4CGGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cggA00
2YKMA 3O4QA 4B8AB 3SYZA 1HYVA 3AVIA 2X6NA 2OZMA 3LP2A 4E7LA 4C8KA 2PYJA 4HCBA 2HHQA 3OY9A 5J1EA 4KHSA 2ZD1A 4GW6A 1RT4A 1HJRA 4DU4A 4BDZA 4H4MA 3ZSRA 3OYHA 3CM5A 3AO4A 3NFAA 4CFAA 3KK3A 1TK5A 4IKFA 4DS5A 4M41A 3L3VA 1KFSA 3LPUA 1C1CA 1LW2A 2HHTA 1TVRA 1VK0A 3OYAA 1VSKA 1SL2A 3MXMA 4F4KA 2KW4A 4M3UA 4Y1DA 2E6MA 4AHTA 1KRPA 4LH4A 1HMVA 4O0JA 4CEZA 3ZT1A 4LH5A 2DFHA 4CF9A 4CEDA 4LSLA 2HW3A 1HYZA 2HNDA 2Q3SA 3AVMA 3WNFA 1BIZA 3ZT0A 3RTVA 3LAKA 1DLOA 1FKPA 2Y1IA 4IFVA 2HHXA 4OPKA 1HQUA 4KTZA 1NJZA 1D8YA 2YNIA 2GBZA 3PX6A 4C8LA 2VWJA 4CJ5A 4Z0UA 4RW8A 5C25A 3DRSA 1WN7A 1J53A 5SWMA 4DTRA 3VQDA 3VQ8A 3C6TA 1YVUA 1WSIA 3CQ8A 1LAVA 4CHPA 3NF6A 3KD1E 1HYSA 4W5NA 2ITGA 1ITGA 4CFDA 4B9LA 4W5RA 4DSEA 4Q5VA 2R7YA 1VSFA 3AO3A 3QEVA 2F8TA 1WLJA 1WAJA 3L2QA 2FC0A 1BGXT 2HNYA 2GV9A 1NKCA 4BDPA 2D0AA 3NH2A 4EP4A 4NCBA 3PO4A 3S3MA 4DSKA 4FLZA 4E19A 4CHQA 2FBTA 4LSNA 5KTQA 4ZTJA 1X9MA 4GMJB 1T03A 1R0AA 4FZXC 3SUOA 1JLEA 4XIUA 3HPHA 4CIFA 4W5OA 5HROA 4J2EA 4CHOA 3LALA 4DFJA 4CESA 1T05A 4KO0A 2OA8A 4GVMA 2OPPA 2P1JA 1TV6A 5KI6A 1MU2A 3V9WA 1NOYA 4B9TA 4FYDA 2DFFA 1S9EA 1KFDA 4FM1A 3RMBA 5J2PA 4RG8A 4BWMA 4Z4EA 4F2RA 4B9UA 2I5JA 5HRNA 3AA2A 4WE1A 2WOMA 2XO7A 4CJ4A 3HM9A 3DLKA 1RBVA 4CK2A 1LWFA 1X1PA 3V1QA 1IH7A 4MQ3A 2GUIA 3JSMA 4B9SA 4OKJA 1C0UA 1UOCA 3KD5E 1FXXA 3IAYA 3MEGA 3NF9A 1N5YA 4E7HA 4RW6A 2ZE2A 3V1RA 1Q9XA 4IFYA 1F21A 1JXEA 4DTNA 4CGJA 4FXDA 3NE6A 3LWLA 1Z26A 4Q0BA 3KLHA 4L8RB 4KHQA 5FRNA 3T3FA 4Z4GA 3O3GA 3OYDA 3SJJA 2EX3A 1JLCA 4CF2A 4FK0A 1RTHA 2OPSA 1NK0A 3BDPA 4DQRA 4I2PA 4TSXA 3LWMA 4HCCA 4ID1A 4CEQA 4CK3A 1T7PA 2P5OA 4DLGA 3ISNC 4HHTA 1NK5A 2IGIA 4M42A 1JLQA 1WSEA 3IG1A 3BGRA 1WSGA 2XY6A 4NCAA 1CZBA 2XY5A 5C42A 4CEFA 1NJXA 4CJSA 4DTJA 1QSYA 3AVAA 1I39A 3L2RA 3K5OA 2BGGA 4IG0A 3U3GA 1KVAA 5I3UA 1BI4A 1KVCA 1UAXA 4CJQA 5KRTA 2YNHA 4CEBA 4JS4A 3SV4A 4PA1A 1WSJA 4PY5A 3E01A 3TR8A 1QQCA 3VQPA 3AV9A 1JLFA 2G8UA 3HYFA 3OS1A 2DFEA 4OKEA 4I7FA 3L3UA 4CIEA 4BE0A 2YKNA 3PX0A 4FJ7A 3D0PA 3B6PA 1RT3A 5J2MA 4LY7A 3DOLA 1C1BA 1UA0A 4FJ8A 1CLQA 1RTDA 1JXBA 4J2BA 2O4IA 1EX4A 1RCHA 3AVNA 1RBTA 4M3RA 2RKIA 1NKEA 1FK9A 4CJFA 2Z1HA 1JKHA 5HRRA 3L2VA 3TAQA 4CJLA 4KHWA 1TKXA 4K8XA 3RRGA 1B9DA 1RBUA 1LV5A 4C8OA 4DS4A 2OZSA 4KKOA 3TAMA 2QK9A 1TGOA 2B4JA 3HPGA 3KKSA 4RW7A 5DK5A 3ZSYA 4CJVA 1NK8A 4E7JA 1WSHA 1KTQA 3DMJA 4NYNA 2D0CA 3AVJA 1Y97A 1HQEA 4E0DA 1TAUA 3LPTA 4CJEA 4IDKA 1RT6A 4CHZA 4G1QA 4N5SA 3HT3A 3SQ0A 4CJKA 4FJ9A 2A1SA 3OS2A 3MEDA 4CGFA 1HNVA 4IBNA 4OGEA 4KI6A 3NGYA 4RW9A 3F9KA 3NF8A 4JRPA 4OLBA 4FJNA 1ZYQA 3VQ5A 1RBRA 4BE2A 3V81A 3RRHA 1RT2A 3OS0A 3QERA 3CG7A 1K6YA 4CK1A 1A5WA 3RMCA 3U6FA 4DG1A 3NF7A 3KLFA 1BHLA 3TANA 1GOCA 3FFIA 4KRFA 3K58A 1S1XA 1TAQA 2LSNA 1B9FA 4N56A 4FLWA 4M3ZA 4CEAA 1REVA 3V9ZA 1SKRA 3LANA 3H08A 3ALYA 2G8VA 4FJKA 4AH9A 1U45A 1Q8IA 3M8RA 3AVFA 4H8KA 2OPQA 3NAEA 4FLVA 3ZSWA 3HPOA 1I3AA 4E1MA 1QS4A 2ZQBA 3MAQA 3DLBA 3AA3A 3VN5A 5HP1A 3NDKA 3CFPA 4DQQA 3HJFA 3ITHA 3T1AA 1L3UA 3KLIA 3VQ6A 5KGXA 1SL1A 3QEIA 3VQBA 1VSEA 3C6UA 4BWJA 4KREA 2HVHA 3KTQA 3SQ1A 3SCXA 4ID5A 2A1RA 4FZYA 3I8DA 1L5UA 3K59A 2IC3A 3P83D 1S9GA 4R5PA 1VRTA 3OYIA 3AO2A 3SQ4A 1RBSA 1CZ9A 2X78A 3OYFA 3KLGA 4DLEA 4DTPA 1T8EA 4ELVA 4J2AA 3ZT3A 3VA3A 4CFCA 4B9MA 4B3OA 1HNIA 3OYMA 4E7IA 4CEEA 4N41A 2F8SA 5E41A 4FJJA 4AHRA 4FJIA 1ASWA 4RW4A 3OJUA 1RTIA 1C0TA 2RPIA 3HSTB 3V6DA 1VSHA 4DQPA 1IKVA 2X6SA 2YV0X 4CCHA 4ELTA 4FJLA 2W42A 1G15A 3VQ7A 3LAMA 3C95A 4KHNA 3QLHA 3QETA 3MXJA 2HHUA 3OYBA 1RT7A 4DTXA 3SUPA 4Z4IA 3IRXA 3QIPA 5EU7A 3KKRA 3TABA 1LWEA 2BE2A 3K5NA 4FZZA 3PY8A 1HPZA 1LWCA 3ZT4A 1X9WA 1LAWA 2X74A 4KTWA 3P1GA 3ZCMA 4DSLA 1VSMA 1U49A 1DTTA 3K57A 3O3HA 4OKKA 4M45A 5FROA 4FM2A 3SNNA 2D0BA 2E6LA 5KGWA 3OYNA 3V9SA 2KFNA 4EZ9A 4DWIA 4CECA 4N47A 3NGZA 2B6AA 1TK8A 3OYKA 3ZSVA 1LW0A 3HVRA 1TKTA 3DLEA 1XI1A 1ZBUA 3QEPA 1FKOA 1U47A 3VA0A 2KQ2A 4NYFA 2OYQA 3TAGA 4KAZA 1RTJA 3VQQA 1TK0A 3RWUA 1J5OA 1S1UA 2E4LA 3ZT2A 2XY7A 4YFUA 4FJ5A 3ZSXA 1XHXA 2EHGA 3KJVA 4DSJA 4HUFA 1RDAA 4HUEA 1KVBA 1RT1A 4CJUA 1C0MA 2YNFA 2BANA 3MEEA 3RMAA 3SPZA 2PYLA 1SKSA 1SKWA 2NUBA 3L8BA 3JYTA 1S5JA 3HP6A 4DTMA 1W9HA 2P5GA 4KV8A 4AHCA 4ZHRA 3K5MA 4KFBA 5C24A 3LZJA 4HTUA 4E3SA 1KLNA 1VRUA 2O4GA 3AVHA 3SPYA 3NGIA 4HUGA 3C94A 1HRHA 1ASVA 3PUFA 4CGGA 4CJTA 4H4OA 5DMRA 1ZBFA 1D9DA 3K5LA 4FLXA 4CE9A 3A2FA 4UQGA 3THVA 3V9XA 1KCFA 3AO1A 5CZ2A 1NK6A 3B6OA 4KTQA 4ELUA 4ZTFA 4AHUA 3EYZA 3NBPA 4FJMA 1BIUA 2VWKA 1NJWA 3MECA 4Z4CA 1WNSA 4B8CA 3CFOA 4DTSA 2FBVA 4QCLA 2G8FA 2DTUA 3LP1A 2HHVA 2G8IA 4B9VA 2AJQA 3U3YA 1EXQA 1Q9YA 3PO5A 3HO1A 1XC9A 4M3WA 4CFBA 1X9SA 5I42A 1RDBA 2P51A 3LDSA 3QNNA 2VG5A 4W5QA 4DTOA 1N6QA 1QE1A 1RDCA 4NCGA 3ZSOA 4FM0A 4I9QA 4M3TA 3ZSZA 2HVIA 1S1WA 1S1TA 1GOBA 3DLRA 4I9LA 5CYQA 3IS9A 3M8QA 3S9HA 3WNHA 2XRIA 3RR7A 1RDDA 5HBMA 1RT5A 1UWBA 2FBXA 4OJRA 1YT3A 4CJRA 3SZ2A 1EETA 3AO5A 2Y1JA 1NK9A 3OYLA 1S6QA 4CF8A 1D9FA 1U04A 3AA5X 3QIOA 3QESA 4B9NA 3DRPA 3VQCA 3AVGA 3G10A 4C8MA 5D3GA 2RF2A 1C6VA 3CFRA 4M3YA 1S1VA 4DSIA 1TL3A 3AVBA 3ASMA 4O55A 4KB1A 2G8WA 3OVNA 5CY4A 5HRSA 4YNQA 1EP4A 3KIOA 5SZTA 1ASUA 3AVCA 2FBYA 4FVMA 1ZBLA 3VQ4A 4DU3A 4FK4A 3RMDA 3UIQA 4E7KA 4KHYA 3P5JA 2KTQA 3M8PA 3V4IA 3DI6A 3HVTA 4DSFA 4PUOA 2VG7A 1YTUA 5JS1A 1EKEA 4OGCA 4E1NA 3DLGA 4DU1A 4DF4A 4E89A 3TAEA 1L3VA 1BCOA 1QTMA 4FLTA 4DFPA 5T7BA 3QINA 1D5AA 2XY8A 1RILA 1IKYA 3HP9A 4MFBA 4CGHA 2PY5A 4KPYA 1SV5A 4J2DA 3CYMA 1B92A 1JLBA 1VSDA 2HHWA 3L2UA 2Z1GA 2G8KA 4LD0A 3K2PA 4FJXA 1C1AA 3DRRA 1VSJA 2WONA 3QNOA 1QSSA 4QOZB 4CERA 4PQUA 2QXFA 3CM6A 2YHAA 1SUQA 2YNGA 1KLMA 4AILC 4F3OA 3TAPA 4BE1A 4F8RA 1U4BA 2HHSA 3AVKA 5J2NA 1TKDA 1NOZA 2ATQA 3QO9A 3NCIA 1J9AA 3AA4A 3HL8A 4BACA 1YTAA 1RNHA 3T19A 3V1OA 2IAJA 2IDOA 3OYGA 3EZ5A 1VSIA 1W0HA 3SUNA 4K8ZA 1BI4B 4DMNA 4O4GA 3WNGA 5J2QA 3DLHA 4FW1A 1IG9A 4F3TA 1CXQA 1QHTA 5HLFA 5CZ1A 4HVJA 4CF1A 1JLAA 1NKBA 4CF0A 2HMIA 1IKXA 4OVLA 4KHUA 3I0SA 3LP3A 1CXUA 3O4NA 3KK1A 3NHGA 4CJPA 3VQAA 4DFMA 3TI0A 4FJHA 4IG3A 1NJYA 2KZMA 3KLEA 4FJGA 4CEOA 3V9UA 1DTQA 2Z1JA 4O5BA 4DFKA 3PV8A 3SV3A 2PZSA 4KB0A 2VG6A 3QEXA 3ULDA 2IS3A 3HK2A 2JLEA 1KSPA 4EZ6A 4JLHA 4F2SA 1BQMA 1VSLA 2YHBA 1QSLA 3NH1A 3OJSA 3G0ZA 4FK2A 4FLUA 3LP0A 4CHYA 1L3TA 4CIGA 2RN2A 4ICLA 3F73A 1L3SA 1JLGA 1GOAA 2JGUA 4I2QA 4JS5A 1UA1A 4Z4FA 4CJ3A 3S3OA 3RR8A 1U48A 2OPRA 1BISA 1XWLA 3NH0A 1J54A 1IO2A 1WAFA 3DOKA 5JS2A 2F96A 4O0IA 3OYCA 4W5TA 3EY1A 3SI6A 2BDPA 3SQ2A 1NK4A 2KZZA 5HRPA 5KRSA 4DTUA 3PX4A 4C8NA 4DF8A 1XHZA 3SUQA 2HB5A 1WSFA 2Z1IA 4FW2A 2IOCA 2B5JA 5FDLA 3OYEA 4O44A 1BL3A 4EP5A 2QKKA 3ZSQA 4AHSA 2KFZA 3LZIA 3OYJA 3TWHA 2HNZA 1JL1A 3VQ9A 3S3NA 4KI4A 2DY4A 4BDYA 1A5VA 1ZBIA 2D5RA 4DQSA 3M8SA 3MXIA 4FLYA 3DYAA 3L2WA 3TARA 1ZBHA 4OLAA 4QAGA 3HXMA 3WNEA 3KK2A 1TL1A 3D45A 1BCMA 4AHVA 4CHNA 1NK7A 4DQIA 1A5XA 2QKBA 4B08A 4CGIA 5CYMA 4PWDA 1IKWA 4CGDA 3TAFA 4OPJA 5K14A 4CJWA 4JRQA 4FCYA 1O1WA 3VQEA 2XHBA 2ETJA 1S6PA 3DM2A 3I0RA 1JL2A 4M3XA 3O3FA 1Z25A 4Y1CA 1SL0A 4Z4HA 5FRMA 3AVLA 2G8HA 3QEWA 1BQNA 1TKZA 4N76A
chains in the Genus database with same CATH superfamily
3JAMO 4B8AB 3CC2N 4FWNA 2OZMA 2QWRA 2KLAA 1HJRA 4B1WB 3FZLA 4I6MB 1TK5A 4CZJA 2I7PA 2OANA 1TVRA 5ADXH 1VSKA 2E6MA 2ZJQL 2DFHA 4BR4A 3FZFA 3CCMN 2HNDA 2QTDA 4JKGB 3AVMA 3ZX3A 1DEJA 1TYQB 2FXUA 3ENOA 4C23A 4BG9A 3LAKA 5KPZA 1DLOA 4LF6K 2HHXA 1HQUA 4KTZA 1D8YA 2YNIA 2GBZA 3R9PA 3PX6A 2VWJA 4IWVA 3JXUA 3G71N 4JKCA 1LAVA 4JHDA 3KD1E 1LCUA 1VSFA 2KHOA 4O8KA 2F8TA 4JK8A 3D7EO 3WXLA 3S3MA 3QB0A 4E19A 4AQYK 3CJBA 4IZ9A 4YOWA 4FZXC 1JLEA 4XIUA 5HROA 3SBGA 3LALA 4DFJA 2NRWA 1T05A 4CJ7A 4KO0A 1LOTB 3V9WA 2P1JA 5KI6A 2RHKA 1MU2A 1NOYA 1Y64A 1XQSC 4B9UA 5HRNA 1RBVA 1YJWN 3Q7BA 1OH8A 1X1PA 3V1QA 4DR4K 1VAZA 2EWSA 1Q18A 3FLCO 1UOCA 3KD5E 3IDHA 3QMLA 2W40A 1YUWA 3H3NO 1JXEA 3E9PA 4CGJA 2UUCK 1Z26A 2GX9A 4Q0BA 2YCHA 4K42A 4Z4GA 2KKZA 4FWQA 3SJJA 4CF2A 1JLCA 1NK0A 3J80O 1T7PA 5AZIA 4DLGA 3AGKA 2GWKA 4JK9A 1BOTO 3IG1A 2XY5A 1C0GA 1VQ6N 4CEFA 3PSFA 3AVAA 3L2RA 3K5OA 2BGGA 1GLAG 5LL6Z 2ZJRL 1H1VA 4WQ5A 3CCSN 2G8UA 3HYFA 1N36K 3AGRA 1NGDA 3WXIA 4CIEA 2YKNA 3D0PA 4H0YB 4LY7A 4CBWA 3OW2M 2F7TA 1JXBA 4J2BA 1E4FT 5GAEP 1JJ2M 3RRGA 1B9DA 2PAVA 4C8OA 3O9UA 2QK9A 1TGOA 1RGIA 4WFBL 2HF4A 3DMJA 1MWKA 4NYNA 4BC4A 3VMFB 1Y97A 1NG9A 3LDOA 4LF8K 3QICA 4BRMA 3LPTA 4CJEA 4G1QA 3SQ0A 2E1ZA 5AQLA 3OS2A 4CGFA 4KI6A 3NGYA 4RW9A 3SBTA 3NF8A 3CC4N 2NRTA 3VQ5A 5KQDA 4BE2A 1U2VA 3FFKB 1VHXA 1A5WA 5JICA 3RMCA 3U6FA 4LF5K 2NZTA 3K58A 4FO0A 4CZLA 4DQ8A 1B9FA 2WFBA 1X3MA 2CGKA 1Q8IA 3Q7CA 4H8KA 4WCEL 3M8RA 1HNZK 5ELZA 1ILYA 3MAQA 3DLBA 3CFPA 2UYTA 5LMNK 4BWJA 4BRAA 3KTQA 4JI6K 1IJJA 3SQ1A 3SCXA 4ID5A 3I8DA 3P83D 4U67L 2UUBK 1E3MA 2BH1A 3SQ4A 1SS6A 3HZ6A 5JVHL 3ZT3A 3VA3A 2JWLA 3QFUA 4DR7K 4N41A 2P9UB 5EXWA 5E41A 1EWQA 3CCUN 1VSHA 2UUAK 2YV0X 4GNIA 3O9RA 3VQ7A 3MXJA 2HHUA 1BO5O 3I56N 3IRXA 2RE2A 5EU7A 4FZZA 3EEQA 1KAZA 3PY8A 1KD1O 4JI0K 3K9JA 4KTWA 3P1GA 4DV3K 1DTTA 3O3HA 4M45A 3OYNA 3V9SA 3A0IX 1BU6O 3THXB 1TK8A 1X9JA 3DLEA 4NLBA 3CCEN 4GVEA 3TAGA 1OH6A 5AZJB 4YFUA 1RDAA 1XNRK 1RT1A 4LFCK 4CJUA 2BANA 5GIOA 1SKSA 1SKWA 3L8BA 3LDPA 3THYB 4H0VB 1P8ZA 4UY8O 3CMEN 3DXMB 4E3SA 1KLNA 2O4GA 4FWOA 3SPYA 1ASVA 1KC8O 3PUFA 2VQFK 2A40A 1ZBFA 5A2QO 5CZ2A 1NK6A 3KHYA 4AHUA 4PKGA 1XC3A 1WNSA 2FBVA 4QCLA 4DV0K 4AF1A 3SK3A 2Q1NA 1I94K 4CZGA 2AJQA 3O4WA 4IOXA 4NLCA 5I42A 1RDBA 1N6QA 4A59A 4W5QA 4DTOA 2FF3B 4FM0A 1S1WA 1GOBA 4I9LA 3IS9A 3M8QA 5BN8A 3WNHA 2XRIA 3WXMB 4M7YA 4DV4K 4JHDB 4B9QA 3OYLA 1S6QA 4B9NA 1NLVA 5AQPA 3RSEA 1K8KA 3AVGA 5AQHA 4BRPA 2NRVA 3CFRA 4M3YA 4DSIA 3OVNA 1NGHA 2FBYA 2A6AA 3UIQA 2KTQA 3V4IA 4DUZK 3HI0A 4E1NA 3DLGA 1IBMK 3TAEA 4E89A 5T7BA 3QINA 1RILA 1IKYA 2IIRA 5EVZA 4CGHA 2PY5A 4FL9A 4J2DA 4NB4A 2Z1GA 2G8KA 3K2PA 1C1AA 3DRRA 4BR9A 2WONA 4DCHA 3QNOA 4WQ4C 3A5LC 3CM6A 3GOIA 2HBLA 3CJ1A 4F8RA 4B3RK 3QDKA 1U4BA 3ENHA 4B1ZA 1NOZA 3HL8A 1JCGA 1RNHA 3EZ5A 1W0HA 3MCAB 1BI4B 5J2QA 2UXDK 1IG9A 4F3TA 5HLFA 1ATRA 4HVJA 4OVLA 3AAPA 3NHGA 4CJPA 4BROA 2KZMA 4FJGA 4KH5A 3V9UA 1DTQA 2Z1JA 3TSUA 4IXCA 2IS3A 5BREA 3HK2A 2JLEA 1KSPA 1BQMA 1VSLA 2YHBA 1P90A 3WQTA 1L3TA 4YDUC 2JGUA 4I2QA 1UA1A 4MLHA 1QVGM 3DOKA 2BDPA 4W5TA 2IOCA 3L4QA 4H03B 5FDLA 3THYA 4OPAA 3H45C 1BL3A 3ZSQA 4AHSA 2KFZA 3S3NA 2O8CA 4KI4A 3C6HA 1A5VA 3FE1A 1S22A 3LDQA 4B3SK 3MXIA 1ZBHA 3L2WA 5CR4A 4H0PA 3HXMA 3KK2A 4AHVA 1BCMA 4DUYK 1NK7A 4DQIA 4BQZA 4B08A 4CGIA 3TAFA 3O8MA 2Q97A 5K14A 3OTOK 2ZWHA 4FCYA 3KZBA 1JL2A 4M3XA 4Y1CA 5H1SQ 4DV2K 3QEWA 1K8AO 2YKMA 3O4QA 3SYZA 4JYAK 1N33K 4E7LA 4C8KA 4GW6A 1HUXA 4BRNA 3ZSRA 3CM5A 4IKFA 4BGBA 4DS5A 1LW2A 2HHTA 1RFQA 1VK0A 3BZKA 5DM7L 3MXMA 4Y1DA 1KRPA 4FOEA 3FZMA 2NLXA 3MDQA 3MX2A 3THWB 4CF9A 5AQIA 4LSLA 4PKHA 3ZX0A 3I8BA 2VGNA 4BRHA 2Q3SA 4BRGA 3WNFA 1BIZA 2Y1IA 2E2PA 3VGMA 4OX9K 1VQMN 4Z0UA 3DRSA 1J53A 4YDUA 3DXKA 2ZM6K 1K73O 4CHPA 3NF6A 5JMVA 1HYSA 2ITGA 4DSEA 1YJ9N 4Q5VA 3AO3A 2QWMA 4GY2B 3H1QA 3L2QA 3CPWM 2FC0A 2GV9A 1DT9A 4BDPA 4NCBA 3NH2A 1BUPA 4EP4A 3PO4A 5BRHA 1NMNA 4CHQA 3WEEB 1X9MA 5KTQA 4H5RA 1R0AA 3SUOA 4BQLA 4J2EA 1SAZA 4K25A 4LF9K 4CHOA 2P9NB 5LJWA 4DR1K 2OA8A 1ATSA 4GVMA 1TV6A 4FYDA 4OPHA 4FM1A 3RMBA 5J2PA 4RG8A 4BWMA 3A8YA 5BPNA 3U9DA 4F2RA 4A61A 2I5JA 3TTFA 2E1YA 2WOMA 2XO7A 3HM9A 5C12A 3O08A 4CK2A 1GLLO 4DV7K 1FXXA 3MEGA 3NF9A 1N5YA 2ZE2A 3CC7N 3V1RA 3VEYA 2YHXA 3MN5A 3ATUA 2YHWA 3MCPA 1D4XA 4I2PA 3LWMA 4ID1A 1NGEA 4HHTA 1JLQA 1WSEA 4IOCL 4NCAA 2JWKA 5C42A 4CJSA 1VQPN 3U3GA 4BRFA 1BI4A 3CJ7A 2YNHA 3DAWA 4JS4A 5EX5A 3VEZA 3SJHA 3TR8A 3VQPA 3DXMA 3MN7A 2DFEA 4OKEA 2GUPA 4I7FA 3WXJA 3L3UA 4BE0A 3PX0A 5C10A 4JI4K 4M7XA 5J2MA 1CLQA 5TKYA 1N8RO 2GTDA 1RCHA 1NKEA 3L4IA 4PKIA 4M3RA 4CJFA 2Z1HA 3BZCA 5HRRA 5M1KA 3WQUA 4CJLA 4EIAA 4KHWA 4IJAA 4BGAA 3ZETB 1LV5A 3TTDA 1XMOK 1BDGA 2FSJA 4KKOA 2BUPA 4RW7A 2B4JA 1Z6RA 2YX6A 3HPGA 5DK5A 4CJVA 1KTQA 2D0CA 3AVJA 3F2KA 1HQEA 1YI2N 1TAUA 3RVCA 4IDKA 3L0QA 3HT3A 4CJKA 3MEDA 5BR9A 4DR3K 4DG1A 3T1YK 1BHLA 3CETA 4H0OA 5BN9A 4JNEA 1NGFA 4M3ZA 1REVA 3V9ZA 2HSTA 3HRGA 3O9TA 1U45A 4QS9A 3NAEA 4E1MA 3VN5A 3KLIA 3VQ6A 1OH5A 4KHPK 2A3ZA 3QEIA 4KREA 3O5BA 4FZYA 4BRKA 2O8BA 4R5PA 1VRTA 2O8CB 1CZ9A 2X78A 3A5NC 1T8EA 4J2AA 3VTHA 4B3OA 4H5VA 1GLJO 1HNIA 1NU0A 3OYMA 1VQ9N 2GELA 4E7IA 4A5AA 3CQXA 4EFHA 4FPBA 4I6MA 1NWKA 3HSTB 1WB9A 1IKVA 4K41A 2W42A 4CZFA 4JKAA 3C95A 4CW7B 3QLHA 3QETA 3OYBA 1RT7A 3SUPA 2VGMA 2VWBA 5ADXA 3KKRA 2YHYA 1VQNN 4X64K 1HPZA 3ZT4A 1X9WA 3SMSA 1G99A 3LDNA 3ZCMA 4DSLA 1VSMA 2Q0UA 2YI1A 4FM2A 1IBLK 5FROA 2D0BA 5KGWA 4DWIA 5LMUK 5M1NA 5GAHP 4N47A 1XI1A 3MK6A 3GL1A 3ZSVA 5C15A 4OO1J 4GKKK 3QEPA 1FKOA 2KQ2A 4LFAK 1RTJA 3RWUA 2PFUA 4LF4K 4CZEA 2XY7A 5FPNA 3C0BA 1U6ZA 3AARA 4B1XB 3VGKA 1NNEA 4DTMA 3LZJA 1YHQN 3DJCA 1VRUA 3C94A 1HRHA 2D1KA 4DV5K 4CGGA 4H4OA 5DMRA 4CE9A 2HF3A 1BIUA 2VWKA 1NJWA 3MECA 3THXA 4DTSA 3KVGA 2G8FA 1YIJN 4ILHA 4AM6A 4C1NI 2G8IA 3HO1A 4ISEA 4ISFA 4O8UA 3LDSA 1QE1A 1YF5L 3ZSZA 1S1TA 5CYQA 3M5RA 3QBWA 2Y1JA 2HHHK 3SZ2A 3AO5A 4KH4A 4QS8A 3VEWA 1U04A 3QIOA 2UXCK 3VQCA 3T69A 1JCFA 4C8MA 5D3GA 1MDUB 1WOQA 1C6VA 2O8DB 1S1VA 4O55A 4KB1A 2G8WA 5CY4A 1EP4A 3KIOA 3VPZA 4JV5K 2O8FA 3UE5A 5HL7L 4FVMA 3PLAA 3VQ4A 4FK4A 3RMDA 3TU5A 1BG3A 3P5JA 3M8PA 3DI6A 3HVTA 4DSFA 4PUOA 2VG7A 1YTUA 5JS1A 3VEOA 4ILJA 4DF4A 4WFAL 3R6MA 5C2FA 4NO7A 1BCOA 3HSCA 2P9KB 3BF1A 4FLTA 4GKJK 1D5AA 1CZAN 4CZMA 1VSDA 1B92A 5C0YA 1KAYA 5AQOA 3P4IA 2QXFA 2YHAA 1SUQA 2YNGA 4F3OA 3TAPA 2HHSA 3AVKA 3QO9A 4BRQA 3T19A 3J8AA 1ZBSA 4X62K 4DMNA 5M1QA 3WNGA 4MO4A 2W6LA 1QHTA 5CZ1A 2UXBK 1NKBA 2HMIA 1IKXA 3TI0A 4LFBK 4FJHA 1NJYA 3WUHA 3KLEA 2ZGZA 2P9NA 4KB0A 2VG6A 1XNQK 2QWLA 3ZETA 3ULDA 4BY9C 4JLHA 4F2SA 3OJSA 3VF4A 4CIGA 3F73A 1ESVA 4JS5A 3RR8A 4CD1A 3EN9A 3SI6A 3EY1A 1NK4A 4BRDA 5HRPA 3PX4A 4DTUA 1EWRA 3SUQA 2HB5A 4FW2A 2B5JA 3OYEA 2VYPA 4O44A 5CHIA 3VERA 3LZIA 3C7NA 3MX5A 2DY4A 4BDYA 1ZBIA 2D5RA 3M8SA 3DYAA 3TARA 2FF6A 4YY3K 4YOYA 2Q31A 3CIPA 4CHNA 4B1UB 3CJCA 1OVYA 3UKUA 4IO9L 3C6AA 3NVMA 3CXCM 2GWJA 4B1VA 3THWA 1DKGD 4OPJA 1RDWX 4JKEA 4CJWA 4JRQA 3DM2A 3I0RA 1N32K 1O13A 3EKSA 1Q7YO 3UKRA 4N76A 3AVIA 3EKUA 2NRXA 3LP2A 3ZYYX 3OY9A 5J1EA 1RT4A 4BRLA 3IFRA 4BDZA 3OYHA 3ZLJA 4JI2K 4BRIA 3AO4A 3KK3A 2QWPA 5AQVA 1R59O 4M41A 2F9WA 3L3VA 2GEMA 5HOOA 5BR8K 4F4KA 4LH4A 4B3TK 4LH5A 3WXKA 3C7NB 1FKPA 3CCLN 2HBJA 4ILGB 4IJNA 3HBTA 3TSPA 2NRRA 3IUCA 1BA0A 3LL3A 3IMXA 5SWMA 1KQSM 1WN7A 2OTJN 3QBXA 3C6TA 4XH1A 1WSIA 4W5NA 4B9LA 4CFDA 4W5RA 3G4SN 4WFNL 3QEVA 1FJGK 5DM6L 3VENA 1BGXT 1QZ5A 4DSKA 4CD3A 1WBDA 3H6EA 4FLZA 3CERA 2FBTA 4LSNA 1T03A 4ZTJA 5LY3A 3B8AX 3P31A 5AQMA 4W5OA 4CIFA 3HTVA 5C2DA 2OPPA 3CD6N 4E1JA 4FWSA 2E20A 4JK7A 2DFFA 3DWLA 1KFDA 5FLXO 2V51B 4Z4EA 1BWFO 1GLFO 4DHYA 3AA2A 4WE1A 2WC9A 1LWFA 1IH7A 4MQ3A 3ZEUB 1KXPA 3RSEB 4E7HA 4RW6A 2UU9K 2P9SB 1Q9XA 4FXDA 1F21A 3FZHA 3NE6A 3LWLA 3E9OA 2IVPA 4XH4A 5AQQA 3KLHA 4L8RB 3SAFA 5FRNA 5MLCQ 2QM1A 3OYDA 1E4GT 1GLEG 1GLBG 4FK0A 5AFUA 2OPSA 4EHTA 4H5WA 3VGLA 4CEQA 2P5OA 4XEIA 1MA9B 1NK5A 4K0KK 2HMPA 3BGRA 1WSGA 3CF5L 2XY6A 1EO1A 4KH6A 4DTJA 4BREA 4F9OA 1I39A 1K8KB 5I3UA 1KVCA 1UAXA 4CJQA 4Z94A 5KRTA 2HBMA 3ZX2A 4CEBA 4PA1A 1WSJA 2CH6A 1QQCA 3CI5A 2ITMA 1ATNA 1JLFA 1NGBA 5AFUH 2QW9A 3IKMA 3B6PA 3EO3A 1NGAA 3DOLA 1C1BA 4FJ8A 4CBXA 2O4IA 3AVNA 1RBTA 4XH5A 1JKHA 3TAQA 5E26A 1TKXA 4K8XA 4DV6K 5AQYA 2FSNA 4DS4A 5AJ3K 4Y0WA 3ZSYA 4BRCA 1NK8A 3HM8A 1T3VA 1IG8A 4H0XB 1WSHA 5GADP 2FLOA 2D0OA 4E0DA 1RT6A 4CHZA 1WBBA 4FJ9A 4HWIA 1HNVA 4OGEA 3UB5A 3CJAA 4OLBA 3O9QA 1ZYQA 1RBRA 1K6YA 4ISGA 4KRFA 3FFIA 1S1XA 2LSNA 4N56A 4FLWA 5E84A 3ALYA 1HJOA 4AH9A 3AVFA 4FLVA 2OPQA 3ZSWA 1SQKA 1QS4A 4JKHA 3AA3A 5AZJA 5HP1A 3NDKA 4DQQA 3HJFA 3ITHA 3T1AA 2NNWA 5KGXA 4YOVA 3DLLL 1VSEA 3C6UA 3P39A 2HVHA 2A1RA 3K59A 2IC3A 1J5EK 1S9GA 3AO2A 3BF3A 1RBSA 2CGLA 4DLEA 3KLGA 4DTPA 3BEXA 4ELVA 4G9ZA 4CFCA 4B9MA 4FWLA 1ZC6A 4CEEA 2F8SA 2P9IB 1ASWA 4RW4A 1RTIA 3BP8A 3V6DA 1ZXOA 2OTLN 4WQ4A 5F2RA 2X6SA 3H3OB 3TPQA 2QI2A 4FWPA 3LAMA 4KHNA 2D4WA 4CZKA 4DTXA 4MDBA 3QIPA 1U2VB 3TABA 3K5NA 1VQKN 2HOEA 1LWCA 2X74A 4BVPA 4JD2A 3K57A 2E2NA 4EZ9A 1NBWA 4PL7A 2O8BB 5M1FA 3NGZA 3OYKA 3HVRA 1TKTA 3HOTA 3NMUA 2NRHA 3TTCA 4KAZA 5GINA 3VA0A 2OYQA 3VQQA 1J5OA 2E4LA 4GV3A 1XHXA 2EHGA 3KJVA 4HUFA 4PL8A 4QS7A 1NJIO 1KVBA 2NRZA 1C0MA 2YNFA 3G6EN 2NUBA 3JYTA 1S5JA 2QWOA 4JKBA 1W9HA 4JI1K 4KV8A 4AHCA 3K5MA 4B3MK 2P5GA 1JCEA 1QZ6A 3AVHA 4MDAA 4U7BA 3NGIA 4HUGA 4CBUA 3M1FA 3CCJN 4DR2K 2P9UA 1WUAA 1NGIA 1D9DA 3MWPA 3K5LA 4A2BA 1VQ8N 4UQGA 4O5FA 1KCFA 4A57A 3B6OA 3J7YP 3OHRA 3K9KA 4FJMA 2A42A 4Z4CA 3UKUB 4B8CA 3CFOA 2HHVA 4JI5K 4FPAA 3ATVA 4B9VA 4IOAL 1QQOA 3U3YA 1EXQA 1SZ2A 5CE3A 2W41A 1XC9A 4M3WA 5M1OA 4CFBA 5BPLA 2P51A 3EE9A 2VG5A 4C1NK 4NCGA 1RDCA 4M3TA 2Q2RA 4I9QA 1V4TA 3DLRA 3S9HA 1S3XA 4CZHA 3I55N 1RDDA 4OJRA 2FBXA 1YT3A 1NK9A 4M63C 3AA5X 3QESA 3DRPA 4FWMA 3G10A 1NGCA 3PIPL 1HX1A 2RF2A 1TL3A 3AVBA 5HRSA 3GBTA 3S41A 3AVCA 2P9LA 4KHYA 3M6GA 1EKEA 3VETA 2IVNA 1L3VA 2QEXN 4BC2A 3LDLA 1EQYA 2HBKA 2XY8A 3J7AP 5F1XA 4KPYA 3U4LA 3LM2A 2HHWA 1JLBA 4LD0A 3PSIA 4QOZB 1QSSA 4PQUA 4CERA 2ASMA 1KLMA 4H5NA 4PHTX 3HOSA 4BVOA 4BE1A 3ID6A 5J2NA 1TKDA 1M1KO 2ZF5O 1QVFM 3VF6A 2ATQA 3UKRB 3NCIA 3AA4A 2WUSA 4BACA 1YTAA 4IDHA 4K8ZA 2IAJA 3SUNA 4O4GA 3FGUA 3DLHA 2E8AA 1CXQA 4WQ5C 3I0SA 3KK1A 3CJ9A 3VQAA 4DFMA 4IG3A 1NM1A 3SLCA 4CEOA 4O5BA 2PZSA 1N34K 1S72N 3ID8A 4B1YB 4H0TB 1HKBA 4ICLA 3WEEA 4Z4FA 1GOAA 5TKWA 3O6WA 4A5BA 1IO2A 1WAFA 5JS2A 4O0IA 2KZZA 5AQGA 3SQ2A 5KRSA 4C8NA 4DF8A 1XHZA 1WSFA 3EL2A 3WT0A 4EP5A 2O8EA 1JL1A 2P9KA 5FPEA 1YITN 1Q86O 4OLAA 1TYQA 3WNEA 3D45A 3N4QA 3FZKA 2IVOA 3M3ZA 1A5XA 2V52B 3KK7A 4PWDA 5BPMA 4JI3K 3N4PA 2BTFA 4CGDA 3CMAN 2YJFA 4JD2B 1O1WA 3VQEA 2XHBA 1SL0A 1T6DA 4Z4HA 3QFPA 2G8HA 1TKZA 2FSKA 3CPEA 1HNWK 2AP1A 1HYVA 2X6NA 3R1XA 2P9PA 2PYJA 4HCBA 2HHQA 3O1WA 4KHSA 3KWGA 2ZD1A 2A5XA 4DU4A 4JKDA 1T44A 4H4MA 3NFAA 4CFAA 2P9IA 5IT9O 3K0SA 1KFSA 3LPUA 1C1CA 1HKCA 5AQJA 3OYAA 1SL2A 4NXNK 2KW4A 4M3UA 1Q82O 4AHTA 1HMVA 2CH5A 4O0JA 4CEZA 5KPRA 4KBOA 4CVNE 3ZT1A 4CEDA 5LJVA 1VQLN 2HW3A 3H46O 1HYZA 3T7ZA 5AQZA 3ZT0A 3RTVA 3U8XA 4YHHK 4IFVA 4OPKA 1NJZA 2OCEA 4C8LA 4YOUA 1TUYA 3CCQN 4CJ5A 4DTRA 4RW8A 5C25A 3O1BA 3VQDA 3VQ8A 1YVUA 5FPMA 3CQ8A 3EZWA 1ITGA 2ASPA 2R7YA 1WLJA 1WAJA 3FR0A 2HNYA 1NKCA 2D0AA 3JS6A 5BRFA 2WTUA 4GMJB 4R79A 3NVKA 5BRDA 3HPHA 1VQ7N 3EE8A 1FW6A 2QXLA 4BR2A 4JKGA 5AQSA 4CESA 2V7ZA 3D2FA 4LF7K 4B9TA 5M1PA 5AQNA 1S9EA 1MWMA 4LC9B 2VCPA 1GLDG 3CQYA 2Q36A 4FWRA 4CJ4A 3DLKA 4IEEA 2GUIA 3JSMA 4B9SA 4IEIA 4OKJA 1C0UA 2E88A 4HTLA 2ZGYA 1HLUA 3IAYA 1HR0K 1W97L 4IFYA 4DTNA 4GV9A 2E5LK 4EAHD 4BG8A 3PIOL 4KHQA 3T3FA 3O3GA 1GLCG 2EX3A 1IBKK 3OBWA 1RTHA 3BDPA 4DQRA 5AQTA 4TSXA 4HCCA 4CK3A 5KPTA 3ISNC 2IGIA 4M42A 1CZBA 1YVNA 1NJXA 1QSYA 1X3NA 4IG0A 1KVAA 3C65A 5FPDA 5IWAK 4JN4A 3SV4A 1J6ZA 3KWIA 1M90O 3E01A 4PY5A 3AV9A 1Q81O 3OS1A 1W7AA 3VEXA 4FJ7A 3ZEUA 1RT3A 4L3QA 3OA9A 4RTFD 1UA0A 2H3GX 1RTDA 3E66A 1EX4A 3F5TA 3T1HK 2RKIA 1FK9A 3L2VA 3O80A 3CHWA 1RBUA 2E2OA 2OZSA 3TAMA 3D2EB 1OKJA 3KKSA 5AZIB 4JEPA 3MN6A 4E7JA 4NXMK 2E2QA 1YJNN 3R8EA 2P9LB 2O8EB 3AAQA 4MO5A 4N5SA 2A1SA 4IBNA 3MMVA 4BR5A 3F9KA 4JRPA 4FJNA 3V81A 3RRHA 1RT2A 5B8HA 3OS0A 3QERA 3CG7A 4CK1A 1IV0A 3VF2A 3NF7A 3KLFA 3TANA 1GOCA 3A5MC 3MWTA 1TAQA 4CEAA 3GDQA 1SKRA 3LANA 3H08A 4YOTA 2G8VA 4FJKA 4X66K 4BC3A 2ASOA 3HPOA 1I3AA 3E9LA 2ZQBA 3OBYA 1L3UA 1SL1A 3CCRN 3VQBA 1L5UA 2PBDA 4A2AA 3OYIA 3OYFA 1QHAA 3GG4A 3R3LA 3VESA 4A62A 4FJJA 4AHRA 4FJIA 3TSQA 3OJUA 1C0TA 2RPIA 4DQPA 3D6RA 3W3DA 4CCHA 4ELTA 4FJLA 1G15A 3F9MA 2D0PA 1HKGA 2F4VK 4Z4IA 1NGJA 4YOXA 1LWEA 2BE2A 3ULEA 1LAWA 1YAGA 5JLHA 1U49A 5AQKA 3SNNA 4OKKA 2E6LA 2KFNA 3LM9A 4CECA 1NGGA 2B6AA 2Q0RA 1LW0A 3VEVA 1ZBUA 1C0FA 3BY5A 1OH7A 1U47A 5AQUA 4NYFA 1OVQA 1TK0A 4RCHA 1S1UA 3ZT2A 1XMQK 3ZSXA 4DSJA 5F0XA 3ULEB 4HUEA 5AR0A 3MEEA 4FJ5A 3RMAA 2PYLA 3SPZA 1Z05A 3HP6A 4FSVA 4MLEA 4ZHRA 4KFBA 5C24A 2F9TA 4HTUA 1QQMA 2AA4A 3MN9A 4AM7A 4CJTA 5AQRA 4BR7A 4FLXA 4FWKA 3A2FA 3THVA 2I7NA 3V9XA 3AO1A 4KTQA 4ELUA 4ZTFA 3EYZA 3NBPA 1NMDA 3U9ZA 5GAGP 2W6KA 2DTUA 3LP1A 1DGKN 4CI6A 4X65K 3SMPA 3D2EA 4JI8K 1Q9YA 3PO5A 3W0LA 4GV6A 5AQFA 1X9SA 5GIPA 3QNNA 4J8FA 2O8FB 1HPMA 3ZSOA 3SAGA 2HVIA 3G25A 4H5TA 1RDUA 3RR7A 5HBMA 3J81O 1RT5A 1UWBA 4JAXA 2J4RA 4CJRA 1EETA 2P9SA 4CF8A 1D9FA 3P38A 4DR5K 4JI7K 1TUUA 2V7YA 4DKWA 4K43A 1W2BM 3ASMA 4YNQA 2A41A 4EHUA 5SZTA 4DB3A 1ASUA 1V4SA 4DV1K 1ZBLA 4DU3A 4E7KA 1BA1A 5JVGL 4OGCA 4DU1A 3D2FB 4RWTA 1KAXA 1YXQA 1QTMA 4DFPA 2QWNA 4BC5A 2O8DA 3HP9A 4MFBA 2DPNA 2WBNA 1SV5A 3A5OC 3CYMA 4BR0A 3L2UA 4FJXA 1K9MO 1VSJA 1XUPO 3I33A 5EOYA 5I9EB 4AILC 3DXKB 3AY9A 1J9AA 3E1YA 3GE1A 3V1OA 5JLFA 2IDOA 3OYGA 1VSIA 4FVUA 4DR6K 3L6QA 4FW1A 1QQNA 4CZIA 4CF1A 1JLAA 2QA4N 4CF0A 4KHUA 3LP3A 1CXUA 2QWQA 3O4NA 1VQON 2ZJPL 4DFKA 3PV8A 3SV3A 3H1VX 3QEXA 4EZ6A 1VQ4N 1QSLA 3NH1A 3G0ZA 4FK2A 4FLUA 3ENBA 3LP0A 4CHYA 2RN2A 1T6CA 1L3SA 1JLGA 4IFEA 4CJ3A 3S3OA 4FOIA 1U48A 2OPRA 1BISA 1XWLA 2YJEA 3NH0A 1J54A 2F96A 3OYCA 5AQWA 1HNXK 2P9PB 4JKFA 2Z1IA 3CCVN 3BUZB 3J7ZO 5KQ8A 2QKKA 4WYBA 3OYJA 3TWHA 2HNZA 3VQ9A 2CGJA 4YORA 4DQSA 4FLYA 3SAHA 3VTIA 4QAGA 3VOVA 1TL1A 1VQ5N 5AQXA 2QKBA 5CYMA 1IKWA 3O9SA 2VQEK 4V19S 4IO8A 4WF9L 2ETJA 1S6PA 3O3FA 1Z25A 5EY4A 3AVLA 5FRMA 1BQNA
chains in the Genus database with same CATH topology
2YKMA 3O4QA 4B8AB 3SYZA 1HYVA 3AVIA 2X6NA 2OZMA 3LP2A 4E7LA 4C8KA 2PYJA 4HCBA 2HHQA 3OY9A 5J1EA 4KHSA 2ZD1A 4GW6A 1RT4A 1HJRA 4DU4A 4BDZA 4H4MA 3ZSRA 3OYHA 3CM5A 3AO4A 3NFAA 4CFAA 3KK3A 1TK5A 4IKFA 4DS5A 4M41A 3L3VA 1KFSA 3LPUA 1C1CA 1LW2A 2HHTA 1TVRA 1VK0A 3OYAA 1VSKA 1SL2A 3MXMA 4F4KA 2KW4A 4M3UA 4Y1DA 2E6MA 4AHTA 1KRPA 4LH4A 1HMVA 4O0JA 4CEZA 3ZT1A 4LH5A 2DFHA 4CF9A 4CEDA 4LSLA 2HW3A 1HYZA 2HNDA 2Q3SA 3AVMA 3WNFA 1BIZA 3ZT0A 3RTVA 3LAKA 1DLOA 1FKPA 2Y1IA 4IFVA 2HHXA 4OPKA 1HQUA 4KTZA 1NJZA 1D8YA 2YNIA 2GBZA 3PX6A 4C8LA 2VWJA 4CJ5A 4Z0UA 4RW8A 5C25A 3DRSA 1WN7A 1J53A 5SWMA 4DTRA 3VQDA 3VQ8A 3C6TA 1YVUA 1WSIA 3CQ8A 1LAVA 4CHPA 3NF6A 3KD1E 1HYSA 4W5NA 2ITGA 1ITGA 4CFDA 4B9LA 4W5RA 4DSEA 4Q5VA 2R7YA 1VSFA 3AO3A 3QEVA 2F8TA 1WLJA 1WAJA 3L2QA 2FC0A 1BGXT 2HNYA 2GV9A 1NKCA 4BDPA 2D0AA 3NH2A 4EP4A 4NCBA 3PO4A 3S3MA 4DSKA 4FLZA 4E19A 4CHQA 2FBTA 4LSNA 5KTQA 4ZTJA 1X9MA 4GMJB 1T03A 1R0AA 4FZXC 3SUOA 1JLEA 4XIUA 3HPHA 4CIFA 4W5OA 5HROA 4J2EA 4CHOA 3LALA 4DFJA 4CESA 1T05A 4KO0A 2OA8A 4GVMA 2OPPA 2P1JA 1TV6A 5KI6A 1MU2A 3V9WA 1NOYA 4B9TA 4FYDA 2DFFA 1S9EA 1KFDA 4FM1A 3RMBA 5J2PA 4RG8A 4BWMA 4Z4EA 4F2RA 4B9UA 2I5JA 5HRNA 3AA2A 4WE1A 2WOMA 2XO7A 4CJ4A 3HM9A 3DLKA 1RBVA 4CK2A 1LWFA 1X1PA 3V1QA 1IH7A 4MQ3A 2GUIA 3JSMA 4B9SA 4OKJA 1C0UA 1UOCA 3KD5E 1FXXA 3IAYA 3MEGA 3NF9A 1N5YA 4E7HA 4RW6A 2ZE2A 3V1RA 1Q9XA 4IFYA 1F21A 1JXEA 4DTNA 4CGJA 4FXDA 3NE6A 3LWLA 1Z26A 4Q0BA 3KLHA 4L8RB 4KHQA 5FRNA 3T3FA 4Z4GA 3O3GA 3OYDA 3SJJA 2EX3A 1JLCA 4CF2A 4FK0A 1RTHA 2OPSA 1NK0A 3BDPA 4DQRA 4I2PA 4TSXA 3LWMA 4HCCA 4ID1A 4CEQA 4CK3A 1T7PA 2P5OA 4DLGA 3ISNC 4HHTA 1NK5A 2IGIA 4M42A 1JLQA 1WSEA 3IG1A 3BGRA 1WSGA 2XY6A 4NCAA 1CZBA 2XY5A 5C42A 4CEFA 1NJXA 4CJSA 4DTJA 1QSYA 3AVAA 1I39A 3L2RA 3K5OA 2BGGA 4IG0A 3U3GA 1KVAA 5I3UA 1BI4A 1KVCA 1UAXA 4CJQA 5KRTA 2YNHA 4CEBA 4JS4A 3SV4A 4PA1A 1WSJA 4PY5A 3E01A 3TR8A 1QQCA 3VQPA 3AV9A 1JLFA 2G8UA 3HYFA 3OS1A 2DFEA 4OKEA 4I7FA 3L3UA 4CIEA 4BE0A 2YKNA 3PX0A 4FJ7A 3D0PA 3B6PA 1RT3A 5J2MA 4LY7A 3DOLA 1C1BA 1UA0A 4FJ8A 1CLQA 1RTDA 1JXBA 4J2BA 2O4IA 1EX4A 1RCHA 3AVNA 1RBTA 4M3RA 2RKIA 1NKEA 1FK9A 4CJFA 2Z1HA 1JKHA 5HRRA 3L2VA 3TAQA 4CJLA 4KHWA 1TKXA 4K8XA 3RRGA 1B9DA 1RBUA 1LV5A 4C8OA 4DS4A 2OZSA 4KKOA 3TAMA 2QK9A 1TGOA 2B4JA 3HPGA 3KKSA 4RW7A 5DK5A 3ZSYA 4CJVA 1NK8A 4E7JA 1WSHA 1KTQA 3DMJA 4NYNA 2D0CA 3AVJA 1Y97A 1HQEA 4E0DA 1TAUA 3LPTA 4CJEA 4IDKA 1RT6A 4CHZA 4G1QA 4N5SA 3HT3A 3SQ0A 4CJKA 4FJ9A 2A1SA 3OS2A 3MEDA 4CGFA 1HNVA 4IBNA 4OGEA 4KI6A 3NGYA 4RW9A 3F9KA 3NF8A 4JRPA 4OLBA 4FJNA 1ZYQA 3VQ5A 1RBRA 4BE2A 3V81A 3RRHA 1RT2A 3OS0A 3QERA 3CG7A 1K6YA 4CK1A 1A5WA 3RMCA 3U6FA 4DG1A 3NF7A 3KLFA 1BHLA 3TANA 1GOCA 3FFIA 4KRFA 3K58A 1S1XA 1TAQA 2LSNA 1B9FA 4N56A 4FLWA 4M3ZA 4CEAA 1REVA 3V9ZA 1SKRA 3LANA 3H08A 3ALYA 2G8VA 4FJKA 4AH9A 1U45A 1Q8IA 3M8RA 3AVFA 4H8KA 2OPQA 3NAEA 4FLVA 3ZSWA 3HPOA 1I3AA 4E1MA 1QS4A 2ZQBA 3MAQA 3DLBA 3AA3A 3VN5A 5HP1A 3NDKA 3CFPA 4DQQA 3HJFA 3ITHA 3T1AA 1L3UA 3KLIA 3VQ6A 5KGXA 1SL1A 3QEIA 3VQBA 1VSEA 3C6UA 4BWJA 4KREA 2HVHA 3KTQA 3SQ1A 3SCXA 4ID5A 2A1RA 4FZYA 3I8DA 1L5UA 3K59A 2IC3A 3P83D 1S9GA 4R5PA 1VRTA 3OYIA 3AO2A 3SQ4A 1RBSA 1CZ9A 2X78A 3OYFA 3KLGA 4DLEA 4DTPA 1T8EA 4ELVA 4J2AA 3ZT3A 3VA3A 4CFCA 4B9MA 4B3OA 1HNIA 3OYMA 4E7IA 4CEEA 4N41A 2F8SA 5E41A 4FJJA 4AHRA 4FJIA 1ASWA 4RW4A 3OJUA 1RTIA 1C0TA 2RPIA 3HSTB 3V6DA 1VSHA 4DQPA 1IKVA 2X6SA 2YV0X 4CCHA 4ELTA 4FJLA 2W42A 1G15A 3VQ7A 3LAMA 3C95A 4KHNA 3QLHA 3QETA 3MXJA 2HHUA 3OYBA 1RT7A 4DTXA 3SUPA 4Z4IA 3IRXA 3QIPA 5EU7A 3KKRA 3TABA 1LWEA 2BE2A 3K5NA 4FZZA 3PY8A 1HPZA 1LWCA 3ZT4A 1X9WA 1LAWA 2X74A 4KTWA 3P1GA 3ZCMA 4DSLA 1VSMA 1U49A 1DTTA 3K57A 3O3HA 4OKKA 4M45A 5FROA 4FM2A 3SNNA 2D0BA 2E6LA 5KGWA 3OYNA 3V9SA 2KFNA 4EZ9A 4DWIA 4CECA 4N47A 3NGZA 2B6AA 1TK8A 3OYKA 3ZSVA 1LW0A 3HVRA 1TKTA 3DLEA 1XI1A 1ZBUA 3QEPA 1FKOA 1U47A 3VA0A 2KQ2A 4NYFA 2OYQA 3TAGA 4KAZA 1RTJA 3VQQA 1TK0A 3RWUA 1J5OA 1S1UA 2E4LA 3ZT2A 2XY7A 4YFUA 4FJ5A 3ZSXA 1XHXA 2EHGA 3KJVA 4DSJA 4HUFA 1RDAA 4HUEA 1KVBA 1RT1A 4CJUA 1C0MA 2YNFA 2BANA 3MEEA 3RMAA 3SPZA 2PYLA 1SKSA 1SKWA 2NUBA 3L8BA 3JYTA 1S5JA 3HP6A 4DTMA 1W9HA 2P5GA 4KV8A 4AHCA 4ZHRA 3K5MA 4KFBA 5C24A 3LZJA 4HTUA 4E3SA 1KLNA 1VRUA 2O4GA 3AVHA 3SPYA 3NGIA 4HUGA 3C94A 1HRHA 1ASVA 3PUFA 4CGGA 4CJTA 4H4OA 5DMRA 1ZBFA 1D9DA 3K5LA 4FLXA 4CE9A 3A2FA 4UQGA 3THVA 3V9XA 1KCFA 3AO1A 5CZ2A 1NK6A 3B6OA 4KTQA 4ELUA 4ZTFA 4AHUA 3EYZA 3NBPA 4FJMA 1BIUA 2VWKA 1NJWA 3MECA 4Z4CA 1WNSA 4B8CA 3CFOA 4DTSA 2FBVA 4QCLA 2G8FA 2DTUA 3LP1A 2HHVA 2G8IA 4B9VA 2AJQA 3U3YA 1EXQA 1Q9YA 3PO5A 3HO1A 1XC9A 4M3WA 4CFBA 1X9SA 5I42A 1RDBA 2P51A 3LDSA 3QNNA 2VG5A 4W5QA 4DTOA 1N6QA 1QE1A 1RDCA 4NCGA 3ZSOA 4FM0A 4I9QA 4M3TA 3ZSZA 2HVIA 1S1WA 1S1TA 1GOBA 3DLRA 4I9LA 5CYQA 3IS9A 3M8QA 3S9HA 3WNHA 2XRIA 3RR7A 1RDDA 5HBMA 1RT5A 1UWBA 2FBXA 4OJRA 1YT3A 4CJRA 3SZ2A 1EETA 3AO5A 2Y1JA 1NK9A 3OYLA 1S6QA 4CF8A 1D9FA 1U04A 3AA5X 3QIOA 3QESA 4B9NA 3DRPA 3VQCA 3AVGA 3G10A 4C8MA 5D3GA 2RF2A 1C6VA 3CFRA 4M3YA 1S1VA 4DSIA 1TL3A 3AVBA 3ASMA 4O55A 4KB1A 2G8WA 3OVNA 5CY4A 5HRSA 4YNQA 1EP4A 3KIOA 5SZTA 1ASUA 3AVCA 2FBYA 4FVMA 1ZBLA 3VQ4A 4DU3A 4FK4A 3RMDA 3UIQA 4E7KA 4KHYA 3P5JA 2KTQA 3M8PA 3V4IA 3DI6A 3HVTA 4DSFA 4PUOA 2VG7A 1YTUA 5JS1A 1EKEA 4OGCA 4E1NA 3DLGA 4DU1A 4DF4A 4E89A 3TAEA 1L3VA 1BCOA 1QTMA 4FLTA 4DFPA 5T7BA 3QINA 1D5AA 2XY8A 1RILA 1IKYA 3HP9A 4MFBA 4CGHA 2PY5A 4KPYA 1SV5A 4J2DA 3CYMA 1B92A 1JLBA 1VSDA 2HHWA 3L2UA 2Z1GA 2G8KA 4LD0A 3K2PA 4FJXA 1C1AA 3DRRA 1VSJA 2WONA 3QNOA 1QSSA 4QOZB 4CERA 4PQUA 2QXFA 3CM6A 2YHAA 1SUQA 2YNGA 1KLMA 4AILC 4F3OA 3TAPA 4BE1A 4F8RA 1U4BA 2HHSA 3AVKA 5J2NA 1TKDA 1NOZA 2ATQA 3QO9A 3NCIA 1J9AA 3AA4A 3HL8A 4BACA 1YTAA 1RNHA 3T19A 3V1OA 2IAJA 2IDOA 3OYGA 3EZ5A 1VSIA 1W0HA 3SUNA 4K8ZA 1BI4B 4DMNA 4O4GA 3WNGA 5J2QA 3DLHA 4FW1A 1IG9A 4F3TA 1CXQA 1QHTA 5HLFA 5CZ1A 4HVJA 4CF1A 1JLAA 1NKBA 4CF0A 2HMIA 1IKXA 4OVLA 4KHUA 3I0SA 3LP3A 1CXUA 3O4NA 3KK1A 3NHGA 4CJPA 3VQAA 4DFMA 3TI0A 4FJHA 4IG3A 1NJYA 2KZMA 3KLEA 4FJGA 4CEOA 3V9UA 1DTQA 2Z1JA 4O5BA 4DFKA 3PV8A 3SV3A 2PZSA 4KB0A 2VG6A 3QEXA 3ULDA 2IS3A 3HK2A 2JLEA 1KSPA 4EZ6A 4JLHA 4F2SA 1BQMA 1VSLA 2YHBA 1QSLA 3NH1A 3OJSA 3G0ZA 4FK2A 4FLUA 3LP0A 4CHYA 1L3TA 4CIGA 2RN2A 4ICLA 3F73A 1L3SA 1JLGA 1GOAA 2JGUA 4I2QA 4JS5A 1UA1A 4Z4FA 4CJ3A 3S3OA 3RR8A 1U48A 2OPRA 1BISA 1XWLA 3NH0A 1J54A 1IO2A 1WAFA 3DOKA 5JS2A 2F96A 4O0IA 3OYCA 4W5TA 3EY1A 3SI6A 2BDPA 3SQ2A 1NK4A 2KZZA 5HRPA 5KRSA 4DTUA 3PX4A 4C8NA 4DF8A 1XHZA 3SUQA 2HB5A 1WSFA 2Z1IA 4FW2A 2IOCA 2B5JA 5FDLA 3OYEA 4O44A 1BL3A 4EP5A 2QKKA 3ZSQA 4AHSA 2KFZA 3LZIA 3OYJA 3TWHA 2HNZA 1JL1A 3VQ9A 3S3NA 4KI4A 2DY4A 4BDYA 1A5VA 1ZBIA 2D5RA 4DQSA 3M8SA 3MXIA 4FLYA 3DYAA 3L2WA 3TARA 1ZBHA 4OLAA 4QAGA 3HXMA 3WNEA 3KK2A 1TL1A 3D45A 1BCMA 4AHVA 4CHNA 1NK7A 4DQIA 1A5XA 2QKBA 4B08A 4CGIA 5CYMA 4PWDA 1IKWA 4CGDA 3TAFA 4OPJA 5K14A 4CJWA 4JRQA 4FCYA 1O1WA 3VQEA 2XHBA 2ETJA 1S6PA 3DM2A 3I0RA 1JL2A 4M3XA 3O3FA 1Z25A 4Y1CA 1SL0A 4Z4HA 5FRMA 3AVLA 2G8HA 3QEWA 1BQNA 1TKZA 4N76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKM A;  3O4Q A;  4B8A B;  3SYZ A;  1HYV A;  3AVI A;  2X6N A;  2OZM A;  3LP2 A;  4E7L A;  4C8K A;  2PYJ A;  4HCB A;  2HHQ A;  3OY9 A;  5J1E A;  4KHS A;  2ZD1 A;  4GW6 A;  1RT4 A;  1HJR A;  4DU4 A;  4BDZ A;  4H4M A;  3ZSR A;  3OYH A;  3CM5 A;  3AO4 A;  3NFA A;  4CFA A;  3KK3 A;  1TK5 A;  4IKF A;  4DS5 A;  4M41 A;  3L3V A;  1KFS A;  3LPU A;  1C1C A;  1LW2 A;  2HHT A;  1TVR A;  1VK0 A;  3OYA A;  1VSK A;  1SL2 A;  3MXM A;  4F4K A;  2KW4 A;  4M3U A;  4Y1D A;  2E6M A;  4AHT A;  1KRP A;  4LH4 A;  1HMV A;  4O0J A;  4CEZ A;  3ZT1 A;  4LH5 A;  2DFH A;  4CF9 A;  4CED A;  4LSL A;  2HW3 A;  1HYZ A;  2HND A;  2Q3S A;  3AVM A;  3WNF A;  1BIZ A;  3ZT0 A;  3RTV A;  3LAK A;  1DLO A;  1FKP A;  2Y1I A;  4IFV A;  2HHX A;  4OPK A;  1HQU A;  4KTZ A;  1NJZ A;  1D8Y A;  2YNI A;  2GBZ A;  3PX6 A;  4C8L A;  2VWJ A;  4CJ5 A;  4Z0U A;  4RW8 A;  5C25 A;  3DRS A;  1WN7 A;  1J53 A;  5SWM A;  4DTR A;  3VQD A;  3VQ8 A;  3C6T A;  1YVU A;  1WSI A;  3CQ8 A;  1LAV A;  4CHP A;  3NF6 A;  3KD1 E;  1HYS A;  4W5N A;  2ITG A;  1ITG A;  4CFD A;  4B9L A;  4W5R A;  4DSE A;  4Q5V A;  2R7Y A;  1VSF A;  3AO3 A;  3QEV A;  2F8T A;  1WLJ A;  1WAJ A;  3L2Q A;  2FC0 A;  1BGX T;  2HNY A;  2GV9 A;  1NKC A;  4BDP A;  2D0A A;  3NH2 A;  4EP4 A;  4NCB A;  3PO4 A;  3S3M A;  4DSK A;  4FLZ A;  4E19 A;  4CHQ A;  2FBT A;  4LSN A;  5KTQ A;  4ZTJ A;  1X9M A;  4GMJ B;  1T03 A;  1R0A A;  4FZX C;  3SUO A;  1JLE A;  4XIU A;  3HPH A;  4CIF A;  4W5O A;  5HRO A;  4J2E A;  4CHO A;  3LAL A;  4DFJ A;  4CES A;  1T05 A;  4KO0 A;  2OA8 A;  4GVM A;  2OPP A;  2P1J A;  1TV6 A;  5KI6 A;  1MU2 A;  3V9W A;  1NOY A;  4B9T A;  4FYD A;  2DFF A;  1S9E A;  1KFD A;  4FM1 A;  3RMB A;  5J2P A;  4RG8 A;  4BWM A;  4Z4E A;  4F2R A;  4B9U A;  2I5J A;  5HRN A;  3AA2 A;  4WE1 A;  2WOM A;  2XO7 A;  4CJ4 A;  3HM9 A;  3DLK A;  1RBV A;  4CK2 A;  1LWF A;  1X1P A;  3V1Q A;  1IH7 A;  4MQ3 A;  2GUI A;  3JSM A;  4B9S A;  4OKJ A;  1C0U A;  1UOC A;  3KD5 E;  1FXX A;  3IAY A;  3MEG A;  3NF9 A;  1N5Y A;  4E7H A;  4RW6 A;  2ZE2 A;  3V1R A;  1Q9X A;  4IFY A;  1F21 A;  1JXE A;  4DTN A;  4CGJ A;  4FXD A;  3NE6 A;  3LWL A;  1Z26 A;  4Q0B A;  3KLH A;  4L8R B;  4KHQ A;  5FRN A;  3T3F A;  4Z4G A;  3O3G A;  3OYD A;  3SJJ A;  2EX3 A;  1JLC A;  4CF2 A;  4FK0 A;  1RTH A;  2OPS A;  1NK0 A;  3BDP A;  4DQR A;  4I2P A;  4TSX A;  3LWM A;  4HCC A;  4ID1 A;  4CEQ A;  4CK3 A;  1T7P A;  2P5O A;  4DLG A;  3ISN C;  4HHT A;  1NK5 A;  2IGI A;  4M42 A;  1JLQ A;  1WSE A;  3IG1 A;  3BGR A;  1WSG A;  2XY6 A;  4NCA A;  1CZB A;  2XY5 A;  5C42 A;  4CEF A;  1NJX A;  4CJS A;  4DTJ A;  1QSY A;  3AVA A;  1I39 A;  3L2R A;  3K5O A;  2BGG A;  4IG0 A;  3U3G A;  1KVA A;  5I3U A;  1BI4 A;  1KVC A;  1UAX A;  4CJQ A;  5KRT A;  2YNH A;  4CEB A;  4JS4 A;  3SV4 A;  4PA1 A;  1WSJ A;  4PY5 A;  3E01 A;  3TR8 A;  1QQC A;  3VQP A;  3AV9 A;  1JLF A;  2G8U A;  3HYF A;  3OS1 A;  2DFE A;  4OKE A;  4I7F A;  3L3U A;  4CIE A;  4BE0 A;  2YKN A;  3PX0 A;  4FJ7 A;  3D0P A;  3B6P A;  1RT3 A;  5J2M A;  4LY7 A;  3DOL A;  1C1B A;  1UA0 A;  4FJ8 A;  1CLQ A;  1RTD A;  1JXB A;  4J2B A;  2O4I A;  1EX4 A;  1RCH A;  3AVN A;  1RBT A;  4M3R A;  2RKI A;  1NKE A;  1FK9 A;  4CJF A;  2Z1H A;  1JKH A;  5HRR A;  3L2V A;  3TAQ A;  4CJL A;  4KHW A;  1TKX A;  4K8X A;  3RRG A;  1B9D A;  1RBU A;  1LV5 A;  4C8O A;  4DS4 A;  2OZS A;  4KKO A;  3TAM A;  2QK9 A;  1TGO A;  2B4J A;  3HPG A;  3KKS A;  4RW7 A;  5DK5 A;  3ZSY A;  4CJV A;  1NK8 A;  4E7J A;  1WSH A;  1KTQ A;  3DMJ A;  4NYN A;  2D0C A;  3AVJ A;  1Y97 A;  1HQE A;  4E0D A;  1TAU A;  3LPT A;  4CJE A;  4IDK A;  1RT6 A;  4CHZ A;  4G1Q A;  4N5S A;  3HT3 A;  3SQ0 A;  4CJK A;  4FJ9 A;  2A1S A;  3OS2 A;  3MED A;  4CGF A;  1HNV A;  4IBN A;  4OGE A;  4KI6 A;  3NGY A;  4RW9 A;  3F9K A;  3NF8 A;  4JRP A;  4OLB A;  4FJN A;  1ZYQ A;  3VQ5 A;  1RBR A;  4BE2 A;  3V81 A;  3RRH A;  1RT2 A;  3OS0 A;  3QER A;  3CG7 A;  1K6Y A;  4CK1 A;  1A5W A;  3RMC A;  3U6F A;  4DG1 A;  3NF7 A;  3KLF A;  1BHL A;  3TAN A;  1GOC A;  3FFI A;  4KRF A;  3K58 A;  1S1X A;  1TAQ A;  2LSN A;  1B9F A;  4N56 A;  4FLW A;  4M3Z A;  4CEA A;  1REV A;  3V9Z A;  1SKR A;  3LAN A;  3H08 A;  3ALY A;  2G8V A;  4FJK A;  4AH9 A;  1U45 A;  1Q8I A;  3M8R A;  3AVF A;  4H8K A;  2OPQ A;  3NAE A;  4FLV A;  3ZSW A;  3HPO A;  1I3A A;  4E1M A;  1QS4 A;  2ZQB A;  3MAQ A;  3DLB A;  3AA3 A;  3VN5 A;  5HP1 A;  3NDK A;  3CFP A;  4DQQ A;  3HJF A;  3ITH A;  3T1A A;  1L3U A;  3KLI A;  3VQ6 A;  5KGX A;  1SL1 A;  3QEI A;  3VQB A;  1VSE A;  3C6U A;  4BWJ A;  4KRE A;  2HVH A;  3KTQ A;  3SQ1 A;  3SCX A;  4ID5 A;  2A1R A;  4FZY A;  3I8D A;  1L5U A;  3K59 A;  2IC3 A;  3P83 D;  1S9G A;  4R5P A;  1VRT A;  3OYI A;  3AO2 A;  3SQ4 A;  1RBS A;  1CZ9 A;  2X78 A;  3OYF A;  3KLG A;  4DLE A;  4DTP A;  1T8E A;  4ELV A;  4J2A A;  3ZT3 A;  3VA3 A;  4CFC A;  4B9M A;  4B3O A;  1HNI A;  3OYM A;  4E7I A;  4CEE A;  4N41 A;  2F8S A;  5E41 A;  4FJJ A;  4AHR A;  4FJI A;  1ASW A;  4RW4 A;  3OJU A;  1RTI A;  1C0T A;  2RPI A;  3HST B;  3V6D A;  1VSH A;  4DQP A;  1IKV A;  2X6S A;  2YV0 X;  4CCH A;  4ELT A;  4FJL A;  2W42 A;  1G15 A;  3VQ7 A;  3LAM A;  3C95 A;  4KHN A;  3QLH A;  3QET A;  3MXJ A;  2HHU A;  3OYB A;  1RT7 A;  4DTX A;  3SUP A;  4Z4I A;  3IRX A;  3QIP A;  5EU7 A;  3KKR A;  3TAB A;  1LWE A;  2BE2 A;  3K5N A;  4FZZ A;  3PY8 A;  1HPZ A;  1LWC A;  3ZT4 A;  1X9W A;  1LAW A;  2X74 A;  4KTW A;  3P1G A;  3ZCM A;  4DSL A;  1VSM A;  1U49 A;  1DTT A;  3K57 A;  3O3H A;  4OKK A;  4M45 A;  5FRO A;  4FM2 A;  3SNN A;  2D0B A;  2E6L A;  5KGW A;  3OYN A;  3V9S A;  2KFN A;  4EZ9 A;  4DWI A;  4CEC A;  4N47 A;  3NGZ A;  2B6A A;  1TK8 A;  3OYK A;  3ZSV A;  1LW0 A;  3HVR A;  1TKT A;  3DLE A;  1XI1 A;  1ZBU A;  3QEP A;  1FKO A;  1U47 A;  3VA0 A;  2KQ2 A;  4NYF A;  2OYQ A;  3TAG A;  4KAZ A;  1RTJ A;  3VQQ A;  1TK0 A;  3RWU A;  1J5O A;  1S1U A;  2E4L A;  3ZT2 A;  2XY7 A;  4YFU A;  4FJ5 A;  3ZSX A;  1XHX A;  2EHG A;  3KJV A;  4DSJ A;  4HUF A;  1RDA A;  4HUE A;  1KVB A;  1RT1 A;  4CJU A;  1C0M A;  2YNF A;  2BAN A;  3MEE A;  3RMA A;  3SPZ A;  2PYL A;  1SKS A;  1SKW A;  2NUB A;  3L8B A;  3JYT A;  1S5J A;  3HP6 A;  4DTM A;  1W9H A;  2P5G A;  4KV8 A;  4AHC A;  4ZHR A;  3K5M A;  4KFB A;  5C24 A;  3LZJ A;  4HTU A;  4E3S A;  1KLN A;  1VRU A;  2O4G A;  3AVH A;  3SPY A;  3NGI A;  4HUG A;  3C94 A;  1HRH A;  1ASV A;  3PUF A;  4CGG A;  4CJT A;  4H4O A;  5DMR A;  1ZBF A;  1D9D A;  3K5L A;  4FLX A;  4CE9 A;  3A2F A;  4UQG A;  3THV A;  3V9X A;  1KCF A;  3AO1 A;  5CZ2 A;  1NK6 A;  3B6O A;  4KTQ A;  4ELU A;  4ZTF A;  4AHU A;  3EYZ A;  3NBP A;  4FJM A;  1BIU A;  2VWK A;  1NJW A;  3MEC A;  4Z4C A;  1WNS A;  4B8C A;  3CFO A;  4DTS A;  2FBV A;  4QCL A;  2G8F A;  2DTU A;  3LP1 A;  2HHV A;  2G8I A;  4B9V A;  2AJQ A;  3U3Y A;  1EXQ A;  1Q9Y A;  3PO5 A;  3HO1 A;  1XC9 A;  4M3W A;  4CFB A;  1X9S A;  5I42 A;  1RDB A;  2P51 A;  3LDS A;  3QNN A;  2VG5 A;  4W5Q A;  4DTO A;  1N6Q A;  1QE1 A;  1RDC A;  4NCG A;  3ZSO A;  4FM0 A;  4I9Q A;  4M3T A;  3ZSZ A;  2HVI A;  1S1W A;  1S1T A;  1GOB A;  3DLR A;  4I9L A;  5CYQ A;  3IS9 A;  3M8Q A;  3S9H A;  3WNH A;  2XRI A;  3RR7 A;  1RDD A;  5HBM A;  1RT5 A;  1UWB A;  2FBX A;  4OJR A;  1YT3 A;  4CJR A;  3SZ2 A;  1EET A;  3AO5 A;  2Y1J A;  1NK9 A;  3OYL A;  1S6Q A;  4CF8 A;  1D9F A;  1U04 A;  3AA5 X;  3QIO A;  3QES A;  4B9N A;  3DRP A;  3VQC A;  3AVG A;  3G10 A;  4C8M A;  5D3G A;  2RF2 A;  1C6V A;  3CFR A;  4M3Y A;  1S1V A;  4DSI A;  1TL3 A;  3AVB A;  3ASM A;  4O55 A;  4KB1 A;  2G8W A;  3OVN A;  5CY4 A;  5HRS A;  4YNQ A;  1EP4 A;  3KIO A;  5SZT A;  1ASU A;  3AVC A;  2FBY A;  4FVM A;  1ZBL A;  3VQ4 A;  4DU3 A;  4FK4 A;  3RMD A;  3UIQ A;  4E7K A;  4KHY A;  3P5J A;  2KTQ A;  3M8P A;  3V4I A;  3DI6 A;  3HVT A;  4DSF A;  4PUO A;  2VG7 A;  1YTU A;  5JS1 A;  1EKE A;  4OGC A;  4E1N A;  3DLG A;  4DU1 A;  4DF4 A;  4E89 A;  3TAE A;  1L3V A;  1BCO A;  1QTM A;  4FLT A;  4DFP A;  5T7B A;  3QIN A;  1D5A A;  2XY8 A;  1RIL A;  1IKY A;  3HP9 A;  4MFB A;  4CGH A;  2PY5 A;  4KPY A;  1SV5 A;  4J2D A;  3CYM A;  1B92 A;  1JLB A;  1VSD A;  2HHW A;  3L2U A;  2Z1G A;  2G8K A;  4LD0 A;  3K2P A;  4FJX A;  1C1A A;  3DRR A;  1VSJ A;  2WON A;  3QNO A;  1QSS A;  4QOZ B;  4CER A;  4PQU A;  2QXF A;  3CM6 A;  2YHA A;  1SUQ A;  2YNG A;  1KLM A;  4AIL C;  4F3O A;  3TAP A;  4BE1 A;  4F8R A;  1U4B A;  2HHS A;  3AVK A;  5J2N A;  1TKD A;  1NOZ A;  2ATQ A;  3QO9 A;  3NCI A;  1J9A A;  3AA4 A;  3HL8 A;  4BAC A;  1YTA A;  1RNH A;  3T19 A;  3V1O A;  2IAJ A;  2IDO A;  3OYG A;  3EZ5 A;  1VSI A;  1W0H A;  3SUN A;  4K8Z A;  1BI4 B;  4DMN A;  4O4G A;  3WNG A;  5J2Q A;  3DLH A;  4FW1 A;  1IG9 A;  4F3T A;  1CXQ A;  1QHT A;  5HLF A;  5CZ1 A;  4HVJ A;  4CF1 A;  1JLA A;  1NKB A;  4CF0 A;  2HMI A;  1IKX A;  4OVL A;  4KHU A;  3I0S A;  3LP3 A;  1CXU A;  3O4N A;  3KK1 A;  3NHG A;  4CJP A;  3VQA A;  4DFM A;  3TI0 A;  4FJH A;  4IG3 A;  1NJY A;  2KZM A;  3KLE A;  4FJG A;  4CEO A;  3V9U A;  1DTQ A;  2Z1J A;  4O5B A;  4DFK A;  3PV8 A;  3SV3 A;  2PZS A;  4KB0 A;  2VG6 A;  3QEX A;  3ULD A;  2IS3 A;  3HK2 A;  2JLE A;  1KSP A;  4EZ6 A;  4JLH A;  4F2S A;  1BQM A;  1VSL A;  2YHB A;  1QSL A;  3NH1 A;  3OJS A;  3G0Z A;  4FK2 A;  4FLU A;  3LP0 A;  4CHY A;  1L3T A;  4CIG A;  2RN2 A;  4ICL A;  3F73 A;  1L3S A;  1JLG A;  1GOA A;  2JGU A;  4I2Q A;  4JS5 A;  1UA1 A;  4Z4F A;  4CJ3 A;  3S3O A;  3RR8 A;  1U48 A;  2OPR A;  1BIS A;  1XWL A;  3NH0 A;  1J54 A;  1IO2 A;  1WAF A;  3DOK A;  5JS2 A;  2F96 A;  4O0I A;  3OYC A;  4W5T A;  3EY1 A;  3SI6 A;  2BDP A;  3SQ2 A;  1NK4 A;  2KZZ A;  5HRP A;  5KRS A;  4DTU A;  3PX4 A;  4C8N A;  4DF8 A;  1XHZ A;  3SUQ A;  2HB5 A;  1WSF A;  2Z1I A;  4FW2 A;  2IOC A;  2B5J A;  5FDL A;  3OYE A;  4O44 A;  1BL3 A;  4EP5 A;  2QKK A;  3ZSQ A;  4AHS A;  2KFZ A;  3LZI A;  3OYJ A;  3TWH A;  2HNZ A;  1JL1 A;  3VQ9 A;  3S3N A;  4KI4 A;  2DY4 A;  4BDY A;  1A5V A;  1ZBI A;  2D5R A;  4DQS A;  3M8S A;  3MXI A;  4FLY A;  3DYA A;  3L2W A;  3TAR A;  1ZBH A;  4OLA A;  4QAG A;  3HXM A;  3WNE A;  3KK2 A;  1TL1 A;  3D45 A;  1BCM A;  4AHV A;  4CHN A;  1NK7 A;  4DQI A;  1A5X A;  2QKB A;  4B08 A;  4CGI A;  5CYM A;  4PWD A;  1IKW A;  4CGD A;  3TAF A;  4OPJ A;  5K14 A;  4CJW A;  4JRQ A;  4FCY A;  1O1W A;  3VQE A;  2XHB A;  2ETJ A;  1S6P A;  3DM2 A;  3I0R A;  1JL2 A;  4M3X A;  3O3F A;  1Z25 A;  4Y1C A;  1SL0 A;  4Z4H A;  5FRM A;  3AVL A;  2G8H A;  3QEW A;  1BQN A;  1TKZ A;  4N76 A; 
#chains in the Genus database with same CATH topology
 3JAM O;  4B8A B;  3CC2 N;  4FWN A;  2OZM A;  2QWR A;  2KLA A;  1HJR A;  4B1W B;  3FZL A;  4I6M B;  1TK5 A;  4CZJ A;  2I7P A;  2OAN A;  1TVR A;  5ADX H;  1VSK A;  2E6M A;  2ZJQ L;  2DFH A;  4BR4 A;  3FZF A;  3CCM N;  2HND A;  2QTD A;  4JKG B;  3AVM A;  3ZX3 A;  1DEJ A;  1TYQ B;  2FXU A;  3ENO A;  4C23 A;  4BG9 A;  3LAK A;  5KPZ A;  1DLO A;  4LF6 K;  2HHX A;  1HQU A;  4KTZ A;  1D8Y A;  2YNI A;  2GBZ A;  3R9P A;  3PX6 A;  2VWJ A;  4IWV A;  3JXU A;  3G71 N;  4JKC A;  1LAV A;  4JHD A;  3KD1 E;  1LCU A;  1VSF A;  2KHO A;  4O8K A;  2F8T A;  4JK8 A;  3D7E O;  3WXL A;  3S3M A;  3QB0 A;  4E19 A;  4AQY K;  3CJB A;  4IZ9 A;  4YOW A;  4FZX C;  1JLE A;  4XIU A;  5HRO A;  3SBG A;  3LAL A;  4DFJ A;  2NRW A;  1T05 A;  4CJ7 A;  4KO0 A;  1LOT B;  3V9W A;  2P1J A;  5KI6 A;  2RHK A;  1MU2 A;  1NOY A;  1Y64 A;  1XQS C;  4B9U A;  5HRN A;  1RBV A;  1YJW N;  3Q7B A;  1OH8 A;  1X1P A;  3V1Q A;  4DR4 K;  1VAZ A;  2EWS A;  1Q18 A;  3FLC O;  1UOC A;  3KD5 E;  3IDH A;  3QML A;  2W40 A;  1YUW A;  3H3N O;  1JXE A;  3E9P A;  4CGJ A;  2UUC K;  1Z26 A;  2GX9 A;  4Q0B A;  2YCH A;  4K42 A;  4Z4G A;  2KKZ A;  4FWQ A;  3SJJ A;  4CF2 A;  1JLC A;  1NK0 A;  3J80 O;  1T7P A;  5AZI A;  4DLG A;  3AGK A;  2GWK A;  4JK9 A;  1BOT O;  3IG1 A;  2XY5 A;  1C0G A;  1VQ6 N;  4CEF A;  3PSF A;  3AVA A;  3L2R A;  3K5O A;  2BGG A;  1GLA G;  5LL6 Z;  2ZJR L;  1H1V A;  4WQ5 A;  3CCS N;  2G8U A;  3HYF A;  1N36 K;  3AGR A;  1NGD A;  3WXI A;  4CIE A;  2YKN A;  3D0P A;  4H0Y B;  4LY7 A;  4CBW A;  3OW2 M;  2F7T A;  1JXB A;  4J2B A;  1E4F T;  5GAE P;  1JJ2 M;  3RRG A;  1B9D A;  2PAV A;  4C8O A;  3O9U A;  2QK9 A;  1TGO A;  1RGI A;  4WFB L;  2HF4 A;  3DMJ A;  1MWK A;  4NYN A;  4BC4 A;  3VMF B;  1Y97 A;  1NG9 A;  3LDO A;  4LF8 K;  3QIC A;  4BRM A;  3LPT A;  4CJE A;  4G1Q A;  3SQ0 A;  2E1Z A;  5AQL A;  3OS2 A;  4CGF A;  4KI6 A;  3NGY A;  4RW9 A;  3SBT A;  3NF8 A;  3CC4 N;  2NRT A;  3VQ5 A;  5KQD A;  4BE2 A;  1U2V A;  3FFK B;  1VHX A;  1A5W A;  5JIC A;  3RMC A;  3U6F A;  4LF5 K;  2NZT A;  3K58 A;  4FO0 A;  4CZL A;  4DQ8 A;  1B9F A;  2WFB A;  1X3M A;  2CGK A;  1Q8I A;  3Q7C A;  4H8K A;  4WCE L;  3M8R A;  1HNZ K;  5ELZ A;  1ILY A;  3MAQ A;  3DLB A;  3CFP A;  2UYT A;  5LMN K;  4BWJ A;  4BRA A;  3KTQ A;  4JI6 K;  1IJJ A;  3SQ1 A;  3SCX A;  4ID5 A;  3I8D A;  3P83 D;  4U67 L;  2UUB K;  1E3M A;  2BH1 A;  3SQ4 A;  1SS6 A;  3HZ6 A;  5JVH L;  3ZT3 A;  3VA3 A;  2JWL A;  3QFU A;  4DR7 K;  4N41 A;  2P9U B;  5EXW A;  5E41 A;  1EWQ A;  3CCU N;  1VSH A;  2UUA K;  2YV0 X;  4GNI A;  3O9R A;  3VQ7 A;  3MXJ A;  2HHU A;  1BO5 O;  3I56 N;  3IRX A;  2RE2 A;  5EU7 A;  4FZZ A;  3EEQ A;  1KAZ A;  3PY8 A;  1KD1 O;  4JI0 K;  3K9J A;  4KTW A;  3P1G A;  4DV3 K;  1DTT A;  3O3H A;  4M45 A;  3OYN A;  3V9S A;  3A0I X;  1BU6 O;  3THX B;  1TK8 A;  1X9J A;  3DLE A;  4NLB A;  3CCE N;  4GVE A;  3TAG A;  1OH6 A;  5AZJ B;  4YFU A;  1RDA A;  1XNR K;  1RT1 A;  4LFC K;  4CJU A;  2BAN A;  5GIO A;  1SKS A;  1SKW A;  3L8B A;  3LDP A;  3THY B;  4H0V B;  1P8Z A;  4UY8 O;  3CME N;  3DXM B;  4E3S A;  1KLN A;  2O4G A;  4FWO A;  3SPY A;  1ASV A;  1KC8 O;  3PUF A;  2VQF K;  2A40 A;  1ZBF A;  5A2Q O;  5CZ2 A;  1NK6 A;  3KHY A;  4AHU A;  4PKG A;  1XC3 A;  1WNS A;  2FBV A;  4QCL A;  4DV0 K;  4AF1 A;  3SK3 A;  2Q1N A;  1I94 K;  4CZG A;  2AJQ A;  3O4W A;  4IOX A;  4NLC A;  5I42 A;  1RDB A;  1N6Q A;  4A59 A;  4W5Q A;  4DTO A;  2FF3 B;  4FM0 A;  1S1W A;  1GOB A;  4I9L A;  3IS9 A;  3M8Q A;  5BN8 A;  3WNH A;  2XRI A;  3WXM B;  4M7Y A;  4DV4 K;  4JHD B;  4B9Q A;  3OYL A;  1S6Q A;  4B9N A;  1NLV A;  5AQP A;  3RSE A;  1K8K A;  3AVG A;  5AQH A;  4BRP A;  2NRV A;  3CFR A;  4M3Y A;  4DSI A;  3OVN A;  1NGH A;  2FBY A;  2A6A A;  3UIQ A;  2KTQ A;  3V4I A;  4DUZ K;  3HI0 A;  4E1N A;  3DLG A;  1IBM K;  3TAE A;  4E89 A;  5T7B A;  3QIN A;  1RIL A;  1IKY A;  2IIR A;  5EVZ A;  4CGH A;  2PY5 A;  4FL9 A;  4J2D A;  4NB4 A;  2Z1G A;  2G8K A;  3K2P A;  1C1A A;  3DRR A;  4BR9 A;  2WON A;  4DCH A;  3QNO A;  4WQ4 C;  3A5L C;  3CM6 A;  3GOI A;  2HBL A;  3CJ1 A;  4F8R A;  4B3R K;  3QDK A;  1U4B A;  3ENH A;  4B1Z A;  1NOZ A;  3HL8 A;  1JCG A;  1RNH A;  3EZ5 A;  1W0H A;  3MCA B;  1BI4 B;  5J2Q A;  2UXD K;  1IG9 A;  4F3T A;  5HLF A;  1ATR A;  4HVJ A;  4OVL A;  3AAP A;  3NHG A;  4CJP A;  4BRO A;  2KZM A;  4FJG A;  4KH5 A;  3V9U A;  1DTQ A;  2Z1J A;  3TSU A;  4IXC A;  2IS3 A;  5BRE A;  3HK2 A;  2JLE A;  1KSP A;  1BQM A;  1VSL A;  2YHB A;  1P90 A;  3WQT A;  1L3T A;  4YDU C;  2JGU A;  4I2Q A;  1UA1 A;  4MLH A;  1QVG M;  3DOK A;  2BDP A;  4W5T A;  2IOC A;  3L4Q A;  4H03 B;  5FDL A;  3THY A;  4OPA A;  3H45 C;  1BL3 A;  3ZSQ A;  4AHS A;  2KFZ A;  3S3N A;  2O8C A;  4KI4 A;  3C6H A;  1A5V A;  3FE1 A;  1S22 A;  3LDQ A;  4B3S K;  3MXI A;  1ZBH A;  3L2W A;  5CR4 A;  4H0P A;  3HXM A;  3KK2 A;  4AHV A;  1BCM A;  4DUY K;  1NK7 A;  4DQI A;  4BQZ A;  4B08 A;  4CGI A;  3TAF A;  3O8M A;  2Q97 A;  5K14 A;  3OTO K;  2ZWH A;  4FCY A;  3KZB A;  1JL2 A;  4M3X A;  4Y1C A;  5H1S Q;  4DV2 K;  3QEW A;  1K8A O;  2YKM A;  3O4Q A;  3SYZ A;  4JYA K;  1N33 K;  4E7L A;  4C8K A;  4GW6 A;  1HUX A;  4BRN A;  3ZSR A;  3CM5 A;  4IKF A;  4BGB A;  4DS5 A;  1LW2 A;  2HHT A;  1RFQ A;  1VK0 A;  3BZK A;  5DM7 L;  3MXM A;  4Y1D A;  1KRP A;  4FOE A;  3FZM A;  2NLX A;  3MDQ A;  3MX2 A;  3THW B;  4CF9 A;  5AQI A;  4LSL A;  4PKH A;  3ZX0 A;  3I8B A;  2VGN A;  4BRH A;  2Q3S A;  4BRG A;  3WNF A;  1BIZ A;  2Y1I A;  2E2P A;  3VGM A;  4OX9 K;  1VQM N;  4Z0U A;  3DRS A;  1J53 A;  4YDU A;  3DXK A;  2ZM6 K;  1K73 O;  4CHP A;  3NF6 A;  5JMV A;  1HYS A;  2ITG A;  4DSE A;  1YJ9 N;  4Q5V A;  3AO3 A;  2QWM A;  4GY2 B;  3H1Q A;  3L2Q A;  3CPW M;  2FC0 A;  2GV9 A;  1DT9 A;  4BDP A;  4NCB A;  3NH2 A;  1BUP A;  4EP4 A;  3PO4 A;  5BRH A;  1NMN A;  4CHQ A;  3WEE B;  1X9M A;  5KTQ A;  4H5R A;  1R0A A;  3SUO A;  4BQL A;  4J2E A;  1SAZ A;  4K25 A;  4LF9 K;  4CHO A;  2P9N B;  5LJW A;  4DR1 K;  2OA8 A;  1ATS A;  4GVM A;  1TV6 A;  4FYD A;  4OPH A;  4FM1 A;  3RMB A;  5J2P A;  4RG8 A;  4BWM A;  3A8Y A;  5BPN A;  3U9D A;  4F2R A;  4A61 A;  2I5J A;  3TTF A;  2E1Y A;  2WOM A;  2XO7 A;  3HM9 A;  5C12 A;  3O08 A;  4CK2 A;  1GLL O;  4DV7 K;  1FXX A;  3MEG A;  3NF9 A;  1N5Y A;  2ZE2 A;  3CC7 N;  3V1R A;  3VEY A;  2YHX A;  3MN5 A;  3ATU A;  2YHW A;  3MCP A;  1D4X A;  4I2P A;  3LWM A;  4ID1 A;  1NGE A;  4HHT A;  1JLQ A;  1WSE A;  4IOC L;  4NCA A;  2JWK A;  5C42 A;  4CJS A;  1VQP N;  3U3G A;  4BRF A;  1BI4 A;  3CJ7 A;  2YNH A;  3DAW A;  4JS4 A;  5EX5 A;  3VEZ A;  3SJH A;  3TR8 A;  3VQP A;  3DXM A;  3MN7 A;  2DFE A;  4OKE A;  2GUP A;  4I7F A;  3WXJ A;  3L3U A;  4BE0 A;  3PX0 A;  5C10 A;  4JI4 K;  4M7X A;  5J2M A;  1CLQ A;  5TKY A;  1N8R O;  2GTD A;  1RCH A;  1NKE A;  3L4I A;  4PKI A;  4M3R A;  4CJF A;  2Z1H A;  3BZC A;  5HRR A;  5M1K A;  3WQU A;  4CJL A;  4EIA A;  4KHW A;  4IJA A;  4BGA A;  3ZET B;  1LV5 A;  3TTD A;  1XMO K;  1BDG A;  2FSJ A;  4KKO A;  2BUP A;  4RW7 A;  2B4J A;  1Z6R A;  2YX6 A;  3HPG A;  5DK5 A;  4CJV A;  1KTQ A;  2D0C A;  3AVJ A;  3F2K A;  1HQE A;  1YI2 N;  1TAU A;  3RVC A;  4IDK A;  3L0Q A;  3HT3 A;  4CJK A;  3MED A;  5BR9 A;  4DR3 K;  4DG1 A;  3T1Y K;  1BHL A;  3CET A;  4H0O A;  5BN9 A;  4JNE A;  1NGF A;  4M3Z A;  1REV A;  3V9Z A;  2HST A;  3HRG A;  3O9T A;  1U45 A;  4QS9 A;  3NAE A;  4E1M A;  3VN5 A;  3KLI A;  3VQ6 A;  1OH5 A;  4KHP K;  2A3Z A;  3QEI A;  4KRE A;  3O5B A;  4FZY A;  4BRK A;  2O8B A;  4R5P A;  1VRT A;  2O8C B;  1CZ9 A;  2X78 A;  3A5N C;  1T8E A;  4J2A A;  3VTH A;  4B3O A;  4H5V A;  1GLJ O;  1HNI A;  1NU0 A;  3OYM A;  1VQ9 N;  2GEL A;  4E7I A;  4A5A A;  3CQX A;  4EFH A;  4FPB A;  4I6M A;  1NWK A;  3HST B;  1WB9 A;  1IKV A;  4K41 A;  2W42 A;  4CZF A;  4JKA A;  3C95 A;  4CW7 B;  3QLH A;  3QET A;  3OYB A;  1RT7 A;  3SUP A;  2VGM A;  2VWB A;  5ADX A;  3KKR A;  2YHY A;  1VQN N;  4X64 K;  1HPZ A;  3ZT4 A;  1X9W A;  3SMS A;  1G99 A;  3LDN A;  3ZCM A;  4DSL A;  1VSM A;  2Q0U A;  2YI1 A;  4FM2 A;  1IBL K;  5FRO A;  2D0B A;  5KGW A;  4DWI A;  5LMU K;  5M1N A;  5GAH P;  4N47 A;  1XI1 A;  3MK6 A;  3GL1 A;  3ZSV A;  5C15 A;  4OO1 J;  4GKK K;  3QEP A;  1FKO A;  2KQ2 A;  4LFA K;  1RTJ A;  3RWU A;  2PFU A;  4LF4 K;  4CZE A;  2XY7 A;  5FPN A;  3C0B A;  1U6Z A;  3AAR A;  4B1X B;  3VGK A;  1NNE A;  4DTM A;  3LZJ A;  1YHQ N;  3DJC A;  1VRU A;  3C94 A;  1HRH A;  2D1K A;  4DV5 K;  4CGG A;  4H4O A;  5DMR A;  4CE9 A;  2HF3 A;  1BIU A;  2VWK A;  1NJW A;  3MEC A;  3THX A;  4DTS A;  3KVG A;  2G8F A;  1YIJ N;  4ILH A;  4AM6 A;  4C1N I;  2G8I A;  3HO1 A;  4ISE A;  4ISF A;  4O8U A;  3LDS A;  1QE1 A;  1YF5 L;  3ZSZ A;  1S1T A;  5CYQ A;  3M5R A;  3QBW A;  2Y1J A;  2HHH K;  3SZ2 A;  3AO5 A;  4KH4 A;  4QS8 A;  3VEW A;  1U04 A;  3QIO A;  2UXC K;  3VQC A;  3T69 A;  1JCF A;  4C8M A;  5D3G A;  1MDU B;  1WOQ A;  1C6V A;  2O8D B;  1S1V A;  4O55 A;  4KB1 A;  2G8W A;  5CY4 A;  1EP4 A;  3KIO A;  3VPZ A;  4JV5 K;  2O8F A;  3UE5 A;  5HL7 L;  4FVM A;  3PLA A;  3VQ4 A;  4FK4 A;  3RMD A;  3TU5 A;  1BG3 A;  3P5J A;  3M8P A;  3DI6 A;  3HVT A;  4DSF A;  4PUO A;  2VG7 A;  1YTU A;  5JS1 A;  3VEO A;  4ILJ A;  4DF4 A;  4WFA L;  3R6M A;  5C2F A;  4NO7 A;  1BCO A;  3HSC A;  2P9K B;  3BF1 A;  4FLT A;  4GKJ K;  1D5A A;  1CZA N;  4CZM A;  1VSD A;  1B92 A;  5C0Y A;  1KAY A;  5AQO A;  3P4I A;  2QXF A;  2YHA A;  1SUQ A;  2YNG A;  4F3O A;  3TAP A;  2HHS A;  3AVK A;  3QO9 A;  4BRQ A;  3T19 A;  3J8A A;  1ZBS A;  4X62 K;  4DMN A;  5M1Q A;  3WNG A;  4MO4 A;  2W6L A;  1QHT A;  5CZ1 A;  2UXB K;  1NKB A;  2HMI A;  1IKX A;  3TI0 A;  4LFB K;  4FJH A;  1NJY A;  3WUH A;  3KLE A;  2ZGZ A;  2P9N A;  4KB0 A;  2VG6 A;  1XNQ K;  2QWL A;  3ZET A;  3ULD A;  4BY9 C;  4JLH A;  4F2S A;  3OJS A;  3VF4 A;  4CIG A;  3F73 A;  1ESV A;  4JS5 A;  3RR8 A;  4CD1 A;  3EN9 A;  3SI6 A;  3EY1 A;  1NK4 A;  4BRD A;  5HRP A;  3PX4 A;  4DTU A;  1EWR A;  3SUQ A;  2HB5 A;  4FW2 A;  2B5J A;  3OYE A;  2VYP A;  4O44 A;  5CHI A;  3VER A;  3LZI A;  3C7N A;  3MX5 A;  2DY4 A;  4BDY A;  1ZBI A;  2D5R A;  3M8S A;  3DYA A;  3TAR A;  2FF6 A;  4YY3 K;  4YOY A;  2Q31 A;  3CIP A;  4CHN A;  4B1U B;  3CJC A;  1OVY A;  3UKU A;  4IO9 L;  3C6A A;  3NVM A;  3CXC M;  2GWJ A;  4B1V A;  3THW A;  1DKG D;  4OPJ A;  1RDW X;  4JKE A;  4CJW A;  4JRQ A;  3DM2 A;  3I0R A;  1N32 K;  1O13 A;  3EKS A;  1Q7Y O;  3UKR A;  4N76 A;  3AVI A;  3EKU A;  2NRX A;  3LP2 A;  3ZYY X;  3OY9 A;  5J1E A;  1RT4 A;  4BRL A;  3IFR A;  4BDZ A;  3OYH A;  3ZLJ A;  4JI2 K;  4BRI A;  3AO4 A;  3KK3 A;  2QWP A;  5AQV A;  1R59 O;  4M41 A;  2F9W A;  3L3V A;  2GEM A;  5HOO A;  5BR8 K;  4F4K A;  4LH4 A;  4B3T K;  4LH5 A;  3WXK A;  3C7N B;  1FKP A;  3CCL N;  2HBJ A;  4ILG B;  4IJN A;  3HBT A;  3TSP A;  2NRR A;  3IUC A;  1BA0 A;  3LL3 A;  3IMX A;  5SWM A;  1KQS M;  1WN7 A;  2OTJ N;  3QBX A;  3C6T A;  4XH1 A;  1WSI A;  4W5N A;  4B9L A;  4CFD A;  4W5R A;  3G4S N;  4WFN L;  3QEV A;  1FJG K;  5DM6 L;  3VEN A;  1BGX T;  1QZ5 A;  4DSK A;  4CD3 A;  1WBD A;  3H6E A;  4FLZ A;  3CER A;  2FBT A;  4LSN A;  1T03 A;  4ZTJ A;  5LY3 A;  3B8A X;  3P31 A;  5AQM A;  4W5O A;  4CIF A;  3HTV A;  5C2D A;  2OPP A;  3CD6 N;  4E1J A;  4FWS A;  2E20 A;  4JK7 A;  2DFF A;  3DWL A;  1KFD A;  5FLX O;  2V51 B;  4Z4E A;  1BWF O;  1GLF O;  4DHY A;  3AA2 A;  4WE1 A;  2WC9 A;  1LWF A;  1IH7 A;  4MQ3 A;  3ZEU B;  1KXP A;  3RSE B;  4E7H A;  4RW6 A;  2UU9 K;  2P9S B;  1Q9X A;  4FXD A;  1F21 A;  3FZH A;  3NE6 A;  3LWL A;  3E9O A;  2IVP A;  4XH4 A;  5AQQ A;  3KLH A;  4L8R B;  3SAF A;  5FRN A;  5MLC Q;  2QM1 A;  3OYD A;  1E4G T;  1GLE G;  1GLB G;  4FK0 A;  5AFU A;  2OPS A;  4EHT A;  4H5W A;  3VGL A;  4CEQ A;  2P5O A;  4XEI A;  1MA9 B;  1NK5 A;  4K0K K;  2HMP A;  3BGR A;  1WSG A;  3CF5 L;  2XY6 A;  1EO1 A;  4KH6 A;  4DTJ A;  4BRE A;  4F9O A;  1I39 A;  1K8K B;  5I3U A;  1KVC A;  1UAX A;  4CJQ A;  4Z94 A;  5KRT A;  2HBM A;  3ZX2 A;  4CEB A;  4PA1 A;  1WSJ A;  2CH6 A;  1QQC A;  3CI5 A;  2ITM A;  1ATN A;  1JLF A;  1NGB A;  5AFU H;  2QW9 A;  3IKM A;  3B6P A;  3EO3 A;  1NGA A;  3DOL A;  1C1B A;  4FJ8 A;  4CBX A;  2O4I A;  3AVN A;  1RBT A;  4XH5 A;  1JKH A;  3TAQ A;  5E26 A;  1TKX A;  4K8X A;  4DV6 K;  5AQY A;  2FSN A;  4DS4 A;  5AJ3 K;  4Y0W A;  3ZSY A;  4BRC A;  1NK8 A;  3HM8 A;  1T3V A;  1IG8 A;  4H0X B;  1WSH A;  5GAD P;  2FLO A;  2D0O A;  4E0D A;  1RT6 A;  4CHZ A;  1WBB A;  4FJ9 A;  4HWI A;  1HNV A;  4OGE A;  3UB5 A;  3CJA A;  4OLB A;  3O9Q A;  1ZYQ A;  1RBR A;  1K6Y A;  4ISG A;  4KRF A;  3FFI A;  1S1X A;  2LSN A;  4N56 A;  4FLW A;  5E84 A;  3ALY A;  1HJO A;  4AH9 A;  3AVF A;  4FLV A;  2OPQ A;  3ZSW A;  1SQK A;  1QS4 A;  4JKH A;  3AA3 A;  5AZJ A;  5HP1 A;  3NDK A;  4DQQ A;  3HJF A;  3ITH A;  3T1A A;  2NNW A;  5KGX A;  4YOV A;  3DLL L;  1VSE A;  3C6U A;  3P39 A;  2HVH A;  2A1R A;  3K59 A;  2IC3 A;  1J5E K;  1S9G A;  3AO2 A;  3BF3 A;  1RBS A;  2CGL A;  4DLE A;  3KLG A;  4DTP A;  3BEX A;  4ELV A;  4G9Z A;  4CFC A;  4B9M A;  4FWL A;  1ZC6 A;  4CEE A;  2F8S A;  2P9I B;  1ASW A;  4RW4 A;  1RTI A;  3BP8 A;  3V6D A;  1ZXO A;  2OTL N;  4WQ4 A;  5F2R A;  2X6S A;  3H3O B;  3TPQ A;  2QI2 A;  4FWP A;  3LAM A;  4KHN A;  2D4W A;  4CZK A;  4DTX A;  4MDB A;  3QIP A;  1U2V B;  3TAB A;  3K5N A;  1VQK N;  2HOE A;  1LWC A;  2X74 A;  4BVP A;  4JD2 A;  3K57 A;  2E2N A;  4EZ9 A;  1NBW A;  4PL7 A;  2O8B B;  5M1F A;  3NGZ A;  3OYK A;  3HVR A;  1TKT A;  3HOT A;  3NMU A;  2NRH A;  3TTC A;  4KAZ A;  5GIN A;  3VA0 A;  2OYQ A;  3VQQ A;  1J5O A;  2E4L A;  4GV3 A;  1XHX A;  2EHG A;  3KJV A;  4HUF A;  4PL8 A;  4QS7 A;  1NJI O;  1KVB A;  2NRZ A;  1C0M A;  2YNF A;  3G6E N;  2NUB A;  3JYT A;  1S5J A;  2QWO A;  4JKB A;  1W9H A;  4JI1 K;  4KV8 A;  4AHC A;  3K5M A;  4B3M K;  2P5G A;  1JCE A;  1QZ6 A;  3AVH A;  4MDA A;  4U7B A;  3NGI A;  4HUG A;  4CBU A;  3M1F A;  3CCJ N;  4DR2 K;  2P9U A;  1WUA A;  1NGI A;  1D9D A;  3MWP A;  3K5L A;  4A2B A;  1VQ8 N;  4UQG A;  4O5F A;  1KCF A;  4A57 A;  3B6O A;  3J7Y P;  3OHR A;  3K9K A;  4FJM A;  2A42 A;  4Z4C A;  3UKU B;  4B8C A;  3CFO A;  2HHV A;  4JI5 K;  4FPA A;  3ATV A;  4B9V A;  4IOA L;  1QQO A;  3U3Y A;  1EXQ A;  1SZ2 A;  5CE3 A;  2W41 A;  1XC9 A;  4M3W A;  5M1O A;  4CFB A;  5BPL A;  2P51 A;  3EE9 A;  2VG5 A;  4C1N K;  4NCG A;  1RDC A;  4M3T A;  2Q2R A;  4I9Q A;  1V4T A;  3DLR A;  3S9H A;  1S3X A;  4CZH A;  3I55 N;  1RDD A;  4OJR A;  2FBX A;  1YT3 A;  1NK9 A;  4M63 C;  3AA5 X;  3QES A;  3DRP A;  4FWM A;  3G10 A;  1NGC A;  3PIP L;  1HX1 A;  2RF2 A;  1TL3 A;  3AVB A;  5HRS A;  3GBT A;  3S41 A;  3AVC A;  2P9L A;  4KHY A;  3M6G A;  1EKE A;  3VET A;  2IVN A;  1L3V A;  2QEX N;  4BC2 A;  3LDL A;  1EQY A;  2HBK A;  2XY8 A;  3J7A P;  5F1X A;  4KPY A;  3U4L A;  3LM2 A;  2HHW A;  1JLB A;  4LD0 A;  3PSI A;  4QOZ B;  1QSS A;  4PQU A;  4CER A;  2ASM A;  1KLM A;  4H5N A;  4PHT X;  3HOS A;  4BVO A;  4BE1 A;  3ID6 A;  5J2N A;  1TKD A;  1M1K O;  2ZF5 O;  1QVF M;  3VF6 A;  2ATQ A;  3UKR B;  3NCI A;  3AA4 A;  2WUS A;  4BAC A;  1YTA A;  4IDH A;  4K8Z A;  2IAJ A;  3SUN A;  4O4G A;  3FGU A;  3DLH A;  2E8A A;  1CXQ A;  4WQ5 C;  3I0S A;  3KK1 A;  3CJ9 A;  3VQA A;  4DFM A;  4IG3 A;  1NM1 A;  3SLC A;  4CEO A;  4O5B A;  2PZS A;  1N34 K;  1S72 N;  3ID8 A;  4B1Y B;  4H0T B;  1HKB A;  4ICL A;  3WEE A;  4Z4F A;  1GOA A;  5TKW A;  3O6W A;  4A5B A;  1IO2 A;  1WAF A;  5JS2 A;  4O0I A;  2KZZ A;  5AQG A;  3SQ2 A;  5KRS A;  4C8N A;  4DF8 A;  1XHZ A;  1WSF A;  3EL2 A;  3WT0 A;  4EP5 A;  2O8E A;  1JL1 A;  2P9K A;  5FPE A;  1YIT N;  1Q86 O;  4OLA A;  1TYQ A;  3WNE A;  3D45 A;  3N4Q A;  3FZK A;  2IVO A;  3M3Z A;  1A5X A;  2V52 B;  3KK7 A;  4PWD A;  5BPM A;  4JI3 K;  3N4P A;  2BTF A;  4CGD A;  3CMA N;  2YJF A;  4JD2 B;  1O1W A;  3VQE A;  2XHB A;  1SL0 A;  1T6D A;  4Z4H A;  3QFP A;  2G8H A;  1TKZ A;  2FSK A;  3CPE A;  1HNW K;  2AP1 A;  1HYV A;  2X6N A;  3R1X A;  2P9P A;  2PYJ A;  4HCB A;  2HHQ A;  3O1W A;  4KHS A;  3KWG A;  2ZD1 A;  2A5X A;  4DU4 A;  4JKD A;  1T44 A;  4H4M A;  3NFA A;  4CFA A;  2P9I A;  5IT9 O;  3K0S A;  1KFS A;  3LPU A;  1C1C A;  1HKC A;  5AQJ A;  3OYA A;  1SL2 A;  4NXN K;  2KW4 A;  4M3U A;  1Q82 O;  4AHT A;  1HMV A;  2CH5 A;  4O0J A;  4CEZ A;  5KPR A;  4KBO A;  4CVN E;  3ZT1 A;  4CED A;  5LJV A;  1VQL N;  2HW3 A;  3H46 O;  1HYZ A;  3T7Z A;  5AQZ A;  3ZT0 A;  3RTV A;  3U8X A;  4YHH K;  4IFV A;  4OPK A;  1NJZ A;  2OCE A;  4C8L A;  4YOU A;  1TUY A;  3CCQ N;  4CJ5 A;  4DTR A;  4RW8 A;  5C25 A;  3O1B A;  3VQD A;  3VQ8 A;  1YVU A;  5FPM A;  3CQ8 A;  3EZW A;  1ITG A;  2ASP A;  2R7Y A;  1WLJ A;  1WAJ A;  3FR0 A;  2HNY A;  1NKC A;  2D0A A;  3JS6 A;  5BRF A;  2WTU A;  4GMJ B;  4R79 A;  3NVK A;  5BRD A;  3HPH A;  1VQ7 N;  3EE8 A;  1FW6 A;  2QXL A;  4BR2 A;  4JKG A;  5AQS A;  4CES A;  2V7Z A;  3D2F A;  4LF7 K;  4B9T A;  5M1P A;  5AQN A;  1S9E A;  1MWM A;  4LC9 B;  2VCP A;  1GLD G;  3CQY A;  2Q36 A;  4FWR A;  4CJ4 A;  3DLK A;  4IEE A;  2GUI A;  3JSM A;  4B9S A;  4IEI A;  4OKJ A;  1C0U A;  2E88 A;  4HTL A;  2ZGY A;  1HLU A;  3IAY A;  1HR0 K;  1W97 L;  4IFY A;  4DTN A;  4GV9 A;  2E5L K;  4EAH D;  4BG8 A;  3PIO L;  4KHQ A;  3T3F A;  3O3G A;  1GLC G;  2EX3 A;  1IBK K;  3OBW A;  1RTH A;  3BDP A;  4DQR A;  5AQT A;  4TSX A;  4HCC A;  4CK3 A;  5KPT A;  3ISN C;  2IGI A;  4M42 A;  1CZB A;  1YVN A;  1NJX A;  1QSY A;  1X3N A;  4IG0 A;  1KVA A;  3C65 A;  5FPD A;  5IWA K;  4JN4 A;  3SV4 A;  1J6Z A;  3KWI A;  1M90 O;  3E01 A;  4PY5 A;  3AV9 A;  1Q81 O;  3OS1 A;  1W7A A;  3VEX A;  4FJ7 A;  3ZEU A;  1RT3 A;  4L3Q A;  3OA9 A;  4RTF D;  1UA0 A;  2H3G X;  1RTD A;  3E66 A;  1EX4 A;  3F5T A;  3T1H K;  2RKI A;  1FK9 A;  3L2V A;  3O80 A;  3CHW A;  1RBU A;  2E2O A;  2OZS A;  3TAM A;  3D2E B;  1OKJ A;  3KKS A;  5AZI B;  4JEP A;  3MN6 A;  4E7J A;  4NXM K;  2E2Q A;  1YJN N;  3R8E A;  2P9L B;  2O8E B;  3AAQ A;  4MO5 A;  4N5S A;  2A1S A;  4IBN A;  3MMV A;  4BR5 A;  3F9K A;  4JRP A;  4FJN A;  3V81 A;  3RRH A;  1RT2 A;  5B8H A;  3OS0 A;  3QER A;  3CG7 A;  4CK1 A;  1IV0 A;  3VF2 A;  3NF7 A;  3KLF A;  3TAN A;  1GOC A;  3A5M C;  3MWT A;  1TAQ A;  4CEA A;  3GDQ A;  1SKR A;  3LAN A;  3H08 A;  4YOT A;  2G8V A;  4FJK A;  4X66 K;  4BC3 A;  2ASO A;  3HPO A;  1I3A A;  3E9L A;  2ZQB A;  3OBY A;  1L3U A;  1SL1 A;  3CCR N;  3VQB A;  1L5U A;  2PBD A;  4A2A A;  3OYI A;  3OYF A;  1QHA A;  3GG4 A;  3R3L A;  3VES A;  4A62 A;  4FJJ A;  4AHR A;  4FJI A;  3TSQ A;  3OJU A;  1C0T A;  2RPI A;  4DQP A;  3D6R A;  3W3D A;  4CCH A;  4ELT A;  4FJL A;  1G15 A;  3F9M A;  2D0P A;  1HKG A;  2F4V K;  4Z4I A;  1NGJ A;  4YOX A;  1LWE A;  2BE2 A;  3ULE A;  1LAW A;  1YAG A;  5JLH A;  1U49 A;  5AQK A;  3SNN A;  4OKK A;  2E6L A;  2KFN A;  3LM9 A;  4CEC A;  1NGG A;  2B6A A;  2Q0R A;  1LW0 A;  3VEV A;  1ZBU A;  1C0F A;  3BY5 A;  1OH7 A;  1U47 A;  5AQU A;  4NYF A;  1OVQ A;  1TK0 A;  4RCH A;  1S1U A;  3ZT2 A;  1XMQ K;  3ZSX A;  4DSJ A;  5F0X A;  3ULE B;  4HUE A;  5AR0 A;  3MEE A;  4FJ5 A;  3RMA A;  2PYL A;  3SPZ A;  1Z05 A;  3HP6 A;  4FSV A;  4MLE A;  4ZHR A;  4KFB A;  5C24 A;  2F9T A;  4HTU A;  1QQM A;  2AA4 A;  3MN9 A;  4AM7 A;  4CJT A;  5AQR A;  4BR7 A;  4FLX A;  4FWK A;  3A2F A;  3THV A;  2I7N A;  3V9X A;  3AO1 A;  4KTQ A;  4ELU A;  4ZTF A;  3EYZ A;  3NBP A;  1NMD A;  3U9Z A;  5GAG P;  2W6K A;  2DTU A;  3LP1 A;  1DGK N;  4CI6 A;  4X65 K;  3SMP A;  3D2E A;  4JI8 K;  1Q9Y A;  3PO5 A;  3W0L A;  4GV6 A;  5AQF A;  1X9S A;  5GIP A;  3QNN A;  4J8F A;  2O8F B;  1HPM A;  3ZSO A;  3SAG A;  2HVI A;  3G25 A;  4H5T A;  1RDU A;  3RR7 A;  5HBM A;  3J81 O;  1RT5 A;  1UWB A;  4JAX A;  2J4R A;  4CJR A;  1EET A;  2P9S A;  4CF8 A;  1D9F A;  3P38 A;  4DR5 K;  4JI7 K;  1TUU A;  2V7Y A;  4DKW A;  4K43 A;  1W2B M;  3ASM A;  4YNQ A;  2A41 A;  4EHU A;  5SZT A;  4DB3 A;  1ASU A;  1V4S A;  4DV1 K;  1ZBL A;  4DU3 A;  4E7K A;  1BA1 A;  5JVG L;  4OGC A;  4DU1 A;  3D2F B;  4RWT A;  1KAX A;  1YXQ A;  1QTM A;  4DFP A;  2QWN A;  4BC5 A;  2O8D A;  3HP9 A;  4MFB A;  2DPN A;  2WBN A;  1SV5 A;  3A5O C;  3CYM A;  4BR0 A;  3L2U A;  4FJX A;  1K9M O;  1VSJ A;  1XUP O;  3I33 A;  5EOY A;  5I9E B;  4AIL C;  3DXK B;  3AY9 A;  1J9A A;  3E1Y A;  3GE1 A;  3V1O A;  5JLF A;  2IDO A;  3OYG A;  1VSI A;  4FVU A;  4DR6 K;  3L6Q A;  4FW1 A;  1QQN A;  4CZI A;  4CF1 A;  1JLA A;  2QA4 N;  4CF0 A;  4KHU A;  3LP3 A;  1CXU A;  2QWQ A;  3O4N A;  1VQO N;  2ZJP L;  4DFK A;  3PV8 A;  3SV3 A;  3H1V X;  3QEX A;  4EZ6 A;  1VQ4 N;  1QSL A;  3NH1 A;  3G0Z A;  4FK2 A;  4FLU A;  3ENB A;  3LP0 A;  4CHY A;  2RN2 A;  1T6C A;  1L3S A;  1JLG A;  4IFE A;  4CJ3 A;  3S3O A;  4FOI A;  1U48 A;  2OPR A;  1BIS A;  1XWL A;  2YJE A;  3NH0 A;  1J54 A;  2F96 A;  3OYC A;  5AQW A;  1HNX K;  2P9P B;  4JKF A;  2Z1I A;  3CCV N;  3BUZ B;  3J7Z O;  5KQ8 A;  2QKK A;  4WYB A;  3OYJ A;  3TWH A;  2HNZ A;  3VQ9 A;  2CGJ A;  4YOR A;  4DQS A;  4FLY A;  3SAH A;  3VTI A;  4QAG A;  3VOV A;  1TL1 A;  1VQ5 N;  5AQX A;  2QKB A;  5CYM A;  1IKW A;  3O9S A;  2VQE K;  4V19 S;  4IO8 A;  4WF9 L;  2ETJ A;  1S6P A;  3O3F A;  1Z25 A;  5EY4 A;  3AVL A;  5FRM A;  1BQN A; 
#chains in the Genus database with same CATH homology
 2YKM A;  3O4Q A;  4B8A B;  3SYZ A;  1HYV A;  3AVI A;  2X6N A;  2OZM A;  3LP2 A;  4E7L A;  4C8K A;  2PYJ A;  4HCB A;  2HHQ A;  3OY9 A;  5J1E A;  4KHS A;  2ZD1 A;  4GW6 A;  1RT4 A;  1HJR A;  4DU4 A;  4BDZ A;  4H4M A;  3ZSR A;  3OYH A;  3CM5 A;  3AO4 A;  3NFA A;  4CFA A;  3KK3 A;  1TK5 A;  4IKF A;  4DS5 A;  4M41 A;  3L3V A;  1KFS A;  3LPU A;  1C1C A;  1LW2 A;  2HHT A;  1TVR A;  1VK0 A;  3OYA A;  1VSK A;  1SL2 A;  3MXM A;  4F4K A;  2KW4 A;  4M3U A;  4Y1D A;  2E6M A;  4AHT A;  1KRP A;  4LH4 A;  1HMV A;  4O0J A;  4CEZ A;  3ZT1 A;  4LH5 A;  2DFH A;  4CF9 A;  4CED A;  4LSL A;  2HW3 A;  1HYZ A;  2HND A;  2Q3S A;  3AVM A;  3WNF A;  1BIZ A;  3ZT0 A;  3RTV A;  3LAK A;  1DLO A;  1FKP A;  2Y1I A;  4IFV A;  2HHX A;  4OPK A;  1HQU A;  4KTZ A;  1NJZ A;  1D8Y A;  2YNI A;  2GBZ A;  3PX6 A;  4C8L A;  2VWJ A;  4CJ5 A;  4Z0U A;  4RW8 A;  5C25 A;  3DRS A;  1WN7 A;  1J53 A;  5SWM A;  4DTR A;  3VQD A;  3VQ8 A;  3C6T A;  1YVU A;  1WSI A;  3CQ8 A;  1LAV A;  4CHP A;  3NF6 A;  3KD1 E;  1HYS A;  4W5N A;  2ITG A;  1ITG A;  4CFD A;  4B9L A;  4W5R A;  4DSE A;  4Q5V A;  2R7Y A;  1VSF A;  3AO3 A;  3QEV A;  2F8T A;  1WLJ A;  1WAJ A;  3L2Q A;  2FC0 A;  1BGX T;  2HNY A;  2GV9 A;  1NKC A;  4BDP A;  2D0A A;  3NH2 A;  4EP4 A;  4NCB A;  3PO4 A;  3S3M A;  4DSK A;  4FLZ A;  4E19 A;  4CHQ A;  2FBT A;  4LSN A;  5KTQ A;  4ZTJ A;  1X9M A;  4GMJ B;  1T03 A;  1R0A A;  4FZX C;  3SUO A;  1JLE A;  4XIU A;  3HPH A;  4CIF A;  4W5O A;  5HRO A;  4J2E A;  4CHO A;  3LAL A;  4DFJ A;  4CES A;  1T05 A;  4KO0 A;  2OA8 A;  4GVM A;  2OPP A;  2P1J A;  1TV6 A;  5KI6 A;  1MU2 A;  3V9W A;  1NOY A;  4B9T A;  4FYD A;  2DFF A;  1S9E A;  1KFD A;  4FM1 A;  3RMB A;  5J2P A;  4RG8 A;  4BWM A;  4Z4E A;  4F2R A;  4B9U A;  2I5J A;  5HRN A;  3AA2 A;  4WE1 A;  2WOM A;  2XO7 A;  4CJ4 A;  3HM9 A;  3DLK A;  1RBV A;  4CK2 A;  1LWF A;  1X1P A;  3V1Q A;  1IH7 A;  4MQ3 A;  2GUI A;  3JSM A;  4B9S A;  4OKJ A;  1C0U A;  1UOC A;  3KD5 E;  1FXX A;  3IAY A;  3MEG A;  3NF9 A;  1N5Y A;  4E7H A;  4RW6 A;  2ZE2 A;  3V1R A;  1Q9X A;  4IFY A;  1F21 A;  1JXE A;  4DTN A;  4CGJ A;  4FXD A;  3NE6 A;  3LWL A;  1Z26 A;  4Q0B A;  3KLH A;  4L8R B;  4KHQ A;  5FRN A;  3T3F A;  4Z4G A;  3O3G A;  3OYD A;  3SJJ A;  2EX3 A;  1JLC A;  4CF2 A;  4FK0 A;  1RTH A;  2OPS A;  1NK0 A;  3BDP A;  4DQR A;  4I2P A;  4TSX A;  3LWM A;  4HCC A;  4ID1 A;  4CEQ A;  4CK3 A;  1T7P A;  2P5O A;  4DLG A;  3ISN C;  4HHT A;  1NK5 A;  2IGI A;  4M42 A;  1JLQ A;  1WSE A;  3IG1 A;  3BGR A;  1WSG A;  2XY6 A;  4NCA A;  1CZB A;  2XY5 A;  5C42 A;  4CEF A;  1NJX A;  4CJS A;  4DTJ A;  1QSY A;  3AVA A;  1I39 A;  3L2R A;  3K5O A;  2BGG A;  4IG0 A;  3U3G A;  1KVA A;  5I3U A;  1BI4 A;  1KVC A;  1UAX A;  4CJQ A;  5KRT A;  2YNH A;  4CEB A;  4JS4 A;  3SV4 A;  4PA1 A;  1WSJ A;  4PY5 A;  3E01 A;  3TR8 A;  1QQC A;  3VQP A;  3AV9 A;  1JLF A;  2G8U A;  3HYF A;  3OS1 A;  2DFE A;  4OKE A;  4I7F A;  3L3U A;  4CIE A;  4BE0 A;  2YKN A;  3PX0 A;  4FJ7 A;  3D0P A;  3B6P A;  1RT3 A;  5J2M A;  4LY7 A;  3DOL A;  1C1B A;  1UA0 A;  4FJ8 A;  1CLQ A;  1RTD A;  1JXB A;  4J2B A;  2O4I A;  1EX4 A;  1RCH A;  3AVN A;  1RBT A;  4M3R A;  2RKI A;  1NKE A;  1FK9 A;  4CJF A;  2Z1H A;  1JKH A;  5HRR A;  3L2V A;  3TAQ A;  4CJL A;  4KHW A;  1TKX A;  4K8X A;  3RRG A;  1B9D A;  1RBU A;  1LV5 A;  4C8O A;  4DS4 A;  2OZS A;  4KKO A;  3TAM A;  2QK9 A;  1TGO A;  2B4J A;  3HPG A;  3KKS A;  4RW7 A;  5DK5 A;  3ZSY A;  4CJV A;  1NK8 A;  4E7J A;  1WSH A;  1KTQ A;  3DMJ A;  4NYN A;  2D0C A;  3AVJ A;  1Y97 A;  1HQE A;  4E0D A;  1TAU A;  3LPT A;  4CJE A;  4IDK A;  1RT6 A;  4CHZ A;  4G1Q A;  4N5S A;  3HT3 A;  3SQ0 A;  4CJK A;  4FJ9 A;  2A1S A;  3OS2 A;  3MED A;  4CGF A;  1HNV A;  4IBN A;  4OGE A;  4KI6 A;  3NGY A;  4RW9 A;  3F9K A;  3NF8 A;  4JRP A;  4OLB A;  4FJN A;  1ZYQ A;  3VQ5 A;  1RBR A;  4BE2 A;  3V81 A;  3RRH A;  1RT2 A;  3OS0 A;  3QER A;  3CG7 A;  1K6Y A;  4CK1 A;  1A5W A;  3RMC A;  3U6F A;  4DG1 A;  3NF7 A;  3KLF A;  1BHL A;  3TAN A;  1GOC A;  3FFI A;  4KRF A;  3K58 A;  1S1X A;  1TAQ A;  2LSN A;  1B9F A;  4N56 A;  4FLW A;  4M3Z A;  4CEA A;  1REV A;  3V9Z A;  1SKR A;  3LAN A;  3H08 A;  3ALY A;  2G8V A;  4FJK A;  4AH9 A;  1U45 A;  1Q8I A;  3M8R A;  3AVF A;  4H8K A;  2OPQ A;  3NAE A;  4FLV A;  3ZSW A;  3HPO A;  1I3A A;  4E1M A;  1QS4 A;  2ZQB A;  3MAQ A;  3DLB A;  3AA3 A;  3VN5 A;  5HP1 A;  3NDK A;  3CFP A;  4DQQ A;  3HJF A;  3ITH A;  3T1A A;  1L3U A;  3KLI A;  3VQ6 A;  5KGX A;  1SL1 A;  3QEI A;  3VQB A;  1VSE A;  3C6U A;  4BWJ A;  4KRE A;  2HVH A;  3KTQ A;  3SQ1 A;  3SCX A;  4ID5 A;  2A1R A;  4FZY A;  3I8D A;  1L5U A;  3K59 A;  2IC3 A;  3P83 D;  1S9G A;  4R5P A;  1VRT A;  3OYI A;  3AO2 A;  3SQ4 A;  1RBS A;  1CZ9 A;  2X78 A;  3OYF A;  3KLG A;  4DLE A;  4DTP A;  1T8E A;  4ELV A;  4J2A A;  3ZT3 A;  3VA3 A;  4CFC A;  4B9M A;  4B3O A;  1HNI A;  3OYM A;  4E7I A;  4CEE A;  4N41 A;  2F8S A;  5E41 A;  4FJJ A;  4AHR A;  4FJI A;  1ASW A;  4RW4 A;  3OJU A;  1RTI A;  1C0T A;  2RPI A;  3HST B;  3V6D A;  1VSH A;  4DQP A;  1IKV A;  2X6S A;  2YV0 X;  4CCH A;  4ELT A;  4FJL A;  2W42 A;  1G15 A;  3VQ7 A;  3LAM A;  3C95 A;  4KHN A;  3QLH A;  3QET A;  3MXJ A;  2HHU A;  3OYB A;  1RT7 A;  4DTX A;  3SUP A;  4Z4I A;  3IRX A;  3QIP A;  5EU7 A;  3KKR A;  3TAB A;  1LWE A;  2BE2 A;  3K5N A;  4FZZ A;  3PY8 A;  1HPZ A;  1LWC A;  3ZT4 A;  1X9W A;  1LAW A;  2X74 A;  4KTW A;  3P1G A;  3ZCM A;  4DSL A;  1VSM A;  1U49 A;  1DTT A;  3K57 A;  3O3H A;  4OKK A;  4M45 A;  5FRO A;  4FM2 A;  3SNN A;  2D0B A;  2E6L A;  5KGW A;  3OYN A;  3V9S A;  2KFN A;  4EZ9 A;  4DWI A;  4CEC A;  4N47 A;  3NGZ A;  2B6A A;  1TK8 A;  3OYK A;  3ZSV A;  1LW0 A;  3HVR A;  1TKT A;  3DLE A;  1XI1 A;  1ZBU A;  3QEP A;  1FKO A;  1U47 A;  3VA0 A;  2KQ2 A;  4NYF A;  2OYQ A;  3TAG A;  4KAZ A;  1RTJ A;  3VQQ A;  1TK0 A;  3RWU A;  1J5O A;  1S1U A;  2E4L A;  3ZT2 A;  2XY7 A;  4YFU A;  4FJ5 A;  3ZSX A;  1XHX A;  2EHG A;  3KJV A;  4DSJ A;  4HUF A;  1RDA A;  4HUE A;  1KVB A;  1RT1 A;  4CJU A;  1C0M A;  2YNF A;  2BAN A;  3MEE A;  3RMA A;  3SPZ A;  2PYL A;  1SKS A;  1SKW A;  2NUB A;  3L8B A;  3JYT A;  1S5J A;  3HP6 A;  4DTM A;  1W9H A;  2P5G A;  4KV8 A;  4AHC A;  4ZHR A;  3K5M A;  4KFB A;  5C24 A;  3LZJ A;  4HTU A;  4E3S A;  1KLN A;  1VRU A;  2O4G A;  3AVH A;  3SPY A;  3NGI A;  4HUG A;  3C94 A;  1HRH A;  1ASV A;  3PUF A;  4CGG A;  4CJT A;  4H4O A;  5DMR A;  1ZBF A;  1D9D A;  3K5L A;  4FLX A;  4CE9 A;  3A2F A;  4UQG A;  3THV A;  3V9X A;  1KCF A;  3AO1 A;  5CZ2 A;  1NK6 A;  3B6O A;  4KTQ A;  4ELU A;  4ZTF A;  4AHU A;  3EYZ A;  3NBP A;  4FJM A;  1BIU A;  2VWK A;  1NJW A;  3MEC A;  4Z4C A;  1WNS A;  4B8C A;  3CFO A;  4DTS A;  2FBV A;  4QCL A;  2G8F A;  2DTU A;  3LP1 A;  2HHV A;  2G8I A;  4B9V A;  2AJQ A;  3U3Y A;  1EXQ A;  1Q9Y A;  3PO5 A;  3HO1 A;  1XC9 A;  4M3W A;  4CFB A;  1X9S A;  5I42 A;  1RDB A;  2P51 A;  3LDS A;  3QNN A;  2VG5 A;  4W5Q A;  4DTO A;  1N6Q A;  1QE1 A;  1RDC A;  4NCG A;  3ZSO A;  4FM0 A;  4I9Q A;  4M3T A;  3ZSZ A;  2HVI A;  1S1W A;  1S1T A;  1GOB A;  3DLR A;  4I9L A;  5CYQ A;  3IS9 A;  3M8Q A;  3S9H A;  3WNH A;  2XRI A;  3RR7 A;  1RDD A;  5HBM A;  1RT5 A;  1UWB A;  2FBX A;  4OJR A;  1YT3 A;  4CJR A;  3SZ2 A;  1EET A;  3AO5 A;  2Y1J A;  1NK9 A;  3OYL A;  1S6Q A;  4CF8 A;  1D9F A;  1U04 A;  3AA5 X;  3QIO A;  3QES A;  4B9N A;  3DRP A;  3VQC A;  3AVG A;  3G10 A;  4C8M A;  5D3G A;  2RF2 A;  1C6V A;  3CFR A;  4M3Y A;  1S1V A;  4DSI A;  1TL3 A;  3AVB A;  3ASM A;  4O55 A;  4KB1 A;  2G8W A;  3OVN A;  5CY4 A;  5HRS A;  4YNQ A;  1EP4 A;  3KIO A;  5SZT A;  1ASU A;  3AVC A;  2FBY A;  4FVM A;  1ZBL A;  3VQ4 A;  4DU3 A;  4FK4 A;  3RMD A;  3UIQ A;  4E7K A;  4KHY A;  3P5J A;  2KTQ A;  3M8P A;  3V4I A;  3DI6 A;  3HVT A;  4DSF A;  4PUO A;  2VG7 A;  1YTU A;  5JS1 A;  1EKE A;  4OGC A;  4E1N A;  3DLG A;  4DU1 A;  4DF4 A;  4E89 A;  3TAE A;  1L3V A;  1BCO A;  1QTM A;  4FLT A;  4DFP A;  5T7B A;  3QIN A;  1D5A A;  2XY8 A;  1RIL A;  1IKY A;  3HP9 A;  4MFB A;  4CGH A;  2PY5 A;  4KPY A;  1SV5 A;  4J2D A;  3CYM A;  1B92 A;  1JLB A;  1VSD A;  2HHW A;  3L2U A;  2Z1G A;  2G8K A;  4LD0 A;  3K2P A;  4FJX A;  1C1A A;  3DRR A;  1VSJ A;  2WON A;  3QNO A;  1QSS A;  4QOZ B;  4CER A;  4PQU A;  2QXF A;  3CM6 A;  2YHA A;  1SUQ A;  2YNG A;  1KLM A;  4AIL C;  4F3O A;  3TAP A;  4BE1 A;  4F8R A;  1U4B A;  2HHS A;  3AVK A;  5J2N A;  1TKD A;  1NOZ A;  2ATQ A;  3QO9 A;  3NCI A;  1J9A A;  3AA4 A;  3HL8 A;  4BAC A;  1YTA A;  1RNH A;  3T19 A;  3V1O A;  2IAJ A;  2IDO A;  3OYG A;  3EZ5 A;  1VSI A;  1W0H A;  3SUN A;  4K8Z A;  1BI4 B;  4DMN A;  4O4G A;  3WNG A;  5J2Q A;  3DLH A;  4FW1 A;  1IG9 A;  4F3T A;  1CXQ A;  1QHT A;  5HLF A;  5CZ1 A;  4HVJ A;  4CF1 A;  1JLA A;  1NKB A;  4CF0 A;  2HMI A;  1IKX A;  4OVL A;  4KHU A;  3I0S A;  3LP3 A;  1CXU A;  3O4N A;  3KK1 A;  3NHG A;  4CJP A;  3VQA A;  4DFM A;  3TI0 A;  4FJH A;  4IG3 A;  1NJY A;  2KZM A;  3KLE A;  4FJG A;  4CEO A;  3V9U A;  1DTQ A;  2Z1J A;  4O5B A;  4DFK A;  3PV8 A;  3SV3 A;  2PZS A;  4KB0 A;  2VG6 A;  3QEX A;  3ULD A;  2IS3 A;  3HK2 A;  2JLE A;  1KSP A;  4EZ6 A;  4JLH A;  4F2S A;  1BQM A;  1VSL A;  2YHB A;  1QSL A;  3NH1 A;  3OJS A;  3G0Z A;  4FK2 A;  4FLU A;  3LP0 A;  4CHY A;  1L3T A;  4CIG A;  2RN2 A;  4ICL A;  3F73 A;  1L3S A;  1JLG A;  1GOA A;  2JGU A;  4I2Q A;  4JS5 A;  1UA1 A;  4Z4F A;  4CJ3 A;  3S3O A;  3RR8 A;  1U48 A;  2OPR A;  1BIS A;  1XWL A;  3NH0 A;  1J54 A;  1IO2 A;  1WAF A;  3DOK A;  5JS2 A;  2F96 A;  4O0I A;  3OYC A;  4W5T A;  3EY1 A;  3SI6 A;  2BDP A;  3SQ2 A;  1NK4 A;  2KZZ A;  5HRP A;  5KRS A;  4DTU A;  3PX4 A;  4C8N A;  4DF8 A;  1XHZ A;  3SUQ A;  2HB5 A;  1WSF A;  2Z1I A;  4FW2 A;  2IOC A;  2B5J A;  5FDL A;  3OYE A;  4O44 A;  1BL3 A;  4EP5 A;  2QKK A;  3ZSQ A;  4AHS A;  2KFZ A;  3LZI A;  3OYJ A;  3TWH A;  2HNZ A;  1JL1 A;  3VQ9 A;  3S3N A;  4KI4 A;  2DY4 A;  4BDY A;  1A5V A;  1ZBI A;  2D5R A;  4DQS A;  3M8S A;  3MXI A;  4FLY A;  3DYA A;  3L2W A;  3TAR A;  1ZBH A;  4OLA A;  4QAG A;  3HXM A;  3WNE A;  3KK2 A;  1TL1 A;  3D45 A;  1BCM A;  4AHV A;  4CHN A;  1NK7 A;  4DQI A;  1A5X A;  2QKB A;  4B08 A;  4CGI A;  5CYM A;  4PWD A;  1IKW A;  4CGD A;  3TAF A;  4OPJ A;  5K14 A;  4CJW A;  4JRQ A;  4FCY A;  1O1W A;  3VQE A;  2XHB A;  2ETJ A;  1S6P A;  3DM2 A;  3I0R A;  1JL2 A;  4M3X A;  3O3F A;  1Z25 A;  4Y1C A;  1SL0 A;  4Z4H A;  5FRM A;  3AVL A;  2G8H A;  3QEW A;  1BQN A;  1TKZ A;  4N76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...