3P39A

Crystal structure of the ns1 effector domain w182a mutant from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
KMPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEANDNTVRVTETIQRFAWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nonstructural protein 1
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
total genus 31
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p39A00
3O9SA 4OPHA 3D6RA 3F5TA 3L4QA 3O9UA 2RHKA 3KWGA 3OA9A 3O9TA 4OPAA 2KKZA 3O9QA 3EE9A 3P39A 2GX9A 3EE8A 3P38A 3RVCA 3O9RA 3M5RA 3P31A 3KWIA
chains in the Genus database with same CATH superfamily
1HNWK 4DSIA 2HHSA 3DLHA 1QSLA 1LOTB 1DTTA 1WSGA 4MO4A 4LD0A 2G8IA 4M45A 3ATUA 5EY4A 4KH4A 2FBVA 4DQIA 3CC4N 1A5XA 3QO9A 4FWLA 3PLAA 4NXNK 4B1UB 3MWTA 3SPZA 4LH4A 1TKXA 5GAGP 4B8AB 4IG0A 3I8DA 1CXUA 2QXLA 1QQCA 2KW4A 2HBKA 2O4GA 1WBBA 3EZ5A 2F9WA 2NRTA 1XHXA 4AQYK 4KFBA 3MEEA 2WUSA 4CZGA 4F8RA 1S1TA 4YNQA 5C24A 4YOVA 3RSEB 4CJVA 4GV6A 2Y1IA 4A2BA 4JK9A 4FJLA 3SI6A 3VMFB 1VQMN 4KV8A 4PKGA 4EZ9A 3CXCM 4RTFD 1VSFA 4RW9A 4FWOA 4G1QA 1C0UA 2H3GX 3V9WA 1VRUA 1LAWA 3R6MA 4LSNA 1NJIO 5JS2A 5AJ3K 4B9VA 3QIPA 1JLBA 3CM5A 4BRKA 2P5OA 3K9JA 1T05A 2KQ2A 1KAXA 3BY5A 3ULEA 5KI6A 3PSFA 4OGEA 5KQDA 1BI4A 1EKEA 4GMJB 2FXUA 1YI2N 4LF6K 4ZTJA 1GLLO 2QA4N 2QWNA 3ZSRA 4CFCA 1SAZA 4FJNA 4CF2A 4DV3K 1WSJA 3LDPA 3CQYA 3SJJA 3QLHA 1X3NA 2A3ZA 4YOTA 4BRFA 3TU5A 3EL2A 4DQPA 3KD1E 2O8BB 2HF3A 2NRHA 3J81O 3M8SA 1Y64A 1D9DA 4IOAL 3S9HA 2KFNA 2P9PB 4BR9A 3QIOA 3SJHA 1C1BA 4FSVA 1R59O 3LANA 2QEXN 2EWSA 3VENA 3AA2A 3T1YK 4LFCK 1YT3A 4JKBA 5BRDA 4C1NK 3P4IA 4CGGA 1XC9A 4RG8A 1SKSA 1VSIA 2IIRA 3BGRA 3CCQN 1N33K 1BA1A 3D6RA 4QS9A 1RBVA 4O44A 1BUPA 4FJMA 4H03B 4BRMA 4WYBA 2YKMA 3GOIA 3THYA 4DTMA 3EO3A 2UXCK 1HX1A 2Q3SA 3I56N 4HUFA 4PL8A 4IDHA 4W5OA 4KTWA 3HOTA 4FWNA 4BG9A 2W6KA 4IKFA 3THVA 4CI6A 4X66K 3CCRN 3WXIA 4CECA 2UXDK 3RSEA 3OW2M 3C6AA 3LP3A 4FLYA 2NRZA 3F73A 3VQCA 3FZKA 3AVJA 4EFHA 1Q81O 1VSJA 1VQLN 2QWMA 5GIPA 1S6PA 3FZMA 3GBTA 4FJHA 4A5BA 3QNOA 1V4SA 1WNSA 3LWLA 3H1QA 4ZHRA 5BRFA 4ELUA 3WXKA 5HBMA 3WQUA 3OBWA 1RBUA 3ZETB 1FKOA 2E2NA 2NRXA 1ILYA 2XY7A 3VA0A 4O55A 1TYQB 2B6AA 2VYPA 2GBZA 5C15A 3GE1A 3ID6A 1WSEA 1L3VA 3MWPA 4JNEA 3H1VX 2E20A 3C65A 2I7PA 2YHBA 4AHSA 3NBPA 1U2VB 4K43A 3UE5A 4B3OA 2GWKA 2ZWHA 4YOWA 4H0YB 5DK5A 4AHRA 4DU1A 3LZJA 3L6QA 1XHZA 1SL1A 4JKHA 3CCSN 3HBTA 3DM2A 1IBKK 1S9EA 5BN9A 4FWMA 4DTPA 1CLQA 2WONA 4CD1A 2IAJA 4JI6K 1C1AA 3AVIA 3VQAA 3CC7N 2PYLA 3AV9A 2Y1JA 2P9PA 1H1VA 1K8AO 2QWLA 5JVGL 3AGKA 3IFRA 5M1KA 4DLEA 1QE1A 1LWCA 1EWQA 2KZZA 3OYFA 2IVNA 1D8YA 4KREA 3VF6A 1TAQA 3DLLL 3QETA 1RTHA 3NAEA 4CD3A 2XY8A 4NXMK 3VQ9A 4CEAA 3ZT1A 4EZ6A 3D7EO 3H45C 3KLGA 3EYZA 3U4LA 1E4GT 1U45A 5AQTA 1FJGK 3MAQA 3MN7A 1GOBA 2Z1HA 4KHPK 3G10A 4KHUA 3O4QA 1REVA 1NGIA 1NBWA 4DTNA 3WNFA 4H5NA 4CEDA 3LALA 1K73O 3MN9A 1QQOA 3R1XA 5HRSA 2AA4A 2O8FA 3ZEUB 1NGAA 1T03A 4JI0K 3AA4A 1QTMA 4N5SA 4GW6A 3TTFA 1T7PA 2OCEA 1I39A 1GLFO 4BDPA 1JLGA 1SS6A 1QQMA 1JL1A 3QESA 3K5OA 4BRPA 4FJ7A 2EX3A 2KHOA 3SBTA 5LJWA 2A1RA 1S1WA 2CGJA 4PA1A 3OTOK 3CETA 4KB1A 2ITMA 4ID5A 2NRRA 4GVMA 3RMAA 4Z4CA 3DXKA 3KLEA 1U4BA 1RT3A 4KHSA 3I8BA 3T1AA 4R79A 2FF3B 4IO9L 3AVAA 2ZGZA 5AQPA 4OLBA 1UWBA 5AR0A 4BR0A 2GUPA 4J2BA 5H1SQ 3KLIA 3PX4A 3V1QA 2E2PA 4CZEA 1Q8IA 1SQKA 3CCMN 2HHWA 1RT1A 1W7AA 2Z1GA 3C7NA 4V19S 1NJWA 2Z1IA 3TTCA 2FSJA 1L5UA 3B6PA 3EE8A 1KLMA 4F2SA 4JV5K 1YITN 3ZX2A 1NGJA 3MX5A 2UUAK 2QWPA 1WBDA 3MDQA 4RWTA 4PY5A 3EZWA 3OHRA 2YNGA 4FK0A 4O5BA 3OYGA 3F9KA 1NK6A 4JS4A 3CIPA 3P1GA 2HNDA 4JK7A 3QEPA 3DLBA 3HL8A 4FXDA 3CF5L 5AZJB 4JKAA 3J8AA 1C6VA 1RTDA 2A41A 2GTDA 3NFAA 4JAXA 4DSEA 4WFNL 1YJWN 3HVTA 1QSYA 4CEQA 5AQFA 3HTVA 3ZSXA 3P5JA 2NZTA 4FO0A 3HI0A 3QEWA 2HMPA 5HL7L 5FRMA 1RT7A 1YTUA 4WQ5A 2HVHA 2O8EB 3FZFA 3AVCA 4CFBA 4CERA 4M7YA 1NLVA 2ZQBA 3AVKA 3ZX3A 1SKWA 4O0JA 1QS4A 4BRCA 1S9GA 1ZBHA 3M6GA 4FM2A 5EVZA 1R0AA 4NYNA 1DLOA 4TSXA 1BA0A 1RBRA 5BREA 5AQJA 4NO7A 3E9PA 1U04A 1VQ9N 3FFKB 2F9TA 3MEGA 2IS3A 4FLTA 2ASMA 3ID8A 5AQVA 3MMVA 3V1OA 4BWMA 5JLHA 3SUNA 1N5YA 3NGIA 4BE2A 1IG9A 3DYAA 4BGAA 3TARA 4JKGB 5J2PA 3CJCA 5BPMA 3LDOA 2QKBA 3DMJA 1N8RO 4XH5A 1DGKN 2RPIA 3SMSA 1WSIA 4X65K 3KJVA 1RILA 3K2PA 4JD2B 4OO1J 1W0HA 3M3ZA 4AILC 1WSHA 3V6DA 4B1XB 4HWIA 4LF9K 4QS8A 1JLFA 2G8FA 5JICA 2P9SB 1VQ5N 3WEEA 4DCHA 3VGLA 2FBTA 1HPMA 1IBLK 3TAPA 1IO2A 4ELTA 4Y1CA 4E19A 3OYJA 1QZ6A 4JI3K 3U8XA 4J2DA 4KI6A 5HRNA 4N41A 1BIZA 4B9MA 3LP2A 3VF2A 3QEXA 4DSKA 4W5RA 3WXJA 3I0RA 4M3XA 4C23A 4BDYA 1JCGA 4C8NA 3V9SA 4XH4A 4OPJA 3HM8A 1EP4A 1FK9A 1DEJA 4M3ZA 3TAEA 2GELA 4QAGA 3QFPA 4LF8K 2O8DA 4M3TA 2WBNA 2NUBA 3CPEA 3A5MC 3H6EA 4CHYA 4C8LA 4BC3A 4CEZA 4DV1K 1Q86O 3ASMA 4JKFA 2UYTA 3P83D 1L3TA 3CQXA 3VN5A 5AZJA 3G0ZA 1ZBFA 4DSJA 3H46O 4NCBA 4CEOA 2BGGA 4BRDA 4ELVA 4NYFA 1OVQA 1NGCA 3GL1A 2VWBA 2XY6A 1SZ2A 4NLBA 5F1XA 4XEIA 1ATRA 1BG3A 4FWQA 1C0GA 1Z05A 2V51B 2HF4A 4BQLA 1RDAA 4PQUA 4BR2A 3K58A 2V52B 3LDSA 4AF1A 2HVIA 1BCOA 1TKZA 1JKHA 3L2UA 3ULEB 1GLDG 3MXMA 3P39A 4LFBK 4MDAA 4B1YB 5HP1A 3SNNA 3LM9A 4B3TK 4JI4K 4X64K 5KGXA 3LWMA 4JKGA 2PBDA 2YHXA 3A0IX 3BF3A 1B9DA 2VGNA 3JSMA 2VG7A 2BDPA 4M41A 1V4TA 3CCEN 3ZSYA 4B3RK 4OPKA 3ULDA 4OPAA 3NGYA 3E1YA 1D5AA 4N47A 4PUOA 3WNHA 2BUPA 1HR0K 4OX9K 1BISA 2P9SA 5K14A 3JS6A 4RW7A 1J5OA 4CCHA 4BWJA 2YX6A 4NCGA 3KVGA 3VF4A 4B1VA 1TL3A 3O8MA 3I55N 3VA3A 2P9IA 2UUBK 4FK4A 3LP1A 2HOEA 3MX2A 3CERA 2QM1A 3S3MA 1KFSA 3RRGA 4BRQA 4CK2A 4UQGA 1QQNA 4L3QA 1VSMA 1J53A 4FWPA 4JEPA 4FOEA 4LFAK 3IUCA 5AQKA 2E2QA 3C6UA 3LZIA 4CGFA 5F0XA 5HRPA 4A62A 3THYB 1IJJA 2DTUA 4I2PA 2YHYA 4KHQA 1HKCA 1NM1A 3MCPA 2E8AA 1XNQK 4FK2A 4EP4A 1EQYA 1VSHA 1NGBA 4B9NA 3U9DA 4QCLA 3T19A 2IVOA 2UXBK 2VGMA 5KRTA 4FW2A 3OYNA 3NF6A 3B6OA 3NVMA 4BROA 4CBXA 2F7TA 4HUGA 3OS0A 5CYQA 4N56A 1GLBG 3PY8A 4PKIA 3M8RA 4B9UA 3OYIA 2W41A 4KO0A 3CCJN 3K0SA 1XC3A 3ENBA 2CH5A 4DF4A 4F3OA 3PSIA 4Z4EA 3NF7A 3QFUA 3VOVA 4LF5K 3CD6N 5CE3A 3PIOL 4K25A 5LMUK 4AHCA 2I7NA 1YTAA 3C0BA 4BDZA 1OH8A 3DLGA 3ATVA 4IFVA 2J4RA 5LJVA 1A5WA 3MEDA 4FM0A 1OH5A 2F8TA 4ISGA 5AQWA 1P90A 3T1HK 1BL3A 3TR8A 4W5QA 4DR2K 5ELZA 3SLCA 3NDKA 1SKRA 3NH1A 1JXBA 2PZSA 2R7YA 4B1ZA 1U48A 5GINA 3ITHA 4X62K 4JI1K 2HHHK 5LMNK 3DLEA 3ZSZA 3MXJA 3IG1A 4YFUA 4FLZA 3U3GA 2YHAA 4OJRA 1MWKA 1K8KB 2QXFA 1YUWA 2O8CA 4GKJK 3V9XA 1VQ8N 3EKUA 4EIAA 2HHQA 1F21A 3OYDA 3L2RA 5DM6L 4BY9C 2HW3A 4DV7K 3H3OB 2ATQA 3A2FA 3AAPA 3CMEN 4BC5A 5EX5A 5M1NA 1JLCA 2HBLA 4ISEA 3UIQA 2Z1JA 4H5WA 4FLVA 1X9WA 4FLUA 2YJFA 4JHDA 4JKDA 4CF9A 4ILGB 2O8FB 1NG9A 5AQLA 5CZ2A 3VESA 3NF8A 5AFUH 3PO4A 4KTZA 4CESA 3DWLA 1LAVA 1ZXOA 3TAFA 3THXB 1L3SA 2E2OA 3IKMA 4DS5A 1E4FT 4DQSA 5HLFA 5GIOA 4DR5K 3OY9A 5FPDA 1HRHA 1RT6A 1XMOK 1TAUA 3IMXA 3LPUA 3OJUA 3KK2A 3L2WA 5CR4A 1GOAA 3ZT0A 4BRAA 4DU3A 1VSKA 4BE1A 1U47A 3DXKB 4DKWA 4Z0UA 4CJPA 3QB0A 1LWFA 1NK0A 1YVNA 5AZIB 3AO5A 3N4QA 4ICLA 1UA1A 3SAHA 1HNXK 1U49A 1VQ7N 1VRTA 3EE9A 2P9NA 1TV6A 2IOCA 2X74A 2VG5A 3LAMA 3ZSOA 4ZTFA 1B92A 4H8KA 3SV4A 3C7NB 3O3FA 3CG7A 2VWKA 3BDPA 1SL2A 4FZZA 1ATNA 3OVNA 3WT0A 2BTFA 2FBYA 4WFAL 1NJZA 4ISFA 1NKEA 4CJUA 4FLXA 3HM9A 3O1WA 3OYKA 3CC2N 4DTJA 4H5TA 2QKKA 5AQUA 5DMRA 3K57A 3DXMA 3A5NC 4KI4A 4M42A 5BRHA 3V9UA 2Q0RA 4I2QA 1U6ZA 4WF9L 4I6MA 5E26A 1ZYQA 3O1BA 1OH6A 3QEVA 2BH1A 3O3GA 1K8KA 1M90O 1Z6RA 2YNFA 4HCCA 4FWKA 3CFRA 2IC3A 2QTDA 2E88A 1N36K 4IEIA 1VQNN 4DV2K 4CZHA 4CJSA 3PX6A 2W6LA 3R3LA 4JI2K 5FDLA 2WC9A 4E3SA 3FLCO 1WLJA 5JMVA 3BUZB 3IDHA 2OPRA 3ENOA 2P9LB 1RDDA 2XY5A 1IBMK 3O6WA 4H4MA 3MECA 3IRXA 4M3UA 4CJEA 3D0PA 4KTQA 3HSCA 3HO1A 4ID1A 1HLUA 4DR1K 4FL9A 5BPLA 4LY7A 4IXCA 3THXA 4DTSA 4DHYA 4YOYA 1HJOA 3H3NO 3S3OA 3RMCA 1I3AA 4JRPA 3QDKA 2VQEK 4CJ5A 3LDNA 2I5JA 4U7BA 3HXMA 2NNWA 2HNYA 3AGRA 4AHTA 4MDBA 2E1ZA 3PV8A 3AVBA 2QI2A 3M8QA 4H0TB 1JLAA 2X6SA 4CJ7A 1IG8A 2Q2RA 1WN7A 3RMDA 4CGJA 3L2QA 3WEEB 2P5GA 1VQ6N 2P9UB 5AZIA 4DTOA 1ASVA 2YI1A 3AO4A 3EEQA 4JRQA 4JS5A 1S6QA 2FF6A 4OPHA 1NGDA 2V7ZA 3HP6A 1Y97A 4MLEA 1IKWA 3L3UA 4IEEA 4E7LA 1RBTA 4KRFA 2GX9A 1BOTO 4B9SA 3GG4A 1NNEA 3P31A 1O1WA 2FLOA 3SBGA 4FVMA 2YV0X 2FSNA 4CIGA 2P1JA 4CZLA 3O4NA 4DUYK 3SYZA 3SQ4A 4JI8K 4K8ZA 1TUUA 3TAGA 2O8DB 2G8VA 1NMNA 3A5OC 2RHKA 3DJCA 4NB4A 3Q7BA 5AQOA 1WOQA 5JLFA 3SCXA 4C8KA 3VQEA 3VTHA 1IV0A 4DQ8A 1SUQA 3O9QA 4FOIA 1YJ9N 5MLCQ 3AVNA 2DPNA 4HHTA 5FPEA 5E41A 2DY4A 4DR4K 3VEWA 3LL3A 4KHYA 5BN8A 4BVOA 3M8PA 3J7ZO 1C1CA 1S1XA 5HOOA 2D0AA 4FZXC 3TWHA 4BVPA 4DFPA 4Z4IA 3ZSWA 4CJWA 1HNZK 4BR5A 2IVPA 2NLXA 5D3GA 2NRVA 1MDUB 2P9LA 4CHQA 3NHGA 1X9JA 2E6LA 1VQKN 2NRWA 2ZGYA 3C6TA 4E89A 1NGHA 4CHOA 4B3MK 4GNIA 4FCYA 4FJKA 1QHTA 4CGIA 4CJKA 4MLHA 2JGUA 2XRIA 2G8UA 4BRGA 2KTQA 4AM6A 5FPNA 1VSLA 3OYBA 5J1EA 1VSEA 3SZ2A 2A42A 5FRNA 3BZKA 3HYFA 4BQZA 2D0OA 1J5EK 1KC8O 2ZJRL 4R5PA 3VETA 3U3YA 3MK6A 4KHNA 1ZBLA 1HYVA 3QMLA 3G25A 4E1MA 4FPBA 4DSLA 4A5AA 2P9UA 1IH7A 4BC4A 1TUYA 3TPQA 2P9IB 3OYEA 1BCMA 2VQFK 4LF4K 3AAQA 4Y0WA 4CJ3A 4FJ5A 2VG6A 3HP9A 3D2FB 4IDKA 4J2AA 4BRLA 2B4JA 3G6EN 3OS2A 4IJNA 1EWRA 4CZKA 4CK1A 4DFMA 1C0FA 5AQMA 1I94K 3ALYA 3W0LA 4RW6A 1Q9YA 1RDCA 1E3MA 4O5FA 3CJ7A 3TAMA 1UOCA 2HNZA 1SL0A 3LM2A 3M1FA 4OVLA 5ADXH 3THWA 1NMDA 4F4KA 4F2RA 3OBYA 4M3WA 3ZCMA 3R9PA 4WE1A 3OJSA 1G15A 3FE1A 5A2QO 3SPYA 3AA5X 3WNGA 2PFUA 3BF1A 1HQUA 1LCUA 2UU9K 4CHZA 3TAQA 4AHVA 2ZM6K 4RW4A 4PWDA 3KK1A 4Y1DA 3SMPA 2FBXA 2P9KB 2RN2A 2X6NA 3SV3A 4C1NI 3I0SA 1KSPA 5T7BA 2A5XA 5AQZA 3UB5A 2Q1NA 1N32K 4CHNA 4BACA 2GWJA 4E7KA 1YJNN 1ZC6A 5F2RA 4BR4A 4MO5A 1HMVA 3NH0A 4LC9B 1L3UA 3AVGA 3QEIA 3JAMO 4BG8A 5J2NA 3LAKA 4BRHA 3ZT2A 4A57A 4J2EA 1EX4A 1RDUA 4BR7A 2E1YA 5I42A 4CK3A 3N4PA 2DFFA 1J6ZA 2OPQA 1BQMA 3AO1A 4KB0A 1HUXA 3RTVA 5M1QA 3D45A 3RR8A 1XMQK 3J7YP 4EHTA 4YOUA 5KPZA 4LSLA 4BC2A 5TKYA 5ADXA 3GDQA 4NLCA 2A40A 4YDUC 2F4VK 2HSTA 3VGKA 1EO1A 2ASPA 3AVHA 5BR8K 1BHLA 4I9QA 3BEXA 3CM6A 3A5LC 5CZ1A 4HCBA 1KAZA 4AH9A 2WTUA 4B9TA 4FVUA 3TSUA 3QNNA 4CZMA 1JLEA 3A8YA 1X9MA 2ZF5O 2O8CB 3U9ZA 3K5LA 3CQ8A 4JLHA 1X3MA 4CF0A 2OZMA 3CJ1A 1O13A 1KFDA 3D2FA 2HMIA 3VQ6A 1Q9XA 3O9RA 3HT3A 3K59A 4CZIA 4BREA 4FLWA 2Q36A 3DLKA 4CGDA 4HUEA 1MWMA 1XWLA 4CGHA 3HSTB 1GOCA 1RCHA 1WUAA 4HVJA 1YIJN 4H4OA 2QK9A 3AVLA 4QOZB 4RCHA 4JHDB 4DS4A 3C95A 5B8HA 1MA9B 2GUIA 4KHWA 1JL2A 2EHGA 3RRHA 1ATSA 3KZBA 3F2KA 5KPRA 2F96A 2XO7A 2VCPA 4M63C 1UAXA 3NGZA 3VQBA 4WQ4C 3PIPL 2KFZA 3VEOA 3ZLJA 4KPYA 3OYHA 3O80A 1S1UA 4DU4A 3IS9A 4I9LA 3EKSA 4RW8A 1T6DA 3WQTA 4YY3K 1VSDA 1FXXA 1RDBA 1VHXA 3CCVN 5BR9A 1BU6O 1HNIA 2WOMA 5TKWA 4O0IA 3LDQA 4CJRA 2P9KA 3B8AX 2OTJN 3OS1A 4EP5A 4PL7A 3DAWA 4I7FA 4IO8A 3FGUA 4DV5K 5HROA 3ZX0A 5GADP 3C6HA 5AQIA 3UKUA 1CXQA 3HPOA 2P9NB 5AQNA 2HHUA 1ESVA 3KLFA 4F3TA 1KVAA 4AM7A 2ITGA 1KVBA 4O8KA 2D0BA 3VQQA 1G99A 4CJFA 1T44A 2GV9A 2G8WA 1KRPA 2IGIA 4CJQA 4Z94A 4FJGA 4CHPA 5C25A 1SV5A 4L8RB 3HOSA 4DUZK 4E1JA 4JKEA 3KTQA 5C10A 5EU7A 3E66A 1QZ5A 3VQ4A 3JYTA 2UUCK 3F5TA 3FFIA 4CF1A 3DXMB 2D0CA 4HTUA 2D1KA 1S72N 2CGLA 3NH2A 1ASWA 3VEZA 1QSSA 4I6MB 4YOXA 5FLXO 3IAYA 3G71N 3M5RA 4MFBA 1ASUA 4JKCA 4MQ3A 2GEMA 1JXEA 3T69A 3SUOA 3VQ8A 3AVMA 2HHXA 4U67L 1S22A 2XHBA 3O9SA 4Q0BA 3FZLA 3U6FA 2G8HA 1ITGA 4CJ4A 4Z4HA 5E84A 4IG3A 3ZSVA 1GLAG 3LPTA 1HJRA 4AHUA 4GY2B 1GLEG 3QBXA 5AQHA 3QBWA 2PYJA 1QVGM 3HVRA 5KRSA 2HBMA 4W5TA 4CF8A 2W42A 3O5BA 1KD1O 4WCEL 4DMNA 2KZMA 2QWOA 1YHQN 1CZBA 4E1NA 1ZBUA 3KK3A 4FJIA 1BQNA 1TKTA 2W40A 1XUPO 1YVUA 1BIUA 2WFBA 3TSQA 3OA9A 5IT9O 3KLHA 2FC0A 2JWLA 1Q7YO 3L4IA 3OYAA 4H0VB 3DOKA 3OYCA 2OPSA 4CVNE 3AY9A 3RVCA 4B3SK 1NK9A 1NGEA 4E7IA 4A61A 1KXPA 2YCHA 4K41A 1NWKA 3K5NA 3EN9A 5AQYA 3TABA 1N34K 3NCIA 3KK7A 4EHUA 3K5MA 4NCAA 5DM7L 5GAHP 4Z4FA 4OKEA 1HPZA 1TGOA 4DR3K 2IDOA 5HRRA 2Q31A 4GVEA 1RDWX 1IKVA 5JVHL 2RF2A 4H0PA 5AQRA 2ETJA 1RT4A 1D9FA 2OYQA 1HKBA 3H08A 3L0QA 3HK2A 3NE6A 1WAJA 3VERA 4KBOA 4CW7B 1YAGA 3RWUA 1RNHA 2OANA 1W97L 2E4LA 2KKZA 1VQPN 4B9QA 5I3UA 3PUFA 3AO2A 4H5RA 4DV4K 4FJXA 4FM1A 2OTLN 3R8EA 2G8KA 3CI5A 5AFUA 4DFJA 3KWIA 3O4WA 1XI1A 3SQ0A 3HRGA 4IFYA 5I9EB 3O9TA 2O8BA 3TTDA 4ILJA 2Q97A 3L3VA 1K9MO 3NMUA 1KVCA 4JYAK 4EAHD 5SWMA 3D2EB 3MN5A 4IJAA 4W5NA 4J8FA 4YHHK 3PO5A 1WAFA 3VQ7A 3O3HA 4BGBA 5M1PA 4DQRA 4XIUA 2ZE2A 4B8CA 1CZ9A 4YORA 3W3DA 1QVFM 1W9HA 2RE2A 4E7JA 3ZSQA 1CZAN 4XH1A 1T3VA 4M3YA 3KHYA 3WNEA 1WB9A 4Z4GA 1NOYA 2P51A 1KQSM 1M1KO 2PY5A 4H0XB 4GV3A 3OYMA 4IOXA 2ZJQL 1QHAA 3DRPA 1T8EA 3FZHA 3UKRB 2LSNA 5AQXA 3TSPA 1LWEA 3VPZA 3MXIA 2HHVA 4LH5A 4DSFA 4FWSA 1FKPA 3VQ5A 5M1OA 2QW9A 5GAEP 3E9LA 1IKXA 4QS7A 3OYLA 2YNHA 2ASOA 4K0KK 3V81A 3HJFA 4CEEA 1S3XA 2YKNA 3VEYA 4BRIA 2Q0UA 4B9LA 2YJEA 3O9UA 1VQ4N 3ZETA 4GKKK 3ISNC 2A6AA 1NU0A 4DF8A 4FJ8A 2JWKA 1TYQA 3ENHA 4O4GA 1BGXT 3CCUN 4CIFA 1X1PA 3P38A 1KLNA 5EXWA 1A5VA 4C8OA 4F9OA 4DTXA 5IWAK 5JS1A 3J7AP 3JXUA 3T7ZA 3BZCA 1U2VA 2D0PA 1UA0A 1JJ2M 3L4QA 1XQSC 1Q82O 3FR0A 2D4WA 4DG1A 1TL1A 1OKJA 2QWQA 1C0TA 4PHTX 3THWB 4DV6K 2HBJA 3KD5E 3VTIA 4DB3A 2DFEA 3QERA 4DLGA 1VK0A 3VQDA 3SUQA 1KTQA 1S5JA 5CY4A 5KPTA 3DOLA 4N76A 4CZFA 2B5JA 3NVKA 1NK4A 1D4XA 3D2EA 3LP0A 4KH6A 4Q5VA 4CFAA 4BRNA 1ZBSA 4OKJA 3CPWM 4K8XA 5LL6Z 1LV5A 4CBUA 2HB5A 4FPAA 3C94A 3DI6A 4GV9A 3AO3A 3ZYYX 1TVRA 5AQSA 1MU2A 4CJTA 3SQ2A 4IFEA 1NGFA 4DFKA 1VAZA 1BDGA 4YDUA 3EY1A 3CFPA 4OGCA 1NGGA 3F9MA 1RFQA 3V1RA 4IZ9A 4O8UA 1HKGA 1GLJO 1K6YA 3SAGA 4DV0K 4ILHA 5AQGA 1RBSA 3VEXA 4FJJA 5SZTA 4OKKA 3CJAA 3S3NA 3UKRA 2E5LK 3V9ZA 4UY8O 3HPGA 3MN6A 3E01A 1X9SA 4FYDA 1JCFA 1RTJA 2FSKA 5C12A 3ZEUA 1RT5A 3LDLA 5M1FA 4JI5K 1NKCA 4IWVA 5EOYA 3TI0A 4HTLA 3CHWA 1P8ZA 1NK5A 5C0YA 3S41A 4B08A 1Z26A 4M7XA 3CMAN 3WXLA 4CBWA 3T3FA 1J9AA 3CJBA 1S1VA 4CEFA 3KKRA 4WFBL 3PX0A 3NF9A 4JK8A 1TKDA 4E0DA 1WSFA 2X78A 1DTQA 2YHWA 5FROA 2VWJA 1XNRK 3AARA 4WQ4A 2D5RA 5LY3A 1EETA 4FWRA 4IBNA 4LF7K 1NKBA 3BP8A 3KIOA 1NK7A 1OH7A 3CFOA 2CGKA 1LW2A 4JN4A 2JLEA 3Q7CA 3J80O 4C8MA 4DTRA 3O08A 4E7HA 5AQQA 1JCEA 5BPNA 3L2VA 1TK0A 3QINA 3DLRA 5CHIA 4JI7K 4K42A 2A1SA 4OLAA 1NJXA 3WUHA 2KLAA 3ZT4A 2OA8A 1FW6A 2ZD1A 2OZSA 5FPMA 4B1WB 2ZJPL 2YNIA 3SQ1A 2BE2A 4KH5A 4BE0A 1J54A 4A59A 2CH6A 5C2FA 1DKGD 1OVYA 4M3RA 1VQON 3MCAB 3VEVA 2RKIA 1GLCG 2HHTA 1KAYA 3I33A 2O4IA 2DFHA 4G9ZA 1BWFO 3V4IA 1NJYA 2PAVA 3DRRA 3UKUB 3QICA 2O8EA 3KKSA 1RTIA 3AA3A 2OPPA 2AJQA 1RGIA 3CJ9A 2E6MA 3DRSA 3E9OA 1YXQA 5KGWA 4PKHA 4CJLA 1W2BM 3RMBA 1ZBIA 1DT9A 4DQQA 3SK3A 4DTUA 5KTQA 3VQPA 3HPHA 2V7YA 1KCFA 3KWGA 5CYMA 4KAZA 4FJ9A 3L8BA 5J2QA 4DWIA 1N6QA 1IKYA 1HYSA 2AP1A 4WQ5C 1BI4B 3SUPA 4IOCL 4DR7K 3CYMA 3RR7A 4A2AA 4CEBA 3AVFA 4CFDA 3G4SN 1Z25A 4H0OA 5J2MA 3CCLN 1LW0A 3WXMB 1Q18A 3HZ6A 3ZT3A 4CE9A 1HNVA 2BANA 4JD2A 4FZYA 2QWRA 3VGMA 4CIEA 1HQEA 3TANA 1TK8A 1TK5A 5KQ8A 1YF5L 1C0MA 1NOZA 4CZJA 2F8SA 4KKOA 5C2DA 1HYZA 1NK8A 3K9KA 1T6CA 4H5VA 1EXQA 1BO5O 4DR6K 1JLQA 1RT2A 4FW1A 3SAFA 5C42A 1B9FA
chains in the Genus database with same CATH topology
4B1XB 2QWOA 3QDKA 1YHQN 4HWIA 3LDNA 4U7BA 4QS8A 1LOTB 2NNWA 3AGRA 5JICA 2P9SB 4MDBA 3WEEA 1VQ5N 2E1ZA 2W40A 1XUPO 4DCHA 3VGLA 1HPMA 4MO4A 2WFBA 3TSQA 3OA9A 3ATUA 2JWLA 5EY4A 1Q7YO 3L4IA 4KH4A 4H0VB 3CC4N 1QZ6A 4FWLA 3U8XA 2QI2A 4H0TB 4CJ7A 3PLAA 1IG8A 4B1UB 2Q2RA 3AY9A 3RVCA 3MWTA 3VF2A 3WEEB 3WXJA 5GAGP 1NGEA 1VQ6N 4A61A 2P9UB 5AZIA 2QXLA 4C23A 1KXPA 2HBKA 1JCGA 2YI1A 2YCHA 2FF6A 4K41A 4OPHA 1NWKA 4XH4A 1NGDA 2F9WA 2V7ZA 3EN9A 2NRTA 5AQYA 3KK7A 4EHUA 4CZGA 2WUSA 5DM7L 3HM8A 5GAHP 4MLEA 4YOVA 1DEJA 4IEEA 2GELA 3RSEB 3QFPA 2Q31A 2GX9A 4GVEA 4GV6A 1BOTO 1RDWX 4A2BA 3GG4A 4H0PA 5JVHL 5AQRA 2WBNA 4JK9A 3P31A 2FLOA 3VMFB 1VQMN 3CPEA 3A5MC 3H6EA 3SBGA 4BC3A 1Q86O 2FSNA 4JKFA 4PKGA 4CZLA 2UYTA 1HKBA 3CXCM 4RTFD 3CQXA 5AZJA 3L0QA 4FWOA 3H46O 1TUUA 3VERA 2H3GX 4KBOA 4BRDA 1YAGA 3A5OC 2RHKA 3DJCA 4NB4A 3Q7BA 1NGCA 1WOQA 5AQOA 5JLFA 3R6MA 2OANA 1W97L 3GL1A 2VWBA 1NJIO 2KKZA 3VTHA 4DQ8A 1VQPN 1SZ2A 4NLBA 4B9QA 3O9QA 4FOIA 5F1XA 5MLCQ 1YJ9N 2DPNA 4XEIA 4H5RA 1ATRA 5FPEA 2OTLN 3VEWA 3LL3A 1BG3A 3R8EA 4FWQA 4BRKA 5BN8A 1C0GA 3CI5A 4BVOA 1Z05A 3K9JA 5AFUA 1KAXA 3KWIA 3ULEA 3J7ZO 2V51B 2HF4A 4BQLA 3O4WA 5HOOA 5KQDA 4BR2A 2FXUA 2V52B 1YI2N 4AF1A 4BVPA 3HRGA 1GLLO 2QA4N 2QWNA 1SAZA 5I9EB 3O9TA 4BR5A 3LDPA 2IVPA 3TTDA 3ULEB 1GLDG 2NLXA 3CQYA 4ILJA 2Q97A 3P39A 1K9MO 1X3NA 3NMUA 2NRVA 1MDUB 2A3ZA 4MDAA 4B1YB 2P9LA 3LM9A 4EAHD 3D2EB 3MN5A 1X9JA 4YOTA 1VQKN 4BRFA 4IJAA 4J8FA 3TU5A 4JKGA 2NRWA 2ZGYA 3EL2A 2PBDA 2YHXA 2HF3A 1NGHA 2NRHA 3A0IX 1Y64A 3BF3A 2VGNA 4GNIA 5M1PA 4BGBA 4IOAL 2P9PB 4BR9A 3SJHA 4FSVA 1R59O 4MLHA 1V4TA 3CCEN 1QVFM 4YORA 3W3DA 4BRGA 2QEXN 2RE2A 2EWSA 3VENA 4OPAA 1CZAN 3E1YA 4AM6A 4XH1A 4JKBA 5FPNA 5BRDA 4C1NK 3P4IA 1T3VA 3KHYA 2BUPA 2P9SA 3JS6A 1KQSM 1M1KO 2A42A 4H0XB 4BQZA 2YX6A 4GV3A 2D0OA 2IIRA 3KVGA 4IOXA 3VF4A 2ZJRL 2ZJQL 1QHAA 4B1VA 3VETA 1KC8O 3O8MA 3CCQN 1BA1A 3D6RA 3FZHA 3MK6A 4QS9A 3UKRB 3I55N 1BUPA 5AQXA 2P9IA 5C0YA 2HOEA 3TSPA 4H03B 3VPZA 3QMLA 3G25A 4BRMA 4WYBA 4FPBA 3MX2A 3CERA 2QM1A 3GOIA 4A5AA 2P9UA 4BRQA 3EO3A 4FWSA 1HX1A 4BC4A 5M1OA 3I56N 2QW9A 1QQNA 4L3QA 4FWPA 5GAEP 4PL8A 4IDHA 1TUYA 4JEPA 3HOTA 3E9LA 4FWNA 4FOEA 3TPQA 4BG9A 2P9IB 4CI6A 4QS7A 3IUCA 3CCRN 2ASOA 5AQKA 3WXIA 2E2QA 5F0XA 4A62A 3AAQA 4Y0WA 3RSEA 1IJJA 3OW2M 3C6AA 1S3XA 3D2FB 3VEYA 2YHYA 4BRIA 2NRZA 4BRLA 1HKCA 2Q0UA 3FZKA 1NM1A 3MCPA 3G6EN 2YJEA 3O9UA 1VQ4N 2E8AA 4EFHA 3ZETA 1Q81O 1VQLN 2QWMA 5GIPA 4IJNA 3FZMA 2A6AA 3GBTA 4CZKA 1EQYA 4A5BA 1C0FA 5AQMA 1V4SA 1NGBA 1TYQA 2JWKA 3ENHA 3U9DA 3H1QA 3W0LA 5BRFA 3CCUN 3P38A 4O5FA 3CJ7A 5EXWA 2IVOA 3WXKA 3WQUA 3OBWA 2VGMA 4F9OA 3LM2A 3M1FA 3ZETB 2E2NA 5ADXH 2NRXA 4BROA 3NVMA 4CBXA 1ILYA 1NMDA 2F7TA 1TYQB 3JXUA 3T7ZA 1GLBG 1U2VA 2D0PA 2VYPA 5C15A 4PKIA 1JJ2M 3GE1A 3OBYA 3L4QA 2W41A 3ID6A 1XQSC 3CCJN 3R9PA 1Q82O 3FR0A 1XC3A 2D4WA 3ENBA 2CH5A 3FE1A 1OKJA 3MWPA 2QWQA 4JNEA 4PHTX 3H1VX 2E20A 2HBJA 3C65A 2I7PA 3QFUA 1U2VB 2PFUA 4K43A 3UE5A 3VTIA 4DB3A 3VOVA 3BF1A 2GWKA 3CD6N 5CE3A 2ZWHA 1LCUA 4YOWA 3PIOL 4K25A 4H0YB 2I7NA 3SMPA 2P9KB 3C0BA 3L6QA 4C1NI 4JKHA 3CCSN 2A5XA 5KPTA 3ATVA 5AQZA 3UB5A 3HBTA 4CZFA 3NVKA 2Q1NA 1D4XA 2J4RA 3D2EA 5LJVA 5BN9A 4FWMA 4KH6A 4BRNA 1ZBSA 4CD1A 2GWJA 3CPWM 4ISGA 5AQWA 1P90A 1YJNN 3CC7N 1ZC6A 4CBUA 5ELZA 3SLCA 5F2RA 2P9PA 4BR4A 1H1VA 4FPAA 4MO5A 2QWLA 5JVGL 1K8AO 4LC9B 4GV9A 3AGKA 3IFRA 5M1KA 3ZYYX 4BG8A 5AQSA 2IVNA 4BRHA 4A57A 1RDUA 3VF6A 2E1YA 4B1ZA 4BR7A 4IFEA 5GINA 3DLLL 1NGFA 3N4PA 1VAZA 1J6ZA 1BDGA 4CD3A 4YDUA 1HUXA 5M1QA 1NGGA 3F9MA 1RFQA 4IZ9A 4O8UA 1HKGA 1GLJO 3SAGA 3D7EO 4EHTA 3H45C 4ILHA 4YOUA 5AQGA 3VEXA 5KPZA 3U4LA 1MWKA 4BC2A 1E4GT 3CJAA 5TKYA 5ADXA 1K8KB 3GDQA 2A40A 4NLCA 4YDUC 3UKRA 1YUWA 4UY8O 2HSTA 3MN6A 3VGKA 1EO1A 2ASPA 5AQTA 1JCFA 2FSKA 1VQ8N 3EKUA 4EIAA 3MN7A 5C12A 3BEXA 3ZEUA 3A5LC 3LDLA 5M1FA 1KAZA 4FVUA 5DM6L 4BY9C 4IWVA 3TSUA 5EOYA 1NGIA 4CZMA 1NBWA 3H3OB 3A8YA 4HTLA 4H5NA 3CHWA 3AAPA 1P8ZA 1K73O 2ZF5O 3CMEN 4BC5A 5EX5A 5M1NA 2HBLA 3MN9A 4ISEA 3S41A 3U9ZA 1QQOA 3R1XA 1X3MA 2AA4A 4M7XA 4H5WA 1NGAA 3ZEUB 3CJ1A 3CMAN 3WXLA 1O13A 4CBWA 3CJBA 3D2FA 2YJFA 4JHDA 3O9RA 3TTFA 4CZIA 4JKDA 4BREA 4WFBL 1GLFO 4ILGB 2Q36A 4JK8A 1MWMA 1QQMA 1SS6A 5AQLA 4BRPA 1WUAA 3VESA 1YIJN 2KHOA 3SBTA 5LJWA 5AFUH 4RCHA 2YHWA 2CGJA 3AARA 3DWLA 4JHDB 1ZXOA 4WQ4A 3CETA 2ITMA 2E2OA 5B8HA 3IKMA 1E4FT 1MA9B 5LY3A 2NRRA 1ATSA 3KZBA 3F2KA 4FWRA 3DXKA 5KPRA 5GIOA 2VCPA 4M63C 3BP8A 5FPDA 3I8BA 2CGKA 4WQ4C 3IMXA 4R79A 2FF3B 4IO9L 3PIPL 2ZGZA 3VEOA 4JN4A 5AQPA 5CR4A 5AR0A 3Q7CA 4BRAA 4BR0A 2GUPA 3O80A 3DXKB 3O08A 5H1SQ 4DKWA 3EKSA 1T6DA 3WQTA 5AQQA 1JCEA 2E2PA 4CZEA 5BPNA 3QB0A 3CCVN 1SQKA 5BR9A 3CCMN 1BU6O 5CHIA 5TKWA 1YVNA 5AZIB 3N4QA 3C7NA 3LDQA 4K42A 2P9KA 3TTCA 3SAHA 3B8AX 1VQ7N 2OTJN 2FSJA 3EE9A 3WUHA 2KLAA 2P9NA 3EE8A 5FPMA 4PL7A 4B1WB 3DAWA 4IO8A 2ZJPL 3FGUA 1YITN 3ZX0A 3ZX2A 1NGJA 3MX5A 4KH5A 5GADP 3C6HA 2QWPA 3MDQA 4RWTA 3EZWA 3OHRA 4A59A 3C7NB 5AQIA 2CH6A 3UKUA 5C2FA 1DKGD 1OVYA 1ATNA 2P9NB 1VQON 5AQNA 1ESVA 3MCAB 3WT0A 2BTFA 3CIPA 3VEVA 4WFAL 4AM7A 4O8KA 1GLCG 1KAYA 4JK7A 3I33A 4ISFA 4G9ZA 1BWFO 3CF5L 1G99A 3O1WA 2PAVA 5AZJB 3UKUB 4JKAA 3J8AA 1T44A 3QICA 3CC2N 4H5TA 2A41A 2GTDA 5AQUA 4JAXA 4WFNL 3DXMA 1RGIA 3CJ9A 4Z94A 3A5NC 1YJWN 5AQFA 3HTVA 5BRHA 3E9OA 2Q0RA 1YXQA 3HOSA 4PKHA 1U6ZA 4E1JA 4JKEA 1W2BM 5C10A 2NZTA 4FO0A 3HI0A 2HMPA 5HL7L 4WF9L 4I6MA 3E66A 4WQ5A 1DT9A 5E26A 3FZFA 1QZ5A 3O1BA 3SK3A 2BH1A 1M90O 1K8KA 3F5TA 4M7YA 1Z6RA 3DXMB 1NLVA 2V7YA 3ZX3A 4FWKA 2D1KA 3KWGA 2QTDA 2E88A 4BRCA 1S72N 2CGLA 3M6GA 4IEIA 2AP1A 4WQ5C 4I6MB 3VEZA 4YOXA 5EVZA 1VQNN 3G71N 4CZHA 4IOCL 3M5RA 1BA0A 3R3LA 4A2AA 5BREA 4JKCA 4NO7A 5AQJA 3G4SN 2GEMA 3E9PA 3T69A 4H0OA 1VQ9N 2WC9A 3FFKB 2F9TA 3CCLN 4U67L 1S22A 2ASMA 3ID8A 3O9SA 3FZLA 3FLCO 3MMVA 1Q18A 5AQVA 3WXMB 5JLHA 5JMVA 3BUZB 3IDHA 1KD1O 3ENOA 3HZ6A 2P9LB 4BGAA 4JD2A 2QWRA 3VGMA 3O6WA 5E84A 4JKGB 3CJCA 1GLAG 5BPMA 5KQ8A 3LDOA 1YF5L 4CZJA 4GY2B 5C2DA 3HSCA 1N8RO 1GLEG 3K9KA 1DGKN 1T6CA 3QBXA 1HLUA 4XH5A 5AQHA 3SMSA 4FL9A 4H5VA 5BPLA 3QBWA 1BO5O 1QVGM 4JD2B 4IXCA 2HBMA 4DHYA 4YOYA 4OO1J 1HJOA 3H3NO 3M3ZA 3SAFA 3O5BA 4WCEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9S A;  4OPH A;  3D6R A;  3F5T A;  3L4Q A;  3O9U A;  2RHK A;  3KWG A;  3OA9 A;  3O9T A;  4OPA A;  2KKZ A;  3O9Q A;  3EE9 A;  3P39 A;  2GX9 A;  3EE8 A;  3P38 A;  3RVC A;  3O9R A;  3M5R A;  3P31 A;  3KWI A; 
#chains in the Genus database with same CATH topology
 1HNW K;  4DSI A;  2HHS A;  3DLH A;  1QSL A;  1LOT B;  1DTT A;  1WSG A;  4MO4 A;  4LD0 A;  2G8I A;  4M45 A;  3ATU A;  5EY4 A;  4KH4 A;  2FBV A;  4DQI A;  3CC4 N;  1A5X A;  3QO9 A;  4FWL A;  3PLA A;  4NXN K;  4B1U B;  3MWT A;  3SPZ A;  4LH4 A;  1TKX A;  5GAG P;  4B8A B;  4IG0 A;  3I8D A;  1CXU A;  2QXL A;  1QQC A;  2KW4 A;  2HBK A;  2O4G A;  1WBB A;  3EZ5 A;  2F9W A;  2NRT A;  1XHX A;  4AQY K;  4KFB A;  3MEE A;  2WUS A;  4CZG A;  4F8R A;  1S1T A;  4YNQ A;  5C24 A;  4YOV A;  3RSE B;  4CJV A;  4GV6 A;  2Y1I A;  4A2B A;  4JK9 A;  4FJL A;  3SI6 A;  3VMF B;  1VQM N;  4KV8 A;  4PKG A;  4EZ9 A;  3CXC M;  4RTF D;  1VSF A;  4RW9 A;  4FWO A;  4G1Q A;  1C0U A;  2H3G X;  3V9W A;  1VRU A;  1LAW A;  3R6M A;  4LSN A;  1NJI O;  5JS2 A;  5AJ3 K;  4B9V A;  3QIP A;  1JLB A;  3CM5 A;  4BRK A;  2P5O A;  3K9J A;  1T05 A;  2KQ2 A;  1KAX A;  3BY5 A;  3ULE A;  5KI6 A;  3PSF A;  4OGE A;  5KQD A;  1BI4 A;  1EKE A;  4GMJ B;  2FXU A;  1YI2 N;  4LF6 K;  4ZTJ A;  1GLL O;  2QA4 N;  2QWN A;  3ZSR A;  4CFC A;  1SAZ A;  4FJN A;  4CF2 A;  4DV3 K;  1WSJ A;  3LDP A;  3CQY A;  3SJJ A;  3QLH A;  1X3N A;  2A3Z A;  4YOT A;  4BRF A;  3TU5 A;  3EL2 A;  4DQP A;  3KD1 E;  2O8B B;  2HF3 A;  2NRH A;  3J81 O;  3M8S A;  1Y64 A;  1D9D A;  4IOA L;  3S9H A;  2KFN A;  2P9P B;  4BR9 A;  3QIO A;  3SJH A;  1C1B A;  4FSV A;  1R59 O;  3LAN A;  2QEX N;  2EWS A;  3VEN A;  3AA2 A;  3T1Y K;  4LFC K;  1YT3 A;  4JKB A;  5BRD A;  4C1N K;  3P4I A;  4CGG A;  1XC9 A;  4RG8 A;  1SKS A;  1VSI A;  2IIR A;  3BGR A;  3CCQ N;  1N33 K;  1BA1 A;  3D6R A;  4QS9 A;  1RBV A;  4O44 A;  1BUP A;  4FJM A;  4H03 B;  4BRM A;  4WYB A;  2YKM A;  3GOI A;  3THY A;  4DTM A;  3EO3 A;  2UXC K;  1HX1 A;  2Q3S A;  3I56 N;  4HUF A;  4PL8 A;  4IDH A;  4W5O A;  4KTW A;  3HOT A;  4FWN A;  4BG9 A;  2W6K A;  4IKF A;  3THV A;  4CI6 A;  4X66 K;  3CCR N;  3WXI A;  4CEC A;  2UXD K;  3RSE A;  3OW2 M;  3C6A A;  3LP3 A;  4FLY A;  2NRZ A;  3F73 A;  3VQC A;  3FZK A;  3AVJ A;  4EFH A;  1Q81 O;  1VSJ A;  1VQL N;  2QWM A;  5GIP A;  1S6P A;  3FZM A;  3GBT A;  4FJH A;  4A5B A;  3QNO A;  1V4S A;  1WNS A;  3LWL A;  3H1Q A;  4ZHR A;  5BRF A;  4ELU A;  3WXK A;  5HBM A;  3WQU A;  3OBW A;  1RBU A;  3ZET B;  1FKO A;  2E2N A;  2NRX A;  1ILY A;  2XY7 A;  3VA0 A;  4O55 A;  1TYQ B;  2B6A A;  2VYP A;  2GBZ A;  5C15 A;  3GE1 A;  3ID6 A;  1WSE A;  1L3V A;  3MWP A;  4JNE A;  3H1V X;  2E20 A;  3C65 A;  2I7P A;  2YHB A;  4AHS A;  3NBP A;  1U2V B;  4K43 A;  3UE5 A;  4B3O A;  2GWK A;  2ZWH A;  4YOW A;  4H0Y B;  5DK5 A;  4AHR A;  4DU1 A;  3LZJ A;  3L6Q A;  1XHZ A;  1SL1 A;  4JKH A;  3CCS N;  3HBT A;  3DM2 A;  1IBK K;  1S9E A;  5BN9 A;  4FWM A;  4DTP A;  1CLQ A;  2WON A;  4CD1 A;  2IAJ A;  4JI6 K;  1C1A A;  3AVI A;  3VQA A;  3CC7 N;  2PYL A;  3AV9 A;  2Y1J A;  2P9P A;  1H1V A;  1K8A O;  2QWL A;  5JVG L;  3AGK A;  3IFR A;  5M1K A;  4DLE A;  1QE1 A;  1LWC A;  1EWQ A;  2KZZ A;  3OYF A;  2IVN A;  1D8Y A;  4KRE A;  3VF6 A;  1TAQ A;  3DLL L;  3QET A;  1RTH A;  3NAE A;  4CD3 A;  2XY8 A;  4NXM K;  3VQ9 A;  4CEA A;  3ZT1 A;  4EZ6 A;  3D7E O;  3H45 C;  3KLG A;  3EYZ A;  3U4L A;  1E4G T;  1U45 A;  5AQT A;  1FJG K;  3MAQ A;  3MN7 A;  1GOB A;  2Z1H A;  4KHP K;  3G10 A;  4KHU A;  3O4Q A;  1REV A;  1NGI A;  1NBW A;  4DTN A;  3WNF A;  4H5N A;  4CED A;  3LAL A;  1K73 O;  3MN9 A;  1QQO A;  3R1X A;  5HRS A;  2AA4 A;  2O8F A;  3ZEU B;  1NGA A;  1T03 A;  4JI0 K;  3AA4 A;  1QTM A;  4N5S A;  4GW6 A;  3TTF A;  1T7P A;  2OCE A;  1I39 A;  1GLF O;  4BDP A;  1JLG A;  1SS6 A;  1QQM A;  1JL1 A;  3QES A;  3K5O A;  4BRP A;  4FJ7 A;  2EX3 A;  2KHO A;  3SBT A;  5LJW A;  2A1R A;  1S1W A;  2CGJ A;  4PA1 A;  3OTO K;  3CET A;  4KB1 A;  2ITM A;  4ID5 A;  2NRR A;  4GVM A;  3RMA A;  4Z4C A;  3DXK A;  3KLE A;  1U4B A;  1RT3 A;  4KHS A;  3I8B A;  3T1A A;  4R79 A;  2FF3 B;  4IO9 L;  3AVA A;  2ZGZ A;  5AQP A;  4OLB A;  1UWB A;  5AR0 A;  4BR0 A;  2GUP A;  4J2B A;  5H1S Q;  3KLI A;  3PX4 A;  3V1Q A;  2E2P A;  4CZE A;  1Q8I A;  1SQK A;  3CCM N;  2HHW A;  1RT1 A;  1W7A A;  2Z1G A;  3C7N A;  4V19 S;  1NJW A;  2Z1I A;  3TTC A;  2FSJ A;  1L5U A;  3B6P A;  3EE8 A;  1KLM A;  4F2S A;  4JV5 K;  1YIT N;  3ZX2 A;  1NGJ A;  3MX5 A;  2UUA K;  2QWP A;  1WBD A;  3MDQ A;  4RWT A;  4PY5 A;  3EZW A;  3OHR A;  2YNG A;  4FK0 A;  4O5B A;  3OYG A;  3F9K A;  1NK6 A;  4JS4 A;  3CIP A;  3P1G A;  2HND A;  4JK7 A;  3QEP A;  3DLB A;  3HL8 A;  4FXD A;  3CF5 L;  5AZJ B;  4JKA A;  3J8A A;  1C6V A;  1RTD A;  2A41 A;  2GTD A;  3NFA A;  4JAX A;  4DSE A;  4WFN L;  1YJW N;  3HVT A;  1QSY A;  4CEQ A;  5AQF A;  3HTV A;  3ZSX A;  3P5J A;  2NZT A;  4FO0 A;  3HI0 A;  3QEW A;  2HMP A;  5HL7 L;  5FRM A;  1RT7 A;  1YTU A;  4WQ5 A;  2HVH A;  2O8E B;  3FZF A;  3AVC A;  4CFB A;  4CER A;  4M7Y A;  1NLV A;  2ZQB A;  3AVK A;  3ZX3 A;  1SKW A;  4O0J A;  1QS4 A;  4BRC A;  1S9G A;  1ZBH A;  3M6G A;  4FM2 A;  5EVZ A;  1R0A A;  4NYN A;  1DLO A;  4TSX A;  1BA0 A;  1RBR A;  5BRE A;  5AQJ A;  4NO7 A;  3E9P A;  1U04 A;  1VQ9 N;  3FFK B;  2F9T A;  3MEG A;  2IS3 A;  4FLT A;  2ASM A;  3ID8 A;  5AQV A;  3MMV A;  3V1O A;  4BWM A;  5JLH A;  3SUN A;  1N5Y A;  3NGI A;  4BE2 A;  1IG9 A;  3DYA A;  4BGA A;  3TAR A;  4JKG B;  5J2P A;  3CJC A;  5BPM A;  3LDO A;  2QKB A;  3DMJ A;  1N8R O;  4XH5 A;  1DGK N;  2RPI A;  3SMS A;  1WSI A;  4X65 K;  3KJV A;  1RIL A;  3K2P A;  4JD2 B;  4OO1 J;  1W0H A;  3M3Z A;  4AIL C;  1WSH A;  3V6D A;  4B1X B;  4HWI A;  4LF9 K;  4QS8 A;  1JLF A;  2G8F A;  5JIC A;  2P9S B;  1VQ5 N;  3WEE A;  4DCH A;  3VGL A;  2FBT A;  1HPM A;  1IBL K;  3TAP A;  1IO2 A;  4ELT A;  4Y1C A;  4E19 A;  3OYJ A;  1QZ6 A;  4JI3 K;  3U8X A;  4J2D A;  4KI6 A;  5HRN A;  4N41 A;  1BIZ A;  4B9M A;  3LP2 A;  3VF2 A;  3QEX A;  4DSK A;  4W5R A;  3WXJ A;  3I0R A;  4M3X A;  4C23 A;  4BDY A;  1JCG A;  4C8N A;  3V9S A;  4XH4 A;  4OPJ A;  3HM8 A;  1EP4 A;  1FK9 A;  1DEJ A;  4M3Z A;  3TAE A;  2GEL A;  4QAG A;  3QFP A;  4LF8 K;  2O8D A;  4M3T A;  2WBN A;  2NUB A;  3CPE A;  3A5M C;  3H6E A;  4CHY A;  4C8L A;  4BC3 A;  4CEZ A;  4DV1 K;  1Q86 O;  3ASM A;  4JKF A;  2UYT A;  3P83 D;  1L3T A;  3CQX A;  3VN5 A;  5AZJ A;  3G0Z A;  1ZBF A;  4DSJ A;  3H46 O;  4NCB A;  4CEO A;  2BGG A;  4BRD A;  4ELV A;  4NYF A;  1OVQ A;  1NGC A;  3GL1 A;  2VWB A;  2XY6 A;  1SZ2 A;  4NLB A;  5F1X A;  4XEI A;  1ATR A;  1BG3 A;  4FWQ A;  1C0G A;  1Z05 A;  2V51 B;  2HF4 A;  4BQL A;  1RDA A;  4PQU A;  4BR2 A;  3K58 A;  2V52 B;  3LDS A;  4AF1 A;  2HVI A;  1BCO A;  1TKZ A;  1JKH A;  3L2U A;  3ULE B;  1GLD G;  3MXM A;  3P39 A;  4LFB K;  4MDA A;  4B1Y B;  5HP1 A;  3SNN A;  3LM9 A;  4B3T K;  4JI4 K;  4X64 K;  5KGX A;  3LWM A;  4JKG A;  2PBD A;  2YHX A;  3A0I X;  3BF3 A;  1B9D A;  2VGN A;  3JSM A;  2VG7 A;  2BDP A;  4M41 A;  1V4T A;  3CCE N;  3ZSY A;  4B3R K;  4OPK A;  3ULD A;  4OPA A;  3NGY A;  3E1Y A;  1D5A A;  4N47 A;  4PUO A;  3WNH A;  2BUP A;  1HR0 K;  4OX9 K;  1BIS A;  2P9S A;  5K14 A;  3JS6 A;  4RW7 A;  1J5O A;  4CCH A;  4BWJ A;  2YX6 A;  4NCG A;  3KVG A;  3VF4 A;  4B1V A;  1TL3 A;  3O8M A;  3I55 N;  3VA3 A;  2P9I A;  2UUB K;  4FK4 A;  3LP1 A;  2HOE A;  3MX2 A;  3CER A;  2QM1 A;  3S3M A;  1KFS A;  3RRG A;  4BRQ A;  4CK2 A;  4UQG A;  1QQN A;  4L3Q A;  1VSM A;  1J53 A;  4FWP A;  4JEP A;  4FOE A;  4LFA K;  3IUC A;  5AQK A;  2E2Q A;  3C6U A;  3LZI A;  4CGF A;  5F0X A;  5HRP A;  4A62 A;  3THY B;  1IJJ A;  2DTU A;  4I2P A;  2YHY A;  4KHQ A;  1HKC A;  1NM1 A;  3MCP A;  2E8A A;  1XNQ K;  4FK2 A;  4EP4 A;  1EQY A;  1VSH A;  1NGB A;  4B9N A;  3U9D A;  4QCL A;  3T19 A;  2IVO A;  2UXB K;  2VGM A;  5KRT A;  4FW2 A;  3OYN A;  3NF6 A;  3B6O A;  3NVM A;  4BRO A;  4CBX A;  2F7T A;  4HUG A;  3OS0 A;  5CYQ A;  4N56 A;  1GLB G;  3PY8 A;  4PKI A;  3M8R A;  4B9U A;  3OYI A;  2W41 A;  4KO0 A;  3CCJ N;  3K0S A;  1XC3 A;  3ENB A;  2CH5 A;  4DF4 A;  4F3O A;  3PSI A;  4Z4E A;  3NF7 A;  3QFU A;  3VOV A;  4LF5 K;  3CD6 N;  5CE3 A;  3PIO L;  4K25 A;  5LMU K;  4AHC A;  2I7N A;  1YTA A;  3C0B A;  4BDZ A;  1OH8 A;  3DLG A;  3ATV A;  4IFV A;  2J4R A;  5LJV A;  1A5W A;  3MED A;  4FM0 A;  1OH5 A;  2F8T A;  4ISG A;  5AQW A;  1P90 A;  3T1H K;  1BL3 A;  3TR8 A;  4W5Q A;  4DR2 K;  5ELZ A;  3SLC A;  3NDK A;  1SKR A;  3NH1 A;  1JXB A;  2PZS A;  2R7Y A;  4B1Z A;  1U48 A;  5GIN A;  3ITH A;  4X62 K;  4JI1 K;  2HHH K;  5LMN K;  3DLE A;  3ZSZ A;  3MXJ A;  3IG1 A;  4YFU A;  4FLZ A;  3U3G A;  2YHA A;  4OJR A;  1MWK A;  1K8K B;  2QXF A;  1YUW A;  2O8C A;  4GKJ K;  3V9X A;  1VQ8 N;  3EKU A;  4EIA A;  2HHQ A;  1F21 A;  3OYD A;  3L2R A;  5DM6 L;  4BY9 C;  2HW3 A;  4DV7 K;  3H3O B;  2ATQ A;  3A2F A;  3AAP A;  3CME N;  4BC5 A;  5EX5 A;  5M1N A;  1JLC A;  2HBL A;  4ISE A;  3UIQ A;  2Z1J A;  4H5W A;  4FLV A;  1X9W A;  4FLU A;  2YJF A;  4JHD A;  4JKD A;  4CF9 A;  4ILG B;  2O8F B;  1NG9 A;  5AQL A;  5CZ2 A;  3VES A;  3NF8 A;  5AFU H;  3PO4 A;  4KTZ A;  4CES A;  3DWL A;  1LAV A;  1ZXO A;  3TAF A;  3THX B;  1L3S A;  2E2O A;  3IKM A;  4DS5 A;  1E4F T;  4DQS A;  5HLF A;  5GIO A;  4DR5 K;  3OY9 A;  5FPD A;  1HRH A;  1RT6 A;  1XMO K;  1TAU A;  3IMX A;  3LPU A;  3OJU A;  3KK2 A;  3L2W A;  5CR4 A;  1GOA A;  3ZT0 A;  4BRA A;  4DU3 A;  1VSK A;  4BE1 A;  1U47 A;  3DXK B;  4DKW A;  4Z0U A;  4CJP A;  3QB0 A;  1LWF A;  1NK0 A;  1YVN A;  5AZI B;  3AO5 A;  3N4Q A;  4ICL A;  1UA1 A;  3SAH A;  1HNX K;  1U49 A;  1VQ7 N;  1VRT A;  3EE9 A;  2P9N A;  1TV6 A;  2IOC A;  2X74 A;  2VG5 A;  3LAM A;  3ZSO A;  4ZTF A;  1B92 A;  4H8K A;  3SV4 A;  3C7N B;  3O3F A;  3CG7 A;  2VWK A;  3BDP A;  1SL2 A;  4FZZ A;  1ATN A;  3OVN A;  3WT0 A;  2BTF A;  2FBY A;  4WFA L;  1NJZ A;  4ISF A;  1NKE A;  4CJU A;  4FLX A;  3HM9 A;  3O1W A;  3OYK A;  3CC2 N;  4DTJ A;  4H5T A;  2QKK A;  5AQU A;  5DMR A;  3K57 A;  3DXM A;  3A5N C;  4KI4 A;  4M42 A;  5BRH A;  3V9U A;  2Q0R A;  4I2Q A;  1U6Z A;  4WF9 L;  4I6M A;  5E26 A;  1ZYQ A;  3O1B A;  1OH6 A;  3QEV A;  2BH1 A;  3O3G A;  1K8K A;  1M90 O;  1Z6R A;  2YNF A;  4HCC A;  4FWK A;  3CFR A;  2IC3 A;  2QTD A;  2E88 A;  1N36 K;  4IEI A;  1VQN N;  4DV2 K;  4CZH A;  4CJS A;  3PX6 A;  2W6L A;  3R3L A;  4JI2 K;  5FDL A;  2WC9 A;  4E3S A;  3FLC O;  1WLJ A;  5JMV A;  3BUZ B;  3IDH A;  2OPR A;  3ENO A;  2P9L B;  1RDD A;  2XY5 A;  1IBM K;  3O6W A;  4H4M A;  3MEC A;  3IRX A;  4M3U A;  4CJE A;  3D0P A;  4KTQ A;  3HSC A;  3HO1 A;  4ID1 A;  1HLU A;  4DR1 K;  4FL9 A;  5BPL A;  4LY7 A;  4IXC A;  3THX A;  4DTS A;  4DHY A;  4YOY A;  1HJO A;  3H3N O;  3S3O A;  3RMC A;  1I3A A;  4JRP A;  3QDK A;  2VQE K;  4CJ5 A;  3LDN A;  2I5J A;  4U7B A;  3HXM A;  2NNW A;  2HNY A;  3AGR A;  4AHT A;  4MDB A;  2E1Z A;  3PV8 A;  3AVB A;  2QI2 A;  3M8Q A;  4H0T B;  1JLA A;  2X6S A;  4CJ7 A;  1IG8 A;  2Q2R A;  1WN7 A;  3RMD A;  4CGJ A;  3L2Q A;  3WEE B;  2P5G A;  1VQ6 N;  2P9U B;  5AZI A;  4DTO A;  1ASV A;  2YI1 A;  3AO4 A;  3EEQ A;  4JRQ A;  4JS5 A;  1S6Q A;  2FF6 A;  4OPH A;  1NGD A;  2V7Z A;  3HP6 A;  1Y97 A;  4MLE A;  1IKW A;  3L3U A;  4IEE A;  4E7L A;  1RBT A;  4KRF A;  2GX9 A;  1BOT O;  4B9S A;  3GG4 A;  1NNE A;  3P31 A;  1O1W A;  2FLO A;  3SBG A;  4FVM A;  2YV0 X;  2FSN A;  4CIG A;  2P1J A;  4CZL A;  3O4N A;  4DUY K;  3SYZ A;  3SQ4 A;  4JI8 K;  4K8Z A;  1TUU A;  3TAG A;  2O8D B;  2G8V A;  1NMN A;  3A5O C;  2RHK A;  3DJC A;  4NB4 A;  3Q7B A;  5AQO A;  1WOQ A;  5JLF A;  3SCX A;  4C8K A;  3VQE A;  3VTH A;  1IV0 A;  4DQ8 A;  1SUQ A;  3O9Q A;  4FOI A;  1YJ9 N;  5MLC Q;  3AVN A;  2DPN A;  4HHT A;  5FPE A;  5E41 A;  2DY4 A;  4DR4 K;  3VEW A;  3LL3 A;  4KHY A;  5BN8 A;  4BVO A;  3M8P A;  3J7Z O;  1C1C A;  1S1X A;  5HOO A;  2D0A A;  4FZX C;  3TWH A;  4BVP A;  4DFP A;  4Z4I A;  3ZSW A;  4CJW A;  1HNZ K;  4BR5 A;  2IVP A;  2NLX A;  5D3G A;  2NRV A;  1MDU B;  2P9L A;  4CHQ A;  3NHG A;  1X9J A;  2E6L A;  1VQK N;  2NRW A;  2ZGY A;  3C6T A;  4E89 A;  1NGH A;  4CHO A;  4B3M K;  4GNI A;  4FCY A;  4FJK A;  1QHT A;  4CGI A;  4CJK A;  4MLH A;  2JGU A;  2XRI A;  2G8U A;  4BRG A;  2KTQ A;  4AM6 A;  5FPN A;  1VSL A;  3OYB A;  5J1E A;  1VSE A;  3SZ2 A;  2A42 A;  5FRN A;  3BZK A;  3HYF A;  4BQZ A;  2D0O A;  1J5E K;  1KC8 O;  2ZJR L;  4R5P A;  3VET A;  3U3Y A;  3MK6 A;  4KHN A;  1ZBL A;  1HYV A;  3QML A;  3G25 A;  4E1M A;  4FPB A;  4DSL A;  4A5A A;  2P9U A;  1IH7 A;  4BC4 A;  1TUY A;  3TPQ A;  2P9I B;  3OYE A;  1BCM A;  2VQF K;  4LF4 K;  3AAQ A;  4Y0W A;  4CJ3 A;  4FJ5 A;  2VG6 A;  3HP9 A;  3D2F B;  4IDK A;  4J2A A;  4BRL A;  2B4J A;  3G6E N;  3OS2 A;  4IJN A;  1EWR A;  4CZK A;  4CK1 A;  4DFM A;  1C0F A;  5AQM A;  1I94 K;  3ALY A;  3W0L A;  4RW6 A;  1Q9Y A;  1RDC A;  1E3M A;  4O5F A;  3CJ7 A;  3TAM A;  1UOC A;  2HNZ A;  1SL0 A;  3LM2 A;  3M1F A;  4OVL A;  5ADX H;  3THW A;  1NMD A;  4F4K A;  4F2R A;  3OBY A;  4M3W A;  3ZCM A;  3R9P A;  4WE1 A;  3OJS A;  1G15 A;  3FE1 A;  5A2Q O;  3SPY A;  3AA5 X;  3WNG A;  2PFU A;  3BF1 A;  1HQU A;  1LCU A;  2UU9 K;  4CHZ A;  3TAQ A;  4AHV A;  2ZM6 K;  4RW4 A;  4PWD A;  3KK1 A;  4Y1D A;  3SMP A;  2FBX A;  2P9K B;  2RN2 A;  2X6N A;  3SV3 A;  4C1N I;  3I0S A;  1KSP A;  5T7B A;  2A5X A;  5AQZ A;  3UB5 A;  2Q1N A;  1N32 K;  4CHN A;  4BAC A;  2GWJ A;  4E7K A;  1YJN N;  1ZC6 A;  5F2R A;  4BR4 A;  4MO5 A;  1HMV A;  3NH0 A;  4LC9 B;  1L3U A;  3AVG A;  3QEI A;  3JAM O;  4BG8 A;  5J2N A;  3LAK A;  4BRH A;  3ZT2 A;  4A57 A;  4J2E A;  1EX4 A;  1RDU A;  4BR7 A;  2E1Y A;  5I42 A;  4CK3 A;  3N4P A;  2DFF A;  1J6Z A;  2OPQ A;  1BQM A;  3AO1 A;  4KB0 A;  1HUX A;  3RTV A;  5M1Q A;  3D45 A;  3RR8 A;  1XMQ K;  3J7Y P;  4EHT A;  4YOU A;  5KPZ A;  4LSL A;  4BC2 A;  5TKY A;  5ADX A;  3GDQ A;  4NLC A;  2A40 A;  4YDU C;  2F4V K;  2HST A;  3VGK A;  1EO1 A;  2ASP A;  3AVH A;  5BR8 K;  1BHL A;  4I9Q A;  3BEX A;  3CM6 A;  3A5L C;  5CZ1 A;  4HCB A;  1KAZ A;  4AH9 A;  2WTU A;  4B9T A;  4FVU A;  3TSU A;  3QNN A;  4CZM A;  1JLE A;  3A8Y A;  1X9M A;  2ZF5 O;  2O8C B;  3U9Z A;  3K5L A;  3CQ8 A;  4JLH A;  1X3M A;  4CF0 A;  2OZM A;  3CJ1 A;  1O13 A;  1KFD A;  3D2F A;  2HMI A;  3VQ6 A;  1Q9X A;  3O9R A;  3HT3 A;  3K59 A;  4CZI A;  4BRE A;  4FLW A;  2Q36 A;  3DLK A;  4CGD A;  4HUE A;  1MWM A;  1XWL A;  4CGH A;  3HST B;  1GOC A;  1RCH A;  1WUA A;  4HVJ A;  1YIJ N;  4H4O A;  2QK9 A;  3AVL A;  4QOZ B;  4RCH A;  4JHD B;  4DS4 A;  3C95 A;  5B8H A;  1MA9 B;  2GUI A;  4KHW A;  1JL2 A;  2EHG A;  3RRH A;  1ATS A;  3KZB A;  3F2K A;  5KPR A;  2F96 A;  2XO7 A;  2VCP A;  4M63 C;  1UAX A;  3NGZ A;  3VQB A;  4WQ4 C;  3PIP L;  2KFZ A;  3VEO A;  3ZLJ A;  4KPY A;  3OYH A;  3O80 A;  1S1U A;  4DU4 A;  3IS9 A;  4I9L A;  3EKS A;  4RW8 A;  1T6D A;  3WQT A;  4YY3 K;  1VSD A;  1FXX A;  1RDB A;  1VHX A;  3CCV N;  5BR9 A;  1BU6 O;  1HNI A;  2WOM A;  5TKW A;  4O0I A;  3LDQ A;  4CJR A;  2P9K A;  3B8A X;  2OTJ N;  3OS1 A;  4EP5 A;  4PL7 A;  3DAW A;  4I7F A;  4IO8 A;  3FGU A;  4DV5 K;  5HRO A;  3ZX0 A;  5GAD P;  3C6H A;  5AQI A;  3UKU A;  1CXQ A;  3HPO A;  2P9N B;  5AQN A;  2HHU A;  1ESV A;  3KLF A;  4F3T A;  1KVA A;  4AM7 A;  2ITG A;  1KVB A;  4O8K A;  2D0B A;  3VQQ A;  1G99 A;  4CJF A;  1T44 A;  2GV9 A;  2G8W A;  1KRP A;  2IGI A;  4CJQ A;  4Z94 A;  4FJG A;  4CHP A;  5C25 A;  1SV5 A;  4L8R B;  3HOS A;  4DUZ K;  4E1J A;  4JKE A;  3KTQ A;  5C10 A;  5EU7 A;  3E66 A;  1QZ5 A;  3VQ4 A;  3JYT A;  2UUC K;  3F5T A;  3FFI A;  4CF1 A;  3DXM B;  2D0C A;  4HTU A;  2D1K A;  1S72 N;  2CGL A;  3NH2 A;  1ASW A;  3VEZ A;  1QSS A;  4I6M B;  4YOX A;  5FLX O;  3IAY A;  3G71 N;  3M5R A;  4MFB A;  1ASU A;  4JKC A;  4MQ3 A;  2GEM A;  1JXE A;  3T69 A;  3SUO A;  3VQ8 A;  3AVM A;  2HHX A;  4U67 L;  1S22 A;  2XHB A;  3O9S A;  4Q0B A;  3FZL A;  3U6F A;  2G8H A;  1ITG A;  4CJ4 A;  4Z4H A;  5E84 A;  4IG3 A;  3ZSV A;  1GLA G;  3LPT A;  1HJR A;  4AHU A;  4GY2 B;  1GLE G;  3QBX A;  5AQH A;  3QBW A;  2PYJ A;  1QVG M;  3HVR A;  5KRS A;  2HBM A;  4W5T A;  4CF8 A;  2W42 A;  3O5B A;  1KD1 O;  4WCE L;  4DMN A;  2KZM A;  2QWO A;  1YHQ N;  1CZB A;  4E1N A;  1ZBU A;  3KK3 A;  4FJI A;  1BQN A;  1TKT A;  2W40 A;  1XUP O;  1YVU A;  1BIU A;  2WFB A;  3TSQ A;  3OA9 A;  5IT9 O;  3KLH A;  2FC0 A;  2JWL A;  1Q7Y O;  3L4I A;  3OYA A;  4H0V B;  3DOK A;  3OYC A;  2OPS A;  4CVN E;  3AY9 A;  3RVC A;  4B3S K;  1NK9 A;  1NGE A;  4E7I A;  4A61 A;  1KXP A;  2YCH A;  4K41 A;  1NWK A;  3K5N A;  3EN9 A;  5AQY A;  3TAB A;  1N34 K;  3NCI A;  3KK7 A;  4EHU A;  3K5M A;  4NCA A;  5DM7 L;  5GAH P;  4Z4F A;  4OKE A;  1HPZ A;  1TGO A;  4DR3 K;  2IDO A;  5HRR A;  2Q31 A;  4GVE A;  1RDW X;  1IKV A;  5JVH L;  2RF2 A;  4H0P A;  5AQR A;  2ETJ A;  1RT4 A;  1D9F A;  2OYQ A;  1HKB A;  3H08 A;  3L0Q A;  3HK2 A;  3NE6 A;  1WAJ A;  3VER A;  4KBO A;  4CW7 B;  1YAG A;  3RWU A;  1RNH A;  2OAN A;  1W97 L;  2E4L A;  2KKZ A;  1VQP N;  4B9Q A;  5I3U A;  3PUF A;  3AO2 A;  4H5R A;  4DV4 K;  4FJX A;  4FM1 A;  2OTL N;  3R8E A;  2G8K A;  3CI5 A;  5AFU A;  4DFJ A;  3KWI A;  3O4W A;  1XI1 A;  3SQ0 A;  3HRG A;  4IFY A;  5I9E B;  3O9T A;  2O8B A;  3TTD A;  4ILJ A;  2Q97 A;  3L3V A;  1K9M O;  3NMU A;  1KVC A;  4JYA K;  4EAH D;  5SWM A;  3D2E B;  3MN5 A;  4IJA A;  4W5N A;  4J8F A;  4YHH K;  3PO5 A;  1WAF A;  3VQ7 A;  3O3H A;  4BGB A;  5M1P A;  4DQR A;  4XIU A;  2ZE2 A;  4B8C A;  1CZ9 A;  4YOR A;  3W3D A;  1QVF M;  1W9H A;  2RE2 A;  4E7J A;  3ZSQ A;  1CZA N;  4XH1 A;  1T3V A;  4M3Y A;  3KHY A;  3WNE A;  1WB9 A;  4Z4G A;  1NOY A;  2P51 A;  1KQS M;  1M1K O;  2PY5 A;  4H0X B;  4GV3 A;  3OYM A;  4IOX A;  2ZJQ L;  1QHA A;  3DRP A;  1T8E A;  3FZH A;  3UKR B;  2LSN A;  5AQX A;  3TSP A;  1LWE A;  3VPZ A;  3MXI A;  2HHV A;  4LH5 A;  4DSF A;  4FWS A;  1FKP A;  3VQ5 A;  5M1O A;  2QW9 A;  5GAE P;  3E9L A;  1IKX A;  4QS7 A;  3OYL A;  2YNH A;  2ASO A;  4K0K K;  3V81 A;  3HJF A;  4CEE A;  1S3X A;  2YKN A;  3VEY A;  4BRI A;  2Q0U A;  4B9L A;  2YJE A;  3O9U A;  1VQ4 N;  3ZET A;  4GKK K;  3ISN C;  2A6A A;  1NU0 A;  4DF8 A;  4FJ8 A;  2JWK A;  1TYQ A;  3ENH A;  4O4G A;  1BGX T;  3CCU N;  4CIF A;  1X1P A;  3P38 A;  1KLN A;  5EXW A;  1A5V A;  4C8O A;  4F9O A;  4DTX A;  5IWA K;  5JS1 A;  3J7A P;  3JXU A;  3T7Z A;  3BZC A;  1U2V A;  2D0P A;  1UA0 A;  1JJ2 M;  3L4Q A;  1XQS C;  1Q82 O;  3FR0 A;  2D4W A;  4DG1 A;  1TL1 A;  1OKJ A;  2QWQ A;  1C0T A;  4PHT X;  3THW B;  4DV6 K;  2HBJ A;  3KD5 E;  3VTI A;  4DB3 A;  2DFE A;  3QER A;  4DLG A;  1VK0 A;  3VQD A;  3SUQ A;  1KTQ A;  1S5J A;  5CY4 A;  5KPT A;  3DOL A;  4N76 A;  4CZF A;  2B5J A;  3NVK A;  1NK4 A;  1D4X A;  3D2E A;  3LP0 A;  4KH6 A;  4Q5V A;  4CFA A;  4BRN A;  1ZBS A;  4OKJ A;  3CPW M;  4K8X A;  5LL6 Z;  1LV5 A;  4CBU A;  2HB5 A;  4FPA A;  3C94 A;  3DI6 A;  4GV9 A;  3AO3 A;  3ZYY X;  1TVR A;  5AQS A;  1MU2 A;  4CJT A;  3SQ2 A;  4IFE A;  1NGF A;  4DFK A;  1VAZ A;  1BDG A;  4YDU A;  3EY1 A;  3CFP A;  4OGC A;  1NGG A;  3F9M A;  1RFQ A;  3V1R A;  4IZ9 A;  4O8U A;  1HKG A;  1GLJ O;  1K6Y A;  3SAG A;  4DV0 K;  4ILH A;  5AQG A;  1RBS A;  3VEX A;  4FJJ A;  5SZT A;  4OKK A;  3CJA A;  3S3N A;  3UKR A;  2E5L K;  3V9Z A;  4UY8 O;  3HPG A;  3MN6 A;  3E01 A;  1X9S A;  4FYD A;  1JCF A;  1RTJ A;  2FSK A;  5C12 A;  3ZEU A;  1RT5 A;  3LDL A;  5M1F A;  4JI5 K;  1NKC A;  4IWV A;  5EOY A;  3TI0 A;  4HTL A;  3CHW A;  1P8Z A;  1NK5 A;  5C0Y A;  3S41 A;  4B08 A;  1Z26 A;  4M7X A;  3CMA N;  3WXL A;  4CBW A;  3T3F A;  1J9A A;  3CJB A;  1S1V A;  4CEF A;  3KKR A;  4WFB L;  3PX0 A;  3NF9 A;  4JK8 A;  1TKD A;  4E0D A;  1WSF A;  2X78 A;  1DTQ A;  2YHW A;  5FRO A;  2VWJ A;  1XNR K;  3AAR A;  4WQ4 A;  2D5R A;  5LY3 A;  1EET A;  4FWR A;  4IBN A;  4LF7 K;  1NKB A;  3BP8 A;  3KIO A;  1NK7 A;  1OH7 A;  3CFO A;  2CGK A;  1LW2 A;  4JN4 A;  2JLE A;  3Q7C A;  3J80 O;  4C8M A;  4DTR A;  3O08 A;  4E7H A;  5AQQ A;  1JCE A;  5BPN A;  3L2V A;  1TK0 A;  3QIN A;  3DLR A;  5CHI A;  4JI7 K;  4K42 A;  2A1S A;  4OLA A;  1NJX A;  3WUH A;  2KLA A;  3ZT4 A;  2OA8 A;  1FW6 A;  2ZD1 A;  2OZS A;  5FPM A;  4B1W B;  2ZJP L;  2YNI A;  3SQ1 A;  2BE2 A;  4KH5 A;  4BE0 A;  1J54 A;  4A59 A;  2CH6 A;  5C2F A;  1DKG D;  1OVY A;  4M3R A;  1VQO N;  3MCA B;  3VEV A;  2RKI A;  1GLC G;  2HHT A;  1KAY A;  3I33 A;  2O4I A;  2DFH A;  4G9Z A;  1BWF O;  3V4I A;  1NJY A;  2PAV A;  3DRR A;  3UKU B;  3QIC A;  2O8E A;  3KKS A;  1RTI A;  3AA3 A;  2OPP A;  2AJQ A;  1RGI A;  3CJ9 A;  2E6M A;  3DRS A;  3E9O A;  1YXQ A;  5KGW A;  4PKH A;  4CJL A;  1W2B M;  3RMB A;  1ZBI A;  1DT9 A;  4DQQ A;  3SK3 A;  4DTU A;  5KTQ A;  3VQP A;  3HPH A;  2V7Y A;  1KCF A;  3KWG A;  5CYM A;  4KAZ A;  4FJ9 A;  3L8B A;  5J2Q A;  4DWI A;  1N6Q A;  1IKY A;  1HYS A;  2AP1 A;  4WQ5 C;  1BI4 B;  3SUP A;  4IOC L;  4DR7 K;  3CYM A;  3RR7 A;  4A2A A;  4CEB A;  3AVF A;  4CFD A;  3G4S N;  1Z25 A;  4H0O A;  5J2M A;  3CCL N;  1LW0 A;  3WXM B;  1Q18 A;  3HZ6 A;  3ZT3 A;  4CE9 A;  1HNV A;  2BAN A;  4JD2 A;  4FZY A;  2QWR A;  3VGM A;  4CIE A;  1HQE A;  3TAN A;  1TK8 A;  1TK5 A;  5KQ8 A;  1YF5 L;  1C0M A;  1NOZ A;  4CZJ A;  2F8S A;  4KKO A;  5C2D A;  1HYZ A;  1NK8 A;  3K9K A;  1T6C A;  4H5V A;  1EXQ A;  1BO5 O;  4DR6 K;  1JLQ A;  1RT2 A;  4FW1 A;  3SAF A;  5C42 A;  1B9F A; 
#chains in the Genus database with same CATH homology
 4B1X B;  2QWO A;  3QDK A;  1YHQ N;  4HWI A;  3LDN A;  4U7B A;  4QS8 A;  1LOT B;  2NNW A;  3AGR A;  5JIC A;  2P9S B;  4MDB A;  3WEE A;  1VQ5 N;  2E1Z A;  2W40 A;  1XUP O;  4DCH A;  3VGL A;  1HPM A;  4MO4 A;  2WFB A;  3TSQ A;  3OA9 A;  3ATU A;  2JWL A;  5EY4 A;  1Q7Y O;  3L4I A;  4KH4 A;  4H0V B;  3CC4 N;  1QZ6 A;  4FWL A;  3U8X A;  2QI2 A;  4H0T B;  4CJ7 A;  3PLA A;  1IG8 A;  4B1U B;  2Q2R A;  3AY9 A;  3RVC A;  3MWT A;  3VF2 A;  3WEE B;  3WXJ A;  5GAG P;  1NGE A;  1VQ6 N;  4A61 A;  2P9U B;  5AZI A;  2QXL A;  4C23 A;  1KXP A;  2HBK A;  1JCG A;  2YI1 A;  2YCH A;  2FF6 A;  4K41 A;  4OPH A;  1NWK A;  4XH4 A;  1NGD A;  2F9W A;  2V7Z A;  3EN9 A;  2NRT A;  5AQY A;  3KK7 A;  4EHU A;  4CZG A;  2WUS A;  5DM7 L;  3HM8 A;  5GAH P;  4MLE A;  4YOV A;  1DEJ A;  4IEE A;  2GEL A;  3RSE B;  3QFP A;  2Q31 A;  2GX9 A;  4GVE A;  4GV6 A;  1BOT O;  1RDW X;  4A2B A;  3GG4 A;  4H0P A;  5JVH L;  5AQR A;  2WBN A;  4JK9 A;  3P31 A;  2FLO A;  3VMF B;  1VQM N;  3CPE A;  3A5M C;  3H6E A;  3SBG A;  4BC3 A;  1Q86 O;  2FSN A;  4JKF A;  4PKG A;  4CZL A;  2UYT A;  1HKB A;  3CXC M;  4RTF D;  3CQX A;  5AZJ A;  3L0Q A;  4FWO A;  3H46 O;  1TUU A;  3VER A;  2H3G X;  4KBO A;  4BRD A;  1YAG A;  3A5O C;  2RHK A;  3DJC A;  4NB4 A;  3Q7B A;  1NGC A;  1WOQ A;  5AQO A;  5JLF A;  3R6M A;  2OAN A;  1W97 L;  3GL1 A;  2VWB A;  1NJI O;  2KKZ A;  3VTH A;  4DQ8 A;  1VQP N;  1SZ2 A;  4NLB A;  4B9Q A;  3O9Q A;  4FOI A;  5F1X A;  5MLC Q;  1YJ9 N;  2DPN A;  4XEI A;  4H5R A;  1ATR A;  5FPE A;  2OTL N;  3VEW A;  3LL3 A;  1BG3 A;  3R8E A;  4FWQ A;  4BRK A;  5BN8 A;  1C0G A;  3CI5 A;  4BVO A;  1Z05 A;  3K9J A;  5AFU A;  1KAX A;  3KWI A;  3ULE A;  3J7Z O;  2V51 B;  2HF4 A;  4BQL A;  3O4W A;  5HOO A;  5KQD A;  4BR2 A;  2FXU A;  2V52 B;  1YI2 N;  4AF1 A;  4BVP A;  3HRG A;  1GLL O;  2QA4 N;  2QWN A;  1SAZ A;  5I9E B;  3O9T A;  4BR5 A;  3LDP A;  2IVP A;  3TTD A;  3ULE B;  1GLD G;  2NLX A;  3CQY A;  4ILJ A;  2Q97 A;  3P39 A;  1K9M O;  1X3N A;  3NMU A;  2NRV A;  1MDU B;  2A3Z A;  4MDA A;  4B1Y B;  2P9L A;  3LM9 A;  4EAH D;  3D2E B;  3MN5 A;  1X9J A;  4YOT A;  1VQK N;  4BRF A;  4IJA A;  4J8F A;  3TU5 A;  4JKG A;  2NRW A;  2ZGY A;  3EL2 A;  2PBD A;  2YHX A;  2HF3 A;  1NGH A;  2NRH A;  3A0I X;  1Y64 A;  3BF3 A;  2VGN A;  4GNI A;  5M1P A;  4BGB A;  4IOA L;  2P9P B;  4BR9 A;  3SJH A;  4FSV A;  1R59 O;  4MLH A;  1V4T A;  3CCE N;  1QVF M;  4YOR A;  3W3D A;  4BRG A;  2QEX N;  2RE2 A;  2EWS A;  3VEN A;  4OPA A;  1CZA N;  3E1Y A;  4AM6 A;  4XH1 A;  4JKB A;  5FPN A;  5BRD A;  4C1N K;  3P4I A;  1T3V A;  3KHY A;  2BUP A;  2P9S A;  3JS6 A;  1KQS M;  1M1K O;  2A42 A;  4H0X B;  4BQZ A;  2YX6 A;  4GV3 A;  2D0O A;  2IIR A;  3KVG A;  4IOX A;  3VF4 A;  2ZJR L;  2ZJQ L;  1QHA A;  4B1V A;  3VET A;  1KC8 O;  3O8M A;  3CCQ N;  1BA1 A;  3D6R A;  3FZH A;  3MK6 A;  4QS9 A;  3UKR B;  3I55 N;  1BUP A;  5AQX A;  2P9I A;  5C0Y A;  2HOE A;  3TSP A;  4H03 B;  3VPZ A;  3QML A;  3G25 A;  4BRM A;  4WYB A;  4FPB A;  3MX2 A;  3CER A;  2QM1 A;  3GOI A;  4A5A A;  2P9U A;  4BRQ A;  3EO3 A;  4FWS A;  1HX1 A;  4BC4 A;  5M1O A;  3I56 N;  2QW9 A;  1QQN A;  4L3Q A;  4FWP A;  5GAE P;  4PL8 A;  4IDH A;  1TUY A;  4JEP A;  3HOT A;  3E9L A;  4FWN A;  4FOE A;  3TPQ A;  4BG9 A;  2P9I B;  4CI6 A;  4QS7 A;  3IUC A;  3CCR N;  2ASO A;  5AQK A;  3WXI A;  2E2Q A;  5F0X A;  4A62 A;  3AAQ A;  4Y0W A;  3RSE A;  1IJJ A;  3OW2 M;  3C6A A;  1S3X A;  3D2F B;  3VEY A;  2YHY A;  4BRI A;  2NRZ A;  4BRL A;  1HKC A;  2Q0U A;  3FZK A;  1NM1 A;  3MCP A;  3G6E N;  2YJE A;  3O9U A;  1VQ4 N;  2E8A A;  4EFH A;  3ZET A;  1Q81 O;  1VQL N;  2QWM A;  5GIP A;  4IJN A;  3FZM A;  2A6A A;  3GBT A;  4CZK A;  1EQY A;  4A5B A;  1C0F A;  5AQM A;  1V4S A;  1NGB A;  1TYQ A;  2JWK A;  3ENH A;  3U9D A;  3H1Q A;  3W0L A;  5BRF A;  3CCU N;  3P38 A;  4O5F A;  3CJ7 A;  5EXW A;  2IVO A;  3WXK A;  3WQU A;  3OBW A;  2VGM A;  4F9O A;  3LM2 A;  3M1F A;  3ZET B;  2E2N A;  5ADX H;  2NRX A;  4BRO A;  3NVM A;  4CBX A;  1ILY A;  1NMD A;  2F7T A;  1TYQ B;  3JXU A;  3T7Z A;  1GLB G;  1U2V A;  2D0P A;  2VYP A;  5C15 A;  4PKI A;  1JJ2 M;  3GE1 A;  3OBY A;  3L4Q A;  2W41 A;  3ID6 A;  1XQS C;  3CCJ N;  3R9P A;  1Q82 O;  3FR0 A;  1XC3 A;  2D4W A;  3ENB A;  2CH5 A;  3FE1 A;  1OKJ A;  3MWP A;  2QWQ A;  4JNE A;  4PHT X;  3H1V X;  2E20 A;  2HBJ A;  3C65 A;  2I7P A;  3QFU A;  1U2V B;  2PFU A;  4K43 A;  3UE5 A;  3VTI A;  4DB3 A;  3VOV A;  3BF1 A;  2GWK A;  3CD6 N;  5CE3 A;  2ZWH A;  1LCU A;  4YOW A;  3PIO L;  4K25 A;  4H0Y B;  2I7N A;  3SMP A;  2P9K B;  3C0B A;  3L6Q A;  4C1N I;  4JKH A;  3CCS N;  2A5X A;  5KPT A;  3ATV A;  5AQZ A;  3UB5 A;  3HBT A;  4CZF A;  3NVK A;  2Q1N A;  1D4X A;  2J4R A;  3D2E A;  5LJV A;  5BN9 A;  4FWM A;  4KH6 A;  4BRN A;  1ZBS A;  4CD1 A;  2GWJ A;  3CPW M;  4ISG A;  5AQW A;  1P90 A;  1YJN N;  3CC7 N;  1ZC6 A;  4CBU A;  5ELZ A;  3SLC A;  5F2R A;  2P9P A;  4BR4 A;  1H1V A;  4FPA A;  4MO5 A;  2QWL A;  5JVG L;  1K8A O;  4LC9 B;  4GV9 A;  3AGK A;  3IFR A;  5M1K A;  3ZYY X;  4BG8 A;  5AQS A;  2IVN A;  4BRH A;  4A57 A;  1RDU A;  3VF6 A;  2E1Y A;  4B1Z A;  4BR7 A;  4IFE A;  5GIN A;  3DLL L;  1NGF A;  3N4P A;  1VAZ A;  1J6Z A;  1BDG A;  4CD3 A;  4YDU A;  1HUX A;  5M1Q A;  1NGG A;  3F9M A;  1RFQ A;  4IZ9 A;  4O8U A;  1HKG A;  1GLJ O;  3SAG A;  3D7E O;  4EHT A;  3H45 C;  4ILH A;  4YOU A;  5AQG A;  3VEX A;  5KPZ A;  3U4L A;  1MWK A;  4BC2 A;  1E4G T;  3CJA A;  5TKY A;  5ADX A;  1K8K B;  3GDQ A;  2A40 A;  4NLC A;  4YDU C;  3UKR A;  1YUW A;  4UY8 O;  2HST A;  3MN6 A;  3VGK A;  1EO1 A;  2ASP A;  5AQT A;  1JCF A;  2FSK A;  1VQ8 N;  3EKU A;  4EIA A;  3MN7 A;  5C12 A;  3BEX A;  3ZEU A;  3A5L C;  3LDL A;  5M1F A;  1KAZ A;  4FVU A;  5DM6 L;  4BY9 C;  4IWV A;  3TSU A;  5EOY A;  1NGI A;  4CZM A;  1NBW A;  3H3O B;  3A8Y A;  4HTL A;  4H5N A;  3CHW A;  3AAP A;  1P8Z A;  1K73 O;  2ZF5 O;  3CME N;  4BC5 A;  5EX5 A;  5M1N A;  2HBL A;  3MN9 A;  4ISE A;  3S41 A;  3U9Z A;  1QQO A;  3R1X A;  1X3M A;  2AA4 A;  4M7X A;  4H5W A;  1NGA A;  3ZEU B;  3CJ1 A;  3CMA N;  3WXL A;  1O13 A;  4CBW A;  3CJB A;  3D2F A;  2YJF A;  4JHD A;  3O9R A;  3TTF A;  4CZI A;  4JKD A;  4BRE A;  4WFB L;  1GLF O;  4ILG B;  2Q36 A;  4JK8 A;  1MWM A;  1QQM A;  1SS6 A;  5AQL A;  4BRP A;  1WUA A;  3VES A;  1YIJ N;  2KHO A;  3SBT A;  5LJW A;  5AFU H;  4RCH A;  2YHW A;  2CGJ A;  3AAR A;  3DWL A;  4JHD B;  1ZXO A;  4WQ4 A;  3CET A;  2ITM A;  2E2O A;  5B8H A;  3IKM A;  1E4F T;  1MA9 B;  5LY3 A;  2NRR A;  1ATS A;  3KZB A;  3F2K A;  4FWR A;  3DXK A;  5KPR A;  5GIO A;  2VCP A;  4M63 C;  3BP8 A;  5FPD A;  3I8B A;  2CGK A;  4WQ4 C;  3IMX A;  4R79 A;  2FF3 B;  4IO9 L;  3PIP L;  2ZGZ A;  3VEO A;  4JN4 A;  5AQP A;  5CR4 A;  5AR0 A;  3Q7C A;  4BRA A;  4BR0 A;  2GUP A;  3O80 A;  3DXK B;  3O08 A;  5H1S Q;  4DKW A;  3EKS A;  1T6D A;  3WQT A;  5AQQ A;  1JCE A;  2E2P A;  4CZE A;  5BPN A;  3QB0 A;  3CCV N;  1SQK A;  5BR9 A;  3CCM N;  1BU6 O;  5CHI A;  5TKW A;  1YVN A;  5AZI B;  3N4Q A;  3C7N A;  3LDQ A;  4K42 A;  2P9K A;  3TTC A;  3SAH A;  3B8A X;  1VQ7 N;  2OTJ N;  2FSJ A;  3EE9 A;  3WUH A;  2KLA A;  2P9N A;  3EE8 A;  5FPM A;  4PL7 A;  4B1W B;  3DAW A;  4IO8 A;  2ZJP L;  3FGU A;  1YIT N;  3ZX0 A;  3ZX2 A;  1NGJ A;  3MX5 A;  4KH5 A;  5GAD P;  3C6H A;  2QWP A;  3MDQ A;  4RWT A;  3EZW A;  3OHR A;  4A59 A;  3C7N B;  5AQI A;  2CH6 A;  3UKU A;  5C2F A;  1DKG D;  1OVY A;  1ATN A;  2P9N B;  1VQO N;  5AQN A;  1ESV A;  3MCA B;  3WT0 A;  2BTF A;  3CIP A;  3VEV A;  4WFA L;  4AM7 A;  4O8K A;  1GLC G;  1KAY A;  4JK7 A;  3I33 A;  4ISF A;  4G9Z A;  1BWF O;  3CF5 L;  1G99 A;  3O1W A;  2PAV A;  5AZJ B;  3UKU B;  4JKA A;  3J8A A;  1T44 A;  3QIC A;  3CC2 N;  4H5T A;  2A41 A;  2GTD A;  5AQU A;  4JAX A;  4WFN L;  3DXM A;  1RGI A;  3CJ9 A;  4Z94 A;  3A5N C;  1YJW N;  5AQF A;  3HTV A;  5BRH A;  3E9O A;  2Q0R A;  1YXQ A;  3HOS A;  4PKH A;  1U6Z A;  4E1J A;  4JKE A;  1W2B M;  5C10 A;  2NZT A;  4FO0 A;  3HI0 A;  2HMP A;  5HL7 L;  4WF9 L;  4I6M A;  3E66 A;  4WQ5 A;  1DT9 A;  5E26 A;  3FZF A;  1QZ5 A;  3O1B A;  3SK3 A;  2BH1 A;  1M90 O;  1K8K A;  3F5T A;  4M7Y A;  1Z6R A;  3DXM B;  1NLV A;  2V7Y A;  3ZX3 A;  4FWK A;  2D1K A;  3KWG A;  2QTD A;  2E88 A;  4BRC A;  1S72 N;  2CGL A;  3M6G A;  4IEI A;  2AP1 A;  4WQ5 C;  4I6M B;  3VEZ A;  4YOX A;  5EVZ A;  1VQN N;  3G71 N;  4CZH A;  4IOC L;  3M5R A;  1BA0 A;  3R3L A;  4A2A A;  5BRE A;  4JKC A;  4NO7 A;  5AQJ A;  3G4S N;  2GEM A;  3E9P A;  3T69 A;  4H0O A;  1VQ9 N;  2WC9 A;  3FFK B;  2F9T A;  3CCL N;  4U67 L;  1S22 A;  2ASM A;  3ID8 A;  3O9S A;  3FZL A;  3FLC O;  3MMV A;  1Q18 A;  5AQV A;  3WXM B;  5JLH A;  5JMV A;  3BUZ B;  3IDH A;  1KD1 O;  3ENO A;  3HZ6 A;  2P9L B;  4BGA A;  4JD2 A;  2QWR A;  3VGM A;  3O6W A;  5E84 A;  4JKG B;  3CJC A;  1GLA G;  5BPM A;  5KQ8 A;  3LDO A;  1YF5 L;  4CZJ A;  4GY2 B;  5C2D A;  3HSC A;  1N8R O;  1GLE G;  3K9K A;  1DGK N;  1T6C A;  3QBX A;  1HLU A;  4XH5 A;  5AQH A;  3SMS A;  4FL9 A;  4H5V A;  5BPL A;  3QBW A;  1BO5 O;  1QVG M;  4JD2 B;  4IXC A;  2HBM A;  4DHY A;  4YOY A;  4OO1 J;  1HJO A;  3H3N O;  3M3Z A;  3SAF A;  3O5B A;  4WCE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...