1C1CA

Crystal structure of hiv-1 reverse transcriptase in complex with tnk-6123
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 147
structure length 536
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1cA05
4G1QB 4K4ZA 4AH9A 4GVMA 4FCYA 2VG5A 1MU2A 4DSEA 1KVBA 2AX1A 4EO8A 2ETJA 3NE6A 2BE2B 4WZMA 2OPRA 4KHQA 4ED8A 3OHBA 5DLFA 4M45A 4LSNB 3NKYA 4CERA 1JL1A 4RW9A 2UVUA 3TAFA 4CK3A 3AVFA 5L1KA 1NKEA 4AHSA 3OYAA 1WNEA 3BGRB 1NOYA 4W5OA 3T5HA 3IG1A 3DYAB 3ZCMA 3M8RA 3K5MA 2B6AA 2ZD1B 5KFVA 2E6MA 1WSJA 3G10A 3CJ5A 4RW8A 5L1JA 2HHTA 3C94A 2D3ZA 5KTQA 3ZT2A 3BSNA 1ASUA 1C0TA 1WNSA 3DLRA 3C6UB 4BE2A 3ZSYA 5F9LA 1W25A 2E6LA 4RW9B 2FJWA 1R0AA 4CK2A 4CJ4A 3ZSZA 1S1XB 3CVKA 2D0AA 3NH2A 4PUOB 2VG7B 1VK0A 4Y2AA 4RNHA 2YNHB 3OYKA 4E7HA 4ZP9A 1S4FA 4FJ7A 1SV5A 3TI0A 1BGXT 4DL2A 2ASDA 1Q9YA 2G8VA 1FK9B 1ZYQA 3RWUA 2XC9A 3TAQA 3GV5B 1RA7A 2G8IA 4NLGA 5F8LA 4O3NA 1JLQB 4OL8A 2WOMB 2IJNA 1D9DA 3VQDA 1IM4A 4MK9A 1QTMA 3LDSA 3GIMA 4O44A 3BJYA 3IS9A 4EYHB 2ALZA 2GIQA 3L2UA 3U3YA 4TY9A 3DRPA 3HM9A 3G6YA 1TK0A 4ED1A 1KVCA 1NK5A 3H4BA 3FSIA 1VSEA 3P5JA 4DS4A 1S1TB 4MK7A 3KLHA 3EZ5A 5J2QB 2R8IA 3I0RB 4YQWA 4E7KA 1Y97A 3SUOA 1YT3A 3OYMA 4DQIA 4QWAA 5JS1A 2WCXA 4IFVB 3C6TA 3HT3A 2W8KA 2P51A 3RTVA 4WE1B 2JEGA 4KSEB 1KTQA 1TGOA 4HTUA 5JUMA 4CFCA 3QESA 4TY8B 1T8EA 3RAXA 3KLEB 1D8YA 4ED0A 3NFAA 1QQCA 4RZRA 2VG7A 1SH3A 5KT4A 1TKZB 1VSDA 3IAYA 3SV3A 4IKAA 5JXSA 2HMIB 3PX4A 4LSLB 3SI8A 5KRTA 4FJHA 4AHRA 4KHSA 2VA2A 2OPRB 2HWHA 4G3IA 5I42B 3CDUA 4DTMA 1U09A 2OZSA 4DTUA 4IH6A 4K4WA 3M8PA 5FROA 4LQ9A 5KT6A 4ELVA 3SPYA 1TAQA 4AILC 4ZP6A 4CGDA 2WHOA 2OPSA 3MXIA 4Q5VA 5KFGA 5C25B 2XCPA 4RNFA 4TY8A 4DU3A 5HBMB 4O0IA 4CHPA 3K57A 3QGIA 2HNZB 4DMNA 1C2PA 1B9DA 3OYHA 1RBSA 4CFBA 4J2EA 1MMLA 3PW7A 3H5UA 3OL7A 2ILZA 1SKSA 1BQMB 1X1PA 1HRHA 3KLHB 4OKEA 4K8XA 3I5CA 3O3GA 2YKNA 4FLTA 4Y1CA 2XI2A 1RBTA 4KB1A 3ZSXA 4URGA 5DQIA 1DLOA 4B9LA 4FJLA 5HP1B 3LAKA 4YMEA 4F2SA 3WNHA 3K5NA 3JSMB 5KT3A 4CF0A 3SQ1A 3DRSA 5KFHA 4Q8FA 4U7CA 2D7SA 2XWYA 3OYGA 1IKWB 3SJJA 1JLQA 1GX6A 2RF2B 4DS5A 4CE9A 4UQGA 3CFRA 3V9SA 2AJQA 1I3AA 4NLUA 4QCLA 2HNYA 4FJNA 3QIPB 4DWIA 2YNIA 1CSJA 3OYEA 1C1CB 4ECSA 1F21A 3L3UA 4BACA 4MKAA 3LP2B 4IFYA 3BSCA 4N56A 4CEBA 4DQQA 5J1EA 1J5OA 4QWDA 2DPJA 4I2QB 3MFHA 1JL2A 1LWFB 3PR4A 3KKRA 4B8AB 2CKWA 3QIOA 3ALYA 4CCHA 1RT4B 3OVNA 1DTTB 4PWDA 5HRSA 3H98A 5KFRA 4J9MA 2X6SA 4HVJA 3QEXA 3AO4A 4HUEA 1L3VA 3AVCA 3DLKA 5KFDA 3RB0A 4CJPA 3AA3A 3H5XA 4BDZA 2R8KA 4LH4A 4O5BA 2ZQBA 4DQRA 4O3OA 3LP0A 4E7IA 3AVAA 4R5PA 2J6UA 1KCFA 4WFZA 4FLWA 3PO5A 4EZ6A 3RMCA 4CEZA 3AO3A 1SKWA 5I42A 1RTHA 5J2QA 3TARA 1U49A 4KPYA 3DI6B 1KFDA 1C0TB 3RB3A 1UWBB 4DSLA 4DTPA 1S9EA 4DU1A 3AV9A 3K5OA 1RTDA 5KT5A 3IGNA 4JV2A 3DOKA 1TL1A 3EY1A 3LZIA 4FZZA 5KFAA 1RT5B 1IKVA 3KK1A 3PJWA 4CF8A 5I3UA 1NNDA 3LP3A 1YTAA 1RDDA 4KV8A 2W42A 1D9FA 3KLFB 2GBZA 3GILA 1JX4A 4KFBA 4N41A 4PQUA 1S0NA 3TQ1A 2FVQA 2JEIA 4M3TA 4CJWA 3HSTB 1S1UA 1T05A 2PYLA 4WXOA 4B9MA 5KFXA 1S1VB 4W5NA 5CYQB 4ZVFA 1U47A 4KE5A 4F4XA 1S9EB 3HPGA 3GIKA 3ISND 2KFZA 1NK9A 3V9UA 2PZSA 2DTUA 5HBMA 5C24B 3M9NB 4XPCA 1RYRA 1S1WA 4CK1A 1BIZA 3OLAA 1BL3A 3L2WA 1RAJA 1J53A 4HCBA 1YTUA 2WONB 3KHHA 4JUZA 1RA6A 3NF7A 1VRUA 3AVHA 1I6JA 3KOAA 3KLIB 1HPZA 3THVA 2UVVA 1HARA 4MKBA 4J9QA 3LWLA 4FK0A 1EXQA 5HLFA 3RB6A 2G8WA 3DDKA 1NK6A 4LD0A 3L2VA 4C8OA 5KFMA 4Q43A 3L3VA 2W7OA 4H4MA 3ZT4A 3DYAA 5CYQA 1ZBUA 1UA1A 4ECZA 1N48A 2XHBA 4ID5B 1S6PB 4M94A 4Z0UA 4ZPBA 4FK2A 3KJVA 4RW8B 3KLEA 3TAMA 1N6QA 4IR9A 2VG6B 1XHXA 4Z4CA 2OPQA 1X9WA 3ITHA 1NK4A 1TL1B 4QW9A 1SH0A 3C6UA 1A5XA 4CGHA 4MK8A 2Z1GA 1REVA 1RCHA 2W9CB 4ECRA 1HQEB 1XI1A 4JS4A 4HUGA 5L9XA 4RW4A 1LWEA 2R2TA 4HCCA 4X2BA 2KW4A 3TAPA 5J2MA 2FLLA 3NAHA 3Q8QB 4CJKA 5KG7A 2ZKUA 1OS5A 1JXEA 4DQSA 3M8SA 3WNGA 3DLEA 1UOCA 4J2BA 3TAMB 1N6QB 4MIAA 1Q8IA 1BCOA 3NBPA 1SUQA 3OJSA 2ZD1A 5KG5A 3DRRA 4IFVA 3HJFA 2IM2A 5C42B 1D5AA 1REVB 2R2UA 2I5JB 5DGAA 5KFCA 3RBDA 3CDEA 1DTQB 1LW2B 1LWEB 2HNDB 1GX5A 1FKPA 4DF4A 1HQUB 4QWEA 4C8KA 1IKVB 2BQ3A 4Z4FA 4R8UA 3E51A 3KLGB 1NK7A 2E9ZA 3DLBA 2NUBA 4IDKB 5HP1A 4MQ3A 3O3HA 1TVRA 4J9NA 1S6PA 4PUOA 2R8GA 4B9VA 1JKHB 4DQPA 4CF9A 4TYBA 2QKBA 4ELUA 4NLTA 4FJMA 1SV5B 1ZBIA 1S1UB 1RTJA 2B5JA 1BQNA 1TL3A 3DI6A 3CYMA 4I7FB 3OHAA 3NGIA 4AHUA 5DK5A 2JGUA 4Q0BA 4F3TA 4NRTA 1XR6A 4MFBB 3SV4A 5KT7A 2OPPA 2HNZA 5KFUA 3BSAA 1QSLA 1TQLA 1LAVA 3PX0A 4DSFA 4R8UB 1RDBA 2FC0A 1IG9A 2BGGA 5F9NA 1S6QB 1UA0A 4EEYA 1KVAA 3FQLA 3QNOA 4AHCA 1QAIA 1KHVA 2WRMA 1JLEA 4EYIB 5KFYA 3DLEB 3AO1A 5FDLB 3BQ2A 3KNAA 1N4LA 4O0JA 3WNFA 4CJVA 4NLYA 4Z4IA 4O4GB 4EP4A 1N5YB 5KFBA 3IN5A 2IMWP 3PW5A 4KAZA 2KFNA 4DTJA 2UUTA 2IBKA 3EZUA 4Y1DA 3RMAA 1B92A 1C0MA 1RT1B 1ZBHA 3SCXA 1A5VA 2E4LA 4RNNA 3KK2B 5DG9A 1HQUA 4CECA 3PVXA 3NAIA 1T7PA 4EBDA 4EBEA 1Z25A 3N6LA 2IDOA 4FJKA 2IA6A 4KTWA 4ED6A 1KLMA 4ZPDA 3KIOA 3IGVA 3PUFA 2YNGB 5J2NB 4LSNA 3OL6A 3UPFA 1LW0A 3A2FA 4N47A 3I0SA 2O5DA 3MEDB 4NRUA 1BQNB 4TQRA 4DSJA 5HLFB 3T1AA 5J1EB 1J5OB 4BWJA 1C6VA 3ICLA 4KHYA 3HVTB 5DLGA 1DLOB 2BR0A 1EETA 3V4IA 3OY9A 1HJRA 1VSFA 4N5SA 3AVJA 3TANA 1WSGA 2VWJA 1QE1A 2AGOA 3AVBA 4KTQA 4CJSA 4FBUA 3N6NA 3MEGB 3CJ3A 3EPIA 1EX4A 5KT2A 2IC3B 4WFYA 3KK1B 1ZTWA 3S9HA 2DPIA 1VSMA 3SI6A 5I3UB 1MU2B 2BQRA 1VSKA 4NZ0A 3GIJA 1FKPB 1IO2A 4CJQA 3MXJA 4WE1A 3NL0A 1HMVB 4KBIA 4NLXA 3K59A 5D3GA 1VRTB 4NYNA 2JEJA 2Y1JA 3TAEA 5KFLA 4QOZB 3DM2A 3KMSA 2IAJA 3QLHB 4OKJA 4KHNA 2IS3A 2XI3A 3V4IB 1LWCB 3QEVA 2HHXA 3RMBA 1ASVA 3QZ7A 2YHAA 3H59A 5CY4A 1FK9A 3V1RA 3JSMA 1RT3B 3DRSB 4I9QA 4NLVA 3B6PA 1S49A 1JLGA 4E1NA 4B8CA 3NGYA 1HNIA 3ZSWA 5CYMA 4FZYA 3PW0A 2YNFA 4FK4A 1NKBA 2XY7A 3GYNA 3K2PA 3PV8A 4J2AA 4O44B 4CEOA 1TKDA 3HPOA 3TVKA 3FFIB 4IRCA 2W8LA 5HROB 3NDKA 3DOLA 4ECQA 3CJ2A 4NYZA 3M9OB 3OS2A 5DGBA 1EP4B 2QE5A 4WYWA 4H8KA 2F8TA 3G6VA 4M3UA 1L3TA 4CJUA 4H54A 2C22A 1TV6A 3K5LA 2BRLA 1LWFA 3B6OA 1HNIB 3SZ2A 2IC3A 3AVLA 3VA0A 1WSEA 3OYIA 4BDYA 1ZBFA 1GOCA 5KFZA 2ZE2A 2P1JA 5DG8A 5KFJA 4NLOA 4TYAA 3E01B 4FS2A 4L8RB 4QPXA 2YV0X 2B6AB 4KHRA 4J9KA 1ZTTA 3ZSRA 2JEFA 4FJJA 2IAJB 1C0UB 4G1QA 3JYTB 3OYBA 5KFSA 2D5RA 4KB7A 3OYFA 1NJXA 2RPIA 4AHVA 4PY5A 1RT2B 4I9LA 4ECWA 2HHQA 3QINA 1BISA 3VQAA 4FW2A 3OSNA 3D45A 1S9GA 3D0PA 1C1AA 1Z4UA 2UVRA 1SL2A 1JLAB 4IOBA 5T7BA 3OL9A 1T3NA 1VSLA 2W7PA 5C42A 1S1VA 1VSIA 1ZETA 4IFYB 1JLBB 2O4IA 3KJVB 1JIHA 4F4KA 4FXDA 2R7YA 5J2PB 3L8BA 3LALA 4I2QA 3VQ7A 3MFIA 4CEDA 1IKYA 3OYNA 1RNHA 4ZHRA 4ECXA 4C8MA 2E9TA 3SQ4A 3F9KA 4XPEA 4JRQA 1JXBA 2W9CA 3LPTA 2WOMA 4XO0A 1JKHA 1KRPA 1JLCB 2G8HA 3DLKB 3HYFA 1U45A 2QK9A 1XR5A 4CIEA 2E9RX 4FJGA 1JLAA 4M95A 1RTJB 1TKXB 4H4MB 2R8JA 1S1XA 4K4SA 3MECA 4J9OA 3KLVA 4B9UA 4HYKA 1CXQA 3AVGA 3T19A 4DF8A 4OVLA 2WTFA 3BREA 3V6DB 1C0UA 1RT3A 1QSSA 3OLBA 4KKOB 2GUIA 3MEEB 4H4OA 4KO0A 3VQ4A 2EC0A 1ITGA 2HNDA 3I5BA 2HVHA 3HP6A 4CGGA 2JC0A 1HQEA 2FVRA 3HHKA 4WFXA 2YKMA 2V0NA 2RN2A 1YVFA 4NCGA 3BGRA 3V81A 3GIIA 3NF6A 4HKQA 4YR0A 1L3UA 5T14A 3KK2A 4CF1A 4N76A 3DMJA 4CJLA 1NJWA 2P5GA 1S1TA 4DFKA 1FKOA 2W9BA 4GC7A 2V4QA 2B5JB 4PQUB 3V6JA 1D0EA 3AO5A 3ZSOA 3IRXB 3LANA 3QO9B 4CHNA 1XC9A 1NK0A 3CDWA 2BRKA 1JLFA 5J2NA 3TAGA 2EX3A 5DQGA 1KHWA 1XWLA 3I8DA 2WK4A 3JYTA 3KLGA 4NCGB 3DLHA 1NHUA 5C24A 1S1WB 3P1GA 2YHBA 2I1RA 4NLSA 4JS5A 4ZMMA 5EWEA 4MIBA 3CIZA 4O3RA 3EPGA 4BWMA 4W5QA 4IH5A 4B3OA 4K4XA 4KO0B 2IM1A 1SUQB 4CJ5A 3TWHA 2QKKA 3HVWA 3NHGA 4KHUA 5L1LA 2FVPA 4DLGA 2ZE2B 2P5OA 2OPPB 3NF8A 1SKRA 1KFSA 2FJXA 5DG7A 4RW7A 3PR5B 4EP5A 2HAIA 3ULDA 4YP3A 4RUCA 3P83D 5HRPA 4F4WA 4KHMA 2D41A 3V1QA 3CWJA 5EWGA 4DTNA 2C2DA 2FJVA 2XRIA 4JV1A 4FS1A 4BE0A 4I2PB 1JLEB 3AO2A 4ED3A 1JLCA 3I0RA 4O4RA 4K8ZA 1RT7B 1TKXA 2OA8A 1J54A 1JLGB 1S9GB 3SUNA 4WYLA 3G0ZA 4DG1A 3CJ0A 2YNFB 4J9RA 5F8NA 4URSA 3SQ0A 1RT1A 3CFPA 4R0EA 1CLQA 5KFOA 1UAXA 1WAFA 4Q45A 2XY8A 2RKIA 2CJQA 1HNVB 5EUHA 3MEGA 1VSHA 4RU9A 4RG8A 1S48A 3U6FA 2J6TA 1GOBA 2BQUA 1LAWA 4WZQA 3OS1A 3T5KA 3DLGB 4QAGA 3FDSA 3KTQA 2ATQA 2KTQA 4I2PA 2RDIA 1ZBLA 1K6YA 2KZMA 3SUQA 2YNIB 2KQ2A 4OLBA 3RR7A 3VQ5A 2X6NA 4M3YA 5KG4A 3LZJA 2Q3SA 3Q8SB 3SFGA 2HHWA 4O3QA 3VA3A 1Z26A 4E7LA 3S3MA 1Q9XA 4JLHA 5K14A 2OPSB 5SWMA 1RILA 5F8IA 3E01A 3LWMA 4DEZA 1BIUA 2Z1HA 3SFUA 3IG1B 4YFUA 4ZPCA 4OGCA 4FLXA 4IG3A 2FBYA 1BI4A 2DFHA 3QO9A 4AHTA 4F3OA 1DTTA 3LPUA 4CEEA 1BCMA 2HHUA 1QS4A 3AVNA 4H4OB 5KG6A 4CHQA 4ICLB 1N56A 3G86A 1KLMB 4CGJA 3IS9B 1VRUB 1VRTA 1W9HA 1K1SA 4FLVA 1EP4A 1HMVA 4TN2A 4NLQA 4OPKA 4DG1B 4FBTA 4TLRA 4B08A 2GV9A 1LWCA 3QEPA 4E19A 4K4TA 3LAMA 1HYVA 3UDLA 2OYQA 1RDAA 4CHZA 3BSOA 1WN7A 1SL1A 4ZPAA 4KAIA 3ITHB 1S10A 1NOZA 3H08A 3OJUA 2R2RA 3RAQA 4CFAA 3KMQA 2A1RA 3RR8A 4BE1A 1FKOB 2W9BB 4IRDA 4QW8A 3GV7B 2EHGA 4URQU 1I39A 2UVWA 1KLNA 4DTSA 2FBTA 4KREA 2F96A 1WSFA 3LP2A 4B9SA 4IDKA 3G6XA 4ECVA 2O4GA 4CESA 3DOKB 3MECB 2FVSA 3QEIA 4TSXA 4F8RA 2WONA 4PA1A 3PY8A 3VQCA 3OYLA 2PYJA 3AVIA 3ISNC 3WNEA 4OGEA 5F8JA 4EO6A 4IQXA 3H2LA 1K1QA 3V1OA 4DSKA 3OSPA 5J2PA 1DTQA 1LW2A 5KFTA 2GC8A 1IKYB 3OYDA 2FLPA 3OL8A 3VQBA 1RTIB 3N6MA 3HKWA 5KG1A 4OLAA 1QUVA 2B43A 1X9SA 5KFEA 3LP0B 1BQMA 4DLEA 3PO4A 4DFMA 3F73A 4Y3CA 1RDCA 2FVCA 5HRNA 1YVUA 3MR5A 2OZMA 1J9AA 2AGQA 4J9PA 1SH2A 4RW4B 2VA3A 4ZTFA 2AX0A 3M9MB 3ASMA 3SNNA 4NLDA 4DTOA 3CM6A 1XR7A 2BANB 4Q44A 1S9FA 5JS2A 4M3ZA 4NCBA 1LV5A 3KK3B 1NK8A 4YR2A 4NLRA 4IBNA 5KGXA 3AVKA 3QETA 4ID5A 1BI4B 1RTIA 4CFDA 3V6DA 1T03A 1U48A 4IG3B 3PX6A 4KKOA 3HP9A 2Z1JA 2FBVA 2RKIB 3DRPB 4YR3A 4FM1A 2VG5B 2OPQB 5DQHA 3QGHA 3GV8B 4CHOA 4ICLA 4M3WA 4FLYA 2FBXA 3QYYA 4FZXC 4J2DA 1C1CA 3O3FA 4LH5A 2HNYB 3UR0A 3QIPA 4O4GA 5FDLA 4C8LA 3OS0A 5HROA 5EU7A 2BANA 3KHRA 3DOLB 1NJZA 2XGPA 3T5JA 4HUFA 1RT6A 2XGQA 3KD5E 1TVRB 1UWBA 1JXLA 2HHVA 4OKKA 2BDPA 2F8EX 3AA2A 1D1UA 2OH2A 4CGIA 3CJ4A 2IOCA 1RT4A 4ED7A 4FJ5A 2D0BA 1IKXA 4ID1A 2X78A 2GIRA 2BE2A 4EBCA 4Y34A 3KLFA 5KFQA 1FXXA 4F2RA 2D0CA 4FJXA 5FRMA 1S0OA 4FLZA 3O4QA 5KI6A 2G8UA 2A1SA 3D28A 4EZ9A 3ZT3A 4FM0A 3KK3A 4ED2A 4Z4EA 5KG2A 2JLEA 3NMAA 4E3SA 1RT2A 1TKTB 1T03B 4TQSA 3PW2A 2YNHA 3HO1A 4FM2A 2FLNA 5KG0A 4RW6B 2IM3A 3RRGA 1QAJA 4CJFA 4K4UA 2F8SA 2PY5A 2AQ4A 3ZT0A 1RTHB 4W5TA 4KI6A 4ZTJA 2R8HA 1JLFB 3HK2A 1TL3B 4M3XA 5FRNA 4FW1A 3IRXA 3HVAA 1NHVA 4F4ZA 4DTXA 4K4YA 2QV6A 2D3UA 4IG0A 2AU0A 4O3PA 1S5JA 3PHEA 1TKZA 1R0AB 3D5MA 4Z4HA 4LSLA 4E7JA 3QLHA 2C2RA 4GW6A 1RBRA 4J9SA 1NKCA 2HW3A 3VQ9A 4DL6A 4C8NA 4Y2CA 1SL0A 3V6HA 4LQ3A 5KFWA 3QERA 4WXWA 3M8PB 3DMJB 1IKWA 4KHWA 3RB4A 1C1BA 2G8KA 3C6TB 4DSIA 4DL4A 3SYZA 5C25A 4B9NA 3Q8RB 4ZVGA 4CJRA 2X74A 5CYMB 4Z4GA 2ATLA 4M3RA 4FJIA 3K58A 4CJ3A 5DMRA 1CZ9A 4CEAA 3DLGA 3FFIA 5EDWA 2IM0A 3C95A 3H4DA 4GMJB 1S0MA 1IH7A 3RBEA 1NJYA 3L2QA 1RT5A 3MXMA 3KLIA 3QNNA 3ZT1A 1HPZB 4GC6A 1CZBA 2AGPA 4RW6A 3H40A 4DFPA 4CEQA 2XY6A 4DU4A 2Z1IA 4IRKA 5CZ2A 4ZP8A 5D3GB 3I0SB 1S97A 3M8QB 3MEDA 3CG7A 3DM2B 3OYCA 3HXMA 5HRRA 3H5YA 5EWFA 4MFBA 1T05B 3LP1A 1GOAA 4CIGA 5KRSA 4MH8A 4ECUA 4IR1A 1QSYA 3CQ8A 3MTKA 1TK5A 4RW7B 4ZVEA 2DY4A 1S6QA 3TR8A 3MAQA 1RYSA 4E0DA 4CJEA 3AA4A 1TAUA 3MR6A 4Q8EA 5F8HA 4J9LA 2RDJA 1W0HA 3NH0A 1IKXB 4JV0A 5KG3A 4K4VA 3NH1A 3NAEA 1X9MA 3QIDA 4O3SA 2W9AA 2AWZA 4FYDA 2UUWA 2ASLA 2YKNB 3VQ6A 1BHLA 1JLBA 3EYZA 4CIFA 4JRPA 4B9TA 4ECYA 1TKTA 4NCAA 4QWBA 1EKEA 3ZSQA 5K14B 4KRFA 4DL3A 1HYZA 4ZHRB 1CXUA 3CFOA 1VSJA 4XIUA 2ITGA 1RTDB 3DRRB 5L1IA 3SPZA 2RF2A 4IH7A 2VG6A 3NF9A 3NBPB 4OPJA 5CZ1A 5C5JA 3VQPA 3KKSA 3Q8PB 2XY5A 2XCAA 3VQEA 4IKFA 3S3OA 3BDPA 4IG0B 4F50A 4F4YA 4KV8B 3QGGA 3VQQA 4DL5A 4KFBB 1RBVA 1WLJA 2C2EA 3BQ1A 1N5YA 3CO9A 3RMDA 4TXSA 3KHLA 5J2MB 1HYSB 3T5LA 3AVMA 4M41A 4O55A 1KSPA 2J6SA 1WSIA 2KZZA 4R5PB 3T3FA 4FJ9A 3LP1B 2HVIA 4DFJA 4M42A 2ILYA 3MR2A 1WSHA 3VQSA 3PJXA 3H5SA 4ECTA 2HWIA 1RDRA 2DFFA 1QE1B 1TV6B 3UQSA 3NCIA 4FLUA 1RT7A 4W5RA 4CGFA 3PZPA 3V9WA 3PW4A 1L3SA 3VN5A 4PWDB 1C1BB 5KFFA 3HPHA 3HVRA 2V9WA 3NGZA 2I5JA 4ELTA 1WAJA 3SUPA 1TK8A 3S3NA 4CJTA 4E89A 2HB5A 4K50A 2G8FA 3L2RA 1HNVA 4BDPA 4DTRA 3FQKA 1HYSA 2LSNA 2R2SA 1L5UA 2XO7A 4ZVHA 4QWCA 3BR9A 3QEWA 4CEFA 1G15A 1EETB 2HHSA 3NGDA 5KFNA 4B3OB 3BQ0A 4FJ8A 1TP7A 2VWKA 2B4JA 5F8MA 1A5WA 3SQ2A 3TABA 4RNOA 4OJRA 3KD1E 3M8QA 2ASJA 5KFIA 4RUAA 3AA5X 2IJFA 4I7FA 1B9FA 4U6PA 3V9ZA 5SZTA 3V9XA 1XHZA 4Q0BB 3ZSVA 4LY7A 3FRZA 3GQCA 3I5AA 2QXFA 5F8GA 1T94A 4RNMA 3KHGA 2V4RA 3VQ8A 4DL7A 1O1WA 2WB4A 1U4BA 4NLWA 1ASWA 2HMIA 3RRHA 3MEEA 4CHYA 4CF2A 3MR3A 1LW0B 4FVMA 4YNQA 2Y1IA 4KTZA 3OYJA 1QHTA 2YNGA 3CM5A 5E41A 2IGIA 2C28A 2DFEA 4E1MA 3O4NA 1RT6B 2YKMB 4HHTA 3V81B 2JC1A 3V6KA 5KFKA 3UIQA 4KB0A 3MF5A 3HVTA 4KI4A 1RBUA 3U3GA 5KFPA 5KGWA 4ZP7A 4NLPA 3QZ8A 1U04A 4NYFA 3HL8A
chains in the Genus database with same CATH superfamily
1P1TA 2B9YA 4AH9A 1YITS 2BH1A 3HZGA 3IUCA 1MU2A 4DSEA 2POKA 2ETJA 2O01C 1SI9A 2MPUA 2BE2B 3CXCM 4BRGA 5E26A 3KDOA 2OPRA 4KHQA 2A2DA 4M45A 3EEQA 3NKYA 1H6KX 2UVUA 4CK3A 3D3CJ 5L1KA 4AHSA 1WNEA 5EHHA 3BGRB 1WDDA 4LRCA 3I9ZA 2XMKA 2V7ZA 3K5MA 1S0VA 2ZD1B 3CGIA 2MGZA 3Q0AA 2GZOA 2RIJA 1U0SA 2AF6A 2R7TA 1WHVA 3CJ5A 1WSJA 5AQZA 2RS2A 3D6RA 5KTQA 2O8FA 3F44A 2F9TA 3BY5A 3C6UB 3M1VB 2N3OA 1Y0HA 1NPRA 3HRGA 2CA9A 4NMLA 3ZSYA 4BE2A 2NPFA 5LOQA 3HF5A 1W25A 3MM9A 4H0OA 5DZ6A 4CT8A 3BS9A 2DNHA 1N36K 2DNZA 3CVKA 4BR0A 1NGEA 1VK0A 2B8QA 1TL7B 4E7HA 1FNMA 4FJ7A 1SV5A 1FRIA 4K2JA 5CR4A 2ASDA 1FK9B 1ZYQA 2MKHA 2XC9A 4KHPF 3GV5B 3AXKA 5GAGU 2I9SA 3QJPA 4NLGA 5F8LA 2ZC3A 2EG2A 2WOMB 3B54A 1IM4A 5K8MA 4HT7A 1QTMA 3IBFB 1ZAXA 3AT1B 3LDSA 1F3FA 2IRXA 2L48A 3FGVA 3VAGA 5H9EJ 3VGVA 3CMEN 3IS9A 2ALZA 2Q97A 3AQOA 3L2UA 4TY9A 4YHHF 3SAGA 5LSLA 3BM7A 4FPIA 3NS5A 4ED4A 1NK5A 2ROGA 4DS4A 3JQJA 5TKWA 4YQWA 3RSEA 2AEJA 2WAQD 3SUOA 3OTEA 3FEXB 3R3TA 3MAHA 2RU9A 2RD5C 3HT3A 2W8KA 3TZXA 2V68A 4IJNA 2X3DA 1NPKA 1HLWA 5JUMA 4B02A 4CFCA 1AUSL 4TY8B 1T8EA 3KDNA 1F60B 1KTVA 3CMES 4CIOA 4A8KA 1QQCA 3D2FB 5MLCQ 1VSDA 3DCAA 3HFVA 4ZVTB 2A3JA 4IKAA 2VV5A 2HMIB 1GEHA 2B4PA 4OHYA 3R5CA 2O66A 2CJYB 4AHRA 4AQYJ 2VA2A 4LFAK 3A8EA 4IO9Q 4DTMA 1GTHA 2DNKA 4IH6A 3HOTA 2Y9HA 2XWXA 4ELVA 3SPYA 3TTFA 4ZP6A 2WHOA 4I6AA 4HACB 2FB0A 3MXIA 5ETQA 3OW2M 4DU3A 2HRYA 2YHXA 3TJ8A 2KO1A 3QGIA 3HX9A 3G4SN 2ZH9A 1C4AA 4J2EA 1RAGB 4JI3K 3QATA 2JFDA 3PYGA 1Y11A 3J7YU 3TVYA 3IFEA 2HHHF 2DNOA 4V19S 4WP9A 4OKEA 4ZPVR 1Q8KA 5A8KA 3R9LA 2E66A 2YKNA 1FFSB 3ZZRA 4JKAA 4FLTA 2ACMA 3B78A 3BKUA 4B9LA 1VQPN 2GO8A 1KNZA 3CMAN 4F2SA 3KWMA 5KT3A 4X4TA 2XBPA 4CO4A 2D7SA 3SJJA 1IKWB 1GX6A 2RF2B 2RQ4A 4CE9A 3CFRA 3O2IA 2ZH6A 4F02A 3MR7A 1WC5A 5IC6B 5EX5A 3MMCA 1C1CB 4LR8A 4YDUC 4MKAA 2GMJA 3ET6A 1OY8A 2YKPA 4AQYF 4N56A 3BBCA 1J5OA 2DPJA 1V6HA 2ZBCA 4M7XA 2GIFA 2NXNA 1SQEA 4CCHA 3J8AA 1LNQA 1DTTB 5T7LA 3H98A 3EDRB 1Q53A 1JCFA 2X6SA 4AM7A 4EU0A 4HVJA 4P10A 1AUDA 2VODA 2D9OA 4PKIA 4WP8A 3D7SB 3RB0A 4JI2F 4USUA 1YBUA 3W3DA 4DV6F 2Q66A 4NXMF 3W5ZA 3MN5A 1O5JA 3FZBA 3CJAA 2J6UA 1CLFA 4YOXA 2MMYA 4IQMA 2GV1A 2W2NP 3J7YI 2DR9A 3O9TA 3EGVA 3NWGA 3AAWB 3THPA 1SKWA 5I42A 1Z2ZA 3K17A 3DI6B 1H7WA 4LF7F 2CGLA 3I9V9 3RB3A 2YKAA 2EBGA 2VU5A 1N32J 4DSLA 3UN2A 1RWMB 2AD9A 2O8BA 1X5OA 2DHHA 1TL1A 3HHLA 4UOFA 4OPAA 2OTJS 2ZH7A 2OEJA 4WJBA 5IS2A 5KFAA 1RT5B 4WK3A 2ZM6K 3LP3A 1YTAA 1RDDA 3VAFA 1FRXA 4JI1F 5IQ6A 4OZ2A 3G8SA 3KLFB 1JX4A 2GBZA 2HZVA 5HVHA 3I56S 3O6QA 3HSDA 1VK3A 1S0NA 1UVJA 1YKWA 3THTA 1X4EA 4M3TA 4CJWA 1T05A 2PYLA 1Q79A 1X4DA 3TP2A 4OLPA 1FTRA 3IC1A 4HWIA 4KE5A 2LXIA 4BBYA 3G82B 2H65B 3ISND 2KFZA 5IT9O 2WUSA 1RP5A 3M9NB 3AA8A 2JVRA 2KKHA 1S1WA 2IJRA 2H51B 4JKBA 4HCBA 4WTOB 3NF7A 3JAMY 1VRUA 4F3QA 1XMBA 3AVHA 4OV1A 1HPZA 1T9VA 2C2KB 2Q6BA 1HARA 5HK4A 4FK0A 5HLFA 4LD0A 2GJFA 1N33K 2DGOA 4C8OA 1B4SA 3DYAA 2CPIA 1UA1A 1N48A 2A10A 5IOLA 4ID5B 1S6PB 3JS6A 1DQ9A 5B0CA 4PKGA 3TAMA 4IR9A 4WWSA 4JB8B 1XHXA 3SJHA 5GAGI 2GO9A 2MSTA 2CYYA 3MHYA 4CGHA 2QWNA 4MK8A 4NE9C 4DUZF 2ZM6F 5AE3A 3TA2A 4ECRA 4ES1A 4JS4A 4HUGA 4OJGA 4RW4A 5G4DA 3N4QA 4S0MA 3CCQN 1FEEA 5AQYA 2QMXA 4C7QA 1U7LA 3MPUB 5KG7A 2ZKUA 2CXEA 2HBRB 3JXUA 3D2EA 4FYYB 2JHEA 3TW0A 3QRPA 4RX6A 1N36J 1HKGA 3DLEA 1N6QB 1RHJB 2QT7A 1EAYC 2HK2A 4IFVA 2XHCA 4LBPA 5KQ8A 4EK2A 1REVB 4FXWA 3CDEA 1AYEA 2RUSA 1LW2B 5B0BA 2E1RA 4FWNA 2IVYA 1GT8A 1YIJS 2Z2LA 4DF4A 1CC7A 3IXQA 2EXUA 3ZETB 2IVPA 3QFHA 3FSYA 4B3SJ 3LGHA 5J1NA 4C8KA 2JRSA 4R8UA 4PEOA 2E9ZA 2BJ9A 2C3YA 5M2PA 4H5VA 4PUOA 2R8GA 2YY3A 2G2YA 1AZSA 1K8KA 4LUBA 3MUTP 4DV2J 1ZBIA 1S1UB 1RTJA 4AT1B 2B5JA 1BQNA 5ADZA 4I7FB 1VQ9N 3OHAA 4WYBA 3NGIA 2K3IA 4CO3A 2JGUA 4NRTA 1XR6A 3MMCB 4MFBB 3SV4A 2ZH4A 5KT7A 3DRYA 5KFUA 2PAVA 2PN6A 3T9NA 4ZJOA 3CCUN 4EEYA 4BRKA 4C0OC 4FVUA 3QNOA 4AHCA 1KHVA 2WRMA 2W40A 1HL6A 5AQTA 5KFYA 2CNOB 4PG7A 3ENOA 4A8WA 8AT1B 2CPYA 3TQEA 3RZAA 4O0JA 4DN9A 4N7TA 4CJVA 4Z4IA 4O4GB 4CZLA 2IMWP 2ZHAA 2IPOB 1F0XA 1O0PA 4DR4J 2HVEA 4DV7F 2UUTA 3U1NA 2YWHA 1C0MA 1RT1B 3SCXA 4Y0FA 3I55N 3KK2B 5DG9A 1H0HB 3PYDA 3NAIA 4M63A 4NI2A 5AE2A 4B3MJ 3OR1A 4IDHA 4FJKA 3CJRA 3A3PB 2HBJA 1HI0P 1YI2S 3CC4N 1TFYA 1N34K 9ATCB 5J2NB 1LW0A 4HH0A 2O5DA 3R8YA 5CXTA 4TQRA 4XK8C 4BRHA 4BCAA 1A7GE 3U4LA 5HQ8A 3HVTB 5DLGA 2MKKA 1V3ZA 1EETA 4DV2F 2UYTA 3POTA 1HJRA 3CCWA 2ZBRA 2V8VA 3AVBA 2DIVA 3N6NA 3ZZUA 3CJ3A 2Q1NA 3HHNB 5KT2A 4U67L 1ZTWA 3K0JA 2P9CA 4ZPWR 3OTOJ 2FQQB 3GIJA 4CJQA 3MXJA 3CTRA 4M5HA 3ZX3A 3B82A 4Y0WA 4NLXA 1VRTB 3DM2A 2E2PA 3QLHB 4OKJA 4KHNA 3Q8VA 4OI1A 3BGLA 2D69A 3MN6A 3H59A 2GVZA 4JI5K 4BVPA 3TSUA 4AF1A 1XNQJ 4WQ5A 4FWKA 3ZSWA 1VISA 1QQOA 2M8HA 4FZYA 2YNFA 3ZZPA 1S6OA 1XNRF 4CLTA 5ITHA 1GLLO 4X66F 1TKDA 3HPOA 4LF8K 2X1GA 1WEXA 2BKPA 1VBXA 2OTJN 3P4IA 4IRCA 4A8SA 2W8LA 3NDKA 5C15A 1EARA 1CULA 2W2MP 1DHMA 4WYWA 2APOA 2F8TA 5A8WB 1HBUB 3EGWB 1TUWA 3OPKA 2XNRA 1MWZA 3GCXP 2MKJA 3HCXA 2A2CA 1U6BA 1LWFA 4Z37A 1HNIB 1NDCA 2MQOA 3TYTA 3GE9A 1WC4A 4NA3A 1GOCA 4JHDA 4EHUA 2P1JA 5DG8A 2Z4PA 3UDVA 1UEKA 1Q78A 4HR2A 4L8RB 2E7WA 2EWSA 1XMQF 2E44A 3ZSRA 3ZX0A 2IIRA 1GXUA 4IZ9A 3W2VA 3NLCA 3CE8A 3CIPA 3OYFA 2K1RA 3A12A 3PSFA 3IM8A 2VUGA 4JKEA 3ZTRA 4JKHA 1NM1A 2JNJA 1SC3B 2OP5A 1C1AA 2ZM6J 1SL2A 2QEXS 4IOBA 4DJBA 1T3NA 4B3MF 1RCXB 1JLBB 2YWEA 1DJ0A 2C3UA 3HHLC 2RDDA 3FZFA 4BC5A 5J2PB 4I2QA 1N88A 3AODA 3MFIA 1IKYA 2CUYA 1RNHA 1IBLF 1H3DA 3A8KA 3SQ4A 4H4KC 3F9KA 4OZ0A 1ZS6A 4LSZB 4FSVA 4XO0A 1K0VA 1HBMA 3D1QA 1JLCB 3Q86A 3DLKB 4GVBA 2QK9A 4H5NA 4P2SA 1JWWA 3AY9A 4KJIA 3AB2B 2K2PA 4L72B 1RTJB 1ZZFA 5A2QU 1URNA 1A0OB 2KB2A 1XMQJ 3ULEA 1CXQA 5D4OA 4HL9A 4GV9A 1C0UA 1EKSA 2COLA 1UWAA 4OYZA 3OLBA 3D7EO 2YJEA 2GUIA 3MEEB 4KO0A 3AY0A 2ERRA 4R25A 2R7XA 2CJ9A 1RACB 1ULRA 3CCZA 3I5BA 1NDPA 4ZVQB 2VBXA 1VBYA 4CGGA 3V2UC 5EVZA 2RN2A 2KHCA 1YVFA 3GIIA 3BGRA 3NF6A 3KUGA 4CYUA 5ETMA 3DC2A 2NUUG 5JMNA 1RB0A 3KK2A 4N76A 2ZVSA 4CJLA 4CLUA 1J6ZA 1S1TA 4JI1K 4DFKA 2V4QA 1VQ8S 1N32F 2HQFA 4PQUB 2LP4A 5LMNF 3ZSOA 3IRXB 3LANA 3QO9B 3SBMA 4I6MB 1XC9A 1RDWX 3CDWA 1GAOA 4Y2IA 4ILJA 3BKFA 2GX9A 4BRMA 5J2NA 2NUHA 3TAGA 2AJFE 4ALZA 4JKGA 2KKZA 1T95A 4NX9A 2CNLB 3I8DA 4W98A 4CTAA 3JYTA 3KLGA 4NCGB 3THXB 5C24A 1IUJA 1WKKA 3FC9A 5AQKA 5A8RB 4BG8A 1E6YB 3VGKA 1P90A 1RBOB 3NOGA 2I1RA 4JS5A 3T1YJ 4DUZK 2P9KA 4MIBA 3CQXA 4KH5A 5LXYA 5CHIA 1WC1A 5HSPA 1ATSA 2QWOA 4IH5A 3D68A 3B4MA 2ZFHA 2G2OA 4LF4J 3OUYA 2IM1A 4KHUA 2RHKA 5L1LA 1NJIO 2QLJB 2FVPA 3A5NC 4DV2K 2P5OA 2O8DB 1KFSA 2FJXA 4ZOSA 5C2DA 1HR0J 3T41A 4MKYA 1G2EA 2C3PA 1TL5A 4RUCA 5HRPA 4F4WA 3DKDA 4KHMA 3O1LA 5EWGA 4DTNA 3QJLA 3CD7A 3J80U 3PIOQ 4JV1A 3C7NA 4K5SA 1BMQB 4E98A 2ZDPA 3AO2A 4ED3A 3RSEB 1TKXA 4RBTA 1J54A 2E5JA 3CC7N 3R2CJ 4PL7A 2YNFB 5F8NA 2KRBA 1T6CA 1TUGB 4URSA 3SCIE 3TEHB 1V3RA 4R0EA 1CLQA 1HI1A 3DLLL 5KFOA 3SBGA 5BYQA 4RG8A 1S48A 2HFOA 1GOBA 2BQUA 1LAWA 1YZ6A 3K9KA 3KTQA 4JV5K 2O8FB 1ZBLA 4UOCA 3BF4A 4BREA 2JX2A 1KN6A 1MW7A 2W1BA 2UUAJ 4OLBA 3RR7A 4HI2A 2HQCA 3S3MA 2NRVA 1TL7A 3LWMA 1U24A 4C8ZA 3DGPB 2NRZA 1WDTA 3T6JA 3D2FA 4AHTA 4F3OA 2GQQA 2VPYB 3UVJB 3I6PA 2HHUA 5FD1A 4CQ1A 3O44A 4CNZA 1QQNA 2UUBJ 1M5VC 1N56A 3G86A 1EX8A 5A8KB 2XB2D 4DR7F 3MUVP 1EP4A 4FP9A 4P71A 4OPKA 2LFVA 5HQMA 2XLIA 3QEPA 4E19A 3BKTA 1ILYA 4DPOA 1T3OA 2OFGX 2BBEA 2C1EB 5D0GA 3ENAA 2IVMA 3QJJA 3WDOA 1CS4A 3BSOA 1SL1A 3ITHB 1S10A 3H08A 2QN6B 4ZDNA 1T3VA 2A1RA 1FE0A 1FWLA 5F0XA 3C8YA 4D3HA 1R31A 4DPYA 3SSRA 2AIRB 2FGOA 3MAAB 4DCJB 3E8OA 4CZJA 1NNEA 4IDKA 4ECVA 1FTCA 3CT9A 2NNWA 2O4GA 4CESA 3MWBA 3QEIA 4LF1A 1XBWA 1BQXA 4YDDB 2UXDF 2WONA 4PA1A 4YOTA 1HBUA 4G65A 1H2UX 1OVYA 1YDLA 3KNGA 3SLCA 2ZBQA 4ZVRB 1L3KA 2UUBF 3H2LA 4BR5A 4NASA 4YHHK 5KFTA 4USTA 5DM7Q 3VEOA 1FXLA 2WVDA 4CJ7A 5C2FA 2QTWA 3LF0A 3J7A1 2LDYA 4XDDA 4PR6A 1HQ2A 4RL1A 4WFAL 1BQMA 1M1GA 4DLEA 5DRKA 4DHYA 2CG8A 1TYQB 2K1RB 4P2MA 1HR0F 3TSQA 1HIYA 1RDCA 5E3PA 2OCEA 1J9AA 1M5HA 1SH2A 3CC2S 1RAOA 4PXEA 1CZAN 3D54A 4M3ZA 1RAFB 1LV5A 4NLRA 3QETA 2D9PA 3C19A 4J9UE 4KGKA 2HLUA 4MLHA 2OI2A 4PQAA 4KKOA 4L74A 2RKIB 2OIHA 3MM6B 5AJ3J 3PEJA 3GBTA 4A5AA 1WHXA 4A48A 3QYYA 2QLBB 3R7BB 2XO6A 3O3FA 4LH5A 3SEOA 1S6UA 2RUGA 1HA1A 2EKYA 4QOTA 3DOLB 1BU6O 3T5JA 1R6YA 2R3VA 4NZ7A 5BPLA 1RT6A 4JK8A 2XGQA 3ZXWA 1TVRB 2LU1A 1GFWB 2ZDOA 4OJHA 4OKKA 2BDPA 1JCGA 2W2PP 3CJ4A 3GU0A 2J0WA 3JTOA 4AUKA 4FJ5A 2F4VJ 1APSA 1GLDG 2DNPA 2VC0A 4MYTA 5T41A 4FO0A 3KLFA 5E33A 5EY4A 4RWTA 5KI6A 3ZT3A 4FM0A 3JSRA 3GR1A 4KPCA 2JLEA 1VQSA 1K8AT 4E3SA 1RQ0A 3PYEA 4YDUA 3HO1A 3PW2A 2IM3A 2G0JA 2QFIA 5E3AA 3UKUA 3PHTA 5IQQA 2PY5A 3ZT0A 4X4VA 3D67A 1JLFB 2OKQA 1TL3B 4HTLA 4FW1A 3IRXA 3EN9A 2VB6A 4O3PA 2NXCA 4M8LA 4WPAA 5IC4B 1WHYA 5F0WA 3CF5L 1R0AB 5IV3A 4E7JA 4CO1A 4FVCA 1NKCA 1URRA 4WCEQ 2LCWA 3V6HA 4JEPA 3QERA 3QMQA 3TZWA 1NZ8A 3D6MB 2G8KA 3C6TB 2JL9A 3Q8RB 3VGMA 5CYMB 4DPWA 4A8YA 3CCSS 2M88A 4FJIA 5JVGL 2HZCA 3D9BA 4YB5A 2ZHBA 3N4WA 2ASMA 3ENQA 3H4DA 4L3NA 2QWMA 1HNZJ 4JI7F 3ZZZA 1NJYA 1KQSR 3L2QA 4Z94A 1RT5A 1H7XA 2CPZA 3CIMA 2M4MA 4OMFG 4DX6A 2VZ9A 4WQ4A 2XMJA 3MPYA 5CCMA 2MQLA 2PEBA 4ZP8A 5IM0B 5D3GB 1MROB 1S97A 3M8QB 2H4YB 3VF2A 3OYCA 2W41A 2MKSA 3H5YA 5D15A 4MFBA 1T05B 3N9UC 4DZDA 3ILLA 4CIGA 2M0GB 4FPAA 2JLGA 4MH8A 3CQ8A 3VTHA 3MTKA 1N34F 4CO0A 3H6EA 1QD1A 3VETA 2LVWA 2U1AA 4U7BA 5BN9A 4E0DA 3IMXA 1TAUA 3C65A 5F8HA 5LMNK 1HNWJ 1W0HA 1IKXB 4K4VA 3NH1A 3W3SA 2YXLA 1KQFB 1X9MA 3LDOA 1XTZA 4F0HA 1EB0A 4FYDA 4FWQA 4IO1A 4ES3A 2HSTA 5TKYA 3O9SA 1T44A 3VQ6A 1BHLA 4K25A 3EYZA 4JRPA 4B9TA 4OHXA 1ATRA 1VCTA 1CXUA 4DV1F 1RAHB 1HUXA 2ITGA 1T9XA 3DRRB 4NI2B 4IH7A 5DM6L 5IT9Y 1WG5A 3SQGA 1UETA 4O8KA 3KKSA 3ETMA 2XCAA 4Q2MA 1ZBSA 3VQEA 1VK8A 2PFUA 4IG0B 5BRFA 3QGGA 2E5IA 4DL5A 3DXBA 5E84A 1WLJA 2HQDA 2IDEA 1BE4A 3CO9A 1KXPA 2JWKA 1HYSB 3T5LA 1U2CA 4LFBK 3AVMA 4GO5X 3OBWA 2KZZA 1YAGA 2VFSA 3LP1B 2ILYA 4OYWA 3VQSA 2GW8A 1RDRA 3BV8A 1RT7A 3CJKA 3AJDA 3I56N 4W5RA 1OQ3A 3PZPA 3IM9A 4YEAA 3HPHA 2KI2A 4PYAA 1HKCA 3UN5A 2Z2YB 5GAEU 1SC4B 3FMBA 1OQ6A 5AJ3F 2G8FA 2QIFA 3FQKA 2LSNA 2R2SA 3JSYA 2Z0GA 5JICA 3IKMA 5IT4A 1KEKA 4X66J 2JJ4D 1EETB 2HGMA 2MB0B 1FDDA 2E5GA 3EL2A 2B9EA 3BH7B 1VQLS 1WOSA 1A5WA 4CLFA 4ZPTR 4LF8J 3G9CA 4ENOA 4I7FA 2FLOA 1B9FA 4B3TK 3AARA 3FVYA 4LY7A 3GQCA 2V50A 3MD1A 4FOIA 4RNMA 1T94A 4AXJA 1M1HA 3HSZA 4QYRA 4QIGA 3MWTA 3OTBA 4QBUA 5F3TA 1FKAF 4JI6K 2PSZA 3MR3A 4MAKA 2HFNA 1FHTA 2GCFA 3M6VA 1H72C 4YNQA 3LW5C 3OYJA 2XYPB 1RUSA 5E41A 5IWAK 2BZ2A 4QZVB 5FIIA 5BRDA 2IGIA 3MX2A 3KJNB 2QX0A 2YKMB 4HHTA 5FPMA 2VFTA 4JI2J 3MF5A 3HVTA 2XSJB 5KFPA 1NEEA 5KGWA 1U8WA 1RHQB 2KHDA 4LF8F 3PRVA 2VGNA 2CJKA 2WB1D 3W2VB 3DXKA 3VEXA 1UVLA 3CPEA 3TX0A 1T02A 4B3MK 4IOAQ 1F2HA 3ILIA 1CQMA 3HMJG 4BC7A 4DU8A 4LF7J 4CERA 4M7YA 4FYVB 1NKEA 3HZEA 3D2EB 5L39A 3GJQB 3VZHA 3IG1A 3M8RA 2BJ8A 2ZWOA 4M5KA 2W4CA 1RJJA 2E6MA 2F9JA 3G10A 4IOCL 4RW8A 2RILA 1T11A 1GQEA 3ZT2A 3MMAB 3FCWA 3AQPA 1ASUA 2PGCA 1IR1A 1BOTO 4JI6F 1DEJA 1CPZA 2Y8WA 5BR8K 4RW9B 4GKKK 4ID8A 4KH4A 2RQKA 1PSDA 1GNKA 3ZSZA 1X3MA 1ICEB 4JI3J 2D0AA 4PUOB 2V2KA 1SJ3P 1WKLA 2GFFA 2OEMA 1S4FA 1FD8A 2UZAA 1VRQC 3TI0A 2XG8A 4WK1A 3CD5A 1U6FA 3RWUA 1XEZA 3TAQA 5AR0A 4UQTA 1MSWD 4JI0K 4O3NA 4OL8A 3EXYA 2IJNA 3VQDA 3FBFA 2LU2A 3WXJA 3KJQB 4EWTA 3GIMA 5KPRA 1FCAA 4EYHB 3CDAA 3U3YA 2LMIA 2FXUA 1KVCA 4CP5A 4DV7K 4YOWA 2AEFA 2CG4A 3RW7A 3FSIA 1VSEA 3P5JA 2FZGB 1YGYA 1BWVA 3ONQA 1S1TB 4MK7A 3F9MA 3KLHA 1Q86T 4F0MA 5J2QB 4HTJA 1WBDA 4PPDA 4WFNQ 1UJ6A 4L6V3 3RRKA 4E8UA 1YT3A 2AKWB 4QWAA 1YJWN 4PXBA 5D77A 3J7Z5 1P9QC 3WIVA 3CERA 3C6TA 5HJXA 3FZLA 1LQ9A 1TGOA 1SIZA 4GKJK 1PILA 3OR1B 3KLEB 2P6SA 2I0XA 4ETZA 3MCOA 3K0SA 1TZ0A 5JMVA 1I51B 4ED0A 2VG7A 1SH3A 1TKZB 2OTLN 3EZWA 4JI8K 3IAYA 5JXSA 1JMTA 3HD2A 3HHEA 5KRTA 3FZ2A 1G1XA 4LF4K 3UFCX 1S59A 5I42B 2YJFA 8RUCA 2OZSA 2DNYA 4CLSA 4ZLJA 4K4WA 4LQ9A 1N32K 2XMAA 1VJWA 2D74B 4L75A 1TAQA 4C1NI 5C2GA 1R89A 2E7XA 4P74A 1H2TZ 3W65A 4CGDA 1U0HB 4RTFD 2K06A 5ADXH 2CQHA 4Q5VA 5KFGA 3TUZC 3LGNA 2XCPA 5K9FA 4RNFA 1SZ2A 4NB4A 2MZRA 4O0IA 3K57A 2MY7A 2UXDJ 4DMNA 1X4CA 3OYHA 1RWXB 5A8RA 2B7BB 3NEKA 1GLCG 3H5UA 3OL7A 2J4RA 4M5IA 1QZ5A 3NG8A 5BR9A 1X1PA 1RWVB 4H5WA 4KRWA 3I5CA 2FUG9 5LMNJ 4YOVA 4HVZA 3PIPQ 4Y00A 1K73O 4URGA 2MQNA 3E9PA 1V3SA 4M5NA 4KHPJ 2ZZMA 3WNHA 2KU7A 2DXEA 3HSGA 5KFHA 3ULEB 2MLYA 4Q8FA 4DS5A 4CW7B 5GMKa 3JSBA 1I3AA 4NLUA 1F9EB 2QA4G 4QCLA 4CBUA 3U9ZA 1KAZA 4FJNA 3QIPB 2K3KA 1CSJA 4ECSA 3CD6N 1UCNA 3X3UA 4CTAB 3IWLA 5CCLA 3BSCA 3T69A 4CEBA 5J1EA 3H1QA 3MFHA 1LWFB 3IR5B 1VQLN 4BRFA 3PR4A 3R27A 5J1PA 4J8FA 1HW9A 2BJEA 3HHLD 1G7CB 5D0HA 2CH6A 1OSDA 4PWUA 1RSCA 3QEXA 2PE8A 4Y6IA 2IVOA 2GUPA 3L09A 3EJMA 1X0FA 4CJPA 4AD6A 2R8KA 4OYMA 2ZQBA 5KPTA 4UF4A 3EWGA 4Y2KA 4E7IA 1FWKA 1Q18A 2DY1A 3FBCA 2DGXA 4EZ6A 1QVFR 1RAAB 3AO3A 3FBBA 3VPZA 1U49A 3JS9A 4XH4A 5CH7B 1KFDA 3H0PA 2DCUB 4USIA 3OUYB 2WZ1A 2H1YA 5I9EB 1PJ6A 1JJ2M 1NMEB 4EGLA 4DU1A 2CJAA 4A8QA 1RTDA 3IGNA 3FLCO 2V34A 2YWFA 3BYPA 4FZZA 3KK1A 3M8ZA 1Y4ZB 1NRKA 3H3NO 4BRNA 5I3UA 4MKVA 2OHDA 1D9FA 2W42A 3T7ZA 4JI3F 4AXIA 4KFBA 2NYHA 4JI6J 4OI2A 2QG9B 3VEYA 2VC1A 2CQCA 3TQ1A 2FVQA 1RZMA 3ZZTA 3HSTB 4B9MA 1S1VB 4W5NA 1YHQS 4ZVFA 3NY0A 1Y7PA 4C0HA 3KVGA 5RUBA 3GYGA 2PZSA 5HBMA 4GKJF 4XPCA 1VQ4N 1BIZA 3H90A 3PCOB 2WONB 1CJVA 2KVQE 5F0UA 2BJDA 4CO5A 2CQIA 4B1UB 1XQIA 4MKBA 2ZNZA 4J9QA 3DDKA 2CPEA 2NRTA 2C2OB 2DIUA 2BW7A 1ZBUA 1HKAA 5M1FA 2YX4A 3KJVA 4HDHA 3KLEA 1N6QA 3WXKA 3ITHA 1NK4A 4KY3A 1HFEL 4PKDB 3I33A 2ZC4A 3BBBA 3MMAA 1REVA 4IFEA 4OZNA 4RUBA 1RCHA 2R9LA 2ASPA 1XI1A 1F5AA 4ANEA 3THXA 2CQ0A 5JVHL 3QAUA 3GFHA 3Q8QB 1HHQA 3E9OA 4DV6J 4DQSA 4DI6A 3GG4A 4Y65A 4HH1A 3CCQS 1P6TA 4QYZK 2RH3A 3WNGA 3CC7S 4JBCA 2G2ZA 4MIAA 2V69A 3OJSA 1Q8LA 7AT1B 4DOZA 3HDSA 3UKRB 3F41A 3NS7B 1BLUA 2HVDA 2HNDB 2MJNA 1GX5A 2PD1A 4R0JA 1FKPA 3ELHA 4WKRA 1HQUB 3FZHA 2FJAB 2F40A 2ZWPA 3H8YA 4Z4FA 3E51A 3DLBA 4CT9A 4IDKB 4C9DA 3O3HA 1TVRA 4OQJA 1NSAA 3RBXA 4BG9A 3FR0A 2GVZB 2ZJRL 3I96A 4DQPA 2Q1LA 4NEYA 4ELUA 1YJNS 4DV7J 2OANA 2RRAA 4FJMA 4K7QA 3SK3A 2J8AA 3L95X 2XTJP 2HBKA 5BRHA 4LF5F 1TL3A 4J91A 4ZCLA 4FDFA 5AXKA 1NGCA 3CYMA 2XQCA 4JV5F 3J81U 4AHUA 1WWHA 4BLGA 5M1NA 2DKOB 2OPPA 2HNZA 1OMSA 1QSLA 3K89A 1TQLA 1RDBA 2HQ3A 2FC0A 2BGGA 3TJAA 1BWFO 1KVAA 4H0YB 3FQLA 4GKJJ 1JLEA 4EYIB 1XK8A 4G9ZA 2V6AA 1R8CA 3AO1A 3CJQA 3KNAA 1NB2A 1ZPWX 2ZH3A 1VC5A 2G4BA 2K8GA 1N4LA 3U8XA 3IBCB 2XZTB 4NLYA 3OW2R 4OZ3A 1N5YB 3ZZYA 3D6FB 3PW5A 4DR3K 3UI3A 2RNEA 2IBKA 3RMAA 2DT9A 4ITSA 2ZOMA 1A5VA 4RNNA 1RBAA 3POTB 2F9WA 1UJ5A 1SAZA 1T7PA 4EBDA 2EK6A 4EBEA 2Z8QA 1Z25A 3UR3C 1PYSB 1KDNA 4X84A 3N6LA 3R5GA 2IA6A 4KTWA 3KIOA 4LBHA 1VQ7S 4K8RA 3PUFA 2YNGB 4LSNA 2F63A 1ZC6A 3UPFA 3A2FA 2PFDA 4N47A 1MROA 1I5OB 4NRUA 4ZLPA 2W6LA 4BWJA 4MDBA 3GIRA 3ICLA 5HANA 2E5LF 4K2XA 2J7KA 1YSJA 3CCLN 3EGNA 3AVJA 3I8BA 2VWJA 4CJSA 4FBUA 4PRFA 3FSXA 3EPIA 1QAYA 1ROFA 1WB9A 2IC3B 3KK1B 2DPIA 1HHSA 1U2FA 4PPZA 3SI6A 5I3UB 2ALYB 1MU2B 1VSKA 4NZ0A 3LDLA 2DR8A 2ZH2A 1IO2A 3OFEA 4JI0F 4WE1A 1SC1B 1DKGD 4KBIA 4YUDA 2Q31A 4WQ4C 2QWQA 3K59A 5D3GA 4TU9A 4NYNA 1OJ4A 4C1NK 3P96A 2CPDA 1SCJB 2XI3A 4DX8H 1WUAA 2HHXA 2GMLA 3QZ7A 1M0SA 3V1RA 3JSMA 1IBMF 3DRSB 4OZJA 1ZM9A 3HLUA 2EBEA 1BC6A 1S49A 2V8PA 1JLGA 3RGIA 4B8CA 3NGYA 2BACA 3A4TA 1HNIA 4P2FA 1Z6RA 3G4SS 2EG1A 4FK4A 2DXFA 4PG4A 2XY7A 3K2PA 5ELZA 3PV8A 4K0KK 3AXMA 4O44B 1JNRB 4H5RA 2XYHB 3PM9A 2PIIA 3D1HA 4PXCA 3EVMA 4GV3A 1U1QA 4ZIVA 4ECQA 5F2RA 5DGBA 3MMBB 3MM8A 3AH6A 2VICA 4BGAA 3TEGA 2UUAF 4H8KA 2F8HA 1F5CA 2E8AA 4H54A 4ILLA 1VQKN 3K5LA 2BKNA 3CJKB 2HQIA 2FD2A 3VA0A 5EOYA 2E2OA 1VQ9S 3OYIA 4DR2K 1ZBFA 5KFZA 3W2WA 1GMWD 4DR7J 4KGVB 1KQKA 2AJ4A 4FS2A 3OHRA 3VENA 5LSOA 2RRNA 2DNQA 4KHRA 1ZTTA 2JEFA 4X66K 2IAJB 4G1QA 2HS0A 2RPIA 4AHVA 3OTCA 4I9LA 2HHQA 4ZVSB 3D3BJ 2WC9A 3OSNA 3D45A 4U96A 1V9OA 2P9NB 4DPXA 3PTWA 3D0PA 1Z4UA 4EUVA 2UVRA 2ZVIA 3HSJA 3OL9A 5MAOA 3IA0A 2AZ1A 4IFYB 1N5QA 1JIHA 4DBQA 4F4KA 3W1YC 3VQ7A 2MQQA 1LCUA 3MCPA 3DU6A 3VEVA 2L41A 1RXOB 3KG0A 2E9TA 1ELOA 1UPMB 5BYRA 3CCRS 2W9CA 3LPTA 4BRAA 1WKJA 2E1CA 1HR0K 3CJ7A 4DV4F 1U45A 1XR5A 2E9RX 4USMA 2VOPA 4FJGA 1JLAA 4RU2A 1K44A 4H4MB 4P2XA 1BWEA 2FZCB 1YRXA 2R8JA 4QU7A 1S1XA 3MPWA 4B1YB 2XULA 3TUJC 1DY3A 4L3QA 1WBBA 2F8MA 1LKZA 3C2PA 3MPVA 2MZ1A 2UV8A 2WTFA 4H0VB 3V6DB 4JV5J 3UCZP 2V67A 1D09B 4H4OA 3VQ4A 3HT0A 2EC0A 3R7NB 2GHVC 5CYJA 1RU1A 4AM6A 1VLYA 2HVHA 3HP6A 1N8RO 4F0KA 3O9RA 2FVRA 2BOPA 4OZLA 3HHKA 1FRLA 4WFXA 1SS6A 2YKMA 2V0NA 4NCGA 1BG3A 1HD0A 5DDOC 2B9XA 2XLKA 3D0HE 2ASYA 2KJVA 2QGFB 1NJWA 5DO2A 2XLJA 1FKOA 2W9BA 2EI5A 2KLAA 4ISEA 2UUBK 3CCSN 5H1SV 1D0EA 4GVLA 2MKIA 1WC0A 3AO5A 2VF3A 4CHNA 3UB5A 3AD7C 2EX3A 2V5HG 1HNZF 4OYOA 4M5LA 1DT9A 4FYXB 1BD6A 2BJ7A 3AB4B 3CCVN 3P1GA 5G0RA 3DXMB 1S76D 4IO8A 3EE9A 5CD4A 1X4BA 2QLXA 3DFEA 2YTCA 2J76E 3EPGA 3AOAA 5LJ5Y 4UOGA 3GG1A 3M4XA 1SUQB 3TWHA 2ZJQQ 3NHGA 1X31C 4EMDA 2ZUAA 1HBNA 3AD8C 2ZE2B 1I3OB 4YY3J 2KH9A 2HAIA 3D4JA 1U2VB 1YZ7A 1WSVA 2WSFC 5A0YB 3ULDA 3SMZA 1EWQA 1GTEA 2D41A 1YIJN 5DDRC 5LM7E 2GVDA 2FJVA 3LUYA 1JLEB 4LVNP 1AT1B 2WVCA 2DH9A 4K0KF 1RFQA 3GL1A 4K8ZA 1FA0A 2OA8A 1JLGB 1S9GB 3SUNA 1NWKA 3LH2S 4DG1A 2W2OP 1EQ0A 2H48B 4J9RA 1G6BA 3GLJA 3CSKA 5IV4A 2IFXA 1JQGA 3CFPA 2J9DE 2ZJPQ 2XMTA 2VFVA 4DR3J 2X1BA 4DR1K 3GYXB 1UAXA 2CVEA 2O1PA 3L4BC 2CJQA 3MEGA 1VSHA 4RU9A 4JKFA 3I32A 1X4GA 3T5KA 3DLGB 4LFBF 1JXVA 3C16A 2PMZD 1Q95G 4RCHA 2KTQA 2ATQA 2RDIA 2HSEB 2MXYA 3W8GA 1I94J 1LFPA 3SUQA 3VZIA 2HYIB 4OIXA 2E20A 5KG4A 3U7JA 4LF9F 5AQWA 4X4QA 3LZJA 1UEVA 4F4AA 3Q8SB 3FFKB 2QI2A 1Z26A 5KOXA 5B09A 5LMUK 3FNNA 2NPIA 1Q9XA 2F4FA 2DITA 4C11A 1RILA 1HBOA 1YJVA 3OVSA 4GY2B 4QPTA 3IG1B 4ZPCA 4OGCA 4FLXA 2P8IA 3A8YA 5AJ3K 5LJ3Y 1OIAA 1GXTA 2FHMA 4PYDA 1VBKA 2DEJA 2LECA 2H3EB 3QO9A 4I6MA 5HL7L 4CEEA 1QS4A 3AVNA 5A76A 2J8SA 4CBXA 4FF2A 1VRUB 1R59O 2D1KA 1N5TA 4NLQA 4ETXA 4OJ1A 4TLRA 4UW2A 2G9OA 3I4HX 5BR8J 1LWCA 4DCOB 2LKZA 3THWB 3C15A 3CD6S 4I1TA 2UU9K 2MTLA 2WTUA 4ZPAA 4OPHA 4CLWA 3SMPA 3IAM9 3OJUA 4NA1A 1VQNN 2BE9B 2P9PA 3TZYA 4URQU 4LF4F 1KLNA 4DTSA 4M1KA 4X65J 2F96A 1WSFA 2O67A 1KVKA 2YHYA 4LF9K 4J90A 4B9SA 5KOWA 3DOKB 3NRBA 1VBZA 2FVSA 3C7NB 4LC9B 2XS5A 2UP1A 1N0UA 2QMWA 3VQCA 3OYLA 2QSWA 1RBLA 4KGMA 2PYJA 4HDGA 1QVGM 3BEGB 3FRYA 2SXLA 3BN4A 2KL8A 3KK7A 2VGMA 2J0XA 4EO6A 4KR0B 3O9QA 4IQXA 1K1QA 4DSKA 2Y8YA 2CPXA 1DTQA 2GC8A 2JDJA 2E5LK 4L3KA 4QIEA 2FLPA 3OL8A 3VQBA 1Q1KA 2LEAA 5KG1A 2P6TA 5KFEA 3MM6A 4JK9A 3ZLJA 3KWGA 4DV3K 3OT9A 3F73A 1FESA 2OZMA 2AGQA 3KZBA 1TR0A 1HI8A 5HQLA 3G25A 4ZTFA 2AX0A 4LRFA 3M9MB 4DV5F 3CM6A 1SVDA 1UJ4A 1T6DA 2HAFA 3P5BP 4NCBA 3KK3B 4YR2A 4MLEA 4USHA 1RTIA 3S8SA 4CFDA 1KVJA 1T03A 1WEZA 2M52A 2Z30B 1R8BA 2VQEK 2FBVA 2XZDB 4YR3A 3ENBA 5ETRA 5AQFA 5AQPA 4DMZA 3GV8B 4ER8A 4PL8A 2Q0RA 1CJKB 2FBXA 3J7AP 4FZXC 2OUGA 4OX7A 2V4JB 1Q5YA 4OHVA 3UR0A 3QIPA 4LVOP 1I1GA 3OS0A 1NGGA 5HROA 4P7VA 2H5IB 5EU7A 2BANA 4P52A 2ADBA 5KAKA 4RJVA 3CMAS 4M5GA 4P75A 4RBUA 3KD5E 5F3ZA 4AL7A 2HHVA 1U2VA 3NNAA 2ZBPA 3W0LA 2XS2A 3AA2A 3M2VB 3WEEB 1JB0C 1HNWK 2IOCA 4FWOA 1Q7LB 4JI5F 2VASA 1IKXA 4ID1A 2NZCA 4C98A 2BE2A 4Y34A 1NH8A 2RT3A 3RW6A 4IUFA 2RS8A 1NH7A 4F2RA 3OR2B 1KONA 4WIIA 1B7YB 4FWMA 1N8RT 1RCOB 3D28A 5FPEA 3J7AN 5LMUF 4Z4EA 3I87A 5KG2A 2VQFK 5GADU 1RT2A 1TTHB 1TKTB 2FLNA 4RW6B 1Q81T 1EHWA 2A3ZA 3DGVA 4K4UA 4OYAA 3VAKA 2F8SA 3UDCA 1FFWB 4W5TA 1RGVA 1ZOTA 1YTYA 4EAHD 3HJVA 2EFVA 1D3WA 1KOOA 4M3XA 5FRNA 3Q8YA 2MKYA 3BO3A 4K4YA 2DR6A 4LFBJ 5AT1B 3QFPA 5AFUH 3WQPA 4FYWB 2G0CA 3MM9B 1FE4A 3FGUA 4JN4A 1TKZA 3R5JB 3LL3A 3QRRA 5CQGA 1HBOB 3QLHA 2C2RA 4GW6A 1RBRA 2HW3A 4DCPB 2AYBA 1SJFA 4Y2CA 5E3CA 2HKEA 4LQ3A 5KFWA 2MSSA 4A5BA 1IKWA 3RB4A 4DXLA 4DU7A 1NZAA 3M30A 3BR8A 4DL4A 4GRSA 2GTDA 2FYXA 4ZVGA 7FD1A 4CJRA 1YQHA 2J5AA 2VWBA 2ATLA 3M05A 1VQMN 1XNQF 1NG9A 4A2BA 3C95A 5K20B 2X1FA 4GMJB 4L76A 3CC4S 3RBEA 3GJTB 3MXMA 4I69A 3KLIA 3RAMA 4DFPA 4CEQA 2Z1IA 1VHFA 2A18A 4IRKA 3AD9C 1ZA2B 2O8EB 3UNGC 2V8HA 3I0SB 2IHR1 3MEDA 4B3TJ 1S72N 1UW9A 2D4WA 3CW2C 5EWFA 3QB0A 1D9AA 1WI8A 5E7OB 2YPYA 3ZYYX 3MDQA 1YWXA 2DY4A 3TR8A 3MAQA 4DDFA 4WFBL 3AA4A 5CE3A 5KG3A 5IWAJ 3OBIA 3CCRN 2I38A 1Z05A 2W6KA 3F2KA 2QWRA 2ZBIA 3U1MA 4EFAC 4BRCA 2F7VA 1I94K 1R6VA 2YKNB 4LFAF 3TX8A 1U25A 2JLFA 4CIFA 4ECYA 1LOUA 2BVZA 4F04B 5EXWA 4KRFA 4YOUA 2VJUA 4HACA 5LMUJ 1S4EA 4ZHRB 3CFOA 1B0PA 3DNCA 4OX8A 1VSJA 1GLEG 3NMUA 1B64A 2Y1RI 3OBYA 3NF9A 4U7UK 5SUHA 5C5JA 3MXHP 4RUHA 3UKRA 2AYGA 2FHOB 4F50A 4NXMJ 4LF5J 3VQQA 3I82A 3QT7A 2FC8A 2NZ4A 2N7CA 2YX6A 2AP6A 4YY3F 2C2EA 1FNXH 1N5YA 3K8WA 5HMXA 4TXSA 4IOXA 3KHLA 4M41A 1PAUB 2J6SA 3T3FA 1ACMB 3QDKA 4I56A 4RWXA 4M42A 5HMWA 1FRHA 2LEBA 4ECTA 2DFFA 1TV6B 2GAHC 4LF7K 3MEKA 1XQSC 4FLUA 2HFSA 4BRIA 1NSKL 3BGUA 3M6UA 3VN5A 1GLFO 1F5BA 1OWXA 2WW4A 2A41A 2V9WA 3M2UA 1AFIA 3NGZA 4ELTA 1WAJA 5AQXA 2ROPA 3R6LB 3S3NA 4CJTA 4DR1F 2HB5A 2OSQA 3L2RA 1HNVA 1VQYA 2B3TB 4BDPA 3HBTA 2FJEB 3Q8UA 4OO1J 3J81Y 5ETSA 3VF0B 1R0CB 1HKBA 1KWMA 4X65K 3BR9A 2NLXA 2IRUA 1G15A 3HTVA 1EJ7L 3R1HA 1V4TA 5AZJA 3BZKA 3C6AA 4F36A 5KFNA 3CD0A 3M2VA 4PG8A 4B3OB 3SMSA 2VJVA 2H54B 2CQ4A 3HD1A 2B4JA 5F8MA 2HMPA 5B8HA 3TABA 3KD1E 2CQ3A 1S7HA 2BXJA 1M1KO 1GK8A 4RUAA 5KFIA 3WQUA 2Y0SD 3V9ZA 1XHZA 4PXDA 2XS7A 1B70B 4IO9L 4D3GA 3VQ8A 3PXGa 1OO0B 1N36F 4CLZA 2HK3A 4KYZA 3EKSA 4DL7A 2ZITA 1C0FA 3EM1A 2E5LJ 4F7VA 3RRHA 2HMIA 3VMFB 2DNNA 4CHYA 4DUTA 2MYFA 4UZBA 4USVA 2OFHX 4CD1A 1FWPA 4CH0S 4O23A 2YNGA 2C28A 2DFEA 3O4NA 2IVNA 1Q7YT 4X4UA 1WEYA 1E6VB 6FD1A 2BM1A 1FX2A 1J5EJ 2M7SA 4DB3A 2YI1A 4KB0A 1RBUA 3U3GA 3WXLA 2CGJA 4NLPA 4NYFA 4G1QB 4K4ZA 5D0EA 3VVUA 4GVMA 1OH6A 2O8CB 3M3ZA 1KVBA 1RAEB 1ZAWA 4WZMA 3MK6A 2AEMA 2V7YA 3G96A 4ED8A 3OHBA 4X64J 5DLFA 4C48A 1WORA 4LSNB 3LPEA 1JL1A 4RW9A 1GMUA 4J7CA 1IBLK 4JK7A 3OYAA 1YJNN 4W5OA 3QNWB 3T5HA 3DYAB 3MGJA 3M5RA 3VF6A 4USKA 2F5GA 4KGZB 4LJMA 5CAAA 4J37A 2RE2A 1UKUA 2FY8A 3R7SB 5L1JA 3AOCA 2D3ZA 1WNSA 5F9LA 1QDUB 4Q2LA 3ET6B 4B3RJ 1AXQA 1S1XB 1TELA 1WC6A 3ZEUA 3O9UA 3G6ES 1OY9A 3PRDA 4Y2AA 2YNHB 3CI5A 2LDIA 2KG1A 3FEZA 1BGXT 4DL2A 2VQFJ 1Q9YA 2VPWB 1MDUB 5GAEI 1RA7A 1VAZA 1JLQB 2XM3A 5FLXY 4C0BA 3SXLA 1D9DA 4MK9A 3KWIA 3NP5A 2ROEA 2DGTA 2FJBB 1UMJA 4O44A 4HT5A 3TA1A 3BJYA 2AP1A 2GIQA 3DRPA 2DJWA 2F4VK 3G6YA 2QL7B 1SBRA 4HHHA 1W26A 1KQSM 3H4BA 3DU5A 2B4OA 1W7WA 1XMQK 8ATCB 3CCVS 4E7KA 4Z7YA 1CS4B 3P3DA 3OYMA 1AFJA 1U8SA 5JS1A 4IFVB 3M1VA 1K8AO 1FEHA 2NREA 4OX6A 2JEGA 1KTQA 4HTUA 4UZCA 2QA4N 5BYSA 1D8YA 1KQGB 1KBRA 4RZRA 5ETOA 3SV3A 3PX4A 1NGFA 5GMEA 2NZTA 4CZGA 3IP0A 3BPSP 2CPFA 3LQVA 2RE1A 1NGHA 1AZSB 1K8KB 2VFRA 1U09A 3M8PA 5FROA 5LY3A 3GONA 3VOVA 1VOMA 3C46A 2ZHOA 2OPSA 1PKUA 5C25B 3O08A 4LR9A 4OX9K 2BX6A 1U02A 4CHPA 1VQ5N 1B9DA 1RBSA 3VWSA 4CFBA 1KC8O 3F5TA 3WC0A 1MMLA 4CZKA 3PW7A 4JYAJ 4BRDA 1KS2A 5EX3A 1SKSA 3UN3A 1BQMB 1HRHA 1TYQA 4K8XA 2RRBA 5DM6Q 3W5YA 1XMOF 4YS2A 2G1HA 4BVOA 2A6OA 4Y1CA 3Q22A 4KB1A 1QY7A 5DQIA 1DLOA 4FJLA 4JI4F 1JNZB 5HP1B 2BM0A 3LAKA 4YMEA 2IMOA 2YPZA 3EICA 3K5NA 3JSMB 3ENHA 3G87A 1YJTA 3DRSA 4CH7A 2DHGA 4HTIA 3Q23A 4O8UA 1VQKS 1UFKA 4UOHA 4B3RF 1XNRK 2GA7A 1PBAA 2HS3A 1CJVB 1QLNA 2AJQA 1FF2A 1Q16B 3V5RA 4ZVOB 4NXNF 1TUUA 3LOUA 2VPZB 4WQ5C 2N4DA 3IBWA 3SDEA 4P6QA 1DBDA 3EO3A 1MG7A 4AL5A 4BACA 2R7OA 3GJRB 2ADCA 4DQQA 1FJEB 3QAEA 1TL4A 4I2QB 3G71N 4I0WA 2UUCJ 3KKRA 1LEOA 2CKWA 3WX4A 3RJMB 3VHQA 3KG4A 4A8XA 1RT4B 3OVNA 5KQDA 4PWDA 3VGTA 3L4QA 4J9MA 2CAJA 3E2EA 4FNHA 2AYMA 4HUEA 3DLKA 4GVBB 5KFDA 3W9HA 3AA3A 1NCLA 2J7WA 1NBEB 3G82A 3A3NB 4DR6K 5THWA 1QVGR 2FSJA 4LH4A 4O5BA 3CEDA 4O3OA 5I3PA 1RISA 4JI4K 5GIOA 2DY9A 2XEXA 4I64A 4DR2F 2W4DA 3AVAA 2DNMA 4R5PA 1KCFA 2HGNA 3TRGA 4WFZA 3A1YG 2QM1A 3E66A 3LDPA 2LA6A 3ILOA 4BRLA 4CEZA 5HATA 1RTHA 2W4PA 3GP9A 2HWTA 1RHKB 3M6XA 1LXNA 1IBMK 1RWNB 1UWBB 1PJ5A 2IYGA 1CBKA 4DTPA 2JFKA 1HNWF 3AV9A 2VKZG 4DPUA 3MPDA 5KT5A 4JV2A 3DOKA 4IOCQ 3EY1A 3O3LA 3LZIA 1KKHA 1IKVA 3C16B 4ZLLA 4CF8A 1FFGB 2ACYA 4HHUA 3E9LA 2PO4A 1R8HA 2W24A 2P9SB 4KV8A 1IJFB 1U1MA 5JLHA 2YWWA 1IR0A 1B3TA 4N41A 4PQUA 1QUPA 4FNIA 2ZJRQ 3PYFA 3NMRA 3S6EA 4BC2A 4OFZA 2VQFF 4B1WB 3UW1A 5BN8A 5HJYA 1Q7YO 1WOOA 2GEMA 1U47A 1IV0A 4F4XA 1S9EB 3HPGA 4H0TB 2JOQA 1NGDA 1J5EK 2OGUA 3ZZ0A 4IXCA 1NK9A 5C12A 3V9UA 2DTUA 5C24B 2QYCA 3O1WA 3MM7A 4EIAA 4DV3J 4CK1A 3VERA 3OLAA 3ATVA 4OI0A 3L2WA 4ISGA 4QR0A 1FXDA 4JUZA 1Q82T 4GMKA 5IZHA 1X60A 3THVA 4ZVPB 2UVVA 3BB5A 3W7BA 1EXQA 3RB6A 2G8WA 1NK6A 4NYOA 2I2YA 5HVGA 1Q82O 3ZT4A 2W7OA 4DR3F 5CYQA 3L7OA 4G1IA 4X65F 4ECZA 4YHHJ 4M94A 4NLBA 3THWA 4ZPBA 4FK2A 5K8OA 2V51B 2VG6B 5AZIA 3I4PA 1X9WA 1TL1B 2WVBA 4QW9A 2G0IA 3QT8A 2DGWA 3C6UA 1XIQA 1A5XA 2MZQA 2V4JA 4F25A 5L38A 2Z1GA 4DV3F 3J81j 3I55S 3DOMA 3CCTA 3QBCA 2KW4A 5E2QA 5J2MA 4AFFA 2FLLA 3NAHA 4CJKA 2P9UB 2YHWA 2RU3A 1FERA 1UPPA 1S57A 4NYPA 5AQHA 1IQTA 5A2QO 4J2BA 3C6HA 3EKUA 4CI6A 2AV5A 1Q8IA 3AGKA 3NBPA 1SUQA 2Z56B 5KG5A 3DRRA 1S79A 3TTCA 2M9KA 5C42B 3SQGB 1D5AA 2I5JB 4KGXB 1DTQB 1VHIA 2C2MB 2HF4A 3A3OB 1LWEB 1A6LA 3CJ1A 3US5A 3VCDA 4LRDA 1FDBA 3M32A 2NRWA 3OTOF 2HGLA 4WBFA 3KLGB 2NUBA 1CC8A 5HP1A 4MQ3A 2D0OA 1E3MA 1NMNA 2AYEA 1Y10A 1S6PA 4B9VA 3VAJA 5JVGQ 1JKHB 1WOQA 1WTBA 3CJ9A 3MTJA 4CF9A 2FIUA 1W2IA 4GKKJ 4WP3A 4ZN1A 1M90T 1NB7A 3P45B 4K0KJ 1RGIA 1A9NB 3DI6A 2VYPA 3RG6A 2OLWA 3SCKE 3RU0A 1U1OA 2VFUA 3UD4P 4ZKAA 1LAVA 3PX0A 4FL9A 2GS8A 3TUIC 2DR5A 4DSFA 5AQIA 3VESA 1IG9A 3TJ9A 3R5BA 5F9NA 1S6QB 1UA0A 3TUPA 3MN7A 3AHPA 2E2NA 1QAIA 3QMLA 3GJSB 1CJKA 2Y0BB 2ATCB 2BV3A 2ZZNA 3DLEB 2GQ2A 5FDLB 3BQ2A 3MN9A 4DV1K 3WNFA 3DDIA 2OELA 4EP4A 2B0GA 5KFBA 3IN5A 1DQAA 1V5IB 3M8WA 3TWZA 3H2VE 3G71S 4MYUA 5H9FJ 5AQJA 1X5PA 3UD3P 1B92A 2RB7A 1ZBHA 3CCEN 3W8PA 4M5JA 4ISFA 3PVXA 4LT6A 3TO8A 1T9UA 4NMXA 2QW9A 5FPNA 1MWYA 1AROP 4DR7K 1C4CA 2E29A 3IGVA 1JCEA 3OL6A 1NDLA 1NHKL 2NRRA 3H3OB 2EFGA 3UWTA 4FPBA 1Y3KA 3I0SA 4BHQA 3MEDB 2EFQA 1BQNB 1MLAA 2ZH8A 4DSJA 5HLFB 2CADA 3P39A 1J5OB 1C6VA 4DR5K 2FHJA 2YBVA 3NGUA 2HPUA 1DLOB 1W97L 3ZX2A 1VLOA 1XMOJ 3FEYB 4N5SA 2L3MA 1W2BR 2YKOA 1QE1A 4KTQA 3WEEA 2H5JB 3ZNJ1 1EX4A 5C7PA 1VSMA 4KBOA 1YJ9N 2W01A 1FKPB 2EKNA 1ZA1B 2HURA 3NL0A 5L8RC 4H0PA 3IWNC 2JEJA 2KM8B 1N5SA 4OI4A 5KFLA 4QOZB 3KMSA 3HOSA 1U1LA 4LF6J 2HIQA 4FN5A 5L9NA 1R27B 3V4IB 4ED5A 2CH5A 1ASVA 2YHAA 4PG5A 5CY4A 4A59A 1VQMS 1QVFM 4WKYA 1OPZA 2Q43A 2P5VA 4I4BA 1YG0A 5I4MA 1HJOA 3B6PA 1RU2A 1NGBA 4LRAA 4TKTA 4CLLA 5E3RA 1IG8A 2QWPA 3PW0A 1RADB 1EQMA 1NKBA 2FTRA 2JH3A 1SXLA 4J2AA 4CEOA 1YJ9S 3TVKA 2A6MA 3FFIB 3A8JA 1NMDA 1IBCB 5AXMA 3DOLA 3W60A 3CJ2A 4NYZA 3M9OB 5K8PA 3OS2A 1EP4B 2QE5A 3G6VA 4M3UA 1L3TA 1YF5L 2IVFB 5GAEP 5B7WA 5F1XA 3Q89A 2C22A 1MWKA 2MQPA 1TV6A 4FWPA 3ZO7A 1QZ6A 1DURA 3B6OA 3D6TB 2HBYB 2QEXN 3NOCA 3AVLA 2OMOA 1YJ7A 1WSEA 2A42A 4BQZA 1KD1O 4BROA 2EFNA 4NLOA 4TYAA 2R7VA 2HHHJ 2GJ2A 2YV0X 4O5FA 4B9QA 3A0IX 1R43A 4LFCK 4BGBA 2B6AB 2MZTA 3UE5A 1X7VA 1C0UB 3WXIA 4NZ6A 4KB7A 1B99A 1NJXA 5GAHU 4PY5A 3VEZA 4ECWA 3QINA 1BISA 3VQAA 4PG6A 1FDAA 4ZJLA 1F6TA 4E2FB 2VKRA 4BQLA 1JLAB 5T7BA 2DCLA 2W7PA 5C42A 1VSIA 1G4CA 1ZETA 1DRZA 2R7YA 3W9JA 4BRPA 3LALA 2DHXA 4JI5J 4CM2A 3OYNA 4ZHRA 2FF6A 2P9LB 1O6XA 3MX5A 4CRJA 2Z2ZA 4XPEA 5AQRA 4FKXA 5HMYA 4JRQA 1JKHA 1WI6A 2OD4A 2G8HA 3HYFA 2WSEC 2AA4A 1SC6A 3WX8A 3NCPA 4M95A 1PC4A 2DXDA 2NSCA 5I3QA 1ZBTA 3GPAA 3C14A 4DR1J 3CC2N 4FF3A 4K4SA 3MECA 4J9OA 5L46A 3KLVA 3ZTQA 3QBXA 4FOEA 1OYEA 1RHRB 5D4LA 5ETPA 3AVGA 3T19A 2CNKB 2NR0A 2XMVA 4MDAA 2BEFA 1RT3A 3CULA 4KKOB 4RO0A 4UTGA 4X64K 3UCUP 1JJCB 2VIHA 1QJHA 1IBLJ 2J9CA 2JC0A 5EX0A 5AXLA 1VQPS 2O8BB 1BA0A 2RQCA 3MCNA 2ZKTA 4QQBA 2CVIA 3MZIA 5LL6d 3HHLB 5T14A 4JI2K 5G0RB 1HNXK 1ATNA 2P5GA 4DKWA 3WQTA 2B5JB 1F2GA 2FPHX 3OV7A 1VYAA 1NK0A 3PEHA 3KJFB 1QAXA 2BRKA 1JLFA 3OXGA 2K7KA 2AW0A 2QRRA 4ZITA 3J81O 5DQGA 5HAOA 5BPMA 1E4FT 2WK4A 2BMBA 2DPNA 1J5EF 3DLHA 4BC9A 1NHUA 4RBVA 5GVQA 1S1WB 2ZF5O 2V9KA 4NLSA 2HVZA 4C8YA 1DQ8A 4ZMMA 1T9TA 3CIZA