2YKNA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPLLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
total genus 163
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yknA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yknA05
4B3OA 2FLNA 4MQ3A 5F8NA 1NK4A 3QIPB 4CF1A 1VRTA 3DRPB 1TVRA 4M41A 3KLHB 1KVBA 4ZP9A 3MFHA 3KHGA 4ECSA 3LP3A 2XY6A 1J5OA 4J9SA 4TYAA 3Q8PB 1UAXA 4CCHA 2D5RA 4K8XA 5F8HA 1JKHB 4RZRA 5J2QB 1ITGA 4J9PA 4FJXA 2D0CA 3MEDA 4NCAA 4OLAA 4NLPA 3I5CA 5KFZA 2XC9A 1S1TA 1G15A 1LAWA 1RT6A 1BHLA 4CECA 4FJHA 5KG4A 1SKSA 4PWDA 2G8HA 4FLWA 3SQ0A 3FFIB 1BQMB 3NCIA 3HPHA 2E9ZA 2IJFA 3V6HA 3QIDA 2WOMA 4W5TA 3CYMA 4KI6A 4RG8A 1K1QA 4K4TA 1T94A 4N47A 5EWFA 1SV5A 1LWFB 1UA1A 5KFHA 3ZSZA 2ASLA 1WSJA 2O4IA 3MFIA 2OPRB 3U3YA 2HHXA 1C1BA 2DY4A 3KJVB 4RU9A 3PW2A 1BL3A 4FJKA 1HRHA 2UUWA 5DG8A 2HVIA 2FBXA 5F8GA 4EEYA 1U4BA 2XY8A 4B9MA 4CEDA 4E19A 4BWMA 4KE5A 4KV8A 2Y1IA 2HHQA 1LWEA 1BCOA 3AA5X 4AHRA 4KTWA 3C95A 4F4KA 3KK3B 2HNDA 3V6JA 4GC6A 3VQSA 3OYJA 2FVRA 3BGRA 4BE1A 3GIMA 5D3GA 4LQ3A 2X78A 4ED3A 4JUZA 3LAKA 2GIQA 3LAMA 3KLFB 4FM1A 3SV3A 4NLVA 1TK5A 1RT2A 3N6MA 4M3WA 3HT3A 3O4QA 5KFVA 3E01A 3AO4A 5C42B 3VQ9A 5KFKA 1CSJA 3HM9A 3TI0A 3ZSRA 1LW2A 5HBMB 1WSFA 3NFAA 4FK4A 2JC0A 3VQ7A 4XPCA 4FLTA 3JYTB 4HUFA 3L3VA 1RA6A 5EUHA 4TY8B 4IH6A 2OPSA 4CJEA 4EO8A 1NHVA 1HNIB 2AQ4A 3CO9A 2W9AA 2YKMB 1T03B 4WZQA 3CFRA 2A1SA 2OPPA 4IBNA 3AVNA 2KZZA 4PQUB 1R0AB 1U47A 3SPYA 1IKYB 1JXEA 4U6PA 5T7BA 5I3UA 3RB3A 3RMBA 3O3HA 3ZSXA 4HCBA 1N6QB 1UWBB 3CJ3A 3UQSA 1HMVB 4J2AA 3QLHB 3HXMA 4K50A 5C24B 1W9HA 4FBUA 4CJUA 4IKFA 2BE2B 3QYYA 4IFYB 3DOKB 4CGGA 1IKVA 1JL2A 2UUTA 1C0TA 3TAMA 3LZIA 3GYNA 3QNOA 1JLEA 3LP0A 3OVNA 4DLEA 5KFCA 2HNYB 1CXQA 3DLKA 2JEGA 4DFJA 4EYHB 1S0NA 4O3QA 1S0MA 3UIQA 3QINA 4F4WA 2RDJA 4YR2A 3PO4A 2VA2A 1S9EB 4ZTJA 1BISA 1MMLA 5KG2A 4FS2A 2UVWA 2FJVA 1RAJA 3K2PA 4C8OA 1BI4A 4IQXA 1C1CA 2HHSA 1GOBA 4NLXA 1JLAB 1S4FA 1L3UA 1TAUA 4CJTA 3CDUA 3KLVA 4H4OB 4I9QA 4CFBA 3B6OA 3D0PA 4WYWA 3AVFA 3OYBA 3PJXA 4ZPBA 1DTTA 1KLNA 4G1QB 3OYMA 4J9QA 4YNQA 4LH5A 1BQNB 3TAGA 3KNAA 3VA3A 3L2VA 1SL2A 2YNFA 3OYCA 1JLBA 4HVJA 3G6VA 2RDIA 4LSNA 3AVMA 4KPYA 5EU7A 3SCXA 2JC1A 3ALYA 2GC8A 2B6AA 1T05A 4K4XA 1OS5A 3RB6A 3LANA 3V9UA 4JV0A 1J53A 3H5YA 4IFVB 4FZYA 1RDDA 2R2TA 3BJYA 2A1RA 4CGDA 4ZPCA 1HYSB 1F21A 4QOZB 2E9RX 4CESA 1JLGA 3H4BA 1S9GB 4DU3A 4RW6B 1SL1A 4CJ4A 3OL6A 2IGIA 1NK9A 3OHBA 1VSKA 4B3OB 4Y34A 5KG3A 4NLSA 4KAIA 4TLRA 4CF2A 4ICLA 3DMJB 3O3GA 1WNSA 2X6NA 4DG1B 1QSSA 5DG7A 4EP4A 1VRTB 1TVRB 3LWLA 4DL5A 2E6MA 3T5KA 2V0NA 1EP4A 1WSEA 1HPZA 5CYMA 5K14A 1J5OB 5F8IA 3PW0A 2O5DA 3NF9A 1RILA 3MEDB 3SI8A 4IOBA 1LW0A 1NOYA 3MEGB 1EETA 3K5LA 3V9SA 4O55A 1S1TB 1JLFA 4NLQA 3UR0A 4J2BA 1RT6B 1EX4A 2O4GA 1RA7A 4KHUA 4PWDB 2VWKA 1ZBFA 3CJ4A 4LH4A 4DTSA 3MEEA 1CZBA 2KZMA 3H5XA 1J9AA 4CIFA 3OYFA 3AVHA 2B4JA 2G8FA 1U09A 1FK9A 1LAVA 2WOMB 2ZQBA 1WNEA 3BDPA 1ASWA 2BRKA 3L2WA 3T5HA 3RB4A 3PX4A 1SV5B 4R0EA 1RYRA 1S49A 3OYKA 3L2QA 2FVPA 3ISND 4CJWA 1C1BB 2ASJA 2ZD1A 4M3YA 3H2LA 4R5PA 3IN5A 4DTJA 4YMEA 1VSLA 3QEWA 5L1JA 1IO2A 5KFNA 3PW5A 4KV8B 1LWEB 2RKIA 4CF8A 4TY9A 2IM0A 2Z1HA 3D5MA 2ILZA 2HNDB 4KHRA 3OL7A 1S97A 3BGRB 5D3GB 3AVCA 2DPIA 3NF6A 3QEIA 1RT5B 4DS4A 1RT2B 4GMJB 3C6UA 3CDWA 4QW9A 3AO3A 3E01B 3JSMA 3D28A 3ZT0A 4CEEA 1J54A 5KFYA 5J2PA 1LW2B 3KHHA 2WRMA 1XR5A 4I2PA 4YQWA 2R8KA 3ZSWA 5F8LA 1LV5A 5FROA 5HRSA 3QZ8A 2BQUA 4CEBA 2HHWA 3V9WA 2OPSB 4CHQA 2DFHA 5T14A 3IG1A 2BANA 4CJSA 3M8QA 3WNEA 4ELVA 3QGIA 3TAPA 4AHSA 3ITHB 2OPPB 1TL3A 5CYQA 3IGVA 1NJWA 2AU0A 1ZBIA 1XC9A 4CGJA 3NF8A 2IM2A 3B6PA 1RCHA 2CKWA 5I3UB 3OLBA 4LY7A 4O3RA 2IBKA 3V81A 4RW9A 3K58A 2IDOA 4FYDA 1RTJA 3SUQA 3GIIA 4CJQA 1GX6A 2X6SA 4ZP8A 2R8GA 5KFBA 4ZMMA 4CJFA 5J2NA 4F2RA 3IAYA 1U49A 2BQRA 5KFEA 5DLFA 2FBTA 3SZ2A 1NNDA 3KKRA 4KHQA 3Q8QB 1NOZA 4C8NA 1TAQA 4N76A 3HVWA 5KFIA 1IKVB 3CIZA 4FCYA 2RF2A 1C0TB 3RB0A 4FJ7A 3TAMB 3PW4A 1JLEB 4KTQA 2F8EX 2E6LA 1JX4A 3LP0B 2E4LA 4H8KA 4ZPDA 1RTDA 3P1GA 3DLKB 4W5NA 2P5OA 4KHMA 2I5JA 1NKEA 3SQ1A 4Z4FA 1BI4B 4E7IA 3M9MB 1C1CB 1B92A 2AGOA 2FBVA 3K59A 4ID5A 4CEOA 5KFRA 4M42A 4I7FA 1ZETA 3KK2A 2F8TA 3VQDA 2G8UA 1Q9YA 4IDKA 3O4NA 2V4QA 1DTTB 1RT7A 4JV2A 3ISNC 3RTVA 3AVLA 2JEIA 4ELTA 2YNFB 3QGHA 4F4ZA 1JLBB 1S10A 2DFFA 4B9UA 4DQPA 1ZBLA 4G3IA 3TAFA 3DLBA 4F3OA 3VQAA 4E7HA 1S1WA 3AA3A 4OGEA 2B6AB 4FW2A 1T05B 1RT4A 3CJ2A 3LDSA 2HWHA 1TP7A 4AHUA 3KLGA 2W9CA 1HYVA 4Z4HA 3SJJA 4FXDA 1JLGB 1GOCA 1NJXA 3CQ8A 3BR9A 4J2DA 4KFBA 4RW8A 3ZT1A 3EZ5A 3E51A 3ZSYA 4EBDA 1NK7A 3OSPA 2WCXA 4OLBA 4ICLB 2C2DA 4MIAA 2VG5A 1FKPB 4MKBA 2XO7A 1MU2A 4URQU 1EP4B 4YR3A 1IH7A 3HKWA 1HPZB 5CYMB 5K14B 4DU1A 3DRSA 4ECYA 5I42A 4C8MA 1X9WA 1WN7A 2LSNA 1HJRA 3RR7A 2D41A 4BWJA 2G8IA 1LW0B 3PR4A 2ZE2A 3TARA 1EETB 5KTQA 5KFAA 1C0UA 1JLFB 4DSLA 1RDAA 2JLEA 4H54A 4AH9A 4B8CA 2B43A 1UA0A 1KVAA 1EKEA 4ZVEA 5J1EA 4Q44A 4WE1A 4BE0A 3CWJA 2CJQA 1N56A 1YTAA 4HHTA 3V6KA 4CHNA 3V1QA 4FJ5A 1FK9B 1RDCA 3MTKA 3PV8A 3OYAA 4MK9A 2OPQA 2ILYA 5HP1A 1ZBHA 1RDBA 3HP9A 4CJPA 4IH7A 4C8KA 4DTMA 2W8LA 4ECTA 4KTZA 2G8VA 3KHRA 2C22A 4DL2A 4E3SA 4ECWA 3U6FA 4AHTA 2ZD1B 4MFBA 4B9SA 3I5BA 4FK0A 1HQUA 1TV6A 2RKIB 1WSGA 2D7SA 1XR6A 2UVRA 4W5OA 4E1NA 1WAFA 3I0SA 3NF7A 1ZTTA 3C6TA 3S3NA 1Z26A 4RNOA 2Y1JA 3Q8SB 1YVFA 3GIJA 4DEZA 2HMIA 1XR7A 1TKXA 3DM2A 1B9FA 4F4YA 3C6UB 2D0BA 2ZKUA 2YNGA 3PY8A 2I1RA 3JSMB 5DG9A 4CJRA 1TKTB 2IC3A 3T3FA 5J2PB 4OKEA 3M9NB 1IKWA 3TANA 3IS9A 3VQPA 4CEZA 4Q8EA 4I2PB 3QO9A 4ECQA 3UPFA 2DPJA 2PYJA 3KD5E 1NHUA 3PVXA 1KHWA 2VG7A 5KRTA 1IKXA 3BSOA 3IG1B 2BANB 3M8QB 4ED0A 3VA0A 5DGBA 1GOAA 1TL3B 5CYQB 1O1WA 4CF0A 4KAZA 4OJRA 3DYAB 3AVBA 3V81B 4NYFA 4RW9B 3LPTA 5FRNA 1RTJB 2HB5A 1VRUA 4Q0BB 4NCGA 1KRPA 1ZYQA 1RTHA 1D1UA 4TSXA 1K1SA 1QAIA 3KIOA 4ECXA 2XGQA 3VQQA 1YTUA 3PW7A 2RF2B 3VQCA 1L3SA 3GILA 2DTUA 3V1RA 4CFCA 5JUMA 4IRKA 1QHTA 4NLYA 5SWMA 1RTDB 4IG3A 2W7OA 3IRXA 4RW4A 1D9DA 3DOLA 1S6QA 4O4GA 3HO1A 3M8PA 1L3VA 4JRPA 4BE2A 3KMSA 2I5JB 3NH1A 3RRHA 4Y2CA 4R8UA 5F9NA 4RNNA 3T5JA 4ID5B 1VSMA 4ECZA 1NJZA 1S48A 3CJ5A 3CJ0A 5F8JA 2Z1JA 2GUIA 4CK3A 4I7FB 4GW6A 1RNHA 4NLDA 1A5XA 3KK2B 4IDKB 5KFGA 4DTNA 4N41A 3RMCA 1RT7B 4FLYA 4KB1A 1FKOA 5KT4A 2P5GA 4KRFA 4Q43A 3NGDA 3ZSQA 3AA4A 4X2BA 4O0IA 3LP1A 4DSIA 4CJ3A 5KT7A 3BQ2A 1HYZA 2J6UA 1RT3B 3SFUA 1S1WB 5DK5A 3RAXA 4Z0UA 1L3TA 4KSEB 1RT4B 2RPIA 3ZT3A 4QWBA 2W9CB 3V6DA 3KLEA 4J9OA 3AO2A 3GIKA 5L9XA 4Z4IA 3K57A 1SH2A 3BSAA 5HRRA 3L8BA 4Z4CA 1C0MA 4RUAA 2IAJA 4E1MA 2JEFA 4KFBB 1KVCA 4Z4GA 3SQ2A 2G8WA 5DQIA 4FLXA 4O3NA 1X9MA 2VG5B 4EZ6A 4W5QA 1T7PA 4Y1CA 2QE5A 1MU2B 4FZXC 4O44A 2YNHA 3UDLA 3OYIA 1KCFA 5CZ1A 2ASDA 3DRSB 4MK7A 5I42B 3Q8RB 3NH0A 2W9BA 4ED7A 2FVQA 4QPXA 3QESA 3EY1A 3FRZA 2WONA 2VG6A 3AV9A 2XHBA 4ED2A 1SL0A 1SH0A 4K4SA 2E9TA 1ASVA 3QIOA 3TR8A 5JXSA 2ZE2B 5E41A 1I3AA 3VN5A 3L2UA 1NKCA 3QZ7A 1C0UB 3OS0A 1ZTWA 4LSLA 2XCAA 3MXJA 2D3ZA 2IMWP 1VSHA 3NDKA 3MXMA 4FLUA 4KHSA 5J1EB 4WE1B 1TK8A 3H5SA 3H40A 3QNNA 4KKOA 4EBEA 2FLLA 1QUVA 4CFDA 4TXSA 4C8LA 3DLGA 5L1KA 2OPQB 2YHBA 5HP1B 1SKRA 2FVSA 4Q5VA 4FVMA 3SPZA 4E89A 4QWCA 4TYBA 3CFPA 4NRUA 1JXLA 2D0AA 4DU4A 4FM2A 3AVJA 3RR8A 3DLHA 4OGCA 3NE6A 1TK0A 4MFBB 3AVIA 2EHGA 2OYQA 3OS2A 2ITGA 1TV6B 4WYLA 4FJMA 3NAHA 3KLFA 4EP5A 3IGNA 4QWEA 3K5OA 4K4ZA 3I0SB 5KT3A 4AHCA 4CJKA 3EZUA 2PY5A 3C6TB 3BREA 3OYHA 3ULDA 2R7YA 1S0OA 4MIBA 2ETJA 5F8MA 3AVKA 3WNGA 3AO5A 2XWYA 4DFPA 3ICLA 1EXQA 2HMIB 1TKXB 1Q9XA 3DM2B 4CE9A 4ZHRA 4XIUA 2YNGB 5L1LA 4N5SA 3VQBA 3MR6A 2QXFA 2IC3B 3TABA 4JS5A 5HRPA 3RWUA 4FJ8A 4FJJA 2JGUA 1IKWB 2C28A 5KFJA 4ED1A 2YKNA 3IS9B 3PJWA 1CLQA 3QO9B 5DGAA 3GQCA 2QKKA 3PZPA 4DTPA 1DLOA 3HVRA 4EZ9A 3KLIA 4Z4EA 1REVA 2C2RA 2VG7B 2W7PA 1IKXB 2B5JA 3ZSVA 1Y97A 4LD0A 5HRNA 3F73A 2IM3A 3RBEA 3OJUA 1TKDA 1HMVA 4IG0A 3BQ1A 4YP3A 1A5VA 3QGGA 2KQ2A 1N4LA 4PUOA 1KHVA 1CXUA 4TN2A 4KHWA 3NHGA 4M3RA 3OSNA 1C6VA 4IFYA 2AX1A 1JL1A 1HNVA 5FDLA 1TGOA 1VRUB 4NCGB 3LWMA 5KG1A 1I6JA 1SUQA 4DLGA 3PO5A 4XO0A 4CHZA 1RTHB 1Z25A 2JEJA 2YNIA 3V9XA 3OL9A 3CDEA 2AGPA 2EC0A 2FLPA 4K4WA 2KFNA 3RRGA 1QAJA 1T8EA 5KFXA 2OZMA 4DQIA 5KG7A 4DF8A 5KG6A 1RDRA 3HHKA 5DQHA 3F9KA 1RBUA 1LWCA 3SYZA 4IG3B 3IRXB 1KLMA 4RW4B 2HHTA 1S6QB 4O4GB 2BR0A 4AHVA 3M8PB 3SQ4A 5J2MA 2V4RA 3ZT2A 3AVGA 3M8RA 3DLRA 3DRRA 4R8UB 4GVMA 2PZSA 5KFTA 3ZT4A 5DLGA 3PX6A 3VQ5A 2FJWA 1RT1A 1WSIA 4DSEA 4FZZA 4DSJA 2R2SA 2ALZA 3FDSA 4DWIA 2QV6A 3V4IA 4NLOA 4LSNB 4F50A 3DLEA 1W25A 1VSFA 4KB7A 1QQCA 3H5UA 4CJ5A 4URGA 4M3UA 4IRDA 3S9HA 4FJNA 1FKOB 3HPOA 3GV7B 5FRMA 3LP1B 3G10A 2W42A 4WFZA 1S6PA 3I0RA 5KFFA 2XRIA 1S1UA 2XGPA 3HPGA 3OYEA 5EWGA 4DTOA 3KOAA 3LZJA 3T19A 4FK2A 4CEFA 2BQ3A 2FC0A 4RW6A 4DFKA 4ED8A 4CIGA 3O3FA 4CK1A 4F4XA 3V6DB 3KLEB 5KG0A 3EPIA 4ID1A 4KREA 3DMJA 5KFLA 4WXWA 4DG1A 1YT3A 2IAJB 3AA2A 1D8YA 1RBSA 4DQRA 4ED6A 1S5JA 1I39A 3OJSA 5C25A 3LP2A 4WFXA 1NKBA 2BGGA 4NLGA 4NZ0A 4F2SA 4KBIA 4OKJA 4BDPA 4O44B 4YFUA 2YNHB 4H4MA 3D45A 5KG5A 1C2PA 1RBTA 4W5RA 2D3UA 2XY7A 4I2QA 3MEGA 4MK8A 1D9FA 3OL8A 2W9BB 4OKKA 4OL8A 4Y2AA 4JV1A 3V1OA 4NYZA 3QEXA 3NGIA 2WONB 3ZCMA 2VG6B 3M9OB 4E7KA 3DI6A 1BIZA 1N48A 2PYLA 1X1PA 2ATQA 3MXIA 3RMAA 4M3XA 2WB4A 3MEEB 1HARA 1NK8A 2R2RA 3TAEA 5KFSA 4OVLA 4LSLB 4KO0A 3CFOA 1TQLA 4E0DA 4URSA 1XI1A 4CJLA 2IJNA 3KK1A 2KFZA 4KKOB 2R8HA 2V9WA 1XHZA 3CG7A 5JS1A 3KHLA 2F8SA 1WLJA 2VA3A 4PA1A 1B9DA 3DLGB 4DTXA 3RMDA 3OYDA 3H4DA 2XY5A 3NKYA 4R5PB 4CHPA 3OLAA 4CGFA 1ZBUA 4YR0A 4QW8A 2HWIA 1U45A 2HAIA 3P5JA 4FS1A 4FLVA 3C94A 3VQ8A 4FLZA 4FJLA 4NYNA 1C1AA 4DL3A 4DL4A 3LALA 3NBPA 1HQEA 1SKWA 2C2EA 1QTMA 4FW1A 1RT5A 4QWDA 4O0JA 4KB0A 3HJFA 4CGIA 3KMQA 2AGQA 3TAQA 4HCCA 1KSPA 4K4YA 3NMAA 3NAEA 3U3GA 2J6TA 4EBCA 4DMNA 1TL1A 5F9LA 3OHAA 4ZHRB 1RBVA 1QE1A 3HVTA 2FVCA 1TKZA 2YKNB 3MR3A 4RW7A 3MR2A 4CF9A 3CVKA 1VSDA 3ITHA 4RNMA 1DLOB 3KLIB 3LPUA 3NL0A 1REVB 2P1JA 2B5JB 4ZVHA 4DQSA 3PHEA 3G0ZA 1BIUA 2OA8A 3WNHA 4CJVA 1D0EA 5J2NB 4IG0B 1N5YA 1X9SA 5EDWA 5KFQA 2QKBA 4BDYA 4M3ZA 4PUOB 5HLFA 5HROA 1S1VA 2OZSA 1Q8IA 3SUPA 2WK4A 3HVAA 1DTQA 1HNVB 4N56A 5FDLB 4DF4A 5KFWA 1FXXA 4U7CA 3MR5A 3SNNA 2J6SA 1SUQB 3NAIA 3HP6A 4J9NA 2R2UA 2XI2A 4DL6A 1S1XA 3QEPA 4CHYA 2AWZA 3SV4A 2WTFA 2YNIB 3AVAA 3VQ6A 4J9MA 2AX0A 4J9LA 2X74A 4QWAA 3THVA 3VQEA 3MECA 3T5LA 3FQLA 1A5WA 5KFOA 5KFDA 1KFDA 4Y1DA 4BACA 3OS1A 1VK0A 3HYFA 3M8SA 1LWCB 3VQ4A 2VWJA 2FJXA 1KLMB 2AJQA 2DFEA 5KFUA 5J2MB 3H08A 3PUFA 3DRRB 2YHAA 2UVUA 4MH8A 4NLTA 1KFSA 4HUEA 4M94A 4NRTA 4Q45A 1JLQA 4CEAA 3L2RA 1RT1B 1JLCA 2HNZA 2IA6A 1RTIA 4ZVGA 3V4IB 5SZTA 3DLEB 1K6YA 5KRSA 5CY4A 4WFYA 3GV8B 3RBDA 1W0HA 2HW3A 4K4UA 4ZTFA 5KT6A 3BSNA 4IR1A 2G8KA 4CIEA 4GC7A 4ECUA 3KLGB 1S6PB 2IOCA 4ZP7A 3I0RB 1S1UB 3K5NA 3QIPA 1Z4UA 3DRPA 2NUBA 1QS4A 3KLHA 3N6NA 4RNHA 4RW8B 2HHUA 4IKAA 3I8DA 4ECVA 3BQ0A 4KI4A 1JKHA 4WZMA 4CHOA 1FKPA 5J2QA 4DS5A 2XI3A 1UOCA 4FBTA 3QETA 4HKQA 5KT2A 3HSTB 5C25B 4CFAA 3LP2B 4E7JA 1D5AA 3H59A 5KFPA 5KFMA 4B9TA 1VSIA 4H4MB 3MAQA 4DTRA 1L5UA 4JRQA 3FFIA 4L8RB 1BQMA 4I9LA 4I2QB 4K4VA 3N6LA 4ELUA 1NJYA 4EO6A 3T1AA 3K5MA 3KKSA 2IS3A 1XWLA 3HL8A 5KI6A 4RNFA 4WXOA 4OPKA 4DFMA 4FJIA 3DI6B 4F8RA 1U48A 1LWFA 4HUGA 1S9FA 1CZ9A 4DSKA 5CZ2A 3MF5A 2OPRA 4KO0B 3EPGA 3KJVA 2Z1GA 1JIHA 4IH5A 4DTUA 3KK1B 4PY5A 4NCBA 3KD1E 2ATLA 4DSFA 4NLUA 4LQ9A 4M45A 2BRLA 4IRCA 5KGWA 3KK3A 2IM1A 4MKAA 4TQRA 4Y3CA 3CM6A 4DQQA 4O3SA 4OPJA 1HQUB 3SFGA 1SH3A 2GV9A 3A2FA 3QERA 3CM5A 4E7LA 2GIRA 4JS4A 4BDZA 4M3TA 1WSHA 5C42A 3NBPB 1HQEB 2OH2A 5HBMA 4B9LA 2UVVA 1T3NA 4O5BA 4ZPAA 3JYTA 3TWHA 4TY8A 4J2EA 4B9VA 4XPEA 3GV5B 1BGXT 4IR9A 4CK2A 2Z1IA 1TKTA 3OYGA 3G6XA 4F3TA 1HNIA 1TL1B 3ZSOA 2YKMA 4RUCA 3S3OA 1T03A 3SI6A 4CEQA 3V9ZA 4PQUA 1R0AA 5DMRA 1IKYA 4KHNA 4EYIB 1QE1B 3HVTB 3RAQA 3DDKA 4O3OA 1TKZB 1GX5A 4AILC 1N6QA 1UWBA 4RW7B 2YV0X 3QLHA 4DL7A 4ECRA 3G86A 1RYSA 3DYAA 5C24A 2BE2A 3AO1A 1BCMA 4B9NA 3DOKA 1XHXA 3NGYA 3FSIA 3SUNA 4Q0BA 4B8AB 1N5YB 3I5AA 4KHYA 3TQ1A 1QSLA 5HLFB 4CGHA 5HROB 4HYKA 2HNYA 1S1VB 2Q3SA 4FJGA 2HVHA 1DTQB 4ZVFA 2EX3A 4QAGA 3OYLA 3HK2A 1S9EA 1IM4A 4TQSA 2FBYA 1S1XB 4NLRA 3H98A 3P83D 1IG9A 3KTQA 3SUOA 4ZP6A 2KW4A 1JLAA 4M95A 4J9KA 3DOLB 1JXBA 3PR5B 2F96A 3MECB 3NGZA 3FQKA 2WHOA 3S3MA 4H4OA 3OYNA 2RN2A 4O4RA 2BDPA 4JLHA 4FJ9A 1QSYA 1NK0A 3EYZA 2W8KA 3WNFA 4G1QA 3BSCA 1KTQA 1BQNA 1NK6A 5JS2A 5L1IA 1NK5A 3NH2A 3G6YA 5DQGA 4Q8FA 2R8IA 1JLQB 3OY9A 4FM0A 2R8JA 4QCLA 1JLCB 2HNZB 3QEVA 4IFVA 1RTIB 2KTQA 4CERA 2P51A 4NLWA 4K8ZA 5C5JA 2QK9A 1VSJA 1HYSA 1U04A 3PX0A 4UQGA 3TVKA 1RBRA 4HTUA 1VSEA 5EWEA 1RT3A 3ASMA 2XCPA 1S9GA 1YVUA 2HHVA 5KT5A 4B08A 4O3PA 4J9RA 1ASUA 1WAJA 2GBZA 3L3UA 5KGXA
chains in the Genus database with same CATH superfamily
3W8GA 4LF7F 2FLNA 4MQ3A 2O8BB 4TNOA 4OI0A 3F41A 3KLHB 1KVJA 4B9QA 3MFHA 5LMUF 2GQQA 2YJEA 1UAXA 4CCHA 1ICEB 2PMHA 3Q0AA 1JKHB 4DPOA 4J8FA 1GMWD 1ITGA 4FJXA 4NCAA 3W9JA 3TTCA 1VQSA 5GAGU 3RW6A 1LAWA 1BHLA 4CECA 3CCRN 2I9SA 2YVSA 1FW6A 2Q6CA 4ILMA 1NEEA 4FYYB 2F4VF 2YQ0A 3V6HA 3QIDA 2WOMA 2PFDA 4W5TA 2RQCA 5LMNF 5L8RC 1SV5A 3CD7A 1UA1A 5KFHA 3O9UA 4C8ZA 3U3YA 3JSBA 4DCJB 2ZBIA 2HHXA 1WHWA 1WOPA 1MN9A 2GELA 2HFSA 2XY8A 1RLCL 4DR5K 1IWAA 3QAUA 5M2UA 5CXTA 1LOUA 4OHYA 4E19A 1R0BG 2Y1IA 4KV8A 2HHQA 2YPYA 4NOHA 4ED4A 4WFBL 1N33J 4FF1A 3V6JA 1RXOB 5D6GA 3VQSA 3BGRA 3MM6B 2X78A 4ED3A 5GAEP 2GIQA 4GY2B 2B56A 3LAMA 3WXIA 1TK5A 1RT2A 3N6MA 3BGOP 2HLTA 2EW9A 2EEYA 5F41A 3CCVN 5KFKA 3CMAS 4JI4J 1IUJA 3ZSRA 2V7YA 5LSLA 1QQOA 2JC0A 3VQ7A 3MURP 1NGJA 3MPYA 3ZTPA 3TA2A 5HQMA 4EO8A 1GTEA 2IYIA 4YUDA 2W9AA 4WWSA 3CFRA 2OPPA 3AVNA 3WUHA 2DNLA 1FWPA 4PQUB 4OQJA 1XNRK 1NDLA 4CLSA 3SPYA 4U6PA 2MKCA 1RWWB 5T7BA 1RBOB 4C4WA 3NMRA 4HCBA 1N6QB 4QQBA 3TSPA 3CJ3A 1CULB 2AV5A 4U67Q 4CJUA 4M7YA 1NGIA 2ZH3A 3EGWB 1VQPS 2ZC4A 2P9IA 1NZAA 1U26A 4Y6IA 2EBGA 3QNOA 1JLEA 2FJDB 1GXLA 3F44A 4DLEA 4DN0A 4OZNA 1S0NA 2L9NA 2NRXA 3WEEA 4YR2A 5C15A 1S9EB 4ZTJA 1MMLA 2UVWA 1V5IB 1VHIA 1YZ7A 5ETOA 3P4UB 2R7RA 2HHSA 2QWOA 1GOBA 5BJRA 1F3FA 3GG1A 4KT0C 4CWBA 4CJTA 1FFWB 4UY8O 4H4OB 4HR2A 3UDCA 4CFBA 3B6OA 3VETA 3AVFA 4ZPBA 1EHWA 1NGAA 3OYMA 4J9QA 3KNAA 2MKHA 3L2VA 3PRDA 1NPKA 2D0OA 3C2PA 1JLBA 1SPBP 4QJVA 3G6VA 2RDIA 3OBIA 4KGXB 1M90T 2E5GA 5BPNA 3SCXA 2MXYA 1NU4A 4LF8F 2E8AA 2B6AA 2R7QA 2KXHA 3MOZA 2YWEA 3R9LA 1J53A 3H5YA 4JI4K 4FZYA 3MHYA 2R2TA 3BJYA 1MDUB 2A1RA 4FSVA 3L4BC 5EX0A 3NGUA 1WC3A 4CESA 3OR1B 1N88A 3OW2R 1S9GB 5DS7A 2B4PA 4CJ4A 2VOPA 2W4PA 1QY7A 3I82A 4Y34A 5KG3A 4NLSA 1RKIA 1QSSA 4X65J 4EP4A 1VRTB 2E5JA 2IVYA 1TVRB 2E6MA 1TL7A 2V0NA 1EP4A 3V4MA 1MWKA 3T6BA 2YH0A 1Q18A 1IR2A 2JWNA 2NRTA 5F8IA 1BHNA 3NF9A 5JLHA 2MSTA 3VF6A 4IOBA 3B4MA 2YPZA 1X0PA 3MEGB 3K5LA 3UR0A 1NDKA 3SAGA 2XS7A 2O4GA 3G8TA 2VWKA 3BGLA 3MEEA 3KJNB 4JKDA 1J9AA 8RUCA 3OFFA 3OYFA 2B4JA 1U09A 1LAVA 1XIQA 2BZ2A 1ILYA 3GJQB 3HD2A 3FZFA 3WXJA 3MM5B 2BRKA 5DM7L 3WIUA 1AT1B 4YS2A 2M8HA 5LSRA 4R0EA 1S49A 2VQFJ 4EWTA 2VBWA 2HSTA 1UMJA 3U1MA 3E1YA 2IRYA 2GIFA 4M3YA 4R5PA 3IN5A 4DTJA 2JLGA 2VF3A 1VSLA 3QEWA 3MMBA 5L1JA 1IO2A 4KH5A 3CCMS 1LWEB 4CF8A 4TY9A 2Z1HA 4JYAK 2CUYA 4DDFA 5IC4B 4OZ1A 1W7WA 3QRPA 5D3GB 1NO8A 3AVCA 2QL9B 3DKDA 5BXIA 1X9JA 2I8EA 3H90A 4H5VA 2BTFA 4IDHA 4JI6K 4F04B 3C6UA 3CDWA 4B1UB 2LQBA 4GV3A 4BR5A 3E01B 3CJRA 5HL7L 1MN7A 2V94A 2AYEA 3NOCA 1SIZA 1LW2B 3KHHA 2J0WA 4YDUC 5CHCB 3FSYA 2MQQA 3ZETB 4YQWA 2JLFA 4WFNQ 4XDCA 4R25A 3EXYA 1ZZFA 4OX8A 4X65K 4CHQA 2HQGA 4DPWA 4LF5F 5DM7Q 2O67A 5D0GA 2DNNA 1B64A 3Q7BA 5T14A 4GVBA 4CNZA 3N4PA 1QZ5A 4IYQA 2IBOA 4M5JA 4AHSA 1QQMA 5CYQA 2AU0A 1XC9A 3AOAA 4MAKA 3NF8A 2CKWA 5I3UB 2YJFA 1WKLA 2P9NB 2GJFA 4WQ5C 4LY7A 4O3RA 2FC9A 4FYDA 4USTA 4X4VA 4C8YA 3OXGA 5FLXU 3CJKA 2L08A 3IAYA 4FO0A 4FWOA 2YQ3A 4ZCMA 5DLFA 3RRKA 1WUUA 2QL7B 1NNDA 3KKRA 1TAQA 3CIZA 4M5DB 1C0TB 3RB0A 4FJ7A 3TAMB 3PW4A 3BO2A 1X3MA 2CDQA 2E6LA 2GQCA 2D9PA 3VAJA 1RTDA 3CSKA 2KHDA 2P5OA 4ISGA 2VQFK 1GQEA 1NKEA 2MY8A 4NI2A 3HI9A 4HACA 2C2KB 2EFVA 4C0OC 3R1XA 4BR9A 1C1CB 3OTDA 3CULA 5HI7A 2ACYA 2AGOA 4X66K 5JMVA 4W92B 4LBIA 1RAOA 1FHTA 4DR2F 1YTYA 4YHHF 1DJ0A 1F6TA 4K25A 1VQNN 2V4QA 1FNOA 1NRKA 3P8BB 4PHTX 3SAFA 4WTOB 2YX7A 4FWSA 3AVLA 5BR8F 4V19X 2YNFB 3QGHA 2HVDA 5A2QO 1ZBLA 5F0UA 1V5VA 2OHDA 4E7HA 3AA3A 4OGEA 3BZQA 4FW2A 1T05B 4H5NA 1YF5L 1YKWA 3LDSA 1SQFA 1D3WA 3MCMA 4BVPA 1H74A 3SJJA 4F67A 4LT6A 4FN5A 4BRQA 1JLGB 2ZVIA 2DNZA 3CQ8A 2V2VA 1CQNA 3E51A 3T9NA 5A6PA 3ZSYA 3OSPA 2ITMA 3D2FA 3UCUP 4B02A 4ICLB 4MIAA 5K8OA 4ITSA 3POTB 4QYRA 4A47A 3MAAA 4MDAA 2IMOA 1E6YB 5K14B 4F9OA 3DRSA 4U96A 4ECYA 4JKCA 3UB5A 4P2MA 1WN7A 1HI0P 2BJ3A 2A6OA 3EVMA 2CWKA 4RO0A 5AT1B 2LSNA 1Q7YO 1OQ3A 2CJKA 2P5VA 4H0YB 5KFAA 4DSLA 2JLEA 4H54A 3G82B 4ZVEA 5J1EA 4WE1A 3QT7A 2XHCA 3W0LA 4B3MK 2VWBA 4UF4A 3CJ7A 4FJ5A 1FK9B 3J81U 1NHKL 3PV8A 4KBOA 2ILYA 2DNKA 4DPUA 5EGYA 4DTMA 2PA8D 3NCRA 2OP5A 1XN9A 2QG9B 2KM8B 4E3SA 1WHXA 3ELHA 3OTOK 4ILJA 3UFCX 4B9SA 1HQUA 2QO3A 2RKIB 1WSGA 1XNRF 2LCWA 2YKOA 3PEHA 1KEKA 3MM8B 3GE9A 4H5WA 1VYAA 4W5OA 5IT0A 1WAFA 3LUYA 2A10A 5AQRA 3NF7A 4ALZA 5FLXY 3C6TA 4ZLNA 4PYDA 1CQMA 3AT1B 2RB7A 1XR7A 2WZ1A 1N8RO 2D0BA 2QGFB 1OYDA 3JSMB 2ABYA 2EVZA 2AHOB 4GO7X 4FWNA 1VQ8S 1TKTB 3A13A 3T3FA 3LGHA 1NMEB 1IKWA 1HHTP 3C6AA 2BMBA 4KR0B 4Q8EA 4I2PB 5GADP 3CQYA 2F8HA 2DPJA 5M1KA 3VAMA 1NHUA 3WXLA 2RHQB 3M8QB 2OFGX 1Y4ZB 4LFBJ 3VA0A 5DGBA 1NU0A 4CF0A 4OJRA 3ENWA 3W3DA 4M8LA 1RTJB 2DNYA 2HB5A 1VRUA 4LF9J 4QIEA 1BUXA 3O8WA 4ZK7M 4OYZA 1RTHA 2VUGA 1HW8A 2BJ9A 2SXLA 1NGBA 2XGQA 5LY3A 4IFEA 4LF2A 1DRZA 3PSFA 1HPMA 2V52B 1QHTA 2V8GA 5SWMA 5M1FA 1D9DA 2CGJA 4O4GA 1X4CA 3HO1A 3M8PA 4BE2A 3KMSA 3OUYB 2AP6A 3NH1A 1IXKA 4Y2CA 1DFDA 3I9V9 1R6VA 2GX8A 4RNNA 2UUCJ 5D8HB 2QWQA 1VSMA 2YKPA 3UKRB 1S48A 1UPPA 3BY5A 4NASA 2R7VA 2DNQA 2Z1JA 5A6WA 4CK3A 4AUKA 2XLJA 2NUHA 4G9ZA 3L4QA 2F3JA 3TQEA 1EIYB 4FLYA 5CR4A 4M5IA 1Q82T 3ZSQA 3AA4A 1HIYA 2HSEB 5C0YA 4L3KA 3ZZZA 1LXNA 3J7ZT 1K44A 1OO0B 5RUBA 3SFUA 1S1WB 4RX6A 5DK5A 3RAXA 4QU7A 4Z0UA 4JOUA 1BD6A 2PSZA 4QWBA 1RBAA 3SIPB 3V6DA 3KLEA 4BCAA 4DV4J 4J9OA 4HHJA 3AO2A 3GIKA 1BC6A 2PN6A 3BBBA 4WPAA 2LXFA 4OHXA 4E1MA 3J81Y 1PJ7A 2KT5A 4FLXA 2GFFA 5BR9A 4XDDA 3W2WB 2VGNA 4JKHA 1VQ5N 4O3NA 1X9MA 2VG5B 3ENQA 1NCLA 3QJJA 3N5FA 3RJMB 1MU2B 1DEJA 2YNHA 5CZ1A 2R7XA 4LF9K 2GMHA 2ZNYA 3NH0A 1IQZA 2N4DA 3EY1A 2QWLA 3MPWA 3CJ9A 3FRZA 3TA0A 4ED2A 4RL1A 2MPUA 3TR8A 2ZE2B 5E41A 5GADU 4JI8F 1EAYC 3VN5A 3EUNA 1NKCA 4JYAF 4P2FA 5IT9U 5BYQA 2DB1A 3NVKA 2ZH4A 3BV8A 4AL6A 1VQPN 4MJKA 3QMLA 2MQNA 3H20A 5E3RA 1TK8A 3M8WA 3BM7A 3UKUA 4EBEA 2PI5A 4JI6F 4CFDA 4C11A 3EVWA 3M2RA 1FJGJ 4E2FB 2UUCK 2UXDF 5HP1B 2UP1A 3AOBA 4M5MA 1RTZA 2YKAA 4FVMA 1DKGD 3SPZA 4E89A 2E1RA 4TYBA 4NRUA 3I33A 3THYB 1JXLA 2K1RA 5B0EA 3RR8A 4TLQA 1FRLA 1KVIA 4PR6A 1KTVA 3JAMU 3M6WA 3G4SN 3ENBA 1U6FA 4MFBB 4HHHA 1DBDA 1S72S 1TV6B 2LEPA 2E7XA 3KLFA 4CJ7A 4P72A 5AQQA 2U1AA 2XULA 3CF5Q 1FESA 3BREA 3ULDA 2FC8A 4DV0J 2ETJA 4DQ8A 3EN9A 2CQ4A 3AO5A 4W4MA 4DUZJ 1EXQA 2BM0A 4DV4K 2ZOMA 2V7ZA 1TKXB 2CG4A 4H0OA 1Q9XA 4CE9A 3RYLA 3O6QA 3LDNA 1WACA 5L1LA 3LDPA 1B7FA 3QJLA 3VQBA 5G4DA 2P9EA 4HH1A 2YKNA 4WBFA 3PJWA 4ENOA 1CLQA 3QO9B 1DLOA 3KLIA 1IR0A 1REVA 1W26A 1M90O 1IKXB 3BO3A 2KI2A 4B1XB 2MQMA 2R4FA 2H3EB 3G2XA 4X66F 5ADXH 5JMNA 2HHHJ 1A5VA 3QGGA 1N4LA 4PUOA 1KHVA 4E1JA 4TN2A 3NHGA 3KG4A 4ZN1A 4IFYA 3DXMA 3AD7C 4PPDA 3GFZA 4DLGA 3NMUA 3A8KA 4DR7F 4CHZA 3CIMA 2Z4PA 1X5PA 2KFNA 4CLTA 4HL9A 5AQNA 3ETMA 2XMVA 3DRXA 3F0NA 1UVKA 4ZKAA 2ZH6A 2Q97A 1T8EA 2J9DE 2KXFA 2Z8QA 2QM1A 4KGKA 4DV3K 3VAGA 1XTZA 3CDAA 4IG3B 1KLMA 4ZVTB 1VC0A 4AHVA 1GLBG 1N5VA 1IBKF 1CS4A 2BEFA 3ZT2A 4Y0WA 2ASOA 3D7EO 2GHVC 1S76D 3ZT4A 2YX4A 4ZVUB 3VQ5A 1N36F 4FZZA 1RWXB 3FDSA 4DWIA 2QV6A 4NLOA 3DLEA 1W25A 4ILRA 2MZSA 3W64A 6FDRA 2J76E 2OMOA 4I6WA 4U9RA 3HPOA 3GV7B 1NUEA 4DV0K 3CC4N 1RWUA 3G10A 4CZJA 3EDQB 4DUZK 5KFFA 4L74A 3HPGA 4CIOA 1Y5IB 4RCHA 3LZJA 4Y2KA 3N4QA 5AZJA 4DV6J 5IT9Y 4RW6A 1ESVA 4ED8A 4YY3F 4F4XA 3K5PA 4OJ3A 3QRRA 4ID1A 3N79A 4K2XA 3U1LA 2IAJB 3AA2A 4B3MF 4FNIA 4USHA 3GJSB 1S5JA 2V51B 2V34A 5LXRA 2NRZA 2IIHA 4WFXA 2FQQB 3ADAC 1NKBA 4NZ0A 1EWRA 3R8YA 3T69A 2HHHK 2O8CB 4O44B 1XK8A 3D45A 4YOXA 5DO2A 1H2TZ 4I2QA 4X84A 3JAMY 1ZAXA 2KG1A 2W9BB 2CA9A 3OTOF 2V2QA 2HQDA 4OKKA 4JV1A 4PWUA 4UQTA 1AB8A 1WTFA 3M30B 2WONB 3SK3A 1ZM9A 3M9OB 1S7HA 2ADCA 2ATQA 4CVNE 3PYFA 4EU0A 4J91A 1ZAVA 1YJTA 1HI1A 5KFSA 4LSLB 1BUPA 1TQLA 4B3RJ 2BKNA 1AZSA 1VRQC 1VBYA 4DV7F 4CBWA 4IUFA 1RADB 3ID6A 3U1NA 4LFAJ 2DCLA 3DGPA 2A3ZA 3FCHA 5AQZA 4ETXA 1CPZA 2P9UA 2MKSA 5IFMA 1PILA 1XMOJ 5AZIA 1PYOB 1ULRA 3VF0B 5M1PA 1P8GA 3NKYA 2PGCA 4UOGA 4EHUA 1U45A 3LM2A 1UJ4A 3GL1A 1HKGA 4WQ5A 4FLZA 4FJLA 4C48A 1SQKA 1AUDA 4TU8A 4A8OA 5ETVA 3W5XA 2O8DB 4IOCQ 2UUBK 3TSUA 3HT0A 4A4JA 1RACB 3GFXA 1NGGA 2GNKA 4O0JA 3JSRA 3M1VA 1TUYA 3R6MA 3KMQA 5KOXA 3TAQA 4DV6K 2LQ5A 5LL6d 1KSPA 4K4YA 3NMAA 3FRYA 2E1AA 3U3GA 4EBCA 1RKJA 1JXVA 4DMNA 2Z0GA 3R1HA 4A48A 4ZHRB 3LH2S 2D1CA 1RBVA 1ZBSA 1QE1A 1T9VA 3US5A 1U02A 2FVCA 1QHAA 2KM8C 4GNIA 1HHQA 4RW7A 4A62A 3TWZA 2RUGA 1MWYA 4D3HA 2HBJA 1E6VA 3LPUA 1U0SA 4Z94A 3G0ZA 2AP1A 2BVZA 1B3TA 4UOFA 2F63A 1D0EA 4CJVA 2KYXA 2KT3A 4IG0B 1YI2N 4QZVB 1GLFO 1BLUA 1LKZA 1ZBTA 4ETZA 1O5JA 3Q86A 4B3TF 3FZMA 4NLCA 4CO3A 3PM9A 3SUPA 4N56A 2DR6A 4DF4A 3SNNA 5L38A 3IBWA 2IHR1 1SUQB 1TUVA 3HP6A 3A5OC 2R2UA 1VOMA 4DL6A 4B3RK 1GH8A 1KC8T 3SV4A 1BDGA 4WFAL 1U1LA 3D6RA 3VQ6A 3Q2SC 2POKA 4LFAK 4J9LA 2HBQB 4GV6A 3THVA 1BOTO 3VQEA 4FWPA 5FLXO 3MUTP 1JNZB 1KFDA 5AQSA 4NB4A 3OS1A 1VK0A 3M8SA 2HK2A 1LWCB 1OIAA 4JI1J 1T9XA 4IO1A 5E84A 2B4OA 4MH8A 4NLTA 4C0BA 3FNNA 1RABB 3D6TB 4M94A 1N52B 4CEAA 3B82A 2N7YA 2Y3YA 2PT0A 1B99A 2IA6A 1RTIA 2QC3A 1M5PC 3OTBA 4QS8A 4ZVGA 1XEZA 4B1ZA 3V4IB 1JCGA 4DX5A 4WFYA 3H3OB 4BC7A 3BB5A 4OYAA 4ZCIA 2VD3A 4JHDA 4BRHA 3MI7X 1Q8LA 2G8KA 1FJCA 4GC7A 3KLGB 1XNQK 2M4MA 3J7AN 3MDQA 2O8BA 3K5NA 2DGOA 1PJ6A 1U25A 4WFAQ 2NUBA 1QS4A 1W2BM 3KLHA 3N6NA 1BWEA 2HHUA 2RUSA 1FRMA 2CPIA 1H1VA 1NLVA 2L9WA 5B7WA 4DUYK 3BQ0A 2AYMA 1VIOA 1JKHA 1QVGR 4CHOA 3QATA 2G2ZA 3QETA 1VLYA 4HKQA 2FUG9 2KVQE 5C25B 4CFAA 1FA0A 2KL8A 2W7AA 3QT5A 4P2XA 4MMOA 1UPMB 2FD2A 3TVZA 5E26A 4JRQA 1FX4A 1UWAA 3HM8A 4I9LA 1F2HA 4OX6A 3EGNA 4ELUA 2W6KA 5BRDA 4WK1A 4EO6A 3T1AA 3K5MA 3HL8A 3TJAA 4QR2A 4RNFA 2XO6A 3DI6B 1VHXA 2HIQA 4HUGA 1S9FA 3BKTA 3WBZA 2HKEA 2HOEA 4QR0A 3P45B 3B54A 2DO4A 5M1NA 1LFWA 3EPGA 3E9LA 2Z1GA 4KH0B 1JIHA 2KB2A 4UOCA 1B7YB 2EFGA 5DZ6A 4QIFA 5M2PA 3KD1E 1UW9A 2RQ4A 2OO4A 2BRLA 5I3QA 5D4LA 4ZLLA 4IRCA 5KGWA 2IM1A 4LFCF 3CM6A 3AJDA 3OQ2A 1M5VC 3MM6A 1RWOB 2YWHA 3QERA 3A2FA 2CG8A 3CM5A 3AJ2A 1FTCA 4O0NA 2BOPA 4QR1A 1RP5A 4JS4A 1WSHA 2BX6A 1NDPA 2OH2A 2CPYA 5T41A 3O9TA 3UI3A 2ZJPL 4WIQA 4J2EA 3GV5B 2DGQA 4IR9A 3D2WA 3D3CJ 2IRUA 2Z1IA 3OYGA 4ZVQB 3O1WA 1KOHA 1AROP 1T9TA 1FRKA 3R7NB 4KRWA 4PQUA 2DT9A 2K3KA 2OTLS 4EYIB 3HVTB 2QWRA 3L4IA 3A5NC 5ETTA 1TKZB 4A8SA 1UZHA 4PQAA 2UU9J 5K8NA 1N6QA 2QIFA 1LK7A 1QZ6A 2FLOA 4DV3F 1CULA 1Q82O 3E8OA 2CQBA 3J7ZO 4K0KJ 3T7ZA 3EXCX 4OX9F 3M32B 5CABA 3D67A 1BCMA 1GMVA 3SUNA 4DPTA 2XMTA 1N5YB 3FVYA 3Q22A 4CGHA 1IJEB 1S1VB 4FJGA 3HRGA 2HVHA 1DTQB 4BGAA 2EX3A 4QAGA 4I56A 3HK2A 1S9EA 2IA0A 3H98A 3P83D 3T41A 2G1DA 3R9PA 2HMPA 1QVFR 4M95A 3AA9A 1JXBA 4LUBA 3NGZA 4NXMJ 4H4OA 1YJNS 2RN2A 2B3TB 4O4RA 1Y5LB 2J7WA 1Q5YA 3CMES 1QSYA 1S79A 4USIA 2RRNA 3THPA 4CH7A 1GXUA 2DEJA 1AXQA 1HBOB 4BC3A 2AEJA 5D4NA 3ILOA 4LREA 5JS2A 1NK5A 4FKXA 3NH2A 4YOTA 1YBTA 2CNNB 5DQGA 2GW8A 2N7CA 2FF3B 3ENAA 2RIJA 2R8JA 3GJTB 2GAGC 2MGZB 2Z2ZA 1IJJA 4O5FA 5IV4A 4QCLA 4CERA 4K8ZA 2HF3A 5C5JA 3KG0A 2CQGA 1S72N 4I0WA 1U04A 3PX0A 3K9JA 1WC0A 4X4OA 5LXYA 3OR1A 1RT3A 4ANCA 1S9GA 5KT5A 4J9RA 3N01A 1JMTA 1WAJA 3ZZ0A 2GBZA 1HBNB 3L3UA 1RAFB 2GA7A 3OVSA 1TFWA 1SXLA 3G8SA 4JK9A 1NK4A 4K43A 1VQLS 1J5EJ 1U7LA 4ES1A 1VRTA 3DRPB 1TVRA 5JVGQ 4M41A 1Y10A 2CJXB 1DZ5A 1I94F 3CTRA 3B8AX 3QSYB 3HOTA 3DLJA 4KC5A 2VBZA 2D5RA 1HNWK 2CPEA 3M6VA 4RZRA 2XMMA 1SQGA 3KDOA 3TUIC 3I5CA 1Y7PA 2XC9A 3OFHA 5AQMA 3MPUB 1SKSA 3ID8A 4FLWA 3SQ0A 3FFIB 3OPKA 3NCIA 3HPHA 2CWXA 3E2EA 3CE8A 5DZ7A 5A76A 4A46A 4MIWA 4J90A 2UUBF 3CGIA 1ZM4A 2L48A 4RG8A 1K1QA 3MM5A 1PBUA 5D0HA 2EG2A 3NS7B 3TYTA 3ZSZA 2ASLA 4QYZJ 4FP9A 2O4IA 1CJVB 1PBAA 1J6ZA 3NGRA 4F36A 3VMFB 2DY4A 4RU9A 4QIGA 4WCEL 2UUWA 2FBXA 2CPZA 3VGMA 4WJBA 4CEDA 3GPAA 2NPIA 4KE5A 4M63A 3AA8A 4UZBA 1LWEA 2DR7A 4KTWA 3VESA 5IT9O 3UDVA 4F4KA 1PKUA 1WUAA 4ZPTR 1HR0F 1U2FA 4NE9C 2PMZD 5GADI 2LU1A 5D3GA 4LF6J 2JL9A 1S4EA 1Q78A 6FD1A 2XMAA 3TPQA 2C1EB 1O13A 3VGSA 2F9WA 1WD6A 3O4QA 5AQIA 3E01A 2WBRA 3UN2A 1IBLJ 1G6BA 1LW2A 5HBMB 1HQ2A 1D4XA 2XMJA 3RSEA 2BE9B 2MJUA 5AXMA 4XPCA 3ZETA 3JYTB 1J5EK 3L7UA 4KHPK 4TY8B 4IH6A 2G2OA 1VQMN 3Q7CA 1ROFA 4AD6A 4CJEA 3JAMO 2JFDA 3ZTQA 3T1HJ 2EPIA 4G6VB 1HI8A 5AFUH 4IBNA 3MCAB 2KZZA 4WCEQ 2QYGA 5I3UA 2P9NA 3W5YA 3RMBA 5ADXA 4JI2F 3O3HA 1KDNA 2DNHA 4CZIA 1HMVB 1KQKA 4J2AA 1U1NA 4F26A 3QLHB 3SQOP 2P8IA 3PFEA 2WUSA 4K50A 4FBUA 1KONA 1RI7A 4GV9A 2E5LF 2DXEA 3QYYA 5E3AA 3ZNUA 4CGGA 2UUTA 4M5DA 1C0TA 2WSCC 3TAMA 1GAOA 3GYNA 4CO4A 1FVQA 3FC9A 3OVNA 2ZUAA 1CVJA 2MDAA 3ZTRA 4QYZK 3UIQA 5HMWA 3QINA 1RU1A 4F4WA 3PO4A 1UFLA 3PCOB 3JB9k 3PNIA 4FS2A 3GFHA 2AT1B 4C8OA 3CCSN 1WORA 2V8PA 4JI0K 2L9DA 4IQXA 4UY85 3FBFA 1C1CA 4NLXA 1JLAB 2A3JA 1XNQF 2A6MA 2ZM6J 3O3LA 3AOCA 3DN9A 3FZLA 1V3SA 1FEEA 2ZWPA 2CNLB 2R9LA 3C15B 2PD1A 1DQAA 3CIPA 2JH3A 1FXRA 1KLNA 1MROB 2RNEA 2HS0A 5EX3A 4G1QB 4ZN3A 4YNQA 4LF6K 3TAGA 1KAYA 4DUYF 2IVOA 3VA3A 3CJ1A 2QA4S 2YNFA 1B0PA 1SJ3P 3J81j 3O44A 3JSYA 1WBBA 4KPYA 2JC1A 4ZIVA 1T05A 2AF6A 4LF4J 3RB6A 3LGNA 3D68A 4JV0A 3U9DA 4OI4A 1HW9A 2QFIA 4ZPCA 2ZJQQ 4QOZB 2E9RX 1SJQA 1JLGA 1H3DA 1M5KC 1XERA 3WT0A 4DU3A 1SL1A 2CH5A 1RCOB 3T1HK 1AW0A 2IGIA 3OHBA 2J9EA 4B3OB 4CF2A 1OYEA 4ICLA 4DPYA 3DMJB 3O3GA 3POTA 2DNPA 4DG1B 5MAOA 3KHYA 3LWLA 3A3OB 3OR2B 3T5KA 1E6YA 4JV5J 1LQ9A 4JI7K 5K14A 2HFZA 3I32A 4A59A 3K7RA 2CJAA 3VENA 3EJMA 2O5DA 2F7VA 4WP3A 3TW0A 1KS2A 4M5NA 5HMYA 2ROEA 3C65A 3CT9A 3VZHA 4C9DA 3LPEA 3I87A 4NLQA 4J2BA 4PPZA 1DHMA 3G82A 2X7IA 1QLNA 1RA7A 2K2PA 4EGLA 4DTSA 4FF3A 3VEXA 3AVHA 1I1GA 1FK9A 3ZTSA 2M5YA 1WNEA 1ASWA 2YTCA 3M6XA 2DYAA 3L2WA 1S7IA 4RKUC 3T5HA 2ZM6K 4JEPA 3QGPA 4M5HA 2FVPA 4ANDA 3QSIA 3GMGA 1C1BB 1XBWA 2ZGYA 2B9WA 1QDUB 2ASJA 4YB7A 1FNXH 4YMEA 2O8EB 2XNQA 2RKIA 4CLLA 2DJWA 2J9DA 3MM8A 1NBEB 2CQPA 2HRTA 1NH8A 3ET6B 2OTJN 1H38A 1S97A 1PIEA 1KC8O 5AQTA 3SCLE 4Y65A 3QEIA 1RT5B 1WF2A 5D78A 5FPDA 1GEHA 4CH0S 3JSMA 3W1YC 4R79A 5KFYA 2B0GA 2A1BA 2XSJB 5CZXA 1XR5A 4L75A 4I2PA 2R8KA 3ZSWA 5FROA 4EI2A 3QZ8A 3HTVA 2BQUA 4CEBA 2W2MP 4ZA1A 2LYVA 2OPSB 5U47A 4RR5A 4ER8A 4K42A 2B7CB 2VKRA 3UW1A 3CCTA 4WP8A 1FX2A 4JV5K 4CJSA 3M8QA 4ELVA 1HWKA 3TAPA 3IGVA 1NJWA 3BBFA 4GKJJ 2CFXA 2R7UA 4FL9A 4JKBA 4N8NA 2IM2A 1N5QA 3OLBA 3T1YK 3CD0A 1UKUA 1RTJA 2QLFB 1S57A 1IJFB 2G9OA 3GIIA 3SUQA 2X6SA 3CCRS 2E88A 2IVMA 5KFBA 4CJFA 5J2NA 4F2RA 3ZLJA 3D66A 3BKUA 3PIOL 1SC1B 3P5TL 2FBTA 1NOZA 5IM0B 1PG5B 1YRTA 1IKVB 2M2BA 4PG6A 2HBRB 4CH1A 4EUVA 4EK2A 4H5RA 2XM3A 3LP0B 2E4LA 2CJBA 4H8KA 4ZPDA 2H5EA 3DLKB 3CHWA 3O1LA 2GO8A 4CYUB 3OUYA 3SQ1A 2X3DA 1BI4B 2X3GA 3W3SA 3M9MB 1H98A 2FBVA 3K59A 2HEKA 1OH8A 1TUUA 3JXUA 1X3NA 2V68A 3MM9B 4GKKJ 1NSAA 3CJTA 1ZETA 3NP5A 1YITN 4JV2A 3ISNC 1RHKB 5B08A 4MO5A 3RTVA 1Q4RA 1CJUB 1R59O 2PBDA 1H2UX 1HNWF 3ATUA 4ELTA 4F4ZA 2OD4A 4X4PA 1VI7A 4G3IA 3OBYA 4F3OA 3VQAA 3TX8A 1S1WA 1YJVA 4QIWD 2C2MB 4C7QA 3LQVA 3CJ2A 4HHUA 5HJXA 2ZVSA 3CCJS 2HWHA 1TP7A 4Z4HA 1WC5A 1HNXF 4A61A 2CQ3A 2DK2A 3VAKA 2MY7A 2XHWA 1GOCA 2H3GX 3BR9A 2FGOA 4RW8A 3R5DA 3W2WA 2WCXA 5DDQC 1BU6O 2C2DA 4OLBA 2VG5A 4GKJK 2U2FA 1FKPB 2G0IA 4ISEA 3CETA 3BZCA 1VAZA 1MU2A 3W65A 2RILA 1WJ9A 5CZVA 4YR3A 2Q0RA 2OTLN 5CYMB 3RGIA 1YIJN 2UXCJ 5IV3A 3EZWA 3SAHA 4DV2J 1VC6A 2E2QA 3RR7A 5B0DA 4BWJA 3UE2A 2G8IA 2ZE2A 3TARA 1X4BA 3ILLA 3OVAA 2HBLA 2PAVA 1OQ6A 1WEZA 2HQCA 2LP4A 3IAM9 2EXUA 1EKEA 3CCQN 4Q44A 1BG3A 4PXDA 3THTA 4BGBA 2WBNA 3FFKB 1YTAA 3CJCA 1OH6A 4USKA 3NY0A 2MEWA 3V1QA 4PG7A 4DZ6A 3GWCA 5HP1A 1ZBHA 3KWMA 3HP9A 4CJPA 3GE1A 1S59A 4KTZA 4DU7A 2G8VA 5E3QA 4P9SA 2RS2A 4KHPF 3IM8A 3THYA 4GKKK 2C22A 4DL2A 2ALYB 4OZ5A 4ECWA 5AQOA 5AQFA 1WELA 5HANA 3SLCA 3HZ6A 2ZD1B 4PKHA 3F5TA 4MFBA 1VBZA 2VFTA 3C6HA 2GGPB 1CLFA 2Q79A 1TV6A 3OW2M 3BO4A 2G4BA 2YI1A 1XR6A 5L39A 2FHKA 1U8SA 1GLDG 5F0WA 1FXLA 2B9YA 4B3SJ 3I9ZA 4O8UA 3R3TA 2CGKA 4OZ3A 3MEKA 4DPXA 3KXDA 4ISFA 1YVFA 1P9YA 2ROPA 3ULEB 1TKXA 2NRVA 2I1RA 3J7YP 3VGVA 5J2PB 3M9NB 1PJ5A 2Q3PA 2F4FA 3VQPA 3QO9A 2YWWA 1TMJA 3QJPA 1IKXA 1VQLN 4NMXA 3IG1B 5F3ZA 4ED0A 4AE5A 4JI0F 1ZH5A 1YBUA 4PG4A 2XSFA 2PI4A 5MLCQ 4OHZA 4DV2K 4GVLA 4I1TA 2HVZA 3DYAB 3AVBA 2FDNA 4NYFA 4RW9B 2DD8S 3QBXA 5FRNA 3DHXA 1Y9OA 2O8FB 4BRDA 4Q0BB 1OY8A 4L76A 1N34J 1NJIT 2Y0SD 3TZXA 2ACMA 1QAIA 1NSPA 1JK9B 3PFOA 4ECXA 1M1GA 5HOOA 2RF2B 1I5OB 2WW8A 4ZVOB 3GILA 1SZ2A 1X5SA 4CFCA 1K9MT 2DNRA 4IRKA 4X4TA 3K2YA 4IG3A 2W1BA 3UVJB 5EOYA 1Y00A 4ILGB 3DOLA 1NBWA 4JI3J 3VEYA 3WXMB 3JQKA 2I5JB 2EK1A 3D0IE 3RRHA 2DGXA 1YJWS 2YX1A 3T5JA 3CCZA 4ID5B 4ECZA 5B0AA 4NA3A 1V4SA 1Y0HA 3CJ5A 5F8JA 2ZUGA 3CXCR 3MN5A 3PACA 1WBDA 4DBQA 1C0FA 4FYWB 4N41A 4DTNA 3RMCA 1H72C 4JI7F 2DHGA 3QFPA 2VQEJ 1JQGA 4KB1A 2N82B 1X7VA 3MMCB 2LLZA 4DR4F 4X2BA 4CJ3A 2ZBCA 3D2EB 5BREA 2J6UA 2DGVA 2DISA 4XAKA 4BQZA 1L3TA 1RT4B 4OFZA 3ZT3A 1Y3JA 4PZVA 5ETKA 2JNJA 3HHLA 4U7UK 3BSAA 3VHQA 4Z4CA 3RZAA 1C0MA 4RUAA 2IAJA 2JWKA 2JEFA 1KVCA 3SQ2A 2G8WA 3FZBA 3NS5A 2GCFA 2F9JA 2MQLA 3IR5B 4EZ6A 4DV1K 3KDNA 2O8CA 4O44A 3UDLA 1KCFA 5CHIA 2ASDA 4MK7A 5CAAA 2W9BA 3DXKB 2HBKA 3AB2B 3MD3A 3HF5A 1N34K 2YY3A 3J7YU 2HG4A 1X8DA 3SCJE 2QWMA 3M30A 2WONA 1VGYA 2J9CA 2MHEA 1SL0A 4HI1A 2AJ2A 1ASVA 5JXSA 3QAEA 1T3OA 1I3AA 4BC4A 3L2UA 4DOZA 4FWKA 1ZTWA 1Q1KA 4LSLA 2XCAA 2QSWA 1VR6A 1T6DA 2D3ZA 1VSHA 4FKYA 3NDKA 3MXMA 4FLUA 1WC4A 1WOOA 4CZEA 3H40A 3SMZA 3PKYA 4JI3K 4EFHA 2FLLA 3MAHA 9RUBA 3ENHA 4CZKA 2YHBA 1WDTA 1K0TA 1T0TV 3H1QA 2K06A 3CCUS 3CFPA 2EK6A 3C46A 4DU4A 3H3NO 2Q6BA 3DLHA 3WC2A 2O8DA 2MKJA 2EHGA 2KJVA 2OAUA 4WYBA 4WYLA 4FJMA 3NAHA 5H9FJ 1P90A 3T1YF 3K5OA 5GAHP 4CJKA 3EZUA 2PY5A 4X62F 2AD9A 4K5SA 2MQOA 4I69A 5JICA 2XWYA 4DFPA 1M1KT 3R7BB 2J0QD 2HMIB 2P9LB 4ZHRA 4XIUA 1HNZF 4EAHD 5FD1A 5AFUA 1F3VA 4N5SA 3NEKA 2QXFA 2AZ1A 4H4KC 4C98A 4JS5A 3RWUA 4FJ8A 2JGUA 3TZZA 4CLWA 5KFJA 5AE3A 3MPVA 3PZPA 4DTPA 3HVRA 4LSZB 1EJ7L 5E0OA 1R3NA 3LDQA 4EZ9A 4FOEA 5A8RB 1LFPA 1MNEA 2JJ4D 2Q1LA 3ZSVA 4LD0A 5HRNA 4DJBA 2YXLA 1T95A 2QJ3A 3OJUA 4IG0A 3P3DA 1Z2LA 2QL5B 3UWTA 5AJ3F 4U95A 4OI1A 2PFUA 5HAOA 2F7TA 2W25A 1QAXA 3OSNA 2M88A 1C6VA 3A8YA 2AX1A 5B0CA 3M2UB 4NCGB 4C1NK 3LWMA 3TA1A 1SUQA 2EFOA 1CJKB 2RAQA 4P7TA 1Z25A 2XZTB 1XQSC 3MGJA 3OL9A 2EC0A 4K4WA 3Q24A 4RWXA 3RRGA 1GK8A 3D3BJ 3JTOA 4DQIA 2BOAA 1J27A 5KG6A 2NXNA 1V4TA 5LL6Z 1VBKA 3F9KA 3TJ8A 1N32F 1RBUA 1LWCA 3SYZA 3IRXB 4YEAA 4RW4B 2HHTA 2BR0A 2V4RA 4XK8C 3DLRA 4X4NA 4R8UB 5KFTA 1VJQA 5DDOC 2UUAJ 2ZBPA 3FUYA 2FJWA 2MZQA 3IDHA 4DSEA 4DSJA 2Z58B 4CLPA 2ALZA 3B4DA 1F9FA 1DT9A 3VGKA 3V4IA 1X4HA 2YBVA 5H9FK 2CGLA 1R8PA 1QQCA 1FDNA 3H5UA 4CJ5A 3P96A 1PAEX 4M3UA 4IRDA 3TSQA 2XZWA 2P2CB 5DETA 1FKOB 4MLEA 2V8HA 3LP1B 2ZZMA 2W42A 1TL5A 4WFZA 3V2UC 2XRIA 3BGFA 1XC3A 3OYEA 3Q23A 1EQMA 3CJSA 2QTDA 1A0OB 4FK2A 3T19A 4N8OA 2FC0A 3GG0A 3KWIA 4DFKA 1R0CB 1X5OA 4CIGA 2JX2A 3C14B 4QU6A 2XQCA 3SSRA 4H5TA 4DV5J 3CCES 4L6V3 4M1KA 5F2RA 2CZVC 5KFLA 5EVZA 2UZAA 4WXWA 1FO1A 1UVMA 1YT3A 4Y2MA 4ED6A 4HWIA 4W98A 1BO5O 5C25A 5GAHU 1SJRA 1IBMJ 3EVOA 2DKOB 4P6QA 4F2SA 4KBIA 2EFPA 4LF1A 2NRHA 4XH5A 4FPRA 5IZHA 3R8EA 4W5RA 1RHUB 3M7VA 1FE4A 3HFVA 3E3XA 3CJAA 4NXNK 4CLFA 3QEXA 3NCQA 1D9AA 4JKGB 2VG6B 3DI6A 1BIZA 1N48A 2P9CA 4IJNA 3MXIA 3MN9A 2WB4A 3MEEB 3PYDA 1HARA 2FHOB 4OVLA 3IWNC 2QXLA 4E0DA 2BUNA 5I3PA 4URSA 4CJLA 4DR3J 3PIPQ 2R8HA 2I6WA 3MN6A 3SXLA 4OV1A 1E4FT 3CG7A 2CIMA 3KHLA 3TOQA 3AARA 1WLJA 2VA3A 4DR1J 1R8HA 4Z7YA 4K59A 2UUAK 3QFWA 4R5PB 1UTAA 4YR0A 2HWIA 2OFHX 2DH9A 1HFEL 2HAIA 1SC6A 4FS1A 2L41A 1T02A 3C94A 1GT8A 2DIUA 2CPFA 2FJEB 4ED5A 2IY5B 1SKWA 4A8QA 2D0PA 4H0XB 5ETLA 1EQ0A 3S8SA 2CQ1A 2ZEJA 3HJFA 3QBCA 4ZJOA 3CPWR 4DHVA 2AGQA 3WXKA 4HCCA 4OIXA 5JVHL 2EC2A 2FSNA 4O23A 1SJ4P 2FY8A 1KQFB 4DR6J 1DAXA 4LVNP 3S01A 3MN7A 5F9LA 3G9CA 2V69A 3CCJN 2LA4A 3M1FA 3HVTA 5CA5A 1VQ5S 1TKZA 3KUHA 4JN4A 2QZ8A 7FD1A 4AQYF 3ITHA 1IBMK 4RNMA 3CCLS 3OT9A 4M5GA 2NYHA 3NL0A 2P1JA 4RBUA 3M32A 1VBXA 2B5JB 4ZVHA 2OA8A 1X4AA 2M9KA 3WNHA 1V9OA 1N5YA 1X9SA 2BV3A 4WFBQ 4M3ZA 4YOEA 1HWJA 4L72B 2FZKB 1S1VA 4PKGA 2OZSA 2WK4A 1DTQA 5FDLB 5KFWA 3THWB 2QW9A 2J6SA 1IWGA 5M1QA 3NAIA 3MCSA 4J9NA 2XI2A 5A0YB 3QEPA 1CC8A 2AWZA 2WTFA 4DR3K 3O5TB 2MLZA 5JVHQ 2X74A 2A42A 1F60B 1Q79A 4BY9C 2HBZB 4QWAA 3T5LA 4BG9A 5EY4A 2LQ9A 1WG1A 4DR1K 5KFDA 3G6EN 3U27A 1RU2A 4Y1DA 1X4GA 1Q53A 1UVLA 2WVDA 2AJQA 5KFUA 1HBOA 4WQ4A 3IBCB 3DRRB 3G4SS 1KFSA 5CCMA 2D69A 3GOIA 3DXSX 1N33K 4OYMA 1ITPA 5KPRA 3BF4A 1RT1B 5IWAJ 2MGZA 3DJCA 2QA1A 4DV1F 1XMQJ 2YQ1A 3MX2A 3LOUA 5CY4A 3RBDA 3FCWA 1FT8A 5HO4A 1NNEA 4JI5F 2VPYB 4RWTA 2O3DA 5F0XA 4DR6K 1T9YA 3KWGA 1S6PB 2UXBJ 7AT1B 3VGTA 3AH6A 1JWWA 3DRPA 4X64J 4IKAA 1OMSA 4CZGA 2Y1LB 2LVWA 4ECVA 2RH3A 3MXHP 5A8KB 1U1PA 4OZLA 2IJRA 5GAEU 1UL3A 3F56A 4FBTA 2QWNA 5KT2A 1VMBA 3LP2B 4E7JA 4WP9A 1D5AA 3H59A 2AKWB 2W2OP 2BKPA 5KFPA 3VERA 2ZFHA 2JDJA 2I7PA 4H4MB 1FERA 1L5UA 1RWKB 3BZKA 3FFIA 1U2RA 5E2QA 3N6LA 1NJYA 2C3MA 4Z37A 4LMZA 2FZCB 1XWLA 2DVIA 4OPKA 3W9HA 3MX5A 4F8RA 4G1IA 2HRYA 4CO5A 2CXEA 1CJVA 3MF5A 5EX5A 4KO0B 4CW7B 5EXWA 4KH6A 2LEAA 2VIHA 1CEZA 4F3MA 4V19S 1R8AA 4JB8B 4NCBA 1E3MA 4PL8A 2ATLA 4DSFA 4NLUA 3QT8A 4LQ9A 1HBUB 1YJRA 3OVBA 4LR7A 3QWUA 2KVIA 2YWGA 2Q66A 4O3SA 2OEJA 5AXLA 3I55N 2GEMA 1HQUB 1NJIO 1YJWN 2GV9A 1XMQK 1RWVB 3SQGB 2GMLA 4BDZA 3CC4S 1K9MO 3NBPB 1HQEB 2C2NA 2CPXA 5BPMA 3IR6B 1YLXA 5HBMA 3IC1A 4A8YA 4CLUA 1U1QA 2UXBK 2GHPA 3A8EA 1RB0A 3JYTA 2LKZA 3UDEA 4TY8A 3H6EA 4B9VA 1BGXT 5E33A 1W2IA 2RQMA 3G6XA 4F3TA 1NSQA 4KYZA 3S3OA 1VIXA 5CYJA 1WKJA 3GSDA 4K7QA 3HSCA 3M4XA 3WC0A 4KHNA 2B8PA 2C42A 3TRGA 5GINA 3CC2N 4AILC 3J7Z5 3O9QA 3QLHA 1RDWX 4DL7A 4ECRA 1FE0A 2OSRA 1YX2A 1WI8A 4B9NA 1XHXA 3NGYA 2VC0A 2VDHA 3KJFB 4RBVA 2B8QA 5HQLA 4LF7J 4WF9L 4NWBA 5HLFB 2CYYA 2W41A 3DGVA 4JAXA 2F5GA 3WX8A 1QAYA 4L3QA 3M5RA 3M2VB 2IFXA 4TQSA 5LMUJ 2FBYA 1S1XB 4NLRA 3M05A 4A2AA 2JFKA 3KTQA 3SUOA 4ZP6A 2KW4A 1JLAA 4J9KA 5HL7Q 1KN6A 2MZTA 3PR5B 1PGZA 4DHYA 2ZGZA 3MECB 4YOYA 3VF2A 1WOSA 2WHOA 2Y9HA 2V6AA 3BDEA 2BDPA 3C15A 4JLHA 4FJ9A 5C12A 3WNFA 1DQ8A 4G1QA 2K7KA 3THXB 2BE7D 5L1IA 3MD1A 1TELA 5HMZA 3BBCA 5BN9A 3CCUN 2V8DA 2F4VJ 1JLQB 1WWHA 4FM0A 2H65B 1JLCB 3QEVA 5LMNJ 2I0XA 2P51A 1FWLA 1R27B 3L7PA 5EHHA 4BR0A 4NA1A 3DWLA 1VSEA 2VYPA 2A6AA 2MB0B 2NPFA 2FGCA 1FDAA 5KGXA 5B0BA 4NXNF 4B3OA 4MLHA 1YRXA 5F8NA 2G0JA 3CJBA 1JJ2R 2ZZNA 3OR2A 4ZP9A 3W9IA 3KHGA 3BPDA 3LP3A 4CBUA 4J9SA 3Q8PB 4K8XA 5F8HA 2H5JB 2GV1A 5J2QB 2ZKTA 2ZF5O 2HQ3A 4J9PA 2DRDA 2D0CA 4OLAA 3SEOA 1YI2S 3CDBA 2HGNA 2KDOA 2FPHX 2QYCA 1MLAA 5ETSA 4DR5F 4Q2MA 1PSDA 4MKVA 1KBRA 1M1KO 4FJHA 5KG4A 1EWQA 5AQGA 3GLJA 3EL2A 2KG0A 5LM7E 2E1MC 2IJFA 1RE1B 1F5AA 3CYMA 5D15A 4K4TA 2R3VA 1T94A 4PAAA 4N47A 4OPHA 1LWFB 3I6PA 2VV5A 4RUHA 1WSJA 3MFIA 2HGMA 2OPRB 5BRFA 1C1BA 3KJVB 4FJKA 1BL3A 5MLCV 1HRHA 4AF1A 5DG8A 3UE5A 4CZCA 4I67A 2DHAA 2VASA 2O8EA 3J7YI 1RUSA 4PCQA 1BCOA 3LDLA 4AHRA 3C95A 3DU5A 3EGVA 4FPAA 3KK3B 3U8XA 3ET6A 2AIRB 4UT4A 2F4VK 4GC6A 4IOAL 2BW2A 3WDOA 3MOJB 5DM6L 4OMFG 3GIMA 4LQ3A 4ZS6A 4E8UA 3FGUA 3ZX3A 3CJ8A 3C3LA 3KLFB 1X60A 2A2DA 5AQJA 3HT3A 1S77D 5KFVA 2VH7A 3FBEA 5AE1A 5HQ8A 3HI0A 3AO4A 2KH9A 3GSIA 2HS3A 1CSJA 5ADZA 3TI0A 1WSFA 2XSJA 3MDFA 3H25A 2LQ8A 2AJ4A 5AXKA 3IWXA 5EUHA 8AT1B 2OPSA 3PDNA 3OXLA 2PMWA 1HNIB 3WX4A 3CO9A 2YKMB 5DJBA 2A1SA 3PHTA 1R0AB 3CCEN 1X0FA 1IKYB 1JXEA 2A18A 2FJAB 4ZDNA 4DUTA 3RB3A 1KQSM 1JJ4A 4LF8J 3ZZTA 3ZSXA 1VQON 1WF1A 5IXUA 1G3OA 5LSOA 3N0VA 4MDBA 2NSCA 1S22A 4JD2A 2CQ0A 1W9HA 4IKFA 2ZH8A 4IFYB 5IM0A 3P38A 3DOKB 4C3MA 1IKVA 1JL2A 4PG8A 1N33F 3IUCA 1IR1A 4PRFA 3LZIA 1QTNB 3TUJC 2DIVA 2OKQA 2KXNB 3KUGA 3LP0A 1S0VA 1WB9A 3DLKA 4ZITA 2OI2A 4EYHB 4O3QA 1S0MA 1RJJA 4CYUA 2DNMA 5EN1A 2FJVA 1RAJA 1BI4A 4QBUA 4JI4F 3FJ2A 3CD5A 2HFNA 1S4FA 1L3UA 1TAUA 3KLVA 3MCNA 3D0PA 3OYBA 3G8QA 4WKRA 1RFQA 4LBPA 1CJUA 3B6BA 2H9ZA 2BW7A 1EARA 1MMNA 3OYCA 4HVJA 4LSNA 3AVMA 5KQDA 3O8MA 5EU7A 1G2EA 1Y64A 3ALYA 2GC8A 3AHPA 2D4WA 2D1KA 4JK7A 2RU9A 1OS5A 1P1TA 4QS7A 5TKYA 3WIVA 1MMDA 4CGDA 1HYSB 3IMQJ 2ZZTA 1H73A 4YOVA 4K8RA 5DRKA 2X1FA 4RW6B 2PEBA 3IO1A 3QFUA 2G0CA 4CO2A 1NK9A 2DGWA 4GMKA 4TLRA 3MUMP 1HKAA 4WU2A 2X6NA 3NWRA 4DL5A 2HPUA 5CYMA 1J5OB 2VKZG 4LFBK 2CDRB 3EZOA 2LECA 2W4CA 2PO4A 4TKTA 2DXFA 2V5HG 3MEDB 5K8MA 3SI8A 3CCLN 5BYRA 2BM1A 1JJCB 4OZ0A 1FFSB 3A5MC 2QLXA 4Q2LA 5GMEA 4O55A 1S1TB 1U24A 1QVFM 3H2UB 2KRBA 3QB0A 1RT6B 4KHUA 4PWDB 2KRRA 3JXOA 3W8PA 1UAWA 4IEEA 4LF5J 4LH4A 1CZBA 3W62A 4CIFA 1R8CA 1NH7A 1HWUA 3ZTOA 2G8FA 4B1VA 2ZQBA 1YG0A 4RJVA 4B1WB 5BPLA 3PX4A 2VOOA 4Z2XA 5GAHI 1RYRA 1Q16B 2Y0BB 3IFEA 3OYKA 3L2QA 3ISND 3GB0A 3BEGB 3MMAB 2XLIA 4JKEA 1RAEB 2ZD1A 4FZVA 2XLKA 3H2LA 3GU0A 1F0XA 2UYTA 1ELOA 5GAGI 2GGPA 2AEFA 2WAQD 5G0RB 4I6MB 1TMMA 2HURA 2IM0A 4X65F 3D5MA 3TTDA 2HNDB 4R0JA 2XWXA 4KHRA 1VDHA 4UUWA 3ETOA 4U7BA 2H4YB 3GTYX 2DPIA 2AZ3A 1OPIA 4EMDA 4FOIA 3ULEA 2LQJA 1FNMA 3G25A 4QW9A 1B70B 3AO3A 3ZEUB 3D28A 4C97A 3ZT0A 4HT7A 3I56S 5J2PA 2WRMA 3JS9A 5ITHA 1RGIA 5F8LA 1LV5A 1L3KA 5HRSA 2GJ2A 2HHWA 4DR2J 3V9WA 3UO0A 1LXJA 4YHHJ 3RUBL 3IG1A 3WNEA 3QGIA 5BR8J 1VC5A 1R6YA 3LTOA 4CGJA 1M5HA 1X5TA 4P71A 2DH8A 2VQFF 2IBKA 4RW9A 3K58A 1PC4A 2IDOA 2O8FA 2OMLA 1KQGB 4P10A 1GX6A 4ZP8A 3IMXA 3NOGA 1R31A 2R42A 1NGHA 5KFEA 3SZ2A 4KHQA 1ZA1B 3Q8QB 2GHWA 4ZLJA 4N76A 4C23A 4LF5K 5KFIA 4FCYA 2RF2A 1G99A 3B8HA 3WQPA 2F8EX 1JX4A 2X1BA 3VVUA 3P1GA 3UVJA 2M0GB 3WQUA 1P1LA 3H42A 2I5JA 4BS2A 3VTHA 2HFOA 3LDOA 3SMPA 1FJGK 6AT1B 5I9EB 1B92A 3KJQB 4XH4A 4ID5A 4FWQA 1C4AA 4CEOA 5KFRA 5A8WB 4M42A 4USJC 2KN4A 1K8AT 1Y5NB 2CADA 2F8TA 1BE4A 3VQDA 1Q9YA 4BR7A 1DTTB 1HHSA 2YHYA 4DMZA 4FYXB 2GWKA 3NGTA 1T9UA 3MMCA 1S10A 3D2EA 4B9UA 2OELA 4WIIA 3ZO7A 3X1LB 2KHCA 5BRHA 1FRIA 1RWNB 1RT4A 2NXJA 4CZHA 1NB2A 4C2MA 4AHUA 1VQMS 4OI2A 5M2RA 9ATCB 4DR2K 2L3MA 4YHHK 2EBEA 2KHOA 1UFKA 3ZT1A 2FJBB 3EZ5A 4EBDA 5BR8K 3LM9A 1XNRJ 1YVNA 2XO7A 3QFHA 5GMDA 4HTIA 4X4SA 3CQXA 1A9NB 2WC9A 1IH7A 3HKWA 1HPZB 2VJUA 4DU1A 4DN9A 3DXKA 4C8MA 1VLOA 3LL3A 1UCNA 3W7BA 1EX8A 1SI9A 1X4FA 3L3CA 1HJRA 2EFQA 2D41A 3DLLL 5IQQA 1LW0B 4FPIA 2FHJD 1EETB 3KZBA 1K8KB 1JLFB 2VONA 1KVAA 2MYFA 1Q8BA 1RBLA 4BE0A 3AD9C 2CJQA 1N56A 3GYXB 2BJDA 3CCSS 3D1HA 2JOQA 3V6KA 4CHNA 5GAEI 1HD0A 2GTDA 2WTUA 4YDUA 4IH7A 1X4EA 3KNGA 4ECTA 2I7NA 4OI6A 2RE2A 3KHRA 3MPDA 1GNKA 2Y1RI 2QRRA 5KAKA 2RVJA 1F9HA 3L95X 3O08A 5IS2A 3VTIA 1FF2A 4U67L 3VOVA 3U6FA 2PIIA 2E1ZA 2HBMA 1TZ0A 4AHTA 4UUXA 1HBMB 3BYPA 3I96A 5K20B 3R3LA 4FK0A 4U8VA 3QICA 5ETRA 2VZ9A 2RRBA 2ZJRL 3I4HX 4E1NA 3AFGA 2JVRA 3P31A 3DLLQ 1Z26A 1NMNA 2Y1JA 3Q8SB 2HMIA 2P9LA 1B9FA 1ZOTA 3PY8A 1OH5A 2PA3A 2HYIB 5KPZA 4OYPA 1MWMA 3P6YC 2XTJP 2H4WB 2A41A 3GG4A 3UD3P 3D7SB 5L46A 4CEZA 3ZZOA 2P9SB 4CTAB 4I68A 5A8RA 2PYJA 3PVXA 1FEHA 1RQ0A 2NXUA 5KRTA 1F1BB 3A3PB 1JCEA 4BRFA 1YJ9N 2BANB 2E44A 1GOAA 1TL3B 4ZPWR 1O1WA 4OHWA 1ZAWA 4AXIA 3EGZA 2Q43A 3V81B 2MKYA 3EO3A 3VEWA 1PYSB 3C19A 3GYGA 4NCGA 3M2UA 4ZIWA 1CJTB 2HQFA 1KRPA 2CQHA 2ZJRQ 1CJKA 3S1TA 1D1UA 2Z2MA 4TSXA 1K1SA 1URRA 1ZZNA 1KVKA 1FDBA 1BA1A 1L3SA 3VQCA 2DTUA 2J4RA 1VQKS 2WVBA 4NLYA 4BHQA 2W7OA 2ZHAA 3IRXA 3FZKA 4RW4A 2V50A 5AE2A 1LOTB 4JRPA 2OCEA 1XMOK 1WSVA 4R8UA 1NJZA 4PEOA 3CJ0A 4PWWA 1HUXA 4I7FB 2OTJS 2VGMA 3HDSA 4JI8J 4GW6A 1A5XA 3KK2B 4M5LA 3OV7A 4AM7A 4JYAJ 2M52A 4IDKB 5KFGA 1RT7B 3GCWP 2DGUA 2GX9A 1FKOA 4LFBF 5C2DA 2P5GA 4KRFA 4Q43A 4KH4A 3LP1A 2WVCA 3KKFA 2RMLA 1HYZA 4JI6J 1WEXA 1RT3B 3EEQA 3IRWP 4KSEB 4IXCA 4FXWA 2RPIA 4OLPA 3BR8A 4LF9F 2UXDJ 3C14A 1YXQA 1MG7A 2W9CB 3FGVA 2FYXA 5T7LB 4Z4IA 3K57A 1Z1ZA 3L8BA 2E1CA 2HF4A 1MWQA 4KFBB 5DQIA 2CQCA 3HOSA 3MTJA 1U8WA 1T7PA 4W5QA 3TVYA 1NM2A 2QE5A 4FZXC 2QEXS 2IPOB 3OYIA 3GR1A 2QLJB 5I42B 3Q8RB 4ED7A 2FVQA 4QPXA 2UUCF 3QESA 1VQ6S 1BQXA 4JKGA 2VG6A 1FJ7A 3AV9A 4ES2A 1SH0A 1U1RA 4OV6A 4K4SA 4W90B 2HGLA 2OLWA 4HTLA 2MZJA 1SKUB 1C0UB 3J8AA 5BN8A 4WFNL 1GLEG 1FTRA 3MXJA 3V5RA 1VQ4S 3Q8YA 4KHSA 3H5SA 3GBTA 2W01A 4YB6A 4LR8A 4C8LA 5FPMA 1N0UA 3MM7B 5L1KA 2OPQB 2VPWB 3IA0A 2PDAA 1KAZA 4X66J 1U1KA 1NWKA 2RHSB 1Y3KA 4JI1K 5GIOA 4DV4F 3C8YA 1HWIA 3VEZA 2D0AA 1YITS 2Q31A 4JI8K 2R7OA 3HHNB 3AVJA 3BP8A 4DR7J