1C1CA

Crystal structure of hiv-1 reverse transcriptase in complex with tnk-6123
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
536
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 536
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1cA05
2VG7A 3NBPA 3CFOA 1D0EA 1ZTTA 1S49A 4I2PB 3HPHA 3PW4A 2HW3A 3FDSA 4EBEA 3GV7B 3LP2B 3BGRA 4Z0UA 1RT7B 4LSLA 4DTXA 1SUQA 3F73A 4FJXA 1LWEB 1I6JA 3RMCA 2HNYB 2BE2A 3I8DA 3OS2A 4EYIB 1D9DA 4IG3B 1QSYA 4IRDA 4Y34A 5DQIA 3CYMA 1HYVA 1TL3B 1QE1A 4DS4A 4TY8A 1LAWA 2RKIA 3DM2A 2OPRB 4PA1A 4ED7A 1SH3A 2ILZA 3Q8QB 2X6SA 4FK0A 1VRUB 4J9NA 4HUFA 4CEEA 4W5QA 1UA1A 4Q8EA 3RMAA 4IKAA 4H4OA 4DFPA 3LAMA 3WNHA 3ZT4A 3QEVA 4RG8A 5L9XA 1TK0A 5KG6A 4J2DA 3DRPA 2EX3A 3CJ4A 4DL4A 4NCGA 3VQSA 5HROB 5KFFA 4HUGA 5HRSA 3CG7A 1DTTB 3MEDB 2XGQA 1TVRA 1ITGA 3JYTA 2ATQA 2FBXA 3TWHA 1QAIA 3CDWA 3ZSYA 2ASDA 4J9KA 4ED2A 4J9SA 3V4IB 1BI4B 4I2PA 4NLDA 3PZPA 3TR8A 4N56A 3LP2A 4B9VA 1RILA 4ELVA 2OPQB 1TAUA 4B9SA 1C1BB 1UOCA 4FW2A 2HNYA 3IG1B 5F8GA 5KFTA 4TLRA 4IG3A 3GIJA 3SQ2A 3ZSVA 3EYZA 4JV0A 1K6YA 3VQBA 2EC0A 1TL1B 1TL3A 1HQUA 1YTUA 4Y2CA 5JXSA 4CK2A 3SUOA 4O3SA 2OPRA 3G10A 4KRFA 3GIMA 4RW8B 5KTQA 3AVBA 1S9FA 4IR1A 4RW6B 1REVA 1OS5A 3O4NA 3NGIA 3L3UA 4Z4CA 3K5NA 2ASJA 3ZT1A 1I3AA 2Y1JA 4W5TA 4B9TA 5SWMA 4KHSA 5KFQA 3OYDA 3ISNC 4NLXA 5F9NA 5KT5A 1BHLA 1C0UA 4HUEA 1WSIA 3SNNA 4CHNA 3MEDA 2VWJA 2FLLA 3QO9B 1JL1A 4DU4A 1S1TB 4LQ9A 3U3YA 4CEZA 3FFIB 4DQSA 1BI4A 4FM1A 1Z4UA 3P5JA 4MFBA 1NK6A 2IGIA 1S1XB 2AX1A 3NAIA 2V0NA 1QTMA 1C1BA 1UWBB 1W25A 3Q8RB 2BRLA 4R8UB 4KHNA 1S0OA 5KFCA 3K2PA 1ZETA 2WB4A 2YNHB 4OKJA 3DMJB 2JEFA 1XR7A 4EP4A 4ECSA 1TL1A 3OYIA 5HRPA 3HVWA 2X74A 2ZE2B 4ICLB 4I9QA 3JSMB 4CJWA 4WZMA 3S3NA 2W9BB 2BR0A 4KTWA 3AVGA 4CJRA 5KFSA 3RB0A 1IKXB 4DSFA 4CJVA 4FJNA 3N6LA 4M41A 1B9FA 4N5SA 3ZT3A 1S6PB 3DRSB 1VSEA 4CEFA 3OJSA 2XHBA 3A2FA 4H4MB 4CF9A 2E9RX 3VA3A 2C22A 3RR8A 3VQ7A 4CF2A 5T14A 3AVNA 5KFJA 4CF0A 3DLGB 1T3NA 1HPZB 5KFVA 4ZPDA 4EYHB 4ECUA 3PO5A 3PUFA 4JUZA 4FBTA 2ASLA 1S1TA 3AA4A 3NF8A 2R2TA 3CJ3A 3T5KA 1U09A 4DF4A 2KZZA 1RT2B 3BSCA 1S1XA 1S4FA 2AQ4A 4KKOA 4JRQA 2HVIA 3SPYA 3QNOA 4NCAA 4RW7B 3L2VA 3G6XA 3PW2A 1S1VA 4I2QA 5HLFB 2DPIA 2YNHA 3OL8A 3OSPA 3DMJA 4FLXA 4CJPA 2BDPA 5I42A 4CFAA 1HQEA 4FJ5A 1TQLA 3JSMA 3KLIA 2E9ZA 2V4RA 2C2EA 1EETA 1KVAA 4O55A 3ZSXA 1LW0B 1IKXA 1FKOB 3BREA 4CJTA 4J9OA 2DFEA 3VQ9A 4K4TA 1S6PA 3DRSA 2IOCA 4CFBA 2YNIB 3KOAA 3KKSA 3CDEA 3WNEA 3HVAA 3D45A 5KT6A 3V6HA 2W9CB 2HAIA 3DLGA 3RBEA 1JLFB 3P83D 1A5WA 3NH1A 1HNVB 4NLWA 1UA0A 4R0EA 3V1RA 3K58A 3DLEB 3NMAA 5J2QB 1JLAB 3SJJA 4JV1A 5KFLA 1VRTA 4FJ9A 1RYSA 4KHQA 2HB5A 5DMRA 3I5CA 3FQLA 5KFYA 4DFMA 3SI6A 4KO0A 5DK5A 1NK7A 2IS3A 2HNDB 4RW7A 4QWCA 5CYMB 4E19A 4ED3A 4LD0A 5HLFA 2B5JB 1I39A 4ZVHA 4YFUA 3LP0A 2IA6A 2OZSA 1HARA 5CZ1A 4I7FB 1N56A 3U3GA 1LWCB 3V1OA 3MR2A 3DLHA 4K4UA 3WNFA 2G8HA 4DSJA 3HO1A 1JXEA 2ZKUA 3PO4A 1U49A 4NZ0A 4DL2A 1FKOA 2HHVA 3KMQA 4CIGA 3EPIA 5CY4A 2O4IA 2E6LA 1RT3B 4K8ZA 2YNIA 3ISND 3ZCMA 2OYQA 1D9FA 3E01B 3E51A 3OS0A 3RTVA 1ZBLA 2IC3A 3RAQA 3BR9A 4FLTA 3DOLB 3VA0A 3I0RA 3PX0A 4RZRA 3T5HA 2W9CA 5KRSA 3MXMA 4PY5A 3OYCA 5KFAA 3OYEA 2FJXA 3D0PA 3ICLA 3KTQA 1ASUA 4K4WA 4B3OB 4HKQA 5J2QA 5J2MA 1JLAA 4ECRA 5KG5A 1RA7A 3OHAA 2P5GA 3NF6A 4KB7A 3H98A 4FCYA 1NJXA 3OL9A 2WONB 5C42B 4RUCA 1Q9YA 2G8IA 2HNDA 3VQDA 1XHXA 5CYMA 1KRPA 1RDDA 2QKBA 3VQPA 4BE2A 4F4XA 2B5JA 3L2QA 1TK8A 3MF5A 2VG5B 3SUNA 1QUVA 4I7FA 1NK0A 1LWCA 2P1JA 4DSLA 4KTQA 2FLNA 1BISA 2EHGA 5JUMA 1X1PA 4NRUA 2XWYA 4Q8FA 3SI8A 3V9XA 5HRNA 5J2PB 3AA5X 1S1WB 3H5SA 4RNMA 1SUQB 4DL6A 2AJQA 4DF8A 2D41A 3SUPA 1DTQB 2BE2B 2KTQA 2IJNA 2FJWA 3SCXA 1RT3A 3DDKA 2JC0A 2E6MA 2OZMA 2FVRA 4NLVA 4FJIA 3TANA 3E01A 3LWLA 4YP3A 3G6YA 3HVTB 1IH7A 4TY8B 4M42A 3DOLA 4XPCA 4J2AA 3DRRA 4NLRA 4RNHA 1RT4B 1RDRA 4Y1CA 2BANA 4B3OA 4OLAA 1NOZA 2Y1IA 2HHWA 1VSLA 4KSEB 1NJZA 3NCIA 3IS9B 1RA6A 2HHQA 5L1KA 4DTPA 2HHTA 2RF2B 4KE5A 3T19A 2G8KA 3PR4A 4ECQA 4DTUA 5KG3A 2X6NA 4EBDA 4NCGB 2JEJA 1SH2A 4WXWA 4DL7A 2ZQBA 5DGAA 4PWDB 3CM6A 4TYBA 2VG5A 3S9HA 1FKPB 3T3FA 4FJJA 4M3ZA 4N47A 2QV6A 3SV3A 1NHUA 2D3UA 3TAEA 1BQMB 3C6UB 3HT3A 3HK2A 3AVHA 3S3OA 1RT5A 5J2PA 1S1WA 5FRNA 4O44B 4ZVEA 4DU3A 1VSFA 3F9KA 3O4QA 1DTQA 1U04A 4M45A 3QGHA 4WFXA 1SL0A 4CJ3A 4DTJA 2FVCA 2UUTA 1YVUA 1RTJB 1HQUB 3EPGA 4WYWA 1HNIB 3P1GA 3HVTA 4I9LA 4LSNA 3BQ2A 3D5MA 4QWEA 1SKRA 4PQUB 3PW7A 1CLQA 3DLKB 5KFEA 1F21A 4CJFA 3KKRA 3KLFA 1RT4A 2OPSB 1TKDA 1REVB 1YTAA 5HRRA 1JLGA 1T05A 4YR0A 3QZ7A 4HCCA 3BSOA 5KFNA 3IS9A 3QGGA 4ZTFA 2XCAA 4NYNA 3LPUA 2RF2A 4MK9A 5KFKA 5T7BA 4CHOA 4IFYB 4NLYA 3AA3A 1VSKA 4C8OA 1C0UB 3ZSQA 2Z1JA 1YT3A 1KHVA 2I1RA 2BQRA 4W5RA 4PWDA 1RAJA 3TAMA 4MKBA 4LH4A 2ITGA 4C8NA 3CIZA 5DG7A 1FKPA 4BE0A 4KAZA 1RTDB 3RRGA 4K4VA 1N5YB 1RBSA 5J1EB 2GC8A 4CHQA 5L1IA 2ALZA 1BQMA 3C6UA 4B9LA 4MFBB 4OPJA 3K5MA 1J53A 1S0MA 1C0TB 4O44A 4FJKA 4EBCA 3HM9A 4B9UA 3MAQA 1EX4A 2FBVA 2JGUA 3K5LA 4EO6A 4IR9A 4ZPBA 4ZVFA 2V9WA 4J9LA 1ZYQA 1RTJA 4JRPA 1HNIA 1NOYA 3GYNA 2ILYA 4PQUA 3HXMA 3Q8PB 3DLKA 3QIPB 3CJ2A 2W42A 1C1CA 3Q8SB 1HYSB 2KW4A 2OPSA 3C95A 4DFKA 1NJWA 5FDLB 4IRCA 4F4ZA 4E7HA 3V1QA 4M3YA 4AHRA 3OYAA 3NH2A 4G3IA 4RUAA 4DS5A 1ZBUA 4IFYA 4XPEA 4FLWA 1IG9A 2IM1A 2DY4A 4O4GB 3QZ8A 4FBUA 2BRKA 3NL0A 1WNSA 4AHVA 5L1LA 4Z4FA 5EUHA 3QLHB 3L2UA 5F8JA 3OYHA 3BQ0A 1BCOA 1RTDA 3MEEB 3KHRA 4DTSA 2R2UA 1N5YA 4HVJA 5J1EA 4IOBA 1S6QA 3U6FA 3SFUA 3KJVA 2OH2A 2IBKA 4KHWA 3PX4A 1SKWA 3AVAA 4KKOB 1WSEA 4O3OA 4FZZA 3M8RA 1C0TA 4F4YA 5C5JA 2O5DA 1S1VB 4I2QB 3ZSOA 3UQSA 2HHXA 3PV8A 4F3TA 4FJ8A 1EKEA 5I42B 1HQEB 5EWFA 5KFPA 3H08A 3SFGA 3KLIB 3GIKA 4NLGA 4FLUA 5KI6A 5KFUA 3QIPA 3SYZA 5KG7A 1EETB 2VA3A 3MXJA 1HYSA 2AWZA 4TYAA 3ZT0A 4CFDA 1C0MA 2D0AA 1NNDA 5FDLA 3PY8A 3CWJA 3EZUA 4F2RA 2W7PA 4ZP6A 2FJVA 2IM2A 1VSHA 4LQ3A 1XI1A 2IMWP 1XR5A 1ASWA 3OSNA 1TAQA 2G8UA 2CKWA 4O4GA 1RT6B 4URQU 3TARA 2UVWA 4URSA 5EWEA 3QLHA 1RT1A 4M94A 2C28A 5JS1A 4O4RA 4DEZA 4TQSA 4KHMA 5KFZA 3QNNA 3OL7A 4Q5VA 3MEEA 4NRTA 2A1SA 1VRTB 1NK9A 3M8PB 4M3UA 4Y3CA 3CJ5A 4MK7A 3AVKA 4KO0B 3S3MA 4ED0A 4RNFA 1N48A 1S9GA 3CDUA 1KFDA 2KZMA 2BQ3A 1HRHA 3OS1A 3KLGB 1B9DA 3LP0B 4DQQA 4CHZA 2QKKA 3KIOA 1XHZA 4F8RA 1Q9XA 3HKWA 2KFNA 2KFZA 2D0CA 4EO8A 4KREA 2WCXA 4O3RA 3MR5A 5DG8A 3CO9A 5KFBA 1NK8A 4C8LA 1S5JA 2AGOA 4E89A 4NLPA 1MMLA 1TKXB 4OGCA 3OLBA 4ZP7A 4O3PA 4F4KA 3AV9A 4F4WA 4FZYA 2R8JA 2PY5A 1GOAA 4AHCA 1QS4A 4J2BA 1IM4A 1L5UA 3H40A 3N6NA 4OVLA 2IC3B 4E1NA 4U7CA 4K8XA 1RT6A 3QETA 3OYBA 3I0RB 1WN7A 3EZ5A 1MU2B 1FK9B 4O0IA 1WNEA 4OLBA 2XRIA 1ASVA 3AVJA 5J2MB 3V9UA 1C2PA 3ASMA 5KT4A 5D3GB 1SKSA 4GMJB 4M3RA 3NGDA 3D28A 3M8PA 3OYGA 3KLHA 3TVKA 3BJYA 3SZ2A 2F8TA 4HTUA 1JLQA 1IO2A 5KT2A 4E7LA 2XY6A 1HMVB 4K4SA 1BL3A 3DI6B 3V81B 4NLQA 4NLSA 3NGYA 3KLGA 3M9OB 3TAQA 2QE5A 4AHTA 4ZHRB 2GIRA 4EZ6A 2WRMA 4IDKA 3KD5E 5J2NA 1RNHA 1W9HA 2Q3SA 5DLGA 4ED1A 4AH9A 3NDKA 1T03A 3M9NB 4BDYA 1JLCA 4ID1A 3BSAA 3FRZA 4WYLA 3VQAA 1GOBA 1RDCA 3V9WA 4EZ9A 4FJMA 1TKXA 1JX4A 2Z1GA 4LH5A 2AU0A 1K1QA 1B92A 4O3QA 3KK1B 4YR2A 1L3SA 4DWIA 1TP7A 5KFXA 2RDJA 2IM0A 2UVVA 4ID5A 2JEGA 3QINA 4BWMA 4CK1A 1MU2A 1FK9A 3LAKA 2R8GA 3DRRB 1UAXA 3RMDA 2HVHA 2V4QA 3V6JA 1GX5A 4FW1A 4KB0A 2R8HA 2BANB 3LZJA 4QWBA 3GV8B 3HP6A 1NKBA 2AGQA 1HYZA 5D3GA 4KHYA 5SZTA 1NKCA 2FLPA 1WSFA 4FJGA 4TQRA 3RR7A 2VA2A 3KK3B 3QIOA 3AVIA 3NAHA 1HMVA 3SUQA 3VQCA 1CSJA 3DI6A 3V81A 4KI6A 4J2EA 4WE1B 3HPOA 4B8CA 4DMNA 2UVUA 4ZHRA 2BQUA 5KRTA 5FRMA 1S48A 1EP4B 4G1QB 4ECWA 4CGIA 3DOKB 3GQCA 2AGPA 4DSKA 3G6VA 2F8SA 4QPXA 1KLMA 4CEAA 3MFIA 4K50A 3T5LA 3UPFA 4J9MA 1NJYA 4ECTA 1W0HA 4E3SA 1RT5B 4LY7A 1WSJA 4UQGA 3VN5A 2D3ZA 5C24B 3RAXA 2R8KA 2OPPB 5KFWA 3OL6A 3KK1A 2J6UA 3OYLA 1BQNB 4KAIA 2FVPA 4E7KA 4QW8A 5CZ2A 2FBYA 2G8FA 4YQWA 3VQ6A 1TKTA 4LSNB 3H4DA 3RMBA 2B6AA 4RU9A 4MIAA 3OYNA 2IAJB 1JLBB 5DLFA 2KQ2A 4ECYA 3NF7A 3KLFB 3BQ1A 1JLGB 1T05B 3BDPA 2CJQA 1RTIB 2R2RA 2VG6A 5DQHA 3LPTA 3MR6A 3QEPA 2XY8A 3T1AA 2XC9A 4QAGA 2R7YA 4FS1A 3PJWA 2J6TA 3OYMA 3KK3A 3SV4A 4MK8A 1LW2B 4FJ7A 4KHRA 3H5XA 3K59A 3ITHA 2WOMB 4KHUA 4WE1A 3I5BA 4K4YA 1QHTA 3KLVA 3TAMB 4O0JA 4B9MA 3MEGA 1EP4A 4G1QA 1S97A 3DOKA 1U45A 4KV8B 4CHYA 1WAJA 4OKEA 1JLEB 1WLJA 4DQIA 4ELUA 4J9RA 1TKZA 3TABA 5F9LA 1X9WA 3AVMA 1D1UA 3LALA 4DQPA 5C24A 3AO5A 4F2SA 2OPPA 5L1JA 4IBNA 1KSPA 1BQNA 1WSGA 4BDZA 2HWHA 2VWKA 4CJ5A 3AO4A 3K57A 4IG0B 2UUWA 3H4BA 1DLOB 2FC0A 2YNFA 5JS2A 2G8WA 4MIBA 3T5JA 4Y2AA 2IAJA 1NK5A 1JLBA 4Q44A 4K4XA 1C1CB 1BGXT 1KVCA 3OJUA 1VSJA 3V6DB 3N6MA 2UVRA 2E4LA 2GUIA 5KT3A 1RTIA 1HJRA 4OL8A 4ZVGA 4CGHA 1TK5A 3B6PA 4O5BA 3HHKA 2O4GA 5KFGA 4WXOA 4BWJA 3M8SA 3QGIA 2GV9A 3M8QB 1WSHA 4DTMA 3NAEA 4R5PB 2HMIB 1J5OB 4J9QA 4Z4EA 2JLEA 4CIFA 3M9MB 2PYJA 1LW2A 2RDIA 3TAPA 4CHPA 4GW6A 2W7OA 1S9EB 2WOMA 4BACA 3TAGA 3ZSWA 1IKWB 2W8KA 3VQ5A 2ATLA 1S6QB 3KJVB 4ECXA 4KV8A 1KTQA 1VSIA 3H59A 3QIDA 3MFHA 1JLEA 1TGOA 1YVFA 4ZP8A 5HBMB 3NF9A 4NYFA 2DFHA 2RPIA 5EWGA 1X9MA 5HP1B 2JEIA 4DTRA 3RWUA 4KFBB 3PVXA 4TXSA 4B8AB 1SV5B 2Z1IA 4IG0A 1L3VA 4N76A 4FJHA 1DLOA 1RT7A 2FVQA 3L8BA 4BE1A 4QOZB 4ECVA 3TAFA 3TI0A 2YHBA 1CXUA 4CESA 1LWEA 2A1RA 2QXFA 3EY1A 2FBTA 1K1SA 2XCPA 3V6DA 3O3FA 1XR6A 3HL8A 3DYAB 4CFCA 4CIEA 4IRKA 4ED6A 4CE9A 2C2RA 5F8NA 4OGEA 4NCBA 2BGGA 4FXDA 3SQ1A 4FM2A 3NE6A 2X78A 3QEIA 2PZSA 4DSEA 1N6QB 3M8QA 3FSIA 4MH8A 4R5PA 4M3TA 2HMIA 1J5OA 3WNGA 1EXQA 1VRUA 2WTFA 4W5OA 1RT1B 1S9EA 3L3VA 4IQXA 3C94A 3IAYA 4IFVB 3GILA 1IKWA 3OVNA 3IRXB 3AVLA 2HNZB 2YNGB 4C8KA 4NYZA 4KTZA 3CFRA 4ZPAA 1D8YA 1JKHB 5HROA 3AO1A 3ZT2A 1SL1A 1DTTA 1X9SA 4M3WA 4OJRA 5HBMA 4CEBA 4DFJA 1RYRA 1S9GB 4AHSA 3RB3A 4CGJA 5HP1A 3V6KA 4RNOA 5KFRA 4KFBA 4M3XA 1BCMA 4QWAA 3V4IA 1ZBFA 1SV5A 3B6OA 1C1AA 1KCFA 4HCBA 4CEQA 4JLHA 4YNQA 2OPQA 4DLGA 4Z4GA 4E1MA 4QW9A 4Q45A 5KG4A 2DFFA 3SPZA 3IG1A 2XY7A 1IKVB 1O1WA 2J6SA 3AVCA 4KBIA 4PUOB 4WFZA 5EDWA 5KG1A 4CERA 1U48A 3DYAA 1Z26A 4FLZA 3V9ZA 5K14B 4FYDA 4DLEA 5EU7A 1N6QA 3ZSRA 2LSNA 2YV0X 4RW8A 3KNAA 2D0BA 3QYYA 1JXLA 4AILC 4H8KA 4RW6A 4FK2A 3G0ZA 5KG0A 4CEOA 3IGNA 4FS2A 3NKYA 2Z1HA 2QK9A 1U4BA 1RDBA 2XI2A 4CJLA 3I0SB 4IFVA 3V9SA 3HSTB 4URGA 3IRXA 2HNZA 2YNGA 5KFMA 5E41A 1JKHA 5KGXA 3KLHB 4CF8A 1JLQB 3DLRA 3QERA 4XO0A 1VSMA 1NHVA 4M95A 1J54A 3QO9A 4L8RB 1LV5A 4MQ3A 2C2DA 3O3GA 4CJ4A 1KLNA 3FFIA 4CF1A 4E0DA 4Q0BB 5F8IA 4QWDA 4AHUA 2B4JA 3OYFA 4IDKB 4F3OA 4Z4IA 5J2NB 4CGGA 1TV6B 4ZMMA 4MKAA 1T03B 5KG2A 1UWBA 1JLCB 1N4LA 4O3NA 1Q8IA 4R8UA 4OPKA 4CJQA 4ZTJA 4N41A 1IKVA 1L3TA 2XI3A 2DPJA 1BIZA 4CJKA 2ETJA 4PUOA 3C6TB 4ZPCA 4Q43A 1QAJA 1T7PA 1LWFB 1J9AA 4FVMA 2HHUA 5DQGA 2ZE2A 4ICLA 1Z25A 3OYKA 4DG1B 5K14A 4X2BA 4RNNA 4J9PA 2W9BA 1A5XA 3ULDA 2YKMB 2W9AA 3KK2B 4ID5B 3O3HA 3OY9A 4DL3A 3CJ0A 3L2RA 4W5NA 3GV5B 3H5YA 4H54A 3MTKA 3UDLA 5KGWA 4CEDA 4WFYA 2XY5A 4WZQA 3PR5B 4U6PA 4TY9A 4CK3A 3KHGA 2D7SA 3I0SA 1S0NA 4H4MA 4RW9B 4FLYA 2F8EX 3AVFA 3CM5A 1R0AB 3VQ8A 5CYQB 4GC6A 3HVRA 5KFIA 1RTHB 3CVKA 1HPZA 2JC1A 4GC7A 3PJXA 2IM3A 2D5RA 1KHWA 3FQKA 4IH7A 3L2WA 3KD1E 1NKEA 3RB4A 4OKKA 4KPYA 3LP1B 4K4ZA 5I3UB 4Q0BA 4NLUA 1RT2A 3QESA 2XO7A 1QSSA 3OYJA 2P51A 5KT7A 1CZ9A 3TQ1A 1TV6A 4XIUA 4FJLA 1RBTA 1KLMB 3KMSA 4GVMA 2GIQA 4FLVA 4DU1A 4C8MA 3HJFA 1ZTWA 1S10A 3LANA 3VQ4A 3C6TA 2IDOA 2NUBA 2YKNB 3LWMA 4YMEA 2IJFA 1LWFA 4NLTA 3BSNA 4CJEA 4ECZA 1SL2A 1GX6A 1T94A 4DG1A 1C6VA 1VSDA 3NHGA 3THVA 4FM0A 2YKMA 1JL2A 3KK2A 3VQEA 1RDAA 3UIQA 1TKTB 4CCHA 1LW0A 3NGZA 2B6AB 1LAVA 4QCLA 3G86A 4DSIA 3IN5A 5KFOA 3QEWA 4TN2A 3NH0A 2G8VA 3AA2A 2HWIA 1RBUA 4RW9A 2VG6B 3DLBA 5F8MA 5FROA 1R0AA 3MECB 5CYQA 3QEXA 1RTHA 3ALYA 4KI4A 1JLFA 3I5AA 4Z4HA 1QSLA 1L3UA 4F50A 2AX0A 2W8LA 2WHOA 2PYLA 1HNVA 1Y97A 1XC9A 4IKFA 3RB6A 1IKYB 1XWLA 3DLEA 3ITHB 2FVSA 3LP1A 5I3UA 4TSXA 2I5JB 4DQRA 2GBZA 3AO2A 5KFHA 3MEGB 4CGFA 1A5VA 3KLEB 3NFAA 3HPGA 4EP5A 5C25B 1RBVA 1S1UB 3H5UA 2XGPA 4JS5A 1TKZB 4Y1DA 4RW4B 2ZD1B 1ZBHA 4ELTA 2VG7B 3MR3A 5F8HA 5DG9A 2YKNA 3NBPB 4ED8A 4EEYA 1GOCA 1WAFA 1KVBA 1CXQA 3PX6A 5F8LA 3LP3A 4DTNA 1VK0A 3RBDA 3PW0A 4CGDA 1ZBIA 1CZBA 3BGRB 3SQ4A 1QQCA 2YNFB 4CJUA 3CFPA 4LSLB 3ZSZA 3RRHA 5KFDA 4CJSA 4IH6A 4JV2A 3SQ0A 1G15A 4CECA 1RCHA 3HP9A 2HHSA 2R2SA 3PHEA 4YR3A 4IH5A 3KHHA 3MXIA 1QE1B 4DTOA 3PW5A 4E7IA 4DL5A 3KHLA 2RKIB 3DM2B 3MECA 2P5OA 1SH0A 3AO3A 4B9NA 1RBRA 4B08A 4E7JA 2B43A 4KB1A 1U47A 4FK4A 1IKYA 4HHTA 3LZIA 2OA8A 4H4OB 1FXXA 1JIHA 2I5JA 2E9TA 3UR0A 1D5AA 4ZP9A 4JS4A 3K5OA 1NK4A 1T8EA 2F96A 1KFSA 2WK4A 3OLAA 1JXBA 3DRPB 3HYFA 3KLEA 3GIIA 2RN2A 2WONA 5C42A 4BDPA 2DTUA 5C25A 5DGBA 3IGVA 1S1UA 2R8IA 3LDSA 1BIUA 4NLOA 1TVRB 4HYKA 3JYTB 2YHAA 3H2LA 3VQQA 3OHBA 4RW4A 2ZD1A 4FZXC 3CQ8A
chains in the Genus database with same CATH superfamily
4RKUC 3H90A 2RQMA 2Q6CA 2NPFA 1S49A 3HPHA 3WIUA 2XG8A 4P7VA 3C7NB 1ZPVA 1RT7B 4Q2LA 2VQFK 1AT1B 2Q79A 3U9DA 3CJ1A 2Y3YA 2P9UA 2XS5A 1YHQN 3RMCA 5JVHQ 4QQBA 3I8DA 2CQ4A 4C23A 3FJ2A 5DQIA 5JICA 2QWPA 2RKIA 2V4JB 4PA1A 2OPRB 2NSBA 2WSEC 4A8YA 2ILZA 2GTDA 3SBGA 2Z2ZA 4LF8J 3THXB 1RWVB 2LXIA 1UJ6A 1FJEB 3EX7B 4H4OA 2AW0A 3OTOK 4Z37A 2DCUB 1MWYA 2IJRA 3QQCD 3EVMA 4J2DA 1TK0A 5KG6A 5HOOA 5ETKA 3GG4A 3VQSA 4IWVA 4HUGA 3TJ8A 4NB4A 2FBXA 3LDOA 2BBEA 4NZ6A 4J9KA 2KYXA 1FA0A 3V4IB 1BI4B 4U67L 2DHGA 4N56A 4B9VA 2MSSA 5KOWA 1RILA 4ELVA 2ROGA 4PKIA 4YB1P 2GWJA 1LK5A 3BP8A 3IG1B 2BM1A 5DETA 4Y6IA 2FSKA 2O3DA 4IG3A 4ID8A 2RRAA 3ZSVA 2E1ZA 2O8CB 2DNQA 2EC0A 1TL1B 1TL3A 1M1HA 3PKMA 4WFNL 3TZXA 2RHSB 5LMUK 2H5JB 3NVKA 4Y2CA 3SUOA 3RUBL 3B4DA 2HSEB 4KRFA 3GIMA 4DPYA 1Q8LA 2V63A 3AVBA 3OD2A 4IR1A 3O4NA 3R7SB 5EXWA 2CJKA 4UOFA 5JMNA 4Z4CA 2ASJA 4BRKA 3CF5Q 3ZT1A 1HI1A 4AQYF 5JVHL 4DV5F 5FPMA 4KHSA 5KFQA 5EGYA 3VHQA 5F9NA 2O8EB 1JXVA 3MCMA 3P38A 3SQGA 3SNNA 3CULA 3MEDA 3B4MA 4OYWA 2VWJA 1S5ZA 5HVHA 2BABA 2MGZA 4K2XA 3KZBA 2P9LA 1YBUA 3U3YA 1ZBTA 3FFIB 1C0FA 4FM1A 1NK6A 3NS7B 3FFKB 4I1TA 4B1ZA 4B3MJ 4JKDA 2KL8A 3QT6A 4DV7F 1ZETA 3QBWA 1VAZA 3CERA 4ZIWA 3DMJB 4JYAK 1RHUB 1XR7A 4K8RA 4ECSA 5HRPA 4JI8F 1URRA 4JI7J 4ICLB 3VAGA 1KVKA 1VBZA 2KHCA 2G0JA 4ES3A 4KTWA 4BR0A 1CJKB 5M1QA 5KFSA 2QGFB 1FXLA 1F5CA 3GJQB 2RJZA 4DSFA 3N6LA 4ZVRB 3BN7A 1S6PB 2XHBA 1X31C 5KAKA 2AF6A 3MUMP 4C4WA 3RR8A 3G4SS 1RB0A 1VS3A 5KFJA 4CF0A 2BUNA 1AW0A 2CPXA 3BH7B 3C15B 3VV2B 3L4IA 5BREA 1TFYA 1FJCA 4YN3B 3PUFA 4JUZA 2ASLA 3HZGA 1JJ2M 2R2TA 3BO3A 4IO1A 3T5KA 1U09A 4X4PA 4DF4A 1RT2B 3CF5L 4KKOA 4JRQA 1W97L 4Q2MA 2BKOA 1GMVA 3VEYA 4X4QA 3CPWM 3L2VA 2CJYB 1ATNA 1S1VA 4I2QA 5HLFB 4OYZA 2DPIA 3U8XA 5DM7Q 1RGVA 1IJEB 3C16B 5K20B 1IWAA 3O6WA 3PIPL 5I42A 4CFAA 1HQEA 2IPOB 2EEYA 1Z05A 3JSMA 1CG2A 2E5LK 2GHPA 2Q36A 2C2EA 3L7PA 4H5VA 1VHFA 2VJUA 3PEHA 4FNIA 3BREA 2UU9J 4YB7A 1TUVA 3GYXB 1YHQS 2B4OA 2ZDOA 4NXMJ 4CM2A 2NXUA 1HWJA 3CD7A 3EM1A 1BU6O 3KOAA 3CDEA 1A6LA 3D45A 1WEZA 5ETLA 3V6HA 2J76E 1Q86O 2W9CB 3DLGA 2EPIA 1JLFB 2OTLN 4JNEA 1ZC6A 1RISA 1HNVB 1PO6A 3CCLN 4KQZA 3DLEB 5J2QB 1JLAB 1D8ZA 3ZZTA 4KHQA 2HB5A 3I5CA 4WTYA 1NK7A 2IS3A 2CGJA 2P9SB 4DR2K 3EGWB 4B3TJ 4A61A 4QWCA 2XWXA 1VI7A 2YJFA 5LSLA 1IJFB 1I39A 3L7UA 2OZSA 3DN9A 4HWIA 5CZ1A 2AJ0A 2BX6A 1LWCB 4O8KA 3ZETB 1GAOA 3TWZA 4WYBA 3MXHP 4JI1K 3US5A 3RYLA 3K8VA 2VB6A 3TJ9A 2CPFA 4DSJA 3HO1A 1OPIA 4UZBA 4HTIA 2EBGA 1RKJA 1XNRK 3QT7A 3GWCA 2PBDA 1H2VZ 4CIGA 2W40A 4YHHF 4MJKA 4K8ZA 2YNIA 1Y7PA 3NLCA 5DM7L 3W9IA 3RZAA 3O6QA 3OS0A 1FRHA 1KC8O 4DX7A 1UZHA 3I0RA 4U7UK 3T5HA 5DJBA 2MJNA 5KRSA 4Y2IA 2X3DA 4BQZA 4PY5A 2VBWA 3OYCA 5KFAA 3OYEA 2YWWA 1OY6A 3EWGA 3KTQA 4UUXA 3CMEN 4HTJA 2EKNA 5B09A 3Q8YA 4J9VA 1R43A 5B08A 4LF5J 1BC6A 3CCEN 2P5GA 3D0HE 1U2CA 4JI6J 1Y4ZB 2YH1A 3ZEUA 3OL9A 1HNXF 1S6OA 4NL5A 2CJAA 1Q9YA 4YOEA 2HNDA 4LIRA 5E3RA 3HSDA 1RDDA 4DUZJ 1NGAA 1G1XA 2B5JA 1GMWD 2VG5B 4TNOA 2YHYA 4DUYK 2YX6A 4QIWD 1NK0A 4DSLA 1PAEX 2IVPA 3DOMA 2EHGA 3D6FB 3BKTA 4NRUA 3R1LA 1N36K 5HRNA 5JLHA 1H74A 4BRDA 4LR8A 4DZ6A 2AIRB 1CJTA 7AT1B 1DTQB 3QBXA 4ZIVA 2IJNA 1RT3A 3DDKA 4JD2A 3A8IA 2HQIA 2E6MA 2OZMA 3E01A 2A6AA 1YITN 5LMNF 1D09B 1T9XA 1VDHA 3CDAA 4OIXA 2OMLA 2RQKA 3CDBA 3CCQS 2Q97A 4RNHA 1RT4B 2GCFA 3ZTQA 2V8HA 1M1GA 4JAXA 4CO3A 3LQVA 2HIQA 3IS9B 3UD4P 2QW9A 1RA6A 2OI2A 4DTPA 2H3GX 2DGQA 2BEFA 3T19A 4KE5A 4PYDA 1JNRB 4JKEA 5HJXA 2VV5A 3PYFA 4DTUA 5KG3A 2HEKA 2UUCF 3T1HK 4OI1A 3OBWA 5DGAA 4S0MA 4V1Ak 3S9HA 1FKPB 1RAAB 4M5DB 4PG6A 2A3JA 4MMOA 3TAEA 4DN9A 2E66A 2ZH6A 5GAEI 3HK2A 3OR2B 3CJSA 5JJBA 2DXEA 4ZVEA 4HDGA 5E3PA 3G71N 1FE0A 3SAFA 4DTJA 3CT9A 2AEFA 3R5GA 3EPGA 3B8HA 4WTOB 3BQ2A 3KWGA 4QWEA 4PQUB 1W2BM 2QZ8A 2FUG9 1HKAA 4CZEA 3I55S 3AB4B 1OH7A 1JLGA 4YR0A 1FNOA 1O13A 3EKSA 3CI5A 1PILA 2QMXA 4X4SA 2P9KA 5KFKA 3UD5A 4CHOA 1Q1KA 3SQGB 4LFBF 3O1BA 1TUGB 4AYBD 1ITPA 5BN8A 3JTPA 2R9LA 2VKZG 2BQRA 5DG7A 2MGZB 3CCLS 2V51B 1RTDB 3I87A 4OJ3A 3LUYA 2GC8A 4DN0A 5B0FA 2HHPA 1Q78A 4USTA 4OPJA 3K5MA 3SDEB 1WF2A 4CW7B 2LEAA 1S0MA 1C0TB 4O44A 2DPNA 4R0JA 3MM8A 2CZVC 3NCPA 3NY0A 4EO6A 1AUSL 4JN4A 4IR9A 3CCMS 4XDDA 3C19A 3W65A 3CC2N 1SXLA 2CADA 1UL3A 4J90A 2D3OR 1ESVA 1OSCA 3DLKA 1NPKA 2U1AA 4X4OA 1YRTA 1V9OA 2W42A 3Q8SB 4FYYB 2OPSA 3C95A 4EU0A 4DFKA 3DU6A 5B0AA 5FDLB 1RQ0A 3DCAA 4IRCA 4E7HA 3W1YC 3OYAA 2CDRB 2L08A 2I6WA 4G3IA 3VAIA 1DRZA 1JJ4A 1NG9A 4XPEA 4FLWA 2IM1A 4O4GB 1F60B 1S3XA 4AHVA 2XYGB 2DR5A 4CVNE 3AXKA 3M2RA 3QLHB 1E4FT 1YJ7A 5F8JA 1RK8A 3IP0A 3D68A 2E8AA 2KJVA 2NUUG 2NSCA 1U8SA 3CMES 3CNQP 3MEEB 3KHRA 1N5YA 5J1EA 4HHJA 4IOBA 3KJVA 1WHWA 3NG8A 1VHXA 4KHWA 3PX4A 4K59A 2R7RA 3AVAA 4KKOB 4O3OA 2BE7D 3R5JB 3NGTA 4F4YA 5C5JA 4FWSA 1S1VB 4I2QB 3B78A 2PFUA 1RXOB 4WIIA 2HHXA 2XTJP 4GKKF 3WQTA 5HJYA 5I42B 1HQEB 5EWFA 5LL6d 3NCRA 1PSDA 5KFUA 4GKJK 3SYZA 3D3CJ 1SJQA 3AJDA 2AWZA 2BJ1A 3G8SA 3C0BA 1NNDA 4H0OA 3PY8A 4B1VA 3EZUA 1UVJA 4D3GA 1V5IB 4JI5F 4DCHA 4LQ3A 1XI1A 5C2CA 5EHHA 1ASWA 3UCGA 3OSNA 2CKWA 4X84A 3PFEA 4URSA 1NGDA 2I2YA 4M94A 4I6AA 5JS1A 4O4RA 2J9CA 4TQSA 2O8DB 2CG4A 2GMLA 3OL7A 1T9VA 3ILLA 2CQ2A 2VL1A 4Q5VA 1RAHB 1OYDA 5BR9A 3M8PB 2NZ4A 3CJ5A 2YTCA 2NPIA 4ZVSB 3AJ2A 5U47A 3A8EA 4ZLJA 2OD6A 3HBTA 4BRIA 3THWA 2RUSA 2WZ1A 2C3YA 3VAKA 4DQQA 3HHLC 4CHZA 1SBRA 2KFYA 1SQKA 2MDAA 4C1NK 4CTAB 4YS2A 1JJCB 1MMDA 3HKWA 2KFNA 3N01A 4P9SA 4KREA 1QVGR 3CO9A 5KFBA 8AT1B 1MNEA 4ZP7A 2Y0BB 1EAYC 4KRWA 2PA8D 3QT5A 3G71S 4F4WA 4FZYA 2PY5A 4USUA 4DX6A 4Z7CA 2ZH9A 5ETVA 2CNNB 1YJTA 4QOTA 4J2BA 4KH4A 3N6NA 5DS7A 4OX9F 3I0RB 2QO3A 1WN7A 3EZ5A 1MU2B 3CJKA 1WNEA 3SMSA 4OLBA 2NNWA 4CT9A 4QBUA 1I1GA 3LM2A 2XNQA 4JKAA 3AVJA 4JI3K 2GX9A 1C2PA 1RAFB 4GMJB 3C46A 2QC3A 2HQCA 3TVKA 1QUPA 3QB0A 1PJ6A 5C2GA 1T02A 2DO0A 1PC4A 4JI0F 2UV8G 5KT2A 5A6WA 4E7LA 4Y00A 3RBXA 1NU4A 4GO7X 4K4SA 5GAGU 4NLQA 2K2PA 2XULA 4NLSA 3NGYA 3KLGA 4PRFA 2QE5A 4AHTA 3CEDA 2M0GB 1FFGB 1QD1A 4IDKA 1OO0B 2RQ4A 5J2NA 1WI8A 4AH9A 3DOMB 3M9NB 1J5EJ 3BSAA 1C0GA 3AJ1A 4N8OA 3C14A 2RRBA 4EZ9A 1UPMB 1TKXA 2Z1GA 4LH5A 1K1QA 2WVEA 1WJ9A 1B92A 4WCEQ 2EFQA 4ZJOA 2BXJA 2DIUA 3KK1B 1WSRA 4DWIA 4A2BA 3IO1A 3CCJN 3CC2S 4ID5A 2PFFB 1I94K 4BWMA 4CK1A 2ZH1A 3KDOA 3RMDA 1FESA 2MLYA 5TKYA 1CBKA 4KB0A 2VD3A 3TX0A 1KS2A 4FWMA 3EE3A 5D3GA 4FF1A 3F44A 1W7WA 2FLPA 4TKTA 6AT1B 4FJGA 5IQQA 3NNAA 4BRAA 2VPYB 3D0IE 4FF4A 3RR7A 3AVIA 1HMVA 2QL7B 1X4GA 3VQCA 4KI6A 3V81A 2D1CA 4ALZA 3HPOA 2DHSA 2E1RA 3BO2A 4DMNA 5KRTA 5FRMA 1EQYA 4ILJA 3DOKB 1QZ6A 3ENQA 4I56A 2F8SA 3CD5A 1N34K 4OYOA 4ECTA 4LY7A 3PYEA 3CCUN 1U1RA 2CYYA 4QR1A 4TLQA 2WVBA 2H5EA 5FPDA 3OL6A 3AD9C 2JNJA 1BQNB 4KAIA 4E7KA 4QW8A 2XNRA 1TKTA 4RWWA 3H4DA 4WF9Q 2PGCA 1X0PA 4K0KF 3AAPA 5DLFA 4OX8A 1HIYA 3BQ1A 1JLGB 3BDPA 4OZ2A 2R2RA 4AL5A 4DV6J 1UVIA 2XY8A 4CDIA 4WCEL 4ZJLA 3T1AA 2J8SA 2DRAA 4QAGA 3U1MA 1HLUA 2JJ4D 2G2ZA 2R7YA 1KNZA 4PKDB 1ZH5A 4FJ7A 3FE1A 3ITHA 4USMA 2L9DA 4WE1A 4OYPA 2PEBA 4K43A 4O0JA 1XERA 1RJJA 2MKIA 2Z2YB 3AAQA 1QLNA 5F3TA 2GHWA 5DO2A 1WLJA 3WT0A 4P73A 2LQ5A 4LF4K 4MKYA 3LALA 5C24A 2RU9A 4G6VB 2OPPA 2XYPB 4HT7A 4BDZA 2KHDA 2YKAA 2VWKA 3K57A 2QSFA 3H4BA 1GLDG 2VCPA 4MIBA 4ZJQA 3VAFA 2IAJA 1VQPN 4Q44A 1VQMS 4K4XA 2DY9A 3NWRA 1VSJA 2UVRA 3GZ7A 4PG5A 2HZVA 3VR1A 4C6AA 2E4LA 3RSEA 1RTIA 5AE1A 4OL8A 3GIRA 4NLCA 4DR3J 1ZS6A 1TK5A 2HFZA 2NRWA 2HGLA 2CWXA 2MMYA 1XUPO 2HMIB 4Z4EA 2LMIA 1B0PA 1KKHA 2PYJA 3GTYX 1REGX 4NA2A 3TAPA 3M2RB 1OPZA 4WF9L 3AOBA 2IIHA 2BJ3A 1OJ4A 2ATLA 1M90T 1VQ8N 1UMJA 2LLZA 3QJLA 2EW9A 3KJVB 1N32F 4ECXA 3ZZUA 1VSIA 2KRBA 1O51A 1YVFA 4JKGA 3F41A 4RUHA 4NYFA 4H03B 2DFHA 2RPIA 5EWGA 3MX2A 3RWUA 2WSCC 4NXNF 2ITMA 4KFBB 3PVXA 4NZ7A 1SC4B 5D8HB 3CE8A 2MQOA 4IG0A 3F9MA 2OD4A 1DLOA 1FEHA 4CLUA 4E98A 2FYXA 1ICEB 3QSIA 2YHBA 3SBMA 3JQJA 2A1RA 3VGKA 1K1SA 3EEQA 1TFWA 1PJ5A 1RWKB 2HHHJ 2EXUA 1TL4A 2E29A 1N6QB 3M8QA 4NO7A 4R5PA 5KQDA 1J5OA 3CCJS 3IAM9 2MPUA 3WNGA 4EIAA 1UTAA 1IBMF 1RP5A 3EZWA 2WTFA 5L46A 1TU0B 1S9EA 3L3VA 4IQXA 1DZ5A 1FDAA 3S41A 2HNZB 3S1TA 2C3PA 4A8FA 4KTZA 3NS5A 4ZPAA 2G4BA 1IVZA 2RQCA 2ZM6K 4B3RF 3KJQB 4M3WA 4JI4J 1CJVB 4OJRA 1LFPA 4X65F 1IJJA 3VESA 3VOVA 3RB3A 2HK3A 2CPYA 2F7TA 1BCMA 5HVGA 3D1QA 3B6OA 1FD2A 2DYAA 2KT2A 1W7AA 2AJ1A 3R1XA 4JLHA 2V2VA 2PMWA 4DLGA 3OTDA 4C7QA 5HQMA 3VGTA 4A48A 1UW9A 3G25A 1CQMA 2XY7A 1O1WA 3N0VA 1I51B 4KBIA 4PUOB 5K8MA 3CCUS 5EDWA 4LF7J 1QZ5A 1U48A 4FLZA 2WAQD 1CVJA 4FYDA 1NPRA 3W8GA 7FDRA 1X3NA 4KGVB 3ZSRA 4LT6A 2YV0X 3QYYA 1HBUB 1JXLA 4AILC 4RW6A 2CQIA 2OSQA 3CJKB 3BKFA 2F3JA 4F9OA 1YG0A 4CEOA 3MK6A 3IGNA 1Q81T 2Z1HA 3MHYA 4L3NA 1U4BA 4I6MB 5LJWA 1U24A 4IFVA 4A8SA 2QWNA 3HSTB 2ZDPA 2HK2A 3BBCA 4BVPA 5KGXA 5IT0A 4EUVA 2AYMA 2FZKB 1VSMA 3H2VE 4L8RB 1LV5A 2FHJA 4CBWA 4LREA 2Z2LA 1KAYA 3S01A 3TR5A 2QJ3A 4QWDA 2B4JA 4IDKB 5J2NB 1SQGA 1TV6B 4WBFA 4ZMMA 2M52A 1D9AA 1R8HA 1TL7B 2B9EA 2LVWA 4OPKA 2H48B 3HM8A 4CJKA 1FFWB 2ZNZA 2GVZB 3C6TB 3ZZZA 4Q43A 4NI2A 2D9OA 2HAFA 3K2YA 2AJFE 4DX5A 3OYKA 3E9OA 3BR8A 5BYRA 2YKMB 3D1HA 1YJNS 4OX9J 3KK2B 1HX1A 4ID5B 1X4AA 4DL3A 3CJ0A 3HD1A 2K8GA 3AB2B 1N33J 1V6HA 5KGWA 1WSVA 4CEDA 1VQPS 4CK3A 4DR4K 4V19S 2D7SA 3I0SA 4RWXA 2E1MC 2XBPA 4RW9B 4FLYA 2R7SA 4TU9A 1VQ7N 1X4BA 3CCWA 4DR5K 5KPRA 1GEHA 3KXDA 5KFIA 2E20A 1KONA 4NYPA 1H98A 2HPUA 3MR7A 2HFUA 1VQ6N 4IH7A 4RCHA 4DU8A 1E4GT 1VR6A 2Q43A 1S57A 4Q0BA 2NS1B 3HMJG 2XO7A 2ZUAA 1XIQA 1QSSA 4EI2A 5KT7A 4XIUA 4FJLA 1RBTA 4KIAA 4X66F 1VQ8S 1F2GA 2GIQA 4JK8A 4DU1A 3EKUA 3KUGA 1YGYA 2QYGA 3OUYA 3LWMA 4LRCA 4YMEA 2VWBA 1SL2A 3U9ZA 3FZKA 3NHGA 4FM0A 1TKTB 3M6GA 1EO1A 1LAVA 3QWUA 1WBBA 4DSIA 3IN5A 1BG3A 1H3DA 5KFOA 3QEWA 3NH0A 2G8VA 2B4UA 3LL3A 4MKVA 2XEXA 5AQRA 3R3TA 5AFUH 4NMLA 3AQPA 5F8MA 4DPTA 5CE3A 4M5GA 1Y9OA 3G87A 3H46O 3QFWA 2XO6A 5MLCV 2WHOA 3BF3A 3RB6A 2HGNA 2V67A 2MSTA 3BM7A 3ITHB 4Y2KA 2R7XA 3LP1A 2ABYA 4TSXA 2GBZA 1WC1A 1PCAA 4LBHA 2QMUB 3ETOA 3W2VA 3JTOA 1FKAF 1BLUA 4X64K 1RBVA 2XMAA 4JS5A 4Y1DA 4RW4B 2ZD1B 2YKQA 5DG9A 3NBPB 3UNGC 2ZOGA 2NXNA 3PX6A 2JVRA 3BYPA 2IHR1 3GBTA 3K0SA 1VK0A 4RJVA 4E1JA 2BOAA 3CJ8A 1CZBA 1S22A 1BWEA 2HVZA 1GLEG 4CJSA 4IH6A 2X1GA 4JV2A 3SQ0A 3VPZA 1KR4A 1YIJN 5AZIB 4FF3A 2I38A 5AQWA 3RSEB 2HFSA 2QT7A 1QE1B 3TTDA 4OYMA 2GAHC 2XMJA 1GLBG 3UE5A 3GLJA 2IVOA 1SH0A 2CQ1A 4B9NA 3AO3A 1FX4A 1RBRA 4E7JA 4O8UA 2B43A 2QLWA 4BBYA 1NEEA 2VDIA 5AQQA 4QIVA 4LF8K 3QAEA 5AR0A 2E9TA 2IIRA 4JS4A 1NK4A 2F96A 4LF9F 3D6MB 4ZITA 1JXBA 3RJMB 3KLEA 3P39A 2WONA 5C42A 2FPHX 4ILMA 5DGBA 3IGVA 4KHPF 4HACB 4OZJA 3BEGB 3LDSA 1YK9A 2MKJA 3W2WA 1TVRB 2VZ9A 2YHAA 3JYTB 2XS2A 4F36A 1YVNA 3CFOA 1GTEA 3HHEA 3FZBA 1S6UA 4I2PB 2HVDA 4A46A 3MPUB 3FDSA 2F5GA 2LQ9A 3GV7B 2WBRA 4D3HA 5HSPA 5G0RA 3MEKA 4DTXA 2RHQB 1RE1B 2LQJA 3EGNA 1NMDA 3IBFB 4FJXA 3OVSA 3W5XA 2HNYB 1K8KA 3HKZD 1D9DA 3ZZPA 1XN9A 5A8WA 1QVGM 3CYMA 4G1PA 2R4FA 1NJIT 1MWZA 2K7JA 2QSWA 2L41A 1HBOA 4DS4A 4TY8A 4ZK7M 3DM2A 4DR7J 4OV6A 1SH3A 3W64A 4UOCA 4IOCQ 1QVFR 3MX5A 2MYFA 4HUFA 2MZTA 3HI0A 3ATUA 3RMAA 5ELZA 1U25A 3ZTSA 4DFPA 4BG8A 1BUXA 3WNHA 2V9KA 3M3ZA 2IRYA 3TUZC 3QEVA 5L9XA 2EX3A 2DO4A 1R0BG 2ZJQQ 2MZQA 4NCGA 5KFFA 1P1LA 4UTGA 2V8PA 2UUBF 2XMTA 3QRRA 4ED5A 2ATQA 1XMOF 1B70B 3QJJA 1Y3JA 3CDWA 3MD3A 3ZSYA 2ASDA 5DDRC 1Q7YT 3TVZA 2GV1A 2IVMA 2R7VA 5CHIA 3IC1A 4NLDA 4ATNA 4B02A 4BC7A 5IV4A 2VKRA 3IBWA 3LP2A 1RKIA 5IQ6A 3O1LA 4B9SA 1C1BB 2EI5A 2OUGA 4B3MK 4LF1A 2EC2A 5ETRA 2GGPB 1K6YA 5IV3A 2ZNYA 4QU6A 5AXMA 4O3SA 4JI7K 3L95X 3CCRN 1WKKA 5KTQA 4RW6B 5L9NA 3NGIA 7FD1A 2KKHA 3K5NA 2ZITA 2N4DA 2PMZD 5SWMA 4B3RJ 3NNCA 3RRKA 3CSKA 3LTOA 3TVYA 4HUEA 4CHNA 1F3FA 4KH1B 4U8YA 4NOHA 2YKOA 2BJEA 5AQJA 3J81Y 2FLLA 1JL1A 1VJWA 4IOCL 1OMSA 4LQ9A 3W61A 3BN4A 2W6LA 3I96A 1V3SA 2IGIA 2E7WA 3I9ZA 3NAIA 2V2ZA 2P9GA 2DGWA 2CA9A 3UR3C 3Q8RB 2ZJQL 1DY3A 3K2PA 2YNHB 4OKJA 4ZDNA 4X62J 4FOEA 3G82A 1VC5A 2RE2A 3HVWA 2X74A 3R27A 4ILGB 4I9QA 3SEOA 5M2PA 2VC0A 4DB3A 1NGBA 3AAWB 1Y5NB 4CJRA 4PQAA 5IT4A 2CPDA 2V34A 5HK4A 1IKXB 2CWKA 1KAXA 4FJNA 1XTZA 3POTA 2ZH5A 1AUDA 4RWTA 1IBKJ 1B9FA 2UU9K 1YIJS 3A2FA 2A40A 3VA3A 2C22A 3VQ7A 4CF2A 1S72S 1PYTA 5T14A 4NXMK 1CC7A 2ZWPA 3AVNA 2BTFA 3DRYA 3FBBA 2PN6A 1NGHA 1QHAA 4EYHB 3AFGA 1W2IA 4ECUA 1FRIA 3PO5A 2VBYA 1UFLA 1S1TA 4CH0S 4KBOA 4H4KC 1HWIA 1CLFA 2UXBJ 1OH5A 4RTFD 5DDOC 1FRMA 1S1XA 5CA5A 2CNOB 2CXEA 4QYRA 1LOUA 3GCWP 4NCAA 4CLYA 3G6XA 2N7YA 3EUNA 4B3TK 3QSYB 4JYAF 4FLXA 3OUYB 1Q4RA 3J7YU 2AD9A 5A0YA 4EMDA 4FJ5A 1GFWB 2YPYA 1PBAA 4H0PA 3KLIA 3GR1A 4U95A 1FRJA 1KVAA 1EETA 4CLSA 2BVZA 3HF5A 4BRGA 1PBUA 4AXIA 2QA4N 4ZPTR 4CJTA 4IUFA 2DFEA 3VQ9A 4DV0J 4FVUA 4C0OC 3PLAA 1VQ9N 3DRSA 4CFBA 2KN4A 3WNEA 1AROP 3DAWA 2FLOA 1H2UX 3D2FB 4HT5A 2HAIA 3MUVP 5HMYA 1Z2ZA 1K0TA 3TSPA 2WTUA 3VF6A 1UA0A 2EVZA 1VQ5N 2YY3A 4FJ9A 4LF5K 3D6HB 1R8AA 2WSFC 3QNWB 4BRLA 3SI6A 5DK5A 4JI6K 4RL1A 4RW7A 3ZXWA 3UCZP 4PCQA 5AQKA 2ZKTA 3HT0A 4YFUA 2A5XA 1LWXA 1DQAA 1HARA 4DUZK 2P9IA 4ILRA 4X4TA 4LUBA 2E5JA 5F1XA 4R79A 5EOYA 4K5RA 3MR2A 1RWPB 1MDUB 3E1YA 4H5NA 4BCAA 2E5LF 3DLJA 2HS0A 2UXCJ 3PO4A 3O5TB 4Z94A 8RUCA 1EJ7L 1EWQA 4LR9A 1FKOA 3PJ9A 4KC5A 4OI2A 2ZWOA 2AZ1A 3MOJB 2L48A 4DCJB 3JXUA 1IN0A 3ISND 1BMQB 1YQHA 1D9FA 3E51A 1ZBLA 4ZS6A 3RAQA 3DOLB 1M90O 3PX0A 2HGMA 4J5OA 4CZJA 3G8QA 2FJXA 3CCRS 5GADP 3ICLA 1ASUA 1F2HA 4HKQA 2QFJA 4BC4A 4P6QA 4ECRA 5HMXA 4KT0C 3OHAA 1WEXA 1M5HA 4FCYA 1HNWJ 3T1YJ 2O8FA 4LBPA 1XMQJ 2WONB 5C42B 4RUCA 2WVCA 3MN5A 2G8IA 1XHXA 5CYMA 1X7VA 2JWNA 3JSRA 3VQPA 4BE2A 1QY7A 1TK8A 3P5BP 4CM0A 3SUNA 2PAVA 4I7FA 5AXKA 5ADXH 2ASOA 2PIIA 3BGUA 4KTQA 4JI1F 4Q7AA 2Z56B 2FLNA 2NRTA 1FFSB 1XK8A 4OYIA 5G0RB 1S1WB 4RNMA 4DF8A 2D41A 2L9NA 1M5KC 4K5SA 1EWRA 4DV2J 2KTQA 4K7QA 1K8KB 4CZHA 1SAZA 3DXKA 2BJDA 3WC2A 2JC0A 3MMCB 1HFEL 4FJIA 1SB6A 2E2OA 1LNQA 3LWLA 3CXCR 3MAAA 4TY8B 1QQMA 3UKUA 1F1BB 1Z2LA 4EWTA 3H6EA 1S59A 1HR0J 2MEWA 3VALA 4J2AA 2PO4A 2UUAJ 4O0NA 1DEJA 4Y1CA 2BANA 4B3OA 4USIA 3DXMA 2LQ8A 2HHQA 4HH1A 1RWNB 2RMLA 3VZHA 1Z6RA 2RF2B 1AB8A 3MAHA 3PIOL 3PR4A 4ECQA 1RHRB 3H20A 1FJGJ 4NCGB 2JEJA 5GAGI 4NEZA 2RS2A 1VQLN 4PWDB 2BM0A 3CM6A 2KM8B 1CS4A 4A47A 1G7CB 3CC4N 1XNQF 4N47A 2D3UA 1N36F 5K8OA 3AVHA 4C8ZA 5K8NA 2NLWA 5J2PA 2RAQA 2A0FB 4LBIA 3GFXA 1BWFO 4CJ7A 3F9KA 1N5SA 2XMMA 5HO4A 2MLXA 3QGHA 1RZMA 2KB2A 1Q81O 2UUTA 3SK3A 1RTJB 3THTA 4WYWA 1HNIB 3PRVA 3HVTA 4TU8A 4M5MA 4I9LA 4F0MA 3D5MA 3FR0A 3PW7A 5AQZA 1Q53A 5AJ3J 4IEEA 2VQEJ 3MGJA 2D74B 2BE9B 4CJFA 3KLFA 1RHQB 4DPWA 1AYEA 1O6XA 5HRRA 3VGLA 1T05A 4CNZA 2QA4S 5RUBA 1MLAA 3ET6A 2CPEA 3OXFA 3QGGA 2HBLA 2Q0UA 1VQ9S 2XCAA 2KRRA 4NYNA 3LPUA 2G13A 2YKPA 2Y0SD 4IFYB 4ISGA 4B3SJ 3AA3A 3M30A 4C8OA 2UUBJ 2QLBB 2I1RA 5GADU 1RAJA 4ZLPA 3B82A 2FGCA 4LH4A 3CIZA 1W26A 4KAZA 3QPIA 3O1WA 1WDDA 3WX4A 4QIEA 3OXLA 1VQ5S 4P10A 3C66A 4MIWA 5L1IA 2ALZA 1BQMA 3C6UA 1N88A 4B9LA 4ZN3A 2PFDA 2HS3A 3HM9A 3MAQA 2VF3A 5HATA 3DDIA 1LK7A 3WX8A 2V9WA 3G82B 2QLXA 4YDUA 2B8QA 3GYNA 2D1KA 3TA1A 3Q8PB 3QIPB 1DHMA 4ISEA 1M5SA 1HYSB 2XZDB 3BS9A 2GELA 4QS8A 2GNKA 2NXEA 3POTB 4KGMA 2N82B 4F4ZA 3V1QA 3N4QA 1GLAG 1S0VA 3O9SA 3NH2A 2ROPA 2V8GA 3PSFA 3I4PA 2MXYA 4RUAA 3MPYA 3QWPA 2BJ7A 2Z0GA 2YXLA 2E1AA 2NRVA 1WDTA 1TUYA 1IG9A 2DY4A 4FBUA 2DH7A 3NL0A 5E3CA 1N0VC 2CQ0A 5T7LA 4Z4FA 2P6TA 4OI0A 1B99A 4LRAA 4F67A 1RWOB 4P2MA 2O66A 3NMUA 3EGZA 2HBYB 3KNGA 3I6PA 2WBMA 1WG5A 1SC6A 2OH2A 3C8YA 3HSGA 3E3XA 3NMRA 5A2QO 3MMAA 3UN3A 3LDPA 4CH7A 3K9JA 1DQ8A 1BOTO 2Z8QA 3F56A 4EK2A 5H9FJ 2LA4A 1NDKA 2RS8A 5A0YB 3D4JA 5J1PA 2M2BA 2EWHA 1JMTA 3KLIB 4FLUA 2QYCA 5KG7A 1EETB 2VA3A 2GJIA 4TYAA 3ZT0A 4CFDA 1C0MA 2QMWA 3OA9A 2RB7A 2RT3A 4F2RA 2LECA 2KM8C 3TUIC 2E5IA 5AXLA 3KDNA 3SCJE 1EB0A 1RT6B 4URQU 1ZA2B 5EWEA 1JJHA 1RDWX 1EQMA 1RBLA 2C28A 4L74A 4GNIA 4KHMA 5KFZA 3Q22A 3QNNA 1RHMB 1IR1A 2JZ5A 2A1SA 4IO9Q 3AODA 1NK9A 4RU2A 3D7EO 3ZYYX 1S9GA 1KFDA 3ZC4A 2KZMA 4NLBA 1CC8A 1MA9B 3OS1A 4CI6A 1B9DA 1VQLS 1CULA 2QTWA 3LH2S 2P9IB 2QKKA 2M7SA 2AZ3A 3TTCA 1XHZA 1N54B 3CC4S 1GXTA 2AV5A 4EO8A 1UAWA 2ZH8A 4UW2A 5DG8A 4GKJF 1J5EK 1S5JA 2AGOA 4E89A 1MMLA 4OGCA 4O3PA 2IDLA 1OKJA 3O9QA 4P2FA 2R8JA 4DMZA 3G6EN 4G65A 2ZZNA 5D0EA 3CCVN 4C0BA 3ZO7A 2HQGA 1L5UA 5HL7Q 3H40A 2F4VF 4OVLA 3TQEA 1YJ9S 2LKZA 3TZYA 4O0IA 2XQCA 4HDHA 4U7BA 3MM5B 3AT1B 3ZNJ1 2WB1D 4ILHA 1UZDA 2ZGZA 1SKSA 1QVFM 3HLUA 4JB8B 3NGDA 2DNLA 3GL1A 3D28A 2B9WA 2KVQE 2F8TA 1DGKN 1HNXK 3QDKA 2YCHA 2VU5A 2OCEA 5E33A 1U1NA 1IBLF 2AA4A 1LQ9A 3TAQA 5DZ6A 4CZMA 2GIRA 3IUCA 5ETNA 2Y8WA 3BO4A 3PDNA 5A2QU 4WQ5C 5DLGA 3NDKA 4IO9L 4BDYA 3OTEA 4ID1A 2W4PA 2WC9A 2OFGX 4A8OA 2F9TA 2DHHA 2K1RA 1HD0A 4FJMA 2AHOB 2MHNA 1RLCL 3DHWC 4CRJA 4AXJA 4MT1A 3ZX0A 2BMBA 3DXKB 4YR2A 1SJRA 3KFWX 4OZ1A 1U1LA 5KFXA 2DD8S 2RDJA 3CTRA 4FXWA 3MAAB 3UKUB 3ILOA 1NH7A 1FK9A 3LAKA 2R8GA 2V4QA 3ZNUA 3BV8A 4HVZA 2X1AA 2R8HA 2BANB 3W8PA 3PG9A 3LZJA 2WW8A 3HP6A 1BA1A 2GVDA 4KHYA 1Q7YO 2A6OA 4L6V3 5SZTA 4DV6K 2AT1B 1NSQA 1N5QA 1FX2A 3D2EA 4YOUA 2UUCK 1G6BA 1HHTP 3SUQA 5AQFA 3DI6A 5HL7L 2O8BA 4WK3A 5IC6B 4B8CA 1T6DA 1UCNA 2UVUA 4ZHRA 1CS4B 2BQUA 3VETA 3FZHA 1S48A 1EP4B 4G1QB 4I69A 3ZLJA 3GQCA 2AGPA 2R3VA 2DGOA 2FTRA 3MFIA 4WK1A 1ULRA 1GNKA 1NJYA 1W0HA 3SSSA 3ULEB 5CD4H 4PXBA 3I56N 4QZVB 1X5OA 2VHGA 2D3ZA 4IJNA 3RAXA 1FDNA 1R6VA 3WDOA 5KFWA 1UJ5A 2YHWA 3PSIA 1IR0A 3W5YA 2VPXB 4YQWA 4BC3A 4C48A 2VFVA 2A41A 4ETXA 3EDQB 1I94F 1T9UA 4X4UA 4RU9A 1EX8A 4MIAA 3DNCA 2HBKA 1WOSA 3UN2A 5D15A 2EK6A 4ECYA 2KQ2A 3KLFB 1T6CA 4M63A 2CVIA 1T05B 5DQHA 3QEPA 4M5JA 2P9EA 2W2PP 4DHVA 1WOPA 2EG2A 3UN5A 4DR3K 4FS1A 3KK3A 2XLJA 3AA9A 1RSCA 4KHRA 3K59A 2WOMB 3I5BA 4K4YA 4Y0WA 2I7NA 3TA0A 3A8YA 1XNQJ 2OHDA 4R25A 2JFKA 3MEGA 3MN7A 3NGRA 1S97A 4X64J 4C11A 3NGKA 2KXHA 3VVUA 1U45A 2QWMA 3MWPA 4L3QA 4KV8B 3GCXP 1N34F 4CHYA 2HYIB 4DQIA 1HBNA 4J9RA 2HSTA 4ZPVR 1CZAN 2MKYA 1TR0A 5E7OB 1J2VA 1F9HA 3IR5B 1KSPA 3Q83A 5D78A 4CJ5A 3SXLA 1UVMA 2KG0A 1U2VB 2FC0A 2GUPA 3EXYA 3FK4A 4DR1J 5JS2A 3A13A 5CZXA 5HQLA 3O9UA 1NK5A 1RTZA 1JLBA 2HIYA 9RUBA 4HH0A 3ENAA 1WHXA 3R5BA 3V6DB 2IDEA 3SJHA 4F3QA 2J0SD 3A3PB 4BWJA 4WXOA 3M8SA 3G6ES 2GV9A 5AQVA 3ENHA 2HHHK 3CCVS 4J9QA 4CIFA 1LW2A 2RDIA 3Q8VA 2ZBPA 4GW6A 2VOPA 4WKRA 1VRQC 4DV3J 3MUTP 3TAGA 4DR6J 1IKWB 1TTHB 4YDDB 1KP6A 3GG1A 4DBQA 2Y9HA 2MQQA 3B54A 2N7CA 4PZVA 1KTQA 3Q0AA 3H59A 2DEIA 5B8HA 3MMAB 1JLEA 2GJ2A 2BH1A 5HBMB 5GVQA 3GMGA 4A8QA 3NF9A 3UDEA 4LF4F 2IVFB 4JI4K 4DTRA 2DNPA 4N8NA 4B8AB 2ZHAA 1SV5B 2Z1IA 1X4EA 1FNXH 1R8PA 4FJHA 2CJ9A 2JH3A 3UVJB 3TAFA 1ILYA 1MROB 1T9TA 1LWEA 1VIXA 3CO0P 2QXFA 4OI3A 3WXJA 3AHPA 3EY1A 4EFHA 2FBTA 3J7AN 2NXJA 3RW6A 3DYAB 3M2UA 2DR9A 4LF7K 2LDYA 2C2RA 5F8NA 4OGEA 5A8KA 1GLJO 4NCBA 3SQ1A 4MH8A 3P6YC 2LDIA 3FEZA 1EXQA 3EVWA 4GY2B 1VRUA 1ATSA 2J8AA 2XMVA 3VCDA 5HMZA 3C94A 4ES1A 3VENA 2HFNA 2NRXA 4FWPA 1HI0P 3IWXA 3EE9A 3OVNA 3IRXB 2DEJA 3AVLA 4ZCMA 2YNGB 3VGMA 4WFBQ 2NRHA 4YY3J 3U27A 5KPTA 1SL1A 3ZT2A 4C3LA 4DFJA 2EBEA 1S9GB 4AHSA 3PIPQ 2WVFA 1T95A 5HP1A 1KQSR 1UP1A 3V6KA 4M3XA 1ZBFA 2DNYA 3AD7C 3T6JA 4OO1J 1ACMB 2L9WA 3QT8A 2W41A 4YNQA 3HFVA 4BG9A 4L73A 2IMOA 4QW9A 1VQKN 2X3GA 2DFFA 4OZ3A 1R3NA 1P6TA 2V50A 1GXUA 4WQ4C 1FXDA 2M3DA 3BB5A 1YSJA 4H5RA 4RBVA 4OPHA 4CERA 2B9XA 4JHDA 2ATCB 5K14B 4Z7YA 3CJ9A 3BBFA 4BGBA 3TUJC 5C12A 1WUUA 4OFZA 2LSNA 3DGPA 3O80A 1D4XA 3ZZRA 4OX9K 4H8KA 4FK2A 3IKMA 1Y00A 2MY7A 4FS2A 3CXCM 1N33K 2QK9A 4PWWA 4CJLA 3V9SA 3CIPA 3SCLE 1YAGA 2GIFA 2ZM6F 1JKHA 1GTHA 2FJBB 2AEMA 1H7WA 4M8LA 1NHVA 4M95A 2ZC3A 3ZX2A 3QO9A 2C2DA 2JSXA 4AT1B 5B0BA 3J7Z5 3GR0A 4AHUA 3FCHA 5AE2A 4BR9A 3EZOA 5KG2A 1UWBA 1NZAA 3TU5A 4WFBL 2XSJA 1IKVA 1BIZA 1HKBA 2V69A 1PYSB 1RU1A 2ZE2A 1KOHA 4PWUA 2ZBRA 3M32B 3OV7A 4DG1B 4X2BA 1IUJA 4JK9A 2W9BA 1A5XA 2W9AA 2F4VJ 4UOHA 1VK3A 1YZ7A 2XLKA 2FSJA 4OZNA 3O3HA 4BRQA 3FSYA 4IYQA 3K0JA 2BZ2A 4CT8A 4BRMA 4CLLA 4U6PA 4TY9A 2B7BB 1L3KA 4H4MA 4LSZB 1RAGB 2H54B 4X4RA 2F8EX 5LXRA 4OJGA 1SQFA 2IFXA 5D4LA 2KLAA 3CM5A 1R0AB 4GC6A 2FIUA 2JC1A 2JRSA 4GC7A 1E6VB 3IFRA 2D5RA 2W2OP 1IBLJ 4OKKA 2O8BB 1X9JA 2DCLA 1LCUA 2UV8A 4DV1J 4KPCA 2V5HG 3KMSA 2DISA 4V19X 4NA1A 3HJFA 3FZ2A 2DGVA 3F2KA 3LANA 2IDOA 1SPBP 2IJFA 1LWFA 4NLTA 4CJEA 3C6HA 1HUXA 3HFKA 3UE2A 1Z1ZA 1U02A 3THVA 2NXCA 2JWLA 3LGHA 2QWOA 3V5RA 5T41A 3VQEA 4EHUA 2W1BA 3VEZA 2VPZB 3M6XA 3NGZA 3CD6N 4QCLA 2PT0A 3W9JA 4Y28C 4W98A 3LA0A 2Q66A 1NRKA 3IM8A 4DR4F 2CGKA 3HOSA 3VAMA 3WQPA 4DR5F 5CYQA 3CGIA 1RTHA 3ALYA 3H7HB 3I5AA 2YWGA 1QSLA 2AX0A 2W4CA 1XC9A 4IKFA 1FWKA 2FVSA 1GXLA 3O44A 5I3UA 4CO4A 4C0HA 2I5JB 4JP8A 5L38A 3H2UB 1NMNA 1SZ2A 1ZM3A 3MEGB 4F3MA 4CGFA 4OZ5A 4CI0B 2VJVA 3NFAA 3HPGA 4C11B 4EP5A 3JXOA 5F3ZA 1S1UB 3W3SA 2C42A 2XGPA 3MTJA 3BZKA 4ELTA 4IQMA 2YKNA 4DOZA 4DV4J 4EEYA 1JNZB 1JB0C 2HQFA 1F3VA 1FT8A 3J7YI 3LP3A 4DTNA 1K8AT 4GRSA 1ZBIA 1QQCA 2CQGA 3PCOB 3ZSZA 4F0HA 1KOOA 2P9UB 5CZVA 1RCHA 1NDLA 3SLCA 5AZJA 3CQYA 2X1BA 4LVNP 4B17A 1H2TZ 2C2OB 5FLXY 4DCPB 2AP1A 1KBRA 4CWBA 3PFOA 4YR3A 4IH5A 4OLOA 1YBTA 3PW5A 2CZ9A 2RKIB 3R2DJ 3MECA 2P5OA 3HCXA 4C98A 2RH3A 3E9LA 4DR7K 4FDFA 4XDCA 3P31A 1IKYA 3CD0A 5DM6Q 3LZIA 2A2DA 4B1UB 2O01C 4H4OB 1VGYA 2LQBA 1R8CA 3CMAN 2J0XA 3UR0A 1D5AA 2MLZA 2XLIA 3MURP 1T8EA 1KFSA 2P9PA 3GIIA 2DTUA 1HNZJ 5C25A 4JKBA 5BPLA 2F8MA 2R8IA 5TKWA 1V3RA 2OAUA 4HYKA 1IBCB 2VG7A 4WFAQ 1YX2A 1D0EA 1R8BA 1X4CA 3PW4A 2NREA 4EBEA 3BGRA 3QRPA 3A0IX 4LSLA 3O8MA 2QN6B 1SUQA 3F73A 2AYGA 1LWEB 1I6JA 2QI2A 4C3KA 3OS2A 3FLCO 4EYIB 4IG3B 1QSYA 4Y34A 1TL3B 2ZGYA 4BVOA 4QYZJ 4MYUA 1DT9A 5A8KB 4BRCA 5IWAF 4ED7A 2FDNA 1KVJA 1V4SA 3Q8QB 2VPWB 4FK0A 1VRUB 1UETA 2A18A 1G2EA 4W5QA 1UA1A 4Q8EA 1TYQA 4IKAA 4LF8F 1RBAA 5FPNA 2Z4PA 1Q8BA 2YWEA 5FLXO 4WKYA 2ZZTA 2DY1A 2Q0RA 4CYUA 3DRPA 3JQKA 1EIYB 4YORA 5HN0A 1DFDA 3CJ4A 4KJIA 2NCKL 4B3RK 1OVQA 5HRSA 3MEDB 1IQZA 4X65K 2OTLS 2M8DB 5IZHA 3K89A 2P9LB 1RHJB 2W01A 4ED2A 5DM6L 3PZPA 3TZZA 3HULA 4FWOA 3C7NA 1E3MA 1TAUA 2MQMA 1UOCA 4ZVUB 3UKRA 2ZOFA 2CNLB 3F0NA 1NGJA 4UOGA 3SQ2A 4FYVB 4USKA 4YEAA 3EYZA 4OX7A 3VQBA 1HQUA 4JHDB 4OI6A 4X62K 2J9EA 3NWGA 3GSIA 4WFAL 3C65A 4L72B 4DPUA 2OPRA 1HD1A 3T41A 2DHXA 5DDQC 3DGPB 2KXNB 2Q1NA 1S9FA 2PD1A 2XMKA 4IDHA 1KTVA 4WIQA 5THWA 4AQYJ 4DV5J 4I4BA 2NYIA 3H25A 1IBKK 4U7UD 2CQ3A 4W5TA 3ISNC 4NLXA 2NLXA 1SJFA 4QPTA 1UPPA 1X60A 2NR0A 3GP9A 1BHLA 1C0UA 2KU7A 5IC4B 4AE5A 2G0CA 3QO9B 2YQ0A 2E1YA 4LF6F 1BDGA 3MMJA 2HFVA 1P9QC 5AQTA 1VQON 1BI4A 5E2QA 3CCES 3DDNA 2AX1A 1FO1A 2UXBK 2BV3A 4I6YA 1JCEA 1UWBB 1W25A 1WELA 3I31A 4DV7J 4B3MF 2BRLA 2XSJB 3PYDA 2WW4A 4KHNA 2WB4A 1DKGD 2JEFA 4CD1A 4JI8J 4EP4A 4A2AA 2O8CA 2YJEA 1TL1A 1BD6A 2ZE2B 3JSMB 3WIVA 4JI7F 4CJWA 2W9BB 3VAJA 3AVGA 2KYZA 1KD1T 2Q31A 3VF4A 1BO5O 2RIJA 3CCSN 1ATRA 3RB0A 1RADB 1WORA 4BHQA 1S77D 1YI2N 2EFGA 3ZT3A 1VSEA 3LDLA 3OJSA 4DV0K 3T9ZA 1ZAVA 1ZPWX 4H4MB 1VLOA 2HRYA 2E9RX 4JKCA 5AQGA 4F04B 2ZJRQ 2O8EA 1YITS 3UCUP 3DLGB 4PXCA 1SKUB 3E8OA 4ZPDA 4ERDA 5GADI 2K06A 2COLA 3AA4A 3T69A 5FLXU 1AXQA 5D6GA 4H5WA 1QQOA 2Q6BA 4I6WA 1M1KO 4ZCKA 1S4FA 3UFCX 4FWNA 4X66K 1EZZB 4M7XA 5LOQA 5H1SV 3CMQA 3VAHA 3M6WA 3OL8A 3OSPA 1HWUA 3DMJA 3U7JA 1W2BR 4UF4A 3OHRA 4CJPA 4FZVA 4I64A 3NGSA 3Q7BA 5LSRA 1H73A 1TQLA 2FJAB 2E9ZA 3OTBA 5CHCB 2VGMA 3VF0B 2HFOA 4O55A 2QL5B 5A6PA 2UXCK 4IJAA 1NWKA 4FOIA 1KXPA 4K4TA 3D67A 2UU9F 1S6PA 1YJUA 1OQ6A 2KXFA 2YNIB 3O4WA 2NZCA 4NXMF 2F40A 5KT6A 1WTFA 5C10A 2H9ZA 2C2NA 3RBEA 1RWWB 1YLXA 3MCAB 1H38A 4NLWA 3MN6A 2R7OA 4R0EA 3K58A 3IFEA 3P45B 3TRGA 5HANA 2MKKA 3SJJA 3O9RA 5KFLA 1VRTA 2VFUA 2R42A 1RYSA 2ZFHA 1AA1B 5DMRA 5EX3A 3FQLA 4DFMA 5I3QA 2LEPA 3ZEUB 1WBDA 4KO0A 2ZWHA 3ENWA 4RR5A 1HNWK 5LSOA 3T1YK 1MN7A 1XMQK 1OY8A 2ZJRL 2HNDB 3QBCA 5EX0A 1KWMA 2CPZA 4E19A 4B3TF 5HLFA 2B5JB 3SAGA 3L4BC 4LRFA 2IA6A 1S99A 3X1LB 3C16A 1N56A 2JLFA 4OHXA 3V1OA 3RW7A 1FWLA 3WNFA 3OBYA 6FD1A 2ZKUA 1MW7A 5BR8F 1FRXA 1CJTB 2E5GA 3MI7X 4XK8C 4YHHJ 5AZJB 5EX5A 3A5NC 3PXGa 1U1QA 4HI2A 1RT3B 4JD2B 4DV2K 5IS2A 3E01B 2E88A 3GU0A 4YOTA 4RZRA 5A76A 4BC9A 1RWUA 2W9CA 4C1NI 2MTLA 3IBCB 3MXMA 2EWSA 1HR0K 3D0PA 1HKCA 4K4WA 2UUAK 4FO0A 4IOXA 1FRLA 5J2QA 2V7ZA 5J2MA 1JLAA 1FTCA 5KG5A 5AQMA 4LF5F 1RA7A 2UXDF 3NF6A 1HNXJ 1PGZA 2P9PB 5CAAA 5AT1B 4JI6F 4FWKA 4P2XA 3CJAA 4OX6A 1VBYA 2P9SA 5HQ8A 3VQDA 3CHWA 1TUUA 1FJGK 2HZAA 1HKGA 3WZ0A 3FNNA 3MF5A 3HDSA 4DUZF 2B4PA 2W4DA 2Y1LB 5JMVA 3R9LA 1LWCA 3ZETA 1UEVA 5C2DA 4CZGA 3S6EA 1VQOS 3WC0A 4JKHA 1BISA 3LW5C 1CQNA 1KQSM 1SS6A 3SI8A 4W4MA 3H5SA 1SUQB 4DL6A 3VEWA 2ZHOA 1HWKA 3SUPA 3NOGA 2GW8A 2FJWA 4NA3A 3G4SN 1VBKA 3DXBA 1UWAA 5LMNJ 3TANA 3G6YA 1IH7A 1OQ3A 3RAMA 1AFJA 4XPCA 1GK8A 5H9EJ 3DRRA 3DKDA 4NLRA 5AJ3K 3F5TA 4F4AA 1RDRA 2VQEK 5I9EB 1NH8A 3CCSS 2Y1IA 1NOZA 1TYQB 2NZTA 1VSLA 1FW6A 1YI2S 5BXIA 5L1KA 2P9KB 3HD2A 2G8KA 2UUCJ 4EBDA 3M8YA 3CCTA 4ENOA 4CZFA 4B3SK 1SH2A 1NSAA 3KKFA 4WXWA 4DL7A 2UUBK 4CLFA 2ADCA 4TYBA 3U1LA 2VG5A 3AGKA 3T3FA 4FJJA 1YDLA 4M3ZA 1FJ7A 1WF0A 2KH9A 1NHUA 1DURA 4P75A 2NUHA 3S3OA 1RT5A 3D3BJ 1MWMA 4O44B 3R3LA 2J5AA 4FPIA 1R31A 3MM8B 3UKRB 1RFQA 1VSFA 2CQBA 1DTQA 4A5AA 1U04A 4M45A 2P9NA 4WFXA 1LOTB 1OIAA 1SL0A 3R5AA 2HMPA 1S4EA 2GQCA 1HQUB 1WI6A 5IWAJ 3P8BB 3P1GA 1NGGA 2ACMA 3DLKB 1F21A 4WP8A 1Q18A 2HRUA 2J4RA 4BR2A 1NMEB 1RT4A 2OPSB 4PXDA 1TKDA 2EFVA 3QZ7A 4HCCA 5AQHA 4DUTA 5MAOA 3IS9A 4B1WB 2UZAA 4ZKAA 3QFPA 4LFBJ 1G4CA 4NLYA 1Q7LB 1NSKL 4CLPA 1VSKA 1C0UB 2UP1A 3IA0A 2Z1JA 2W25A 1NSPA 3O5BA 4W5RA 3E66A 1FKPA 4BE0A 2HWTA 2AMCB 3BYRA 4M5DA 3RRGA 2VC1A 1RBSA 1N5YB 5J1EB 3FEYB 2ERRA 4CHQA 3OQ2A 2PI4A 3OR2A 2HVEA 4WU3A 3SIPB 1P9YA 3C6AA 3HSCA 5M1NA 4EBCA 4B9UA 3AQOA 4FWRA 2FBVA 2JGUA 1X0FA 3K5LA 2R7UA 3ENVA 1U2FA 4ZPBA 4LFCF 5AQXA 3FMBA 4ZVFA 4JRPA 1TZ0A 4USVA 2MQLA 5H9FK 1B64A 1HI8A 4JI2F 2GZOA 4PQUA 2KDOA 4C9DA 4I0WA 3VEVA 4ZA1A 1Y64A 1SJ4P 2DGUA 3HHLA 4GV9A 3SSQA 2C2KB 3MMBA 1UJ4A 2DIVA 1GT8A 4M1KA 6FDRA 3OTCA 2L3MA 2A42A 1BY9A 3S7RA 2EFPA 3FGVA 4EHTA 1BQXA 3QZ8A 2BRKA 2VFTA 5EUHA 3R5CA 4LF6J 4FVCA 1WC0A 2V2KA 2HLTA 5L39A 2RSQA 4E8UA 1RTDA 1B0VA 2R2UA 3ETMA 1S6QA 2J9DA 2IBKA 4XH5A 5C15A 3FCVA 3SDEA 1WSEA 1FDBA 3T9NA 1C0TA 1MMNA 4BR4A 3B6BA 3THWB 2O5DA 5LL6Z 4GKKJ 3GOIA 3ZSOA 1XQIA 3NVMA 3UQSA 5GAHP 2KT5A 1VLYA 3H08A 4BRFA 3GIKA 3CCQN 5KI6A 2ZH4A 3MXJA 5KQ8A 3MCNA 2LU2A 3THYA 4EGLA 5FDLA 2EKYA 2LFVA 4JI5J 3CWJA 4LFAF 2W7PA 4ZP6A 4LC9B 1U2RA 2IM2A 1FXRA 4PHTX 1T9YA 2GO8A 2IMWP 2QA2A 4XH4A 1TAQA 2G8UA 5LM7E 4O4GA 1Q79A 4OYXA 2UVWA 3QLHA 1RT1A 2XSFA 2FF3B 4DEZA 1DQ9A 1VJQA 3OXGA 3MEEA 4NRTA 2YWKA 1VRTB 3NGUA 3Q24A 1F9FA 3A5OC 4QR2A 4FPAA 4MK7A 1K8AO 4FYWB 3LPYA 4KO0B 4CIOA 4AM7A 4RNFA 1N48A 5AQOA 3CDUA 4HHUA 1U6ZA 1IQTA 1OSDA 2BQ3A 2MKSA 1U1KA 1GLFO 1HRHA 4OYAA 4GVBA 4OHYA 1YWXA 3LF0A 3KLGB 2YQ1A 1LFWA 3X3UA 2MQPA 3L09A 1NLVA 1G3OA 4OV1A 3KIOA 4F8RA 5IOLA 2KFZA 3MR5A 3ENBA 3I55N 1NK8A 2ZH2A 4C8LA 2GQQA 2DNRA 3C14B 1TKXB 3OLBA 1J6ZA 3KG0A 4PKGA 3A8KA 2GX8A 4ANDA 4F4KA 4HL9A 4QU7A 8ATCB 4LMZA 1GOAA 4FPRA 3JB9k 2FZGB 1N5VA 1PAUB 4AHCA 1IM4A 4E1NA 2BKNA 4K8XA 4UUWA 3QETA 3OYBA 4BQLA 2XRIA 2RHKA 2O8DA 1ASVA 5EN1A 3R6LB 5J2MB 3V9UA 2H1YA 3ASMA 5D3GB 4IXCA 4M3RA 1Q82T 1D3WA 3EN9A 3M8PA 3O3LA 2MZJA 4JI0J 3BJYA 4JV5F 3AOAA 2G2YA 4HTUA 1LEOA 2FD2A 1HMVB 3V81B 1SC1B 4RBTA 3CCMN 5LXYA 3M9OB 3M5RA 3A4TA 1W9HA 4CTAA 4ED1A 3BUZB 4G9ZA 3ENOA 4TVAB 3FRZA 3VQAA 5BR8J 1J5EF 4Y0FA 1GOBA 1RDCA 3FBFA 2RVJA 2Q2RA 2MKHA 5GAHU 4ZVTB 2IM0A 2CRLA 2UVVA 1V4TA 2JEGA 3AXMA 3QINA 1MU2A 3DRRB 1UAXA 4PKHA 2HVHA 4OI4A 2IBOA 1GX5A 4FW1A 1B7YB 3D7SB 4QWBA 2UXDJ 1O0PA 1NKBA 2AGQA 3MM7A 2C3MA 4TQRA 2VBZA 4A8WA 3DRXA 2VA2A 2IY5B 2CZ4A 2GHVC 2BW2A 2DH8A 3IWLA 5AE3A 4LIWA 4J2EA 2PE8A 4WE1B 1XBWA 1ZBSA 2I9SA 4XH1A 4ECWA 2WBNA 4CGIA 1XNQK 3FC9A 5CXTA 1H72C 4DSKA 2FB0A 4AD6A 3CCZA 2JDJA 3T5LA 3UPFA 4V19J 4J9MA 4E3SA 1RT5B 4P71A 2QEXN 1WSJA 2OEKA 4BROA 2E2NA 2FHKA 4UQGA 3D6TB 3VN5A 5C24B 1TMJA 2R8KA 2OPPB 2CQHA 2P9NB 2HLUA 3ELHA 3KK1A 2J6UA 4MO5A 3OYLA 2FVPA 2CAJA 1ZAWA 2DRDA 3VQ6A 4K0KJ 3RMBA 4DR1K 5FIIA 4USHA 2IAJB 4FWLA 3ZZOA 3NF7A 3N28A