2YNHA

Hiv-1 reverse transcriptase in complex with inhibitor gsk500
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
total genus 164
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynhA05
2KW4A 3QZ8A 2VG7B 4NLDA 3VA3A 1S1WB 3H4DA 3EZ5A 1MU2A 1NK5A 1T7PA 3AVBA 3KIOA 5KFCA 4IG3B 3V9WA 3HT3A 5KFTA 3KLIB 1VRUA 3CJ3A 4OPJA 2WCXA 1X1PA 3PW2A 1VSKA 1NK4A 5HP1A 2C2RA 2KFNA 1BQMB 1S1TA 2YHAA 3S3NA 4CJ5A 4CHOA 2AJQA 3QEWA 3H08A 3KLFA 5T14A 3B6PA 2I5JB 4HVJA 4N76A 4DSKA 3KLEB 1D9FA 3PJXA 2GBZA 5KFPA 1C0TA 4DG1B 4WXOA 4M95A 2F8TA 4XPCA 3L3VA 3AVLA 1CZ9A 3VQ9A 2D0CA 1N56A 3QIPA 1VSJA 4CJSA 5DQIA 3KKSA 4G1QA 4J9SA 1W0HA 1K6YA 1NOZA 3NH1A 3LP2B 3H5SA 3RB6A 2RF2B 3SQ1A 3MF5A 5L1LA 3AO5A 3PX4A 2W7OA 3NF6A 1R0AA 4CIGA 1HPZB 3AVHA 3V1OA 2B43A 1ZBIA 5D3GA 1QAJA 2Y1JA 3UIQA 2FJVA 1A5VA 4ZHRB 3AVMA 5KFDA 1KTQA 4YQWA 4OKKA 1SUQB 4G3IA 3UDLA 3TAPA 2OPPA 1RT2A 1S9FA 2YNIA 2ASLA 4K50A 4C8OA 4ECYA 3QZ7A 4ZP7A 2LSNA 3ZT3A 3L2WA 1QUVA 4EO8A 2W9BB 4Z0UA 3DMJA 4ZTJA 5CYMB 5HLFA 4KHNA 4QWCA 4DTNA 4M3ZA 1JLQA 3T5JA 1SH0A 2JEFA 2AGQA 4DF4A 4PA1A 2G8WA 2W7PA 1TK0A 3QINA 4CF1A 3QYYA 4FK4A 3I5CA 4Y2CA 4TY9A 4C8KA 1LWEB 4QWBA 2BDPA 3I5BA 2X6SA 4W5OA 5DMRA 4B9SA 3OYAA 4ED0A 4QWAA 3WNEA 1ZBLA 2RPIA 1VSLA 4CK2A 1LWCA 3QGIA 1C1CA 2BQ3A 3TAMB 3KHRA 3OL7A 1Y97A 4K4SA 3AA4A 3NBPB 2OA8A 3QO9B 4MKAA 1YVFA 2W9CA 4FZYA 1QSYA 3HP6A 4TN2A 3DI6A 1W9HA 4J9KA 2IOCA 4HCBA 1JLFB 4WFXA 3NHGA 3RWUA 4B9VA 3EY1A 1L3UA 1I39A 3C6TA 2HNDB 3TAFA 3NGIA 4J2BA 5K14A 3CG7A 1U45A 1LW0B 3K2PA 1KVBA 4OJRA 3OYDA 3GV8B 1U09A 4H4MB 2J6TA 1D0EA 2OYQA 5DG8A 4NLPA 3GV7B 5I42A 3S3OA 4DSFA 2Q3SA 4TY8B 3HPHA 5C42B 2J6UA 5KT6A 4OKEA 4B8CA 4M3UA 1VSFA 3PO4A 1J9AA 1TKDA 3DOLA 4O4GA 4O0IA 4YNQA 4RW8A 4FK2A 2QV6A 4CJEA 3D0PA 1S0OA 3LP1A 4NCAA 1HQEB 4KTZA 1ITGA 4KKOB 2DTUA 2FJXA 3AA5X 4B3OA 1GOBA 2AQ4A 2AX1A 4J2DA 3H5UA 3E01B 2E9ZA 4FLZA 3QESA 1SV5B 1TP7A 1RNHA 2WONB 3VQPA 3RBDA 2GIRA 4DS4A 4OVLA 1U48A 1WN7A 3RAQA 3MAQA 3QGHA 4Y34A 2BE2B 1RTDB 4CHYA 3SI6A 4W5QA 2D3ZA 4CF2A 3OS1A 5HRPA 4IFYA 4DL7A 1S9EB 3SJJA 2RDJA 4CEBA 4ICLA 4LQ3A 4DFJA 1VSDA 1HYSA 4KTWA 2IM0A 4B08A 1U47A 2R2SA 4MIBA 4LH5A 2GUIA 2BANA 3PO5A 3RRHA 4ZPCA 2OPRA 3MECB 1EP4B 4FJLA 4J9PA 2WB4A 2D7SA 2YKMA 1HYZA 4NLVA 1B9FA 1RDRA 3K57A 3DM2B 1RTJA 2FJWA 2ZQBA 4NLOA 3ITHA 2DPIA 3VQ6A 4DL2A 1RDBA 4E0DA 2R8KA 3PVXA 2OH2A 1T03B 2RDIA 1QE1A 1REVB 4QAGA 1I3AA 2EX3A 4JV2A 1TV6A 3DRRB 4EBEA 3PR5B 2JEJA 2B4JA 3G0ZA 1DTQA 4FJKA 2QKBA 2IJNA 1KHWA 4M3WA 4WE1B 1C2PA 2VG6A 4FLUA 5KT5A 4Y3CA 3RB0A 1XHZA 4LH4A 4KFBB 1LWFB 4CGIA 3CVKA 4F3TA 1X9MA 4IQXA 1KFSA 3OL6A 3H40A 4EEYA 1XR7A 1WNSA 5KFWA 3SV3A 1WSIA 1C0MA 3TR8A 1JLCB 4KV8A 4HTUA 4K4UA 4DU3A 4F4XA 3IRXA 4DTRA 2HWIA 4KTQA 3FFIB 4CECA 3ZSXA 1RT3B 1HNVB 4AHUA 4Z4GA 3PW5A 3QEXA 4PQUB 4CHNA 2QXFA 3KLVA 3OYNA 1S1VB 5EWGA 2R8JA 4KB1A 4F4WA 4FS2A 3KK2A 1X9WA 5KGXA 3KK3B 1JXLA 3E51A 5L1IA 3I0SB 1SH2A 1S9GA 1JL1A 5F9LA 4MFBA 3BGRA 2YNFB 1MMLA 3CFRA 1KCFA 1XWLA 3OL9A 4FM1A 4DMNA 2HNYB 1VRTA 5EU7A 4NLRA 2WOMA 1ZTWA 3PHEA 3U3GA 4WYWA 1ZBUA 3HVTB 5I3UB 4CHPA 3JYTB 3Q8QB 4R8UB 2ILYA 2QE5A 4LD0A 4BDPA 2KZZA 1EX4A 4E7HA 1X9SA 4NRUA 3KD1E 4KO0B 3SUOA 5KFXA 3KOAA 4HHTA 3OSPA 2ILZA 4ED8A 3AV9A 1YT3A 3PJWA 1DLOB 4Q44A 3EYZA 3S9HA 1JKHA 1BQNA 4CJKA 2ZD1A 5HBMB 3RMDA 4LSNB 3DDKA 3QIDA 1FKOB 4BE0A 1RT5B 5KFSA 4ZVFA 1HNIA 3DYAA 4NYNA 2B6AA 1D1UA 4FJ7A 4C8NA 3QNOA 1NHUA 2HW3A 5J2MA 2C22A 1JLGA 1L3SA 4DL5A 5KFAA 4RU9A 4Y1CA 4RUCA 1EKEA 5SZTA 3HXMA 4EYHB 3Q8PB 3JSMB 2GC8A 3GIMA 1T05B 1DTTA 1WSHA 4ECSA 4I2QA 3PW4A 2AGOA 5KFYA 4FBUA 3M8RA 2Z1HA 3F9KA 1YTUA 2IM2A 2A1RA 3K5NA 4DSEA 4M3RA 5HROA 4O44A 4FW1A 5KG6A 3KK1B 1QS4A 4IH5A 1TKTB 3C94A 3CYMA 3D5MA 2E9RX 2IS3A 3DRPB 5CYQA 4FK0A 1BCMA 3LZJA 4DTMA 4Q5VA 4U7CA 1KLMB 5KFLA 2HVIA 3V6KA 3VA0A 2RKIB 4NLSA 2W8LA 4BACA 1BHLA 4RW6A 3NE6A 2D3UA 4LY7A 1RT7A 3WNHA 3ZT2A 1S1UB 5FRMA 3NGZA 5F8GA 4K8ZA 2HMIA 4FJ9A 3ZSVA 4W5RA 1GOCA 3GIIA 3ZSRA 3UQSA 2XO7A 3F73A 4NYZA 2EHGA 3PZPA 2YNGA 4IR1A 3NF9A 2R2UA 2P1JA 4FJGA 3DLEB 5F8MA 1G15A 4OKJA 2F8EX 4CESA 4IG0B 2YKNA 2JEIA 1ZYQA 5KFJA 5KRSA 4RNMA 3AVJA 2OPSB 3V9UA 1TKXB 4O3NA 4IFVB 4F50A 4KSEB 3V6JA 4CJRA 2XY8A 1B92A 3CWJA 5E41A 5KFIA 1NKCA 2E6LA 1JLAA 3L2QA 1MU2B 1RTIB 5DK5A 3VQ7A 2G8VA 3CDEA 4MK7A 4PWDA 3C95A 4Q0BA 2YNHA 3LANA 5J2NA 5KRTA 2VG5A 2R8IA 3OYEA 1HJRA 3UPFA 4IDKA 5HP1B 1TL1A 3KNAA 4F4ZA 1RAJA 3RAXA 3K5OA 1S1TB 2IBKA 5HRNA 1NJYA 3LAKA 3O3FA 1TKZB 2IM1A 1ZTTA 2KZMA 3GILA 1C6VA 3RB4A 2XGQA 4OGEA 1KVAA 4QOZB 2D0BA 3SQ2A 4IOBA 1HQUA 2GIQA 3CDUA 3KLGA 5KG2A 3ZSWA 1WSJA 2BQRA 2HHQA 3AVNA 2UVRA 3EPGA 4M41A 1C1BA 3T5KA 4ID5A 2HWHA 4RZRA 4ED3A 3IGVA 4NLXA 1RCHA 4C8MA 5J2QA 2VWJA 4KHWA 1R0AB 4PUOA 4E1MA 1RTHA 1TK5A 4CEZA 1N5YA 4GMJB 3T3FA 1RT6A 3OLAA 5C24A 3MEEA 3MEDA 3FSIA 3MFHA 2R8GA 2IA6A 2UUTA 2W9AA 3LALA 4CEEA 1UWBA 2VG7A 4LSLB 4RNFA 2YNIB 3LPUA 1S1WA 1CLQA 1RBTA 1VSEA 4WZQA 3ZCMA 4CEOA 4IG3A 5KT4A 4ELTA 4FJ5A 4I2PB 3KLIA 1RYRA 1RBRA 1D9DA 4KHQA 1GX6A 2OPQA 5KG7A 1JLEB 4FLXA 4CEDA 4N47A 3NL0A 4NLYA 2ETJA 1QAIA 3SFGA 2I5JA 4ZP6A 1FKPA 3OYCA 4IKAA 2ZE2A 4J9QA 3LAMA 4EP4A 4CF8A 4DG1A 3ZSYA 3ZSQA 1IH7A 4O5BA 1C1CB 4EZ6A 2IC3A 4CGFA 5C5JA 5DQHA 3GV5B 3M8SA 4ED2A 4W5NA 2W9CB 4DTPA 5J1EB 1KVCA 4OGCA 5L1JA 1QQCA 4F4YA 1RBSA 4GC7A 4MK8A 3LP2A 4I7FB 4QW9A 4BWJA 4M94A 4CF0A 4XIUA 3C6TB 1J53A 3AVFA 1WSEA 5KG5A 5K14B 1S10A 3H5XA 2BR0A 3HJFA 1UOCA 3AO4A 4KI4A 2UVWA 1RDDA 2WRMA 4KREA 3ISND 4IRCA 4DSIA 2OZSA 3OS2A 3NCIA 5I42B 2E4LA 3PV8A 3K5MA 4DQRA 3H2LA 1OS5A 4ZTFA 1HRHA 5CYMA 2ASDA 1RA7A 4RUAA 4CGDA 1EXQA 4IRDA 4RW8B 3DOKB 5C25B 1RT4B 2R7YA 4DTOA 4M3YA 3HKWA 1C0UA 1FK9B 4KAIA 2YV0X 4F4KA 3HP9A 4KB0A 3OYBA 3VQ8A 2XRIA 3WNFA 2G8UA 4B9TA 4DF8A 4IH6A 4CEFA 3RMAA 3MXMA 1N6QB 3I0RB 2JC0A 1IKXB 3OYJA 1BGXT 1SL2A 4Y1DA 5KFVA 3BQ0A 3TAMA 3M8PA 4K4TA 3H59A 3NBPA 3TI0A 3CJ0A 3GIJA 3K58A 3OYMA 3B6OA 4ICLB 2FBVA 3VQQA 1Q9XA 4OPKA 3MXIA 2V4QA 1J5OA 4HUGA 2Z1IA 4BDYA 4CJPA 2OPRB 1LAWA 5HRSA 3HPOA 3KTQA 2YKMB 3RRGA 1S1XA 4BDZA 4U6PA 2Y1IA 4KHYA 1ASUA 4F2RA 3ITHB 3KHLA 4TQRA 4O3SA 1HMVA 4DL4A 1VK0A 4F8RA 2C2DA 3G10A 3CJ2A 4TY8A 5C42A 3Q8RB 2QKKA 4J9OA 5J2PA 1RA6A 3LP3A 2XY5A 3ICLA 1QE1B 4B8AB 3OYFA 3MR3A 3NMAA 3FQLA 3KJVA 3KD5E 1VSMA 1TV6B 4FJJA 2NUBA 3IS9B 3DLGB 2GV9A 3RB3A 4UQGA 2ALZA 4CEAA 1Z25A 2HHSA 5KFRA 4ED6A 1BI4B 3SUNA 1BCOA 4ECTA 2VG6B 4E1NA 3AVKA 5CZ2A 2PYJA 1JXEA 4ZVHA 3M8QB 1QHTA 3E01A 2E6MA 3OJUA 4MQ3A 3NF8A 5T7BA 3NGDA 4L8RB 3IN5A 2XI3A 1LW2A 4CJUA 1K1SA 3AO3A 1D5AA 4KV8B 3LPTA 3RMCA 2HHXA 4Y2AA 4M45A 3IRXB 1TK8A 1RTDA 1RDCA 3ZT1A 1S9EA 1XHXA 1JIHA 3QLHA 4M42A 3CFOA 1LV5A 3KLHA 4H4OB 4ZVEA 1S97A 3MECA 3LP0B 1NNDA 3DM2A 2W8KA 5KTQA 3NGYA 2XHBA 4QWDA 3OLBA 5FDLB 1TGOA 4IH7A 4CJLA 3SZ2A 3BSOA 5KI6A 3V81B 3BREA 1VRTB 1T03A 1TVRB 2WOMB 2OZMA 1XC9A 4O0JA 1REVA 2AWZA 1IKVA 2E9TA 4CGGA 3DRRA 2BQUA 3FRZA 4O4RA 3T5LA 3V4IA 2VA3A 4CE9A 1BIUA 1S5JA 3MXJA 4WFZA 2O5DA 4KFBA 1LWFA 1BQNB 4URQU 3IAYA 2XGPA 1NKBA 1WAJA 4HYKA 4DQQA 3ISNC 4YR3A 1C1AA 3QIOA 4E7IA 3BQ2A 1JLCA 4NCGB 3H5YA 2B6AB 1QSSA 3DLKA 4FXDA 1XI1A 4QW8A 4KAZA 4KBIA 4KHMA 5J2MB 4CERA 5DLFA 4AHCA 4LQ9A 2I1RA 1HNVA 1JLGB 4H54A 4CJ3A 4RW9B 5L9XA 1VSHA 4CGJA 2C28A 4DTSA 4PQUA 1S6QA 1IKYA 4EBCA 4ZP8A 2D0AA 4I2QB 3SQ4A 1S4FA 4B9LA 4CJFA 2HVHA 3L2UA 4WFYA 3KK3A 5SWMA 3NH2A 3I0SA 4J9NA 4DSJA 4O44B 4KHRA 2G8HA 3SQ0A 3OVNA 3D45A 2IAJA 4DSLA 1JLBB 4AHVA 2BRKA 3MEGB 3VQBA 1SKSA 1CXUA 3TWHA 5F8NA 3QEVA 2HNYA 3C6UB 2EC0A 3DRSA 3HHKA 1SL0A 4HUFA 4ZPAA 4BE1A 5I3UA 5KGWA 3JYTA 4RW7B 4RW6B 3ZSOA 4W5TA 1T3NA 4CFBA 4YFUA 4KO0A 3V6HA 3FQKA 1ASWA 3EZUA 2HMIB 2KTQA 4F2SA 4O3RA 5KFKA 4FM0A 1JL2A 2YNGB 4O55A 5HBMA 2X78A 5HRRA 3NDKA 2P5GA 3L2RA 4K4XA 4IR9A 5KFQA 2D5RA 1ASVA 2KFZA 2XWYA 4ELUA 4Q45A 4NZ0A 4CJTA 4M3TA 4X2BA 4TLRA 3SYZA 4ED7A 1K1QA 2HNZA 4N56A 3CO9A 2IMWP 1S6PA 3HPGA 2FC0A 2V0NA 4N41A 1XR6A 5KFOA 4CEQA 1N4LA 3NAEA 2YNHB 1T05A 4Z4FA 3T5HA 3MR2A 3OS0A 4CJWA 5J2NB 4JS5A 4JS4A 2KQ2A 4O3PA 2DFFA 1TL1B 2P51A 1NK7A 4H8KA 3QETA 3U6FA 4E7KA 1ZBHA 3LWLA 1RBUA 4ECZA 2VWKA 4FJXA 2BGGA 3PUFA 2QK9A 3DRPA 1TL3A 5JS1A 4FCYA 4FJNA 5KFGA 3BQ1A 2RKIA 1O1WA 4Q43A 2VA2A 5KT7A 1VRUB 2V4RA 4FLYA 1GX5A 4URGA 3HYFA 1F21A 2ATLA 3IG1A 4DL3A 2Z1GA 4NYFA 1S1UA 2G8IA 1RT1A 4BWMA 1NK8A 3CM6A 4R5PA 3O3HA 3QGGA 3AVGA 1NOYA 4Q8EA 1U49A 1I6JA 4J9RA 3KLFB 2Z1JA 2XI2A 1C1BB 4ID5B 3DLEA 1L3VA 2R2RA 1SH3A 3OL8A 3VQDA 3AVAA 4Z4HA 3SNNA 1C0TB 3FDSA 3GYNA 1N5YB 2OPSA 1BISA 3MEEB 1EETA 3P83D 3V9XA 4IFVA 5F8HA 3N6NA 4I9QA 5KFBA 1JX4A 3QIPB 3VQAA 1WNEA 1UWBB 4ECVA 4G1QB 2B5JA 3VQCA 1RYSA 4FZXC 2O4GA 2FVCA 3AO2A 4RW4A 4N5SA 1RTIA 2ATQA 1ZBFA 3L2VA 2JC1A 3CQ8A 5EWEA 3AVIA 1IKWA 3T19A 4MIAA 3V6DA 3OHBA 1RILA 1SL1A 4NLQA 2OPQB 1KSPA 3LDSA 1ZETA 5D3GB 4CF9A 4MH8A 5L1KA 2X6NA 4DTXA 4BE2A 4ED1A 1B9DA 1SKWA 2F8SA 3PR4A 3TAQA 4IKFA 5EDWA 3PX0A 2XCAA 1TKZA 2OPPB 1FKPB 1RT2B 2AU0A 2ZE2B 4DLGA 1IG9A 3ALYA 5F8IA 4K4YA 3G6YA 3M9MB 4I9LA 3L8BA 3DMJB 3OY9A 2IC3B 3OYGA 5HLFB 4YMEA 2J6SA 3KMQA 4NCBA 3GQCA 1JLQB 2AX0A 5KFUA 4AHRA 4M3XA 1KRPA 2WHOA 1BQMA 3OYKA 3QEIA 1S0NA 5KFNA 3CM5A 3TANA 3KLEA 4JV1A 4Z4IA 4JUZA 1T94A 4DTJA 1LWCB 2FLLA 4K4ZA 2IGIA 1Z4UA 3AA3A 4DU4A 4KHSA 2XCPA 4DU1A 3ZT4A 1TQLA 1IM4A 4QPXA 3BR9A 4LSLA 3DI6B 2ASJA 3IGNA 2DPJA 1WAFA 2UUWA 4DS5A 3CJ5A 1T8EA 2XY6A 4FW2A 4I2PA 1CSJA 4RNNA 2RF2A 5DGBA 1KFDA 4TXSA 3QEPA 1GOAA 3CJ4A 3HM9A 3KMSA 1HPZA 3G6VA 5F9NA 5JUMA 1JLEA 2PYLA 4RNHA 1C0UB 4ZHRA 1SUQA 3KKRA 2FBTA 3MFIA 4GW6A 4KPYA 2DFHA 3O4QA 3M9OB 4RG8A 1IO2A 4KHUA 4KB7A 3THVA 4TQSA 3H98A 4JRPA 2W9BA 3DOLB 4ECWA 2G8FA 4OLBA 1NHVA 4O4GB 4CK3A 3M8PB 4DQIA 2AGPA 1JXBA 2JEGA 4J9LA 3TAGA 5KFZA 4KRFA 4E3SA 4FJIA 3LP1B 5J1EA 3TVKA 4B3OB 3KHGA 3TARA 1LWEA 1J5OB 3K5LA 4I7FA 3RR8A 1RBVA 1Q9YA 5KT2A 1A5WA 1S1XB 5KFHA 3T1AA 4J9MA 4O3OA 1XR5A 4OL8A 1FXXA 1A5XA 3WNGA 1HMVB 2O4IA 3QO9A 4ECXA 4MKBA 4IFYB 3L3UA 1CXQA 3O4NA 4FVMA 2ZKUA 4EBDA 4FLVA 1JLFA 1L5UA 1HYSB 4HKQA 5J2PB 4C8LA 2IDOA 2WK4A 2BANB 4WXWA 3H4BA 3PY8A 3KJVB 5KFMA 4FLTA 3G6XA 3K59A 2HNDA 4ID1A 3DOKA 5KT3A 2V9WA 5C25A 1RT4A 3V9ZA 3TABA 3HVAA 2XY7A 3HSTB 1LW0A 4K4WA 3CFPA 1RTJB 4KE5A 1S49A 2P5OA 5CY4A 3U3YA 4B9NA 3G86A 3Q8SB 4H4MA 4EP5A 1FK9A 1S0MA 2IJFA 3P5JA 4IRKA 3ZSZA 3SPYA 2FVQA 4KI6A 3D28A 1NJXA 1N6QA 3I0RA 1LW2B 4CHQA 3PW7A 4TYAA 4J2EA 1IKXA 2F96A 1NJZA 5F8LA 3BSAA 3M9NB 1D8YA 1DTQB 4DFPA 1S48A 4J2AA 3SV4A 4QCLA 4DFMA 3MR5A 4Q8FA 2FVSA 1HQEA 4RNOA 5EWFA 4KKOA 5DG9A 3QLHB 4CGHA 3KLHB 2W42A 2FVPA 1SV5A 4DFKA 2WONA 4ECQA 5KG3A 2FLNA 3NAIA 5DGAA 3VQ5A 4CIFA 1U4BA 4CFDA 3GIKA 3RTVA 3VQSA 3BJYA 4WZMA 4OLAA 3N6LA 2BE2A 4URSA 2XC9A 4QWEA 1TAQA 3S3MA 1UAXA 2R2TA 2HHTA 4K4VA 2CKWA 3BSCA 4F3OA 4E19A 2FBXA 4FJMA 5JXSA 1IKVB 3KK2B 3DLRA 2ITGA 1EP4A 1Z26A 3P1GA 3IS9A 4B9UA 3DLGA 4FBTA 4CJVA 4CFCA 3V4IB 2BRLA 2WTFA 3RBEA 1BI4A 1UA0A 1S9GB 4E7JA 5DG7A 3QNNA 1RDAA 1W25A 2HAIA 4MFBB 1YVUA 5FROA 3BGRB 3M8QA 3V9SA 3AVCA 3VQ4A 1NJWA 3V1QA 5DLGA 4CIEA 4YR0A 3DLHA 3HVRA 3DLKB 1BIZA 2FVRA 3CIZA 4YP3A 3OJSA 3QERA 3KHHA 4FYDA 4WE1A 3A2FA 4IBNA 4E7LA 2FLPA 3VQEA 4ZMMA 4JRQA 1JKHB 1S6QB 4YR2A 4DWIA 2YHBA 2ZD1B 1IKYB 4H4OA 4E89A 3NH0A 1N48A 5F8JA 3EPIA 3LP0A 3PX6A 1HNIB 2HB5A 3DYAB 4DLEA 5FDLA 4ZPBA 3SUPA 1L3TA 5FRNA 1QTMA 2PY5A 4ELVA 2IAJB 3FFIA 2FBYA 2G8KA 1RT3A 1KHVA 3AO1A 4AILC 2JLEA 4TSXA 2DY4A 3V81A 3DRSB 5KG1A 1TVRA 3I8DA 3I5AA 1S1VA 1DTTB 2C2EA 4FJ8A 4Z4CA 4DQSA 4HUEA 3NFAA 3V1RA 5HROB 4ZPDA 2CJQA 1BL3A 4DL6A 5CZ1A 2YNFA 1HYVA 2JGUA 3NAHA 5CYQB 4AH9A 3RMBA 4AHTA 3LWMA 4NCGA 4FLWA 4HCCA 2HHVA 3HVTA 4R0EA 4XPEA 4NLWA 4R8UA 4GVMA 4WYLA 1RT7B 1U04A 4FZZA 5JS2A 4ECRA 1QSLA 4AHSA 3O3GA 2HNZB 3PW0A 1WSGA 3SUQA 3HVWA 1S6PB 1YTAA 4RW9A 1DLOA 4FM2A 4MK9A 1CZBA 3BDPA 4LSNA 3NKYA 4XO0A 3RR7A 4GC6A 4CK1A 1FKOA 3ZT0A 2YKNB 1UA1A 1RT5A 4O3QA 1SKRA 2D41A 4NLUA 1NKEA 2X74A 3LZIA 3MTKA 3HO1A 4DQPA 3N6MA 5EUHA 4ZVGA 1KLNA 3HK2A 4CCHA 3ASMA 4CFAA 4CJ4A 1JLBA 3TAEA 3SFUA 4EO6A 3MEGA 4ECUA 1TL3B 4CJQA 2UVUA 3DLBA 3C6UA 4NLGA 3OYLA 1JLAB 4DTUA 5KG0A 4FS1A 3AA2A 4FJHA 4PWDB 2DFEA 4Q0BB 3JSMA 3BSNA 4RW7A 1LAVA 3OYHA 3ULDA 2VG5B 5KFFA 4K8XA 3IG1B 4IDKB 1RT1B 5DQGA 1Q8IA 5KG4A 3SI8A 1WLJA 4R5PB 4TYBA 1VSIA 3KK1A 3MR6A 4PY5A 1TKTA 3TQ1A 3UR0A 4JLHA 1KLMA 2UVVA 1WSFA 1NK9A 1EETB 1HQUB 4B9MA 2PZSA 3SCXA 2HHWA 2HHUA 3KLGB 4NRTA 4CHZA 2B5JB 3SPZA 3CDWA 2A1SA 2RN2A 3VN5A 4EYIB 3HL8A 1HARA 4RW4B 2IM3A 5KFEA 1NK6A 4DEZA 4NLTA 3NF7A 4EZ9A 1IKWB 3V6DB 5J2QB 4IG0A 4ZP9A 1TAUA 4PUOB 1RTHB 3OHAA 2R8HA 4JV0A 1RT6B 1NK0A 4Z4EA 5C24B 3MEDB 3OSNA 1TKXA 1J54A 3OYIA
chains in the Genus database with same CATH superfamily
3VEZA 3F0NA 1XMOK 3NGRA 4NWBA 3K8WA 3EZ5A 2VKRA 2UUBJ 3MAAA 3RJMB 4X66K 3HT3A 5KFTA 1VRUA 4BVOA 5B0DA 2WCXA 1D8ZA 2H9ZA 2KFNA 1NZ8A 2R42A 1S1TA 2G2ZA 1IBLK 4ZJLA 1HKCA 2HSTA 3ZC4A 3KLFA 4A47A 3NGKA 2YHYA 1FESA 2G1HA 2Q79A 4DSKA 5M1NA 4CZMA 1C0TA 4DG1B 4XPCA 3L3VA 2GV1A 2FSJA 3MMBA 3IDHA 2ADCA 1VLOA 1JJHA 1N56A 1VSJA 1WOOA 4G1QA 4J9SA 2QYGA 3PYEA 3C65A 1T6DA 4LFBJ 1NOZA 1GTEA 3GSIA 3RB6A 1NMEB 3MF5A 2A5XA 2P9NB 2W7OA 4G1IA 1KBRA 4BC2A 1VLYA 1QAJA 4E1JA 2Y1JA 2XEXA 1A5VA 4ZHRB 3AVMA 1HIYA 1KTQA 4YQWA 3CULA 4CO3A 5DETA 3CCSS 1HD0A 1KR4A 2LDYA 2ZGZA 1S9FA 3PLAA 2BV3A 4K42A 1WC0A 3QZ7A 5BREA 4KH1B 3P8BB 3U02A 4EO8A 5AQHA 3DMJA 1NPKA 2ASPA 1S4EA 5M2PA 1HNWK 4GKKF 3B4MA 4KHNA 4ILGB 3D9BA 3D4JA 2RQMA 2JEFA 1WHWA 5BN9A 4NL5A 1VC0A 3EWGA 4WIQA 5AQQA 2VBXA 4FK4A 4CDIA 3MD3A 4Y2CA 4TY9A 4C8KA 1S77D 2BDPA 1GMWD 1VJWA 3RW6A 3VAMA 3OYAA 2YH0A 5GAEU 4QWAA 1QDUB 5AFUH 1VSLA 3FGVA 1GMUA 1U8WA 4LFCF 1C1CA 2HQ3A 2WFBA 3KHRA 4YY3F 4K4SA 4MKAA 1YVNA 1QSYA 3MOJB 1CC7A 3O9QA 5KAKA 4TN2A 3M3ZA 1W9HA 4HCBA 1JLFB 5JVGL 4CZLA 2XZTB 4OYIA 4B9VA 2YJFA 1I39A 5E7OB 1I94F 2KG0A 5F2RA 2HQDA 1IR2A 3RBXA 5K14A 1FX4A 1H73A 2XLIA 2BJ8A 4MMOA 1KVBA 4BQLA 2YWEA 2C2ZB 3OYDA 2BACA 5HL7Q 2QA4N 2Y1RI 1D0EA 2Z2MA 5AQWA 2DTJA 4NLPA 4JV5J 4OZJA 3FCWA 3J81O 4TY8B 4CLKA 4ZVUB 4OKEA 4M3UA 3PO4A 1J9AA 3SDEA 4WBFA 3DOLA 2VV5A 2O8BB 1DRZA 4CJEA 1JNZB 2DRBA 1ITGA 4CLUA 4V19J 1R0BG 2RE2A 2AQ4A 2AX1A 4R79A 4M7YA 2LMIA 2CQBA 1OJ4A 3W2VA 1RNHA 2EC2A 2F40A 3RBDA 1WF1A 4DS4A 1OVQA 2KB2A 4IOXA 1WN7A 3RAQA 1WTBA 1WBBA 4DHVA 4GKJK 4CHYA 3SI6A 4DPOA 4W5QA 4PPDA 2D3ZA 1AA1B 1JJ2M 5HRPA 4IFYA 1S9EB 4ICLA 4QQBA 4AQYK 3HZ6A 3W7BA 1NGCA 4OHYA 2K8GA 2LLZA 1U47A 1X5OA 3PO5A 2PA3A 1M1HA 2VONA 2CIMA 1EP4B 4M5JA 2OFHX 4USUA 3DM2B 2FJWA 2DNQA 3P4IA 2UUAK 4XAKA 3CXCM 2WAQD 3UNGC 4NLOA 4MT1A 1DJ0A 3SMZA 3CB4A 4E0DA 5D4NA 2ZBIA 3IFRA 1SJ1A 3W2WA 1T03B 2X51A 4OFZA 2RDIA 5A8KB 1U1NA 1REVB 2IYGA 5D0EA 4JV2A 3J7Z5 1TV6A 4EBEA 1YGYA 2C42A 2QKBA 3G0ZA 4OYZA 2VPXB 3K0SA 4M3WA 2KT5A 2GCFA 4L74A 2VG6A 5AZJA 1XHZA 2A0FB 1U2VB 2QLWA 3CVKA 4IQXA 2M2BA 5E3AA 3CMES 1RBLA 3DRXA 3CGIA 1JLCB 2NRTA 4EUVA 1YBAA 2P9EA 4Q2LA 4K4UA 2GEMA 4F4XA 4ENOA 3ETMA 2KU7A 1BA1A 2CVEA 2Y9HA 3FFIB 5KOWA 2LEPA 1RT3B 1HNVB 4M5MA 2KVQE 2VJVA 3V2UC 4TU7A 5JMVA 3HHLC 1SS6A 2DCUB 4O8UA 4CHNA 3DGVA 1NDPA 3C16B 4EAHD 1IR1A 2UXBF 2A18A 4F4WA 1P1LA 2UU9J 4L6V3 2C3OA 3PEJA 1F6TA 3MM5B 2Z58B 5L1IA 5IWAJ 5H9EJ 4TLQA 2GA7A 3AOCA 3CIPA 4WFBQ 3VAGA 4MFBA 3BGRA 2DNOA 3CFRA 3IBWA 2H4WB 3QWPA 5EU7A 3THWA 4C1NI 2WBRA 1ZTWA 2MHNA 1N0VC 5I3UB 4CHPA 1ZPWX 4MDBA 5AQMA 2ILYA 1M1GA 4BDPA 1M1KT 3SUOA 3QQCD 1UTAA 3UVJA 2W4CA 4HHTA 4ED8A 3AV9A 4PKHA 1YT3A 2NXNA 3PJWA 1DLOB 4PRFA 2Q0UA 4CJKA 4NEYA 1X4BA 4PWWA 3L0QA 1JJ4A 1YJRA 3LH2S 1X8DA 2IVFB 5LMNK 1AUSL 4ZK7M 2CPIA 4ZVFA 3JQKA 2A1BA 1SJRA 1HNIA 5IFMA 2QO3A 2H1YA 4NYNA 3GL1A 3QGPA 1E6VA 4DR5F 2HW3A 2IVYA 5LJ5Y 1JLGA 2GUPA 4U9RA 1DHMA 4Y1CA 4RUCA 5SZTA 4EYHB 2D0OA 3Q8PB 2IY5B 2AYMA 1WSHA 1B0PA 2MSTA 2BXJA 5KFYA 3JTOA 1OH7A 3OQ2A 4JI1F 1ZM9A 2Z1HA 5FPMA 1YTUA 2IM2A 2KXFA 1VQLN 2A1RA 3K5NA 3CEDA 4DSEA 1NGBA 1CJTB 1UZHA 4M3RA 5HROA 4O44A 1EZZB 2FJBB 3HFVA 3KK1B 5D0HA 2ZOGA 3C94A 4OYBA 2E9RX 2IS3A 3DRPB 3IMQJ 2YQ3A 3W9HA 1IN0A 1RKIA 4FK0A 1BCMA 3ZYYX 1KLMB 1R8PA 4R25A 4Y2IA 5KFLA 4WFNL 3VA0A 4WYBA 3G4SN 3NE6A 2D3UA 4LY7A 2KJVA 4A8SA 3Q7CA 2MQNA 1T44A 1SC3B 3NGZA 5F8GA 1RXOB 3AGKA 1VQMS 3ZSRA 4I4BA 4NYZA 2EHGA 2YNGA 2O66A 2UXDK 3PHTA 3BY5A 4QS9A 2R4FA 1PAUB 5C2DA 2JVOA 2WSCC 3W65A 5KFJA 3G8QA 3FEZA 2Y8YA 3OUYA 2BJEA 2VPZB 1HR0K 5A0YA 2WVBA 2XY8A 2M5YA 5C0YA 4DX8H 1SI9A 5DK5A 1T9WA 1H7WA 3LANA 3FZLA 1HJRA 4I6MA 2KHOA 4DV1J 1UJ6A 3W0LA 4DCJB 4QIFA 3KNAA 4BRNA 1P90A 3RAXA 4WQ4C 4DN0A 3LAKA 1WKLA 4RBVA 3PIOQ 3MZIA 3DU5A 4LFAF 4Z94A 4P73A 4ZVSB 4DR1J 4OGEA 4A8MP 4QOZB 3HKZD 2D0BA 3MPVA 2UXCJ 4LF8K 2AEJA 1NGFA 3P39A 1QZ6A 5DDQC 4V1Ak 2RRBA 2HYIB 4UT4A 3AVNA 3K9JA 2UVRA 5LJWA 4BBYA 3ZXWA 4ED3A 1WHYA 3IGVA 1SXLA 4C8MA 4B02A 4KHWA 4ZS6A 4YOEA 4ZCKA 2ZH9A 3W66A 1N5YA 3T3FA 2RU9A 4UF4A 2MJNA 1QZ5A 4A46A 3FSIA 1PKUA 3NCRA 2R8GA 2M52A 2IA6A 4W90B 3ISZA 3TUZC 2MQMA 3ZCMA 4ZIVA 4YDUC 2ZC3A 3SMPA 1Q7YO 3OTOK 4ELTA 5BPNA 1YK9A 4KHQA 3TZYA 1R8AA 2OPQA 4RWXA 3HHDA 4M63A 5DM6Q 3SSQA 4CEDA 1WD6A 1ZM3A 4IOAQ 1TL7B 8RUCA 2NXUA 2V67A 3LAMA 4CF8A 2KXNB 7AT1B 4DG1A 2IC3A 2E66A 3IM9A 2ZDPA 4FWOA 5DQHA 3GV5B 1NZAA 2CPXA 4KIAA 1AUDA 2R7VA 2H5IB 1XQSC 4OGCA 2HFNA 4X66J 2XO6A 3L4BC 2BJ7A 3BP8A 2Q43A 3A5NC 2LQ9A 2NZCA 4MK8A 3OBIA 4M94A 1ICEB 2CA9A 3C6TB 2CQPA 3B8HA 3NCPA 1IBLJ 3HJFA 2BR0A 1Y11A 1QY7A 2GX9A 4KI4A 2WRMA 4KREA 2W40A 3WEEB 3MM7A 5I42B 4DQRA 2P9GA 4DMZA 1OS5A 2QA4S 3OFHA 4DR7F 3Q2SC 1YIJS 2B7CB 4AE5A 2HLUA 3DOKB 4FF4A 5D6GA 1YHQS 2G0CA 3BGLA 4M3YA 3UCGA 1CPZA 4F4KA 2L3MA 4DR6K 4DR2F 4UOFA 3UFCX 3HBTA 2K7JA 4Y1DA 4ZPVR 1V3SA 3I56S 3M8PA 2XYPB 5A2QO 3CJ0A 5LMUF 3OYMA 3MAHA 4B1UB 3CQYA 1VC5A 4NXNF 4OPKA 1GXLA 2V4QA 4HUGA 5E3PA 4BDYA 1QVGM 1EWRA 4X62K 2W01A 4X4TA 3WZ0A 2J4RA 3R2DJ 3KWGA 4YHHF 1FDNA 5HOOA 3CJTA 4F2RA 2DNKA 3KHLA 3M2UB 1FDDA 1HMVA 2XSFA 4DL4A 1IJFB 1VK0A 4BRQA 2C2DA 3CJ2A 4TY8A 4JKHA 2XY5A 3OYFA 3MR3A 6AT1B 4BR9A 3FQLA 3KJVA 2ZJQQ 3KKFA 3IS9B 4NZ6A 3DLGB 2GV9A 3RB3A 4UQGA 5HJXA 2HHSA 2KFYA 3SUNA 3NS7B 3AXMA 4E1NA 1J27A 5DS7A 4LF6K 5B08A 2ZJRL 1MLAA 2K7KA 2E6MA 3HZGA 3M1FA 2QLFB 3NGDA 2XI3A 3C46A 2ZH2A 4OIXA 3RMCA 4IOCQ 1VQPS 2FQQB 4PKGA 1RDCA 3ZT1A 1F3VA 3OBWA 1S9EA 1XHXA 1SZ2A 5AQKA 2VFUA 4M7XA 3QLHA 1NMNA 1HWIA 3CFOA 1S97A 2WBMA 3AB4B 4M5GA 1XBWA 2VFSA 3EKUA 2R7UA 3NMRA 1CC8A 3RSEB 4NXMK 3DM2A 2W8KA 3EVOA 2CDRB 4QWDA 5FDLB 2O8CB 1FJGK 1TGOA 2GJFA 3VF0B 4UY85 1I51B 2FGCA 1VRTB 1T03A 3SBMA 2WOMB 3M2RA 5A8KA 4O0JA 1REVA 4FWLA 2Z57B 1IKVA 4CGGA 4LVOP 1W2BM 3FRZA 2OANA 3CNQP 3UD5A 4HLBA 1BIUA 3QFUA 2XMAA 3G87A 3ZNJ1 3BF3A 1B7YB 3IAYA 4I6AA 1RI7A 3SJHA 4YUDA 2M88A 1H98A 4YR3A 1C1AA 4U7BA 2OELA 1JLCA 2B6AB 4KGXB 4FXDA 4G1PA 1X0PA 4NB4A 2LFVA 3GFYA 1TL5A 2I1RA 1HNVA 2XLKA 3NVKA 4BRGA 4RW9B 3MM6A 1SBRA 1VSHA 1VQON 4ZCLA 3NNCA 3GB0A 2OKQA 1FJEB 2GWJA 4ZP8A 1U6BA 3LQVA 3N9UC 3O80A 2HFSA 4J9VA 3L2UA 4CLLA 1N5TA 2BVZA 3MM5A 2PIIA 4J9NA 2KM8C 2KO1A 2M3DA 4USJC 1U2FA 1YJUA 2QTDA 4BHQA 3SQ0A 2IAJA 2ZM6K 1T0TV 2BRKA 2DGUA 1SKSA 3C6UB 3DRSA 3M8WA 1YJ9S 3CI5A 3H90A 3NGTA 1SL0A 1TFWA 5I3UA 1Y3KA 3P49B 1QHAA 5KQDA 5KGWA 1GFWB 4PZVA 3ZSOA 4W5TA 2R7QA 4CH1A 3DXKB 3FQKA 3TU5A 3DDNA 4Y2KA 1DQ9A 5GADP 2VH7A 3NCQA 4V19S 4QR1A 3GE9A 3T1YK 4CBXA 2P5GA 2HZVA 3A8IA 4JI7F 1NGEA 3L2RA 4K41A 5CA5A 4JI8K 3L7PA 3MMVA 5KFQA 4JKFA 3MUVP 5A8WB 1VQ4S 2HVEA 1ASVA 1UEKA 2Z0GA 4CJTA 4BY9C 4HI2A 2UZAA 3CO9A 1U8SA 3FSXA 1FW6A 4WCEL 5JVHL 2XZDB 2IHR1 2V0NA 3W62A 5KFOA 4O8KA 4Z4FA 1K0TA 3OS0A 2E5LK 4CJWA 5AQGA 2Q97A 4JS4A 3I31A 2P51A 1F9EB 4YOVA 3BF1A 3J80U 2V4JA 2FUG9 4JI2F 1CJTA 3U6FA 1RBUA 5LMNJ 2RUSA 4FJXA 5LSRA 3DRPA 2NCKL 2D0PA 2ZHBA 1CJKB 1N34J 1PILA 2MMYA 3VETA 3BQ1A 4WFAQ 2VA2A 3Q2TC 5KT7A 1IM6A 3R7NB 3FZBA 1F21A 3MPUB 2FSNA 3I9ZA 1NK8A 2NRRA 4Q8EA 3GJSB 4ID5B 3KG1A 1L3VA 3EZOA 5IM0B 1CULB 2FZKB 3OL8A 1BU6O 4Z4HA 3SNNA 3I8BA 3FDSA 3C7NA 1OKJA 2PEHA 3VPZA 2LQBA 3OR2A 3D68A 2VU5A 3R5AA 2W2QP 3QIPB 1UWBB 2LXUA 2O4GA 3HCXA 4BRCA 4N5SA 3D6HB 1FRXA 1ZBFA 3L2VA 1WTFA 3Q7BA 2CQHA 5EWEA 3E1YA 4WP9A 3OHBA 1SL1A 1RILA 4K0KK 3AAWB 3H1QA 2KVIA 1KSPA 4B17A 1YG0A 2DKOB 4CF9A 4ED1A 4RPFA 3EDQB 3PR4A 2F9WA 4B3MF 1NDLA 3ALYA 4K4YA 2JNJA 4I6YA 3G6YA 4WQ4A 3MMCB 2N7CA 3C3LA 3OY9A 3ENHA 3RU0A 2XMUA 5H1SV 2L41A 5HLFB 1IG8A 3GQCA 2OGUA 2XMWA 2WHOA 4DBQA 4M8LA 4X4UA 3M30B 2ZZTA 3ELHA 2MKCA 5EXWA 4JV1A 2N4DA 4LF5J 4Z4IA 4JUZA 5LJ3Y 3M2VA 1NU0A 1HBMB 2JWLA 2FLLA 4K4ZA 2GS8A 2W6LA 1MWQA 3AA3A 1ZXOA 2RRAA 1CJVB 5LT5A 1NUEA 1IM4A 3G71S 3N5FA 3DI6B 1HNXF 1B4SA 3TYTA 3CJ5A 2KH9A 3ZTQA 3JSBA 4FW2A 4RNNA 3K89A 4KY3A 4NYPA 1BUPA 3QB0A 2QM1A 1KFDA 1GXUA 3A3PB 4TXSA 4HH0A 2DBBA 2QX0A 3HM9A 3KMSA 5JUMA 1ATSA 2PYLA 1MWZA 4IXCA 2DGQA 3ZZZA 2IRUA 3CJ7A 4USTA 1SUQA 4N8NA 3O6WA 3MFIA 4GW6A 1IQZA 3AD9C 4RG8A 3H98A 2W9BA 4O4GB 4GV6A 4CK3A 2AP6A 3UE2A 4X65F 5CD4A 4WU2A 3OTOJ 3TVKA 1LWEA 4RLEA 4YDDB 2ZGYA 1RBVA 2G2OA 1RE1B 2W4PA 2HF3A 5G0RB 1A5WA 1S1XB 5KFHA 4J9MA 1G1XA 4O3OA 1AXQA 1XR5A 2MGZB 3JSYA 1FXXA 1NSPA 1GMVA 1A5XA 1E3MA 3CC2S 4B3SF 3QO9A 1UW9A 1NPPA 4MKBA 3WEEA 2AJ0A 1CXQA 2NRXA 2HFUA 1SQKA 4HKQA 5AQOA 2EKYA 2F9DA 1GAOA 2I7PA 2HZCA 3K59A 3DOKA 1MG7A 1NGGA 1XMQK 2XY7A 1LW0A 1H0HB 2P5OA 5CY4A 3U3YA 3G86A 4FP9A 5AJ3K 3Q8SB 4H4MA 2QLBB 4IRKA 2B7BB 3SPYA 3K17A 3EO3A 4KI6A 1P9QC 2GIFA 1HA1A 4TYAA 4J2EA 1HQ2A 2F96A 5F8LA 4JI4J 4X4PA 2ZH4A 1VQNN 1DTQB 1S6OA 4PYAA 4AD6A 4J2AA 4LBHA 4QCLA 4HT5A 4DFMA 2F4VK 2CJAA 4Q8FA 3A12A 2FVSA 3PYGA 1HQEA 1V5IB 1M1KO 3J7AN 2BJ1A 5JVGQ 2PMWA 1QQMA 4JKGB 2FVPA 2WONA 5DDRC 2FLNA 2RH3A 1KP6A 3DCAA 4DR6J 3MWTA 4WZMA 2YH1A 2CG8A 2RAQA 2XC9A 1UAXA 2NRVA 3KG0A 4K4VA 1WEYA 5BR9A 4OJ1A 3H6EA 4XTTA 3F56A 1N36F 5F1XA 4MJKA 2HFVA 2DB1A 3ZZ0A 4U95A 3KK2B 3D1QA 3MCPA 2ITGA 1N32K 1RWWB 1B99A 3P1GA 3IS9A 3DLGA 4FBTA 3D0IE 4USWA 2DY9A 2PAVA 5AXKA 5EN1A 2Z2YB 1ELOA 2ZOMA 3AVCA 3PIPL 5DJBA 2B3TB 4DV0J 1VBZA 1VC6A 5ETSA 1SJ4P 5BN8A 1EKRA 2YKPA 3HVRA 3DLKB 1BIZA 3W3DA 1LK5A 3CIZA 2OMOA 1C0FA 4NO7A 2OTJS 1NB2A 1Q7LB 2O01C 4YP3A 3OJSA 4UOCA 4FYDA 1J5EJ 4WE1A 2YVSA 3HLUA 1IQTA 2JWKA 4QJVA 2FLPA 3CCLS 4YR2A 3S01A 3D6TB 3EPIA 3PX6A 2VQFK 4LF6J 1ATRA 5C2GA 3T9NA 5FDLA 1L3TA 4FZVA 2MKJA 4BVPA 4HTJA 1UVIA 2G8KA 2E2PA 2YWFA 2P5VA 2BABA 3IXQA 5KG1A 3CPWM 3I5AA 5DZ6A 2C2EA 2N3LA 4Z4CA 2MZTA 3KXDA 2QW9A 1EHWA 4LF9K 2K3IA 2FXUA 4ZPDA 4WPAA 1VQ7S 2YNFA 3TO8A 5AQTA 1KQGB 1HYVA 2JGUA 4ZLPA 5CYQB 2XYGB 4NXMJ 2BW7A 2FHMA 3U9DA 1FJGJ 3RMBA 4AHTA 3LWMA 3JS9A 4FLWA 2HHVA 3HVTA 5MLCV 3CUNA 3LDNA 3IP0A 5CZXA 4GVMA 1RADB 3G6EN 1RHKB 4UTGA 1RHMB 5GADI 4FZZA 2F9TA 1QSLA 4AHSA 3O3GA 3CDAA 4FWNA 3MM9B 3SUQA 4NYOA 2IDLA 4RW9A 5I4MA 3PKYA 1KNZA 2DR8A 3M6UA 1EAYC 4R0JA 5FLXU 4O3QA 3X3UA 3LZIA 1S5ZA 1OYEA 3QFHA 4CFAA 2B4OA 4DUYK 1IJJA 3SFUA 3E2EA 1TL3B 5GAHP 1P9YA 2WW8A 3C6UA 3OYLA 1JLAB 1DAXA 2VYPA 1ZC6A 1BWEA 1LAVA 4I68A 5CCMA 3ULDA 3MURP 2VG5B 2ZH8A 3PEHA 4IDKB 3DXKA 1RBAA 1U2CA 1Q95G 3OR1B 1SC4B 1Q8IA 3SI8A 1PG5B 2UU9F 3EN9A 4PY5A 3A8YA 2AF6A 1XNRK 3TQ1A 3UR0A 2DYAA 2HBKA 3MI7X 4DV4K 1U26A 5B7WA 3DLJA 2I38A 3NEKA 1WSFA 3FBBA 3DU6A 4ES3A 1EETB 1HQUB 2HHWA 2HHUA 1GLAG 3KLGB 4CNYA 2B5JB 3SPZA 1S22A 1WSRA 4EYIB 4RW4B 3HJVA 5KFEA 4KBOA 1V6HA 1MWKA 4NLTA 1IKWB 4JOUA 1JCEA 3IBFB 4OJ3A 1TAUA 1IR0A 4PUOB 1V9OA 1RTHB 2MLZA 3OHAA 2R8HA 3U9ZA 2PI4A 4JV0A 4P2FA 4A8WA 1NK0A 5HK4A 3C15B 3OSNA 5ETPA 4DV3K 3TJ9A 4DZ6A 1UJ4A 3J7YI 3VENA 4JI8J 4D3GA 2VG7B 4F0HA 1CJKA 5IQ6A 3MN5A 4GV9A 1FNOA 4WFNQ 3J81j 3V9WA 2CJYB 1RWVB 4OPJA 1VSKA 2NYIA 2VIHA 2C2RA 2J0WA 3MCSA 1BQMB 5TKYA 2YHAA 3ULEA 2E1AA 3ZX3A 4CJ5A 4DV7K 3QEWA 3CCWA 2B8PA 2OSRA 3D2FB 4N76A 3NMUA 3KLEB 2V2KA 1TMMA 2DHSA 2DCLA 1M0SA 4JYAF 2KRRA 1N33J 3U1LA 1SQFA 5BPMA 2D0CA 3O44A 3QIPA 2E7XA 4FPBA 5C12A 2J8AA 3KWIA 2B8QA 1W0HA 1VQ6N 3W1YC 2RF2B 3UDCA 4W4MA 2QZ8A 3NF6A 4CIGA 3FZ2A 3B4DA 3AVHA 3L4QA 2B43A 5FLXO 1ZBIA 4C3LA 2I9SA 1NXIA 3HX9A 4DR3F 5IT9U 4JB8B 9RUBA 3M8ZA 4ECYA 1EQYA 3TW0A 4U8YA 3OTBA 3MMCA 4ZP7A 2LSNA 3ZT3A 4Z0UA 2ZWPA 3IAS9 5CYMB 5HLFA 4DTNA 3F44A 4B3TK 4PA1A 1RJJA 3MTJA 1TK0A 4FWKA 3D7EO 3M30A 4X4SA 1KTVA 3FK4A 1Y4ZB 1NGJA 3AOAA 5EVZA 4DV1F 3TVYA 5DMRA 1UCNA 4B9SA 3CCRN 2ADBA 2PO4A 3WNEA 4CZCA 1GQEA 1Q16B 1HBMA 2GGPB 3QGIA 1T6CA 2BM0A 4Y65A 3H0PA 5LOQA 3TSPA 2BQ3A 3OL7A 4LF4F 1B0TA 2W9CA 1YVFA 2FF6A 2I0XA 3HP6A 1FNMA 4Z7CA 3DI6A 1ZPVA 2UXCF 4J9KA 3CCVN 2QSWA 3CD7A 5KQ8A 1Z2LA 3NHGA 1S7HA 3W5ZA 2D4WA 2VCPA 5K9FA 2HNDB 4FYWB 4J2BA 5IV3A 1U45A 2I6WA 2CWXA 4KHPK 3GV8B 3THXB 3SK3A 5K8OA 3CD6S 2J6TA 5DG8A 5C42B 2JFKA 1WI8A 1MDUB 3SEOA 4KJIA 1A7GE 2APOA 1RK8A 4O4GA 4RW8A 3ZZUA 3JS6A 3CCZA 2QV6A 3P3DA 5JLHA 1NPRA 1S0OA 4NCAA 4U8VA 4QU6A 2FJXA 2R3VA 3MMJA 3WHIA 2BKPA 4J2DA 1VQNS 4BR5A 2E9ZA 4RX6A 4BR4A 1SV5B 2RS2A 3QT8A 4DKWA 3DKDA 3O9RA 2R7OA 1U48A 3EKSA 1DBDA 2MGZA 1JK9B 3MAQA 4MYTA 4C48A 2DVIA 2ZWHA 2IRXA 3B78A 4CF2A 3OS1A 5AXMA 3PRDA 5GVQA 4P7TA 1UJ5A 4QOTA 2IM0A 4B08A 1XMOF 2GUIA 4LH5A 4FF1A 3AGRA 3RRHA 2J9DA 4ZPCA 4J9PA 2ZHAA 3A5LC 1RTZA 3CMAN 2D7SA 2YKMA 4YOWA 2VC1A 3CJBA 3SBGA 4A8OA 1B9FA 4BG9A 3D3BJ 1ATNA 2YKQA 3MMAA 2DPIA 1DARA 4TKTA 3BZQA 4DL2A 1IBLF 1YITN 2R8KA 3PVXA 4JI6K 2HK2A 2YQ0A 4CT8A 1GLLO 4EFAC 1XIQA 3DRRB 3DN9A 2B4JA 1DTQA 2IJNA 1H72C 4OZ0A 1B64A 1C2PA 3UD4P 4OMFG 5J1NA 4LH4A 3THYA 1Q86T 1KQSM 2HVZA 4CZKA 2B4UA 4JKGA 4QYZK 1X9MA 3K5PA 2V8HA 2JLGA 3CCEN 2WBNA 1RQ0A 3H40A 2RSQA 2ROEA 2V2VA 4QIEA 3SV3A 2FB0A 5BRHA 4KV8A 1TYQB 5HATA 4DU7A 4MO5A 4DTRA 1IXKA 4QS8A 3ZSXA 1LWXA 1S72S 3LF0A 4O0NA 4Z4GA 1H74A 4CM0A 1U1OA 1RHRB 2QWLA 3OYNA 4PKIA 2QXFA 1KVKA 4BRFA 4TNOA 3KK2A 1XC3A 4H0OA 1XN9A 3IFEA 4CLFA 3L3CA 1HNWF 2DHHA 3I0SB 1SH2A 3IWLA 2DGSA 4DV2K 4BQZA 4ATNA 5F9LA 1MMLA 3TA0A 3LTOA 1PYSB 1UVKA 4USIA 2OTLN 4M5KA 2QMUB 3P5BP 1HKAA 4WF9L 5HJYA 1RHQB 4R8UB 2QE5A 2KZZA 3EEQA 1EX4A 3TPQA 4UUXA 3ULHA 5KFXA 4XDCA 1QAYA 3OSPA 5AQSA 1HW8A 2HRTA 4Q44A 1N32J 4LT6A 3S9HA 1BQNA 4OV6A 4QZVB 2QWOA 4MLEA 5HBMB 3G6ES 4JD2A 4A2AA 1ACMB 4BE0A 1RT5B 2CNKB 4FVCA 3CJCA 3S41A 1BXNA 2QIFA 1D1UA 4C8NA 3QNOA 2DEJA 1H2TZ 4P9SA 5BRFA 2C22A 3M8YA 1VJQA 1P6TA 2QA1A 1S57A 1M5VC 3GIMA 1T05B 3TEHB 1JJ2R 1O6XA 5E3RA 3TJ8A 2AGOA 2MKKA 4YY3K 3E9PA 4FW1A 2O1PA 4UY8T 1QS4A 3CYMA 3K0JA 3D5MA 2UUCK 2VQFJ 5CYQA 1OPZA 4Q5VA 3S8SA 1BUXA 1CJUB 1WBDA 3ZZOA 2W8LA 4RW6A 4C11A 3ZZPA 3GDQA 1U0SA 3MM9A 3IR7B 4GKJF 4A5AA 4FJ9A 1DY3A 3G2XA 4W5RA 2GJIA 3W5YA 3B82A 2CXEA 3NF9A 4AQYF 2P1JA 5LSOA 4IG0B 3US5A 1J2VA 2MZRA 3VAJA 4MIWA 3AVJA 4LUBA 2E2OA 1M5PC 1RP5A 3FZMA 2UUAF 3L95X 4I69A 1JLAA 3L2QA 1RTIB 3R2CJ 2HBZB 2G8VA 4MK7A 3C95A 3MAAB 4JI0J 4LFBK 3R8YA 3MCNA 1PAEX 3SAGA 2CQ2A 4JK8A 4ILJA 2VG5A 2R8IA 3HFZB 3UPFA 4IDKA 1X4FA 5EX3A 4DPTA 4UOHA 3OR1A 4F4ZA 3GOIA 1S1TB 1IV0A 5IZHA 5HRNA 5AT1B 1NJYA 1FRLA 2HS0A 3O5TB 4ANEA 2LQ8A 1HKGA 2KZMA 3GILA 2OCEA 3RB4A 2XGQA 1YLXA 1HX1A 1Y00A 3D2WA 1WUUA 2R7TA 4NE9C 3SQ2A 1N5SA 4DUYJ 1HQUA 5AXNA 1NSKL 3CDUA 3KLGA 4WP8A 1T9TA 1WDTA 3UW1A 5KG2A 1W7AA 2BQRA 2QL9B 2DD8S 5THWA 4WCEQ 5JVHQ 5E26A 3E3XA 4OZ3A 1FRIA 4NLXA 4CZGA 3GG0A 1PGZA 4NLCA 4PUOA 4E1MA 1RTHA 3OFEA 3UD3P 1TK5A 3N79A 4GMJB 1YJ7A 4MDAA 1VQ6S 1N88A 3C15A 1QAXA 3LALA 3OFGA 1N54B 4CWBA 4CEEA 2D1CA 2M7SA 2VG7A 4RNFA 1KAZA 1X7VA 1CLQA 1VSEA 2GFFA 3EZWA 4DDFA 4I2PB 5JICA 1VHFA 2QL7B 3TSQA 1D9DA 4C97A 3WXIA 3X1LB 5L8RC 3UKUA 3NNAA 4NLYA 3SFGA 4FXWA 3OTDA 2ZE2A 4EP4A 3WQPA 4KGMA 1I3OB 1M5HA 3VZIA 4F9OA 2CQGA 1R6YA 1C1CB 4EZ6A 2F7VA 2KLAA 3M8SA 3CCUS 3G9CA 4W5NA 4H0TB 2BUPA 3VHQA 5J1EB 2X1GA 4OI2A 2BJ9A 1RBSA 2B4VA 4UZCA 1UKUA 3WQTA 4BWJA 4QW9A 4XIUA 3A3OB 1U0HA 1WSEA 3CCSN 5K14B 1N5QA 2MLYA 3H5XA 4L76A 2PBDA 2GQ2A 4BRLA 4DV7J 2UVWA 3ISND 4IRCA 3HTVA 1URRA 2U1AA 4DSIA 3THPA 3NCIA 1VK8A 4FDFA 3K5MA 3PV8A 4WP3A 3H2LA 4G6VB 5JJBA 5LXRA 4YOTA 3SDEB 5CYMA 4RUAA 3WUHA 3VEVA 5C25B 1QLNA 4DR5K 2NPIA 1ZZFA 3MM8A 4J8FA 1FK9B 4KAIA 3B54A 3S7RA 2YV0X 3VQ8A 1N5VA 2XRIA 3WNFA 1RU1A 2A2CA 2Q31A 4UUWA 4CEFA 5A8RA 1FERA 1EJ7L 1YI2N 2UXDF 2NZ4A 3UE5A 1SL2A 2P9IB 5GAGP 2GGPA 3BQ0A 3GR1A 3IR5B 1OH5A 3TI0A 1EWQA 4HEA9 3B6OA 4ICLB 1VIXA 4X64K 2CJKA 3NNHA 3HOSA 1HR0F 1Q9XA 3AT1B 4B3TJ 1J5OA 2Z1IA 3GFZA 3VGTA 1S6UA 5HRSA 3KTQA 3I9V9 5A2QY 2MQ8A 2Y1IA 1ASUA 3ZTRA 3THXA 3GG1A 2MQOA 4O3SA 2VHGA 1J6ZA 2JZ5A 2YKOA 5C42A 1X60A 1OWXA 5J2PA 2SXLA 3ICLA 3NMAA 1W97L 4C7QA 5AQZA 1FRMA 1TV6B 4ANCA 1EARA 1VSMA 4FJJA 1D09B 1RWOB 4LF8F 2LU1A 4IEEA 2ALZA 2VGNA 4CEAA 1Z25A 5CHIA 1W2IA 4ED6A 2V8PA 1TL4A 1K73O 3HSJA 1BI4B 1BCOA 2VG6B 5ETOA 2HGMA 2VFVA 5AZJB 2XBPA 1O0PA 5IC6B 5IWAK 3M8QB 2EG2A 5H9EK 4MQ3A 3A8EA 1H3DA 2V50A 4KHPJ 4L8RB 3IN5A 2QGFB 4B1XB 4CJUA 1K1SA 2CPYA 4CD3A 3GR0A 5M1PA 1C0GA 2HHXA 5AXLA 1TK8A 3BBCA 4CH7A 1RU2A 3R6LB 2MY7A 3PXGa 4FN5A 4DV6K 1JIHA 3OV7A 1WI6A 2A42A 4GVEA 2DNMA 3NWRA 1LV5A 4ZIWA 4FYVB 4G9ZA 2EEYA 3P6YC 3D1OA 3OTOF 3K2YA 3RW7A 1UVMA 1NNDA 4C8ZA 5KTQA 2DNNA 3D0GE 4CJLA 2MEWA 3SZ2A 5FPNA 3BSOA 1ITPA 2RD5C 2I2YA 5BR8J 3PSIA 3V81B 4BROA 2QWQA 4A59A 3G8SA 1SC1B 3MPDA 3DRRA 1QD1A 3GONA 5LM7E 1CS4A 3CMEN 4O4RA 3O9UA 3V4IA 3UVJB 4CE9A 3VGMA 3MXJA 4ILMA 1RUSA 2O5DA 4WFZA 4AYBD 4M5LA 5C7PA 1NKBA 5HANA 4HYKA 2ZVSA 3DNCA 4DQQA 3QSYB 1YDLA 2ZH7A 1R8BA 5GINA 3QIOA 3TNVA 3DXMA 1F5BA 3BQ2A 1TYQA 4Y00A 5T41A 4QW8A 4CO1A 4KBIA 4JI6J 4KHMA 3F5TA 3POTA 2UV8A 1JLGB 2WSFC 1NNEA 3PRBA 3BO4A 3L09A 2QC3A 5M2UA 3A13A 2DNLA 1S6QA 3LGMA 2CGJA 2EW9A 1DQ8A 2DIVA 1UP1A 2EG1A 5CCLA 3G25A 4J7CA 4CJFA 3CJSA 1IWGA 4WFYA 4QIGA 5SWMA 4USMA 3I0SA 4FOEA 1QVGR 3CC7N 1Y7PA 2WTUA 1FDAA 4O44B 2G8HA 2AEMA 1P27B 3D45A 2CUYA 2DNYA 1JLBB 1AROP 2R7RA 2O8EB 2FIUA 5D77A 3MEGB 2B56A 5GAEP 3VQBA 1CXUA 3PIPQ 2EC0A 4FPRA 4DR6F 1A6LA 3BS9A 3HHKA 3WIVA 3TWZA 4LBPA 3I32A 4HUFA 2VPWB 4ILRA 4RW7B 1RGVA 1T3NA 2V52B 4CFBA 4YFUA 2GWKA 2AEFA 4LBIA 5ETMA 2XULA 3FCHA 1X3MA 3QMLA 2XHWA 3PM9A 1JL2A 2YNGB 2L9DA 4O55A 3MDFA 2HF4A 5HBMA 4RKUC 4ISEA 1SC6A 2X78A 4FWSA 5HRRA 1X4EA 4ZN1A 3H2UB 1SIWB 1X9JA 4X62F 1U1PA 4IR9A 2PMZD 4PR6A 1MROB 2GZOA 2PFDA 4LR7A 2D5RA 1R6VA 3H3NO 2XWYA 3DFEA 4NZ0A 1F0XA 5K20B 2JLFA 2HNZA 4N56A 4FYYB 5M1FA 1S6PA 4DR2K 4N41A 2EK6A 4CEQA 3UI3A 1T05A 4CYUB 2KQ2A 4I6MB 4OI4A 3VEXA 2LVWA 4OPAA 2IDEA 3NP5A 5DZ7A 3W63A 2FTRA 4P75A 3N01A 1DGKN 3ZLJA 3UKRA 1ZBHA 1VHIA 2VWKA 3PUFA 2CG4A 1NAQA 1TMJA 4GKKJ 3SAFA 3IM8A 4CZFA 3D0HE 3VF4A 4FCYA 1RLCL 3LUYA 4P71A 1VQMN 4DUZK 4FLYA 3M32B 3U1NA 4NYFA 1RT1A 4BWMA 3OPKA 1RWXB 4YORA 1X4GA 2H48B 3VGKA 4LFCJ 4WTOB 3DJCA 4DPXA 2R2RA 1SH3A 4YY3J 4JKEA 2WZ1A 3AVAA 3VQDA 3LM2A 2GNKA 3NVMA 3SSRA 4Y6IA 1N5YB 3NGUA 2QWRA 1BISA 2UUCJ 1OH8A 2K3KA 3P83D 4NXMF 3V9XA 4QS7A 5KFBA 3GMGA 1I94J 1JX4A 1Y9OA 3VQCA 4XDDA 1RYSA 3CT9A 4CNZA 1RTIA 2ZNZA 3CQ8A 3T19A 4MIAA 3WX8A 2OPQB 1OY6A 2ITMA 5GIPA 2O67A 5L1KA 3C0BA 4BE2A 1S76D 1V3RA 5EDWA 4QIWD 2OPPB 4FWRA 1RT2B 5HSPA 2RQ4A 4D3HA 3M9MB 1IBKK 2IC3B 2OAUA 4DQ8A 1RGIA 3KMQA 4RO0A 1JLQB 5KFUA 3NS6A 1VFJA 3QEIA 2HFZA 1S0NA 3CM5A 1YZ7A 2M0GB 2QI2A 3TANA 3GIRA 2HGLA 2HFOA 1T94A 2CPFA 2L9NA 1HWKA 4BR7A 1WELA 4PG6A 5GMDA 2DHXA 2I7NA 4FWMA 3ZT4A 2I8EA 4HACA 3MM7B 2D1KA 5DO2A 1Q0NA 2DPJA 3IGNA 1OY8A 2ZM6F 2UUWA 3FZFA 1T8EA 1D4XA 4I2PA 3QEPA 1HPZA 2W1BA 1S12A 3SLCA 1X31C 2AZ3A 4DR4F 2RE1A 2DK2A 4P6QA 3MGJA 1Q82T 2CFXA 4OHZA 4KPYA 3T1YF 2MLXA 3M9OB 3THVA 3FJ2A 4TQSA 4JRPA 4WJBA 4Z7YA 3TJAA 2G8FA 3TTCA 4JI8F 1NHVA 3M8PB 3DOMA 4DQIA 1YI2S 5IOLA 2N3OA 5J1EA 2QN6B 1R7IA 2DNZA 3W9IA 3A8JA 3R5BA 4B3OB 3ZX2A 3KHGA 2W2PP 1Q86O 1O8BA 4LR8A 5ETNA 1LFPA 5H1SQ 2YKAA 2OI2A 3MEKA 5KT2A 1NCLA 5I9EB 1EO1A 2E5LF 2IVOA 3T1AA 3AD7C 3TSUA 3M6VA 1ZS6A 1HMVB 1YIJN 4ZKAA 2G4BA 2V8VA 3SAHA 5AQIA 2ZKUA 4EBDA 1JMTA 3AY0A 4FLVA 1L5UA 1YHQN 1HYSB 2EK1A 4OYPA 3VESA 4C8LA 4JI7K 2IDOA 2BANB 2NXEA 3H4BA 3PY8A 3KJVB 1Q78A 2HHHK 2PE8A 1OVYA 2NQPA 3A3NB 1FEEA 5C25A 3TABA 3HVAA 1RTJB 1S49A 5CQGA 1YF5L 4MAKA 5AQUA 1TUVA 1FK9A 1TUGB 1TZ0A 2V63A 3I56N 5G4DA 1ZH5A 1OY9A 3G82A 4DCOB 2ACMA 3PW7A 2IA0A 4NZ7A 2P9IA 3BSAA 3MX2A 1U25A 3M9NB 2FHOB 3MWBA 3Q0AA 1S48A 2AW0A 2XMTA 4W92B 3GYXB 1OH6A 2P9KB 4A5BA 4RNOA 4Y2MA 1VQKN 1FCAA 4QR0A 4KKOA 3WC2A 1AW0A 3QLHB 4J91A 5ETKA 1MMNA 3KK7A 3RVCA 3EE8A 2YWWA 3IRWP 3VOVA 4ECQA 4QBUA 4DR5J 3VQ5A 3A0IX 3SCLE 1OSCA 3GIKA 3L9ZA 2DGXA 2XMVA 2B9WA 3VQSA 1RDUA 5CZVA 3R9LA 4K0KF 2OD6A 3Q22A 1IWAA 4ZOSA 2Q2RA 1NG9A 4OLAA 2BE2A 4URSA 2FC9A 3ENBA 4QWEA 2E2QA 2R2TA 5CAAA 2LA6A 1BA0A 2A40A 3IBCB 3QBWA 2CKWA 4JNEA 3BSCA 4F3OA 4PL8A 4JI1J 1ILYA 3M2RB 2JOQA 1BC6A 1IKVB 2FZGB 1FFGB 3AARA 1VK3A 4FXVA 3UR3C 4B9UA 4X64J 1HHQA 1QM9A 3LO3A 1DKGD 1BI4A 4B1VA 1S9GB 2KN4A 4E7JA 1RDAA 1W25A 2HAIA 2KT3A 4DPYA 5FD1A 3M8QA 3V9SA 1VQPN 4UY8O 2HQFA 3QT7A 1U1QA 1RCXB 2E1MC 5B0BA 4FO0A 2LXIA 3KHHA 3BKUA 3HSDA 2BEFA 2EI5A 4ZVQB 4K2JA 4IBNA 4E7LA 2X1AA 2E1ZA 3MM6B 4B3MK 3CCJN 4JRQA 1JKHB 4FWPA 1A0OB 2AP1A 4OLOA 2RIJA 4IQMA 1B7FA 2NRZA 5F8JA 2G0JA 3HHLB 3DYAB 2WVCA 2ZDOA 4A4JA 4ZPBA 2BJDA 5HMZA 4Y0WA 2PY5A 4ELVA 2IAJB 2FBYA 1GK8A 2YPZA 4ZLNA 3V81A 3DRSB 3CC7S 1T9VA 3I8DA 1NBWA 1S1VA 2DNHA 3N5BA 1DTTB 3BO2A 4PYDA 4DV6J 3VEOA 3NFAA 4LFAJ 1Y3JA 5B0CA 5GAEI 2LYVA 1HNXK 5CZ1A 3VGSA 3NAHA 4OZLA 4DN9A 2RMLA 2WUSA 4U7UK 4ED5A 3FKBA 3CCQN 1N34K 2NSCA 4R0EA 2R7SA 3PFEA 1NU4A 2QT7A 1RT7B 1U04A 1WHXA 5JS2A 4ECRA 3MN6A 3PW0A 1WC3A 1HNZF 3VTHA 1NM1A 3BDPA 4LSNA 3NKYA 4XO0A 1FKOA 4CT9A 3ZT0A 2VB6A 2YKNB 4RTFD 2HQGA 3ILIA 2V4JB 4S0MA 1FWLA 1YJ9N 3HO1A 5EUHA 1XMQF 1KKHA 3AODA 4CCHA 5C2FA 2BOAA 3ASMA 4CJ4A 1JLBA 2MHEA 3TAEA 4ZVOB 5AJ3F 2O8EA 3MEGA 4ECUA 4JHDA 3QPIA 1GXTA 4CJQA 3DHWC 4I1TA 3T69A 3AA2A 2QEXS 2DFEA 4Q0BB 3JSMA 3EE9A 5F0XA 4KQZA 2A3JA 4RW7A 4WF9Q 4AL7A 3SQGB 4DPWA 3BN7A 2F4VF 1WLJA 1VQ4N 2JH3A 1TKTA 2WW4A 3GU0A 1RAOA 1YAGA 2VGMA 4OV1A 3C7NB 3FMWA 2FD2A 5JLFA 2EFGA 3CJKB 1MROA 2UVVA 3OR2B 1NK9A 1G2EA 4M5HA 3VGUA 3KZBA 5CR4A 4CRJA 4I67A 3AAQA 1YJNN 1JCGA 2DEIA 4FNIA 3AAPA 4CHZA 2EFVA 2RN2A 3VN5A 1DT9A 1PSDA 3HL8A 2ZH5A 4NA1A 2IM3A 2LEAA 4ZLLA 1Q81T 5B0AA 4DEZA 4EZ9A 5MLCQ 2V34A 4CYUA 5J2QB 1X4DA 1PJ6A 4X84A 4P52A 3BB5A 1RT6B 2DRAA 4LF5K 5C24B 2RVJA 2AJ4A 1TKXA 1J54A 5AQFA 4DR7J 4EHTA 3OW2M 4NLDA 3H4DA 4F36A 3EM1A 2CQDA 1MU2A 5E2QA 2CQ0A 3AVBA 4QR2A 2O8DA 5FPEA 4IG3B 1RWMB 3BKTA 4A61A 3KLIB 3M32A 1NDKA 1X1PA 1VCTA 3PW2A 5HP1A 4DR2J 2ZOFA 2MYFA 2XS7A 3CPWR 4LIWA 4H0VB 3VMFB 2FZCB 4DUTA 4ZVTB 1HBUB 1ZAXA 4CHOA 2AJQA 4FVUA 3H08A 5T14A 3NRBA 2MKIA 1N36K 3B6PA 3WXJA 1V4TA 4IFEA 1ZBTA 4HVJA 3PJXA 2GBZA 3CJQA 3H2VE 4M95A 2F8TA 2CPJA 4YEAA 3M2VB 1OO0B 3AVLA 2DT9A 1FEHA 1CZ9A 2NXCA 2VQFF 3VQ9A 3M6GA 1PC4A 4KH5A 2CH5A 4U67Q 4DUZJ 3T9ZA 4YHHJ 1OQ6A 3NH1A 4W98A 3LGHA 1VYAA 4IZ9A 3SQ1A 3TA1A 3JSRA 3AO5A 3PX4A 2VQEK 1R0AA 1UAWA 4MLHA 3V1OA 3ZETB 2X1BA 1WWHA 2DRDA 3UIQA 1Y5NB 4LF9F 4C0BA 5KFDA 4OKKA 1SUQB 1PJ5A 3UDLA 2OD4A 3TAPA 2OPPA 1RT2A 4DV5K 2YNIA 2ASLA 3AQPA 4K50A 1SJFA 4YOXA 2W9BB 3FC9A 4QWCA 4M3ZA 1JLQA 1SH0A 4LRFA 2AGQA 2ABYA 2W7PA 3HI9A 3QINA 4CF1A 4CI6A 3RBZA 2RT3A 1NM2A 4ISGA 1LWEB 4IUFA 1MA9B 3DHXA 3I5BA 2X6SA 2HBYB 1HFEL 1T9UA 3G71N 4ED0A 3UCUP 1ZBLA 2Y1LB 2RPIA 1AFJA 1XUPO 2JFDA 1S0VA 1XTZA 2V7ZA 2MZQA 4BRMA 1NSAA 5CE3A 1CQMA 1K0VA 4LF7K 1EB0A 3TAMB 2NZTA 1Y97A 4JI4K 3NBPB 2OA8A 3QO9B 4FZYA 3RZAA 4Z37A 2F8MA 3KUHA 1IBKJ 4DUYF 3EX7B 4JK7A 4WFXA 3RWUA 1FRHA 4NA2A 2VUGA 3EY1A 1GLCG 3P5TL 3LDOA 2QRRA 3TAFA 5B0GA 3NGIA 3CG7A 3O4WA 3DLLL 2N4CA 1LW0B 3QNWB 4OJRA 4P2MA 1GLJO 4IDHA 1JQGA 4H4MB 1BQXA 2ZJPL 2F7TA 3GV7B 1FWPA 3S3OA 4DSFA 1KXPA 4L72B 5E84A 1XNRF 3RG6A 2F9JA 1YRXA 1VSFA 1TELA 1V5VA 1TKDA 1B70B 5FIIA 1KWMA 4DV4F 3O3LA 4O0IA 4YNQA 4FK2A 4WQ5C 3PCOB 5IQQA 1HBOA 4NLBA 3D0PA 4C0HA 1HQEB 4KTZA 5D78A 2DTUA 3AA5X 4B3OA 4WWSA 5M1KA 1IUJA 2ZBPA 1GOBA 2ZVIA 1KD1T 3H5UA 3E01B 3CC2N 3QESA 3LA0A 1TP7A 3JAMU 4CBUA 2WONB 3VQPA 5EY4A 2P9CA 2GIRA 4CIOA 3CCMN 1VQKS 4OVLA 4FF3A 3PDNA 1YBUA 3BGFA 4OX7A 3HM8A 4DV0K 2CQ1A 4L73A 1RTDB 2YY3A 1Y64A 2LQJA 1VRQC 3LDQA 4DL7A 4WU3A 2RDJA 4DV3F 1GTHA 1FF2A 1AB8A 1Q1KA 4LQ3A 4OYOA 2CGLA 1HYSA 3C14B 1J5EK 2R2SA 2BANA 8AT1B 4ID8A 3VGLA 1NGIA 2OPRA 2UYTA 2AYGA 1RAIB 2VKZG 5IS2A 1HYZA 4NLVA 1RDRA 2DH7A 1RTJA 3KG4A 4RUBA 3AXKA 2ZQBA 3ITHA 3ZTOA 4YB6A 3VQ6A 3GBTA 3D7SB 3VZHA 3ZFVA 2QMXA 4HTIA 3AH6A 1TUYA 3R7SB 1QE1A 1I3AA 4FL9A 3FR0A 1G6BA 3PR5B 3JTNA 4FJKA 4IWVA 3NGSA 1MMDA 1E4GT 2C1EB 3HHNB 1KHWA 4JI7J 1FT8A 4WE1B 2P9KA 4FLUA 2HHHJ 4Y3CA 3RB0A 2ROGA 1Q8KA 4PG4A 1IVZA 2HQIA 2E5HA 2MTLA 4EU0A 3OL6A 4EEYA 5KFWA 1WSIA 1C0MA 3TR8A 2BA9A 4HTUA 3CCJS 2HSEB 4DU3A 1W7WA 2IIRA 3IRXA 4FKXA 4KTQA 1MW7A 1VHXA 1SB6A 3QEXA 2E88A 1U2RA 5EWGA 4KB1A 1X9WA 4CZEA 1BG3A 3KK3B 1JXLA 2CAJA 2L08A 3E51A 3LW5C 4B3TF 1S9GA 2XMKA 1JL1A 3SCJE 3NG8A 2YNFB 2OTJN 1XWLA 1KCFA 5HQ8A 4L3QA 5AQVA 2HNYB 4X4VA 3Q24A 3U3GA 4WYWA 3CCLN 1ZBUA 3HVTB 1SJQA 4FF2A 1Z2ZA 1X9SA 4NRUA 3KD1E 3KOAA 2ILZA 3CCQS 2Z30B 3MN9A 1JKHA 3B8AX 3E9LA 1R89A 2C3UA 3RMDA 4QYRA 1VQYA 3ET6A 4ISFA 5KFSA 1RWNB 2OHDA 3HHLA 3DYAA 3MD1A 3EGWB 4CVNE 5J2MA 4HDHA 1L3SA 5ELZA 4DL5A 5KFAA 2B0GA 1EKEA 2KM8B 2RQCA 2EBGA 3HXMA 1PIEA 2ZH6A 1F9HA 3V4MA 5AE3A 4JI5K 1DTTA 4HH1A 1VQ7N 2EVZA 4HHUA 2COLA 4I2QA 4ECSA 3T1HF 3PW4A 4AT1B 3JB9k 3W3SA 3R5CA 3OBYA 3F9KA 4B3MJ 1WOPA 4USHA 2J0XA 1WACA 4NI2A 5KG6A 3QT5A 4IH5A 3TVZA 4BREA 3GFXA 3BN4A 4U96A 2XNRA 3MPWA 3LZJA 4DTMA 3UCZP 3VVTA 3VAIA 2RKIB 1BHLA 1RT7A 3WNHA 4JKDA 1WC5A 3ZT2A 5FRMA 2Z56B 3UDEA 1SPBP 2HMIA 3ZSVA 5C10A 2F1FA 3GIIA 3UQSA 2XO7A 3PZPA 1WG4A 3ENVA 4IR1A 2AHOB 2R2UA 5BXIA 4FJGA 3DLEB 2FLOA 4OX9F 1YJNS 1G15A 1VAZA 4K25A 4DX6A 4CESA 2YKNA 2JEIA 5KRSA 2E7VA 2KYXA 1XMBA 3CC4S 2MZJA 4AF1A 4RNMA 2CPDA 5F41A 1HNXJ 2JJ4D 2ASOA 2OPSB 2QMWA 5HI7A 4F50A 3RUBL 5IT4A 4A48A 4KSEB 3V6JA 1N33K 3CWJA 2C3MA 5E41A 5KFIA 4IJAA 3HT0A 1YJWS 4H0YB 3CDEA 2F65A 2FJDB 3WIUA 4Q0BA 4F25A 2YNHA 4JI6F 1WC4A 1IBMK 2ZZNA 5J2NA 5KRTA 1L3KA 3GTYX 3IMXA 1TL1A 2AYEA 1RAJA 3SQGA 3UN3A 5F0WA 4J9UE 2IBKA 3HSCA 3ULEB 4ZA1A 3J81U 3O3FA 1RFQA 1FFWB 1TKZB 1LKZA 1ZTTA 2N82B 3KNGA 1VBKA 1C6VA 2DH9A 4RBUA 4M63C 1KVAA 4X65J 1Q82O 4B3RK 4PAAA 3CJKA 5AQYA 4OI1A 1Y0HA 2GIQA 2J7UA 3ZSWA 1UVJA 2HHQA 2NLWA 2VZ9A 3EPGA 4M41A 1C1BA 3T5KA 2LP4A 2MDAA 4OYAA 4RZRA 4WKRA 4PXBA 4B3SJ 4EI2A 1KVIA 1RCHA 5J2QA 2VWJA 1IBCB 4PQAA 4EWTA 4CEZA 1RT6A 2F3JA 5C24A 3MEEA 5D15A 3MFHA 2UUTA 2W9AA 4PG7A 3PYFA 4DV2F 4LSLB 3LPUA 3O1BA 1FJCA 1NRKA 1FWKA 3P96A 4IG3A 5KT4A 3KLIA 7FD1A 2BX6A 1GX6A 4YOYA 5KG7A 1JLEB 1X4HA 2MKSA 2J76E 2AIRB 2FJAB 3LM9A 3NL0A 1HBUA 3CJRA 2KDOA 1QAIA 2OEJA 1FKPA 2VL1A 4U7UD 1ESVA 4LREA 4XH5A 1U24A 1LXNA 2IVMA 3ZSQA 4F3QA 1IH7A 3EVWA 4JI3F 4O5BA 3W5XA 4H5VA 1KOOA 1WUAA 5C5JA 2W9CB 3VEWA 1E6YB 4DTPA 5K8MA 1YWXA 3CQXA 4A57A 1WDDA 2H51B 2O8FB 4F4YA 2V6AA 3R1LA 1ULRA 2DY1A 3PACA 2CYYA 1HWJA 4I7FB 3BKFA 4DCPB 4CF0A 2ZUGA 5KG5A 4RBTA 5HQLA 1S10A 1NGHA 4C3KA 2RHKA 3UNYA 2ZF5O 3ZETA 1RDDA 2XQCA 1N36J 4YDUA 4NEZA 3J80O 2P9PA 2OZSA 2GHWA 2VC0A 4F4AA 1XNQK 2HBJA 2E4LA 2YXLA 4ZPTR 1FTRA 1F5AA 2YX4A 2H4YB 3M05A 2UUCF 4ZTFA 2ASDA 1RA7A 2PGCA 4CGDA 1EXQA 4RW8B 1MSWD 4K59A 1RT4B 1ZOTA 5ETTA 4GO7X 4DTOA 2UUBF 2FC8A 1GLDG 1C0UA 5EHHA 2VQEJ 3HP9A 2FPHX 3OYBA 2E44A 5LY3A 4P2XA 4WKYA 3RMAA 3IUCA 3SCIE 1BGXT 2VPYB 2DO4A 3M4XA 2NLXA 3KFWX 5KFVA 2XB2D 4RUHA 3TAMA 4CBWA 4DV5J 5AQPA 2G0IA 4K4TA 3NBPA 3OTEA 1P1TA 4PXDA 3L7UA 3WDOA 3K58A 1QQNA 3CCMS 2FBVA 2OUGA 4CM2A 3VQQA 2V8DA 3L7OA 5EOYA 3CD5A 3CD6N 5KOXA 2PEBA 1LOTB 3IWNC 3HPOA 3NOCA 2YKMB 4LFBF 1YRTA 3RRGA 2IPOB 2VOPA 4U6PA 4KHYA 5KPRA 3MMAB 2DGTA 1VQ5S 4TQRA 1KOHA 3SQOP 4JKCA 1WKJA 4B1WB 3G10A 3AD8C 1VQ8S 3D67A 3U1MA 2QKKA 3H46O 1RA6A 3LP3A 4LF7J 4B8AB 1NBEB 2W25A 2YHXA 2NUBA 2QLJB 3O8WA 8ATCB 3GYGA 3BR8A 5KFRA 1NWKA 1RLDA 2C2MB 3THYB 2PYJA 4ZLJA 1JWWA 1YQHA 1QHTA 3E01A 2DXFA 4WQ5A 3ETOA 3NF8A 2AJ2A 1LW2A 2FJEB 2GX8A 5EGYA 2VODA 1YBTA 1D5AA 4KV8B 2ZFHA 2GVDB 4Y2AA 4M45A 2FHJA 3FUYA 1RTDA 2HBRB 1K8KB 3O9TA 3R5GA 3TRGA 2HBLA 3BPSP 3C14A 2HBQB 3KLHA 4H4OB 2OEKA 4V19X 4UQTA 4UW2A 5L46A 2M4MA 2EKNA 4BCAA 2NREA 3LP0B 5IXUA 3C2PA 1LXJA 1R8HA 3DAWA 3NGYA 1XQIA 1RWUA 3I55N 3OLBA 4IH7A 1WEZA 4HTLA 4UZBA 1NDCA 2XYHB 5KI6A 1B3TA 3GJQB 3BREA 2W2MP 1XC9A 5ADXA 4JV5F 2VJUA 1CBKA 2VFRA 2AMCB 3DGPA 1FVSA 3FBEA 2V8GA 4PEOA 5T7LA 1S5JA 1BQNB 1FVQA 1H1VA 1GT8A 4JD2B 3LGNA 4DZDA 2J0SD 3ISNC 1S72N 3BH6B 4E7IA 4GVLA 4NCGB 3N28A 5E3CA 3TR5A 3VAHA 2NNWA 1XI1A 2CJBA 2NXJA 4KAZA 2DXDA 4WIIA 5AE2A 4CERA 3A5MC 5DLFA 4AHCA 3QDKA 3ZZYA 4H54A 5L9XA 2M8DB 2C28A 4OZNA 4DTSA 4YB1P 3BYPA 1WG5A 5BYSA 1RZMA 1IKYA 4EBCA 3C19A 1QUPA 2D0AA 3HI0A 3SQ4A 1Q81O 4KH0B 4B9LA 1K73T 4IO8A 3KK3A 2AD9A 3NH2A 2O3DA 5AQLA 3NOGA 2CRLA 3Q23A 4DSLA 5E5NA 3ZX0A 4I6WA 3BZKA 2VDIA 2DNPA 1N8RT 3TWHA 3OXFA 3O2IA 3QEVA 2HNYA