4CGGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cggA00
5EU7A 3WNGA 1KRPA 3TANA 1JXBA 3AVAA 4MFBA 3SI6A 4KB0A 1TV6A 4CGDA 3K57A 3HP6A 3HJFA 2ZD1A 4CJWA 2P5GA 2VG6A 3NGZA 2B5JA 3C95A 4RW7A 2YNFA 3LP0A 4CF0A 4N5SA 1IH7A 4Y1DA 4UQGA 3V9ZA 2RKIA 4IBNA 1NJYA 2GBZA 2DFHA 3T19A 3H08A 3M8QA 1RILA 4B9SA 1O1WA 2Z1IA 1JL2A 1S9EA 3TARA 1QS4A 3NH2A 2PYLA 1L3TA 1QSSA 1RTHA 4H8KA 1C1CA 2HMIA 4PUOA 5JS1A 5SWMA 3VQQA 3CFRA 3QO9A 1ZBLA 3C6TA 5KI6A 3KK3A 2HHVA 3DRRA 2YKNA 1DLOA 3AV9A 3VQ9A 3ALYA 1XHXA 3LWMA 3TWHA 3AVKA 5HLFA 3SZ2A 2DY4A 2EHGA 3VN5A 4FJ8A 1SKRA 4YNQA 1X1PA 1YT3A 3QEVA 4I7FA 3S3NA 2FBTA 4CHOA 1DTQA 2G8UA 1B9FA 4F8RA 3LP1A 2NUBA 2LSNA 3AA4A 2QKKA 4OPKA 3NFAA 5FRNA 1Z26A 1GOCA 2JGUA 4DSFA 4KPYA 4FXDA 4DS4A 3ZCMA 3ZSZA 3CM5A 3LPUA 4KFBA 4HHTA 3HK2A 2E6MA 3K59A 3NE6A 3MEEA 4OKEA 3V6DA 4BWJA 3O3GA 4AHCA 1HYZA 3PX6A 4DLGA 1VSKA 3KLEA 4CK3A 4YFUA 3NH0A 1SL1A 4FJMA 4CGGA 1VRUA 2HNYA 1D9DA 3O4NA 1BIUA 4CHNA 3HT3A 4CIFA 2A1RA 4B9NA 4EZ9A 4Z4FA 2Z1GA 4FK2A 3L2QA 1DTTA 2G8VA 4ICLA 4FJHA 2E6LA 4Q5VA 3G10A 3L3UA 4KRFA 1HNIA 4CEEA 1U4BA 1NK9A 4DF8A 3M8RA 3OYKA 3AO2A 5J1EA 1TK0A 1ZBHA 4E7HA 4CF9A 1L3UA 1IG9A 1ASVA 1TKXA 3OJSA 4DTRA 1Y97A 1CLQA 1XWLA 3HXMA 4PY5A 1WSHA 1BQNA 3AA2A 1LAWA 3AO5A 3VQ7A 1UAXA 4CF8A 1IKXA 4FJGA 1J9AA 1MU2A 2OA8A 3AA3A 5CY4A 4FJXA 3SUPA 1QTMA 1LWFA 1S6QA 3CM6A 3LP3A 3NH1A 1RT7A 3SCXA 3NBPA 4B08A 2R7YA 1HRHA 4CJTA 3SNNA 4CK1A 2ZQBA 5J2QA 4B9MA 3S9HA 4DTXA 4FJ9A 4N56A 3RR7A 3IG1A 5K14A 5T7BA 4DSJA 1HYVA 1C0TA 3DLKA 1S9GA 4Y1CA 3OYMA 1U47A 1TK5A 1BI4B 5FRMA 3RTVA 1UWBA 3TI0A 4DWIA 1JLEA 3QINA 4B8CA 4E0DA 1LWCA 1T03A 2HHSA 3T3FA 4TSXA 4DMNA 4HUEA 4G1QA 3VQAA 2BGGA 1RBSA 3NAEA 4CFDA 1J53A 3SJJA 4CIEA 4QAGA 1RT6A 3ZSWA 2OPSA 4WE1A 3SUNA 4M41A 3K5LA 4Z4EA 4O0JA 2DFEA 2FBYA 2QXFA 3KD1E 4DSEA 3RMCA 4CGHA 5HRNA 4E19A 4LY7A 3VQ4A 1EP4A 5DK5A 2GUIA 1QHTA 2A1SA 1J54A 1KFSA 4KI4A 4CJ5A 3P5JA 1JLAA 4BDPA 3RWUA 1RT4A 3I8DA 4DU1A 5KGXA 4KHUA 4M3ZA 2HHXA 4HCCA 5CZ2A 3P1GA 1D9FA 1S1XA 3V81A 3JSMA 2XY5A 4MQ3A 1BL3A 3AA5X 4CERA 2YNHA 5HRRA 3MXIA 3D45A 2G8HA 1JLFA 3AVIA 3PUFA 4OKJA 2FC0A 4LH4A 4N76A 1XC9A 1KVAA 2IDOA 4IKFA 1FXXA 3AVNA 1XI1A 2OPQA 2DTUA 4OPJA 4FLTA 2YHBA 1WSEA 1NOZA 2ATQA 3DOKA 4NCGA 4CJFA 1NOYA 3MEGA 4FLXA 4GMJB 2Z1HA 1X9WA 4O55A 4LD0A 3F73A 3ULDA 3SUOA 1JLCA 2X78A 1RBUA 1UA0A 3ZSXA 3CG7A 2DFFA 4FJKA 3F9KA 2OYQA 4I9LA 4N41A 3BDPA 1LV5A 3PV8A 3DLGA 4RW4A 3U3GA 3ZSRA 5HRPA 3M8SA 3TAQA 1X9MA 3NGIA 3VQ6A 4CFCA 2GV9A 3LAMA 4KB1A 3OYGA 4FLYA 1FK9A 2BANA 3MAQA 3V9SA 1S1TA 2O4IA 1VSDA 1KLNA 3KIOA 1B9DA 1L3SA 2QKBA 3K58A 1U49A 4DSIA 1RTIA 1GOBA 5CYMA 4B8AB 3VA3A 2KFZA 4Z4HA 4FK4A 3OJUA 1KCFA 4RW6A 5KRTA 2HW3A 1EX4A 3DLEA 3KJVA 4OLBA 1TL1A 4AHRA 1YVUA 3HYFA 3LPTA 1XHZA 4H4OA 3D0PA 1NK0A 1IKVA 3QERA 4LSNA 3VQ8A 3V4IA 3LANA 1NKCA 4PQUA 3MEDA 4FM0A 4DSLA 2YKMA 2IS3A 3AVFA 4BWMA 4CFBA 1TAUA 2D0CA 4FW2A 2JLEA 1S1UA 2VG5A 2X6NA 1C1AA 3OYJA 4DQQA 4FYDA 3SV4A 2XRIA 1WSIA 5J2MA 3TAGA 1NKBA 1SL2A 3VQ5A 3EZ5A 4CGIA 1A5VA 4HUGA 3OYLA 1K6YA 3HPHA 3ZSQA 4CJKA 1KVCA 3L2UA 3K5MA 1S5JA 4F2SA 1X9SA 3AVLA 4ID1A 1TK8A 4FLZA 3PX4A 4CEFA 1T8EA 3TABA 4CHYA 3VQBA 1KVBA 2G8KA 1RBVA 3KLGA 3VQCA 3L3VA 4O0IA 2PYJA 3QLHA 2X74A 4H4MA 4IDKA 3ZT1A 4DS5A 1NK6A 1WLJA 2EX3A 2RN2A 2WOMA 3OS2A 4CF2A 4CJPA 4RG8A 3ITHA 3ZSYA 1S6PA 2FBXA 1Q9XA 4GW6A 5KGWA 1BISA 3OYNA 4E7LA 1CXQA 1Q8IA 4FZYA 1HQEA 3U3YA 4O4GA 1NK7A 2YHAA 2Y1IA 3KTQA 1RT1A 3DRSA 4HCBA 4KTQA 3G0ZA 3S3MA 1HYSA 3LP2A 4I9QA 4J2DA 4B3OA 4FZXC 4K8XA 1HJRA 1WSGA 1REVA 3AO1A 1U48A 3MXMA 2QK9A 1W9HA 2WONA 3DI6A 1JXEA 3JYTA 3OYHA 3U6FA 4ID5A 3PX0A 4PA1A 3ISNC 1CZ9A 3AVBA 3QETA 4IFVA 3DM2A 4EP4A 3HP9A 3KKRA 4NYFA 2KTQA 2Z1JA 4CHZA 1W0HA 4DFMA 3P83D 3SYZA 4FVMA 4PWDA 4AHTA 4DF4A 1LAVA 2OPRA 4DTOA 5J2PA 1JLQA 1NK5A 4DLEA 4C8LA 4IFYA 4DFKA 4OLAA 3KK1A 1HNVA 3SQ1A 1I3AA 1VSHA 2YNGA 3SUQA 4FK0A 5C42A 2HHWA 4JRPA 4RW8A 4CJSA 3I0RA 1VRTA 1BGXT 4HVJA 1NJZA 3KKSA 3O3HA 4E3SA 3HM9A 4ZTJA 4KTZA 3HPOA 4FLVA 3OVNA 1Z25A 1WSJA 3MECA 4FZZA 4C8NA 3K5NA 4F3TA 3LWLA 1C0MA 1BIZA 4OKKA 4CJRA 3OYBA 2D0AA 1FKPA 2G8WA 1KLMA 3QIPA 5C25A 3EYZA 4W5TA 1LWEA 1B92A 4DTJA 2P51A 5KTQA 1N6QA 3CFOA 4NYNA 5E41A 1NK8A 2OZMA 3L2WA 1RDCA 3NF9A 1RDAA 3SV3A 4CEDA 1ZYQA 1SKWA 3DLHA 4M3YA 4FLWA 2D5RA 4CJUA 3OYAA 4FM2A 3FFIA 4B9UA 4DQPA 1ASUA 4W5QA 4KHWA 4IG3A 4DU4A 3L8BA 4E7JA 2BDPA 2HHTA 2HHQA 2O4GA 4CEAA 2XHBA 4JLHA 4CHPA 2HVHA 3KLFA 1RTJA 2RPIA 4CJ3A 2XY7A 3THVA 4CK2A 1WAFA 4CJEA 4DTSA 4M45A 3B6PA 1TL3A 2IAJA 1TKDA 2FBVA 2ITGA 1IKWA 3I0SA 4KO0A 4W5NA 4Q0BA 1I39A 1VK0A 3SQ2A 1SUQA 1A5WA 3OYIA 1LW0A 3LDSA 1U45A 3TAPA 1F21A 5FROA 4ZTFA 1BI4A 3OYCA 3RMDA 3PY8A 2VWKA 3AVMA 1TVRA 2XY8A 3AO4A 3V1RA 4O5BA 4OJRA 3DMJA 5FDLA 4DTUA 4DTNA 3RRHA 4N47A 2G8IA 1QSYA 3SQ0A 1N5YA 2IGIA 3T1AA 4BE0A 5HROA 5SZTA 3TAFA 1GOAA 3V1OA 3LZJA 1KFDA 4LH5A 3L2VA 1RBTA 4CJ4A 2KW4A 1JLBA 5D3GA 1QQCA 1CZBA 4CGJA 1JKHA 2PY5A 1WN7A 2X6SA 3MXJA 3QESA 1TKTA 2IC3A 3L2RA 3OYDA 3VQEA 4M3WA 3QEWA 3TR8A 1RT2A 4OGEA 4W5RA 4B9VA 1ZBUA 4LSLA 3V9WA 2B4JA 3AVHA 3VQDA 3HL8A 4DG1A 4F2RA 3OS0A 4FJNA 3NF6A 4NCAA 3UIQA 4FCYA 1HMVA 1TKZA 4CF1A 3V9UA 3NF7A 1TGOA 4J2BA 4JRQA 2HNDA 1EXQA 1C0UA 3HO1A 3RR8A 5CYQA 3VQPA 1BCOA 1HQUA 2I5JA 1VSLA 2OPPA 3O3FA 1WAJA 4L8RB 1UOCA 1RCHA 1R0AA 2HNZA 4CHQA 3DRPA 1NJWA 3IAYA 5KRSA 3NF8A 4Z0UA 2E4LA 4FLUA 4EP5A 1L3VA 4J2EA 3NCIA 3TAEA 3HVTA 4XIUA 2KZMA 3KLHA 2OZSA 1YTUA 4C8MA 2F8TA 4KHQA 2XO7A 1C1BA 1EKEA 4FW1A 4E1MA 4KHYA 4BDZA 4CEQA 3IRXA 1HPZA 4JS4A 2G8FA 4OVLA 1T7PA 2P5OA 1UA1A 3QEXA 1L5UA 4EZ6A 4KI6A 1ZBIA 4QOZB 4DTPA 4KHSA 4JS5A 1RT5A 4I2QA 3OYFA 4BACA 1VSFA 1IKYA 1NK4A 4FJLA 1BHLA 1WNSA 1S1VA 3VA0A 4CFAA 4AHSA 1J5OA 3CQ8A 1RTDA 2HHUA 4R5PA 4CECA 4KREA 4IG0A 4DQIA 1Q9YA 3WNHA 3QNOA 3IS9A 4B9LA 4M3RA 1T05A 4ZHRA 2KZZA 2IOCA 4ELVA 1ITGA 4C8KA 1JLGA 4GVMA 4DSKA 3AO3A 3K2PA 3NDKA 4AHVA 4K8ZA 2KQ2A 4KTWA 4FJIA 4DQRA 4DU3A 1RNHA 4KV8A 4RW9A 2D0BA 3C94A 5C24A 3A2FA 4HUFA 4C8OA 2HB5A 4Z4CA 4W5OA 1LW2A 1RDDA 1BCMA 2VWJA 1NKEA 2YNIA 1RT3A 4E1NA 4CEOA 4NCBA 3OY9A 4DFPA 4OGCA 3KD5E 3AVCA 3M8PA 5HP1A 1VSJA 2KFNA 3OS1A 3SPZA 1WSFA 3ZT4A 4AH9A 1S1WA 1SKSA 3S3OA 1VSIA 4QCLA 3HVRA 3DYAA 4CEZA 4KHNA 4O44A 2ZE2A 3KLIA 3HSTB 4CE9A 4CESA 4BE1A 2PZSA 5I3UA 3EY1A 3BGRA 3ZSOA 2RF2A 2BE2A 2B6AA 4E7KA 1VSMA 2YV0X 4KKOA 4Z4GA 4E89A 3C6UA 3QEIA 4BDYA 3CYMA 4AILC 4ELTA 4CEBA 3SQ4A 4B9TA 2XY6A 1EETA 2P1JA 4CCHA 3CFPA 3K5OA 1SL0A 5CZ1A 4CJLA 1SV5A 1RDBA 3NHGA 3WNFA 1D5AA 2W42A 2F96A 4CIGA 3E01A 4M3TA 3DLRA 2ETJA 1ZBFA 3WNEA 3LALA 4F4KA 4DQSA 3DOLA 1U04A 1KSPA 3ASMA 1QSLA 3OYEA 4AHUA 1BQMA 3DLBA 3ZSVA 1NJXA 3PO4A 3LZIA 3QNNA 3PO5A 4CGFA 4Z4IA 3RMBA 3V1QA 3QIOA 1RBRA 2F8SA 3O4QA 4M42A 1A5XA 5DMRA 2Y1JA 4DFJA 3RRGA 4M3UA 4I2PA 4CJQA 4J2AA 2HVIA 1TAQA 5HRSA 1YTAA 2AJQA 4F3OA 3LAKA 1KTQA 3KK2A 4KAZA 3ZT2A 1JL1A 3V9XA 3HPGA 1VSEA 3ZT0A 4FJ5A 4M3XA 1G15A 2Q3SA 1IO2A 3RMAA 3NGYA 4FJJA 1D8YA 3B6OA 5HBMA 1FKOA 5I42A 5J2NA 4HTUA 3AVGA 4E7IA 4FJ7A 1QE1A 3AVJA 4DTMA 3QEPA 3SPYA 1C6VA 4CJVA 3TAMA 3ZT3A 1ASWA 4BE2A 5JS2A 4FM1A 2VG7A 1CXUA 4ELUA
chains in the Genus database with same CATH superfamily
3TANA 4CGDA 1GLLO 2ZD1A 2P5GA 2PAVA 2YJEA 1NGDA 2YNFA 3LP0A 3QMLA 3H3OB 3BEXA 3T19A 1QQMA 1RILA 2P9IB 2Z1IA 1JL2A 1S3XA 5H1SQ 1QS4A 1LCUA 1QSSA 4QS9A 4FL9A 4PUOA 3VQQA 3CFRA 4B3RK 2YKNA 1DLOA 3AV9A 2HSTA 3WQUA 4FWRA 3VN5A 4FJ8A 4YNQA 3M1FA 4YOVA 2WFBA 4GY2B 2NUBA 3CJ1A 1P90A 3BZKA 2QKKA 4IXCA 4A2AA 3ZCMA 3ZSZA 3ZEUB 3CM5A 4KFBA 5EY4A 5DM7L 3HK2A 3IKMA 4AHCA 3OBWA 3KLEA 4CK3A 1SL1A 4LF8K 4MDAA 2EWSA 1D9DA 3HT3A 4CIFA 3UKUA 4Z4FA 4J8FA 4ICLA 4M7YA 3Q7CA 1U6ZA 4Q5VA 4HWIA 4JI7K 3T1YK 3FZMA 1HNIA 1U4BA 3SMSA 5J1EA 4CF9A 1TKXA 2P9SB 3OA9A 4BY9C 1WSHA 4BG9A 1LAWA 2E2NA 4DV3K 3MWPA 4FJGA 1J9AA 1MU2A 3PIPL 3SUPA 1VQ4N 3CM6A 1QTMA 3LP3A 3NBPA 1TYQA 1HNZK 5B8HA 4DR7K 5J2QA 4JKHA 3S9HA 5K14A 1HYVA 2HOEA 1U47A 3OYMA 1JCFA 4GVEA 5FRMA 1YUWA 5JVGL 4DWIA 1JLEA 4B8CA 3L6QA 2HHSA 4DB3A 4G1QA 4BRCA 4CFDA 3ZSWA 2OPSA 4XH4A 3K5LA 4Y0WA 3R8EA 2DFEA 1ZBSA 2E1YA 4H0TB 4CJ7A 2IVOA 4DSEA 3KD1E 4CGHA 2P9UA 5DK5A 3T1HK 2NNWA 4B1UB 4KHUA 5KGXA 2CGLA 1MWMA 3P1GA 4ISGA 3LL3A 2XY5A 2D0PA 3WXJA 4FVUA 4CERA 1KD1O 3IMXA 2YNHA 5HRRA 5BRHA 2KZZA 1KVAA 2IDOA 1NU0A 1FXXA 3VERA 2IIRA 4CBUA 1VQ6N 2QWOA 2YHBA 2ATQA 3DOKA 1NOYA 2Z1HA 2X78A 1NWKA 1RBUA 2I7NA 3ZSXA 3O8MA 3TAQA 5HRPA 4U7BA 3MK6A 1X9MA 3CCLN 4KB1A 3O9SA 4A5AA 3D7EO 1S1TA 5AQMA 1KLNA 3KIOA 1L3SA 3C6AA 4EHUA 5CYMA 4B8AB 3VA3A 2HW3A 3LDLA 5JICA 1WBDA 1KXPA 1QVGM 3SAHA 4IEIA 2GTDA 4H4OA 3QERA 4LSNA 3V4IA 4WFNL 1K9MO 3ZX0A 2YKMA 2JLEA 3HM8A 4BRLA 1KC8O 2VG5A 3OYJA 1C1AA 1WSIA 1NKBA 1A5VA 3OYLA 1K6YA 3L2UA 3BY5A 1KAXA 1X9SA 2VQEK 3FLCO 4B3TK 4DR1K 1T8EA 5C2FA 5I9EB 4UY8O 4IOCL 5AJ3K 1E4GT 2WC9A 2X74A 3MN5A 3J7ZO 1K8AO 2BTFA 5GAGP 4RG8A 1S6PA 2YHXA 3E9PA 4YORA 1Q18A 3AGRA 1CXQA 5HOOA 5BPLA 3KTQA 4KTQA 3R9PA 3DRSA 4YHHK 1WUAA 1X9JA 4FZXC 4K8XA 1HJRA 1U48A 2QK9A 3CCRN 3DI6A 1T6DA 4PA1A 5MLCQ 1M90O 1RGIA 3F2KA 5AQNA 4CHZA 3NVKA 3SYZA 4PWDA 5J2PA 3HSCA 1NK5A 4C8LA 3KK1A 3SQ1A 1I3AA 3TSQA 3KKSA 2O8BB 3VEXA 3HM9A 4PL7A 4CJRA 5LJVA 1KLMA 3A5OC 1QHAA 4W5TA 2NZTA 3CD6N 4GV6A 5M1OA 5IWAK 3L2WA 3NF9A 2F4VK 1ZYQA 4M3YA 4FLWA 2D5RA 3M6GA 4DU4A 3L8BA 4E7JA 2HHTA 3E1YA 1D4XA 2XHBA 1YIJN 4JLHA 2P9KB 1BWFO 3LDQA 2HVHA 4C1NK 3KLFA 3F5TA 1RTJA 3N4QA 1DKGD 1WAFA 1VQ7N 1P8ZA 3B6PA 5JLFA 1TKDA 2NRTA 1V4SA 4Q0BA 1LW0A 3THWB 1BI4A 3RMDA 4NLBA 1TVRA 2XY8A 1IJJA 4H5VA 3SQ0A 1N5YA 2IGIA 3LZJA 1ATSA 1BOTO 4CJ4A 2KW4A 5EXWA 1NBWA 4BVOA 3KZBA 1CZBA 4EFHA 5D3GA 4YY3K 1C0FA 3GG4A 2IC3A 4LF9K 3L4IA 4CZEA 3MN9A 3QFUA 3VEWA 2HBKA 1RT2A 1ZBUA 3ZYYX 4IOAL 2B4JA 4R79A 3VQDA 3HL8A 2HBMA 2P9KA 1HMVA 1TKZA 4CF1A 3MN7A 3P38A 4J2BA 4JRQA 1HLUA 1C0UA 3VQPA 3O3FA 4I6MB 3THYA 4YOTA 1UOCA 2HNZA 5BRFA 4FLUA 2E4LA 1L3VA 4JI1K 3NCIA 1QQOA 2KZMA 2OZSA 4C8MA 1BG3A 4KHYA 2CH6A 1WBBA 3ZETB 4QOZB 4DV4K 3QEXA 1L5UA 3O1WA 2VWBA 4BC4A 3VEOA 3I33A 2E8AA 1S1VA 3VA0A 1NGJA 1RTDA 2HHUA 3CJ9A 4FPAA 1Y64A 1HNWK 1ITGA 5FPEA 4C8KA 4MO4A 1JLGA 4DSKA 4FJIA 4DU3A 4RW9A 4BC3A 3G71N 5AQLA 4H0YB 2HB5A 1LW2A 4H0PA 2NRWA 2YNIA 3I8BA 1RT3A 4JI3K 4E1NA 4NCBA 2O8DB 3HOTA 4DFPA 4GV9A 4KHNA 3DYAA 2HF3A 3HSTB 4CESA 3ZETA 4BE1A 5I3UA 1VSMA 5AQGA 3LDOA 4AILC 3R3LA 4ELTA 4CEBA 5AQRA 4BRQA 4JKEA 3OTOK 3H46O 3SBTA 2W42A 2F96A 3DLRA 3WNEA 3LALA 3DOLA 2HBLA 5GAHP 4FWQA 4BVPA 4CZGA 1BQMA 2RHKA 3ZX3A 4KH6A 1XUPO 3ULEB 3DXMB 4MLEA 4LF4K 3QIOA 2OTLN 4O8UA 4DFJA 4JNEA 1K8KA 4J2AA 3FGUA 4F3OA 4KAZA 1EWQA 3ZT2A 3HPGA 4DHYA 4BR7A 3O80A 4FJJA 1XNRK 1SAZA 3B6OA 2ZF5O 3AARA 2UUAK 4DTMA 3SPYA 4FM1A 1WB9A 4CI6A 2VG7A 3MX5A 5EU7A 3WNGA 1KRPA 4MFBA 4KB0A 2QWLA 1TV6A 3HJFA 4JKGA 1I94K 3GE1A 2V7ZA 2CGKA 2B5JA 3C95A 4JK8A 3LDPA 4UQGA 3V9ZA 2RKIA 5AR0A 4JV5K 2GBZA 3DLLL 4B9SA 1S9EA 4JEPA 1J5EK 1L3TA 2PYLA 5AQWA 3DXMA 1C1CA 4FWPA 2GEMA 4BRDA 3DRRA 3VQ9A 2FLOA 3AVKA 4CZHA 2EHGA 5AZIB 1SKRA 1ZC6A 1YT3A 3S3NA 4I7FA 3LM9A 3CXCM 2FBTA 4CHOA 1DTQA 4F8RA 3LP1A 4ILGB 2LSNA 3AA4A 2O8CA 3UB5A 3CIPA 1NMNA 5FRNA 1N8RO 2YHYA 1Z26A 1GOCA 4KPYA 2E1ZA 4CZLA 3C6HA 3LPUA 3T7ZA 4HHTA 4BQLA 4M7XA 3V6DA 4IWVA 4BWJA 3TU5A 3O3GA 1XMQK 3CMEN 4YFUA 4CGGA 1VRUA 2ZWHA 3SJHA 4B9NA 4NB4A 4FPBA 2G8VA 3L3UA 2AA4A 4KRFA 3UE5A 5AZJB 4CEEA 4NLCA 4DF8A 3WUHA 3OYKA 4E7HA 1YJWN 1GLDG 1CLQA 3VQ7A 3HBTA 4U67L 2UU9K 1IKXA 1HPMA 2OA8A 4BQZA 4X65K 4X62K 5CY4A 1KAYA 1S6QA 3NH1A 3CCQN 2R7YA 3AGKA 4CJTA 3HOSA 4IJAA 4YOWA 4DTXA 3RR7A 1OH7A 4H0VB 4FO0A 4K25A 3RTVA 3TI0A 2JWKA 5C2DA 2E5LK 3QINA 1T03A 4TSXA 4DMNA 4HUEA 4WQ4A 4JKAA 5EX5A 3VQAA 3NAEA 4X66K 1J53A 4EAHD 3SJJA 4WE1A 3SUNA 2IVPA 4O0JA 4CBXA 1EP4A 1RDWX 1YJ9N 4CJ5A 1VQ5N 3P5JA 1JLAA 4DKWA 5AZJA 4BDPA 3RWUA 4DU1A 2VQFK 1XMOK 4HCCA 1C0GA 3QDKA 3MXIA 2G8HA 3AVIA 3PUFA 4OKJA 2FC0A 4N76A 3AVNA 2OPQA 2DTUA 1OKJA 1WSEA 1NOZA 4IEEA 4NCGA 4CD1A 3J81O 4FLXA 1X9WA 4O55A 4LD0A 2O8EA 1JLCA 1W2BM 2DFFA 4FJKA 3F9KA 4I9LA 4IO9L 3PV8A 4RW4A 3U3GA 3M8SA 2Q31A 4BREA 1VQ9N 2GV9A 2UXBK 4WYBA 1FK9A 2BANA 4MLHA 1VSDA 3WXLA 4GV3A 3HTVA 1U49A 2KFZA 3ID6A 2NRHA 4QS7A 5KPRA 4RW6A 5KRTA 4B1WB 3DLEA 3CMAN 4OLBA 4Z94A 1TL1A 2QXLA 4AHRA 1JJ2M 3LPTA 3HYFA 1XHZA 1NG9A 1IKVA 3VQ8A 3K9JA 4DSLA 4DR5K 3AVFA 4CFBA 4HTLA 3WXIA 1ESVA 1S1UA 4JK7A 4FOIA 5J2MA 1SL2A 3VQ5A 1EWRA 4CJKA 3K5MA 1KVCA 3L0QA 3AVLA 1TK8A 3PX4A 3L4QA 3K0SA 1RBVA 5KQ8A 3L3VA 1SZ2A 5BRDA 4DS5A 3ZT1A 3J7AP 2EX3A 2RN2A 5AFUH 1BISA 4FWNA 4E7LA 1Q8IA 2P9IA 4FZYA 1NK7A 3C7NB 1HKGA 4HCBA 1YVNA 4J2DA 2E2QA 4JI8K 1W9HA 1JXEA 3JYTA 3OYHA 4JI2K 4BRPA 1CZ9A 3CC2N 4IFVA 4NYFA 2Z1JA 4A62A 3HZ6A 3H1QA 4DTOA 4OX9K 1HNVA 4FK0A 4JRPA 3JAMO 1VRTA 1BO5O 4MDBA 3ZEUA 3J80O 4ZTJA 3R6MA 3BF3A 3CC4N 1Z25A 1SQKA 3I56N 2D0AA 2G8WA 5C25A 3EYZA 4PKHA 1NGHA 1SS6A 1NK8A 1S22A 3CCEN 1RDAA 3DLHA 3OYAA 2IVNA 1NGBA 4B3SK 4B9UA 1ASUA 2Q36A 4DCHA 4W5QA 2P9PB 2QWRA 2HHQA 2O4GA 4CEAA 1X3MA 4CHPA 2P9SA 3THXB 5F1XA 1N36K 4GKKK 5M1FA 4DQ8A 2XY7A 4CK2A 1TUUA 1TL3A 3CCUN 4ISEA 1IKWA 3I0SA 4KO0A 3SQ2A 1SUQA 4BC2A 3OYCA 4CBWA 2VWKA 3AVMA 4KHPK 3AO4A 3V1RA 4DTNA 2G8IA 1NNEA 1OH8A 4NXMK 3KWIA 2P9LB 4BE0A 2GELA 3TAFA 3V1OA 1KFDA 3ATUA 1QQCA 4DV0K 2PY5A 3ENHA 4BR4A 1WN7A 2NRZA 2QTDA 1ATNA 4M3WA 3QEWA 2A40A 3MN6A 4OGEA 3O9QA 2A42A 4B9VA 4LSLA 2P9PA 4F2RA 3FZKA 2FF3B 3O08A 3NF7A 1JCGA 4K43A 3RR8A 5CYQA 1HQUA 2OPPA 2ZJPL 5GAEP 3RSEB 4AQYK 3CJCA 3DRPA 3J7YP 4BR0A 1NJWA 1YTUA 1X3NA 1C1BA 4E1MA 3IRXA 3VETA 2UUBK 2P5OA 4OVLA 4KI6A 1UA1A 2QWPA 4KHSA 3F9MA 2ZJRL 4BACA 4LF7K 1IKYA 1NK4A 3W0LA 5BR8K 2WUSA 3CQ8A 3VF4A 4DQIA 1Q9YA 3IS9A 4B9LA 4M3RA 4ZHRA 1VHXA 3R1XA 4ELVA 4GVMA 5EVZA 3AO3A 1ZXOA 2KQ2A 5FPNA 4JI0K 4KV8A 1FJGK 4W5OA 4CZJA 4WQ4C 1RDDA 2VWJA 2Q97A 2I7PA 4OGCA 4YOXA 3FFKB 2KFNA 3OS1A 4QCLA 3ZT4A 1S1WA 5AQSA 1VSIA 3CETA 4CEZA 3KLIA 4CE9A 2V51B 2NRRA 4A5BA 5AFUA 3BGRA 2RF2A 2BE2A 2B6AA 4KKOA 4FWLA 3FE1A 4E89A 3VEVA 3C6UA 5GADP 4BDYA 3VENA 4B9TA 4CCHA 3CFPA 2PFUA 1NJIO 1RDBA 3NHGA 4CD3A 3AAQA 1G99A 4IDHA 4CIGA 1ZBFA 3A8YA 1QSLA 3I55N 3SLCA 1NJXA 3PO5A 3QNNA 3EE9A 3RMBA 3V1QA 4DR6K 5CE3A 1XC3A 3C0BA 5DMRA 2V7YA 4M42A 2YCHA 4I2PA 4CJQA 2HVIA 1TAQA 4BGBA 1N34K 2O8BA 1YTAA 2AJQA 4KH4A 3KK2A 4LF6K 2Q1NA 3U8XA 1VSEA 3ZT0A 3RVCA 4KH5A 5AQZA 2Q3SA 5HL7L 4LFBK 1FKOA 5I42A 5J2NA 4YOUA 4LFCK 3BP8A 5AQYA 4CJVA 3ZT3A 1ASWA 1CXUA 1NLVA 5C0YA 3AVAA 3HP6A 3A5MC 4CJWA 4DR2K 4N5SA 4CF0A 1RDUA 1IH7A 3FZHA 4Y1DA 1NJYA 4IBNA 2DFHA 3H08A 1DT9A 3M8QA 1O1WA 3TARA 2OTJN 1RTHA 5JS1A 2HMPA 5AQTA 5SWMA 1ZBLA 3THWA 3C6TA 5KI6A 3KK3A 2HHVA 3GBTA 2ITMA 3LWMA 1LOTB 3CQXA 1QVFM 3DXKB 4YOYA 4EIAA 3QEVA 1B9FA 4C1NI 2QA4N 2W6LA 3NFAA 4OPKA 2D0OA 5BN8A 3WEEB 3TTCA 4FXDA 2E6MA 4OKEA 3PX6A 1HYZA 2UYTA 3NH0A 4FJMA 3NMUA 1BIUA 2A1RA 4EZ9A 4CZIA 5AQHA 3QFPA 2Z1GA 4JI4K 3CCMN 3L2QA 4ILJA 1ILYA 4I6MA 3GL1A 2E6LA 3G10A 5ADXH 1NK9A 3M8RA 1WOQA 3CCJN 3KVGA 3AO2A 1L3UA 1IG9A 3OJSA 5IT9O 5F0XA 4PY5A 4CF8A 1BQNA 3AA2A 2WBNA 1HUXA 3CCSN 3G25A 1LWFA 3PLAA 1OVQA 1RT7A 1BA0A 4B08A 4FOEA 4FJ9A 4N56A 5T7BA 1C0TA 3FR0A 4Y1CA 1TK5A 3C65A 3WEEA 1NGFA 1LWCA 2DPNA 1XQSC 2BGGA 1RBSA 4CIEA 4QAGA 4AM6A 3N4PA 4Z4EA 5TKWA 3RMCA 1KAZA 5GINA 4E19A 4LY7A 3VQ4A 3SAGA 1QHTA 2A1SA 1J54A 3CJAA 1KFSA 3SAFA 3OHRA 4B3MK 1RT4A 1O13A 2O8DA 3A5LC 1D9FA 1S1XA 3V81A 5FPMA 4MQ3A 1BL3A 1T6CA 4K42A 4IJNA 1OH6A 3D45A 1R59O 4LH4A 3CJBA 1XC9A 2FSNA 1XI1A 4JKBA 5BN9A 1HKCA 4FLTA 1U2VB 2YX6A 1NGAA 4CJFA 3MEGA 4GMJB 3F73A 5FLXO 4K0KK 3BDPA 1LV5A 3ZSRA 4CFCA 2HBJA 3OYGA 2O4IA 4V19S 3BF1A 1B9DA 4O5FA 3K58A 4LC9B 5C15A 1RTIA 1GOBA 3U9ZA 4Z4HA 3MWTA 2GWKA 4A61A 3ULEA 2A6AA 3KWGA 1KCFA 3D6RA 5A2QO 3KJVA 3EN9A 1YVUA 3O1BA 3D0PA 2E2OA 4JD2B 3VGKA 2IS3A 1TAUA 2W40A 4FW2A 4XEIA 3K9KA 4ISFA 4O8KA 5BPMA 2Q0RA 1HJOA 5JMVA 4DQQA 4FYDA 2ASMA 3SV4A 2BH1A 4A2BA 3EZ5A 4CGIA 4HUGA 1U2VA 4F2SA 1S5JA 4ID1A 4CEFA 3TABA 4CHYA 2G8KA 3VQCA 1RFQA 4BRMA 4O0IA 2PYJA 3QLHA 3VGMA 2WOMA 4H5RA 3OS2A 4CF2A 4CJPA 3ITHA 3VEZA 3ZSYA 1Q9XA 4GW6A 4DUYK 4JHDB 3U3YA 2YHAA 2Y1IA 1RT1A 4KBOA 4MO5A 1QZ5A 3S3MA 4B3OA 4I9QA 4A59A 1HYSA 3TPQA 2WONA 4G9ZA 3DJCA 3ISNC 3QETA 5M1PA 4WQ5A 3KKRA 5AZIA 3TSPA 2W6KA 4AHTA 2OPRA 4IFYA 1CZAN 2YNGA 3SUQA 5C42A 2HHWA 4RW8A 2Q2RA 4HVJA 4E3SA 4FWOA 4KTZA 4WCEL 2Q0UA 3OVNA 1WSJA 4C8NA 3K5NA 4F3TA 3LWLA 4L3QA 1C0MA 4OKKA 3OYBA 1FKPA 3A0IX 3QIPA 1OH5A 1B92A 4DTJA 2P51A 4BRKA 5KTQA 4NYNA 2YI1A 3AY9A 2OZMA 5ADXA 1ATRA 3SV3A 4CEDA 4CJUA 5BREA 1VQ8N 4IG3A 2BDPA 3D2FB 3P31A 3CQYA 1HX1A 5AQUA 1T44A 4CJ3A 2RPIA 3THVA 4PKIA 4DTSA 4M45A 1W97L 5CHIA 5DM6L 1I39A 3LDSA 1U45A 3TAPA 1F21A 4ZTFA 3PY8A 4O5BA 4OJRA 5FDLA 4BRNA 1VQLN 3CF5L 3T1AA 5SZTA 3ZLJA 2UUCK 4LH5A 1YF5L 1JLBA 1JKHA 3MXJA 4BR9A 3QESA 3L2RA 3EZWA 3VQEA 2AP1A 2QWMA 3TR8A 3D2EB 4H5TA 1E3MA 4W5RA 2E2PA 3D2FA 4DG1A 4NCAA 2VYPA 3UIQA 3O9RA 3V9UA 2OANA 3UKUB 2HNDA 1VSLA 1WAJA 2NLXA 5KPTA 4CHQA 3IAYA 5KRSA 3NF8A 4EP5A 2YHWA 4BR2A 3KLHA 2F8TA 4KHQA 3U9DA 2XO7A 4FW1A 1IBMK 4K41A 5LMUK 4WFAL 4JS4A 2G8FA 1T7PA 4EZ6A 1TYQB 4JS5A 1RT5A 4I2QA 5E84A 3OYFA 1VSFA 1WNSA 3EO3A 4BR5A 3VPZA 4BGAA 4FSVA 3NVMA 4KREA 4CECA 4IG0A 3WNHA 4XH5A 1MA9B 1IV0A 3D2EA 1T05A 2IOCA 5C12A 3K2PA 2P9NB 3NDKA 4AHVA 4K8ZA 4KTWA 1Z05A 4DQRA 3SMPA 1RNHA 3ZX2A 2D0BA 3VGLA 2P9UB 3A2FA 4HUFA 4C8OA 1BDGA 4A57A 1BCMA 1NKEA 4B1XB 4JYAK 3E9OA 3EKSA 3OBYA 4X64K 3KD5E 3AVCA 3P4IA 3EE8A 3QB0A 1VSJA 4IZ9A 1WSFA 4AH9A 3S3OA 2PBDA 3HVRA 2ZE2A 2VGMA 3J8AA 3QBXA 3JXUA 1YI2N 3ZSOA 3WXKA 4PKGA 4Z4GA 3GDQA 1EO1A 3CYMA 3SQ4A 1EETA 3K5OA 3C7NA 3OW2M 5CZ1A 1SV5A 3WNFA 4M3TA 3WQTA 3EEQA 3ID8A 3U4LA 4DR4K 2P9NA 3ASMA 1IBLK 1T3VA 2ASPA 3PO4A 3LZIA 4CGFA 5KPZA 1RBRA 3CJ7A 2F8SA 2UXCK 2GX9A 4BRAA 1Q81O 3HI0A 2Y1JA 2E20A 5HRSA 3LAKA 1JL1A 4M3XA 2F7TA 5AQQA 3Q7BA 1V4TA 3RMAA 1D8YA 4FJ7A 1QZ6A 4FWMA 1S72N 5M1KA 1QE1A 3AVJA 3TAMA 2QW9A 5JS2A 2HHHK 4ELUA 1YXQA 1W7AA 1JXBA 3SK3A 3SI6A 4H5NA 3K57A 4H0XB 2D4WA 2GUPA 2VG6A 3NGZA 4RW7A 3THXA 5CR4A 3MCPA 4RWTA 5FPDA 3NH2A 4H8KA 2HMIA 5LY3A 3QO9A 1NMDA 3ALYA 1XHXA 3TWHA 5HLFA 3SZ2A 2DY4A 2P9LA 3LDNA 1X1PA 1MDUB 2G8UA 4FWSA 1Q82O 1K73O 4PHTX 4WQ5C 4JN4A 4DSFA 2JGUA 4GNIA 4DS4A 3K59A 3NE6A 4CZKA 4F9OA 4DR3K 3MEEA 4EHTA 4DLGA 1VSKA 4IO8A 2A41A 2HNYA 4OPHA 3O4NA 4CHNA 1VQKN 4GKJK 5LL6Z 3DWLA 4FK2A 4JKFA 5TKYA 4BROA 1DTTA 1NGEA 1GLBG 3RSEA 4BC5A 4JAXA 4LFAK 5GIOA 2RE2A 2FSKA 1TK0A 1ZBHA 3P39A 3H6EA 1ASVA 2CH5A 1Y97A 3UKRB 4DTRA 1XWLA 5ELZA 3HXMA 3AO5A 2ZM6K 3CERA 1UAXA 4BRGA 4DV2K 1FW6A 4NXNK 3AA3A 4FJXA 2ASOA 3E66A 3SCXA 5EOYA 1HRHA 4B9MA 4YDUA 2KHOA 2ZQBA 4CK1A 3SNNA 3IG1A 4DSJA 3DLKA 4CZMA 1S9GA 1IBKK 1BI4B 3EKUA 1UWBA 1VQON 1Z6RA 4E0DA 3KK7A 3MDQA 3T3FA 1KQSM 3IUCA 1NGGA 1VQNN 3O4WA 3CPWM 1RT6A 4NO7A 4M41A 1TUYA 1YJNN 2FBYA 2QXFA 4RTFD 4DV7K 5HRNA 3FZLA 4OPAA 2GUIA 4KI4A 1VQPN 2FSJA 1NGIA 3IFRA 4JKCA 3I8DA 4M3ZA 2HHXA 5CZ2A 4AM7A 3JSMA 3AA5X 3UKRA 2VGNA 4FJHA 1JLFA 3THYB 4IKFA 4BRIA 4OPJA 3CHWA 2GWJA 4WFBL 3TTDA 3SUOA 5AQOA 3ULDA 3T69A 1GLFO 1UA0A 3CG7A 2OYQA 4N41A 3DLGA 1BA1A 1J6ZA 4IOXA 3VQ6A 4CW7B 3NGIA 3LAMA 4FLYA 3MAQA 3V9SA 2QKBA 4DSIA 3O5BA 3CC7N 4FK4A 3OJUA 1EX4A 4JI6K 2NRXA 2WTUA 4DV5K 1NK0A 3O6WA 4PQUA 3LANA 5M1QA 3WXMB 3MEDA 5BR9A 4DV6K 4FM0A 1NKCA 4BWMA 4AF1A 2D0CA 3MCAB 1H1VA 2X6NA 2XRIA 3TAGA 5AQXA 3JS6A 3HPHA 3ZSQA 5AQIA 5JLHA 1Q7YO 4FLZA 3FZFA 3VQBA 1KVBA 3KLGA 1JCEA 2F9WA 1VQMN 4H4MA 4IDKA 5C10A 1NK6A 1WLJA 5KQDA 1N33K 3A5NC 2FBXA 5KGWA 3OYNA 4LF5K 3MX2A 4QS8A 3E9LA 3EL2A 1HQEA 4O4GA 3G0ZA 3LP2A 3PIOL 3TSUA 5AQVA 4WF9L 1WSGA 1REVA 3AO1A 2KKZA 3MXMA 3PX0A 3U6FA 4ID5A 4H5WA 3G6EN 3AVBA 3DM2A 4EP4A 3HP9A 2KTQA 2CGJA 1W0HA 3DXKA 4DFMA 3M3ZA 3P83D 4FVMA 4DF4A 1LAVA 1JLQA 4DLEA 1N32K 4OLAA 4DFKA 2VCPA 1VSHA 1NM1A 2OCEA 1K8KB 4CJSA 1BU6O 3I0RA 3B8AX 5M1NA 1BGXT 1NJZA 3O3HA 2A3ZA 4CZFA 2JWLA 3HPOA 4FLVA 1YHQN 3MECA 4FZZA 4BRFA 3VTIA 1BIZA 1M1KO 2QEXN 3VEYA 1GLJO 1EQYA 4OO1J 2QWQA 3DAWA 1LWEA 3W3DA 3H3NO 5LMNK 1N6QA 3CFOA 5E41A 4JI5K 3IDHA 1RDCA 1MWKA 1SKWA 4IFEA 4FM2A 3FFIA 2YJFA 4DQPA 4KHWA 4DV1K 2FXUA 4JKGB 3BZCA 1VAZA 4PL8A 3CPEA 2A5XA 4M63C 4B1YB 4CJEA 2ZJQL 2IAJA 2FBVA 2KLAA 2ITGA 4JKDA 4W5NA 5AQFA 1VK0A 3OYIA 1A5WA 3S41A 5FROA 5AQPA 2QWNA 3BUZB 4DTUA 3DMJA 3RRHA 2ZGZA 4JK9A 4N47A 1QSYA 2H3GX 4BG8A 5HROA 1GOAA 3L2VA 1RBTA 3WT0A 4CGJA 2O8CB 2X6SA 4E1JA 2D1KA 1TKTA 4ILHA 3MMVA 3OYDA 1IG8A 3VF2A 3H1VX 2E88A 4FWKA 3V9WA 2V52B 3QICA 3AVHA 4CVNE 3OS0A 4FJNA 3NF6A 4FCYA 1OVYA 1TGOA 1HR0K 1DEJA 2J4RA 4H03B 1EXQA 3HO1A 3ENBA 1BCOA 2I5JA 1XNQK 3AAPA 2HF4A 4L8RB 1RCHA 1R0AA 4Z0UA 1HNXK 3GOIA 4J2EA 1QQNA 3TAEA 1NGCA 3HVTA 4XIUA 1EKEA 4BDZA 3O9TA 4CEQA 4DUZK 1HPZA 1ZBIA 4DTPA 4B9QA 1GLCG 4FJLA 3ENOA 1BHLA 1BUPA 4CFAA 4AHSA 1J5OA 5F2RA 5GIPA 4R5PA 3QNOA 4YDUC 1HKBA 5AQKA 4JD2A 2QM1A 3CI5A 3C94A 4H0OA 5C24A 4Z4CA 3VMFB 4RCHA 5AQJA 4CEOA 2O8FB 3OY9A 3VOVA 3M8PA 5HP1A 3SPZA 2F9TA 1SKSA 2FF6A 3VF6A 1YITN 4O44A 1E4FT 3SBGA 2QI2A 1DGKN 2PZSA 3H45C 3VESA 3EY1A 4E7KA 2BUPA 3O9UA 2YV0X 4B1VA 2UXDK 3TTFA 3G4SN 3QEIA 1YAGA 2XY6A 2O8EB 2P1JA 1GLEG 3ATVA 4JHDA 5JVHL 4C23A 1SL0A 4CJLA 5E26A 1D5AA 3E01A 2ZGYA 2ETJA 4F4KA 4DQSA 1U04A 3HRGA 1KSPA 3OYEA 4AHUA 3DLBA 5BPNA 3ZSVA 3M5RA 3VTHA 4Z4IA 4XH1A 4BRHA 1Q86O 3O4QA 4M3UA 1A5XA 3RRGA 3LM2A 2O8FA 2W41A 1KTQA 3V9XA 3PSIA 1GLAG 5LJWA 4FJ5A 3CCVN 1G15A 1IO2A 3KHYA 3NGYA 2NRVA 5HBMA 4HTUA 3AVGA 4E7IA 4B1ZA 3PSFA 3QEPA 1C6VA 3QBWA 4BE2A
chains in the Genus database with same CATH topology
5EU7A 3WNGA 1KRPA 3TANA 1JXBA 3AVAA 4MFBA 3SI6A 4KB0A 1TV6A 4CGDA 3K57A 3HP6A 3HJFA 2ZD1A 4CJWA 2P5GA 2VG6A 3NGZA 2B5JA 3C95A 4RW7A 2YNFA 3LP0A 4CF0A 4N5SA 1IH7A 4Y1DA 4UQGA 3V9ZA 2RKIA 4IBNA 1NJYA 2GBZA 2DFHA 3T19A 3H08A 3M8QA 1RILA 4B9SA 1O1WA 2Z1IA 1JL2A 1S9EA 3TARA 1QS4A 3NH2A 2PYLA 1L3TA 1QSSA 1RTHA 4H8KA 1C1CA 2HMIA 4PUOA 5JS1A 5SWMA 3VQQA 3CFRA 3QO9A 1ZBLA 3C6TA 5KI6A 3KK3A 2HHVA 3DRRA 2YKNA 1DLOA 3AV9A 3VQ9A 3ALYA 1XHXA 3LWMA 3TWHA 3AVKA 5HLFA 3SZ2A 2DY4A 2EHGA 3VN5A 4FJ8A 1SKRA 4YNQA 1X1PA 1YT3A 3QEVA 4I7FA 3S3NA 2FBTA 4CHOA 1DTQA 2G8UA 1B9FA 4F8RA 3LP1A 2NUBA 2LSNA 3AA4A 2QKKA 4OPKA 3NFAA 5FRNA 1Z26A 1GOCA 2JGUA 4DSFA 4KPYA 4FXDA 4DS4A 3ZCMA 3ZSZA 3CM5A 3LPUA 4KFBA 4HHTA 3HK2A 2E6MA 3K59A 3NE6A 3MEEA 4OKEA 3V6DA 4BWJA 3O3GA 4AHCA 1HYZA 3PX6A 4DLGA 1VSKA 3KLEA 4CK3A 4YFUA 3NH0A 1SL1A 4FJMA 4CGGA 1VRUA 2HNYA 1D9DA 3O4NA 1BIUA 4CHNA 3HT3A 4CIFA 2A1RA 4B9NA 4EZ9A 4Z4FA 2Z1GA 4FK2A 3L2QA 1DTTA 2G8VA 4ICLA 4FJHA 2E6LA 4Q5VA 3G10A 3L3UA 4KRFA 1HNIA 4CEEA 1U4BA 1NK9A 4DF8A 3M8RA 3OYKA 3AO2A 5J1EA 1TK0A 1ZBHA 4E7HA 4CF9A 1L3UA 1IG9A 1ASVA 1TKXA 3OJSA 4DTRA 1Y97A 1CLQA 1XWLA 3HXMA 4PY5A 1WSHA 1BQNA 3AA2A 1LAWA 3AO5A 3VQ7A 1UAXA 4CF8A 1IKXA 4FJGA 1J9AA 1MU2A 2OA8A 3AA3A 5CY4A 4FJXA 3SUPA 1QTMA 1LWFA 1S6QA 3CM6A 3LP3A 3NH1A 1RT7A 3SCXA 3NBPA 4B08A 2R7YA 1HRHA 4CJTA 3SNNA 4CK1A 2ZQBA 5J2QA 4B9MA 3S9HA 4DTXA 4FJ9A 4N56A 3RR7A 3IG1A 5K14A 5T7BA 4DSJA 1HYVA 1C0TA 3DLKA 1S9GA 4Y1CA 3OYMA 1U47A 1TK5A 1BI4B 5FRMA 3RTVA 1UWBA 3TI0A 4DWIA 1JLEA 3QINA 4B8CA 4E0DA 1LWCA 1T03A 2HHSA 3T3FA 4TSXA 4DMNA 4HUEA 4G1QA 3VQAA 2BGGA 1RBSA 3NAEA 4CFDA 1J53A 3SJJA 4CIEA 4QAGA 1RT6A 3ZSWA 2OPSA 4WE1A 3SUNA 4M41A 3K5LA 4Z4EA 4O0JA 2DFEA 2FBYA 2QXFA 3KD1E 4DSEA 3RMCA 4CGHA 5HRNA 4E19A 4LY7A 3VQ4A 1EP4A 5DK5A 2GUIA 1QHTA 2A1SA 1J54A 1KFSA 4KI4A 4CJ5A 3P5JA 1JLAA 4BDPA 3RWUA 1RT4A 3I8DA 4DU1A 5KGXA 4KHUA 4M3ZA 2HHXA 4HCCA 5CZ2A 3P1GA 1D9FA 1S1XA 3V81A 3JSMA 2XY5A 4MQ3A 1BL3A 3AA5X 4CERA 2YNHA 5HRRA 3MXIA 3D45A 2G8HA 1JLFA 3AVIA 3PUFA 4OKJA 2FC0A 4LH4A 4N76A 1XC9A 1KVAA 2IDOA 4IKFA 1FXXA 3AVNA 1XI1A 2OPQA 2DTUA 4OPJA 4FLTA 2YHBA 1WSEA 1NOZA 2ATQA 3DOKA 4NCGA 4CJFA 1NOYA 3MEGA 4FLXA 4GMJB 2Z1HA 1X9WA 4O55A 4LD0A 3F73A 3ULDA 3SUOA 1JLCA 2X78A 1RBUA 1UA0A 3ZSXA 3CG7A 2DFFA 4FJKA 3F9KA 2OYQA 4I9LA 4N41A 3BDPA 1LV5A 3PV8A 3DLGA 4RW4A 3U3GA 3ZSRA 5HRPA 3M8SA 3TAQA 1X9MA 3NGIA 3VQ6A 4CFCA 2GV9A 3LAMA 4KB1A 3OYGA 4FLYA 1FK9A 2BANA 3MAQA 3V9SA 1S1TA 2O4IA 1VSDA 1KLNA 3KIOA 1B9DA 1L3SA 2QKBA 3K58A 1U49A 4DSIA 1RTIA 1GOBA 5CYMA 4B8AB 3VA3A 2KFZA 4Z4HA 4FK4A 3OJUA 1KCFA 4RW6A 5KRTA 2HW3A 1EX4A 3DLEA 3KJVA 4OLBA 1TL1A 4AHRA 1YVUA 3HYFA 3LPTA 1XHZA 4H4OA 3D0PA 1NK0A 1IKVA 3QERA 4LSNA 3VQ8A 3V4IA 3LANA 1NKCA 4PQUA 3MEDA 4FM0A 4DSLA 2YKMA 2IS3A 3AVFA 4BWMA 4CFBA 1TAUA 2D0CA 4FW2A 2JLEA 1S1UA 2VG5A 2X6NA 1C1AA 3OYJA 4DQQA 4FYDA 3SV4A 2XRIA 1WSIA 5J2MA 3TAGA 1NKBA 1SL2A 3VQ5A 3EZ5A 4CGIA 1A5VA 4HUGA 3OYLA 1K6YA 3HPHA 3ZSQA 4CJKA 1KVCA 3L2UA 3K5MA 1S5JA 4F2SA 1X9SA 3AVLA 4ID1A 1TK8A 4FLZA 3PX4A 4CEFA 1T8EA 3TABA 4CHYA 3VQBA 1KVBA 2G8KA 1RBVA 3KLGA 3VQCA 3L3VA 4O0IA 2PYJA 3QLHA 2X74A 4H4MA 4IDKA 3ZT1A 4DS5A 1NK6A 1WLJA 2EX3A 2RN2A 2WOMA 3OS2A 4CF2A 4CJPA 4RG8A 3ITHA 3ZSYA 1S6PA 2FBXA 1Q9XA 4GW6A 5KGWA 1BISA 3OYNA 4E7LA 1CXQA 1Q8IA 4FZYA 1HQEA 3U3YA 4O4GA 1NK7A 2YHAA 2Y1IA 3KTQA 1RT1A 3DRSA 4HCBA 4KTQA 3G0ZA 3S3MA 1HYSA 3LP2A 4I9QA 4J2DA 4B3OA 4FZXC 4K8XA 1HJRA 1WSGA 1REVA 3AO1A 1U48A 3MXMA 2QK9A 1W9HA 2WONA 3DI6A 1JXEA 3JYTA 3OYHA 3U6FA 4ID5A 3PX0A 4PA1A 3ISNC 1CZ9A 3AVBA 3QETA 4IFVA 3DM2A 4EP4A 3HP9A 3KKRA 4NYFA 2KTQA 2Z1JA 4CHZA 1W0HA 4DFMA 3P83D 3SYZA 4FVMA 4PWDA 4AHTA 4DF4A 1LAVA 2OPRA 4DTOA 5J2PA 1JLQA 1NK5A 4DLEA 4C8LA 4IFYA 4DFKA 4OLAA 3KK1A 1HNVA 3SQ1A 1I3AA 1VSHA 2YNGA 3SUQA 4FK0A 5C42A 2HHWA 4JRPA 4RW8A 4CJSA 3I0RA 1VRTA 1BGXT 4HVJA 1NJZA 3KKSA 3O3HA 4E3SA 3HM9A 4ZTJA 4KTZA 3HPOA 4FLVA 3OVNA 1Z25A 1WSJA 3MECA 4FZZA 4C8NA 3K5NA 4F3TA 3LWLA 1C0MA 1BIZA 4OKKA 4CJRA 3OYBA 2D0AA 1FKPA 2G8WA 1KLMA 3QIPA 5C25A 3EYZA 4W5TA 1LWEA 1B92A 4DTJA 2P51A 5KTQA 1N6QA 3CFOA 4NYNA 5E41A 1NK8A 2OZMA 3L2WA 1RDCA 3NF9A 1RDAA 3SV3A 4CEDA 1ZYQA 1SKWA 3DLHA 4M3YA 4FLWA 2D5RA 4CJUA 3OYAA 4FM2A 3FFIA 4B9UA 4DQPA 1ASUA 4W5QA 4KHWA 4IG3A 4DU4A 3L8BA 4E7JA 2BDPA 2HHTA 2HHQA 2O4GA 4CEAA 2XHBA 4JLHA 4CHPA 2HVHA 3KLFA 1RTJA 2RPIA 4CJ3A 2XY7A 3THVA 4CK2A 1WAFA 4CJEA 4DTSA 4M45A 3B6PA 1TL3A 2IAJA 1TKDA 2FBVA 2ITGA 1IKWA 3I0SA 4KO0A 4W5NA 4Q0BA 1I39A 1VK0A 3SQ2A 1SUQA 1A5WA 3OYIA 1LW0A 3LDSA 1U45A 3TAPA 1F21A 5FROA 4ZTFA 1BI4A 3OYCA 3RMDA 3PY8A 2VWKA 3AVMA 1TVRA 2XY8A 3AO4A 3V1RA 4O5BA 4OJRA 3DMJA 5FDLA 4DTUA 4DTNA 3RRHA 4N47A 2G8IA 1QSYA 3SQ0A 1N5YA 2IGIA 3T1AA 4BE0A 5HROA 5SZTA 3TAFA 1GOAA 3V1OA 3LZJA 1KFDA 4LH5A 3L2VA 1RBTA 4CJ4A 2KW4A 1JLBA 5D3GA 1QQCA 1CZBA 4CGJA 1JKHA 2PY5A 1WN7A 2X6SA 3MXJA 3QESA 1TKTA 2IC3A 3L2RA 3OYDA 3VQEA 4M3WA 3QEWA 3TR8A 1RT2A 4OGEA 4W5RA 4B9VA 1ZBUA 4LSLA 3V9WA 2B4JA 3AVHA 3VQDA 3HL8A 4DG1A 4F2RA 3OS0A 4FJNA 3NF6A 4NCAA 3UIQA 4FCYA 1HMVA 1TKZA 4CF1A 3V9UA 3NF7A 1TGOA 4J2BA 4JRQA 2HNDA 1EXQA 1C0UA 3HO1A 3RR8A 5CYQA 3VQPA 1BCOA 1HQUA 2I5JA 1VSLA 2OPPA 3O3FA 1WAJA 4L8RB 1UOCA 1RCHA 1R0AA 2HNZA 4CHQA 3DRPA 1NJWA 3IAYA 5KRSA 3NF8A 4Z0UA 2E4LA 4FLUA 4EP5A 1L3VA 4J2EA 3NCIA 3TAEA 3HVTA 4XIUA 2KZMA 3KLHA 2OZSA 1YTUA 4C8MA 2F8TA 4KHQA 2XO7A 1C1BA 1EKEA 4FW1A 4E1MA 4KHYA 4BDZA 4CEQA 3IRXA 1HPZA 4JS4A 2G8FA 4OVLA 1T7PA 2P5OA 1UA1A 3QEXA 1L5UA 4EZ6A 4KI6A 1ZBIA 4QOZB 4DTPA 4KHSA 4JS5A 1RT5A 4I2QA 3OYFA 4BACA 1VSFA 1IKYA 1NK4A 4FJLA 1BHLA 1WNSA 1S1VA 3VA0A 4CFAA 4AHSA 1J5OA 3CQ8A 1RTDA 2HHUA 4R5PA 4CECA 4KREA 4IG0A 4DQIA 1Q9YA 3WNHA 3QNOA 3IS9A 4B9LA 4M3RA 1T05A 4ZHRA 2KZZA 2IOCA 4ELVA 1ITGA 4C8KA 1JLGA 4GVMA 4DSKA 3AO3A 3K2PA 3NDKA 4AHVA 4K8ZA 2KQ2A 4KTWA 4FJIA 4DQRA 4DU3A 1RNHA 4KV8A 4RW9A 2D0BA 3C94A 5C24A 3A2FA 4HUFA 4C8OA 2HB5A 4Z4CA 4W5OA 1LW2A 1RDDA 1BCMA 2VWJA 1NKEA 2YNIA 1RT3A 4E1NA 4CEOA 4NCBA 3OY9A 4DFPA 4OGCA 3KD5E 3AVCA 3M8PA 5HP1A 1VSJA 2KFNA 3OS1A 3SPZA 1WSFA 3ZT4A 4AH9A 1S1WA 1SKSA 3S3OA 1VSIA 4QCLA 3HVRA 3DYAA 4CEZA 4KHNA 4O44A 2ZE2A 3KLIA 3HSTB 4CE9A 4CESA 4BE1A 2PZSA 5I3UA 3EY1A 3BGRA 3ZSOA 2RF2A 2BE2A 2B6AA 4E7KA 1VSMA 2YV0X 4KKOA 4Z4GA 4E89A 3C6UA 3QEIA 4BDYA 3CYMA 4AILC 4ELTA 4CEBA 3SQ4A 4B9TA 2XY6A 1EETA 2P1JA 4CCHA 3CFPA 3K5OA 1SL0A 5CZ1A 4CJLA 1SV5A 1RDBA 3NHGA 3WNFA 1D5AA 2W42A 2F96A 4CIGA 3E01A 4M3TA 3DLRA 2ETJA 1ZBFA 3WNEA 3LALA 4F4KA 4DQSA 3DOLA 1U04A 1KSPA 3ASMA 1QSLA 3OYEA 4AHUA 1BQMA 3DLBA 3ZSVA 1NJXA 3PO4A 3LZIA 3QNNA 3PO5A 4CGFA 4Z4IA 3RMBA 3V1QA 3QIOA 1RBRA 2F8SA 3O4QA 4M42A 1A5XA 5DMRA 2Y1JA 4DFJA 3RRGA 4M3UA 4I2PA 4CJQA 4J2AA 2HVIA 1TAQA 5HRSA 1YTAA 2AJQA 4F3OA 3LAKA 1KTQA 3KK2A 4KAZA 3ZT2A 1JL1A 3V9XA 3HPGA 1VSEA 3ZT0A 4FJ5A 4M3XA 1G15A 2Q3SA 1IO2A 3RMAA 3NGYA 4FJJA 1D8YA 3B6OA 5HBMA 1FKOA 5I42A 5J2NA 4HTUA 3AVGA 4E7IA 4FJ7A 1QE1A 3AVJA 4DTMA 3QEPA 3SPYA 1C6VA 4CJVA 3TAMA 3ZT3A 1ASWA 4BE2A 5JS2A 4FM1A 2VG7A 1CXUA 4ELUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EU7 A;  3WNG A;  1KRP A;  3TAN A;  1JXB A;  3AVA A;  4MFB A;  3SI6 A;  4KB0 A;  1TV6 A;  4CGD A;  3K57 A;  3HP6 A;  3HJF A;  2ZD1 A;  4CJW A;  2P5G A;  2VG6 A;  3NGZ A;  2B5J A;  3C95 A;  4RW7 A;  2YNF A;  3LP0 A;  4CF0 A;  4N5S A;  1IH7 A;  4Y1D A;  4UQG A;  3V9Z A;  2RKI A;  4IBN A;  1NJY A;  2GBZ A;  2DFH A;  3T19 A;  3H08 A;  3M8Q A;  1RIL A;  4B9S A;  1O1W A;  2Z1I A;  1JL2 A;  1S9E A;  3TAR A;  1QS4 A;  3NH2 A;  2PYL A;  1L3T A;  1QSS A;  1RTH A;  4H8K A;  1C1C A;  2HMI A;  4PUO A;  5JS1 A;  5SWM A;  3VQQ A;  3CFR A;  3QO9 A;  1ZBL A;  3C6T A;  5KI6 A;  3KK3 A;  2HHV A;  3DRR A;  2YKN A;  1DLO A;  3AV9 A;  3VQ9 A;  3ALY A;  1XHX A;  3LWM A;  3TWH A;  3AVK A;  5HLF A;  3SZ2 A;  2DY4 A;  2EHG A;  3VN5 A;  4FJ8 A;  1SKR A;  4YNQ A;  1X1P A;  1YT3 A;  3QEV A;  4I7F A;  3S3N A;  2FBT A;  4CHO A;  1DTQ A;  2G8U A;  1B9F A;  4F8R A;  3LP1 A;  2NUB A;  2LSN A;  3AA4 A;  2QKK A;  4OPK A;  3NFA A;  5FRN A;  1Z26 A;  1GOC A;  2JGU A;  4DSF A;  4KPY A;  4FXD A;  4DS4 A;  3ZCM A;  3ZSZ A;  3CM5 A;  3LPU A;  4KFB A;  4HHT A;  3HK2 A;  2E6M A;  3K59 A;  3NE6 A;  3MEE A;  4OKE A;  3V6D A;  4BWJ A;  3O3G A;  4AHC A;  1HYZ A;  3PX6 A;  4DLG A;  1VSK A;  3KLE A;  4CK3 A;  4YFU A;  3NH0 A;  1SL1 A;  4FJM A;  4CGG A;  1VRU A;  2HNY A;  1D9D A;  3O4N A;  1BIU A;  4CHN A;  3HT3 A;  4CIF A;  2A1R A;  4B9N A;  4EZ9 A;  4Z4F A;  2Z1G A;  4FK2 A;  3L2Q A;  1DTT A;  2G8V A;  4ICL A;  4FJH A;  2E6L A;  4Q5V A;  3G10 A;  3L3U A;  4KRF A;  1HNI A;  4CEE A;  1U4B A;  1NK9 A;  4DF8 A;  3M8R A;  3OYK A;  3AO2 A;  5J1E A;  1TK0 A;  1ZBH A;  4E7H A;  4CF9 A;  1L3U A;  1IG9 A;  1ASV A;  1TKX A;  3OJS A;  4DTR A;  1Y97 A;  1CLQ A;  1XWL A;  3HXM A;  4PY5 A;  1WSH A;  1BQN A;  3AA2 A;  1LAW A;  3AO5 A;  3VQ7 A;  1UAX A;  4CF8 A;  1IKX A;  4FJG A;  1J9A A;  1MU2 A;  2OA8 A;  3AA3 A;  5CY4 A;  4FJX A;  3SUP A;  1QTM A;  1LWF A;  1S6Q A;  3CM6 A;  3LP3 A;  3NH1 A;  1RT7 A;  3SCX A;  3NBP A;  4B08 A;  2R7Y A;  1HRH A;  4CJT A;  3SNN A;  4CK1 A;  2ZQB A;  5J2Q A;  4B9M A;  3S9H A;  4DTX A;  4FJ9 A;  4N56 A;  3RR7 A;  3IG1 A;  5K14 A;  5T7B A;  4DSJ A;  1HYV A;  1C0T A;  3DLK A;  1S9G A;  4Y1C A;  3OYM A;  1U47 A;  1TK5 A;  1BI4 B;  5FRM A;  3RTV A;  1UWB A;  3TI0 A;  4DWI A;  1JLE A;  3QIN A;  4B8C A;  4E0D A;  1LWC A;  1T03 A;  2HHS A;  3T3F A;  4TSX A;  4DMN A;  4HUE A;  4G1Q A;  3VQA A;  2BGG A;  1RBS A;  3NAE A;  4CFD A;  1J53 A;  3SJJ A;  4CIE A;  4QAG A;  1RT6 A;  3ZSW A;  2OPS A;  4WE1 A;  3SUN A;  4M41 A;  3K5L A;  4Z4E A;  4O0J A;  2DFE A;  2FBY A;  2QXF A;  3KD1 E;  4DSE A;  3RMC A;  4CGH A;  5HRN A;  4E19 A;  4LY7 A;  3VQ4 A;  1EP4 A;  5DK5 A;  2GUI A;  1QHT A;  2A1S A;  1J54 A;  1KFS A;  4KI4 A;  4CJ5 A;  3P5J A;  1JLA A;  4BDP A;  3RWU A;  1RT4 A;  3I8D A;  4DU1 A;  5KGX A;  4KHU A;  4M3Z A;  2HHX A;  4HCC A;  5CZ2 A;  3P1G A;  1D9F A;  1S1X A;  3V81 A;  3JSM A;  2XY5 A;  4MQ3 A;  1BL3 A;  3AA5 X;  4CER A;  2YNH A;  5HRR A;  3MXI A;  3D45 A;  2G8H A;  1JLF A;  3AVI A;  3PUF A;  4OKJ A;  2FC0 A;  4LH4 A;  4N76 A;  1XC9 A;  1KVA A;  2IDO A;  4IKF A;  1FXX A;  3AVN A;  1XI1 A;  2OPQ A;  2DTU A;  4OPJ A;  4FLT A;  2YHB A;  1WSE A;  1NOZ A;  2ATQ A;  3DOK A;  4NCG A;  4CJF A;  1NOY A;  3MEG A;  4FLX A;  4GMJ B;  2Z1H A;  1X9W A;  4O55 A;  4LD0 A;  3F73 A;  3ULD A;  3SUO A;  1JLC A;  2X78 A;  1RBU A;  1UA0 A;  3ZSX A;  3CG7 A;  2DFF A;  4FJK A;  3F9K A;  2OYQ A;  4I9L A;  4N41 A;  3BDP A;  1LV5 A;  3PV8 A;  3DLG A;  4RW4 A;  3U3G A;  3ZSR A;  5HRP A;  3M8S A;  3TAQ A;  1X9M A;  3NGI A;  3VQ6 A;  4CFC A;  2GV9 A;  3LAM A;  4KB1 A;  3OYG A;  4FLY A;  1FK9 A;  2BAN A;  3MAQ A;  3V9S A;  1S1T A;  2O4I A;  1VSD A;  1KLN A;  3KIO A;  1B9D A;  1L3S A;  2QKB A;  3K58 A;  1U49 A;  4DSI A;  1RTI A;  1GOB A;  5CYM A;  4B8A B;  3VA3 A;  2KFZ A;  4Z4H A;  4FK4 A;  3OJU A;  1KCF A;  4RW6 A;  5KRT A;  2HW3 A;  1EX4 A;  3DLE A;  3KJV A;  4OLB A;  1TL1 A;  4AHR A;  1YVU A;  3HYF A;  3LPT A;  1XHZ A;  4H4O A;  3D0P A;  1NK0 A;  1IKV A;  3QER A;  4LSN A;  3VQ8 A;  3V4I A;  3LAN A;  1NKC A;  4PQU A;  3MED A;  4FM0 A;  4DSL A;  2YKM A;  2IS3 A;  3AVF A;  4BWM A;  4CFB A;  1TAU A;  2D0C A;  4FW2 A;  2JLE A;  1S1U A;  2VG5 A;  2X6N A;  1C1A A;  3OYJ A;  4DQQ A;  4FYD A;  3SV4 A;  2XRI A;  1WSI A;  5J2M A;  3TAG A;  1NKB A;  1SL2 A;  3VQ5 A;  3EZ5 A;  4CGI A;  1A5V A;  4HUG A;  3OYL A;  1K6Y A;  3HPH A;  3ZSQ A;  4CJK A;  1KVC A;  3L2U A;  3K5M A;  1S5J A;  4F2S A;  1X9S A;  3AVL A;  4ID1 A;  1TK8 A;  4FLZ A;  3PX4 A;  4CEF A;  1T8E A;  3TAB A;  4CHY A;  3VQB A;  1KVB A;  2G8K A;  1RBV A;  3KLG A;  3VQC A;  3L3V A;  4O0I A;  2PYJ A;  3QLH A;  2X74 A;  4H4M A;  4IDK A;  3ZT1 A;  4DS5 A;  1NK6 A;  1WLJ A;  2EX3 A;  2RN2 A;  2WOM A;  3OS2 A;  4CF2 A;  4CJP A;  4RG8 A;  3ITH A;  3ZSY A;  1S6P A;  2FBX A;  1Q9X A;  4GW6 A;  5KGW A;  1BIS A;  3OYN A;  4E7L A;  1CXQ A;  1Q8I A;  4FZY A;  1HQE A;  3U3Y A;  4O4G A;  1NK7 A;  2YHA A;  2Y1I A;  3KTQ A;  1RT1 A;  3DRS A;  4HCB A;  4KTQ A;  3G0Z A;  3S3M A;  1HYS A;  3LP2 A;  4I9Q A;  4J2D A;  4B3O A;  4FZX C;  4K8X A;  1HJR A;  1WSG A;  1REV A;  3AO1 A;  1U48 A;  3MXM A;  2QK9 A;  1W9H A;  2WON A;  3DI6 A;  1JXE A;  3JYT A;  3OYH A;  3U6F A;  4ID5 A;  3PX0 A;  4PA1 A;  3ISN C;  1CZ9 A;  3AVB A;  3QET A;  4IFV A;  3DM2 A;  4EP4 A;  3HP9 A;  3KKR A;  4NYF A;  2KTQ A;  2Z1J A;  4CHZ A;  1W0H A;  4DFM A;  3P83 D;  3SYZ A;  4FVM A;  4PWD A;  4AHT A;  4DF4 A;  1LAV A;  2OPR A;  4DTO A;  5J2P A;  1JLQ A;  1NK5 A;  4DLE A;  4C8L A;  4IFY A;  4DFK A;  4OLA A;  3KK1 A;  1HNV A;  3SQ1 A;  1I3A A;  1VSH A;  2YNG A;  3SUQ A;  4FK0 A;  5C42 A;  2HHW A;  4JRP A;  4RW8 A;  4CJS A;  3I0R A;  1VRT A;  1BGX T;  4HVJ A;  1NJZ A;  3KKS A;  3O3H A;  4E3S A;  3HM9 A;  4ZTJ A;  4KTZ A;  3HPO A;  4FLV A;  3OVN A;  1Z25 A;  1WSJ A;  3MEC A;  4FZZ A;  4C8N A;  3K5N A;  4F3T A;  3LWL A;  1C0M A;  1BIZ A;  4OKK A;  4CJR A;  3OYB A;  2D0A A;  1FKP A;  2G8W A;  1KLM A;  3QIP A;  5C25 A;  3EYZ A;  4W5T A;  1LWE A;  1B92 A;  4DTJ A;  2P51 A;  5KTQ A;  1N6Q A;  3CFO A;  4NYN A;  5E41 A;  1NK8 A;  2OZM A;  3L2W A;  1RDC A;  3NF9 A;  1RDA A;  3SV3 A;  4CED A;  1ZYQ A;  1SKW A;  3DLH A;  4M3Y A;  4FLW A;  2D5R A;  4CJU A;  3OYA A;  4FM2 A;  3FFI A;  4B9U A;  4DQP A;  1ASU A;  4W5Q A;  4KHW A;  4IG3 A;  4DU4 A;  3L8B A;  4E7J A;  2BDP A;  2HHT A;  2HHQ A;  2O4G A;  4CEA A;  2XHB A;  4JLH A;  4CHP A;  2HVH A;  3KLF A;  1RTJ A;  2RPI A;  4CJ3 A;  2XY7 A;  3THV A;  4CK2 A;  1WAF A;  4CJE A;  4DTS A;  4M45 A;  3B6P A;  1TL3 A;  2IAJ A;  1TKD A;  2FBV A;  2ITG A;  1IKW A;  3I0S A;  4KO0 A;  4W5N A;  4Q0B A;  1I39 A;  1VK0 A;  3SQ2 A;  1SUQ A;  1A5W A;  3OYI A;  1LW0 A;  3LDS A;  1U45 A;  3TAP A;  1F21 A;  5FRO A;  4ZTF A;  1BI4 A;  3OYC A;  3RMD A;  3PY8 A;  2VWK A;  3AVM A;  1TVR A;  2XY8 A;  3AO4 A;  3V1R A;  4O5B A;  4OJR A;  3DMJ A;  5FDL A;  4DTU A;  4DTN A;  3RRH A;  4N47 A;  2G8I A;  1QSY A;  3SQ0 A;  1N5Y A;  2IGI A;  3T1A A;  4BE0 A;  5HRO A;  5SZT A;  3TAF A;  1GOA A;  3V1O A;  3LZJ A;  1KFD A;  4LH5 A;  3L2V A;  1RBT A;  4CJ4 A;  2KW4 A;  1JLB A;  5D3G A;  1QQC A;  1CZB A;  4CGJ A;  1JKH A;  2PY5 A;  1WN7 A;  2X6S A;  3MXJ A;  3QES A;  1TKT A;  2IC3 A;  3L2R A;  3OYD A;  3VQE A;  4M3W A;  3QEW A;  3TR8 A;  1RT2 A;  4OGE A;  4W5R A;  4B9V A;  1ZBU A;  4LSL A;  3V9W A;  2B4J A;  3AVH A;  3VQD A;  3HL8 A;  4DG1 A;  4F2R A;  3OS0 A;  4FJN A;  3NF6 A;  4NCA A;  3UIQ A;  4FCY A;  1HMV A;  1TKZ A;  4CF1 A;  3V9U A;  3NF7 A;  1TGO A;  4J2B A;  4JRQ A;  2HND A;  1EXQ A;  1C0U A;  3HO1 A;  3RR8 A;  5CYQ A;  3VQP A;  1BCO A;  1HQU A;  2I5J A;  1VSL A;  2OPP A;  3O3F A;  1WAJ A;  4L8R B;  1UOC A;  1RCH A;  1R0A A;  2HNZ A;  4CHQ A;  3DRP A;  1NJW A;  3IAY A;  5KRS A;  3NF8 A;  4Z0U A;  2E4L A;  4FLU A;  4EP5 A;  1L3V A;  4J2E A;  3NCI A;  3TAE A;  3HVT A;  4XIU A;  2KZM A;  3KLH A;  2OZS A;  1YTU A;  4C8M A;  2F8T A;  4KHQ A;  2XO7 A;  1C1B A;  1EKE A;  4FW1 A;  4E1M A;  4KHY A;  4BDZ A;  4CEQ A;  3IRX A;  1HPZ A;  4JS4 A;  2G8F A;  4OVL A;  1T7P A;  2P5O A;  1UA1 A;  3QEX A;  1L5U A;  4EZ6 A;  4KI6 A;  1ZBI A;  4QOZ B;  4DTP A;  4KHS A;  4JS5 A;  1RT5 A;  4I2Q A;  3OYF A;  4BAC A;  1VSF A;  1IKY A;  1NK4 A;  4FJL A;  1BHL A;  1WNS A;  1S1V A;  3VA0 A;  4CFA A;  4AHS A;  1J5O A;  3CQ8 A;  1RTD A;  2HHU A;  4R5P A;  4CEC A;  4KRE A;  4IG0 A;  4DQI A;  1Q9Y A;  3WNH A;  3QNO A;  3IS9 A;  4B9L A;  4M3R A;  1T05 A;  4ZHR A;  2KZZ A;  2IOC A;  4ELV A;  1ITG A;  4C8K A;  1JLG A;  4GVM A;  4DSK A;  3AO3 A;  3K2P A;  3NDK A;  4AHV A;  4K8Z A;  2KQ2 A;  4KTW A;  4FJI A;  4DQR A;  4DU3 A;  1RNH A;  4KV8 A;  4RW9 A;  2D0B A;  3C94 A;  5C24 A;  3A2F A;  4HUF A;  4C8O A;  2HB5 A;  4Z4C A;  4W5O A;  1LW2 A;  1RDD A;  1BCM A;  2VWJ A;  1NKE A;  2YNI A;  1RT3 A;  4E1N A;  4CEO A;  4NCB A;  3OY9 A;  4DFP A;  4OGC A;  3KD5 E;  3AVC A;  3M8P A;  5HP1 A;  1VSJ A;  2KFN A;  3OS1 A;  3SPZ A;  1WSF A;  3ZT4 A;  4AH9 A;  1S1W A;  1SKS A;  3S3O A;  1VSI A;  4QCL A;  3HVR A;  3DYA A;  4CEZ A;  4KHN A;  4O44 A;  2ZE2 A;  3KLI A;  3HST B;  4CE9 A;  4CES A;  4BE1 A;  2PZS A;  5I3U A;  3EY1 A;  3BGR A;  3ZSO A;  2RF2 A;  2BE2 A;  2B6A A;  4E7K A;  1VSM A;  2YV0 X;  4KKO A;  4Z4G A;  4E89 A;  3C6U A;  3QEI A;  4BDY A;  3CYM A;  4AIL C;  4ELT A;  4CEB A;  3SQ4 A;  4B9T A;  2XY6 A;  1EET A;  2P1J A;  4CCH A;  3CFP A;  3K5O A;  1SL0 A;  5CZ1 A;  4CJL A;  1SV5 A;  1RDB A;  3NHG A;  3WNF A;  1D5A A;  2W42 A;  2F96 A;  4CIG A;  3E01 A;  4M3T A;  3DLR A;  2ETJ A;  1ZBF A;  3WNE A;  3LAL A;  4F4K A;  4DQS A;  3DOL A;  1U04 A;  1KSP A;  3ASM A;  1QSL A;  3OYE A;  4AHU A;  1BQM A;  3DLB A;  3ZSV A;  1NJX A;  3PO4 A;  3LZI A;  3QNN A;  3PO5 A;  4CGF A;  4Z4I A;  3RMB A;  3V1Q A;  3QIO A;  1RBR A;  2F8S A;  3O4Q A;  4M42 A;  1A5X A;  5DMR A;  2Y1J A;  4DFJ A;  3RRG A;  4M3U A;  4I2P A;  4CJQ A;  4J2A A;  2HVI A;  1TAQ A;  5HRS A;  1YTA A;  2AJQ A;  4F3O A;  3LAK A;  1KTQ A;  3KK2 A;  4KAZ A;  3ZT2 A;  1JL1 A;  3V9X A;  3HPG A;  1VSE A;  3ZT0 A;  4FJ5 A;  4M3X A;  1G15 A;  2Q3S A;  1IO2 A;  3RMA A;  3NGY A;  4FJJ A;  1D8Y A;  3B6O A;  5HBM A;  1FKO A;  5I42 A;  5J2N A;  4HTU A;  3AVG A;  4E7I A;  4FJ7 A;  1QE1 A;  3AVJ A;  4DTM A;  3QEP A;  3SPY A;  1C6V A;  4CJV A;  3TAM A;  3ZT3 A;  1ASW A;  4BE2 A;  5JS2 A;  4FM1 A;  2VG7 A;  1CXU A;  4ELU A; 
#chains in the Genus database with same CATH topology
 3TAN A;  4CGD A;  1GLL O;  2ZD1 A;  2P5G A;  2PAV A;  2YJE A;  1NGD A;  2YNF A;  3LP0 A;  3QML A;  3H3O B;  3BEX A;  3T19 A;  1QQM A;  1RIL A;  2P9I B;  2Z1I A;  1JL2 A;  1S3X A;  5H1S Q;  1QS4 A;  1LCU A;  1QSS A;  4QS9 A;  4FL9 A;  4PUO A;  3VQQ A;  3CFR A;  4B3R K;  2YKN A;  1DLO A;  3AV9 A;  2HST A;  3WQU A;  4FWR A;  3VN5 A;  4FJ8 A;  4YNQ A;  3M1F A;  4YOV A;  2WFB A;  4GY2 B;  2NUB A;  3CJ1 A;  1P90 A;  3BZK A;  2QKK A;  4IXC A;  4A2A A;  3ZCM A;  3ZSZ A;  3ZEU B;  3CM5 A;  4KFB A;  5EY4 A;  5DM7 L;  3HK2 A;  3IKM A;  4AHC A;  3OBW A;  3KLE A;  4CK3 A;  1SL1 A;  4LF8 K;  4MDA A;  2EWS A;  1D9D A;  3HT3 A;  4CIF A;  3UKU A;  4Z4F A;  4J8F A;  4ICL A;  4M7Y A;  3Q7C A;  1U6Z A;  4Q5V A;  4HWI A;  4JI7 K;  3T1Y K;  3FZM A;  1HNI A;  1U4B A;  3SMS A;  5J1E A;  4CF9 A;  1TKX A;  2P9S B;  3OA9 A;  4BY9 C;  1WSH A;  4BG9 A;  1LAW A;  2E2N A;  4DV3 K;  3MWP A;  4FJG A;  1J9A A;  1MU2 A;  3PIP L;  3SUP A;  1VQ4 N;  3CM6 A;  1QTM A;  3LP3 A;  3NBP A;  1TYQ A;  1HNZ K;  5B8H A;  4DR7 K;  5J2Q A;  4JKH A;  3S9H A;  5K14 A;  1HYV A;  2HOE A;  1U47 A;  3OYM A;  1JCF A;  4GVE A;  5FRM A;  1YUW A;  5JVG L;  4DWI A;  1JLE A;  4B8C A;  3L6Q A;  2HHS A;  4DB3 A;  4G1Q A;  4BRC A;  4CFD A;  3ZSW A;  2OPS A;  4XH4 A;  3K5L A;  4Y0W A;  3R8E A;  2DFE A;  1ZBS A;  2E1Y A;  4H0T B;  4CJ7 A;  2IVO A;  4DSE A;  3KD1 E;  4CGH A;  2P9U A;  5DK5 A;  3T1H K;  2NNW A;  4B1U B;  4KHU A;  5KGX A;  2CGL A;  1MWM A;  3P1G A;  4ISG A;  3LL3 A;  2XY5 A;  2D0P A;  3WXJ A;  4FVU A;  4CER A;  1KD1 O;  3IMX A;  2YNH A;  5HRR A;  5BRH A;  2KZZ A;  1KVA A;  2IDO A;  1NU0 A;  1FXX A;  3VER A;  2IIR A;  4CBU A;  1VQ6 N;  2QWO A;  2YHB A;  2ATQ A;  3DOK A;  1NOY A;  2Z1H A;  2X78 A;  1NWK A;  1RBU A;  2I7N A;  3ZSX A;  3O8M A;  3TAQ A;  5HRP A;  4U7B A;  3MK6 A;  1X9M A;  3CCL N;  4KB1 A;  3O9S A;  4A5A A;  3D7E O;  1S1T A;  5AQM A;  1KLN A;  3KIO A;  1L3S A;  3C6A A;  4EHU A;  5CYM A;  4B8A B;  3VA3 A;  2HW3 A;  3LDL A;  5JIC A;  1WBD A;  1KXP A;  1QVG M;  3SAH A;  4IEI A;  2GTD A;  4H4O A;  3QER A;  4LSN A;  3V4I A;  4WFN L;  1K9M O;  3ZX0 A;  2YKM A;  2JLE A;  3HM8 A;  4BRL A;  1KC8 O;  2VG5 A;  3OYJ A;  1C1A A;  1WSI A;  1NKB A;  1A5V A;  3OYL A;  1K6Y A;  3L2U A;  3BY5 A;  1KAX A;  1X9S A;  2VQE K;  3FLC O;  4B3T K;  4DR1 K;  1T8E A;  5C2F A;  5I9E B;  4UY8 O;  4IOC L;  5AJ3 K;  1E4G T;  2WC9 A;  2X74 A;  3MN5 A;  3J7Z O;  1K8A O;  2BTF A;  5GAG P;  4RG8 A;  1S6P A;  2YHX A;  3E9P A;  4YOR A;  1Q18 A;  3AGR A;  1CXQ A;  5HOO A;  5BPL A;  3KTQ A;  4KTQ A;  3R9P A;  3DRS A;  4YHH K;  1WUA A;  1X9J A;  4FZX C;  4K8X A;  1HJR A;  1U48 A;  2QK9 A;  3CCR N;  3DI6 A;  1T6D A;  4PA1 A;  5MLC Q;  1M90 O;  1RGI A;  3F2K A;  5AQN A;  4CHZ A;  3NVK A;  3SYZ A;  4PWD A;  5J2P A;  3HSC A;  1NK5 A;  4C8L A;  3KK1 A;  3SQ1 A;  1I3A A;  3TSQ A;  3KKS A;  2O8B B;  3VEX A;  3HM9 A;  4PL7 A;  4CJR A;  5LJV A;  1KLM A;  3A5O C;  1QHA A;  4W5T A;  2NZT A;  3CD6 N;  4GV6 A;  5M1O A;  5IWA K;  3L2W A;  3NF9 A;  2F4V K;  1ZYQ A;  4M3Y A;  4FLW A;  2D5R A;  3M6G A;  4DU4 A;  3L8B A;  4E7J A;  2HHT A;  3E1Y A;  1D4X A;  2XHB A;  1YIJ N;  4JLH A;  2P9K B;  1BWF O;  3LDQ A;  2HVH A;  4C1N K;  3KLF A;  3F5T A;  1RTJ A;  3N4Q A;  1DKG D;  1WAF A;  1VQ7 N;  1P8Z A;  3B6P A;  5JLF A;  1TKD A;  2NRT A;  1V4S A;  4Q0B A;  1LW0 A;  3THW B;  1BI4 A;  3RMD A;  4NLB A;  1TVR A;  2XY8 A;  1IJJ A;  4H5V A;  3SQ0 A;  1N5Y A;  2IGI A;  3LZJ A;  1ATS A;  1BOT O;  4CJ4 A;  2KW4 A;  5EXW A;  1NBW A;  4BVO A;  3KZB A;  1CZB A;  4EFH A;  5D3G A;  4YY3 K;  1C0F A;  3GG4 A;  2IC3 A;  4LF9 K;  3L4I A;  4CZE A;  3MN9 A;  3QFU A;  3VEW A;  2HBK A;  1RT2 A;  1ZBU A;  3ZYY X;  4IOA L;  2B4J A;  4R79 A;  3VQD A;  3HL8 A;  2HBM A;  2P9K A;  1HMV A;  1TKZ A;  4CF1 A;  3MN7 A;  3P38 A;  4J2B A;  4JRQ A;  1HLU A;  1C0U A;  3VQP A;  3O3F A;  4I6M B;  3THY A;  4YOT A;  1UOC A;  2HNZ A;  5BRF A;  4FLU A;  2E4L A;  1L3V A;  4JI1 K;  3NCI A;  1QQO A;  2KZM A;  2OZS A;  4C8M A;  1BG3 A;  4KHY A;  2CH6 A;  1WBB A;  3ZET B;  4QOZ B;  4DV4 K;  3QEX A;  1L5U A;  3O1W A;  2VWB A;  4BC4 A;  3VEO A;  3I33 A;  2E8A A;  1S1V A;  3VA0 A;  1NGJ A;  1RTD A;  2HHU A;  3CJ9 A;  4FPA A;  1Y64 A;  1HNW K;  1ITG A;  5FPE A;  4C8K A;  4MO4 A;  1JLG A;  4DSK A;  4FJI A;  4DU3 A;  4RW9 A;  4BC3 A;  3G71 N;  5AQL A;  4H0Y B;  2HB5 A;  1LW2 A;  4H0P A;  2NRW A;  2YNI A;  3I8B A;  1RT3 A;  4JI3 K;  4E1N A;  4NCB A;  2O8D B;  3HOT A;  4DFP A;  4GV9 A;  4KHN A;  3DYA A;  2HF3 A;  3HST B;  4CES A;  3ZET A;  4BE1 A;  5I3U A;  1VSM A;  5AQG A;  3LDO A;  4AIL C;  3R3L A;  4ELT A;  4CEB A;  5AQR A;  4BRQ A;  4JKE A;  3OTO K;  3H46 O;  3SBT A;  2W42 A;  2F96 A;  3DLR A;  3WNE A;  3LAL A;  3DOL A;  2HBL A;  5GAH P;  4FWQ A;  4BVP A;  4CZG A;  1BQM A;  2RHK A;  3ZX3 A;  4KH6 A;  1XUP O;  3ULE B;  3DXM B;  4MLE A;  4LF4 K;  3QIO A;  2OTL N;  4O8U A;  4DFJ A;  4JNE A;  1K8K A;  4J2A A;  3FGU A;  4F3O A;  4KAZ A;  1EWQ A;  3ZT2 A;  3HPG A;  4DHY A;  4BR7 A;  3O80 A;  4FJJ A;  1XNR K;  1SAZ A;  3B6O A;  2ZF5 O;  3AAR A;  2UUA K;  4DTM A;  3SPY A;  4FM1 A;  1WB9 A;  4CI6 A;  2VG7 A;  3MX5 A;  5EU7 A;  3WNG A;  1KRP A;  4MFB A;  4KB0 A;  2QWL A;  1TV6 A;  3HJF A;  4JKG A;  1I94 K;  3GE1 A;  2V7Z A;  2CGK A;  2B5J A;  3C95 A;  4JK8 A;  3LDP A;  4UQG A;  3V9Z A;  2RKI A;  5AR0 A;  4JV5 K;  2GBZ A;  3DLL L;  4B9S A;  1S9E A;  4JEP A;  1J5E K;  1L3T A;  2PYL A;  5AQW A;  3DXM A;  1C1C A;  4FWP A;  2GEM A;  4BRD A;  3DRR A;  3VQ9 A;  2FLO A;  3AVK A;  4CZH A;  2EHG A;  5AZI B;  1SKR A;  1ZC6 A;  1YT3 A;  3S3N A;  4I7F A;  3LM9 A;  3CXC M;  2FBT A;  4CHO A;  1DTQ A;  4F8R A;  3LP1 A;  4ILG B;  2LSN A;  3AA4 A;  2O8C A;  3UB5 A;  3CIP A;  1NMN A;  5FRN A;  1N8R O;  2YHY A;  1Z26 A;  1GOC A;  4KPY A;  2E1Z A;  4CZL A;  3C6H A;  3LPU A;  3T7Z A;  4HHT A;  4BQL A;  4M7X A;  3V6D A;  4IWV A;  4BWJ A;  3TU5 A;  3O3G A;  1XMQ K;  3CME N;  4YFU A;  4CGG A;  1VRU A;  2ZWH A;  3SJH A;  4B9N A;  4NB4 A;  4FPB A;  2G8V A;  3L3U A;  2AA4 A;  4KRF A;  3UE5 A;  5AZJ B;  4CEE A;  4NLC A;  4DF8 A;  3WUH A;  3OYK A;  4E7H A;  1YJW N;  1GLD G;  1CLQ A;  3VQ7 A;  3HBT A;  4U67 L;  2UU9 K;  1IKX A;  1HPM A;  2OA8 A;  4BQZ A;  4X65 K;  4X62 K;  5CY4 A;  1KAY A;  1S6Q A;  3NH1 A;  3CCQ N;  2R7Y A;  3AGK A;  4CJT A;  3HOS A;  4IJA A;  4YOW A;  4DTX A;  3RR7 A;  1OH7 A;  4H0V B;  4FO0 A;  4K25 A;  3RTV A;  3TI0 A;  2JWK A;  5C2D A;  2E5L K;  3QIN A;  1T03 A;  4TSX A;  4DMN A;  4HUE A;  4WQ4 A;  4JKA A;  5EX5 A;  3VQA A;  3NAE A;  4X66 K;  1J53 A;  4EAH D;  3SJJ A;  4WE1 A;  3SUN A;  2IVP A;  4O0J A;  4CBX A;  1EP4 A;  1RDW X;  1YJ9 N;  4CJ5 A;  1VQ5 N;  3P5J A;  1JLA A;  4DKW A;  5AZJ A;  4BDP A;  3RWU A;  4DU1 A;  2VQF K;  1XMO K;  4HCC A;  1C0G A;  3QDK A;  3MXI A;  2G8H A;  3AVI A;  3PUF A;  4OKJ A;  2FC0 A;  4N76 A;  3AVN A;  2OPQ A;  2DTU A;  1OKJ A;  1WSE A;  1NOZ A;  4IEE A;  4NCG A;  4CD1 A;  3J81 O;  4FLX A;  1X9W A;  4O55 A;  4LD0 A;  2O8E A;  1JLC A;  1W2B M;  2DFF A;  4FJK A;  3F9K A;  4I9L A;  4IO9 L;  3PV8 A;  4RW4 A;  3U3G A;  3M8S A;  2Q31 A;  4BRE A;  1VQ9 N;  2GV9 A;  2UXB K;  4WYB A;  1FK9 A;  2BAN A;  4MLH A;  1VSD A;  3WXL A;  4GV3 A;  3HTV A;  1U49 A;  2KFZ A;  3ID6 A;  2NRH A;  4QS7 A;  5KPR A;  4RW6 A;  5KRT A;  4B1W B;  3DLE A;  3CMA N;  4OLB A;  4Z94 A;  1TL1 A;  2QXL A;  4AHR A;  1JJ2 M;  3LPT A;  3HYF A;  1XHZ A;  1NG9 A;  1IKV A;  3VQ8 A;  3K9J A;  4DSL A;  4DR5 K;  3AVF A;  4CFB A;  4HTL A;  3WXI A;  1ESV A;  1S1U A;  4JK7 A;  4FOI A;  5J2M A;  1SL2 A;  3VQ5 A;  1EWR A;  4CJK A;  3K5M A;  1KVC A;  3L0Q A;  3AVL A;  1TK8 A;  3PX4 A;  3L4Q A;  3K0S A;  1RBV A;  5KQ8 A;  3L3V A;  1SZ2 A;  5BRD A;  4DS5 A;  3ZT1 A;  3J7A P;  2EX3 A;  2RN2 A;  5AFU H;  1BIS A;  4FWN A;  4E7L A;  1Q8I A;  2P9I A;  4FZY A;  1NK7 A;  3C7N B;  1HKG A;  4HCB A;  1YVN A;  4J2D A;  2E2Q A;  4JI8 K;  1W9H A;  1JXE A;  3JYT A;  3OYH A;  4JI2 K;  4BRP A;  1CZ9 A;  3CC2 N;  4IFV A;  4NYF A;  2Z1J A;  4A62 A;  3HZ6 A;  3H1Q A;  4DTO A;  4OX9 K;  1HNV A;  4FK0 A;  4JRP A;  3JAM O;  1VRT A;  1BO5 O;  4MDB A;  3ZEU A;  3J80 O;  4ZTJ A;  3R6M A;  3BF3 A;  3CC4 N;  1Z25 A;  1SQK A;  3I56 N;  2D0A A;  2G8W A;  5C25 A;  3EYZ A;  4PKH A;  1NGH A;  1SS6 A;  1NK8 A;  1S22 A;  3CCE N;  1RDA A;  3DLH A;  3OYA A;  2IVN A;  1NGB A;  4B3S K;  4B9U A;  1ASU A;  2Q36 A;  4DCH A;  4W5Q A;  2P9P B;  2QWR A;  2HHQ A;  2O4G A;  4CEA A;  1X3M A;  4CHP A;  2P9S A;  3THX B;  5F1X A;  1N36 K;  4GKK K;  5M1F A;  4DQ8 A;  2XY7 A;  4CK2 A;  1TUU A;  1TL3 A;  3CCU N;  4ISE A;  1IKW A;  3I0S A;  4KO0 A;  3SQ2 A;  1SUQ A;  4BC2 A;  3OYC A;  4CBW A;  2VWK A;  3AVM A;  4KHP K;  3AO4 A;  3V1R A;  4DTN A;  2G8I A;  1NNE A;  1OH8 A;  4NXM K;  3KWI A;  2P9L B;  4BE0 A;  2GEL A;  3TAF A;  3V1O A;  1KFD A;  3ATU A;  1QQC A;  4DV0 K;  2PY5 A;  3ENH A;  4BR4 A;  1WN7 A;  2NRZ A;  2QTD A;  1ATN A;  4M3W A;  3QEW A;  2A40 A;  3MN6 A;  4OGE A;  3O9Q A;  2A42 A;  4B9V A;  4LSL A;  2P9P A;  4F2R A;  3FZK A;  2FF3 B;  3O08 A;  3NF7 A;  1JCG A;  4K43 A;  3RR8 A;  5CYQ A;  1HQU A;  2OPP A;  2ZJP L;  5GAE P;  3RSE B;  4AQY K;  3CJC A;  3DRP A;  3J7Y P;  4BR0 A;  1NJW A;  1YTU A;  1X3N A;  1C1B A;  4E1M A;  3IRX A;  3VET A;  2UUB K;  2P5O A;  4OVL A;  4KI6 A;  1UA1 A;  2QWP A;  4KHS A;  3F9M A;  2ZJR L;  4BAC A;  4LF7 K;  1IKY A;  1NK4 A;  3W0L A;  5BR8 K;  2WUS A;  3CQ8 A;  3VF4 A;  4DQI A;  1Q9Y A;  3IS9 A;  4B9L A;  4M3R A;  4ZHR A;  1VHX A;  3R1X A;  4ELV A;  4GVM A;  5EVZ A;  3AO3 A;  1ZXO A;  2KQ2 A;  5FPN A;  4JI0 K;  4KV8 A;  1FJG K;  4W5O A;  4CZJ A;  4WQ4 C;  1RDD A;  2VWJ A;  2Q97 A;  2I7P A;  4OGC A;  4YOX A;  3FFK B;  2KFN A;  3OS1 A;  4QCL A;  3ZT4 A;  1S1W A;  5AQS A;  1VSI A;  3CET A;  4CEZ A;  3KLI A;  4CE9 A;  2V51 B;  2NRR A;  4A5B A;  5AFU A;  3BGR A;  2RF2 A;  2BE2 A;  2B6A A;  4KKO A;  4FWL A;  3FE1 A;  4E89 A;  3VEV A;  3C6U A;  5GAD P;  4BDY A;  3VEN A;  4B9T A;  4CCH A;  3CFP A;  2PFU A;  1NJI O;  1RDB A;  3NHG A;  4CD3 A;  3AAQ A;  1G99 A;  4IDH A;  4CIG A;  1ZBF A;  3A8Y A;  1QSL A;  3I55 N;  3SLC A;  1NJX A;  3PO5 A;  3QNN A;  3EE9 A;  3RMB A;  3V1Q A;  4DR6 K;  5CE3 A;  1XC3 A;  3C0B A;  5DMR A;  2V7Y A;  4M42 A;  2YCH A;  4I2P A;  4CJQ A;  2HVI A;  1TAQ A;  4BGB A;  1N34 K;  2O8B A;  1YTA A;  2AJQ A;  4KH4 A;  3KK2 A;  4LF6 K;  2Q1N A;  3U8X A;  1VSE A;  3ZT0 A;  3RVC A;  4KH5 A;  5AQZ A;  2Q3S A;  5HL7 L;  4LFB K;  1FKO A;  5I42 A;  5J2N A;  4YOU A;  4LFC K;  3BP8 A;  5AQY A;  4CJV A;  3ZT3 A;  1ASW A;  1CXU A;  1NLV A;  5C0Y A;  3AVA A;  3HP6 A;  3A5M C;  4CJW A;  4DR2 K;  4N5S A;  4CF0 A;  1RDU A;  1IH7 A;  3FZH A;  4Y1D A;  1NJY A;  4IBN A;  2DFH A;  3H08 A;  1DT9 A;  3M8Q A;  1O1W A;  3TAR A;  2OTJ N;  1RTH A;  5JS1 A;  2HMP A;  5AQT A;  5SWM A;  1ZBL A;  3THW A;  3C6T A;  5KI6 A;  3KK3 A;  2HHV A;  3GBT A;  2ITM A;  3LWM A;  1LOT B;  3CQX A;  1QVF M;  3DXK B;  4YOY A;  4EIA A;  3QEV A;  1B9F A;  4C1N I;  2QA4 N;  2W6L A;  3NFA A;  4OPK A;  2D0O A;  5BN8 A;  3WEE B;  3TTC A;  4FXD A;  2E6M A;  4OKE A;  3PX6 A;  1HYZ A;  2UYT A;  3NH0 A;  4FJM A;  3NMU A;  1BIU A;  2A1R A;  4EZ9 A;  4CZI A;  5AQH A;  3QFP A;  2Z1G A;  4JI4 K;  3CCM N;  3L2Q A;  4ILJ A;  1ILY A;  4I6M A;  3GL1 A;  2E6L A;  3G10 A;  5ADX H;  1NK9 A;  3M8R A;  1WOQ A;  3CCJ N;  3KVG A;  3AO2 A;  1L3U A;  1IG9 A;  3OJS A;  5IT9 O;  5F0X A;  4PY5 A;  4CF8 A;  1BQN A;  3AA2 A;  2WBN A;  1HUX A;  3CCS N;  3G25 A;  1LWF A;  3PLA A;  1OVQ A;  1RT7 A;  1BA0 A;  4B08 A;  4FOE A;  4FJ9 A;  4N56 A;  5T7B A;  1C0T A;  3FR0 A;  4Y1C A;  1TK5 A;  3C65 A;  3WEE A;  1NGF A;  1LWC A;  2DPN A;  1XQS C;  2BGG A;  1RBS A;  4CIE A;  4QAG A;  4AM6 A;  3N4P A;  4Z4E A;  5TKW A;  3RMC A;  1KAZ A;  5GIN A;  4E19 A;  4LY7 A;  3VQ4 A;  3SAG A;  1QHT A;  2A1S A;  1J54 A;  3CJA A;  1KFS A;  3SAF A;  3OHR A;  4B3M K;  1RT4 A;  1O13 A;  2O8D A;  3A5L C;  1D9F A;  1S1X A;  3V81 A;  5FPM A;  4MQ3 A;  1BL3 A;  1T6C A;  4K42 A;  4IJN A;  1OH6 A;  3D45 A;  1R59 O;  4LH4 A;  3CJB A;  1XC9 A;  2FSN A;  1XI1 A;  4JKB A;  5BN9 A;  1HKC A;  4FLT A;  1U2V B;  2YX6 A;  1NGA A;  4CJF A;  3MEG A;  4GMJ B;  3F73 A;  5FLX O;  4K0K K;  3BDP A;  1LV5 A;  3ZSR A;  4CFC A;  2HBJ A;  3OYG A;  2O4I A;  4V19 S;  3BF1 A;  1B9D A;  4O5F A;  3K58 A;  4LC9 B;  5C15 A;  1RTI A;  1GOB A;  3U9Z A;  4Z4H A;  3MWT A;  2GWK A;  4A61 A;  3ULE A;  2A6A A;  3KWG A;  1KCF A;  3D6R A;  5A2Q O;  3KJV A;  3EN9 A;  1YVU A;  3O1B A;  3D0P A;  2E2O A;  4JD2 B;  3VGK A;  2IS3 A;  1TAU A;  2W40 A;  4FW2 A;  4XEI A;  3K9K A;  4ISF A;  4O8K A;  5BPM A;  2Q0R A;  1HJO A;  5JMV A;  4DQQ A;  4FYD A;  2ASM A;  3SV4 A;  2BH1 A;  4A2B A;  3EZ5 A;  4CGI A;  4HUG A;  1U2V A;  4F2S A;  1S5J A;  4ID1 A;  4CEF A;  3TAB A;  4CHY A;  2G8K A;  3VQC A;  1RFQ A;  4BRM A;  4O0I A;  2PYJ A;  3QLH A;  3VGM A;  2WOM A;  4H5R A;  3OS2 A;  4CF2 A;  4CJP A;  3ITH A;  3VEZ A;  3ZSY A;  1Q9X A;  4GW6 A;  4DUY K;  4JHD B;  3U3Y A;  2YHA A;  2Y1I A;  1RT1 A;  4KBO A;  4MO5 A;  1QZ5 A;  3S3M A;  4B3O A;  4I9Q A;  4A59 A;  1HYS A;  3TPQ A;  2WON A;  4G9Z A;  3DJC A;  3ISN C;  3QET A;  5M1P A;  4WQ5 A;  3KKR A;  5AZI A;  3TSP A;  2W6K A;  4AHT A;  2OPR A;  4IFY A;  1CZA N;  2YNG A;  3SUQ A;  5C42 A;  2HHW A;  4RW8 A;  2Q2R A;  4HVJ A;  4E3S A;  4FWO A;  4KTZ A;  4WCE L;  2Q0U A;  3OVN A;  1WSJ A;  4C8N A;  3K5N A;  4F3T A;  3LWL A;  4L3Q A;  1C0M A;  4OKK A;  3OYB A;  1FKP A;  3A0I X;  3QIP A;  1OH5 A;  1B92 A;  4DTJ A;  2P51 A;  4BRK A;  5KTQ A;  4NYN A;  2YI1 A;  3AY9 A;  2OZM A;  5ADX A;  1ATR A;  3SV3 A;  4CED A;  4CJU A;  5BRE A;  1VQ8 N;  4IG3 A;  2BDP A;  3D2F B;  3P31 A;  3CQY A;  1HX1 A;  5AQU A;  1T44 A;  4CJ3 A;  2RPI A;  3THV A;  4PKI A;  4DTS A;  4M45 A;  1W97 L;  5CHI A;  5DM6 L;  1I39 A;  3LDS A;  1U45 A;  3TAP A;  1F21 A;  4ZTF A;  3PY8 A;  4O5B A;  4OJR A;  5FDL A;  4BRN A;  1VQL N;  3CF5 L;  3T1A A;  5SZT A;  3ZLJ A;  2UUC K;  4LH5 A;  1YF5 L;  1JLB A;  1JKH A;  3MXJ A;  4BR9 A;  3QES A;  3L2R A;  3EZW A;  3VQE A;  2AP1 A;  2QWM A;  3TR8 A;  3D2E B;  4H5T A;  1E3M A;  4W5R A;  2E2P A;  3D2F A;  4DG1 A;  4NCA A;  2VYP A;  3UIQ A;  3O9R A;  3V9U A;  2OAN A;  3UKU B;  2HND A;  1VSL A;  1WAJ A;  2NLX A;  5KPT A;  4CHQ A;  3IAY A;  5KRS A;  3NF8 A;  4EP5 A;  2YHW A;  4BR2 A;  3KLH A;  2F8T A;  4KHQ A;  3U9D A;  2XO7 A;  4FW1 A;  1IBM K;  4K41 A;  5LMU K;  4WFA L;  4JS4 A;  2G8F A;  1T7P A;  4EZ6 A;  1TYQ B;  4JS5 A;  1RT5 A;  4I2Q A;  5E84 A;  3OYF A;  1VSF A;  1WNS A;  3EO3 A;  4BR5 A;  3VPZ A;  4BGA A;  4FSV A;  3NVM A;  4KRE A;  4CEC A;  4IG0 A;  3WNH A;  4XH5 A;  1MA9 B;  1IV0 A;  3D2E A;  1T05 A;  2IOC A;  5C12 A;  3K2P A;  2P9N B;  3NDK A;  4AHV A;  4K8Z A;  4KTW A;  1Z05 A;  4DQR A;  3SMP A;  1RNH A;  3ZX2 A;  2D0B A;  3VGL A;  2P9U B;  3A2F A;  4HUF A;  4C8O A;  1BDG A;  4A57 A;  1BCM A;  1NKE A;  4B1X B;  4JYA K;  3E9O A;  3EKS A;  3OBY A;  4X64 K;  3KD5 E;  3AVC A;  3P4I A;  3EE8 A;  3QB0 A;  1VSJ A;  4IZ9 A;  1WSF A;  4AH9 A;  3S3O A;  2PBD A;  3HVR A;  2ZE2 A;  2VGM A;  3J8A A;  3QBX A;  3JXU A;  1YI2 N;  3ZSO A;  3WXK A;  4PKG A;  4Z4G A;  3GDQ A;  1EO1 A;  3CYM A;  3SQ4 A;  1EET A;  3K5O A;  3C7N A;  3OW2 M;  5CZ1 A;  1SV5 A;  3WNF A;  4M3T A;  3WQT A;  3EEQ A;  3ID8 A;  3U4L A;  4DR4 K;  2P9N A;  3ASM A;  1IBL K;  1T3V A;  2ASP A;  3PO4 A;  3LZI A;  4CGF A;  5KPZ A;  1RBR A;  3CJ7 A;  2F8S A;  2UXC K;  2GX9 A;  4BRA A;  1Q81 O;  3HI0 A;  2Y1J A;  2E20 A;  5HRS A;  3LAK A;  1JL1 A;  4M3X A;  2F7T A;  5AQQ A;  3Q7B A;  1V4T A;  3RMA A;  1D8Y A;  4FJ7 A;  1QZ6 A;  4FWM A;  1S72 N;  5M1K A;  1QE1 A;  3AVJ A;  3TAM A;  2QW9 A;  5JS2 A;  2HHH K;  4ELU A;  1YXQ A;  1W7A A;  1JXB A;  3SK3 A;  3SI6 A;  4H5N A;  3K57 A;  4H0X B;  2D4W A;  2GUP A;  2VG6 A;  3NGZ A;  4RW7 A;  3THX A;  5CR4 A;  3MCP A;  4RWT A;  5FPD A;  3NH2 A;  4H8K A;  2HMI A;  5LY3 A;  3QO9 A;  1NMD A;  3ALY A;  1XHX A;  3TWH A;  5HLF A;  3SZ2 A;  2DY4 A;  2P9L A;  3LDN A;  1X1P A;  1MDU B;  2G8U A;  4FWS A;  1Q82 O;  1K73 O;  4PHT X;  4WQ5 C;  4JN4 A;  4DSF A;  2JGU A;  4GNI A;  4DS4 A;  3K59 A;  3NE6 A;  4CZK A;  4F9O A;  4DR3 K;  3MEE A;  4EHT A;  4DLG A;  1VSK A;  4IO8 A;  2A41 A;  2HNY A;  4OPH A;  3O4N A;  4CHN A;  1VQK N;  4GKJ K;  5LL6 Z;  3DWL A;  4FK2 A;  4JKF A;  5TKY A;  4BRO A;  1DTT A;  1NGE A;  1GLB G;  3RSE A;  4BC5 A;  4JAX A;  4LFA K;  5GIO A;  2RE2 A;  2FSK A;  1TK0 A;  1ZBH A;  3P39 A;  3H6E A;  1ASV A;  2CH5 A;  1Y97 A;  3UKR B;  4DTR A;  1XWL A;  5ELZ A;  3HXM A;  3AO5 A;  2ZM6 K;  3CER A;  1UAX A;  4BRG A;  4DV2 K;  1FW6 A;  4NXN K;  3AA3 A;  4FJX A;  2ASO A;  3E66 A;  3SCX A;  5EOY A;  1HRH A;  4B9M A;  4YDU A;  2KHO A;  2ZQB A;  4CK1 A;  3SNN A;  3IG1 A;  4DSJ A;  3DLK A;  4CZM A;  1S9G A;  1IBK K;  1BI4 B;  3EKU A;  1UWB A;  1VQO N;  1Z6R A;  4E0D A;  3KK7 A;  3MDQ A;  3T3F A;  1KQS M;  3IUC A;  1NGG A;  1VQN N;  3O4W A;  3CPW M;  1RT6 A;  4NO7 A;  4M41 A;  1TUY A;  1YJN N;  2FBY A;  2QXF A;  4RTF D;  4DV7 K;  5HRN A;  3FZL A;  4OPA A;  2GUI A;  4KI4 A;  1VQP N;  2FSJ A;  1NGI A;  3IFR A;  4JKC A;  3I8D A;  4M3Z A;  2HHX A;  5CZ2 A;  4AM7 A;  3JSM A;  3AA5 X;  3UKR A;  2VGN A;  4FJH A;  1JLF A;  3THY B;  4IKF A;  4BRI A;  4OPJ A;  3CHW A;  2GWJ A;  4WFB L;  3TTD A;  3SUO A;  5AQO A;  3ULD A;  3T69 A;  1GLF O;  1UA0 A;  3CG7 A;  2OYQ A;  4N41 A;  3DLG A;  1BA1 A;  1J6Z A;  4IOX A;  3VQ6 A;  4CW7 B;  3NGI A;  3LAM A;  4FLY A;  3MAQ A;  3V9S A;  2QKB A;  4DSI A;  3O5B A;  3CC7 N;  4FK4 A;  3OJU A;  1EX4 A;  4JI6 K;  2NRX A;  2WTU A;  4DV5 K;  1NK0 A;  3O6W A;  4PQU A;  3LAN A;  5M1Q A;  3WXM B;  3MED A;  5BR9 A;  4DV6 K;  4FM0 A;  1NKC A;  4BWM A;  4AF1 A;  2D0C A;  3MCA B;  1H1V A;  2X6N A;  2XRI A;  3TAG A;  5AQX A;  3JS6 A;  3HPH A;  3ZSQ A;  5AQI A;  5JLH A;  1Q7Y O;  4FLZ A;  3FZF A;  3VQB A;  1KVB A;  3KLG A;  1JCE A;  2F9W A;  1VQM N;  4H4M A;  4IDK A;  5C10 A;  1NK6 A;  1WLJ A;  5KQD A;  1N33 K;  3A5N C;  2FBX A;  5KGW A;  3OYN A;  4LF5 K;  3MX2 A;  4QS8 A;  3E9L A;  3EL2 A;  1HQE A;  4O4G A;  3G0Z A;  3LP2 A;  3PIO L;  3TSU A;  5AQV A;  4WF9 L;  1WSG A;  1REV A;  3AO1 A;  2KKZ A;  3MXM A;  3PX0 A;  3U6F A;  4ID5 A;  4H5W A;  3G6E N;  3AVB A;  3DM2 A;  4EP4 A;  3HP9 A;  2KTQ A;  2CGJ A;  1W0H A;  3DXK A;  4DFM A;  3M3Z A;  3P83 D;  4FVM A;  4DF4 A;  1LAV A;  1JLQ A;  4DLE A;  1N32 K;  4OLA A;  4DFK A;  2VCP A;  1VSH A;  1NM1 A;  2OCE A;  1K8K B;  4CJS A;  1BU6 O;  3I0R A;  3B8A X;  5M1N A;  1BGX T;  1NJZ A;  3O3H A;  2A3Z A;  4CZF A;  2JWL A;  3HPO A;  4FLV A;  1YHQ N;  3MEC A;  4FZZ A;  4BRF A;  3VTI A;  1BIZ A;  1M1K O;  2QEX N;  3VEY A;  1GLJ O;  1EQY A;  4OO1 J;  2QWQ A;  3DAW A;  1LWE A;  3W3D A;  3H3N O;  5LMN K;  1N6Q A;  3CFO A;  5E41 A;  4JI5 K;  3IDH A;  1RDC A;  1MWK A;  1SKW A;  4IFE A;  4FM2 A;  3FFI A;  2YJF A;  4DQP A;  4KHW A;  4DV1 K;  2FXU A;  4JKG B;  3BZC A;  1VAZ A;  4PL8 A;  3CPE A;  2A5X A;  4M63 C;  4B1Y B;  4CJE A;  2ZJQ L;  2IAJ A;  2FBV A;  2KLA A;  2ITG A;  4JKD A;  4W5N A;  5AQF A;  1VK0 A;  3OYI A;  1A5W A;  3S41 A;  5FRO A;  5AQP A;  2QWN A;  3BUZ B;  4DTU A;  3DMJ A;  3RRH A;  2ZGZ A;  4JK9 A;  4N47 A;  1QSY A;  2H3G X;  4BG8 A;  5HRO A;  1GOA A;  3L2V A;  1RBT A;  3WT0 A;  4CGJ A;  2O8C B;  2X6S A;  4E1J A;  2D1K A;  1TKT A;  4ILH A;  3MMV A;  3OYD A;  1IG8 A;  3VF2 A;  3H1V X;  2E88 A;  4FWK A;  3V9W A;  2V52 B;  3QIC A;  3AVH A;  4CVN E;  3OS0 A;  4FJN A;  3NF6 A;  4FCY A;  1OVY A;  1TGO A;  1HR0 K;  1DEJ A;  2J4R A;  4H03 B;  1EXQ A;  3HO1 A;  3ENB A;  1BCO A;  2I5J A;  1XNQ K;  3AAP A;  2HF4 A;  4L8R B;  1RCH A;  1R0A A;  4Z0U A;  1HNX K;  3GOI A;  4J2E A;  1QQN A;  3TAE A;  1NGC A;  3HVT A;  4XIU A;  1EKE A;  4BDZ A;  3O9T A;  4CEQ A;  4DUZ K;  1HPZ A;  1ZBI A;  4DTP A;  4B9Q A;  1GLC G;  4FJL A;  3ENO A;  1BHL A;  1BUP A;  4CFA A;  4AHS A;  1J5O A;  5F2R A;  5GIP A;  4R5P A;  3QNO A;  4YDU C;  1HKB A;  5AQK A;  4JD2 A;  2QM1 A;  3CI5 A;  3C94 A;  4H0O A;  5C24 A;  4Z4C A;  3VMF B;  4RCH A;  5AQJ A;  4CEO A;  2O8F B;  3OY9 A;  3VOV A;  3M8P A;  5HP1 A;  3SPZ A;  2F9T A;  1SKS A;  2FF6 A;  3VF6 A;  1YIT N;  4O44 A;  1E4F T;  3SBG A;  2QI2 A;  1DGK N;  2PZS A;  3H45 C;  3VES A;  3EY1 A;  4E7K A;  2BUP A;  3O9U A;  2YV0 X;  4B1V A;  2UXD K;  3TTF A;  3G4S N;  3QEI A;  1YAG A;  2XY6 A;  2O8E B;  2P1J A;  1GLE G;  3ATV A;  4JHD A;  5JVH L;  4C23 A;  1SL0 A;  4CJL A;  5E26 A;  1D5A A;  3E01 A;  2ZGY A;  2ETJ A;  4F4K A;  4DQS A;  1U04 A;  3HRG A;  1KSP A;  3OYE A;  4AHU A;  3DLB A;  5BPN A;  3ZSV A;  3M5R A;  3VTH A;  4Z4I A;  4XH1 A;  4BRH A;  1Q86 O;  3O4Q A;  4M3U A;  1A5X A;  3RRG A;  3LM2 A;  2O8F A;  2W41 A;  1KTQ A;  3V9X A;  3PSI A;  1GLA G;  5LJW A;  4FJ5 A;  3CCV N;  1G15 A;  1IO2 A;  3KHY A;  3NGY A;  2NRV A;  5HBM A;  4HTU A;  3AVG A;  4E7I A;  4B1Z A;  3PSF A;  3QEP A;  1C6V A;  3QBW A;  4BE2 A; 
#chains in the Genus database with same CATH homology
 5EU7 A;  3WNG A;  1KRP A;  3TAN A;  1JXB A;  3AVA A;  4MFB A;  3SI6 A;  4KB0 A;  1TV6 A;  4CGD A;  3K57 A;  3HP6 A;  3HJF A;  2ZD1 A;  4CJW A;  2P5G A;  2VG6 A;  3NGZ A;  2B5J A;  3C95 A;  4RW7 A;  2YNF A;  3LP0 A;  4CF0 A;  4N5S A;  1IH7 A;  4Y1D A;  4UQG A;  3V9Z A;  2RKI A;  4IBN A;  1NJY A;  2GBZ A;  2DFH A;  3T19 A;  3H08 A;  3M8Q A;  1RIL A;  4B9S A;  1O1W A;  2Z1I A;  1JL2 A;  1S9E A;  3TAR A;  1QS4 A;  3NH2 A;  2PYL A;  1L3T A;  1QSS A;  1RTH A;  4H8K A;  1C1C A;  2HMI A;  4PUO A;  5JS1 A;  5SWM A;  3VQQ A;  3CFR A;  3QO9 A;  1ZBL A;  3C6T A;  5KI6 A;  3KK3 A;  2HHV A;  3DRR A;  2YKN A;  1DLO A;  3AV9 A;  3VQ9 A;  3ALY A;  1XHX A;  3LWM A;  3TWH A;  3AVK A;  5HLF A;  3SZ2 A;  2DY4 A;  2EHG A;  3VN5 A;  4FJ8 A;  1SKR A;  4YNQ A;  1X1P A;  1YT3 A;  3QEV A;  4I7F A;  3S3N A;  2FBT A;  4CHO A;  1DTQ A;  2G8U A;  1B9F A;  4F8R A;  3LP1 A;  2NUB A;  2LSN A;  3AA4 A;  2QKK A;  4OPK A;  3NFA A;  5FRN A;  1Z26 A;  1GOC A;  2JGU A;  4DSF A;  4KPY A;  4FXD A;  4DS4 A;  3ZCM A;  3ZSZ A;  3CM5 A;  3LPU A;  4KFB A;  4HHT A;  3HK2 A;  2E6M A;  3K59 A;  3NE6 A;  3MEE A;  4OKE A;  3V6D A;  4BWJ A;  3O3G A;  4AHC A;  1HYZ A;  3PX6 A;  4DLG A;  1VSK A;  3KLE A;  4CK3 A;  4YFU A;  3NH0 A;  1SL1 A;  4FJM A;  4CGG A;  1VRU A;  2HNY A;  1D9D A;  3O4N A;  1BIU A;  4CHN A;  3HT3 A;  4CIF A;  2A1R A;  4B9N A;  4EZ9 A;  4Z4F A;  2Z1G A;  4FK2 A;  3L2Q A;  1DTT A;  2G8V A;  4ICL A;  4FJH A;  2E6L A;  4Q5V A;  3G10 A;  3L3U A;  4KRF A;  1HNI A;  4CEE A;  1U4B A;  1NK9 A;  4DF8 A;  3M8R A;  3OYK A;  3AO2 A;  5J1E A;  1TK0 A;  1ZBH A;  4E7H A;  4CF9 A;  1L3U A;  1IG9 A;  1ASV A;  1TKX A;  3OJS A;  4DTR A;  1Y97 A;  1CLQ A;  1XWL A;  3HXM A;  4PY5 A;  1WSH A;  1BQN A;  3AA2 A;  1LAW A;  3AO5 A;  3VQ7 A;  1UAX A;  4CF8 A;  1IKX A;  4FJG A;  1J9A A;  1MU2 A;  2OA8 A;  3AA3 A;  5CY4 A;  4FJX A;  3SUP A;  1QTM A;  1LWF A;  1S6Q A;  3CM6 A;  3LP3 A;  3NH1 A;  1RT7 A;  3SCX A;  3NBP A;  4B08 A;  2R7Y A;  1HRH A;  4CJT A;  3SNN A;  4CK1 A;  2ZQB A;  5J2Q A;  4B9M A;  3S9H A;  4DTX A;  4FJ9 A;  4N56 A;  3RR7 A;  3IG1 A;  5K14 A;  5T7B A;  4DSJ A;  1HYV A;  1C0T A;  3DLK A;  1S9G A;  4Y1C A;  3OYM A;  1U47 A;  1TK5 A;  1BI4 B;  5FRM A;  3RTV A;  1UWB A;  3TI0 A;  4DWI A;  1JLE A;  3QIN A;  4B8C A;  4E0D A;  1LWC A;  1T03 A;  2HHS A;  3T3F A;  4TSX A;  4DMN A;  4HUE A;  4G1Q A;  3VQA A;  2BGG A;  1RBS A;  3NAE A;  4CFD A;  1J53 A;  3SJJ A;  4CIE A;  4QAG A;  1RT6 A;  3ZSW A;  2OPS A;  4WE1 A;  3SUN A;  4M41 A;  3K5L A;  4Z4E A;  4O0J A;  2DFE A;  2FBY A;  2QXF A;  3KD1 E;  4DSE A;  3RMC A;  4CGH A;  5HRN A;  4E19 A;  4LY7 A;  3VQ4 A;  1EP4 A;  5DK5 A;  2GUI A;  1QHT A;  2A1S A;  1J54 A;  1KFS A;  4KI4 A;  4CJ5 A;  3P5J A;  1JLA A;  4BDP A;  3RWU A;  1RT4 A;  3I8D A;  4DU1 A;  5KGX A;  4KHU A;  4M3Z A;  2HHX A;  4HCC A;  5CZ2 A;  3P1G A;  1D9F A;  1S1X A;  3V81 A;  3JSM A;  2XY5 A;  4MQ3 A;  1BL3 A;  3AA5 X;  4CER A;  2YNH A;  5HRR A;  3MXI A;  3D45 A;  2G8H A;  1JLF A;  3AVI A;  3PUF A;  4OKJ A;  2FC0 A;  4LH4 A;  4N76 A;  1XC9 A;  1KVA A;  2IDO A;  4IKF A;  1FXX A;  3AVN A;  1XI1 A;  2OPQ A;  2DTU A;  4OPJ A;  4FLT A;  2YHB A;  1WSE A;  1NOZ A;  2ATQ A;  3DOK A;  4NCG A;  4CJF A;  1NOY A;  3MEG A;  4FLX A;  4GMJ B;  2Z1H A;  1X9W A;  4O55 A;  4LD0 A;  3F73 A;  3ULD A;  3SUO A;  1JLC A;  2X78 A;  1RBU A;  1UA0 A;  3ZSX A;  3CG7 A;  2DFF A;  4FJK A;  3F9K A;  2OYQ A;  4I9L A;  4N41 A;  3BDP A;  1LV5 A;  3PV8 A;  3DLG A;  4RW4 A;  3U3G A;  3ZSR A;  5HRP A;  3M8S A;  3TAQ A;  1X9M A;  3NGI A;  3VQ6 A;  4CFC A;  2GV9 A;  3LAM A;  4KB1 A;  3OYG A;  4FLY A;  1FK9 A;  2BAN A;  3MAQ A;  3V9S A;  1S1T A;  2O4I A;  1VSD A;  1KLN A;  3KIO A;  1B9D A;  1L3S A;  2QKB A;  3K58 A;  1U49 A;  4DSI A;  1RTI A;  1GOB A;  5CYM A;  4B8A B;  3VA3 A;  2KFZ A;  4Z4H A;  4FK4 A;  3OJU A;  1KCF A;  4RW6 A;  5KRT A;  2HW3 A;  1EX4 A;  3DLE A;  3KJV A;  4OLB A;  1TL1 A;  4AHR A;  1YVU A;  3HYF A;  3LPT A;  1XHZ A;  4H4O A;  3D0P A;  1NK0 A;  1IKV A;  3QER A;  4LSN A;  3VQ8 A;  3V4I A;  3LAN A;  1NKC A;  4PQU A;  3MED A;  4FM0 A;  4DSL A;  2YKM A;  2IS3 A;  3AVF A;  4BWM A;  4CFB A;  1TAU A;  2D0C A;  4FW2 A;  2JLE A;  1S1U A;  2VG5 A;  2X6N A;  1C1A A;  3OYJ A;  4DQQ A;  4FYD A;  3SV4 A;  2XRI A;  1WSI A;  5J2M A;  3TAG A;  1NKB A;  1SL2 A;  3VQ5 A;  3EZ5 A;  4CGI A;  1A5V A;  4HUG A;  3OYL A;  1K6Y A;  3HPH A;  3ZSQ A;  4CJK A;  1KVC A;  3L2U A;  3K5M A;  1S5J A;  4F2S A;  1X9S A;  3AVL A;  4ID1 A;  1TK8 A;  4FLZ A;  3PX4 A;  4CEF A;  1T8E A;  3TAB A;  4CHY A;  3VQB A;  1KVB A;  2G8K A;  1RBV A;  3KLG A;  3VQC A;  3L3V A;  4O0I A;  2PYJ A;  3QLH A;  2X74 A;  4H4M A;  4IDK A;  3ZT1 A;  4DS5 A;  1NK6 A;  1WLJ A;  2EX3 A;  2RN2 A;  2WOM A;  3OS2 A;  4CF2 A;  4CJP A;  4RG8 A;  3ITH A;  3ZSY A;  1S6P A;  2FBX A;  1Q9X A;  4GW6 A;  5KGW A;  1BIS A;  3OYN A;  4E7L A;  1CXQ A;  1Q8I A;  4FZY A;  1HQE A;  3U3Y A;  4O4G A;  1NK7 A;  2YHA A;  2Y1I A;  3KTQ A;  1RT1 A;  3DRS A;  4HCB A;  4KTQ A;  3G0Z A;  3S3M A;  1HYS A;  3LP2 A;  4I9Q A;  4J2D A;  4B3O A;  4FZX C;  4K8X A;  1HJR A;  1WSG A;  1REV A;  3AO1 A;  1U48 A;  3MXM A;  2QK9 A;  1W9H A;  2WON A;  3DI6 A;  1JXE A;  3JYT A;  3OYH A;  3U6F A;  4ID5 A;  3PX0 A;  4PA1 A;  3ISN C;  1CZ9 A;  3AVB A;  3QET A;  4IFV A;  3DM2 A;  4EP4 A;  3HP9 A;  3KKR A;  4NYF A;  2KTQ A;  2Z1J A;  4CHZ A;  1W0H A;  4DFM A;  3P83 D;  3SYZ A;  4FVM A;  4PWD A;  4AHT A;  4DF4 A;  1LAV A;  2OPR A;  4DTO A;  5J2P A;  1JLQ A;  1NK5 A;  4DLE A;  4C8L A;  4IFY A;  4DFK A;  4OLA A;  3KK1 A;  1HNV A;  3SQ1 A;  1I3A A;  1VSH A;  2YNG A;  3SUQ A;  4FK0 A;  5C42 A;  2HHW A;  4JRP A;  4RW8 A;  4CJS A;  3I0R A;  1VRT A;  1BGX T;  4HVJ A;  1NJZ A;  3KKS A;  3O3H A;  4E3S A;  3HM9 A;  4ZTJ A;  4KTZ A;  3HPO A;  4FLV A;  3OVN A;  1Z25 A;  1WSJ A;  3MEC A;  4FZZ A;  4C8N A;  3K5N A;  4F3T A;  3LWL A;  1C0M A;  1BIZ A;  4OKK A;  4CJR A;  3OYB A;  2D0A A;  1FKP A;  2G8W A;  1KLM A;  3QIP A;  5C25 A;  3EYZ A;  4W5T A;  1LWE A;  1B92 A;  4DTJ A;  2P51 A;  5KTQ A;  1N6Q A;  3CFO A;  4NYN A;  5E41 A;  1NK8 A;  2OZM A;  3L2W A;  1RDC A;  3NF9 A;  1RDA A;  3SV3 A;  4CED A;  1ZYQ A;  1SKW A;  3DLH A;  4M3Y A;  4FLW A;  2D5R A;  4CJU A;  3OYA A;  4FM2 A;  3FFI A;  4B9U A;  4DQP A;  1ASU A;  4W5Q A;  4KHW A;  4IG3 A;  4DU4 A;  3L8B A;  4E7J A;  2BDP A;  2HHT A;  2HHQ A;  2O4G A;  4CEA A;  2XHB A;  4JLH A;  4CHP A;  2HVH A;  3KLF A;  1RTJ A;  2RPI A;  4CJ3 A;  2XY7 A;  3THV A;  4CK2 A;  1WAF A;  4CJE A;  4DTS A;  4M45 A;  3B6P A;  1TL3 A;  2IAJ A;  1TKD A;  2FBV A;  2ITG A;  1IKW A;  3I0S A;  4KO0 A;  4W5N A;  4Q0B A;  1I39 A;  1VK0 A;  3SQ2 A;  1SUQ A;  1A5W A;  3OYI A;  1LW0 A;  3LDS A;  1U45 A;  3TAP A;  1F21 A;  5FRO A;  4ZTF A;  1BI4 A;  3OYC A;  3RMD A;  3PY8 A;  2VWK A;  3AVM A;  1TVR A;  2XY8 A;  3AO4 A;  3V1R A;  4O5B A;  4OJR A;  3DMJ A;  5FDL A;  4DTU A;  4DTN A;  3RRH A;  4N47 A;  2G8I A;  1QSY A;  3SQ0 A;  1N5Y A;  2IGI A;  3T1A A;  4BE0 A;  5HRO A;  5SZT A;  3TAF A;  1GOA A;  3V1O A;  3LZJ A;  1KFD A;  4LH5 A;  3L2V A;  1RBT A;  4CJ4 A;  2KW4 A;  1JLB A;  5D3G A;  1QQC A;  1CZB A;  4CGJ A;  1JKH A;  2PY5 A;  1WN7 A;  2X6S A;  3MXJ A;  3QES A;  1TKT A;  2IC3 A;  3L2R A;  3OYD A;  3VQE A;  4M3W A;  3QEW A;  3TR8 A;  1RT2 A;  4OGE A;  4W5R A;  4B9V A;  1ZBU A;  4LSL A;  3V9W A;  2B4J A;  3AVH A;  3VQD A;  3HL8 A;  4DG1 A;  4F2R A;  3OS0 A;  4FJN A;  3NF6 A;  4NCA A;  3UIQ A;  4FCY A;  1HMV A;  1TKZ A;  4CF1 A;  3V9U A;  3NF7 A;  1TGO A;  4J2B A;  4JRQ A;  2HND A;  1EXQ A;  1C0U A;  3HO1 A;  3RR8 A;  5CYQ A;  3VQP A;  1BCO A;  1HQU A;  2I5J A;  1VSL A;  2OPP A;  3O3F A;  1WAJ A;  4L8R B;  1UOC A;  1RCH A;  1R0A A;  2HNZ A;  4CHQ A;  3DRP A;  1NJW A;  3IAY A;  5KRS A;  3NF8 A;  4Z0U A;  2E4L A;  4FLU A;  4EP5 A;  1L3V A;  4J2E A;  3NCI A;  3TAE A;  3HVT A;  4XIU A;  2KZM A;  3KLH A;  2OZS A;  1YTU A;  4C8M A;  2F8T A;  4KHQ A;  2XO7 A;  1C1B A;  1EKE A;  4FW1 A;  4E1M A;  4KHY A;  4BDZ A;  4CEQ A;  3IRX A;  1HPZ A;  4JS4 A;  2G8F A;  4OVL A;  1T7P A;  2P5O A;  1UA1 A;  3QEX A;  1L5U A;  4EZ6 A;  4KI6 A;  1ZBI A;  4QOZ B;  4DTP A;  4KHS A;  4JS5 A;  1RT5 A;  4I2Q A;  3OYF A;  4BAC A;  1VSF A;  1IKY A;  1NK4 A;  4FJL A;  1BHL A;  1WNS A;  1S1V A;  3VA0 A;  4CFA A;  4AHS A;  1J5O A;  3CQ8 A;  1RTD A;  2HHU A;  4R5P A;  4CEC A;  4KRE A;  4IG0 A;  4DQI A;  1Q9Y A;  3WNH A;  3QNO A;  3IS9 A;  4B9L A;  4M3R A;  1T05 A;  4ZHR A;  2KZZ A;  2IOC A;  4ELV A;  1ITG A;  4C8K A;  1JLG A;  4GVM A;  4DSK A;  3AO3 A;  3K2P A;  3NDK A;  4AHV A;  4K8Z A;  2KQ2 A;  4KTW A;  4FJI A;  4DQR A;  4DU3 A;  1RNH A;  4KV8 A;  4RW9 A;  2D0B A;  3C94 A;  5C24 A;  3A2F A;  4HUF A;  4C8O A;  2HB5 A;  4Z4C A;  4W5O A;  1LW2 A;  1RDD A;  1BCM A;  2VWJ A;  1NKE A;  2YNI A;  1RT3 A;  4E1N A;  4CEO A;  4NCB A;  3OY9 A;  4DFP A;  4OGC A;  3KD5 E;  3AVC A;  3M8P A;  5HP1 A;  1VSJ A;  2KFN A;  3OS1 A;  3SPZ A;  1WSF A;  3ZT4 A;  4AH9 A;  1S1W A;  1SKS A;  3S3O A;  1VSI A;  4QCL A;  3HVR A;  3DYA A;  4CEZ A;  4KHN A;  4O44 A;  2ZE2 A;  3KLI A;  3HST B;  4CE9 A;  4CES A;  4BE1 A;  2PZS A;  5I3U A;  3EY1 A;  3BGR A;  3ZSO A;  2RF2 A;  2BE2 A;  2B6A A;  4E7K A;  1VSM A;  2YV0 X;  4KKO A;  4Z4G A;  4E89 A;  3C6U A;  3QEI A;  4BDY A;  3CYM A;  4AIL C;  4ELT A;  4CEB A;  3SQ4 A;  4B9T A;  2XY6 A;  1EET A;  2P1J A;  4CCH A;  3CFP A;  3K5O A;  1SL0 A;  5CZ1 A;  4CJL A;  1SV5 A;  1RDB A;  3NHG A;  3WNF A;  1D5A A;  2W42 A;  2F96 A;  4CIG A;  3E01 A;  4M3T A;  3DLR A;  2ETJ A;  1ZBF A;  3WNE A;  3LAL A;  4F4K A;  4DQS A;  3DOL A;  1U04 A;  1KSP A;  3ASM A;  1QSL A;  3OYE A;  4AHU A;  1BQM A;  3DLB A;  3ZSV A;  1NJX A;  3PO4 A;  3LZI A;  3QNN A;  3PO5 A;  4CGF A;  4Z4I A;  3RMB A;  3V1Q A;  3QIO A;  1RBR A;  2F8S A;  3O4Q A;  4M42 A;  1A5X A;  5DMR A;  2Y1J A;  4DFJ A;  3RRG A;  4M3U A;  4I2P A;  4CJQ A;  4J2A A;  2HVI A;  1TAQ A;  5HRS A;  1YTA A;  2AJQ A;  4F3O A;  3LAK A;  1KTQ A;  3KK2 A;  4KAZ A;  3ZT2 A;  1JL1 A;  3V9X A;  3HPG A;  1VSE A;  3ZT0 A;  4FJ5 A;  4M3X A;  1G15 A;  2Q3S A;  1IO2 A;  3RMA A;  3NGY A;  4FJJ A;  1D8Y A;  3B6O A;  5HBM A;  1FKO A;  5I42 A;  5J2N A;  4HTU A;  3AVG A;  4E7I A;  4FJ7 A;  1QE1 A;  3AVJ A;  4DTM A;  3QEP A;  3SPY A;  1C6V A;  4CJV A;  3TAM A;  3ZT3 A;  1ASW A;  4BE2 A;  5JS2 A;  4FM1 A;  2VG7 A;  1CXU A;  4ELU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...