3P39A

Crystal structure of the ns1 effector domain w182a mutant from influenza a/vietnam/1203/2004 (h5n1) virus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
b'KMPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEANDNTVRVTETIQRFAWRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title X-ray structures of the NS1 effector domain from highly pathogenic influenza A/Vietnam/1203/2004 (H5N1) virus
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 31
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3p39A00
3EE9A 3P38A 4OPHA 2RHKA 3L4QA 3EE8A 3KWIA 3M5RA 3O9QA 3O9TA 3OA9A 3P31A 3O9UA 3RVCA 3KWGA 3P39A 3F5TA 2GX9A 3O9SA 4OPAA 2KKZA 3D6RA 3O9RA
chains in the Genus database with same CATH superfamily
3CJBA 2OA8A 2Y1IA 4FWLA 3L0QA 4CJ7A 4DLGA 1QS4A 2X6NA 4CJSA 2VQEK 4UY8O 2FBVA 2D5RA 1WBDA 4R79A 2Q36A 4FWSA 3VQ6A 3E01A 1NG9A 2IVNA 5JICA 3T7ZA 4BC2A 3O5BA 4ILGB 3J81O 1TK8A 1TV6A 3CERA 3NVMA 4KH4A 1UA1A 4ELTA 4LF9K 3IUCA 3R9PA 2HHWA 4BRNA 4OX9K 5IWAK 4K42A 3EZ5A 1HNXK 2Z1IA 4JYAK 2B6AA 4IO8A 4CW7B 2HMIA 2I5JA 1VSHA 1RCHA 5M1KA 2B4JA 3VEVA 4YHHK 5CYQA 2A1RA 4H4MA 1RBVA 1C0FA 4OGCA 3V9UA 2FC0A 3CMEN 5FPDA 2QK9A 2P9SA 2ZGZA 4A2AA 1EETA 3TAQA 1TL3A 3ZSXA 1NK5A 4IOCL 1QTMA 3CC2N 4O5BA 4FLTA 3HYFA 3JXUA 2QWRA 4FLVA 1BL3A 4JHDA 1YXQA 5AQIA 2UUAK 2YNIA 2Q3SA 2VG6A 1MDUB 4A2BA 4M3RA 3MWTA 1BCMA 3RSEA 3NAEA 4IEEA 3K59A 3OYIA 3EEQA 3QEVA 4FZYA 4CZLA 4DMNA 1UA0A 1NK8A 2A40A 4CEZA 1QQNA 3A8YA 1WAJA 3A5OC 1BWFO 4JKGA 5AFUA 5DM7L 5KQ8A 3NDKA 4BWJA 1T6CA 1L5UA 4CGJA 3VEZA 3ZCMA 4C1NK 1MWMA 1WN7A 2XY8A 4JI1K 2HSTA 4YDUA 5BR8K 3CFRA 4KKOA 1J5EK 3J7AP 2O8DA 1RDCA 3OBYA 1Q8IA 4BR4A 3K5NA 4A5BA 3KTQA 1TL1A 4IFYA 3DXKB 2NRTA 4WFAL 5BPNA 4AQYK 1IV0A 3O1WA 4NXMK 4LH5A 1ZYQA 3VF6A 3WNEA 2BE2A 5HL7L 1I94K 4JKEA 3SQ4A 2YNFA 3P31A 2O8CA 4DU3A 1EP4A 3NF7A 2VG7A 1YAGA 3HZ6A 5AQXA 4B9VA 3AVGA 3LDSA 3CPEA 5KPZA 1SKSA 4LSNA 3UIQA 4QOZB 4DQQA 1HKGA 1W2BM 4DTPA 2FF6A 2EX3A 1NJZA 3H08A 3I33A 1SS6A 4F3TA 2Q31A 4BRKA 3C0BA 3ID8A 4Z0UA 3PLAA 1RDDA 1S3XA 3O9SA 3BGRA 2FSKA 5AQRA 1Q7YO 2JWLA 2X74A 1F21A 1JKHA 4H0VB 3CCLN 1CZ9A 4O4GA 1C0MA 1ASWA 1J9AA 1JLCA 4BVPA 2YV0X 4DS5A 1DTTA 3D45A 3AA2A 2D4WA 1C0GA 2X78A 1YITN 4XEIA 2HMPA 3S9HA 1YT3A 1VQ7N 2ZJPL 3AO2A 2P9SB 4KHWA 3RWUA 3DLBA 1ZBFA 2HVIA 3QDKA 4H5TA 3K0SA 5LL6Z 4FZXC 4JHDB 3FE1A 1RT4A 2NRRA 4CEAA 3CC7N 4BRHA 3OYBA 3DI6A 3MXJA 4KAZA 5D3GA 3RSEB 1JLFA 4DLEA 2DY4A 4FCYA 1IBMK 4XH1A 3ITHA 2F8SA 3TU5A 3C95A 1RBSA 4PKHA 4BR2A 1NGFA 2E2PA 4X62K 2KW4A 3AARA 4CIEA 4JKGB 2WTUA 4FL9A 1KXPA 4LY7A 1SKWA 4JK9A 2JLEA 4H0TB 1TVRA 1UWBA 2P9UA 4RW7A 3SBTA 1ZBSA 1XHXA 3E66A 4Z4HA 1N32K 2JGUA 4CK2A 4FJNA 4Z4FA 2KTQA 4WQ5A 2O8DB 1XWLA 2QWOA 5JLFA 1YTUA 4JNEA 1ZBUA 5JMVA 1KVCA 3P5JA 1X1PA 3J7ZO 1YJNN 2RF2A 3VTIA 1T3VA 3MEDA 5EXWA 3EO3A 4FJGA 4E1NA 2YHYA 2VWBA 1JJ2M 3QLHA 3QFUA 3SPYA 3UKRA 4H5NA 2ASPA 3C7NA 3SV3A 3SV4A 4B1YB 1QSLA 1NGBA 1VQ8N 3LDPA 1ITGA 2O8CB 1MU2A 4NYFA 2HHTA 3CPWM 3NBPA 1BQMA 4DSLA 4DFMA 2GUIA 3CIPA 2DPNA 3DRSA 4DV7K 1CXUA 4JKFA 4JI8K 2UXBK 3O4NA 1IG9A 4J2DA 3U9DA 3ZT0A 1KAXA 4H5RA 1XNQK 2HW3A 3SUOA 3LP2A 2RKIA 1VHXA 4CGDA 4FK2A 4JD2A 4AILC 2GWJA 4CJEA 1IKWA 4B3MK 1NMNA 4LFBK 5HBMA 4YDUC 1RT5A 3OJUA 1TUYA 1VSFA 1SV5A 3O4QA 2NRHA 2CGKA 3O6WA 3VENA 4YY3K 4XH4A 3DLGA 1EQYA 2HNZA 3OVNA 4CGGA 4ILJA 3CCUN 3U9ZA 4K8ZA 2IS3A 4Y1CA 2QEXN 3LWMA 2PZSA 2HNDA 4FM2A 1SUQA 3MX5A 1QZ6A 5SWMA 3GL1A 3O80A 5GADP 3K5MA 3MXMA 4GVMA 2V51B 1QSYA 2G8FA 2BTFA 3K5LA 1Z6RA 4KFBA 4N56A 1RTIA 2E20A 2FF3B 2CH5A 3CCQN 3CJCA 3D6RA 1U48A 3O1BA 3AVJA 3ZX2A 3KK2A 3M8SA 5EX5A 4FOIA 4CF0A 3V6DA 3QICA 3M3ZA 4PWDA 3CCJN 3VF4A 5C25A 4KHPK 3ZX0A 4E19A 1IJJA 2NLXA 1D9FA 3THVA 3OHRA 1S5JA 4EIAA 3CFOA 2W6KA 3PIOL 3AO5A 3QERA 1NOZA 1RDAA 4XIUA 4E1MA 1RNHA 1A5XA 2V52B 3LAKA 4IXCA 1QHTA 2W42A 4FLZA 4ZTFA 2YJEA 3T1HK 4DTOA 2YHAA 4KHNA 5LJWA 3H6EA 5I42A 4M7XA 1L3VA 4BE2A 4BDPA 4W5NA 5HP1A 5AZJA 3THWA 2HNYA 4BGBA 1KAYA 1IH7A 3UKRB 1NNEA 1OKJA 3C7NB 2UXCK 1BI4A 1HNZK 2P51A 1FKPA 1NKEA 1HYVA 1BA1A 4B8CA 4CESA 1LWEA 4JKCA 1KSPA 2V7YA 4CK1A 1X9MA 5EU7A 3LZJA 4JI3K 2RE2A 3PO5A 1VRUA 1Z25A 2IVOA 2YHXA 4LC9B 1D4XA 4PL7A 2HHSA 3MXIA 1N34K 4DR1K 3AVBA 5ADXA 3ENBA 3G0ZA 4DV0K 4OPKA 3LP1A 2XHBA 3PX0A 3TTCA 4NB4A 1DLOA 5TKWA 4JD2B 1VSKA 4CEQA 4E7JA 3SK3A 5KGWA 1BIUA 1RDBA 3KKRA 3SJHA 3O9UA 4WQ5C 2QKKA 2ZJQL 3VTHA 3OYLA 3ATVA 4JI5K 4IG3A 3DM2A 3SMPA 5AQLA 3AO3A 2E6MA 1ASUA 1HUXA 2E88A 4CERA 3CQ8A 2HHXA 2QI2A 3O3HA 1HNWK 1WB9A 4CVNE 4BRLA 3H1QA 5AQMA 2EHGA 3IDHA 1IBLK 4FK0A 1R59O 1FJGK 2QXLA 1H1VA 3QIOA 3HL8A 3AVIA 1NK7A 3V1OA 5CHIA 4OO1J 4DSEA 3WNFA 2E5LK 4A57A 2R7YA 2BH1A 2VWKA 1CZBA 3WEEA 4DF4A 4BRDA 4K25A 1IKYA 1Z05A 1BIZA 3R6MA 1SAZA 2BUPA 3VQEA 3HXMA 5EVZA 1W97L 4KI4A 5AQJA 4B3SK 1VSIA 3NCIA 1YJWN 1GLEG 2NRZA 5GAHP 3ZYYX 3I55N 4M42A 4JEPA 3CCEN 4FJMA 3QO9A 3HVTA 1ESVA 4BDZA 3MWPA 5JVGL 4BE0A 4Z4IA 4B9MA 3E9PA 3MEGA 1QVGM 5AQPA 4MDBA 3LP3A 3V9SA 1BO5O 1GOAA 1HJOA 4CK3A 2QM1A 4FPBA 4OPJA 1JCFA 2P9LA 5AZJB 5T7BA 4DQRA 2QTDA 4BDYA 3THWB 4PQUA 4RTFD 1QE1A 2PY5A 1NGEA 1WSEA 2DTUA 3Q7CA 4BRGA 1U2VA 2ASOA 4AHCA 4U67L 4DFPA 4CGFA 4R5PA 1T6DA 2ZWHA 5JLHA 1B9DA 5FROA 2O8EA 1GOCA 4DU1A 1UOCA 4CHYA 5I3UA 3DYAA 4IDHA 2I7NA 5JVHL 3IS9A 4B3RK 4I6MA 1A5VA 3IRXA 3HOSA 3NGIA 3VA3A 4NYNA 3I8DA 4BQLA 3HP6A 3VEOA 2BANA 2WFBA 3T19A 5FLXO 5HRNA 4DSFA 4F2RA 3ZSRA 1W0HA 3KHYA 4CJQA 4FOEA 4BWMA 1UAXA 1QVFM 2Z1HA 4G1QA 4G9ZA 1D8YA 4FW2A 2P9NA 1K6YA 5AQUA 3VEYA 1WSHA 3SZ2A 4OPAA 1J6ZA 4DR7K 1ASVA 4JKBA 5K14A 2FBYA 1NGIA 3OYDA 4B9UA 4JI2K 4XH5A 4CJVA 4MLEA 5AZIA 3QNNA 4KHYA 2ASMA 4O44A 3BZKA 1LOTB 3THXA 3KK1A 3MDQA 3H3OB 4CEFA 4CBWA 4JI7K 4DKWA 3CCMN 1XQSC 2DFHA 4OGEA 3ZSWA 5AJ3K 3KKSA 5KI6A 3MN6A 3TPQA 3EE9A 2D0OA 3C94A 4BR5A 4DUZK 3PX6A 2OZMA 2W41A 4OLAA 3CF5L 3WEEB 5BN9A 3L6QA 4N76A 2UU9K 1NKCA 2PBDA 4FJLA 5HLFA 3LDLA 5F2RA 2G8WA 4DV2K 2IOCA 1XC9A 3LWLA 3A5MC 3QBWA 3LALA 2ZJRL 4NLBA 3S3MA 4DHYA 1JLAA 1U04A 4EZ9A 5AQOA 4RG8A 3D2EA 4DS4A 1WUAA 4H0PA 2HHUA 3AY9A 4DQSA 4HCCA 1HQUA 3FLCO 4FLXA 4QCLA 2GELA 3N4PA 3T69A 3VQQA 5J2PA 1EXQA 3E1YA 1D5AA 1C0TA 3ZETA 4X65K 3OYFA 1HPZA 4DR4K 4KB0A 2P9LB 5AFUH 4IG0A 4FWOA 3KLHA 3RMCA 4F3OA 4CJPA 1VQON 4LF7K 4GVEA 3D2FB 5J2MA 2HHQA 1JCEA 3LM2A 3HP9A 3ZSZA 1U2VB 3SYZA 1RTHA 1LW2A 3L2QA 3MCPA 3P39A 1HKBA 3N4QA 4MLHA 4RW6A 3V9XA 3VQ7A 1Q81O 1ZBIA 1VQ6N 2O8EB 1YF5L 4H0XB 2FBTA 2F96A 3MN9A 4LFCK 1P90A 3WXIA 4I6MB 3CJAA 4WYBA 3F2KA 3NH1A 4CZKA 4QAGA 2W40A 3HI0A 5AQVA 4PKGA 1XMQK 2WONA 1S72N 4CHQA 4F9OA 1G15A 5E41A 1T05A 4FM1A 1NGAA 2OPQA 2P9NB 3F9KA 3ZSYA 1JXEA 4FWQA 4FJHA 2ITMA 1KLMA 4DSJA 1JL1A 4AM7A 3ZT4A 3UKUA 1WLJA 2CGLA 5AZIB 4FJ5A 3GDQA 5AQKA 3OA9A 1TKZA 4CD3A 3THXB 1BOTO 4E7HA 3VERA 5HOOA 1WNSA 1WBBA 2OPRA 3A5NC 2AJQA 4DR2K 1NJIO 4BGAA 4NCAA 1GLCG 3FGUA 3VQAA 1Z26A 3FFIA 4Z94A 2A6AA 4B1XB 1U45A 3HM9A 3ASMA 2GTDA 3TABA 4Q0BA 3RVCA 3MN5A 4EP5A 3OTOK 3OYKA 5M1OA 4YOWA 3RR7A 1J54A 3OYMA 4DTUA 2G8UA 2QWNA 1BQNA 2KZZA 3D2EB 3M5RA 4X64K 3VF2A 3EYZA 3PIPL 4C8KA 3F9MA 2O4GA 5A2QO 1WSJA 3E9OA 4DTXA 4ZHRA 3NE6A 3TI0A 2PAVA 4FK4A 5TKYA 3ZETB 2QWQA 3DOLA 2IAJA 3FZMA 4RW8A 4CEOA 1XHZA 3FR0A 3LP0A 4JN4A 3V1RA 1EWQA 4YOYA 2G8KA 4B9NA 4OKJA 2Q0RA 4OLBA 3KLFA 1NLVA 3L3VA 4BY9C 3NMUA 1FK9A 3CQXA 1VSJA 3AGRA 3VQ5A 2VQFK 5LMUK 1NM1A 1QZ5A 4FJKA 4LD0A 2Y1JA 3A2FA 4ELVA 3CMAN 1SL2A 4MO4A 5C0YA 1DKGD 4CZIA 4BG8A 4C1NI 4CHZA 3KJVA 4DUYK 3H1VX 3QIPA 4E0DA 1LAVA 1OH6A 3PY8A 2QKBA 2ITGA 4DTJA 5DK5A 2CH6A 3WT0A 3I8BA 5AQTA 3HVRA 5BREA 2PYJA 4HUGA 5HRPA 1SQKA 3ZSQA 3THYA 3HOTA 2E2OA 4ISEA 3JSMA 3RMDA 3ZSVA 2Q97A 2G8IA 1T44A 3U3YA 1N36K 3UKUB 4FSVA 3G10A 1DEJA 3HRGA 1KVAA 4CF8A 1RBUA 2FSNA 2YHBA 1XI1A 3NFAA 4JI0K 4CZJA 4CJ3A 2XO7A 2OYQA 1JL2A 1YVNA 2IC3A 2HVHA 3DJCA 5BPLA 3WNHA 4CZHA 4DQPA 4GMJB 4YFUA 2VG5A 3ULEA 4B9TA 4FJJA 4GW6A 1ZBHA 3CCSN 3CETA 5M1NA 3OYGA 4K43A 3PV8A 5C15A 3SCXA 2YKNA 4RWTA 2EWSA 1C1AA 1HRHA 3BDPA 4CEBA 4Q5VA 3TARA 4IEIA 4FJ7A 1RBTA 3KD1E 1HLUA 1NK4A 1S6QA 3V81A 3HT3A 4IDKA 3SI6A 2O8BA 1BDGA 5HRRA 2XRIA 4BRMA 1RTDA 3CD6N 3F5TA 3D0PA 3U4LA 2P9UB 3C6TA 4HWIA 1RDWX 1LW0A 3QESA 2FSJA 5AQNA 3OBWA 5C2FA 3ZEUA 4K8XA 4BRPA 3TSPA 4FLWA 3L2WA 4W5TA 3ENHA 3T1AA 1GLDG 3O9TA 3H45C 3VOVA 4CJ4A 1VQ5N 4NCGA 4DV1K 3NGZA 2HHHK 4JI4K 4M3YA 1VQKN 4CJWA 1YIJN 3EZWA 3GOIA 2ZQBA 2JWKA 3EKUA 4CEDA 1NOYA 3I0SA 4LF4K 4OKEA 3TTDA 2ZF5O 4BVOA 1GLBG 1NJYA 5KPRA 2RHKA 2O4IA 4K0KK 1N5YA 4WFNL 3MECA 3AA3A 4BR7A 3P83D 3DWLA 4H0OA 3FZFA 3TANA 2H3GX 4CFCA 1TKDA 2NZTA 3BF1A 3AV9A 2NRVA 3VEXA 3KVGA 4PHTX 3I56N 1NMDA 3SQ1A 1RGIA 2X6SA 1KAZA 3LPTA 2UUCK 1JLQA 5LY3A 3RTVA 3VQBA 3ZLJA 5C10A 4KTWA 3KK7A 3D7EO 4U7BA 1VSEA 3THYB 3C6AA 3G25A 1VSLA 4W5OA 4CF2A 5F0XA 4JS4A 5KPTA 4M41A 1K9MO 1NGHA 2E2NA 3AVLA 3CYMA 5ADXH 1ZBLA 4NLCA 2NRXA 4DSIA 2XY5A 3QBXA 3V9WA 1HYZA 3CJ7A 3QEXA 2CGJA 2GV9A 4EP4A 1CXQA 3K57A 3VMFB 5BN8A 2YJFA 2WOMA 1HPMA 3L2VA 3U8XA 5M1FA 3VQDA 2P5OA 3IMXA 4PUOA 4AH9A 1P8ZA 3KWIA 3KD5E 1K8AO 4CD1A 3AVFA 1X9WA 3ULEB 5SZTA 4LH4A 3OYAA 3T1YK 4ICLA 3SAFA 2WUSA 3AAQA 3DOKA 2RN2A 3AVMA 4PY5A 3VN5A 1C6VA 4OKKA 3B8AX 1XNRK 2NUBA 3VETA 3L3UA 2E4LA 3WQTA 4HTUA 1GLLO 3CCVN 3LDNA 3VQ4A 3OYEA 3HSTB 3KZBA 5HROA 2D0PA 2D0CA 4UQGA 2O8BB 1GOBA 1EX4A 4CI6A 3K58A 4B9LA 3GE1A 5LMNK 1OVYA 3AO1A 5AQFA 3EKSA 3BY5A 2WC9A 1RT3A 5IT9O 4B08A 4NXNK 4EZ6A 3AVKA 1V4SA 4DFKA 4KBOA 4E7IA 2D1KA 2HF4A 2ATQA 3ZEUB 1C0UA 3IKMA 4KV8A 4B9QA 3TR8A 3OS1A 4DU4A 3DAWA 3JS6A 4F2SA 2IVPA 3SUNA 3FZHA 3PSIA 4ILHA 4AHSA 5AQWA 5JS1A 4PA1A 2ZGYA 3VGMA 1T8EA 1BI4B 2KHOA 3LDQA 3MCAB 3QETA 5FPNA 2HBKA 3IG1A 4CZEA 4NO7A 1IKXA 1KC8O 3HJFA 1V4TA 4WQ4C 3ISNC 5KRSA 1NBWA 3EN9A 4CJUA 4MO5A 5MLCQ 2ZM6K 4FJIA 3M1FA 5AQSA 3ZT2A 4DQIA 3RR8A 1HYSA 4DV5K 2KLAA 5CZ1A 3S3OA 4JI6K 3V4IA 4CZFA 1FKOA 3CM5A 1HX1A 1NK6A 2IGIA 4BC5A 2E6LA 4O0IA 1KRPA 1IO2A 3WXLA 4JKHA 3CC4N 3RRHA 3EE8A 1KQSM 3I0RA 3WQUA 4DV4K 1T7PA 5BRDA 1CLQA 3A0IX 3VQ9A 3TAGA 4J2AA 3BP8A 2RPIA 3G71N 4FM0A 4JAXA 1QHAA 1W7AA 4M3WA 1TK0A 1S1UA 1T03A 3SMSA 3QFPA 4BREA 4C8NA 3R8EA 4O0JA 2WBNA 1S1TA 4YOVA 2HBMA 4F8RA 3A5LC 4CZGA 3AVAA 4LFAK 1NK0A 4WF9L 4LF8K 4BR0A 3NVKA 4H5VA 4B1ZA 3KWGA 1EKEA 1MA9B 2OZSA 3J7YP 4J8FA 4H0YB 4BQZA 2E1YA 4J2BA 4ZTJA 1NGDA 3R3LA 1TKTA 3ID6A 3K2PA 3PUFA 1TYQA 4BRQA 3EY1A 2I7PA 2QXFA 3HSCA 3J8AA 4O55A 4CECA 4B1UB 3M8PA 3C6HA 4QS9A 4JRPA 1OH7A 3RRGA 5CY4A 5B8HA 5FPEA 4F4KA 3O3GA 4JV5K 1RFQA 1NGCA 3P1GA 5BPMA 3SAGA 2PYLA 4LF5K 1GLJO 3L4IA 1S1WA 4IWVA 3G4SN 4YORA 4LF6K 1NGJA 4CF9A 2Z1GA 4DG1A 1YTAA 3ENOA 3UB5A 3L2UA 1SL1A 3S3NA 1HQEA 1DT9A 2GBZA 2QA4N 4OPHA 3OS2A 4CBXA 1YI2N 1QQOA 4NCBA 3NF8A 2F8TA 4KI6A 2YCHA 4FWMA 1RBRA 3WXKA 3OYJA 3WUHA 1RTJA 1REVA 3NF9A 1FXXA 4CIGA 1VQ9N 2XY7A 3PO4A 5ELZA 3VGKA 3CFPA 3K9KA 1KTQA 1S9EA 4BRIA 4PL8A 5CR4A 2G8HA 1HNVA 2HBLA 3LDOA 1U6ZA 4DQ8A 4IOAL 4YOTA 4LSLA 4IFEA 1OH8A 3SUPA 4HTLA 4GKJK 1S22A 3VA0A 1J5OA 1RT2A 3V1QA 4KHUA 5M1PA 3TSQA 4BRAA 3H46O 4CJLA 4CCHA 1YHQN 1BG3A 4JK7A 4K41A 1DGKN 1K73O 4HVJA 3E9LA 2P9PA 4WFBL 5FRMA 4YNQA 3PSFA 3MX2A 4FWPA 4WCEL 4X66K 4GV6A 4CFAA 4FVUA 3AAPA 1SKRA 4W5RA 1QQMA 4H03B 1ATNA 4JK8A 5BRHA 1SZ2A 4E7KA 4EHTA 1NJXA 4DTNA 2FBXA 1QSSA 4H5WA 3VQCA 2HF3A 4CBUA 1BISA 1Q9YA 5FPMA 3AGKA 2F9WA 3K5OA 1VSDA 1OH5A 4KHSA 2D0BA 2A41A 4BRFA 3OYNA 1L3UA 3AA4A 1FW6A 4AHVA 3UE5A 1TGOA 4ISGA 4E1JA 5H1SQ 1A5WA 4ID1A 1X9SA 4AHTA 4GNIA 1IBKK 3IFRA 4BR9A 4N5SA 3CHWA 1K8KA 3O9QA 1L3SA 1Y97A 4KH5A 3LZIA 4Z4EA 2YNHA 3B6OA 1XMOK 2UXDK 1ATRA 4Y1DA 1WSIA 3QNOA 1N6QA 3MEEA 2GWKA 3ULDA 4A5AA 2W6LA 2KFZA 3OY9A 1BGXT 4AM6A 3M8RA 1VQ4N 1TYQB 3U3GA 3MAQA 2OTLN 1LCUA 3AVHA 3O08A 3DLEA 2YKMA 2AA4A 3KLIA 3C65A 1QQCA 3RMAA 5BRFA 4FWNA 3VPZA 4B1WB 4M3XA 1LAWA 4CGIA 3CQYA 3VEWA 4FJ9A 1WSGA 3CXCM 3O3FA 1HR0K 3C6UA 1BUPA 2A42A 2YNGA 4CHPA 5C42A 1B9FA 4DCHA 1J53A 4TSXA 3KLEA 2O8FA 4HHTA 3S41A 5GIPA 2PFUA 4FJXA 1EO1A 1JLGA 4H4OA 4AF1A 4I7FA 1M90O 3SQ2A 1VQNN 1KCFA 4EAHD 3SBGA 3IAYA 1NWKA 2A5XA 4CEEA 3NH2A 4QS7A 5KRTA 3HPHA 2IIRA 5AQYA 4JKDA 1TUUA 2OPPA 4O5FA 3QMLA 4QS8A 2Q1NA 1BCOA 4DR3K 4GV9A 3G6EN 4PKIA 3PX4A 2OANA 1L3TA 1VK0A 3OYHA 5KGXA 3CM6A 1SL0A 3ALYA 4IFVA 3Q7BA 4HUEA 3V9ZA 4GKKK 2E1ZA 3AA5X 3DXMA 4E89A 3ZT3A 4B3OA 5KQDA 2XY6A 1RILA 4KREA 2ETJA 1I3AA 3OS0A 4BACA 4FPAA 3CJ1A 4IZ9A 2P9PB 2D0AA 2YI1A 4O8KA 1E4GT 4YOXA 1N33K 1VQPN 4I9LA 4H8KA 4DV6K 4EHUA 4M3TA 4DR5K 4CJFA 2IDOA 5M1QA 1KLNA 1Q86O 2VYPA 2GX9A 4BE1A 3DLKA 2FXUA 3RMBA 2VWJA 3QEWA 4W5QA 4M63C 4FLYA 5C2DA 4BC3A 1GLAG 1Q9XA 1WAFA 3U6FA 1LWFA 4CE9A 3HO1A 4JKAA 3R1XA 3LANA 4E7LA 5C24A 1GLFO 1K8KB 4CFDA 3TAEA 2LSNA 1NJWA 4IO9L 4CJKA 1NKBA 1ILYA 1TKXA 3ZSOA 4BRCA 4CGHA 3ZX3A 4DB3A 3NF6A 2J4RA 5HRSA 1N8RO 1JLEA 5E26A 5LJVA 4IJNA 4B3TK 4FXDA 4A59A 3J80O 4DTSA 1NGGA 3BUZB 3W0LA 4JS5A 5CZ2A 1JXBA 2E2QA 3FZLA 5GAEP 3DMJA 4C23A 4WQ4A 3KK3A 3CI5A 3JYTA 4Z4GA 1KFDA 4I2QA 4MDAA 4I2PA 1S9GA 2P9IA 3QEIA 1WOQA 4C8MA 3DLHA 4BG9A 3QINA 5FDLA 1ZC6A 3AVNA 1HKCA 4KTZA 5GINA 4J2EA 1S1VA 3ATUA 2O8FB 2VGNA 2F7TA 2G8VA 3MMVA 3L2RA 1Q18A 1EWRA 4M3ZA 3P4IA 5GAGP 4FJ8A 3BF3A 1M1KO 3LPUA 2HB5A 3LL3A 1B92A 2P9KA 1RT6A 2ZE2A 1VQMN 4HCBA 1HMVA 4CHOA 4KRFA 1YJ9N 3GBTA 1S1XA 5E84A 1WSFA 2F9TA 3CG7A 3EL2A 3OW2M 4CIFA 3TAMA 4DTRA 4FZZA 3OYCA 5C12A 4OJRA 4MQ3A 3P38A 1NK9A 2DFFA 1KD1O 3VQPA 1E4FT 2YHWA 4M45A 5DMRA 3L8BA 4YOUA 4DF8A 1LWCA 2DFEA 5AQQA 3DXMB 3OJSA 1HNIA 4B9SA 5FRNA 2KKZA 2Q2RA 5J1EA 3MN7A 4B8AB 2OTJN 5J2NA 2E8AA 4GV3A 1TAQA 2B5JA 2OCEA 3DLLL 1VSMA 3FZKA 5I9EB 4I9QA 3L4QA 5AQZA 4CJRA 2OPSA 3NH0A 1W9HA 1VRTA 1X9JA 4WE1A 2FLOA 1RT7A 1YUWA 5J2QA 5F1XA 4FYDA 4FLUA 3TTFA 4KB1A 4CHNA 3FFKB 4DV3K 5BR9A 2YX6A 4CJ5A 3VGLA 3MK6A 1ATSA 2A3ZA 1CZAN 4FWKA 2HOEA 3H3NO 4JLHA 3K9JA 3O8MA 1E3MA 1I39A 2ZD1A 1IG8A 3QB0A 3HPGA 1JLBA 1G99A 2KQ2A 4HUFA 3BZCA 3HBTA 5AQGA 4KHQA 3JAMO 1RT1A 1R0AA 4L3QA 4BROA 4Y0WA 5EOYA 4BC4A 2VCPA 4DFJA 3SPZA 3M6GA 3NGYA 1O1WA 4E3SA 4KO0A 4B1VA 4CFBA 3SJJA 2A1SA 3HM8A 4FW1A 4ELUA 2P5GA 2HBJA 2Q0UA 3SQ0A 1NU0A 1DTQA 2Z1JA 1C1BA 1Y64A 2VGMA 3CJ9A 5GIOA 3WNGA 1TK5A 1YVUA 2P9IB 5KTQA 4C8OA 2HHVA 2KZMA 3QEPA 1U4BA 1D9DA 1KFSA 4IOXA 1KVBA 3BEXA 3HPOA 3SAHA 1RDUA 1ZXOA 5JS2A 3TAPA 3SLCA 4AHUA 3SUQA 1MWKA 1Q82O 2GEMA 1BHLA 4KPYA 2P9KB 2QWMA 4RW9A 1VAZA 2UUBK 3HTVA 1VQLN 3CCRN 4ISFA 2UYTA 3O4WA 4CZMA 4O8UA 5CE3A 4KTQA 2QWLA 4A62A 3WXJA 4V19S 3KIOA 4FO0A 3DRPA 3B6PA 2QWPA 3AO4A 4RW4A 4AHRA 1OVQA 4RCHA 1U49A 4CJTA 2NNWA 2QW9A 3SNNA 4N41A 3M8QA 3DRRA 2GUPA 3TSUA 1HJRA 4A61A 4CF1A 1IKVA 3DLRA 3KLGA 4DSKA 2BGGA 3VQ8A 1BA0A 3TAFA 5CYMA 1X3NA 2V7ZA 2KFNA 3ZT1A 2P1JA 3DXKA 2F4VK 4IBNA 4DR6K 2NRWA 4Z4CA 1U47A 4FWRA 3T3FA 5EY4A 2AP1A 1XC3A 4GY2B 3F73A 4C8LA 3O9RA 5DM6L 4M3UA 4JRQA 3TWHA 1O13A 3D2FA 4IJAA 2BDPA 4OVLA 1BU6O 1TAUA 4DTMA 1LV5A 3LAMA 3W3DA 4IKFA 3HK2A 1XUPO 4ID5A 3NHGA 1C1CA 3VESA 4EFHA 4L8RB 3GG4A 1S6PA 3AVCA 4FVMA 3WXMB 4M7YA 4KH6A 5AR0A 4DWIA 4MFBA 5AQHA 1X3MA 3LM9A 1JCGA 4N47A
chains in the Genus database with same CATH topology
3CJBA 4NB4A 3TTCA 3HOTA 5TKWA 4JD2B 3UE5A 4FWLA 5H1SQ 4ISGA 2E2OA 4E1JA 4ISEA 3L0QA 4CJ7A 3SK3A 4GNIA 2Q97A 3IFRA 4BR9A 3CHWA 4UY8O 3SJHA 1K8KA 1T44A 3O9QA 4R79A 2Q36A 4FWSA 3O9UA 4WQ5C 2IVNA 4KH5A 3UKUB 4FSVA 2ZJQL 5JICA 3T7ZA 3VTHA 4BC2A 3ATVA 1DEJA 3HRGA 3O5BA 4ILGB 1ATRA 2FSNA 3SMPA 5AQLA 4CZJA 3CERA 3NVMA 4KH4A 2GWKA 3IUCA 3R9PA 4A5AA 1HUXA 2E88A 4AM6A 1YVNA 4BRNA 2QI2A 3DJCA 4K42A 5BPLA 1TYQB 4CZHA 1VQ4N 2OTLN 4BRLA 3H1QA 3ULEA 1LCUA 3O08A 5AQMA 4IO8A 3IDHA 3CCSN 2AA4A 3CETA 3C65A 5M1NA 5M1KA 3VEVA 4K43A 1R59O 5BRFA 4FWNA 1C0FA 3VPZA 5C15A 4B1WB 4RWTA 3CMEN 3CQYA 2EWSA 2QXLA 1H1VA 3VEWA 5FPDA 3CXCM 2P9SA 2ZGZA 1BUPA 4A2AA 2A42A 3CC2N 4IOCL 5CHIA 4OO1J 4IEIA 3JXUA 2QWRA 4DCHA 1HLUA 4A57A 3S41A 5GIPA 2BH1A 2PFUA 4JHDA 3WEEA 1YXQA 1EO1A 5AQIA 4BRDA 4K25A 1Z05A 4AF1A 3R6MA 1SAZA 1MDUB 1M90O 4A2BA 2BUPA 3MWTA 5EVZA 1W97L 1BDGA 5AQJA 3RSEA 1VQNN 4EAHD 3SBGA 4IEEA 4BRMA 1NWKA 2A5XA 3CD6N 1YJWN 1GLEG 3F5TA 4CZLA 3U4LA 2A40A 2NRZA 2P9UB 5GAHP 3ZYYX 3I55N 4HWIA 1RDWX 4QS7A 1QQNA 3A8YA 4JEPA 3CCEN 2FSJA 2IIRA 5AQNA 1ESVA 3A5OC 1BWFO 3OBWA 4JKGA 4JKDA 5AQYA 5AFUA 1TUUA 3MWPA 3ZEUA 5C2FA 5DM7L 5KQ8A 5JVGL 4BRPA 3E9PA 3TSPA 4O5FA 3QMLA 4QS8A 1T6CA 1QVGM 5AQPA 2Q1NA 4MDBA 3VEZA 4C1NK 4GV9A 1MWMA 3G6EN 4PKIA 1BO5O 3ENHA 1HJOA 2OANA 2HSTA 4YDUA 1GLDG 3O9TA 3H45C 3VOVA 3Q7BA 2QM1A 3OBYA 4FPBA 2E1ZA 3DXMA 1VQ5N 1JCFA 2P9LA 5AZJB 4BR4A 1X3MA 2QTDA 4A5BA 1VQKN 1YIJN 5KQDA 3DXKB 3EZWA 3GOIA 4RTFD 2NRTA 2JWKA 3EKUA 5BPNA 4WFAL 3O1WA 3TTDA 2ZF5O 4FPAA 4BVOA 3VF6A 1GLBG 1NGEA 5KPRA 3CJ1A 4IZ9A 2RHKA 3Q7CA 4BRGA 2P9PB 1U2VA 4WFNL 5HL7L 2ASOA 4JKEA 2YI1A 4O8KA 4BR7A 3DWLA 1E4GT 4U67L 4H0OA 3FZFA 4YOXA 2H3GX 1VQPN 1T6DA 2ZWHA 3P31A 4EHUA 2NZTA 3BF1A 5JLHA 2NRVA 3VEXA 3KVGA 4PHTX 3I56N 1SQKA 5M1QA 1NMDA 1Q86O 2VYPA 1RGIA 2GX9A 4IDHA 1YAGA 1KAZA 3HZ6A 5AQXA 2I7NA 2FXUA 5JVHL 5LY3A 5C10A 3CPEA 4I6MA 4M63C 5KPZA 3KK7A 3D7EO 5C2DA 4BC3A 4U7BA 1GLAG 3HOSA 4BQLA 1HKGA 3C6AA 3VEOA 2WFBA 1W2BM 3G25A 2FF6A 3KHYA 4FOEA 5F0XA 5KPTA 1QVFM 3I33A 1K9MO 1NGHA 4JKAA 4G9ZA 2E2NA 1SS6A 3R1XA 2Q31A 1GLFO 5ADXH 1K8KB 3C0BA 4BRKA 3ID8A 4NLCA 3PLAA 2P9NA 2NRXA 3QBXA 1S3XA 5AQUA 3O9SA 3CJ7A 3VEYA 4OPAA 1J6ZA 4IO9L 2CGJA 2FSKA 4JKBA 5AQRA 3VMFB 5BN8A 1Q7YO 2JWLA 1ILYA 2YJFA 1NGIA 1HPMA 4H0VB 3U8XA 4XH5A 4BRCA 5M1FA 3ZX3A 4DB3A 3CCLN 4MLEA 5AZIA 3IMXA 2J4RA 2ASMA 1N8RO 5E26A 5LJVA 1P8ZA 3KWIA 4IJNA 1K8AO 1LOTB 4A59A 4CD1A 1NGGA 3BUZB 3MDQA 4BVPA 3ULEB 3W0LA 3H3OB 2E2QA 3FZLA 4CBWA 5GAEP 4C23A 2D4WA 1C0GA 4WQ4A 4DKWA 3CCMN 1XQSC 3CI5A 1YITN 4XEIA 4MDAA 2HMPA 3SAFA 2WUSA 2P9IA 3AAQA 3MN6A 3TPQA 1VQ7N 3EE9A 2ZJPL 2D0OA 1WOQA 2P9SB 4BR5A 4BG9A 3QDKA 3B8AX 1ZC6A 4H5TA 3VETA 1HKCA 2W41A 5GINA 3ATUA 3WQTA 2VGNA 1GLLO 2F7TA 3LDNA 3CCVN 3CF5L 4JHDB 3WEEB 5BN9A 3FE1A 3MMVA 3L6QA 1YI2N 3KZBA 1Q18A 2NRRA 2D0PA 3CC7N 4BRHA 2PBDA 3P4IA 5GAGP 3BF3A 3RSEB 4CI6A 1M1KO 3LDLA 3GE1A 5F2RA 3LL3A 2P9KA 1OVYA 5AQFA 1VQMN 3EKSA 3A5MC 3QBWA 2WC9A 4XH1A 1YJ9N 3TU5A 3GBTA 2ZJRL 5E84A 4NLBA 4PKHA 4BR2A 2F9TA 1V4SA 4DHYA 3EL2A 3OW2M 1NGFA 4KBOA 2E2PA 5C12A 5AQOA 3D2EA 2D1KA 2HF4A 3AARA 3P38A 4JKGB 4FL9A 3ZEUB 1WUAA 1KXPA 4H0PA 1KD1O 3IKMA 3AY9A 1E4FT 4JK9A 4H0TB 4B9QA 2YHWA 2P9UA 3FLCO 3SBTA 1ZBSA 2GELA 3E66A 3N4PA 4YOUA 3DAWA 3T69A 3JS6A 3E1YA 2IVPA 3ZETA 4WQ5A 3FZHA 5AQQA 3DXMB 2QWOA 5JLFA 2P9LB 2KKZA 2Q2RA 5AFUH 3MN7A 4ILHA 4JNEA 5AQWA 5JMVA 2OTJN 3J7ZO 2ZGYA 3VGMA 1YJNN 2E8AA 1T3VA 2KHOA 4FWOA 3VTIA 4GV3A 3DLLL 3FZKA 3EO3A 3LDQA 3MCAB 5EXWA 5I9EB 3L4QA 5AQZA 5FPNA 2HBKA 2VWBA 2YHYA 1VQON 4CZEA 1JJ2M 4GVEA 4NO7A 3D2FB 1X9JA 1KC8O 1JCEA 1V4TA 3LM2A 4WQ4C 2FLOA 3QFUA 1U2VB 1YUWA 3UKRA 1NBWA 4H5NA 2ASPA 3C7NA 3EN9A 3MCPA 3P39A 1HKBA 3N4QA 1NGBA 4MO5A 4MLHA 4B1YB 5F1XA 5MLCQ 3LDPA 1Q81O 1VQ8N 3M1FA 3TTFA 5AQSA 1VQ6N 1YF5L 2KLAA 3FFKB 3CPWM 4CZFA 1HX1A 4BC5A 4H0XB 5BR9A 2YX6A 3MN9A 1P90A 3WXLA 4JKHA 3CIPA 3WXIA 3CC4N 4I6MB 2DPNA 3EE8A 3CJAA 3MK6A 3VGLA 1KQSM 4WYBA 3F2KA 4JKFA 3WQUA 1ATSA 5BRDA 2A3ZA 4CZKA 3A0IX 1CZAN 2W40A 3HI0A 4FWKA 2HOEA 3H3NO 5AQVA 3BP8A 3U9DA 4PKGA 3G71N 3K9JA 1KAXA 4JAXA 4H5RA 3O8MA 1QHAA 1S72N 4F9OA 1IG8A 3SMSA 3QB0A 3QFPA 1NGAA 4BREA 1G99A 4JD2A 2P9NB 3HBTA 5AQGA 2GWJA 3R8EA 2WBNA 4L3QA 4BROA 4Y0WA 5EOYA 4BC4A 4FWQA 2VCPA 2ITMA 4YOVA 2HBMA 4YDUC 3A5LC 3M6GA 4CZGA 4AM7A 1TUYA 3UKUA 4B1VA 2CGLA 5AZIB 3GDQA 2NRHA 4BR0A 4WF9L 2CGKA 3O6WA 5AQKA 3OA9A 3NVKA 4H5VA 4CD3A 4B1ZA 3KWGA 3HM8A 1MA9B 3VENA 1BOTO 4XH4A 3VERA 4J8FA 1EQYA 4H0YB 2HBJA 5HOOA 4BQZA 2Q0UA 3A5NC 2E1YA 1NGDA 4ILJA 3CCUN 1NJIO 3R3LA 3U9ZA 4BGAA 3ID6A 2VGMA 1Y64A 1TYQA 1GLCG 4BRQA 3FGUA 2QEXN 3CJ9A 2I7PA 5GIOA 3HSCA 4Z94A 2A6AA 4B1XB 2P9IB 3J8AA 4B1UB 3MX5A 1QZ6A 3C6HA 3GL1A 3O80A 4QS9A 5GADP 5B8HA 5FPEA 2GTDA 4IOXA 1RFQA 3BEXA 2V51B 3RVCA 3MN5A 1NGCA 5BPMA 3SAGA 2BTFA 3SAHA 1GLJO 3L4IA 1RDUA 1Z6RA 1ZXOA 4IWVA 3G4SN 3SLCA 2E20A 4YORA 1NGJA 1MWKA 2FF3B 5M1OA 2CH5A 4YOWA 3CCQN 3CJCA 1Q82O 2GEMA 3ENOA 3UB5A 3D6RA 2P9KB 2QWMA 3O1BA 3ZX2A 1VAZA 1DT9A 2QA4N 3HTVA 1VQLN 3CCRN 5EX5A 4ISFA 4FOIA 4OPHA 2UYTA 3O4WA 1QQOA 2QWNA 3M3ZA 3QICA 4O8UA 4CBXA 4CZMA 5CE3A 2YCHA 4FWMA 2QWLA 3D2EB 3CCJN 3M5RA 4A62A 3WXKA 3VF4A 3WXJA 3WUHA 3VF2A 3ZX0A 3PIPL 3F9MA 1VQ9N 4FO0A 3E9OA 1IJJA 5ELZA 2NLXA 3VGKA 2QWPA 3OHRA 3K9KA 2PAVA 4EIAA 3PIOL 4BRIA 4RCHA 5TKYA 4PL8A 3ZETB 2NNWA 2QW9A 5CR4A 2HBLA 3LDOA 2QWQA 2V52B 4IXCA 3FZMA 1U6ZA 2YJEA 3FR0A 4JN4A 4DQ8A 2GUPA 3TSUA 4IOAL 4YOTA 4A61A 5LJWA 4IFEA 4YOYA 4HTLA 3H6EA 4M7XA 1S22A 1BA0A 2Q0RA 5AZJA 5M1PA 1NLVA 3TSQA 1X3NA 2V7ZA 3H46O 4BRAA 4BY9C 3NMUA 3CQXA 3AGRA 3DXKA 4BGBA 2NRWA 1KAYA 3UKRB 1OKJA 4FWRA 1YHQN 3C7NB 5EY4A 1BG3A 1NM1A 2AP1A 1XC3A 4GY2B 4JK7A 1QZ5A 4K41A 1DGKN 1K73O 3O9RA 1BA1A 3E9LA 2P9PA 5DM6L 4WFBL 4JKCA 1O13A 3D2FA 2V7YA 4IJAA 3CMAN 1BU6O 4MO4A 5C0YA 1DKGD 3MX2A 4FWPA 4CZIA 4WCEL 4BG8A 4GV6A 4FVUA 4C1NI 3AAPA 3W3DA 1QQMA 2RE2A 4H03B 1XUPO 3H1VX 2IVOA 1ATNA 4JK8A 5BRHA 1SZ2A 2YHXA 4LC9B 3VESA 4EHTA 1D4XA 4EFHA 4PL7A 2CH6A 3GG4A 3WXMB 3WT0A 3I8BA 4H5WA 5ADXA 5AQTA 3ENBA 2HF3A 5BREA 4M7YA 4CBUA 4KH6A 5FPMA 3AGKA 2F9WA 5AR0A 5AQHA 2A41A 3LM9A 4BRFA 1JCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE9 A;  3P38 A;  4OPH A;  2RHK A;  3L4Q A;  3EE8 A;  3KWI A;  3M5R A;  3O9Q A;  3O9T A;  3OA9 A;  3P31 A;  3O9U A;  3RVC A;  3KWG A;  3P39 A;  3F5T A;  2GX9 A;  3O9S A;  4OPA A;  2KKZ A;  3D6R A;  3O9R A; 
#chains in the Genus database with same CATH topology
 3CJB A;  2OA8 A;  2Y1I A;  4FWL A;  3L0Q A;  4CJ7 A;  4DLG A;  1QS4 A;  2X6N A;  4CJS A;  2VQE K;  4UY8 O;  2FBV A;  2D5R A;  1WBD A;  4R79 A;  2Q36 A;  4FWS A;  3VQ6 A;  3E01 A;  1NG9 A;  2IVN A;  5JIC A;  3T7Z A;  4BC2 A;  3O5B A;  4ILG B;  3J81 O;  1TK8 A;  1TV6 A;  3CER A;  3NVM A;  4KH4 A;  1UA1 A;  4ELT A;  4LF9 K;  3IUC A;  3R9P A;  2HHW A;  4BRN A;  4OX9 K;  5IWA K;  4K42 A;  3EZ5 A;  1HNX K;  2Z1I A;  4JYA K;  2B6A A;  4IO8 A;  4CW7 B;  2HMI A;  2I5J A;  1VSH A;  1RCH A;  5M1K A;  2B4J A;  3VEV A;  4YHH K;  5CYQ A;  2A1R A;  4H4M A;  1RBV A;  1C0F A;  4OGC A;  3V9U A;  2FC0 A;  3CME N;  5FPD A;  2QK9 A;  2P9S A;  2ZGZ A;  4A2A A;  1EET A;  3TAQ A;  1TL3 A;  3ZSX A;  1NK5 A;  4IOC L;  1QTM A;  3CC2 N;  4O5B A;  4FLT A;  3HYF A;  3JXU A;  2QWR A;  4FLV A;  1BL3 A;  4JHD A;  1YXQ A;  5AQI A;  2UUA K;  2YNI A;  2Q3S A;  2VG6 A;  1MDU B;  4A2B A;  4M3R A;  3MWT A;  1BCM A;  3RSE A;  3NAE A;  4IEE A;  3K59 A;  3OYI A;  3EEQ A;  3QEV A;  4FZY A;  4CZL A;  4DMN A;  1UA0 A;  1NK8 A;  2A40 A;  4CEZ A;  1QQN A;  3A8Y A;  1WAJ A;  3A5O C;  1BWF O;  4JKG A;  5AFU A;  5DM7 L;  5KQ8 A;  3NDK A;  4BWJ A;  1T6C A;  1L5U A;  4CGJ A;  3VEZ A;  3ZCM A;  4C1N K;  1MWM A;  1WN7 A;  2XY8 A;  4JI1 K;  2HST A;  4YDU A;  5BR8 K;  3CFR A;  4KKO A;  1J5E K;  3J7A P;  2O8D A;  1RDC A;  3OBY A;  1Q8I A;  4BR4 A;  3K5N A;  4A5B A;  3KTQ A;  1TL1 A;  4IFY A;  3DXK B;  2NRT A;  4WFA L;  5BPN A;  4AQY K;  1IV0 A;  3O1W A;  4NXM K;  4LH5 A;  1ZYQ A;  3VF6 A;  3WNE A;  2BE2 A;  5HL7 L;  1I94 K;  4JKE A;  3SQ4 A;  2YNF A;  3P31 A;  2O8C A;  4DU3 A;  1EP4 A;  3NF7 A;  2VG7 A;  1YAG A;  3HZ6 A;  5AQX A;  4B9V A;  3AVG A;  3LDS A;  3CPE A;  5KPZ A;  1SKS A;  4LSN A;  3UIQ A;  4QOZ B;  4DQQ A;  1HKG A;  1W2B M;  4DTP A;  2FF6 A;  2EX3 A;  1NJZ A;  3H08 A;  3I33 A;  1SS6 A;  4F3T A;  2Q31 A;  4BRK A;  3C0B A;  3ID8 A;  4Z0U A;  3PLA A;  1RDD A;  1S3X A;  3O9S A;  3BGR A;  2FSK A;  5AQR A;  1Q7Y O;  2JWL A;  2X74 A;  1F21 A;  1JKH A;  4H0V B;  3CCL N;  1CZ9 A;  4O4G A;  1C0M A;  1ASW A;  1J9A A;  1JLC A;  4BVP A;  2YV0 X;  4DS5 A;  1DTT A;  3D45 A;  3AA2 A;  2D4W A;  1C0G A;  2X78 A;  1YIT N;  4XEI A;  2HMP A;  3S9H A;  1YT3 A;  1VQ7 N;  2ZJP L;  3AO2 A;  2P9S B;  4KHW A;  3RWU A;  3DLB A;  1ZBF A;  2HVI A;  3QDK A;  4H5T A;  3K0S A;  5LL6 Z;  4FZX C;  4JHD B;  3FE1 A;  1RT4 A;  2NRR A;  4CEA A;  3CC7 N;  4BRH A;  3OYB A;  3DI6 A;  3MXJ A;  4KAZ A;  5D3G A;  3RSE B;  1JLF A;  4DLE A;  2DY4 A;  4FCY A;  1IBM K;  4XH1 A;  3ITH A;  2F8S A;  3TU5 A;  3C95 A;  1RBS A;  4PKH A;  4BR2 A;  1NGF A;  2E2P A;  4X62 K;  2KW4 A;  3AAR A;  4CIE A;  4JKG B;  2WTU A;  4FL9 A;  1KXP A;  4LY7 A;  1SKW A;  4JK9 A;  2JLE A;  4H0T B;  1TVR A;  1UWB A;  2P9U A;  4RW7 A;  3SBT A;  1ZBS A;  1XHX A;  3E66 A;  4Z4H A;  1N32 K;  2JGU A;  4CK2 A;  4FJN A;  4Z4F A;  2KTQ A;  4WQ5 A;  2O8D B;  1XWL A;  2QWO A;  5JLF A;  1YTU A;  4JNE A;  1ZBU A;  5JMV A;  1KVC A;  3P5J A;  1X1P A;  3J7Z O;  1YJN N;  2RF2 A;  3VTI A;  1T3V A;  3MED A;  5EXW A;  3EO3 A;  4FJG A;  4E1N A;  2YHY A;  2VWB A;  1JJ2 M;  3QLH A;  3QFU A;  3SPY A;  3UKR A;  4H5N A;  2ASP A;  3C7N A;  3SV3 A;  3SV4 A;  4B1Y B;  1QSL A;  1NGB A;  1VQ8 N;  3LDP A;  1ITG A;  2O8C B;  1MU2 A;  4NYF A;  2HHT A;  3CPW M;  3NBP A;  1BQM A;  4DSL A;  4DFM A;  2GUI A;  3CIP A;  2DPN A;  3DRS A;  4DV7 K;  1CXU A;  4JKF A;  4JI8 K;  2UXB K;  3O4N A;  1IG9 A;  4J2D A;  3U9D A;  3ZT0 A;  1KAX A;  4H5R A;  1XNQ K;  2HW3 A;  3SUO A;  3LP2 A;  2RKI A;  1VHX A;  4CGD A;  4FK2 A;  4JD2 A;  4AIL C;  2GWJ A;  4CJE A;  1IKW A;  4B3M K;  1NMN A;  4LFB K;  5HBM A;  4YDU C;  1RT5 A;  3OJU A;  1TUY A;  1VSF A;  1SV5 A;  3O4Q A;  2NRH A;  2CGK A;  3O6W A;  3VEN A;  4YY3 K;  4XH4 A;  3DLG A;  1EQY A;  2HNZ A;  3OVN A;  4CGG A;  4ILJ A;  3CCU N;  3U9Z A;  4K8Z A;  2IS3 A;  4Y1C A;  2QEX N;  3LWM A;  2PZS A;  2HND A;  4FM2 A;  1SUQ A;  3MX5 A;  1QZ6 A;  5SWM A;  3GL1 A;  3O80 A;  5GAD P;  3K5M A;  3MXM A;  4GVM A;  2V51 B;  1QSY A;  2G8F A;  2BTF A;  3K5L A;  1Z6R A;  4KFB A;  4N56 A;  1RTI A;  2E20 A;  2FF3 B;  2CH5 A;  3CCQ N;  3CJC A;  3D6R A;  1U48 A;  3O1B A;  3AVJ A;  3ZX2 A;  3KK2 A;  3M8S A;  5EX5 A;  4FOI A;  4CF0 A;  3V6D A;  3QIC A;  3M3Z A;  4PWD A;  3CCJ N;  3VF4 A;  5C25 A;  4KHP K;  3ZX0 A;  4E19 A;  1IJJ A;  2NLX A;  1D9F A;  3THV A;  3OHR A;  1S5J A;  4EIA A;  3CFO A;  2W6K A;  3PIO L;  3AO5 A;  3QER A;  1NOZ A;  1RDA A;  4XIU A;  4E1M A;  1RNH A;  1A5X A;  2V52 B;  3LAK A;  4IXC A;  1QHT A;  2W42 A;  4FLZ A;  4ZTF A;  2YJE A;  3T1H K;  4DTO A;  2YHA A;  4KHN A;  5LJW A;  3H6E A;  5I42 A;  4M7X A;  1L3V A;  4BE2 A;  4BDP A;  4W5N A;  5HP1 A;  5AZJ A;  3THW A;  2HNY A;  4BGB A;  1KAY A;  1IH7 A;  3UKR B;  1NNE A;  1OKJ A;  3C7N B;  2UXC K;  1BI4 A;  1HNZ K;  2P51 A;  1FKP A;  1NKE A;  1HYV A;  1BA1 A;  4B8C A;  4CES A;  1LWE A;  4JKC A;  1KSP A;  2V7Y A;  4CK1 A;  1X9M A;  5EU7 A;  3LZJ A;  4JI3 K;  2RE2 A;  3PO5 A;  1VRU A;  1Z25 A;  2IVO A;  2YHX A;  4LC9 B;  1D4X A;  4PL7 A;  2HHS A;  3MXI A;  1N34 K;  4DR1 K;  3AVB A;  5ADX A;  3ENB A;  3G0Z A;  4DV0 K;  4OPK A;  3LP1 A;  2XHB A;  3PX0 A;  3TTC A;  4NB4 A;  1DLO A;  5TKW A;  4JD2 B;  1VSK A;  4CEQ A;  4E7J A;  3SK3 A;  5KGW A;  1BIU A;  1RDB A;  3KKR A;  3SJH A;  3O9U A;  4WQ5 C;  2QKK A;  2ZJQ L;  3VTH A;  3OYL A;  3ATV A;  4JI5 K;  4IG3 A;  3DM2 A;  3SMP A;  5AQL A;  3AO3 A;  2E6M A;  1ASU A;  1HUX A;  2E88 A;  4CER A;  3CQ8 A;  2HHX A;  2QI2 A;  3O3H A;  1HNW K;  1WB9 A;  4CVN E;  4BRL A;  3H1Q A;  5AQM A;  2EHG A;  3IDH A;  1IBL K;  4FK0 A;  1R59 O;  1FJG K;  2QXL A;  1H1V A;  3QIO A;  3HL8 A;  3AVI A;  1NK7 A;  3V1O A;  5CHI A;  4OO1 J;  4DSE A;  3WNF A;  2E5L K;  4A57 A;  2R7Y A;  2BH1 A;  2VWK A;  1CZB A;  3WEE A;  4DF4 A;  4BRD A;  4K25 A;  1IKY A;  1Z05 A;  1BIZ A;  3R6M A;  1SAZ A;  2BUP A;  3VQE A;  3HXM A;  5EVZ A;  1W97 L;  4KI4 A;  5AQJ A;  4B3S K;  1VSI A;  3NCI A;  1YJW N;  1GLE G;  2NRZ A;  5GAH P;  3ZYY X;  3I55 N;  4M42 A;  4JEP A;  3CCE N;  4FJM A;  3QO9 A;  3HVT A;  1ESV A;  4BDZ A;  3MWP A;  5JVG L;  4BE0 A;  4Z4I A;  4B9M A;  3E9P A;  3MEG A;  1QVG M;  5AQP A;  4MDB A;  3LP3 A;  3V9S A;  1BO5 O;  1GOA A;  1HJO A;  4CK3 A;  2QM1 A;  4FPB A;  4OPJ A;  1JCF A;  2P9L A;  5AZJ B;  5T7B A;  4DQR A;  2QTD A;  4BDY A;  3THW B;  4PQU A;  4RTF D;  1QE1 A;  2PY5 A;  1NGE A;  1WSE A;  2DTU A;  3Q7C A;  4BRG A;  1U2V A;  2ASO A;  4AHC A;  4U67 L;  4DFP A;  4CGF A;  4R5P A;  1T6D A;  2ZWH A;  5JLH A;  1B9D A;  5FRO A;  2O8E A;  1GOC A;  4DU1 A;  1UOC A;  4CHY A;  5I3U A;  3DYA A;  4IDH A;  2I7N A;  5JVH L;  3IS9 A;  4B3R K;  4I6M A;  1A5V A;  3IRX A;  3HOS A;  3NGI A;  3VA3 A;  4NYN A;  3I8D A;  4BQL A;  3HP6 A;  3VEO A;  2BAN A;  2WFB A;  3T19 A;  5FLX O;  5HRN A;  4DSF A;  4F2R A;  3ZSR A;  1W0H A;  3KHY A;  4CJQ A;  4FOE A;  4BWM A;  1UAX A;  1QVF M;  2Z1H A;  4G1Q A;  4G9Z A;  1D8Y A;  4FW2 A;  2P9N A;  1K6Y A;  5AQU A;  3VEY A;  1WSH A;  3SZ2 A;  4OPA A;  1J6Z A;  4DR7 K;  1ASV A;  4JKB A;  5K14 A;  2FBY A;  1NGI A;  3OYD A;  4B9U A;  4JI2 K;  4XH5 A;  4CJV A;  4MLE A;  5AZI A;  3QNN A;  4KHY A;  2ASM A;  4O44 A;  3BZK A;  1LOT B;  3THX A;  3KK1 A;  3MDQ A;  3H3O B;  4CEF A;  4CBW A;  4JI7 K;  4DKW A;  3CCM N;  1XQS C;  2DFH A;  4OGE A;  3ZSW A;  5AJ3 K;  3KKS A;  5KI6 A;  3MN6 A;  3TPQ A;  3EE9 A;  2D0O A;  3C94 A;  4BR5 A;  4DUZ K;  3PX6 A;  2OZM A;  2W41 A;  4OLA A;  3CF5 L;  3WEE B;  5BN9 A;  3L6Q A;  4N76 A;  2UU9 K;  1NKC A;  2PBD A;  4FJL A;  5HLF A;  3LDL A;  5F2R A;  2G8W A;  4DV2 K;  2IOC A;  1XC9 A;  3LWL A;  3A5M C;  3QBW A;  3LAL A;  2ZJR L;  4NLB A;  3S3M A;  4DHY A;  1JLA A;  1U04 A;  4EZ9 A;  5AQO A;  4RG8 A;  3D2E A;  4DS4 A;  1WUA A;  4H0P A;  2HHU A;  3AY9 A;  4DQS A;  4HCC A;  1HQU A;  3FLC O;  4FLX A;  4QCL A;  2GEL A;  3N4P A;  3T69 A;  3VQQ A;  5J2P A;  1EXQ A;  3E1Y A;  1D5A A;  1C0T A;  3ZET A;  4X65 K;  3OYF A;  1HPZ A;  4DR4 K;  4KB0 A;  2P9L B;  5AFU H;  4IG0 A;  4FWO A;  3KLH A;  3RMC A;  4F3O A;  4CJP A;  1VQO N;  4LF7 K;  4GVE A;  3D2F B;  5J2M A;  2HHQ A;  1JCE A;  3LM2 A;  3HP9 A;  3ZSZ A;  1U2V B;  3SYZ A;  1RTH A;  1LW2 A;  3L2Q A;  3MCP A;  3P39 A;  1HKB A;  3N4Q A;  4MLH A;  4RW6 A;  3V9X A;  3VQ7 A;  1Q81 O;  1ZBI A;  1VQ6 N;  2O8E B;  1YF5 L;  4H0X B;  2FBT A;  2F96 A;  3MN9 A;  4LFC K;  1P90 A;  3WXI A;  4I6M B;  3CJA A;  4WYB A;  3F2K A;  3NH1 A;  4CZK A;  4QAG A;  2W40 A;  3HI0 A;  5AQV A;  4PKG A;  1XMQ K;  2WON A;  1S72 N;  4CHQ A;  4F9O A;  1G15 A;  5E41 A;  1T05 A;  4FM1 A;  1NGA A;  2OPQ A;  2P9N B;  3F9K A;  3ZSY A;  1JXE A;  4FWQ A;  4FJH A;  2ITM A;  1KLM A;  4DSJ A;  1JL1 A;  4AM7 A;  3ZT4 A;  3UKU A;  1WLJ A;  2CGL A;  5AZI B;  4FJ5 A;  3GDQ A;  5AQK A;  3OA9 A;  1TKZ A;  4CD3 A;  3THX B;  1BOT O;  4E7H A;  3VER A;  5HOO A;  1WNS A;  1WBB A;  2OPR A;  3A5N C;  2AJQ A;  4DR2 K;  1NJI O;  4BGA A;  4NCA A;  1GLC G;  3FGU A;  3VQA A;  1Z26 A;  3FFI A;  4Z94 A;  2A6A A;  4B1X B;  1U45 A;  3HM9 A;  3ASM A;  2GTD A;  3TAB A;  4Q0B A;  3RVC A;  3MN5 A;  4EP5 A;  3OTO K;  3OYK A;  5M1O A;  4YOW A;  3RR7 A;  1J54 A;  3OYM A;  4DTU A;  2G8U A;  2QWN A;  1BQN A;  2KZZ A;  3D2E B;  3M5R A;  4X64 K;  3VF2 A;  3EYZ A;  3PIP L;  4C8K A;  3F9M A;  2O4G A;  5A2Q O;  1WSJ A;  3E9O A;  4DTX A;  4ZHR A;  3NE6 A;  3TI0 A;  2PAV A;  4FK4 A;  5TKY A;  3ZET B;  2QWQ A;  3DOL A;  2IAJ A;  3FZM A;  4RW8 A;  4CEO A;  1XHZ A;  3FR0 A;  3LP0 A;  4JN4 A;  3V1R A;  1EWQ A;  4YOY A;  2G8K A;  4B9N A;  4OKJ A;  2Q0R A;  4OLB A;  3KLF A;  1NLV A;  3L3V A;  4BY9 C;  3NMU A;  1FK9 A;  3CQX A;  1VSJ A;  3AGR A;  3VQ5 A;  2VQF K;  5LMU K;  1NM1 A;  1QZ5 A;  4FJK A;  4LD0 A;  2Y1J A;  3A2F A;  4ELV A;  3CMA N;  1SL2 A;  4MO4 A;  5C0Y A;  1DKG D;  4CZI A;  4BG8 A;  4C1N I;  4CHZ A;  3KJV A;  4DUY K;  3H1V X;  3QIP A;  4E0D A;  1LAV A;  1OH6 A;  3PY8 A;  2QKB A;  2ITG A;  4DTJ A;  5DK5 A;  2CH6 A;  3WT0 A;  3I8B A;  5AQT A;  3HVR A;  5BRE A;  2PYJ A;  4HUG A;  5HRP A;  1SQK A;  3ZSQ A;  3THY A;  3HOT A;  2E2O A;  4ISE A;  3JSM A;  3RMD A;  3ZSV A;  2Q97 A;  2G8I A;  1T44 A;  3U3Y A;  1N36 K;  3UKU B;  4FSV A;  3G10 A;  1DEJ A;  3HRG A;  1KVA A;  4CF8 A;  1RBU A;  2FSN A;  2YHB A;  1XI1 A;  3NFA A;  4JI0 K;  4CZJ A;  4CJ3 A;  2XO7 A;  2OYQ A;  1JL2 A;  1YVN A;  2IC3 A;  2HVH A;  3DJC A;  5BPL A;  3WNH A;  4CZH A;  4DQP A;  4GMJ B;  4YFU A;  2VG5 A;  3ULE A;  4B9T A;  4FJJ A;  4GW6 A;  1ZBH A;  3CCS N;  3CET A;  5M1N A;  3OYG A;  4K43 A;  3PV8 A;  5C15 A;  3SCX A;  2YKN A;  4RWT A;  2EWS A;  1C1A A;  1HRH A;  3BDP A;  4CEB A;  4Q5V A;  3TAR A;  4IEI A;  4FJ7 A;  1RBT A;  3KD1 E;  1HLU A;  1NK4 A;  1S6Q A;  3V81 A;  3HT3 A;  4IDK A;  3SI6 A;  2O8B A;  1BDG A;  5HRR A;  2XRI A;  4BRM A;  1RTD A;  3CD6 N;  3F5T A;  3D0P A;  3U4L A;  2P9U B;  3C6T A;  4HWI A;  1RDW X;  1LW0 A;  3QES A;  2FSJ A;  5AQN A;  3OBW A;  5C2F A;  3ZEU A;  4K8X A;  4BRP A;  3TSP A;  4FLW A;  3L2W A;  4W5T A;  3ENH A;  3T1A A;  1GLD G;  3O9T A;  3H45 C;  3VOV A;  4CJ4 A;  1VQ5 N;  4NCG A;  4DV1 K;  3NGZ A;  2HHH K;  4JI4 K;  4M3Y A;  1VQK N;  4CJW A;  1YIJ N;  3EZW A;  3GOI A;  2ZQB A;  2JWK A;  3EKU A;  4CED A;  1NOY A;  3I0S A;  4LF4 K;  4OKE A;  3TTD A;  2ZF5 O;  4BVO A;  1GLB G;  1NJY A;  5KPR A;  2RHK A;  2O4I A;  4K0K K;  1N5Y A;  4WFN L;  3MEC A;  3AA3 A;  4BR7 A;  3P83 D;  3DWL A;  4H0O A;  3FZF A;  3TAN A;  2H3G X;  4CFC A;  1TKD A;  2NZT A;  3BF1 A;  3AV9 A;  2NRV A;  3VEX A;  3KVG A;  4PHT X;  3I56 N;  1NMD A;  3SQ1 A;  1RGI A;  2X6S A;  1KAZ A;  3LPT A;  2UUC K;  1JLQ A;  5LY3 A;  3RTV A;  3VQB A;  3ZLJ A;  5C10 A;  4KTW A;  3KK7 A;  3D7E O;  4U7B A;  1VSE A;  3THY B;  3C6A A;  3G25 A;  1VSL A;  4W5O A;  4CF2 A;  5F0X A;  4JS4 A;  5KPT A;  4M41 A;  1K9M O;  1NGH A;  2E2N A;  3AVL A;  3CYM A;  5ADX H;  1ZBL A;  4NLC A;  2NRX A;  4DSI A;  2XY5 A;  3QBX A;  3V9W A;  1HYZ A;  3CJ7 A;  3QEX A;  2CGJ A;  2GV9 A;  4EP4 A;  1CXQ A;  3K57 A;  3VMF B;  5BN8 A;  2YJF A;  2WOM A;  1HPM A;  3L2V A;  3U8X A;  5M1F A;  3VQD A;  2P5O A;  3IMX A;  4PUO A;  4AH9 A;  1P8Z A;  3KWI A;  3KD5 E;  1K8A O;  4CD1 A;  3AVF A;  1X9W A;  3ULE B;  5SZT A;  4LH4 A;  3OYA A;  3T1Y K;  4ICL A;  3SAF A;  2WUS A;  3AAQ A;  3DOK A;  2RN2 A;  3AVM A;  4PY5 A;  3VN5 A;  1C6V A;  4OKK A;  3B8A X;  1XNR K;  2NUB A;  3VET A;  3L3U A;  2E4L A;  3WQT A;  4HTU A;  1GLL O;  3CCV N;  3LDN A;  3VQ4 A;  3OYE A;  3HST B;  3KZB A;  5HRO A;  2D0P A;  2D0C A;  4UQG A;  2O8B B;  1GOB A;  1EX4 A;  4CI6 A;  3K58 A;  4B9L A;  3GE1 A;  5LMN K;  1OVY A;  3AO1 A;  5AQF A;  3EKS A;  3BY5 A;  2WC9 A;  1RT3 A;  5IT9 O;  4B08 A;  4NXN K;  4EZ6 A;  3AVK A;  1V4S A;  4DFK A;  4KBO A;  4E7I A;  2D1K A;  2HF4 A;  2ATQ A;  3ZEU B;  1C0U A;  3IKM A;  4KV8 A;  4B9Q A;  3TR8 A;  3OS1 A;  4DU4 A;  3DAW A;  3JS6 A;  4F2S A;  2IVP A;  3SUN A;  3FZH A;  3PSI A;  4ILH A;  4AHS A;  5AQW A;  5JS1 A;  4PA1 A;  2ZGY A;  3VGM A;  1T8E A;  1BI4 B;  2KHO A;  3LDQ A;  3MCA B;  3QET A;  5FPN A;  2HBK A;  3IG1 A;  4CZE A;  4NO7 A;  1IKX A;  1KC8 O;  3HJF A;  1V4T A;  4WQ4 C;  3ISN C;  5KRS A;  1NBW A;  3EN9 A;  4CJU A;  4MO5 A;  5MLC Q;  2ZM6 K;  4FJI A;  3M1F A;  5AQS A;  3ZT2 A;  4DQI A;  3RR8 A;  1HYS A;  4DV5 K;  2KLA A;  5CZ1 A;  3S3O A;  4JI6 K;  3V4I A;  4CZF A;  1FKO A;  3CM5 A;  1HX1 A;  1NK6 A;  2IGI A;  4BC5 A;  2E6L A;  4O0I A;  1KRP A;  1IO2 A;  3WXL A;  4JKH A;  3CC4 N;  3RRH A;  3EE8 A;  1KQS M;  3I0R A;  3WQU A;  4DV4 K;  1T7P A;  5BRD A;  1CLQ A;  3A0I X;  3VQ9 A;  3TAG A;  4J2A A;  3BP8 A;  2RPI A;  3G71 N;  4FM0 A;  4JAX A;  1QHA A;  1W7A A;  4M3W A;  1TK0 A;  1S1U A;  1T03 A;  3SMS A;  3QFP A;  4BRE A;  4C8N A;  3R8E A;  4O0J A;  2WBN A;  1S1T A;  4YOV A;  2HBM A;  4F8R A;  3A5L C;  4CZG A;  3AVA A;  4LFA K;  1NK0 A;  4WF9 L;  4LF8 K;  4BR0 A;  3NVK A;  4H5V A;  4B1Z A;  3KWG A;  1EKE A;  1MA9 B;  2OZS A;  3J7Y P;  4J8F A;  4H0Y B;  4BQZ A;  2E1Y A;  4J2B A;  4ZTJ A;  1NGD A;  3R3L A;  1TKT A;  3ID6 A;  3K2P A;  3PUF A;  1TYQ A;  4BRQ A;  3EY1 A;  2I7P A;  2QXF A;  3HSC A;  3J8A A;  4O55 A;  4CEC A;  4B1U B;  3M8P A;  3C6H A;  4QS9 A;  4JRP A;  1OH7 A;  3RRG A;  5CY4 A;  5B8H A;  5FPE A;  4F4K A;  3O3G A;  4JV5 K;  1RFQ A;  1NGC A;  3P1G A;  5BPM A;  3SAG A;  2PYL A;  4LF5 K;  1GLJ O;  3L4I A;  1S1W A;  4IWV A;  3G4S N;  4YOR A;  4LF6 K;  1NGJ A;  4CF9 A;  2Z1G A;  4DG1 A;  1YTA A;  3ENO A;  3UB5 A;  3L2U A;  1SL1 A;  3S3N A;  1HQE A;  1DT9 A;  2GBZ A;  2QA4 N;  4OPH A;  3OS2 A;  4CBX A;  1YI2 N;  1QQO A;  4NCB A;  3NF8 A;  2F8T A;  4KI6 A;  2YCH A;  4FWM A;  1RBR A;  3WXK A;  3OYJ A;  3WUH A;  1RTJ A;  1REV A;  3NF9 A;  1FXX A;  4CIG A;  1VQ9 N;  2XY7 A;  3PO4 A;  5ELZ A;  3VGK A;  3CFP A;  3K9K A;  1KTQ A;  1S9E A;  4BRI A;  4PL8 A;  5CR4 A;  2G8H A;  1HNV A;  2HBL A;  3LDO A;  1U6Z A;  4DQ8 A;  4IOA L;  4YOT A;  4LSL A;  4IFE A;  1OH8 A;  3SUP A;  4HTL A;  4GKJ K;  1S22 A;  3VA0 A;  1J5O A;  1RT2 A;  3V1Q A;  4KHU A;  5M1P A;  3TSQ A;  4BRA A;  3H46 O;  4CJL A;  4CCH A;  1YHQ N;  1BG3 A;  4JK7 A;  4K41 A;  1DGK N;  1K73 O;  4HVJ A;  3E9L A;  2P9P A;  4WFB L;  5FRM A;  4YNQ A;  3PSF A;  3MX2 A;  4FWP A;  4WCE L;  4X66 K;  4GV6 A;  4CFA A;  4FVU A;  3AAP A;  1SKR A;  4W5R A;  1QQM A;  4H03 B;  1ATN A;  4JK8 A;  5BRH A;  1SZ2 A;  4E7K A;  4EHT A;  1NJX A;  4DTN A;  2FBX A;  1QSS A;  4H5W A;  3VQC A;  2HF3 A;  4CBU A;  1BIS A;  1Q9Y A;  5FPM A;  3AGK A;  2F9W A;  3K5O A;  1VSD A;  1OH5 A;  4KHS A;  2D0B A;  2A41 A;  4BRF A;  3OYN A;  1L3U A;  3AA4 A;  1FW6 A;  4AHV A;  3UE5 A;  1TGO A;  4ISG A;  4E1J A;  5H1S Q;  1A5W A;  4ID1 A;  1X9S A;  4AHT A;  4GNI A;  1IBK K;  3IFR A;  4BR9 A;  4N5S A;  3CHW A;  1K8K A;  3O9Q A;  1L3S A;  1Y97 A;  4KH5 A;  3LZI A;  4Z4E A;  2YNH A;  3B6O A;  1XMO K;  2UXD K;  1ATR A;  4Y1D A;  1WSI A;  3QNO A;  1N6Q A;  3MEE A;  2GWK A;  3ULD A;  4A5A A;  2W6L A;  2KFZ A;  3OY9 A;  1BGX T;  4AM6 A;  3M8R A;  1VQ4 N;  1TYQ B;  3U3G A;  3MAQ A;  2OTL N;  1LCU A;  3AVH A;  3O08 A;  3DLE A;  2YKM A;  2AA4 A;  3KLI A;  3C65 A;  1QQC A;  3RMA A;  5BRF A;  4FWN A;  3VPZ A;  4B1W B;  4M3X A;  1LAW A;  4CGI A;  3CQY A;  3VEW A;  4FJ9 A;  1WSG A;  3CXC M;  3O3F A;  1HR0 K;  3C6U A;  1BUP A;  2A42 A;  2YNG A;  4CHP A;  5C42 A;  1B9F A;  4DCH A;  1J53 A;  4TSX A;  3KLE A;  2O8F A;  4HHT A;  3S41 A;  5GIP A;  2PFU A;  4FJX A;  1EO1 A;  1JLG A;  4H4O A;  4AF1 A;  4I7F A;  1M90 O;  3SQ2 A;  1VQN N;  1KCF A;  4EAH D;  3SBG A;  3IAY A;  1NWK A;  2A5X A;  4CEE A;  3NH2 A;  4QS7 A;  5KRT A;  3HPH A;  2IIR A;  5AQY A;  4JKD A;  1TUU A;  2OPP A;  4O5F A;  3QML A;  4QS8 A;  2Q1N A;  1BCO A;  4DR3 K;  4GV9 A;  3G6E N;  4PKI A;  3PX4 A;  2OAN A;  1L3T A;  1VK0 A;  3OYH A;  5KGX A;  3CM6 A;  1SL0 A;  3ALY A;  4IFV A;  3Q7B A;  4HUE A;  3V9Z A;  4GKK K;  2E1Z A;  3AA5 X;  3DXM A;  4E89 A;  3ZT3 A;  4B3O A;  5KQD A;  2XY6 A;  1RIL A;  4KRE A;  2ETJ A;  1I3A A;  3OS0 A;  4BAC A;  4FPA A;  3CJ1 A;  4IZ9 A;  2P9P B;  2D0A A;  2YI1 A;  4O8K A;  1E4G T;  4YOX A;  1N33 K;  1VQP N;  4I9L A;  4H8K A;  4DV6 K;  4EHU A;  4M3T A;  4DR5 K;  4CJF A;  2IDO A;  5M1Q A;  1KLN A;  1Q86 O;  2VYP A;  2GX9 A;  4BE1 A;  3DLK A;  2FXU A;  3RMB A;  2VWJ A;  3QEW A;  4W5Q A;  4M63 C;  4FLY A;  5C2D A;  4BC3 A;  1GLA G;  1Q9X A;  1WAF A;  3U6F A;  1LWF A;  4CE9 A;  3HO1 A;  4JKA A;  3R1X A;  3LAN A;  4E7L A;  5C24 A;  1GLF O;  1K8K B;  4CFD A;  3TAE A;  2LSN A;  1NJW A;  4IO9 L;  4CJK A;  1NKB A;  1ILY A;  1TKX A;  3ZSO A;  4BRC A;  4CGH A;  3ZX3 A;  4DB3 A;  3NF6 A;  2J4R A;  5HRS A;  1N8R O;  1JLE A;  5E26 A;  5LJV A;  4IJN A;  4B3T K;  4FXD A;  4A59 A;  3J80 O;  4DTS A;  1NGG A;  3BUZ B;  3W0L A;  4JS5 A;  5CZ2 A;  1JXB A;  2E2Q A;  3FZL A;  5GAE P;  3DMJ A;  4C23 A;  4WQ4 A;  3KK3 A;  3CI5 A;  3JYT A;  4Z4G A;  1KFD A;  4I2Q A;  4MDA A;  4I2P A;  1S9G A;  2P9I A;  3QEI A;  1WOQ A;  4C8M A;  3DLH A;  4BG9 A;  3QIN A;  5FDL A;  1ZC6 A;  3AVN A;  1HKC A;  4KTZ A;  5GIN A;  4J2E A;  1S1V A;  3ATU A;  2O8F B;  2VGN A;  2F7T A;  2G8V A;  3MMV A;  3L2R A;  1Q18 A;  1EWR A;  4M3Z A;  3P4I A;  5GAG P;  4FJ8 A;  3BF3 A;  1M1K O;  3LPU A;  2HB5 A;  3LL3 A;  1B92 A;  2P9K A;  1RT6 A;  2ZE2 A;  1VQM N;  4HCB A;  1HMV A;  4CHO A;  4KRF A;  1YJ9 N;  3GBT A;  1S1X A;  5E84 A;  1WSF A;  2F9T A;  3CG7 A;  3EL2 A;  3OW2 M;  4CIF A;  3TAM A;  4DTR A;  4FZZ A;  3OYC A;  5C12 A;  4OJR A;  4MQ3 A;  3P38 A;  1NK9 A;  2DFF A;  1KD1 O;  3VQP A;  1E4F T;  2YHW A;  4M45 A;  5DMR A;  3L8B A;  4YOU A;  4DF8 A;  1LWC A;  2DFE A;  5AQQ A;  3DXM B;  3OJS A;  1HNI A;  4B9S A;  5FRN A;  2KKZ A;  2Q2R A;  5J1E A;  3MN7 A;  4B8A B;  2OTJ N;  5J2N A;  2E8A A;  4GV3 A;  1TAQ A;  2B5J A;  2OCE A;  3DLL L;  1VSM A;  3FZK A;  5I9E B;  4I9Q A;  3L4Q A;  5AQZ A;  4CJR A;  2OPS A;  3NH0 A;  1W9H A;  1VRT A;  1X9J A;  4WE1 A;  2FLO A;  1RT7 A;  1YUW A;  5J2Q A;  5F1X A;  4FYD A;  4FLU A;  3TTF A;  4KB1 A;  4CHN A;  3FFK B;  4DV3 K;  5BR9 A;  2YX6 A;  4CJ5 A;  3VGL A;  3MK6 A;  1ATS A;  2A3Z A;  1CZA N;  4FWK A;  2HOE A;  3H3N O;  4JLH A;  3K9J A;  3O8M A;  1E3M A;  1I39 A;  2ZD1 A;  1IG8 A;  3QB0 A;  3HPG A;  1JLB A;  1G99 A;  2KQ2 A;  4HUF A;  3BZC A;  3HBT A;  5AQG A;  4KHQ A;  3JAM O;  1RT1 A;  1R0A A;  4L3Q A;  4BRO A;  4Y0W A;  5EOY A;  4BC4 A;  2VCP A;  4DFJ A;  3SPZ A;  3M6G A;  3NGY A;  1O1W A;  4E3S A;  4KO0 A;  4B1V A;  4CFB A;  3SJJ A;  2A1S A;  3HM8 A;  4FW1 A;  4ELU A;  2P5G A;  2HBJ A;  2Q0U A;  3SQ0 A;  1NU0 A;  1DTQ A;  2Z1J A;  1C1B A;  1Y64 A;  2VGM A;  3CJ9 A;  5GIO A;  3WNG A;  1TK5 A;  1YVU A;  2P9I B;  5KTQ A;  4C8O A;  2HHV A;  2KZM A;  3QEP A;  1U4B A;  1D9D A;  1KFS A;  4IOX A;  1KVB A;  3BEX A;  3HPO A;  3SAH A;  1RDU A;  1ZXO A;  5JS2 A;  3TAP A;  3SLC A;  4AHU A;  3SUQ A;  1MWK A;  1Q82 O;  2GEM A;  1BHL A;  4KPY A;  2P9K B;  2QWM A;  4RW9 A;  1VAZ A;  2UUB K;  3HTV A;  1VQL N;  3CCR N;  4ISF A;  2UYT A;  3O4W A;  4CZM A;  4O8U A;  5CE3 A;  4KTQ A;  2QWL A;  4A62 A;  3WXJ A;  4V19 S;  3KIO A;  4FO0 A;  3DRP A;  3B6P A;  2QWP A;  3AO4 A;  4RW4 A;  4AHR A;  1OVQ A;  4RCH A;  1U49 A;  4CJT A;  2NNW A;  2QW9 A;  3SNN A;  4N41 A;  3M8Q A;  3DRR A;  2GUP A;  3TSU A;  1HJR A;  4A61 A;  4CF1 A;  1IKV A;  3DLR A;  3KLG A;  4DSK A;  2BGG A;  3VQ8 A;  1BA0 A;  3TAF A;  5CYM A;  1X3N A;  2V7Z A;  2KFN A;  3ZT1 A;  2P1J A;  3DXK A;  2F4V K;  4IBN A;  4DR6 K;  2NRW A;  4Z4C A;  1U47 A;  4FWR A;  3T3F A;  5EY4 A;  2AP1 A;  1XC3 A;  4GY2 B;  3F73 A;  4C8L A;  3O9R A;  5DM6 L;  4M3U A;  4JRQ A;  3TWH A;  1O13 A;  3D2F A;  4IJA A;  2BDP A;  4OVL A;  1BU6 O;  1TAU A;  4DTM A;  1LV5 A;  3LAM A;  3W3D A;  4IKF A;  3HK2 A;  1XUP O;  4ID5 A;  3NHG A;  1C1C A;  3VES A;  4EFH A;  4L8R B;  3GG4 A;  1S6P A;  3AVC A;  4FVM A;  3WXM B;  4M7Y A;  4KH6 A;  5AR0 A;  4DWI A;  4MFB A;  5AQH A;  1X3M A;  3LM9 A;  1JCG A;  4N47 A; 
#chains in the Genus database with same CATH homology
 3CJB A;  4NB4 A;  3TTC A;  3HOT A;  5TKW A;  4JD2 B;  3UE5 A;  4FWL A;  5H1S Q;  4ISG A;  2E2O A;  4E1J A;  4ISE A;  3L0Q A;  4CJ7 A;  3SK3 A;  4GNI A;  2Q97 A;  3IFR A;  4BR9 A;  3CHW A;  4UY8 O;  3SJH A;  1K8K A;  1T44 A;  3O9Q A;  4R79 A;  2Q36 A;  4FWS A;  3O9U A;  4WQ5 C;  2IVN A;  4KH5 A;  3UKU B;  4FSV A;  2ZJQ L;  5JIC A;  3T7Z A;  3VTH A;  4BC2 A;  3ATV A;  1DEJ A;  3HRG A;  3O5B A;  4ILG B;  1ATR A;  2FSN A;  3SMP A;  5AQL A;  4CZJ A;  3CER A;  3NVM A;  4KH4 A;  2GWK A;  3IUC A;  3R9P A;  4A5A A;  1HUX A;  2E88 A;  4AM6 A;  1YVN A;  4BRN A;  2QI2 A;  3DJC A;  4K42 A;  5BPL A;  1TYQ B;  4CZH A;  1VQ4 N;  2OTL N;  4BRL A;  3H1Q A;  3ULE A;  1LCU A;  3O08 A;  5AQM A;  4IO8 A;  3IDH A;  3CCS N;  2AA4 A;  3CET A;  3C65 A;  5M1N A;  5M1K A;  3VEV A;  4K43 A;  1R59 O;  5BRF A;  4FWN A;  1C0F A;  3VPZ A;  5C15 A;  4B1W B;  4RWT A;  3CME N;  3CQY A;  2EWS A;  2QXL A;  1H1V A;  3VEW A;  5FPD A;  3CXC M;  2P9S A;  2ZGZ A;  1BUP A;  4A2A A;  2A42 A;  3CC2 N;  4IOC L;  5CHI A;  4OO1 J;  4IEI A;  3JXU A;  2QWR A;  4DCH A;  1HLU A;  4A57 A;  3S41 A;  5GIP A;  2BH1 A;  2PFU A;  4JHD A;  3WEE A;  1YXQ A;  1EO1 A;  5AQI A;  4BRD A;  4K25 A;  1Z05 A;  4AF1 A;  3R6M A;  1SAZ A;  1MDU B;  1M90 O;  4A2B A;  2BUP A;  3MWT A;  5EVZ A;  1W97 L;  1BDG A;  5AQJ A;  3RSE A;  1VQN N;  4EAH D;  3SBG A;  4IEE A;  4BRM A;  1NWK A;  2A5X A;  3CD6 N;  1YJW N;  1GLE G;  3F5T A;  4CZL A;  3U4L A;  2A40 A;  2NRZ A;  2P9U B;  5GAH P;  3ZYY X;  3I55 N;  4HWI A;  1RDW X;  4QS7 A;  1QQN A;  3A8Y A;  4JEP A;  3CCE N;  2FSJ A;  2IIR A;  5AQN A;  1ESV A;  3A5O C;  1BWF O;  3OBW A;  4JKG A;  4JKD A;  5AQY A;  5AFU A;  1TUU A;  3MWP A;  3ZEU A;  5C2F A;  5DM7 L;  5KQ8 A;  5JVG L;  4BRP A;  3E9P A;  3TSP A;  4O5F A;  3QML A;  4QS8 A;  1T6C A;  1QVG M;  5AQP A;  2Q1N A;  4MDB A;  3VEZ A;  4C1N K;  4GV9 A;  1MWM A;  3G6E N;  4PKI A;  1BO5 O;  3ENH A;  1HJO A;  2OAN A;  2HST A;  4YDU A;  1GLD G;  3O9T A;  3H45 C;  3VOV A;  3Q7B A;  2QM1 A;  3OBY A;  4FPB A;  2E1Z A;  3DXM A;  1VQ5 N;  1JCF A;  2P9L A;  5AZJ B;  4BR4 A;  1X3M A;  2QTD A;  4A5B A;  1VQK N;  1YIJ N;  5KQD A;  3DXK B;  3EZW A;  3GOI A;  4RTF D;  2NRT A;  2JWK A;  3EKU A;  5BPN A;  4WFA L;  3O1W A;  3TTD A;  2ZF5 O;  4FPA A;  4BVO A;  3VF6 A;  1GLB G;  1NGE A;  5KPR A;  3CJ1 A;  4IZ9 A;  2RHK A;  3Q7C A;  4BRG A;  2P9P B;  1U2V A;  4WFN L;  5HL7 L;  2ASO A;  4JKE A;  2YI1 A;  4O8K A;  4BR7 A;  3DWL A;  1E4G T;  4U67 L;  4H0O A;  3FZF A;  4YOX A;  2H3G X;  1VQP N;  1T6D A;  2ZWH A;  3P31 A;  4EHU A;  2NZT A;  3BF1 A;  5JLH A;  2NRV A;  3VEX A;  3KVG A;  4PHT X;  3I56 N;  1SQK A;  5M1Q A;  1NMD A;  1Q86 O;  2VYP A;  1RGI A;  2GX9 A;  4IDH A;  1YAG A;  1KAZ A;  3HZ6 A;  5AQX A;  2I7N A;  2FXU A;  5JVH L;  5LY3 A;  5C10 A;  3CPE A;  4I6M A;  4M63 C;  5KPZ A;  3KK7 A;  3D7E O;  5C2D A;  4BC3 A;  4U7B A;  1GLA G;  3HOS A;  4BQL A;  1HKG A;  3C6A A;  3VEO A;  2WFB A;  1W2B M;  3G25 A;  2FF6 A;  3KHY A;  4FOE A;  5F0X A;  5KPT A;  1QVF M;  3I33 A;  1K9M O;  1NGH A;  4JKA A;  4G9Z A;  2E2N A;  1SS6 A;  3R1X A;  2Q31 A;  1GLF O;  5ADX H;  1K8K B;  3C0B A;  4BRK A;  3ID8 A;  4NLC A;  3PLA A;  2P9N A;  2NRX A;  3QBX A;  1S3X A;  5AQU A;  3O9S A;  3CJ7 A;  3VEY A;  4OPA A;  1J6Z A;  4IO9 L;  2CGJ A;  2FSK A;  4JKB A;  5AQR A;  3VMF B;  5BN8 A;  1Q7Y O;  2JWL A;  1ILY A;  2YJF A;  1NGI A;  1HPM A;  4H0V B;  3U8X A;  4XH5 A;  4BRC A;  5M1F A;  3ZX3 A;  4DB3 A;  3CCL N;  4MLE A;  5AZI A;  3IMX A;  2J4R A;  2ASM A;  1N8R O;  5E26 A;  5LJV A;  1P8Z A;  3KWI A;  4IJN A;  1K8A O;  1LOT B;  4A59 A;  4CD1 A;  1NGG A;  3BUZ B;  3MDQ A;  4BVP A;  3ULE B;  3W0L A;  3H3O B;  2E2Q A;  3FZL A;  4CBW A;  5GAE P;  4C23 A;  2D4W A;  1C0G A;  4WQ4 A;  4DKW A;  3CCM N;  1XQS C;  3CI5 A;  1YIT N;  4XEI A;  4MDA A;  2HMP A;  3SAF A;  2WUS A;  2P9I A;  3AAQ A;  3MN6 A;  3TPQ A;  1VQ7 N;  3EE9 A;  2ZJP L;  2D0O A;  1WOQ A;  2P9S B;  4BR5 A;  4BG9 A;  3QDK A;  3B8A X;  1ZC6 A;  4H5T A;  3VET A;  1HKC A;  2W41 A;  5GIN A;  3ATU A;  3WQT A;  2VGN A;  1GLL O;  2F7T A;  3LDN A;  3CCV N;  3CF5 L;  4JHD B;  3WEE B;  5BN9 A;  3FE1 A;  3MMV A;  3L6Q A;  1YI2 N;  3KZB A;  1Q18 A;  2NRR A;  2D0P A;  3CC7 N;  4BRH A;  2PBD A;  3P4I A;  5GAG P;  3BF3 A;  3RSE B;  4CI6 A;  1M1K O;  3LDL A;  3GE1 A;  5F2R A;  3LL3 A;  2P9K A;  1OVY A;  5AQF A;  1VQM N;  3EKS A;  3A5M C;  3QBW A;  2WC9 A;  4XH1 A;  1YJ9 N;  3TU5 A;  3GBT A;  2ZJR L;  5E84 A;  4NLB A;  4PKH A;  4BR2 A;  2F9T A;  1V4S A;  4DHY A;  3EL2 A;  3OW2 M;  1NGF A;  4KBO A;  2E2P A;  5C12 A;  5AQO A;  3D2E A;  2D1K A;  2HF4 A;  3AAR A;  3P38 A;  4JKG B;  4FL9 A;  3ZEU B;  1WUA A;  1KXP A;  4H0P A;  1KD1 O;  3IKM A;  3AY9 A;  1E4F T;  4JK9 A;  4H0T B;  4B9Q A;  2YHW A;  2P9U A;  3FLC O;  3SBT A;  1ZBS A;  2GEL A;  3E66 A;  3N4P A;  4YOU A;  3DAW A;  3T69 A;  3JS6 A;  3E1Y A;  2IVP A;  3ZET A;  4WQ5 A;  3FZH A;  5AQQ A;  3DXM B;  2QWO A;  5JLF A;  2P9L B;  2KKZ A;  2Q2R A;  5AFU H;  3MN7 A;  4ILH A;  4JNE A;  5AQW A;  5JMV A;  2OTJ N;  3J7Z O;  2ZGY A;  3VGM A;  1YJN N;  2E8A A;  1T3V A;  2KHO A;  4FWO A;  3VTI A;  4GV3 A;  3DLL L;  3FZK A;  3EO3 A;  3LDQ A;  3MCA B;  5EXW A;  5I9E B;  3L4Q A;  5AQZ A;  5FPN A;  2HBK A;  2VWB A;  2YHY A;  1VQO N;  4CZE A;  1JJ2 M;  4GVE A;  4NO7 A;  3D2F B;  1X9J A;  1KC8 O;  1JCE A;  1V4T A;  3LM2 A;  4WQ4 C;  2FLO A;  3QFU A;  1U2V B;  1YUW A;  3UKR A;  1NBW A;  4H5N A;  2ASP A;  3C7N A;  3EN9 A;  3MCP A;  3P39 A;  1HKB A;  3N4Q A;  1NGB A;  4MO5 A;  4MLH A;  4B1Y B;  5F1X A;  5MLC Q;  3LDP A;  1Q81 O;  1VQ8 N;  3M1F A;  3TTF A;  5AQS A;  1VQ6 N;  1YF5 L;  2KLA A;  3FFK B;  3CPW M;  4CZF A;  1HX1 A;  4BC5 A;  4H0X B;  5BR9 A;  2YX6 A;  3MN9 A;  1P90 A;  3WXL A;  4JKH A;  3CIP A;  3WXI A;  3CC4 N;  4I6M B;  2DPN A;  3EE8 A;  3CJA A;  3MK6 A;  3VGL A;  1KQS M;  4WYB A;  3F2K A;  4JKF A;  3WQU A;  1ATS A;  5BRD A;  2A3Z A;  4CZK A;  3A0I X;  1CZA N;  2W40 A;  3HI0 A;  4FWK A;  2HOE A;  3H3N O;  5AQV A;  3BP8 A;  3U9D A;  4PKG A;  3G71 N;  3K9J A;  1KAX A;  4JAX A;  4H5R A;  3O8M A;  1QHA A;  1S72 N;  4F9O A;  1IG8 A;  3SMS A;  3QB0 A;  3QFP A;  1NGA A;  4BRE A;  1G99 A;  4JD2 A;  2P9N B;  3HBT A;  5AQG A;  2GWJ A;  3R8E A;  2WBN A;  4L3Q A;  4BRO A;  4Y0W A;  5EOY A;  4BC4 A;  4FWQ A;  2VCP A;  2ITM A;  4YOV A;  2HBM A;  4YDU C;  3A5L C;  3M6G A;  4CZG A;  4AM7 A;  1TUY A;  3UKU A;  4B1V A;  2CGL A;  5AZI B;  3GDQ A;  2NRH A;  4BR0 A;  4WF9 L;  2CGK A;  3O6W A;  5AQK A;  3OA9 A;  3NVK A;  4H5V A;  4CD3 A;  4B1Z A;  3KWG A;  3HM8 A;  1MA9 B;  3VEN A;  1BOT O;  4XH4 A;  3VER A;  4J8F A;  1EQY A;  4H0Y B;  2HBJ A;  5HOO A;  4BQZ A;  2Q0U A;  3A5N C;  2E1Y A;  1NGD A;  4ILJ A;  3CCU N;  1NJI O;  3R3L A;  3U9Z A;  4BGA A;  3ID6 A;  2VGM A;  1Y64 A;  1TYQ A;  1GLC G;  4BRQ A;  3FGU A;  2QEX N;  3CJ9 A;  2I7P A;  5GIO A;  3HSC A;  4Z94 A;  2A6A A;  4B1X B;  2P9I B;  3J8A A;  4B1U B;  3MX5 A;  1QZ6 A;  3C6H A;  3GL1 A;  3O80 A;  4QS9 A;  5GAD P;  5B8H A;  5FPE A;  2GTD A;  4IOX A;  1RFQ A;  3BEX A;  2V51 B;  3RVC A;  3MN5 A;  1NGC A;  5BPM A;  3SAG A;  2BTF A;  3SAH A;  1GLJ O;  3L4I A;  1RDU A;  1Z6R A;  1ZXO A;  4IWV A;  3G4S N;  3SLC A;  2E20 A;  4YOR A;  1NGJ A;  1MWK A;  2FF3 B;  5M1O A;  2CH5 A;  4YOW A;  3CCQ N;  3CJC A;  1Q82 O;  2GEM A;  3ENO A;  3UB5 A;  3D6R A;  2P9K B;  2QWM A;  3O1B A;  3ZX2 A;  1VAZ A;  1DT9 A;  2QA4 N;  3HTV A;  1VQL N;  3CCR N;  5EX5 A;  4ISF A;  4FOI A;  4OPH A;  2UYT A;  3O4W A;  1QQO A;  2QWN A;  3M3Z A;  3QIC A;  4O8U A;  4CBX A;  4CZM A;  5CE3 A;  2YCH A;  4FWM A;  2QWL A;  3D2E B;  3CCJ N;  3M5R A;  4A62 A;  3WXK A;  3VF4 A;  3WXJ A;  3WUH A;  3VF2 A;  3ZX0 A;  3PIP L;  3F9M A;  1VQ9 N;  4FO0 A;  3E9O A;  1IJJ A;  5ELZ A;  2NLX A;  3VGK A;  2QWP A;  3OHR A;  3K9K A;  2PAV A;  4EIA A;  3PIO L;  4BRI A;  4RCH A;  5TKY A;  4PL8 A;  3ZET B;  2NNW A;  2QW9 A;  5CR4 A;  2HBL A;  3LDO A;  2QWQ A;  2V52 B;  4IXC A;  3FZM A;  1U6Z A;  2YJE A;  3FR0 A;  4JN4 A;  4DQ8 A;  2GUP A;  3TSU A;  4IOA L;  4YOT A;  4A61 A;  5LJW A;  4IFE A;  4YOY A;  4HTL A;  3H6E A;  4M7X A;  1S22 A;  1BA0 A;  2Q0R A;  5AZJ A;  5M1P A;  1NLV A;  3TSQ A;  1X3N A;  2V7Z A;  3H46 O;  4BRA A;  4BY9 C;  3NMU A;  3CQX A;  3AGR A;  3DXK A;  4BGB A;  2NRW A;  1KAY A;  3UKR B;  1OKJ A;  4FWR A;  1YHQ N;  3C7N B;  5EY4 A;  1BG3 A;  1NM1 A;  2AP1 A;  1XC3 A;  4GY2 B;  4JK7 A;  1QZ5 A;  4K41 A;  1DGK N;  1K73 O;  3O9R A;  1BA1 A;  3E9L A;  2P9P A;  5DM6 L;  4WFB L;  4JKC A;  1O13 A;  3D2F A;  2V7Y A;  4IJA A;  3CMA N;  1BU6 O;  4MO4 A;  5C0Y A;  1DKG D;  3MX2 A;  4FWP A;  4CZI A;  4WCE L;  4BG8 A;  4GV6 A;  4FVU A;  4C1N I;  3AAP A;  3W3D A;  1QQM A;  2RE2 A;  4H03 B;  1XUP O;  3H1V X;  2IVO A;  1ATN A;  4JK8 A;  5BRH A;  1SZ2 A;  2YHX A;  4LC9 B;  3VES A;  4EHT A;  1D4X A;  4EFH A;  4PL7 A;  2CH6 A;  3GG4 A;  3WXM B;  3WT0 A;  3I8B A;  4H5W A;  5ADX A;  5AQT A;  3ENB A;  2HF3 A;  5BRE A;  4M7Y A;  4CBU A;  4KH6 A;  5FPM A;  3AGK A;  2F9W A;  5AR0 A;  5AQH A;  2A41 A;  3LM9 A;  4BRF A;  1JCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...