1C1CA

Crystal structure of hiv-1 reverse transcriptase in complex with tnk-6123
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
539
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 536
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1cA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1cA05
4URQU 1S48A 1BI4A 4QWAA 3U3YA 1QHTA 3VQCA 1C0UB 3VQ6A 4EO8A 1U45A 4OJRA 1REVB 1JLBA 1HMVA 3CDEA 4JUZA 4K4YA 4YFUA 4ID5B 2B43A 5DQGA 4RW4B 1TP7A 4NCBA 2B5JB 2UUWA 5FRMA 2EX3A 2HMIB 3BDPA 4F3TA 2BRKA 2Y1IA 4GC6A 3SV3A 3G6VA 3QIPB 4IOBA 2WOMB 2ATQA 4M42A 3PO4A 4CJTA 4B9MA 1RTJA 2D3ZA 1GOBA 5KFFA 4CE9A 3I0RA 1JLGA 4CERA 3KMQA 1DTQB 2VG5A 1ASUA 2VWKA 5KFAA 3CFPA 5CZ1A 3DRSB 5HBMB 1C1AA 3OVNA 2XWYA 5KFHA 4CGFA 4J9MA 4FJNA 5KFZA 3GV8B 1XWLA 2IS3A 4OLBA 2HHWA 4MKAA 1QAJA 1S9FA 4CJWA 4E1NA 3K58A 4B9NA 4Y2CA 3H5XA 2OPPB 5C42B 2IM2A 1LW0B 1U4BA 3M9NB 4CFDA 1S0MA 3TAFA 1W25A 1CZ9A 3TWHA 4IKFA 4HUGA 2A1RA 1JLFB 2ASLA 1HYVA 4Z4IA 4AILC 1ZBIA 4R5PB 4DQRA 3TARA 5F9NA 3RR7A 4CJVA 2D0CA 3ITHA 2IC3A 1NK8A 1N6QB 1QQCA 5KT2A 5KFSA 2YNHB 4F50A 3NH2A 3KKRA 1QE1B 3RMAA 2ZE2A 4HTUA 2BRLA 3OL8A 1KVAA 1SKSA 2C2RA 1N56A 5L1IA 4DFMA 2DTUA 4QWEA 3EPIA 2Q3SA 1T3NA 1RDAA 3IS9B 4KFBA 4KB7A 1WN7A 4CEFA 1KCFA 2RN2A 3TABA 3L3UA 5DK5A 3C6TA 1NKEA 2G8UA 5FDLA 5J2PA 3CJ5A 4NLUA 5KFNA 3T5JA 3OHBA 1S1WA 2BR0A 1QTMA 5J2NA 1S1UA 4ECTA 3QNNA 2RKIA 3OYAA 1RT4B 3BSNA 4ZPAA 3SJJA 4F3OA 4FZYA 4DTRA 1YTUA 4QCLA 4FJXA 3O4NA 4CESA 2BE2B 4E19A 2R7YA 1GX6A 4B3OA 3P5JA 1IKXA 4HKQA 3V9ZA 1B9DA 1FK9A 1OS5A 3CDUA 3BR9A 1LWCB 2XO7A 2PYJA 4E7JA 3QERA 3IG1B 4IFYB 3VQSA 4XIUA 2X6NA 4DU4A 3H5UA 2ILZA 1BQNB 4DSJA 4PUOA 3PX0A 1S1TA 5L1JA 3TAEA 2E9RX 2IBKA 3L2WA 2WCXA 4FVMA 5D3GA 1X9WA 2R2RA 1LWEB 4URGA 2AX1A 4DTJA 3JSMA 4Y34A 1TKXA 3M8PA 4I2PB 4CEOA 4JS5A 4J9QA 4I9QA 1C6VA 3N6NA 3PX6A 4CEQA 3NBPA 2AJQA 4O4RA 2VG6B 5J1EA 3RB0A 1S4FA 4KI6A 2QKKA 4I9LA 3M8RA 3CFRA 1TV6A 3MXMA 4Y1DA 4DU1A 1EP4B 3HVWA 4YNQA 2JEGA 3QEXA 4PY5A 5DQIA 3MEEB 3H4DA 3QLHA 2V0NA 1HPZA 3K57A 1TKTA 1HQEB 3K5MA 5C24B 4GMJB 3NGIA 2ASJA 3ULDA 3DOLB 4KAZA 4B9TA 5DG9A 4X2BA 1EXQA 4Y1CA 4RW8B 4W5OA 3KHLA 1RT6A 1RTIA 3OL6A 3UIQA 2ITGA 4OLAA 1RDDA 4CJLA 4K4VA 2GIRA 2BGGA 4EBEA 5F8LA 5KG5A 4FJ5A 3M8QB 3ZT1A 4DQSA 2HHUA 1C0TB 1QUVA 2BQRA 4E0DA 4FK0A 3PVXA 1T05A 3DYAB 1UWBB 1W9HA 4FJJA 5KFUA 3KK1B 3JYTA 1RYRA 3S9HA 4LSNA 4NLPA 4F4KA 3O3HA 1LW2A 5SZTA 3AO3A 3DM2B 1RT3B 3GILA 2WK4A 1RTHA 2YKMB 3VQ5A 2JEIA 4CIEA 3KHGA 3SYZA 3I5BA 1T7PA 4WZMA 4NLTA 4M3TA 4IH5A 3CG7A 3Q8RB 3AVCA 2XY8A 1D9DA 3S3OA 2D3UA 3PW5A 2J6UA 3TAPA 4CJEA 1ZBLA 3ZSQA 4HUFA 3M8SA 1L3TA 4K4WA 2B6AA 4CIGA 3SUNA 4FJGA 4DSEA 4ECYA 4FM1A 4M3ZA 5CYMB 1YT3A 5KG7A 2E9ZA 3BSOA 3PO5A 1RT2B 3I0SB 3PW2A 4DSLA 1R0AB 2FBYA 2E9TA 4PA1A 4FYDA 4ICLB 5SWMA 3KLIB 3DOKB 3FDSA 2W9CB 3GV5B 4PQUA 5KFEA 2KFNA 1SH2A 1IO2A 2W9BA 2AGPA 3KK3A 4M95A 4CFAA 4K4UA 1RT5A 3V4IA 4TY9A 2R8GA 2W7PA 4J9KA 1I3AA 3ISND 4I2QA 4QWDA 4IRDA 4DTOA 3T19A 4K50A 4DG1A 4BE1A 1QSYA 4MFBA 1CXQA 2E6MA 4WXWA 1HNIA 4CEBA 3RAXA 5HLFA 5C25A 1S6PA 5C5JA 4RW9A 4ZTJA 3PHEA 4IG3B 4FJ8A 1S6QB 4M3WA 3IN5A 3ALYA 1TL3B 4YQWA 3VN5A 3QEVA 1U09A 3F9KA 3AA3A 1JLEA 3KHHA 1D5AA 2XCAA 3OL9A 3EPGA 1T03B 4NZ0A 1A5WA 5DQHA 4KTWA 4ZMMA 3BQ0A 2YV0X 3SFGA 1NJXA 5FROA 1Q9XA 1Z26A 1VRTA 4ECWA 4DTXA 1KLNA 2IAJA 3AVIA 1U49A 1K1QA 3NHGA 3SQ1A 4CF0A 4JV0A 5I42B 4J9OA 3DMJB 3ZT2A 4M3UA 4Z4GA 4WYLA 1XR7A 4DTSA 2XI2A 2VG7B 1L3SA 1L5UA 4WFYA 4ED0A 1Q9YA 3TI0A 2C22A 4FLYA 5J2QB 1S0OA 2FBXA 3N6LA 3KJVB 4CJFA 3AVBA 4CHOA 1RILA 3O3FA 2I5JA 4DQIA 5HROB 4Q8FA 4EO6A 1RNHA 2HHQA 2CKWA 3DLGA 4WE1B 1DTTA 2RPIA 3MEGA 4IG0A 3FQKA 1SH3A 3AVFA 3E01B 2W7OA 1JLCA 1TGOA 3P1GA 3OY9A 1KLMA 1HJRA 2OPSA 4R8UB 1ZYQA 5L1LA 3SQ4A 4C8KA 2XRIA 4BWJA 3OYMA 5KFXA 2D41A 5HRNA 3NGYA 4IDKB 4KV8B 3FRZA 1S9EA 4AHUA 5K14B 5KRSA 2WHOA 4DSFA 3H5YA 4YR3A 3OSNA 4Z0UA 4HCBA 5F8JA 3EZUA 4G1QA 4DQPA 2DPIA 2WRMA 3NF9A 4FLUA 1JXBA 1C0UA 4PWDB 3HP6A 2FVSA 5HRPA 1REVA 2PY5A 3FFIB 4CEEA 4RNOA 4EP5A 1S1VB 3QINA 3K5OA 4KI4A 4RW4A 3H4BA 5DLFA 2D5RA 2YHBA 2B5JA 3U6FA 3TAGA 4RNHA 4CJSA 3V6DB 3KD1E 3V9SA 2HHTA 4LY7A 2XY5A 3MR2A 4O3PA 4O3OA 3QIPA 3HPOA 1RT7A 5EWEA 3KHRA 2QXFA 3SUPA 3G6YA 1Z25A 1KFSA 3V81B 4NLQA 4CECA 2YKNA 1SKWA 5EU7A 1DTQA 5L9XA 3UQSA 1JLQB 3M9MB 4YR2A 4AHVA 3VQ7A 4DF8A 3MR6A 4DL5A 3DRSA 2G8KA 5HBMA 3HYFA 3DLBA 4CJPA 4JS4A 4J2AA 3NE6A 2E6LA 4ED3A 3LP0A 4ZPCA 2OPPA 5KG3A 5C42A 1TVRB 2IMWP 1LW0A 1RT1B 4DL6A 4CF1A 4FJKA 4Q0BB 4C8OA 4EZ6A 3D5MA 2OPQB 4DFPA 3LWMA 4HVJA 2VWJA 1RDRA 1JLFA 1BQMB 2DFHA 1YVUA 3BGRB 3QEWA 4ELTA 1JKHB 1A5XA 4N47A 3HVRA 1UA0A 1TKZB 3H40A 4ECRA 2XGPA 1NJYA 4ED7A 1ZETA 1N5YB 1HNVB 3TAMB 3OYEA 2YNHA 3D45A 5KFLA 1QE1A 1J5OB 3HPHA 1RTDB 2XY6A 2FJWA 1BCOA 4C8MA 3LPTA 2HHVA 4DWIA 3OYBA 3IS9A 1RDBA 4Q45A 2XGQA 3BQ1A 4FK2A 2XI3A 4E7HA 1JL2A 4NLOA 3RWUA 1JXEA 3UDLA 1NKBA 1SL2A 3NAIA 5KFGA 2C2DA 2W8LA 2V4RA 5JS2A 5KG2A 1KRPA 4CGDA 4B8AB 4N76A 1EETB 3SQ0A 3ZSRA 3GIIA 3MEDB 1NHUA 2HVHA 4TQSA 5KGXA 4EBDA 1G15A 1LAVA 3SCXA 1D9FA 4N41A 3UR0A 5CY4A 3AVGA 1RT4A 2B4JA 2GC8A 1BHLA 2PZSA 3NAHA 4DS5A 4CEAA 2GUIA 1WSHA 4CJUA 4IR1A 4IKAA 2IA6A 1F21A 5L1KA 3OLAA 2VG5B 3KMSA 5KG6A 4EEYA 4DU3A 3QO9B 4Q8EA 5KFQA 4CJ4A 4EP4A 4M3RA 4CHZA 2Z1IA 1BCMA 1BQNA 3ZT3A 4GW6A 4FLXA 1LWFA 3CYMA 4HUEA 1FXXA 4OKEA 4H8KA 1VRUA 5KFOA 1LWEA 2JEJA 3Q8SB 3OYFA 1IKWB 2XCPA 2F8EX 1A5VA 1NJZA 4HYKA 4FZXC 4I2PA 3L2QA 3DI6A 3SPZA 3RMCA 3RRHA 3MXJA 3IGVA 3MXIA 2FC0A 4TLRA 2J6TA 3OYDA 3PR4A 2FJVA 4J2EA 2IC3B 2VG6A 2OYQA 4ZVEA 1XHXA 5EWGA 3KLVA 3DRPB 1NNDA 5I3UB 3PW4A 4TY8B 4ELUA 2WTFA 3DLHA 5KG0A 5KFCA 2ZE2B 3SV4A 3NH0A 3CJ4A 3NAEA 1EP4A 5J2MB 3OLBA 3ZCMA 3OYKA 4CIFA 4QW8A 5T14A 3MEEA 5HRRA 1JLAB 1X1PA 1IKYB 4OPKA 1HQEA 5C24A 1WSEA 2FVRA 1C1CA 5KFMA 4DF4A 5KFIA 4RW8A 4W5TA 2O4GA 1RYSA 2LSNA 4BE0A 4FLWA 3MFHA 4DMNA 4TYBA 1S9GB 3M8QA 4O0JA 4OGEA 3LALA 2HVIA 5F9LA 3RBEA 1C0TA 4DTMA 4ZVFA 4FCYA 3NH1A 4GC7A 2HHSA 5EUHA 2HNZB 3DYAA 1UWBA 4BDYA 3IRXB 5KFJA 3SI6A 1D8YA 3QESA 2ILYA 3GV7B 4NYNA 4KE5A 4F2SA 3DM2A 1RT3A 1IKXB 4KHMA 1RAJA 1X9MA 2HNDB 2YKMA 4JRQA 2HAIA 4OPJA 1X9SA 4UQGA 3I5AA 1IKVB 3OYIA 4QW9A 4E7LA 1S97A 4PUOB 4KSEB 1J9AA 3B6OA 4BE2A 3GIMA 3G86A 3LAMA 1TAQA 3H98A 2QE5A 3VQDA 4CCHA 3H08A 3HO1A 4RW6B 4DLGA 1ZBHA 5CYMA 3AV9A 1TK0A 3HHKA 2V4QA 4J9PA 4RNFA 3Q8PB 1IH7A 4N5SA 4Q44A 1RT2A 3I0SA 4DS4A 2F8SA 3C6UB 3SQ2A 3O3GA 1R0AA 2IDOA 1ZTWA 2AU0A 1L3VA 4ECUA 4Y3CA 1BIUA 3DOKA 2W9CA 3ZSOA 3NBPB 1FKOB 3NGZA 5T7BA 4CGHA 3L2UA 4IQXA 4MH8A 4DL7A 3U3GA 4Z4EA 4CK2A 5DGAA 1T94A 4ID1A 4NLWA 3NF6A 4TN2A 3SNNA 4H54A 2QKBA 3V1RA 5KFYA 4EYHB 3KLHB 4DEZA 4IG3A 4ZP9A 1S6QA 1TL1B 2IM0A 3T3FA 4IFVB 1C1BB 1TL3A 4KB0A 4WFXA 4MK9A 1WSFA 4K4TA 2RF2A 4XPCA 5KFRA 3AVKA 3KD5E 4ZVHA 5KFWA 2ZD1B 2HNYB 5CYQB 5HP1B 3QGIA 4TYAA 1J53A 3OSPA 1YVFA 1T03A 4WZQA 3WNEA 3D28A 1VK0A 5KRTA 4K4ZA 2GBZA 3ZSXA 3RB6A 4NYFA 1XR6A 3PJWA 3MECA 2G8FA 3AVMA 3UPFA 1HQUB 4NCGB 4M45A 5I42A 3AA5X 3DMJA 1I39A 1DLOB 2BQUA 4AH9A 4EYIB 4LSNB 4KHWA 1JL1A 3GIJA 4RG8A 2AGQA 3SUOA 3PW0A 3CIZA 1I6JA 5J2QA 4B9UA 2DPJA 3EY1A 3KJVA 1NOZA 2OA8A 4M3YA 2KZZA 2UVWA 3GQCA 1CXUA 3ZSZA 2IJFA 3L3VA 5HROA 1D1UA 4Y2AA 2W42A 4WE1A 4RW7B 1VSKA 3E01A 4URSA 4J9RA 5DMRA 3LWLA 4O55A 3ZSWA 1SH0A 3LZJA 2YNIA 2AX0A 3DLKB 2IM3A 1SKRA 4U6PA 1S5JA 4MQ3A 2YNFB 1RA7A 1RBTA 2J6SA 1VSLA 4B08A 4ZPBA 3BQ2A 4OKJA 4DL4A 2OH2A 3HK2A 4FJHA 4B8CA 1EKEA 3SPYA 2P5GA 4CHYA 4H4MB 4ZHRB 4F2RA 4IDKA 1U47A 4KV8A 1SV5A 4M41A 3V9WA 4YP3A 5K14A 1TK5A 4QOZB 3KLGB 1TKDA 3V4IB 4I2QB 4GVMA 1HYSB 3AO5A 4DG1B 3MFIA 1U04A 3AO1A 3MF5A 3HVTB 1HNIB 4PWDA 1S6PB 1NHVA 4ZPDA 2WB4A 2C2EA 3FFIA 3A2FA 1RDCA 1S1VA 1SL1A 1KVCA 4RZRA 3MTKA 2BANB 4JLHA 3T5LA 3P83D 4ZP7A 2PYLA 3V6DA 4NRTA 2ASDA 4OL8A 3B6PA 3QIOA 4FM0A 3VQEA 4MIBA 3OYCA 3WNGA 1SL0A 4FZZA 3LP2B 5KI6A 1SUQB 4W5NA 4ELVA 4IH6A 1VSIA 3OYNA 5KG1A 4DFKA 4LQ9A 3LAKA 4KKOA 3KLEB 4O0IA 3V81A 3OS2A 3TANA 2IJNA 4U7CA 1Z4UA 4ED1A 2OPRB 5F8MA 1JLQA 4LSLA 4Z4FA 4FJ9A 4CK1A 4FS1A 4NLXA 3THVA 1HARA 4C8NA 3DLEB 4FJLA 5KFKA 1GOCA 5DLGA 4O44B 3HL8A 4M94A 1QSSA 1S1XB 3ISNC 1D0EA 1WSJA 4YR0A 2VA2A 4MK8A 5JUMA 4KO0B 4ID5A 1TVRA 1RT1A 4LH4A 4O4GB 5KFPA 3CQ8A 4ZTFA 4H4OB 4Q0BA 4OKKA 4K4XA 3KIOA 4DLEA 1NK4A 3LP3A 1MU2B 4CHQA 4CHNA 3LZIA 2OPQA 2HMIA 2O4IA 4CFCA 2AQ4A 2CJQA 1BQMA 2WOMA 3BGRA 3DRRB 4E7KA 3WNHA 1VSDA 4I7FB 3MEGB 3OJUA 1XC9A 3OS0A 1TKZA 3V9XA 2XY7A 4WYWA 1GOAA 1FKPB 2EC0A 1N5YA 1HNVA 2ETJA 3SUQA 4O5BA 3TAMA 3KK2B 3I8DA 1NK6A 2FBVA 3CJ0A 1RTDA 5KT7A 4F8RA 4LD0A 4NRUA 3Q8QB 2WONB 3PW7A 3S3NA 2R8IA 3ZT0A 1EX4A 4KRFA 2IGIA 1S9EB 2YNGB 4KREA 5KGWA 1BISA 5E41A 1UAXA 3VQAA 3LP1B 4MK7A 4HHTA 2OZMA 4J9SA 4CJ5A 4BACA 4ZVGA 3BSCA 4K4SA 2FVPA 2JEFA 1VSEA 2P1JA 3TR8A 4R5PA 5F8IA 3QYYA 3HSTB 1EETA 4EBCA 3V6KA 3G10A 3HT3A 4IRCA 4AHRA 3MEDA 2D0AA 1KSPA 1N6QA 1L3UA 2FLNA 2O5DA 2G8IA 3NL0A 4XO0A 3RTVA 2KTQA 1JIHA 4ECVA 5KT4A 3CDWA 1RT7B 4DTUA 2HWIA 1RBVA 2ZKUA 3V9UA 3C94A 1NK7A 3K2PA 3OYGA 3AO4A 2DFFA 3C95A 1C2PA 2YKNB 1RBSA 2D0BA 3KLFB 2G8WA 1WSGA 5DGBA 2X6SA 3QO9A 2KW4A 1BI4B 4DFJA 5KFVA 5F8NA 2ALZA 3RRGA 1ZTTA 4KHUA 1WAJA 3V1OA 3G6XA 1JLBB 2ZQBA 4QWBA 1HMVB 3LP0B 4CGIA 3L8BA 1VSFA 4M3XA 1WNSA 3M9OB 3T5HA 3CO9A 1IKWA 4DTNA 2D7SA 3SZ2A 3OL7A 4JV1A 2G8VA 5KT3A 1S49A 3CJ2A 4NYZA 3AA2A 3VQQA 3QEIA 3NMAA 2I1RA 3V6JA 4F4ZA 1HYZA 2R2TA 4FJIA 2UVVA 3QGGA 1VSMA 3DDKA 2BE2A 2GIQA 4ED8A 1RTJB 4K8XA 3BJYA 2FJXA 1WAFA 2P5OA 1CLQA 3DRPA 5I3UA 3I0RB 4TY8A 3CM5A 1JLGB 3CVKA 2V9WA 4FLVA 1LWCA 4RNNA 3QIDA 4IH7A 1K6YA 4DL3A 4O3SA 3IG1A 4CHPA 1QS4A 4IFYA 5J2MA 3NF8A 4ZP6A 4TQRA 2FBTA 1JLAA 2Y1JA 1IKYA 3MR3A 1WNEA 4Q43A 3F73A 3RAQA 2W9AA 2HB5A 4CJ3A 4CJRA 4BDPA 4EZ9A 1S10A 1WSIA 3ICLA 3T5KA 4MIAA 4IRKA 3ASMA 3ZT4A 1S9GA 3V1QA 2OZSA 4RU9A 2FLLA 1ASVA 4RUAA 3S3MA 3NFAA 3ITHB 1JXLA 4TSXA 3TAQA 2KFZA 2HNZA 4KPYA 4CEZA 1WLJA 3QNOA 2XC9A 4CJQA 1ZBUA 3IRXA 4CF8A 4NLYA 3GIKA 4KHYA 5JS1A 4RUCA 3DLRA 1K1SA 3N6MA 4ED6A 2EHGA 2HNDA 4KFBB 4KHQA 4CF9A 1C0MA 4CEDA 3DOLA 3FSIA 5JXSA 2BQ3A 1VSHA 1IKVA 1XI1A 4FS2A 3L2VA 4KTZA 2FLPA 4LQ3A 4DQQA 3NF7A 1RBRA 3C6TB 4G3IA 2P51A 5FDLB 5J2PB 1LWFB 2GV9A 4KBIA 3V6HA 3OYJA 4JRPA 1XHZA 1S1WB 4K8ZA 3EZ5A 1VRUB 4MKBA 3AVJA 1CSJA 2X78A 1NJWA 5KT5A 4NLSA 4RW6A 5J2NB 1S1UB 3PJXA 1ITGA 4Z4HA 3KK1A 4E1MA 2RKIB 3C6UA 3DI6B 2AWZA 4QWCA 1JX4A 1UOCA 5DG7A 3K5NA 1FKOA 2W8KA 3I5CA 4B3OB 2NUBA 3O4QA 1LAWA 4B9SA 3T1AA 4DSKA 3FQLA 4NLRA 3RMDA 1FK9B 4F4WA 3QEPA 2HW3A 3VQBA 3OJSA 4YMEA 3PUFA 1XR5A 2YHAA 1VSJA 3ZSVA 3KLHA 4CK3A 2HWHA 5F8GA 1TL1A 3BREA 1KVBA 2FVCA 1S1TB 4IFVA 1C1BA 5DG8A 2DFEA 3WNFA 4J2BA 5FRNA 2IOCA 2ZD1A 5D3GB 1C1CB 2HNYA 5CYQA 1O1WA 1BGXT 5HP1A 3IGNA 3BSAA 3JSMB 3D0PA 1IM4A 3GYNA 1TKXB 3M8PB 1NKCA 4FXDA 4ICLA 3KLIA 1RBUA 1KHVA 2Z1JA 3PV8A 3NKYA 1TK8A 5J1EB 2C28A 4E3SA 4FLZA 3AVAA 1HQUA 4NCGA 1TV6B 5EDWA 3G0ZA 2QV6A 1IG9A 1DLOA 3KOAA 3AVHA 3AO2A 1NK0A 4KHRA 4E7IA 4KHSA 2UVRA 3RB4A 3QLHB 2A1SA 1HPZB 1TKTB 3TQ1A 1B92A 2F8TA 4N56A 4ECSA 5CZ2A 4R0EA 4NLGA 1RT6B 1W0HA 1RTIB 3SI8A 4LH5A 3QETA 4RW7A 3H5SA 3MR5A 4TXSA 3KTQA 4HCCA 4QAGA 3OYHA 3DLKA 2DY4A 4B9LA 4IBNA 2X74A 2G8HA 2YNFA 4J2DA 4KAIA 2KZMA 3HVAA 4WXOA 1CZBA 2Z1GA 1T05B 4Z4CA 3LPUA 4KHNA 1Q8IA 3JYTB 4H4MA 4ZHRA 4BDZA 1BIZA 4DSIA 2VG7A 2E4LA 4F4YA 2R8KA 3OS1A 1LW2B 4AHTA 5KFDA 3KLGA 1U48A 4OVLA 1RTHB 4E89A 3AA4A 4FW1A 1HYSA 3ZSYA 2IM1A 4CFBA 3K5LA 4IR9A 4FM2A 2Z1HA 2R2UA 4J9NA 3HVTA 4Q5VA 2R8JA 4NLDA 1MMLA 2F96A 4W5QA 1Y97A 4OGCA 1LV5A 4O3NA 4FK4A 3KNAA 4DTPA 2JLEA 2ATLA 2BANA 2RDIA 4RNMA 2B6AB 3KKSA 2RF2B 4B9VA 4R8UA 1TQLA 1ASWA 4XPEA 3PX4A 3RR8A 3PR5B 2RDJA 3LP2A 1SUQA 3QZ7A 3RB3A 5EWFA 1HRHA 3KLEA 4AHSA 1UA1A 3MECB 3OYLA 4PQUB 1YTAA 2W9BB 3VA3A 3KK3B 3CM6A 2OPRA 3HPGA 4ECQA 1RCHA 5KTQA 1RT5B 3LDSA 3TVKA 5KG4A 3AVLA 4KTQA 2AGOA 4KB1A 3CWJA 4MFBB 1BL3A 3DLEA 3VQ9A 4CGJA 4O44A 5C25B 5HLFB 4RW9B 1S1XA 3VQ4A 4C8LA 3OHAA 5KT6A 4KO0A 4ED2A 4FJ7A 3IAYA 1N48A 4O4GA 3VQPA 4NCAA 3AVNA 4H4OA 2UUTA 2UVUA 3NGDA 1MU2A 3PY8A 1JLEB 5KFTA 1NK9A 1KTQA 3HP9A 2XHBA 4WFZA 3MAQA 3DRRA 1N4LA 4DL2A 4BWMA 4JV2A 3HXMA 4CGGA 4I7FA 4FLTA 4FBTA 3CFOA 3E51A 4FW2A 1VRTB 2YNIB 1FKPA 2BDPA 3KK2A 3SFUA 2IAJB 3VA0A 3QGHA 3HM9A 3VQ8A 3EYZA 4J9LA 1B9FA 2WONA 4O3QA 1KFDA 1NK5A 5HRSA 3HJFA 1SV5B 4CJKA 2QK9A 2YNGA 4FJMA 2FVQA 3H59A 1RA6A 2HHXA 4ZP8A 3PZPA 3LP1A 3L2RA 1ZBFA 2VA3A 3NCIA 2JC0A 4O3RA 4ECXA 4QPXA 2I5JB 4F4XA 1GX5A 4CF2A 3DLGB 1JKHA 1DTTB 3RMBA 2KQ2A 1QAIA 4IG0B 4AHCA 1KHWA 1JLCB 1T8EA 4FBUA 2R2SA 1KLMB 4ECZA 2OPSB 4L8RB 1NOYA 4W5RA 1J5OA 3QZ8A 4NLVA 2JGUA 3K59A 3LANA 3H2LA 1S0NA 3HKWA 3NDKA 3CJ3A 4KKOB 5F8HA 2JC1A 2R8HA 3RBDA 5KFBA 3KLFA 1TAUA 4LSLB 1J54A 4G1QB 1QSLA
chains in the Genus database with same CATH superfamily
2YVSA 1M1KT 3AOBA 1EQYA 1JLBA 3CC2N 2KT2A 4K4YA 5CZVA 2RS8A 1HNWJ 4ANEA 2OCEA 3QT5A 2C2OB 5GAHP 1PGZA 3JSYA 5JJBA 2ADCA 1GLJO 2VOPA 3U1NA 3Q23A 4UY85 2EX3A 4ILJA 3BO3A 2HZVA 2GO8A 3QIPB 1FJEB 2WOMB 3Q86A 2DH7A 4X4SA 4LF4J 4JV5F 1GOBA 5KFFA 3UN2A 2OAUA 4CERA 1DTQB 1ASUA 3R6MA 5KFAA 1WHYA 4EMDA 5M2RA 3OVNA 3EXCX 1N34J 5IV3A 4OLBA 2XNRA 4MKAA 1QAJA 4BRMA 4CJWA 4E1NA 3T9NA 3HT0A 4CZGA 4RJVA 2FZKB 4J9UE 3TAFA 2A1RA 2XTJP 5EOYA 1HYVA 4DQRA 3HFZB 1TELA 5F9NA 3RR7A 4CJVA 3DDIA 1GLCG 3ITHA 4X62F 1NK8A 2RHKA 4BR0A 3E66A 3SSRA 3QFUA 3MM5A 5U47A 3KKRA 1QE1B 2OEJA 3MCMA 2VQFK 2IYGA 2QWRA 1SKSA 1BHNA 1GFWB 4DFMA 1N56A 2GJIA 4QWEA 1T3NA 1NGDA 3I56S 1WB9A 3IS9B 2I8EA 2UUCF 4M5LA 1IBKK 3CJTA 5AR0A 2B9XA 2LDIA 2O8EA 5F0XA 3CEDA 1DBDA 4NLUA 2ZBIA 3T5JA 4J90A 1ZA1B 1S1WA 3R5CA 3PSFA 5JMNA 2FJAB 3US5A 2IDEA 4G65A 2APOA 1S1UA 3BO4A 4DOZA 2LDYA 4CQ1A 2R7QA 1RZMA 3SJJA 4FZYA 1YTUA 1Y4ZB 4C11A 4FJXA 2R7YA 1GX6A 3M05A 4B3OA 3P5JA 4XEIA 3M2UA 4C2MA 2BYCA 1VK3A 2MKSA 1OVQA 2NRVA 4P2XA 3FVYA 3JQMA 1YKWA 3QERA 4ILRA 3VQSA 3BF3A 3GBTA 2JJ4D 1FHTA 1BQNB 1LNQA 3PX0A 2D9OA 3L2WA 3KNGA 3VMFB 2R2RA 4URGA 3G25A 1H1VA 2AX1A 3ZYYX 1U02A 1GT8A 4ANDA 4JS5A 4DV2F 2E7XA 4IYQA 2O8FB 2MXYA 3NBPA 4ZVQB 3TPQA 2AJQA 5E3AA 4RTFD 1N8RT 1GXUA 1YX2A 4CTAA 1S4FA 3CFRA 3KJNB 4Y1DA 3AAWB 3O5BA 4YNQA 3G87A 3K0JA 3FLCO 3MEEB 1HPZA 4DN9A 2HAFA 2KH9A 1LOUA 3K5MA 4GRSA 4LF5J 3C6HA 1C0GA 3K7RA 2ASJA 2FHMA 1V3ZA 3ULDA 1ESVA 3KHLA 1RT6A 4X4TA 1LCUA 2HFOA 4PQAA 3UIQA 1RDDA 4K4VA 2BGGA 2FYXA 2VH7A 4DQSA 3ETOA 3TNVA 2QL7B 4AE5A 4OI2A 2W2MP 4FK0A 2XS5A 1FI4A 1UWBB 1RK8A 1OYEA 5DZ7A 3JYTA 1RYRA 3R8EA 4DV1K 2CZ4A 4YHHJ 2E1YA 2Q31A 4NLPA 4DV7F 2LQ5A 2HBMA 4FWQA 3UDCA 3TUZC 5M1OA 1H98A 3G82A 3VQ5A 3I55N 3SYZA 3I5BA 3CUNA 4NLTA 4M3TA 4GKJJ 3CG7A 2QWPA 1D9DA 5C12A 3S3OA 1MW7A 3PW5A 2KRRA 4UOHA 2W4PA 3HMJG 4WTOB 2GELA 1N8RO 1WG1A 2P9EA 5K8OA 3M8SA 4K4WA 4PG7A 4F0KA 3I9ZA 4AXIA 4M3ZA 1RHJB 4L72B 5KG7A 2E9ZA 4Z37A 3PO5A 3I0SB 1BO5O 2CJ9A 3A8IA 1N33F 2GJ2A 1RXOB 2D9PA 4PA1A 4FYDA 4ICLB 2J9EA 4PQUA 5KFEA 1RADB 2C2KB 2W2PP 1HKCA 4M95A 2B3TB 4CFAA 2R8GA 2GA7A 4YY3K 4J9KA 2YY3A 3ULEB 3R5BA 1ZPVA 2HBYB 1IG8A 4BR5A 1CXQA 2IHR1 2EFNA 4WXWA 3O3LA 2ZOFA 4RW9A 1UFKA 1X4HA 3TWZA 4IG3B 3Q7BA 2ACYA 2AMCB 5LJWA 3AY0A 2OTLS 2J9CA 1EQ0A 4YQWA 2KYXA 3EE8A 1U09A 2PA3A 3KHHA 3GE9A 2MKCA 3C15B 1D5AA 5LMNK 1T03B 5DQHA 3EX7B 4L6V3 4QIWD 1IXKA 1NJXA 2YV0X 1EB0A 1JCEA 1NBEB 5C10A 4FWNA 2HWTA 2IAJA 2R9LA 3VEYA 4JV0A 3D1QA 4MKYA 4FNIA 2Z30B 1R59O 1EHWA 2WSEC 5BPLA 3ZZZA 5AQLA 1RP5A 2CRLA 1L3SA 4FOEA 1FX2A 5ADXH 4DR3K 2OD4A 3UKUB 5J2QB 1TR0A 3TP2A 5IFMA 1S5ZA 3VVTA 4PG6A 1ELOA 1H3DA 3O3FA 5HROB 4EO6A 1T9VA 3IA0A 4C97A 3MN7A 3T41A 1BUPA 2EI5A 1DTTA 4Y2IA 2RPIA 4IG0A 1SH3A 4B3MF 3E01B 1JLCA 1JJHA 4CZCA 1KLMA 3OTCA 2OPSA 1ZYQA 2GFFA 2DR6A 3HHLD 1RGVA 4PKIA 4BWJA 4JI6K 3AD8C 2EWHA 3QQCD 3OYMA 1N36K 3KXDA 2E2NA 2G1DA 5KFXA 2IVFB 1KAZA 4OJHA 3D6MB 1LFPA 4CLFA 3FRZA 1S9EA 5IS2A 1DGKN 2H3EB 3DFEA 4AHUA 5K14B 2D4WA 2WHOA 3ZTPA 4YR3A 4NMLA 3OSNA 2E5IA 3CCQN 4X62J 1LKZA 2X3DA 4DQPA 3JSBA 5E2QA 3QRRA 3KJFB 3H2UB 4FLUA 2ZUAA 2HGLA 4LVOP 1JXBA 4PWDB 3HP6A 2QJ3A 2J4RA 5HRPA 2PY5A 4NLBA 2OUGA 4CEEA 4RNOA 3GL1A 4EP5A 1S1VB 3VEZA 3QINA 3K5OA 4NXNF 3MWPA 3H4BA 2XMJA 4AF1A 1XK8A 2HPUA 4CJSA 1ZM9A 1SJFA 3V6DB 4H0XB 2VPYB 5ETKA 4O3PA 3QIPA 3HPOA 2QMWA 1PC4A 2G0CA 1OIAA 5D4OA 3KHRA 4H0PA 3W5ZA 2HZCA 3A3OB 3THXB 3OT9A 2MJNA 2WVDA 3J81j 2DPNA 1E4GT 1X4EA 1DTQA 3PRVA 4YR2A 1CJVB 3MR6A 3F44A 3TJ8A 1O5JA 3JS6A 1TUVA 3W63A 4CJPA 1DARA 3CMEN 1T3VA 4JS4A 3C19A 3UNGC 2EEYA 3AQOA 1HUXA 1FWKA 3FZKA 4ED3A 4I6MA 5MAOA 2IMWP 4KPCA 1WORA 3E9PA 3OA9A 1WC4A 4H5NA 4C8OA 2RDDA 3GLJA 3IBWA 3G96A 3BGRB 4ELTA 4UY8T 2R3VA 1JKHB 4B1YB 4N47A 4WCEL 1NJYA 5HOOA 1ZETA 4LJMA 4EHTA 3ZTRA 3TAMB 3D45A 1QE1A 3CD6N 3ZETB 4R25A 4LREA 4FPIA 4CM0A 4C8MA 4A8XA 3QT7A 2IMOA 5B08A 2HS0A 5LSRA 3OYBA 1ATSA 5K20B 3IS9A 2E5LF 1ZBSA 2YQ3A 4FZVA 1OJ4A 2WSCC 2YX4A 4E7HA 2HBLA 5M2PA 1Y5LB 4DPYA 1RWPB 4N76A 1R8BA 3FK4A 4DHYA 2PA8D 2VF3A 3PEHA 2AYMA 4N41A 1N54B 4Y0WA 3LA0A 2B4JA 4USVA 2X1AA 1WTBA 3PIOQ 4X4VA 3IM9A 2CQPA 2HURA 3CB4A 4M8LA 4OQJA 1U24A 4JI3F 2XYGB 4DR4F 1X4GA 2LVWA 3I4PA 2E1MC 1T6DA 2VG5B 3KMSA 5HVGA 2MZ1A 3QO9B 3NLCA 3MK6A 1YJTA 4M3RA 2YXLA 3A0IX 2M4MA 1BQNA 4FLXA 1LWFA 4DV7J 3S7RA 5L39A 1T02A 1NGIA 3LDLA 2QA4N 2L41A 3KG4A 3OYFA 4ISFA 3SEOA 3RGIA 2HFUA 4PHTX 3ZNUA 4OZJA 2NYIA 2O8FA 4ILGB 1VS3A 4Y2KA 2FC0A 4JKHA 4CZKA 2OYQA 5ETSA 2AT1B 4Y0FA 1XHXA 1F9FA 2BXJA 4TY8B 2WTFA 5KFCA 2ZE2B 5AE3A 1SB6A 4C3MA 3VQTA 3ZCMA 3UE5A 2ROGA 4CIFA 1N33J 3MEEA 3HF5A 3MM8B 1JLAB 2WVBA 4YB7A 1OY6A 3TJ9A 2H1YA 4BRCA 1YRTA 4OPKA 4B3TK 2VD3A 1C1CA 4DF4A 2UU9J 2HMPA 2O4GA 1WBBA 5HMZA 4BE0A 2V63A 3WBZA 1UJ4A 2OHDA 2RNEA 4O0JA 4OGEA 1JJ4A 1RWNB 2I2YA 1N0VC 5F9LA 3AA8A 4ZVFA 4DN0A 2HGNA 4LF9F 4LRCA 1UWBA 2DNZA 4NI2B 4JYAK 4W4MA 3IRXB 3PG9A 3GMGA 1Z05A 2NXNA 4H0TB 1D8ZA 2HNDB 4JK8A 1GEHA 3QFPA 1X9SA 2ZOMA 4UQGA 1IKVB 1UMJA 4DU8A 4JAXA 4PG4A 2V4JB 1T9WA 3ENOA 2VQEF 5B8HA 7FDRA 2CVEA 4PUOB 2KVQE 3GIMA 3VQDA 3H08A 4OYMA 2XYPB 3AV9A 3HHKA 2V4QA 3Q8PB 1YJRA 3I0SA 4DS4A 2F8SA 4HR2A 3ZTSA 3EZWA 4HT5A 1L3VA 1J2VA 4Y3CA 1BIUA 1MWZA 3Q2TC 5T7BA 1FXRA 3M1VB 4CGHA 2J0XA 3L2UA 4MH8A 5K5MA 5DGAA 2OP5A 4ID1A 4B3MJ 4IEIA 3ULEA 2FGOA 1S57A 3HHLB 4TN2A 4NXMK 4AQYK 2GMHA 1WWHA 1IBMK 1NSKL 2CZVC 1IVZA 2QKBA 3V1RA 5BPMA 5KFYA 3D7EO 4IG3A 3IXQA 1TL1B 3WQTA 3FFKB 1VQKN 3T3FA 3T1HK 2VJUA 4FWLA 1WSFA 4K4TA 5KFRA 4XPCA 3O5TB 4FP9A 4JEPA 3KD5E 1D4XA 2ZD1B 5CYQB 1F2HA 3GU0A 3QGIA 2AZ1A 3C15A 4OV6A 2DIVA 2Q6BA 1YVFA 1T03A 3NVKA 1VK0A 3CCVN 2V8PA 2VKRA 3RB6A 1QVFR 4M1KA 2I7PA 4U7UD 4KC5A 1HQUB 2KXFA 3AJDA 4X4PA 2PGCA 1I39A 4NOHA 2B7CB 2MQMA 3SQGA 3BKUA 2P2CB 1FD2A 3QPIA 2KXHA 3CCWA 4U9RA 1SQEA 1GH8A 5A8RB 5J2QA 2DPJA 1NOZA 5FPDA 2KZZA 2I6WA 2IJFA 1QQOA 4M7XA 5HROA 1D1UA 2HFSA 4ES3A 2W42A 1HKBA 4DUYK 3HRGA 2VV5A 1O13A 3E01A 4URSA 5DMRA 2LXUA 2AX0A 2X1BA 4U6PA 2LQ8A 1S3XA 4ES2A 2VFRA 3GYXB 4OYIA 2ZBQA 2OH2A 1I94K 3IUCA 4KGXB 4FYXB 4H4MB 4ZHRB 2NPIA 1U47A 3LM2A 4QU6A 5I4MA 4YP3A 5K14A 1N5SA 4WU2A 4OX9J 5FJ4A 3CD0A 4WCEQ 4DG1B 2OMOA 3MFIA 3AO1A 3MPDA 3MF5A 4YDUA 1HNIB 2DCLA 4PWDA 4MYTA 1S6PB 5LSLA 2E44A 3MPWA 1RDCA 2G0IA 1S1VA 5AXMA 3VPZA 4ZCMA 4PZVA 4JLHA 2LXFA 1MA9B 4Y65A 2E5LJ 5AE1A 3V6DA 5K8NA 4OPHA 4QIFA 1SL0A 3OYCA 2RUGA 3UNYA 4IH6A 4BR2A 3H90A 3THXA 2A3JA 4DV4F 3TANA 4U7CA 3CCES 1H2UX 5F8MA 3EVWA 5AE2A 3OXFA 2P9PB 4Z4FA 1CJVA 2NXEA 1CZAN 3GJRB 2DT9A 2OKQA 1U2RA 2VBYA 4FJLA 3M32B 4DV6F 1WSJA 4FWKA 4YR0A 3MD3A 1NRKA 1JCGA 4OX8A 4LH4A 4O4GB 5DS7A 2RE1A 3U9ZA 4DR4J 2ASPA 4DLEA 3GCWP 3LP3A 3OTEA 4CHQA 3UFCX 2N4CA 2QC3A 4CO4A 2H4WB 2OMLA 5BR8F 3BGRA 2NZTA 3DRRB 1BA1A 3WHIA 2V8VA 4I7FB 3MEGB 3HSCA 2ETJA 3SUQA 4O5BA 3TAMA 3I8DA 4NO7A 3CJ0A 4LIWA 3EGWB 3ZETA 4A4JA 1Y3JA 1CQMA 2MLXA 3VGKA 4LD0A 4LF7J 1VMBA 3PW7A 3S3NA 4OZ1A 2CZ9A 1CEZA 5A8WA 1WACA 3AY9A 3OTBA 1UAXA 2FZCB 3HOSA 4HHTA 2OZMA 5B09A 4J9SA 2ZH6A 3BYPA 3RRKA 2KHDA 3Q0AA 4WFBL 2J76E 3TUJC 4YDXA 2P1JA 2AYBA 1HI1A 3CF5L 5F8IA 4WPAA 2GWJA 4UOCA 1NDKA 4AHRA 4ED4A 3U9DA 1YHQS 4ZN3A 1SI9A 3EGVA 1M90O 3D2WA 3CDWA 3CJQA 5L46A 3D2EA 1U25A 2DRBA 3VF4A 2HWIA 2ZKUA 2UXBF 3K8VA 1NK7A 5GADP 2DFFA 1Q7LB 1YITN 2FY8A 3MOZA 1VQ9S 2L9DA 1RBSA 2HSTA 1GLEG 2BW2A 4JI7F 4LF9J 3QO9A 1HBNB 3Q8UA 1YVNA 1BI4B 3WUHA 5F8NA 4ILLA 2DJWA 4I4BA 4NEZA 3RRGA 2V51B 3R5JB 4CD1A 5G4DA 3G6XA 3LP0B 3CCMN 3L8BA 4M3XA 4QBUA 3QSYB 1G3OA 4K41A 4BROA 4LR7A 2D7SA 3WX8A 4A8WA 4XH1A 1S49A 1SVDA 3QEIA 1HYZA 2VFVA 2UYTA 4FJIA 4A8FA 2NRXA 2GV1A 2KDOA 2BE2A 3D2FB 3UI3A 2VQEJ 3FUYA 1YJWN 1RTJB 4DR6K 3A5MC 3CPWR 1QZ5A 1WAFA 2GX9A 3GE1A 2ASYA 1BY9A 4TY8A 1RQ0A 4DR2K 4FLVA 3NGRA 1K6YA 4O3SA 4CHPA 8RUCA 4OYWA 5IC4B 4DPTA 1JWWA 3MOJB 4TQRA 3M2VB 3MM8A 1JLAA 2AKWB 2Y1JA 3W0LA 4IXCA 2KO1A 1U1RA 4BR9A 2DXDA 3F73A 4B3SK 2OTJN 2W9AA 1Z2ZA 5C15A 2NLWA 1WC1A 4EZ9A 1XNRK 4LFCK 1WSIA 3M7VA 3ICLA 2VDIA 3T7ZA 1QLNA 1QAXA 1C0FA 3H8YA 3OHRA 3B8HA 4TSXA 3EM1A 5GAGP 2AF6A 4NI2A 3T6JA 3IRXA 1J5EF 4I69A 3MN6A 3EVMA 4CF8A 2A2DA 2HIYA 2MQLA 5JS1A 1Z6RA 1K1SA 5HJYA 2V7YA 2YBVA 3MMJA 4WF9L 2HNDA 4LF8K 2WW4A 3U02A 2QN6B 1C0MA 4CEDA 3DOLA 2BQ3A 1IKVA 1XI1A 3L2VA 2JFDA 4B17A 2V4JA 2KU7A 3KUGA 1FFGB 2BW7A 2P51A 2NCKL 2GV9A 1B7YB 1OY9A 4EWTA 4ZIWA 1VC0A 1AZSB 2BTFA 4K8ZA 1XNQF 3EZ5A 1VRUB 3AVJA 2X78A 4A47A 2V2VA 4NLSA 4O23A 3PJXA 2HQFA 3KK1A 2RKIB 3DI6B 1PYTA 4CZLA 1GMUA 2QT7A 3M6UA 5DG7A 3I5CA 1WG5A 3SCKE 4M5DB 2Q3PA 4GV6A 1LAWA 4FO0A 2CDQA 3QEPA 3PUFA 3BB5A 4RX6A 4MMOA 3S01A 4CK3A 2FHKA 4IQMA 1TL1A 3P6YC 3NOGA 4B1XB 2YWKA 2ZOGA 2DFEA 2ZM6K 1Q8BA 2J0SD 4CBWA 2ZD1A 2R42A 5D3GB 2WZ1A 4ISEA 1N34K 5CYQA 4K5SA 1YIJN 3LUYA 4P2SA 5TKWA 3CD7A 5IM0B 3BSAA 3JSMB 3D0PA 1TU0B 1TKXB 2LP4A 2XYHB 4ZA1A 1X7VA 4GV3A 3WQPA 3ENAA 1UVJA 1WHXA 3W65A 4DV0F 4CW7B 3L3CA 2MHNA 5D0EA 2JWKA 3AVAA 1HQUA 4D3HA 5EDWA 4PXEA 1BD6A 2BJ7A 3DGVA 1TL7B 4RU2A 1RBLA 5IXUA 2UVRA 3RB4A 4USHA 2X1FA 2GGPA 2CJKA 1TKTB 3TQ1A 4DV4J 3W5XA 4OLOA 4N56A 3N4QA 4ZLJA 2XSFA 2CJAA 3E8OA 4ZVRB 2G2YA 3CCLN 1F2GA 4DV6J 2CAJA 3MR5A 4A61A 4QAGA 3OYHA 5IT9O 3SIPB 2LA6A 4KAIA 2F65A 2HRYA 1CZBA 4Z4CA 5HANA 3FCHA 4BRNA 5EX5A 4H4MA 4ZHRA 1X60A 3NCPA 2VBWA 4WJBA 3RSEB 2HBZB 4F4YA 1EO1A 1URNA 5KFDA 3B4MA 3PXGa 5A76A 4CFBA 3I32A 4IR9A 5A2QU 4BRIA 4FM2A 4OYAA 2R2UA 1QQNA 4ZJQA 3PRDA 1H2VZ 2F96A 1KKHA 2JLEA 2ATLA 3A12A 1R8HA 2DO0A 4XPEA 3PX4A 4NA3A 2O8CB 3PR5B 2I38A 1Q8KA 3CXCM 1KQSM 3CT9A 3QZ7A 3RB3A 5EWFA 3OQ2A 2ZDOA 3IBCB 4AHSA 3MECB 1NUEA 1D09B 3OTOK 4WFBQ 2H4YB 2P9PA 3LDSA 4WFNL 3CF5Q 2YPZA 1U6BA 3WC2A 3NCQA 5HLFB 2NRWA 2M5YA 4C8LA 3OHAA 3MXHP 3RW7A 2UXBJ 2QXLA 4ED2A 1NH7A 1N48A 4UW2A 4O4GA 2PMHA 3VQPA 5ITHA 4NCAA 2UUTA 2RRBA 3AD7C 2UVUA 4I68A 1K8AO 3PY8A 3ZX3A 4JI7J 1KTQA 3IFRA 9RUBA 2Z8QA 1BE4A 2CPHA 3DRRA 4BWMA 1S99A 3HXMA 4I7FA 4JKAA 2GW8A 4FW2A 1VRTB 2YNIB 2BDPA 2B4VA 1JB0C 1VQLS 3ZFVA 5AZIB 2LQJA 3VQ8A 4DX8H 1B9FA 3RZAA 3NS6A 4O3QA 1OH8A 1NK5A 5IOLA 3V5RA 1TUYA 4YOUA 3HJFA 2EKNA 4DBQA 4K8RA 1HHSA 3L2RA 2EW9A 3GB0A 3J80U 3LDPA 2V2KA 3RBXA 3NCIA 1RDUA 2DR9A 2Z4PA 4ECXA 4Z2XA 1W2BR 4A8SA 2ZH8A 1PAUB 1HW8A 1XMOF 3QGPA 2KKZA 1YI2N 4AHCA 1PIEA 4C8ZA 1YUWA 4CLLA 2NXCA 1NOYA 4W5RA 4WP3A 5K8PA 5AQZA 2RRNA 1Q5VA 1Z2LA 3H2LA 1S0NA 2BV3A 2PFFB 2JDJA 3UDVA 1JNZB 4BC9A 2Q43A 2Z57B 1DRZA 5KFBA 3MX2A 1TAUA 4LSLB 4EAHD 2LECA 2PFUA 1HBNA 4URQU 1BI4A 5BXIA 1J5EJ 3U3YA 2QYGA 1RI7A 2ZVSA 1C0UB 1U45A 4OJRA 3N0VA 4K2XA 4JUZA 2EFQA 2DXFA 2JWLA 1VQ6S 4RW4B 5GINA 2CGKA 2UUWA 1FTCA 3J7YP 4OYPA 2CPFA 1NDLA 4WF9Q 4ZITA 2DTJA 2HMIB 4UTGA 4F3TA 3HD1A 2A6OA 2Y1IA 4GC6A 2E5JA 4YB1P 1LEOA 2ATQA 2Y8YA 3D2FA 2FC9A 4CJTA 1RTJA 1Q18A 4BBYA 4DUZF 3KMQA 2HHHK 2DGXA 3DRSB 4XDCA 5HBMB 1C1AA 1Y7PA 3M2VA 2YWHA 3D68A 1XWLA 2IS3A 4K2JA 2HHWA 1KVJA 1S9FA 4B9NA 4Y2CA 2OPPB 1IN0A 3M9NB 1CZ9A 2XG8A 4HLBA 1IJJA 2Y0SD 2VIHA 4JI2F 4IOCQ 1JLFB 2ASLA 4Z4IA 4JV5K 4IO9L 1ZBIA 3GSDA 1VC5A 3V4MA 2CQCA 4GVBB 2D0CA 3VZIA 4PXBA 1N6QB 4CH0S 3ENHA 2DGSA 2XMVA 1IBLK 3KG1A 2NUHA 2YNHB 5KFSA 4F50A 2X7IA 2H51B 2Q0RA 1EARA 1LK7A 2B4UA 3O4WA 3CO0P 4HTUA 1RABB 4CBUA 2LEBA 1KVAA 1EKRA 2DTUA 1S76D 3B8AX 2KM8B 1NU4A 1WN7A 4DV0J 4FPRA 4CEFA 3P96A 2I7NA 4A8KA 2E8AA 3GFZA 2RN2A 3EZOA 4ZVTB 3LM9A 2G8UA 2BABA 3HTVA 3LO3A 2LMIA 1VQ5N 1AZSA 2EFGA 5KFNA 1HBUB 2H5IB 4KRWA 1QTMA 1MMNA 4DZ6A 3QNNA 2RKIA 1Y0HA 2UXCF 3OYAA 3D6HB 1F5AA 1RT4B 4O0NA 2XZTB 1VBXA 5B0BA 3A3NB 2UUCK 4QCLA 3O4NA 4CESA 4E19A 5IT0A 1HR0F 1IKXA 1V5IB 4M5DA 4I67A 1B9DA 2QWMA 5IT4A 1RISA 3CDUA 2Y9HA 1HBOB 3OV7A 1LWCB 2AA4A 3CETA 1I3OB 5IWAF 3IG1B 4DCJB 4XIUA 3C6AA 5AXKA 1B0VA 3KZBA 4FNHA 3TTCA 2M2BA 4DSJA 1X4AA 1QY7A 4HI1A 5L1JA 5CABA 2HQGA 3NNAA 2RRAA 5H9FK 1UPMB 5D3GA 1X9WA 3BBCA 1LWEB 4ZDNA 4CT9A 5IM0A 5D6GA 3JSMA 3EXYA 8ATCB 1TKXA 4JKEA 3EDQB 4I9QA 5C2CA 1B99A 1X4CA 3SQOP 2F9DA 1C6VA 1TL4A 3N6NA 4OFZA 2CQ3A 4J9VA 2UV8A 2HRTA 1VHIA 4O4RA 3GFXA 4X66F 4BRFA 2QKKA 3BZCA 1E6VB 1RBOB 3ELHA 5LJVA 4RKUC 1EP4B 1TL7A 2CGJA 2BM0A 4PY5A 5DQIA 3H4DA 1FXLA 1W7WA 1TKTA 3JAMO 4M5IA 1IWGA 4DV2K 1EXQA 4Y1CA 5GIOA 5DRKA 3GP9A 4C3KA 4JI5F 1KWMA 3OL6A 3GJSB 4W98A 4WFNQ 4WQ4A 1C4CA 2LKZA 5KG5A 3I31A 5C7PA 3NY0A 3WXIA 2HK3A 1C0TB 1QUVA 4E8UA 3ZNJ1 4OHZA 4CNYA 4U7BA 3G8QA 3PYDA 1P8GA 3NEKA 2QEXN 1U8SA 4FJJA 5KFUA 5A0YB 4ANCA 4JI1F 4G1IA 3T69A 3M3ZA 5AQGA 3VTIA 3RSEA 5BN8A 2UV8G 3O3HA 4WQ5A 5SZTA 3DM2B 5FLXO 1RT3B 3GILA 2V2QA 1H6KX 2JEIA 5M1QA 4UZCA 4CIEA 3Q7CA 4CJ7A 4OZ0A 1T7PA 4WZMA 1S77D 3AOAA 2XY8A 3TUPA 2VFSA 4ETZA 2D3UA 3KWIA 3IR6B 3HSJA 3FE1A 3NOCA 2EVZA 1PBAA 4MT1A 2K3IA 1C4AA 1TL5A 2GHPA 2HIQA 3MCOA 3K9KA 4DSEA 3S8SA 2O8CA 4ECYA 4DI6A 4XTTA 1YT3A 3QWUA 3BSOA 4RBTA 1FNXH 1R0AB 4HTJA 5SWMA 2V5HG 3KLIB 3GV5B 2MHEA 1XMOJ 1T0TV 3CJ8A 4DUTA 3PJ9A 2DHAA 2V69A 2CQBA 4I2QA 4GVEA 3O8MA 4QWDA 3T19A 1QSYA 4K50A 2DR8A 1ROFA 3IFEA 2WUSA 2E6MA 4PL7A 4CEBA 5HLFA 3RAXA 1OPIA 1S72S 4L75A 2YQ0A 1S6QB 4M3WA 2BUPA 2GUPA 2EFPA 4CZIA 3ALYA 3B4DA 3I4HX 3HSDA 2XCAA 4AYBD 1VJQA 4ENOA 2FHOB 3NS7B 3EPGA 4NZ0A 1KONA 3O80A 1UCNA 4ZMMA 1RLCL 3SFGA 3MUVP 3AH6A 1YZ7A 1VRTA 4ECWA 2J7UA 1BWFO 5FPEA 4BC2A 2A3ZA 5FPNA 3CJBA 2O66A 1K1QA 4GNIA 3MPUB 2HFNA 1T9YA 4J9OA 2KJWA 3DMJB 4R0JA 5ETQA 2NLXA 3VEOA 3T1YK 1DKGD 4WYLA 3N01A 1XR7A 4DTSA 2VG7B 4EFAC 2JZ5A 2RQ4A 2CH6A 5LOQA 3JTPA 2MZRA 4WTYA 5G0RB 2C22A 4FLYA 5D4NA 4CZMA 4DUZJ 5D77A 2FBXA 3N6LA 3KJVB 3AVBA 4CHOA 3AJ1A 1RNHA 2X1GA 2OI2A 1Q53A 1FEHA 4ZCKA 4JI8K 3FQKA 3AVFA 2KT5A 1S7IA 3FZMA 4RCHA 3LDOA 1KN6A 3I87A 4HACB 3VAKA 1RGIA 3CCUS 1WHWA 1FJCA 4QS7A 3UN3A 2D41A 3NMUA 4E1JA 3NGYA 4KV8B 1FRHA 2ALYB 1R3NA 2M8DB 1TUUA 3HDSA 5KRSA 3QJPA 1FVQA 3H5YA 2A0FB 4HCBA 5F8JA 4IO9Q 2CJYB 5ETRA 3RJMB 3IWXA 3NF9A 1PBUA 3J7ZT 1VHFA 2V68A 1C0UA 4B3MK 2FVSA 3B54A 4X4UA 1KAYA 1HA1A 1N5TA 3MM6B 3V2UC 3DCAA 4BC5A 4RW4A 1SC3B 1EWRA 5DLFA 3EJMA 2YHBA 2ROPA 2NZCA 2CH5A 3KD1E 4D3GA 4LY7A 2MZJA 4C3LA 2Q79A 4O3OA 3OVBA 3QICA 2XZWA 3NRBA 2VDHA 4NA1A 3LF0A 4M5HA 3V81B 1GMVA 2AHOB 5L9XA 3UQSA 1JLQB 3M9MB 4WP9A 2BJ3A 3VQ7A 3OUYB 4CLTA 3DRSA 2G8KA 5HBMA 3HYFA 2J9DA 4YEAA 3DLBA 4R79A 3NWRA 2UXCJ 4B1WB 4NXNK 1SJ4P 2E6LA 1RHMB 3QBXA 3A1YG 3BO2A 2OPPA 3WXLA 1TVRB 4DL6A 4DPOA 4CD3A 3DAWA 3CCSN 1Q16B 3S41A 4DV5K 2ZH3A 1REGX 2OPQB 4J5OA 3LGNA 4HVJA 2CQIA 2E5HA 1JLFA 3QEWA 1WF2A 2YKAA 2Z2MA 1M1GA 2EK6A 1A5XA 1N0UA 4GVBA 5FPMA 3H40A 3R5GA 1UVKA 3VGLA 2YNHA 5KFLA 3CULA 4LFBK 4BGAA 3QAUA 3FSYA 1YJNN 1RUSA 1RTDB 2XY6A 2DNKA 3BM7A 2DGQA 4Z7CA 1RKIA 4ED5A 4QZVB 1X5PA 4A62A 1SBRA 2Z2YB 2ZBRA 4JKBA 2WW8A 4Q45A 3D54A 4X66J 1NPPA 1PYOB 1EQMA 3CJSA 4FK2A 3LPYA 2QA1A 1IBKF 2BZ2A 3AOCA 3RWUA 1X4DA 3UCUP 1PJ7A 1S79A 3ENVA 2HLUA 5AXNA 4I56A 2V4RA 5KG2A 2A10A 4DKWA 4A2BA 1VQ8N 3ZSRA 3OTDA 2FQQB 1HBUA 1KVKA 5KGXA 3WT0A 4EBDA 1G15A 4MO4A 4ZLPA 3UR0A 1RT4A 3BF1A 2VGMA 1ZZFA 5AQYA 1UFLA 1HNXK 4BRQA 1WSHA 1W7AA 1YRXA 3TZXA 5IT9U 7FD1A 5KOXA 4GKKK 4G6VB 4IKAA 1VISA 2CPJA 1HBOA 4ATNA 1DAXA 2OFGX 4LVNP 1S59A 1NGAA 4CLSA 3O9UA 1RSCA 3TOQA 4CHZA 3ILIA 1RLDA 2F40A 4JI1J 1BCMA 4GW6A 4HUEA 1FXXA 3F9MA 1KNZA 1L3KA 5KFOA 2A42A 1LWEA 3Q8SB 5E5NA 2XCPA 2QIFA 1NJZA 4FZXC 4ILHA 3RMCA 4JI3K 4H4KA 4PEOA 3MXIA 4BS2A 3LQVA 3PR4A 1MDUB 5EWGA 3DRPB 1KC8T 2JVRA 1E6VA 1OSCA 3DLHA 4OPAA 5EHHA 2K7KA 5KG0A 1HFEL 3SV4A 3D6RA 5F2RA 2P9UB 4OV1A 1EP4A 3E1YA 3OLBA 3OYKA 1U0SA 5HRRA 1X1PA 4F3QA 3L7OA 2K06A 5CYJA 5KFMA 2YQ1A 2UUBK 1HWLA 4WYBA 4QR0A 1DJ0A 2P6TA 4A48A 3MFHA 1AFJA 2ZHAA 3ONQA 1S9GB 2RQMA 1U6ZA 2HVIA 1HD1A 1UFWA 1C0TA 4ERDA 4FCYA 4GC7A 2GAGC 2RQKA 2XO6A 3SI6A 2P9CA 4CLKA 2AV5A 2IDLA 3ET6B 4F2SA 4ZCIA 3DM2A 4OIXA 1RT3A 1X9MA 4YDUC 4RBVA 4CZHA 1OH7A 3M2UB 2MQOA 2HQCA 4OPJA 2ZF5O 2Z2ZA 3QJJA 5AQKA 2WC9A 2KG1A 1S97A 2QLXA 3HHDA 4BVPA 2H48B 1KC8O 1J9AA 3B6OA 4BE2A 5ETMA 3Q8VA 4LF9K 1SJ3P 2HQIA 3LAMA 4ILMA 2W24A 3HOTA 2YX6A 1ZAWA 2J7WA 2COLA 5L38A 5CZXA 4LBHA 3I33A 3WXJA 3C6UB 4Y00A 1R0AA 3EICA 1ZTWA 4ECUA 2CQDA 3BEXA 4DCHA 4E98A 3NBPB 3QMLA 3NGZA 1A6LA 4IQXA 4DL7A 1D3WA 1T94A 2DNMA 1G99A 4CTAB 2XM3A 3SSSA 3C65A 3NF6A 2BKOA 4X4OA 2Q36A 4X84A 2VC0A 1LFWA 3DGPA 4H54A 1ZM3A 3A3PB 2MYFA 4DEZA 5LJ5Y 1S6QA 2E88A 1C1BB 4NEYA 3GR0A 2X3GA 4WFXA 1JNRB 1P9YA 2RF2A 3AVKA 2D3O1 2HNYB 3R3TA 3R9PA 2XMTA 2BA9A 1Z1ZA 3W3DA 3H0PA 5KRTA 1Q0NA 2UUAF 1NSAA 1FX4A 3PJWA 5LMNF 2X51A 3CC4N 2OELA 3VGMA 1VQPN 1BUXA 3QT6A 4MKVA 1AFIA 4M45A 3DMJA 1HI0P 4CBXA 2UXDK 3GOIA 3H3NO 1AW0A 1NO8A 3CIPA 1VQMS 1VQ7S 8AT1B 1JL1A 3D1OA 3PW0A 5G0RA 3OR1A 2B8QA 3GCXP 3U7JA 4B9UA 1SAZA 1VQNN 3KJVA 4BREA 3O8WA 3U1LA 2UVWA 3GQCA 2V9KA 2NXJA 2KLAA 3L3VA 4Y2AA 6FD1A 3FC9A 3UR3C 3IR7B 3RW6A 2IVMA 3HD2A 1GQEA 1VSKA 3LWLA 4YUDA 3LZJA 3DLKB 2IM3A 2YKQA 3QFWA 1RA7A 2J6SA 5B0GA 4ZPBA 5M1NA 2QM1A 4OKJA 3RBZA 2K8GA 4CH7A 3SPYA 1EKEA 2P5GA 4KGKA 1V5VA 4JI6F 2GQ2A 2VASA 3TW0A 4KV8A 1SV5A 1N36F 4WK1A 2LEPA 4CLYA 4M41A 2E2QA 4QOZB 1TKDA 3G6ES 3UB5A 3HZEA 1OH6A 3HVTB 3IAS9 3HI9A 1Y3KA 2C2EA 3MM6A 1NB7A 2DK2A 3GG0A 5BYSA 1NGJA 3MTKA 2VQFJ 2OGUA 3DC2A 3T5LA 2V34A 1JK9B 3WEEB 3UKRB 1SS6A 3ETMA 4FM0A 3I8BA 3FGUA 3VQEA 2A40A 4MIBA 3JSRA 3LP2B 1UL3A 2CPDA 5KI6A 1SUQB 4QIGA 5I3QA 1IBKJ 2R4FA 1FFSB 5GAGI 4LQ9A 1WDDA 3KLEB 4C4WA 3V81A 3W9IA 2GMLA 3VF2A 3KDOA 2OPRB 4QIVA 1JLQA 4QS9A 1N32K 3BF4A 3OUYA 4CK1A 2XS2A 3THVA 2VWBA 4ZVPB 5DDQC 3SBMA 5AQWA 3SLCA 3HL8A 1S1XB 1SPBP 1D0EA 2HVEA 4JK7A 4ID5A 1TVRA 3EKSA 5F0UA 1RCOB 3UCZP 4H4OB 1CLFA 2WAQD 3P38A 1MU2B 2N7CA 3QBCA 3LZIA 2OPQA 3D6FB 1MG7A 5IZHA 4CFCA 2CJQA 3MN9A 4NYOA 1PO6A 4WIIA 4H0YB 5GAEP 1A7GE 3P8BB 3DRXA 2DEIA 4FVUA 1BXNA 5IQ6A 2HK2A 4WYWA 3BYRA 2P9SB 3GR1A 3AB4B 2BUNA 3A8YA 5AT1B 3KK2B 1NK6A 1R6YA 2FBVA 4F0HA 1RTDA 5LJ3Y 5KT7A 1RB0A 3L9ZA 3PDNA 3Q8QB 1B7FA 1CG2A 2OFHX 2R8IA 3CJAA 1S9EB 2YNGB 1DURA 4KREA 2U2FA 3GTYX 4MYUA 1NJIT 4DR7K 1BLUA 2M88A 5AXLA 3MGJA 4BACA 3F0NA 5BR8K 3NGTA 4P7VA 3H2VE 2C1EB 3VTHA 2C3OA 3M6XA 4K4SA 3SK3A 2L48A 3ILOA 3P39A 3TR8A 1WI6A 4R5PA 3HSTB 4BR7A 1CJKB 1KSPA 2W6KA 3JAMU 4H0VB 3AJ2A 1SQGA 2O5DA 2OD6A 1NGBA 2G8IA 2R7OA 4ECVA 4QQBA 5KT4A 1VJWA 3VGVA 4K7QA 3T6BA 4DTUA 1RBVA 3HHLC 3EMTA 4BC3A 3C94A 2VHGA 3K2PA 1FDDA 5BJRA 3AD9C 2D0BA 3KLFB 2CJXB 2G8WA 2M3DA 5DGBA 3W2WB 2W2NP 2CQ2A 1VQOS 3A5LC 1ZTTA 4KHUA 2C3PA 1VAZA 1WAJA 5JICA 2ZQBA 1XTZA 5FLXU 4I6MB 1WUAA 4DV1J 3M9OB 3CO9A 3M2RB 3QFHA 2E1ZA 3SZ2A 3OL7A 4JV1A 5KT3A 4NYZA 3AA2A 3NMAA 4LMZA 4FWMA 4JI4F 3QGGA 1VSMA 3DDKA 1NJIO 3TVYA 3CHWA 2FHJA 4JI7K 4K8XA 3BJYA 2FJXA 3DRPA 2CNKB 3I0RB 5H9EJ 1VR6A 1JLGB 1HNZK 4UUXA 3ZTOA 3THYB 1TZ0A 2P9UA 1QS4A 4IFYA 2Y1RI 1VQ4S 1WNEA 4Q43A 1M0SA 4CLZA 3RAQA 4DHVA 3CC7S 2PC6A 3CI5A 3A8JA 3VOVA 4B3TF 2M70A 1CJTB 2GJFA 3T5KA 4MIAA 3ASMA 5GMKa 2GTDA 2KRBA 3M8WA 1PCAA 1S9GA 2OZSA 4RU9A 2ZNYA 2FLLA 3TUIC 3S3MA 3NFAA 1JXLA 3TAQA 4CEZA 3DXSX 2EFVA 1WLJA 1ZM4A 2C3UA 1V9OA 4MLEA 2GIFA 2L9WA 4LR8A 3GIKA 3C3LA 4RUCA 4UOGA 2NRZA 1IV0A 3ET6A 3O9SA 2I9SA 2UUAJ 5GMDA 2EHGA 3G71S 1W97L 2XB2D 1DHMA 5LMNJ 1F1BB 4KFBB 4KHQA 1R8PA 3A8KA 1OVYA 5JXSA 3PM9A 1VSHA 4P75A 3CCTA 4KTZA 4KGMA 4BRKA 3FBEA 3R1LA 4DQQA 2F8HA 1RBRA 2YWGA 2PI5A 4J37A 1LWFB 1YLXA 3V6HA 1XHZA 1P27B 2N4DA 1O51A 1FJGK 2VGNA 3CJCA 3UO0A 1YJ9S 5J2NB 1NDPA 2PO4A 2F63A 3C14B 3KHYA 4Z4HA 5DZ6A 4E1MA 4BHQA 4DR3J 2H54B 5AQRA 3C6UA 2FY1A 4QWCA 1KD1T 3H20A 3K5NA 1KOOA 4WKRA 1Q79A 2W8KA 1WOSA 4L76A 4BRPA 2P8IA 3W9HA 1IR1A 3H42A 3FQLA 4HHHA 4DB3A 3RMDA 2PI4A 2HW3A 3VQBA 3OJSA 2EFOA 4YMEA 1XR5A 4UT4A 3E3XA 5HAOA 1VSJA 3BR8A 3ZSVA 4OYZA 4NXMF 1XNQK 4ZS6A 4JI6J 4HT7A 1WF0A 3IO1A 1IBMF 3WQUA 1KVBA 2FVCA 1N36J 1C1BA 1NHKL 3PIOL 3OXLA 4PPZA 1JXVA 1C1CB 2HNYA 3T1HF 1O1WA 3KWGA 1EZZB 3DWLA 1IM4A 3M8PB 1NKCA 3VR1A 3R7NB 3VZHA 1FKAF 5M1PA 1RAFB 2Z1JA 3NGKA 1IJEB 4M5JA 1CJUB 3FNNA 2PMWA 1TV6B 3G0ZA 5ETPA 4U8VA 3CC2S 3KOAA 3AVHA 3AO2A 1NK0A 1HQ2A 4KHSA 3MN5A 2E7VA 2YHWA 5FD1A 1JQGA 3O9QA 3HSGA 2R7WA 1KD1O 1P9QC 4DV3K 4A8OA 3QETA 4DV0K 5E84A 2BM1A 3J7YI 4TXSA 2CGLA 1FERA 2DY4A 3DLKA 2AJ1A 3FGVA 4EI2A 4DUYF 4OO1J 3X3UA 2X74A 4N77A 3MI7X 4WXOA 1T9UA 2Z1GA 1T05B 2HZAA 3NNCA 2QA2A 3WIVA 4LRDA 5BPNA 4DSIA 2V8HA 2E4LA 1I94F 1LW2B 5RUBA 2R7XA 4FW1A 2UU9F 1XN9A 3KUHA 3CXCR 1KQSR 3WX4A 1SKUB 5B0DA 2J8SA 2BACA 2AEMA 4J9NA 3HVTA 4Q5VA 4NLDA 4W5QA 4FK4A 1Q95G 1BU6O 3KNAA 3DXMA 4DTPA 3R6GB 1RDWX 2RDIA 3M5RA 2B6AB 4B9VA 3WEEA 3UKRA 4R8UA 2DIUA 3VCDA 2DR7A 4OI3A 2GVDB 3LP2A 1QDUB 1SUQA 1S22A 4RO0A 4TU7A 1HRHA 3KLEA 3C46A 3LDNA 3CMAN 1YTAA 2W9BB 4G9ZA 3VA3A 4RWTA 3KK3B 2OPRA 1RCHA 1CPZA 3I96A 1RT5B 1FEEA 3R7SB 3M30B 4A57A 5IQQA 2G13A 3VV2B 5KG4A 1VHXA 3BN7A 4KB1A 4QJVA 3CWJA 3VQ9A 3SQGB 1S1XA 2ASMA 3CCJN 2ASOA 5KT6A 2HVDA 1R8AA 2LEAA 1GXLA 3AODA 2DYAA 1XJWB 3HBTA 3AVNA 4H4OA 3VWSA 1FTRA 2LA4A 5AQHA 1MU2A 3L7PA 1JLEB 1NK9A 2QI2A 2KT3A 2ZWPA 1N4LA 2DHGA 4DL2A 4CZJA 4JV2A 1FA0A 4HEA9 3LH2S 2F9WA 3E51A 3F41A 2QL9B 3FRYA 2P9SA 3M4XA 4ZVOB 3KK2A 3SFUA 1WUUA 1F5CA 2NRRA 3HM9A 1UW9A 1OH5A 1VQSA 5HRSA 4JI4J 2EWSA 2BE7D 3FEXB 4NASA 2YNGA 3ZO7A 3VALA 4ZP8A 1HHTP 2GQQA 1HWIA 3VAIA 3PZPA 1ZBFA 4A8QA 2VA3A 6FDRA 4Q7AA 2CUYA 3D66A 4QPXA 2I5JB 2XMKA 3HCXA 4LBIA 2VICA 2W6LA 1UVMA 3RMBA 2DHXA 1QAIA 1CJKA 1KHWA 2R2SA 3PYEA 4L8RB 3MWTA 4QYZK 1J5OA 1LXNA 3QZ8A 2DGOA 2GEMA 2MZQA 3BN4A 4FYYB 4B3TJ 2OEKA 2AEJA 2FF6A 5JVGL 3TYTA 1XMQK 2LXIA 2JC1A 2R8HA 4PG5A 1CS4B 5AQVA 1YQHA 3KLFA 1TFWA 4ZPVR 3W2WA 1AB8A 2MQ8A 1S48A 3K5PA 1QHTA 4KJIA 2QL5B 4OZ5A 3VQ6A 4EO8A 4YFUA 1DQ8A 2XULA 2WB1D 3JTNA 2B43A 3J81O 2C42A 1TP7A 1R43A 3K9JA 1O6XA 1WI8A 3M2RA 2B5JB 3BDPA 2Q1LA 2BRKA 3LDQA 3G6VA 3WIUA 4IOBA 3TTDA 2FSKA 2IPOB 1OQ6A 1GTEA 4DPWA 3PO4A 3KWMA 3I55S 3OR2B 3FJ2A 4OX9F 5DETA 2D0PA 5AZJA 3I0RA 4C0OC 1JLGA 3U1MA 2QZ8A 3CFPA 1WKJA 4DR6F 2VCPA 2DO4A 3THYA 1I1GA 2VKZG 4OJGA 1Q82O 2ZH7A 5CZ1A 2XWYA 2VU5A 3B78A 3UD5A 1QJHA 4B3RK 2EBEA 3GV8B 1AXQA 1GLFO 5A8WB 3K58A 3H5XA 4JI0K 1H74A 1LW0B 3ZZTA 4WQ4C 4XAKA 1B64A 3G4SN 4CFDA 1H7WA 3TWHA 4IKFA 3FEYB 1HBMA 4HUGA 1WC5A 1CJTA 1EKSA 5IT9Y 4ID8A 3MMVA 2RJZA 3DOMB 4IUFA 2HFVA 4NXMJ 1XNRF 4LFCF 4LFAK 1IBMJ 1OY8A 1SC6A 2IC3A 2AP1A 3R5DA 3H45C 1QQCA 5KT2A 2M9KA 3NH2A 4WQ5C 3T1HJ 4C0BA 1BDGA 4EHUA 1R27B 3R9LA 3D2EB 2BRLA 3OL8A 3FZFA 5KPZA 3C7NA 2Q3SA 3SMZA 4U67L 4KFBA 1RWKB 4KB7A 4PKGA 4KH6A 4F67A 4LRBA 2F4VK 3RVCA 1T95A 4JI2K 1YJUA 5AQPA 4LF8F 2RB7A 1HW9A 5LMUF 3L3UA 1NKEA 2A6MA 2ZZNA 3R7BB 1BA0A 3LPEA 5I3PA 5HMXA 3OXGA 4C48A 3OHBA 2QLBB 2XHCA 5J2NA 4G1PA 3C14A 4ECTA 1YTYA 1RHQB 1BWEA 2M0GB 5IC6B 1UEKA 1KP6A 2CNLB 4LF7F 1F6TA 2YWWA 2XMUA 1XQSC 3BSNA 3TA1A 3PFOA 4ZPAA 4F3OA 4DTRA 4OYXA 2BE2B 4TNOA 4QS8A 3V9ZA 1GLAG 4DUYJ 3OPKA 4K0KK 2P9LB 3DRYA 2NS1B 2XO7A 2DNQA 4XH4A 2U1AA 2X6NA 4DU4A 3H5UA 2CDRB 1SC1B 2P9KB 3TAEA 2E9RX 1I94J 2IBKA 3S1TA 2IVYA 3IBFB 4FVMA 1RAEB 3F5TA 3LW5C 4FL9A 4Y34A 2CQGA 2ZM6F 1UKUA 3M8PA 4I2PB 1HR0K 4WBFA 4J9QA 2DNYA 2ABYA 2NRHA 3PX6A 4CEQA 4C0HA 3HLUA 3CCQS 2AYEA 2RS2A 4P6QA 1CJUA 5D0RA 5IWAK 4KI6A 3M8RA 4I9LA 2MSTA 1TV6A 3MXMA 4NL5A 4FN5A 1B4SA 2JEGA 5AQJA 4USMA 2ACMA 2V0NA 3K57A 1PJ6A 3L0QA 3HFKA 3OVSA 3NGIA 4F9OA 3DOLB 4KAZA 4B9TA 4X2BA 4W5OA 2GHWA 4KH1B 3W66A 4IFEA 2QFJA 5DDPC 5K8MA 5F8LA 1U1OA 2FUG9 4FPAA 2HHUA 3F56A 3GZ7A 2NUUG 3Q83A 2PN6A 2HS3A 3PVXA 1T05A 3CMES 3KK1B 4JKCA 1FT8A 3S9HA 2MJUA 4LSNA 2DEJA 4F4KA 1GAOA 2AJFE 1LW2A 2MKIA 3Q89A 3AO3A 3O1WA 3ZZPA 4NZ6A 2WK4A 4NPOA 2YKMB 2AJ0A 2YJEA 1P1LA 1UVLA 3KHGA 4JI5K 2EXUA 4OX6A 3TU5A 4IH5A 2G9OA 1RE1B 3PNIA 2J6UA 3N5BA 2XHWA 4HUFA 3GFYA 1Q86T 2B6AA 4CIGA 3CD6S 3D7SB 5CAAA 1VOMA 1F60B 4K59A 2GVDA 5CYMB 2CPZA 2BEFA 4GVLA 1PG5B 3PW2A 4DSLA 2E9TA 4DZDA 2W9CB 3I82A 3NWGA 1SH2A 3G8SA 1IO2A 2W9BA 3KK3A 4K25A 1VLOA 1RT5A 3V4IA 2PMZD 2BBEA 3M30A 3ISND 2IIHA 4IRDA 3OTOF 4ZVSB 4F02A 4RWWA 5C5JA 4ZTJA 2E1PA 4CI6A 3PHEA 4FJ8A 4OMFG 5LM7E 5LXYA 1M5VC 3D0IE 1E3MA 2GGPB 2CNNB 3IN5A 2PSZA 1TL3B 2IJRA 3WXKA 2JRSA 3VN5A 3I56N 1AA1B 2HHPA 3VEWA 3F9KA 5JVGQ 1JLEA 3BZKA 1HLUA 4HH1A 2NQPA 1NGCA 1NZAA 2MSSA 1A5WA 1X3NA 3BGUA 4ISGA 1N5VA 2C2NA 3BQ0A 4RBUA 1ZZNA 3AQPA 3O9RA 4K5RA 5DJBA 4DTXA 1YAGA 1U49A 3AVIA 3MDFA 4CF0A 3PLAA 5I42B 2KM8C 3W64A 5D4LA 3IWLA 4M3UA 4Z4GA 3OBIA 1Q86O 2QA4S 2NYHA 5BRDA 1L5UA 1D9AA 2DBBA 4M5MA 1M5KC 3TI0A 1NPRA 1S0OA 3E9OA 4F7VA 3QDKA 5HSPA 4CJFA 2PE8A 4DR6J 3HHEA 1RILA 2I5JA 1VBZA 3SBGA 2QMXA 4U7UK 2CKWA 2MDAA 4WE1B 1IR2A 2K2PA 4DL0C 1F0XA 1Q7YT 1TGOA 1HJRA 5L1LA 3SQ4A 5J1PA 4C8KA 3HZ6A 3O1LA 5HRNA 1T11A 3CNQP 4B3SJ 4IDKB 2BJ9A 1ZS6A 1EX8A 4AXJA 4JOUA 1XNRJ 3DU5A 4LFCJ 1CS4A 4Z0UA 4NX9A 4K43A 2VYPA 2DPIA 4HL9A 2DRAA 1X4BA 3BKTA 2YHXA 1M90T 1BG3A 3CCRN 3FR0A 2LCWA 3VVUA 4S0MA 4ZVUB 4DMZA 3ZLJA 4KT0C 1ZOTA 2B5JA 3U6FA 4H4KC 2RE2A 3TAGA 2B56A 4FOIA 4U67Q 4H5RA 2OJ3A 2HHTA 3V9SA 2XY5A 3MR2A 4LF8J 4JHDB 2Z56B 1YRUA 2OO4A 1RT7A 1RU1A 5AJ3K 5EWEA 1FRXA 5LMUJ 3TVZA 3FZBA 2QXFA 3SUPA 1Z25A 3OR2A 4L3NA 4O5FA 2KB2A 4NLQA 3H25A 4CECA 2YKNA 4MLHA 1SKWA 1QVGM 2F7TA 5EU7A 3MM7B 3ILJA 4AHVA 2V8DA 4OZ2A 1APSA 4HTLA 2HHHF 2IA0A 3GPAA 1Q7YO 2EC2A 1SJ1A 2N7YA 3JAMY 4FF1A 4QU7A 2BJEA 2HF3A 2MLYA 3NE6A 3N79A 2OEMA 4ZPCA 3MHYA 5KG3A 1LW0A 1RT1B 4CF1A 4FJKA 1YGYA 4EZ6A 3D5MA 3WZ0A 3EWGA 5GAGU 1RDRA 1OWXA 2MKJA 4N8OA 1YVUA 4LF6F 3DOMA 4KGZB 4KHPK 4P2MA 4PRFA 1TKZB 2DGTA 4ECRA 1Y5NB 2XGPA 4ED7A 2OANA 1HNVB 4IO1A 1H2TZ 4OHVA 4OZ3A 3NS5A 1BCOA 5FLXY 4YOWA 2ZM6J 1VQKS 1IBLF 3QATA 4I0WA 2HHVA 4PG8A 2HBKA 3DXBA 4C23A 2DGWA 1RDBA 1KOHA 2ERRA 1MWMA 1VRQC 1FWLA 4DXLA 3O44A 4X65K 2PEBA 1WHVA 2XI3A 1QHAA 5ELZA 3CCVS 1JXEA 1NKBA 3NAIA 5KFGA 4U8YA 5T7LB 2C2DA 4FXWA 1NB2A 1AUDA 2P9NB 4DU7A 1KRPA 4CGDA 1NLKL 1O8BA 1EETB 5AQMA 3SQ0A 3GIIA 1M1KO 2H65B 3MEDB 1NHUA 2HVHA 4LT6A 2VPWB 3H6EA 4TQSA 1S12A 4DR1F 2ATCB 2OTLN 1LAVA 1RFQA 1VC6A 4W92B 5CY4A 3AVGA 2PZSA 4PCQA 3WC0A 4CEAA 4QYRA 5HJXA 1WOPA 4X64K 4QIEA 3GJTB 4RUBA 4IR1A 2O8DB 2IA6A 3MPYA 1F21A 5L1KA 3OLAA 1MN7A 2P9LA 4EEYA 4CJ4A 2ZKTA 3TEGA 3NCRA 3AB2B 2Z1IA 1KQKA 1XC3A 2P9KA 3ZT3A 5MLCV 2HOEA 4HHUA 5ETNA 1ZPWX 1FDNA 3MCAB 2RQCA 4H0OA 4A5AA 2HQ3A 1X31C 1IKWB 4WU3A 3NNHA 2HQDA 3ILLA 4HYKA 1Y9OA 4I2PA 3SPZA 1NAQA 2GNKA 5F3ZA 4Y6IA 3RRHA 3IGVA 2HKEA 3K2YA 4TLRA 2FJVA 4I6YA 4J2EA 5C2DA 3B82A 1MROB 4HDGA 4ZVEA 4C9DA 3PW4A 5I3UB 2DNGA 2IFXA 2CWKA 3M8YA 5LT5A 3NH0A 3CJ4A 5J2MB 2R7SA 5A8KB 3SBTA 5T14A 1UAWA 3E2EA 2NZ4A 3O6WA 3SMPA 4DCOB 1ILYA 4HDHA 2ZBCA 5KFIA 4W5TA 1PJ5A 3OTOJ 2LSNA 4DMNA 4TYBA 4ZKAA 5M1FA 1CC7A 3LALA 3BDEA 3PYFA 1XERA 1M5OC 4GO5X 4DTMA 2HRUA 3NH1A 6AT1B 4ZOSA 3TZYA 2HHSA 2HNZB 3DN9A 4HTIA 2N3OA 4BDYA 5AQUA 4B1UB 1B0TA 4CWBA 3CCRS 2ZH5A 2QSWA 1HNWK 2ILYA 4NYNA 2ZHOA 4KE5A 4WK3A 5CH7B 1CC8A 1IKXB 4KHMA 1RAJA 2YKMA 3H3OB 4JRQA 4IOCL 2HAIA 1E4FT 2RUSA 3ZC4A 3ZZ0A 1RKJA 4LF4K 3I5AA 4TKTA 9ATCB 3OYIA 3ZZUA 4QW9A 1J6ZA 4E7LA 2NSBA 4V19J 2VFTA 1BMQB 4GO7X 4J8FA 4KSEB 1RCXB 4OYOA 3G86A 1TAQA 2R7RA 2QE5A 3IM8A 3HO1A 2YX7A 4RW6B 3KYLA 5GAEI 3FZLA 1ZBHA 5CYMA 3HSZA 4IJNA 4AL6A 3BZQA 4J9PA 4RNFA 4H5VA 4N5SA 1QAYA 4Q44A 3SQ2A 3O3GA 2IDOA 1NZ8A 2W9CA 2QLFB 3SCJE 3ZSOA 1YJ7A 5HQ8A 3PKMA 4Z4EA 2WSFC 3U3GA 4CK2A 4ZN1A 2QWLA 1P8ZA 4NLWA 1NMNA 4X4NA 3W3SA 5AQNA 3SNNA 2B0GA 3GONA 4BG9A 1M1HA 4EYHB 3MD1A 3KLHB 1X8DA 1T9XA 5H9EK 3EGNA 5CXTA 2D69A 2DNNA 3Q22A 2IM0A 1K8KA 2YJFA 3BUZB 4UF4A 4AM6A 1B3TA 1TUWA 1TL3A 4L3KA 5ETLA 4ZVHA 2ADBA 4F26A 2AD9A 2CJBA 5HP1B 2DNPA 4PYAA 4TYAA 2AIRB 5HL7L 2B9EA 1GLDG 1P1TA 2YH0A 5GAHI 1YITS 4K4ZA 2GBZA 5MLCQ 5CCLA 2G8FA 3QSIA 3J81U 2WVCA 2LQBA 3AVMA 5LY3A 5D8HB 4NCGB 5I42A 2QLWA 3PRBA 3QAEA 4OJ1A 1K8AT 4EYIB 1WKLA 3CCMS 2PEHA 3AGKA 1FE4A 1FNOA 1DFDA 4RG8A 1G2EA 3SUOA 3T1YF 3CPEA 2ZBPA 3GSIA 5F1XA 3CIZA 1OO0B 3BEGB 1WEZA 3EY1A 2ZJRL 1AYEA 5ADZA 4EUVA 2UUAK 1PC5A 3VGSA 1YJWS 5E7OB 4FYVB 2HHHJ 4WE1A 1TMMA 4ETXA 4WP8A 4O55A 3ZSWA 1SH0A 2EG1A 1SKRA 3R2CJ 1S5JA 4MQ3A 4ZK7M 1VSLA 5BYQA 4AL7A 1FRMA 4JI8F 4DL4A 1B70B 5BREA 4FJHA 1VI7A 1QUPA 3UWTA 1PILA 4F2RA 4HI2A 4IDKA 2N3LA