1QE1A

Crystal structure of 3tc-resistant m184i mutant of hiv-1 reverse transcriptase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE, SUBUNIT P66
total genus 121
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1qe1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qe1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qe1A05
2HHWA 3AVBA 5T14A 1RBVA 1CXUA 4F4WA 1TK0A 3H2LA 2X6NA 1C1CB 4N41A 1WNEA 4FM0A 2AU0A 4RW9B 3U6FA 5DQGA 3ZT2A 2BE2B 4RZRA 4I7FB 3N6LA 3GIJA 3L3VA 2Y1JA 2JC0A 4J9KA 1JL2A 3AVKA 1T94A 5J2MA 2V4QA 3NF7A 2GIQA 3SQ0A 3M8QA 4DSJA 4MH8A 4XPEA 3U3YA 1R0AA 3QLHB 1KVAA 4RUCA 4CIGA 4ED7A 4E0DA 2RKIB 2F8SA 1FK9B 3VN5A 3FFIB 3KLGA 4Q44A 4DF4A 3HM9A 3VQ6A 1N5YA 4IRCA 2XGPA 4M3TA 4CK2A 3QNOA 4H4MA 4FJNA 4KHMA 2IM2A 4DL2A 1DLOA 3S3OA 3OS0A 4TQSA 4BE1A 1WAFA 3GV7B 1JLQB 3NBPA 4YMEA 4LH4A 3NCIA 2D0CA 3LP2B 1IKXA 4LSNB 3HT3A 4HCCA 5KFCA 1XR5A 4EBCA 3OSNA 4YR2A 1GOBA 4W5QA 4E7HA 4UQGA 3T5KA 1S9FA 5FROA 2ATLA 1LWEB 4NLRA 1QSLA 4FBTA 1MU2B 2B5JA 4WFXA 4CJVA 5FDLB 3I5CA 4CHPA 4KREA 1X9WA 4KHNA 2BRKA 2ZE2B 2LSNA 3AO1A 4DFMA 2HNYB 4ECUA 3RMCA 3DMJB 1JLAB 4RW8A 4KTZA 3DRPA 3HXMA 1FKPA 5DLGA 1IKXB 4LSNA 1RDAA 4R0EA 2W9BB 4FXDA 5J2NB 3B6PA 3S9HA 4Q45A 3AVIA 4Z4FA 3C95A 4XO0A 5I3UB 3DM2A 4CF8A 4WYWA 3AV9A 1OS5A 3QZ8A 3RR7A 3M8PB 3K5NA 1S0OA 4ID1A 4KB1A 4Y1CA 4O3RA 4KSEB 3DLGB 4NCAA 1B9DA 4EO6A 4WZQA 4CF0A 1VRUA 4KV8B 1BQNA 2ILYA 4FM2A 4NLYA 1S48A 4IG3B 1SKRA 2OPRB 1RTIA 3ZSZA 1NK4A 5DMRA 1KVBA 2RDJA 3SUOA 3V81A 5CY4A 5C25A 3P5JA 4O3NA 5J2QA 3PW4A 2DFHA 1JLGB 2AX1A 3CM5A 1JXBA 1BIUA 4RG8A 3HKWA 4AHVA 1IKVA 2WCXA 1VSHA 4IR9A 4CHNA 2ASJA 3H5XA 4EYIB 3KTQA 3BSAA 4RW7B 3THVA 5HRNA 3RTVA 4FVMA 5T7BA 2KFNA 3BQ2A 3OLBA 1RTIB 3QEPA 2HNYA 3LAMA 5DG8A 2VWKA 3VQSA 3NL0A 3DMJA 1JKHB 2FBTA 2HWIA 1SL1A 3RBEA 4CHOA 4C8LA 4DSFA 1T03B 4K50A 4Q8FA 2VA3A 1C0TB 4WXOA 3EPIA 1C0UB 1RCHA 3QGGA 3PY8A 1QQCA 4OKJA 3DLBA 4TY9A 1LAWA 1X1PA 2YNIB 4B9SA 3IRXA 2BRLA 3OL9A 3AVNA 4F3OA 3L2WA 1HNVB 2C2RA 4KFBB 3VQPA 4NCGA 3VQ9A 4HUEA 3QLHA 2YKNA 3SPZA 1A5WA 1CSJA 1BCOA 3OYFA 4DTNA 1IH7A 3KKRA 1Y97A 3H4DA 4YR3A 3CFPA 4FK2A 5DLFA 3UQSA 4WE1A 1N6QB 3QGIA 2RF2A 3UPFA 4O3SA 1YVUA 3I0SA 3L2UA 3RRGA 2E6LA 4IKFA 1N4LA 3K5OA 1BIZA 4B9TA 3I5BA 4EBEA 2YNFA 1HJRA 2XCAA 1I3AA 3FRZA 1HQUA 2WB4A 4URQU 3NGZA 2IC3A 1F21A 1VSEA 5EDWA 3MFIA 1ZBUA 3EZ5A 3WNFA 3KK3B 2R2TA 4CHQA 4CGIA 2HVIA 1DLOB 3ZSQA 1JKHA 1RBSA 3WNGA 3VQ4A 4JV2A 4NRTA 3QERA 5FRMA 4TN2A 3CFRA 1RDCA 1TAQA 3HSTB 1JLAA 4Q43A 4HHTA 3HO1A 2XGQA 3QYYA 2RKIA 3T5JA 5CZ1A 4B8AB 4H54A 1LWEA 2IMWP 5D3GB 1UA0A 3CG7A 1O1WA 1TV6B 3AO3A 4TY8A 3OL8A 3SPYA 3DI6B 3AO2A 3T5LA 5JXSA 1TKZB 4M3RA 4ELUA 4O55A 1S1TB 2HMIB 1JLCB 1C1BB 3DLKB 2R8IA 4K8ZA 2Y1IA 3V6DB 2OZSA 3HPHA 1RT5A 4J9QA 3VQEA 2VA2A 1Q9YA 4ED8A 1L5UA 4ED6A 5JS2A 3I0RB 4FLYA 4B9NA 5L1JA 4ZVFA 4IR1A 5C24A 2ETJA 1SH3A 4FK0A 4DG1B 4CJLA 3KK2A 4FS1A 2WK4A 5SWMA 1NOYA 4KHRA 4DSEA 3SI8A 1CZ9A 1N48A 2F96A 3NF8A 3CVKA 3OYKA 1RBRA 5KG7A 3T1AA 2FJWA 1SKWA 2B4JA 4KAZA 3ZT0A 1TAUA 3LZJA 4RW8B 1VRTB 2VG6B 3P1GA 4DTUA 4DEZA 1T05A 4BE0A 1BL3A 2KW4A 3AA4A 2RDIA 4I2QA 1RNHA 4DFJA 1S5JA 3CM6A 1TK8A 4KI4A 3RAQA 2OPSB 4DSKA 1R0AB 4OGCA 4AHTA 3AA5X 3H08A 4RNHA 2J6UA 4IBNA 3HJFA 5HLFA 4DLGA 1TK5A 3CO9A 3FFIA 3KLGB 1BISA 1KFDA 5FRNA 1U45A 3C6UB 3OYIA 4CJ5A 4KO0A 4Z0UA 5EUHA 1RT1A 4Q0BB 4J9PA 4FJGA 4WFYA 5KT6A 3D0PA 1BCMA 4PY5A 1HYZA 1L3UA 1S1VA 2XY7A 3HPOA 1C2PA 4U6PA 3EY1A 2YNGA 4E1MA 1C0TA 2HNDB 2GC8A 1RT2A 4J9LA 3CDEA 4RUAA 4ID5B 3LPUA 4B9LA 2YNHB 5EU7A 5KFDA 4FLXA 5KFLA 5EWGA 4L8RB 1LW0A 3VQ8A 2V9WA 2HWHA 4DL4A 5KT5A 2W42A 5F8GA 5J2PB 3LP1A 4DQSA 3H4BA 1FKPB 3OYCA 2RPIA 4CJEA 3KHHA 3MXMA 3PR5B 3KLEB 2I5JB 1C0MA 2AGQA 2D7SA 4F50A 4ID5A 3V1OA 1J9AA 3NGIA 5DK5A 3DRSA 4XPCA 4K4SA 3C6TA 3NH2A 5KFXA 4HKQA 4BDYA 4TSXA 1D9DA 4BWJA 4ZTFA 2X74A 4RNNA 3KD1E 2DFFA 4J9NA 2IJNA 1VSIA 4BDZA 4I2PA 4YNQA 3RRHA 3IGNA 2W8KA 4JUZA 1BQNB 4DTJA 1HQUB 1SV5B 5F8HA 3QEWA 3DLEA 2AJQA 3TQ1A 2VG7B 4M3WA 4ZP9A 2J6SA 1KHWA 4JS4A 5C25B 4DTPA 1QAIA 2KFZA 3LWLA 4CEFA 5HP1A 2FC0A 1U09A 3PX4A 1XC9A 3Q8SB 2P5OA 3M8RA 1QSYA 2C22A 3KLHA 2JEJA 2JGUA 2ASLA 2EC0A 2D0AA 1VK0A 3RB3A 4AHRA 4MK9A 1K1QA 2VWJA 2ATQA 2C2EA 3NGYA 3L2QA 4IFVB 2AX0A 2YV0X 4ZVHA 1MU2A 4OJRA 1MMLA 1NJZA 3OYLA 3HL8A 5KRTA 1D9FA 1JLEB 1XWLA 4CGHA 3BREA 1Q8IA 4CEBA 1JLBA 3LP0A 1J53A 1WSJA 4ECSA 4KHYA 4I9QA 4DTMA 3CDWA 3SJJA 5HBMA 1S4FA 2XY6A 1RBUA 4LSLB 1LWFA 1N56A 1N5YB 1ZTWA 3V1RA 1G15A 4TY8B 4NLQA 3G10A 3AVLA 3IG1B 4PUOB 4M95A 1JLQA 3TANA 4Y34A 3DLGA 2Z1JA 1S9GB 1HNIB 3QETA 1TL3B 2WONA 1XR7A 2E9TA 3OYAA 4EYHB 3D45A 3OS1A 2OYQA 2P1JA 3TAQA 5KT7A 3QO9B 3NAHA 3Q8PB 2G8VA 4EZ9A 3V9ZA 4E7JA 5I42A 4OVLA 4KHSA 1X9MA 1HPZA 4ZPCA 3LALA 5JUMA 3K57A 1ZYQA 5DG7A 2YNFB 5DG9A 4FJLA 4MKAA 3ICLA 1WN7A 3KJVA 2IC3B 4CEZA 1J54A 2JLEA 1X9SA 2EHGA 1B92A 3H5YA 4C8KA 5KFNA 3MECA 3ITHA 1W25A 4IH7A 1NJYA 4ECRA 3NAEA 4KBIA 1UOCA 4CK1A 1TKDA 5L1KA 1HQEB 3V6JA 1NKCA 1GX5A 1TVRA 1QUVA 5HROA 2W9CA 4EP5A 3FSIA 4TQRA 4C8MA 3TAMA 5KT2A 4E7KA 4DQRA 3ISND 2DFEA 2IAJA 4F4XA 2YKNB 1VRUB 1T8EA 1KHVA 3DI6A 4O4GB 4CEAA 2NUBA 3OY9A 3HK2A 1WAJA 4FZZA 1ZBHA 3ZCMA 4N47A 4W5TA 3AA2A 3MF5A 1REVA 2HNDA 3OYBA 3CJ4A 3MR6A 4CF1A 4E7LA 1EETB 1NK6A 1S9EB 1NK7A 3SFUA 2IBKA 4K4ZA 4NLXA 4ECXA 1HYVA 2J6TA 1BQMA 3FDSA 1NNDA 4OKEA 4F2SA 4QW8A 1RTDB 1RDDA 3KMQA 3HPGA 1TKXA 1NKBA 4XIUA 3A2FA 4R5PB 4FW2A 1WSGA 5DQIA 4FJIA 4K4UA 2B43A 3M8QB 3OYJA 2IM3A 4KE5A 4FJHA 2FBVA 4OPKA 2WHOA 3T3FA 3H5SA 2KZMA 3IN5A 3JYTB 4C8NA 1U04A 2OPSA 4AILC 1NJWA 2OPRA 2Z1GA 5KFFA 3LDSA 4FJJA 2FVPA 3JSMB 3KD5E 4CHZA 3G6YA 3VA3A 1ZBLA 3IS9B 4IH6A 4CFDA 3KHRA 1RYRA 3NE6A 1KFSA 4IRKA 2G8IA 2AWZA 1QAJA 3CJ5A 4CE9A 3HVWA 4ELVA 3N6NA 5F8LA 3D5MA 4Y2CA 2BR0A 3CYMA 1RT3A 2W9AA 2CKWA 3BSOA 2IS3A 1RTHA 3SQ2A 4PWDA 2RF2B 4KB0A 4B9VA 4GMJB 3QESA 4F3TA 1JXLA 3NAIA 3MFHA 1TQLA 1NOZA 1C0UA 3ZSOA 1BGXT 4B8CA 4PUOA 1FKOB 3DLKA 3OHAA 4QOZB 4JV1A 4TLRA 3FQKA 3V9WA 3F73A 2R2RA 3RBDA 4RW9A 4IH5A 3DDKA 2D0BA 3PW2A 4URGA 4MK7A 3TAEA 3L2RA 4CJTA 1UWBA 1NHVA 4ICLB 3EYZA 3CJ0A 4QWAA 4O0JA 1NK8A 5KFPA 4Z4EA 2XCPA 4YP3A 1S6PA 4O3PA 1D0EA 4KB7A 3TAGA 3KLEA 4G3IA 3KOAA 4DU1A 2E4LA 1KRPA 4O0IA 1YT3A 4CFAA 2VG6A 4CEDA 1S1UB 2XY5A 1HMVA 2VG5B 2C2DA 1TV6A 2E9RX 3LZIA 3HHKA 3ZSVA 3K58A 5I42B 3IGVA 5KG4A 4OLBA 1GOAA 4NYZA 2UVUA 3ULDA 4HYKA 2BANA 4DWIA 3I8DA 2DPJA 3AVCA 1I6JA 3AVJA 4HUFA 4ECVA 4CGJA 5KT4A 1LWCB 2QK9A 4F2RA 4CJ4A 1VSMA 4CEOA 5J2QB 4NLDA 4QWCA 4NZ0A 3I0RA 1IKVB 3OL6A 2QKBA 3SQ4A 1WLJA 1RTJA 1CZBA 3SFGA 2OH2A 5F9LA 1KLNA 2IOCA 4Y1DA 1S0NA 1WSHA 3H98A 4Z4CA 1FKOA 4M41A 5KFQA 4DF8A 3KLFB 3DRPB 3O3HA 5C5JA 4FJ5A 3DOLB 2R2UA 3EPGA 1XHXA 3GIMA 4KKOA 4RNOA 1REVB 1JL1A 2EX3A 4M3XA 4YR0A 4CGGA 3DRRA 4NRUA 2I5JA 3BJYA 4M94A 3NF9A 1Z25A 1U4BA 3NMAA 4DU4A 1TKZA 1YTAA 2ZQBA 5KG2A 3K59A 3P83D 4CECA 3RMBA 5EWFA 2FJVA 4PQUB 1DTQB 1BI4A 3BR9A 3O3GA 3SV3A 4Z4HA 1HNVA 2X6SA 3M9OB 4EZ6A 3QIOA 5DGBA 4FS2A 3ZT3A 3NGDA 1RT4B 4CF9A 5DGAA 4IFYB 1LWFB 5F8IA 3QZ7A 4J9MA 4NLWA 1BQMB 4N5SA 4TYBA 3KHGA 1BHLA 4O4GA 1W0HA 4BWMA 4IRDA 3KLIA 1XI1A 2X78A 5J1EB 3IG1A 3MR3A 3KKSA 3RMDA 1RTDA 5KFYA 1NKEA 1RT2B 3AA3A 3QIDA 1JLGA 1SH2A 4PQUA 1JLFB 3RR8A 3OHBA 4K4WA 3V9XA 2QV6A 3QINA 5F8NA 1U47A 2FVRA 4JS5A 4IDKA 4CGFA 4KTQA 4RW7A 4CEQA 4KPYA 4CERA 5K14B 4FZXC 4CESA 4ECZA 4B3OA 1B9FA 1HPZB 1D8YA 5J2PA 2ZD1B 5HRRA 3PW7A 3D28A 4CJQA 2BQRA 1NJXA 3GILA 3KJVB 4O3QA 3HP6A 3M8PA 2BDPA 3BDPA 3OYDA 1KVCA 4ECTA 3LP2A 1ZTTA 3VQ7A 3NFAA 1FK9A 1IKWB 1RA6A 2D3UA 5F8JA 4KV8A 1D1UA 3QNNA 1FXXA 5KG3A 1TL1A 5C42B 2BQ3A 4LY7A 2O4IA 3V1QA 3ZSWA 2IJFA 4JV0A 2FVSA 4M45A 3TAPA 2DTUA 2HNZB 1ITGA 2R8HA 3SNNA 5CYQA 3BQ0A 3SCXA 4CJUA 1S0MA 3MEDB 3KMSA 2HVHA 2YNHA 3OVNA 4K8XA 1JLEA 4E1NA 4HTUA 4NCBA 3DLEB 1DTTB 4K4YA 4ECYA 1N6QA 1SV5A 2V0NA 4ED0A 4Z4GA 3SUQA 3KK3A 1W9HA 4RNMA 1ASVA 4RW4A 4N56A 1TGOA 4FLUA 2ZE2A 2ALZA 2R7YA 4TYAA 1U49A 4EP4A 4LH5A 1WSFA 3SUNA 3QIPB 3LAKA 2FBYA 4DL5A 2QKKA 4H4MB 4J9OA 2OPQB 1VSJA 2YNIA 4O44A 2Z1IA 4IFVA 2QE5A 4JRPA 4DTXA 1IM4A 4CJ3A 4K4XA 5JS1A 3NBPB 2GBZA 5KFZA 5CYMB 3PHEA 1RT5B 1RILA 5KGXA 1WSIA 2HHXA 1VSLA 4Y3CA 4KFBA 4EEYA 2GV9A 4FJKA 1XR6A 5KG6A 4KTWA 4JLHA 3DOKA 4DTOA 5HBMB 1RTJB 1RT1B 3V6HA 4R8UB 3PX0A 2G8FA 1XHZA 2FJXA 2ASDA 4RW6A 2A1RA 3VQAA 3KK1B 3DOLA 1S1VB 1S6QA 4KKOB 4DMNA 3ZSYA 3CFOA 3PW0A 4CCHA 5KFRA 1TL3A 2P51A 2W9BA 1LWCA 4PA1A 2WTFA 3EZUA 1S9GA 4CIFA 2G8UA 1L3VA 1TKTA 3MEGB 2OA8A 3PX6A 1RT7B 1RYSA 1SUQA 4NLOA 4NYNA 3G6VA 3MEEB 1EP4B 4O3OA 3QGHA 4KAIA 3KLIB 3H59A 2FLLA 3BGRB 2XC9A 2HAIA 4FYDA 3AVHA 2F8TA 2P5GA 1ASWA 4EBDA 3PZPA 1EKEA 4ZP8A 4E89A 5E41A 4KHUA 3ITHB 3G86A 3M9MB 2OPQA 1S49A 3VQQA 1S1XB 4ICLA 5K14A 3TWHA 2JC1A 4IQXA 4B3OB 1S1TA 3MEEA 3OL7A 2W8LA 4QCLA 3CWJA 4LD0A 1SL0A 2YHBA 4DTRA 1NK5A 3GQCA 4DFKA 3OSPA 3TAMB 2XY8A 2XO7A 4O5BA 2F8EX 3AVFA 2O4GA 4NLPA 4W5RA 1QE1A 3I0SB 2AGOA 1C1CA 3RB4A 4DSLA 3V9SA 2OZMA 2WOMB 3UR0A 2G8HA 1S1XA 3FQLA 2PYJA 4G1QA 1TP7A 4WE1B 2IA6A 1LW2B 5HRPA 4WFZA 1UA1A 3ALYA 3TAFA 5J1EA 2VG7A 3LP1B 3PV8A 2ZKUA 3U3GA 3E01B 3LPTA 5KFAA 2UUWA 4ZVEA 3HVAA 2D3ZA 3TI0A 3GIIA 2HHUA 2KQ2A 1S97A 5J2NA 1U48A 3AVGA 4CHYA 3I5AA 4E3SA 3CIZA 4CJWA 1LW2A 3F9KA 3Q8RB 1S1WB 2JEGA 3RB0A 5HLFB 4H8KA 3GV8B 1NHUA 3QEXA 4NLVA 3V4IB 4OLAA 5F8MA 3OLAA 3V6DA 2XI2A 4LQ3A 3LP0B 1JLBB 5KFSA 2BE2A 1VSFA 3M9NB 2R8KA 4I7FA 3MXJA 3JYTA 4RW4B 4M42A 1C1AA 4DG1A 1QTMA 1JXEA 3ZSXA 4LSLA 3KK2B 3OYGA 4W5OA 1J5OB 3SI6A 2ITGA 4Y2AA 4OKKA 3VQCA 5KFKA 1QHTA 4ED2A 4OPJA 1EETA 1NK9A 4N76A 3ZT4A 1UAXA 1RA7A 3KNAA 4MFBA 4IFYA 4MQ3A 5KFHA 1RT3B 2IM1A 3NKYA 2OPPA 2YKMA 3KLHB 3RMAA 4WXWA 4KHWA 4G1QB 2IDOA 2KZZA 4DFPA 4ZHRA 1C6VA 4J2BA 3DYAB 3AO5A 3VQDA 3BSCA 3OYMA 1Q9XA 3BQ1A 4QWEA 1LW0B 4EO8A 2FBXA 2UVWA 3CJ2A 4CJRA 3E01A 1QSSA 4IKAA 5CYMA 4ZMMA 3OYEA 4ZP6A 4GC7A 2HB5A 2PZSA 5KFVA 5L9XA 2XHBA 4M3UA 5CZ2A 3DLHA 4E7IA 3PJXA 4H4OA 1GX6A 2OPPB 1SH0A 3GV5B 1RDBA 4CIEA 2W7OA 2Q3SA 4HVJA 4FK4A 1SUQB 1S1WA 3LANA 2AGPA 1D5AA 4RW6B 4ED1A 5KFIA 4J9SA 5KRSA 2HW3A 4DS4A 1RT6B 2XWYA 4ZP7A 1LAVA 3S3MA 1C1BA 3KHLA 3V81B 4QWBA 4QWDA 3MR5A 2W9CB 4X2BA 1KCFA 1TVRB 1EX4A 2R8JA 5HROB 2UVRA 1DTQA 4AH9A 5L1IA 1HYSB 3H40A 5C24B 2VG5A 1Z26A 4NCGB 4H4OB 3NDKA 1IKYA 5KGWA 1RDRA 4BACA 2B5JB 2FVCA 2DPIA 4IG0A 4WYLA 4ED3A 4NLTA 4JRQA 2Z1HA 5CYQB 2HHSA 3BGRA 3MEDA 2BQUA 2XRIA 3O3FA 3H5UA 3RWUA 4MK8A 4URSA 3K5MA 2FLNA 2FLPA 3O4NA 1S6QB 3V9UA 2ILZA 4MIAA 1IG9A 4CGDA 1T05B 1HARA 1QE1B 4I2QB 2XI3A 4B9UA 3L8BA 3DM2B 3SYZA 4ZHRB 3QO9A 1TKTB 4B9MA 3DYAA 3NH0A 4E19A 3G0ZA 5L1LA 1HQEA 1Z4UA 5KT3A 4Q8EA 4NLSA 3ISNC 2C28A 2HHQA 5KI6A 3PO5A 1JLFA 3MR2A 3E51A 4TXSA 3DRRB 2GUIA 4FLWA 4FLTA 4FJ8A 1A5XA 2HHVA 4DL6A 4FJ9A 3DLRA 3MAQA 4MKBA 3PUFA 4Q0BA 4O4RA 2A1SA 1RT6A 1YVFA 4K4TA 2HHTA 5D3GA 4OL8A 1TL1B 5C42A 1SL2A 1I39A 4FCYA 3RB6A 3KLVA 3ASMA 5FDLA 3HVRA 5KFJA 1BI4B 5KTQA 4FLZA 5KG5A 3ZT1A 3V4IA 3QEVA 2KTQA 1JIHA 3DOKB 4C8OA 1S9EA 3MXIA 2UUTA 1RT4A 2B6AA 4R8UA 3IRXB 4IG0B 3Q8QB 3WNEA 4BE2A 3GIKA 4CF2A 2QXFA 1SKSA 3NHGA 1CXQA 3G6XA 5J2MB 4ELTA 4KHQA 1T03A 4GVMA 4CFBA 4DQPA 1J5OA 4K4VA 2V4RA 3TABA 3T19A 1T7PA 4MIBA 4GC6A 4CK3A 3OYNA 4ZTJA 2E6MA 3MEGA 3TARA 4F4KA 3ZSRA 2BGGA 4MFBB 1RT7A 3O4QA 2YKMB 3AO4A 2B6AB 3GYNA 3NF6A 4ZVGA 1UWBB 1JX4A 2FVQA 4I2PB 4NYFA 3QEIA 1ZBFA 4FM1A 5KG1A 4I9LA 4CJPA 3WNHA 5KFTA 3S3NA 4DQIA 4QAGA 3PJWA 3CDUA 5KFOA 3T5HA 4Q5VA 1KSPA 4F8RA 2AQ4A 2D5RA 1L3TA 3OJUA 1ASUA 1LV5A 4AHCA 1YTUA 2JEFA 4NLGA 1HMVB 3OS2A 2JEIA 4Z4IA 3VQBA 2DY4A 3PR4A 4GW6A 4O44B 5HRSA 3IAYA 3PVXA 2BANB 3OJSA 4ZPAA 5KFWA 2IM0A 4CJSA 4FJXA 4ZPDA 3NH1A 3SV4A 1HYSA 3PW5A 1WNSA 4J9RA 1VRTA 2D41A 5I3UA 4DQQA 2O5DA 3N6MA 4W5NA 4ZPBA 4FZYA 4DL3A 4DL7A 3BSNA 1KLMA 3HYFA 3K2PA 4F4ZA 4FJMA 1S6PB 3SUPA 1CLQA 1S10A 2PYLA 1ZBIA 3QIPA 4ECQA 4NLUA 1TKXB 4R5PA 4QPXA 4DS5A 3SQ1A 1IKYB 3RAXA 1KTQA 3MECB 4AHSA 4DLEA 4DU3A 2G8WA 3OYHA 2R2SA 1EP4A 2HNZA 1JLCA 4CJKA 1KLMB 4CEEA 1EXQA 4RU9A 3M8SA 3UIQA 2W7PA 5F9NA 4CFCA 1A5VA 4J2DA 3IS9A 4HUGA 5KFEA 4DTSA 3TR8A 4M3ZA 1DTTA 1HNIA 4RNFA 2WONB 1RTHB 4PWDB 3C94A 4AHUA 2WRMA 1HRHA 4FLVA 2I1RA 4J2AA 4QW9A 4WZMA 1L3SA 4IOBA 1WSEA 5KFUA 3K5LA 3HVTA 2WOMA 2IGIA 5SZTA 4IG3A 1GOCA 4FJ7A 3L3UA 3MTKA 4B08A 3KLFA 3KK1A 1VSKA 1ZETA 2RN2A 4HCBA 4M3YA 4FBUA 3TVKA 2G8KA 4KO0B 2PY5A 3PO4A 4FW1A 3B6OA 4YQWA 3C6TB 4IDKB 5KFMA 5EWEA 3DRSB 3LP3A 3VQ5A 4YFUA 1VSDA 2YHAA 3HVTB 1K1SA 1IO2A 3HP9A 2ZD1A 4KI6A 3V6KA 1T3NA 3LWMA 2YNGB 2E9ZA 3AVAA 2GIRA 3SZ2A 3VA0A 4OGEA 4LQ9A 4BDPA 4CJFA 2HMIA 3C6UA 2R8GA 2IAJB 4KRFA 4DSIA 3AVMA 1QS4A 4ECWA 5KFBA 3UDLA 3CJ3A 4J2EA 2CJQA 5KG0A 4F4YA 1NK0A 1RBTA 1K6YA 1IKWA 1S1UA 4U7CA 5DQHA 3L2VA 2UVVA 3JSMA 3KIOA 5HP1B 1RAJA 3CQ8A 5KFGA
chains in the Genus database with same CATH superfamily
1DQ8A 3AVBA 5C15A 3I55S 3A5NC 4PWUA 1TK0A 2OI2A 1WNEA 2IHR1 4FM0A 3O1WA 4RW9B 3U6FA 4MIWA 2DD8S 3GIJA 2GCFA 4LBPA 2K2PA 2Y1JA 2LLZA 4HI1A 3CDAA 4DPYA 1JL2A 5AQVA 1T94A 3RW6A 4DR7K 2GIQA 3SQ0A 1Q81O 2RJZA 3U3YA 4PR6A 4RUCA 3QFWA 4X62J 4ED7A 4BRFA 1WBBA 3FZMA 4Q44A 3R3LA 1EHWA 2V8PA 3FBEA 3HCXA 4LF4F 2BZ2A 4H4MA 3BBCA 3TJ9A 1KXPA 2Q3PA 4KHMA 3OS0A 4TQSA 3KZBA 4HI2A 3GV7B 4J5OA 4C0BA 2VFTA 4LH4A 2D0CA 4HCCA 2C2MB 4EBCA 4YR2A 1GOBA 5E2QA 2G1DA 1PCAA 2HQIA 1VI7A 2RQ4A 3MD1A 3T5KA 1VQNN 3LGMA 1LWEB 3VERA 5GAEP 3M1VB 1MU2B 1BUXA 2DHAA 2O8FB 2E1MC 2QL5B 2LSNA 2HNYB 3O1BA 3P4IA 1JLAB 2Q6BA 3UI3A 4QQBA 3DRPA 3HXMA 3QBXA 5H9EK 2C2OB 2ZJPL 2W9BB 1A9NB 3B6PA 4Q45A 3AVIA 2RU3A 3O4WA 3H25A 5I3UB 4FXWA 4A2AA 2L41A 4CF8A 4WYWA 2VB6A 4DR4F 2PN6A 3CJRA 3M8PB 1TR0A 3HT0A 5AQSA 3TJ8A 3FBCA 1RCXB 2B4VA 2ZKTA 1B9DA 4WZQA 4F4AA 3HFVA 3RG6A 3PFEA 2JWNA 2ILYA 2PFDA 3QT8A 1BA1A 4GKKF 5GAGI 2VPYB 2AW0A 2ZZMA 3H45C 1RTIA 1MROB 3DRYA 4B1VA 3K8WA 3KJNB 1WC6A 1HJOA 2RDJA 5DM7L 4NA1A 1J5EF 1ZA2B 2DFHA 5JLHA 3BGUA 1XMOK 1FVSA 1JXBA 4RG8A 1NZ8A 1DT9A 2BKOA 4KRWA 1VSHA 4IR9A 2VKRA 3SQGB 1NXIA 2ASJA 3QJJA 3H5XA 4EYIB 1RTZA 3CJ7A 3F56A 5ETVA 4KR0B 5AE1A 2Z8QA 3DDIA 2HNYA 4EUVA 3VQSA 2VWKA 1JKHB 2MPUA 4IEIA 4C8LA 4CHOA 3AQPA 2H3EB 2VA3A 4WXOA 3PY8A 1RCHA 3FBFA 4U8YA 2GX8A 3DLBA 4TY9A 1LAWA 1GMWA 4OLPA 4BC3A 2Y9HA 4B9SA 1QY7A 2ZBCA 1LNQA 2QC3A 4NZ7A 3WC2A 4TLQA 1MMNA 3P8BB 2HHHF 1N52B 3M8YA 4A5BA 4L76A 2DH7A 3L2WA 3EVWA 1HNVB 2C2RA 4KFBB 4DHYA 2E7WA 2GHPA 4ENOA 4WCEQ 4NCGA 4C11A 4HUEA 3JTNA 3HHLD 1A5WA 1ZXOA 1BCOA 1N5QA 3OYFA 4DTNA 1IH7A 3KKRA 1VBYA 2JRSA 3MOZA 3H4DA 1NUEA 2A42A 1QQNA 2Y8YA 3SCJE 1RLCL 2P9LB 2CWXA 5M2PA 2RF2A 2DGVA 3UPFA 4NA3A 4O3SA 4FDFA 3KK7A 1BIZA 3CT9A 3QFPA 2YNFA 1VK8A 1HJRA 3FRZA 4KH1B 1VSEA 3MFIA 1TUYA 4WFNQ 3TZZA 4WFAQ 3OW2R 1GH8A 5IS2A 4CHQA 2HVIA 4CGIA 1JKHA 4FP9A 1UW4A 1GLLO 1CVJA 2W2OP 4JV2A 4NRTA 1F5AA 1RDCA 3AQOA 2RQKA 1UVJA 4LVOP 1D3WA 3HZEA 4HHTA 2XMVA 3QYYA 3I9ZA 2MQ8A 3HSCA 3OVAA 2ZZNA 1LWEA 2IMWP 5D3GB 2PGCA 2H5IB 3CG7A 4TY8A 3OL8A 3DI6B 1EARA 3S41A 2HMIB 3PACA 4BR9A 2LCWA 3QFHA 1C1BB 3QFUA 5LSOA 2Y1IA 3P3DA 1X4BA 4RTFD 2GMJA 1Q9YA 3ATVA 4ED8A 1L5UA 3TTCA 4FKYA 3DDNA 3JQKA 5C24A 2N3LA 2ETJA 4DG1B 1GAOA 4FS1A 1RGIA 3DHXA 1JQGA 3UDCA 4KHRA 4DSEA 2KXNB 1N48A 1YHQS 2F96A 1U24A 3OYKA 3UCUP 5IM0A 3LDPA 5KG7A 3VEVA 1CS4B 2B4JA 2GELA 1TAUA 3U1LA 3KUHA 4D3HA 2R7UA 3W7BA 2KHDA 1PJ6A 2DVIA 3Q24A 2G2ZA 4DEZA 3KUGA 2RDIA 4I2QA 3FEXB 4DU7A 3THXB 1ZPVA 1S5JA 4I1TA 2W6KA 2E1RA 1U6FA 5F2RA 2FXUA 4ETZA 3AA5X 3VETA 4RNHA 2IRYA 4IBNA 3CCLS 3BZKA 3PKYA 3OUYA 3C2PA 4OZLA 3EKSA 1FRIA 3ZX3A 4Z0UA 5BXIA 3Q86A 4KH0B 5EUHA 4WFYA 5KT6A 4PY5A 1HYZA 1HNXK 2CWKA 2XY7A 3EY1A 2QW9A 2OMOA 1C0TA 3C14B 2XM3A 1QVGR 3HSJA 2OGUA 2EWHA 1BHNA 2BW2A 1B70B 5EU7A 3O9QA 4HHJA 1ATNA 3ULHA 3WXLA 3GBTA 4V19J 4A47A 3OXGA 3NS7B 2V9WA 4DL4A 4QPTA 4NXNK 1Y9OA 4DV1K 4DPXA 3LP1A 4FWPA 4DQSA 4WKRA 1XMOF 2RPIA 4MYUA 3O8MA 3KHHA 4NI2B 5FPNA 5DK5A 1E4GT 3DRSA 2ZHAA 4DCHA 2YQ0A 3LTOA 5KFXA 4HKQA 4GKKK 1X3NA 4TSXA 4TKTA 2XLJA 2AJ1A 2QRRA 1Y10A 1UVIA 5ADXA 3W2WA 2DFFA 2IJNA 4PZVA 4BDZA 2Z57B 2DY9A 2MKCA 1OWXA 4FWSA 4LFBJ 2BE9B 1MSWD 1KBRA 2EG1A 4BRIA 4USHA 4BY9C 3TQ1A 2VFVA 1NG9A 2J6SA 3GWCA 1REGX 1DRZA 4JS4A 2E5GA 1CBKA 2FC0A 4N8NA 4OO1J 3MI7X 3CMQA 3M8RA 1XNQF 2KVIA 2DGWA 2JGUA 3HZGA 3UN3A 2RUGA 5FPMA 3GFXA 2EC0A 2D0AA 2W24A 3RB3A 3VEYA 1XIQA 3UDVA 1K1QA 1IQTA 1KAXA 2ATQA 1P1TA 2AX0A 2EKNA 1MU2A 1EWRA 2HS3A 2UXDJ 2E2PA 5KRTA 1MWMA 1Q8IA 3HD1A 1J53A 2KG0A 5AFUA 3NG8A 5ETQA 3DGPA 2CXEA 5E7OB 3OTOF 2XY6A 3LUYA 1LWFA 4OI0A 2O8CA 1ZTWA 3AOAA 1G15A 3CCRN 1JCFA 1AUDA 4NLQA 2CGLA 3AVLA 3HDSA 5DZ7A 1RU2A 1M5SA 2M5YA 1WORA 2E5LK 3MMJA 2DGOA 2JX2A 4BR0A 2BABA 3QETA 4LVNP 4F7VA 2WONA 3D4JA 2E9TA 2J76E 2KKHA 2OEJA 5KT7A 4JK8A 2RQMA 1H1VA 3NAHA 4EZ9A 2KHOA 1YI2S 4MLEA 3LALA 1YBTA 5JUMA 5LM7E 1CS4A 5DG9A 4FJLA 4EHTA 2V34A 2EXUA 1GLDG 2R7SA 4DV4F 1X9SA 1CQMA 4ZLJA 5KFNA 2DNQA 3VCDA 4JI0J 3ITHA 2KB2A 2GGPA 4ECRA 5CYJA 2B9XA 2CPEA 4KBIA 1TKDA 2QLWA 5L1KA 2ZM6K 3EO3A 1NKCA 1GX5A 3G82B 2VH7A 4YOEA 4C8MA 2ASPA 4E7KA 3V5RA 4DQRA 1FWKA 2LDIA 1R8HA 4JI3K 1LOUA 4F4XA 3BKUA 3NS6A 2MSTA 5L9NA 2QSFA 1KHVA 3TPQA 1UPPA 3AA9A 3FZLA 3VTIA 4CEAA 2NUBA 5CHIA 3OY9A 4FWLA 4FZZA 1N34F 4KHPJ 4AE5A 1JJCB 4N47A 5DM6Q 3CCUN 4DB3A 4HTJA 3O9UA 1U0HA 4AQYJ 1REVA 3ENQA 2O3DA 3EGWB 2RMLA 3HHLB 1FNMA 2CH5A 4LJMA 1TUVA 2D0OA 2OLWA 2BM1A 1HNWF 3WEEA 5LY3A 3FDSA 4DUZF 4CD3A 2LU2A 4BHQA 4M5MA 5IWAJ 3FMBA 1RDDA 1TKXA 1NKBA 2VV5A 3A2FA 4FW2A 3OYJA 2IM3A 3CCSN 4KE5A 1K0VA 4OPKA 3BF3A 1FA0A 2CNKB 2VQEK 4DL0C 3T3FA 2I2YA 2KN4A 4AD6A 2V8GA 3IN5A 4C8NA 3MMBB 4UTGA 2EW9A 1HKAA 3GPAA 2E66A 5KFFA 3JSMB 3M32B 5B09A 2CNLB 1B0VA 2CQ1A 3NCPA 1QAJA 3CJ5A 1IQZA 3OR1A 4CE9A 3MCNA 3RZAA 4WF9L 4DR6K 2K7KA 3D5MA 4Y2CA 4DHVA 4I64A 2CKWA 2IS3A 2Q1NA 3A12A 5G0RA 2YVSA 4B9VA 5AQOA 5F0WA 4F3TA 1JXLA 3NAIA 3CF5L 1C0UA 2VL1A 1BGXT 4PUOA 2GAHC 3OHAA 4KIAA 3GE1A 4JV1A 4TLRA 3FQKA 2KT3A 1VR6A 4YDUA 4RW9A 3O2IA 2PD1A 2ZH2A 4DR3J 4MK7A 2BA9A 1Q7YO 4JI1K 4BC9A 1XTZA 3M1FA 3VAIA 4ZOSA 4ICLB 4B17A 4DV3K 4F04B 4QWAA 1EJ7L 2XCPA 3OFGA 1JNRB 4O3PA 3TAGA 5M2RA 2QA4N 4G3IA 3KOAA 4JYAJ 3NOGA 6AT1B 3CPWM 3L4BC 3DOMB 4DU1A 4K8RA 4H4KA 1KRPA 4O0IA 2RHKA 4CFAA 4X4NA 1S1UB 5L39A 2E9RX 4B3SJ 1T9VA 4JI1F 5AQLA 5BR9A 4ZVOB 5A0YA 2X1GA 4BRHA 3IGVA 1OIAA 3I33A 1K8AO 4NYZA 2LA4A 4H0YB 4FWMA 4LFAJ 4DWIA 3I8DA 1UFLA 2XMUA 4HUFA 2B51A 3C65A 2FJBB 1CJTA 1NB2A 4F2RA 1T9TA 2Q43A 4CJ4A 5LMNK 3M7VA 5B8HA 3R8EA 1WDTA 4QYZK 1RTJA 2DGXA 3FR0A 4WYBA 1UW9A 4O5FA 1WSHA 1EWQA 2GQQA 4M41A 5LMUK 2DH8A 3KLFB 3O3HA 3J8AA 4DBQA 4DR5J 2ADBA 3TJAA 3W5XA 2HOEA 4KKOA 1RSCA 2QA2A 2PFFB 2PI4A 3H1VX 2EX3A 3ZZRA 4A46A 4L3KA 3G8SA 2MZRA 2I5JA 3BJYA 3R9LA 3N0VA 4M94A 3QJLA 3SIPB 1H2VZ 1TKZA 3CJCA 4BG8A 1HX1A 2HYIB 1X4CA 3CEDA 4HDGA 4K7QA 2DGUA 3RMBA 2FJVA 2G0CA 3H2UB 1DTQB 3SV3A 3OR2B 1WHVA 3M9OB 1HPMA 3QIOA 1RUSA 1RXOB 5JVGQ 3NGDA 4CF9A 1ZM2A 5F8IA 3QZ7A 2A40A 3SAFA 1YJTA 4M8LA 3THYB 3DFEA 2DNPA 2UXDK 3CCJS 3NNCA 1OQ6A 4GVEA 4O4GA 4P72A 2DNGA 4IEEA 3K17A 3KKSA 3UN5A 5KFYA 1RT2B 4WF9Q 1JLGA 3CD6S 3AAQA 1SH2A 2NR0A 3V9XA 1YLXA 1U47A 3EUNA 3CE8A 3DXMB 1NMDA 2V7ZA 3HI9A 4IDKA 4CGFA 2J9EA 3VGSA 5IT9Y 4DV0K 1UFWA 2DNRA 4H03B 4B3OA 3OTEA 4GNIA 1VK3A 3ENWA 5HRRA 4LF8K 2XMMA 1R43A 1SAZA 3FZHA 3HI0A 4LBHA 3KJVB 1UJ4A 5JVHQ 1KOOA 5H1SQ 2BDPA 2MHEA 3BDPA 2DNYA 2RT3A 3VQ7A 1TMJA 2D3UA 1V6HA 3CMEN 1FXXA 4OZNA 5KG3A 5C42B 2O4IA 1QVFM 4QIGA 3V1QA 3ZSWA 4M45A 4OZ2A 3TAPA 2L9WA 3SNNA 5CYQA 3BQ0A 1X5PA 2HIYA 1S0MA 4CJUA 4WQ5C 2L3MA 1KAYA 2YNHA 3NGRA 4GVLA 1XMQJ 4NCBA 1TL5A 3O44A 3MMCA 2DNZA 2V0NA 1HI8A 2G13A 3NRBA 4FOEA 4RW4A 2CQHA 3CMAS 1E4FT 2X1BA 1TL4A 1IXKA 4FLUA 2XYPB 2ZE2A 2ALZA 3LPEA 3SSQA 2R7YA 5B0EA 4CZJA 1M5KC 4K0KF 1SJ1A 4PWWA 4EP4A 1UJ6A 4LH5A 2E5IA 3SUNA 1SIWB 1OJ4A 4V19X 2DIVA 1UPMB 3CCMN 3MN6A 2OPQB 3QNWB 1T0TV 2MQLA 3ET6A 3RJMB 1N5SA 4IFVA 4KH4A 3OTOJ 4CJ3A 4AF1A 2KL8A 2GBZA 4ES3A 5JS1A 2W2QP 3VMFB 5KGXA 4HR2A 2BV3A 4LF4J 2HHXA 3FGUA 1VSLA 2C3UA 1VBZA 1N5VA 4PXEA 1SJFA 5B0CA 3OUYB 3FZBA 3QICA 3DOKA 5HBMB 4TU8A 3AAWB 3JSYA 1XHZA 2W41A 2DR6A 3VQAA 3KK1B 3MTJA 1S1VB 1S6QA 3C8YA 4DMNA 2NRXA 3ZSYA 3CFOA 4CCHA 4KJIA 3UW1A 4U8VA 4DR2K 2XO6A 2VYPA 1TKTA 3MEGB 1FXLA 1GFWB 4W98A 1V5IB 4YOYA 3E2EA 4QU6A 3KLIB 2BE7D 1CJKB 4LF7K 2LYVA 1TTHB 1V9OA 2HAIA 1G6BA 3T1YJ 2RSQA 3AVHA 2YX1A 2P5GA 4EBDA 3L7UA 2FHOB 4A8MP 2R7WA 4IO9L 1H98A 1AW0A 2OPQA 3ZETB 1S49A 5DRKA 1RWKB 3RVCA 5K14A 3TWHA 2JC1A 3ZTPA 2DNLA 5DDPC 4BRAA 1S1TA 2BEFA 1JK9B 1SL0A 4CZGA 3GQCA 4O5BA 3AVFA 2O4GA 1NO8A 5AR0A 4CVNE 3I0SB 1BWEA 4NXNF 2HIQA 2NZ4A 4JKEA 2G8HA 3PG9A 5TKYA 2PYJA 2NYIA 5E33A 4ANEA 1S72N 3AD7C 4CTAB 3NP5A 4WFZA 5GAEU 2DNHA 3IWXA 2ZOMA 5MAOA 3UKUA 3E01B 2UUWA 3D1HA 5HVGA 1IG8A 3PTWA 4OJ1A 2KQ2A 2DRBA 4WQ4A 5J2NA 3IAM9 2YHYA 1U48A 3CHWA 4CHYA 4LF6J 4E3SA 2HWTA 1Y5LB 1RBOB 2ZHOA 5LMNJ 2KYXA 2PMWA 5HLFB 4DV7F 4WP3A 1IBLJ 1RI7A 4BGAA 3OLAA 2R7QA 1EB0A 1VSFA 3M9NB 3MXJA 1WC4A 2HS4A 1NMNA 4RW4B 2DHXA 1C1AA 3KK2B 2CQDA 3VQTA 3C6HA 3DXSX 3R5AA 1SQEA 5AQXA 4ED2A 2NXCA 2MZSA 3TO8A 4N76A 3ZT4A 1RA7A 4MFBA 4IFYA 4MQ3A 5KFHA 2B4OA 1HLUA 2YKMA 1VJWA 2C42A 3RMAA 4WXWA 1CG2A 2P2CB 1NBWA 2XZWA 3BUZB 2QWMA 1YF5L 3BSCA 1VLYA 1Q9XA 2C1EB 2UVWA 4CJRA 1DZ5A 3O6QA 1KQSR 2XHBA 3DLHA 3W0LA 3QDKA 4H4OA 1GX6A 2OPPB 1SH0A 4CI0B 4DPWA 4PG8A 3HFZB 4B1YB 5ETTA 3T1HK 4RCHA 4FK4A 3LANA 2AGPA 4XTTA 4J9SA 2HW3A 5KRSA 1TUGB 4ZP7A 3CSKA 3S3MA 1C1BA 3D54A 2YWFA 3V81B 4X2BA 1KKHA 1VQPN 3DXKA 2MQNA 1Z26A 2VG5A 3FK4A 2ZH9A 1HNZK 4OX7A 4JI5F 3NDKA 4DZDA 5KGWA 4CLZA 2DO4A 4BACA 4WYLA 1KD1T 5ELZA 1MN7A 4JRQA 1OVQA 2HHSA 2V67A 3BGRA 3MEDA 4JV5J 3ATUA 4A5AA 1Z1ZA 4MK8A 2ERRA 4OJGA 3RWUA 5AQGA 2FLPA 3O4NA 1S6QB 1RAOA 2UUBK 4MIAA 4OIXA 5FLXO 2XI3A 1GNKA 3THPA 2B8QA 2Z2MA 4CLSA 1AZSB 3W9IA 4U96A 4ZHRB 4Y65A 4C1NI 2UXCJ 2HGMA 4DR7J 1E6YA 2MKYA 3D7EO 4CNZA 4JKBA 3IR7B 1BLUA 4FYYB 1XNRK 2GVZA 3HTVA 2P9CA 2FLOA 1PG5B 3PO5A 3WQPA 3CI5A 3MR2A 2GUIA 2RQCA 4GKJJ 1LXJA 2ZITA 4RO0A 3BGLA 2KI2A 3QBWA 4YN3B 4YORA 4MKBA 5AE3A 3PUFA 3UE5A 4AXIA 3UKRB 1QQOA 2ZF5O 1UEVA 4UZBA 1YVFA 2N4CA 4WFAL 4K4TA 5HVFA 5C0YA 2ZC3A 1SL2A 2GW8A 1SIZA 3M32A 3KLVA 5FDLA 2UU9K 1BI4B 4FLZA 5KG5A 4TU9A 3O5TB 3ENAA 3EM1A 4QOTA 3W9HA 4LRFA 1S9EA 4NXMF 4U67Q 1RDWX 1YRTA 1RT4A 4ED4A 3D6FB 2GNKA 2V9KA 5BRHA 1YVNA 3BZCA 4PXCA 5CABA 1WUAA 2HQ3A 5J2MB 1RHMB 1Q86T 3W60A 3KG1A 4CFBA 2HQCA 3TABA 4PRFA 1T9UA 1Q86O 1NGAA 2VJVA 3PKMA 3NF6A 4ZVGA 1A6LA 3HBTA 2QYGA 1UWBB 4JKGB 2CG4A 1JX4A 4LF5F 2FVQA 3QEIA 2DITA 1Q53A 4RLEA 1GQEA 2WW4A 1G2EA 3S3NA 3CDUA 2MLZA 1WTBA 1RKJA 5KFOA 4Q5VA 3JS6A 1QZ5A 4CLFA 4C3KA 5EGYA 3D7SB 1YTUA 4BGBA 2RVJA 3PSFA 1HMVB 3VVUA 4CLUA 2O8CB 3D0IE 3U02A 1FI4A 5HRSA 3SSSA 5CCMA 1SC1B 2HGNA 3PVXA 4PPDA 2VGMA 4X4TA 5IT9O 3RW7A 2CYYA 2NRVA 4FJXA 1F60B 3GJQB 2YJEA 4CO4A 1WNSA 1UETA 2HK2A 3BR8A 4MT1A 3N6MA 4W5NA 3VAKA 3I32A 4P2MA 1KLMA 3HYFA 4NLCA 3K2PA 4F4ZA 2R7XA 1Q8LA 1S6PB 4MDBA 2CPIA 1BMQB 4RWWA 1PYTA 1ZBIA 1C4AA 3CQXA 1QLNA 2BKPA 2J9DE 3OFEA 1LCUA 3SQ1A 1N36F 3L7OA 4AHSA 3BPSP 4JD2B 3MMVA 4ZCMA 4X4OA 1UWAA 2HS0A 2R2SA 3DWLA 2HNZA 3HSZA 1N36K 4CEEA 3RSEA 3BGOP 4M5KA 3FNNA 3VESA 3UDEA 2B9EA 1H73A 5F9NA 3IS9A 4HUGA 4WK1A 5KFEA 4DTSA 1OH6A 1VQ6N 4CM0A 3CCUS 3W5ZA 4RNFA 2WONB 1RTHB 5D4OA 4A8SA 2NRZA 4FLVA 2I1RA 4J2AA 4TNOA 4ES1A 2OD6A 1FJGJ 4WZMA 1Y11A 3LL3A 4LIRA 3NOCA 5SZTA 4IG3A 2GVZB 2IVMA 3O1LA 1Q95G 4FJ7A 3L3UA 2R7TA 1W97L 3QRQA 3EE3A 4RBTA 2QXLA 3UD5A 3MAHA 1FJCA 4PABA 2PY5A 4HL9A 5EWEA 3LP3A 3AOCA 2YHAA 3DLLQ 1K1SA 1QM9A 2RE2A 4KT0C 2W2NP 2FYXA 1T3NA 2YNGB 2UV8A 3AVAA 3CPEA 3G25A 3C16A 4AM6A 4OYIA 3SZ2A 4OGEA 2KT2A 2HMIA 5LT5A 1QS4A 4LF5K 3UDLA 3RGIA 4J2EA 4DUYF 2CJQA 1RBTA 4J9UE 1IKWA 4GVBA 3PYFA 3RSEB 3CCEN 1T95A 4D3GA 5HP1B 3CQ8A 2QMWA 4NMLA 2HHWA 4USWA 2BJDA 2EFVA 2UXBF 4OYAA 2HRYA 1NGBA 4N41A 1P27B 4NZ6A 2EFGA 4HHHA 4CLPA 4C0OC 3HF5A 5CR4A 3AVKA 4JI7F 5J2MA 5BR8F 4GO7X 4ILJA 4NXMK 4KH5A 2W2PP 3D67A 3PRDA 2ZH6A 3DXMA 5GADP 3QLHB 2UU9F 3POTB 5JICA 2IVFB 1XQIA 2RKIB 2F8SA 1FK9B 1RWNB 3P31A 5L46A 3MM8B 1T11A 4ZPVR 3CC7N 1RWUA 3VQ6A 1N5YA 1N54B 3PNIA 4IRCA 3FZFA 2XGPA 2VQEF 1FRJA 4CK2A 4FJNA 1HLWA 4DL2A 2UUBJ 1DLOA 3R7NB 3LDOA 2J8SA 1P6TA 1HBNA 4DX7A 3A5MC 2HHHJ 7AT1B 1IKXA 4LSNB 2OTJS 3HT3A 2MY7A 2OELA 3GJTB 5KFCA 1XR5A 3PHTA 1WEYA 1HI1A 1T6DA 1IR2A 4W5QA 4LFAF 1Q4RA 1N33J 1XNRJ 3MHYA 1S9FA 1ELOA 3UR3C 3IRWP 2ATLA 1KQKA 4ILGB 1IR0A 3D1QA 4WFXA 4CHPA 5GIOA 1X9WA 3M6WA 4ZCKA 2BRKA 3OFFA 2AKWB 3AO1A 5A8RB 2UUBF 1FDNA 4ECUA 1IBKK 1FKPA 5DLGA 2FHKA 1RDAA 4R0EA 5J2NB 4NI2A 3THTA 3C95A 1IWGA 4XO0A 5U47A 3A3NB 3DM2A 3J80Y 3AV9A 4OYOA 2QSWA 4RU2A 4ID1A 1WB9A 2LA6A 1FWPA 4Y1CA 4V1Ak 2H4WB 4O3RA 4NCAA 2AHOB 5IT9U 3Q23A 2V51B 4H5WA 2LFVA 1VRUA 4UF4A 2L9NA 2KT5A 1WC5A 4B3SK 2YKPA 1S48A 4IG3B 2A5XA 1TYQB 4LFBK 2OAUA 3ZSZA 4BCAA 5DMRA 1X4AA 4CZLA 4P71A 3T9ZA 2Q1LA 2QM1A 3P5BP 5J2QA 3PW4A 3U4LA 2ABYA 3D3BJ 4PG4A 2Z58B 2AEMA 4RW7B 2V4JB 1S57A 3THVA 5HRNA 1FERA 3NLCA 4FVMA 2KFNA 4CH1A 4OHYA 3MPDA 4JHDB 3BQ2A 1R0BG 3QEPA 2ZJQL 5DG8A 1N33F 3DMJA 5HOOA 1WOSA 4DSFA 2DR8A 4U7BA 1T03B 4K50A 4CT9A 5LMUJ 4Z94A 3QGGA 1FE0A 1QQCA 4OKJA 1GLCG 2NRRA 1Q82O 3OL9A 3DGPB 3AVNA 3QBCA 2YXLA 2Q0UA 4OX6A 5EX3A 1Q82T 3VQ9A 2QYCA 4DV7K 2O8DB 5HMYA 3BO3A 3ZETA 3NNAA 4PL7A 1NU4A 5BR8J 2FSJA 3UQSA 2HAFA 1N34J 4WE1A 1RQ0A 1N6QB 2YHWA 2WSFC 2C3OA 5A8WA 2YY3A 2ZEJA 3A8YA 5ETLA 1Y3JA 3SK3A 4M5DB 2C3YA 2Q36A 1DARA 3BPDA 2E6LA 3K5OA 3F5TA 2VOPA 2MZ1A 4EBEA 1YTYA 3TR5A 4CWBA 1HQUA 1ZBUA 1Q81T 3ID8A 1F6TA 5AQKA 4CLWA 1F5BA 5EXWA 3WNGA 4Y2IA 2O8FA 3O3LA 4TN2A 4N8OA 2HFVA 3E1YA 4Q2LA 1JLAA 4OYXA 3HO1A 2V5HG 2RKIA 2RRAA 3CCQN 4PAAA 2CJ9A 3MWTA 3EE8A 3AO3A 1O1WA 3SPYA 2GEMA 3T5LA 1QVFR 5JXSA 4JKHA 3PIPQ 4O55A 1S1TB 1JLCB 5C2CA 4PCQA 3I4HX 1NSQA 3DLKB 3HPHA 3TW0A 4J9QA 3VQEA 5TKWA 1U26A 4LF7F 2LEPA 4IR1A 2KRRA 5SUHA 3VGVA 2Z2LA 3IM8A 5AXMA 4IXCA 3T1AA 2M4MA 3KKFA 4KAZA 3ZT0A 1B7FA 4QIFA 3G8QA 1VRTB 3MXHP 2EVZA 3K89A 2RHQB 1T05A 2YWWA 1BL3A 3AA4A 1GTEA 4FF2A 2VASA 4ZVSB 4NASA 5CXTA 4FWQA 2OIHA 1PJ5A 1TK8A 3CM6A 1D9AA 3RAQA 2MZJA 4DSKA 4OPAA 2XS7A 3C46A 2KH9A 4ZK7M 1R0AB 4OGCA 4AHTA 3MX2A 3GFYA 2FJDB 2XNRA 2P9UA 4A57A 5CE3A 2OMLA 2CVEA 3CO9A 2FZKB 3OR2A 5FRNA 3W8GA 3R5BA 2UUCK 4Q0BB 4NXMJ 2ZDOA 5BREA 3OBWA 3EICA 3NCRA 2AF6A 3ZX0A 4U6PA 1EQYA 3SMZA 5ADXH 4WJBA 4E1MA 5C2FA 4CO5A 5A76A 3PCOB 4ID5B 3LPUA 4B9LA 2V8VA 5KFDA 3O8WA 2HFNA 5HQLA 4L8RB 5KFLA 1WC0A 1VQ7N 4X4RA 1X0FA 2NXJA 5KT5A 5IV3A 5F8GA 4DR1F 1G99A 1RHJB 1NU0A 4JP8A 3H4BA 2KDOA 4PG7A 4HVZA 4JI7J 1Q18A 4CJEA 5HAOA 3CJBA 5LJVA 4BRCA 3KLEB 2BW7A 2D7SA 3W8PA 4Y00A 2F63A 4XPCA 2YH0A 5E26A 3C6TA 1M1KO 4BDYA 4BLGA 1D9DA 3BS9A 3FCHA 4JI4J 4BWJA 4C1NK 2B0GA 1I5OB 2ADCA 2VHGA 2CA9A 4I2PA 2PC6A 1U1LA 1GXLA 3VGKA 4JUZA 1BQNB 2E20A 1HQUB 4OLOA 4RBVA 3M8WA 1HHQA 4LF8F 1YDLA 3QEWA 3DLEA 2AJQA 3FFKB 3C66A 4M3WA 4XK8C 4CZEA 4I67A 4BRLA 1QAIA 2KFZA 3LWLA 2OTJN 4A8QA 1YIJN 3HKZD 3PX4A 1XC9A 3Q8SB 2ZBQA 2NZCA 2P5OA 3K0SA 1QSYA 1WOQA 2C22A 1VQPS 2ASLA 4JKFA 3TTDA 1VK0A 2CFXA 1ZAVA 3L6QA 2VWJA 4BRPA 1FD2A 3G87A 5GAHI 3OYLA 3Q89A 1BE4A 2JZ5A 2YKQA 1XWLA 3W9JA 4CEBA 2BYCA 3AARA 1XJWB 4ECSA 3AA8A 2HBYB 3DKDA 1UZHA 1PKUA 3TSQA 1S4FA 1RBUA 5I4MA 3THYA 3V1RA 2JOQA 5L38A 3M3ZA 4OMFG 1VQOS 1VHFA 4L72B 1OSDA 4LRDA 3NS5A 1NWKA 4JBCA 5IQQA 4A2BA 1JLQA 4QR0A 4K5SA 4WU3A 4Y34A 1R6YA 2Z1JA 1S9GB 1KONA 1HNIB 5LMUF 3CJKA 3D6MB 3KG4A 3GOIA 1YK9A 3TAQA 2P1JA 2Y8WA 1MN9A 2HKEA 4WKYA 2F7TA 2P5VA 1YJRA 3V9ZA 2UXBJ 1R3NA 2AIRB 4KHSA 2ZBPA 4DV7J 4USKA 3CIPA 5LMNF 3EN9A 3DHWC 4L3NA 1ZYQA 5DG7A 2YNFB 1ZA1B 2E7XA 3OBYA 3ICLA 2LEAA 1WN7A 2MKJA 2IC3B 1J54A 4BRQA 2JLEA 2XQCA 3H5YA 4C8KA 3MECA 2KM8B 4F0MA 3LQVA 4XEIA 2ZZTA 1XUPO 1PC5A 4IH7A 2CVIA 3PYEA 4LFCF 1UOCA 2ASMA 1HQEB 1R8PA 1TVRA 1QUVA 1LWXA 2W9CA 3M5RA 4WQ4C 2XYHB 3FSIA 3KUEA 2X1AA 4JEPA 1PAEX 3ZZOA 2E29A 2AT1B 2QMUB 2IMOA 3O9TA 3Q7CA 2YKNB 1NGHA 3DI6A 4DR1J 3AXMA 3HK2A 1WAJA 4B3MJ 3ZCMA 1WHXA 2BOPA 3C7NA 2AP6A 2CJXB 5IOLA 1NJIT 5GAGP 4CF1A 1S9EB 1QD1A 1NK7A 1PGZA 4FWNA 5E3PA 1WHWA 4JI0F 3SFUA 2IBKA 4NLXA 1NGIA 2IRUA 1NAQA 2DB1A 4ECXA 2VQFK 2MYFA 2J6TA 2QA1A 1NNDA 1BUPA 4OKEA 2UXCK 3MOJB 4F2SA 2B9WA 4BVPA 1UAWA 1H7XA 1RWOB 4QW8A 5AZIB 3HPGA 2Q97A 4K4UA 2YJFA 2B43A 2BJ3A 3JQMA 5A8KB 5JLFA 1QVGM 3BY5A 2JVOA 3H5SA 2KZMA 5G0RB 3JYTB 2OPSA 2BJ7A 2GJFA 1SKUB 4FJJA 3C6AA 4L3QA 4H5NA 3QT5A 1FFSB 1A7GE 3KHRA 3NE6A 3HMJG 2AWZA 4ELVA 5D8HB 2ZGZA 5F8LA 3A3OB 1Q0NA 2GV1A 3CYMA 3BSOA 1RTHA 2M3DA 2HSTA 5BRFA 4PWDA 2RF2B 2HRTA 4GMJB 1FX4A 2DYAA 4G9ZA 3MFHA 3MUVP 1TQLA 3FCWA 1FKOB 3DLKA 4MJKA 4B3MF 4QOZB 1R8AA 3HHEA 2P9SA 3QRRA 3V9WA 2CIMA 4URGA 3B8AX 2JWKA 4CZCA 1UWBA 2DIUA 3ULEB 3CJ0A 1IBMF 5AZIA 2YWGA 1S6PA 1EAYC 2GHWA 4KB7A 2W7AA 2QWLA 1RWWB 1UP1A 3HULA 3J7ZT 3OVBA 2NZTA 1DQ9A 1YT3A 2VG6A 3HX9A 2XY5A 1O13A 4LMZA 3WXJA 3LZIA 2HFUA 1V4TA 1BO5O 3MMAB 3K58A 3H1QA 3ZSVA 4NX9A 4MTPA 3FRYA 2VBZA 1WOPA 2DPJA 4K25A 4X4UA 4OYZA 3NEKA 3ZLJA 4ECVA 1SJQA 5KT4A 3JSBA 2QK9A 4H4KC 4PXDA 4QWCA 4NZ0A 3I0RA 1TMMA 3QAUA 2M7SA 1TU0B 2Z56B 3LA0A 1WLJA 1KLNA 4Y1DA 3BZQA 2WSCC 1S0NA 1G4CA 3H98A 3IC1A 5KFQA 4B9QA 4X62F 3EPGA 2LEBA 4OZ3A 3U1MA 1REVB 1LXNA 1JL1A 4YR0A 1YJUA 4CGGA 3DRRA 2HRUA 3FKBA 3GJRB 3NF9A 2XMKA 3GG1A 3UKRA 1YTAA 3M30B 5F3ZA 1YITN 1AYEA 2UUAJ 4M7YA 1N36J 2GWKA 2QWPA 2V7YA 3BR9A 4Z4HA 4BRDA 1HNVA 2X6SA 4B3RF 4EZ6A 3SQOP 4IUFA 2FPHX 2YCHA 1RT4B 3UVJB 1KTVA 1LWFB 1ZZNA 3WQUA 1F0XA 2F4VK 1X3MA 1W0HA 2X78A 5IWAK 2IYGA 3IG1A 4RJVA 3PRVA 2DHHA 3QIDA 2J9CA 1JLFB 3ZC4A 2ZUGA 2Y1RI 2QV6A 3TZWA 2OSQA 3FBBA 2FVRA 4GMKA 3I4PA 1NGJA 4RW7A 4KPYA 2WB1D 4CERA 5K14B 1I51B 3ADAC 4JI3J 4ECZA 4LRCA 2NSCA 4ZVRB 1FO1A 4K43A 3PW7A 3KNGA 2D3OR 1YZ7A 1VGYA 3T9NA 3R5GA 2UYTA 1WUUA 4NWBA 4IO9Q 2BQRA 4MLHA 1F9FA 4O3QA 3ZZYA 3HP6A 4JI4F 2MQPA 5AJ3F 3OYDA 4ECTA 3LP2A 3RBZA 1RA6A 3GG0A 3P6YC 2GZOA 1TL1A 4DV2F 4LY7A 4CTAA 2IJFA 4JV0A 4HTIA 4XH4A 3VF6A 4ZN3A 2W1BA 2KO1A 3HLUA 2ZWOA 2O8DA 5B0BA 3U9DA 3DLJA 1YJVA 3OVNA 2HBMA 4WPAA 4IYQA 1DTTB 4OJ3A 4K4YA 3R1XA 3TA0A 1NDCA 4OQJA 4JV5K 4LR7A 4ED0A 4Z4GA 1R7IA 2XS5A 4RNMA 2P9NA 1N32J 2QIFA 4JYAF 4N56A 3CDBA 2BTFA 3OFHA 2EBGA 1TUWA 3F2KA 4JKAA 1Q7YT 2CZ4A 2DO0A 2KKZA 4TYAA 5ETKA 1ZM4A 3R3TA 3QIPB 1FNOA 1NLVA 2BX6A 4DR6J 3MDFA 3M2VB 4O8UA 2QKKA 4CW7B 3W2VA 1DURA 2PMHA 4YB6A 1VSJA 2YNIA 2HVEA 4JRPA 5AQRA 4UY8O 1HBNB 1X5OA 3N4WA 1WI6A 2A2CA 1X4GA 3CW2C 4EEYA 2GV9A 4KTWA 4OZ5A 5BYRA 1B0TA 3PX0A 4MO5A 2JDJA 3QJPA 4RW6A 2B4PA 5A8WB 3DOLA 2X1FA 4ZDNA 3T41A 3PW0A 2IDEA 4LC9B 1TL3A 2QFIA 2YKOA 3FEZA 1VC6A 5K20B 2OTLN 3EZUA 4DN0A 1IBKJ 3PX6A 5LL6d 4M5HA 1SC3B 1RYSA 1SUQA 5GADU 4NLOA 4O3OA 2DNOA 4FF3A 2IYIA 3GSIA 4HLBA 3MN5A 3NGUA 2B8PA 4YY3J 4FYDA 4K2XA 2F8TA 5JVHL 1EKEA 5JMVA 3ZEUB 4E89A 5E41A 4KHUA 3ZTQA 2VBYA 3VQQA 1S1XB 4ICLA 3LDNA 1Z2LA 3O80A 3BO2A 4B3OB 1SPBP 3OL7A 3KHYA 3CD5A 4QCLA 2A0FB 4WFNL 1JWWA 5BPNA 2DT9A 2YPYA 4DFKA 4A8FA 2XY8A 3D6TB 4HT5A 4H0XB 4NLPA 4W5RA 4B3RJ 4I56A 1C1CA 2DHSA 3BH7B 5KPZA 4Y2MA 3J7AN 2WOMB 3FQLA 2IA6A 1LW2B 5HRPA 4C0HA 1W7AA 3UE2A 3ALYA 4QS8A 3TAFA 3LP1B 4TVAB 3U3GA 1VS3A 4WK3A 3TSUA 3LPTA 5KFAA 1LFPA 2M70A 3POTA 3PDNA 3K9KA 2AJFE 4DI6A 2LECA 3AVGA 3TX8A 3I5AA 2Q2RA 2APOA 3CIZA 2D0PA 2MY8A 3F9KA 4JAXA 1S1WB 3CCTA 5M1OA 1J2VA 2NPFA 2CZ9A 1ESVA 1UEKA 3D6RA 3ONQA 3AY9A 3GV8B 3OA9A 1NHUA 3QEXA 3ZFVA 2E88A 1GK8A 1C0GA 2EFQA 2EBEA 3LP0B 1FRHA 1NPKA 5M1PA 2B4UA 6FD1A 4I7FA 2RUSA 1WDDA 5HMXA 1JXEA 4IOXA 3VALA 5T41A 4Y2AA 4QBUA 3HHLC 5KFKA 1WSRA 3NXZA 2ZGYA 1NK9A 4KYZA 1WACA 1UAXA 5A2QU 3ZTRA 4ALZA 3KNAA 3ZZPA 1T02A 2IM1A 5DO2A 2BBEA 5M1FA 3CJKB 2KZZA 4DFPA 3T6BA 3D2FB 1ZC6A 1C6VA 3DYAB 3OYMA 3KJFB 5K8OA 1VQSA 4EO8A 3CJ2A 1QSSA 3OYEA 4ZP6A 3B54A 1H7WA 2PZSA 3F9MA 1IJEB 3B8HA 2GVDA 3QWPA 5L9XA 2F4VJ 4E7IA 1S12A 3H20A 1F9HA 3KG0A 3GV5B 2MHNA 1RDBA 2F1FA 2P9KA 4OYBA 4ZCLA 2YWKA 2PI5A 1FTCA 3N01A 4F0HA 4RW6B 5KFIA 2JFKA 4DS4A 1RT6B 1LAVA 2YQ3A 2FY1A 2PSZA 3MPWA 2FD2A 4QWDA 3MR5A 1KCFA 5HROB 1V4SA 3J7YI 4AH9A 3VVTA 5C24B 3CF5Q 1VFJA 1X9JA 4NCGB 1IM6A 4C11B 3DJCA 4FYXB 3C14A 4H4OB 5K9FA 1IKYA 3VR1A 3BN4A 1RDRA 1NPRA 2FVCA 2DPIA 4ED3A 2OEKA 1AFIA 5CYQB 2R4FA 1RABB 3RUBL 3O3FA 2XRIA 1RZMA 5B0AA 3T1YK 1PC4A 3H5UA 4CQ1A 1IVZA 3K5MA 2FLNA 3V9UA 4DMZA 1KDNA 4K5RA 1IG9A 1IR1A 1T05B 4DXLA 1HARA 2NREA 1ICEB 3CCRS 1Q5YA 3SBMA 4AL6A 3L8BA 3DM2B 3SYZA 3D2FA 2XMTA 3NH0A 2W2MP 3LGHA 3PRBA 3G0ZA 5L1LA 3I87A 3CCVN 1DJ0A 3Q8VA 3SSRA 1OH5A 3J81j 1S3XA 2VKZG 1VQKN 4NLSA 3ISNC 2C28A 2RHSB 4K42A 4FXVA 5C12A 2HHQA 1JLFA 4USJC 3MUMP 2GFFA 3E51A 5FPDA 3A4TA 4FLWA 2ZVIA 3B82A 2CJKA 2XSJA 5E3CA 4CH7A 4DL6A 1ATRA 2AP1A 2A1BA 1U1PA 3DLRA 1NGGA 4RPFA 3AB2B 3OQ2A 4OZJA 2O66A 4LR8A 1RT6A 2HHTA 5AQHA 2CGKA 2VPZB 2XHCA 5KAKA 1FW6A 4FVCA 3HVRA 4LF7J 1U7LA 5KTQA 5AQTA 2WVEA 1N33K 3QEVA 2QZ8A 4DR7F 3TA1A 4C8OA 4M5JA 2M8HA 5EOYA 4R8UA 3IRXB 4H5RA 1LQ9A 3Q8QB 4JV5F 3OHRA 3V4MA 3GIKA 4CF2A 1SKSA 4JOUA 3RYLA 5D6GA 1CXQA 3G6XA 4KHQA 3MWBA 3ENBA 1J5OA 4K4VA 2QEXS 3ZXWA 3T19A 4Q7AA 4MIBA 2E6MA 3TARA 3E9OA 1P8GA 4MFBB 3GMGA 3QMQA 2YKMB 4UOFA 4B3SF 1HNWJ 4CZIA 3GYNA 4C8YA 4NMXA 1X60A 2QI2A 2W01A 4P2FA 1YAGA 4IJNA 3L0QA 1BWFO 1O6XA 2FHJD 1I1GA 4FWOA 1NCLA 5T7LA 4I9LA 4CJPA 1VQ9S 3WNHA 5KFTA 4FVUA 2E1CA 4ATNA 5CA5A 4F3MA 2NQPA 3HHDA 4ZPWR 2D69A 3FLCO 4JKCA 4H0TB 4I69A 1HHTP 3OJUA 2PDAA 1GLJO 4NLGA 5F0UA 3I96A 2X3DA 1Z6RA 5LXRA 2JEIA 4Z4IA 2DY4A 3PR4A 2IRXA 1K8KA 4ZIVA 4A8WA 1Y7PA 4P2SA 4FNHA 4ZPAA 2XLKA 1BD6A 2IM0A 1RISA 1ZZFA 4ZPDA 4CJSA 3J81O 3NH1A 2BJEA 3SV4A 4AQYK 1HYSA 3MAAB 2IVYA 3PIPL 5CD4H 5I3UA 5AT1B 4Y28C 1N0VC 1SC6A 4DQQA 1RAFB 3CTRA 3CJAA 4FJMA 2F4FA 3R6LB 1KS2A 3CCLN 3US5A 1S10A 2PYLA 4JKDA 3ZO7A 3M05A 3FZKA 4ECQA 5AE2A 3CJQA 3MCAB 4DS5A 1K73O 4BR2A 3RAXA 1KTQA 3MECB 4BVOA 1TFWA 2K8GA 1Y5NB 2M52A 4DU3A 2OKQA 2NYHA 4NLBA 1HWUA 2G8WA 1EP4A 1JLCA 2AYBA 4CJKA 1KLMB 2AYMA 4RU9A 5DDOC 3EEQA 5GIPA 3EGVA 3EXYA 1VAZA 1KP6A 1WSVA 2ROGA 3MGJA 3IM9A 3TR8A 1HNIA 1KD1O 2CNOB 4DR5F 4AHUA 2WRMA 1JXVA 1HRHA 1GLFO 2XYGB 2VFUA 4IOBA 4X4QA 5M1NA 2E1PA 2G2OA 3K5LA 5AQPA 2FHJA 3MM6A 2IGIA 1KQFB 1GOCA 1TUUA 4ZVUB 2RIJA 4AQYF 3KLFA 1VSKA 2UXBK 2POKA 4UUWA 4HCBA 4C9DA 2MJUA 1T9WA 4XH5A 2XWXA 2G8KA 2QJ3A 3IXQA 4FW1A 3B6OA 4HWIA 4YQWA 3C6TB 1CJUB 4FF1A 4ZCIA 4YFUA 1FF2A 1V5VA 1T44A 3HVTB 4C3MA 3HP9A 3R2DJ 2ZD1A 3PXGa 4KI6A 3V6KA 4JI3F 4XDDA 2E9ZA 4MYTA 4A61A 2GIRA 3R6MA 1VQYA 3CCJN 2E44A 1D4XA 3K0JA 4QZVB 4DSIA 3S7RA 4MMOA 3T7ZA 1DQAA 1X0PA 4IOAQ 3H6EA 8AT1B 1K6YA 4U7CA 1RHQB 2AYEA 1U0HB 2OTLS 4DV4K 3SEOA 3AB4B 5T14A 3EL2A 5J1PA 1RBVA 2BMBA 1CXUA 1B4SA 2DCLA 4HACB 1MLAA 2X6NA 2DGSA 1GMWD 4CI6A 1LOTB 2BE2B 1IWAA 4I7FB 3N6LA 4JNEA 3L3VA 2CJAA 2DR7A 4YOWA 2JC0A 4J9KA 3NF7A 5D78A 2GMLA 1HFEL 4QU7A 2VDHA 3BEGB 5HMZA 4MH8A 1R0AA 1KVAA 3WZ0A 3MD3A 4E0DA 7FDRA 4ZJLA 3DNCA 3FFIB 3KLGA 3CCVS 3AD9C 3HM9A 4M3TA 3GFHA 3W2VB 2IM2A 5A0YB 2EEYA 4BE1A 1WAFA 4YHHK 1JLQB 2VGNA 3S6EA 3NCIA 3LP2B 1HD0A 2HVZA 3DU6A 3OSNA 3OBIA 2UXCF 3HFKA 4E7HA 2ZH8A 2W4DA 5FROA 1FVQA 2B9YA 4FBTA 5H9FK 2B5JA 1YJWN 5FDLB 3I5CA 1F1BB 4KHNA 4USIA 2ZE2B 4JN4A 3B4MA 3TYTA 4X4VA 3L95X 4RW8A 2WAQD 4PKGA 1B99A 4FZVA 1IKXB 4LSNA 5K8PA 3QB0A 3T1YF 2NCKL 4E2FB 1QZ6A 3S9HA 4Y2KA 3FZ2A 3CMAN 4DX8H 3TNVA 3MPUB 3DXBA 1AZSA 2GMHA 2CQ4A 2HFSA 2FJEB 2HQGA 1OS5A 2EG2A 3RR7A 5HK4A 4G65A 3OT9A 3K5NA 1S0OA 4M63C 2WSEC 5MLCQ 1OO0B 1F3FA 5FPEA 2BH1A 3DLGB 1YGYA 4BRGA 4PKDB 3W3DA 3CPWR 4EO6A 4OHVA 1BQNA 1U6ZA 3AHPA 1UL3A 1RFQA 1UVNA 5BYSA 1YJ9N 4L74A 1JJ4A 3Q2TC 4FM2A 3MDQA 3M30A 1FJGF 1NK4A 1KVBA 3GG4A 2RH3A 2HBZB 2VFSA 3R2CJ 3SUOA 3V81A 2KJWA 5C25A 2ZBRA 4O3NA 4BQLA 2NRWA 1JLGB 2AX1A 3CM5A 4ISGA 2QGFB 2CZVC 3OTBA 1OPZA 3BM7A 1GMVA 1MG7A 2LQ5A 1NGDA 4K59A 3D0GE 1BOTO 2K06A 1NSAA 3RTVA 5T7BA 2ITMA 2F65A 1B3TA 2OJ3A 3OLBA 2VF3A 3LAMA 3ZNUA 2FBTA 2HWIA 1SL1A 3RBEA 2NPIA 4ZLLA 4WCEL 2PBDA 1C0TB 3EPIA 1C0UB 3RAMA 1VQMN 3BO4A 3CCQS 2KXFA 3PEJA 1X1PA 3IRXA 2BRLA 3JSRA 3N28A 4LF9K 4ILLA 1SXLA 5BRDA 4EU0A 1EZZB 3G4SS 2M8DB 4C2MA 1D09B 1FRXA 3K7RA 5DM7Q 3CB4A 3CMES 4XDCA 3A8IA 3QLHA 2YKNA 3M6UA 4P6QA 1Y97A 3ZZUA 3CFPA 5DLFA 3P96A 3M6XA 2F9TA 3SMPA 3QGIA 4X66K 5HL7Q 3J7A1 4E1JA 3KFWX 3L4IA 2K7JA 1EQ0A 2OD4A 8RUCA 1ZBTA 3GDQA 3RRGA 3MN9A 4M5IA 2W40A 1N4LA 1FDDA 3J7YP 2J5AA 4BRMA 1NHKL 4R0JA 2WB4A 3M6GA 2IC3A 2LVWA 2XNQA 2N7YA 2R2TA 1X7VA 2PMZD 3ZSQA 1HNZF 2F5GA 4ED5A 3WUHA 3QERA 4ID8A 4W4MA 2FQQB 1RU1A 1RB0A 4Q43A 1SJ4P 3BBFA 2BKNA 3T5JA 5A6WA 2KU7A 4B8AB 4OV1A 1UA0A 1E6VA 4H0OA 4OHXA 1VQ8S 2FTRA 1TKZB 1GXUA 4ZLPA 1N8RO 2R8IA 4K8ZA 1FWLA 1BC6A 1RT5A 3G71N 2VA2A 2PA8D 5M2UA 4ED6A 5JS2A 3SLCA 3I0RB 4FLYA 4ZVFA 2SXLA 4FK0A 4CZMA 4BR4A 4CJLA 3AODA 2P9LA 3CJSA 4ZITA 3VOVA 5GAHU 4CJ7A 3SI8A 1CZ9A 3M1VA 1K73T 3NF8A 2FJWA 4DR4J 4BC4A 2JJ4D 4BRKA 4RW8B 1QDUB 2V8HA 4DTUA 2H5EA 4QR1A 4BE0A 2PEHA 1M0SA 2P9IA 2MGZA 4EHUA 1F2GA 2C2NA 4J7CA 3NVMA 2OPSB 1QAYA 1WEZA 1RAGB 4DLGA 4M1KA 3J81Y 2V94A 1LFWA 4DCPB 1BISA 4O23A 5J1NA 1KFDA 4C3LA 3IR5B 1U45A 2BJ8A 2A3ZA 3AT1B 5AXKA 4KO0A 2LXFA 3PM9A 1RT1A 4JI6J 2N7CA 3MM7B 4J9PA 1SCJB 2A2DA 2OHDA 2JWLA 1M1HA 2Y0BB 3CCMS 1L3UA 1YQHA 2O01C 1S1VA 4QYRA 5D0HA 3V2UC 3A3PB 3JS9A 3RU0A 2QLFB 2HNDB 2GC8A 1HIYA 2XHWA 4FSVA 2YNHB 1SS6A 3AGKA 4E98A 4ILRA 3MM5B 5EWGA 1LW0A 1NJIO 1QHAA 2HWHA 3KDOA 4IOAL 3HJVA 2W42A 4AL5A 2LU1A 5J2PB 4KGKA 1FRMA 1SVDA 1FKPB 4JI2F 3R1HA 1C4CA 3OYCA 4FPRA 5AZJB 5K8MA 3CXCR 3MXMA 2X7IA 1J5EK 3IKMA 2HZAA 1C0MA 2A18A 5AQNA 1RWPB 4F50A 3HHNB 4ID5A 5D0EA 1J9AA 4HACA 2IBOA 4K4SA 2VONA 2I8EA 4EGLA 4PXBA 3SMSA 4BROA 4RBUA 4A62A 1YJ9S 1KWMA 3IA0A 2E1ZA 1HQ2A 4RNNA 3AY0A 4AM7A 1NPPA 4J9NA 3WDOA 5AJ3K 4YNQA 3IGNA 4ERDA 2XTJP 1FCAA 2GTDA 1TL7A 3CCES 2J4RA 3N4PA 1SV5B 5F8HA 3VGUA 2LXUA 3MMBA 4ZP9A 4DR2F 1KHWA 4U95A 2GHVC 3VAMA 4CEFA 5HP1A 5KOXA 1U09A 3GLJA 5RUBA 4FPAA 3KLHA 3GONA 4CNYA 2G9OA 4DCOB 4Z7YA 1I3OB 3SDEB 5KOWA 4BC7A 1G1XA 3NMUA 4AHRA 3M2VA 2F4VF 2YV0X 1O5JA 1R8BA 4OJRA 3KWGA 5ETSA 1OQ3A 1T9XA 3OPKA 1D9FA 4RL1A 3RRKA 3BREA 4CGHA 1WWHA 2X3GA 3A8KA 2XLIA 1JLBA 1WSJA 3JXOA 4DTMA 5EN1A 3BYRA 1OH7A 2UUAK 4LSLB 1B0PA 1N5YB 4I6YA 1WKKA 3R5CA 4TY8B 3W62A 4K0KK 2UZAA 3F41A 3IG1B 5LJWA 4NXNJ 4M95A 2YH1A 4MO4A 1IUJA 1K9MO 1XNQJ 1EX8A 3DLGA 4JI8J 2EWSA 1TL3B 5C7PA 4LF9J 1XR7A 3JAMO 3NVKA 3O5BA 3OYAA 5GINA 3OS1A 2WW8A 3I8BA 1K9MT 1R59O 1VQLN 3Q8PB 4OVLA 3ELHA 2IJRA 2QWNA 3IWLA 2WTUA 4JHDA 4DJBA 3MM9B 1H74A 1WEXA 4MKAA 2H1YA 4CEZA 2UUCJ 2G1HA 2ZH5A 1YBAA 1W25A 3VZHA 3NAEA 3HM8A 4CK1A 2O8EA 3MCPA 2F8HA 1KNZA 2HGLA 1K47A 2JLFA 3N4QA 2WUSA 1JMTA 1NH7A 1VYAA 3TX0A 3TAMA 5KT2A 4ITSA 2DK2A 3L9ZA 2MQOA 2DFEA 2K3IA 3VAFA 2JLGA 1G7CB 1IBMK 1VRUB 2IIRA 1T8EA 3Q22A 4O4GB 3EMTA 2HHPA 1VBXA 3A0IX 1RE1B 3TA2A 3OXFA 3CIMA 2EK1A 2DXDA 1ZBHA 5HANA 1ZPWX 2IIHA 2ASYA 4HTLA 1NDLA 1K8KB 5LXYA 1RBLA 3MF5A 2HNDA 3MR6A 4DV5K 2MTLA 4LFCJ 3CULA 1NK6A 1KR4A 2Z4PA 2CAJA 2HEKA 4K4ZA 2CQGA 3I56S 4B1ZA 2CDQA 2UXDF 1BQMA 4LFAK 2CG8A 3OTDA 4OHWA 2BJ1A 3H3NO 3GTYX 4LT6A 1RTDB 3TUZC 3KMQA 4XIUA 4R5PB 1WSGA 5IC4B 2AZ3A 1AA1B 2C2KB 4QYZJ 2M88A 3D2EB 1YWXA 2OUGA 3VEXA 2GGPB 4R25A 2WHOA 1HBOB 3R97A 1YJNS 1U04A 2OO4A 2YX7A 2Z1GA 1IBLF 3IUCA 4BC5A 3KD5E 4CHZA 4OYMA 3G6YA 1ZBLA 3IS9B 2V52B 2O8BA 3W2WB 1RKIA 4IRKA 2GX9A 3L7PA 4G1PA 3HVWA 3TVYA 1U1QA 4LF6F 2W4CA 4DUZJ 1AFJA 1GMUA 2Z30B 5HO4A 2PT0A 1RT3A 3E8OA 2W9AA 2IA0A 3U1NA 1FESA 4KB0A 3QESA 3I31A 4JI0K 5M1QA 4GV3A 2ROPA 3O9SA 2N3OA 2AMCB 3WT0A 1BG3A 3F73A 2R2RA 2G2YA 3RBDA 4IH5A 4EIAA 4JI2J 1GT8A 2FSKA 1YX2A 3TAEA 4A8XA 5AQFA 3ZTOA 4CJTA 3QGPA 1H0HB 5HI7A 4O0JA 1Q8BA 1NK8A 4YP3A 2E5HA 4L73A 1D0EA 1FJEB 3KLEA 1OVYA 4UY85 4KHPK 3DRXA 1GTHA 4DV0J 1HWIA 3FVYA 1UVKA 4WBFA 4CEDA 4DV3F 4YY3F 2NXEA 1Q8KA 1HMVA 2VFRA 2C2DA 1TV6A 3KWMA 4KC5A 3ISZA 2Z0GA 1NH8A 5KG4A 1UMJA 1GOAA 3C15B 2BANA 5GMEA 1Y64A 4DR3F 5HN0A 1I6JA 3AVJA 5D4NA 3B4DA 2HBJA 3THWA 1XMBA 3FGVA 3OTCA 1NSPA 1K8AT 3WBZA 2YWHA 1NSKL 1IKVB 2JHEA 3OL6A 2WVFA 5AJ3J 1CZBA 2OH2A 5F9LA 5DDQC 4AFFA 1X5SA 1XEZA 4O0NA 4QR2A 5C2GA 1U2VA 4Z4CA 4CLKA 4I6AA 4G1IA 3HSGA 4DF8A 3DRPB 5DJBA 2R2UA 2RRNA 1XHXA 5AXLA 3LPYA 1JCGA 2PFUA 1FFGB 4M3XA 5HVHA 1ZAXA 4NRUA 3P38A 1NM1A 1Y4ZB 1M5OC 4ILMA 4P75A 2FZGB 4CT8A 1Z25A 5AQMA 2FDNA 2KFYA 1U4BA 1XN9A 3NMAA 4DU4A 5IQ6A 3SCIE 5KG2A 2ZQBA 2DISA 3LO3A 2HBLA 3K59A 1Q5VA 3P83D 4CECA 1SI9A 4BR7A 4PQUB 3BH6B 1OPIA 3UCZP 3O3GA 1NLKL 3H8YA 4LBIA 3IBWA 5DGBA 2VICA 2VQFJ 5DGAA 4J9MA 3MCMA 1BQMB 1FRKA 1RK8A 2MQQA 1AXQA 4BWMA 3KHGA 4IRDA 5ETPA 3U8XA 3SJHA 5ADZA 3A5OC 5J1EB 3MR3A 1WHYA 4JI1J 4USUA 3RMDA 1RTDA 1NKEA 1N0UA 4PQAA 2HMPA 4IZ9A 4DV3J 3RR8A 3OHBA 5F8NA 2D1CA 3RBXA 2L48A 3SBTA 3VGMA 3UVJA 1B9FA 3PYDA 2R42A 3IFEA 1HPZB 1D8YA 2P8IA 2ZD1B 1G3OA 1U1KA 3D28A 2I38A 2KM8C 3TZYA 1UJ5A 1NJXA 4RR5A