2YNHA

Hiv-1 reverse transcriptase in complex with inhibitor gsk500
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 164
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynhA05
1D9FA 4I7FB 2BDPA 4KKOA 1C1AA 3BGRB 3L2WA 5T7BA 4FJ7A 4DMNA 1HQUA 3KJVA 4BWMA 4DLGA 4WE1A 3TAMA 3AVAA 1JX4A 4L8RB 2OPRA 4OVLA 4DEZA 1XR6A 4DLEA 4NLOA 1LV5A 1Z4UA 3UR0A 4CF9A 1SH0A 2ATLA 1CZ9A 3DI6B 1BHLA 5CY4A 1VSEA 3CDWA 3DLHA 3H98A 4ZVHA 4HUGA 3GV8B 2DPIA 1S1VB 3QEPA 5KFPA 4JV2A 1NJXA 3F9KA 1IKWB 5FROA 1XHXA 4KV8B 2IJNA 4O3SA 3I0SB 4IH7A 4URSA 4F4KA 1XC9A 4B08A 2FVCA 3NCIA 2FBTA 2JGUA 3FDSA 1VSHA 4Q45A 1IM4A 4LY7A 4K50A 4LSNA 4CJ3A 2HMIB 4KPYA 5I3UA 5KFZA 4NLGA 3NH1A 3WNFA 1LW0B 4M94A 4K4XA 3GILA 3Q8PB 3RB3A 4QWDA 2FVRA 4TY8A 4Q5VA 2ZQBA 3EPIA 1JLGA 5KFMA 4J9NA 3TR8A 3AO5A 3V9ZA 3OS1A 3CQ8A 2D3UA 3BSCA 1YT3A 4FJ9A 3H5SA 5F8GA 1KVAA 4GMJB 4ZHRB 4CHYA 3MEEB 3THVA 3MR3A 4W5TA 2X6NA 1L3SA 4PUOB 4ECTA 2IMWP 2D0BA 2YKMB 4X2BA 1NJYA 4CJUA 3CG7A 4DWIA 2HW3A 3PW4A 3I0RA 4ECWA 4EBEA 1S9EB 4DTNA 1TKTB 3VA3A 3AVHA 1TAUA 4KO0A 4YR3A 4Z4HA 2W8LA 1RT1B 4RW8B 3OLAA 3OYFA 3V6DB 5K14B 1HNIA 1EETA 3SQ4A 3RAQA 1RA6A 3VQPA 4CEAA 2OPPB 2BANB 4DL5A 3CYMA 3ASMA 2HHUA 4DL6A 3RR8A 2HHWA 3TWHA 3RRGA 4DL3A 3GIJA 1UAXA 4FLUA 4CJVA 4WZMA 3GIMA 3UIQA 1S1UA 3TABA 1DTQB 5J2NB 5DGAA 3F73A 2AU0A 3VQQA 3OYLA 2VWKA 3KTQA 1LWEA 1RCHA 2R7YA 4TYAA 4RUCA 3VN5A 2KZZA 4WXOA 5JUMA 1S1WA 3V9SA 1S1TB 5FDLB 4NCAA 4MIAA 1TK5A 3MXJA 2IM0A 3DLKA 4FJGA 2DFEA 3DDKA 1WSEA 4XIUA 2XHBA 3C6UB 2OZSA 5L1IA 3ZT0A 4Q8FA 1RT2A 4IKAA 2RDIA 1KHWA 1GX6A 1KHVA 3OHAA 1REVB 4QW9A 4NLSA 3HKWA 3HVTB 3SUPA 4ZTJA 3GYNA 4CJSA 1JKHB 5HP1A 4BE0A 4DSEA 4PQUB 3N6LA 5KFCA 1J5OA 5KT3A 4RZRA 1WNEA 2OPSA 1VSLA 3KKRA 4Y3CA 3RRHA 3UQSA 4TN2A 1MMLA 3M9MB 4FS2A 1R0AA 3TVKA 1IKVB 4RNOA 2A1RA 5KRTA 1C0UB 1Q8IA 2DY4A 4KE5A 2W9CB 5FRMA 3S3NA 4JV1A 1S48A 3K5LA 3AVMA 4K4ZA 3IAYA 5KFSA 4KI4A 1QSYA 1C0MA 3KHRA 5EDWA 3V1OA 1WAJA 4H54A 1RTIB 3MFHA 2FLLA 5EUHA 4FLZA 4XPEA 4KTWA 1NK6A 4H4MB 4E7IA 4J9MA 4CIGA 3LWMA 4KKOB 4DS4A 3MR5A 1WN7A 2X74A 2DFHA 1JLCA 3QETA 3V6HA 1JXLA 1HQUB 3P5JA 4ECSA 3HPOA 3KJVB 4F2RA 3MFIA 3KIOA 4NLQA 4NCGA 3MECA 3KOAA 4WE1B 3TAMB 4LH4A 4CEFA 2OPRB 3KK1A 4IG3A 4TLRA 3D0PA 1OS5A 3HPHA 2XRIA 3TARA 3K2PA 3NGZA 4DTSA 3TAPA 3VQ4A 4IH6A 4FW1A 3DRRA 5DG7A 2XWYA 2R8IA 5KFYA 4Y1CA 4ICLA 4FJIA 5C42A 4ECVA 1HARA 1MU2A 3RMCA 4Q0BA 1KLNA 4IFVA 4ZPAA 3ZT2A 4B3OA 1WSFA 3LAKA 5KFOA 3EZUA 1RDBA 4U7CA 1IKXA 4CF2A 4NLDA 4B9LA 3SI8A 4TQSA 2ETJA 2O4GA 1JL2A 2QK9A 3VQBA 3RB4A 3IRXA 2FVSA 4E7JA 4CCHA 2GC8A 2R2SA 5KT2A 4EZ9A 3I8DA 1HYSA 3MEDA 4LSNB 3OSPA 4ELTA 3DOLA 2IM2A 5I3UB 4RNMA 5F8HA 2KZMA 5KT5A 3PO5A 5C25A 2IS3A 5J1EA 3QEXA 3LPTA 4TY8B 4O3NA 1JLGB 2FVQA 4M95A 1N48A 2Z1HA 4IDKA 4O4RA 4ZMMA 4W5NA 2Y1JA 2G8IA 2O4IA 3L3VA 2JLEA 3L2RA 1A5VA 1F21A 4DQQA 4E7LA 4C8OA 3T5JA 2PZSA 3I0RB 3AVGA 3IGNA 3TAGA 4M3ZA 4NYZA 1LW2A 4NYNA 2G8VA 3NDKA 2DTUA 1JLBA 4DQSA 5KFWA 5DQIA 4FBTA 1QS4A 2XY7A 5DG8A 4BE2A 4KO0B 4KB7A 1GOBA 4B9TA 2JEIA 3M8QA 3RMDA 1X9SA 3KK3A 3M9OB 1T3NA 2R2RA 3RB6A 4DFPA 4ZVEA 2HNZA 3HSTB 1HNIB 1EETB 4IRKA 2BRLA 2ZD1A 3ZT1A 4KB1A 4E19A 3TQ1A 4ELVA 4J9SA 4TSXA 2R2UA 4FM0A 4ID5A 1K6YA 4EP4A 1X1PA 3V1RA 2OH2A 5J2PA 5HRRA 4J9RA 1S1UB 1CXUA 3AVBA 4ECRA 1S9GA 3DRPA 1YVUA 3WNGA 2VA3A 4M3UA 2HNDA 3I5BA 5JS1A 3IS9A 3NH0A 4DSFA 2F96A 1LWEB 1BIUA 1J54A 3KKSA 2VG6A 2UVVA 4MK8A 3KD5E 4CFCA 2HHQA 1UWBA 1S1WB 4DQIA 3PR5B 4F8RA 1EP4A 3DLKB 2CJQA 4ECUA 1ASWA 4ECXA 2V0NA 4OGCA 3OYEA 3SPYA 4FS1A 4ELUA 4FK4A 3SPZA 4O0IA 3PX4A 5KG4A 4CJWA 4PWDA 1XWLA 2XCAA 1RT2B 1TQLA 4QWBA 4CK3A 4MH8A 4Y2CA 3M8PA 1C6VA 2DPJA 4NZ0A 2GV9A 1FK9A 5DLFA 3NMAA 3KK2A 5HP1B 4KHWA 2NUBA 3SJJA 2YNHA 3L2VA 3LP0A 2HHTA 1J5OB 2OPSB 4CEOA 3K5OA 3ALYA 1R0AB 4F50A 2FBYA 1LAVA 5CYMA 4PA1A 3BQ1A 3ZSVA 3HJFA 2WB4A 3V9XA 4KHYA 4IBNA 4Q44A 1SUQA 1C1BA 4FYDA 2ASDA 1JXBA 3I5CA 2Q3SA 4KTQA 1C0TA 3CJ2A 3ZT4A 5KFGA 3VQSA 5D3GA 4I2QA 2KTQA 2V4RA 4CEEA 5KG2A 2QXFA 2E4LA 4O44A 1QAIA 1KFSA 2IJFA 2CKWA 2WOMA 1S4FA 3CFOA 1FKOA 3CO9A 1JLCB 3PUFA 5JS2A 2JEJA 4TYBA 4YMEA 4W5RA 2G8KA 4NCGB 3NKYA 3MECB 4FVMA 3OYGA 4CEQA 2QV6A 3OYNA 3KK1B 4IG3B 3SZ2A 3QERA 4EYIB 5F8NA 1IH7A 3OLBA 1KLMA 3V6KA 4ZVGA 3AA3A 4B9VA 3PW0A 1WSJA 3SQ2A 3DRRB 1HYZA 1UA0A 3GV7B 4CK1A 1RDRA 2G8WA 3LALA 2EC0A 1JLQA 3MR2A 3VQEA 4KHMA 3QO9A 1KVCA 4ICLB 5C42B 1MU2B 4Q0BB 4IFVB 5E41A 5F8IA 3MAQA 4B3OB 2E6MA 4I2PA 4HTUA 4JS4A 1IKXB 1VK0A 2W9AA 4FJLA 1HMVA 1TAQA 3AO3A 1ZBFA 3IRXB 1RTHA 1RBUA 4HCBA 1HYSB 3MEDB 4DF4A 3LANA 3DOLB 1W25A 1WSHA 3H08A 4HCCA 4DFMA 3OY9A 1DLOA 4ED2A 5KFQA 5C25B 3ZSXA 1L3TA 5J1EB 4EP5A 1U4BA 2OPQA 3T19A 4CERA 2UVWA 2KFZA 3VQ5A 3TAEA 4B9UA 5JXSA 4CGJA 4FW2A 4N56A 1KCFA 4IDKB 3HT3A 5DG9A 4AHCA 2XGQA 3SI6A 1QSLA 3AA2A 3P1GA 3RBDA 3NHGA 2EHGA 4C8KA 4MK7A 1FXXA 3K5MA 4J9PA 4Z4GA 3JYTA 4FZZA 1LW2B 3OS0A 4J2AA 1FKPA 1JLBB 1BCMA 4YNQA 4ECQA 4OKEA 2BRKA 3V81A 3KHLA 3VQ6A 1HYVA 3M8QB 2FLNA 3KK3B 1JIHA 2XY6A 3TAFA 3CFPA 5KTQA 3HM9A 4QWCA 4N5SA 4HUFA 2HNZB 3NF8A 5KT7A 3BSOA 3RWUA 1D9DA 2ZD1B 4OGEA 5KFXA 3CWJA 4ED1A 3LZIA 4LSLA 4FLTA 1D8YA 2AQ4A 4DTMA 5DQHA 4ID5B 1ZBUA 3ULDA 1X9MA 4DL7A 3PJXA 3AVCA 5J2PB 3FSIA 3OL8A 4DTXA 3KMQA 4CHNA 5I42A 3SFGA 5KFFA 3BSAA 1S9GB 3DRPB 1ZBIA 4CJFA 2XGPA 2HNDB 2FC0A 2YNFA 5L1JA 3IS9B 4KBIA 4RNHA 1EKEA 5HRSA 3CJ0A 4ECZA 2VG6B 3CDUA 3CDEA 5KFDA 3RR7A 4O3RA 1UWBB 1VSJA 2V9WA 2FJWA 4BE1A 1IO2A 4Q43A 2B5JA 1EP4B 4Y1DA 3HVRA 1TVRA 2J6UA 2RF2A 4FK2A 1N5YA 4XO0A 3M9NB 1KFDA 1NKEA 4CK2A 1RYRA 3E01A 1RBVA 4K4VA 2QE5A 4EO8A 1YTUA 5KFVA 1BISA 5HRNA 3NL0A 4PWDB 3OL6A 1NOYA 4FK0A 2JEFA 3ZCMA 4CGDA 1SL0A 2ILZA 1VRTA 3NAEA 3M8PB 4Z0UA 2R8JA 4DTRA 1FK9B 3KK2B 4Z4CA 5C5JA 2UVRA 3ZSZA 4ZP6A 2YNHB 3LP0B 3VA0A 3VQCA 4N41A 2C2RA 2E6LA 5EWFA 3O4NA 3PR4A 3KLVA 4N47A 4NLTA 3PZPA 1XI1A 5CYMB 3OYAA 4CHQA 3ZSRA 5KFBA 3K58A 2FJXA 3C6TA 4DTUA 4B8CA 4OPKA 1ASVA 2GBZA 3KLGA 4ZPBA 4H4OA 3HL8A 1SUQB 1IKYA 1C1BB 3QEVA 5DK5A 3VQAA 4GC7A 2C2EA 1C0TB 4OKJA 4DF8A 3RMAA 5T14A 2HNYA 5D3GB 4M3XA 4I2QB 4O0JA 1JLFA 4O44B 5KFLA 4JRQA 2BQRA 2WOMB 4FXDA 4Y34A 1FKOB 2OYQA 4ZVFA 5CZ2A 1ZBHA 3CM6A 3LP3A 3H4BA 2GUIA 3LAMA 3L8BA 1RT3A 3NAIA 4B9SA 3G6VA 4CHOA 3H5YA 3MXMA 1BCOA 3DYAA 3U6FA 2YNGA 1KLMB 1QAJA 4KHSA 3T5HA 1RDDA 2AGPA 4ECYA 3H2LA 3D28A 4CGFA 4O3QA 1S0NA 4Q8EA 1JLQB 1SH2A 4EO6A 4FZYA 3PO4A 1TK8A 3QO9B 2RDJA 4GVMA 3KLHA 1C2PA 3CJ4A 4R8UA 5KG3A 3HYFA 1SH3A 3IG1A 3ZSYA 4I2PB 5EWEA 3QESA 1RT6A 3QNNA 1HMVB 4AH9A 2VWJA 3DLBA 3QIDA 4DSLA 3TI0A 3G0ZA 1YTAA 3ITHA 1XR5A 1RTHB 2J6TA 4CECA 2KW4A 4IH5A 3BREA 5KFNA 2HWIA 4CF8A 1DLOB 4TXSA 2ATQA 4DS5A 4QWAA 2OPQB 2VG7A 4NLUA 2WONA 1T03A 4PY5A 1ZTTA 3AV9A 3MEGA 4DSIA 4FJMA 1S6QA 3Q8RB 1TV6A 3HK2A 4RNNA 1S6PA 4IR9A 4HVJA 2YNIA 3KLEA 3ZSWA 4OJRA 1RBSA 4M3WA 3BQ2A 4CE9A 2ZE2A 1HRHA 4CJPA 2R2TA 1L5UA 4I9QA 4BDYA 3JYTB 2ASLA 3VQ9A 1FKPB 3KHHA 3V81B 3QIOA 1BQMA 1A5WA 4HHTA 3TANA 1J53A 4LQ9A 4B9NA 4DSKA 4R5PA 4FBUA 5KFKA 1CLQA 2C28A 4MK9A 3QLHA 1QQCA 1NK9A 3M8RA 3H4DA 3L3UA 2C22A 1HJRA 3BDPA 5CZ1A 1JL1A 4MQ3A 4OL8A 4XPCA 4KHNA 4LSLB 2KQ2A 1CXQA 4WZQA 3DLGA 4KAZA 5HBMA 4J2EA 4R0EA 3QIPA 4J9QA 4KHUA 3AVLA 1RT4A 4K4WA 2ZKUA 1S0OA 1TL1A 1RTDA 2QKKA 3QZ8A 1NJWA 5I42B 4J2DA 1WAFA 3OYJA 5KG5A 1QE1A 4ZPCA 3S3MA 2G8UA 2YNFB 1U49A 1CZBA 2GIRA 3V6JA 4UQGA 4WFXA 3PW7A 4FJXA 2JEGA 2BGGA 3OVNA 4F4WA 4GC6A 2D5RA 1NHVA 2B5JB 4B8AB 3FQKA 1TVRB 2RF2B 4BDPA 3TAQA 1N5YB 4LD0A 4DL2A 1GX5A 3M8SA 3E01B 4MKAA 2PYLA 1L3VA 3AVNA 1KVBA 1VSFA 4OLBA 3SUOA 4IR1A 1I6JA 5L1LA 5F8JA 3K5NA 2IDOA 1BI4A 4ED7A 1VRTB 4RNFA 4BDZA 4QPXA 4JV0A 5KFTA 3MTKA 4CEDA 4CJQA 2ITGA 3VQ7A 3LP1A 1HNVA 3H5UA 2XO7A 4DFJA 4OPJA 1Q9YA 4IKFA 3SNNA 4WXWA 4NLVA 1RTJA 4CJEA 3C6TB 3DMJA 4M3YA 1SKRA 3KLGB 2E9RX 4DU1A 3V4IA 4H4OB 1BL3A 5DLGA 2AJQA 1S0MA 1IKYB 3CJ3A 2P1JA 3G6XA 4RW9A 2BQUA 1LWFA 5EU7A 4CJ5A 3AVIA 4EBCA 2HNYB 2HVHA 2IC3A 3EPGA 4HUEA 1JLFB 4LQ3A 5KFAA 1NHUA 1B92A 4B9MA 5F8LA 2HVIA 3E51A 4BACA 4FLWA 1RT3B 2HWHA 4K4UA 4FM1A 5C24A 4QCLA 3DYAB 4NRUA 1ASUA 4RW4A 4IG0A 4MFBA 2A1SA 3Q8SB 2FBXA 2YNGB 1I39A 3LWLA 1NNDA 1TKXA 4KI6A 1A5XA 1DTTA 3V9WA 4NLPA 3O3FA 1RT5A 4NLXA 3IGVA 4KHRA 3AVJA 2IAJA 4YR0A 5F8MA 4CF1A 4MKBA 3O3HA 4IQXA 3KLHB 4WFYA 2IM3A 4R8UB 4FLVA 4TQRA 3IG1B 3NH2A 1LAWA 4CGGA 4I9LA 1RT6B 2YHAA 3PJWA 4F3OA 4CFDA 1RDAA 3HVWA 1HQEA 3V1QA 4CGHA 3ITHB 4JRPA 2FJVA 1NK8A 2D7SA 4K8XA 3VQDA 1EXQA 4OKKA 3SUQA 3NF6A 4CFAA 1RT7A 3SQ0A 4AHVA 3SUNA 1HPZA 1BQNA 4KFBA 2HHSA 5KG0A 2VG7B 4CJ4A 3H59A 1XR7A 1RDCA 2WONB 1T03B 3LP2A 3UPFA 3OYDA 2RPIA 3MEGB 1VSIA 1S6QB 3BSNA 2WK4A 4F4ZA 1TV6B 1S6PB 3KHGA 2YNIB 3KLEB 2AGQA 4O3PA 2YKNA 2E9TA 3U3YA 5HRPA 2ZE2B 5F9LA 3PV8A 5KGWA 2P5GA 1T7PA 2V4QA 4JLHA 2F8EX 3G86A 4KAIA 4RW6A 1BQMB 1S1XA 1RAJA 3ZSQA 2B4JA 4R5PB 4JS5A 3QLHB 4AHTA 3ISNC 3S9HA 4M42A 4EEYA 3DOKA 1U04A 5HLFA 3A2FA 4DSJA 3V9UA 1JLEA 4ED6A 4O55A 2HAIA 3QINA 3DM2A 4J2BA 3KLIA 1KTQA 4NLYA 2AX1A 3DLGB 4F4YA 4AHRA 4CEBA 5HBMB 2BR0A 1I3AA 3QIPB 5KG1A 1RT4B 1TL1B 1RTDB 3H5XA 3QGIA 4EYHB 1TL3A 3O3GA 3CIZA 1TKZA 1QE1B 5SWMA 4URGA 1SL1A 4BWJA 3KD1E 1Z26A 1N56A 1VSDA 1NK7A 4DU3A 4IOBA 4E89A 2AWZA 2WRMA 1Y97A 4AILC 3C95A 3N6NA 4NLRA 3D45A 3WNEA 2W9BA 2EX3A 4E1MA 4CIEA 4YP3A 3OYMA 2UVUA 3OYIA 1SKSA 4CJRA 5KGXA 5DMRA 1ZBLA 3HO1A 1S10A 4WYWA 1NKCA 4DG1A 1BI4B 4QWEA 2R8HA 4G1QA 1IG9A 1SV5A 4CF0A 2F8SA 4CEZA 4C8LA 5L1KA 3KLFA 4FLYA 1K1QA 1U45A 2C2DA 2OZMA 2IOCA 4EZ6A 1VSMA 4N76A 2HB5A 2YHBA 2RKIA 2X78A 2XCPA 3LP1B 1HNVB 3OYHA 2B6AA 2XI3A 1W0HA 4M3RA 4FJ8A 3NE6A 5KFIA 1T94A 3QNOA 2B43A 4KHQA 1N6QA 3AO1A 4QOZB 4RU9A 3GIIA 1RTJB 3DMJB 4MIBA 3NBPA 1JLAA 3NFAA 3NF7A 3HP9A 3V4IB 3QGGA 4E3SA 2AGOA 3PW2A 3EY1A 1NJZA 4G3IA 3QGHA 3DLEA 4ID1A 4RW9B 1LWCA 3KNAA 4DFKA 5J2MA 1LWFB 3JSMA 5J2QA 4ED8A 3UDLA 2I1RA 4DQRA 4CHZA 4FJ5A 2KFNA 1VRUA 2IC3B 2ASJA 3BJYA 4ZP8A 4YR2A 4FJKA 2W7PA 2IBKA 1T8EA 1TGOA 3RB0A 5F9NA 5KFRA 4YFUA 2W7OA 4CJKA 1U47A 2LSNA 3ZSOA 2BE2A 1B9FA 5C24B 4DTPA 1B9DA 3HHKA 3PVXA 1VSKA 1SKWA 4HYKA 4FJHA 4RW4B 3OL7A 4IFYA 4IG0B 4MFBB 5CYQA 3BR9A 3OYCA 2FLPA 1Z25A 3NAHA 4DTJA 4FCYA 4K8ZA 4CFBA 1TKXB 1DTTB 1S5JA 3QZ7A 2UUWA 5EWGA 1RT5B 2P51A 2IAJB 3T5LA 3NGDA 1J9AA 4ZTFA 4NCBA 3NGYA 1T05A 2OA8A 2D0CA 3AO4A 1QTMA 4TY9A 3EZ5A 3CVKA 3SFUA 2R8KA 3HPGA 1HQEB 3DRSA 3SQ1A 4W5QA 2FVPA 3K59A 2VG5A 1NK4A 4ZPDA 5KFJA 4DQPA 1NK5A 4C8NA 3C94A 1RT7B 4IRDA 4QAGA 3O4QA 3MXIA 1HPZB 1BQNB 4KFBB 4Z4FA 2DFFA 4NLWA 3D5MA 5HROA 3FFIA 3RAXA 3LP2B 1YVFA 4ZP9A 2I5JA 1C1CA 4RW7A 2R8GA 1K1SA 3PW5A 3PX6A 2Y1IA 3AA4A 2WHOA 1UA1A 2YKNB 3VQ8A 4RUAA 5KT6A 2F8TA 4O4GA 3CFRA 2ALZA 3HVAA 4I7FA 4K4TA 5DQGA 4E1NA 1CSJA 3RBEA 1G15A 3QEIA 3ISND 3BGRA 5DGBA 1RNHA 4RW6B 1S1XB 4NRTA 2G8FA 5L9XA 1RBTA 1GOAA 4O5BA 3SCXA 3DOKB 3AA5X 4Y2AA 1EX4A 5HLFB 3OYKA 3LDSA 1TK0A 2HHVA 1N4LA 1JLEB 4HKQA 4KRFA 3DI6A 3DM2B 3IN5A 1TKDA 3KLIB 1NK0A 1U09A 1QUVA 1RBRA 1S1VA 2JC0A 4ZP7A 1D1UA 1IKWA 3T1AA 3ICLA 4KV8A 4YQWA 1BGXT 1TL3B 3I0SA 4EBDA 3LZJA 3NF9A 1TKZB 1QSSA 4F2SA 2XC9A 1D0EA 3GQCA 2QKBA 4DU4A 4ED0A 1NKBA 5KT4A 4M45A 2D3ZA 2E9ZA 2HMIA 3K57A 1WNSA 2O5DA 4J9OA 3SV4A 1LW0A 2W9BB 4CHPA 3HXMA 1S9FA 4QW8A 4OLAA 1RILA 1ZETA 2D0AA 2UUTA 3FQLA 3GIKA 4W5OA 1ZYQA 1BIZA 4ZHRA 3MEEA 4DG1B 3G10A 3MR6A 4O3OA 4PUOA 4FJJA 2YKMA 4G1QB 1SV5B 2RN2A 3MF5A 3LPUA 3KLFB 3HP6A 1NOZA 4M41A 1W9HA 4FLXA 3RMBA 2VA2A 2AX0A 3AVFA 1S9EA 4CGIA 1RYSA 1WLJA 3OHBA 4KB0A 1WSGA 2RKIB 2IA6A 1TKTA 2WTFA 2B6AB 3CM5A 3L2QA 4E7HA 2Z1GA 1TP7A 5KRSA 3OYBA 1N6QB 4KREA 1XHZA 4AHSA 1RT1A 1ITGA 2X6SA 4RW8A 2ILYA 5KG7A 3V6DA 1KSPA 5K14A 3NBPB 1JLAB 4H8KA 2G8HA 4FZXC 4K4YA 2XY8A 3BQ0A 2D41A 3DLRA 3T3FA 1X9WA 2OPPA 4C8MA 3RTVA 3SV3A 2BANA 2PY5A 2BQ3A 3DLEB 1LWCB 3QYYA 5J2MB 3JSMB 5J2QB 3Q8QB 4CESA 1DTQA 1VRUB 3I5AA 5KFHA 5J2NA 4FJNA 1S97A 1D5AA 1S49A 4CJTA 3PY8A 3SYZA 3NGIA 4U6PA 1U48A 4E7KA 2IM1A 2Z1IA 3AO2A 4Z4EA 2BE2B 1S1TA 5FDLA 4M3TA 5KFUA 4CIFA 4CJLA 4GW6A 5FRNA 2GIQA 1QHTA 4WFZA 1O1WA 4IFYB 2Z1JA 4KSEB 5CYQB 3OL9A 4LH5A 2J6SA 4IRCA 3CJ5A 3C6UA 2IGIA 2HHXA 4RG8A 4Z4IA 5KFEA 3ZT3A 2PYJA 3AVKA 1KRPA 4E0DA 1T05B 3QEWA 1Q9XA 1SL2A 2XI2A 4JUZA 1REVA 2WCXA 4DL4A 3OJSA 2YV0X 4F3TA 5KG6A 5KI6A 3HVTA 3GV5B 4KTZA 3N6MA 4J9LA 4NYFA 1ZTWA 3FRZA 1JKHA 3DRSB 4J9KA 4PQUA 3WNHA 1UOCA 3OJUA 2VG5B 3P83D 2P5OA 5SZTA 3S3OA 1WSIA 2W42A 3EYZA 1IKVA 3H40A 3PHEA 3U3GA 4DTOA 3PX0A 3OS2A 4ED3A 4URQU 3L2UA 1C0UA 5HROB 1L3UA 3FFIB 2W9CA 3B6OA 4FM2A 2XY5A 2I5JB 4AHUA 2JC1A 1C1CB 4RW7B 4WYLA 4K4SA 1RA7A 3T5KA 1RTIA 3OSNA 4F4XA 1JXEA 2W8KA 3B6PA 3G6YA 3KMSA 2FBVA 4H4MA 1GOCA 4O4GB
chains in the Genus database with same CATH superfamily
1VS3A 2UXCK 2ERRA 3CJSA 2BDPA 5EY4A 3U1MA 2ZBRA 2OTJS 3TZWA 4MYUA 3N79A 3BGRB 5T7BA 1HQUA 5AZJA 4GO7X 3MXHP 3KJVA 3G8QA 4J7CA 1N5TA 4EFAC 4DV2F 1X31C 2CRLA 1CZ9A 1BHLA 5CY4A 1HBMA 1I5OB 5LMNF 2NLXA 3KG0A 4KH6A 1W7AA 3QAUA 1Q82T 3NGSA 3ENBA 5M2RA 3O08A 3QEPA 2CQ2A 2B56A 1NJXA 4QYRA 1IKWB 5FROA 4DR6K 4OYWA 4O3SA 4F4KA 4EHUA 1SIZA 4DV5K 2FBTA 3IA0A 1NMDA 3KDNA 1T0TV 3D0HE 4JKGB 4JI7J 3W1YC 3PYGA 2PDAA 2WVDA 4LSNA 3UD4P 5I3UA 1Q8BA 3R5BA 4P10A 1U0HB 3GILA 3HZEA 2FVRA 3VERA 4Q5VA 2ZQBA 4C4WA 3EPIA 4J9NA 3V9ZA 3KUEA 4CO0A 1F2HA 2GS8A 5E7OB 4WFNQ 4M5HA 2BE9B 5ETQA 1KVAA 4GMJB 4CHYA 3MEEB 4RKUC 3MR3A 5DM6Q 2VL1A 1RWNB 2WVEA 4ECTA 5CD4A 2NRZA 4NPOA 4DWIA 3LGHA 2WTUA 2V2ZA 4U8VA 3SCIE 3T9NA 1SJ4P 3D0IE 1VQNS 2ZGZA 4NA3A 5K5MA 1TAUA 3FZBA 4BVOA 2OSRA 2HF3A 2VONA 2MHEA 3OYFA 3GJTB 2DH9A 4OJHA 1VQ6S 2IRYA 2MPUA 2I2YA 5I9EB 2OPPB 1HIYA 4U8YA 2GHWA 3J7YP 3P45B 1AFJA 1NMNA 3TR5A 2HHWA 4CM0A 2UUBJ 3RRGA 1T6CA 3ETOA 4DL3A 4FLUA 3UIQA 3GIMA 1G6BA 4CZKA 3QQCD 3OYLA 4B3RF 2VWKA 3KTQA 1LWEA 4QYZJ 4TYAA 4RUCA 4NCAA 2VYPA 1TK5A 2HFUA 3MXJA 1B7YB 3DLKA 4A59A 3LH2S 4LF6K 1Y3KA 1OIAA 2PBDA 5L9NA 1WJ9A 3L3CA 4ETXA 2BX6A 2NCKL 1RWXB 4IKAA 2UXCF 3OHAA 1REVB 4QW9A 1NNEA 2Q97A 2OGUA 2EWHA 3VEZA 5HP1A 1N5QA 4C6AA 4FDFA 3IUCA 4DSEA 2FJBB 1K9MT 1ZH5A 4EIAA 4MLHA 2C3PA 2EKYA 3M2VB 1MMLA 4A62A 4L73A 1R0AA 1NMEB 1IKVB 3TEGA 5RUBA 2A1RA 4BRMA 5E84A 2BEFA 4KE5A 5HATA 2W9CB 3ZNUA 4JV1A 3ILLA 3K5LA 1FXLA 1ZZNA 5KFSA 2GVDA 1QSYA 3SSRA 4DR6F 1X4BA 1SC4B 5EDWA 4QPTA 3JAMY 1QAXA 3VEWA 4MMOA 4KTWA 4DV5F 4OIXA 3BGOP 3BO2A 2VFSA 2J9DE 2VFVA 2F65A 5C0YA 1R27B 1UETA 2DFHA 2X74A 1JXLA 1HQUB 5AZJB 3HPOA 4ECSA 5D8HB 3WXJA 3KJVB 4F2RA 1XIQA 3MECA 3O2IA 1Q5VA 4QIFA 4LH4A 4CM2A 2MQQA 4X66K 5IM0A 1SJFA 1LOUA 1HBMB 3NGZA 4JI8J 2XMWA 3VQ4A 2FHJD 1U2CA 3DRRA 3OVAA 1IXKA 3TUPA 3M6UA 2Q79A 3HMJG 3MCAB 4ECVA 1HARA 2AJ2A 1MU2A 1HNWJ 2DH7A 3ADAC 3LAKA 4DPXA 5E33A 3TZZA 4CF2A 4B9LA 2ETJA 2QK9A 1JL2A 2UU9K 4E7JA 4EZ9A 4LSNB 1IBKJ 2P9LA 5I3UB 1RHJB 2A2DA 5F8HA 1T44A 2CFXA 2IS3A 3QEXA 3O3LA 2AA4A 5HL7L 4N8NA 4O3NA 1PAEX 2ZNYA 3GLJA 3TEHB 1IR1A 2WAQD 3D1QA 4OX7A 4O4RA 4W5NA 2Y1JA 2VPWB 3L3VA 3D7SB 4DQQA 4C8OA 2YX1A 2BUNA 2YKPA 2QLFB 2D9PA 4ILRA 1APSA 4AL6A 1H0HB 3JSBA 4LRCA 3IGNA 3BKFA 4Y65A 1LW2A 3MCMA 4NYNA 3NDKA 3D6FB 3PYDA 3ETMA 2PMWA 4DQSA 2E29A 5DG8A 5GAEU 1FJGJ 1WC3A 4B9TA 3HD1A 2DEJA 3RMDA 3DKDA 1S6UA 3BF3A 2VPZB 2R2RA 4LF6F 1WEXA 2XWXA 5K8NA 4PEOA 3HSTB 1BC6A 4IRKA 2ZD1A 3CHWA 2QXLA 4JEPA 5CD4H 2ZBIA 3V1RA 3I4HX 2OH2A 4A8YA 4J9RA 3HSZA 2ZKTA 3AVBA 2E1PA 3D67A 3L7PA 2HNDA 4DSFA 2F96A 1LWEB 2GGPA 2VG6A 1SZ2A 2G2YA 3OFFA 4EMDA 4X4TA 1BA0A 3NOCA 1PBAA 2JJ4D 1I51B 2AHOB 3TOQA 5IT4A 4PKHA 1EP4A 1ZPVA 3DLKB 4ECUA 2HK2A 1ROFA 4B3MK 2XQCA 4OGCA 1FDAA 1SJRA 4IOAL 2BJ8A 1XWLA 2XCAA 2F9TA 1NGEA 2VPXB 3VF0B 3ONQA 4L72B 3M8PA 3T9ZA 1FEEA 4CLFA 2DPJA 5DLFA 4B1ZA 3KK2A 5HP1B 3SJJA 3L2VA 1YHQS 3J81j 2HHTA 3C3LA 3PFOA 3SK3A 4X66F 1RK8A 3OXGA 1KQGB 1R0AB 2KM8B 4PA1A 3MOZA 3HJFA 4DUTA 2W4DA 2WB4A 2FJAB 2FHJA 3P49B 3UCZP 1OYEA 2MHNA 4Q44A 2N3OA 2ASOA 1X4CA 4AL7A 3VV2B 2GVDB 3N0VA 1S77D 1CJVA 3QBXA 3L7OA 3FBBA 1GMVA 2R7QA 4PKDB 2KTQA 4OYPA 3O9RA 1FDBA 2FF6A 2QXFA 2UU9F 1KFSA 2IJFA 1B0VA 1UMJA 2MQOA 3AJDA 3LDQA 2LVWA 1NEEA 4NXMJ 3MECB 5K8MA 2CPDA 2E66A 4X4NA 3OYNA 3QERA 3W5YA 4FPIA 5IM0B 3IAM9 4ZCKA 2KJWA 2MYFA 3U4LA 4LF8K 2IVNA 4FSVA 1HHSA 4CVNE 5GMDA 3DRRB 3RAMA 1S0VA 2YJFA 3G96A 4B17A 3F44A 4RUBA 2G8WA 3BH6B 2DEIA 2CG4A 1MU2B 3L95X 5E41A 5F8IA 3MAQA 4FF4A 4JS4A 2DNLA 3FZFA 2AKWB 4PZVA 2W9AA 1TAQA 3ILIA 3AO3A 1OY9A 1RTHA 2P9LB 3A8IA 3MAHA 2BABA 4HCCA 4ILLA 3OY9A 1DLOA 1Q79A 4OI4A 1U4BA 1DGKN 4EP5A 1FRMA 4CLKA 2UVWA 2KFZA 3VQ5A 1ELOA 2ZZNA 3I6PA 3UKRA 3C15A 4AHCA 1VGYA 2NXEA 3H42A 2Y1RI 3P1GA 3NHGA 2EHGA 2Q1NA 1R0CB 1FE4A 4NI2A 3FZKA 2FGOA 2AEJA 4V1Ak 1LW2B 4J2AA 4CZLA 4LF1A 3KHLA 2YKAA 4CBXA 2P5VA 1FD2A 3TAFA 2OEJA 4HUFA 3NF8A 5AJ3K 3BSOA 1AW0A 5GAGI 2ZD1B 4OGEA 5KFXA 3CWJA 4Q2LA 1D8YA 1VAZA 1X9MA 1NO8A 4DL7A 1QAYA 2V2VA 4JI0J 3MAAA 3OL8A 4H0OA 2YWWA 3SFGA 5KFFA 3TZYA 2VIHA 2GELA 2OJ3A 4WQ4A 4N7TA 2NRWA 2FF3B 1ZBIA 2XGPA 1QTNB 2HNDB 1FXRA 5D78A 2FC0A 2GGPB 3CJ0A 2VG6B 4LVNP 2VODA 3R97A 4O3RA 4WFAQ 4JI2J 2FJWA 2Q0RA 1EP4B 2KO1A 3MK6A 4FF2A 1FE0A 3DDIA 2QE5A 5KFVA 2I0XA 3O80A 4DR5K 5HRNA 2QWPA 2VDIA 2Y8WA 3NL0A 2AF6A 1UVKA 1KWMA 2JEFA 4DV0K 3NAEA 3NMUA 5DDRC 1MWZA 4LF9K 2BKPA 3M8PB 4BRLA 2A6MA 4DTRA 3M6VA 3KK2B 1Q95G 5C5JA 2HLTA 2GQ2A 3EM1A 2MZSA 4N41A 2C2ZB 2C2RA 3SIPB 1UFWA 4OI0A 1GTEA 4OFZA 2WFBA 4LF8F 1WHYA 3EMTA 5AE3A 1OQ3A 3C6TA 1WI6A 2HZAA 3G25A 3CCSS 4OPKA 2GBZA 3OVSA 2WSCC 4DR1K 5LOQA 4ZPBA 5AQOA 2RRBA 2B9XA 3HL8A 3T41A 1WSVA 1YZ7A 4HHJA 1CJVB 5DK5A 3TX8A 2C2EA 4DF8A 1SAZA 4DUZJ 5ETNA 3VOVA 2O8FA 1UZHA 1NJIO 5AQHA 2YHWA 2BQRA 2W2PP 2PA3A 4Y34A 4QR0A 4CH7A 3IP0A 4QS7A 4BR2A 1FKAF 1NM1A 3LP3A 2E2NA 3G6VA 4CHOA 3H5YA 3MXMA 4GV6A 1U24A 4LF2A 1VQPS 4UOGA 2AEFA 1VBKA 1PYTA 5D0RA 3BM7A 3BS9A 1QAJA 1TMJA 3BZQA 3JXOA 3K17A 5ETPA 1U1MA 3T5HA 4UQTA 1RDDA 1CBKA 3D28A 4WTOB 2ZITA 1NM2A 3NNCA 2DNNA 3GR1A 2CPXA 5JVGL 4P7VA 5BR9A 2J8SA 2XS5A 4USJC 2DVIA 3HYFA 1R89A 3IG1A 3RZAA 2K7JA 4GMKA 4WWSA 2VWJA 3DLBA 4DSLA 5ADXA 4X4RA 2GUPA 1RTHB 4P2MA 4JI6K 4IH5A 3MMCA 4CZFA 3VZHA 3H25A 2YVSA 3RRKA 3CMES 3VZIA 1DLOB 2SXLA 3SBMA 5A76A 4TXSA 3J81Y 5AJ3F 5AQIA 2YXLA 3GSDA 4PG6A 2HVDA 3D3BJ 1MWQA 1S72S 2VG7A 2FIUA 3ZTRA 4NLUA 2E44A 2HZCA 3A8JA 2BJEA 1ZTTA 2E5JA 2QLBB 2VQEJ 3UKRB 3C15B 4OX9K 4HVJA 2CPIA 5HQ8A 2YNIA 2OCEA 1XNRF 1RBSA 1EAYC 2P9UA 2VB6A 4NI2B 3O9QA 2J7KA 3U9ZA 1VQ4N 2MKYA 4JI3J 2ASLA 4DHVA 1WWHA 2DITA 1E4FT 4WK3A 2NZTA 4C0BA 1BQMA 4HHTA 1J53A 2E8AA 1G2EA 5BRDA 2W6KA 3H45C 3I9V9 1QQCA 3QB0A 4OI2A 2QA2A 4YDUA 2BOAA 3O1LA 3L3UA 2NXUA 4CWBA 1I94J 2VC1A 3L09A 2CA9A 3IDHA 4DR5F 3GFHA 4ER8A 1BA1A 2H5EA 4UOFA 4KHNA 2QFJA 2KQ2A 4WZQA 2ZZMA 3CDBA 4J2EA 4DV0F 3P5TL 4R0EA 3QIPA 4LF9F 4K4WA 3MAAB 5ETTA 1RTDA 1YSJA 3QZ8A 2MJNA 1CZAN 2Q43A 2EFQA 2CH5A 5KG5A 1QE1A 3CSKA 3CCLS 3S3MA 3ZETA 4BRAA 2XMTA 3L4BC 5G0RA 4WFXA 3PW7A 4FJXA 3DC2A 2CQ1A 2BGGA 3OVNA 3H2VE 3I4PA 4GC6A 3U7JA 4PXCA 3FQKA 5FPDA 3CCES 3HOSA 2VDHA 4DR1F 1B4SA 4DR4J 3HJVA 4MKAA 2KT2A 1Q86O 4Z7CA 1VSFA 2CJKA 2O66A 4OLBA 2LEPA 1WUAA 1OO0B 4JI7K 2QJ3A 4XAKA 4ISEA 1BMQB 4QU6A 4FOIA 3LQVA 1NUEA 5AR0A 1VQOS 4G1IA 1JNRB 2R7UA 2QYCA 3GE1A 4GV9A 5KFTA 2B4PA 4CJQA 2ITGA 3LP1A 1HNVA 1HA1A 4PCQA 4L6V3 4ES2A 2YKOA 3JS6A 4UOHA 1EB0A 4FPAA 2IMOA 1B64A 3C6TB 1ZAVA 2D0OA 4XDDA 1M1KO 1UVLA 3BP8A 2YX7A 4L3KA 1BL3A 2EFPA 3S6EA 1S0MA 3CJ3A 4RW9A 3K5PA 1M5KC 1LWFA 5KQDA 1MWKA 2YKQA 3AVIA 4QS9A 2O8FB 3EPGA 4LQ3A 4H5TA 2GW8A 3Q2SC 5E3AA 2HEKA 5F8LA 4JI6F 2BACA 3MD1A 4FVCA 4FWLA 3CCRS 5DS7A 2UUBK 4CLPA 2FBXA 5A6PA 4HI2A 4E1JA 3FBEA 3LWLA 1I39A 2LLZA 1A5XA 2HQIA 1RT5A 4NLXA 5J1PA 3AVJA 2NRVA 4QYZK 4CRJA 2H4YB 4LT6A 2QL7B 4I6WA 1KD1O 3IG1B 1YJVA 4L76A 2PIIA 2LQ8A 3AB2B 3ZZTA 4WF9L 2F4VJ 4F3OA 1AROP 1TFWA 2X1BA 3RJMB 2RS8A 2YQ0A 2D7SA 3MMCB 2I9SA 3CERA 1BUPA 2G0CA 5D4NA 5M1NA 2OEMA 4PABA 2CGKA 2AYEA 4LIWA 4H0XB 3P4UB 4KFBA 2HHSA 2VG7B 1YLXA 4CJ4A 4JV5J 3UPFA 2RPIA 4H5NA 3BSNA 3HT0A 3KHGA 2YNIB 2C1EB 2FHKA 3MMVA 3V4MA 2P9UB 3CDAA 2XNRA 4FPBA 1FRLA 1QVGM 4JLHA 2A10A 2QM1A 2HZVA 2BXJA 4JKCA 3VTHA 3G86A 4RW6A 1BQMB 4LIRA 4H4KC 5FPNA 5FLXY 1YITN 2GQQA 3S9HA 2VBWA 3DOKA 4BRHA 3E3XA 1U04A 3P8BB 3DLLL 2FQQB 2R4FA 5EGYA 1SQFA 4OHYA 4O55A 2G2ZA 1RWOB 3QINA 3PRVA 3ENHA 3LM9A 3THTA 3E8OA 1FNOA 2I7PA 4JI7F 4AHRA 2AYGA 3HHEA 4A61A 2IA0A 3P31A 3QIPB 2P9EA 4AYBD 1XN9A 1HR0F 3DRYA 1RTDB 1QZ5A 2PFDA 4JK7A 1E4GT 2BJ3A 3CIZA 3D6MB 1TKZA 1QE1B 3POTA 1ZA1B 3ZETB 4CO1A 4BWJA 3O1BA 4JI8K 5G0RB 2Q6CA 4KH0B 2WBMA 2VBYA 3ET6A 2WRMA 1T9UA 2OKQA 1Y97A 3T6JA 3MM6A 3HZ6A 3C95A 4AILC 2F9WA 4UY8T 3TP2A 3C2PA 2CQHA 4MJKA 4K5RA 4LSZB 5KGXA 5DMRA 1ZBLA 4UZBA 3LDPA 6FD1A 3MWTA 1U1OA 3D68A 5D4PA 2ZJRQ 4WYWA 4DG1A 1KONA 2R8HA 1IBKK 2LEAA 1K1QA 1NBEB 2OZMA 3GJSB 3K8WA 3U8XA 1X4FA 4HDGA 3LP1B 1HNVB 3GFYA 2CJAA 1RKJA 2UUBF 1T94A 4NXNF 1N6QA 1WOOA 2NLWA 1C4AA 3NBPA 1JLAA 3NFAA 1YI2N 3QGGA 4P2XA 1CLFA 3PW2A 2PGCA 1NJZA 1A7GE 2CWKA 4RW9B 2QWLA 1FJGK 5THWA 4CZMA 1LWFB 3JSMA 5J2QA 4ED8A 3NVKA 3UDLA 2I1RA 2YH0A 1U8SA 4ISFA 1BG3A 2DT9A 4CHZA 3TA0A 1JXVA 3MDFA 1CQNA 4UOCA 3BJYA 2ZC3A 2IVPA 2W7PA 3RB0A 5F9NA 1CG2A 3ZSOA 2BE2A 3ZTPA 3PVXA 1DQ8A 1VSKA 1HKGA 3M8YA 4HYKA 4FJHA 3BR9A 5CYQA 4Y0WA 2FLPA 3NAHA 4XDCA 4DV1J 4OYOA 4CFBA 3GJRB 2A3JA 1RT5B 5U47A 3NGDA 1P27B 4FXWA 4OYBA 3N4QA 4DZDA 3HBTA 3TQEA 2D0CA 4NL5A 1QTMA 4BR0A 3CVKA 4ILGB 3C19A 1R6YA 4GKKJ 1LOTB 3HPGA 5I3PA 3DRSA 2GMJA 3DU6A 3SAHA 2PEHA 5C2DA 1NK4A 2VG5A 1KVKA 3C94A 2R7RA 5KOXA 3A5NC 3O4QA 3LOUA 4KFBB 1SB6A 3D5MA 4OI3A 2R7XA 3RAXA 4AXIA 4BCAA 3UR3C 4I68A 2F9DA 3PX6A 2J7UA 2WHOA 1H2TZ 2CJYB 2Z4PA 3JTNA 3QWPA 5K20B 4RUAA 4F0KA 4O4GA 3CFRA 1BWEA 2KXNB 3HVAA 2HFVA 4JI8F 1TYQA 5DGBA 5E5NA 1RNHA 3KWIA 4RW6B 5M2PA 4NRTA 5EN1A 3CJRA 3TNVA 1GOAA 3DOKB 2RHSB 3UB5A 2HS0A 2YQ3A 2HSTA 1TK0A 2HHVA 5CCMA 4KRFA 3DI6A 1TKDA 1VOMA 1H98A 1NK0A 4BREA 1RBRA 3THWA 1OSDA 2JC0A 2VBZA 3VGKA 1K73O 1IBKF 3QBCA 1UJ6A 3TJ8A 5KPZA 2BM0A 4WFNL 4LRDA 2HGNA 2FXUA 4YHHK 1TKZB 2O8CA 4DJBA 1QSSA 3POTB 2A6OA 2XC9A 4F67A 1MA9B 4DU4A 1JJHA 2QKBA 2YX4A 3CPEA 1P8GA 3ET6B 1RCOB 4UY85 3MM6B 1WNSA 2RQMA 1LW0A 2LCWA 3C65A 4CHPA 1P6TA 1YBTA 3HI9A 3HXMA 4QW8A 3VAKA 4KIAA 3HX9A 3V5RA 5L46A 2UUTA 1RBAA 1FJGF 5FPMA 2YWGA 4UZCA 4ZHRA 3G8TA 2HFNA 1KQKA 4ZK7M 4BG8A 4DG1B 3QRPA 4O3OA 4PUOA 3MCSA 2RN2A 2ZDOA 1P9QC 5GAEI 4P75A 3D2FA 1W9HA 3TYTA 3RMBA 1R7IA 2NNWA 3MCPA 3W65A 1WSGA 2PMZD 1DEJA 1QZ6A 2WTFA 5IT9Y 2QMWA 3L2QA 4E7HA 7FDRA 2Z1GA 2KL8A 5KRSA 1N6QB 4KREA 1RT1A 1RWVB 2X6SA 2GV1A 2ILYA 3V6DA 1KSPA 1G99A 3W60A 3NBPB 1JLAB 5BJRA 3R3TA 1IJEB 4K4YA 2XY8A 3LM2A 4P7TA 2D41A 2IDEA 2DRDA 3DLRA 3KKFA 3HM8A 4NLCA 5F2RA 3SV3A 1JB0C 4ANEA 3M5RA 4DR2J 3ZC4A 4QR2A 4UUXA 4U67L 4YOXA 3CJQA 3JSMB 5J2QB 2HGLA 2LYVA 3Q8QB 4CLTA 1QM9A 1DTQA 3I5AA 2CUYA 4RL1A 5KFHA 3GWCA 4FJNA 3D66A 3TTDA 1UPPA 1V5VA 2QA1A 3VESA 1S49A 3ULHA 3GZ7A 3PY8A 5BXIA 4OYXA 3NGIA 4U6PA 2ROPA 3I31A 2CH6A 2FGCA 2MQ8A 2BE2B 5FDLA 3CCVN 4CIFA 4CJLA 4GW6A 2GIQA 3NMRA 4WFZA 4KSEB 5CYQB 2C2NA 3EGVA 5JICA 4ZCIA 5LSOA 1PAUB 3M8WA 1FX4A 2EK1A 3B8AX 2P6TA 1FRIA 2HHXA 3AFGA 4ITSA 4RG8A 4KH4A 4Z4IA 2B7BB 3OFEA 4OZLA 4A8QA 3GB0A 4JI2K 4C8ZA 4ZVPB 3U1LA 5DM7Q 2YV0X 5KG6A 1FRJA 2RUGA 3GV5B 2HPUA 2K8GA 3N6MA 1PGZA 4KTZA 4IO9L 1ZTWA 1VQYA 2MKHA 3DNCA 1P90A 1JKHA 2RSQA 1S22A 3DRSB 4J9KA 2M8DB 3ID6A 2VF3A 3TJ9A 1ULRA 4DX6A 2V69A 2VG5B 3S3OA 3ZTSA 1WSIA 4LMZA 2XO6A 3EYZA 2MY7A 5G4DA 3JB9k 1CULA 4JK8A 3A13A 4DTOA 5EHHA 2AV5A 1X8DA 3KFWX 3M8ZA 3HLUA 3R8YA 3FK4A 4HWIA 3B6OA 2XY5A 1UEKA 3GDQA 4BRDA 4AHUA 4LFBK 5MLCV 4Z2XA 4K4SA 1RA7A 3LDLA 1Q5YA 1FI4A 3OSNA 4F4XA 1X0PA 4LFCJ 3PEJA 2NUUG 4YHHF 4O8KA 3GJQB 1NZAA 5EX0A 1B7FA 2FBVA 4H4MA 2BYCA 4P9SA 1R8PA 4O4GB 1RWWB 2XEXA 3AOBA 2F63A 2ADBA 1TYQB 4KKOA 5D6GA 2HFOA 1PJ6A 5K9FA 1VIOA 1FWKA 1M90T 4BWMA 1EWRA 4YOYA 1WC0A 2MQNA 1JX4A 4L8RB 2OPRA 4QIGA 1LFPA 4OVLA 4OZ3A 4DPTA 1LV5A 4DUZK 1Z4UA 2VH7A 2ZWPA 3DI6B 3MX5A 2RH3A 5LMNJ 4LFAF 3H98A 1WDTA 4HUGA 1DBDA 3GV8B 3W3SA 2HBQB 2V8GA 3THWB 4RWXA 5KFPA 3F9KA 3VVTA 2IJNA 1KOOA 2DKOB 1IBMK 3TSQA 2BE7D 4B08A 2O8CB 3NCIA 1F60B 3VQTA 4QS8A 1RAIB 5B0DA 1KEKA 4H5WA 1VSHA 4ED4A 2BZ2A 1IM4A 2UV8G 4K50A 3OXFA 4F4AA 4CJ3A 3VVUA 1LW0B 4M94A 1UAWA 4A8MP 3RB3A 5ELZA 2N3LA 4ZS6A 3CQ8A 2D3UA 3BSCA 5ETLA 4B3TK 4ZHRB 4IEIA 1L3SA 4PUOB 2JFDA 2QA4G 3A5LC 3O4WA 3OA9A 3LA0A 1BDGA 3CG7A 3R9LA 3D2FB 2HW3A 3PW4A 3I0RA 2BJDA 4F04B 4OZ1A 5IZHA 4DTNA 2M9KA 1YTYA 3E2EA 5EXWA 1DAXA 2JVRA 1V3ZA 3TUZC 5IS2A 2VQEK 3W63A 1Q16B 3KG1A 2P9CA 1RT1B 1X5PA 1KC8O 2YHXA 2ZC4A 4M63A 3V6DB 1NDKA 2RJZA 1HNIA 5LXYA 4JKHA 2HHUA 1N88A 2R7TA 1R8HA 4JI2F 2F8MA 3TWHA 2EBEA 2UYTA 5B0GA 1UJ5A 4CJVA 5HVGA 4WZMA 1JJCB 3TABA 3NS7B 1DTQB 3GFZA 4AFFA 2RNEA 2A6AA 4K42A 5AQUA 4B3RJ 3CTRA 3MX2A 1UP1A 2RHQB 3PACA 1RCHA 3I9ZA 2R7YA 4PG5A 4WXOA 5AXMA 3H46O 1S1WA 5FDLB 3NOGA 5CZVA 1JCEA 3FCVA 1B3TA 1VISA 3NCQA 4YUDA 2KVIA 3FBFA 3DDKA 2DFEA 2MLZA 4LFBF 4M5IA 1EZZB 2N82B 4ES1A 3ZT0A 1BLUA 1J27A 3E1YA 2J0QD 5F41A 3IXQA 1KHVA 2UXCJ 3KXDA 3SUPA 5IT0A 5C2CA 4ZTJA 2DNMA 1JKHB 1LKZA 3AD8C 4DR4K 2QWNA 3N6LA 5KFCA 2HRTA 1WNEA 4RZRA 1VSLA 2OPSA 3VPZA 2GMLA 2VPYB 1XQSC 2PAVA 1NJIT 4JN4A 4M63C 3S41A 1AYEA 4DR3K 4DZ6A 1CULB 2DBBA 3Q89A 1RTZA 3U1NA 4USHA 2NXCA 1Q8IA 1M0SA 3G6EN 5FRMA 4K4ZA 3IAYA 4KI4A 3W9HA 3MFHA 2FLLA 1IBMF 5C10A 4NEZA 4ZVTB 1IV0A 3O5BA 4H4MB 1N8RO 3CJ1A 4CIGA 3FEZA 4FKYA 4KKOB 2B51A 3MR5A 3P5JA 2O8BA 1VR6A 3MFIA 2Q6BA 3VAIA 2OPRB 3KK1A 2B9WA 2W2MP 1VQ4S 3D0PA 5E26A 4OX8A 3R6LB 3UCUP 3K2PA 5AQTA 1BY9A 4B3TF 4BRCA 4FW1A 1QHAA 1S99A 5DG7A 4RWWA 3TWZA 5DETA 2R8IA 4F36A 3GE9A 2PA8D 2F40A 3FCWA 4FJIA 5C42A 1H7WA 4Q0BA 1KLNA 4M5JA 3IBWA 4B3OA 5KFOA 3EZUA 4C23A 1IKXA 3QFPA 4NLDA 2W4CA 1Q7YT 2QL5B 2B9YA 1KOHA 3VQBA 3IRXA 4CCHA 2OD6A 2VQEF 4N77A 5D0HA 1HYSA 2Z56B 3MEDA 3OUYA 4ELTA 3G71N 3DOLA 2IM2A 4M7XA 3NWRA 5C25A 1MW7A 4FOEA 2ASPA 4WIIA 2FVQA 4FXVA 4F9OA 4M95A 3CJ9A 3L6QA 2XZWA 3UNGC 4IDKA 2G8IA 4YB5A 2JZ5A 2MY8A 4ZLLA 1A5VA 3SMZA 4E7LA 2EFOA 5JVHQ 4ID8A 2PZSA 3I0RB 3TAGA 4NYZA 5LMUJ 4YOUA 2DTUA 1JLBA 4G9ZA 1QS4A 4JV5K 5AE1A 4CIOA 2HBYB 3FZHA 2JEIA 1X9SA 1FF2A 3KK3A 2JWLA 3I8BA 3RB6A 2V8DA 4DFPA 1GLEG 2CGLA 1VYAA 5CA5A 1HNIB 3PIOQ 4WFAL 2IBOA 2BRLA 3MTJA 3ZT1A 4JI1J 1RGVA 4E19A 4K0KJ 4DI6A 4ELVA 2PC6A 2PSZA 1Q1KA 2DGWA 4CI0B 2QZ8A 4FF1A 1HNZJ 2VFUA 2V50A 5HRRA 1SQEA 3UWTA 4ECRA 3DRPA 4I4BA 1YVUA 4WYBA 3WNGA 4H03B 1RACB 4M3UA 1NH7A 3IS9A 3NH0A 4JK9A 3WDOA 3KKSA 3AXMA 4OQJA 4MK8A 4CFCA 1EKRA 4DR3F 1S1WB 4DQIA 2E2OA 3IWXA 2FD2A 1JJ2M 4ECXA 4W92B 3OYEA 4JYAJ 2G13A 1MG7A 1RHRB 4FK4A 4O0IA 1GK8A 5KG4A 2CXEA 4BR4A 2FHOB 4Z37A 1W2BM 3A3OB 4ETZA 2GHVC 1K8AO 4K25A 1PSDA 2KT3A 3BGLA 2PO4A 3VF6A 1ZM9A 2NUBA 4KHWA 4A2AA 3D1HA 3TPQA 3LP0A 1JCFA 4A47A 2OPSB 4F7VA 3GPAA 2L9DA 1P9YA 3T6BA 4X66J 4ENOA 4F50A 1LAVA 3H3OB 2DPNA 5ETKA 3NGUA 4HI1A 1PKUA 2ATCB 1FTRA 2ACYA 2NRTA 1XTZA 1RADB 3JQJA 1JXBA 3I5CA 2BTFA 5AZIA 2DK2A 1U1KA 3CJ2A 3ZT4A 3PJ9A 5D3GA 2V4RA 1YF5L 1FEHA 3P6YC 3QBWA 3B8HA 4EHTA 3CO9A 3PUFA 1FESA 2MQPA 2JEJA 4TYBA 4YMEA 2O8BB 3EEQA 1WI8A 2VQFJ 3MM8A 3MM9A 3HFVA 4CEQA 1E3MA 4KGMA 3KK1B 1DQAA 5BR8J 3AGRA 1U7LA 4X4PA 4ZVGA 3PW0A 3J7ZT 3EKUA 1YITS 2HHHK 2CG8A 3FBCA 2GAGC 3HHLD 3VQEA 1EO1A 1JCGA 2V68A 3D54A 1RU2A 2LA6A 5C42B 4X4OA 1K44A 3MGJA 4Q0BB 5LJWA 3THXA 5F3ZA 4B3OB 2E6MA 3BB5A 4JV5F 1IKXB 2FJEB 2PMHA 1VK0A 2MZ1A 3FFKB 3IMXA 4WTYA 3AQOA 4CO4A 4DU7A 3IRXB 2NSCA 4HCBA 1HYSB 3MEDB 3OUYB 2E1MC 3LANA 3DOLB 3E9OA 3K9JA 3UKUA 3H08A 2IRXA 4DFMA 4F25A 3GYGA 1T11A 5FIIA 5KFQA 5C25B 3ZSXA 1L3TA 3L4QA 2RQKA 2KXFA 2OPQA 2CIMA 2C2KB 2A2CA 4GKKK 3NS6A 4FW2A 4IDKB 1YG0A 2RIJA 4BC2A 3JQKA 5GADU 3OTOF 3ILJA 1MN7A 3ZFVA 1M5PC 3AA2A 2DY9A 2HQDA 4DPWA 1NPPA 1GLLO 3W61A 2FJDB 2LECA 1JLBB 1U1RA 3SMPA 5CE3A 4YNQA 2BRKA 3V81A 1VFJA 2M88A 1HYVA 5M1QA 3KK3B 3MWPA 2DGUA 4CH1A 1RLCL 1OY8A 1YJUA 3CFPA 3HM9A 2F8HA 3TRGA 4QWCA 1HWUA 2QI2A 1F9EB 2YX6A 5KT7A 2FC8A 3RWUA 3HULA 3CCUN 3BPSP 4EU0A 4LSLA 4FLTA 2WC9A 1ZBUA 3ULDA 2Q1LA 3OQ2A 4RR5A 3TTFA 3W9IA 4DTXA 1RLDA 4CHNA 5I42A 1YI2S 4NB4A 2MTLA 3DRPB 2D0PA 2HG4A 3OTEA 2VOOA 4Y00A 1JNZB 3IS9B 1RE1B 3CDEA 5KFDA 2KT5A 3RR7A 1N5SA 1SKUB 1WG4A 4ZKAA 3OFGA 3VMFB 4Q43A 4BRQA 2A40A 4Y1DA 2RF2A 4C7QA 3FMBA 1TU0B 1N5YA 1Q81T 1HHTP 3M9NB 2K2PA 1NKEA 2A5XA 4EO8A 2VGMA 3NGKA 4HACA 1BISA 5B0CA 3U9DA 1NOYA 4FK0A 1ATNA 3ZCMA 3W5XA 2ZEJA 2M5YA 1IJJA 3IR5B 3AXKA 3A4TA 2R8JA 4OHXA 4XEIA 2UVRA 1MROA 4ZP6A 3LP0B 3I96A 3HHDA 1ZAWA 4DUYK 4MIWA 2OHDA 4JHDA 2E6LA 2IIHA 4J37A 2DR9A 3O4NA 3PR4A 4CBWA 3ELHA 4NLTA 1XI1A 4LF8J 3GL1A 3K58A 4DTUA 4WQ5C 2HHHF 4WKYA 2CNKB 4K7QA 1RQ0A 3HHLA 1FJ7A 3QEVA 4FWSA 7FD1A 5AZIB 3N5FA 3VQAA 3BO4A 4GC7A 1H2UX 1KKHA 3NGRA 1MN9A 4OKJA 3RMAA 3N9UC 5D3GB 3EJMA 5AQNA 1UEUA 3W0LA 2QL9B 4CNYA 3WIUA 1JJ2R 1NRKA 3NEKA 3MM8B 3MM9B 3LAMA 2IVMA 4ZCLA 1DKGD 1NLKL 1R31A 1ZPWX 2OIHA 3ZEUA 2D1CA 3NG8A 3J7Z5 1W2BR 2YNGA 2W25A 1NGGA 4WFBQ 1HW9A 4GKKF 1OMSA 3H2LA 3L0QA 2P9PA 4ZPWR 3ZZUA 4O3QA 4Q8EA 2IFXA 3PO4A 1T95A 3OFHA 1YJ7A 2YH1A 1NWKA 4Y2KA 5HQMA 1WEYA 3CJ4A 4R8UA 3THXB 1SH3A 3ZSYA 2CAJA 5EWEA 3QESA 1RT6A 3GOIA 2V8HA 3QNNA 3SQOP 3QIDA 1QQOA 3TI0A 1RJJA 3BF4A 4GVBA 3MD3A 5KFNA 1NGJA 3UKUB 2R9LA 2HWIA 3OW2M 4ZJLA 3T7ZA 4PG4A 5AJ3J 1SI9A 1U2FA 4EFHA 4QWAA 5AQVA 2OPQB 4PKIA 3UDCA 3ZTQA 4PY5A 3AV9A 4DSIA 3O6WA 3CD6N 1VC5A 3ZSWA 5JLHA 1XNRJ 3DXMA 5CHIA 2G0IA 1IWGA 4CE9A 2UP1A 1BWVA 1U25A 2R2TA 4K2JA 3UO0A 1L5UA 1QJHA 4HEA9 2NR0A 3PDNA 3BBBA 3VQ9A 1K73T 5HAOA 4AUKA 3KHHA 3V81B 2XMAA 4LQ9A 4QZVB 4DSKA 1YVNA 5KFKA 1NK9A 3EZOA 3M8RA 2CQ0A 3BO3A 1UVJA 1CQMA 1FWPA 5CZ1A 3UVJA 1JL1A 1Z2LA 4DR5J 2LA4A 4CD1A 4LSLB 1UVNA 4FNIA 4KAZA 2X1GA 5HBMA 4DV0J 2QWRA 4KHUA 2CVIA 4LF9J 3AVLA 1GLJO 2JLFA 1S0OA 4H0VB 2QKKA 2QWQA 2HFZA 5I42B 4J2DA 3I82A 2Q36A 1AXQA 1IBLK 1TL4A 2W2NP 4ZVRB 4DUYF 2EFGA 3JS9A 3V6JA 4QOTA 5LM7E 4E98A 2D5RA 3M05A 1NHVA 4YY3J 4B8AB 5LJ3Y 4USTA 2RF2B 2O1PA 1N5YB 3D2EA 4LD0A 1GX5A 3M8SA 4F0HA 2RDDA 5GAHI 4HACB 4LR9A 3AVNA 4IEEA 2BW7A 3CCVS 5GINA 3ZZOA 1I6JA 4FYXB 5A2QY 2IDOA 2ZVSA 1R6VA 1V3SA 3BUZB 4AXJA 1F5BA 1PJ7A 1FXDA 2F4FA 2W24A 2YWHA 1SJ1A 1MROB 3H5UA 2XO7A 2E5LJ 2ZOMA 4JHDB 4IKFA 2BM1A 4RBTA 2CQBA 1DJ0A 1X9JA 4KC5A 1G3OA 1RTJA 3IFRA 3VENA 4CJEA 4M3YA 2VGNA 3THYA 2JHEA 3A8KA 2D69A 3HHLB 3VCDA 3UFCX 5F1XA 2HSEB 3G6XA 2KJVA 3R6GB 2BQUA 3PCOB 4A48A 3FJ2A 2H3GX 4CJ5A 1OH6A 3FSXA 4J91A 4TU9A 1IQZA 2HVHA 2IC3A 2XYGB 4HUEA 5CQGA 5KFAA 1B92A 4B9MA 2W6LA 2RE2A 2KLAA 4JI6J 3C7NA 1DZ5A 2HVIA 1YXQA 4WPAA 1X5OA 4FM1A 2IJRA 4UT4A 2F1FA 5GADP 1ASUA 2OAUA 1NDLA 2V94A 3ZEUB 4IG0A 2YNGB 2HVZA 1DY3A 1NNDA 2P9PB 4B3RK 3O3FA 3O9UA 5LT5A 3UN2A 4B1UB 4CF1A 4P2SA 4M1KA 3IAS9 4RU2A 4WFYA 5IV3A 4R8UB 4FLVA 4DX7A 1RT6B 1PIEA 3PJWA 4X4UA 2OP5A 3MHYA 1JWWA 4CFDA 3IM8A 1RDAA 4OJ3A 1HQEA 3V1QA 4JRPA 4GVBB 5AXNA 1MMNA 4ZVQB 1EXQA 1SVDA 1BOTO 1UL3A 1VCTA 3SQ0A 3Q8VA 3MEKA 4TU8A 3AARA 5GIPA 2MKIA 4OMFG 3B78A 2G2OA 3OYDA 4ZJOA 2FSJA 3CMAN 4I0WA 1VSIA 3EE9A 2WK4A 4N8OA 1Q82O 2VJUA 2AGQA 3DXMB 1V6HA 1J5EK 1IBLF 3WX8A 5HRPA 1RWPB 5F9LA 5I4MA 3PV8A 5KGWA 1TZ0A 2V52B 1YBUA 2LXIA 3W3DA 3EVOA 3HI0A 3AAWB 2QIFA 4GNIA 3QGPA 1WBBA 1S1XA 2Y3YA 3WHIA 2LDIA 1RBOB 1UFKA 2D1KA 3ZSQA 2B4JA 1WF1A 4JS5A 3ISNC 2XYHB 1Y7PA 3A2FA 3V9UA 3OBYA 2DH8A 2HBRB 3UVJB 5HJYA 3J80U 1XK8A 4XH4A 4PL8A 1D8ZA 1RAEB 5HBMB 3G87A 4IDHA 2XG8A 1HR0J 4EYHB 3RU0A 5ETOA 4H0PA 5KPRA 3MUTP 3OW2R 2RILA 5SWMA 4JI4K 4URGA 1VQLN 3KD1E 3RYLA 1D4XA 1N56A 1VSDA 2ADCA 3FGUA 4DU3A 3AY0A 2AWZA 2RUSA 4CW7B 1DURA 2E5HA 3BN4A 3H1VX 2Q2RA 2CZVC 4E1MA 3D2EB 3M1VA 3ZTOA 2CQIA 3OYIA 1U1NA 3CJBA 2GX9A 3EO3A 2ZJQQ 3CUNA 5D77A 3WX4A 4NZ7A 4CLYA 4JKDA 2CGJA 2L48A 1SV5A 4CF0A 1NDPA 4C8LA 5L1KA 2IYIA 4FYWB 2IOCA 2WBNA 1VSMA 5C2GA 2HB5A 2PN6A 3BV8A 1J6ZA 1U2VA 2XCPA 3OYHA 1YAGA 2XI3A 1W0HA 2HOEA 2IIRA 4FJ8A 5HMZA 1F3VA 5KFIA 4LF5K 2B43A 4NXNJ 1S57A 3GIIA 3C66A 1RTJB 2I8EA 2PEBA 4R25A 3THYB 5KOWA 1F3FA 4E3SA 1BHNA 4ZOSA 4ZN3A 2AGOA 5LMUK 2KHCA 4G3IA 1YJNN 2VFTA 4ID1A 3PSFA 3KNAA 2VV5A 4OZJA 4DFKA 4DQRA 2GAHC 4OYMA 2WB1D 2KFNA 3G6ES 2IC3B 5BPMA 3ZZ0A 4C2MA 4FJKA 1RKIA 4A5AA 1Q8KA 5HN0A 2IBKA 2VD3A 3C7NB 1RWUA 5DM7L 3N4WA 1QD1A 5KFRA 4JI1K 2OEKA 4USVA 2W7OA 4K0KK 3HSGA 1U47A 1FDDA 2LSNA 1B9FA 1VLOA 1K9MO 4DTPA 3H0PA 1VHIA 2DIUA 1HNZK 4IG0B 3EXYA 1Y9OA 4BGAA 5M2UA 5ETVA 4MDAA 4JI5J 3QZ7A 3BN7A 5EWGA 5BRHA 3T1YK 1LNQA 1J5EF 2NXNA 1M5VC 3DFEA 3R1LA 2DNKA 4TY9A 1WSRA 4ZPTR 3OXLA 3SFUA 1HQEB 3M32A 3SQ1A 4JYAK 4DHYA 1ZA2B 4P52A 4RPFA 1RHKB 4P6QA 1XUPO 1BXNA 3F5TA 4ZPDA 1OYDA 4PQAA 1N32J 4NMXA 3MXIA 2J5AA 3OTDA 2FPHX 3GU0A 4NLWA 3FFIA 3G71S 3T69A 2LQ9A 2I5JA 2DNOA 3ZZPA 4PXDA 1C1CA 3MPDA 2R8GA 3GR0A 3PW5A 1VBYA 5DZ6A 3AA4A 2Z58B 5ETRA 4BBYA 4JI4F 3SSQA 3AOCA 1TUVA 4BR5A 1RBLA 4NA1A 4K4TA 3G8SA 2VICA 2CDQA 3LTOA 3VWSA 1S1XB 5AQJA 3OD2A 1K47A 4RCHA 3P96A 3SCXA 3AA5X 3EVMA 1EX4A 4M5KA 3OYKA 3D1OA 3CE8A 2DRAA 1Q53A 2FDNA 3IN5A 3QT5A 2KB2A 1E6YA 2KFYA 1U09A 1QUVA 2KM8C 1VQ9N 1EQMA 1NSQA 4I69A 4QJVA 3VEOA 3T1AA 2QMXA 3K0JA 2VQFK 4KV8A 4USKA 3JAMU 2CZ9A 3LZJA 3BR8A 5BR8K 1EARA 4HTLA 4RWTA 4DV6J 3D9BA 1D0EA 4KGZB 3WIVA 4LF5F 3IWNC 5KT4A 2OSQA 2P9NA 2XZTB 5AQKA 2UV8A 5D4LA 5F0WA 4CNZA 3M1VB 5LMUF 3NXZA 5HO4A 5AQRA 5SUHA 4A8SA 5EX5A 1R8BA 4W5OA 3CC7N 1QLNA 2XMUA 2R42A 5BRFA 5IXUA 1NPRA 2YKMA 1SV5B 3QSIA 3ZLJA 3HP6A 1NOZA 4C1NK 4M41A 1VK3A 3AT1B 2Z2ZA 3AVFA 1S9EA 4JI1F 4CGIA 1F1BB 4G65A 4K0KF 1U2VB 1TKTA 3QFUA 5HMWA 3ZX0A 1HNZF 2M70A 1PG5B 4AHSA 2VBXA 4LBHA 5KG7A 3C6HA 2E2QA 4C0OC 3CGIA 1NBWA 1YWXA 5BYSA 1KN6A 3BQ0A 3ENVA 4WU2A 2MB0B 3T1YF 3T3FA 3MUMP 2FY1A 2BANA 2BQ3A 1Q7LB 1PYSB 1Y10A 1WC1A 5DDQC 1NAQA 3MPWA 3ENWA 1NU4A 3C14A 4FWKA 4ILHA 4QIVA 5J2NA 1S97A 4ILJA 1B70B 5K8PA 4JYAF 2AIRB 3CD0A 1D5AA 4IOCQ 1WACA 2FZGB 1U48A 1SQKA 4E7KA 3AO2A 4Z4EA 5L8RC 3QT8A 3DU5A 5AXKA 1QHTA 2HBLA 1CS4A 4LH5A 3C16A 3TUJC 1E6VA 3C6UA 2OMLA 4B1VA 4C9DA 2HBZB 5B0FA 2ASYA 4PXBA 4BRIA 3WC0A 1Q9XA 2IY5B 3MI7X 1VQ7N 1NPKA 2XI2A 4JUZA 2WCXA 3OJSA 4O0NA 3D2WA 2P9GA 5KI6A 3HVTA 4ZVSB 4J9LA 4USWA 4NYFA 5IC6B 4BGBA 5TKWA 4PQUA 3M32B 1WHWA 3CO0P 4B3SK 4ZDNA 4NA2A 3P83D 5SZTA 3TU5A 5BYRA 2XLKA 2PFFB 4B1YB 3H40A 1K0VA 1UFLA 1GMUA 3U3GA 3DXKA 4X62K 4C3MA 4URQU 4X4SA 2C2MB 3L2UA 4M5NA 4O23A 1L3UA 3H6EA 3FFIB 2WBRA 4FM2A 1MLAA 1Q78A 3S1TA 2I5JB 1C1CB 2VQFF 4BC3A 3T5KA 1RTIA 5BR8F 3B6PA 4C98A 4YHHJ 4DX5A 4HHUA 3UN5A 1XBWA 5AQSA 3WT0A 1D9FA 5CR4A 2EVZA 4P72A 2BOPA 1U6BA 4Y28C 2DXFA 2ROEA 4DMNA 2ZH8A 1ACMB 4Q2MA 2E1CA 4DLGA 4WE1A 3BH7B 3PIPQ 2Y0SD 1NLVA 5AQGA 5AE2A 4DLEA 3UR0A 1SH0A 1VSEA 3DLHA 4LFAJ 4ZVHA 1URRA 3DN9A 3QDKA 1N34K 1E6YB 1YJ9N 5JMVA 1X7VA 1XEZA 2A0FB 4KV8B 4IH7A 3CCUS 4URSA 2LQBA 4CT8A 2Y9HA 3J80O 1GQEA 4L3QA 2O3DA 1VLYA 4OV1A 3FDSA 1RAGB 3KG4A 3GG4A 4LY7A 2P9NB 3A3PB 2CQCA 5GAGU 5KFZA 4E2FB 4NLGA 3KZBA 3NH1A 4G1PA 3P39A 4QWDA 4TY8A 1OH5A 3B82A 2I38A 3E9LA 3TR8A 3AO5A 3OS1A 4FJ9A 3H5SA 4UUWA 2NPFA 5ITHA 1ZAXA 3PIOL 4W5TA 2G9OA 2X6NA 5CH7B 3A8EA 3FR0A 2IMWP 1HW8A 3UN3A 2YKMB 4X2BA 1NJYA 4CZGA 1RAOA 4NASA 2DCUB 1H73A 3ISZA 5AQXA 2MKSA 4EBEA 2F7TA 1S9EB 4O8UA 4LF7J 3R3LA 4ILMA 1TKTB 3AVHA 1H6KX 1GMWA 3M2UA 3WEEA 3A3NB 1IWAA 2MKCA 2ZGYA 3O8WA 2CPEA 4Z4HA 2W8LA 2BJ7A 3TSPA 3GTYX 2VKZG 1SXLA 4GY2B 4OV6A 2JWNA 1TUUA 1XNRK 3OLAA 4ATNA 3BKUA 1FHTA 1EETA 3SQ4A 1ZS6A 1RA6A 3UD5A 3VQPA 1YZ6A 1OH8A 2BANB 3CCWA 3MMJA 4DL6A 3RR8A 3KDOA 3GIJA 1EWQA 3C14B 2OLWA 3T1HK 4ZCMA 5J2NB 5DGAA 3F73A 5H9FK 2AU0A 3VQQA 2QTWA 4B3SF 4OZ5A 2P9IA 2YY3A 1VRQC 2H51B 2LDYA 3LGNA 3VN5A 1CEZA 1RCXB 4X62F 4QU7A 3CC2N 5GVQA 3NWGA 2EK6A 4J90A 4TKTA 1CS4B 1XJWB 2IM0A 3C16B 1XMOJ 4FJGA 2BW2A 3IRWP 3HKZD 4LFBJ 2XHBA 1E6VB 2NPIA 3C6UB 1LWXA 2DTJA 3P38A 4ZLNA 2VOPA 1K8KA 1WHXA 4OJGA 1RT2A 2RDIA 1GX6A 2Z57B 3QICA 4YY3K 3HVTB 3BY5A 1C0GA 5LXRA 2AP6A 4CJSA 4BE0A 4PQUB 1B0TA 5KT3A 4JKFA 2MEWA 3KKRA 4Y3CA 3RRHA 3DHXA 3UQSA 3KUGA 4TN2A 4F3MA 1N33J 4WQ4C 1XMQK 3DXKB 3GCXP 3Q0AA 4BRKA 1N34F 2DY4A 3O44A 1PC4A 2G0JA 1S48A 1UJ4A 3BGUA 4V19X 1HD1A 2WVFA 1C0MA 1NB2A 3KHRA 1WAJA 4PYAA 1CPZA 5IQ6A 1RTIB 2E5LK 3AJ2A 2GCFA 1IBMJ 4XPEA 3HFKA 5IV4A 5ETSA 4J9MA 1SC3B 3LWMA 3HSCA 2FUG9 1WN7A 3S7RA 1JLCA 3CD6S 3V6HA 4PPZA 4QQBA 2LU2A 4NCGA 3AODA 2DB1A 3DXSX 5HVHA 3KOAA 5AFUA 4WE1B 4CEFA 1CVJA 4IG3A 4TLRA 3J8AA 4NO7A 3J7YI 1OS5A 1BO5O 2XRIA 3TARA 1HKCA 4DOZA 5EOYA 3TAPA 3PTWA 4B3TJ 4ERDA 4IH6A 4AM7A 2MZTA 4LRFA 4I1TA 5FD1A 5HI7A 3THPA 3ZX2A 5KFYA 2GO9A 2CPHA 3RMCA 4ZPAA 3ZT2A 1WSFA 3MCNA 1ZM2A 1RDWX 1FWLA 1Y4ZB 4U7CA 5AQYA 4TQSA 1KXPA 3RB4A 2FVSA 2GVZA 3IR7B 2KYXA 4FYVB 5KT2A 3I8DA 3OSPA 2XMMA 3JAMO 3QAEA 2UXBJ 1SJQA 5KT5A 2GA7A 3PO5A 3Q23A 1HJOA 5J1EA 1WC4A 1ILYA 3R7BB 4TY8B 1VJWA 5LSLA 2CNNB 2K3IA 2AYMA 5E3QA 3PKMA 1OVQA 1PC5A 1R8CA 3EX7B 3GIRA 4TLQA 4ZMMA 3T1HF 2O4IA 2JLEA 3L2RA 1F21A 2V34A 3T5JA 4KH5A 3AVGA 1GFWB 1AA1B 2XLJA 4D3GA 5DQIA 2XY7A 4FBTA 4BE2A 1FD8A 3M2UB 3WEEB 4KB7A 4DR7J 3JSYA 3M4XA 3K0SA 2LU1A 3M9OB 1T3NA 4C8YA 3CC4N 1GLCG 3J81U 1T6DA 3MR7A 5C2FA 2ZHOA 4C11A 3QRRA 4FPRA 1HKBA 1EETB 1VJQA 1MMDA 1YUWA 3H1QA 2O8DA 4IUFA 2CYYA 3PKYA 4TSXA 4FM0A 4ID5A 1LXJA 3FC9A 4EP4A 4M7YA 3QT7A 2B4UA 1YRUA 4BR9A 5J2PA 4YY3F 3W8PA 1CXUA 5HQLA 2VA3A 3EE3A 3CJAA 4BG9A 3WC2A 1UWAA 2F3JA 2IVFB 3I5BA 3N28A 2AEMA 2P9IB 1BIUA 1REGX 1HBNA 4A8OA 2QX0A 5CZXA 1KVIA 1WC6A 2UVVA 1XMQF 3KD5E 3FRYA 4BC9A 4DR3J 2HHQA 2N7CA 2KKZA 3TO8A 1HI8A 4Z94A 4A5BA 3SCJE 1HR0K 8RUCA 2ROGA 4EWTA 3GONA 4BRPA 1RZMA 2DHGA 4FS1A 2E5LF 3SPZA 1K8KB 3PX4A 3SXLA 5KQ8A 5E3PA 4L75A 4YDUC 3BKTA 2W01A 4AL5A 2C42A 1RT2B 4QWBA 4C97A 3NRBA 4CK3A 3QFWA 4MH8A 4L74A 4Y2CA 4IWVA 1N52B 3RG6A 1WD6A 1C6VA 2XZDB 2D9OA 2GV9A 1FK9A 4ZLPA 2YNHA 2DHXA 4QIWD 3K5OA 3UD3P 3QRQA 4DL0C 2FBYA 4DV4F 3OR2A 1IVZA 3Q7BA 3BQ1A 3ZSVA 2HHPA 3BZCA 3V9XA 5HMYA 3CULA 4IBNA 3SCLE 2CQPA 4KJIA 3CCJN 2Z2MA 3RBZA 1F5AA 2HBJA 1C1BA 3I56N 4FYDA 1HLWA 2ASDA 1Z1ZA 4X84A 4WFBL 2I7NA 4KTQA 3US5A 5GAGP 4NXNK 2X1FA 2KH9A 3QFHA 3NNAA 3SDEA 4I2QA 5BPNA 4CEEA 3CMAS 2E4LA 3RW7A 2PFUA 3CFOA 4QBUA 1XNQF 1JLCB 4FKXA 5JS2A 3D4JA 4NCGB 3NKYA 4U9RA 3OYGA 1NH8A 4IG3B 1R3NA 3SZ2A 1B0PA 5LL6Z 4JD2A 3DCAA 4J5OA 2VASA 1IH7A 3OLBA 3V6KA 2EPIA 3AA3A 4PPDA 1WSJA 2L3MA 3SQ2A 4E8UA 3H7HB 2KVQE 1UA0A 3GV7B 3SAGA 3LALA 1BE4A 2H4WB 3MR2A 2EC0A 2NSBA 1T9XA 1KVCA 5EX3A 2L9NA 4WKRA 4ZVUB 3QJPA 3MN6A 4I2PA 2LQ5A 4HTUA 4DV3K 4CO3A 4FJLA 2WVBA 1PO6A 2OUGA 5A6WA 1ZBFA 4RUHA 5AFUH 5IWAK 4JI5K 5B0AA 2G1DA 2GVZB 1RBUA 3RUBL 1W25A 4FWNA 4B9QA 1FNMA 3CCMN 2FC9A 5J1EB 1VQLS 3JQMA 5ADXH 2XTJP 2QWOA 2AYBA 4CERA 4B9UA 3NVMA 3TAEA 5JXSA 4CGJA 4OYIA 5AQZA 4N56A 3A0IX 1V5IB 2QYGA 5D0EA 5DG9A 2QA4N 3TVZA 1QSLA 3OTOJ 2YWKA 2DO0A 4PR6A 2E7WA 1HBUA 4X64J 3RBDA 5CXTA 4BQLA 1N32K 1FXXA 4Y2IA 3K5MA 4J9PA 2BUPA 1QVFM 3WBZA 3JYTA 4FZZA 4BRGA 3TJAA 3RBXA 3VAFA 1BCMA 1HX1A 4DPUA 4ECQA 2HWTA 1FJEB 2FLNA 2LXFA 1JIHA 2XY6A 4ANDA 4IO1A 5KTQA 4N5SA 4C11B 5B08A 1H3DA 4UY8O 3HHNB 2WSEC 2O8DB 2YCHA 3LZIA 2X51A 2AQ4A 4DTMA 5DQHA 4ID5B 3DRXA 2QSWA 4GKJK 2D74B 3PJXA 2Z8QA 4CYUA 5J2PB 4CQ1A 4OHZA 4OI1A 2ZOFA 2JNJA 2GFFA 4CJFA 1YJNS 2QG9B 5L1JA 2QC3A 5HRSA 4MKVA 1HBNB 3GG1A 3CDUA 4HH1A 4A57A 2JX2A 1FCAA 3CCTA 3K8VA 2DGVA 5FLXU 4ZVOB 1VSJA 2V9WA 2DR5A 1IO2A 4B1WB 2YHYA 3ZXWA 1RAFB 2DHAA 4NEYA 5B8HA 3WZ0A 4CK2A 1WDDA 1RYRA 4JOUA 1RBVA 4K4VA 3VAMA 4DV6K 3RGIA 2UZAA 2CQ4A 1HPMA 3CJTA 4KBOA 5T41A 3W2VA 5BN8A 1JK9B 2OTLN 3DOMA 4CGDA 3SQGA 3BZKA 1YJTA 2Q0UA 1OY6A 2FZCB 4Z0UA 1CJKA 4U67Q 2Q31A 4YEAA 1FK9B 4Z4CA 2LP4A 2L08A 2YNHB 3QPIA 3VQCA 2AJ1A 4KHPJ 5EWFA 4Y6IA 4N47A 3F2KA 4PAAA 2WW8A 3OR2B 2WUSA 5FPEA 1T9TA 5KFBA 2FJXA 4B8CA 2HHHJ 1ASVA 2E1YA 4F02A 1MWMA 2V8VA 1C1BB 1Y5LB 5E0OA 2Q3PA 4R79A 1OPZA 3R5DA 4JAXA 1UPMB 4YB7A 4DV3F 3CNQP 3SDEB 4M3XA 4I2QB 4JRQA 3SBGA 3FEXB 5IWAF 2M3DA 4JI5F 2OYQA 4J8FA 5CZ2A 1ZBHA 1F6TA 3H4BA 2ZH5A 3FEYB 5HK4A 1RT3A 4IO9Q 2H1YA 3NAIA 4K43A 4B9SA 2AZ1A 2FYXA 3DYAA 2NRRA 4JD2B 4H5VA 3MMAA 3U6FA 1FRKA 4YB1P 1VQ8N 4BC5A 2Y8YA 2BVZA 3Q8UA 3VAJA 1SH2A 1TK8A 2BMBA 3H90A 3QMQA 3RW6A 4GVMA 1N32F 1R43A 1C2PA 2JRSA 2B7CB 5KG3A 4MT1A 4I2PB 1YX2A 3A8YA 4AH9A 1VQ9S 1X3NA 1XR5A 2J6TA 2KW4A 3BREA 3R5CA 4CF8A 1HWKA 2DGOA 4FWPA 4KPCA 4LBIA 4EAHD 3OR1A 1HNXJ 3EKSA 1VC0A 3MPVA 1SIWB 2ZH6A 1R59O 2WONA 1QQMA 1D3WA 4UW2A 4GKJF 2YBVA 5BN9A 2MZJA 1BUXA 3Q8RB 3BYPA 1TV6A 5HJXA 3HK2A 4IR9A 3KLEA 2U2FA 2GWJA 4FNHA 2B4VA 3BQ2A 2ZH4A 1HBUB 2ZE2A 2XHWA 4I9QA 4WBFA 4BDYA 1P1TA 3JYTB 2NXJA 3CC7S 2RB7A 2R7OA 2EEYA 3QIOA 3ILOA 3TANA 4B9NA 3ZNJ1 1RWKB 5B09A 4MK9A 2J0WA 3UW1A 1F2GA 3W7BA 2ZHAA 3VEVA 2C22A 3MN9A 4DV6F 5DM6L 3AA8A 4ES3A 2E20A 1U6FA 2HYIB 4CO2A 1MNEA 4J9QA 4FWMA 1ZM3A 4CYUB 3EGWB 1RT4A 2ZKUA