2YNHA

Hiv-1 reverse transcriptase in complex with inhibitor gsk500
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 164
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynhA05
5DK5A 3M8PB 5KG5A 4ZPBA 1HYSB 1K1SA 2XY5A 3OSPA 1HYZA 4Q0BB 2XC9A 4IG3A 2IAJB 3DRRB 1QSLA 1TKXB 4F50A 1RT5B 2YNFA 1BCOA 4O4GB 1WSEA 5EUHA 3MFIA 1WNSA 3VQBA 2HVIA 1WAJA 5HRNA 1TL3A 4FZZA 4FBUA 2HNZA 3OVNA 1SKSA 1NK4A 3TAFA 1N5YA 4FM0A 2F96A 4ECQA 4MIBA 4WXWA 4MK9A 4N56A 4KO0A 2B6AB 1KHWA 1MU2A 2OPSB 3DMJA 3GV7B 3OYHA 3QNNA 1I3AA 3V9ZA 5KT6A 1A5WA 5KFKA 5JS1A 4ZP9A 2WB4A 2V9WA 2E4LA 5EDWA 1K6YA 3IGNA 3QNOA 1KSPA 1ZBUA 4URSA 4O3PA 4X2BA 1SV5B 1GX5A 3KLHA 4OKEA 3WNFA 4PWDA 4HUGA 4EEYA 3MXJA 4ZHRA 1FKPA 3C94A 1BQMB 4KI4A 3QEVA 1NKBA 3IRXA 4E0DA 4DL5A 3KKRA 4DFJA 2BDPA 3PHEA 1LWCB 3MR6A 3OYJA 5HLFB 3CVKA 2RN2A 3AA4A 2C2DA 3NF7A 4RNFA 3BGRB 1LW2A 4DLGA 3AVFA 3BQ1A 3M8PA 2OYQA 4Y1DA 3QYYA 4CEBA 3BJYA 4Q0BA 2IAJA 3DRRA 4CGHA 1BGXT 4IFYB 1T03B 1RT5A 4O4GA 1JXLA 1KLMA 2Z1HA 4NLWA 3V6DB 1JLAA 4NLTA 3LPUA 4ECYA 4ZPDA 3H2LA 5L1LA 3VN5A 4E3SA 4CHQA 2OH2A 5KFRA 2B6AA 4Q5VA 4I7FB 5T14A 2OPSA 2HHWA 3WNEA 2D0BA 3LDSA 3PX4A 3RAXA 1T05B 2DPIA 4FBTA 2HB5A 3QIPB 3CQ8A 3CJ2A 4EP5A 1T8EA 5KFZA 3M9OB 4F8RA 1JXBA 1SV5A 1LAVA 5HP1B 4KHSA 5L1KA 3RMCA 4ECWA 2GIRA 1CZ9A 1QSSA 1RT6B 1Q9YA 4DG1B 1FKOB 2F8EX 4XPCA 1W25A 1IH7A 2GBZA 4Z0UA 3P83D 4CEFA 1NJXA 4NYZA 5KT4A 2WOMB 2KTQA 1LWCA 4W5QA 4CF9A 1HYVA 2HWHA 5HLFA 3CDUA 3HT3A 2R8IA 3QINA 2W9CB 4CCHA 4F3TA 1RT1B 4B8AB 3KHRA 4IBNA 4NLGA 3TVKA 4EZ6A 2DFEA 3I0SB 3QZ8A 3NF8A 1DTTB 1VSHA 4ZPCA 3NE6A 4TY9A 4OJRA 4CK2A 3NH1A 4OL8A 4IFYA 1T03A 3O3HA 1NOZA 4ZMMA 1HQEB 2WCXA 3T3FA 3V6DA 2XY8A 4AHTA 2HHQA 2I1RA 1Z25A 3BSNA 2BANA 1L3SA 4IDKA 2QXFA 4IH6A 3DDKA 1VSMA 2VA2A 1C6VA 4FK2A 4RW8A 3PO4A 4O3RA 2WHOA 1WAFA 1IKYA 4I7FA 3LANA 4DMNA 1C0TB 5KFEA 4CHZA 1IM4A 2UVUA 4W5TA 1VSFA 4DQIA 3ZT2A 3AO5A 1RBTA 1T05A 1J53A 3ASMA 3QIPA 1QUVA 4AHVA 2FVCA 3GQCA 3SI8A 2AGPA 5HP1A 2B43A 1OS5A 3MR3A 1RT6A 4NCGB 4DG1A 1FKOA 3HVTB 2R2RA 3NF9A 4OLBA 1MMLA 4WXOA 2WOMA 3SPZA 3K57A 2W7PA 4EYIB 3O4NA 4FLTA 5KFYA 2DPJA 1RT1A 5DQGA 1NK7A 1WN7A 4EBCA 3NGYA 3I0SA 4TY8B 3VQ6A 1RDAA 1RBVA 3TAMB 1O1WA 1DTTA 3KLVA 1WSHA 4BACA 1BI4A 1S6QB 4KSEB 1JLQB 4CEAA 3OHAA 5HRSA 1HQEA 5KFXA 3MFHA 2HNYB 1RYSA 5EU7A 3OYCA 3HP6A 4O3SA 5KFOA 4FW2A 3KTQA 4LSLA 4B9VA 1N6QB 4AH9A 1EXQA 4ECTA 4DFPA 2HVHA 1TP7A 4FJNA 2OPPB 4DSIA 2HHXA 1C0TA 3K59A 2G8HA 2F8TA 3ZCMA 3GIJA 4DTPA 3TAGA 3ISNC 3SV3A 1RDRA 3SFUA 3S3MA 3AVGA 4KB0A 2R2UA 3CJ3A 4KAZA 4ED3A 3VQ8A 2XCAA 4MFBB 4KB7A 3M8RA 5K14B 1VRUB 1J54A 3G6VA 1HQUB 4GVMA 4DQRA 4NCGA 1NNDA 1CXQA 3TI0A 3KJVA 3V6HA 3RB6A 3HVTA 2G8FA 3OYAA 3ISND 2IM1A 2NUBA 3WNGA 4JV0A 3OL8A 2Z1JA 1HMVB 1C1BB 2IJFA 2IOCA 4KV8B 1RTHB 4JLHA 3ZT4A 2C28A 2AX1A 5CY4A 1ZYQA 2AX0A 4FW1A 1RTDB 4XPEA 4JS4A 3G86A 1BISA 4C8LA 4QWDA 2D7SA 4CJ5A 3EY1A 3QEPA 4MKAA 4TY8A 1RT4B 4HHTA 1WSIA 5KFPA 4DTOA 3CFRA 4B9SA 5C42B 1BL3A 1S6QA 3NGDA 4O3QA 2W8LA 4CIEA 5E41A 3T5KA 5I3UB 2YNIA 2HNYA 2IBKA 1JLBB 4NCAA 3DLBA 1NK8A 5JUMA 4QWAA 3GIIA 4J2BA 1N6QA 4NRTA 3SCXA 4Z4CA 2OPPA 3CWJA 1ZETA 1RTIB 4Y34A 3M8QB 3QIOA 4TLRA 2WTFA 5F8IA 2YHAA 2XCPA 3VA3A 4KHYA 4J9MA 4FCYA 4CJLA 2EC0A 2XHBA 1TK0A 1DTQB 5I42B 4E89A 1HQUA 2JLEA 2E9RX 2G8KA 4AHSA 4RNNA 5DGBA 1GOAA 4Y2AA 4O0JA 4TN2A 4ICLA 4EYHB 3SNNA 1S0NA 1VSLA 3H98A 4KV8A 1RTHA 4E7JA 4DL6A 4CK3A 1SUQA 3ICLA 2DTUA 4GC7A 3RRGA 1RTDA 4IR1A 3BQ0A 4DQSA 2VWJA 1RT4A 4JV1A 4O3OA 3KK1B 4BE2A 5C42A 4YMEA 2B4JA 2JC1A 3ZSXA 2HNDB 4CIFA 1LAWA 3H5YA 1X9SA 4HUEA 4KFBA 5KFHA 4CFAA 2AGOA 5I3UA 3HKWA 5F8MA 1S1XB 3EZ5A 3VQCA 1NHUA 3M9MB 1JLBA 2GIQA 4H8KA 2D3UA 1IKVB 1CXUA 4KHUA 4IRKA 1EX4A 3DRPB 3MXIA 1LW0B 3OL6A 4KKOB 4K4YA 1RTIA 3M8QA 2GC8A 1TV6B 2HW3A 2UUTA 3SFGA 4FLXA 4CJSA 4K4WA 4DEZA 1ASUA 3LALA 4TSXA 3UIQA 3ZSYA 3B6OA 1DTQA 3VQAA 4RW7B 1GOBA 4DTUA 2PY5A 1KCFA 1YVUA 5CYQB 4RNMA 1XHXA 1C1AA 4J9SA 4IFVB 5KG2A 3D45A 3P5JA 2DFFA 4CHPA 4HCBA 4J9RA 1U4BA 5KG4A 4M3UA 5KFJA 1S5JA 2D41A 3KIOA 4M3WA 4CF2A 2XI2A 3C6UB 2VG5B 3Q8SB 1U45A 3AVKA 3OYLA 1JLEB 3KK1A 2V0NA 4JUZA 4ECZA 1RT7B 1U09A 2HNDA 3PJWA 1B9FA 4B9LA 3O4QA 3RAQA 3I8DA 4YQWA 1LWEB 2XGPA 2HMIA 1S1XA 1EKEA 5T7BA 2HHTA 4MK7A 4NLDA 1YT3A 3V1QA 3MECB 5KRTA 2B5JB 4KHQA 3ALYA 1IKVA 3AO3A 3GV8B 4H4MB 3N6NA 2UVVA 2V4QA 4CGIA 2QV6A 5FRMA 3DRPA 1LW0A 3G6YA 4KKOA 4HYKA 2X6SA 2RF2B 4NLPA 1JKHB 1TV6A 1FXXA 4DSLA 3IG1B 2O5DA 4Q8FA 2ITGA 4NYFA 4PUOA 3PVXA 5KFMA 4LQ9A 1CZBA 2KQ2A 4RW7A 1B9DA 5CYQA 1I6JA 3N6LA 3ZSRA 1JL2A 2JEFA 4IFVA 2G8UA 3EPGA 3FDSA 3OYDA 3DLRA 3PW2A 3O3GA 4M42A 2ASJA 5F8LA 3G10A 3TR8A 1C1CA 4I9QA 5KFVA 1S0MA 3RR7A 1KVBA 2ASDA 3IS9A 4TQRA 3MEDB 2VG5A 1JX4A 1Y97A 1U49A 3GILA 1JLEA 4FZYA 1RT7A 4F2SA 3NL0A 2IJNA 2KFZA 3PX0A 4I2PB 3RWUA 4Q45A 3KK2B 1LWEA 3QETA 4QPXA 3ZT3A 2OA8A 3MECA 2E6MA 2B5JA 1X1PA 3F73A 3RMAA 1B92A 3K2PA 4H4MA 1XC9A 3IAYA 4M41A 3WNHA 4KPYA 2KZMA 3V1RA 3U6FA 2BRKA 4DWIA 2EX3A 3TWHA 3AVLA 4WE1A 2FJWA 2RF2A 2WONB 1JKHA 4J9LA 4N41A 2FLPA 3KOAA 3IG1A 4RW6B 1J5OB 4K4TA 4DQQA 4DL3A 4WZMA 4N5SA 4K4ZA 1HYSA 1S6PB 4K8ZA 3L2RA 3DLEB 4DSJA 1C2PA 4FJJA 1TKXA 1JLCB 2RDIA 3LP1B 4Y3CA 1K1QA 3AVIA 2FC0A 4ZVGA 3KKSA 3AO1A 3CJ4A 2A1RA 3IGVA 3MEGB 2PYLA 3V6KA 4G1QB 4FJHA 4CGDA 3QLHB 1VRTB 1S0OA 4Y1CA 3OSNA 3MEDA 3I5CA 3NGIA 3AVCA 4DQPA 1DLOB 4W5OA 4CERA 4FJ5A 3GIKA 4I2PA 3OLBA 4BDPA 3SUPA 3KK2A 3SQ0A 1KRPA 2XO7A 4ZVEA 3PW0A 1BCMA 1JL1A 5DMRA 2G8VA 5J2QB 3VA0A 1VSDA 2JC0A 3HXMA 1TK5A 4J9QA 1BQMA 1VSIA 4B3OB 4DSFA 3PR4A 4W5NA 4CJQA 3H4DA 5KFAA 2WONA 1TQLA 2E9TA 1TL1B 3BGRA 3OYKA 4K4VA 1W9HA 4RW6A 3VQ9A 3EYZA 2E6LA 1S6PA 3DLEA 4FYDA 4CJ3A 1SH3A 1WSFA 1RAJA 5KFLA 1JLCA 3LP1A 4IG0B 3GYNA 1TVRB 3QERA 4IKFA 2W9AA 3PV8A 3DLGB 4CE9A 2I5JB 3MEGA 3NAHA 4QWCA 3AA3A 3OJUA 4G1QA 3C95A 2Q3SA 3DOLB 3QLHA 1VRTA 4C8KA 1DLOA 3HVRA 4FJ7A 2D3ZA 4CF8A 1IG9A 4NCBA 2BQ3A 4OKKA 2UUWA 4RUCA 3NHGA 5J2QA 3LAMA 4DLEA 4NLUA 3HM9A 1UAXA 2YNGB 2F8SA 2KFNA 3OS0A 1RA6A 4LY7A 4DTJA 4B3OA 2XWYA 4FJ9A 1NKCA 3BR9A 1KFDA 3CDEA 3Q8PB 4IR9A 4ED0A 4KTZA 4BE1A 3AVJA 1J9AA 3SPYA 2AWZA 2KZZA 1CLQA 3PJXA 2W9CA 1RDDA 4ZTJA 3BSAA 5JS2A 4XIUA 1TL1A 5KFSA 2IC3B 1NJZA 1D9DA 3LP3A 5HBMB 4ED7A 1NHVA 2BQUA 4TYBA 2E9ZA 3KD1E 4FJMA 4BE0A 3ZSZA 3K5OA 5KFDA 3NAEA 4CEZA 3JSMB 1TVRA 5F8GA 2VA3A 3AA2A 2VWKA 1GOCA 4O44B 4JS5A 4FZXC 3DLGA 3SUQA 1KHVA 2I5JA 3SQ2A 2W8KA 1TAQA 4W5RA 3DOLA 1S4FA 2GV9A 4J2EA 4E19A 1SKWA 3LPTA 1L3UA 4Z4EA 1S48A 3TAQA 3FQKA 2XY7A 2JEIA 2IM0A 4LH4A 4IRCA 2OPQB 4EP4A 3RMBA 3D28A 4IOBA 3TARA 4E1MA 2R8HA 4R5PB 3SZ2A 1U04A 4CK1A 2Y1IA 3ZT0A 3AO2A 2YNGA 4FLYA 2P1JA 1VK0A 3A2FA 4QW9A 4YR0A 4ELTA 1UOCA 2AJQA 3D0PA 5KT7A 3PW7A 4G3IA 4TYAA 3VQQA 4LD0A 1SH0A 5KFCA 2AGQA 3G0ZA 3T5JA 4DL7A 3TAMA 4ECSA 3BDPA 4LQ3A 3TAPA 4FM1A 3CM6A 3CO9A 1JLQA 3JSMA 1UA1A 3QGHA 5C25B 2D5RA 5L1IA 1HJRA 3L2UA 4F3OA 1N4LA 3V6JA 4KHMA 4ELUA 3V4IB 1WSJA 2CKWA 3MF5A 2IM3A 3UR0A 4ELVA 3TQ1A 4F2RA 3D5MA 4OPKA 2ZQBA 3L8BA 4RNHA 4EBDA 1Z26A 1ASWA 3NDKA 2VG7B 4TXSA 4RNOA 1CSJA 2J6TA 5KRSA 3RBDA 3NF6A 1NKEA 2OPRB 3RMDA 4B9UA 3HSTB 2R2TA 3LP0B 3T5LA 5KG0A 2BRLA 4C8OA 2FVSA 2O4GA 4KI6A 4MFBA 5K14A 1VRUA 3NCIA 5L1JA 4F4WA 3OYGA 5F8JA 3F9KA 3S9HA 1D8YA 4WYWA 4R5PA 4FS2A 1Q8IA 3EPIA 5EWFA 4WFYA 4YP3A 4E7KA 4E7HA 4AHUA 4CEOA 1QHTA 1HMVA 4DSKA 1C1BA 4CEEA 1NK5A 4HUFA 2W9BB 4ECUA 4K4SA 1RNHA 3HVAA 4MK8A 3PX6A 4IH7A 2ILYA 1BIZA 2D0AA 1XR7A 5C24B 1NK0A 2ASLA 3G6XA 1QAJA 3KLGB 3NH0A 3HYFA 5C25A 5KG7A 1W0HA 3HO1A 4R8UB 2XRIA 3KLEB 1VSKA 4CHOA 3V4IA 2IA6A 2ETJA 2FVRA 4U6PA 4F4XA 1RDCA 1VSJA 3L3UA 2R8JA 5C5JA 5JXSA 3V9UA 2VG7A 3HVWA 1Q9XA 3IN5A 5FDLB 4B8CA 4FXDA 3Q8QB 1EETB 4FS1A 3LP0A 4HKQA 4MQ3A 5KTQA 3QGIA 5KFWA 1ASVA 4CFBA 5I42A 1JLFB 4WFXA 3QO9B 2BR0A 4MH8A 4DL2A 4CF0A 4DTNA 1QQCA 2WK4A 3V1OA 3TAEA 4CJPA 3KMQA 3L2WA 4ECVA 2PYJA 5KI6A 1KVAA 2G8WA 4CGJA 3UDLA 3JYTB 4J9KA 3CYMA 5KFTA 4DFMA 2Z1IA 4IRDA 3VQ7A 5KG6A 4Z4GA 2UVWA 1VSEA 5CZ2A 1UWBB 4NLQA 4B9MA 2XI3A 5C24A 3VQDA 1ITGA 4ZP8A 4CFCA 3KLGA 5SWMA 1EP4B 1L5UA 4QOZB 3MR5A 4BDZA 5DQHA 1ZBIA 4R8UA 3MXMA 1MU2B 3TANA 3SUOA 1A5XA 1JXEA 4IKAA 1BQNB 4IH5A 1S9GB 4CIGA 3KLIB 4KE5A 4CJWA 4OGEA 2P5GA 4NRUA 4YFUA 4J9OA 4KTQA 2JEJA 1ZBLA 5FDLA 3AVMA 3OHBA 4YR3A 3K5NA 4M3RA 3OYBA 3NKYA 1XI1A 1EETA 3DM2B 1TK8A 4ZHRB 2ATLA 5HRRA 5KT2A 4Z4HA 3IRXB 4DSEA 4BWJA 2J6UA 3FQLA 4WFZA 1JLFA 3QO9A 5J2NB 3KLFB 2D0CA 1RCHA 3OYFA 4XO0A 2X78A 4M3YA 4HVJA 1L3VA 3HHKA 1ZBHA 5CYMB 3TABA 3JYTA 4M3TA 3KD5E 3OYNA 1GX6A 1LV5A 1TKZB 3EZUA 3RB0A 3C6UA 1KLMB 3H08A 3PUFA 1UWBA 1KLNA 1JLAB 3H4BA 4I9LA 2R7YA 4KRFA 4EZ9A 2HHSA 1R0AB 3HJFA 4NLYA 3RRHA 1EP4A 3CFPA 4J2DA 3SJJA 3LP2B 5KFNA 2RKIB 4KAIA 3MTKA 2A1SA 3KNAA 2J6SA 1HNVB 4ZPAA 3ULDA 3DLHA 1RT2B 4ZTFA 3K58A 3SYZA 4CEQA 1BQNA 4K4UA 3HK2A 1S9GA 1S1TB 3KHLA 3FSIA 4F4KA 3KLIA 5KFFA 2R8GA 1WLJA 2YKMB 1HRHA 4FVMA 4M45A 4J9PA 4NLRA 2FLNA 4ZVHA 1KTQA 3QEIA 4K4XA 3DYAB 3GV5B 3BQ2A 3QESA 3DM2A 5EWEA 4MKBA 1JIHA 5L9XA 3CJ5A 2QE5A 5CZ1A 2IM2A 2AQ4A 4PY5A 4QCLA 2FJXA 5J2NA 2UVRA 3HP9A 3KLFA 4NLXA 4O55A 1XR5A 3I0RB 4Z4FA 2HWIA 3T19A 4F4YA 4GC6A 5CYMA 3NBPB 4RW4B 2W42A 2YKNB 4CJEA 3VQSA 2Z1GA 3OJSA 1RT3B 4AILC 1TKZA 5J1EB 4I2QB 3ZT1A 1S49A 2FLLA 1L3TA 3LWLA 3U3YA 1S10A 2QKBA 3U3GA 4FM2A 4ID5B 1T7PA 1R0AA 2BANB 5F9LA 4IDKB 4DS5A 3CFOA 1RA7A 4EO8A 2IGIA 4HCCA 3LP2A 4RW8B 2RKIA 4J9NA 1HARA 4NZ0A 4OLAA 4DTRA 4FJLA 1IKYB 4M94A 1HNVA 2W7OA 1RT2A 1X9MA 2X6NA 4O4RA 3S3NA 1S1TA 3KK3B 1ZTTA 3THVA 4EO6A 2FBVA 3AVBA 2YKMA 4FLVA 4RU9A 1SL1A 2HAIA 1SKRA 2C2EA 3L2VA 4ZP6A 2JEGA 2RPIA 4DTMA 3DYAA 4CJ4A 5KT3A 3T1AA 1TKDA 1G15A 1J5OA 4DFKA 2R2SA 1TGOA 3AVAA 4ED8A 4K50A 2ZD1B 3VQPA 4FJIA 3H5XA 4CJTA 3CJ0A 4ED6A 3FRZA 2IS3A 2VG6B 3BREA 4DTSA 4DF8A 4R0EA 3OL7A 3I0RA 4E7IA 4U7CA 3M9NB 3NBPA 4RW4A 4E7LA 2YKNA 1S9EB 2CJQA 1S1UB 2XY6A 1NK9A 1RT3A 1BI4B 1QE1B 1HNIB 5J1EA 4I2QA 3P1GA 2P51A 3LZJA 4PA1A 4CEDA 2Y1JA 4ID5A 4FLWA 4LSLB 1TKTB 4DU1A 4KB1A 2PZSA 4J2AA 3H40A 2HHVA 5J2MB 2FBXA 4H54A 3VQ4A 2ATQA 2BE2B 3HPGA 3SV4A 3PR5B 3KK3A 2FVPA 3KMSA 4CF1A 1S9FA 4ECXA 1D0EA 3BSCA 3SQ1A 4FK4A 3RBEA 2ZE2B 5KFIA 4DL4A 1WSGA 2IDOA 4FJXA 1NJYA 4L8RB 4ECRA 4AHRA 1S1WB 4H4OB 3NH2A 1IKXB 3KJVB 3C6TB 4Y2CA 4YR2A 5KG1A 3GIMA 4MIAA 2ZD1A 1N48A 4LH5A 4FJKA 2ILZA 3PZPA 5SZTA 2DY4A 4IG0A 1LWFB 4ZVFA 3RB4A 2QKKA 4O3NA 2ZKUA 3DLKB 2VG6A 1FK9B 3LAKA 2BGGA 1QS4A 2QK9A 5KGWA 3ZSOA 4E1NA 4AHCA 1S9EA 1S1UA 3CDWA 4M3XA 1RBUA 1KVCA 1QE1A 1HNIA 4NYNA 5D3GB 1NOYA 1QAIA 4B08A 4O5BA 4UQGA 5KFGA 3AV9A 4OPJA 4DU3A 3OLAA 4BDYA 2IMWP 1D9FA 1XHZA 2YNIB 3OL9A 1QSYA 1RDBA 4OKJA 3E51A 2RDJA 1JLGB 4TQSA 1TKTA 1QTMA 5EWGA 1YVFA 4Q44A 5HROB 5J2MA 4KHNA 1C0MA 1BHLA 1NJWA 4M3ZA 1RTJB 3L2QA 3SUNA 3OYMA 2BE2A 3FFIB 4NLSA 3KHHA 3PW5A 3L3VA 5FROA 5KFBA 3KHGA 3V9SA 2ZE2A 4FK0A 1N56A 3RB3A 1T94A 3T5HA 3B6PA 1D5AA 1RBRA 1T3NA 2YNHB 3K5MA 1S1WA 3ITHB 3QGGA 4H4OA 1IKXA 3C6TA 2IC3A 3DRSB 2FBYA 2X74A 4DTXA 4ICLB 2EHGA 2G8IA 5HBMA 1UA0A 4JV2A 1X9WA 3NAIA 3CG7A 1LWFA 1XWLA 1SUQB 4KHWA 1RILA 3DLKA 5J2PB 4GW6A 4DS4A 4B9TA 1FK9A 4O44A 2GUIA 4ID1A 4CFDA 4NLVA 2HHUA 3H5UA 2JGUA 1C0UB 2C2RA 2XGQA 3QEXA 3I5AA 2KW4A 4QWBA 3ZSWA 3MEEB 5D3GA 3PW4A 3RTVA 4PQUB 5KGXA 4KFBB 4JRPA 3Q8RB 5HRPA 3CM5A 1YTAA 1JLGA 4URGA 3AVNA 1A5VA 2FJVA 1REVB 3NFAA 2OPQA 4URQU 5HROA 4K8XA 5DLGA 3BSOA 4KTWA 4NLOA 4BWMA 3OS2A 4CJUA 1WNEA 1U47A 1RTJA 3OY9A 3FFIA 3AVHA 4ED2A 4KREA 2ALZA 1BIUA 4QW8A 4CHYA 1D1UA 3H59A 3QEWA 4CGGA 3RR8A 4ZP7A 2C22A 2YNHA 3UQSA 3VQEA 4N76A 3E01B 4OGCA 1RBSA 3ITHA 3ZSQA 4LSNB 3NMAA 3DRSA 3MAQA 2LSNA 4YNQA 3OYEA 3ZSVA 5F8HA 5DG9A 5KT5A 5FRNA 2O4IA 5DQIA 1Z4UA 1SL0A 2FBTA 5J2PA 3AA5X 1XR6A 3V81B 4FJGA 3QIDA 4C8NA 1HPZB 4CESA 4Z4IA 3V9WA 3DOKB 1C0UA 3N6MA 4CHNA 1SL2A 2DFHA 2P5OA 3DI6B 3MR2A 5F9NA 4FLUA 4QWEA 4JRQA 3S3OA 1IKWB 4FJ8A 3MEEA 4PQUA 4EBEA 4RW9B 2HMIB 3O3FA 2OPRA 4CJKA 3QZ7A 1RYRA 1REVA 2YV0X 4WZQA 5F8NA 4RG8A 1ZTWA 1YTUA 2R8KA 2FVQA 2AU0A 3PY8A 1S1VB 4Q43A 3OS1A 4QAGA 4C8MA 3K5LA 4O0IA 4RUAA 5DG8A 4PUOB 3HL8A 4WYLA 5DLFA 4IG3B 2W9BA 3E01A 5DG7A 2YNFB 4CECA 3CIZA 4LSNA 4DF4A 3PO5A 4RZRA 3HPHA 1TL3B 4N47A 2HNZB 5KFQA 2OZSA 4KHRA 1N5YB 3UPFA 1ZBFA 1KFSA 3NGZA 3V81A 1C1CB 4KO0B 1HPZA 3KLEA 4KBIA 1F21A 2OZMA 1TAUA 3DMJB 3IS9B 3DOKA 2YHBA 3DI6A 3OYIA 1S97A 1U48A 3LZIA 4F4ZA 1IKWA 4CJVA 2BQRA 3V9XA 2V4RA 3AO4A 4Q8EA 4CJRA 4GMJB 1NK6A 4RW9A 3M8SA 2WRMA 3KLHB 4PWDB 4HTUA 1IO2A 4OVLA 4CGFA 1FKPB 4IQXA 4CJFA 3H5SA 4FLZA 4DU4A 5DGAA 3I5BA 3SI6A 3LWMA 1I39A 4M95A 1SH2A 3VQ5A 4WE1B 1S1VA 3SQ4A 4B9NA 4ED1A 3HPOA 5KG3A 1LW2B 5KFUA
chains in the Genus database with same CATH superfamily
2C2NA 4BC4A 5KG5A 5KOWA 1HBNA 5HMWA 1HYSB 2XY5A 3CJRA 5E3AA 1QSLA 1TKXB 4LBHA 2IVMA 4A48A 4UY8T 2XG8A 1WSEA 3MFIA 4TU8A 3VQBA 2OI2A 3IP0A 4HHHA 1TL3A 3E9OA 4FBUA 3WXLA 2NPIA 3OVNA 5AQUA 2VKZG 3SXLA 3TAFA 2BJEA 4FM0A 4ECQA 3DNCA 4MIBA 4WXWA 4KO0A 3GJQB 3QFWA 3HD2A 3BZQA 3QNNA 3V9ZA 1A5WA 4I6MB 4RBUA 5KFKA 2RMLA 2OP5A 1QZ6A 3IGNA 1S3XA 8AT1B 1SC1B 4MIWA 4O3PA 3CC7S 1BWEA 2RE2A 2DNNA 3KLHA 1KVKA 4USHA 1GMVA 1SQEA 1T9VA 1NJIO 3C94A 5D77A 4F7VA 4NXNK 4S0MA 3QEVA 5D0RA 3WIVA 1VQ5N 1HBMA 2ZM6K 1LWCB 2E20A 2B9YA 3MR6A 1T44A 5HLFB 1YHQN 4ZOSA 2HZCA 2RN2A 1VC5A 3VF2A 4LF4J 3NXZA 3NF7A 4RNFA 3BGRB 2HK2A 2AV5A 4RBVA 3AVFA 2A3JA 3MCSA 5AE1A 2GCFA 4ANCA 1NLVA 4CGHA 4FNHA 3MXHP 4U7UD 2Z1HA 1VQ9N 2L9WA 4ZPDA 5AE3A 1V5VA 3H2LA 4E3SA 4CHQA 3SAFA 3M4XA 4Q5VA 2A3ZA 2EVZA 4NASA 2GMLA 1UW4A 2V63A 4KT0C 2OFHX 1NXIA 3RAXA 2HB5A 1UPMB 3DU6A 5KFZA 2WSEC 4KYZA 4NLCA 4FKYA 3BBBA 3DHWC 2GUPA 4KHSA 4QYZJ 3RMCA 2GIRA 3MD3A 1CZ9A 4DG1B 4Q2MA 5L8RC 4LF4F 1IH7A 5BREA 2XZDB 5HOOA 5SUHA 4NYZA 4BRQA 2KTQA 1LWCA 4CF9A 1RZMA 5HLFA 3CDUA 3QINA 3KHRA 5DM7Q 2DFEA 4M63C 3RSEB 4KIAA 1QM9A 1BD6A 3QZ8A 4OZ1A 1DTTB 4NA2A 3NH1A 4OL8A 1SJFA 3O3HA 4LFBJ 3CCLS 1H98A 2HHQA 1PKUA 2I1RA 1DQ9A 3MPWA 2CPZA 1VSMA 1OQ6A 5GADI 2VA2A 3PTWA 4OYXA 2R3VA 2JLGA 1WAFA 1IKYA 2ZVIA 2Q43A 2ZZMA 1VI7A 1H6KX 2C1EB 3SCJE 4W5TA 1YRUA 1RBTA 5FJ4A 4OPAA 1QUVA 2F8HA 4AHVA 2FVCA 3GQCA 1JCEA 3SI8A 6FD1A 2B43A 2QTDA 3MR3A 4NCGB 4DG1A 3LGMA 2Q36A 2ZJRL 2ZUAA 3TSQA 2G4BA 4WXOA 4L76A 5GAEU 4FOIA 3SPZA 2CQ0A 1JQGA 5IT0A 4OJHA 5KFYA 2BKNA 1HLWA 1NK7A 4LFBF 4CO3A 1WN7A 5JJBA 3Q2SC 3GIRA 2J0QD 1O1WA 2QMUB 1KAZA 1DTTA 2WBRA 1WSHA 1S6QB 2EFQA 2FJBB 3AY0A 4N8NA 3CEDA 4G1PA 4CEAA 3DXKB 4Y00A 2YKOA 2HGMA 4QIEA 1WACA 1RYSA 4J37A 3TJ8A 4ZLNA 3VAHA 2FY8A 5E26A 2VQEK 3S01A 4DFPA 2HVHA 1TUVA 2HHHK 5A8KB 1FNOA 5F3ZA 5AR0A 1JB0C 4PR6A 1UEVA 3ZCMA 3GIJA 3EUNA 3IWNC 1CQMA 3ISNC 3SV3A 3G6EN 3AQPA 3SFUA 3S3MA 2P9KB 3W64A 4MFBB 4KB7A 2GVDA 3TA2A 3M8RA 2QJ3A 3BZCA 4OIXA 3EE8A 4NCGA 1UVJA 1CVJA 3CMES 2RUSA 3QRQA 3V6HA 3AFGA 2G8FA 3OYAA 5ETLA 2IOCA 4JLHA 4CI0B 3EGWB 1ZM9A 3KZBA 3H2VE 4FW1A 3KDOA 5BPMA 1RTDB 1IJEB 1BISA 4DI6A 2M3DA 1RT4B 4ZVQB 4HHTA 3M2RB 2V8HA 4DTOA 3CFRA 4B9SA 4QU7A 1VISA 1S6QA 4O3QA 1WOPA 1FVQA 3DXKA 3F5TA 2CA9A 3DDIA 2IBKA 2KDOA 2Z2ZA 3R5BA 4DN0A 1NK8A 1QVFM 4QWAA 3GIIA 2E2QA 4A4JA 2Z4PA 4NRTA 1VIXA 3F2KA 5A8KA 4UT4A 2GMHA 2Y9HA 4NXNJ 4GMKA 4I6YA 2MJUA 5F0XA 2ZM6J 4Y34A 4DCJB 3OBIA 2AYGA 3CPEA 3SCIE 2JFDA 2KG1A 1TK0A 1DTQB 5LSRA 2V4JB 4O0JA 5AQFA 1M1GA 5K8NA 1S0NA 3G4SN 3GG1A 3KHYA 2ACMA 3UKRB 4OI4A 2CNKB 2FXUA 2NNWA 1S72S 3ICLA 1WKLA 3OHRA 2DTUA 1RTDA 1I3OB 2KT5A 1NZ8A 1RT4A 3R97A 5FIIA 3MN5A 3M2RA 4BE2A 4USMA 1SC6A 3UKUA 3M6UA 3FMBA 2I8EA 1LAWA 3H5YA 4K25A 4KFBA 3F0NA 3W3DA 2YPYA 5CD4H 4NXNF 4JHDB 1F9EB 3EZ5A 1VQNS 5A2QY 1WUUA 3SAGA 3MD1A 2ZM6F 5C2GA 3S41A 4KHUA 4IRKA 4P75A 5B8HA 2CPDA 4AD6A 1T9TA 4A59A 2E1RA 3HCXA 4PXDA 3P5BP 3OL6A 1FE0A 2MHEA 3W8PA 4FLXA 1SJ1A 4I64A 3UIQA 4HL9A 5D4PA 2P2CB 2EW9A 1DTQA 3QWPA 3O1BA 1IBLK 3L4BC 2V4JA 4EWTA 3IWXA 1YVUA 5CYQB 4RBTA 2K3IA 1FXDA 4IFVB 3D45A 2Z8QA 2HFZA 3O9UA 3UKRA 5HATA 5CYJA 5KG4A 2VV5A 3L7PA 1B0VA 1UZDA 1S5JA 2D41A 2ZZTA 3FRYA 3N0VA 2VG5B 2NXCA 3Q8SB 2P9UB 1KOOA 2V0NA 4ECZA 1RT7B 3W5YA 3TWZA 3UB5A 3ID6A 4P74A 1RP5A 1URRA 4JHDA 1EKEA 4HI2A 2ZJQL 2JVRA 3O3LA 3ALYA 3GV8B 2V4QA 1B70B 2VPWB 2E1ZA 4ZJLA 4PXCA 4NLPA 4CRJA 2FHJD 4DSLA 3IG1B 2VBWA 4Q8FA 2VOOA 3ZTOA 3JS6A 1CZBA 4FF1A 4I4BA 2V50A 5CYQA 1I6JA 1DJ0A 4N8OA 4ISFA 2JL9A 4OHYA 1JL2A 6FDRA 3W1YC 4IFVA 2G8UA 1NDCA 1SAZA 3FDSA 3OYDA 4NWBA 4BHQA 5B0GA 3OVAA 1X0PA 4DR6K 5F8LA 2VQEJ 4G6VB 1YJ7A 1KVBA 2HHHJ 3MEDB 2VG5A 3AXMA 1JX4A 3E1YA 1G3OA 2P9UA 3I8BA 1U49A 1S57A 3B54A 1RT7A 3NL0A 2ZHAA 1JK9B 4IOAQ 4I2PB 2H5IB 3KK2B 2RE1A 3MR7A 3A8JA 3PEJA 3HHLC 4CZJA 4C2MA 3ET6B 2M5YA 2Y1LB 3HRGA 1OSDA 2A18A 1NWKA 1UVLA 3O1WA 1ICEB 2HBLA 1X1PA 3I96A 3R27A 2KZMA 3PRBA 3U6FA 1KAXA 5CCLA 2VD3A 2KL8A 4LF8K 3F44A 4BRLA 4LRBA 2X1FA 4N41A 3SIPB 4DL0C 3H3OB 3J80O 2MB0B 3E2EA 3IG1A 4KR0B 4K4TA 4GKJK 2D0PA 1F5AA 4K8ZA 3DLEB 1I5OB 1TMJA 3ZETB 4FJJA 4I6WA 1JLCB 3QPIA 5IZHA 4F3MA 2VQEF 1MA9B 3VAJA 3W9IA 2WZ1A 2HHHF 3MMVA 4ISGA 3A12A 2W2PP 3G9CA 4CGDA 3QLHB 1DZ5A 2I6WA 1NZAA 3OSNA 3MEDA 2VPXB 1KONA 4DQPA 2WSFC 1SQFA 2LVWA 4WP9A 4CERA 1KD1T 4FJ5A 4AL6A 3GIKA 1VFJA 3CT9A 4AUKA 1VJQA 4I2PA 1Q53A 4K7QA 3KK2A 2FD2A 3ET6A 2AJ0A 3VGTA 1I51B 1VSDA 2AJ1A 3HXMA 4J9QA 2GV1A 4K2JA 2ZH8A 3PR4A 1VOMA 3JB9k 5HMYA 4C23A 3R2DJ 5KFAA 1XIQA 1TQLA 5F0UA 4P9SA 3R5JB 2E6LA 3L6QA 4ZVUB 2DVIA 3DLEA 4CLFA 3D4JA 3ZETA 4CJ3A 1JLCA 2IIHA 4IG0B 3PKYA 1TVRB 1X4AA 4WJBA 4HI1A 2LU2A 1WDDA 4OYMA 3RBXA 3M1VA 3HHNB 1J6ZA 3NAHA 3AA3A 4NMLA 5M1PA 2C3PA 3SSQA 2Q3SA 3QLHA 2J9DA 3K5PA 4K0KK 1S59A 2D3ZA 1HWUA 3C14B 2LEAA 2MZSA 1NG9A 3PYFA 4OKKA 1FWLA 2IMOA 5HVFA 4WTYA 3LDQA 2GS8A 2YNGB 4PKHA 4JI4K 4DTJA 1NKCA 1GMWA 1K8AT 2HF4A 4AYBD 4IR9A 4ED0A 4KTZA 1TZ0A 4DPWA 3SPYA 2KZZA 2R7OA 1RAGB 1RDDA 2YQ3A 4EFAC 1M0SA 5KFSA 2IC3B 3M2VB 4ES1A 3OFGA 8ATCB 1N52B 2BQUA 2E9ZA 1Y00A 2CZ4A 1IVZA 3J7ZO 1Y4ZB 3MWPA 3K5OA 4CEZA 1TVRA 5F8GA 4IO9L 1LNQA 5E3CA 4CLSA 1WOQA 1ZXOA 1V4SA 3SAHA 1U1KA 5C12A 4JS5A 2BJ9A 2HBJA 4QIWD 1ZAXA 3CDBA 3SQ2A 2W4DA 2WC9A 3M6GA 2E5GA 2GV9A 3OVSA 4KH6A 4YOEA 4CJ7A 5AXLA 1FRIA 1NGBA 3TAQA 4CM0A 3C14A 1IBLF 4LH4A 3UE2A 3U02A 3UNYA 2ZVSA 1NH8A 4UY85 3QJJA 4IOBA 5D8HB 2R8HA 2QIFA 2XYPB 2QTWA 4CK1A 2GW8A 3ZT0A 2YNGA 5IFMA 2NSCA 2XM3A 4WKRA 4YR0A 3D0PA 3HM8A 4PEOA 4V1Ak 4BRPA 2UV8G 4JEPA 4A8QA 1OSCA 1Y64A 3OXFA 1GLDG 3VQQA 4LD0A 4DR6J 4P2XA 2YX6A 3M2VA 3C6AA 2O3DA 1NU0A 1RLDA 4ECSA 1X31C 2AT1B 4UQTA 1RHUB 3TAPA 3H8YA 5C0YA 2CQGA 4FM1A 1MN7A 1YLXA 4ANEA 1UA1A 4F3OA 4ID8A 3OXLA 1YRXA 2IVOA 1NGGA 2J7UA 3V4IB 4DX7A 2CKWA 2H3EB 2HVZA 2ZQBA 1ASWA 3DU5A 4FYXB 4JKGB 1X8DA 4TXSA 4QR1A 4UW2A 1NGIA 5AQTA 4BR2A 5KRSA 1NDKA 1NKEA 2OPRB 2MKIA 4LF8J 4FL9A 5K5MA 2BW2A 1VQ8N 2BRLA 5K14A 4DR5K 2Q79A 5F8JA 3S9HA 4GKJJ 2YY3A 1Q8IA 4CZHA 4YP3A 3MK6A 4CEOA 1UWAA 4DR6F 1XQIA 4DSKA 3PYDA 2DHXA 3L09A 3O8MA 1SCJB 1HKBA 5JLHA 3VGUA 4K4SA 1WBBA 2IIRA 5JVHQ 3VAKA 3ENAA 2ZGZA 3VAFA 1BIZA 2D0AA 5C24B 3SMZA 3DRYA 4IJAA 2ASLA 2K2PA 4LRCA 5ETVA 5GAGU 4QJVA 3NH0A 3HYFA 4IOCQ 1TFYA 1WJ9A 2D0OA 3LM9A 2XRIA 1R27B 4X4UA 1ACMB 3V4IA 1YITS 3HBTA 1T02A 2IA6A 2ETJA 4RPFA 3X1LB 3J80U 1BMQB 2MEWA 8RUCA 1AZSA 4LF8F 3GTYX 4JKGA 3IDHA 3HVWA 2R4FA 1XTZA 5FDLB 3BP8A 2F5GA 4GKJF 3BO2A 4FS1A 3CIPA 1N36K 4OMFG 1RAFB 4DL2A 1QQCA 4M5IA 1V3RA 2VH7A 5BN8A 3KMQA 2FY1A 1VK8A 3CSKA 3R9LA 5E0OA 1RTZA 3C8YA 4J9KA 4IEEA 2B4PA 3CCES 2E1CA 3CF5Q 3G71S 5BYSA 3VQ7A 2UVWA 2CQCA 5CZ2A 3SBTA 4A2AA 1ZH5A 4G1IA 4B9MA 2XI3A 5C24A 3VQDA 4CZMA 2VFTA 4CFCA 5SWMA 1PSDA 4W98A 2GTDA 5GADP 1WC3A 3OTEA 4DUZK 5HMXA 3SUOA 1QVGM 1H2UX 3K2YA 3D0GE 3RW6A 3KLIB 3UCUP 3VGLA 1CS4A 1GAOA 4JI4J 1BWFO 2P5GA 3R6LB 1G1XA 1P27B 4NRUA 1ATRA 1KQSM 5FDLA 1UEUA 4YDUC 1VQ4N 4D3HA 4M3RA 1PJ7A 2DNYA 2CADA 3DM2B 1TK8A 3UE5A 5KT2A 4Z4HA 3VEWA 3IRXB 4GV3A 2RDDA 5IM0B 5J2NB 2H1YA 1TMMA 3MN6A 4FSVA 3P8BB 2FHOB 1L3VA 1NHKL 3HHKA 3N4QA 4JKCA 3TABA 3MN7A 4RU2A 1XJWB 3I4PA 3R2CJ 3A3PB 4KHPK 1LV5A 1Q7YT 3RB0A 4K0KF 2CQDA 3C6UA 4M8LA 3H08A 4JN4A 3MCAB 2R7YA 2NZ4A 2CJYB 2HHSA 1TELA 2DGTA 4IDHA 3QQCD 3CFPA 3SJJA 1ZC6A 1RBLA 2CYYA 3FE1A 3MTKA 3FZMA 4JI7K 1E3MA 4JI4F 4K43A 3J81Y 1HHTP 2L08A 3ULDA 3O5TB 3K58A 2BJ8A 4DCPB 3SYZA 3P39A 3TPQA 1JXVA 4K4UA 1S1TB 2HIQA 4F4KA 1J5EK 3KLIA 5KFFA 2X51A 3PIPQ 3IKMA 2YKMB 1HRHA 4WYBA 2ZUGA 1ZM4A 2XMAA 3B78A 4ZCIA 3BQ2A 3QESA 3DM2A 5EWEA 3TZZA 3E9PA 2RD5C 2VGNA 4B1UB 3EVWA 2FSNA 2QE5A 3HOSA 1EJ7L 1VQPS 3Q8YA 5J2NA 1EAYC 4C7QA 2H51B 4USIA 2AJ2A 2XMWA 3I0RB 2BM0A 4F4YA 2GJIA 2MSSA 4QS9A 1RSCA 3D2FA 1FERA 3VQSA 4LR8A 2PFFB 3U1LA 2EC2A 1GXUA 3ZT1A 1NGEA 4P72A 5K20B 4NA1A 3U3YA 1RWWB 4JP8A 2CXEA 4PYAA 3BUZB 1DBDA 4IDKB 4BRKA 4J8FA 2DHAA 1HARA 4OLAA 4DTRA 3D66A 1WKJA 4GO7X 2N3LA 4M94A 3LOUA 1X9MA 4F36A 4DR5J 1TU0B 3O6WA 5LJVA 1S1TA 3THVA 1GTEA 1SPBP 1FHTA 3AVBA 3MCNA 2YKMA 4Z7CA 2LQ5A 1Q4RA 2MPUA 4ZP6A 3EGZA 2RPIA 2ZOFA 2G1DA 3US5A 3T1AA 3THTA 3IA0A 1R3NA 1OIAA 2R2SA 1TGOA 3AVAA 2QW9A 2ZD1B 2DRDA 3ILLA 2QA4S 4DU7A 1FW6A 2EK6A 4DF8A 4DR7K 1PO6A 1X3MA 3OL7A 5JMVA 1AFIA 3I0RA 4CD1A 2GAGC 4E7IA 1IR0A 4C4WA 2CJQA 1ZPWX 2XNRA 4AQYK 1BI4B 1QE1B 5M1OA 2P51A 4PKGA 3HHLB 4JK9A 1YJRA 5B7WA 2O8DB 4CW7B 2Y1JA 2F63A 4C0OC 2YJFA 4FLWA 4LMZA 2LA6A 2PZSA 4DR5F 4LR7A 4J2AA 2HFNA 4A8SA 1KD1O 4PRFA 1RE1B 2A10A 1N36J 1KEKA 3LM2A 3T7ZA 1KWMA 1WC6A 1NSAA 1S0VA 2HBKA 4AT1B 3PR5B 1RHRB 1Q81T 2GA7A 3KMSA 4H5NA 1S9FA 5HO4A 5M1NA 4MO4A 3PACA 3RBEA 4JI0K 1NJYA 4USWA 2IYIA 4WBFA 3M30A 1RWKB 1UVNA 5KG1A 3GIMA 2H3GX 2OEKA 4K5SA 2ZD1A 4LH5A 2RT3A 2FJEB 3W5ZA 4X4OA 1LWFB 4O3NA 4LBPA 3LAKA 2Y0BB 2KFYA 4HH1A 2BUPA 4YHHK 1QS4A 3G96A 3ZSOA 2QRRA 3HTVA 4DUZJ 3DOMB 3CDWA 1SZ2A 1CJUA 2M9KA 1KVCA 1QE1A 3NNHA 4B08A 1FRMA 4UQGA 3HKZD 3AV9A 1HUXA 3Q8VA 3HHLA 2IMWP 1D9FA 2PIIA 4OKJA 1Q95G 2RDJA 3A5LC 2HGLA 5EWGA 3BF1A 3H6EA 4E8UA 4EHTA 4FYVB 1NJWA 4M3ZA 1H2VZ 1ZZFA 1ZA2B 4OI6A 3OYMA 2M4MA 4NLSA 2CDQA 3NGKA 5IV4A 1K73T 3AGKA 3L3VA 3KHGA 3V9SA 2XTJP 3HZ6A 1WOSA 1HKAA 5LMNK 1EB0A 1VR6A 3VR1A 2XHWA 3B6PA 1VK3A 2YKQA 3NVKA 2VC1A 2VYPA 2G0IA 4NXMK 2FBYA 4KHPJ 2Q1LA 1UA0A 1NB2A 4MDAA 4H5TA 4DUZF 1LWFA 4BRMA 4KHWA 3O9SA 4C9DA 1P90A 2NS1B 4DS4A 4O44A 2HHUA 2UV8A 4LF5K 1C0UB 2C2RA 4JI7J 2X3DA 3QEXA 1YG0A 2KW4A 5DRKA 3DOMA 3ZSWA 1AROP 4A8OA 4DKWA 4WFNQ 1HI0P 5KGXA 1J5EJ 4JRPA 3CCWA 4YY3K 1YTAA 3BDEA 1A5VA 1F2HA 1REVB 2OPQA 4NX9A 4URQU 5DDQC 4JI3K 3MM9B 2CPHA 5AQWA 5DLGA 4EHUA 3AOBA 3TX8A 3LUYA 1JCFA 5I3PA 2HOEA 1RWVB 1NH7A 4BY9C 1LCUA 4IUFA 3AVHA 1EQYA 4E1JA 4ED2A 5BPNA 4ZCMA 3ETMA 5AFUA 2JWLA 4H0PA 1BIUA 4KHPF 2W01A 1D1UA 2W40A 3H59A 3UD5A 1VLOA 3RR8A 4CIOA 3VQEA 1FFSB 4N76A 3ZSQA 3NMAA 2W2MP 3DLLQ 4L73A 4L72B 4JI7F 1AYEA 5DQIA 1U1MA 1XR6A 4C8NA 5MLCQ 2GQCA 1RCXB 3CJKB 1J5EF 1C0UA 2A6MA 2DFHA 4DU8A 3S3OA 4O23A 2L41A 4FJ8A 3RW7A 2MSTA 2LQBA 1LWXA 1NNEA 2HMIB 2JWKA 1UMJA 4YN3B 5A6WA 4CJKA 3CMEN 1REVA 3MM9A 2DYAA 4H5RA 1Y3KA 1KVIA 2AU0A 3Q83A 2A41A 4Q43A 4ATNA 3OS1A 4C8MA 3K5LA 4DR7J 3BYRA 1X4GA 2DR7A 3KVGA 5DM7L 3HL8A 5DLFA 5G0RB 2JLFA 2VPZB 5CZVA 5DG7A 5BYQA 4CECA 4AQYJ 3H42A 5AE2A 4EU0A 3KUGA 3HPHA 3T69A 2ADBA 2F8MA 2C3YA 2XMTA 1YHQS 1DFDA 3UPFA 1VLYA 3ZZTA 2IPOB 3I55S 3GFXA 3CJKA 1F21A 2OZMA 3DMJB 2CQ3A 3IS9B 3UI3A 5B09A 1QHAA 1S97A 2HBQB 4F4ZA 2V4RA 4OHVA 3FBFA 4PZVA 2NRVA 4FPIA 2QLBB 2P9GA 4OZ5A 1VQ9S 3ENWA 4K2XA 2A6AA 2E66A 4PWDB 4HTUA 4JI0J 3N28A 1IO2A 4DV5K 4G9ZA 2UU9K 4IQXA 2HBMA 4CJFA 2ACYA 3CC2S 4DR7F 5M2UA 5DDOC 3I5BA 2KM8C 2XYHB 3LWMA 5IC4B 3EEQA 1SH2A 4WE1B 4YOUA 3T6BA 4B9NA 3VF4A 5ETKA 5KG3A 3H25A 4AQYF 1K47A 1ZBSA 5LSOA 4OJ3A 3M8PB 4YHHJ 2DGXA 1K1SA 4HHUA 3DRRB 4FOEA 3CPWR 1BCOA 3W3SA 5EUHA 4WFBQ 1P8GA 5HN0A 4FZZA 1YUWA 1VQNN 2DRAA 2RS8A 4LF7K 1JJHA 3GSIA 2EBGA 3M6XA 1WC5A 3DMJA 2HFVA 3GV7B 1K8KB 1RDUA 5LY3A 3POTB 2O8BB 5JS1A 4ZP9A 4JI0F 2V9WA 4B3MK 4DV3K 1ZBUA 4URSA 3NS6A 3NGSA 2LEPA 2FF6A 4OKEA 4PWDA 5LMNJ 4HUGA 4RR5A 3RZAA 5AQPA 3P4IA 4E0DA 4DL5A 3KKRA 4NXMJ 2AYBA 3PHEA 3P49B 3QNWB 4YHHF 2KHOA 2EKNA 1FVSA 5LOQA 1QQNA 3AA4A 2AF6A 2YH0A 4DLGA 1KBRA 3L95X 3WHIA 3M8PA 4Y1DA 4CEBA 4LF5J 2FB0A 4CH1A 1HX1A 3DRRA 3GP9A 3AB4B 2HIYA 1BGXT 1PYTA 2F4VK 3TZXA 2D1KA 1T03B 1OY6A 1JXLA 1FJGF 1B7FA 3ADAC 3HF5A 1M5HA 3LPUA 4ECYA 3W9HA 4RWXA 2CZ9A 2AA4A 4YY3J 5L1LA 1W2BM 2HYIB 2OTJN 1KC8O 2CPJA 3QFHA 4I7FB 3ENVA 4JI3J 4BRNA 4BVPA 2D0BA 1U26A 5LMNF 3POTA 4P7VA 2O8BA 1T05B 4QQBA 4FBTA 4NO7A 4BRHA 3QIPB 3H45C 1FT8A 3CJ2A 3WXMB 3CD6N 5FLXO 4RWWA 4NXMF 2ZHOA 4X64J 2D9OA 3LW5C 4RKUC 1Q9YA 1IJFB 1VYAA 2F8EX 4N7TA 1YZ6A 2VOPA 4ILMA 5BR8K 1WTFA 3P83D 2DH9A 4CEFA 2GWKA 2QWMA 1I94K 2E5HA 4NMXA 2WOMB 4NYPA 3ZTPA 3CJSA 2HWHA 3HT3A 4C11B 4LF5F 2J8AA 2KXFA 2R8IA 2E7VA 2ZWHA 3WT0A 1RT1B 4B8AB 1VHFA 1JJ2M 2DCLA 1Q16B 3G6ES 4EZ6A 2QC3A 3T41A 3ID8A 2HS3A 1TUWA 1VQ7S 4ZPCA 3NE6A 4W90B 4YY3F 3TOQA 1IM6A 4CK2A 1T03A 2RRBA 3HULA 3S1TA 4ZMMA 3H1VX 2BYCA 4OYPA 2XY8A 3HFZB 1SIWB 3ILJA 2QXFA 3DDKA 4ENOA 4RW8A 1LOUA 4O3RA 2J9EA 2WHOA 4I7FA 1UVIA 2H4WB 1TL5A 1C0TB 5AXNA 4YDUA 2UVUA 3GPAA 1VSFA 1T05A 1WEZA 3QIPA 2G0CA 2RNEA 3NS5A 3CHWA 3ZZOA 4GNIA 2X1GA 2V2QA 4ZVRB 2MZTA 1U1RA 3BN7A 3IC1A 5GMKa 2AGPA 1Q1KA 2LCWA 1D9AA 3OT9A 1VHXA 3NF9A 2MY7A 1MMLA 2NXUA 2WOMA 3K57A 2IA0A 4C11A 4EYIB 4FLTA 1VDHA 3QT5A 1RT1A 1X4EA 2C2MB 3FC9A 2MLXA 3H2UB 1LKZA 2YX1A 1KXPA 3SCKE 3TAMB 4CLPA 3OA9A 3CD7A 4ILHA 1JLQB 3MZIA 1Q82T 5KFXA 2WAQD 3UN2A 3G4SS 3KTQA 1XN9A 1PJ5A 1E6VB 3K17A 3NMRA 4C3MA 2PFDA 4DV5J 2OPPB 2UU9J 1C0TA 2W4PA 2G8HA 3FBCA 1Y5LB 3UDVA 2B9XA 2R2UA 4ED3A 3VQ8A 1VRUB 1TL4A 1J54A 1HQUB 4FN5A 2DISA 1NNDA 3I9ZA 2NZCA 2IM1A 4LF9K 2NUBA 2Z1JA 1C1BB 5C2FA 2MQMA 3EKUA 4KV8B 3BPSP 2ROGA 4TKTA 2AX1A 4LF7J 2ZH9A 2AX0A 4MMOA 4I67A 3UCZP 1VQMS 1NPRA 3G86A 4C8LA 2D7SA 1NDLA 4CJ5A 4PG8A 3EY1A 5HANA 1BL3A 3SK3A 3BY5A 3R7SB 2W8LA 1VBZA 2HLTA 4P2SA 3EKSA 4B3MJ 3M32A 4DV3J 4DV5F 4IOAL 2UU9F 2HHPA 2FPHX 3DLBA 2Z58B 3R1XA 1IUJA 1E6VA 2KHDA 1BXNA 3UW1A 1N54B 4P2MA 2OPPA 1OVQA 1WF1A 4B3RK 1XC3A 1VHIA 1VCTA 3MPVA 3C15B 5F8IA 1RHMB 4QR0A 5AQSA 1NCLA 2BJDA 3VA3A 3FUYA 4FCYA 3QBXA 2EC0A 2UUAF 3R1HA 1HQUA 3DAWA 4RNNA 2P9CA 4LF7F 2F4VJ 2D74B 4ICLA 3P45B 3I82A 1EWRA 5CA5A 3PFEA 4KV8A 5JLFA 2LDYA 1H3DA 4CK3A 3ZZYA 2N82B 3FEXB 4DN9A 3GYGA 5DZ6A 4LIWA 1N32K 3PKMA 3QWUA 4B3MF 3FGVA 4DV3F 2KJVA 4JV1A 2CQ2A 3GR1A 2E2NA 2FIUA 5D15A 5AXMA 1BHNA 2KXHA 2HBRB 2VQFK 5K9FA 2VL1A 2ALYB 3EJMA 2HRUA 3KG4A 1UEKA 3M9MB 2ITMA 4H8KA 3HT0A 2D3UA 1RDWX 1CXUA 3MHYA 4BQLA 2OEJA 2DB1A 3DRPB 5BR8J 3MXIA 3J7YU 3R5DA 1LW0B 3W60A 3MAAB 5CD4A 3HFKA 1I94J 4USUA 2DY9A 3C15A 4NOHA 4MLEA 5AQZA 2BW7A 1T6CA 3E8OA 2DBBA 3SFGA 4CD3A 2DO4A 1M5VC 3THXB 1ULRA 4OLOA 3IM8A 1RJJA 3ZSYA 1U1LA 1U6ZA 1YJVA 4JOUA 1C1AA 1WD6A 1MMNA 2Q0RA 4WP3A 3CJTA 2DFFA 1HWKA 2MMYA 1O51A 1RHJB 1RKJA 1RK8A 2Y8WA 2MKKA 1ELOA 1YJUA 4M3UA 2CZVC 5FLXU 5K8MA 4CLTA 4WTOB 3P3DA 4DPOA 4DV4K 3AVKA 2DRBA 1H74A 5JMNA 3OYLA 2OFGX 1JLEB 3BEGB 2XQCA 4A46A 3IMQJ 1B9FA 3O4QA 3VQTA 4CWBA 4DPTA 2QXLA 2G1HA 1LWEB 4KPCA 5BR8F 4YOYA 4NLDA 3KFWX 1I94F 3MECB 4X65K 2B5JB 2PD1A 4KHQA 2K06A 3AO3A 3MMBB 4CGIA 3DRPA 5EX0A 1LW0A 1NSKL 2Z2LA 3MAAA 3RU0A 1FI4A 3A5MC 4YDDB 2NXJA 2PDAA 2NYIA 2O5DA 5GIPA 3THXA 3MWBA 2F3JA 3W7BA 2ITGA 2X1BA 4PUOA 2V34A 1W97L 1YBTA 2QGFB 5BRDA 3BR8A 4YUDA 1N5VA 4GV9A 4NZ7A 4LF6K 1H7XA 2ZH6A 3DLRA 3O3GA 3G10A 3TR8A 2YCHA 1S4EA 2ASDA 2HQGA 4DPXA 2XLIA 5ETNA 4FYYB 3GILA 1JLEA 5HL7Q 1A0OB 4FZYA 4M5JA 4ZVOB 4ILRA 2P9SA 2KFZA 3ZZ0A 2CDRB 2YHWA 3RWUA 4FF4A 1LWEA 4LC9B 2LXFA 4HWIA 1P6TA 4QPXA 3ZT3A 2F4FA 3MECA 2E6MA 2B5JA 1G4CA 4Y2IA 4OLPA 4ANDA 1XC9A 3IAYA 3MMBA 2BACA 2D69A 4M41A 2V8GA 2ZH4A 4WU2A 4H0YB 5EXWA 4LF9J 3V1RA 3HOTA 4OI3A 2D1CA 3CCEN 2FJWA 3K0JA 2SXLA 3O5BA 2FLPA 2JZ5A 2UUBK 4RW6B 2GX8A 4DQQA 2LA4A 4K4ZA 1S6PB 3I31A 3L2RA 2PA3A 1NBEB 4NB4A 3K0SA 3W65A 1OPIA 2AHOB 2FC0A 3AO1A 3CJ4A 2A1RA 2ZBCA 3IGVA 2B4VA 5AQMA 4NPOA 4E98A 5K8OA 3JSYA 3BH7B 1JNZB 5AQYA 4MYTA 2B4UA 4Y1CA 3I5CA 2QA1A 4B3RJ 3TEHB 4W5OA 1LK5A 1GH8A 1U1NA 2PMWA 1X3NA 3DC2A 3OLBA 2P9IB 4RL1A 2P9NB 3PW0A 1BCMA 1RHKB 4LF9F 1JL1A 2Y0SD 2KM8B 4AM7A 2W41A 3PIOQ 1BQMA 1WUAA 4DSFA 2DNMA 4DR4F 2CNNB 4W5NA 4CJQA 5CHIA 2HBYB 2YKPA 4DX8H 4UOHA 4OO1J 4K42A 4K4VA 5AQOA 1WG1A 1W9HA 4RW6A 3VQ9A 2HG4A 2C3UA 5JVHL 1N32J 1S6PA 1CQNA 1WSFA 1RAJA 3M7VA 2FSJA 3GCWP 3GYNA 1JJ4A 1O5JA 2ZH1A 3M6WA 2F9DA 2OEMA 3FZKA 1KN6A 2W9AA 2VQFJ 1CZAN 4IOCL 4Y0WA 3HHDA 1DHMA 3AQOA 3V5RA 2ASMA 4CE9A 2VKRA 3KUHA 4B3RF 1FRXA 3OJUA 1IQTA 3C95A 3VERA 3DOLB 3IFRA 3KNGA 4C8KA 1HA1A 1FDDA 1SKUB 2RRNA 1NSQA 3OFEA 4HH0A 5D4OA 2RILA 4NCBA 1H2TZ 3QATA 5JICA 3CXCM 2WVBA 1RHQB 5A2QO 3DDNA 3TA1A 3S6EA 2NUUG 1VQPN 4DLEA 1KNZA 3LGHA 5H1SV 3HM9A 3W9JA 4R0JA 1RA6A 2BA9A 2ZZNA 3ZZZA 1RISA 3Q8PB 1N34K 3VESA 3GFZA 1N32F 3AVJA 3A5NC 1GT8A 2RU3A 2AWZA 1D4XA 1CLQA 3PJXA 2W9CA 2PC6A 1NJZA 3G82B 3CF5L 1VQ8S 2VQFF 1T9UA 4UTGA 1NHVA 3KD1E 1OO0B 4FJMA 4DV4J 3NAEA 2AP6A 2CVEA 3JSMB 4CZGA 2VA3A 2VWKA 3PHTA 4KJIA 3CIMA 3TQEA 1KHVA 1F3FA 1PBUA 3JAMU 5HK4A 2IVFB 2M7SA 2QWLA 4X65J 2HFUA 3DOLA 3ZO7A 4J2EA 3G8TA 4FDFA 4E19A 5BYRA 2HWTA 1U1QA 3LPTA 1UP1A 3CJQA 1S48A 4LFCK 1XBWA 3UNGC 2QYCA 3MX2A 3FQKA 1SBRA 4CH0S 2IM0A 3D3BJ 2DGQA 3MCMA 4EP4A 2BV3A 3D1OA 2MY8A 3ZLJA 3OPKA 2QA4N 4M5LA 3K89A 4R5PB 3AO2A 3NG8A 2RIJA 1VK0A 2OELA 2CQIA 4LF6J 3PM9A 5KT7A 3O08A 1YRTA 1RXOB 1RUSA 2H5JB 4DV4F 3BEXA 2NREA 1SH0A 1TL7A 3G82A 2V67A 3G0ZA 2O8FA 4FPAA 2YH1A 3BDPA 4E2FB 1DGKN 4JNEA 3JSMA 3QGHA 4OZ2A 1M1KT 4X65F 3L2UA 3ULEB 3V6JA 7AT1B 4ELUA 3GZ7A 1RB0A 2F9JA 3MF5A 2IM3A 1Q82O 4ZCLA 1FO1A 3TQ1A 1HHSA 1FRHA 3D5MA 3L8BA 4RNHA 2GHPA 2VGMA 1OQ3A 4NLBA 4RNOA 3PIPL 2U1AA 3G8SA 4B9UA 4U9RA 2DHGA 3BN4A 1WB9A 1BWVA 2LQJA 2KXNB 1FWPA 1X4DA 2R2TA 1B4SA 4C8OA 5DDPC 2O4GA 4KI6A 5AQNA 2UUBJ 4LF6F 4MT1A 3NCIA 5L1JA 1WTBA 4R5PA 1MWZA 4FS2A 3CJAA 3SJHA 2AEMA 3AJ1A 4B1VA 1HMVA 2XSJA 3M05A 2NSBA 2KO1A 3VPZA 1NK5A 4C8YA 2JJ4D 2W9BB 2ZNZA 1NMEB 3HVAA 3G87A 2XYGB 1M5KC 2EPIA 2WVFA 1XR7A 4MAKA 1BDGA 1QAJA 4CQ1A 4Y65A 2BKPA 3R8EA 1EWQA 1KP6A 4A8MP 1W0HA 3MM7B 2WVCA 3MUTP 1VSKA 1CG2A 2H65B 3VVUA 1DRZA 2CQHA 2DNGA 4B3SK 1HI1A 3KUEA 2FVRA 2RSQA 4U6PA 4F4XA 1SJ3P 2A42A 1RDCA 3X3UA 2R8JA 3IBCB 3W63A 5JXSA 5HQLA 3CCMS 3KWMA 2UUBF 3O4WA 1DEJA 1BQXA 2HQIA 2DR9A 1ASVA 1RAIB 5I42A 2MLZA 3PSFA 3IWLA 3MAHA 1RACB 4CF0A 5AZJB 4DTNA 3V1OA 3TAEA 1YWXA 3GONA 4ECVA 5CCMA 2WFBA 2G8WA 3UDLA 4JI8J 1SI9A 5AQQA 4Z2XA 1IWAA 3CYMA 1BOTO 4DFMA 1X5OA 2Z1IA 4H5WA 4Z4GA 1IR1A 2CVIA 3SBGA 3R5AA 4X4TA 2NQPA 4ZP8A 1EP4B 3ENQA 3MR5A 2OUGA 5DQHA 3MM7A 2QLFB 3D3CJ 3MXMA 3BF3A 1A5XA 1FDAA 1JXEA 4IKAA 1BQNB 4CM2A 4YOWA 1S9GB 2CAJA 3HSCA 3KJQB 3WEEB 1OH5A 3MMJA 4EFHA 4J9OA 1N34J 1ZBLA 2CRLA 3EO3A 3NCQA 3OHBA 4YR3A 3K5NA 3OYBA 3JXUA 4OYAA 4FWLA 4DSEA 1HBMB 4BWJA 4A61A 4WFZA 1VJWA 5AZJA 1QAXA 1RCHA 4P7TA 3OYFA 4IYQA 3B82A 4Z94A 4M3YA 5BRFA 4UOFA 1VBYA 3FZHA 4USVA 4M3TA 1N8RT 4LT6A 3J7YI 5A2QU 4Y6IA 3BV8A 1LFWA 5IWAK 3PUFA 4A8WA 2YBVA 1R8AA 4I9LA 4KRFA 4EZ9A 2HKEA 3QGPA 1R0AB 3U27A 2OMOA 1EP4A 3KJNB 4LFCJ 4U8YA 1M90T 4J2DA 2VJVA 5KFNA 2RKIB 2CWKA 2J6SA 2B0GA 2AZ1A 5LXRA 1BQNA 3HK2A 1S9GA 3PXGa 3KHLA 3WEEA 4AFFA 1WLJA 5GAHU 2DXDA 4M45A 3ZYYX 3QEIA 4K4XA 2NRTA 3DYAB 4CBWA 5DDRC 3MX5A 1Y7PA 4MKBA 1JIHA 3MOJB 5CZ1A 2KVIA 2IYGA 2FJXA 2CPXA 2WUSA 4NLXA 1YBAA 4FWMA 2KJWA 4O55A 1XR5A 3I55N 2QL7B 4WU3A 4W92B 4HLBA 5HVHA 3JS9A 4GC6A 3NBPB 4RW4B 2VBYA 4CJEA 1K9MT 2Z1GA 1RT3B 4KH4A 4LFCF 3SSRA 2G9OA 3L4QA 4K8RA 3LWLA 4WFNL 4A2BA 2QKBA 2VFRA 4YDXA 4X4VA 3KK7A 1T7PA 1W26A 2MKSA 4CZEA 1R0AA 2Q97A 1GFWB 2IGIA 5I4MA 2GHVC 1N5SA 2RKIA 3ELHA 2H54B 1IKYB 3CC2N 2PO4A 1RCOB 2W7OA 3VGKA 2DIVA 2Y3YA 3NLCA 3VTHA 4CT9A 2X6NA 4O4RA 4C1NI 3S3NA 5GMEA 1ZTTA 3VCDA 4EO6A 2FBVA 4FLVA 4KGKA 3JAMY 1QQMA 2C2EA 3PYEA 4BLGA 2JEGA 4OJGA 5IQQA 3IO1A 4ZLJA 4DJBA 4BROA 4DTMA 1DURA 3VF0B 3DYAA 1VBXA 1J5OA 2VUGA 5F2RA 2JVOA 2KLAA 2QN6B 3DLLL 2IDLA 2Z2YB 3NCRA 3CJ0A 1NUEA 4NEYA 5GINA 2VG6B 1PYOB 3MN9A 4DTSA 1IWGA 2B56A 1FX4A 4CLUA 1JJCB 4LFAK 3NBPA 4RW4A 2B8PA 1T0TV 2BEFA 2HEKA 3MPDA 1S9EB 3ETOA 4B3SJ 2CJAA 1RT3A 1UETA 1GLJO 4PA1A 1QTNB 3R3TA 4CEDA 3OTOK 2W2NP 1Q5YA 2FHJA 3DKDA 5J2MB 3D1HA 3TYTA 1FD8A 4B1XB 3CCQN 3VQ4A 4Y2KA 3LQVA 4IFEA 2ATQA 1PJ6A 2A0FB 2FVPA 2RQCA 1MW7A 4ECXA 1Y9OA 2ZE2B 2GVDB 2OKQA 1Q79A 2Q31A 1I1GA 2IDOA 5KOXA 2VODA 1QJHA 4FJXA 3FCWA 4ECRA 1IKXB 1U0HB 4Y2CA 4YR2A 4MIAA 4DX6A 4K5RA 4FJKA 5SZTA 1URNA 4P71A 2DY4A 2J0SD 4B3SF 3DLKB 2VG6A 5MAOA 3BKUA 2BGGA 3I56S 3BGFA 1YJTA 2QK9A 3L7OA 3VZIA 4AHCA 2QT7A 1S9EA 3LH2S 1RBUA 2ZGYA 1QAIA 4HT7A 4CLWA 3OLAA 2V8PA 5AQJA 1Q5VA 1XHZA 3OL9A 4OQJA 4TQSA 4KC5A 2DGWA 2HFSA 3GYXB 1DQ8A 5J2MA 4WCEL 1C0MA 1BHLA 3OFHA 3C16B 3L2QA 3SUNA 3IR6B 4BVOA 3FFIB 2WTUA 2H5EA 3OTDA 3D6RA 3K9KA 3KHHA 4ZVTB 2ZBQA 1F9FA 3DRXA 2ZE2A 5L39A 1T94A 9RUBA 1VQ7N 1RBRA 2YNHB 3K5MA 4F4AA 2GX9A 3ITHB 1BG3A 1GNKA 1IKXA 3A1YG 2DR8A 1U0HA 2O01C 2QLJB 3IRWP 1VRQC 3ZZRA 2EKYA 2BOAA 2G8IA 5HBMA 3ZEUB 1X9WA 1GLLO 5IWAJ 4WFBL 1XWLA 3WQTA 2P9EA 3DLKA 3TRGA 5J2PB 4GW6A 3KXDA 5EX3A 4ID1A 4CFDA 1R8PA 2JGUA 3L3CA 3MGJA 3I5AA 3C6HA 1EO1A 1XMQK 1Y3JA 1EHWA 3VVTA 1YTYA 3UKUB 3RTVA 2K7JA 1VS3A 4KFBB 2B7BB 2DY1A 2PMZD 2FSKA 2ZBIA 3HMJG 2I38A 1YJNS 4BC5A 3C2PA 3NFAA 3Q0AA 3J81O 5C2DA 4KTWA 3BSOA 4NLOA 5TKWA 5AQRA 3OS2A 1GLAG 1WNEA 2EI5A 3C16A 2ZFHA 3FFIA 3VGSA 2EEYA 2DD8S 2ALZA 3NCPA 4QW8A 3A3OB 5IWAF 4CGGA 4ZP7A 2YNHA 2QWQA 2CPFA 3UD4P 3ITHA 3AOCA 1KVJA 3SCLE 2LSNA 3NOCA 2O66A 3OYEA 5J1PA 3ZEUA 3BM7A 2YQ1A 5DG9A 5FRNA 2O4IA 4OZLA 4LR9A 3KDNA 1FDNA 5J2PA 3P38A 3AA5X 4FJGA 4CO2A 1VMBA 3V9WA 4CBUA 3Q23A 4CHNA 2P5OA 3DI6B 1M1KO 5F9NA 1LXNA 4IO1A 1IKWB 4WF9Q 3PSIA 4UOGA 4I68A 2BX6A 4J9VA 4LJMA 1HQ2A 3R3LA 4EBEA 3CETA 2PGCA 3CCZA 2AIRB 4BRCA 4GRSA 5KQ8A 4BREA 4WZQA 1QVGR 3GR0A 1KTVA 2LP4A 2R8KA 2V69A 4F0HA 1XMBA 4LBIA 5BJRA 2O8EB 5B08A 1VQMN 2NRWA 2OO4A 2R7QA 4RUAA 1KQSR 2NXEA 2RQ4A 5DETA 4WYLA 3EZOA 4LFAJ 4IG3B 1S77D 3THWB 2YNFB 3G2XA 3J7AN 4M5DB 1K0VA 1U02A 1RWOB 2FTRA 2V5HG 2P9PB 3S8SA 2QFIA 3OTOJ 1MWQA 3OBWA 3KLEA 2VASA 1VIOA 3DI6A 4DZ6A 1IKWA 2LQ9A 1OH7A 2BQRA 2W6LA 3AO4A 3QMQA 2OD4A 4GMJB 1NK6A 2WBMA 4AL7A 4ILLA 2YVSA 2V8DA 2OTJS 2HQCA 1WF2A 3H5SA 4DU4A 3UFCX 2LECA 1R59O 1G6BA 3BS9A 5L9NA 5AJ3K 4LFAF 4M95A 3VQ5A 2DNKA 3W2VB 2DH7A 4ED1A 2O8EA 3M1FA 2HBZB 1PILA 2J8SA 4J90A 3OUYA 3CD6S 1UPPA 4ETXA 2G13A 1HFEL 3OSPA 1HYZA 4Q0BB 2XC9A 4IG3A 2ROEA 2ZH2A 3THWA 2YNFA 3OTOF 1C0GA 4F67A 1WNSA 4M5DA 4ZLPA 4HTLA 2W4CA 3VEYA 2B9EA 1NK4A 2K8GA 2P9PA 3M8WA 3NP5A 2NRRA 3VEXA 4MK9A 4N56A 1KHWA 3NWGA 1MU2A 2OPSB 3FKBA 2XS7A 4DBQA 2N7YA 1F5BA 3OYHA 1I3AA 3ILIA 2PEHA 3O80A 5EDWA 1KSPA 4AXJA 3EWGA 4X2BA 3FBBA 1SV5B 1RI7A 1GX5A 2Y1RI 3WNFA 4PL8A 1AXQA 4EEYA 4ZHRA 4KI4A 2ZWPA 1OY8A 3AB2B 3WBZA 4DFJA 3A8IA 2IDEA 2NPFA 3PYGA 4ZVPB 2I0XA 1WHVA 2DNPA 4DHVA 3W2VA 4WQ5A 2UYTA 2ZOGA 2C2DA 3TTCA 2R7RA 1T11A 2OYQA 3NRBA 3QYYA 1VQYA 4Q0BA 4LF1A 1XMQJ 1SJ4P 1SC3B 2XMVA 1N8RO 1KLMA 3CJ8A 2QEXS 1JLAA 1VAZA 3MM8A 3M1VB 4UY8O 4LVNP 2HLUA 3VN5A 2MDAA 4HT5A 4J7CA 2OH2A 3FVYA 1JMTA 2OPSA 3EVOA 2HHWA 4QYRA 4DR2K 3PX4A 2JSXA 3H46O 4EP5A 2N4DA 4F8RA 3OD2A 1U0SA 1SV5A 1LAVA 5HP1B 3FZBA 4BRFA 4ZA1A 1QSSA 4JKFA 4XAKA 2RHQB 4OZ3A 4XPCA 1W25A 2GBZA 3PLAA 3EXCX 1YZ7A 4I1TA 2RHSB 1Z05A 3EDQB 1HYVA 2Z57B 4FWPA 4CCHA 1XMQF 4F3TA 3TVKA 5E7OB 3J7A1 3IMXA 2CNOB 3DLJA 1LFPA 4EUVA 5GAHI 1VSHA 4TY9A 3J81U 4BR9A 1X4BA 1K9MO 1HQEB 3T3FA 3N5BA 4AHTA 3MURP 1SS6A 2RS2A 1R43A 2FHMA 1QDUB 2BANA 1L3SA 1OH6A 4IH6A 1GK8A 1C6VA 4FK2A 3PO4A 1RWNB 5HMZA 2MTLA 5F41A 1IM4A 4P73A 2BVZA 3ASMA 3IXQA 1Y5IB 2CGJA 2M70A 5HP1A 1GXLA 4DOZA 2J4RA 1OS5A 2UXCK 2YI1A 2B8QA 3O8WA 3HVTB 4RO0A 1Z2ZA 3GE9A 1UL3A 3GB0A 5M2PA 2FF3B 4OZ0A 1JCGA 2VC0A 2XEXA 2DPJA 1NGHA 2V68A 5DQGA 5IT4A 1HL6A 4EBCA 3NGYA 2UP1A 4TY8B 2OIHA 1RDAA 1RBVA 2HFOA 5E3PA 3KLVA 4BACA 5HRSA 1HQEA 1KQFB 4OYIA 3MFHA 2HNYB 4WKYA 2CWXA 5EU7A 1QLNA 4FW2A 2HAFA 2R9LA 4LSLA 2N7CA 3VMFB 2ZHBA 2E5JA 1N88A 1QZ5A 5A76A 1MWMA 4DSIA 2HHXA 3K59A 4X66K 2F8TA 2BXJA 1AUDA 1CPZA 4USKA 4OI0A 1Y5NB 5AJ3J 5C2CA 1RDRA 3EGNA 3CCRN 3CJ3A 4KAZA 2XCAA 5K14B 1RAAB 3G6VA 2V6AA 4GVMA 4DQRA 3D67A 1OYEA 3TI0A 3KJVA 3RB6A 3HVTA 1F0XA 3HDSA 2R42A 3TSUA 4QIFA 4O8KA 2F40A 4JV0A 4H0XB 5HI7A 2RB7A 4TU9A 4JYAK 4PL7A 2IJFA 3VAIA 1RTHB 4OZJA 2C28A 4JV5K 1ZYQA 3J7YP 4XPEA 4JS4A 3HHEA 3VF6A 4QWDA 2ZC4A 4MKAA 4TY8A 3JSBA 1WSIA 5ADXH 5LJ3Y 2YWWA 5C42B 1NM2A 5KPZA 3NGDA 3BO4A 5HL7L 3T5KA 4GY2B 4QIVA 2RQKA 3VGMA 2YNIA 2HNYA 1EX8A 1JLBB 4NCAA 5LSLA 4J2BA 3LPYA 3SCXA 5GAEI 1AZSB 2MZRA 1WDTA 5AJ3F 1KR4A 3K9JA 3UCGA 3BO3A 1FESA 1FJ7A 2ASOA 3EXYA 1RTIB 3LO3A 3QIOA 3M8QB 1S79A 4TLRA 4V19S 1YK9A 4PXBA 2XCPA 2W25A 3LDLA 1U2RA 4CJLA 4F0KA 3OR2B 3WDOA 2JLEA 2HGNA 3BH6B 2G8KA 4HTIA 5DGBA 1DQAA 4U8VA 2NUHA 4Y2AA 3T9NA 1S12A 4TN2A 4EYHB 3CCVN 3U1NA 4BC9A 1VSLA 4CH7A 4CNZA 1FRJA 1RTHA 2CFXA 4E7JA 1OH8A 2BTFA 1SUQA 2HRTA 1U8SA 4NE9C 3RRGA 3IBWA 4IR1A 3DGVA 3BQ0A 4DQSA 3QDKA 4O3OA 3KK1B 5HQMA 5C42A 4YMEA 5U47A 2BABA 4DR2J 2B4JA 2JC1A 4ZIVA 4HUEA 3UDEA 5KFHA 4CFAA 4JKBA 2AGOA 3EE3A 3WQUA 2XZTB 3HKWA 1ZZNA 1S1XB 4DV7K 3VQCA 4PG4A 1JLBA 2KT3A 5E33A 4QZVB 2YJEA 3Q8UA 3PIOL 2J7KA 5ELZA 1CS4B 2CUYA 2DGSA 2IJRA 4KKOB 4CO1A 1XK8A 5L46A 4K4YA 1RTIA 3M8QA 2GC8A 4CJSA 4K4WA 3NGUA 3H3NO 1ASUA 3LALA 3ISZA 4TSXA 2DTJA 4CLYA 3B6OA 3W5XA 5A8RA 3OR2A 5CR4A 2UXDK 3VQAA 3LDPA 4DTUA 2GWJA 1XHXA 2Q6BA 3E3XA 3W2WB 3P5JA 3D7EO 1VQ6S 4J9RA 1TFWA 2FJDB 1GEHA 4A62A 3OQ2A 5KFJA 4DR2F 4M3WA 3QAEA 4CF2A 3SDEA 1XQSC 2XI2A 3C6UB 1UCNA 1U45A 2F7TA 3N01A 1ZAWA 4QPTA 3KK1A 3V4MA 4JUZA 2E2PA 4B9LA 1OY9A 3JTPA 2XGPA 1S1XA 2HHTA 5D78A 1YT3A 3V1QA 4FPBA 4H4MB 2UXCJ 2HQ3A 2QV6A 1S76D 1YQHA 1IBCB 2K7KA 3I4HX 1X5SA 3G6YA 4KKOA 2RF2B 2N3OA 1JKHB 3DCAA 2OMLA 1FXXA 1ZS6A 5CZXA 3CJBA 3WQPA 5KFMA 4LQ9A 2HURA 2VU5A 3FGUA 2W7AA 1B9DA 2FYXA 3N6LA 2Y8YA 2E1MC 5C15A 3ZSRA 2DH8A 2JEFA 1FX2A 2M52A 3W2WA 4C6AA 3EPGA 4RX6A 3GCXP 3PW2A 3D2FB 3FNNA 2IY5B 5AQIA 1C1CA 3CCMN 4TQRA 2GJ2A 1Y97A 3IUCA 2QM1A 4X66J 3DHXA 3VAMA 2XMKA 3MI7X 3IFEA 3PX0A 2UXCF 2CNLB 4H5VA 2E5LK 2J9CA 1YJWN 4OHWA 2XB2D 1FEHA 4AXIA 2E88A 3O2IA 1W2BR 5D6GA 3F73A 1B92A 3K2PA 4H4MA 3WC0A 2V94A 4LUBA 3SBMA 3THPA 4KPYA 3WNHA 4LREA 2BRKA 4DWIA 2EX3A 4JYAJ 2RF2A 4ITSA 1JKHA 4J9LA 4JV5J 3KOAA 4DL3A 4OI2A 4N5SA 1HYSA 4M1KA 2A40A 2KYZA 4DSJA 1C2PA 1TKXA 3CJ9A 4Y3CA 1U2FA 4B17A 3QB0A 3C46A 1NRKA 1WHWA 4ZVGA 4EGLA 1T9WA 3KKSA 4X66F 1JJ2R 4G1QB 1MG7A 4FJHA 1VRTB 4DUYK 3ATUA 3NGIA 2MZQA 3AVCA 4KGZB 4I6MA 2MKYA 1V3ZA 1F9HA 2FZKB 4BQZA 4BDPA 4M5NA 3SUPA 3SQ0A 2ZH3A 4KH1B 2XO7A 2L9NA 2JC0A 4CTAB 1OKJA 1HKGA 1L3KA 4JYAF 4XEIA 1TK5A 5EY4A 1VSIA 4JV5F 2VIHA 1PG5B 1CEZA 4BRDA 4KBOA 2DO0A 1UJ6A 3G8QA 1Q18A 1QAYA 3H4DA 2XHCA 3QT7A 3W0LA 3BGRA 3OYKA 4MDBA 3M30B 3J7ZT 2M2BA 4YS2A 3CMAN 2AP1A 5LL6Z 3OXGA 4FYDA 1SH3A 3AH6A 3QERA 1SQKA 4IKFA 1N33K 2A2DA 3U1MA 2VZ9A 4C1NK 3PV8A 2B7CB 4DV7J 2I5JB 3N5FA 4BRAA 4QWCA 2XMJA 1CJUB 4G1QA 1OVYA 4U67Q 1VRTA 3BPDA 2KT2A 1B3TA 2QZ8A 2EFVA 4DV2K 5DO2A 2MLYA 3HVRA 1IG9A 4JI1K 4FO0A 5IT9O 1DT9A 4HDHA 3GE1A 5DS7A 3HZGA 1VQOS 2KG0A 4CBXA 3LAMA 3M3ZA 3CE8A 4CTAA 4NLUA 1APSA 1UAXA 3NGTA 2UXDJ 2KFNA 3BBCA 4LY7A 2Q2RA 2XWYA 4ZVSB 4FJ9A 3BR9A 3Q24A 3BKFA 4OHXA 3WC2A 4BE1A 2PFUA 1J9AA 2HVEA 4BC7A 3MPYA 4ZTJA 3P4UB 2AD9A 3I9V9 4OFZA 5A6PA 3RSEA 2GZOA 4YOVA 2D9PA 2CH5A 3HSGA 1MWKA 4TYBA 3VHQA 4BE0A 2CJKA 4DV7F 3ZSZA 4C3LA 2VFVA 4ZPVR 4F0MA 1WSVA 4O44B 2D3O1 2BE9B 1ESVA 2MGZB 3SUQA 3AT1B 3CCSN 2I5JA 1XEZA 2W8KA 1TAQA 2BM1A 4W5RA 1U6BA 1S4FA 3QBCA 5BR9A 3TUZC 2PSZA 2AEFA 1L3UA 4Z4EA 1N36F 1U25A 1R6YA 3Q89A 2LFVA 2UXDF 4ES3A 4PHTX 2VF3A 2O67A 4IRCA 2OPQB 3L7UA 3RMBA 1AA1B 2XNQA 3D28A 3HX9A 3TARA 4E1MA 3MEKA 2CG8A 3A4TA 3SZ2A 3MMAB 1U04A 3GJSB 2P1JA 3VWSA 2GQQA 3A2FA 3AXKA 4QW9A 4ELTA 2AJQA 1EQ0A 2ZF5O 3PW7A 1Q8LA 4NA3A 4G3IA 1K8AO 5B0CA 3TSPA 2M88A 4M7YA 1RGIA 4L3QA 3A8YA 5B0BA 3T5JA 4IWVA 4CO0A 1UJ4A 3CM6A 3CO9A 1RADB 4JI5K 3OTBA 4CT8A 5C25B 5L1IA 3WX8A 1N4LA 5AQGA 3MPUB 3CJ1A 2MGZA 1MWYA 2E5LJ 4J5OA 2PEBA 1MLAA 2PT0A 4WFAQ 4F2RA 4EBDA 2VG7B 1CBKA 3LL3A 1DAXA 1FNXH 2J6TA 4L3KA 1V9OA 1E6YB 3RBDA 4FWNA 1UFKA 2G0JA 2CJXB 2LYVA 4OV1A 4W4MA 4BR0A 4K59A 3HSTB 4H0VB 3T5LA 1TUUA 5AQXA 4LIRA 1IQZA 2MXYA 2P9KA 3E9LA 4MFBA 1FEEA 2C3OA 4F26A 2PE8A 4A5AA 1LXJA 4WYWA 3MMAA 1Q8KA 1RWUA 2DCUB 1Q78A 4E7KA 4E7HA 4USTA 5B0AA 2ZNYA 4AHUA 5BPLA 1VQKN 3I56N 3KWGA 1QHTA 3WIUA 1WSRA 4X64K 1WF0A 2G2ZA 2Q0UA 1XNRK 5M2RA 1RNHA 1HPMA 3PX6A 3UR3C 3AHPA 4DUYJ 2ILYA 3S7RA 2EXUA 1W7AA 1WKKA 1NK0A 2E5LF 3QAUA 2CQBA 2ZH7A 1H0HB 1S7IA 2XWXA 5C25A 4KGVB 3HO1A 3RRKA 4R8UB 1MDUB 3LDOA 4OHZA 3AD9C 4CHOA 2VFSA 2W2QP 2FLOA 3L3UA 3CULA