4CGGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cggA00
5HBMA 4B9TA 4CFAA 1DLOA 3K5LA 1D5AA 4DTSA 3RRHA 4ZHRA 5HP1A 2PYLA 4ELVA 2HHWA 4YNQA 2XO7A 1BQNA 4CHOA 2HHVA 3P83D 1NK5A 4W5OA 3S3NA 1HMVA 4RW8A 3T19A 5KI6A 4JS5A 4KB0A 4CGFA 5HRSA 1HYVA 2X6NA 2YKMA 4B08A 1T7PA 1UWBA 4FZYA 4DSEA 3AO1A 3AA2A 5J2MA 1I39A 1TAQA 3V9XA 4DS4A 2P5OA 4B9VA 1ZBIA 1VRTA 4RW6A 1JLQA 4KHSA 4CEZA 2X6SA 3UIQA 4E89A 2HHSA 3AVAA 3KJVA 1NJYA 1IKYA 2Z1GA 4KHUA 4PY5A 3AVHA 3QNOA 3KTQA 4I7FA 2D0BA 4CE9A 1VSHA 3KKSA 3F9KA 4ID5A 3CG7A 1BI4B 1RT6A 1JL2A 4E7HA 2PY5A 3DOKA 4OGEA 3MEDA 3QEWA 1ASUA 3AO3A 3V81A 4KB1A 1NOZA 4E1MA 1ITGA 4AHCA 1SKWA 3KD1E 1N6QA 2PZSA 1BHLA 4Z4GA 1A5VA 3TANA 4OKKA 4DQQA 2BGGA 3OS1A 1XI1A 1IKXA 1NKEA 2B6AA 3K5NA 1QS4A 2ATQA 2XY7A 3LPTA 4HTUA 3HP6A 3NH0A 1JLCA 4YFUA 1RT1A 1C6VA 1QE1A 2VG7A 1LWFA 4KFBA 4OLBA 4I9QA 3LZJA 1TKZA 4J2BA 1BCOA 1RT4A 4J2AA 4B9NA 3RMCA 2G8KA 3AVGA 3LPUA 2KZMA 3LP2A 2DY4A 3QEPA 3BGRA 4NCBA 4CEDA 2I5JA 3DLHA 5FRNA 1RBVA 5CYMA 3ZSYA 3VA0A 1S6QA 4RW9A 1LAWA 3OYGA 3O3FA 1Z26A 1KRPA 4DSLA 3DI6A 4OLAA 4RW4A 2B4JA 4QAGA 1TKTA 3JSMA 4FJHA 4ICLA 1S1TA 3ZT2A 1RBUA 3DRRA 4PA1A 4KHNA 1ASVA 2R7YA 4ID1A 1KSPA 2ETJA 1A5XA 3HVRA 4JLHA 3SPYA 1VSFA 3NFAA 1L3SA 1S1WA 4EZ6A 3HYFA 4OKJA 4H4OA 4CJPA 3VA3A 3VQ9A 4FM1A 3K5MA 4ZTJA 2XY8A 1NJWA 3P5JA 1B9DA 2EX3A 4Z0UA 3AVCA 1RT7A 4CFCA 4FJKA 4IFVA 3CM6A 4RW7A 3G10A 3NH2A 3OYJA 4DSJA 1YTAA 1ZBFA 4FW2A 4JRPA 1WSEA 3HVTA 2KFZA 3RMAA 1S1UA 1NJZA 4E0DA 3ZT4A 4IG0A 3C6TA 3K5OA 3EY1A 4FLUA 4DU1A 4FCYA 5J2NA 3SUNA 4FLVA 1J5OA 1VSKA 4ELTA 4LY7A 1X1PA 3O4QA 3CQ8A 3U3YA 2EHGA 3PX0A 4Z4FA 4DTPA 3B6OA 3DLRA 2OPQA 4CFBA 4Y1CA 1IO2A 5KGXA 4PQUA 4HHTA 1TV6A 5C42A 4CESA 3LP1A 1UA0A 2IOCA 1C1BA 4F2SA 4ELUA 3S3MA 4K8XA 4M3XA 3MEEA 3TAEA 3VQPA 3RMDA 5DK5A 4CJ3A 4E7LA 4IKFA 3DOLA 2OA8A 1O1WA 3TAGA 4GMJB 3D45A 3ALYA 4KHWA 4Z4EA 3HJFA 3LAKA 4DTUA 3IG1A 3C6UA 4I2PA 3O3GA 4CIEA 4CGHA 3AO5A 4CEFA 4BACA 1X9WA 1UOCA 3NBPA 2VG6A 4FM2A 3HPOA 1U04A 1RDDA 2KW4A 2QXFA 2YNGA 5CZ1A 1W9HA 3QESA 1TAUA 2HNYA 1ASWA 1TGOA 1F21A 5KRTA 4BWMA 2FBYA 1RDAA 4E7KA 4DTOA 1RNHA 2W42A 1RT5A 1S1VA 3AA4A 4I2QA 1HNIA 4O55A 3QEIA 5HLFA 3SUPA 2WOMA 3VQ5A 3OYFA 3QLHA 5SWMA 3SZ2A 4J2EA 4E7JA 1C1AA 3KLGA 4KAZA 2ZE2A 1NOYA 3AVBA 4DTMA 1A5WA 3PO5A 1SL1A 4HUEA 4HUFA 1Y97A 1LAVA 2P51A 5CY4A 4KI4A 1EX4A 2OZSA 1CZBA 4PWDA 3MECA 3CFRA 3SQ2A 1LW2A 2VWKA 4DWIA 4M3WA 1JLBA 1T05A 5D3GA 3ZSQA 3VQEA 3PV8A 3V6DA 4CEQA 4CJ5A 3AA5X 5T7BA 2XY6A 4AHTA 3SI6A 5FROA 1J53A 1RT2A 3VQCA 3WNHA 5EU7A 1EETA 3OYCA 3C94A 3QERA 3WNFA 3KD5E 1X9SA 1NK8A 2HHUA 3NHGA 2KFNA 3NF6A 4DU4A 1NKBA 4FLYA 3VQ8A 1IKVA 3OYNA 2RN2A 1Z25A 3OJSA 2OPPA 3M8QA 3QIPA 4C8MA 2YHAA 4HVJA 2Y1IA 4TSXA 2JLEA 4N41A 3VQ7A 3OYLA 3QEVA 4C8LA 3H08A 2IC3A 4CJTA 2Z1JA 4K8ZA 1XWLA 1HRHA 1S6PA 1SL0A 4LSLA 3EYZA 4FJMA 3AVMA 2D0CA 1RTIA 4Q5VA 4CJWA 3F73A 4OPJA 4DLGA 1Q9XA 3SYZA 1RBTA 2O4IA 3KLFA 4CEAA 4CEEA 1TK5A 1C1CA 4FJIA 1JL1A 4LSNA 2E6LA 4B9LA 4O4GA 3ZCMA 4CGIA 3DM2A 4BE1A 4I9LA 4DFKA 1WLJA 2AJQA 2F96A 5JS1A 3NGYA 1BGXT 4FLTA 3LALA 2HNDA 3VQ4A 3VQ6A 4DQIA 2DTUA 2OPSA 3AVKA 1X9MA 4KPYA 2Z1IA 3QEXA 3O4NA 5K14A 3SUOA 4Z4CA 1KVAA 4JRQA 3SQ1A 4NCGA 4KTWA 3G0ZA 3I0SA 1B9FA 1NK0A 1CXUA 3LP3A 1RBSA 4B8CA 3DLBA 4CK2A 2NUBA 3I0RA 4DSFA 3QNNA 4OPKA 4LD0A 3FFIA 3V4IA 4DG1A 3S3OA 4EZ9A 1HPZA 4M3RA 1KVBA 3NCIA 4F4KA 1L3TA 2VWJA 3TAPA 1RTJA 5J1EA 3PY8A 3HK2A 4Z4HA 5HROA 4FJ9A 4CIGA 2QKKA 4CJ4A 4CIFA 3SQ4A 4LH5A 3V1QA 3CYMA 1J9AA 4O5BA 3PX6A 3L2WA 3EZ5A 1ZBLA 1WAJA 1VSIA 2PYJA 3SQ0A 1DTQA 3C95A 3CFPA 2IS3A 1C0TA 3VQBA 3SV3A 4FK0A 1NKCA 2IGIA 5FRMA 2GUIA 3CM5A 2OPRA 4FK2A 2YKNA 3ZSVA 1KTQA 3OYDA 3KK2A 4Z4IA 4FZXC 3VQDA 3L2QA 4AHVA 2DFFA 3K59A 3RTVA 1S9EA 5DMRA 3HM9A 3QETA 4CJLA 4EP4A 3OYBA 4C8KA 3HO1A 4Y1DA 1ZBHA 1IH7A 2ZD1A 3QINA 3TAFA 4M45A 4F3OA 2BE2A 3HL8A 3TAQA 1KLNA 3AVNA 1BI4A 5E41A 2RPIA 2ZQBA 4F3TA 1HQUA 1YTUA 1MU2A 4CCHA 4DQRA 3D0PA 2G8HA 4CJRA 3AVLA 1WSFA 1RTHA 3ZSRA 3ASMA 1FK9A 4E19A 1SV5A 4CHQA 1TKXA 3OYHA 2HW3A 2HVIA 3MXMA 5CYQA 1ZYQA 1QSLA 1KFSA 1C0UA 1REVA 4N5SA 4CF1A 4CHNA 4B9MA 1HYZA 4CEOA 4FJ5A 4HCCA 2YHBA 3NF9A 4WE1A 3ZSXA 2Y1JA 3OVNA 3VN5A 3THVA 3L8BA 1VSEA 3ISNC 3ZT3A 4HCBA 1GOCA 2P1JA 4E1NA 3NGZA 1JXEA 4BDZA 4FLXA 1TL1A 3SNNA 5I3UA 3L2UA 2O4GA 3L3VA 4CERA 5C25A 1LWEA 4R5PA 1U4BA 3LAMA 2Z1HA 2LSNA 1SUQA 4C8OA 3IAYA 4DQPA 3L2VA 3AO2A 4W5QA 4CJQA 4E7IA 4FJJA 4H8KA 2G8VA 3SJJA 3NE6A 3E01A 1HQEA 1HNVA 1Q9YA 1WSJA 3ZSOA 3NAEA 4W5RA 4KRFA 4FW1A 4CGGA 4CJVA 4MFBA 5KGWA 1WAFA 4CJKA 4MQ3A 3SV4A 4DQSA 1T03A 3OS2A 1TK8A 4OJRA 2X74A 3HPHA 3V9WA 2ITGA 1D8YA 4M3TA 4QCLA 1YVUA 2RKIA 3V9SA 1KFDA 3K2PA 4EP5A 5HRNA 1NK9A 4CF8A 1RBRA 1HYSA 4CEBA 1FKPA 2E4LA 3NH1A 1RT3A 3ZSZA 4AILC 5HRPA 1TVRA 4AH9A 2FBTA 1JLFA 3TR8A 3T1AA 3I8DA 2FC0A 3RRGA 4DSIA 4CHZA 3V1OA 1IKWA 4NCAA 4FXDA 1C0MA 1VK0A 2BDPA 4QOZB 1EXQA 3OYAA 2HMIA 4OKEA 4N56A 3OYEA 3T3FA 3DLKA 4F2RA 3PX4A 3IS9A 3VQQA 4M3YA 1UAXA 1WN7A 3DMJA 3ZT0A 1S5JA 1BQMA 1I3AA 1YT3A 3A2FA 4O44A 4CF0A 3K57A 1LV5A 2G8WA 2HHXA 2WONA 3QIOA 1RILA 3PO4A 1ZBUA 5FDLA 3HT3A 2HVHA 4DTNA 4IBNA 3LDSA 3KK1A 3LP0A 3JYTA 1U48A 4W5TA 3ULDA 1BISA 3TAMA 2OZMA 3ZT1A 4BDYA 1EP4A 4GVMA 5KRSA 2RF2A 1KCFA 2YNIA 4FJ7A 1VRUA 1JKHA 1QSYA 4DSKA 1CLQA 3WNGA 1BCMA 1SKSA 3CFOA 4DFPA 1J54A 1N5YA 4M42A 1T8EA 3LANA 4CJUA 1S1XA 4E3SA 1HJRA 1NJXA 1IG9A 2E6MA 3OJUA 1JLGA 3ZSWA 4CJEA 4HUGA 3S9HA 4OVLA 1L5UA 4CK3A 4PUOA 3MAQA 4CF2A 4KV8A 4DS5A 1VSJA 2KQ2A 3HSTB 1EKEA 1XHZA 3OYKA 2QK9A 3RR7A 1R0AA 1NK7A 3U3GA 4F8RA 2HHTA 3HP9A 1Q8IA 1JLAA 3KK3A 1KLMA 1WSHA 1WSIA 1CXQA 4OGCA 1RTDA 1RCHA 1BIZA 4FYDA 3KKRA 5HRRA 1BIUA 4FM0A 1QTMA 3IRXA 4M41A 3SUQA 4CJSA 3OY9A 1TL3A 3QO9A 3TWHA 1TK0A 4FJGA 4FVMA 5J2PA 2KZZA 4NYFA 3SCXA 1GOBA 4KREA 4KTQA 1SL2A 2HHQA 3AO4A 1RDCA 4CHPA 2QKBA 3DLEA 1UA1A 1S9GA 1JLEA 4IG3A 3VQAA 4O0IA 4KTZA 3M8RA 4M3ZA 2GV9A 3OYIA 4CK1A 1LW0A 4FJXA 4FZZA 3NDKA 4CECA 4FJLA 3DLGA 1L3UA 1QHTA 1QSSA 4KKOA 3NF8A 2JGUA 2XHBA 4DTRA 3KLHA 1WSGA 3LWLA 1VSLA 4FLZA 3L3UA 3DRPA 5J2QA 3MXIA 4KHYA 3OYMA 4DU3A 2X78A 3U6FA 3WNEA 3V1RA 4CGDA 3AVIA 4IDKA 3RR8A 4BWJA 2B5JA 3TARA 1VSMA 2XY5A 2IDOA 1GOAA 4CGJA 1L3VA 3B6PA 1QQCA 4L8RB 4O0JA 5KTQA 1XC9A 1KVCA 2F8TA 3KLEA 1B92A 3AVJA 3AVFA 1LWCA 4AHUA 2P5GA 4B3OA 2HB5A 4M3UA 4FK4A 4N47A 2G8IA 4AHRA 1G15A 4CHYA 1XHXA 4BDPA 2KTQA 4CJFA 3HXMA 4B8AB 2D5RA 3RMBA 4DMNA 1TKDA 1K6YA 2Q3SA 1NK4A 2YNHA 3BDPA 3ITHA 1DTTA 3MEGA 4DTJA 2OYQA 4NYNA 4KO0A 1CZ9A 1JXBA 1RDBA 4DTXA 4CF9A 3LZIA 3KLIA 4DFJA 3AV9A 1U47A 2YV0X 4XIUA 4BE0A 1FKOA 2VG5A 4LH4A 4UQGA 2FBVA 2IAJA 3SPZA 4BE2A 3P1GA 2F8SA 3OS0A 4B9SA 4ZTFA 4KHQA 4CFDA 4IFYA 2BANA 4RG8A 3DRSA 3M8PA 4G1QA 4FLWA 3M8SA 4FJNA 1VSDA 2DFEA 4AHSA 2D0AA 2A1SA 5SZTA 1U49A 1WNSA 5JS2A 4H4MA 1U45A 1SKRA 1D9FA 3K58A 2HNZA 3KIOA 3L2RA 3NF7A 2GBZA 3HPGA 3LWMA 4DF4A 2G8UA 3V9ZA 2XRIA 1NK6A 4Q0BA 4KI6A 3DYAA 3O3HA 2A1RA 3MXJA 1W0HA 3V9UA 5C24A 4C8NA 1BL3A 2FBXA 3TABA 3PUFA 4B9UA 4DLEA 4FJ8A 1FXXA 4W5NA 3NGIA 4DFMA 3RWUA 1D9DA 2DFHA 2YNFA 4DF8A 3AA3A 2G8FA 4J2DA 4JS4A 5I42A 3TI0A 4GW6A 5CZ2A 4N76A
chains in the Genus database with same CATH superfamily
1DLOA 1D5AA 2Q1NA 2PYLA 4ZHRA 4ELVA 1HR0K 4DR7K 2NLXA 3P83D 4C1NK 4W5OA 3S3NA 4RW8A 5AQGA 3SAHA 5AQMA 5KI6A 4KB0A 5HRSA 2X6NA 3CC7N 4B08A 4I9QA 4DSEA 1I39A 1TAQA 5AQYA 4B3TK 1ZBIA 2HHSA 4CEZA 2A5XA 4PY5A 3AVHA 3WEEB 1JJ2M 1RFQA 3TSUA 4DHYA 4WCEL 3CG7A 1OKJA 1ZXOA 1QQMA 3H45C 3A5NC 3CC2N 2PY5A 2HF4A 1ASUA 3OBYA 3GDQA 1KXPA 3OA9A 4E1MA 4DV5K 3OS1A 2UU9K 2B6AA 1VQPN 3CXCM 1BO5O 1JLCA 4WQ5C 1C6VA 2VG7A 4H0TB 1ZBSA 4OLBA 1BCOA 1RT4A 3WQUA 4J2AA 3SMSA 4NXNK 5A2QO 1WBDA 1BU6O 4NCBA 1RBVA 4CZKA 1S6QA 3OYGA 3AARA 4FJHA 5JLFA 4FPBA 3ZT2A 1ASVA 4JKGA 2R7YA 3EEQA 1WB9A 3FFKB 2HBJA 1A5XA 3HVRA 4BRQA 3TPQA 1L3SA 4OKJA 4H0PA 4ZTJA 3P5JA 3O9TA 1VQ7N 3AVCA 2E2NA 3ZX0A 2ZM6K 1MDUB 2HOEA 2UXBK 1WSEA 1S1UA 4YOVA 4ELTA 1X1PA 3O4QA 3CHWA 3U3YA 3PX0A 1WUAA 1N8RO 3B6OA 3GBTA 1IO2A 4JKGB 1VHXA 1Q86O 1UA0A 1GLBG 4EAHD 4ELUA 1RDWX 4JKFA 3VQPA 2O8DA 3HRGA 4CJ3A 4E7LA 3IMXA 4U7BA 4KHWA 1O1WA 1P8ZA 2YHXA 3D45A 4BROA 4Z4EA 4GVEA 3LAKA 4DTUA 1VQ6N 3C6UA 5GIOA 4I2PA 3OBWA 1GLLO 4CEFA 1U2VA 3NBPA 2VG6A 1YJWN 3HPOA 1U04A 3QESA 2KW4A 2QWPA 1TGOA 4FPAA 2FBYA 4BWMA 5GINA 2F4VK 1V4SA 4DTOA 1RNHA 1RT5A 1ZC6A 3SUPA 2ZE2A 1C0FA 4XH5A 5GIPA 2WTUA 1LAVA 2P51A 2JWKA 1EX4A 3EE8A 5B8HA 4PWDA 5EX5A 4DWIA 4NO7A 1JLBA 3ZSQA 3VQEA 3PV8A 3FZHA 3V6DA 4CJ5A 3AA5X 3QBXA 3SI6A 5M1FA 1J53A 1RT2A 2D0OA 3WNHA 3WNFA 1X9SA 1NK8A 2ASPA 2HHUA 3NHGA 4B1XB 4GNIA 3DXKA 4CZGA 3K0SA 2RN2A 3OJSA 3W0LA 3QIPA 2E88A 2WBNA 4N41A 2V7ZA 5KQDA 5AQTA 1LOTB 1HRHA 1S6PA 4LSLA 4FJMA 2D0CA 2CGJA 4Q5VA 2UUAK 5AQRA 4DLGA 1Q9XA 5EVZA 1TK5A 2KHOA 4BG8A 1VQNN 2VWBA 2AJQA 3ENBA 4FWMA 3SMPA 1DEJA 1BGXT 3NGYA 4FLTA 2HNDA 1TUYA 3VQ4A 4K41A 5KPRA 2DTUA 2OPSA 3AVKA 1X9MA 2Z1IA 5BPLA 3QEXA 3VEVA 3SUOA 4DR3K 5FPMA 3SQ1A 2ASMA 4NCGA 4WFAL 3I0SA 1NK0A 3LP3A 3QNNA 4FJ8A 4EZ9A 1HPZA 3NCIA 2VGMA 4YOTA 1NGDA 1L3TA 2VWJA 1RTJA 3BZKA 3PY8A 4K25A 3HK2A 4NLCA 5HROA 4FJ9A 4CIGA 3P31A 2O8EB 2QKKA 3THYA 1VSIA 3CI5A 1DTQA 3C95A 3ZX3A 3CFPA 3VQBA 3SQ0A 1NKCA 2OPRA 3M1FA 3I56N 2E2QA 2DFFA 3RTVA 3QETA 4CJLA 4C8KA 4Y1DA 3DXMB 4M45A 4IWVA 2BE2A 3TAQA 1KLNA 1BI4A 4AQYK 4F3TA 1YTUA 4CCHA 3TSPA 3CJ9A 3UKRB 1WSFA 3AGRA 1RTHA 2D1KA 3ZSRA 1M1KO 2O8EA 4E19A 1WOQA 4BRHA 4BC5A 2E2PA 3J8AA 3U8XA 1C0UA 4B9MA 1GLJO 4FJ5A 4HCCA 1U6ZA 3O9RA 4JD2B 3O5BA 1EWRA 3ISNC 4HCBA 4E1NA 1TL1A 4PKHA 3UE5A 5GAHP 3FGUA 5KQ8A 1SUQA 3IAYA 4DQPA 4LFAK 3AO2A 2G8VA 3UB5A 4JI0K 3UKRA 1HQEA 3LM2A 3NAEA 4JV5K 4MFBA 5KGWA 1WAFA 4J2EA 4DQSA 2F9TA 3HOTA 1ATSA 4CEBA 3NH1A 1HJOA 1RT3A 1TVRA 3PSFA 3TR8A 1JLFA 3I8DA 3T1AA 4DSIA 4JI7K 4FXDA 3P39A 1IKWA 3B8AX 3T69A 1BDGA 3OYEA 3VQQA 4BGAA 3AGKA 1W2BM 3ZT0A 2PYJA 1BQMA 1I3AA 4PKGA 5I9EB 3QB0A 2F7TA 1RILA 4JKAA 3PO4A 4B3MK 1YIJN 4FL9A 1T3VA 4IBNA 3LDSA 4DV0K 4W5TA 3ULDA 4GVMA 5KRSA 1KCFA 1QSYA 5BN9A 4DFPA 1J54A 1DT9A 3I8BA 4RWTA 3CPWM 1NJXA 4WFNL 3DLLL 3ZSWA 4CJEA 3FE1A 3MAQA 1NBWA 3HSTB 1EKEA 4JI6K 4QS8A 1NK7A 3WXLA 1XUPO 2E1ZA 1NGCA 4H5TA 1RTDA 1RCHA 2AA4A 1BIUA 4M41A 1E4GT 5F0XA 3OY9A 3TWHA 2KZZA 1SL2A 2Q36A 2HHQA 3DLEA 5AQQA 4IZ9A 4O0IA 1WBBA 4M3ZA 3VTHA 4H0XB 4CECA 2NRXA 4FJLA 2GUPA 1QSSA 3CMEN 4FWRA 3O80A 5J2QA 3MXIA 5KPZA 3U6FA 3WNEA 1YAGA 3AVIA 4C1NI 4BWJA 1VSMA 5E26A 1JCEA 1L3VA 3B6PA 4L8RB 2BTFA 1NMNA 4JK9A 1K8AO 1B92A 1O13A 4M3UA 2NRWA 1BOTO 3HM8A 5C12A 2D5RA 4H0YB 1K6YA 3M5RA 4ILGB 1NK4A 3CCEN 4BC2A 4DTJA 4CZFA 2IVNA 5KPTA 4DFJA 3JS6A 3K9KA 4BE0A 4UQGA 2FBVA 4BE2A 4B9SA 3O8MA 1QZ5A 4IFYA 4G1QA 4AHSA 2P9SA 5SZTA 4RCHA 1YI2N 1U49A 4FOEA 4FWNA 1SKRA 3KIOA 4Q0BA 4KI6A 3DYAA 3V9UA 4ILJA 1BL3A 4B1VA 5F2RA 3TABA 1QZ6A 2CH6A 1NGJA 1TUUA 3RWUA 3AA3A 3MWTA 2G8FA 5I42A 3TI0A 5HBMA 4B9TA 3U9DA 4YNQA 2XO7A 2HHVA 1NK5A 1HMVA 3QFUA 1HYVA 4A57A 1N33K 1UWBA 4FZYA 2HMPA 1VRTA 4KHSA 1Z05A 4E89A 1NGFA 4KHUA 1KC8O 3BF3A 3KTQA 1VSHA 4ID5A 2W41A 1RT6A 1JL2A 1W97L 2FXUA 1XMOK 3MEDA 4K0KK 2QWLA 3QEWA 2O8DB 4KB1A 5MLCQ 4FVUA 1TYQB 4B3SK 1HKBA 4AHCA 3KD1E 1N6QA 2PZSA 1BHLA 3SK3A 3TANA 4DQQA 3H3OB 3FR0A 3MCPA 1IKXA 4CZIA 1NGBA 2XY7A 4HTUA 3NH0A 4YFUA 1RT1A 4A5AA 4OPAA 1S22A 3QEPA 3BGRA 5FRNA 4CEDA 2I5JA 3DLHA 3VA0A 3CCMN 4RW9A 3O3FA 1KRPA 3DI6A 4OLAA 2O8FA 2B4JA 1TKTA 1RBUA 3DRRA 4ID1A 1KSPA 3E66A 1VQON 1SAZA 4FWKA 5DM7L 3N4PA 1Q7YO 3SPYA 3NFAA 4GV9A 3F5TA 1VQ4N 3K5MA 4JYAK 3G71N 2QEXN 1VQ9N 3CF5L 3OYJA 4DSJA 1YTAA 1ZBFA 4FW2A 1NJZA 3K5OA 4DU1A 2YI1A 4FLUA 3HTVA 4FLVA 3MMVA 3CQ8A 1KAXA 2EHGA 3DLRA 3ATVA 1MWKA 3R6MA 3LP1A 4M3XA 3S3MA 3U4LA 3LDLA 3RMDA 1NG9A 4I6MA 4IKFA 3DOLA 4CD3A 3A0IX 3ID8A 3O3GA 4CIEA 3PIOL 3J7YP 3KWIA 1RDDA 3K9JA 1QHAA 4M63C 1RDAA 4DUYK 2RE2A 4BRCA 5HLFA 2W42A 1HNIA 3VQ5A 3SZ2A 3QLHA 5AQJA 4E7JA 2NRRA 3KLGA 2W6LA 4KAZA 2IVPA 3AVBA 3ENOA 4DTMA 3PO5A 3JAMO 1SL1A 4OPHA 4HUEA 1Y97A 3D2EB 2GTDA 5CY4A 4KI4A 4IO8A 1CZBA 2WFBA 3VEWA 2HHHK 4BR4A 3MECA 1CZAN 5GAEP 3CFRA 2YX6A 1LW2A 4ISFA 3THYB 5D3GA 1QQNA 4JKHA 5AQFA 5AQXA 3KD5E 5EU7A 3OYCA 3C94A 4CW7B 5BREA 1IG8A 2KFNA 1ATNA 1IKVA 3OYNA 4LF4K 4CZHA 3M8QA 4C8MA 1KAYA 4YOYA 2IC3A 3D2EA 4CJTA 4K8ZA 1XWLA 3EYZA 1RTIA 5AQZA 2VQEK 2O8BB 2O4IA 3KLFA 2NRHA 2W6KA 1JL1A 2E6LA 4DR5K 4O4GA 3ZCMA 1HLUA 3NMUA 3DM2A 4BE1A 4I9LA 2F96A 4JD2A 1NWKA 3WT0A 1JCFA 1Y64A 2HBMA 4KPYA 5BR9A 4HTLA 2JWLA 4Z4CA 3RSEA 4FSVA 4KTWA 1H1VA 3F9MA 2NNWA 3E9PA 4B8CA 2A42A 4CK2A 1OH6A 4DSFA 4OPKA 1KVBA 2PBDA 3TAPA 3H1VX 3CCQN 2AP1A 3CQYA 4DSLA 4O5BA 3CJ7A 3EZ5A 4FWOA 5FRMA 4EHUA 4JNEA 3KK2A 2HSTA 3VQDA 3L2QA 4FWQA 3QICA 4AHVA 4LF7K 1N36K 5DMRA 3HO1A 3OYBA 3RSEB 5LJVA 1ZBHA 3TAFA 2HF3A 3D2FA 2RPIA 1HQUA 1MU2A 2OTJN 4BVPA 2P9PA 2HW3A 3VF4A 4AM6A 1ZYQA 1QSLA 3PSIA 2A41A 1KAZA 2YHBA 2ZGYA 3D6RA 3VN5A 3L8BA 4XH1A 1HNWK 1JXEA 2O4GA 1U4BA 1ATRA 3MX5A 3VF2A 4R79A 5LL6Z 3SJJA 4H5VA 1Q9YA 1WSJA 3VGKA 3ZSOA 4FW1A 3HPHA 3V9WA 1IBKK 1NK9A 1KFDA 3K2PA 5HRNA 3E9LA 1Q82O 1HYSA 3PLAA 5BRFA 4NCAA 3V1OA 5F1XA 1VK0A 1EXQA 2HMIA 4BRDA 2E8AA 3T3FA 4F2RA 3IS9A 4B3RK 1UAXA 3HM9A 1YT3A 3K57A 5AQSA 3QIOA 3VETA 5FDLA 3HT3A 1T6DA 4A2AA 3LP0A 5DM6L 3JYTA 1U48A 1BISA 3ZT1A 4BDYA 4FJ7A 2YNIA 4WQ5A 3AAQA 2ZWHA 3Q7CA 3OW2M 3QMLA 3WNGA 4BREA 4M42A 1EQYA 4CJUA 3ZETA 4DQ8A 1X9JA 1MWMA 1JLGA 1L5UA 4OVLA 4CK3A 4PUOA 4KV8A 1VSJA 2KQ2A 1XHZA 1U2VB 2QK9A 4WQ4C 3MWPA 3KK3A 1WSHA 4NB4A 1WSIA 3O9UA 1BWFO 3A8YA 4CJSA 4YHHK 2UXDK 5J2PA 4IOCL 1GOBA 3CCRN 3SCXA 4KTQA 4KREA 5HL7L 3AO4A 3EZWA 5AFUA 1VAZA 1UA1A 2GV9A 3ULEA 2Q0RA 4FLZA 4IJNA 3DXKB 3OYMA 3C7NA 3V1RA 5EXWA 4CGDA 4YOWA 3OHRA 1GLCG 3DWLA 2XY5A 4CGJA 1GOAA 1YJNN 4UY8O 4O0JA 5KTQA 2QWQA 2F8TA 4IDHA 2P5GA 2HB5A 4FK4A 4N47A 2G8IA 3BZCA 1RGIA 4L3QA 4BDPA 2KTQA 4DKWA 2A3ZA 4B8AB 5CR4A 1ILYA 5M1KA 5BRDA 1TKDA 3VGLA 2Q3SA 3WQTA 3BDPA 3ITHA 3THWB 4U67L 1X3NA 3VEXA 4V19S 3O9SA 2E1YA 4CF9A 1T44A 1K8KB 4XIUA 4LF9K 3EKUA 2VG5A 3SPZA 3P1GA 2GX9A 3OTOK 2F8SA 3OS0A 1SZ2A 1GLDG 4KHQA 3CQXA 3M8SA 3BUZB 3THXB 5AQOA 4HWIA 3IFRA 3C6HA 1U45A 3K58A 3MN9A 3NF7A 4BY9C 3DAWA 1NK6A 3VEZA 2P9LA 2FF6A 2QWNA 3O3HA 4DV2K 1OVYA 1W0HA 4A62A 4DLEA 3VERA 3CJBA 2IVOA 2P9UB 3NGIA 4DFMA 1M90O 4JS4A 4GW6A 5CZ2A 5GADP 5BRHA 4CFAA 3J7AP 3K5LA 5LY3A 4DTSA 1V4TA 4B1WB 4CHOA 3TU5A 4BRPA 3T19A 4JS5A 4G9ZA 4YDUC 4YOUA 3AA2A 3AO1A 4B9VA 3V9XA 4DS4A 4RW6A 4BC4A 1JLQA 3UIQA 3AVAA 3KJVA 1NJYA 2Z1GA 3O1BA 1VQMN 2QWRA 3QBWA 4J8FA 3QNOA 1N34K 4CE9A 3KKSA 3F9KA 4FWPA 1R59O 3L4QA 2FSNA 3DOKA 4OGEA 3VEOA 4JAXA 3C65A 3TSQA 4LF8K 3V81A 3QDKA 5C0YA 1NOZA 1ITGA 1A5VA 4OKKA 2BGGA 4WF9L 2V7YA 3PIPL 5FPDA 1XI1A 2I7NA 1QS4A 2ATQA 3EL2A 4ILHA 1EWQA 3KZBA 1QE1A 2VCPA 4KFBA 1IJJA 1JCGA 1NLVA 1Q18A 3AVGA 3LPUA 3SJHA 2KZMA 3LP2A 2DY4A 4LF6K 4CBWA 5CYMA 5AZIB 3G25A 1Z26A 2OCEA 4JHDB 4QAGA 3JSMA 5CE3A 4OO1J 2ASOA 3FLCO 5E84A 5BPNA 2UXCK 4DR2K 1I94K 1S1WA 3HYFA 1IV0A 4CJPA 3VA3A 3VQ9A 3N4QA 2XY8A 1NJWA 1B9DA 3AAPA 4CFCA 5AJ3K 3NH2A 3G10A 4CBXA 3CCUN 4JRPA 4H0OA 3G4SN 3C6TA 5J2NA 4FCYA 3SUNA 5AZIA 1J5OA 1VSKA 4CZEA 4Z4FA 4DTPA 2OPQA 3RVCA 4Y1CA 5KGXA 1NGEA 1FJGK 2O8BA 5C42A 4CESA 4QS9A 2IOCA 1C1BA 3MEEA 1HNZK 3TAGA 3HJFA 3IG1A 4CGHA 4FM2A 3CJCA 3Q7BA 2YNGA 1W9HA 1ASWA 1F21A 3KVGA 4E7KA 2E5LK 1S1VA 3QEIA 3AA4A 5EY4A 3HSCA 2WOMA 3OYFA 5SWMA 1VQKN 5AQIA 4BRMA 1C1AA 1NOYA 4JK7A 4HUFA 5ADXH 4XEIA 4FWSA 2GWJA 5TKYA 5M1OA 3U9ZA 1T05A 1QVGM 3WXIA 2XY6A 4AHTA 3VQCA 4H5RA 3F2KA 1EETA 1N32K 3QERA 4EFHA 2Q31A 3NF6A 5BPMA 4DU4A 1NKBA 4FLYA 4A59A 4JI4K 2CH5A 2OPPA 2YHAA 4HVJA 4TSXA 3S41A 1YUWA 2NRTA 1BUPA 3VQ7A 3QEVA 2O8CB 3H08A 2Z1JA 3VEYA 1NGGA 4CZJA 3AVMA 4PKIA 3WXJA 2HBLA 4CJWA 4OPJA 4JK8A 3SYZA 1RBTA 4CEEA 3L4IA 1C1CA 4B9LA 4BR2A 1IBMK 1WLJA 3LDQA 3WEEA 3LALA 2QI2A 4EIAA 1QVFM 1Q81O 3BEXA 4PL7A 5K14A 1HUXA 1KVAA 4B1UB 4JRQA 1IBLK 1B9FA 2O8CA 2FF3B 3DLBA 2NUBA 3V4IA 4LD0A 4F4KA 3S3OA 4DG1A 4JI3K 4Z4HA 3SAFA 1VQLN 4CJ4A 4CZLA 3CC4N 3SQ4A 3V1QA 3CYMA 1ZBLA 3PX6A 4EZ6A 3L2WA 3ATUA 3VENA 4FK0A 3SV3A 4IO9L 2GUIA 3H3NO 4FK2A 3OYDA 2P9IB 3HI0A 4MLEA 2UUCK 1HNXK 4EP4A 1IH7A 3QINA 5IWAK 3HL8A 2YHYA 5E41A 2ZQBA 1C0GA 4DQRA 3D0PA 2G8HA 3ZETB 2GELA 1NM1A 2BH1A 2ZJQL 4KH5A 1OH8A 1FK9A 1SV5A 1QQOA 2P9SB 5C2DA 1X3MA 2FSJA 3O4WA 5CYQA 4BRLA 3ZX2A 1KFSA 1REVA 4CF1A 4CEOA 3NF9A 4WE1A 3ZSXA 4LFBK 5ADXA 1YVNA 3ZT3A 2P1JA 5LJWA 3LDOA 4BDZA 4MDBA 5I3UA 3L2UA 5AR0A 5C25A 2FSKA 4CERA 2D4WA 1LWEA 5IT9O 2Z1HA 5CHIA 3L2VA 4W5QA 4E7IA 4H8KA 1HKCA 3CD6N 3E01A 4M7YA 1D4XA 3O9QA 4W5RA 4DR6K 4CJVA 1S72N 4C8OA 4CJKA 2PAVA 4MQ3A 1D8YA 3OS2A 4OJRA 2ITGA 1YVUA 2RKIA 3V9SA 4EP5A 3BY5A 4CF8A 1RBRA 5H1SQ 1FKPA 2E4LA 4AILC 3ZSZA 1T6CA 1CLQA 5HRPA 2KKZA 3T1HK 2FBTA 4W5NA 4CHZA 2BDPA 3OYAA 4N56A 3PX4A 2HHXA 4CF0A 3DMJA 4A2BA 1OH7A 3A2FA 2CGLA 2OTLN 2G8WA 2RHKA 4CJ7A 3CCVN 5C2FA 3ID6A 3DJCA 2OZMA 4JKEA 1EP4A 2RF2A 4DSKA 3NVKA 3EO3A 3CFOA 1N5YA 3MX2A 1S1XA 4E3SA 1IG9A 2E6MA 4A5BA 3OYKA 4LC9B 1K8KA 4DV7K 2HHTA 3HP9A 1Q8IA 1JLAA 4JKCA 5AQNA 3P38A 2Q2RA 4DV6K 1BIZA 4FYDA 3KKRA 4FM0A 1TL3A 4FJGA 1TK0A 4NYFA 4B1ZA 3MK6A 1J6ZA 4CHPA 1JLEA 2P9LB 3M8RA 1DGKN 4QS7A 4GV3A 1OVQA 4FZZA 3NDKA 3DLGA 1L3UA 3NF8A 3WUHA 2P9UA 3ZEUB 4DTRA 1WSGA 1KQSM 3LWLA 3GOIA 1VSLA 3L3UA 2X78A 4F9OA 4IDKA 3RR8A 1XMQK 5M1NA 3MCAB 3A5OC 3CJAA 1NGIA 1QQCA 3GL1A 2WUSA 4B1YB 3JXUA 4I6MB 3AVFA 3SBGA 2OANA 4AHRA 1G15A 4CHYA 1XHXA 4DR4K 4CJFA 4JKBA 3HXMA 1NMDA 1VQ8N 4X66K 2NRVA 2YNHA 4E1JA 4BRNA 2HBKA 3MEGA 2KLAA 4IXCA 4NYNA 4KO0A 1CZ9A 1JXBA 5JICA 1YHQN 4DTXA 1YJ9N 4BQLA 3UKUA 3KLIA 4BR5A 3AV9A 3GG4A 2IAJA 3L0QA 3HZ6A 4ZTFA 3IDHA 2ITMA 2BANA 4O8UA 3M8PA 3QFPA 4FJNA 1VSDA 2DFEA 2D0AA 5HOOA 1WNSA 4H4MA 4H5NA 3L2RA 3LWMA 2GBZA 2V51B 3HPGA 4DF4A 3ZLJA 2ZJPL 2A1RA 2P9KA 4BR7A 3O1WA 3PUFA 4ISEA 4JHDA 3H1QA 3UKUB 4GKKK 4B9QA 2DFHA 4DF8A 1HX1A 4N76A 4PHTX 1XQSC 4NLBA 1SQKA 3RRHA 5HP1A 2UUBK 2HHWA 1BQNA 3H46O 3D2FB 5ELZA 4CGFA 1NGHA 2YKMA 3WXMB 1J5EK 1T7PA 2P5OA 5J2MA 4K43A 5FLXO 4JI1K 2X6SA 1IKYA 1RDUA 4LFCK 1XNQK 4I7FA 2D0BA 3L6QA 3M3ZA 4KH6A 1BI4B 3CETA 3IUCA 4E7HA 4YDUA 3TTFA 3AO3A 1NNEA 3SAGA 3CCJN 1SKWA 4Z4GA 3MN5A 1NKEA 3K5NA 3CIPA 4IEEA 3LPTA 5BN8A 3HP6A 4IJAA 3G6EN 1LWFA 2YJFA 1SS6A 3P4IA 4GKJK 3LZJA 1TKZA 4J2BA 4O8KA 4MO4A 4B9NA 3RMCA 2G8KA 2F9WA 3VF6A 1W7AA 3ZSYA 4BQZA 1LAWA 2QWOA 3KK7A 4H5WA 2E20A 4RW4A 5AQPA 4WQ4A 4K42A 4ICLA 1S1TA 4KHNA 4PA1A 2ETJA 4JLHA 2VQFK 2P9PB 1VSFA 4WYBA 4CZMA 4H4OA 2VGNA 4BR9A 4FM1A 5LMUK 3FZMA 3VPZA 2EX3A 4Z0UA 1RT7A 3T7ZA 4FJKA 4IFVA 3CM6A 4RW7A 4KHPK 2VYPA 2BUPA 3HVTA 2KFZA 5AQUA 3RMAA 4E0DA 4DR1K 3ZT4A 4IG0A 3EY1A 3CJ1A 5LMNK 1HPMA 4LY7A 4CFBA 4PQUA 4HHTA 1TV6A 4F2SA 4BRIA 4K8XA 3ENHA 3TAEA 5DK5A 2OA8A 2YCHA 4GMJB 3ALYA 4JEPA 3LL3A 3AO5A 4BACA 1X9WA 1UOCA 2ZGZA 3MN7A 5CZ1A 2Q0UA 2QXFA 3NVMA 1TAUA 1GLEG 2HNYA 4JN4A 5KRTA 3EE9A 4I2QA 4O55A 5C10A 3ULEB 3VTIA 2I7PA 3I55N 4JI5K 3M6GA 3SBTA 1A5WA 2IIRA 3C7NB 4BC3A 4YY3K 2OZSA 5JMVA 1LCUA 1BA1A 2DPNA 2Q97A 2VWKA 3EN9A 4AF1A 3SQ2A 4M3WA 4CEQA 5T7BA 1XNRK 2P9IA 5FROA 4PL8A 4X62K 2D0PA 4YORA 4AM7A 3VQ8A 3R9PA 1Z25A 2Y1IA 2JLEA 3OYLA 4C8LA 3IKMA 3FZKA 1SL0A 2ZF5O 3F73A 2P9NA 2YJEA 1DKGD 4CEAA 4FJIA 4LSNA 3FZFA 5FPEA 5BR8K 4CGIA 1YF5L 4MLHA 4DFKA 5JS1A 2NZTA 4NXMK 3GE1A 3VQ6A 3R3LA 3J80O 4DQIA 3C6AA 4IOAL 3O4NA 1K73O 4JI8K 4IEIA 5C15A 3HOSA 4CBUA 4Z94A 3CCSN 3G0ZA 1CXUA 1RBSA 4WFBL 3I0RA 3FFIA 4M3RA 3MDQA 2QW9A 2P9NB 2CGKA 5J1EA 1Z6RA 4CIFA 4LH5A 1J9AA 1WAJA 2IS3A 1C0TA 1MA9B 4X64K 2IGIA 4DV1K 3CM5A 2YKNA 3ZSVA 1GLAG 1KTQA 5TKWA 4Z4IA 4FZXC 3D7EO 5JVGL 4BG9A 2E2OA 2ZJRL 4FOIA 4A61A 3THWA 3K59A 1S9EA 3VGMA 2ZD1A 5AQKA 4F3OA 1VQ5N 2UYTA 3AVNA 3LM9A 4CJRA 3AVLA 3CMAN 4YOXA 4KBOA 3ASMA 4JI2K 5AQLA 3VMFB 3R8EA 4M7XA 4CHQA 1TKXA 3OYHA 3THXA 3CCLN 3A5LC 4BR0A 2HVIA 3MXMA 3J7ZO 4FO0A 2QA4N 2EWSA 4N5SA 4CHNA 1HYZA 3A5MC 2Y1JA 3OVNA 3THVA 1VSEA 1NJIO 1GOCA 3NGZA 4FLXA 2W40A 3SNNA 4ISGA 3L3VA 4R5PA 3LAMA 1E3MA 2LSNA 3W3DA 2H3GX 1TYQA 1HKGA 2QTDA 4CJQA 3J81O 4FJJA 3KWGA 1E4FT 3H6EA 1GLFO 3NE6A 1HNVA 5JLHA 5JVHL 4KRFA 4CGGA 3SV4A 1T03A 4DUZK 3HBTA 1TK8A 4QCLA 2X74A 1YXQA 4LF5K 4CI6A 4M3TA 5M1PA 1ESVA 4GV6A 3CERA 3ZEUA 4AH9A 4FWLA 2FC0A 3RRGA 4QOZB 2A6AA 1C0MA 4OKEA 3BF1A 3I33A 3DLKA 4M3YA 1WN7A 1S5JA 4O44A 1LV5A 1P90A 2QWMA 4XH4A 1EO1A 3FZLA 4BRGA 2WONA 4BRFA 2O8FB 4MDAA 5AFUH 3E9OA 1ZBUA 4DB3A 2HVHA 5GAGP 1FW6A 4DTNA 3KK1A 3DXMA 3MN6A 3AY9A 3TAMA 2GEMA 1VRUA 1JKHA 1BCMA 1SKSA 1BG3A 2PFUA 1NU0A 1XC3A 1T8EA 3LANA 5EOYA 1HJRA 5AQHA 3OJUA 3CPEA 3S9HA 4HUGA 4CF2A 4DS5A 3ZYYX 4BVOA 3RR7A 1R0AA 4F8RA 3U3GA 4KH4A 4IFEA 1KLMA 4RTFD 1CXQA 4OGCA 5M1QA 5HRRA 2YHWA 3WXKA 1G99A 3IRXA 1QTMA 3SUQA 3KHYA 3QO9A 4FVMA 3LDPA 1RDCA 3O6WA 2QKBA 1S9GA 2V52B 4IG3A 3VQAA 3R1XA 4KTZA 2WC9A 2P9KB 1KD1O 3OYIA 4CK1A 1LW0A 4FJXA 5AQVA 4Y0WA 1QHTA 4BRAA 4KKOA 4CVNE 2JGUA 1BA0A 2XHBA 3KLHA 1OH5A 3DRPA 4KHYA 2FLOA 3TTDA 4DU3A 2A40A 4BRKA 2B5JA 3TARA 2IDOA 3TTCA 4BGBA 1XC9A 3VESA 1KVCA 3KLEA 3AVJA 1LWCA 4AHUA 4B3OA 4O5FA 2J4RA 3SLCA 1YITN 3LDNA 4MO5A 5AZJB 3RMBA 4DMNA 4OX9K 1DTTA 2OYQA 4DV4K 1RDBA 4X65K 3LZIA 4CD1A 1U47A 2YV0X 4H0VB 1FKOA 4LH4A 4DV3K 2QM1A 4EHTA 4CFDA 4C23A 4RG8A 3DRSA 2QXLA 4IOXA 4FLWA 3O08A 4H03B 2A1SA 5JS2A 3C0BA 5FPNA 1D9FA 2HNZA 3T1YK 2G8UA 3BP8A 3V9ZA 2XRIA 5AZJA 1K9MO 3MXJA 1S3XA 3VOVA 5C24A 4C8NA 1NGAA 2FBXA 3E1YA 4DCHA 4JKDA 4B9UA 5AQWA 1FXXA 1D9DA 2NRZA 2YNFA 4J2DA 2GWKA 4GY2B 3EKSA
chains in the Genus database with same CATH topology
5HBMA 4B9TA 4CFAA 1DLOA 3K5LA 1D5AA 4DTSA 3RRHA 4ZHRA 5HP1A 2PYLA 4ELVA 2HHWA 4YNQA 2XO7A 1BQNA 4CHOA 2HHVA 3P83D 1NK5A 4W5OA 3S3NA 1HMVA 4RW8A 3T19A 5KI6A 4JS5A 4KB0A 4CGFA 5HRSA 1HYVA 2X6NA 2YKMA 4B08A 1T7PA 1UWBA 4FZYA 4DSEA 3AO1A 3AA2A 5J2MA 1I39A 1TAQA 3V9XA 4DS4A 2P5OA 4B9VA 1ZBIA 1VRTA 4RW6A 1JLQA 4KHSA 4CEZA 2X6SA 3UIQA 4E89A 2HHSA 3AVAA 3KJVA 1NJYA 1IKYA 2Z1GA 4KHUA 4PY5A 3AVHA 3QNOA 3KTQA 4I7FA 2D0BA 4CE9A 1VSHA 3KKSA 3F9KA 4ID5A 3CG7A 1BI4B 1RT6A 1JL2A 4E7HA 2PY5A 3DOKA 4OGEA 3MEDA 3QEWA 1ASUA 3AO3A 3V81A 4KB1A 1NOZA 4E1MA 1ITGA 4AHCA 1SKWA 3KD1E 1N6QA 2PZSA 1BHLA 4Z4GA 1A5VA 3TANA 4OKKA 4DQQA 2BGGA 3OS1A 1XI1A 1IKXA 1NKEA 2B6AA 3K5NA 1QS4A 2ATQA 2XY7A 3LPTA 4HTUA 3HP6A 3NH0A 1JLCA 4YFUA 1RT1A 1C6VA 1QE1A 2VG7A 1LWFA 4KFBA 4OLBA 4I9QA 3LZJA 1TKZA 4J2BA 1BCOA 1RT4A 4J2AA 4B9NA 3RMCA 2G8KA 3AVGA 3LPUA 2KZMA 3LP2A 2DY4A 3QEPA 3BGRA 4NCBA 4CEDA 2I5JA 3DLHA 5FRNA 1RBVA 5CYMA 3ZSYA 3VA0A 1S6QA 4RW9A 1LAWA 3OYGA 3O3FA 1Z26A 1KRPA 4DSLA 3DI6A 4OLAA 4RW4A 2B4JA 4QAGA 1TKTA 3JSMA 4FJHA 4ICLA 1S1TA 3ZT2A 1RBUA 3DRRA 4PA1A 4KHNA 1ASVA 2R7YA 4ID1A 1KSPA 2ETJA 1A5XA 3HVRA 4JLHA 3SPYA 1VSFA 3NFAA 1L3SA 1S1WA 4EZ6A 3HYFA 4OKJA 4H4OA 4CJPA 3VA3A 3VQ9A 4FM1A 3K5MA 4ZTJA 2XY8A 1NJWA 3P5JA 1B9DA 2EX3A 4Z0UA 3AVCA 1RT7A 4CFCA 4FJKA 4IFVA 3CM6A 4RW7A 3G10A 3NH2A 3OYJA 4DSJA 1YTAA 1ZBFA 4FW2A 4JRPA 1WSEA 3HVTA 2KFZA 3RMAA 1S1UA 1NJZA 4E0DA 3ZT4A 4IG0A 3C6TA 3K5OA 3EY1A 4FLUA 4DU1A 4FCYA 5J2NA 3SUNA 4FLVA 1J5OA 1VSKA 4ELTA 4LY7A 1X1PA 3O4QA 3CQ8A 3U3YA 2EHGA 3PX0A 4Z4FA 4DTPA 3B6OA 3DLRA 2OPQA 4CFBA 4Y1CA 1IO2A 5KGXA 4PQUA 4HHTA 1TV6A 5C42A 4CESA 3LP1A 1UA0A 2IOCA 1C1BA 4F2SA 4ELUA 3S3MA 4K8XA 4M3XA 3MEEA 3TAEA 3VQPA 3RMDA 5DK5A 4CJ3A 4E7LA 4IKFA 3DOLA 2OA8A 1O1WA 3TAGA 4GMJB 3D45A 3ALYA 4KHWA 4Z4EA 3HJFA 3LAKA 4DTUA 3IG1A 3C6UA 4I2PA 3O3GA 4CIEA 4CGHA 3AO5A 4CEFA 4BACA 1X9WA 1UOCA 3NBPA 2VG6A 4FM2A 3HPOA 1U04A 1RDDA 2KW4A 2QXFA 2YNGA 5CZ1A 1W9HA 3QESA 1TAUA 2HNYA 1ASWA 1TGOA 1F21A 5KRTA 4BWMA 2FBYA 1RDAA 4E7KA 4DTOA 1RNHA 2W42A 1RT5A 1S1VA 3AA4A 4I2QA 1HNIA 4O55A 3QEIA 5HLFA 3SUPA 2WOMA 3VQ5A 3OYFA 3QLHA 5SWMA 3SZ2A 4J2EA 4E7JA 1C1AA 3KLGA 4KAZA 2ZE2A 1NOYA 3AVBA 4DTMA 1A5WA 3PO5A 1SL1A 4HUEA 4HUFA 1Y97A 1LAVA 2P51A 5CY4A 4KI4A 1EX4A 2OZSA 1CZBA 4PWDA 3MECA 3CFRA 3SQ2A 1LW2A 2VWKA 4DWIA 4M3WA 1JLBA 1T05A 5D3GA 3ZSQA 3VQEA 3PV8A 3V6DA 4CEQA 4CJ5A 3AA5X 5T7BA 2XY6A 4AHTA 3SI6A 5FROA 1J53A 1RT2A 3VQCA 3WNHA 5EU7A 1EETA 3OYCA 3C94A 3QERA 3WNFA 3KD5E 1X9SA 1NK8A 2HHUA 3NHGA 2KFNA 3NF6A 4DU4A 1NKBA 4FLYA 3VQ8A 1IKVA 3OYNA 2RN2A 1Z25A 3OJSA 2OPPA 3M8QA 3QIPA 4C8MA 2YHAA 4HVJA 2Y1IA 4TSXA 2JLEA 4N41A 3VQ7A 3OYLA 3QEVA 4C8LA 3H08A 2IC3A 4CJTA 2Z1JA 4K8ZA 1XWLA 1HRHA 1S6PA 1SL0A 4LSLA 3EYZA 4FJMA 3AVMA 2D0CA 1RTIA 4Q5VA 4CJWA 3F73A 4OPJA 4DLGA 1Q9XA 3SYZA 1RBTA 2O4IA 3KLFA 4CEAA 4CEEA 1TK5A 1C1CA 4FJIA 1JL1A 4LSNA 2E6LA 4B9LA 4O4GA 3ZCMA 4CGIA 3DM2A 4BE1A 4I9LA 4DFKA 1WLJA 2AJQA 2F96A 5JS1A 3NGYA 1BGXT 4FLTA 3LALA 2HNDA 3VQ4A 3VQ6A 4DQIA 2DTUA 2OPSA 3AVKA 1X9MA 4KPYA 2Z1IA 3QEXA 3O4NA 5K14A 3SUOA 4Z4CA 1KVAA 4JRQA 3SQ1A 4NCGA 4KTWA 3G0ZA 3I0SA 1B9FA 1NK0A 1CXUA 3LP3A 1RBSA 4B8CA 3DLBA 4CK2A 2NUBA 3I0RA 4DSFA 3QNNA 4OPKA 4LD0A 3FFIA 3V4IA 4DG1A 3S3OA 4EZ9A 1HPZA 4M3RA 1KVBA 3NCIA 4F4KA 1L3TA 2VWJA 3TAPA 1RTJA 5J1EA 3PY8A 3HK2A 4Z4HA 5HROA 4FJ9A 4CIGA 2QKKA 4CJ4A 4CIFA 3SQ4A 4LH5A 3V1QA 3CYMA 1J9AA 4O5BA 3PX6A 3L2WA 3EZ5A 1ZBLA 1WAJA 1VSIA 2PYJA 3SQ0A 1DTQA 3C95A 3CFPA 2IS3A 1C0TA 3VQBA 3SV3A 4FK0A 1NKCA 2IGIA 5FRMA 2GUIA 3CM5A 2OPRA 4FK2A 2YKNA 3ZSVA 1KTQA 3OYDA 3KK2A 4Z4IA 4FZXC 3VQDA 3L2QA 4AHVA 2DFFA 3K59A 3RTVA 1S9EA 5DMRA 3HM9A 3QETA 4CJLA 4EP4A 3OYBA 4C8KA 3HO1A 4Y1DA 1ZBHA 1IH7A 2ZD1A 3QINA 3TAFA 4M45A 4F3OA 2BE2A 3HL8A 3TAQA 1KLNA 3AVNA 1BI4A 5E41A 2RPIA 2ZQBA 4F3TA 1HQUA 1YTUA 1MU2A 4CCHA 4DQRA 3D0PA 2G8HA 4CJRA 3AVLA 1WSFA 1RTHA 3ZSRA 3ASMA 1FK9A 4E19A 1SV5A 4CHQA 1TKXA 3OYHA 2HW3A 2HVIA 3MXMA 5CYQA 1ZYQA 1QSLA 1KFSA 1C0UA 1REVA 4N5SA 4CF1A 4CHNA 4B9MA 1HYZA 4CEOA 4FJ5A 4HCCA 2YHBA 3NF9A 4WE1A 3ZSXA 2Y1JA 3OVNA 3VN5A 3THVA 3L8BA 1VSEA 3ISNC 3ZT3A 4HCBA 1GOCA 2P1JA 4E1NA 3NGZA 1JXEA 4BDZA 4FLXA 1TL1A 3SNNA 5I3UA 3L2UA 2O4GA 3L3VA 4CERA 5C25A 1LWEA 4R5PA 1U4BA 3LAMA 2Z1HA 2LSNA 1SUQA 4C8OA 3IAYA 4DQPA 3L2VA 3AO2A 4W5QA 4CJQA 4E7IA 4FJJA 4H8KA 2G8VA 3SJJA 3NE6A 3E01A 1HQEA 1HNVA 1Q9YA 1WSJA 3ZSOA 3NAEA 4W5RA 4KRFA 4FW1A 4CGGA 4CJVA 4MFBA 5KGWA 1WAFA 4CJKA 4MQ3A 3SV4A 4DQSA 1T03A 3OS2A 1TK8A 4OJRA 2X74A 3HPHA 3V9WA 2ITGA 1D8YA 4M3TA 4QCLA 1YVUA 2RKIA 3V9SA 1KFDA 3K2PA 4EP5A 5HRNA 1NK9A 4CF8A 1RBRA 1HYSA 4CEBA 1FKPA 2E4LA 3NH1A 1RT3A 3ZSZA 4AILC 5HRPA 1TVRA 4AH9A 2FBTA 1JLFA 3TR8A 3T1AA 3I8DA 2FC0A 3RRGA 4DSIA 4CHZA 3V1OA 1IKWA 4NCAA 4FXDA 1C0MA 1VK0A 2BDPA 4QOZB 1EXQA 3OYAA 2HMIA 4OKEA 4N56A 3OYEA 3T3FA 3DLKA 4F2RA 3PX4A 3IS9A 3VQQA 4M3YA 1UAXA 1WN7A 3DMJA 3ZT0A 1S5JA 1BQMA 1I3AA 1YT3A 3A2FA 4O44A 4CF0A 3K57A 1LV5A 2G8WA 2HHXA 2WONA 3QIOA 1RILA 3PO4A 1ZBUA 5FDLA 3HT3A 2HVHA 4DTNA 4IBNA 3LDSA 3KK1A 3LP0A 3JYTA 1U48A 4W5TA 3ULDA 1BISA 3TAMA 2OZMA 3ZT1A 4BDYA 1EP4A 4GVMA 5KRSA 2RF2A 1KCFA 2YNIA 4FJ7A 1VRUA 1JKHA 1QSYA 4DSKA 1CLQA 3WNGA 1BCMA 1SKSA 3CFOA 4DFPA 1J54A 1N5YA 4M42A 1T8EA 3LANA 4CJUA 1S1XA 4E3SA 1HJRA 1NJXA 1IG9A 2E6MA 3OJUA 1JLGA 3ZSWA 4CJEA 4HUGA 3S9HA 4OVLA 1L5UA 4CK3A 4PUOA 3MAQA 4CF2A 4KV8A 4DS5A 1VSJA 2KQ2A 3HSTB 1EKEA 1XHZA 3OYKA 2QK9A 3RR7A 1R0AA 1NK7A 3U3GA 4F8RA 2HHTA 3HP9A 1Q8IA 1JLAA 3KK3A 1KLMA 1WSHA 1WSIA 1CXQA 4OGCA 1RTDA 1RCHA 1BIZA 4FYDA 3KKRA 5HRRA 1BIUA 4FM0A 1QTMA 3IRXA 4M41A 3SUQA 4CJSA 3OY9A 1TL3A 3QO9A 3TWHA 1TK0A 4FJGA 4FVMA 5J2PA 2KZZA 4NYFA 3SCXA 1GOBA 4KREA 4KTQA 1SL2A 2HHQA 3AO4A 1RDCA 4CHPA 2QKBA 3DLEA 1UA1A 1S9GA 1JLEA 4IG3A 3VQAA 4O0IA 4KTZA 3M8RA 4M3ZA 2GV9A 3OYIA 4CK1A 1LW0A 4FJXA 4FZZA 3NDKA 4CECA 4FJLA 3DLGA 1L3UA 1QHTA 1QSSA 4KKOA 3NF8A 2JGUA 2XHBA 4DTRA 3KLHA 1WSGA 3LWLA 1VSLA 4FLZA 3L3UA 3DRPA 5J2QA 3MXIA 4KHYA 3OYMA 4DU3A 2X78A 3U6FA 3WNEA 3V1RA 4CGDA 3AVIA 4IDKA 3RR8A 4BWJA 2B5JA 3TARA 1VSMA 2XY5A 2IDOA 1GOAA 4CGJA 1L3VA 3B6PA 1QQCA 4L8RB 4O0JA 5KTQA 1XC9A 1KVCA 2F8TA 3KLEA 1B92A 3AVJA 3AVFA 1LWCA 4AHUA 2P5GA 4B3OA 2HB5A 4M3UA 4FK4A 4N47A 2G8IA 4AHRA 1G15A 4CHYA 1XHXA 4BDPA 2KTQA 4CJFA 3HXMA 4B8AB 2D5RA 3RMBA 4DMNA 1TKDA 1K6YA 2Q3SA 1NK4A 2YNHA 3BDPA 3ITHA 1DTTA 3MEGA 4DTJA 2OYQA 4NYNA 4KO0A 1CZ9A 1JXBA 1RDBA 4DTXA 4CF9A 3LZIA 3KLIA 4DFJA 3AV9A 1U47A 2YV0X 4XIUA 4BE0A 1FKOA 2VG5A 4LH4A 4UQGA 2FBVA 2IAJA 3SPZA 4BE2A 3P1GA 2F8SA 3OS0A 4B9SA 4ZTFA 4KHQA 4CFDA 4IFYA 2BANA 4RG8A 3DRSA 3M8PA 4G1QA 4FLWA 3M8SA 4FJNA 1VSDA 2DFEA 4AHSA 2D0AA 2A1SA 5SZTA 1U49A 1WNSA 5JS2A 4H4MA 1U45A 1SKRA 1D9FA 3K58A 2HNZA 3KIOA 3L2RA 3NF7A 2GBZA 3HPGA 3LWMA 4DF4A 2G8UA 3V9ZA 2XRIA 1NK6A 4Q0BA 4KI6A 3DYAA 3O3HA 2A1RA 3MXJA 1W0HA 3V9UA 5C24A 4C8NA 1BL3A 2FBXA 3TABA 3PUFA 4B9UA 4DLEA 4FJ8A 1FXXA 4W5NA 3NGIA 4DFMA 3RWUA 1D9DA 2DFHA 2YNFA 4DF8A 3AA3A 2G8FA 4J2DA 4JS4A 5I42A 3TI0A 4GW6A 5CZ2A 4N76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBM A;  4B9T A;  4CFA A;  1DLO A;  3K5L A;  1D5A A;  4DTS A;  3RRH A;  4ZHR A;  5HP1 A;  2PYL A;  4ELV A;  2HHW A;  4YNQ A;  2XO7 A;  1BQN A;  4CHO A;  2HHV A;  3P83 D;  1NK5 A;  4W5O A;  3S3N A;  1HMV A;  4RW8 A;  3T19 A;  5KI6 A;  4JS5 A;  4KB0 A;  4CGF A;  5HRS A;  1HYV A;  2X6N A;  2YKM A;  4B08 A;  1T7P A;  1UWB A;  4FZY A;  4DSE A;  3AO1 A;  3AA2 A;  5J2M A;  1I39 A;  1TAQ A;  3V9X A;  4DS4 A;  2P5O A;  4B9V A;  1ZBI A;  1VRT A;  4RW6 A;  1JLQ A;  4KHS A;  4CEZ A;  2X6S A;  3UIQ A;  4E89 A;  2HHS A;  3AVA A;  3KJV A;  1NJY A;  1IKY A;  2Z1G A;  4KHU A;  4PY5 A;  3AVH A;  3QNO A;  3KTQ A;  4I7F A;  2D0B A;  4CE9 A;  1VSH A;  3KKS A;  3F9K A;  4ID5 A;  3CG7 A;  1BI4 B;  1RT6 A;  1JL2 A;  4E7H A;  2PY5 A;  3DOK A;  4OGE A;  3MED A;  3QEW A;  1ASU A;  3AO3 A;  3V81 A;  4KB1 A;  1NOZ A;  4E1M A;  1ITG A;  4AHC A;  1SKW A;  3KD1 E;  1N6Q A;  2PZS A;  1BHL A;  4Z4G A;  1A5V A;  3TAN A;  4OKK A;  4DQQ A;  2BGG A;  3OS1 A;  1XI1 A;  1IKX A;  1NKE A;  2B6A A;  3K5N A;  1QS4 A;  2ATQ A;  2XY7 A;  3LPT A;  4HTU A;  3HP6 A;  3NH0 A;  1JLC A;  4YFU A;  1RT1 A;  1C6V A;  1QE1 A;  2VG7 A;  1LWF A;  4KFB A;  4OLB A;  4I9Q A;  3LZJ A;  1TKZ A;  4J2B A;  1BCO A;  1RT4 A;  4J2A A;  4B9N A;  3RMC A;  2G8K A;  3AVG A;  3LPU A;  2KZM A;  3LP2 A;  2DY4 A;  3QEP A;  3BGR A;  4NCB A;  4CED A;  2I5J A;  3DLH A;  5FRN A;  1RBV A;  5CYM A;  3ZSY A;  3VA0 A;  1S6Q A;  4RW9 A;  1LAW A;  3OYG A;  3O3F A;  1Z26 A;  1KRP A;  4DSL A;  3DI6 A;  4OLA A;  4RW4 A;  2B4J A;  4QAG A;  1TKT A;  3JSM A;  4FJH A;  4ICL A;  1S1T A;  3ZT2 A;  1RBU A;  3DRR A;  4PA1 A;  4KHN A;  1ASV A;  2R7Y A;  4ID1 A;  1KSP A;  2ETJ A;  1A5X A;  3HVR A;  4JLH A;  3SPY A;  1VSF A;  3NFA A;  1L3S A;  1S1W A;  4EZ6 A;  3HYF A;  4OKJ A;  4H4O A;  4CJP A;  3VA3 A;  3VQ9 A;  4FM1 A;  3K5M A;  4ZTJ A;  2XY8 A;  1NJW A;  3P5J A;  1B9D A;  2EX3 A;  4Z0U A;  3AVC A;  1RT7 A;  4CFC A;  4FJK A;  4IFV A;  3CM6 A;  4RW7 A;  3G10 A;  3NH2 A;  3OYJ A;  4DSJ A;  1YTA A;  1ZBF A;  4FW2 A;  4JRP A;  1WSE A;  3HVT A;  2KFZ A;  3RMA A;  1S1U A;  1NJZ A;  4E0D A;  3ZT4 A;  4IG0 A;  3C6T A;  3K5O A;  3EY1 A;  4FLU A;  4DU1 A;  4FCY A;  5J2N A;  3SUN A;  4FLV A;  1J5O A;  1VSK A;  4ELT A;  4LY7 A;  1X1P A;  3O4Q A;  3CQ8 A;  3U3Y A;  2EHG A;  3PX0 A;  4Z4F A;  4DTP A;  3B6O A;  3DLR A;  2OPQ A;  4CFB A;  4Y1C A;  1IO2 A;  5KGX A;  4PQU A;  4HHT A;  1TV6 A;  5C42 A;  4CES A;  3LP1 A;  1UA0 A;  2IOC A;  1C1B A;  4F2S A;  4ELU A;  3S3M A;  4K8X A;  4M3X A;  3MEE A;  3TAE A;  3VQP A;  3RMD A;  5DK5 A;  4CJ3 A;  4E7L A;  4IKF A;  3DOL A;  2OA8 A;  1O1W A;  3TAG A;  4GMJ B;  3D45 A;  3ALY A;  4KHW A;  4Z4E A;  3HJF A;  3LAK A;  4DTU A;  3IG1 A;  3C6U A;  4I2P A;  3O3G A;  4CIE A;  4CGH A;  3AO5 A;  4CEF A;  4BAC A;  1X9W A;  1UOC A;  3NBP A;  2VG6 A;  4FM2 A;  3HPO A;  1U04 A;  1RDD A;  2KW4 A;  2QXF A;  2YNG A;  5CZ1 A;  1W9H A;  3QES A;  1TAU A;  2HNY A;  1ASW A;  1TGO A;  1F21 A;  5KRT A;  4BWM A;  2FBY A;  1RDA A;  4E7K A;  4DTO A;  1RNH A;  2W42 A;  1RT5 A;  1S1V A;  3AA4 A;  4I2Q A;  1HNI A;  4O55 A;  3QEI A;  5HLF A;  3SUP A;  2WOM A;  3VQ5 A;  3OYF A;  3QLH A;  5SWM A;  3SZ2 A;  4J2E A;  4E7J A;  1C1A A;  3KLG A;  4KAZ A;  2ZE2 A;  1NOY A;  3AVB A;  4DTM A;  1A5W A;  3PO5 A;  1SL1 A;  4HUE A;  4HUF A;  1Y97 A;  1LAV A;  2P51 A;  5CY4 A;  4KI4 A;  1EX4 A;  2OZS A;  1CZB A;  4PWD A;  3MEC A;  3CFR A;  3SQ2 A;  1LW2 A;  2VWK A;  4DWI A;  4M3W A;  1JLB A;  1T05 A;  5D3G A;  3ZSQ A;  3VQE A;  3PV8 A;  3V6D A;  4CEQ A;  4CJ5 A;  3AA5 X;  5T7B A;  2XY6 A;  4AHT A;  3SI6 A;  5FRO A;  1J53 A;  1RT2 A;  3VQC A;  3WNH A;  5EU7 A;  1EET A;  3OYC A;  3C94 A;  3QER A;  3WNF A;  3KD5 E;  1X9S A;  1NK8 A;  2HHU A;  3NHG A;  2KFN A;  3NF6 A;  4DU4 A;  1NKB A;  4FLY A;  3VQ8 A;  1IKV A;  3OYN A;  2RN2 A;  1Z25 A;  3OJS A;  2OPP A;  3M8Q A;  3QIP A;  4C8M A;  2YHA A;  4HVJ A;  2Y1I A;  4TSX A;  2JLE A;  4N41 A;  3VQ7 A;  3OYL A;  3QEV A;  4C8L A;  3H08 A;  2IC3 A;  4CJT A;  2Z1J A;  4K8Z A;  1XWL A;  1HRH A;  1S6P A;  1SL0 A;  4LSL A;  3EYZ A;  4FJM A;  3AVM A;  2D0C A;  1RTI A;  4Q5V A;  4CJW A;  3F73 A;  4OPJ A;  4DLG A;  1Q9X A;  3SYZ A;  1RBT A;  2O4I A;  3KLF A;  4CEA A;  4CEE A;  1TK5 A;  1C1C A;  4FJI A;  1JL1 A;  4LSN A;  2E6L A;  4B9L A;  4O4G A;  3ZCM A;  4CGI A;  3DM2 A;  4BE1 A;  4I9L A;  4DFK A;  1WLJ A;  2AJQ A;  2F96 A;  5JS1 A;  3NGY A;  1BGX T;  4FLT A;  3LAL A;  2HND A;  3VQ4 A;  3VQ6 A;  4DQI A;  2DTU A;  2OPS A;  3AVK A;  1X9M A;  4KPY A;  2Z1I A;  3QEX A;  3O4N A;  5K14 A;  3SUO A;  4Z4C A;  1KVA A;  4JRQ A;  3SQ1 A;  4NCG A;  4KTW A;  3G0Z A;  3I0S A;  1B9F A;  1NK0 A;  1CXU A;  3LP3 A;  1RBS A;  4B8C A;  3DLB A;  4CK2 A;  2NUB A;  3I0R A;  4DSF A;  3QNN A;  4OPK A;  4LD0 A;  3FFI A;  3V4I A;  4DG1 A;  3S3O A;  4EZ9 A;  1HPZ A;  4M3R A;  1KVB A;  3NCI A;  4F4K A;  1L3T A;  2VWJ A;  3TAP A;  1RTJ A;  5J1E A;  3PY8 A;  3HK2 A;  4Z4H A;  5HRO A;  4FJ9 A;  4CIG A;  2QKK A;  4CJ4 A;  4CIF A;  3SQ4 A;  4LH5 A;  3V1Q A;  3CYM A;  1J9A A;  4O5B A;  3PX6 A;  3L2W A;  3EZ5 A;  1ZBL A;  1WAJ A;  1VSI A;  2PYJ A;  3SQ0 A;  1DTQ A;  3C95 A;  3CFP A;  2IS3 A;  1C0T A;  3VQB A;  3SV3 A;  4FK0 A;  1NKC A;  2IGI A;  5FRM A;  2GUI A;  3CM5 A;  2OPR A;  4FK2 A;  2YKN A;  3ZSV A;  1KTQ A;  3OYD A;  3KK2 A;  4Z4I A;  4FZX C;  3VQD A;  3L2Q A;  4AHV A;  2DFF A;  3K59 A;  3RTV A;  1S9E A;  5DMR A;  3HM9 A;  3QET A;  4CJL A;  4EP4 A;  3OYB A;  4C8K A;  3HO1 A;  4Y1D A;  1ZBH A;  1IH7 A;  2ZD1 A;  3QIN A;  3TAF A;  4M45 A;  4F3O A;  2BE2 A;  3HL8 A;  3TAQ A;  1KLN A;  3AVN A;  1BI4 A;  5E41 A;  2RPI A;  2ZQB A;  4F3T A;  1HQU A;  1YTU A;  1MU2 A;  4CCH A;  4DQR A;  3D0P A;  2G8H A;  4CJR A;  3AVL A;  1WSF A;  1RTH A;  3ZSR A;  3ASM A;  1FK9 A;  4E19 A;  1SV5 A;  4CHQ A;  1TKX A;  3OYH A;  2HW3 A;  2HVI A;  3MXM A;  5CYQ A;  1ZYQ A;  1QSL A;  1KFS A;  1C0U A;  1REV A;  4N5S A;  4CF1 A;  4CHN A;  4B9M A;  1HYZ A;  4CEO A;  4FJ5 A;  4HCC A;  2YHB A;  3NF9 A;  4WE1 A;  3ZSX A;  2Y1J A;  3OVN A;  3VN5 A;  3THV A;  3L8B A;  1VSE A;  3ISN C;  3ZT3 A;  4HCB A;  1GOC A;  2P1J A;  4E1N A;  3NGZ A;  1JXE A;  4BDZ A;  4FLX A;  1TL1 A;  3SNN A;  5I3U A;  3L2U A;  2O4G A;  3L3V A;  4CER A;  5C25 A;  1LWE A;  4R5P A;  1U4B A;  3LAM A;  2Z1H A;  2LSN A;  1SUQ A;  4C8O A;  3IAY A;  4DQP A;  3L2V A;  3AO2 A;  4W5Q A;  4CJQ A;  4E7I A;  4FJJ A;  4H8K A;  2G8V A;  3SJJ A;  3NE6 A;  3E01 A;  1HQE A;  1HNV A;  1Q9Y A;  1WSJ A;  3ZSO A;  3NAE A;  4W5R A;  4KRF A;  4FW1 A;  4CGG A;  4CJV A;  4MFB A;  5KGW A;  1WAF A;  4CJK A;  4MQ3 A;  3SV4 A;  4DQS A;  1T03 A;  3OS2 A;  1TK8 A;  4OJR A;  2X74 A;  3HPH A;  3V9W A;  2ITG A;  1D8Y A;  4M3T A;  4QCL A;  1YVU A;  2RKI A;  3V9S A;  1KFD A;  3K2P A;  4EP5 A;  5HRN A;  1NK9 A;  4CF8 A;  1RBR A;  1HYS A;  4CEB A;  1FKP A;  2E4L A;  3NH1 A;  1RT3 A;  3ZSZ A;  4AIL C;  5HRP A;  1TVR A;  4AH9 A;  2FBT A;  1JLF A;  3TR8 A;  3T1A A;  3I8D A;  2FC0 A;  3RRG A;  4DSI A;  4CHZ A;  3V1O A;  1IKW A;  4NCA A;  4FXD A;  1C0M A;  1VK0 A;  2BDP A;  4QOZ B;  1EXQ A;  3OYA A;  2HMI A;  4OKE A;  4N56 A;  3OYE A;  3T3F A;  3DLK A;  4F2R A;  3PX4 A;  3IS9 A;  3VQQ A;  4M3Y A;  1UAX A;  1WN7 A;  3DMJ A;  3ZT0 A;  1S5J A;  1BQM A;  1I3A A;  1YT3 A;  3A2F A;  4O44 A;  4CF0 A;  3K57 A;  1LV5 A;  2G8W A;  2HHX A;  2WON A;  3QIO A;  1RIL A;  3PO4 A;  1ZBU A;  5FDL A;  3HT3 A;  2HVH A;  4DTN A;  4IBN A;  3LDS A;  3KK1 A;  3LP0 A;  3JYT A;  1U48 A;  4W5T A;  3ULD A;  1BIS A;  3TAM A;  2OZM A;  3ZT1 A;  4BDY A;  1EP4 A;  4GVM A;  5KRS A;  2RF2 A;  1KCF A;  2YNI A;  4FJ7 A;  1VRU A;  1JKH A;  1QSY A;  4DSK A;  1CLQ A;  3WNG A;  1BCM A;  1SKS A;  3CFO A;  4DFP A;  1J54 A;  1N5Y A;  4M42 A;  1T8E A;  3LAN A;  4CJU A;  1S1X A;  4E3S A;  1HJR A;  1NJX A;  1IG9 A;  2E6M A;  3OJU A;  1JLG A;  3ZSW A;  4CJE A;  4HUG A;  3S9H A;  4OVL A;  1L5U A;  4CK3 A;  4PUO A;  3MAQ A;  4CF2 A;  4KV8 A;  4DS5 A;  1VSJ A;  2KQ2 A;  3HST B;  1EKE A;  1XHZ A;  3OYK A;  2QK9 A;  3RR7 A;  1R0A A;  1NK7 A;  3U3G A;  4F8R A;  2HHT A;  3HP9 A;  1Q8I A;  1JLA A;  3KK3 A;  1KLM A;  1WSH A;  1WSI A;  1CXQ A;  4OGC A;  1RTD A;  1RCH A;  1BIZ A;  4FYD A;  3KKR A;  5HRR A;  1BIU A;  4FM0 A;  1QTM A;  3IRX A;  4M41 A;  3SUQ A;  4CJS A;  3OY9 A;  1TL3 A;  3QO9 A;  3TWH A;  1TK0 A;  4FJG A;  4FVM A;  5J2P A;  2KZZ A;  4NYF A;  3SCX A;  1GOB A;  4KRE A;  4KTQ A;  1SL2 A;  2HHQ A;  3AO4 A;  1RDC A;  4CHP A;  2QKB A;  3DLE A;  1UA1 A;  1S9G A;  1JLE A;  4IG3 A;  3VQA A;  4O0I A;  4KTZ A;  3M8R A;  4M3Z A;  2GV9 A;  3OYI A;  4CK1 A;  1LW0 A;  4FJX A;  4FZZ A;  3NDK A;  4CEC A;  4FJL A;  3DLG A;  1L3U A;  1QHT A;  1QSS A;  4KKO A;  3NF8 A;  2JGU A;  2XHB A;  4DTR A;  3KLH A;  1WSG A;  3LWL A;  1VSL A;  4FLZ A;  3L3U A;  3DRP A;  5J2Q A;  3MXI A;  4KHY A;  3OYM A;  4DU3 A;  2X78 A;  3U6F A;  3WNE A;  3V1R A;  4CGD A;  3AVI A;  4IDK A;  3RR8 A;  4BWJ A;  2B5J A;  3TAR A;  1VSM A;  2XY5 A;  2IDO A;  1GOA A;  4CGJ A;  1L3V A;  3B6P A;  1QQC A;  4L8R B;  4O0J A;  5KTQ A;  1XC9 A;  1KVC A;  2F8T A;  3KLE A;  1B92 A;  3AVJ A;  3AVF A;  1LWC A;  4AHU A;  2P5G A;  4B3O A;  2HB5 A;  4M3U A;  4FK4 A;  4N47 A;  2G8I A;  4AHR A;  1G15 A;  4CHY A;  1XHX A;  4BDP A;  2KTQ A;  4CJF A;  3HXM A;  4B8A B;  2D5R A;  3RMB A;  4DMN A;  1TKD A;  1K6Y A;  2Q3S A;  1NK4 A;  2YNH A;  3BDP A;  3ITH A;  1DTT A;  3MEG A;  4DTJ A;  2OYQ A;  4NYN A;  4KO0 A;  1CZ9 A;  1JXB A;  1RDB A;  4DTX A;  4CF9 A;  3LZI A;  3KLI A;  4DFJ A;  3AV9 A;  1U47 A;  2YV0 X;  4XIU A;  4BE0 A;  1FKO A;  2VG5 A;  4LH4 A;  4UQG A;  2FBV A;  2IAJ A;  3SPZ A;  4BE2 A;  3P1G A;  2F8S A;  3OS0 A;  4B9S A;  4ZTF A;  4KHQ A;  4CFD A;  4IFY A;  2BAN A;  4RG8 A;  3DRS A;  3M8P A;  4G1Q A;  4FLW A;  3M8S A;  4FJN A;  1VSD A;  2DFE A;  4AHS A;  2D0A A;  2A1S A;  5SZT A;  1U49 A;  1WNS A;  5JS2 A;  4H4M A;  1U45 A;  1SKR A;  1D9F A;  3K58 A;  2HNZ A;  3KIO A;  3L2R A;  3NF7 A;  2GBZ A;  3HPG A;  3LWM A;  4DF4 A;  2G8U A;  3V9Z A;  2XRI A;  1NK6 A;  4Q0B A;  4KI6 A;  3DYA A;  3O3H A;  2A1R A;  3MXJ A;  1W0H A;  3V9U A;  5C24 A;  4C8N A;  1BL3 A;  2FBX A;  3TAB A;  3PUF A;  4B9U A;  4DLE A;  4FJ8 A;  1FXX A;  4W5N A;  3NGI A;  4DFM A;  3RWU A;  1D9D A;  2DFH A;  2YNF A;  4DF8 A;  3AA3 A;  2G8F A;  4J2D A;  4JS4 A;  5I42 A;  3TI0 A;  4GW6 A;  5CZ2 A;  4N76 A; 
#chains in the Genus database with same CATH topology
 1DLO A;  1D5A A;  2Q1N A;  2PYL A;  4ZHR A;  4ELV A;  1HR0 K;  4DR7 K;  2NLX A;  3P83 D;  4C1N K;  4W5O A;  3S3N A;  4RW8 A;  5AQG A;  3SAH A;  5AQM A;  5KI6 A;  4KB0 A;  5HRS A;  2X6N A;  3CC7 N;  4B08 A;  4I9Q A;  4DSE A;  1I39 A;  1TAQ A;  5AQY A;  4B3T K;  1ZBI A;  2HHS A;  4CEZ A;  2A5X A;  4PY5 A;  3AVH A;  3WEE B;  1JJ2 M;  1RFQ A;  3TSU A;  4DHY A;  4WCE L;  3CG7 A;  1OKJ A;  1ZXO A;  1QQM A;  3H45 C;  3A5N C;  3CC2 N;  2PY5 A;  2HF4 A;  1ASU A;  3OBY A;  3GDQ A;  1KXP A;  3OA9 A;  4E1M A;  4DV5 K;  3OS1 A;  2UU9 K;  2B6A A;  1VQP N;  3CXC M;  1BO5 O;  1JLC A;  4WQ5 C;  1C6V A;  2VG7 A;  4H0T B;  1ZBS A;  4OLB A;  1BCO A;  1RT4 A;  3WQU A;  4J2A A;  3SMS A;  4NXN K;  5A2Q O;  1WBD A;  1BU6 O;  4NCB A;  1RBV A;  4CZK A;  1S6Q A;  3OYG A;  3AAR A;  4FJH A;  5JLF A;  4FPB A;  3ZT2 A;  1ASV A;  4JKG A;  2R7Y A;  3EEQ A;  1WB9 A;  3FFK B;  2HBJ A;  1A5X A;  3HVR A;  4BRQ A;  3TPQ A;  1L3S A;  4OKJ A;  4H0P A;  4ZTJ A;  3P5J A;  3O9T A;  1VQ7 N;  3AVC A;  2E2N A;  3ZX0 A;  2ZM6 K;  1MDU B;  2HOE A;  2UXB K;  1WSE A;  1S1U A;  4YOV A;  4ELT A;  1X1P A;  3O4Q A;  3CHW A;  3U3Y A;  3PX0 A;  1WUA A;  1N8R O;  3B6O A;  3GBT A;  1IO2 A;  4JKG B;  1VHX A;  1Q86 O;  1UA0 A;  1GLB G;  4EAH D;  4ELU A;  1RDW X;  4JKF A;  3VQP A;  2O8D A;  3HRG A;  4CJ3 A;  4E7L A;  3IMX A;  4U7B A;  4KHW A;  1O1W A;  1P8Z A;  2YHX A;  3D45 A;  4BRO A;  4Z4E A;  4GVE A;  3LAK A;  4DTU A;  1VQ6 N;  3C6U A;  5GIO A;  4I2P A;  3OBW A;  1GLL O;  4CEF A;  1U2V A;  3NBP A;  2VG6 A;  1YJW N;  3HPO A;  1U04 A;  3QES A;  2KW4 A;  2QWP A;  1TGO A;  4FPA A;  2FBY A;  4BWM A;  5GIN A;  2F4V K;  1V4S A;  4DTO A;  1RNH A;  1RT5 A;  1ZC6 A;  3SUP A;  2ZE2 A;  1C0F A;  4XH5 A;  5GIP A;  2WTU A;  1LAV A;  2P51 A;  2JWK A;  1EX4 A;  3EE8 A;  5B8H A;  4PWD A;  5EX5 A;  4DWI A;  4NO7 A;  1JLB A;  3ZSQ A;  3VQE A;  3PV8 A;  3FZH A;  3V6D A;  4CJ5 A;  3AA5 X;  3QBX A;  3SI6 A;  5M1F A;  1J53 A;  1RT2 A;  2D0O A;  3WNH A;  3WNF A;  1X9S A;  1NK8 A;  2ASP A;  2HHU A;  3NHG A;  4B1X B;  4GNI A;  3DXK A;  4CZG A;  3K0S A;  2RN2 A;  3OJS A;  3W0L A;  3QIP A;  2E88 A;  2WBN A;  4N41 A;  2V7Z A;  5KQD A;  5AQT A;  1LOT B;  1HRH A;  1S6P A;  4LSL A;  4FJM A;  2D0C A;  2CGJ A;  4Q5V A;  2UUA K;  5AQR A;  4DLG A;  1Q9X A;  5EVZ A;  1TK5 A;  2KHO A;  4BG8 A;  1VQN N;  2VWB A;  2AJQ A;  3ENB A;  4FWM A;  3SMP A;  1DEJ A;  1BGX T;  3NGY A;  4FLT A;  2HND A;  1TUY A;  3VQ4 A;  4K41 A;  5KPR A;  2DTU A;  2OPS A;  3AVK A;  1X9M A;  2Z1I A;  5BPL A;  3QEX A;  3VEV A;  3SUO A;  4DR3 K;  5FPM A;  3SQ1 A;  2ASM A;  4NCG A;  4WFA L;  3I0S A;  1NK0 A;  3LP3 A;  3QNN A;  4FJ8 A;  4EZ9 A;  1HPZ A;  3NCI A;  2VGM A;  4YOT A;  1NGD A;  1L3T A;  2VWJ A;  1RTJ A;  3BZK A;  3PY8 A;  4K25 A;  3HK2 A;  4NLC A;  5HRO A;  4FJ9 A;  4CIG A;  3P31 A;  2O8E B;  2QKK A;  3THY A;  1VSI A;  3CI5 A;  1DTQ A;  3C95 A;  3ZX3 A;  3CFP A;  3VQB A;  3SQ0 A;  1NKC A;  2OPR A;  3M1F A;  3I56 N;  2E2Q A;  2DFF A;  3RTV A;  3QET A;  4CJL A;  4C8K A;  4Y1D A;  3DXM B;  4M45 A;  4IWV A;  2BE2 A;  3TAQ A;  1KLN A;  1BI4 A;  4AQY K;  4F3T A;  1YTU A;  4CCH A;  3TSP A;  3CJ9 A;  3UKR B;  1WSF A;  3AGR A;  1RTH A;  2D1K A;  3ZSR A;  1M1K O;  2O8E A;  4E19 A;  1WOQ A;  4BRH A;  4BC5 A;  2E2P A;  3J8A A;  3U8X A;  1C0U A;  4B9M A;  1GLJ O;  4FJ5 A;  4HCC A;  1U6Z A;  3O9R A;  4JD2 B;  3O5B A;  1EWR A;  3ISN C;  4HCB A;  4E1N A;  1TL1 A;  4PKH A;  3UE5 A;  5GAH P;  3FGU A;  5KQ8 A;  1SUQ A;  3IAY A;  4DQP A;  4LFA K;  3AO2 A;  2G8V A;  3UB5 A;  4JI0 K;  3UKR A;  1HQE A;  3LM2 A;  3NAE A;  4JV5 K;  4MFB A;  5KGW A;  1WAF A;  4J2E A;  4DQS A;  2F9T A;  3HOT A;  1ATS A;  4CEB A;  3NH1 A;  1HJO A;  1RT3 A;  1TVR A;  3PSF A;  3TR8 A;  1JLF A;  3I8D A;  3T1A A;  4DSI A;  4JI7 K;  4FXD A;  3P39 A;  1IKW A;  3B8A X;  3T69 A;  1BDG A;  3OYE A;  3VQQ A;  4BGA A;  3AGK A;  1W2B M;  3ZT0 A;  2PYJ A;  1BQM A;  1I3A A;  4PKG A;  5I9E B;  3QB0 A;  2F7T A;  1RIL A;  4JKA A;  3PO4 A;  4B3M K;  1YIJ N;  4FL9 A;  1T3V A;  4IBN A;  3LDS A;  4DV0 K;  4W5T A;  3ULD A;  4GVM A;  5KRS A;  1KCF A;  1QSY A;  5BN9 A;  4DFP A;  1J54 A;  1DT9 A;  3I8B A;  4RWT A;  3CPW M;  1NJX A;  4WFN L;  3DLL L;  3ZSW A;  4CJE A;  3FE1 A;  3MAQ A;  1NBW A;  3HST B;  1EKE A;  4JI6 K;  4QS8 A;  1NK7 A;  3WXL A;  1XUP O;  2E1Z A;  1NGC A;  4H5T A;  1RTD A;  1RCH A;  2AA4 A;  1BIU A;  4M41 A;  1E4G T;  5F0X A;  3OY9 A;  3TWH A;  2KZZ A;  1SL2 A;  2Q36 A;  2HHQ A;  3DLE A;  5AQQ A;  4IZ9 A;  4O0I A;  1WBB A;  4M3Z A;  3VTH A;  4H0X B;  4CEC A;  2NRX A;  4FJL A;  2GUP A;  1QSS A;  3CME N;  4FWR A;  3O80 A;  5J2Q A;  3MXI A;  5KPZ A;  3U6F A;  3WNE A;  1YAG A;  3AVI A;  4C1N I;  4BWJ A;  1VSM A;  5E26 A;  1JCE A;  1L3V A;  3B6P A;  4L8R B;  2BTF A;  1NMN A;  4JK9 A;  1K8A O;  1B92 A;  1O13 A;  4M3U A;  2NRW A;  1BOT O;  3HM8 A;  5C12 A;  2D5R A;  4H0Y B;  1K6Y A;  3M5R A;  4ILG B;  1NK4 A;  3CCE N;  4BC2 A;  4DTJ A;  4CZF A;  2IVN A;  5KPT A;  4DFJ A;  3JS6 A;  3K9K A;  4BE0 A;  4UQG A;  2FBV A;  4BE2 A;  4B9S A;  3O8M A;  1QZ5 A;  4IFY A;  4G1Q A;  4AHS A;  2P9S A;  5SZT A;  4RCH A;  1YI2 N;  1U49 A;  4FOE A;  4FWN A;  1SKR A;  3KIO A;  4Q0B A;  4KI6 A;  3DYA A;  3V9U A;  4ILJ A;  1BL3 A;  4B1V A;  5F2R A;  3TAB A;  1QZ6 A;  2CH6 A;  1NGJ A;  1TUU A;  3RWU A;  3AA3 A;  3MWT A;  2G8F A;  5I42 A;  3TI0 A;  5HBM A;  4B9T A;  3U9D A;  4YNQ A;  2XO7 A;  2HHV A;  1NK5 A;  1HMV A;  3QFU A;  1HYV A;  4A57 A;  1N33 K;  1UWB A;  4FZY A;  2HMP A;  1VRT A;  4KHS A;  1Z05 A;  4E89 A;  1NGF A;  4KHU A;  1KC8 O;  3BF3 A;  3KTQ A;  1VSH A;  4ID5 A;  2W41 A;  1RT6 A;  1JL2 A;  1W97 L;  2FXU A;  1XMO K;  3MED A;  4K0K K;  2QWL A;  3QEW A;  2O8D B;  4KB1 A;  5MLC Q;  4FVU A;  1TYQ B;  4B3S K;  1HKB A;  4AHC A;  3KD1 E;  1N6Q A;  2PZS A;  1BHL A;  3SK3 A;  3TAN A;  4DQQ A;  3H3O B;  3FR0 A;  3MCP A;  1IKX A;  4CZI A;  1NGB A;  2XY7 A;  4HTU A;  3NH0 A;  4YFU A;  1RT1 A;  4A5A A;  4OPA A;  1S22 A;  3QEP A;  3BGR A;  5FRN A;  4CED A;  2I5J A;  3DLH A;  3VA0 A;  3CCM N;  4RW9 A;  3O3F A;  1KRP A;  3DI6 A;  4OLA A;  2O8F A;  2B4J A;  1TKT A;  1RBU A;  3DRR A;  4ID1 A;  1KSP A;  3E66 A;  1VQO N;  1SAZ A;  4FWK A;  5DM7 L;  3N4P A;  1Q7Y O;  3SPY A;  3NFA A;  4GV9 A;  3F5T A;  1VQ4 N;  3K5M A;  4JYA K;  3G71 N;  2QEX N;  1VQ9 N;  3CF5 L;  3OYJ A;  4DSJ A;  1YTA A;  1ZBF A;  4FW2 A;  1NJZ A;  3K5O A;  4DU1 A;  2YI1 A;  4FLU A;  3HTV A;  4FLV A;  3MMV A;  3CQ8 A;  1KAX A;  2EHG A;  3DLR A;  3ATV A;  1MWK A;  3R6M A;  3LP1 A;  4M3X A;  3S3M A;  3U4L A;  3LDL A;  3RMD A;  1NG9 A;  4I6M A;  4IKF A;  3DOL A;  4CD3 A;  3A0I X;  3ID8 A;  3O3G A;  4CIE A;  3PIO L;  3J7Y P;  3KWI A;  1RDD A;  3K9J A;  1QHA A;  4M63 C;  1RDA A;  4DUY K;  2RE2 A;  4BRC A;  5HLF A;  2W42 A;  1HNI A;  3VQ5 A;  3SZ2 A;  3QLH A;  5AQJ A;  4E7J A;  2NRR A;  3KLG A;  2W6L A;  4KAZ A;  2IVP A;  3AVB A;  3ENO A;  4DTM A;  3PO5 A;  3JAM O;  1SL1 A;  4OPH A;  4HUE A;  1Y97 A;  3D2E B;  2GTD A;  5CY4 A;  4KI4 A;  4IO8 A;  1CZB A;  2WFB A;  3VEW A;  2HHH K;  4BR4 A;  3MEC A;  1CZA N;  5GAE P;  3CFR A;  2YX6 A;  1LW2 A;  4ISF A;  3THY B;  5D3G A;  1QQN A;  4JKH A;  5AQF A;  5AQX A;  3KD5 E;  5EU7 A;  3OYC A;  3C94 A;  4CW7 B;  5BRE A;  1IG8 A;  2KFN A;  1ATN A;  1IKV A;  3OYN A;  4LF4 K;  4CZH A;  3M8Q A;  4C8M A;  1KAY A;  4YOY A;  2IC3 A;  3D2E A;  4CJT A;  4K8Z A;  1XWL A;  3EYZ A;  1RTI A;  5AQZ A;  2VQE K;  2O8B B;  2O4I A;  3KLF A;  2NRH A;  2W6K A;  1JL1 A;  2E6L A;  4DR5 K;  4O4G A;  3ZCM A;  1HLU A;  3NMU A;  3DM2 A;  4BE1 A;  4I9L A;  2F96 A;  4JD2 A;  1NWK A;  3WT0 A;  1JCF A;  1Y64 A;  2HBM A;  4KPY A;  5BR9 A;  4HTL A;  2JWL A;  4Z4C A;  3RSE A;  4FSV A;  4KTW A;  1H1V A;  3F9M A;  2NNW A;  3E9P A;  4B8C A;  2A42 A;  4CK2 A;  1OH6 A;  4DSF A;  4OPK A;  1KVB A;  2PBD A;  3TAP A;  3H1V X;  3CCQ N;  2AP1 A;  3CQY A;  4DSL A;  4O5B A;  3CJ7 A;  3EZ5 A;  4FWO A;  5FRM A;  4EHU A;  4JNE A;  3KK2 A;  2HST A;  3VQD A;  3L2Q A;  4FWQ A;  3QIC A;  4AHV A;  4LF7 K;  1N36 K;  5DMR A;  3HO1 A;  3OYB A;  3RSE B;  5LJV A;  1ZBH A;  3TAF A;  2HF3 A;  3D2F A;  2RPI A;  1HQU A;  1MU2 A;  2OTJ N;  4BVP A;  2P9P A;  2HW3 A;  3VF4 A;  4AM6 A;  1ZYQ A;  1QSL A;  3PSI A;  2A41 A;  1KAZ A;  2YHB A;  2ZGY A;  3D6R A;  3VN5 A;  3L8B A;  4XH1 A;  1HNW K;  1JXE A;  2O4G A;  1U4B A;  1ATR A;  3MX5 A;  3VF2 A;  4R79 A;  5LL6 Z;  3SJJ A;  4H5V A;  1Q9Y A;  1WSJ A;  3VGK A;  3ZSO A;  4FW1 A;  3HPH A;  3V9W A;  1IBK K;  1NK9 A;  1KFD A;  3K2P A;  5HRN A;  3E9L A;  1Q82 O;  1HYS A;  3PLA A;  5BRF A;  4NCA A;  3V1O A;  5F1X A;  1VK0 A;  1EXQ A;  2HMI A;  4BRD A;  2E8A A;  3T3F A;  4F2R A;  3IS9 A;  4B3R K;  1UAX A;  3HM9 A;  1YT3 A;  3K57 A;  5AQS A;  3QIO A;  3VET A;  5FDL A;  3HT3 A;  1T6D A;  4A2A A;  3LP0 A;  5DM6 L;  3JYT A;  1U48 A;  1BIS A;  3ZT1 A;  4BDY A;  4FJ7 A;  2YNI A;  4WQ5 A;  3AAQ A;  2ZWH A;  3Q7C A;  3OW2 M;  3QML A;  3WNG A;  4BRE A;  4M42 A;  1EQY A;  4CJU A;  3ZET A;  4DQ8 A;  1X9J A;  1MWM A;  1JLG A;  1L5U A;  4OVL A;  4CK3 A;  4PUO A;  4KV8 A;  1VSJ A;  2KQ2 A;  1XHZ A;  1U2V B;  2QK9 A;  4WQ4 C;  3MWP A;  3KK3 A;  1WSH A;  4NB4 A;  1WSI A;  3O9U A;  1BWF O;  3A8Y A;  4CJS A;  4YHH K;  2UXD K;  5J2P A;  4IOC L;  1GOB A;  3CCR N;  3SCX A;  4KTQ A;  4KRE A;  5HL7 L;  3AO4 A;  3EZW A;  5AFU A;  1VAZ A;  1UA1 A;  2GV9 A;  3ULE A;  2Q0R A;  4FLZ A;  4IJN A;  3DXK B;  3OYM A;  3C7N A;  3V1R A;  5EXW A;  4CGD A;  4YOW A;  3OHR A;  1GLC G;  3DWL A;  2XY5 A;  4CGJ A;  1GOA A;  1YJN N;  4UY8 O;  4O0J A;  5KTQ A;  2QWQ A;  2F8T A;  4IDH A;  2P5G A;  2HB5 A;  4FK4 A;  4N47 A;  2G8I A;  3BZC A;  1RGI A;  4L3Q A;  4BDP A;  2KTQ A;  4DKW A;  2A3Z A;  4B8A B;  5CR4 A;  1ILY A;  5M1K A;  5BRD A;  1TKD A;  3VGL A;  2Q3S A;  3WQT A;  3BDP A;  3ITH A;  3THW B;  4U67 L;  1X3N A;  3VEX A;  4V19 S;  3O9S A;  2E1Y A;  4CF9 A;  1T44 A;  1K8K B;  4XIU A;  4LF9 K;  3EKU A;  2VG5 A;  3SPZ A;  3P1G A;  2GX9 A;  3OTO K;  2F8S A;  3OS0 A;  1SZ2 A;  1GLD G;  4KHQ A;  3CQX A;  3M8S A;  3BUZ B;  3THX B;  5AQO A;  4HWI A;  3IFR A;  3C6H A;  1U45 A;  3K58 A;  3MN9 A;  3NF7 A;  4BY9 C;  3DAW A;  1NK6 A;  3VEZ A;  2P9L A;  2FF6 A;  2QWN A;  3O3H A;  4DV2 K;  1OVY A;  1W0H A;  4A62 A;  4DLE A;  3VER A;  3CJB A;  2IVO A;  2P9U B;  3NGI A;  4DFM A;  1M90 O;  4JS4 A;  4GW6 A;  5CZ2 A;  5GAD P;  5BRH A;  4CFA A;  3J7A P;  3K5L A;  5LY3 A;  4DTS A;  1V4T A;  4B1W B;  4CHO A;  3TU5 A;  4BRP A;  3T19 A;  4JS5 A;  4G9Z A;  4YDU C;  4YOU A;  3AA2 A;  3AO1 A;  4B9V A;  3V9X A;  4DS4 A;  4RW6 A;  4BC4 A;  1JLQ A;  3UIQ A;  3AVA A;  3KJV A;  1NJY A;  2Z1G A;  3O1B A;  1VQM N;  2QWR A;  3QBW A;  4J8F A;  3QNO A;  1N34 K;  4CE9 A;  3KKS A;  3F9K A;  4FWP A;  1R59 O;  3L4Q A;  2FSN A;  3DOK A;  4OGE A;  3VEO A;  4JAX A;  3C65 A;  3TSQ A;  4LF8 K;  3V81 A;  3QDK A;  5C0Y A;  1NOZ A;  1ITG A;  1A5V A;  4OKK A;  2BGG A;  4WF9 L;  2V7Y A;  3PIP L;  5FPD A;  1XI1 A;  2I7N A;  1QS4 A;  2ATQ A;  3EL2 A;  4ILH A;  1EWQ A;  3KZB A;  1QE1 A;  2VCP A;  4KFB A;  1IJJ A;  1JCG A;  1NLV A;  1Q18 A;  3AVG A;  3LPU A;  3SJH A;  2KZM A;  3LP2 A;  2DY4 A;  4LF6 K;  4CBW A;  5CYM A;  5AZI B;  3G25 A;  1Z26 A;  2OCE A;  4JHD B;  4QAG A;  3JSM A;  5CE3 A;  4OO1 J;  2ASO A;  3FLC O;  5E84 A;  5BPN A;  2UXC K;  4DR2 K;  1I94 K;  1S1W A;  3HYF A;  1IV0 A;  4CJP A;  3VA3 A;  3VQ9 A;  3N4Q A;  2XY8 A;  1NJW A;  1B9D A;  3AAP A;  4CFC A;  5AJ3 K;  3NH2 A;  3G10 A;  4CBX A;  3CCU N;  4JRP A;  4H0O A;  3G4S N;  3C6T A;  5J2N A;  4FCY A;  3SUN A;  5AZI A;  1J5O A;  1VSK A;  4CZE A;  4Z4F A;  4DTP A;  2OPQ A;  3RVC A;  4Y1C A;  5KGX A;  1NGE A;  1FJG K;  2O8B A;  5C42 A;  4CES A;  4QS9 A;  2IOC A;  1C1B A;  3MEE A;  1HNZ K;  3TAG A;  3HJF A;  3IG1 A;  4CGH A;  4FM2 A;  3CJC A;  3Q7B A;  2YNG A;  1W9H A;  1ASW A;  1F21 A;  3KVG A;  4E7K A;  2E5L K;  1S1V A;  3QEI A;  3AA4 A;  5EY4 A;  3HSC A;  2WOM A;  3OYF A;  5SWM A;  1VQK N;  5AQI A;  4BRM A;  1C1A A;  1NOY A;  4JK7 A;  4HUF A;  5ADX H;  4XEI A;  4FWS A;  2GWJ A;  5TKY A;  5M1O A;  3U9Z A;  1T05 A;  1QVG M;  3WXI A;  2XY6 A;  4AHT A;  3VQC A;  4H5R A;  3F2K A;  1EET A;  1N32 K;  3QER A;  4EFH A;  2Q31 A;  3NF6 A;  5BPM A;  4DU4 A;  1NKB A;  4FLY A;  4A59 A;  4JI4 K;  2CH5 A;  2OPP A;  2YHA A;  4HVJ A;  4TSX A;  3S41 A;  1YUW A;  2NRT A;  1BUP A;  3VQ7 A;  3QEV A;  2O8C B;  3H08 A;  2Z1J A;  3VEY A;  1NGG A;  4CZJ A;  3AVM A;  4PKI A;  3WXJ A;  2HBL A;  4CJW A;  4OPJ A;  4JK8 A;  3SYZ A;  1RBT A;  4CEE A;  3L4I A;  1C1C A;  4B9L A;  4BR2 A;  1IBM K;  1WLJ A;  3LDQ A;  3WEE A;  3LAL A;  2QI2 A;  4EIA A;  1QVF M;  1Q81 O;  3BEX A;  4PL7 A;  5K14 A;  1HUX A;  1KVA A;  4B1U B;  4JRQ A;  1IBL K;  1B9F A;  2O8C A;  2FF3 B;  3DLB A;  2NUB A;  3V4I A;  4LD0 A;  4F4K A;  3S3O A;  4DG1 A;  4JI3 K;  4Z4H A;  3SAF A;  1VQL N;  4CJ4 A;  4CZL A;  3CC4 N;  3SQ4 A;  3V1Q A;  3CYM A;  1ZBL A;  3PX6 A;  4EZ6 A;  3L2W A;  3ATU A;  3VEN A;  4FK0 A;  3SV3 A;  4IO9 L;  2GUI A;  3H3N O;  4FK2 A;  3OYD A;  2P9I B;  3HI0 A;  4MLE A;  2UUC K;  1HNX K;  4EP4 A;  1IH7 A;  3QIN A;  5IWA K;  3HL8 A;  2YHY A;  5E41 A;  2ZQB A;  1C0G A;  4DQR A;  3D0P A;  2G8H A;  3ZET B;  2GEL A;  1NM1 A;  2BH1 A;  2ZJQ L;  4KH5 A;  1OH8 A;  1FK9 A;  1SV5 A;  1QQO A;  2P9S B;  5C2D A;  1X3M A;  2FSJ A;  3O4W A;  5CYQ A;  4BRL A;  3ZX2 A;  1KFS A;  1REV A;  4CF1 A;  4CEO A;  3NF9 A;  4WE1 A;  3ZSX A;  4LFB K;  5ADX A;  1YVN A;  3ZT3 A;  2P1J A;  5LJW A;  3LDO A;  4BDZ A;  4MDB A;  5I3U A;  3L2U A;  5AR0 A;  5C25 A;  2FSK A;  4CER A;  2D4W A;  1LWE A;  5IT9 O;  2Z1H A;  5CHI A;  3L2V A;  4W5Q A;  4E7I A;  4H8K A;  1HKC A;  3CD6 N;  3E01 A;  4M7Y A;  1D4X A;  3O9Q A;  4W5R A;  4DR6 K;  4CJV A;  1S72 N;  4C8O A;  4CJK A;  2PAV A;  4MQ3 A;  1D8Y A;  3OS2 A;  4OJR A;  2ITG A;  1YVU A;  2RKI A;  3V9S A;  4EP5 A;  3BY5 A;  4CF8 A;  1RBR A;  5H1S Q;  1FKP A;  2E4L A;  4AIL C;  3ZSZ A;  1T6C A;  1CLQ A;  5HRP A;  2KKZ A;  3T1H K;  2FBT A;  4W5N A;  4CHZ A;  2BDP A;  3OYA A;  4N56 A;  3PX4 A;  2HHX A;  4CF0 A;  3DMJ A;  4A2B A;  1OH7 A;  3A2F A;  2CGL A;  2OTL N;  2G8W A;  2RHK A;  4CJ7 A;  3CCV N;  5C2F A;  3ID6 A;  3DJC A;  2OZM A;  4JKE A;  1EP4 A;  2RF2 A;  4DSK A;  3NVK A;  3EO3 A;  3CFO A;  1N5Y A;  3MX2 A;  1S1X A;  4E3S A;  1IG9 A;  2E6M A;  4A5B A;  3OYK A;  4LC9 B;  1K8K A;  4DV7 K;  2HHT A;  3HP9 A;  1Q8I A;  1JLA A;  4JKC A;  5AQN A;  3P38 A;  2Q2R A;  4DV6 K;  1BIZ A;  4FYD A;  3KKR A;  4FM0 A;  1TL3 A;  4FJG A;  1TK0 A;  4NYF A;  4B1Z A;  3MK6 A;  1J6Z A;  4CHP A;  1JLE A;  2P9L B;  3M8R A;  1DGK N;  4QS7 A;  4GV3 A;  1OVQ A;  4FZZ A;  3NDK A;  3DLG A;  1L3U A;  3NF8 A;  3WUH A;  2P9U A;  3ZEU B;  4DTR A;  1WSG A;  1KQS M;  3LWL A;  3GOI A;  1VSL A;  3L3U A;  2X78 A;  4F9O A;  4IDK A;  3RR8 A;  1XMQ K;  5M1N A;  3MCA B;  3A5O C;  3CJA A;  1NGI A;  1QQC A;  3GL1 A;  2WUS A;  4B1Y B;  3JXU A;  4I6M B;  3AVF A;  3SBG A;  2OAN A;  4AHR A;  1G15 A;  4CHY A;  1XHX A;  4DR4 K;  4CJF A;  4JKB A;  3HXM A;  1NMD A;  1VQ8 N;  4X66 K;  2NRV A;  2YNH A;  4E1J A;  4BRN A;  2HBK A;  3MEG A;  2KLA A;  4IXC A;  4NYN A;  4KO0 A;  1CZ9 A;  1JXB A;  5JIC A;  1YHQ N;  4DTX A;  1YJ9 N;  4BQL A;  3UKU A;  3KLI A;  4BR5 A;  3AV9 A;  3GG4 A;  2IAJ A;  3L0Q A;  3HZ6 A;  4ZTF A;  3IDH A;  2ITM A;  2BAN A;  4O8U A;  3M8P A;  3QFP A;  4FJN A;  1VSD A;  2DFE A;  2D0A A;  5HOO A;  1WNS A;  4H4M A;  4H5N A;  3L2R A;  3LWM A;  2GBZ A;  2V51 B;  3HPG A;  4DF4 A;  3ZLJ A;  2ZJP L;  2A1R A;  2P9K A;  4BR7 A;  3O1W A;  3PUF A;  4ISE A;  4JHD A;  3H1Q A;  3UKU B;  4GKK K;  4B9Q A;  2DFH A;  4DF8 A;  1HX1 A;  4N76 A;  4PHT X;  1XQS C;  4NLB A;  1SQK A;  3RRH A;  5HP1 A;  2UUB K;  2HHW A;  1BQN A;  3H46 O;  3D2F B;  5ELZ A;  4CGF A;  1NGH A;  2YKM A;  3WXM B;  1J5E K;  1T7P A;  2P5O A;  5J2M A;  4K43 A;  5FLX O;  4JI1 K;  2X6S A;  1IKY A;  1RDU A;  4LFC K;  1XNQ K;  4I7F A;  2D0B A;  3L6Q A;  3M3Z A;  4KH6 A;  1BI4 B;  3CET A;  3IUC A;  4E7H A;  4YDU A;  3TTF A;  3AO3 A;  1NNE A;  3SAG A;  3CCJ N;  1SKW A;  4Z4G A;  3MN5 A;  1NKE A;  3K5N A;  3CIP A;  4IEE A;  3LPT A;  5BN8 A;  3HP6 A;  4IJA A;  3G6E N;  1LWF A;  2YJF A;  1SS6 A;  3P4I A;  4GKJ K;  3LZJ A;  1TKZ A;  4J2B A;  4O8K A;  4MO4 A;  4B9N A;  3RMC A;  2G8K A;  2F9W A;  3VF6 A;  1W7A A;  3ZSY A;  4BQZ A;  1LAW A;  2QWO A;  3KK7 A;  4H5W A;  2E20 A;  4RW4 A;  5AQP A;  4WQ4 A;  4K42 A;  4ICL A;  1S1T A;  4KHN A;  4PA1 A;  2ETJ A;  4JLH A;  2VQF K;  2P9P B;  1VSF A;  4WYB A;  4CZM A;  4H4O A;  2VGN A;  4BR9 A;  4FM1 A;  5LMU K;  3FZM A;  3VPZ A;  2EX3 A;  4Z0U A;  1RT7 A;  3T7Z A;  4FJK A;  4IFV A;  3CM6 A;  4RW7 A;  4KHP K;  2VYP A;  2BUP A;  3HVT A;  2KFZ A;  5AQU A;  3RMA A;  4E0D A;  4DR1 K;  3ZT4 A;  4IG0 A;  3EY1 A;  3CJ1 A;  5LMN K;  1HPM A;  4LY7 A;  4CFB A;  4PQU A;  4HHT A;  1TV6 A;  4F2S A;  4BRI A;  4K8X A;  3ENH A;  3TAE A;  5DK5 A;  2OA8 A;  2YCH A;  4GMJ B;  3ALY A;  4JEP A;  3LL3 A;  3AO5 A;  4BAC A;  1X9W A;  1UOC A;  2ZGZ A;  3MN7 A;  5CZ1 A;  2Q0U A;  2QXF A;  3NVM A;  1TAU A;  1GLE G;  2HNY A;  4JN4 A;  5KRT A;  3EE9 A;  4I2Q A;  4O55 A;  5C10 A;  3ULE B;  3VTI A;  2I7P A;  3I55 N;  4JI5 K;  3M6G A;  3SBT A;  1A5W A;  2IIR A;  3C7N B;  4BC3 A;  4YY3 K;  2OZS A;  5JMV A;  1LCU A;  1BA1 A;  2DPN A;  2Q97 A;  2VWK A;  3EN9 A;  4AF1 A;  3SQ2 A;  4M3W A;  4CEQ A;  5T7B A;  1XNR K;  2P9I A;  5FRO A;  4PL8 A;  4X62 K;  2D0P A;  4YOR A;  4AM7 A;  3VQ8 A;  3R9P A;  1Z25 A;  2Y1I A;  2JLE A;  3OYL A;  4C8L A;  3IKM A;  3FZK A;  1SL0 A;  2ZF5 O;  3F73 A;  2P9N A;  2YJE A;  1DKG D;  4CEA A;  4FJI A;  4LSN A;  3FZF A;  5FPE A;  5BR8 K;  4CGI A;  1YF5 L;  4MLH A;  4DFK A;  5JS1 A;  2NZT A;  4NXM K;  3GE1 A;  3VQ6 A;  3R3L A;  3J80 O;  4DQI A;  3C6A A;  4IOA L;  3O4N A;  1K73 O;  4JI8 K;  4IEI A;  5C15 A;  3HOS A;  4CBU A;  4Z94 A;  3CCS N;  3G0Z A;  1CXU A;  1RBS A;  4WFB L;  3I0R A;  3FFI A;  4M3R A;  3MDQ A;  2QW9 A;  2P9N B;  2CGK A;  5J1E A;  1Z6R A;  4CIF A;  4LH5 A;  1J9A A;  1WAJ A;  2IS3 A;  1C0T A;  1MA9 B;  4X64 K;  2IGI A;  4DV1 K;  3CM5 A;  2YKN A;  3ZSV A;  1GLA G;  1KTQ A;  5TKW A;  4Z4I A;  4FZX C;  3D7E O;  5JVG L;  4BG9 A;  2E2O A;  2ZJR L;  4FOI A;  4A61 A;  3THW A;  3K59 A;  1S9E A;  3VGM A;  2ZD1 A;  5AQK A;  4F3O A;  1VQ5 N;  2UYT A;  3AVN A;  3LM9 A;  4CJR A;  3AVL A;  3CMA N;  4YOX A;  4KBO A;  3ASM A;  4JI2 K;  5AQL A;  3VMF B;  3R8E A;  4M7X A;  4CHQ A;  1TKX A;  3OYH A;  3THX A;  3CCL N;  3A5L C;  4BR0 A;  2HVI A;  3MXM A;  3J7Z O;  4FO0 A;  2QA4 N;  2EWS A;  4N5S A;  4CHN A;  1HYZ A;  3A5M C;  2Y1J A;  3OVN A;  3THV A;  1VSE A;  1NJI O;  1GOC A;  3NGZ A;  4FLX A;  2W40 A;  3SNN A;  4ISG A;  3L3V A;  4R5P A;  3LAM A;  1E3M A;  2LSN A;  3W3D A;  2H3G X;  1TYQ A;  1HKG A;  2QTD A;  4CJQ A;  3J81 O;  4FJJ A;  3KWG A;  1E4F T;  3H6E A;  1GLF O;  3NE6 A;  1HNV A;  5JLH A;  5JVH L;  4KRF A;  4CGG A;  3SV4 A;  1T03 A;  4DUZ K;  3HBT A;  1TK8 A;  4QCL A;  2X74 A;  1YXQ A;  4LF5 K;  4CI6 A;  4M3T A;  5M1P A;  1ESV A;  4GV6 A;  3CER A;  3ZEU A;  4AH9 A;  4FWL A;  2FC0 A;  3RRG A;  4QOZ B;  2A6A A;  1C0M A;  4OKE A;  3BF1 A;  3I33 A;  3DLK A;  4M3Y A;  1WN7 A;  1S5J A;  4O44 A;  1LV5 A;  1P90 A;  2QWM A;  4XH4 A;  1EO1 A;  3FZL A;  4BRG A;  2WON A;  4BRF A;  2O8F B;  4MDA A;  5AFU H;  3E9O A;  1ZBU A;  4DB3 A;  2HVH A;  5GAG P;  1FW6 A;  4DTN A;  3KK1 A;  3DXM A;  3MN6 A;  3AY9 A;  3TAM A;  2GEM A;  1VRU A;  1JKH A;  1BCM A;  1SKS A;  1BG3 A;  2PFU A;  1NU0 A;  1XC3 A;  1T8E A;  3LAN A;  5EOY A;  1HJR A;  5AQH A;  3OJU A;  3CPE A;  3S9H A;  4HUG A;  4CF2 A;  4DS5 A;  3ZYY X;  4BVO A;  3RR7 A;  1R0A A;  4F8R A;  3U3G A;  4KH4 A;  4IFE A;  1KLM A;  4RTF D;  1CXQ A;  4OGC A;  5M1Q A;  5HRR A;  2YHW A;  3WXK A;  1G99 A;  3IRX A;  1QTM A;  3SUQ A;  3KHY A;  3QO9 A;  4FVM A;  3LDP A;  1RDC A;  3O6W A;  2QKB A;  1S9G A;  2V52 B;  4IG3 A;  3VQA A;  3R1X A;  4KTZ A;  2WC9 A;  2P9K B;  1KD1 O;  3OYI A;  4CK1 A;  1LW0 A;  4FJX A;  5AQV A;  4Y0W A;  1QHT A;  4BRA A;  4KKO A;  4CVN E;  2JGU A;  1BA0 A;  2XHB A;  3KLH A;  1OH5 A;  3DRP A;  4KHY A;  2FLO A;  3TTD A;  4DU3 A;  2A40 A;  4BRK A;  2B5J A;  3TAR A;  2IDO A;  3TTC A;  4BGB A;  1XC9 A;  3VES A;  1KVC A;  3KLE A;  3AVJ A;  1LWC A;  4AHU A;  4B3O A;  4O5F A;  2J4R A;  3SLC A;  1YIT N;  3LDN A;  4MO5 A;  5AZJ B;  3RMB A;  4DMN A;  4OX9 K;  1DTT A;  2OYQ A;  4DV4 K;  1RDB A;  4X65 K;  3LZI A;  4CD1 A;  1U47 A;  2YV0 X;  4H0V B;  1FKO A;  4LH4 A;  4DV3 K;  2QM1 A;  4EHT A;  4CFD A;  4C23 A;  4RG8 A;  3DRS A;  2QXL A;  4IOX A;  4FLW A;  3O08 A;  4H03 B;  2A1S A;  5JS2 A;  3C0B A;  5FPN A;  1D9F A;  2HNZ A;  3T1Y K;  2G8U A;  3BP8 A;  3V9Z A;  2XRI A;  5AZJ A;  1K9M O;  3MXJ A;  1S3X A;  3VOV A;  5C24 A;  4C8N A;  1NGA A;  2FBX A;  3E1Y A;  4DCH A;  4JKD A;  4B9U A;  5AQW A;  1FXX A;  1D9D A;  2NRZ A;  2YNF A;  4J2D A;  2GWK A;  4GY2 B;  3EKS A; 
#chains in the Genus database with same CATH homology
 5HBM A;  4B9T A;  4CFA A;  1DLO A;  3K5L A;  1D5A A;  4DTS A;  3RRH A;  4ZHR A;  5HP1 A;  2PYL A;  4ELV A;  2HHW A;  4YNQ A;  2XO7 A;  1BQN A;  4CHO A;  2HHV A;  3P83 D;  1NK5 A;  4W5O A;  3S3N A;  1HMV A;  4RW8 A;  3T19 A;  5KI6 A;  4JS5 A;  4KB0 A;  4CGF A;  5HRS A;  1HYV A;  2X6N A;  2YKM A;  4B08 A;  1T7P A;  1UWB A;  4FZY A;  4DSE A;  3AO1 A;  3AA2 A;  5J2M A;  1I39 A;  1TAQ A;  3V9X A;  4DS4 A;  2P5O A;  4B9V A;  1ZBI A;  1VRT A;  4RW6 A;  1JLQ A;  4KHS A;  4CEZ A;  2X6S A;  3UIQ A;  4E89 A;  2HHS A;  3AVA A;  3KJV A;  1NJY A;  1IKY A;  2Z1G A;  4KHU A;  4PY5 A;  3AVH A;  3QNO A;  3KTQ A;  4I7F A;  2D0B A;  4CE9 A;  1VSH A;  3KKS A;  3F9K A;  4ID5 A;  3CG7 A;  1BI4 B;  1RT6 A;  1JL2 A;  4E7H A;  2PY5 A;  3DOK A;  4OGE A;  3MED A;  3QEW A;  1ASU A;  3AO3 A;  3V81 A;  4KB1 A;  1NOZ A;  4E1M A;  1ITG A;  4AHC A;  1SKW A;  3KD1 E;  1N6Q A;  2PZS A;  1BHL A;  4Z4G A;  1A5V A;  3TAN A;  4OKK A;  4DQQ A;  2BGG A;  3OS1 A;  1XI1 A;  1IKX A;  1NKE A;  2B6A A;  3K5N A;  1QS4 A;  2ATQ A;  2XY7 A;  3LPT A;  4HTU A;  3HP6 A;  3NH0 A;  1JLC A;  4YFU A;  1RT1 A;  1C6V A;  1QE1 A;  2VG7 A;  1LWF A;  4KFB A;  4OLB A;  4I9Q A;  3LZJ A;  1TKZ A;  4J2B A;  1BCO A;  1RT4 A;  4J2A A;  4B9N A;  3RMC A;  2G8K A;  3AVG A;  3LPU A;  2KZM A;  3LP2 A;  2DY4 A;  3QEP A;  3BGR A;  4NCB A;  4CED A;  2I5J A;  3DLH A;  5FRN A;  1RBV A;  5CYM A;  3ZSY A;  3VA0 A;  1S6Q A;  4RW9 A;  1LAW A;  3OYG A;  3O3F A;  1Z26 A;  1KRP A;  4DSL A;  3DI6 A;  4OLA A;  4RW4 A;  2B4J A;  4QAG A;  1TKT A;  3JSM A;  4FJH A;  4ICL A;  1S1T A;  3ZT2 A;  1RBU A;  3DRR A;  4PA1 A;  4KHN A;  1ASV A;  2R7Y A;  4ID1 A;  1KSP A;  2ETJ A;  1A5X A;  3HVR A;  4JLH A;  3SPY A;  1VSF A;  3NFA A;  1L3S A;  1S1W A;  4EZ6 A;  3HYF A;  4OKJ A;  4H4O A;  4CJP A;  3VA3 A;  3VQ9 A;  4FM1 A;  3K5M A;  4ZTJ A;  2XY8 A;  1NJW A;  3P5J A;  1B9D A;  2EX3 A;  4Z0U A;  3AVC A;  1RT7 A;  4CFC A;  4FJK A;  4IFV A;  3CM6 A;  4RW7 A;  3G10 A;  3NH2 A;  3OYJ A;  4DSJ A;  1YTA A;  1ZBF A;  4FW2 A;  4JRP A;  1WSE A;  3HVT A;  2KFZ A;  3RMA A;  1S1U A;  1NJZ A;  4E0D A;  3ZT4 A;  4IG0 A;  3C6T A;  3K5O A;  3EY1 A;  4FLU A;  4DU1 A;  4FCY A;  5J2N A;  3SUN A;  4FLV A;  1J5O A;  1VSK A;  4ELT A;  4LY7 A;  1X1P A;  3O4Q A;  3CQ8 A;  3U3Y A;  2EHG A;  3PX0 A;  4Z4F A;  4DTP A;  3B6O A;  3DLR A;  2OPQ A;  4CFB A;  4Y1C A;  1IO2 A;  5KGX A;  4PQU A;  4HHT A;  1TV6 A;  5C42 A;  4CES A;  3LP1 A;  1UA0 A;  2IOC A;  1C1B A;  4F2S A;  4ELU A;  3S3M A;  4K8X A;  4M3X A;  3MEE A;  3TAE A;  3VQP A;  3RMD A;  5DK5 A;  4CJ3 A;  4E7L A;  4IKF A;  3DOL A;  2OA8 A;  1O1W A;  3TAG A;  4GMJ B;  3D45 A;  3ALY A;  4KHW A;  4Z4E A;  3HJF A;  3LAK A;  4DTU A;  3IG1 A;  3C6U A;  4I2P A;  3O3G A;  4CIE A;  4CGH A;  3AO5 A;  4CEF A;  4BAC A;  1X9W A;  1UOC A;  3NBP A;  2VG6 A;  4FM2 A;  3HPO A;  1U04 A;  1RDD A;  2KW4 A;  2QXF A;  2YNG A;  5CZ1 A;  1W9H A;  3QES A;  1TAU A;  2HNY A;  1ASW A;  1TGO A;  1F21 A;  5KRT A;  4BWM A;  2FBY A;  1RDA A;  4E7K A;  4DTO A;  1RNH A;  2W42 A;  1RT5 A;  1S1V A;  3AA4 A;  4I2Q A;  1HNI A;  4O55 A;  3QEI A;  5HLF A;  3SUP A;  2WOM A;  3VQ5 A;  3OYF A;  3QLH A;  5SWM A;  3SZ2 A;  4J2E A;  4E7J A;  1C1A A;  3KLG A;  4KAZ A;  2ZE2 A;  1NOY A;  3AVB A;  4DTM A;  1A5W A;  3PO5 A;  1SL1 A;  4HUE A;  4HUF A;  1Y97 A;  1LAV A;  2P51 A;  5CY4 A;  4KI4 A;  1EX4 A;  2OZS A;  1CZB A;  4PWD A;  3MEC A;  3CFR A;  3SQ2 A;  1LW2 A;  2VWK A;  4DWI A;  4M3W A;  1JLB A;  1T05 A;  5D3G A;  3ZSQ A;  3VQE A;  3PV8 A;  3V6D A;  4CEQ A;  4CJ5 A;  3AA5 X;  5T7B A;  2XY6 A;  4AHT A;  3SI6 A;  5FRO A;  1J53 A;  1RT2 A;  3VQC A;  3WNH A;  5EU7 A;  1EET A;  3OYC A;  3C94 A;  3QER A;  3WNF A;  3KD5 E;  1X9S A;  1NK8 A;  2HHU A;  3NHG A;  2KFN A;  3NF6 A;  4DU4 A;  1NKB A;  4FLY A;  3VQ8 A;  1IKV A;  3OYN A;  2RN2 A;  1Z25 A;  3OJS A;  2OPP A;  3M8Q A;  3QIP A;  4C8M A;  2YHA A;  4HVJ A;  2Y1I A;  4TSX A;  2JLE A;  4N41 A;  3VQ7 A;  3OYL A;  3QEV A;  4C8L A;  3H08 A;  2IC3 A;  4CJT A;  2Z1J A;  4K8Z A;  1XWL A;  1HRH A;  1S6P A;  1SL0 A;  4LSL A;  3EYZ A;  4FJM A;  3AVM A;  2D0C A;  1RTI A;  4Q5V A;  4CJW A;  3F73 A;  4OPJ A;  4DLG A;  1Q9X A;  3SYZ A;  1RBT A;  2O4I A;  3KLF A;  4CEA A;  4CEE A;  1TK5 A;  1C1C A;  4FJI A;  1JL1 A;  4LSN A;  2E6L A;  4B9L A;  4O4G A;  3ZCM A;  4CGI A;  3DM2 A;  4BE1 A;  4I9L A;  4DFK A;  1WLJ A;  2AJQ A;  2F96 A;  5JS1 A;  3NGY A;  1BGX T;  4FLT A;  3LAL A;  2HND A;  3VQ4 A;  3VQ6 A;  4DQI A;  2DTU A;  2OPS A;  3AVK A;  1X9M A;  4KPY A;  2Z1I A;  3QEX A;  3O4N A;  5K14 A;  3SUO A;  4Z4C A;  1KVA A;  4JRQ A;  3SQ1 A;  4NCG A;  4KTW A;  3G0Z A;  3I0S A;  1B9F A;  1NK0 A;  1CXU A;  3LP3 A;  1RBS A;  4B8C A;  3DLB A;  4CK2 A;  2NUB A;  3I0R A;  4DSF A;  3QNN A;  4OPK A;  4LD0 A;  3FFI A;  3V4I A;  4DG1 A;  3S3O A;  4EZ9 A;  1HPZ A;  4M3R A;  1KVB A;  3NCI A;  4F4K A;  1L3T A;  2VWJ A;  3TAP A;  1RTJ A;  5J1E A;  3PY8 A;  3HK2 A;  4Z4H A;  5HRO A;  4FJ9 A;  4CIG A;  2QKK A;  4CJ4 A;  4CIF A;  3SQ4 A;  4LH5 A;  3V1Q A;  3CYM A;  1J9A A;  4O5B A;  3PX6 A;  3L2W A;  3EZ5 A;  1ZBL A;  1WAJ A;  1VSI A;  2PYJ A;  3SQ0 A;  1DTQ A;  3C95 A;  3CFP A;  2IS3 A;  1C0T A;  3VQB A;  3SV3 A;  4FK0 A;  1NKC A;  2IGI A;  5FRM A;  2GUI A;  3CM5 A;  2OPR A;  4FK2 A;  2YKN A;  3ZSV A;  1KTQ A;  3OYD A;  3KK2 A;  4Z4I A;  4FZX C;  3VQD A;  3L2Q A;  4AHV A;  2DFF A;  3K59 A;  3RTV A;  1S9E A;  5DMR A;  3HM9 A;  3QET A;  4CJL A;  4EP4 A;  3OYB A;  4C8K A;  3HO1 A;  4Y1D A;  1ZBH A;  1IH7 A;  2ZD1 A;  3QIN A;  3TAF A;  4M45 A;  4F3O A;  2BE2 A;  3HL8 A;  3TAQ A;  1KLN A;  3AVN A;  1BI4 A;  5E41 A;  2RPI A;  2ZQB A;  4F3T A;  1HQU A;  1YTU A;  1MU2 A;  4CCH A;  4DQR A;  3D0P A;  2G8H A;  4CJR A;  3AVL A;  1WSF A;  1RTH A;  3ZSR A;  3ASM A;  1FK9 A;  4E19 A;  1SV5 A;  4CHQ A;  1TKX A;  3OYH A;  2HW3 A;  2HVI A;  3MXM A;  5CYQ A;  1ZYQ A;  1QSL A;  1KFS A;  1C0U A;  1REV A;  4N5S A;  4CF1 A;  4CHN A;  4B9M A;  1HYZ A;  4CEO A;  4FJ5 A;  4HCC A;  2YHB A;  3NF9 A;  4WE1 A;  3ZSX A;  2Y1J A;  3OVN A;  3VN5 A;  3THV A;  3L8B A;  1VSE A;  3ISN C;  3ZT3 A;  4HCB A;  1GOC A;  2P1J A;  4E1N A;  3NGZ A;  1JXE A;  4BDZ A;  4FLX A;  1TL1 A;  3SNN A;  5I3U A;  3L2U A;  2O4G A;  3L3V A;  4CER A;  5C25 A;  1LWE A;  4R5P A;  1U4B A;  3LAM A;  2Z1H A;  2LSN A;  1SUQ A;  4C8O A;  3IAY A;  4DQP A;  3L2V A;  3AO2 A;  4W5Q A;  4CJQ A;  4E7I A;  4FJJ A;  4H8K A;  2G8V A;  3SJJ A;  3NE6 A;  3E01 A;  1HQE A;  1HNV A;  1Q9Y A;  1WSJ A;  3ZSO A;  3NAE A;  4W5R A;  4KRF A;  4FW1 A;  4CGG A;  4CJV A;  4MFB A;  5KGW A;  1WAF A;  4CJK A;  4MQ3 A;  3SV4 A;  4DQS A;  1T03 A;  3OS2 A;  1TK8 A;  4OJR A;  2X74 A;  3HPH A;  3V9W A;  2ITG A;  1D8Y A;  4M3T A;  4QCL A;  1YVU A;  2RKI A;  3V9S A;  1KFD A;  3K2P A;  4EP5 A;  5HRN A;  1NK9 A;  4CF8 A;  1RBR A;  1HYS A;  4CEB A;  1FKP A;  2E4L A;  3NH1 A;  1RT3 A;  3ZSZ A;  4AIL C;  5HRP A;  1TVR A;  4AH9 A;  2FBT A;  1JLF A;  3TR8 A;  3T1A A;  3I8D A;  2FC0 A;  3RRG A;  4DSI A;  4CHZ A;  3V1O A;  1IKW A;  4NCA A;  4FXD A;  1C0M A;  1VK0 A;  2BDP A;  4QOZ B;  1EXQ A;  3OYA A;  2HMI A;  4OKE A;  4N56 A;  3OYE A;  3T3F A;  3DLK A;  4F2R A;  3PX4 A;  3IS9 A;  3VQQ A;  4M3Y A;  1UAX A;  1WN7 A;  3DMJ A;  3ZT0 A;  1S5J A;  1BQM A;  1I3A A;  1YT3 A;  3A2F A;  4O44 A;  4CF0 A;  3K57 A;  1LV5 A;  2G8W A;  2HHX A;  2WON A;  3QIO A;  1RIL A;  3PO4 A;  1ZBU A;  5FDL A;  3HT3 A;  2HVH A;  4DTN A;  4IBN A;  3LDS A;  3KK1 A;  3LP0 A;  3JYT A;  1U48 A;  4W5T A;  3ULD A;  1BIS A;  3TAM A;  2OZM A;  3ZT1 A;  4BDY A;  1EP4 A;  4GVM A;  5KRS A;  2RF2 A;  1KCF A;  2YNI A;  4FJ7 A;  1VRU A;  1JKH A;  1QSY A;  4DSK A;  1CLQ A;  3WNG A;  1BCM A;  1SKS A;  3CFO A;  4DFP A;  1J54 A;  1N5Y A;  4M42 A;  1T8E A;  3LAN A;  4CJU A;  1S1X A;  4E3S A;  1HJR A;  1NJX A;  1IG9 A;  2E6M A;  3OJU A;  1JLG A;  3ZSW A;  4CJE A;  4HUG A;  3S9H A;  4OVL A;  1L5U A;  4CK3 A;  4PUO A;  3MAQ A;  4CF2 A;  4KV8 A;  4DS5 A;  1VSJ A;  2KQ2 A;  3HST B;  1EKE A;  1XHZ A;  3OYK A;  2QK9 A;  3RR7 A;  1R0A A;  1NK7 A;  3U3G A;  4F8R A;  2HHT A;  3HP9 A;  1Q8I A;  1JLA A;  3KK3 A;  1KLM A;  1WSH A;  1WSI A;  1CXQ A;  4OGC A;  1RTD A;  1RCH A;  1BIZ A;  4FYD A;  3KKR A;  5HRR A;  1BIU A;  4FM0 A;  1QTM A;  3IRX A;  4M41 A;  3SUQ A;  4CJS A;  3OY9 A;  1TL3 A;  3QO9 A;  3TWH A;  1TK0 A;  4FJG A;  4FVM A;  5J2P A;  2KZZ A;  4NYF A;  3SCX A;  1GOB A;  4KRE A;  4KTQ A;  1SL2 A;  2HHQ A;  3AO4 A;  1RDC A;  4CHP A;  2QKB A;  3DLE A;  1UA1 A;  1S9G A;  1JLE A;  4IG3 A;  3VQA A;  4O0I A;  4KTZ A;  3M8R A;  4M3Z A;  2GV9 A;  3OYI A;  4CK1 A;  1LW0 A;  4FJX A;  4FZZ A;  3NDK A;  4CEC A;  4FJL A;  3DLG A;  1L3U A;  1QHT A;  1QSS A;  4KKO A;  3NF8 A;  2JGU A;  2XHB A;  4DTR A;  3KLH A;  1WSG A;  3LWL A;  1VSL A;  4FLZ A;  3L3U A;  3DRP A;  5J2Q A;  3MXI A;  4KHY A;  3OYM A;  4DU3 A;  2X78 A;  3U6F A;  3WNE A;  3V1R A;  4CGD A;  3AVI A;  4IDK A;  3RR8 A;  4BWJ A;  2B5J A;  3TAR A;  1VSM A;  2XY5 A;  2IDO A;  1GOA A;  4CGJ A;  1L3V A;  3B6P A;  1QQC A;  4L8R B;  4O0J A;  5KTQ A;  1XC9 A;  1KVC A;  2F8T A;  3KLE A;  1B92 A;  3AVJ A;  3AVF A;  1LWC A;  4AHU A;  2P5G A;  4B3O A;  2HB5 A;  4M3U A;  4FK4 A;  4N47 A;  2G8I A;  4AHR A;  1G15 A;  4CHY A;  1XHX A;  4BDP A;  2KTQ A;  4CJF A;  3HXM A;  4B8A B;  2D5R A;  3RMB A;  4DMN A;  1TKD A;  1K6Y A;  2Q3S A;  1NK4 A;  2YNH A;  3BDP A;  3ITH A;  1DTT A;  3MEG A;  4DTJ A;  2OYQ A;  4NYN A;  4KO0 A;  1CZ9 A;  1JXB A;  1RDB A;  4DTX A;  4CF9 A;  3LZI A;  3KLI A;  4DFJ A;  3AV9 A;  1U47 A;  2YV0 X;  4XIU A;  4BE0 A;  1FKO A;  2VG5 A;  4LH4 A;  4UQG A;  2FBV A;  2IAJ A;  3SPZ A;  4BE2 A;  3P1G A;  2F8S A;  3OS0 A;  4B9S A;  4ZTF A;  4KHQ A;  4CFD A;  4IFY A;  2BAN A;  4RG8 A;  3DRS A;  3M8P A;  4G1Q A;  4FLW A;  3M8S A;  4FJN A;  1VSD A;  2DFE A;  4AHS A;  2D0A A;  2A1S A;  5SZT A;  1U49 A;  1WNS A;  5JS2 A;  4H4M A;  1U45 A;  1SKR A;  1D9F A;  3K58 A;  2HNZ A;  3KIO A;  3L2R A;  3NF7 A;  2GBZ A;  3HPG A;  3LWM A;  4DF4 A;  2G8U A;  3V9Z A;  2XRI A;  1NK6 A;  4Q0B A;  4KI6 A;  3DYA A;  3O3H A;  2A1R A;  3MXJ A;  1W0H A;  3V9U A;  5C24 A;  4C8N A;  1BL3 A;  2FBX A;  3TAB A;  3PUF A;  4B9U A;  4DLE A;  4FJ8 A;  1FXX A;  4W5N A;  3NGI A;  4DFM A;  3RWU A;  1D9D A;  2DFH A;  2YNF A;  4DF8 A;  3AA3 A;  2G8F A;  4J2D A;  4JS4 A;  5I42 A;  3TI0 A;  4GW6 A;  5CZ2 A;  4N76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...