2YKNA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPLLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
total genus 163
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yknA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yknA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yknA05
3ULDA 3SPZA 4L8RB 3HP6A 5HROB 4O4GA 2WRMA 3K5NA 2YNHB 3V1RA 3T5JA 2OPRB 3DOLA 3MECB 2V4QA 1A5WA 1JXLA 3V1OA 4KI6A 1RDCA 3B6PA 2AX1A 3MEEA 3CFOA 3PVXA 4E7KA 4TQSA 2XGPA 3GV8B 3EZUA 3OHAA 3H59A 1ZBFA 1T7PA 1KVBA 4MK8A 1TL3B 3QO9B 2XY7A 2PYLA 3AV9A 4KO0B 4TY8B 1S5JA 3M8RA 2X78A 4FLXA 1RT3A 4F4ZA 4LQ3A 4NLDA 3OYHA 2VA2A 3HVWA 4OKKA 2OPPB 1BQMA 4RW8B 2BGGA 3DRPA 1O1WA 1KRPA 5C5JA 4BDYA 3ZSYA 3PR4A 5J1EA 4FLZA 3HKWA 1IM4A 4CJRA 5DQHA 1ZBUA 3SNNA 4Y2AA 4W5QA 4AILC 5J2QA 5I42B 2EHGA 2BR0A 4GC7A 1L3UA 3NH0A 1ZYQA 1X9MA 5JUMA 2DFFA 3CJ5A 4K4XA 4K50A 1QQCA 4JRQA 1NJXA 1NK6A 1XR7A 1VRTA 1TK8A 2FVCA 1U09A 4CEEA 1EXQA 3DYAB 1GX5A 4FJJA 1HMVA 4NCBA 4DL7A 1RA7A 3NH1A 3TAFA 3Q8PB 1VSLA 2WONA 4G3IA 5J2NA 4NLYA 4CJ4A 3DOKB 3QEXA 4MIBA 1U49A 4E3SA 2WTFA 2PYJA 3GIMA 1RT2A 2VG5B 3QIPB 3EY1A 4KHSA 3I0SB 2W7OA 2HWHA 3RMBA 1RT7A 3GYNA 1UA0A 4KAZA 4CESA 1RCHA 1ZTWA 1C0UB 4RNNA 5F8JA 3ZT2A 4PUOB 4Q43A 4WE1A 4CJSA 4E7JA 2IM0A 4DS5A 1RTIA 1HJRA 1U4BA 1WSIA 1JLGA 1SH0A 3AA3A 3TARA 2YNIB 1MMLA 1RTDA 2YHAA 1RT5A 4IBNA 3KHRA 4W5RA 4CJTA 1VK0A 5KRTA 3M9OB 4CEAA 1HNIB 4KBIA 5DG8A 4K4WA 3HPGA 1JX4A 3V4IB 1RT4A 1Z26A 3LPUA 5CZ2A 2AU0A 4JS5A 5CY4A 2G8KA 4RW6B 2W9BA 3BQ0A 3AA5X 3M8PB 1GOAA 3ZSXA 3OS2A 4J9KA 3DRSA 2FLPA 4CHYA 3DLEA 1EETA 2OPSB 4RW7A 3G6VA 3PO5A 3C6TA 4IG3B 2D41A 3MR6A 3KLIA 2WOMA 4QWEA 4K4UA 3VQDA 4ED0A 4I2PA 4LSNA 1LWEB 4MKAA 4W5OA 3PR5B 1L3TA 2RDJA 2RF2A 3SQ0A 1TVRA 1KCFA 4Z0UA 1RTJA 4ICLB 1KVCA 3H4BA 5KFYA 3TAMB 1ASWA 4E7HA 3VQCA 2DY4A 1SH3A 4DTXA 4ELUA 4CJUA 3AVKA 4ZTFA 4KB7A 3KIOA 3UIQA 1LW2B 1LWFB 5DLGA 4ZP9A 1HQEB 3MF5A 1GOBA 5FRMA 2W9CA 4JV1A 1EP4B 3CM5A 1RT6B 2RKIA 1RAJA 1NKCA 2PZSA 2BANB 3H40A 4F3TA 3OVNA 4ZPAA 1S4FA 1N4LA 4DQQA 3FRZA 2FBYA 4OVLA 5F8MA 1YTAA 4DMNA 5KFUA 2FLLA 4HCBA 3P1GA 1RBRA 4CGDA 4FLYA 2BDPA 1L3VA 4WYLA 3DRRA 2A1RA 1C1AA 4G1QA 3H98A 3K5OA 1WSJA 3SUQA 4XO0A 3VA0A 3AO3A 4ZPDA 5KFWA 2FBVA 5KFXA 4FJMA 1JLQA 4KHMA 3QNOA 1HARA 2IJNA 3H5SA 5T14A 1BIZA 2B4JA 4ZPBA 4YR3A 1FKPA 4I7FB 4O3PA 3OY9A 4O0IA 2HB5A 3AVAA 2VG6A 4Q5VA 4PY5A 1T03B 4C8NA 2AWZA 3NGYA 3CFRA 4Q44A 1W9HA 4CEZA 3SI8A 2UVWA 3IS9A 3DLKB 4IQXA 1S1XB 1LW0A 3ITHB 5J2PA 3NDKA 3HVRA 1X9WA 2FJXA 2ZE2B 4K4SA 4E89A 4LQ9A 1REVA 4NCGA 4J9LA 4F4KA 4I2QA 4CJQA 3V9XA 4N41A 3ZCMA 5HRSA 5HP1B 4PWDA 4FJIA 4KHWA 2X6NA 5KGWA 4FLVA 4N76A 3L2WA 2VWJA 5J2NB 4NLRA 5KTQA 3IRXA 1KFSA 4CHNA 3JSMB 3QZ8A 4CGJA 4KHUA 5KG6A 3VQ7A 1RT2B 2QKKA 2XC9A 4LY7A 4OKJA 4J2BA 1QHTA 1BQNA 1RDBA 3IGNA 5KFEA 1TV6A 4ID5B 3K57A 2DFEA 1S1WB 2YKMB 3OJSA 2IM3A 2O5DA 3QIOA 3KKRA 3TI0A 3SV4A 2XI2A 4ZHRB 4DQPA 3MEGA 4MIAA 4IFVA 2UVVA 1CXQA 3KLFA 4DQIA 5C24A 5KFVA 2QK9A 5D3GB 4Q0BB 4J9QA 4CEFA 1JLBB 4CE9A 1SH2A 2BRLA 1D5AA 4C8OA 2KFZA 3C94A 4CFBA 3VQSA 3DLGA 5EUHA 5KFAA 3KK1A 4YQWA 2XCPA 4Z4GA 2DTUA 4CF8A 5KG4A 3TR8A 4B9VA 2XI3A 3NF8A 3K5LA 1C1CA 3MEDA 3N6NA 2X74A 1TKTA 4AHRA 1YVFA 3RBEA 5KFMA 3I8DA 3CJ3A 3O4NA 4O3QA 3KKSA 4CJWA 1TKZA 4BDPA 3SFUA 4DTMA 4W5NA 2XY5A 2ZKUA 4RNHA 1IKYB 3WNGA 3D0PA 2YKNB 2ALZA 4TYBA 3FFIB 1NK4A 2IM2A 5L1JA 2Z1HA 3PO4A 3ISNC 4DLGA 1ITGA 4Q8FA 1SV5B 4RW9A 4TQRA 1TVRB 3EPIA 2P1JA 1S1TB 1VRUA 1SKSA 1RTJB 3K2PA 2OPQB 4EYHB 3Q8QB 4CK1A 1HQUA 3V6HA 4GVMA 3NH2A 4DTPA 2B5JB 5JXSA 4BE2A 4EZ6A 1WSEA 3VQBA 3HO1A 1DTQB 4IRDA 2BE2A 4Y3CA 2W9CB 3KLEA 3DMJA 4I9LA 4NLPA 4QW9A 3RMCA 2D7SA 3V1QA 1RA6A 4Q8EA 3OYMA 5KG7A 5E41A 1NJWA 1NKEA 4O55A 5KG5A 3CFPA 5DG9A 4DSFA 3LP2B 2HHUA 3KHLA 3QINA 4CK3A 4WFYA 4F4YA 3GIJA 1KFDA 2G8IA 3M8SA 4NYNA 3BSOA 2HNZB 2Z1IA 1I39A 3RB4A 2P51A 4NYFA 2JGUA 2JEIA 4DTRA 2E6MA 3BGRA 2FVSA 3HHKA 4HYKA 1FKPB 5T7BA 2HHWA 1T3NA 4IRKA 1NOZA 3KLHB 2V4RA 1JLEB 1S1UB 2VG7B 2AJQA 2OA8A 5KT2A 5FRNA 3C6UA 2V0NA 2VWKA 2KTQA 3I0RB 3OYAA 2D0BA 3S3MA 4FJKA 2IJFA 1WAJA 1JKHB 4EP5A 4CJVA 4F50A 4M3WA 3LZJA 3WNHA 1ZBLA 1RTHA 1ZTTA 2YHBA 3ZSWA 4ELTA 1WAFA 4CFAA 5F9NA 4U7CA 3RB0A 4O4RA 1BCMA 1S97A 1T94A 1RBTA 1S1VB 3PX4A 2Y1JA 4EEYA 1FK9A 3S3NA 3FDSA 2YNFB 1LWCA 2J6SA 3V6KA 4MFBB 4FJNA 3JYTB 1S0NA 4DTJA 4RW4B 4DEZA 2KZMA 4B9NA 5EDWA 3E51A 1Z25A 1S6QA 1QAJA 3QEIA 5KG1A 4ED3A 2BQ3A 3V9UA 4RUAA 1HPZB 4Z4EA 2OZSA 3LWLA 4B9LA 1YTUA 3T5HA 2I5JA 5CYMB 3V6JA 3L2UA 2XWYA 1C6VA 2HAIA 2E9RX 4KKOB 4QWAA 3SQ2A 3OSPA 3MEGB 3ZT3A 3Q8SB 3PV8A 3NBPA 1SL1A 2UVUA 4E7IA 3N6LA 4K4ZA 2F96A 3H2LA 3NMAA 1UAXA 3PW0A 3KK2B 3PJXA 4E1MA 4O5BA 3ISND 3DLGB 5DLFA 4IG0A 1MU2A 2ILZA 1C2PA 2IAJA 5KRSA 2W7PA 3BDPA 4AHTA 1C1CB 3KLGB 1A5VA 5KT7A 2R7YA 4RUCA 3LP0B 1R0AB 2XO7A 2QKBA 3AVNA 1S9GB 4R5PB 4H4OB 3H08A 1TKDA 4LD0A 3F9KA 3ALYA 5KFLA 4J2DA 4KFBA 4CHPA 3VQAA 1JIHA 2WHOA 4IFYB 4HUGA 1UA1A 1VSKA 1XHZA 1J5OA 2FC0A 1N6QA 3MXIA 3IG1B 2BQRA 4TN2A 3KD1E 4FBTA 2HHSA 4IDKB 1S6PA 2AGPA 1BI4A 2QXFA 2EX3A 3U6FA 4LH5A 2C28A 3M8QA 4BE1A 3HVTB 4F2SA 2ASDA 2B6AB 4DL5A 3P83D 4AHCA 1QE1B 2BQUA 3OYJA 4Q45A 3QYYA 3MR2A 3TAQA 4I9QA 3UPFA 3AVGA 4FBUA 5FROA 1RT1A 2IC3A 3QGGA 5HRNA 4ZVGA 4B9SA 1X1PA 4TLRA 2XCAA 2HMIA 4N5SA 4NLGA 3L2VA 2JC1A 3V81B 3TAEA 3QEPA 2XY6A 3GILA 5K14B 1T8EA 2O4GA 4B8CA 1TKXA 3CM6A 2KFNA 1IKXA 4GW6A 4E0DA 4CEDA 2HNDA 5KG3A 5EWGA 3IN5A 2R8HA 4DSJA 4ECSA 2B43A 1IKWB 3HM9A 4WXOA 4DSEA 2VA3A 2OYQA 2Q3SA 4EO6A 4O44B 3K5MA 3E01A 1BCOA 4DQRA 1DLOB 1T05B 1K1QA 3DLHA 4DG1B 4CJPA 3U3GA 1Y97A 3KNAA 4Y2CA 1SL2A 4FK2A 5HBMA 3OL6A 2D3UA 5L1LA 1IKVB 3IAYA 1UWBA 4ECQA 3OLBA 4OKEA 3CQ8A 1SKWA 4KHNA 4M3YA 3T1AA 4CGIA 1IH7A 4CK2A 3VN5A 3D28A 2O4IA 3DI6B 3V9ZA 3QLHA 1WN7A 3LP3A 2FLNA 1KLMA 1TK5A 3DLBA 1SUQA 1B92A 3KK3B 5CZ1A 4PQUB 5KFGA 3CIZA 3VQ8A 1SL0A 1JLAB 5KT4A 2JEFA 4WZQA 1N5YB 1GX6A 3HK2A 1JLCB 4K4VA 2W42A 1JLFB 3AVLA 4LSLB 3B6OA 3LP1B 1S9EB 2D3ZA 2W9AA 4ED7A 1WSFA 2IS3A 1F21A 3DM2A 1C1BA 4O4GB 2XY8A 5SWMA 4RNOA 3DOLB 5I3UA 5KFIA 3H5XA 2R8IA 3KJVA 4J9RA 2XGQA 4H4MA 2OZMA 3MEEB 4URSA 1CZBA 1K1SA 3PW4A 3GV5B 3ZT1A 2KW4A 1B9FA 1JL1A 3CG7A 5KFHA 3RTVA 4HHTA 5C42A 4OPJA 1DTTA 3A2FA 3NHGA 4EP4A 1BISA 3RAQA 1QSSA 3MFHA 4ZVEA 5KT6A 1RT3B 3V6DA 4X2BA 4M3RA 1HRHA 1FKOA 5DMRA 4FJ8A 3AVFA 1QUVA 1HYVA 1BQMB 4ZMMA 2HHXA 1JXBA 3VQPA 3DRPB 5HLFA 3KHGA 3UQSA 4KRFA 3L2QA 3L8BA 3M9MB 1QAIA 1D9FA 2E6LA 5J1EB 1RDAA 2R2SA 1D9DA 2A1SA 4KI4A 1W0HA 3EPGA 3PJWA 5KI6A 1GOCA 1C0MA 2R2RA 3SV3A 5J2QB 1NJYA 1KLNA 1NK8A 4WYWA 1UOCA 5C25A 2DFHA 4CFCA 2G8UA 4IH7A 2ZD1A 4QWBA 1VSFA 4R8UA 2G8HA 5F8NA 3NKYA 3RB6A 4B9TA 4EBDA 1VRTB 3QESA 3SJJA 2IOCA 1XR5A 4KV8A 2E9ZA 1HMVB 1HYSA 1U04A 4ED8A 1TL1A 3AVCA 4NLTA 4CERA 2F8EX 3EYZA 2WONB 4HTUA 3HT3A 1KSPA 3BSNA 2AQ4A 3NGZA 4KHQA 5L1IA 3U3YA 1RT1B 5CYQA 5J2MA 3LALA 4DSIA 3ASMA 5KG2A 3AVMA 1RT7B 4O3OA 3IGVA 3ZSZA 3KMSA 4CEQA 1LAWA 4E7LA 4ID1A 4Y1CA 4Y1DA 4KREA 3D5MA 5HROA 5EU7A 4TYAA 2JC0A 4WE1B 2YNHA 1RTIB 1CXUA 2OPRA 3MECA 1S9FA 3NF6A 3OYNA 3GIIA 4N56A 1JLGB 4NYZA 3NF9A 1RTDB 1WNSA 1RT5B 3ZSRA 5KFCA 4FJ5A 1J9AA 3OJUA 3RRHA 4NLXA 2YNGA 5KFZA 4J9PA 5HBMB 4RNFA 2LSNA 1TL3A 3QO9A 1RT4B 4CHQA 4KO0A 1YVUA 4TY8A 4C8KA 4BWJA 4O0JA 1BHLA 4HKQA 3GV7B 2W9BB 4FJLA 1VSHA 3NAHA 2OPPA 4RW8A 3DRSB 3DLEB 3QLHB 3T3FA 1EETB 4RW7B 1K6YA 3RMAA 3C6TB 3FQLA 4B08A 5KT5A 3QEVA 1IG9A 3KLIB 1NHUA 2WOMB 2GBZA 1KLMB 2GUIA 2J6UA 3CJ2A 5HRPA 1Q9YA 3VQ4A 1WLJA 4GC6A 4I2PB 4LSNB 4IH6A 2HWIA 2RF2B 1VSJA 4E19A 1L3SA 4YNQA 1XI1A 4DU4A 5KFDA 1FXXA 4FW1A 4M42A 4Y34A 4KAIA 4YMEA 4KTQA 3G6YA 4DFJA 4R0EA 2RPIA 4EO8A 3VQ6A 3DYAA 4RZRA 4H8KA 4HUFA 2HHTA 1XHXA 3CJ0A 2OH2A 1QS4A 1KHVA 3DOKA 1NJZA 2RKIB 2FJWA 4DL4A 3AO2A 4M95A 4H4MB 1QSLA 2VG5A 2GV9A 3NCIA 3QIPA 1L5UA 1D0EA 3I0SA 3H4DA 3AA2A 2R2UA 3LWMA 4QCLA 3ZT0A 3T19A 3H5YA 1TAQA 3P5JA 4LH4A 4KTWA 3DRRB 1C0UA 5L1KA 4CGFA 3HL8A 4FJXA 4K8XA 4G1QB 4PUOA 3OYBA 2D5RA 3HVAA 3BQ1A 2PY5A 3ZSQA 2CKWA 4ZP6A 2XHBA 2HVHA 4NLQA 4NLSA 4JUZA 2FVPA 1JLQB 1NHVA 4NRUA 3VQ5A 1SKRA 3OYDA 4DTNA 2KQ2A 2YNIA 2EC0A 1ASVA 4NZ0A 3BREA 2F8SA 3ZSVA 4J9MA 2DPIA 2VG6B 4WZMA 3OYLA 1HNIA 4DL3A 5KFQA 4Z4HA 2G8VA 3V4IA 5KFJA 4QOZB 2JEGA 4WFXA 1VSMA 4F8RA 3IS9B 1LW0B 4FJHA 5DGAA 5J2PB 4TY9A 4NLWA 2HHQA 1RDRA 3KLVA 4R8UB 4RW6A 1A5XA 1Q9XA 3M8PA 4DTOA 1REVB 4NCGB 3K58A 2OPSA 4I2QB 4IG3A 3SCXA 4PWDB 4RU9A 4DU3A 5HRRA 3SPYA 1HYSB 4ED2A 1KHWA 1BIUA 4AHSA 3OSNA 1ZBIA 5KFSA 3IRXB 1LWEA 4NLOA 2C2EA 1TQLA 3MR5A 4DLEA 4YFUA 3PW2A 4JV2A 4DSKA 4ICLA 4OLBA 3V9SA 2ITGA 1J54A 5KFTA 3CO9A 4CJKA 3TAMA 2R8JA 1BQNB 2RN2A 4NCAA 5KGXA 2KZZA 1TV6B 4ELVA 2R8GA 2HHVA 4M41A 4IKAA 2UUWA 3G6XA 3HP9A 1ASUA 1LW2A 4CGHA 1LWFA 4J9NA 1HQEA 4CCHA 4IFVB 3KLFB 5DK5A 5C24B 1EP4A 1RT6A 3L2RA 4MKBA 2BANA 3RB3A 1NNDA 1YT3A 1I3AA 4FLWA 1CZ9A 3MFIA 4OGEA 2YNGB 2ETJA 5DQGA 3KK1B 4J9OA 4H54A 3AVBA 3OS1A 4BWMA 3MEDB 1TKTB 4RG8A 4CHOA 4JRPA 3RR8A 2P5OA 2F8TA 4O3SA 4B9UA 4NLUA 3NAIA 1TKZB 2GIQA 3QERA 1NKBA 1D8YA 2FJVA 5KFRA 5FDLA 1EX4A 2JEJA 4EBCA 4FJ9A 4I7FA 4KTZA 2G8FA 3CDUA 2WK4A 1C0TA 3L3UA 1T03A 2QE5A 3NGIA 1U47A 4Z4IA 3QNNA 4DSLA 1NK0A 4M45A 3G10A 4RW9B 4ED6A 3DLKA 5KFOA 3TVKA 1S1XA 3ITHA 2RDIA 4EZ9A 1XR6A 1VRUB 2ZE2A 4OPKA 4KB1A 3CYMA 3WNFA 3RAXA 3ZSOA 4DF8A 4TXSA 1HQUB 3PZPA 4EYIB 5F9LA 2Z1JA 3C95A 4QAGA 5HP1A 4M3UA 2DPJA 4CIFA 5KFBA 2IBKA 4DWIA 4JV0A 2BE2B 3KLEB 3DMJB 3RMDA 3HPHA 3QZ7A 4DL6A 3JSMA 2Y1IA 1QTMA 3NL0A 4ECRA 3H5UA 4ZVFA 3CDEA 1B9DA 4KE5A 2CJQA 4AHVA 2FVRA 1X9SA 2FVQA 3UR0A 5F8IA 4ID5A 2WCXA 1S1WA 3DLRA 3VQQA 2YKMA 2C22A 3NE6A 4CF1A 4HUEA 4ECXA 4ZHRA 5KFPA 2W8LA 2R8KA 3O3HA 3I5BA 3PX0A 3PUFA 3N6MA 4FJGA 2FBXA 3OS0A 5D3GA 4Q0BA 4IH5A 1LV5A 3BGRB 4M94A 4DU1A 1NK7A 3OLAA 1JLBA 1RBVA 4HCCA 1CLQA 2AGQA 3CVKA 4URQU 2GIRA 4DTSA 3HSTB 1KVAA 3C6UB 4FS1A 1OS5A 3SZ2A 3EZ5A 4DTUA 4ZVHA 3O3FA 4XPEA 1RTHB 4FJ7A 3HXMA 4JS4A 3WNEA 3BSAA 4IOBA 3BQ2A 4ZP8A 1IKYA 1W25A 2YKNA 2I1RA 4KPYA 3CJ4A 3FFIA 4QWCA 4FLTA 1FK9B 3LANA 1LWCB 1RYSA 4BACA 3SUNA 3G0ZA 1SV5A 1RILA 4JLHA 3QGIA 3NGDA 5JS1A 1S49A 1S1TA 1S6QB 2AX0A 4DQSA 2OPQA 4ECZA 4K8ZA 4ECTA 5KFFA 4CEBA 3OYKA 1N56A 4FZYA 2I5JB 2QV6A 2B5JA 3AO1A 1IO2A 4FZZA 2C2DA 5F8HA 1DTQA 4M3XA 4OJRA 1ZETA 3NFAA 3NF7A 3O4QA 3NBPB 3SYZA 4DS4A 4CJ5A 2ASLA 3MXMA 3TQ1A 4CIEA 4C8MA 4DFMA 1U45A 2IA6A 3ZT4A 3AVJA 4DFKA 4FCYA 4CJFA 1I6JA 4C8LA 5DGBA 1WSHA 4IG0B 1MU2B 1HNVA 3VA3A 2IAJB 3LP2A 4F4WA 3PW5A 3KD5E 3PX6A 5DQIA 4N47A 4MK9A 4CFDA 3LDSA 2E4LA 3GQCA 4ZP7A 3QETA 2HNZA 3M9NB 4IR1A 1XWLA 1NK9A 2P5GA 1TAUA 4NRTA 2YV0X 3TABA 3CDWA 1CSJA 4KFBB 1HYZA 5FDLB 4O3RA 4BE0A 4QWDA 4CF9A 4ECYA 1J5OB 3KLHA 3OYEA 4FXDA 1N6QB 1JLEA 4CJLA 1S1UA 2VG7A 5F8LA 2J6TA 4B9MA 3UDLA 2ATQA 1C0TB 3VQEA 4CJ3A 3I0RA 1S6PB 1BI4B 3AO4A 1JKHA 1VSDA 3M8QB 3TAGA 3NAEA 3QGHA 2WB4A 3MXJA 4Z4CA 3D45A 4CF0A 3T5KA 3RBDA 3HYFA 4B3OA 1S48A 4CGGA 3SI6A 3BSCA 3OYIA 2IC3B 3BR9A 1S1VA 5EWEA 2HNYA 2UUTA 2HMIB 1NOYA 4ED1A 4CHZA 2YNFA 2HVIA 4OL8A 4J9SA 4J2EA 1TKXB 4MFBA 4ZPCA 3JYTA 5L9XA 2NUBA 4RW4A 1IKXB 3OHBA 4HVJA 4CECA 2HNDB 2D0CA 4W5TA 3OYFA 5KT3A 5JS2A 2D0AA 5F8GA 3TAPA 2IDOA 3OYCA 3KOAA 3O3GA 4FM1A 4CIGA 1HPZA 2IGIA 3E01B 1EKEA 4ECUA 2ILYA 2Z1GA 4CF2A 2HW3A 4ECWA 5CYMA 2ZQBA 4FLUA 1WSGA 4KKOA 2X6SA 4URGA 4F3OA 4FM0A 3CWJA 1RDDA 4MQ3A 1UWBB 2GC8A 3F73A 1U48A 3KK2A 4DL2A 3QIDA 3V9WA 2E9TA 4IR9A 4DFPA 1TK0A 3AVHA 4YP3A 3OL8A 1ZBHA 4KB0A 4F4XA 1G15A 3KLGA 3MTKA 3PHEA 4WXWA 1SUQB 3LP0A 1R0AA 5SZTA 1S9GA 3LAKA 4MH8A 4R5PA 1RBSA 4H4OA 2R2TA 4FK4A 5I42A 4QW8A 3LAMA 2FBTA 1BGXT 3I5AA 3K59A 4MK7A 3SUPA 4IFYA 3QEWA 3IG1A 3LZIA 4E1NA 3HPOA 4M3TA 2XRIA 4F2RA 5KFNA 3FQKA 3Q8RB 2ASJA 3SUOA 3KHHA 4IDKA 3RR7A 3RWUA 4XIUA 1JXEA 4FW2A 3DM2B 1C1BB 3HVTA 2UVRA 2B6AA 3RRGA 2W8KA 1NK5A 1S0OA 3PW7A 4GMJB 5I3UB 4BDZA 1QE1A 3KJVB 3LPTA 3G86A 4U6PA 1XC9A 4OGCA 1RNHA 4FYDA 4EBEA 4TSXA 4WFZA 1RBUA 4CEOA 3PY8A 1S10A 4M3ZA 4FM2A 5C42B 3VQ9A 1DTTB 3V81A 2ATLA 5K14A 4CJEA 1D1UA 1LAVA 4K4YA 2JLEA 3V6DB 1Q8IA 3GIKA 1FKOB 1IKWA 1TGOA 3S3OA 1N48A 5HLFB 4J2AA 4O44A 3AVIA 4ECVA 4ZTJA 1DLOA 1T05A 3DDKA 1HNVB 4K4TA 4DG1A 4RNMA 4XPCA 3MAQA 4FS2A 1KTQA 3KTQA 4YR0A 4B8AB 3I5CA 4AHUA 1IKVA 2BRKA 3TWHA 5C25B 3ICLA 4KHYA 3FSIA 5DG7A 3OL9A 3HJFA 5EWFA 1S0MA 2ZD1B 3S9HA 3L3VA 3KMQA 3THVA 1QSYA 4FZXC 1TP7A 4QPXA 3DI6A 3MR3A 1VSEA 4NLVA 4KHRA 4PA1A 4O3NA 3TANA 4KV8B 3AO5A 5KFKA 2G8WA 1JL2A 4DF4A 3SFGA 2V9WA 3AA4A 4IRCA 1TL1B 3KK3A 4FVMA 3T5LA 4PQUA 4YR2A 3OYGA 4AH9A 1RYRA 4KSEB 2C2RA 1VSIA 4B3OB 2AGOA 2IM1A 4UQGA 4OLAA 3OL7A 5KG0A 1JLAA 4IKFA 5CYQB 4FK0A 5J2MB 1Z4UA 1J53A 3SQ4A 1N5YA 1BL3A 1JLCA 2HNYB 1JLFA 2IMWP 1WNEA 4LSLA 3SQ1A 3LP1A 3BJYA 1S9EA 4Z4FA
chains in the Genus database with same CATH superfamily
4KIAA 3SPZA 4DR7F 4Y28C 2KN4A 3K5NA 3V1RA 2XNRA 3T5JA 2KG1A 4LF7F 1A5WA 3A8JA 4CO2A 1VQMN 4HTIA 1VQON 1SJRA 1QZ5A 3EZUA 3OHAA 4NEZA 4OHYA 5H9EJ 1TL3B 2ZVIA 4KO0B 3MEKA 4TY8B 3M8RA 1S5JA 3AD9C 4FLXA 4WTOB 1QLNA 1N34F 1NCLA 4WTYA 3OYHA 5LMNF 2DGQA 4CLKA 2VA2A 1X4AA 3S7RA 1BQMA 1O1WA 3QATA 3CNQP 5GMEA 2AKWB 3PR4A 2YPZA 3QJLA 2Z2ZA 4FLZA 2NRVA 1YX2A 3ONQA 2CQ4A 2YX6A 4W5QA 4YB1P 3KZBA 5I42B 2RE1A 1TUGB 1L3UA 3VEZA 5JMVA 3NH0A 1ZYQA 2WAQD 2DFFA 4ENOA 3TJ8A 3LGHA 3NNAA 3CJ5A 4K50A 1QQCA 1NJXA 4WP8A 1VRTA 2MHEA 4YB5A 5AE2A 4BRKA 3OA9A 3IBFB 1HMVA 3BGFA 4NCBA 1WOSA 3TAFA 1NBWA 4G3IA 4EAHD 5J2NA 4NLYA 2D9PA 3OVAA 4CJ4A 1SI9A 3DU5A 1U49A 3GSDA 4PABA 3L95X 3GIMA 4F4AA 3EL2A 4JB8B 3EY1A 1FT8A 4YN3B 2W7OA 4D3HA 1BUXA 4JKCA 2HS3A 3GYNA 1UA0A 2GWJA 1HR0J 2V68A 4WE1A 4E7JA 3TZWA 4HWIA 2VPXB 2GWKA 4Q7AA 1HWIA 2JX2A 1Q82O 3AA3A 1H3DA 3U4LA 3U1MA 1MMLA 2BE7D 2QEXS 4EUVA 5HN0A 3KHRA 2O67A 1VK0A 5M1KA 1X60A 2FDNA 1VBZA 1XIQA 1JX4A 4JKGB 1RT4A 1Z26A 2RU3A 1DARA 1P8ZA 2AU0A 2XMMA 4HVZA 1ZPWX 1NLKL 4LRAA 3TJ9A 2VIHA 5LOQA 2G8KA 4ISEA 3OHRA 3DLEA 1U1NA 1EETA 2Q2RA 3DGVA 3PO5A 3C6TA 1R59O 3UKUA 1C4AA 3G4SN 4M5IA 2P9EA 2P9UB 2WOMA 1FJEB 2RJZA 4K4UA 3SLCA 3D1OA 2LQ5A 2IBOA 1LWEB 1N0VC 2HAFA 4CW7B 4MKAA 4W5OA 3PR5B 3W9JA 2RDJA 2RF2A 4GO5X 2DO4A 1RCOB 3UCGA 3K9KA 1DGKN 2PMZD 1N5SA 4L74A 5KFYA 5A2QO 4OYAA 1ATSA 5A8KB 1ASWA 4KT0C 4OQJA 2DNPA 3VQCA 2DY4A 2HS0A 3M2UB 2ZDPA 2GUPA 1SQKA 2A5XA 1GOBA 1P27B 5IV3A 1RT6B 1RAJA 3FJ2A 2BJEA 2AHOB 3VHQA 3W60A 3LA0A 2FBYA 4A4JA 5LSLA 2FLLA 2VHGA 1RBRA 4CGDA 4FLYA 3R1LA 4WYLA 4KPCA 2A1RA 5IWAJ 2W40A 5JMNA 3TSQA 1MMDA 3FZLA 1MDUB 1E6YB 4CO1A 4ZPDA 1FX2A 3THYB 3QNOA 1CULA 4KGKA 5T14A 4ZPBA 1FKPA 4I7FB 1YJNS 4JI7F 4ZLNA 4Q5VA 3OFFA 1T03B 1S6OA 3OPKA 3CFRA 2XMTA 3VEOA 4X62K 3TZXA 2X7IA 1LW0A 2Q6CA 5J2PA 3PIPQ 2KJVA 4FWSA 2ZE2B 1Q8LA 2UZAA 3VAKA 3TPQA 1EWQA 4E89A 2KO1A 1XEZA 3FNNA 2QN6B 4C0HA 4K0KK 1RADB 4F4KA 3HTVA 5HP1B 2BZ2A 2QA4S 2GTDA 2W2PP 4PHTX 5KGWA 4FLVA 3LDQA 2C1EB 4QU7A 1WEYA 1G1XA 3IRXA 2V2QA 2VPYB 1M1KT 2E1MC 2DNMA 4KHUA 3QJPA 3VQ7A 2Q0RA 2FZCB 2QKKA 1FD8A 2O8EA 4XTTA 1T9WA 3I4PA 4JI0F 4LY7A 3NGSA 4OKJA 3RUBL 5AQRA 2FJEB 2PN6A 5D0GA 1QHTA 1BQNA 2BJ1A 4JYAJ 3J7AP 1KBRA 5IT0A 1RDBA 4M8LA 4BR4A 2DR5A 4JI5J 2IM3A 3GFZA 4M7YA 4ZHRB 4HT7A 3RSEB 2RQKA 4IFVA 1WI8A 4JI6J 1RWOB 3AJ2A 5D3GB 1QVGR 4BRMA 4J9QA 4KH6A 3C94A 3VR1A 1BHNA 1Z2ZA 2E1CA 3P45B 2E5LK 1KQSR 3TR8A 1T9VA 3SSQA 2MSTA 2OD4A 3L4QA 2X74A 4AL5A 2CG8A 4B1ZA 4WCEL 2YQ0A 5AZIA 3HFVA 2XULA 2DNHA 2W2OP 3KKSA 4CM2A 1HLWA 3TVZA 3MMCB 3SCJE 3D7EO 1HD1A 4RNHA 3D0PA 1F9EB 4LBPA 1IR1A 1I5OB 4DLGA 1ITGA 4G6VB 3PRVA 4DV6K 2Q97A 4MMOA 1TVRB 4J91A 3EPIA 3SAGA 3R3TA 1RTJB 3UNYA 4CO5A 4CK1A 4LF2A 4H5NA 1HQUA 3A1YG 3V6HA 5ADXH 3NH2A 1P6TA 5H9FJ 5BYSA 1X4BA 2BE2A 2XMWA 4OJHA 3P39A 5AQLA 1YG0A 3C16B 2I2YA 2AV5A 4ES3A 3HSGA 1CJKA 2P9IB 3MXHP 2GHWA 3V1QA 1P9QC 4X4OA 2E2OA 3J7AN 3PFOA 1RWWB 5AE3A 2XB2D 1DKGD 1VQNN 1HHSA 4ZVQB 1KVIA 5DG9A 2YCHA 4FWOA 4DSFA 2FHKA 2FSJA 2HHUA 3ADAC 4CH1A 3KHLA 2NYIA 3QINA 3VF4A 3CMAN 4F4YA 1R89A 2C42A 4I1TA 1URNA 3OV7A 4FPBA 3RB4A 2P51A 2JGUA 2E6MA 4HYKA 1T3NA 3KLHB 1JLEB 2A0FB 5EHHA 1HR0F 3WUHA 1NGCA 1FCAA 3O5TB 3LM9A 2KTQA 2XSJA 1RHJB 5HVHA 1WAJA 3O8MA 4EP5A 3QT5A 4Y2MA 3LZJA 3THWA 2RMLA 2MHNA 2MY8A 3UE5A 3AQOA 1X4DA 3VF0B 1HFEL 3POTA 4O4RA 1BCMA 1S97A 1NJIO 2LEPA 2AJFE 2RDDA 2XM3A 3B4DA 3LDPA 3R5BA 3FE1A 4WFNL 1NBEB 5AFUH 3FDSA 2YNFB 2DITA 1LWCA 4XH5A 4QR1A 2O8FA 4DX7A 2KHOA 4ZLLA 1PSDA 1PJ6A 2DR8A 2E2NA 3OVSA 3QEIA 4ED3A 3B82A 2V5HG 4DUZJ 3MUVP 3V9UA 4AQYJ 2K3IA 5E3AA 2OZSA 1PIEA 3V6JA 5ETSA 4KKOB 2D9OA 4OO1J 2CQ1A 2XMVA 2BJ9A 3EN9A 3SQ2A 3OSPA 3MEGB 3ZT3A 2IIHA 2G1DA 3SBTA 4E7IA 1VLOA 3N6LA 3NMAA 2OO4A 3M1VB 2CQGA 3O9QA 3D54A 3PJXA 4BRLA 2E5GA 2RVJA 4ISGA 1ICEB 3C15B 4IG0A 1MU2A 4A8YA 1T11A 3KLGB 2R7YA 4RUCA 2XO7A 1K9MO 2GAGC 3G25A 2NXCA 4H4OB 2QFIA 2I9SA 1MW7A 3F9KA 4CLSA 2XLKA 4CHPA 4U67L 4DV2J 3CJ8A 2A2DA 4PEOA 2Z2LA 1VSKA 1XHZA 1WUAA 3MXIA 2BQRA 4G9ZA 3KD1E 1YHQS 2DGOA 2FJBB 7FD1A 4FBTA 1AZSB 1XQIA 2AGPA 2EX3A 2C28A 4F2SA 4FNHA 3P83D 4QBUA 2VV5A 5CHCB 4JKBA 2BQUA 3OYJA 3QYYA 5JJBA 4I9QA 3MZIA 3IR6B 3QGGA 2JWLA 4ZVGA 3DXMB 2JJ4D 3P31A 5ETRA 1R3NA 1FNMA 4NLGA 2F40A 4WU3A 2RQMA 2P9SA 3V81B 1T8EA 2O4GA 3GYGA 3T6BA 4QS9A 4E0DA 5FLXO 4CEDA 2R8HA 2B43A 3SQOP 4WXOA 4BY9C 2QL5B 3GIRA 4XH4A 1FJGK 4OJ1A 2VQEJ 4O44B 3K5MA 1BCOA 2GX9A 1K1QA 2FSNA 4JN4A 3M5RA 1C4CA 3FCHA 1OY8A 1RBOB 4CJPA 4YB6A 4F3MA 1Y97A 2I38A 2YH1A 3HHLD 5RUBA 4X4VA 1RP5A 3QBXA 2KT2A 4Y00A 3ENVA 4OKEA 3CQ8A 4QIGA 3T7ZA 2EFGA 3BKUA 4JI2K 2OEJA 2LQ8A 4JYAF 3VN5A 2E5IA 2O4IA 1TYQB 4GNIA 5AQPA 2XG8A 3CPWM 3CERA 3OFGA 4PXCA 2FLNA 3DLBA 4C11A 1U8WA 1O51A 3KK3B 4NWBA 5CZ1A 3EXCX 2CNOB 4JI6F 1YLXA 5KFGA 2QTDA 4YOXA 2NSBA 2ZH8A 1GLBG 1SL0A 1JLAB 4MLHA 2CJAA 1VQPS 1OH8A 2DXEA 2W42A 4LSLB 2D3ZA 1FVQA 5CA5A 1WSFA 5B0GA 2IS3A 3F41A 2P2CB 4O4GB 2XY8A 2DGWA 1NEEA 3CJQA 3L09A 2EFOA 3DOLB 2R8IA 3CJKB 3KJVA 5E0OA 1WKJA 2QG9B 4J9RA 2XGQA 2BJ8A 1QUPA 4M5LA 3UDCA 3GV5B 1YZ7A 3ZT1A 3ZTRA 3IWLA 1B9FA 3T9ZA 3A2FA 4LREA 3M30B 4DR3K 4PXBA 1QSSA 4LF6J 1JQGA 4ZVEA 1KQGB 4X2BA 1YF5L 2E1YA 4M3RA 1FKOA 2U1AA 1Z2LA 2C2KB 1B3TA 3AVFA 3GLJA 2CG4A 1HYVA 3K0SA 3CI5A 2ZM6K 1VQYA 3H45C 3UQSA 3L8BA 5CCLA 1QAIA 1D9FA 4KC5A 4L3QA 5F1XA 4GVEA 2GW8A 4KI4A 3PJWA 5GMKa 2CA9A 1C0MA 3SV3A 2UUAK 1N32J 2P9PA 4CFCA 3FCWA 2DFHA 4IH7A 3ZTPA 2ZD1A 2NZ4A 4TNOA 2LU1A 1DZ5A 3IO1A 2MQPA 4A2BA 4B9TA 2C3OA 4EBDA 4YOUA 2KL8A 2JZ5A 1VQ5S 4CLLA 2OUGA 1SCJB 3TRGA 1GXTA 2PBDA 3R1XA 3X3UA 3LL3A 4J9VA 4ED8A 3KUEA 2D74B 3EYZA 4JBCA 2YXLA 3VAJA 1U1RA 1VQ6S 5E26A 3S41A 3JTOA 3GFYA 2A3JA 4JD2A 3U3YA 2H54B 2BEFA 3F5TA 1M0SA 3LALA 4JK8A 3H6EA 4DX6A 1CS4B 4DSIA 5L8RC 3ZLJA 1RT7B 1YDLA 3ZSZA 2QIFA 5HI7A 4Y1CA 3H7HB 4HL9A 3D5MA 1UZDA 2JDJA 4I6AA 5HROA 4HHUA 3KHYA 2YNHA 2DY9A 5GAGP 4ALZA 3MECA 4ZCMA 4IEEA 1JLGB 4EU0A 1U02A 2WSEC 1K8AO 3NF9A 3LQVA 4OI6A 1WNSA 5KFCA 4ZPTR 4QOTA 5ETLA 5LJ5Y 4NLXA 5KFZA 4H5RA 4RNFA 2EBEA 5M1QA 3QO9A 1FXDA 5LMUK 1TUYA 2ZJQQ 4C8KA 4BWJA 1BHLA 2W9BB 2EG2A 3AGKA 4AQYF 1F0XA 2K06A 4LF8F 1AB8A 5AE1A 5GIPA 4RW7B 3CJ1A 1T0TV 4B08A 1IG9A 1KLMB 1U6FA 3ZX2A 2J6UA 5HRPA 4HT5A 3VQ4A 4LSNB 3TEGA 1WB9A 2HWIA 4YHHJ 2OI2A 5THWA 1SBRA 2XMAA 4DU4A 1KDNA 4B3TJ 4KTQA 1SIWB 2WFBA 4QJVA 5A76A 4PL8A 3HM8A 4EO8A 1BUPA 2NRWA 1XMBA 4H8KA 1IBMK 4MKYA 2M70A 4HUFA 3Q22A 2MQOA 1HQ2A 1D8ZA 2GJ2A 3OTOK 1KHVA 1WC1A 3IBCB 5C0YA 3MMAB 2KHCA 4DL4A 5LJ3Y 3CCZA 4DV2F 3MD3A 2JLFA 2QTWA 4M95A 4H4MB 3FSXA 2AT1B 3N01A 2HK3A 3VAMA 4M5DA 3QIPA 1L5UA 3BEGB 4HR2A 3R97A 3LF0A 2HIYA 3M4XA 5T7LA 3A5MC 3WXMB 5L1KA 4FYYB 4FJXA 2FB0A 4USWA 2XS5A 2RE2A 3HVAA 2XHBA 4JK7A 4NLQA 1NB7A 1NHVA 4NRUA 1TUUA 4DTNA 4U7BA 2F8SA 4RTFD 3I9ZA 3L0QA 5GAHI 5IT9O 1OH6A 2ERRA 3WEEB 4WZMA 4F0MA 4AM7A 2KKHA 4Z4HA 4PKHA 3ZO7A 3HSJA 4WFXA 3LGNA 3DOMA 2R7TA 1QD1A 1XNQJ 4RW6A 3SBMA 3M8PA 2VQEF 3BY5A 4DTOA 2CGKA 1JNZB 3PDNA 2MYFA 2HZAA 3P3DA 1REVB 3MWBA 1CLFA 4DZ6A 4ANDA 1V3RA 5HRRA 2CDQA 3SPYA 2M8HA 5ETVA 1U1LA 1BIUA 2GQQA 4OX9F 1OYEA 2KU7A 5A8WB 3UD3P 3TX8A 3MR5A 4QIWD 4DR5K 4OLBA 1KQFB 5B0FA 3TAMA 3CCVS 3KKFA 4OHVA 1M1HA 2W2MP 1X4HA 5KGXA 3CJBA 2NNWA 1U2RA 3ZZOA 2HHVA 4M41A 2C3UA 1LW2A 1K73O 2DEJA 2OTLN 4Z7YA 2UUCK 4ZCIA 5DK5A 4CT8A 1D4XA 4A46A 2E44A 2RRAA 3T1YK 5HMXA 3W2VA 4JI4K 3RB3A 1GT8A 1NNDA 4LR9A 3C2PA 3IAM9 3UW1A 3H0PA 4CLUA 2ETJA 2IRUA 2AP1A 4H54A 2ROPA 4FPIA 1IM6A 1CPZA 3WXIA 4KH1B 3NRBA 4P10A 2RAQA 2QLJB 2HBKA 2YX4A 1WC0A 4RL1A 2F8TA 1HNXJ 4B9UA 4NLUA 2BJ7A 2FJVA 2QWLA 1ZXOA 3W62A 2JEJA 4NX9A 3W61A 4EIAA 1SVDA 3M1FA 4ANCA 4CJ7A 3MI7X 4LF6F 4Z4IA 3CGIA 4RW9B 3GJQB 4O5FA 5KFOA 1S1XA 1VIOA 1U26A 4CYUB 1XR6A 1RU2A 3E1YA 3HZGA 3RAXA 2EI5A 3PZPA 2J7KA 1HNZJ 4QAGA 4LBIA 2R3VA 1PJ7A 1YBTA 1Y4ZB 5KFBA 1Y3KA 2E5JA 4DWIA 4LBHA 1N32F 3RMDA 3HPHA 3QZ7A 3JSMA 5ETPA 3OR2B 3MPDA 2JVOA 3NL0A 4ECRA 2KXHA 2DISA 1NG9A 1ZM4A 2DHGA 2ZBPA 3EXYA 2NQPA 4AHVA 2FVQA 3UR0A 1GTHA 1C0FA 1S1WA 4DCJB 2YKMA 4BRGA 4X64F 2C22A 3NE6A 5KAKA 4CF1A 1VQ8S 3M32A 1U2CA 1KC8T 4HUEA 3GPAA 3TUZC 1EO1A 1R6YA 3C7NA 1ZZNA 5BRFA 4Q0BA 4IH5A 1LV5A 4M94A 4DU1A 3ETMA 3EDQB 3G2XA 2GIRA 2V63A 2E88A 5D77A 2KT5A 2P9NB 2DEIA 3RBXA 4FF4A 3M6XA 3MPVA 2VPWB 3VEWA 3R7BB 4XPEA 1RTHB 5GAHU 1RBAA 4FJ7A 1FF2A 1UW9A 3HXMA 4LUBA 2NS1B 4WK3A 1A9NB 3D66A 1TL7A 1JXVA 2BX6A 1IKYA 2YKNA 2NRRA 2RRBA 3CJ4A 3FFIA 4QWCA 4FLTA 4AFFA 5B0DA 1FK9B 2GIFA 1FW6A 5GAEI 4Y0FA 3LANA 2PEBA 3BZCA 2DO0A 2ZJPL 2F8HA 4JI5K 4H4KC 2EK6A 3VTIA 4NA2A 1S49A 1S1TA 5D0HA 1BU6O 1YITN 4CP5A 5KFFA 1X4EA 3UN5A 2F65A 3JXUA 1N56A 4MYTA 2H1YA 4GKJF 2I5JB 4B17A 3VAFA 5J1PA 1L3KA 4OJRA 1ZETA 3CJCA 5MLCV 4YHHF 1OH5A 4LF5J 5ETKA 4DKWA 3MXMA 2PFDA 4C8MA 3Q8VA 4B3TF 1SC1B 3VTHA 2M9KA 4DFKA 4CJFA 1WSHA 1VS3A 4XAKA 1RHKB 1K8KA 2MJNA 3WXKA 1E6VB 1NGJA 2OSQA 4MO5A 1QQNA 4N47A 2V94A 1FDDA 3TO8A 2FXUA 3O08A 2L41A 4DR1K 1TAUA 4X4PA 1U1PA 4KFBB 1N36J 1CQMA 4BE0A 3A5OC 4CF9A 1J5OB 3OYEA 2CPXA 1N6QB 3RU0A 4DR4J 4B9MA 3ZETB 3VQEA 2ROGA 3I0RA 3OBIA 2N3OA 3TUJC 4CH0S 3AO4A 1VSDA 3M8QB 4YY3J 4JNEA 2WB4A 3NOCA 3D45A 3T5KA 2ZZMA 3HYFA 4CZGA 3AHPA 1WC5A 3OYIA 2IYGA 2GEMA 4JKHA 5ETMA 1FX4A 2HMIB 2DH8A 3HSZA 1VQKS 4CHZA 3EM1A 2HVIA 1LNQA 5GIOA 1K44A 2W24A 3A13A 2FZKB 4MFBA 2HBMA 4ZPCA 1XNQF 4RW4A 2ZGYA 3OHBA 3L4BC 2RIJA 4W5TA 5JS2A 3TSPA 3AY9A 1XMOJ 3O3GA 4CIGA 1HPZA 2AYGA 4LR7A 5AJ3K 3MM5B 4ECWA 2UU9K 4WP3A 2AEJA 4FLUA 1WSGA 1AA1B 1R6VA 2HF4A 3HOSA 3MMJA 4RO0A 3MX5A 3CWJA 3VGSA 1N33J 1RDDA 4P7VA 1IG8A 4FWKA 3AXMA 3RJMB 1U48A 3KK2A 3H1QA 4DL2A 2J7WA 1H6KX 2BM0A 4I0WA 4F04B 2UXDK 2YPYA 1LXJA 4NYPA 2EKYA 3QQCD 1ZBHA 4KB0A 4DPOA 4JI1J 3VOVA 3MTKA 2JHEA 1AW0A 4WXWA 4DN0A 2LQBA 5CE3A 3LP0A 1R0AA 5SZTA 1S9GA 4R5PA 5I42A 4PKDB 4QW8A 3VAGA 4U7UK 4O0NA 2FLOA 3I6PA 1NGAA 3VGVA 4WQ5A 4IO1A 4HTLA 4WYBA 4DUZK 2HFOA 5IS2A 2ASJA 4U96A 3KHHA 1JXEA 4FW2A 1PC5A 1RWUA 1HNXF 3HVTA 1WSRA 5HQMA 5KPRA 4QYZJ 2PGCA 4KY3A 3E2EA 3GWCA 5AXLA 1J27A 5GAEU 3HRGA 1YBUA 1KWMA 3PIOL 3EMTA 3G86A 1SJ1A 5HMZA 1WG1A 4RLEA 4C0BA 4U6PA 1HKBA 2XO6A 4FYDA 1FA0A 1IR2A 1XERA 1SIZA 3PY8A 1S10A 2UXBK 2ATLA 1WKKA 1FNXH 4CJEA 1D1UA 4OV1A 5TKYA 2MXYA 3NG8A 1GH8A 4K4YA 4W92B 1KOOA 3W5XA 3GIKA 4MAKA 3R6MA 3BF3A 1GMWD 4B1WB 1KONA 4PG8A 4OYMA 4B02A 2MLZA 4LF1A 1N48A 1HNZF 3S3OA 3A8KA 3DAWA 3A8EA 2V4JA 4ZTJA 4DV7K 2AEFA 5AQZA 3D9BA 2MKYA 2LXFA 4FS2A 2FY1A 1KTQA 2C2ZB 4QPTA 1W7WA 2CQ2A 4AF1A 5C25B 4DPUA 3OL9A 1Q82T 1WC6A 1FVSA 1YSJA 3KMQA 3P4UB 1QSYA 4FZXC 3DI6A 1S99A 3MR3A 1RHQB 4X4UA 3TANA 4CLWA 1V3ZA 1X5TA 3OTBA 4LF4J 4FYWB 3AA4A 4IRCA 2V2VA 2J0XA 3IKMA 2V34A 1QY7A 4PQUA 4YR2A 3OYGA 1F5AA 4AH9A 3WDOA 1IJFB 2HGLA 1RYRA 4NLCA 2C2RA 4OLAA 1VLYA 4B3SJ 3OL7A 5EX3A 2ZDOA 4LRDA 3BPDA 1J53A 4DV4J 4C3KA 4C97A 2FC8A 1WNEA 2IMWP 5E3CA 1FJ7A 3SQ1A 3BB5A 3LP1A 3BJYA 3QFWA 1IXKA 1ACMB 1XBWA 4Z4FA 3G96A 3R2DJ 3ULDA 4L8RB 2WRMA 3E66A 3GTYX 1JJCB 1HI0P 3GE9A 1U24A 4EHUA 1LKZA 3V1OA 2PSZA 2M0GB 5F0UA 5E3PA 1M5PC 2AX1A 3HX9A 3MEEA 4OMFG 3CFOA 3PVXA 5E2QA 3L6QA 3FSYA 1T7PA 1IBLK 4MK8A 2H4WB 4J5OA 1TELA 1YXQA 3FRYA 4GVLA 4X66J 2KJWA 4LFCJ 1MSWD 2L3MA 3BZQA 4F4ZA 4LQ3A 1U0HB 3UFCX 2JFDA 4ZA1A 4Y0WA 2FF3B 5AR0A 3IR7B 1RWXB 1YJNN 3GMGA 4DXLA 2F4VK 5C5JA 4DV0J 4BDYA 4I6MA 2ZZNA 2ROEA 1RAAB 5J1EA 2QWNA 2DR6A 5BR8K 5DQHA 1YRTA 3SNNA 4Y2AA 4LF5F 4ZDNA 4IZ9A 2BR0A 2G1HA 4USKA 5EGYA 1S12A 4IOAL 2QA4N 3Q89A 5C2FA 1S4EA 1U09A 4CEEA 3MM6A 3SQGA 3M2RB 4CZLA 3ET6B 2WW8A 4B3MJ 1JJ2R 2LDYA 1X3NA 2WONA 1LOUA 2B4PA 3QEXA 2W6KA 3MN7A 2ACYA 1X4CA 4DR4F 4TU8A 2IRXA 3I0SB 3TUPA 3UR3C 4L76A 1R7IA 4KAZA 4A8SA 4FF2A 1FRJA 4BR9A 5G4DA 4CJSA 1FI4A 2IM0A 2OKQA 4DS5A 4OI0A 2ZHBA 4F36A 2OELA 4Y65A 2PE8A 2NXJA 3J7YI 4K5RA 3GE1A 4MYUA 1J2VA 2YNIB 1UMJA 1RTDA 2YHAA 4IBNA 3J81U 4CJTA 5KRTA 3M9OB 3D2EB 3OTDA 4CEAA 1HNIB 4FWPA 3V4IB 1FD2A 3AD8C 2LDIA 3CJTA 5F0WA 4H0PA 1MWMA 4H0TB 1XMOF 1GOAA 1WTFA 4I56A 2GCFA 2LEAA 2OPSB 4MJKA 4JOUA 4IG3B 2MKSA 1UCNA 2MQMA 3KLIA 2P9KA 1I1GA 2KFYA 2E1RA 1N33F 2DNYA 4ED0A 2M52A 3JSYA 2KLAA 1QAXA 2G2ZA 3SXLA 1S72S 3NNCA 2PO4A 2BJ3A 3BP8A 1TVRA 1KCFA 4Z0UA 3J7ZO 1IUJA 1RTJA 5IC6B 3H4BA 3PIPL 3HKZD 4OYXA 4JI1F 4LIWA 4ELUA 1T3OA 4WFAQ 4DCPB 4KB7A 4USVA 4AXJA 2MB0B 3MF5A 4BC4A 3B78A 1NLVA 2B9YA 3C16A 2WSCC 1NKCA 3D6RA 1U1MA 2J9DA 2BANB 4ZPAA 3OBWA 3IP0A 4BG8A 3WBZA 3CCSS 1N4LA 4DQQA 3EKUA 1K47A 5G0RB 2J8AA 4BRDA 3DRRA 2UUBK 3H98A 1MA9B 1WSJA 3SUQA 4ANEA 2MKKA 3F0NA 4KHPJ 3AO3A 5KFXA 1YJWS 5TKWA 3GFHA 2DT9A 4FJMA 3TW0A 4JI3K 3MCNA 4OI4A 5KQDA 3FBEA 2KHDA 1HARA 4FXVA 3H5SA 3R8EA 4YR3A 2MQLA 3MPUB 3WQPA 3EGVA 3AVAA 1M5HA 2VG6A 4DR2K 4C8NA 3DXKA 1BY9A 2E2PA 2UVWA 3IS9A 3DLKB 4IQXA 5KQ8A 1X9WA 2FJXA 3HSDA 4K4SA 1J5EK 4LQ9A 4NCGA 2EWHA 3IC1A 4J9LA 4U8VA 1Z05A 4CJQA 1Q7LB 1Q53A 2BUPA 4IOXA 3CXCR 4KHWA 3THXB 3AXKA 1U7LA 2OANA 1VQ9N 5GINA 3L2WA 2QWRA 2Y3YA 3HZ6A 5KTQA 1LXNA 3HHLA 4DQ8A 3SJHA 3MX2A 3QZ8A 3MN9A 4CGJA 1ELOA 2DHAA 1BWEA 4CM0A 1NJIT 3CD7A 2HLUA 2XC9A 2L9DA 2ADBA 4P72A 2A6OA 2NUUG 4A8WA 3IGNA 4LF4F 2H51B 4ID5B 3FCVA 4IFEA 1IJEB 1Q95G 3BPSP 2MZTA 4G1PA 3QIOA 4DQPA 4BR0A 4HTJA 3NNHA 3MEGA 3KLFA 2DNQA 2LKZA 4B3SF 3SDEA 1KQSM 4AT1B 4RWTA 4FOEA 2PFUA 4DV4F 4CEFA 5EX0A 3Q7BA 4CE9A 3RYLA 3GU0A 1XC3A 2V50A 3VQSA 3KK1A 4YQWA 4GKKK 2DTUA 1YI2S 4B9VA 3J7YU 3K5LA 3N6NA 1TKTA 2D1KA 3RBEA 2CJ9A 4ITSA 3EJMA 1AROP 4BDPA 3SFUA 4DTMA 3CD6S 3MCSA 3HOTA 2XY5A 1YHQN 5DM7L 4B1UB 1Y5IB 3I55S 2E2QA 2ALZA 2P9LB 2IM2A 5L1JA 1K9MT 2CJKA 2Z1HA 4X66F 1G4CA 5HVGA 1FHTA 5HSPA 4V19X 4LFCF 4U95A 4Q8FA 3ZZ0A 1SV5B 1ZA2B 1W2BR 4TQRA 2JVRA 2ZWHA 3CPEA 2P1JA 1SKSA 1UZHA 3K2PA 2OPQB 4EYHB 3OR1B 4DV0F 1KAYA 2HK2A 2KVQE 4X62J 2IMOA 2NZCA 4MTPA 4M5MA 2RNEA 3VQBA 1DTQB 2O8CA 2FTRA 2W9CB 2B9XA 4Z94A 2GFFA 4DV3K 4K0KJ 4K42A 3QRRA 2PAVA 3T1HK 1WUUA 1WKLA 3EWGA 2HVZA 1RA6A 2BA9A 3OYMA 3FMWA 4EGLA 5KG7A 1EJ7L 3W2WA 5HQLA 1VC0A 4B3MF 5LL6d 2KRBA 3UN2A 2DGXA 4A62A 1NGBA 4PR6A 3IM8A 1WOPA 1I94K 4K5SA 1U1OA 2AIRB 1I39A 3H3NO 4QR2A 4BVPA 4DTRA 2FVSA 3HHKA 2CQ3A 4KJIA 4IRKA 5GAHP 2W6LA 1S1UB 2AJQA 2VFVA 2OA8A 4K2JA 5KT2A 3C6UA 1CC7A 2W25A 2V0NA 3CC7S 2VWKA 3OYAA 1U6BA 2IJFA 3OXGA 2EPIA 5IQQA 4IOCL 2YI1A 4F50A 2MQNA 4UOCA 1Z6RA 2NXNA 1VQPN 2JL9A 1YJ7A 2E5LJ 4WBFA 2OIHA 4CFAA 3LDLA 4BLGA 2CZ9A 2ZJRL 3MAHA 3MM9B 2VBXA 4DUYF 3M2VA 3PX4A 2XTJP 4EEYA 5FPMA 4DI6A 1RDUA 3BZKA 4FJNA 1S0NA 4ATNA 3G82B 4FNIA 3PYEA 1REGX 4DJBA 4GV3A 3E51A 5KG1A 2BQ3A 4I64A 3PKMA 4RUAA 2F7VA 2DNNA 2NPIA 1RWVB 3RG6A 3CCJS 1YTUA 5CYMB 4DV6J 2PMHA 1HW9A 4CTAA 3W3DA 2ZH6A 4A48A 4MIWA 4PZVA 3G6EN 3UCZP 1CJVB 1JCEA 3PW0A 4FVUA 2XLIA 3K2YA 8AT1B 3GJRB 1NPPA 3R9LA 2CGLA 3ISND 1V3SA 4MO4A 1ZBTA 3BDPA 1C1CB 1A5VA 5KT7A 1B0VA 4FVCA 2GVDB 4HDHA 2IVFB 2QKBA 1N88A 3FR0A 2HHPA 2K3KA 5K5MA 1JCFA 5B09A 2YJFA 3O4WA 1VYAA 4RWWA 4J2DA 3P8BB 1VQ5N 1YAGA 1UA1A 2XBPA 3PLAA 3A3PB 5BPMA 4WJBA 2HHSA 1S6PA 3PTWA 1VQ6N 1BI4A 2QGFB 3BYPA 2B6AB 3D1QA 1I3OB 3CCWA 2X1AA 1EIYB 2XS2A 2F3JA 4DN9A 3P5BP 5FROA 2IC3A 1HI8A 1KAZA 3NS7B 3C19A 3F2KA 4B9SA 1D09B 2A41A 1T9XA 2PI4A 4N5SA 3D67A 2Y8WA 1CJTB 2F1FA 3TAEA 9ATCB 5K14B 2QWPA 3HFKA 1IKXA 3DLJA 2ZWPA 2HNDA 5KG3A 2CADA 3PJ9A 3HM9A 2M5YA 2A6AA 3WHIA 4CT9A 2OYQA 2Q3SA 2J4RA 4DQRA 1WORA 1DLOB 1N36K 4DG1B 2LA6A 2ASPA 3UCUP 1RQ0A 3U3GA 4Y2CA 1EQ0A 5KOWA 2D3UA 3C14B 3N4WA 4QQBA 3CQXA 1K8AT 3JSBA 3CC2S 5AQUA 4YY3K 2QL7B 1U8SA 3BDEA 4O23A 1Q81O 4FDFA 1NGGA 1B7FA 2DNKA 1NH7A 1KLMA 2I6WA 1SUQA 5H1SV 4DV5F 4EHTA 1O5JA 3H20A 3O6QA 3J81Y 2YKQA 2ZWOA 4B1YB 3VQ8A 2YJEA 3VGUA 5KT4A 1X9JA 2JEFA 1N5YB 3HK2A 4YDUC 1JLCB 2GNKA 4K4VA 1JLFB 1Y3JA 5GAEP 3W5YA 1S9EB 1SQGA 1SJQA 4CLZA 2W9AA 1YIJS 3DM2A 1C1BA 4RNOA 1WF1A 1UEVA 1DEJA 2C3PA 5AQYA 3H42A 4H4MA 2OZMA 1XN9A 1WBDA 2KT3A 3IMXA 3PW4A 3AFGA 4GVBA 4W98A 1VGYA 2IA0A 3VETA 2JLGA 4HHTA 1H73A 4A61A 2GMHA 3QBCA 1AXQA 5JVGL 3HBTA 2V8HA 3ZTSA 4A8KA 3V6DA 3AJDA 1HRHA 3VZIA 2Q1NA 5LXYA 1BQMB 2HHXA 4ZMMA 4X62F 4ED5A 1JXBA 5HLFA 2P6TA 5D78A 3M9MB 1UJ5A 2EEYA 2E6LA 1CEZA 4Z37A 2JWKA 1D9DA 1U0SA 1W0HA 1KTVA 2YVSA 4K0KF 4USHA 1GOCA 3VCDA 1FJGJ 2R2RA 1NJYA 4B3RK 1UOCA 2ZJQL 3VQTA 4LFBK 1KN6A 4QYZK 1ITPA 5F3ZA 2WBMA 1PC4A 4MLEA 1JNRB 1VRTB 2AEMA 3SJJA 1XR5A 4KV8A 4NXMK 3KWMA 3TOQA 2E9ZA 1HMVB 3V5RA 3D7SB 1HBUB 1TL1A 2DNZA 4CERA 3MDQA 4JI2J 4HTUA 2VBZA 1KSPA 4J37A 4OFZA 3MMBA 4KHQA 1U2VB 3WQUA 1RT1B 3CCVN 5CYQA 1RKJA 1VCTA 1VHFA 5KG2A 3AVMA 4O3OA 3ZZPA 2XHCA 1RAIB 1H2UX 4KREA 5HOOA 5EU7A 4TYAA 2VYPA 3OXFA 5CD4A 4WE1B 2YBVA 5KPTA 1HI1A 3MM8A 4OI3A 2E5LF 2OPRA 1S9FA 3NF6A 2JNJA 4NYZA 1RWNB 3IWXA 2MPUA 3ZEUA 1HPMA 4H03B 2IVMA 1Y9OA 3ZSRA 2GJIA 4FJ5A 1NGDA 1J9AA 3OJUA 5L46A 3SAFA 1W2IA 3RRHA 4J9PA 5C2DA 5HBMB 2QA1A 2OCEA 2LP4A 4A5BA 1RT4B 4CHQA 1VISA 4O0JA 1LFWA 2HMPA 3CJSA 4OI2A 2OPPA 4RW8A 5LL6Z 1FTRA 2FUG9 4ETZA 3DLEB 2DNOA 1EETB 4DV6F 3C6TB 3UKUB 4DR3J 4KBOA 5KT5A 1TUWA 1NHUA 2WOMB 4DPXA 1BC6A 5C2GA 2WVCA 2YQ3A 3CJ2A 3ILLA 3ZC4A 4GC6A 1Y10A 5IZHA 3G4SS 3OXLA 1RISA 4BVOA 2ZM6J 1VHIA 3MK6A 5E33A 4E1JA 2RF2B 1TMMA 2HQCA 5E3RA 4E19A 1XI1A 4IXCA 5KFDA 4M42A 4FZVA 1V4SA 4KAIA 4ILRA 3VENA 4DFJA 4FL9A 4NZ7A 3GG4A 3F56A 1OKJA 2UUAJ 3DYAA 4QS7A 2CPFA 4RZRA 4B1VA 4FF3A 1DQ8A 3N5BA 3CTRA 4IQMA 2P9GA 1XHXA 1EARA 1T02A 2YTCA 4BGBA 3HD1A 2MGZB 2O8DA 3DOKA 1TZ0A 2CPDA 3GSIA 3PHTA 2LCWA 5JICA 2ZNZA 2VG5A 3TZZA 4PWWA 1SAZA 1D0EA 1GK8A 5BYRA 3ZT0A 4M5JA 2A10A 3S6EA 1TAQA 3H5YA 2MMYA 4WIIA 4KTWA 1C0UA 4CGFA 3HL8A 4K8XA 4PUOA 4IWVA 1RHRB 2D5RA 5FIIA 3BQ1A 5K8MA 3GCXP 2VBYA 2F9DA 2G2OA 5IOLA 4NLSA 4PYAA 2V9KA 1SKRA 3VQ5A 1CULB 4P75A 1ASVA 1UL3A 2ZBQA 2E5HA 2CWKA 4FWRA 1E3MA 2H5EA 5KFJA 3HHNB 4OHZA 3VVUA 3H3OB 1VSMA 1OH7A 4F8RA 2HURA 4CO4A 1LW0B 4FJHA 4PQAA 5DGAA 5J2PB 4Y2IA 4NLWA 1RDRA 5IT9Y 3W9HA 4R8UB 3KWIA 1Q9XA 4NMXA 5D15A 5AFUA 5LMUJ 3BS9A 1NM1A 3KVGA 1XQSC 3D0IE 1Q0NA 1HYSB 3RW7A 1KHWA 3BKTA 4DV1K 1AUSL 1ZBIA 3C0BA 3IRXB 1FFSB 2AZ1A 4BRCA 1M5SA 3O1LA 3B8AX 5D0RA 2O8EB 4YFUA 4ICLA 5LSRA 5A0YA 5KFTA 2VODA 4CJKA 1BQNB 3OD2A 1QVFR 2KZZA 4ELVA 5AQMA 4HHHA 4IKAA 3G6XA 3EE3A 3HP9A 2GGPA 1ASUA 1LWFA 1H98A 4CLFA 4J9NA 1HQEA 3RBZA 4IFVB 1EP4A 3ULHA 3CETA 3IFRA 3L2RA 4M63A 1IBMJ 2VQFJ 1I3AA 2NREA 1YVNA 3EGWB 3MFIA 4OGEA 3OTOJ 1UVLA 5GAGU 4K7QA 4WP9A 1RKIA 1OQ3A 2R7VA 4C8YA 2VD3A 3SCLE 3OS1A 3D68A 1ZAWA 2NSCA 5B0EA 3QMQA 5AZIB 2IY5B 1DRZA 3RR8A 2P5OA 1KAXA 3HF5A 2J8SA 1D8YA 2GIQA 2ADCA 1NKBA 2YKPA 4BRAA 1HBMA 2DK2A 1EX4A 3UVJA 4WFNQ 4FJ9A 1K0VA 1X4GA 1EAYC 4NYOA 2CYYA 3VGTA 1FDAA 3L3UA 4XH1A 1U47A 3NGIA 4DSLA 1NK0A 5IXUA 2QMXA 3AA9A 3G10A 4M45A 1RWPB 4ED6A 3ITHA 4EZ9A 1VC6A 1GMVA 5FJ4A 1GMWA 1OVQA 1KS2A 1HQUB 4PPZA 4TXSA 4DDFA 5F9LA 1VQKN 3H2VE 3DCAA 5IFMA 1CZAN 1FJGF 1SPBP 4FKYA 2BE2B 4DL6A 2Y1IA 1CJKB 3H5UA 3I4HX 2NXUA 2OFHX 4ZVFA 4KHPK 1B9DA 4KE5A 3N28A 3CIPA 1VQNS 4JI2F 2W4CA 2MLXA 5B0AA 1PJ5A 4ZS6A 4ECXA 3PYFA 4DR5J 2F9WA 2D3OR 5KFPA 2R8KA 3O3HA 3I5BA 3CMAS 1FRMA 3PX0A 3DLLL 4DOZA 4Y6IA 4U67Q 3J7YP 3N6MA 1YUWA 2K1RA 2FBXA 1NK7A 3OLAA 1JLBA 1RBVA 4X64K 1BQXA 2QX0A 1APSA 2UUCJ 4DTSA 3BH6B 4K2XA 3QWPA 2QO3A 4FOIA 2VZ9A 4FS1A 2Y1RI 2FJAB 2NLWA 2XSJB 1GLLO 3AAQA 4KH0B 4P7TA 3T1YJ 5DZ7A 2MY7A 4JI4J 5CH7B 3THWB 1RWMB 3MM7A 4LC9B 3G71S 2D0PA 1F3VA 4JS4A 3CPWR 4IOBA 3POTB 1WI6A 3LW5C 2RILA 4C48A 3Q23A 3W7BA 1Q86O 1LWCB 1RYSA 1KNZA 3SUNA 4P52A 2O8FB 1WBBA 1VQLN 3WC0A 3TTDA 1NU0A 5AQVA 3QGIA 3AH6A 1EWRA 2VDIA 3DXBA 5JS1A 3W8GA 4ECZA 4K8ZA 4ECTA 4IJAA 5H1SQ 3P49B 4C3MA 4DR3F 1FWPA 3DC2A 3BF4A 3OYKA 4CQ1A 2B5JA 2HRUA 4FZZA 3EZWA 2C2DA 5F8HA 1X8DA 2ZM6F 2UXCK 1MNEA 1VQSA 3NGRA 4U9RA 4K59A 2I7PA 4C1NK 3FZHA 3HULA 1UPPA 4DFMA 4UZBA 1ZH5A 1G6BA 3BKFA 3ZT4A 4OV6A 2UUAF 2JH3A 1I6JA 2P5VA 4ZN1A 5DGBA 4IG0B 1MU2B 3L3CA 2IIRA 3NS6A 3LP2A 3KD5E 3PW5A 2IVYA 1F3FA 3O9RA 1UFWA 4CFDA 3LDSA 4ILLA 4P71A 2HNZA 3F44A 3M9NB 3QNWB 4H0YB 4FYVB 2P5GA 4NRTA 3NGKA 3CDWA 1CSJA 1S3XA 2VKZG 1NMEB 3NCPA 3R6LB 2V7ZA 4O3RA 4CI0B 1O13A 3O5BA 4LMZA 3M05A 3JXOA 4CJLA 2VG7A 3A0IX 3UDLA 2ATQA 2JWNA 2GHPA 2V8DA 4I69A 4BG9A 1Q18A 1JKHA 1IJJA 2MJUA 3CF5L 1OPZA 2M3DA 3QGHA 3MXJA 4P74A 1FKAF 3RVCA 2CQHA 3N5FA 1S48A 3SI6A 3BSCA 3N79A 2AYEA 2XZDB 3BR9A 1FTCA 1S1VA 4ZK7M 5EWEA 3D6HB 3B4MA 3DDIA 1VJQA 1CVJA 2P9SB 4OL8A 5AT1B 2BJDA 3JYTA 2NUBA 4IUFA 2D0CA 4JP8A 2HF3A 3MN5A 2HQFA 2CRLA 5LMUF 1A6LA 2D0AA 5F8GA 3OYCA 3KOAA 2IGIA 4AM6A 2HW3A 1EKEA 2FSKA 3CIMA 4ERDA 2WW4A 2X6SA 3MWPA 4HI1A 4MQ3A 3M3ZA 3HT0A 4YOVA 3QDKA 3U8XA 2GC8A 2GZOA 3JS9A 3V9WA 4KQZA 5EY4A 2OAUA 5DS7A 3MAAA 2VONA 4WFBL 4F4XA 1H2VZ 1SQFA 2F63A 3MCMA 1G15A 3PHEA 4C11B 2IHR1 2FD2A 1ZM2A 2BBEA 1RBSA 4DHYA 3OW2M 4FK4A 2NRTA 1ZAXA 2R9LA 1HKCA 1FO1A 1SC6A 1IBMF 2MKJA 3I5AA 2LMIA 2Q79A 2VFUA 3SUPA 4JI8K 3B54A 4IFYA 3OTOF 4UF4A 1PYSB 5E3QA 1HHQA 3IG1A 4PG6A 4E1NA 2XRIA 5KFNA 4OIXA 4JKAA 4DR1J 4IDKA 3RWUA 2YH0A 3GONA 2QFJA 4O8KA 1NK5A 4H5TA 4ZOSA 1S0OA 3DHWC 1QE1A 3GR0A 4J90A 1MWKA 3VZHA 3KJVB 3LPTA 4LF9K 1RB0A 3H2UB 1S57A 3K0JA 3ZZZA 1SKUB 2CAJA 1U6ZA 1KEKA 4WFZA 4CEOA 4M3ZA 3FZKA 4FM2A 4RJVA 4HACA 4UT4A 3A12A 4ID8A 3GG0A 3M6VA 3ENHA 1FKOB 1IKWA 2BE9B 1GQEA 4J2AA 3WX4A 3AVIA 1T05A 3DDKA 3NS5A 4ZVPB 4XPCA 1T9TA 4OYPA 2MSSA 1ATRA 2QLWA 2Y0SD 5BPLA 2Z2YB 3KTQA 1KVKA 2V8GA 4AHUA 1IKVA 1PKUA 2BTFA 5E84A 1BXNA 5DG7A 5AJ3J 2G0IA 4CBUA 1RGIA 2UU9J 2ZD1B 3S9HA 3E9PA 1RLCL 3VGKA 1TP7A 3JAMU 2KVIA 2G8WA 2PT0A 1PYOB 2XNQA 1JL2A 2K7KA 2V9WA 4DR5F 1PBAA 2CPEA 2WC9A 2F4FA 2GMLA 3I9V9 1OMSA 5B0BA 1YJ9N 2UXDJ 3I56N 1HIYA 1Q8BA 4UQGA 1DBDA 4JD2B 3DGPA 4IKFA 2AMCB 2KB2A 1XK8A 2HNYB 3T1YF 4JI4F 2PA8D 3CCUS 1RHUB 3HP6A 5HROB 1PO6A 1XMQJ 1FEHA 4H4KA 4NB4A 2YNHB 3J7ZT 2YHYA 3MECB 3NMUA 3CCSN 2IVOA 3B6PA 4E7KA 3NGUA 3VAIA 3GV8B 3R7SB 1ZBFA 4LR8A 3CCQS 1SC3B 1KVBA 3UKRA 3QO9B 2XY7A 2WUSA 2FGOA 1J6ZA 1YJWN 1RT3A 1S7HA 5U47A 2EBGA 4NLDA 3HVWA 4FWQA 3W66A 4CLPA 2UXBJ 4FKXA 4JHDA 2BGGA 3DRPA 1VIXA 1HW8A 3QGPA 5B08A 2CJYB 2AP6A 2VFRA 5D4OA 2FC9A 3OFHA 1IM4A 4CVNE 2OMOA 4WQ5C 1ZBUA 2ZH9A 3BO4A 2ZOGA 1M90O 5J2QA 2EHGA 2DGUA 4DV7J 1X9MA 5JUMA 3KDNA 3AOCA 4K4XA 1R8PA 3L7OA 1NK6A 5IM0A 3ZFVA 2IDEA 5IWAF 1EXQA 1GX5A 4FJJA 5AQKA 5JVHL 4DL7A 3FZMA 3GG1A 4ZVOB 3Q8PB 5AQFA 1IBKK 1VSLA 6FD1A 4HI2A 1PCAA 1RCXB 2QRRA 4M5GA 4E3SA 2HVEA 2WTFA 2N4DA 2P9CA 5AZJA 3A8IA 2AYBA 2DIVA 3CC4N 4M5DB 3QIPB 1NDKA 4HLBA 4RCHA 4TU7A 2HWHA 3N4QA 4Z7CA 4LFAK 2O01C 1OWXA 1RCHA 1ZTWA 1HL6A 5T7LB 2HWTA 5F8JA 1RACB 3ZT2A 4Q43A 1RTIA 1HJRA 5HMWA 2DVIA 3CUNA 4WQ4A 2NRHA 1WSIA 2B9EA 3VGMA 1DQ9A 1UVMA 5F3TA 1XTZA 1FRKA 1RT5A 1YI2N 5SUHA 4DZDA 4RBVA 2E1AA 1SJFA 2RSQA 4WF9Q 1UAWA 4KBIA 5DG8A 3HPGA 1NZAA 1T3VA 5DZ6A 2BOAA 1IV0A 1RAFB 5CCMA 5CZ2A 1MN9A 3QRQA 3P96A 3DOMB 5ELZA 2E29A 3CD6N 4RW6B 3BQ0A 3M8PB 3ZSXA 3OS2A 2QYGA 4J9KA 1IBLJ 3DRSA 4CHYA 4WU2A 1NPKA 3G6VA 4JI5F 2HFNA 4QWEA 4CO0A 4I2PA 5HVFA 2VC1A 1QTNB 1L3TA 2F4VJ 2YX1A 2HS4A 1R8BA 4G65A 2YHWA 2ZFHA 3W64A 1N34J 5BR8J 2XMUA 2ASOA 3TAMB 3Q2TC 3VV2B 4A8OA 1SH3A 4DTXA 2BXJA 1TR0A 4P73A 4CJUA 3AVKA 4ZTFA 2NXEA 3UIQA 2OHDA 1LW2B 2WSFC 3VMFB 4ZP9A 4ES2A 4M5NA 2W9CA 4JV1A 2NZTA 3Q83A 3HI0A 2RKIA 5M1PA 2PZSA 5DDRC 2OTLS 4F3TA 2YWGA 5FPDA 1S4FA 2RUGA 4KH4A 4DR1F 4OVLA 5F8MA 1YTAA 4DMNA 2RHQB 3P1GA 1MN7A 2BDPA 1L3VA 4PWUA 2ZBIA 1R8CA 1C1AA 4G1QA 1D3WA 2ZZTA 3THTA 2Q31A 4ZCKA 3VA0A 1HWLA 5KFWA 2FBVA 2MDAA 3NLCA 1FRXA 1JLQA 4KHMA 3H46O 4AUKA 2IJNA 1MROA 1EZZB 1BIZA 1HBOA 2B4JA 2J0SD 3OY9A 2KXFA 2AJ1A 1XNRK 2BABA 2ZJPQ 4PY5A 4ED4A 1H1VA 3H90A 4CEZA 3SI8A 4ILGB 3CXCM 3TX0A 1S1XB 4NI2B 1N54B 3HVRA 3CJ9A 4ILJA 4M5KA 1YJUA 4I2QA 4N41A 5HRSA 3DHXA 4PWDA 5I9EB 1WDDA 4FJIA 1R0CB 3J80U 1DT9A 4NLRA 4KYZA 2NRXA 2EKNA 2UU9F 3JSMB 4RKUC 1BDGA 4KGXB 1HNWK 1RT2B 1KC8O 3AARA 4GV9A 3JQMA 4X4TA 3CCJN 5J1NA 4DR6K 3RW6A 2CNLB 2XSFA 1NDPA 1FWLA 2DD8S 5CZXA 4B1XB 1TV6A 1SQEA 3K57A 1S1WB 2HPUA 4Q2LA 2YKMB 1WF2A 2O5DA 3M32B 3KKRA 3TI0A 2UXDF 3OBYA 1VJWA 2UVVA 1CXQA 3C7NB 2VWBA 5C24A 2N7YA 2RT3A 5KFVA 3OUYA 3E8OA 4Q0BB 2EK1A 2W4DA 5B0CA 3VERA 3N4PA 5M2PA 2BRLA 1D5AA 2KFZA 2BKOA 7FDRA 4CFBA 5ETOA 4WKRA 3LPEA 2H5JB 4YORA 2XCPA 4Z4GA 4CF8A 3N0VA 4V19J 2XI3A 4W4MA 1C1CA 3MEDA 2PA3A 3JTPA 5KFMA 3MURP 4DUZF 5CHIA 4O3QA 2VFSA 4CJWA 1TKZA 2LU2A 4W5NA 2COLA 3Q0AA 1W2BM 2O1PA 1M5OC 2UUBJ 1TL7B 1IKYB 3WNGA 3ZTOA 2YKNB 3FFIB 1NK4A 4UY8O 3PO4A 2G4BA 2SXLA 2HVDA 3QICA 2DIUA 3PRBA 1QDUB 4JK9A 4JI3J 5AQGA 3PM9A 5D4PA 4H0OA 2UXBF 1WTBA 3IXQA 1S1TB 1VRUA 4BHQA 4ZN3A 4DR2J 3TU5A 2B51A 4ZJOA 1X31C 9RUBA 4GVMA 4DTPA 2LXIA 4X84A 5JXSA 2VQFK 1A0OB 2H4YB 4EZ6A 4FN5A 3HO1A 4IRDA 1N8RT 1DY3A 4Y3CA 1J5EJ 3KLEA 4DV7F 2O8BA 3DMJA 5C10A 3V4MA 4N8NA 3ULEA 4BROA 5D0EA 2D7SA 3CCEN 4DL0C 4O55A 5KG5A 2B8QA 2KRRA 3M7VA 1K8KB 4IO9L 3O8WA 4CK3A 2JSXA 1WHVA 4WPAA 2G8IA 2E7VA 4NYNA 3BSOA 5FPNA 5EXWA 2GHVC 1DURA 2DXFA 3SBGA 3BGRA 1Y7PA 2OD6A 2HQGA 3OQ2A 3GR1A 3NP5A 5T7BA 4FPAA 5A8RA 3HD2A 4JI0J 1DQAA 1IQZA 5FRNA 3W5ZA 3NXZA 1OSCA 3I0RB 2D0BA 2OTJS 4L73A 1NPRA 2ALYB 3WNHA 1ZBLA 1F60B 4USUA 2CQ0A 3ZSWA 4ELTA 5ETQA 1Q81T 4GKKJ 1TTHB 5F9NA 2Z56B 4U7CA 3KG4A 3RB0A 3FZFA 1RLDA 2L08A 2Y1JA 4OX6A 3S3NA 3M8WA 2P8IA 1YTYA 1QJHA 3V6KA 2GVZA 4MFBB 4A8QA 1RSCA 2B3TB 4DTJA 3JAMY 4RW4B 4F3QA 4BRFA 2GA7A 4B9NA 2G0JA 4DUYK 4C0OC 1IBLF 1Z25A 1S6QA 3BF1A 3VESA 3FGUA 3O9SA 4BR2A 2CWXA 1OIAA 4QIFA 1HPZB 1R8AA 4B9LA 2HQ3A 4A5AA 3HJVA 4DMZA 2YWWA 3NCQA 1ZM9A 1Q78A 1TUVA 4V1Ak 1T6DA 1LEOA 2YWHA 2IVPA 5DM6L 2AW0A 4QWAA 3FEZA 3G8TA 2F4VF 1B70B 2ZBRA 4DPWA 3Q8SB 3PV8A 3NBPA 4K4ZA 1UAXA 1N0UA 3A4TA 5CXTA 5BR8F 1LWXA 3D4JA 2R7SA 3KK2B 3CCLS 4E1MA 1W97L 2F5GA 5BREA 1HBNA 4O5BA 5BXIA 3DLGB 3CJRA 4C23A 4OYOA 2ILZA 4DV3J 1C2PA 2IAJA 1G99A 1JK9B 3WIUA 2EC2A 3T1HJ 3LP0B 1R0AB 1S9GB 1X7VA 1JJHA 5AQXA 4R5PB 4USIA 3H08A 3WZ0A 2VUGA 4LD0A 3FZBA 2E1ZA 3ALYA 5KFLA 1ATNA 4A57A 3GZ7A 3VQAA 5E7OB 2WHOA 1I94J 1VQ7N 5HJYA 4TN2A 1X5PA 2ASYA 5C2CA 4DX5A 1YJRA 1JJ4A 2MZ1A 1HBUA 2A3ZA 2JOQA 3HVTB 4CNZA 3TZYA 2HHHK 2W41A 4AHCA 3ILJA 1V6HA 1H7WA 4Q45A 2B4VA 1U2VA 4ZPWR 3UPFA 4FBUA 1RT1A 3R9PA 3D2WA 3ZZTA 4AD6A 5HRNA 4QIEA 4OZ0A 3D2FA 4TLRA 2XCAA 5B8HA 3L2VA 2OLWA 2JC1A 4X65K 2R7UA 1S77D 4MKVA 3QEPA 2XY6A 3GILA 1TKXA 3CM6A 2KFNA 3MCOA 4GW6A 3IN5A 4DSJA 3PKYA 3CE8A 4DSEA 4NXNK 2LQ9A 2VA3A 5K8NA 2V4JB 3E01A 1OVYA 4ZIVA 2DJWA 4ZVUB 1IWGA 5F41A 3ID8A 3KNAA 1FE4A 4DU8A 5HBMA 4L3NA 3OL6A 5L1LA 2H9ZA 3FBBA 2ATCB 3IAYA 3U7JA 1UWBA 1FJCA 2QC3A 4IOAQ 3J7Z5 5A6PA 5DO2A 4B9QA 3D28A 5F2RA 3MCAB 2I0XA 3DI6B 3V9ZA 5A6WA 1WN7A 2BW7A 3H8YA 3SSRA 1H72C 3AQPA 1MMNA 2HBZB 3Q7CA 2X1BA 4P2FA 4PQUB 2HFVA 4A47A 1UPMB 1CJUA 1WHYA 2DRBA 4ILHA 3CIZA 2KDOA 4CI6A 2W7AA 2Q1LA 5A2QU 4WZQA 4OYBA 1WF0A 1S59A 1F1BB 4OZ2A 1GX6A 1FFWB 5AXNA 3B6OA 3LP1B 4DV5K 5M1FA 2W1BA 5K8PA 3FZ2A 3IM9A 4LT6A 4M5HA 2D4WA 2N82B 1OQ6A 2KKZA 2K8GA 3MGJA 2MGZA 5I3UA 5KFIA 3WX8A 2DBBA 2UUBF 2R7QA 3GP9A 3MEEB 2XYGB 1RABB 1CC8A 3CJAA 4K8RA 4JI3F 2KM8C 3FBFA 3RTVA 1BWFO 5C42A 3MR7A 1DTTA 4CWBA 5DDPC 3NHGA 3CCRS 4EP4A 3RAQA 2QWQA 4JV5K 5KT6A 3DWLA 1SJ3P 1GLFO 3O80A 4DR2F 1QUVA 1F5BA 2WTUA 3HMJG 3VQPA 2VB6A 1D9AA 3CDAA 1WDTA 2EXUA 2LXUA 1SZ2A 4I6MB 2X51A 5J1EB 4HDGA 4BRPA 1J5EF 2A1SA 1TFWA 3P38A 3UO0A 3TUIC 5KI6A 2P6SA 3J81j 1KLNA 4WYWA 1E4FT 2G8UA 3SCKE 3SMPA 4CZKA 1NXIA 1XUPO 4QWBA 1VSFA 4R8UA 2G8HA 3NKYA 3RB6A 3UN3A 1RAGB 3AT1B 3CQYA 4ER8A 2IOCA 2QI2A 3MPWA 3K8WA 1B0TA 3MM6B 1UVNA 4N7TA 3SQGB 1BMQB 1HYSA 3AVCA 3U9ZA 3VVTA 2F8EX 2WONB 3BV8A 3HT3A 4OZ5A 4J8FA 1YQHA 4EFAC 4ES1A 3BSNA 5L1IA 4C9DA 5J2MA 4GRSA 4ZKAA 3ASMA 2ZGZA 3IGVA 4J7CA 3KMSA 4CEQA 2EFPA 2XLJA 4QS8A 4BCAA 2CPJA 3QPIA 4C8ZA 1X0FA 4GKKF 2YKOA 2IYIA 3DU6A 1GLAG 2HYIB 3J80Y 1KR4A 2RS8A 4OX7A 4DCOB 3V2UC 1RTDB 3B6BA 5CD4H 4F26A 3IR5B 4OPAA 1Q7YO 3C65A 4A59A 4LRFA 1TL3A 4V19S 3Q24A 4KO0A 3ETOA 4TY8A 1C0GA 1YVUA 4CZJA 1HWJA 1VHXA 5KPZA 1WWHA 2VICA 1Q5YA 3I33A 3SCIE 3QAEA 3GV7B 1HD0A 1VK8A 4FJLA 3NAHA 3BBFA 3QLHB 2CZVC 4ZVRB 3RMAA 1HJOA 3LH2S 3AB2B 3RGIA 3FQLA