2YNHA

Hiv-1 reverse transcriptase in complex with inhibitor gsk500
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 164
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynhA05
1RDAA 2YKNA 4YMEA 4EYHB 2XI3A 2W9BB 3ZSQA 1S5JA 4ZPAA 1TKXA 4IH5A 4J2EA 4KHQA 3OYKA 1OS5A 2PYLA 3TARA 4IKAA 3H5XA 3CFOA 3TAGA 3EY1A 3H98A 3MEGA 3PX6A 1RTIA 3QEXA 1IKXB 1W0HA 4OPJA 3CQ8A 3HHKA 1TL1A 2J6TA 1REVA 5KI6A 4M95A 4DQRA 2XC9A 4WXWA 4FK0A 4DF4A 3RMDA 4ZVGA 1D9DA 3ZSWA 4I9QA 4QWDA 4C8MA 4YFUA 2IBKA 3V4IA 3HJFA 1EKEA 4PQUA 4MIBA 4TYBA 4EP5A 3CM5A 2XCAA 2J6UA 4AH9A 1VRTA 1BQNB 2R8IA 5KFTA 2ZE2A 3RMBA 1D9FA 1RDBA 1JL2A 1IKWA 3RB3A 1RT3A 4CGHA 3AO1A 4ZHRA 3PW5A 4DLEA 3O4QA 3RR7A 4NLRA 3DMJB 1RT7B 1S9EA 1BGXT 4KTZA 1NHUA 1WSGA 1N56A 1I39A 2P5OA 4M94A 1C0UA 4H8KA 4J2BA 3SZ2A 4F3OA 3G6XA 1SV5B 3KK2B 2XI2A 4DSIA 4I2QA 1EXQA 3AVAA 4X2BA 3QZ8A 4Y1CA 2XY6A 4CGFA 4M3UA 1DTQB 2C22A 1WAJA 3JYTB 4K8ZA 3JSMA 1RT1A 3SQ1A 4BDPA 4K4VA 2HAIA 1JIHA 4ZPCA 1J53A 2OYQA 3AO4A 4ZVFA 3KLIA 1VSLA 2P5GA 5DQHA 1RBTA 2CJQA 4FJNA 1RT6A 5DLFA 1S9EB 3CJ2A 5CY4A 2G8FA 1KHVA 2Z1IA 3QLHB 3L8BA 4ZP6A 1SH3A 4DSKA 3TR8A 2W9AA 4O5BA 2YNGB 2BQRA 4Z4FA 3QNOA 1GX6A 5EWGA 1DLOA 5J2NB 2JGUA 4FJ5A 3RB4A 3AVNA 2IGIA 5J1EB 1RT5A 4W5NA 3DLRA 4AHVA 1HYSA 1GX5A 4IG0B 3OYLA 3QIDA 4IFYA 1S9GA 3DRRA 4N5SA 1S9GB 1I6JA 4KHWA 3RMAA 4B9LA 4WFYA 4WXOA 4EO8A 3SFGA 3SUOA 3QO9A 1JLCA 1RTHB 4IG3A 3GQCA 2W7OA 2D0BA 5DK5A 1NK7A 2R2RA 4DTXA 2P51A 4BE0A 3AO5A 4U7CA 2JC0A 4F50A 4FZXC 4NYNA 3SQ0A 4ZHRB 4B8AB 4IKFA 4CJRA 1JLQA 4ECTA 4CHZA 1NK8A 1QAIA 3DYAA 2VG7B 4MK7A 4DLGA 2DY4A 3DRSB 3CJ5A 4O3RA 3O3FA 2KZMA 5KFHA 2D0AA 2Z1JA 1C1BA 1S0MA 3LDSA 4CJ4A 1K1SA 4CERA 4C8KA 2HHSA 1QQCA 4O4RA 1KVCA 3NGIA 4FJGA 4AHTA 1MU2B 1NJWA 1WSEA 2O4GA 3U3YA 3OYGA 3QETA 3H2LA 1S1UA 4TQSA 3GV8B 3NMAA 1CZBA 4FJ7A 4RG8A 5KFOA 3OHAA 3WNGA 3UIQA 4ELVA 4CJEA 1X9WA 4RUCA 4O3QA 2VA3A 4N56A 3DOKA 3THVA 4EBCA 4DQSA 1S9FA 1YVFA 5CYMB 3RR8A 5DG9A 2W8KA 2WONA 4W5TA 3RB6A 5HRPA 5KRSA 3RAQA 3P83D 4Y1DA 4M3RA 4CEQA 4NLXA 2XO7A 1KVAA 3IS9B 3ULDA 3RRHA 4MKBA 2PY5A 1RAJA 3KLEB 2RDIA 3ITHB 4CHYA 1HNIB 4J9PA 5KT2A 4FLXA 2CKWA 2KW4A 3M8PB 3C6UA 1S6QB 4XPCA 2E9ZA 1HYVA 3MEDB 2W9CB 1RBUA 1X9MA 4Z4EA 4E1NA 1S1WB 3OL7A 5J2MB 4FS1A 4DTSA 1SL0A 1DTQA 1SUQB 2RKIA 4DS4A 3JSMB 2FJXA 4FCYA 4I9LA 1XR7A 1EETB 1JL1A 1NK4A 4LH5A 3VA0A 3OS1A 3VQQA 5CYQA 3MEDA 2W9CA 3V1QA 4CJUA 1J5OB 1KRPA 1S1UB 3CDWA 2FJVA 2C2RA 1YVUA 5EUHA 1WSFA 3V6DA 4MFBB 4LQ3A 4CJWA 3DOLA 4NLTA 2FLNA 2E9RX 5KFAA 4MK9A 1RBRA 1S1XA 1IKWB 3K58A 4HHTA 5HBMA 4E7IA 1T94A 5HROB 2KZZA 4CF8A 1U49A 1QHTA 3NL0A 1BQNA 3MR3A 3CIZA 4B9MA 3ZT2A 3HM9A 2IDOA 3VQ5A 4ELUA 1IM4A 2HNYA 4K4UA 3S9HA 1RDCA 1HARA 4CGGA 4DTRA 4Q8EA 4AHSA 1LWEB 4DL7A 2VWKA 3LAMA 4ZVEA 5T7BA 3G6VA 2ILZA 1A5VA 4WZQA 3MXJA 4DFPA 2OPPB 1R0AA 4W5RA 4M42A 2G8IA 1KVBA 4GMJB 1VSEA 4CJPA 2UUTA 2V0NA 2IMWP 5KFPA 2RDJA 1FKPA 3NAHA 1JX4A 4TN2A 4KFBA 3NKYA 4CJ5A 3TWHA 3HVTB 4LQ9A 4ZPBA 2VWJA 2OPRB 4IOBA 1HMVB 3IG1A 1QTMA 5KT5A 2XY8A 3ASMA 1K1QA 3P1GA 1LWFB 1N6QA 3OLAA 3DLHA 3GIIA 2ASLA 2G8KA 3K5MA 3NH2A 5KFYA 3FDSA 2OZSA 1LAWA 4H4MB 5C42B 4KHUA 4OJRA 4FJ8A 3SV3A 3MEEA 4PUOA 4BDZA 4NZ0A 3Q8SB 4RW7B 5J1EA 3KLIB 3M8RA 4I7FA 3OYNA 3PR4A 4CGDA 1TAQA 2O5DA 1C6VA 4FM1A 4MH8A 3QO9B 4CEBA 1HYSB 2XRIA 4KHNA 1S1TB 1RT1B 5KFUA 3I5BA 4K4XA 5KFCA 3DRRB 1C0TA 1RBSA 1VSDA 1S6QA 4RNHA 3DLKB 3KJVB 4NLOA 4Q8FA 3KKRA 3DRPA 2EC0A 1HNIA 2F8EX 4KI6A 2BANB 3TAMA 3RTVA 3MF5A 5F8NA 3LWLA 3KD5E 1HNVA 2UVVA 1RDRA 1KFDA 2YNGA 5CYMA 2AWZA 1RA6A 3FQKA 1SH2A 5KFZA 3S3NA 1C0TB 2DPIA 3PZPA 3FSIA 2XCPA 4CJVA 1Q9XA 3KLEA 4Z4HA 3LP1A 5DGBA 4H4OB 1F21A 4I2QB 3C6TA 2FVRA 4ZMMA 1D5AA 3O3HA 4HYKA 4QW8A 3PVXA 4FXDA 4DFKA 2YHAA 2OPSB 2YNHA 1N6QB 4NLVA 3LP0A 3OJSA 2XGQA 2UVWA 1UWBA 4R0EA 4WE1B 4JV2A 1WNEA 1G15A 2D5RA 4OKJA 4PA1A 3H5UA 4JRPA 1C2PA 1N48A 3AA5X 2OH2A 3TI0A 3TAPA 4MKAA 3PJXA 5L9XA 3G10A 3NHGA 5KFJA 3QGHA 3FRZA 1SH0A 3VQ7A 2F8SA 1MMLA 1ZBUA 1KFSA 3Q8PB 4DWIA 4CJ3A 3FFIA 3TVKA 2UUWA 2GV9A 2FBTA 1VRTB 4XO0A 3CO9A 4Y34A 1NOYA 4BWMA 1ZBLA 4LY7A 4O55A 5KG7A 5HROA 1NK9A 1EP4A 3D45A 4AHRA 4FBUA 3Q8QB 3MXMA 3EZUA 1JLAB 2KQ2A 2V4QA 3M8SA 1K6YA 5HRNA 3V1OA 3D5MA 1REVB 5EDWA 3OS0A 4URQU 4KHMA 2KFNA 4IBNA 2GBZA 3CM6A 2ILYA 5FRMA 4KPYA 4ED8A 5KFWA 1JLBA 4LH4A 2D3UA 3TABA 3T1AA 5KFIA 4NLUA 3SV4A 4CEAA 1UA1A 4E7JA 3SQ4A 2XGPA 2JLEA 2HHUA 2EX3A 2FVQA 3ZSRA 2PYJA 4FJKA 4RNFA 3VQAA 4CIFA 2ASJA 4O4GA 3OYMA 1WLJA 4ZTFA 4DTNA 4RW6A 2HMIB 1BL3A 2HHVA 2HB5A 4IFVB 4AHUA 1S1VB 2WTFA 4O0JA 1VSFA 3G86A 3MR5A 1GOBA 4BACA 4Y2CA 3H4BA 3DOLB 3VQ8A 1TK5A 3QEWA 1QSLA 3KLHA 3H59A 3SI8A 3DRPB 3Q8RB 4ECYA 4IRCA 2ETJA 1BI4A 4DF8A 2ITGA 2FLPA 3PW4A 4N76A 2BQ3A 2XY5A 5DG8A 3IS9A 4W5QA 3NCIA 3OL6A 2JEIA 4PWDA 2ATQA 3ITHA 2DFHA 3CJ4A 4IDKB 2HWIA 4DEZA 4OL8A 2QK9A 4LSLB 5F8JA 1U48A 4Z4GA 4EEYA 3DLGB 5KFVA 5I42A 3M8QA 1RBVA 1C0UB 1BISA 2IJFA 5E41A 3SQ2A 1TV6A 3QIOA 3LP3A 3TQ1A 4DL2A 3MTKA 1RYSA 1XI1A 3HVAA 2BQUA 4F4ZA 1Q9YA 4Y3CA 4H4MA 5KG0A 2G8HA 4MIAA 1TL3B 4K4WA 3T5HA 1RNHA 4M3ZA 2C28A 4IQXA 3UQSA 2R8HA 4B8CA 5DMRA 1C1AA 1FK9B 3MEEB 4EP4A 2IC3A 3BSOA 2G8WA 5C25B 1LWCA 3AVMA 3OYJA 4IR1A 3N6LA 2YKNB 4YR3A 4F4KA 3E01A 5KGXA 3NBPA 1KLMA 3NAIA 4HVJA 1RCHA 1UAXA 1S6PA 3KLGA 1ASUA 1KTQA 2D41A 3F9KA 3PX0A 2B5JB 4NLDA 4CE9A 4RU9A 2E6LA 2B4JA 3TAEA 4CEFA 3RMCA 3HVWA 1IG9A 3BREA 1JLFA 1T03A 1XR6A 4B08A 4J9SA 4TLRA 4JUZA 2V4RA 5C25A 5KGWA 2WOMB 3TANA 4DQIA 2F8TA 1KSPA 1S10A 5HP1B 3QNNA 4B9TA 1S6PB 4URSA 1W25A 1VK0A 1LW2B 3C94A 3LP2A 4H54A 5FDLA 1CLQA 1LWEA 5D3GB 2DFEA 3CDEA 4FJIA 4CHQA 1JXLA 3DM2A 4J9QA 3SUPA 3SPZA 3SCXA 1WAFA 4ECVA 1RYRA 3M9NB 1NK0A 4IH7A 1HQUA 3WNEA 4FLWA 1D8YA 5J2MA 3KIOA 1FK9A 4XPEA 2R2SA 4CFBA 4CGIA 4N47A 3CFRA 3OS2A 4DSJA 1VRUA 4B9NA 4CJKA 3ZT0A 2R7YA 3V1RA 2YKMA 5L1KA 3OL8A 3WNHA 3QERA 3PJWA 4NCGB 2OPQB 5CYQB 4IRDA 2AQ4A 3HL8A 3AA2A 4FZZA 5KFRA 4E1MA 2QKKA 4ZPDA 1L3SA 4KKOA 4KHSA 3M8PA 1U45A 5KT4A 1NK5A 2FVSA 2BR0A 3LANA 3KLFB 2OPSA 2YNHB 3PHEA 1L5UA 3IN5A 1B9FA 1NJYA 1DTTA 2RN2A 1SKRA 4NCGA 2BRKA 1ZTTA 5CZ1A 1BQMB 3DLGA 3AO2A 2JEFA 4K4SA 3K57A 3KJVA 5KFQA 3HVRA 4IDKA 1RDDA 2HVHA 4KTWA 3VA3A 3B6OA 4RW9B 2HHWA 2IM0A 2FBYA 2R8KA 4AILC 3AA4A 5K14B 2QE5A 3AVFA 3K5OA 4KI4A 4M3XA 1NOZA 1HQUB 3HSTB 4PY5A 5DGAA 1TKTB 4FLZA 1VSJA 2RF2B 4YNQA 4CF1A 1NKEA 1JLAA 4CJFA 4CGJA 4FK4A 1HQEB 1JLEA 1TQLA 5KG3A 3O4NA 4B9VA 4R8UB 4PQUB 4URGA 1J54A 4NYZA 4ZP8A 1U09A 5KG2A 5C42A 2IAJA 4CF2A 2OA8A 2B6AA 3KK1A 4ZVHA 4O3OA 3ZCMA 3CDUA 2KTQA 3VQSA 4ICLB 1EX4A 5DQGA 2HNDB 1RILA 4JS4A 3DLEB 3DRSA 3QESA 4HUEA 2FVCA 1LW2A 3H4DA 1C0MA 4Z0UA 1BCOA 3GYNA 3NBPB 3OYHA 1N4LA 1JLGA 4Q5VA 3D0PA 3KD1E 3VQ4A 3AA3A 2BGGA 4ECXA 3HPOA 2Q3SA 4KB7A 2ZD1B 3KHLA 4LD0A 3V81A 4OPKA 3ALYA 4DFMA 1YTUA 2HNZB 3SUQA 4TQRA 1CXQA 4HUFA 4FJJA 1TKTA 1RT5B 3MEGB 4QAGA 2IM1A 3WNFA 2RF2A 4NLSA 2IS3A 4QWEA 3PUFA 3M9MB 1WSJA 1BIUA 4ECSA 2OPQA 1WSHA 1S0NA 4KSEB 2YV0X 1L3VA 4CECA 1UOCA 3HPGA 1RT6B 1X1PA 3TAMB 1TK8A 4OLAA 3PO4A 5KFEA 3BGRB 2JEJA 4TXSA 3V6HA 3BGRA 1T05A 1BCMA 3KKSA 1FKOA 5EU7A 4NCAA 4XIUA 3V9WA 3OL9A 3LWMA 4NYFA 4PUOB 3H08A 3I0RB 5F8MA 1S48A 3SNNA 3K2PA 2E9TA 4QOZB 1GOCA 5KFGA 4U6PA 1QSYA 4CEOA 3P5JA 5D3GA 1WN7A 3HO1A 2C2EA 3GIJA 3DM2B 4AHCA 3ZSVA 4ECUA 4DTMA 1QSSA 4W5OA 2WRMA 1YT3A 2GIRA 4ED3A 4DSLA 2HHXA 5KFSA 3RBEA 4FJXA 5HLFB 2HHTA 3MFIA 1IO2A 1RTDB 3OSNA 2IM2A 3UR0A 4J9OA 4K4ZA 2GIQA 4TY8B 3KK3A 1ZETA 1B9DA 3CJ3A 1QE1A 2VG6B 3UPFA 1JLGB 3RWUA 3HK2A 3AVJA 1MU2A 3HYFA 1ZTWA 3U3GA 3VQCA 3KOAA 4RW7A 4FLTA 4Z4IA 3MXIA 4YR0A 4WFXA 1HMVA 4B9SA 2W42A 1T3NA 1HJRA 4YP3A 4O0IA 3OY9A 2XHBA 4FLUA 1LWFA 4DU3A 4O3PA 1N5YB 1RTIB 4R5PA 4R5PB 4F2RA 2ZE2B 1S49A 4HUGA 3ZT4A 2KFZA 3L2RA 4BDYA 2AX1A 2UVUA 5F8HA 1WSIA 3KNAA 4ICLA 3B6PA 2IM3A 3BJYA 4ELTA 3E01B 3ZT1A 3OYIA 2LSNA 2WOMA 1X9SA 2Y1IA 3C95A 4FM0A 3IRXA 3RB0A 4ECRA 4JV0A 4M3TA 4DG1B 5FROA 3QGGA 1LAVA 5JS2A 2W8LA 5C5JA 4HTUA 3HXMA 3SI6A 4Q0BA 4FK2A 1S0OA 3LZIA 2R8GA 3NF7A 4JRQA 3HP6A 4ED2A 2EHGA 4ECWA 3M9OB 5F8LA 4PWDB 4O3SA 3NH0A 4KB0A 4J9NA 2HNYB 1A5WA 3OYEA 3PV8A 4Q43A 4NLYA 4IRKA 5I42B 3HP9A 1VSIA 2WCXA 3BSNA 3IGNA 1LW0B 2JC1A 3OJUA 3LP1B 3GILA 5L1JA 3OHBA 1KLNA 4FZYA 2AGPA 3L3VA 3NGDA 3CYMA 2FVPA 4CIEA 1J5OA 4CFDA 1D0EA 4E89A 2QV6A 3BR9A 2G8VA 3KK2A 5F8IA 5J2NA 4QWAA 5DG7A 3F73A 1T05B 4CEZA 4EBDA 1LW0A 1SKWA 4YQWA 1NKBA 1VRUB 3GV5B 3AVKA 5T14A 3I0SA 4F4YA 3VN5A 2A1SA 3I0SB 1TAUA 2YKMB 3V9ZA 3DDKA 3PO5A 4WYWA 1LV5A 4B3OA 2HW3A 3OVNA 1NHVA 4C8LA 2OPRA 4CFAA 4CCHA 1U47A 2IJNA 4F3TA 4FJHA 2ALZA 4KO0B 4RZRA 1W9HA 4CHOA 3KLHB 4FYDA 3M8QB 4HCBA 4KB1A 1CZ9A 2AGOA 3EPGA 1EP4B 3KHHA 2C2DA 3OYAA 3T5LA 3MAQA 1ASWA 4GVMA 5KT7A 4FM2A 4DSFA 3QGIA 2IOCA 1XC9A 3N6NA 3LP2B 3QZ7A 4K50A 3KK3B 3AO3A 3IAYA 4C8OA 4F4WA 3OYBA 4F2SA 2E4LA 3DLEA 2V9WA 2VA2A 3NF8A 3TAFA 1L3UA 4RW8B 5FDLB 2ZD1A 4RW8A 4QPXA 5KFBA 1SL1A 1S4FA 3HKWA 5KT3A 1ZYQA 3KMQA 1UWBB 4K4YA 4QWCA 3S3MA 2YNFA 2QKBA 2B5JA 2B6AB 3KK1B 1TVRA 1N5YA 4TY8A 1UA0A 2HNDA 4E7HA 2VG7A 1T03B 4WYLA 2FLLA 4NRTA 4QWBA 4GW6A 3PW7A 5JXSA 4DL4A 4DG1A 4R8UA 3LPTA 5KFMA 1HPZB 3LZJA 4DTOA 1TKZA 3VQDA 3K5NA 4CJLA 4E0DA 4Q44A 2NUBA 4TY9A 4CFCA 1NJZA 5HP1A 3V9XA 4DTJA 1JLBB 4O4GB 3QEPA 3QIPB 3E51A 3ISND 4M3YA 1RT2B 3KHRA 5DQIA 1JLQB 1RTJA 5C24A 1TKXB 1QE1B 2VG6A 1SL2A 3V6DB 1XR5A 1IKVA 3I0RA 3MR6A 1BQMA 3VQPA 3L2VA 4YR2A 1JLCB 3EYZA 3AVCA 4LSLA 1J9AA 3UDLA 4BWJA 4HCCA 4EZ9A 4JV1A 3G6YA 4KHYA 4F4XA 3BQ0A 4DTPA 1QAJA 1HRHA 5J2QB 1TGOA 2ASDA 5I3UB 4CJQA 4KKOB 4L8RB 3GV7B 5K14A 3KLFA 1KCFA 1ZBIA 1S97A 3OYCA 3V6JA 4CESA 4LSNA 4FBTA 1A5XA 4MK8A 5F8GA 1GOAA 3DMJA 3D28A 5DLGA 4KHRA 4ECQA 3QLHA 2ATLA 2I5JA 2RPIA 2D0CA 4I7FB 1S1VA 2X74A 4Q0BB 4QCLA 4I2PB 1TKZB 3V6KA 3ZT3A 5KFFA 4G1QB 1Z4UA 4KTQA 4DSEA 4JS5A 1C1CB 4BE2A 1C1CA 4FW1A 1RT4A 3PW2A 3I8DA 3HVTA 3LPUA 4HKQA 3K5LA 2FJWA 3KMSA 5JS1A 4KV8A 1JKHA 3OSPA 1ITGA 2X6SA 4RW6B 2HMIA 4O3NA 2AJQA 3OYFA 3H40A 2ZQBA 3K59A 3DLBA 3LAKA 3O3GA 4KREA 1RT7A 2I1RA 1CSJA 3RRGA 4DFJA 4DL5A 2X6NA 4UQGA 4DU4A 2BRLA 1IH7A 3VQEA 1JXBA 1VSKA 1L3TA 3ISNC 1Q8IA 4NLQA 4NRUA 2Z1GA 3IG1B 2HNZA 2A1RA 4DU1A 4DQPA 1JLFB 3V9UA 3BQ2A 4GC6A 3QINA 4FJMA 5KG5A 1C1BB 3NF9A 3NGZA 1I3AA 4WE1A 3SPYA 3AVBA 4F8RA 2AGQA 2JEGA 1IKYB 4DMNA 3T5KA 4IR9A 1SKSA 1U4BA 3LP0B 3FQLA 4RNMA 4KV8B 4TYAA 3RAXA 1U04A 1Z26A 4WFZA 4CIGA 5HRRA 1YTAA 4CHNA 5KG4A 2IC3B 2IA6A 4OKEA 3PY8A 5KFXA 3GIKA 1B92A 3C6TB 3NE6A 4G1QA 1KLMB 2O4IA 4EO6A 1HQEA 4M45A 3MFHA 3FFIB 2W7PA 2WHOA 4DL6A 2Z1HA 2YNIB 4EZ6A 5HLFA 4CK1A 1NJXA 1BHLA 3ZSOA 3L2QA 2GUIA 3DI6A 4NLWA 2X78A 3KHGA 3VQ6A 3AVGA 2WK4A 1DTTB 1EETA 3KTQA 3TAQA 4B9UA 2QXFA 1XHXA 2R2TA 3NDKA 3NF6A 4KBIA 1XHZA 3DLKA 2D7SA 3MR2A 3CWJA 5HRSA 4M41A 1TKDA 1LWCB 5KFKA 4RNNA 4N41A 2OZMA 3AVIA 5CZ2A 3I5AA 1TV6B 2AX0A 4B3OB 4E7KA 2F96A 4CJTA 3JYTA 5I3UA 5C24B 2AU0A 1Z25A 1KHWA 3GIMA 4NLGA 4IFVA 5KRTA 1SUQA 4K8XA 4J2AA 4CF0A 4FW2A 3S3OA 4ID5A 2BDPA 4K4TA 1SV5A 4OGCA 4O44A 5KFLA 5SWMA 1S1TA 4O44B 4EBEA 3PW0A 1VSMA 2E6MA 3V4IB 4KFBB 1TK0A 3IGVA 4I2PA 2ZKUA 1HYZA 4FS2A 1D1UA 4OLBA 2YNIA 4FJLA 3OLBA 1ASVA 3KLGB 3H5YA 4ZP9A 3C6UB 3ICLA 5L1IA 4DQQA 2OPPA 1R0AB 3EZ5A 3V81B 3G0ZA 4OKKA 4ED7A 1Y97A 1NKCA 4BE1A 2WONB 4CEDA 3IRXB 3CG7A 1NNDA 1ZBFA 2FBVA 3MECA 5J2PA 4C8NA 3U6FA 2W9BA 4NLPA 4E3SA 3A2FA 1FXXA 2YHBA 1BIZA 3AVHA 4IH6A 1JLEB 5JUMA 3T5JA 4ECZA 2R8JA 4CF9A 4RW4B 5KG1A 5F9LA 3NH1A 4FLVA 4G3IA 1IKVB 2IAJB 1FKPB 1RTDA 4RUAA 1ZBHA 4KRFA 4DTUA 4EYIB 3BDPA 1TVRB 4H4OA 4WZMA 3HPHA 3N6MA 4ID1A 3OYDA 2HWHA 2P1JA 2I5JB 4ZTJA 4ZP7A 1QS4A 3KLVA 2J6SA 4CHPA 4JLHA 4CJSA 2DFFA 3BSCA 4CK2A 4KE5A 2WB4A 3L3UA 4RW4A 4ED0A 4TSXA 1DLOB 4MFBA 4DL3A 5SZTA 1T7PA 1JKHB 3L2UA 1RT4B 1HNVB 5F9NA 4E7LA 1S1XB 3SYZA 4ED6A 4QW9A 1FKOB 4ID5B 5J2QA 4J2DA 4GC7A 2B43A 5KG6A 1TP7A 4IG0A 1CXUA 4M3WA 1TL3A 4Y2AA 2DPJA 4IFYB 3AVLA 3QEVA 2VG5B 4OVLA 4NCBA 5J2PB 4LSNB 4Q45A 3CVKA 3VQ9A 2GC8A 3ZSXA 3SJJA 2BE2B 4KO0A 2BE2A 2XY7A 1T8EA 2DTUA 3NAEA 3NGYA 1WNSA 4DS5A 3PX4A 1JXEA 5EWFA 1O1WA 1VSHA 1RTHA 2G8UA 5FRNA 3BQ1A 2R2UA 3NFAA 4J9RA 2BANA 1RTJB 4CEEA 5KTQA 2Y1JA 1S1WA 4RW9A 4OGEA 4RNOA 2D3ZA 3ZSZA 3RBDA 4E19A 2RKIB 5HBMB 3HT3A 1QUVA 1BI4B 3V9SA 4FVMA 2XWYA 3VQBA 4FLYA 4Z4CA 1RT3B 2HVIA 3PR5B 5KT6A 4J9LA 2VG5A 5EWEA 3CFPA 3EPIA 3ZSYA 2YNFB 4J9KA 2HHQA 3SUNA 5KFDA 3L2WA 1RT2A 5KFNA 2UVRA 2FC0A 4KAIA 1NK6A 3DYAB 3H5SA 3QEIA 4ED1A 2PZSA 5L1LA 3SFUA 4J9MA 1RA7A 3DI6B 3I5CA 1XWLA 3DOKB 2FBXA 1HPZA 3T3FA 1IKYA 3T19A 4FJ9A 3BSAA 1IKXA 4KAZA 3LALA 3QYYA 4IG3B 3CJ0A 1TL1B 4CK3A 3QIPA 3AV9A 4MQ3A 3MECB
chains in the Genus database with same CATH superfamily
3ZZRA 1RDAA 2KVQE 1E6VA 1S5JA 4ZPAA 2HQ3A 4IH5A 1FJ7A 3E2EA 4J7CA 2C42A 3DGVA 5BN8A 3VTHA 2KT3A 4NASA 1FE4A 3EY1A 3PX6A 3NS5A 3QEXA 4OPJA 2YWKA 1TL1A 1KVIA 3DJCA 1REVA 2XC9A 4WXWA 3QT5A 4DF4A 4ZVGA 2MQNA 2MSSA 2WSEC 3GSDA 4DQ8A 2B4OA 4I9QA 2W7AA 4K5SA 4BRAA 2DHXA 2P9KA 3V4IA 3CCES 2AMCB 1X4DA 5M1PA 3SCJE 2XCAA 3CJBA 2J6UA 4DR7F 3SBGA 4WJBA 1S0VA 3IWXA 2R8IA 1XNQF 2OLWA 3V2UC 3UB5A 1D9FA 2OD4A 5D77A 1NDPA 1NWKA 1JL2A 1IKWA 3OT9A 4DKWA 3RB3A 2VOOA 4ZHRA 3I32A 3CJQA 4NLRA 5M1KA 1BGXT 4X84A 1HR0K 5JICA 1WSGA 1XJWB 2M9KA 3EE8A 4H8KA 3KKFA 1FX2A 1ZAXA 1NXIA 1EXQA 3AVAA 3Q8YA 4JK7A 1DTQB 2BBEA 2C22A 4BRNA 4NMXA 2JLFA 1RT1A 4E1JA 5EX5A 3TPQA 1RGIA 2E5IA 2OYQA 3SSRA 1ZPVA 3HI9A 3CJSA 1NGEA 1HW8A 1JQGA 4UUWA 4OHYA 1RWUA 3QT6A 4DPTA 1RBTA 1F60B 2OSRA 1S9EB 4ERDA 4YB5A 3VGUA 3L8BA 3ZTRA 5DDQC 4M5DA 1T9TA 1BMQB 3LW5C 4DV3K 4O5BA 1B3TA 4JI1F 4YY3F 1HFEL 3OQ2A 1E6YA 1N88A 4FJ5A 1JNRB 2O8DB 4A8KA 3DXKA 4AHVA 3OXLA 4JD2B 4PKGA 1HYSA 4L74A 4DV2J 3OYLA 2PFDA 2J9DE 1S9GA 3DRRA 4B9LA 4H03B 3SUOA 1M5HA 4LBHA 1JLCA 2V50A 5DK5A 5LXRA 2IDEA 4HI2A 4KT0C 4U7CA 3THWA 5HSPA 4L73A 4PQAA 4NYNA 2GHVC 4RL1A 1NK8A 1S3XA 3R3TA 2KM8B 2DY4A 1O13A 2KZMA 3O3FA 2NSBA 3K2YA 1WHYA 3OTDA 1UJ6A 1R27B 1QQCA 4O4RA 2UUAJ 2GJFA 1HWLA 4OYMA 2P9IA 1NAQA 3AGRA 3H2LA 4ZK7M 4OZ0A 4ETXA 3H6EA 1HBMB 4NXMK 4ER8A 3ZZYA 3EXYA 4HEA9 3AQPA 4OFZA 1N5TA 4RUCA 5IT9U 3CCSS 4N56A 4WF9Q 2I7PA 3THVA 4DQSA 1R6VA 1YVFA 1FT8A 3RR8A 4FKYA 3AARA 1W7AA 1CJKA 1IBKF 2OEMA 3PDNA 1O5JA 4CEQA 1SJFA 3WZ0A 4DUYF 3LQVA 1T44A 1DKGD 1KVAA 3KLEB 3ZO7A 1C0FA 2V5HG 4J9PA 3MMBA 4OX7A 3KG1A 1IQZA 2KB2A 1HYVA 2GEMA 2R4FA 1RBUA 1YI2N 5HO4A 4E1NA 1S1WB 3G71S 4FS1A 2PMWA 4DTSA 4WCEL 5A2QY 4EHUA 3EZWA 2F1FA 3MXHP 5LJ3Y 2W6KA 3DDIA 4BRCA 4FCYA 1XR7A 1JL1A 4OX9J 1NK4A 5CYQA 2BW7A 2Z2LA 4CJUA 3M05A 4PWUA 3CDWA 2HRYA 2DISA 4K7QA 2F9JA 1WSFA 1TUUA 3CCJN 3EKUA 3POTA 5KFAA 2ITMA 1S1XA 3K58A 2VL1A 4CH7A 3CQYA 1BQNA 2B4UA 3CIZA 4G1PA 1XMQK 3FEXB 2LKZA 2RSQA 1RISA 5M2RA 2CJXB 4FXWA 3S9HA 2CPDA 2MZRA 2ZH5A 1FW6A 2Y0SD 3D2EA 4DTRA 1K8AO 3LDNA 5CD4H 4AHSA 1LWEB 4DL7A 4ZVEA 5IWAK 5T7BA 2B4PA 3G6VA 1A5VA 4WZQA 1R0AA 4W5RA 4GMJB 1KP6A 1VSEA 4LF5K 3U8XA 1VQYA 1ILYA 2IMWP 1RWWB 1X4AA 4OZLA 5KFPA 2RDJA 1HD1A 4JI5J 4FF3A 1JX4A 4DV0F 3HVTB 2ASMA 4E98A 5BPNA 1RAEB 3A8JA 2NREA 4IOBA 2KLAA 1QTMA 3WT0A 3UWTA 1LWFB 3DLHA 4IUFA 3GIIA 2ASLA 4F4AA 4NYPA 3FDSA 3A3OB 5IWAJ 1LAWA 4U67L 3WXJA 4RUBA 4DPUA 2EWSA 2W1BA 4FJ8A 2Z2MA 3SV3A 5M1NA 3AXKA 4RW7B 3AOCA 4JB8B 3FR0A 1FKAF 4MH8A 4CEBA 1HYSB 4UOCA 3BV8A 1RT1B 3GFXA 3I5BA 1W2BM 1S6QA 1BDGA 3DLKB 3KJVB 1F5CA 2YQ3A 3UN2A 5B08A 3DRPA 4KI6A 3CF5L 1ZM3A 3LWLA 2OIHA 3KD5E 1NGAA 1HNVA 1RDRA 3MMAA 3WIUA 3FQKA 4LUBA 4NZ7A 4ZJOA 2PFUA 3THYA 3S3NA 2R7VA 3EL2A 1C0TB 2XCPA 4HT5A 3QT7A 5GAGU 2HVDA 3CSKA 1KQGB 1CQMA 2YWGA 1RB0A 3W9IA 1Q9XA 3D7EO 2VPYB 2HIQA 5JMVA 4CLLA 2YVSA 4I2QB 3C6TA 3MAAA 4P72A 1AW0A 4ZMMA 5MLCQ 2YHAA 1N6QB 2OELA 1IBMF 3D6MB 4X4RA 3H7HB 3R7NB 2FIUA 2XGQA 1KEKA 2UVWA 4LMZA 2CNOB 1RCXB 4JV2A 2VBZA 5BJRA 3NS6A 4I69A 1MG7A 1C2PA 3BZCA 3TI0A 2DR9A 5DM6Q 3NHGA 4MO4A 2FC9A 3VQ7A 2H5IB 4LIRA 1KFSA 3Q8PB 2CGLA 2RS2A 4XTTA 1UCNA 1UEVA 1KQFB 4CJ3A 3TVKA 4CYUA 3MX5A 2UUAF 1WORA 2FBTA 1E4FT 4ZLPA 4HDHA 4LY7A 3D1HA 5HROA 3D45A 4PXCA 4MDBA 4AHRA 4FBUA 2QWMA 2KQ2A 2V4QA 1DJ0A 1UFLA 1HQ2A 1YKWA 1REVB 1U6FA 3NVMA 1CS4B 2GBZA 3CM6A 3H3OB 3X3UA 4ED8A 2DNNA 2E1PA 2MSTA 4DUYK 2UXCF 1F6TA 4IOCQ 3T1AA 1EKRA 1HNXF 3ULHA 3FZHA 3MCPA 2HFUA 1UA1A 4KH5A 4USWA 2VASA 1PILA 2EX3A 3ZSRA 3WEEA 4EAHD 4CIFA 3OYMA 4C23A 4RW6A 1BL3A 2HHVA 3KHYA 3M30A 4AHUA 1H1VA 1FWKA 3G86A 4BACA 3TNVA 1U7LA 3CJTA 1Y5NB 3H4BA 2V63A 2LQ5A 4X4SA 2GAGC 4ID8A 3DOLB 3VQ8A 4CM2A 1QSLA 3M32A 1Y11A 1U6ZA 3SI8A 3DRPB 2C3YA 3FSXA 2JWKA 3IR5B 2NXNA 4E8UA 3BYRA 1NLKL 5BYQA 5CCLA 2BQ3A 2ASPA 5DG8A 4F0HA 5EX0A 5K8NA 3OL6A 3ITHA 1IXKA 2QK9A 5IV3A 4PL8A 1IVZA 4EEYA 1HX1A 5I42A 1C0UB 1BISA 5E41A 4EFAC 1TV6A 3LP3A 1Y3JA 4A46A 3R6MA 2G1DA 3NCRA 1XI1A 3HVAA 4QR0A 1VRQC 3AAPA 4Z7CA 3UQSA 1JCEA 3W61A 1FK9B 3HSJA 3OPKA 2QLXA 4CQ1A 1WBBA 2ZJPQ 2ZZNA 3CMQA 5ELZA 4FKXA 4XH1A 4YR3A 2EBGA 1URNA 4LF7K 2ZDPA 1KLMA 1S99A 1ZAVA 4ISGA 2ZHBA 2OTJS 5HOOA 2EFGA 4NLDA 4C11A 3PX0A 5AE2A 2E6LA 2BA9A 4DV2K 2B4JA 4ISFA 1FD2A 4FVCA 5BYRA 3TAEA 3RMCA 2QYCA 4G6VB 5C2GA 2QT7A 4NYOA 1C4CA 4J9SA 4TLRA 3VOVA 2V4RA 5C25A 2B3TB 1RBOB 4GKJF 2H3GX 3TANA 4ILMA 2LA6A 4FYXB 2NNWA 5CCMA 2ZNZA 2BJ9A 2HFSA 5AZIB 3QNNA 2O8EB 3C94A 3IBWA 3JS9A 3QFHA 5FDLA 1CLQA 1LWEA 1N0VC 5DJBA 1JMTA 4CHQA 4FPAA 1YGYA 2KN4A 1RYRA 3QRPA 3M7VA 1XNRJ 1I5OB 1FJGK 4WBFA 2YX1A 2I6WA 1T9UA 1KKHA 4CFBA 4CGIA 4N47A 2JFKA 2ASOA 3DHXA 3BGUA 1WSVA 2AJFE 2FJBB 5L1KA 3WNHA 1U1LA 1H98A 5D0GA 5CYQB 2H4YB 3WQPA 5DDRC 2OP5A 4OZ3A 2WVEA 4E2FB 5K8PA 3HL8A 4WF9L 1J6ZA 4KKOA 5GADI 4BG9A 2FVSA 3ENHA 3KLFB 3M1FA 2OPSA 2HBJA 1P90A 3PHEA 3QFWA 1NJYA 1B9FA 1FEEA 1DTTA 2RN2A 5CZ1A 3J7A1 1BQMB 2CWXA 3AO2A 2JEFA 4C0BA 4QYZK 3ETOA 2W2OP 3NWRA 3CETA 2WW4A 3BS9A 1ZM9A 2MQLA 2QFJA 3HFZB 1NHKL 2FBYA 3Q7CA 3TA1A 4AILC 3TW0A 3AA4A 4CZLA 2QE5A 2PA8D 2OI2A 3AVFA 3SBMA 3UNYA 1NOZA 4QIEA 3QBWA 2NYHA 3A4TA 1O0PA 2L9NA 5DGAA 4XDDA 2CQCA 5L38A 4YB1P 4C3LA 3GR0A 3JAMY 4CF1A 1NKEA 1JLAA 4LVOP 3QMQA 4FK4A 3ZX2A 3OA9A 4R8UB 3M8ZA 1NPKA 2HG4A 4PXEA 3N5FA 1U09A 5BRFA 2VBYA 4YHHK 5KG2A 3QMLA 1I3OB 1P8ZA 4JI4F 4JI0F 4CF2A 1PO6A 2OA8A 3KK1A 4ZVHA 4O3OA 3ZCMA 4ICLB 1EX4A 3QESA 4YOUA 2LCWA 3F2KA 2V94A 3W65A 1LW2A 1RE1B 3H4DA 1C0MA 4Z0UA 1GXUA 4B1WB 1UVLA 1BCOA 3J8AA 3OYHA 1N4LA 1JLGA 4R79A 4KGVB 3DKDA 3D0PA 3VQ4A 5M1FA 2W4DA 1UVMA 4PG7A 3HPOA 4B1ZA 5LMNJ 4LD0A 4OPKA 3ALYA 4DFMA 2ZHOA 1ZBTA 2WVFA 3HZGA 5TKWA 1CXQA 1YXQA 4HUFA 4YY3J 3AD9C 2HEKA 2HPUA 4DB3A 4L76A 4QAGA 3PSFA 2ALYB 2Q0RA 4QWEA 2JNJA 3PUFA 2GQ2A 3BGFA 5AJ3K 2YV0X 1L3VA 1R8HA 3HPGA 4ZOSA 1RZMA 2NRXA 4IJAA 2JEJA 3G6EN 4I1TA 3BGRA 1T05A 1BCMA 4KH6A 1NDKA 1FVQA 1FKOA 4FNIA 5FLXO 3FEZA 5LSLA 4NYFA 2D74B 1S48A 4QOZB 1GOCA 1NCLA 5D3GA 2AYEA 1RAHB 4ECUA 1BQXA 4JI4K 4DTMA 1EWQA 2B9EA 1YK9A 4W5OA 1YT3A 3AB4B 3FBEA 3KNGA 3MFIA 1AB8A 4HWIA 1IO2A 2IM2A 1ZM4A 4DR3J 4K4ZA 2GIQA 4H0PA 4U9RA 1Q7YT 1B9DA 3CJ3A 1QE1A 3UPFA 2I9SA 4LFCF 4JAXA 3HYFA 2HSEB 2A2CA 4JI6F 1LXJA 4KGMA 1Q8LA 1Z2LA 2HHHF 1XN9A 3VTIA 1HMVA 4DV3F 1T3NA 1HJRA 2CPEA 2OTLN 5HVFA 3OY9A 3M2VA 3MPDA 3VAIA 4C7QA 3BKTA 4B17A 4DPXA 1VQNS 4FWRA 5E3QA 1WG1A 2DH9A 3KJFB 8RUCA 4DR2F 1APSA 1S49A 2KFZA 4BDYA 2BJDA 2IM3A 3BJYA 3GLJA 3OYIA 2WOMA 3EJMA 3C95A 3IRXA 4JV0A 4M3TA 4DG1B 5FROA 4ZIWA 1LAVA 4RCHA 4HTUA 3SI6A 3F44A 4Q0BA 1QJHA 3JAMU 1UPPA 2VQFJ 4ED2A 1XMOJ 2EHGA 1WOSA 4UOHA 5F8LA 1S76D 4PWDB 2VKZG 3NH0A 3M3ZA 2HNYB 1PJ7A 4NLYA 4TNOA 3T1HJ 3CXCR 4M5KA 4CRJA 4IRKA 2RHKA 3IGNA 3GIRA 2JC1A 2P9SB 3GILA 5HMXA 3W64A 3O6WA 3VGSA 3OHBA 1PYTA 4FZYA 1SBRA 3NGDA 2XS2A 4CIEA 3N4PA 3QFUA 2ZH8A 2EW9A 3MEKA 3BR9A 4ZLLA 2BJ3A 4QWAA 3POTB 3GU0A 2C3PA 1T05B 4CEZA 1LW0A 2MKJA 5C12A 5AQIA 2Z0GA 4BR4A 3I0SA 1KWMA 4CLPA 2B7BB 2KKZA 4LREA 4A57A 3RBZA 4C97A 1SC4B 3PEHA 2UXCJ 5AJ3F 4KH1B 3Q8UA 4CCHA 2IJNA 2ALZA 2Y0BB 4CHOA 4DV5J 3M8QB 2HVEA 4HCBA 3EX7B 4KB1A 5ETTA 3EPGA 1EP4B 3UVJB 2C2DA 4Y28C 4UUXA 4XEIA 4CLFA 2A42A 2V34A 4DSFA 3CD6S 1HI1A 3N6NA 3LP2B 3KK3B 3GFZA 3G9CA 1IUJA 1HD0A 3SLCA 3Q7BA 2VA2A 2VFVA 3NF8A 3SSSA 2ZD1A 1HJOA 3D1OA 3D9BA 3AHPA 3VEYA 2GWKA 2KYXA 1CQNA 1VQ9S 1TL7B 3KMQA 4BRKA 1G3OA 3S3MA 4QR1A 2B5JA 4FWNA 3KK1B 2UU9F 2HNDA 2YCHA 2A40A 4WYLA 2UUAK 4DR7J 1WB9A 2R9LA 2VONA 4R8UA 5KFMA 3F56A 3VQDA 4E0DA 4U8VA 2FJDB 2NUBA 1FI4A 5IT4A 4WFAL 1NJZA 1GLDG 1XQIA 4C8YA 1RT2B 4ZLJA 2ZF5O 1S6OA 2VG6A 1XR5A 1IKVA 4K2JA 5GIOA 1BQMA 3D6HB 3UKRB 1WC1A 1JLCB 3EYZA 4QYZJ 1OYDA 4LSLA 4X65J 3NGKA 1HLUA 3O9TA 3UDLA 2B9XA 2Y1RI 4EZ9A 4JV1A 3G6YA 4PG5A 1VR6A 4F4XA 1VQMS 1FHTA 4DTPA 2Z56B 2HBRB 2L3MA 4CJQA 4KKOB 4LJMA 2DY9A 1VQ8N 3KLFA 2EFQA 3TYTA 1KCFA 1S97A 4C2MA 2KL8A 1VJWA 2MKSA 4CO1A 1GOAA 3DMJA 4FYVB 4PZVA 4KH0B 1DRZA 2ATLA 3S41A 4OYWA 1S1VA 1Q5YA 3ILOA 4X4TA 4Q7AA 2Q0UA 4BR5A 4CNZA 3TRGA 2ZEJA 3GWCA 1LNQA 3R7BB 2ACYA 1C1CB 3PIOQ 1RT4A 1MMDA 5CHIA 1REGX 1YDLA 1GAOA 3KMSA 4WIIA 4ATNA 4DR3K 1DEJA 3OYFA 3H40A 3DLBA 3O3GA 3PRBA 3JXOA 4XK8C 2O01C 3HZ6A 4HTLA 4BS2A 1JNZB 3AH6A 3EVOA 4ZVPB 1T9VA 1IH7A 3CJRA 4OX8A 4DV4K 1ITPA 1BO5O 1R31A 1Q8IA 4RLEA 4DQPA 1K9MT 4H5RA 1UP1A 3D54A 3MMJA 3W63A 3FZMA 3NF9A 3QFPA 5H9EK 3PNIA 4P6QA 1TYQA 4F8RA 2GO8A 4RNMA 4KV8B 3IDHA 3TA0A 3PY8A 3GIKA 1DY3A 1CEZA 1B92A 3NE6A 1KLMB 2O4IA 1HQEA 4XH5A 3FFIB 1Y3KA 2W7PA 2HQIA 1OKJA 4JI3J 1VQ4S 2UXBJ 2O8DA 1EQ0A 5HLFA 1NJXA 4ENOA 3ZSOA 3QNWB 2GUIA 3DI6A 4NLWA 4KJIA 2OKQA 2WK4A 4JHDB 5AQYA 1X5PA 3N9UC 3TP2A 2ZHAA 1XHXA 3NF6A 3MR2A 3EGWB 3TVYA 5HRSA 4M41A 5KFKA 2ZBRA 4Q2MA 3DXMB 2OZMA 3K9JA 2ZWHA 4U67Q 2BTFA 3FGVA 1IG8A 3G8SA 4V19S 3D3CJ 4X4UA 3CMEN 2OTJN 4NLGA 4NEZA 2HS3A 3SAFA 4JKFA 5IV4A 3DU6A 4CF0A 4WP3A 4WK3A 4OYIA 1H38A 3MMCA 1CS4A 3GONA 5M2PA 5SWMA 3PW0A 3K17A 3ZTQA 3V4IB 1HYZA 2HFOA 1FVSA 1Y4ZB 4X4OA 1YTYA 2WB1D 3O80A 5C2FA 1ASVA 3KLGB 4OHXA 1VJQA 3THPA 2GV1A 1FESA 1F9FA 4DQQA 3EZ5A 3PSIA 3KFWX 1NM2A 2VF3A 4BE1A 4ZIVA 2VQEJ 3IRXB 1IR1A 4M5NA 4CEDA 3CG7A 2HBZB 3GZ7A 4F9OA 1ZBFA 1XMQF 1X60A 2HVZA 3JTOA 1AT1B 3MECA 1Q8KA 2QLFB 5F0WA 3U6FA 4NLPA 4E3SA 2R7UA 3A2FA 1P8GA 1IBKJ 5JUMA 1OY9A 5IT9Y 4FF1A 5KG1A 3NH1A 4NB4A 1T3OA 4RUAA 3SSQA 2ZNYA 1L3KA 2E1MC 2CNKB 1HHSA 2YKQA 3N6MA 4HHUA 2V2KA 2P1JA 1VBYA 1F3VA 2BV3A 2MKKA 4ZP7A 1JJHA 2RAQA 1IR0A 1U1QA 3C66A 1RAAB 2WB4A 4LRBA 3L3UA 3THXA 4PR6A 4PKDB 3L2UA 2AKWB 1HNVB 5F9NA 2QEXN 4ED6A 2CJKA 1OPIA 4QW9A 2ZJRL 1WC3A 5J2QA 3KG4A 4GC7A 2B43A 3ZNJ1 2O1PA 2MKIA 3VAGA 1TL3A 4F3MA 2P2CB 4YDXA 5J2PB 2XMTA 4Q45A 2KG0A 3C15A 1GFWB 3SJJA 2FDNA 2HQGA 3G96A 2MQQA 2H1YA 2OCEA 1FFWB 1LEOA 4J8FA 1RTJB 1UW9A 3GSIA 3EM1A 1Q8BA 2YPYA 3MAHA 4DV6F 4OGEA 2MY7A 1WI6A 2D3ZA 1S79A 1NGBA 3ZSZA 3ULEB 3RYLA 3RBDA 5LJ5Y 4E19A 4C3MA 3HT3A 4KH4A 4FVMA 3HTVA 3C6AA 4JKGA 3R5AA 2QL5B 1V5VA 4LF1A 3TVZA 2GMJA 3CCTA 1H3DA 4B02A 1M5PC 2GHWA 1QAXA 3EPIA 3ZSYA 3RRKA 5BR8F 4LC9B 4J9KA 2FY8A 5LSOA 3L2WA 2KXFA 1EX8A 2UVRA 4DZDA 1LOUA 3DYAB 3RZAA 3J80Y 4DV3J 4ED1A 1RA7A 3DI6B 3DOKB 2FBXA 1HPZA 3T3FA 5AQMA 1Q82T 1IKXA 3FSYA 3LALA 4KAZA 1NEEA 4OHZA 1RTZA 2HQDA 4CK3A 1U1OA 1AUSL 4C4WA 3JS6A 3D0HE 4YMEA 3VPZA 4EYHB 4P9SA 4PG6A 2FF6A 3PCOB 1H6KX 4J2EA 4OJ3A 4KHQA 3OYKA 3W60A 2J8SA 2M88A 4CTAB 5EXWA 3TARA 2GS8A 1MDUB 3J81O 3UD5A 1RTIA 4M5JA 5DETA 2MHEA 1W0HA 4DCOB 3OBYA 3NY0A 2FC8A 2H5EA 5KI6A 4M95A 4DQRA 2KG1A 5LM7E 2BEFA 3CJKA 1SPBP 3RMDA 2JFDA 4I68A 3ADAC 4M5LA 4DPWA 3K0SA 5EHHA 4LFCJ 5AE3A 3VGMA 1VAZA 3LDPA 2YQ1A 2K2PA 3BF3A 2IBKA 4WQ5C 1YJRA 7FDRA 3NP5A 1EKEA 4JI8F 4MIBA 4TYBA 2V8PA 5IQQA 3ENWA 2KRBA 3DCAA 4QYRA 1Q0NA 3L6QA 3D6TB 1BQNB 5G4DA 3O9QA 4YDUA 2WUSA 2NXJA 3RMBA 4M63C 1RDBA 4MKVA 5A0YB 1O6XA 4NE9C 2XLIA 3DMJB 2BJ8A 2MQOA 5ETKA 4KTZA 1NHUA 4WQ4A 1NGHA 4M94A 1VK8A 2ZDOA 4UOGA 5JLFA 5K20B 3SZ2A 4F3OA 3G6XA 3KK2B 1EWRA 2CH5A 2HMPA 3JAMO 4DSIA 1HHTP 4CZCA 2AEMA 1OO0B 4CGFA 5HL7Q 4M3UA 1N5VA 4LF5J 2DNRA 1XERA 1JJCB 3MDFA 2XHWA 5LMNF 1HBMA 2HF3A 4BR0A 4K8ZA 3SQ1A 1NUEA 1PC5A 1JIHA 4ZPCA 2OANA 3AO4A 3KLIA 4OJGA 4ILGB 5DQHA 2CJQA 1RWXB 4FJNA 4AT1B 2P9UA 1RT6A 2CZ9A 2G8FA 3PRVA 3ENQA 5D4PA 4DI6A 1WUUA 4C1NK 4CO2A 4CH0S 2RQCA 1T9WA 4L6V3 2QJ3A 3ZZPA 3WC2A 3TR8A 2UUCK 2DCUB 4Z4FA 1GX6A 2J9DA 5EWGA 2ZUGA 2MQ8A 5J2NB 2JGUA 2E5LF 3QDKA 4JI6K 3AVNA 3W62A 4NPOA 4B3MK 5AE1A 2M52A 1UZHA 4QR2A 2DNGA 2GGPA 3SDEA 4I6YA 5AQSA 3QIDA 4IO8A 4IFYA 5AZIA 4N5SA 1S9GB 1WC4A 4KHWA 4WFYA 4WXOA 4EO8A 2M8DB 2WBMA 1KBRA 1T6CA 2BKOA 3QO9A 4DUZF 3OTBA 2W7OA 2V68A 1TMMA 5F0UA 3VAFA 3O9SA 4YOTA 2RQMA 2R2RA 4DTXA 4P2XA 4JKCA 3THWB 2LQ9A 3G71N 4FZXC 4P7VA 2LXIA 4W4MA 4CJRA 4IKFA 3DOMB 2YJFA 3DYAA 3CJ5A 3QRQA 5M1QA 2O8EA 2Z1JA 1C1BA 3EN9A 1U0HA 1V4TA 2MZ1A 1S0MA 2D3O1 1LXNA 3M6WA 2W6LA 5KQ8A 3NG8A 3FC9A 4YEAA 4UOFA 2QA4G 2HHSA 4OYPA 1MU2B 1RWOB 2O4GA 2FHOB 2HWTA 3OVSA 4X62F 2GVZA 2RDDA 4IEIA 1HLWA 1R0BG 1U8WA 5E3RA 4UTGA 4ED4A 3QETA 4OYOA 5B0DA 2WAQD 4TQSA 1V4SA 2J0QD 2CQHA 2KI2A 4YOEA 1PGZA 4X65F 4FJ7A 4RG8A 1E6YB 5KFOA 3UIQA 4ELVA 4CJEA 2B8QA 2AF6A 1X9WA 5HJXA 3ATVA 3DOKA 4EBCA 4JV5K 2B51A 1NZ8A 5CYMB 3HHLA 1LWXA 2WONA 4W5TA 3RB6A 3RAQA 3R5CA 1VFJA 3I6PA 4OI3A 4MKBA 2PY5A 3ET6B 1NMNA 3ITHB 4CHYA 1HNIB 5KT2A 2ZJQQ 3DLJA 2CKWA 2KW4A 3ENOA 1Y5LB 1UPMB 4K0KJ 3CNQP 3C6UA 4LF2A 2W9CB 2CPYA 2HURA 2Y9HA 2IA0A 4TKTA 3KYLA 4LF4K 3IR6B 1DTQA 1YG0A 1KN6A 3O8MA 4CLTA 2FJXA 4TVAB 1N36J 4HH0A 1EETB 2QL7B 3C15B 1F1BB 2G1HA 4K42A 3FJ2A 3OS1A 3VQQA 3MEDA 2EG1A 3GFHA 3V1QA 4DX6A 1KRPA 1UEKA 4OI0A 3OTCA 1YVUA 4FOEA 3V6DA 4MFBB 4LQ3A 2CQPA 5H1SV 3DOLA 4NLTA 2E9RX 4CJWA 2QM1A 1RAOA 1IKWB 4H0YB 1Y10A 2OJ3A 2CVIA 1QHTA 3MR3A 5B0EA 1NJIT 2V2QA 3N0VA 3WEEB 3O8WA 1ZA1B 2IVOA 2IDOA 5A8WA 4ELUA 1IM4A 2HNYA 4K4UA 1RDCA 4WKYA 9RUBA 4BRIA 3R27A 5E33A 3LO3A 5AJ3J 2H51B 4G1IA 3CXCM 5J1PA 1YBTA 2CNLB 1ATNA 3C8YA 1BU6O 2VJUA 1W2BR 2HLTA 2ILZA 3MXJA 1UMJA 3DWLA 5AXKA 2IVPA 2UUTA 2V0NA 5AQHA 5LT5A 3NAHA 3L4BC 2QFIA 3IRWP 1HI0P 3FZKA 2KYZA 4YORA 4KFBA 4ZPBA 2VWJA 1QQMA 2OPRB 4O8KA 1HMVB 2E7VA 2K7KA 4Z2XA 1K1QA 3P1GA 1N6QA 3OLAA 2G8KA 3IAM9 4J9UE 1LFWA 1YITN 2QWOA 1U0SA 5C42B 4OJRA 2JL9A 3R9LA 3CCEN 5J1EA 2RNEA 4B1XB 4I7FA 2CQBA 1TAQA 4R25A 4QPTA 4K4XA 4ETZA 2UXBF 1C0TA 4GVEA 1RBSA 1V5IB 2Q1LA 4Q8FA 4AQYK 2J7KA 2KT5A 3R6LB 3QB0A 2QX0A 1VC0A 3W66A 3VGTA 2HK3A 1EARA 2DR8A 2XLJA 1I94J 1KFDA 3G8QA 3VEVA 3VGVA 3Q23A 3CC2N 2YNGA 1NU4A 1S6UA 2ABYA 1FA0A 4DR2J 2DHHA 1PYOB 3M8WA 4USUA 1ZH5A 3E8OA 2DPIA 2G0IA 5GAGP 4AQYF 4Z4HA 3LP1A 3ZZZA 4H4OB 1F21A 1D5AA 3O3HA 3EGNA 2DNHA 4QW8A 1OH5A 3PVXA 1OSDA 3B4DA 2DR7A 3OJSA 2F65A 3IM8A 1BLUA 1HBOB 2YHYA 1WNEA 4OKJA 2G4BA 3TTFA 4PA1A 1N48A 2OH2A 4PYDA 3WDOA 3PJXA 4L3KA 3G10A 5KFJA 3A8YA 3QGHA 2UU9J 1Q86O 5LXYA 1HPMA 3ZX3A 4B1VA 1MMLA 1ZBUA 4DWIA 1KC8O 5B0FA 3FFIA 3MOJB 2MLXA 4BROA 3MUTP 1DT9A 4XO0A 3ZYYX 4CT8A 3H2UB 4Y34A 1NOYA 3C16A 2LDIA 4BWMA 1ZBLA 3V4MA 2LFVA 2D9PA 1PC4A 4JKDA 5F2RA 1WTBA 3A0IX 4CVNE 5GAGI 1JLAB 3WBZA 2E7WA 4URQU 2HBKA 1TUWA 4DV4F 2KFNA 4IBNA 1RCOB 3VVUA 3TZYA 5FRMA 5KFWA 1URRA 1JLBA 4LH4A 1HW9A 4H4KC 1M1KT 3TO8A 2LP4A 1TUYA 1H74A 4JKBA 3TABA 2QRRA 3MPYA 2NYIA 4DJBA 1FF2A 1YJTA 1KQSM 2X1GA 2VQFK 4JI3F 2GW8A 3SQ4A 2CWKA 2DNQA 3AD8C 3HSCA 4FJKA 2UXDF 1V9OA 2ASJA 3FZLA 1WOOA 2DVIA 2W01A 2HZVA 2FHMA 2QI2A 2HB5A 1VIOA 4LFAK 1S1VB 1JCGA 3L7PA 1VSFA 3ET6A 4BRPA 3VAJA 3QAUA 1WELA 2XZDB 2OD6A 4RO0A 4AL7A 3QEWA 3O5TB 2DR5A 3J80U 5JVHQ 4C0OC 1WEZA 2N7YA 4ZVOB 1BI4A 3OW2R 2MZSA 2RE2A 3RU0A 2ITGA 2FLPA 4KR0B 2WW8A 1OYEA 4BC9A 4Y0WA 1TUVA 4W5QA 1Q82O 1N5SA 1S12A 1IV0A 4DOZA 1N34K 3CJ4A 4WK1A 4DEZA 4OPAA 2HBMA 4OL8A 4LSLB 1ZC6A 5F8JA 1U48A 5KFVA 2DHAA 2GVZB 3QAEA 3F5TA 3VAKA 5AFUA 3QIOA 2CA9A 3H20A 3R2DJ 3TQ1A 2QLBB 2ZH4A 3ILLA 4KPCA 3W2WA 1RYSA 3CD6N 2BQUA 4H4MA 5KG0A 3GTYX 3QSIA 3SQOP 3M5RA 3T5HA 4M3ZA 4JI3K 2C28A 3UKRA 5GIPA 1ATRA 3P39A 4B8CA 4I64A 1MW7A 3M6XA 3MEEB 1VHXA 4EP4A 4YHHJ 4NXMF 3H3NO 5AQGA 3GE9A 2IC3A 3MWTA 5C25B 3IKMA 3NGUA 4IR1A 3N6LA 2YKNB 4CBWA 1WG5A 4F4KA 1BWVA 3NCPA 3NBPA 4USHA 4DX7A 1B7YB 3NAIA 4HVJA 2ZBIA 1RCHA 1UAXA 3CC4S 1ASUA 4X64J 1KTQA 1GLEG 3RVCA 4CBXA 1WI8A 4C11B 3F9KA 2B5JB 3DRYA 4ES2A 4CE9A 3OUYB 1X7VA 5IC6B 3H90A 4W90B 3DHWC 2E2PA 4CEFA 5KOWA 2GJ2A 1CJTA 3SMZA 3LPEA 1X5OA 4HTIA 2R7QA 2M7SA 4B3RJ 5KGWA 3AD7C 4DQIA 4W98A 1UTAA 4LF7F 4URSA 3FCWA 3LP2A 4NA3A 2DFEA 3HBTA 2OFHX 3ZETA 2CJBA 1JXLA 3FEYB 3WIVA 2N3OA 2VPZB 2IVMA 5AT1B 1WAFA 4PXBA 4BLGA 4H0TB 2Q3PA 3KJNB 1NK0A 4IH7A 2OHDA 5FIIA 1D8YA 3TZZA 3US5A 1FK9A 2D1CA 2CIMA 4M63A 2ADCA 2Q31A 3OHRA 1H2VZ 4P73A 4I56A 2R7YA 1LCUA 2LDYA 3S8SA 5KQDA 3PJWA 3VGKA 4NCGB 1Y9OA 3QJLA 1FJCA 3HSZA 5JVGQ 1R7IA 2FTRA 3MX2A 2XQCA 4C48A 4ZPDA 1L3SA 3M8PA 1U45A 5EGYA 5DM7Q 1I94F 4ZVTB 2APOA 2CGKA 1L5UA 4EU0A 1IJJA 2LEPA 3IN5A 3B78A 1MWMA 1VQ7S 2AZ1A 4MIWA 4IFEA 3DDNA 2CNNB 1IBMJ 4K4SA 5KFQA 3HVRA 3ILIA 1HI8A 5AQPA 2ZFHA 1BUXA 4KTWA 5KPTA 3VA3A 2V4JB 2RMLA 2EG2A 2HHWA 3I8BA 2R8KA 3MWBA 2VQEK 2CZVC 2X1AA 1HQUB 3MHYA 3MM7B 1S5ZA 4MT1A 1VQON 4DX8H 3I9ZA 2HSTA 1TKTB 1GNKA 2E2OA 4BRLA 4CGJA 3MM6B 1JLEA 1TQLA 5KG3A 3O4NA 2E5LK 2WBRA 4HL9A 4URGA 1J54A 5CA5A 2XHCA 4ZP8A 5C42A 1TR0A 2P9KB 1M1GA 2K06A 3A3NB 1QAYA 2YHXA 2KTQA 2R7TA 3IBCB 3WQTA 2PIIA 1M0SA 2MXYA 4JS4A 4JP8A 3DRSA 2FVCA 2Y8WA 1FERA 1M90O 4QIWD 3MM9B 5HQ8A 3UCUP 2CG8A 1SZ2A 2ZWOA 3R5BA 3IO1A 4M7YA 3GYNA 3TEGA 1WDDA 4LF6F 3I33A 4Q5VA 4OLPA 5AQJA 2O8CB 4N8NA 2BGGA 2NPFA 4OJHA 2Q3SA 3KHLA 4DV0J 4PL7A 3E9OA 2UXDK 3Q22A 4MJKA 5E3AA 1FRIA 2HNZB 2BZ2A 2G2ZA 4FWQA 1NZAA 4TQRA 4FJJA 3DXSX 3CF5Q 4O0NA 2K3KA 2D9OA 3U4LA 1TKTA 1IBKK 1NGJA 4L3NA 2XWXA 2IM1A 1EJ7L 3HD2A 4CBUA 5IT9O 5AZJA 3M9MB 1BIUA 2OPQA 4K8RA 4CECA 2Z57B 1W2IA 1UOCA 4LFBJ 2XLKA 1CC7A 1G4CA 1TK8A 4DX5A 2FY1A 4JKEA 5KFEA 3BGRB 3V6HA 3NLCA 4DCPB 4Y00A 1Q86T 4I4BA 1A9NB 5EU7A 5AQRA 3CB4A 4YB6A 1S72N 4DV2F 3I0RB 1FE0A 3K2PA 2E9TA 2ROPA 2AP1A 4U6PA 4IZ9A 2FF3B 4FPIA 3GIJA 3T1HK 2RIJA 2N7CA 1U25A 1UW4A 2WRMA 3MM8B 3AJ2A 3B8HA 4H5VA 2GIRA 4DSLA 3JSBA 5KFSA 4PPZA 4FJXA 5E5NA 5HLFB 1X4HA 4YOWA 2HIYA 4FWSA 2C3UA 2RRNA 1SQGA 4DR1F 5BRDA 3ZC4A 3WXKA 1IWAA 2ZH1A 1JLGB 3P5TL 2EXUA 3HK2A 3AVJA 1MU2A 1ZTWA 4UY8O 5GAHU 3VQCA 3KOAA 4RW7A 1QLNA 2MQPA 5CYJA 3UFCX 3CCMN 1O8BA 4K5RA 4YR0A 2KU7A 2PAVA 2UU9K 4O0IA 1NSAA 2XHBA 4FLUA 3IXQA 1LWFA 3TUZC 4DR4F 1G1XA 1GMWA 4R5PB 2ZE2B 5J1NA 4HUGA 3ZT4A 1WSIA 5F8HA 2YX6A 1HA1A 4ICLA 3MWPA 2XZWA 3E01B 2LSNA 1X9SA 2ZVIA 3RB0A 3D6RA 4JK8A 5C0YA 1RAGB 3D2EB 2W8LA 3IFEA 3UNGC 4FK2A 3K5PA 1S0OA 3LZIA 3I55S 2R8GA 2RD5C 1P9YA 1N54B 2NLXA 4ECWA 2CAJA 2BJEA 4NI2B 4KB0A 1ZXOA 4J9NA 4BVPA 3U9ZA 2CDQA 3PV8A 3OYEA 4LFBK 1VSIA 4ZN3A 3BSNA 5BREA 1KLNA 5AQXA 4CW7B 3L3VA 2GGPB 3SDEB 2P6SA 4PYAA 4GRSA 2DR6A 4WYBA 4A2BA 1U1RA 4ES3A 2GUPA 1KXPA 3KK2A 2PEHA 1Q79A 2B56A 5F8IA 4NXNF 1V3RA 5J2NA 2DCLA 5B0AA 1EB0A 5K8OA 4B3MJ 2VPWB 1QY7A 4JI6J 1X4GA 3F73A 3TR5A 2EFPA 3ZXWA 4FWOA 1UETA 5T14A 3D2FB 2C2KB 4F4YA 2A1SA 1VQKS 5ETOA 4F26A 3V9ZA 3MN9A 3DDKA 4HI1A 4QU6A 1VQPN 1HBUA 3PO5A 4WYWA 1LV5A 2HW3A 5E3CA 2DGUA 4C8LA 2KRRA 2YKAA 1KR4A 4CFAA 3KG0A 1HNXJ 2E1ZA 5THWA 3PLAA 4KO0B 3R9PA 5AR0A 2B9YA 3R3LA 1CZ9A 4U95A 3KHHA 1KNZA 5JVGL 2ZH3A 1HUXA 4FWPA 3T5LA 3MAQA 2ACMA 5HK4A 5HL7L 4QQBA 3QGIA 2JVOA 2LXUA 2IOCA 2XSFA 4K50A 3QZ7A 3CJKB 3AO3A 1J5EF 5EY4A 4C8OA 3DLLL 3HD1A 2VQEF 4JKHA 3AY0A 2P9IB 3BN4A 2RUGA 4RW8B 5FDLB 4NOHA 4RW8A 1CPZA 1UEUA 4QPXA 5KFBA 3CCRS 4CO0A 3OUYA 2UYTA 1S4FA 2F3JA 5KT3A 4CWBA 1NSPA 1OJ4A 2QLWA 1UWBB 4K4YA 4OYZA 4QWCA 2QL9B 4CO5A 2QKBA 1OQ3A 3QWPA 2E1AA 4M5GA 2B6AB 1TVRA 1J5EK 4TY8A 1UA0A 4KY3A 3VHQA 1WF1A 3CJAA 2V67A 4QWBA 5JXSA 4BQLA 4ZVRB 4NL5A 1HPZB 4DTOA 3R7SB 4K0KF 3EUNA 4CFCA 3ZFVA 1J5EJ 1JLBB 3QEPA 1DFDA 3RG6A 2P9PB 1RHRB 1JLQB 4KC5A 3EO3A 1TL7A 2PO4A 2MKCA 5C24A 1WHVA 1SL2A 5CQGA 2EK1A 1VQ5S 3VENA 2R7OA 3VQPA 4Y65A 5A0YA 4YR2A 1T95A 2VB6A 4JKGB 1SC6A 3CE8A 5ETVA 1J9AA 1N52B 2YWEA 8AT1B 2DO0A 4KHYA 1W26A 3BQ0A 1NGGA 1HRHA 4FOIA 3HT0A 2ASDA 4USIA 5I3UB 1R8BA 4FN5A 3AOBA 3GV7B 5K14A 1A7GE 1VGYA 1XK8A 1A5XA 4MK8A 2PBDA 3R8EA 2RHSB 1CZAN 5DLGA 4ECQA 2OAUA 4BRQA 3QLHA 2I5JA 2D0CA 2P9SA 1CJUB 2RT3A 4QCLA 4I2PB 3PYDA 3J7AP 1R89A 4KTQA 3PW2A 3FBBA 4RBUA 5ETLA 1QHAA 3R5GA 4BR2A 2FJWA 4B3SJ 1UZDA 3OSPA 3PFEA 4RW6B 6FD1A 2X6SA 2IFXA 4K43A 2ZQBA 1K73T 3R1LA 2HGLA 3LAKA 2R7WA 1X3MA 4KREA 2NZCA 1CSJA 3Q0AA 3O08A 4OLOA 5GVQA 1HR0J 4UQGA 2PSZA 1JXBA 2WZ1A 2QWLA 2FGOA 2G2OA 1NO8A 1FEHA 4R0JA 4NRUA 3HFKA 3P31A 4GY2B 1JLFB 3CI5A 4RU2A 1Y7PA 4BRGA 2HKEA 5ETPA 3NGZA 3AVBA 3BN7A 3O6QA 3T5KA 3GBTA 3OTOK 1Q7LB 2JDJA 2VJVA 3QSYB 4CIGA 5HRRA 5ADXA 2QSWA 5KG4A 4UT4A 3BH7B 4OKEA 3NMUA 5AFUH 1DGKN 3GPAA 1IM6A 3C6TB 3BO3A 4CYUB 3FMBA 4G1QA 2GA7A 4NZ6A 2K7JA 2WHOA 3GG4A 4CT9A 4BRDA 2EVZA 4I0WA 2HHHJ 1VQ5N 2K1RB 2VICA 4CK1A 1BHLA 1H7XA 3KHGA 1R6YA 4ILJA 2RHQB 1U1NA 5A8WB 1NB2A 2ERRA 2XMMA 3SMSA 1RLCL 1ZZFA 2QXFA 3NDKA 2A1BA 3DLKA 3CDAA 2KM8C 4RNNA 3HM8A 3J7YP 1AROP 4KGXB 5HJYA 3CT9A 4N41A 1NG9A 4KHPJ 1FO1A 4FZVA 2O3DA 1B0VA 5CZ2A 2AX0A 2MGZA 2P9LA 4B3OB 3N28A 4ITSA 2YKPA 2QWRA 3JYTA 5I3UA 4BC5A 3VGLA 1KHWA 2DGOA 3GIMA 1V6HA 4BRHA 5G0RA 3OBIA 4K8XA 3I4HX 4HACB 1CJVB 4A5AA 1FWPA 5AQQA 2E6MA 4EHTA 3HI0A 1TK0A 4LF7J 4I2PA 2ZKUA 3DGPA 4DR6K 3BYPA 4OLBA 3HSDA 5A6PA 3CO0P 3C6UB 1EKSA 3FKBA 1R0AB 4WP8A 3N79A 4ED7A 4O23A 1NKCA 1XUPO 1AZSB 2FSKA 2WONB 2DBBA 2H65B 2PMHA 4DL0C 3CCJS 1QZ6A 4MMOA 4AQYJ 4HHJA 2M70A 5EX3A 3A8KA 1IBLK 2YXLA 1AUDA 1JLEB 3T5JA 4ECZA 3VAMA 4CH1A 4RW4B 4FLVA 1YRTA 3W8PA 4KRFA 2ATCB 1RHUB 4EYIB 3BDPA 4LT6A 1YHQN 4WZMA 5ETQA 2EBEA 1U1KA 4FSVA 3IAS9 2ROGA 2HWHA 5LJWA 4FF2A 2B4VA 3VEWA 2I5JB 4ZTJA 3BKFA 2J6SA 4JLHA 5A76A 4CJSA 2DFFA 4CK2A 4KRWA 4KE5A 5SZTA 1DLOB 4MFBA 1SIZA 4NO7A 3RUBL 1RT4B 3PKMA 1S1XB 2QA4S 2J7UA 1B64A 4BC7A 4A8QA 2QO3A 1FKOB 2G2YA 2RQKA 2XULA 2QC3A 3AB2B 3CCSN 1TP7A 1BE4A 4Y2AA 4IFYB 3H42A 3OV7A 2K3IA 5LL6Z 2WBNA 5DRKA 2GC8A 3JXUA 4WTYA 2BE2B 2KXHA 1T8EA 2FZGB 3NAEA 1WNSA 1YJUA 3W5XA 2KHOA 3PX4A 1JXEA 4Z7YA 2G8UA 3BQ1A 3NFAA 4J9RA 2Q79A 4DU7A 1S1WA 1PJ5A 4ZVSB 2ZJPL 3AOAA 3PTWA 3CC7S 4RNOA 1KQKA 4JI2K 3D66A 1OSCA 4CLYA 2OUGA 1QUVA 4QZVB 1BI4B 4BVOA 3VQBA 3C19A 2OO4A 4Z4CA 1RT3B 1VHIA 3PR5B 5KT6A 4NA2A 3EEQA 2VG5A 5GINA 5K5MA 3CFPA 1ZOTA 2A6MA 2H5JB 3BZQA 4LF9K 1YRUA 2ZBPA 2AW0A 4OX9K 2RU3A 2NRWA 2HHQA 3OD2A 3CUNA 3SUNA 1RT2A 5KFNA 3IR7B 2CGJA 2X7IA 1TL4A 5FPEA 1NK6A 3MURP 2VYPA 3H5SA 4ZS6A 2Q97A 1GLBG 2PZSA 5FPMA 4LF9J 3SFUA 4J9MA 5BR8K 3THTA 2AJ1A 2R3VA 1VBZA 2DNYA 4CZMA 4ILLA 2GWJA 3Q2SC 4IJNA 4K0KK 1EHWA 1YSJA 1P27B 3CJ0A 2NUHA 3I87A 2ZC4A 2QG9B 1AXQA 1FRJA 4MQ3A 1HHQA 2YKNA 2W9BB 3CCQN 4IYQA 1XNRK 3C0BA 1P1TA 2IYGA 1OS5A 1YQHA 2PYLA 1NB7A 2VFTA 2FB0A 4IKAA 1K8AT 3CD5A 3TAGA 3H98A 3MEGA 3AA9A 3C14A 2DNOA 4USKA 3MCSA 2J6TA 5GAHI 4DV4J 3MGJA 3RSEB 1S22A 4FK0A 3M2RB 2FZCB 1FXLA 2O66A 2M5YA 5T7LB 3F41A 3ZSWA 4QWDA 4YFUA 2QEXS 2WVCA 2E8AA 3HJFA 1GLAG 4PQUA 4EWTA 4EP5A 4AH9A 2PN6A 3CJ8A 4J37A 1WKKA 1VRTA 3ZX0A 5KFTA 5IXUA 2ZE2A 2XMUA 1DBDA 4UW2A 1RT3A 4CGHA 3AO1A 4JD2A 3W9HA 3W1YC 3PRDA 2ZZTA 5LMUJ 5IOLA 1RT7B 2CJYB 1S9EA 2ZGYA 3J7YU 3CCUN 1C0UA 2ZBCA 4J2BA 4BHQA 2BM1A 2DXEA 1SV5B 2XI2A 2MKYA 1JJ2R 4X2BA 3QZ8A 1GT8A 4Y1CA 4M5HA 5DM6L 1WAJA 1HIYA 2I0XA 3JSMA 3FBCA 3H8YA 4K4VA 2HAIA 3R2CJ 1HNWK 4P7TA 4ZVFA 4CLSA 2P5GA 1CJVA 3CJ2A 3K8WA 3GOIA 4C3KA 4A61A 5D4NA 2GX8A 3M30B 4ZP6A 2B0GA 2JVRA 4DSKA 1HKAA 3EWGA 1FX4A 3VETA 2YNGB 2BQRA 5LMUK 3AAWB 2YH1A 3QNOA 1DLOA 2QMXA 2IMOA 3R6GB 3N5BA 1VQOS 5J1EB 1RT5A 3DLRA 1GX5A 5IM0A 3AODA 4AYBD 1CVJA 4AF1A 1FDAA 3IMXA 4ZJLA 4LF4F 2KT2A 5B0BA 3O1BA 2YBVA 2WTUA 3RMAA 3CTRA 3LA0A 4IOAL 1VLOA 2RRBA 4HR2A 3SFGA 1NBEB 3W5ZA 1WSRA 3FMWA 2O67A 1JXVA 4IG3A 2D0BA 1NK7A 2K1RA 4BE0A 3UDVA 2XYGB 3KDNA 3NVKA 4JI2F 1VQ7N 2ZWPA 3M6VA 4ZHRB 4B8AB 4GKKJ 4DR2K 3EZOA 3Q86A 3RAMA 1QAIA 1YUWA 1A6LA 2VG7B 4MK7A 4O3RA 4WU2A 4B3SK 2D0AA 4CJ4A 2LQ8A 4CERA 3D0IE 4C8KA 4CJ7A 1KVCA 3NGIA 4FJGA 4AHTA 4CZFA 4WU3A 1WSEA 3A5NC 1RWNB 3U3YA 1N8RT 3OYGA 2XSJA 2CADA 1S1UA 1VQ4N 3BZKA 4DR6F 3SBTA 1QD1A 3MM7A 2NCKL 3NS7B 3OHAA 3WNGA 2ASYA 2DGTA 3WC0A 4JV5J 1R43A 1X4EA 5GAHP 4XH4A 1KTVA 3D3BJ 1S59A 2MMYA 4ZA1A 3U27A 2W8KA 3BO2A 2PC6A 2QIFA 5H9FJ 2RQ4A 3MPUB 5HRPA 5KPRA 3W7BA 3P83D 2JH3A 3D68A 3IS9B 1YJNN 3RRHA 1P6TA 1RAJA 2P9EA 3VQTA 5F1XA 1F9HA 4FLXA 5DO2A 2E9ZA 3MEDB 1NSKL 4IO1A 1X9MA 2VKRA 1M5KC 1ZBSA 2ZUAA 3OL7A 5J2MB 1FNOA 2BKNA 3FK4A 4X66F 4EFHA 1KAZA 4DS4A 1MWZA 2C2NA 3JSMB 1VIXA 4OJ1A 5FD1A 5AXMA 2VODA 4U7UK 3PIOL 4YS2A 1GQEA 2V4JA 3HHEA 4FPBA 4LH5A 3X1LB 4ZPVR 1QUPA 3W0LA 3M2UA 4PRFA 2W9CA 1J5OB 2P9CA 5B0GA 2XS5A 4FWMA 5HN0A 1S1UB 4M7XA 5DS7A 2YQ0A 3MI7X 2C2RA 5EUHA 3S6EA 1RBRA 1S7IA 2YWWA 1RP5A 2ZC3A 5CZXA 4E7IA 1T94A 3ZNUA 5HROB 3CMAS 4CF8A 2DJWA 1U49A 3NL0A 3GG0A 3VCDA 3D2WA 4B9MA 4F04B 3MM6A 1GMVA 4OZJA 2POKA 4Y0FA 1ELOA 3VQ5A 4DMZA 1JJ4A 1MROB 3PFOA 2X1BA 2ZZMA 1HARA 2MPUA 2RE1A 2DHSA 1VS3A 1I1GA 2MZJA 2Q6CA 2VWKA 3WQUA 2ZH2A 2JWLA 3OW2M 4F25A 2WVDA 4DFPA 1Y5IB 4FWLA 2WSCC 2E2QA 2X3DA 4CJPA 2ADBA 4MLEA 3CPWM 2HZCA 5HVHA 5CH7B 4RPFA 4PABA 1J27A 3NKYA 4CJ5A 3TWHA 2CFXA 4LQ9A 3H46O 1SKUB 3KUEA 4F36A 3NGSA 4CO3A 3ASMA 2DITA 1G2EA 1FXDA 5KFYA 2QTWA 1WC0A 3P4UB 4I6WA 7FD1A 4H4MB 3GCWP 1XNQK 5I4MA 1LFPA 4QS9A 4PUOA 2IDLA 3KXDA 4BDZA 3Q8SB 2M4MA 4V19X 2F7TA 3M8RA 1C0GA 3JQMA 3OYNA 1XMOF 3PR4A 4CGDA 2ZJQL 4FM1A 4OI1A 2HGNA 3QO9B 5IM0B 2XRIA 1S1TB 1FDBA 5KFCA 1VSDA 3ELHA 4RNHA 5JJBA 2ZM6K 1GLFO 4NLOA 3GYGA 2FUG9 2EC0A 1HNIA 2CPZA 4IXCA 2BANB 3TAMA 1ROFA 1WJ9A 4B9QA 5F8NA 1IWGA 2UVVA 2QZ8A 1SXLA 2JSXA 4O8UA 2A2DA 1XNQJ 5CYMA 5LOQA 4PHTX 1R3NA 1SH2A 3SXLA 5KFZA 2E66A 5B0CA 3UKUA 4BREA 3FSIA 1WG4A 1VMBA 4CJVA 1MWKA 4NMLA 2V7YA 3KLEA 5SUHA 3G8TA 2ZM6J 4JK9A 2YWHA 1F2HA 4NXNK 5DDPC 1B99A 3KWGA 2FVRA 3C6HA 4JN4A 4YN3B 3MN7A 3BKUA 2MYFA 2OPSB 5D0EA 2LLZA 1TUGB 3C46A 5F41A 1NNEA 1UWBA 4R0EA 2LQBA 4WE1B 1QVGR 4RWWA 4XAKA 3RSEA 3GR1A 3H5UA 3E66A 4JRPA 4MKAA 3CIMA 2VBWA 5L9XA 3NNHA 3MR7A 3FRZA 3CCVS 4F67A 1VLYA 4FWKA 4B3RF 1U2FA 1UWAA 3K0JA 2DNMA 2KHDA 2JZ5A 3MOZA 1VRTB 1XMBA 1F2GA 3PYEA 4AUKA 4O55A 1U2RA 2E1CA 3FUYA 4I67A 4BY9C 5KG7A 1NK9A 4S0MA 2E2NA 3Q8QB 1CJTB 5IWAF 3LDLA 5HRNA 3DN9A 3BY5A 5EDWA 3OS0A 5AQOA 2VHGA 3GJRB 1HL6A 1XBWA 1X4BA 2ILYA 4KPYA 2JOQA 3L09A 3HZEA 2Q1NA 2DXFA 2H54B 2O8FB 3TUIC 1TFYA 2H48B 4USTA 4NLUA 3ZEUB 4H0XB 1T0TV 4E7JA 3GJQB 4NEYA 3DXKB 2JLEA 1RJJA 3HHNB 5L8RC 3T1YK 1YITS 4RNFA 2DNKA 5H9EJ 5GMDA 1WLJA 2F4VF 1DQ9A 2C2MB 3OR2B 4IFVB 3GFYA 2WTFA 3KK7A 3MMVA 4GV6A 1GOBA 2W40A 1QQOA 4OHWA 3L4QA 5M1OA 3H59A 5I3QA 2DRAA 1SQEA 3Q8RB 4ECYA 4BC3A 4QJVA 2ETJA 3VESA 2NR0A 3W5YA 3PYFA 3WXIA 2CDRB 3PW4A 4H4KA 4N76A 2XY5A 4LFBF 3GMGA 3NCIA 2JEIA 4PWDA 1YVNA 2DFHA 3OR1B 4IDKB 1YIJN 2FGCA 5LY3A 3DLGB 3M8QA 1RBVA 4WKRA 3SQ2A 4LIWA 3CHWA 3OTEA 4B3TJ 4DL2A 1Q9YA 2IHR1 5MLCV 2IVYA 4MIAA 1TL3B 4OIXA 3O9RA 1RNHA 3MCNA 5HQMA 4IQXA 3FZ2A 2I38A 2R8HA 5DMRA 1C1AA 2BKPA 4F02A 3ZTSA 2RUSA 2DY1A 2G8WA 1PCAA 1LWCA 3AVMA 3OYJA 1WD6A 1UL3A 4ANEA 3WHIA 3E01A 2FZKB 1HWJA 7AT1B 3G6ES 3DFEA 2D41A 1YJ9N 1ATSA 2NRHA 1EO1A 2C3OA 4DDFA 2ZITA 3VZHA 3BREA 2XYPB 4B08A 1KD1O 1UJ4A 1IJEB 1OVYA 4CLKA 1NH7A 2WOMB 2FHJA 2LXFA 3J7ZT 1KSPA 3CC7N 5FPDA 1S10A 5HP1B 6AT1B 4NA1A 1S6PB 5C15A 4F7VA 5BPLA 4H54A 4J90A 1VISA 3G4SN 3CULA 3EE3A 4H0VB 2PMZD 3CDEA 2CXEA 2IBOA 2RB7A 3E3XA 1RAFB 3SUPA 3SCXA 1VQLS 5CD4A 2ZH9A 3M9NB 1IBLF 4CZIA 3UE5A 3WNEA 4DV0K 5J2MA 3TQEA 3U1MA 3KIOA 4XPEA 3IMQJ 1YRXA 3BB5A 1YJWN 5G0RB 3OS2A 4DSJA 1R59O 1LQ9A 4CJKA 3ZT0A 5HMYA 2QA4N 3OFHA 3P4IA 3QERA 2J0XA 2OPQB 4QIVA 2P9LB 4GKJK 4FZZA 3HX9A 4P52A 3JTNA 4WIQA 4KHSA 4X4VA 4PPDA 5KT4A 2DH8A 2F7VA 2BR0A 3LANA 4NLBA 2P6TA 5IFMA 4M5IA 2FSJA 1SKRA 2AJ4A 2BRKA 2OMLA 1P1LA 3DLGA 2Y8YA 1Z2ZA 3K57A 1DQ8A 5FPNA 3TUPA 4IDKA 2D0PA 2EFNA 1RDDA 2HVHA 1HNZF 3GJSB 2IM0A 3BDEA 3DNCA 2G0JA 3Q89A 5GAEP 1KQSR 2AHOB 1NH8A 2QGFB 4PY5A 5AQUA 1U6BA 4WCEQ 1RHQB 1VSJA 3DXMA 4CLWA 3T1HF 4YNQA 4X62K 4CJFA 3JB9k 1HQEB 2Q2RA 4B9VA 2J0SD 2J0WA 4NYZA 3CC2S 2AEJA 2IAJA 4ZLNA 1HBNB 1WBDA 1SI9A 3KDOA 1QTNB 3VQSA 4LRFA 1U2VA 1FFGB 1XMOK 1DURA 1RILA 2VC1A 3DLEB 3J7AN 3WXMB 2BM0A 1VYAA 4LF6J 4MYTA 5AQVA 1WC5A 4EGLA 4MDAA 4WQ4C 2L48A 4P2FA 3J7YI 3KD1E 2A3ZA 4DUZJ 4ECXA 1JWWA 4MTPA 2NSCA 3D67A 1KVJA 1PBUA 1RBAA 1DAXA 2FPHX 4U7UD 5I9EB 2OEJA 5EVZA 3EVWA 2F8HA 2HS4A 1YZ7A 4N8OA 5A2QO 1RT5B 3MEGB 3WNFA 4NLSA 2IS3A 5L9NA 3UDCA 3FFKB 4ECSA 4L75A 2LECA 3M4XA 4DR3F 1K0TA 4X66J 3CQXA 2EFOA 1KDNA 2YX4A 2U2FA 1SCJB 1D4XA 4DR7K 4OI4A 2C2ZB 4OLAA 4ANDA 4TXSA 3CPEA 3LGNA 3W2WB 3OFFA 4JHDA 4NCAA 4XIUA 1YBUA 5BR9A 2CQ2A 3V9WA 4BG8A 3LWMA 3O44A 1QVFM 3H08A 5F8MA 1HWUA 5KFGA 1QSYA 4CEOA 3QJJA 2U1AA 2C2EA 4AHCA 3CCLS 2ZH6A 2LYVA 1QSSA 3LDQA 2JWNA 1HKGA 3CD7A