2YNHA

Hiv-1 reverse transcriptase in complex with inhibitor gsk500
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
560
structure length
560
Chain Sequence
b'NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 164
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynhA05
3RBEA 3RRGA 3MEEB 3LALA 2G8KA 4OGCA 1X9SA 4DEZA 1NK6A 4ECUA 3EZUA 4HTUA 3OLBA 2HNYB 5HLFB 3L2UA 3HO1A 1JL1A 4DTPA 4MFBA 4DQSA 4KHQA 1U09A 1VRUA 2YNFA 2R2RA 5KFMA 1LWFA 5KTQA 1HYSA 3HPOA 3OYLA 1VSIA 3KLHB 1JKHB 3ITHB 1KVBA 2ITGA 4J2AA 4N41A 1DLOA 4J9RA 2BANA 2Q3SA 5JS2A 1X9MA 4J9LA 1S1XA 4DSLA 4NLTA 1HYVA 1HARA 3CFRA 1CXQA 1RYRA 4TY8B 2R8IA 2KFZA 2ETJA 3AO3A 4NLRA 3H2LA 4OL8A 3H5YA 4KKOB 3AVJA 3RMBA 3M8QB 3GIKA 3DI6A 3VA3A 1U4BA 2HHWA 4QWBA 4KRFA 1TV6A 4LD0A 3GQCA 4K8XA 1OS5A 1FKPA 4KV8B 2WONA 4FM2A 3UDLA 5DG7A 1D1UA 4FJHA 2FLNA 1QSYA 4IDKB 1TQLA 2P5GA 1RA6A 4BDYA 4ED6A 4EZ6A 5JXSA 5C5JA 4ELUA 4M94A 2F96A 5KFUA 2ZKUA 1UOCA 4AHUA 4DU4A 1RT2A 1WSIA 3N6LA 2JEGA 2Z1GA 5F8JA 1NK7A 3SQ2A 1L3SA 3V9WA 2B5JA 1WSGA 1KLMA 3QESA 1QQCA 3DRSB 3B6PA 2RKIA 5FDLA 1EETB 5J2QB 3AO5A 4KB1A 4DTJA 3CO9A 4NLUA 4TLRA 1C0UB 3DRRB 4EEYA 4CGGA 2P1JA 4NYNA 3N6NA 1S6QB 4MH8A 4J9OA 3KK3A 4F4YA 2W9BB 5HBMA 5D3GA 2OPSB 3T5KA 3V81B 1JLAA 2CKWA 2G8IA 3KHLA 1N4LA 1N48A 1SUQB 2ILYA 1RTIA 1RA7A 2VWJA 2P51A 2PZSA 4CHZA 2HWHA 1S0MA 3OY9A 1C1AA 3KMQA 4YNQA 3KHRA 4LH4A 1SH3A 3OJUA 1S1VB 4CERA 1FK9A 4IRCA 4W5QA 4Y1DA 3RMAA 3MTKA 4E19A 5C25B 2KZZA 1T3NA 1TKXB 4E7KA 3LP0A 4DU3A 2Z1JA 2XWYA 4DL4A 1C0TB 4CJ5A 4CJQA 1RYSA 4H4OA 3N6MA 1RDRA 2R8JA 4RW9A 4O3QA 1Z26A 3O3GA 2HHUA 2RF2B 5HROB 4DTRA 2PYJA 4QW9A 4CFCA 4MK7A 2Y1IA 4J9SA 4WYLA 4E3SA 2J6SA 3AA4A 2PYLA 1TAQA 4YQWA 4LSNA 2BRLA 1D8YA 1JLBA 1BQMA 3CFPA 1WNSA 4HUFA 1BCOA 2WOMA 3KMSA 4DTNA 4DSJA 1JLFB 4RG8A 4MK8A 4CGDA 3V1RA 3MEEA 3LDSA 4IFYA 2IM0A 1EXQA 4BDPA 3K5MA 3QNNA 1DTTB 3D45A 3QERA 4ZP8A 4K50A 5DLGA 4DTXA 4QCLA 2HNYA 4YR2A 1EP4B 2AX0A 4ELTA 2RPIA 5T14A 1S97A 5CZ2A 5SZTA 3K2PA 4I2QA 3TI0A 3O4QA 3BQ2A 3VQ4A 4J9NA 1ZTTA 4KHNA 1R0AB 2ILZA 1TP7A 2G8UA 3VQPA 1CXUA 3NH0A 3RTVA 3G10A 3V4IA 5KG7A 4CEFA 4AILC 3CDUA 4KI6A 3TAEA 2JEIA 4PA1A 3VQ5A 3VQCA 3BSNA 3CQ8A 5KFBA 3LAKA 3AVLA 1NK9A 3K5LA 2EHGA 4H54A 1RNHA 3BREA 1RILA 4I2PB 2WCXA 1N6QB 3OYKA 4TY8A 4CGFA 4IR1A 3NAIA 5KT5A 4GC6A 1NK4A 5F8MA 1VSJA 2UVWA 2GIRA 4R8UB 1NKCA 1NJXA 1JLEB 3QEWA 1TL3B 2GIQA 4XIUA 4BWMA 3HHKA 4K4WA 2UUTA 2ALZA 1IKXA 3DLRA 4DL6A 4OKEA 1JLQB 3D5MA 3H4DA 1LW0B 4LSLB 1N56A 2YNGA 2E4LA 2Z1IA 2CJQA 3OYNA 2HNZB 3V9XA 4Y1CA 2ZD1A 2HW3A 3ZT3A 2HB5A 3CJ5A 3AV9A 4DS4A 1F21A 4NYZA 3AVHA 3ZCMA 1C1BB 3NFAA 2XRIA 4RUAA 1DTQB 4KBIA 2HHQA 3MECA 5HRRA 4FK2A 3RWUA 2BRKA 5I3UA 3IRXA 4CK3A 5KFVA 5KG0A 1D9FA 4CESA 3LP2A 1RT4B 4ZPDA 3LANA 4OKKA 1RDCA 4O4GB 1I39A 1U47A 3DLKA 4DQQA 4K4ZA 4CHOA 1XR6A 4ID5A 2W8KA 2GBZA 4ECXA 1S9FA 3KD1E 3CDWA 3DOKB 3NDKA 5KFFA 4FJ7A 4NLPA 3PW0A 1MU2A 2XY7A 4XO0A 3JSMA 2C2EA 5L1KA 3T5JA 2VG5B 4URGA 3KD5E 3VQQA 1B92A 4DWIA 1RBSA 5KI6A 3FFIB 2XY5A 1KVAA 2E6LA 4HUGA 5F8HA 3SV4A 2I5JA 3QEIA 3OYDA 5CY4A 3TR8A 2YKNA 3DMJA 3QZ8A 4CJEA 2DFHA 4LQ9A 4WFXA 1RT3A 2VG6B 5CYMB 4MIBA 3ICLA 1FKOA 4O44A 1W9HA 3BGRA 3NBPA 5FROA 4H4MB 4C8OA 3LPTA 4DSEA 2E6MA 4K4UA 1RTJA 3ULDA 4DQIA 3V1OA 1XR5A 4KTQA 5JUMA 3IAYA 4Q8EA 2D3ZA 4YFUA 2XO7A 1ASVA 3S3OA 3OSNA 2A1RA 4FLXA 4N76A 2F8TA 4FLYA 4DMNA 4DSKA 2VA2A 3MEGA 2EX3A 4CJWA 1KVCA 1Q9YA 4RW6A 2J6UA 2HHTA 1UAXA 1IKVB 1G15A 2W9CB 1ZBHA 4PY5A 1XI1A 4E7LA 2B6AA 3L2VA 3DDKA 1SL1A 4FJ8A 3PO5A 4Z4GA 3I8DA 2R2TA 4FJIA 5HRNA 1LWCA 4CK1A 1UWBA 3OYGA 1RT5A 3LWMA 2G8FA 2YKMB 2O4GA 4GMJB 3ZSOA 4CFDA 4IBNA 3AVAA 2ZE2B 4CECA 4IG3B 3ZSZA 3CDEA 3QIOA 5EDWA 3VN5A 4CEQA 5J2MB 2DPJA 1EKEA 4TYAA 4W5RA 5E41A 4BDZA 2OYQA 5J2PA 2QK9A 2IS3A 2UVVA 2XY8A 1GOBA 3DYAA 1U45A 4RNMA 4O0IA 5L1JA 2FJVA 4K4VA 2IOCA 1KRPA 4M45A 1JIHA 5KFPA 4CJFA 5F9LA 4FJMA 4JRQA 1REVB 4PWDA 4C8LA 3BSAA 3MR3A 1LWEB 3M9NB 3KK1B 3DM2A 1K6YA 3KLIB 3JYTB 3KKRA 4ZPCA 3VQBA 1S1TA 2W7PA 4R5PB 4WZMA 4Z4CA 4CEZA 4FBTA 1XHXA 1S9GA 5KG5A 1C6VA 5DGBA 3HPHA 1RTHB 1BQNA 4RUCA 1NOZA 3T5HA 3K5OA 4X2BA 4DQRA 4ECQA 1C2PA 2IJNA 4E1NA 1BI4B 1TL1B 4FLWA 2UVRA 2DY4A 3QIPA 3I5BA 3C6TB 3H59A 3LP1A 4CHNA 4Q43A 4B9MA 5KFCA 1BL3A 4Q0BA 4C8KA 1HNIB 1QE1A 4IQXA 2BR0A 3PUFA 3PW7A 3CIZA 3NF7A 3OYMA 5CYQB 4OGEA 4OPJA 2XGQA 4F2SA 2V0NA 3M9MB 3SUOA 3TAMA 3AO2A 1TKZA 1LV5A 4N5SA 1RTDA 3TWHA 3OHBA 2XCPA 4DL7A 2OPPA 3PX6A 5KFXA 5EWEA 1JX4A 3NH2A 3M8PB 4C8NA 1HRHA 3FQKA 4NYFA 4GVMA 3V6DB 2R2SA 1C1CA 3V6KA 3VQ9A 3ZT0A 2IC3A 2VG5A 4NCBA 4FCYA 5KG4A 4DU1A 1VSLA 4CJKA 3L3VA 3E01B 2HNDB 3AA5X 1VRTB 3OS1A 2FBVA 1NJWA 2D5RA 1RT1B 3HM9A 3SQ0A 1GX6A 3BR9A 4G1QA 4I7FA 3AVFA 4ZHRB 3PW2A 1A5XA 3QYYA 2XCAA 3I0RA 5KGWA 1HPZB 3PW4A 4RW7A 2OPQA 4Q5VA 4BE0A 1NOYA 3DOLA 3TARA 3HKWA 3OYHA 4PQUB 1HYZA 3S3MA 1LW2A 4I9LA 5KG1A 4FK4A 5KT4A 2QXFA 3AA2A 3U3YA 5EWGA 4ICLA 3QO9A 3PX4A 1TKTB 3NH1A 3OHAA 3RR8A 4ED1A 2AGQA 2W8LA 1QSSA 4RU9A 2V9WA 3KJVA 4BE1A 4HKQA 5J2NA 1L3UA 4H8KA 1D5AA 4CJRA 4CGJA 3NF6A 1S1UA 3KOAA 5F8GA 2BQRA 3DLGA 3RB3A 4JV1A 2BE2A 2GUIA 5KT6A 4RW4B 4Z4HA 1VSHA 5KFTA 3PY8A 1IKYB 3T1AA 4PUOA 1HNVB 2ASJA 4F3OA 5DGAA 4DG1B 4DLGA 2KQ2A 5C42B 1T05A 1XHZA 3KLFB 2AQ4A 2G8HA 3G6XA 3GYNA 4HVJA 3OYBA 3QGIA 4FJKA 3C6UB 3H5SA 1CZ9A 3AVKA 3S3NA 5HP1B 3NL0A 3TAQA 5L1LA 1JXLA 5DK5A 1JLGA 4AHVA 5KFSA 2W42A 1ASUA 4YP3A 4MK9A 2HMIB 4FS2A 3EYZA 2XY6A 3O3HA 2FJWA 1X9WA 3QEVA 1L3TA 4FK0A 4NCGB 3WNGA 3WNFA 1J5OB 5C24A 2IAJA 2IBKA 4M95A 3PHEA 2E9ZA 3ZSYA 4IOBA 4CEOA 4RW8B 2XHBA 1TVRA 2WB4A 4F4WA 1HQUB 3SUPA 5L1IA 3TABA 3KLIA 5EWFA 1ZBLA 2FVPA 1MMLA 4DF4A 1S5JA 2NUBA 4N56A 4TYBA 3QGGA 2G8WA 1KFSA 1S1WB 3KIOA 1HQEA 4M42A 1T94A 4U7CA 3PR5B 3OL8A 3IS9B 3U6FA 1A5WA 4CIFA 1KSPA 4ZMMA 4IG0A 2HHSA 4LH5A 4FLVA 2YNIB 2R8GA 3DRPA 3DLEA 3HVTB 4NLVA 5EU7A 4K4YA 4CJVA 4JS4A 3O4NA 4CJ3A 4IR9A 5DG9A 1T03B 4URSA 5KFKA 1JLCB 4CEEA 4HCBA 4WXOA 2PY5A 3V9SA 5EUHA 3OS0A 1WLJA 1CLQA 3BJYA 5HLFA 3PX0A 1NJZA 4O3NA 3HSTB 1ASWA 4CF0A 4JV2A 1RCHA 2IMWP 3UR0A 1S4FA 3V6DA 5I42B 2OPRB 1S48A 3GV5B 4DTMA 3QLHB 3KLHA 4OLBA 4WE1B 4ECZA 4FBUA 3KHHA 1JKHA 4DSIA 3ITHA 3NGIA 2BQUA 3HVWA 3EZ5A 1N5YB 4DTSA 2O4IA 2YNHB 4OKJA 1WSEA 2XI2A 3CFOA 1IM4A 4CFAA 4QWAA 2VG7B 2QE5A 4ZVFA 4KTWA 4IFVB 2R8KA 3UPFA 4FLUA 3CG7A 4XPEA 4G3IA 4AHTA 4KKOA 2AJQA 3M8QA 1IKWB 1L5UA 4L8RB 4KO0B 3H5UA 5J1EB 3MFIA 4FJNA 2X6NA 4KV8A 5CZ1A 4NZ0A 3OL7A 4IDKA 1SV5B 1WAJA 3KK2B 4CEAA 4B3OB 4J9QA 1TAUA 1Z4UA 1BISA 4B9UA 4DFKA 3MEDB 3M9OB 1Y97A 4M3YA 4CHQA 3BQ0A 4KREA 1RT7B 2I1RA 4J2BA 3Q8PB 4BE2A 5K14B 4FJJA 2HVHA 3SQ4A 4DTOA 4AHRA 4RNHA 3L8BA 4Z4EA 1S10A 4EBCA 1ITGA 1Q8IA 3KKSA 3AO1A 3DRSA 1S9EB 1EETA 5J2QA 2FJXA 1HNVA 4DQPA 2FVSA 5F9NA 1S6PB 1C0UA 3DRRA 2Z1HA 3NAHA 4J2EA 1S6QA 4M3ZA 3CYMA 4QWDA 2W9BA 2OPSA 3GIMA 3V81A 1YVFA 3NGDA 1K1QA 1SUQA 3EY1A 1RDDA 3VQ8A 3SYZA 1HMVB 2FLLA 3QINA 4M3RA 4F50A 2V4RA 1S1VA 4B9LA 4FVMA 3OYCA 3G6YA 3PW5A 1WSHA 2D0AA 5C25A 1QTMA 4DL5A 1TKXA 3SPYA 4MFBB 3GILA 3V6HA 1WSFA 3AO4A 4OLAA 1VRUB 2DPIA 4ECSA 3HXMA 2YNFB 1C0TA 1RBUA 1LWFB 1HYSB 3RBDA 4CFBA 4WFZA 1X1PA 2RF2A 2WK4A 4MIAA 3FRZA 5KG6A 4JUZA 4FZZA 4IH7A 1L3VA 2BANB 3S9HA 5HROA 1VSKA 4Z4IA 1S1XB 2YHAA 2IDOA 4C8MA 5L9XA 3FQLA 3K59A 3ZT4A 1T7PA 4NRTA 5T7BA 3OYFA 5DQIA 3PVXA 4FYDA 1W25A 1KHVA 3SUNA 5SWMA 3DI6B 4NLSA 3EPGA 1GOAA 3HVRA 3OYIA 1ZBFA 2OZSA 1TV6B 3HK2A 3C95A 1FKPB 2WONB 3QEPA 3OYAA 4AHSA 1JLFA 3H98A 3SI6A 1SH0A 4MKAA 1IH7A 2JGUA 3OL9A 4K4XA 3MXJA 2XGPA 4ZVGA 2JEJA 3K58A 3KHGA 4KHUA 2YHBA 1DTTA 4ZTFA 1EP4A 3PR4A 4IKAA 1RT2B 2D7SA 1T8EA 4TXSA 3CWJA 1R0AA 4DSFA 3RAQA 2GV9A 2B5JB 2RN2A 3OJSA 2RKIB 3ASMA 5FDLB 3SPZA 1BHLA 3ZSVA 1TK5A 4UQGA 4Y3CA 4TY9A 4EO8A 5DG8A 3KNAA 3RAXA 5KG2A 4CF9A 3K5NA 4ED7A 1NJYA 2B4JA 4I2PA 4K4SA 5HBMB 5D3GB 3D28A 1N6QA 3AVGA 4M3XA 3OVNA 1JLAB 4KTZA 3I0SB 3HPGA 1NHVA 2KZMA 5JS1A 1IKWA 4N47A 4FZXC 1QAJA 3HL8A 3LPUA 4R8UA 3CM5A 2C28A 1JLEA 3IG1B 4F4KA 1TL3A 3DLBA 4Y2CA 5KFLA 1LAVA 2G8VA 4IKFA 3V6JA 1SV5A 4K4TA 3P83D 2IA6A 2FVQA 4KHWA 3RB4A 1O1WA 1JLQA 3LP0B 3MFHA 1LW0A 3L2RA 1RBTA 4LSLA 4ECWA 4CIGA 2HWIA 2F8EX 5HRPA 2HNZA 4H4OB 2FBTA 3TQ1A 4QWCA 3KLEB 4RW9B 2X74A 4M41A 4FM1A 4Q45A 4ECTA 3K57A 4DFPA 3CJ3A 1C1BA 1JL2A 1SKWA 4F8RA 4E1MA 1DTQA 4YMEA 2QKBA 2ATLA 3V9UA 1YVUA 4DL2A 4XPCA 1J54A 2BGGA 3ZT1A 3F73A 1S0OA 4KHRA 3ALYA 1I3AA 1KFDA 4CGHA 3V9ZA 4EP5A 3FDSA 4QOZB 1RT4A 1NNDA 2IM1A 1YTAA 4CF2A 4LSNB 3IGVA 4ZPBA 4EO6A 1B9DA 1NKEA 1QUVA 4O4GA 4DFMA 1JLBB 3PJXA 3QNOA 1BQMB 4KFBB 4OVLA 4EBEA 3NF8A 4CEDA 2WOMB 4J2DA 4QAGA 3IGNA 1UA1A 1SKSA 3DOKA 1JXEA 1VSFA 1SL0A 4IFYB 3MAQA 3NCIA 5DQGA 3AVBA 2RDJA 4O5BA 4QWEA 1CZBA 3T3FA 3G0ZA 4ZPAA 1B9FA 1QS4A 3FFIA 1WSJA 4I2QB 4K8ZA 2KTQA 4ED8A 2B43A 3AA3A 1ZETA 2UUWA 4FJ9A 4FZYA 3VQAA 3U3GA 2YV0X 3RMDA 3V4IB 3KLGB 3TAFA 2JLEA 2AU0A 1NK8A 2VG6A 3NKYA 3OS2A 1TK0A 3GV8B 3AVCA 4JV0A 5CYMA 2ASLA 3C94A 3Q8RB 3LP3A 4CEBA 4H4MA 1RAJA 5KT3A 4AHCA 4ZVEA 2E9TA 3RMCA 4O55A 3VA0A 4W5TA 2KFNA 4B8CA 4M3UA 3VQ7A 4ZP6A 4EYHB 2AX1A 4O3RA 5KFDA 3P5JA 3NHGA 4CGIA 2AGOA 4FXDA 1IKVA 4CE9A 2W9CA 3SFUA 3TAPA 2IM3A 2V4QA 2OA8A 1XR7A 1IKXB 3AVMA 3ISNC 3O3FA 2X78A 1NKBA 1KLNA 3B6OA 1JXBA 3IN5A 1VSDA 1U04A 2YNGB 3THVA 4HYKA 3NGZA 3H5XA 3PO4A 3QZ7A 3GIIA 3RRHA 4NRUA 2LSNA 5KFRA 2YKMA 2ZD1B 4FS1A 5DLFA 4NLGA 4LQ3A 4ID1A 5KFAA 2R7YA 3CJ0A 3SI8A 2AWZA 2JC1A 2UVUA 4CCHA 2ZE2A 4CJSA 4IG3A 4FLTA 3MXMA 3I5AA 2FBXA 3MECB 5J2MA 4Y34A 3V1QA 2XI3A 1I6JA 1ZYQA 4IRKA 2P5OA 5I3UB 3IRXB 1A5VA 4Y2AA 1YTUA 1W0HA 4CHYA 2FBYA 4IRDA 1NK5A 1QSLA 2ZQBA 3LP2B 3SCXA 4F2RA 1D0EA 4I9QA 3MF5A 2D0BA 3I0SA 3QIDA 3EPIA 3DLKB 3LZIA 1RDBA 5KRTA 2VWKA 4JLHA 3HT3A 4ID5B 1K1SA 1BIZA 1REVA 4J9MA 3IG1A 2RDIA 5HRSA 2HHXA 1LWEA 1U49A 3KK1A 4WYWA 4DL3A 2AGPA 1MU2B 1QHTA 1RDAA 2IM2A 3MR6A 4J9PA 3JYTA 3JSMB 4R5PA 4URQU 5KFGA 3NGYA 4KI4A 3WNHA 3CJ2A 1ZBUA 1RTHA 3ZT2A 4IH5A 2I5JB 3G86A 3L2QA 3NAEA 2YKNB 3DMJB 2J6TA 4KAIA 3RB0A 1BI4A 4NLXA 1TL1A 3KLEA 1VK0A 3C6TA 3D0PA 2QV6A 3VQEA 1RT3B 1HNIA 3OYEA 4DLEA 1FKOB 1UA0A 4O44B 3SV3A 5KFOA 3BGRB 3NBPB 2X6SA 4FJLA 4W5NA 4E7HA 2F8SA 5CYQA 4E0DA 1RTJB 1KTQA 4O3OA 2DFEA 4HCCA 2OH2A 4B08A 2D41A 2WRMA 2EC0A 2DFFA 2D3UA 4EYIB 3MEGB 4KFBA 2R8HA 4RW6B 4GW6A 3AVNA 3CJ4A 3M8PA 3VQ6A 2C2DA 5KGXA 3T19A 3HJFA 4E7IA 3RR7A 2B6AB 1GOCA 4R0EA 2W9AA 4JRPA 3E51A 5KT2A 4Z4FA 4EP4A 2XC9A 3KLVA 1LWCB 1UWBB 3E01A 2FLPA 3GIJA 4CJUA 2HNDA 4OPKA 1RT5B 1FXXA 4KB7A 1J9AA 1VRTA 2ATQA 4B9TA 3SQ1A 2BQ3A 1RT1A 4ELVA 5KFEA 4ZHRA 2WTFA 4YR0A 3KLGA 4B8AB 1HPZA 4WXWA 4F4ZA 4CJ4A 4DF8A 3OSPA 1GX5A 3I5CA 2HAIA 5F8LA 4BACA 5J2PB 2C22A 5KFWA 3T5LA 4DTUA 3SUQA 2QKKA 4MKBA 5KFIA 4WZQA 1S0NA 4PQUA 4BWJA 3H40A 2R2UA 3DYAB 3PJWA 1RBVA 1TKTA 3L2WA 4TQSA 2OZMA 3G6VA 4E89A 1NHUA 4CIEA 4FLZA 4PWDB 4OJRA 4FW1A 3SNNA 1WNEA 5KFJA 1HJRA 4NLQA 3DM2B 3MR5A 2O5DA 2FC0A 4DS5A 1S1TB 4O3SA 1RT6B 1S9GB 4Q44A 4RW4A 2ASDA 1BQNB 2E9RX 1IKYA 4J9KA 3VQSA 4ZTJA 4DG1A 3QIPB 3H08A 4ED0A 5C42A 1KCFA 3FSIA 3KLFA 3LP1B 3OYJA 4Q0BB 3Q8QB 2BDPA 4TQRA 3C6UA 1QE1B 2HHVA 4ZP7A 5HP1A 4FJGA 4GC7A 2C2RA 3CM6A 5KRSA 4YR3A 3CVKA 4WFYA 1CSJA 4FM0A 2HMIA 3LAMA 4KSEB 3TANA 5FRMA 3TAMB 2KW4A 1TKZB 3ISND 4NCGA 3TVKA 1RTDB 1J5OA 3DLHA 4DFJA 3SFGA 3QEXA 4O3PA 2OPPB 3WNEA 1S49A 3HVAA 5KFNA 3GV7B 2W7OA 3UQSA 4TN2A 4RW8A 1D9DA 3M8SA 1HQUA 4ZP9A 4CF1A 1C1CB 4RZRA 4NLOA 2IC3B 4F3TA 4CK2A 3SJJA 5DMRA 4LY7A 4U6PA 4NCAA 1WN7A 1VSMA 4FJ5A 1DLOB 1S1WA 4IH6A 3HP9A 1XWLA 3IS9A 1BCMA 4G1QB 4I7FB 3I0RB 3M8RA 3H4BA 4NLWA 4F4XA 1XC9A 4RW7B 2YNIA 2OPQB 5KG3A 3HVTA 3DOLB 1QAIA 3BSCA 3F9KA 1NK0A 1J53A 3Q8SB 3BDPA 4RNFA 1LW2B 4KE5A 1Z25A 4ECRA 4FJXA 2FVCA 2D0CA 3UIQA 2HVIA 1T03A 2WHOA 4ICLB 1JLCA 3QO9B 3KTQA 5F8IA 1RBRA 4HHTA 1IO2A 3OL6A 3KJVB 5J2NB 5KT7A 3BQ1A 4KPYA 4NLYA 2DTUA 3L3UA 3BSOA 1S1UB 3ZSRA 3DLGB 1U48A 3RB6A 5I42A 3VQDA 2BE2B 2OPRA 1SKRA 4HUEA 3QLHA 1KLMB 4WE1A 3TAGA 4ED3A 3ZSWA 2IJFA 3HP6A 4PUOB 3ZSXA 4KHMA 1N5YA 2YNHA 5KFQA 1T05B 2JC0A 4FW2A 2Y1JA 1YT3A 4CJLA 5FRNA 2VG7A 1ZBIA 4KAZA 3KK3B 1KHWA 4KB0A 4IFVA 4KHSA 4Q8FA 1EX4A 5DQHA 1BIUA 2VA3A 1RTIB 4EBDA 1JLGB 4KHYA 4KO0A 3LWLA 5F8NA 5J1EA 1SH2A 3HYFA 1Q9XA 3NE6A 3SZ2A 5KFHA 4MQ3A 4B9SA 3KK2A 4QW8A 1FK9B 2FVRA 4CHPA 1SL2A 4B3OA 5C24B 4ECVA 2IAJB 3PV8A 4O0JA 3MEDA 1C0MA 3A2FA 5KFZA 4NLDA 1RT7A 2IGIA 4M3TA 5K14A 1TVRB 3ZSQA 1IG9A 4O4RA 4E7JA 1TGOA 1TK8A 4B9VA 2GC8A 3QETA 3AVIA 3NF9A 4CF8A 1TKDA 1LAWA 1RT6A 1BGXT 2JEFA 4M3WA 4RNOA 3P1GA 3PZPA 4CJTA 4EZ9A 1ZTWA 1S9EA 1HQEB 4Z0UA 4TSXA 4ECYA 4QPXA 3NMAA 3MR2A 1S6PA 5KFYA 4ZVHA 4IG0B 4RNNA 1VSEA 4CJPA 3OLAA 4AH9A 4B9NA 3DRPB 3DLEB 3QGHA 4JS5A 4ED2A 2A1SA 3LZJA 1WAFA 4W5OA 1HMVA 3MXIA
chains in the Genus database with same CATH superfamily
3RBEA 1TTHB 3RRGA 1X4EA 1XMOK 1HNWK 3LALA 1RCOB 1ZXOA 4OGCA 2EW9A 1YI2S 4BC4A 3O5BA 3R3LA 4ECUA 1KQGB 4ZLPA 2HNYB 3EGWB 3H6EA 4MJKA 3FMBA 5GVQA 2A5XA 1U09A 1IBKF 4PWWA 2R2RA 4EUVA 1RHQB 5KTQA 3WC2A 1HYSA 1PSDA 4Z94A 3R1XA 3AD9C 2HBMA 5JICA 1I1GA 3ENVA 4IO8A 4J2AA 3BEXA 1WKKA 2OTJN 4JKDA 3M8YA 2Q3SA 4ZLLA 5HMXA 1S1XA 5IT9O 1TMJA 1HYVA 3R5CA 3L95X 1KOOA 2KFZA 3IAM9 4OZLA 4NLRA 4OL8A 4KKOB 2DRBA 2MQMA 3DI6A 3VA3A 4CH0S 3HI9A 4K8XA 5EHHA 1FKPA 4LSZB 4LC9B 5M2UA 1QSYA 3MWTA 2Q0UA 1CQMA 2BJ3A 5DDQC 3I55S 2LU2A 1DRZA 3K9KA 4EZ6A 1UVKA 4JI8F 1HR0J 4P6QA 3N4PA 2HLUA 5CZXA 2F96A 1EX8A 3M30A 2ZKUA 3VMFB 3R7BB 1YIJN 4IEIA 4DU4A 1M5KC 2R42A 4NX9A 4UOCA 3H45C 1FO1A 2BX6A 2WAQD 5F8JA 3NVMA 5MLCQ 1ZAVA 3D2WA 1XMOJ 3WXMB 3NS6A 5LSOA 1VQMS 1WSGA 3FR0A 3DRSB 3B6PA 2L08A 3MGJA 1ROFA 4NLUA 1KVIA 3PCOB 1TELA 4EEYA 3VQTA 2P1JA 3SLCA 3N6NA 5HMZA 4MH8A 3TUZC 4J9OA 1DURA 2XYPB 2HSEB 5D3GA 3Q89A 3Q0AA 2CKWA 1TL5A 3KHLA 3IFRA 1RTIA 1OSCA 4P75A 2PZSA 4K5RA 1OPZA 4FWSA 3OY9A 2G13A 3RSEA 4LH4A 2DHXA 1R8BA 3OJUA 1S1VB 3MX2A 4CERA 5AFUA 2CYYA 4Y1DA 4BRPA 2KZZA 1BUPA 4B3TF 4FYVB 2ZHBA 3GBTA 4A8MP 2HURA 3HTVA 2P6TA 4DL4A 2M7SA 1RYSA 1UPMB 4AFFA 1ICEB 3O1LA 3MM5A 1WHYA 2ZH4A 4TU9A 3TWZA 2ABYA 2JZ5A 3AD8C 4DXLA 3FFKB 3H0PA 2Q1LA 2FGCA 4FWMA 1R0CB 4E3SA 2J6SA 3M2UB 1TAQA 1UVIA 2JX2A 1FE4A 2VJUA 2NPFA 1WHVA 3MM6A 3BGUA 2HQIA 1MW7A 4NA2A 3CFPA 2RB7A 4HUFA 3O80A 1R8AA 2CJKA 3V4MA 3PKYA 4FWNA 1VDHA 3C6HA 4JKAA 3DGVA 3D45A 5LMNK 3O1BA 4K50A 2HNYA 4YR2A 2YX6A 2LDIA 2AX0A 3DXKA 5CZ2A 3DFEA 3O4QA 2ILZA 1CXUA 2QWRA 5LXYA 4AILC 3C14A 3D0IE 3CJCA 1HI1A 2ZVIA 3SMZA 3CC4S 3EDQB 3F5TA 1XJWB 2U1AA 4JI4J 1WG5A 2DNRA 2O8DA 2Y8YA 2E5LJ 2RH3A 2DNQA 4C1NK 3BREA 3L4QA 4I2PB 5GAEI 3KG1A 1N6QB 4X65F 4CGFA 3ZZTA 3VTIA 4GC6A 2WSEC 3TUPA 2UVWA 1NJXA 5IC6B 1JCFA 3QEWA 1WG4A 1QVFM 1H6KX 2GIQA 4HTJA 1SJ1A 3VPZA 4AUKA 4BVOA 3HSDA 1T9VA 3J7YI 4CD3A 2VBWA 3H4DA 1N56A 1SKUB 3MCPA 3V9XA 3M2VB 4Y1CA 2HW3A 4UOHA 2FHMA 2HB5A 2PEBA 3G8TA 3GCXP 3AV9A 4DS4A 1Q95G 1F21A 4NYZA 4KBIA 2XMKA 1HX1A 3MECA 3RWUA 3NNHA 3LGNA 2D74B 5I3UA 2GMLA 2WSFC 2ZBIA 2V2ZA 1WJ9A 4C11A 4DCHA 3AAQA 4LF8K 2L41A 3L3CA 5KG0A 4CESA 5RUBA 4QIWD 4CHOA 2E1YA 3EN9A 4BG9A 4ECXA 2MY8A 1X5PA 3W2VA 3PW0A 2Z2LA 2XY7A 4H5VA 1HPMA 5L1KA 3KD5E 2VG5B 4URGA 1RBSA 3GR1A 1D3WA 2CDRB 5DETA 4UTGA 2I5JA 3OYDA 2NXEA 3V5RA 1ZC6A 3DMJA 1RHJB 5BRDA 5ELZA 4WFXA 2DR5A 3WT0A 1IR1A 2CXEA 2EC2A 1YITS 2M2BA 3MMCA 4ED5A 5FROA 3HBTA 1DQ9A 3V1OA 3CJKA 3I9V9 4CLUA 3B6BA 2Q1NA 2HOEA 1HNZJ 1JQGA 3SAGA 2A1RA 4WQ5A 4N76A 1S57A 3CCEN 3DXSX 3D0HE 2VA2A 2Q0RA 1NGEA 4CJWA 2HHTA 1IKVB 3O5TB 4PY5A 5AZIA 4LF8J 2B6AA 3NLCA 3GTYX 1SL1A 1YZ6A 4LF5K 4B1VA 3PO5A 1S22A 3OBWA 1FDBA 3R6LB 2HFUA 1RU2A 2QG9B 1XNQK 3ZFVA 2G8FA 4ILMA 2YKMB 5JVHL 2O4GA 3VR1A 2J9CA 2XNQA 4W98A 3MEKA 3VEXA 3ZSOA 1Q1KA 4CECA 2ZE2B 3ENAA 1FJGK 3NCQA 3VN5A 5EDWA 4FWKA 3CO0P 4CEQA 5CZVA 2DPJA 5E41A 3H42A 3BF3A 5C15A 2QK9A 2BM1A 3KUEA 2XY8A 1UVMA 4DZ6A 1UTAA 2VDIA 4O0IA 4DV2J 2FD2A 1QZ5A 4YDDB 3HZ6A 4R25A 4JRQA 3J7ZT 4PWDA 3BSAA 1K8AT 2P9IB 1EKSA 3JYTB 4ZPCA 4ZVSB 3JS9A 4BCAA 4WZMA 4Z4CA 4FBTA 1XHXA 1FF2A 3ENOA 2KU7A 1QUPA 3ENHA 4X4TA 1NOZA 2B4UA 3T5HA 3K5OA 2XNRA 4ECQA 1HBOA 3CCZA 4ILLA 4FLWA 2UVRA 1KS2A 1M0SA 5BPLA 3FMWA 3C6TB 2H5IB 3ATVA 5KFCA 1F1BB 1HD1A 3KKFA 4DV5F 2XMVA 4C8KA 1HNIB 4USHA 2ZJQQ 4WCEQ 4IQXA 2BR0A 3PUFA 1K8KB 1XNQJ 2NYHA 5I3PA 4DHVA 3TJ8A 3M1FA 2XGQA 4KT0C 3CXCR 5ETSA 2VQEF 2CQGA 3EWGA 2HVEA 5BR8F 1S6OA 4X4UA 2RUSA 4N5SA 3W61A 4P71A 2UXCK 2LKZA 1U7LA 4DL7A 3PX6A 4GKJF 5EWEA 3NH2A 1K73O 1G2EA 4BY9C 4C8NA 3GL1A 3FQKA 3W9JA 4NYFA 3SMPA 3CPEA 3V6DB 3GG1A 2A10A 2CG4A 4UUWA 2P9NA 2I7PA 1KAYA 2VG5A 2XMTA 3ISZA 4LIWA 2HFZA 3NWRA 2KKHA 1J6ZA 2GWKA 4LBIA 1RT1B 4DV0F 4P2XA 2E7VA 1GX6A 3BH7B 4ZHRB 2XCAA 1HPZB 4AXIA 3PIPL 2LQ8A 4RW7A 2OPQA 2AEFA 2GQCA 4JI0J 4YHHJ 1WF1A 3DOLA 4ZDNA 4GKKK 3HKWA 1SJRA 2YKAA 1HYZA 2OSRA 2MTLA 4I9LA 4K0KK 3TX0A 2X3GA 4FK4A 1RWPB 5KT4A 3BV8A 2RT3A 4AQYJ 3AJ1A 4DJBA 3QO9A 3NH1A 3L0QA 3RR8A 3O8MA 2G0JA 3ETMA 1VC5A 3BZQA 2JH3A 2SXLA 3IP0A 4YEAA 4HKQA 3FGUA 2CIMA 1FVSA 2H4WB 3NF6A 3RB3A 4JV1A 3PYDA 3LM2A 2BE2A 2OD4A 3HT0A 4CZEA 1QVGR 4IOCL 3LA0A 3PY8A 3G71S 1IKYB 2UXCJ 1Q7YO 2ROPA 1G3OA 3CCLS 4B3MF 4EWTA 1XN9A 2ZH6A 2Y0SD 1YJVA 1XHZA 3G96A 2VKRA 1F3VA 1KC8O 2AQ4A 5IXUA 4HVJA 1URNA 3VF4A 3NVKA 3H1QA 5HP1B 3TAQA 3UVJA 3QFHA 4B1UB 4AHVA 3HHDA 5KFSA 1ASUA 3N4WA 3M32A 3EYZA 2XY6A 4GO7X 1X9WA 4UY85 1L3TA 4FK0A 1RLCL 4NCGB 1QQMA 3DXMB 5AQPA 4I64A 3WNFA 2UU9K 4D3GA 1U1NA 3GJSB 3T1HK 4J91A 4DUYF 2XHBA 4NXNK 4K0KJ 1QAXA 5E26A 2RMLA 3TABA 4DF4A 1RXOB 4TYBA 2MKKA 2YQ0A 1IBLK 4J7CA 2VPYB 1HI8A 2G8WA 2K7KA 8ATCB 4G65A 2F3JA 4B17A 3FBCA 4FYYB 4OHWA 1HWUA 2HHSA 2AD9A 1QVFR 4DUZF 3DLLQ 5CAAA 2R8GA 2F4VJ 3DLEA 2V2QA 2HPUA 3CW2C 4K4YA 4JI1F 1RBOB 3DJCA 3G8SA 5DG9A 2VFVA 1HLUA 1E6VA 5KFKA 1JLCB 4I6MB 4CEEA 2PY5A 5EUHA 3OS0A 4X4OA 3IMQJ 5HLFA 1DFDA 2DIVA 3HSTB 2X51A 3R7NB 3SAHA 2EXUA 3KUHA 4Y0WA 1S4FA 3QB0A 3UDVA 3V6DA 2KXNB 5I42B 3TA1A 2OPRB 1RGVA 3GV5B 1JJ2R 4B3RJ 1UFKA 4WE1B 4ECZA 1JKHA 5B0GA 5BPNA 3R8EA 2D0PA 1GAOA 1WC1A 2DCUB 1UFLA 3P39A 1IM4A 2CA9A 4WU2A 5IV3A 1HKAA 2LDYA 2VG7B 4PZVA 4ZVFA 4OJHA 3UPFA 4FLUA 3CG7A 4AHTA 4W90B 1H7XA 5AXKA 1VCTA 1IBLJ 1LQ9A 1L5UA 2VKZG 3MFIA 2X6NA 3TR5A 1I51B 2J9EA 3OL7A 3KK2B 1Z4UA 2VJVA 1NLVA 2NS1B 4NOHA 1BISA 2HFNA 3T6JA 2QWOA 1UCNA 1P1TA 3CD0A 1BO5O 4QIEA 5F3ZA 1RT7B 2I1RA 1GK8A 4PL7A 4BE2A 4FJJA 2CRLA 4DTOA 1WEYA 3L8BA 5AQTA 4EBCA 1CLFA 2I38A 1Q8IA 1GTHA 1S9EB 1EETA 5J2QA 1EQ0A 4Y0FA 2FVSA 5AQHA 2DNHA 3AD7C 4OYAA 4JBCA 1RAEB 3DRRA 3ZX0A 1LOUA 3NAHA 1S6QA 2C3OA 4FF1A 3CYMA 4AD6A 2OGUA 2KFYA 2HAFA 5ADXA 3V81A 5I9EB 3Q83A 4YOTA 1K1QA 1UPPA 1SUQA 4V19X 5AZJA 2K3KA 3VQ8A 1HMVB 4KIAA 2KG0A 3OUYB 3IBFB 2K1RB 3VV2B 1XMQF 4B9LA 3HHLA 3W5XA 2KYXA 3CMAN 2VFSA 2D0AA 1W2BM 5C25A 1QTMA 2R7SA 1UJ4A 1TKXA 4H4KA 1WSFA 4WQ4A 1VRUB 3EMTA 2DPIA 3UKRB 1YJUA 2YNFB 1C0TA 1FTCA 4BRIA 4WFZA 3MDFA 3ENBA 1FX2A 4BREA 4JUZA 5HROA 2YJEA 1Y5LB 2IDOA 3HFKA 2XEXA 3D6MB 2ZJRQ 3OYFA 3CCLN 1ELOA 3SUNA 5SWMA 2ZM6K 2QIFA 2UUAF 3AJ2A 3R1LA 4P2SA 3OW2M 1TV6B 3HK2A 4WFNL 1FE0A 2FSJA 3C95A 2ZOFA 2R7TA 2YKQA 2B9WA 4CLSA 3DHXA 4AHSA 3ULEB 2ZZTA 3SI6A 1ZAWA 4MKAA 3OL9A 3FBFA 3KHGA 2YHBA 2ALYB 4OHXA 3G4SS 1DTTA 3FVYA 1N0UA 3IKMA 1EP4A 5HVGA 4YB5A 5F0XA 4TXSA 4EHTA 5F2RA 2XYGB 4DSFA 1IM6A 2KT2A 2QSWA 2IIRA 5LJWA 1NNEA 1HIYA 2BJDA 3N5FA 3QGPA 1JJ4A 4UQGA 2MQOA 2CVEA 3W5ZA 4EO8A 4CT8A 5EX3A 4CF9A 4ED7A 1NJYA 1T9UA 4K4SA 3D28A 4M3XA 4KTZA 4OX8A 1HHTP 3A5OC 2KB2A 3HL8A 1WC4A 4R8UA 2ZH8A 1JLEA 2EPIA 3TW0A 1CJTA 4WBFA 1TL3A 1ZM9A 2XZTB 4IKFA 1RAGB 2RQMA 5CYJA 1V5IB 2KXHA 3HSZA 4KY3A 1H3DA 3RB4A 1O1WA 4JNEA 1K9MT 3MN6A 3LP0B 2DGVA 2NREA 3L2RA 2I9SA 2JOQA 3M6XA 1VAZA 2NQPA 2G9OA 2GIFA 4H4OB 3KVGA 4QWCA 2X74A 3O44A 4DFPA 1JL2A 2A42A 2M5YA 3KG4A 2DRAA 2ATLA 1VI7A 3BGOP 2PSZA 2D4WA 3NEKA 1S0OA 1KFDA 4CGHA 1YJWN 4EP5A 1R31A 2AYGA 3SBTA 3MMAB 4ZPBA 3LL3A 1QUVA 1HKBA 1JLBB 3SMSA 1NDCA 3SDEA 4ZIVA 1YRTA 1BQMB 4OVLA 4M5IA 4DR2K 2CQHA 4J2DA 4QAGA 4DX7A 3VALA 1UW9A 3DOKA 4K25A 4IFYB 2F9DA 3CC7S 2RDJA 4CVNE 4K2XA 2ZUGA 4IXCA 4HT7A 1VFJA 4ZPAA 3D9BA 4A46A 1QS4A 3FFIA 4KRWA 3MUTP 1WSJA 3POTA 2DGUA 4ED8A 1ZETA 2WFBA 4FZYA 2L3MA 2IRXA 2YV0X 2X7IA 3V4IB 3RMDA 2EK6A 3QFWA 2JLEA 1U6ZA 2AU0A 4I69A 2DCLA 3MCMA 5DM6L 1ITPA 2VG6A 3WC0A 1G99A 3GV8B 3BH6B 3AVCA 1LKZA 3W9IA 1GLAG 3OA9A 3MD3A 2WBMA 4A5BA 2COLA 2UXBJ 4P73A 4O55A 4DR1J 4X4VA 4K42A 3VAHA 4O3RA 2V8DA 5IWAF 3NHGA 4FXDA 1E6YB 2W9CA 3SFUA 3Q8VA 3AVMA 5B08A 1WF0A 3O3FA 5A0YB 2BUPA 5AQOA 5AQVA 1KLNA 5FLXY 2P9LB 1EWQA 3UN3A 1UVJA 2LQ5A 2GX8A 1U04A 4JI0F 1PG5B 3K8VA 4HYKA 3PO4A 3C7NB 1GXTA 1B64A 4OYZA 3RRKA 2ZD1B 5DLFA 5KFAA 5CXTA 4NYPA 4CM0A 1YXQA 4CCHA 2RUGA 1NSKL 2DHHA 4FLTA 1RBAA 3V1QA 1YK9A 3TTFA 1T9TA 1I6JA 1TUVA 2Z2ZA 4ZCMA 5DDPC 4CHYA 1DHMA 4U96A 4QBUA 4IRDA 1GQEA 3LP2B 2UUCF 4JYAJ 3SCXA 4C97A 1D0EA 1KNZA 3ID6A 3QIDA 4I68A 3LZIA 1RDBA 5KRTA 5CHIA 1K1SA 4J37A 4EU0A 1REVA 4J9MA 5AQJA 2DY9A 4LFAJ 2HHXA 2GQ2A 1LWEA 3IRWP 4DL3A 1QHTA 2IM2A 3MR6A 4DR7K 4R5PA 4BR2A 1VQ9S 3FBBA 3R5JB 3CJ2A 1ZBUA 1RTHA 3ZT2A 3FKBA 2AF6A 1VBYA 4WTOB 1HBMA 3L2QA 2YI1A 3NAEA 2YKNB 2ZJQL 2ZVSA 4WCEL 2J6TA 4KAIA 2QL9B 2PD1A 1AFIA 1NDPA 1VK0A 2MJNA 4L72B 1F5BA 2QV6A 2DNLA 1RT3B 4XAKA 4YY3F 5A8WA 4BR4A 3V2UC 4DLEA 4USJC 1PJ7A 1FKOB 3P49B 3SV3A 3GMGA 5KFOA 1HBUA 2V69A 3JSRA 4E7HA 3UD3P 5CYQA 1RTJB 2D3OR 4WTYA 1LXNA 4DV3K 4HCCA 2PGCA 2ZOMA 3IR6B 2RE2A 2FPHX 5D4OA 4RTFD 2Z2MA 4RX6A 3AOCA 1R27B 1ZPWX 3P45B 2R8HA 4RW6B 2HIQA 3GLJA 1RI7A 3CJ4A 3M8PA 1FJCA 4KHPK 2LEPA 2C2DA 4BRDA 5KGXA 5HMYA 2G2YA 3VZHA 4R0EA 2DXEA 1SI9A 3PNIA 3CE8A 4EP4A 1H73A 2XC9A 4S0MA 1WHXA 2HZAA 2XHWA 3PACA 5M1FA 1UWBB 3E01A 2HNDA 2YQ3A 1RT5B 3E66A 3A1YG 2ATQA 3HD2A 1GLLO 5D8HB 2WTFA 1WELA 3J80Y 2HG4A 1MWQA 3BGLA 4WXWA 4PG8A 4F4ZA 4CJ4A 4H0YB 2GVDA 2HAIA 3CC2S 5A2QU 1HNXK 3GR0A 2C22A 5KFWA 2QKKA 4C0OC 2MHEA 4YDUC 4BWJA 1BQXA 1Q8KA 1WF2A 3DYAB 1W2BR 2GMJA 3CJ7A 3EM1A 3RVCA 1FXLA 3RU0A 3CSKA 4NXMJ 1TKTA 1WSVA 4FLZA 4EFAC 1BHNA 4OJRA 3SNNA 4CD1A 4WKRA 3DM2B 3MR5A 1E6YA 1Q81T 4PABA 4DV3J 2HF4A 5BN9A 4LF4J 1RT6B 1S9GB 2ADBA 3PRBA 1U1OA 2ASDA 1UVLA 1BWEA 3ZYYX 5BRHA 3N9UC 2MZQA 1VQ6S 2RHQB 1NLKL 1KD1O 1JMTA 5EN1A 2BYCA 4JOUA 4JK7A 1J2VA 2YHWA 2R3VA 4Q0BB 2GCFA 4TQRA 3C6UA 2HHVA 3KNGA 1XNRF 4WU3A 4GC7A 4OZ0A 3P96A 1U1PA 3BN7A 4CH7A 5E84A 1JJCB 3ZEUB 1J5OA 4LFBF 4IO1A 5AQRA 1HBNB 4DFJA 1R8CA 4K8RA 5ETRA 1WDTA 3OPKA 3WNEA 2BM0A 1HNXJ 2AKWB 5CABA 2W7OA 1RFQA 3SK3A 4RW8A 1BMQB 4YB6A 1M1KO 1HQUA 4ZP9A 4WFAQ 3EGZA 4RZRA 2BABA 3T1YJ 3DHWC 1RACB 2BJ8A 4FPAA 4LY7A 1KBRA 4U6PA 4BR7A 2IVFB 2WTUA 3IBCB 3DLLL 9ATCB 3HP9A 3FGVA 1D8ZA 2DD8S 4G1QB 4I7FB 4LF7F 4NPOA 1ZM3A 4X64J 3H4BA 1XC9A 2YNIA 2DR7A 1GLCG 1QAIA 4B3SK 2FHJA 1NK0A 1MN9A 4NYOA 3JSYA 1NSQA 3Q8SB 3FK4A 3BDPA 3L6QA 1K0TA 1KONA 4TU7A 3EE9A 2XZDB 4ECRA 1W7AA 4DR6J 2BW2A 3BF4A 4HHTA 1IO2A 3OL6A 3QFUA 3KJVB 1BUXA 3C19A 5HO4A 4NLYA 2B9XA 3BN4A 4OI0A 2P9PB 2N4DA 3T69A 3VQDA 3B8HA 3QLHA 2FZCB 2ZBRA 4ED3A 3ZSWA 2IJFA 3HP6A 4PUOB 2CADA 4DX6A 3GIRA 4KHMA 2R7WA 4LMZA 1N5YA 1VJQA 1EARA 4KGVB 3U1NA 2UXDF 2GVZB 4DMZA 4CJLA 1ZBIA 2J0WA 2AJ2A 2H65B 4IFVA 2YVSA 3CF5Q 4KHSA 4Q8FA 1EX4A 1BIUA 2VA3A 1KAZA 3OTOK 3CETA 1LWXA 4DV7K 1RDWX 1CJUB 3BKUA 3I82A 1XERA 3A5LC 3A3PB 1Q9XA 4FF3A 2QL7B 4QPTA 4GV6A 4TNOA 2BKOA 3NMRA 1XEZA 4B9SA 4CHPA 1SL2A 1FK9B 4JKEA 5C24B 2G0IA 1DARA 1Q82T 2JWNA 3MEDA 1C0MA 1E4FT 1HUXA 3OR1B 4QIGA 4DR5K 2L9WA 3ZSQA 1IG9A 4O4RA 4E7JA 2AYBA 4X4RA 2MLYA 4B9VA 2GC8A 2ZH1A 4EAHD 3QETA 3NF9A 1HJOA 4CF8A 1FXDA 1RT6A 5CR4A 4HHHA 3P1GA 3PZPA 1X4BA 1H2VZ 3GB0A 5AQIA 3G8QA 4ETXA 1T3OA 4QPXA 3FEYB 2EI5A 3MR7A 4Z7CA 4CJPA 3OLAA 4B9NA 4AH9A 3TJ9A 4R0JA 2KT3A 1B0VA 1QQOA 4U8YA 2V94A 1NGCA 1B7FA 5L46A 4W5OA 5B0AA 1UETA 3D3CJ 1PGZA 1NGIA 3HKZD 2G8KA 3CC2N 3VAKA 2X1FA 1X9SA 4DEZA 4C9DA 1S59A 3ILOA 3L2UA 3HO1A 1JL1A 3HHLC 4MFBA 4DV7J 3CCUS 4EIAA 5HQMA 3KWMA 5G0RA 1N36J 1RHRB 1NRKA 2XHCA 3EVMA 3HPOA 4PG4A 3OYLA 4H4KC 2QZ8A 3GU0A 1VSIA 2QEXN 3VEWA 1AA1B 3HX9A 2NSCA 1Q79A 4LF9F 4N41A 1UW4A 3QT6A 3W66A 3THYB 2ZJRL 4J9RA 5HQ8A 4DUTA 1HA1A 1UJ5A 4NEYA 4QU6A 3P31A 5JS2A 2O67A 2HIYA 1Q8LA 3CFRA 1RAFB 3QAEA 2VOOA 3VGUA 3G82B 4TY8B 1AYEA 3QNWB 2ETJA 4X4PA 2CQ4A 1RP5A 2HWTA 3H5YA 2UUBK 3RMBA 3M8QB 3MWPA 3MM9B 2WONA 5FPEA 4UY8T 3UDLA 1D1UA 3FZKA 3QT8A 2PA8D 1TQLA 2ROGA 5JVGQ 3U1MA 4BDYA 4WYBA 5JXSA 3Q22A 1NAQA 2DGXA 4ELUA 1MMNA 2MHNA 1U24A 1UOCA 1ZZFA 5AR0A 4OYPA 2YXLA 3VERA 1NK7A 4X84A 3QRQA 1F2HA 1N34F 3QESA 3I6PA 2ZBQA 5AQXA 2RKIA 5FDLA 4DR1F 1PC4A 2RRNA 3M1VB 4KB1A 3W60A 4IZ9A 1C0UB 2C3YA 4FXWA 4CGGA 2FXUA 4KH6A 1RDUA 2XMJA 2JNJA 4F4YA 1IJEB 5HBMA 2OPSB 2DIUA 3ZXWA 4NA1A 4PHTX 2W41A 4BRKA 4X66J 2G8IA 1HNWF 1TYQA 1S0VA 2N7CA 2P51A 3Q7BA 1O0PA 1X60A 5IM0B 2HVZA 4YNQA 3NGRA 5HL7L 2YCHA 3UDCA 1FK9A 2VYPA 4C6AA 3ZETA 2ZITA 4E19A 2FTRA 2UUBJ 1ZA2B 1VLOA 1T3NA 2Z58B 2H5JB 1TUWA 1MDUB 3RUBL 1LEOA 3CQYA 4CJQA 3QWUA 3N6MA 2MSSA 1M5HA 3MWBA 5I3QA 1XUPO 4O3QA 1YZ7A 1AUSL 2HHUA 4ZVRB 2QLBB 4C8ZA 4BGBA 1YDLA 2P9GA 4DTRA 4CFCA 4WYLA 4LFAF 4MDBA 4FKYA 3LPYA 4ZS6A 4F04B 3R8YA 5BYRA 3EGNA 1M1HA 4PKIA 4PL8A 4WF9Q 3O2IA 2NXUA 3UKUB 1WNSA 2BTFA 4DSJA 2WVCA 4OMFG 4D3HA 4MKYA 4RG8A 2MZJA 4MK8A 3BB5A 2YWFA 1EXQA 4RR5A 4F0HA 3FZHA 3K5MA 5M2RA 1FRLA 4BRGA 3K8WA 4DB3A 4ZP8A 2D3O1 4ELTA 2N7YA 5T14A 1QD1A 3TI0A 4A8YA 1TL7B 1FRXA 3D1HA 2DBBA 2AZ3A 2LQ9A 3VQPA 1Y11A 3VEZA 3T9ZA 3NH0A 3RTVA 3A8KA 3L7OA 4CEFA 4JI7K 1X31C 4OV1A 1RLDA 3D2EB 4KI6A 3TAEA 4YN3B 4PA1A 3VQ5A 2ZH5A 4L3KA 2NRZA 2FJBB 2O1PA 1IV0A 1U2CA 5KFBA 3PRDA 1T9XA 2BZ2A 3AY9A 3MCNA 1RNHA 1SQFA 1RILA 2WCXA 4TY8A 1NBWA 4IR1A 3NAIA 4BRQA 1WTFA 3SXLA 5F8MA 3HHEA 4LR7A 3H3OB 1WC5A 4MTPA 1YTYA 4CLTA 3CNQP 4P52A 4DCPB 1VQNS 2HQFA 4CNZA 1N5SA 1PBUA 3DLRA 4BS2A 3Q24A 3D5MA 4M5JA 4USKA 3IR7B 1OH8A 1LW0B 1S99A 2Z1IA 2CJQA 4JEPA 3OYNA 2HNZB 1SPBP 1KQKA 1NJIT 3VOVA 2KLAA 4QIVA 3IUCA 2EK1A 1Y3JA 2PFFB 1B99A 3SBGA 3AVHA 3CCQS 4RUAA 3SCJE 3CCUN 2FF6A 4G6VB 2V8VA 3GPAA 5HRRA 2FHKA 5ETQA 4FK2A 3PEJA 3E9OA 1S6UA 2VUGA 3MMVA 3EUNA 3PFEA 3A8YA 4CK3A 3SQGA 3TA2A 4A62A 3JAMY 3MOZA 4OKKA 3MM7B 1VGYA 1VBKA 4AXJA 3HLUA 3DLKA 3CCSS 1XR6A 4ID5A 3ZZ0A 5E0OA 2VHGA 4EHUA 4CLLA 5LMNF 2YPYA 1S9FA 4DV6K 5IM0A 1RUSA 3KD1E 2F4FA 5CCLA 3D2FB 3CDWA 4EFHA 3SJHA 3NDKA 2H4YB 2QFIA 5KFFA 4B1YB 4NLPA 5ADZA 2NRWA 3W0LA 3JSMA 4ZVOB 4C1NI 3T5JA 2YHYA 1B92A 1NDKA 4ILHA 3CCTA 4CO3A 1KVAA 1S7IA 4HUGA 5ITHA 8RUCA 2PDAA 3TR8A 2JWKA 3LO3A 1WORA 2FHOB 4CJEA 1WOPA 5B8HA 4Y6IA 2DFHA 1YF5L 4LQ9A 4DPTA 4USIA 2GJFA 4H5RA 5CYMB 3ICLA 4O44A 2QFJA 2CZ9A 1W9HA 4NASA 3NBPA 3GYGA 1D9AA 3LPTA 3ULDA 4DQIA 4YOXA 2Z4PA 1RWNB 5AE2A 1XR5A 5JUMA 3IAYA 4Q8EA 3ILLA 3H2VE 4A59A 3OSNA 1XTZA 1BU6O 4CLPA 3W8PA 1M5OC 4DMNA 3DOMA 4C4WA 3D6FB 1FW6A 4DSKA 2IYGA 1ZBHA 2MZRA 3OR2B 1OVQA 4JK8A 1NDLA 4JV5J 4Q2LA 1O5JA 3I8DA 2R2TA 1LWCA 1YJ9N 4X4SA 2EKYA 1RAOA 4ILRA 4DV6J 3NP5A 2EFPA 5CE3A 5GIOA 4CFDA 4NWBA 2KXFA 3ATUA 5HJXA 2OYQA 1Z2ZA 5AE3A 1GLDG 4BRMA 3TUJC 2IS3A 2UVVA 1GOBA 3GJTB 3DU6A 4BC7A 2FJVA 1RHMB 2IOCA 3GSDA 1U25A 1U2VB 1BE4A 1F5CA 5G4DA 4HACB 3F44A 1H72C 3M9NB 4ZVTB 2P5VA 2WVBA 1FRIA 3MPVA 2Y3YA 5GAGP 4JD2B 5KG5A 4DPOA 4O8KA 1P6TA 2JDJA 4FVUA 1T0TV 4GO5X 3HPHA 3MCOA 3E9PA 5CHCB 3X3UA 4F0MA 2WVFA 3WEEA 4DQRA 3I33A 4PPZA 1C2PA 5E33A 4WWSA 4EK2A 4JP8A 1BI4B 2EWHA 4KBOA 4E1NA 1TL1B 2DY4A 2MXYA 2M0GB 3NCPA 3LP1A 4CHNA 3C2PA 1BL3A 4KR0B 3B8AX 2LLZA 1ZOTA 1QE1A 5HOOA 3C16B 3TZYA 1YJNN 1IBKJ 3OYMA 4DPUA 4BQZA 4OPJA 2QA4N 4GVBA 2KHDA 3AGRA 2ASMA 1VQ8N 3PM9A 3AO2A 2DEIA 1TKZA 1X5TA 1DBDA 1C4AA 3DDNA 2M9KA 4AL7A 3VEVA 1IJJA 4LF5F 4A4JA 5KFXA 1JX4A 3I56S 1HRHA 4HHJA 2FDNA 1IWAA 2R2SA 1C1CA 1ILYA 2PC6A 2XLJA 3VQ9A 3ZT0A 5BR9A 1VSLA 1VMBA 2V52B 1VRTB 3OS1A 2OTLN 2QWMA 1NJWA 1R7IA 1A5XA 3CJBA 4JI8J 2YBVA 3R5GA 4Y2IA 3CCJS 4G1IA 3ILIA 1OY9A 4PCQA 1Y3KA 1OPIA 2ASOA 1C0GA 1KVKA 1LW2A 2ZH2A 3CCQN 2QXFA 5EWGA 4ICLA 3PX4A 2FJEB 1FJ7A 2LQJA 2W7AA 3BBFA 1RTZA 5DJBA 3SAFA 3I9ZA 2V9WA 5E5NA 1J5EK 4BE1A 3MMBB 5J2NA 4H8KA 5BYSA 4CGJA 1S1UA 2IBOA 4ANDA 3CCSN 3DLGA 2MLZA 3DGPB 4B1WB 3M2RA 3KWGA 3CF5L 4CLYA 4JI2F 3G6ES 3W5YA 1I94F 2NLWA 3KZBA 3U9ZA 4CZGA 1SBRA 5C42B 1T05A 5HMWA 3UCZP 4BG8A 2H3EB 3CEDA 3OYBA 5T7LA 2EG2A 3H5SA 4B3TJ 3AVKA 3R7SB 3MM8A 5DK5A 2HHHJ 3EGVA 2D9OA 2W42A 1VC6A 4X65K 3MOJB 3O3HA 2CPXA 1NPRA 1M90O 2M52A 1SJ4P 4Y2KA 5HI7A 2V67A 2C3PA 1PYSB 3E1YA 4XDDA 2A3ZA 3T9NA 5M1KA 4CEOA 3BZCA 1R59O 1YSJA 4XTTA 5D0EA 5EWFA 2E1ZA 1AZSA 3PYGA 1VQPN 4N56A 2W2MP 4JKGA 5F0WA 2G1DA 5K8NA 1KFSA 3VGTA 4M42A 1M5PC 4DL0C 1R8HA 2QA2A 3PR5B 3OL8A 2F7TA 4GKKF 1KSPA 4ZMMA 5C2CA 1CJVB 3HOSA 3KUGA 3ZZYA 4LH5A 4WPAA 2D69A 3W2WA 4CBWA 4KH1B 1Q86T 5BXIA 1XIQA 3C46A 5U47A 2FUG9 2BJ1A 3NRBA 4IR9A 2P8IA 1T03B 5BYQA 3ZTQA 3FZMA 1TZ0A 4WXOA 3V9SA 5E3CA 4C8YA 2YH1A 4OYXA 1WLJA 1CLQA 3PX0A 4O3NA 2D1KA 4JV2A 3T41A 2VBZA 1M1GA 2HVDA 1QHAA 4X65J 3CCMN 1W7WA 3GP9A 4DPYA 1LFWA 5C0YA 2OD6A 5H9EK 3KLHA 1NBEB 3KHHA 3ITHA 2XS7A 2BQUA 3JTPA 3NCRA 5FLXU 1RSCA 3R1HA 1J27A 3E2EA 3CFOA 2YKOA 1U0SA 4QWAA 3O9TA 1TFYA 2Z8QA 1DQAA 5HSPA 3D0GE 1KQSR 2KI2A 2W4PA 4XPEA 4CTAA 2Z2YB 5JVGL 2UU9F 1IKWB 4KO0B 4M1KA 2QC3A 5J1EB 1Y9OA 4KV8A 1NGJA 2GGPB 3T1HF 4IDKA 2B4VA 3AFGA 3NXZA 1TAUA 3ADAC 1WBDA 1RAIB 3MDQA 4PXDA 4B9UA 3M9OB 1Y97A 3BQ0A 2CJYB 2W24A 2F5GA 4K43A 2E7WA 4QS8A 5K14B 2HVHA 3VTHA 1ZZNA 1M5SA 2JFKA 2DGSA 2QWPA 5GADI 3PSIA 4RNHA 1WEZA 1F9FA 3MXHP 2O8BB 3GE1A 5AQFA 3KKSA 3JTOA 4PG6A 5E3RA 2N3OA 2FJXA 2DRDA 2FIUA 4OPAA 1S6PB 4UOFA 1X4HA 2P9UA 1PCAA 4J2EA 1IWGA 4M3ZA 4QYRA 2BE7D 1S79A 2W9BA 3GIMA 2GELA 4I4BA 1UEUA 3NGDA 2V8HA 3QBXA 3TQEA 3A0IX 5E2QA 1N54B 4PWUA 1E3MA 2P9KB 2FLLA 3QINA 3QATA 4M3RA 1MWYA 4F50A 3WXIA 2V4RA 2QX0A 3MHYA 2UV8A 3NNAA 2UZAA 3G6YA 1U1KA 1WSHA 1CQNA 1FDDA 2KVIA 4FOEA 2CFXA 3EE3A 3KK7A 1HYSB 3ZTRA 2OJ3A 2RHKA 5IT4A 2RF2A 2NYIA 2DNOA 4MIAA 3FRZA 5AT1B 4O23A 4ZCKA 3I96A 3J7A1 3S9HA 4Z4IA 1S1XB 4UT4A 2LU1A 5L9XA 3K59A 1CJVA 3L4BC 3LGHA 4NRTA 4J8FA 3C15A 1GH8A 3PVXA 2J8SA 1W25A 1CS4A 3G6EN 3DI6B 3MURP 4L73A 3J80U 3OYIA 3NG8A 1VQKN 2QRRA 2OZSA 3PYFA 2BJEA 4A8FA 2VQEK 1FKPB 3A3OB 3L9ZA 1T44A 5KPRA 5BR8K 1FX4A 3HFVA 1JLFA 1EKRA 5E3QA 3X1LB 2C2OB 4ZVGA 3FZ2A 4ITSA 4CZIA 5DZ6A 1WOQA 1GT8A 2IVYA 3CB4A 3M30B 4JKBA 2V63A 4IKAA 2CH5A 2D7SA 2JHEA 1T8EA 1G7CB 5GAEP 1W26A 3THXA 4KJIA 1R0AA 5HAOA 1FDAA 4IFEA 2VL1A 5IFMA 2RN2A 3OJSA 4K59A 1BHLA 4USVA 1OIAA 1F60B 1JB0C 2W4CA 2ZBCA 1VQ7N 1URRA 3RAXA 5KG2A 1RK8A 3K5NA 4A5AA 2OO4A 5EXWA 2MKCA 4C7QA 2B4JA 4LFCF 4Q2MA 1Q5VA 3J7YP 5D3GB 3FSXA 1GEHA 4NMLA 5IV4A 2KT5A 4A8KA 1IKWA 1NSPA 4N47A 1QAJA 2DXDA 3CM5A 4V19S 1U02A 4ID8A 2QLFB 3RSEB 1LAVA 2G8VA 3MN5A 2BKPA 4ZPWR 4DV5J 1GMUA 2E8AA 5BPMA 2P2CB 4OO1J 3ULHA 4OX9F 2FVQA 1X7VA 3KHYA 1JLQA 3MFHA 4MLHA 1VQYA 4LSLA 4KPCA 4OX7A 4QR2A 2VQEJ 5BR8J 3SSQA 4M41A 2O8EA 4ECTA 1SIZA 3EVOA 3KJFB 2MQPA 3K57A 3CJ3A 1C1BA 4F8RA 3WQUA 4GKJJ 1DTQA 2NCKL 4YMEA 4FKXA 2FZKB 3V9UA 3IXQA 2ZM6F 3F73A 1I3AA 4FPBA 4DU8A 2Y1RI 2YX1A 1HKCA 1HR0K 1RT4A 2HBQB 1NNDA 1WC3A 2HZCA 5THWA 3IGVA 4ZCIA 4EO6A 3PHTA 3GWCA 2FLOA 4O4GA 3MM6B 3KJNB 4DFMA 3QNOA 1U1MA 3E8OA 1QQNA 4DV0J 3IGNA 2OEKA 2HSTA 1LOTB 4Y00A 3NCIA 5DQGA 4FVCA 3O8WA 5H1SV 4KH5A 4IJAA 3AOAA 3HSGA 1PILA 3DXKB 2HGNA 4AL5A 4DU7A 4K8ZA 4M5DA 2B43A 3AA3A 4DKWA 1PO6A 3U3GA 2BOAA 3C14B 3HSCA 1WKJA 2NRVA 4CT9A 3OS2A 1TK0A 1U8SA 2EWSA 4P7TA 4M8LA 3Q8RB 2O8DB 2FY1A 4H4MA 3LDPA 1PAEX 5KT3A 2ZWOA 2MKSA 4ZVQB 3P5TL 2E9TA 3FZBA 2IJRA 5LOQA 3IO1A 4TVAB 4CO2A 4B3MJ 4B8CA 4ZP6A 4A61A 1N8RO 3MX5A 2OIHA 3A5NC 1CBKA 2OA8A 3OXGA 4GVEA 2HZVA 1U6BA 2QI2A 1M90T 3I31A 4JKHA 2X78A 3R2DJ 4BGAA 1MN7A 3B6OA 2B3TB 4DX5A 3THVA 3HI0A 1RWOB 4LF2A 2MZTA 3RRHA 4NRUA 2LSNA 5E7OB 5KFRA 3JB9k 1SS6A 2I0XA 1RAHB 3OFHA 3VAMA 4LQ3A 4NLGA 3WXJA 2R7YA 3EDRB 1NGBA 3SI8A 5A2QY 2AWZA 3OBYA 2UVUA 4CJSA 4IG3A 3DRXA 3MXMA 3I5AA 4A57A 3MECB 5J2MA 2XI3A 4DUYJ 2XMAA 5I3UB 1A5VA 1YTUA 3SBMA 1W0HA 4C11B 4C3MA 1NK5A 1V3SA 4DR2F 4I6WA 6FDRA 4M5MA 1PJ5A 3CCVS 2VWKA 3Q2SC 3U7JA 1BIZA 1YBUA 4H0OA 3PRVA 3EO3A 2HK3A 3FCVA 3W2VB 4X4NA 3KK1A 2AGPA 4DUZJ 4J9PA 2WW4A 2CG8A 2DVIA 4JI1J 5KFGA 4OX6A 2DK2A 1FESA 4FN5A 4IH5A 4JI4K 2I5JB 3G86A 3NGUA 4ES1A 2E5LK 2HHHF 3DMJB 4ZJLA 5ETNA 1N33F 4QR1A 4FDFA 3D0PA 3VQEA 3MAAA 4DCOB 3OYEA 5AXLA 2X3DA 2QA1A 4WIIA 3MMCB 2QLWA 4W5NA 2F8SA 2GW8A 5HVFA 5AFUH 3CJKB 3R97A 2DFEA 4LBHA 2D41A 2HRYA 5JLFA 2LMIA 1BA1A 4EYIB 1JCEA 4RBUA 5C2DA 2KDOA 1EJ7L 3MPYA 3AVNA 2MGZB 1NH8A 3CCRS 2WVDA 5AZIB 1SAZA 3T19A 3RR7A 4E7IA 2B6AB 5A76A 5TKYA 4JRPA 4LT6A 4XH1A 4WKYA 2GS8A 3OFFA 3KLVA 1N5VA 1U8WA 2GAHC 2QA4G 2FLPA 1FRKA 4KB7A 4B9TA 1O8BA 3SQ1A 3P4IA 2E66A 4B8AB 2PIIA 2MB0B 4C0BA 1OH6A 5F8LA 1WD6A 2Q6CA 4WZQA 4PQUA 2AT1B 3GG4A 2R2UA 2D1CA 2CUYA 2ZEJA 2QN6B 4PXEA 5K5MA 2W6LA 2A0FB 4TQSA 2HQGA 4DCJB 4OFZA 2VFRA 3A13A 4PWDB 4FW1A 5KFJA 2VU5A 3D67A 5B0FA 2EVZA 2YPZA 2A41A 3FZFA 4RW4A 1XK8A 4Q7AA 2E9RX 2ITMA 3T7ZA 4J9KA 1WC0A 1HBOB 4ZTJA 4DG1A 1YI2N 4UZBA 4M7XA 1XMQJ 3FSIA 3KLFA 1HNZK 1S5ZA 3Q8QB 4CP5A 4F7VA 2J0XA 2PMZD 3VZIA 1OO0B 4FF4A 2CQ3A 3N0VA 4WFBQ 2C2RA 4J90A 1JCGA 2F65A 9RUBA 2B4OA 4WFYA 2HMIA 3UNYA 4KSEB 3TANA 5FLXO 4KHPF 3ISND 1FJEB 2DHGA 1Y5NB 4MDAA 3VHQA 4OYOA 3OTBA 2M70A 3EXCX 2RAQA 3HVAA 3OTDA 2V51B 4TN2A 3P6YC 2MDAA 3M8SA 4CF1A 5C2GA 2P9NB 2KJWA 4F3TA 2UUAJ 1C4CA 1FTRA 3SJJA 4C48A 1FI4A 3VGVA 4I1TA 1OQ6A 4FJ5A 1S1WA 4IH6A 3I55N 4JI3F 1RJJA 3H25A 1HQ2A 1XWLA 3IS9A 2C2ZB 1FCAA 3AODA 3HJVA 1AT1B 2JVOA 3A3NB 1RWVB 4DV2K 4RW7B 2NRTA 2OPQB 3CJTA 3HVTA 3DOLB 2H9ZA 4RNFA 3QSYB 1V3ZA 1VQMN 2LXFA 4FZVA 2HVIA 2G1HA 3QO9B 3KTQA 2E5GA 1HFEL 3CD6S 3U8XA 1WG1A 2QMWA 2BEFA 4CO5A 5HVHA 4MO5A 5KT7A 2MGZA 4LBPA 2DTUA 4LVNP 1YVNA 3ZSRA 1U48A 1SC4B 3RB6A 2BE2B 4GVLA 3VF2A 1KLMB 2CH6A 3TAGA 3VAGA 5DM7L 4UOGA 3ZSXA 3Q86A 2YNHA 4IWVA 3VGMA 4J5OA 4FW2A 2Y1JA 1FKAF 1YT3A 4C98A 1BOTO 4KAZA 3KK3B 4KB0A 4QOTA 2VV5A 5DQHA 2XLKA 3H90A 2DT9A 3UVJB 1S72S 3TJAA 3UFCX 3LWLA 2BW7A 1SH2A 3HYFA 2ZZNA 3ZTPA 3M32B 3SZ2A 3U4LA 4ZCLA 5KFHA 2W2NP 4FXVA 3TEHB 3RJMB 4B3OA 1PYTA 2E2NA 3PV8A 3GDQA 4NZ7A 3JAMU 5IWAK 3A2FA 5K9FA 4YOYA 3BUZB 5KFZA 2HS0A 5GAGU 4UW2A 5FPMA 3J80O 4LRFA 4CO0A 4M3TA 2CAJA 2KRRA 2LP4A 1TK8A 3TTDA 4Y2MA 3UWTA 4C23A 2IMOA 4PXCA 4DR4F 1MA9B 4JI0K 1V5VA 4YHHK 2MKIA 4M3WA 2R7UA 2P9SA 4JN4A 1RZMA 2EFNA 4ECYA 3NMAA 2YWHA 3MR2A 4B3SF 4LF6F 5KFYA 4AQYK 4HL9A 2UP1A 2LECA 5CD4H 3DLEB 4ANCA 3QGHA 1UL3A 1PC5A 4ED2A 3LZJA 3LM9A 1WAFA 1CJKB 2UUCK 3TTCA 1E6VB 4F25A 2RU3A 3CC4N 1VBZA 3MEEB 2NRXA 4JI5F 1NK6A 4NLCA 3EZOA 5HLFB 4BRNA 1NM1A 4DTPA 4OZ2A 4KHQA 5KFMA 2FB0A 4EI2A 1LWFA 1MWZA 1Y7PA 1OH7A 4P2MA 1JKHB 2ROEA 5IWAJ 2VODA 4FYXB 2BANA 2HBRB 1NH7A 3OTOF 1QTNB 1X9MA 4J9LA 4NLTA 1RABB 1CXQA 4DV1F 1CPZA 3PYEA 5EX0A 2R8IA 3VF6A 3CMQA 3CJRA 3H20A 1EIYB 4YDUA 1ZM4A 3GIKA 4W92B 3MCAB 4GV9A 2HHWA 2L9DA 1DKGD 4LD0A 3DN9A 1OS5A 3R9LA 4OJ3A 4FM2A 5DG7A 1QDUB 1I5OB 3NS7B 5AQKA 3G2XA 2FLNA 4FJHA 2BVZA 2P5GA 4CZJA 2IFXA 1RA6A 1W2IA 4DR5F 5LL6Z 5LSLA 1F9EB 4PPDA 3ZX2A 3VGSA 4M94A 5KFUA 3BF1A 1BA0A 1KKHA 2FZGB 1X3NA 5D4NA 1OYDA 2ZC3A 4AHUA 3EICA 2NLXA 1RT2A 2VGMA 1CULA 2HBJA 2JEGA 3M6UA 2UUCJ 1O51A 3UO0A 1AROP 1LK7A 3SQ2A 4LRDA 1CC8A 1L3SA 4BRAA 2XMUA 2F4VK 3V9WA 4A48A 2B5JA 2EFGA 5T41A 1KLMA 4A8XA 1QQCA 2ZDOA 1EETB 5J2QB 3AO5A 4DTJA 3CO9A 1W97L 3IMXA 4TLRA 3M7VA 2B0GA 2GHWA 3DRRB 3BKTA 1PIEA 4NYNA 1RWUA 1S6QB 2ZH3A 2XMMA 2R7QA 2B51A 3RAMA 3KK3A 4H0XB 4FPRA 3V81B 1CC7A 3MPUB 1JLAA 3P8BB 1N4LA 3RG6A 1SUQB 2R7OA 5AZJB 1ZS6A 4CHZA 2X1BA 2HWHA 1S0MA 1OQ3A 3ZNUA 4IOXA 2R7VA 3KMQA 3JXOA 2GX9A 4B3RK 4A8WA 2FJDB 4YY3J 3AH6A 1VQOS 2M8DB 3HHLB 1YITN 3MN9A 1HWIA 4W5QA 3OT9A 4HI1A 3G87A 3ZTOA 3C8YA 3GG0A 3MTKA 3WXKA 5C25B 4X62J 3BPDA 1TKXB 3UD4P 1WB9A 2CZVC 1C0TB 3CD6N 3TOQA 2AP1A 2R8JA 4RW9A 4IO9L 5C2FA 5A8KA 2VONA 4OHVA 3O1WA 1N88A 4DBQA 5HROB 3CDBA 4K41A 4CNYA 2PYLA 1P8ZA 4ALZA 4LSNA 1WDDA 2BRLA 1RGIA 2OFGX 3BYPA 3NY0A 4HLBA 3HFZB 4CO1A 2ACMA 2DR8A 1E4GT 4H0TB 1CJKA 1BCOA 2WOMA 3KMSA 4DTNA 3R27A 4L74A 3B4DA 3MEEA 3CD7A 1Q0NA 3V1RA 3LW5C 5K8MA 1DTTB 5AQLA 3QERA 2GJ2A 3CJ1A 5DLGA 1V3RA 4QCLA 1EP4B 3HRGA 3TO8A 1S97A 4I2QA 3RZAA 2EFQA 1ZTTA 4OYWA 4KHNA 3EKUA 1TP7A 3R5AA 1U0HA 2VPXB 3G10A 1BWVA 4LRAA 1WC6A 1H98A 2RRBA 3CDUA 3PG9A 5JVHQ 3VQCA 4CYUA 5DDRC 3CJ9A 1BY9A 1FHTA 4LF7K 5M1OA 3LAKA 2RHSB 1NK9A 2PBDA 1I3OB 4RCHA 2KN4A 1RU1A 4ETZA 2BH1A 3OYKA 2IPOB 4DX8H 1KTVA 1VSJA 4RWWA 5HQLA 1WUAA 4R8UB 4UZCA 4I56A 1JLEB 3VEYA 5B0CA 1CJTB 1TL3B 4XIUA 5DO2A 4BWMA 2JWLA 2GMHA 3THTA 2NXCA 4K4WA 2UUTA 5LMUF 2ALZA 1IKXA 3QJPA 1MG7A 1XNRJ 4DL6A 2A6OA 4DZDA 2YNGA 5B7WA 2E4LA 2VZ9A 3A4TA 4LVOP 1UP1A 2GA7A 3ZT3A 4LFBJ 3ZCMA 2AEJA 3TPQA 1NZAA 3QRPA 2Q36A 2XRIA 4CIOA 2HHQA 4E8UA 4YB7A 2UXDK 3IRXA 1DAXA 1NG9A 5FJ4A 1YJ7A 5KFVA 1CG2A 1D9FA 5GIPA 2MQQA 2V34A 3LANA 3U02A 2V4JA 1RDCA 4J9UE 3NOCA 4BRHA 3SDEB 3UD5A 4K4ZA 4DR3F 5IOLA 2WW8A 2CQ2A 3JSBA 4LF7J 4ZA1A 3DOKB 2E88A 4FJ7A 1MU2A 4ZJQA 3OXLA 1UEKA 4XO0A 1L3KA 3VQQA 4V19J 4DWIA 5KI6A 3FFIB 2XY5A 2E6LA 2UV8G 4JI6F 5F8HA 3SV4A 3QEIA 3POTB 1S3XA 3C3LA 2CJXB 2PI5A 3B82A 3M4XA 2AJ4A 2VG6B 2VF3A 4BVPA 2OI2A 1RKIA 5C10A 3P5BP 3M6WA 4MIBA 4DI6A 4KH0B 2MZSA 3BGRA 4C8OA 4CBXA 4DSEA 4K4UA 1NEEA 2F9WA 3G71N 4KTQA 1FNMA 5A8RA 4K7QA 1IBMF 2XO7A 1KP6A 3S3OA 2B9EA 1R89A 3A12A 2F8TA 4PG7A 4FLYA 1P27B 4ZIWA 3MEGA 3VVTA 1X3MA 2EX3A 4BC5A 1KVCA 1Q9YA 1FRMA 4YOEA 3SSRA 1QM9A 3BR8A 1Q4RA 2J6UA 2UXDJ 4PQAA 1UAXA 1G15A 2W9CB 1XI1A 3HMJG 4E7LA 3BM7A 2VFUA 3VGLA 2KM8C 2DKOB 5GAEU 3VETA 2RILA 1YLXA 1AXQA 2W25A 5HRNA 1R43A 3BBCA 4F0KA 3VESA 2HS4A 3OYGA 3HD1A 2DYAA 1VQON 1YRXA 4IOCQ 3K5PA 3NGSA 1IUJA 4WIQA 3OFGA 4X4QA 4HDHA 2QM1A 4LREA 5LJ3Y 1YAGA 3CDEA 3QIOA 2KHOA 4BHQA 3AQOA 3FRYA 2FF3B 2WBNA 3J7YU 4BDZA 3LTOA 2HRTA 4FWPA 2NR0A 5J2PA 1X4GA 1EAYC 3RGIA 4DPWA 1Y5IB 2DH7A 5AQUA 3WDOA 1KRPA 1GLJO 4FWRA 4CJFA 5F9LA 3ID8A 4HTLA 2ZH9A 2E1AA 4FJMA 1REVB 1T02A 4C8LA 3AB2B 4BC2A 1WKLA 2YWGA 1LWEB 5H9FJ 1ZBSA 1K6YA 3KLIB 3KKRA 4ZLJA 3VQBA 1S1TA 2W7PA 4R5PB 2LA4A 2RE1A 4CEZA 2J5AA 3HF5A 1LNQA 5AQZA 3ZZOA 1T11A 5DGBA 2Q6BA 1RTHB 1BQNA 1WTBA 3W65A 1TFWA 4ERDA 4RUCA 1HBMB 4N8OA 4OZJA 1K73T 2DNGA 3QMQA 2NZTA 3QIPA 1S12A 2VD3A 3GFZA 3I5BA 2UXBK 3PJ9A 3H59A 4B9MA 1X9JA 2IVOA 1S7HA 4DR1K 5A8WB 5KPZA 2CGJA 3J7ZO 4Z7YA 1HBUB 1R6YA 2HBZB 2NRRA 1VHXA 3EJMA 5CYQB 1K8AO 1YJRA 4OGEA 4OZ3A 3F41A 5L9NA 1YBTA 1N0VC 2MKHA 2V0NA 3TAMA 4RL1A 4YOVA 1RTDA 4LF9J 3QBWA 3OHBA 2XCPA 1CEZA 2OPPA 1RISA 1ZAXA 3M8PB 4GVMA 4B02A 2NXJA 5D4LA 5E3PA 5B0DA 4FWOA 2IC3A 3AJDA 2RD5C 5AQSA 2DNPA 5KG4A 4DU1A 7FD1A 2DTJA 4ZVPB 4B1ZA 4CJKA 3L3VA 3E01B 2HNDB 3AA5X 4CZFA 3JAMO 4A8SA 2DR9A 4ZLNA 3WBZA 3HM9A 3BR9A 4JYAK 3AVFA 3QYYA 3I0RA 5KGWA 2GUPA 3US5A 1OY6A 2BV3A 4USMA 2GVDB 3TU5A 2B8QA 4CH1A 1VOMA 2W4DA 3TARA 1Q7YT 3WHIA 2D9PA 4LFAK 1KAXA 3S3MA 2DH8A 3K89A 5KG1A 3TVYA 4BRFA 2O01C 1VQ5S 2XWXA 3AA2A 3TSQA 1V4SA 2YQ1A 3MZIA 1N34J 1KC8T 4QS7A 1TKTB 3OHAA 2OMLA 2XS2A 3CXCM 2W8LA 1QSSA 4RU9A 1FWLA 2Q31A 3R9PA 3LDOA 2XSJA 5D6GA 1N32F 1L3UA 1D5AA 1Q53A 4USUA 2A2DA 3LDLA 2M8HA 2X1GA 2BQRA 3WQPA 1TR0A 1HNWJ 1P1LA 2GUIA 4MYUA 5KFTA 3DRYA 1VIXA 1FWPA 4R79A 3ELHA 1HNVB 5D4PA 2ASJA 2LQBA 1FFSB 4DLGA 1SXLA 3CCES 3TEGA 2KQ2A 2V8PA 3ET6A 2O8CA 3GYNA 4NI2A 3FEXB 3QGIA 4FJKA 2APOA 3C6UB 2OFHX 1CZ9A 3S3NA 4MMOA 3NL0A 5L1LA 3CI5A 1JLGA 2Q2RA 2CNKB 3Q2TC 1YJTA 4XEIA 4YP3A 4CRJA 4MK9A 3E3XA 4FS2A 4RBVA 3QEVA 3E9LA 2QTDA 2CPZA 3WNGA 2V7ZA 1J5OB 4CLWA 2IAJA 2GV1A 4I67A 4I6YA 2IBKA 2H1YA 5LXRA 4M95A 2VH7A 3PHEA 2E9ZA 1B4SA 4IOBA 1NGFA 4RW8B 2ZFHA 1TVRA 4F4WA 1HQUB 5L1IA 3KLIA 2HQDA 2I7NA 2HS3A 1MMLA 2NNWA 3M8WA 2XS5A 2NUBA 3QGGA 2CPJA 3HCXA 2EFVA 4HEA9 1RBLA 2O8FA 3P3DA 2BJ9A 3KIOA 1HQEA 1T94A 4PYAA 4U7CA 2LCWA 1QVGM 2CWKA 3U6FA 3G4SN 5CCMA 1A5WA 3R6MA 4IG0A 2RVJA 4NXMK 4FF2A 2YNIB 3TVZA 3DRPA 4NLVA 3MMJA 3FSYA 4KH4A 2K06A 2E5JA 3KJQB 4N7TA 4CJVA 1BG3A 4AYBD 4X62F 4JS4A 3FBEA 5LL6d 3O4NA 4JAXA 4CJ3A 1NGAA 2A40A 2V2KA 2DXFA 2LEBA 1J5EF 4URSA 4LF4K 1WACA 4WFNQ 2CGKA 4OI3A 4BRLA 3CIMA 4QIFA 5ETKA 3BJYA 1NJZA 4RLEA 1U1QA 2ZNYA 1ASWA 1FEEA 2VQFF 2AHOB 4DTMA 3QLHB 2QL5B 1PBAA 3NGIA 2DEJA 3N4QA 2B9YA 1N5YB 1GMWD 4F67A 2I2YA 4DTSA 3D1OA 4OKJA 1WSEA 4C2MA 1ATNA 4CFAA 3I32A 3QICA 2GEMA 4KTWA 4ZJOA 4IFVB 2R8KA 4KKOA 1NMEB 2XB2D 4E1JA 4L8RB 4JHDB 4Y28C 3H5UA 3HHLD 3AY0A 3QWPA 2PN6A 3G25A 5CZ1A 2LFVA 4NZ0A 3T1YK 3GONA 1SV5B 4CEAA 4J9QA 2FSKA 4G9ZA 4DFKA 1CZAN 3MEDB 5IT0A 5LT5A 3AGKA 4CHQA 2Z30B 1KR4A 4KREA 3PTWA 5GMKa 3Q8PB 4PAAA 2QXLA 3SQ4A 4ILGB 4J9VA 4X64K 1CVJA 4Z4EA 1VJWA 3ZZZA 3TA0A 4JB8B 2ATCB 2H54B 3AO1A 4DV4F 4YOUA 3DRSA 5LMNJ 3DKDA 2CJAA 1SQEA 1HNVA 4G1PA 5F9NA 1JJ2M 3CC7N 1VS3A 3OW2R 1UFWA 3MD1A 4OQJA 1RB0A 4DR6K 2ZZMA 4QWDA 1YVFA 4KGKA