1QE1A

Crystal structure of 3tc-resistant m184i mutant of hiv-1 reverse transcriptase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE, SUBUNIT P66
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 121
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1qe1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qe1A05
4DQQA 3KLVA 1RT5A 2XGPA 4RNMA 3HVTB 1J53A 2VA3A 4NLOA 5KG7A 4OLBA 4O0JA 1WSHA 2YKMB 3LP1B 1S49A 4DL2A 3D5MA 2A1RA 1D9DA 2DFEA 3IRXA 2FVRA 3CJ5A 1HMVA 3QEXA 3CFPA 4U6PA 1DLOB 2ILYA 3DRRA 4E89A 4DL3A 2WTFA 4PQUB 1S9EB 1SL2A 4YMEA 4GMJB 1TV6B 2WB4A 1WSGA 3DRSB 2OH2A 3DLGA 3QINA 4CE9A 1RILA 3NCIA 2D7SA 1VSJA 1RDCA 3WNHA 4B9TA 3SV4A 3KHRA 1RT7B 2F8TA 1QSSA 4NLYA 3QYYA 4KI6A 1JLAA 1TL1B 3UDLA 2XGQA 3L2WA 1C0TA 4AHRA 3NF8A 3OL8A 3OS2A 4ECQA 3RAXA 4DSKA 4BE2A 5CYMA 1ZBIA 4FS1A 3H40A 4QWDA 4DS5A 4Q8EA 3TAMA 3ZT0A 4G1QB 3AVNA 2BR0A 2KW4A 2ETJA 1SKSA 5KG2A 3ICLA 2YNIB 3M9MB 1KHWA 3SNNA 3TQ1A 3NF6A 3VQQA 3AVMA 4W5TA 3M9NB 3ISNC 4QAGA 4BWMA 3KLIA 4CJTA 2RPIA 3Q8SB 4KB7A 1RNHA 2HVHA 5T7BA 3HK2A 4CK2A 3SUOA 2PYLA 2XC9A 3GV8B 1XR7A 1RT2B 4F3OA 4DFPA 4TY8A 3DYAA 4DFKA 4KKOA 4ZP7A 1WSFA 4NLDA 1BI4A 5JUMA 1YVFA 4RW7B 5J2PA 3DMJB 1JLEB 1TK5A 2IBKA 1U4BA 3M8SA 4HHTA 2R8IA 3UR0A 1RT6A 3C94A 3HSTB 1RA6A 1WLJA 5C42A 4OLAA 3KKSA 3QZ8A 2ASJA 4IFVA 2E6LA 1FK9A 3HL8A 1BQMB 3DOKB 1X9SA 1GX5A 2ASLA 4PY5A 4KHSA 5HROB 4FJ8A 3SFUA 4IKFA 4MK7A 4FK2A 5KTQA 3AV9A 3SJJA 4M45A 1NNDA 4DS4A 3QO9A 2VWJA 3KJVA 1Q8IA 3NGZA 2IS3A 4WFZA 5L1JA 5KG4A 4ID1A 4CEBA 4DTOA 2OPSB 1QSYA 1VSLA 4BACA 4DQSA 2W7OA 5CZ1A 4IG3B 4CGDA 4RW6B 1JLQA 4E1MA 1TL3A 3DM2A 2YKNB 2HWHA 4H4MB 4E7LA 2WK4A 3OY9A 5KT3A 4FJ9A 1T03A 3AVIA 5D3GA 5I3UA 3VQBA 3KMQA 3CDUA 3KLHA 2O4IA 3KOAA 4DTNA 3PVXA 2AWZA 4ZP6A 4EP4A 1UOCA 3HPGA 1S1WB 3QGHA 4CHPA 1WSJA 5KFHA 1S1UA 4DL5A 2FBXA 1NHVA 3OYGA 3E51A 4WYLA 4O5BA 5HRSA 2E6MA 1DTQB 3I5BA 2QV6A 4CJQA 3IS9A 3QNNA 3KLGA 5KFJA 5SZTA 4QWEA 1U48A 2G8VA 2VG5A 3SUQA 3DRPA 4NLQA 5KI6A 2Z1GA 4Q8FA 4PWDA 4F4YA 3KIOA 2F96A 5KFIA 4KHMA 3SPZA 3OLBA 3OS1A 1IKXA 2AX1A 2XWYA 4DSJA 2Z1IA 4TLRA 1WSEA 5KG0A 4W5RA 3OYBA 4B9LA 4I7FB 1SL1A 4NYFA 3V4IB 4CJKA 3OYDA 4ZPCA 2IAJB 4TXSA 5KFGA 3CM6A 2YNFB 5KFTA 1RYSA 1J54A 1Q9YA 2QXFA 3NAEA 5KRTA 1R0AA 4IKAA 3OYLA 4Y34A 1HARA 4NLGA 1ZBLA 2AGPA 4IH5A 2R8JA 4Z4FA 1TKTA 4LY7A 1LW2A 1A5WA 2P51A 1LWCA 2W8LA 5KFFA 3S9HA 2HB5A 4F4KA 3ZSYA 1S6PA 1Y97A 4CJFA 1QUVA 4ED8A 2KTQA 3GIKA 3PX0A 3V9SA 1OS5A 3DLEB 1QE1A 3OYAA 2FLLA 4B08A 3NH2A 4LSNB 3ITHA 2V9WA 4W5OA 4CIFA 4DSEA 5J2NA 4CFDA 3QIPB 1RT1B 4K4ZA 3JYTA 2RDIA 1IKWB 4Q43A 4N76A 5F9LA 4DTRA 2CJQA 4CF2A 4H4OA 1BCMA 3I5CA 4R5PB 4FM1A 5KFWA 3F9KA 3HJFA 3H5YA 3PW2A 4KO0A 4EP5A 3DLBA 2ITGA 5KGWA 1YVUA 4KHNA 1RDRA 4NLRA 3T19A 2JGUA 1JXLA 1KFSA 2OPQA 3KLFA 2J6TA 4KTQA 4CJEA 3KK1B 3HVAA 1NOZA 2O5DA 1JLFA 3OYJA 5DQGA 2AQ4A 4Y1DA 1HPZA 2PZSA 4O4GA 3RTVA 1A5VA 1RTJA 5SWMA 3PUFA 3DOLB 3Q8RB 1T7PA 4FM0A 3O3HA 1L5UA 3AA5X 1VRTA 1ZBUA 1L3TA 5KFPA 2KZZA 3FSIA 2Z1JA 2ATQA 4M3YA 2BE2A 3M8QB 1JKHA 1SV5A 4J9SA 4RU9A 3AA3A 2W9BA 5KFAA 4EYIB 4CFAA 4I2QB 1IO2A 3LDSA 3VQSA 4CFCA 4M3TA 1S6QB 2ZQBA 3VQDA 2HHTA 2X6NA 1RTHB 4NRTA 2C2DA 5FRNA 4ED3A 3MFIA 3QLHB 1CLQA 2IGIA 2JEFA 4MFBB 4Z4EA 4R8UB 1LWEA 5KG5A 4JRPA 5KFBA 3U3GA 1FKPB 4OPKA 1JX4A 3PR5B 4FBUA 1GOBA 1MU2A 3HM9A 4XPCA 1T05A 4Q0BB 4K8ZA 4FVMA 3OS0A 1IG9A 1ASUA 4DQPA 1ZBFA 3CYMA 2XY5A 4AH9A 2QK9A 3AVLA 4FBTA 3Q8QB 4B8AB 3CDEA 4B9NA 1XC9A 1Z4UA 2AGOA 3CG7A 1FKOA 4FJ7A 5C24B 4ZP8A 1GOAA 4JS4A 3IN5A 4NCGB 4NCAA 4NCBA 1TK8A 5KFVA 1N48A 1WN7A 3S3OA 3V9WA 1KLNA 4J9MA 1TVRA 3LZJA 4M3WA 1EETB 3NBPA 3AVBA 4BDYA 1Z25A 5KFEA 1SH3A 2QKBA 3TAGA 2HMIA 4O3OA 4ZHRA 1QS4A 3QEVA 3V6DB 3ZSXA 4LH4A 4O44B 1IKVB 5DMRA 4QCLA 3NGYA 3QERA 2FVQA 1YT3A 3P5JA 3C95A 1HNIA 4J2BA 4JLHA 1S0NA 4DSIA 2HHWA 1S9GB 4FW2A 4ELVA 3TABA 2C2EA 4NZ0A 5EUHA 5C25B 2OYQA 1LW0B 5J1EB 4HUEA 1C1AA 3H08A 4CJUA 3NL0A 2BRKA 5KFNA 1CXUA 3HVTA 3RWUA 3TAFA 4K4WA 4BWJA 3BQ2A 2YKMA 3LP1A 4EYHB 3VQAA 3AVCA 3B6OA 4K4UA 4E7KA 5KFXA 4ZTFA 3HT3A 3THVA 1DLOA 4KE5A 1UA1A 4E19A 2OPPB 3KD5E 4PQUA 4DL7A 2RKIB 4TYAA 4RNOA 1JLGB 1TV6A 1O1WA 3AA2A 3DRSA 4CESA 4DMNA 2D5RA 1ZTWA 3QNOA 1S5JA 1QHTA 2FVPA 4RNFA 3P1GA 3KD1E 3I0RB 3ULDA 4CGHA 1RT7A 2WOMB 4X2BA 1WAJA 2UVRA 2G8WA 3BJYA 3RRHA 2VWKA 3WNFA 1UA0A 2UVWA 1TL1A 2Y1IA 4WXWA 4Q5VA 3AO3A 3HP6A 4ED7A 2XY6A 4BDPA 3RAQA 3V81B 4URQU 3LPUA 3ZT4A 3SFGA 1NK8A 4OJRA 3V1OA 4CJLA 1TKXB 3C6UB 3K58A 1C1CB 4G1QA 4CJ3A 3RMDA 4NRUA 4ED6A 3GIJA 3L2VA 3KLEB 2YNIA 4J9QA 3IG1B 2R8HA 1Z26A 4K4TA 4IRDA 1RT3A 2YHAA 2G8KA 4DTUA 4DSLA 4IBNA 3NGDA 3SQ2A 1RT2A 1RBTA 2VA2A 1RTIB 1HYVA 1IKYB 1S10A 2VG7B 3I5AA 5KFKA 4RW7A 3T5HA 1S1XB 3DMJA 3KK2B 1JLCB 1JLEA 1TKZB 4UQGA 1D8YA 1ZTTA 4ZVGA 3OHAA 4LH5A 3NH0A 3MEGB 3O4NA 1D0EA 3OYEA 2R2SA 3OLAA 1TK0A 4DLEA 1BQMA 1T94A 2HNDB 1W25A 3K5NA 5L9XA 3EYZA 4KAIA 3FQLA 3UPFA 5HROA 2IM0A 3G0ZA 5HRPA 5HP1B 4MIBA 4F2RA 4KI4A 3PJXA 2D0AA 2HWIA 2D0BA 2PY5A 4DG1B 1NKBA 2QKKA 1A5XA 3N6NA 2LSNA 3AVFA 4IR1A 4CK3A 1X9MA 4ECWA 1C6VA 5DG9A 5KT4A 2XCPA 2OPSA 4KSEB 4XPEA 4IG3A 4KPYA 4KHYA 3CO9A 4RW6A 4ZVFA 5CY4A 2YKNA 1GOCA 3QEIA 4H4MA 5F8NA 3BSAA 1LWFB 3QEPA 3QIOA 4YR2A 4URGA 4FLTA 3MR6A 2WCXA 5KFZA 1CSJA 1S1WA 3SI6A 3FRZA 3I8DA 3PZPA 3MEEB 1QQCA 2Z1HA 3MR2A 2DPJA 4CJPA 2FBTA 1VSIA 1NK4A 1DTQA 3RR7A 1EKEA 4FZZA 5F8MA 1TAQA 3K5LA 4F4XA 2JEJA 4FYDA 3PJWA 1TKDA 5EDWA 4FLXA 4FJJA 5KFRA 3B6PA 5F9NA 3I0SB 3PO5A 3IGVA 2OZSA 1QAJA 3V6JA 3RMAA 3MF5A 3QEWA 4MH8A 2IM1A 4J9PA 2YHBA 5F8HA 3NAIA 4Z4CA 5KFUA 3O3FA 1VK0A 4E3SA 3MECB 4TN2A 3MR3A 4AHCA 1ZETA 4E0DA 4I7FA 3KHGA 4O0IA 3V4IA 1CXQA 4LSLB 4KV8B 3ZT1A 3OYIA 4FJIA 2IAJA 4CIGA 1EP4B 2YNFA 4ED0A 4EZ6A 3PW5A 5C5JA 3NMAA 5KFCA 4YR0A 4Y2CA 3SZ2A 4Z0UA 3SQ1A 2IM2A 2RN2A 1HYZA 4IFVB 4BE0A 4QWAA 2DPIA 3LPTA 4KTWA 1BHLA 2UUWA 2DFHA 3CJ0A 3G6YA 1RT4B 4ED2A 4CEAA 3DLEA 1SH2A 3BQ0A 4O3RA 1QAIA 4LSNA 3DLKB 1JXBA 1W0HA 3KJVB 1VSEA 3LP2B 3QIPA 1RT1A 3VN5A 1LAVA 4DTMA 1TP7A 4ELTA 1RDBA 1U49A 1IKWA 1SUQB 4JV2A 2VG6B 3BGRB 3MTKA 4R5PA 3KK3B 4L8RB 3G86A 4M95A 4ZP9A 4YP3A 3AO4A 3OJSA 2EHGA 4EO8A 4CGGA 1VRUB 3VQ7A 2D41A 2IJFA 1D5AA 3ISND 3OSPA 2JEIA 3KK1A 3RB4A 3FFIB 5DGAA 4KFBB 3M8PB 4WYWA 3L2QA 1RBRA 1L3SA 2OPRB 3QIDA 3L2UA 4I9LA 3NGIA 3UIQA 3N6LA 3HKWA 3HYFA 4CCHA 3D28A 3GIMA 4FM2A 4IH6A 4C8LA 5KT2A 3CQ8A 3TVKA 3DOLA 3HP9A 1NJWA 3L2RA 3IAYA 1KTQA 4N47A 1NKEA 3JSMB 4EZ9A 2XI3A 3KNAA 4Y3CA 3M8QA 1NK0A 2YNGB 1KLMB 1RA7A 4CEOA 2P1JA 3A2FA 4I2QA 1YTUA 3BR9A 4W5NA 1B9DA 3AVHA 3ZSOA 1S6QA 3MEDB 3QZ7A 5EWEA 4K4SA 4FLYA 1RTHA 3CJ4A 2AGQA 2DY4A 4CGJA 5HLFA 1QTMA 1K6YA 3RB6A 5FDLB 3QLHA 4N56A 2IOCA 2D0CA 4WFYA 2RF2B 3SQ0A 4C8OA 4MFBA 4HTUA 4R8UA 1RAJA 1ASWA 4WFXA 4AHUA 1ZYQA 1UWBB 4CJ5A 4C8MA 1T3NA 1S97A 1SL0A 3TWHA 4Q0BA 1RYRA 5F8LA 3L3UA 3DLHA 2B6AB 1NJZA 4RUCA 4Q45A 3QESA 2JLEA 1N5YB 4QPXA 4RW9B 1S1VB 4OKJA 3ZSQA 4WXOA 1I39A 3HO1A 4AHSA 2UUTA 1KVCA 5C24A 3CJ3A 3ITHB 5HRRA 5I42B 3TAEA 1T8EA 4NCGA 4ECTA 1S1TB 4LD0A 4EO6A 4OGEA 4B9UA 1JXEA 3PV8A 1C0MA 4MK9A 1EETA 4DTPA 1KRPA 1MMLA 3C6TB 4TSXA 5FRMA 1J9AA 3VQCA 4CECA 4KO0B 2B4JA 2W8KA 4DEZA 4KHWA 3V6DA 1BQNB 2YNHB 4DLGA 5JS1A 4PUOB 4I2PB 4RW8A 1IKVA 1NJXA 4ECZA 2B43A 5F8JA 5EWGA 4F3TA 1I6JA 4KRFA 2WHOA 1D9FA 3BSNA 3V1RA 1S9GA 1HQUA 3V9XA 1JIHA 3RBEA 2WONB 1TAUA 2D3ZA 3GV5B 2G8UA 5C25A 4CJWA 2WRMA 3H5XA 1XHZA 2W7PA 4QW8A 2GC8A 4JS5A 1LW0A 5DK5A 1REVB 5J1EA 4OKEA 4DU3A 3K5OA 3CFOA 5KFQA 1NJYA 1VRTB 4O3PA 1JL2A 5HBMB 4W5QA 1HYSB 2JC0A 3LP0B 4RNHA 4J9NA 3N6MA 3VA3A 3VQ4A 2FC0A 3DDKA 4IQXA 3SQ4A 3OHBA 1SKWA 4KTZA 3LZIA 3T3FA 3OL9A 3T5LA 2OPPA 2F8EX 1XWLA 1XR6A 4FCYA 1NHUA 5CYQB 1WSIA 2RKIA 4XIUA 3NH1A 4KREA 1JLGA 4ID5B 2ZE2B 4Y1CA 2ZD1B 4B3OB 1XI1A 3K5MA 4ICLB 2P5GA 2F8SA 4RG8A 5DLGA 3I0RA 3PX6A 3ZSWA 4FZXC 1HQEB 3FDSA 2WOMA 2XY7A 3RR8A 4IG0B 4CHNA 3ZSZA 2NUBA 4U7CA 3V81A 4J9OA 3S3MA 2RDJA 4DL4A 4ZPDA 1SH0A 1TKXA 3C6UA 4M3ZA 1C1CA 3HVWA 4CFBA 1VSHA 3HPHA 1NOYA 5DLFA 4IR9A 2ATLA 2KFZA 4IFYB 1BIUA 3KLEA 3ZT3A 4RW4B 4NLSA 3TAQA 3GYNA 5J2QB 3IG1A 2E9RX 4ZVHA 3DLRA 3NAHA 3SUNA 2HNZB 1S9EA 3PX4A 4DL6A 2IC3B 5KG6A 1S9FA 1N6QB 1J5OB 3AVAA 2Q3SA 1C1BB 1RTIA 1IKYA 2VG7A 2V4QA 4FJHA 4LQ9A 5DG8A 4IDKB 4M3UA 2W9CB 2I1RA 3SUPA 3KK2A 1JLCA 1HJRA 2DFFA 2B5JB 3HPOA 3SCXA 1RBUA 4QW9A 3MEGA 2G8FA 1C0UB 5L1KA 3ZSVA 4K4XA 1VSMA 4F8RA 4CF8A 4H8KA 4FXDA 4GW6A 2HNDA 5J2MB 5EU7A 3PHEA 5K14B 2ILZA 3O3GA 2IM3A 3TAPA 3TARA 5L1LA 5HP1A 1JLBB 2E9TA 3DI6B 3VQ8A 2GUIA 5KFLA 4DG1A 2J6UA 3NFAA 1KHVA 4CGFA 3LP3A 2ASDA 4K4YA 4MKBA 2BRLA 5F8IA 3L3VA 3AO5A 3V9ZA 3OVNA 2HNYB 3CDWA 4AHTA 4GVMA 3V6HA 5KFDA 4JRQA 3QGIA 4CJSA 4NLVA 1LWFA 3AVKA 1K1SA 2J6SA 5T14A 4EEYA 1HRHA 2HAIA 3FQKA 4RNNA 4H54A 4KB1A 1L3UA 4OPJA 1HNVB 4O3NA 4MKAA 4B9SA 4ELUA 4G3IA 2R2RA 4CHZA 3RBDA 3LWMA 2BQ3A 3QETA 3MEEA 3QGGA 3DOKA 3H59A 1F21A 4KHRA 4CEFA 4R0EA 1DTTB 4QWBA 1W9HA 4FLZA 4HKQA 1RTDB 1G15A 3SYZA 2I5JB 2IA6A 3MXIA 4WE1B 2HHXA 3E01B 2AU0A 1LAWA 2BANB 5KFSA 4ECSA 4FLVA 1RT5B 3V6KA 4K4VA 1KSPA 2BQUA 3I0SA 3H4DA 4ZPBA 3IRXB 2FVSA 3L8BA 3PY8A 1HMVB 3AVGA 3T5KA 4NLXA 3OSNA 3DRRB 4QOZB 1TGOA 1RT3B 4PA1A 3MECA 4NLWA 4AHVA 1NKCA 1N56A 3TR8A 4Z4IA 4ZTJA 4CF1A 3DLGB 3ZSRA 2HHVA 4LSLA 4KV8A 4C8KA 5KFYA 1LV5A 2R8GA 1EP4A 3AO1A 4J9LA 4DU1A 3H2LA 2UVUA 3EZUA 3WNEA 1KFDA 4LQ3A 2X78A 3LAMA 1JLAB 4AILC 3ZCMA 1C0TB 4ECXA 2O4GA 4IRKA 4FJNA 4MIAA 4JV0A 5CYMB 2R2TA 1JL1A 2Y1JA 4ZMMA 3SI8A 3TAMB 3TANA 2FLPA 5KFOA 1RT4A 4CERA 4EBCA 1YTAA 3DLKA 3LANA 2KZMA 1B9FA 3KLIB 3U3YA 2C28A 3D45A 3LP2A 1D1UA 3AA4A 4HVJA 4M3RA 1U47A 5DGBA 1SUQA 3MXMA 1Q9XA 4TY8B 3DYAB 4HCCA 3RB0A 4KKOB 4FJKA 2VG6A 4FLWA 2EX3A 3BGRA 1BI4B 4FJGA 4JV1A 3KK3A 1WAFA 3KHHA 3VA0A 4CHYA 5J2PB 3G10A 4CEDA 4ED1A 2C22A 1RT6B 4RZRA 4DQRA 4Q44A 1VRUA 3U6FA 2X74A 4DFJA 2R7YA 5C42B 3LALA 4C8NA 4DU4A 4B8CA 3BDPA 1FK9B 3FFIA 3OYKA 5FROA 4KFBA 3EY1A 3S3NA 3M8PA 4DF8A 4GC7A 4CHQA 4FW1A 3VQEA 2ZKUA 1U04A 3BQ1A 2OPRA 4WZQA 4J2EA 3K57A 1VSFA 4Z4GA 4B9VA 3QO9B 4DTXA 1RBVA 4DQIA 4IRCA 2G8HA 2W9AA 1BISA 2UVVA 5KG1A 4NLUA 3JSMA 1BGXT 1VSKA 4CK1A 3ASMA 1JLQB 1TL3B 1C2PA 3DM2B 2YNGA 1KLMA 2DTUA 3NF7A 1T03B 5D3GB 5I3UB 3AVJA 2FLNA 4OL8A 3MEDA 4K8XA 4OVLA 5KT6A 2OA8A 3KLHB 4KB0A 2FBVA 3P83D 2HHQA 2GBZA 4HUFA 5CZ2A 5JS2A 1U45A 3SV3A 3NF9A 3HVRA 4DFMA 3KHLA 4ECRA 4CGIA 5FDLA 2RF2A 4FZYA 1S1UB 1I3AA 4KHQA 4CEZA 1KCFA 4KHUA 3K2PA 3GQCA 3OYHA 3M9OB 1UWBA 4F2SA 3IS9B 3KLGB 3HHKA 4FJ5A 4DWIA 3Q8PB 2B6AA 2QE5A 3G6XA 2VG5B 4HUGA 1UAXA 1N5YA 1QSLA 3DRPB 4NLTA 4URSA 4FJMA 4RW9A 1S1VA 3NKYA 3OYMA 4PWDB 3EZ5A 2GIQA 1X9WA 3IGNA 4N5SA 2XCAA 5EWFA 4YFUA 1IKXB 2IDOA 3CIZA 5I42A 4FJXA 1BL3A 4FJLA 1S1TA 2IJNA 5F8GA 4WZMA 2OZMA 1N4LA 2AX0A 3RMBA 1VSDA 3C6TA 3MXJA 1NK7A 1CZBA 2FJVA 1L3VA 2GV9A 3VQ5A 3OL7A 2XI2A 1FKPA 1R0AB 4YNQA 1S48A 1B92A 1BQNA 2YNHA 3RB3A 4PUOA 4I2PA 2W42A 4Y2AA 3CWJA 1TKTB 4F50A 5HRNA 4JUZA 3VQ9A 1LW2B 3MFHA 4CEEA 2JC1A 1X1PA 1LWCB 2XO7A 2FJWA 2WONA 1S6PB 4CHOA 4ZVEA 5DQHA 1IH7A 1QE1B 4ECVA 3PO4A 4B9MA 3KKRA 1REVA 3EPGA 3VQ6A 1SKRA 4MK8A 4CJ4A 1CZ9A 5J2NB 4HCBA 4QWCA 3HXMA 3JYTB 3CJ2A 5HBMA 1HYSA 3LP0A 4ECUA 3NHGA 2G8IA 1ZBHA 4H4OB 4BE1A 2E4LA 3BREA 2ALZA 4M3XA 5KG3A 5CYQA 4O44A 4ID5A 4OKKA 2ZE2A 5L1IA 5HLFB 2KQ2A 2OPQB 3KLFB 2ZD1A 4B3OA 5DG7A 4ICLA 3T5JA 4EBEA 3OYNA 2JEGA 1JLFB 1EX4A 3OJUA 3NDKA 1HQEA 1HPZB 3V9UA 4O4GB 2HHUA 3RMCA 3H5UA 2PYJA 3CM5A 1RTJB 4IG0A 2E9ZA 1RCHA 1WNEA 4O3SA 2FJXA 3LWLA 2BDPA 3LAKA 4E7HA 2FVCA 5DQIA 5KT5A 3TI0A 3PW4A 3ALYA 2BE2B 3H98A 1JKHB 1SV5B 3CFRA 1K1QA 3T1AA 2IMWP 2W9BB 4IFYA 5KT7A 4RW4A 3UQSA 5J2QA 1WNSA 3O4QA 1BIZA 1ITGA 2AJQA 1GX6A 2HNZA 2HVIA 3D0PA 2IC3A 2EC0A 4F4ZA 2A1SA 1U09A 1N6QA 1J5OA 1C1BA 4TYBA 3OYFA 1LWEB 3PR4A 4FK0A 4IDKA 2W9CA 5KGXA 2XHBA 2BQRA 3KMSA 4XO0A 4KBIA 1MU2B 4RW8B 2B5JA 4J9KA 4OGCA 1T05B 2R8KA 4TY9A 1S0OA 5KRSA 4DF4A 2HW3A 4O55A 3SPYA 1C0UA 3ZT2A 4IH7A 3H5SA 4F4WA 4J2AA 4EBDA 4NYNA 4E1NA 2KFNA 1HQUB 1KVBA 1RDDA 1NK9A 4M42A 3RRGA 1XR5A 4E7JA 4ECYA 5J2MA 4BDZA 5K14A 3WNGA 2C2RA 1RDAA 1FKOB 4Z4HA 4TQRA 1JLBA 3DI6A 3OL6A 3GILA 4DSFA 4NLPA 1IM4A 2V0NA 4CEQA 4YQWA 1RBSA 4KAZA 4TQSA 4MQ3A 2D3UA 1TVRB 2P5OA 1S0MA 2CKWA 5E41A 3NBPB 3EPIA 3GV7B 5JXSA 1FXXA 3G6VA 4M41A 4E7IA 4J2DA 2HNYA 1S4FA 2R2UA 4K50A 4I9QA 2GIRA 3F73A 3OYCA 1KVAA 1TQLA 1ASVA 3CVKA 2HMIB 4CJRA 4CIEA 1S1XA 4ZHRB 3H4BA 3BSOA 3VQPA 4IOBA 1TKZA 3MAQA 1NK5A 2X6SA 4CF9A 4N41A 2XRIA 4RUAA 1HNVA 4HYKA 1EXQA 3K59A 2BGGA 4FS2A 2HHSA 4J9RA 3GIIA 3PW0A 4CJVA 5KFMA 4FLUA 4DTSA 1HNIB 4CF0A 4FK4A 2V4RA 2XY8A 1NK6A 3KTQA 3MR5A 1BCOA 3AO2A 2FBYA 2YV0X 3BSCA 4YR3A 1DTTA 3M8RA 4DTJA 4ZPAA 1RTDA 4O4RA 2I5JA 4M94A 3V1QA 4WE1A 3PW7A 4O3QA 4NYZA 1XHXA 4GC6A 3E01A 3NE6A 2BANA
chains in the Genus database with same CATH superfamily
2N3LA 1U2CA 1RT5A 1JK9B 4RNMA 4X4TA 2EVZA 1PAEX 4CLYA 1DFDA 2VKZG 1K0TA 4YB7A 1D9DA 1HMVA 4QU6A 1WUUA 4P74A 1U2VB 2P9NB 4E89A 2AJ0A 1U02A 5B0DA 2P9KA 1ULRA 2VDHA 3LPEA 4PXCA 4GMJB 2WB4A 1WSGA 1ZXOA 2O8BA 2OH2A 3DLGA 1U1LA 4CE9A 2YVSA 2EC2A 3T6JA 2Q43A 1VSJA 1M5HA 3S1TA 1RDCA 2GHPA 3SV4A 4LRCA 1U2RA 1RT7B 2F8TA 4KRWA 5BREA 2UXBJ 1QSSA 4NLYA 2CAJA 3QYYA 1JLAA 2KB2A 1C0TA 4AHRA 3OS2A 5CH7B 4DL0C 4BE2A 5CYMA 1ZBIA 4ZK7M 1X31C 4DMZA 3ZT0A 2R42A 3AVNA 1ILYA 1NDCA 3W61A 1KHWA 3TTCA 3POTA 4W5TA 3M9NB 1HPMA 4QAGA 3KLIA 1RWKB 3D3CJ 2FSNA 3CCLN 4KB7A 2O3DA 3S41A 1LEOA 2HVHA 2FZCB 3EDRB 5K20B 5JVGQ 3HK2A 4CK2A 3SUOA 4WF9L 2LLZA 1FRJA 2U2FA 1XR7A 4Z7CA 4DFPA 1BI4A 3TOQA 3L3CA 3KKFA 3PKYA 4OYPA 1ZC6A 1TK5A 2RDDA 3CJBA 4QS8A 4HHTA 2ZZTA 1FO1A 3CC2N 2M5YA 3S8SA 1RA6A 4P10A 2AW0A 3MD1A 2PMZD 3KKSA 3GSDA 3PHTA 4DR5K 2FQQB 1FK9A 1X9SA 1J6ZA 3BYPA 3EWGA 4PY5A 2CADA 1B7YB 4IKFA 2A3JA 4MK7A 4DR7J 5M1KA 1J27A 3GWCA 3QO9A 2EPIA 4WFZA 5L1JA 2K1RA 2VODA 4ID1A 2D74B 2OEJA 2HRYA 4CEBA 1VSLA 2H3GX 3Q2SC 2EFVA 1BD6A 2CWXA 5GIOA 2QEXS 4MMOA 1YJNN 1HNWK 3DM2A 3Q24A 2WK4A 2HHHJ 4JI6J 4FJ9A 3DRYA 1F9EB 2AF6A 1GLBG 4AUKA 2CQGA 3O9UA 2WVBA 3EEQA 3QGHA 5F2RA 3HULA 4WCEQ 4GVEA 1FWKA 3WIUA 3E51A 4O5BA 4A8WA 3H2UB 2C1EB 4B1VA 4LFBK 3OD2A 3ZXWA 5SZTA 4DPXA 2DNQA 4UZBA 4DUYF 4LSZB 3WQPA 3BH7B 4J7CA 2OSRA 4BVPA 1W2BR 1N36F 2XYPB 3NS5A 4P7VA 5K9FA 3EX7B 2MHEA 2E2QA 2KRBA 4FYVB 4CO0A 1VQ6S 4G1PA 3BO3A 2DB1A 1A9NB 1NH7A 3OLBA 4FF3A 3NGKA 3CJRA 3QT8A 3BGUA 1PGZA 5KG0A 1MW7A 2A0FB 1SJ3P 1X3NA 4I7FB 4EMDA 3V4IB 4ZJLA 4ZPCA 5CA5A 5ADXA 2CPJA 4DOZA 5A8KB 4TXSA 5KFGA 2DITA 3RU0A 2YNFB 1VQ8S 5KFTA 1J54A 1VLYA 3NAEA 5KRTA 1R0AA 5HL7L 4IKAA 1WDTA 2E7WA 1NUEA 4Y34A 1HARA 4NLGA 1M1GA 4IH5A 4CNYA 1RHRB 1TKTA 3O6QA 1M1KT 4JK9A 1A5WA 1CBKA 3M8YA 2FDNA 2W8LA 2XMMA 4F4KA 2HB5A 4U7UK 1ZA1B 2VQFF 4ED8A 1YZ7A 3PX0A 3K0JA 4ILJA 1VLOA 4B08A 1RACB 1VK8A 2HIYA 2CG4A 2ZVSA 4CM0A 3M8WA 2RDIA 5F9LA 1K73O 2DNPA 3ULEB 5BYSA 3TJAA 2VOPA 3EXCX 2NRXA 3PW2A 4KO0A 2CH5A 1YVUA 4NLRA 4DHVA 4I68A 1LOTB 3DU5A 5GMKa 4K2JA 3DGPA 4ZPVR 1F5BA 1NOZA 3L7UA 2O5DA 1JQGA 4U67Q 2AQ4A 3MZIA 3PYGA 2BUNA 2PZSA 1A5VA 5IWAF 1RTJA 3ILLA 1HJOA 1J5EJ 2FY1A 5JICA 3DOLB 3Q8RB 1T7PA 1VRTA 1HKBA 1ZBUA 2EFQA 2K8GA 3I4PA 2NXEA 1L3TA 3FSIA 2Z1JA 1NBWA 4M3YA 2BE2A 3GIRA 3M8QB 1FVQA 1JKHA 3OTEA 4BVOA 4EYIB 4CFAA 3UDEA 4C0HA 2CA9A 1S6QB 2IVNA 3SCLE 1AYEA 2C2DA 3VETA 1VQ9S 4FO0A 2VB6A 3C16B 2OTJS 2XSJA 2NYHA 4Z4EA 1GK8A 4ANCA 4R8UB 1LWEA 3ONQA 2AJ1A 4OPKA 2PFFB 4BC2A 3KHYA 2CQ4A 4Q0BB 1UMJA 4C0BA 4C11B 1IG8A 1IG9A 4DQPA 1ASUA 3CYMA 1PJ7A 2XY5A 3U7JA 3VGSA 4BG9A 4AH9A 4A8XA 3AVLA 4M5LA 3JS6A 4FBTA 2B4OA 2MY7A 3X3UA 3FSYA 1Z4UA 4J90A 2XMKA 5C24B 1T95A 3C15A 5D0GA 1DKGD 4FF2A 3SQGB 4NCBA 1LCUA 4IWVA 1FJ7A 1N48A 1WN7A 1NRKA 3V9WA 1WF0A 2WBMA 2P9SB 2YHXA 2XYGB 1MWZA 5MLCV 2V2KA 1Z25A 2UXDF 3QRPA 1SH3A 1YJWN 3M32B 2QKBA 3JQKA 1IBMK 4O3OA 4ZHRA 3QEVA 3V6DB 2KT5A 3ZZUA 1TR0A 2CNLB 3ZSXA 3G8QA 4M5KA 2HZCA 2RRAA 2X1FA 4CQ1A 2ASOA 2JLFA 3K2YA 1OWXA 4A8OA 1HNIA 4J2BA 1S0NA 2HHWA 4FW2A 4ELVA 2C2EA 3NMRA 5EUHA 3A8JA 3NMUA 1HHQA 5AZIA 1LFPA 1OQ3A 4DZ6A 3W8GA 1WSRA 2MXYA 3RBZA 3A8KA 1FTCA 2AMCB 1LW0B 2XSFA 2B9YA 3T1YF 3H08A 1RB0A 4CJUA 3NL0A 2DD8S 4QIVA 5LMNK 2QLBB 5F3ZA 3TAFA 1Q5VA 1QTNB 3BQ2A 5IXUA 2AYEA 5E5NA 1BWFO 4WTYA 1FTRA 1OPZA 5KFXA 4CLZA 1HKCA 1Y7PA 2Z2YB 1V6HA 1WKJA 1U2VA 2P9NA 3E3XA 4DX7A 1H0HB 2OPPB 3PTWA 1U2FA 4DL7A 3QGPA 2RKIB 3R7NB 1JLGB 4YY3F 3AA2A 1ZM4A 1XBWA 2AIRB 4H0XB 3P1GA 3KD1E 3I0RB 4CGHA 1NNEA 1RT7A 2WOMB 4DUYJ 3BJYA 3RRHA 2VWKA 2A3ZA 1N36J 2UVWA 2V9KA 4Q5VA 2CJXB 2RAQA 1P1TA 3AO3A 3RAQA 3LPUA 3H3OB 3ZT4A 3I33A 3HHLB 5HVGA 2OKQA 3EE8A 3C6UB 1EQYA 3N79A 2AP1A 1R3NA 5ADXH 3GIJA 4PQAA 3VESA 3CJTA 2HWTA 4J9QA 3DJCA 3IG1B 2R8HA 4K4TA 1VHFA 1FVSA 2G8KA 4DSLA 2J9DA 2H1YA 3AOBA 3PIPL 1EQMA 3J80O 1S10A 3D9BA 3DOMB 4BRKA 2PDAA 4Y00A 4DCHA 1S1XB 4C48A 3F2KA 3TO8A 3MEGB 3QQCD 3ENVA 2AJ4A 2VQFJ 4DR7K 2HS3A 3UCUP 3MD3A 2O8EB 4AFFA 3VGTA 2I0XA 2L41A 3MUMP 2JNJA 1W25A 1K0VA 3EYZA 1S22A 3M6VA 1TL4A 5HSPA 1YRXA 1IV0A 1WD6A 3G0ZA 2LFVA 1KKHA 2K7JA 2D0AA 2D0BA 1CC8A 1OO0B 2IVOA 2RILA 2IDLA 2MKHA 1X9MA 3EN9A 3BUZB 1C6VA 4JI6K 2ZF5O 4KYZA 4KSEB 1VQ5N 4ZVFA 1SVDA 1YITS 2KLAA 1LWFB 2F9WA 2IYGA 3GFYA 6FD1A 4GKJJ 4ZVTB 4URGA 1HI1A 1O0PA 4UY8O 5KFZA 3FRZA 1NGBA 2ZHOA 4K2XA 2HBZB 4CLPA 3MEEB 1ZOTA 2YKAA 1GLLO 2QTDA 1VSIA 5AQLA 3OUYB 3DKDA 3FBEA 3B82A 5ETSA 5F8MA 2VC1A 1F2HA 1NJIT 3PJWA 2XHCA 4FLXA 5JVHL 2H51B 1QAXA 3B6PA 2HMPA 3I0SB 4WFBL 3QEWA 4PWUA 3CCUS 4XEIA 4LREA 2J9EA 4LIWA 3DCAA 5AQZA 3SCKE 2MB0B 3HSZA 4TN2A 4C0OC 3IO1A 4I7FA 1GMVA 3V4IA 1CULB 2HGNA 1CXQA 3PSIA 2AT1B 1KC8T 5A8KA 4FJIA 4C2MA 2YNFA 3VEOA 2Q79A 1IR0A 2CQHA 4DR2F 2C3MA 5ETKA 1NZ8A 2C2NA 2VQEF 4BRFA 3GBTA 5A2QO 2MJUA 4Y2CA 3WBZA 1QVFR 2EKYA 3C0BA 2RN2A 2YWFA 4BRQA 4OLPA 3IBFB 2WUSA 3CJ0A 3W8PA 4ED2A 4ZLJA 3BQ0A 3GJTB 1ITPA 4O3RA 3DLKB 1KQSR 1W0HA 1P1LA 3KJVB 2CPZA 3HSCA 1VSEA 3CJKB 2LEAA 4DTMA 4HVZA 3VZIA 2CQDA 1U49A 3H8YA 2H65B 2UYTA 1HFEL 3ULEA 3PRDA 1F3VA 1A7GE 4B3TF 3MTKA 4L8RB 3ZEUB 3MTJA 1VRQC 3G86A 4YP3A 2IFXA 1U25A 2YQ1A 1HI8A 1VRUB 3VQTA 3VQ7A 5M2UA 3A5MC 3J7YP 3W3DA 2QN6B 4DPYA 4IFEA 4KFBB 3AOCA 1RBRA 3T1YJ 3L6QA 2E1ZA 3ENWA 3QIDA 4HACB 1UPPA 3UIQA 3HKWA 3HYFA 1HI0P 5IT4A 2NXCA 2B3TB 3P5TL 4C8LA 3DOLA 1TL5A 3OT9A 1YQHA 2N7YA 3T41A 5H9FJ 3FR0A 3MM5B 3L2RA 3QFUA 4ZN3A 2P6SA 2WBRA 3M8QA 1RA7A 3A2FA 4B3MF 4ETXA 4W5NA 3AVHA 3ZSOA 1S6QA 3MEDB 2FJBB 1WOOA 4K4SA 3CJ4A 2AGQA 2F4VF 2DY4A 1CS4B 1QTMA 3C16A 2XTJP 2CVIA 2E1PA 2D0CA 2BM0A 2RF2B 4HTUA 4R8UA 1RAJA 3I9V9 3GE9A 4ZJQA 3T9NA 2QGFB 4CJ5A 1B70B 1S97A 2F9DA 4Q0BA 5B0FA 4C11A 1U1RA 4O23A 4DN9A 3HM8A 3RGIA 5E3QA 3QESA 5EVZA 4QPXA 4E8UA 4OKJA 5AQRA 3MPYA 1B0TA 2ZNYA 1Q7YO 2NRRA 2HGMA 2ZOGA 1KVCA 3TYTA 5C24A 3ITHB 1UVMA 1T8EA 2BJ7A 3SQGA 4LD0A 4NE9C 2P9SA 4H0PA 1C0MA 4FOIA 4JV5F 2R7QA 1J9AA 2DNLA 4F0MA 1JJCB 3M32A 4CBXA 4OV6A 1U26A 5AQSA 4KHWA 3V6DA 1Q86T 3UB5A 4PUOB 2C3UA 1FJGF 4ZLLA 4OZNA 5EWGA 2ZZMA 1XERA 1O13A 3V1RA 4HDHA 5AQFA 2BW2A 4BC7A 3R1LA 4C3KA 1B4SA 3Q22A 3H25A 4CZLA 2FYXA 2WAQD 5JLHA 2CJBA 2CZ4A 3GV5B 3H5XA 1XHZA 1H2UX 2EFGA 4QW8A 4EAHD 3E1YA 5E2QA 1LW0A 1REVB 2YX6A 1U1PA 4PHTX 3K5OA 3CFOA 3K0SA 1XMQF 3LP0B 2WSCC 2B9WA 3UCZP 3N6MA 5B0BA 3VA3A 3VQ4A 4ANDA 3SQ4A 3OHBA 1MWKA 3F56A 4HH0A 3QICA 3T3FA 1FDNA 2OPPA 2DGTA 1NHUA 3THYB 2RKIA 3TX8A 3FEYB 2H48B 4KREA 1JLGA 2ZUGA 4DUYK 3KDOA 3RW6A 4BR5A 1URNA 3QT7A 2ZD1B 4B3OB 2PEBA 3K5MA 1N36K 2BX6A 2F8SA 5F41A 3I0RA 3PX6A 3H1VX 4BGBA 2X3GA 4L73A 2WOMA 4F26A 2XY7A 3Q8YA 5A8RB 4K42A 1T9UA 4GVLA 3TNVA 1S5ZA 4OYZA 4LFCF 3VF2A 3OTOF 3HHLA 4DL4A 4ZPDA 1FCAA 1SH0A 4CZEA 2F3JA 3C6UA 2KKZA 3M2UB 2V69A 5DLFA 4IFYB 1BIUA 4IZ9A 4RW4B 4NLSA 4L6V3 5DM7L 2KYZA 1MN9A 3IG1A 2E9RX 1IJFB 2RSQA 3MWTA 3QFWA 3DLRA 3SUNA 3MCMA 2RS2A 1YX2A 2HNZB 1UJ6A 1MWMA 2CFXA 4ZITA 3W64A 1VR6A 3L4QA 4DR2J 1LK5A 2E1MC 4C4WA 5EN1A 3DOMA 4UW2A 2GQ2A 2VQFK 5EY4A 2FXUA 5DZ7A 2HK2A 3FZBA 1UW4A 1UW9A 4QW9A 3MEGA 2G8FA 4V19J 2FZKB 5GVQA 1VSMA 1U1NA 3ZX0A 4H8KA 1Y9OA 4GO5X 1QY7A 3US5A 4FF4A 4EHTA 2DEJA 3BZQA 2CRLA 5J2MB 2A40A 5AQQA 5K14B 3FK4A 1NXIA 2JH3A 3JSRA 1FWPA 3DI6B 4MT1A 3CXCM 2J6UA 1C4CA 1FERA 2B9XA 2ASDA 3WXKA 4MKBA 4ZCLA 2MQ8A 1R8AA 4ZPWR 4GVMA 4FP9A 2P8IA 4JRQA 4CJSA 4NLVA 1LWFA 5LT5A 1KWMA 5T14A 4EEYA 2HBLA 4BQLA 2ZH2A 1MG7A 2YJFA 5IWAK 4KB1A 1PBUA 1HNVB 1PCAA 4ELUA 2QSFA 3R7BB 2ZBIA 1FRXA 3QETA 3MEEA 1RHJB 3CJ8A 3H59A 4R0EA 2DXDA 1DTTB 4NXNJ 1WG4A 1V9OA 2I5JB 4WE1B 3FGUA 3OUYA 5LSLA 3I55S 3E01B 2BANB 4ECSA 3M7VA 3EKSA 2IDEA 1T9WA 2JFKA 1PSDA 2BQUA 4B3MJ 3I0SA 1VYAA 4Y6IA 5EGYA 2OTLN 4M5HA 2FVSA 3L8BA 1LNQA 3HHDA 4I6AA 2HZAA 4PXDA 3T5KA 4NLXA 1XC3A 1K8AO 1RT3B 5A6PA 1E3MA 2F4VJ 1UPMB 4GNIA 3NEKA 2FJDB 1N56A 4CZGA 2VFRA 3VALA 4Z4IA 4DUZJ 1CULA 3ZSRA 4C8KA 5KFYA 1LV5A 1EHWA 3FVYA 3AO1A 2KN4A 2R7VA 4DU1A 4FWOA 4X4OA 1NEEA 2IVYA 3EZUA 4LQ3A 3O9QA 3BPDA 3MN5A 2ZJRL 4ED5A 1AW0A 3HBTA 1V5IB 3ZTOA 3OHRA 2R2TA 1JL1A 2W41A 2KDOA 4JHDB 3BV8A 2UXDK 2FLPA 1X0FA 1IWGA 1CJTB 3MEKA 1OVQA 4CERA 3D0GE 4UZCA 3DLKA 3LANA 2HFZA 4C97A 4HTJA 4JV5J 1ACMB 2C28A 5B0GA 3CJKA 3PG9A 1U47A 3MXMA 1XNQF 3WIVA 3RB0A 4KKOB 3MMCB 2ZWHA 5AXMA 1AT1B 4JV1A 4PRFA 5J2PB 3ZEUA 4OIXA 1TU0B 1SC1B 4ED1A 3RJMB 3EMTA 3AQPA 4OI6A 5A76A 4EHUA 3T1YK 4XAKA 4DQRA 1HBUB 1VRUA 4Q44A 1BA1A 3HHNB 4WQ5C 5C42B 3LALA 3AQOA 3B4DA 5CABA 3OBIA 4KFBA 3B8HA 1M5VC 5H9FK 3OFFA 4Z37A 2L48A 4HACA 3CCVS 1BO5O 3P38A 1XMQJ 2CJAA 1RBVA 5LL6Z 2G8HA 2CUYA 4ER8A 2W9AA 2XLJA 4HTLA 4YY3K 4CLUA 4A57A 3MM5A 1BGXT 2HRTA 1RWUA 1JLQB 1TL3B 1C2PA 2JZ5A 3TZXA 2KYXA 2P9PB 3L7OA 5GADI 1T03B 5BN9A 3MEDA 2FJEB 3KLHB 3EGZA 1VISA 2M9KA 2E1YA 5CZ2A 1CS4A 4JI5F 1G1XA 4ECRA 4CGIA 3Q83A 2RF2A 1ZZNA 5BYQA 1KCFA 3B78A 3K2PA 1FX2A 3M9OB 1HD1A 2BM1A 2V68A 2VONA 1RKJA 1BDGA 4CNZA 2GVZB 1XIQA 3HHKA 3Q8PB 2GW8A 3FZKA 1AROP 3H45C 1M1HA 3G6XA 4FYWB 1Y0HA 4DV1J 3DRPB 4ILLA 2WC9A 1EO1A 4FJMA 4OYMA 5DETA 1HX1A 2GIQA 3MCOA 3PJ9A 2XCAA 3TA1A 4YFUA 2UU9F 3HI9A 1NO8A 1BL3A 5H1SV 2IJNA 5DZ6A 1N34F 1OVYA 2F8HA 2QJ3A 2ZH4A 2DISA 3TSQA 1NK7A 1RAGB 5C12A 5HVFA 1FKPA 3VV2B 1FE0A 1S48A 2HS0A 1B92A 1R0CB 2XLKA 4PUOA 1TELA 4Y2AA 2FC9A 5HRNA 4CO1A 2VFTA 3OR1B 1TYQB 2XO7A 3O9TA 5IV3A 3M5RA 5DQHA 2GELA 5D0EA 3KNGA 1AXQA 1WUAA 4KJIA 1QE1B 3PO4A 4B9MA 3KKRA 1REVA 1SKRA 1YZ6A 4ILRA 1CZ9A 2W6LA 4OZ3A 2DIUA 4QWCA 2R7SA 2KFYA 3CEDA 1CG2A 1HBMB 3LP0A 3PLAA 4ECUA 2VBZA 4H4OB 2E5LF 4BE1A 1KNZA 3G87A 3P39A 1LXJA 1RP5A 3THYA 1BMQB 3E9OA 4DHYA 3I56S 1Y5IB 1IBLJ 5L1IA 2KQ2A 5L46A 2ZD1A 4B3OA 5KOXA 1ATRA 3VOVA 4ZOSA 3OJUA 4RTFD 3V9UA 5BYRA 5A8RA 4O4GB 3C2PA 2HHUA 3H5UA 1TUUA 2PYJA 3CM5A 4ZVOB 4YOUA 1WNEA 3AJ2A 2BDPA 2ZH8A 4CIOA 2O67A 4ZLNA 5KT5A 3TSPA 5U47A 2XWXA 3ZTPA 3C6AA 2CPIA 3M2UA 3ZO7A 4H0TB 2W9BB 4IFYA 4ES1A 5KT7A 4DR2K 4RW4A 1RWMB 3J81j 1SJQA 4AXJA 2VQEK 4CBWA 3PRVA 2NUHA 2CGLA 2HNZA 4WF9Q 2YKOA 4F4ZA 2D3O1 1V3RA 3PR4A 1FDAA 3HHEA 3CD5A 5KGXA 4K0KF 1JNRB 4XO0A 1WOSA 2V8HA 1MU2B 4RW8B 2XHWA 1T05B 1XMOF 2D1CA 2HW3A 1FJEB 4O55A 3DGVA 2ZC3A 5AQMA 4F4WA 4J2AA 5ETVA 4E1NA 3VF6A 3IKMA 4E98A 1F9FA 2A2DA 3KUGA 4P7TA 4G1IA 5G4DA 5J2MA 5K14A 3LF0A 2YWHA 4RLEA 4B3TK 4QR0A 2H9ZA 2FD2A 2COLA 1TMJA 4TQRA 3DI6A 2N4CA 4U96A 4CLTA 4DSFA 4YEAA 4NLPA 2V0NA 3J80Y 4CEQA 2M4MA 1RBSA 4KAZA 1XNQJ 2BE7D 4MQ3A 4OZ2A 5E3CA 3GV7B 3WX4A 4X84A 3W2VB 4OI4A 1HHTP 3LDQA 4EU0A 4L3QA 1Y3KA 1P9YA 2GIRA 4DCOB 1KVAA 1TQLA 1ASVA 4BC9A 4KHPF 2OHDA 4CIEA 2ZC4A 1R7IA 1TKZA 1U0SA 1I3OB 1NK5A 4N41A 4YB6A 1HNVA 1WACA 2HHSA 5C2GA 4J9RA 4DTSA 2V4RA 1FFWB 2FBYA 3W1YC 3CCES 5I9EB 4X4QA 3FJ2A 1DTTA 1XEZA 4O4RA 2I5JA 4WE1A 3ATUA 4NYZA 4GC6A 3E01A 3NE6A 2BANA 4B3MK 3S7RA 1K44A 2CQ0A 4CZHA 2HRUA 3UWTA 4RU2A 2Y1LB 1J53A 3HKZD 5D4LA 1RSCA 1UFWA 1WSHA 1KD1T 2F4VK 3SJHA 4QJVA 1H98A 2DFEA 3CFPA 3ID8A 1O6XA 1DLOB 3PIOL 3QDKA 4JI5J 2XB2D 1RWVB 4OX9F 1SL2A 5EX5A 2ZGZA 5AQWA 3OW2R 1TV6B 3DRSB 3C6HA 3CCMN 2C3OA 2YPZA 5AQTA 1WEYA 5CHCB 4B9TA 4Y65A 5HL7Q 2YCHA 3BM7A 3ZNJ1 1RCXB 1TL1B 4KBOA 2HQGA 1CQNA 3CCJS 4DSKA 2OMLA 4MKYA 4CWBA 3W9IA 3UE5A 4FS1A 3A4TA 1GLDG 1H7WA 1TMMA 2ZBQA 4JV5K 4JHDA 1NU0A 3GFZA 1SKSA 5D15A 2A10A 5KG2A 2L3MA 3KJQB 1J2VA 1N34J 3M9MB 3CERA 1D09B 3W60A 3VQQA 2QL5B 4BWMA 4OZ1A 4CJTA 2XM3A 1FJGK 3A8YA 3LGHA 3ZZTA 2K7KA 1PJ5A 2DY1A 1GMUA 2P9IB 4J91A 4RJVA 1YBTA 3VGKA 2LXUA 4DFKA 1VQSA 4KKOA 2FLOA 4ZP7A 4Y0FA 1F5CA 5A2QY 3MMCA 4NLDA 5JUMA 5J2PA 4P52A 4HI1A 2UUBJ 3P96A 5AQIA 1JLEB 3MDFA 4M5DB 3CPWR 1VQMS 2IBKA 3IR7B 4OPAA 3UR0A 3HSTB 3SMPA 1HBUA 4HR2A 1ZPWX 1WLJA 4YHHJ 2BKPA 1YWXA 5C42A 3QZ8A 2ASJA 1N8RT 1XMQK 2QWRA 2DNYA 4BR7A 2HBYB 3WQTA 3I82A 4K5SA 2ASLA 3WXIA 2GHVC 2PA8D 2P9LB 1MMDA 3AV9A 1VQPS 4C23A 3TTDA 5HQ8A 1Q8IA 2E5IA 3FCHA 1KDNA 2IS3A 2E5LJ 2H3EB 5KG4A 1KTVA 2OPSB 4V19X 3QSIA 4IG3B 4RW6B 1JLQA 4BC3A 1TL3A 3KG0A 2YKNB 2HWHA 3R5CA 2P9PA 4H4MB 1YHQS 1T03A 1IQTA 5M2PA 4IQMA 3CDUA 3KLHA 2O4IA 5JJBA 1CC7A 4NA2A 2QWNA 1SJ1A 1SXLA 4LFCK 4EP4A 3HPGA 1S1WB 3OTOK 4DPTA 2BJ9A 5KFHA 4A8SA 4DL5A 4P2FA 4WYLA 2QLFB 2E6MA 2KXFA 3QJPA 3NGRA 2QV6A 5KQDA 2GVZA 1NGDA 3QNNA 3MCNA 2MKSA 5KFJA 2NNWA 4MLHA 4WFAL 3D6TB 1KONA 1RWPB 1YBAA 2G8VA 1Q86O 3SUQA 3DRPA 1HNZJ 4NLQA 2DR9A 3VGMA 4YN3B 1IWAA 4RWWA 5KOWA 2GX9A 2HQFA 5KFIA 4KHMA 4LF7J 3D54A 2AX1A 1VBKA 4TLRA 4WKRA 1WSEA 1WC3A 3CJ9A 4B9LA 2XMJA 4RBTA 4CO4A 3QRRA 3MM6A 3OYDA 4K0KJ 4HT5A 4DV6F 2YI1A 3Q7CA 2F8MA 4X4VA 1RYSA 1XMOJ 3VEVA 3TZWA 1BWEA 4M5NA 5IFMA 5HI7A 1ZBLA 3R5AA 3L7PA 3OR1A 5M1NA 3IMXA 2P51A 4A8MP 2MY8A 4HLBA 4B3RJ 4WP3A 1YJ9N 4A4JA 1OH8A 1OS5A 1QE1A 3VVTA 1GXTA 4JK7A 3VAGA 1LQ9A 4LMZA 1X5OA 2QWPA 4K4ZA 4F7VA 1HBMA 4OZJA 2VBYA 2CJQA 3FBBA 4H4OA 1SQGA 1DAXA 3TW0A 4R5PB 2HPUA 3GONA 3F9KA 3HJFA 1F1BB 4FN5A 4OI2A 3J80U 1A6LA 2X1GA 2D4WA 3T19A 5LMUJ 2P9GA 2E88A 2E66A 1KFSA 3MPWA 2J6TA 4M5MA 4KTQA 3R6MA 1Q1KA 1QDUB 3OYJA 5T41A 4M5JA 2R7UA 4LR7A 3DXMB 2YX4A 1VC6A 2VBWA 4O4GA 4TU9A 2DO0A 3P31A 3BN4A 5SWMA 3OXFA 2C3PA 2Q97A 2F7VA 4FM0A 1L5UA 1N54B 1NB2A 5KFPA 2VD3A 5FJ4A 4DJBA 2ASYA 3CETA 4OYWA 3CD0A 1YIJN 4H4KC 4RU9A 2W9BA 5KFAA 4ZVUB 2GS8A 4JBCA 4CFCA 4M3TA 2H5EA 3H20A 3VQDA 3J81O 2W2QP 3PIPQ 5HQLA 3ZLJA 1RTHB 5IT9Y 2G2YA 2B4PA 3O9SA 4ED3A 3UR3C 2RHKA 2ROEA 4ALZA 3PSFA 3QLHB 4HI2A 2JEFA 4MFBB 3OXLA 4JRPA 5KFBA 3M1VB 3KWIA 4PZVA 3AJ1A 3PR5B 1MU2A 3R6LB 4XPCA 1T05A 3B6BA 3FFKB 3QMQA 1PILA 4K8ZA 4FVMA 4GV3A 4F0KA 5ETTA 4I6WA 2JDJA 2MZTA 2QK9A 4L75A 2QI2A 3R5GA 1ZAWA 1XNQK 3IA0A 4LT6A 1VQ4S 4B8AB 2M70A 3CDEA 2OMOA 1XC9A 2AGOA 3TVYA 3CG7A 4FJ7A 3VHQA 1XJWB 2ZH7A 3IN5A 3BPSP 2FTRA 4NCAA 2ZDOA 5KFVA 3IWLA 3LO3A 3ET6B 4KH4A 1HLWA 1KLNA 3LZJA 4DV7F 1EETB 2LEPA 3AVBA 2XS7A 2E2PA 3W2VA 4EGLA 5HN0A 5KFEA 1EKSA 4F9OA 1HBOB 3EJMA 3TAGA 3GR0A 1QS4A 4FOEA 3R2CJ 1E4FT 4IEEA 1B7FA 4YB1P 1N0VC 5B7WA 4P9SA 4JYAF 3QERA 1YT3A 2L08A 1MMNA 2Y8WA 5MAOA 1S9GB 5A2QU 1UP1A 2VPYB 4YDXA 2OP5A 4TNOA 2QXLA 3HJVA 2UUCF 2OYQA 2JWKA 1FX4A 5KFNA 4ILMA 4CDIA 3RWUA 3ZNUA 4JI5K 2YWWA 2EXUA 4P2SA 5F0WA 2KHDA 3NVKA 1DLOA 2MKKA 1KAXA 1ZA2B 2MQPA 4C9DA 1TV6A 2JJ4D 5FIIA 3DRSA 1WC1A 4OX6A 1QHTA 4FWLA 2MQLA 3D6MB 3C7NB 3CQXA 3BB5A 3ETOA 2UVRA 2UU9K 1WJ9A 1TL1A 2Y1IA 3HP6A 4ED7A 3V81B 1WEZA 1NK8A 1N34K 3HF5A 4PR6A 1RLCL 4OHWA 2G2ZA 4BRGA 2EI5A 3CJ1A 4IEIA 1UEKA 4DV0F 4L76A 4AL7A 3RMDA 4ED6A 1X3MA 1CVJA 3L2VA 3OXGA 2XMAA 1Z26A 4IRDA 2DR8A 4YUDA 2YHAA 1RFQA 4DV6J 4IBNA 2XQCA 2PC6A 4CLSA 3NCRA 2FSKA 1WF1A 1WDDA 4D3GA 2PMHA 2P9IA 3UDVA 4LRDA 1RAOA 2KXHA 3I5AA 2Z0GA 2ZHAA 4PYDA 1JLEA 4X65F 4ZVGA 4M5DA 1MA9B 3MUVP 1JJHA 4RBUA 1MROB 3BS9A 4JI1F 1DBDA 3O4NA 3OYEA 2R2SA 1TK0A 2QFIA 3AA8A 4QU7A 2HBMA 5L9XA 2XEXA 2E5LK 2P9EA 2K3IA 2P9LA 5HP1B 2HWIA 3HSJA 5F3TA 3ENHA 1NKBA 1A5XA 4ZVRB 2LSNA 2WW4A 3AVFA 4IR1A 4KGVB 2CJ9A 3PRBA 3D0IE 3R6GB 5KT4A 2XCPA 4NO7A 2OPSA 1NMDA 4DKWA 4YORA 3MMVA 5CR4A 4XPEA 4IG3A 1U24A 4KPYA 4RW6A 1VQ6N 1X4GA 2YKNA 3QEIA 2AEJA 4H4MA 1E6YB 3BSAA 4NL5A 4ILGB 4NA1A 4JAXA 2Q0RA 1N5VA 1H74A 1O5JA 2DNNA 3BKTA 1V5VA 3A13A 3EGWB 1UVKA 1CSJA 1S1WA 3SI6A 3HI0A 2NXJA 3K17A 1ESVA 1ZAVA 4RWXA 2Z1HA 3OA9A 2DPJA 1VQ8N 4CJPA 2FBTA 3MHYA 1NK4A 3UFCX 4K43A 3RR7A 3AOAA 3NY0A 1FNXH 1KEKA 3VAIA 2JEJA 1OYEA 2HURA 2V4JB 2E1RA 2XMTA 8RUCA 4YDDB 1FXRA 3IGVA 3M2VA 1Y3JA 1QAJA 3RMAA 1FRMA 4MH8A 3K8WA 4J9PA 4C3MA 4OYXA 5HVHA 3J8AA 3NAIA 3G4SS 4Z4CA 1WC6A 4K0KK 4N77A 3SK3A 1VK0A 2ZNZA 4E3SA 3SDEB 2VASA 1XMOK 2J7WA 4ATNA 1ZETA 2G1HA 4M8LA 1NGAA 3N5BA 4PXEA 4AHCA 2VV5A 4MIWA 4ZCIA 4O0IA 1H2VZ 3T7ZA 3P5BP 1MNEA 3ZT1A 2BA9A 3CCSS 1FRIA 5H9EJ 3NMAA 1VK3A 1NSKL 1LKZA 3D3BJ 3OTBA 3R5BA 3AA9A 2N4DA 5IT9U 2IM2A 2OEMA 1KS2A 4OO1J 1HYZA 4DR1F 5BRHA 4CZIA 5L9NA 3I4HX 1XQSC 2DPIA 3LPTA 4KTWA 5GADP 3I96A 2UUWA 1BHLA 2GHWA 5AQUA 3RG6A 3G6YA 1XQIA 4DV5F 4OJ1A 3J7ZT 3D0HE 1M90O 4KHPK 4RKUC 3MI7X 1JXBA 4DV7J 1Q18A 2D9OA 3ZETB 2P9CA 2WW8A 2NREA 3VEZA 2FHJD 3K89A 4KGMA 3MAAB 3D68A 3H2VE 1T6DA 3QPIA 2HQDA 1SUQB 3OR2B 4JV2A 2VG6B 5FPMA 3HMJG 5E3AA 4R5PA 4DR3J 4JYAJ 2EG2A 1G4CA 4M95A 4ZP9A 1PYSB 4UY85 2AA4A 1F9HA 2IJFA 1R8HA 3K9JA 3IM8A 3ISND 2IRYA 1VQ9N 2ZOFA 2QX0A 2JEIA 3O4WA 3RB4A 5DGAA 2UUCJ 3M8PB 1K8KB 3L2QA 1EWQA 5CAAA 1D4XA 2G9OA 4NEYA 2OPRB 4I9LA 2P2CB 4CCHA 4DR6F 4YOXA 2P9UB 5DJBA 2UXBF 2EG1A 4XTTA 4OX9K 1YRTA 3KXDA 4I56A 3HP9A 4EZ9A 3JSMB 4LJMA 2RQKA 4B1UB 4CEOA 2P1JA 3MDQA 3THPA 2V6AA 3ID6A 2Q6CA 3N01A 3QZ7A 5EWEA 3CSKA 3FUYA 1RTHA 3HT0A 5HLFA 4FWPA 3RB6A 3QLHA 4IO1A 4GMKA 2IOCA 2GNKA 4WFYA 3CC7S 3SQ0A 4MFBA 3RUBL 1K47A 2Q36A 3M1VA 4D3HA 4AHUA 1GFWB 1ZYQA 4C8MA 1HWLA 1SL0A 3TWHA 2BJ8A 2W2MP 1HKGA 1RZMA 1YXQA 3DLHA 3QNWB 5C0YA 3GG4A 4XH4A 1DT9A 4DV0J 5DDPC 1NJZA 4Q45A 2RU9A 1N5YB 3GU0A 4AE5A 3SBGA 4RW9B 1HBNB 4WXOA 1I39A 1HNXJ 3Q86A 1LOUA 4AHSA 1NGCA 4JEPA 2YWGA 1U1KA 2V2VA 1BWVA 2V52B 4QBUA 3LH2S 2OO4A 4LVNP 3ET6A 5FD1A 1JXEA 1EETA 4DTPA 2ZJPQ 1N5QA 3C6TB 4X65J 4DCJB 2IMOA 1GNKA 3P4UB 1HBOA 5CZXA 4IO9L 4KO0B 2B4JA 2ZGYA 3MX2A 1KD1O 3ENAA 4LF2A 1BQNB 2YNHB 4DLGA 1NJXA 2HHHF 2B43A 2HLTA 5F8JA 4F3TA 4M63C 5JLFA 2KJWA 1HR0F 2E1AA 2G13A 1S9GA 1HQUA 3V9XA 1JIHA 3BO4A 4WBFA 2G1DA 1KOOA 2W7PA 2EFOA 2GC8A 2VJUA 4JS5A 3MMBB 3R1XA 2LP4A 4AD6A 4LF8J 3FBCA 1VRTB 2GEMA 1JL2A 4W5QA 2M2BA 3EZOA 4BRAA 1EIYB 5ELZA 2M0GB 4ZCKA 1HHSA 4JI3F 1N33J 1GQEA 8AT1B 2MZQA 2FC0A 1FD8A 1WHWA 1NGFA 1TZ0A 1RAHB 2CPEA 3NLCA 2F8EX 1XR6A 1WSIA 3ILJA 1S7HA 5A6WA 4XIUA 1FHTA 1UVJA 4NI2A 2XSJB 3JSYA 2Y9HA 3C7NA 4WYBA 3KDNA 1HQEB 2Q2RA 1G7CB 4N8OA 3RR8A 2AKWB 3QAUA 3GJRB 3EICA 2ALYB 3VCDA 3V81A 3FBFA 3S3MA 2AYMA 2RDJA 4R25A 4ZLPA 4LF1A 3HVWA 4DV6K 4CFBA 2O8DB 2QG9B 3S01A 4KQZA 2CQCA 3TJ9A 2PN6A 3GJSB 5J2QB 4QYRA 4ZVHA 1PO6A 4O0NA 1I51B 2J0WA 1S9EA 4NMLA 3A5LC 3O8WA 4DL6A 2YBVA 2IC3B 4EI2A 4MLEA 2CNOB 1YJVA 4I6YA 3AVAA 4N7TA 3B8AX 2V7ZA 2V4QA 4FJHA 2KH9A 4LQ9A 2W9CB 4X4UA 2I1RA 1I5OB 3BZCA 2DHSA 1YITN 4QYZJ 2DCLA 1HJRA 5AE1A 4DR1J 2C42A 3HPOA 1WBDA 4P75A 3SCXA 1RBUA 1X4AA 4NLBA 1MROA 1C0UB 3ZSVA 3AARA 2LDYA 4CF8A 5EOYA 1WTBA 2C3YA 4DV5J 3MOJB 4GW6A 5B0EA 4G6VB 2Z8QA 3PHEA 4U9RA 3TAPA 2IM3A 5L1LA 4QS7A 3MCSA 3D66A 5HP1A 3PM9A 3H90A 2OANA 4A8KA 3ILIA 4DV3J 2RT3A 3FMBA 3G82A 3HZEA 4K4YA 2JX2A 1J5EF 2F7TA 5F8IA 1SCJB 4FWRA 3NG8A 3OVNA 5B8HA 4AHTA 1B99A 1RBLA 4FPAA 5GMEA 3QGIA 1E6YA 3CCUN 3KYLA 2QWMA 2N82B 5M1QA 2K2PA 3VGVA 2PBDA 2HS4A 4RNNA 4O3NA 2Q0UA 4MKAA 1ZH5A 3IFEA 2DGSA 5FPEA 1BHNA 2KJVA 2WVDA 3M05A 4CI0B 3D1HA 4OZLA 4L74A 3DOKA 3DHWC 4DR6J 4CEFA 4HKQA 1RAAB 1G15A 3MM8B 2VU5A 2HHXA 2NLXA 1NAQA 5M1PA 2DGVA 2YTCA 1P8GA 2V4JA 3R97A 1T0TV 1G99A 1KSPA 1S79A 3CMAS 1TUWA 2DH7A 3PY8A 2FHMA 3DC2A 1UJ5A 4XDCA 3DRRB 2EFNA 2CPYA 3SDEA 1HWIA 2J5AA 1S4EA 4NLWA 1X4FA 5H9EK 2X51A 4USUA 2YHYA 3GR1A 1SC4B 3H2LA 4QIWD 3WNEA 2X78A 5LM7E 2QA4G 5E0OA 5JMVA 3AY0A 4ECXA 4GV6A 1RXOB 4JV0A 1QZ5A 3THXB 2Y1JA 4ZMMA 4DV7K 3SI8A 4GKKF 1TUVA 3TAMB 3TANA 1BU6O 2OFGX 1ZPVA 2KKHA 2VFVA 5IQ6A 2CIMA 4DCPB 4QZVB 3PYDA 4EBCA 3WZ0A 1ATNA 1YTAA 1IJJA 4WQ4C 3DHXA 2OJ3A 3ZETA 3U3YA 1ELOA 1B64A 1DY3A 3D45A 3WXJA 1VQOS 1GLEG 3AA4A 4JYAK 4HEA9 1RBAA 3MAAA 1SUQA 3OR2A 4I1TA 4Q7AA 3DYAB 2GMJA 2VG6A 4FLWA 2GMHA 1U1MA 1YAGA 2J0XA 3G10A 2Q3PA 2QIFA 5D0RA 3LDPA 1HR0J 2UUCK 3MM7B 2QL7B 4JKAA 3D2WA 2C22A 1RT6B 4K7QA 3CIMA 3U6FA 4DFJA 4BROA 3DLJA 2BOPA 2EBGA 4C8NA 5J1PA 4OQJA 4DU4A 4B8CA 2LU1A 3M8PA 4GC7A 2MKCA 1K8KA 1H1VA 4MKVA 4AQYJ 1RDUA 2OPRA 4WZQA 4XH5A 1ICEB 4ETZA 4Z4GA 2P9UA 3GL1A 4GV9A 4DTXA 4PAAA 1H7XA 4JI3J 1IR2A 4IOCQ 1BISA 4F04B 2UVVA 4QIGA 3JSMA 3CNQP 1VSKA 4CK1A 3ASMA 2W4PA 3IUCA 3AHPA 4HDGA 2J0QD 2DO4A 3AAWB 1DRZA 2E8AA 2DTUA 3NF7A 4I64A 4CP5A 1IXKA 5KT6A 2OA8A 4A2BA 2FBVA 4HUFA 2DR7A 3S6EA 4M7YA 4NWBA 3HVRA 2RUGA 4DFMA 4BCAA 3IDHA 1VQLS 5CCLA 4DV0K 3OYHA 2RU3A 4F2SA 2DGWA 3QBCA 1GH8A 2MZSA 3IS9B 2H5IB 4FJ5A 3CF5L 1CZAN 2QE5A 5AQHA 1N5YA 3VMFB 2ABYA 4LBHA 4RW9A 3NKYA 1HBNA 3H3NO 5HOOA 4PWDB 4WU2A 4NXMF 3J81Y 4DBQA 2DNHA 4N5SA 3KK7A 1IKXB 4X65K 3QATA 3CIZA 3QBXA 2XZTB 3R5JB 2OZMA 4JI1K 1N4LA 3C6TA 2NLWA 4BRPA 1UJ4A 2VF3A 3TU5A 3BN7A 1ZM9A 1JXVA 2KHOA 1BQNA 5LJWA 2YNHA 3RB3A 1S72S 1UAWA 2W42A 1HD0A 1FF2A 4OYBA 2A6AA 8ATCB 1WOPA 4GKJF 2KRRA 4DX6A 1LWCB 3O5TB 2FJWA 1S6PB 1X60A 1NGHA 3V4MA 3FZHA 2PA3A 2KT3A 2KM8C 1IH7A 2HKEA 3MMBA 2ADCA 1GT8A 3TP2A 3ULHA 3EPGA 2XBPA 3CT9A 2RNEA 4HCBA 3AB4B 3JYTB 3DXKB 2NPFA 3NHGA 1CJVB 3PIOQ 2RHQB 1T9YA 1CPZA 1X4DA 3QBWA 2WBNA 3CCQS 1DGKN 1YJTA 4O44A 4A8YA 3CXCR 4OKKA 2CDRB 3SMSA 3KLFB 1HWUA 3T5JA 2I2YA 1VBZA 3OYNA 1JLFB 2H4YB 2W4DA 4UTGA 3IBWA 1HQEA 4AM7A 3ZZYA 4PPDA 4TVAB 2NZ4A 4H0OA 3RMCA 2CNKB 3E9PA 2CPFA 3JSBA 3LWLA 4O3SA 1GMWD 2L9WA 5HO4A 4LVOP 2O8DA 3H98A 3GOIA 3CFRA 3ENBA 1EQ0A 3P3DA 3T1AA 4QIEA 3O5BA 3P45B 3VAJA 2DR6A 4IJNA 5J2QA 1R8PA 1BIZA 1VQ7S 2AJQA 5LXRA 2B4VA 3OBWA 1P8ZA 3D0PA 1FEHA 2IC3A 4DR1K 2A1SA 4TYBA 2N3OA 2GWKA 1RCOB 2W9CA 1H2TZ 3HSDA 4DV5K 3NS6A 4J9KA 5GAHP 3C19A 2R8KA 4TY9A 4DF4A 1E6VB 4JD2B 1C0UA 3ZT2A 1F0XA 4ES2A 4GKKJ 5BR8F 2P6TA 4I69A 2KFNA 3U4LA 4USHA 1RDDA 1NK9A 3RRGA 3QWUA 2OAUA 1FKOB 4Z4HA 3UD5A 4DPOA 5HATA 4B3SJ 3OL6A 3I55N 3GILA 1IM4A 4A62A 1T02A 4YQWA 1I1GA 4TQSA 2R7XA 2D3UA 4DN0A 5GADU 2P5OA 2MLZA 3EPIA 5JXSA 1FXXA 4A47A 4FVUA 3O80A 4E7IA 3Q8UA 2R2UA 2O01C 3CVKA 2HMIB 1OSDA 3MOZA 1VIXA 3RSEA 1BC6A 4DR6K 1O51A 4BBYA 2MMYA 3SSRA 1UL3A 3K59A 2UXBK 4FLUA 4CF0A 2XY8A 3MR7A 3AO2A 3P4IA 2HSEB 3BSCA 4DTJA 2L9NA 3MM8A 4M94A 3V1QA 4USVA 4WQ5A 3P49B 1JJ4A 2V50A 2CXEA 2OELA 4M5IA 4DQQA 1XMBA 2DTJA 2PMWA 2XGPA 4WFAQ 3HVTB 1ROFA 1DQ9A 1PC4A 4OLBA 1OKJA 3FZMA 1RWNB 3LP1B 3EGVA 4LRAA 1Y11A 2BW7A 2YWKA 5AZJB 3QEXA 1NHKL 4U6PA 1RK8A 4C8YA 4FYXB 2ILYA 4V1Ak 3DRRA 4DL3A 2HFVA 1NMEB 3A3NB 2BKOA 2E7XA 2VBXA 3D7SB 2FF6A 4HHUA 3QINA 3X1LB 3TPQA 2D7SA 5L8RC 3R27A 2E5JA 2LMIA 5ITHA 1K9MT 3KHRA 3U02A 6FDRA 4KI6A 1Q8LA 3DFEA 1SIWB 5CYJA 1CEZA 3I31A 2CGJA 3RAXA 5HK4A 1IQZA 1S99A 5HJXA 4NXMJ 3THXA 4QWDA 4DS5A 2GWJA 4Q8EA 4IUFA 3TAMA 4G1QB 1QLNA 2ZBRA 3PXGa 2BR0A 4R0JA 2KW4A 2ETJA 3KJFB 1U8WA 1FNOA 3R3TA 3LGMA 3SNNA 3TQ1A 1N52B 3NF6A 1FFGB 3CCVN 3BF1A 4U8VA 3Q8SB 2VWBA 2Z30B 1RNHA 2HHHK 1CJKB 2MQOA 3GSIA 1HR0K 2XC9A 4PL7A 3W9HA 3DYAA 3J81U 1WSFA 3DN9A 1T3VA 1YVFA 3IWXA 3DMJB 3WUHA 3MK6A 3DLLL 3MM7A 2MDAA 5FLXY 1RT6A 3TR5A 2ZBCA 2QO3A 2BBEA 4UOGA 2LA6A 4IFVA 4BGAA 1QAYA 3SLCA 2DGUA 1KBRA 4JI3K 2CQPA 1GX5A 4MYUA 4OMFG 5DM6Q 3SFUA 4BS2A 2EBEA 4FK2A 3SJJA 4J5OA 4M45A 1NNDA 3QWPA 2CNNB 3LPYA 2VWJA 3I9ZA 4P2XA 3CE8A 2QFJA 2XS5A 5AQNA 1QSYA 1YI2S 3HX9A 4B1XB 3CGIA 2W7OA 2W6KA 5THWA 4CGDA 4E1MA 1SPBP 1FDDA 3IBCB 5BPNA 3OY9A 3AD9C 3ZTSA 3VQBA 1Y5LB 3KMQA 4DB3A 3IXQA 1W7WA 4LUBA 3KOAA 3SIPB 2AWZA 3PVXA 1Y64A 2F9TA 3CJQA 2HEKA 4ZP6A 2E2NA 1UOCA 1S3XA 4NX9A 1DQAA 3WQUA 1NLKL 3N4WA 2FBXA 2QRRA 1WHVA 1NHVA 3CD6S 2EW9A 1DTQB 3AODA 1WWHA 4OJ3A 1SQEA 1RUSA 4CJQA 3IS9A 4NMXA 2QA4S 3GYGA 4QWEA 3CPEA 1JJ2M 4DV2F 1C4AA 4USWA 1U48A 3FZ2A 5KI6A 2Z1GA 4CZCA 3W3SA 4Q8FA 3HTVA 4PWDA 1RDWX 2F96A 4LF5F 3ZX3A 3SPZA 2VPXB 4USKA 2ASPA 4OYAA 4CVNE 1IKXA 2NXNA 2XWYA 5HMYA 1KOHA 3BZKA 2NRZA 4W5RA 3OYBA 2Y0BB 2MLYA 1WHYA 1GAOA 3IM9A 1SL1A 1HNWJ 4NYFA 4CJKA 1F5AA 4C8ZA 2IAJB 3EVOA 5C7PA 3CM6A 1QM9A 1FNMA 1UEUA 2JWLA 2QXFA 4FPIA 3UNGC 4WU3A 2CPDA 3MWPA 3OYLA 2PO4A 1NDKA 5BR8J 3HFKA 4G65A 3QAEA 2AGPA 2R8JA 2Q6BA 5EXWA 1Q53A 3I56N 1R6YA 4LIRA 1VQNS 1LWCA 1J5EK 2E5HA 1S6PA 1Y97A 4CJFA 1QUVA 5LJ3Y 3LM2A 2HQ3A 2BEFA 3V9SA 1N0UA 1RU1A 4OYOA 4NXNF 1V4TA 2V9WA 4W5OA 4CIFA 1VCTA 4CFDA 3QIPB 1RT1B 5CD4A 3LDLA 3JYTA 3DXKA 3HFZB 3IAS9 5B0CA 4DTRA 2HFSA 4CF2A 2X3DA 1KXPA 2MEWA 3SBTA 5FPDA 3I5CA 5HANA 1CJVA 4FM1A 3PFOA 4Y2KA 5KFWA 3H5YA 3BEXA 1NDPA 3DLBA 4EP5A 3L09A 1RQ0A 2ITGA 4UT4A 4KHNA 1RDRA 1UVIA 1OH5A 2JGUA 1JXLA 1N5TA 3KLFA 2NRTA 3HVAA 1JLFA 2B56A 3K5PA 4DUZF 5DQGA 1M5OC 4A2AA 4Y1DA 4FPRA 3RTVA 4YS2A 1QQMA 1IVZA 3VVUA 1T11A 3JS9A 4PEOA 3H42A 4A5AA 3R9PA 3JAMY 3BKFA 4CLLA 1WG1A 2XMWA 1WB9A 3O44A 3OVSA 7FD1A 5CCMA 3UW1A 1IO2A 3LDSA 3VQSA 1HL6A 2J8SA 3G6ES 1BQXA 5FRNA 3MFIA 1GXUA 5L39A 1CLQA 4GKKK 4DZDA 1FKPB 3W65A 1JX4A 4ZIVA 1V4SA 2XS2A 5B08A 3LOUA 3HM9A 2YHWA 1KN6A 3GCXP 4JI0F 1E6VA 2ZUAA 4JD2A 3OS0A 4EFAC 1AZSB 4JN4A 4B02A 3F9MA 2FZGB 2F9JA 3A12A 1LFWA 2EFPA 4B9NA 5IM0B 1G2EA 2UZAA 1FKOA 1WTFA 2IYIA 4JKEA 4JS4A 2VCPA 1TK8A 3S3OA 2QMUB 4M3WA 4BDYA 1GLAG 3IR5B 1W26A 3TUIC 3NWRA 2FHKA 1H3DA 2ZJQQ 2FY8A 2HMIA 4DR4F 3NNHA 2E44A 1IKVB 1M0SA 3EE9A 4NA3A 3NGYA 5HMWA 2MJNA 1UFLA 2RQ4A 3P5JA 3C95A 4JLHA 4DSIA 4FWKA 4L72B 3A5NC 5IT9O 2ZBPA 4GRSA 2DIVA 1AFIA 2BOAA 2ZZNA 2HQIA 3RZAA 4ZDNA 4LBPA 4HTIA 4H5VA 5J1EB 5FLXU 4HUEA 1NCLA 2DNZA 1CXUA 3HVTA 3GLJA 3CCJN 2W7AA 4BWJA 4K4WA 2FUG9 3LP1A 3VQAA 1VQKS 3B6OA 4E7KA 4DV1F 5AZJA 3R8YA 2G0CA 3THVA 2DXFA 1DJ0A 4PG5A 4DU8A 1LXNA 3KD5E 1RAEB 4ID8A 5GINA 2I6WA 5AQOA 4RNOA 4FZVA 4CESA 3D67A 2D5RA 3UKRB 3DWLA 3QNOA 2C2OB 1N32F 1S5JA 2FVPA 4HHJA 1PKUA 3E66A 4JKBA 3ULDA 3IC1A 4XK8C 2DNKA 4NXMK 1X0PA 4X2BA 4DV2J 2G8WA 4OZ5A 1QZ6A 5DDQC 1UA0A 1VQMN 5F0XA 4BC4A 4OJRA 5ADZA 4LF5J 4CJLA 3UCGA 3EO3A 1C1CB 4G1QA 3OTDA 4PXBA 1SJFA 3I32A 1NDLA 2J7UA 4YDUA 4UUWA 3A8EA 2JSXA 5D77A 5LMNJ 2GZOA 1VQPN 2DRBA 2MHNA 4DTUA 2BE9B 1CJKA 5GAEP 1BUXA 1PAUB 5M1OA 3FZFA 3PEJA 2ZJPL 4GKJK 1C0GA 3N28A 4CTAB 4KGZB 1RTZA 3DAWA 2VA2A 1RTIB 1HYVA 3G71S 3UN5A 3T5HA 3DMJA 4YOYA 1JLCB 1TKZB 4UQGA 1YHQN 3OHAA 2IA0A 3GP9A 4LH5A 3NH0A 1GXLA 2GO9A 2AJ2A 3BH6B 3CD7A 1UWAA 5AE2A 2UP1A 2APOA 5CD4H 5C10A 1HW9A 4DLEA 1SAZA 4P72A 5LY3A 1T94A 4OHXA 5DO2A 1IBLF 2VUGA 3TQEA 2HNDB 1U8SA 3K5NA 4KAIA 3FQLA 2OIHA 2IM0A 1U6FA 1PIEA 5HRPA 1WOQA 4F2RA 2LCWA 3PJXA 2QM1A 2QKKA 3AGRA 3MURP 3EUNA 3NGSA 4ECWA 1EX8A 3AFGA 1BY9A 4Y28C 3R7SB 5GAGI 4OPHA 4KHYA 5IC4B 2HOEA 1M1KO 5CY4A 2C2MB 3C14B 5F8NA 1QD1A 4OI1A 2EKNA 4DQ8A 3QEPA 3QIOA 1IN0A 3HRGA 4FLTA 3MR6A 1XK8A 2KU7A 4JK8A 3O1WA 1FXDA 4CH1A 3PZPA 3TVZA 4QOTA 5KAKA 1QQCA 5K8NA 3MR2A 5FPNA 1DTQA 3HDSA 3GJQB 4FZZA 3K5LA 5D4PA 4F4XA 1R31A 4PG8A 5EDWA 1Z1ZA 2YQ0A 4FJJA 4LR8A 2JOQA 3TTFA 5KFRA 3CJAA 1S6OA 3PO5A 1SQFA 2OZSA 4FKYA 2LU2A 3MF5A 4H5NA 2IM1A 2YHBA 5F8HA 3R3LA 1VFJA 3O3FA 3SXLA 4P71A 3GTYX 4OHZA 5BR8K 5B09A 4H4KA 5EX3A 4CM2A 2HFOA 4LSLB 2V8GA 3JAMU 2IAJA 3QT6A 4IO9Q 4ED0A 5I3PA 4JI0J 1NPPA 1Z05A 3PW5A 2PIIA 4Y2IA 5KFCA 4FWNA 4J8FA 1WEXA 2V2QA 4Z0UA 4FL9A 3K7RA 1R8BA 2ZITA 2QC3A 1X7VA 4RBVA 1NSQA 3D6FB 4H0YB 5GAHU 3OV7A 3CCTA 1RT4B 1T9XA 1SH2A 2XULA 1AA1B 2D1KA 2B51A 1QAIA 2VJVA 2DHXA 1KAZA 3UN3A 3LP2B 3QIPA 1RT1A 2W40A 3M30A 4IOAQ 2LXFA 1TP7A 2LQ9A 4DR4J 4FNIA 2JL9A 4F02A 2XMUA 4ERDA 2M88A 1RKIA 5HMXA 5LOQA 1E4GT 4EO8A 1VGYA 2D41A 4USMA 3KJNB 3EE3A 4PKIA 3OSPA 3CC4S 1SC3B 4WIQA 3FFIB 1K8AT 1TUGB 3CCZA 2QA1A 3OBYA 2R7OA 4WTOB 1L3SA 3L2UA 3NGIA 1RGIA 2YXLA 3C3LA 3N6LA 3D28A 3GIMA 4FM2A 2O8CB 4IH6A 4NZ6A 5KT2A 4XDDA 3TVKA 2I7NA 4ILHA 2HBJA 2Z2ZA 2RMLA 3FNNA 2NZTA 2ZH3A 1KTQA 1NKEA 2GO8A 2XI3A 3KNAA 1NK0A 1VQ4N 2YNGB 1KLMB 1NM2A 2JHEA 3M2RB 2GA7A 3BR9A 3M6UA 3OFHA 1N32J 4FLYA 2B8QA 3ENOA 1Y10A 1Q16B 3HCXA 3MM6B 4CGJA 1PJ6A 1YTYA 1K6YA 2IVFB 1H72C 5FDLB 4N56A 1YDLA 4AXIA 4C8OA 1YJRA 4WFXA 4KGKA 3SSQA 4DDFA 2CPHA 1UWBB 2ZWPA 4NLCA 1OY6A 2G0IA 4CZMA 1PG5B 2UUBF 1KP6A 2C2KB 3L3UA 1AZSA 2B6AB 2Q1LA 2RUSA 2A6OA 3DDNA 2JLEA 3U1NA 4WP8A 4YHHF 4TU8A 3MN7A 2GUPA 3HO1A 4LF9F 5IM0A 4OZ0A 4PKHA 4EWTA 3C65A 1FA0A 2XG8A 3CJ3A 3LTOA 5HRRA 1BUPA 3BGLA 3VF4A 1LWXA 1S1TB 1ZZFA 2WTUA 4AF1A 4GO7X 4PYAA 4TSXA 5FRMA 3BF3A 4OX8A 2ZDPA 2D9PA 4CECA 4DEZA 4GY2B 4NOHA 5JS1A 4BC5A 1IKVA 3SEOA 3G8SA 4ZVSB 1SIZA 3FC9A 2WHOA 3C8YA 1D9FA 3W2WB 4DPWA 3OVBA 4HH1A 3BR8A 1TAUA 2MYFA 4CT8A 3M3ZA 1AUSL 1UFKA 3MUTP 2FHJA 1HUXA 3WEEB 3SCJE 5D6GA 2KT2A 3CMES 1NWKA 5DK5A 5J1EA 2BMBA 1HIYA 2OGUA 4OKEA 4DU3A 1K9MO 1U7LA 3G96A 3AAQA 5KFQA 1NJYA 4IOCL 3CCRS 3MPDA 5AQVA 1VBXA 4RNHA 3KWGA 1HNZF 2VOOA 3PKMA 1SKWA 4KTZA 2QA2A 3ZZ0A 1XWLA 4LF7F 5CYQB 1ZBSA 3NH1A 2JRSA 3HSGA 1WC0A