1C1CA

Crystal structure of hiv-1 reverse transcriptase in complex with tnk-6123
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 147
structure length 536
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1cA05
4RW4A 2FVQA 1S1WA 5F8MA 4ICLA 3QGHA 2G8WA 2W42A 2FBVA 3HJFA 1ZTTA 4OKKA 1RT7A 4F4WA 4R0EA 3CJ4A 1NJWA 3MTKA 2HWHA 3CJ3A 4NLWA 3KTQA 4KHWA 4F4XA 1CZBA 1K6YA 3PY8A 2BRKA 4H4MB 3VQAA 4RUCA 4K4ZA 4YNQA 5KG5A 5KFRA 4ZP9A 1RTIB 1KTQA 4W5QA 2HHXA 1C1BB 3L3UA 4F2RA 1D9FA 2AGQA 4M42A 1D9DA 5J2PA 2AX0A 5I42B 1IG9A 4OLAA 2QK9A 2VA2A 5FDLA 3V6HA 4HUFA 3CFPA 3AO2A 4RW7B 1F21A 3OSNA 4XPEA 1NHUA 3KK1B 4URGA 2AX1A 4TYAA 1W25A 3HM9A 3QNNA 4DTSA 2IMWP 2VG5B 3C6TB 5L1IA 2FBTA 4RZRA 1XR5A 1D5AA 1NKEA 4FLYA 4O3RA 1WNEA 1RTHB 1Y97A 5KG6A 2P1JA 3ITHA 3PW5A 4KO0B 4RW6B 5C25B 1GOBA 2BANA 3CDUA 3L2QA 5KRTA 4KHUA 4DTJA 1K1QA 3DYAB 3MECB 5KFYA 3RB6A 2YHAA 4RNMA 4FYDA 4CEOA 3MEEA 4IG3A 3GV5B 4DF4A 5KFIA 1KVCA 4KTQA 3PW7A 3A2FA 1C0UB 4FS2A 5SWMA 4NYNA 2X6SA 3NH2A 1ASUA 3AVCA 1VSHA 3PJXA 4FJKA 5DG8A 1T05A 2HNYA 4DL5A 3OYBA 1BQMA 3T19A 1NNDA 4DL2A 1ZYQA 1EETB 2OYQA 3D5MA 4NYZA 4FVMA 1TKTA 4NLGA 1KRPA 3OVNA 3M8RA 4RUAA 4CF9A 1S1UA 4KB7A 4CJ3A 3GIJA 4KTWA 1DTTB 3IRXA 3BREA 5J1EB 2IAJA 3BQ0A 2IJFA 1LW0B 4ED1A 4TLRA 4TYBA 3VQBA 4NLUA 3LP1B 1NJYA 3NFAA 1RT5A 4Y2AA 3NF8A 3QIPA 3KNAA 1Z4UA 2QKKA 2A1RA 3JSMA 2J6UA 1RBRA 2G8IA 3UPFA 3KLHA 3OYIA 1RT2B 2HMIB 3NBPB 3CFRA 3HK2A 1HQUB 3KMSA 1S97A 2YNHB 2Z1HA 1EXQA 1LWEB 4FLXA 3QO9B 2ZD1A 5DLFA 3AO4A 4Z4EA 3CIZA 5JXSA 4EBEA 3EPIA 1UOCA 3AVJA 2O5DA 4CK3A 3KLEA 4DU4A 3RAXA 3PHEA 3DLGB 2KTQA 5F9LA 4Y2CA 1RBVA 4GMJB 1GOAA 1S9EA 1JLCB 4NLDA 2R2UA 1HQEB 1T3NA 2HHWA 1OS5A 3Q8PB 3G6VA 2ILZA 4B9LA 4IDKB 4I2QA 5C42A 2XC9A 3BGRB 4HCBA 5KFUA 2PZSA 4CHYA 4J9OA 2HNDA 3NF6A 3ZSVA 3VA3A 3V6JA 4QWEA 1IKVB 4HYKA 4HUEA 4AILC 4BACA 3KLGA 4DSKA 3AVHA 1BGXT 3DLBA 2AGPA 4EP5A 1JLQA 4RNHA 1UWBA 2X74A 3I0RA 4JV0A 5CZ1A 2EC0A 4E3SA 5KGXA 3DRRA 5C5JA 4GC7A 1RT4B 4IR1A 4KE5A 5FDLB 3MFHA 4R8UA 5I3UA 2FVRA 3B6PA 3OYAA 3KK3B 1RTDA 1HRHA 3KMQA 1WSFA 3QEPA 3OYLA 3I5CA 3VQ9A 3LAKA 1BIZA 1HPZB 2DPJA 4CK1A 3H98A 3OLBA 3NAHA 3TWHA 3RMAA 3ITHB 1IKWB 4CF0A 3QLHB 1JXBA 3AVLA 4JV1A 1RCHA 4MQ3A 5HP1A 3TVKA 4DSEA 2OPRB 4PQUA 2VG7A 4QW9A 3I0SB 4H54A 4DWIA 2W9CB 2R2RA 1C1CA 1U45A 4FJ9A 3TAQA 4OGEA 4YQWA 1QS4A 4Z4HA 4DFKA 1JLBA 2DY4A 2JGUA 1LW2A 2JC0A 2YNIA 4IG0A 2IGIA 4E1MA 2HHSA 4IG3B 3VN5A 3QINA 4WZQA 3FSIA 3OYJA 4I2PA 4OVLA 1A5WA 4W5RA 3ZT2A 5JS2A 2D7SA 4NCBA 4XO0A 3FFIA 3K5OA 5D3GB 2XWYA 2KFNA 1VSMA 3SNNA 1TV6B 2WK4A 3LWLA 4EEYA 1L3VA 3SQ2A 3T5JA 4KHSA 4CFBA 3SUQA 2R7YA 4K4UA 3I8DA 1CXQA 2WHOA 1S1UB 3V6DA 2KFZA 4NCGA 4EBDA 2RF2A 1L3SA 1GOCA 1TK0A 2O4GA 3D45A 4B8CA 4AHTA 3WNGA 4KHMA 2WB4A 3ASMA 4CF1A 1SL2A 3V1QA 4B08A 3C94A 5CY4A 4FJJA 3THVA 2FVSA 3CO9A 1TKZA 2C2DA 3ZT0A 4F2SA 5J2MA 2O4IA 3GIIA 5C24B 4ELUA 3LAMA 4MFBB 3KLHB 1IH7A 3LZJA 1JLGA 5HRPA 4KAIA 3VQ4A 2KZZA 4AHSA 4PWDB 4KI6A 4ZPBA 1JKHA 4M3TA 2ZD1B 5KFAA 3DLHA 4CEDA 4LSLB 3KLEB 1IKXB 1KFSA 2W8KA 2EHGA 4U6PA 2XRIA 1JLFA 4N47A 5DGBA 1FKOA 4QW8A 4CJ5A 1XI1A 2Y1JA 2IC3A 4EYIB 3T1AA 4LH5A 4I2QB 1LWFA 2OH2A 3TAMA 1SH3A 3L2RA 5HLFA 3BQ1A 4O55A 3U3YA 3DRSB 2ITGA 1SV5A 1HYSB 1JL1A 1QE1A 3OL7A 2AWZA 3CM6A 4OKJA 4CGIA 4CJRA 4IRDA 4ZHRB 3OL6A 4B3OB 4ZTJA 4G3IA 2C2EA 4I7FA 2YKNB 4DU1A 1BISA 3DOLB 3GIMA 1T03B 3RB3A 3KK2B 1RT1B 3HVAA 1TQLA 3MR6A 4E89A 4NLXA 3ZSRA 3Q8SB 2BR0A 2DPIA 3NF9A 1X9WA 3QYYA 4CJPA 1NJZA 1ZBFA 1JLAB 3DLKB 3OSPA 4ELVA 2YNFA 1S0NA 3SPZA 2BGGA 1RBTA 3LWMA 3O3FA 5I3UB 4CF8A 5J2QA 3DRPB 3FDSA 4WE1A 1R0AB 3FQKA 3BR9A 3AVAA 1TL3A 1VRUA 4ID5B 3OYCA 3O4QA 1SKSA 1S10A 4E7HA 2XHBA 3HVTB 5KFGA 3HL8A 2RPIA 1KCFA 2IM0A 2PY5A 3G0ZA 4JS4A 4KRFA 3SV4A 3WNFA 4F8RA 4Y3CA 3RMCA 3IN5A 3KHGA 1SUQA 4DF8A 4H8KA 4CJLA 1KLNA 2PYLA 3BSNA 3DMJB 3MEDA 4ZP6A 4ED6A 1RBSA 4CIGA 3OYEA 2BE2A 1WSGA 3E01A 4CJVA 4DSFA 4Q8EA 5F8LA 4B8AB 4O44B 1A5VA 4Z4GA 5FROA 3D0PA 1VSDA 3ZSQA 3SUOA 2IM3A 3ZT3A 3VQ6A 2ASLA 3BSOA 4FLZA 4NLRA 4IG0B 3K5MA 4J9SA 2R2SA 2V4QA 3V4IA 1VSLA 1BI4B 3H4DA 2P51A 3K5NA 1FKPA 1VRTA 2RDJA 4IH5A 3K59A 4F3OA 4KHQA 5K14B 4Y1CA 4DEZA 2XGPA 4FK2A 4BWJA 1REVA 5KFZA 3GIKA 4NLPA 4KI4A 3MR2A 2B6AB 2ZE2A 3T3FA 1QQCA 3L2VA 3KLIB 4J9QA 4CJUA 4DQIA 3V6DB 3H08A 3OY9A 4C8OA 4EBCA 4BDPA 5F8JA 4NYFA 3VQEA 1RYSA 4FJNA 1S6PB 4ZPAA 5KT5A 3AA5X 4CHOA 4CEQA 4XIUA 3M9MB 2W9BA 5HRNA 3HP9A 3PW4A 5KFPA 4IBNA 2Y1IA 4R5PB 4EP4A 3QNOA 1LWCA 1SKWA 2RDIA 3CG7A 1KHVA 4O3PA 2VG6A 4CECA 2G8HA 2CKWA 4DLGA 1L3TA 1RDDA 4HTUA 3TAEA 3NMAA 4M94A 5KFVA 3GILA 2GBZA 2GIQA 3IG1B 3SQ1A 2D3UA 1JKHB 1SH0A 1L5UA 1DTQA 3CDWA 4E7LA 3P5JA 2B5JB 1EX4A 4YFUA 1KLMA 3WNHA 4OPJA 3VQDA 3DM2A 2OPPA 3DLEA 4DQRA 4CHQA 4CCHA 2IOCA 2IC3B 4NLOA 3OS2A 1LWFB 3EZUA 4RW9A 1SV5B 4BE2A 3PUFA 4MH8A 3EZ5A 4FM1A 2IJNA 3NL0A 4WFZA 4RNFA 3KD1E 4K4TA 4Q0BA 3OJSA 3V81A 1JLEA 4ECXA 4QAGA 2GUIA 4PUOB 4CFAA 2B43A 3UR0A 5FRMA 3LP0B 3MXMA 4O3QA 4WXOA 3RBDA 1J9AA 1XHXA 4CJWA 3MEGA 5CYQB 1RTJA 3ZSWA 5F8HA 3AA3A 4KBIA 3KJVA 4CGDA 2HHQA 3RB4A 2AU0A 1VRUB 4B9UA 4K8XA 3H59A 1HNVB 2IS3A 3M9OB 3RWUA 1TK5A 1NKBA 1S1VB 1S6QB 3KKRA 1JL2A 4F4ZA 1CLQA 2KQ2A 1BCOA 3LZIA 1QAJA 3OS0A 3QGGA 4EYHB 5KG0A 5F9NA 3PVXA 4AH9A 4C8LA 4FZYA 1MU2A 2UUTA 4DSJA 2HB5A 1S49A 3E01B 4PY5A 4ED3A 3RMDA 1YTAA 1WN7A 1TVRB 4J9LA 4KFBB 2UVRA 4WXWA 1J5OB 1IKYA 2R2TA 4DU3A 2HNZA 1KVBA 4RU9A 1W0HA 1N6QB 4GVMA 2A1SA 1U09A 3GYNA 3TI0A 3C6UA 3OYNA 3RTVA 4LH4A 4LY7A 4M3RA 3ZSYA 2OPQB 1D1UA 1RBUA 5CYMB 4FLWA 4N5SA 2ETJA 3K57A 1UA1A 4F4YA 2FC0A 3G86A 4FW2A 4I9QA 3QZ8A 4IRCA 2OPSB 1C1AA 3EPGA 1NOYA 1N5YB 1TK8A 2OA8A 3PO4A 3CM5A 4QWCA 4CF2A 4QWDA 1BCMA 4CJ4A 2WOMA 1C0TA 3M8PA 5KG7A 1S9GA 4RNNA 4LSNA 3FQLA 4O4RA 4C8NA 2RKIB 3AO5A 5KTQA 3QZ7A 4CEAA 4Z4CA 3LP2A 3V6KA 4RW4B 4FS1A 1S1WB 3DLRA 2IM1A 3O3HA 4ICLB 1HMVA 4N56A 3H40A 4YR0A 4CGGA 2OZSA 2C22A 1T7PA 4Z4FA 1MMLA 4ECTA 4I9LA 3QIOA 4KAZA 2FBYA 3KHRA 4HCCA 1RT7B 3PW0A 3G10A 1S4FA 1EKEA 4ECUA 3ULDA 1NK8A 1J53A 5HROA 2ATQA 4J2AA 3OHBA 4IFYA 4ECZA 1NJXA 2FLPA 3CQ8A 1GX6A 4DL4A 4TY9A 1Q8IA 4IH7A 4FJMA 1RA6A 1NOZA 4CJSA 2HVIA 4FJ7A 2WONA 5J2PB 4J2BA 3AVIA 4E0DA 3H2LA 1I6JA 3G6XA 1XWLA 1X9MA 3NGYA 2E4LA 4IFVA 3PW2A 1RDCA 4FLVA 1C6VA 3LDSA 4K4VA 4JS5A 5KFFA 4EO6A 3D28A 1QSYA 3IS9A 3U6FA 2F96A 3S9HA 1HYZA 3LANA 3AVGA 3ALYA 2VA3A 4KHRA 3MR5A 4IKAA 3V9SA 5KT2A 3DOKA 2JEIA 5T14A 3NGDA 4J9MA 2YNGA 1RT6A 1GX5A 2BANB 4FW1A 3E51A 4CEZA 3NH1A 1N48A 4CHNA 2E6MA 5KFXA 5DK5A 3HSTB 2JLEA 4CJTA 2PYJA 3CJ2A 4KKOA 2J6TA 1BQNA 3S3NA 2IBKA 1X9SA 3RB0A 3MEEB 2I5JA 4LQ9A 4Y1DA 3HPOA 3JYTA 4FLTA 1K1SA 4FJIA 1QHTA 4DFJA 1NK4A 3M8QA 2D0AA 4B9NA 1DLOA 4H4OA 3I5BA 1TGOA 1SL0A 1C0MA 1T05B 3HPGA 2ALZA 2HNYB 2YKMA 3OYMA 1BQMB 3N6LA 3DI6A 1EP4A 1TKTB 4U7CA 1TL1A 3ISND 1SH2A 2OZMA 5DGAA 1VSFA 4NLYA 4FBTA 4WFYA 3H5SA 4ZVFA 4MKBA 4TXSA 4FXDA 5KGWA 3SI6A 3IRXB 3DDKA 2IAJB 2DFEA 3NF7A 1NK0A 4JRPA 3H5YA 5J2NA 1FK9A 3NAEA 2GV9A 1WSEA 3OL8A 3KLFA 2JEFA 3HVRA 1RT5B 2C28A 4ECYA 4ED0A 3QIDA 3QIPB 4HKQA 3KLVA 1RILA 3PZPA 3JSMB 2D3ZA 1WNSA 4JLHA 4CIFA 3VQ8A 4DS4A 5KFLA 5KFMA 3H4BA 1JIHA 2XCAA 4KPYA 4ECSA 1FXXA 2RN2A 1NK9A 3KOAA 4CJEA 3HP6A 2HHUA 3KD5E 4OKEA 4J9RA 4OLBA 4WFXA 3Q8RB 5HRSA 5DLGA 1HMVB 1S1XA 2FJWA 1S9EB 4NLVA 4RG8A 3ISNC 4FBUA 3VQSA 1LAWA 2Q3SA 1RDAA 4W5TA 4QWAA 3RRHA 1XR7A 3RR7A 4MIBA 4O4GA 5C42B 3SV3A 1KSPA 5I42A 3ZT1A 2KZMA 4K4SA 2LSNA 4DTOA 2WCXA 2ASDA 4KB1A 2HNDB 5KT7A 4CEBA 5F8GA 4C8MA 3RBEA 4RW7A 4J2DA 5HBMA 2JEJA 4DS5A 5KG4A 3KK1A 4RW8A 3KLGB 1S0OA 4OGCA 2IA6A 2VG5A 1S1TA 5JS1A 3C6TA 1RA7A 1JLQB 3F9KA 1UWBB 3I0RB 4NRTA 4DMNA 4E7JA 3V9ZA 3DRRB 4J2EA 4E7IA 1RTHA 4M41A 2DTUA 3IGVA 4RW6A 5C25A 4URQU 4DQPA 3HYFA 4R8UB 2R8HA 5KI6A 4XPCA 4E1NA 2QKBA 4W5OA 4FJGA 1RTDB 4ZPCA 5KT4A 2BQRA 3TABA 4J9PA 4CJKA 2G8UA 3NKYA 3OYKA 3MECA 1RYRA 2UVUA 4DQSA 2ASJA 2YV0X 3L2UA 1RT3A 4O3SA 5L1JA 1U04A 2ZKUA 2W9AA 3MR3A 1C0UA 1KHWA 3MFIA 1KFDA 2YNGB 2V4RA 3F73A 4CGJA 1W9HA 5EUHA 4Q5VA 5HP1B 4FJXA 4DSLA 2G8VA 4PQUB 1QTMA 5KFQA 4YMEA 3HPHA 2VG7B 1VSIA 3SJJA 1ZBUA 3IAYA 1EETA 3IGNA 4DG1A 3EYZA 4M3WA 1C1CB 3N6NA 3UIQA 4K4WA 2FVCA 1JLBB 1B9DA 4CESA 1YTUA 2QV6A 2ZQBA 4BDYA 4WYLA 1LW2B 2YNIB 5T7BA 3BDPA 1DTTA 5J1EA 3WNEA 4CJFA 3B6OA 4M45A 3NE6A 5KFBA 2BRLA 4I2PB 1VK0A 4E7KA 4QOZB 1LW0A 4OJRA 1LAVA 3SZ2A 3FFIB 4HUGA 3LP1A 5DQHA 2HHTA 4M3XA 3HO1A 1G15A 3BJYA 2Z1GA 1HNIA 3T5HA 2IDOA 3PR5B 2HWIA 4NCGB 4ECQA 5DQIA 4ZPDA 2RF2B 4TQSA 1RT2A 4FJHA 2HMIA 3N6MA 3NBPA 3U3GA 5KFNA 1HQUA 5KFEA 5FRNA 2YNHA 1LWEA 4AHCA 3QO9A 3CJ5A 2JEGA 2FJVA 3QESA 1D8YA 4KB0A 1B92A 2FLNA 4ZP8A 3QGIA 2C2RA 1TKZB 3PR4A 4ED7A 3KKSA 5J2MB 3DLGA 1WSJA 2DFHA 1JLCA 3VQCA 1HQEA 1SL1A 2AJQA 4DL3A 1NKCA 2GIRA 1JLGB 4FK4A 4IDKA 3BGRA 4NCAA 4CGFA 3H5UA 4O3OA 3BSAA 1IKVA 5L1LA 4JUZA 4F4KA 4O0IA 3CJ0A 1S1XB 1QSLA 1JLFB 3K2PA 1FKOB 5KFHA 3NGZA 4FZZA 3RR8A 4DFMA 4O4GB 3TAMB 1RT4A 5HLFB 1QE1B 4IQXA 3OYGA 4ED2A 4KSEB 4I7FB 5HBMB 3KK3A 3LP3A 1I3AA 4K50A 4RW8B 2AQ4A 4LQ3A 5CZ2A 2E9RX 1S1TB 4CE9A 2JC1A 1RDRA 1S48A 1VSEA 4W5NA 4NZ0A 4TY8A 3LPUA 4NLSA 2XY8A 1HPZA 1TAQA 4ZVHA 3SUPA 1RDBA 3AVMA 3PJWA 1U47A 2YNFB 4YR2A 1IKWA 3QLHA 4MK7A 3MXJA 1ASVA 1U48A 5KG1A 1UAXA 2UVWA 1T94A 5J2QB 2GC8A 3OHAA 4ZVGA 4WE1B 2I1RA 1TL3B 5KFWA 2OPRA 2FJXA 2B4JA 3V1OA 3AA4A 3I0SA 5KFCA 1HJRA 2W9CA 1TAUA 4N41A 4BWMA 4MKAA 1L3UA 1RT3B 1QSSA 3QETA 3RAQA 4KREA 1TKXA 1U49A 1XHZA 1SUQB 3S3OA 3MEDB 2EX3A 2BE2B 1C2PA 3GV8B 4YR3A 3OJUA 3H5XA 3SFUA 2P5OA 3AV9A 1YVFA 4DTRA 3TAPA 2VWJA 5D3GA 3AVFA 2V9WA 1A5XA 1TV6A 4DG1B 3QEIA 1B9FA 2D41A 4J9NA 2XI2A 3V9XA 4FJLA 1BHLA 3VQ5A 4DQQA 4GW6A 4ZP7A 4HVJA 1D0EA 5KFOA 3AO1A 4FM0A 3O4NA 1ZTWA 3V4IB 4CFCA 3ZSOA 2X78A 4DTMA 1FKPB 1VRTB 5EDWA 4DTNA 2W8LA 3GQCA 4IH6A 3RRGA 4TQRA 4B9TA 1REVB 2V0NA 3Q8QB 4URSA 1HNIB 5C24A 2FLLA 4LD0A 2ZE2B 5E41A 1JX4A 1CXUA 1VSJA 4MFBA 3AA2A 2P5GA 3LPTA 3I5AA 4MIAA 4PWDA 3L3VA 1VSKA 5KFKA 2FBXA 2E9TA 1SKRA 5KT3A 2W9BB 2XO7A 1T8EA 3PO5A 1ZBHA 2Z1JA 4LSLA 1IKXA 1JXEA 2R8GA 4EZ6A 1LWCB 3PX4A 4ZVEA 2VG6B 2FVPA 4DTPA 4IKFA 3GV7B 3SCXA 1J54A 4B9MA 5KFTA 1YVUA 3DRSA 1X1PA 1HYSA 1NK6A 4CJQA 4E19A 1DTQB 4ZHRA 3HKWA 4B3OA 2YHBA 4BE0A 2YKNA 4G1QA 1KLMB 3DOLA 3KHHA 3OYDA 2DFFA 1T03A 4ECWA 5L9XA 3DM2B 2OPPB 3DLEB 4CK2A 2R8JA 3KK2A 1RT1A 1JXLA 1Q9XA 5DG9A 3OL9A 1ZBIA 4FM2A 1JLAA 3DLKA 1WAFA 2XY5A 4RW9B 5EWEA 2ATLA 3V1RA 5DG7A 4FCYA 1U4BA 1NK5A 3L8BA 1QUVA 4DTXA 4ID1A 4KHYA 3P1GA 3DRPA 3CYMA 1BL3A 2E9ZA 1Q9YA 1O1WA 3QERA 4Q0BB 2ILYA 1R0AA 4ID5A 3V81B 1JLEB 3NGIA 3VA0A 4L8RB 3V9UA 4Q44A 3NH0A 2QE5A 2J6SA 2HHVA 4O3NA 4O5BA 3HVTA 1KVAA 4QWBA 4TY8B 4O0JA 4OPKA 1NHVA 4EO8A 1ZBLA 3MEGB 1RTJB 4CHPA 5KG3A 3HXMA 2W7OA 3DMJA 3CFOA 3KJVB 5JUMA 4O44A 5KT6A 4CERA 3NDKA 4KV8A 4F3TA 1WSIA 4HHTA 1NK7A 3OYHA 4Q45A 4F50A 1TKDA 3KHLA 4OL8A 3FRZA 1ZETA 2KW4A 2Z1IA 5KFDA 5EWGA 3TR8A 4B9VA 3G6YA 3UDLA 2W7PA 4AHVA 1RNHA 1WLJA 4NLQA 1TKXB 5KG2A 1BI4A 1MU2B 4TSXA 3OLAA 4FZXC 4BDZA 5K14A 3SQ0A 1IKYB 4N76A 3AO3A 2HNZB 3HT3A 4Q8FA 2F8EX 3OYFA 2R8IA 3C6UB 2B6AA 4DLEA 5KRSA 3KLIA 3AVBA 3TANA 2UVVA 4WYWA 3HVWA 4ECRA 3L2WA 2WRMA 1S6PA 4AHUA 3NAIA 3BSCA 3T5KA 2XY6A 2BDPA 4CHZA 4IR9A 3O3GA 2BQ3A 3QEXA 1ITGA 2WOMB 2CJQA 1C0TB 3M8PB 3V9WA 1Z25A 1S9GB 4LSNB 4R5PA 2D5RA 3TAGA 3SI8A 1IO2A 3VQPA 3CDEA 4H4MA 3LP2B 3VQ7A 4K4YA 3NCIA 4DTUA 4AHRA 3ICLA 3BQ2A 1RTIA 4RNOA 2XCPA 4X2BA 4ED8A 1UA0A 2WTFA 4YP3A 4DL7A 4C8KA 3SYZA 1C1BA 4MK8A 4UQGA 3AVNA 1ASWA 1S9FA 3ZSZA 3OS1A 2HW3A 3IG1A 1BIUA 2HAIA 4EZ9A 5EU7A 3CWJA 2B5JA 5HROB 1IM4A 1HYVA 4JRQA 1XC9A 4QPXA 3MF5A 4NLTA 2E6LA 3QEVA 4IFYB 4FJ5A 3K58A 5F8NA 3LALA 3SFGA 3VQQA 1LV5A 2UUWA 3ZCMA 1XR6A 3ZT4A 4CGHA 4TN2A 4DFPA 4GC6A 5DQGA 1I39A 3K5LA 1S5JA 1YT3A 5L1KA 1QAIA 3M9NB 1S0MA 4Z4IA 2WONB 3ZSXA 4G1QB 5DMRA 4KO0A 4ELTA 2X6NA 4M95A 2VWKA 3CVKA 4PUOA 3TARA 3KIOA 3PX0A 4CFDA 3LP0A 4IRKA 3AVKA 4PA1A 3NHGA 4CEEA 4IFVB 3T5LA 4JV2A 2G8FA 1CSJA 5EWFA 3C95A 4ZMMA 3DYAA 1Z26A 3EY1A 5CYQA 3IS9B 5F8IA 4WZMA 1N56A 2D0BA 4FLUA 2XI3A 4K4XA 2QXFA 4B9SA 4DL6A 3DOKB 3PX6A 1N4LA 3TQ1A 4FK0A 1HNVA 1RT6B 3MXIA 1S1VA 4Y34A 5KFJA 3S3MA 1S6QA 4IOBA 2IM2A 3UQSA 4J9KA 4FJ8A 2F8SA 4KKOB 3SQ4A 4ECVA 1BQNB 3HHKA 4BE1A 4ZTFA 4K8ZA 2I5JB 3JYTB 2G8KA 4M3YA 1TVRA 3M8QB 4KV8B 4KFBA 2AGOA 1TP7A 1DLOB 4H4OB 1J5OA 4CEFA 4Z0UA 2NUBA 3TAFA 1N6QA 5HRRA 2XY7A 4M3ZA 2R8KA 2D0CA 2YKMB 4CIEA 1WAJA 3MAQA 3M8SA 3DI6B 2OPQA 1EP4B 5CYMA 1TL1B 3P83D 4M3UA 3PV8A 5KFSA 4KHNA 2HVHA 4QCLA 3QEWA 2OPSA 1HARA 5SZTA 4MK9A 1N5YA 4Q43A 4DSIA 2XGQA 3SUNA 4NRUA 1CZ9A 5J2NB 1FK9B 1RAJA 1WSHA 3RMBA 2BQUA 2F8TA 2RKIA 3KLFB 4KTZA 3SPYA
chains in the Genus database with same CATH superfamily
1YBAA 1WHXA 1S1WA 2GMHA 1TFWA 1VOMA 5AE1A 4B3RK 5GAEU 3ENBA 1RWKB 4MKVA 1PILA 2BTFA 2W42A 2G8WA 2GFFA 2EBEA 4RJVA 2VD3A 3CE8A 4M5KA 1ZTTA 3IO1A 3IC1A 4BR7A 1H7XA 2MHEA 1U1LA 3CJ4A 3PSFA 3CCTA 4ZK7M 1NJWA 2HWHA 3KTQA 3I9ZA 5A8KA 4Y0FA 1CZBA 4A5BA 1IN0A 2KN4A 4IO9L 1FTRA 1K6YA 2P2CB 3HHLB 4AM6A 3UVJB 4YNQA 5KG5A 4BHQA 3DLJA 4IOCL 2HHXA 4M7YA 3L3UA 1WKKA 4F2RA 4F0HA 1HFEL 2AGQA 4M42A 4YS2A 2IRYA 5HAOA 2EC2A 5AQYA 3S7RA 1VQKS 3R8YA 3V6HA 3N4WA 4V19J 2Z0GA 4YHHK 4R79A 1Y64A 3BY5A 3OSNA 4PL7A 1NH7A 4URGA 3HM9A 4AF1A 5ETMA 2IMWP 2W40A 3C15A 5EOYA 4WCEL 5L1IA 2A0FB 1EQMA 4TLQA 1NKEA 1WKJA 3AGRA 4LRBA 1RLDA 1FWKA 4OV1A 5HL7L 3PW5A 2EFQA 5C25B 1BHNA 4C11A 3UCGA 1YLXA 3CJAA 3IWXA 3JAMO 2BANA 4I6YA 5GAEI 2W2OP 3HKZD 4K2JA 3L2QA 3HJVA 2N7CA 1Q0NA 2J7KA 4PAAA 2RS2A 4JI8J 1UVKA 3DYAB 2BA9A 3MECB 4BR2A 3OVAA 4X64J 4FYDA 3MEEA 1QTNB 4ALZA 2Y8YA 5KFIA 4AXIA 2BKOA 4KTQA 5K8OA 4FS2A 1VCTA 4WKRA 1NDCA 8RUCA 2HNYA 1BQMA 4YB6A 2FHMA 3D5MA 4NYZA 1TKTA 3T9NA 2W2MP 1ZXOA 2OLWA 3PSIA 2BJ8A 1UEVA 3PJ9A 1HWLA 3M2VB 3R8EA 3IRXA 3THPA 1RKIA 5EX3A 3LW5C 3DXBA 1LW0B 1F6TA 4NLUA 2AD9A 3CSKA 2QA4N 4YDUA 1RT5A 4X62J 1YITS 3QIPA 2ZOFA 1NB2A 3GG1A 4P73A 1N32K 4LVNP 3WHIA 2J6UA 1RBRA 3ENOA 1N5VA 1VBZA 5L9NA 2XLJA 1CJVB 5DRKA 3OPKA 3NBPB 3CFRA 2O8DB 3KMSA 1S97A 2MMYA 2WSCC 1HUXA 4Y2IA 3AVJA 2O5DA 4CK3A 5BYRA 4DR2J 2VOOA 2KLAA 4HH1A 3M6UA 3PHEA 3KUGA 5F9LA 1RBVA 3QB0A 2VFUA 1KQKA 3E8OA 5AR0A 3Q8PB 3G6VA 2ILZA 4B9LA 1PG5B 5C42A 2C3YA 2P9EA 2XC9A 5A0YA 3C0BA 5KFUA 3M1VB 3MWTA 2UP1A 2LA4A 3U7JA 4DV2F 4V19X 2GCFA 4CHYA 4A8OA 1ATRA 4L73A 4P74A 3VA3A 3EVMA 3V6JA 1PBUA 1NH8A 2WVBA 4FF4A 4AILC 4DSKA 2HRTA 3QWPA 3DLBA 1M0SA 4EP5A 1Q7LB 2EC0A 2WAQD 1RWMB 1K8KB 3DRRA 4C98A 5HMXA 4USIA 4GC7A 1RT4B 3M2UA 4W90B 2DTJA 3AY0A 4NXMK 1GTHA 4IUFA 2CWKA 1Y10A 3CJ1A 3B6PA 5K8NA 1HRHA 4YOTA 3IDHA 4J5OA 2HS0A 1S3XA 4NA3A 2NRRA 4JI6J 4LR9A 1SC1B 1BIZA 4ZLNA 4XK8C 4OQJA 3TWHA 2E7WA 4C11B 3AVLA 2ZBRA 4AL7A 1H74A 3TVKA 2YX1A 3FBCA 4OHVA 3A8EA 4YQWA 3SSRA 4Z4HA 4OI0A 4KQZA 3PKYA 2JC0A 2YNIA 4E1MA 3FEYB 3Q0AA 2LXFA 2ACMA 2PO4A 5BR8F 2F4FA 3G6ES 4OVLA 5AQNA 1IJJA 4W5RA 3BP8A 2AEJA 4NYPA 1N0UA 3UKUA 3K5OA 4L72B 5D3GB 2E1MC 4TVAB 2XB2D 1TV6B 3LWLA 3SQ2A 3T5JA 4KHSA 4LF6K 5LXYA 3L09A 2P9KA 4OPAA 4NCGA 4EBDA 1U2RA 2A6OA 2RF2A 4QPTA 1TK0A 2Z30B 2PE8A 4B8CA 1B7FA 4JI8F 4CF1A 4BR5A 4KH5A 2UXDJ 3V1QA 3GU0A 3J7YP 1VQ8S 3ZT0A 3KUEA 1VQMS 2CG4A 3GE9A 3I82A 4DPOA 3ZZUA 4MFBB 2DR6A 3Q2TC 3LZJA 1N0VC 4DUZJ 3J7AP 3HD2A 1NDKA 4N77A 2KL8A 3PXGa 4KAIA 1WHYA 1W2BR 4PWDB 5BN8A 2FB0A 4U9RA 2WVCA 5KOXA 1YJ7A 4LSLB 4K0KF 1IBCB 4C1NK 1S59A 1T3VA 2ATCB 1FKOA 4QW8A 1OYEA 4CJ5A 5DM7L 3HD1A 3TAMA 1T9WA 2KU7A 3BQ1A 4O55A 3VGTA 4OKJA 4CGIA 5HSPA 3G71N 4NWBA 4I7FA 3DOLB 1FXRA 2HSEB 3VGVA 4C0BA 1VJWA 5K5MA 1HW8A 3KK2B 2VWBA 3HVAA 1AUSL 1TQLA 3MR6A 4NLXA 2BR0A 3M6WA 4ES3A 5LXRA 4AQYF 2XHWA 3QYYA 3BDEA 1ZBFA 3DLKB 2FJDB 2OEMA 1IV0A 3CMQA 1YJWN 1FA0A 2I7NA 2HGLA 1CJTA 2MB0B 3O3FA 4FWNA 4BRMA 4CF8A 4CBXA 4WE1A 3FQKA 3OYCA 1TL3A 3FJ2A 2OEJA 4C1NI 3AXMA 1H2VZ 1SKSA 5JVHL 3HVTB 3BBBA 4G6VB 2VQEF 1R31A 2RQMA 3VHQA 5AQPA 2RPIA 4JKFA 4B3TK 2CDRB 4QR0A 2D4WA 1NG9A 3FK4A 1UZHA 2C42A 2V2VA 3QMQA 1SUQA 4H8KA 1KLNA 4QU7A 5AFUA 2PYLA 4OHWA 4ZP6A 4PG7A 2GWJA 4ED6A 5AQGA 4CIGA 5CE3A 2V52B 3OYEA 4PG8A 4I1TA 5HVFA 4DSFA 4CZLA 5F8LA 4OZ1A 1RAHB 4LF5K 2VIHA 4J9UE 5CQGA 1PSDA 4Z4GA 4OZ3A 3SUOA 2IM3A 3GJSB 3JXUA 4JHDB 3NY0A 4IWVA 2LQJA 1WACA 4J9SA 3GE1A 5M1OA 1IBLK 3MMVA 5GAHP 2V4QA 1VSLA 3H4DA 1FKPA 4WU2A 1Z05A 3DAWA 4BREA 1WB9A 2GJFA 1WKLA 2JJ4D 3GFHA 4DEZA 1SIWB 4BWJA 4KRWA 2B6AB 1RSCA 1U0HB 1QQCA 1FNOA 1YJTA 1PJ5A 3H08A 4C8OA 2QI2A 3VQEA 3CCMS 4LVOP 1RYSA 4M1KA 4BG9A 3U9DA 1T0TV 1GLLO 2PAVA 5ETOA 1U1KA 4XIUA 4CEQA 1IR2A 2JWKA 1NNEA 5KFPA 3HI9A 1SKWA 2XSFA 1Q5VA 3D9BA 2CKWA 2HGNA 1V3ZA 3R6LB 3G82B 3Q8VA 5AE3A 5D4LA 5DM6Q 4M94A 2BJEA 4I4BA 3IG1B 1PAUB 1FFGB 2EKYA 3VEXA 1Q86O 4MT1A 2N3OA 5LSLA 2OPPA 3B6BA 9ATCB 4CHQA 5ETVA 3CD7A 4CCHA 4HACA 1H2UX 2IOCA 2JFDA 3NS5A 3BKTA 3OS2A 3EZUA 2OEKA 3W0LA 3PHTA 4LRFA 2IVOA 1F5CA 4MH8A 3CETA 3NL0A 1Y00A 4HHHA 1RHKB 4BVPA 4K25A 3LGMA 4Q0BA 3U1LA 5BPMA 3V81A 1JLEA 1MN9A 4A57A 4QAGA 2UZAA 3J8AA 4PUOB 4S0MA 1XNQF 1ATNA 3CC4N 4ILLA 2B43A 5BN9A 2ZUGA 3LP0B 4N7TA 1HHTP 2FF3B 1J9AA 4DV7K 1VBKA 3FSXA 4W92B 2WFBA 1Q82O 3AA3A 4B3SJ 1TYQB 4CGDA 3MMAB 5LMUJ 3H20A 3D3CJ 4B9UA 1FX2A 1T3OA 4RBTA 5DDPC 1HLUA 3TZWA 3WX8A 4WFAL 3RWUA 2ZHAA 1NKBA 1S1VB 1Q18A 4X66J 4BGAA 2XBPA 2ADCA 1CLQA 5JVGL 3LZIA 1QAJA 3THYB 1N33K 3QGGA 4EYHB 4AH9A 2UUTA 4FF3A 1S49A 4ED3A 5IC6B 1YTAA 1WN7A 1TVRB 4KFBB 5F0WA 3OW2M 3ZX3A 2PDAA 3KWGA 4ILRA 2UUBF 2RJZA 3MOZA 3AAQA 2HNZA 1W0HA 4LF7K 3CMEN 5IT9O 1JJ2M 1F9HA 3GDQA 4ANCA 4LY7A 4M3RA 4A5AA 5LT5A 3P38A 1S7IA 3PYDA 2ETJA 3K57A 3F5TA 4F4YA 4P10A 1UFWA 2RE2A 3G86A 4FW2A 3VGKA 3C16B 3QZ8A 3GWCA 4DR4K 1F9FA 3PO4A 3CM5A 4QWCA 4CF2A 1BCMA 2OIHA 4J7CA 3CJCA 5KG7A 1CJUB 1S9GA 3MN9A 4LSNA 3FQLA 3CPWR 2R7UA 1X4HA 2RKIB 3WQTA 4Z4CA 4RW4B 2W25A 3O2IA 3O3HA 3F44A 1KVKA 3QIOA 2FBYA 3MWPA 3KHRA 5LSRA 3LDQA 1RT7B 1IBMJ 4OYBA 1P1TA 3GJQB 5AQFA 2XSJB 5EX0A 2VASA 2ATQA 4DR5J 5A8WA 3LUYA 4CLWA 4DPXA 1CZAN 3CDAA 4EK2A 2MQLA 3CQ8A 1XC3A 2CNLB 4IH7A 4FJMA 1VBYA 3VEZA 3TUIC 3UW1A 3ZZPA 1YBTA 1V3RA 2G0IA 3W2VB 5GAGI 1UVNA 1OJ4A 3NS7B 1I6JA 2W4CA 4I56A 2HPUA 2WW4A 1U26A 1QJHA 4PR6A 1XWLA 1I94F 3NNCA 2K8GA 3NGYA 2KG0A 5LMNK 3GMGA 4IFVA 3ZZRA 1EB0A 4JS5A 5KFFA 4EO6A 3D28A 4EUVA 3VAGA 3TSPA 3U6FA 4LREA 1FEEA 2RRBA 3D0IE 5E84A 4JI5K 4IKAA 2KG1A 1NU0A 4DR3J 2E1PA 2JEIA 4BC5A 3NGDA 2DIVA 2YNGA 4Q2MA 1RT6A 1VYAA 4RPFA 4CHNA 2RD5C 2E6MA 4YEAA 1QHAA 2DNLA 2PEHA 3JSRA 3CJ2A 2PYJA 4A8FA 4WQ5A 2J6TA 1SAZA 2IBKA 4XEIA 1AW0A 4LSZB 2UU9K 4LFAK 5M2PA 5EVZA 1QHTA 4PZVA 1NK4A 3M8QA 4G65A 2D0AA 2NXUA 2DD8S 4H4OA 3I5BA 1TGOA 2FPHX 3BH6B 1C0MA 1T05B 1XJWB 2YKMA 2W2PP 3N6LA 3TUJC 1Q16B 5AQRA 3J80O 4UTGA 2OZMA 4FWQA 3H5SA 1SQFA 4MKBA 4FXDA 3K8VA 4DCPB 3SIPB 5KGWA 3SI6A 3WIVA 2NXNA 1R6VA 2IAJB 2V94A 3CJBA 3MDFA 1RUSA 3H5YA 5J2NA 1P27B 1FK9A 3NAEA 2IBOA 4I6AA 2GV9A 2DR9A 1G1XA 4ETXA 3M05A 3KLVA 2VBXA 1OWXA 3PZPA 3LGHA 3ONQA 1HL6A 4KGVB 3CCUN 1E4GT 3D6MB 3CJKB 4X66F 4ECSA 2OTLS 3O9RA 4RX6A 2OD4A 1RE1B 1NK9A 3VPZA 4CJEA 5C12A 4HI1A 4B1UB 1H2TZ 1SJ1A 3L4IA 4J90A 5HRSA 4C0HA 2QEXS 1S9EB 1RAIB 2F4VK 4DN9A 4GV3A 2WTUA 3QFPA 5HJXA 4W5TA 2HHHF 4MIBA 3BPDA 3ZT1A 2PC6A 4GVBB 3MPUB 2GQ2A 1U25A 2Z8QA 5DDOC 1CQNA 4KB1A 4YORA 3O1WA 2HNDB 2VFVA 5F8GA 4J2DA 4RW7A 5HBMA 2NSCA 5K20B 3SMZA 2PMWA 4CLUA 2GAGC 2GEMA 1RK8A 3TEGA 2E7XA 3M8ZA 2VG5A 2XYGB 3C6TA 1RA7A 4DMNA 4E7JA 3MPDA 2B4OA 4J2EA 2M8HA 1RTHA 1WC1A 3L6QA 2DTUA 3IGVA 3HYFA 4EAHD 2OCEA 4E1NA 1CS4B 2QWQA 2EXUA 4YY3K 1RTDB 1CEZA 4ZJLA 3O1BA 4CJKA 2YJFA 2QN6B 3NOCA 1RYRA 1IBMF 1X0PA 3RBXA 3THXB 2CG8A 3L2UA 5L1JA 1B70B 2M9KA 4DR1J 3SCKE 1N8RO 2ZKUA 1HBOB 4DR5F 1XMQK 3MR3A 1KHWA 3MFIA 4GVEA 3UNGC 2YNGB 1O13A 1FF2A 5AQKA 3IMQJ 5EUHA 5HP1B 4FJXA 5B0CA 5KFQA 3HPHA 1U2VB 5FPMA 4WWSA 3SDEB 5KPRA 3N6NA 3LDOA 2FVCA 5AQJA 4CESA 1AXQA 4BDYA 4WYLA 1LW2B 3LGNA 4RWTA 4CJFA 4M45A 1HIYA 3IR5B 4I2PB 4HHJA 4ZIVA 3SZ2A 3FFIB 4BRGA 4HUGA 2CQPA 1HBNA 5L39A 2XWXA 1HNWJ 1FWLA 2E1AA 3T5HA 1V3SA 4O8UA 2B0GA 4ZPDA 2HK2A 1HWKA 4K42A 2HMIA 4KBOA 2YNHA 1LWEA 3QO9A 1T9VA 5M2UA 1E6YA 1NDLA 4NPOA 1B92A 3TA0A 2OTJN 1IQZA 2QLJB 3KKSA 3DLGA 5DO2A 1VQ8N 3QBXA 2CQ2A 4FVCA 2CJKA 1VQMN 1JLGB 2D0PA 4JKHA 2AMCB 3C14B 4ID8A 4CZGA 3VERA 3H5UA 2IIHA 4RU2A 3PRVA 3ZETA 5GIPA 4BRFA 1IKVA 4JKGB 4WFNL 1DAXA 4JUZA 3DNCA 4NE9C 4O0IA 2DNGA 4Y2KA 4KGKA 5FIIA 1NZAA 2MXYA 4DR7J 4FZZA 3P4IA 3WXIA 3ZTQA 1QE1B 4WF9L 3OYGA 4JBCA 1HWJA 3WEEB 4R25A 5EGYA 2PI5A 2DT9A 3NCRA 5HBMB 1HX1A 1UFKA 2NCKL 4FXWA 1HR0J 4K50A 1HNXK 3TYTA 2GMJA 2G1DA 4DUTA 2AQ4A 2P9PA 4MLHA 2OGUA 2MKYA 3L7PA 1X4GA 2JC1A 2YWFA 2D0OA 4NLSA 2IVNA 3A5NC 4ZVHA 3A8YA 3OTCA 1RDBA 1XBWA 3HM8A 4PXCA 1FO1A 4D3HA 1IKWA 3QLHA 3MXJA 4OJ1A 5KG1A 1QD1A 3OHAA 4ZVGA 4C2MA 4LF9K 4X65K 1AT1B 4H5NA 4BRCA 3EVOA 4HTLA 1VQPS 4MKAA 1U6BA 1L3UA 1QSSA 3D0GE 1JJ4A 1U49A 3OQ2A 1C2PA 3GV8B 3OJUA 4DTRA 2V9WA 3QEIA 4RUBA 4NXMF 3VV2B 3EXYA 1BHLA 4EU0A 1HBUA 1K0TA 4GW6A 4PYAA 4BLGA 1FRXA 1VQ5N 3IMXA 4FM0A 3FRYA 1BUPA 1ZTWA 5BRHA 1OIAA 4CFCA 2YKQA 3BGFA 3MPWA 2ZH9A 2RVJA 5EDWA 1H38A 1QVFR 2QWPA 2LXUA 4EIAA 5A6WA 4B9TA 4DJBA 1REVB 3TVZA 3R7SB 4URSA 2K1RB 4DR1F 1QDUB 2DGOA 5C24A 4LD0A 4OYIA 1CXUA 2CQ0A 1VSJA 1YRXA 4DPTA 5IFMA 1F2HA 2P5GA 4TU8A 1BDGA 1SKRA 4QS8A 1U6ZA 2Z1JA 1N5TA 2BX6A 3QRPA 1IKXA 4OMFG 1VFJA 4CDIA 2R8GA 1LWCB 3HT0A 3M1FA 4P52A 4P72A 1FXDA 2E5JA 3M6XA 4WKYA 2AT1B 2JFKA 4U96A 3MM8B 4DTPA 1RWNB 3I9V9 2DISA 3LQVA 4B9MA 3DRSA 2BYCA 4YOVA 2RE1A 3UKRA 4U67Q 2BKNA 1RHUB 3J81U 1E6VB 4ZHRA 1NEEA 4HT5A 1RAEB 3VEWA 1HNWF 5HMYA 2BJ9A 3MURP 3BH7B 3CCEN 4F67A 1JXLA 3D1HA 3OA9A 1N36K 5C0YA 1Q9XA 2LEAA 3DKDA 3CIPA 1S72S 4P2SA 1RACB 4FM2A 1WAFA 2B9WA 4RW9B 3ENVA 5EWEA 2GJ2A 3L8BA 1QUVA 1U8WA 3P1GA 2G1HA 4DZ6A 3AB4B 3FSYA 2ILYA 1RXOB 5J1PA 5T7LB 3VA0A 3V9UA 4Q44A 3NH0A 4NOHA 1XMOK 2HHVA 5AQSA 2P9UB 3P39A 3R1HA 1UZDA 3EICA 2CPJA 2QWLA 3RVCA 1P8ZA 1ZBLA 3MEGB 5KG3A 1VQYA 3CERA 1HI1A 2PMHA 4O44A 5KT6A 3SMSA 1GXLA 3PTWA 3P5BP 2JLGA 3P96A 2GQQA 3OVSA 2DXEA 2NXJA 4DR7F 3OYHA 2V8DA 4N8NA 4Q45A 1R59O 4ZKAA 3QT8A 3GJTB 4F50A 3KHLA 4OL8A 4DV4K 2CIMA 4B9VA 5KFDA 5EWGA 2RB7A 1YG0A 2IPOB 1MROB 2POKA 5KG2A 4OI1A 4TSXA 1HR0F 3U02A 4M5DA 1WSVA 2P9IA 5K14A 3SQ0A 1CBKA 4N76A 3SAHA 4WP3A 5E3QA 3HT3A 1SJ3P 5IT0A 3C6UB 3VCDA 4NMLA 1MMDA 3KLIA 2WBMA 3O1LA 3AVBA 3TANA 4ILMA 1NU4A 3AA9A 4ECRA 1HKBA 2CNNB 4YB5A 3DU6A 3RW6A 2XY6A 3CULA 2O8BA 3O3GA 2R7OA 2YX7A 3OTOJ 3GFZA 3M8PB 2VODA 1LXNA 3UO0A 1VQ7S 2D5RA 3VQPA 3KZBA 4H4MA 3LP2B 2RRNA 3VQ7A 4OI3A 5KAKA 1RLCL 3BQ2A 1VQ6S 1S0VA 2AA4A 3MN7A 2V8HA 2V68A 1C1BA 3AVNA 1HNZJ 5U47A 3FZLA 5EU7A 1YJUA 3CC2S 2MKCA 5HROB 1IBLF 1FXLA 3HRGA 2RQCA 4JRQA 3MF5A 3VR1A 3HF5A 2YWHA 1I5OB 2AW0A 3QEVA 2R3VA 4WP9A 4FJ5A 3D67A 3UE5A 3ETMA 2O8CA 2CPIA 4OJHA 3K5LA 4DV5J 1WUAA 1QAIA 2WONB 5BPLA 3ZSXA 4M5MA 4ELTA 2W01A 3BKUA 2VPZB 3CVKA 1XEZA 4X4UA 2IIRA 3SBMA 2FY1A 3TARA 4OZ0A 1H98A 2MQNA 2G8FA 2G0CA 4JI2K 3M7VA 1RDWX 4FWLA 3EY1A 5CYQA 5ETNA 1VRQC 4A8YA 4UY85 3POTA 1D9AA 2QXFA 4B9SA 4DL6A 4LF2A 4BC9A 4E1JA 3DOKB 1BA0A 2ASOA 1V4SA 2MQPA 2JRSA 2E5IA 3IR7B 3TQ1A 4FK0A 5B0EA 3MXIA 4JI7J 4DPWA 2IM2A 3MMCA 3UQSA 1QY7A 4J9KA 2QO3A 3C3LA 4FJ8A 1ITPA 4WCEQ 1A7GE 3SQ4A 3PCOB 3U1MA 1HD1A 2GVZB 1E4FT 5HL7Q 2HBKA 2JL9A 3GIRA 1HD0A 4TU7A 1DLOB 4CEFA 2YBVA 4O5FA 4Z0UA 2V5HG 1MNEA 1M5VC 4NL5A 4CIEA 3MAQA 1RAFB 3O9QA 4PG5A 3P83D 4K7QA 5KFSA 2HVHA 2EK6A 3I96A 1B3TA 3T1YF 1FDDA 3G8TA 5AFUH 3J7Z5 4Q2LA 3Q89A 2KHDA 1SBRA 1TL7A 2OHDA 3OFFA 3IWNC 5ETLA 1T11A 1WBDA 1J5EK 5FPDA 4ICLA 2FBVA 2CAJA 3HJFA 2R7XA 3CC7N 2C1EB 4OKKA 4R0EA 3W61A 3N0VA 2G0JA 1SQKA 2MTLA 2CJBA 3AQPA 1TUYA 4H4MB 1ZBSA 4J37A 4PG4A 3VQAA 1EHWA 4K4ZA 3MTJA 4XDDA 4CJ7A 5KFRA 2DNHA 5ETSA 1R8PA 2KT3A 1C1BB 3KHYA 3CJRA 2Q0UA 1D9DA 1PKUA 1X4DA 5AQMA 2IDEA 5EHHA 4A8MP 4FPRA 1IG9A 1YK9A 2QK9A 5FDLA 2E7VA 1SJQA 3I8BA 1M5KC 3CFPA 4HDHA 3EE9A 3AO2A 2X1AA 5GMKa 1VLOA 1NHUA 3BF4A 2QSFA 4NA2A 2EI5A 2AX1A 4BGBA 2JWLA 1XR5A 2RSQA 3OTOF 5CZXA 4O3RA 1WNEA 2ZH7A 2KFYA 3P4UB 1Y97A 2DGWA 2P1JA 4RW6B 1PYTA 4DBQA 5D0HA 4IJNA 2BH1A 5IWAJ 1M5SA 2YKPA 4ZVOB 3HBTA 1MWKA 1CC7A 1UAWA 1HNZF 4KHUA 4B3MJ 4UOHA 4XH5A 2P6TA 3DHXA 2YHAA 3ET6A 2RAQA 2XHCA 4CEOA 2ROGA 1APSA 1U1MA 3KDOA 4USMA 3RZAA 1KVCA 1WD6A 1C0UB 4CQ1A 4NYNA 1ASUA 3KG0A 3AVCA 3DGPB 2YPYA 4WQ4A 2CPDA 3C8YA 1XNRJ 3T19A 4DL2A 1ZYQA 3EZWA 1KRPA 3KNGA 3A8JA 3M8RA 2W2NP 1S1UA 5A2QY 4DV0J 3MCOA 4AFFA 2BM0A 1NM1A 1VR6A 4KTWA 1DTTB 3BREA 3R6GB 2A40A 3BQ0A 2EFPA 3A8IA 5LY3A 3OUYA 1ZM2A 1Q81O 4ITSA 2QJ3A 4K2XA 3NGTA 2LYVA 3LP1B 3MAAA 1ZA2B 1NJYA 3NFAA 3AOAA 1TR0A 2QX0A 4Y2AA 4Y65A 1ZS6A 1FVSA 5DM6L 3T41A 3BO2A 1Z4UA 3JSMA 2G8IA 4YN3B 1DARA 2KYZA 1ZM9A 5H9FK 3PFOA 1RT2B 2DGQA 4JI7F 3HSGA 1HQUB 2Z1HA 4FLXA 1R27B 3AO4A 2B9XA 5E3RA 5GAGP 3DWLA 4ILHA 5JXSA 4EBEA 1GLAG 3EE8A 1H72C 3RAXA 1SI9A 2ZJRQ 1GOAA 3CGIA 3UDVA 3TZZA 4NLDA 4PEOA 1VQ9S 4FL9A 1HQEB 2B4PA 1T3NA 2HHWA 2X7IA 7FDRA 2NREA 1YKWA 2VBZA 5L8RC 4IDKB 2VPWB 3F56A 4EFAC 1O0PA 2ITMA 1FHTA 1IR1A 2BE7D 4OYMA 1NGBA 4J9OA 1ILYA 4QIWD 3BYPA 2MEWA 4YHHJ 5FPEA 1NGAA 1XK8A 3KJQB 2DNYA 4IOXA 4HYKA 2ZBPA 4JI0J 1F3FA 2HVEA 3CUNA 1OVQA 4H0TB 4RNHA 5CZ1A 1EZZB 3BBFA 3R5GA 4IR1A 5FDLB 1JQGA 2D1KA 3EN9A 4H5VA 4R8UA 5I3UA 5FLXU 4JYAJ 3OYAA 1IVZA 4E98A 3QEPA 4KGXB 4I67A 4A62A 2CQ4A 5HOOA 3CQYA 4I64A 1F5BA 1OQ6A 3RBZA 5IS2A 2FSJA 2DPJA 4CK1A 3H98A 5AZJB 2W1BA 4ED4A 4CF0A 1JXBA 2A3ZA 3N28A 2IVFB 2V4JA 4JV1A 2M3DA 2OPRB 2VG7A 3I0SB 4C6AA 4H54A 4DWIA 2W9CB 2W2QP 1C1CA 1U45A 1N34J 3TAQA 2AJ2A 4AM7A 3U1NA 4CM0A 1JLBA 2DY4A 2CPZA 3VN5A 3QINA 4XH1A 4WZQA 4ILJA 5LSOA 3FSIA 1IBKK 3OYJA 3UFCX 2XS7A 3VALA 4JV5J 3D68A 3AJ2A 3J7YU 2KFNA 1VSMA 5HJYA 3D2EA 3ID6A 1L3VA 3MX5A 4I0WA 4Y6IA 1R8AA 3EGNA 3SUQA 2V9KA 4K4UA 4DV2K 1CXQA 2WHOA 4YY3F 3OXFA 1S1UB 1GXTA 4OFZA 2KFZA 2B8PA 1L3SA 5IWAF 8ATCB 3CCLS 2OANA 1NDPA 4DDFA 3FVYA 4KHMA 2WB4A 5A6PA 2P9NB 3NNAA 2WVFA 3TO8A 2FY8A 2LVWA 4B08A 2A6AA 5CY4A 4FJJA 4ZCLA 3W2WB 3CO9A 2C2DA 5J2MA 3GIIA 1WI6A 4J8FA 1PYOB 4MIWA 4ELUA 2WZ1A 5BR9A 1ESVA 2J8SA 3CPEA 2KZZA 2HQDA 1XNRF 1JKHA 3W3DA 1R8CA 1KFSA 2ZGYA 1XQIA 3R2DJ 5AQUA 1JLFA 3O5BA 1I51B 3J81O 4EYIB 1ELOA 2D3OR 1FRLA 1SH3A 5HLFA 4H5RA 3U3YA 1HYSB 1JL1A 1YJNN 3J7YI 1KD1O 2AWZA 1VHIA 3FZKA 4CJRA 2BJ1A 4ZTJA 5SUHA 1KS2A 2C2EA 4DU1A 3GIMA 1YHQS 3FLCO 2BACA 5D15A 1RT1B 3G4SN 2LCWA 1OPIA 2OKQA 1FRKA 4PKIA 4ELVA 1S0NA 4FPBA 1S72N 2QMXA 2XMMA 4P71A 5I3UB 1H3DA 1NSPA 1WC4A 1P90A 3X1LB 2CGJA 1B0TA 1S7HA 3AARA 5MAOA 2KM8C 4GMKA 5AXMA 3OFGA 2IM0A 2PY5A 2Q1LA 4JS4A 1EO1A 3EEQA 4JI8K 3SV4A 4Y3CA 2F65A 4E8UA 5GAHU 3KHGA 3C6AA 5IOLA 4DF8A 3L7UA 4USJC 3QRQA 3BSNA 3DMJB 3MEDA 4X64K 3HCXA 3GL1A 4HTJA 3B4DA 5JICA 4B8AB 2IVPA 1RAAB 2DHAA 1U1PA 4JI0F 4CP5A 1A5VA 1VQSA 5B7WA 3PYEA 3M2RA 3D0PA 3ZSQA 2V34A 1UWAA 4LF6J 2B4VA 1VJQA 3ILIA 2QYCA 4USKA 2FTRA 2FXUA 4K0KK 2R2SA 3VVTA 1BI4B 3K5NA 2M0GB 1VRTA 5IT4A 4IH5A 5EX5A 4F3OA 3QAUA 4USWA 2DNPA 1G99A 3SSSA 3CCJS 2XGPA 5EXWA 1MDUB 3LL3A 4WFAQ 2DHXA 2HOEA 4ILGB 4KI4A 1Q8LA 2CQDA 1FW6A 4XTTA 3MGJA 3P49B 4CZFA 2ZF5O 4JKBA 3JTOA 5LJ3Y 2C2KB 3K2YA 3LM2A 2ZC3A 4ANDA 1S6PB 3D0HE 3CMAS 2P9LA 4CHOA 2W9BA 3HP9A 1GFWB 1MMNA 2YWEA 1RHQB 3EUNA 4JI1J 2E5LJ 2N7YA 2RDIA 3CG7A 1NJIO 3DDIA 2NQPA 5GAHI 4O3PA 1U1OA 4DR2K 2G8HA 3Q7CA 1BO5O 3TAEA 4JV5F 3GCXP 3G87A 2GBZA 3SSQA 2GIQA 3ULEA 3TNVA 1JKHB 1SH0A 2JVOA 3MZIA 5CCLA 4E7LA 3D7EO 2B5JB 2GVDA 2IA0A 1K47A 2AIRB 4OPJA 1K0VA 3DM2A 1CJKA 1RWWB 3FBBA 3HX9A 4NLOA 3QDKA 3S41A 2XMWA 4P6QA 4FOIA 5H9EK 3QBWA 4FWOA 3EDQB 2CXEA 4BE2A 4OJ3A 2PMZD 3GONA 3EZ5A 2IJNA 4WFZA 4KGMA 3D54A 2NRWA 4LFCF 3FBEA 2CRLA 3BZQA 2YWWA 2GUIA 2MZ1A 4CFAA 3UR0A 2RH3A 3MEKA 1T44A 4O3QA 4CYUA 4WXOA 2V50A 1G6BA 1XIQA 4USVA 3QAEA 3A0IX 1RTJA 2FZCB 1NSQA 3KJVA 2HLUA 4IO8A 3RB4A 2AU0A 2XLIA 1WG4A 3CCQS 3H59A 2FHJA 1HNVB 5HVGA 1YJ9S 4U7UK 2IS3A 5E7OB 1TK5A 1VQNS 1RADB 2DNQA 1S6QB 1JJ2R 3KKRA 3QT5A 2DGXA 1JL2A 2KQ2A 2WUSA 1OPZA 2NUHA 2MGZA 3OS0A 4C8LA 2IHR1 4IQMA 4FZYA 5KPTA 1MU2A 3UCZP 4DHVA 3RMDA 1HHQA 5IQQA 2Z2LA 2UVRA 3UCUP 4WXWA 4QOTA 2GMLA 4X4OA 4RU9A 1N6QB 2X3GA 1U09A 3GYNA 3MMBB 3TI0A 2FHOB 4RTFD 1RBUA 5CYMB 1C4CA 2ERRA 5GMEA 1MWQA 1UA1A 2P9SB 3W9IA 1RBAA 3AAWB 4IRCA 1JNRB 2OPSB 1Z2LA 3EPGA 4A47A 1NOYA 1TK8A 1FFWB 2WOMA 1C0TA 2VH7A 1AFIA 1RZMA 2UXDK 5L46A 3SK3A 2V69A 1W97L 2HIYA 3Q8UA 4YR0A 2OZSA 2C22A 4Z4FA 1V9OA 3D2FA 1FFSB 1MMLA 4ECTA 4I9LA 4DV3F 4RBUA 4KAZA 1XNQK 3IA0A 4MMOA 4DV4F 4DUZK 1U0SA 1S4FA 1EKEA 3ULDA 2OJ3A 4JD2A 1WHVA 3O9UA 4J2AA 4UUWA 5HMZA 2YQ0A 3OHBA 4JKAA 4CLYA 4UZCA 3H46O 3TRGA 1P6TA 2CUYA 4TY9A 1Q8IA 3L0QA 4L74A 3FC9A 2KHCA 1NOZA 4CJSA 3FCWA 4ZVUB 2NRHA 2KJVA 5J2PB 4J2BA 4E0DA 3R97A 4Z7YA 5G0RA 4CI0B 4WIQA 3QJLA 3BR8A 1GAOA 2ZH5A 2E20A 3A13A 3NGRA 3HZGA 4OYAA 1GLCG 4W98A 4I6MA 1GXUA 2XYPB 3IS9A 3TR5A 2F96A 3PEJA 1HYZA 3LANA 3ALYA 5KT2A 4O23A 4JI1F 4CZCA 4Q7AA 2E5LF 2RIJA 2DH7A 5IZHA 4UUXA 3GB0A 3BEGB 4FW1A 2E2OA 3PRBA 4CO5A 4CEZA 1YXQA 2Q1NA 5DK5A 4CH0S 4PHTX 1WORA 4A8KA 2JLEA 3HSTB 4CJTA 2YI1A 1N33J 2HFUA 3ENAA 1X9SA 3ZLJA 3K0SA 4LQ9A 1FX4A 3ISZA 2K06A 2V63A 4FJIA 2V51B 3CXCR 1QZ5A 3BN7A 5MLCQ 4LF7J 4ZN1A 1B64A 1P9QC 5E3AA 3NWGA 3OYMA 2M88A 1EP4A 2MQMA 4AL5A 1TL1A 4KH4A 4A2AA 1SH2A 1NXIA 4ZVQB 2VKZG 4ZVFA 5C2DA 2C2MB 3DDKA 2DFEA 1NK0A 2GX9A 2QW9A 4DV6J 3GR1A 4FDFA 2QL9B 4CIOA 1WSEA 1BC6A 4ECYA 2NXEA 4ED0A 2UXBF 1TTHB 2NLWA 4P2XA 2HK3A 4JLHA 1A6LA 2O3DA 1X3NA 4WTOB 3QSYB 3AH6A 4NYOA 5RUBA 1K8AO 2DRAA 3H4BA 4A8WA 1Q86T 3TSUA 1WC0A 3T1HJ 3O5TB 3OBIA 1BA1A 3HHLA 3UVJA 2VKRA 3R2CJ 1IM6A 4G1PA 4OZ2A 4JKEA 4OLBA 3Q8RB 2XMTA 5DLGA 1S1XA 3CCSN 3TZYA 4GKKJ 4NLVA 3D2FB 1HWUA 4HHUA 1LAWA 3RRHA 3O6WA 1XR7A 4YB1P 3RR7A 2HF4A 4O4GA 1VQ9N 4UY8O 3KUHA 3HSZA 1W2BM 1KSPA 4K4SA 2DR8A 2LSNA 2HG4A 2WCXA 4IJAA 3H42A 4H5TA 5KT7A 4GV9A 2Q97A 4OZLA 4CEBA 2NXCA 2MQ8A 4DS5A 5KG4A 4X4SA 3KLGB 3VAHA 4OGCA 2RQ4A 2GAHC 1S1TA 2RQKA 5JS1A 2LMIA 1HKAA 1JLQB 4PXDA 1UWBB 3F9KA 4H03B 3I0RB 4JAXA 5AZIB 2AHOB 3W9JA 4E7IA 1JMTA 3I55S 5C25A 3AD7C 3TTDA 5KI6A 4XPCA 2QKBA 3MCPA 4G1IA 5AQHA 4WFNQ 3ZX0A 2G8UA 1S5ZA 3MECA 2UVUA 3FR0A 4M8LA 4QR2A 2F40A 4LC9B 1LNQA 3ZZOA 2LEPA 4OX9F 3KWIA 4OYPA 3EXCX 2RNEA 3QPIA 3J7ZO 2G4BA 1NSKL 1SPBP 5K8MA 3HHNB 2EKNA 1D3WA 4PQUB 2CADA 1QTMA 2Z2ZA 3SJJA 4H4KA 3FE1A 5B0AA 3IGNA 3F0NA 3EYZA 2QT7A 3CIMA 3UIQA 4X66K 2PI4A 1YX2A 2QV6A 2DRBA 5T7BA 3M2VA 2B7BB 2ZOMA 3NE6A 3PEHA 1VK0A 2K2PA 1LW0A 1LWXA 4OJRA 2FJEB 5M1QA 3GFXA 2HHHK 3HO1A 4M3XA 4QIEA 2PSZA 4IO1A 3BJYA 1U2FA 5KPZA 3HFZB 2FDNA 4XH4A 5DQIA 1PAEX 1NGFA 4ES2A 1CJVA 1U7LA 4FJHA 3NBPA 2O8DA 5T41A 1ZOTA 5AJ3J 1UTAA 2GA7A 4BROA 3CJ5A 4DQ8A 1D8YA 1TKZB 1WSJA 3M6GA 4CWBA 2VPXB 3MI7X 2F4VJ 3CJ9A 1O6XA 1YZ6A 4DL3A 2GIRA 3T9ZA 4FK4A 1GLDG 2G9OA 1ICEB 3U9ZA 4NCAA 3M1VA 3ZFVA 2EK1A 3CCVN 4EI2A 4CGFA 1IBMK 2GGPB 4O3OA 1HJOA 2V8GA 1UPPA 3AODA 4F4KA 3GP9A 1S1XB 4DR5K 1UCNA 1ZM3A 4OLOA 1G7CB 3SEOA 1K8KA 4O4GB 4Y2MA 4DV6F 4AD6A 1RT4A 3VGLA 2Y8WA 2B51A 1TZ0A 1S6UA 4E2FB 3BKFA 1ZAXA 4ED2A 1V4TA 2DHSA 1FJ7A 3TX0A 4KSEB 2HBMA 3LP3A 3GCWP 3T6JA 2ZM6J 1YVNA 3HMJG 4QS7A 3CD6S 2IVYA 1N5SA 5J1NA 1S1TB 1S48A 1UJ5A 2XY8A 1WEYA 4HTIA 3SUPA 4CZHA 1U47A 2HFOA 2YNFB 2NRTA 3T1HF 2LU1A 1XMQJ 2MKJA 4MK7A 2DIUA 1DQ8A 4V1Ak 2UVWA 3UR3C 2IYIA 1T94A 5J2QB 2GC8A 3LOUA 3WT0A 2I1RA 3MCNA 4DCOB 2FJXA 2VICA 2B4JA 3V1OA 1NPKA 1RJJA 2A1BA 5KFCA 1HJRA 2I8EA 4N41A 2MJNA 3LDNA 3QRRA 4P75A 3S3OA 3QFHA 3CD0A 2BE2B 2JSXA 3SFUA 4NB4A 2F9DA 5D3GA 1MG7A 3AVFA 5CD4H 3SQGB 2X51A 1TV6A 4CO3A 3MN6A 4C3KA 2QLFB 4LF8J 4DQQA 2WBNA 3HFKA 1XTZA 5E3PA 1WDTA 3BZCA 1U8SA 2ASMA 4CLFA 3V4IB 2X78A 4DTMA 3AJ1A 3ILOA 3A5OC 4ZCIA 3H2VE 2MZQA 1Y3KA 2QYGA 2PFDA 2ZWHA 2V0NA 3Q8QB 5LJWA 2QLBB 3I87A 2FLLA 5E41A 2ZE2B 3IR6B 4MFBA 3VAMA 3SAFA 1OQ3A 4UW2A 4MIAA 4ZJQA 1RFQA 4PWDA 2VPYB 1KDNA 2XO7A 3O9SA 1T8EA 2WVEA 1HI0P 4O8KA 3PO5A 4JN4A 1Q8BA 1ZBHA 4LSLA 4WBFA 1JXEA 1IBKF 3CPWM 3D2WA 4EZ6A 2VDIA 3TPQA 2VG6B 1WC5A 2FVPA 1IJFB 1HQ2A 3GV7B 2ZZMA 5KFTA 1YVUA 2QL5B 1IWAA 1CQMA 4CJQA 2K7JA 1DTQB 2YHBA 1KLMB 3R9LA 1VS3A 3DOLA 3DLEB 1D09B 2C3MA 1R43A 3KK2A 3IP0A 1VQON 2OSQA 4OJGA 5DG9A 3U8XA 3TA2A 2NZCA 2BE9B 1RP5A 3QT7A 4LF4F 1ZBIA 3DLKA 1U1RA 3DRYA 1N8RT 1GEHA 4DTXA 4ID1A 4KHYA 4Z2XA 3CYMA 3CCWA 1J27A 3P31A 3NGIA 2J6SA 3MCMA 4O5BA 3HVTA 1KVAA 3CI5A 2W4PA 1K73T 1HKCA 4O0JA 5D4OA 1FI4A 3M5RA 1NHVA 1SB6A 2ACYA 2EFOA 1FVQA 4CHPA 2NNWA 2W7OA 4DR1K 2VB6A 4CERA 4KHPJ 1T9UA 3V5RA 2ZH8A 4ZPWR 3MCAB 4HHTA 4A46A 1KC8T 4OI4A 4JHDA 4CZKA 4MTPA 2CPEA 1YJ9N 4PG6A 1DRZA 3TR8A 2ZHOA 3G6YA 3UDLA 2W7PA 4GNIA 1WLJA 5AE2A 4B1XB 2Y9HA 3M8WA 3NGUA 3LDPA 4BDZA 1NAQA 4F0MA 2PIIA 1IKYB 1KBRA 2W7AA 3Q24A 4DR6J 3AO3A 2ZJRL 3H1QA 4Q8FA 3NVKA 3ZTSA 3OYFA 2B6AA 4DLEA 1U0HA 2UVVA 4GVLA 1HNWK 2VHGA 2CNOB 2N4CA 2YH0A 1KOOA 3CCRN 1WDDA 4RBVA 4AHUA 3NAIA 2W24A 3H8YA 1KAXA 2BVZA 4IR9A 4RWXA 3QEXA 1XMBA 3V9WA 1Z25A 2MKIA 4X64F 4NMXA 2HVDA 1IO2A 2V7ZA 2ZWPA 2DBBA 3DXMB 4AHRA 7AT1B 1RTIA 4RNOA 2XCPA 5D0RA 5FD1A 3G82A 2OD6A 1UA0A 2WTFA 4YP3A 1S9FA 2HW3A 3OS1A 3IG1A 2P8IA 1QVGR 4NXNJ 1BIUA 4EZ9A 3CWJA 4HEA9 5HQLA 3QNWB 2XS5A 1IM4A 4LF8F 4QPXA 5ELZA 1MW7A 5AQLA 4NLTA 4WP8A 4BVOA 2E6LA 4IFYB 3MUTP 3LALA 1RCOB 1VC6A 1XR6A 4CGHA 4GC6A 3J7A1 5DQGA 1S5JA 4DR7K 4Z4IA 4X62F 3US5A 4KO0A 2VWKA 2QA1A 4PUOA 4YB7A 3IFRA 3LP0A 3AVKA 4PA1A 1HR0K 4CEEA 1M5HA 4A2BA 3JQJA 4ZMMA 1WC3A 4FZVA 4P7TA 2PBDA 2H5EA 3QFUA 3JAMU 5DETA 2KXNB 1RB0A 3TX8A 3W9HA 4FLUA 2XI3A 4OHZA 1TYQA 4K4XA 4DR2F 1GLBG 3MMAA 4LRDA 3M32B 4DX7A 2AJFE 2XMVA 4JI4J 3R3LA 3ZZYA 2M52A 2WBRA 1D4XA 5I3QA 3J81Y 1Q8KA 4OLPA 1FRJA 2C2NA 1S1VA 4U7UD 4ZS6A 2CVIA 2F8SA 2UYTA 4KKOB 3THYA 1BQNB 3JTNA 2A6MA 1KVIA 3HHKA 2I5JB 3JYTB 4P9SA 4M3YA 1TVRA 4KFBA 1K9MO 2AGOA 1TP7A 4ED5A 2D9PA 2QA4S 3TAFA 3CJQA 2ROPA 3BUZB 3GSIA 1WAJA 3M8SA 4BG8A 3DI6B 2GX8A 4CLTA 1FD2A 3OTEA 3C16A 3P8BB 4ZCMA 4JI6F 2XGQA 1CJUA 1UMJA 2ZJPL 5CABA 4MLEA 4CD1A 1W7AA 2BQUA 2F8TA 2RKIA 3KLFB 1UVIA 4RW4A 5ETTA 3FZ2A 4PCQA 4CBUA 1M5OC 3D66A 2CZ4A 1RT7A 4KHPF 2XSJA 3CJ3A 2O8FB 1YI2N 4KHWA 2J7UA 2EW9A 3ZTPA 4RUCA 1WWHA 2E88A 1RTIB 1RDUA 1RWXB 4W5QA 3LPEA 2CGKA 4HI2A 2QRRA 4TU9A 2L41A 2LP4A 1D9FA 1T02A 2EPIA 3D6TB 3W2VA 5I42B 5ADZA 3HOSA 4IXCA 3VF4A 1VISA 3RAMA 1F21A 4XPEA 1OVYA 3KK1B 1X5PA 3N4PA 4JI2J 3QNNA 2BJ3A 4DTSA 4KIAA 1N88A 2FBTA 4DCHA 4RZRA 2UXDF 3DRXA 2RUGA 1D5AA 4FLYA 3TUZC 1B7YB 4CM2A 1WEZA 1WTFA 1A9NB 3BF1A 5KG6A 3MM5B 3ITHA 4KO0B 2EBGA 1GOBA 5DJBA 2W4DA 5A2QO 3I55N 2OMOA 4DUZF 2H4WB 3IM9A 3GOIA 3T1YK 1K1QA 3DFEA 1XN9A 3MM9B 4U95A 2DEIA 3W1YC 2V8PA 5KFYA 3M30B 2QWNA 3RRKA 4FNHA 5GINA 1EIYB 4DF4A 4USHA 4BRKA 3PW7A 2YQ1A 3NH2A 1VSHA 2KH9A 2NUUG 4FJKA 5TKYA 1T05A 1TUGB 1FNMA 3OYBA 2RUSA 1EETB 2OYQA 1FESA 3UN3A 4FVMA 1FDBA 1J2VA 4NLGA 2HBRB 2DPNA 1X60A 3OVNA 4RUAA 2HS4A 1B99A 1P9YA 3WQPA 5DZ7A 4WK3A 4KB7A 4CJ3A 5J1EB 2IAJA 1S22A 2ZH2A 2X1GA 4GO7X 2WSFC 3AD9C 5GAGU 3VVUA 4TLRA 1FRIA 2LDYA 4TYBA 3VQBA 3TW0A 5JLHA 2E1ZA 2U2FA 1PC4A 1S79A 4AE5A 4WJBA 1X4CA 5C2FA 1DQ9A 2A1RA 4YOEA 3KLHA 2KVIA 3Q22A 1M5PC 5BREA 3OYIA 2VC1A 2QIFA 3CJKA 1VIOA 3TWZA 3UD5A 1NMDA 1BD6A 3DLLL 2APOA 1QVFM 4FPIA 1LOUA 3CIZA 2A2DA 3O08A 1UOCA 3OTOK 3EPIA 4DU4A 3KLEA 2K3KA 2CZ9A 1WOOA 3MM6B 4CRJA 2HYIB 2KTQA 1XUPO 4OHYA 4GMJB 3FCVA 1S9EA 1JLCB 2HHPA 4QU6A 2UV8A 4YOUA 2DKOB 3N79A 2XG8A 3FUYA 3BGRB 3G71S 4FP9A 2DXDA 4GVBA 4HCBA 1HNZK 1U1QA 3L4QA 2HNDA 5HVHA 4QWEA 3P6YC 4BQZA 2MQQA 2AGPA 3TTCA 5IV3A 1YJWS 4U7BA 1IWGA 4LFBJ 5KGXA 3OR1B 2E2QA 4DV5K 1RABB 2R7RA 4KE5A 2YKOA 1X5TA 2DYAA 2MKHA 3MFHA 1VQKN 1CS4A 3AB2B 2AJ4A 3KK3B 1RTDA 1NGCA 3VGMA 3VTHA 2QLXA 1Y0HA 3OYLA 3I5CA 4F25A 2QWOA 4OYOA 2J0WA 3TA1A 3GBTA 1X4BA 3W5ZA 3LAKA 3N5FA 2CH5A 4BRPA 2DO4A 3THXA 1HPZB 2A3JA 4TNOA 4ZVSB 2FZGB 4XAKA 4PKGA 3ITHB 1HBOA 3HSDA 2C3PA 2L9DA 2QGFB 1RCHA 4MQ3A 2VC0A 3NGKA 5HP1A 4DSEA 1GNKA 3PLAA 5HN0A 4NI2B 1U2VA 3SDEA 2NRZA 4JI7K 2XULA 4CTAB 1R6YA 4DFKA 3TU5A 1OO0B 3OR2B 4EMDA 4H0YB 3DHWC 1LW2A 2BW2A 1YJVA 4IG0A 2IGIA 2HHSA 4RWWA 4I2PA 4X4PA 1FJCA 1A5WA 3N9UC 3ZT2A 1N5QA 1FJEB 2D7SA 3VWSA 3ZEUB 4NCBA 3FFIA 1SQEA 2WK4A 3PIOQ 2HIQA 5F41A 1U6FA 3ATVA 4OYWA 1RAOA 4AHTA 4QJVA 4OI6A 3ASMA 5IXUA 2QFIA 2RU3A 2ZITA 4B3SF 2O4IA 1BXNA 1YITN 5LMUF 1SVDA 2UUCJ 3LAMA 1HI8A 1RBLA 2N82B 3KLHB 2LQBA 1JLGA 5HRPA 3W62A 5HO4A 3C14A 4KI6A 3N5BA 2D1CA 3X3UA 5LL6d 4M3TA 5KFAA 3DLHA 1QQMA 4CEDA 3W5XA 3KLEB 4JKGA 2CPHA 2W8KA 3S6EA 2XRIA 4N47A 5DGBA 4M5NA 3FBFA 3R5BA 2IC3A 4ZIWA 2MZSA 1AYEA 4LH5A 3PKMA 2ZNZA 1SV5A 2YHXA 1PJ7A 1BUXA 1QE1A 4BR0A 3B82A 3CM6A 4IRDA 3L3CA 2LDIA 4B3OB 2MJUA 3WEEA 2HURA 2O66A 2YKNB 4QYZJ 2RU9A 4NASA 3PDNA 1BISA 1WG5A 3KYLA 1LXJA 2HRUA 1T03B 1FD8A 3Q8YA 3D1QA 3EO3A 2CVEA 1CVJA 4FOEA 3O4WA 3M8YA 2HEKA 4E89A 3UN5A 2QL7B 1VQ4S 3ZSRA 3Q8SB 2VONA 3NF9A 3C7NB 1C0FA 3S01A 4CJPA 1NJZA 1JLAB 3OSPA 1SCJB 3THWB 2BGGA 3LWMA 1RBTA 3H1VX 2KI2A 2HMPA 3DRPB 3FDSA 1SJRA 1R0AB 3BR9A 4ID5B 4X4VA 1BQXA 2VDHA 2I2YA 5KFGA 5IWAK 1KCFA 4KRFA 2YJEA 3D6HB 2NPFA 5EN1A 3WNFA 4F8RA 4LF1A 3IN5A 1DZ5A 4CJLA 1LK7A 3VF0B 1WSGA 1Q81T 4MAKA 4M63C 1DJ0A 2ZGZA 5FLXY 4DI6A 1FKAF 1K73O 1ATSA 4LFBF 4BY9C 1Q4RA 3HSCA 3VQ6A 2CQBA 2PFFB 4CVNE 1XNRK 3MAHA 1KQSR 4NLRA 4IG0B 3K5MA 2LQ9A 2GUPA 3MOJB 2GIFA 3VESA 4DX5A 2P51A 1Q79A 5DS7A 4ZCKA 2VQFJ 2J76E 2RDJA 1REGX 3G6EN 5CA5A 1WOSA 3KFWX 2Q79A 4FK2A 1REVA 3K89A 3GIKA 1KC8O 1BY9A 2K1RA 4NLPA 3MR2A 3JTPA 2FHKA 4M5GA 3N4QA 3EL2A 3VETA 4DR3F 3OY9A 4EBCA 5F8JA 4FJNA 4JNEA 2YHYA 3AA5X 4L76A 2IFXA 3M9MB 2I6WA 1OY9A 3RUBL 3PW4A 3GJRB 1KAYA 4H4KC 1NPPA 4R5PB 3GYGA 4EP4A 2EFNA 1LWCA 1KHVA 2ZH1A 4DLGA 3EJMA 4GRSA 1Z2ZA 1TUUA 3MM8A 4CT9A 1S77D 4HTUA 2AZ3A 4YDDB 3CNQP 3VTIA 2LEBA 3NMAA 3UWTA 3IAM9 2HVZA 3SQ1A 3I6PA 1WTBA 4I68A 1Y4ZB 4FWKA 1E6VA 2CQHA 3CDWA 3DGVA 3P5JA 3K5PA 1EX4A 4YFUA 3T69A 1OY8A 3WNHA 3G9CA 1BOTO 1EJ7L 3VQDA 3IUCA 2LLZA 2EWSA 4Z37A 5BR8J 1L3KA 2IC3B 3VZIA 1NGEA 4JI0K 4C3MA 2H5JB 4RW9A 1SV5B 2M4MA 3PUFA 4FM1A 3C66A 3VF2A 2HQFA 2J8AA 3KD1E 3L9ZA 2NR0A 4K4TA 2J9DE 3FKBA 5T7LA 3OJSA 2ZVIA 4ECXA 3TEHB 2E8AA 2UUCF 2P9UA 1NLVA 4JYAK 2HQ3A 1YAGA 4F3QA 4DZDA 3CF5L 1NM2A 1XHXA 1H7WA 2CQ3A 4CJWA 3MEGA 4BC4A 5F8HA 3IRWP 5A8RA 2DEJA 1X4FA 2HHQA 4DU7A 1JJHA 2MZRA 1ZPVA 5GVQA 4FVUA 4ISFA 2QZ8A 1NO8A 5D8HB 1HBMB 5K8PA 3C19A 3C46A 4F4ZA 1BCOA 5M1NA 1N34K 4K0KJ 3WIUA 1MROA 2DGVA 2AP1A 4XDCA 4DSJA 1EKRA 1SC4B 3FFKB 4PY5A 2M7SA 3OTDA 3ZX2A 2QLWA 3J80U 4J9LA 4C3LA 1J5OB 2R2TA 4DU3A 3AT1B 4JV5K 2GJIA 4B02A 2A1SA 4OZ5A 3C6UA 3RTVA 1R0BG 4LH4A 2OPQB 2QMWA 2XZDB 5ETKA 1D1UA 4FLWA 3QICA 3CJ8A 2GHVC 2BABA 4NLBA 5KOWA 3O80A 3CCUS 2XNQA 2FC0A 5CHIA 4I9QA 2JHEA 3EGVA 1KKHA 1N5YB 2OA8A 4EHTA 3LTOA 4CJ4A 2F8HA 1LOTB 4FNIA 3M8PA 4AQYJ 4ZVPB 4RNNA 4O4RA 1VK8A 3FEXB 1X5OA 3AO5A 5KTQA 4OX6A 4ISEA 3LP2A 3V6KA 3VQTA 2XS2A 2NPIA 1S1WB 2FSKA 4JEPA 3DLRA 2IM1A 3MK6A 4LFCK 4N56A 1T7PA 4IEEA 2BW7A 3D3BJ 1FTCA 1KP6A 4CNYA 4YOWA 2VQEJ 4HCCA 1KD1T 3PW0A 3ENQA 3CCMN 4ECUA 4C7QA 2YHWA 3TJ8A 1T6DA 5HROA 1S76D 1VLYA 5A8KB 2DGSA 5E0OA 2C3UA 3OFEA 4ECZA 2DJWA 3ELHA 1RWOB 3G8SA 1NJXA 1TU0B 2AYBA 4DL4A 2VQFF 1BLUA 2LA6A 5H9EJ 2W41A 1Y7PA 1Y5NB 2HVIA 3BGUA 2WONA 3OV7A 2VGMA 4CBWA 4Z7CA 1GMVA 3RW7A 1C0GA 4WFBQ 3OT9A 3H2LA 2Q31A 1SIZA 4YDUC 2X3DA 3OFHA 1QQOA 1ZA1B 2FUG9 4PRFA 2BUNA 4FKXA 2E4LA 5B0FA 3O9TA 3PW2A 1RDCA 1LKZA 3FCHA 3LDSA 1NUEA 2E5GA 3I56S 4K4VA 3C15B 3AVGA 2VA3A 3V9SA 3DOKA 5T14A 4J9MA 2N3LA 4LIWA 1GX5A 2BANB 2O67A 3NH1A 1VHFA 3NOGA 2Y1LB 3G96A 4Y28C 3G8QA 1O5JA 4FXVA 9RUBA 5A8RB 3MEEB 2M8DB 4H0VB 3TQEA 5B0BA 4FLTA 2GVZA 3J81j 3QFWA 1WF1A 2MKSA 3DC2A 3Q7BA 1Q7YO 1NBEB 4B9NA 1DLOA 1WC6A 2JH3A 1SL0A 3FMBA 1FJGJ 4DV3K 3ZTOA 2ALZA 2HNYB 1BQMB 1X8DA 2NYHA 1NSAA 1TKTB 4U7CA 3ISND 3BBCA 5DGAA 1NGJA 1VSFA 4WFYA 5LJVA 2MLZA 3IRXB 2H48B 3BGLA 4JKDA 4X84A 4JRPA 4OX7A 3G25A 5DZ6A 1C4AA 1F5AA 1X31C 1WF0A 2OTJS 4X4NA 5FPNA 2ZH4A 3BV8A 3OL8A 5DDRC 2JEFA 1RT5B 2C28A 1NJIT 2UUAJ 2AEFA 3QIPB 2KXHA 4HKQA 3EE3A 4EGLA 2YVSA 3HDSA 3DU5A 2LQ8A 1XNQJ 1WNSA 1DY3A 5BRDA 2XMAA 3MUMP 1EWRA 4J91A 2DCUB 3BEXA 2FGCA 1UVMA 1JIHA 4JI3J 4KPYA 1RCXB 2HGMA 1FXXA 2RN2A 4ZA1A 1QAYA 3BM7A 1WJ9A 2YH1A 5B8HA 5D78A 2CPYA 4HLBA 2CDQA 2MLXA 3HP6A 1P1LA 2ZBCA 2HHUA 4DB3A 3J7AN 1B0PA 4WFXA 4JI1K 4K8RA 2E5LK 1EQYA 3D6RA 1LQ9A 4RG8A 4FBUA 3WXKA 1RDAA 3C6HA 4QWAA 5AXNA 2J5AA 2VYPA 5C42B 5A0YB 3SV3A 4FYWB 2KZMA 3FZBA 5AQIA 3M4XA 3BZKA 1F1BB 2BMBA 4C8MA 4BC7A 4KC5A 1NGHA 3WXMB 3OTBA 4RW8A 2VBWA 1S0OA 2IA6A 4NX9A 2R7TA 1IG8A 2UUBJ 5FJ4A 3V9ZA 2GTDA 4F4AA 5CYJA 3BF3A 4B1WB 3DRRB 2YWGA 4ZPTR 1SZ2A 3ZO7A 2G2ZA 4M41A 4BR9A 3M2UB 4RW6A 4URQU 1HA1A 4DQPA 4GKJJ 2E1RA 2JLFA 2R8HA 1Q5YA 1AZSA 4BCAA 4W5OA