1C1CA

Crystal structure of hiv-1 reverse transcriptase in complex with tnk-6123
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 147
structure length 536
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1cA05
3DMJB 1S6PB 2ALZA 2VA2A 1RT7A 4FM0A 5D3GB 3KHGA 1ZBFA 1S10A 4J9KA 2OPSB 2X6SA 4KI4A 4O3PA 1FXXA 4Y34A 2DFHA 2C2DA 4AHCA 3T19A 4FYDA 1T3NA 4FJMA 3MECA 4CJKA 3FQLA 3WNHA 1FKPA 4KFBA 3G6XA 4TYAA 2UVVA 4I2PB 4ZVEA 2PYLA 3HPGA 3ASMA 1S6QB 4CJRA 2JGUA 4W5RA 4NLGA 4DLEA 3AA4A 5F9LA 3G10A 1Z26A 3KNAA 4CGJA 3KLEA 4ED2A 4FJNA 3AO1A 4AHVA 1N4LA 1T94A 3HK2A 4C8MA 3NMAA 4Q0BA 3H40A 3EPGA 1S9GA 2VWJA 2R2UA 4OJRA 4DQQA 2IA6A 3HHKA 3GILA 3KD1E 4ELVA 5J2NB 4DL6A 1BL3A 2WCXA 2XI2A 3NGYA 4B8AB 4QCLA 4PUOB 4KKOA 2V4QA 1KFSA 4KFBB 4TQRA 4K4WA 2JC1A 2ZD1B 3NAIA 4FJ5A 3D45A 1YT3A 3K2PA 4CE9A 3L3UA 3N6MA 3AVAA 4OGCA 1TL3A 4IKAA 3MR6A 4CF0A 4BDZA 1ZTWA 3L3VA 4QWBA 5EWFA 4YP3A 3KLHB 3QIDA 1SH2A 4F4ZA 1TKTB 3EYZA 4BE0A 2AGOA 5J1EA 4JRQA 3IG1A 4O3OA 4GW6A 4DTXA 3DLBA 3MEEB 1LW2B 3KKRA 4J9OA 3BSCA 3DI6A 1NK6A 4IFYB 1TAUA 5FDLA 4F3OA 4FS2A 5F8GA 4CHPA 1REVA 1TK0A 4KB1A 1N5YB 3V4IA 4ECZA 4E19A 4ID5A 5L1JA 3WNEA 1IKVA 2YKMB 4WE1B 2E6MA 4HCBA 3O4NA 4CJWA 4R8UB 3PZPA 3VQAA 4FJ7A 2OPRA 2UVWA 4DF8A 1RTHA 3G0ZA 2FVPA 4EBDA 3OVNA 1MU2B 5KFBA 3PW4A 1EETA 2KZZA 3SI8A 5J2QA 5FRMA 3QEPA 1WSHA 5C42A 1LW2A 3C95A 4OVLA 1JKHA 1Z25A 4DS4A 4J9PA 4FJ9A 1EXQA 4OKKA 1TL1A 3DRSB 2HMIA 2IC3B 5I3UA 3CJ4A 3Q8SB 2EX3A 4C8LA 4F50A 1JLFA 5KT6A 5FROA 4R5PB 3QEIA 1IKWB 4TXSA 5KFUA 1IH7A 2A1RA 4DTUA 4J9MA 4M95A 4BE1A 3CO9A 4CGIA 2W7PA 2B5JB 3O3GA 1RT6B 3DOKA 1J5OA 4O4GB 1DTQB 4RW7A 1D9DA 3AVKA 3SV3A 2Y1JA 4W5TA 2RDIA 4J9QA 1UWBA 3QIOA 1QAIA 3ITHA 3M9NB 3CM5A 4B9VA 4JV1A 3TWHA 3AO5A 2Z1JA 2B4JA 2IM2A 3WNFA 4Y2CA 3V9SA 1TP7A 1J54A 1LWFB 3K5LA 4ECXA 4YR3A 3Q8PB 2IAJB 2W9AA 3DM2A 4CF8A 5SWMA 4IDKB 4N41A 1BCOA 2WOMB 3PO5A 3OHBA 4YQWA 3QIPA 4XIUA 4G1QA 1SKWA 1CXQA 3U3GA 4ICLA 1TVRB 3H4DA 1JXLA 1GOBA 3OHAA 3SV4A 1QHTA 4CF9A 4YMEA 3O3HA 4RNFA 4KHNA 3CVKA 1JLAA 1RBVA 3TAPA 4NCAA 2XRIA 1RT1B 5C5JA 3KK1A 4RW7B 3GIJA 4ELUA 2C2RA 3L2WA 2W7OA 4NYNA 5J2PA 3PW7A 3MTKA 1I6JA 4M3UA 5CZ2A 2YKNA 4FLTA 3SUPA 4H4OA 2W42A 4OLAA 2FVCA 5KTQA 3UDLA 1FKOB 3TAMA 3PX4A 3ZT1A 5EU7A 1YTUA 3CYMA 2RF2B 4NRTA 5KFTA 2ILZA 3VQSA 2ETJA 3CDUA 3BGRB 3KLGB 4ECVA 3SNNA 1WLJA 1XI1A 1HYVA 1C1BB 4IG0A 4N47A 2O5DA 5EWEA 5F8IA 4CF1A 3NCIA 4BDYA 1BI4A 4CK1A 5KFHA 3SUQA 2D3ZA 4CHNA 5HBMA 4CJ5A 2JEJA 3PJXA 5DQHA 4DSFA 4DU1A 1S6PA 4CGGA 4JV2A 4R0EA 3RMAA 4BACA 3AVLA 3VQ9A 4FZZA 4ED6A 2I5JA 4KHQA 3NAEA 4B9LA 4IRCA 1CLQA 1B9FA 4TY8A 2BR0A 3TAQA 1A5VA 5J2PB 3HP6A 2ASDA 1JLGA 1ZYQA 4NZ0A 5F8MA 1A5WA 2XY5A 1SH0A 3RAXA 4E3SA 4IOBA 4K4TA 1BIZA 3H08A 3EY1A 2FC0A 5HP1A 4TY9A 5KT5A 3MEDA 3MF5A 1Y97A 3VQ7A 3M9OB 2OA8A 1XC9A 3LAKA 4CEAA 2HHUA 2YNIB 1RBRA 3WNGA 1KSPA 5KG2A 4H4MA 1XWLA 3QNOA 2HHSA 2DTUA 4I7FA 3QEWA 3G86A 4I2QB 5HBMB 2P5GA 1RYRA 4Z4EA 1LWCB 2W9BB 3DLKB 4K4SA 1JLCA 1NJWA 2BQRA 2IBKA 3GIKA 3HT3A 4CJFA 4CFBA 4ED0A 4CF2A 1I3AA 3V6KA 4KHWA 3FFIB 1RA6A 1NK0A 3I5CA 3AO2A 3I5BA 4FCYA 4EP5A 2F8TA 4N76A 2QE5A 1L3VA 4KTWA 4DSJA 3HKWA 2JLEA 1JX4A 4YR0A 1JLQB 1C6VA 2HWHA 2F8SA 2NUBA 4QW9A 3OLAA 1HPZA 1NOZA 3AVGA 2DPIA 2KZMA 4URQU 2UUTA 2OPQA 3H5YA 2RKIB 4DL7A 5KG6A 4QAGA 3M8RA 2XWYA 3CQ8A 3OYJA 5F8JA 3H59A 4ECYA 4WXWA 4DFKA 1IKYB 4CK3A 2WTFA 1CSJA 5J2MA 4O5BA 4IRKA 4M3WA 4DSIA 4IRDA 4FJIA 3C6UA 3H5XA 4JV0A 3ZSXA 4ECUA 4O0JA 3HXMA 4XO0A 1K1QA 3T3FA 3NH2A 4FJLA 1U45A 3GV8B 1VSFA 4OKJA 2FVRA 4RW4A 2D5RA 3V4IB 4DMNA 4CHQA 4DL2A 2AGQA 4ID5B 1S1TB 4AHRA 1GX5A 2HNDA 3CFOA 1YTAA 1NJZA 5HLFA 2HAIA 3KMQA 4CJTA 3LWLA 1WN7A 1U49A 4PQUB 4YFUA 1S9FA 4R8UA 4H8KA 5FRNA 4W5NA 3IS9B 3DMJA 4GC6A 1S6QA 2FLLA 4QW8A 3DOLB 3RRGA 3OL6A 3ALYA 3KLEB 4J9RA 3Q8RB 4BWJA 3DRRB 4AH9A 5J2QB 3TAEA 3MEGA 2O4GA 4O3QA 4M3RA 4E89A 4DLGA 5HROA 2GC8A 1XHXA 2F8EX 2G8HA 4HUFA 3V9UA 4KO0A 4I9LA 2VG5A 4MKBA 2BE2B 4J2EA 1NHUA 3QNNA 3OYLA 1TV6B 1HYSB 4NLYA 2HVIA 2VWKA 2R7YA 3NL0A 2HW3A 4E7HA 1HQEA 1S0NA 1IKWA 2ASLA 4AILC 3ZSQA 4FJ8A 4KKOB 4O0IA 1SL0A 1W0HA 3BQ1A 2IJNA 4GC7A 3DOKB 2ZKUA 2FBYA 4DTMA 3SJJA 3DOLA 4B9SA 5C25B 4ZP9A 2OZSA 2AWZA 1GOCA 3CJ5A 3AVMA 4RW9B 5KFCA 4DSLA 4RNMA 5CYMB 4AHSA 1VSKA 2D41A 3NFAA 1N56A 2JEFA 3RTVA 1JLEB 2HNZB 1KHVA 3OS2A 4IDKA 4CERA 5HRPA 4DS5A 4URGA 3HPHA 2FBTA 3JYTB 3MXMA 2AJQA 4ZP8A 3IG1B 4F3TA 3MEEA 3MR5A 1NJYA 3L8BA 4HKQA 3QO9B 4JS5A 2G8KA 3HVRA 4TLRA 4NLUA 4IG3A 1RDRA 4B08A 2G8IA 3HVAA 1LWEB 3CM6A 2XY8A 1WSFA 4Z0UA 1HQUB 3SPYA 4ZTFA 3ZSVA 4B3OA 1NK9A 4DG1B 1VRUA 3VQQA 5F9NA 3RBDA 4DWIA 3HYFA 2C2EA 3BQ2A 2YNFA 1LV5A 4KTQA 2DY4A 3EZ5A 3S3OA 2R2TA 3HL8A 4J9NA 4GVMA 3T5LA 5KG5A 1ASUA 4RW9A 1FKOA 1QQCA 5KFFA 3K5OA 1T05A 2PZSA 4IKFA 4LSNA 1KFDA 3CDEA 1RTIB 2HNZA 4I2PA 4FK2A 3EPIA 3VQCA 3QGIA 4K8XA 1MMLA 2XHBA 3SQ4A 2J6UA 1RDCA 1REVB 5DG8A 5C42B 2W8KA 4RW6A 3AA5X 3TAFA 4MH8A 2WB4A 4IG3B 3QERA 3NGIA 3OJSA 1JL1A 1HQUA 2HHWA 2FJVA 3NGDA 1VRUB 3V6JA 5KGWA 3MFHA 4FZXC 1NK5A 1Q8IA 1TKXB 1BIUA 4C8NA 1T8EA 3ZT2A 4Q45A 4WZQA 4FM1A 3SI6A 4XPCA 3K57A 4CJLA 1HNVB 3G6YA 2XGQA 3CJ0A 5KFGA 3V81B 1S1XB 3PVXA 1G15A 4B9MA 2VA3A 2WONB 3LP2A 1NKCA 5DG7A 4M94A 3TQ1A 4J2AA 1N6QB 3KK2B 1JXBA 1T03A 3DLHA 4O44A 3E01B 1VSEA 1KTQA 3D0PA 3AA3A 3RMBA 5EWGA 2P1JA 3GQCA 3ULDA 3QIPB 4DEZA 3OS0A 4KBIA 3F73A 5T7BA 1DTTB 4ZVFA 3AVJA 3VQ5A 4HUGA 5DMRA 3PHEA 2GIQA 3ZSRA 2W8LA 2VG7A 2JEIA 4M3YA 4RNHA 4LY7A 4ZHRA 1VRTA 3PJWA 4Y2AA 3SQ1A 4CGDA 3T1AA 3DLGA 1HARA 2WONA 2CKWA 2UVRA 3M8SA 3RRHA 1S1UB 4ECRA 1HJRA 2D0BA 4RG8A 1WSGA 4LSLB 3KK3A 4YNQA 3I0RA 4XPEA 5KT2A 2YKMA 4WE1A 3HSTB 3SUOA 4CEOA 1S49A 1S48A 4IFVB 1R0AA 1VSJA 3KLVA 5E41A 3KLGA 3OS1A 1HYZA 5SZTA 1IKYA 3VN5A 1X9WA 4K4YA 1BI4B 2HHQA 2Z1GA 3L2QA 3AVIA 4KB0A 2XCAA 2YNHB 4KREA 1U48A 3D28A 3KOAA 1NOYA 5KGXA 2HHTA 1BQMB 4ED8A 4MKAA 5CZ1A 4AHUA 5KT4A 4DTSA 1WSIA 2UUWA 3PW0A 4KV8B 1JLFB 4R5PA 4Z4CA 3B6OA 3ZT4A 4EYIB 1SH3A 2IDOA 2IOCA 3OSNA 4E0DA 4CJSA 4FJKA 2C28A 1RDAA 1TK5A 2FLNA 3UIQA 2R8KA 4K4XA 5K14B 4PA1A 1RT5B 4IR9A 3ZSOA 3RAQA 4EP4A 1RTDA 3LP1B 4I2QA 2BQ3A 2YHBA 4CFCA 4TN2A 2YNGA 4ZPAA 5CY4A 4F2RA 3BSNA 1RDBA 3DM2B 3CIZA 3NE6A 3K5NA 1BQNA 1L3UA 5KFXA 4RNOA 4FW2A 2ASJA 3M8QB 3V6HA 3NBPA 1RT3A 5KFAA 4LD0A 1D5AA 3BREA 3N6LA 3MXIA 4FLUA 3M8PA 5C24B 1I39A 4IFYA 4U7CA 1SUQA 2AQ4A 5FDLB 4X2BA 4F8RA 3RB4A 4ZMMA 1ITGA 2HNYB 3RMDA 1ZBUA 4DL5A 4I9QA 1J9AA 3JSMB 3PY8A 4WFZA 2B6AA 3MFIA 3DLEB 3C6TA 3OJUA 4CEZA 5DGAA 2RKIA 1SL1A 3LP0A 4DTPA 3LP1A 2G8UA 3RMCA 1ASWA 4B9TA 5KFSA 5CYMA 3PR4A 4UQGA 4MIAA 4TSXA 3NF9A 5KRSA 1RT7B 3QGHA 3LAMA 3BGRA 2R2SA 5EUHA 4CEDA 3KLFA 1NK8A 1EETB 3MXJA 5DQIA 2E9TA 1FK9A 4KB7A 3QETA 2PY5A 1TQLA 4O55A 3H5SA 2R8IA 4ZTJA 3RR8A 4Q8EA 2OPQB 1KHWA 1RNHA 3HO1A 3SZ2A 1EP4B 1FKPB 3Q8QB 2V9WA 4N56A 3NF6A 4ECQA 4DSEA 2KQ2A 5HLFB 1RTHB 1XR7A 4WZMA 1Z4UA 3CWJA 2IMWP 4LQ3A 3RBEA 2AX0A 2RDJA 4DQIA 4KSEB 1DTQA 3OYBA 3VQ4A 4CFAA 4Q0BB 4RNNA 3SQ0A 1KLNA 2FBVA 3V9XA 2Y1IA 3DDKA 4ECSA 3ITHB 4FW1A 3DRSA 2HMIB 2E4LA 4JRPA 2GBZA 4HHTA 4DQPA 3UQSA 3AVCA 4I7FB 5J2NA 1QE1B 1S4FA 1S5JA 1D8YA 1WAFA 4M3XA 3ZT3A 1C0UB 5JUMA 3CFPA 2BANB 4NCBA 1VSHA 1L5UA 1EP4A 1QTMA 3CJ3A 5T14A 4U6PA 4ZP6A 2FJXA 3VA3A 1RYSA 1UWBB 1TKZA 3DI6B 3ZSWA 2G8WA 1W25A 3MEGB 5KT3A 4PY5A 1EX4A 4E7KA 2DFFA 5HROB 4DFPA 3KHLA 4MIBA 3OLBA 4W5QA 4M41A 3KLHA 2IJFA 3VQBA 3DRPA 4NLQA 4PWDB 2XI3A 1TKTA 3CG7A 1A5XA 4CGFA 3CDWA 2ZE2A 3SCXA 4EZ9A 3LWMA 5J1EB 3I0SB 3OL8A 3IRXB 4LH5A 4B9UA 1L3SA 3N6NA 4WYWA 1IKXA 5KG4A 4N5SA 3CFRA 1C0TA 3V6DA 4NLTA 2XY7A 3F9KA 1BCMA 4CJQA 1S1VB 2OPRB 1QSSA 1KLMB 4TQSA 5D3GA 1NJXA 2X78A 3T5KA 3OYGA 3IGVA 3ICLA 2FLPA 1O1WA 2R2RA 1D9FA 4FJGA 4QWEA 3HJFA 1YVFA 1K1SA 1C1CB 1LW0A 3DLGB 5I3UB 4O4RA 4CJVA 2KTQA 3BDPA 3PR5B 4FK0A 4J2BA 4ZVGA 1S0MA 4B8CA 4RU9A 3VQ8A 4M3TA 5KFVA 4J9LA 4ECTA 3GIIA 3KLIB 4Q5VA 1S1TA 1DLOA 1HNIB 2FBXA 2AX1A 3L2UA 4ZVHA 4Q8FA 2QK9A 4FJXA 2GV9A 4NCGA 2RN2A 1RT2B 1IM4A 3ZCMA 5DG9A 1UAXA 1X9MA 4DTOA 2YNFB 3M9MB 4KPYA 3FDSA 4GMJB 1HMVA 2YNHA 4OGEA 3AVNA 2BRLA 4MFBA 3OL7A 2B5JA 1SV5A 3V1OA 1T05B 3UR0A 4KV8A 3SPZA 1SL2A 4ZPCA 4NLPA 5KFLA 4CIGA 2WRMA 2ZD1A 4Z4GA 1UA0A 3QGGA 1W9HA 1JLBB 4FVMA 1HNIA 4BE2A 1GX6A 1LWFA 4NLOA 2P5OA 3QEXA 3E51A 4O3NA 1RT1A 2G8VA 3D5MA 4KHRA 3OYEA 3KK2A 4DFMA 3DLRA 4KHYA 1RT5A 1D0EA 3MAQA 2R8GA 1JLCB 4KE5A 3NAHA 4CCHA 3KJVB 2FVQA 1QUVA 2JEGA 2Z1HA 2BGGA 2YV0X 3LALA 3KHRA 3TAMB 3EZUA 2VG6B 2OZMA 3ZSZA 1WAJA 1OS5A 1XR5A 3KKSA 5L1LA 1X1PA 3HPOA 3K58A 3KK1B 4CGHA 4CJ4A 4IH5A 2VG7B 4FZYA 1N48A 3O4QA 2WHOA 5KFOA 1JKHB 2LSNA 2OPSA 2CJQA 2OPPA 1N6QA 1T03B 4EZ6A 5KFPA 5CYQB 2HNYA 4CJEA 2RF2A 4IH6A 5KFYA 1U47A 3HVTB 1QSLA 3JSMA 1Q9XA 4NLVA 2I5JB 4JUZA 4LH4A 3H4BA 5KFKA 4O3RA 1U04A 5KFMA 4DL3A 1T7PA 3LP0B 1L3TA 3CJ2A 4CK2A 1VSMA 4ED1A 4CHOA 4PQUA 5HRNA 5JXSA 1NKEA 4NLWA 2C22A 2VG6A 4DQRA 3OYFA 1RT4A 4FLVA 2BDPA 4ZHRB 1S9GB 4MK7A 3SYZA 2HVHA 3MEDB 1TAQA 4IH7A 2IC3A 3FSIA 4DF4A 2YNIA 2GUIA 4MQ3A 5KFJA 1FK9B 4O3SA 2E9ZA 2OPPB 4FXDA 5KFRA 4EYHB 4LSLA 1HYSA 4PUOA 4NYFA 1WSJA 4F2SA 5KG3A 2AU0A 4CEBA 5EDWA 3S3NA 4G1QB 4Y1CA 1R0AB 4FLYA 2YHAA 1VSIA 2XC9A 2W9CB 1TKXA 4DSKA 3AVBA 4NLDA 3SFGA 4QWCA 2R8HA 4CECA 3H98A 1D1UA 3QLHB 3H2LA 1TK8A 4F4KA 1TL3B 4E1NA 1IO2A 2QKBA 4JS4A 4E7LA 3DYAB 2XGPA 1RT4B 2HHVA 2W9BA 3PW2A 2G8FA 2VG5B 4TYBA 5KG7A 3AO3A 3VQ6A 3TI0A 4K50A 4K4UA 3V9ZA 5DLFA 4K8ZA 2D0CA 3QEVA 3TARA 1C1AA 3V1RA 1C0MA 3C94A 4HYKA 1QE1A 2V4RA 3OYCA 4CESA 4RUCA 1ZETA 5DGBA 1WSEA 3PUFA 3LZIA 3NDKA 4IG0B 1ZTTA 1DTTA 5J2MB 3VQDA 1BGXT 2IGIA 1C2PA 1JLQA 4WFXA 5DLGA 4HTUA 4KHSA 3QESA 1LWEA 2D0AA 4Z4HA 4CIFA 3SUNA 5C25A 5KG1A 4QOZB 3PV8A 2V0NA 1RAJA 2QV6A 4AHTA 2Q3SA 5KFIA 4H4OB 3DYAA 4HVJA 1SKSA 5KFNA 4CJPA 4HCCA 4F4YA 3DLEA 2YNGB 2RPIA 2XO7A 1UOCA 3OYKA 2OH2A 4ELTA 2DPJA 4MK8A 3C6UB 4FM2A 3BSOA 3OSPA 1S9EB 1IKXB 1RCHA 1QAJA 3M8PB 5KFWA 3S9HA 1RDDA 1SUQB 4NLRA 4ED7A 1S1VA 1CZBA 3PW5A 4H4MB 4DG1A 3HP9A 4EBEA 4RW4B 1RTJA 1K6YA 4RW6B 4Q43A 2KFZA 3C6TB 3NGZA 3QZ7A 4DU3A 3AVFA 2HWIA 4TY8B 4OPJA 4KO0B 3FQKA 1LAVA 3KIOA 3K59A 1B92A 4HUEA 1RILA 3MR2A 5F8HA 2BRKA 3KHHA 4LQ9A 3NHGA 2B43A 3IS9A 4K4VA 3VQEA 1RBTA 5KG0A 5HP1B 4URSA 2JC0A 3KLFB 5DQGA 3KMSA 4FLXA 4E1MA 1U4BA 5I42A 2ILYA 3RB6A 2BE2A 2XY6A 3QINA 1RT2A 3AV9A 2WOMA 3P1GA 1NNDA 3E01A 5KFDA 1IKVB 2I1RA 4CEQA 1WNEA 4RW8B 1HMVB 1VK0A 2ZQBA 3ISND 4BDPA 5L1IA 3OYMA 1JXEA 1WNSA 1JLAB 4MFBB 3LANA 1RBSA 3M8QA 3OL9A 4CHYA 4KAIA 3LDSA 4EEYA 4FBUA 2R8JA 1GOAA 3TR8A 1N5YA 1ZBLA 1VRTB 4KHMA 3LPTA 2YKNB 1CZ9A 1S1WB 2ATLA 5L9XA 1TL1B 3TAGA 3TANA 1S1UA 3ISNC 2B6AB 2F96A 3JYTA 3KK3B 4NYZA 4CEFA 5DK5A 3IGNA 5HRRA 3ZSYA 4RUAA 3SFUA 1XR6A 1XHZA 2UVUA 5HRSA 1RT6A 3V6DB 2EC0A 1J53A 4FS1A 4Z4FA 1NKBA 1LAWA 2FVSA 3S3MA 4E7JA 3DRRA 1KLMA 3OYNA 3FRZA 1Q9YA 1QSYA 1VSLA 4G3IA 4OKEA 1S1WA 3GV5B 4ZPBA 4FJJA 1BQMA 1JIHA 1TV6A 3QYYA 4B9NA 2E6LA 3I5AA 4IFVA 3NF8A 5JS1A 4CIEA 3G6VA 1SKRA 1J5OB 4IBNA 4QWAA 4Q44A 4IQXA 3PX6A 2D3UA 3L2VA 3B6PA 4KAZA 1YVUA 3MR3A 5K14A 2HHXA 2KFNA 1LWCA 4FBTA 2IAJA 4CJ3A 3NKYA 4EBCA 1EKEA 1RTDB 2D7SA 1LW0B 3T5JA 4DTRA 1HRHA 2XCPA 4KRFA 4Z4IA 4ZP7A 1KVBA 3GYNA 1KRPA 3PO4A 3GIMA 1TVRA 4ICLB 2A1SA 1ZBHA 1HQEB 3HM9A 3KD5E 3GV7B 3KLIA 2IM1A 4CJUA 3LP3A 2P51A 2WK4A 1RT3B 3LP2B 4F4XA 3OYAA 1VSDA 3U6FA 3TVKA 3QO9A 1CXUA 2IS3A 3NH1A 1JLBA 2ITGA 1HPZB 2QKKA 4F4WA 4DQSA 4B3OB 3NF7A 2E9RX 3SQ2A 3I8DA 3BSAA 1JL2A 5F8LA 4DL4A 5KT7A 2IM0A 1TKDA 3HVWA 1NK4A 2QXFA 4DTNA 1JLEA 2FJWA 3O3FA 4K4ZA 4FK4A 3DRPB 1MU2A 1SV5B 3LZJA 2ZE2B 3I0SA 1C1BA 2BQUA 4LSNB 3P83D 5C24A 1RTIA 3TABA 3OYDA 3RWUA 3LPUA 3L2RA 2PYJA 1RA7A 3BQ0A 5KRTA 3V1QA 1NHVA 2HB5A 4WFYA 4OL8A 5KFEA 1B9DA 4W5OA 4M3ZA 4KTZA 3ZT0A 4CFDA 3OY9A 2GIRA 3PX0A 3I0RB 3AO4A 1BISA 2X6NA 4C8OA 3RR7A 1JLGB 3DLKA 3KTQA 3IN5A 1C1CA 3HVTA 4C8KA 5KFQA 4O4GA 2J6SA 1KCFA 4RZRA 2ATQA 3BR9A 4EO6A 4M42A 3OYIA 1HNVA 3T5HA 1U09A 1DLOB 1S1XA 3AA2A 4MK9A 1UA1A 2OYQA 1S9EA 4J9SA 4NLXA 4NCGB 3BJYA 3K5MA 5L1KA 4OPKA 2Z1IA 3H5UA 2J6TA 4DFJA 4O44B 1QS4A 5CYQA 1NK7A 1IG9A 1RTJB 1BHLA 4J2DA 4KI6A 4YR2A 3IAYA 2DFEA 4FLWA 4H54A 4ZPDA 1TGOA 4ECWA 1F21A 4ED3A 2EHGA 1C0UA 3VQPA 2IM3A 1S0OA 4EO8A 3FFIA 3OYHA 3NH0A 2W9CA 2AGPA 3RB0A 4BWMA 4IR1A 3V81A 5F8NA 3UPFA 3QLHA 5KFZA 5KI6A 3RB3A 1TKZB 4CEEA 1KVAA 4L8RB 2KW4A 4ID1A 4DTJA 4OLBA 2O4IA 4NRUA 4JLHA 4DU4A 1S97A 3VA0A 2X74A 3U3YA 5I42B 3MECB 3THVA 1RBUA 4WYLA 4FJHA 4Y3CA 1BQNB 4PWDA 4FLZA 4KHUA 1KVCA 4NLSA 5JS2A 4E7IA 3QZ8A 3NBPB 1ASVA 2BANA 4M45A 2HNDB 3IRXA 1X9SA 3A2FA 3P5JA 3KJVA 3AVHA 4QWDA 1ZBIA 4WXOA 4RW8A 4CHZA 4QPXA 3V9WA 1C0TB 4Y1DA
chains in the Genus database with same CATH superfamily
1X0FA 3ZZYA 2EFGA 3MMBB 2HQIA 4OYBA 2LYVA 4KHPF 1S0VA 1P6TA 4WTYA 1Z1ZA 2EFOA 3X3UA 3VCDA 4ZITA 4WQ5A 3H0PA 1ZBFA 2RDDA 2X6SA 2NLWA 2PEHA 3C66A 1KAZA 1X31C 2DGWA 3T19A 2DNOA 1CJUB 4BRQA 2Z58B 1RGVA 1X4BA 4TYAA 4I2PB 2PYLA 1KC8O 3DXBA 3D0GE 3OTDA 2ASMA 3AA4A 2KJWA 1B3TA 2KT2A 3FCVA 2EI5A 2NXNA 2QWLA 4AHVA 4Q0BA 1FWLA 3H40A 2V9KA 3BUZB 4H0XB 2IDLA 4Z37A 5AT1B 4YDUA 4DQQA 1R0BG 3BP8A 3EMTA 2DB1A 2LLZA 4JD2B 4ELVA 5CYJA 2WCXA 3KWGA 3NGYA 3VR1A 2ZJRQ 2XWXA 2QLXA 1KFSA 2Q31A 2ZD1B 3D45A 1YT3A 4CE9A 3BO2A 1REGX 3L3UA 3CD0A 2IPOB 1YUWA 3QT5A 3MR6A 1VC0A 4BDZA 1ZTWA 3L3VA 4A2AA 2A10A 2HLUA 3JSYA 3C19A 3FJ2A 3KLHB 4J37A 3O6WA 1RWNB 3FZBA 4BE0A 5IM0A 4O3OA 4DTXA 1K8AT 1LW2B 2QSFA 4EFAC 1ILYA 1TTHB 1NK6A 4CZEA 4O5FA 4IFYB 2BW2A 5FDLA 2N3LA 3N4WA 5F8GA 1TK0A 5AQNA 3CDBA 2ZM6K 3LM9A 3BPSP 3KG1A 1FJGJ 1NO8A 3OT9A 4WE1B 4DV4K 3O1WA 3QPIA 3O4NA 4CJWA 5U47A 1Z05A 1D8ZA 1U6ZA 4R8UB 3PZPA 4NE9C 2OPRA 1NPKA 2OHDA 3CD5A 3ENAA 5A2QY 3G0ZA 1MU2B 4CDIA 1HD0A 3R97A 3BS9A 5HVFA 3SI8A 5FRMA 2V4JA 4QU6A 1NLVA 2E5LK 5C42A 2BABA 2GFFA 1U1QA 1Z25A 4J9PA 4FJ9A 1TL1A 1Q7LB 3Q8SB 2NXJA 2EX3A 4A59A 1P27B 3MX5A 3THTA 1NMNA 5FROA 2QMWA 4P2FA 3QEIA 4OZ5A 2ROGA 2XZTB 2OTLS 4M95A 3CO9A 2WVBA 3UO0A 5C7PA 4X4NA 1RZMA 3TUIC 2B5JB 3EXCX 4CZFA 3O3GA 4WQ5C 2EK6A 1H38A 2MJNA 4ILLA 5LMNK 1YJ9N 1AA1B 2B4OA 3D6FB 4FDFA 2DNGA 3QIOA 2V2KA 3MURP 2KXFA 3ITHA 3ONQA 4NLCA 3AO5A 2Z1JA 2B4JA 3WNFA 4EU0A 2KG1A 2HMPA 1HW8A 1MROB 1TL7B 3R7NB 2CH6A 4CF8A 1S5ZA 1BCOA 1RWMB 4XIUA 4G1QA 3U3GA 1S7IA 4ICLA 3H4DA 3CIPA 4LR7A 1QTNB 3R5GA 2M9KA 4EI2A 4PPZA 1OIAA 5CABA 1VQ7N 4CF9A 3O3HA 5ETMA 3W9JA 5GAGP 1NDLA 5AQSA 3ZZUA 4NCAA 1W7AA 3UR3C 2CADA 4I0WA 1Y64A 2XRIA 1Q18A 1T95A 3GIJA 4ELUA 3MN5A 4NYNA 4OZJA 2MEWA 3PW7A 5CZ2A 4F25A 4FLTA 4FYXB 1JXVA 2DD8S 2B9YA 3TAMA 4DR4J 2DKOB 2C2ZB 2IIHA 4DV7F 3ZT1A 1WOOA 3CYMA 2RF2B 5HATA 3DLJA 2ILZA 3D6TB 1EIYB 2VOPA 3W2VA 1HYVA 4N47A 4IG0A 4ETXA 4AQYF 2F9DA 3O2IA 5EWEA 4DV7J 1X4HA 4CF1A 3NCIA 3GWCA 3OTBA 3SUQA 5HBMA 4Q2MA 1AYEA 5LM7E 5K9FA 2XSJA 4B3SJ 1K0VA 3S8SA 4E1JA 1DQ8A 4BACA 4UY85 4B9LA 5M2PA 3ID6A 3HP6A 1OYDA 2W40A 2QYCA 4ZN1A 1J2VA 3FNNA 5IZHA 2XTJP 3CJBA 1TUVA 2RIJA 2HBMA 1AXQA 3BGOP 4IJAA 3UCGA 2OA8A 1X4GA 5KG2A 1XWLA 1YX2A 3W5XA 3MAHA 2P5GA 1IBCB 5M1OA 3CCVN 2CJAA 2DNYA 4Z4EA 3CDAA 2WSCC 2W9BB 2DNHA 3DLKB 4K4SA 1YI2S 5BPNA 4DPWA 3MAAA 4YN3B 4Y2IA 4GO7X 3HT3A 4CJFA 4L72B 4CFBA 1RI7A 4KGXB 1NJIT 3M6GA 2EK1A 2AZ1A 4YDXA 1NUEA 3FFIB 2OD4A 2XYHB 3U1MA 3HLUA 2C3PA 2LQ8A 3CF5Q 3NCPA 4N76A 1GLLO 3AY0A 2MJUA 1C6VA 3T1HF 4A47A 1E6YA 4QAGA 1XMQJ 3PKMA 1SXLA 3OYJA 3MMCB 4DV6F 3M2UA 4WXWA 2B3TB 2WTFA 5AQRA 3MCAB 1IJJA 2VJUA 2QYGA 4CBUA 3HHLA 1GTEA 1BWVA 3HFZB 3ZTSA 4FXWA 1M90T 1NLKL 4C0OC 3FE1A 2O8CA 2MKKA 3ZSXA 1P9YA 5DZ7A 3ZZTA 3KYLA 4M5HA 3TP2A 1KP6A 2F8MA 3GV8B 3D7EO 2MQPA 1FI4A 4LF5F 1YIJN 2FVRA 2W6KA 1MWZA 3MPYA 1UVMA 4WYBA 5IV3A 1M5PC 4M1KA 4DL2A 2AGQA 4AHRA 3IAM9 1GX5A 2F9JA 2HNDA 4JI1J 3CFOA 2HAIA 3JTNA 2XO6A 3TZZA 4EGLA 3PTWA 5HOOA 1S9FA 5BJRA 4R8UA 4H8KA 2BUPA 1H7WA 5HMZA 5KQDA 3THXA 3OL6A 3M6WA 2DHHA 4DKWA 1V9OA 3MHYA 5J2QB 1N36K 3GJSB 1GLFO 2YX1A 3MMAA 4BR0A 4HUFA 4I9LA 2XQCA 3HD1A 2UU9J 1NGCA 1WHYA 4MKBA 4J2EA 2LQBA 2JH3A 4OLPA 3NL0A 2B0GA 1S0NA 2QWPA 2P9UB 1OPZA 2ASLA 4AILC 4M63C 4O0IA 3AOBA 5HMWA 1SL0A 1DHMA 1W0HA 4P2XA 3BQ1A 2NR0A 4GC7A 2UUCJ 1WBDA 3DOKB 2ZKUA 5IOLA 4J9UE 3LDNA 1Q81O 2KB2A 3SJJA 4BC9A 3DOLA 2P2CB 3DXMA 4BG8A 3NGUA 2ZH8A 3D1OA 5KFCA 2O67A 2O8FA 2RUGA 3UVJB 4UZBA 1KHVA 3OS2A 1N33J 1HBMA 3LL3A 4DX6A 3HPHA 1X3MA 2FBTA 2RQ4A 4F3TA 1QUPA 2E1YA 1NG9A 4JS5A 2C3MA 4NLUA 1GTHA 4B08A 2G8IA 3PYDA 1PAEX 3HVAA 3CM6A 3IFRA 3BH7B 4F9OA 5CHIA 4B3OA 4X4VA 5F9NA 1U1MA 2HRYA 2ZH9A 4Z94A 5A76A 3KZBA 2FB0A 2YWKA 1B99A 3AQPA 3LDLA 4LRCA 4JHDA 4RW9A 1QQCA 1ZM9A 4OI3A 1BG3A 3K5OA 2IVNA 4DV7K 3N5BA 2PZSA 2BACA 4CBXA 3OW2M 4FK2A 1OKJA 3VQCA 2DNNA 3QGIA 3W2VB 2FUG9 1AB8A 5C42B 2HKEA 2W8KA 3AH6A 4NEZA 5AQQA 3H2UB 5E7OB 3OJSA 4XDCA 4PYDA 4IO9L 3NGDA 1VRUB 2FF6A 1NK5A 1Q8IA 3JTOA 5IT9Y 4X62K 4ITSA 4KYZA 3TZYA 3TPQA 4Q45A 2E2QA 1IR0A 4FN5A 2N7CA 1HNVB 3G6YA 1VQ9N 1FW6A 2XGQA 3CJ0A 2DO0A 1G15A 5A6WA 2HURA 2A0FB 4LFBJ 3HM8A 1A0OB 3QAEA 3J7AP 1N6QB 1U0SA 4GVBB 1XMQF 2G1HA 3D2EA 4EIAA 3DC2A 4O44A 3ZX3A 1KTQA 3AA3A 3C7NA 4XDDA 1MNEA 3NCQA 2YPYA 3ZLJA 7FD1A 2P1JA 3GQCA 3ULDA 3KWIA 4KBIA 1G99A 1W7WA 3G6EN 3AXKA 3AVJA 3NWRA 4P10A 2PD1A 3H3NO 2W8LA 2VG7A 4PKIA 3U27A 4RNHA 4LY7A 3RG6A 1XMOK 4ZHRA 1GAOA 3FKBA 1VQ6S 3PCOB 2QEXS 4Y2AA 1WF2A 3FCHA 4CGDA 1MMDA 3LDPA 2C3YA 2CKWA 2FC9A 4DV1K 1S1UB 4JKGB 4DPOA 3SCKE 3DXKB 1YJVA 1XNRF 4LF8F 3KK3A 2CGKA 2RUSA 4LF5K 1HBNA 3TO8A 1GXUA 2YKMA 1QVFM 3ETMA 2GEMA 3U4LA 5H9EK 1HIYA 1VSJA 1WUUA 3PDNA 3GG4A 3KLVA 3NVMA 4ZJOA 4EFHA 1HWIA 3R7SB 4K4YA 1VI7A 3ENOA 5D77A 2HHQA 2Z1GA 3AVIA 2MQMA 2YNHB 1U48A 2JNJA 3D28A 3KOAA 3UDCA 4OPAA 1L3KA 4CYUB 5CZ1A 4LF2A 1TELA 4JV5J 1QLNA 2A41A 4KV8B 2HHHK 1S7HA 3M05A 3C46A 1KQFB 3QQCD 4ZVSB 2W1BA 2HRTA 1SH3A 5EHHA 4U7UD 2YHWA 4WKYA 5C2DA 2X1GA 2C28A 3N0VA 1BC6A 3G71S 1U1LA 3UIQA 4OX6A 3RU0A 1SJ3P 1UJ6A 4JYAF 3Q8UA 2NRTA 3EZOA 5AQXA 3N79A 1VCTA 3OFGA 4I4BA 4EP4A 3CNQP 2Q3PA 4OMFG 2VQFF 4CFCA 1Y3KA 5CY4A 3BSNA 1RDBA 1M1GA 2UXDF 1JB0C 1VQ5N 3O9QA 3UD5A 4IOCL 4G6VB 3FEXB 3LF0A 3P8BB 2UXCF 2WW8A 4EHUA 1FNOA 3MXIA 4FLUA 1I39A 2KVIA 1SUQA 3P38A 1SJ4P 3BZQA 3IM9A 3CJ8A 4U7BA 4F8RA 3VZIA 1CULB 2PO4A 3QAUA 2E2NA 2ZDOA 2UUBF 1NGHA 3RMDA 4GY2B 1UAWA 5D6GA 1KVKA 4K0KK 5DGAA 2KT5A 5F3TA 3P31A 4YEAA 4X4SA 4ZK7M 3LP1A 5JJBA 2ADCA 1FCAA 1OQ6A 2GS8A 2VGMA 1J5EJ 4TKTA 4GVLA 4UQGA 3A8IA 2OFGX 3UD4P 3NF9A 1XC3A 2IIRA 5LJ5Y 2JLFA 3LAMA 5EUHA 3KLFA 1H7XA 3MXJA 3C15A 1GLCG 2F4VJ 3T1HJ 3S6EA 3QETA 3VEYA 1PYOB 2PY5A 3ZX0A 2YKAA 3UN3A 1LWXA 3UDVA 1VQ5S 3RR8A 4Q8EA 1VC5A 2Q36A 1KOOA 2VFUA 1JJHA 5I9EB 1EP4B 4BRCA 5F3ZA 1EKSA 2V9WA 2Y8YA 3E2EA 4N56A 4ECQA 2KQ2A 1XR7A 4WZMA 2GTDA 1Z2LA 2IMWP 2PC6A 1RJJA 2CVIA 4R25A 4KSEB 1O13A 5C0YA 1WF1A 3CD6N 3OYBA 1OH8A 4JI4F 2G0IA 3ZX2A 2DO4A 1B7FA 3O3LA 2Y1IA 3V9XA 1NZ8A 2MLYA 1S76D 4JRPA 2GBZA 5IT9U 3AVCA 2GVZB 3CJRA 3WQPA 1EHWA 1S4FA 1S5JA 5CHCB 1D8YA 3RW6A 2HGLA 4MDAA 1VAZA 3ZEUA 1C0UB 2Y9HA 3CJ3A 4WP3A 2UXBJ 4V19S 4ZP6A 2FJXA 5EXWA 1SC3B 1RYSA 3TSUA 5G0RB 2P9PA 1W25A 5EVZA 4DFPA 2MY7A 3HI0A 2V8PA 1SIZA 4QR1A 3OLBA 5ADXA 4LIRA 3TWZA 4W5QA 4M41A 2GZOA 2IJFA 1FRHA 4CI6A 3CDWA 1XQIA 4C3LA 3IRXB 2AT1B 2Q2RA 3NY0A 4WYWA 3CMAN 1RAAB 4DV6J 4DV1F 2QL9B 3CFRA 2JDJA 1C0TA 4NLTA 1RISA 1LFPA 1BCMA 4CJQA 1S1VB 2OPRB 1Q79A 2F1FA 2WSFC 1KLMB 2P6TA 3SBTA 4KPCA 4ETZA 1T9VA 2X78A 3ET6B 3T5KA 3IMXA 1O1WA 1UEUA 2R2RA 2N4CA 3P4UB 4QWEA 2E7XA 3HJFA 1YVFA 1K1SA 4KH4A 3GSDA 3QJPA 4JK9A 2XMUA 1VQ4S 1SQKA 2E20A 4JP8A 1VBZA 2F3JA 2A3JA 2KTQA 4BC5A 1S0MA 3W62A 4M3TA 3K89A 4K5SA 2DXEA 4QYZK 2QWNA 2NYIA 3W66A 2AJ4A 3WIUA 4Z7CA 4M8LA 4PWWA 1CZAN 4BQLA 5M2UA 1X9MA 3M9MB 3UDEA 2W01A 3M8WA 2YNHA 2IMOA 3AVNA 5HANA 4MFBA 6AT1B 1PILA 3TRGA 1Q5YA 2MQLA 3UR0A 5IM0B 1ZC6A 4KV8A 1TMJA 3SPZA 2KO1A 3GTYX 1VQ8S 5KFLA 1H74A 2DJWA 2W25A 4X64F 2ZD1A 4LFAK 4FNIA 4FYVB 4PL7A 3CETA 2OSQA 2VL1A 3CJCA 4BE2A 3Q89A 5I3QA 4OHYA 1CJKB 1O8BA 3E51A 2YI1A 2G8VA 1YXQA 2LA6A 4DFMA 2ZOMA 3PEHA 1TUGB 1NBEB 2ATCB 3V4MA 2R8GA 1JLCB 1H2UX 1HWJA 3DN9A 1M90O 2JEGA 4BRNA 4JI5J 2YV0X 3KHRA 4DUZF 3GONA 3EZUA 2VG6B 4CIOA 2OZMA 3EDQB 3Q7CA 2QL7B 4DV2F 2P9KA 2DNZA 4O8UA 4F26A 5IC4B 1X1PA 3KK1B 3UKUB 4FZYA 3D6RA 3O4QA 5LOQA 1YG0A 1WD6A 1CC8A 1N6QA 4GVBA 1R31A 3MTJA 1AUSL 1MLAA 1N34J 2UV8G 3R3LA 3CC7N 4QIEA 2HRUA 5F1XA 1Q7YT 1U47A 4OJGA 2I5JB 1FNMA 4LH4A 1QQMA 4O3RA 3MCMA 1FNXH 4DL3A 3LP0B 4JI8K 1HBOA 3CJ2A 2UXDJ 2QG9B 1N36J 4PQUA 5GAEU 3CF5L 3K0JA 2JLGA 2R7VA 4TVAB 4DQRA 5DDRC 2CGJA 4FLVA 2UU9K 4FYWB 5LMNF 4ZHRB 1S9GB 3BBBA 4IH7A 4CZMA 1EARA 3MCSA 4MQ3A 1RP5A 2HFVA 1FK9B 4YB5A 3J7A1 1BQXA 4FXDA 3I87A 5KFRA 1G2EA 1LOTB 2P9LB 2G0CA 3CCMN 4EAHD 5CCLA 1RHRB 5EDWA 3NGTA 3S3NA 4LF8K 3MWTA 4Y1CA 4FLYA 1UJ5A 2XC9A 1TKXA 2W9CB 4DSKA 3MCOA 3AVBA 1XBWA 4NMXA 4DX5A 2ITMA 2F40A 2E5LF 4JS4A 4DZ6A 3K9KA 2NREA 3WC2A 4USIA 4H4KC 4TYBA 1X4FA 2I7PA 1RHJB 1N36F 2D0CA 5JVHL 2BUNA 2WW4A 1FHTA 4OI2A 2A2DA 2IA0A 3EE9A 4HYKA 1F5AA 2W2MP 4CESA 1ZETA 1WSEA 3LZIA 2Y0BB 5AE1A 4BCAA 1LXJA 4P73A 1DTTA 4ATNA 2B4PA 2ADBA 1J5EF 4KHSA 4USJC 1LWEA 1RBOB 1WOQA 3F56A 4JYAK 2DNKA 3Q2SC 1IBMF 1AW0A 1YRUA 2YQ0A 4AHTA 2Q3SA 4H4OB 4FWLA 2EG1A 3DLEA 4M5DB 4QS8A 1AT1B 2G1DA 2QA4S 2BM0A 2K06A 5TKWA 3OYKA 1N5VA 4MK8A 3RBXA 4DMZA 3BKFA 3O9UA 1YDLA 2CQ4A 1RCHA 2QXLA 2W2OP 1RDDA 3EZWA 1NGBA 4WU2A 2V69A 3CD7A 3SXLA 1S1VA 2RS8A 3ZO7A 1CULA 1BA0A 3R6MA 2CZ9A 1BWFO 4LVNP 1GLBG 4DN0A 5M1KA 3H1QA 4EBEA 4RW4B 3HP9A 3DU5A 2GHWA 4HACB 2CQ0A 4B3MK 3AVFA 1FJEB 3FQKA 4FZVA 3JXUA 3KIOA 5D15A 4LFBF 3NHGA 2B43A 4OZ0A 1Q0NA 2XHWA 4K4VA 3Q0AA 3SSSA 2C2OB 3EJMA 1YI2N 4USMA 3KLFB 1ZZFA 3CCLN 3KMSA 4P72A 3SSQA 4USWA 4DUTA 1FRIA 2ILYA 3OXGA 3EE8A 1Q82T 5LMUK 3QINA 2VFSA 3AV9A 2WOMA 4BLGA 1NNDA 3PACA 1YJWN 1IKVB 2I1RA 3JSRA 4AM7A 4K59A 2ZQBA 5MLCV 5RUBA 3OYMA 1JXEA 3CPWR 1VQKN 4MFBB 1PIEA 1ACMB 2Q97A 2NPFA 2KHDA 1RBSA 4ZOSA 3MM9B 1UCNA 2ZH7A 1K47A 4KAIA 5AQGA 1PO6A 3LDSA 4NI2B 1VRTB 5E5NA 4CZCA 1VQLN 2EFPA 3TAGA 3TANA 4CLPA 1RAHB 3MZIA 3IWXA 1NSPA 4LF5J 3CCLS 3W60A 1HWKA 1CQNA 5DK5A 2QI2A 2AIRB 3IGNA 5HRRA 1XR6A 1GQEA 2UVUA 2I0XA 2EFNA 4DR1K 5HRSA 1RT6A 4LF1A 4YY3F 4Z4FA 3TX8A 4LR9A 4ZIVA 3TSPA 1LAWA 2FVSA 5HL7Q 4E7JA 1KLMA 3BGLA 3OYNA 2VHGA 3DAWA 3FRZA 2DR7A 3ATVA 1HFEL 3G71N 2HLTA 4LF6F 4B1YB 3T9NA 2HSTA 2E6LA 3I5AA 1VQMS 4A8WA 3TYTA 1KONA 3NF8A 4Q44A 4NXMJ 2VU5A 1SJ1A 2VQFJ 2EKYA 4PL8A 4M5NA 3MEKA 2ZWPA 5AQVA 2ZHAA 3B6PA 4DR2F 1NGEA 3WXJA 2IDEA 1SQGA 5DDPC 3R8EA 5JVGL 4JI0F 2IAJA 3GZ7A 4EBCA 3OTOJ 3QMQA 1LW0B 3T5JA 1HRHA 2AJ2A 4BRMA 5L38A 4JKCA 4ZP7A 4C8YA 3MM7B 1KRPA 5K8NA 5ITHA 2ZH4A 1ZBHA 3IMQJ 3UNGC 3GV7B 3KLIA 5GAHP 4CJUA 2P9SA 1JCFA 1QAXA 2AW0A 2V5HG 1NGFA 3LP2B 3OYAA 3U6FA 1VIOA 3NMRA 3NH1A 4X4RA 4CW7B 1AZSA 4LUBA 3M4XA 4GO5X 1I94F 4B3OB 3BSAA 3I6PA 3THYB 1NK4A 4LSZB 3G4SN 2HZCA 9RUBA 4DTNA 5HQLA 1BE4A 2ACMA 4FK4A 3TTFA 2KU7A 2YX6A 2NUHA 2BQUA 1FX4A 1RTIA 5D8HB 5IFMA 3GR1A 3HX9A 1XMBA 3OXFA 1PGZA 6FD1A 5K8PA 4W5OA 3TX0A 2GIRA 3CT9A 2X6NA 5LXRA 1S3XA 3POTB 3SDEB 2W4CA 1NAQA 4XK8C 1F2HA 1C1CA 2ERRA 1CPZA 1FWPA 1RU1A 1RGIA 2MZRA 1WOPA 1FE4A 2H3GX 1IBLK 4CD1A 1U1RA 2FIUA 1Z2ZA 3CMQA 1HNVA 4KR0B 3JB9k 3MMAB 1YTYA 4HHUA 2CPJA 4MK9A 1JJ4A 1S9EA 3B78A 4MLEA 3TTDA 2D9OA 2RILA 4K41A 1VQON 4EMDA 2G2ZA 3H5UA 3CMAS 4O44B 1QS4A 4IOAQ 3HT0A 1NK7A 1BHLA 1JCGA 4J2DA 4KI6A 2DFEA 3VQPA 2IM3A 5K20B 3OYHA 4IUFA 3OHRA 2W9CA 3O8WA 3RB0A 2AGPA 2XSFA 5G4DA 1RK8A 1X5OA 3QLHA 2DEIA 1TKZB 2RT3A 3A1YG 2KW4A 4ID1A 4DTJA 3J80O 2HBQB 1S97A 3VA0A 4GKJJ 3U3YA 3UVJA 2CZVC 5AXMA 1BQNB 3A13A 4ZCLA 3IAS9 4E7IA 2BANA 1FXLA 6FDRA 1HKAA 3GIRA 1NEEA 3KJVA 2UUAK 4DUYK 4FPRA 2E8AA 4WXOA 5IQ6A 5BR8K 2QMUB 3V9WA 3DMJB 1YJUA 2ALZA 4Q2LA 2Y1LB 4FM0A 5D3GB 4LBIA 3LGMA 3B8AX 4B3RK 1JJ2R 2DNLA 4J9KA 3U9ZA 4LR8A 2OPSB 1SS6A 4KH0B 3L7PA 1FXXA 4Y34A 4G9ZA 2DFHA 2FDNA 1HBNB 4CJKA 4CT8A 2CQBA 4ZVEA 2VFTA 1VQ4N 3UWTA 3ASMA 4C48A 4X62J 4DLEA 4J5OA 5F9LA 3G10A 5BR8F 1HNXF 2UUAF 1T94A 4DUYJ 3THPA 3UNYA 3EPGA 3KUHA 3O5TB 2UUCF 4OJRA 3J80U 2FJAB 4C8ZA 5B0GA 1BL3A 4RWXA 4C3KA 3J81O 4HH1A 3JXOA 2YBVA 4DJBA 3C14B 1M5SA 2V4QA 2EFQA 4TQRA 1I1GA 5C2FA 1GLAG 3AVAA 4OGCA 3HHDA 1KS2A 2FHJA 3G82A 1CJVA 1FVSA 1R89A 3CO0P 1G1XA 4X64J 2QA2A 3AD8C 2K3KA 1TUUA 1CG2A 3WEEB 3UN2A 1RACB 3EYZA 3UKRB 4DR3K 4JRQA 4ZVPB 3KKRA 4J9OA 3DI6A 1Y3JA 3BKTA 1TAUA 2OELA 1BOTO 4YHHJ 2EW9A 4F3OA 1WELA 4ES3A 1U7LA 2Z56B 4FS2A 5LT5A 2J7KA 4CHPA 3U9DA 1REVA 4GRSA 3N9UC 1T9XA 4RR5A 2FSJA 4ID5A 3JQJA 1NNEA 3M1VA 3DDNA 3WIVA 4OZ2A 4M5LA 4ES2A 3C8YA 1Z6RA 3VHQA 3VQAA 2CH5A 2VDHA 4FJ7A 1RTHA 3CIMA 2J7UA 2FVPA 3OVNA 2X1AA 2DIUA 4L3KA 3VERA 5E26A 5ETVA 3NNCA 1LW2A 3C95A 1VJQA 5CAAA 5FLXU 1HHSA 1X0PA 3EE3A 3N5FA 3WZ0A 1UL3A 3E3XA 1EXQA 2DNRA 1FVQA 1PC4A 4F50A 2A1BA 4TXSA 1F9EB 2FSNA 1OY9A 5D0RA 1WC4A 2W7PA 2PN6A 4JK7A 1XEZA 3O44A 5AR0A 1RT6B 4KGMA 4BRKA 3V5RA 1D9DA 2Y1JA 4OHXA 2IJRA 1QAIA 4FP9A 5C10A 4D3GA 1BA1A 3FBFA 3TWHA 2IM2A 5CH7B 3V9SA 1TP7A 1J54A 3MCNA 4CO0A 3K5LA 3Q8PB 2IAJB 2ZH6A 3C65A 4N41A 1T9TA 4YQWA 2VICA 3QIPA 3CJKA 4JI6F 5ADZA 4LF9K 3OHAA 3SV4A 1QHTA 3A12A 1QZ6A 1S22A 4ZLPA 2I2YA 1TZ0A 1EKRA 2LXIA 3MN7A 3ZFVA 3K0SA 3MTKA 4AFFA 1VQ7S 2HGMA 2RSQA 1IQZA 4J91A 2FVCA 5KTQA 3UDLA 1FKOB 3H25A 1IJEB 5B0BA 4JN4A 1HPMA 5KFTA 3VZHA 4USTA 2NRRA 3VQSA 4A62A 2QWOA 2QLJB 3N01A 1IBLF 2OMOA 2NYHA 3CMES 2IY5B 5F8IA 4BDYA 4LIWA 1BI4A 4CK1A 2XM3A 2DCUB 5BN9A 2D3ZA 4CJ5A 4H0TB 3NP5A 2JEJA 2AD9A 1X4EA 5DQHA 4DSFA 4DU1A 1SQEA 2GAHC 2LU1A 3MAAB 4MDBA 3K2YA 4ILJA 2V50A 3M32A 1H1VA 3VQ9A 4FZZA 4BRLA 4KHQA 4F67A 1B9FA 4TY8A 3VTHA 2BR0A 1A5VA 2GV1A 4I68A 2XY5A 3H2VE 1SH0A 3RAXA 4E3SA 5AFUH 4AL5A 1BIZA 2Q79A 3ELHA 3HD2A 2MQQA 2FC0A 4E8UA 2QMXA 4TY9A 1WEZA 3M9OB 5A8KB 3GFXA 4PG4A 2HHUA 2YNIB 2MZSA 2D74B 3CC2S 1CJKA 4I2QB 4BVOA 3EICA 2BTFA 5HBMB 2NPIA 2VZ9A 2XSJB 1YBAA 1LWCB 2YQ1A 3CCWA 1Y5LB 1HLUA 2IBKA 2EG2A 2IVYA 4DDFA 3VETA 4CLYA 1I3AA 3V6KA 2V94A 1RHQB 2CWKA 1X4DA 2PBDA 2JHEA 3AO2A 4RTFD 4A8SA 3I5BA 4JKBA 1R8AA 2P8IA 4A8YA 3C14A 2F8TA 2QE5A 3J7AN 1U25A 2DR8A 2NSBA 2JLEA 1JX4A 1JLQB 5A8WA 4QW9A 3NLCA 3JS9A 3OLAA 3HZ6A 2KZMA 2UUTA 4RKUC 4DL7A 3G82B 3E9LA 2P9IB 5EX0A 5AJ3F 1U8WA 3AOAA 3MCPA 4DFKA 1IKYB 2Z2MA 1CSJA 3NVKA 4ZLLA 3DGPB 3PSFA 4FJIA 4JYAJ 3H5XA 4YOTA 4JV0A 4AF1A 3T1HK 1K1QA 3CCUS 3HI9A 1U45A 2YWEA 5E3CA 5EX5A 2HS0A 2MKJA 3NWGA 3OFEA 4OKJA 3NMUA 2ZGZA 4DX8H 4USVA 2JZ5A 2L9NA 4H0YB 3EUNA 3PHTA 4WFBQ 4I56A 2DNMA 2P9UA 4Z7YA 2QC3A 3LWLA 2FJEB 1N34F 1U49A 3HOSA 4PQUB 4C7QA 5BR9A 4YFUA 1X9JA 3SK3A 5FRNA 3IS9B 3DMJA 4JI0J 4B17A 2FLLA 3ILOA 3DOLB 3RRGA 3QWUA 4BWJA 2Q1NA 3DRRB 3R2DJ 3A3PB 4AH9A 2XULA 4AXJA 3MEGA 3R1LA 2O4GA 4M3RA 4E89A 5HROA 4LFAJ 4IEEA 1KD1T 2F8EX 3TZWA 3VGTA 1AROP 4K7QA 3PXGa 1NHUA 3MI7X 1TV6B 2HPUA 5D4OA 4M5MA 2HVIA 1Y5IB 2IHR1 4E7HA 1NU0A 1HNXJ 1IKWA 2K7JA 3QB0A 1GEHA 3CCMS 4FJ8A 3DHWC 3W5YA 4DU8A 5AE2A 2HQGA 3THWB 4DR6J 2IJNA 1CBKA 2VCPA 1LQ9A 4DTMA 3G2XA 3MOZA 2OEMA 4ZP9A 1T9WA 2AWZA 2KDOA 1GOCA 4FL9A 3AVMA 4RW9B 1WWHA 4DSLA 3UCZP 3KFWX 5CYMB 2JEFA 1VGYA 1NMEB 2V68A 4CLZA 3IBFB 2JL9A 1Q7YO 3JYTB 1OVQA 4Y0FA 3HHLC 3IG1B 4U9RA 4NZ6A 1CJTB 2HQFA 2B9EA 4DZDA 3JSBA 2MXYA 4TLRA 1LWEB 3PJ9A 2YWGA 3A8YA 3S1TA 5GAEI 3FSXA 1PC5A 4ZTFA 4W90B 1NK9A 1VRUA 1RCOB 3M1FA 3HYFA 1Q86O 3GG0A 2OCEA 3EZ5A 2M88A 5A6PA 2R2TA 2ZUGA 4J9NA 3CCRS 5JICA 2PA8D 4GVMA 5LJVA 1NB2A 1Y00A 5KG5A 1ASUA 1FKOA 4RCHA 4B1WB 1V6HA 1T05A 3MMVA 7AT1B 4DQ8A 2VQFK 3QICA 4CM0A 4GV6A 4I2PA 5B0EA 1IBMK 2R7XA 5DG8A 3SLCA 1YRXA 2C2NA 1PBUA 4RW6A 3AA5X 2IYGA 2K2PA 2R3VA 3TAFA 3QSIA 3NGIA 1KWMA 2KRRA 1JL1A 1OWXA 5FD1A 4UOGA 2HHWA 4TNOA 4F04B 1WORA 2FJVA 3BDEA 3MK6A 4C6AA 3P6YC 1VR6A 1TKXB 5EN1A 5DDOC 2AJ1A 5ETSA 1T8EA 2CJBA 2DNPA 3ZT2A 3OVAA 4WZQA 4FM1A 3SI6A 4HHJA 4OJ3A 2XS2A 1RABB 4V1Ak 2MSTA 3MGJA 4I6YA 3PVXA 2VA3A 2WONB 3LP2A 4JI5K 3C6HA 2RD5C 5E3PA 2YJFA 1IWGA 1KC8T 3TW0A 3EM1A 3HBTA 3E01B 2ZC3A 4NX9A 2FY1A 3F41A 1X4CA 3GYXB 3RMBA 1K73O 4AL6A 3QIPB 4DEZA 3RUBL 4DCJB 1XNRK 1DTTB 5DM6Q 1WTBA 2B4UA 4PEOA 1V4TA 4XEIA 3VQ5A 5DMRA 1GK8A 2BXJA 4M3YA 1JK9B 3LUYA 3UB5A 1VRTA 3G9CA 2I9SA 1QQOA 2PMHA 3U1LA 3R5CA 4JI5F 4JEPA 2HQCA 2Z2ZA 2RRNA 2EWHA 3M8SA 5F2RA 3KUGA 3EEQA 4RG8A 1WSGA 1BHNA 2LEPA 4YNQA 3E8OA 5KT2A 3HSTB 1S49A 3QATA 3W3SA 1R0AA 2DRBA 5E41A 4LJMA 4Y00A 1RLCL 4LMZA 4EUVA 5BYSA 1U0HB 3GU0A 3CCRN 1BI4B 2MZTA 1KBRA 3L2QA 4KB0A 2XCAA 4BG9A 1YJRA 1RAGB 3I55N 4KREA 2QSWA 3MPDA 4NLBA 1W2BR 1NOYA 3K8WA 5GMEA 5KGXA 2HHTA 3C0BA 5IXUA 3ILIA 2FZGB 1TYQA 5KT4A 1WSIA 2UUWA 4U8VA 5IT0A 3D7SB 4IO8A 4R5PA 4ER8A 1IJFB 1U1KA 1WSVA 3GE9A 2IDOA 3OTOK 4FJKA 3VOVA 2DR6A 2FLNA 1R6YA 5B0CA 2ZWOA 1B0VA 4IR9A 3ZXWA 3ZSOA 1YJNS 1NZAA 3LP1B 4B1UB 4HL9A 3CJAA 4DPUA 3SAGA 5DO2A 2HHHJ 3ENBA 4F2RA 2VBYA 3CIZA 1N0VC 4BR4A 3GFYA 2RNEA 4DBQA 1U1OA 2O1PA 4FW2A 4DPYA 3T1YJ 3P39A 1B0TA 1RAFB 5KFAA 4LD0A 2HIYA 3N6LA 4LF9F 5BPLA 2AQ4A 2E2PA 3RB4A 3AAQA 2KXNB 3DU6A 4UZCA 3CC4N 4ZDNA 4DL5A 4I9QA 1J9AA 3PY8A 2B6AA 3MFIA 3M5RA 3B4MA 4L6V3 1R6VA 1W2IA 2RKIA 2CQDA 5ETKA 1SL1A 4LT6A 4JI8F 2BJ9A 2E5LJ 1ASWA 1OO0B 4N8OA 3GP9A 2QTDA 5KRSA 2DHGA 1BXNA 2QN6B 3ZNUA 1RT7B 2VQEF 3PSIA 1P1LA 1UFWA 2E9TA 2HFZA 2EPIA 3GG1A 5IWAF 3HRGA 5LJWA 4KB7A 4KGZB 3IO1A 4PZVA 1T44A 4OJHA 4E98A 4O55A 4UOFA 2R8IA 2A6OA 4B3SF 2D0PA 2DTJA 3HO1A 1XUPO 3SZ2A 5AQLA 1FKPB 2ZF5O 3VVTA 2F4VK 2OANA 2FF3B 3G96A 3ULEA 1P8ZA 5HLFB 2CXEA 3H8YA 1Z4UA 4LQ3A 3DFEA 3OR1A 2AX0A 1IWAA 4DQIA 1T9UA 3VQ4A 4Q0BB 3S01A 4RNNA 4JI3J 2Q43A 4ECSA 3ITHB 2VODA 3OPKA 2E4LA 1UKUA 4DQPA 3UQSA 3E1YA 4OFZA 4I7FB 3OBWA 3TJAA 3AA8A 4OX9F 4BBYA 5AQYA 2O8BB 2YQ3A 2NQPA 4A8QA 2A42A 3CFPA 2BANB 3JTPA 1EP4A 4UY8O 4DCHA 4NWBA 4BRFA 3NS6A 1HR0K 2J0WA 4JI2F 4KGVB 3QT8A 2W4DA 4DN9A 1T6CA 1UWBB 1TKZA 3DI6B 2WVDA 1X5SA 2VC0A 2G8WA 5LL6d 3MEGB 1I51B 3I8BA 1EX4A 5HROB 4MIBA 4U95A 4E2FB 1Q86T 4HHHA 2ZVSA 5CCMA 3KLHA 3VQBA 3DRPA 4NLQA 4AUKA 4PKDB 3NNAA 3BZCA 4CGFA 2GMHA 2Q0RA 1PJ7A 3SCXA 1MWQA 3LWMA 3WQUA 4LH5A 4B9UA 3VMFB 4J9VA 2PMWA 1WF0A 2FZCB 4TU7A 4WIQA 4YB7A 2XY7A 3F9KA 3EVWA 4P71A 4U8YA 1QSSA 3THWA 3BEGB 3G8SA 1NJIO 3IGVA 1D9FA 1RWUA 5B08A 3R9PA 5CZVA 3ZTOA 3D6MB 2LXFA 1PSDA 2RQKA 1XMQK 1IV0A 2HFOA 3QRRA 2HFUA 5KFVA 4J9LA 3GIIA 4C4WA 1RBLA 3AB4B 2FBXA 2ASYA 3OR2A 4H0OA 4Q8FA 4FJXA 5HVHA 3BKUA 4RUBA 1ZM3A 4QQBA 2RHQB 1S79A 1UAXA 4CTAB 1VC6A 2WFBA 2M7SA 3FDSA 1TFWA 1HMVA 3A8KA 4BRAA 2N7YA 2V2VA 2W2PP 1RAOA 4KBOA 2BRLA 4B3TJ 3L4IA 3GE1A 3TA2A 3WEEA 3V1OA 5GIPA 1T05B 5ELZA 4DR2J 1SL2A 2OO4A 1ZBSA 4ZPCA 3US5A 3A5OC 1SB6A 3TVYA 5AQWA 4Z4GA 4ZVQB 1W9HA 1X5TA 2R4FA 1PJ6A 1GX6A 1LWFA 2H51B 3SQOP 2NSCA 2P5OA 5GMKa 3QEXA 3Q8YA 4CZJA 4KHYA 1D0EA 1HNWF 5J1PA 2MGZB 4K8RA 1QY7A 2N3OA 1QUVA 3BZKA 2Z57B 2NCKL 2KXHA 2ZHOA 4OYWA 5ETNA 2O3DA 4WF9L 3HPOA 4DR6K 2XMJA 2FZKB 4IH5A 1WG1A 1F0XA 2WHOA 2G13A 5KFOA 1JKHB 2OPSA 2CJQA 2BE7D 1T03B 2MSSA 4FVCA 3VGVA 2HQDA 3H46O 5CYQB 4CJEA 1R0CB 5KFYA 3B54A 3WXKA 5T7LB 3HVTB 3JSMA 4WFNL 1Q9XA 2WBMA 3NNHA 2O8EA 2CDRB 4NLVA 3AD9C 3IP0A 3H4BA 4MMOA 1WC6A 4CK2A 4ED1A 4CHOA 5AFUA 4JHDB 3PG9A 5JXSA 2X1FA 1YJTA 2O8CB 2ZM6J 2VG6A 1XNQJ 3A8JA 3OYFA 1RT4A 3JQMA 3IUCA 3CJ7A 2H48B 1F60B 5GAEP 3RRKA 2YNIA 2MKYA 2GUIA 2G2YA 5KFJA 4RBVA 3UE2A 2MY8A 4EYHB 3E9OA 2VBWA 3CD6S 4PUOA 1WKLA 2XS7A 4NYFA 1WSJA 5KG3A 2VIHA 1NMDA 4CEBA 4QS7A 1R0AB 5KPRA 2WC9A 4IWVA 3H98A 3H2LA 2CDQA 3L4QA 1N5TA 4E1NA 1IO2A 4DR7J 3KJFB 1C4AA 3VAKA 2MZJA 5I4MA 3R6LB 3J7ZT 2W9BA 2DISA 1VMBA 3AO3A 3TI0A 4K50A 4K4UA 2OTJS 3V9ZA 4RWTA 4UUXA 3VEOA 3VALA 2K3IA 3TARA 2RJZA 4CO1A 3J7YI 1QE1A 4BC4A 1W2BM 1N33K 4RUCA 3QWPA 1HBMB 3PUFA 3HSCA 1RU2A 2BE9B 2KYXA 2QLBB 4BC2A 4FWNA 3SMPA 3D0IE 1ZTTA 3ZTRA 2OEKA 2F7VA 2HEKA 5DLGA 4Z4HA 3SUNA 3D4JA 5KG1A 2Q6BA 4FOEA 5BYQA 3PIPQ 3D2FA 3DYAA 5FPDA 1SKSA 5KFNA 4CBWA 3I4PA 3GOIA 1IN0A 2CNOB 1KXPA 2QRRA 4DR3F 2RPIA 2XO7A 1NM2A 2OH2A 2KFYA 4ELTA 3MD3A 2DH7A 3CJTA 4BHQA 4FM2A 4RJVA 3OSPA 2F8HA 1IKXB 1KOHA 2ZZTA 1QAJA 2P6SA 1ITPA 1XQSC 3NS7B 2QWMA 1ZAWA 2XS5A 1UW9A 2V8VA 2ZOFA 4TLQA 4BRDA 2X3DA 3O8MA 5IQQA 1B7YB 3BN7A 1N88A 4H4MB 4QIWD 4DG1A 4N8NA 1K6YA 1FA0A 2MB0B 2O8DB 5LJ3Y 4Q43A 4OHZA 3QJLA 3NGZA 3GCWP 4DU3A 3PRDA 4W98A 1B92A 1SCJB 5F8HA 2ZFHA 1OY8A 1UEKA 2Y0SD 4M5DA 3SMZA 3DDIA 2YPZA 2FTRA 2O01C 5KG0A 3VGLA 5HP1B 4URSA 3SEOA 2JC0A 3J7YU 4B3RJ 2VFVA 4DB3A 2JFKA 2BKNA 4DPXA 1U4BA 2DGXA 3AOCA 2DGVA 2BE2A 2GJFA 1XIQA 2UV8A 1NGGA 2HBJA 4WFBL 4OJ1A 3P1GA 5KFDA 4CEQA 4DV2J 1KAYA 4M5GA 4RW8B 4HACA 1HMVB 2HAFA 2CPIA 3ISND 1RB0A 4A8MP 4JKEA 2H1YA 3TJ8A 1V3ZA 1HKGA 3ZETA 2UUAJ 1N54B 1YLXA 4MAKA 2JVOA 1QZ5A 3QFPA 3TR8A 1DZ5A 1R27B 4DHVA 1TL1B 5KQ8A 4Y2KA 1W97L 2KJVA 4I64A 1S1UA 2QFIA 4L76A 4ED4A 1JNZB 3DXKA 3CMEN 3KK3B 4CEFA 3KWMA 3ZSYA 4IEIA 4JNEA 4MKVA 1HR0F 3DKDA 3F5TA 4DX7A 1NKBA 2FD2A 4P2MA 5C12A 4RUHA 3LGHA 4BR9A 2K7KA 5FLXY 4JKGA 1VSLA 4OKEA 1S1WA 3GV5B 4KGKA 3J80Y 3QBXA 4JV5K 3P4IA 3PM9A 2P5VA 3AJDA 3HFVA 1WDDA 4HH0A 3PX6A 2MHNA 4FSVA 2JVRA 4Y6IA 2BYCA 2DXDA 4WCEL 2LA4A 3J81Y 2KFNA 1BU6O 4HEA9 4FBTA 4CJ3A 4G1IA 2D7SA 2XMWA 4DTRA 4OLOA 2KI2A 2XCPA 2WVCA 4Z4IA 1KVBA 4L75A 2VBZA 3BF4A 4RBTA 2I7NA 3I31A 4ICLB 5FPMA 4KRWA 3IXQA 3KG0A 2QA4G 3MDQA 3LP3A 5SUHA 2P51A 1IXKA 3ZTPA 4DV0K 2WK4A 1RT3B 5B0DA 4F4XA 4GVEA 3TVKA 1NRKA 2IS3A 1N33F 1D3WA 1YIJS 1ATRA 2NRHA 2QKKA 1M1KO 4DQSA 1VHXA 2HFSA 4WU3A 2MYFA 4H5RA 3DLLQ 4OZ3A 4DL4A 2Z2LA 1M5HA 2IM0A 2GX8A 4YHHK 5F0UA 3HVWA 3VAGA 2C1EB 2MGZA 1JLEA 1MU2A 2CFXA 3O1BA 3BBCA 2ZE2B 1RKIA 3ZNJ1 2YH1A 3A5MC 2BJ8A 4DV3K 1C1BA 2JSXA 1H73A 5C24A 2GQCA 3OYDA 1SC4B 3RWUA 4YOUA 1QJHA 2ALYB 3HCXA 3QT6A 3LPUA 2H54B 2CPHA 3BQ0A 4ID8A 3D1HA 3V1QA 1YBUA 5C2GA 2HB5A 3K7RA 1AZSB 1B9DA 2ZBPA 4M3ZA 1D4XA 2CQHA 1TU0B 2QA4N 3I0RB 4IDHA 2GHPA 3GYGA 3GFHA 3RR7A 1JLGB 1F3VA 2OP5A 3QBCA 3THYA 5KFQA 4O4GA 2OJ3A 5ADXH 2IRXA 3FBCA 5AZJA 3MM6B 3RVCA 3BR9A 3Q83A 1U09A 3AA2A 2OYQA 5EGYA 2NZTA 3CCJN 1SJFA 2C2MB 4PKGA 4O0NA 2CIMA 3L7UA 4BC7A 2Z1IA 2MZ1A 4DFJA 4B3TK 2L41A 1WOSA 1MDUB 1YAGA 1QAYA 3M3ZA 4FLWA 3ZZ0A 3N4PA 1TGOA 1PJ5A 3POTA 3SDEA 3LGNA 1C0UA 1FFWB 1S0OA 3FFIA 2VPXB 3CCSN 3KHYA 4BWMA 2GIFA 4DV2K 1LFWA 2L08A 3V81A 2R7WA 5KFZA 5KI6A 4NRUA 4LF4F 2FHMA 2Z4PA 1BUPA 4X65J 2X74A 4OV6A 3THVA 4WYLA 2COLA 2A6AA 3MMCA 4PWDA 3M2RA 4NYPA 4FLZA 4KHUA 1KVCA 3M2UB 5JS2A 3QZ8A 2HNDB 3IRXA 3TVZA 1H0HB 3AVHA 4C97A 5CD4H 1ZBIA 4HLBA 3Q7BA 4RW8A 1C0TB 2CYYA 1VFJA 1EX8A 2H65B 2CPXA 2MLZA 1RT7A 5A0YB 1YJNN 4DUYF 4OQJA 1S12A 2CG8A 3TOQA 2LKZA 1S10A 1HWLA 3UW1A 3HJVA 4KI4A 3T6JA 3NXZA 5H1SV 4AHCA 4FYDA 2BH1A 2GQ2A 3MECA 4JI7F 4K0KF 3FQLA 4YORA 1FKPA 4KFBA 3G6XA 2UVVA 4JK8A 2CA9A 1PYSB 4BS2A 3W64A 3SBGA 3KVGA 4CJRA 4JI0K 4NA2A 2JGUA 4W5RA 3THXB 1HBUA 3KLEA 4WK1A 4FJNA 3AO1A 4JI3K 1WKKA 1N4LA 2VYPA 4DV0F 5HQ8A 4AM6A 2RRBA 3HK2A 4C8MA 1FE0A 1VQKS 3NMAA 2WTUA 1T11A 1S9GA 2D4WA 1DURA 2R2UA 2CAJA 2AJFE 2IA6A 3EDRB 4A5AA 3HHKA 3CCSS 4KH6A 5HVGA 2B56A 1DKGD 3KD1E 3L7OA 4A8KA 1FJ7A 2IRYA 1O5JA 2ZUAA 4B3TF 4B8AB 1BWEA 3M6VA 4A8XA 3BR8A 4YDDB 3D68A 2JC1A 3NAIA 4FJ5A 3MM8B 1KVJA 3ZTQA 1TL3A 4M5JA 4IKAA 2QW9A 4CF0A 1Y4ZB 3DLLL 4QWBA 1FKAF 3OW2R 4ZCIA 3QSYB 3D9BA 3WX8A 2M8HA 3QIDA 1RXOB 3BO3A 1SH2A 1TKTB 2FC8A 1FXRA 3ATUA 3KG4A 2CJXB 3RAMA 5J1EA 2AGOA 2ROEA 3H90A 3T7ZA 2YCHA 4GW6A 5H9FJ 3EL2A 3MEEB 2H9ZA 4CLSA 2DITA 1F3FA 3BSCA 5G0RA 3I82A 2G0JA 4KB1A 3FRYA 4ZPTR 1N5YB 3R9LA 1ATNA 1Q8KA 4DV3F 4MLHA 2V52B 5L1JA 2VGNA 3DXSX 4ILGB 1K9MT 3ADAC 2ZZMA 3FZLA 5AQZA 1VQSA 2DRDA 1HKCA 1I3OB 1I94K 2LDIA 3A0IX 2D9PA 2UVWA 1V5IB 3E66A 1FRKA 3OR1B 5KFBA 1VYAA 3PW4A 2KZZA 5J2QA 2ASOA 1XMOF 3VAJA 3OV7A 4DS4A 3BY5A 2Z2YB 4OKKA 1S6OA 5I3UA 3CJ4A 4NXNJ 2XLIA 1T0TV 2MTLA 2BJ7A 1JLFA 5KT6A 4R5PB 2HHPA 1ZPWX 1IH7A 4J9MA 3M1VB 4BE1A 1FFSB 2BKOA 2X7IA 3W3DA 2BBEA 3MMJA 4BVPA 2BOAA 3DOMB 9ATCB 1RFQA 3DOKA 4O4GB 1DTQB 3AVKA 1FD2A 3SV3A 2E1AA 3QT7A 4W5TA 1MA9B 5BRDA 1RWOB 2RDIA 3D6HB 1UWBA 2VKZG 5BRFA 3LPEA 4C9DA 1OJ4A 2UXBF 1T02A 2UXDK 3D2EB 1URNA 5ETOA 1YKWA 1LWFB 3GJTB 3CC4S 4ECXA 4YR3A 3TA1A 2W9AA 1DEJA 5SWMA 4IDKB 5AZIA 3GBTA 1X4AA 2WOMB 3PO5A 3VVUA 3EXYA 3C2PA 1TVRB 3AHPA 1XNRJ 1VQPN 3BEXA 1JXLA 1GOBA 1R43A 1GNKA 2KVQE 1X60A 1RBVA 2YWHA 1EO1A 5DDQC 2PAVA 4KIAA 1RT1B 3FZMA 1HNWK 4RW7B 4F36A 5D0GA 3CULA 3C6AA 1I6JA 3U1NA 3FGUA 4H4OA 2W42A 4FWKA 3SAHA 1NU4A 5H9EJ 2D3O1 4WPAA 4JI4K 3TR5A 3CW2C 2J4RA 5T7LA 3LH2S 3M2RB 1XERA 3E9PA 4ECVA 3W63A 1WLJA 1C1BB 2HBRB 4DR1F 2FSKA 3TA0A 1N0UA 4K25A 5KFHA 1K44A 2PIIA 4CHNA 3ENQA 1UWAA 3FK4A 1KNZA 4CGGA 4JV2A 1LNQA 4AE5A 3MOJB 3RMAA 4PAAA 4CTAA 1KQSM 1MW7A 3J7ZO 1WDTA 2I5JA 2GW8A 1H2VZ 3NAEA 1CLQA 3L9ZA 4AXIA 2M4MA 4FKYA 5J2PB 2AYEA 1JLGA 2ASDA 3IDHA 1NGIA 4NZ0A 1ZAXA 4IOBA 2OTLN 1S59A 3MPWA 3H08A 4PG8A 2E2OA 3UE5A 1YRTA 2HS3A 1S72S 3VQ7A 4NEYA 4HTJA 3BBFA 1XC9A 3LAKA 3WNGA 5DZ6A 4EK2A 4K2XA 3W7BA 2HHSA 3QNOA 2DTUA 4I7FA 1Q53A 1B0PA 2P9LA 1RYRA 3CCQN 3WC0A 4OYMA 3FLCO 1R8HA 2HK3A 1NJWA 2DPNA 3MUMP 2BQRA 3GIKA 4V19J 4ED0A 4CF2A 3UCUP 3IR7B 2AHOB 4BR2A 4PCQA 1FEHA 2VJVA 2CWXA 4KHWA 1DJ0A 5DRKA 2FGCA 1NK0A 1WSRA 3I9ZA 8AT1B 3TZXA 1KQGB 4FCYA 1H98A 1S4EA 2FPHX 3R7BB 4C23A 4KTWA 2KYZA 3EGWB 4C0HA 1GMWD 3HKWA 4YR0A 2HWHA 2F8SA 2NUBA 2MQNA 1N5SA 1NOZA 3AVGA 3R2CJ 4URQU 2OPQA 3H5YA 4B3MF 1IBKK 4OI1A 2XYPB 4YB6A 3M8RA 2XWYA 3CI5A 5AXLA 3CQ8A 2E1PA 1IQTA 3H59A 2VONA 1DT9A 3TSQA 5ETQA 2CZ4A 4ZA1A 2GA7A 1C0FA 4CK3A 5BREA 3WUHA 5LXYA 4YOVA 1FRLA 5J2MA 1QVGR 4O5BA 4IRKA 4DSIA 4IRDA 2XLKA 2R7RA 4ECUA 4O0JA 3RSEB 4XO0A 2MKCA 1RKJA 5HJYA 1UZHA 2H4WB 4FJLA 1KVIA 4S0MA 1VSFA 1P1TA 2RU9A 4PQAA 1Q78A 3SAFA 2M52A 5IT4A 2D5RA 2ZBCA 2IVFB 4CHQA 1EAYC 1S1TB 1NJZA 1YTAA 4CJTA 3KMQA 1WN7A 2YWFA 4HVZA 4FF3A 4GC6A 4W5NA 1CS4A 3Q23A 2FXUA 3ALYA 2VBXA 5HJXA 3KLEB 2XMAA 3Q8RB 1ZM2A 3EKSA 1GLEG 2P9PB 1UTAA 1N32F 1RDWX 1YF5L 4O3QA 4DLGA 3P3DA 3V9UA 4KO0A 2VG5A 3NOGA 4CLWA 1GH8A 2BE2B 2L3MA 3QNNA 5GVQA 3OYLA 4NLYA 1HYSB 1MWYA 2HOEA 4C11A 2RQCA 1UW4A 1NDPA 3MPVA 2B8QA 3BV8A 2NZCA 1XTZA 1ZA2B 3ZSQA 4DOZA 4RL1A 1OH7A 1FDAA 2E5HA 3K8VA 1VQ9S 4UT4A 4X65K 4UUWA 3HFKA 4MIWA 3CERA 3ET6A 4B9SA 5C25B 2OZSA 3W2WA 2GNKA 1EWQA 1EQYA 4A4JA 3CJ5A 3D2FB 2W4PA 3OQ2A 4RNMA 3MM7A 2QLWA 5KOXA 4AHSA 2D41A 4WWSA 3L09A 4IQMA 3RGIA 1N56A 3IRWP 1PBAA 4IDKA 4CERA 5HRPA 4URGA 5DJBA 1T9YA 1RBAA 3FUYA 1M5OC 3MXMA 2CQPA 5MLCQ 4ZP8A 2R42A 3MEEA 2UXCJ 5AQKA 4HKQA 2G8KA 3HVRA 1H72C 1RDRA 5M2RA 2XY8A 4BC3A 1HQUB 3SPYA 2NRZA 3OBIA 3ZSVA 4AQYK 5AQJA 4DG1B 2OUGA 4PPDA 4WCEQ 3RBDA 1M5VC 4QS9A 1LV5A 2R7QA 3M30B 2RB7A 2DY4A 4H4KA 1HI0P 3BN4A 3OTOF 1HJOA 2V7YA 3S3OA 3K17A 3OFFA 3HL8A 3H42A 2GWKA 4DR6F 4OZ1A 2JWKA 5KFFA 1OQ3A 2AF6A 2VASA 5HQMA 1RTIB 4HI2A 2HNZA 1LCUA 3O80A 5E3RA 5L39A 5DM7L 1FD8A 1FJCA 3GFZA 3ENVA 4K8XA 1MMLA 3SQ4A 2E5JA 3CCTA 1LKZA 4QIVA 2O8DA 1V3RA 4MH8A 4IG3B 3TJ9A 2UUCK 2V2ZA 4LFCJ 1RHKB 3EVMA 4ENOA 3ZEUB 1KAXA 3V6JA 4JAXA 1B4SA 3ILJA 3CXCM 2MZQA 3QRQA 4C8NA 1CVJA 2DGTA 3K57A 3D0HE 1HD1A 3TEHB 3ZETB 5KFGA 1S1XB 1RWXB 4DI6A 5DG7A 3TQ1A 4J2AA 2OSRA 4LRFA 3KK2B 3GB0A 1JXBA 2MPUA 3C16A 4B3RF 4JI3F 3D0PA 2KT3A 2XBPA 2FHKA 1U2CA 2P9GA 3PYEA 2H5JB 1NGJA 4FPBA 3BH6B 2ZEJA 3CE8A 1U0HA 2C3OA 4ZVFA 4CI0B 3SQGB 4HUGA 4BGAA 3IR5B 1R59O 2HBYB 3ZSRA 3UKUA 5GAGU 3F0NA 4WBFA 2DY1A 2VDIA 4LBPA 2JRSA 1N34K 1VLYA 3KK7A 4CZIA 4X66F 3DLGA 4J7CA 1HARA 1HKBA 2WONA 2J0XA 2UVRA 3L0QA 3MUVP 1MROA 1TL7A 3W65A 4DV3J 2D0BA 4CP5A 3C3LA 4LSLB 3I0RA 4XPEA 2PEBA 3HDSA 2NRWA 3HZGA 1YWXA 3H20A 4DR2K 3OS1A 1SVDA 2PA3A 5SZTA 3CCUN 3VN5A 1SKUB 3OBYA 1G7CB 3KDOA 2RE2A 1CEZA 2J0SD 2N4DA 4WIIA 1DY3A 3A3OB 1BDGA 4JI2K 2OI2A 1BQMB 4MKAA 1JQGA 4UOHA 3D1QA 1NDCA 3PYGA 3LQVA 2IVPA 4LF6K 1VBKA 4Z4CA 3B6OA 3ZT4A 3O9TA 2J76E 4CJSA 2HFNA 2BVZA 4DCOB 2GVDA 4KC5A 2ZH2A 5K14B 3BGUA 1RT5B 4PKHA 3RAQA 1URRA 3DGVA 2M2BA 1T6DA 2BQ3A 2GX9A 2YHBA 1HI8A 4QJVA 4ZPAA 1WUAA 4X64K 3DM2B 3NE6A 3K5NA 5KFXA 2CUYA 3AJ2A 1RT3A 3BREA 1FJGF 1OYEA 5C24B 4LC9B 4U7CA 1UMJA 4EHTA 1FDDA 2RS2A 4NL5A 2QWQA 4ZMMA 1ZBUA 1U8SA 4FYYB 5MAOA 4WFZA 3EGVA 4H5VA 3DLEB 2C2KB 3F9MA 3LP0A 2NXEA 4DTPA 2EVZA 3KXDA 2XEXA 2F4FA 3HHLD 3RMCA 1I94J 2Q66A 4B9TA 4KY3A 4MIAA 4TSXA 4OHWA 2R2SA 3BGRA 4CEDA 4F0KA 1EETB 1HNZJ 5DQIA 1VQNS 1GMVA 1FK9A 2L9DA 4LREA 4M5KA 5B0FA 4LF4K 5TKYA 1X8DA 2J9DA 5EX3A 1TQLA 3H5SA 2RAQA 3VGUA 3A5LC 3VAIA 2OPQB 4ANCA 1KHWA 1JMTA 1OH6A 4DHYA 1N8RO 3FVYA 4JD2A 1RTHB 4OPHA 4OX7A 3HHLB 5DM6L 1F5CA 1WEYA 2MLXA 3RYLA 4KJIA 4CFAA 4RU2A 2F5GA 1KLNA 3AAPA 2BJ1A 1XK8A 3H7HB 4CNZA 4FW1A 3DRSA 2HMIB 3S7RA 4OZLA 1TUWA 4GV3A 5J2NA 3MWBA 2YY3A 3FMBA 3CC7S 4NCBA 1VSHA 1L5UA 4DR4K 3NRBA 5T14A 4U6PA 4LRAA 4DPTA 1EJ7L 4N77A 1CS4B 3P96A 3ULEB 4DL0C 1G3OA 3FZHA 3ZSWA 4A61A 2OMLA 4E7KA 2DFFA