3P39A

Crystal structure of the ns1 effector domain w182a mutant from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
KMPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEANDNTVRVTETIQRFAWRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 31
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p39A00
3KWGA 3O9QA 3D6RA 2RHKA 3OA9A 3O9UA 2GX9A 3O9SA 3F5TA 3EE8A 3O9TA 3O9RA 4OPAA 2KKZA 3P31A 4OPHA 3M5RA 3L4QA 3EE9A 3RVCA 3P39A 3P38A 3KWIA
chains in the Genus database with same CATH superfamily
1BI4A 2GWKA 3ATUA 1SAZA 4BVPA 1XNRK 1EWQA 1FKPA 4JKCA 3EZ5A 2Z1GA 3NF6A 4BGBA 3EKSA 5I3UA 1RDAA 4FXDA 2JGUA 4B9QA 1U48A 3VGKA 3BF3A 4FPBA 4IG3A 3QMLA 2O4GA 4MFBA 3HT3A 5KPRA 3OYNA 3SLCA 3MXIA 3MX5A 4BC2A 4DQRA 3DLEA 3CFRA 4FVUA 4FZYA 5KGXA 4O5BA 2V52B 5EVZA 4ISGA 3CERA 4FJ7A 4FW1A 4NXNK 2FSNA 3OS0A 1UA1A 3QIPA 1CZBA 4IJAA 4DG1A 5IT9O 4HVJA 1VRUA 4A2AA 4FLZA 5AQSA 4YFUA 4K42A 2HHXA 1CXUA 5CZ2A 3NVKA 2HF3A 2HMPA 2P9LB 3UKRB 1IKYA 1MDUB 3CD6N 1QQOA 2KZMA 1HX1A 2HNZA 3H6EA 3MEGA 3MECA 2YX6A 1E3MA 1A5XA 3PLAA 1GLAG 4B3OA 3D2FA 1RT3A 4A57A 4BY9C 1B92A 3DLLL 3TSUA 1NK6A 1XMOK 4BG9A 4N47A 2A40A 4BR2A 2P51A 1YTAA 1U2VA 2E4LA 1LCUA 5HOOA 2OZMA 2IC3A 1C1BA 4HUEA 3T1AA 1FW6A 3FZKA 1KFSA 3O9UA 3OYIA 4KB0A 3H45C 4N76A 3O9TA 1GOAA 2WC9A 4DS4A 2FXUA 3TTDA 4DFMA 3IS9A 1N36K 3A8YA 4C23A 2E2QA 4L3QA 4FO0A 4IO9L 4BQZA 4K8XA 3CCMN 4J2BA 3KK1A 1RDWX 3AO4A 3TABA 3LP0A 2G8HA 4CEBA 3WXLA 1J5OA 1OVYA 5C2DA 4V19S 3EEQA 4CEOA 3AGKA 1QS4A 2F7TA 2RF2A 5EY4A 3W0LA 1BGXT 3O4NA 2OPRA 2PYJA 4G9ZA 2FBTA 4LH4A 3KK3A 3PIOL 3ZETA 3AO1A 3I33A 3E1YA 4IG0A 2XRIA 1T03A 4WQ4C 1MU2A 2AA4A 2P5GA 2KW4A 4C1NK 1NJZA 1RBVA 3BUZB 4MDBA 5FDLA 3PIPL 4Y0WA 2FSKA 3V9SA 1RBUA 3TPQA 4FWKA 4B1WB 3AV9A 2DFEA 4BRGA 2O8BB 4PY5A 1YJ9N 1JLQA 1LWFA 4U7BA 4OGCA 5AQGA 3I8DA 1U45A 3KLFA 1SKWA 3O8MA 2W40A 3CQXA 3VENA 1VSJA 3VQ7A 5GADP 3H3OB 2P5OA 4FJKA 4DR4K 3P31A 1ZBSA 3DLRA 5AQFA 1Z25A 4OLBA 3PX0A 1N8RO 3D7EO 2HMIA 3VQDA 3N4PA 4E1JA 3T3FA 4DMNA 4J2EA 3LWLA 3OVNA 3EN9A 1IH7A 2D0AA 3VN5A 1BA1A 2QI2A 4KV8A 3LAMA 4IXCA 1C1CA 4F3TA 4FWPA 4DU4A 1RT1A 3J8AA 3OA9A 1EP4A 3C95A 4CD1A 4BVOA 4CZEA 3SUPA 1DTQA 4HTUA 3V81A 4DQIA 1ZBHA 5HRNA 2HSTA 2OANA 3OYLA 4CEFA 4RW8A 1KAXA 3OJSA 5AZIB 4CHZA 4DV7K 4DR5K 5AQRA 4NLCA 3K59A 4UQGA 4CJRA 1VQKN 2QWLA 3C6TA 3LDLA 3AVAA 3AVFA 1YAGA 1VQLN 4CHOA 4O44A 1XC9A 5EX5A 4IOXA 3DM2A 4M41A 4JI1K 3SQ2A 4CZIA 4DSLA 1N5YA 4BR0A 4FJLA 1IKVA 4CGDA 3ZT1A 4CIGA 3QDKA 4B9UA 3T69A 3ZT3A 4M3XA 2HHTA 4LF4K 3CFPA 3LANA 1WUAA 4BQLA 5AQZA 2X74A 2VG7A 2JWLA 1GLCG 5GIPA 1TVRA 3THXB 4HTLA 4CFBA 4EIAA 3SK3A 3IFRA 4CZFA 3U6FA 1X3NA 3AA3A 1G99A 3CCQN 1XI1A 4B9LA 1C0TA 4IFYA 4FLUA 3THVA 4C8NA 5J2MA 1RT4A 3VGMA 3LPUA 3HJFA 4CEAA 3O9QA 1EO1A 1NGAA 2J4RA 3BZKA 1DLOA 3LZJA 4U67L 3AVNA 4DSJA 1WSHA 2DFFA 2E1ZA 5HRPA 1XHZA 1JCGA 3U3YA 1TAUA 4ILHA 5HLFA 2Q3SA 4DTPA 3RRGA 1T44A 1S22A 3OYEA 1WAJA 4B8CA 1K9MO 2FBYA 4CECA 2QEXN 3T7ZA 3CHWA 1S72N 3NF8A 4I9QA 4FZXC 2A42A 4XEIA 3KD5E 4DF8A 4LC9B 4CERA 1GLBG 1X3MA 5M1KA 1YTUA 2A1RA 1OH6A 1D9DA 5FRMA 4O8KA 1VQNN 4DCHA 2X78A 2ZD1A 3O9SA 3VQAA 2OYQA 4H4OA 1S6PA 4DQ8A 3OBYA 1RBRA 1YHQN 3OYKA 1UWBA 4BR9A 2DFHA 3LDQA 4IDHA 2V7ZA 1JCFA 4WQ4A 3M1FA 5C15A 5LMUK 4HUGA 1XNQK 2QWMA 2W42A 3WNGA 4AHTA 1V4SA 3MCPA 2P9UB 1VQ4N 3ZX3A 5AQNA 4AF1A 1SL0A 1NK5A 3SMPA 3VQ8A 1NJWA 1NK7A 3F5TA 4BR5A 4CGFA 3CG7A 3K9KA 4E89A 3K9JA 5KPZA 4Q0BA 1VSIA 4DV1K 3HPHA 4CJ3A 3M8PA 4NYFA 3CYMA 1NJXA 1Q18A 1X9SA 3I0RA 3A5LC 1JCEA 4DHYA 2XY5A 3KLGA 3VQCA 3AO2A 1CZ9A 3ZSWA 1VSDA 3KVGA 3FE1A 3P83D 5CYQA 4NLBA 5ADXA 5JVHL 4JK9A 5GIOA 4B9VA 4GV9A 3U8XA 5HL7L 1VSFA 3HPOA 3L2RA 5LL6Z 1WN7A 1Q81O 5JICA 2D0OA 2QXLA 4GKJK 2HNYA 2I7PA 4Z4EA 3O4QA 1KSPA 4CJ4A 1GLEG 4FM0A 3FR0A 3VETA 3O4WA 2YJEA 2YNIA 1QQMA 3LPTA 3CXCM 2QWNA 3HSTB 4QOZB 1TK8A 1P8ZA 4H5RA 1NNEA 3KK7A 3R6MA 1VQPN 5AZJA 4OKEA 4FJGA 1RDDA 4DQQA 4O4GA 1RBSA 1NJIO 3G25A 4OVLA 1VQ5N 3TAQA 4IOAL 3G0ZA 3AVCA 3HL8A 3ENOA 4PL8A 2QXFA 3RMCA 2JWKA 1IKWA 1Z26A 1M90O 4H03B 4CZJA 1KFDA 3NGYA 3GDQA 3V4IA 1IKXA 2EX3A 4ZHRA 1M1KO 1MWMA 1NG9A 1WAFA 3FZLA 4KRFA 3MCAB 3S9HA 1BHLA 3DWLA 4PL7A 3HVTA 5KQ8A 1TL1A 4FZZA 1RDBA 1NGGA 3M8SA 1NGBA 1YXQA 3ZX2A 1YVUA 4F2RA 1ZBLA 2NRTA 3RMAA 1S3XA 2WTUA 4BRIA 4IEEA 1WSEA 4HCCA 3ITHA 3CJCA 1LWCA 5BRFA 3QERA 5JLFA 5AQOA 4DTOA 3QESA 1A5WA 3O3GA 5C2FA 4DTJA 4K25A 2G8WA 4H0XB 4DV0K 5CY4A 3CQYA 3NDKA 2D0CA 4CESA 2G8FA 1VSEA 3BEXA 3G4SN 1RT7A 4AM6A 5GAGP 3QEWA 3D2EA 4CJKA 4JS5A 1CZAN 5AQTA 3CETA 3UE5A 3BP8A 3ISNC 3H1QA 3JXUA 4ID1A 4BDZA 3SAFA 2YV0X 2KHOA 4BC5A 2OPQA 4FK4A 1W97L 2HHVA 2NUBA 3HP6A 1QVGM 2FF3B 3CCUN 2NRVA 1HPMA 5BPMA 4YY3K 1LAVA 4CK1A 5I42A 4Y1CA 2ASPA 3NGIA 3O80A 5AQLA 2IIRA 2Q36A 1KLNA 3SUQA 2E2OA 3Q7BA 1RTDA 4FK0A 3E9PA 1WBDA 1RTIA 4I2QA 3JYTA 3CFOA 1MA9B 3SAGA 1XHXA 4BC3A 2ITMA 4RW6A 3T19A 5HBMA 4B8AB 4F8RA 3K0SA 1KTQA 4CZHA 3H46O 4JI0K 3SPYA 5E84A 1KAZA 3L4IA 4JD2B 1JXEA 4QS8A 3WEEB 2P9NB 1S1VA 5AQYA 4JI5K 3OY9A 1GOCA 1BQNA 4ICLA 4AHVA 3ZSQA 5GINA 3S3NA 4DUYK 2PFUA 4O55A 4F4KA 1RDUA 1NJYA 4WCEL 4R79A 4RTFD 3PO5A 3QBXA 1OVQA 3P5JA 2Q2RA 1HMVA 1TGOA 2QA4N 2D0BA 4KO0A 3BY5A 1Q8IA 1N32K 5HROA 2PAVA 2VQEK 4FPAA 2UYTA 2IOCA 1SV5A 4B08A 3QEIA 4DV5K 1WBBA 4BDYA 4J2AA 5M1OA 4JI7K 3F9MA 2A5XA 2G8UA 5TKWA 4IBNA 5KI6A 2E2PA 1ZBFA 5J1EA 2GTDA 3VEYA 2D5RA 3MK6A 5J2NA 2IS3A 3TSQA 3WXJA 4KH6A 3TWHA 1WSIA 5C42A 3VEVA 4XH5A 1HKCA 1NKBA 3LM2A 4IZ9A 3WNFA 1QSLA 3WXIA 4JKGB 4LY7A 3CMAN 5BN9A 1S1XA 3MWPA 1OKJA 3DRPA 3KLIA 4IEIA 4DR2K 2O8EB 4JI4K 4LF5K 4JK7A 1GLJO 2EWSA 2RHKA 2YJFA 2A41A 5E26A 4ILJA 2KFZA 5JVGL 3DMJA 4MQ3A 4FYDA 3NBPA 2EHGA 2ZGZA 4MO4A 1TYQB 4KHNA 4Z4IA 3CM5A 4I7FA 4OKJA 3AVIA 3KKRA 3CPWM 1O13A 5FPEA 2ZWHA 5LY3A 3CCRN 3OHRA 2HVIA 2HHQA 4M42A 4JKAA 4CHQA 3J7ZO 3ULEB 3HSCA 1NBWA 4FWOA 3ID8A 1RTHA 1KLMA 1SUQA 3FFKB 3WEEA 2P9NA 3NH0A 3AVJA 3IG1A 3OYHA 3E9LA 4JI3K 1QZ6A 3LZIA 3OJUA 4A61A 3ID6A 2FBXA 3QNOA 1BWFO 4BRMA 3RR8A 1RT2A 3DOKA 5AFUH 4NXMK 3QBWA 2QKKA 5FROA 1H1VA 1K6YA 3OTOK 4FCYA 4JKHA 1NK0A 4OPJA 3WNEA 1RFQA 1SQKA 3HVRA 3THWB 4CJLA 4OPAA 4RWTA 4B9MA 1JLBA 1V4TA 3EO3A 5JS2A 3SQ1A 1WOQA 2NRZA 1BISA 4A59A 3A5OC 2NRRA 2UXDK 3ULDA 2YHBA 1TUYA 2X6NA 1NMDA 3C6UA 4CEEA 4H0TB 4O0JA 5FLXO 4N41A 5DK5A 4NCBA 2VWBA 4ELVA 2ZJRL 3V1QA 1ASUA 2QK9A 5CZ1A 1HNVA 3R3LA 3UIQA 1ZC6A 4KHPK 1ZXOA 4DR7K 3AVLA 4WQ5C 2V51B 1EX4A 4JKGA 1NWKA 4Z4HA 4B1VA 2O8EA 3CCEN 1QQCA 3SI6A 3AVGA 3SQ0A 3MN7A 1C0FA 5AJ3K 1KCFA 3IKMA 5FPMA 1KXPA 1YUWA 1HQUA 4JI6K 1WLJA 3VQPA 4CK3A 3J80O 1KRPA 4FK2A 3PV8A 1TYQA 4BRCA 4EHTA 4CJQA 4BE1A 4AILC 4DQPA 4DSIA 2ZM6K 4PA1A 2VWJA 1SL2A 4ID5A 2Y1JA 4CZLA 5C24A 2ZJPL 2F9WA 3M5RA 3ULEA 1NK9A 1Q7YO 4B1ZA 3MX2A 2HBLA 4B9SA 3L2WA 1S1WA 2P9LA 3UKRA 3I56N 2OPSA 4IJNA 1Q9YA 3HBTA 4H5NA 4A5AA 4FJJA 2VG6A 4JI2K 3LP3A 2E6LA 2VG5A 4HCBA 1XWLA 5FPNA 1IV0A 4CJ7A 4X62K 3LL3A 3P1GA 2QWRA 3WXKA 1L3VA 1EXQA 3DI6A 3G10A 4PKIA 4FJXA 3QO9A 4GNIA 3THWA 1TAQA 3SJJA 1XMQK 2KTQA 2CH5A 4WYBA 4H8KA 4KB1A 1IG8A 5GAHP 4FWSA 1XQSC 3SPZA 1UA0A 1SL1A 4KHWA 4H5VA 4AHUA 4FLWA 1SS6A 4DLGA 1ASWA 1FK9A 3VMFB 4NCGA 1U49A 4H0PA 5DMRA 1ZBIA 1HNWK 1ILYA 4NCAA 3M6GA 1IG9A 4BRKA 5BR8K 4ISFA 4IOCL 1O1WA 1NOYA 3EL2A 4GVMA 2Q0RA 3V1RA 1RDCA 4FWLA 3OYJA 3VQBA 3J7YP 3T1HK 3EKUA 4AHSA 4IKFA 1BCMA 3AVBA 3NHGA 4F3OA 5AQXA 4CEZA 4K0KK 4FLVA 4KAZA 1E4FT 1D4XA 3AVMA 1LW0A 3LP1A 4FWRA 1JLCA 3BGRA 5EXWA 3V9ZA 4B3TK 1NMNA 3SCXA 3VA0A 1QE1A 1HKBA 1KVBA 3R9PA 1ZBUA 3VF4A 3VF6A 4IFVA 3CI5A 3S3MA 4ELTA 2O8BA 1ASVA 3LM9A 4H0YB 4JNEA 1IO2A 3I55N 3P4IA 4CFAA 4BE0A 5SZTA 3QEVA 1LW2A 4A62A 1HPZA 1SKSA 1ITGA 3FGUA 2W41A 1L5UA 4RW4A 1I94K 1VSLA 3AVHA 4JLHA 4YORA 4CJFA 1WSGA 3M3ZA 3O3FA 5CR4A 2YHXA 3U9DA 5D3GA 5E41A 2GELA 4DV4K 2Z1IA 4BRAA 2OPPA 3BDPA 3F2KA 4FJ9A 4YDUC 2D1KA 2E88A 1HYSA 4E19A 5AQUA 3WNHA 3AA4A 2YKNA 3CCLN 3KD1E 1NGDA 1S1UA 1LWEA 3BZCA 5BRHA 4GV3A 1RILA 1BQMA 4XH4A 3MEDA 3DLHA 4WQ5A 4CJ5A 3A2FA 2HNDA 2YHWA 4DWIA 2QWPA 4EAHD 3VOVA 2PZSA 4KPYA 3VEZA 5AZIA 1K73O 1T3VA 2HB5A 4KTZA 2HOEA 4CZKA 4DSKA 4PUOA 3DRRA 4BG8A 2YNHA 2G8VA 1YITN 1TKZA 2RKIA 3CCSN 3V9UA 4FSVA 3EE8A 1DEJA 3ZT0A 3O08A 3ZSYA 1HR0K 2HF4A 2A3ZA 4BR4A 4BRHA 3PO4A 2YHAA 1D5AA 4DSFA 3QETA 1VRTA 4BRNA 2CGLA 2E6MA 3RMBA 2ZJQL 4DFPA 3J7AP 4GW6A 2VGNA 3F73A 4BWJA 4E7HA 1I3AA 3KIOA 4GVEA 4CIEA 3JSMA 2B6AA 4JKFA 2XY7A 1IBMK 3THXA 4I2PA 1HYVA 1TKDA 4CEDA 4XIUA 4WFAL 1FJGK 2P9SB 4J2DA 1F21A 1U6ZA 3RSEB 4LD0A 4MLEA 4CGGA 1J54A 4DSEA 3F9KA 5KTQA 4FVMA 3SV4A 4DTSA 3SZ2A 3K5MA 1VQON 4B9NA 3C65A 5JS1A 1ATRA 3MAQA 3HPGA 4CK2A 5KPTA 3KJVA 4JS4A 1NM1A 3QINA 1DT9A 2BDPA 4H5WA 3SYZA 4DR6K 3HTVA 4FJHA 4CHYA 3WUHA 3L4QA 1B9FA 3RMDA 3CC2N 2RN2A 5JLHA 1QZ5A 3SAHA 1VQMN 2G8IA 2YHYA 1ATSA 4KH4A 5IWAK 1KD1O 1YJNN 3SJHA 4A5BA 3H1VX 4YOXA 5BR9A 2OTJN 2YKMA 3KKSA 3HI0A 4W5OA 4FJMA 4DTRA 1EETA 5K14A 3VEOA 2KZZA 3HO1A 3DLGA 5DM6L 2ASOA 4GKKK 4C8MA 1GLDG 2D0PA 3E01A 5KGWA 5AQKA 2QW9A 3OYCA 2W6LA 2GV9A 2KFNA 4CJVA 1JKHA 5M1NA 3KLEA 1C6VA 3G6EN 3OW2M 2CGKA 2P9UA 4CFDA 3W3DA 4FJ5A 3OYFA 2H3GX 4JKEA 4JEPA 3OYBA 3G71N 2GBZA 2F4VK 3ALYA 1HLUA 3TSPA 5EOYA 2WOMA 2QWOA 1VK0A 3KTQA 1XUPO 1SKRA 2P9PB 3DRSA 1U4BA 3L6QA 1NU0A 2KQ2A 3SBGA 4LSLA 3LDSA 3JS6A 2FBVA 3VQ5A 2IVNA 3LALA 5ELZA 1BU6O 1W0HA 2HW3A 4A2BA 3SUNA 3VERA 2CGJA 4E0DA 2RPIA 2QM1A 1BOTO 1QHTA 3HOTA 1T05A 3H3NO 1RCHA 4QCLA 4YDUA 1G15A 4F2SA 2XO7A 2P9SA 4C1NI 4NYNA 3O3HA 3ZX0A 2YCHA 4CEQA 4N5SA 3ZSRA 2B5JA 4BACA 1Z05A 3TAPA 2O8DB 2BTFA 3SNNA 3KK2A 4KI4A 1Y97A 4BRFA 3CJ1A 1W9HA 1ATNA 3QNNA 4CD3A 1KVAA 4JKBA 4OLAA 3SMSA 4KHSA 5GAEP 3NE6A 1RTJA 4CVNE 4OPHA 4GV6A 4WF9L 2NLXA 1NKCA 2E20A 4M63C 4MDAA 1YIJN 5LJVA 1GLLO 3QLHA 4CJEA 3CC7N 5T7BA 3R1XA 1B9DA 3SQ4A 4X64K 3FLCO 3TAFA 2AJQA 1P90A 3K58A 3O5BA 1YVNA 4CGHA 4HUFA 4ELUA 4JKDA 3K5LA 5F1XA 3C7NB 3NCIA 2R7YA 1HNXK 1X9MA 1W2BM 3VA3A 1BIZA 4DU3A 4J8FA 2JLEA 1Q82O 5M1PA 2NRWA 3RRHA 3SBTA 1HNZK 1HYZA 2WFBA 3TR8A 4CHNA 3QFUA 1Q9XA 1BIUA 4FM2A 4DF4A 4MLHA 3MN5A 4K43A 1YT3A 3ENBA 4JK8A 3L0QA 4DTUA 2BGGA 2P9PA 3QEXA 4H0VB 3ZCMA 4AQYK 2KLAA 3ATVA 2O8CB 4CGIA 3L2VA 4BGAA 1NGIA 1U47A 3J81O 4RCHA 1W7AA 2BUPA 1TK0A 5HRRA 3PUFA 3O9RA 2DPNA 2OCEA 2IGIA 1CXQA 1HQEA 5HRSA 2FLOA 1RBTA 1OH7A 3MMVA 4LF7K 3P39A 4M3RA 4YOWA 4O8UA 2IVOA 2O8DA 3ZYYX 3TU5A 4I9LA 3E9OA 1C0UA 4E7KA 4CJSA 3DLBA 1QSYA 1YJWN 4KI6A 4KHYA 3DXKB 3ZSXA 4DTMA 4JV5K 2HBKA 3MWTA 3TAMA 3MN9A 1VSKA 3AA2A 1R0AA 3ZETB 3C94A 3VPZA 3OYAA 3BF1A 4JD2A 4DLEA 1A5VA 4BRLA 3T1YK 1YI2N 3LWMA 3CJ7A 4LF6K 3VTHA 5KRSA 3TAGA 4CIFA 1NLVA 2QKBA 4RW9A 4FWQA 4PKGA 1IBKK 4BROA 1YF5L 4BRQA 3MXMA 2NRHA 3CPEA 2YNFA 4Z4FA 4BR7A 3C7NA 3CF5L 3AO5A 4EHUA 3EZWA 4FJIA 1FXXA 3EY1A 2D4WA 3QEPA 2UUCK 4JAXA 1KVCA 2P9KB 3E66A 5DM7L 2ZGYA 3ZSOA 2NRXA 2QWQA 2HHSA 4DQSA 3AAPA 4OO1J 2Y1IA 4KREA 3LDNA 4M3UA 4JN4A 2HBJA 1NGHA 4E3SA 2O8CA 3UKUB 1DGKN 3K2PA 5AFUA 1NGCA 2F96A 2A6AA 5F0XA 4KBOA 4M7XA 4Z4CA 5H1SQ 1VQ6N 1FKOA 2QTDA 4GY2B 1UAXA 1RT6A 1IBLK 4IWVA 1IJJA 2F8TA 4O5FA 4B1UB 4FWMA 3K5NA 5B8HA 4DB3A 4AHRA 3MN6A 1QTMA 3LDOA 5SWMA 1XC3A 1N33K 1JLAA 4ILGB 4OPKA 5J2PA 3PX6A 3FZFA 3NFAA 2ASMA 2XY8A 3VQQA 4BREA 2FC0A 3CMEN 1JL2A 4E1NA 5AQIA 2ZQBA 3O6WA 3S3OA 3AAQA 4CJPA 3DXKA 3V1OA 2P1JA 4N56A 4TSXA 4DS5A 2CH6A 4X66K 3EE9A 3TAEA 2UXCK 3AARA 4ISEA 4RG8A 4L8RB 4JYAK 1C0MA 3KWGA 3NF7A 4YOUA 3ZEUB 4B3MK 1QVFM 1REVA 1T6CA 4FJ8A 3V9WA 4HWIA 1RGIA 1JLGA 5AQVA 3A5MC 1RNHA 4YHHK 4EZ9A 3L2QA 3DYAA 3HK2A 1E4GT 3EYZA 4WFNL 2AP1A 1TKXA 3DJCA 4DTXA 4R5PA 4IDKA 1GOBA 2P9KA 3ZLJA 1BUPA 3HP9A 2F8SA 1JLFA 1D9FA 2WUSA 3CJ9A 3M8RA 3QB0A 4DKWA 1JJ2M 2KKZA 3D0PA 4M3WA 1ESVA 2Q31A 5I9EB 4CF1A 3CC4N 3U4LA 3VF2A 4FW2A 3UKUA 3Q7CA 1N34K 1KQSM 4LH5A 3V9XA 2ETJA 2FF6A 2NZTA 5KRTA 3ASMA 2UXBK 3LDPA 4Y1DA 3M8QA 5AQQA 4E7IA 4M7YA 2WBNA 2V7YA 1NK4A 4HHTA 3QFPA 4CI6A 3HOSA 2ZF5O 1JLEA 4YOYA 4I6MB 3WT0A 4X65K 2XHBA 1NKEA 4K8ZA 1X9WA 1S5JA 1DKGD 2X6SA 2GUIA 3A0IX 1GLFO 2Q97A 3DXMB 3D6RA 1VSHA 3QICA 4OGEA 4FJNA 2ATQA 3OYMA 4KTQA 4FM1A 3ZT2A 5F2RA 3D45A 4FWNA 4EP4A 4K41A 2UUBK 1HUXA 4BRDA 2OZSA 3MEEA 4Q5VA 1OH8A 4YOVA 4KHUA 3ZEUA 4IFEA 5BRDA 4EZ6A 1WNSA 4DR3K 2PBDA 4JI8K 5BPLA 3H08A 4LFBK 2E1YA 2LSNA 5CE3A 3GOIA 2E8AA 3HM9A 4DV3K 3UB5A 2GUPA 2E2NA 4CHPA 3GBTA 3L3UA 4CZMA 4M45A 2IDOA 2ITGA 3B6OA 2HHWA 4CZGA 3NH2A 1NGEA 1HJRA 2GX9A 1S9GA 4CGJA 3SUOA 3OS1A 5BN8A 1WSFA 3K57A 4EFHA 3A5NC 4W5QA 5AQJA 2IAJA 2A1SA 4FOEA 4BWMA 4O0IA 5LMNK 3PY8A 1NGJA 3KZBA 4B9TA 5AZJB 4C8LA 1VQ8N 5BPNA 2FSJA 1SZ2A 3AO3A 3B8AX 1LOTB 3DAWA 3GL1A 4RW7A 4I6MA 3CCVN 3KLHA 3IRXA 1JL1A 3K5OA 4CBUA 1EWRA 2IVPA 3O1WA 1HNIA 1J9AA 1Z6RA 3I8BA 4DTNA 3ZSVA 1TV6A 1J6ZA 4QS7A 2HHHK 1S6QA 4KFBA 3DXMA 3PSIA 3VEWA 4M3ZA 1OH5A 3THYB 4H4MA 3RTVA 4DR1K 5ADXH 4BC4A 3VQ6A 1L3UA 3NH1A 4GMJB 3DOLA 1BA0A 1BL3A 1J5EK 2HVHA 1LV5A 1VQ9N 2VWKA 3NF9A 5TKYA 3RWUA 1K8AO 3CCJN 4M3YA 3WXMB 1J53A 5HP1A 3ZSZA 4AHCA 3D2EB 4B1XB 3CJBA 3OYDA 4ZTFA 4M3TA 2O4IA 3HRGA 4YOTA 4YNQA 1C1AA 1K8KB 3IMXA 3L3VA 3TI0A 4Z4GA 1LAWA 4NB4A 1QHAA 5BREA 1DTTA 1VSMA 1VHXA 3HYFA 4B3RK 3VTIA 4LFCK 4XH1A 1NOZA 4AH9A 5MLCQ 1Q86O 3C6HA 3IDHA 1WSJA 2BE2A 3HM8A 3VGLA 3ZT4A 4EP5A 1HRHA 3C6AA 3GG4A 1QQNA 1S9EA 1X1PA 2YNGA 3MXJA 2UU9K 1JXBA 3C0BA 4CF9A 3FFIA 3NVMA 2OA8A 3CJAA 3B6PA 4CCHA 3P38A 4CF0A 4LSNA 2VQFK 3CM6A 3VQEA 5C12A 2NNWA 4FLTA 3LP2A 4JHDB 4FLYA 3WQTA 4DUZK 4E7LA 2W6KA 3NMUA 2VCPA 2B4JA 2DTUA 3U3GA 4W5TA 2Q0UA 5C25A 1ZYQA 1CLQA 1TUUA 3VQ4A 3AGRA 4PKHA 2WONA 2ZE2A 4E7JA 5CHIA 4W5NA 1VAZA 4B1YB 3LAKA 4JRPA 2I7NA 1N6QA 2G8KA 2VGMA 3HZ6A 5KQDA 4WFBL 4CF2A 5FPDA 4LF9K 3THYA 2GWJA 3FZMA 1QSSA 3MDQA 3DLKA 3PX4A 1KAYA 1L3SA 2PY5A 4DU1A 3TTCA 5CYMA 3OS2A 5JMVA 3TARA 3N4QA 1L3TA 1Y64A 5AQMA 1BG3A 3AVKA 3FZHA 5AQWA 2BH1A 2F9TA 4QAGA 1BDGA 2O8FB 2P9IB 3RSEA 5C10A 2RE2A 3KWIA 4FLXA 4OJRA 3VESA 1TK5A 2E5LK 3GE1A 4CE9A 1BI4B 4C8OA 4KTWA 2YI1A 1S1TA 1T8EA 3OBWA 4UY8O 1UOCA 1K8KA 4FOIA 4Z94A 4W5RA 3I0SA 3SV3A 5AQPA 2XY6A 1KC8O 4PQUA 4PHTX 1T7PA 1HKGA 2I5JA 4LFAK 1HJOA 3KHYA 3PSFA 4FL9A 2HHUA 4LF8K 3WQUA 2PYLA 5LJWA 3ENHA 5AQHA 3HXMA 3S41A 5C0YA 4MO5A 2Z1JA 4ZTJA 1TKTA 4H5TA 3L8BA 1NGFA 4E1MA 4BDPA 2VYPA 3U9ZA 2Q1NA 3NAEA 2GEMA 3AA5X 4H0OA 3RVCA 3R8EA 3QIOA 4QS9A 1EQYA 4CBWA 3VQ9A 4C8KA 1RT5A 4KHQA 1MWKA 2HBMA 4OX9K 2BANA 2DY4A 4JHDA 3CIPA 3IUCA 3IAYA 4IO8A 1D8YA 3CQ8A 3NGZA 3TTFA 1VQ7N 3TANA 4DV2K 4KKOA 4DV6K 5AR0A 4OKKA 3L2UA 5FRNA 4WE1A 4B3SK 4AM7A 5M1FA 3O1BA 4BE2A 3D2FB 2UUAK 1TL3A 2Z1HA 4CW7B 1BCOA 4F9OA 1R59O 1NK8A 4CJUA 3V6DA 1I39A 1U2VB 3RR7A 1T6DA 4NO7A 1U04A 4JRQA 3VEXA 4CFCA 5EU7A 4CJTA 4DFKA 3AY9A 4CBXA 4KH5A 4BRPA 5J2QA 4CF8A 4G1QA 5A2QO 1EKEA 4DFJA 3JAMO 1C0GA 4CJWA 2OTLN 4PWDA 1X9JA 4Z0UA 3OYGA 2O8FA 2P9IA 1WB9A 1BO5O 5M1QA
chains in the Genus database with same CATH topology
3DWLA 1NGDA 4PL7A 3KWGA 5KQ8A 4YOUA 3ZEUB 2GWKA 3ATUA 4BVPA 1SAZA 1QVFM 1NGGA 5BRHA 4GV3A 1T6CA 4JKCA 1NGBA 1YXQA 4HWIA 3ZX2A 4XH4A 2NRTA 1S3XA 4BGBA 3EKSA 1RGIA 4WQ5A 4BRIA 4IEEA 5AQVA 3CJCA 5BRFA 3A5MC 4B9QA 5AQOA 5JLFA 2YHWA 3VGKA 3BF3A 2QWPA 4FPBA 4EAHD 1E4GT 3QMLA 3VOVA 5C2FA 4WFNL 4K25A 4H0XB 2AP1A 3DJCA 3VEZA 3CQYA 5AZIA 1K73O 1T3VA 5KPRA 3SLCA 3BEXA 2P9KA 3G4SN 2HOEA 4AM6A 4CZKA 5GAGP 1BUPA 3MX5A 4BC2A 3D2EA 4BG8A 4FVUA 1YITN 2WUSA 1CZAN 3CJ9A 5AQTA 3CETA 3QB0A 2V52B 3BP8A 3UE5A 5EVZA 3CCSN 4FSVA 3EE8A 1DEJA 3H1QA 3CERA 3JXUA 4ISGA 4DKWA 1JJ2M 2KKZA 3SAFA 3O08A 2FSNA 1ESVA 2HF4A 2KHOA 2Q31A 4IJAA 4BC5A 5I9EB 2A3ZA 4BR4A 3CC4N 3U4LA 4A2AA 4BRHA 3VF2A 1W97L 3UKUA 3Q7CA 1KQSM 5AQSA 4BRNA 1QVGM 2CGLA 4K42A 2FF3B 3CCUN 2FF6A 2ZJQL 2NRVA 1HPMA 2NZTA 5BPMA 3NVKA 2HF3A 2VGNA 2HMPA 3LDPA 2P9LB 3UKRB 2ASPA 1MDUB 3O80A 4M7YA 5AQLA 2IIRA 2WBNA 4GVEA 2Q36A 5AQQA 2V7YA 3CD6N 1QQOA 2E2OA 1HX1A 3QFPA 3H6EA 3Q7BA 4CI6A 3HOSA 4JKFA 2ZF5O 2YX6A 3E9PA 4YOYA 3PLAA 1GLAG 4I6MB 3D2FA 3WT0A 4A57A 4BY9C 3DLLL 3TSUA 1MA9B 4WFAL 4BG9A 2P9SB 2A40A 3SAGA 4BC3A 4BR2A 2ITMA 1U6ZA 3RSEB 1DKGD 4MLEA 3A0IX 1U2VA 1GLFO 1LCUA 2Q97A 3DXMB 3H46O 4CZHA 3D6RA 5HOOA 5E84A 1KAZA 3L4IA 3QICA 4JD2B 1VQON 4QS8A 3WEEB 3C65A 2P9NB 3FZKA 5AQYA 1ATRA 3O9UA 5KPTA 3H45C 5GINA 3O9TA 1NM1A 2WC9A 1DT9A 2FXUA 3TTDA 2PFUA 5F2RA 4H5WA 4FWNA 3A8YA 3HTVA 3WUHA 4C23A 4K41A 2E2QA 3L4QA 4L3QA 4FO0A 1HUXA 3CC2N 4BRDA 1RDUA 4IO9L 5JLHA 1QZ5A 3SAHA 1VQMN 4WCEL 4YOVA 2YHYA 3ZEUA 4BQZA 1ATSA 4KH4A 4R79A 3CCMN 1KD1O 1YJNN 1RDWX 4IFEA 5BRDA 3SJHA 4RTFD 2PBDA 4A5BA 5BPLA 3H1VX 4YOXA 3WXLA 2E1YA 1OVYA 3QBXA 5BR9A 5C2DA 2OTJN 2Q2RA 3HI0A 5CE3A 2QA4N 3GOIA 2E8AA 3AGKA 2F7TA 5EY4A 3VEOA 3W0LA 2PAVA 3UB5A 2GUPA 5DM6L 2ASOA 2E2NA 4G9ZA 4FPAA 2UYTA 3GBTA 4CZMA 1GLDG 3PIOL 3ZETA 2D0PA 3I33A 5M1OA 3E1YA 3F9MA 5AQKA 4WQ4C 2A5XA 2QW9A 4CZGA 5TKWA 2E2PA 2AA4A 2GTDA 3VEYA 3MK6A 5M1NA 3G6EN 4C1NK 1NGEA 3OW2M 2CGKA 3TSQA 2P9UA 3WXJA 3W3DA 4KH6A 3BUZB 4MDBA 2GX9A 2H3GX 4JKEA 4JEPA 3G71N 5BN8A 3PIPL 4Y0WA 2FSKA 3A5NC 4XH5A 1HKCA 3VEVA 5AQJA 4EFHA 3LM2A 3TPQA 4IZ9A 1HLUA 3TSPA 4FWKA 3WXIA 4FOEA 4JKGB 5EOYA 4B1WB 3CMAN 5BN9A 4BRGA 2QWOA 1NGJA 3KZBA 1XUPO 3MWPA 2P9PB 1OKJA 5AZJB 4IEIA 1YJ9N 3L6QA 3SBGA 4U7BA 3JS6A 1VQ8N 5BPNA 4JK7A 1GLJO 2RHKA 2EWSA 2YJFA 2IVNA 5AQGA 2A41A 5E26A 4ILJA 1BU6O 5ELZA 5JVGL 2FSJA 4A2BA 3O8MA 2W40A 3CQXA 3VENA 1SZ2A 2ZGZA 2CGJA 3VERA 4MO4A 1TYQB 3B8AX 1LOTB 5GADP 2QM1A 3H3OB 3DAWA 1BOTO 3GL1A 4I6MA 3HOTA 3CCVN 3H3NO 3P31A 1ZBSA 5AQFA 4YDUA 3CPWM 1O13A 1N8RO 3D7EO 4CBUA 5FPEA 2IVPA 2ZWHA 5LY3A 2P9SA 3N4PA 4C1NI 3O1WA 4E1JA 1Z6RA 3CCRN 3OHRA 3I8BA 3ZX0A 4JKAA 2YCHA 3EN9A 1J6ZA 4QS7A 3J7ZO 3ULEB 3HSCA 1NBWA 3DXMA 4FWOA 3ID8A 1BA1A 1Z05A 3VEWA 2QI2A 4IXCA 2BTFA 3FFKB 4FWPA 3WEEA 4BRFA 2P9NA 3CJ1A 3J8AA 1ATNA 4CD3A 4JKBA 5ADXH 3E9LA 3OA9A 3SMSA 1QZ6A 4BC4A 5GAEP 4CD1A 4A61A 3ID6A 4BVOA 4CZEA 1BWFO 4BRMA 1BA0A 5AFUH 4OPHA 3QBWA 4GV6A 1H1VA 2HSTA 1VQ9N 4WF9L 2NLXA 2OANA 2E20A 4JKHA 4M63C 1KAXA 4MDAA 5TKYA 5AZIB 1YIJN 1K8AO 5LJVA 5AQRA 3CCJN 4NLCA 1GLLO 3WXMB 1VQKN 2QWLA 3CC7N 3LDLA 1RFQA 3D2EB 1SQKA 4B1XB 3CJBA 3HRGA 3R1XA 1YAGA 4YOTA 1VQLN 1K8KB 3IMXA 3FLCO 4OPAA 4RWTA 1V4TA 5EX5A 1P90A 3O5BA 1YVNA 4IOXA 3EO3A 4CZIA 4NB4A 1QHAA 5BREA 4JKDA 1WOQA 2NRZA 4A59A 4BR0A 3A5OC 5F1XA 2NRRA 3C7NB 3VTIA 4XH1A 5MLCQ 1Q86O 1W2BM 4J8FA 1TUYA 1Q82O 1NMDA 2NRWA 3C6HA 3QDKA 3IDHA 5M1PA 3SBTA 3HM8A 3VGLA 4H0TB 3T69A 3C6AA 2WFBA 3GG4A 1QQNA 2VWBA 2ZJRL 3QFUA 1WUAA 4BQLA 3R3LA 5AQZA 1ZC6A 4MLHA 1ZXOA 3MN5A 2JWLA 4K43A 1GLCG 5GIPA 3ENBA 4JK8A 4WQ5C 3L0QA 2V51B 4HTLA 3C0BA 4JKGA 4EIAA 3NVMA 3IFRA 3SK3A 4CZFA 1X3NA 3CJAA 1G99A 3CCQN 1NWKA 2P9PA 4B1VA 3CCEN 4H0VB 3P38A 3MN7A 3ATVA 2KLAA 1C0FA 3VGMA 5C12A 2NNWA 3O9QA 1EO1A 3IKMA 5FPMA 1NGAA 1KXPA 1YUWA 2J4RA 4JHDB 4BGAA 1NGIA 4U67L 4RCHA 3WQTA 1TYQA 2BUPA 2E1ZA 4BRCA 2VCPA 3NMUA 1JCGA 4EHTA 4ILHA 2Q0UA 3O9RA 1TUUA 3AGRA 4PKHA 1T44A 1S22A 4CZLA 2DPNA 5CHIA 1VAZA 2ZJPL 4B1YB 2F9WA 2I7NA 3M5RA 2FLOA 1K9MO 2QEXN 2VGMA 3MMVA 3T7ZA 3CHWA 3HZ6A 3P39A 3ULEA 5KQDA 4YOWA 4O8UA 2IVOA 4WFBL 1S72N 5FPDA 4B1ZA 1Q7YO 2A42A 2GWJA 3MX2A 4XEIA 3FZMA 3ZYYX 2HBLA 4LC9B 1GLBG 3TU5A 1X3MA 5M1KA 2P9LA 3MDQA 3UKRA 1KAYA 3E9OA 3I56N 4O8KA 4IJNA 4DCHA 1VQNN 3HBTA 4H5NA 4A5AA 3O9SA 3TTCA 1YJWN 3DXKB 4DQ8A 5JMVA 3OBYA 3N4QA 1YHQN 2HBKA 1Y64A 3MWTA 4BR9A 3LDQA 5FPNA 3MN9A 1BG3A 4IDHA 2V7ZA 3FZHA 5AQMA 2BH1A 2F9TA 5AQWA 1BDGA 4CJ7A 1JCFA 3ZETB 3LL3A 2P9IB 4WQ4A 3RSEA 5C10A 2RE2A 2QWRA 3KWIA 3VPZA 3VESA 3M1FA 3WXKA 3BF1A 5C15A 2QWMA 3GE1A 4JD2A 4BRLA 4PKIA 1YI2N 1V4SA 2YI1A 3MCPA 4GNIA 4UY8O 3OBWA 2P9UB 1VQ4N 3CJ7A 3ZX3A 5AQNA 4AF1A 1K8KA 4FOIA 2CH5A 3VTHA 4WYBA 3SMPA 1NLVA 3F5TA 4Z94A 4BR5A 1IG8A 4FWQA 4PKGA 5GAHP 3K9KA 4FWSA 3K9JA 1XQSC 5AQPA 4BROA 1YF5L 4BRQA 5KPZA 1KC8O 2NRHA 3CPEA 4BR7A 3C7NA 4PHTX 4EHUA 3CF5L 1HKGA 4H5VA 3EZWA 1SS6A 1HJOA 2D4WA 3KHYA 3VMFB 4FL9A 4H0PA 4JAXA 1ILYA 2P9KB 3WQUA 3E66A 3M6GA 1Q18A 5DM7L 2ZGYA 4BRKA 5LJWA 2NRXA 2QWQA 3A5LC 1JCEA 3ENHA 3EL2A 4ISFA 4DHYA 3AAPA 4IOCL 4OO1J 2Q0RA 5AQHA 4FWLA 3S41A 5C0YA 4MO5A 3EKUA 4H5TA 3KVGA 3FE1A 1NGFA 3LDNA 2VYPA 5AQXA 4NLBA 5ADXA 3U9ZA 4JN4A 2Q1NA 4JK9A 5JVHL 5GIOA 2HBJA 2GEMA 1E4FT 4H0OA 1D4XA 3RVCA 3R8EA 1NGHA 4QS9A 1EQYA 4GV9A 3UKUB 3U8XA 4CBWA 5HL7L 1DGKN 4FWRA 1MWKA 2HBMA 1NGCA 5AFUA 2A6AA 5F0XA 4KBOA 1Q81O 4JHDA 2D0OA 2QXLA 3CIPA 3IUCA 4M7XA 2I7PA 5EXWA 4IO8A 5JICA 5H1SQ 1VQ6N 2QTDA 1GLEG 4GY2B 3FR0A 1HKBA 3TTFA 3R9PA 1VQ7N 4IWVA 1IJJA 3VF6A 5AR0A 3O4WA 3CI5A 3VETA 3VF4A 2YJEA 4O5FA 4B1UB 4FWMA 1QQMA 5B8HA 3CXCM 4DB3A 2QWNA 3MN6A 1P8ZA 3LDOA 3O1BA 4H5RA 3D2FB 4AM7A 5M1FA 1XC3A 3KK7A 3R6MA 4ILGB 1VQPN 4H0YB 3LM9A 4JNEA 5AZJA 3I55N 3P4IA 3FZFA 1R59O 4F9OA 2ASMA 1U2VB 4A62A 1T6DA 4BREA 4NO7A 3FGUA 3CMEN 2W41A 3VEXA 1NJIO 3G25A 5AQIA 4YORA 3AY9A 3O6WA 4CBXA 1VQ5N 3M3ZA 4KH5A 4BRPA 5CR4A 4IOAL 2YHXA 3U9DA 3AAQA 3ENOA 4PL8A 2GELA 3DXKA 2JWKA 4BRAA 1C0GA 3F2KA 4H03B 4CZJA 1M90O 3GDQA 4YDUC 2OTLN 2CH6A 2D1KA 1X9JA 1M1KO 1MWMA 2E88A 2P9IA 3EE9A 5AQUA 3AARA 4ISEA 1BO5O 3FZLA 3CCLN 3MCAB 5M1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  3O9Q A;  3D6R A;  2RHK A;  3OA9 A;  3O9U A;  2GX9 A;  3O9S A;  3F5T A;  3EE8 A;  3O9T A;  3O9R A;  4OPA A;  2KKZ A;  3P31 A;  4OPH A;  3M5R A;  3L4Q A;  3EE9 A;  3RVC A;  3P39 A;  3P38 A;  3KWI A; 
#chains in the Genus database with same CATH topology
 1BI4 A;  2GWK A;  3ATU A;  1SAZ A;  4BVP A;  1XNR K;  1EWQ A;  1FKP A;  4JKC A;  3EZ5 A;  2Z1G A;  3NF6 A;  4BGB A;  3EKS A;  5I3U A;  1RDA A;  4FXD A;  2JGU A;  4B9Q A;  1U48 A;  3VGK A;  3BF3 A;  4FPB A;  4IG3 A;  3QML A;  2O4G A;  4MFB A;  3HT3 A;  5KPR A;  3OYN A;  3SLC A;  3MXI A;  3MX5 A;  4BC2 A;  4DQR A;  3DLE A;  3CFR A;  4FVU A;  4FZY A;  5KGX A;  4O5B A;  2V52 B;  5EVZ A;  4ISG A;  3CER A;  4FJ7 A;  4FW1 A;  4NXN K;  2FSN A;  3OS0 A;  1UA1 A;  3QIP A;  1CZB A;  4IJA A;  4DG1 A;  5IT9 O;  4HVJ A;  1VRU A;  4A2A A;  4FLZ A;  5AQS A;  4YFU A;  4K42 A;  2HHX A;  1CXU A;  5CZ2 A;  3NVK A;  2HF3 A;  2HMP A;  2P9L B;  3UKR B;  1IKY A;  1MDU B;  3CD6 N;  1QQO A;  2KZM A;  1HX1 A;  2HNZ A;  3H6E A;  3MEG A;  3MEC A;  2YX6 A;  1E3M A;  1A5X A;  3PLA A;  1GLA G;  4B3O A;  3D2F A;  1RT3 A;  4A57 A;  4BY9 C;  1B92 A;  3DLL L;  3TSU A;  1NK6 A;  1XMO K;  4BG9 A;  4N47 A;  2A40 A;  4BR2 A;  2P51 A;  1YTA A;  1U2V A;  2E4L A;  1LCU A;  5HOO A;  2OZM A;  2IC3 A;  1C1B A;  4HUE A;  3T1A A;  1FW6 A;  3FZK A;  1KFS A;  3O9U A;  3OYI A;  4KB0 A;  3H45 C;  4N76 A;  3O9T A;  1GOA A;  2WC9 A;  4DS4 A;  2FXU A;  3TTD A;  4DFM A;  3IS9 A;  1N36 K;  3A8Y A;  4C23 A;  2E2Q A;  4L3Q A;  4FO0 A;  4IO9 L;  4BQZ A;  4K8X A;  3CCM N;  4J2B A;  3KK1 A;  1RDW X;  3AO4 A;  3TAB A;  3LP0 A;  2G8H A;  4CEB A;  3WXL A;  1J5O A;  1OVY A;  5C2D A;  4V19 S;  3EEQ A;  4CEO A;  3AGK A;  1QS4 A;  2F7T A;  2RF2 A;  5EY4 A;  3W0L A;  1BGX T;  3O4N A;  2OPR A;  2PYJ A;  4G9Z A;  2FBT A;  4LH4 A;  3KK3 A;  3PIO L;  3ZET A;  3AO1 A;  3I33 A;  3E1Y A;  4IG0 A;  2XRI A;  1T03 A;  4WQ4 C;  1MU2 A;  2AA4 A;  2P5G A;  2KW4 A;  4C1N K;  1NJZ A;  1RBV A;  3BUZ B;  4MDB A;  5FDL A;  3PIP L;  4Y0W A;  2FSK A;  3V9S A;  1RBU A;  3TPQ A;  4FWK A;  4B1W B;  3AV9 A;  2DFE A;  4BRG A;  2O8B B;  4PY5 A;  1YJ9 N;  1JLQ A;  1LWF A;  4U7B A;  4OGC A;  5AQG A;  3I8D A;  1U45 A;  3KLF A;  1SKW A;  3O8M A;  2W40 A;  3CQX A;  3VEN A;  1VSJ A;  3VQ7 A;  5GAD P;  3H3O B;  2P5O A;  4FJK A;  4DR4 K;  3P31 A;  1ZBS A;  3DLR A;  5AQF A;  1Z25 A;  4OLB A;  3PX0 A;  1N8R O;  3D7E O;  2HMI A;  3VQD A;  3N4P A;  4E1J A;  3T3F A;  4DMN A;  4J2E A;  3LWL A;  3OVN A;  3EN9 A;  1IH7 A;  2D0A A;  3VN5 A;  1BA1 A;  2QI2 A;  4KV8 A;  3LAM A;  4IXC A;  1C1C A;  4F3T A;  4FWP A;  4DU4 A;  1RT1 A;  3J8A A;  3OA9 A;  1EP4 A;  3C95 A;  4CD1 A;  4BVO A;  4CZE A;  3SUP A;  1DTQ A;  4HTU A;  3V81 A;  4DQI A;  1ZBH A;  5HRN A;  2HST A;  2OAN A;  3OYL A;  4CEF A;  4RW8 A;  1KAX A;  3OJS A;  5AZI B;  4CHZ A;  4DV7 K;  4DR5 K;  5AQR A;  4NLC A;  3K59 A;  4UQG A;  4CJR A;  1VQK N;  2QWL A;  3C6T A;  3LDL A;  3AVA A;  3AVF A;  1YAG A;  1VQL N;  4CHO A;  4O44 A;  1XC9 A;  5EX5 A;  4IOX A;  3DM2 A;  4M41 A;  4JI1 K;  3SQ2 A;  4CZI A;  4DSL A;  1N5Y A;  4BR0 A;  4FJL A;  1IKV A;  4CGD A;  3ZT1 A;  4CIG A;  3QDK A;  4B9U A;  3T69 A;  3ZT3 A;  4M3X A;  2HHT A;  4LF4 K;  3CFP A;  3LAN A;  1WUA A;  4BQL A;  5AQZ A;  2X74 A;  2VG7 A;  2JWL A;  1GLC G;  5GIP A;  1TVR A;  3THX B;  4HTL A;  4CFB A;  4EIA A;  3SK3 A;  3IFR A;  4CZF A;  3U6F A;  1X3N A;  3AA3 A;  1G99 A;  3CCQ N;  1XI1 A;  4B9L A;  1C0T A;  4IFY A;  4FLU A;  3THV A;  4C8N A;  5J2M A;  1RT4 A;  3VGM A;  3LPU A;  3HJF A;  4CEA A;  3O9Q A;  1EO1 A;  1NGA A;  2J4R A;  3BZK A;  1DLO A;  3LZJ A;  4U67 L;  3AVN A;  4DSJ A;  1WSH A;  2DFF A;  2E1Z A;  5HRP A;  1XHZ A;  1JCG A;  3U3Y A;  1TAU A;  4ILH A;  5HLF A;  2Q3S A;  4DTP A;  3RRG A;  1T44 A;  1S22 A;  3OYE A;  1WAJ A;  4B8C A;  1K9M O;  2FBY A;  4CEC A;  2QEX N;  3T7Z A;  3CHW A;  1S72 N;  3NF8 A;  4I9Q A;  4FZX C;  2A42 A;  4XEI A;  3KD5 E;  4DF8 A;  4LC9 B;  4CER A;  1GLB G;  1X3M A;  5M1K A;  1YTU A;  2A1R A;  1OH6 A;  1D9D A;  5FRM A;  4O8K A;  1VQN N;  4DCH A;  2X78 A;  2ZD1 A;  3O9S A;  3VQA A;  2OYQ A;  4H4O A;  1S6P A;  4DQ8 A;  3OBY A;  1RBR A;  1YHQ N;  3OYK A;  1UWB A;  4BR9 A;  2DFH A;  3LDQ A;  4IDH A;  2V7Z A;  1JCF A;  4WQ4 A;  3M1F A;  5C15 A;  5LMU K;  4HUG A;  1XNQ K;  2QWM A;  2W42 A;  3WNG A;  4AHT A;  1V4S A;  3MCP A;  2P9U B;  1VQ4 N;  3ZX3 A;  5AQN A;  4AF1 A;  1SL0 A;  1NK5 A;  3SMP A;  3VQ8 A;  1NJW A;  1NK7 A;  3F5T A;  4BR5 A;  4CGF A;  3CG7 A;  3K9K A;  4E89 A;  3K9J A;  5KPZ A;  4Q0B A;  1VSI A;  4DV1 K;  3HPH A;  4CJ3 A;  3M8P A;  4NYF A;  3CYM A;  1NJX A;  1Q18 A;  1X9S A;  3I0R A;  3A5L C;  1JCE A;  4DHY A;  2XY5 A;  3KLG A;  3VQC A;  3AO2 A;  1CZ9 A;  3ZSW A;  1VSD A;  3KVG A;  3FE1 A;  3P83 D;  5CYQ A;  4NLB A;  5ADX A;  5JVH L;  4JK9 A;  5GIO A;  4B9V A;  4GV9 A;  3U8X A;  5HL7 L;  1VSF A;  3HPO A;  3L2R A;  5LL6 Z;  1WN7 A;  1Q81 O;  5JIC A;  2D0O A;  2QXL A;  4GKJ K;  2HNY A;  2I7P A;  4Z4E A;  3O4Q A;  1KSP A;  4CJ4 A;  1GLE G;  4FM0 A;  3FR0 A;  3VET A;  3O4W A;  2YJE A;  2YNI A;  1QQM A;  3LPT A;  3CXC M;  2QWN A;  3HST B;  4QOZ B;  1TK8 A;  1P8Z A;  4H5R A;  1NNE A;  3KK7 A;  3R6M A;  1VQP N;  5AZJ A;  4OKE A;  4FJG A;  1RDD A;  4DQQ A;  4O4G A;  1RBS A;  1NJI O;  3G25 A;  4OVL A;  1VQ5 N;  3TAQ A;  4IOA L;  3G0Z A;  3AVC A;  3HL8 A;  3ENO A;  4PL8 A;  2QXF A;  3RMC A;  2JWK A;  1IKW A;  1Z26 A;  1M90 O;  4H03 B;  4CZJ A;  1KFD A;  3NGY A;  3GDQ A;  3V4I A;  1IKX A;  2EX3 A;  4ZHR A;  1M1K O;  1MWM A;  1NG9 A;  1WAF A;  3FZL A;  4KRF A;  3MCA B;  3S9H A;  1BHL A;  3DWL A;  4PL7 A;  3HVT A;  5KQ8 A;  1TL1 A;  4FZZ A;  1RDB A;  1NGG A;  3M8S A;  1NGB A;  1YXQ A;  3ZX2 A;  1YVU A;  4F2R A;  1ZBL A;  2NRT A;  3RMA A;  1S3X A;  2WTU A;  4BRI A;  4IEE A;  1WSE A;  4HCC A;  3ITH A;  3CJC A;  1LWC A;  5BRF A;  3QER A;  5JLF A;  5AQO A;  4DTO A;  3QES A;  1A5W A;  3O3G A;  5C2F A;  4DTJ A;  4K25 A;  2G8W A;  4H0X B;  4DV0 K;  5CY4 A;  3CQY A;  3NDK A;  2D0C A;  4CES A;  2G8F A;  1VSE A;  3BEX A;  3G4S N;  1RT7 A;  4AM6 A;  5GAG P;  3QEW A;  3D2E A;  4CJK A;  4JS5 A;  1CZA N;  5AQT A;  3CET A;  3UE5 A;  3BP8 A;  3ISN C;  3H1Q A;  3JXU A;  4ID1 A;  4BDZ A;  3SAF A;  2YV0 X;  2KHO A;  4BC5 A;  2OPQ A;  4FK4 A;  1W97 L;  2HHV A;  2NUB A;  3HP6 A;  1QVG M;  2FF3 B;  3CCU N;  2NRV A;  1HPM A;  5BPM A;  4YY3 K;  1LAV A;  4CK1 A;  5I42 A;  4Y1C A;  2ASP A;  3NGI A;  3O80 A;  5AQL A;  2IIR A;  2Q36 A;  1KLN A;  3SUQ A;  2E2O A;  3Q7B A;  1RTD A;  4FK0 A;  3E9P A;  1WBD A;  1RTI A;  4I2Q A;  3JYT A;  3CFO A;  1MA9 B;  3SAG A;  1XHX A;  4BC3 A;  2ITM A;  4RW6 A;  3T19 A;  5HBM A;  4B8A B;  4F8R A;  3K0S A;  1KTQ A;  4CZH A;  3H46 O;  4JI0 K;  3SPY A;  5E84 A;  1KAZ A;  3L4I A;  4JD2 B;  1JXE A;  4QS8 A;  3WEE B;  2P9N B;  1S1V A;  5AQY A;  4JI5 K;  3OY9 A;  1GOC A;  1BQN A;  4ICL A;  4AHV A;  3ZSQ A;  5GIN A;  3S3N A;  4DUY K;  2PFU A;  4O55 A;  4F4K A;  1RDU A;  1NJY A;  4WCE L;  4R79 A;  4RTF D;  3PO5 A;  3QBX A;  1OVQ A;  3P5J A;  2Q2R A;  1HMV A;  1TGO A;  2QA4 N;  2D0B A;  4KO0 A;  3BY5 A;  1Q8I A;  1N32 K;  5HRO A;  2PAV A;  2VQE K;  4FPA A;  2UYT A;  2IOC A;  1SV5 A;  4B08 A;  3QEI A;  4DV5 K;  1WBB A;  4BDY A;  4J2A A;  5M1O A;  4JI7 K;  3F9M A;  2A5X A;  2G8U A;  5TKW A;  4IBN A;  5KI6 A;  2E2P A;  1ZBF A;  5J1E A;  2GTD A;  3VEY A;  2D5R A;  3MK6 A;  5J2N A;  2IS3 A;  3TSQ A;  3WXJ A;  4KH6 A;  3TWH A;  1WSI A;  5C42 A;  3VEV A;  4XH5 A;  1HKC A;  1NKB A;  3LM2 A;  4IZ9 A;  3WNF A;  1QSL A;  3WXI A;  4JKG B;  4LY7 A;  3CMA N;  5BN9 A;  1S1X A;  3MWP A;  1OKJ A;  3DRP A;  3KLI A;  4IEI A;  4DR2 K;  2O8E B;  4JI4 K;  4LF5 K;  4JK7 A;  1GLJ O;  2EWS A;  2RHK A;  2YJF A;  2A41 A;  5E26 A;  4ILJ A;  2KFZ A;  5JVG L;  3DMJ A;  4MQ3 A;  4FYD A;  3NBP A;  2EHG A;  2ZGZ A;  4MO4 A;  1TYQ B;  4KHN A;  4Z4I A;  3CM5 A;  4I7F A;  4OKJ A;  3AVI A;  3KKR A;  3CPW M;  1O13 A;  5FPE A;  2ZWH A;  5LY3 A;  3CCR N;  3OHR A;  2HVI A;  2HHQ A;  4M42 A;  4JKA A;  4CHQ A;  3J7Z O;  3ULE B;  3HSC A;  1NBW A;  4FWO A;  3ID8 A;  1RTH A;  1KLM A;  1SUQ A;  3FFK B;  3WEE A;  2P9N A;  3NH0 A;  3AVJ A;  3IG1 A;  3OYH A;  3E9L A;  4JI3 K;  1QZ6 A;  3LZI A;  3OJU A;  4A61 A;  3ID6 A;  2FBX A;  3QNO A;  1BWF O;  4BRM A;  3RR8 A;  1RT2 A;  3DOK A;  5AFU H;  4NXM K;  3QBW A;  2QKK A;  5FRO A;  1H1V A;  1K6Y A;  3OTO K;  4FCY A;  4JKH A;  1NK0 A;  4OPJ A;  3WNE A;  1RFQ A;  1SQK A;  3HVR A;  3THW B;  4CJL A;  4OPA A;  4RWT A;  4B9M A;  1JLB A;  1V4T A;  3EO3 A;  5JS2 A;  3SQ1 A;  1WOQ A;  2NRZ A;  1BIS A;  4A59 A;  3A5O C;  2NRR A;  2UXD K;  3ULD A;  2YHB A;  1TUY A;  2X6N A;  1NMD A;  3C6U A;  4CEE A;  4H0T B;  4O0J A;  5FLX O;  4N41 A;  5DK5 A;  4NCB A;  2VWB A;  4ELV A;  2ZJR L;  3V1Q A;  1ASU A;  2QK9 A;  5CZ1 A;  1HNV A;  3R3L A;  3UIQ A;  1ZC6 A;  4KHP K;  1ZXO A;  4DR7 K;  3AVL A;  4WQ5 C;  2V51 B;  1EX4 A;  4JKG A;  1NWK A;  4Z4H A;  4B1V A;  2O8E A;  3CCE N;  1QQC A;  3SI6 A;  3AVG A;  3SQ0 A;  3MN7 A;  1C0F A;  5AJ3 K;  1KCF A;  3IKM A;  5FPM A;  1KXP A;  1YUW A;  1HQU A;  4JI6 K;  1WLJ A;  3VQP A;  4CK3 A;  3J80 O;  1KRP A;  4FK2 A;  3PV8 A;  1TYQ A;  4BRC A;  4EHT A;  4CJQ A;  4BE1 A;  4AIL C;  4DQP A;  4DSI A;  2ZM6 K;  4PA1 A;  2VWJ A;  1SL2 A;  4ID5 A;  2Y1J A;  4CZL A;  5C24 A;  2ZJP L;  2F9W A;  3M5R A;  3ULE A;  1NK9 A;  1Q7Y O;  4B1Z A;  3MX2 A;  2HBL A;  4B9S A;  3L2W A;  1S1W A;  2P9L A;  3UKR A;  3I56 N;  2OPS A;  4IJN A;  1Q9Y A;  3HBT A;  4H5N A;  4A5A A;  4FJJ A;  2VG6 A;  4JI2 K;  3LP3 A;  2E6L A;  2VG5 A;  4HCB A;  1XWL A;  5FPN A;  1IV0 A;  4CJ7 A;  4X62 K;  3LL3 A;  3P1G A;  2QWR A;  3WXK A;  1L3V A;  1EXQ A;  3DI6 A;  3G10 A;  4PKI A;  4FJX A;  3QO9 A;  4GNI A;  3THW A;  1TAQ A;  3SJJ A;  1XMQ K;  2KTQ A;  2CH5 A;  4WYB A;  4H8K A;  4KB1 A;  1IG8 A;  5GAH P;  4FWS A;  1XQS C;  3SPZ A;  1UA0 A;  1SL1 A;  4KHW A;  4H5V A;  4AHU A;  4FLW A;  1SS6 A;  4DLG A;  1ASW A;  1FK9 A;  3VMF B;  4NCG A;  1U49 A;  4H0P A;  5DMR A;  1ZBI A;  1HNW K;  1ILY A;  4NCA A;  3M6G A;  1IG9 A;  4BRK A;  5BR8 K;  4ISF A;  4IOC L;  1O1W A;  1NOY A;  3EL2 A;  4GVM A;  2Q0R A;  3V1R A;  1RDC A;  4FWL A;  3OYJ A;  3VQB A;  3J7Y P;  3T1H K;  3EKU A;  4AHS A;  4IKF A;  1BCM A;  3AVB A;  3NHG A;  4F3O A;  5AQX A;  4CEZ A;  4K0K K;  4FLV A;  4KAZ A;  1E4F T;  1D4X A;  3AVM A;  1LW0 A;  3LP1 A;  4FWR A;  1JLC A;  3BGR A;  5EXW A;  3V9Z A;  4B3T K;  1NMN A;  3SCX A;  3VA0 A;  1QE1 A;  1HKB A;  1KVB A;  3R9P A;  1ZBU A;  3VF4 A;  3VF6 A;  4IFV A;  3CI5 A;  3S3M A;  4ELT A;  2O8B A;  1ASV A;  3LM9 A;  4H0Y B;  4JNE A;  1IO2 A;  3I55 N;  3P4I A;  4CFA A;  4BE0 A;  5SZT A;  3QEV A;  1LW2 A;  4A62 A;  1HPZ A;  1SKS A;  1ITG A;  3FGU A;  2W41 A;  1L5U A;  4RW4 A;  1I94 K;  1VSL A;  3AVH A;  4JLH A;  4YOR A;  4CJF A;  1WSG A;  3M3Z A;  3O3F A;  5CR4 A;  2YHX A;  3U9D A;  5D3G A;  5E41 A;  2GEL A;  4DV4 K;  2Z1I A;  4BRA A;  2OPP A;  3BDP A;  3F2K A;  4FJ9 A;  4YDU C;  2D1K A;  2E88 A;  1HYS A;  4E19 A;  5AQU A;  3WNH A;  3AA4 A;  2YKN A;  3CCL N;  3KD1 E;  1NGD A;  1S1U A;  1LWE A;  3BZC A;  5BRH A;  4GV3 A;  1RIL A;  1BQM A;  4XH4 A;  3MED A;  3DLH A;  4WQ5 A;  4CJ5 A;  3A2F A;  2HND A;  2YHW A;  4DWI A;  2QWP A;  4EAH D;  3VOV A;  2PZS A;  4KPY A;  3VEZ A;  5AZI A;  1K73 O;  1T3V A;  2HB5 A;  4KTZ A;  2HOE A;  4CZK A;  4DSK A;  4PUO A;  3DRR A;  4BG8 A;  2YNH A;  2G8V A;  1YIT N;  1TKZ A;  2RKI A;  3CCS N;  3V9U A;  4FSV A;  3EE8 A;  1DEJ A;  3ZT0 A;  3O08 A;  3ZSY A;  1HR0 K;  2HF4 A;  2A3Z A;  4BR4 A;  4BRH A;  3PO4 A;  2YHA A;  1D5A A;  4DSF A;  3QET A;  1VRT A;  4BRN A;  2CGL A;  2E6M A;  3RMB A;  2ZJQ L;  4DFP A;  3J7A P;  4GW6 A;  2VGN A;  3F73 A;  4BWJ A;  4E7H A;  1I3A A;  3KIO A;  4GVE A;  4CIE A;  3JSM A;  2B6A A;  4JKF A;  2XY7 A;  1IBM K;  3THX A;  4I2P A;  1HYV A;  1TKD A;  4CED A;  4XIU A;  4WFA L;  1FJG K;  2P9S B;  4J2D A;  1F21 A;  1U6Z A;  3RSE B;  4LD0 A;  4MLE A;  4CGG A;  1J54 A;  4DSE A;  3F9K A;  5KTQ A;  4FVM A;  3SV4 A;  4DTS A;  3SZ2 A;  3K5M A;  1VQO N;  4B9N A;  3C65 A;  5JS1 A;  1ATR A;  3MAQ A;  3HPG A;  4CK2 A;  5KPT A;  3KJV A;  4JS4 A;  1NM1 A;  3QIN A;  1DT9 A;  2BDP A;  4H5W A;  3SYZ A;  4DR6 K;  3HTV A;  4FJH A;  4CHY A;  3WUH A;  3L4Q A;  1B9F A;  3RMD A;  3CC2 N;  2RN2 A;  5JLH A;  1QZ5 A;  3SAH A;  1VQM N;  2G8I A;  2YHY A;  1ATS A;  4KH4 A;  5IWA K;  1KD1 O;  1YJN N;  3SJH A;  4A5B A;  3H1V X;  4YOX A;  5BR9 A;  2OTJ N;  2YKM A;  3KKS A;  3HI0 A;  4W5O A;  4FJM A;  4DTR A;  1EET A;  5K14 A;  3VEO A;  2KZZ A;  3HO1 A;  3DLG A;  5DM6 L;  2ASO A;  4GKK K;  4C8M A;  1GLD G;  2D0P A;  3E01 A;  5KGW A;  5AQK A;  2QW9 A;  3OYC A;  2W6L A;  2GV9 A;  2KFN A;  4CJV A;  1JKH A;  5M1N A;  3KLE A;  1C6V A;  3G6E N;  3OW2 M;  2CGK A;  2P9U A;  4CFD A;  3W3D A;  4FJ5 A;  3OYF A;  2H3G X;  4JKE A;  4JEP A;  3OYB A;  3G71 N;  2GBZ A;  2F4V K;  3ALY A;  1HLU A;  3TSP A;  5EOY A;  2WOM A;  2QWO A;  1VK0 A;  3KTQ A;  1XUP O;  1SKR A;  2P9P B;  3DRS A;  1U4B A;  3L6Q A;  1NU0 A;  2KQ2 A;  3SBG A;  4LSL A;  3LDS A;  3JS6 A;  2FBV A;  3VQ5 A;  2IVN A;  3LAL A;  5ELZ A;  1BU6 O;  1W0H A;  2HW3 A;  4A2B A;  3SUN A;  3VER A;  2CGJ A;  4E0D A;  2RPI A;  2QM1 A;  1BOT O;  1QHT A;  3HOT A;  1T05 A;  3H3N O;  1RCH A;  4QCL A;  4YDU A;  1G15 A;  4F2S A;  2XO7 A;  2P9S A;  4C1N I;  4NYN A;  3O3H A;  3ZX0 A;  2YCH A;  4CEQ A;  4N5S A;  3ZSR A;  2B5J A;  4BAC A;  1Z05 A;  3TAP A;  2O8D B;  2BTF A;  3SNN A;  3KK2 A;  4KI4 A;  1Y97 A;  4BRF A;  3CJ1 A;  1W9H A;  1ATN A;  3QNN A;  4CD3 A;  1KVA A;  4JKB A;  4OLA A;  3SMS A;  4KHS A;  5GAE P;  3NE6 A;  1RTJ A;  4CVN E;  4OPH A;  4GV6 A;  4WF9 L;  2NLX A;  1NKC A;  2E20 A;  4M63 C;  4MDA A;  1YIJ N;  5LJV A;  1GLL O;  3QLH A;  4CJE A;  3CC7 N;  5T7B A;  3R1X A;  1B9D A;  3SQ4 A;  4X64 K;  3FLC O;  3TAF A;  2AJQ A;  1P90 A;  3K58 A;  3O5B A;  1YVN A;  4CGH A;  4HUF A;  4ELU A;  4JKD A;  3K5L A;  5F1X A;  3C7N B;  3NCI A;  2R7Y A;  1HNX K;  1X9M A;  1W2B M;  3VA3 A;  1BIZ A;  4DU3 A;  4J8F A;  2JLE A;  1Q82 O;  5M1P A;  2NRW A;  3RRH A;  3SBT A;  1HNZ K;  1HYZ A;  2WFB A;  3TR8 A;  4CHN A;  3QFU A;  1Q9X A;  1BIU A;  4FM2 A;  4DF4 A;  4MLH A;  3MN5 A;  4K43 A;  1YT3 A;  3ENB A;  4JK8 A;  3L0Q A;  4DTU A;  2BGG A;  2P9P A;  3QEX A;  4H0V B;  3ZCM A;  4AQY K;  2KLA A;  3ATV A;  2O8C B;  4CGI A;  3L2V A;  4BGA A;  1NGI A;  1U47 A;  3J81 O;  4RCH A;  1W7A A;  2BUP A;  1TK0 A;  5HRR A;  3PUF A;  3O9R A;  2DPN A;  2OCE A;  2IGI A;  1CXQ A;  1HQE A;  5HRS A;  2FLO A;  1RBT A;  1OH7 A;  3MMV A;  4LF7 K;  3P39 A;  4M3R A;  4YOW A;  4O8U A;  2IVO A;  2O8D A;  3ZYY X;  3TU5 A;  4I9L A;  3E9O A;  1C0U A;  4E7K A;  4CJS A;  3DLB A;  1QSY A;  1YJW N;  4KI6 A;  4KHY A;  3DXK B;  3ZSX A;  4DTM A;  4JV5 K;  2HBK A;  3MWT A;  3TAM A;  3MN9 A;  1VSK A;  3AA2 A;  1R0A A;  3ZET B;  3C94 A;  3VPZ A;  3OYA A;  3BF1 A;  4JD2 A;  4DLE A;  1A5V A;  4BRL A;  3T1Y K;  1YI2 N;  3LWM A;  3CJ7 A;  4LF6 K;  3VTH A;  5KRS A;  3TAG A;  4CIF A;  1NLV A;  2QKB A;  4RW9 A;  4FWQ A;  4PKG A;  1IBK K;  4BRO A;  1YF5 L;  4BRQ A;  3MXM A;  2NRH A;  3CPE A;  2YNF A;  4Z4F A;  4BR7 A;  3C7N A;  3CF5 L;  3AO5 A;  4EHU A;  3EZW A;  4FJI A;  1FXX A;  3EY1 A;  2D4W A;  3QEP A;  2UUC K;  4JAX A;  1KVC A;  2P9K B;  3E66 A;  5DM7 L;  2ZGY A;  3ZSO A;  2NRX A;  2QWQ A;  2HHS A;  4DQS A;  3AAP A;  4OO1 J;  2Y1I A;  4KRE A;  3LDN A;  4M3U A;  4JN4 A;  2HBJ A;  1NGH A;  4E3S A;  2O8C A;  3UKU B;  1DGK N;  3K2P A;  5AFU A;  1NGC A;  2F96 A;  2A6A A;  5F0X A;  4KBO A;  4M7X A;  4Z4C A;  5H1S Q;  1VQ6 N;  1FKO A;  2QTD A;  4GY2 B;  1UAX A;  1RT6 A;  1IBL K;  4IWV A;  1IJJ A;  2F8T A;  4O5F A;  4B1U B;  4FWM A;  3K5N A;  5B8H A;  4DB3 A;  4AHR A;  3MN6 A;  1QTM A;  3LDO A;  5SWM A;  1XC3 A;  1N33 K;  1JLA A;  4ILG B;  4OPK A;  5J2P A;  3PX6 A;  3FZF A;  3NFA A;  2ASM A;  2XY8 A;  3VQQ A;  4BRE A;  2FC0 A;  3CME N;  1JL2 A;  4E1N A;  5AQI A;  2ZQB A;  3O6W A;  3S3O A;  3AAQ A;  4CJP A;  3DXK A;  3V1O A;  2P1J A;  4N56 A;  4TSX A;  4DS5 A;  2CH6 A;  4X66 K;  3EE9 A;  3TAE A;  2UXC K;  3AAR A;  4ISE A;  4RG8 A;  4L8R B;  4JYA K;  1C0M A;  3KWG A;  3NF7 A;  4YOU A;  3ZEU B;  4B3M K;  1QVF M;  1REV A;  1T6C A;  4FJ8 A;  3V9W A;  4HWI A;  1RGI A;  1JLG A;  5AQV A;  3A5M C;  1RNH A;  4YHH K;  4EZ9 A;  3L2Q A;  3DYA A;  3HK2 A;  1E4G T;  3EYZ A;  4WFN L;  2AP1 A;  1TKX A;  3DJC A;  4DTX A;  4R5P A;  4IDK A;  1GOB A;  2P9K A;  3ZLJ A;  1BUP A;  3HP9 A;  2F8S A;  1JLF A;  1D9F A;  2WUS A;  3CJ9 A;  3M8R A;  3QB0 A;  4DKW A;  1JJ2 M;  2KKZ A;  3D0P A;  4M3W A;  1ESV A;  2Q31 A;  5I9E B;  4CF1 A;  3CC4 N;  3U4L A;  3VF2 A;  4FW2 A;  3UKU A;  3Q7C A;  1N34 K;  1KQS M;  4LH5 A;  3V9X A;  2ETJ A;  2FF6 A;  2NZT A;  5KRT A;  3ASM A;  2UXB K;  3LDP A;  4Y1D A;  3M8Q A;  5AQQ A;  4E7I A;  4M7Y A;  2WBN A;  2V7Y A;  1NK4 A;  4HHT A;  3QFP A;  4CI6 A;  3HOS A;  2ZF5 O;  1JLE A;  4YOY A;  4I6M B;  3WT0 A;  4X65 K;  2XHB A;  1NKE A;  4K8Z A;  1X9W A;  1S5J A;  1DKG D;  2X6S A;  2GUI A;  3A0I X;  1GLF O;  2Q97 A;  3DXM B;  3D6R A;  1VSH A;  3QIC A;  4OGE A;  4FJN A;  2ATQ A;  3OYM A;  4KTQ A;  4FM1 A;  3ZT2 A;  5F2R A;  3D45 A;  4FWN A;  4EP4 A;  4K41 A;  2UUB K;  1HUX A;  4BRD A;  2OZS A;  3MEE A;  4Q5V A;  1OH8 A;  4YOV A;  4KHU A;  3ZEU A;  4IFE A;  5BRD A;  4EZ6 A;  1WNS A;  4DR3 K;  2PBD A;  4JI8 K;  5BPL A;  3H08 A;  4LFB K;  2E1Y A;  2LSN A;  5CE3 A;  3GOI A;  2E8A A;  3HM9 A;  4DV3 K;  3UB5 A;  2GUP A;  2E2N A;  4CHP A;  3GBT A;  3L3U A;  4CZM A;  4M45 A;  2IDO A;  2ITG A;  3B6O A;  2HHW A;  4CZG A;  3NH2 A;  1NGE A;  1HJR A;  2GX9 A;  1S9G A;  4CGJ A;  3SUO A;  3OS1 A;  5BN8 A;  1WSF A;  3K57 A;  4EFH A;  3A5N C;  4W5Q A;  5AQJ A;  2IAJ A;  2A1S A;  4FOE A;  4BWM A;  4O0I A;  5LMN K;  3PY8 A;  1NGJ A;  3KZB A;  4B9T A;  5AZJ B;  4C8L A;  1VQ8 N;  5BPN A;  2FSJ A;  1SZ2 A;  3AO3 A;  3B8A X;  1LOT B;  3DAW A;  3GL1 A;  4RW7 A;  4I6M A;  3CCV N;  3KLH A;  3IRX A;  1JL1 A;  3K5O A;  4CBU A;  1EWR A;  2IVP A;  3O1W A;  1HNI A;  1J9A A;  1Z6R A;  3I8B A;  4DTN A;  3ZSV A;  1TV6 A;  1J6Z A;  4QS7 A;  2HHH K;  1S6Q A;  4KFB A;  3DXM A;  3PSI A;  3VEW A;  4M3Z A;  1OH5 A;  3THY B;  4H4M A;  3RTV A;  4DR1 K;  5ADX H;  4BC4 A;  3VQ6 A;  1L3U A;  3NH1 A;  4GMJ B;  3DOL A;  1BA0 A;  1BL3 A;  1J5E K;  2HVH A;  1LV5 A;  1VQ9 N;  2VWK A;  3NF9 A;  5TKY A;  3RWU A;  1K8A O;  3CCJ N;  4M3Y A;  3WXM B;  1J53 A;  5HP1 A;  3ZSZ A;  4AHC A;  3D2E B;  4B1X B;  3CJB A;  3OYD A;  4ZTF A;  4M3T A;  2O4I A;  3HRG A;  4YOT A;  4YNQ A;  1C1A A;  1K8K B;  3IMX A;  3L3V A;  3TI0 A;  4Z4G A;  1LAW A;  4NB4 A;  1QHA A;  5BRE A;  1DTT A;  1VSM A;  1VHX A;  3HYF A;  4B3R K;  3VTI A;  4LFC K;  4XH1 A;  1NOZ A;  4AH9 A;  5MLC Q;  1Q86 O;  3C6H A;  3IDH A;  1WSJ A;  2BE2 A;  3HM8 A;  3VGL A;  3ZT4 A;  4EP5 A;  1HRH A;  3C6A A;  3GG4 A;  1QQN A;  1S9E A;  1X1P A;  2YNG A;  3MXJ A;  2UU9 K;  1JXB A;  3C0B A;  4CF9 A;  3FFI A;  3NVM A;  2OA8 A;  3CJA A;  3B6P A;  4CCH A;  3P38 A;  4CF0 A;  4LSN A;  2VQF K;  3CM6 A;  3VQE A;  5C12 A;  2NNW A;  4FLT A;  3LP2 A;  4JHD B;  4FLY A;  3WQT A;  4DUZ K;  4E7L A;  2W6K A;  3NMU A;  2VCP A;  2B4J A;  2DTU A;  3U3G A;  4W5T A;  2Q0U A;  5C25 A;  1ZYQ A;  1CLQ A;  1TUU A;  3VQ4 A;  3AGR A;  4PKH A;  2WON A;  2ZE2 A;  4E7J A;  5CHI A;  4W5N A;  1VAZ A;  4B1Y B;  3LAK A;  4JRP A;  2I7N A;  1N6Q A;  2G8K A;  2VGM A;  3HZ6 A;  5KQD A;  4WFB L;  4CF2 A;  5FPD A;  4LF9 K;  3THY A;  2GWJ A;  3FZM A;  1QSS A;  3MDQ A;  3DLK A;  3PX4 A;  1KAY A;  1L3S A;  2PY5 A;  4DU1 A;  3TTC A;  5CYM A;  3OS2 A;  5JMV A;  3TAR A;  3N4Q A;  1L3T A;  1Y64 A;  5AQM A;  1BG3 A;  3AVK A;  3FZH A;  5AQW A;  2BH1 A;  2F9T A;  4QAG A;  1BDG A;  2O8F B;  2P9I B;  3RSE A;  5C10 A;  2RE2 A;  3KWI A;  4FLX A;  4OJR A;  3VES A;  1TK5 A;  2E5L K;  3GE1 A;  4CE9 A;  1BI4 B;  4C8O A;  4KTW A;  2YI1 A;  1S1T A;  1T8E A;  3OBW A;  4UY8 O;  1UOC A;  1K8K A;  4FOI A;  4Z94 A;  4W5R A;  3I0S A;  3SV3 A;  5AQP A;  2XY6 A;  1KC8 O;  4PQU A;  4PHT X;  1T7P A;  1HKG A;  2I5J A;  4LFA K;  1HJO A;  3KHY A;  3PSF A;  4FL9 A;  2HHU A;  4LF8 K;  3WQU A;  2PYL A;  5LJW A;  3ENH A;  5AQH A;  3HXM A;  3S41 A;  5C0Y A;  4MO5 A;  2Z1J A;  4ZTJ A;  1TKT A;  4H5T A;  3L8B A;  1NGF A;  4E1M A;  4BDP A;  2VYP A;  3U9Z A;  2Q1N A;  3NAE A;  2GEM A;  3AA5 X;  4H0O A;  3RVC A;  3R8E A;  3QIO A;  4QS9 A;  1EQY A;  4CBW A;  3VQ9 A;  4C8K A;  1RT5 A;  4KHQ A;  1MWK A;  2HBM A;  4OX9 K;  2BAN A;  2DY4 A;  4JHD A;  3CIP A;  3IUC A;  3IAY A;  4IO8 A;  1D8Y A;  3CQ8 A;  3NGZ A;  3TTF A;  1VQ7 N;  3TAN A;  4DV2 K;  4KKO A;  4DV6 K;  5AR0 A;  4OKK A;  3L2U A;  5FRN A;  4WE1 A;  4B3S K;  4AM7 A;  5M1F A;  3O1B A;  4BE2 A;  3D2F B;  2UUA K;  1TL3 A;  2Z1H A;  4CW7 B;  1BCO A;  4F9O A;  1R59 O;  1NK8 A;  4CJU A;  3V6D A;  1I39 A;  1U2V B;  3RR7 A;  1T6D A;  4NO7 A;  1U04 A;  4JRQ A;  3VEX A;  4CFC A;  5EU7 A;  4CJT A;  4DFK A;  3AY9 A;  4CBX A;  4KH5 A;  4BRP A;  5J2Q A;  4CF8 A;  4G1Q A;  5A2Q O;  1EKE A;  4DFJ A;  3JAM O;  1C0G A;  4CJW A;  2OTL N;  4PWD A;  1X9J A;  4Z0U A;  3OYG A;  2O8F A;  2P9I A;  1WB9 A;  1BO5 O;  5M1Q A; 
#chains in the Genus database with same CATH homology
 3DWL A;  1NGD A;  4PL7 A;  3KWG A;  5KQ8 A;  4YOU A;  3ZEU B;  2GWK A;  3ATU A;  4BVP A;  1SAZ A;  1QVF M;  1NGG A;  5BRH A;  4GV3 A;  1T6C A;  4JKC A;  1NGB A;  1YXQ A;  4HWI A;  3ZX2 A;  4XH4 A;  2NRT A;  1S3X A;  4BGB A;  3EKS A;  1RGI A;  4WQ5 A;  4BRI A;  4IEE A;  5AQV A;  3CJC A;  5BRF A;  3A5M C;  4B9Q A;  5AQO A;  5JLF A;  2YHW A;  3VGK A;  3BF3 A;  2QWP A;  4FPB A;  4EAH D;  1E4G T;  3QML A;  3VOV A;  5C2F A;  4WFN L;  4K25 A;  4H0X B;  2AP1 A;  3DJC A;  3VEZ A;  3CQY A;  5AZI A;  1K73 O;  1T3V A;  5KPR A;  3SLC A;  3BEX A;  2P9K A;  3G4S N;  2HOE A;  4AM6 A;  4CZK A;  5GAG P;  1BUP A;  3MX5 A;  4BC2 A;  3D2E A;  4BG8 A;  4FVU A;  1YIT N;  2WUS A;  1CZA N;  3CJ9 A;  5AQT A;  3CET A;  3QB0 A;  2V52 B;  3BP8 A;  3UE5 A;  5EVZ A;  3CCS N;  4FSV A;  3EE8 A;  1DEJ A;  3H1Q A;  3CER A;  3JXU A;  4ISG A;  4DKW A;  1JJ2 M;  2KKZ A;  3SAF A;  3O08 A;  2FSN A;  1ESV A;  2HF4 A;  2KHO A;  2Q31 A;  4IJA A;  4BC5 A;  5I9E B;  2A3Z A;  4BR4 A;  3CC4 N;  3U4L A;  4A2A A;  4BRH A;  3VF2 A;  1W97 L;  3UKU A;  3Q7C A;  1KQS M;  5AQS A;  4BRN A;  1QVG M;  2CGL A;  4K42 A;  2FF3 B;  3CCU N;  2FF6 A;  2ZJQ L;  2NRV A;  1HPM A;  2NZT A;  5BPM A;  3NVK A;  2HF3 A;  2VGN A;  2HMP A;  3LDP A;  2P9L B;  3UKR B;  2ASP A;  1MDU B;  3O80 A;  4M7Y A;  5AQL A;  2IIR A;  2WBN A;  4GVE A;  2Q36 A;  5AQQ A;  2V7Y A;  3CD6 N;  1QQO A;  2E2O A;  1HX1 A;  3QFP A;  3H6E A;  3Q7B A;  4CI6 A;  3HOS A;  4JKF A;  2ZF5 O;  2YX6 A;  3E9P A;  4YOY A;  3PLA A;  1GLA G;  4I6M B;  3D2F A;  3WT0 A;  4A57 A;  4BY9 C;  3DLL L;  3TSU A;  1MA9 B;  4WFA L;  4BG9 A;  2P9S B;  2A40 A;  3SAG A;  4BC3 A;  4BR2 A;  2ITM A;  1U6Z A;  3RSE B;  1DKG D;  4MLE A;  3A0I X;  1U2V A;  1GLF O;  1LCU A;  2Q97 A;  3DXM B;  3H46 O;  4CZH A;  3D6R A;  5HOO A;  5E84 A;  1KAZ A;  3L4I A;  3QIC A;  4JD2 B;  1VQO N;  4QS8 A;  3WEE B;  3C65 A;  2P9N B;  3FZK A;  5AQY A;  1ATR A;  3O9U A;  5KPT A;  3H45 C;  5GIN A;  3O9T A;  1NM1 A;  2WC9 A;  1DT9 A;  2FXU A;  3TTD A;  2PFU A;  5F2R A;  4H5W A;  4FWN A;  3A8Y A;  3HTV A;  3WUH A;  4C23 A;  4K41 A;  2E2Q A;  3L4Q A;  4L3Q A;  4FO0 A;  1HUX A;  3CC2 N;  4BRD A;  1RDU A;  4IO9 L;  5JLH A;  1QZ5 A;  3SAH A;  1VQM N;  4WCE L;  4YOV A;  2YHY A;  3ZEU A;  4BQZ A;  1ATS A;  4KH4 A;  4R79 A;  3CCM N;  1KD1 O;  1YJN N;  1RDW X;  4IFE A;  5BRD A;  3SJH A;  4RTF D;  2PBD A;  4A5B A;  5BPL A;  3H1V X;  4YOX A;  3WXL A;  2E1Y A;  1OVY A;  3QBX A;  5BR9 A;  5C2D A;  2OTJ N;  2Q2R A;  3HI0 A;  5CE3 A;  2QA4 N;  3GOI A;  2E8A A;  3AGK A;  2F7T A;  5EY4 A;  3VEO A;  3W0L A;  2PAV A;  3UB5 A;  2GUP A;  5DM6 L;  2ASO A;  2E2N A;  4G9Z A;  4FPA A;  2UYT A;  3GBT A;  4CZM A;  1GLD G;  3PIO L;  3ZET A;  2D0P A;  3I33 A;  5M1O A;  3E1Y A;  3F9M A;  5AQK A;  4WQ4 C;  2A5X A;  2QW9 A;  4CZG A;  5TKW A;  2E2P A;  2AA4 A;  2GTD A;  3VEY A;  3MK6 A;  5M1N A;  3G6E N;  4C1N K;  1NGE A;  3OW2 M;  2CGK A;  3TSQ A;  2P9U A;  3WXJ A;  3W3D A;  4KH6 A;  3BUZ B;  4MDB A;  2GX9 A;  2H3G X;  4JKE A;  4JEP A;  3G71 N;  5BN8 A;  3PIP L;  4Y0W A;  2FSK A;  3A5N C;  4XH5 A;  1HKC A;  3VEV A;  5AQJ A;  4EFH A;  3LM2 A;  3TPQ A;  4IZ9 A;  1HLU A;  3TSP A;  4FWK A;  3WXI A;  4FOE A;  4JKG B;  5EOY A;  4B1W B;  3CMA N;  5BN9 A;  4BRG A;  2QWO A;  1NGJ A;  3KZB A;  1XUP O;  3MWP A;  2P9P B;  1OKJ A;  5AZJ B;  4IEI A;  1YJ9 N;  3L6Q A;  3SBG A;  4U7B A;  3JS6 A;  1VQ8 N;  5BPN A;  4JK7 A;  1GLJ O;  2RHK A;  2EWS A;  2YJF A;  2IVN A;  5AQG A;  2A41 A;  5E26 A;  4ILJ A;  1BU6 O;  5ELZ A;  5JVG L;  2FSJ A;  4A2B A;  3O8M A;  2W40 A;  3CQX A;  3VEN A;  1SZ2 A;  2ZGZ A;  2CGJ A;  3VER A;  4MO4 A;  1TYQ B;  3B8A X;  1LOT B;  5GAD P;  2QM1 A;  3H3O B;  3DAW A;  1BOT O;  3GL1 A;  4I6M A;  3HOT A;  3CCV N;  3H3N O;  3P31 A;  1ZBS A;  5AQF A;  4YDU A;  3CPW M;  1O13 A;  1N8R O;  3D7E O;  4CBU A;  5FPE A;  2IVP A;  2ZWH A;  5LY3 A;  2P9S A;  3N4P A;  4C1N I;  3O1W A;  4E1J A;  1Z6R A;  3CCR N;  3OHR A;  3I8B A;  3ZX0 A;  4JKA A;  2YCH A;  3EN9 A;  1J6Z A;  4QS7 A;  3J7Z O;  3ULE B;  3HSC A;  1NBW A;  3DXM A;  4FWO A;  3ID8 A;  1BA1 A;  1Z05 A;  3VEW A;  2QI2 A;  4IXC A;  2BTF A;  3FFK B;  4FWP A;  3WEE A;  4BRF A;  2P9N A;  3CJ1 A;  3J8A A;  1ATN A;  4CD3 A;  4JKB A;  5ADX H;  3E9L A;  3OA9 A;  3SMS A;  1QZ6 A;  4BC4 A;  5GAE P;  4CD1 A;  4A61 A;  3ID6 A;  4BVO A;  4CZE A;  1BWF O;  4BRM A;  1BA0 A;  5AFU H;  4OPH A;  3QBW A;  4GV6 A;  1H1V A;  2HST A;  1VQ9 N;  4WF9 L;  2NLX A;  2OAN A;  2E20 A;  4JKH A;  4M63 C;  1KAX A;  4MDA A;  5TKY A;  5AZI B;  1YIJ N;  1K8A O;  5LJV A;  5AQR A;  3CCJ N;  4NLC A;  1GLL O;  3WXM B;  1VQK N;  2QWL A;  3CC7 N;  3LDL A;  1RFQ A;  3D2E B;  1SQK A;  4B1X B;  3CJB A;  3HRG A;  3R1X A;  1YAG A;  4YOT A;  1VQL N;  1K8K B;  3IMX A;  3FLC O;  4OPA A;  4RWT A;  1V4T A;  5EX5 A;  1P90 A;  3O5B A;  1YVN A;  4IOX A;  3EO3 A;  4CZI A;  4NB4 A;  1QHA A;  5BRE A;  4JKD A;  1WOQ A;  2NRZ A;  4A59 A;  4BR0 A;  3A5O C;  5F1X A;  2NRR A;  3C7N B;  3VTI A;  4XH1 A;  5MLC Q;  1Q86 O;  1W2B M;  4J8F A;  1TUY A;  1Q82 O;  1NMD A;  2NRW A;  3C6H A;  3QDK A;  3IDH A;  5M1P A;  3SBT A;  3HM8 A;  3VGL A;  4H0T B;  3T69 A;  3C6A A;  2WFB A;  3GG4 A;  1QQN A;  2VWB A;  2ZJR L;  3QFU A;  1WUA A;  4BQL A;  3R3L A;  5AQZ A;  1ZC6 A;  4MLH A;  1ZXO A;  3MN5 A;  2JWL A;  4K43 A;  1GLC G;  5GIP A;  3ENB A;  4JK8 A;  4WQ5 C;  3L0Q A;  2V51 B;  4HTL A;  3C0B A;  4JKG A;  4EIA A;  3NVM A;  3IFR A;  3SK3 A;  4CZF A;  1X3N A;  3CJA A;  1G99 A;  3CCQ N;  1NWK A;  2P9P A;  4B1V A;  3CCE N;  4H0V B;  3P38 A;  3MN7 A;  3ATV A;  2KLA A;  1C0F A;  3VGM A;  5C12 A;  2NNW A;  3O9Q A;  1EO1 A;  3IKM A;  5FPM A;  1NGA A;  1KXP A;  1YUW A;  2J4R A;  4JHD B;  4BGA A;  1NGI A;  4U67 L;  4RCH A;  3WQT A;  1TYQ A;  2BUP A;  2E1Z A;  4BRC A;  2VCP A;  3NMU A;  1JCG A;  4EHT A;  4ILH A;  2Q0U A;  3O9R A;  1TUU A;  3AGR A;  4PKH A;  1T44 A;  1S22 A;  4CZL A;  2DPN A;  5CHI A;  1VAZ A;  2ZJP L;  4B1Y B;  2F9W A;  2I7N A;  3M5R A;  2FLO A;  1K9M O;  2QEX N;  2VGM A;  3MMV A;  3T7Z A;  3CHW A;  3HZ6 A;  3P39 A;  3ULE A;  5KQD A;  4YOW A;  4O8U A;  2IVO A;  4WFB L;  1S72 N;  5FPD A;  4B1Z A;  1Q7Y O;  2A42 A;  2GWJ A;  3MX2 A;  4XEI A;  3FZM A;  3ZYY X;  2HBL A;  4LC9 B;  1GLB G;  3TU5 A;  1X3M A;  5M1K A;  2P9L A;  3MDQ A;  3UKR A;  1KAY A;  3E9O A;  3I56 N;  4O8K A;  4IJN A;  4DCH A;  1VQN N;  3HBT A;  4H5N A;  4A5A A;  3O9S A;  3TTC A;  1YJW N;  3DXK B;  4DQ8 A;  5JMV A;  3OBY A;  3N4Q A;  1YHQ N;  2HBK A;  1Y64 A;  3MWT A;  4BR9 A;  3LDQ A;  5FPN A;  3MN9 A;  1BG3 A;  4IDH A;  2V7Z A;  3FZH A;  5AQM A;  2BH1 A;  2F9T A;  5AQW A;  1BDG A;  4CJ7 A;  1JCF A;  3ZET B;  3LL3 A;  2P9I B;  4WQ4 A;  3RSE A;  5C10 A;  2RE2 A;  2QWR A;  3KWI A;  3VPZ A;  3VES A;  3M1F A;  3WXK A;  3BF1 A;  5C15 A;  2QWM A;  3GE1 A;  4JD2 A;  4BRL A;  4PKI A;  1YI2 N;  1V4S A;  2YI1 A;  3MCP A;  4GNI A;  4UY8 O;  3OBW A;  2P9U B;  1VQ4 N;  3CJ7 A;  3ZX3 A;  5AQN A;  4AF1 A;  1K8K A;  4FOI A;  2CH5 A;  3VTH A;  4WYB A;  3SMP A;  1NLV A;  3F5T A;  4Z94 A;  4BR5 A;  1IG8 A;  4FWQ A;  4PKG A;  5GAH P;  3K9K A;  4FWS A;  3K9J A;  1XQS C;  5AQP A;  4BRO A;  1YF5 L;  4BRQ A;  5KPZ A;  1KC8 O;  2NRH A;  3CPE A;  4BR7 A;  3C7N A;  4PHT X;  4EHU A;  3CF5 L;  1HKG A;  4H5V A;  3EZW A;  1SS6 A;  1HJO A;  2D4W A;  3KHY A;  3VMF B;  4FL9 A;  4H0P A;  4JAX A;  1ILY A;  2P9K B;  3WQU A;  3E66 A;  3M6G A;  1Q18 A;  5DM7 L;  2ZGY A;  4BRK A;  5LJW A;  2NRX A;  2QWQ A;  3A5L C;  1JCE A;  3ENH A;  3EL2 A;  4ISF A;  4DHY A;  3AAP A;  4IOC L;  4OO1 J;  2Q0R A;  5AQH A;  4FWL A;  3S41 A;  5C0Y A;  4MO5 A;  3EKU A;  4H5T A;  3KVG A;  3FE1 A;  1NGF A;  3LDN A;  2VYP A;  5AQX A;  4NLB A;  5ADX A;  3U9Z A;  4JN4 A;  2Q1N A;  4JK9 A;  5JVH L;  5GIO A;  2HBJ A;  2GEM A;  1E4F T;  4H0O A;  1D4X A;  3RVC A;  3R8E A;  1NGH A;  4QS9 A;  1EQY A;  4GV9 A;  3UKU B;  3U8X A;  4CBW A;  5HL7 L;  1DGK N;  4FWR A;  1MWK A;  2HBM A;  1NGC A;  5AFU A;  2A6A A;  5F0X A;  4KBO A;  1Q81 O;  4JHD A;  2D0O A;  2QXL A;  3CIP A;  3IUC A;  4M7X A;  2I7P A;  5EXW A;  4IO8 A;  5JIC A;  5H1S Q;  1VQ6 N;  2QTD A;  1GLE G;  4GY2 B;  3FR0 A;  1HKB A;  3TTF A;  3R9P A;  1VQ7 N;  4IWV A;  1IJJ A;  3VF6 A;  5AR0 A;  3O4W A;  3CI5 A;  3VET A;  3VF4 A;  2YJE A;  4O5F A;  4B1U B;  4FWM A;  1QQM A;  5B8H A;  3CXC M;  4DB3 A;  2QWN A;  3MN6 A;  1P8Z A;  3LDO A;  3O1B A;  4H5R A;  3D2F B;  4AM7 A;  5M1F A;  1XC3 A;  3KK7 A;  3R6M A;  4ILG B;  1VQP N;  4H0Y B;  3LM9 A;  4JNE A;  5AZJ A;  3I55 N;  3P4I A;  3FZF A;  1R59 O;  4F9O A;  2ASM A;  1U2V B;  4A62 A;  1T6D A;  4BRE A;  4NO7 A;  3FGU A;  3CME N;  2W41 A;  3VEX A;  1NJI O;  3G25 A;  5AQI A;  4YOR A;  3AY9 A;  3O6W A;  4CBX A;  1VQ5 N;  3M3Z A;  4KH5 A;  4BRP A;  5CR4 A;  4IOA L;  2YHX A;  3U9D A;  3AAQ A;  3ENO A;  4PL8 A;  2GEL A;  3DXK A;  2JWK A;  4BRA A;  1C0G A;  3F2K A;  4H03 B;  4CZJ A;  1M90 O;  3GDQ A;  4YDU C;  2OTL N;  2CH6 A;  2D1K A;  1X9J A;  1M1K O;  1MWM A;  2E88 A;  2P9I A;  3EE9 A;  5AQU A;  3AAR A;  4ISE A;  1BO5 O;  3FZL A;  3CCL N;  3MCA B;  5M1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...