3U6FA 3V6KA 1KLMA 3CJ5A 4ZVEA 4DSIA 4KHWA 4YNQA 1OS5A 4R5PB 5DGAA 4XPEA 4M41A 4KV8B 5KFKA 2C2DA 3KTQA 2VG5A 1N48A 3KIOA 3KMQA 4OKKA 4CGHA 2IC3B 3KK1A 3K5NA 1JXBA 5J2QB 4Z4CA 4CFDA 1S1UB 4YQWA 4O0JA 3AA3A 1LWEA 3MR5A 3MECB 1YT3A 3WNEA 3MF5A 4KE5A 3L2VA 1TAUA 4KHMA 5C42A 3RRGA 4FLZA 5CYQB 4O3RA 3NF9A 3RBEA 1LAVA 4NLOA 1WSHA 2BANB 2FVQA 1BIUA 3IAYA 2YHAA 3AVIA 3E01B 4PY5A 3C94A 3BR9A 4H4MA 5F8IA 4HUEA 1SKWA 4XO0A 1KVBA 4MIAA 4DWIA 3PX6A 4O5BA 2OPRB 2PY5A 3DM2A 2HHVA 3ZT0A 4WYWA 2ILZA 3ZT4A 2BQUA 3I8DA 5HRSA 3B6OA 4Q8FA 4RUAA 2C22A 3V1OA 1N5YB 2IM3A 2WK4A 2HVHA 3KLFB 3G6XA 4K8ZA 3OS2A 4F4WA 3N6LA 4Z4GA 4JS4A 3QLHA 1NNDA 1JLAB 3TR8A 2HHSA 1HPZB 2LSNA 1HQUB 2FBTA 5KT2A 2KFNA 1N5YA 1RT7B 1TVRB 2ATLA 4ZP6A 2OPPB 2W8LA 5I3UA 3QEXA 3KLHA 4XIUA 4JRQA 3I0SA 4FLXA 1B92A 3EPIA 4ELUA 3DI6B 4CFAA 1ZBHA 3DLRA 3MEGA 4AHTA 3BQ2A 3HVWA 1L3VA 1HYVA 1DLOA 2PYLA 1UAXA 3WNGA 1JX4A 4JUZA 3SV4A 4ED8A 1G15A 1IKWA 1BCMA 1NK7A 3ZT1A 5KFOA 1LWCA 2G8WA 3QIPB 1D8YA 3QINA 5E41A 4DTOA 2UVVA 3TWHA 3H2LA 4W5TA 4DQPA 2XI2A 3MECA 4W5QA 3G6VA 4J9SA 1RBUA 3OYBA 5D3GB 1C1CA 4ECZA 4EO6A 1S1XB 3RWUA 4NYNA 5KT4A 1NKBA 3D5MA 4Y1DA 3SI6A 3NF8A 3SNNA 4KV8A 4Q8EA 4LSNB 4R5PA 1HJRA 2FBVA 4FJMA 1S9EA 3F73A 2HAIA 3GIIA 4CF2A 4FJHA 4ECQA 1C0UB 1RNHA 1KLMB 2R8IA 5HRRA 1QAJA 1B9DA 2WONB 4F2RA 3TAFA 4NRUA 3SQ2A 1TK5A 2AWZA 2ILYA 4DF4A 4WYLA 1WSEA 1EETA 4AH9A 4KTQA 3RB6A 3HVTB 1A5XA 3LP0A 3BJYA 4M3XA 2XC9A 1JLGA 4DSFA 1RILA 3AO1A 3LP1B 1N4LA 2X74A 3HVAA 1XWLA 4IG3A 1MU2A 5KFPA 4FJ7A 1T7PA 1S49A 5DQHA 4B9VA 4CEBA 4CESA 1T05B 4I7FA 3CFRA 1SV5A 4Q43A 3CYMA 2HHUA 4M3ZA 4FK0A 4QAGA 3CWJA 3C6UB 1SH2A 2NUBA 4KREA 4YR2A 2RKIB 4E7KA 3H5SA 1BGXT 3OYAA 4W5RA 1HARA 4K4UA 1KHVA 1JXEA 4QPXA 3MR3A 2O4IA 4DU4A 5DG7A 4NCBA 4LH5A 3T5KA 2DFEA 1IKYB 3HK2A 1TAQA 4MK8A 4FJ8A 2XWYA 4FXDA 1BL3A 4FCYA 4JLHA 1S0NA 2D41A 4MFBB 4CK2A 4E1NA 4J9OA 3O3GA 3NF6A 4DU3A 1SV5B 5J2MA 4I7FB 5T7BA 4KFBB 2XO7A 4ED3A 3V9XA 2W7OA 4Y3CA 5KFGA 3KOAA 4RW6B 3QGIA 3MTKA 3BDPA 4DS4A 1HMVB 3LP2B 4CK1A 5KGXA 5KTQA 3OL7A 1U49A 3K5LA 1K1SA 1FK9B 2ITGA 4CEFA 2HHXA 4J2AA 3HVTA 2IS3A 3OS0A 3KJVA 1JLEB 1RDRA 3H08A 3VQSA 4FJ9A 4B08A 4ZPAA 1NJYA 4K8XA 1DTQB 2VWKA 3FFIA 5KFRA 4DMNA 1TKTA 4UQGA 1RAJA 4KB7A 4KI6A 4URGA 2R7YA 2FLLA 4WFYA 4E89A 3KLVA 4EBCA 2J6SA 1C0UA 3AA2A 1VSHA 2EC0A 3K58A 4IH5A 2HWHA 4IBNA 4FW1A 1N6QA 1CZBA 2HWIA 4X2BA 4OVLA 4ICLB 3PX0A 4O55A 5FROA 3B6PA 3V1RA 2RF2A 4E0DA 3OJSA 3QETA 1ZBFA 3KK3A 4DTNA 1KSPA 1RA6A 1C1BA 3QO9A 1HYZA 4I2PA 3WNHA 1NK5A 3O3HA 4CJKA 2J6UA 3TARA 3LWLA 2F8TA 3QIPA 3OYKA 2YKMA 4Y2CA 3G0ZA 5KFYA 3BQ1A 4CGFA 3KHLA 2HB5A 3PY8A 4GMJB 1XHZA 3MXMA 1U48A 1BQMB 4YR0A 4O4GB 1WAJA 2WTFA 3QZ7A 5SZTA 4TYAA 2KW4A 3D28A 2GC8A 5DLGA 3IS9B 4ZMMA 1VK0A 4GVMA 3DI6A 1D9DA 3AVMA 3F9KA 3GQCA 5HBMA 1VSFA 1O1WA 2BGGA 1QQCA 5KG2A 5I3UB 4OKEA 4CCHA 2B5JA 1T94A 3QIOA 1TK8A 4CECA 4B8CA 1LW0B 1JLBB 4FS1A 3K57A 4DL5A 1RT7A 1L3SA 3U3YA 2OH2A 1HQUA 4CJQA 3DYAB 4CIGA 1JLAA 4PQUB 3L3UA 1R0AA 4FS2A 3KLGB 2F8SA 4ZTJA 4CEQA 3HSTB 3FQLA 1YTUA 1QUVA 4CF9A 3PUFA 4ZPCA 4NLXA 1CXUA 1NKEA 2E6MA 5L9XA 5KFBA 3TAQA 4FVMA 4DG1B 4YR3A 4RW9A 2G8VA 1TL1B 5KFJA 5KG4A 1EKEA 3NAEA 1IKXA 4RNNA 2OPRA 4IQXA 1VSDA 1S6QA 2EX3A 4EZ9A 1RBSA 3HL8A 3DRPA 1C0MA 1RBTA 4O3SA 1JLFB 1VSJA 1VSMA 3E01A 3FRZA 4ED2A 5EWEA 2BANA 1RT3A 3HP9A 5KT6A 1RT5A 2KQ2A 1KVCA 4CEEA 2GV9A 4IKAA 1ZETA 4KB0A 3IRXB 3I0RA 5CYMA 1IKVB 3K5MA 4DFPA 1J53A 4AHUA 2ASDA 3HXMA 3M9OB 1WLJA 3HM9A 4KSEB 4CJWA 2B6AA 2IC3A 4LD0A 5SWMA 3AO3A 1T03A 2HHWA 2IM0A 4TY8A 4KKOA 5CZ2A 4NLQA 5F9LA 3AVAA 4DQSA 5KFWA 2IAJA 5DG9A 3CJ2A 3CM5A 2OYQA 5CYMB 2JEIA 3DOLA 3TANA 3ISND 2W8KA 3SYZA 1NJXA 4N47A 2GIRA 2BQ3A 3GILA 1RDDA 1WAFA 3PR4A 3MEEA 5KG6A 1U4BA 3IGNA 4O4RA 3VQDA 4NLVA 4NLUA 1X9SA 1RTDA 3LAMA 3KK2A 1Y97A 3V9ZA 2DPIA 3DRRA 2XHBA 1IKXB 1U09A 3EY1A 4FLWA 4WFXA 4EYHB 4CHZA 4DG1A 2CJQA 1T8EA 3VQCA 3NKYA 4FBTA 3QEIA 1KVAA 5KFVA 4RUCA 3MFIA 5HROB 2V0NA 5J2NA 3BSNA 4FZXC 3I5CA 4RNOA 3Q8QB 4G1QA 1UA0A 1HNVA 3DYAA 4J9LA 3M8SA 4DU1A 3V4IA 5K14B 4CJLA 4DTRA 3BGRB 2R2UA 3NF7A 4FJNA 1YTAA 5HBMB 4FLVA 4RNHA 5I42B 4N76A 3HO1A 3G6YA 1SL0A 3IS9A 4E7IA 2BQRA 3AVJA 4NCAA 4W5OA 3RR7A 5EU7A 4O4GA 3QEWA 3Q8SB 4J9RA 1BQMA 3RMDA 3NH2A 1XR5A 3L2WA 1NOYA 2AGPA 3PO4A 4FM0A 2P51A 4RU9A 4LH4A 3OHBA 1TKXB 4HUGA 1VRUA 2Z1IA 2FVCA 1Q8IA 2OPSB 4ZPBA 3WNFA 3TI0A 3LANA 4NLYA 3ZSZA 4ZHRA 2E9RX 1S6PB 3PJWA 2ALZA 1S1VA 1RBVA 1S0MA 4CJFA 1RBRA 4OPKA 3TAMA 2UUWA 4HKQA 2ZD1B 3AVCA 4EP4A 3SJJA 2D0CA 4RW4A 1REVA 3JSMB 3RTVA 3KHRA 1RT1A 3V6DB 2IDOA 1SL1A 3QYYA 3DOKA 3OL6A 4AILC 1BIZA 4FK4A 4F8RA 4M42A 1LW2B 1GX6A 4ECRA 1C0TA 4OJRA 2G8UA 1TKTB 4IR1A 3Q8RB 4FJJA 3C6TB 4O3PA 3FFIB 1DTQA 3EYZA 4B9UA 4RNMA 2O5DA
chains in the Genus database with same CATH superfamily
2DITA 2A1SA 2DY4A 3J7ZT 2LP4A 2F40A 3M4XA 5BRDA 4GV3A 3HKZD 1T9UA 5KFFA 2E1ZA 4CI0B 2M3DA 4A59A 1XQSC 2OPSA 4JEPA 3AAWB 5EUHA 2CWXA 1TR0A 3GTYX 3SQOP 2XYHB 2J7UA 1X5TA 3RAQA 2LMIA 1Q8BA 2J0SD 2MMYA 3DMJA 2OLWA 1WG5A 2MSTA 4KR0B 3CCQS 2IJNA 2BJ9A 2GJ2A 2MEWA 2F96A 1S72N 3ZZZA 2V9KA 3NAHA 4CH1A 1OVYA 4CDIA 6FDRA 1XNQK 3WEEB 1RWWB 4DR5K 4QPTA 3NS6A 4Z94A 5KG3A 4DV0J 3FZMA 1JJ2M 2D4WA 3CIMA 3BP8A 3R6MA 3ZEUB 3BGRA 2GQCA 2FC9A 1H74A 3GIMA 2XCAA 2M88A 3QT8A 3H5YA 4A8QA 1IG8A 2QFIA 4Y0FA 3BKUA 3ZT3A 1F9EB 2R7RA 3FSIA 5FPEA 4ZVRB 4CJRA 1QS4A 4DR1J 1TMMA 2QK9A 3ULDA 4IG3B 4WFNL 2H51B 3A8JA 4J2BA 4R8UB 5KRTA 5JVHL 3U1NA 1F5CA 1U8WA 2ZVIA 4JKGA 5LXRA 5HATA 3C3LA 4R0EA 2MLZA 5GAHU 4K4ZA 3Q22A 2X1AA 2A1RA 1WC5A 4F25A 5K5MA 4ILLA 4J2DA 1CS4B 1WTFA 4I9LA 5DM6Q 4BE2A 4KAIA 4QBUA 4YFUA 4LSNA 1VOMA 2F63A 3KDNA 2OTLS 1HPMA 1S10A 4TY8B 5FDLB 3NBPB 2Y1IA 2F9DA 2CVEA 2GO8A 2ZH3A 4E7LA 1S1XA 3O9RA 1UETA 4MKVA 1C1CB 1DQ8A 5KFTA 2K7JA 4LF8F 4IKFA 3W5ZA 1UW4A 2ASOA 1ZBLA 4ZVUB 2OKQA 3DKDA 3G25A 4PKHA 1Y3JA 1S9GA 3VAJA 2DO4A 2KKHA 1FTRA 1RT3B 4ZP9A 2QA4N 1UTAA 2WVDA 3CXCM 2BE2B 3Q7CA 2AYGA 3K59A 3VAMA 5BPNA 1ZBTA 1I3AA 3HHDA 2YNGB 1ZA1B 1PJ6A 1MLAA 5F8GA 2CYYA 4OL8A 1VSIA 1DARA 4RBTA 4CYUB 1VSKA 1EKSA 1BD6A 2UUTA 2DCUB 2VFVA 5EVZA 4LR7A 3GV7B 3H0PA 2IY5B 1HPZA 5DRKA 2F8EX 3PRDA 2PGCA 4U6PA 3L7UA 4KHNA 5AQLA 5HSPA 1WSGA 4U67Q 4DV3K 1TUGB 3RYLA 1XNRF 4CVNE 3T1HJ 2J8AA 3A2FA 1NBEB 3AB2B 3GB0A 4ZPWR 1CZAN 5HVGA 4O44A 5KQDA 1LK5A 1JL2A 2Q97A 4URQU 3NGSA 1BUPA 3SBMA 4LSZB 4J9QA 5HQLA 4CWBA 5KFIA 2EWHA 1S1WB 3TZXA 2XRIA 3OYIA 4GKKK 2HW3A 4H4MB 1W26A 2Z2MA 1UA1A 4DSLA 1SC6A 4FOIA 3PSIA 4IO8A 4M3UA 1NPPA 4CBUA 5GAEI 1YRUA 3E2EA 2ZWPA 2FD2A 1RJJA 3U1LA 1VS3A 1SC1B 1UVJA 4OGCA 4PAAA 2G0JA 4XDDA 2R42A 2QLJB 2VA2A 3ZTOA 2CGJA 4I2PB 1K8KA 2ZBQA 3QO9B 4C8YA 4BRKA 5MAOA 1WJ9A 2ZH4A 2BDPA 2IGIA 1MNEA 1NDKA 4TQSA 2GV1A 4A8MP 4DV0K 2XM3A 4TU8A 1HQEB 4L74A 3IG1B 4ICLA 2AHOB 3CJAA 1JQGA 3PYEA 1HQEA 1HW9A 1WG4A 5IC6B 3AOCA 2RSQA 2AA4A 4QW8A 4ECYA 3VAIA 4IZ9A 2FJWA 1G1XA 2VG7B 1G4CA 1HUXA 2CADA 2JWLA 4E8UA 1ZTWA 1U45A 2Y1LB 2GW8A 3KYLA 4RLEA 1ZZFA 3GYNA 2OA8A 3G9CA 2ZVSA 4BACA 3VQ6A 1V3ZA 2PFDA 2Q43A 3TAEA 4NI2B 6FD1A 3GG0A 3VEZA 1VQ4N 3O5TB 1X4CA 1TUYA 1UEUA 1VBYA 3P38A 1F5BA 4PWWA 5J2MB 2QTDA 1JB0C 5LJVA 1RI7A 3N4WA 3KLEB 1N5QA 2YV0X 4DV2K 4MFBA 1RT4B 2I7NA 2HBLA 1HA1A 2HZVA 3ZSXA 4ZPDA 4X62K 5KFMA 5H9FK 1Y3KA 2DNLA 2WOMB 4MK7A 3VETA 2YKNA 4UOFA 3RMCA 4WE1A 2CH6A 1S1TA 4K0KK 3H45C 3G86A 2R8KA 4WFNQ 5CYJA 4KH1B 1KN6A 4U7UK 2Z1JA 4ILMA 2BW2A 3TX0A 3BF1A 1T05A 4B9LA 4JRPA 3I6PA 2HGMA 5ADZA 3T5JA 4IYQA 2H3GX 3G82B 3ENBA 5AQMA 1S9GB 5E2QA 4ZVHA 3BEGB 4DQRA 3WXKA 3ZSYA 4CZFA 1KC8O 1Y7PA 3VGMA 1EETB 3T1AA 2OMOA 3TAPA 4V19X 1SB6A 1X3NA 1UZHA 3SAFA 2N3LA 4AHSA 2V7ZA 3W8GA 2E1AA 5GIPA 2UV8A 4X4TA 2P5OA 2UP1A 5FRMA 4ZP7A 5IXUA 4MDBA 3PEHA 3NVMA 4YB6A 1SH3A 1S9EB 3DXBA 5AZIB 2XNRA 1NGDA 2CPXA 1ZM3A 3EGVA 4ECXA 4DV7K 1ASWA 2ABYA 4TLRA 1OVQA 3QMQA 4PA1A 1IUJA 2CPEA 3HYFA 4USJC 1C1AA 4GC7A 3GR1A 3FDSA 3HOSA 1FF2A 4J91A 3VQQA 4EBDA 1JIHA 1RWNB 4WKYA 4M8LA 2ZGYA 3QDKA 2J9CA 1HX1A 1S0VA 3H8YA 4ILRA 1RTZA 4OO1J 1SJFA 2KJWA 4Y2AA 2BOPA 2I8EA 1ACMB 1FWKA 3KWMA 4IFEA 3HF5A 1QVGM 5DO2A 1IKWB 2ZOGA 1IM4A 1RISA 4X65J 4OYWA 4NZ6A 2B4OA 2VFTA 2RE1A 4R8UA 3E9PA 3DLLL 2MJNA 3PHTA 4C3MA 4YOWA 1F21A 2JHEA 3DGPA 3KNAA 4DFMA 2ZKTA 4OX9J 4C3LA 4CO4A 1FKAF 3WUHA 1HI1A 1IH7A 3CO0P 1BLUA 3G10A 2OSQA 2UV8G 2FSNA 4EFHA 4JI4K 3MURP 1X9MA 4NLWA 4DCHA 2BRKA 4NMLA 4URSA 2CZ4A 1UWBA 3LPTA 1ZBIA 1U8SA 2WOMA 1NSPA 1VQ9N 1ITGA 4D3HA 3WEEA 7FD1A 5BPMA 3GU0A 5JS2A 4CERA 4CLUA 4AHVA 2Z2YB 4JK8A 4DX8H 3GE1A 4AQYJ 2YKPA 2VJUA 4CLKA 3ISNC 4FLYA 1KS2A 2DGQA 3ZCMA 3VGKA 1ZBSA 1C4CA 2G2YA 1GH8A 2FBXA 1TZ0A 3CF5Q 3MMBA 3G71N 2R8JA 4L3NA 2YBVA 9RUBA 3PW7A 1SCJB 3BY5A 3SQ1A 2D7SA 5DDPC 3SUOA 2NUHA 3SFGA 3HSGA 1X4BA 1ASUA 2V9WA 1YI2N 3F0NA 3R7NB 1WWHA 2QFJA 3CQ8A 2GTDA 1S1UA 2ZUAA 1WF1A 4ECVA 3SAHA 1R0BG 4FWSA 2KJVA 3KG4A 1VQ6N 4ES3A 3M1VA 1Q82T 3W3DA 5GVQA 3BUZB 1SH0A 2R7TA 3EPGA 1VBXA 3JSRA 1FWPA 3R7SB 3HFKA 5HRNA 4ELTA 2XS7A 2FTRA 4F4ZA 2VONA 2ZH7A 4M5JA 1FJEB 4NLRA 3EGNA 2XZWA 2J4RA 3M1FA 3UPFA 4JI1K 1K0VA 2KO1A 3WIVA 1GOBA 3HZ6A 1CJVB 3FBEA 2K1RB 4IG0A 3CDWA 1M5HA 2AIRB 2VKRA 3AGKA 3MCPA 3D1HA 1RCHA 1D9FA 1FKPA 5LT5A 3IGVA 3B8HA 3UQSA 2Y8YA 1U04A 4HCCA 4FKXA 1S1WA 2KVIA 1XMQJ 1XBWA 1SJ3P 2XSFA 3PYDA 3RRHA 2HRUA 1S59A 3AAQA 2K7KA 2W25A 4O44B 1VJWA 4C0HA 4KHRA 1MSWD 3NCIA 2A18A 4MTPA 2D1KA 3MCMA 4XH1A 1WC0A 3CPEA 4JAXA 3CC7S 1CJTA 5AXKA 3MM9B 2QA4S 4KT0C 2ZBPA 4RW8A 3PV8A 2CAJA 3H42A 2DIVA 2OTLN 3ZSVA 3ZSOA 2JH3A 5G0RB 2AJ2A 1X5PA 3B82A 1RT6B 2IM1A 3RBZA 1M1GA 4Q2LA 4NEZA 4YORA 4DR4F 2W7PA 4Y1CA 2ZHBA 1D0EA 1WOSA 1SPBP 2BE2A 2NRXA 4ANDA 1KTVA 5HRPA 3FCHA 5B0FA 2ZHOA 2R7SA 1N8RO 2B4PA 3OL8A 5AXNA 3L7PA 3PVXA 5A8KA 4PWDA 3SV3A 1BQNB 1KONA 5ETOA 3HJFA 1U0SA 3CPWM 1FDAA 4DR6K 1QDUB 1FDNA 5DETA 3H4DA 4QWBA 1XMOK 2CPIA 2V8HA 4CLPA 4BR0A 2FLNA 1FXLA 2KH9A 3GBTA 1GMWA 4QIVA 5FDLA 1X4DA 3PIPQ 2YHBA 2QWPA 3JXUA 4LFBJ 4USHA 4K4VA 3FEZA 3EVMA 4G6VB 1J9AA 2EVZA 2XY8A 2CUYA 3CCMS 4BDYA 2NRTA 4C1NI 2XYGB 3MM7A 3CO9A 2I5JA 3M2RB 3VQBA 1Y5IB 5CA5A 3HSDA 3LPUA 3ZXWA 1Q5YA 3VOVA 1RBOB 3CJKA 3O4WA 1NHVA 2HHQA 1AYEA 1FW6A 3SMPA 1T9XA 1RAIB 4DQIA 2XULA 3LDNA 2A40A 4JHDA 5TKYA 1TV6A 4KTZA 1WDDA 3T1YK 1C6VA 4DEZA 2ZJQQ 2HF3A 5CHIA 3SDEA 1QE1B 5J1EB 2Z4PA 3CD6S 4JKAA 1N0VC 2HAFA 1SKUB 1KAZA 5EOYA 1N32F 4Q45A 4C4WA 3CJCA 3VQ8A 4Y28C 3DGPB 2RHKA 2X7IA 4LF9F 1JLCB 4JI0J 1RGIA 3LM9A 2XCPA 2F8HA 3AVHA 4DTXA 4IQMA 3PO5A 1KQGB 4BY9C 5JXSA 1NM2A 2BJ1A 3GDQA 4IEIA 4WQ5C 4FM1A 2HYIB 1XEZA 4GVBA 4X4UA 3P1GA 3R3LA 3IMXA 2MZRA 4C2MA 4B3OA 4LRBA 4RL1A 5C2GA 3CVKA 2V4QA 1TL5A 4OYMA 3RB4A 2FLOA 2B4JA 2ALYB 2KHOA 2BA9A 3MM7B 2DNPA 4UOCA 3PW0A 2G8HA 3GFXA 3KG0A 1R27B 4O3QA 3QIDA 3H6EA 2ZF5O 2VC0A 2AJ4A 5B0EA 3OTOJ 3RMBA 1BDGA 4WFBL 3HFZB 3JAMO 1B7YB 2PO4A 4CHYA 3THVA 1TP7A 2BJ7A 2CQDA 2GAGC 4HWIA 3FSYA 2VG6A 2IVFB 4DU8A 5AJ3K 4H0OA 3V6DA 3ZSQA 3PZPA 2CPHA 2ZD1A 1WC1A 2W9AA 1FRKA 3M6GA 4LRDA 5DLFA 3HSCA 5A6PA 4CO1A 3R27A 4EBEA 2CJYB 3OS1A 3WBZA 3VHQA 2OD6A 4L72B 4B3MJ 3HPHA 4Z4HA 2DEJA 4CZJA 4FP9A 2OZMA 5LSOA 3IAM9 3VGLA 3MM6A 2MXYA 3H20A 3QWPA 5K8OA 3PW4A 1BOTO 2DH7A 5C25B 2RJZA 4BRHA 3UNYA 3THTA 2DFFA 3MM9A 1U2VA 2XMJA 1JKHB 1N36J 4AM6A 2AU0A 4DV0F 2MLYA 3CMAS 4LFAK 4F4YA 4BQZA 4C3KA 3KLEA 2DGTA 4JI6K 4X64F 4HLBA 3HX9A 3NOCA 5DZ7A 3R5AA 2R2SA 3H40A 1M90T 1QSSA 3VQ4A 1MU2B 3OVNA 2BBEA 4HT5A 1FKPB 3U3GA 4NPOA 5BREA 3HD2A 2GQQA 3WHIA 4ED5A 4OGEA 3TUJC 2C28A 5BYQA 4A48A 3X1LB 1BWFO 5B0BA 5L46A 1Y11A 3CCLN 2G2ZA 3RMAA 3QQCD 1HW8A 4WP3A 4ETZA 4DU7A 2Z1GA 3U4LA 3OYLA 4M63A 3ADAC 1QAIA 4B9SA 1RCOB 2DH8A 2FDNA 5KFDA 2DFHA 1HBMA 3U6FA 2A2DA 3CJ5A 4ZIWA 3CJBA 3F41A 3W66A 1QTNB 4KHWA 1OS5A 4U96A 4M41A 4KGMA 5KFKA 3KMQA 4OKKA 2UUCK 1U7LA 1HWLA 1FO1A 4JI7K 2ZDPA 4YQWA 5HMYA 3CHWA 5IM0A 2E5LJ 4BHQA 4X4QA 1TAUA 4AT1B 3RRGA 3DWLA 4ZLJA 4DBQA 5BR9A 4HTJA 2IIRA 4Z37A 4O3RA 5HQMA 4OZ5A 1QZ6A 1I3OB 1BIUA 3IAYA 4LUBA 3E01B 3C94A 3BR9A 4DUZK 4H4MA 4HUEA 5LSRA 1S7HA 3IXQA 3KFWX 1SKWA 2X1BA 3T9ZA 4OYZA 4XDCA 4CT8A 4A8WA 4X84A 3WX8A 3BBFA 2ZNZA 2ILZA 2GZOA 2BQUA 3I8DA 3GCXP 5HRSA 2Y9HA 2OANA 1WEYA 1N5YB 3W64A 2IM3A 4F4WA 2WBMA 3N6LA 4Z4GA 1NNDA 2RU3A 3OXLA 1Q0NA 5BYRA 5KT2A 2G13A 2D9PA 3FUYA 2KFNA 3UDEA 1Q4RA 1UVKA 2JNJA 2DXFA 2L41A 1RKIA 3RW7A 3CCMN 3C7NB 4JRQA 3CCZA 1N36F 4FLXA 3EXCX 2XSJA 3MDFA 2YQ3A 3BQ2A 1YITS 3GONA 2PSZA 2D3OR 3WNGA 4P72A 1JX4A 1NK7A 2XHWA 5KFOA 3BB5A 3OTCA 1TFWA 2ZUGA 3QIPB 2O8FA 4ZCKA 2ZJPL 5EGYA 3IUCA 4W5TA 3NMRA 2XI2A 3MECA 2DYAA 1OY9A 1LOUA 3W9JA 5K20B 2CQBA 5DDQC 3VEWA 4ECZA 4TKTA 2CQGA 2F8MA 3O1WA 2ZOFA 2VICA 5KT4A 2Q79A 4JN4A 2DRDA 2ZH5A 5BN9A 5AZIA 1S9EA 3ZFVA 4BVOA 4BS2A 2HG4A 2EXUA 2QSFA 4ECQA 1SC4B 1QAJA 3AD7C 1UFKA 2B4VA 4B3SJ 2UXCF 3PLAA 1D8ZA 4NRUA 2GX8A 4C98A 2OFGX 1WSEA 4KTQA 3CJQA 1W2IA 3I31A 3HVTB 6AT1B 5BR8J 3LP0A 5BRHA 3G82A 1JLGA 3J7A1 1ZM2A 1RILA 3AO1A 2P6TA 4GVEA 3OUYA 4IG3A 3N0VA 1T7PA 4KPCA 4BRAA 1LCUA 2HSEB 5DQHA 4B9VA 1U0HB 2K3KA 3BZQA 3E8OA 4CEBA 1T05B 2BM0A 4JD2A 2HHUA 4H0TB 4QAGA 5JLFA 4DZDA 2NUBA 1RWXB 5EN1A 3W60A 4YR2A 2BZ2A 1PJ7A 2F1FA 4QS7A 4GKJF 1AROP 8AT1B 2JOQA 4WU2A 1KHVA 2QMXA 2FZCB 4LH5A 2GVZA 4M7YA 2DFEA 3TP2A 1HR0J 1GXLA 2OFHX 3HK2A 2CQ3A 1EJ7L 1TAQA 4U9RA 1RGVA 1S0NA 4BRNA 3PRVA 4MFBB 3OBWA 3SBTA 3O3GA 2P9IA 2VUGA 1JCGA 2ZM6J 3M2VA 5J2MA 1E4GT 4KFBB 2XO7A 2Q6BA 3V9XA 1FHTA 2EFNA 3DNCA 3UI3A 3MUMP 2V6AA 2C3YA 1JMTA 4DS4A 5KTQA 4CK1A 3IR7B 3JAMU 3QRRA 3ZX0A 3H1VX 2HHXA 2RE2A 3OS0A 4JI2F 1JLEB 3HHNB 5JVGQ 3OD2A 1PJ5A 3FFIA 5AXMA 2EG2A 4XTTA 3T6JA 3CGIA 1PAUB 1NMDA 3TR5A 1NDLA 1W97L 4WFYA 3KLVA 2J5AA 1HHSA 3NWGA 2J6SA 1R8BA 2EC0A 1VHXA 4IH5A 4FW1A 2CNOB 2W2NP 1CZBA 4ICLB 4XH4A 4IUFA 1SI9A 5FROA 3UVJB 2YVSA 2LU1A 3V1RA 2RF2A 2G1HA 1G7CB 4E0DA 3PFOA 3M30A 3RAMA 4FOEA 2J8SA 2YX4A 4FF1A 1Q81T 4CJKA 3QNWB 2ZBRA 1ZM4A 2JZ5A 3X3UA 1ATRA 2YKMA 5KFYA 4CGFA 4Z7CA 1N33K 4DR5F 3MXMA 1U48A 4Y00A 4WQ4C 4YR0A 4O4GB 4H5VA 3MDQA 2KW4A 3D28A 2HQGA 4EAHD 3CB4A 3HSJA 4B3RJ 3ETOA 4I0WA 4DR7J 5F41A 1AZSB 2B5JA 3VGSA 4WBFA 1TK8A 2MKCA 4I69A 1D3WA 4UZBA 4DL5A 3CCTA 2EI5A 4LFAF 4DPWA 2POKA 1R6VA 1HQUA 3DYAB 2RIJA 5M2PA 1JLAA 3L3UA 3KLGB 1RADB 3H7HB 3O2IA 4L75A 1A6LA 2QM1A 1ATNA 4BGBA 2V50A 4M5MA 3HSTB 4ANEA 3CSKA 3FQLA 1YTUA 4W98A 1NKEA 4DR2K 2N7CA 5L9XA 5KFBA 2B0GA 2DNKA 3M8ZA 2DNNA 4YR3A 1ZXOA 1TL1B 2IA0A 1IKXA 4IQXA 3UD4P 5BR8K 3ENOA 2OTJN 2CQIA 2XQCA 2GUPA 4EZ9A 1FFSB 1FRHA 1RBSA 2ADCA 1FXRA 5LMUF 1RBTA 2NXUA 2RUSA 2QLWA 3SSRA 1RT3A 1W2BM 2MZQA 1FESA 1SXLA 4KB0A 2J7KA 5DS7A 1OMSA 4CLZA 1MWYA 3QBXA 4DV5J 4USTA 2EPIA 1YZ7A 2J0XA 5GMDA 5ETLA 2ASDA 4KSEB 1REGX 5AE2A 4CJWA 1T11A 3A1YG 5M1KA 3AO3A 1T03A 5K8MA 1HL6A 4DV7J 4OYXA 4TY8A 1NH7A 4KKOA 2FGCA 1H38A 3D6RA 2JJ4D 2OP5A 2IAJA 3VALA 3FE1A 4YY3J 4CZKA 1GXUA 4CZCA 4USKA 3K7RA 3O9TA 2BQ3A 4DUYF 2QI2A 1HNXJ 1WAFA 5C15A 3QSIA 4K59A 3M8WA 4RJVA 3ZZRA 3PSFA 1HNWK 4ZJQA 1KD1O 3TX8A 1RTDA 3LAMA 1XQIA 5HO4A 4LF7F 5U47A 2DPIA 1XK8A 4LIRA 3NGRA 4EYHB 4DG1A 4JKGB 3BO4A 2RILA 4WWSA 3CCRN 3VQCA 3I82A 2HF4A 3H2UB 4JB8B 1S7IA 1VQ9S 3I56N 4RUCA 1IJJA 3N4QA 4LJMA 3MFIA 5AE3A 2YH0A 2PEHA 4E98A 4H5WA 3VAHA 4QS9A 4CO2A 3I5CA 1M5SA 1JWWA 2UXBF 3Q8QB 1N0UA 1HNVA 2V94A 2CXEA 2LFVA 4JI2J 3V4IA 3FZ2A 3PCOB 2VBWA 2Z2LA 3BGRB 3ZEUA 2MTLA 3NF7A 1TYQA 2ASMA 5H9EK 4UY85 4FJNA 2DGSA 5HBMB 3O5BA 4PG4A 2EBEA 3UW1A 2VU5A 1JNRB 3IS9A 2BQRA 1BC6A 4LVNP 3CCUS 1OPIA 3GLJA 5EU7A 1M5OC 2R7VA 3RMDA 4X65K 1NOYA 3BGFA 4O23A 3PO4A 4FM0A 1X4AA 2P51A 1VRUA 3FZHA 2DRBA 2HPUA 1FTCA 2D3O1 1Q8IA 4ZPBA 2FJBB 3T9NA 4NLYA 2QRRA 3SJHA 4X66F 2Q36A 3MMAA 3CQXA 2NRHA 2LQJA 4MIWA 2ALZA 1S1VA 1RBVA 4H5TA 3AJ1A 1NXIA 2JFDA 4CLTA 4A2BA 4EP4A 3SJJA 3D6HB 4RW4A 1FNMA 1S6UA 5F0UA 3D9BA 4ZDNA 3RG6A 1WC3A 3ZZYA 4AILC 1BIZA 4EMDA 3OW2M 4B3SK 4F8RA 4M42A 1GX6A 4FNHA 4ECRA 2G8UA 4WU3A 2VOPA 4IR1A 3Q8RB 2QA4G 3EYZA 4B9UA 4MKYA 2R7UA 1DEJA 1OSDA 2W2PP 4NYPA 3KJVB 5J2PA 3MN5A 4WK1A 1N5SA 4LF6F 3EEQA 4HDGA 3LW5C 4CJ5A 2NS1B 5KPTA 1EQMA 2H9ZA 4HHHA 3E51A 1ZYQA 3D0PA 4A61A 3SQGA 4JI1J 1WOOA 4KHYA 2HMIA 2B56A 1RAAB 4XEIA 3M3ZA 5CD4H 2QW9A 3D1OA 4M3RA 1QSLA 3A5OC 3UDLA 1VLOA 3LZJA 2VIHA 2AF6A 5IV3A 4P73A 1OH6A 4F3OA 4Z0UA 5L9NA 2PN6A 3S1TA 3QATA 4LF6K 4R0JA 5A6WA 2F7VA 2ZEJA 2X6SA 3D0IE 4FXVA 5KFNA 4K4TA 3GG4A 4P7TA 4B1YB 3QEPA 4F3MA 1MN7A 2HZCA 1B0PA 3I87A 4O3NA 4I9QA 1J5EK 2E20A 1RDAA 3AY0A 4QWEA 3QAEA 4QCLA 3VESA 5HROA 4P2MA 1U1LA 1Z26A 1FJGF 4DUTA 1HLUA 4BRCA 1AB8A 4JYAJ 4IDHA 1HBOA 4ILGB 1QQNA 4CJVA 1WSVA 1VAZA 4LF8K 2HFSA 4NCGA 4NXNJ 1S4FA 3HHKA 4AM7A 1UL3A 5D4OA 2UU9F 2M9KA 3MGJA 1Y00A 5A0YA 3NLCA 3PIOQ 3FGUA 1N33J 2HFVA 3NGYA 1VQLN 1PKUA 3ZZTA 5F8JA 1VQYA 2Z0GA 3AVNA 2GQ2A 1WHVA 4FZVA 2V2QA 3CERA 4IXCA 1Z4UA 1SKRA 2DY1A 4YB1P 1S77D 2B6AB 1RTHA 3I55N 1XUPO 4QR2A 4HACB 3DXSX 1AT1B 2YX7A 5D4PA 3DHXA 4DL3A 4DSJA 4KO0B 1BWEA 3N4PA 1N33F 3W2WA 3M32A 2BR0A 5AQWA 1TL3B 3G6EN 3I0RB 3T41A 2BTFA 4CK3A 4IDKA 5LMNF 4JV0A 3NH1A 4EZ6A 3ID6A 1URRA 8ATCB 4RWXA 3Q2SC 1UVMA 2E6LA 3THXB 1R0CB 4PR6A 4Y65A 4U7CA 4I67A 3DLJA 2O3DA 3PYFA 4QYRA 3UDCA 2OPPA 2DNGA 1YF5L 2UUAF 2YHXA 3LZIA 2Z1HA 4YHHK 2DNOA 3VGUA 2C42A 1TVRA 1RT2B 4L8RB 3EM1A 3G96A 4IFVA 3BQ0A 1Y0HA 3T1YJ 3EGZA 3QLHB 3D6TB 4TN2A 2IA6A 3K5OA 4NLSA 3MEDB 4EWTA 2QSWA 1F3VA 3J7ZO 5AZJA 2HS3A 4I6AA 3M9MB 1U26A 5K9FA 3ID8A 4F3TA 3L3CA 3OYHA 3ZYYX 4G3IA 2GGPB 2BV3A 4BC7A 3DM2B 2ZJRQ 5KPZA 1EHWA 1YJWN 1FKOB 5L8RC 3FZLA 5C7PA 3OTOK 4X66K 3J7AN 4CFBA 2VGMA 4ILJA 1T3OA 4ER8A 2HRYA 3CW2C 1KC8T 4P2XA 3R1LA 1Q7LB 2XMMA 4JI8F 3LO3A 1KHWA 5CZXA 2Q1NA 2DHHA 4ZVQB 4K4SA 3UB5A 2KXHA 2IBOA 4G1PA 3M7VA 1VYAA 1ZAVA 2NYHA 3NAIA 3ZZUA 3R5GA 1U1QA 1HHTP 5IS2A 4CJUA 3JQMA 3JTNA 3VF6A 2JX2A 4IH7A 3AARA 3HPGA 2MZJA 4BRIA 3TJAA 1WEXA 3ZSWA 3R1XA 1R6YA 3ZETA 1N6QB 1VQ5S 2FHMA 1TU0B 1RE1B 4G9ZA 4RZRA 3UD3P 3SI8A 2YQ0A 2CQ2A 3HLUA 2FY8A 1F60B 4NWBA 4OQJA 1BI4B 2M5YA 1NDPA 2I9SA 3S3OA 5E5NA 4CW7B 5JICA 2QE5A 3RAXA 5KRSA 3D2WA 3FSXA 4DR3F 2E2QA 3ENQA 2WB1D 3V9SA 2EHGA 3LP2A 2KFZA 1Q86T 4CZEA 4FJ5A 3SZ2A 3ZT2A 5RUBA 3R3TA 1UJ4A 1K8AO 4TU9A 5IT9O 1HBUB 1HRHA 5LMNK 1FFWB 2LQ9A 1P6TA 1BMQB 5HMXA 1VQNS 1LXNA 1VIXA 3JQKA 3ILJA 2IHR1 2KYXA 5ETRA 4PUOA 2MKJA 2JC1A 3SK3A 1NEEA 1VRTB 1N52B 4YP3A 4J9KA 3THYB 3LAKA 1V3RA 4L3KA 1FE0A 3M6XA 3O8WA 4ILHA 1WHYA 5A8RA 1IR1A 2AEMA 2EW9A 2IPOB 1CZ9A 1QVFM 4ZTFA 4L6V3 2JWNA 4DV4K 3T1HK 4NXNK 4LT6A 5B7WA 3HTVA 3O4QA 2Y1JA 4ELVA 1RAFB 4CGIA 4ED6A 3CD7A 4HCBA 3EE9A 4FJIA 5GMKa 4C11A 2DGVA 4ECWA 5D0RA 1LEOA 3CM6A 2FF3B 4K5SA 1VQNN 3NGIA 2IM2A 3HKWA 1A7GE 3LGHA 2RQKA 4JS5A 1DZ5A 4JK9A 4ZP8A 4CF0A 5D15A 1NB2A 4AQYF 1CQMA 1ROFA 2ZM6F 1L3TA 3GIKA 3T1HF 2O4GA 1X4HA 3EKUA 3IBCB 3VMFB 3BV8A 1YJ9N 1XI1A 2O8EA 4NLGA 5FLXY 2JVRA 4CZMA 5F8NA 1YVFA 2OAUA 2CDRB 3CMAN 4OHYA 4DMZA 3G8TA 3H2VE 4IFYB 4WPAA 1M5VC 3CJ1A 3VQ9A 5F8LA 4MYTA 1VQPS 4DL4A 3FR0A 1IWAA 4CE9A 3UKUB 4FBUA 3ILIA 1LWCB 4CJPA 3OFFA 4B3TJ 2P9PA 3EE3A 3Q8VA 3PJ9A 3DLGB 4ZLLA 3GMGA 3M05A 4DL6A 3J7YP 1FJGJ 2YH1A 3I0SB 2V7YA 3V9WA 3K8WA 5DG8A 2V8GA 5HVFA 2MZ1A 5KT7A 3QGGA 2JEJA 4LF8J 4BRGA 1M5PC 4CFCA 3O6QA 3H98A 5A8RB 5JMNA 1JJ2R 4A8XA 1KCFA 2WTUA 3ZTQA 3IFEA 3QGHA 3MFHA 1IWGA 1X60A 2EK6A 5F3ZA 4O3OA 1BU6O 1H2UX 3DC2A 2FHJD 1P9YA 3D54A 3R97A 3VAKA 3QFHA 4B17A 3W3SA 3UFCX 2A6MA 3LDOA 1UVLA 3KKSA 3KD5E 1VMBA 3ONQA 2EFVA 5H9FJ 3CCJN 3GJTB 4LSLB 3K0JA 2VC1A 2Z56B 2XWXA 1WUUA 4CEAA 1RLCL 4PXCA 1PSDA 1RTJA 1FX4A 1NGFA 2W2MP 4ISEA 5DJBA 2LQ8A 2WVBA 4AL5A 2D5RA 4JI0F 1RHMB 4C8NA 1XMOF 1WHWA 3KD1E 3EMTA 3W2VA 4DFKA 5E84A 1SKSA 1NJZA 3ULHA 5AE1A 5F9NA 4WZMA 2WSEC 1LWEB 4DV4J 1BI4A 3S3MA 2BVZA 2Q3SA 3KK1B 3OYCA 4OYBA 4PEOA 3L0QA 4P75A 4OI3A 2VFUA 3K0SA 3GFYA 1NK4A 4CZIA 1U2RA 1JXLA 1VQLS 1TL4A 4FZZA 3I8BA 3P8BB 4O8KA 3C8YA 5IQ6A 2NXCA 5GAHP 2GJFA 1DGKN 2YNFB 1KQSM 4ZHRB 3CDUA 4CEOA 2C2KB 1K73T 3DOMA 2BKPA 1Q16B 1FA0A 3EL2A 2Y1RI 1ATSA 3D1QA 1VRUB 1P27B 5AQJA 2J0QD 2RRAA 2MY7A 2DNZA 3JYTB 2MZTA 4DR7F 1WSRA 3KKFA 1XMQF 4F26A 2AEJA 1RDCA 3SCXA 2MDAA 4ID5A 4ZITA 1O51A 3MOJB 4AL6A 3MMJA 3ET6A 4UOHA 2AYMA 3UCGA 2R8GA 4CBXA 3QGPA 1LV5A 5G4DA 4Z4FA 4J9PA 1BHLA 4XPCA 4DR5J 1R31A 1KFDA 5K14A 3J80U 4MH8A 1N54B 3GZ7A 2V2KA 2N7YA 1SJQA 2LA6A 2H3EB 3TW0A 4FWOA 4NYFA 2R2RA 5CH7B 1HWUA 1RYRA 5J2NB 1LWFB 1T6DA 4FYYB 2YX6A 3CMES 3NE6A 4DV1K 3AVBA 4PABA 4XAKA 3JYTA 5KG1A 3AODA 3S9HA 5C24B 2RUGA 4ZA1A 2FLPA 2DPNA 3TTCA 3WQPA 2P5GA 3CFOA 3OXFA 5H1SQ 1LKZA 5BR8F 3CCEN 5D4NA 2NNWA 2W4DA 3DJCA 2P9KA 4IDKB 4ZVPB 1MWZA 3VVTA 1S22A 1PYTA 2PIIA 3Q8UA 5ADXA 4HHJA 1TL3A 1RWKB 4CM2A 2IAJB 3D67A 1AFIA 5KFSA 1CJKB 4KKOB 4RG8A 4CHNA 4FLUA 3TEHB 2ASLA 3AVLA 2UVWA 4IEEA 2HOEA 4WZQA 4FSVA 2QX0A 2VQEK 5L1JA 4AL7A 3OYFA 2AQ4A 1ASVA 2Y0SD 1W2BR 5EX5A 2IBKA 3BN4A 1V4TA 4HVJA 1RAEB 3ENHA 4K4XA 4DTSA 5D77A 4DX6A 4IOCL 4CZGA 3RBDA 2ASJA 1DJ0A 5T7LA 2F9TA 1NAQA 2KRBA 3OL9A 3RGIA 1GEHA 4DV1J 1BCOA 4F2SA 1HNZF 4RNFA 3HHLB 1HNIA 3THPA 2PYJA 4GKKJ 2KM8C 3EDRB 4OJ3A 2XS5A 1HJOA 4G1IA 2R7OA 4LSLA 4NCGB 2HVEA 3GFHA 4JV5K 1TL1A 3C0BA 4TU7A 2EC2A 4F0HA 3CC4S 2C2ZB 5KG7A 1P1TA 4KYZA 4FWRA 1ZOTA 3S7RA 1CBKA 4OX8A 1SUQB 4PG5A 3KLGA 4UZCA 1NGGA 5LMUK 4WFZA 2MYFA 4DL2A 3SUNA 5HL7L 4FYDA 1R89A 1DY3A 1E6VB 3SMZA 3KZBA 2ACYA 2V8VA 1IBLF 3TNVA 1Q9XA 2YWGA 4BC5A 5I9EB 1AZSA 4FW2A 4HH1A 4DV5K 1JLQA 2W6LA 5H9EJ 1HI0P 1SUQA 4LR9A 3ZSRA 4NLPA 5JJBA 3TTDA 4LFCF 2RB7A 3UE5A 2GMLA 1S99A 3MMCA 1GT8A 4NA3A 4ZVFA 3PTWA 3TSUA 4PHTX 2KT5A 3ATVA 1YITN 2W9BA 3TO8A 2YKMB 3THWA 2CPJA 2DK2A 4M94A 1QQOA 3O9QA 1U6BA 2DR9A 2HFNA 2HMIB 4IRCA 3TVKA 4NL5A 4AXJA 3HHLA 2P6SA 3SQGB 1C1BB 3ICLA 4U7BA 4FF3A 5L1IA 3KK3B 2X78A 3IBFB 5T7LB 2ASYA 2PE8A 3O1BA 1VQON 4C8LA 4YDUC 2X3DA 2NSBA 4K4WA 5J2PB 4I1TA 2AP1A 3CCUN 4USMA 4YUDA 2ZKUA 1YG0A 3AJ2A 5IT9Y 3GOIA 1K0TA 3EX7B 3PJXA 4PWUA 4E7HA 3F5TA 1FXDA 2JDJA 4GO7X 4DL7A 1LW2A 3JQJA 3W7BA 3WXIA 2HVZA 1RT1B 4NXMF 2MQ8A 3CCRS 3IP0A 4YDXA 3PW5A 1JLEA 1Y5NB 3AY9A 3EE8A 3FNNA 4BR5A 4TXSA 3UCUP 5JS1A 1S1VB 3M8PB 3LGMA 2WUSA 4DSEA 2C2RA 1XTZA 1LXJA 1EQ0A 4NOHA 2G9OA 4BE1A 3AVFA 2V68A 2G0IA 5GMEA 4DZ6A 1P1LA 1MWKA 1SQGA 1TKXA 3BKTA 3M2VB 3DRSB 4OI2A 1GMVA 4KI4A 5IWAK 1Q86O 4JI4F 2W6KA 1LOTB 1U1KA 2F3JA 3HI9A 1KDNA 2G4BA 4OFZA 1W25A 5ITHA 2KU7A 3IN5A 3WIUA 1TGOA 5L1KA 4A8OA 4C23A 2GVZB 4WQ5A 1ESVA 1OH7A 2UXDJ 3J80O 3CDEA 1G2EA 3THYA 4KH4A 4MT1A 3NHGA 1RHUB 1KQKA 1E4FT 2UVUA 4QW9A 4ES2A 3OJUA 3CG7A 1NDCA 1KTQA 2WCXA 1NGIA 3KDOA 1NNEA 2ZGZA 3ZTRA 4ATNA 4HTUA 3IMQJ 2RMLA 3N5BA 3ATUA 5F0WA 4AHRA 2ZJPQ 3ET6B 4DS5A 3T69A 3OUYB 1NJWA 2RD5C 1NSKL 1BA1A 1V6HA 2G8KA 1N5TA 1AW0A 3RRKA 2HHHF 2ETJA 2E2OA 1FD8A 2IVMA 3MR7A 4P7VA 4PG6A 1WKJA 4B9NA 1M1KT 3QEVA 2IOCA 3M8RA 1CULB 3IM9A 2MLXA 1SC3B 2D69A 2QV6A 3MEEB 4BGAA 1SL2A 1GOCA 1EWRA 2P1JA 4CGGA 1T3NA 3NOGA 3CPWR 1KLMA 1VIOA 2QO3A 5IOLA 4DV7F 3IBWA 4JKEA 5DGAA 3DU5A 2VYPA 3P4IA 4KV8B 3KVGA 2C2DA 1N48A 4KH0B 3MM8A 3C15A 2VF3A 1GLBG 2BJEA 3R2DJ 2M52A 3W62A 4KJIA 3GIRA 3HOTA 1WF2A 4LVOP 4O0JA 1LWEA 3WNEA 4KE5A 5AQTA 5AQGA 3CIPA 2LEPA 2OD4A 3W2VB 4K25A 1U02A 1H0HB 3NF9A 3RBEA 3C14A 3N01A 4PZVA 4C6AA 4Z2XA 4DUYK 1GMUA 2L9DA 3O44A 1WTBA 4RUBA 2I7PA 3MWPA 2HURA 4DWIA 2PMWA 3PX6A 2OPRB 1E6YB 2DTJA 3C7NA 3ZT0A 3CCVS 2ZHAA 4BQLA 4LFAJ 4RUAA 3GJSB 3O8MA 2G0CA 4I56A 2M0GB 4QIFA 2UUCJ 2UYTA 4BR4A 2HVHA 1FDDA 3HJVA 2CDQA 3OS2A 1F1BB 1RABB 4Z7YA 3WZ0A 4ZS6A 3MAAB 4FVUA 2M7SA 3QLHA 2DISA 2DGOA 1JLAB 1T9VA 2UZAA 1QZ5A 3LOUA 2CIMA 2FBTA 3W61A 1N5YA 2W7AA 4FXWA 2ATLA 3D3BJ 2MQPA 5B0CA 5I3UA 2RVJA 2MQOA 1GTHA 3I0SA 3LQVA 3EPIA 4ELUA 4JKBA 1HKBA 1UFWA 2I6WA 4ZCLA 1ZA2B 3MEGA 3DLRA 1RAOA 4AHTA 1ZBHA 3HVWA 1PBUA 3G8QA 1TUVA 2ZH8A 1HYVA 1DLOA 3NWRA 1HWIA 3N28A 1Z1ZA 4M5HA 2XZTB 1PG5B 4FYWB 3GG1A 1BCMA 3ZT1A 2AW0A 3UKUA 1YXQA 4DTOA 2UVVA 4DQPA 3VEYA 4W5QA 4JKCA 1AXQA 4KHPJ 3GYGA 4J9SA 1RBUA 4A46A 3M30B 3ZZPA 4EO6A 2E66A 2YPYA 3L4BC 3RWUA 4ISGA 1GLLO 2Q0UA 2HQIA 2PA3A 3UVJA 1NKBA 4TNOA 2F4VF 4J37A 3SNNA 4Q8EA 1UP1A 4ZPVR 1UW9A 2ITMA 4R5PA 4FJMA 2E5JA 2YY3A 3ELHA 4YB5A 4BRFA 2HAIA 3GIIA 4YS2A 4CF2A 4E1JA 2HFOA 1I94J 2RQMA 4QJVA 1PC4A 3SXLA 1N34J 1B9DA 4F2RA 2DR8A 1TK5A 4P71A 3AOBA 2KHCA 2ILYA 4I68A 4OZ2A 2D1CA 1A5XA 4B3RK 1H6KX 2L3MA 2JLGA 1NGBA 2NRWA 3H1QA 2AD9A 4K41A 1IBKF 3K9JA 2DCLA 2X74A 1RWVB 2NPIA 1MU2A 4OX6A 3A4TA 5AQUA 4Q43A 4BRLA 5M1OA 2FUG9 3GPAA 2P9IB 1FI4A 3C6UB 2RKIB 4E7KA 4UY8O 2PI5A 2RQCA 1BGXT 3H5SA 3OYAA 1VISA 2FJDB 1N34F 4W5RA 1H73A 4YHHF 1BO5O 3OFEA 4TLQA 4DU4A 4YOTA 2L48A 4HTLA 4JI6J 2E29A 4XK8C 3TYTA 2F4VJ 4KGVB 1WKLA 2H5EA 2AZ1A 4MK8A 2FYXA 4FXDA 3KUGA 4JLHA 1W7AA 2D41A 4CK2A 4E1NA 4J9OA 2NQPA 3NF6A 1RHJB 4YN3B 3IA0A 3CCES 4JD2B 5T7BA 1R7IA 2ROPA 1YVNA 4BLGA 1HBUA 3CE8A 5KFGA 3KUEA 2ZBIA 2YHWA 2DB1A 2MSSA 3QGIA 2RS8A 1HMVB 5KGXA 2IRXA 3OL7A 2P9UB 3I32A 1L3KA 1U49A 2ITGA 4CEFA 3HVTA 1S72S 2IS3A 3KJVA 4LF5K 5T41A 2KM8B 3FKBA 3H08A 5TKWA 1BHNA 4B08A 4ZPAA 2VQFK 5FPDA 1DTQB 2VWKA 2E2NA 2W4CA 3W63A 1YRXA 2APOA 1TKTA 3A5NC 4DV1F 1NGCA 4URGA 3QAUA 3PDNA 3QJLA 3OPKA 1OH8A 4JI5K 1VSHA 1PYSB 2IYGA 3H90A 4IBNA 2ZJQL 2KHDA 1N6QA 2DR7A 4X2BA 4OVLA 2IDLA 3PX0A 2OEMA 1GQEA 2HBZB 3B6PA 1CJUA 2FSJA 4QQBA 3VV2B 4DOZA 1ZBFA 1OIAA 3UWTA 3J8AA 3PM9A 4DHYA 3WNHA 2HBRB 1NK5A 3O3HA 4MYUA 5IWAJ 2P9SB 3BO3A 3OHRA 1RSCA 3BQ1A 3KHLA 3PY8A 4ZLPA 3MX5A 1T95A 1HNZJ 3QSYB 1WAJA 2WTFA 5SZTA 4TYAA 4F0KA 1CG2A 5A2QO 3IS9B 4H0XB 4GVMA 2XSJB 3AVMA 2CWKA 3NXZA 1FNOA 4IOAL 1QQCA 4CLYA 3NGKA 5KG2A 1H1VA 1TYQB 4CCHA 1T94A 1NB7A 2DXDA 3CD0A 4OYOA 3AA9A 3PG9A 1L3SA 2OH2A 1RBLA 4CJQA 4X64K 1EWQA 2XHCA 2EFPA 2RDDA 4PQUB 3J80Y 4FS2A 4OX7A 3BM7A 2F8SA 1NCLA 3CD5A 4ZPTR 2HQDA 1RKJA 3UKRA 4CF9A 3PUFA 4NLXA 2K8GA 3R6GB 4H03B 3TUPA 4FVMA 1T9WA 4DG1B 4RW9A 2GMJA 4QOTA 2CNNB 4RNNA 5CCLA 1VSDA 3ZNUA 2EX3A 2WW4A 1T3VA 2WW8A 3HFVA 2HHPA 3UN5A 2VKZG 4JYAK 3THXA 3VCDA 3M2RA 1JLFB 1NBWA 1VSJA 1VSMA 1K9MO 3E01A 3FRZA 3MWTA 4WP8A 2ZWOA 2MKIA 2ZDOA 4CEEA 3H3NO 5LJ5Y 3GSIA 4B3SF 4PKIA 4HI1A 3KHYA 5CYMA 3HULA 3HZEA 3GYXB 3K5MA 2GMHA 4DFPA 1J53A 2V69A 3WXLA 2CGKA 4I4BA 2R3VA 2KXFA 2W24A 3NCQA 2B9WA 2MQQA 4LD0A 3DU6A 1RZMA 4BR9A 2HHWA 2IM0A 2HQCA 3B6BA 3K8VA 3BO2A 3LF0A 5CZ2A 2NSCA 4DQSA 3FC9A 3DXMB 5EY4A 4H0VB 3CJ2A 2OYQA 3AXKA 2WSCC 2PC6A 3M8YA 3ISND 4C7QA 1NJXA 2NPFA 5GAGP 3KNGA 2O8DB 5KG6A 3IGNA 4O4RA 3VQDA 4NLUA 2HBKA 3EICA 4MO5A 4A5BA 3J81j 3EY1A 1PILA 2VWBA 4WFXA 2CJQA 1T8EA 3NKYA 4QYZJ 3QEIA 3MXHP 1KVAA 2LXIA 5KFVA 1Q8LA 3BZCA 2AT1B 5CR4A 1NMEB 1KOOA 2NXJA 2YKAA 4CIOA 3BSNA 1U1PA 2A0FB 2RAQA 1NZAA 4BRQA 1UA0A 3BYRA 4LR8A 2BKOA 2W01A 2LU2A 4OI4A 2CJXB 1O5JA 4F9OA 4FNIA 1NRKA 2OI2A 2LQ5A 2PFFB 1NGJA 1YTAA 1YWXA 1WKKA 2GAHC 2DT9A 3HO1A 4N76A 4FWMA 3G6YA 3FLCO 5AQZA 2QWLA 3AVJA 4NCAA 4W5OA 3RR7A 2VL1A 3QEWA 4JI2K 4FL9A 3MM6B 3Q8YA 3L2WA 5IZHA 4BC4A 3POTA 1PO6A 2K1RA 3EXYA 3DXKB 4RU9A 5AXLA 4HUGA 4OX9K 1BQXA 3FZBA 3QPIA 1MW7A 4EHUA 2KXNB 3E9LA 3CF5L 2FVCA 3TI0A 3LANA 3A8EA 3ZTSA 2ZH6A 5KOWA 1S6PB 2Q66A 3PJWA 1VLYA 2OCEA 1RBRA 3FGVA 4OPKA 4HKQA 1YKWA 2ZD1B 3AVCA 2V67A 1Z6RA 3V6DB 2IDOA 5HK4A 5BJRA 4RCHA 5HQ8A 1XC3A 2IYIA 2X51A 4Y0WA 2N82B 3BPDA 1ICEB 3LGNA 4EHTA 2FJAB 4CD3A 4FJJA 1CVJA 5IT9U 3FFIB 1QQMA 2HHHK 2BX6A 2NXNA 2O5DA 4DQ8A 1CEZA 4RW4B 3KMSA 3I5BA 4ED0A 4GVLA 5C10A 3U9DA 1FK9A 2EEYA 3IO1A 3IWXA 3RW6A 2KB2A 3DCAA 2HGLA 4N5SA 4NXMJ 2A41A 1BE4A 3DLEB 4OPHA 2QMWA 5KT3A 2QTWA 1YJ7A 3GE9A 4DV6K 1NGHA 2CQPA 4KFBA 1KLNA 3MMBB 4B3OB 1FRIA 2IVPA 2FVPA 4Z4IA 3BBBA 1SQEA 4OLPA 2BUNA 3MPYA 4ZCMA 3A5MC 4RW7A 1HD0A 3VEVA 2JL9A 4KTWA 4Q44A 2W42A 4FK2A 1UAWA 1VJQA 3US5A 1JLCA 1EO1A 1J5OA 4H54A 3CETA 3MN6A 1YZ6A 3P96A 1YJRA 3JTPA 5M2RA 1GK8A 1NMNA 1XNRJ 3SCIE 2KL8A 5BRFA 1RXOB 2QA2A 2VD3A 4BC9A 3AO2A 5CY4A 4GW6A 2V34A 2J9DA 1VBKA 2JEGA 4U8YA 1QE1A 4G1QB 2YWWA 2WC9A 1NK6A 3TPQA 2KRRA 3FBBA 1TV6B 4U95A 3BGOP 3QT6A 4JHDB 4CI6A 2D3UA 3TABA 4IJNA 1Q7YO 2EFOA 5ETPA 3HCXA 4YEAA 4WFBQ 3KWIA 3EDQB 1KVJA 1OWXA 4NXMK 4JV5F 3EUNA 1N56A 3AA4A 3LP0B 1LFWA 3R6LB 1WSIA 4OZ1A 2D0BA 3NH0A 7AT1B 3DRRB 2XMAA 3VAGA 1RTDB 1T9YA 1HHQA 2RRNA 5AT1B 1EP4A 3NCPA 2AV5A 1ZBUA 4V19S 5EWGA 3SUQA 1BISA 4JI5J 5C2CA 2WVEA 4TQRA 2EFGA 3VAFA 4B1XB 3CD6N 3N6MA 1P90A 3VA0A 2KLAA 2LKZA 2DNQA 2GBZA 2A1BA 4JI7J 1A5VA 3GL1A 3FQKA 4Q5VA 2BKNA 4CLFA 2PMHA 4EYIB 1HKAA 3EN9A 4ECUA 4BC3A 2EFQA 4PWDB 3AQPA 4AHCA 1IBLJ 3CC4N 4CEZA 1EX8A 1WI6A 5I4MA 4CF8A 4OHVA 5BYSA 1RT5B 3MHYA 2W9CA 3FCWA 4FN5A 2MQMA 3PKMA 2DBBA 4DV4F 3KHHA 5ETKA 2P8IA 3RVCA 1UZDA 2V8DA 3L8BA 3OXGA 5C2DA 2V2ZA 4DCOB 3BSOA 3TA0A 2OO4A 4Y2MA 2Z58B 5AQHA 5KT5A 2CJKA 1OSCA 1ILYA 1CC7A 3MN7A 1OH5A 3O4NA 5F8HA 3MR6A 4WE1B 4B8AB 4DQQA 4Q0BA 3FCVA 1M5KC 4K7QA 4X66J 4LFBK 4L73A 2YWFA 1HYSB 3M6VA 3EZUA 2GWJA 3BYPA 2V8PA 2CGLA 4QS8A 3UR0A 4BCAA 4B3MK 3VWSA 1FRXA 3UN2A 2B5JB 5KQ8A 3BSAA 3L2UA 2ZC4A 2EWSA 2ASPA 1RK8A 3NDKA 3F9MA 2HHTA 3MAQA 4FWNA 5GAGI 4CTAA 1N34K 2HQ3A 1TK0A 1X9WA 3ULEA 3OTDA 1KXPA 3H4BA 2HGNA 5C42B 1CXQA 4CRJA 5IM0B 1P9QC 2DJWA 2B7BB 2L9WA 3JS6A 1XMBA 1DTTB 2VG7A 1RACB 3CC2N 4UQTA 2EKNA 4OJHA 4M5DA 4QWCA 1X4EA 2HBJA 2IFXA 1QVGR 3V6HA 2XGPA 3O6WA 5JMVA 2R2TA 1HBMB 4HVZA 1RHQB 4PG8A 3HI0A 4ZN3A 3BSCA 1MWMA 4JI4J 1Z05A 5D0HA 1I51B 3SUPA 2HNDA 1T0TV 2VDHA 4CQ1A 3ULEB 4QR0A 4BRPA 4LF2A 4CP5A 4ZCIA 3C46A 3M8QB 4YOXA 4DR3J 1V5IB 1D09B 1YLXA 3AA8A 2A3ZA 2NRRA 3AD8C 3K89A 5DDRC 2YNIA 2HBQB 4WQ4A 1X5OA 3F2KA 2VFSA 5F0XA 3CCVN 3TTFA 1HI8A 1TKZA 2BUPA 1JKHA 1YUWA 3ITHA 4CJ3A 4Q0BB 2ZOMA 5HOOA 3PR5B 1UKUA 5C25A 1O0PA 1NSAA 2HSTA 2UXBJ 4QWDA 1F9HA 4GV6A 1V3SA 5M1PA 2L08A 1Q82O 2E1PA 2EKYA 1YIJN 2M8HA 2RU9A 4JYAF 4MK9A 1UJ6A 1IG9A 1U0HA 1RDBA 2DKOB 1NWKA 4DV2F 4KB1A 1FJCA 3MCSA 2ROEA 4L76A 1U1MA 2R7XA 4HUFA 1JLGB 5JVHQ 3R8YA 4HHTA 1MA9B 3JSYA 4CHQA 1CPZA 4DKWA 4DXLA 3ETMA 3PRBA 1S6OA 1KOHA 1YHQS 1YSJA 5A2QU 4DTMA 4B3MF 3QNOA 1WNSA 2VWJA 3R1HA 2UUBK 3TA1A 3BGLA 1NU4A 2IMOA 4BBYA 4RWTA 4F04B 3DDKA 1NK9A 3VGVA 4X4NA 4NZ0A 1S9FA 2XS2A 4JOUA 2JC0A 2DXEA 2OIHA 2FXUA 3LALA 4OI6A 2LCWA 3V9UA 2WFBA 5M2UA 5D3GA 4NASA 1Y5LB 3MCAB 2QLBB 4LQ3A 1EP4B 3IWNC 4DL0C 1RP5A 5KG0A 1ZAWA 1YJNS 2BEFA 5KI6A 4CEDA 2YXLA 3WT0A 4P9SA 1VGYA 4GVBB 2I1RA 3B78A 1VQKS 4F02A 5KFLA 1E3MA 2AX1A 3MN9A 2GHWA 3TZZA 2D0OA 4PYDA 4I64A 4P52A 2JGUA 2YCHA 1NLKL 3KLHB 3VVUA 1HNWJ 1N8RT 4B02A 4BE0A 2LQBA 4DN0A 1WB9A 2F9WA 5J1EA 1OYDA 2E7XA 5FLXU 1GLFO 3QRPA 1WELA 2CPYA 4E19A 4FZYA 4GKJK 2C2OB 3DRXA 4OLBA 3S3NA 2HVDA 1WEZA 1SIWB 4J90A 4I2QA 3SMSA 3NGUA 3T19A 1K1QA 2FB0A 2P9GA 3CCJS 4AXIA 3QBCA 1Q81O 1RT4A 3CJKB 2C2NA 4IO9Q 2NCKL 3ENVA 3EVWA 4UTGA 5HMZA 2JLFA 2YNIB 3DMJB 3NMUA 3B8AX 4KHPK 4KAZA 5BN8A 3PW2A 4EK2A 1EXQA 3TZWA 2LXUA 2E44A 2LA4A 1YJWS 2I5JB 1KVKA 4ECSA 2J76E 3LH2S 4UUWA 2BH1A 1XHXA 1KBRA 4CH7A 5MLCQ 3O3FA 1XERA 2QWOA 2HNDB 4CNZA 3JAMY 4LF5J 4G65A 1FJ7A 1PGZA 3W8PA 1HBNB 2YQ1A 1NJIT 3EZ5A 2QJ3A 1YJUA 3G6ES 3NFAA 5EWFA 4DPYA 2VG5B 4DR2F 1MMLA 1BQNA 2F4VK 4ED1A 5LL6d 5BXIA 3HT3A 3IG1A 1VQ7S 3K9KA 3KHGA 4IRKA 4M45A 2KTQA 1S76D 4JV2A 1DTTA 4UW2A 1H3DA 1K8KB 4DLEA 4K2JA 3VQ5A 1UVNA 4O8UA 2FBYA 2WB4A 1LAWA 5C12A 2UXCK 1I6JA 3A8IA 2ADBA 3NGTA 1C4AA 2R8HA 4HTIA 3SFUA 4CGJA 3BDEA 5FPMA 1BXNA 1R8AA 4RW8B 4UY8T 4WXOA 3A3OB 2RDIA 4D3GA 4N8OA 1UMJA 2DGXA 4ID8A 5ETVA 2E5GA 2BXJA 4CJTA 1LWXA 3MD1A 3AHPA 5HJXA 2CPFA 5ELZA 3CJSA 1HYSA 3CMEN 1YBAA 1U2VB 2E7VA 3C6HA 1PAEX 3FEYB 4FDFA 4DUZJ 1X0FA 3G8SA 3LWMA 3QERA 1MG7A 3VQAA 4CYUA 1TL7B 5KFZA 4DTJA 1GLDG 1FVSA 5AR0A 1IVZA 2YNGA 4JP8A 2NREA 2CRLA 1RWPB 1RLDA 2QLXA 3DLBA 3NGDA 5HN0A 2D3ZA 2QL7B 2IDEA 5HP1B 3I33A 4ALZA 2WRMA 4J2EA 3TVZA 2W9CB 2C3PA 1A5WA 2GJIA 4N56A 1NGAA 4IJAA 3W5YA 1IN0A 2FJEB 5KFAA 4CM0A 1VQMN 1IO2A 2VG6B 4WTOB 4EEYA 3A0IX 2WAQD 4DLGA 1OQ6A 5B09A 2IMWP 1DKGD 3NP5A 3MEKA 3R9LA 2QT7A 1HBNA 1T44A 1VSEA 5E33A 1Z2ZA 2QN6B 3NBPA 1BWVA 2B7CB 2V4RA 2VBZA 1C0GA 3GP9A 4F67A 2LVWA 4DPUA 3IFRA 2KFYA 2QXLA 4X4OA 1CS4A 2FIUA 4K42A 4QYZK 1W0HA 4RTFD 4CGDA 5CAAA 2CH5A 2E9ZA 3NY0A 5KG5A 1UPMB 1EARA 3MCNA 2AP6A 4KQZA 1WSFA 4IR9A 1VQMS 4P2SA 4H8KA 3UKRB 2K2PA 3A13A 4HI2A 2D9OA 4BWJA 1QM9A 4KRWA 4LF6J 3D45A 4I2QB 4BR2A 4PQUA 4QOZB 1UWBB 1X4GA 1JLBA 3UO0A 2H1YA 1Y10A 3SDEB 1HKCA 2VGNA 3TJ8A 1SVDA 4OZNA 1J5OB 3IR6B 3VPZA 3LDSA 2QIFA 4CIEA 2LDIA 4S0MA 2MPUA 2GS8A 4AFFA 3KUHA 2LLZA 1IBMK 1XJWB 1L5UA 4RW7B 4CJSA 1RA7A 2AGQA 3V5RA 2FVSA 3GIJA 4RUHA 3TRGA 4X65F 1KKHA 4F36A 4USWA 4DSKA 3I56S 1KD1T 2RS2A 3DLEA 5T14A 3P83D 2WBRA 1YAGA 4OYAA 4CJEA 2F7TA 2VQFJ 3OYMA 5E3CA 2A2CA 1D1UA 3AA5X 1GX5A 1R59O 3HVRA 4X4PA 1GNKA 1DT9A 4FJGA 1M0SA 4F7VA 1QHTA 2QL5B 5JVGL 1C0TB 1NGEA 2Q0RA 1Q5VA 1RHRB 1NO8A 1GMWD 5KAKA 5F3TA 3DOKB 5JLHA 1RU1A 2W2QP 5KFEA 2ZZTA 4C8OA 2W2OP 3MPDA 5F8MA 3G4SS 1OY8A 1S6PA 4YB7A 1IBMJ 3CDBA 3BZKA 4RW6A 5HP1A 1RHKB 4BWMA 3VTIA 4N7TA 4NLT<