2YKMA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
557
structure length
557
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPCLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
molecule tags Hydrolase
source organism Human immunodeficiency virus type 1 bh10
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
total genus 156
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ykmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ykmA05
3OSPA 1WLJA 3IRXA 2XGPA 1ZBUA 4FZZA 4FJ5A 4GC7A 3SUOA 2W7PA 4TSXA 1KFDA 4RNOA 2VWKA 5KFZA 3PJXA 3I5BA 3ZSZA 4EP5A 5F8HA 4WFXA 3NGYA 4Q5VA 4RNMA 4CJ3A 1RTHA 3H98A 4F3OA 1TL3A 1C1AA 1S1UB 2FJVA 2EX3A 3SYZA 4CJWA 2O4GA 3WNHA 3T5LA 3LPUA 2FBTA 3O3FA 2HHVA 1RTIB 3RMCA 2P5OA 4Z4FA 1TQLA 5KFOA 2HHTA 5KT3A 4K4VA 1S1VB 1IKVB 1CZBA 4CJFA 3ZSQA 2VWJA 3V6HA 2R2TA 5HLFA 1TK8A 1YVUA 4NRUA 4CIFA 1JLBA 1MU2A 2FLLA 4DL4A 1TKXB 5DK5A 4Z4GA 4HHTA 3JYTB 1LV5A 4DL2A 2Y1IA 3G0ZA 2HVIA 1ZETA 3M8QA 4ECTA 4KTZA 4H8KA 1I3AA 4BWMA 4J2AA 2UVWA 3V9ZA 3TWHA 5L1LA 4WFZA 1YT3A 1S6QA 2OH2A 3ULDA 2RDIA 4KTWA 2YKNB 5DG7A 1XI1A 1U48A 4DU4A 1S1VA 1DTQB 3V9WA 4Z4HA 1WSGA 4EYIB 3MEGB 2W9BA 5D3GB 5EDWA 4HUEA 1SL1A 1LAWA 1U45A 1RDDA 3KK1B 1C2PA 3VQ9A 5KGXA 3N6MA 1IKWB 4JRPA 4FJHA 3BREA 3HKWA 2FJXA 3WNEA 4C8MA 4NLRA 3DLEA 2IC3A 3VQEA 4QWAA 2O4IA 3VQAA 2V9WA 1QAJA 1TL3B 1U04A 4CJQA 4FJ8A 1EETA 4FBUA 1RT4A 4DEZA 4RG8A 3TAGA 1RT1A 3DDKA 4J9KA 4I7FA 5J2PB 3VQSA 3NHGA 4FJ7A 4FJMA 1J5OA 3F73A 3KMSA 3IG1B 1X1PA 1RT3A 1RCHA 3GIIA 4ZP7A 5L1JA 3V1OA 4ZVGA 4RW4A 1GOAA 4O44B 4CGJA 3S3MA 3O4NA 4J9OA 1RDCA 2AJQA 5F9LA 3KTQA 3QINA 4O3SA 2LSNA 4ECQA 4F3TA 3KHLA 3VQ5A 1NK6A 4B08A 3SQ4A 1IKWA 4URGA 3C95A 4E3SA 4KB1A 3ZSWA 4JV1A 2XCAA 4HCCA 3KNAA 3GV8B 4OPJA 1S5JA 1N4LA 2RF2B 2EC0A 2JEJA 1S6QB 4ZP6A 3PW0A 1RTJB 3E51A 4ED6A 4DQPA 1RBTA 4DQIA 3RMDA 4N56A 5SZTA 3Q8PB 2IA6A 2B4JA 5JS2A 3V81A 2V4QA 3OLBA 5KFPA 4KFBA 2YNGB 4O3QA 4Y3CA 5DQIA 1S6PB 1TKZB 3PX6A 2FVQA 1C0TA 1HNVA 3HVAA 4NLYA 5KT2A 1RA7A 3OL8A 5I3UB 4HKQA 1QSSA 4CGDA 3K59A 3I5CA 4O3OA 2R8KA 2C2EA 3VA3A 5C5JA 2JEFA 3MR2A 2R8IA 5CY4A 4J9NA 3PY8A 4O55A 4CFAA 2D3ZA 3LP1A 3K57A 3FFIA 3RAXA 1TAQA 2J6SA 3VQ7A 5C24A 2HW3A 1JLAA 4ZPAA 1RTJA 3IGNA 3AVLA 3ASMA 3QZ7A 3CDWA 3H4DA 4DSKA 3KLFB 4EBDA 3H40A 4NLTA 3FDSA 3E01A 2F8TA 4ZVFA 4DTRA 3MECB 3LZIA 3RBDA 2FLPA 4TN2A 5KT4A 5K14B 3IS9A 1X9SA 1RBSA 3AO2A 4NYNA 2VG7A 2KW4A 2HMIA 2PY5A 2F8SA 2DFEA 3NFAA 3VQCA 2G8VA 3TAFA 1BIUA 4H4MA 4E7LA 1ZBIA 3DLHA 4WYLA 1SL2A 1ASWA 2Z1IA 3TARA 3TI0A 1EP4A 3N6NA 2AQ4A 1SUQB 3OS2A 3CO9A 1T05B 1HYZA 2UUWA 4RZRA 4YNQA 4CCHA 3PO4A 2G8HA 3FQLA 1B9FA 1FXXA 3VQ4A 3F9KA 1J5OB 3MAQA 1SKRA 3NAHA 3IRXB 1REVB 1D1UA 1C6VA 4ECSA 3P5JA 2WOMA 4DWIA 1K1SA 4EO6A 2HNZA 4OGEA 2FVPA 4ECVA 1HNVB 4CEOA 3TANA 1KHVA 2JC1A 1NOYA 2HVHA 4WE1A 2QK9A 1JXBA 1TP7A 4KSEB 3KK1A 2YNIA 4HCBA 1JXEA 4M3YA 1QAIA 2OA8A 5KFAA 4LH4A 4DQSA 2VA3A 4KHWA 1G15A 1S10A 1XHXA 4E7JA 2C22A 2RF2A 4FK4A 5FRMA 1VSJA 1KSPA 3M8QB 1S1TA 4JS5A 2HHXA 1OS5A 3D5MA 1HYSB 3GYNA 3LDSA 4B3OA 4WE1B 1TKXA 3TAMB 3NH1A 3AVMA 2DFHA 4CJLA 4KBIA 1BQNB 3PJWA 3MR3A 1T03B 4ECWA 1QTMA 4M95A 4WZMA 1FKOB 5KFMA 3H59A 5KG4A 4M3WA 3CJ0A 1FK9B 4O44A 2D0AA 5HP1B 3CYMA 5HRNA 4MH8A 4Q45A 1U09A 2JC0A 5KFTA 1RT3B 2C28A 2AGPA 4CK1A 4CIGA 1RTHB 3Q8QB 4CHQA 4CHZA 2WONB 2HHWA 3SUPA 3HL8A 4GVMA 4ZP9A 1HNIA 4J9RA 3TR8A 2E9ZA 4JRQA 4ID5B 1EETB 3FQKA 2W42A 5F8NA 1WSIA 1MMLA 1A5WA 3KLIB 3KHGA 3QLHB 4CEQA 4J2DA 4CEBA 3LWLA 2OPRB 5J2QB 1LWCA 1SH3A 4M3XA 3KLGA 3OYNA 4DSJA 2GIRA 3VQQA 2W9BB 4X2BA 1DTQA 3B6OA 1VSLA 5JS1A 3KOAA 1SKSA 4FZYA 5F8MA 3OL9A 2YKNA 4W5TA 3KLFA 4B8AB 4BDZA 2IS3A 1HQEA 4N5SA 2VA2A 4ZTJA 1L5UA 2B5JA 3HVTA 2FBXA 5F8GA 2D0CA 4IG3B 4DU1A 3THVA 3LP1B 1NK0A 4JLHA 4FM0A 4B9VA 4E7HA 2IM2A 4KHYA 3EZ5A 3EPGA 1MU2B 4LSNB 1UA1A 4ZHRB 2WHOA 2KFNA 2YKMB 4I2QA 4DG1B 1RYSA 4URSA 4FLWA 3LP3A 2D5RA 2OPSB 2YNGA 3V81B 4CJUA 3SV3A 1LW0B 3QGHA 4XIUA 1JKHB 2WB4A 4NLSA 2O5DA 3T5HA 2X78A 3SPZA 4Y2AA 4NYZA 4TY8A 4KV8B 4Y34A 2R8JA 2EHGA 4XPCA 4FJXA 1DLOB 3QEXA 2IAJB 3CM6A 1DTTB 2DTUA 5KG5A 2HHQA 3CWJA 2BQUA 3RR8A 4I9LA 4E89A 4YQWA 4DL3A 3ZT4A 3MXIA 2ATQA 1UWBB 1TKDA 1TV6A 3HPHA 3TQ1A 3ITHB 3LP0A 3T3FA 4RNFA 4NLDA 4ECUA 2R8GA 2W9CB 5DGBA 3H08A 1Z25A 4GW6A 4IBNA 3DYAB 3MFHA 1RA6A 3SFGA 2GV9A 3KLHB 2OZMA 2FLNA 4KKOA 1QQCA 2YHAA 4DFJA 3LAKA 4DL6A 3S9HA 4M3UA 4F4YA 5DLGA 4ZPCA 3MR6A 1BQMB 1KRPA 1FKPA 4AHRA 4PY5A 4OKKA 5EWGA 5T7BA 5KFGA 2KZMA 1R0AB 3NGZA 1IKYA 3L3VA 2AX1A 1SKWA 4FS1A 3ZT0A 4TYBA 4U6PA 4OPKA 5JUMA 3V1QA 3MXJA 1WAFA 5HBMA 2PZSA 2ITGA 4CECA 3QIPA 3ICLA 2JEIA 4LY7A 4YR3A 1VK0A 4RW6B 1WNEA 3PO5A 4FLVA 3AA5X 3KJVA 1T94A 4TLRA 4IKAA 4OLBA 3CG7A 5CYMA 5C42B 3DRSA 5EU7A 4IG0A 4B8CA 4TYAA 1LW2B 4QW9A 3SFUA 3NF6A 3DOKB 4BE1A 3GV7B 3AVJA 3V6DA 3OSNA 4J2EA 5C25A 2HHSA 3CJ2A 3DOLA 4R8UA 4IOBA 1C1CB 3K5NA 3TAQA 1KHWA 2IJFA 2XY5A 4KB7A 4RW8A 4DQRA 1VSDA 4G1QA 1HPZA 3NAEA 1NK9A 3GQCA 5FROA 1C1BB 2OYQA 3L2QA 3M9NB 1NJZA 2UVVA 2QE5A 4CJRA 3VQDA 1S1XB 1A5XA 4QW8A 4CJEA 3KLVA 1TVRA 4BE2A 1ITGA 3NAIA 5KFBA 3PR5B 1RDRA 4DTMA 2BGGA 1HMVB 1RTIA 4CEDA 4FJJA 1JLCA 2D0BA 1KVCA 3DI6A 1S1UA 3OS1A 4NYFA 4DL5A 3SQ2A 3I0RB 4IRKA 2G8UA 1B92A 4KHNA 1Q8IA 2I1RA 3K5OA 2VG5B 4CJPA 3M8PB 3TVKA 4O3NA 3AA2A 3L2WA 5KFDA 3KLEA 3HSTB 3TAEA 2BQRA 4WFYA 2DPIA 3NGIA 1U49A 3KD1E 4MKBA 2QKBA 3HO1A 4IRCA 3EY1A 3DRRA 1CXQA 4M41A 3PUFA 1K6YA 5J1EB 1GX6A 5KG7A 1TKTB 3K2PA 4J9PA 4M3ZA 5DG8A 4QWBA 2OPPB 4C8NA 4W5RA 2IGIA 3K5MA 3LP2B 3H5XA 3AVNA 4Z4CA 2VG6B 3KKSA 4R5PB 4ELVA 4O4RA 4ZP8A 3QYYA 1S9EB 4ED8A 3OYLA 1D5AA 4ELTA 4CF9A 1C0UA 2ZD1B 2RKIB 4CF1A 2Z1HA 4CHOA 5KFIA 3FRZA 4O5BA 3NBPA 3GIMA 1B9DA 4BACA 4NLUA 1RT5A 4M3TA 4RNNA 4IR9A 1BCMA 4GC6A 3DLGB 2Q3SA 4K8ZA 4FJ9A 4EBEA 1KLMA 5L1IA 4K4WA 4RW7B 1VSEA 4F4WA 3SQ1A 3IAYA 4AHSA 1TAUA 3VN5A 4FZXC 2DFFA 3V4IA 1QE1A 4RU9A 4LSLA 3I5AA 1A5VA 3NL0A 4J9QA 3RBEA 2XGQA 4I2PA 4CF0A 5KRSA 1SV5A 2C2DA 2X6SA 3AVBA 1TK0A 4NCBA 2WK4A 2ILYA 4CK2A 3QZ8A 1NJWA 4TQRA 3DLKB 1L3VA 4J9MA 4AHTA 2YV0X 3QIDA 2BE2B 2IBKA 3OYGA 1IKXA 4CIEA 3G6YA 4DSIA 1RT2B 1JLGB 4CF8A 3DM2A 4MK7A 1KVBA 2B43A 4J9SA 2FBYA 3S3NA 3BSNA 3HJFA 5DMRA 2NUBA 4Q0BB 3BGRA 3AO3A 2FVSA 4FYDA 3H5YA 4DTUA 4F50A 4ED3A 3AO5A 3BR9A 1RT2A 3QETA 4IFYB 5CYQB 1S9GB 3MEDA 1QHTA 3AA3A 4CJKA 2KQ2A 1S97A 3KK3A 1VRTB 3CDUA 4QWDA 3VA0A 2XCPA 1N5YB 3CFPA 3DLRA 2W8LA 1WAJA 4Q8EA 3SCXA 3AVCA 4YFUA 4MIAA 4M3RA 3TAPA 2QKKA 3BQ0A 4Y1DA 2ASJA 1SH2A 4PWDB 3SUQA 3M8RA 5J2NA 4IH7A 3PW4A 1YTAA 4CJ4A 4KHQA 4FJNA 4BE0A 3CM5A 4CJ5A 4KHSA 4FLTA 3RAQA 2QXFA 3P1GA 4B9TA 4O4GB 3BSAA 1RBUA 1WSEA 2ZE2A 1N6QB 3KIOA 2HNYB 5HRRA 3DLGA 3CJ3A 4J9LA 3NCIA 1Q9XA 1RT6A 1C0MA 4NCGA 3K58A 3SPYA 4FK0A 1EKEA 4F4KA 2ZQBA 3PR4A 3OYDA 4JV0A 3U6FA 4BDPA 3UIQA 3UPFA 1WN7A 4R5PA 1GOBA 2FVCA 4K4SA 4L8RB 4URQU 4KHRA 3O4QA 4O0IA 4NCGB 2JLEA 2UUTA 4EEYA 4FVMA 5E41A 4CEZA 1LWEB 1D0EA 4KHMA 1UAXA 1ASUA 3OYHA 1JLFB 2Z1GA 2YNHA 3IN5A 3NF8A 1NNDA 3MEEA 4Z0UA 4CK3A 4DLGA 3V9XA 4F2RA 1W25A 1F21A 3V9SA 4DFMA 3C6TB 1HQUB 4NLXA 4CJVA 4E19A 3OVNA 1S0NA 3VQ8A 4NLOA 4FLYA 1BI4A 5HROB 3EPIA 1N56A 4W5QA 3V6JA 3V9UA 5KGWA 2ILZA 1CSJA 4K50A 4BDYA 4DF8A 3HPOA 4KPYA 4ZVEA 2G8KA 4ICLA 1TL1A 3QO9B 3ALYA 3PX4A 2I5JB 2E9RX 3I0SA 2FC0A 5CYQA 4DSFA 4KO0B 3C6UA 4QOZB 4CJSA 4CJTA 1S1XA 4FLXA 4IRDA 3G86A 3PHEA 2PYJA 3RR7A 4CEFA 1JLFA 5L1KA 1ZBFA 4B9UA 4IDKB 3O3HA 4CEEA 2HWHA 3VQPA 5KFSA 1GX5A 2AWZA 5KG2A 3MTKA 2YHBA 1N48A 2JEGA 3UR0A 1C1CA 2E4LA 2GC8A 3BJYA 1TGOA 4PUOA 4RW9B 3OYBA 4QWCA 4HVJA 1JLQA 2QV6A 2BRKA 5KFNA 4B9SA 2KZZA 1SV5B 3SUNA 4DS4A 5KFYA 2V0NA 3GIKA 4B9LA 4RW9A 4H4OB 3RRHA 2JGUA 2HNDB 3RB6A 2J6TA 1LWFB 4ED1A 4YR0A 5FDLA 3OY9A 1KLMB 2CKWA 3NE6A 2E6MA 4IDKA 1T7PA 3I8DA 1ZYQA 2J6UA 3M8SA 3NBPB 4K4ZA 4CEAA 1ZTTA 4F2SA 2OPQA 4AILC 3PVXA 5J2MA 2AX0A 1KVAA 3OYCA 1YVFA 1R0AA 4ZMMA 3C6UB 4PUOB 1ZBLA 3I0SB 2YNFB 3H4BA 2AGOA 1CZ9A 4BWJA 5DG9A 2GIQA 4ICLB 4M45A 1VSIA 4FM2A 3T5KA 1XHZA 3AV9A 4OGCA 3KHHA 3HXMA 3DRPA 2D41A 3HM9A 1VSHA 4E1MA 2G8WA 3DRRB 1CXUA 4E0DA 1RDBA 4DQQA 1EXQA 4IFVB 3U3GA 4KO0A 4PQUA 1TV6B 4N47A 4K4UA 2B6AB 1VSFA 4MQ3A 1Q9YA 1RTDB 2Z1JA 4ZPBA 4CESA 3V6KA 2DY4A 1D9DA 1JLEA 3DMJA 4TY8B 4KHUA 3DRPB 1ASVA 3ZSRA 4FK2A 5FRNA 3T19A 3PW2A 2IDOA 2ALZA 4U7CA 1LW0A 1S49A 3AVAA 4B9MA 3AVGA 5DGAA 4OVLA 3C6TA 4DTNA 1NKBA 1HMVA 5F8LA 4FJLA 2F96A 1ZBHA 3HP9A 2OPSA 1JX4A 3QEPA 3SV4A 4MFBA 1JL2A 2ZKUA 4FBTA 4DG1A 4XO0A 3T1AA 1KTQA 1BL3A 1Y97A 4ZHRA 1VRUA 5DLFA 4O3RA 3RB3A 3AO1A 4DSEA 5I42A 1RAJA 4TY9A 5F8JA 4Z4EA 2XY8A 3OYKA 1N6QA 4O4GA 3EZUA 3H5SA 1Z26A 3L3UA 2BDPA 1C0UB 1LWFA 3G10A 3L2VA 4N41A 3QERA 4FJIA 2B5JB 3QESA 1RNHA 1J54A 2XI2A 2A1SA 1HQEB 4F4ZA 4W5NA 3O3GA 4EO8A 2G8FA 3G6XA 4NLGA 3CJ4A 1BCOA 2RPIA 1BHLA 1BGXT 5C42A 2GBZA 4LD0A 1JLEB 5KT6A 2UVUA 1N5YA 3NH0A 2OPRA 5J2QA 4UQGA 1VRTA 2B6AA 1XR6A 3OYIA 1X9MA 3MEDB 4K4XA 4IFYA 3KK2A 1HJRA 3QIPB 5J2NB 2FVRA 2C2RA 3PV8A 5HBMB 2BRLA 5EWEA 1HNIB 4Q0BA 4WZQA 1NOZA 3V1RA 4Q43A 4KAZA 4QCLA 4KE5A 4LQ3A 2HB5A 4ED2A 2BANB 2XWYA 5KFLA 1UA0A 2KFZA 1VSMA 3SNNA 3PZPA 1EX4A 2X74A 1UOCA 1FKPB 4WXOA 3SI8A 5HP1A 2YNFA 4E7IA 4DTOA 4E1NA 1RBVA 4CFBA 4C8LA 1T8EA 1IO2A 5KFVA 3RB4A 1NJXA 2RDJA 1TVRB 2AU0A 2BANA 1HYVA 4FCYA 1SL0A 2OPQB 3BGRB 2FBVA 3EYZA 5HROA 1BQNA 2P1JA 1BI4B 2W9CA 2P51A 1WSHA 1GOCA 4LSLB 4ID1A 1JLGA 3FSIA 3KK2B 3V4IB 3NH2A 2D3UA 5F9NA 4ELUA 4N76A 4ED0A 2HNDA 2ASDA 3OLAA 5C25B 1DLOA 3MXMA 3LPTA 2ATLA 1WNSA 1I6JA 3HT3A 5KG0A 1RT5B 1QSLA 3CJ5A 1L3UA 4DFKA 3SZ2A 1S0MA 4Y1CA 3KHRA 2P5GA 4CHNA 5JXSA 4DTXA 4I2PB 2R2SA 3DLBA 2RKIA 3DRSB 2YNIB 3U3YA 4C8KA 2Y1JA 1NHVA 3K5LA 4HTUA 3HVWA 5F8IA 4AH9A 2IM0A 4Q44A 3PX0A 4I2QB 1NKCA 1Z4UA 1TKTA 3QNNA 3GV5B 3OYJA 2IJNA 3AVHA 5I42B 3D28A 1VRUB 4NLQA 5L9XA 5KFFA 4MFBB 2BQ3A 4IR1A 4IG3A 1ZTWA 3SI6A 1KLNA 4R0EA 2OZSA 2HWIA 5DQHA 2ETJA 4PWDA 5KFUA 1RILA 4DTSA 2I5JA 3AVFA 3M8PA 3TABA 4FJKA 3UQSA 4JUZA 4HUGA 1BQMA 2XO7A 3NF7A 3LP2A 1EP4B 1W9HA 4C8OA 4H4MB 3DMJB 1RTDA 5KRTA 1JLCB 4ECRA 3OYAA 3ZSOA 1RBRA 5KFQA 2UVRA 4PQUB 3ITHA 5KFCA 3BQ2A 4IFVA 3S3OA 4ID5A 5DQGA 4OKJA 4OLAA 3NDKA 1DTTA 3NKYA 4RUCA 5KFEA 2YNHB 2WONA 1J9AA 4ECXA 3L2RA 5KFJA 4ED7A 1JL1A 3MR5A 1LWEA 1JLAB 1D9FA 5C24B 2AGQA 4ZVHA 3MFIA 1JKHA 5HRPA 4QAGA 3FFIB 5KFRA 3OL7A 1QSYA 1W0HA 1XR7A 5CZ2A 1HRHA 5J2MB 3PW7A 3QNOA 2IMWP 3QEIA 4KAIA 5KG6A 1RT6B 3CDEA 2XRIA 4EZ9A 5KFXA 1T03A 3OYMA 1D8YA 3VQBA 4IG0B 2XY6A 4M42A 4CFDA 4FM1A 4WXWA 2HNYA 2A1RA 3RTVA 3L8BA 4G1QB 3KJVB 5KFWA 4EP4A 4FLZA 4KB0A 5FDLB 3LANA 3LZJA 3BDPA 4R8UB 3HVTB 1X9WA 2R2RA 3SJJA 4H4OA 2W8KA 4IKFA 5HRSA 1KFSA 4O3PA 1LW2A 3KD5E 1O1WA 4IH5A 2R7YA 1IH7A 1JLQB 1BIZA 3CQ8A 3HP6A 1JXLA 4FLUA 1S9EA 2KTQA 2ASLA 3H5UA 3KK3B 1XWLA 3VQ6A 3HK2A 5KT5A 5KTQA 4RW6A 2VG6A 3ISNC 1S9GA 4NRTA 4DTJA 2RN2A 3OS0A 4KTQA 3BSCA 3LWMA 4AHUA 1VSKA 4RW4B 4CE9A 1REVA 3AA4A 5KG3A 4HUFA 3RB0A 4TQSA 2HAIA 5KI6A 4ECZA 1IKYB 4DLEA 4OL8A 4FS2A 4NLWA 3DM2B 3LP0B 4MIBA 3KLEB 3KMQA 3NMAA 3RRGA 4Z4IA 1UWBA 1IKXB 4CGGA 2BE2A 2FJWA 3ZSYA 5KT7A 1NJYA 1TL1B 3QO9A 3LALA 2VG5A 4OJRA 1IM4A 4M94A 3DLKA 5EWFA 5J2PA 4I7FB 4O0JA 2BR0A 1LAVA 2IM3A 1RT4B 2W9AA 2XY7A 2X6NA 1YTUA 4E7KA 3QEVA 3OJSA 4GMJB 3DI6B 4EYHB 4CHPA 3AVKA 3CIZA 3ZCMA 2VG7B 2HMIB 3TAMA 5K14A 3Q8RB 1HQUA 1J53A 1HYSA 2D7SA 1QE1B 1NK7A 4I9QA 4DS5A 3OJUA 3ZSXA 4LH5A 4QWEA 3E01B 2E9TA 2YKMA 3MEEB 2CJQA 4ZPDA 4KV8A 1C1BA 3HVRA 3NGDA 4MK9A 4NLPA 3RMBA 4CGFA 2WTFA 3OL6A 4DSLA 4XPEA 4MK8A 3UDLA 2ZD1A 1KCFA 2IOCA 3BSOA 4FW2A 3DOLB 3AO4A 3ZT2A 3JYTA 4MKAA 4NLVA 1TK5A 4Q8FA 4DL7A 3RWUA 3MF5A 4Y2CA 1JLBB 3V6DB 3BQ1A 2R2UA 3DOKA 4K4YA 3HYFA 4AHVA 1C0TB 2E6LA 2HNZB 1S6PA 1TKZA 2PYLA 3OHBA 2XC9A 2WOMB 2G8IA 4EBCA 2ZE2B 1LWCB 1XR5A 3N6LA 1RYRA 2HHUA 1K1QA 4CGHA 3M9MB 3QLHA 3KLIA 1U4BA 4K4TA 2V4RA 1U47A 3ZT3A 3HHKA 4ECYA 3H2LA 4DU3A 4RNHA 4PA1A 1NK8A 3GILA 4FW1A 4KI4A 1QS4A 2W7OA 3I0RA 3OYEA 4WYWA 1BISA 1SH0A 3KLGB 5T14A 2GUIA 4DF4A 4J2BA 4KREA 2IM1A 2WRMA 4DTPA 1IG9A 3IS9B 4DFPA 1S4FA 3WNFA 3SQ0A 3T5JA 1CLQA 3QGGA 5KFKA 3CFRA 3MECA 4AHCA 1FKOA 3P83D 4NZ0A 4CERA 3KLHA 1NKEA 3QGIA 3DYAA 3CFOA 4CFCA 3NF9A 3CVKA 4CHYA 3A2FA 4B3OB 3D0PA 3LAMA 1HPZB 4IH6A 3IG1A 4RW8B 1S0OA 1JIHA 1S1TB 3B6PA 3IGVA 4ZTFA 1S1WB 3D45A 1NK5A 4KI6A 4JS4A 2IAJA 1FK9A 1WSJA 3ZSVA 1NK4A 1WSFA 4QPXA 4YMEA 4FXDA 1RT1B 3JSMA 1S48A 2WCXA 5I3UA 3ISND 1RT7A 4CF2A 2F8EX 4F4XA 3L2UA 2IC3B 3DLEB 1QUVA 5CYMB 4G3IA 4EZ6A 1HARA 4KFBB 2XHBA 5EUHA 3Q8SB 4FJGA 2XI3A 4YP3A 4F8RA 3ZT1A 5D3GA 4H54A 3MEGA 4RW7A 3C94A 4HYKA 1S9FA 4KRFA 1RT7B 4DMNA 3OHAA 3G6VA 4LSNA 4LQ9A 1L3TA 3WNGA 4TXSA 3JSMB 3GIJA 1L3SA 4NCAA 5KG1A 4W5OA 3QIOA 4OKEA 3M9OB 1S1WA 3HPGA 3QEWA 4RUAA 5CZ1A 3PW5A 1XC9A 4B9NA 3KKRA 2R8HA 1T05A 4IQXA 1I39A 1RDAA 3AVIA 2DPJA 1SUQA 4K8XA 3RMAA 5HLFB 1NHUA 3OYFA 2OPPA 4YR2A 5KFHA 1IKVA 1T3NA 4CGIA 4KKOB 5J1EA 5SWMA 4JV2A
chains in the Genus database with same CATH superfamily
2MZSA 4UW2A 2UUBJ 5TKWA 4FZZA 4FJ5A 5E3PA 1ATRA 3JSYA 2L9WA 2W7PA 1Q82T 4K5SA 4PG8A 2RHSB 1FD8A 3TJ9A 3QBXA 2DY9A 3PJXA 2P9KB 2GVZA 3ZSZA 2BJ1A 4EU0A 4EP5A 2BXJA 4Z7YA 4WFXA 1KN6A 2V63A 2OANA 1RHQB 2EFPA 4Q5VA 4RNMA 1X4DA 1RTHA 3H98A 3DHWC 4USUA 3CJKB 1NB2A 4DR6F 1C1AA 2FJVA 4LREA 4ISFA 3WNHA 2VFVA 3FMWA 2MZ1A 3LPUA 2QA4G 4LMZA 2ZWOA 3O3FA 2HHVA 2P9NB 1KQSR 4F9OA 1TQLA 5JVGL 3GG4A 2H48B 2HHTA 3VTIA 2PA3A 2VWJA 2R2TA 3C65A 4AFFA 4CIFA 3M2RA 4A5BA 3VOVA 4DL4A 4Z4GA 1IJEB 4K41A 4HHTA 1LV5A 2Y1IA 4H5RA 1ZETA 3EM1A 2ZVSA 5CCMA 3UNGC 4IFEA 4H8KA 3SAHA 4BWMA 4J2AA 4WFZA 3CJTA 1YT3A 2OH2A 1ULRA 4CT9A 2YKNB 1VC0A 3WIVA 1XI1A 1U48A 3ID6A 3V9WA 1WSGA 1ZS6A 4EYIB 2Z8QA 2W9BA 1LAWA 1U45A 1C2PA 1AT1B 1R6YA 1IKWB 1UJ5A 2DRBA 2FZKB 1BLUA 4NLRA 3VEXA 2O4IA 3FBFA 3WQPA 3AOAA 1TL3B 1GLEG 1U04A 4M5MA 5JVHQ 4JYAF 4DEZA 3VAKA 1VR6A 3DDKA 1GTHA 2ZJQL 4J9KA 5J2PB 2MJNA 3B82A 3KDOA 2R7RA 4FJ7A 3EGNA 5LSOA 4FJMA 1NJIO 4KH1B 1X1PA 4PZVA 5AQGA 2VL1A 1OH6A 4X66F 1RAAB 4ZVGA 3G82A 4O44B 1SXLA 2PIIA 3UKUB 3S3MA 3O4NA 4KHPK 4J9OA 5AXLA 3UD5A 2MZJA 3R5AA 5CABA 4B1ZA 3P5TL 1QQOA 4A8YA 4ECQA 4WK3A 2ZOGA 3OQ2A 4URGA 4KB1A 4LUBA 4B1VA 2O8CB 3E9LA 4EK2A 4CYUB 2XCAA 3GV8B 1VFJA 2VICA 2CJ9A 1UWAA 3TJAA 2ZH8A 2RIJA 2VFSA 1S6QB 5H9EK 2M9KA 2KT2A 4I67A 6FDRA 1BC6A 3P6YC 3Q8PB 2IA6A 2QTDA 2V4QA 5KFPA 4KFBA 3Q7CA 4Y3CA 5DQIA 1S6PB 1TKZB 2WTUA 1VBYA 1ZAWA 3HVAA 4LF9F 3OL8A 1QSSA 2VFRA 4CGDA 1QUPA 3I5CA 4O3OA 4A8XA 1KC8O 3VA3A 1KAXA 5C5JA 4O55A 2OSRA 1R0CB 2LEAA 3VF0B 3K57A 1VQ4N 3QT7A 2R4FA 2MB0B 1IR1A 1JLAA 1RAOA 1OJ4A 4KRWA 4ZPAA 3GSIA 2CNKB 1RACB 5AQOA 3HHDA 3FZBA 1NBWA 3G71S 1U7LA 3E01A 3B54A 2UXBK 4CD3A 4DTRA 3DGPB 3LZIA 3RBDA 3GSDA 2K1RB 2V68A 3IS9A 4A4JA 1RBSA 3AO2A 3NGKA 3P38A 4CZIA 3I6PA 3C15B 2CPEA 3LM2A 4DR7K 1BIUA 2X3DA 5GIPA 1ZBIA 2W6KA 4FYYB 3VGKA 2Z1IA 1KQKA 3TI0A 3MAHA 4IDHA 2AQ4A 3KK7A 3CO9A 1T05B 2UUAF 3D6HB 1T02A 2DK2A 5AE3A 3VAGA 4CCHA 3PO4A 2MSTA 2XQCA 3VQ4A 3PIOQ 3MAQA 1SKRA 1YJNN 1IBLF 3NAHA 1XNQK 3U1LA 3HD1A 1VOMA 1KXPA 3PRVA 1D1UA 3D7EO 2H54B 2G13A 3EMTA 4ZKAA 1M0SA 4MLHA 2E66A 4LT6A 3BZCA 3DOMA 3JTPA 3KFWX 2FVPA 4JKCA 4ECVA 3D6RA 4CEOA 1WWHA 3ZEUB 4CLUA 3LOUA 2UXCF 2C3YA 4A46A 1E4FT 5B0GA 1BWFO 3O1WA 4WE1A 5BYSA 2J0WA 1TP7A 1Y9OA 3M1VB 1O0PA 4AF1A 2NQPA 4KSEB 1QJHA 2YNIA 2LU2A 1GH8A 1JXEA 4M3YA 1URNA 1FVSA 2BOAA 1YJ7A 5ADXH 3W2WB 4BC4A 3WZ0A 2NRZA 2ZH6A 2QLWA 3ZZYA 4K7QA 4GO5X 4BC7A 1RQ0A 3ZX0A 2C22A 4RWXA 2P9IA 2IVPA 4LRCA 2HAFA 3MM9A 2QX0A 1HYSB 3QB0A 4DN0A 3NH1A 1BQNB 3PJWA 1T03B 3W3DA 1V4TA 5MLCV 1N5VA 2QA4S 4M3WA 2QG9B 3LW5C 4O44A 3CYMA 1U09A 2JLGA 5DDOC 1W2BR 1K47A 4ED5A 1RT3B 4DR5F 2C28A 2AGPA 4CK1A 4CIGA 4OO1J 2HK2A 3IBFB 3GONA 4CHQA 1V9OA 3W65A 4Y28C 3VEYA 3PIPL 3CCVS 1MMNA 3B6BA 1RWWB 2HHWA 2XEXA 3SUPA 5AFUA 3HL8A 2VBZA 1TUGB 4M8LA 4LF7F 1EETB 2PSZA 4NEZA 4ZJQA 3KLIB 3R5DA 1U25A 3KHGA 3QLHB 4CEQA 2O8EA 1YJRA 3QBCA 3BN4A 2OPRB 5J2QB 1SH3A 2QRRA 3EE9A 1CS4B 5KQDA 2QWNA 2ROEA 4DV6F 3PJ9A 1F0XA 4X2BA 2KT3A 3B6OA 2E1ZA 4ZCLA 2YKNA 4W5TA 4BC9A 3V5RA 4MO5A 2RRAA 2ZDOA 4FWKA 1QVFR 1X5PA 3HVTA 4NLBA 2D0CA 3K0JA 4DU1A 3LP1B 1NK0A 1VYAA 1WTBA 4B9VA 5AZJB 4KHYA 3EPGA 1OIAA 1V3ZA 1WORA 5JLHA 2ZVIA 4PQAA 1IQTA 4NXNF 1KDNA 2HPUA 2QLXA 3OV7A 4FSVA 4URSA 2F8HA 4DPXA 2D5RA 4PXBA 3HD2A 4LF6F 2NRTA 3T1YF 5L9NA 1WEZA 4DR2F 4ZCKA 1HBNB 3M1FA 3CCMN 2O5DA 5AQZA 2X78A 4Y2AA 1YF5L 1WUAA 2HFSA 4RKUC 1MA9B 1GLJO 3NEKA 2EHGA 4XPCA 1IG8A 2IAJB 4IOCQ 1YITN 2D0OA 2HHQA 2BQUA 2QA1A 2ATQA 1TV6A 3HPHA 3ITHB 2KH9A 1LXNA 5C0YA 4Y2MA 3BF4A 2W9CB 4IBNA 2GV9A 2HKEA 3KLHB 4CP5A 3UR3C 2OZMA 1DQ9A 2YHAA 3LAKA 2YPYA 3VMFB 3S9HA 2K3KA 2YCHA 4X64K 2F9DA 4IOAQ 3AB4B 3MR6A 4BR7A 4R25A 5EWGA 5T7BA 4K2JA 4B3RF 2YI1A 3VAHA 2AX1A 4U6PA 2EWSA 4UOFA 1O51A 2Z57B 1S7HA 2OTLS 3MXJA 1RWMB 2PZSA 2ITGA 3QIPA 3THYB 3ICLA 2DH7A 3A8JA 1VK0A 3BBCA 3PO5A 2H51B 1TZ0A 1MLAA 5B09A 2O8DA 2QMWA 1T94A 1A6LA 3DDIA 1LEOA 4TLRA 4A48A 1N0VC 5CYMA 3CG7A 2XSFA 3DRSA 5EU7A 4B8CA 4TYAA 3SQGB 3P45B 1S12A 4PABA 3GV7B 3AVJA 2EFVA 3OTDA 2J8SA 2V6AA 3OSNA 1ZM2A 4MDBA 4GNIA 4XEIA 3CF5Q 3O5BA 3I55N 4IJNA 2XY5A 4KB7A 3QFHA 1VSDA 1VQPN 2QYGA 1OH5A 1NK9A 2IYIA 2D3O1 3VF6A 1WKJA 1A9NB 1C1BB 1R3NA 4FWQA 4ZJLA 2OEKA 2UVVA 1M1GA 2BE7D 4QW8A 2RQMA 1TVRA 4CDIA 4BE2A 2NXUA 3CCTA 2BGGA 4DTMA 1RDRA 1FJGK 1JNRB 1WHVA 3X1LB 1EKRA 4G65A 1JLCA 2WB1D 3PRBA 3DI6A 1S1UA 3OS1A 1R89A 5HL7Q 4NYFA 1O5JA 4NOHA 4B3SJ 4ZVPB 3A5NC 1D09B 2LKZA 4DX5A 5GIOA 5H9FJ 1XBWA 3O4WA 3HCXA 5C10A 4WFYA 1U49A 1PYTA 1SI9A 1U2FA 3DRRA 3MN5A 3PUFA 2XLJA 3NXZA 4L3NA 3K2PA 1RCXB 4QWBA 2OPPB 4W5RA 2LEPA 5IV3A 2VG6B 1RGVA 4ETZA 3KKSA 3QWPA 1YKWA 3MMCB 2Q6CA 4R5PB 1LCUA 2AJ0A 1FE0A 3QYYA 1GT8A 1S9EB 2HGLA 5MLCQ 4JV5K 1C0UA 2CWKA 4FWRA 1EHWA 2G1DA 4DV3K 1WJ9A 4CF1A 1KQSM 4IO1A 3NVKA 4CHOA 4DR2J 2HK3A 3FRZA 2FSNA 4NLUA 4M3TA 4PKDB 3HFVA 4X84A 4JHDB 4TNOA 1GEHA 1VSEA 5L1IA 1IBLK 3SQ1A 4AHSA 3VN5A 4JK7A 4LSLA 1A5VA 3M7VA 3D1QA 3M6GA 1F5BA 2XGQA 2A2DA 5KRSA 2X6SA 3ENWA 5AQMA 4M5HA 4CK2A 2ILYA 3EZOA 1F6TA 3W0LA 2HS3A 4TQRA 3DLKB 5ETQA 1MWMA 2LLZA 4J9MA 4GVBB 2UUCK 1DFDA 3KG4A 2UXDJ 1TL4A 1BE4A 1RT2B 4PPZA 3ZTRA 2LCWA 1KVBA 1FESA 3CQXA 3C7NB 4DUZJ 3BGRA 4PKIA 3H5YA 4DTUA 3KJQB 3JQKA 2J0XA 3BR9A 3K8VA 3ULEA 3ETMA 3WT0A 2YWKA 4Y0FA 4CJKA 4DUTA 1BA0A 2A3ZA 1YI2S 3WIUA 4DX8H 2DGVA 3CDUA 3M8YA 3VA0A 3CFPA 5M2PA 3OTEA 3AVCA 1GLAG 4OMFG 2MGZB 5A6PA 5FPMA 4DZDA 3SCKE 2LP4A 2QKKA 2GJIA 2KRBA 1RLDA 2DNPA 5HK4A 4A2BA 5J2NA 4IH7A 4JI0F 4GKJJ 4KHQA 2O67A 4BRMA 3BBFA 3CJQA 3RAQA 4BRIA 3P1GA 3BSAA 4FNHA 3KIOA 2HNYB 5HRRA 2O8BA 5DZ7A 4CLKA 2DO4A 2OEJA 3CJ1A 2P8IA 2KXHA 3TRGA 4FK0A 1EKEA 2ATCB 4F4KA 1LNQA 2ZQBA 1SZ2A 4WIQA 3C46A 4JV0A 3U6FA 1HW9A 2CQGA 2FVCA 4GKJK 2MQ8A 2UUTA 4EEYA 5E3QA 4CEZA 1UAXA 1QZ6A 4XK8C 5GAGU 3VVTA 1HNXK 2E5LF 3IN5A 5ETSA 4MJKA 3ZTSA 1YZ7A 3PRDA 4Z0UA 2H3GX 1BA1A 3AJDA 2AKWB 4UTGA 1N54B 1EO1A 5AJ3J 3MMJA 3LL3A 4E19A 1WG4A 1S0NA 2O1PA 3BGLA 4FO0A 1B0PA 1BI4A 2KJVA 5LMNJ 1N56A 1DQ8A 2GGPB 2ASPA 5KGWA 1CSJA 4BDYA 4DV2J 5LJ3Y 2CQIA 1OO0B 1A0OB 3PX4A 3I0SA 1VBKA 5CYQA 3UW1A 1I94J 5LJWA 1T9TA 4Y65A 3W62A 1S5ZA 2BJ3A 2C2ZB 2AMCB 3BZKA 4IDKB 4CEEA 2JL9A 3TPQA 2AWZA 2OFHX 3VAIA 1FJ7A 5KG2A 1N48A 1XUPO 1C1CA 1MMDA 2AYGA 1KOOA 2E4LA 3M05A 1QZ5A 4PUOA 2ZBCA 4QWCA 3OYBA 3TX8A 1JLQA 1KEKA 1G1XA 5KFNA 1T3VA 1TUYA 2CJBA 4N77A 4UOGA 2NSBA 2JFDA 2V0NA 2V5HG 4H4OB 4O8UA 3UCZP 1GXTA 9RUBA 3D67A 4LF9J 3H90A 1LWFB 2ZNYA 2J6TA 5BPLA 1EQ0A 4DU8A 3CMES 2CKWA 2PMZD 1ESVA 2E6MA 1KBRA 2E20A 1T7PA 4OZLA 2HBYB 3MMAB 4ZOSA 3LPYA 5JICA 4FPRA 4CEAA 3EXYA 1ZTTA 4Z2XA 4F2SA 5HL7L 4X4TA 2HZCA 3FC9A 2MGZA 2X7IA 3R6MA 4RUBA 1R0AA 4ZMMA 1K8KA 5BYRA 2VASA 3H4BA 2YNFB 2ADBA 4X4NA 3I96A 5LXYA 1V5VA 1OVQA 1XHZA 2HRTA 3KHHA 3OVAA 1HIYA 3DXSX 4E1MA 1IWAA 5GAEP 3IM9A 3UD4P 4FKXA 4JV5F 1EXQA 4IFVB 3U3GA 2DO0A 4A2AA 1FEEA 5CHCB 2UXCJ 1VSFA 1Q9YA 2SXLA 4J91A 1GMWA 1S0VA 2VHGA 4OI4A 4KHUA 1SB6A 3DRPB 1T9WA 5FRNA 1Z05A 4WIIA 4RO0A 1WACA 1S57A 2CGJA 2CQ1A 1VISA 1LW0A 3QSYB 4X4SA 3CCEN 3WHIA 5DGAA 4DTNA 3C6TA 4PG6A 4DV5J 5T7LB 1U8WA 3HP9A 2ZHOA 1JX4A 3QEPA 1MWQA 1WELA 5DM7Q 1SC3B 5M1OA 3R6LB 4JHDA 1CPZA 3SBGA 1Y7PA 5DLFA 3VF2A 2HSEB 4TY9A 4OI1A 2HLUA 3OYKA 4H5VA 1KWMA 1Z26A 3L3UA 2BDPA 4QYRA 2E2OA 1N33K 1RI7A 3L2VA 2VZ9A 2BX6A 2HIYA 4FJIA 1TMJA 3GG0A 1HQEB 2IRUA 3UE5A 1FERA 4K43A 2RQKA 2G8FA 2LQ5A 2A3JA 3CCJS 3CJ4A 1BCOA 1NZAA 4PCQA 3F56A 4B9QA 1N32K 4N7TA 5C42A 1JXVA 3SDEA 4ZPTR 2NS1B 2DGTA 2UVUA 1N5YA 3R3TA 3NH0A 3BO3A 1GLBG 4M63C 2FHKA 4K4XA 1R0BG 2L08A 3QIPB 2PGCA 3THYA 2R7SA 2C2RA 4OX7A 3PDNA 1U1QA 4U7UD 1R8HA 4QCLA 3FZLA 3V1RA 4KAZA 4LFAF 4B1YB 1H2VZ 2Q43A 3WDOA 2DNMA 3SBMA 3TR5A 3ID8A 1OMSA 3PLAA 1UKUA 2RNEA 1NH8A 3PG9A 2CDRB 4ZLNA 1FKPB 1EB0A 3SI8A 1VQOS 4E1NA 4CFBA 4C8LA 1T8EA 1X4BA 4KR0B 1FWLA 1HYVA 3R1LA 3M2VB 1YVNA 2OPQB 1TUWA 3ETOA 2FBVA 2NXCA 3GU0A 5HROA 2W9CA 3QRRA 4LF6J 4LSLB 4X4RA 4DPTA 2NYHA 3J81j 4ANEA 4ED0A 3OLAA 1DY3A 5C25B 4LFAK 2ATLA 1WNSA 3TTFA 2Q36A 5KG0A 2CJKA 2B8QA 1L3UA 3SZ2A 2P5GA 2HF4A 4EFHA 5JXSA 4B1WB 4I2PB 3AOBA 3DRSB 5AQLA 1NXIA 2EBEA 3ILJA 3D7SB 3MUVP 3ZZOA 2ZITA 5F8IA 2K7KA 2BM1A 2RU3A 3RW6A 3T6BA 2I8EA 3A5MC 2Y1RI 4Q44A 1WOQA 4I6WA 1M1HA 1FJGJ 2IJNA 2NZ4A 4L72B 4UOHA 1IJJA 2WBRA 3NRBA 1RJJA 2MY8A 4IG3A 1ZTWA 5C2GA 3SI6A 1KLNA 2KN4A 3NS5A 4F0HA 4N8OA 2HWIA 1RSCA 2I5JA 3M8PA 4FJKA 4HTIA 5D4PA 1TTHB 3LP2A 1EP4B 2DNNA 1HNZF 1RWUA 4YOXA 4DR5J 4H4MB 2C42A 3BF3A 1M5VC 4JV5J 3JB9k 5KRTA 3ZSOA 1RBRA 1OH8A 4HTJA 1K9MO 1RABB 1XEZA 2UVRA 5D0GA 4DV0K 1RU2A 2AZ3A 3ENHA 4PQUB 3ITHA 3BQ2A 2K7JA 4J5OA 1XMBA 2VUGA 1Z6RA 2CA9A 3NKYA 3CD5A 1T3OA 2R9LA 2YNHB 4ECXA 2H5IB 4PHTX 1FRLA 2PFUA 5E84A 1VK8A 3H42A 3MFIA 1BUXA 2LDIA 5HRPA 3FFIB 3OL7A 4NXNJ 2DHHA 2HBLA 1S6UA 2M8HA 1QSYA 2KYXA 5A76A 1VQLS 1NGHA 5CZ2A 1HRHA 5J2MB 2JVOA 3PW7A 3FMBA 3QEIA 3SSRA 4ZCIA 5KFXA 4EZ9A 1VLYA 5LM7E 4QBUA 2VC1A 1D8ZA 3EJMA 1FX4A 3L8BA 4O8KA 3Q8YA 1VQPS 4BR0A 4EP4A 3BDPA 4CH1A 1D9AA 1BD6A 4H4OA 2W8KA 3POTA 2VQFJ 1UW4A 3TUPA 3L4BC 3ILOA 2B9XA 3B78A 3KD5E 3GDQA 1HWLA 2Z2YB 1GLLO 1IH7A 3BN7A 1JLQB 3UFCX 1BIZA 4UUXA 1JXLA 5AJ3F 2CZVC 5CCLA 3PKMA 4P2XA 3KNGA 2OTJS 2O8EB 5KTQA 4TU9A 2IFXA 3LDPA 5FJ4A 4YORA 3J7YU 1S9GA 4NRTA 3UE2A 2RN2A 3VENA 5A6WA 4CIOA 2BZ2A 5E0OA 4M5DB 1Q53A 3BR8A 2UP1A 1YAGA 1REVA 5BPNA 1YXQA 5IFMA 4HUFA 4Z94A 4ES3A 5KI6A 2P9EA 1IKYB 4BRPA 4FS2A 3DM2B 2ZJPQ 3KLEB 3KMQA 3JAMO 4Z4IA 3RRGA 2GA7A 1UWBA 1GXUA 1Y5LB 4CGGA 3ZSYA 2MKHA 2VG5A 4M94A 3MCOA 4I7FB 1HR0F 3MWBA 3WEEB 2V94A 1XQSC 1FNXH 4PKHA 3CCMS 2FZCB 2AW0A 4EYHB 2B51A 2QFJA 3IR7B 1HBNA 2JX2A 3CIZA 4KC5A 3TJ8A 2XS5A 3CJ7A 2YKQA 1WB9A 1HQUA 4LF9K 1HYSA 1QE1B 2G0CA 3R9LA 3UDEA 2B8PA 1NJIT 3ZSXA 4D3GA 3A1YG 1HBUA 3ZO7A 3E01B 5RUBA 2NRHA 4USWA 2XO6A 3OFHA 4ZPDA 1N36J 4WP9A 2V50A 2DH9A 1YBUA 3RMBA 4CGFA 2IMOA 2QEXS 1CQMA 4USTA 2IOCA 3DLLL 2FLOA 3M1VA 2C2KB 4JD2A 2G0JA 4MKAA 1TK5A 1JLBB 3BV8A 1U2CA 4C2MA 3RU0A 4IO9Q 2QSFA 1C0TB 1S6PA 1TKZA 1KONA 3OHBA 4JI5F 1TL5A 1U0HB 1SJQA 3P5BP 3IKMA 4CGHA 1WC1A 2DD8S 2DHGA 4F7VA 3KLIA 2PI4A 1V4SA 4K4TA 1DEJA 1QAXA 2DVIA 2YQ0A 4OZ5A 4UZCA 3FZHA 4PA1A 1PKUA 1NK8A 2Y3YA 2UXCK 3KLGB 4J2BA 1SJ4P 4LF4K 3IS9B 2ZHAA 4DFPA 4F3QA 3DGPA 5KFKA 1R8PA 3CFRA 3IM8A 3D68A 3B8HA 3P83D 4TU7A 4OHYA 4GRSA 4NZ0A 3EVOA 3CJRA 4CERA 3TWZA 1VS3A 2P9CA 4CFCA 3NF9A 1T95A 3TO8A 3D0PA 1HPZB 5I3PA 3UKRA 4RW8B 3CCES 3HI9A 3DXBA 3IGVA 4FVUA 1AYEA 3O8MA 1NK5A 3CDAA 4HT7A 4PXEA 3F2KA 1FK9A 1NK4A 4YMEA 4FXDA 1RT1B 1S48A 3CCRS 1JMTA 1PBAA 2F8EX 1XK8A 4LBPA 4OJ1A 3R8YA 2DT9A 4G3IA 1HARA 3WX4A 3Q8SB 4OYPA 1F5CA 2XMTA 4CNYA 2AD9A 4F8RA 2RB7A 4M5NA 4RW7A 1KQGB 2E5LK 4LSNA 1RWVB 1L3TA 3WNGA 4TXSA 3U1MA 3QIOA 3HPGA 1CJVB 4Q7AA 4C11B 1CBKA 4L75A 2EFGA 2ZNZA 3TA1A 5BREA 1RDAA 3AVIA 1LXJA 2DPJA 4K8XA 2LDYA 1NHUA 3OYFA 1R6VA 5FD1A 3W63A 2RS8A 2OPPA 4YR2A 3CJBA 4FWNA 1T3NA 3AQOA 4G1IA 2ZDPA 4CGIA 2MMYA 4I64A 1J6ZA 1B0TA 4JV2A 3VV2B 3W2VA 3O80A 3IRXA 3ATVA 1DAXA 3C19A 1ZBUA 4C23A 2G1HA 3R7SB 5A0YB 1QD1A 5K9FA 1KD1T 2DIVA 2BJDA 3U8XA 1KFDA 2VWKA 2HRYA 3I5BA 2A5XA 3DU6A 2H4YB 1HFEL 4DB3A 2P5VA 4EUVA 1UVKA 8ATCB 4F3OA 1S1UB 2O66A 2O4GA 3PKYA 3T5LA 1UVIA 4K42A 3CJ8A 2FBTA 3L6QA 2W01A 3R5JB 3TSQA 1HX1A 3D9BA 1VQLN 5LY3A 4WU2A 1IKVB 1WEXA 3DXMA 3NMRA 3AGRA 4DI6A 3Q22A 2CIMA 1AW0A 1JLBA 3VETA 5DDRC 5E3RA 5DK5A 1TKXB 2XMUA 3G96A 2GCFA 4DL2A 3G0ZA 2CADA 1VQ8N 3NLCA 2RUSA 3IC1A 4DR4K 4C9DA 3CCSN 4TKTA 5GAGP 3M8QA 4GO7X 2A41A 3AAQA 4H0OA 4LF8K 5E26A 2GMJA 4CJ7A 3LTOA 1EARA 1VHXA 4DR6K 3UVJB 2XHWA 5L1LA 1S6QA 3ULDA 2E1RA 3HHEA 3H0PA 5DG7A 4OIXA 3ELHA 1VC5A 4Z4HA 3H25A 2FGCA 1NNEA 3AARA 4HUEA 1RDDA 3KK1B 3VQ9A 3OT9A 4JRPA 3BYRA 2FJXA 3A3PB 2W2MP 3TTCA 3VQEA 1Q81T 2QWOA 2DIUA 2V9WA 1QAJA 2IDLA 3D2EA 4ZVSB 3VVUA 3TAGA 5IM0A 5AQJA 4ALZA 4I7FA 2V69A 2AJ1A 5M2UA 3NHGA 1D3WA 2GVZB 1J5OA 1DRZA 3F73A 1X8DA 2ZH3A 3GR0A 4QIEA 3GPAA 4NMXA 2QA2A 4BREA 5L1JA 2GUPA 3F0NA 4RW4A 3PFOA 1GOAA 2CQ4A 2CRLA 3VQTA 1K8AO 1IBMK 1V6HA 1HBMA 4JI6F 5F9LA 3KTQA 1R8BA 2WBNA 3EE8A 2MJUA 4OYXA 4O3SA 2LSNA 4F3TA 4DHVA 3KHLA 1NK6A 3VQ5A 4GVEA 1IKWA 3BPDA 3EVMA 3KUHA 2KU7A 2BA9A 3JQJA 3KNAA 2KXFA 5LL6d 1S5JA 4OPJA 2OTLN 1I3OB 2VGMA 1RCOB 2EKYA 2JEJA 2H9ZA 4AM7A 1U6FA 5HN0A 5IM0B 4ZP6A 1RTJB 4DV6J 2WUSA 4J9VA 3AJ2A 3A8IA 2YBVA 4DQPA 5LMNF 2P9GA 4OI6A 1F3FA 4DQIA 4LF5F 3RMDA 2RRBA 4A8QA 4OI0A 3JQMA 4FWPA 1Y3JA 1FA0A 1RHRB 4KGKA 5A8KA 4DPYA 3PX6A 4YY3K 2VPXB 5KT2A 1RA7A 5I3UB 2DHXA 3K59A 3AODA 1XNRK 2JEFA 2V2VA 1PAEX 5AZJA 4CFAA 2D3ZA 1U2RA 2AJFE 3FFIA 4WFNL 4OX9K 3BO2A 2J6SA 2V7YA 6AT1B 2E1AA 2PN6A 2FSJA 3O6WA 2HQCA 5J1NA 5DETA 4DSKA 3MPWA 1NSQA 3UNYA 1VRQC 2I7NA 2XLKA 2ZZNA 4HL9A 3OTBA 3MECB 2DEIA 2DGQA 2FLPA 3GE9A 5KT4A 3T9ZA 2VG7A 2F8SA 3TEHB 3RG6A 1KOHA 3L09A 3VQCA 2FHMA 2XBPA 1N33J 3M6XA 3OXLA 3SK3A 3DLHA 3TARA 3J81U 1EP4A 4WFAL 3AXMA 3NNHA 1N5TA 1SUQB 3UDCA 3W64A 5IWAK 1HYZA 2ZOMA 3NGUA 2UUWA 1OY8A 4YNQA 2G8HA 1B9FA 3EO3A 3MK6A 1NDLA 4XAKA 1N88A 3P5JA 2V8HA 2ZZMA 2BUNA 3GTYX 2YX4A 1KVIA 2Y8WA 2VDIA 5HANA 3MM9B 4C11A 3HKZD 4WFBL 1QAIA 4KH6A 3NWGA 4LH4A 5F1XA 4DQSA 4KHWA 3G4SN 1S10A 2UUAK 1XHXA 5BXIA 2BW7A 1CJTB 5F0UA 1VJQA 4UF4A 4OI2A 1VSJA 3M8QB 4LVOP 1Q8BA 1S1TA 4QR0A 5J1PA 3K89A 2XLIA 3CXCR 1X0FA 2MZRA 3D5MA 3LDSA 2MKCA 3TAMB 2ZJPL 3WXLA 3LF0A 4CJLA 3JTNA 4KBIA 3GFYA 2GHVC 3W7BA 2KM8C 3CO0P 5EN1A 1QTMA 1FKOB 4M7YA 3OFEA 5KFMA 4C0BA 3CJ0A 3NOCA 5HRNA 2F40A 1H2TZ 2U1AA 4MH8A 4Q45A 1Y64A 2JC0A 4JI7J 2OMOA 4WF9L 3K5PA 2IVMA 2B4OA 2V7ZA 2HZVA 3MM5B 4CHZA 2RHKA 3ENVA 4LFBJ 4B3TK 3O44A 3IDHA 1HNIA 4J9RA 3TU5A 3BKUA 3TR8A 3OUYA 2W42A 2PEBA 2VPZB 1MMLA 1SJ1A 4EHUA 4H0TB 5FPDA 2A10A 2DR6A 4JKHA 2HQIA 3KUEA 4QS9A 2BACA 3BDEA 3LWLA 1LWCA 1WG5A 1Q86T 2HVEA 3UWTA 3SMPA 4LF1A 1VSLA 4CH7A 4FZYA 2E2NA 5F8MA 3GE1A 4DV7K 4BDZA 2IS3A 4C0HA 2D0PA 1HQEA 4IOCL 4N5SA 4ZTJA 4L73A 3O08A 5A8WB 4CM2A 4X4OA 3A12A 2FDNA 1H2UX 4ZVQB 2MQOA 2DRDA 4JLHA 1Q0NA 3EZ5A 2XMAA 4Y00A 1MU2B 1Y5NB 4YHHK 1RDWX 4YUDA 4LFBF 2P9LA 3F5TA 2KFNA 4X4VA 3T1YK 4ILLA 1CJUA 4LFAJ 2RJZA 2GIFA 5TKYA 2ZGZA 1RYSA 4X65J 3E8OA 4RCHA 4BCAA 3F41A 2DCUB 2CPHA 1JKHB 4NLSA 1N52B 3T5HA 3SPZA 4YY3F 3ZNUA 3AAPA 3GBTA 3LDQA 2R7OA 4TY8A 4DR4F 2NLXA 4KV8B 4A8OA 3MURP 4JI2J 1LK5A 2HGNA 1DLOB 2ZWPA 5CD4H 4LF2A 3NMUA 1VQSA 4YQWA 1TKDA 3TQ1A 2VQEK 3T3FA 1VQ6S 3TP2A 4LF8J 1FCAA 2GQCA 4RL1A 3H08A 5M1NA 4QR2A 3W2VB 3SFGA 4KH5A 2ZH2A 1F60B 2EG1A 4NLCA 1IV0A 3CUNA 5AQFA 4DFJA 1QQCA 4DL6A 4ISGA 1GMWD 4ZPCA 3VPZA 1REGX 2JFKA 4DX7A 3TUZC 5IQQA 3CB4A 2XMWA 5KFGA 3W8GA 5ITHA 4JYAJ 4ZN3A 3ZFVA 1R0AB 4FS1A 3J7ZO 1RAFB 4TYBA 5F41A 4OPKA 1B3TA 5C15A 3FBCA 3V1QA 4ES1A 1DURA 4C98A 1TL7A 2RMLA 5HBMA 5GAEI 3CCLS 3DXKA 4MKVA 3Q83A 4DOZA 1FRIA 3IO1A 1WNEA 5K20B 1KR4A 3UDVA 4P52A 2CGLA 1NHKL 4OLBA 4V19X 2NXEA 3OFGA 3HM8A 4DV0J 4IG0A 3M32B 1WHYA 1RAIB 4Q2MA 1LW2B 4QW9A 5CXTA 1CQNA 3SFUA 2D1KA 4BE1A 5DO2A 1Q8KA 4C97A 3MM7B 3P4UB 1DJ0A 1DARA 2QWQA 3ULHA 3K5NA 2KYZA 1FX2A 2K2PA 4KGZB 4FYXB 3W61A 4DQRA 3C16B 3LPEA 1AZSB 4H0YB 2R7UA 2HFUA 1UTAA 5FLXO 2OYQA 1SQGA 3FJ2A 3VQDA 1S1XB 5CR4A 3N5FA 2GFFA 1A5XA 2RHQB 2B4VA 2CQCA 3JXUA 1ITGA 3NAIA 3PR5B 2BOPA 1HMVB 4OPHA 1H73A 1IJFB 1KVCA 2IDEA 3ZZRA 2ZBIA 1VGYA 4J7CA 2OCEA 3I0RB 3AT1B 3J81Y 4KHNA 2NZTA 2H1YA 5HAOA 4JI7F 2ZC4A 2B9EA 2VG5B 4CJPA 4FL9A 4P9SA 3OVSA 2FC9A 3KLEA 3HSTB 4ANCA 1WSRA 2BQRA 2KI2A 3CCRN 1W2IA 3NGIA 3KD1E 4IRCA 3EY1A 4B3TF 4M41A 9ATCB 4CZKA 1GX6A 5KG7A 1APSA 1TKTB 2RE2A 5DG8A 2CZ4A 3IAS9 5SUHA 3N01A 4N8NA 3MWTA 4ANDA 2N3LA 5D4NA 1NCLA 8AT1B 1D5AA 2OI2A 2M0GB 4K59A 3GZ7A 5KFIA 1IR2A 1UPPA 4PRFA 1KAZA 4NXMJ 4JI5J 4GC6A 3WBZA 5AQRA 1RHMB 4J37A 5IC6B 3N79A 4FJ9A 2JRSA 1KLMA 4K4WA 1H7XA 3T7ZA 3RZAA 1TAUA 1K0VA 2DFFA 3FBEA 3V4IA 1QE1A 2FF3B 1F5AA 4CF0A 1SV5A 1RAEB 2C2DA 2GEMA 3D1HA 4LFBK 3MPVA 3GB0A 3IWLA 2FD2A 5M1PA 3T69A 2WK4A 4DV3F 1NJWA 1NLKL 2EPIA 5BPMA 3GG1A 1M1KT 4GY2B 2HRUA 3ZZTA 2IBKA 3OYGA 3ULEB 4DSIA 4DV1K 2GW8A 2DGXA 1Q18A 3L4IA 2B43A 3AHPA 4J9SA 2FBYA 3I56N 1LFWA 3BSNA 1EWQA 3C7NA 1RTZA 4M5LA 4FYDA 5F0XA 1JJHA 4CO2A 4F50A 4I0WA 3QETA 3QPIA 1S9GB 4DUZF 3MEDA 4ZN1A 4OYMA 1QHTA 3AA3A 1XIQA 4LRBA 2RH3A 3VEZA 2DNRA 5LOQA 3LM9A 2FXUA 2UYTA 1TYQB 5A8RA 3TAPA 3A13A 2HQDA 4CH0S 3BQ0A 3FZMA 2H5JB 2ASJA 3PSFA 3SXLA 1BO5O 3M8RA 2WC9A 1YTAA 4CJ4A 5JVHL 1X7VA 5HQLA 3K0SA 4BE0A 4FJNA 3CPWR 1HBOA 2QXFA 4O4GB 1RBUA 1WSEA 2ZE2A 1N6QB 3PIPQ 3P49B 4BY9C 1MROB 4QOTA 4RU2A 4AL7A 4BLGA 2CPZA 3KG1A 2GNKA 4J9LA 3A5OC 3NCIA 1RT6A 2FZGB 1C0MA 1IBLJ 2XWXA 3UIQA 3UPFA 4R5PA 4RBUA 2XULA 2CGKA 4K4SA 4L8RB 2J8AA 3O4QA 4O0IA 2C2MB 3QGPA 3VEVA 2JLEA 4DCJB 1D0EA 3MTJA 2XB2D 3WXJA 3UN5A 1ASUA 3OYHA 2YNHA 1O6XA 5IC4B 3DCAA 4BRHA 1HBOB 2BKPA 1N5QA 4CLZA 4F2RA 2RQ4A 1F21A 4P72A 3C6TB 1N32J 3VQ8A 4WJBA 2HF3A 3VGUA 1HWIA 3MEKA 2NSCA 5HROB 2YWWA 3EPIA 2E5GA 4W5QA 3I82A 3V6JA 3V9UA 1S3XA 2ILZA 1JCEA 4K50A 2DGOA 3VZIA 2W2QP 2CQDA 4KPYA 1IWGA 4ICLA 1TL1A 3QO9B 5D6GA 4B3SF 2ZHBA 4DSFA 1P8ZA 4OX9F 3C6UA 4EIAA 3KWIA 1OPZA 1WDTA 2DR7A 4DX6A 4QOZB 4CJSA 4FLXA 4IRDA 3GFXA 3ZNJ1 3RR7A 4CEFA 3U9ZA 2A6OA 5L1KA 4DV0F 4B9UA 2CPFA 1FNMA 1Y4ZB 3GR1A 3NWRA 1NH7A 2JEGA 1F9HA 1Y0HA 5JVGQ 2GC8A 2QC3A 3VGLA 5B0EA 2HBJA 2C3UA 3PEHA 4RW9B 1GLCG 2BEFA 3SDEB 4HVJA 2BRKA 2ASMA 2YWFA 3O6QA 3MMAA 3GIKA 4RW9A 1MROA 1YJUA 1FJGF 2JGUA 5HSPA 3RB6A 1IBKK 4WK1A 5FDLA 4YOEA 3OY9A 3MM6A 4CTAB 1KLMB 1VQ4S 3BKFA 2ZM6F 3D54A 3CC2N 3BBBA 4RX6A 3M8SA 3OA9A 4OHVA 3G87A 2LVWA 3HTVA 8RUCA 3OR1B 2OPQA 4AILC 2A18A 2PEHA 3NP5A 3WC2A 5K8MA 2AX0A 2DGSA 1KVAA 5AQUA 4PR6A 1RU1A 1YVFA 5D8HB 3C6UB 4P7TA 4PUOB 3IBCB 3BB5A 4LFCK 1NSAA 2ZH5A 4BWJA 5FPNA 2NXNA 4ICLB 4M45A 1WKKA 2JWLA 2CQBA 5DJBA 3WXMB 3HXMA 2CQPA 3DRPA 3J80O 1U6BA 2E2PA 3IR5B 2D41A 2C1EB 2HYIB 2GO8A 4E0DA 5IWAF 1RDBA 5D0HA 3C14B 4Q2LA 3CSKA 1HJOA 1TV6B 3O3LA 1CG2A 1WC3A 4P2FA 2PFFB 4BRQA 4ZPBA 3V6KA 2DY4A 1OQ6A 3SCIE 3E2EA 1ASVA 4FK2A 2GGPA 1X9JA 5CZXA 4NXNK 5ETKA 3CCLN 2ALZA 3CNQP 1R31A 4OLPA 1S49A 4B9MA 3AVAA 3CMEN 3AVGA 3HI0A 1N0UA 1RAGB 1HMVA 4BHQA 1T9UA 2OPSA 4Y2KA 2ZKUA 4FBTA 4XO0A 3G9CA 2LYVA 3KKFA 3EGZA 2KKZA 1VQYA 1BL3A 3BF1A 1J5EJ 3DHXA 4ZVOB 4O3RA 3RB3A 2LXUA 3AO1A 2ZOFA 5EX5A 2UZAA 3MXHP 2XY8A 4CBWA 2WVBA 4O4GA 2V8DA 2L3MA 3AB2B 2IHR1 4A8FA 3G10A 4K25A 2KT5A 1RUSA 2BJ7A 4P10A 1J54A 4M7XA 3CC4S 5GAHU 3TZYA 3GYXB 3U1NA 2A1SA 1MN9A 1FTRA 5HQMA 3M4XA 1VQ9S 1BGXT 2GBZA 2PE8A 5ADXA 1NPKA 4K0KF 2OPRA 5J2QA 3AJ1A 2ZM6J 4BC2A 4B02A 3N4WA 1XR6A 3R7NB 1X9MA 2DR9A 1XMOK 5L46A 3KK2A 3DXKB 4WFAQ 2XZDB 3FCHA 3PV8A 2BRLA 3FRYA 4Q0BA 2F4VK 4WZQA 1NOZA 3SLCA 4KE5A 5KAKA 4JI8F 1Q7YT 2BANB 3VAJA 1FT8A 1P1LA 1ZM3A 3CXCM 2KFZA 1X3NA 2X74A 1EX4A 1OSCA 3QSIA 1UOCA 2XNQA 1ZBTA 2ZC3A 2YNFA 4E7IA 1RBVA 3IWXA 5GAHI 2EK6A 1NJXA 2RDJA 1SC1B 2AU0A 2BANA 1YBAA 1SL0A 2CXEA 3BGRB 3FCVA 5G4DA 4PAAA 5BRFA 4OQJA 1BQNA 1BI4B 2P6SA 5EX0A 4ZIVA 4FXWA 4CI0B 4ID1A 2A0FB 3KK2B 3V4IB 4AL6A 2XMJA 3KVGA 3NH2A 2KLAA 4N76A 1DLOA 1TR0A 5CE3A 1P90A 1I6JA 3HT3A 4AM6A 1M5HA 3CJ5A 4DFKA 2VFTA 1TU0B 1UEVA 2NRXA 4Y1CA 3THXA 2QSWA 3KHRA 4DTXA 2GAHC 4IQMA 5ETMA 4ISEA 2ASYA 2VGNA 4JI5K 3MM8A 1VQMS 4BRCA 2OIHA 4OZ2A 4I2QB 1Q82O 2X1FA 1TKTA 1AUSL 3AVHA 1UJ6A 3D28A 3TA0A 2E2QA 4NA1A 1HR0K 1RWNB 4MFBB 1R43A 1RZMA 1QQNA 4QIVA 5BJRA 4RTFD 2FTRA 4ITSA 1U26A 4CO3A 3U7JA 4ZIWA 4JUZA 4HUGA 1BQMA 1H74A 1E6VA 5AJ3K 4YHHF 4JI0J 1RLCL 4U95A 3M2UA 3MI7X 3DMJB 5HMXA 2QT7A 1I94K 3J7AN 1VQ8S 1YHQS 2VOPA 2GELA 4GV3A 3BPSP 2HFVA 5E3AA 1MWKA 2ZH1A 5IXUA 2GX9A 5KFQA 2UUBK 1BDGA 3UD3P 3FZKA 2P9UA 3VGMA 3N4QA 1WKLA 4OLAA 4WP3A 4CZJA 1Y5IB 4RUCA 2WONA 1BMQB 3L2RA 5KFJA 1FRJA 1UZDA 1JLAB 2KL8A 2AGQA 4ZVHA 4B3TJ 2OFGX 1K44A 3G2XA 4G9ZA 4P2MA 3H2VE 3CETA 4H03B 1HI8A 2ADCA 4OJGA 2AIRB 3K2YA 2IMWP 4KAIA 5KG6A 2IA0A 1S59A 3A8KA 3OYMA 2O8FB 1JJ4A 2VB6A 2KVQE 4IG0B 2VU5A 3M32A 2XY6A 4CFDA 4FM1A 3AD8C 4WXWA 1AB8A 1XMOF 3KJVB 5KFWA 5JLFA 5FLXY 5IT4A 4CTAA 4DPOA 5FDLB 3LZJA 4R8UB 2CAJA 1X9WA 3MMBA 2PFDA 2DR8A 3MUMP 3QQCD 5MAOA 2V2ZA 1TFWA 5ETTA 2RUGA 3HP6A 4CYUA 1OYEA 5BR8J 2KTQA 2ASLA 3P31A 3H5UA 1J5EF 3QMLA 4F04B 2VG6A 3OS0A 1OWXA 2V8GA 4NI2B 1X5TA 3BSCA 4JKAA 3LWMA 3FR0A 2CZ9A 4CE9A 3BH6B 1CULA 4FOEA 2HAIA 3R6GB 2A1BA 1WG1A 4DLEA 4NLWA 1NMDA 5D0RA 3NMAA 2BE2A 2FJWA 5KT7A 2UXBJ 3LALA 1NSPA 3ZC4A 2KXNB 1IM4A 1LFPA 5B0FA 2G2OA 5J2PA 1LAVA 1ZAVA 1RT4B 4JOUA 2W9AA 2DPNA 2XY7A 2X6NA 3LDNA 4E7KA 4GMJB 4DR1F 1M5SA 3GJSB 1URRA 4AQYJ 1PC4A 2VG7B 3FCWA 3LH2S 4ATNA 1CVJA 3TAMA 1J53A 1RHJB 1WBDA 3U9DA 4LH5A 2QL5B 2UXDF 3MOZA 1I1GA 1MW7A 1YTYA 2OTJN 2P9LB 1CJTA 1N34J 1C1BA 3HVRA 1KD1O 2QN6B 2BTFA 1MWYA 1Q86O 4K0KK 3OL6A 4DSLA 1FO1A 4MK8A 3MCAB 1PCAA 4QZVB 4PL8A 5LL6Z 5I9EB 3RW7A 5IT9O 2VPWB 2F9TA 4Y2CA 3V6DB 2R7XA 4L6V3 2R2UA 2MQQA 3SCJE 2YH1A 3FFKB 2E6LA 1GLDG 2DGWA 1U8SA 3LDOA 1ZAXA 4RWWA 2EFQA 2PYLA 4JKDA 3K9JA 4DV5F 4KH0B 3FK4A 4EBCA 3QJJA 3Q0AA 2ZE2B 4O5FA 1LWCB 3ET6A 3BKTA 4WCEL 3VAFA 2F8MA 2H3EB 2I6WA 1WD6A 4JKFA 2V4RA 3ZT3A 4OYZA 3OW2M 3HSGA 3P3DA 2Q2RA 4RNHA 1NGFA 1TYQA 4KI4A 1NM2A 2ZFHA 4U7UK 3A3OB 5IQ6A 2Z56B 1SH0A 5T14A 1NGJA 3S8SA 4KREA 2AEJA 2WRMA 3GFZA 4OX6A 2W41A 3PSIA 1NUEA 5E3CA 3IRWP 4R0JA 5BN9A 4M1KA 1H7WA 4W4MA 3TW0A 1DQAA 3WNFA 3MECA 3W5XA 3A8EA 3DRXA 2GTDA 2BKNA 1WBBA 5C12A 4WQ5C 1OY9A 4LBIA 1QM9A 3DYAA 4A8SA 4QYZK 4LSZB 3A2FA 3J81O 4B3OB 2YWGA 2IY5B 4IH6A 4DHYA 2BH1A 3WUHA 1JIHA 1S1TB 4CZGA 1OQ3A 4LF5K 3D45A 4OZNA 4QPXA 3JSMA 2WCXA 2F4VJ 1N36F 1A7GE 2R7VA 2E1MC 2MQPA 1RT7A 1PBUA 2WSCC 3OTOK 2IC3B 5GAGI 2UXDK 2XHBA 5EUHA 2DRAA 2V8VA 3CEDA 1HHTP 2OKQA 3CC7N 2XI3A 4YP3A 3ZT1A 1Z1ZA 2P9IB 1Q78A 4H54A 1J2VA 4NB4A 4EMDA 2IVOA 4HYKA 1S9FA 4DMNA 4DV2F 2CQ3A 1P6TA 3G6VA 1WC5A 4LFCJ 3JSMB 1VAZA 1L3SA 3W2WA 4NCAA 4DR3F 5KPZA 1B0VA 1PC5A 2HS4A 4OKEA 5U47A 3M9OB 2JDJA 3GL1A 3QEWA 4RUAA 5CZ1A 3TYTA 1NDPA 2R8HA 2EK1A 1I39A 2E7WA 4RUHA 3D2WA 5AQIA 2VKRA 3C6HA 3FGUA 2XTJP 1G2EA 1FDAA 3THWA 4NWBA 1U02A 3G8TA 1WLJA 2AYMA 3PIOL 4CNZA 4HR2A 2PC6A 4GC7A 2HMPA 3K7RA 4RNOA 2JWNA 3C2PA 2W40A 3UI3A 1NZ8A 5AQYA 5F8HA 1PO6A 3FEXB 2QL7B 3NGYA 2LEBA 4CJ3A 2P9PB 3VCDA 2EX3A 3GJQB 4CJWA 5CZVA 1M5OC 5M1FA 1JQGA 3SAFA 3RRKA 1IBMF 1QHAA 1RTIB 2AJ4A 5H9FK 1F2GA 4A47A 4FP9A 2A6AA 4Z4FA 1KTVA 1T9XA 4CJFA 3V6HA 3HX9A 1TK8A 1YVUA 4Z7CA 4X64J 1S77D 1IM6A 2FLLA 2RSQA 1QQMA 2HGMA 3R7BB 3PFEA 3JYTB 3I56S 2HVIA 2CYYA 4QYZJ 3D1OA 5HVFA 3SMSA 4KTZA 2RRNA 5ETNA 2UVWA 1VJWA 3TWHA 3CIMA 3C8YA 2PBDA 3E1YA 1DGKN 3QICA 1N5SA 1S1VA 4OX8A 1FHTA 5D3GB 5EDWA 1YZ6A 3DU5A 3N6MA 4G1PA 1YRTA 4FJHA 3HKWA 1FKAF 3WNEA 4C8MA 1V3RA 4P74A 3VQAA 2KJWA 2I9SA 1QLNA 1I94F 1YSJA 4OFZA 4CJQA 1EETA 4FBUA 1CLFA 1RT4A 4RG8A 2W2NP 1RT1A 3RGIA 1GFWB 2IIHA 3VQSA 4F36A 1S4EA 4JAXA 1YRXA 2PAVA 4W90B 2R3VA 3ONQA 5AZIB 3KMSA 2VBWA 2O8CA 1RT3A 2CG8A 1RCHA 1ACMB 3EUNA 1CULB 4DQ8A 4WWSA 5F2RA 3D0GE 4CGJA 1FDDA 1U6ZA 5AQTA 5D15A 1CJKB 1WI6A 2AEFA 1RDCA 3V4MA 4A59A 2YX7A 4YOYA 3QINA 2BVZA 1SJ3P 1X60A 3GYGA 2B4UA 4B08A 3SQ4A 3LGMA 3VALA 2DKOB 4E3SA 3ZSWA 4BVOA 4JV1A 2N82B 2QWMA 2LQ8A 4KGXB 4CQ1A 1N4LA 3FGVA 3TSUA 5AT1B 2OEMA 4JI6J 2DBBA 3PW0A 3UVJA 2VIHA 3LO3A 3RUBL 3KUGA 7FD1A 3AGKA 1YI2N 1LOTB 3HZ6A 2XS2A 5SZTA 4I6MA 2B4JA 5JS2A 3CGIA 1OVYA 3OLBA 2BJ9A 1NPPA 2FVQA 4IWVA 1C0TA 1HNVA 4NLYA 4HKQA 3CE8A 1J5EK 3EDQB 3RAMA 1S76D 2H4WB 5GADP 1YIJN 4J9NA 4NXMF 3RAXA 5KQ8A 3QFUA 4YS2A 2HBQB 3MGJA 1IXKA 1H72C 3IGNA 3ASMA 2J9DE 3QZ7A 3CDWA 3OR2A 3H4DA 3KLFB 3R1XA 2XNRA 2F8TA 4ZVFA 4JBCA 1TUVA 4O23A 2JJ4D 5FIIA 4W98A 4WPAA 5A0YA 1EJ7L 1HLWA 1X9SA 1HKGA 1Q81O 2PY5A 2DFEA 2AJ2A 2G8VA 1GMVA 3TAFA 4B3MK 1SL2A 3I55S 1ASWA 3N6NA 2VCPA 2BM0A 5DDQC 2P9KA 2CJYB 1Y00A 1Q79A 2J5AA 4RZRA 1FXXA 5DDPC 2ALYB 2Y0BB 3F9KA 4XTTA 3ILLA 3SSQA 3ZXWA 1Q1KA 1REVB 1NGGA 1NDCA 5LJVA 1B7FA 1NGBA 3CPWM 2WOMA 2F4VF 2IIRA 3GIRA 2KO1A 2MKKA 4OGEA 2MQNA 1HNVB 2AP1A 1TMMA 3H3NO 4A57A 2GQ2A 1NOYA 1SS6A 3MM8B 4DR4J 2HVHA 2QK9A 4I6MB 1VDHA 1WDDA 1NU4A 2OA8A 2QXLA 4C0OC 1YQHA 1G15A 1EZZB 3NGRA 4HHHA 4FWMA 4E7JA 2R7TA 5FRMA 2OELA 1KSPA 1HBUB 3T9NA 2B7BB 2KB2A 3A5LC 2W24A 4JS5A 3BEGB 4X4QA 3GYNA 3AQPA 2QMUB 2RE1A 1VLOA 3MR3A 3IP0A 3OPKA 3R97A 1W97L 4WZMA 2IYGA 2P9NA 4QIWD 2A2CA 3SCLE 5KFTA 3E9PA 3RBXA 5EY4A 2EBGA 1T6CA 1RTHB 2KFYA 3Q8QB 1B99A 2VYPA 1E4GT 3GOIA 2V67A 2DITA 4IXCA 1NWKA 4GVMA 2OUGA 4ZP9A 3M30B 1SQEA 4JRQA 2UU9J 4ID5B 3FQKA 3CC4N 3G4SS 1JK9B 1WSIA 4CM0A 1A5WA 2LXIA 4J2DA 4CEBA 3MD3A 3ILIA 5IS2A 4CD1A 2W9BB 3FZ2A 4QIGA 5JS1A 1SKSA 2DR5A 2ZBQA 5D78A 3KYLA 2AT1B 3JSBA 1XC3A 2VA2A 2GX8A 4U7BA 3S7RA 1JCFA 5F8GA 2W7AA 1OYDA 4IG3B 3THVA 2J7WA 3MAAB 1P1TA 1NB7A 2N3OA 4LC9B 3MPYA 5ADZA 3EKUA 4FM0A 4E7HA 1SC4B 2IM2A 3M2RB 4F02A 3S41A 4ZHRB 7AT1B 4OLOA 3L7PA 4WBFA 4OJHA 3W66A 2OPSB 2F65A 2YNGA 4JEPA 3V81B 4CJUA 2FJEB 3QGHA 4XIUA 1XNRF 2WB4A 4HDHA 1F3VA 2ZH7A 2AHOB 4DUYJ 2QI2A 3FLCO 3WEEA 4AUKA 1P9YA 3T1HF 4FJXA 1DTTB 2M7SA 1K73O 4I9LA 2P2CB 4BROA 3THPA 3MXIA 1UWBB 2OAUA 3X3UA 4RNFA 4ECUA 2HBMA 5DGBA 3DYAB 5A2QO 1X3MA 1Q16B 3DJCA 2FLNA 2QLJB 2Q79A 1BU6O 5I3QA 3PNIA 2IRXA 3G8SA 5HMWA 1K73T 1KRPA 3CMAN 1FKPA 4AHRA 1S99A 4PY5A 1GMUA 1XMOJ 2KZMA 3L3VA 3ZT0A 3FE1A 2D9OA 5HJXA 2P9SA 4I69A 5A2QY 4JK9A 2MY7A 4UY85 1IBCB 4CECA 2KHCA 2JEIA 4LY7A 4YR3A 4RW6B 5AR0A 1RHKB 3IFEA 3AA5X 1UFWA 4WQ4A 4OYIA 1MN7A 2ROPA 4IKAA 4ZLJA 2WFBA 1KAYA 5C42B 1IUJA 5DM7L 3L4QA 3CJ9A 3NF6A 4JI4K 1YJTA 2V51B 3V6DA 4J2EA 2E1YA 1FWKA 3BO4A 4LF4J 2Q97A 5C25A 4P6QA 2IJRA 4R8UA 3TAQA 2MKYA 1FRXA 3ZTQA 4JKEA 3LDLA 2IJFA 4FVCA 3W60A 4WQ4C 4G1QA 3NAEA 3GQCA 1SPBP 3MWPA 2FJAB 5FROA 3S01A 4ZPVR 4HACB 3M9NB 4A5AA 4RBVA 1FE4A 4CJRA 4J9UE 3M2VA 3PYDA 4CJEA 3KLVA 1SJRA 5F3TA 2E7XA 1HWKA 4DV1F 2J9CA 3H45C 2CNLB 4FJJA 4JI4F 2D0BA 4K8RA 4DL5A 3SQ2A 4CZCA 1B92A 1WOOA 1Q8IA 5IOLA 4HTLA 1UP1A 2LQJA 1P8GA 3M8PB 3TOQA 3I32A 5KFDA 3A8YA 3I8BA 4YOUA 4CLSA 4DV3J 3B8AX 3TAEA 3BP8A 4JI3F 2NRWA 3OXFA 1N33F 2WBMA 3HLUA 4KIAA 4IOXA 2QKBA 2IBOA 3HHLA 1T11A 1PJ7A 1K6YA 1NBEB 5J1EB 4CLYA 2Z2LA 1ZC6A 3MDFA 1FJCA 4NI2A 4EAHD 4C8NA 2IGIA 3AOCA 2CJAA 3K5MA 3H5XA 4Z4CA 5IZHA 4KQZA 4MT1A 3J7A1 1PG5B 4RPFA 2VDHA 3OBWA 4ELVA 1K8KB 2BJEA 3IXQA 2M4MA 3RBZA 4ELTA 1WTFA 2ZD1B 2NYIA 2GWKA 1HL6A 3MX2A 4IZ9A 4XDDA 3T1HK 4JI0K 4O5BA 4BACA 1S79A 1RT5A 4FF4A 4RNNA 1P27B 1HQ2A 4ER8A 3ZX2A 4DXLA 4K8ZA 2RDDA 4F26A 4EBEA 1VQON 3M8WA 4QR1A 4RW7B 4F4WA 5GMDA 4RBTA 4CVNE 1NAQA 3H1QA 2YHXA 3H8YA 4TVAB 4RU9A 3DFEA 3NL0A 4J9QA 2ASOA 3RBEA 3QAUA 4LF5J 3AVBA 4NCBA 3QZ8A 5C7PA 3C0BA 3MX5A 5G0RA 2XM3A 2OP5A 2OD4A 4AHTA 1VQNN 2YV0X 4FDFA 3TZZA 3QIDA 4YDXA 2BE2B 4I4BA 1QVGR 1QY7A 4KYZA 3PYFA 4CIEA 3IMQJ 4CF8A 2E5IA 1YLXA 2VD3A 4ZLPA 4GKKF 3FZFA 3Q86A 4ZITA 1R7IA 3S3NA 2J7UA 4OZ3A 1EWRA 3AO3A 4I1TA 1XNQJ 1UEKA 2P9UB 4DV6K 3AO5A 4ED3A 3HHNB 5CYQB 2MLYA 1S97A 2KQ2A 1VRTB 3AXKA 4QWDA 2NXJA 1N5YB 2ZH9A 3M6WA 2W8LA 1WAJA 1M5PC 4Q8EA 3SCXA 2Q1LA 4YFUA 3O2IA 2VH7A 1H38A 4U67Q 1E6VB 4ZA1A 4MIAA 4E1JA 3QRQA 4M3RA 1HNWK 3Q2TC 4PWUA 4ILJA 1VQ7N 1WOPA 2ZF5O 4C3LA 4J90A 5HMYA 4Y1DA 1SBRA 4PWDB 3SUQA 3HBTA 2ERRA 2GVDA 2HQFA 3CCUS 1U2VB 4CJ5A 4LR9A 2AA4A 4KHSA 4FLTA 3SAGA 2WAQD 3ZETB 4B9TA 2F63A 3FKBA 3DLGA 3WXIA 3J7YP 3J7ZT 4PEOA 1ZA1B 4F0MA 3M6VA 1Q9XA 3RSEA 1X5SA 4NCGA 3G6ES 3K58A 2VKZG 3TVZA 3SPYA 1HWJA 4BQLA 3OYDA 1WN7A 1GOBA 1NG9A 2UUBF 1NGAA 4OZ1A 4HEA9 4NCGB 4FVMA 3RSEB 5E41A 4FWLA 4BC3A 1LWEB 1MG7A 1X31C 4CO5A 2Z1GA 4FYWB 2KKHA 3NF8A 3MEEA 3JXOA 2E5JA 3KWGA 3Q23A 4CK3A 4WF9Q 3V9XA 1HD1A 1HUXA 5HJYA 1W25A 3V9SA 1X5OA 1HQUB 3K8WA 1HI1A 3ZTOA 2CPYA 4FLYA 1G99A 1KS2A 4CO0A 4KJIA 4BRAA 4DN9A 2NUUG 2XMMA 4DF8A 4BVPA 1N34F 3AD7C 1RFQA 3HPOA 4ZVEA 3U02A 3ALYA 3VGTA 3IUCA 2E9RX 3D6TB 1HNWJ 2BBEA 4KO0B 4EHTA 2Q3PA 1S1XA 1HNWF 5BRDA 1SCJB 2ABYA 3PHEA 2MKSA 4M5DA 4ILGB 5IT0A 2OD6A 3O3HA 2HWHA 3VQPA 2V8PA 2LQ9A 3MTKA 2YHBA 3VERA 2HZAA 2KHDA 5LMUJ 3NNCA 3EEQA 3I9ZA 3BJYA 5HMZA 2DNKA 1TGOA 5LJ5Y 4WCEQ 3BGFA 3MCPA 4B1UB 2GWJA 2JLFA 3FSXA