4CGGA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cggA00
3AO2A 4GMJB 5J2QA 3HVTA 4O44A 1X1PA 1D9DA 4FK4A 3SPYA 1QHTA 1RTHA 4AHTA 1LWFA 1NJWA 5I3UA 4HUEA 4FLZA 2KZMA 4F4KA 4NYNA 1RDAA 1KVBA 1SV5A 4ID1A 1NOYA 4DTNA 3SUPA 3EYZA 2E6MA 5FRMA 3PO4A 4FYDA 1S1WA 2VG7A 4FCYA 3V9WA 4K8ZA 3L2UA 3RMAA 1D5AA 4DQQA 1BL3A 3VQAA 4M3WA 5SWMA 3RMCA 3DLHA 1ZBUA 1TL3A 5HBMA 3VQ9A 1HYZA 3G0ZA 3QEVA 3HPHA 1UOCA 1VSMA 4FJ8A 4O55A 4W5RA 2IAJA 1WSJA 2XRIA 4C8MA 4CEOA 4DQRA 1B9FA 4CJEA 5J2MA 3OYFA 4DFMA 4OKJA 3MECA 5CZ2A 2B5JA 4CHQA 2HB5A 3HPGA 3MEEA 3OYBA 1WSEA 1GOCA 3CM5A 1T03A 1Q9XA 2RPIA 4IG0A 2O4GA 4DQIA 4KI6A 4HHTA 3AO5A 1L3UA 4E7KA 4KI4A 1EXQA 5HP1A 4FZZA 3IG1A 4CEDA 4E1MA 3NE6A 4BE1A 4K8XA 1RNHA 2OPQA 4DSFA 2ITGA 1NK6A 2IOCA 3EZ5A 2HHSA 3L2QA 4O0JA 4DSKA 4CJPA 4AILC 4CJFA 1D9FA 4NYFA 3ZSOA 3S3MA 1L3VA 4L8RB 4FK0A 3C95A 3F9KA 3TI0A 4I2QA 3ALYA 1VSIA 1RBSA 3MEDA 2PZSA 1BQNA 4Y1DA 3U3GA 3QETA 4M42A 3CM6A 4RW9A 3EY1A 4PA1A 4JRPA 3PX0A 4CFBA 2BDPA 3K5LA 2E6LA 1Y97A 2E4LA 1RBVA 3ZSZA 3OYAA 4EZ9A 3NH1A 1T8EA 1C1BA 4DQSA 4M3UA 4B3OA 3OS0A 4IFVA 2FBXA 2Z1JA 1LV5A 3TWHA 4YFUA 2IS3A 5C24A 2JGUA 4CECA 3KK1A 4BDPA 2Z1GA 4CFCA 2XY7A 4N5SA 4AHVA 1C0TA 3ZT4A 4Q5VA 4I9QA 3K5MA 3DLRA 4KTWA 1HJRA 3E01A 3KD1E 3KKRA 4DTMA 4CHNA 3V9SA 3FFIA 2YV0X 3U3YA 2FC0A 1ASVA 2OPRA 3VN5A 5HRNA 3SQ1A 4AHRA 3L3UA 4B9MA 3D0PA 3ZT3A 3VQQA 3OJSA 1HRHA 4FVMA 4OPJA 5KGXA 3KLFA 3F73A 3ZT0A 3KTQA 3RRHA 1IKYA 4C8NA 3HJFA 4CJKA 3LAMA 2G8VA 3NGYA 2HNZA 3T3FA 2OPPA 1IH7A 3OYKA 3IS9A 1XC9A 1ITGA 4ZHRA 5K14A 4DSIA 3OYEA 2OA8A 1S1XA 3T1AA 3VA3A 3DRPA 4W5QA 4H8KA 3QESA 3M8RA 2DFFA 3NFAA 3AO3A 3TAMA 4BDZA 1ASUA 1TGOA 1VRTA 1W9HA 3DOLA 4CIFA 1IKWA 3S9HA 1JXEA 1ZBFA 1YTUA 3TAPA 4FZXC 1J5OA 1XHZA 2G8FA 3AVKA 3RRGA 1O1WA 1QS4A 3DLBA 3LZJA 4E0DA 4CJ5A 2EX3A 3KLGA 1TAQA 4ELUA 4F3OA 1KCFA 2HHXA 1KFSA 1N5YA 1BI4A 3KD5E 1LW2A 4CJ4A 4CEZA 2Z1IA 5DK5A 3C6UA 4FZYA 3DI6A 2HVHA 4CJWA 4CJRA 1JLGA 3ZSQA 3RMBA 4CESA 1TKXA 1NK8A 1BIUA 1NJYA 3V1RA 5CY4A 1HQEA 1RBRA 3HSTB 1KLNA 4B08A 1ASWA 4HVJA 4KAZA 3P1GA 3SZ2A 3QERA 1J54A 3V1OA 2BE2A 5J2NA 3S3OA 4GW6A 2HVIA 2RN2A 4CHOA 4FJ7A 2BANA 2OYQA 1FK9A 3QIOA 5CYMA 4CK3A 1C0MA 1RT3A 2Y1JA 3SCXA 3MXMA 4LD0A 3L2VA 1DTTA 3DLKA 2PYJA 3SJJA 1UA0A 3K59A 1RBTA 2O4IA 1CLQA 4DF8A 2RF2A 1C1AA 3I0RA 1KFDA 4OPKA 1S1VA 1B9DA 2FBTA 1K6YA 4FM2A 4DWIA 2ETJA 4CHYA 4N41A 1REVA 3AA2A 3SUNA 2KTQA 1WLJA 3P83D 1JKHA 1TV6A 4CEBA 4CERA 4FJ9A 3KKSA 1S9EA 3SNNA 1BCMA 3AA3A 3OYGA 2X74A 4Z4IA 1WN7A 4BDYA 3SV3A 1HNVA 4H4MA 3RR8A 1J9AA 2HHUA 1RTJA 4DFKA 3DLEA 3TANA 1VSEA 4G1QA 4FJ5A 1Z25A 4KRFA 5C42A 3K2PA 4JS4A 2YNFA 4N56A 4HCCA 3OVNA 3C6TA 1EP4A 1JXBA 1RBUA 2B4JA 2GBZA 4DLGA 3DYAA 1JLAA 3P5JA 4DS5A 5HRSA 4MFBA 4J2DA 1BGXT 1XHXA 4CK1A 1BCOA 1U47A 4NCBA 3LALA 5KRTA 3PV8A 1X9WA 3VQ7A 3PX4A 4FJXA 1TKTA 1SKSA 3HM9A 2ZE2A 1VSLA 1RT6A 5J1EA 3OS1A 4J2BA 4FJKA 3QIPA 3KK3A 3TR8A 4E3SA 4FJJA 2HW3A 2VG5A 1SL1A 1VSJA 1DTQA 2JLEA 2WONA 3CYMA 3LP2A 3M8PA 3NH2A 3OY9A 3K5OA 4O5BA 4IDKA 3JYTA 4DFPA 1JLBA 4TSXA 3RMDA 4HUGA 2YKNA 2P51A 3HYFA 4O4GA 4KTQA 1TVRA 4W5TA 3AA5X 3VQBA 3KLHA 1IKXA 5FDLA 2RKIA 4M3TA 1QTMA 3ZSXA 4ID5A 1RT7A 1EETA 3LP3A 4M45A 3AVMA 3ZT2A 4BWMA 1NK4A 4DTOA 4OVLA 1KLMA 1L5UA 1NK5A 3MEGA 4CJVA 3RTVA 4DU1A 3AVGA 3KJVA 1WAFA 3ITHA 1I39A 4CGFA 4CF9A 2HHTA 4E7IA 1S5JA 1J53A 4Z4CA 1VSDA 4B9SA 3TAQA 3D45A 4DSJA 4IBNA 3CFPA 1YVUA 1BI4B 3ZSRA 4KHWA 2DTUA 3VA0A 4FJHA 3LWLA 1L3SA 4KV8A 3AVBA 1VK0A 4DG1A 1MU2A 2YNIA 4LH4A 5KI6A 3O4QA 4CEQA 4PY5A 1RDCA 3HO1A 3G10A 3OYHA 3LPTA 1D8YA 1W0HA 1C0UA 4N47A 4M3XA 2HHVA 2IDOA 1TK8A 4CJUA 2XY5A 4FM0A 3SYZA 3L2RA 3M8QA 4OLAA 3HL8A 3NBPA 2GUIA 4DU3A 3V6DA 1T05A 4HTUA 4I2PA 4J2AA 2DFHA 4KTZA 1WSHA 1CZBA 3VQEA 1CXQA 2VG6A 4DMNA 1X9SA 1KRPA 3V9ZA 3ZT1A 5T7BA 2A1SA 3NF9A 3VQDA 3AVJA 4R5PA 3JSMA 3QNOA 3AO4A 2P5GA 1B92A 3NH0A 4HUFA 4Z4EA 1VSHA 1NK7A 3O3GA 3OYCA 4JS5A 1ZBHA 3NF7A 2KZZA 3V1QA 5KTQA 4I7FA 2XY8A 2R7YA 1ZBLA 4F8RA 2W42A 1JLFA 3L2WA 1RDDA 5KGWA 4CCHA 3NF8A 1RT4A 2HNYA 4E7JA 3SUQA 4DLEA 1TKZA 1JL2A 3AVCA 2ZD1A 1VRUA 3QLHA 4JRQA 1QSSA 1GOBA 4CK2A 3AVIA 4DSLA 4FXDA 1KSPA 4FJMA 2YKMA 2FBVA 2KFZA 3V81A 1N6QA 4XIUA 1VSFA 1TK0A 5C25A 1CXUA 1EX4A 1SUQA 1UWBA 2KQ2A 1LWCA 4FW1A 4CF1A 3KLEA 4DTSA 4CJ3A 4FJLA 3SQ0A 3LAKA 4DSEA 2EHGA 4LSLA 4CGJA 4FLWA 1QSYA 1QSLA 1JL1A 4CF2A 3U6FA 2G8KA 4MQ3A 2IC3A 2A1RA 4DF4A 1RTDA 1S6QA 3PY8A 2G8UA 5SZTA 1S6PA 4F2RA 4CIGA 4KHUA 4CF8A 1FKPA 2D0BA 3VQ6A 2NUBA 1QE1A 3V9UA 4IFYA 4E7LA 3DRRA 2P5OA 4QOZB 4W5OA 3VQCA 4BACA 2G8IA 4C8OA 3ZCMA 4FLYA 2XY6A 4B9UA 1RTIA 4O0IA 2F96A 4CIEA 2Q3SA 2GV9A 3ISNC 4BE2A 4B9VA 3DLGA 3IAYA 1KVCA 2QXFA 1F21A 3QO9A 1HPZA 1WSFA 4Z0UA 1L3TA 3AVAA 4KB0A 4IG3A 3CFOA 5E41A 3HPOA 5FRNA 3PO5A 2X6NA 1YT3A 1I3AA 4ICLA 4AH9A 4AHCA 3OYDA 4KREA 1LAVA 3T19A 3S3NA 1RDBA 3DRSA 3SV4A 5CZ1A 3ZSWA 3QEXA 2QKBA 2ATQA 3AVFA 1NKBA 3NF6A 1T7PA 4QCLA 4FJGA 2VWKA 4Z4FA 3RR7A 1IO2A 4M41A 3NGIA 2BGGA 1HNIA 1Q9YA 4FLUA 3SQ4A 3AVHA 3HP6A 2VWJA 4KB1A 3BDPA 3VQPA 2X6SA 3LANA 4CHZA 4OGEA 4M3RA 3WNEA 4KHSA 1NJZA 3BGRA 1WNSA 1IG9A 3SPZA 4C8KA 1HQUA 2OZMA 2D5RA 4DTRA 2YHAA 3OYMA 3NGZA 5DMRA 2HNDA 1WAJA 3H08A 3O4NA 4FW2A 4CJSA 4DQPA 1ZBIA 2QK9A 1XI1A 1Z26A 2WOMA 2I5JA 4E1NA 4CEFA 2XO7A 1RILA 3MXJA 1LW0A 3O3HA 5CYQA 1A5XA 4IKFA 3MAQA 4KHQA 3LP0A 1U04A 4B9TA 4NCAA 1C1CA 4M3YA 4PWDA 1U4BA 2QKKA 2X78A 4DTUA 4JLHA 5I42A 2OPSA 3NCIA 3WNGA 1U48A 2DY4A 4WE1A 1BISA 3VQ8A 1QQCA 3TAFA 1BQMA 3ASMA 4E7HA 1C6VA 1TAUA 2LSNA 3IRXA 4B8CA 1RT1A 3CQ8A 1U45A 3TAEA 3LWMA 3MXIA 5JS1A 4RW8A 3NAEA 4RW6A 4EP5A 4AHUA 3OYLA 3QEIA 3B6PA 4N76A 1X9MA 1WSIA 1WSGA 3LZIA 3ZSVA 2B6AA 2FBYA 3ULDA 2P1JA 5JS2A 4CJLA 3SQ2A 5HROA 4KPYA 1S1TA 1S9GA 1VSKA 3AVLA 4NCGA 3VQ4A 2DFEA 4W5NA 4EP4A 4UQGA 4PQUA 3OS2A 3SI6A 1RT5A 1Q8IA 4KO0A 1SL0A 1SKWA 4DTXA 3AV9A 5KRSA 2YHBA 3QEPA 4DTPA 2Y1IA 1R0AA 4Z4HA 2PY5A 2Z1HA 4OJRA 4PUOA 1A5VA 4RW7A 4QAGA 2XHBA 2G8HA 4LY7A 3QINA 4GVMA 4E89A 1G15A 3UIQA 4CGIA 3QNNA 4CJQA 1FXXA 3HXMA 1UAXA 2YNHA 4C8LA 3WNFA 2D0CA 5EU7A 4ZTFA 3B6OA 3PUFA 4KKOA 1BIZA 1JLCA 4CGGA 3V4IA 4OLBA 2F8TA 1GOAA 3LDSA 1HYSA 4ELVA 2IGIA 4RG8A 3HP9A 1ZYQA 4CFAA 1RT2A 3CFRA 4DTJA 4FJIA 4Q0BA 5D3GA 3ZSYA 4LH5A 4BWJA 5FROA 3VQ5A 1BHLA 1KTQA 1NKCA 3SUOA 3AA4A 4CGDA 3I8DA 1KVAA 1LWEA 4FLXA 3PX6A 4M3ZA 4H4OA 4E19A 4DS4A 4CEEA 4I9LA 3K5NA 1NKEA 3K57A 3C94A 3I0SA 1FKOA 1HMVA 4CHPA 3OYIA 3CG7A 3DM2A 1TK5A 3HVRA 3DOKA 2OZSA 1LAWA 3OYNA 5HRRA 1SKRA 4OKKA 4CF0A 4FLTA 2PYLA 4DFJA 1NOZA 4KHNA 3NDKA 4Z4GA 1A5WA 3KK2A 4CGHA 1JLEA 3KLIA 1IKVA 4OGCA 3HT3A 3K58A 4FLVA 3V9XA 5HLFA 3THVA 1CZ9A 4F2SA 1XWLA 3LP1A 1UA1A 1NK9A 4ELTA 4ZTJA 4B8AB 5HRPA 4AHSA 3LPUA 3TABA 2KW4A 3A2FA 1NK0A 2YNGA 4FM1A 2F8SA 1JLQA 4CE9A 4J2EA 4B9NA 3TARA 1S1UA 3OJUA 1TL1A 4BE0A 2ZQBA 1U49A 3O3FA 4B9LA 4FJNA 4KHYA 3L3VA 3M8SA 1RCHA 3AVNA 3L8BA 4HCBA 2HMIA 3DMJA 3NHGA 1EKEA 3OYJA 5J2PA 4FK2A 4F3TA 4CFDA 1SL2A 2G8WA 1NJXA 4EZ6A 3WNHA 3QEWA 4CJTA 3KIOA 1DLOA 1HYVA 3HK2A 2AJQA 2HHQA 4Y1CA 4OKEA 4CEAA 2KFNA 4DU4A 1YTAA 3RWUA 3AO1A 4KFBA 2HHWA 4YNQA 3TAGA 2D0AA 1TKDA 4LSNA 4RW4A
chains in the Genus database with same CATH superfamily
4Z94A 1RGIA 1YUWA 2CGKA 4O44A 2P9LB 4FK4A 4OO1J 4AHTA 3ENOA 1NBWA 5I3UA 4HUEA 2P9NA 1SV5A 1VQLN 1NOYA 1GLFO 5FRMA 1BDGA 4BRLA 3K9JA 3V9WA 3L2UA 3HOSA 3VQAA 1YJNN 3LDLA 1C0GA 3DLHA 1ZBUA 1TL3A 3JS6A 3HPHA 1UOCA 4O55A 2IAJA 4CJEA 4GVEA 4CHQA 3MEEA 1WSEA 3CM5A 2RPIA 2O4GA 5AQGA 4KI6A 4E7KA 4EHUA 1EXQA 4FZZA 1QHAA 3IG1A 4E1MA 5AQPA 2ITGA 2WC9A 1NK6A 3UKUB 3CMAN 4NYFA 3ZSOA 3S3MA 1L3VA 4L8RB 3F9KA 4L3QA 5MLCQ 3QETA 4M42A 4JRPA 3PX0A 4PA1A 1KAYA 2ASOA 3K5LA 3ZX2A 2HF3A 1T8EA 5AQHA 5BPLA 4YFUA 5C24A 4BDPA 2Z1GA 4JKGA 1N33K 3ZT4A 3E01A 2OCEA 3FZMA 4FWQA 3VPZA 3KD1E 1GLAG 2P9SB 2E2NA 2FC0A 2OPRA 3VN5A 3Q7BA 4U67L 4AHRA 3BY5A 1ATNA 4A61A 3VQQA 3D0PA 4FVMA 4OPJA 4BRMA 2NRWA 3O9UA 1VQMN 3HJFA 4FWPA 2G8VA 2I7NA 5AQKA 5M1OA 3AAPA 3OYKA 4DSIA 3OYEA 1CZAN 1QVFM 4CZHA 3VA3A 1BU6O 3M3ZA 3DRPA 1VQPN 3TAMA 3NFAA 3AO3A 1TGOA 3DOLA 4CIFA 1IKWA 3CXCM 3EL2A 1Q86O 3TAPA 4FWSA 4FZXC 2A42A 2VCPA 1QS4A 3KLGA 3WXJA 4QS9A 3C0BA 1SS6A 1BI4A 5GIOA 4IO9L 4B3MK 3C6UA 1YXQA 4JKCA 2HVHA 3THXA 1JLGA 3VF2A 3ZSQA 4BVPA 5CY4A 1RBRA 5EY4A 1KLNA 4HWIA 4JD2B 4B1YB 2FLOA 1OH6A 4GW6A 3PSIA 5CE3A 4CK3A 1RT3A 3DLKA 4DR4K 2Q36A 2HMPA 4WQ5C 4DF8A 1KFDA 3IMXA 4N41A 4FOIA 1WLJA 4CEBA 4X64K 4LC9B 4CERA 5AR0A 1BCMA 3SV3A 1HNVA 3H46O 3BF1A 3E9LA 4H4MA 1M1KO 1ZC6A 3DLEA 3TANA 2QI2A 4IFEA 4BC4A 2YNFA 4DV3K 3OVNA 1V4TA 3C6TA 1EP4A 2GBZA 3O1BA 4JI8K 1JLAA 4DS5A 4MFBA 4BC3A 1NGHA 5C10A 3TTFA 3D2FA 1BCOA 4DCHA 4YOYA 4LF5K 3L6QA 4FJXA 3VQ7A 3DXKB 3HM9A 1RT6A 3TR8A 3A5NC 4PKGA 4A59A 2VWBA 1BUPA 2BTFA 4OPHA 4CJ7A 1SL1A 2CH6A 2JLEA 3LP2A 4DFPA 1WBBA 4IDKA 4TSXA 4HUGA 2D4WA 4O4GA 4CZFA 3KLHA 4M3TA 3VQBA 1IKXA 2RKIA 2HSTA 4ID5A 1EETA 4M45A 3ZT2A 2IVOA 1KLMA 4JI7K 3RTVA 4DU1A 1WAFA 1I39A 4JEPA 2HHTA 4FWLA 5BPMA 4Z4CA 4A57A 4B1XB 2WUSA 4BRGA 4UY8O 3O9RA 4FJHA 1L3SA 1VK0A 1O13A 3EN9A 4H5TA 3G4SN 3HO1A 3G10A 4A2BA 3OYHA 4ISGA 3LPTA 1D8YA 1W0HA 4JKBA 2O8CB 3O6WA 3CIPA 4CJUA 1S72N 4BRCA 3HL8A 2GUIA 1XNRK 4HTUA 2DFHA 1WSHA 1KRPA 2VG6A 4RTFD 3CJCA 5T7BA 2ITMA 3VQDA 2P9KB 3OBYA 3QNOA 3MN9A 4A5BA 2YHYA 4HUFA 1VSHA 3QDKA 4JS5A 1ZBHA 3V1QA 3CD6N 3NF8A 2HNYA 1TKZA 4CZGA 1QSSA 2NRZA 4AQYK 1OVQA 1SQKA 4FJMA 2FBVA 3V81A 1TK0A 3FE1A 1CXUA 3U9ZA 3KLEA 3SK3A 3A8YA 4IXCA 1QSLA 2G8KA 2A1RA 1NG9A 2W41A 5FLXO 2HBJA 1S6PA 3CERA 2UUBK 1TYQB 1YJ9N 3MDQA 4YOUA 4E7LA 3CCJN 1D4XA 3VQCA 3C65A 1HUXA 2ZJRL 4H5WA 3WXKA 4O0IA 1N32K 1HKBA 2UYTA 1MDUB 1I94K 1L3TA 2PAVA 5BR9A 3CQYA 3CCEN 3QB0A 4WFBL 5H1SQ 5AQJA 4ICLA 4AHCA 5ADXH 3S3NA 4KH6A 1T6CA 3I56N 1IO2A 4FLUA 3SQ4A 2JWKA 3OBWA 1YIJN 2V7ZA 3BDPA 4JV5K 4OGEA 3WNEA 3P31A 5AQZA 3M5RA 4C8KA 1HQUA 1GLBG 3KVGA 3M6GA 4MDBA 2UUAK 2HNDA 3O4NA 5LJVA 4CJSA 4DUZK 1Z26A 2WOMA 4IKFA 1IG8A 3MXJA 4H0OA 3SAHA 4NCAA 4CZMA 4M3YA 1K9MO 1IBKK 1U48A 2DY4A 4WE1A 4DR7K 3SBGA 1BQMA 1C6VA 3O08A 5JVHL 3A5LC 1TUUA 3TAEA 1SZ2A 4RW6A 4EP5A 3OYLA 3I55N 3B6PA 5AQNA 1YHQN 1WSGA 2OTLN 3HOTA 3CQXA 4CJLA 3AGRA 3AY9A 3AVLA 4NCGA 4W5NA 3P38A 1XUPO 4IDHA 4BRIA 5LY3A 3OS2A 1RT5A 5JLFA 1X3MA 3AV9A 4DB3A 4CI6A 4KBOA 3DWLA 2A41A 4DV7K 4Z4HA 2Z1HA 4OJRA 4PL7A 1U6ZA 1RDWX 3QINA 4GVMA 1HJOA 3UB5A 4CGIA 4BR4A 3A0IX 1UAXA 2YNHA 4NB4A 3CCUN 4C8LA 4LF7K 5AQYA 1ILYA 4NLCA 3V4IA 1GOAA 1QQMA 3TSPA 5LMUK 3HP9A 5LMNK 3DXMA 3D6RA 4BWJA 4JAXA 3CJ9A 3SUOA 4CGDA 3PX6A 4BC2A 4CVNE 4M3ZA 3BP8A 3WQUA 4BRNA 4I9LA 3K57A 3C94A 1HMVA 4CHPA 4DV6K 4OKKA 2PYLA 3RSEA 4DFJA 3R8EA 4JI0K 2O8EB 3KLIA 3THYB 5JVGL 1CZ9A 4DHYA 1DT9A 1UA1A 4B8AB 2HBLA 3H1QA 2F8SA 1W7AA 4OPAA 2P9IB 2O8BB 5DM6L 1W2BM 4B9LA 4FJNA 1OKJA 3CHWA 3AVNA 3DMJA 4HTLA 3VMFB 1EKEA 4CFDA 3O5BA 1HYVA 3W0LA 4OKEA 2IIRA 4FWNA 3AGKA 2NRTA 3KWIA 4GMJB 5J2QA 1X1PA 1QHTA 2HF4A 1NJWA 2KZMA 1S3XA 2CGLA 1KVBA 3SUPA 2E6MA 4O5FA 3PO4A 4FYDA 3FGUA 2VG7A 4WFAL 4FCYA 3RMAA 1XQSC 1D5AA 1BL3A 4CD3A 1VQNN 3F9MA 5HBMA 1YAGA 1VSMA 3CC7N 4W5RA 1WSJA 5J2MA 3OA9A 4YORA 3OYFA 4DFMA 4OKJA 3MECA 4I6MB 1GOCA 5AQOA 1C0FA 4HHTA 3AO5A 1LOTB 1L3UA 5HP1A 3NE6A 4CEDA 4BE1A 1KXPA 1RNHA 4CZJA 2PBDA 2HOEA 4DSKA 4CJPA 1D9FA 3TI0A 4I2QA 4H0XB 1RBSA 2P9PA 3MEDA 1BQNA 3CM6A 3R3LA 4JI1K 4CFBA 2BDPA 3OHRA 1Y97A 3CPEA 3NH1A 1VQON 3IUCA 3KWGA 3OS0A 4IFVA 3KK1A 4B3RK 2AA4A 4DQ8A 3VF4A 2XY7A 4OX9K 4BR5A 3DLRA 1HJRA 4DTMA 4CHNA 3U3YA 4FWOA 4NLBA 1NGFA 5C2FA 2CGJA 3MN6A 4FPAA 3U9DA 3OJSA 5KGXA 4K0KK 3F73A 1HKCA 4C8NA 3F5TA 3LAMA 3LDQA 5LL6Z 2HNZA 3T3FA 2D0OA 3IS9A 1XC9A 5K14A 5GAHP 3T1AA 4W5QA 3DAWA 1VRTA 3J7YP 3G6EN 3TPQA 4C23A 1VQ5N 3AVKA 4BVOA 4CJ5A 2EX3A 4ELUA 1TAQA 5BN8A 4F3OA 2NLXA 4H5NA 1NGEA 1N5YA 2ZGZA 4CJ4A 4CEZA 3ZX3A 1LCUA 5CR4A 2F9WA 1Q82O 1EO1A 1FJGK 2W40A 1DKGD 3V1RA 4RWTA 3C6AA 3LDNA 3THWB 5AQQA 3P1GA 3SZ2A 3QERA 3V1OA 4CHOA 4FJ7A 1FK9A 2Y1JA 1NGIA 1NM1A 4JHDB 1DTTA 5BRHA 1NWKA 2PYJA 3SJJA 1GLCG 3ZEUB 1UA0A 4WCEL 5AQUA 2O4IA 1CLQA 4ILHA 4OPKA 4MO5A 4FM2A 1BG3A 3K0SA 2ETJA 3VEVA 1REVA 3SUNA 3P83D 3SAGA 1JKHA 4JI3K 2WFBA 2KKZA 2ZF5O 4Z4IA 4BDYA 5AZJA 4KRFA 1ZXOA 3EKUA 5C42A 3P4IA 4JK8A 1JXBA 1RBUA 3EO3A 2B4JA 3CCVN 4DLGA 3P5JA 4IEIA 5HRSA 1NLVA 1JJ2M 4FSVA 4DR1K 4LFAK 3PV8A 2P9UA 1SKSA 3OS1A 3QIPA 1K8KA 5GIPA 4FJJA 3C7NA 3CYMA 3M8PA 4O8UA 3JYTA 3K5OA 4O5BA 4LF4K 1JLBA 4W5TA 1Y64A 5AQTA 1QTMA 3LP3A 2YJFA 2YHXA 3ENBA 2Q0UA 3AVGA 3KJVA 4V19S 3ITHA 4CGFA 2YHWA 4DUYK 1S5JA 1VSDA 4DSJA 1YVUA 3ZSRA 5AZIA 3LWLA 3QBXA 1RDCA 1U2VA 1N34K 1C0UA 4N47A 4M3XA 2HHVA 1TK8A 2E20A 2XY5A 5AQVA 3DLLL 4FM0A 3L2RA 4H0PA 4OLAA 3NBPA 3EZWA 3MWPA 4NXNK 4I2PA 1CXQA 3ID8A 3OTOK 4R5PA 3NH0A 5EX5A 4LF9K 2KZZA 5KTQA 4I7FA 4XH4A 2R7YA 3L2WA 1RDDA 5KGWA 3SBTA 1IJJA 1JL2A 1IBLK 3QLHA 3VEOA 1JCEA 4JI6K 2YKMA 5C25A 1UWBA 1SUQA 2O8DB 4DSEA 4LSLA 5JLHA 4CF2A 2IC3A 1X9JA 3WXIA 1EWRA 3E1YA 3WXMB 4CF8A 1M90O 2BH1A 2NUBA 3V9UA 3E9PA 3U4LA 3DRRA 3ZCMA 3FZKA 4K43A 2F96A 4CIEA 3L4QA 1F21A 1WSFA 3O9TA 4IG3A 3CFOA 3PO5A 3ZYYX 3OYDA 1Q18A 1MWMA 3SV4A 4WYBA 3QEXA 2ATQA 3AVFA 4QCLA 2HBKA 4M41A 3NGIA 2BGGA 1ATRA 1Q9YA 1Q81O 4O8KA 3VEYA 3E66A 4ISFA 2Q31A 4H0VB 4CHZA 4M3RA 4KHSA 3BGRA 1WNSA 1IG9A 3VOVA 1NJIO 4PKHA 2YHAA 3NGZA 3CCMN 5DMRA 4FW2A 2QK9A 1ZBIA 1T3VA 4CZLA 2I5JA 4E1NA 5J2NA 4FXDA 3ZLJA 4KHQA 4GV9A 3O1WA 1C1CA 3SLCA 2O8FA 5I42A 3NCIA 3VQ8A 3TAFA 3ASMA 4E7HA 3IRXA 4B8CA 3LM9A 1P8ZA 2W6LA 1WSIA 2ASMA 5A2QO 4YOXA 2E1YA 3LZIA 5BN9A 3ZSVA 2E2QA 2B6AA 2FBYA 3ZETA 2P1JA 1S9GA 3VQ4A 4M63C 1YI2N 4EP4A 4PQUA 2FXUA 3SI6A 1SL0A 3CJAA 3NMUA 2YHBA 3ZEUA 1NGJA 2P9LA 1A5VA 4RW7A 4E89A 1MWKA 5FPEA 3UIQA 3QNNA 1FXXA 3HXMA 2E88A 3WEEB 2D0CA 5EU7A 4KKOA 1BIZA 4CGGA 5BRDA 4FWMA 2QEXN 4GNIA 2Q1NA 3LDSA 5KPZA 4ELVA 5AQIA 4Q0BA 3ZSYA 2YJEA 3I8DA 1KVAA 3TTDA 4E19A 4PKIA 3H45C 3J8AA 3CG7A 3OYIA 3CCSN 3HVRA 3DOKA 1TK5A 2OZSA 3OYNA 4CF0A 4FLTA 3UKUA 3NDKA 1A5WA 3KK2A 4OGCA 4FLVA 5HLFA 1HPMA 4K41A 3FZHA 1XWLA 3D7EO 3WQTA 4IJNA 4IJAA 3LPUA 5KPTA 3TABA 1NK0A 4BROA 1JLQA 4JKAA 5AQXA 3KK7A 1S1UA 1U49A 3L8BA 3CC4N 2HMIA 2PFUA 5CHIA 3NHGA 3GL1A 1SL2A 3QEWA 3CCQN 3KIOA 2P9SA 4Y1CA 4DU4A 1YTAA 3VTHA 3WUHA 3RWUA 1NNEA 4A62A 2HHWA 1NGGA 4LSNA 4C1NI 2QWMA 3AO2A 4IZ9A 3HVTA 4XH1A 1D9DA 1RTHA 1LWFA 5IWAK 4FLZA 4FVUA 2E2OA 4F4KA 1RDAA 4BG8A 3KHYA 4DTNA 4WQ4C 3JAMO 1S1WA 3TSUA 4DQQA 3RMCA 4EAHD 4JNEA 3E9OA 1HYZA 3QEVA 2XRIA 4C8MA 1B9FA 3D2EB 5CZ2A 3HPGA 2FSNA 5M1NA 2QTDA 1Q9XA 1E4FT 3IKMA 1JCGA 3I33A 4K42A 3UKRB 3N4QA 2IOCA 3CJ7A 3EZ5A 3L2QA 4O0JA 2Q2RA 4JD2A 2V51B 5E84A 4CJFA 4CZEA 3C95A 2ZJQL 3ALYA 2PZSA 3U3GA 3EY1A 2E6LA 2JWLA 3ZSZA 1T44A 3T7ZA 1GLEG 4EZ9A 2GX9A 4M3UA 4DQSA 4DV4K 4B3OA 2Z1JA 1LV5A 3TWHA 5AQSA 2JGUA 1XNQK 4CFCA 4N5SA 4AHVA 4Q5VA 2NNWA 4BR7A 4I9QA 3LDOA 4IO8A 3ULEB 1ASVA 4DR2K 5FPDA 3L3UA 4WFNL 2F7TA 3MMVA 3SJHA 2HHHK 2UUCK 5B8HA 3HI0A 3ZT0A 5FPNA 1YJWN 1EWQA 1JCFA 3DXKA 3UE5A 4CJKA 2OPPA 2Q0RA 3PSFA 2P9NB 4ISEA 4ZHRA 3H3OB 5BPNA 2OA8A 1S1XA 3M8RA 4BDZA 3GOIA 1W9HA 4EIAA 3CC2N 1J5OA 2G8FA 3DLBA 4E0DA 2HHXA 1KCFA 4YDUC 1KFSA 4KHPK 5F2RA 1HNZK 1VQKN 4CBWA 3KD5E 1LW2A 2Z1IA 5DK5A 2Q97A 3RMBA 2UXBK 1TKXA 1NK8A 1BA1A 1NJYA 2O8CA 4DR6K 3VF6A 3HSTB 5JICA 3CCRN 3O80A 4ILGB 5JMVA 1J54A 3QFUA 4BRKA 3S3OA 2HVIA 2BANA 5KPRA 1C0MA 3SCXA 2GUPA 3SAFA 3MN7A 4LD0A 3MXMA 1GLLO 3N4PA 3K59A 1RBTA 2P9KA 3I0RA 2QW9A 4DWIA 1S1VA 1B9DA 2FBTA 1K6YA 3H1VX 4CD1A 4CHYA 3AA2A 2KTQA 1DEJA 4FJ9A 1S9EA 3SNNA 3L0QA 2X74A 1WN7A 4WQ4A 2HHUA 4JKGB 1RTJA 4DFKA 5GINA 3K2PA 4JS4A 2QM1A 4M7XA 1ATSA 1X9WA 5KRTA 3BEXA 4FJKA 1QVGM 4BR9A 3FLCO 4E3SA 2VG5A 2WONA 1DTQA 3NH2A 1TYQA 2P51A 5FDLA 4WF9L 3ZSXA 3AVMA 3I8BA 4BWMA 1MA9B 5AFUA 1L5UA 1NK5A 3MEGA 4CJVA 2VGNA 4MO4A 4A2AA 4E7IA 1J53A 3TAQA 4QS8A 1K73O 2D0PA 4X62K 3CFPA 1BI4B 4Y0WA 5AQMA 3VA0A 3FZLA 3AVBA 2KLAA 1MU2A 4DG1A 4RCHA 2QWNA 3O4QA 4CEQA 3THXB 3SMPA 3EKSA 3EE8A 4PL8A 1KAXA 5BREA 2FF3B 4BREA 3M8QA 3V6DA 1T05A 4J2AA 4KTZA 2AP1A 1KD1O 4XH5A 3HSCA 3HZ6A 3V9ZA 5AQFA 1H1VA 1NMNA 3AVJA 3JSMA 4Z4EA 4MLEA 3O3GA 3NF7A 4JKEA 4MDAA 4F8RA 5M1FA 5C0YA 1JLFA 4CCHA 1RT4A 4E7JA 3SUQA 4DLEA 5AFUH 3AVCA 3HRGA 1HLUA 1VAZA 1VRUA 2ZD1A 5EOYA 4JRQA 1GOBA 4CK2A 3AVIA 3FZFA 1KSPA 2KFZA 5GAEP 1EX4A 2KQ2A 4FW1A 4DTSA 4CF1A 2OTJN 1WUAA 4KH4A 4CJ3A 4FJLA 4YOVA 3SQ0A 3D2FB 4YDUA 1KAZA 2EHGA 3A5OC 4CGJA 4FLWA 1QSYA 1JL1A 3PIPL 4EHTA 3U6FA 3ENHA 4PHTX 1S6QA 3PY8A 4F2RA 4KHUA 1FKPA 1ESVA 2GWKA 3VQ6A 2P5OA 4W5OA 4C8OA 4FLYA 3MCPA 2XY6A 4X66K 2GV9A 3ISNC 3DLGA 1KVCA 2V7YA 1HPZA 4Z0UA 5FRNA 1VQ9N 2E5LK 1YT3A 5EVZA 4AH9A 3T19A 4DV0K 4GKKK 5CZ1A 1T7PA 1NKBA 3ATUA 2VWKA 3CCLN 2BUPA 4FWKA 3AVHA 3HP6A 2VWJA 4B3TK 3LANA 4LF8K 4AF1A 3GDQA 4JYAK 4FWRA 2OZMA 3OYMA 1QZ6A 2O8EA 1WAJA 1R59O 4DQPA 2QWOA 1NGBA 1XI1A 3THYA 2XO7A 4CEFA 3LL3A 5CYQA 1A5XA 3MAQA 3LP0A 1U04A 3T69A 4B9TA 1SAZA 5TKYA 5AQRA 1U4BA 4DTUA 4JLHA 3O8MA 5ELZA 3WNGA 2P9IA 3TU5A 1QQCA 2O8BA 1TAUA 5BRFA 2LSNA 3CQ8A 4BGBA 2NRXA 3MXIA 4BRHA 5BR8K 4N76A 1X9MA 5F0XA 3C6HA 5JS2A 5HROA 4KPYA 1VSKA 2DFEA 4JK7A 4UQGA 3VGLA 4DTXA 3QEPA 2VYPA 3AARA 4DTPA 1HR0K 2Y1IA 5HL7L 2PY5A 1W97L 1OH5A 1HNWK 4QAGA 2QWPA 4LY7A 5M1QA 3IFRA 1VHXA 1G15A 4CBUA 3BF3A 3BZKA 3HBTA 1BOTO 3O9SA 2QA4N 3WNFA 4ZTFA 4BQLA 3B6OA 1HX1A 4OLBA 1YVNA 4RG8A 2VQFK 4FJIA 4CFAA 1RT2A 4IOAL 2IVPA 1NMDA 5D3GA 4I6MA 4LH5A 4B3SK 3AA4A 4FLXA 3W3DA 4H4OA 4DS4A 3MK6A 3TSQA 3ZX0A 3J81O 3I0SA 2YCHA 1FKOA 4FL9A 3DM2A 4KH5A 4CBXA 4KHNA 4CGHA 3VGMA 4CZKA 4A5AA 1JLEA 3HT3A 3V9XA 4F2SA 4JI2K 1NK9A 4AHSA 4BRPA 2ZM6K 3TARA 4BE0A 1TL1A 4KHYA 2ZQBA 3L3VA 4IOCL 4HCBA 3MCAB 4FO0A 4FK2A 4F3TA 4GKJK 1BA0A 1NJXA 3WNHA 4CJTA 3HK2A 2HHQA 3DJCA 2KFNA 3R1XA 4KFBA 3H6EA 3R6MA 2IVNA 4J8FA 4YNQA 1GLDG 2D0AA 4JKHA 1TKDA 2W6KA 2E8AA 4RW4A 4DR3K 3MN5A 4BC5A 3SPYA 4NYNA 4ID1A 2V52B 3EYZA 3ATVA 3R9PA 2F9TA 5AQWA 4K8ZA 2A6AA 2UXDK 2NRVA 4M3WA 5SWMA 5HOOA 3VQ9A 4IWVA 3G0ZA 3K9KA 4FJ8A 4CEOA 3EE9A 4DQRA 3DXMB 2B5JA 2HB5A 3OYBA 1T03A 4IG0A 2NRRA 4DQIA 4H0YB 4KI4A 4M7YA 4K8XA 2OPQA 4DSFA 2GEMA 1YF5L 2F4VK 3H3NO 3RSEB 2QWRA 2HHSA 2FSJA 3THWA 4AILC 4FOEA 4FK0A 4JKFA 4H5VA 1QQNA 1VSIA 4JHDA 4Y1DA 3L4IA 4R79A 4RW9A 3RVCA 1IBMK 3VEZA 2QXLA 2E4LA 1RBVA 3OYAA 1C1BA 3BUZB 1EQYA 2FBXA 3M1FA 1WOQA 2IS3A 4CECA 5M1KA 3NVMA 4E1JA 2CH5A 1C0TA 3MX2A 3K5MA 4BR0A 4KTWA 4LF6K 3KKRA 3QBWA 3V9SA 3FFIA 2YV0X 3KZBA 3QMLA 3SMSA 5HRNA 2UXCK 4GY2B 3SQ1A 3HTVA 1OH7A 4B9MA 3ZT3A 3KLFA 1HRHA 3KTQA 3RRHA 1VQ8N 2KHOA 1IKYA 1QQOA 3ID6A 3NGYA 4YHHK 4ILJA 3Q7CA 3F2KA 4DR5K 1IH7A 1VQ7N 1ITGA 3AAQA 5ADXA 4CZIA 3WT0A 4H8KA 3QESA 2DFFA 1ASUA 3S9HA 1E4GT 1JXEA 1ZBFA 1YTUA 1XHZA 3RRGA 1FW6A 1O1WA 3LZJA 5AJ3K 4GV3A 4NO7A 3J80O 4FZYA 2ASPA 3DI6A 4CJWA 4CJRA 3MX5A 1Z6RA 3CF5L 4GV6A 4CESA 1BIUA 1ZBSA 1HQEA 2RE2A 3CETA 3CPWM 4B08A 1ASWA 4HVJA 4KAZA 2BE2A 5FPMA 2RN2A 1N36K 2OYQA 3QIOA 5CYMA 2P9PB 4JKDA 3L2VA 3CI5A 2VQEK 3S41A 2RF2A 1C1AA 4JI5K 1G99A 4WQ5A 3VENA 1J5EK 1TV6A 1J6ZA 3KKSA 3AA3A 3OYGA 3RR8A 1N8RO 1J9AA 4YOWA 1VSEA 4G1QA 4FJ5A 1Z25A 4N56A 4HCCA 4U7BA 4H03B 3DYAA 1NGDA 5AQLA 4J2DA 1BGXT 1XHXA 2O8DA 4CK1A 1U47A 4NCBA 3LALA 3PX4A 1TKTA 2ZE2A 1BO5O 1VSLA 5J1EA 4J2BA 4BRDA 3KK3A 4CW7B 2HW3A 3U8XA 4DV2K 1VSJA 2E1ZA 1HNXK 3OY9A 3RMDA 2YKNA 3HYFA 4KTQA 1TVRA 3AA5X 2GTDA 4XEIA 1RT7A 1NK4A 4DTOA 5C12A 4OVLA 3JXUA 1XC3A 3LM2A 4CF9A 4B9SA 1DGKN 3CJBA 5M1PA 3D45A 4IBNA 4KHWA 2DTUA 4KV8A 1VQ4N 2YNIA 5KI6A 3QICA 4LH4A 4PY5A 2YI1A 1TUYA 5GADP 1V4SA 2IDOA 3CJ1A 3SYZA 4G9ZA 2YX6A 4DU3A 4DV1K 1KC8O 4DMNA 3G25A 1CZBA 3VQEA 1X9SA 4BY9C 2ZGYA 3ZT1A 2A1SA 2RHKA 3NF9A 3VERA 1YITN 5IT9O 3AO4A 2P5GA 1B92A 1NK7A 1NGAA 4NXMK 3OYCA 2XY8A 1ZBLA 3O4WA 2W42A 1Q7YO 2FSKA 4BG9A 3QFPA 5AZJB 2D1KA 3PIOL 4C1NK 4DSLA 2NZTA 2WTUA 2OANA 1N6QA 4XIUA 1VSFA 4YOTA 1LWCA 3A5MC 3LAKA 4JN4A 2P9UB 2NRHA 4MQ3A 5EXWA 4EFHA 4DF4A 1RTDA 1K8KB 2G8UA 5SZTA 3VEXA 4CIGA 3C7NB 3LDPA 2D0BA 3EEQA 2HBMA 1QE1A 4IOXA 4IFYA 4QOZB 2ZJPL 4B9QA 4BACA 2G8IA 1OH8A 4B9UA 1RTIA 4H0TB 3T1HK 3J7AP 2Q3SA 4BE2A 4B9VA 3IAYA 2QXFA 3B8AX 3QO9A 3AVAA 4KB0A 5E41A 3HPOA 2X6NA 1I3AA 3WEEA 4KREA 1OVYA 1LAVA 1QZ5A 1RDBA 3DRSA 4DV5K 5AZIB 4X65K 2A3ZA 3ZSWA 5TKWA 3P39A 2QKBA 1GLJO 3NF6A 4FJGA 4Z4FA 1U2VB 3RR7A 4B1WB 1HNIA 5C15A 1XMOK 2H3GX 5DM7L 1WB9A 4KB1A 3FR0A 3VQPA 2X6SA 1NJZA 1VQ6N 1NGCA 3SPZA 3WXLA 2D5RA 1IV0A 1NU0A 5LJWA 4DTRA 3GG4A 1S22A 4B1VA 3H08A 3T1YK 4B1UB 4JI4K 4B1ZA 1RILA 1LW0A 3O3HA 2FF6A 3VETA 2GWJA 2ZWHA 4K25A 4PWDA 2QKKA 2X78A 2OPSA 1BISA 2I7PA 1U45A 1RT1A 2EWSA 4MLHA 3LWMA 5JS1A 4RW8A 3NAEA 3QEIA 4AHUA 3VGKA 3MWTA 5KQ8A 3ULDA 3VEWA 2E2PA 3VESA 3SQ2A 1S1TA 3GE1A 1E3MA 1Q8IA 4KO0A 1SKWA 4BRQA 5KRSA 2J4RA 1R0AA 4FPBA 4JK9A 4PUOA 4BRAA 2XHBA 2G8HA 4AM6A 5GAGP 4DKWA 4CJQA 3TTCA 1K8AO 1X3NA 2QWQA 5I9EB 3PUFA 3GBTA 4LFBK 1JLCA 2F8TA 1WBDA 3PLAA 5C2DA 1HYSA 2IGIA 1ZYQA 3CFRA 4DTJA 3D2EA 5FROA 3VQ5A 3J7ZO 4AM7A 1BHLA 1KTQA 1NKCA 4BQZA 1LWEA 4CEEA 3K5NA 2DPNA 1NKEA 3UKRA 1Z05A 1XMQK 3BZCA 4YY3K 3HM8A 4QS7A 1BWFO 1LAWA 1SKRA 1RFQA 5HRRA 3G71N 1NOZA 4Z4GA 5KQDA 3NVKA 1IKVA 4BRFA 3K58A 3THVA 3IDHA 4BR2A 3O9QA 2QWLA 1T6DA 3LP1A 4LFCK 4ELTA 1KQSM 4ZTJA 5HRPA 2O8FB 3CMEN 1RDUA 2KW4A 3A2FA 2YNGA 4FM1A 4F9OA 4CE9A 4J2EA 1HKGA 1P90A 4B9NA 2VGMA 3OJUA 3O3FA 3M8SA 1RCHA 4BGAA 2UU9K 3OW2M 3OYJA 2A40A 5F1XA 2GELA 5J2PA 2G8WA 2A5XA 4EZ6A 3ULEA 1DLOA 2AJQA 3ZETB 3VTIA 4IEEA 4CEAA 3AO1A 5E26A 2WBNA 3TAGA 4H5RA 3FFKB
chains in the Genus database with same CATH topology
3AO2A 4GMJB 5J2QA 3HVTA 4O44A 1X1PA 1D9DA 4FK4A 3SPYA 1QHTA 1RTHA 4AHTA 1LWFA 1NJWA 5I3UA 4HUEA 4FLZA 2KZMA 4F4KA 4NYNA 1RDAA 1KVBA 1SV5A 4ID1A 1NOYA 4DTNA 3SUPA 3EYZA 2E6MA 5FRMA 3PO4A 4FYDA 1S1WA 2VG7A 4FCYA 3V9WA 4K8ZA 3L2UA 3RMAA 1D5AA 4DQQA 1BL3A 3VQAA 4M3WA 5SWMA 3RMCA 3DLHA 1ZBUA 1TL3A 5HBMA 3VQ9A 1HYZA 3G0ZA 3QEVA 3HPHA 1UOCA 1VSMA 4FJ8A 4O55A 4W5RA 2IAJA 1WSJA 2XRIA 4C8MA 4CEOA 4DQRA 1B9FA 4CJEA 5J2MA 3OYFA 4DFMA 4OKJA 3MECA 5CZ2A 2B5JA 4CHQA 2HB5A 3HPGA 3MEEA 3OYBA 1WSEA 1GOCA 3CM5A 1T03A 1Q9XA 2RPIA 4IG0A 2O4GA 4DQIA 4KI6A 4HHTA 3AO5A 1L3UA 4E7KA 4KI4A 1EXQA 5HP1A 4FZZA 3IG1A 4CEDA 4E1MA 3NE6A 4BE1A 4K8XA 1RNHA 2OPQA 4DSFA 2ITGA 1NK6A 2IOCA 3EZ5A 2HHSA 3L2QA 4O0JA 4DSKA 4CJPA 4AILC 4CJFA 1D9FA 4NYFA 3ZSOA 3S3MA 1L3VA 4L8RB 4FK0A 3C95A 3F9KA 3TI0A 4I2QA 3ALYA 1VSIA 1RBSA 3MEDA 2PZSA 1BQNA 4Y1DA 3U3GA 3QETA 4M42A 3CM6A 4RW9A 3EY1A 4PA1A 4JRPA 3PX0A 4CFBA 2BDPA 3K5LA 2E6LA 1Y97A 2E4LA 1RBVA 3ZSZA 3OYAA 4EZ9A 3NH1A 1T8EA 1C1BA 4DQSA 4M3UA 4B3OA 3OS0A 4IFVA 2FBXA 2Z1JA 1LV5A 3TWHA 4YFUA 2IS3A 5C24A 2JGUA 4CECA 3KK1A 4BDPA 2Z1GA 4CFCA 2XY7A 4N5SA 4AHVA 1C0TA 3ZT4A 4Q5VA 4I9QA 3K5MA 3DLRA 4KTWA 1HJRA 3E01A 3KD1E 3KKRA 4DTMA 4CHNA 3V9SA 3FFIA 2YV0X 3U3YA 2FC0A 1ASVA 2OPRA 3VN5A 5HRNA 3SQ1A 4AHRA 3L3UA 4B9MA 3D0PA 3ZT3A 3VQQA 3OJSA 1HRHA 4FVMA 4OPJA 5KGXA 3KLFA 3F73A 3ZT0A 3KTQA 3RRHA 1IKYA 4C8NA 3HJFA 4CJKA 3LAMA 2G8VA 3NGYA 2HNZA 3T3FA 2OPPA 1IH7A 3OYKA 3IS9A 1XC9A 1ITGA 4ZHRA 5K14A 4DSIA 3OYEA 2OA8A 1S1XA 3T1AA 3VA3A 3DRPA 4W5QA 4H8KA 3QESA 3M8RA 2DFFA 3NFAA 3AO3A 3TAMA 4BDZA 1ASUA 1TGOA 1VRTA 1W9HA 3DOLA 4CIFA 1IKWA 3S9HA 1JXEA 1ZBFA 1YTUA 3TAPA 4FZXC 1J5OA 1XHZA 2G8FA 3AVKA 3RRGA 1O1WA 1QS4A 3DLBA 3LZJA 4E0DA 4CJ5A 2EX3A 3KLGA 1TAQA 4ELUA 4F3OA 1KCFA 2HHXA 1KFSA 1N5YA 1BI4A 3KD5E 1LW2A 4CJ4A 4CEZA 2Z1IA 5DK5A 3C6UA 4FZYA 3DI6A 2HVHA 4CJWA 4CJRA 1JLGA 3ZSQA 3RMBA 4CESA 1TKXA 1NK8A 1BIUA 1NJYA 3V1RA 5CY4A 1HQEA 1RBRA 3HSTB 1KLNA 4B08A 1ASWA 4HVJA 4KAZA 3P1GA 3SZ2A 3QERA 1J54A 3V1OA 2BE2A 5J2NA 3S3OA 4GW6A 2HVIA 2RN2A 4CHOA 4FJ7A 2BANA 2OYQA 1FK9A 3QIOA 5CYMA 4CK3A 1C0MA 1RT3A 2Y1JA 3SCXA 3MXMA 4LD0A 3L2VA 1DTTA 3DLKA 2PYJA 3SJJA 1UA0A 3K59A 1RBTA 2O4IA 1CLQA 4DF8A 2RF2A 1C1AA 3I0RA 1KFDA 4OPKA 1S1VA 1B9DA 2FBTA 1K6YA 4FM2A 4DWIA 2ETJA 4CHYA 4N41A 1REVA 3AA2A 3SUNA 2KTQA 1WLJA 3P83D 1JKHA 1TV6A 4CEBA 4CERA 4FJ9A 3KKSA 1S9EA 3SNNA 1BCMA 3AA3A 3OYGA 2X74A 4Z4IA 1WN7A 4BDYA 3SV3A 1HNVA 4H4MA 3RR8A 1J9AA 2HHUA 1RTJA 4DFKA 3DLEA 3TANA 1VSEA 4G1QA 4FJ5A 1Z25A 4KRFA 5C42A 3K2PA 4JS4A 2YNFA 4N56A 4HCCA 3OVNA 3C6TA 1EP4A 1JXBA 1RBUA 2B4JA 2GBZA 4DLGA 3DYAA 1JLAA 3P5JA 4DS5A 5HRSA 4MFBA 4J2DA 1BGXT 1XHXA 4CK1A 1BCOA 1U47A 4NCBA 3LALA 5KRTA 3PV8A 1X9WA 3VQ7A 3PX4A 4FJXA 1TKTA 1SKSA 3HM9A 2ZE2A 1VSLA 1RT6A 5J1EA 3OS1A 4J2BA 4FJKA 3QIPA 3KK3A 3TR8A 4E3SA 4FJJA 2HW3A 2VG5A 1SL1A 1VSJA 1DTQA 2JLEA 2WONA 3CYMA 3LP2A 3M8PA 3NH2A 3OY9A 3K5OA 4O5BA 4IDKA 3JYTA 4DFPA 1JLBA 4TSXA 3RMDA 4HUGA 2YKNA 2P51A 3HYFA 4O4GA 4KTQA 1TVRA 4W5TA 3AA5X 3VQBA 3KLHA 1IKXA 5FDLA 2RKIA 4M3TA 1QTMA 3ZSXA 4ID5A 1RT7A 1EETA 3LP3A 4M45A 3AVMA 3ZT2A 4BWMA 1NK4A 4DTOA 4OVLA 1KLMA 1L5UA 1NK5A 3MEGA 4CJVA 3RTVA 4DU1A 3AVGA 3KJVA 1WAFA 3ITHA 1I39A 4CGFA 4CF9A 2HHTA 4E7IA 1S5JA 1J53A 4Z4CA 1VSDA 4B9SA 3TAQA 3D45A 4DSJA 4IBNA 3CFPA 1YVUA 1BI4B 3ZSRA 4KHWA 2DTUA 3VA0A 4FJHA 3LWLA 1L3SA 4KV8A 3AVBA 1VK0A 4DG1A 1MU2A 2YNIA 4LH4A 5KI6A 3O4QA 4CEQA 4PY5A 1RDCA 3HO1A 3G10A 3OYHA 3LPTA 1D8YA 1W0HA 1C0UA 4N47A 4M3XA 2HHVA 2IDOA 1TK8A 4CJUA 2XY5A 4FM0A 3SYZA 3L2RA 3M8QA 4OLAA 3HL8A 3NBPA 2GUIA 4DU3A 3V6DA 1T05A 4HTUA 4I2PA 4J2AA 2DFHA 4KTZA 1WSHA 1CZBA 3VQEA 1CXQA 2VG6A 4DMNA 1X9SA 1KRPA 3V9ZA 3ZT1A 5T7BA 2A1SA 3NF9A 3VQDA 3AVJA 4R5PA 3JSMA 3QNOA 3AO4A 2P5GA 1B92A 3NH0A 4HUFA 4Z4EA 1VSHA 1NK7A 3O3GA 3OYCA 4JS5A 1ZBHA 3NF7A 2KZZA 3V1QA 5KTQA 4I7FA 2XY8A 2R7YA 1ZBLA 4F8RA 2W42A 1JLFA 3L2WA 1RDDA 5KGWA 4CCHA 3NF8A 1RT4A 2HNYA 4E7JA 3SUQA 4DLEA 1TKZA 1JL2A 3AVCA 2ZD1A 1VRUA 3QLHA 4JRQA 1QSSA 1GOBA 4CK2A 3AVIA 4DSLA 4FXDA 1KSPA 4FJMA 2YKMA 2FBVA 2KFZA 3V81A 1N6QA 4XIUA 1VSFA 1TK0A 5C25A 1CXUA 1EX4A 1SUQA 1UWBA 2KQ2A 1LWCA 4FW1A 4CF1A 3KLEA 4DTSA 4CJ3A 4FJLA 3SQ0A 3LAKA 4DSEA 2EHGA 4LSLA 4CGJA 4FLWA 1QSYA 1QSLA 1JL1A 4CF2A 3U6FA 2G8KA 4MQ3A 2IC3A 2A1RA 4DF4A 1RTDA 1S6QA 3PY8A 2G8UA 5SZTA 1S6PA 4F2RA 4CIGA 4KHUA 4CF8A 1FKPA 2D0BA 3VQ6A 2NUBA 1QE1A 3V9UA 4IFYA 4E7LA 3DRRA 2P5OA 4QOZB 4W5OA 3VQCA 4BACA 2G8IA 4C8OA 3ZCMA 4FLYA 2XY6A 4B9UA 1RTIA 4O0IA 2F96A 4CIEA 2Q3SA 2GV9A 3ISNC 4BE2A 4B9VA 3DLGA 3IAYA 1KVCA 2QXFA 1F21A 3QO9A 1HPZA 1WSFA 4Z0UA 1L3TA 3AVAA 4KB0A 4IG3A 3CFOA 5E41A 3HPOA 5FRNA 3PO5A 2X6NA 1YT3A 1I3AA 4ICLA 4AH9A 4AHCA 3OYDA 4KREA 1LAVA 3T19A 3S3NA 1RDBA 3DRSA 3SV4A 5CZ1A 3ZSWA 3QEXA 2QKBA 2ATQA 3AVFA 1NKBA 3NF6A 1T7PA 4QCLA 4FJGA 2VWKA 4Z4FA 3RR7A 1IO2A 4M41A 3NGIA 2BGGA 1HNIA 1Q9YA 4FLUA 3SQ4A 3AVHA 3HP6A 2VWJA 4KB1A 3BDPA 3VQPA 2X6SA 3LANA 4CHZA 4OGEA 4M3RA 3WNEA 4KHSA 1NJZA 3BGRA 1WNSA 1IG9A 3SPZA 4C8KA 1HQUA 2OZMA 2D5RA 4DTRA 2YHAA 3OYMA 3NGZA 5DMRA 2HNDA 1WAJA 3H08A 3O4NA 4FW2A 4CJSA 4DQPA 1ZBIA 2QK9A 1XI1A 1Z26A 2WOMA 2I5JA 4E1NA 4CEFA 2XO7A 1RILA 3MXJA 1LW0A 3O3HA 5CYQA 1A5XA 4IKFA 3MAQA 4KHQA 3LP0A 1U04A 4B9TA 4NCAA 1C1CA 4M3YA 4PWDA 1U4BA 2QKKA 2X78A 4DTUA 4JLHA 5I42A 2OPSA 3NCIA 3WNGA 1U48A 2DY4A 4WE1A 1BISA 3VQ8A 1QQCA 3TAFA 1BQMA 3ASMA 4E7HA 1C6VA 1TAUA 2LSNA 3IRXA 4B8CA 1RT1A 3CQ8A 1U45A 3TAEA 3LWMA 3MXIA 5JS1A 4RW8A 3NAEA 4RW6A 4EP5A 4AHUA 3OYLA 3QEIA 3B6PA 4N76A 1X9MA 1WSIA 1WSGA 3LZIA 3ZSVA 2B6AA 2FBYA 3ULDA 2P1JA 5JS2A 4CJLA 3SQ2A 5HROA 4KPYA 1S1TA 1S9GA 1VSKA 3AVLA 4NCGA 3VQ4A 2DFEA 4W5NA 4EP4A 4UQGA 4PQUA 3OS2A 3SI6A 1RT5A 1Q8IA 4KO0A 1SL0A 1SKWA 4DTXA 3AV9A 5KRSA 2YHBA 3QEPA 4DTPA 2Y1IA 1R0AA 4Z4HA 2PY5A 2Z1HA 4OJRA 4PUOA 1A5VA 4RW7A 4QAGA 2XHBA 2G8HA 4LY7A 3QINA 4GVMA 4E89A 1G15A 3UIQA 4CGIA 3QNNA 4CJQA 1FXXA 3HXMA 1UAXA 2YNHA 4C8LA 3WNFA 2D0CA 5EU7A 4ZTFA 3B6OA 3PUFA 4KKOA 1BIZA 1JLCA 4CGGA 3V4IA 4OLBA 2F8TA 1GOAA 3LDSA 1HYSA 4ELVA 2IGIA 4RG8A 3HP9A 1ZYQA 4CFAA 1RT2A 3CFRA 4DTJA 4FJIA 4Q0BA 5D3GA 3ZSYA 4LH5A 4BWJA 5FROA 3VQ5A 1BHLA 1KTQA 1NKCA 3SUOA 3AA4A 4CGDA 3I8DA 1KVAA 1LWEA 4FLXA 3PX6A 4M3ZA 4H4OA 4E19A 4DS4A 4CEEA 4I9LA 3K5NA 1NKEA 3K57A 3C94A 3I0SA 1FKOA 1HMVA 4CHPA 3OYIA 3CG7A 3DM2A 1TK5A 3HVRA 3DOKA 2OZSA 1LAWA 3OYNA 5HRRA 1SKRA 4OKKA 4CF0A 4FLTA 2PYLA 4DFJA 1NOZA 4KHNA 3NDKA 4Z4GA 1A5WA 3KK2A 4CGHA 1JLEA 3KLIA 1IKVA 4OGCA 3HT3A 3K58A 4FLVA 3V9XA 5HLFA 3THVA 1CZ9A 4F2SA 1XWLA 3LP1A 1UA1A 1NK9A 4ELTA 4ZTJA 4B8AB 5HRPA 4AHSA 3LPUA 3TABA 2KW4A 3A2FA 1NK0A 2YNGA 4FM1A 2F8SA 1JLQA 4CE9A 4J2EA 4B9NA 3TARA 1S1UA 3OJUA 1TL1A 4BE0A 2ZQBA 1U49A 3O3FA 4B9LA 4FJNA 4KHYA 3L3VA 3M8SA 1RCHA 3AVNA 3L8BA 4HCBA 2HMIA 3DMJA 3NHGA 1EKEA 3OYJA 5J2PA 4FK2A 4F3TA 4CFDA 1SL2A 2G8WA 1NJXA 4EZ6A 3WNHA 3QEWA 4CJTA 3KIOA 1DLOA 1HYVA 3HK2A 2AJQA 2HHQA 4Y1CA 4OKEA 4CEAA 2KFNA 4DU4A 1YTAA 3RWUA 3AO1A 4KFBA 2HHWA 4YNQA 3TAGA 2D0AA 1TKDA 4LSNA 4RW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AO2 A;  4GMJ B;  5J2Q A;  3HVT A;  4O44 A;  1X1P A;  1D9D A;  4FK4 A;  3SPY A;  1QHT A;  1RTH A;  4AHT A;  1LWF A;  1NJW A;  5I3U A;  4HUE A;  4FLZ A;  2KZM A;  4F4K A;  4NYN A;  1RDA A;  1KVB A;  1SV5 A;  4ID1 A;  1NOY A;  4DTN A;  3SUP A;  3EYZ A;  2E6M A;  5FRM A;  3PO4 A;  4FYD A;  1S1W A;  2VG7 A;  4FCY A;  3V9W A;  4K8Z A;  3L2U A;  3RMA A;  1D5A A;  4DQQ A;  1BL3 A;  3VQA A;  4M3W A;  5SWM A;  3RMC A;  3DLH A;  1ZBU A;  1TL3 A;  5HBM A;  3VQ9 A;  1HYZ A;  3G0Z A;  3QEV A;  3HPH A;  1UOC A;  1VSM A;  4FJ8 A;  4O55 A;  4W5R A;  2IAJ A;  1WSJ A;  2XRI A;  4C8M A;  4CEO A;  4DQR A;  1B9F A;  4CJE A;  5J2M A;  3OYF A;  4DFM A;  4OKJ A;  3MEC A;  5CZ2 A;  2B5J A;  4CHQ A;  2HB5 A;  3HPG A;  3MEE A;  3OYB A;  1WSE A;  1GOC A;  3CM5 A;  1T03 A;  1Q9X A;  2RPI A;  4IG0 A;  2O4G A;  4DQI A;  4KI6 A;  4HHT A;  3AO5 A;  1L3U A;  4E7K A;  4KI4 A;  1EXQ A;  5HP1 A;  4FZZ A;  3IG1 A;  4CED A;  4E1M A;  3NE6 A;  4BE1 A;  4K8X A;  1RNH A;  2OPQ A;  4DSF A;  2ITG A;  1NK6 A;  2IOC A;  3EZ5 A;  2HHS A;  3L2Q A;  4O0J A;  4DSK A;  4CJP A;  4AIL C;  4CJF A;  1D9F A;  4NYF A;  3ZSO A;  3S3M A;  1L3V A;  4L8R B;  4FK0 A;  3C95 A;  3F9K A;  3TI0 A;  4I2Q A;  3ALY A;  1VSI A;  1RBS A;  3MED A;  2PZS A;  1BQN A;  4Y1D A;  3U3G A;  3QET A;  4M42 A;  3CM6 A;  4RW9 A;  3EY1 A;  4PA1 A;  4JRP A;  3PX0 A;  4CFB A;  2BDP A;  3K5L A;  2E6L A;  1Y97 A;  2E4L A;  1RBV A;  3ZSZ A;  3OYA A;  4EZ9 A;  3NH1 A;  1T8E A;  1C1B A;  4DQS A;  4M3U A;  4B3O A;  3OS0 A;  4IFV A;  2FBX A;  2Z1J A;  1LV5 A;  3TWH A;  4YFU A;  2IS3 A;  5C24 A;  2JGU A;  4CEC A;  3KK1 A;  4BDP A;  2Z1G A;  4CFC A;  2XY7 A;  4N5S A;  4AHV A;  1C0T A;  3ZT4 A;  4Q5V A;  4I9Q A;  3K5M A;  3DLR A;  4KTW A;  1HJR A;  3E01 A;  3KD1 E;  3KKR A;  4DTM A;  4CHN A;  3V9S A;  3FFI A;  2YV0 X;  3U3Y A;  2FC0 A;  1ASV A;  2OPR A;  3VN5 A;  5HRN A;  3SQ1 A;  4AHR A;  3L3U A;  4B9M A;  3D0P A;  3ZT3 A;  3VQQ A;  3OJS A;  1HRH A;  4FVM A;  4OPJ A;  5KGX A;  3KLF A;  3F73 A;  3ZT0 A;  3KTQ A;  3RRH A;  1IKY A;  4C8N A;  3HJF A;  4CJK A;  3LAM A;  2G8V A;  3NGY A;  2HNZ A;  3T3F A;  2OPP A;  1IH7 A;  3OYK A;  3IS9 A;  1XC9 A;  1ITG A;  4ZHR A;  5K14 A;  4DSI A;  3OYE A;  2OA8 A;  1S1X A;  3T1A A;  3VA3 A;  3DRP A;  4W5Q A;  4H8K A;  3QES A;  3M8R A;  2DFF A;  3NFA A;  3AO3 A;  3TAM A;  4BDZ A;  1ASU A;  1TGO A;  1VRT A;  1W9H A;  3DOL A;  4CIF A;  1IKW A;  3S9H A;  1JXE A;  1ZBF A;  1YTU A;  3TAP A;  4FZX C;  1J5O A;  1XHZ A;  2G8F A;  3AVK A;  3RRG A;  1O1W A;  1QS4 A;  3DLB A;  3LZJ A;  4E0D A;  4CJ5 A;  2EX3 A;  3KLG A;  1TAQ A;  4ELU A;  4F3O A;  1KCF A;  2HHX A;  1KFS A;  1N5Y A;  1BI4 A;  3KD5 E;  1LW2 A;  4CJ4 A;  4CEZ A;  2Z1I A;  5DK5 A;  3C6U A;  4FZY A;  3DI6 A;  2HVH A;  4CJW A;  4CJR A;  1JLG A;  3ZSQ A;  3RMB A;  4CES A;  1TKX A;  1NK8 A;  1BIU A;  1NJY A;  3V1R A;  5CY4 A;  1HQE A;  1RBR A;  3HST B;  1KLN A;  4B08 A;  1ASW A;  4HVJ A;  4KAZ A;  3P1G A;  3SZ2 A;  3QER A;  1J54 A;  3V1O A;  2BE2 A;  5J2N A;  3S3O A;  4GW6 A;  2HVI A;  2RN2 A;  4CHO A;  4FJ7 A;  2BAN A;  2OYQ A;  1FK9 A;  3QIO A;  5CYM A;  4CK3 A;  1C0M A;  1RT3 A;  2Y1J A;  3SCX A;  3MXM A;  4LD0 A;  3L2V A;  1DTT A;  3DLK A;  2PYJ A;  3SJJ A;  1UA0 A;  3K59 A;  1RBT A;  2O4I A;  1CLQ A;  4DF8 A;  2RF2 A;  1C1A A;  3I0R A;  1KFD A;  4OPK A;  1S1V A;  1B9D A;  2FBT A;  1K6Y A;  4FM2 A;  4DWI A;  2ETJ A;  4CHY A;  4N41 A;  1REV A;  3AA2 A;  3SUN A;  2KTQ A;  1WLJ A;  3P83 D;  1JKH A;  1TV6 A;  4CEB A;  4CER A;  4FJ9 A;  3KKS A;  1S9E A;  3SNN A;  1BCM A;  3AA3 A;  3OYG A;  2X74 A;  4Z4I A;  1WN7 A;  4BDY A;  3SV3 A;  1HNV A;  4H4M A;  3RR8 A;  1J9A A;  2HHU A;  1RTJ A;  4DFK A;  3DLE A;  3TAN A;  1VSE A;  4G1Q A;  4FJ5 A;  1Z25 A;  4KRF A;  5C42 A;  3K2P A;  4JS4 A;  2YNF A;  4N56 A;  4HCC A;  3OVN A;  3C6T A;  1EP4 A;  1JXB A;  1RBU A;  2B4J A;  2GBZ A;  4DLG A;  3DYA A;  1JLA A;  3P5J A;  4DS5 A;  5HRS A;  4MFB A;  4J2D A;  1BGX T;  1XHX A;  4CK1 A;  1BCO A;  1U47 A;  4NCB A;  3LAL A;  5KRT A;  3PV8 A;  1X9W A;  3VQ7 A;  3PX4 A;  4FJX A;  1TKT A;  1SKS A;  3HM9 A;  2ZE2 A;  1VSL A;  1RT6 A;  5J1E A;  3OS1 A;  4J2B A;  4FJK A;  3QIP A;  3KK3 A;  3TR8 A;  4E3S A;  4FJJ A;  2HW3 A;  2VG5 A;  1SL1 A;  1VSJ A;  1DTQ A;  2JLE A;  2WON A;  3CYM A;  3LP2 A;  3M8P A;  3NH2 A;  3OY9 A;  3K5O A;  4O5B A;  4IDK A;  3JYT A;  4DFP A;  1JLB A;  4TSX A;  3RMD A;  4HUG A;  2YKN A;  2P51 A;  3HYF A;  4O4G A;  4KTQ A;  1TVR A;  4W5T A;  3AA5 X;  3VQB A;  3KLH A;  1IKX A;  5FDL A;  2RKI A;  4M3T A;  1QTM A;  3ZSX A;  4ID5 A;  1RT7 A;  1EET A;  3LP3 A;  4M45 A;  3AVM A;  3ZT2 A;  4BWM A;  1NK4 A;  4DTO A;  4OVL A;  1KLM A;  1L5U A;  1NK5 A;  3MEG A;  4CJV A;  3RTV A;  4DU1 A;  3AVG A;  3KJV A;  1WAF A;  3ITH A;  1I39 A;  4CGF A;  4CF9 A;  2HHT A;  4E7I A;  1S5J A;  1J53 A;  4Z4C A;  1VSD A;  4B9S A;  3TAQ A;  3D45 A;  4DSJ A;  4IBN A;  3CFP A;  1YVU A;  1BI4 B;  3ZSR A;  4KHW A;  2DTU A;  3VA0 A;  4FJH A;  3LWL A;  1L3S A;  4KV8 A;  3AVB A;  1VK0 A;  4DG1 A;  1MU2 A;  2YNI A;  4LH4 A;  5KI6 A;  3O4Q A;  4CEQ A;  4PY5 A;  1RDC A;  3HO1 A;  3G10 A;  3OYH A;  3LPT A;  1D8Y A;  1W0H A;  1C0U A;  4N47 A;  4M3X A;  2HHV A;  2IDO A;  1TK8 A;  4CJU A;  2XY5 A;  4FM0 A;  3SYZ A;  3L2R A;  3M8Q A;  4OLA A;  3HL8 A;  3NBP A;  2GUI A;  4DU3 A;  3V6D A;  1T05 A;  4HTU A;  4I2P A;  4J2A A;  2DFH A;  4KTZ A;  1WSH A;  1CZB A;  3VQE A;  1CXQ A;  2VG6 A;  4DMN A;  1X9S A;  1KRP A;  3V9Z A;  3ZT1 A;  5T7B A;  2A1S A;  3NF9 A;  3VQD A;  3AVJ A;  4R5P A;  3JSM A;  3QNO A;  3AO4 A;  2P5G A;  1B92 A;  3NH0 A;  4HUF A;  4Z4E A;  1VSH A;  1NK7 A;  3O3G A;  3OYC A;  4JS5 A;  1ZBH A;  3NF7 A;  2KZZ A;  3V1Q A;  5KTQ A;  4I7F A;  2XY8 A;  2R7Y A;  1ZBL A;  4F8R A;  2W42 A;  1JLF A;  3L2W A;  1RDD A;  5KGW A;  4CCH A;  3NF8 A;  1RT4 A;  2HNY A;  4E7J A;  3SUQ A;  4DLE A;  1TKZ A;  1JL2 A;  3AVC A;  2ZD1 A;  1VRU A;  3QLH A;  4JRQ A;  1QSS A;  1GOB A;  4CK2 A;  3AVI A;  4DSL A;  4FXD A;  1KSP A;  4FJM A;  2YKM A;  2FBV A;  2KFZ A;  3V81 A;  1N6Q A;  4XIU A;  1VSF A;  1TK0 A;  5C25 A;  1CXU A;  1EX4 A;  1SUQ A;  1UWB A;  2KQ2 A;  1LWC A;  4FW1 A;  4CF1 A;  3KLE A;  4DTS A;  4CJ3 A;  4FJL A;  3SQ0 A;  3LAK A;  4DSE A;  2EHG A;  4LSL A;  4CGJ A;  4FLW A;  1QSY A;  1QSL A;  1JL1 A;  4CF2 A;  3U6F A;  2G8K A;  4MQ3 A;  2IC3 A;  2A1R A;  4DF4 A;  1RTD A;  1S6Q A;  3PY8 A;  2G8U A;  5SZT A;  1S6P A;  4F2R A;  4CIG A;  4KHU A;  4CF8 A;  1FKP A;  2D0B A;  3VQ6 A;  2NUB A;  1QE1 A;  3V9U A;  4IFY A;  4E7L A;  3DRR A;  2P5O A;  4QOZ B;  4W5O A;  3VQC A;  4BAC A;  2G8I A;  4C8O A;  3ZCM A;  4FLY A;  2XY6 A;  4B9U A;  1RTI A;  4O0I A;  2F96 A;  4CIE A;  2Q3S A;  2GV9 A;  3ISN C;  4BE2 A;  4B9V A;  3DLG A;  3IAY A;  1KVC A;  2QXF A;  1F21 A;  3QO9 A;  1HPZ A;  1WSF A;  4Z0U A;  1L3T A;  3AVA A;  4KB0 A;  4IG3 A;  3CFO A;  5E41 A;  3HPO A;  5FRN A;  3PO5 A;  2X6N A;  1YT3 A;  1I3A A;  4ICL A;  4AH9 A;  4AHC A;  3OYD A;  4KRE A;  1LAV A;  3T19 A;  3S3N A;  1RDB A;  3DRS A;  3SV4 A;  5CZ1 A;  3ZSW A;  3QEX A;  2QKB A;  2ATQ A;  3AVF A;  1NKB A;  3NF6 A;  1T7P A;  4QCL A;  4FJG A;  2VWK A;  4Z4F A;  3RR7 A;  1IO2 A;  4M41 A;  3NGI A;  2BGG A;  1HNI A;  1Q9Y A;  4FLU A;  3SQ4 A;  3AVH A;  3HP6 A;  2VWJ A;  4KB1 A;  3BDP A;  3VQP A;  2X6S A;  3LAN A;  4CHZ A;  4OGE A;  4M3R A;  3WNE A;  4KHS A;  1NJZ A;  3BGR A;  1WNS A;  1IG9 A;  3SPZ A;  4C8K A;  1HQU A;  2OZM A;  2D5R A;  4DTR A;  2YHA A;  3OYM A;  3NGZ A;  5DMR A;  2HND A;  1WAJ A;  3H08 A;  3O4N A;  4FW2 A;  4CJS A;  4DQP A;  1ZBI A;  2QK9 A;  1XI1 A;  1Z26 A;  2WOM A;  2I5J A;  4E1N A;  4CEF A;  2XO7 A;  1RIL A;  3MXJ A;  1LW0 A;  3O3H A;  5CYQ A;  1A5X A;  4IKF A;  3MAQ A;  4KHQ A;  3LP0 A;  1U04 A;  4B9T A;  4NCA A;  1C1C A;  4M3Y A;  4PWD A;  1U4B A;  2QKK A;  2X78 A;  4DTU A;  4JLH A;  5I42 A;  2OPS A;  3NCI A;  3WNG A;  1U48 A;  2DY4 A;  4WE1 A;  1BIS A;  3VQ8 A;  1QQC A;  3TAF A;  1BQM A;  3ASM A;  4E7H A;  1C6V A;  1TAU A;  2LSN A;  3IRX A;  4B8C A;  1RT1 A;  3CQ8 A;  1U45 A;  3TAE A;  3LWM A;  3MXI A;  5JS1 A;  4RW8 A;  3NAE A;  4RW6 A;  4EP5 A;  4AHU A;  3OYL A;  3QEI A;  3B6P A;  4N76 A;  1X9M A;  1WSI A;  1WSG A;  3LZI A;  3ZSV A;  2B6A A;  2FBY A;  3ULD A;  2P1J A;  5JS2 A;  4CJL A;  3SQ2 A;  5HRO A;  4KPY A;  1S1T A;  1S9G A;  1VSK A;  3AVL A;  4NCG A;  3VQ4 A;  2DFE A;  4W5N A;  4EP4 A;  4UQG A;  4PQU A;  3OS2 A;  3SI6 A;  1RT5 A;  1Q8I A;  4KO0 A;  1SL0 A;  1SKW A;  4DTX A;  3AV9 A;  5KRS A;  2YHB A;  3QEP A;  4DTP A;  2Y1I A;  1R0A A;  4Z4H A;  2PY5 A;  2Z1H A;  4OJR A;  4PUO A;  1A5V A;  4RW7 A;  4QAG A;  2XHB A;  2G8H A;  4LY7 A;  3QIN A;  4GVM A;  4E89 A;  1G15 A;  3UIQ A;  4CGI A;  3QNN A;  4CJQ A;  1FXX A;  3HXM A;  1UAX A;  2YNH A;  4C8L A;  3WNF A;  2D0C A;  5EU7 A;  4ZTF A;  3B6O A;  3PUF A;  4KKO A;  1BIZ A;  1JLC A;  4CGG A;  3V4I A;  4OLB A;  2F8T A;  1GOA A;  3LDS A;  1HYS A;  4ELV A;  2IGI A;  4RG8 A;  3HP9 A;  1ZYQ A;  4CFA A;  1RT2 A;  3CFR A;  4DTJ A;  4FJI A;  4Q0B A;  5D3G A;  3ZSY A;  4LH5 A;  4BWJ A;  5FRO A;  3VQ5 A;  1BHL A;  1KTQ A;  1NKC A;  3SUO A;  3AA4 A;  4CGD A;  3I8D A;  1KVA A;  1LWE A;  4FLX A;  3PX6 A;  4M3Z A;  4H4O A;  4E19 A;  4DS4 A;  4CEE A;  4I9L A;  3K5N A;  1NKE A;  3K57 A;  3C94 A;  3I0S A;  1FKO A;  1HMV A;  4CHP A;  3OYI A;  3CG7 A;  3DM2 A;  1TK5 A;  3HVR A;  3DOK A;  2OZS A;  1LAW A;  3OYN A;  5HRR A;  1SKR A;  4OKK A;  4CF0 A;  4FLT A;  2PYL A;  4DFJ A;  1NOZ A;  4KHN A;  3NDK A;  4Z4G A;  1A5W A;  3KK2 A;  4CGH A;  1JLE A;  3KLI A;  1IKV A;  4OGC A;  3HT3 A;  3K58 A;  4FLV A;  3V9X A;  5HLF A;  3THV A;  1CZ9 A;  4F2S A;  1XWL A;  3LP1 A;  1UA1 A;  1NK9 A;  4ELT A;  4ZTJ A;  4B8A B;  5HRP A;  4AHS A;  3LPU A;  3TAB A;  2KW4 A;  3A2F A;  1NK0 A;  2YNG A;  4FM1 A;  2F8S A;  1JLQ A;  4CE9 A;  4J2E A;  4B9N A;  3TAR A;  1S1U A;  3OJU A;  1TL1 A;  4BE0 A;  2ZQB A;  1U49 A;  3O3F A;  4B9L A;  4FJN A;  4KHY A;  3L3V A;  3M8S A;  1RCH A;  3AVN A;  3L8B A;  4HCB A;  2HMI A;  3DMJ A;  3NHG A;  1EKE A;  3OYJ A;  5J2P A;  4FK2 A;  4F3T A;  4CFD A;  1SL2 A;  2G8W A;  1NJX A;  4EZ6 A;  3WNH A;  3QEW A;  4CJT A;  3KIO A;  1DLO A;  1HYV A;  3HK2 A;  2AJQ A;  2HHQ A;  4Y1C A;  4OKE A;  4CEA A;  2KFN A;  4DU4 A;  1YTA A;  3RWU A;  3AO1 A;  4KFB A;  2HHW A;  4YNQ A;  3TAG A;  2D0A A;  1TKD A;  4LSN A;  4RW4 A; 
#chains in the Genus database with same CATH topology
 4Z94 A;  1RGI A;  1YUW A;  2CGK A;  4O44 A;  2P9L B;  4FK4 A;  4OO1 J;  4AHT A;  3ENO A;  1NBW A;  5I3U A;  4HUE A;  2P9N A;  1SV5 A;  1VQL N;  1NOY A;  1GLF O;  5FRM A;  1BDG A;  4BRL A;  3K9J A;  3V9W A;  3L2U A;  3HOS A;  3VQA A;  1YJN N;  3LDL A;  1C0G A;  3DLH A;  1ZBU A;  1TL3 A;  3JS6 A;  3HPH A;  1UOC A;  4O55 A;  2IAJ A;  4CJE A;  4GVE A;  4CHQ A;  3MEE A;  1WSE A;  3CM5 A;  2RPI A;  2O4G A;  5AQG A;  4KI6 A;  4E7K A;  4EHU A;  1EXQ A;  4FZZ A;  1QHA A;  3IG1 A;  4E1M A;  5AQP A;  2ITG A;  2WC9 A;  1NK6 A;  3UKU B;  3CMA N;  4NYF A;  3ZSO A;  3S3M A;  1L3V A;  4L8R B;  3F9K A;  4L3Q A;  5MLC Q;  3QET A;  4M42 A;  4JRP A;  3PX0 A;  4PA1 A;  1KAY A;  2ASO A;  3K5L A;  3ZX2 A;  2HF3 A;  1T8E A;  5AQH A;  5BPL A;  4YFU A;  5C24 A;  4BDP A;  2Z1G A;  4JKG A;  1N33 K;  3ZT4 A;  3E01 A;  2OCE A;  3FZM A;  4FWQ A;  3VPZ A;  3KD1 E;  1GLA G;  2P9S B;  2E2N A;  2FC0 A;  2OPR A;  3VN5 A;  3Q7B A;  4U67 L;  4AHR A;  3BY5 A;  1ATN A;  4A61 A;  3VQQ A;  3D0P A;  4FVM A;  4OPJ A;  4BRM A;  2NRW A;  3O9U A;  1VQM N;  3HJF A;  4FWP A;  2G8V A;  2I7N A;  5AQK A;  5M1O A;  3AAP A;  3OYK A;  4DSI A;  3OYE A;  1CZA N;  1QVF M;  4CZH A;  3VA3 A;  1BU6 O;  3M3Z A;  3DRP A;  1VQP N;  3TAM A;  3NFA A;  3AO3 A;  1TGO A;  3DOL A;  4CIF A;  1IKW A;  3CXC M;  3EL2 A;  1Q86 O;  3TAP A;  4FWS A;  4FZX C;  2A42 A;  2VCP A;  1QS4 A;  3KLG A;  3WXJ A;  4QS9 A;  3C0B A;  1SS6 A;  1BI4 A;  5GIO A;  4IO9 L;  4B3M K;  3C6U A;  1YXQ A;  4JKC A;  2HVH A;  3THX A;  1JLG A;  3VF2 A;  3ZSQ A;  4BVP A;  5CY4 A;  1RBR A;  5EY4 A;  1KLN A;  4HWI A;  4JD2 B;  4B1Y B;  2FLO A;  1OH6 A;  4GW6 A;  3PSI A;  5CE3 A;  4CK3 A;  1RT3 A;  3DLK A;  4DR4 K;  2Q36 A;  2HMP A;  4WQ5 C;  4DF8 A;  1KFD A;  3IMX A;  4N41 A;  4FOI A;  1WLJ A;  4CEB A;  4X64 K;  4LC9 B;  4CER A;  5AR0 A;  1BCM A;  3SV3 A;  1HNV A;  3H46 O;  3BF1 A;  3E9L A;  4H4M A;  1M1K O;  1ZC6 A;  3DLE A;  3TAN A;  2QI2 A;  4IFE A;  4BC4 A;  2YNF A;  4DV3 K;  3OVN A;  1V4T A;  3C6T A;  1EP4 A;  2GBZ A;  3O1B A;  4JI8 K;  1JLA A;  4DS5 A;  4MFB A;  4BC3 A;  1NGH A;  5C10 A;  3TTF A;  3D2F A;  1BCO A;  4DCH A;  4YOY A;  4LF5 K;  3L6Q A;  4FJX A;  3VQ7 A;  3DXK B;  3HM9 A;  1RT6 A;  3TR8 A;  3A5N C;  4PKG A;  4A59 A;  2VWB A;  1BUP A;  2BTF A;  4OPH A;  4CJ7 A;  1SL1 A;  2CH6 A;  2JLE A;  3LP2 A;  4DFP A;  1WBB A;  4IDK A;  4TSX A;  4HUG A;  2D4W A;  4O4G A;  4CZF A;  3KLH A;  4M3T A;  3VQB A;  1IKX A;  2RKI A;  2HST A;  4ID5 A;  1EET A;  4M45 A;  3ZT2 A;  2IVO A;  1KLM A;  4JI7 K;  3RTV A;  4DU1 A;  1WAF A;  1I39 A;  4JEP A;  2HHT A;  4FWL A;  5BPM A;  4Z4C A;  4A57 A;  4B1X B;  2WUS A;  4BRG A;  4UY8 O;  3O9R A;  4FJH A;  1L3S A;  1VK0 A;  1O13 A;  3EN9 A;  4H5T A;  3G4S N;  3HO1 A;  3G10 A;  4A2B A;  3OYH A;  4ISG A;  3LPT A;  1D8Y A;  1W0H A;  4JKB A;  2O8C B;  3O6W A;  3CIP A;  4CJU A;  1S72 N;  4BRC A;  3HL8 A;  2GUI A;  1XNR K;  4HTU A;  2DFH A;  1WSH A;  1KRP A;  2VG6 A;  4RTF D;  3CJC A;  5T7B A;  2ITM A;  3VQD A;  2P9K B;  3OBY A;  3QNO A;  3MN9 A;  4A5B A;  2YHY A;  4HUF A;  1VSH A;  3QDK A;  4JS5 A;  1ZBH A;  3V1Q A;  3CD6 N;  3NF8 A;  2HNY A;  1TKZ A;  4CZG A;  1QSS A;  2NRZ A;  4AQY K;  1OVQ A;  1SQK A;  4FJM A;  2FBV A;  3V81 A;  1TK0 A;  3FE1 A;  1CXU A;  3U9Z A;  3KLE A;  3SK3 A;  3A8Y A;  4IXC A;  1QSL A;  2G8K A;  2A1R A;  1NG9 A;  2W41 A;  5FLX O;  2HBJ A;  1S6P A;  3CER A;  2UUB K;  1TYQ B;  1YJ9 N;  3MDQ A;  4YOU A;  4E7L A;  3CCJ N;  1D4X A;  3VQC A;  3C65 A;  1HUX A;  2ZJR L;  4H5W A;  3WXK A;  4O0I A;  1N32 K;  1HKB A;  2UYT A;  1MDU B;  1I94 K;  1L3T A;  2PAV A;  5BR9 A;  3CQY A;  3CCE N;  3QB0 A;  4WFB L;  5H1S Q;  5AQJ A;  4ICL A;  4AHC A;  5ADX H;  3S3N A;  4KH6 A;  1T6C A;  3I56 N;  1IO2 A;  4FLU A;  3SQ4 A;  2JWK A;  3OBW A;  1YIJ N;  2V7Z A;  3BDP A;  4JV5 K;  4OGE A;  3WNE A;  3P31 A;  5AQZ A;  3M5R A;  4C8K A;  1HQU A;  1GLB G;  3KVG A;  3M6G A;  4MDB A;  2UUA K;  2HND A;  3O4N A;  5LJV A;  4CJS A;  4DUZ K;  1Z26 A;  2WOM A;  4IKF A;  1IG8 A;  3MXJ A;  4H0O A;  3SAH A;  4NCA A;  4CZM A;  4M3Y A;  1K9M O;  1IBK K;  1U48 A;  2DY4 A;  4WE1 A;  4DR7 K;  3SBG A;  1BQM A;  1C6V A;  3O08 A;  5JVH L;  3A5L C;  1TUU A;  3TAE A;  1SZ2 A;  4RW6 A;  4EP5 A;  3OYL A;  3I55 N;  3B6P A;  5AQN A;  1YHQ N;  1WSG A;  2OTL N;  3HOT A;  3CQX A;  4CJL A;  3AGR A;  3AY9 A;  3AVL A;  4NCG A;  4W5N A;  3P38 A;  1XUP O;  4IDH A;  4BRI A;  5LY3 A;  3OS2 A;  1RT5 A;  5JLF A;  1X3M A;  3AV9 A;  4DB3 A;  4CI6 A;  4KBO A;  3DWL A;  2A41 A;  4DV7 K;  4Z4H A;  2Z1H A;  4OJR A;  4PL7 A;  1U6Z A;  1RDW X;  3QIN A;  4GVM A;  1HJO A;  3UB5 A;  4CGI A;  4BR4 A;  3A0I X;  1UAX A;  2YNH A;  4NB4 A;  3CCU N;  4C8L A;  4LF7 K;  5AQY A;  1ILY A;  4NLC A;  3V4I A;  1GOA A;  1QQM A;  3TSP A;  5LMU K;  3HP9 A;  5LMN K;  3DXM A;  3D6R A;  4BWJ A;  4JAX A;  3CJ9 A;  3SUO A;  4CGD A;  3PX6 A;  4BC2 A;  4CVN E;  4M3Z A;  3BP8 A;  3WQU A;  4BRN A;  4I9L A;  3K57 A;  3C94 A;  1HMV A;  4CHP A;  4DV6 K;  4OKK A;  2PYL A;  3RSE A;  4DFJ A;  3R8E A;  4JI0 K;  2O8E B;  3KLI A;  3THY B;  5JVG L;  1CZ9 A;  4DHY A;  1DT9 A;  1UA1 A;  4B8A B;  2HBL A;  3H1Q A;  2F8S A;  1W7A A;  4OPA A;  2P9I B;  2O8B B;  5DM6 L;  1W2B M;  4B9L A;  4FJN A;  1OKJ A;  3CHW A;  3AVN A;  3DMJ A;  4HTL A;  3VMF B;  1EKE A;  4CFD A;  3O5B A;  1HYV A;  3W0L A;  4OKE A;  2IIR A;  4FWN A;  3AGK A;  2NRT A;  3KWI A;  4GMJ B;  5J2Q A;  1X1P A;  1QHT A;  2HF4 A;  1NJW A;  2KZM A;  1S3X A;  2CGL A;  1KVB A;  3SUP A;  2E6M A;  4O5F A;  3PO4 A;  4FYD A;  3FGU A;  2VG7 A;  4WFA L;  4FCY A;  3RMA A;  1XQS C;  1D5A A;  1BL3 A;  4CD3 A;  1VQN N;  3F9M A;  5HBM A;  1YAG A;  1VSM A;  3CC7 N;  4W5R A;  1WSJ A;  5J2M A;  3OA9 A;  4YOR A;  3OYF A;  4DFM A;  4OKJ A;  3MEC A;  4I6M B;  1GOC A;  5AQO A;  1C0F A;  4HHT A;  3AO5 A;  1LOT B;  1L3U A;  5HP1 A;  3NE6 A;  4CED A;  4BE1 A;  1KXP A;  1RNH A;  4CZJ A;  2PBD A;  2HOE A;  4DSK A;  4CJP A;  1D9F A;  3TI0 A;  4I2Q A;  4H0X B;  1RBS A;  2P9P A;  3MED A;  1BQN A;  3CM6 A;  3R3L A;  4JI1 K;  4CFB A;  2BDP A;  3OHR A;  1Y97 A;  3CPE A;  3NH1 A;  1VQO N;  3IUC A;  3KWG A;  3OS0 A;  4IFV A;  3KK1 A;  4B3R K;  2AA4 A;  4DQ8 A;  3VF4 A;  2XY7 A;  4OX9 K;  4BR5 A;  3DLR A;  1HJR A;  4DTM A;  4CHN A;  3U3Y A;  4FWO A;  4NLB A;  1NGF A;  5C2F A;  2CGJ A;  3MN6 A;  4FPA A;  3U9D A;  3OJS A;  5KGX A;  4K0K K;  3F73 A;  1HKC A;  4C8N A;  3F5T A;  3LAM A;  3LDQ A;  5LL6 Z;  2HNZ A;  3T3F A;  2D0O A;  3IS9 A;  1XC9 A;  5K14 A;  5GAH P;  3T1A A;  4W5Q A;  3DAW A;  1VRT A;  3J7Y P;  3G6E N;  3TPQ A;  4C23 A;  1VQ5 N;  3AVK A;  4BVO A;  4CJ5 A;  2EX3 A;  4ELU A;  1TAQ A;  5BN8 A;  4F3O A;  2NLX A;  4H5N A;  1NGE A;  1N5Y A;  2ZGZ A;  4CJ4 A;  4CEZ A;  3ZX3 A;  1LCU A;  5CR4 A;  2F9W A;  1Q82 O;  1EO1 A;  1FJG K;  2W40 A;  1DKG D;  3V1R A;  4RWT A;  3C6A A;  3LDN A;  3THW B;  5AQQ A;  3P1G A;  3SZ2 A;  3QER A;  3V1O A;  4CHO A;  4FJ7 A;  1FK9 A;  2Y1J A;  1NGI A;  1NM1 A;  4JHD B;  1DTT A;  5BRH A;  1NWK A;  2PYJ A;  3SJJ A;  1GLC G;  3ZEU B;  1UA0 A;  4WCE L;  5AQU A;  2O4I A;  1CLQ A;  4ILH A;  4OPK A;  4MO5 A;  4FM2 A;  1BG3 A;  3K0S A;  2ETJ A;  3VEV A;  1REV A;  3SUN A;  3P83 D;  3SAG A;  1JKH A;  4JI3 K;  2WFB A;  2KKZ A;  2ZF5 O;  4Z4I A;  4BDY A;  5AZJ A;  4KRF A;  1ZXO A;  3EKU A;  5C42 A;  3P4I A;  4JK8 A;  1JXB A;  1RBU A;  3EO3 A;  2B4J A;  3CCV N;  4DLG A;  3P5J A;  4IEI A;  5HRS A;  1NLV A;  1JJ2 M;  4FSV A;  4DR1 K;  4LFA K;  3PV8 A;  2P9U A;  1SKS A;  3OS1 A;  3QIP A;  1K8K A;  5GIP A;  4FJJ A;  3C7N A;  3CYM A;  3M8P A;  4O8U A;  3JYT A;  3K5O A;  4O5B A;  4LF4 K;  1JLB A;  4W5T A;  1Y64 A;  5AQT A;  1QTM A;  3LP3 A;  2YJF A;  2YHX A;  3ENB A;  2Q0U A;  3AVG A;  3KJV A;  4V19 S;  3ITH A;  4CGF A;  2YHW A;  4DUY K;  1S5J A;  1VSD A;  4DSJ A;  1YVU A;  3ZSR A;  5AZI A;  3LWL A;  3QBX A;  1RDC A;  1U2V A;  1N34 K;  1C0U A;  4N47 A;  4M3X A;  2HHV A;  1TK8 A;  2E20 A;  2XY5 A;  5AQV A;  3DLL L;  4FM0 A;  3L2R A;  4H0P A;  4OLA A;  3NBP A;  3EZW A;  3MWP A;  4NXN K;  4I2P A;  1CXQ A;  3ID8 A;  3OTO K;  4R5P A;  3NH0 A;  5EX5 A;  4LF9 K;  2KZZ A;  5KTQ A;  4I7F A;  4XH4 A;  2R7Y A;  3L2W A;  1RDD A;  5KGW A;  3SBT A;  1IJJ A;  1JL2 A;  1IBL K;  3QLH A;  3VEO A;  1JCE A;  4JI6 K;  2YKM A;  5C25 A;  1UWB A;  1SUQ A;  2O8D B;  4DSE A;  4LSL A;  5JLH A;  4CF2 A;  2IC3 A;  1X9J A;  3WXI A;  1EWR A;  3E1Y A;  3WXM B;  4CF8 A;  1M90 O;  2BH1 A;  2NUB A;  3V9U A;  3E9P A;  3U4L A;  3DRR A;  3ZCM A;  3FZK A;  4K43 A;  2F96 A;  4CIE A;  3L4Q A;  1F21 A;  1WSF A;  3O9T A;  4IG3 A;  3CFO A;  3PO5 A;  3ZYY X;  3OYD A;  1Q18 A;  1MWM A;  3SV4 A;  4WYB A;  3QEX A;  2ATQ A;  3AVF A;  4QCL A;  2HBK A;  4M41 A;  3NGI A;  2BGG A;  1ATR A;  1Q9Y A;  1Q81 O;  4O8K A;  3VEY A;  3E66 A;  4ISF A;  2Q31 A;  4H0V B;  4CHZ A;  4M3R A;  4KHS A;  3BGR A;  1WNS A;  1IG9 A;  3VOV A;  1NJI O;  4PKH A;  2YHA A;  3NGZ A;  3CCM N;  5DMR A;  4FW2 A;  2QK9 A;  1ZBI A;  1T3V A;  4CZL A;  2I5J A;  4E1N A;  5J2N A;  4FXD A;  3ZLJ A;  4KHQ A;  4GV9 A;  3O1W A;  1C1C A;  3SLC A;  2O8F A;  5I42 A;  3NCI A;  3VQ8 A;  3TAF A;  3ASM A;  4E7H A;  3IRX A;  4B8C A;  3LM9 A;  1P8Z A;  2W6L A;  1WSI A;  2ASM A;  5A2Q O;  4YOX A;  2E1Y A;  3LZI A;  5BN9 A;  3ZSV A;  2E2Q A;  2B6A A;  2FBY A;  3ZET A;  2P1J A;  1S9G A;  3VQ4 A;  4M63 C;  1YI2 N;  4EP4 A;  4PQU A;  2FXU A;  3SI6 A;  1SL0 A;  3CJA A;  3NMU A;  2YHB A;  3ZEU A;  1NGJ A;  2P9L A;  1A5V A;  4RW7 A;  4E89 A;  1MWK A;  5FPE A;  3UIQ A;  3QNN A;  1FXX A;  3HXM A;  2E88 A;  3WEE B;  2D0C A;  5EU7 A;  4KKO A;  1BIZ A;  4CGG A;  5BRD A;  4FWM A;  2QEX N;  4GNI A;  2Q1N A;  3LDS A;  5KPZ A;  4ELV A;  5AQI A;  4Q0B A;  3ZSY A;  2YJE A;  3I8D A;  1KVA A;  3TTD A;  4E19 A;  4PKI A;  3H45 C;  3J8A A;  3CG7 A;  3OYI A;  3CCS N;  3HVR A;  3DOK A;  1TK5 A;  2OZS A;  3OYN A;  4CF0 A;  4FLT A;  3UKU A;  3NDK A;  1A5W A;  3KK2 A;  4OGC A;  4FLV A;  5HLF A;  1HPM A;  4K41 A;  3FZH A;  1XWL A;  3D7E O;  3WQT A;  4IJN A;  4IJA A;  3LPU A;  5KPT A;  3TAB A;  1NK0 A;  4BRO A;  1JLQ A;  4JKA A;  5AQX A;  3KK7 A;  1S1U A;  1U49 A;  3L8B A;  3CC4 N;  2HMI A;  2PFU A;  5CHI A;  3NHG A;  3GL1 A;  1SL2 A;  3QEW A;  3CCQ N;  3KIO A;  2P9S A;  4Y1C A;  4DU4 A;  1YTA A;  3VTH A;  3WUH A;  3RWU A;  1NNE A;  4A62 A;  2HHW A;  1NGG A;  4LSN A;  4C1N I;  2QWM A;  3AO2 A;  4IZ9 A;  3HVT A;  4XH1 A;  1D9D A;  1RTH A;  1LWF A;  5IWA K;  4FLZ A;  4FVU A;  2E2O A;  4F4K A;  1RDA A;  4BG8 A;  3KHY A;  4DTN A;  4WQ4 C;  3JAM O;  1S1W A;  3TSU A;  4DQQ A;  3RMC A;  4EAH D;  4JNE A;  3E9O A;  1HYZ A;  3QEV A;  2XRI A;  4C8M A;  1B9F A;  3D2E B;  5CZ2 A;  3HPG A;  2FSN A;  5M1N A;  2QTD A;  1Q9X A;  1E4F T;  3IKM A;  1JCG A;  3I33 A;  4K42 A;  3UKR B;  3N4Q A;  2IOC A;  3CJ7 A;  3EZ5 A;  3L2Q A;  4O0J A;  2Q2R A;  4JD2 A;  2V51 B;  5E84 A;  4CJF A;  4CZE A;  3C95 A;  2ZJQ L;  3ALY A;  2PZS A;  3U3G A;  3EY1 A;  2E6L A;  2JWL A;  3ZSZ A;  1T44 A;  3T7Z A;  1GLE G;  4EZ9 A;  2GX9 A;  4M3U A;  4DQS A;  4DV4 K;  4B3O A;  2Z1J A;  1LV5 A;  3TWH A;  5AQS A;  2JGU A;  1XNQ K;  4CFC A;  4N5S A;  4AHV A;  4Q5V A;  2NNW A;  4BR7 A;  4I9Q A;  3LDO A;  4IO8 A;  3ULE B;  1ASV A;  4DR2 K;  5FPD A;  3L3U A;  4WFN L;  2F7T A;  3MMV A;  3SJH A;  2HHH K;  2UUC K;  5B8H A;  3HI0 A;  3ZT0 A;  5FPN A;  1YJW N;  1EWQ A;  1JCF A;  3DXK A;  3UE5 A;  4CJK A;  2OPP A;  2Q0R A;  3PSF A;  2P9N B;  4ISE A;  4ZHR A;  3H3O B;  5BPN A;  2OA8 A;  1S1X A;  3M8R A;  4BDZ A;  3GOI A;  1W9H A;  4EIA A;  3CC2 N;  1J5O A;  2G8F A;  3DLB A;  4E0D A;  2HHX A;  1KCF A;  4YDU C;  1KFS A;  4KHP K;  5F2R A;  1HNZ K;  1VQK N;  4CBW A;  3KD5 E;  1LW2 A;  2Z1I A;  5DK5 A;  2Q97 A;  3RMB A;  2UXB K;  1TKX A;  1NK8 A;  1BA1 A;  1NJY A;  2O8C A;  4DR6 K;  3VF6 A;  3HST B;  5JIC A;  3CCR N;  3O80 A;  4ILG B;  5JMV A;  1J54 A;  3QFU A;  4BRK A;  3S3O A;  2HVI A;  2BAN A;  5KPR A;  1C0M A;  3SCX A;  2GUP A;  3SAF A;  3MN7 A;  4LD0 A;  3MXM A;  1GLL O;  3N4P A;  3K59 A;  1RBT A;  2P9K A;  3I0R A;  2QW9 A;  4DWI A;  1S1V A;  1B9D A;  2FBT A;  1K6Y A;  3H1V X;  4CD1 A;  4CHY A;  3AA2 A;  2KTQ A;  1DEJ A;  4FJ9 A;  1S9E A;  3SNN A;  3L0Q A;  2X74 A;  1WN7 A;  4WQ4 A;  2HHU A;  4JKG B;  1RTJ A;  4DFK A;  5GIN A;  3K2P A;  4JS4 A;  2QM1 A;  4M7X A;  1ATS A;  1X9W A;  5KRT A;  3BEX A;  4FJK A;  1QVG M;  4BR9 A;  3FLC O;  4E3S A;  2VG5 A;  2WON A;  1DTQ A;  3NH2 A;  1TYQ A;  2P51 A;  5FDL A;  4WF9 L;  3ZSX A;  3AVM A;  3I8B A;  4BWM A;  1MA9 B;  5AFU A;  1L5U A;  1NK5 A;  3MEG A;  4CJV A;  2VGN A;  4MO4 A;  4A2A A;  4E7I A;  1J53 A;  3TAQ A;  4QS8 A;  1K73 O;  2D0P A;  4X62 K;  3CFP A;  1BI4 B;  4Y0W A;  5AQM A;  3VA0 A;  3FZL A;  3AVB A;  2KLA A;  1MU2 A;  4DG1 A;  4RCH A;  2QWN A;  3O4Q A;  4CEQ A;  3THX B;  3SMP A;  3EKS A;  3EE8 A;  4PL8 A;  1KAX A;  5BRE A;  2FF3 B;  4BRE A;  3M8Q A;  3V6D A;  1T05 A;  4J2A A;  4KTZ A;  2AP1 A;  1KD1 O;  4XH5 A;  3HSC A;  3HZ6 A;  3V9Z A;  5AQF A;  1H1V A;  1NMN A;  3AVJ A;  3JSM A;  4Z4E A;  4MLE A;  3O3G A;  3NF7 A;  4JKE A;  4MDA A;  4F8R A;  5M1F A;  5C0Y A;  1JLF A;  4CCH A;  1RT4 A;  4E7J A;  3SUQ A;  4DLE A;  5AFU H;  3AVC A;  3HRG A;  1HLU A;  1VAZ A;  1VRU A;  2ZD1 A;  5EOY A;  4JRQ A;  1GOB A;  4CK2 A;  3AVI A;  3FZF A;  1KSP A;  2KFZ A;  5GAE P;  1EX4 A;  2KQ2 A;  4FW1 A;  4DTS A;  4CF1 A;  2OTJ N;  1WUA A;  4KH4 A;  4CJ3 A;  4FJL A;  4YOV A;  3SQ0 A;  3D2F B;  4YDU A;  1KAZ A;  2EHG A;  3A5O C;  4CGJ A;  4FLW A;  1QSY A;  1JL1 A;  3PIP L;  4EHT A;  3U6F A;  3ENH A;  4PHT X;  1S6Q A;  3PY8 A;  4F2R A;  4KHU A;  1FKP A;  1ESV A;  2GWK A;  3VQ6 A;  2P5O A;  4W5O A;  4C8O A;  4FLY A;  3MCP A;  2XY6 A;  4X66 K;  2GV9 A;  3ISN C;  3DLG A;  1KVC A;  2V7Y A;  1HPZ A;  4Z0U A;  5FRN A;  1VQ9 N;  2E5L K;  1YT3 A;  5EVZ A;  4AH9 A;  3T19 A;  4DV0 K;  4GKK K;  5CZ1 A;  1T7P A;  1NKB A;  3ATU A;  2VWK A;  3CCL N;  2BUP A;  4FWK A;  3AVH A;  3HP6 A;  2VWJ A;  4B3T K;  3LAN A;  4LF8 K;  4AF1 A;  3GDQ A;  4JYA K;  4FWR A;  2OZM A;  3OYM A;  1QZ6 A;  2O8E A;  1WAJ A;  1R59 O;  4DQP A;  2QWO A;  1NGB A;  1XI1 A;  3THY A;  2XO7 A;  4CEF A;  3LL3 A;  5CYQ A;  1A5X A;  3MAQ A;  3LP0 A;  1U04 A;  3T69 A;  4B9T A;  1SAZ A;  5TKY A;  5AQR A;  1U4B A;  4DTU A;  4JLH A;  3O8M A;  5ELZ A;  3WNG A;  2P9I A;  3TU5 A;  1QQC A;  2O8B A;  1TAU A;  5BRF A;  2LSN A;  3CQ8 A;  4BGB A;  2NRX A;  3MXI A;  4BRH A;  5BR8 K;  4N76 A;  1X9M A;  5F0X A;  3C6H A;  5JS2 A;  5HRO A;  4KPY A;  1VSK A;  2DFE A;  4JK7 A;  4UQG A;  3VGL A;  4DTX A;  3QEP A;  2VYP A;  3AAR A;  4DTP A;  1HR0 K;  2Y1I A;  5HL7 L;  2PY5 A;  1W97 L;  1OH5 A;  1HNW K;  4QAG A;  2QWP A;  4LY7 A;  5M1Q A;  3IFR A;  1VHX A;  1G15 A;  4CBU A;  3BF3 A;  3BZK A;  3HBT A;  1BOT O;  3O9S A;  2QA4 N;  3WNF A;  4ZTF A;  4BQL A;  3B6O A;  1HX1 A;  4OLB A;  1YVN A;  4RG8 A;  2VQF K;  4FJI A;  4CFA A;  1RT2 A;  4IOA L;  2IVP A;  1NMD A;  5D3G A;  4I6M A;  4LH5 A;  4B3S K;  3AA4 A;  4FLX A;  3W3D A;  4H4O A;  4DS4 A;  3MK6 A;  3TSQ A;  3ZX0 A;  3J81 O;  3I0S A;  2YCH A;  1FKO A;  4FL9 A;  3DM2 A;  4KH5 A;  4CBX A;  4KHN A;  4CGH A;  3VGM A;  4CZK A;  4A5A A;  1JLE A;  3HT3 A;  3V9X A;  4F2S A;  4JI2 K;  1NK9 A;  4AHS A;  4BRP A;  2ZM6 K;  3TAR A;  4BE0 A;  1TL1 A;  4KHY A;  2ZQB A;  3L3V A;  4IOC L;  4HCB A;  3MCA B;  4FO0 A;  4FK2 A;  4F3T A;  4GKJ K;  1BA0 A;  1NJX A;  3WNH A;  4CJT A;  3HK2 A;  2HHQ A;  3DJC A;  2KFN A;  3R1X A;  4KFB A;  3H6E A;  3R6M A;  2IVN A;  4J8F A;  4YNQ A;  1GLD G;  2D0A A;  4JKH A;  1TKD A;  2W6K A;  2E8A A;  4RW4 A;  4DR3 K;  3MN5 A;  4BC5 A;  3SPY A;  4NYN A;  4ID1 A;  2V52 B;  3EYZ A;  3ATV A;  3R9P A;  2F9T A;  5AQW A;  4K8Z A;  2A6A A;  2UXD K;  2NRV A;  4M3W A;  5SWM A;  5HOO A;  3VQ9 A;  4IWV A;  3G0Z A;  3K9K A;  4FJ8 A;  4CEO A;  3EE9 A;  4DQR A;  3DXM B;  2B5J A;  2HB5 A;  3OYB A;  1T03 A;  4IG0 A;  2NRR A;  4DQI A;  4H0Y B;  4KI4 A;  4M7Y A;  4K8X A;  2OPQ A;  4DSF A;  2GEM A;  1YF5 L;  2F4V K;  3H3N O;  3RSE B;  2QWR A;  2HHS A;  2FSJ A;  3THW A;  4AIL C;  4FOE A;  4FK0 A;  4JKF A;  4H5V A;  1QQN A;  1VSI A;  4JHD A;  4Y1D A;  3L4I A;  4R79 A;  4RW9 A;  3RVC A;  1IBM K;  3VEZ A;  2QXL A;  2E4L A;  1RBV A;  3OYA A;  1C1B A;  3BUZ B;  1EQY A;  2FBX A;  3M1F A;  1WOQ A;  2IS3 A;  4CEC A;  5M1K A;  3NVM A;  4E1J A;  2CH5 A;  1C0T A;  3MX2 A;  3K5M A;  4BR0 A;  4KTW A;  4LF6 K;  3KKR A;  3QBW A;  3V9S A;  3FFI A;  2YV0 X;  3KZB A;  3QML A;  3SMS A;  5HRN A;  2UXC K;  4GY2 B;  3SQ1 A;  3HTV A;  1OH7 A;  4B9M A;  3ZT3 A;  3KLF A;  1HRH A;  3KTQ A;  3RRH A;  1VQ8 N;  2KHO A;  1IKY A;  1QQO A;  3ID6 A;  3NGY A;  4YHH K;  4ILJ A;  3Q7C A;  3F2K A;  4DR5 K;  1IH7 A;  1VQ7 N;  1ITG A;  3AAQ A;  5ADX A;  4CZI A;  3WT0 A;  4H8K A;  3QES A;  2DFF A;  1ASU A;  3S9H A;  1E4G T;  1JXE A;  1ZBF A;  1YTU A;  1XHZ A;  3RRG A;  1FW6 A;  1O1W A;  3LZJ A;  5AJ3 K;  4GV3 A;  4NO7 A;  3J80 O;  4FZY A;  2ASP A;  3DI6 A;  4CJW A;  4CJR A;  3MX5 A;  1Z6R A;  3CF5 L;  4GV6 A;  4CES A;  1BIU A;  1ZBS A;  1HQE A;  2RE2 A;  3CET A;  3CPW M;  4B08 A;  1ASW A;  4HVJ A;  4KAZ A;  2BE2 A;  5FPM A;  2RN2 A;  1N36 K;  2OYQ A;  3QIO A;  5CYM A;  2P9P B;  4JKD A;  3L2V A;  3CI5 A;  2VQE K;  3S41 A;  2RF2 A;  1C1A A;  4JI5 K;  1G99 A;  4WQ5 A;  3VEN A;  1J5E K;  1TV6 A;  1J6Z A;  3KKS A;  3AA3 A;  3OYG A;  3RR8 A;  1N8R O;  1J9A A;  4YOW A;  1VSE A;  4G1Q A;  4FJ5 A;  1Z25 A;  4N56 A;  4HCC A;  4U7B A;  4H03 B;  3DYA A;  1NGD A;  5AQL A;  4J2D A;  1BGX T;  1XHX A;  2O8D A;  4CK1 A;  1U47 A;  4NCB A;  3LAL A;  3PX4 A;  1TKT A;  2ZE2 A;  1BO5 O;  1VSL A;  5J1E A;  4J2B A;  4BRD A;  3KK3 A;  4CW7 B;  2HW3 A;  3U8X A;  4DV2 K;  1VSJ A;  2E1Z A;  1HNX K;  3OY9 A;  3RMD A;  2YKN A;  3HYF A;  4KTQ A;  1TVR A;  3AA5 X;  2GTD A;  4XEI A;  1RT7 A;  1NK4 A;  4DTO A;  5C12 A;  4OVL A;  3JXU A;  1XC3 A;  3LM2 A;  4CF9 A;  4B9S A;  1DGK N;  3CJB A;  5M1P A;  3D45 A;  4IBN A;  4KHW A;  2DTU A;  4KV8 A;  1VQ4 N;  2YNI A;  5KI6 A;  3QIC A;  4LH4 A;  4PY5 A;  2YI1 A;  1TUY A;  5GAD P;  1V4S A;  2IDO A;  3CJ1 A;  3SYZ A;  4G9Z A;  2YX6 A;  4DU3 A;  4DV1 K;  1KC8 O;  4DMN A;  3G25 A;  1CZB A;  3VQE A;  1X9S A;  4BY9 C;  2ZGY A;  3ZT1 A;  2A1S A;  2RHK A;  3NF9 A;  3VER A;  1YIT N;  5IT9 O;  3AO4 A;  2P5G A;  1B92 A;  1NK7 A;  1NGA A;  4NXM K;  3OYC A;  2XY8 A;  1ZBL A;  3O4W A;  2W42 A;  1Q7Y O;  2FSK A;  4BG9 A;  3QFP A;  5AZJ B;  2D1K A;  3PIO L;  4C1N K;  4DSL A;  2NZT A;  2WTU A;  2OAN A;  1N6Q A;  4XIU A;  1VSF A;  4YOT A;  1LWC A;  3A5M C;  3LAK A;  4JN4 A;  2P9U B;  2NRH A;  4MQ3 A;  5EXW A;  4EFH A;  4DF4 A;  1RTD A;  1K8K B;  2G8U A;  5SZT A;  3VEX A;  4CIG A;  3C7N B;  3LDP A;  2D0B A;  3EEQ A;  2HBM A;  1QE1 A;  4IOX A;  4IFY A;  4QOZ B;  2ZJP L;  4B9Q A;  4BAC A;  2G8I A;  1OH8 A;  4B9U A;  1RTI A;  4H0T B;  3T1H K;  3J7A P;  2Q3S A;  4BE2 A;  4B9V A;  3IAY A;  2QXF A;  3B8A X;  3QO9 A;  3AVA A;  4KB0 A;  5E41 A;  3HPO A;  2X6N A;  1I3A A;  3WEE A;  4KRE A;  1OVY A;  1LAV A;  1QZ5 A;  1RDB A;  3DRS A;  4DV5 K;  5AZI B;  4X65 K;  2A3Z A;  3ZSW A;  5TKW A;  3P39 A;  2QKB A;  1GLJ O;  3NF6 A;  4FJG A;  4Z4F A;  1U2V B;  3RR7 A;  4B1W B;  1HNI A;  5C15 A;  1XMO K;  2H3G X;  5DM7 L;  1WB9 A;  4KB1 A;  3FR0 A;  3VQP A;  2X6S A;  1NJZ A;  1VQ6 N;  1NGC A;  3SPZ A;  3WXL A;  2D5R A;  1IV0 A;  1NU0 A;  5LJW A;  4DTR A;  3GG4 A;  1S22 A;  4B1V A;  3H08 A;  3T1Y K;  4B1U B;  4JI4 K;  4B1Z A;  1RIL A;  1LW0 A;  3O3H A;  2FF6 A;  3VET A;  2GWJ A;  2ZWH A;  4K25 A;  4PWD A;  2QKK A;  2X78 A;  2OPS A;  1BIS A;  2I7P A;  1U45 A;  1RT1 A;  2EWS A;  4MLH A;  3LWM A;  5JS1 A;  4RW8 A;  3NAE A;  3QEI A;  4AHU A;  3VGK A;  3MWT A;  5KQ8 A;  3ULD A;  3VEW A;  2E2P A;  3VES A;  3SQ2 A;  1S1T A;  3GE1 A;  1E3M A;  1Q8I A;  4KO0 A;  1SKW A;  4BRQ A;  5KRS A;  2J4R A;  1R0A A;  4FPB A;  4JK9 A;  4PUO A;  4BRA A;  2XHB A;  2G8H A;  4AM6 A;  5GAG P;  4DKW A;  4CJQ A;  3TTC A;  1K8A O;  1X3N A;  2QWQ A;  5I9E B;  3PUF A;  3GBT A;  4LFB K;  1JLC A;  2F8T A;  1WBD A;  3PLA A;  5C2D A;  1HYS A;  2IGI A;  1ZYQ A;  3CFR A;  4DTJ A;  3D2E A;  5FRO A;  3VQ5 A;  3J7Z O;  4AM7 A;  1BHL A;  1KTQ A;  1NKC A;  4BQZ A;  1LWE A;  4CEE A;  3K5N A;  2DPN A;  1NKE A;  3UKR A;  1Z05 A;  1XMQ K;  3BZC A;  4YY3 K;  3HM8 A;  4QS7 A;  1BWF O;  1LAW A;  1SKR A;  1RFQ A;  5HRR A;  3G71 N;  1NOZ A;  4Z4G A;  5KQD A;  3NVK A;  1IKV A;  4BRF A;  3K58 A;  3THV A;  3IDH A;  4BR2 A;  3O9Q A;  2QWL A;  1T6D A;  3LP1 A;  4LFC K;  4ELT A;  1KQS M;  4ZTJ A;  5HRP A;  2O8F B;  3CME N;  1RDU A;  2KW4 A;  3A2F A;  2YNG A;  4FM1 A;  4F9O A;  4CE9 A;  4J2E A;  1HKG A;  1P90 A;  4B9N A;  2VGM A;  3OJU A;  3O3F A;  3M8S A;  1RCH A;  4BGA A;  2UU9 K;  3OW2 M;  3OYJ A;  2A40 A;  5F1X A;  2GEL A;  5J2P A;  2G8W A;  2A5X A;  4EZ6 A;  3ULE A;  1DLO A;  2AJQ A;  3ZET B;  3VTI A;  4IEE A;  4CEA A;  3AO1 A;  5E26 A;  2WBN A;  3TAG A;  4H5R A;  3FFK B; 
#chains in the Genus database with same CATH homology
 3AO2 A;  4GMJ B;  5J2Q A;  3HVT A;  4O44 A;  1X1P A;  1D9D A;  4FK4 A;  3SPY A;  1QHT A;  1RTH A;  4AHT A;  1LWF A;  1NJW A;  5I3U A;  4HUE A;  4FLZ A;  2KZM A;  4F4K A;  4NYN A;  1RDA A;  1KVB A;  1SV5 A;  4ID1 A;  1NOY A;  4DTN A;  3SUP A;  3EYZ A;  2E6M A;  5FRM A;  3PO4 A;  4FYD A;  1S1W A;  2VG7 A;  4FCY A;  3V9W A;  4K8Z A;  3L2U A;  3RMA A;  1D5A A;  4DQQ A;  1BL3 A;  3VQA A;  4M3W A;  5SWM A;  3RMC A;  3DLH A;  1ZBU A;  1TL3 A;  5HBM A;  3VQ9 A;  1HYZ A;  3G0Z A;  3QEV A;  3HPH A;  1UOC A;  1VSM A;  4FJ8 A;  4O55 A;  4W5R A;  2IAJ A;  1WSJ A;  2XRI A;  4C8M A;  4CEO A;  4DQR A;  1B9F A;  4CJE A;  5J2M A;  3OYF A;  4DFM A;  4OKJ A;  3MEC A;  5CZ2 A;  2B5J A;  4CHQ A;  2HB5 A;  3HPG A;  3MEE A;  3OYB A;  1WSE A;  1GOC A;  3CM5 A;  1T03 A;  1Q9X A;  2RPI A;  4IG0 A;  2O4G A;  4DQI A;  4KI6 A;  4HHT A;  3AO5 A;  1L3U A;  4E7K A;  4KI4 A;  1EXQ A;  5HP1 A;  4FZZ A;  3IG1 A;  4CED A;  4E1M A;  3NE6 A;  4BE1 A;  4K8X A;  1RNH A;  2OPQ A;  4DSF A;  2ITG A;  1NK6 A;  2IOC A;  3EZ5 A;  2HHS A;  3L2Q A;  4O0J A;  4DSK A;  4CJP A;  4AIL C;  4CJF A;  1D9F A;  4NYF A;  3ZSO A;  3S3M A;  1L3V A;  4L8R B;  4FK0 A;  3C95 A;  3F9K A;  3TI0 A;  4I2Q A;  3ALY A;  1VSI A;  1RBS A;  3MED A;  2PZS A;  1BQN A;  4Y1D A;  3U3G A;  3QET A;  4M42 A;  3CM6 A;  4RW9 A;  3EY1 A;  4PA1 A;  4JRP A;  3PX0 A;  4CFB A;  2BDP A;  3K5L A;  2E6L A;  1Y97 A;  2E4L A;  1RBV A;  3ZSZ A;  3OYA A;  4EZ9 A;  3NH1 A;  1T8E A;  1C1B A;  4DQS A;  4M3U A;  4B3O A;  3OS0 A;  4IFV A;  2FBX A;  2Z1J A;  1LV5 A;  3TWH A;  4YFU A;  2IS3 A;  5C24 A;  2JGU A;  4CEC A;  3KK1 A;  4BDP A;  2Z1G A;  4CFC A;  2XY7 A;  4N5S A;  4AHV A;  1C0T A;  3ZT4 A;  4Q5V A;  4I9Q A;  3K5M A;  3DLR A;  4KTW A;  1HJR A;  3E01 A;  3KD1 E;  3KKR A;  4DTM A;  4CHN A;  3V9S A;  3FFI A;  2YV0 X;  3U3Y A;  2FC0 A;  1ASV A;  2OPR A;  3VN5 A;  5HRN A;  3SQ1 A;  4AHR A;  3L3U A;  4B9M A;  3D0P A;  3ZT3 A;  3VQQ A;  3OJS A;  1HRH A;  4FVM A;  4OPJ A;  5KGX A;  3KLF A;  3F73 A;  3ZT0 A;  3KTQ A;  3RRH A;  1IKY A;  4C8N A;  3HJF A;  4CJK A;  3LAM A;  2G8V A;  3NGY A;  2HNZ A;  3T3F A;  2OPP A;  1IH7 A;  3OYK A;  3IS9 A;  1XC9 A;  1ITG A;  4ZHR A;  5K14 A;  4DSI A;  3OYE A;  2OA8 A;  1S1X A;  3T1A A;  3VA3 A;  3DRP A;  4W5Q A;  4H8K A;  3QES A;  3M8R A;  2DFF A;  3NFA A;  3AO3 A;  3TAM A;  4BDZ A;  1ASU A;  1TGO A;  1VRT A;  1W9H A;  3DOL A;  4CIF A;  1IKW A;  3S9H A;  1JXE A;  1ZBF A;  1YTU A;  3TAP A;  4FZX C;  1J5O A;  1XHZ A;  2G8F A;  3AVK A;  3RRG A;  1O1W A;  1QS4 A;  3DLB A;  3LZJ A;  4E0D A;  4CJ5 A;  2EX3 A;  3KLG A;  1TAQ A;  4ELU A;  4F3O A;  1KCF A;  2HHX A;  1KFS A;  1N5Y A;  1BI4 A;  3KD5 E;  1LW2 A;  4CJ4 A;  4CEZ A;  2Z1I A;  5DK5 A;  3C6U A;  4FZY A;  3DI6 A;  2HVH A;  4CJW A;  4CJR A;  1JLG A;  3ZSQ A;  3RMB A;  4CES A;  1TKX A;  1NK8 A;  1BIU A;  1NJY A;  3V1R A;  5CY4 A;  1HQE A;  1RBR A;  3HST B;  1KLN A;  4B08 A;  1ASW A;  4HVJ A;  4KAZ A;  3P1G A;  3SZ2 A;  3QER A;  1J54 A;  3V1O A;  2BE2 A;  5J2N A;  3S3O A;  4GW6 A;  2HVI A;  2RN2 A;  4CHO A;  4FJ7 A;  2BAN A;  2OYQ A;  1FK9 A;  3QIO A;  5CYM A;  4CK3 A;  1C0M A;  1RT3 A;  2Y1J A;  3SCX A;  3MXM A;  4LD0 A;  3L2V A;  1DTT A;  3DLK A;  2PYJ A;  3SJJ A;  1UA0 A;  3K59 A;  1RBT A;  2O4I A;  1CLQ A;  4DF8 A;  2RF2 A;  1C1A A;  3I0R A;  1KFD A;  4OPK A;  1S1V A;  1B9D A;  2FBT A;  1K6Y A;  4FM2 A;  4DWI A;  2ETJ A;  4CHY A;  4N41 A;  1REV A;  3AA2 A;  3SUN A;  2KTQ A;  1WLJ A;  3P83 D;  1JKH A;  1TV6 A;  4CEB A;  4CER A;  4FJ9 A;  3KKS A;  1S9E A;  3SNN A;  1BCM A;  3AA3 A;  3OYG A;  2X74 A;  4Z4I A;  1WN7 A;  4BDY A;  3SV3 A;  1HNV A;  4H4M A;  3RR8 A;  1J9A A;  2HHU A;  1RTJ A;  4DFK A;  3DLE A;  3TAN A;  1VSE A;  4G1Q A;  4FJ5 A;  1Z25 A;  4KRF A;  5C42 A;  3K2P A;  4JS4 A;  2YNF A;  4N56 A;  4HCC A;  3OVN A;  3C6T A;  1EP4 A;  1JXB A;  1RBU A;  2B4J A;  2GBZ A;  4DLG A;  3DYA A;  1JLA A;  3P5J A;  4DS5 A;  5HRS A;  4MFB A;  4J2D A;  1BGX T;  1XHX A;  4CK1 A;  1BCO A;  1U47 A;  4NCB A;  3LAL A;  5KRT A;  3PV8 A;  1X9W A;  3VQ7 A;  3PX4 A;  4FJX A;  1TKT A;  1SKS A;  3HM9 A;  2ZE2 A;  1VSL A;  1RT6 A;  5J1E A;  3OS1 A;  4J2B A;  4FJK A;  3QIP A;  3KK3 A;  3TR8 A;  4E3S A;  4FJJ A;  2HW3 A;  2VG5 A;  1SL1 A;  1VSJ A;  1DTQ A;  2JLE A;  2WON A;  3CYM A;  3LP2 A;  3M8P A;  3NH2 A;  3OY9 A;  3K5O A;  4O5B A;  4IDK A;  3JYT A;  4DFP A;  1JLB A;  4TSX A;  3RMD A;  4HUG A;  2YKN A;  2P51 A;  3HYF A;  4O4G A;  4KTQ A;  1TVR A;  4W5T A;  3AA5 X;  3VQB A;  3KLH A;  1IKX A;  5FDL A;  2RKI A;  4M3T A;  1QTM A;  3ZSX A;  4ID5 A;  1RT7 A;  1EET A;  3LP3 A;  4M45 A;  3AVM A;  3ZT2 A;  4BWM A;  1NK4 A;  4DTO A;  4OVL A;  1KLM A;  1L5U A;  1NK5 A;  3MEG A;  4CJV A;  3RTV A;  4DU1 A;  3AVG A;  3KJV A;  1WAF A;  3ITH A;  1I39 A;  4CGF A;  4CF9 A;  2HHT A;  4E7I A;  1S5J A;  1J53 A;  4Z4C A;  1VSD A;  4B9S A;  3TAQ A;  3D45 A;  4DSJ A;  4IBN A;  3CFP A;  1YVU A;  1BI4 B;  3ZSR A;  4KHW A;  2DTU A;  3VA0 A;  4FJH A;  3LWL A;  1L3S A;  4KV8 A;  3AVB A;  1VK0 A;  4DG1 A;  1MU2 A;  2YNI A;  4LH4 A;  5KI6 A;  3O4Q A;  4CEQ A;  4PY5 A;  1RDC A;  3HO1 A;  3G10 A;  3OYH A;  3LPT A;  1D8Y A;  1W0H A;  1C0U A;  4N47 A;  4M3X A;  2HHV A;  2IDO A;  1TK8 A;  4CJU A;  2XY5 A;  4FM0 A;  3SYZ A;  3L2R A;  3M8Q A;  4OLA A;  3HL8 A;  3NBP A;  2GUI A;  4DU3 A;  3V6D A;  1T05 A;  4HTU A;  4I2P A;  4J2A A;  2DFH A;  4KTZ A;  1WSH A;  1CZB A;  3VQE A;  1CXQ A;  2VG6 A;  4DMN A;  1X9S A;  1KRP A;  3V9Z A;  3ZT1 A;  5T7B A;  2A1S A;  3NF9 A;  3VQD A;  3AVJ A;  4R5P A;  3JSM A;  3QNO A;  3AO4 A;  2P5G A;  1B92 A;  3NH0 A;  4HUF A;  4Z4E A;  1VSH A;  1NK7 A;  3O3G A;  3OYC A;  4JS5 A;  1ZBH A;  3NF7 A;  2KZZ A;  3V1Q A;  5KTQ A;  4I7F A;  2XY8 A;  2R7Y A;  1ZBL A;  4F8R A;  2W42 A;  1JLF A;  3L2W A;  1RDD A;  5KGW A;  4CCH A;  3NF8 A;  1RT4 A;  2HNY A;  4E7J A;  3SUQ A;  4DLE A;  1TKZ A;  1JL2 A;  3AVC A;  2ZD1 A;  1VRU A;  3QLH A;  4JRQ A;  1QSS A;  1GOB A;  4CK2 A;  3AVI A;  4DSL A;  4FXD A;  1KSP A;  4FJM A;  2YKM A;  2FBV A;  2KFZ A;  3V81 A;  1N6Q A;  4XIU A;  1VSF A;  1TK0 A;  5C25 A;  1CXU A;  1EX4 A;  1SUQ A;  1UWB A;  2KQ2 A;  1LWC A;  4FW1 A;  4CF1 A;  3KLE A;  4DTS A;  4CJ3 A;  4FJL A;  3SQ0 A;  3LAK A;  4DSE A;  2EHG A;  4LSL A;  4CGJ A;  4FLW A;  1QSY A;  1QSL A;  1JL1 A;  4CF2 A;  3U6F A;  2G8K A;  4MQ3 A;  2IC3 A;  2A1R A;  4DF4 A;  1RTD A;  1S6Q A;  3PY8 A;  2G8U A;  5SZT A;  1S6P A;  4F2R A;  4CIG A;  4KHU A;  4CF8 A;  1FKP A;  2D0B A;  3VQ6 A;  2NUB A;  1QE1 A;  3V9U A;  4IFY A;  4E7L A;  3DRR A;  2P5O A;  4QOZ B;  4W5O A;  3VQC A;  4BAC A;  2G8I A;  4C8O A;  3ZCM A;  4FLY A;  2XY6 A;  4B9U A;  1RTI A;  4O0I A;  2F96 A;  4CIE A;  2Q3S A;  2GV9 A;  3ISN C;  4BE2 A;  4B9V A;  3DLG A;  3IAY A;  1KVC A;  2QXF A;  1F21 A;  3QO9 A;  1HPZ A;  1WSF A;  4Z0U A;  1L3T A;  3AVA A;  4KB0 A;  4IG3 A;  3CFO A;  5E41 A;  3HPO A;  5FRN A;  3PO5 A;  2X6N A;  1YT3 A;  1I3A A;  4ICL A;  4AH9 A;  4AHC A;  3OYD A;  4KRE A;  1LAV A;  3T19 A;  3S3N A;  1RDB A;  3DRS A;  3SV4 A;  5CZ1 A;  3ZSW A;  3QEX A;  2QKB A;  2ATQ A;  3AVF A;  1NKB A;  3NF6 A;  1T7P A;  4QCL A;  4FJG A;  2VWK A;  4Z4F A;  3RR7 A;  1IO2 A;  4M41 A;  3NGI A;  2BGG A;  1HNI A;  1Q9Y A;  4FLU A;  3SQ4 A;  3AVH A;  3HP6 A;  2VWJ A;  4KB1 A;  3BDP A;  3VQP A;  2X6S A;  3LAN A;  4CHZ A;  4OGE A;  4M3R A;  3WNE A;  4KHS A;  1NJZ A;  3BGR A;  1WNS A;  1IG9 A;  3SPZ A;  4C8K A;  1HQU A;  2OZM A;  2D5R A;  4DTR A;  2YHA A;  3OYM A;  3NGZ A;  5DMR A;  2HND A;  1WAJ A;  3H08 A;  3O4N A;  4FW2 A;  4CJS A;  4DQP A;  1ZBI A;  2QK9 A;  1XI1 A;  1Z26 A;  2WOM A;  2I5J A;  4E1N A;  4CEF A;  2XO7 A;  1RIL A;  3MXJ A;  1LW0 A;  3O3H A;  5CYQ A;  1A5X A;  4IKF A;  3MAQ A;  4KHQ A;  3LP0 A;  1U04 A;  4B9T A;  4NCA A;  1C1C A;  4M3Y A;  4PWD A;  1U4B A;  2QKK A;  2X78 A;  4DTU A;  4JLH A;  5I42 A;  2OPS A;  3NCI A;  3WNG A;  1U48 A;  2DY4 A;  4WE1 A;  1BIS A;  3VQ8 A;  1QQC A;  3TAF A;  1BQM A;  3ASM A;  4E7H A;  1C6V A;  1TAU A;  2LSN A;  3IRX A;  4B8C A;  1RT1 A;  3CQ8 A;  1U45 A;  3TAE A;  3LWM A;  3MXI A;  5JS1 A;  4RW8 A;  3NAE A;  4RW6 A;  4EP5 A;  4AHU A;  3OYL A;  3QEI A;  3B6P A;  4N76 A;  1X9M A;  1WSI A;  1WSG A;  3LZI A;  3ZSV A;  2B6A A;  2FBY A;  3ULD A;  2P1J A;  5JS2 A;  4CJL A;  3SQ2 A;  5HRO A;  4KPY A;  1S1T A;  1S9G A;  1VSK A;  3AVL A;  4NCG A;  3VQ4 A;  2DFE A;  4W5N A;  4EP4 A;  4UQG A;  4PQU A;  3OS2 A;  3SI6 A;  1RT5 A;  1Q8I A;  4KO0 A;  1SL0 A;  1SKW A;  4DTX A;  3AV9 A;  5KRS A;  2YHB A;  3QEP A;  4DTP A;  2Y1I A;  1R0A A;  4Z4H A;  2PY5 A;  2Z1H A;  4OJR A;  4PUO A;  1A5V A;  4RW7 A;  4QAG A;  2XHB A;  2G8H A;  4LY7 A;  3QIN A;  4GVM A;  4E89 A;  1G15 A;  3UIQ A;  4CGI A;  3QNN A;  4CJQ A;  1FXX A;  3HXM A;  1UAX A;  2YNH A;  4C8L A;  3WNF A;  2D0C A;  5EU7 A;  4ZTF A;  3B6O A;  3PUF A;  4KKO A;  1BIZ A;  1JLC A;  4CGG A;  3V4I A;  4OLB A;  2F8T A;  1GOA A;  3LDS A;  1HYS A;  4ELV A;  2IGI A;  4RG8 A;  3HP9 A;  1ZYQ A;  4CFA A;  1RT2 A;  3CFR A;  4DTJ A;  4FJI A;  4Q0B A;  5D3G A;  3ZSY A;  4LH5 A;  4BWJ A;  5FRO A;  3VQ5 A;  1BHL A;  1KTQ A;  1NKC A;  3SUO A;  3AA4 A;  4CGD A;  3I8D A;  1KVA A;  1LWE A;  4FLX A;  3PX6 A;  4M3Z A;  4H4O A;  4E19 A;  4DS4 A;  4CEE A;  4I9L A;  3K5N A;  1NKE A;  3K57 A;  3C94 A;  3I0S A;  1FKO A;  1HMV A;  4CHP A;  3OYI A;  3CG7 A;  3DM2 A;  1TK5 A;  3HVR A;  3DOK A;  2OZS A;  1LAW A;  3OYN A;  5HRR A;  1SKR A;  4OKK A;  4CF0 A;  4FLT A;  2PYL A;  4DFJ A;  1NOZ A;  4KHN A;  3NDK A;  4Z4G A;  1A5W A;  3KK2 A;  4CGH A;  1JLE A;  3KLI A;  1IKV A;  4OGC A;  3HT3 A;  3K58 A;  4FLV A;  3V9X A;  5HLF A;  3THV A;  1CZ9 A;  4F2S A;  1XWL A;  3LP1 A;  1UA1 A;  1NK9 A;  4ELT A;  4ZTJ A;  4B8A B;  5HRP A;  4AHS A;  3LPU A;  3TAB A;  2KW4 A;  3A2F A;  1NK0 A;  2YNG A;  4FM1 A;  2F8S A;  1JLQ A;  4CE9 A;  4J2E A;  4B9N A;  3TAR A;  1S1U A;  3OJU A;  1TL1 A;  4BE0 A;  2ZQB A;  1U49 A;  3O3F A;  4B9L A;  4FJN A;  4KHY A;  3L3V A;  3M8S A;  1RCH A;  3AVN A;  3L8B A;  4HCB A;  2HMI A;  3DMJ A;  3NHG A;  1EKE A;  3OYJ A;  5J2P A;  4FK2 A;  4F3T A;  4CFD A;  1SL2 A;  2G8W A;  1NJX A;  4EZ6 A;  3WNH A;  3QEW A;  4CJT A;  3KIO A;  1DLO A;  1HYV A;  3HK2 A;  2AJQ A;  2HHQ A;  4Y1C A;  4OKE A;  4CEA A;  2KFN A;  4DU4 A;  1YTA A;  3RWU A;  3AO1 A;  4KFB A;  2HHW A;  4YNQ A;  3TAG A;  2D0A A;  1TKD A;  4LSN A;  4RW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...