2YKNA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPLLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 163
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yknA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yknA05
3ZSYA 2ZKUA 4URGA 3WNGA 4ELUA 1S5JA 1N56A 3I5CA 4O3OA 4KSEB 3NAHA 3TABA 4J9LA 5KFSA 3VQSA 3VN5A 4NLGA 4BE0A 2FVPA 3TANA 2FBYA 4EO6A 2UVRA 4OPJA 2HMIA 2D7SA 3HVAA 3NF9A 1J5OB 4NLRA 1LW0A 3N6MA 5KFTA 4CJRA 3MFIA 4AH9A 1RT1B 3QLHA 4BDPA 3HT3A 4CIGA 4K4WA 1S9EA 4CFBA 1NHVA 1JLAB 3EPGA 3C6UB 4KHSA 5HLFA 5EDWA 4IRKA 3QZ8A 3T5KA 1S0OA 4YNQA 4O0JA 3TAQA 3NKYA 1LW0B 1X9WA 3T3FA 5F8MA 2ZD1A 3PV8A 1VSIA 4TY8B 1TKXA 4J9MA 2FBVA 4JV0A 2W9BA 3KLEB 1FKPB 2G8WA 1VSKA 1JLQA 3DI6B 4NLYA 3AA4A 4DFKA 4IFVB 3DLEB 3AO1A 2WONA 1TVRA 4XIUA 3OSPA 4Y1DA 2OYQA 4U6PA 4DFMA 2AGOA 1LW2A 3OL6A 1SKSA 4WXWA 4K50A 4O4GB 2ASDA 5I42B 3CM5A 4I7FA 4CK2A 3KD1E 5KT7A 4I9LA 3RMDA 1KLMB 1S4FA 2W9CA 2ATLA 3C6TA 2YHAA 4KTZA 3CJ3A 4FS1A 3AVFA 5C24A 1HPZB 1RT5A 2Z1GA 2HNZB 3TARA 1BHLA 4KV8A 2YNFA 3MEGA 1LWEA 5F9LA 4DSEA 5KFAA 1JLCB 1R0AA 3AVHA 4NLTA 4FLZA 3V6KA 4I2QA 4I7FB 3ZSVA 3IG1B 2IS3A 2I1RA 1ZETA 3DRPA 3PJWA 3EYZA 1SUQA 4KHYA 2FJXA 1EKEA 4J9PA 1JLFB 4XPEA 5CYQB 5KG2A 3KLHB 2UUTA 1SKRA 3I0RB 3DRSB 2W8LA 4EBCA 1J9AA 4W5RA 2ALZA 4MK9A 3ZSWA 4FM2A 2B43A 4TYBA 1VRUB 4IG3B 1IKVB 4OGEA 4ZP9A 3KTQA 3FSIA 2UUWA 4F3OA 1C2PA 4B9MA 4FK4A 4DQSA 4F2RA 5T7BA 2V0NA 2R8KA 4DTRA 4L8RB 2C2EA 4KHRA 1NOZA 4MH8A 4J9QA 3KLFB 4CEZA 1TAUA 2DPIA 2D3ZA 3SYZA 3M9MB 1L3UA 3PZPA 4NYNA 2KQ2A 1NJZA 4Q8EA 5EWFA 2VG5B 1BGXT 3LP2A 3Q8QB 3JYTA 4MFBA 3BQ0A 3QEWA 4FJXA 1KSPA 3DLRA 3VQ4A 2B6AA 4B8CA 3RB6A 5KG6A 2OPSB 1NK7A 2B5JA 5JUMA 5DG8A 1ZBHA 4KAIA 4Y2CA 3GIMA 4KFBB 5DG7A 4IKFA 1EETA 3U3YA 2BQ3A 4DF8A 4AHVA 2YV0X 3OHBA 1S1UB 1TKZB 3CJ4A 4FM1A 1JL2A 2YHBA 4CFDA 5L1JA 2NUBA 3V81A 2R2TA 5KT2A 4CHNA 4E3SA 1WSIA 3UDLA 2P51A 3Q8SB 3DYAB 3OYJA 2IM0A 4ID5A 1IM4A 2WB4A 2BRLA 1Z4UA 3HP6A 4R0EA 4RU9A 4GC7A 4ED6A 1HARA 4PUOB 4FLWA 4K4YA 1D0EA 3DM2B 4AHRA 3EPIA 1WSGA 4RUCA 1C0UB 3BSOA 4URSA 2YNIA 2E6LA 3I8DA 3V6DA 1KHVA 3LZJA 1BIUA 3AA3A 3AVNA 4DL6A 4M94A 1RILA 2GIQA 4QW8A 3PJXA 3SFUA 3S3MA 3KMSA 2Z1JA 2IJNA 2BDPA 4YFUA 2OZMA 2HWIA 4FLYA 3VQ7A 3KHGA 4DQIA 4Q43A 2IJFA 1N6QA 1L5UA 1HRHA 4WFYA 2WOMA 4CECA 3D28A 3ULDA 1S9EB 4LH5A 3TAPA 2OZSA 4WXOA 1WSFA 2DTUA 2KTQA 2D0AA 2YNFB 3OYBA 4CF2A 1NK5A 4MQ3A 3QGHA 2AGPA 4DU3A 4B9LA 1ZBIA 4EP4A 3RR7A 1BISA 1RCHA 4RW6A 2FLNA 4J9NA 4TYAA 2BANA 4RW4B 3V1OA 1W25A 3MECB 2KZMA 4Z4EA 3O3GA 2I5JA 2HHSA 2BRKA 3KLIB 3KHRA 3G6VA 4FZXC 4CHZA 3OVNA 3T5JA 4AHSA 5KT5A 3C94A 5KRSA 2IOCA 4CJ4A 4RZRA 4IR1A 5L1LA 4FK2A 3AA5X 4KBIA 4DG1A 5HBMB 3TI0A 2X6SA 1RA6A 4OKJA 1XR7A 3SUQA 4JS5A 4WYWA 5CZ1A 4KHMA 3QZ7A 4CHOA 1B92A 3LDSA 3ZSQA 1U49A 3GYNA 1IKWB 3RB3A 4KKOA 4ECXA 5HLFB 3CVKA 1QAIA 1D5AA 1NK0A 4N47A 1JLGA 3V4IB 4OGCA 4DMNA 2FVSA 3PY8A 1NK8A 2P5OA 3ZT4A 3NF6A 3MR3A 4FBTA 1HMVB 2GV9A 3TWHA 3P5JA 3HPGA 1U4BA 5JS2A 3L2QA 4TQRA 2Y1IA 3OL7A 3KLGA 4DEZA 3BSCA 3NMAA 1RDBA 1HYSB 3TAEA 3T5HA 2VG7B 1RTHB 2VWJA 3OYFA 2RF2B 4M3WA 2YNHB 1L3TA 4J9OA 1S1VA 4NRUA 3NH0A 4OL8A 5DG9A 4W5OA 1T03B 4PA1A 4NLPA 5KFGA 4OKEA 4PUOA 1YVUA 5DGAA 5KG1A 1CXUA 4J2AA 3OHAA 3ISNC 4E7LA 1SV5A 2DPJA 1TK5A 4AHTA 2KFNA 3LZIA 1GX5A 3ICLA 2X78A 3LAMA 2XY7A 2FLPA 4M41A 4ED0A 4O3QA 2FC0A 4CHQA 5KG7A 2OA8A 2RN2A 4M3XA 4FJ9A 4IQXA 4J9SA 1DTTB 3O3HA 3KK1B 1S1TA 4RW8B 1RT7B 1VSJA 1BQNB 1S1XB 1RA7A 4CE9A 4IFVA 3K5NA 3HO1A 4WFZA 5CYMB 4KB1A 1T3NA 1NKCA 3GV8B 3NE6A 1FKOA 2W9BB 2C2RA 1C1CB 4WE1A 1VSFA 2X6NA 4RNFA 3V1QA 3M8SA 4QWBA 3RR8A 4JV2A 4ECWA 3V6HA 1C1BA 3H5SA 4F4XA 2JLEA 1HQEA 3V9XA 1LWEB 3TAMA 3NF8A 3GQCA 3AVLA 2E9TA 2XHBA 3K59A 4RG8A 1X1PA 3KK1A 2YNGB 2AJQA 4ICLA 1T05A 1RTJB 4CJQA 1HYVA 3V9ZA 3H40A 3DDKA 2HHQA 1ITGA 4GMJB 4TXSA 2GUIA 4Z0UA 3WNEA 4J2BA 2ATQA 3S9HA 4BDYA 2HWHA 3GV7B 4E0DA 1XHXA 4CGHA 2BQUA 2W7PA 3NCIA 3OL8A 3O3FA 1S1UA 2ASLA 4KO0A 3HVTA 4Q0BB 4CIFA 4ECTA 2QKKA 3LP0B 2FLLA 1IG9A 1S0NA 1S9FA 5I3UA 1XI1A 1RTIA 2IAJB 3KNAA 4J2DA 1YT3A 1QSYA 3CJ2A 4AHCA 4FS2A 4FLXA 2OPQB 2DFHA 2X74A 3AVAA 1XR6A 3MXMA 1JLGB 3H08A 1WN7A 4M3ZA 3DYAA 5DLFA 4C8NA 3CIZA 2G8UA 4EBEA 3CDWA 3OLBA 1HYSA 1S48A 3KLGB 4HUGA 3V6JA 3PO4A 3C6UA 5KGWA 4B9NA 4DS5A 3I0SB 4MKBA 3DOLA 1C0MA 4CF1A 1W0HA 3KLEA 1L3VA 4G1QB 3DLKA 3T1AA 4MFBB 1S6QB 4KFBA 3DRRB 3QNOA 4CGGA 1RT2B 1ASVA 4FXDA 3EZ5A 1O1WA 4K4SA 4H4MB 1HNVB 2V4RA 4DQPA 3PUFA 4TY8A 3H4BA 4KRFA 2W9CB 3HXMA 2XCPA 4CJ3A 5KFHA 3N6LA 4DL3A 3AO4A 4FK0A 3PO5A 4NCGB 2JEGA 4EBDA 2YKMA 3P1GA 4CHPA 2PYJA 3JSMB 2P1JA 3K2PA 4QWAA 1J5OA 4E89A 3L3UA 3H98A 1WNEA 4FJ5A 3QINA 3H5YA 4G1QA 3SQ2A 1TQLA 4R8UA 3MR6A 3QO9B 4ZVHA 2XGPA 3VQ8A 1S9GA 3K5OA 4NZ0A 3V1RA 2BQRA 2PZSA 3FQLA 4WE1B 1IKXB 4RUAA 1K1SA 3ZSRA 5F8HA 2BGGA 1C6VA 5KFYA 4BWMA 3OY9A 1JLCA 1G15A 4H4OA 2J6UA 1TKTA 5KFBA 4ZMMA 1CZBA 2R7YA 3LP3A 5C25A 3C95A 3L2VA 3PW0A 1S6PA 4WYLA 1IKXA 5KFJA 3DLGB 3CDUA 2B4JA 3I0RA 5KT4A 5FDLA 4CEOA 4N41A 2YNGA 5HRSA 3HYFA 4DSLA 4IDKB 2W9AA 4CF9A 1BQMB 4E7KA 4CFAA 1F21A 4B9TA 3M8QB 5KFWA 4Z4HA 5DK5A 1JXEA 5I3UB 5J2PA 3D5MA 4CEDA 4DTXA 4J9RA 3PR5B 5C25B 4ECQA 4CJKA 4KO0B 2YKNB 2OPQA 4ZP7A 3GV5B 4WZQA 4Q44A 4MIBA 5KFIA 4QWEA 3IG1A 4DSJA 3OJSA 3LP1B 3LAKA 1TL1B 3IGNA 4HCCA 4F8RA 4CEEA 3OYLA 1DTQA 4B3OA 5KFRA 1KVCA 4CGJA 2KFZA 4NRTA 4Q45A 3HK2A 4DF4A 3QIOA 5HRRA 3RB0A 4R5PB 4CJLA 3T19A 3TR8A 1EETB 3V81B 4YR3A 3NL0A 4Y1CA 1JLEB 4HCBA 1SKWA 1WSJA 4ZP6A 2RPIA 4LSLB 1SL0A 3G10A 1BIZA 3HVWA 2WK4A 5HROB 1DTTA 3KK3A 5KFXA 4EP5A 3RBDA 3G0ZA 4IH6A 3IGVA 4TQSA 3OYCA 3L2RA 2J6TA 3OL9A 1B9FA 3FFIA 1FXXA 2ITGA 4EYIB 1NK6A 5KGXA 3OYEA 1T7PA 3KLFA 2ZQBA 1FKOB 1WNSA 4ED8A 1S1VB 1GX6A 4CJTA 2VG7A 2XY5A 3LPUA 4FJLA 3VQ9A 2E9ZA 4KHUA 4DFJA 2IM1A 3AVCA 2F8SA 3SV4A 4CJFA 2XY8A 4O3SA 3V9SA 4W5TA 3H5UA 3D0PA 2D0BA 2O4GA 4Y34A 2BE2B 4RNMA 4AHUA 1LWCA 3MXIA 2EC0A 3OYHA 1X9SA 1K6YA 4BWJA 1ZBLA 3OS2A 5KFCA 4I2PA 1SV5B 3RTVA 3SUNA 5C5JA 1VSMA 1C1AA 4FW1A 1UWBA 3BJYA 4H54A 1TKTB 4ZVFA 4ED3A 5DLGA 3OSNA 3MFHA 4FJGA 3LP0A 4KV8B 2IA6A 4GVMA 1JLBB 5J1EA 5C24B 3CDEA 1KLNA 5FDLB 3FDSA 4K4TA 4IR9A 1R0AB 1Z26A 3ZSZA 3SZ2A 4ZTJA 1RT3A 1CSJA 3MR5A 3OYKA 3NF7A 4YR2A 5L1IA 1TL3A 1RDDA 2D3UA 1DLOA 4RW7A 3CFOA 5F8NA 2IC3B 4NLQA 1C0UA 2VG6A 5J2QB 4TY9A 4U7CA 1FK9A 2R8HA 4KB7A 5DMRA 4J2EA 3HL8A 2A1RA 2JC1A 5F8IA 3VQBA 4HUFA 3H4DA 1QSSA 2FBXA 3KLHA 5KT6A 4K4VA 2E6MA 1ASUA 3M8PB 4IG0A 3PW4A 2WHOA 3V4IA 4N56A 2JEFA 4CJVA 2Z1HA 3QO9A 2G8KA 4KKOB 3UR0A 4QWCA 4IBNA 5DGBA 3PW2A 4CHYA 3B6OA 1A5VA 4CFCA 3NH2A 1IKYA 1QQCA 2G8HA 2HW3A 3AVGA 5KFQA 1RBRA 4W5NA 4K4UA 5K14B 1Q9XA 1JKHA 2VG6B 1JLEA 3ZT3A 1RT1A 1NHUA 4EZ9A 2W8KA 3MECA 1RBUA 4LSNA 3CJ5A 5EU7A 1UOCA 3FRZA 5EUHA 3IN5A 1BCMA 2EX3A 4JV1A 1W9HA 2F96A 1NK9A 4WZMA 3JYTB 3DOKB 5KG3A 1RNHA 4ECZA 3MR2A 3KK3B 3T5LA 2HHWA 1KTQA 3OYGA 1BL3A 1BI4A 3CYMA 3LWMA 1KRPA 4ECSA 1TGOA 4IFYA 4CJSA 3SI6A 1ZYQA 3GILA 3SJJA 2F8TA 4H4OB 4GW6A 3SUPA 3TAGA 1NJWA 1BQNA 2OH2A 3RAQA 1U48A 3QERA 2R2SA 5L9XA 1LWCB 3V9WA 1RTDB 3ISND 4RNNA 1GOBA 1KCFA 5KI6A 4ZPDA 4ZTFA 1LWFB 3SCXA 1BCOA 3VQDA 1WSHA 5DQIA 2D5RA 4F4ZA 1HQUB 1REVA 2JC0A 4CEAA 1QSLA 4QOZB 4H4MA 3PX4A 3QEIA 5KRTA 2QE5A 4BDZA 4PWDB 3E51A 2UVWA 2WCXA 2C22A 3PVXA 5KFDA 1UAXA 3SQ1A 3DLHA 2DFEA 4TLRA 4JRQA 3SQ0A 4IRDA 5KT3A 1N4LA 3KD5E 2ASJA 4DSIA 1LWFA 3MXJA 4CEBA 4OLBA 5FRNA 3KK2B 4KTWA 3NH1A 4FLVA 5F8LA 2R8JA 4ID1A 4NYZA 1REVB 2KW4A 3IS9A 1ZTTA 3M9NB 2IC3A 4R5PA 1VRTB 2XGQA 2XY6A 3UIQA 4JRPA 4C8KA 3KLIA 1SL1A 2AQ4A 2QXFA 1TAQA 4KB0A 4W5QA 3LP2B 1Y97A 3MEEB 3WNHA 1NKBA 3Q8RB 4IG0B 3ALYA 4EEYA 2PY5A 3GIJA 5CYMA 4UQGA 1OS5A 4DSKA 3KMQA 3PX6A 3ZCMA 2OPRB 1HNIA 4O44A 4IDKA 5KFUA 2KZZA 3UQSA 1KVAA 3SNNA 5KTQA 2ETJA 3CWJA 4XPCA 1QTMA 3NGDA 2HHTA 2D0CA 1RT6B 4CGFA 2HMIB 3M8QA 1JIHA 2UVUA 5KFZA 1VRUA 4IG3A 5K14A 4RNHA 4KE5A 5J2NA 3AVKA 3IRXB 3ZT0A 3OYNA 4E1NA 3E01B 4F4KA 1L3SA 4CEFA 3MAQA 1WSEA 4FJIA 4FJ8A 3AO5A 4Z4GA 2OPPB 5T14A 1NKEA 4FW2A 3DOKA 4DTUA 4C8LA 4I2PB 1JX4A 4M3YA 1NJXA 4IFYB 2DFFA 2IAJA 4Q5VA 4NYFA 4B9SA 1RT6A 1RTHA 2JEIA 4JUZA 2HAIA 4ED2A 2HNDA 3KJVB 5HROA 3IRXA 1A5WA 1TKXB 4O4RA 3SV3A 1S9GB 3JSMA 4Q8FA 1MMLA 1VSDA 4HVJA 5EWEA 2FJWA 1N5YA 2ILZA 4RW6B 2WONB 1SH2A 1ZBUA 4ZPBA 2QK9A 4PWDA 2HNDB 1RT4B 4LD0A 4YMEA 1GOAA 2V9WA 4KI6A 4PQUA 1HQUA 3M8PA 4DTJA 4ZVEA 1QE1B 3WNFA 4MIAA 1C1CA 5DQHA 4DLEA 4CJUA 5HBMA 2UVVA 4HUEA 4FZYA 3I5AA 4HYKA 1XWLA 3SPZA 1B9DA 1BQMA 1HYZA 4DQQA 3QEXA 3FQKA 1Q8IA 4CIEA 4M3RA 2ZE2A 2GBZA 4O3PA 1RT3B 4IKAA 4BACA 3I0SA 3SI8A 3LP1A 4FVMA 1UA0A 4B08A 1UA1A 3QIPB 5KG0A 3HSTB 1TKDA 3GIIA 4OJRA 3QGIA 2HHVA 4ED7A 1C0TA 1S10A 3VQPA 3DRSA 5D3GA 1KFSA 1N48A 1HMVA 2A1SA 4EO8A 3HP9A 1D9DA 3DLEA 4F3TA 4O5BA 1U45A 4RW9B 3RB4A 1TV6B 3BGRA 4M95A 4QWDA 3K58A 4BE1A 3QYYA 4DL4A 4B8AB 4GC6A 4Q0BA 2RKIA 4NCBA 3QIPA 1BI4B 1I39A 3QEPA 4IOBA 4DTSA 4M3TA 4DTNA 3S3NA 3AVIA 3BSAA 4F50A 3C6TB 2FVQA 3AVJA 3QEVA 3SUOA 2O4IA 1T8EA 3L2UA 3DMJA 3LALA 3K5LA 1J53A 4ELVA 4IH5A 3RBEA 3RWUA 3GIKA 1IKYB 4Z4CA 2OPSA 4FJ7A 3AO3A 4CCHA 5KFVA 4DS4A 3O4QA 1S97A 4Y3CA 4FLUA 1K1QA 1WAJA 4O3NA 4H8KA 1Z25A 5FRMA 3FFIB 3ZSXA 2IMWP 5HRNA 4BE2A 5C42B 2FJVA 3DRRA 3HJFA 2QKBA 2CJQA 4DTPA 3M9OB 1S49A 1HPZA 1RT5B 1SH3A 5JXSA 2JGUA 4J9KA 4HTUA 1XR5A 4NLOA 1T94A 4DTOA 3KK2A 2G8FA 2AX0A 4CJEA 3PHEA 4URQU 1YVFA 3PW7A 1I6JA 1ZBFA 3G6XA 4NLVA 2WTFA 3P83D 3NAIA 4OLAA 1U09A 1HNVA 1EXQA 3DRPB 4CF0A 5C42A 1RT4A 3ZT2A 4NLUA 4TN2A 3OJUA 2XO7A 2AX1A 1SL2A 1KVBA 3RMCA 2VA3A 4C8OA 4KHNA 5FROA 3PR4A 1VSHA 2YKNA 4ZPCA 1QE1A 3VQ6A 1TL3B 4O0IA 1RTDA 4FJMA 4PQUB 3NHGA 2E9RX 4NLDA 4RNOA 2ZE2B 5KFKA 4R8UB 3D45A 1N6QB 2XRIA 3HVTB 5J2QA 1JLBA 3MTKA 4O55A 5KG4A 5F9NA 3M8RA 4RW7B 2FBTA 3L3VA 3UPFA 4YQWA 2FVCA 3HVRA 1KLMA 3RRGA 3HM9A 3DLGA 4N5SA 4ZHRA 1J54A 2D41A 2RDJA 2HB5A 3OYAA 2IDOA 4ECYA 1RDCA 3NGIA 1XHZA 4MK7A 3DM2A 1S0MA 3VQAA 1U04A 2B5JB 3NBPB 4FCYA 1NOYA 4AILC 5HRPA 2C2DA 3RAXA 3ZT1A 1WLJA 4B9VA 3NAEA 4CF8A 3KHHA 3SPYA 5KG5A 3IS9B 5CZ2A 3KKRA 2FVRA 4F4WA 4CK3A 3B6PA 4LSNB 4ZHRB 3CQ8A 1ASWA 5KFPA 4E7JA 1VRTA 1LV5A 1JKHB 3AV9A 3KHLA 2XI3A 1S1WB 3ITHA 1EX4A 3EY1A 1S6QA 2AWZA 2W7OA 2LSNA 3TAMB 3KIOA 1DLOB 2CKWA 3QLHB 2IM3A 4CESA 5KFFA 4KI4A 1YTUA 4X2BA 4LH4A 4ECVA 3AO2A 1D8YA 1TL1A 4CGDA 1D1UA 2VA2A 4CERA 4DU1A 1JXBA 5KFOA 4B3OB 3VQQA 2AGQA 1RAJA 4ZVGA 2I5JB 1JL1A 1LAVA 3OYIA 1KFDA 3OLAA 4JS4A 2R8GA 2GIRA 5SWMA 2V4QA 4KHQA 2Y1JA 3O4NA 3E01A 5J2NB 3ITHB 4FM0A 4Y2AA 4YP3A 4KREA 2R2RA 1YTAA 2YKMB 2RF2A 3EZUA 4DG1B 5L1KA 2R2UA 3VQ5A 2B6AB 2W42A 1LW2B 2R8IA 4KAZA 4M3UA 3ASMA 4K4ZA 3KJVA 1TVRB 3AVBA 3PX0A 4Z4IA 4F4YA 1IO2A 4DFPA 4K8XA 4RW4A 4DLGA 4NCAA 3CG7A 1MU2A 2GC8A 1ZTWA 4E19A 3DLKB 3H59A 4WFXA 4EYHB 1IH7A 4ID5B 2HNZA 4DL7A 4I2QB 3L8BA 4XO0A 3KLVA 3CM6A 2BE2A 2C28A 3H2LA 3VQEA 1NK4A 2XCAA 3K5MA 4QAGA 3MEGB 1GOCA 1S6PB 4HHTA 1TK8A 1D9FA 1RDAA 3IAYA 4MKAA 4FLTA 1QUVA 3VQCA 4LQ9A 2RDIA 1QHTA 5HP1A 3CFPA 4FZZA 3OS1A 1TP7A 2IM2A 2EHGA 4FJJA 4K4XA 3QGGA 4I9QA 4DSFA 4OVLA 3LPTA 3MEDB 1SH0A 1JXLA 4FJKA 2XC9A 3NBPA 4O3RA 4DL2A 5KFLA 5KFNA 2HHXA 3LWLA 2HVHA 3QETA 4KPYA 3VA0A 2G8VA 3MEEA 4QW9A 3CFRA 4E1MA 2JEJA 3AA2A 3K57A 3U3GA 2VG5A 4CK1A 5I42A 3HKWA 4FJHA 4CEQA 4QPXA 1LAWA 4KHWA 4E7IA 4LQ3A 5SZTA 3Q8PB 1S1WA 4M42A 1EP4B 3AVMA 4NLSA 5F8GA 2HVIA 3BR9A 3U6FA 4ELTA 4FJNA 1Q9YA 4LY7A 4RW9A 4ECUA 4NLXA 4OKKA 3TVKA 1KHWA 3QIDA 5D3GB 4EZ6A 2F8EX 3TAFA 3G86A 1VK0A 4TSXA 3I5BA 1QS4A 3NDKA 3SFGA 4ZPAA 1HQEB 1A5XA 2ILYA 3G6YA 2O5DA 1RYSA 2Z1IA 3F73A 1VSEA 1RT7A 4RW8A 3KKSA 4OPKA 3N6NA 3DMJB 5EWGA 3BSNA 3OS0A 4ECRA 4IH7A 4CJPA 4Z4FA 1QAJA 2PYLA 2XWYA 3RMAA 5KFMA 1WAFA 3SQ4A 2YNIB 3VA3A 1HNIB 4O44B 2BR0A 4HKQA 1U47A 3NGYA 4FBUA 4CGIA 1JLAA 4QCLA 1RTIB 2HNYB 2J6SA 5KFEA 1C1BB 4DQRA 1FKPA 1T03A 3H5XA 1CZ9A 4NCGA 1JLQB 1NNDA 5J2MA 2ZD1B 2E4LA 2WRMA 3F9KA 3NGZA 3V9UA 3LANA 2YNHA 4LSLA 5J1EB 3OYMA 3DI6A 3THVA 2AU0A 1RBVA 4DWIA 1RTJA 1TKZA 5DQGA 4KTQA 2DY4A 3RRHA 2WOMB 3QESA 2HHUA 4DTMA 3BREA 4JLHA 4B9UA 1S1XA 1FK9B 3CO9A 3DOLB 1S1TB 5HP1B 3KOAA 4E7HA 4F2SA 5JS1A 2IGIA 4O4GA 4YR0A 4N76A 2HNYA 3CJ0A 1RBTA 3OYDA 4DU4A 4C8MA 4FYDA 3BQ1A 3ZSOA 4ED1A 5J2MB 1CXQA 1RT2A 2BANB 4NLWA 1TV6A 3BGRB 4CJ5A 3L2WA 2VWKA 3MEDA 1TK0A 1JLFA 5CYQA 2P5GA 3NFAA 1SUQB 4MK8A 2RKIB 1N5YB 1RBSA 4ZP8A 1UWBB 2OPPA 3V6DB 1VSLA 1C0TB 3DLBA 2IBKA 4IRCA 3PW5A 1RDRA 3S3OA 3HPOA 1MU2B 4DL5A 1I3AA 1RYRA 1X9MA 3BDPA 5J2PB 2XI2A 4PY5A 2QV6A 4M45A 3HPHA 1IKWA 5E41A 1IKVA 3BQ2A 3TQ1A 3RMBA 2Q3SA 1DTQB 4CJWA 1XC9A 2G8IA 4G3IA 3HHKA 4ICLB 1T05B 3A2FA 5F8JA 1CLQA 1EP4A 3QNNA 2OPRA 4K8ZA 1NJYA 3MF5A 5CY4A 1HJRA
chains in the Genus database with same CATH superfamily
2P8IA 2DO4A 1HNZJ 4USWA 1SIZA 1Y5NB 4MO4A 1RBLA 1SPBP 3IKMA 4J9LA 3NMRA 3GIRA 1RHJB 3TANA 3MMCA 2ZZNA 4A8XA 1SQKA 4ILLA 4MYUA 5EX5A 3KG0A 4NLRA 2AJFE 5BR8K 1H6KX 3FMWA 4WQ4A 4PG6A 2FF6A 5SUHA 4LF4F 5L39A 4X62J 1R31A 2W40A 2HIQA 2H54B 3R8EA 3T3FA 4FNHA 1I94J 2IA0A 4K0KF 1FCAA 1FKPB 3DI6B 2NZCA 2L3MA 3AA4A 4IFVB 3AO1A 3F9MA 2WONA 1SXLA 1TVRA 1NBWA 3QMLA 2VFTA 2WVCA 1SKSA 3TZZA 4O4GB 2ASDA 3AAQA 5I42B 4I7FA 3T1YJ 5M1KA 3KD1E 3FBCA 5KT7A 3RMDA 2NCKL 3E8OA 5GAGP 2KN4A 1HKAA 3AVFA 4X4QA 2QMXA 2DHGA 2Z1GA 4UOFA 4DR6F 3CJCA 5AQXA 3W5XA 3QJJA 3MEGA 3NWRA 3AXKA 1PGZA 3TA2A 3AVHA 3V6KA 2PEHA 3ZSVA 1IQTA 2IS3A 2KYZA 3DRPA 1ZETA 3PJWA 2QA2A 3MM7A 2XMUA 1RSCA 1VHFA 2FJXA 3UE2A 3QDKA 6AT1B 4QIVA 3DRSB 2XHWA 4BC2A 1FEHA 3DU5A 4WCEQ 1J9AA 4W5RA 3LUYA 5FPMA 3PSIA 1YHQN 4IG3B 2M0GB 5HJXA 4ZP9A 3FSIA 1S72S 4F3OA 2D9OA 5BYRA 1GLEG 3SCLE 4DZDA 2BOPA 2R8KA 1YJ9N 4PXBA 2G0CA 5K8PA 1NOZA 5E7OB 3MM6B 3A0IX 5TKYA 2D3ZA 3WT0A 3MPUB 4NYNA 1SIWB 2UXDK 5LJWA 4B3TK 4R25A 2VG5B 1BGXT 2CFXA 3LP2A 4CNYA 1DFDA 4MFBA 4ID8A 2KDOA 4FJXA 5AE3A 2GW8A 1NK7A 4KAIA 4Y2CA 4KFBB 4IKFA 2BQ3A 4DF8A 4LSZB 2J7UA 1TKZB 2FSJA 4J5OA 4B17A 2LXUA 4DI6A 4DR2J 3TU5A 3V81A 2R2TA 3CCVS 4OJHA 4DV3F 1ZPVA 2I6WA 2ZJPQ 2O01C 2IM0A 3V4MA 4K5SA 1VQSA 3MUVP 2XSFA 4AQYJ 1UPPA 4ED6A 3VEXA 3EPIA 2UZAA 1ZOTA 2RVJA 2YNIA 1FXLA 3MOJB 2E6LA 3V6DA 1EJ7L 1BIUA 3CPWM 3LZJA 3AA3A 4M94A 4ISEA 2QN6B 3PJXA 3S3MA 3KMSA 2QLJB 1RAIB 4YFUA 2VUGA 2HWIA 2Q43A 2VQEK 2N7CA 1WBBA 1XC3A 2H48B 4DQIA 2IJFA 4DR5K 2WOMA 1SBRA 3D28A 4AF1A 1S9EB 2OZSA 4WFNL 2BJ1A 1RAFB 1FRIA 3OTBA 5IT4A 3NGRA 4AQYK 3DGPA 1RU2A 3G25A 1RI7A 2N3OA 4JNEA 2AGPA 4DU3A 2E2PA 5BPMA 5HMXA 2C3OA 3O3GA 4CT9A 4ILRA 2L9NA 2AYBA 1WC3A 1HFEL 2BRKA 2YHWA 4ILJA 4FZXC 3T5JA 3FMBA 4JD2B 2RAQA 4HH1A 5KRSA 1TL7B 4LVOP 2IOCA 3E1YA 4DPUA 3B78A 3H3NO 4KBOA 1VLOA 3HHLA 4FK2A 1M90T 1N32J 2UUCK 3RSEB 2Y0SD 4B3RF 1HBMA 1TZ0A 1EKSA 3DHXA 4XDCA 3QZ7A 1B92A 1HW9A 2A6MA 1EWRA 1A9NB 1K8AT 2X1AA 1MWMA 4RO0A 5HLFB 2EI5A 4XH1A 3Q8VA 1VQ6N 1D5AA 3BF3A 1R8PA 2DNGA 3UR3C 3V4IB 4Q2LA 2QA4G 2COLA 1OVQA 5LSLA 3QRPA 1NK8A 4YOYA 3G82B 4RJVA 4C8YA 2GV9A 4PKDB 2Y8YA 3L2QA 3WBZA 2LECA 4M63A 3NMAA 5KPRA 3T5HA 3OPKA 1RTHB 2IVFB 3NNHA 4M3WA 2YNHB 2VDIA 3ET6B 4KC5A 4EMDA 2HBJA 5B0EA 3W3SA 1S1VA 4NRUA 3NH0A 1G2EA 3ZTRA 1FTRA 4NLPA 4OKEA 1EQYA 2MXYA 3TX0A 5HJYA 3UVJB 4M7XA 1NXIA 3THXB 1SV5A 1DHMA 2CPYA 3RJMB 4CH7A 3G4SS 2X78A 2XY7A 3THWA 2V7ZA 1Y7PA 4A5AA 3C19A 2Q6BA 5GAEP 5CAAA 5K8OA 4M3XA 5C10A 1EX8A 1SAZA 1DTTB 3O3HA 3KK1B 3AAWB 1RT7B 1BQNB 3OR2A 1Q81O 5F1XA 3ETOA 3E9PA 1EO1A 3A5MC 2CGJA 4KB1A 3UW1A 1T3NA 3GV8B 2D69A 3K2YA 2CQ0A 4MJKA 4WE1A 2E7XA 1CJUA 5BPNA 4WU3A 1Q95G 2X6NA 1N33K 9RUBA 1BY9A 3FZFA 4ECWA 3A8IA 3SQGB 3CO0P 4F4XA 2JLEA 1QQNA 4JI5J 3V9XA 2MEWA 1N5VA 4A8FA 2XLIA 2KKZA 3TAMA 4YHHF 3KK1A 2UUCJ 2XMAA 2YNGB 3Q0AA 2CZ9A 3FZ2A 4ICLA 4CJQA 3UFCX 4RR5A 3H40A 5C7PA 4GMJB 5AQIA 5AQTA 4KR0B 5JJBA 4BDYA 2E7VA 4L3KA 1S76D 1SKUB 4M5KA 1XHXA 2O67A 4X65J 4DV6J 3QSIA 3OL8A 3MUMP 2ASLA 4KO0A 3HVTA 4ECTA 1B0TA 2QKKA 2EVZA 3CE8A 3LP0B 5ETLA 2FTRA 4FF3A 5BYSA 4E1JA 1YT3A 3K0SA 4DBQA 4HHHA 2ROPA 1EARA 2X74A 2NXCA 3AVAA 4HH0A 2QWNA 4U8YA 3DYAA 2W24A 5HO4A 2D0PA 2X51A 4NXNJ 4EBEA 4WIIA 2UXCJ 3OLBA 3IR5B 1AFIA 2LVWA 5D0GA 4LF8K 3I56N 3C6UA 1CBKA 5KGWA 2R4FA 5MLCQ 4DS5A 2XEXA 5HI7A 4OZ0A 4IFEA 3VGVA 1L3VA 2UXDJ 3U9ZA 1SC4B 1U24A 1GMWA 3IWNC 3FVYA 4CI6A 3QNOA 4A47A 2SXLA 2WZ1A 1RT2B 5GAEI 5JMNA 4FXDA 1ASVA 1RWOB 4H4MB 1PYOB 2V4RA 2GCFA 7FDRA 5HSPA 2GJIA 4ZLPA 4TY8A 1Z05A 2PEBA 1TUYA 1Y3JA 1X4CA 4DL3A 3ID6A 1W2IA 4WFNQ 1ZAXA 3JSMB 2P1JA 1X4DA 1J5OA 3M6WA 3CCSS 9ATCB 3SQ2A 4KQZA 4U8VA 4CYUB 1S6UA 3QO9B 4ZVHA 2DR8A 4WP9A 2ASOA 3SAGA 3A8YA 1V6HA 4NX9A 3X3UA 2BGGA 1N5QA 1C6VA 3OY9A 4KIAA 4ZCKA 1FF2A 1TKTA 2J9CA 3NP5A 2MDAA 3PW0A 1S6PA 3J7ZO 4B1WB 3GLJA 4NXMK 4X65K 3I0RA 4ZPTR 4DHYA 1KEKA 1U8SA 5KT4A 1E4FT 1CZAN 3QB0A 2NRTA 2CJXB 2OKQA 4DSLA 4IDKB 2W9AA 4WF9Q 3O9QA 2V9KA 2CIMA 1JXEA 3KVGA 4DTXA 3NNCA 4LF5J 3OJSA 1TL1B 2R7VA 3VR1A 4F8RA 4NPOA 3OYLA 5A2QU 4DR2K 4B3OA 2MYFA 2KFZA 4NRTA 2P9UB 2MHEA 2GVZB 4ES3A 3RB0A 3T19A 3KDNA 5HQ8A 3V81B 3NL0A 3J7YP 3I55N 4Y1CA 2KH9A 2DNQA 3G8QA 4A48A 3AJ2A 4PKGA 2QMUB 2RPIA 1SL0A 3FJ2A 4PAAA 1U8WA 2QX0A 4WP8A 4OHYA 5AZJB 2WK4A 5M1FA 3DOMB 2HHHJ 4EP5A 3RBDA 1FESA 1ZM3A 3MWTA 2K8GA 3SK3A 3LGHA 2CQ4A 3FFIA 1HBOA 1FXXA 3M2UB 2VDHA 3TTDA 2D3O1 3EL2A 4EYIB 4DR4J 3CERA 1NK6A 1T7PA 3ETMA 3KLFA 2AEMA 3AFGA 4FWNA 3P45B 1G99A 1IR0A 2MQQA 4JB8B 4CJTA 2VG7A 1MWYA 3LPUA 2E9ZA 5B0FA 4KHUA 3ZEUB 3GJSB 3W7BA 4WF9L 3K5PA 4H0YB 3N79A 3M8WA 4P2SA 2V8GA 2UUAJ 4DV0F 1Y5IB 2D0BA 2O4GA 3S01A 3OVAA 1HUXA 1AA1B 1SJQA 5ADXH 3MWBA 4BLGA 4V19S 5C5JA 5IT9U 1UWBA 1MROB 2KFYA 5A6WA 4EWTA 3O3LA 4P7VA 3DXKB 1TKTB 3DLJA 2ZH3A 2VOPA 3TO8A 1RAGB 3O8WA 3P96A 4YOEA 4ZVTB 3OSNA 1AUSL 4FJGA 2H3GX 4H0OA 2IA6A 2ASPA 4HTJA 3CJTA 1VC6A 5C24B 1AROP 5FDLB 3AQOA 4K4TA 4IR9A 2W2MP 1VAZA 4ZTJA 1CSJA 3OYKA 3KYLA 4HR2A 4LRAA 4RW7A 3ILLA 4GO5X 2YQ0A 3ZTSA 1FRLA 4TY9A 4H0VB 5DMRA 3KJFB 4NLCA 2A1RA 4JK9A 4JI2F 4HUFA 1QSSA 1J5EF 2CWKA 2E6MA 3N0VA 3ZC4A 1ASUA 3PW4A 4BC5A 3CCUN 3UWTA 3EVOA 4CJVA 2Z1HA 1IBCB 4P7TA 4JI8F 3UR0A 4QWCA 5DGBA 1UZDA 4M5MA 2WSCC 1UEVA 2DHAA 3T6BA 3NH2A 2NRRA 3CJ9A 1QQCA 3AVGA 2MGZB 1Q9XA 2F9DA 1IR1A 2RHQB 3ZT3A 4EZ9A 2EKNA 1GMWD 4L74A 2PGCA 3MECA 4LSNA 1SB6A 2DD8S 1DEJA 1BCMA 1FI4A 2YH1A 2EX3A 4JV1A 1W9HA 3VTHA 1NK9A 2KRRA 4FPRA 3JYTB 3DOKB 1RNHA 2O8CB 3MR2A 2J0WA 3T5LA 3D1HA 4F04B 3GR1A 4DR4K 2XMJA 2M8HA 3J80Y 1Q0NA 4ZPWR 4DX7A 5DDPC 4ECSA 1TGOA 4UUXA 5EX3A 2H5IB 2YHXA 4QJVA 1J5EJ 4IOCQ 3BYRA 3M2RA 3HFZB 1NJWA 1HKGA 3RAQA 3IP0A 2R2SA 2YCHA 3MPYA 2OMOA 5L9XA 3CXCM 2XZWA 4U7UK 1DARA 4RNNA 1KCFA 4ZTFA 3HI0A 4BS2A 2KHOA 3W5ZA 2D5RA 4PEOA 3WXLA 1RCXB 4QOZB 4H4MA 3A3PB 3PX4A 5KRTA 2QE5A 3MCMA 4BR5A 3PVXA 3DLHA 3SQ0A 3C7NA 2KJVA 4IRDA 3IR6B 4PQAA 5KPZA 1N4LA 2Z56B 4QS8A 1LWFA 5FRNA 2I9SA 2Z4PA 3KK2B 2QXLA 3FEZA 1YZ7A 4FLVA 2XM3A 4H0XB 1BMQB 4DV0J 4B9QA 5L38A 4HHUA 3EGWB 1ZTTA 2KJWA 2QM1A 1E6VB 4L73A 1H2TZ 2VFSA 2AQ4A 2UUBJ 2ZH5A 2CNKB 4KB0A 3IBFB 4W5QA 1OY8A 3MM6A 2HFSA 4OLPA 2QWMA 3WNHA 5JVHQ 1NKBA 2CDRB 4K8RA 3W2VB 4LF8J 4G1PA 2PY5A 2XYPB 1DZ5A 4DR4F 3QWPA 1OS5A 4DSKA 1WDTA 1XNRF 5H9EK 4DX5A 3BN7A 2VQFK 2BW2A 4AQYF 3PX6A 3L4IA 4P74A 2P6TA 5CCLA 3J7A1 3QWUA 4KH4A 2ETJA 3CWJA 1X4BA 4XPCA 3NGDA 2NR0A 1WJ9A 4DCPB 4IJNA 1JIHA 4JI0J 4BR0A 4M63C 2PO4A 4IG3A 2QW9A 5J2NA 1K47A 3DLLQ 2XYHB 3OYNA 4Y2IA 3MN9A 2HG4A 4WFBL 5F0WA 4CEFA 5D8HB 1WSEA 1SC3B 3CCQS 1WEYA 2MKSA 4FW2A 3CTRA 4I2PB 1RAOA 3GG0A 4B9SA 2KU7A 3T6JA 2WFBA 2HAIA 4YY3K 2HLUA 1U2FA 5HROA 4I56A 1A5WA 3A3NB 1SQFA 1VFJA 4HEA9 4DV3K 3BGOP 3QT8A 4GO7X 1VSDA 3TEGA 1U02A 2JL9A 4CLWA 3BZKA 2HBLA 4ETZA 3WXJA 3VF4A 3A8EA 4B3RK 3THTA 2W2NP 4YMEA 1Y00A 3LPEA 4KI6A 4PQUA 3OXGA 3M8PA 1LOTB 5E84A 3IR7B 3Q23A 5DQHA 2MSSA 2YKQA 5B8HA 4DLEA 5HBMA 2UVVA 1HHQA 5A0YA 3I5AA 3ZX3A 3FCVA 1PSDA 4WQ4C 4USUA 2EFVA 3B4MA 4CZJA 3FQKA 3QJLA 2OUGA 2DCLA 2FF3B 2ZE2A 2AJ2A 4A8OA 1SC6A 2GBZA 1RT3B 2I7NA 4QOTA 2C3UA 3CCLN 3SI8A 5LMUK 1UA0A 4B08A 1UA1A 1QDUB 4USJC 3QGIA 4OI3A 3TVYA 1W2BM 3WZ0A 3J81j 3DRSA 5D3GA 3U8XA 3SMPA 1QVFM 3HD2A 2RS2A 3HP9A 5EY4A 4F3TA 4RW9B 3BGRA 3TYTA 3K58A 2MQNA 3W2WB 4B8AB 4CM0A 1N5TA 4WKYA 4AE5A 4IOBA 4DTNA 3CEDA 3BSAA 2J0QD 3CCMN 2FVQA 4ED4A 1KONA 2Q97A 5AZJA 3K5LA 1WKKA 4M5DB 2CZVC 4BRFA 4Z4CA 4LF5F 4A61A 1YTYA 3K7RA 4CCHA 4CIOA 2J8SA 5KFVA 4WQ5C 5D0HA 4GVEA 4Y3CA 4FLUA 1WAJA 1EAYC 3H8YA 1FRKA 2QKBA 1Q79A 1X60A 3M2VB 4C2MA 1HPZA 4LFBJ 1VQLN 3MMJA 4N8NA 3NG8A 4CWBA 4RBTA 3D7EO 2XSJA 4I0WA 4QYZK 4FOEA 3PHEA 5IM0A 2DHSA 1YAGA 2AZ1A 3KG1A 5DJBA 3P83D 3AA9A 1NB7A 1WHWA 2HZVA 3MX2A 2X1GA 2Z57B 1EXQA 2QA1A 5C42A 1HHSA 1RT4A 3SIPB 3ID8A 3J81U 3LO3A 4CTAA 2XO7A 3PIPQ 1SL2A 1KVBA 3RMCA 3HSGA 4C8OA 2OGUA 2VU5A 3G9CA 3CCMS 3BS9A 1WC6A 2YKAA 1IBKK 1RTDA 4FJMA 4CW7B 2EWSA 1VR6A 4NLDA 1YUWA 4R8UB 1T6CA 2VFUA 3MTKA 3M8RA 5LMUJ 3HBTA 2FBTA 1KQSM 3GTYX 4BR2A 3DLGA 3M1VB 2MKHA 2HB5A 2V4JB 3K8WA 2RQ4A 1NO8A 4DPXA 2MY7A 4I67A 5RUBA 4MK7A 1DKGD 2MTLA 2HQCA 4AILC 4O8KA 3VPZA 5HRPA 2APOA 2C2DA 4JKEA 1N8RT 3NEKA 1WLJA 3HFKA 3CCJN 4NYPA 3SPYA 3FRYA 2QWRA 2GVDA 4F4WA 4DV7F 4LSNB 1VQYA 1B4SA 2F1FA 2CGKA 2NSBA 1JB0C 4DCOB 1JKHB 1VQOS 1JNZB 3KHLA 3CULA 2Y1LB 2ZJRQ 3RRKA 2DJWA 4A8WA 4JKGA 3T9NA 2LSNA 3VEWA 1DLOB 3L4BC 4ER8A 4JV5J 3W61A 4KI4A 3JTNA 4LF8F 4X2BA 2G9OA 4LH4A 3AO2A 4CGDA 5AJ3K 2D0OA 5KFOA 1J27A 3GB0A 1RAJA 4CZIA 5MAOA 3MX5A 3PYFA 1RHQB 4AD6A 2FLOA 2ZWHA 4IJAA 2V4QA 5M2RA 3VGSA 3UKRA 4FM0A 3MM8B 2R2RA 1U1LA 3C3LA 4EIAA 1VQNS 3D3BJ 1BQXA 3ET6A 2B6AB 4ZVQB 2LA6A 1N0VC 1S57A 2NYHA 3OUYB 3DAWA 1LW2B 2F65A 1F3VA 1RZMA 2XQCA 1ATSA 3AVBA 4FWSA 4K8XA 4RW4A 3R6GB 4CTAB 2YI1A 4NCAA 2GC8A 2RNEA 3ONQA 4FVUA 3G6EN 3US5A 3GU0A 4I2QB 3KLVA 2M3DA 2XMMA 1MA9B 5DM7L 2J4RA 3WXKA 4HDGA 4KH1B 5D4LA 3K5MA 4QAGA 1GOCA 1S6PB 4JAXA 2VZ9A 1RDAA 3BBBA 3AH6A 1GNKA 3DN9A 4KGXB 1QUVA 1ILYA 4LQ9A 4HT5A 4FYVB 3VEOA 3OS1A 4ZS6A 3CCSN 4UOHA 2VB6A 1BG3A 5H9EJ 2ZBPA 5TKWA 2RUGA 2F9JA 2VGNA 2A40A 1JXLA 3IA0A 2XC9A 2WW8A 2CNLB 4UOCA 4DL2A 1UMJA 3UN5A 2KG1A 2DNOA 1RHUB 3QRQA 5C12A 3VAHA 3MEEA 5L46A 3X1LB 3CFRA 1BC6A 3U3GA 3E9OA 2GUPA 5I42A 3QGPA 3HKWA 1IVZA 3D2EA 3MD3A 1ELOA 2A10A 1K9MT 1HKCA 3ZO7A 1X4AA 1S1WA 4M42A 1HI8A 2MB0B 3LF0A 1EP4B 1KQKA 5F8GA 3BR9A 3U6FA 4OZ1A 4JI8J 2PC6A 3BO2A 2KRBA 3C8YA 5AFUA 4ECUA 2DIVA 2YHYA 1KHWA 4OIXA 5D3GB 1XJWB 3G86A 4TSXA 1CQNA 1TTHB 2NUUG 3ILOA 1I94K 2HF3A 5M1NA 1CQMA 1YJUA 3F73A 2Z1IA 3L0QA 2UYTA 3OS0A 2O8DA 4F0MA 3MM9A 4K25A 4IH7A 4F3MA 2GAHC 5C2CA 4NZ6A 4OFZA 4FWPA 2MHNA 2XWYA 5EVZA 3RMAA 2CYYA 2YKPA 3DC2A 4QYRA 4OZJA 4OHZA 4O44B 4HKQA 1U47A 1WSVA 1WWHA 1HR0F 2BUPA 1VHXA 4NXNK 2M7SA 4DQRA 3Q24A 1FKPA 1T03A 3H5XA 4NCGA 2CNOB 1VIXA 3FR0A 5M1QA 1RWVB 2WRMA 3NGZA 2HFZA 3LANA 1X5TA 4LSLA 3D0GE 2JVRA 4KGVB 3D0HE 3SCJE 2DNYA 3MR7A 1RTJA 5DQGA 2DY4A 3CNQP 3OR1A 3VMFB 4UUWA 4B9UA 1U6ZA 3EN9A 3P5TL 4F3QA 3T69A 1XMQF 4RL1A 1S1TB 4DQ8A 3KOAA 3AGKA 2C42A 3GFHA 2EG2A 4JKAA 2H5JB 1D3WA 3CJ0A 5ETQA 4HDHA 2HZAA 4C8MA 3T1YF 4FYDA 3BQ1A 1PC4A 4ED1A 4BVOA 2QL9B 2P9LB 1LNQA 2WVFA 4A2AA 1RT2A 2OP5A 3VGTA 3BGRB 3L2WA 3MEDA 3JAMO 4LUBA 4E98A 3DRYA 3N28A 1SUQB 1N5YB 4JI0F 4OYXA 1UWBB 1MROA 3V6DB 1C0TB 4IRCA 4OI1A 1JJCB 1X4HA 4DL5A 1WG1A 4OZ5A 3DXSX 3UCZP 2V63A 2JDJA 2RMLA 3CXCR 3OVBA 2XWXA 1A6LA 4RCHA 1IKVA 3PXGa 3BQ2A 3TQ1A 4JI8K 3RMBA 2Q3SA 3HZEA 1R6YA 3OBYA 1PAEX 3NWGA 2QFIA 2G8IA 2MZRA 3MAAA 1TFWA 3TEHB 3A2FA 1X3MA 3CD6S 3D6FB 2J5AA 3QNNA 2YX1A 1NJYA 5BXIA 5LL6Z 1H1VA 3ZSYA 2ZKUA 3L7UA 4ELUA 4LBIA 1S5JA 3DJCA 3G82A 2AMCB 3M32B 3I5CA 4FWLA 3QPIA 4BE0A 1FERA 4OPJA 2HMIA 1BO5O 1LW0A 3N6MA 3MFIA 4CO2A 3QLHA 2WUSA 3MMAB 1S9EA 2DNPA 4K4WA 4OJ1A 1K8AO 1ZBSA 3EPGA 1Q53A 3C6UB 3AB2B 3M3ZA 5HMZA 1OY9A 4YDUA 4LFCJ 4O0JA 2Y9HA 3L4QA 3BGFA 4RBVA 3AY9A 2UUAF 4IOXA 1X9WA 1VC0A 2UU9K 4QIEA 3RYLA 4B3MK 3PV8A 3JB9k 4ZKAA 4JV0A 3KLEB 1VSKA 2W01A 4P73A 1M5KC 1JLQA 1S6OA 4NLYA 4LF9J 4DFKA 1ZS6A 3KWGA 4XIUA 4PL7A 3OR2B 1HBMB 4O23A 2AGOA 3NGUA 4WXWA 3N5FA 4K50A 2ZH9A 4X4TA 1R0BG 2EXUA 3CM5A 4CK2A 4OPAA 3R5BA 1F0XA 1KLMB 1QLNA 4Z7CA 2VV5A 2YHAA 4KTZA 4CVNE 4FS1A 2KL8A 4FOIA 1BHLA 4FN5A 1N54B 4NLTA 3QFPA 4FLZA 5DRKA 4I2QA 4I7FB 3IG1B 3L6QA 2XS2A 3SJHA 2I1RA 1KQSR 5AQNA 1HX1A 5D0RA 2XHCA 5LMNF 2V69A 2MY8A 4DU8A 4X62F 4XPEA 2F9WA 2EWHA 3KLHB 3AOAA 4AM6A 5CH7B 2OELA 3GDQA 1PBUA 4I1TA 2ALZA 2RHKA 3ZSWA 4IQMA 5D77A 4JI6F 2B43A 2UXCF 1VRUB 2J8AA 1Y5LB 1B0PA 2IRUA 4OGEA 3BKTA 1FO1A 1C2PA 4K7QA 3NLCA 1GXUA 1YDLA 1CULB 5T7BA 4LIRA 3GMGA 4DTRA 4KHRA 4UY8T 2HBZB 2ZUAA 2EBGA 2DPIA 3LGMA 3M9MB 5ETKA 3JAMU 1HLWA 2VICA 2KQ2A 3MM5A 4Q8EA 5LMUF 5EWFA 1X5SA 5KQDA 1FJEB 2J76E 3QEWA 4B3TF 1TYQB 5B08A 2C1EB 3H7HB 3CMAN 3VQ4A 2B6AA 3SLCA 4YDUC 3H46O 2IYGA 3ZXWA 4I64A 3GIMA 4RBUA 3TTFA 5DG7A 2YXLA 4ATNA 2JHEA 3U3YA 1GXTA 2KI2A 4OYOA 5ADZA 2Y1RI 1EIYB 1T9UA 1N34K 4FM1A 3N01A 3A12A 5E26A 4KGKA 4WTOB 2YHBA 2GIFA 2F9TA 4E3SA 3TZWA 2UXBK 3Q8SB 1FJGK 3OYJA 4C4WA 4ID5A 2W41A 1VOMA 4PG7A 1IM4A 2WB4A 2BRLA 1S77D 3UD5A 4R0EA 4GC7A 4PWWA 1HARA 2A2DA 2CA9A 4AHRA 1NDPA 1KC8T 2FDNA 2YWKA 4P2XA 3K0JA 2VASA 1W97L 2B4PA 2IVNA 2KO1A 1RACB 1FVSA 1RILA 2GIQA 4QW8A 3M7VA 4FLYA 3HLUA 4Q43A 4F0KA 4QS9A 2Q0RA 4NLBA 1QZ5A 3ZZZA 4PG8A 3ULDA 2RU3A 4XTTA 1F2GA 1RLDA 4DU7A 4LH5A 4ZLJA 2BV3A 2M9KA 2HGMA 2KTQA 2D0AA 1PILA 3OYBA 4CF2A 1NK5A 3VAMA 2NLXA 4CO1A 4MLEA 4B9LA 2AJ0A 5E0OA 4RW6A 4UQTA 4W90B 4C9DA 4TYAA 4FF4A 3V1OA 1W25A 4Z4EA 3M05A 2DT9A 1SJ3P 3KLIB 3FLCO 2V8DA 3D68A 4NZ7A 3JTPA 3OVNA 4AHSA 4BC3A 3SDEB 3W9HA 3C94A 3CJ8A 2H5EA 2D4WA 2Y8WA 3M6VA 1J2VA 4RZRA 4IR1A 4V19X 1XTZA 5L1LA 4KBIA 4DG1A 4FYXB 1HNWJ 2VBYA 3TI0A 1RA6A 1HWJA 4WYWA 2A18A 3C2PA 4NXMJ 5B0AA 3ZSQA 1T9TA 2H9ZA 2OTJN 3RB3A 4BRHA 4KKOA 1R8AA 2QA4N 4ECXA 2YJFA 3C7NB 2HEKA 2AJ1A 1JLGA 4OGCA 2JWLA 3P31A 2ZBCA 2GQ2A 4RPFA 3J7YI 4OI6A 2P5OA 3NF6A 1X31C 3P5JA 1U4BA 5JS2A 4LF5K 4TQRA 4OYPA 3NCQA 1ACMB 2V67A 4DEZA 3HHNB 4B3SF 1HYSB 3TAEA 1Q8KA 2WSFC 2VWJA 4CZEA 2M2BA 4J9OA 3LDQA 4KHPK 5GIPA 3UD3P 1F60B 4BQLA 1WF0A 5K5MA 3F41A 3LDOA 4PA1A 4J91A 2DBBA 2OANA 2N82B 3HFVA 4PUOA 5DGAA 1WSRA 1YWXA 3D2FB 5JVGL 3OHAA 2ZNZA 1FWLA 3ISNC 2YX4A 3ELHA 3LZIA 2NXNA 2XBPA 3R7NB 3LAMA 4M41A 4O3QA 4A2BA 1K8KA 1VQLS 4DPYA 1V3RA 4FWOA 1IN0A 4IFVA 4WFZA 1O0PA 3CJSA 4KPCA 3CB4A 1XUPO 2VJVA 3R9LA 1NKCA 4OX8A 4OZ3A 2CZ4A 2V50A 3NE6A 1LCUA 4H5NA 4DL0C 3SAFA 2PIIA 3HM8A 1NBEB 1P8ZA 4JV2A 5BREA 3THYA 3CQYA 2J7KA 1C1BA 3VF0B 3H5SA 2LQJA 1TL4A 3TTCA 2H65B 3BYPA 2ACYA 1NGIA 2E9TA 3J7YU 3MK6A 1X1PA 3PLAA 1T05A 1MMDA 2PA3A 2MLXA 4CZHA 1RWKB 1BHNA 1ITGA 3MAAB 4YHHK 3ENAA 4TXSA 2GUIA 3AOCA 3I31A 2PFFB 5ETTA 4B1XB 3DCAA 2BQUA 2W7PA 3O3FA 1N0UA 4CIFA 1R43A 3RBZA 1S0NA 1S9FA 1UPMB 1RHMB 3BH7B 2IAJB 2J0SD 1QSYA 3CJ2A 3OHRA 4UW2A 4F67A 3CCTA 4FS2A 3G87A 2DFHA 1Q18A 2P9IA 2JSXA 2P9KB 5J1PA 1FD2A 3ZZTA 4M3ZA 2QI2A 3AD8C 2EBEA 5DLFA 2UUCF 1IXKA 3CIZA 1D8ZA 4DUYF 3AD9C 2I0XA 1S48A 3PO4A 5LJ5Y 3HSCA 2R3VA 4DR3K 4F7VA 2K06A 2NRZA 4A8KA 1CJVA 5B0GA 4LF6K 3MCOA 2M70A 2K7JA 2HURA 1C0MA 4MKYA 4IOAL 2OI2A 3DLKA 3T1AA 2DR9A 2DXEA 4MFBB 1S6QB 4KFBA 4CLZA 1SCJB 2ZH4A 1HNVB 3GE9A 4PPZA 4DQPA 3PUFA 4ZPVR 3LGNA 2ZUGA 3B4DA 4USKA 2PBDA 2W9CB 5AQVA 4CJ3A 3DGPB 5GAHP 3CSKA 5IWAF 4FK0A 2K3IA 3PO5A 4NCGB 2JEGA 2YKMA 4LJMA 3P1GA 4U67Q 4H0PA 1RWNB 2HGLA 2ZBIA 3MD1A 1MDUB 3H5YA 5F3ZA 1TQLA 4JYAF 3QT7A 4CLFA 1S9GA 2VJUA 2Z58B 1IKXB 4RUAA 1M0SA 2GAGC 3ZSRA 3IXQA 1W2BR 3H1VX 5T41A 2HYIB 3MM7B 4BWMA 3EX7B 1Q82T 1JLCA 1O51A 2J6UA 1GTHA 4DR7K 3MDFA 2VWBA 2LQBA 3VF6A 1JXVA 2R7YA 1G3OA 3AJ1A 4J37A 1E3MA 1YGYA 3ZETB 2QJ3A 5KFJA 2V6AA 3DLGB 5IM0B 2QYCA 3ZNJ1 3QBXA 4CEOA 2L48A 2JLFA 5HRSA 4DV2K 4M8LA 2CQCA 3CC4S 4CF9A 4E7KA 5IQQA 4JKFA 2H1YA 4Z4HA 5DK5A 2IJRA 5I3UB 3VF2A 2FUG9 1H72C 3BY5A 2OPQA 2DKOB 3GV5B 3PEHA 4NA2A 5KFIA 1BA0A 1V3ZA 3CCEN 1GEHA 5GAHU 4B3SJ 4CEEA 5IV4A 4U67L 2CNNB 2AZ3A 1RXOB 4RX6A 1S4EA 4Q45A 5HK4A 3HK2A 5BRHA 5HRRA 3TR8A 1KVKA 2YWWA 5HMWA 2P6SA 2QT7A 1NM1A 2NQPA 2ATCB 2H4WB 2FD2A 1S3XA 2DH7A 3DXBA 4BCAA 1BIZA 2BKPA 4CLSA 1DTTA 4FP9A 3KK3A 3RU0A 4AL7A 3G0ZA 3NGTA 1CEZA 3IGVA 4TQSA 4DUYK 4BG9A 3RZAA 3L2RA 2J6TA 2IPOB 3OD2A 2ITGA 5KGXA 5KOWA 1XERA 2ZQBA 1KP6A 2B3TB 2CQPA 1S1VB 4JKHA 4PRFA 5L9NA 4N7TA 3EWGA 3ISZA 4FJLA 4DFJA 1DAXA 3LW5C 3AVCA 4J8FA 1M1HA 3UNGC 2F8SA 4BR4A 4CJFA 2BKOA 3CD5A 3V9SA 4CLTA 1X3NA 1Y9OA 2LLZA 2HHHF 4W5TA 3GYXB 5HN0A 2NRHA 1X5OA 2B8PA 1NGHA 2BE2B 4RNMA 3OYHA 1IV0A 1X9SA 3IWLA 4DV3J 1IBMJ 3SCIE 1ZBLA 4I2PA 1YLXA 2DIUA 4H54A 2EPIA 2E1CA 2VOOA 2MJNA 1OYEA 1WOOA 3MFHA 3LP0A 3BGUA 1NH8A 4GVMA 5CR4A 3O6QA 1JLBB 4M1KA 4MLHA 3CDEA 4J9VA 1KLNA 2XNRA 3D0IE 3ZSZA 3SZ2A 1RT3A 3GBTA 3MR5A 1RB0A 3NF7A 3CFOA 1SS6A 2IC3B 1C0UA 1RHKB 1T3VA 5GADU 1XNQJ 3BKFA 2YH0A 4KB7A 1YJWS 3LDPA 2PMWA 4JI0K 4KRWA 3VQBA 3MAHA 1DGKN 2BXJA 3WIUA 1UJ5A 3M8PB 4N56A 3I96A 1U1QA 5AQJA 1YRUA 2UP1A 2QLBB 3U1LA 1GT8A 2G8KA 3K9JA 4IBNA 3LDLA 5CHIA 3VOVA 4JI5F 1A5VA 1LFWA 2RQMA 4CFCA 2PD1A 2HZCA 3N4WA 5KFQA 4W5NA 4K4UA 2VL1A 5ELZA 3VEYA 4ILHA 2W8KA 1WG4A 4LRCA 3O1LA 1RBUA 5CD4H 2E2NA 4OZLA 1UOCA 1FHTA 4DCJB 5IS2A 5KG3A 3DDNA 5D0EA 5EHHA 3CC4N 3FSXA 3LWMA 1BI4A 4HTLA 2DCUB 5AQQA 4IWVA 1T6DA 2XMVA 3SI6A 4ZOSA 1ZAWA 1EQMA 2J9DE 1FE4A 4H4OB 2VPXB 4DV5K 3UI3A 2O8CA 3VALA 4LREA 3SUPA 1LWXA 3TAGA 3CCES 1U48A 4CH0S 1KR4A 5E3AA 3V9WA 1KC8O 4UY85 2WAQD 2QWQA 1GOBA 3J81Y 2LFVA 2MKYA 4DMZA 1LWFB 4X64J 4B1UB 3R9PA 1BCOA 3VQDA 3UD4P 4CO0A 2JC0A 1N34F 3DWLA 3TA0A 3JQKA 2XMKA 1BXNA 2C22A 1UAXA 2IVMA 4AYBD 1Q7LB 2AD9A 5IZHA 4DSIA 4CEBA 3AD7C 3L7PA 5A8RB 2MZJA 5F8LA 2R8JA 1FTCA 4NYZA 4CD1A 1REVB 4EFAC 4R5PA 3G8TA 2XGQA 2XY6A 2FIUA 1CULA 2YWHA 2PMHA 3KLIA 5K20B 4CP5A 3B8AX 1TAQA 4BRAA 3O1WA 3HHLD 4FVCA 2XLKA 1NWKA 3JSYA 3W1YC 3FZHA 5CYMA 4UQGA 1LK7A 5A8KA 4CO4A 1T11A 1BA1A 1HNIA 3E66A 3RSEA 5KTQA 1KQFB 2D1CA 3P4IA 4OHXA 2O8FB 5IT9Y 1BUPA 1VRUA 5K14A 4DXLA 4JN4A 2NREA 4IO1A 4KGZB 3ZEUA 4E1NA 3E01B 4F4KA 3SQOP 2VFVA 4NWBA 4FJ8A 3EEQA 4Z4GA 5T14A 4DTUA 1HD1A 4Y2MA 4WK3A 8AT1B 1NJXA 2DFFA 4RUHA 4NYFA 1RT6A 1HNXJ 4CI0B 1WTBA 4JUZA 2N4CA 1TELA 4OX9K 2WBMA 4QR1A 5IQ6A 3FFKB 4S0MA 3FSYA 1HBUA 2RRNA 2ZVSA 4JKGB 3JSMA 4Q8FA 2VQFF 3FZBA 1MMLA 4HVJA 5A0YB 1FKAF 3M4XA 1FT8A 1NRKA 2ZNYA 2Y3YA 3M2UA 3C16A 2HNDB 1K8KB 2ZBQA 4NOHA 1YITS 3TSQA 2GHVC 3BO4A 2ZDPA 1XNRJ 2AIRB 3THWB 2BH1A 4YOVA 4DTJA 1IG8A 4ZVEA 3L7OA 1C1CA 1UFKA 1OH5A 3MPWA 4FZYA 4LVNP 4HHJA 2UUBF 2UU9J 2XZTB 4WWSA 3SPZA 1B9DA 1R6VA 3PEJA 1VISA 1FEEA 2R7UA 2HHPA 1Q8IA 4M3RA 1Q8BA 1PJ5A 2NNWA 1KWMA 4BACA 2QLWA 3I0SA 1MW7A 4GY2B 3RAMA 3LP1A 1SQEA 4YOUA 3QIPB 2F40A 1PAUB 2HHVA 4BVPA 3QBWA 1S10A 3VQPA 4DX8H 2E5JA 3I9ZA 2LEPA 4EO8A 3JXUA 1D9DA 4CO5A 4O5BA 3C6HA 2NXEA 3PNIA 2D74B 1LXNA 1GLCG 4MTPA 4LF7K 4DL4A 4H5RA 1FX4A 3MEKA 1CS4A 1R8BA 3QEPA 2RDDA 1SJFA 4DTSA 3AVIA 4JI3K 3AVJA 2O4IA 4YY3F 3C15B 5E3PA 3DMJA 4GV6A 2R7WA 3NVMA 1V9OA 2GX8A 4ELVA 3GIKA 1H0HB 1U2VB 4FJ7A 2NSCA 2HPUA 1HWKA 3O4QA 1S97A 4A57A 5LT5A 4K42A 1J6ZA 5ETVA 5FRMA 2B4OA 3FFIB 1HBOB 3ZSXA 1CS4B 3POTB 4DN0A 5C42B 2J9DA 3HJFA 2CJQA 3J8AA 1KXPA 4BR7A 3HTVA 2OSRA 4GKJK 4HTUA 4QS7A 3TSUA 2Q3PA 4DTOA 1RABB 4DPWA 4UTGA 5EXWA 2G8FA 1WDDA 2GELA 2ZH2A 2P9CA 5AQSA 3VAFA 5HATA 1VQ7N 3FGUA 2WTFA 3R97A 1D9AA 5D4PA 1U09A 1OYDA 4CF0A 1T44A 3ZT2A 4NLUA 1MG7A 3POTA 1TUVA 4TN2A 4TU8A 2LYVA 5D78A 1BOTO 5FROA 3Q8YA 3OBWA 2YKNA 4WK1A 2PDAA 2ASYA 2V5HG 2C3YA 4RNOA 2ZE2B 2GS8A 4QIGA 2XRIA 3HVTB 5J2QA 4O55A 4FNIA 3BO3A 2FGOA 5F9NA 3ZTQA 4RW7B 4PXDA 3UPFA 4QIWD 2OTLN 1KLMA 3RRGA 1RUSA 1J54A 2RDJA 3CCLS 2AYMA 1XBWA 3HHEA 4DUTA 4OZ2A 1NSQA 1U04A 4JI4K 3NBPB 3UDVA 1YJTA 1D09B 3WEEB 3RAXA 1GLBG 1E6VA 2EFOA 4B9VA 1Q5YA 3NAEA 4CF8A 5AQGA 3IS9B 5KQ8A 2CGLA 3EDQB 4ZHRB 2MPUA 2AW0A 2E5HA 4WYBA 3DNCA 2F7TA 5G0RB 2AWZA 3KIOA 2WC9A 5BR8J 3CIMA 4NXMF 2NS1B 4CESA 5KFFA 4LBHA 3M32A 3ENHA 3J7Z5 4ZCIA 1UW4A 4WJBA 4ECVA 3T1HJ 1D8YA 1TL1A 4I6AA 4PR6A 1D1UA 2VC1A 2QWLA 4DU1A 4B3OB 2QWPA 4IZ9A 2KXNB 2K1RB 2V2KA 3DXMA 4JS4A 3CF5Q 3I33A 2GIRA 2KB2A 1YSJA 4O5FA 4YN3B 2A42A 4YP3A 3QQCD 1Y11A 3CMAS 4EHTA 2YKMB 2DY9A 3VGKA 4DG1B 2FHJD 3VQ5A 2CQGA 1I3OB 3H2UB 1UVMA 2W42A 2XSJB 4DR2F 4LT6A 5AQYA 5A6PA 2ZHOA 2JH3A 4OMFG 4K4ZA 3FBBA 3UKRB 4Z4IA 4DLGA 3MGJA 3CG7A 4MAKA 2GJ2A 3DLKB 2BE7D 4LF4J 4ID5B 4DL7A 3L8BA 3CM6A 2BE2A 4F4AA 2C28A 4M5HA 2KYXA 3IBWA 3KK7A 4RUBA 3R8YA 1TK8A 3IAYA 4WP3A 2BM0A 1UP1A 3AARA 1VQPN 1O5JA 4L75A 3PYGA 3VQCA 3RGIA 2QC3A 2HBRB 1QHTA 3L09A 4X84A 5HP1A 3CFPA 4DB3A 4FZZA 1TP7A 2EHGA 4A46A 4UT4A 3FEYB 3QGGA 3SSRA 4CBWA 3DHWC 4DR7F 4IOCL 1GLAG 4FJKA 2JWKA 1VQ8S 3ULEB 1XQIA 4O3RA 5KFLA 3PDNA 5KFNA 1G4CA 2HHXA 2HVHA 3AT1B 1IBKJ 3QETA 4KPYA 2QTWA 3GFXA 1P90A 3VA0A 2OEJA 4QW9A 4E1MA 1TMMA 2JEJA 5B0CA 2PA8D 1XN9A 4B3TJ 4C0OC 3HHLB 4FJHA 3PJ9A 1IJEB 2X3GA 5IT9O 1FNXH 3OT9A 5A2QY 4DR6J 2R9LA 4L3NA 4NLSA 1MN9A 2HVIA 3AVMA 4Q2MA 5AXNA 1X8DA 1HJOA 2CUYA 4NLXA 3TVKA 3QIDA 4P72A 4EZ6A 3GCWP 2HAFA 3M8YA 1B3TA 3CW2C 1VK0A 5H9FJ 3I5BA 4C3KA 1QS4A 3BH6B 2LCWA 1UEUA 2OTJS 4LFBK 3EZOA 1A5XA 2O5DA 4M5DA 4JI3J 3M1FA 1VSEA 4KJIA 1RT7A 1NGCA 3KWMA 2BMBA 4OPKA 3MMAA 3BSNA 1I94F 5IC6B 1TU0B 3DU6A 5LMNJ 4CJPA 4DV2F 3I8BA 1W26A 3PYDA 4ZK7M 2GJFA 4X4VA 3SQ4A 2YNIB 4XAKA 4AL6A 3VA3A 5AJ3F 1HWIA 3NGYA 1RFQA 4YB1P 4CH1A 2J6SA 2RS8A 2E5GA 4CLLA 1CZ9A 2WTUA 1JLQB 3ZX2A 3P38A 4NXNF 2P9IB 5J2MA 1UFLA 2E4LA 4UOGA 3V9UA 1WC0A 1YJVA 2YNHA 2DR6A 5FIIA 3O6WA 5J1EB 3DI6A 3THVA 3K17A 2ZITA 1HNZF 4WQ5A 4DWIA 4KTQA 3TZXA 2KHDA 3BN4A 2IIHA 2HHUA 3HRGA 4JP8A 3BREA 1NH7A 3MCPA 4I4BA 1FK9B 3SEOA 3A3OB 3KFWX 5HP1B 5JS1A 4DV5F 2VONA 3KWIA 1XMQK 1HWLA 3R1LA 4JD2A 2EK6A 4NMLA 5J2MB 1G6BA 5HMYA 2G1HA 4CJ5A 3H0PA 1TK0A 3S8SA 3PFOA 4QZVB 3SXLA 3VAKA 1VSLA 3DLBA 2HFVA 3TWZA 3HOTA 4LF9K 3NCRA 3HPOA 4KH0B 2NZTA 1RYRA 3FC9A 4B1YB 1Y3KA 4JI1K 2DGOA 2F5GA 3PM9A 3A4TA 4M45A 3HPHA 1IKWA 5E41A 3HI9A 3RBXA 4DPTA 2HVEA 4AM7A 1DTQB 3TUJC 1GMVA 3SAHA 4MO5A 1YBUA 5AQZA 3HMJG 1VIOA 2F8MA 1M5VC 4ICLB 1CLQA 3J7ZT 1RAAB 3IRWP 1N36F 4AL5A 3WNGA 2PI5A 4Y65A 1N56A 4LFAK 2W4DA 5FLXY 4OHWA 1O8BA 4O3OA 4KSEB 3TABA 5KFSA 3VQSA 2FVPA 4EO6A 4WCEL 2D7SA 3HVAA 3NF9A 3PIOQ 3W66A 4XDDA 1RGVA 4CYUA 4CJRA 5KFTA 1VC5A 4EAHD 5AE2A 1FXDA 1RT1B 3HT3A 4CIGA 1APSA 1YQHA 2BVZA 4I68A 2ZVIA 1WEZA 4KHSA 3ZFVA 1YX2A 3OFHA 3I4PA 1PIEA 4IRKA 4UZCA 3QZ8A 1S0OA 1XMOF 4YNQA 3D6TB 4RWXA 4Z94A 4Y6IA 2Z0GA 1LW0B 2ZH1A 3ENQA 2J0XA 2Q31A 4CQ1A 3PKMA 1QD1A 2ZD1A 2XZDB 3IMXA 1WC4A 4TY8B 1TKXA 4J9MA 1YJ7A 2FBVA 1RKIA 2W9BA 5GAGI 2G8WA 1IBLJ 1D4XA 4DV6F 2ITMA 1M5SA 4BC4A 1RCOB 3OSPA 2VH7A 2DGXA 1O13A 4Y1DA 5AXLA 4RWWA 1H74A 2CAJA 3GJRB 4U6PA 4DFMA 2O1PA 1LW2A 2F4VK 2HBKA 4PZVA 3NOCA 4Z7YA 1U6BA 1S4FA 8RUCA 4Y0WA 4MDBA 3EGVA 3TUIC 3C6AA 4ZLLA 3UKUA 2F7VA 3K9KA 5C24A 3D4JA 4HACA 1RT5A 1RDUA 2HNZB 5CABA 3TARA 4Y0FA 3QFUA 2AP1A 4EFHA 2FJAB 4LF2A 1LWEA 5KFAA 2UXBJ 2XMWA 4EU0A 2BJ3A 2R7OA 1S99A 3EGZA 3G8SA 1WHXA 3F5TA 1C4AA 1SUQA 5L8RC 4KHYA 1FFWB 1EKEA 4J9PA 2DH8A 1JLFB 5A8KB 5CYQB 1WOSA 5KG2A 2UUTA 1SKRA 3I0RB 1BD6A 2W8LA 1OQ6A 4IYQA 1AT1B 4MK9A 3LDNA 3T1YK 1FRJA 3UKUB 1IKVB 4HACB 3VZHA 2NLWA 2GWJA 3WQUA 5A8RA 1QVGM 2UXCK 4DQSA 4F2RA 3HDSA 2C2EA 2MGZA 1EKRA 4BROA 4MH8A 3L9ZA 3CD6N 3KLFB 1U1MA 1L3UA 1K44A 4JI1F 1NJZA 1SJRA 1CJKA 2IYIA 3JYTA 2GMJA 1CJTA 2F3JA 3BQ0A 3NGKA 2I7PA 2QO3A 4HLBA 4B8CA 3R5JB 5KG6A 2OPSB 2MQPA 2B5JA 5JUMA 3BZCA 1ZBHA 3I9V9 3KJNB 4X62K 1EETA 2LXIA 4AHVA 1MWQA 1NPRA 3OHBA 3CJ4A 2A3JA 2DNLA 4CFDA 5L1JA 3R1XA 5KT2A 3QAUA 2QL5B 3UDLA 2FC9A 4DX6A 4ZN1A 2QEXS 4H5VA 5LJVA 3CMEN 1U1KA 1H38A 1Z4UA 5JICA 4RU9A 3ADAC 1NGAA 4FLWA 1D0EA 2YQ3A 4ZN3A 3UVJA 1RWMB 3IUCA 2RRBA 4RUCA 3DOMA 4M5GA 3I8DA 5BN9A 2DGWA 1KHVA 1YK9A 2GMHA 2FSKA 4DL6A 4PYDA 4LF7F 1NHKL 4KY3A 2Z1JA 2BDPA 3LTOA 2OZMA 2H51B 1WI6A 4DR1F 1ZZNA 2I8EA 3KHGA 1FA0A 2CG4A 3U7JA 3O1BA 1N6QA 1HRHA 2GHWA 4B3MJ 4KHPJ 4FL9A 4CLUA 3TAPA 4WXOA 2XG8A 2MLZA 1WSFA 2YNFB 4MQ3A 2XULA 3C16B 3I87A 3NXZA 3W9IA 3FCHA 3RR7A 1F2HA 1RCHA 4C8ZA 5M1OA 5J1NA 2FLNA 4W4MA 4J9NA 1MLAA 5HAOA 3MECB 2KZMA 2I5JA 4NASA 2FC8A 3G6VA 4CHZA 3RW6A 3SBMA 3MI7X 4QIFA 5KT5A 1NLKL 2B9YA 4OLOA 1NMEB 2HSEB 4UZBA 1P9YA 1VYAA 2DR5A 5IC4B 1CC7A 3JS9A 3SSSA 3SUQA 4JS5A 4P2MA 4KHMA 1WUUA 4I6MA 4F02A 4CHOA 1LK5A 3AA8A 3B54A 1JJ2M 1U2RA 1Q5VA 3GYNA 3OTCA 4DR5F 3CVKA 2ZJQL 1R0CB 1QAIA 2GV1A 4N47A 5T7LA 4DMNA 4K0KJ 2RUSA 3IWXA 2FVSA 2GFFA 1GLLO 4HI2A 2HK2A 2AYGA 3PY8A 1B7YB 2XMTA 3ZT4A 4FBTA 4YB5A 1L3KA 1HMVB 3WX8A 3FBEA 3UN2A 1FNMA 1QQOA 3KLGA 1RDBA 5CZXA 1XK8A 1WF2A 2YX7A 2CQ1A 2VBWA 3OYFA 2RF2B 1Z6RA 3VHQA 2BACA 4JI2J 2IHR1 1YKWA 2NRVA 4LFAJ 1JJ4A 4W5OA 2C2MB 1T03B 3UDEA 2W7AA 3NRBA 1YVUA 1NSAA 1CXUA 4QR2A 4KH6A 1KAXA 4GKKK 4AHTA 4TNOA 1HI0P 3VVTA 4CNZA 3PHTA 1BWFO 2MSTA 3BV8A 4LR8A 4PL8A 2C2OB 3M8ZA 1G1XA 2FC0A 2OA8A 2RN2A 1ZXOA 3AB4B 4IQXA 4YB6A 1S1TA 4RW8B 1VSJA 2GEMA 1S1XB 3QATA 1RA7A 2RQKA 3K5NA 3HO1A 4X4NA 1FJGJ 2DXFA 2PAVA 3DFEA 3DGVA 2ROEA 1FKOA 2W9BB 2C2RA 1C1CB 5GAGU 5GAEU 1U2CA 4ZCMA 5B0DA 3D1QA 4NI2A 1VSFA 4RNFA 4C1NI 2BW7A 3JTOA 4QWBA 3RR8A 2HK3A 3EVMA 5HVFA 1HQEA 2YWFA 1F9HA 3GJTB 2B7CB 3NF8A 3AVLA 2XHBA 1B0VA 1XIQA 2WVEA 1RTJB 1VQ4N 1HYVA 5ETMA 3V9ZA 2HHQA 4WPAA 4X4OA 5AQFA 1HHTP 4X4RA 4Z0UA 3WNEA 2QWOA 2E44A 1NGGA 1KKHA 3O4WA 4J2BA 3S9HA 3GV7B 1Y4ZB 4CGHA 3QMQA 2BUNA 1RKJA 1S1UA 5EN1A 3BR8A 1ZAVA 3Q22A 2KKHA 2FLLA 1XI1A 3KNAA 2BJ7A 5AQUA 4A8MP 4P9SA 4AHCA 4TVAB 1XR6A 3MXMA 1JLGB 4CZLA 1WN7A 4BC7A 3N4QA 2M8DB 2NXJA 3OUYA 3CC7S 4ISFA 2RE1A 1SI9A 1U2VA 2AEFA 4FWRA 2E20A 2G8UA 3JSRA 1ZH5A 1HYSA 1H73A 4HUGA 3KLGB 2FPHX 3I0SB 3AQPA 5E3QA 1MN7A 3DOLA 1C0GA 5I9EB 2W25A 5DDQC 2MQ8A 4MMOA 5FJ4A 4WKRA 4EUVA 4W98A 2VGMA 1JQGA 2YKOA 1YG0A 3VETA 3NGSA 4IO9L 3EZ5A 3VGMA 4K4SA 1RWXB 4GVBB 5JVHL 5GAHI 2HBMA 4X65F 3H4BA 3R27A 3HXMA 3TVZA 2XCPA 4DUZJ 4B3SK 2CWXA 3EGNA 3N6LA 5KFHA 3ZX0A 1M90O 1YXQA 3ENOA 2DRDA 2EC2A 4AXIA 4YHHJ 2QSWA 3L3UA 3H98A 1H2UX 4W92B 4FJ5A 4PXEA 2FY1A 1U0HA 3M30B 1F9EB 2BJDA 5U47A 3TOQA 2QFJA 5CHCB 2XGPA 4GMKA 2W6LA 3K5OA 4NZ0A 3V1RA 3CMQA 2BQRA 2PZSA 4WE1B 2M88A 4M5JA 2MZQA 3VESA 2ZWPA 5F8HA 2KM8B 1PKUA 3VAGA 2XYGB 3M1VA 1HBNB 1G15A 4H4OA 4NL5A 5KFBA 5B7WA 1QTNB 1CZBA 2LU1A 1HKBA 3IMQJ 3L2VA 3GR0A 1IKXA 3G4SN 4BQZA 2PN6A 1UETA 2RQCA 1UTAA 3HT0A 2O8BA 3HKZD 2BM1A 1JJHA 4AT1B 1BQMB 1YRTA 4CFAA 1F21A 4B9TA 3M8QB 4DR3F 1PJ7A 5KFWA 2XNQA 1UL3A 5J2PA 4CEDA 2PMZD 2MMYA 3PR5B 5C25B 1WKLA 2W4PA 4ECQA 4CJKA 3GFZA 2YKNB 4Q44A 3H3OB 4MIBA 3IG1A 4DSJA 3WQPA 3W64A 3IGNA 4HCCA 5AZIB 2BYCA 1KVCA 4CGJA 5D15A 3A5NC 4DF4A 2BABA 4R5PB 4CJLA 2IRXA 1X0PA 3CC2N 3TUPA 1JLEB 1SKWA 4G9ZA 1WSJA 3MM8A 1S5ZA 4ZP6A 3MN6A 1VQ6S 4LSLB 1OPZA 4K59A 4V1Ak 3L3CA 3HVWA 1NGEA 4K5RA 3E2EA 4K0KK 3T9ZA 3VZIA 1GLFO 3OYCA 5AE1A 1B9FA 3MZIA 5M1PA 2OEMA 2KT3A 3ATUA 3D67A 2CVEA 1WF1A 4B3RJ 3D54A 3W3DA 2KLAA 2QLFB 1VQON 2HQIA 1RBOB 1GX6A 1UFWA 2E2QA 2XY5A 1PJ6A 3LOUA 3VQ9A 3EUNA 2X1BA 2ALYB 4JI2K 1WB9A 2B9EA 1VJQA 1VQ5S 1J5EK 4O3SA 3TX8A 1GMUA 4P71A 4OYAA 3D0PA 2Q66A 3UO0A 4Y34A 4AHUA 1LWCA 2DO0A 1K6YA 2KVQE 2HHHK 3OS2A 4C0HA 4ZVOB 1SV5B 3RTVA 4X66J 1VSMA 1C1AA 4BGBA 4FW1A 1DURA 1YJWN 5I3QA 4ZVFA 3UCUP 2ZOFA 2QLXA 2HQDA 1DY3A 2DRBA 3WC0A 4YB7A 5J1EA 1YJRA 2BJ9A 3FDSA 2ZM6K 2XO6A 3GJQB 3B8HA 3ZETA 1RDDA 2CPZA 3JXOA 1RISA 2E2OA 5F8NA 4NLQA 2M5YA 2VG6A 5J2QB 4PXCA 1FK9A 2R8HA 1UW9A 1TL7A 4I6WA 3HL8A 4PWUA 4NA3A 5F8IA 3H4DA 3SQGA 2FBXA 2OJ3A 2ZOGA 5KT6A 1T95A 4K4VA 2YWEA 1ATRA 4IG0A 2GMLA 3FZMA 3S7RA 2DTJA 2JEFA 4K2JA 2CDQA 3TJAA 1KQGB 1BU6O 2P9NA 2CPFA 1BWVA 5ETNA 3PW2A 4OO1J 1X5PA 4CHYA 5F3TA 2QTDA 2V34A 3D3CJ 5M2PA 1IKYA 3GFYA 1K73O 3PIPL 2HW3A 5K14B 2J9EA 2GX9A 1VHIA 2VG6B 1JLEA 4LFAF 4DV6K 1RT1A 1NHUA 1I51B 3ZZRA 2RH3A 5EU7A 2OD4A 2GVDB 5EUHA 5G4DA 2V51B 5I4MA 2O8DB 3QJPA 5BPLA 2F96A 2I2YA 1M1KT 3VERA 1WOQA 5AXKA 3MDQA 1RBAA 1Z1ZA 4ECZA 3MPVA 3OW2R 1R89A 3OYGA 1N32F 3O9SA 5D4NA 3GG4A 3CYMA 2JFKA 1NSKL 1M5PC 1KRPA 5BRDA 4IFYA 1UVJA 4CJSA 1URRA 3W60A 2CADA 3CCRN 2F8TA 2P5VA 4H0TB 3VENA 2ADBA 1UVNA 1DQ8A 2FHMA 4QBUA 4GW6A 1VQ9N 4H4KC 2OH2A 3WXMB 2W2QP 1EQ0A 4X4PA 2JLGA 3R2DJ 4C3LA 1RTDB 3ISND 5KI6A 2C3PA 1N33J 4ZPDA 2OEKA 3EM1A 3SCXA 1OVYA 3D1OA 2E5LF 3B82A 2MKKA 3JQJA 2O8EB 5DQIA 2VKRA 3NCPA 4F4ZA 1REVA 4CEAA 1GAOA 4F26A 2HKEA 1FD8A 4USIA 5CYJA 5JLFA 4BDZA 4PWDB 3E51A 2IDEA 2UVWA 2WCXA 4CZCA 5KFDA 4C11A 1CJUB 1HNXK 2DFEA 4JRQA 3ILIA 4NEZA 5KT3A 1RP5A 3D9BA 1YBAA 3C14A 2ASJA 2LDYA 5LM7E 3MXJA 3NH1A 1W7AA 4ID1A 2XS5A 5ITHA 1P8GA 2BA9A 1K0VA 2IC3A 1FRXA 1VLYA 3UIQA 1B64A 1RQ0A 3MM5B 3D6HB 4IDHA 1Q78A 2ROGA 3CCWA 4F0HA 3MEEB 1M5HA 3CCZA 5CZVA 3Q8RB 3MWPA 3ALYA 1QHAA 2YWGA 1XNRK 4MYTA 3TP2A 3TW0A 3ULEA 3KXDA 5JLHA 4RKUC 2F4VF 5AXMA 5FLXO 3SCKE 4P10A 1FJCA 1ROFA 4O44A 1EHWA 4IDKA 1OSDA 3UQSA 2VBZA 3LH2S