1QE1A

Crystal structure of 3tc-resistant m184i mutant of hiv-1 reverse transcriptase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE, SUBUNIT P66
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 121
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1qe1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qe1A05
4YMEA 4HCCA 5KG6A 4CJEA 4K4YA 4BE2A 4TN2A 1ZBUA 4H8KA 2XI2A 3SQ4A 3Q8SB 3BSNA 2W8LA 4AILC 4IG3B 4EYIB 4DU1A 4DLEA 3TANA 3AVHA 1LWEB 4K4ZA 2FJVA 4NYFA 2FVCA 3O3GA 3NBPB 1FKPA 1JLAA 4KTQA 4LSNA 3NGDA 3BJYA 3V6KA 3PHEA 4DFPA 1RBUA 4Y3CA 4ZP7A 4E89A 1RYRA 2IM3A 3NDKA 5KFWA 4O3PA 1T05B 4CJ5A 4J9NA 4K4WA 2ASDA 3C6TA 4FLZA 3QO9A 1D0EA 3LALA 4E7KA 1U48A 1J5OA 4RW6A 3KHRA 3TQ1A 4B9TA 3KLIA 2FC0A 4TYAA 3F9KA 3BREA 2GUIA 3AVBA 1TV6A 1T03A 2W7PA 4NCGA 5DK5A 4ZP9A 4F8RA 4TQRA 1G15A 4PWDA 1K1QA 4DG1B 3QNNA 3V9SA 2WK4A 3DOKB 4E0DA 4WYLA 1RA6A 5F9NA 3QZ7A 4ECVA 3K2PA 3NF7A 5DQIA 3KLEA 4M94A 1WSHA 2OH2A 4J2DA 2NUBA 4ECRA 1IO2A 4CHZA 2DFEA 4URSA 2FBTA 4IH7A 3GIIA 4IFVA 5C24A 3OYCA 3PW2A 4C8LA 4ECSA 3HVTB 4DL6A 4CHPA 1I3AA 3HT3A 1RT2A 4Q0BA 3E01B 2G8FA 3BSCA 5KFIA 1TKXB 1IM4A 5HROA 4CJSA 3LP0B 1S1WA 3DLHA 3ZT1A 2VWJA 3O4NA 2W9CA 1BISA 3HVRA 4CERA 2YNFA 3AO1A 3UDLA 3NMAA 2HHWA 2R8JA 2QK9A 3NF9A 4IFYA 4IH5A 4PUOB 2IM1A 4FJ9A 1Q9XA 3AA5X 3HPHA 3SI6A 4ZVFA 3L2QA 2RDIA 1F21A 3DRSA 2G8IA 1SV5A 3Q8QB 4NCBA 4TLRA 5F8MA 4B08A 2V9WA 3PW5A 4OVLA 2YNHA 5KT2A 4EO6A 4L8RB 4AHTA 1REVB 5KT7A 5KFPA 2KQ2A 3M8SA 2HHXA 3AA3A 2QXFA 2JEFA 5KFCA 4FJNA 3CJ3A 1SH2A 5J2NB 5F8GA 4F4WA 3VQPA 3UQSA 3MAQA 3F73A 1S0MA 4K4UA 5EUHA 1HQEB 5KFSA 5DLFA 1HYVA 2E4LA 2J6UA 1U04A 2G8KA 3KK2A 1XHZA 1MU2B 2DPIA 3G0ZA 2OPQA 1TKZB 4DSFA 3QIDA 3CJ2A 5KGXA 1NJWA 5HRSA 1TVRA 3NGZA 3MEGA 4CGIA 5J2MA 3RWUA 2WOMA 3NE6A 2Y1JA 1N56A 5KFXA 4LQ3A 1C1BA 1IKXA 4CJTA 4J9RA 2V4QA 4OL8A 3BSOA 5DGAA 3M8PB 3CIZA 4FBTA 3D0PA 1B9FA 2UVWA 4JV0A 3BSAA 4NZ0A 3KLFA 4FLWA 1NK6A 1C2PA 1NKCA 1JLFA 2R8HA 1HMVA 5C25A 4KAZA 3NH0A 3V9ZA 4CGHA 4ECYA 3DRPA 4F3TA 2VG5A 3SPZA 3M9MB 4ECZA 1NJYA 3QEWA 4LD0A 2ALZA 4KHRA 3B6OA 3BQ1A 4YNQA 1NK9A 4BE1A 4J9OA 3ZCMA 1JX4A 1JLGB 4C8KA 5F8HA 4C8MA 4GMJB 3HL8A 4M45A 5KFTA 1TKDA 1S48A 2YHBA 4I2QA 5KFEA 4E19A 3K59A 2GV9A 4KHQA 1S9GB 3L2UA 2D0AA 2VG7A 2XCPA 1J5OB 4HKQA 2IAJB 3HYFA 3MR3A 1Z25A 2GIQA 4W5RA 1NOYA 4WFZA 3MXIA 1W25A 4B9VA 1S1VA 4NCGB 3L2WA 4DL7A 2YNIB 2AGQA 1XWLA 4QPXA 4Q44A 1QSYA 3C94A 1Z4UA 2G8HA 1X9WA 3DRRA 2BRLA 3NCIA 4KRFA 1DLOA 3VQ8A 1S97A 5F8JA 1VRUA 1C0UB 3JSMA 2HHTA 1WAFA 4BDZA 3OJUA 3SZ2A 2UVVA 4QWBA 5KFVA 1BCOA 4F50A 1DTTB 2BE2B 1LWCB 4FVMA 1L5UA 3AVCA 1SH0A 2FBVA 3FSIA 3KJVA 3KNAA 3OYJA 4CEOA 1NK0A 4TQSA 3OL9A 4E1MA 4AHRA 2BANA 5K14A 4KO0A 3QINA 3UIQA 1RTDA 1GOBA 1RT4B 4X2BA 1RT2B 4RW8A 5CYQA 4LH5A 4CEBA 3VQEA 3DLGA 3RBDA 3L2RA 2D5RA 2JC0A 3BQ0A 5HROB 4CFCA 3QEXA 3TAFA 1TK8A 2YHAA 4NLQA 5KG0A 4R8UA 2BRKA 1S9FA 2D3ZA 1SUQA 3EPGA 1VK0A 4DTOA 4FK4A 2C28A 1S6QB 5KFDA 2BQRA 2HNZB 1T3NA 3OLBA 2BQUA 4ZPAA 5KFLA 2Z1HA 2DPJA 3CJ4A 4RW4B 2RPIA 4OPKA 3VA3A 2EX3A 4O4GB 5J2QB 4ICLA 4LSLB 1I6JA 4ED3A 1JXBA 2KZZA 1KHVA 4M41A 1L3TA 1XR5A 1RTHB 1UWBA 2XI3A 1JLBB 2AX0A 3IN5A 1S1XA 4KBIA 2V0NA 3G6VA 4WXOA 4CCHA 5KFBA 4RUAA 1HNIB 4DQSA 4DTPA 4Z4HA 3DLEB 2XWYA 1WLJA 3AVGA 4ZPBA 4DL2A 3PO5A 1BQNA 1TGOA 2KFNA 2JLEA 5J1EA 1ZBHA 1NK5A 2B5JA 1JKHA 4DSLA 3ZT4A 3QLHB 2DFHA 1VSHA 1WSIA 3OL8A 2IC3A 3CM6A 1S9EB 2HNYA 2F8SA 2Y1IA 3ULDA 3TAGA 2AGPA 5KFGA 3K5OA 4FZXC 4JUZA 3I5AA 4NLRA 1Q9YA 1U47A 4C8OA 2XY7A 4DF4A 1RBVA 1T94A 1RT6B 4RW7A 3V1RA 4FCYA 1XR6A 2W7OA 5HP1A 3NFAA 3MTKA 3CM5A 3CQ8A 4KFBA 3P1GA 4NRUA 4GW6A 1KRPA 5DG9A 2IA6A 4CJUA 3H4DA 1HMVB 3M8RA 5DG7A 4HUGA 5FDLA 4Z4EA 3T1AA 2R8GA 2GIRA 3ZSRA 3AVIA 5KFHA 1TQLA 2B4JA 3JYTA 1BI4A 4O0JA 4NRTA 3V4IA 4B3OB 3LPUA 4NLGA 4DTUA 1X1PA 2AWZA 3OLAA 4R5PA 1VSKA 4ZHRA 3LAMA 2G8UA 3OYBA 4MK9A 3KTQA 4KHSA 2UVUA 3MECB 1TL1B 4AHUA 4DSJA 4IR1A 2OPRA 4NLSA 3OSNA 1C1CB 3TVKA 3IRXB 1NHUA 4KREA 1JLCB 4JS4A 4ID1A 4ED6A 2HAIA 1IKVA 3LP2B 4BDPA 4XO0A 3RMBA 2FBYA 3NGYA 5E41A 1S1UB 1RT1B 3TAMA 1YVFA 1S49A 2OPPA 3ZT0A 3S3OA 1TAQA 3FQLA 1TKTB 3AVAA 5CZ2A 2OPSB 3TAQA 2XY5A 3VQCA 3H59A 3SUQA 3JSMB 1ZBLA 1KTQA 2GC8A 2HHQA 3THVA 1C0MA 3OYNA 4KSEB 3D5MA 4FJIA 3VQAA 3QIOA 5I42A 2R8IA 4B9LA 2VG6A 3KLGB 1RT7A 2ZE2B 3RB0A 2WONA 4KI4A 3CO9A 3KLHB 5HLFB 3EZ5A 3IGVA 3V1OA 4F3OA 2HMIB 4J2AA 3CYMA 1Y97A 3V81B 3G86A 2HVHA 5CYQB 1IKYA 1HQUB 4IG0B 3DOLB 1S0OA 2YKNA 4DMNA 2X6NA 3LP1A 2HWHA 3U3YA 2QV6A 1UAXA 4PY5A 1KFDA 4ECTA 5I3UA 4YP3A 4IDKB 2YKMA 4QW8A 2DTUA 5DLGA 2J6SA 3KLVA 4F2RA 4CJ4A 4OLBA 3ZSYA 2R2RA 1BQMA 5KG3A 3SPYA 4HTUA 1KHWA 3O3FA 3SFGA 2R2SA 4DFJA 4NYNA 3ICLA 2O4IA 3QGIA 4Q8FA 3H08A 4QWAA 3KD1E 4RNHA 1RT3A 5KG5A 4YQWA 1QQCA 1HYSB 4KB1A 4CGJA 4CF2A 2FVRA 1XHXA 4ED7A 4J2EA 1L3SA 3DYAA 2RKIA 3OYDA 3ITHB 4WE1A 4Q45A 3NF8A 4EEYA 4ZP8A 5JS1A 1LWFB 2ATLA 5KT4A 2ZD1B 4I2PA 3IAYA 4F4KA 2HWIA 4B9NA 3TR8A 1HPZA 1C1AA 5D3GA 1RDAA 5KFQA 1RDRA 3VQ6A 4F4ZA 3SV3A 3MEDA 4BWJA 1HNVA 4TY8A 3G6XA 3PY8A 5JXSA 4B8AB 1CSJA 1KVBA 1WN7A 3ALYA 4E3SA 2HNDA 3DI6A 1RTIA 4H4OA 3QIPA 1NKBA 2O5DA 3V6HA 3DMJA 4Z4GA 3IG1B 2W9BA 4O55A 1S6PB 2A1RA 4O3NA 1EETB 2WCXA 1BL3A 4CK2A 3IS9B 4FJLA 4ED8A 3MEEA 1VRTB 1BGXT 2B6AA 4CEEA 1LAVA 2Z1JA 3A2FA 5L9XA 3NF6A 3FDSA 4OKJA 1N6QA 4LH4A 2YV0X 3HVWA 4BACA 4ZP6A 2HHSA 3PX4A 2ILZA 3QERA 5CYMA 3S3MA 3RAXA 4MIBA 1RBRA 5FDLB 4QCLA 1QE1A 3I5CA 2KFZA 2W9AA 2PY5A 3PO4A 4KPYA 4YFUA 1RTJB 3I0SB 1FXXA 4FM1A 5KG4A 4WFYA 1JLQA 2IOCA 4I7FA 3HPGA 4KB0A 1EP4A 3ZSWA 4QW9A 2I5JB 4M3UA 2VWKA 3SI8A 3OHAA 3M8QA 4Z4IA 5FRMA 1S1TB 2O4GA 4KKOA 4MFBB 2RN2A 4AHVA 4JV2A 4KTWA 1C0TB 3C6UB 1ZBFA 1ZTTA 3QEPA 3KHLA 2AU0A 3NAHA 3FFIB 3BGRB 3OHBA 3OYGA 4M3WA 3RR7A 3DM2A 2YNGA 4KTZA 4FXDA 3K57A 4EZ9A 1D8YA 3KK1A 3V9UA 4O0IA 1JLEA 1MMLA 4Y1DA 4DWIA 3PR5B 5KFOA 4QAGA 2AGOA 4CFBA 3WNEA 4RW9B 4CECA 4DL3A 4G1QB 3SJJA 4GVMA 5C42B 5KRSA 1TL3B 1JL2A 1DTQA 4FM0A 1IG9A 5SWMA 2XHBA 4EBDA 5I42B 5HRPA 1XI1A 4DTNA 3DLKB 3BR9A 2RF2A 4CHYA 3GV7B 3K58A 1SH3A 1RT5A 4O3OA 4O4RA 1NKEA 4G3IA 4E7JA 5EDWA 4DFMA 1LW2A 3L2VA 2Q3SA 1IKYB 4Q8EA 3T5JA 2P51A 3LP1B 3EYZA 2PYLA 1FKPB 1VSDA 1JLAB 4H54A 4LSNB 1SKSA 4FS1A 4DTJA 4H4MA 4FJJA 1NHVA 4ED0A 2C2RA 2D0BA 1A5VA 4LY7A 5KGWA 4ECWA 3C6TB 3QO9B 1RA7A 1ZETA 3LP3A 4RW6B 2QKBA 3HVAA 1CXQA 3KLIB 4FJMA 1RAJA 5T7BA 4CJWA 4FJHA 3ZSQA 3KHHA 4CF8A 1U49A 2C2EA 4NLWA 1TAUA 1TV6B 1T03B 3AO5A 3ASMA 4Y2AA 3DLBA 4Y1CA 4PWDB 1FK9A 2B43A 3KK3A 5KT5A 4ID5A 1JXEA 4RNMA 4RG8A 4N41A 2ZQBA 4CJPA 4FJ8A 4I9LA 3GYNA 3GIJA 1B9DA 3RB3A 5DGBA 2X74A 3V6DA 3KLEB 4DQIA 3VQ5A 4O44A 5L1KA 1RNHA 4MK7A 1N48A 4M3RA 3OSPA 5KI6A 3ZSOA 4RNNA 5J2PA 1N5YA 3HHKA 4IFVB 5C24B 2ITGA 3HP9A 2OZMA 2BGGA 4Q0BB 1W9HA 5C5JA 4KE5A 4HHTA 3HK2A 2V4RA 2EC0A 4PA1A 1S4FA 4F2SA 1UOCA 1RBTA 4IKAA 1S1WB 4K8ZA 5T14A 4MK8A 2W9CB 5KFYA 3MXMA 4KHUA 4K8XA 2B6AB 4ZMMA 2YNFB 4CHNA 4IG3A 1J54A 5CZ1A 1FKOA 4CFAA 1LWEA 4IFYB 3I0RA 3KHGA 2UVRA 2XY6A 3NGIA 4BWMA 3AVFA 3O4QA 4Z4FA 1GOAA 3ZSVA 5KFMA 4FM2A 1CXUA 5EU7A 2IMWP 1BCMA 1BIZA 3DRSB 3D28A 1T05A 1SV5B 4J9PA 4DTXA 5KFJA 1L3VA 1ASWA 1RILA 2GBZA 2ZKUA 1EP4B 2YNHB 4RNOA 5KFZA 3SQ1A 1ASVA 4MQ3A 4JLHA 1KLMA 4OPJA 3SFUA 2D0CA 4IBNA 1J53A 2JEGA 4CESA 4FJGA 3LWMA 4DG1A 2R2TA 4KV8A 3CFPA 3DOKA 2IM0A 4JRQA 2VA3A 1SKRA 1Z26A 3KK2B 2E9TA 3V6JA 1GX6A 3SYZA 3GQCA 3TAEA 5HRNA 2OPQB 3U6FA 3PUFA 3HP6A 2E9ZA 4WFXA 4YR3A 4N5SA 4CJVA 1U4BA 2D41A 3KK1B 1TVRB 4K4TA 4F4YA 1WNEA 3NH2A 3MEGB 5J2MB 2WOMB 1XC9A 1HJRA 4IRCA 3K5LA 3PJXA 4OKKA 2IS3A 1C1BB 1IKXB 4Z4CA 2AX1A 3KMSA 3OS1A 3HVTA 3TWHA 3BQ2A 3DDKA 3E01A 4Y34A 3KLFB 3N6LA 1TKXA 3HO1A 4CEZA 1JLFB 2DFFA 4N47A 5C25B 4ZVEA 3LP0A 3DRPB 3P5JA 4FK2A 4DL5A 2VG5B 4HUEA 2RF2B 2D3UA 3OS2A 5FRNA 3G6YA 3OYLA 4FLUA 1WNSA 4HCBA 4PUOA 1S10A 4NLXA 2W8KA 4AH9A 4J9LA 4IRKA 1WSEA 3VN5A 2XY8A 2WTFA 3MFIA 4ZVGA 1TK5A 4MKBA 2LSNA 4TSXA 2P5OA 3M9OB 1JL1A 4DFKA 1GX5A 4B9MA 4I2QB 1RDCA 5KFNA 3Q8RB 4IR9A 4XIUA 1REVA 4CE9A 2VG7B 2KW4A 3ZT2A 4FYDA 5J2NA 1NK8A 3MR5A 3SUPA 3H5UA 3HM9A 1HQEA 1S1VB 4KHYA 3NHGA 3CDWA 2W42A 3RTVA 3LANA 3MFHA 1MU2A 5F9LA 2IJFA 3DRRB 1NJZA 4B9SA 1DLOB 3KMQA 2FJWA 1VRUB 4M3YA 1TKZA 4FW2A 4GC6A 1A5WA 3VQ7A 5KFUA 3PV8A 3I5BA 4ZPCA 2I1RA 4OGCA 2IBKA 4CFDA 2UUTA 1EXQA 5L1JA 3TARA 4EBEA 4O3QA 3H2LA 3D45A 3KJVB 5KG7A 1GOCA 4FJ5A 1IKWA 3OYFA 2JGUA 2P5GA 4OKEA 3M8PA 1WSGA 2BANB 4ECXA 5K14B 4BE0A 4KO0B 4ED2A 3H5XA 1RTDB 4DL4A 2BQ3A 4C8NA 1KVCA 4DQQA 3TI0A 2OZSA 2E6LA 4RW8B 1HYZA 3KOAA 4E7HA 2F8EX 3DLGB 1LW0A 2HVIA 2WRMA 4CEQA 1UA0A 4DTSA 4YR0A 4Q5VA 1L3UA 3UR0A 4FLVA 4R8UB 3NAIA 3PW4A 4ZTJA 3SQ2A 1SUQB 2ILYA 4W5OA 1RBSA 3N6NA 1JLGA 2HW3A 1FKOB 3ISNC 3I0RB 4RUCA 3PVXA 3AA2A 4WYWA 2ASJA 3MR6A 1HARA 3RRHA 4NCAA 4ICLB 2FLLA 3CWJA 3QESA 3QZ8A 4CJLA 4FK0A 3EY1A 4TXSA 1S9GA 5KG2A 1UWBB 4ECUA 4IRDA 2IAJA 3AVKA 1XR7A 5DQHA 2XO7A 2FVQA 3VA0A 4KHMA 4HVJA 4QWDA 3GILA 1CLQA 1S1XB 2KTQA 1J9AA 4PQUA 5FROA 1D1UA 1KLMB 3KD5E 3QNOA 2XCAA 3T5LA 3FQKA 1BQNB 5DQGA 2VA2A 3AVMA 2YNIA 4CJKA 5KTQA 5J1EB 4KV8B 4U6PA 5KFAA 2B5JB 1JKHB 4FBUA 4ZTFA 1QSLA 5JUMA 1C0UA 3QGHA 1JXLA 1VSFA 1QS4A 3WNFA 4DQPA 1NJXA 3AV9A 4CIFA 4DS5A 1RCHA 3UPFA 5KT6A 2XC9A 3T5KA 4OGEA 2IC3B 1DTTA 4CJFA 2BE2A 2HNYB 1LWCA 3HXMA 4NLUA 1ZBIA 4M3XA 3AVJA 4CGDA 2HHUA 4IH6A 3PJWA 4CHQA 4TYBA 4RW7B 3MR2A 1VSEA 3S9HA 4J2BA 3H5SA 4CJ3A 3ISND 5HP1B 5CY4A 3KIOA 4N76A 1RT4A 4IQXA 2FBXA 4KFBB 4WXWA 4DS4A 4EBCA 3HKWA 3LWLA 4URQU 3T3FA 1NOZA 3WNGA 3L8BA 3RMAA 3CJ0A 4KI6A 5EWFA 4ZVHA 3TAPA 4OJRA 4EO8A 2PZSA 4ELTA 4OLAA 3VQQA 4TY9A 2C22A 3CJ5A 3M9NB 2CKWA 3JYTB 3QYYA 1S6QA 1BI4B 3LZJA 3V4IB 2HNZA 4Q43A 1SL0A 4R5PB 4ZHRB 3GIMA 4RW4A 1I39A 4O4GA 3NH1A 5J2QA 4J9MA 5JS2A 4KHNA 4LSLA 3LAKA 4KB7A 1O1WA 3OYEA 2DY4A 1RTHA 4FS2A 2X6SA 2OPRB 1JLBA 2BR0A 3LZIA 5F8NA 1R0AA 4W5QA 4M95A 4ELUA 1HNIA 3PX6A 3DLEA 1IKVB 1K6YA 2KZMA 3V9WA 2HHVA 2FVPA 3O3HA 4CHOA 3TAMB 1UA1A 5HBMA 1ZYQA 2IJNA 2OPPB 3SUNA 2J6TA 3QLHA 2OYQA 4U7CA 4M42A 3SCXA 4O5BA 4FLTA 3L3UA 4NLTA 3PR4A 3NL0A 1D9DA 1BIUA 1S9EA 1HRHA 1KSPA 5L1LA 3NKYA 4NLPA 5KFFA 4IKFA 2A1SA 4XPEA 4M3ZA 4DF8A 1QAIA 1QTMA 3T5HA 1KLNA 1RT6A 3CDUA 4ECQA 3GIKA 2VG6B 4ELVA 1RT7B 1IKWB 5EWGA 2BDPA 1N4LA 2WONB 2JEJA 3LDSA 2IGIA 3N6MA 1YT3A 3RBEA 5KT3A 3HSTB 1VSMA 2YKNB 1LV5A 2XRIA 1LW0B 2QE5A 4URGA 5I3UB 1TP7A 3MXJA 2YKMB 2IDOA 1T8EA 4B3OA 2R2UA 1BQMB 4DTMA 2R8KA 4FJKA 4JV1A 2Z1IA 4FZYA 4O3SA 1WSJA 2EHGA 1SL1A 4E7LA 3MECA 1TL1A 2ASLA 1RT3B 3KKSA 2HB5A 4K50A 4RNFA 3NAEA 3OY9A 1C1CA 4QOZB 3IRXA 3BDPA 3DYAB 1W0HA 2RKIB 3CFRA 4WE1B 1JLCA 1TK0A 4CIGA 3LP2A 4EP4A 4DQRA 4I2PB 3VQDA 1EX4A 3AO2A 4YR2A 3VQSA 3E51A 4PQUB 1S1UA 1RT1A 4WZQA 4UQGA 3QETA 5KFRA 5DG8A 3SUOA 1HPZB 5D3GB 1BHLA 3OYKA 3AVNA 1TKTA 1RDDA 4CGFA 1C6VA 3EPIA 2OPSA 4K4SA 3MEDB 3GV8B 4AHCA 1HNVB 1Q8IA 2Z1GA 5DMRA 4WZMA 3CFOA 1VSJA 3I8DA 4TY8B 3OVNA 1SKWA 2AJQA 2CJQA 4DU4A 4CJRA 3AO3A 3AVLA 4Z0UA 4MIAA 4R0EA 4EP5A 4LQ9A 2HNDB 3H4BA 3DI6B 1RTIB 4H4OB 3PX0A 3QIPB 2F8TA 3K5NA 3DMJB 2W9BB 4IOBA 2D7SA 3KLGA 2ZE2A 1YVUA 2X78A 4FJXA 1OS5A 4NLYA 3OL6A 5F8IA 3LPTA 3AA4A 3OYAA 3KLHA 3MEEB 5HLFA 3V9XA 4J9KA 2HMIA 3H40A 4FJ7A 4RZRA 3PZPA 3V81A 1EKEA 1HQUA 4IG0A 3DOLA 4EYHB 5KRTA 1N6QB 3U3GA 3NBPA 4CGGA 4FLYA 2FJXA 3L3VA 4IDKA 3QEIA 5CYMB 4ED1A 1ASUA 3PW7A 4DSEA 1S5JA 1ZTWA 1QE1B 4DLGA 3H98A 1NNDA 2P1JA 3MF5A 3ZT3A 3RMDA 2WHOA 1X9SA 1JLQB 3FRZA 4K4XA 3V1QA 4I7FB 3VQ9A 1U09A 1HYSA 3QEVA 5HRRA 4JRPA 3M8QB 3ITHA 5EWEA 3AO4A 3IGNA 4QWEA 3OJSA 1LWFA 4KKOB 3C95A 4CEDA 1WAJA 4B8CA 2ZD1A 1X9MA 1R0AB 4B9UA 2C2DA 1D9FA 3RR8A 3WNHA 4KHWA 1RYSA 4DSIA 4DEZA 1KFSA 1ITGA 2PYJA 4CF1A 3HJFA 1JIHA 3DM2B 4DTRA 2YNGB 3RMCA 5HBMB 1KVAA 3SV4A 4CJQA 2OA8A 3Q8PB 4DSKA 1JLEB 4NLDA 4ZPDA 3VQBA 5F8LA 4M3TA 2G8VA 1QHTA 4QWCA 2JC1A 4MKAA 3B6PA 2JEIA 4FLXA 3IG1A 1DTQB 1S6PA 2RDJA 4FZZA 3CG7A 1EETA 4FW1A 4F4XA 5KG1A 4O3RA 4K4VA 3TABA 3IS9A 3CVKA 3HPOA 4J9SA 1VRTA 4AHSA 2XGQA 4Y2CA 3RRGA 1RT5B 4EZ6A 3OS0A 1VSIA 4CK1A 3SNNA 2XGPA 4KAIA 1U45A 1LW2B 4W5NA 1QUVA 3S3NA 4CIEA 2WB4A 2E6MA 3RB6A 3CDEA 1SL2A 4HYKA 1QAJA 1RTJA 4H4MB 3I0SA 4J9QA 1S0NA 2QKKA 4MH8A 4N56A 2R7YA 2G8WA 2FLPA 4CEAA 2I5JA 3SQ0A 3OYMA 2F96A 4NLVA 3OYHA 2FVSA 2AQ4A 3VQ4A 1CZ9A 1S1TA 3RB4A 5SZTA 1QSSA 3GV5B 4MFBA 2UUWA 3EZUA 1C0TA 3C6UA 3RAQA 1NK7A 1FK9B 3FFIA 1YTUA 3P83D 4BDYA 3BGRA 5KFKA 2ATQA 4JS5A 3KK3B 2ETJA 4E7IA 2FLNA 1WSFA 3T19A 1NK4A 4ID5B 3OL7A 2E9RX 4W5TA 1VSLA 1LAWA 1K1SA 1KCFA 4DU3A 1YTAA 4E1NA 3ZSXA 4I9QA 4RW9A 4CK3A 4HUFA 3V6DB 3QGGA 3K5MA 4G1QA 3ZSZA 4O44B 4RU9A 4NLOA 4CEFA 3H5YA 5C42A 1TL3A 5J2PB 1N5YB 5L1IA 1B92A 3DLRA 3PW0A 3KKRA 1CZBA 4CF9A 4CF0A 4GC7A 1D5AA 1T7PA 1RDBA 4XPCA 3OYIA 4NYZA 2IM2A 3G10A 3DLKA 1A5XA 1IH7A
chains in the Genus database with same CATH superfamily
4DV7F 1NJIT 2VBYA 5EVZA 4K4YA 4BE2A 1KXPA 4JKBA 1M5VC 4M8LA 4A8XA 4IG3B 1HWIA 4A8KA 4DLEA 4QU7A 5G0RB 1LWEB 4LRFA 1XMQK 1T9XA 3GMGA 1NGDA 1RBOB 3JQKA 1VJQA 4DFPA 3ENQA 2QEXN 4ZP7A 3VAHA 4M1KA 3NDKA 3C0BA 2CPYA 3H1QA 3S6EA 4K4WA 2ZJRQ 3O1WA 4WFBQ 3KUEA 3B8AX 4KRWA 3TQ1A 1SIZA 3BEXA 1VQ7S 2F7TA 4YOWA 3F9KA 2PFUA 1G2EA 2GWJA 1H7XA 3QICA 4A8MP 4TQRA 4PWDA 2QWNA 4CW7B 3DOKB 2RQCA 1FTCA 2HHHK 4EIAA 1QHAA 3R3TA 3T1YF 5F9NA 1RDWX 4UW2A 3QZ7A 5CR4A 2XSJB 4U7BA 4IOAL 3CJBA 3IMXA 4LF8K 3MWTA 3MCAB 1EQMA 5GMEA 3BPDA 3BYRA 5DQIA 3BO3A 4M94A 1WSHA 3MK6A 1Q81O 4J2DA 1NPRA 2NXEA 1IO2A 1RU2A 4CHZA 2DFEA 5C2GA 4FOIA 1IR2A 3OYCA 1NU0A 4CHPA 3HT3A 1GNKA 3E01B 5KFIA 2FSNA 1IM4A 4L6V3 1S1WA 3DLHA 2M70A 4ZDNA 3UO0A 3POTA 3UD5A 1H6KX 3NNHA 2GO8A 2CDQA 4CLFA 2GJ2A 1UJ6A 3NMAA 2HHWA 3UI3A 2QK9A 4CZEA 3R7SB 4C9DA 1H2VZ 4FJ9A 3AA5X 2K7KA 3HPHA 4ZVFA 4IDHA 2RDIA 5AQFA 3DRSA 1IBMK 2E1AA 4NCBA 4TLRA 2P6TA 4CO5A 3PW5A 5KT2A 4EO6A 2XQCA 3K7RA 3IUCA 2E7VA 1CQNA 2OELA 2DR9A 1AZSB 4CYUA 4BHQA 3THWA 2GWKA 1Y3JA 3MN7A 1TMJA 2YKPA 5JVHL 5F8GA 4F4WA 3UE2A 2GIFA 3IAM9 3EE9A 4O5FA 4BC4A 5DLFA 2E4LA 2J6UA 3AOBA 4FPRA 1YI2N 4H0PA 3RJMB 3BYPA 3HHLB 2OSRA 4KY3A 1MDUB 3BH7B 2J76E 3QIDA 3DXKB 2HBJA 4DZDA 1NJWA 1TVRA 2W1BA 1WB9A 3M2VA 2YCHA 4HVZA 3PIPQ 2Y1JA 4B1ZA 5KFXA 2D9PA 1IKXA 1FRJA 5E5NA 2FHOB 4QPTA 5GAHI 2O8BB 4PG4A 2QJ3A 4WIQA 1PYTA 2FZGB 2HQDA 1NKCA 2R8HA 1HMVA 3UN5A 3NWGA 1UMJA 3CHWA 2VG5A 2HG4A 2W2QP 2UXDF 3EE3A 1FX2A 4ECZA 1NJYA 3QEWA 1GLFO 2UXCK 4KHRA 3B6OA 1WHYA 2ZWOA 4X64K 2D0OA 3B78A 3CCTA 4BCAA 3GFZA 3HI9A 2FD2A 4H0TB 3MM6B 3MPUB 1WC1A 3CE8A 1FDDA 1A9NB 1IJJA 3HL8A 1LKZA 5GAEI 2DRBA 1U1KA 1TKDA 3N0VA 4I2QA 2YHBA 2A18A 4B1WB 3PIOQ 2E2NA 2DNHA 2AW0A 3L2UA 1SBRA 3J7AP 1J5OB 4HKQA 2N3OA 4DV2J 3CJSA 2P9KB 1N36K 3N01A 3AH6A 1NOYA 4WFZA 2IBOA 3U7JA 4Z7YA 2AGQA 4QPXA 2E5HA 3HT0A 1QSYA 2RE1A 1U1PA 2P9IB 3DRRA 2BRLA 3CD7A 3H20A 4C11B 1E6YB 5F8JA 3RGIA 2JNJA 3SZ2A 3ZZUA 1BCOA 4F50A 1LWCB 4JI3J 4FVMA 5F3ZA 1L5UA 3DAWA 4KH6A 3U9DA 3AVCA 3FSIA 2CZ9A 3L7OA 2DO0A 4TQSA 4CBXA 4AHRA 2ZZTA 5K14A 4KO0A 3HBTA 3J81j 1RT4B 2ASMA 3VQEA 2QMXA 1HX1A 2IIRA 4BLGA 2ACYA 5D4LA 2H3EB 3BGUA 2JC0A 3MPVA 3P5BP 3OFFA 3ULEB 1RCXB 3QEXA 2KHDA 5A8WB 3S41A 1TK8A 2YHAA 2AJ1A 1ZZNA 1S9FA 2F3JA 4G1PA 2C28A 5AFUH 1PGZA 3OA9A 2VFUA 2BQRA 2HNZB 2BQUA 3OLBA 3UKRA 3G25A 3I56N 4ZPAA 5KFLA 2Z1HA 4CZLA 4OHVA 3VA3A 4LSLB 2W24A 5B0GA 2HHHF 2ZM6K 1AT1B 2KZZA 1XR5A 4YOEA 3CCES 3E1YA 2XI3A 5BYRA 4ZVPB 3M30A 2R7SA 4LF8F 5JVGQ 3G6VA 1FESA 4P2FA 4RX6A 4RUAA 2ADCA 3DLEB 2XWYA 4FYWB 1OQ6A 3CJKB 1WLJA 2KFNA 2F4FA 4DPTA 2L9WA 1TGOA 2HZVA 2GUPA 2JLEA 5J1EA 2I7NA 2FJBB 2B5JA 4DZ6A 2NXUA 3QLHB 2BEFA 3NG8A 3J80O 1WSIA 2O8EA 3HD1A 3EM1A 3OL8A 3TZYA 1AB8A 3T41A 2Y1IA 4OMFG 3ULDA 2AGPA 4A48A 3MM9B 3K5OA 3UDCA 4JI1K 2XNQA 1N32F 2BJ7A 1NLVA 5K8MA 3HSGA 1Q9YA 2XY7A 1BC6A 2EBGA 4DF4A 1T94A 4CH1A 2GJFA 4RW7A 4DL0C 1T6DA 5CZXA 2NCKL 3ZETA 3L95X 4ES3A 2CUYA 2GNKA 3NFAA 3CM5A 3P49B 1YX2A 5GINA 4ZA1A 2HFNA 2IA6A 5BREA 2A41A 1IBMF 4DPOA 3M8RA 3W62A 2HF4A 2O8CB 3BV8A 2CJKA 3I96A 5C2FA 4YOYA 5FDLA 4F26A 2RUSA 2F4VJ 4I6MB 2GIRA 4B9QA 2B4JA 1OMSA 1RAEB 3W9HA 1QTNB 1TYQB 3V4IA 3PG9A 1Y4ZB 3LPUA 1NO8A 4ZVQB 1U7LA 2LEBA 3N9UC 5BPMA 4PKGA 2I8EA 3UE5A 2G8UA 1WI6A 1KNZA 3KTQA 4KHSA 3MECB 4B3RJ 3DFEA 4G65A 4AL5A 5IQQA 4IR1A 3D1OA 3OSNA 1JQGA 2LXIA 1FW6A 2O8FA 4JS4A 4HH1A 2HAIA 4LRCA 4BDPA 3WIUA 1YIJN 3AQOA 2HFZA 1UJ5A 3TJ8A 5E41A 3K9JA 3VGLA 1YVFA 2P9EA 1FXLA 5M1PA 3TAQA 4UUXA 1QVGM 3H59A 3JSMB 4FWKA 2W6LA 2UV8G 3THVA 3CSKA 3M3ZA 2XSFA 4KSEB 4K7QA 2F65A 3VQAA 2UXCF 5BR9A 2R8IA 4X64F 3MURP 1MSWD 2JWLA 4JI0K 4OYIA 3CO9A 2AJ4A 3EZ5A 2BUNA 2HBMA 3IGVA 1NXIA 2JLFA 4WU2A 4J2AA 1TL7A 3W66A 4ZKAA 1DHMA 2B4VA 2AYEA 4GKKK 5CYQB 1IKYA 1HQUB 4KPCA 3O1LA 1S0OA 1FJCA 3LP1A 2HWHA 4YORA 3U3YA 2QV6A 4JK9A 4PY5A 1B4SA 1C0GA 2DTUA 3KLVA 4F2RA 4DX5A 4K42A 1YJTA 4YDUC 5KG3A 1N36F 3P96A 2R2SA 1H3DA 2DD8S 1GMWA 2RIJA 4QWAA 4RNHA 3PIOL 1Y10A 2VICA 4YQWA 1QQCA 1HYSB 2GMHA 1XHXA 2MZQA 1O8BA 3OYDA 1A0OB 1H2TZ 3OXLA 3SIPB 3TTCA 2APOA 2Z4PA 3OTDA 2ZZNA 4FYXB 2QIFA 5KFQA 4NA2A 4KC5A 3VQ6A 5KQ8A 4F4ZA 1RKJA 2FGCA 1WF2A 1NPKA 2V8PA 2H3GX 4NX9A 4OQJA 2XZTB 5JXSA 3LDNA 2CZ4A 1KVBA 3DWLA 1RTIA 4H4OA 4B17A 4OLPA 4U95A 1UPMB 4UZBA 3HHEA 4O55A 1S6PB 1EETB 5EX0A 2FJDB 1BL3A 5IOLA 3O5TB 3WXJA 1YITS 4CK2A 1H2UX 1FI4A 1JJHA 4ED8A 3EVOA 2ZBRA 1VQKS 4GRSA 2VQFJ 3A2FA 5L9XA 4LF9K 3TSQA 3FBEA 1N6QA 4P72A 2ZM6F 4LH4A 2X51A 4A61A 3OTBA 2GO9A 4ZP6A 3OVAA 1RFQA 2HHSA 1X3NA 5DM6L 4CBUA 2PDAA 1OSCA 2HS3A 4BG9A 2O8DA 4QCLA 1RBRA 1S12A 3CCVS 3OR1B 2KFYA 4Z94A 4OO1J 2YKQA 3W9JA 3PO4A 4DOZA 2AIRB 3LGHA 1RTJB 2ALYB 4FM1A 3TSUA 4LF7K 4ILJA 2IOCA 3J8AA 1WC4A 3G82A 4USUA 5LSRA 4DR6K 5ELZA 4RCHA 4Q2LA 3ATVA 3SDEB 3ZZYA 2VGMA 3M8QA 5F2RA 2C3MA 4NZ7A 2ZH7A 1RQ0A 5AQVA 1RAHB 1S1TB 3QMLA 4KKOA 4MFBB 4DR4J 4KTWA 3THYA 3QEPA 4JI1F 3KHLA 3CCUN 1I3OB 4M3WA 4LSZB 4DR5J 3RR7A 3DM2A 3W61A 4CLZA 2QN6B 1QVFM 4ATNA 1S22A 5GVQA 1D8YA 3KK1A 3V9UA 4O0IA 4A46A 3PR5B 4QAGA 2AGOA 1HHTP 3FCHA 3X1LB 3H7HB 4RW9B 1NBWA 1J2VA 5FD1A 4CECA 4G1QB 3SJJA 5F41A 3ULHA 3KZBA 3GSIA 3TEGA 1I51B 3THPA 3EVWA 1X4HA 5SWMA 3BF3A 2VFVA 5JLFA 5I42B 5HRPA 3CF5L 1BA0A 2PN6A 2DB1A 3TA1A 1SH3A 3F0NA 3UCGA 1RT5A 4O4RA 1QVFR 1WKLA 3FCWA 4E7JA 1J5EK 4P52A 1M5KC 3L2VA 2KKZA 3T5JA 2AEFA 3P6YC 1Z6RA 2XS5A 2Q66A 3J7ZO 1T9VA 3WZ0A 5DDOC 1NHVA 3KWMA 4ED0A 1RHUB 3JTNA 4LY7A 4J9UE 2NREA 4NO7A 1RA7A 1ZETA 1Q86O 2NRRA 4P2SA 3LP3A 4U96A 1S76D 1K73T 2QKBA 3HVAA 4H0YB 4RUBA 2XLJA 2PMZD 4FJMA 1S4EA 5T7BA 3G9CA 4A8SA 3ASMA 4Y2AA 3ZEUA 4Y1CA 4PWDB 1TUVA 3WX8A 4X66J 3OPKA 5KT5A 4CDIA 2CQ3A 4RG8A 3SQOP 1VQLS 2KRRA 4JI0F 1YJ9S 5AQRA 3GYNA 1ZOTA 2QLBB 4B02A 4DUZF 2DH8A 4F36A 2CQ0A 4ER8A 2KG1A 6FD1A 2RHSB 2ZC3A 2ITGA 3HP9A 3NCRA 1LK7A 1ZPVA 4HHTA 5HANA 3Q8UA 3WIVA 2DXDA 2A10A 5GAEU 1S1WB 1T3OA 2B9XA 3POTB 1U1QA 2KL8A 3VEWA 3BBCA 3H8YA 4KHUA 4K8XA 3TRGA 2W2OP 1GLCG 1J54A 2JRSA 5H9FK 4CFAA 3I0RA 3KHGA 3NGIA 4CZFA 2CNOB 3N79A 3KJQB 4U8VA 2HQGA 2Z2YB 3ZSVA 5KFMA 3H1VX 5IV4A 1BCMA 3DRSB 4ILRA 5CA5A 1X4CA 3M6VA 3MN6A 2G1DA 1P90A 3BKTA 4PCQA 1ASWA 1RILA 1P9QC 2OI2A 4OX9J 1EP4B 2YX7A 5IV3A 3C3LA 5FLXO 5E3RA 2DIUA 2HBZB 3B82A 3SFUA 3THWB 1UL3A 1JMTA 4MKVA 2HIYA 1J53A 4CESA 3CJAA 2GX8A 4OZ0A 3CERA 4LMZA 4XDCA 2RS8A 3LWMA 4DG1A 1U25A 4OHZA 4KV8A 3CFPA 2LXUA 4XTTA 3QRPA 3CCSN 1UEVA 1SKRA 1Z26A 2QEXS 4A2BA 3A8EA 1XMOK 1TL5A 3V6JA 3ZO7A 2E1RA 1HWLA 5HRNA 1WF1A 1P8GA 1U4BA 3O44A 2PI4A 5GADI 4CIOA 1TVRB 4K4TA 1WNEA 4IOXA 3NH2A 4U67Q 3M2VB 5GAGI 3WUHA 2KXHA 3ONQA 4KHPJ 1VCTA 2WAQD 1IKXB 4JOUA 4GMKA 1WTBA 1JCFA 1GH8A 1A7GE 1Y5IB 3TWHA 1GXLA 4PG5A 1VQ8N 3ATUA 4ZLJA 1MNEA 4CEZA 4B1UB 1HLWA 4LF7F 2VG5B 4HUEA 4OI4A 1N5QA 3HFZB 4RWWA 3OS2A 2DNZA 2QWMA 1M0SA 3OYLA 4LF5J 1URRA 4PUOA 2J8SA 3UFCX 2W8KA 2Z2ZA 4J9LA 4IRKA 1D4XA 2XY8A 1R8CA 2B9WA 1H38A 3R5BA 4DU7A 1JL1A 2MDAA 4WP8A 4I2QB 1W7AA 2YHWA 1RDCA 4LR7A 3VGMA 4CD3A 3PACA 3NCQA 1EQ0A 2GHWA 3Q7CA 1KC8T 5J2NA 2OTLS 5DDRC 1HQEA 1NDPA 4KHYA 3F9MA 1SCJB 2W42A 5K20B 3MFHA 2E2QA 2K8GA 3EKSA 4DV3K 4GVLA 3AAQA 2J0WA 3DRRB 1NNEA 3CCLN 4B9SA 3GR0A 4A47A 3KMQA 4M3YA 4GC6A 3VQ7A 5KFUA 3I5BA 4C0OC 4IWVA 2I1RA 4OYOA 2D4WA 1KKHA 4EBEA 3H2LA 1J5EF 2Z30B 5KG7A 2DGXA 2KXNB 1GOCA 2VDHA 1IKWA 1V3RA 2P9SA 4LFBJ 2HBLA 2P5GA 4OKEA 4P75A 4NLBA 4ECXA 5K14B 4KO0B 3H5XA 2NRTA 3O1BA 1BUPA 1WHWA 1RCOB 2XO6A 4JI4J 3NGKA 4DQQA 2OZSA 1YI2S 3GCWP 2E6LA 3KOAA 3T9ZA 1CPZA 3BM7A 5K8PA 2J9DA 2HVZA 2ZOGA 4OYWA 3SCJE 3RW6A 3UR0A 5B08A 4ZVSB 1AA1B 4MMOA 1W2BR 2HLTA 2NZTA 3NAIA 2HZCA 1NGJA 2BW2A 3MD1A 2PFFB 1RBSA 1FKOB 3E9LA 4E98A 4HTLA 2ASYA 4YB7A 3AA2A 3MR6A 3B54A 4NZ6A 5KOWA 3RRHA 4M7YA 1SB6A 4RTFD 2KG0A 4GV6A 3EY1A 1S9GA 3K0SA 3A8JA 4IRDA 2IAJA 5DQHA 3VA0A 3M30B 4M5HA 2GS8A 3MN9A 3VEYA 5JJBA 4PQUA 1CJVA 5FROA 3LA0A 3KD5E 2L41A 4C1NI 2D69A 2XCAA 1BWVA 1HW8A 1Q7LB 3R5CA 2DO4A 4NXMK 5KTQA 1QDUB 5J1EB 3T6BA 5AT1B 4CJKA 3TWZA 5KFAA 2B5JB 5F3TA 4EU0A 4ZTFA 3VWSA 4CQ1A 1C0UA 3QGHA 4JV5J 2F9WA 4DQPA 1NJXA 2O8EB 3A12A 5IZHA 1RCHA 3TA0A 3CGIA 4OGEA 3HULA 2FF6A 3C8YA 2CNKB 2V4JA 4RW7B 2XHCA 1GTEA 1PG5B 3ZETB 4N76A 4EHTA 3GG1A 2IVMA 3LWLA 3ZXWA 5CCMA 3SJHA 3CJ0A 1FE4A 3TAPA 1S6UA 2PZSA 3MEKA 3ID8A 5D0HA 3VGKA 2PE8A 1GMVA 2NR0A 2C22A 3QFPA 5CD4A 2XMVA 5C15A 3MPDA 1AUSL 5IFMA 3V4IB 4Q43A 1F0XA 4EK2A 4FVUA 3TW0A 3GIMA 2X1FA 2VDIA 4RW4A 1RWXB 1UVNA 4DKWA 4J9MA 5JS2A 1NAQA 3TUPA 2XHWA 3OXGA 2KLAA 2HBYB 2V2ZA 1XMOF 4FS2A 1Q7YO 4DV0F 1JLBA 2ZNZA 1NUEA 4BRHA 2YJFA 1SI9A 1FERA 4OZLA 4BVPA 3VHQA 2EG1A 3V9WA 2HHVA 3I55S 3MXHP 1UA1A 2IJNA 1HKBA 2GAGC 3VENA 3SUNA 3CJQA 2J6TA 3RVCA 4OI2A 2OYQA 5CYJA 2UUCF 4V19S 1TUWA 4WWSA 1JNRB 3MDFA 1Q53A 3L3UA 3PR4A 1D9DA 3NL0A 3SMZA 4M3ZA 2V7YA 4IUFA 1IV0A 1OKJA 4PAAA 2UUBJ 3H3OB 5L38A 2VF3A 4MYUA 1MWMA 2QRRA 1FRLA 2NLXA 1WEYA 1TL7B 3R5GA 3CIPA 3FMWA 2QFIA 2VWBA 1LW0B 3SXLA 1P27B 2C3UA 3SBTA 1URNA 1U2VA 3ZZ0A 1F5AA 4ZOSA 2Z1IA 5LJVA 4FZYA 4X65J 4KQZA 1NM2A 1PILA 4RL1A 1VFJA 4E7LA 5I3QA 3I82A 3AD8C 2DGWA 2HB5A 1RHRB 1WDDA 4DV3F 4K50A 1Y11A 2C2NA 3NAEA 1N33K 1CVJA 4QOZB 3NP5A 3HMJG 3BDPA 1B0VA 1JLCA 1TK0A 4CIGA 2ZEJA 2MKIA 4RKUC 4C3MA 1QY7A 2DGSA 4BRFA 1VQPN 2YI1A 4YR2A 4DR7J 5DO2A 3W3DA 4Y0FA 3VOVA 4QR0A 3VAMA 3N5FA 1R31A 3R7NB 5DETA 3JAMU 4CGFA 2OPSA 4AHCA 2Z1GA 4WZMA 1VSJA 1W26A 2QSWA 2CJQA 1X4AA 4MYTA 3AO3A 4Z0UA 4MIAA 1GXTA 1RTIB 4DR3J 4H4OB 4M63C 4W4MA 3EVMA 2F8TA 4E2FB 1I1GA 3K5NA 1RBAA 1DURA 3KLGA 1HA1A 4FJXA 2X78A 4NLYA 3OL6A 1RGIA 3LPTA 3KLHA 4DV6J 1R6YA 4FJ7A 3US5A 5EX5A 3TTFA 3R27A 3H46O 4IG0A 4EYHB 1N6QB 3CCQN 4CGGA 4ZJLA 3L3VA 4IDKA 2O8DB 1ASUA 3PW7A 1IM6A 1OVYA 1HL6A 4OYPA 4PABA 2QXLA 4NEYA 1DBDA 1NNDA 2PD1A 5DJBA 1JCGA 2WHOA 1YZ7A 3RYLA 3G82B 3ISZA 3HZ6A 4NXMF 4F3MA 3C6HA 2GVDA 5LOQA 2FSJA 3M8QB 3MCMA 2BKOA 4U9RA 2OFGX 3AO4A 4DV4J 4QWEA 4KKOB 1ZM9A 1WAJA 5ADZA 1X9MA 1R0AB 4B9UA 3RR8A 3EGWB 1YVNA 3QJLA 4CLTA 4YB1P 4RR5A 4D3HA 2DIVA 3VAFA 4DSIA 3C15A 1KFSA 3HJFA 3DM2B 4MLHA 5U47A 1LWXA 3NVMA 3SV4A 2OA8A 1M1HA 4NLDA 1H98A 4DV1F 5F8LA 2W25A 2DRDA 4YHHJ 2G0IA 2G8VA 4QR2A 4A8FA 3BO2A 4MKAA 3IG1A 4FZZA 4AQYJ 4BQZA 3AAWB 1HI0P 4K4VA 3D0HE 4FVCA 1VQ5S 3R6GB 2B9YA 1R59O 4C8YA 4G1IA 2VASA 1RT5B 4WQ4C 3HKZD 3G8TA 1VSIA 3SNNA 2XGPA 2CNNB 1U45A 5M2UA 4M5LA 2VU5A 4CIEA 2M52A 2E6MA 4ALZA 1SL2A 3E9PA 1Q82O 1IBLJ 3A5LC 3I0SA 4PPDA 1S0NA 4FYYB 1IVZA 2QKKA 2AJFE 4N56A 2R7YA 4MDBA 4CEAA 2M5YA 3QSYB 2MYFA 3SQ0A 3OYMA 4BGAA 4HR2A 2JZ5A 4NLVA 2CPDA 4ZIWA 2MHNA 2IRYA 1FTRA 2AQ4A 2E5JA 4IOCQ 3RB4A 2VIHA 4B3TF 1QSSA 3GV5B 3C6UA 3RAQA 1UVIA 3ZEUB 1OH5A 3FFIA 1RAAB 3BGRA 2QA4S 3AD9C 3VGUA 4P73A 1AFIA 5LL6d 3D66A 1WKKA 4OIXA 2W4PA 1LAWA 3O4WA 2IVNA 4DU3A 4I9QA 3QBWA 2RB7A 4HUFA 3QGGA 3D6TB 3Q23A 3EE8A 2CJBA 4RU9A 4NLOA 3H5YA 3OW2M 1KOHA 5L1IA 3N28A 3DLRA 3KKRA 4CF9A 4GC7A 1T7PA 3C7NA 1RDBA 3R2CJ 3R9PA 1I94J 4NYZA 3U1LA 2GQQA 1A5XA 2B51A 3WQUA 3P45B 2DNKA 5KG6A 3FVYA 1ZBUA 4F02A 1OH6A 2XI2A 4ZIVA 3BSNA 1S6OA 1L3KA 3E8OA 4FF4A 3MMCA 3I31A 4DU1A 1N33F 4CZJA 2RVJA 4K4ZA 2QMUB 3NBPB 3D6RA 5AQHA 4KTQA 2UYTA 3BJYA 4KIAA 4ZLNA 4DR1K 3DRXA 5E3PA 5KFWA 5IWAJ 5CZVA 4CJ5A 4FLZA 3QO9A 2ROPA 3LALA 4E7KA 3EGNA 1U48A 4FDFA 2FHJD 2R7RA 4I67A 1N34J 1J6ZA 5BYQA 3I4PA 1NHKL 2GUIA 1T03A 5IT9U 2W7PA 4H5VA 4NCGA 4ZP9A 4F8RA 4P2MA 1G15A 1K1QA 2HIQA 4DG1B 1EJ7L 4C1NK 3V9SA 2ZJPQ 4L73A 1RA6A 1DRZA 3QJJA 3O80A 4ERDA 3K2PA 4XH4A 2M7SA 2K7JA 5IT9Y 2ZH5A 1HR0K 2QL9B 5MAOA 3IR5B 2FY8A 4IFVA 4IH7A 5C24A 3GIIA 2HVEA 3PW2A 1VISA 5D0EA 1I3AA 1RT2A 2YX4A 4Q0BA 3H0PA 1P8ZA 1SJQA 2OANA 3CC4S 1HUXA 5SUHA 1UJ4A 2B0GA 3ZT1A 4ZN3A 3O4NA 1U6ZA 2DGQA 3VGVA 1WTFA 1BISA 2CWKA 4CERA 1PIEA 2XMWA 1VBKA 4YY3F 4LR8A 1NGHA 2R8JA 1ACMB 3R3LA 3Q86A 4IFYA 1NGAA 4PUOB 4EFHA 3GOIA 1IBCB 4I6AA 3NMRA 1F21A 1HIYA 1U02A 4ZJQA 4BRPA 3ZTQA 2RE2A 5F8MA 3EGVA 2P9UA 2LQ8A 4L8RB 5KT7A 1KD1T 5KFPA 3Q0AA 2RS2A 4JI3K 1AROP 4JI8J 4DB3A 2QXFA 1QQOA 3CJ3A 5J2NB 2PFDA 5AR0A 4BRQA 3CC2N 4MKYA 4OFZA 1HQEB 5KFSA 1HYVA 2N4CA 1U04A 2QYGA 3MMBA 3JAMO 5KPRA 1BE4A 1WHXA 1OY6A 4X4TA 2OCEA 2ZBQA 3CJ2A 2CJ9A 4M7XA 1HI8A 1M90T 3NGZA 2DNPA 2E1PA 4JKFA 2B9EA 2EW9A 2ZBPA 2F7VA 4KH0B 5D6GA 2VUGA 1C1BA 4J9RA 2P9SB 2MKSA 3A8IA 4OL8A 3MZIA 3QT8A 3BSOA 4BRIA 3TZWA 1B9FA 4JV0A 3BSAA 3KLFA 3A3NB 4FLWA 2EKYA 2ZUGA 3GWCA 2F1FA 3D6MB 4LF4K 4ECYA 4KH4A 1LK5A 3K2YA 1ZAVA 2R7OA 2YQ3A 3SPZA 1EHWA 2D74B 3NCPA 4CZIA 3ZNJ1 2CVIA 1WOSA 2AYMA 4LT6A 3ZCMA 5HQLA 4Y2IA 1JX4A 5E84A 4C8KA 3D0IE 4C8MA 4GMJB 3FE1A 4M45A 5KFTA 1FD8A 3JB9k 4N8NA 4E19A 3R1HA 4LC9B 1PAUB 3BUZB 1S9GB 4OV6A 4DR2J 2D0AA 4RPFA 2IAJB 3EZWA 4B1VA 1OQ3A 3MR3A 3AFGA 2QWPA 2W4DA 4DV5F 3P38A 2DKOB 1W2IA 2DT9A 4B9VA 3LF0A 4Z2XA 4K25A 1ZBTA 3J81U 2KYZA 4WBFA 1GXUA 1XWLA 1YUWA 2MGZA 5HN0A 2RNEA 2BV3A 1ZAWA 3X3UA 2E5LJ 4KRFA 3NWRA 4AF1A 2K3KA 3VQ8A 2FTRA 1VRUA 1C0UB 2DVIA 1WAFA 4BDZA 2IFXA 2WVEA 2UVVA 1PSDA 3EKUA 3CJ8A 5FJ4A 4DMZA 4LFCK 1F9HA 4IO9L 2VPYB 3BGOP 2XMAA 2F4VK 3KJVA 3BZQA 2RMLA 3J81Y 2V4JB 4E1MA 3VTHA 2BANA 2R42A 3EN9A 4OYAA 3UIQA 4ZPWR 1GOBA 1RHJB 4LH5A 4FWOA 4DR1F 4B3RK 3DLGA 3GL1A 3FEXB 2D5RA 5HROB 3W5ZA 3HM8A 3CD0A 3B4MA 1RE1B 2BRKA 3ID6A 2ZVSA 1CBKA 2DGOA 3EPGA 4H5NA 1R8HA 5KFDA 1LFPA 3P31A 5LMUJ 1T3NA 2E2OA 3PRVA 1RABB 4NA3A 3M8WA 4RW4B 1FWPA 1JXBA 2MPUA 3DDNA 3ZTSA 2HQIA 3M7VA 2R4FA 3IP0A 1JLBB 1ZA1B 4KBIA 2H65B 2V0NA 4IO8A 1EQYA 4WXOA 2D1KA 5KFBA 3BPSP 4JYAJ 1NDLA 4DL2A 2DR5A 3QJPA 5HMYA 3IM9A 4DV7J 1FCAA 1HR0F 5HJYA 3Q24A 2ZJPL 1K9MT 4ILGB 2NYIA 1NK5A 1HD1A 2QZ8A 5A8KA 4C98A 5AQXA 4FL9A 1VK3A 1HKAA 2GGPA 3IM8A 3CM6A 2Y0BB 2F8SA 5KFGA 4JUZA 3HHLD 2KHCA 4NLRA 2M88A 3M2UA 3T9NA 3E9OA 2CWXA 4FCYA 5D4OA 2W7OA 3PCOB 4RWXA 3P1GA 3ZZTA 3CULA 4GW6A 3SAGA 4BRKA 4C0HA 5LXYA 1Q16B 4PXBA 2LQJA 2MJUA 1KVKA 3T1AA 3ZZRA 5IT0A 4NL5A 4JI3F 4Y6IA 1U2VB 5HO4A 4NLGA 1X1PA 1UEKA 5K8NA 5K5MA 1YG0A 2AWZA 4ZHRA 2LEAA 4QZVB 1U24A 4MK9A 1UVLA 5EN1A 3M6GA 1KN6A 4AHUA 2QW9A 3LDLA 2DNQA 2Y8WA 4NLSA 3TVKA 1NHUA 1JLCB 3VF2A 4ZVOB 5J1NA 2LCWA 1X4DA 1FFWB 1AFJA 2UUAF 4F0MA 3GCXP 3MCPA 2OPPA 1VBYA 2AKWB 2MQ8A 5AE1A 4P6QA 2VPWB 3UN2A 5CZ2A 2VQFK 2RD5C 2WUSA 1T9UA 2OPSB 4OHXA 2NXJA 1FRHA 8RUCA 4LF4F 1CJTA 4K2JA 4CP5A 1ZBLA 2GC8A 3M6WA 2JFDA 1C0MA 3NGRA 2VH7A 1WBDA 5AFUA 3KLGB 4GO5X 3V4MA 5LJWA 2A6MA 3KLHB 4JKHA 3BF1A 4ZPVR 1WEXA 3G86A 3ETMA 4IG0B 5AQIA 4DMNA 3CCEN 2HMPA 4JD2B 1KFDA 3O3LA 4IDKB 4QW8A 5DLGA 3CMAS 4CJ4A 4OLBA 3LM9A 2JSXA 4OYMA 2MTLA 4HTUA 2QWOA 1KHWA 4DFJA 1JJ2M 3CJ9A 4NYNA 4DR5K 2XG8A 5AZIA 1YJNN 2ACMA 2KM8C 3KD1E 1RT3A 5DM7L 1WORA 5KG5A 3OV7A 4HDHA 5MLCQ 4EI2A 4ED7A 2ZH1A 2KN4A 1YZ6A 4J2EA 3DYAA 2BJEA 2CGJA 1RADB 4BR7A 2ATLA 4LFCF 3TU5A 3UN3A 5AQKA 4CT8A 3IAYA 1RISA 2M0GB 2UXDJ 3TR8A 1F3VA 3C15B 4FKXA 4LVNP 1HPZA 1C1AA 2YPZA 3C65A 5F0WA 4FXWA 4OZ3A 3VERA 1RDRA 1FFGB 1R0BG 1KVIA 4NMXA 4BWJA 3WT0A 1HNVA 4K0KJ 4OHYA 2LECA 4YEAA 5ETOA 2HGLA 2XWXA 4TY8A 3G6XA 4B3RF 2COLA 3PY8A 4B8AB 1VJWA 3OQ2A 1WN7A 4PXCA 2HNDA 4E3SA 1F60B 4ZLPA 2O5DA 3DMJA 3IG1B 4UUWA 5KPTA 2A1RA 1REGX 2RQ4A 5HOOA 2CA9A 2QO3A 2XMUA 3W5XA 2ZJQL 3OFGA 2R7XA 4NYPA 3KJNB 2B6AA 1WKJA 2I2YA 4HACA 2ATCB 3FZLA 3HVWA 1QAYA 3QSIA 1G1XA 1ZZFA 3QERA 2BM0A 3RAXA 4CBWA 1XIQA 1Q5VA 4HH0A 3DU5A 4HI1A 2KFZA 2W9AA 3JTOA 1VIXA 3TA2A 2EFPA 4X66K 2PY5A 4YFUA 3I0SB 1FXXA 4M5DA 1JLQA 1N5SA 3HPGA 2P9NA 4M3UA 4ENOA 2VWKA 1FFSB 3GE9A 2MKYA 1B99A 5FRMA 3HOTA 1NU4A 2O4GA 2RN2A 4AHVA 3C6UB 3I87A 2BBEA 2YWWA 3FFIB 2LA4A 5AQUA 3BGRB 3OYGA 2KKHA 3ZX0A 2BABA 4FXDA 3K57A 4LBPA 1PC5A 3SQGA 4PYDA 2V6AA 3AB2B 4Y1DA 1GLDG 2MY8A 2J9DE 5HK4A 4CFBA 2MLZA 3IFRA 5KRSA 3ZX3A 2O01C 3SCIE 2HHHJ 1HJOA 4JP8A 2CQ2A 1FNMA 1XI1A 4JI2F 2WC9A 2BKNA 3MOZA 4A2AA 3BR9A 2W41A 4CHYA 4ZLLA 2M8HA 2HS0A 2X1GA 2VHGA 4FZVA 4DFMA 3QPIA 1LW2A 2Q3SA 3MMCB 2P51A 4J37A 4FWPA 2QA1A 3A8KA 3JQJA 4XAKA 3EYZA 1VSDA 1K8KA 3MDQA 1ZS6A 2WFBA 3AXMA 1BMQB 4WIIA 2C2RA 2D0BA 1A5VA 5KGWA 1WWHA 2UZAA 2XULA 3QO9B 1N32J 1W97L 1XUPO 1CXQA 1DKGD 3GFYA 2YHYA 2MLXA 1HNXJ 1RAJA 1VQYA 3UCZP 3KHHA 4YN3B 1U49A 4KHPK 2C2EA 1TAUA 1T03B 4RUHA 2CPEA 2JL9A 2B43A 1VIOA 2DHHA 4DUYK 1YITN 4N41A 2GFFA 4ILHA 1VQKN 2W7AA 2B4UA 2N3LA 1BUXA 4QS8A 2LDIA 4C7QA 1B9DA 3RB3A 2X74A 1WUUA 1C4AA 2YWKA 2ZH3A 3VZHA 2PA8D 4RBUA 5L1KA 3FNNA 3OSPA 5KI6A 1N5YA 1KP6A 3J7AN 4IFVB 2BXJA 5C24B 1I5OB 1DAXA 3IAS9 4DQ8A 3CCVN 3GJSB 1YXQA 3QAUA 4Q0BB 1W9HA 3CC7S 5C5JA 5BN9A 5ADXH 4KE5A 3U9ZA 4GKJK 2XYHB 1VMBA 4PA1A 1EAYC 4F2SA 4DR5F 2QYCA 4IKAA 3O9RA 5KOXA 3MXMA 4O0NA 3F56A 4ZMMA 3MWBA 1HFEL 3DJCA 4CHNA 1Z1ZA 3K5PA 3CI5A 4MDAA 4WQ5A 2I9SA 4IFYB 2XY6A 2XS2A 4I56A 4J90A 3DKDA 3AVFA 3MM8A 1CXUA 2MZJA 5EU7A 2KU7A 2R7WA 1T05A 3VCDA 3R8EA 5JICA 2DY9A 2LEPA 3CXCR 1S72S 1R0CB 2MLYA 5KFJA 2GBZA 2UXCJ 3FFKB 3UVJA 4H4KC 4RNOA 1CULA 1KVJA 5KFZA 4X64J 4OPJA 3LOUA 1ICEB 1WOOA 4MIWA 4FJGA 1EZZB 2HZAA 3HJVA 4LFBK 2H54B 2R2TA 4C97A 4JRQA 3VQTA 2BW7A 3MMBB 5AQYA 4DHYA 1GX6A 3QRRA 3Q8YA 3SYZA 1TUGB 3HRGA 3GQCA 3RAMA 2BH1A 2GEMA 1MMDA 2DTJA 2UU9F 4ISGA 4WFXA 2Z58B 4CJVA 8AT1B 2ZH2A 4JI6J 2IIHA 2F8MA 2DJWA 4QOTA 1XC9A 1NG9A 3NEKA 1Y64A 3PJXA 2IS3A 1C1BB 3VEXA 1GEHA 2HLUA 2IHR1 1WSVA 2YHXA 4Y34A 3KLFB 2HVDA 1TKXA 3HO1A 1QJHA 4X66F 1HD0A 2DFFA 3LP0A 4QYZJ 4DL5A 1GTHA 2RF2B 3DXMA 2JVOA 2RUGA 3BY5A 1OPIA 3G87A 1NGGA 4FNHA 4Z7CA 3G6YA 3W8PA 1WNSA 4HCBA 1S10A 4NLXA 5CXTA 5EOYA 3T1HK 3OXFA 3HI0A 3MFIA 4ZVGA 1TK5A 1YLXA 2LSNA 1WHVA 1VS3A 1N8RT 3ILOA 2AJ2A 2CPIA 3KUHA 3M2RA 4M63A 4UOHA 4JV5K 1YJ9N 4GVBA 5KFNA 3Q8RB 3C46A 4XIUA 1REVA 2P9LB 4UF4A 1LEOA 3D2EB 2MXYA 4I0WA 2CQPA 1MWZA 1VDHA 4CO3A 4JI7K 4CO2A 3MN5A 2CVEA 3IBWA 2BE9B 3MUMP 3LANA 2LMIA 2MGZB 2QM1A 3SMSA 1MU2A 3KG4A 3M6XA 1IQZA 3NMUA 2KT3A 3CD6S 2HFUA 2FJWA 2HFOA 1VRUB 4I1TA 2A2DA 3VAGA 4FW2A 4ZPCA 3PHTA 5D4NA 4F3QA 3HF5A 5C10A 4QIWD 4F4AA 4QIGA 3KJVB 3TR5A 2B7BB 4FJ5A 3OYFA 2JGUA 2BX6A 2C3YA 1WSGA 2AF6A 1ZM3A 2BANB 1H7WA 4BE0A 2C3PA 3D7SB 2BQ3A 4X4VA 4E7HA 2CZVC 3DLGB 4Z37A 1MG7A 4M5GA 4DTSA 2QTDA 4YR0A 3T69A 4GV9A 2OEMA 4ANDA 3FBFA 3JSRA 4ZTJA 2A40A 2HW3A 2A1BA 3ISNC 3EUNA 4M5MA 2NXCA 4K59A 2LLZA 2ASJA 1RACB 2VFSA 4USHA 3D4JA 3IC1A 4WFNL 3CWJA 3QESA 4CJLA 4DUYF 4PG6A 2D9OA 2HF3A 4H0OA 3R6LB 4ZCKA 1XR7A 4KHMA 4HVJA 4QWDA 3GILA 5LMNJ 1CLQA 1YWXA 1CZAN 3UDVA 2QMWA 2MZTA 1KLMB 1RWWB 3RBZA 2UUBK 2HAFA 2QGFB 1WSRA 1B3TA 2VA2A 2QLWA 1MWKA 2NQPA 5A8KB 1VSFA 3WNFA 2L48A 4GKJF 2GGPB 4NPOA 3HSZA 3UPFA 5KT6A 3CDAA 3T5KA 4NLUA 1PAEX 1ZBIA 3KVGA 4TYBA 4OI0A 1LOUA 1VSEA 3S9HA 3GJRB 2DNLA 3H5SA 4X65K 3ISND 3KIOA 3WDOA 2CG8A 3CD5A 4IQXA 4DS4A 2FBXA 4WK1A 3HKWA 4JHDA 5K9FA 3GYGA 5C2DA 1NOZA 3L8BA 3RMAA 4C4WA 4KI6A 1WOPA 2DBBA 4EO8A 2HBQB 1OIAA 4ELTA 1TELA 3VQQA 4JBCA 4O23A 2KB2A 2AD9A 1KAYA 2CKWA 3AGKA 2HQCA 4JI0J 1S6QA 2ASOA 3LZJA 4DR7K 1NZ8A 4KGVB 1Z2LA 4DUZJ 2OTLN 4ZHRB 3FRYA 3R9LA 1BG3A 3FZHA 3LAKA 1X5SA 1SKUB 2BJ3A 4DI6A 3OYEA 1RTHA 3QB0A 3A5OC 2UXBJ 4ZK7M 2PT0A 2BR0A 3SK3A 4BY9C 5EHHA 3LDOA 2FQQB 2XYGB 4M95A 3ENWA 4DR3K 3GJTB 3PX6A 5B0EA 1K6YA 2C1EB 1DQAA 2KVQE 2YKOA 1KQFB 3H90A 2YBVA 2OPPB 4DV6K 3IR6B 4BRDA 4U7CA 3SCXA 1JNZB 4O5BA 1HBUA 4FLTA 4NLTA 3G71S 3DLLL 2L08A 3P5TL 1S9EA 1KSPA 1CJTB 3RRKA 4NLPA 5KFFA 4IKFA 1IXKA 2A1SA 4XPEA 2MB0B 3F2KA 1U2FA 2NRVA 3DXSX 1M5HA 3T5HA 2RAQA 1RT6A 4NWBA 3ELHA 1D09B 2EBEA 4WFAQ 3VF0B 3ZYYX 2JEJA 3T1HF 1H74A 3B6BA 3TX0A 3VPZA 2DYAA 4GO7X 5KT3A 4UOFA 2CDRB 3HSTB 2CJYB 2VJVA 1LV5A 4C0BA 4H5TA 2BE7D 4URGA 3IBCB 1KQSR 4DV4K 1TP7A 1TL4A 2PI5A 4B3OA 4BC7A 4DTMA 4JI7F 4FJKA 3BBFA 5K8OA 4JV1A 5AE2A 1UVJA 1WSJA 3KYLA 1IBKJ 2EHGA 1SL1A 5AZIB 3ZC4A 4MLEA 3IWXA 1RT3B 3CCZA 3VESA 3HFVA 1HKCA 3CIMA 4UY8O 2GMJA 4YHHK 2DHGA 4ISFA 3PXGa 4P9SA 5HMXA 4BC3A 3DYAB 1BY9A 2DNYA 4WP3A 3DLJA 3SLCA 1HNZJ 3TZXA 3S1TA 3LP2A 3AY9A 4JI5J 4LFAK 1VAZA 4AQYK 1RT1A 2ZH4A 5JMNA 4UQGA 2N7YA 2R7QA 3QETA 4NLCA 3SUOA 1IJFB 5AQQA 3FZMA 3VVUA 1HPZB 1ULRA 1BHLA 1TKTA 1ZC6A 4CRJA 1Q81T 2LU2A 2Y1LB 1WI8A 3GV8B 1GFWB 4IFEA 1HNVB 4KGMA 2KDOA 5DMRA 2HYIB 4M5JA 4TY8B 1XNQF 2AJQA 4DU4A 2FPHX 2EWSA 5CQGA 1MROA 4R0EA 4USMA 4LQ9A 5IM0A 2HNDB 3PX0A 1YRTA 4RBTA 3EX7B 3EEQA 4R25A 3DMJB 2RU3A 3VF4A 8ATCB 2ZE2A 1HWKA 4WYBA 3WXMB 1IBLK 3AA4A 5HLFA 3HX9A 4UY85 1Y5LB 4J9KA 1XMQF 3ENVA 5CH7B 1CEZA 3PZPA 3V81A 2W40A 3W1YC 2V94A 4HACB 2OEKA 4OI6A 5G0RA 2HSTA 3IKMA 4DCPB 1H72C 4FLYA 2NPFA 3QEIA 1SC4B 2IA0A 1O51A 1G4CA 1Q1KA 4DSEA 2H5EA 2ZFHA 2FDNA 3L4QA 2KT5A 2X3DA 3RMDA 3I55N 4M5DB 2AZ1A 1JLQB 1N88A 4K4XA 3V1QA 4FWNA 2P9NB 2JX2A 1J5EJ 3W2VB 3QEVA 2X1AA 2ZJRL 4JK7A 4HL9A 3CETA 5HRRA 2RJZA 2E88A 4WFBL 3ITHA 5EWEA 1KDNA 2J7WA 1LWFA 3C95A 4B8CA 1D9FA 4OV1A 3ZZOA 1JIHA 2J0SD 5D0GA 1I94K 4CZMA 5HBMB 1KVAA 4CJQA 4X65F 5H1SQ 1YJNS 3Q8PB 5A6WA 4DSKA 2GVZB 3VQBA 4BRNA 4M3TA 3W65A 3GZ7A 1Q5YA 2CPXA 2FC9A 3LPEA 5HL7Q 2VONA 2JEIA 1PBAA 3H45C 2RDJA 4FW1A 3GYXB 3E3XA 4O3RA 2QLJB 1YKWA 3IS9A 2IY5B 3CVKA 2F8HA 3H3NO 3RG6A 3H6EA 2MQMA 5IWAK 4J9SA 1VRTA 1VQ6S 1RWMB 4AHSA 1Z05A 2XGQA 4Y2CA 3U1MA 1N34K 2E29A 1LW2B 4W5NA 3O8WA 2NZCA 4AFFA 4KGXB 2BJDA 1K0VA 3QFHA 2WB4A 1K8KB 4HLBA 2YWFA 4F0KA 3RUBL 4DR3F 2FYXA 2LXFA 1FVSA 3I32A 2L9DA 3PYGA 2FLPA 2Q1LA 3KDOA 2C42A 1F1BB 3QAEA 4MTPA 1GMWD 1PYSB 7FDRA 3CMES 1WG1A 5DRKA 1BDGA 3EZUA 3O6QA 2VGNA 2G0JA 4J5OA 3A4TA 1SVDA 2C2OB 5A76A 3P83D 2ATQA 4JS5A 4E7IA 2F9JA 2OIHA 3CJRA 2FLNA 1YJVA 1NK4A 3CPEA 2LFVA 4WCEQ 3DXKA 2YWGA 3HCXA 1ILYA 4PRFA 4W5TA 3DGPA 3CO0P 1YTAA 1M1KO 2ZNYA 3K5MA 4FSVA 2K1RA 2F63A 5HJXA 5LJ3Y 5C42A 1TL3A 3THTA 3PIPL 1N5YB 1B92A 1NWKA 1VQSA 1CZBA 2FJEB 1D5AA 2OGUA 4DV0J 2VKRA 3WC2A 4XPCA 4PL8A 3DLKA 5GAHP 2Q6CA 4YMEA 2GCFA 4HCCA 3U8XA 2LA6A 4H8KA 3Q8SB 2W8LA 2VPZB 4AILC 4JI8K 1KQGB 4EYIB 4KH1B 4YHHF 3TANA 3AVHA 3OD2A 4NYFA 2FVCA 2RRNA 2KH9A 2VD3A 1FKPA 4DX6A 2QFJA 2UUCJ 1JLAA 2DITA 4LSNA 5AQJA 3MM8B 3V6KA 3PHEA 1RBUA 4Y3CA 1RYRA 2IM3A 4LFAF 5AXLA 4O3PA 1T05B 5FIIA 2ASDA 3C6TA 4F67A 2MZRA 2WTUA 3JQMA 1J5OA 3D3CJ 3G4SS 4WKRA 3KLIA 3UVJB 1CULB 1Z2ZA 4BRCA 5FPDA 4TYAA 3R97A 1V3SA 1XERA 4QJVA 4X62J 3TJ9A 5DK5A 5BR8K 2VFTA 3I4HX 3QNNA 2JLGA 2WK4A 3D2FA 1UTAA 4QU6A 3EMTA 1VQ5N 4WYLA 1CG2A 1RK8A 2CQ4A 4ECVA 1TR0A 3TJAA 1ZM4A 5LXRA 4USKA 3NF7A 2OH2A 3G8QA 2NUBA 4DPUA 4ECRA 1N0VC 4FWRA 4URSA 1V3ZA 3QRQA 1VQON 2FLOA 3J7YP 4C8LA 3GG0A 3A13A 4J9VA 5C0YA 5BJRA 3BSCA 1TKXB 2DGVA 4R0JA 4CJSA 4XH1A 3LP0B 2IYIA 5LSLA 5I4MA 1FRKA 2K2PA 2VWJA 1EX8A 2CG4A 2W9CA 3MGJA 4CM2A 3HVRA 2YNFA 3AO1A 1X4EA 3UDLA 4OPHA 3NOGA 3ENHA 2IM1A 3FBCA 1FDNA 3V5RA 4GVEA 3ZLJA 4C6AA 3SI6A 4M5NA 2ZWPA 5B0FA 5AQWA 4YOTA 4B3SK 4IJAA 2QA4N 2J5AA 1SV5A 2DNNA 3Q8QB 2E5LK 3M2RB 3FEZA 3W8GA 4GVBB 3Q2TC 4AHTA 3MI7X 1REVB 3TVYA 1BO5O 1TU0B 5AQNA 1KEKA 2KQ2A 1VI7A 2YTCA 3M8SA 3AA3A 2AZ3A 2KJVA 4FJNA 2DH9A 2EFOA 7FD1A 5JVGL 3F73A 1S0MA 2E8AA 4CLKA 2NXNA 1RAIB 2G8KA 3KK2A 2V2VA 1XHZA 1MU2B 4FYVB 3AJDA 2E20A 3G0ZA 1Q8KA 3B4DA 5KGXA 5IWAF 4CGIA 5J2MA 5B0AA 1N34F 1JJCB 4HHUA 1N56A 4ZN1A 4LQ3A 4NXMJ 2OTJN 3FZ2A 3IWLA 3ZZZA 3PLAA 5CCLA 3QWPA 4ZITA 5DGAA 4FBTA 3CIZA 2XLKA 4TVAB 3EO3A 3BP8A 1T9TA 4NZ0A 1NGFA 1C2PA 1JLFA 4KAZA 4LF1A 4F04B 3NH0A 3V9ZA 2V8HA 4F3TA 3NNAA 1R7IA 1UEUA 2YH1A 1S7IA 3M8YA 4LD0A 2ALZA 3CTRA 3I9ZA 5AZJA 4LIRA 3CQXA 4PPZA 2DCUB 1E6VA 2VQEK 4JYAK 3PTWA 5L39A 4BE1A 1UW4A 2YX1A 4HEA9 3BN7A 4K43A 5F8HA 4DV1J 1NDCA 2HOEA 4EWTA 3NGSA 1S7HA 2GV9A 4KHQA 3MHYA 1NGEA 2POKA 3BDEA 3GJQB 2VG7A 2XCPA 1WUAA 4BRLA 4R79A 2GIQA 2CADA 4PWWA 4W5RA 2PEBA 2EI5A 3MXIA 4DPXA 1S1VA 3L2WA 2XMTA 1BLUA 3ENOA 4Q44A 3S7RA 3UKUA 3UNGC 1Z4UA 3C94A 4WCEL 2HHPA 3UNYA 4BC9A 3NCIA 1DLOA 1S97A 3CC4N 3JSMA 2P2CB 2KHOA 4QQBA 3K9KA 4QWBA 5KFVA 2NZ4A 2Z2MA 1UWAA 1PKUA 1V5IB 1U2RA 3TVZA 2BJ9A 1VGYA 2FBVA 3CUNA 3OYJA 4GKKF 3IR7B 2LYVA 4JI8F 5AQOA 1E4GT 3OL9A 3CCJN 4ITSA 3QINA 1X60A 4X2BA 4W90B 4RW8A 5CYQA 4CEBA 4JHDB 4B3TJ 2RQMA 4MO5A 2R7UA 3RBDA 3L2RA 1XTZA 3TAFA 2GJIA 3CEDA 4NLQA 4PKHA 1KS2A 1NJIO 3C66A 1SUQA 3W60A 3I33A 4FK4A 1APSA 1S6QB 1XNRK 1FEEA 5AJ3K 5DDQC 2ZGYA 5BR8F 2XZWA 1I6JA 1FJGK 2Z57B 1L3TA 1FX4A 1RTHB 3UWTA 3M1VA 3U02A 3IN5A 3PYFA 3MX2A 1NCLA 1S1XA 1E3MA 2H5IB 3FZFA 1IJEB 4DTPA 4Z4HA 2IJRA 2NUUG 4ZPBA 3PO5A 1WEZA 3F41A 4CYUB 4ZVUB 1BQNA 4ED4A 2NPIA 4ID8A 3BB5A 1ZBHA 4E8UA 5B0CA 1JKHA 4DSLA 3ZT4A 4IEIA 1R43A 1N33J 2CQIA 4Y28C 4D3GA 1HBUB 2G4BA 1BXNA 2HS4A 5FPNA 1S9EB 2HNYA 1DY3A 2QA2A 3QBCA 2ZGZA 2DPNA 4FZXC 4CH7A 2GZOA 5L46A 2B8QA 3WQPA 1X0FA 4C8OA 4LF9F 2IMOA 1RT6B 3C2PA 1VQNN 3V1RA 2OO4A 3VAIA 1YHQN 3QWUA 1XR6A 3GG4A 3GB0A 3LH2S 5HP1A 3N4WA 3CQ8A 4KFBA 4CH0S 4NRUA 5DG9A 4FWLA 1RBLA 2PAVA 4CJUA 4B3SF 1VQ9S 6FDRA 2FIUA 1HMVB 4P71A 2E5LF 4HUGA 1BD6A 3J7ZT 2R8GA 3AY0A 1DQ8A 4H0VB 4A8OA 1K8AO 4DR6F 3JYTA 1Q78A 4NRTA 4B3OB 1Q86T 4DTUA 4C48A 2EK1A 3IFEA 2UXDK 3OLAA 1VSKA 2ZHOA 4CNZA 4AYBD 3OYBA 5BRHA 4NE9C 2W4CA 4K0KK 4TU7A 2GELA 4G9ZA 2OPRA 5E33A 4HWIA 3CW2C 4KREA 2B3TB 3VEZA 3EXCX 4H03B 3ETOA 3LP2B 4XO0A 3RMBA 5MLCV 1RT1B 5ETSA 3TAMA 4OZ2A 2F40A 4DPYA 4YY3J 3J80U 2B4PA 3FQLA 3PRDA 1TKTB 3AVAA 5ETRA 1UKUA 3LW5C 3HSDA 2V2QA 3AXKA 5IQ6A 3BGFA 2XY5A 4ISEA 3SUQA 4PWUA 1W2BM 1KTQA 2DGUA 3L7PA 3OYNA 2HGNA 4DX7A 5IM0B 1S77D 2BVZA 5IT4A 1R3NA 3QIOA 5I42A 1VBXA 1J27A 4H4KA 5HMZA 4B9LA 1RT7A 2ZE2B 2VQEF 2CIMA 4JYAF 2FHMA 1F3FA 2N4DA 3J80Y 2WONA 5HLFB 3CCMN 5BPLA 1Y97A 3V81B 2HVHA 3VETA 1WD6A 2YKNA 1V4SA 1LQ9A 1NM1A 4A8WA 3W64A 2WSEC 2CQ1A 4ECTA 5I3UA 1S79A 2J6SA 3CJ7A 2R2RA 1VLYA 1BQMA 2DEIA 1RB0A 3SFGA 3K89A 3ICLA 3UKRB 4JKCA 2O1PA 5ETMA 1GLLO 3H08A 4WF9Q 2BOAA 1YAGA 4YB6A 4KB1A 4LR9A 2FVRA 4UOGA 5M1FA 2OFHX 3ITHB 2LU1A 4C23A 2V34A 1OSDA 1YJWN 2E7XA 5JS1A 1LWFB 4F9OA 1IR1A 2V5HG 4F4KA 4B9NA 3OVSA 1Y5NB 1RTZA 1T9WA 5D4PA 2GAHC 3GIRA 3SCKE 3MEDA 4CT9A 1BHNA 3MTJA 4N8OA 2C2MB 4LF6J 4K41A 3F5TA 3TQEA 3ALYA 3O9SA 2ZDOA 3BZKA 5JMVA 4PG7A 4OJGA 3IS9B 3TPQA 4A62A 1XNRF 4FJLA 4CZCA 5AJ3F 1K8AT 3BZCA 1VRTB 1N32K 3C16A 2BACA 1N5VA 1LAVA 2Z1JA 3NF6A 4DV5J 3FDSA 4OKJA 2HQFA 1HNXK 3PM9A 1FJGF 2YV0X 2CH5A 4CWBA 1GLBG 1U6FA 1S59A 2V8VA 4ZCMA 3PX4A 1X4GA 5FDLB 2OD4A 1QE1A 1XQIA 3G96A 3D1HA 4KPYA 5KG4A 4WFYA 3L3CA 4PXDA 1R27B 1VQMN 3A1YG 2ZVIA 1EP4A 4QW9A 2ZF5O 2AP1A 3SI8A 3DXBA 1DARA 3BGLA 3Q83A 1N54B 3VAKA 2HGMA 3GSDA 3FUYA 5LJ5Y 3IDHA 4IQMA 1ZBFA 4DR1J 2O8FB 3NAHA 1XQSC 3OHBA 2IRXA 1GT8A 2EK6A 4KTZA 4EZ9A 5J1PA 2GMLA 3DGPB 3W63A 4GNIA 3UD3P 3SCLE 4C3KA 2Y8YA 4DL3A 2K1RB 4GVMA 4KGZB 1VK8A 2P5VA 5C42B 1RWKB 3CDBA 4U67L 1TL3B 3QNWB 5GADP 1JL2A 1DTQA 3CT9A 3CMAN 5GAGP 4EBDA 2Q2RA 1FD2A 1R89A 2DR6A 2WZ1A 4KBOA 3DLKB 2FF3B 3FJ2A 4PEOA 5KQDA 2WVCA 4CLLA 4O3OA 4V19X 3A5NC 1HNWJ 5EDWA 2F9DA 1HR0J 2GW8A 1K0TA 2CNLB 4OZ1A 4K0KF 5EX3A 1IKYB 4Q8EA 1UP1A 1DEJA 3LP1B 3K8VA 4V1Ak 1FKPB 1UFKA 1JLAB 4LSNB 5HI7A 1SKSA 4FS1A 2YQ0A 4YOXA 1YJRA 4JKGA 4ECWA 3C6TB 4TLQA 2P9PA 3KLIB 2W2PP 4JI6K 4CJWA 3EDRB 3ZSQA 4FJHA 4PKDB 2J9CA 3AO5A 3DLBA 2QA4G 3BF4A 1FK9A 4ZPTR 2BUPA 3THXA 3KK3A 2EFVA 3D2FB 4LREA 4ID5A 1JXEA 4RNMA 4N77A 5AQGA 3C6AA 3JS6A 4FJ8A 4QYZK 3J7YI 2BJ1A 3MMAA 5G4DA 3I9V9 3V6DA 1CJUA 2LQ5A 2JFKA 3W9IA 2DNMA 4DQIA 1N52B 3VQ5A 4O44A 3KFWX 1RJJA 4MK7A 4M3RA 3ZSOA 4RNNA 5J2PA 3HHKA 3WXKA 2J0XA 3ZTOA 2OZMA 1UETA 3TUZC 2BGGA 3HK2A 3P4UB 3D7EO 3O8MA 2V4RA 1SQGA 3CCRS 1S4FA 4CD1A 4TNOA 1UOCA 1RBTA 4K8ZA 4MK8A 4AL7A 2W9CB 2UUAJ 5KFYA 5DM6Q 2A5XA 1KR4A 1NH8A 4EFAC 2YNFB 3EZOA 2F9TA 2GHVC 4JN4A 1HWJA 1FKOA 3NRBA 4FWQA 3BN4A 5GIPA 3MOJB 3OTOJ 1GOAA 4FM2A 1V4TA 1Q7YT 2IMWP 4LF4J 1BIZA 1CQMA 1SV5B 4DTXA 3ZFVA 4WF9L 1YRXA 1L3VA 1U2CA 3SQ1A 1ASVA 1H73A 1VR6A 4MQ3A 4PYAA 3VEVA 3NNCA 2FGOA 2D0CA 2CJAA 3CPWM 2HEKA 2HFSA 3O6WA 1FWLA 3AHPA 5B09A 2A6AA 2JHEA 4EMDA 3VF6A 2IM0A 2WW8A 2E44A 4ZJOA 2NRHA 3THYB 3KK2B 1Y9OA 4DX8H 4BRMA 1OO0B 4JAXA 3U6FA 3HP6A 4YR3A 2D41A 3KK1B 4F4YA 3VZIA 1RHKB 2CAJA 5J2MB 4XH5A 3WEEA 2YKAA 3K5LA 2KM8B 4UTGA 1HNXF 1X3MA 3WX4A 2AP6A 2AX1A 3QT5A 3KMSA 4ANCA 3P8BB 3HVTA 3CF5Q 3CPWR 2B4OA 1RXOB 4IO1A 3Q89A 3BQ2A 2NRWA