2YKNA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPLLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 163
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yknA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yknA05
2ZD1A 4KREA 4K4TA 4NLUA 4E1MA 4I2QB 1VK0A 3NBPA 4M3XA 2WOMB 4KFBA 4DEZA 3SFGA 3FFIA 1RA6A 3G6YA 3AVLA 4FBUA 2HNDB 2BE2B 2QV6A 4FM1A 4DTUA 2VG7A 2R2TA 1VSHA 2X74A 2IS3A 1RT2A 2DPJA 5FRNA 1C6VA 3JYTA 4WYLA 3L3VA 2XI2A 3PVXA 3DLGB 3SFUA 4ZPDA 5KFTA 5FROA 1NNDA 2R2UA 4ECSA 2YNHB 4CERA 2O4GA 2IAJA 2W42A 1NK7A 3CFPA 1DTQA 4RUCA 3KHLA 1KTQA 4CK2A 5KFGA 5I42B 5KFEA 3Q8QB 3T5JA 2E9ZA 4B8CA 4G1QB 3BREA 3VA3A 1IKYA 4U6PA 1NJYA 1L3UA 4DFKA 4TYAA 4QPXA 2XY6A 1VSEA 4J2AA 2A1RA 1T05B 5F9NA 4KV8A 3HP9A 2UVVA 4FLVA 1SKRA 1X9WA 2XCPA 4LH4A 4KO0A 1CZ9A 1ASWA 4R5PA 3PO5A 4QWEA 3H08A 3ZSQA 1KHWA 3THVA 4IQXA 3QEIA 4DF8A 3KLFB 4M94A 4DL7A 5T14A 4M3YA 3I0SA 1MU2A 3OLBA 1FKPB 5KT6A 4FXDA 3BQ1A 3V6KA 3V4IA 2R8KA 5L1JA 3EPIA 1W0HA 3ZT2A 4EZ9A 4I7FA 4GC6A 2HNYB 1SH2A 3QESA 4NLVA 2Z1IA 5KFBA 1HYSA 3OHAA 3MXIA 4W5OA 2V4QA 3E01B 4K8ZA 4AHTA 3HVTB 3QZ8A 5C42A 4ELTA 5FDLB 3U3YA 3DRRA 3T1AA 1TKXA 3H5YA 2RKIA 2GIRA 3K5OA 3DLBA 4FJ9A 1LAWA 4CEEA 4HHTA 1RTIA 1Q9YA 1FK9A 2IMWP 4CGFA 3L2UA 3UIQA 1RT4A 3V81A 3V1RA 5EU7A 4RG8A 1IKVA 1D9FA 3L2QA 1EETA 2KW4A 4CJRA 2VWJA 1X9SA 4CEDA 4KTWA 3WNFA 5F9LA 4FLTA 1LW0B 4CECA 4LQ3A 3CDEA 3IG1B 1W9HA 1S9FA 4CF1A 4KB0A 4J9KA 4OJRA 2HW3A 3OYGA 3I0RA 3LAMA 1TVRB 5KT2A 3NDKA 2C2RA 3SQ0A 1VSKA 1SH0A 4ZHRB 4MKBA 4J2BA 4J9PA 3ZT4A 1BCOA 4M3UA 3RMCA 1RCHA 3ZT1A 3M9MB 1TV6B 4CGDA 4FLZA 3VQ9A 4CHOA 3M8PB 4IG0B 1KLMA 1S0MA 4DTOA 1BHLA 3QEVA 1HPZA 4IH7A 4RNMA 3MFHA 5CYMB 4NLTA 2VA2A 1GOCA 3OSPA 4CESA 2WONA 4OPJA 4O0IA 3B6OA 3PUFA 4DTRA 3CJ4A 4I2PA 1WNEA 1RT5B 1U4BA 1J9AA 4ED1A 1JLEA 2KZMA 4Q44A 4DS5A 2HHWA 1N4LA 2OPQA 3E51A 2JEIA 1U09A 2FC0A 4ZVEA 4FM0A 4KI4A 2X6SA 5KFHA 5HLFA 1TGOA 2FVRA 1WNSA 5KFWA 4NLOA 4CJWA 3HPGA 2HNDA 2BE2A 3NCIA 3AVBA 3L2WA 2V0NA 3VQCA 3QNNA 3G6XA 2FVPA 3NF9A 4XIUA 2X6NA 5F8LA 4DLGA 2HVHA 2JEJA 3FQLA 3H98A 1RT3A 4JV1A 3QIOA 4QWAA 3G86A 3KTQA 2AX1A 4BE0A 4F8RA 1JLCB 3RRHA 3DOKB 1U49A 3OSNA 2YNGA 3HJFA 4OVLA 1HQEB 1LV5A 1IKXA 3K2PA 1B9FA 4PUOB 4G1QA 1EKEA 4ECZA 3ALYA 4DG1B 3V6DB 4OLAA 4FJGA 2CKWA 4DTJA 2HMIB 3SQ2A 3TVKA 1T05A 5DQHA 3B6PA 1EX4A 5CYQA 2W8KA 4ECQA 2IOCA 3OYHA 4QWDA 2D0AA 4TY8A 4ECRA 3CJ3A 4FBTA 4K4VA 3QO9B 4E3SA 1QSLA 3KLGB 3TR8A 4B9SA 4YNQA 4QW8A 1S1WB 4O3PA 1D8YA 2ZE2B 5KFNA 4C8KA 1QAIA 3V1QA 3K5LA 1S1TA 2D0CA 4ID5B 1Y97A 3HXMA 4HTUA 1NK8A 4YR2A 1LWFA 2R2RA 1NOYA 3VQDA 3ZT3A 5KGXA 4G3IA 4C8LA 1B9DA 1BISA 3FSIA 3RR8A 1C0TB 3OYKA 2HHUA 5DG7A 2FBTA 1T7PA 4M3RA 5KG1A 4R0EA 2KTQA 3NAEA 3SI6A 4DQIA 1TK5A 4NLDA 1J53A 1DLOA 5K14A 3HVTA 5EWFA 4OGCA 3AO1A 1VRUB 3OL9A 4ECUA 3VQBA 1HMVA 3H4DA 4LD0A 4CIEA 3HM9A 2DFEA 3VQPA 5J2QB 4FJKA 4R8UA 4IFVB 1CXUA 3O3FA 3VN5A 3HP6A 1UWBB 4FJ5A 3H59A 2OYQA 3MR5A 1TK8A 1BQNA 1TKTB 1EXQA 4JV0A 4BDPA 2I5JA 3P83D 4DSKA 4QW9A 3RMAA 3MECB 2R8GA 3IG1A 4E7KA 4EYHB 1NHVA 5F8IA 1XC9A 3RMBA 5HBMA 4KPYA 3A2FA 1Q8IA 3KLEA 3M9NB 4DTPA 5KT4A 1RAJA 2YNFB 3DDKA 3NL0A 1HNIB 1JLFB 3L8BA 4M3TA 1JLGB 1RDBA 2F8TA 3QERA 1GX6A 1YTUA 1W25A 4KHYA 2D7SA 4E7HA 3IGNA 1T03B 1FXXA 4RW9B 4Z4HA 5KTQA 2V4RA 4IR1A 4CF9A 1NKEA 3QZ7A 3DI6B 2HHQA 4NYZA 4Z4IA 4DSLA 1LWCB 2YKNA 1N6QB 3BR9A 3TAFA 4F4WA 2AGOA 3HVAA 2B6AA 1NJXA 4MKAA 4Y1DA 1RTHA 1ZBUA 5EUHA 3PZPA 4F3TA 1JLQA 5HRNA 1T3NA 4FK2A 2YKMB 5KFPA 1N56A 5EDWA 2VG6B 5KFFA 4RW8B 4FS1A 1NJWA 4IFYA 4B3OB 3VQ8A 4BWJA 4CHQA 2WHOA 3BSAA 4EBCA 3LP2B 2W9CA 1C2PA 3ZSOA 3IAYA 4KAIA 2G8UA 3Q8PB 1Z4UA 3HYFA 2VG5B 2WB4A 4H4MB 3DRSA 1HJRA 2PYJA 3PW0A 4ED3A 1ZYQA 2PYLA 4ZP9A 3S3MA 2E9RX 2O5DA 1U04A 3VQSA 3UPFA 4E19A 3DYAA 1RBUA 1C1BB 1REVB 1LWEB 1JL1A 3QEWA 4ID1A 1JLCA 3ASMA 3CYMA 2AGQA 4CEZA 3QLHA 4HYKA 1TAQA 1BGXT 3OJUA 4DG1A 2OPSA 3NKYA 2ATLA 1T8EA 3TAEA 4CJ5A 3KLVA 4N56A 4CEBA 4ZTJA 4HKQA 4O44B 4NCGB 3MR2A 1C1CB 3CIZA 4H4OB 2OPRB 3KJVB 3AV9A 2BRKA 4RZRA 1KVCA 4B8AB 3KHRA 3AO3A 4DL2A 1S1WA 3PR5B 1BQMA 4URQU 1CLQA 3DMJA 3OL7A 3MAQA 2UVUA 1X1PA 4CJPA 1S0OA 4RW7B 2DTUA 1I3AA 4TN2A 3QGIA 3TABA 4CFDA 2DFHA 1JLAA 4YQWA 4CJUA 1RBTA 1QAJA 1S9GA 3CJ2A 5J2PB 2G8HA 3DLEA 5L1KA 4RNOA 3DRPB 4JRQA 2G8FA 3GYNA 1S6QB 4OKJA 2ASJA 1Q9XA 4UQGA 1WSIA 1TL3B 2FVQA 1VRUA 3M8QB 5F8MA 4TQRA 4FCYA 4DU4A 5J2QA 5D3GA 5KG0A 4J9NA 4RW6A 1KLNA 4CFBA 4LQ9A 3OYMA 4J9MA 5KG3A 5CY4A 2Y1JA 4IG3A 5KFUA 4YR3A 1SKSA 2G8KA 3VQ5A 3V1OA 1HNVB 2IM1A 5HROA 4MH8A 2RDIA 3Q8SB 4WFYA 4EBDA 1XR5A 5HRRA 2AU0A 2G8IA 4ICLB 1D0EA 3WNHA 3OYEA 4B9NA 3TARA 3LWMA 4CFAA 3O3HA 1YVUA 2IM0A 3D5MA 4KB1A 3HO1A 2EHGA 5KFRA 1QE1A 5DLGA 1RILA 1VRTA 1D1UA 4E1NA 3CFOA 3HVRA 1JLFA 4J9OA 1NK6A 3KMSA 3CQ8A 3RB3A 5KFZA 4CJSA 1RT1A 1U47A 4LSNB 4URGA 4DU1A 3SPYA 4DL6A 1IG9A 2KZZA 4KKOA 1FKOA 1LAVA 5C5JA 3H2LA 5DG8A 3DI6A 4CJ3A 3CG7A 4CF2A 2IJNA 4QWCA 5J2MB 1N6QA 3SZ2A 1DTTB 1F21A 5KFCA 2HHTA 4FLUA 2IJFA 3PW5A 3PY8A 4RW4A 3T5LA 4C8MA 3DM2A 3OJSA 3KIOA 1S1XB 3QEPA 3CVKA 4K4SA 1J54A 4C8OA 4JS4A 4Y2CA 4M42A 4RW8A 1S9EB 4B3OA 4OGEA 1KCFA 5HRPA 1JLBB 3VQEA 3LP2A 3N6MA 1RDRA 4MK8A 4DL5A 1WSHA 1L5UA 4E7LA 3QETA 1N5YB 3WNEA 1MMLA 3G6VA 1I39A 2C2EA 2VG5A 4CHZA 3V9ZA 4WFZA 4EYIB 1TKZA 1VSIA 1SL1A 3NFAA 2IC3A 1RTJA 5J2NB 3QYYA 3UDLA 4ZPAA 1VSLA 2E9TA 2JC0A 3MTKA 3TAMB 3AO2A 3OY9A 4KHSA 2QKBA 4NLRA 1JIHA 5KRTA 1RBRA 3ISND 2HNZA 1C1BA 1REVA 4KE5A 4RNHA 2ATQA 2Z1JA 4NRTA 3V9XA 1JX4A 4DFJA 2HVIA 3G0ZA 1ITGA 3QIPA 2RDJA 3LP1B 1RT7A 5HRSA 1CSJA 5KFJA 5E41A 4FK4A 3SUPA 4ED0A 3LP0B 5DMRA 3VQQA 4ECYA 3OYLA 5HP1A 4O44A 4FZZA 4IRDA 1SV5A 4KBIA 2W7PA 5F8HA 2J6SA 5CZ2A 5J1EB 3K5NA 4WE1B 2C22A 4URSA 5JS1A 2ITGA 2BANB 2XO7A 3RRGA 4NRUA 4F2RA 1WAFA 1NK9A 4ZP7A 4IDKA 3Q8RB 4Q5VA 3KLIA 4CF8A 4RW7A 3BGRA 3G10A 2DPIA 3LP3A 4CJFA 1QQCA 4FLXA 4FJ7A 4ZVGA 4O0JA 3KKSA 1BIZA 1VSJA 2IGIA 3C6UB 3KK3B 3MEEA 2HWHA 3MXMA 3SCXA 3KLHA 4WZQA 3TQ1A 2AX0A 2Z1GA 3U3GA 3I5BA 3HPOA 1JXBA 1IH7A 4B08A 3C6TB 4I2QA 3SUOA 2WOMA 4CGJA 5I3UB 4HUFA 5KG6A 3KKRA 2Y1IA 4YP3A 1WSEA 4B9TA 2RF2B 4CJLA 3M8SA 3VQ7A 1YVFA 1S48A 4LSLB 3I5CA 4NCAA 4W5NA 4J9QA 1XR6A 4NLGA 3V9SA 2WRMA 5KFOA 4MFBB 2AJQA 5KFDA 1GOBA 1S1UB 5L1IA 3QEXA 3CDWA 1EP4B 4FJNA 1QSYA 3DLGA 3H5UA 4FZXC 2P51A 2BQUA 2YNHA 3VQAA 1TL1B 1HNVA 4FS2A 2UVWA 1T94A 3OYJA 5DGAA 1OS5A 5I42A 1Z26A 4FW1A 4GW6A 4QCLA 5KFVA 4F3OA 3T19A 4DFPA 3DLKB 4OL8A 4WYWA 5L9XA 3MR3A 5SZTA 3RBEA 2D5RA 1IM4A 2JEGA 1SUQB 3QNOA 2W9BB 4JLHA 3NAIA 5FRMA 1X9MA 1BI4B 3FRZA 4TY9A 3RR7A 1C0MA 2R8IA 5JXSA 2XHBA 3IRXB 1R0AB 4FW2A 2F8SA 2FVSA 2HHXA 3KLFA 4KHMA 4MK9A 4CHNA 5J2MA 3RTVA 4KHNA 1JXLA 3L2VA 3GIIA 1FKPA 3DOLB 3PJXA 2WTFA 4Q0BB 5L1LA 1WSGA 2JLEA 4LY7A 2HNYA 1JKHB 1HRHA 1VSDA 4TYBA 3BQ0A 1JLBA 4O3SA 3E01A 3I5AA 4ECVA 4N47A 4ECTA 2FJXA 1RT6B 5FDLA 2XRIA 4EO6A 5C24B 4O4GB 3OHBA 2CJQA 1BIUA 4K4YA 3HSTB 3ZSYA 3OS0A 3AO5A 4H54A 4Q8EA 4KFBB 1RYSA 4Q8FA 4B9UA 1RBVA 2FBYA 3S9HA 1LW0A 4O4RA 3GV8B 2VG7B 3GIMA 4CJEA 3ZCMA 3LAKA 2ALZA 3PW2A 4CIGA 4J2DA 4KSEB 4O3RA 5F8NA 4EBEA 1TVRA 1S0NA 4BDYA 2IAJB 2C28A 3VA0A 2B43A 4K50A 1C0UB 4ZHRA 1DTQB 5KFSA 4J9SA 3L3UA 3I8DA 4PA1A 2OZMA 1TV6A 4DQQA 2ETJA 2R7YA 3M8PA 4IG0A 2QXFA 4GVMA 5SWMA 3V9UA 1HQUB 4NLQA 3O3GA 4HUEA 1K1QA 5J1EA 3RB0A 3OYBA 3P5JA 4C8NA 4DQRA 4WE1A 1WAJA 4KV8B 4WZMA 3OS1A 5C25B 5CYMA 4AHVA 3AVCA 1S1VB 1G15A 3TWHA 4KB7A 4ZPCA 4KO0B 2IA6A 4ED2A 4E7IA 4R5PB 3ZSWA 4JUZA 4ZP8A 4FK0A 2FLNA 1RT5A 1XWLA 4O3OA 3CM5A 4JS5A 1XR7A 3GV7B 2P5OA 4FJMA 3LALA 4AH9A 3C6TA 3V4IB 5DQIA 1KFDA 4ED6A 2IM2A 1A5WA 4I7FB 4H8KA 4DTMA 3SNNA 2YNIB 4Z4GA 5DG9A 4EO8A 2JGUA 3PX4A 1U45A 2FBXA 1ZETA 3KNAA 3HVWA 2HWIA 4WXOA 4E89A 3OYNA 1S1UA 1ASVA 1EP4A 2D0BA 3CFRA 3DRRB 3CWJA 1TKXB 4F4YA 3AA5X 3OYIA 3NHGA 2RKIB 2G8VA 4QWBA 3O4NA 3VQ4A 3SI8A 3EZ5A 1RTIB 1TKDA 3UR0A 1BL3A 1NK4A 1QTMA 3AO4A 4FJLA 3DOKA 3V81B 1HQEA 4PUOA 1IKVB 1RBSA 1EETB 3S3OA 3V6DA 4EP4A 4B9VA 3DLRA 1IKWB 4HCCA 5KI6A 4IH5A 2HMIA 5KG4A 4FJIA 1YT3A 3WNGA 2BR0A 3K58A 3N6NA 2BDPA 2W9BA 3ICLA 2XGQA 1SH3A 2KFNA 1RNHA 3QO9A 1BI4A 1SL0A 3KD1E 2BQRA 1WSFA 3AVJA 3KLGA 4DSJA 3V9WA 4TQSA 3ZSZA 3ZSRA 3SV4A 1QS4A 2ZE2A 4EEYA 3GIJA 1KLMB 4ID5A 3NE6A 4NZ0A 3DOLA 4NCBA 1HPZB 4Q0BA 5KFAA 4J9LA 3C94A 1C0TA 1JKHA 1S97A 2XY8A 3HL8A 3PW7A 4FJ8A 4YR0A 4NLSA 1SKWA 3U6FA 4TXSA 3C95A 3KOAA 1SL2A 2KQ2A 5KFQA 1WN7A 5KT3A 1KRPA 3OL6A 1JLEB 3UQSA 2OPQB 2W8LA 1S4FA 2QE5A 4IFVA 4CIFA 3AVFA 1UWBA 4CK1A 4K4XA 3RAXA 5DK5A 4DSFA 4CGHA 5HLFB 3SJJA 2A1SA 3K59A 3NF7A 1KVAA 4DLEA 1WSJA 1A5XA 1TKTA 3AA2A 3MEDB 2GC8A 2QK9A 3MECA 3NF6A 2WK4A 3ULDA 4DTSA 4KI6A 3SPZA 2UUTA 1LW2B 3ZSXA 1RT3B 5T7BA 4CEQA 3PR4A 2Q3SA 2DY4A 1C0UA 2D3ZA 1ZBFA 2YNFA 2IBKA 4RNFA 1HNIA 2YNGB 1IKXB 1JLGA 1YTAA 1XHXA 4PY5A 4M3WA 3FQKA 1T03A 4ED8A 1UAXA 2IM3A 3NH1A 4F2SA 1HQUA 2D41A 4RW9A 4K4UA 4JV2A 4W5RA 4M3ZA 1NKCA 4Y2AA 4HCBA 3EYZA 4DS4A 3KK1B 5C25A 4M95A 5CYQB 4PQUB 4I9QA 3HK2A 2E6MA 1S1VA 4IH6A 1ASUA 1LWCA 4NLPA 4TY8B 4AHSA 4HUGA 2Z1HA 5JS2A 4F4ZA 1RTDB 2OZSA 3TI0A 1L3TA 2VWKA 4MIBA 2YKMA 3T3FA 5KFXA 2VG6A 2IDOA 4Y3CA 3GIKA 4EP5A 4ZMMA 2GV9A 4W5QA 2R8JA 1S1TB 2WCXA 4CJ4A 3BSCA 4DFMA 3RB4A 2OPPB 4IRKA 1LWFB 2RN2A 4O3QA 4K4WA 3TAGA 3SUNA 2OH2A 3H40A 3OLAA 4CFCA 1NKBA 3AVMA 3MXJA 5F8GA 2YNIA 3RBDA 4H4MA 2ILYA 2GUIA 4FYDA 4OKEA 1K6YA 4ZVFA 4Q43A 1RYRA 2GBZA 1DLOB 3PX6A 5K14B 3KHHA 1HMVB 4Z0UA 3T5KA 3RWUA 5KFLA 3JSMB 3NGDA 4CF0A 4R8UB 5F8JA 3RMDA 1QSSA 4DU3A 4F4KA 1LWEA 4N76A 4QAGA 3IS9B 4KHRA 1BQNB 2BQ3A 3OYAA 3OS2A 3BJYA 2PY5A 3NH0A 2UUWA 1D9DA 1HYZA 4FM2A 2I5JB 3H5XA 3K5MA 4Y1CA 1IKWA 4XPCA 3N6LA 1QHTA 1C1AA 3BDPA 3CM6A 3NAHA 3AVNA 1S10A 4LH5A 4NCGA 1C1CA 3AA3A 4H4OA 5HBMB 2OPRA 3KJVA 3LZIA 1S6PB 4XPEA 5KRSA 3KLEB 4WXWA 2OA8A 2D3UA 1TK0A 4BE2A 2P5GA 1XHZA 4I9LA 1D5AA 3NMAA 2C2DA 5KFMA 2XY5A 4L8RB 4Q45A 2AQ4A 3QGGA 3S3NA 5DLFA 4NLYA 4DQPA 2ASLA 4CHPA 2HHVA 2V9WA 3SQ4A 1UA0A 1CZBA 4QOZB 4CJQA 3TAQA 3NGIA 4RUAA 2B5JB 1NK5A 3HPHA 4BWMA 1TP7A 1NK0A 5J2PA 2YKNB 3ITHB 1VSFA 2B6AB 4EZ6A 3DRPA 1RTHB 3QINA 5KFYA 4RU9A 4CK3A 1JLQB 4OKKA 1S6QA 2HB5A 2VA3A 2YHBA 1TL3A 4DSIA 4RNNA 3M8QA 4IFYB 1S5JA 2XWYA 4TSXA 1GOAA 4OPKA 2W9CB 2JC1A 4IRCA 4J2EA 4FJHA 4FZYA 4MQ3A 3VQ6A 4BDZA 4YFUA 3NGZA 4ECXA 3ZT0A 2XC9A 3DRSB 3MEDA 3MR6A 4ED7A 2G8WA 1NOZA 3HKWA 2EC0A 2X78A 4DL3A 1UA1A 1I6JA 1UOCA 4ICLA 1BCMA 2FLPA 3MEGB 1WLJA 1LW2A 3ISNC 3OYDA 3TANA 3DYAB 4IOBA 2ILZA 3QGHA 4DTNA 4CCHA 3LPTA 2FJVA 4BE1A 3NH2A 2QKKA 3EY1A 3OL8A 5KT7A 2JEFA 3QLHB 2I1RA 3AVAA 2NUBA 2OPSB 2EX3A 1ZBHA 3BSNA 1TAUA 4LSNA 3FDSA 4DQSA 1NJZA 3KK2B 1HYVA 4AILC 3EZUA 3AVHA 1RA7A 4YMEA 3KK1A 4FVMA 4PQUA 1KFSA 3PJWA 4X2BA 1ZTWA 4IR9A 3F73A 1DTTA 2ASDA 1O1WA 4B9MA 2BGGA 4N41A 4FJJA 1RTDA 4E7JA 3F9KA 1IO2A 1HARA 1S1XA 4NLWA 1BQMB 4DMNA 4Z4EA 2O4IA 3DMJB 4CHYA 4Y34A 1S9EA 1J5OB 1JL2A 3ZSVA 4KRFA 5EWGA 4XO0A 4WFXA 2OPPA 2ZKUA 3GQCA 1A5VA 1N5YA 3KD5E 1RDCA 4DL4A 1JLAB 4K4ZA 1U48A 1KVBA 4ZPBA 3M9OB 5KG2A 4PWDB 1S9GB 4GC7A 3CO9A 3TAPA 3D28A 1QUVA 4O5BA 2W9AA 1L3VA 2FJWA 1KHVA 3DLEB 2FVCA 1ZBIA 2ZD1B 4KAZA 3NBPB 5J2NA 3LDSA 1B92A 4NYNA 3CJ5A 3FFIB 3TAMA 4ZVHA 3JSMA 5D3GB 5KT5A 4RW6B 2ZQBA 1RT2B 4MIAA 3QIDA 4DSEA 3IN5A 3SYZA 4CEOA 4Z4CA 1GX5A 3IS9A 4K8XA 3JYTB 2J6TA 3L2RA 2DFFA 4IG3B 1ZBLA 3PW4A 3LP1A 3PHEA 4CEFA 1KSPA 4F50A 4M45A 4KHWA 5HROB 3SQ1A 3T5HA 2RPIA 5JUMA 2XCAA 3MF5A 4MK7A 3V6JA 5KFKA 2YV0X 3LPUA 3LP0A 5KG7A 3RB6A 2AWZA 1IKYB 3OVNA 3AVIA 3V6HA 3P1GA 3AVKA 1S6PA 3NF8A 4HVJA 1QE1B 1VRTB 2XY7A 3LZJA 2BANA 4E0DA 1CXQA 4GMJB 1XI1A 2P1JA 2FLLA 2E4LA 3KMQA 1ZTTA 1RT1B 2HHSA 4DTXA 2XGPA 4AHCA 4KKOB 4IKAA 1FKOB 3IGVA 1TQLA 2B5JA 3C6UA 3KK3A 2FBVA 4NYFA 4ELVA 2AGPA 3I0SB 1MU2B 3ITHA 4CJKA 3H5SA 4KTQA 4RW4B 3DM2B 5EWEA 5I3UA 5KGWA 1RDDA 2RF2A 1RDAA 4CJVA 4AHRA 1HYSB 3CJ0A 2LSNA 2W7OA 4DF4A 3PX0A 1N48A 4LSLA 4ZP6A 3BQ2A 4JRPA 2UVRA 4CGGA 3SUQA 4MFBA 3O4QA 5C42B 3D45A 2F8EX 4CJTA 5KFIA 4U7CA 2KFZA 4CGIA 5KG5A 3LANA 4FLYA 1TKZB 1TL1A 2IC3B 3PO4A 3AA4A 4KHQA 1FK9B 1RTJB 2B4JA 3AVGA 3NGYA 4ELUA 2GIQA 1RT4B 3OYFA 2BRLA 4O3NA 4KHUA 4FLWA 3MFIA 3MEGA 3GILA 2E6LA 3K57A 4AHUA 3OYCA 4DWIA 3BSOA 2F96A 4J9RA 3M8RA 4TLRA 4F4XA 3RAQA 4N5SA 2HNZB 3DLKA 1S49A 5CZ1A 2PZSA 3CDUA 1SUQA 4Z4FA 3QIPB 3I0RB 3HT3A 1RT7B 4B9LA 5DGBA 4IKFA 4CE9A 4W5TA 3LWLA 2J6UA 3KK2A 3IRXA 1R0AA 3KHGA 5HP1B 1VSMA 1JXEA 4KTZA 1NHUA 4OLBA 2XI3A 1SV5B 4IBNA 3PV8A 4FJXA 1L3SA 3DLHA 4CEAA 3H4BA 2HAIA 1Z25A 3SV3A 5DQGA 2R8HA 4M41A 2WONB 3HHKA 3D0PA 4NLXA 1J5OA 3GV5B 4IDKB 3KLIB 4O55A 3BGRB 4I2PB 2YHAA 2R2SA 4ZTFA 3EPGA 1K1SA 1RT6A 3MEEB 4ECWA 4PWDA 5C24A 3KLHB 4BACA 4O4GA
chains in the Genus database with same CATH superfamily
3TTFA 2CQ2A 2WOMB 4I67A 1RHMB 3A3NB 1YJWS 1ZM2A 2QV6A 5LJ5Y 1VK3A 4KHPJ 3ELHA 3SMPA 2X74A 4JI5K 3ZTQA 1ULRA 1Q8LA 5L38A 2VFVA 2V2QA 3TPQA 4OZ2A 3DCAA 2W42A 3CFPA 3VF4A 4GKKF 4NL5A 5KFEA 2KDOA 3TQEA 4X65F 5AR0A 3T5JA 3BREA 2VASA 4H0TB 3KXDA 2F1FA 2XY6A 3AGRA 4J2AA 4RJVA 5JVGQ 2K06A 5I3PA 4CTAA 1HIYA 4W92B 3OQ2A 2VDHA 3O2IA 3GOIA 4FLVA 1X9WA 1G6BA 3QSYB 2DNRA 3CNQP 2HK3A 3VQTA 4IO1A 3CCLS 1ASWA 3PO5A 4P10A 5A0YA 4QWEA 3H08A 1KHWA 1JCEA 3CJSA 3QEIA 2HOEA 1MU2A 3KJFB 3OLBA 5KT6A 3NVMA 4MTPA 3FR0A 3V6KA 3V4IA 1U8SA 4WKRA 5ETNA 6FDRA 2R8KA 4ALZA 3EPIA 1W0HA 2DR8A 2Q43A 4EZ9A 3BP8A 1QVFM 2OD6A 2HNYB 3QESA 4NLVA 2D4WA 5KFBA 3OHAA 5AJ3K 2BJ8A 2H4WB 2NYIA 4K8ZA 4LF8F 3G71S 1G99A 2U2FA 2VL1A 4P2XA 3BYPA 1F5BA 4FP9A 5LSLA 3KUGA 1AFJA 3OR1A 1TKXA 2MZ1A 3H5YA 2RKIA 2JWNA 3BN7A 5E3CA 4YOEA 4B3SK 2FXUA 4FJ9A 2L41A 3R2CJ 1RTIA 1OO0B 1P1TA 3D2WA 4DR7F 2MLXA 5EU7A 3L2QA 2KW4A 1X9SA 2QEXS 1NO8A 4CEDA 4KTWA 1RAIB 3NOGA 3EJMA 1H2UX 3IG1B 1W9HA 1S9FA 2KB2A 5A8KB 3OXFA 4CF1A 4J9KA 4DX8H 3MMBA 3LAMA 1L3KA 5KT2A 3MWTA 4ZIVA 2D3O1 2C2RA 3SQ0A 1WI6A 4MKBA 4AFFA 2ZJPQ 4J9PA 1BCOA 4M3UA 3RMCA 1RCHA 3ZT1A 3CF5L 4CGDA 4PXEA 4DU8A 3BGLA 2YQ0A 5T7LA 1RXOB 2GHVC 3QEVA 4IH7A 4XH1A 2VA2A 5DDPC 2WONA 3OD2A 4B3RK 1YJ7A 2KRBA 1AUDA 1M1KO 3ZEUB 4LJMA 1N4LA 2P9SA 4AXJA 2JEIA 4ZVEA 3MM9B 4FM0A 2NPIA 2GFFA 1UEKA 2W2NP 4ETZA 4ES1A 2DGUA 2YWHA 3US5A 3ULEA 3NVKA 1V5IB 4WCEL 2C2KB 4EUVA 4DV1K 1KAZA 1RWXB 3DOMB 4FNHA 5KFWA 5H1SQ 4OYXA 5AE1A 3HPGA 4CZLA 2BE2A 4A8OA 2P9UA 1GLEG 3D7EO 3L2WA 2W2MP 3QNNA 3ZLJA 2FVPA 4JKFA 3W5YA 2ZOGA 4GVEA 4DV3K 3H98A 1RT3A 4OI2A 2B4VA 4WYBA 5H9EJ 3TR5A 4F8RA 1JLCB 2XBPA 3OSNA 4FPIA 2CADA 1B9FA 1MG7A 1SAZA 2VD3A 1Q4RA 3HDSA 3M30B 2HQCA 1YIJS 2CKWA 4DTJA 4OYIA 3JSBA 1IWGA 2EKNA 4A47A 1YQHA 1T05A 1V3RA 5CYQA 1WBDA 2W8KA 2IOCA 4QWDA 1NGEA 4TY8A 4FBTA 2KN4A 1C4CA 3QO9B 2ITMA 4E3SA 1ZXOA 4H5NA 1WKLA 1Y4ZB 1MNEA 4QW8A 1VQ7N 2KI2A 2NRZA 2RU3A 1JXVA 1D8YA 4O8UA 1NXIA 1R3NA 4C8KA 3V1QA 1S1TA 3NMRA 1QLNA 4ERDA 2H65B 2D0PA 1NOYA 3ZT3A 4G3IA 3TEGA 5GMKa 3MCSA 1VQMS 3FSIA 1I94F 2E1PA 5AZIB 2HHUA 5KG1A 2KU7A 1B7FA 3VF2A 3NAEA 4DQIA 3ZX0A 1TK5A 4OYMA 2V9KA 1J53A 5K14A 1NSKL 3WC0A 1NCLA 5EY4A 1HMVA 4DQ8A 2P5VA 1DKGD 1CVJA 2GCFA 1R89A 4ZVUB 5DM6Q 4DR2J 3MMCB 4PCQA 4FJ5A 5HMXA 1UZHA 1KVIA 1S72N 1YJNS 2VHGA 1NM1A 5FLXU 1BQNA 3VEYA 1RUSA 1R43A 4JV0A 2WBRA 3HHLD 3SIPB 1J5EJ 3WXKA 4KGXB 4OX9J 2P9PB 2X7IA 3CD6N 2ZHOA 3MUVP 2CH5A 2QYGA 3GSDA 3IAM9 3OTDA 1FERA 1XIQA 1XC9A 3RMBA 3WHIA 1TFYA 4KPYA 2AW0A 5B8HA 8ATCB 2M5YA 1RAJA 2A2DA 3DDKA 4USUA 1N33J 3DHWC 2CH6A 2DGSA 1JLGB 5BYQA 2ASMA 2DEJA 5IM0A 1W25A 5JVHQ 3IGNA 3NNHA 3CULA 1VQON 4GMKA 4RW9B 3EGVA 5KTQA 2V4RA 2HZVA 2DHXA 5DDQC 6FD1A 2BX6A 5CA5A 5D4OA 1LWCB 2YKNA 3AODA 4FSVA 1SQEA 3BR9A 3HVAA 3CCVS 1NJXA 4WP3A 1MN9A 4C9DA 1JLQA 4FK2A 2VPYB 4FVCA 3VQ8A 4HHHA 2W9CA 3EE9A 1C2PA 3ZSOA 2XSJB 4LFBK 2G8UA 3A8KA 3DDIA 2A6OA 1S6OA 3P38A 2ZNYA 1H2VZ 4KHPK 2GS8A 3O1BA 3PEJA 3KG0A 2R9LA 2PYJA 5L8RC 3AARA 2NXJA 4ZP9A 1OPZA 2E9RX 3U4LA 2O5DA 3P8BB 2JDJA 3M2RB 1RBUA 1REVB 1LWEB 3HFZB 3QEWA 3E9LA 5THWA 4B3TJ 2ZGZA 4CEZA 1BGXT 4PQAA 4DU7A 2P6TA 3PYEA 3NKYA 2NSCA 3FCWA 2AYEA 4OIXA 4CJ5A 2HQGA 4CJ7A 3KKFA 4PG5A 2R7UA 3OTOJ 4WBFA 3MR2A 2E5LF 1C1CB 3CIZA 3HZEA 5LL6d 4H4OB 4DR5J 1NMEB 3UKUA 2CNLB 4KH4A 4LVOP 3AO3A 3W2VB 2BZ2A 4M5JA 3NP5A 1CLQA 3MAQA 1X1PA 1OVYA 4RR5A 2B9XA 5ADZA 2Z4PA 1I3AA 2O8BA 2OEKA 2ROPA 2DFHA 1RBTA 1S9GA 1KC8O 4I69A 3DLEA 2OTLS 2GHPA 2E20A 4YY3F 4JRQA 1HD0A 1S6QB 1I3OB 3UO0A 2FVQA 2A6MA 1VRUA 3M8QB 2M3DA 4TQRA 4JI8J 4G65A 5J2QA 1HBUB 1N5SA 2MGZB 2MKIA 4RWWA 4RW6A 3AB2B 3CCQN 1T3VA 5FIIA 3JAMY 4M5GA 5KG3A 2YH0A 5K8NA 1NHKL 3VQ5A 1XNRF 1HPMA 5HROA 5CD4A 2Q31A 1AT1B 1HWKA 2GMHA 3WNHA 3CGIA 3VV2B 5CYJA 4W90B 3U8XA 4LIWA 4USJC 4KB1A 2EHGA 1Q81O 1QE1A 3AJDA 1VRTA 2A5XA 5K20B 1D1UA 4E1NA 2VICA 4WFNL 3G9CA 4BLGA 2KFYA 3QT7A 4URGA 3UCGA 4DU1A 3CJQA 5KQDA 5D0EA 1X4HA 1MSWD 5DG8A 3DI6A 1R7IA 3IAS9 4CF2A 1N6QA 1RHJB 3HHLB 3VEXA 1F21A 5AQMA 4ID8A 4QBUA 1R8AA 3PW5A 3OJSA 3TRGA 1YKWA 3CVKA 2G13A 2NPFA 1FJEB 1W2BM 1S9EB 4MKYA 4OGEA 1N36F 1X5OA 3VQEA 1N34K 5IV3A 1GLAG 2E1YA 1UKUA 1HBOA 3QETA 2G1DA 4NEYA 3ZNUA 4JI3F 2L9WA 3V9ZA 2NREA 4WFZA 2QRRA 4USWA 4DV5K 3UDCA 1TKZA 1VSIA 1KD1T 3NFAA 4K0KF 1N5TA 2ZGYA 1WD6A 4UQTA 2MZSA 4LUBA 3QYYA 1MWKA 1VSLA 4DBQA 2E9TA 1EIYB 4GV6A 3AO2A 5AQVA 1K0TA 2QKBA 4WJBA 4MO5A 4F67A 1JIHA 2FD2A 1SIZA 5H9EK 3ISND 1C1BA 4KE5A 4IXCA 3ZFVA 4RNHA 2Z1JA 1BWEA 3POTB 4NRTA 1HBMB 4B1YB 1YITS 2YWWA 1JX4A 4M1KA 4EWTA 2HVIA 3H6EA 3G0ZA 3QIPA 4LF9J 2RDJA 1W26A 3M32B 2QWOA 1VR6A 3M8YA 2CPYA 1KVKA 2DO0A 2CAJA 3VAHA 3QFPA 1ZPVA 4KR0B 4ED0A 1TYQB 3VQQA 3J81O 4CBXA 1SQFA 4O44A 2DTJA 3Q2SC 3MM8A 4FZZA 3OTEA 3BH6B 4LRAA 2W7PA 5F8HA 5J1EB 3GZ7A 3PRBA 4WE1B 2C22A 4URSA 2UUBK 2ZKTA 2ITGA 2BANB 1TMMA 3RRGA 4NRUA 4F2RA 2LP4A 3H20A 4DUYF 2COLA 4HACB 1NK9A 3U27A 1XMOJ 3V5RA 2AEMA 3PFEA 3BGRA 3BO3A 5LMUK 2UXBF 2BE9B 2DPIA 3LP3A 3U9DA 1QQCA 2MPUA 3KKSA 1BIZA 3EGWB 3MEEA 4K42A 3MXMA 2CFXA 4B1VA 2Z1GA 3VALA 3ZO7A 3PKMA 2O8EB 2GMLA 4PXDA 4ENOA 4CGJA 3N79A 1RB0A 2ZM6F 3KKRA 2W6LA 3Q0AA 5GMDA 3FEYB 2FSKA 1YVFA 1IJFB 4DR2K 2CJYB 4QS9A 5BJRA 2RQ4A 4LSLB 4NCAA 1RWOB 4K5SA 1XR6A 3OV7A 2W6KA 1E6YB 2Q0UA 1GOBA 2I9SA 2PBDA 3KUHA 3F44A 3DLGA 3CHWA 4OX9K 3VQAA 5GAEI 3ZYYX 3C14A 4FW1A 2K7JA 1O6XA 1FDDA 1FNMA 2EG2A 3RUBL 1N33K 5L9XA 5MLCQ 2CPFA 3R5BA 4A4JA 2IYGA 3OTBA 3TTDA 1FJGF 4IOCQ 5I9EB 1X3NA 1X9MA 1BI4B 1F3VA 4NXNJ 2W24A 4BGAA 2ZITA 4GO5X 1BA1A 5H9FK 3UB5A 1PJ5A 3MK6A 3IRXB 1HI0P 2MHNA 4FW2A 2F7TA 3RGIA 3AXKA 2HHXA 2J8SA 3GFXA 2F9TA 4KHMA 3J7A1 4CHNA 5J2MA 4KHNA 3UKRB 3CQYA 1FKPA 3PJXA 1JWWA 5M1PA 3CCLN 3WQUA 3PIPQ 1O0PA 4U7BA 2D3OR 1VSDA 2DIUA 2CIMA 3R8EA 4M63C 5GADI 3I5AA 1Y3JA 2RS8A 1VQNS 1N0VC 4ECTA 2FHKA 2BJ3A 1RT6B 5FDLA 3JSYA 3AD9C 3UN2A 1VIXA 4JI4J 2LKZA 3SCKE 3RVCA 1BIUA 4K4YA 3OS0A 1PCAA 1FW6A 3DAWA 4H54A 2UUAK 2DGTA 3VZIA 3G71N 3NGSA 1XEZA 3OFEA 5ETKA 1LKZA 3FVYA 1P27B 1LW0A 1JCGA 4A8XA 4CLSA 3TA2A 1DZ5A 2EVZA 4CBWA 4J2DA 2X1BA 4KSEB 3UNGC 4O3RA 4EBEA 2V7YA 1K47A 4BDYA 2C28A 2B43A 3NMUA 4P2MA 3OTOK 2QEXN 1U24A 5KFSA 3I8DA 2JHEA 2OZMA 1R27B 1TV6A 4DR5K 2QWMA 2R7TA 1XC3A 2QA4G 3D1OA 4CW7B 5HMZA 1FJCA 1Z2ZA 1IJJA 1HQUB 4HUEA 3GJQB 5BYSA 4CTAB 4C8NA 3O80A 4JI2J 3OS1A 5C25B 4WFBQ 1GTHA 3TJAA 2DXEA 1W2BR 5B0AA 5D78A 4H0OA 4E7IA 5A2QU 4OZLA 5A0YB 1Q79A 4ZA1A 1OQ3A 3A0IX 4OO1J 1W7WA 1NGJA 4E8UA 5B7WA 1XR7A 1X60A 2V34A 3V4IB 4ED6A 2E7XA 2V50A 4JI8K 2A3JA 3C2PA 1A5WA 2KLAA 4DR6J 4DZDA 2YWGA 4WTOB 5DG9A 4EO8A 1U45A 2JGUA 1ZETA 3KNAA 2H3EB 4B3MJ 4E89A 2IDLA 4YB5A 1S1UA 3H7HB 2JNJA 1ASVA 2WVDA 4JI6F 1EP4A 1Q1KA 3MDFA 3OR1B 1F5CA 3J7ZT 4B02A 1TKXB 4F4YA 3EO3A 3OYIA 3KWIA 2RKIB 3CCJS 4UY8O 4QWBA 4I6YA 3SI8A 2F4VJ 4AM6A 1RTIB 2BXJA 1QTMA 3DOKA 3GJTB 2CQGA 2W4PA 1HUXA 1RBSA 2EW9A 2SXLA 3V6DA 2BKPA 3MMAB 4B9VA 2E1ZA 3DLRA 2QA1A 5KG4A 4ISFA 3K2YA 1VQ5S 1QAXA 2BDPA 3ICLA 3MMBB 2KFNA 5AE2A 4IWVA 1KOOA 1P8GA 1VQ8S 4P72A 3W9JA 1YIJN 3V9WA 3BF4A 3ZZUA 4CLZA 4EEYA 4R0JA 5T7LB 3DXSX 1RBAA 4NCBA 4J9LA 3C94A 3TZZA 1GLBG 1C0TA 3J7YP 2HS3A 3EXCX 3C7NA 1JKHA 3HHDA 1X9JA 4WF9Q 1AW0A 3PW7A 4DCOB 4NLSA 3W3SA 3BM7A 3U6FA 4TXSA 4DV0F 2O8DA 1EQMA 4ZCKA 5KT3A 1FWKA 3UQSA 3ZTSA 4JYAF 2P9SB 5KPZA 2W8LA 4L3QA 2CDRB 3TO8A 1LOTB 2IA0A 4FKXA 5AT1B 3ZZTA 2QE5A 3QGPA 3ULEB 1UWBA 2QZ8A 4DSFA 4CGHA 4H5RA 1NDKA 3NF7A 1RU2A 1VLOA 5AXMA 2UYTA 3AA2A 4IO9L 5LSRA 2P9UB 5C7PA 1Q78A 1S7HA 4HHJA 4ZJQA 2ZZTA 1FXRA 2HLTA 4WFAL 5SUHA 4DTSA 2QN6B 3SPZA 3L7OA 1LW2B 4DR4F 1YJNN 2OIHA 1RT3B 2DY4A 1GK8A 4ILLA 1C0UA 2D3ZA 4B1ZA 3QBWA 1ZAVA 2YNFA 2FB0A 2QTWA 3SDEA 3QPIA 1C4AA 3S6EA 4DPUA 4YOVA 3PIOL 4OJ1A 3FQKA 1B7YB 4BY9C 1QVGM 3NH1A 3N01A 3OA9A 4K4UA 4JI7F 4JV2A 5FJ4A 3L95X 4HCBA 1U2VA 1UVNA 3S01A 3KK1B 3TWZA 5CYQB 4DXLA 4I9QA 3TOQA 1XMOK 3A5MC 1S1VA 1ASUA 4NLPA 4TY8B 4CLKA 2Z1HA 2ZBPA 5JS2A 4F4ZA 1FTCA 1T9YA 1L3TA 2EWSA 4Q2LA 1HHTP 4ZMMA 2GTDA 2GV9A 2QI2A 4X66J 2WSFC 1S1TB 5M2UA 2QYCA 3N5BA 4WQ4C 4CJ4A 2OPPB 3CJ9A 3PLAA 2RN2A 3CCVN 1PG5B 2W7AA 1IJEB 4J9UE 2L3MA 2YNIA 2O66A 4CZCA 3DGPA 1AXQA 4Q43A 1CBKA 4P75A 3CCZA 4ZJLA 4F4AA 3PX6A 5K14B 3B82A 4X62J 1HMVB 5IZHA 5DZ6A 1CLFA 3RWUA 5KFLA 1XMQJ 2NXEA 4CF0A 5F8JA 3RMDA 3R8YA 1LWXA 2BABA 4V19S 4Y0WA 2Q66A 2JZ5A 4KHRA 1BQNB 3OYAA 1NGCA 3OS2A 1WG4A 3NH0A 1YXQA 3THYA 4RX6A 2CVIA 2WAQD 4RBUA 4JEPA 1JJ4A 3BDPA 5CH7B 5GAHU 1U8WA 1OSDA 2IIRA 3CJRA 5KRSA 2W2QP 2D3UA 1TK0A 4BE2A 1XHZA 1D5AA 3NMAA 4K7QA 2XY5A 1OH8A 5LT5A 3C0BA 2AQ4A 1PKUA 3M7VA 5DLFA 1Q5VA 2MQPA 1DT9A 2JFDA 2M8HA 1TMJA 5IM0B 4DQPA 5C2DA 1UA0A 2V9WA 1BWFO 3SQ4A 4JI0J 3M2UA 3UR3C 2DISA 2DNPA 4PPDA 5BR8K 3NGIA 4RUAA 3AOCA 4OHXA 4DPYA 2YKNB 1RK8A 1K9MT 3CIPA 1VC6A 5ELZA 4TVAB 3DLLL 3DRPA 3QINA 3FZMA 1JLQB 4OKKA 2J0XA 4JI4K 2VA3A 4JKAA 2DNLA 1TL3A 4DSIA 4NYOA 4RNNA 1S5JA 4JI5F 4OPKA 2W9CB 4IRCA 4HEA9 5EN1A 2O8CB 4MQ3A 4QR0A 2OTLN 1LOUA 4CZGA 4ECXA 4A8YA 1U6FA 1U2RA 2HYIB 5A8RB 3MR6A 2EKYA 2D1CA 2NRHA 3HKWA 2EC0A 1UA1A 3VVTA 3NWRA 3SCJE 4OI4A 3MEGB 3EKSA 2ACYA 2EBEA 1R31A 2XO6A 4DCHA 4LF6J 2P9NA 3W66A 2CQDA 3BV8A 3FEZA 1X4GA 3MCAB 3NH2A 2QKKA 3EY1A 3OL8A 2G2OA 5HOOA 1JNZB 2EX3A 1IBMF 4LSNA 1A9NB 4NI2A 3FDSA 4JI2K 3ZZ0A 4AL7A 4U7UK 3BPDA 1U0SA 4X64F 2VB6A 4YEAA 4X2BA 1ZTWA 4BG8A 3LM2A 3UKUB 3M6XA 2RH3A 4FJJA 2V69A 5AJ3F 1TTHB 3TUJC 3L9ZA 3W8GA 2EI5A 2JOQA 2O8BB 1WHXA 1RDCA 4DL4A 1KVBA 1D8ZA 4B3SF 4PWDB 1S9GB 3UD5A 4GC7A 1ATRA 3BEGB 5DM7Q 4B3MK 3DLEB 2FVCA 1GTEA 4LFCJ 5IT9Y 4PKIA 2A41A 3E66A 4NYNA 3CJ5A 3FFIB 5FPNA 2CNOB 2CJAA 2F4VK 1PBAA 2DNGA 3GG1A 3HCXA 2B3TB 4RW6B 2DJWA 4UZCA 2ZQBA 3BGOP 1LFWA 2LEBA 4MIAA 3QIDA 3IS9A 4OYWA 3VTHA 2J6TA 3THWA 3HI9A 2D9OA 3UI3A 3PW4A 3QBCA 2NQPA 3PHEA 3CI5A 2YKAA 4M7XA 1QVGR 2NRVA 2AV5A 3D9BA 5HROB 2HF4A 4L72B 3MF5A 3EICA 2K1RA 5IS2A 3O9RA 3RB6A 1IKYB 1NGFA 1YITN 4K25A 5F0XA 2MSSA 3V6HA 5HANA 1U02A 4JD2B 2HRTA 3AVKA 5AFUH 1OYEA 3GIRA 1QE1B 2JH3A 1Q8KA 4BQZA 1VRTB 3SAFA 5GVQA 1LCUA 2D9PA 2BVZA 2W4CA 1O13A 4B3RF 4QZVB 1VQYA 5AQRA 2HHHJ 2E88A 3ID8A 3CPEA 2IIHA 3KMQA 4X65K 4RUBA 3PSFA 3D68A 1M5OC 3ET6A 3L4IA 2ZH3A 4LBIA 3K9KA 1RWVB 3C6UA 3M1FA 4ELVA 4NYFA 3FCHA 1YK9A 3ITHA 2H4YB 4U95A 2E1MC 3A3PB 3H5SA 4PXCA 5EWEA 5E3AA 2HFNA 2LLZA 2KT3A 3IDHA 2RF2A 4CJVA 4ZP6A 4DV3F 3UE2A 3FFKB 2UVRA 4CGGA 4C4WA 1HBOB 4JB8B 2C42A 3CB4A 1SJFA 4MFBA 2WC9A 3PSIA 2ZJRL 3T41A 4U7CA 4CGIA 4QS8A 3AOAA 3B4DA 1TKZB 2HIYA 1S79A 3PO4A 3C3LA 2VGNA 2RS2A 2GIQA 2GJFA 4KHUA 3A8EA 3VENA 1MROA 4P6QA 3GILA 3M5RA 4OI0A 4LF8K 3OYCA 2KXHA 3BSOA 2F96A 3M8RA 1ACMB 3T1HJ 3C15A 1OH7A 1H74A 1VCTA 1O5JA 2N82B 2BACA 1SUQA 4Z4FA 3QIPB 3HT3A 2DGQA 5DGBA 3MUMP 5AQNA 3QB0A 3IMXA 2X1GA 3HFVA 2VYPA 3Q24A 2GQQA 1VSMA 1UMJA 4KTZA 1CPZA 2HS0A 4OLBA 4IBNA 3PV8A 3DHXA 3DLHA 3HTVA 3LH2S 2HAIA 4ZOSA 4A61A 4X66K 2RB7A 4FWRA 5DQGA 2R8HA 2KXNB 3VAGA 1WKKA 5HMYA 2E1CA 3THTA 4YB7A 2CGKA 2H5JB 1OH5A 3MI7X 1HNZJ 3BGRB 4ZTFA 2LMIA 4RO0A 3EPGA 1KQFB 3MEEB 4ECWA 4USVA 1ZAWA 4BACA 4O4GA 2UU9F 1IN0A 1DJ0A 4K4TA 1GMWA 4MYUA 4X62K 3MXHP 2VPXB 2GX9A 1XMQK 1WACA 3G6YA 3AVLA 3NGUA 3VMFB 3THXA 4FBUA 3MPDA 2CPEA 3CJ7A 3QT8A 3ETMA 1IR1A 1NM2A 2IS3A 4BVOA 3OTCA 2GGPA 1V9OA 1Y00A 2MMYA 4A5BA 3L3VA 2ADCA 3T69A 1WC1A 3DLGB 2EBGA 4ZPDA 5KFTA 1NNDA 4KGMA 2R2UA 2IAJA 4OZNA 4C11A 2YKOA 2CPXA 5KFGA 4QIFA 4C7QA 1XJWB 2F8MA 2E9ZA 5G4DA 1NJYA 4N8OA 2G2ZA 3TJ9A 4MLHA 1N0UA 4KV8A 3EE8A 4RWXA 2E2NA 1UVKA 1S7IA 1R6YA 1SKRA 3O5BA 4ZLNA 4EAHD 2VUGA 3AD8C 4LH4A 4PXBA 2ZHBA 4E2FB 5AQSA 4R5PA 4DF8A 4DL7A 1CJTA 3I0SA 1FEHA 1FKPB 3BQ1A 3CSKA 1TUWA 4KHPF 4PL7A 2RRAA 1H1VA 3JTOA 4YS2A 4LF4J 2BYCA 3ZT2A 2HIQA 4GC6A 2XYPB 1GLFO 4A8WA 2Z1IA 4AL5A 2CPJA 2R7OA 3DKDA 4C1NK 3MD3A 5C42A 5FDLB 3U3YA 1HKGA 3T1AA 4ZVTB 3H45C 3IWXA 5B0EA 3DLBA 5LMNJ 4CEEA 3D6FB 3LPYA 2QLXA 4H4KC 3GSIA 4CGFA 4YORA 3EM1A 1UPPA 2NXNA 4LF6K 1LW0B 4CECA 4JN4A 2Q1LA 2BKOA 3L4QA 3MGJA 4ZVOB 4KB0A 3LF0A 2HW3A 1NDPA 4C8YA 5C0YA 1WHWA 3OYGA 3I0RA 3E8OA 4C0OC 4P2FA 3NDKA 3TTCA 1SH0A 4J2BA 3ZT4A 1TV6B 4FLZA 2LQ5A 2J9CA 1BXNA 1KLMA 3CETA 4G1PA 2MLYA 4DTOA 1RGVA 3MWPA 3MAAA 1HPZA 3AY0A 1Z1ZA 4DV7J 1VQ8N 4CZKA 4L3NA 1CJKA 1MLAA 3ENHA 1WELA 2XYHB 4OPJA 2OEJA 2XB2D 1NB2A 4I2PA 3R7SB 4DMZA 1U4BA 3D1QA 1J9AA 2QXLA 2FHJD 4LFCK 4Q44A 2G0CA 2OPQA 3E51A 2FC0A 5AQQA 1T3OA 3BZQA 2VWBA 4LIRA 5EXWA 3FZKA 2KH9A 3UWTA 1C0GA 2PA8D 4WQ5C 3KFWX 2W2PP 4P71A 4BRNA 3FRYA 4CJWA 3NCIA 2WUSA 2V0NA 3M6UA 3NLCA 1SJRA 3TVYA 2EG1A 3SAHA 4XIUA 1YHQS 3OXLA 1SCJB 3SQOP 2XHWA 3W60A 1E6VA 2K8GA 2HVHA 3FQLA 3F2KA 3QIOA 5F3ZA 4K41A 2E2QA 3DOKB 2LCWA 2YQ1A 1V5VA 4FXVA 4FO0A 1EKEA 4ECZA 4DG1B 1FFSB 3FUYA 2FJDB 3V6DB 3AQPA 3A8YA 3AFGA 4DN0A 2GWKA 3SQ2A 3ATUA 3B6PA 1EX4A 2E2OA 1UPMB 3H90A 2ZBIA 2HHPA 1QAYA 1QSLA 4B9SA 4YNQA 2QSFA 2A0FB 3I4PA 3M6WA 1S1WB 3D6HB 2YI1A 4F9OA 5KFNA 1SXLA 3IO1A 3FCVA 4PYAA 3K5LA 3HXMA 1N8RO 2V4JB 1NK8A 3FGUA 2R2RA 2W41A 2J8AA 1BISA 1FX2A 5LL6Z 3RR8A 1C0TB 4C23A 4V19J 1T7PA 1OVQA 1DQ8A 4NLDA 2O8DB 1DLOA 3GCWP 4ECUA 3H4DA 2FDNA 3HM9A 4CIEA 4DPWA 3VQPA 4BCAA 3H3OB 1NMDA 3HP6A 1UWBB 3LOUA 1AROP 2Q0RA 1Y3KA 1EXQA 4BVPA 3QFUA 3D3BJ 2QWLA 1SZ2A 1BD6A 2MJNA 1AFIA 4KIAA 4J5OA 3IG1A 3W0LA 1M1KT 1VRQC 2FGCA 5A8KA 4QYZK 3GMGA 3A2FA 1Q8IA 3KLEA 2KJWA 2FHMA 2DHGA 4LMZA 4DTPA 1N54B 2YNFB 3WUHA 3SDEB 2M2BA 1JLFB 3L8BA 1RDBA 4Z4HA 3KDNA 4IR1A 1NKEA 2N7CA 1U2VB 3L7PA 1RWMB 7FD1A 4Z4IA 2AF6A 3NOCA 4DSLA 1HNZK 4WPAA 3A5OC 4MKAA 5TKYA 3ETOA 1T3NA 5DO2A 4DR2F 4L75A 5M1OA 9RUBA 2CQBA 3ZEUA 1BHNA 4IFYA 3IBFB 4BWJA 3BSAA 3G82A 3MM9A 1BLUA 3GBTA 3Q8PB 5AQIA 3NNAA 1J5EF 2LECA 2UZAA 1TUYA 4OX9F 3X1LB 3UFCX 2AZ3A 2VG5B 1M5KC 4AXIA 2WB4A 3R97A 3I33A 1DGKN 4WQ4A 2HKEA 2VC1A 3PW0A 5HMWA 1F5AA 1N36K 2CG8A 1N33F 1WOSA 1U04A 3UPFA 4E19A 3HHNB 1KQSM 4KH6A 4JI3K 1JLCA 4K0KK 3U1LA 5AQWA 1RU1A 4Z37A 2ZVIA 3OJUA 2RVJA 1DEJA 1FX4A 3M30A 2MKKA 5EHHA 5JLFA 2ATLA 2P9EA 3J8AA 2LQ9A 3JAMO 3CERA 4KPCA 3BY5A 4HKQA 3CDBA 5IXUA 4CH7A 2ADBA 3W5ZA 3MN5A 2BRKA 2ZVSA 4RZRA 1W7AA 4HT7A 1FHTA 4B8AB 1FCAA 5C15A 3I56N 3ADAC 4DL2A 4BQLA 3PR5B 4URQU 3DMJA 3OL7A 4ILGB 3B54A 4UOFA 2UVUA 3F5TA 4KQZA 3HOSA 4LF4K 4TN2A 3QGIA 3TABA 4CFDA 2FJEB 3C8YA 2AJ1A 3WIUA 4YQWA 2E1RA 1KKHA 1QAJA 5AZIA 2VCPA 2ALYB 4JHDA 2VIHA 1I51B 2G8HA 3ZZYA 1FF2A 2E1AA 1WORA 5ETQA 4HR2A 3W5XA 4KBOA 3DRPB 2C3MA 1FO1A 4FF2A 1P6TA 2ASJA 4BR7A 3TX8A 1TL3B 1YI2N 2UXBK 1EHWA 4B3TF 2E8AA 5LMNK 4X4TA 5D3GA 1ZA2B 1KLNA 3MMCA 4LQ9A 3WX8A 4J9MA 2NYHA 2EEYA 1QZ6A 1KNZA 5KFUA 3OTOF 3MM5B 4DX5A 3V1OA 1HNVB 4X4VA 4DR5F 3MN9A 2RDIA 3Q8SB 4EBDA 3DXMA 1ROFA 2P9PA 4B9NA 3OYEA 3TARA 1YGYA 4ZCMA 5CE3A 3O3HA 4LRCA 2IM0A 3ENVA 4CZFA 3IUCA 1P8ZA 5KFRA 2P9NB 1LK5A 1Q82O 3WBZA 4OZ5A 1OIAA 2QW9A 5AQPA 1VQPS 1NK6A 3KMSA 3CQ8A 1XBWA 2Z2YB 2ZBQA 4CJSA 1RT1A 4LSNB 1FRXA 4DL6A 3QJJA 1GH8A 1GMWD 4PRFA 4UOGA 1LAVA 5C5JA 3R6GB 2IJNA 4FYYB 3J80Y 4QWCA 2LFVA 3SZ2A 1FJGK 4JI8F 3J7AN 1ILYA 2OSRA 3RRKA 2IJFA 2PMHA 4IEIA 3DM2A 4J7CA 1SPBP 3KIOA 3QEPA 4JS4A 4Y2CA 3MURP 4M42A 3CF5Q 4GY2B 3VF6A 4RPFA 2DNNA 1RHQB 2CJBA 2OJ3A 1H73A 1YJ9S 2XSJA 5CR4A 1WSHA 1YLXA 1GLLO 2ZH2A 4O5FA 2ZOFA 1RHRB 1I39A 2C2EA 1N32J 1BC6A 1UVJA 2MQMA 1KQGB 2IC3A 3WXMB 3UDLA 4ZPAA 3OW2M 2JC0A 3MTKA 5CHIA 2WZ1A 3MZIA 1MWMA 3OY9A 4KHSA 2OTJN 2FF6A 2J7UA 1FE0A 1REVA 2F3JA 5AQKA 3V9XA 3NG8A 4DFJA 3WXJA 3THWB 2MTLA 1Z2LA 1CSJA 5E41A 3FBFA 1KC8T 2V2ZA 3FBEA 1FFGB 4FWSA 3CO0P 4ECYA 5E84A 5BREA 1GEHA 5HP1A 2VQFJ 4UY85 4CLWA 3WDOA 3GU0A 2YVSA 2BH1A 4NOHA 2K2PA 3W2VA 5JS1A 2MZRA 1TL5A 2LU2A 5KOWA 3IBWA 4C3MA 4ZIWA 3Q8RB 4Q5VA 3KLIA 3G10A 3A3OB 4WP9A 5AQUA 4F3MA 4X4UA 3SEOA 4FLXA 4ZVGA 4I4BA 1VSJA 2IGIA 4Y00A 3C6UB 4AT1B 4BR5A 2CGJA 3KLHA 2R7VA 1M1GA 3C6TB 1QM9A 4I2QA 2UV8G 1Q81T 2XTJP 4N7TA 1U0HA 1WSEA 2RF2B 4ZN3A 3VQ7A 1KQSR 4LF9F 3EKUA 2ZC3A 1H38A 1HBUA 2MGZA 4W5NA 4CH1A 3R27A 1KP6A 2V8DA 3V9SA 5KFOA 4MFBB 3EEQA 3QEXA 2OANA 3CCUS 1QHAA 3CDWA 3WXLA 2J5AA 3H5UA 1F60B 5D77A 3BF1A 4LR7A 1PYSB 4WWSA 4QIWD 2CVEA 4PYDA 5HK4A 1Z26A 2K3IA 2ZH1A 5BRDA 1XNQJ 4QCLA 2CNKB 2ZFHA 2HVZA 3AT1B 2VJVA 4DFPA 5IC4B 4DL0C 4WYWA 6AT1B 3MR3A 1XMOF 2RUGA 2D5RA 1IM4A 2A3ZA 1SUQB 5GAEU 3QNOA 4JLHA 1WEZA 1N88A 5FRMA 2I8EA 4TY9A 3PJ9A 3RR7A 3U02A 3OBIA 3OBYA 2GHWA 5D4LA 3FSYA 3KLFA 4C97A 3L2VA 4GRSA 1F9EB 4LREA 1AYEA 1LXNA 4ZPWR 1RAOA 5L1LA 1R0BG 1GLCG 5BR9A 3OBWA 1HWIA 4PABA 3BQ0A 4O3SA 2EFOA 4C3LA 3E01A 4A46A 3PCOB 2H48B 2XRIA 4EO6A 1IXKA 2AA4A 2XM3A 2V68A 3VAMA 4O4GB 3FZHA 2OCEA 3HSTB 3AO5A 2O8FA 3VGMA 3ZTPA 5GADU 4GVBB 3DU5A 4G1IA 2DNKA 2RSQA 1SC4B 3ZCMA 2GGPB 3HKZD 3POTA 2FPHX 1HBMA 3PW2A 4CIGA 3RW6A 1ZAXA 4A2BA 5F8NA 1TVRA 1S0NA 3M32A 4LRFA 2IAJB 3A1YG 2DRDA 3PIPL 4ZHRA 4C11B 4J9SA 3L3UA 4PA1A 3MMJA 4Y65A 1TYQA 5HL7L 2R7YA 3M8PA 2QXFA 4ES2A 4GVMA 5SWMA 3OXGA 4OYAA 4Y2MA 2C1EB 4KJIA 2KVIA 3O3GA 2AYGA 5J1EA 4WE1A 3WX4A 4LVNP 4KV8B 1VYAA 1Q18A 2NZCA 2MSTA 4RBVA 3TWHA 4ZPCA 5CQGA 4JI4F 3OVAA 4R5PB 1Y7PA 3AAPA 4ZP8A 4DOZA 2AP1A 2FLNA 2DD8S 4OZ0A 3MX5A 3G8SA 2UUCJ 3R1HA 2F9WA 4O3OA 3KNGA 1S77D 4LRBA 5DQIA 4CO0A 3C6HA 1EWRA 4U96A 2J76E 2HURA 2Z2MA 4YN3B 3WC2A 2WVEA 5K9FA 1YJRA 1E6YA 4B17A 3OYNA 2PFUA 3VEVA 1RBLA 2GVZB 5M1KA 3CFRA 4GV9A 3CCMS 1YG0A 3NHGA 1Y5NB 3C66A 2G8VA 2NNWA 3O4NA 4WFBL 3UR0A 2MB0B 2Y9HA 1FD2A 3D54A 4OHWA 3AO4A 5AQGA 4YDUC 1VBKA 4PKGA 1YHQN 4PUOA 4JI2F 3S3OA 3SK3A 3BYRA 5HO4A 4IOXA 2AKWB 4K8RA 4H4KA 1U6ZA 1KVJA 1T9VA 1LXJA 1SH3A 2Q3PA 1RNHA 4XDCA 1BI4A 1SL0A 1FDNA 2ZC4A 3DRYA 2BJ9A 2BQRA 4OX7A 2AJFE 1DRZA 1M1HA 2VFUA 1RFQA 4TQSA 1FRJA 3SV4A 1NPKA 2ZE2A 3GIJA 1HKBA 4WTYA 1KLMB 3NGKA 4RCHA 4NZ0A 4DR6F 1HPZB 4UZBA 5KFAA 3LW5C 1BUPA 4B3MF 3VOVA 2YH1A 1CJKB 1BMQB 4HWIA 2EFQA 1S97A 2MDAA 4WFNQ 3HL8A 3O9SA 4I64A 4YR0A 3UDVA 2HQ3A 3FNNA 3C95A 2XZTB 1N32K 3GFZA 2F4VF 2KQ2A 5KFQA 2ERRA 1WN7A 1QQMA 2OPQB 4A57A 2J9DA 3QWUA 2QO3A 1ZZFA 4NLBA 1WF0A 4IFVA 4CIFA 2A10A 2V52B 4P74A 3AAWB 4FF1A 2BUPA 5DK5A 2A1SA 1JK9B 1KVAA 1A5XA 1TKTA 1U2FA 4U67Q 3MEDB 4MT1A 2RU9A 2GC8A 4FVUA 3R3LA 3HSZA 4EI2A 3MECA 4CVNE 4NB4A 1TR0A 4WQ5A 4KI6A 2CGLA 1E6VB 2UUTA 1OY6A 2KHCA 3ZX2A 1RABB 1VQ9S 5T7BA 5IT4A 2VQFK 4PWUA 1HNIA 1P9QC 2QLJB 1S57A 1YTAA 2F4FA 3O1WA 2V8VA 5FLXY 4F2SA 1HQUA 2AYBA 4W5RA 1NKCA 4Y2AA 4JKCA 3EYZA 4DS4A 4F26A 5C25A 4M95A 3HK2A 3CC2S 4IH6A 4ED4A 2K3KA 3MUTP 5HQLA 5HI7A 1Q16B 2QL9B 4JBCA 2OZSA 3TI0A 2B9WA 2YKPA 2VFSA 3CD5A 3G6ES 2VWKA 4CI0B 4UY8T 4MO4A 4AM7A 3T3FA 1IBMK 1NGAA 3GIKA 2B0GA 2R8JA 2HFSA 3S7RA 2NXCA 4X64K 4DFMA 1S22A 1NRKA 5LXRA 2XS2A 4O3QA 4K4WA 2HLUA 2OH2A 3BZKA 4GNIA 1AUSL 1AA1B 4BRQA 1NKBA 1FESA 5IT0A 3AVMA 4HH0A 3RBDA 2RQMA 1G7CB 3KZBA 4BRIA 1PO6A 5JICA 4OKEA 4ZVFA 2UP1A 4BREA 1DLOB 5AQTA 1S12A 4Z0UA 2J0SD 3JSMB 3NGDA 2H3GX 3HZ6A 5A6PA 1D09B 1QSSA 5KOXA 3EDRB 2EPIA 1XNQK 2Q97A 4FOEA 4QAGA 5BN8A 3ZX3A 3BJYA 2PY5A 2MZQA 1HYZA 1UJ6A 3K5MA 3MMAA 4HI1A 4Y1CA 1FRMA 3C6AA 4DKWA 3TNVA 3TZWA 1C1AA 5ETSA 3NAHA 3AVNA 4LH5A 2CJ9A 3W7BA 4ZN1A 1WSRA 4QU7A 3OR2B 4X66F 4XPEA 3KLEB 4WXWA 3D6TB 2DK2A 2P5GA 3QMQA 4I9LA 1IBKJ 2PSZA 2VC0A 5KFMA 2R7XA 4L8RB 4Q45A 2VPZB 3QRRA 5AE3A 3EXYA 5B0DA 1FT8A 1HA1A 2RE2A 1BDGA 2DNQA 2AJ2A 2ASLA 1TU0B 4OYBA 2HHVA 4DI6A 4QOZB 2WSEC 1VQKS 1FTRA 2QT7A 4J91A 1NK5A 4BWMA 1TP7A 1NK0A 2Y1LB 5E33A 4X62F 5E3PA 3H8YA 4YB6A 3TYTA 1XMQF 1CJVB 2KKHA 3KK7A 4CK3A 3BEXA 3LDOA 3SLCA 5B08A 3G8TA 4JV5J 4IFYB 4MDAA 4EMDA 3H42A 4TSXA 3GPAA 4FWNA 1TFWA 4YOWA 2VQEJ 3G82B 1K73O 2LA4A 3HD2A 1F9HA 1CS4B 4BDZA 3OPKA 1F2GA 4NA2A 4CNZA 3ZT0A 2XC9A 1IG8A 2RRBA 4BRMA 2ZDOA 2X78A 4CO2A 3F41A 1FVQA 2VBZA 1WTBA 1HR0J 3A13A 1WLJA 4CH0S 5IT9O 1LW2A 3ISNC 3A5NC 2FZGB 3IWNC 2DHSA 5CCMA 3C46A 4CCHA 4JI0F 4BE1A 4BC4A 1WTFA 5KT7A 1AB8A 2IVYA 4FWMA 2Z57B 3AVAA 2NUBA 1F0XA 3L3CA 1ZBHA 1WHVA 2GJ2A 1FXDA 3I55S 4K59A 3BS9A 4AILC 2F9JA 3EZUA 3O6WA 3ZZZA 3AVHA 1RA7A 2U1AA 3KK1A 3JS6A 2FLOA 1KFSA 3PJWA 1ZOTA 3F73A 1VQPN 4LF7J 1A0OB 1NLVA 4O23A 4N41A 4A8FA 4E7JA 2UUCK 1WDDA 4JOUA 1HARA 4NLWA 4DMNA 3DMJB 5E5NA 4Y34A 3JXUA 5MLCV 2PI4A 1J5OB 4KRFA 4MJKA 5EWGA 1NZ8A 4U9RA 2WW4A 2OPPA 4AD6A 2J4RA 2ZKUA 1SB6A 1J6ZA 4DR3J 4FPBA 2HRYA 4H0YB 4P2SA 3M9OB 2ASPA 1KXPA 1QUVA 4O5BA 4JHDB 1RLDA 1MA9B 1KHVA 1AZSB 2ZD1B 1BUXA 3LL3A 2I7PA 3NBPB 3F9MA 4LF6F 3IR6B 3E3XA 1B92A 1YJ9N 1VQLS 5EX5A 5ETPA 5JMVA 4HDGA 3LPEA 2HMPA 5D3GB 4LT6A 5LOQA 4NMXA 1RT2B 4ISGA 1TUUA 1T02A 2UU9K 3JYTB 3HBTA 2V2VA 3LP1A 4CEFA 2AMCB 5CABA 3SQ1A 3T5HA 2RPIA 3DXMB 5JUMA 4MK7A 3V6JA 1U1KA 5KFKA 3LPUA 2YHWA 3LP0A 4JI1J 1R8HA 3GJSB 4X4OA 1T9TA 5B0GA 3BKUA 3CUNA 3MD1A 3NF8A 4HVJA 2HF3A 1NJIO 3CXCM 5DM7L 3LZJA 3RSEA 1CXQA 4CDIA 3MPUB 3OVSA 5D0GA 2JWLA 1BQXA 3GLJA 1RT1B 2PE8A 2BA9A 4CO5A 1RISA 1VQ6S 4LFCF 4AHCA 2C2OB 3Q7CA 4BR4A 2A18A 1WEYA 2FBVA 2OSQA 1VI7A 3I82A 2QA4S 1CJUB 3AH6A 4CJKA 4KTQA 1WEXA 4DJBA 3JQMA 3DM2B 2B4OA 2DNHA 4RL1A 5KGWA 1RDDA 3CMEN 2MQ8A 5M2RA 1RDAA 3OFHA 1HYSB 2XMWA 3CJ0A 1NNEA 4DF4A 1DFDA 2O8CA 4JRPA 1NG9A 3SUQA 1HKCA 2F8EX 4CJTA 5KFIA 4X4SA 2NRWA 3ZTOA 2LDIA 5KG5A 5DRKA 2H9ZA 2YX1A 5BRHA 5A8RA 2IC3B 4OV6A 4GV3A 3AA4A 1FK9B 4CBUA 2B4JA 5GAGU 1PJ7A 1RT4B 4O3NA 5ADXH 2RHQB 4PG6A 4K2JA 3MEGA 2E6LA 3PACA 3CCUN 4TLRA 4R79A 2HHHF 3RAQA 4FYVB 4FN5A 4N5SA 1Q86O 3CMAS 1FRLA 2LXFA 1IBCB 1ZPWX 2KHDA 2VODA 4C0BA 2ZOMA 3P31A 2CQ1A 4GKJJ 3K5PA 3UD4P 4FWOA 4N8NA 4W5TA 3LWLA 4DN9A 4IO9Q 3G87A 2H1YA 5GIPA 3GR0A 5AXNA 5HP1B 3JSRA 2YY3A 4DPTA 4CD1A 3D0IE 4WFAQ 2E44A 5GMEA 5L46A 3GG0A 4DPOA 4CEAA 1Y9OA 4PWWA 1QY7A 3E9PA 1OKJA 1MWYA 2Z8QA 4C3KA 3HHKA 4NLXA 3GV5B 3KLIB 4JK7A 1VHIA 3PIOQ 3J81U 2R2SA 2YX4A 3O8WA 2DNOA 1K1SA 3IM9A 1Y5LB 2HBYB 3DLJA 5A8WB 4PWDA 1U1OA 3KLHB 1X8DA 2OLWA 1X0FA 3P5TL 4KREA 4NLUA 1RDUA 4I2QB 4CNYA 3T1HF 1T95A 4DEZA 3FFIA 1U0HB 3QRPA 1VBZA 1RA6A 2P9LA 2HNDB 5HATA 2FF3B 2VG7A 2R2TA 1VSHA 1MWQA 2YPYA 3CJKA 2WB1D 5FRNA 4J8FA 4Q7AA 3HX9A 3TUZC 2HGMA 3SFUA 2CQCA 2QFJA 2B8PA 4NE9C 1NK7A 4M8LA 1DTQA 4RUCA 3KHLA 1KTQA 4CK2A 4ILJA 4G1QB 3VA3A 1IKYA 1ZZNA 1L3UA 4AL6A 4JD2A 4QPXA 1IBKK 1HNZF 2GQ2A 2XMTA 1XQIA 3HP9A 2UVVA 4QQBA 1H98A 2WVBA 4I1TA 4GVLA 2HZAA 2HRUA 1CZ9A 2QG9B 1HLUA 3MDQA 4FKYA 2XS7A 3HSJA 3THVA 4IQXA 4CLLA 4DUZJ 3KLFB 4M94A 4M3YA 4OZ3A 3IA0A 5HQ8A 1F3FA 2CZ4A 2B9YA 4FXDA 3PKYA 2AT1B 4JV5K 4Y0FA 1HW8A 2VQEK 4I7FA 3DWLA 3NEKA 1SH2A 4B1UB 1TL7B 1S72S 1PC4A 3RW7A 1BOTO 2B56A 3BBBA 2V4QA 3E01B 1FKAF 5M1FA 4AHTA 1RGIA 3HVTB 3QZ8A 4ELTA 3QDKA 1XN9A 3ENAA 3DRRA 3K5OA 3SCIE 4FDFA 4HHTA 1Q9YA 5KPTA 4Y28C 2IMWP 1PGZA 4EIAA 2PFFB 3UIQA 2O8FB 4X4NA 3JXOA 3ATVA 4RG8A 1IKVA 3EVOA 1D9FA 1EETA 2VWJA 1P90A 3QQCD 4DV4J 4FLTA 3EE3A 4HL9A 3CCMN 3CDEA 3CXCR 4DHVA 3FZLA 1DY3A 2NXUA 4OJRA 1RKIA 1TVRB 5JLHA 1VSKA 4ZHRB 2ZZNA 3VQ9A 4LF4F 4DCJB 4FL9A 3M8PB 4LF7K 1S0MA 3FMBA 1VLYA 4ISEA 3TEHB 5CZVA 4A8MP 3MFHA 1Y0HA 3I9V9 4NLTA 1FRIA 1GOCA 2GQCA 3OSPA 4CESA 5U47A 2P9IB 4NX9A 2ZWOA 5LMNF 1WNEA 1U25A 4HH1A 4ED1A 1X4FA 3OT9A 4DS5A 2HHWA 2Y8YA 1U09A 1NMNA 2JVRA 4ILRA 4KI4A 3G8QA 2IYIA 2X6SA 2YPZA 5AJ3J 4OHZA 4E1JA 3IWLA 1LNQA 5HLFA 3GWCA 4HDHA 2FVRA 5LJ3Y 1WNSA 2QMXA 3GG4A 3LTOA 4EGLA 1S59A 3AVBA 2JLFA 3VQCA 1YX2A 1RTZA 1YJTA 2X6NA 1UFLA 4LFAJ 4DLGA 4OHYA 1J5EK 2JEJA 2JX2A 2LXUA 3G86A 4WU2A 2GIFA 1YJWN 3KTQA 4JI1K 3CPWM 4OI6A 3R9LA 2ZDPA 3RRHA 4LF5J 4OVLA 2YKQA 3T6BA 4DV7F 4PUOB 2W2OP 4OLAA 2OUGA 2BKNA 1WC4A 3TVKA 5DQHA 1VQ9N 2IHR1 8AT1B 3NRBA 5GAHP 1T9WA 4YDUA 4L6V3 4ECQA 3OYHA 3ILLA 4CM0A 3GYGA 2D0AA 3CJ3A 1PIEA 2WVFA 3LDNA 4I0WA 4I6WA 2EFPA 3K7RA 3W64A 3U1NA 2ZE2B 1QAIA 3MM6B 2VOPA 3W9HA 4H0VB 2DGWA 4YR2A 1LWFA 2DGVA 3VQDA 5KGXA 1MW7A 4C8LA 2W01A 3UN3A 4ZITA 2QL7B 3G6EN 1S99A 3OYKA 2L08A 3GR1A 3ULHA 2FBTA 2APOA 1FWPA 3PYDA 4R0EA 3VGLA 1V3ZA 1KWMA 4OGCA 3OL9A 3VQBA 2N7YA 4DV1J 2DFEA 1BE4A 4R8UA 2HGNA 4IFVB 3VN5A 2BM1A 2OYQA 2QSWA 3IRWP 1WUUA 2HQFA 1TK8A 1NPRA 1TKTB 5LY3A 2I5JA 3P83D 3IR5B 2PIIA 1UJ4A 3GJRB 4DV6J 4H03B 4B3TK 3RMAA 3MECB 4OYPA 1M0SA 4E7KA 2V2KA 4EYHB 4BRDA 4GKJK 5M1NA 5IFMA 2FYXA 3M9NB 3EVMA 3J7YI 3CJAA 1Q5YA 3NL0A 1HNIB 3CCES 4M3TA 2DYAA 1NGHA 3FEXB 1HWJA 3QERA 1GX6A 4CLFA 1YJUA 3CEDA 1Y10A 3R1LA 1BU6O 4I6MA 2DO4A 1FXXA 3O9UA 5JMNA 3W8PA 4CF9A 3N4PA 2E66A 1KS2A 2XSFA 1B3TA 1K8KA 3AGKA 3K0JA 3EL2A 3TAFA 4A5AA 1YBUA 2AGOA 2B6AA 3VAKA 4ATNA 1JJ2M 2GUPA 1RTHA 2BW7A 1ZBUA 5EUHA 3PZPA 4F3TA 1WDTA 5HRNA 5KFPA 1N56A 1JMTA 5EDWA 5KFFA 4RW8B 3QFWA 4FS1A 3D66A 1NJWA 4B3OB 2WHOA 2MY8A 3HMJG 5I3QA 3LP2B 3BO2A 1J27A 1Z6RA 2QLBB 2ZH8A 3HYFA 4P73A 5F1XA 1IWAA 4Y2KA 3B6BA 2DNMA 2MYFA 1HJRA 4DX6A 1NZAA 4ED3A 2IJRA 1ZYQA 1HLWA 1SKUB 5M1QA 5AQYA 3DYAA 3K8VA 3BBCA 4I6AA 4CO1A 1N8RT 4ID1A 1FVSA 3ASMA 3BUZB 4AF1A 2AGQA 1VIOA 3QLHA 1R8PA 1RWUA 4I56A 4DG1A 5L9NA 1T8EA 3E9OA 3TAEA 2KXFA 3KLVA 4NZ7A 1SS6A 4N56A 1OYDA 3N5FA 2DVIA 2GMJA 4CZMA 3LDLA 2K7KA 1KVCA 4JKGB 3L4BC 2D1KA 3KHRA 1OMSA 2ROGA 3BB5A 4DDFA 3I55N 1JNRB 1S1WA 1BQMA 2OO4A 2B4PA 1WBBA 2VGMA 4CJPA 1S6UA 1UFWA 4RW7B 2FC9A 2V4JA 1ZH5A 4B1XB 4CJUA 3VAJA 2ZUAA 2UXDJ 4RKUC 4RNOA 2PD1A 3PHTA 5CCLA 4LFBJ 3Q8YA 4HI2A 3J80O 1Q9XA 4UQGA 4OLPA 4DU4A 2IRXA 2KT2A 1VQMN 4OFZA 3VAIA 3QMLA 4BR9A 3CPWR 5D6GA 2AJ4A 2DRAA 4DV4K 5CY4A 2Y1JA 4IG3A 2G8KA 2DHAA 3VEOA 3L7UA 3TSUA 3BKFA 2IM1A 3GE9A 1VQLN 4MH8A 4WFYA 2BTFA 4F0MA 2AU0A 5HRRA 2G8IA 1D0EA 4LF9K 1Q0NA 3D67A 1KTVA 4CT8A 3D5MA 2VDIA 5MAOA 3HO1A 4DR1J 3A5LC 4L76A 1RILA 3MOJB 3E1YA 3CFOA 4UW2A 1JLFA 1VHFA 2YCHA 3RB3A 5BPNA 3QT5A 1YJVA 4Y2IA 1U47A 3SPYA 1IG9A 4ES3A 3ENOA 3H2LA 2B4UA 2DPNA 2MY7A 3CG7A 1R8BA 2IDEA 3SBGA 2PEBA 4EHUA 2J9DE 5KPRA 2L48A 2HHTA 4FLUA 4C8MA 1RE1B 4K4SA 1J54A 2AIRB 4BR2A 1VQ6N 2CDQA 2DITA 1KCFA 3D6MB 5IC6B 1JLBB 3N6MA 1L5UA 2QA4N 1IV0A 4XH4A 3WNEA 2P9KA 1MMLA 2GVDA 2Z0GA 1LK7A 2VG5A 1RHUB 3HF5A 4OX6A 2RIJA 1UTAA 4EYIB 2CUYA 1HNWJ 4LFAK 1RTJA 4JKDA 2CYYA 2R7SA 3D0GE 1U1QA 1I1GA 1TZ0A 1HW9A 1JCFA 2RQKA 4LC9B 1FRKA 3SSSA 4NLRA 3DRXA 2E29A 3FK4A 1RBRA 4NEZA 4LF5K 3I96A 4YB1P 2ATQA 4MAKA 4IOAL 2O01C 1QQNA 2HVDA 4HTIA 3VGVA 1HI1A 2GEMA 4MMOA 4FWKA 1QDUB 3LP1B 5HRSA 1DURA 5B0FA 4FK4A 1NU4A 1NAQA 3D2EB 3R3TA 3R1XA 3ZZPA 3SSQA 3LP0B 2Z2LA 3CMAN 3OYLA 2ZWPA 3MCMA 1EQ0A 4NXNK 1P1LA 3SSRA 4A8QA 3PG9A 4W4MA 1JJ2R 4IRDA 3ZNJ1 2J6SA 5CZ2A 3AD7C 3CQXA 3QWPA 3RSEB 2LEAA 2YBVA 4BRGA 2R4FA 4LF2A 7FDRA 2JL9A 1WAFA 3H3NO 4ZP7A 5B09A 3VERA 1N32F 3LA0A 3MN7A 1FI4A 3G96A 2BOPA 4BC5A 1HD1A 2JWKA 4O0JA 4CP5A 5E3RA 2HWHA 2GNKA 3SCXA 3HI0A 3I5BA 1JXBA 4B08A 1IH7A 1HWUA 4A48A 5ETRA 1N34J 1OSCA 3M1VA 4ZJOA 1Q82T 1VMBA 4HUFA 5KG6A 2Y1IA 4YP3A 4B9TA 1S48A 3TVZA 2IY5B 1WI8A 3OUYA 3I5CA 2UV8A 3T9NA 4DV5J 4J9QA 2MZJA 4NLGA 1U7LA 2KG0A 2BE7D 3NCRA 2AJQA 5KFDA 3I31A 1FDBA 4FJNA 1QSYA 1FDAA 2RILA 4DV6K 2BQUA 3MM5A 2VQFF 4J9VA 2YNHA 1HNVA 2UVWA 1T94A 2MZTA 3OYJA 5I42A 3BGUA 3WIVA 2LU1A 4GW6A 2J0QD 4F3OA 4U7UD 4OL8A 3QAUA 2FC8A 1R6VA 4NXMJ 2DCLA 2W9BB 3NAIA 3FRZA 2D74B 3WQPA 2R8IA 2XHBA 2QWNA 2CQ0A 2UUBJ 2PT0A 2FVSA 3KVGA 3K89A 4IZ9A 2CZ9A 1HQ2A 4RLEA 3U9ZA 2KKZA 3Q89A 1JXLA 3GIIA 5E26A 5AQZA 3DOLB 1VISA 1H7XA 4Q0BB 1V4TA 5LMUJ 2EWHA 1ZBSA 2JLEA 4LY7A 1EX8A 1VBYA 5HVFA 1KN6A 3EGZA 5IOLA 4TYBA 4XTTA 4K43A 2FUG9 4X84A 1MWZA 4DR6K 2VOOA 2J7WA 2F7VA 1MMDA 1G4CA 1XNQF 2ZHAA 3W63A 2CJQA 3TA0A 2R7WA 4Z7YA 1RWPB 4Q8EA 2ZH7A 4Q8FA 4B9UA 3PM9A 1GAOA 3S9HA 1Q95G 2P9LB 2NUHA 4UF4A 5LXYA 2VG7B 3SAGA 5F41A 3CJKB 2AZ1A 2ALZA 3N0VA 3L6QA 4U8YA 2E7WA 5ITHA 4K50A 2M52A 1DTQB 4OHVA 2IVMA 4CO3A 3O9QA 5K8PA 4IG0A 1HHSA 2CPHA 2EK6A 4HT5A 4D3HA 4NLQA 1K1QA 3RB0A 3P5JA 3T1YJ 5H9FJ 1WAJA 4WZMA 1QVFR 2BJDA 5CYMA 4OI1A 4AHVA 4OX8A 3AB4B 2DXDA 4BRKA 3AVCA 5AXKA 5AQHA 5T41A 2XS5A 1Q7YO 4ED2A 1UJ5A 3DGVA 3ZSWA 3EWGA 3LDPA 2UXDK 1RT5A 2CA9A 1NDCA 4BRCA 1T44A 4JS5A 2C3YA 3GV7B 2P5OA 1WG1A 2CPDA 4AH9A 1G1XA 2ZWHA 1REGX 1RKJA 3C6TA 2F8HA 1YBTA 1KFDA 3SJHA 2IM2A 1NSPA 4I7FB 4H8KA 4DTMA 2WTUA 3SNNA 5GAGI 1J2VA 2LA6A 2NCKL 2FBXA 4BROA 2XLJA 2HWIA 4EFAC 3TJ8A 2GWJA 4I68A 2BW2A 2D0BA 3IBCB 2UUAJ 3DRRB