2YKNA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
557
structure length
557
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPLLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
total genus 163
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yknA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yknA05
3MR2A 2KTQA 1JLGB 5F8GA 4ZPBA 2XO7A 3V9ZA 4QW8A 4RW7B 3H5YA 4B9TA 4F4KA 1D1UA 3B6OA 2DFFA 4CHNA 4CJ5A 4RNOA 4OPJA 1UOCA 2KW4A 4DU1A 1VRUB 1LW2A 5KFCA 3VQ4A 3V9WA 1GOBA 3H5UA 1J54A 4I9QA 1NNDA 4Z4HA 3RR7A 1FKOA 3V81A 2GC8A 5KGXA 1KRPA 4TLRA 2RPIA 1NKBA 2Y1IA 4HHTA 5KFKA 4OGEA 1B9FA 4FK4A 1C0TB 3ZSQA 3H4DA 3TQ1A 3LP0A 3MXJA 3I0RA 3G10A 2PY5A 4H54A 1TKTA 1ZBHA 3I8DA 4FXDA 2FVRA 3Q8SB 3QIOA 3MTKA 2ZE2A 3OYCA 5D3GB 2VG5B 4RNHA 4CGDA 4ID5A 2W9BA 2KQ2A 3UR0A 3S9HA 1FXXA 3LP2B 2BANA 4Q0BB 1S0OA 2R8HA 4GVMA 3EPGA 3O4NA 1TL1A 4J9LA 4FYDA 4ZVHA 1KLNA 4DL5A 1W25A 4NYNA 1HNIA 4Z4GA 1HYVA 1W9HA 3H59A 3OS2A 2HHUA 4CEAA 5EWGA 4DS5A 3C6TA 1RA7A 4FW1A 4EYHB 4C8MA 2P5OA 1N4LA 4O0JA 4NCAA 3FDSA 1B9DA 4JLHA 2YV0X 2I5JA 1RILA 4KKOB 1U45A 3CDUA 1ITGA 1TKZB 4O3RA 2R8IA 3M8QB 4Q45A 3MEEA 2Z1IA 1TKXA 4BE1A 3SYZA 1S1TB 4ELUA 4RU9A 3MAQA 3K5MA 4OKKA 1I39A 4GC6A 4NRTA 2WCXA 1EKEA 1RTJB 2XI2A 1N6QA 4AHSA 4BACA 3VQ7A 5KFUA 4YP3A 3D5MA 3FRZA 4QW9A 5F8NA 4FW2A 3GV5B 2DPIA 4URGA 4FLUA 2GIQA 2E9TA 1T8EA 3DRRA 3BSAA 5DLFA 4C8LA 2IM3A 2EX3A 1UA0A 2VG7A 3TAMB 4DWIA 3MEDB 3OLBA 4O44B 1BHLA 5FRNA 4O4GB 2FBTA 1NHVA 3JYTB 4BDYA 5C42B 2V9WA 3SUQA 3VQEA 5K14A 4EBCA 2OA8A 4RW9B 1S0NA 1TAUA 4O3SA 2WONB 4TSXA 2YNFB 1RT6A 1HPZA 4FJIA 2DTUA 1ZBIA 1X9MA 2C2EA 3PHEA 4NLTA 3OYBA 2KZZA 5KFWA 3T5LA 3KK2A 4ZMMA 3L3UA 1CZBA 2KZMA 2XC9A 2IMWP 1RT4B 4ZHRB 4IRCA 4HVJA 4CCHA 2GV9A 2D41A 1HYSA 5CYQB 2W8KA 5L1LA 4DFKA 3KNAA 4PWDB 4ED6A 4DU4A 2A1RA 3DLKB 1VRTA 5C24A 3FFIA 2J6SA 5DGAA 1C6VA 1NKEA 1HNVA 3ZCMA 3GV8B 4Z4EA 3CM5A 1KVBA 4O5BA 1RNHA 3CDEA 1HMVA 3RRHA 1TV6B 1WSGA 4TY8B 5HLFA 1T7PA 4M42A 1UWBB 3KD1E 4DL4A 4DSLA 1BCMA 4NLUA 4CJUA 3TR8A 4O55A 1C1BB 3QGGA 3GV7B 3HPGA 5J1EB 3BQ1A 4J2DA 4DL7A 3TVKA 4DQQA 4E7LA 1Q9XA 5HRPA 3OYIA 2YKMB 4IG3A 4IFYA 1T05B 3GQCA 3T19A 2W9CA 1K1QA 3HP6A 3MR5A 3AVIA 4ICLA 3AA2A 4WE1A 3EPIA 4JRPA 2RF2B 1S9EA 4NLQA 3PW0A 2B5JA 1UAXA 2HNDA 5HP1B 1HYZA 5SWMA 3P83D 2IBKA 1NJZA 5DGBA 4G1QA 2AU0A 2VG6B 5L1IA 4GC7A 2OH2A 1BISA 3HL8A 1ZTTA 3V1RA 1REVB 1BQMA 4GW6A 4N76A 1RT7B 4KO0A 1S9FA 1HARA 5EWEA 4YR2A 1U04A 4NLDA 1JLCA 4ZP9A 3RBEA 2E6MA 4EZ6A 2X74A 4DL6A 1JLFB 1O1WA 3KLEA 1S6PB 3OYFA 1RBTA 3ITHA 4FS2A 4TY9A 2HNYB 3WNHA 4FLTA 4C8NA 4NRUA 1C1AA 2C22A 3OJSA 4Y1CA 2P51A 4I2QA 3IRXA 1LWEB 5KGWA 2RDJA 3DYAA 5F9NA 5KG5A 1IKXB 3NH0A 3H08A 1VSKA 1RT3A 3LAMA 3KLFA 3BSOA 2IM0A 1SUQA 2RKIA 4OGCA 3VQPA 5KRTA 3DLEB 3L3VA 4FJJA 5HRNA 3CWJA 5EU7A 3H5XA 5KFVA 3KLGB 2F8TA 4CF0A 4JRQA 5DMRA 1LAWA 2XGQA 1W0HA 2HNZB 4I7FB 2ZD1A 4KFBA 1LWFA 2YHAA 3AVAA 3I5CA 4ECSA 3NL0A 3ICLA 4K4YA 3BDPA 3TARA 2XHBA 4KB0A 4M3XA 1RTIA 3RR8A 4CFDA 4ED3A 2WB4A 3AO1A 5J2MB 1U09A 3FQKA 3Q8RB 3IG1A 3ZSWA 3NKYA 1JKHA 1SKSA 3LPTA 2OPRA 1KVAA 1D8YA 1FKPA 1SKRA 4IRKA 1D0EA 4QWAA 3IN5A 3QGHA 2JEJA 1KLMA 4DS4A 3V6JA 4BDPA 4FS1A 3KJVB 3HP9A 4B3OB 1EP4A 3NAHA 1EETB 4O3QA 1NK6A 3AVJA 3QNOA 5KFLA 3M9OB 2HWIA 1HRHA 4NLXA 4NCGB 4CIFA 2BGGA 3V6KA 4E1NA 4KHSA 2R8GA 1T94A 4O3OA 1FKOB 4NLWA 5KG3A 5KT6A 4CF2A 4DSFA 3MXIA 4FK0A 1JX4A 3AVCA 2D3UA 4RW8A 1NOYA 4R0EA 3H2LA 4DMNA 4AH9A 4CGGA 3CJ2A 1L5UA 2X78A 5I42A 4YMEA 5L1JA 5FRMA 4DTJA 3LP1A 2VWKA 3IAYA 5KG0A 2E4LA 2FC0A 1YVUA 4KSEB 2FVCA 4XIUA 3GIJA 3V9SA 1DTQA 4ELTA 3QEWA 3LPUA 1RT2B 3SQ1A 4CE9A 4O0IA 3DM2B 4LH5A 3S3NA 3CJ4A 2WK4A 3L2UA 3UDLA 1S5JA 3NCIA 3OJUA 5HROB 2R7YA 2V0NA 1IKVB 1IKYA 5J2PB 3A2FA 5FDLA 3QGIA 2OPSA 3KK3B 5HRSA 4KBIA 4FJ5A 4QPXA 3V1QA 2PZSA 1L3VA 4QCLA 4OLBA 1T03A 4K4XA 3ZT2A 2HHVA 5KFXA 2FLPA 1QSYA 4DTMA 4ECRA 3C6TB 3CJ3A 4EZ9A 4DU3A 4WYLA 3TAEA 3OYNA 3EZUA 1NK7A 4IKFA 4W5NA 1ASWA 3E01A 1QAJA 4BE2A 1JLEB 1J53A 4CK1A 2YNIB 3NBPA 2YNHA 3M8RA 2IC3A 3HVTA 4H4MA 2ATQA 4EO8A 4FLZA 1GX6A 1TKXB 2F8SA 5C25A 3HKWA 4TXSA 4N56A 1Z26A 3OYEA 2FBVA 4FJLA 1IH7A 1VSEA 4KHUA 3ULDA 3ZT1A 3WNGA 3RAXA 1RT1A 4TQRA 3DRSB 1WSFA 4DL3A 3K58A 3ZT3A 3VQSA 5F8MA 4R8UA 2EC0A 2F8EX 4FJ7A 1S1XB 1WSJA 1C0UB 4MKBA 2Z1JA 2JEFA 4LY7A 4M94A 4B9LA 5JS2A 4Q44A 4AILC 3BJYA 2X6SA 4DTUA 4CJPA 1NK4A 4IRDA 3MFHA 5F8JA 2C2RA 4B08A 2G8FA 2PYLA 2HMIB 3PUFA 2VG7B 4F4XA 3VQQA 4KI6A 1XC9A 4CEBA 4WFXA 1I3AA 1VSDA 4QWEA 4IOBA 4NLSA 2ETJA 4IR9A 3SJJA 4IG0A 1S9GB 4QAGA 4FBTA 4MK7A 4W5TA 5SZTA 4X2BA 3OHAA 3OYLA 3DLGA 1HQUA 1S1WA 3ALYA 5DG9A 1HPZB 1BI4B 3V4IA 3RAQA 3MR3A 1ASUA 2R2TA 4FZXC 3QIPA 1ZBUA 3AO2A 1XR5A 1CSJA 1KFDA 1S1VB 1QSSA 1TL3B 1KVCA 3DOKB 1S1UB 3ZSVA 2VA3A 4CECA 4ELVA 4MH8A 4J9MA 1EX4A 1U49A 4ZPCA 4Y2AA 4CJEA 1VRTB 5C24B 4HUFA 4DF8A 1QSLA 5KFSA 4MFBB 3VQ8A 1UA1A 2BE2B 1Q8IA 1RTDB 3VA0A 1R0AA 1C0MA 2XI3A 4DTOA 2JLEA 1QAIA 4CEZA 1JXEA 1GOAA 4CEDA 3D28A 4OVLA 1BIZA 4CFAA 4MK8A 5I3UA 1KCFA 4WZMA 3RMBA 4F4WA 3C95A 4E19A 1WAJA 3ZT4A 4J9KA 2KFZA 4MIAA 1BQNA 4U6PA 3I0SA 3SI6A 1HQEA 3KMQA 2Q3SA 5EWFA 1L3SA 4PUOB 4JV2A 3L2QA 2XCAA 1C1CB 5KI6A 4L8RB 4M3RA 1YVFA 5C5JA 4C8OA 3MECB 3SV4A 3QEPA 4I9LA 4LD0A 3IS9B 1NK0A 4EBDA 3KLVA 3VA3A 4J9RA 4TQSA 2IM2A 5JUMA 1MU2A 2D3ZA 2FLLA 4W5OA 1IKWA 5KFFA 4LQ3A 3QLHB 5T14A 1TVRA 4IFVA 1VSHA 1N5YA 4RUAA 1JLGA 4Z4CA 3FSIA 2JEGA 1FK9B 1QS4A 1LV5A 4B8CA 3L2RA 3NF6A 2WHOA 1BL3A 1LAVA 4RW7A 4RZRA 2ATLA 1BQMB 4LSLB 4FJ9A 4KO0B 4J2EA 4F3OA 1A5WA 4E3SA 2XWYA 1RT5B 3SUOA 4NLGA 1JLCB 1QTMA 4RNFA 1BIUA 3SUNA 3G86A 3LP3A 4ED0A 3C6UB 3LZJA 2D5RA 2Y1JA 1VRUA 2YHBA 4ED2A 1NKCA 4ZVFA 2FLNA 3N6LA 5KFMA 3N6MA 1OS5A 4WZQA 1QE1B 1NJYA 3JSMB 4AHVA 4KAZA 3KMSA 1RBSA 1JXLA 4DSIA 4PA1A 3BGRA 4F50A 3DYAB 4B9NA 2ZQBA 4F2SA 3KHLA 2VA2A 1NJWA 1ZTWA 4KHYA 5KFYA 1LW0B 1N48A 3SQ2A 2IS3A 2RKIB 3KHGA 2WOMB 4FLWA 3RMDA 4CEFA 3HPOA 2AQ4A 3TAPA 2XGPA 1Z4UA 5D3GA 3DOLA 2VG5A 4EYIB 4ECZA 1J9AA 2YKNB 2QV6A 4LSNA 5T7BA 2BQ3A 3LP2A 3S3OA 3O3HA 4KFBB 1LWFB 3CO9A 4FLVA 3O4QA 1WNEA 3MFIA 1QHTA 2G8KA 4CJFA 4CJWA 4FJHA 3TAGA 4IDKA 2XY5A 2Z1GA 1J5OB 3ZT0A 1RBRA 3SFUA 4AHCA 3DI6A 4Z4FA 2DPJA 3QZ7A 1JKHB 2P5GA 4DTRA 4ECYA 1K6YA 2OPRB 5KFEA 3U3GA 2G8HA 1N56A 1FKPB 4KE5A 3G6XA 4KKOA 3EYZA 2IGIA 1RYRA 3PR4A 1G15A 1RDDA 1TKZA 4B8AB 3KLIB 3PZPA 1GX5A 3M8QA 4B9UA 4NLVA 4R5PB 3M8PB 4NLPA 5KFNA 1S1TA 3KLHA 3BSCA 4HCCA 3VQBA 2C2DA 1RTJA 3T5JA 4EP4A 2JEIA 3SUPA 2YNGB 4XPEA 4CHPA 3QO9B 4DQRA 4H4OB 4ZTFA 2C28A 5DG8A 2HWHA 3KK1A 4RG8A 2BRLA 5DLGA 3V1OA 3WNEA 5F9LA 4K4TA 1JIHA 5CYMB 4MIBA 3H40A 5I42B 1D9DA 3LP1B 2D0BA 1VSJA 3PO4A 1JLQB 4E7IA 2R8JA 4KAIA 1KTQA 3OLAA 1TK8A 1S6QA 3TAMA 3MEDA 3F9KA 1DTQB 2J6TA 2I1RA 4OKEA 4E7HA 4O4GA 3BR9A 4N41A 4KHMA 2OZMA 3SQ0A 4CJQA 5C42A 3QYYA 4FJNA 1VSFA 3KOAA 4WYWA 2BRKA 5KFPA 4CJKA 1S0MA 2YNFA 1RTHB 1DTTB 3MEGB 3RB3A 3OSPA 3QINA 3OHBA 4CJ3A 4JS5A 2AWZA 1RDCA 3DLBA 3CFPA 2AX0A 1WLJA 4J2AA 2B6AB 3V6DB 4WXWA 4RW6B 1KSPA 3AA5X 4BE0A 2OPPB 3HVAA 4F8RA 4QWCA 5CYQA 3BREA 2IJNA 4Q8EA 3K5OA 4C8KA 3DLKA 3NMAA 4ECUA 3AA4A 4NLYA 2DFHA 3NBPB 1TV6A 3AO5A 5CY4A 2IC3B 4YFUA 3DMJB 1JL1A 4NYZA 3ZSXA 2BDPA 4FM0A 3V9UA 2ALZA 1UWBA 4KB7A 4K4SA 5CZ2A 3PY8A 1BCOA 4JUZA 4CJTA 3VQCA 3EZ5A 1C1BA 1ZYQA 3NDKA 3O3FA 4ZVGA 2HHSA 4BDZA 3ZSYA 4M45A 1IO2A 4DTSA 4K8ZA 2AX1A 5DK5A 3NF9A 4K4ZA 3PW2A 2YKMA 5E41A 2R2RA 1T05A 4J2BA 4ZP7A 3RB0A 2UVVA 3KKSA 1LW2B 1JLBA 3KHHA 4Q8FA 4AHRA 3NFAA 3QZ8A 5KFZA 1NHUA 4NZ0A 2QKBA 4FZYA 2J6UA 5KFGA 1Q9YA 2RF2A 4E89A 3TAFA 4Z4IA 4OJRA 3V81B 1KHVA 1RAJA 3AVLA 3SPZA 3NGYA 5HP1A 4CEOA 4JV0A 3I5AA 2VG6A 1JL2A 1CLQA 3LP0B 1S10A 1REVA 1RDRA 2IDOA 3I0RB 1RT7A 1LWCA 1EXQA 3NF7A 1XR6A 1TKTB 3HYFA 4CF9A 1TKDA 4CIGA 3QERA 2JC1A 5KT5A 4KB1A 4M41A 3D0PA 3PX6A 1VSMA 2OYQA 3M9MB 2ZE2B 3AO4A 3CM6A 4W5QA 2HVHA 3OS1A 1JLAA 3AVKA 4ID5B 2W9BB 1S6PA 3PX4A 3QETA 2IAJA 5J2NA 2BANB 4DFPA 3CFOA 1RDBA 2LSNA 2UVWA 2HNYA 3HHKA 4IH6A 1QQCA 1Y97A 4FCYA 3NF8A 1TL1B 1DLOA 3NAEA 3QNNA 4FZZA 3RRGA 1R0AB 4WXOA 4FJMA 1LWEA 2XRIA 4MQ3A 3DRPA 1HNIB 2E9RX 3DLRA 4MK9A 2HHWA 5FROA 3K2PA 4DQSA 4DF4A 3OL8A 3V9XA 3RMAA 2W7OA 2BQRA 4FJ8A 2OPQA 3DLEA 2XY7A 1WNSA 4M3WA 1HQEB 2I5JB 4DG1A 4YR3A 4XO0A 4KV8A 3CJ0A 4PQUA 4ECTA 3V6HA 3KLGA 2EHGA 3G0ZA 2FBXA 2O5DA 4AHTA 2FVPA 4HKQA 2E6LA 3TAQA 5KG7A 2QK9A 3MEEB 4I7FA 4YNQA 4K50A 2IOCA 1YTUA 4I2PA 2ASJA 4M3ZA 3LWLA 1N6QB 4DQIA 3OYAA 1L3UA 1TVRB 4IFVB 4ED1A 5KFOA 5J2MA 5KT4A 4ECXA 1GOCA 3H5SA 3OVNA 4NLOA 4FLYA 4CGFA 5L1KA 3DRRB 1JXBA 2CKWA 3PVXA 4CJSA 4FBUA 4HUEA 3PO5A 3QEXA 4O3PA 2PYJA 1NJXA 5DQHA 3KJVA 4B3OA 5KT7A 4YR0A 1U4BA 2HVIA 3OYMA 1D9FA 4FJXA 3HT3A 1EETA 2JC0A 3MXMA 3G6YA 2AGQA 5K14B 5KTQA 4OKJA 4NCGA 1T3NA 4KRFA 3PW7A 1RT6B 3UPFA 5DG7A 3OL7A 3LALA 1TQLA 4J9QA 1ZBLA 2V4RA 2GIRA 3GIMA 2QKKA 4DTPA 2IJFA 3BGRB 4RW4A 3KK2B 3THVA 4CFCA 4CK2A 3CYMA 5EDWA 5L9XA 3EY1A 4J9SA 1HYSB 1RA6A 2X6NA 3SPYA 1RBUA 3FFIB 4CGIA 3CJ5A 5F8LA 1HNVB 1SL1A 3L8BA 3SFGA 4K4VA 5KFRA 3NHGA 2ITGA 4OPKA 3HXMA 1RCHA 4ECQA 1HMVB 1WSIA 1RT2A 3DOLB 2O4IA 4CJLA 3DM2A 5HBMA 1A5XA 2A1SA 3SV3A 4LSNB 4EEYA 5KFDA 3AA3A 5HLFB 4FVMA 3RMCA 4CF1A 4KHRA 5J2QA 5HROA 1CZ9A 3K5NA 1IKVA 4IH7A 5J2PA 3RTVA 3KK3A 3L2VA 3OL9A 3PX0A 5DQGA 5JXSA 4FJGA 2AJQA 3SQ4A 1WSHA 3S3MA 1SV5A 3GYNA 3NGZA 4CFBA 4B9VA 2UVRA 1RBVA 4DTNA 1NK9A 4IDKB 1CXUA 3DLHA 2HW3A 1NK8A 4JV1A 5KFJA 4IG3B 4IFYB 3DI6B 1MMLA 2W42A 3SNNA 4EO6A 2P1JA 1XHZA 4DLGA 2W9CB 1JLEA 1XI1A 1SH0A 4TYAA 3AO3A 4ECVA 4ICLB 1K1SA 4J9PA 2HHQA 2YNIA 4WE1B 1KFSA 3RB4A 3HVRA 3LDSA 3TI0A 4H8KA 3IGVA 1S9EB 3PW4A 3WNFA 4FLXA 2G8UA 2B5JB 2IM1A 2HNDB 2D0AA 3KLHB 4CHYA 3LWMA 2XY8A 3PR5B 4G1QB 5KG4A 1Z25A 2CJQA 3DDKA 3DRSA 1ASVA 4DFMA 1C2PA 4F2RA 3HJFA 5KFAA 1S1XA 1C0UA 3KK1B 3TWHA 4DSJA 5KFTA 4M3TA 5F8IA 4HCBA 3KLEB 4DFJA 4KTWA 4XPCA 4G3IA 3NAIA 3ITHB 3GILA 3AV9A 3UQSA 5EUHA 2FJXA 3M9NB 3NGIA 3K5LA 2HMIA 4NYFA 3PJXA 1S6QB 2ASLA 4F4ZA 3T1AA 1TAQA 4DQPA 4I2QB 2ILZA 3IRXB 3RBDA 4N47A 1S9GA 3H98A 4RNNA 3F73A 4F3TA 1RT3B 2IA6A 2KFNA 4KHQA 4E0DA 1C0TA 5KRSA 3VQAA 3KLFB 3MF5A 1RYSA 4M3UA 1SUQB 2W7PA 1BI4A 4IKAA 2ASDA 3OY9A 3GIIA 1WAFA 2FVQA 3AVFA 3HO1A 4IR1A 5DQIA 5KFBA 4K4WA 1S1VA 1TL3A 3DOKA 1S1UA 3O3GA 1D5AA 4CIEA 4URSA 2G8IA 3KIOA 4BWMA 1S48A 2ZD1B 2HHTA 1NOZA 4Q0BA 1ZETA 3N6NA 4MFBA 2G8VA 2BE2A 1YT3A 4QOZB 2GBZA 4WFYA 4TYBA 4CHZA 1RTDA 1VSLA 4UQGA 4E7KA 3AVNA 5KG6A 4DSKA 1X1PA 4IQXA 3OL6A 4Y3CA 3QIDA 4AHUA 1RTIB 2BR0A 3ASMA 2RDIA 3BQ2A 4FM1A 2W8LA 3HPHA 3IG1B 4PY5A 1U47A 4DL2A 3PV8A 4ZPDA 2DFEA 2UUWA 3OYHA 3T5HA 3M8SA 4CESA 4PUOA 3HK2A 1SH2A 4ZP6A 5KG2A 1QUVA 1KLMB 4WFZA 1SKWA 1C1CA 1EP4B 4DSEA 1L3TA 3MECA 4LH4A 4OL8A 1JLBB 4GMJB 3IS9A 2FBYA 3PJWA 5CZ1A 5KT2A 4MKAA 4K8XA 3CFRA 4KPYA 3VN5A 4ED7A 4ZTJA 2Z1HA 1TK5A 4CERA 3QLHA 4E7JA 4RW8B 3Q8QB 1XHXA 4OLAA 1FK9A 4CHOA 3OYDA 1RDAA 2GUIA 2BQUA 3CG7A 1TGOA 4LSLA 3KKRA 1VK0A 4Y1DA 4CJRA 3SZ2A 1LWCB 3G6VA 1XWLA 3FQLA 3NGDA 1RT5A 3AVHA 1ZBFA 3AVMA 3SCXA 2AGOA 4O44A 3ZSRA 5KFIA 1X9WA 4KI4A 4DTXA 4EBEA 3C6UA 1JLAB 4QWBA 3JYTA 2IAJB 5J2NB 4RW9A 1S4FA 1QE1A 2WONA 1IKYB 3JSMA 4U7CA 3SI8A 1XR7A 1DLOB 5FDLB 2OPSB 2FVSA 3MR6A 3KD5E 4M3YA 3HVWA 3UIQA 3DRPB 1B92A 2WRMA 2QE5A 1T03B 3L2WA 5JS1A 3TANA 2HAIA 1RT4A 4ZHRA 4KHWA 3AVBA 4KHNA 1LW0A 2UVUA 4DLEA 4ZPAA 4PWDA 2B43A 2R8KA 2DY4A 2WOMA 2R2SA 3QEVA 5KFHA 4HUGA 2OPQB 3E01B 4ID1A 4DG1B 3KTQA 3RWUA 4KV8B 4PQUB 4F4YA 1SL2A 3I5BA 1SL0A 2O4GA 4CK3A 4RNMA 2UUTA 2YNHB 4IBNA 3HVTB 2YKNA 4CEQA 3LAKA 3NH1A 4H4MB 4TY8A 4CJ4A 3OYJA 2D7SA 1IG9A 5C25B 2WTFA 4DEZA 4I2PB 3K59A 3LZIA 3P5JA 3NE6A 3B6PA 2W9AA 1NK5A 3IGNA 4FK2A 4FJKA 3TABA 3ISNC 3PW5A 3QEIA 4KTZA 1RT1B 1I6JA 4URQU 3ZSOA 5J1EA 4O3NA 4LQ9A 4R8UB 4FM2A 4QWDA 4KREA 4E1MA 1J5OA 4ECWA 3Q8PB 3CDWA 2FJVA 1IM4A 2R2UA 1U48A 2XCPA 3VQ6A 4YQWA 2E9ZA 1WSEA 4CEEA 5KT3A 4CGJA 3KHRA 2AGPA 3C94A 2OZSA 2JGUA 3H4BA 1A5VA 3P1GA 3KLIA 1TK0A 2G8WA 4JS4A 4R5PA 2RN2A 3M8PA 2V4QA 4Y34A 4IG0B 4CHQA 4B9MA 4HYKA 3T5KA 1S97A 2XY6A 3DLGB 5KFQA 1HQUB 1S1WB 4CGHA 2YNGA 3QO9A 3V4IB 1BGXT 4TN2A 4H4OA 3QIPB 3CIZA 3RB6A 3AVGA 4HTUA 4RW4B 4ED8A 4O4RA 3VQ9A 1JLFA 2HB5A 4RUCA 3OSNA 5CYMA 3CVKA 4KTQA 4IH5A 1HJRA 2ZKUA 1JLQA 4ZVEA 1YTAA 3BQ0A 3D45A 5F8HA 3QESA 4NCBA 3VQDA 3K57A 2FJWA 4CF8A 5HBMB 1IKXA 4N5SA 3ZSZA 5I3UB 5J2QB 1S49A 3T3FA 1RTHA 1DTTA 3MEGA 4ZP8A 3U6FA 4W5RA 1BQNB 3I0SB 4NLRA 3HSTB 1SV5B 3E51A 4Q5VA 3OYKA 2B6AA 3V6DA 1X9SA 4RW6A 4K4UA 1TP7A 4BWJA 1WN7A 2OPPA 3GIKA 4Q43A 2HNZA 3LANA 4Z0UA 4CJVA 1CXQA 1SH3A 2VWJA 4J9OA 3ISND 2QXFA 4EP5A 4B9SA 4M95A 3NH2A 2HHXA 3VQ5A 2B4JA 5HRRA 3U3YA 3OYGA 1VSIA 2NUBA 1F21A 3OS0A 3HM9A 4J9NA 1KHWA 5KG1A 2ILYA 3CQ8A 3DMJA 1MU2B 1IKWB 2D0CA 4Y2CA 3BSNA 1N5YB 2F96A
chains in the Genus database with same CATH superfamily
3AA9A 1IBCB 1AUDA 2KTQA 1JLGB 3EGWB 1R8PA 2J5AA 5ETPA 2JFDA 1RHQB 1NGIA 1PKUA 2RDDA 4CDIA 1ATSA 4B1UB 3H5YA 2MQ8A 3B6OA 4CHNA 3F2KA 5AXNA 3JQKA 3SCIE 2AF6A 3LDNA 3SMPA 2QWNA 5KFCA 3IFEA 2V94A 3VQ4A 1G6BA 3RVCA 4HDHA 3SJHA 3P3DA 3W61A 3PTWA 4RUBA 1FKOA 2EFPA 3V81A 3QWPA 5K20B 3HM8A 2RPIA 2GO9A 3CD7A 5HL7L 4UOCA 1FXLA 4NB4A 4JI2F 5ETTA 3H4DA 1U24A 1QAXA 3TQ1A 3LP0A 1MWYA 3NGTA 3G10A 1B7FA 2QTWA 3PIOL 3I8DA 5BR8K 4FXDA 2FVRA 1RISA 4LF7K 2J9DE 1V3RA 1N36K 3OYCA 2DGTA 2VG5B 3OW2M 3DU5A 4ID5A 3UR0A 2DGUA 3AD8C 2DHHA 1VFJA 2RUGA 4A46A 3D0GE 3F0NA 2BE9B 2P2CB 4E1JA 5LL6d 1S0OA 4EU0A 1Y64A 3EPGA 1NGFA 4ZVHA 1KLNA 4DL5A 4YB7A 2J0QD 1W25A 1HNIA 1Q8LA 1W9HA 3H59A 3OS2A 4FWPA 5EWGA 4DS5A 1LEOA 4CZGA 3N28A 4X65J 2P5OA 5ETLA 2N7YA 3NGUA 4E8UA 2H65B 3J7AN 1B9DA 1H98A 3THWB 2BJ8A 1AXQA 3W2VB 5LL6Z 5ETMA 2HIYA 3BBFA 4KKOB 2DYAA 1ITGA 2WVBA 1TKZB 3AXKA 2R8IA 3MEEA 4BE1A 1TKXA 4DR3K 3VGLA 3MAQA 3K5MA 4LFCF 4PPZA 4OKKA 5J1NA 2H51B 1LNQA 2F63A 3TUZC 4GC6A 4I4BA 2VHGA 3B4DA 4AHSA 1IR0A 3VQ7A 3JXOA 5KFUA 4YP3A 4GO5X 3CIPA 5HI7A 4FW2A 1PYOB 3AA8A 1Z2ZA 4URGA 4FLUA 1VDHA 2GW8A 5JVHQ 1UMJA 3BSAA 4C8LA 3ZTSA 3CERA 2D1CA 3O8WA 2CPZA 3TAMB 2ZF5O 1FRKA 3G82B 4O4GB 4K0KF 3JYTB 5MAOA 1XC3A 1M0SA 3VQEA 3SUQA 4RW9B 4RUHA 3I87A 1RWNB 2WONB 2JSXA 3VESA 2IBOA 4DV5K 1XERA 2DNHA 3N5FA 5EOYA 1WUUA 2KZZA 3KK2A 4ZHRB 3GFHA 3CCLS 4NI2B 4BVOA 1HYSA 5CYQB 3RW7A 1VQNN 4PWDB 4ED6A 1Z1ZA 3NXZA 3W60A 1VRTA 5BREA 4JBCA 4DCJB 4BRDA 3GV8B 4ZPTR 4O5BA 4FF1A 1RNHA 3A5LC 4KT0C 1TV6B 5GADP 2MQQA 1NDKA 3U1LA 1UWBB 2E2OA 4WU2A 4CJUA 1IG8A 4KRWA 3TR8A 2UYTA 4DPOA 2QSWA 1U0SA 3QGGA 1VQ5N 4CBWA 5I3QA 4DL7A 3CE8A 4CZJA 3OYIA 1REGX 2YKMB 2PO4A 4IG3A 2M5YA 2MKYA 1SVDA 1T05B 3QWUA 2V4JA 2HOEA 5IZHA 3V2UC 3HP6A 3NCQA 3AA2A 2KYZA 3EPIA 3OFGA 2H1YA 1PCAA 4JKGA 2EK6A 4ZVSB 1S9EA 5JLFA 2B5JA 4FPRA 3I4HX 5M1KA 3MM9A 4C8YA 5SWMA 5GAGI 1WOOA 2QC3A 2HZVA 4QS7A 4WBFA 2OH2A 3K0SA 2O8FB 3CCES 3B82A 4HDGA 5BN9A 3V1RA 4PG6A 5AQZA 4KO0A 4BG9A 1NJIT 4YR2A 3N4WA 3RBEA 1EAYC 3W62A 3EE8A 1VQLN 2E6MA 4I6MB 1JLFB 4NEZA 1KXPA 1N5TA 4J90A 1ELOA 1S6PB 1RBTA 3P4IA 1OPIA 1X3MA 3MK6A 1F9EB 1Y0HA 3OJSA 2V34A 4I2QA 3SBTA 5KGWA 4NOHA 4HACA 3DYAA 1GXLA 1IKXB 3GR1A 3H08A 3SSSA 2VBWA 2IM0A 5D0EA 1SUQA 1CEZA 3MM7A 3W5XA 2KO1A 4FJJA 2RRAA 1M5KC 3CWJA 3KLGB 4JYAF 5DMRA 3CQXA 3ATVA 3QJJA 3TP2A 2XGQA 2ZD1A 1AYEA 2D4WA 3J7Z5 1GLBG 1OY6A 3AVAA 3G96A 2DR6A 4U67Q 1U6FA 1RAFB 1S7IA 3ICLA 3BDPA 2E2PA 2DH9A 4RR5A 4IDHA 5ETQA 3LDOA 1XNRJ 1R6VA 3FQKA 3Q8RB 2FZGB 3J7YP 2WVDA 1JKHA 2OPRA 3MD3A 2W4DA 4OX6A 1FKPA 4AL7A 2JEJA 1RWUA 1KLMA 2VQEK 4H0TB 3MI7X 4FS1A 3KJVB 3M8ZA 2QTDA 4Q2LA 2QYGA 4O3QA 3CC2N 2QLBB 3AVJA 2A10A 2OI2A 3DOMA 8ATCB 4CIFA 4IOAL 2GAGC 1NPRA 1VQMN 4KHSA 2ZH6A 2FTRA 1FKOB 4O3OA 5KG3A 4A8OA 4OO1J 4K7QA 4L75A 3AVCA 2D3UA 1WBBA 1H0HB 1R43A 2OTJS 2EK1A 3S8SA 3FMBA 3MM6B 3CJ2A 4YB6A 3MAAB 2MZQA 4XH5A 2FC0A 4XIUA 2FVCA 3G8QA 3V9SA 5CXTA 2OP5A 3LPUA 1LXJA 4LH5A 3ZLJA 2KFYA 3L4IA 2WK4A 1F6TA 3R6GB 3L4QA 3UDLA 4OHZA 3FEXB 2V0NA 1IKVB 3A2FA 2DO4A 5FDLA 2OPSA 3D0HE 4KBIA 3A12A 1WEYA 2VZ9A 4JI3F 2HKEA 4K4XA 1B0VA 2IVOA 2HHVA 1A0OB 4DTMA 4IZ9A 2EG1A 2ZBRA 5JLHA 4DU3A 4OI4A 1M90O 1VQKN 4W5NA 1JB0C 3QRPA 2BOAA 1JLEB 4PR6A 1U1KA 5AE1A 3QPIA 3NMUA 2IC3A 5L9NA 1SKUB 4H4MA 4W90B 2ATQA 4EO8A 4FLZA 2XYGB 1TKXB 5C25A 3HKWA 3KVGA 5F0UA 2Q97A 1DFDA 5M2RA 5LOQA 1IH7A 1RJJA 1R89A 3ZT1A 2X3GA 1WSFA 3FVYA 2QW9A 2EC0A 2F8EX 4C4WA 2CZ9A 1KQGB 1U1LA 1ZBTA 2HVEA 1YIJN 4FWMA 4CBXA 1EKRA 4LY7A 3H0PA 3OXLA 4OFZA 3TUIC 3MX5A 4DTUA 3MCMA 1NK4A 4IRDA 1HBNB 3MFHA 2QZ8A 3PUFA 3M2UB 4OLPA 1CJTA 1CJUB 2C2OB 3RBZA 5HQ8A 4X4UA 4WFXA 4QWEA 2GJ2A 4NLSA 2ETJA 1S9GB 4FBTA 2RE2A 3OHAA 5K9FA 2QO3A 2DISA 1WC1A 3TSPA 2DXEA 1S76D 2CQDA 2V5HG 2MKJA 2DEJA 2VC0A 2GGPA 4YY3F 4NXNF 4OYWA 3CULA 3AO2A 1UVNA 1XR5A 4M63C 3LOUA 3IBWA 3VR1A 3UKRB 1KVCA 4BVPA 3DOKB 3ULHA 2VBXA 2BTFA 4ELVA 4MH8A 1U49A 3TTFA 1BXNA 3AGKA 4ZPCA 3VZIA 3BY5A 1VRTB 2W4PA 3FSYA 1IBMF 3CJ8A 4HLBA 3R1HA 1NGCA 1QAIA 1VQ4N 1Q7YT 2LECA 1GOAA 4CEDA 2CJBA 4DJBA 3FCWA 2ZZMA 5AQKA 4H5WA 4MIAA 4ER8A 3MWTA 2DO0A 4FWOA 4X66F 3I0SA 3LQVA 3SI6A 1HQEA 3KMQA 5LM7E 2VASA 3CJSA 4IO8A 2XCAA 1LWXA 2DIUA 3FRYA 3UN3A 1HNZK 2W01A 2ROGA 3QEPA 4LMZA 2CADA 3IS9B 4IJAA 1RAEB 5AQHA 1BE4A 4Y28C 3SBGA 3NNAA 3VA3A 4J9RA 5JUMA 2CXEA 2VH7A 3CJTA 3DHXA 3MURP 2D3ZA 2FLLA 4W5OA 2KDOA 2VQFJ 4CW7B 4LQ3A 3ENAA 2PBDA 3ZO7A 4FWQA 2XSFA 3ZXWA 4Z4CA 2JEGA 3KYLA 2GHPA 3NF6A 1BL3A 2ATLA 1QZ5A 3FZLA 4KO0B 4F3OA 3IDHA 1RSCA 4UQTA 2XWYA 1RBOB 4K41A 3SUOA 4NLGA 3H8YA 4WQ4A 1FDDA 1N0UA 4YEAA 3SUNA 1HI8A 3C6UB 1VRUA 4ED2A 2GVDB 4ZVFA 1DURA 4WZQA 2QA1A 3DCAA 1QE1B 3CCZA 1PJ7A 4AHVA 2YPYA 5E84A 4KAZA 1KR4A 1JXLA 4DR2J 3DYAB 5E7OB 3KHLA 1ZTWA 4KHYA 2QWOA 5KFYA 4B9QA 2IS3A 3GP9A 5GMEA 4CLYA 4YOWA 3CB4A 3RMDA 1WG5A 2I38A 1XK8A 1OY8A 5IWAK 2NREA 1YI2N 2AQ4A 1IBLK 4O0NA 2A6MA 5D3GA 3DOLA 1HNXJ 1NG9A 2QV6A 2PT0A 5T7BA 3CO9A 3WIVA 3O4QA 3MFIA 3CF5Q 3FBCA 1QHTA 4LF2A 1HKGA 1WHWA 4DV3J 4RBTA 4CYUA 1FFGB 3UN5A 3UW1A 1NLKL 5GAHP 4FJHA 3TAGA 3CJKA 1LK7A 2DGVA 4IDKA 4BHQA 2XY5A 4WU3A 3AY0A 3ZT0A 3ENWA 3Q8VA 3DI6A 1BG3A 4Z4FA 2P5GA 1JKHB 1RI7A 4CLZA 2OPRB 4DUTA 4K43A 4MYUA 3CDBA 1FKPB 1FX2A 1RADB 2G1DA 1UETA 1VJQA 3WXLA 1NB2A 4B8AB 3OV7A 4ALZA 5LXRA 2HG4A 4B9UA 1NJIO 2IIHA 4NLVA 1HNZF 3M8PB 4NLPA 1Q8KA 1S1TA 5KFNA 1NO8A 4NXMF 4LBHA 2C2DA 4PHTX 2WFBA 4WCEQ 3KWMA 3T5JA 4UY8T 4EP4A 4UOHA 4M1KA 2PI4A 2YNGB 1JJHA 4A5BA 2J9CA 2AJ2A 4DQRA 3W9HA 4DU8A 3IR7B 2C28A 1DZ5A 2R7QA 1ESVA 5DLGA 1HKBA 4K4TA 5CYMB 2MZJA 5HATA 3MUMP 1N32F 1ZAXA 2ZEJA 1KOOA 4MIWA 1VSJA 5EHHA 2RU3A 1XNQF 2CQIA 4KAIA 1KTQA 3AFGA 3JAMY 2XS2A 1F0XA 4V19S 1FWKA 3J7AP 2UXCJ 4KHMA 4PEOA 5H9FK 4G9ZA 3O9QA 4QBUA 4ILHA 3QT7A 4DUZK 1RTHB 2ZC3A 4FYYB 3OSPA 1VOMA 3VAJA 2U1AA 4JN4A 4DV4F 2AWZA 5DO2A 1RDCA 6FD1A 3OTCA 4J2AA 2B6AB 3V6DB 4WXWA 2UZAA 3TEHB 1FFWB 2I6WA 2ZH3A 4J37A 4WP3A 3BREA 4Q8EA 4C8KA 2LMIA 4ECUA 3A8YA 4ISGA 2V68A 2XSJA 5IFMA 2IC3B 4X4TA 5BR9A 2DNLA 2PMZD 3VALA 2KI2A 2OSRA 4DX6A 4FM0A 2HS4A 1R8HA 3Q8YA 2OKQA 1C1BA 1ZYQA 1WACA 1X5SA 2XZWA 2QYCA 3HCXA 2ZBQA 4M45A 2I8EA 3NMRA 3B78A 2AX1A 3VHQA 5DK5A 5I3PA 4K4ZA 2LLZA 4FWNA 5E41A 1LOTB 2R2RA 4ZP7A 1G2EA 1JLBA 4Q8FA 3CIMA 4LF8J 3NFAA 5C10A 1NHUA 4DPTA 5GAEI 2MZTA 2DRAA 4FZYA 3GG4A 1Q9YA 2RF2A 1CJTB 3JSBA 3AVLA 4QU6A 3SPZA 3NGYA 2MPUA 4JV0A 4C3MA 5D4PA 3OTBA 1HWJA 1CLQA 3I0RB 4BC4A 3DGPA 1CJKB 2KU7A 3HYFA 4OZ0A 4CO2A 4CF9A 1RDWX 4C1NK 2JC1A 5KT5A 1MWKA 4M41A 2IVFB 1VSMA 2QMXA 4OYAA 5CHIA 2P9UA 2W9BB 3QETA 3QT8A 2GEMA 1GTHA 1NWKA 3CFOA 2LSNA 5A6WA 1MMNA 1JJCB 4IH6A 3OTDA 4ZOSA 3J80U 1QQCA 3TX8A 4FZZA 5LJVA 5DM7L 2OEKA 1KS2A 4WXOA 1I5OB 2E9RX 4A8KA 2XYHB 3QICA 2HK2A 4JD2B 3GYGA 2GQQA 2MY7A 1HJOA 1RZMA 2W2PP 3RMAA 4WFBQ 3MD1A 2BQRA 3MUVP 2MSSA 5IT4A 4GVLA 1WNSA 1HQEB 3KJQB 4PQUA 4ECTA 3V6HA 1FRXA 2DXDA 3ZTRA 5FPEA 3UE5A 4FWKA 1VQ9N 1VK8A 3TAQA 2R7SA 1FJEB 3WHIA 4B3RJ 3N01A 1YTUA 3CSKA 2AYMA 3EGNA 2ASJA 3GBTA 1HPMA 4ERDA 1N6QB 4LFAK 2EC2A 1VBXA 3T1YF 2B51A 3UKUB 1L3UA 3PHTA 3RYLA 4QIGA 3CDAA 5J2MA 4BR9A 1ICEB 1GOCA 3H5SA 3KFWX 4CGFA 5L1KA 2HZAA 2V9KA 1E4FT 1N33K 2CKWA 3QGPA 4B3SF 2FHKA 4JI8F 3W5YA 4CJSA 3TQEA 2VOPA 3D4JA 1S12A 4UZCA 1ILYA 1NJXA 5KAKA 1U4BA 2ZJPL 2MJNA 3HT3A 1LXNA 2OO4A 2JC0A 5CABA 4X4QA 3MXMA 1NGEA 3A8KA 5K14B 4JKHA 3N9UC 5AJ3J 3G87A 4NCGA 1T3NA 1F2HA 1X4FA 4OJGA 5IV4A 5DG7A 1KD1T 3OL7A 3LALA 1TQLA 1X5OA 3CCVN 1ZBLA 2NCKL 1EWQA 2F65A 2GIRA 4YDDB 4DTPA 1CPZA 4CH7A 3GLJA 4KY3A 2QL5B 2DHXA 2NS1B 3R5BA 2FSKA 2J0XA 2PGCA 2Q31A 3EY1A 3GJSB 4J9SA 2R4FA 2YX1A 4QYZJ 3BGLA 1N5SA 2DR7A 2X6NA 5CE3A 4RLEA 3VF4A 5F8LA 1SL1A 3L8BA 8RUCA 4W98A 3NHGA 1TUYA 1HBOA 2Z58B 5A8RA 4TNOA 4JKFA 3DOLB 2GUPA 3R5GA 2OJ3A 4EEYA 3RMCA 5HLFB 3WC0A 5J2QA 1U25A 1YBUA 3K5NA 3AJ2A 3K0JA 1D8ZA 5A2QU 3PX0A 3OL9A 4Y0FA 5JXSA 4P7TA 4DV1F 3S3MA 1I94K 3GYNA 3PSIA 1GT8A 4B3MJ 4O8UA 4CFBA 2B3TB 3CJKB 2R9LA 2HQ3A 2UVRA 1NK9A 3NCPA 4IDKB 2WTUA 3D54A 4KHPF 4JV1A 4X84A 3DI6B 1Q5YA 5A8WA 2P1JA 4ILGB 3EVWA 1NSKL 4WP9A 4P6QA 4TYAA 4ECVA 4FKYA 4OJHA 2H48B 2OD4A 4PKIA 2UUBJ 5AQFA 1KFSA 2OCEA 3TI0A 1HLWA 3IGVA 2EI5A 2D0AA 2BBEA 3LWMA 3MCSA 4WIQA 1XUPO 4CI0B 2CJQA 4F9OA 1U1NA 3A0IX 2RH3A 2O8EA 4CJ7A 1GLCG 3HD1A 1OYDA 3A5OC 4X64K 1I51B 2GCFA 4M3TA 5F8IA 3M2VA 4A61A 2ZBPA 3ITHB 5E2QA 3UQSA 2J9DA 2V51B 4NYFA 5F3TA 3O3LA 4MTPA 1U1OA 4DQPA 2EBGA 4AUKA 4CI6A 4N47A 5SUHA 2LXIA 4RNNA 4A8XA 1RT3B 5KRSA 3W8PA 3VQAA 1JJ2M 2IVYA 1K73T 3KLFB 3AAQA 2BOPA 4M3UA 2NRHA 1WI6A 1BI4A 3EVMA 3GIIA 3PDNA 2CPXA 2Z2YB 2MQNA 1NDCA 3EUNA 4USKA 3KIOA 3MPWA 3NP5A 4I68A 2BE2A 1OKJA 2JX2A 2CQ1A 4TYBA 4JI2J 4CHZA 4NA2A 1VSLA 4E7KA 3CMAN 1HQ2A 5KG6A 3ZZPA 3OL6A 4M5DA 4Y3CA 5B09A 4X4SA 3OFFA 4AE5A 4NL5A 2LP4A 5G4DA 3IG1B 2BJ3A 2A42A 4DL2A 4EGLA 2R7WA 3OYHA 1X4HA 4JKBA 4HH1A 3S1TA 4F0MA 1W97L 4CESA 1FA0A 3FNNA 2O8BB 2MLZA 1QUVA 3OTOF 5CD4A 2RJZA 4LVOP 1L3TA 3MECA 3M6XA 2FJAB 1JLBB 2FBYA 2CJXB 1F5CA 3MMAB 3VN5A 5CA5A 4QS9A 4ED7A 2P9PB 4L73A 2V8DA 1TK5A 4CERA 3QLHA 5LSOA 3BGUA 4ENOA 1XN9A 4C3LA 1RDAA 2BQUA 1YLXA 4PL7A 1M5SA 3CG7A 3KKRA 4FPBA 4LFCJ 3NGDA 1ZA2B 3O1LA 2OGUA 3M30B 2AGOA 4LT6A 3ENQA 4X65K 1X9WA 1QUPA 3G4SS 3Q24A 2LEPA 1MDUB 1SBRA 2K7JA 2DGXA 3JSMA 4DQ8A 4U7CA 2FVSA 2KXNB 3KD5E 2N7CA 3CMES 3O6WA 1XQIA 3HVWA 2QG9B 1B92A 2QE5A 1T03B 1FESA 2HAIA 3AVBA 2DY1A 3ONQA 4Y2MA 4DLEA 4ZPAA 2MKSA 3D2WA 2B43A 3UNGC 4K0KJ 4P2SA 3JS6A 3AARA 4KGVB 4HUGA 3F9MA 4J8FA 1KTVA 4ID1A 3WBZA 1RWKB 4IO9L 1S72N 4PQUB 2A1BA 1SL2A 3I5BA 1MN9A 2YKNA 4CEQA 1IUJA 4CJ4A 3C0BA 3BDEA 5KQDA 3OYJA 2F9WA 1IG9A 3T69A 3MZIA 1I3OB 1VGYA 2MB0B 4BGAA 3P5JA 4ANCA 1O8BA 2W9AA 4FK2A 2FPHX 3CCSS 4KTZA 2I0XA 4XH1A 3ZSOA 3J81O 1YHQN 4R8UB 4FM2A 3J80O 5HK4A 3M32B 1N54B 3QFPA 2XCPA 2E9ZA 1T11A 2AJ4A 2IA0A 5KT3A 2XZTB 2DHSA 2M88A 2FSNA 2JGUA 3PIPL 2P9KA 2AEFA 1YK9A 3KLIA 1TK0A 1YVNA 2RN2A 4IG0B 4KBOA 2CQ0A 4B9MA 4CWBA 4BC3A 5B0EA 1YUWA 1S97A 1FNOA 1S1WB 5AXKA 2ZJRQ 4P2MA 1BGXT 4TN2A 1NUEA 3CIZA 4HTUA 4O4RA 2NRXA 3OSNA 1VRQC 2MXYA 3O9TA 3D3BJ 3CCMN 4HHJA 1HJRA 3GCXP 1VQMS 1DQ9A 3AQOA 5D15A 1RGIA 3FJ2A 5GAGU 1NBEB 2E1YA 4U96A 4ES2A 3BQ0A 3D45A 3VGUA 3VGMA 4BQLA 2O67A 1HA1A 4N5SA 4OLOA 1H72C 5J2QB 3T3FA 3HHNB 1DTTA 3MEGA 1Y11A 3C8YA 4MYTA 4ZP8A 1FRJA 3GJQB 1Y4ZB 1BQNB 1O5JA 1ZXOA 3L6QA 5EXWA 2V8GA 2LQ8A 2O3DA 2MKCA 2ZWHA 3C7NB 5A76A 4Z7YA 2OPPA 5FLXO 3C2PA 2QA2A 5HVHA 1SZ2A 1DRZA 4Z0UA 1U1RA 5A6PA 2VWJA 4J9OA 1X3NA 2ZOMA 5ELZA 3VQ5A 4TKTA 4CP5A 5B8HA 4C1NI 4HEA9 3OYGA 3LDPA 2FGCA 3GJTB 1Q4RA 1WORA 5KG1A 2ZHOA 3MPYA 1IKWB 1SJ3P 1KQKA 4NYPA 3T1HF 1YF5L 4JYAJ 5F8GA 2I9SA 3JTOA 3MMVA 3IA0A 3V9ZA 3WX4A 1YKWA 5BPMA 3IRWP 4QW8A 3GOIA 4F04B 3R97A 2M70A 4B9TA 4A8MP 4F4KA 3CEDA 5A2QO 1KD1O 4CJ5A 4RNOA 2HBLA 2E1ZA 4AL5A 3BBCA 4ETZA 1JNZB 4P73A 2KW4A 1Q82O 4DPYA 3IMXA 1LW2A 3GR0A 1NGAA 1K8KB 5B0CA 3NOCA 3HSGA 1V4TA 3M6WA 4UOGA 3OBIA 7FDRA 1NU4A 1J54A 3DHWC 2VFVA 2UU9F 2BKOA 3HZGA 2K06A 1KRPA 4HHTA 5KFKA 4FOIA 1B9FA 2CFXA 3K7RA 2X7IA 1NPKA 3DC2A 3U1MA 4WQ5A 4NWBA 4LVNP 1VQ6S 1BY9A 3SIPB 3NVKA 5HMWA 2HQGA 1XNRK 3QJPA 5HSPA 3KWIA 5LSLA 4JKEA 2ZE2A 2LA4A 3MDFA 1AZSB 2E66A 1CG2A 1BO5O 1FXXA 3LP2B 4WFAL 3ENOA 2FHOB 3IP0A 2R8HA 4FYDA 1Z05A 3C46A 4Z4GA 1HYVA 2FHMA 2BM0A 3OD2A 4ANDA 2HHUA 2AEMA 1F5BA 2QM1A 4BBYA 3C6TA 2C3OA 4A2AA 4C8MA 1D3WA 4PRFA 3LM9A 2WBMA 4HR2A 4NCAA 3FDSA 4R25A 4JLHA 1HWKA 4USVA 4DV7F 2I5JA 1RILA 4RBVA 1U45A 1LK5A 3AD9C 3M8QB 2RQCA 1IR1A 2Z1IA 4JI3J 2XS7A 5AZIB 4CLKA 3H6EA 1RTJB 3IM9A 5M1FA 1RWMB 4BACA 2JLGA 4FF3A 3D5MA 3AD7C 2KL8A 1H38A 5F8NA 1TL7A 2DR8A 4DR7F 2KH9A 2XMMA 5BRHA 3GV5B 2JHEA 2X1BA 5M2PA 1RFQA 1T8EA 1U2VB 3DRRA 4JI7F 2KJWA 4GMKA 2EX3A 3VOVA 1K73O 4DV0F 1TUUA 2P9IA 2HFUA 4DWIA 2W25A 4AXIA 3I32A 5FRNA 2FBTA 4CNYA 3AAPA 4BY9C 2YKOA 1HBUB 2FJBB 3D66A 3WZ0A 2KYXA 1TAUA 2BW2A 1HPZA 1ZBIA 4P2XA 3TW0A 4L3QA 1WHYA 2D3O1 4ZMMA 1B0TA 2HRYA 2KZMA 3UDEA 4CCHA 4HVJA 4PCQA 4O23A 2D41A 2V50A 2W8KA 2XQCA 3KNAA 2NXUA 3DLKB 3FFIA 5IOLA 5DGAA 2JWNA 2M9KA 1OO0B 1O0PA 2IVMA 1WB9A 1KVBA 3DLLQ 1HMVA 1I1GA 2V67A 5AXMA 4IXCA 3EE3A 1T7PA 4M42A 3NOGA 4BC2A 3UWTA 4YY3J 4NXNJ 2JRSA 2BUNA 1YI2S 1BCMA 5E0OA 1Y7PA 1UJ6A 1GK8A 4WTYA 1VC6A 2NSCA 2CZ4A 4ES1A 2XULA 4OIXA 4QYRA 3QSYB 2E1PA 3HPGA 1HHSA 3BQ1A 1FJ7A 4J2DA 1IBMJ 4E7LA 3J7ZT 1CULB 2KHOA 3P49B 3H7HB 7AT1B 5HRPA 3C14A 2KB2A 2Z8QA 4IFYA 1F3FA 3O9UA 5C15A 3MR5A 2ZGYA 2FDNA 4KIAA 3LGMA 3GL1A 2PC6A 2CWXA 2QA4S 4A8QA 4KH4A 2AV5A 4X66J 1P9YA 4B1VA 3P83D 2IBKA 1UJ4A 1X4BA 4GNIA 3VEOA 5D6GA 4G1QA 3ULEB 2FJDB 2VG6B 2MGZA 4GC7A 4A5AA 3M6UA 3GE9A 3TOQA 2HSTA 3KK7A 4N76A 5HO4A 1RT7B 5EWEA 3OVSA 2VDHA 4AT1B 1XIQA 2X74A 1O1WA 4A8FA 3I4PA 2HMPA 2VJUA 2CPHA 1F3VA 4BRMA 2RVJA 4C8NA 4NRUA 4Y1CA 1LWEB 2CNOB 4PG5A 5E5NA 5KG5A 3MN6A 1RLDA 4U9RA 1SAZA 4AQYF 1G1XA 5TKYA 3IM8A 3BSOA 2XMVA 2IYGA 3M6VA 2AA4A 5KRTA 3VQPA 3DLEB 5HRNA 1CS4B 4OYPA 5KFVA 4ISEA 1E6VA 2UXBF 1QQNA 1W0HA 4EFHA 2B56A 4KFBA 3MPUB 4EFAC 3ENBA 4PKGA 2J7WA 2QGFB 1HBMA 1KN6A 3AT1B 4B3TF 3TARA 2XHBA 4KB0A 4WF9L 4CFDA 5HMXA 1MLAA 3AO1A 4OPHA 4FVCA 4OQJA 2JZ5A 4C0OC 4OI1A 1KVAA 3CD0A 4DR2K 1SKRA 2DGWA 3DDIA 2M4MA 4UY85 4E98A 1BHNA 2Y8YA 5HAOA 4BDPA 1DBDA 4B3OB 2GQ2A 4F67A 3Q8UA 2RSQA 3ZZOA 1FD2A 3S6EA 5F0XA 2HWIA 1NSQA 1HRHA 5EX3A 1NZ8A 1HNXK 2R8GA 4LFBF 3BH6B 4KH5A 1OPZA 3MXIA 4DSFA 3TWZA 1JX4A 4RW8A 1FF2A 3THTA 3C3LA 2D74B 5IT0A 4DV3K 3UCUP 2XMWA 4AH9A 4I64A 3I56N 1L5UA 4DTJA 1HNZJ 4DCOB 4NXMJ 2UV8A 1YVUA 2J8AA 3GIJA 1GEHA 3RZAA 4FDFA 4ELTA 7FD1A 1ZBSA 4CE9A 3E3XA 1B4SA 2MLXA 3G2XA 5JMVA 2HEKA 3W0LA 2HGMA 2UUAF 3R5DA 5HROB 3THYA 1IKYA 5J2PB 1N32J 5HMYA 3I55N 1TTHB 1BC6A 1XNQJ 5KFXA 1QSYA 1T44A 3C6TB 2WB1D 4JI1F 5E3PA 2F4VF 2MHNA 3TX0A 3OYNA 3ZTPA 1NK7A 3QFWA 1ASWA 1FTCA 4BE2A 3OUYB 1J53A 4KGXB 3WDOA 5AXLA 1U26A 3EZOA 4B1XB 4EIAA 1A6LA 1RWPB 4FVUA 3CJQA 4DV4J 2F7VA 2RUSA 2HAFA 3VTHA 5D8HB 2F8SA 3JAMU 2Z56B 4TXSA 4LBIA 4N56A 4MDAA 1Z26A 3OYEA 2FBVA 4FJLA 1TFWA 4KHUA 1FXRA 4DV2F 3WT0A 2UXCK 3RAXA 1RT1A 4TQRA 1VQ9S 2IVPA 4DL3A 4OJ1A 5KPZA 3OQ2A 3BF4A 4WP8A 2Z1JA 1N34F 5IQQA 3V4MA 2M7SA 5T41A 4Q44A 2X6SA 4JI4F 3I6PA 3CQYA 3O4WA 2LA6A 1YJ9S 2G8FA 1QVFM 4CNZA 3CNQP 3H3OB 4KI6A 3B8AX 4CEBA 1RAHB 4IR9A 1YITS 2PA8D 3N0VA 4X2BA 4ZJLA 3BKUA 3QBCA 4E2FB 3U7JA 3DLGA 1FO1A 3THPA 3P5TL 1HPZB 2OIHA 2ZHBA 1N8RT 2CH6A 3V4IA 2R2TA 3M2RB 4NLCA 5GAEU 2D3OR 3KJNB 3Q7CA 2HS3A 1K47A 1D09B 1B7YB 2MYFA 2VUGA 3TRGA 1OH5A 3THXA 1X0PA 3UDVA 4C2MA 1WF1A 3BH7B 3CCVS 2W2MP 4CJEA 1K9MT 4DF8A 1QZ6A 1RTDB 1R0AA 2KM8C 2JLEA 2QLJB 4ZVOB 1BIZA 4JK7A 5IC6B 4MK8A 4LF8K 5I3UA 1KCFA 1KQSR 3HF5A 1WAJA 3D2EA 3ZT4A 3G8TA 2EW9A 5BYSA 3EZWA 3O80A 3HDSA 2YWWA 2P9LB 3U9DA 2VF3A 4LF9F 4PUOB 3Q7BA 2BZ2A 1HWLA 2R7XA 4N8OA 2XG8A 3ZZRA 5KI6A 4L8RB 3UD3P 4DXLA 3HI0A 4OJ3A 2R3VA 4C8OA 3SV4A 3AB4B 4FO0A 3SDEA 1NK0A 4BRNA 4EBDA 4UF4A 1NGDA 1X9JA 3VGVA 2ZJQQ 4TQSA 2BYCA 2ZC4A 4C8ZA 1MU2A 4ZVUB 5TKWA 4IFVA 1VSHA 1N5YA 1QTNB 4CO5A 2W1BA 1JLGA 1LV5A 4B8CA 4WQ5C 2R42A 1IR2A 2BABA 2Q6BA 4BR0A 3PJ9A 2QA4G 4JKCA 4H0YB 1RT5B 1VQ7S 2W2NP 1YRTA 4RNFA 3G86A 3FMWA 3T1YJ 3PG9A 1NKCA 3R27A 3UB5A 3N6LA 3LTOA 2YKAA 3N6MA 4XTTA 3G71S 1APSA 1KP6A 2RQMA 4P10A 3SAHA 4OYZA 1T6DA 2DHGA 4B3RK 2WC9A 3BGRA 4F50A 1WHXA 4LF4F 1RHUB 4B3SJ 2VA2A 4JI8J 2ROPA 1LCUA 1TELA 1LW0B 2ZFHA 1N48A 2QWLA 1S77D 3SQ2A 5LSRA 3VAKA 4CEFA 2X1GA 4F36A 3O44A 3HPOA 1PG5B 4CIOA 4BRFA 2XGPA 1XMQF 2EKYA 1W26A 2VG5A 4ECZA 3I9ZA 3RSEB 4BRAA 3J7ZO 2GAHC 4KFBB 4M5HA 4JEPA 4FLVA 3BN4A 4G1PA 2CA9A 1HR0F 2Z2LA 1SJ1A 2C3YA 1YJTA 4CJWA 5LJ5Y 4V1Ak 2OELA 5AJ3K 2Z1GA 1RBRA 2DPJA 4DTRA 3CMAS 1K6YA 1UKUA 3THWA 2FLOA 1N56A 2VFTA 3W2VA 3FCVA 4KE5A 4KKOA 3RGIA 1RYRA 1TKZA 2L9WA 4QYZK 1FDNA 1GX5A 4DV1J 4LBPA 2M8HA 4MKYA 1BMQB 3N5BA 3D6FB 5CYJA 5DDPC 3BSCA 1VHIA 4HCCA 4CQ1A 3LF0A 2RHSB 1R8BA 1HNWK 1UVIA 1IV0A 4KHPJ 4DPWA 1V6HA 2DNOA 2J9EA 4H4OB 3O08A 3KK1A 3IUCA 1NSAA 4RG8A 1UJ5A 1NU0A 4P71A 3MWPA 1QJHA 1H74A 2DT9A 3WNEA 5HN0A 3O9RA 1KVIA 4MIBA 3H40A 4B3MK 4E7IA 4UW2A 3RRKA 4Q7AA 1TK8A 1S6QA 3TAMA 3G82A 3VF2A 4OKEA 4O4GA 3BR9A 4OHVA 2P5VA 1SC3B 2DNMA 3MPDA 4JI0F 3CPEA 5FPMA 3QYYA 2CQGA 3C66A 5KFPA 2UUBK 1T3VA 1D9AA 2O1PA 4Y2IA 4CJ3A 4ILJA 1FRLA 3ZEUB 2F3JA 3DLBA 5D0GA 3CFPA 3RBXA 4RW6B 3FZHA 3CC7N 4NI2A 1RQ0A 4QWCA 5CYQA 2WSEC 1SJQA 4ZA1A 3K5OA 3HTVA 2NNWA 3NNCA 2CG8A 2CYYA 5BRFA 4LF6F 3TTDA 2DFHA 4CVNE 3K89A 3IAS9 3DN9A 5DDOC 3HSZA 4KGMA 1TV6A 4YFUA 3DMJB 1EQMA 2IYIA 2E5JA 4CH1A 4NYZA 1UWBA 5K8MA 3TNVA 5FLXY 4K4SA 5CZ2A 1WELA 3BGOP 1S72S 4CJTA 5BPLA 3D1OA 1M1KT 3TSQA 3BP8A 3BM7A 3NDKA 2C3PA 4HH0A 4BDZA 4FP9A 1IO2A 3CCTA 1ZPWX 2F8HA 4OX9F 3NF9A 2ZWOA 5BJRA 3TJAA 4M7XA 2YKMA 1MWZA 3SMZA 1T05A 1SIWB 2V69A 4J2BA 1WC4A 1RDUA 3AGRA 3EKUA 1Z2LA 1YHQS 4JAXA 1KOHA 2J6UA 3ILOA 4BRPA 2NRZA 4E89A 4UUWA 2FGOA 1KHVA 4JV5F 1RAJA 1Y3JA 3SXLA 4WJBA 3CCUS 3HSCA 3OFEA 3IC1A 3WEEB 2OTLN 4JI2K 1EZZB 1Q86T 1X5TA 2D1KA 3OTOJ 1HNWF 2LVWA 3H20A 2O8FA 1S10A 5ADXH 4ZPWR 2IDOA 3FKBA 2ZVSA 5AT1B 2FC8A 2ASYA 3US5A 1TKTB 2VFSA 5L46A 2YH1A 3CCRN 3D0PA 2ZHAA 4I6MA 1RKJA 3QFHA 3MCAB 1S6PA 1VIXA 2DY9A 5J2NA 4OYBA 2BANB 1KQSM 5GADI 2Q36A 1K44A 3H1VX 1TL1B 2BJ1A 1AB8A 3NAEA 3QNNA 3RRGA 1R0AB 2LQ5A 4FJMA 2XRIA 3D7EO 3DLRA 2E1RA 4ETXA 9RUBA 1ROFA 5FROA 3E9OA 4AM7A 6FDRA 4DF4A 4ZITA 3OL8A 3V9XA 2W7OA 1SQGA 2WSFC 2P6TA 2XY7A 3EKSA 2J4RA 3Q2TC 1HKAA 3MOJB 4LR9A 3KLGA 2FBXA 2O5DA 1XMBA 2DD8S 2BH1A 3IBCB 4HKQA 2ZOFA 2E6LA 2HF4A 5KG7A 5H9EJ 4LFCK 4J7CA 4M3ZA 4DQIA 1MROB 1Y5LB 4OYXA 2CJ9A 3OYAA 5I9EB 2ROEA 2QLFB 4IFVB 4ED1A 5KFOA 3OVNA 1RWVB 4NLOA 4FLYA 1UPPA 1Y5IB 1FFSB 1P8ZA 3AQPA 4FBUA 3CC4N 1N8RO 5T7LB 3KJVA 3CCQS 3KUHA 4K0KK 4EUVA 5KT7A 4P52A 2HVIA 4IEIA 3OYMA 4FJXA 4BR5A 4YOYA 1M1GA 5KTQA 4KRFA 2YJFA 3PW7A 3HSDA 1RT6B 4L3NA 4J9QA 2H3EB 3FGVA 3BGRB 4RW4A 4WPAA 4CK2A 1ZAWA 1MW7A 5EDWA 5L9XA 5JVGQ 4JI6F 3MM6A 1RA6A 1PBAA 3SPYA 3MAAA 1P8GA 2YWKA 4CGIA 3MGJA 3CJ5A 1HNVB 2QLWA 8AT1B 2KHDA 1RCHA 2DKOB 4CT9A 2O4IA 2P9NB 1KVJA 5HBMA 4CLFA 2A1SA 2YX4A 3A1YG 1UEVA 1FTRA 2H9ZA 1CZ9A 1IKVA 2D9OA 4FYWB 3D6RA 3SQ4A 1WSHA 3J7YI 1SV5A 4B9VA 4GKKF 1ZC6A 1CXUA 3DLHA 3CF5L 1NK8A 1ZZNA 3BZKA 2H5IB 3MEKA 3MHYA 1WF0A 4OYOA 2W42A 1XHZA 4DLGA 4L72B 2W9CB 1FW6A 1JLEA 2JVOA 3AO3A 4ICLB 1K1SA 2ZH7A 2F9DA 4WE1B 2G0IA 3PYDA 1SPBP 3HVRA 1YJWS 2LQBA 2B4OA 5AQGA 2KXFA 3WX8A 2RHQB 2G8UA 2HNDB 4JHDA 4USTA 3VENA 4CHYA 3JTPA 1JQGA 2H5JB 3D3CJ 3T7ZA 3UI3A 4Z2XA 2ZJPQ 1FDAA 1P1TA 4YDUA 4C0BA 4H0VB 1ASVA 4ITSA 3D67A 1YJNS 2PMHA 4ANEA 3EICA 3KK1B 2E88A 2GHWA 3G8SA 3R3LA 2W40A 2UXDF 3D6TB 2HBKA 4WCEL 3KLEB 4DFJA 2KXHA 2ASPA 3CCLN 3NAIA 3AV9A 1HBNA 3T1HJ 5EUHA 2H3GX 3K5LA 3PJXA 3M2UA 1BWEA 1CJUA 1S6QB 4F4ZA 2I7PA 2ILZA 3IRXB 2RQ4A 1S9GA 4I0WA 1FKAF 3F73A 3BGFA 2IA6A 1PYTA 3SQOP 4QOTA 1X0FA 2ASDA 2FVQA 3AVFA 2YWHA 4K59A 5DQIA 4LF5F 3UE2A 2W4CA 4JYAK 3OXFA 3UKRA 3DOKA 4H5RA 4PKHA 4GKJF 1D5AA 3BBBA 2V8HA 2G8IA 2UU9J 4K42A 4HTIA 1WTBA 3C6AA 2GBZA 4X4OA 4WFYA 4UQGA 4QPTA 4LREA 3ADAC 2M0GB 1Q81T 1X1PA 4YS2A 4K2XA 1RTIB 2HGLA 2XM3A 2B0GA 5HOOA 2RDIA 3BQ2A 1SCJB 2GMLA 1ATNA 4WKRA 3HPHA 3CJ9A 2J0SD 2OAUA 4ZPDA 1Q0NA 2FQQB 2F9JA 3A3OB 3M8SA 4PYDA 4I1TA 3HK2A 4DUYF 3CCEN 2ZM6F 1RGVA 2K8GA 4WFZA 1SKWA 1F1BB 1EP4B 2AJFE 2E29A 2E5LF 4LH4A 3X3UA 1FXDA 1EB0A 3IS9A 3BO2A 3PJWA 5CZ1A 3EWGA 2AKWB 5CAAA 2HSEB 5AQUA 4K8XA 3CFRA 4KPYA 2RILA 3CPWR 3A8JA 3UVJB 4A8WA 4DV7J 3NLCA 3M3ZA 4CO1A 4DR1F 4K8RA 1XHXA 2O8DB 2HRTA 3DDNA 3Q86A 4OLAA 1Y9OA 3MR7A 4UZBA 1YJVA 2RQKA 2RIJA 3SZ2A 4CJRA 1VK0A 3G6VA 3JSRA 1XWLA 3AVHA 1ZBFA 2VOOA 2GX9A 3ZSRA 1G7CB 2GX8A 2LU2A 4EBEA 3C6UA 3IWXA 4EK2A 4QWBA 4OZ2A 5CD4H 6AT1B 2GVDA 4B1YB 5J2NB 1M5OC 1H2UX 1QE1A 4DR7J 1NGJA 1XR7A 1OQ3A 3TA2A 2CGKA 4EAHD 4JI3K 5DZ6A 3L2WA 4JI7J 1RT4A 3TO8A 4DV0J 5DM6Q 3EDQB 5LMUF 4TU8A 1Q95G 2B4UA 4MKVA 2DRDA 3QEVA 5KFHA 2M3DA 1VBYA 3E01B 3X1LB 2J0WA 4F4YA 2OMLA 4CK3A 1O13A 2YNHB 4IBNA 3HVTB 2ZUAA 4WFBL 2CQ2A 2M8DB 4OI0A 4IQMA 4R0JA 3QATA 4HL9A 3IMQJ 3LZIA 4A8SA 3IGNA 4FJKA 3TABA 1F5AA 5CH7B 2JNJA 1M5VC 2ACMA 3OXGA 4DU7A 1EHWA 1WSVA 1I6JA 2WW4A 5IQ6A 5J1EA 4ECWA 5AQVA 3Q8PB 3CDWA 4BGBA 2FJVA 2MSTA 1YDLA 3VQ6A 4LC9B 4CEEA 2BUPA 3CJBA 4YHHF 3KHRA 2AGPA 2OZSA 1CQMA 1HIYA 2QWPA 2G8WA 1FI4A 3M8PA 2B4VA 2XMAA 3D1HA 2VGNA 2R7UA 1NH7A 1HW9A 5MLCV 1HQUB 2HHHF 4JKDA 2YNGA 5A8KB 1BD6A 4YY3K 3QIPB 3RB6A 4NXNK 1MWMA 4RW4B 1WOSA 2IMOA 5B0BA 2HB5A 2XYPB 1EARA 4RUCA 1GNKA 5CYMA 2W6LA 3SQGB 1FHTA 5AE2A 1UFKA 4C48A 2HLTA 1IBMK 3ETMA 1YTAA 2BV3A 2E1MC 1URRA 1CQNA 2MQPA 5E3CA 5HBMB 1R31A 4BRHA 4I6YA 2XNQA 4DR6F 4UT4A 2HURA 1RTHA 4A2BA 1HKCA 3EVOA 3U6FA 2C1EB 2JWKA 4W5RA 4FYVB 4X66K 4FSVA 1T6CA 1TUVA 4NLRA 1SV5B 3E51A 4Q5VA 3OYKA 3FEYB 2B6AA 3V6DA 1X9SA 2NPIA 2K3IA 2BVZA 3QSIA 4Q43A 2KG1A 2P9SB 2B9YA 2DNPA 1X7VA 4CJVA 1W7WA 3Q0AA 1CXQA 3NS6A 3KUEA 4M95A 4AQYJ 3V5RA 1OVQA 1M1HA 3N79A 1FERA 3D2FA 4NZ7A 4NX9A 4DCPB 2ZH2A 3OS0A 1KHWA 3CQ8A 1FEHA 4FYXB 1GTEA 2D0CA 3ET6A 4M5NA 4JHDB 2B7CB 2UXBJ 3CTRA 4CZCA 4ZPBA 3UR3C 4RW7B 1VC0A 2VL1A 1RACB 1ULRA 1U6BA 4ID8A 4L76A 4QIWD 1RCOB 1IBKF 4C6AA 3PFOA 2ACYA 3H46O 4B3TJ 4GRSA 2AP1A 3V9WA 1C4AA 4IOCQ 1GOBA 3U4LA 1G4CA 1TU0B 2P9EA 4I9QA 1NNDA 4Z4HA 2YX7A 5L39A 2B8QA 4IJNA 2GC8A 1NKBA 2KG0A 2Y1IA 4FF4A 1RWXB 4OGEA 4FK4A 3ZSQA 4ILLA 2F7TA 3MXJA 2QMWA 3DXBA 3I0RA 4ED4A 2PY5A 4H54A 1WEZA 1CJKA 1ZBHA 3DXKB 3QIOA 1IJFB 5CZVA 3S41A 1UVJA 4CGDA 4RNHA 3VGSA 1NNEA 3MM8B 1JJ4A 2W9BA 2KQ2A 4C11B 3S9HA 4LFBJ 3RG6A 3EMTA 5KOWA 4WK3A 4RWWA 3CJCA 3A8IA 1C4CA 4GVMA 2AIRB 4XK8C 3O4NA 5B0GA 3HMJG 3I8BA 4NYNA 5AQTA 5IM0B 5BYRA 1NEEA 4JD2A 4CEAA 1RA7A 4HHHA 1MG7A 3GYXB 1N4LA 3HOTA 4R79A 5D78A 2UUAJ 1Q53A 2OSQA 2MY8A 1U6ZA 2HF3A 1YX2A 2XMKA 3DLJA 3CPWM 3R9PA 4Q45A 4NPOA 4U95A 3SYZA 4NXMK 1SS6A 1I39A 1RWWB 2OFHX 4ZJQA 2XBPA 2XI2A 4DV6J 4JI1J 1N6QA 2F4VJ 5ETSA 1DQ8A 2DHAA 2KT2A 4JK8A 3UKUA 5E3QA 3FRZA 2I2YA 3P5BP 1TMJA 4CZEA 3OA9A 3VEWA 3OVAA 1N32K 2R7TA 2VFUA 2GIQA 2E9TA 1GMUA 2DGSA 5DLFA 2IM3A 1VC5A 1XNQK 2XB2D 1CZAN 1UA0A 2VG7A 2ZDPA 3MEDB 3SCJE 1P9QC 4NMXA 4DV2J 4I69A 3HJVA 2L08A 3A3NB 5DS7A 3ZZUA 1NHVA 1J6ZA 4JK9A 4BDYA 5C42B 4CO4A 5K14A 4EBCA 1S0NA 2D0OA 4O5FA 4AFFA 4O3SA 1KNZA 2YNFB 3VGTA 5DRKA 2VPWB 4DV4K 1N34J 2WW8A 4OZ5A 2ZVIA 3HHEA 2C2EA 1KWMA 4M5GA 3PHEA 4NLTA 4JI4J 5KFWA 3T5LA 3L3UA 2V8VA 1CZBA 1VBZA 1Q81O 1RT4B 2F5GA 4RJVA 4BCAA 4DFKA 1UVMA 3UCGA 3GFZA 3QMLA 1TUWA 2ZH4A 3FCHA 3TPQA 3FGUA 2HFZA 1NKEA 2J6SA 1C6VA 1FX4A 1LFPA 4LF1A 3ZCMA 4Z4EA 2HS0A 4L6V3 2YQ0A 3CDEA 2BEFA 4DBQA 4OHXA 5HJXA 2ITMA 2NXNA 1KAZA 3FR0A 1X60A 1PO6A 4OZLA 3RW6A 2ZH1A 5HLFA 1DQAA 3LA0A 3M7VA 2HK3A 4NLUA 4YDUC 3VEXA 2W6KA 1FRIA 1CVJA 2V7YA 3GV7B 3UDCA 1OH7A 5J1EB 4QJVA 5EGYA 2YHWA 3TVKA 1WKKA 3K17A 2AYBA 3HHLD 9ATCB 1Q9XA 1A7GE 4H0PA 3GQCA 3BZQA 1VISA 1K1QA 4N7TA 2DNRA 3QJLA 5ETVA 1RCXB 2B9XA 5DJBA 3BF1A 4DL0C 2A0FB 3A5NC 2HBYB 3MWBA 3TUPA 3O5BA 5AQLA 3PW0A 3U1NA 5HP1B 1WOPA 3H42A 5BXIA 3R8YA 4CD1A 4LF9J 5L1IA 3MAHA 2VD3A 2ZOGA 2AJ1A 4HT7A 5LT5A 3AB2B 2UV8G 1REVB 4PABA 1HARA 3BF3A 3NRBA 1U04A 1RB0A 3MTJA 2XHWA 2FY8A 2PDAA 4EZ6A 4RCHA 2VODA 4DL6A 2ADBA 2VYPA 1GMVA 2LU1A 1NH8A 3P6YC 4OI2A 1YZ7A 3NG8A 1S79A 1BOTO 3OYFA 3ITHA 4FS2A 4TY9A 3VAMA 2HNYB 3WNHA 4FLTA 2G2ZA 2HIQA 2B8PA 1KBRA 2P51A 3K9JA 2CPJA 3PRBA 3MCPA 1BLUA 5F9NA 3NH0A 3CGIA 4HVZA 1RT3A 3LAMA 3BO4A 3LUYA 1HHQA 3KLFA 2DCLA 4OGCA 1NB7A 1XMOK 1SC6A 3L3VA 4FPAA 2AD9A 1S22A 2BX6A 4ZCLA 2OEMA 2F8TA 1EKSA 4CF0A 4JRQA 4YUDA 3N4PA 3O2IA 1IJEB 1YQHA 1LAWA 1OVYA 4EHUA 4I7FB 1LWFA 3CJ1A 4LF4J 3E66A 2YHAA 3AODA 5LMNF 3I5CA 1CBKA 3L4BC 1VI7A 1OWXA 3ZZYA 2I7NA 2UUCF 2N3OA 3D2FB 3P31A 3ZYYX 4K4YA 1KEKA 3T1YK 3RR8A 3I33A 3ET6B 1K0VA 2WB4A 4FWLA 2OHDA 4K25A 3IG1A 1XMQJ 1J5EF 2YX6A 3LL3A 3O8MA 3NKYA 4YORA 1SKSA 2CRLA 3NCRA 4H4KA 3W9JA 4B3SK 1D0EA 4JI8K 3R5CA 4JI5F 2O8BA 3IN5A 4PZVA 3KNGA 1HR0J 4DS4A 2HFSA 5JJBA 3HP9A 2BJDA 2JL9A 1OQ6A 1EETB 2KT3A 1NK6A 3QNOA 2YY3A 1TYQB 1Q16B 4NLXA 2BGGA 3MMAA 3V6KA 1BWVA 2P9PA 1T94A 5KT6A 1YRUA 2Y1RI 3PKMA 1NOYA 5H1SV 4R0EA 2IVNA 1S0VA 3H2LA 1VQ8S 1LFWA 3CD5A 1VYAA 4DMNA 2AYGA 4PL8A 3DU6A 2BJ7A 5L1JA 5FRMA 4BREA 3R2CJ 2FF3B 2VWKA 5AQNA 1B70B 5KG0A 4A4JA 2E4LA 2VGMA 3SSQA 2FSJA 4MLHA 1WC3A 3M30A 4BR7A 1DTQA 5IT9O 3QEWA 2OTLS 1BU6O 1RT2B 4IWVA 4LSZB 2VU5A 3DM2B 2FXUA 3S3NA 3DRYA 2PI5A 1S5JA 3OJUA 2R7YA 3J81U 1FNMA 3MCNA 1F9FA 3JTNA 3QGIA 3KK3B 3P39A 2CQBA 1FCAA 3CCRS 4DV1K 3V1QA 2PZSA 1VQPS 1L3VA 4QCLA 1T03A 2VICA 3ZT2A 4M5KA 2FLPA 2DR9A 1UFLA 4KHPK 3L9ZA 3CJ3A 1IM6A 2Q0RA 4L3KA 1R0CB 3VQTA 4EZ9A 4WYLA 4BLGA 1W2BR 5BRDA 4JI0J 3EZUA 1XMOF 2MHEA 1QAJA 4CK1A 1RU2A 2YNIB 3NBPA 4QQBA 3M8RA 1X4CA 1FJGF 4C97A 1RBLA 2MTLA 3BKFA 1GLDG 1O51A 3EGZA 1DARA 2A3ZA 1RWOB 4N77A 3VMFB 5RUBA 1VSEA 4PWWA 4WFNL 3MOZA 3WNGA 1YRXA 2JOQA 3E9PA 2GMHA 3DRSB 2K1RB 3ZT3A 4M5IA 1WSRA 4R8UA 1S1XB 1WSJA 1C0UB 3NS7B 3M32A 3CHWA 4LF6J 1MN7A 4DPUA 2PFDA 4MKBA 2Q0UA 3HKZD 2CIMA 2V63A 4PAAA 1K8AT 4F25A 4B9LA 5JS2A 3MMCB 3BJYA 3NNHA 2A5XA 4A8YA 5F8JA 2C2RA 4B08A 2PYLA 2HMIB 2VG7B 3VQQA 5KPTA 4RKUC 1YXQA 2FB0A 1XC9A 4YOXA 4IOBA 4DR5J 4IG0A 2QI2A 4QAGA 4W5TA 2YKQA 1ZAVA 3SEOA 4OX9J 1GAOA 2KVIA 2HQFA 2V2QA 1S1WA 3ALYA 5DG9A 4BRKA 5IXUA 4PPDA 3CC4S 3TVYA 1HD1A 5JMNA 5FLXU 1YBTA 3RAQA 3MR3A 4FZXC 1VAZA 1CSJA 2H5EA 1S1VB 5BYQA 1TL3B 1S1UB 2BKNA 3ZSVA 2VA3A 1Q7YO 3TJ9A 1EX4A 1AW0A 5KPRA 2FHJD 5AFUA 4JV5J 4C23A 4Y2AA 4HUFA 5KFSA 4MFBB 2HRUA 3VQ8A 1UA1A 2ERRA 2J8SA 2VBZA 1HFEL 2NRWA 1HNWJ 1WF2A 3C16B 3RU0A 2XI3A 1C0MA 1C0FA 5B7WA 4OVLA 2WBRA 2ZNZA 1VS3A 4J9UE 2E1CA 3RMBA 1O6XA 4F4WA 1NBWA 4WIIA 1X4AA 3DLLL 3ZZTA 3K8WA 5C2GA 1BQNA 1IQTA 2Q3SA 3C7NA 5EWFA 2WVEA 5GADU 1L3SA 4JV2A 2VPZB 4M7YA 3OTOK 2ASMA 1HI1A 2R7VA 2F40A 4X62F 1C1CB 1RAIB 3JS9A 3MUTP 4M3RA 2VDIA 1YVFA 3OR1B 4FOEA 1HI0P 4I9LA 3CMQA 3MMBB 3PYEA 3KLVA 4MO5A 1S59A 3D7SB 2IM2A 4LUBA 1IKWA 5KFFA 2OMOA 3BEXA 3SLCA 1KONA 4RUAA 2MLYA 1FK9B 1QS4A 1V9OA 1VR6A 4B17A 4RZRA 1QLNA 2L9DA 3TA0A 4LSLB 5K5MA 4J2EA 1A5WA 1WJ9A 1SQFA 2OUGA 3QBXA 5FPDA 4FL9A 3LP3A 3LZJA 2Y1JA 2D5RA 2YHBA 1K8KA 5AZJB 2FLNA 3AAWB 2DXFA 2DVIA 3FZBA 1NJYA 1JMTA 1W2IA 5AQXA 3FZ2A 1RBSA 5H9EK 4PA1A 4I67A 4U7UK 4BRIA 1NJWA 2EWSA 5M2UA 3L0QA 5F0WA 3OVBA 1AFJA 2Y1LB 2V2VA 1X4DA 3MN5A 2WOMB 4FLWA 2C3MA 4BRQA 1CJVB 5BR8F 4LF7F 1QQMA 3TAPA 2CJAA 1Z4UA 4P9SA 5G0RB 4GVBA 1N36F 3OBYA 4PQAA 4RO0A 1KAYA 2YI1A 1AZSA 3U27A 2EFVA 2IFXA 3LP2A 3O3HA 1BQXA 4BC5A 1LWFB 2NSBA 2G8KA 4GV6A 2GQCA 3M4XA 1PIEA 4JI6J 4CJFA 4P74A 2DK2A 3ZZ0A 2BJ9A 4F7VA 1VQNS 1VQSA 4ZCIA 3JSYA 1J5OB 1Y3KA 4FNHA 3RJMB 2ZGZA 3DKDA 1GXTA 3SFUA 3HFVA 3VAHA 4GO7X 3B4MA 2K2PA 1SQKA 4PXCA 1HHTP 2G8HA 2HFVA 2Y8WA 4UY8O 2E44A 2YH0A 3G6XA 3EYZA 2IGIA 4BQZA 2JDJA 5CCLA 3PR4A 2CAJA 4KQZA 3M8QA 3DWLA 4DR3F 3J7YU 4R5PB 2BXJA 3CJAA 4NZ6A 4DHYA 5AZIA 4GKKJ 3VQBA 1VQ5S 3G4SN 4MMOA 1RK8A 1RTJA 2NRRA 3TEGA 2CQ3A 4XPEA 4CHPA 2C42A 3QO9B 4ZTFA 5DG8A 3H2UB 2C2ZB 3CMEN 2BRLA 2G1HA 3V1OA 2NZCA 3LGNA 1JIHA 4KH6A 3HOSA 2WSCC 3HT0A 1U2VA 1D9DA 2CNLB 2P6SA 1JLQB 3PO4A 4X4NA 1DGKN 3OLAA 1VBKA 2VC1A 3F9KA 1DTQB 2J6TA 3QT5A 2OZMA 1HW8A 1HBUA 3FLCO 4FJNA 2PSZA 1VSFA 1OH6A 2C2KB 4WYWA 2MZ1A 4CJKA 1S0MA 1JNRB 3QINA 5M1QA 2UXDJ 1VQLS 1W2BM 4DV5F 2JLFA 3I96A 3JXUA 2AX0A 1WLJA 1DHMA 3CCSN 3F5TA 1UZHA 1NGHA 1IWGA 2GTDA 4BE0A 2AJ0A 3C15B 3P38A 4DX8H 4F8RA 1EQ0A 1PILA 5DZ7A 2QL9B 2A40A 3DLKA 3W2WA 5ETRA 2BW7A 4NLYA 3EXYA 3M6GA 2IPOB 3NBPB 3AO5A 5CY4A 2NXCA 2YWEA 3ZSXA 2COLA 4LF5J 3T1HK 4KB7A 1VHFA 2CH5A 3PY8A 3BPDA 3PSFA 2YVSA 4JUZA 4GKJJ 5CZXA 1RAGB 2Z2MA 3ZNJ1 1NXIA 3EZ5A 3VQCA 3O3FA 4ZVGA 2JVRA 3ZSYA 3R1XA 1HX1A 1FDBA 1CULA 1U1QA 4F4AA 3OHRA 4ZLPA 3PW2A 3B6BA 1Y10A 2UVVA 4KGZB 3TR5A 3HZEA 5KFZA 4M8LA 3R6LB 3FFKB 2QKBA 5M1OA 2PEHA 1VHXA 4DR4K 2UU9K 1R8AA 1RABB 1B3TA 2EFGA 3V81B 4ZN1A 3J7A1 4CEOA 2DCUB 1VJWA 3GONA 4DUYJ 3ULEA 2ZM6J 1DJ0A 2VG6A 2HQIA 1JL2A 1W7AA 3LP0B 3DAWA 3VGKA