1C1CA

Crystal structure of hiv-1 reverse transcriptase in complex with tnk-6123
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 536
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1cA05
4FLYA 2RPIA 2PY5A 4C8MA 3DMJA 4CJTA 5KFFA 4DG1A 1VRTA 5KFRA 3AVIA 3G10A 5CYMA 3HXMA 2HWHA 4ZPDA 4AHUA 3NH2A 2Q3SA 1RBUA 1NOYA 4BDZA 3SNNA 4X2BA 1N5YA 3PW5A 2UVWA 4F4XA 5EWEA 4GVMA 2YNHB 5KG1A 3DM2A 2FVQA 1NK6A 4J2DA 4E7JA 3KMQA 4HUEA 1SKRA 3M8QB 4Z4GA 5T14A 4DQRA 3E01B 3QEIA 2ASJA 4K4UA 3FSIA 1TL1A 3ASMA 2ASLA 2B5JB 3MR2A 1D9DA 3VQQA 4IG3B 5HP1A 2VG6A 1JL2A 1RDDA 1KVBA 1VSLA 1TKTB 3SQ2A 2GBZA 3TI0A 1IKVB 3HJFA 3ITHB 2OZMA 1ZBUA 1RBVA 1HQEB 4Q8FA 3V1QA 4DF8A 1ITGA 1RDAA 2A1RA 5EWGA 3V9ZA 1X9WA 1S0OA 4K4TA 4C8OA 4O0JA 2B6AA 1IKYB 4Y34A 4O3OA 3CDUA 3IG1A 2BGGA 1NK9A 1WN7A 4BDYA 3MFIA 5KG0A 2ILYA 1KSPA 3A2FA 4GC7A 3AA3A 3QGIA 4W5RA 4NCBA 1WSJA 4Y1CA 3NF7A 5DGAA 3PHEA 1K6YA 4CECA 3DLGB 3KIOA 4IDKB 1L5UA 3TWHA 4IG0A 4O3PA 2XCAA 1GOCA 4CJQA 4FJ5A 3WNGA 4DTMA 1BHLA 3Q8QB 3IAYA 1RTDB 4O55A 3OLAA 2F8TA 3CJ0A 3T19A 5L1LA 3HVAA 4EEYA 2XY6A 4IRKA 3RB3A 4KHNA 4OPJA 4CF1A 4ID5B 1RAJA 1RBTA 4FCYA 3LP0B 1VSKA 2FLPA 4DSKA 4E7HA 5C42A 4ICLB 3NGDA 1TKXB 1RTIB 3BR9A 3AVJA 4FBTA 2UUWA 1RTHA 5KG5A 4EO6A 4F4YA 4K4WA 3CWJA 1EX4A 4KHYA 3CDWA 4F2SA 4E7LA 5F8HA 1ZTTA 3ZSQA 2JEFA 2E9ZA 1ZBIA 5I3UA 3QLHA 1C0UB 4Z4CA 2P5OA 3C6UB 1I39A 2B43A 5J2NA 5DQGA 1ZBHA 5SZTA 1RILA 3KNAA 4QWAA 1HPZA 1JLAB 5F8GA 3DLEB 1Y97A 3P1GA 4IKAA 3VQ8A 1KHWA 1RNHA 4CHZA 4K8ZA 1SUQB 4PUOB 1UWBA 3SPYA 2G8UA 2OZSA 2GIQA 2VG7B 3M8SA 2WTFA 4KAIA 3NGIA 3OYHA 4CFAA 4H8KA 2RDIA 3V9SA 1VSDA 5KRSA 3EY1A 3VQCA 4DQPA 4M3XA 4CJ5A 4I2PA 3O3GA 1S1WA 3TAMB 1VSJA 3KJVA 3KLFB 1EP4A 3KK2A 5K14B 1I6JA 4CJ3A 4M3UA 3GV8B 3I5BA 3H4DA 1LAWA 4ZP9A 1RT4A 4KSEB 3BSCA 5KFVA 5KGWA 3ZSYA 4CEOA 3N6MA 3QZ8A 2W8LA 3NAEA 2XI3A 1JLQA 4E1MA 1B92A 1U49A 4Q45A 4CJPA 4KFBA 5KFSA 3HPHA 2EX3A 4CFCA 3WNEA 4DMNA 3GYNA 3LZJA 2DFFA 3CJ3A 1VSHA 1U09A 1IKWA 2FJVA 2HWIA 1S97A 2P1JA 5J2PA 2JEJA 4Y2AA 1LW0B 1C1AA 5KFDA 1IH7A 3DRPA 3QETA 2XCPA 1DTQB 2UVRA 4BE0A 3RB4A 3CM5A 2OYQA 2WRMA 3T5JA 4LSLA 3RB0A 1LWCB 1YTUA 4FJNA 3NF9A 5EUHA 2KZZA 2D3UA 3D45A 2AJQA 5JS2A 4ELVA 1RA6A 3Q8RB 3MEDA 3DLKB 5KT3A 2XC9A 4ZP7A 3GQCA 2D41A 4MKBA 1KFDA 5JS1A 1N48A 1WAJA 2DFEA 1T05A 3JSMB 3JYTB 1WNSA 3GV7B 2RDJA 4Z4FA 1ZETA 4IR1A 3EZ5A 3DOLA 1JL1A 3SQ4A 3OS0A 4CESA 4KREA 4LD0A 3HP6A 3PX4A 4M3TA 4FZYA 1T03A 4JRPA 3HK2A 3OVNA 1HNVB 3PW4A 1JLFB 1RT7B 4H54A 2W9AA 4DS5A 5HLFA 2YHBA 3U3GA 2QE5A 3S3NA 4EP4A 1FKPB 4J9PA 3V9XA 3HO1A 4B9LA 4J2EA 1OS5A 4AHSA 1B9FA 1BISA 4FK2A 4NLUA 4MKAA 1RT3A 2BANA 4CJLA 3H5YA 4H4MB 2I5JA 1FKOB 5KFAA 3KMSA 1KFSA 3QIPA 3LDSA 2VWJA 4IH7A 4B9NA 1BQNB 2C28A 3PX0A 3L8BA 2J6UA 1L3TA 1XHZA 1S1UA 4AH9A 4MK9A 1NK7A 4B8AB 1S9GB 4WFXA 1EXQA 4CGDA 4L8RB 3SQ1A 4KB7A 4OL8A 2DPJA 1QE1B 3LAKA 3RWUA 5CZ1A 1NJWA 2DY4A 3FFIB 1JLEB 3MECB 3O3FA 3NAIA 5C5JA 3OJUA 4KB0A 2HW3A 4BWMA 3RTVA 4KHUA 3OJSA 4RW9B 4DQQA 4DSFA 3RRHA 4ELUA 1S1VA 5I42A 4J9RA 1S1TB 1JLBA 2IM3A 3H08A 4EYIB 1BI4A 2RKIA 3SFUA 5DG7A 3RAQA 4DU4A 1WLJA 4CK1A 2W7OA 2HHVA 3KK1A 3OY9A 4BE2A 4DTXA 2FVRA 4FM1A 3NBPA 4C8LA 4FJXA 3VQ5A 2ATQA 4RNNA 3RAXA 3HKWA 2PYJA 4W5TA 5DLGA 4KRFA 4K50A 4N41A 4DTUA 2WONA 5FDLB 4OJRA 1Q8IA 2WHOA 5KFZA 3DRSB 1Q9YA 2V9WA 1ASUA 1SV5A 3V1RA 4FLZA 2X78A 1NJZA 1CSJA 3KLGA 3KOAA 4CF9A 3NF6A 2IGIA 4CIEA 1RCHA 1HQUA 3M9NB 1KVAA 3DRRB 2F8EX 2FBTA 4OKEA 4O4GB 4RW8A 1QQCA 1C6VA 4RW6A 3VA0A 1Z25A 2DFHA 1N6QA 2Y1JA 2WB4A 2YNIB 1JLGB 2W8KA 3SUNA 4GW6A 4DLGA 2QKKA 2P51A 4DL2A 5DG8A 1Q9XA 1C0TB 3I0RB 3OYNA 3NKYA 4WE1B 4KO0B 4BE1A 4FLUA 2D0AA 4BWJA 2ITGA 4PQUB 4I2QA 4I7FB 4G1QA 4DTSA 5C24A 3ZSZA 1RT1A 4NCGA 3K5MA 4Z4HA 4J9NA 2HNYB 4KI6A 1TL3B 3SFGA 4Y2CA 2IAJA 2IA6A 1F21A 1VSMA 2D5RA 1SKSA 3QGHA 2Y1IA 3OYMA 1D8YA 1RDCA 3T5LA 3OYGA 1D5AA 4PY5A 4TYBA 1MU2B 1LV5A 1RBSA 2AX1A 1NNDA 2E9RX 4CHNA 4KHSA 1VRUA 3ZT2A 3OYBA 4FJ8A 2E4LA 4M45A 4AHRA 4CGJA 3O4QA 5EU7A 1C0MA 1S4FA 4LSNB 1BCMA 2YKNA 1SL1A 4ECVA 3M8PA 3FDSA 5KFJA 3WNFA 4NLVA 3NL0A 2DTUA 3PVXA 2F96A 4WYLA 2W42A 3H98A 1ZTWA 3KLEB 4AHCA 4CHQA 1RTJB 3OHBA 3TABA 5HROB 1EETA 4NRUA 5KFKA 1U04A 3DDKA 4CEAA 1TVRB 2IJNA 4ZHRB 4AILC 1S48A 3K5NA 2X6SA 4AHTA 4EZ6A 4ZPAA 4RNFA 1KRPA 4FVMA 2YNFA 3SUPA 3SYZA 5HBMB 1D1UA 1U48A 3AA4A 3EZUA 3IRXB 4OKKA 3HT3A 5KFGA 1J5OA 1SH0A 5JUMA 3HVWA 1CXQA 1JXBA 1EKEA 3V6DA 4DF4A 2X74A 1RT2B 2ZD1A 2BRKA 2OPQB 4ECZA 4Y1DA 4E3SA 3MXMA 1JLCA 4KHRA 1DTTB 2DPIA 1XHXA 2PZSA 1TV6A 2HHQA 2FC0A 4M42A 4ECUA 5KT4A 4HUFA 1JX4A 3V4IB 3D28A 2KQ2A 3CG7A 2YV0X 4KV8B 2OPPB 1N4LA 3S9HA 4ZVEA 1D9FA 3KLIB 3L2VA 1RA7A 2BQRA 4OGEA 3MFHA 4E19A 4IFYB 4DFJA 3HL8A 3RMDA 3HVTA 3BQ0A 1JKHA 1S9EA 4YP3A 2FJXA 4WXWA 3KLHB 2W9BA 4QW8A 4RW4B 3EYZA 4IRDA 2HNDA 1HNIA 4DL5A 1TKZA 4RW7B 1LW2A 4E1NA 3HHKA 3MEEA 2W9CA 1KLMA 1RT5A 3LP2A 5JXSA 4IH6A 5DMRA 2GIRA 4CJUA 4R0EA 1RYSA 3VA3A 2HVIA 1TKDA 3QO9B 4WZMA 3OS2A 3OSPA 1UA0A 2QV6A 2FJWA 1LAVA 5KGXA 3NCIA 4DWIA 3BGRB 3TARA 4QWBA 4OKJA 1WNEA 4IBNA 3QEVA 5FRMA 3IS9A 4U7CA 2YKMB 3K57A 4FZZA 3I0SA 2YHAA 4F4ZA 1QSLA 4KTZA 2XGQA 4DL6A 5J1EB 3H5UA 4M41A 3GIIA 4K4SA 2ASDA 4Q44A 3SPZA 2ZE2B 1W25A 5F9LA 3AO4A 3O4NA 3ZT3A 1KVCA 2HAIA 2AGOA 3U6FA 4FS2A 4H4OA 3S3MA 5DQHA 1IG9A 4ECYA 2KFNA 3F9KA 1L3SA 1QSYA 4C8NA 4CJVA 1NK4A 3NE6A 2IMWP 5CZ2A 5HRRA 3ZSWA 2YNGB 4HUGA 5DK5A 3PY8A 1LWEA 5FRNA 4O44B 4OLBA 2CKWA 2G8VA 1LWCA 1QSSA 4CF0A 2O5DA 3AO1A 4FJIA 1HYZA 2FBYA 4NLOA 3DI6B 3FQKA 2E6LA 2HMIA 4R5PB 4JUZA 4CIGA 5F8JA 3L2WA 4FXDA 1FK9A 5KFIA 5DLFA 4JV1A 1S49A 4Q0BB 4CF8A 3DOKB 4KKOA 5E41A 4WYWA 3DLHA 4F3OA 3NDKA 1T8EA 3D5MA 1RT6B 1JXLA 4FYDA 2VWKA 3RB6A 4I9QA 1IKXA 1ZYQA 2OA8A 3GV5B 3DMJB 3VQBA 4DG1B 1VRTB 4ED2A 2KZMA 3NH1A 2I1RA 5CYMB 3M9MB 2FBVA 5KG3A 3V6KA 2IC3A 2QKBA 3LALA 1N5YB 4ZP6A 4Q8EA 2BRLA 3Q8SB 3RMBA 2E6MA 3DM2B 4J9LA 3AVMA 2W7PA 1C1BA 4H4MA 2IJFA 4M3RA 4NCAA 4OLAA 3AO5A 3BDPA 3G6XA 4NLTA 1CZBA 4MH8A 5CYQA 1TL1B 3OSNA 3B6PA 4DTJA 5KI6A 5HP1B 2VG6B 1VSEA 4HKQA 1HYSA 1C1CA 3CDEA 1DLOA 3H4BA 4EBCA 3VN5A 2OPSA 4CJWA 4CGIA 2C2RA 1NHUA 1REVA 3BJYA 3IGNA 1LWFA 4TY8A 4J9MA 2O4GA 4PA1A 2R8IA 3LP3A 2B6AB 1S1TA 3V81A 3HPOA 5L1IA 5KT5A 3RMCA 3IG1B 3LWLA 5C25B 4BDPA 5D3GA 3T1AA 5DG9A 2FVPA 1R0AB 3KHHA 3P5JA 1S1XA 1ZBLA 1QUVA 4MFBA 2XRIA 3KD1E 1ASWA 1GOBA 4IG0B 3MEGA 3SJJA 1TAUA 3LP1A 3G6YA 4KHMA 2R8JA 1VSIA 1YVUA 4Z0UA 3ZSOA 2NUBA 2X6NA 3KK3A 2FLNA 4JRQA 3CFOA 1SL2A 4FJ7A 2HHUA 4JLHA 1QHTA 2ATLA 1BIUA 1HMVA 3ZSXA 3TANA 1HARA 3DYAA 5DQIA 4WFZA 4PWDB 5C42B 2IM2A 4CJRA 4QWCA 3PJXA 1K1QA 2G8IA 2J6SA 1RTHB 1BQMA 4F8RA 4IRCA 1FXXA 2IM1A 5KFBA 1J53A 1TP7A 1HJRA 1XWLA 3QIDA 4NRTA 4LY7A 3T5KA 4F50A 3MR5A 1UA1A 3RRGA 5KT7A 4EZ9A 3OLBA 3VQ7A 5I3UB 3QLHB 5J2NB 2BDPA 4FJKA 1L3UA 1QAJA 4N56A 2BR0A 4R8UA 4W5NA 4NLDA 3OYLA 4IFVA 4W5OA 4B3OA 3AA2A 3I5CA 4J9SA 4JV0A 4K4ZA 1XC9A 3I8DA 3T3FA 4IH5A 3K5OA 1MU2A 4FLVA 3OYIA 1NK8A 1L3VA 4I2PB 2JLEA 1S1WB 1S6PA 4K4XA 3KJVB 4OGCA 1EP4B 3KK2B 3L3UA 1S6QA 3V9WA 1U4BA 5J2QA 3V1OA 3PJWA 1RT4B 5J2MA 2IS3A 4J2AA 3G6VA 3PR4A 3V6JA 2HHSA 1BIZA 1JLQB 4ED1A 5KFNA 4DL7A 4KFBB 4HYKA 2G8HA 4CF2A 3ALYA 3UR0A 1KLNA 4FW1A 2VG5A 3KD5E 1IKWB 3MR6A 4EBEA 5J2PB 3N6NA 4E7IA 3QNNA 2XY7A 4CK3A 3NFAA 2HNZA 2VA2A 3C95A 4DTNA 3DRPB 2WOMA 3OYKA 3OHAA 5KT2A 2OPRA 4F2RA 2AWZA 2A1SA 4OVLA 3SV3A 4FJJA 3C6TA 4LSLB 4FJHA 1GX5A 3PR5B 2HHTA 3SI6A 3SQ0A 4MQ3A 3QEXA 4URSA 2BE2B 3MEDB 3QYYA 3QESA 5KG7A 1J9AA 5T7BA 4DL4A 2R8GA 1T05B 4EYHB 3NF8A 1NHVA 5F8IA 3PW2A 3DOLB 1UAXA 3KKSA 3THVA 1T03B 3F73A 3KHGA 2BQUA 4B9MA 4FJMA 2YNHA 3H40A 3ZT1A 1X1PA 4JS4A 4CEDA 3CFPA 5HLFB 1S10A 4CFBA 3M8QA 1S5JA 3SV4A 1WSEA 2XWYA 4CE9A 3E01A 3L2QA 3RR8A 2RF2B 2B5JA 2AGPA 4RNMA 1TGOA 4IG3A 5KFWA 4ED3A 4FZXC 1TKTA 5F8MA 1RT3B 2BANB 4RU9A 4YMEA 1IKVA 1QAIA 2R2SA 3QGGA 3ITHA 3RMAA 1BCOA 2I5JB 2GV9A 4ECSA 5KG4A 3ULDA 4B08A 1HQEA 3QIPB 3BSOA 4HVJA 5KFOA 2YKMA 4TQRA 2R8KA 4DSIA 4WFYA 1IKYA 3QNOA 4F4KA 2C22A 4K8XA 1S1UB 1ZBFA 4DFKA 4ECTA 1Z4UA 2UUTA 3UQSA 5F8LA 4NLYA 3OL8A 4RNHA 2V4RA 2ZE2A 1S0NA 3K5LA 4CEQA 2P5GA 2D0CA 3NGYA 4B9VA 2XI2A 4M95A 3U3YA 4E7KA 4KI4A 3Q8PB 2D7SA 4HCCA 3ZCMA 3T5HA 3DLGA 2KW4A 2ETJA 4IDKA 1BL3A 1S1VB 3K59A 5I42B 1JLBB 4CJKA 3PO5A 5KFEA 1WAFA 2RKIB 3AVBA 4NYZA 3O3HA 1RTDA 2AGQA 2B4JA 1IO2A 2FVSA 1J54A 2V0NA 3KHLA 3KK1B 5L9XA 3QZ7A 3NBPB 4CEBA 3VQ6A 1A5VA 3P83D 4ID5A 4RUAA 3CJ4A 4F4WA 4ELTA 3KTQA 5KFPA 3LP0A 3D0PA 2AQ4A 5KG2A 4Y3CA 4ICLA 3TAEA 1TKXA 2WONB 1RTIA 5CY4A 2IBKA 3V9UA 4LH5A 4DLEA 2F8SA 1SV5B 4NLPA 1VSFA 3DOKA 2E9TA 3KLGB 4JS5A 1CLQA 1RT6A 4J9OA 2G8WA 4CHOA 1HQUB 2AX0A 4F3TA 5EDWA 4ECQA 4ED0A 4CEFA 4RW8B 3UDLA 1C0UA 1SH3A 1HRHA 4FK4A 3C6UA 4RW6B 4CIFA 4WZQA 4MIBA 3KHRA 1N6QB 1JLAA 4TSXA 5FROA 3DLEA 4DFPA 3HVRA 4NLQA 1CZ9A 3LZIA 4ZMMA 4BACA 4NLGA 1SUQA 2XHBA 4PUOA 3PW7A 2VG7A 4O0IA 5KRTA 3NAHA 4O4RA 4CCHA 3QINA 4ZVFA 4I9LA 1KCFA 4TQSA 3GIKA 4FS1A 2IDOA 4TN2A 1U45A 2IOCA 4AHVA 4ID1A 4I2QB 3TAMA 4DSEA 4G1QB 3KLFA 5C24B 1RT1B 4NCGB 3VQ9A 2G8KA 4KB1A 4RUCA 5K14A 4CJFA 3TAFA 4XPEA 2IAJB 3HM9A 4DTRA 3VQAA 2JGUA 2O4IA 3AVGA 4MK7A 2Z1IA 2UVUA 1GX6A 4Q5VA 2HHXA 2KFZA 1XR5A 1VRUB 4QWDA 4CHYA 4B9SA 3ICLA 3TAQA 4JV2A 4CJEA 1TK8A 2YKNB 1K1SA 1NJYA 3M8PB 2UVVA 3PW0A 1NOZA 1NKCA 3NH0A 1N56A 5C25A 1LW0A 4KHQA 4ZVGA 4MK8A 1EETB 1R0AA 1DTQA 5KTQA 3GIJA 3TAPA 4N5SA 3OYCA 4ED6A 4KE5A 1RDRA 3ZT4A 2YNFB 4DSJA 4K4VA 3DLKA 1XR6A 1TK5A 4K4YA 4ECXA 4DU3A 3JSMA 1J5OB 2FVCA 3JYTA 4QAGA 4FLWA 3LPUA 4QOZB 4FJ9A 3V6DB 1GOAA 3NMAA 3BREA 3OYEA 3CQ8A 4YQWA 2ZD1B 3CJ2A 4FLXA 3KKRA 5KFHA 3PUFA 4HHTA 1JLCB 4PWDA 3OL6A 3QERA 2ALZA 4CJSA 3RBDA 3OS1A 4FK0A 4TYAA 1HNVA 3B6OA 1JLFA 1TV6B 3TVKA 1RT7A 5KFQA 1ASVA 1G15A 2Z1GA 4IR9A 3WNHA 4IQXA 1KTQA 4DSLA 1FKPA 1NK5A 2BQ3A 4DTPA 3OYJA 4FLTA 3BQ1A 4WXOA 1NK0A 4LQ3A 3AVCA 2WCXA 3I5AA 1JIHA 4OPKA 3GIMA 4N76A 1X9SA 3HVTB 5F9NA 1JKHB 4U6PA 1S9EB 2VA3A 2JC0A 1FKOA 4M3ZA 2W9BB 2HNDB 3H5SA 1HNIB 4FBUA 1TKZB 2RN2A 1LW2B 1BQNA 4MIAA 3PX6A 5KFLA 3MEEB 2W9CB 1KLMB 1RT5B 3ZT0A 3LP2B 3MXIA 3AVLA 5KG6A 3HYFA 4B9UA 4M3WA 1S9GA 4HCBA 3ISND 4NLXA 3MR3A 1QE1A 2HVHA 5HRNA 3FFIA 1JLEA 3MECA 3CIZA 3IS9B 4J9QA 2D3ZA 3LPTA 1MMLA 4XPCA 4RW9A 3L2RA 5L1KA 3I0SB 3LANA 5KFUA 3VQEA 3SUQA 3NGZA 4LH4A 3RR7A 4URQU 3EPGA 3CFRA 1T3NA 3S3OA 4ZVHA 4N47A 4GC6A 3MXJA 2EC0A 4YR0A 1NKEA 1KHVA 5KFTA 3VQ4A 4H4OB 3PV8A 3CJ5A 3AO3A 3TAGA 1I3AA 1YT3A 1S9FA 4J2BA 5FDLA 3DRSA 4E89A 3AA5X 4TY9A 1JXEA 2Z1JA 4CEZA 1LWEB 4HTUA 3AVAA 4DQSA 3UIQA 1C2PA 2ZKUA 3ISNC 1TQLA 4ED7A 2BE2A 2R2RA 3M8RA 4KHWA 3DRRA 4FW2A 3C94A 2HMIB 3IGVA 3EPIA 4O4GA 4M94A 2JEGA 4XIUA 1CXUA 3CYMA 4KBIA 1FK9B 4GMJB 4CGHA 3AVNA 2YNIA 4UQGA 1JLGA 3SUOA 4ZTJA 3DLBA 3PO4A 4NLRA 1C0TA 4KKOB 3I0RA 3OL7A 3AVKA 4DTOA 3H59A 4ZPCA 4RNOA 3AVFA 4WE1A 4KO0A 1IKXB 4DL3A 3AVHA 4PQUA 3SCXA 4DFMA 4DEZA 4I7FA 2EHGA 1HPZB 2IC3B 3L3VA 3AO2A 1RDBA 4XO0A 2RF2A 3OYFA 3QEPA 1UWBB 2QXFA 2HNYA 1TL3A 3H5XA 1TK0A 4FJGA 5KFCA 3E51A 1SKWA 1UOCA 1T94A 4NLSA 1C1BB 3DLRA 1TAQA 4ZTFA 3NHGA 3KLVA 4NZ0A 3G0ZA 3CO9A 1WSIA 4LQ9A 5CYQB 5KT6A 2HB5A 1O1WA 2FBXA 4QW9A 4FJLA 3H2LA 4URGA 4LSNA 5KFXA 1HYSB 1C1CB 3OL9A 3KLEA 3SZ2A 3OYAA 1T7PA 1DLOB 4DQIA 1RTJA 1S0MA 3HP9A 1XI1A 5HROA 4ED8A 3VQDA 3ZSVA 1HYVA 4CK2A 3CM6A 2OPSB 4C8KA 1WSFA 5DGBA 2D0BA 1TVRA 2C2EA 4ZHRA 4W5QA 1REVB 2R2TA 3K2PA 3QEWA 1LWFB 4TY8B 4O3NA 3IN5A 3OYDA 1W0HA 3MTKA 4YR2A 3V81B 2ILZA 2G8FA 5HBMA 4O5BA 3GILA 3IRXA 3G86A 3VQSA 5D3GB 2XY5A 1RYRA 3MF5A 4TXSA 1WSHA 1S1XB 3QIOA 4MFBB 1RT2A 1IM4A 4CGGA 1U47A 2OPQA 3LAMA 2GUIA 1DTTA 3MEGB 3VQPA 4ZPBA 3LP1B 2OH2A 3HPGA 4EBDA 1RBRA 1YVFA 5HRPA 3FQLA 4EP5A 4B8CA 3KK3B 3V4IA 1BGXT 1B9DA 2FLLA 4KV8A 2OPPA 1WSGA 4CERA 4Q43A 3KLIA 4O3SA 1HMVB 1Z26A 4ECRA 3UPFA 3DYAB 4NYNA 4TLRA 4IFYA 4YFUA 3BSAA 4CFDA 3AV9A 1QTMA 2XO7A 1D0EA 5KFYA 4B9TA 4RZRA 4Z4EA 3KLHA 2JC1A 3SI8A 4RW4A 1BQMB 2R2UA 3K58A 4RW7A 4IKFA 5KFMA 4QWEA 3LWMA 3TR8A 3M9OB 2GC8A 3ZSRA 2R7YA 1NKBA 3FRZA 3TQ1A 2J6TA 2Z1HA 4Z4IA 3QO9A 2V4QA 4KTQA 1SL0A 3BSNA 2XY8A 4QPXA 3MAQA 4FM0A 1XR7A 3V6HA 3BGRA 4YR3A 3BQ2A 5SWMA 2R8HA 4R8UB 2PYLA 4KTWA 4IFVB 4B3OB 4O3QA 3HSTB 3CVKA 1SH2A 5J1EA 4O3RA 4CHPA 4KAZA 4IOBA 1QS4A 1YTAA 4RG8A 4DS4A 1A5XA 4QCLA 4KPYA 1A5WA 5EWFA 1S6PB 4NYFA 2WK4A 5HRSA 2C2DA 4YNQA 1S6QB 2QK9A 5J2QB 4M3YA 4J9KA 4NLWA 4ZP8A 5J2MB 1BI4B 1W9HA 4CGFA 1VK0A 3L2UA 2ZQBA 4EO8A 4ECWA 2YNGA 5L1JA 4E0DA 4O44A 5F8NA 1NJXA 2HHWA 2CJQA 2AU0A 4CEEA 2KTQA 2VG5B 2JEIA 3DI6A 4CJ4A 2XGPA 4R5PA 3N6LA 3PZPA 2HNZB 4DU1A 2WOMB 3RBEA 1X9MA 2OPRB 4Q0BA 3C6TB 2IM0A 2LSNA 4G3IA 4FM2A
chains in the Genus database with same CATH superfamily
4IDHA 3VAGA 1YX2A 4CJTA 4ZN3A 1RGVA 4DG1A 2WVFA 2NYIA 1PSDA 5B0GA 2A3JA 4DPUA 3PJ9A 1AZSB 2E5LF 4PWWA 2Q3SA 3BO4A 9RUBA 2YQ3A 4BDZA 2A2DA 2CZVC 4DR2K 1N5YA 4ZPVR 1J6ZA 4DPYA 1U8SA 1UEVA 4DU8A 2VBZA 3DOMA 4GVMA 4CLPA 1NK6A 3MPDA 4J2DA 1K47A 5IT4A 4HUEA 3W5XA 1SKRA 4Z4GA 1PBAA 2M0GB 2W4DA 1SPBP 3FSIA 1CS4A 4BRFA 5HP1A 2VG6A 1Y5LB 3VGUA 1KVBA 3DAWA 1RDWX 7FD1A 3SQ2A 2YH0A 3HJFA 2DNRA 3WXJA 5ETSA 1HQEB 2FDNA 1NSAA 4Y0FA 5T7LB 4DF8A 2A1RA 5EWGA 3V9ZA 1MDUB 4B3RK 4K4TA 4C8OA 4JI4K 1K44A 4PQAA 3R6LB 4OYXA 4Y34A 3UO0A 1UEKA 1HKGA 3CCRS 3ID6A 5B08A 3CDUA 1VK8A 1Q1KA 5CE3A 1WN7A 3MFIA 2ILYA 3BBFA 1KSPA 3A2FA 3QGIA 3D6FB 1WSJA 4U7BA 1XMOF 1WC6A 5DGAA 3RRKA 1W2BR 2B9EA 2XMTA 4FWRA 3TWHA 2V34A 3SCJE 4O3PA 2XCAA 3UNYA 4N8NA 3R8YA 3UWTA 3EGNA 3IAYA 1RTDB 2QMUB 4C97A 2RQMA 3CD0A 3HVAA 2JNJA 2IYGA 1V3SA 3CD6N 4KHNA 4I6MA 2FZKB 3UN3A 4XAKA 2FLPA 5M2PA 3MM8B 3P6YC 1P8GA 3HHNB 2DNPA 3VTHA 2CFXA 3BPSP 2UUWA 4NYPA 5CAAA 2ERRA 4K4WA 3K0JA 3CWJA 4CLTA 4KHYA 2R7QA 3M2VB 3CCQS 4KGZB 1Q8KA 3ZSQA 1UKUA 4BQLA 2VASA 2ZGYA 3QLHA 1P27B 2P5OA 1I39A 1Q82T 4ZCMA 1ZBHA 4WFNL 1HPZA 1KHWA 4CHZA 5FLXO 1M5PC 3VESA 3M8SA 4KAIA 4KYZA 4JI8J 1YJWS 5KRSA 2WB1D 1WEYA 3ZETB 3ZZRA 4I2PA 4JI0F 3O3GA 1VSJA 1UZDA 4CLSA 3QDKA 4WKYA 4A8FA 1NLKL 2FYXA 4ZP9A 4KSEB 4WF9L 3VAHA 3A3OB 2MDAA 3VEXA 1SIWB 3ZSYA 2MZ1A 3N6MA 2OTLS 5IT9Y 2ALYB 2XI3A 1REGX 4QU7A 4KGMA 4E1MA 1U2VB 4KFBA 3HPHA 2EX3A 5HVFA 1EQ0A 3WNEA 2GW8A 3CJ3A 1VSHA 2FHOB 1YK9A 1S97A 4M1KA 4Z37A 3GB0A 4KR0B 2P9IA 3T69A 4USKA 4DR1F 3CQXA 2HEKA 3SDEB 4IO9L 3CCUS 1C1AA 3QETA 4LRCA 4BC4A 2UVRA 4OI2A 3H0PA 3UDVA 2NRRA 2DH7A 2QYCA 3EUNA 4OYOA 3BH6B 5JS2A 1RA6A 1X0PA 4XH4A 1Y3JA 3MEDA 2DKOB 4CLYA 1CVJA 4B3TK 3DLKB 1C4AA 2HBZB 4LFBJ 4LF1A 4ZP7A 1UVJA 2Q31A 2C2OB 1IJEB 3S1TA 2DFEA 3UVJA 3A5LC 2P9CA 4RBVA 4MMOA 1JL1A 4UOFA 3OS0A 1OPZA 2B56A 3HP6A 4OZNA 4LD0A 4M3TA 4JI4J 1QJHA 1FJGF 3TEGA 4JI6F 3OVNA 1JJ4A 4H54A 2W9AA 1FNMA 4DUYF 1M0SA 2QE5A 4EP4A 3MTJA 3BEGB 4MJKA 1P90A 4A59A 3VR1A 2ADBA 2EWSA 4C1NK 4B9LA 4J2EA 1G7CB 1WORA 3WEEA 3O9RA 2Z2YB 3R5CA 3H25A 1KONA 2CH5A 1RWMB 3C16B 1FKOB 1KFSA 1WHWA 1PCAA 3IBWA 3GZ7A 3A4TA 1R7IA 2PA3A 1TL4A 3PX0A 4AF1A 3L8BA 2GX9A 4ERDA 3W1YC 3QJPA 1VJQA 1EXQA 4CGDA 2HS4A 3GG4A 3OFFA 3SQ1A 1QE1B 1PJ6A 1RBAA 3RWUA 4YB6A 2LXFA 2CIMA 4DOZA 1YF5L 2V52B 1X4CA 3VERA 3VMFB 2PD1A 2DY4A 2I2YA 1T3OA 4DXLA 4B1YB 4RKUC 4KB0A 2UXCJ 4KHUA 4YDUA 4RW9B 1VQSA 2Z4PA 4J9RA 3M6VA 4IWVA 2RKIA 4DU4A 2RRAA 3CQYA 4HHHA 2N7YA 1H2UX 4DV2J 4BE2A 2F4VF 4RWXA 4C8LA 2KL8A 1GTHA 1ZPWX 4LBPA 4UOGA 3HKWA 4CO4A 2PYJA 4DCPB 3Q22A 1RWXB 4C2MA 3KVGA 2KM8B 5FDLB 5HJXA 4OJRA 1U2RA 4WFAQ 2WHOA 4P2XA 4AL5A 2X78A 3LF0A 5CZVA 4CF9A 3PTWA 2H51B 2IGIA 1RCHA 1RADB 1HQUA 2W41A 3EVWA 3DLLL 2FBTA 2ZOFA 3VA0A 2CQPA 2XTJP 3HMJG 2Y1JA 3N9UC 1VQ4S 1AZSA 3FNNA 3SUNA 4GW6A 4E2FB 2BVZA 2PEHA 5AQIA 1HUXA 3NKYA 1NGGA 4WE1B 3WUHA 1X0FA 3MD1A 2D0AA 2MJUA 3VAKA 1NB7A 4PQUB 2K7KA 1XERA 2A2CA 2E20A 2ZJQL 4DTSA 3ZSZA 5K8MA 2DBBA 1WWHA 3EVOA 4Z4HA 1VIXA 2HNYB 1RU2A 1NDPA 3J7Z5 1F21A 2E8AA 2Y1IA 4GVLA 4B3TJ 2GJ2A 1W2BM 1D5AA 1WOSA 3CPWM 4NI2B 1NNDA 2E9RX 5LSOA 1VRUA 1H3DA 3ZT2A 3SBGA 4WKRA 2E4LA 2P9PA 4CGJA 5BPMA 3UCUP 1S4FA 1K73T 1UVLA 1MG7A 3OD2A 2ZC3A 5D4NA 3M8PA 3VV2B 2O8EB 3PYFA 2F96A 4CP5A 3MURP 5EXWA 3KXDA 1RABB 2V4JA 4LR7A 1U04A 2PO4A 1M1KT 4ZHRB 4AILC 1S48A 4ZLLA 1RWUA 1B3TA 3BYRA 1RAHB 1KRPA 4USTA 3TA2A 3SUPA 1WC1A 2ZM6K 1SQKA 1SS6A 1ICEB 3EZUA 1R89A 5LJWA 4AT1B 1SJ3P 4DR2F 5A6PA 5JUMA 1CXQA 1Y64A 2QTDA 1M90O 4EHUA 3D2EB 4ECZA 4Y1DA 2MQOA 5L9NA 3THTA 5HMWA 2HHQA 2ZBPA 3D28A 2KQ2A 4KV8B 2OPPB 3G8TA 4A62A 2YPYA 3O2IA 4ZVEA 2DXDA 1RA7A 2HMPA 3THWA 3MFHA 3M2VA 4RPFA 3FMBA 1EAYC 5CCMA 4EMDA 2KXHA 3BQ0A 3PRVA 3HHLB 4YP3A 4BRKA 1D8ZA 4I67A 5HI7A 4RW4B 1RAOA 4DU7A 1HNIA 5D4LA 2GV1A 3MEEA 2W9CA 4RCHA 1RT5A 3HJVA 1ULRA 2V69A 4IH6A 2GIRA 4CJUA 3N79A 2E2QA 2HVIA 3QO9B 3ZETA 3TJ9A 1LAVA 1GK8A 5KGXA 2J9DE 4DWIA 2QA4N 3TARA 4OKJA 2VDIA 1AROP 5FRMA 3IS9A 5IS2A 4U7CA 3MN6A 3MPYA 3K57A 3EO3A 3NG8A 2QC3A 3LOUA 1FDNA 4HACA 2XMVA 4QIGA 1DJ0A 4DDFA 1TFWA 2X3DA 4KC5A 1OY6A 3MCNA 1FXRA 5GMDA 1U2VA 1W25A 5F9LA 2XLIA 3NMUA 3LGHA 4B1ZA 2UUCF 3FBFA 3OBYA 5BXIA 2AA4A 1Y00A 5A8KB 4RBTA 2NXJA 5U47A 2FSKA 2FHJD 5GAHI 3S3MA 3QRQA 1F1BB 2Y8YA 2OD6A 1L3SA 4C8NA 4CJVA 1KVJA 4CBWA 1KTVA 5HRRA 4PAAA 5DK5A 3EGVA 1LWEA 5FRNA 4OLBA 3NP5A 2VYPA 1HYZA 3JB9k 3FQKA 2WVBA 4R5PB 2O67A 3MM6B 5F8JA 2ZH5A 1A7GE 3TZWA 1HKCA 3TSPA 5GAGI 2UUBK 4B3SK 1K8KB 1L3KA 1S49A 4Q0BB 2YVSA 3N4QA 2U2FA 4HTIA 3DLHA 4F3OA 3NDKA 2EK1A 2VWKA 4I9QA 4USUA 5BYRA 4AE5A 1VQ9S 3VQBA 3TUIC 2QJ3A 1VRTB 1G2EA 4Q2MA 5KG3A 3C14B 3NGUA 2QKBA 3LALA 5K20B 3WQPA 4NYOA 1FESA 1N52B 2BRLA 2RDDA 3M32A 2W4CA 2E6MA 3DM2B 2UUAF 1MWMA 3P5TL 2ZM6J 1C1BA 1RZMA 3G2XA 3UDCA 2V2ZA 4JEPA 2O66A 2LEPA 4CZCA 4WQ4C 3U7JA 3OV7A 2F1FA 1HYSA 1C1CA 2E88A 1W2IA 1YI2S 1T11A 2DPNA 2JDJA 2XBPA 3OTDA 2OPSA 4DV1K 2CA9A 1HD0A 3K8VA 2HZAA 4DV0K 3ZTRA 1REVA 2HPUA 4TY8A 2FJBB 2W01A 3JS9A 3V81A 4ZVQB 1URRA 2YX1A 2CVEA 3VAIA 4I68A 1K0VA 3VVTA 3C2PA 2Q6BA 2P9NB 3MDFA 2OSRA 2MLYA 3SAGA 3E66A 4PPDA 2IBOA 5F1XA 1ZBLA 4U8VA 2XRIA 4K5SA 5EOYA 4CLFA 3SJJA 4CO2A 1TAUA 2GHWA 3G6YA 5JVHQ 2R8JA 2QLJB 1PYSB 2FF3B 2HAFA 3CFOA 3KUGA 3U9DA 4UY85 5HQ8A 5AE2A 3T9NA 2ATLA 4FWKA 3ZSXA 3MI7X 3AT1B 2ZHOA 1O6XA 4PXBA 2HRTA 3R6GB 4OJGA 1FEHA 4FOIA 4QWCA 4C3LA 1K1QA 2J6SA 3VTIA 2GO8A 3AQOA 3U1NA 1LWXA 4F8RA 1QTNB 4QBUA 1LXJA 4NRTA 4F50A 3MR5A 4M5KA 2B8PA 4JKHA 3IR6B 3UCGA 4EFAC 5J2NB 2DH9A 2BDPA 3K89A 3A3PB 1YVNA 1QAJA 3WIVA 4JBCA 4R8UA 1RGIA 3OYLA 4LVOP 1UVNA 1XC9A 5AQVA 3IC1A 4L3KA 1YITS 2AP6A 2DNYA 1YJRA 2Z56B 1VQNN 2QLBB 3OYIA 1NK8A 1L3VA 2XZDB 3AOAA 3TQEA 1LFWA 1NGEA 3V9WA 1RHQB 3V1OA 2M3DA 3SSSA 1NSPA 4BRMA 4JKCA 1UFKA 4WU3A 1W97L 2I7PA 1VOMA 3G6VA 3PR4A 3V6JA 1BIZA 4HYKA 3UR0A 4F9OA 4DV4F 4A8QA 1JQGA 3N6NA 1AT1B 3RUBL 2VC0A 5E7OB 2F63A 4ILHA 4DX6A 2HNZA 3R97A 1P1LA 3ENQA 2NSCA 2OPRA 3SV3A 3GJQB 1GX5A 3CJKA 3QEXA 5HO4A 4URSA 2BE2B 3QYYA 3CJCA 5T7BA 3O9TA 4BC3A 4DL4A 3CJ1A 5DM7Q 3ET6B 4KH0B 1RHJB 3TYTA 4MYTA 2R7VA 5F8IA 4DV0J 1UAXA 4FSVA 2GVDB 4JI0J 1T03B 3F73A 3UD3P 2BQUA 4DV6F 1QQOA 3ZT1A 2NCKL 2C42A 1GLDG 2G1DA 1I94F 2ACMA 4CE9A 1DHMA 5GAEI 2VDHA 4DJBA 1VQKS 4IG3A 3ZZPA 3FZMA 2HVZA 3CERA 3C15A 3CJAA 2KJVA 3W7BA 1HWIA 4DV3F 3QGGA 2MQLA 1LNQA 2CAJA 3RMAA 2Y3YA 4ECSA 4QJVA 3QIPB 5KFOA 1OJ4A 4DR5K 2RSQA 3DDNA 1BE4A 4DR7K 1EARA 4WFYA 1IKYA 4K8XA 1YAGA 3AARA 4HDHA 4ECTA 3KZBA 3O9SA 3UQSA 5CH7B 4NLYA 2OD4A 2V4RA 4OLPA 5E3PA 2G2OA 4CEQA 2P5GA 4NXMF 3KNGA 4LFCF 4B9VA 3AJDA 2D0CA 4FL9A 4M95A 3U3YA 2ZBCA 1TZ0A 4IDKA 1BL3A 2OMLA 1NDLA 1YJUA 5G0RB 4CJKA 4QYRA 3M8ZA 5I3PA 2E2OA 2XMUA 4JYAK 3EWGA 2B4JA 2J0XA 1J54A 1U26A 2V0NA 1WG5A 3F0NA 3KK1B 5L9XA 4CM2A 4JI6J 4CEBA 8AT1B 3KTQA 4DUYJ 1K8AT 2BACA 1Q8BA 4Y3CA 4ICLA 4R25A 1TKXA 4A8YA 1H7XA 1E3MA 2LVWA 1SZ2A 3V9UA 3CJTA 3CCJS 3J81U 2ZDOA 3MMBB 1NMDA 2XM3A 2E9TA 2CYYA 3KLGB 4LVNP 6FD1A 4JS5A 5K5MA 1E6VB 3J80U 4FF4A 2BKPA 5AQNA 2WSEC 2P8IA 4F3TA 4ECQA 1YBAA 2L48A 1VQMS 2R7OA 3C6UA 4WZQA 1NGIA 1T44A 2XQCA 3RAMA 2XYGB 1N6QB 5AXLA 2ZJPQ 2P9EA 3G4SS 1OH8A 3HOSA 3LZIA 4ZMMA 3FZKA 4NLGA 1SUQA 4YN3B 3PW7A 4JI3K 4O0IA 3MDQA 5KRTA 4U7UD 2DGWA 3VF2A 3I32A 1KCFA 2AYMA 4AUKA 2IMOA 3GR1A 1KNZA 3EKSA 2DITA 1U0HB 4WQ5C 1VBYA 3PFEA 4I2QB 3TAMA 1DQ9A 2F9DA 4G1QB 5C24B 1HBOB 2G8KA 4CJFA 1TFYA 3TAFA 2IVNA 5F0WA 3HM9A 4ED5A 2GQ2A 3FZHA 4BRPA 1FVSA 2F4VJ 2EFQA 3DGVA 3W8PA 3AVGA 3FK4A 4MK7A 1QUPA 1SQEA 2B0GA 1S72N 1GX6A 2RVJA 3QFUA 3C7NB 2XLKA 4CJEA 1TK8A 1HNZK 1LW0A 2KXFA 4OQJA 3T6JA 2FLOA 2XLJA 4JI7F 2XMWA 2PFUA 1XMQK 2E7WA 1BMQB 3BPDA 2AD9A 4YOVA 3JXUA 4QR0A 2E5JA 4ED6A 4KE5A 1X3NA 1RDRA 4DSJA 4HEA9 1VQ7N 1XR6A 4RO0A 2B8QA 2YCHA 4DU3A 1ZBTA 4LRBA 4OMFG 4KH5A 1QHAA 3F9MA 4WFBQ 3JSMA 4QAGA 3JYTA 1RWOB 2ZZNA 5A2QO 4CJ7A 1KD1T 1F2HA 3KWMA 5KFHA 4HHTA 1RWVB 4DR7J 2ALZA 1FRIA 3OS1A 3I4PA 5SUHA 5BR9A 1MN7A 1JLFA 3TVKA 1RT7A 2UV8G 3HDSA 4BR0A 2V8HA 2JWKA 4F26A 2AIRB 1KTQA 5FPNA 1FKPA 1NK5A 2JLGA 2BQ3A 4DTPA 4LF9J 1NK0A 2F5GA 1KKHA 4LQ3A 5KPZA 3T41A 4G1IA 2DR6A 5F9NA 1IUJA 4Y2MA 1S79A 2VA3A 4JYAJ 2KHOA 3MZIA 4M3ZA 3H5SA 3AAPA 1LW2B 2DNMA 4MIAA 5KFLA 4ZVSB 3ZT0A 1GEHA 3SAFA 2V2VA 3H90A 3NGTA 3R5GA 3EM1A 5E84A 4M3WA 1S9GA 3AA8A 3ISND 3TR5A 1PC4A 3AY9A 4F0HA 3MR3A 4MLHA 1TYQA 2RRNA 1F2GA 3MN9A 1IJFB 2CPIA 1WHYA 2AMCB 2E29A 4EI2A 1S57A 5L1KA 4WF9Q 3H2VE 3C3LA 3LANA 5KFUA 4ZLJA 2HFNA 2E1PA 2WC9A 3NGZA 3RR7A 1HR0F 2YHYA 2WVCA 5B09A 2BZ2A 4DI6A 2YKOA 5EN1A 2LQBA 1IBMF 1V4TA 4ZDNA 4YR0A 3TX0A 4M7YA 1FHTA 1U6BA 1KHVA 3PV8A 3AO3A 3J80O 3D2FB 4LUBA 2M7SA 4X4UA 1CULA 4YY3F 2GAHC 3CJRA 4DQSA 3UIQA 4LF7F 4U8YA 3ISNC 2BE2A 2IVYA 3C94A 3IGVA 5M1PA 3NNAA 2AYGA 4DV7F 2X7IA 4GMJB 1HI8A 3AVNA 2F9JA 3EXYA 3PO4A 3VGLA 4NLRA 1AUSL 1C0TA 4KKOB 3CCMS 4FWOA 3HTVA 4B3MK 4DTOA 2OTJN 1HNZJ 4RTFD 2KHDA 1X5OA 1T9YA 2AT1B 3HKZD 2GHVC 4DR4F 4CBXA 3AVHA 2D74B 2YBVA 1AYEA 1VQ5S 4I7FA 2EHGA 5AQKA 1OVYA 1RFQA 1XMQJ 2IC3B 1RDBA 3B82A 5AT1B 3NS5A 1UWBB 2QXFA 4OIXA 3POTA 3H5XA 4EHTA 1HW9A 1SKWA 4EAHD 3AHPA 2UUCJ 1T94A 2LQJA 1KEKA 1TUWA 1FCAA 3G87A 3RSEA 1R31A 3CO9A 4LQ9A 5CYQB 5KT6A 4RUHA 1O1WA 1OMSA 4M5DB 4NASA 2J0QD 2BABA 3CCWA 2ZH9A 4CO0A 3OL9A 1DLOB 4AD6A 1RTJA 3KDNA 5DDPC 3IFRA 3VQDA 3ZSVA 3QFPA 3CM6A 4AQYF 4C8KA 4LF8K 1RCXB 4Y2IA 3BEXA 1TVRA 2R2TA 1FJEB 3K2PA 1NB2A 3JTPA 3IN5A 1GAOA 1Q8LA 5A8WB 2KXNB 3ZTPA 4O5BA 1H98A 2Q43A 5D3GB 2FZGB 2XY5A 1CJKB 2IVPA 4ISGA 2YHWA 2OO4A 3HLUA 2B4OA 2OPQA 3SSRA 3LAMA 2J4RA 3VGVA 3JS6A 3MEGB 2NYHA 3LP1B 2OH2A 2YQ1A 2GMJA 1NJIT 1PYTA 4EBDA 1RBRA 2KKHA 4GKJF 4GNIA 3D0GE 1PG5B 2KN4A 3N4PA 4B8CA 3V4IA 1B9DA 1ESVA 3M6GA 2UUAJ 3H46O 3KLIA 1GTEA 5HQLA 2V63A 1A0OB 2BW2A 1KC8T 4NYNA 2CQ0A 1QTMA 1VRQC 2DNLA 2XO7A 4BRCA 4IOAL 3OUYA 3SQOP 1D3WA 3M2RA 2IDLA 2VH7A 1BQMB 2R2UA 3OTEA 1G3OA 4LF5K 4QWEA 1G6BA 3LWMA 2GC8A 3ZSRA 3R7SB 4IXCA 1XIQA 2Z1HA 4X64K 4KTQA 1U1LA 1X9JA 1VQ8N 3ADAC 1XN9A 3H3NO 4FM0A 3ZTQA 4M8LA 3V6HA 3BGRA 2GUPA 3DJCA 3TPQA 3JAMU 4IFVB 3V5RA 4PKDB 1ATRA 4GY2B 3HSTB 1SH2A 3T9ZA 2A18A 4FXVA 4IOBA 2G0IA 2OANA 5AZIA 2ZITA 3SBMA 1A5XA 4J5OA 3IAS9 5EWFA 3U1LA 4GVBA 1XQSC 2LQ9A 1Q5VA 1JNRB 4YNQA 5JVGL 5J2QB 4JN4A 3KDOA 2N4DA 5GADI 3AD7C 4J9KA 2B7BB 3P4UB 5J2MB 1W9HA 4RR5A 1KAXA 3UKUB 3NVMA 4EO8A 2XSJA 3TEHB 4O44A 1P1TA 4CLZA 5C2DA 2KTQA 2VG5B 3U4LA 2JEIA 3DI6A 4CJ4A 3EJMA 2MGZB 1SVDA 2JHEA 3NOGA 1N32K 3N6LA 3WDOA 2M8DB 2ROGA 5C2FA 4DU1A 3RGIA 3ID8A 2W24A 2WOMB 3CETA 3HI0A 3VHQA 3NS6A 3FC9A 3C6TB 2D9PA 3P45B 1HBNA 2PI4A 4CF0A 2RPIA 2CQ3A 1VBZA 2PY5A 5KFFA 2PA8D 2HOEA 1LEOA 3MCPA 4ZPDA 3NH2A 5AQUA 4LF8J 1RBUA 1NOYA 3M2UA 3I9ZA 2JOQA 5ETPA 1FRKA 3PW5A 2A6MA 4BC2A 5M1OA 4CRJA 3M8QB 5T14A 4DQRA 1N0VC 1HWJA 2BXJA 4XTTA 2ASJA 3MPVA 3CCRN 2B5JB 1D9DA 1R8BA 1JL2A 3DXKB 4C4WA 3GONA 1TKTB 4DV4J 2RU3A 5DDRC 2GBZA 2V7ZA 1IKVB 5BR8K 1ZBUA 2VQFF 1WHXA 2U1AA 1S0OA 3K7RA 4O3OA 3GCXP 2QA4G 5AQZA 2YKPA 3Q83A 3IG1A 1NK9A 1HI0P 4BDYA 5IFMA 2YHXA 4W5RA 3LDLA 1VQOS 3NF7A 1Q78A 2MKKA 3DLGB 1F5CA 2H65B 1T95A 2BJ9A 2ZNYA 3VF6A 4IG0A 3IXQA 1DARA 4CJQA 1BHLA 4O55A 3CJ0A 3UW1A 2AP1A 5L1LA 3MMAA 2KG0A 1S6UA 2XY6A 4DV5K 4UT4A 4IRKA 3CCQN 3I9V9 3RB3A 5AE3A 1AFJA 1XNRK 5EVZA 4CF1A 4ID5B 4KHPF 1I94J 1VSKA 5AQSA 2CDRB 1VC6A 5AQFA 3J81Y 4WK3A 1OPIA 2ZH4A 5CXTA 1T6CA 4O8KA 1WELA 4FBTA 1RQ0A 1RTHA 4EO6A 4F4YA 4I56A 2EEYA 5D4PA 2MQNA 2D4WA 1YJWN 1PC5A 2DNKA 3NNHA 4LF2A 3ENAA 5I3UA 2JWLA 2B43A 5DQGA 1VHFA 3ZTOA 1R0BG 5F8GA 3P1GA 3GFZA 5IC4B 2UXDK 3VQ8A 1RNHA 5IWAK 1UWBA 1SC3B 2G8UA 3MWBA 3BO3A 1FRLA 2OTLN 3V9SA 5C2GA 3R5JB 2YWHA 1V3RA 4M5HA 3PSIA 1S1WA 3PIOQ 3TOQA 3KLFB 5K14B 2DK2A 2H4WB 4M3UA 3RW6A 2Q66A 1LAWA 1RT4A 3TZYA 4AM6A 3BSCA 3W64A 2ZVSA 3AQPA 3CCUN 2QN6B 2W8LA 1YJTA 2GO9A 3NAEA 2FSJA 1JLQA 2C3PA 4ZN1A 2O01C 2V5HG 5KFSA 1BU6O 4CFCA 2NRWA 3W2WA 2FJVA 2HWIA 3H1QA 8ATCB 1UP1A 3R27A 2P1JA 5J2PA 1VR6A 2LMIA 4OLOA 1VBKA 2A0FB 2YWFA 3D1QA 5KFDA 1IH7A 3DRPA 1BXNA 3W61A 3CM5A 1U6FA 4LSLA 3RB0A 1LWCB 5GIOA 2D3UA 4ELVA 3Q8RB 1Y10A 1JCGA 1LFPA 4C8YA 4A57A 2XC9A 1ZC6A 3GQCA 1S7HA 3MMCB 2D41A 3F56A 5BR8J 1N48A 1T05A 4CQ1A 2RDJA 4Z4FA 1ZETA 4BR7A 2VKRA 3BP8A 3SQ4A 4CESA 3WIUA 2MSSA 3GJSB 4CZIA 2NUUG 1VQPS 2M70A 4DQ8A 3HK2A 3JTOA 1X4GA 3PW4A 4NXNF 1BDGA 5HLFA 1Y3KA 1FRJA 2QMXA 3L6QA 2P9UA 4LF4F 5AQYA 3V9XA 3W2VA 1XQIA 4BVPA 3HO1A 5AQMA 4YHHK 3DHXA 4AHSA 2BUNA 1RHMB 1R43A 1LXNA 3T6BA 2BANA 4XK8C 1N8RO 2B3TB 4H4MB 3K5PA 1FNXH 3LDSA 2DO4A 3MOZA 2B7CB 4J37A 2MHEA 4DV5J 3THYB 1XNRJ 3QT7A 4JI7J 2XULA 4F36A 4JI2F 1S1UA 2LP4A 3VEYA 3G6EN 2WTUA 3M4XA 4GO5X 4C98A 2NLXA 3H2UB 3SMZA 2D69A 4QIEA 4L8RB 5AJ3J 2RS8A 1B0PA 3MECB 1JLEB 3VOVA 1ATSA 5C5JA 2GVZB 3KFWX 4BWMA 3OFHA 1S1VA 1FX2A 4LBIA 5I42A 1S1TB 2R7XA 1JLBA 5JICA 3H08A 4NWBA 5LMNJ 1WD6A 3OY9A 3M6UA 3NBPA 3ZLJA 2UXDJ 1S6OA 3CCVS 2ATQA 4LBHA 3RYLA 5IWAJ 4GKKF 3RAXA 2UU9F 3VEWA 2K1RA 4AXJA 2W1BA 5DLGA 4KRFA 4N41A 1VQ4N 2CJ9A 1Q9YA 3DRSB 2V9WA 4UOHA 1ASUA 2HK2A 2IIRA 4FLZA 3IMXA 2O8FB 4ID8A 5D0GA 1UWAA 3KOAA 2Y8WA 3NF6A 4L6V3 1SAZA 1KVAA 4LFAK 2F8EX 3AB4B 4O4GB 4RW8A 3HFKA 4O5FA 1P9QC 1WJ9A 1C6VA 4RW6A 4FWMA 1UVIA 2VHGA 2DFHA 4DPXA 1XNQF 2NZ4A 2WB4A 3BKTA 4OI1A 1JLGB 2W8KA 4W4MA 1SKUB 2CUYA 3W66A 3I0RB 2VBYA 1UJ6A 3M1VA 4OYBA 1RACB 4WP8A 4KO0B 1CQNA 2C3UA 4BE1A 3EGWB 4FLUA 1HNWK 1W7WA 4X66K 4CYUA 4BVOA 1GQEA 3BF4A 1OQ6A 1SQGA 2DGQA 1RT1A 2Q79A 4P71A 4WQ4A 1HR0J 1J5EK 4J9NA 4KI6A 4PR6A 3SFGA 2IAJA 2IA6A 4P75A 3F2KA 3OA9A 3QGHA 3OYMA 1UJ4A 2ZJRQ 1RDCA 4PY5A 4CZEA 4P2FA 2GJIA 1LV5A 3QQCD 2VZ9A 2RQCA 2AX1A 1RTZA 5LMUF 4FJ8A 1UTAA 3HT0A 4M45A 3ZZ0A 2CQIA 5EU7A 3VPZA 3OXLA 1DZ5A 1A9NB 3UN2A 2YKNA 4P6QA 3FDSA 3WNFA 1VS3A 3Q8UA 1ZAVA 3H98A 1N33F 1U6ZA 2A5XA 4CHQA 1GMWD 3TABA 2E2NA 4NRUA 3CCZA 1GLLO 1HPMA 4CEAA 3HSJA 2WFBA 3DXMB 2CGLA 4DV7J 2X6SA 2CRLA 4RNFA 1I1GA 2NXUA 3O8WA 2YNFA 1D1UA 4YHHJ 4OHYA 2W2MP 4OKKA 3G82A 3HT3A 3X1LB 1J5OA 5A8RA 4JKGA 3IMQJ 2HZCA 3HVWA 3ZFVA 4JB8B 4AXIA 2GQCA 2X74A 1RT2B 2BRKA 2MLXA 1JLCA 4KHRA 5C7PA 3MUMP 3LQVA 2PZSA 1TV6A 2O1PA 2FC0A 4JOUA 3KG1A 3O5TB 3HHDA 4DUZF 4HUFA 1JX4A 3VF4A 2XSFA 1X5PA 3SCKE 4CZLA 1R8HA 1D9FA 2RS2A 2DNHA 3ULHA 1EZZB 4QIFA 4U96A 3CC7N 2HQGA 3RMDA 3HVTA 3L4BC 3QRRA 1NMNA 1TMJA 4IYQA 1O51A 5E26A 3Q2SC 3KLHB 2W9BA 1HBMA 2HNDA 4HT5A 4HHUA 3CMAS 2WSFC 1TKZA 2AF6A 2RRBA 2UV8A 3HHKA 4OZJA 1KLMA 2ZGZA 3LP2A 1AFIA 3G25A 4R0EA 2HHHK 2OSQA 1RYSA 1TKDA 2PSZA 3W9HA 5LJ3Y 3OS2A 3OSPA 3AGRA 1UA0A 3OFGA 1BO5O 2QV6A 2C3MA 3G96A 3NCIA 3GLJA 3JAMY 2H5IB 4KH1B 5A76A 2X1BA 4Y2KA 3D67A 4IBNA 2VV5A 1HWLA 4X4PA 5KOWA 1PJ7A 3QFWA 5CYJA 1P6TA 4QR1A 5A0YB 4F4ZA 5EHHA 4KTZA 2XGQA 3E3XA 1RWWB 1YRXA 4K4SA 4OYWA 3FGUA 4DHYA 5BN8A 2F4FA 3AO4A 3KG0A 3ZT3A 1BD6A 3I55S 2R7WA 2HAIA 1HI1A 2MMYA 3AAWB 4RJVA 4FS2A 4HT7A 4H4OA 5KQDA 1Q79A 4ECYA 2KFNA 2HRUA 2LU1A 4X66J 5CZ2A 3SJHA 2YNGB 3WXKA 2CPFA 2C3OA 1ELOA 2CKWA 2G8VA 1LWCA 1OSDA 1QSSA 1OYEA 2O5DA 3DNCA 3N4WA 4FJIA 2FBYA 2N82B 1J5EJ 1VQ9N 1FX4A 2P9LA 4JUZA 4X65K 4CIGA 4ZA1A 5HQMA 2CQ4A 1FK9A 4D3HA 5KFIA 1WKLA 2COLA 3DOKB 2UYTA 5E41A 1CJTA 2D9OA 4ES1A 4V19S 3RU0A 1IKXA 1U2FA 1FTCA 4C11A 4LMZA 1HLWA 1KVKA 1GH8A 4CIOA 4DG1B 4ED2A 2E1AA 3GOIA 3I82A 1RWNB 1N5YB 4DCHA 1YHQN 2NNWA 3NRBA 1WOOA 4Q8EA 2DEJA 1YI2N 3DOMB 3C0BA 3Q8SB 1PJ5A 5HK4A 3CB4A 3AVMA 2KRRA 2W7PA 3R8EA 4H4MA 2XMMA 4NCAA 4NMXA 1GLAG 1Q7YO 3CF5Q 3PSFA 2MB0B 3I8BA 4MH8A 2IRUA 1CS4B 2IHR1 1E4GT 1H74A 5HP1B 1LOTB 4L3NA 2VG6B 4HKQA 3CDEA 1PILA 2J5AA 1IM6A 3H4BA 3J7AN 2O8DA 4JV5F 4WCEQ 1Q81T 4CJWA 2C2RA 4A8XA 2Q6CA 3ONQA 4JI1F 1TL7A 2MQQA 3E8OA 2PFDA 4MO4A 1S1TA 4X62F 4UF4A 4JK8A 2IRXA 3THPA 1XC3A 3NGRA 2QW9A 2YI1A 3EGZA 3T1AA 4ZJQA 3G8SA 1OWXA 5CZXA 2FVPA 1R0AB 3KHHA 3P5JA 1TUUA 3K8WA 4IUFA 1QUVA 2CNLB 2IA0A 4LRAA 2PN6A 4AFFA 1VSIA 1YVUA 2NUBA 2X6NA 2FLNA 4JRQA 2BV3A 2M9KA 3CEDA 1HMVA 2CH6A 4I6MB 1HARA 4WTOB 3DYAA 4IEIA 4WFZA 4PWDB 2A10A 2IM2A 3SMPA 4WK1A 2O8CA 3TX8A 1JMTA 5M1KA 3JTNA 3AJ1A 1FXXA 2VQEF 2DNOA 1HJRA 1YITN 2FGOA 3QIDA 3T5KA 1Q86T 4EZ9A 3G8QA 3JSRA 2CGKA 1X31C 2MEWA 3QLHB 3D0IE 4CM0A 1LOUA 3NNCA 4F02A 4LR9A 1S12A 4YUDA 2HGLA 4FJKA 1R27B 3FBBA 4K0KK 3OR1A 1N5VA 2VFSA 5IT9O 4B3OA 2FHMA 1IR0A 3I5CA 3L95X 1BOTO 3VENA 3U27A 3T3FA 3I8DA 4FOEA 4X65J 4FLVA 1H2VZ 4OZ2A 2LU2A 4I2PB 5BRFA 1S6PA 4K4XA 1XK8A 2MQPA 1WSRA 4FYXB 1S6QA 2MKIA 2HFUA 4A8WA 4K25A 2F9TA 2Z30B 2UP1A 4DR6F 4J2AA 1F5BA 1H72C 4E8UA 3P49B 4XDDA 4DL7A 4KFBB 2G8HA 3ENOA 3ALYA 5DM6L 3FEYB 4FW1A 2J9DA 4QZVB 2YH1A 3MR6A 4EBEA 3FUYA 2P9IB 5K9FA 2VA2A 1N54B 3NMRA 4NA3A 1TMMA 5KT2A 4TNOA 4F2RA 4A46A 2A1SA 5AQOA 4FJJA 1BUPA 4JAXA 4FJHA 3PR5B 1NWKA 3SI6A 3SQ0A 4MQ3A 2E2PA 3MEDB 3AODA 4BROA 5JMNA 4ZIVA 4H0PA 3QESA 1QQMA 1J9AA 3NGSA 3IWNC 2FPHX 2GWJA 3UVJB 4EYHB 1VQKN 2OIHA 2KHCA 2AJ2A 2CWXA 3KKSA 1LQ9A 2M2BA 2QWMA 3GFXA 3KHGA 4FJMA 2YNHA 4CD3A 1X1PA 4IOAQ 1CEZA 3IR7B 4JS4A 4CEDA 3CFPA 1OH6A 1S10A 3SV4A 2V8DA 3E01A 3L2QA 2CZ4A 1UL3A 3OVBA 4H0VB 3RR8A 4BR4A 1C0GA 3MM7A 2ROEA 2G2ZA 1VHIA 3LPYA 4OJ1A 3U9ZA 5KFWA 4OFZA 1WI6A 3WEEB 4FZXC 1RHKB 4YMEA 4KGVB 1X4HA 1QAIA 1GLBG 3ITHA 4EGLA 2EG2A 2LDYA 4CWBA 4XDCA 2GAGC 1VDHA 2Z2ZA 2X1GA 4K43A 1WI8A 4TQRA 4OX9F 3QPIA 3IAM9 4ZS6A 3DLJA 3TZZA 2UUTA 1YZ6A 2EWHA 3K5LA 3OPKA 3GDQA 3SAHA 4HLBA 3NGYA 3O1LA 4L73A 3Q8PB 4HCCA 6FDRA 5JVGQ 2MYFA 3TZXA 4GV9A 3OQ2A 2MY8A 1TU0B 1WAFA 2NRHA 1K9MO 3CCJN 2RKIB 3O3HA 1IO2A 4CT9A 2HFSA 1RAIB 3QZ7A 1X4BA 1HNXK 4K0KJ 2MKHA 1MN9A 5FPEA 1WC5A 1KVIA 4F4WA 4ELTA 4NXNJ 2B4PA 3L7PA 1WBBA 1DFDA 3A8YA 5KFPA 3LP0A 1KDNA 2EKNA 2OI2A 4M5GA 1B4SA 5KG2A 5M2RA 3TAEA 1RTIA 3IP0A 4X4OA 5FJ4A 4DLEA 1U1PA 4UUWA 3ZZOA 3DOKA 2YJFA 1Y5NB 1QD1A 3QMQA 4OZ1A 4RUBA 3PKMA 2L08A 3ISZA 2BTFA 1S0VA 2FJEB 4J9OA 1HQUB 3O08A 4ED0A 4CEFA 1YQHA 2ROPA 1C0UA 3BO2A 1HRHA 2PGCA 1U24A 3AD8C 5HMYA 1JLAA 4FDFA 4TSXA 3DLEA 3HVRA 2DIVA 4BACA 4PUOA 2AHOB 2FUG9 2VG7A 1IBLK 3NAHA 4O4RA 4CCHA 1SC4B 1S99A 3I56S 4WJBA 3EE3A 4TQSA 2K8GA 4PYAA 4FS1A 3E9LA 4NLBA 4TN2A 3M05A 4AHVA 1OY8A 3Q86A 4ID1A 2Q3PA 2MKJA 1IBKK 1RK8A 4V19J 3CXCR 2ASOA 2DCUB 3RBZA 3VQ9A 4RUCA 1KN6A 3H3OB 4F0KA 2UXBF 2V67A 1GXLA 1BC6A 4LFBK 4KJIA 3N5BA 4TU8A 5HJYA 2BOPA 4GKKJ 3DXBA 2Z1IA 2UVUA 4Q5VA 3DC2A 3FEZA 1VK3A 1VRUB 4B1VA 3PIPL 4CHYA 2R7RA 2P9PB 4LREA 5ETMA 5LL6d 5AQXA 2DHXA 3QFHA 5RUBA 3C65A 4C48A 1NJYA 3M8PB 2Y9HA 1NOZA 2JX2A 4DR3F 4ZVGA 4DX7A 5AXKA 3A8EA 4GVEA 5AQRA 4DMZA 1R0AA 1DTQA 2V4JB 3MM5A 1ZZNA 5KTQA 3B4MA 2YTCA 3P96A 3GIJA 4I0WA 4C6AA 4N7TA 1KOOA 2OFGX 3ZT4A 2HVDA 1WB9A 3ZNJ1 1AA1B 1JCFA 4IOCL 3HSGA 3IBCB 3ZTSA 4FLWA 2FVCA 2K2PA 4QOZB 3OYEA 4FLXA 3KKRA 5LXYA 4PWDA 2CXEA 4ZVRB 5C15A 4H4KA 4TYAA 1HNVA 3OW2R 1ASVA 3V2UC 1G15A 2EFVA 4X4SA 1X4DA 3WNHA 1DQ8A 3O5BA 5AZJA 3LDNA 2UXCK 3PACA 3BQ1A 4WXOA 3THWB 2F65A 4Y0WA 1YJ9S 3I5AA 1JIHA 5LMUJ 3OTBA 3GIMA 4N76A 1X9SA 3A5OC 4DV2K 3K9KA 4RL1A 3J8AA 5BN9A 4FBUA 1HNIB 1GT8A 3UE5A 2EXUA 3B8AX 1N33J 1HNXJ 1BQNA 3PX6A 3MEEB 2W9CB 2HQIA 1RT5B 2HBQB 5KG6A 1NGFA 3HYFA 1NXIA 1TELA 4OYMA 4DX5A 2JVOA 1FDAA 3FFKB 5HRNA 2KVIA 2ZH1A 4J8FA 3FFIA 3KUHA 2ZHAA 3IS9B 5B0EA 3KJNB 1EKRA 1H73A 4HACB 4C0BA 3SUQA 1VC5A 5L8RC 3CFRA 4C7QA 3OTOK 1T3NA 1M5OC 4ZVHA 4GC6A 1DRZA 1N36F 4OJ3A 4Y65A 1GXTA 5D0EA 4DUZJ 1IBLJ 3Q24A 3TP2A 2C2KB 2DT9A 3CJ5A 1FNOA 4QU6A 1UPMB 1I3AA 1YT3A 3R2DJ 1S9FA 2DCLA 3MGJA 4P7VA 3ZEUA 3ILIA 3AA5X 3MN7A 3CCMN 2R7UA 3TUPA 1LWEB 1IBKJ 1WKJA 4XH5A 2ZKUA 3QSYB 3G71S 2J9EA 1LK7A 2R2RA 3DRRA 4ANDA 5K8NA 2O8BA 2LA4A 2VGMA 1VQ5N 3M30A 1T3VA 2DR7A 4FKXA 4FVCA 1S22A 4CGHA 1T0TV 2YNIA 2BA9A 4LRDA 4ZTJA 2QRRA 3R9LA 3IM8A 4OPAA 4J9VA 3AVFA 4USMA 3HZ6A 3QWPA 2HFOA 1CBKA 3DGPA 2V2KA 4IJAA 1JNZB 3KWIA 5D0RA 2CPEA 3LTOA 4K7QA 4ZVUB 2XO6A 4PXEA 4DFMA 1X5TA 1EHWA 4I69A 4TU9A 2VF3A 4WYBA 3THXA 3OYFA 3OR2A 3QEPA 7FDRA 1TL3A 4RBUA 3FEXB 1UETA 1TK0A 2NPIA 5KFCA 3E51A 3M32B 2QIFA 2DHSA 4MKYA 3CDAA 2Q2RA 1C1BB 1E6YA 3DLRA 1TAQA 4IQMA 5LSRA 3NHGA 2GJFA 1RCOB 3ZC4A 2RU9A 1CJVB 1IVZA 1ZM3A 5AFUH 3G0ZA 2EFPA 3ATUA 1WSIA 4JI5F 3QICA 3QB0A 2FBXA 3H2LA 5DJBA 4URGA 4LSNA 3WXIA 4OHWA 4BRDA 1FJ7A 5KFXA 1HYSB 1C1CB 5D0HA 3KLEA 3SZ2A 3OYAA 1T7PA 4DQIA 4EIAA 2CZ9A 3QAEA 5HROA 4ED8A 2OJ3A 4USHA 2OPSB 1VQNS 3NCPA 5DGBA 1REVB 3QEWA 4TY8B 1WSVA 4O3NA 1W0HA 3CJ8A 3V81B 2ILZA 5CA5A 3J7ZO 3KJFB 2G8FA 5HBMA 2XEXA 1NSKL 2YX6A 4B9QA 4BG9A 3IRXA 3EE9A 4WFAL 2YWKA 3D68A 3RBXA 3MF5A 4TXSA 1WSHA 3LDPA 4Y6IA 1FJCA 4CNZA 1DTTA 2SXLA 4ZPBA 3HD1A 2BMBA 2OHDA 4H0OA 3EZOA 1YVFA 3N28A 3VAFA 2F7VA 1YGYA 4LR8A 5KPRA 2FLLA 2YY3A 3EDQB 1B7FA 4TLQA 4OI3A 4IFEA 1EIYB 5M1QA 1NGAA 4ECRA 3NLCA 1OH7A 3CXCM 3SCLE 2L9NA 4IFYA 2MKCA 2Y1RI 3AV9A 4FWLA 4B9TA 3T1HK 2L9DA 4CT8A 3OTOJ 1M5KC 1X8DA 4JKEA 4RW7A 4IKFA 2JJ4D 3IWXA 1B64A 4JV5J 2RMLA 2R7YA 2NR0A 4JI1J 1RBLA 3DFEA 2V4QA 3CMES 5AFUA 5F41A 3D0HE 2XY8A 1VISA 2GFFA 2XB2D 1XR7A 3BQ2A 3R1XA 4PG8A 4CI0B 2R8HA 4R8UB 2NZCA 5H9FK 2PYLA 4AL6A 3TSUA 2ACYA 3CVKA 4WPAA 5J1EA 4O3RA 4CHPA 1QZ5A 1YTAA 3NEKA 1YWXA 2G0CA 1A5WA 1N34K 4NYFA 1IWAA 4Y00A 2NREA 2WK4A 3WHIA 1VQLS 4JI8F 1YSJA 5BPNA 2QL9B 2LCWA 1W7AA 5KOXA 2GEMA 4NLWA 1BI4B 2ZQBA 3CCES 2NQPA 1GLEG 4E0DA 1NJXA 1LKZA 2QLFB 3T1YK 3J7A1 2K7JA 1VLYA 2ZBQA 1YZ7A 3Q23A 2CPZA 2GZOA 3O80A 1ZBSA 3MPUB 2HBMA 3DCAA 3KKFA 4DKWA 2HNZB 3J7YP 2KM8C 2MXYA 1PIEA 2FC8A 1X9MA 2OPRB 5L38A 4I64A 3SQGA 5CR4A 2DXEA 4CZHA 3CJKB 3A8KA 2KT3A 4C8MA 3DMJA 3FRYA 3GTYX 5B0AA 3HZEA 2VPWB 5CYMA 2HWHA 4LF6J 2LKZA 1NM1A 2QWPA 3LDQA 2YWWA 4MKVA 3ZX3A 4F4XA 4KRWA 5EWEA 5KG1A 5L46A 4F4AA 4BRIA 1OYDA 3FVYA 1MROA 3KWGA 2QWLA 2E66A 2HQFA 2HF3A 3KMQA 3W3SA 4B3RF 1HHTP 4OZLA 2WVDA 4JI4F 3GG1A 1HD1A 3AA9A 2ZVIA 3BH7B 4K4UA 1TL1A 3ASMA 1NZ8A 4YOWA 3WC0A 2E5LK 4IG3B 1RDDA 4M5JA 1VSLA 4KBOA 3C15B 3TI0A 2KH9A 1IN0A 4H5TA 1VQON 4KGKA 1RBVA 4Q8FA 2N3OA 2RNEA 2EBEA 1X9WA 2NXCA 4FF1A 2CQDA 4O0JA 1YRUA 1WKKA 2B6AA 3E9PA 3M7VA 1IKYB 2JFDA 3QWUA 3SMSA 3O9QA 4PCQA 5BYQA 4CVNE 2VBXA 4GC7A 2OKQA 3AA3A 3T1HJ 3LPEA 1S72S 1ZPVA 3AOBA 3RZAA 3PHEA 3HHLD 4CLKA 4IDKB 1RKIA 4Q7AA 5GINA 1ZH5A 3A0IX 1N5TA 1GOCA 3ETOA 4FJ5A 4WTYA 3WNGA 4DTMA 3Q8QB 3VCDA 2NRTA 2F8TA 4EEYA 1VAZA 5AQTA 2LQ5A 2H54B 3MX5A 4ZCKA 1R6VA 4M7XA 3JSBA 4OPJA 1RAJA 1FRXA 4ATNA 5KQ8A 5CD4H 5H9FJ 4U67Q 2G1HA 4FCYA 3LDOA 1KQGB 3ZYYX 4QQBA 2MQ8A 1F9EB 4DSKA 4E7HA 5C42A 4ICLB 2PAVA 1TKXB 1VJWA 4YOYA 1UCNA 4MLEA 3AVJA 1N34J 1SBRA 2CPXA 2J9CA 1EX4A 5C12A 4JHDA 3LM9A 3MM9A 3CDWA 4E7LA 2EC2A 1YJ7A 2DNNA 2HGMA 5ETNA 5GIPA 2AYEA 2KG1A 5F8HA 1ZTTA 2JEFA 2E9ZA 1ZBIA 5ETKA 5ETRA 2ZKTA 2HIYA 3C6UB 2HSEB 4OX9J 3EVMA 1RILA 3HHLC 3KNAA 4QWAA 1QVGR 4UY8O 1H38A 1Y97A 1TUGB 1SUQB 2I8EA 2GIQA 3T1YJ 4ZJLA 2WTFA 5LT5A 2QEXS 1KS2A 3UKRA 3OYHA 1GMUA 2RDIA 3AB2B 2JVRA 1YTYA 5J1PA 2WUSA 3EY1A 3VQCA 1CJVA 4DQPA 4CJ5A 2J0WA 3TAMB 1RBOB 4QYZK 1M5SA 3KJVA 2LYVA 4NO7A 1EP4A 3KK2A 2JL9A 4YORA 1I6JA 2NSBA 3GV8B 1HJOA 3H4DA 4I4BA 1RWPB 4ILMA 1ZA2B 2I6WA 2HZVA 5CABA 1GLCG 2LDIA 4E1JA 3GPAA 2B9XA 1U49A 4BC7A 4Q45A 4FNIA 3DHWC 2PEBA 3LZJA 3GYNA 2DFFA 3NCRA 1U09A 4B3TF 4JI0K 1IKWA 3CCLS 2QWRA 5LSLA 2AEMA 2JEJA 4PYDA 1I51B 3LH2S 1KQKA 1LW0B 5K8OA 2F8MA 2WSCC 4M63C 5C0YA 3CD7A 4USIA 5CD4A 4BE0A 4NOHA 4NZ7A 3EKUA 3T5JA 1YTUA 5HAOA 4JD2A 1VQPN 5EUHA 2KZZA 2F40A 2AJQA 2E5LJ 3TUZC 4TKTA 3AY0A 2VOOA 1ZS6A 4MKBA 5AQJA 1WDTA 5JS1A 4DR1K 3JSMB 1V9OA 3JYTB 1WNSA 3F5TA 4MDBA 2RJZA 2ASPA 1GMWA 3BR8A 3EZ5A 2D3O1 4IR1A 3DOLA 4KREA 3PX4A 4PG6A 4FZYA 2V50A 1Z2LA 4B1WB 3FZBA 1JLFB 1RT7B 1T9WA 3P4IA 1Q4RA 3S3NA 1FKPB 2MZJA 1YUWA 3U1MA 3MHYA 1VLOA 3M1FA 2PDAA 4NLCA 1B9FA 1BISA 2JZ5A 4B17A 1JK9B 4MKAA 1RT3A 4K2XA 2BJDA 2ZBIA 1FJGK 2E44A 4JI6K 2I5JA 2CPJA 4CH1A 3KMSA 2VWJA 2LEAA 3IRWP 4B9NA 4DUYK 4BR5A 2FQQB 2C28A 3PKYA 2J6UA 1AW0A 4MK9A 4ZLPA 1XMOJ 1KBRA 5E3CA 1S9GB 5ETOA 3PG9A 3CIPA 2V68A 2J7WA 3ENBA 1TYQB 4KB7A 2P6SA 2XS5A 2DPJA 1FFGB 3LAKA 2VPZB 5CZ1A 2R7SA 3CCVN 4PXCA 1NJWA 1UFLA 4MIWA 1FXLA 5BPLA 3O3FA 2QZ8A 1WUUA 5AQPA 3ILLA 3EEQA 2KT5A 3RTVA 3PM9A 3OJSA 1D4XA 1ITPA 4ELUA 3MUVP 4DSFA 3RRHA 5D15A 4EYIB 1BI4A 2ZDPA 3VGTA 2BH1A 1WLJA 3L4IA 1EQYA 1YRTA 4CK1A 2W7OA 2ZF5O 4DTXA 2FVRA 4FJXA 4A5BA 2Q0RA 4RNNA 2VKZG 4FPAA 1XBWA 1T9XA 1U1OA 1SI9A 1RSCA 1NH7A 4DTUA 4QIVA 2WONA 3FSXA 1CULB 1SV5A 5KPTA 1YDLA 4QYZJ 1CSJA 2DR5A 1NG9A 2EW9A 2F4VK 2HVEA 3M9NB 2Z2MA 5BYSA 4JKDA 3VAJA 3QJJA 4OKEA 4A8MP 5MLCV 1QQCA 3CGIA 2QT7A 2M52A 1Z25A 3NWGA 2A3ZA 5E3AA 5AE1A 5I4MA 1TR0A 2VODA 4DLGA 2P51A 5HMZA 1O5JA 5DG8A 1C0TB 3C8YA 3OYNA 4BR9A 4OYPA 3SSQA 2V51B 1U02A 2A6AA 2FC9A 4I7FB 4NCGA 3GIRA 5K8PA 4Y2CA 3POTB 5H1SV 1VSMA 3H6EA 2D5RA 1D09B 2HS3A 1D8YA 3T5LA 2BKOA 2H4YB 4ED4A 3P39A 1FTRA 2JFKA 2BJ8A 3RSEB 4OZ3A 4CHNA 4KHSA 4DR1J 3D3CJ 3IO1A 2ZM6F 3O4QA 1C0MA 1PKUA 2QFJA 1IR2A 3GG0A 1SL1A 1BCMA 4ECVA 3CC4S 4NLVA 3NL0A 2DTUA 3PVXA 2W42A 1FW6A 3P38A 1HL6A 3CCSS 4AHCA 1RTJB 4ANEA 3OHBA 1EETA 4LF9K 1TVRB 2IJNA 3WQTA 3J7AP 4AHTA 4EZ6A 2HKEA 2VC1A 3CE8A 3MCSA 4ZPAA 4B1UB 4FVMA 3SYZA 2C1EB 2CWKA 1Q82O 1U48A 3MAAA 2RIJA 4QS7A 1FJGJ 2MZTA 3V6DA 2APOA 2ZD1A 2OPQB 4E3SA 2BJ7A 3D4JA 2OEJA 5BREA 4JK7A 1YKWA 2A6OA 4M42A 5B0CA 3CMAN 3G9CA 3V4IB 3CG7A 2YV0X 1N4LA 4OJHA 1JXVA 2ZJPL 3KLIB 4OGEA 3HCXA 3PEHA 4E19A 2QWQA 2XHCA 3R6MA 1EKSA 4F7VA 4OYIA 3HOTA 3HL8A 4JI5J 1JKHA 3I96A 1S9EA 3OUYB 2FJXA 3W65A 1Q53A 4JKAA 4WXWA 3M2RB 3QGPA 2X1AA 4DL5A 2Z0GA 1RUSA 1Q7LB 4OV1A 4E1NA 1KWMA 3KYLA 5H9EJ 4PRFA 3HSCA 2RH3A 2RQ4A 4NEYA 2NXNA 3MN5A 3HZGA 5E2QA 3CULA 1CQMA 2FJWA 2GMHA 3I55N 2P5VA 3BGRB 3LUYA 1SC1B 4QWBA 3ULEA 3NXZA 3R7BB 2EPIA 3QEVA 2FB0A 3DRXA 1E4FT 2X51A 2DRBA 3ZZYA 1ZM2A 3I0SA 1QSLA 4M41A 2HLTA 4PZVA 2AV5A 5AZIB 1BHNA 3GIIA 4BLGA 1F3VA 2XZTB 3PIPQ 3O4NA 1HWUA 3WC2A 5LL6Z 4GVBB 1XEZA 5E3QA 1T9VA 1URNA 2UUBF 5DQHA 3CPWR 3VGMA 1IG9A 1UJ5A 4B3SF 2HF4A 4I1TA 2R9LA 3NE6A 2IMWP 4ZOSA 1DEJA 2XSJB 4HUGA 3PY8A 3OVSA 1RI7A 3CJ7A 4O44B 4WFBL 3D6HB 4IOXA 3W5YA 3WXLA 4A2BA 5GMEA 3BGOP 3A12A 3DI6B 1U8WA 2UUCK 3HSDA 3WXMB 2HMIA 2ZZTA 3CTRA 3GMGA 2I38A 3EL2A 4IOCQ 3IBFB 2P9KA 5DLFA 1XUPO 4JV1A 3MMJA 1HBNB 1RLDA 1RT6B 3GCWP 1JXLA 4FYDA 2WBMA 2QMWA 3HRGA 1ZYQA 2VD3A 1RAGB 3GV5B 5FIIA 4D3GA 1U7LA 2KZMA 5LM7E 2Y1LB 3V6KA 2AJ0A 3M2UB 3FR0A 1UW4A 3KG4A 2ASYA 2CPHA 4ZP6A 2NUHA 3RMBA 1RHUB 4J9LA 1I5OB 4DV1F 5IOLA 4WFNQ 4DV0F 4M3RA 1U1MA 3AO5A 3BDPA 3Q8YA 4H0TB 3G6XA 2Q97A 4NLTA 2HBYB 3CJQA 3OSNA 3B6PA 4DTJA 5KI6A 2GA7A 3W5ZA 1VSEA 2ZOMA 3HBTA 4EBCA 1EO1A 4I6YA 3K0SA 2OP5A 2UUAK 4CGIA 4ETXA 2WBRA 1NHUA 4CO3A 4BR2A 3Q8VA 5B7WA 3IGNA 1LWFA 2ZHBA 3CIMA 4HVZA 1HKBA 2IIHA 3CCTA 1Y4ZB 4PA1A 3LP3A 2O3DA 3HPOA 4DR2J 3S8SA 2K3KA 1QVFR 1GLFO 3RMCA 3QNWB 1R59O 4H0YB 3IG1B 5C25B 2X3GA 2RHQB 1HHQA 1R6YA 5TKYA 2YX7A 4C9DA 1F9HA 5JMVA 1S1XA 4XH1A 3J81O 4MFBA 2DGVA 4IG0B 2FZCB 2BM1A 2NRZA 4IO9Q 3NS7B 4KHMA 1JJ2R 4Z0UA 2HHPA 4CLLA 3KK3A 4FNHA 1RKJA 2A41A 3MMAB 1SL2A 1W26A 2MKSA 2HHUA 1QHTA 1BIUA 1M1GA 3TWZA 1UPPA 5FPMA 4B3RJ 1ZAXA 4J91A 1FEEA 3MCMA 2ZH8A 4CJRA 2CQ1A 1PO6A 2G8IA 2Q1NA 3OHRA 1RTHB 2G4BA 1V4SA 4IRCA 1H1VA 4CO5A 5KFBA 1K73O 1UMJA 1J53A 1TP7A 3MK6A 1WHVA 4EUVA 2GGPA 4LY7A 1UA1A 3E1YA 5KT7A 3QRPA 3OLBA 5IM0A 5I3UB 2PC6A 5B0BA 1M1KO 1YBUA 4HH1A 1L3UA 1T02A 1BWVA 4N56A 4FP9A 4NLDA 2YQ0A 5DO2A 4W5OA 1FDBA 3AA2A 4J9SA 4IH5A 2E1MC 4AL7A 2JLEA 1DURA 1S1WB 2D1KA 4G65A 3BKUA 4OGCA 3L3UA 2QL5B 2RHSB 2YXLA 3PJWA 1RT4B 2LFVA 2KU7A 2BUPA 5I3QA 1M1HA 2M8HA 2GNKA 1JLQB 3W0LA 3G6ES 3C19A 4K5RA 2V2QA 5KFNA 1NGCA 1KLNA 4UOCA 2KVQE 2OCEA 3KD5E 3W2WB 5GAHP 5MLCQ 5F2RA 4CLWA 5J2PB 3LO3A 1H0HB 3QNNA 2XY7A 4CK3A 3FE1A 3NFAA 2E1ZA 3C95A 3DRPB 2WZ1A 3OYKA 3GBTA 2OEMA 2AWZA 2J7UA 4OVLA 2LXIA 5IQQA 4LSLB 5C2CA 3J7YU 2R3VA 2HHTA 2ZC4A 2W40A 4DV4K 5GAGP 4TVAB 3NY0A 1HA1A 3TRGA 3A8IA 1T05B 5H1SQ 4L3QA 1NHVA 3AGKA 1MW7A 3UFCX 1VQ6N 1B7YB 3I6PA 3THVA 3DLLQ 2OGUA 1XJWB 4H4KC 7AT1B 4DR5F 5HLFB 3PYDA 1S5JA 4DR7F 1WSEA 3BBCA 2P9UB 3BY5A 3W2VB 4WU2A 1YJNS 2AGPA 1TGOA 5KAKA