2YKMA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPCLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 156
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ykmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ykmA05
2B5JA 1BQMB 3DLEA 4NLQA 4IFYB 2HMIB 3BSCA 1DTTB 3SUNA 1LW0A 2E9TA 4NRTA 4IG0B 5F8NA 4HVJA 1RDRA 5J2MA 1RT5A 2IMWP 3H5SA 4U6PA 1RT1B 1TKXA 4B8AB 4ZVEA 4Y2AA 4CECA 4LSNA 3RB6A 3DDKA 3C94A 5KFBA 1S6QA 1HYSB 5CZ1A 5KG7A 1KVCA 4GVMA 2DPJA 2O4IA 3RWUA 3DRPA 3FRZA 3I5BA 2XY5A 2A1RA 4H8KA 3OYBA 1HNIA 5L9XA 3CJ0A 1QHTA 3V81B 2ILYA 3L2QA 3CFRA 1S1XB 4W5NA 1WNSA 4J9QA 4GC7A 3H5XA 3V1QA 5KFAA 2W9CB 2XRIA 4DQIA 4CHQA 2W9BA 3D28A 4E1NA 2F8EX 4KV8A 4M45A 4RW7B 1BI4B 1LWCB 2YKMA 4Y2CA 1C6VA 2WONB 4M3YA 4IG3B 2AWZA 4EO8A 5J2QB 3SQ2A 1IKWB 3IN5A 1JLFA 4NCBA 1RTIB 2AJQA 3WNGA 4OPJA 4FJMA 3PW4A 4YQWA 3DOLB 3DYAA 4K4TA 4KO0B 2YV0X 4YNQA 4B9VA 2XO7A 3HPHA 2G8KA 3VQBA 1QSSA 4O3NA 4UQGA 3CFOA 3P1GA 5I42A 2ATLA 1G15A 4G1QB 1RT4B 2V0NA 3TWHA 1RT7A 4HCCA 3BQ0A 5KFGA 1IKYA 4F4ZA 1VSFA 3QESA 3PO5A 3RRHA 2R8KA 3VQ8A 2KTQA 4CGGA 4IRDA 4DF8A 5KG2A 4J2AA 2D41A 3QGGA 1BQNB 2XGPA 4ED6A 4FCYA 1XR5A 1WSEA 4CF9A 5DLFA 5KFXA 4K4UA 3IGNA 5J2QA 4AILC 2FVCA 1T7PA 3NGIA 3CIZA 1ZBUA 2VG7A 3VQAA 3SZ2A 4IH6A 3QEWA 4RW8A 4CEDA 3RTVA 3F9KA 4WYWA 1S10A 3PJXA 4PY5A 4B3OB 1QSLA 4H4MA 5FDLA 4QOZB 1HNVA 1L3TA 5CYQA 3DLRA 4CJEA 2BE2B 5HRSA 5FRNA 3AO1A 1NJXA 3OYEA 4NYFA 4IDKB 5KFRA 3KJVB 4CJFA 2E6MA 3B6PA 5KRSA 3K2PA 3DRRB 3HKWA 1IKXB 1RYSA 3U3GA 4G1QA 3KMSA 3FQLA 1S6PA 4HTUA 4F3OA 1JL1A 1QE1A 3RMDA 3DRPB 1IKVA 4CIGA 2BANB 3LZIA 4N56A 2CJQA 3HL8A 3CJ3A 3HT3A 3DLKA 3VN5A 1EETB 3OYLA 2OZMA 2R7YA 3QINA 4FJ9A 4XIUA 4H4OB 3V9SA 1MU2A 2D0AA 3AVHA 4Y1CA 4ECSA 3SUPA 2P5GA 1IM4A 4FK4A 2C2DA 2W42A 4FLTA 2PYLA 1BI4A 2VWKA 3MEDA 2BQ3A 1I3AA 4DU4A 1U45A 4ZHRB 4ZP6A 2IM3A 3KNAA 2D0CA 3OSNA 4Q8FA 2F8SA 5HP1B 2DFFA 4TN2A 1S1VB 4RW4A 4MQ3A 4Q8EA 5KG1A 1WSIA 3V6DB 3KHLA 1N4LA 1Y97A 2BE2A 4KB1A 4HUFA 4E1MA 4FLXA 4IR9A 4FLZA 4RW9B 1KLMB 3OYMA 2UVWA 5F8JA 1S1TA 4K4XA 3KLVA 4FS2A 1HMVA 3ZT0A 1TL3B 4BWMA 4PQUB 1LWEA 1Q9YA 4DFJA 3FFIA 3NH0A 3L8BA 1S0NA 4Z4EA 3TAQA 4DQSA 4FBTA 1QS4A 4C8MA 2YNGB 4O3OA 4FJIA 2IA6A 2Z1GA 4DL7A 5JS2A 2GIQA 5KFYA 5DLGA 1O1WA 2PYJA 3AO3A 4KV8B 4ED3A 5FROA 1DTTA 1KRPA 1HPZA 5DQGA 4Y3CA 4EBEA 4KHYA 4WZMA 3HJFA 3GYNA 4G3IA 4FJGA 4M3WA 1JLEA 3OSPA 3QLHA 2VA2A 3NFAA 3QO9A 4WXOA 1T03A 2WCXA 4DL6A 1XHZA 5C25A 3VQDA 3DLEB 3PR4A 2B4JA 2QXFA 4BE2A 4CEOA 1OS5A 3ZSOA 1DTQB 3KHGA 1KCFA 1HARA 4FLUA 3E51A 2J6UA 4FVMA 4C8KA 3SNNA 3MAQA 3JYTB 3L3UA 1S1TB 4URGA 3LP1A 2G8IA 3QEPA 5FDLB 3NGYA 3KLEA 1TK8A 4DTOA 1FKPA 4TY8B 1LW2A 3EYZA 5KRTA 2YKNB 4FM2A 3L2VA 1NK5A 3ZSZA 5I42B 3I8DA 1WSFA 1TAQA 5DK5A 4J2EA 5KFWA 3EZ5A 1KHWA 2ETJA 2Z1IA 1TKTA 1TV6B 1QQCA 1SH0A 2HAIA 3K5MA 2FVPA 2IBKA 5DG7A 3ZSRA 1WSHA 1D5AA 3SQ0A 3D45A 4TQSA 4M94A 1NK8A 4U7CA 3H40A 4OLBA 1Z26A 1S1XA 4TSXA 1S1UA 4CIFA 3RMCA 1JKHB 3LP0A 1DLOA 4DTNA 3M8SA 4ICLA 2AX1A 3G86A 4DG1B 3BGRA 4QAGA 2OPSA 1B9DA 3JSMA 3O3HA 1U4BA 3KLFA 1NNDA 3DLGA 2IAJA 4KB7A 2RN2A 3HXMA 4PWDB 4B9TA 1RTDB 3T5KA 2AQ4A 1R0AB 1GOAA 3HK2A 4OKJA 4RNMA 2OPRA 4NYZA 3BR9A 4XPCA 2FLPA 3DOLA 3B6OA 4NLVA 3N6LA 3NAIA 4DFPA 2VG5B 4ECUA 1BISA 5KFCA 4MK7A 4Y34A 4ZMMA 3QZ8A 4KKOA 1HMVB 4NRUA 3KLHB 1TL1A 3NKYA 4M3RA 1ZTWA 4KHUA 4QWEA 1RDAA 2W8LA 4WYLA 3LANA 2C2EA 2FVRA 2RF2B 1LWFA 3RRGA 4YP3A 2G8HA 2CKWA 3GV5B 4RW6A 3SFGA 1N6QB 4EZ6A 2JGUA 4B9UA 4C8NA 2ZD1B 1TV6A 1TK5A 3VQ6A 5KFTA 1T3NA 1CZ9A 1TVRB 1L3UA 5KFOA 2HNDA 5KFFA 4AH9A 4CESA 1VRTB 5HLFA 1WAJA 1RT5B 4KHQA 1N5YA 5KFSA 4EP5A 1TKZB 2X6SA 3OYGA 2ZQBA 4I9QA 3AO5A 4DG1A 3EZUA 5C25B 4O44B 3KLIA 1J53A 4J9LA 3V1OA 1X1PA 4CJ3A 2IS3A 4NLUA 2OYQA 1S6QB 5KFMA 2I5JB 1BL3A 1RBRA 2GV9A 2RDIA 3DOKA 2D5RA 3OYNA 2GIRA 4CCHA 4FXDA 3QZ7A 1S9EB 4Q45A 3V9UA 4C8OA 2IC3A 2C2RA 4WXWA 3BQ1A 2XC9A 1EKEA 3HPGA 4FS1A 3MEEB 2V4QA 4EYHB 4OLAA 2BDPA 4IFVA 1KHVA 2WHOA 3ZSVA 1F21A 3BDPA 1RBUA 3QETA 4ECXA 4E7HA 4IH5A 3KD1E 3I0RB 1UA1A 3OYAA 4JRPA 1X9WA 3OS1A 1Z4UA 1ASWA 1HRHA 3IGVA 5KFIA 1EP4A 4K4ZA 2DTUA 3PY8A 5KG6A 4RW7A 3OJSA 3N6MA 5L1LA 4R5PA 2AX0A 4MK8A 1S1UB 4YFUA 5JS1A 4TLRA 3TAMA 4DTSA 3PW2A 3M8RA 4HYKA 4KHMA 3ZCMA 2DPIA 3MF5A 3SQ4A 3ISND 3UIQA 4O4RA 3RR8A 4DQPA 1JXBA 1S9GB 2HHSA 3EPGA 4XPEA 4DF4A 4I7FA 1FKOA 3PX0A 4RW4B 2WOMB 5KFHA 3NF7A 4JLHA 2VG6B 4RZRA 4J9PA 4LSNB 2B6AA 4ZPAA 4NLPA 4KFBB 3GIKA 4JRQA 3OLAA 4M3TA 3AVMA 5I3UA 4OL8A 4FJLA 3QNOA 2OPPA 4BACA 4J9MA 2EHGA 2IJNA 1GX5A 5F9LA 3NL0A 3MR3A 1YTUA 3H2LA 3O3GA 1S0MA 2BQRA 1HNIB 4FW2A 1UWBA 4CHZA 4DL4A 4WE1A 3SPZA 4AHVA 5JXSA 4DTPA 1JLEB 4KI4A 4KSEB 3I0RA 4CJPA 4C8LA 3MFHA 3V9WA 2KZMA 2G8WA 4GC6A 3H5YA 1RILA 3PW0A 1BQNA 4PUOA 2WONA 2FJVA 4FJKA 5HLFB 3KHHA 3NF9A 4DQQA 3JYTA 3OYIA 1SUQB 4LSLA 3NAEA 5L1KA 3LAKA 3QLHB 1WAFA 1VSIA 2X6NA 5DGAA 4IKFA 4O3SA 4CHNA 1HNVB 3TAFA 4Z4FA 3C6TA 3V1RA 2IGIA 3OS2A 1W25A 3KJVA 4KE5A 2AU0A 3AVCA 2QK9A 4IRCA 5EWGA 1KVBA 4E0DA 3EY1A 3T1AA 4EEYA 1RBVA 4O3QA 3MR2A 4HCBA 3LPTA 4B3OA 4HHTA 3CWJA 4TXSA 1TL1B 3DLHA 3C6UB 4CFDA 1S48A 4MIAA 1BGXT 3SJJA 2B6AB 3HSTB 3VQ7A 4Y1DA 2BR0A 5F8GA 1MU2B 4RNNA 5KGXA 4E3SA 3AV9A 3D0PA 4IKAA 1VSKA 4KKOB 4IFYA 3DLBA 2FBTA 3KKRA 3KLFB 4ZVHA 2HNYB 5KT4A 1SH3A 4NZ0A 1S5JA 3UDLA 5KFUA 3AVBA 2HNDB 5K14B 5C24B 3AVLA 4FZZA 3G6YA 4BDPA 1RT3B 2B5JB 1HQUA 1C1BA 2OPSB 3JSMB 4RUCA 3ASMA 1TK0A 3OYHA 1K6YA 2KZZA 4QPXA 3DRSB 2B43A 4ED8A 2FBXA 2WRMA 3M9MB 1TVRA 1HYSA 4W5QA 4Z0UA 4K8ZA 3A2FA 3I0SB 2QV6A 4JV1A 2ALZA 3CDEA 4ZPBA 4KHSA 4J9OA 3ICLA 1J9AA 1JLGB 2FVQA 1HJRA 2XWYA 3NE6A 1RBSA 4I2PA 1C0UA 4CEFA 3MEEA 1XR6A 3H4DA 2RF2A 3HM9A 3FQKA 2V4RA 1WSGA 2P51A 4FLVA 3K58A 5DGBA 3G6XA 3VQQA 4AHRA 4CEQA 2HB5A 3I5CA 4E7IA 3DOKB 1IKVB 5DG8A 5KFVA 3MECA 5D3GB 4CJ4A 4ZP7A 3KLGB 2X78A 4LD0A 2R8HA 3KK1A 3TANA 4IOBA 2XI3A 4NLTA 1K1QA 3LP3A 4H4OA 1WLJA 4KRFA 4F4YA 2JEIA 3GIMA 4H54A 1N5YB 3UPFA 3IAYA 3L2RA 1I6JA 1A5WA 1NK6A 4Q0BB 2J6TA 4OKEA 2XGQA 2DFEA 4FK0A 4B8CA 4NLDA 1SL2A 3QEIA 4I7FB 3ISNC 5DQHA 3MR5A 3QO9B 3V6DA 4N5SA 3ITHB 3ZT4A 4IRKA 4CEEA 4GW6A 1GOCA 1DTQA 3KOAA 3MEGA 5KFNA 1VK0A 1S1WA 4FW1A 3NGZA 3E01B 4N41A 5EDWA 4DS5A 4KPYA 1VRUA 3SPYA 4RG8A 1TL3A 2G8VA 2XHBA 2VG6A 4CHOA 4WZQA 5KFLA 2ASDA 4I9LA 4M3UA 1T05A 4E7LA 1ASVA 5C42A 4QWAA 1D0EA 3S9HA 4FM0A 3VA0A 3TI0A 4KI6A 4NLYA 4IH7A 4Q0BA 4RUAA 1Q9XA 1KFSA 3KLGA 3GQCA 2ASLA 4MFBA 4CJLA 4AHTA 3F73A 3RBEA 2W8KA 5CY4A 1RT3A 2AGOA 2E9RX 1D9FA 4CK3A 5T7BA 1RT1A 2F8TA 1C1BB 4BDYA 5CYQB 1JX4A 3NGDA 2ZKUA 1JXLA 2JEFA 4J9SA 4AHUA 4M42A 1NKBA 2G8UA 1MMLA 4I2QA 3BQ2A 4CFAA 1S1WB 1S6PB 1JXEA 3HP9A 5CYMA 2RDJA 1SL0A 4IR1A 4JV0A 3KK3A 1BCOA 5F8HA 1IO2A 4CJWA 4FJ5A 2JLEA 3CFPA 3FFIB 4M3XA 1VSHA 5J1EA 2JC1A 4W5RA 5C42B 4CFBA 4ZVFA 4KHWA 2KQ2A 2ZD1A 3LALA 3LP2A 1YTAA 3N6NA 2BANA 1VSLA 1CZBA 1D8YA 4ECVA 4OGCA 3PVXA 4RU9A 2WK4A 1KSPA 4KAZA 3RBDA 2R8GA 4RW6B 1ZBHA 2OPQB 3AA3A 4HUGA 2W7OA 2RKIB 1TP7A 4DSLA 1HQEA 3T5LA 2ASJA 2FJXA 1IG9A 1SV5B 4DLGA 4CEBA 4YR2A 3VQEA 5J2MB 2YHBA 1ZTTA 2C22A 3Q8SB 3AO2A 1HYZA 3KIOA 3KK3B 3KHRA 4ECTA 1U04A 4ZPDA 1WSJA 1RTIA 1J5OB 3PHEA 3V6HA 5KFEA 4TQRA 4K4YA 2GUIA 4BWJA 4MKBA 3IRXB 4NCGA 3E01A 2XCPA 4R8UA 1C1CB 3O4QA 3SV3A 3OHBA 2D7SA 3V6KA 1S0OA 2D0BA 1X9MA 4F2RA 4RNFA 2E6LA 3PO4A 1N56A 3O4NA 1C0TA 4LH4A 1S49A 3KTQA 4E19A 4J9RA 4R5PB 3AVGA 1FK9A 1RYRA 1RAJA 3AVAA 1SKWA 5KG4A 1JKHA 3LP0B 3OYFA 1T8EA 4NLOA 1ZBFA 4DLEA 2IM1A 4GMJB 3NH2A 2XY7A 2R2SA 1WN7A 3QGIA 5EUHA 3KK1B 3TAEA 2GC8A 4IG3A 3I0SA 3ZT2A 3VQ4A 3DMJB 3LP1B 4J2DA 2WOMA 1U09A 4QWDA 1LAVA 4BDZA 2YNIB 1A5VA 4EYIB 3AA4A 4KTQA 2ZE2A 4NCAA 4N47A 3M8PB 3L2UA 1JIHA 3PV8A 2FVSA 5KT7A 4URSA 3K5OA 1JLBB 5HROA 3DM2B 4M3ZA 4J9KA 1FKOB 2I1RA 3HHKA 5DMRA 1KVAA 3H08A 3T3FA 2UVUA 4ID5B 4CJ5A 3GV7B 1J5OA 1SH2A 2KW4A 4IDKA 4DTMA 2RPIA 5KT3A 1RDDA 1T05B 2E9ZA 1W9HA 3T5JA 3MEGB 2R2RA 5L1JA 2AGPA 3GIJA 3IRXA 1REVB 4O55A 2HHTA 2OPPB 3M8QB 4URQU 4LH5A 1RCHA 1RDCA 3QIOA 4CE9A 3G6VA 3ZSYA 3MEDB 3HVTA 4CFCA 3SI8A 3OYCA 4DSJA 1U48A 4FBUA 4CERA 4IG0A 3VQCA 4CJQA 1SUQA 4NLWA 3SV4A 2RKIA 3OHAA 1BIZA 1IKWA 3PW5A 1QTMA 1NHVA 1TKXB 4ED2A 4ECWA 3H59A 2OPRB 3PW7A 2HHQA 3NBPA 1XHXA 1YT3A 2W9AA 1CXQA 1KLNA 4ECQA 4ECZA 1LW0B 2HVIA 2HNZA 3DI6A 1JLBA 5HROB 4W5TA 1KLMA 2XCAA 5J2PB 5F8MA 5HP1A 4X2BA 3IS9B 1RNHA 4DL5A 2A1SA 1TKZA 1S4FA 2NUBA 3KLEB 1YVFA 2UVRA 5SWMA 3NF6A 4K4VA 2YNHB 3OYDA 2OH2A 4WFZA 5KFDA 3HVRA 2J6SA 3RMBA 2BQUA 4NCGB 4RW9A 3HYFA 4ZTFA 5KGWA 4FJJA 3BSOA 2VG5A 3NDKA 4JS5A 3AVIA 1RTJB 4DSFA 3KLHA 2YHAA 4JUZA 2HHWA 4Z4IA 3C6UA 1ITGA 1UAXA 4DU1A 5SZTA 1EP4B 3M9NB 3OYKA 3HP6A 1ZYQA 4ED7A 4M95A 1HQUB 3G10A 5F9NA 3BSNA 3C95A 3HO1A 2DY4A 3LDSA 3SI6A 3HVTB 3P5JA 4ZHRA 3CQ8A 4QCLA 4RNHA 2VA3A 3T5HA 5F8IA 1ZBIA 4Q5VA 2BGGA 5HRPA 5JUMA 2YKNA 5KFJA 2R8JA 4OVLA 4ELUA 4MH8A 1BIUA 4W5OA 2Q3SA 4OJRA 1EXQA 5I3UB 3CDUA 4R0EA 4TY9A 4ZP9A 4R8UB 2V9WA 5L1IA 4ZP8A 2BRKA 3AVKA 1LW2B 1CXUA 4E89A 4LQ9A 3RB3A 4B9MA 5HRNA 1SKRA 1J54A 2FLLA 4DMNA 4FJ7A 4JS4A 5HRRA 2FBYA 4FJ8A 1RBTA 5E41A 3CJ5A 3MECB 5D3GA 4ZVGA 1L3SA 3EPIA 1RA6A 1B92A 4DFMA 2OA8A 4Z4CA 1JLAB 1QUVA 3L2WA 3DMJA 4O0IA 2KFZA 1X9SA 4FM1A 1T03B 4FK2A 3ZT3A 3OYJA 2OZSA 3NCIA 3OL9A 4QW8A 4ED0A 3AVJA 4DEZA 3K57A 2FJWA 4CHYA 3TVKA 2IM0A 1S9GA 1U49A 1EX4A 3V9ZA 3AA2A 4NLXA 5J2PA 3OJUA 4DTRA 1JLGA 1C1CA 4F2SA 4F4KA 2EC0A 2QKKA 4KO0A 1RT6A 2FC0A 4MKAA 1CSJA 1YVUA 4I2PB 1C0TB 3ZT1A 4B9SA 3V4IA 4B9LA 4WE1B 2UVVA 2DFHA 3ULDA 1NK9A 3OY9A 4F50A 2YNFB 3V81A 4Q43A 4FLWA 4IFVB 3QYYA 3TR8A 1GX6A 2LSNA 4DL3A 4DQRA 3K5LA 4K8XA 3LZJA 1LAWA 4NLSA 3NMAA 4CGFA 4EBCA 4J2BA 2UUWA 1UWBB 4YR0A 1HPZB 3NH1A 1NOYA 4DU3A 2XY6A 4K50A 4YMEA 1TQLA 3HVAA 3BJYA 3THVA 2YNGA 4IQXA 3CYMA 1S97A 4DL2A 1JLCA 1JLFB 3TAMB 4MK9A 5KT5A 4O44A 3QGHA 4KHRA 5KT2A 3VQ5A 2P1JA 3DLGB 4O4GB 3M8PA 3HPOA 2HNYA 2IDOA 2JC0A 3QEVA 3CM6A 4CK1A 4BE0A 3DI6B 5KT6A 4LSLB 1T94A 1D9DA 3FSIA 4CHPA 4F8RA 4DWIA 1CLQA 3OLBA 3S3MA 4H4MB 4B08A 3NAHA 4CF0A 3OVNA 3C6TB 3NBPB 1JL2A 1NJZA 1A5XA 3MFIA 2Y1JA 3PJWA 3UR0A 2HNZB 4KHNA 4QWCA 4K4WA 5EWEA 1FXXA 4Z4GA 4DTXA 4CF2A 3QIPB 3KK2A 3TARA 3G0ZA 1NHUA 5FRMA 1FKPB 4TY8A 1JLQA 1NJYA 1XC9A 1LWFB 4CEZA 1EETA 2HVHA 2W7PA 1XWLA 1NKCA 4CJSA 2PZSA 1VSMA 2BRLA 2OPQA 2X74A 4CGDA 4OGEA 1IKYB 3RAXA 1RTJA 1ZETA 4CF8A 3SYZA 3PX6A 5HBMB 4NLRA 1VSEA 1TGOA 1Z25A 1KTQA 1BQMA 2R2UA 2JEJA 4O0JA 5KFZA 4AHCA 3TAPA 4Z4HA 4F3TA 3LPUA 5C5JA 1B9FA 4KREA 4FZYA 3Q8QB 1BCMA 1UA0A 2HWIA 2QKBA 5KTQA 1KFDA 3S3NA 3NHGA 4AHSA 3L3VA 2R2TA 5EWFA 2F96A 1SV5A 2D3ZA 1XR7A 4CJTA 4PWDA 1RTHA 4EO6A 4CK2A 3BSAA 3O3FA 2HW3A 3U6FA 3AVFA 1QSYA 3WNHA 3IS9A 1VRUB 3K59A 5J2NB 3CM5A 4YR3A 4KTZA 3ZSWA 3V4IB 2FBVA 1NJWA 4KTWA 3M9OB 4O3PA 4XO0A 4E7JA 4EP4A 1VSJA 3SFUA 4Q44A 4O3RA 3PX4A 3IG1B 1QE1B 5F8LA 4ICLB 4B9NA 4F4WA 3V6JA 4CJRA 4HUEA 3RMAA 4ZPCA 3CVKA 3DLKB 2XY8A 4BE1A 2KFNA 1XI1A 5KG0A 2ILZA 3PUFA 3MXMA 4FJNA 5K14A 5C24A 3PR5B 1D1UA 1L3VA 4CGJA 4QW9A 5KG5A 4CGHA 4M41A 3BGRB 2UUTA 4RNOA 5HBMA 1TAUA 1QAJA 2P5OA 3HVWA 1UOCA 3VQPA 3GIIA 3KD5E 2IM2A 4J9NA 4LQ3A 4ED1A 3U3YA 1IH7A 3QEXA 1JLAA 1NKEA 3RB0A 1C1AA 4FZXC 4DSKA 2R8IA 3CO9A 3I5AA 4CGIA 3OL7A 1C0UB 4FYDA 4K4SA 1SL1A 4DSEA 4EZ9A 4TYBA 1N6QA 3LWLA 3IG1A 5KG3A 3QIPA 3M8QA 3KK2B 1RDBA 3MXJA 4CIEA 3QNNA 3UQSA 4PQUA 1RT6B 3K5NA 2IC3B 1LWCA 2YKMB 3FDSA 3AVNA 1FK9B 3SUQA 2Z1HA 2FLNA 2XI2A 4OKKA 4MIBA 1VSDA 2O4GA 3VA3A 1C0MA 3TAGA 2PY5A 4ZTJA 3BREA 3ZSQA 4CEAA 4CJKA 4ID1A 2IJFA 3PZPA 4ECRA 2IAJB 3OL6A 4PUOB 1BHLA 1QAIA 4LY7A 4HKQA 1NOZA 5CYMB 2JEGA 4ELVA 1R0AA 2IOCA 5KI6A 3S3OA 3WNEA 3OL8A 1N48A 3SQ1A 4L8RB 4WFXA 1U47A 3KLIB 4WFYA 3NF8A 5KFPA 2VG7B 3ITHA 2ZE2B 2QE5A 3OS0A 1LV5A 3CJ4A 3TQ1A 3DRSA 2C28A 5J1EB 1ASUA 2YNFA 4I2QB 2ITGA 4KFBA 4RW8B 5KFQA 4NLGA 3WNFA 3KMQA 3DYAB 2Y1IA 1RT7B 2VWJA 3TABA 4FJXA 1TKTB 1RT2A 1RA7A 3AO4A 1S9EA 4CJVA 4DTJA 3ZSXA 2EX3A 4OPKA 2YNHA 4NYNA 3VQ9A 5DG9A 3MR6A 4JV2A 3RR7A 1IKXA 1HYVA 1RT4A 3LAMA 4DSIA 1WNEA 3SCXA 1HQEB 4F4XA 1JLCB 3H5UA 1NK0A 3D5MA 4KAIA 2HMIA 1TKDA 3ALYA 3CDWA 5T14A 3SUOA 2WTFA 3V9XA 1JLQB 5KFKA 1VRTA 3T19A 1Q8IA 1DLOB 4O5BA 4ELTA 1S1VA 5DQIA 3H98A 1C2PA 2G8FA 2HWHA 2WB4A 2HHVA 4O4GA 1I39A 2HHUA 1NK4A 3RAQA 4CJUA 3GV8B 1RTDA 2Z1JA 2I5JA 1L5UA 3VQSA 3P83D 2D3UA 4ECYA 4DS4A 1RT2B 3CJ2A 4KBIA 3QERA 2YNIA 3KKSA 4CF1A 3H4BA 1K1SA 2ATQA 1S9FA 1SKSA 4KB0A 3DRRA 4TYAA 3RB4A 4E7KA 2HHXA 1RTHB 3Q8PB 1REVA 2AGQA 1GOBA 4FLYA 3DM2A 3CG7A 3LP2B 2O5DA 2W9BB 4DFKA 5J2NA 5CZ2A 3QIDA 4PA1A 1LWEB 4ID5A 1W0HA 4QWBA 4DTUA 2E4LA 4MFBB 3Q8RB 1NK7A 4N76A 3MXIA 3AA5X 1ZBLA 3GILA 4IBNA 3LWMA 4FJHA 5EU7A 4EBDA 2GBZA 3MTKA 2W9CA
chains in the Genus database with same CATH superfamily
2KM8C 1BQMB 3DLEA 4NLQA 4ZVOB 2GQ2A 5GMKa 3TRGA 1VQLN 1I5OB 1LW0A 2E9TA 1CJTA 2NSCA 1F9FA 1ZS6A 5TKWA 2F4FA 5B7WA 4IG0B 2WC9A 1KQSR 3O8MA 5J2MA 1HFEL 4WK1A 1RT1B 3VVUA 5E3CA 4Y2AA 3RB6A 3BZCA 1UVNA 3DDKA 2CIMA 4JI5F 4PG5A 2HMPA 5CZ1A 4JI3K 4GVMA 2O4IA 4NL5A 2HSTA 3RWUA 2GJIA 3OXLA 4H5WA 3RBXA 3VEVA 3B4DA 3I9ZA 3V81B 2ILYA 4OZ2A 1S1XB 2AKWB 4USMA 2JX2A 1WNSA 2KKHA 1NGCA 2P9PA 4OHXA 3L6QA 2W9CB 2XRIA 4DQIA 5B0AA 3M32A 1NB7A 2NRXA 1LWCB 2YKMA 3VENA 3VGKA 5T7LB 1OH7A 2WONB 4IG3B 1VK3A 3SBTA 1T9VA 3M8YA 4EO8A 1YK9A 3QT7A 3IN5A 1TTHB 1SJ3P 4MLEA 3OTCA 1W26A 4DV1J 2AJQA 4Q7AA 2MQPA 4JB8B 1JJHA 1CJKB 1RBAA 4YQWA 1KOOA 3MXHP 1NDCA 4YS2A 1DQ8A 2CVEA 3QMQA 1YJNN 4K42A 3VAGA 2IVMA 5FPEA 2XO7A 3HPHA 3W2VB 2G8KA 3OQ2A 1HKCA 1IWAA 5I42A 4ES2A 2FHKA 2OFGX 4G1QB 2Z2YB 2V52B 5D0RA 2HQIA 2V0NA 3CCUN 1RE1B 4B3TF 3VQ8A 4DF8A 1BO5O 4WFNL 5KG2A 3N0VA 1BQNB 4FCYA 1HD0A 5GAEI 3JAMU 1WSEA 5AZJB 2P6TA 3IGNA 1YJNS 4AILC 1R8CA 1GLAG 1NZ8A 4JI1F 3ENQA 3M1VA 1Q4RA 1MNEA 2VG7A 2CQ2A 1M0SA 5CHCB 3VQAA 3SZ2A 2DHSA 2ZUAA 1P90A 4IH6A 4BVPA 2JDJA 2JFKA 3GIRA 3O80A 2P9UB 5H9FK 3F9KA 4YDXA 1VQ9S 3HULA 1KN6A 4KJIA 3F2KA 3T9ZA 2V50A 3U02A 2DRDA 3U1MA 1L3TA 2F4VJ 5CYQA 3CXCR 5FRNA 5BPLA 4IDKB 3GTYX 2KXHA 5KFRA 3LA0A 1CEZA 1BUPA 1AT1B 4OX8A 4L74A 1IKXB 1RYSA 2XSFA 1IQTA 3VEYA 3U3GA 2OSQA 3FQLA 1S6PA 3O08A 1JL1A 1QE1A 1OH8A 2BANB 4N56A 2FJAB 4GKJF 4DR1F 4PKDB 3J7ZT 1DURA 5EHHA 2DGSA 1YITS 2KHDA 2AHOB 3AVHA 3CB4A 1YBTA 3GJTB 4MMOA 2ZH4A 4JNEA 2GHVC 3VV2B 4NXMJ 4ZHRB 2KT3A 4ZP6A 1RAIB 1OY8A 3I55N 2SXLA 5HP1B 2DFFA 1HBMA 3T1YF 4LBIA 3A1YG 4CTAA 3VAMA 4IOAL 4EFHA 1YRXA 4OFZA 3RZAA 1F5AA 3SMSA 1RAHB 5ETSA 2VJUA 2F4VK 3GL1A 4FLXA 3CCWA 4RW9B 1VQPN 1KLMB 3JSBA 5F8JA 4K4XA 3KLVA 1HMVA 1MN9A 1IM6A 3H2VE 1AZSB 2GHPA 4BWMA 1UEKA 3H3NO 1LWEA 3MZIA 5HSPA 2KXNB 3FFIA 1R27B 1LFPA 3NH0A 1S0NA 3SSSA 3H2UB 3Q8VA 4DQSA 1NU0A 1YXQA 2YNGB 1PYTA 4OI4A 2KHOA 1ZA1B 4UTGA 5KFYA 1HNXF 1IJJA 1T3VA 1FTRA 2MQLA 2DISA 4M5LA 5HJXA 3AO3A 3T1HK 4A8WA 1DTTA 2RDDA 3PCOB 1KRPA 4DZ6A 4Y3CA 1EZZB 3CF5L 5B0FA 2WSCC 3FBCA 3GYNA 2V8PA 4G3IA 5FD1A 1Q7YO 3OSPA 1MWKA 2VA2A 3CMAN 1XHZA 3VQDA 2DNNA 2B4JA 4CRJA 1VQ5S 2CUYA 1HKBA 3FGUA 1M5KC 1PJ6A 2YWEA 1HARA 2CNLB 2DRBA 5AJ3K 3TUPA 3HI9A 1BDGA 4JI2F 3HX9A 4DR7F 1S1TB 3L3UA 2O8DB 2Q6BA 3GU0A 1CS4A 3P5TL 4FWQA 2PA8D 4TY8B 4K7QA 3Q0AA 2NR0A 3I8DA 4LF4F 4LF1A 4C9DA 1QLNA 3LPYA 4YOWA 4J2EA 2XMJA 2XS7A 1QUPA 1R43A 1N34K 3U8XA 4DUYJ 1SJ1A 2UV8G 1VCTA 5AQLA 2Q43A 3KJQB 3AB2B 5BR8F 5DG7A 1Y5LB 4M94A 3C66A 4OLBA 1Z26A 4LT6A 1S1XA 4H0VB 4BRIA 1U1MA 4NYOA 2OTLN 1ZC6A 4DTNA 3M8SA 4AL5A 4ICLA 4DG1B 3B54A 4QAGA 1JNZB 3O3HA 4OPHA 1FFWB 3NS6A 4KB7A 1SIWB 3UCZP 3WXJA 4EWTA 4PWDB 1RTDB 2AQ4A 2C3OA 2V4JB 4WTYA 2LP4A 3HK2A 1M1GA 4NYZA 1X3MA 2EFQA 2FLPA 3HHNB 1B7YB 2P9IB 1X0PA 4YUDA 5DM6Q 5HMYA 3R8YA 4DV6J 3VETA 2VG5B 1YRTA 4DR3K 1BISA 5KFCA 2WVBA 2F9WA 2OELA 1TL1A 4JI2J 4KHUA 1RDAA 3LANA 3SCKE 4UOGA 5B08A 4K41A 2CKWA 3GV5B 3SFGA 5A2QU 4B9UA 2AYMA 4C8NA 4WU2A 4Y2KA 1TK5A 3R7SB 5F3ZA 3ILLA 4CBWA 4WFBL 4QS8A 3X3UA 1T3NA 1CZ9A 2UUAJ 5KFOA 2HNDA 5KFFA 2W7AA 3ZZOA 3P6YC 2WVCA 1H38A 2ZQBA 2PI5A 4U9RA 2W41A 1Y3KA 3IXQA 2ZOGA 2ROEA 4CH0S 2RDIA 4CLTA 2VU5A 4YB7A 3DOKA 5F41A 2GIRA 2DGUA 4PKHA 2NZTA 2NRWA 4MAKA 4C8OA 2IC3A 2C2RA 2XC9A 2OANA 4GV9A 3HPGA 1PGZA 2A3ZA 3LQVA 4IFVA 2QLBB 3FZ2A 2QRRA 3QETA 4E7HA 3KD1E 3I0RB 1UA1A 4B3MJ 3EZWA 3OS1A 2RVJA 2ZJQL 1HRHA 2AW0A 5DM6L 1IBLF 4MO4A 4RW7A 7FDRA 1M5PC 5L1LA 4KT0C 4R5PA 1V4TA 4P75A 2AX0A 2HSEB 3RGIA 2E1YA 1BU6O 1MSWD 1JCEA 4FF3A 2CQHA 5EVZA 3QFUA 4HYKA 3I31A 3ZCMA 3J7AN 3SQ4A 2BVZA 1QY7A 1RHKB 4F26A 4GKJJ 3VGUA 3J81O 4XPEA 4DF4A 1T9WA 2W25A 4JLHA 4LSNB 4DPOA 4NLPA 1MW7A 2X3DA 1SQKA 3W66A 2CA9A 4M3TA 4OL8A 1HBUB 4LR8A 2IFXA 2OPPA 3KJNB 2A2DA 3H2LA 2BQRA 1HNIB 1NO8A 4AHVA 4LIRA 1JLEB 3O6QA 3HSGA 3ENOA 4NA2A 3IWNC 1IR0A 3A5LC 5HVGA 2YX1A 4C8LA 3FZKA 1PYSB 3V9WA 4ZA1A 2G8WA 3T1HF 4BROA 3QB0A 3CJSA 1RILA 3HTVA 4DR2J 3PW0A 5EX3A 4DR6K 3N5BA 4NI2B 3OYIA 3NAEA 4LSLA 3T7ZA 2V8DA 1WAFA 1AUSL 4CHNA 1HNVB 1FRXA 2QLXA 4Z4FA 3BF1A 2DXFA 3MMBB 3KJVA 3CJ1A 1FJGK 4U96A 3C15B 1YX2A 4GKKJ 4HCBA 1GMWA 2NZ4A 1OY9A 1HIYA 4TXSA 1IBKJ 1TL1B 3C6UB 3VR1A 1VBYA 1BGXT 3IKMA 4FOEA 4Y1DA 5LM7E 3HZEA 4USWA 1Q82O 4RNNA 5KGXA 1CJVA 2QSFA 1I1GA 1VSKA 5K8OA 3KKFA 4ZVHA 3FGVA 4ILRA 3VAJA 3QBWA 1S5JA 3LH2S 2E1PA 5C24B 1UTAA 1NEEA 3J80U 4L3KA 3MMAA 3MPYA 2ZJPQ 2W40A 5L9NA 4YOEA 3KVGA 3CCUS 2XZWA 1VISA 4LVNP 1VQLS 2KZZA 2B43A 4Z0UA 4GKJK 1UFKA 3I0SB 2KDOA 2QV6A 2BOAA 4J9OA 1Q81T 2HBYB 2WUSA 4LFAF 2AJ1A 2GJFA 1T6DA 5E3AA 1BD6A 5M2PA 1RBSA 1C0UA 4JI5J 3DC2A 2CJ9A 2MZRA 2V4RA 2P51A 3OPKA 3BBBA 4AHRA 1SJFA 4CEQA 1OQ6A 1P9QC 1WJ9A 2YHYA 1VQ7S 2P9SA 2PIIA 5AQFA 2X78A 5T7LA 2R8HA 3KK1A 3TANA 4JI1K 3ZXWA 1REGX 1K1QA 1E3MA 3GIMA 1IXKA 5AQWA 4DV7K 1FEEA 2AD9A 3AXKA 4NLDA 1H6KX 1SL2A 2BBEA 4EIAA 1HNZF 3QMLA 4CNZA 1CQNA 4RBVA 2ZDPA 3SMPA 4RBTA 3QO9B 2OEKA 4JK9A 1VQSA 3PLAA 4CEEA 5IWAK 2QWMA 4HTIA 3ET6A 2OCEA 1HR0F 4JN4A 3IP0A 4FW1A 2MLYA 3DCAA 3E01B 4KPYA 4OI0A 1QAYA 5HK4A 4RG8A 3TSPA 2XHBA 2PN6A 2ZJQQ 2V51B 5A8RA 9ATCB 3CMES 4P6QA 1ASVA 3B4MA 5C42A 2ASOA 4QWAA 1D0EA 3S9HA 4CH1A 2HQ3A 1KONA 2CPZA 1YJVA 2DGXA 2O8BA 4X4SA 1ITPA 3FCWA 3D6HB 3TA2A 3HKZD 4RUAA 3KLGA 3GQCA 1OY6A 2ASLA 1ZBSA 2YCHA 3NNAA 3FUYA 2AGOA 3C6AA 2E9RX 4CWBA 4LF7F 2C2KB 5T7BA 2F8TA 5DO2A 5CYQB 4WFBQ 1S57A 2C42A 2ZKUA 1IUJA 3MX2A 1OMSA 4IEEA 4FOIA 1K0TA 5M1OA 5CR4A 2LFVA 4GMKA 1QVFR 1S6PB 2QA1A 4JV0A 1WI6A 3KK3A 4XH1A 4OI2A 2RAQA 4ZCLA 2JLEA 1VSHA 2PGCA 1RLCL 5C42B 3AA8A 3NLCA 4CFBA 4X4VA 4ZVFA 3EGZA 3P4IA 1YTAA 2VHGA 2IYGA 3CTRA 3PVXA 3UWTA 2BJ3A 3QWUA 3B6BA 4NASA 2EI5A 5IXUA 4RU9A 2EKYA 4KAZA 2MZTA 3W62A 9RUBA 2X1FA 2OPQB 2H51B 4HUGA 1NMEB 2RKIB 2NLWA 3GR1A 3R2CJ 1E6VA 3T5LA 2ZWHA 4PKIA 4OYAA 2VL1A 1HHTP 4B3SF 5MAOA 4YR2A 4DJBA 4AM7A 3KIOA 3KK3B 3TNVA 3KHRA 2AZ1A 1NNEA 5CHIA 4ZPDA 2DXEA 2IVOA 1H2TZ 3PHEA 5KFEA 2ZF5O 2BA9A 4E2FB 1FNMA 2WVFA 1QZ5A 1S4EA 2R7OA 2XCPA 4HI2A 3EM1A 3O4QA 4H5NA 1HI1A 4GVEA 4FWSA 3QT8A 4BLGA 5C2FA 1ZOTA 4F2RA 4RNFA 2JRSA 1UMJA 2UUBK 2W24A 1S49A 3KTQA 4E19A 3AVGA 3DN9A 1RYRA 1MLAA 3MAAB 1WHVA 1IWGA 2LXUA 2YX7A 1K44A 2EW9A 3FZMA 3S6EA 1OYEA 1ZM2A 3O5TB 4W92B 2R2SA 3VEWA 4K2XA 2A18A 3LDPA 4FDFA 4IG3A 4JBCA 2IYIA 3GBTA 5KAKA 3ZT2A 5AQQA 3RYLA 5FLXU 3PG9A 4J2DA 4QPTA 2WOMA 2UUBF 3D2EA 2L9DA 2U1AA 4PZVA 4AQYF 2IVPA 3ULEB 1RU1A 2HFUA 3K5OA 1SC4B 1MN7A 4DR5J 5D4NA 2E20A 4LF6F 2MQNA 5DMRA 3H08A 3PRVA 4QIWD 5MLCV 2UVUA 3H1QA 1SH2A 5DM7Q 2DR9A 4IDKA 4M63A 2RPIA 1RDDA 1T05B 1RFQA 2E9ZA 3MOJB 2Q1NA 1W9HA 2AGPA 5KQDA 4WF9L 3IRXA 4JV5K 4O55A 2E5IA 1RBLA 1VC6A 1Z1ZA 1RDCA 3QIOA 4YB5A 3BEXA 5I4MA 4IDHA 2LQ9A 2VQFF 3BKUA 3HVTA 2IHR1 2LQ5A 4DSJA 4FBUA 1N52B 1H73A 3VQCA 4DXLA 4BC5A 2NRHA 3PW5A 2P9LA 1NHVA 2G13A 4UUWA 4ED2A 4ECWA 5DZ7A 2OPRB 3PW7A 2MZJA 3U1NA 2EWHA 1CXQA 1NDLA 2HVIA 1HD1A 3ZETB 1JLBA 2E5LK 4X2BA 3IS9B 1TKZA 1S4FA 2MJUA 5LMUK 5SWMA 4CT9A 1WORA 2L41A 3OYDA 3O5BA 5B0BA 1CZAN 1Y9OA 4ZLLA 3ET6B 1HBOA 1VQKS 5KPZA 3RMBA 2LA6A 3N4QA 3DGPB 4BBYA 4FJJA 1G2EA 3M3ZA 3KLHA 5IT9U 4OX9K 2YHAA 4JV5J 5M1QA 3FMBA 2GEMA 1ITGA 5SZTA 1EP4B 1KC8T 2M2BA 3TX0A 4X4OA 5SUHA 2EWSA 1ZYQA 2KYZA 3R1LA 1E6VB 3BSNA 4JKGA 1TMMA 3P5JA 4CLFA 4XK8C 2QLWA 2GWKA 5D8HB 4QCLA 1RP5A 2F9DA 4RNHA 5ETKA 2KXFA 1R59O 2YQ0A 4K0KK 1UVJA 3UNGC 5GINA 2KU7A 3NXZA 1XNRJ 1Y10A 3JSYA 2KH9A 4CI6A 1O51A 1ZM3A 2CZ4A 4TLQA 2P8IA 4C3MA 4HDGA 2KLAA 4JP8A 5L1IA 2CNOB 4P10A 1LW2B 1CXUA 3P38A 5LY3A 1KBRA 2Y8WA 1VJWA 3MAAA 2BMBA 2GGPB 2BJDA 2HHHK 4USUA 5HRRA 4FJ8A 3UKUB 1RWWB 4OZ5A 3M30B 3L2WA 1V4SA 4X66J 4L73A 4BRCA 4B17A 3HJVA 1VBXA 3ZT3A 3OYJA 2QC3A 2OZSA 2OIHA 4IJNA 4QW8A 1FXDA 3PIPQ 2RT3A 5K8PA 3OTOF 4NLXA 2UP1A 5J2PA 4NZ6A 2YWKA 1F3VA 1JLGA 1D8ZA 2EC0A 4CTAB 1K8KA 4JKAA 4MDAA 4MKAA 1XNQK 3NEKA 4I2PB 4B9LA 5C12A 2UVVA 4M5HA 3DLJA 2HBQB 3V81A 5MLCQ 1OVYA 4Q43A 4FO0A 4LSZB 2AJFE 4EBCA 2QGFB 2HRYA 4BC3A 2ITMA 2UUWA 5E2QA 1UWBB 4Z37A 1WG5A 1NOYA 2XY6A 2E5GA 4LR9A 4AXJA 3HVAA 1WBBA 3THVA 2YNGA 2I7PA 3CCRN 3MMAB 2GV1A 1S97A 5KT2A 4O44A 3QGHA 1CVJA 2M88A 2O66A 1CLFA 2DO4A 2HNYA 1VQ7N 2J76E 4CK1A 5KT6A 3GCWP 3UFCX 4H4MB 3OVBA 3NAHA 4CF0A 2E5HA 3C6TB 1RAEB 1NJZA 4L6V3 3R5GA 3PJWA 1J5EF 5JMVA 2HNZB 2ZJRL 5EWEA 4NXNF 2IMOA 5H9EK 3MMJA 2NXNA 1GTHA 2ZBCA 3KK2A 2P9EA 1NHUA 4M5GA 4OHWA 1K9MT 4DZDA 4IXCA 2CPDA 4WCEQ 5FRMA 4TY8A 4DV0J 1JLQA 4FWPA 1TZ0A 1XC9A 3MCPA 4CEZA 3CIPA 2HVHA 5AQMA 3N4WA 4C6AA 2PZSA 2BRLA 2MHEA 2X74A 1ROFA 7AT1B 4OGEA 4BRMA 1IKYB 4CF8A 1YVNA 3PX6A 1VSEA 1Z25A 1KTQA 3VGTA 2JEJA 3FZFA 5E84A 3JXUA 4Z4HA 1PJ7A 2YWFA 2OEJA 4KREA 1FRLA 2M5YA 1UA0A 5K8MA 4YHHF 2NSBA 1EKSA 3ZO7A 5HVHA 3AY9A 1A0OB 1ZXOA 3S3NA 1TYQA 2A2CA 4AHSA 1VHIA 2R2TA 3SQGB 4PXBA 3R1XA 4CJTA 4ED5A 4YB1P 2QWNA 4PWDA 1RTHA 4EO6A 3VEOA 2HW3A 3U6FA 3DLLQ 4ERDA 3DDIA 3K59A 4YR3A 3ZSWA 2XTJP 5ETOA 1HHQA 3SAHA 3M9OB 5EOYA 2OUGA 3MTJA 1XEZA 3TVZA 2K3KA 1OIAA 2XULA 3PX4A 3IG1B 3F9MA 4ICLB 2QG9B 3D9BA 3M6XA 3VAIA 1Q1KA 2XY8A 1YJ9N 4X4RA 2KFNA 1XI1A 1WUUA 5KG0A 3PUFA 2DNGA 4FJNA 5C24A 1D1UA 1Q78A 4QW9A 4CGHA 3BGRB 4M41A 4WQ5A 4RNOA 5HBMA 1ZZFA 2P5OA 3HVWA 1UOCA 3ETOA 1TFWA 1B7FA 1EAYC 4B1XB 4P73A 1XMQK 2W2PP 2MJNA 2CPYA 1IH7A 2A0FB 1EO1A 1JJCB 1HWIA 1JLAA 3K0JA 3O2IA 3RB0A 3R1HA 2N4DA 1KEKA 3D2EB 5ETLA 3CO9A 5BN9A 2Y0BB 3DWLA 3TUJC 1SL1A 1N5QA 2O8CB 4TYBA 2FHOB 3AD8C 3IG1A 5KG3A 2QL9B 3BKFA 5AE2A 1MWZA 3TP2A 3CCJS 2X7IA 3QSIA 1KC8O 2QTDA 2CDRB 4HDHA 2YKPA 2IC3B 5A8WB 5F0WA 4BRLA 1YJUA 4C98A 1LWXA 4NXNK 2Y3YA 1VSDA 4U67L 2VPXB 3CCQS 4LF8J 1RWOB 4DPXA 3ZSQA 2VQEK 4CEAA 4CJKA 4FWMA 5L8RC 2OGUA 5D0EA 1U0HB 1QAIA 2UXCJ 3RU0A 3O1BA 2HYIB 4ELVA 5KI6A 3KLIB 4WFYA 4M5JA 4G1PA 2CQBA 3QAUA 3W65A 2ZE2B 3OS0A 2MXYA 3CJ4A 3C15A 1V5VA 2YNFA 4I2QB 1TMJA 3IO1A 3TZYA 1RHJB 4E98A 4B1YB 1FTCA 3TABA 4LFBK 1MMDA 2P9CA 1WI8A 5K9FA 3IR6B 3HSDA 2UXBF 1BLUA 2AZ3A 1M5SA 2Z58B 4CO4A 3OA9A 4OPKA 1UPPA 5EXWA 1OSCA 3Q86A 2QMWA 3LAMA 3ULHA 4DSIA 4OZ3A 3SCXA 1N54B 2K2PA 4F4XA 1NM2A 4JHDA 3VGLA 1JLCB 4DHVA 5ETTA 2E1ZA 3TW0A 4AE5A 3ALYA 3SUOA 3FSXA 2P5VA 4HACA 4DR3J 1IVZA 3QAEA 1Q8IA 1DT9A 2PEHA 3ZX3A 4ELTA 5DQIA 4JI2K 2HQFA 2CJYB 4DUZF 2VFTA 4JKGB 2HWHA 1I39A 2BUPA 2ZGZA 1X5TA 4RWTA 1X4FA 1L5UA 3VQSA 3P83D 4BRPA 3AQOA 4DS4A 1RT2B 4WPAA 3LDLA 1SPBP 4FXVA 4Z7YA 3AD7C 2UUAK 4B3RJ 2DR5A 3KFWX 1SKSA 5FPMA 4KB0A 3DRRA 2HVDA 2CPEA 4E7KA 3Q8PB 4OHZA 5FPNA 1GOBA 2N4CA 1GMUA 2M8DB 5C2DA 1P1TA 4V19S 4KR0B 4IQMA 1UFWA 1VQ6N 4ID5A 4YDUA 2W2MP 2D3O1 4IEIA 3Q8RB 4CH7A 3W8PA 3CE8A 3MXIA 2UUCK 4X64F 2DBBA 3NVMA 5ADZA 2XLJA 3ZZPA 3GILA 3LWMA 4FP9A 4FJHA 4EBDA 5GADU 2VASA 1FRHA 2I9SA 3CCMN 5IQQA 3G82B 2NYHA 2C3MA 3BSCA 1NGAA 3SUNA 1B0TA 2LQ8A 2V68A 4X64J 2MLXA 2QMXA 3OFFA 2RE2A 3PIOL 4U7UK 3SCIE 5F8NA 4HVJA 3CCES 3NOCA 4K2JA 4IOAQ 2IMWP 4CLUA 5BRDA 2E29A 4RL1A 4LF5F 4R79A 2BE7D 1VIOA 1O8BA 2HURA 3A5NC 4CECA 4U95A 4MDBA 2B7CB 3NGKA 1HBOB 4DHYA 3JS6A 1KVCA 1NGGA 2QL7B 4OV1A 1HWJA 3VF0B 4X66K 4YOVA 1HNWJ 4KGVB 3H8YA 3OD2A 1UW4A 3ELHA 2Q66A 2A1RA 4H8KA 1GXLA 2IIHA 3UI3A 5L9XA 1S6UA 1QHTA 3L2QA 3CFRA 2DPNA 1VLYA 1PBAA 3G8QA 2VFVA 2PI4A 4A47A 4J9QA 3WXMB 1G99A 1Y11A 4QIEA 3H5XA 3V1QA 3NCRA 2A5XA 2W9BA 1XC3A 3F56A 3BF4A 3HHDA 4M45A 2VC0A 1S72S 1ICEB 1BI4B 4NMLA 1XNQJ 4Y28C 1WC5A 3ONQA 3VERA 4M3YA 5BXIA 1M90T 2HFVA 1RCXB 5LJ3Y 3FEXB 4DR7K 2J0QD 2KM8B 5DDPC 4ZVRB 2Q97A 1UWAA 4YB6A 1WDTA 3DOLB 4JKEA 3NP5A 5HJYA 4K4TA 3AJ1A 1R0CB 1NSPA 4KO0B 4YNQA 1IBMK 1QSSA 4O3NA 4DL0C 3P1GA 5IWAF 2ATLA 3D6TB 4H03B 1RADB 4EK2A 1RT4B 3TWHA 2GQQA 2MPUA 4HCCA 4ZVQB 3BQ0A 2GCFA 1CJVB 2W01A 3QESA 2R8KA 4M5NA 2KTQA 4CGGA 2RD5C 3CDAA 3DXMB 2D41A 2XGPA 1RWXB 3DXBA 1U6ZA 2Z30B 3TUZC 1XR5A 4AD6A 5KFXA 3P45B 1IBMF 3D0GE 4Y6IA 2G1DA 1G6BA 1Q16B 4A4JA 1T7PA 3NGIA 4AUKA 4OYIA 4ITSA 3TJ9A 2RU3A 4JI4J 3QEWA 2FY8A 2MEWA 4WYWA 4YHHK 3CW2C 1NMNA 4PY5A 4B3OB 2D4WA 1PC4A 5HMWA 2KL8A 3AO1A 3OYEA 4CJFA 3DRRB 4G1QA 3KMSA 2YX4A 4HTUA 4F3OA 3C14B 4KGZB 3DRPB 3SK3A 3LZIA 1H98A 2BJ1A 3NCPA 5AQZA 2O01C 4NA3A 3HT3A 1H7XA 1N5SA 4ATNA 1EETB 3OYLA 3D7EO 3QRRA 2DNPA 2F1FA 1N8RT 3CCVN 4H4OB 4LMZA 3V9SA 4YY3J 3EVWA 1MU2A 4DV6F 2G0IA 4ECSA 4NO7A 1IM4A 3M1VB 2JWNA 1SC3B 3CJBA 1T02A 3HLUA 1I3AA 3BR8A 2IM3A 3CIMA 2EG2A 4JI7J 2PSZA 3EMTA 3ATUA 4RW4A 1T9TA 5KG1A 3ZNUA 2JWLA 3VTHA 1I94F 4KB1A 4HUFA 4WP9A 4IR9A 3R5JB 3I8BA 4FLZA 3PYEA 2RU9A 4EMDA 3MCMA 4F7VA 4PQUB 3K0SA 3AODA 4X64K 1YZ7A 3O9RA 3FKBA 3EZOA 2FUG9 4C7QA 1EWRA 4BHQA 3EE3A 1JXVA 3L8BA 4DUYF 3C19A 3TAQA 4FBTA 2W2QP 4C8MA 4KH1B 4O3OA 4FJIA 3RAMA 4DL7A 2Z1GA 4M8LA 4LF4J 3EDRB 4KV8B 1DHMA 1FI4A 5M1FA 3UW1A 1HPZA 2APOA 4KHYA 3MOZA 3MWTA 3THPA 3N79A 5AQTA 4M3WA 1JLEA 1X5OA 2LVWA 1GLFO 1AW0A 3NFAA 3QO9A 3BS9A 3PRDA 2WCXA 3DLEB 4Y65A 4BE2A 4X4NA 2ABYA 3ZSOA 4FVMA 3JS9A 2YJFA 3D6MB 1BHNA 2K7JA 5BN8A 4YOTA 4JOUA 1FCAA 3QSYB 1N33F 4DTOA 3QJLA 4FWRA 2BEFA 2E1MC 2DNMA 3ZSZA 3EEQA 1RJJA 3EE9A 1RZMA 5DK5A 3DDNA 3CJAA 3M2VA 3DFEA 1KAXA 1KHWA 1ESVA 4ZJLA 3WQTA 3SQ0A 3E8OA 1HW8A 4YN3B 1NPRA 3MPUB 4OX9F 3C46A 4DX5A 4TSXA 2Y9HA 3RMCA 4CIFA 1JKHB 3LP0A 2JZ5A 3G2XA 2D1KA 4LF5J 3BGRA 3M2UA 3V5RA 1B9DA 1U4BA 5C0YA 3KLFA 2F8MA 4CZFA 2HAFA 4FF4A 3H6EA 3D2FA 2XLIA 4B9TA 1R0AB 3FR0A 3A8IA 1AB8A 1PAEX 4UY8T 3MEKA 1E4GT 2OPRA 2Z8QA 4P9SA 3BR9A 1VR6A 4ZDNA 2I38A 2PBDA 1X60A 2NXJA 3E9OA 2HBKA 4BCAA 4NLVA 1N32K 2CQPA 4GRSA 3FSYA 1FJ7A 3VPZA 3G96A 4BRAA 4MK7A 4Y34A 4KKOA 5DM7L 4QWEA 4QR2A 2W8LA 5DJBA 2XMMA 2C2EA 1R8HA 3ENWA 4C3LA 3BYRA 3CJ7A 4YP3A 2G8HA 1VQMS 1N6QB 4K8RA 2ZD1B 4QU7A 1L3KA 4K43A 3I4HX 3AOCA 3MCSA 5LJWA 3MX5A 1M5OC 1TVRB 3HSZA 1VRTB 5HLFA 5IT9O 1PO6A 3KYLA 1RT5B 1N5YA 1WOOA 5KFSA 1TKZB 4I9QA 4NLCA 3EZUA 1HI8A 5C25B 4O44B 3KLIA 3GG0A 1S3XA 3TA1A 4J9LA 1S6QB 2I5JB 2HBMA 1BL3A 2GV9A 3TX8A 1PG5B 2B4PA 4CQ1A 3UD3P 1N32J 2MKHA 3I4PA 4FXDA 4ANEA 1S9EB 4Q45A 3CULA 3EGNA 3V9UA 4WXWA 4LR7A 3NRBA 4DCPB 2V4QA 4J37A 4ED4A 4OLAA 2RHSB 3OFEA 2WHOA 5CCLA 3ZSVA 2CPHA 1RBUA 4I6WA 4ECXA 2YKOA 2FZKB 3BGUA 1YDLA 3CCSN 3FZLA 4FF1A 1Z4UA 2GTDA 3G4SN 3IGVA 1LFWA 1DARA 4K4ZA 2DHHA 5KG6A 1RUSA 2Z2ZA 1LCUA 3WEEB 3J7YI 2VPZB 1FJGF 3DNCA 5JS1A 4B3RK 4PG7A 4LFBF 4NZ7A 1YIJS 3G6EN 3RJMB 1U8SA 2MB0B 5ADXA 4KHMA 4FVUA 3UIQA 4O4RA 4OHVA 1WF0A 4DQPA 3MM9A 4C0OC 5HANA 1VQ9N 1S9GB 5IZHA 3EPGA 5TKYA 1UVLA 3BH6B 1GLCG 4ETZA 2H1YA 3ZZTA 2CGJA 2CJKA 5FLXY 3OW2M 3G4SS 3THXB 2VG6B 4RZRA 2NZCA 1M1KO 4DN9A 4F67A 4KFBB 1TUYA 4JRQA 1T9XA 2K7KA 3NGTA 4BACA 1KVIA 2EHGA 4WU3A 2BXJA 3A5MC 1GX5A 3NL0A 4AQYJ 3L4BC 1YTUA 1O5JA 4FW2A 2FC8A 2BZ2A 3VF2A 4X4PA 4WE1A 3SPZA 2RNEA 3P8BB 3HSCA 3WEEA 5JXSA 2F8HA 2J8SA 4KI4A 5C2GA 2V8VA 4KSEB 2ZM6F 4QS9A 1RACB 1URNA 3WC2A 2RHQB 4NMXA 3FFKB 2VGMA 1RAOA 4LFAK 4GC6A 2K06A 4X4UA 5F3TA 2FJVA 1P6TA 3KHHA 4KHPF 5A0YA 3NGRA 5L1KA 3HOSA 1VYAA 1HPMA 3NY0A 2X6NA 3L4QA 5DGAA 2QWPA 3CC2S 1YHQS 1GLJO 4OZ0A 2EBEA 1VBKA 3KWIA 1AXQA 3HFVA 1W25A 3WC0A 3E9PA 2R7QA 3SEOA 5EWGA 2NRVA 1WACA 1KVBA 4E0DA 2EFOA 3TA0A 3T1AA 3MR2A 3LPTA 4B3OA 5EY4A 2J9CA 2P9SB 1PC5A 2B6AB 2PFDA 3HSTB 2OFHX 4G6VB 3VQ7A 3B8HA 3O1LA 3M2VB 2MKJA 3Q83A 2IVNA 1QAXA 3AV9A 1B0VA 3D0PA 2FBTA 3KKRA 3THWB 2XMUA 3CCVS 1SH3A 4NZ0A 2RB7A 5KFUA 2OTJS 2VKZG 4OJ1A 4FZZA 1WC1A 1EIYB 1RT3B 4WKYA 4CZKA 2RIJA 2B5JB 1HQUA 4FF2A 3W5XA 2DNOA 4RPFA 4RUCA 2VBXA 2X1AA 3DRSB 4ED8A 2WRMA 3BZKA 4W5QA 5LMNK 2UXDF 3M6WA 3CDEA 4ZPBA 4KHSA 3THYB 3GSDA 2D0OA 2RILA 2MQOA 1J9AA 1JLGB 3QT6A 2G1HA 3OUYB 4RO0A 1HJRA 2XWYA 4I2PA 4M63C 4LF5K 3MEEA 1XR6A 3QFWA 2RF2A 3VF4A 4A8FA 1WSGA 1SQFA 3G6XA 3VQQA 4CZGA 4U7UD 2R7VA 1IKVB 5DG8A 3NNHA 5LT5A 3EN9A 1I94J 4CJ4A 4IO8A 4ZP7A 3KLGB 4MO5A 5IFMA 2DVIA 4IOBA 1MWYA 2XI3A 1U02A 4RU2A 4LF7J 4ZPWR 1J5EJ 1DZ5A 4KRFA 1RHMB 2JLGA 1N88A 4F36A 4J7CA 3IAYA 3L2RA 1LNQA 1I6JA 1V9OA 4JKDA 4P2XA 5D4PA 3G71N 1YI2S 2J6TA 3J7AP 1VRQC 2DFEA 2ASPA 4Y2MA 3QPIA 3C7NB 4JD2A 1S7HA 3R3LA 1X7VA 2MKCA 2MGZB 1UW9A 1BE4A 1RAGB 2LEBA 4PCQA 2GMHA 5DQHA 2P9LB 1T11A 3V6DA 1X4DA 2KJWA 1UETA 4OMFG 3ZT4A 3IAM9 4IRKA 3ZC4A 5GADI 3MEGA 2FZGB 1K8AO 3R97A 2HVEA 2OSRA 3NGZA 4N41A 1IV0A 5EDWA 2FQQB 1K73O 4CLWA 4ETXA 1TL3A 4DV3K 4WZQA 5AE1A 1O6XA 1FT8A 4FNHA 4K5SA 4I9LA 1T05A 2AEMA 5AQUA 4JYAF 1YBAA 3HI0A 1H1VA 3MMVA 3VZIA 4NLYA 2PMHA 2F63A 4C48A 4Z2XA 5A8WA 4CJLA 2YI1A 4B9QA 3MDQA 2OJ3A 5CY4A 2E7XA 4CK3A 1C1BB 5C7PA 1N34J 1JX4A 5JVGL 2RRAA 1UVIA 3R27A 3GG1A 4M42A 1NKBA 4KH6A 2G8UA 4QBUA 2RQMA 2RDJA 1SL0A 2Q6CA 3TUIC 1Q86T 1BCOA 5G0RB 1B70B 3EO3A 2W2NP 3LDNA 2Q31A 4FJ5A 1KOHA 2EC2A 3FFIB 4FYWB 5J1EA 2Z0GA 1YJRA 2HHPA 3K2YA 2JC1A 3ZTOA 5M2UA 2QTWA 2BKOA 4KHWA 3LALA 3LP2A 3N6NA 1YBUA 2FY1A 5HL7Q 1H74A 1CZBA 2O8BB 4ANDA 1SC1B 4QQBA 3R9LA 1VHXA 2G0CA 4ZS6A 3AA3A 1YWXA 3L7UA 4CZIA 3NCQA 1TP7A 4DSLA 1GTEA 2CADA 3VAKA 1EARA 5HOOA 1FDAA 2XM3A 2YQ3A 3T1YK 3SQGA 4DLGA 2HEKA 4CEBA 2ZBPA 5AQOA 4R25A 3Q8SB 1HYZA 1V5IB 3VWSA 1F6TA 4ECTA 1U04A 2LEAA 1GK8A 5IV3A 5CZXA 1F3FA 2Z4PA 1FDNA 5FIIA 3NG8A 2L3MA 2CGKA 3MMBA 1IBKF 4TQRA 4K4YA 2GUIA 3LOUA 4BWJA 4MKBA 2UU9F 3W2WA 2RS2A 4NCGA 4DR4K 2DK2A 3O9QA 2YHXA 4R8UA 1NH8A 2HLTA 1ZM4A 4NX9A 3TU5A 3O9SA 2ZGYA 3V6KA 1S0OA 2D0BA 1B99A 5I9EB 2E6LA 1N56A 3QT5A 4BR2A 4J9RA 4R5PB 2GVDA 4MIWA 3D7SB 3AVAA 2DCUB 1SKWA 1JKHA 3LP0B 1T8EA 3OYFA 4UOFA 3W0LA 1WC0A 4DR2F 3MPWA 3M2UB 2MKKA 1H7WA 1NRKA 2UU9K 3R3TA 1NGHA 2XY7A 2QA4N 4CYUA 3QGIA 1ZA2B 5CA5A 5EUHA 1NMDA 3KK1B 3ZZYA 3TAEA 2GC8A 4JYAK 5CCMA 2QWRA 3VQ4A 1YIJN 2OHDA 3LP1B 3MK6A 3CD6N 2CQCA 4QWDA 1RWUA 1DQ9A 2Z2MA 1S76D 2YKAA 1U1NA 1A5VA 4EYIB 5LL6Z 2ZE2A 1H2VZ 4RBUA 1VIXA 2FVSA 2XMTA 3O4WA 3UCGA 3EKUA 3POTB 5HROA 4MYUA 1X5SA 2AJ2A 3DM2B 2VQFJ 1U1QA 4A8YA 4OZNA 2Z2LA 1QJHA 4J9KA 4X62J 4ID5B 4KBOA 4CZEA 3CC4N 4CJ5A 3GV7B 1J5OA 1R8BA 5DS7A 4DTMA 4ZCMA 3H46O 2HBRB 1WOQA 1ZH5A 1A6LA 2ASMA 3D3BJ 2HHTA 2DITA 4URQU 4CO1A 5HATA 4OPAA 4AL7A 3ZLJA 2ZH5A 3ZSYA 3MEDB 1F2HA 1O0PA 4CFCA 2JVRA 4DV2J 1U48A 4IG0A 4CJQA 1RCOB 3WX4A 2OMLA 4QU6A 1SUQA 3JTOA 4NLWA 4ZVPB 4UW2A 1BC6A 3OHAA 5HMZA 2PEBA 3QICA 1RDWX 1Q0NA 1TELA 4ZLJA 3BH7B 5D0GA 1W7AA 4CM2A 1O13A 4CO3A 2W9AA 5J1PA 1KLNA 2OI2A 3PHTA 1WKLA 1B64A 1VMBA 2CNKB 4DDFA 4KH4A 2XCAA 3WIVA 5F8MA 5HP1A 1RNHA 4DL5A 4X65J 2C1EB 3WHIA 5DDRC 3ZX0A 3KLEB 1YVFA 1Z2ZA 4UUXA 3K5PA 2OH2A 4WFZA 5KFDA 3A0IX 3H25A 3IFRA 4N7TA 1U1OA 3HVRA 2J6SA 4FWKA 4RW9A 4TU8A 5KGWA 3AJDA 3BSOA 3DAWA 2VG5A 1Q8LA 2BM1A 3RSEB 2J7WA 4JS5A 4DSFA 4C1NI 3QFPA 3HRGA 2HHWA 4Z4IA 2DT9A 3FCVA 2Z57B 3SCLE 3UE5A 1KXPA 4HACB 1AFJA 1ZAXA 2NRTA 2R9LA 3R7BB 2HRUA 3UDCA 4CZJA 4ZPVR 4ED7A 5E5NA 3A8YA 3HO1A 2H65B 2WBNA 1HUXA 3LDSA 2DY4A 2LYVA 3I32A 4BG8A 3ZZZA 4PG4A 4HTJA 3U7JA 2RRNA 5F8IA 2OP5A 4Q5VA 2D3OR 2BGGA 5JUMA 2YKNA 1SB6A 5KFJA 1Y3JA 2WBRA 2HZAA 4MH8A 1BIUA 5ITHA 4W5OA 1SQEA 3CDUA 4R0EA 4C1NK 2Q0UA 4KH5A 2M8HA 3HHLC 3W64A 4R8UB 1LOTB 4ZP8A 1UVKA 3FC9A 3AVKA 1ATNA 3RB3A 4B9MA 3WT0A 2XMAA 4BC7A 3VQTA 3CD0A 2G9OA 4I4BA 2EK1A 5B09A 3G82A 1OSDA 2BUNA 3DLLL 4ZVGA 4ZLPA 1L3SA 4DFMA 1R8PA 3AFGA 3US5A 4OI1A 2FHMA 3DMJA 4O0IA 3BDEA 2HIYA 1X9SA 3L09A 4CDIA 3R5CA 4FK2A 3DXSX 3TVYA 1VQNS 3NCIA 2FJWA 3TVKA 1U49A 2C3UA 4C4WA 3AA2A 3HD1A 4ZJOA 3TTDA 4DTRA 5GVQA 1C1CA 3T6JA 4F2SA 3I6PA 1J6ZA 1OQ3A 4KO0A 1RT6A 2FC0A 1YVUA 1C0TB 3DJCA 3V4IA 1HJOA 4K0KF 4WE1B 2DFHA 3OY9A 1XTZA 1PKUA 3PFOA 4LF2A 3QYYA 3PDNA 4DL3A 3H1VX 2XYHB 2O8EB 4NLSA 3NMAA 3IBFB 2P9NB 5AQHA 3GYGA 4FWLA 1WHXA 1KNZA 1RAFB 4K50A 2FF6A 1TQLA 1GLDG 4LIWA 1MWQA 3ZTPA 4ISFA 5CXTA 3N5FA 1JLCA 3MUMP 5HO4A 1XUPO 5KT5A 4KHRA 3OW2R 1JCFA 4M7YA 3VQ5A 2P1JA 3M8PA 3FEYB 1HI0P 5BR8J 3WX8A 4JI4F 4C0HA 1T94A 3QRQA 4CHPA 4F8RA 2LU2A 1VQ8S 3OLBA 5EGYA 1PYOB 3S3MA 4PR6A 3OVNA 2J7KA 1UPMB 3MFIA 4L75A 1WTFA 3D0IE 4WWSA 3HF5A 2XZTB 4OLOA 4CLZA 4QWCA 3G71S 1YI2N 4DV6K 4Z4GA 1SI9A 1U1PA 3R6MA 3FVYA 1XK8A 4I64A 1U6FA 3TARA 1Q5VA 1RU2A 3CJ8A 3KUEA 2XNRA 3OR1A 4JI7K 2VYPA 2PC6A 3SDEB 4CZHA 1PAUB 4Y00A 1VSMA 4JI6K 4ZK7M 2OPQA 5JMNA 3RRKA 2ZH6A 3SSRA 4JHDB 1RTJA 4J90A 5HBMB 3QJPA 2WSFC 4AHCA 4ZN3A 3TAPA 1U26A 3EL2A 1YKWA 4JD2B 1K47A 2B8QA 3K8VA 5JVHL 2HWIA 5AXKA 2U2FA 1CULA 2QKBA 3CMEN 3E1YA 5CABA 2VC1A 3I9V9 2F96A 3H45C 1SV5A 1FW6A 1XR7A 2KKZA 1EQ0A 3ENAA 3D2FB 4YDUC 3SIPB 2COLA 4NEYA 3IS9A 2BW2A 5J2NB 1UKUA 2OEMA 3EUNA 4KTZA 2GUPA 2FSKA 3IUCA 2FBVA 4IO9L 1NJWA 4KTWA 4DN0A 1Y5IB 1X4BA 1NDKA 1H2UX 4OLPA 1VSJA 4EP4A 2AJ0A 3NS7B 1QE1B 3PEJA 4B9NA 4F4WA 3V6JA 3RMAA 3GE9A 2XNQA 4P7TA 3QJJA 5L46A 2GGPA 4X66F 2MKIA 3PR5B 2HF3A 3M4XA 3HFKA 4MTPA 3MN5A 3CJKB 4WK3A 1GMVA 3UVJB 2GWJA 3GIIA 3VQPA 2GS8A 2KT5A 1Y7PA 2IM2A 2AV5A 2EXUA 3QEXA 3L3CA 2Y0SD 3D6FB 2R8IA 2ZHOA 2VQEF 3HCXA 4DBQA 1W2BM 1LK5A 3KXDA 3CETA 4EZ9A 4LVOP 1Q53A 3LWLA 3QBXA 1X4HA 3CC4S 4NEZA 3QIPA 3M8QA 3KK2B 4OJ3A 2KI2A 3CCSS 4CIEA 3QNNA 5D0HA 2H9ZA 1OJ4A 3SLCA 1FK9B 3SUQA 2V2KA 2XI2A 4USKA 3KK7A 1MDUB 2PAVA 4HH1A 4ZTJA 2CH5A 2JWKA 3BKTA 1FNXH 3SBGA 3GYXB 2PT0A 4KQZA 4H5VA 2LEPA 1S12A 4ZN1A 5HMXA 4ID1A 2IJFA 4MKVA 4N8OA 3L9ZA 2ZHAA 3OL6A 5CH7B 4HKQA 5CYMB 2MZ1A 3K8WA 2IOCA 3WNEA 3OL8A 3SQ1A 3M6GA 4WFXA 3BEGB 3OTBA 3NF8A 1XMQF 4B3TJ 3WIUA 2VG7B 3DHWC 2LU1A 3TQ1A 1CC7A 2AJ4A 5J1EB 1ASUA 3KWGA 3WNFA 2ITGA 3W9JA 5KFQA 3KMQA 4ILLA 2J0SD 1RT7B 1OVQA 2VWJA 4JI3J 2VBWA 1TKTB 1RA7A 1FF2A 3AO4A 3TEGA 4B3MF 2DRAA 2GJ2A 4DTJA 4NYNA 4CLSA 3VQ9A 1FX2A 3RR7A 3OBWA 1IKXA 1HYVA 3MHYA 1RT4A 4FZVA 2DNZA 4FPAA 2FHJD 1HQEB 4A57A 3H5UA 1NK0A 3J8AA 4KAIA 2ZH1A 1TKDA 5T14A 3SBMA 2WTFA 3V9XA 4WTOB 2VQEJ 1JLQB 4HR2A 4DCHA 2VD3A 1WC4A 2YWHA 3O8WA 3OTOK 4OI6A 2NQPA 2DHAA 1DLOB 1URRA 4O5BA 2D1CA 4DR6J 3H98A 3U27A 2ZEJA 1KD1O 2HHVA 3PTWA 1NK4A 3RAQA 3LM2A 1VQ5N 5M1NA 1RTDA 3K7RA 2VV5A 4N8NA 4ECYA 4KBIA 3QERA 2YNIA 3KKSA 4CF1A 5AQKA 2VGNA 3FNNA 5IT0A 1RTHB 1Q18A 1WEZA 2AGQA 1FHTA 2JSXA 4OO1J 3LP2B 2O5DA 2W9BB 4DFKA 2W4CA 2QX0A 2QO3A 3DOMB 4PA1A 1LWEB 2GW8A 2VF3A 5EX0A 1LOUA 3WQPA 2E4LA 3VALA 3AA5X 1ZBLA 3CCRS 3TQEA 3L7OA 2RUGA 4RWWA 4CO0A 1U0SA 5EU7A 3HZGA 2DTUA 2H3GX 3VMFB 1RDUA 1DTTB 2O1PA 3OVAA 4NRTA 2OAUA 3OFGA 1RDRA 2DHXA 3H5SA 2XEXA 4OZJA 4U6PA 2BW7A 3D68A 2ZC3A 1TKXA 4BC2A 3UN5A 5F0XA 1X0FA 2X1GA 4AF1A 4LSNA 1S7IA 5KFBA 3D1HA 3IA0A 3JXOA 3CMAS 2H5IB 3OR2A 3HT0A 2GFFA 3I5BA 2LLZA 3GFZA 4IOXA 4FWOA 1HNIA 4OZ1A 1DKGD 4ZIWA 2M3DA 2ZH7A 4W5NA 4UZBA 4K0KJ 3DXKA 4GC7A 2UUCJ 5AE3A 1N34F 3D28A 2F8EX 2KVIA 4KV8A 4RW7B 1YJTA 4D3GA 3G8SA 1FE4A 3CJTA 2J0WA 4ZCKA 5E0OA 1NH7A 5J2QB 2XHCA 4KRWA 1CC8A 1IKWB 1TL7A 4HHHA 4U8VA 4NCBA 1RTIB 3HD2A 2RQKA 1FWKA 3WNGA 2H4YB 2QFIA 4OPJA 4YHHJ 3C7NA 1P8GA 3JB9k 3AQPA 1WDDA 3FMWA 2M52A 2HS3A 1TFYA 3DYAA 2E7WA 3C14A 3CCQN 2ADBA 4A5AA 4PWWA 1HNXJ 5BRFA 2HBZB 3VQBA 4UQGA 1ULRA 2DGQA 2JFDA 3D1QA 4BR9A 3D66A 1VQNN 1G15A 4UY8O 1M5VC 3DXKB 4LRFA 1VSFA 3PO5A 2DXDA 3RRHA 4X4QA 4J2AA 2D0PA 3QGGA 3J7A1 3CCMS 4LJMA 4K4UA 2E2OA 2R3VA 5J2QA 2FVCA 1UZDA 4B02A 2F65A 4Z7CA 1ZBUA 4DV1K 3WXKA 4U8YA 1S10A 3PJXA 2QWOA 3MM7B 3NWGA 5IOLA 2VUGA 5FDLA 3P3DA 4PXEA 3K9KA 1YZ6A 5JVHQ 5HRSA 4WP8A 1NJXA 1U24A 1GLEG 4NYFA 3KG1A 3S41A 5IS2A 3KJVB 1XBWA 2E6MA 3B6PA 1CG2A 1RHUB 3K2PA 2VDIA 4HWIA 2YPYA 3FZHA 2O3DA 3MPVA 1BWVA 1IKVA 1NLVA 5CD4H 2CJQA 4S0MA 5H1SV 3HL8A 3CJ3A 3DLKA 2DIVA 3DU6A 3OV7A 3VEXA 3VN5A 2OZMA 4MYTA 2YHWA 3FJ2A 2AT1B 4FJ9A 1D3WA 2Q0RA 2DEIA 4XIUA 3UDVA 4HHUA 1HNZJ 2D0AA 5KQ8A 1X4GA 5LMUF 3SUPA 2P5GA 4FK4A 2C2DA 2ZBIA 4WFAQ 3AOAA 1IBLK 1RISA 2VWKA 3MEDA 2BQ3A 4OHYA 2WZ1A 4DU4A 2WB1D 1U45A 2ZM6J 3KNAA 2D0CA 3OSNA 3T1YJ 3TTFA 2IBOA 2DGTA 3UR3C 5B0CA 4TN2A 1Q5YA 4DV0K 4MQ3A 4Q8EA 1WSIA 4H0PA 2HZCA 3KHLA 1N4LA 5GMDA 2E66A 2FPHX 2FSNA 1IBCB 4FKYA 2KHCA 1YTYA 2J8AA 3IWLA 4TKTA 4ES1A 2UVWA 2O8FB 3BN4A 3VAFA 2M70A 4FS2A 3ZT0A 2OLWA 3W2VA 3F5TA 2BACA 4M5DB 4DFJA 3SDEA 3IM8A 1RWNB 1KKHA 1QS4A 3GMGA 4AYBD 2IA6A 2GIQA 1M90O 5THWA 4PYAA 1O1WA 2PYJA 4ED3A 4A48A 3AGKA 3GR0A 3ATVA 5FROA 2DHGA 3AAPA 4EBEA 2E2NA 4BC4A 2AYBA 4WZMA 3HJFA 5AZIA 3T41A 1QQNA 2MGZA 4FJGA 4X65F 3OXFA 1SJQA 1UEVA 1YRUA 4WXOA 1T03A 4DL6A 1FERA 2YJEA 4BS2A 3N28A 5BR8K 4CEOA 1OS5A 3GPAA 3E51A 1EHWA 3GCXP 1WHYA 1Q7YT 4IJAA 4IOCQ 3SNNA 2O8FA 5A0YB 2XYPB 4URGA 3LP1A 3MI7X 1VHFA 3KLEA 3NGYA 1TK8A 2VQFK 3N01A 1H72C 3EYZA 4FM2A 3L2VA 3ILIA 3ENBA 4H0OA 3GZ7A 5E3QA 1WSFA 1TAQA 1WG4A 2AIRB 2X51A 4PABA 5KFWA 2Z1IA 1TKTA 5U47A 5AJ3F 1QQCA 3M32B 3K5MA 2DCLA 2KYXA 2DEJA 1RWMB 2IBKA 3ZSRA 1WSHA 1D5AA 3D45A 3MM6A 4TQSA 3JSRA 4DX7A 3H40A 4X62F 5E3RA 1S1UA 4RKUC 2KN4A 4LFBJ 1NHKL 3G9CA 2AP1A 2AX1A 4ALZA 4V19X 1A7GE 2H54B 2OPSA 1WD6A 5IT4A 3JSMA 2NRZA 1NNDA 2AA4A 4K25A 3DLGA 2IAJA 2RN2A 2NLXA 1CJUA 2CJBA 4EHUA 2IDEA 1GOAA 5IT9Y 2D74B 4DPTA 2XS5A 3AXMA 3W3SA 3PEHA 1TR0A 4FYXB 4WJBA 4DV7F 1VQPS 2MDAA 2OMOA 2L9NA 4LF8K 5GAHP 3DOLA 5C2CA 3B6OA 3MDFA 3N6LA 3QDKA 3NAIA 4DFPA 3L95X 4ECUA 4HI1A 1HMVB 1TUVA 3KLHB 2EVZA 3OUYA 3NWRA 1R3NA 2UZAA 3Q7BA 4M3RA 4BR4A 1ZTWA 4EU0A 2ACMA 2FVRA 4QIFA 5JVGQ 2MKYA 1EKRA 5A8KA 4EZ6A 2JGUA 1JQGA 3SJHA 1TV6A 2CVIA 3ADAC 3VQ6A 3WXLA 4CNYA 4KH0B 1L3UA 2DTJA 4CESA 1F9HA 2UYTA 1WAJA 3A3PB 4KHQA 1HX1A 4EP5A 3UKRB 5B0GA 2X6SA 3OYGA 4WQ5C 4CT8A 2GELA 4I6MA 2N3OA 1ZM9A 2UUBJ 3RW7A 1FE0A 3V1OA 1X1PA 4CJ3A 1UJ6A 4NLUA 2OYQA 1HA1A 3W2WB 2IPOB 1RBRA 3DGPA 1HBUA 5ADXH 3G87A 2D5RA 4Z94A 3OYNA 2V6AA 3QZ7A 1D09B 4KGXB 5FLXO 1AA1B 1RSCA 4L3NA 4NWBA 2YPZA 3MEEB 1WUAA 3I96A 4CZLA 5BYSA 2BDPA 1LEOA 4LF9J 3VESA 3JAMO 3OR2B 4IH5A 3CPWM 3OYAA 1WKKA 2YWWA 2DGVA 1X9WA 1ASWA 4DV3F 5KFIA 1NUEA 1KS2A 5GMEA 1K8AT 1WBDA 5ETVA 3N6MA 4JI0F 5BPMA 3QGPA 4A61A 1NPKA 4X62K 4TLRA 3UD5A 4DTSA 3PW2A 4QR0A 3DU5A 2YWGA 3I87A 4NPOA 4A46A 2DPIA 5CZVA 3ISND 4OX9J 1JXBA 2V9KA 2QFJA 2IVYA 3J81Y 3TPQA 1Z6RA 5AQIA 5IC6B 3FBFA 2LXFA 2GMJA 4RW4B 4OJHA 3NF7A 1RI7A 4A62A 1FJCA 1BMQB 4LRBA 3I56N 1T44A 2XSJA 1SZ2A 2DIUA 2HBLA 3OLAA 4BGAA 3AVMA 5I3UA 4FJLA 3ZX2A 3W7BA 5AR0A 3PSFA 1APSA 2O8DA 1SVDA 3B8AX 2IJNA 4DX8H 5F9LA 2M0GB 3O3GA 1S0MA 2VKRA 4CHZA 4DL4A 3CCTA 3D4JA 4JI8J 4JI7F 4ZOSA 3ILJA 1F60B 3MM5B 3S8SA 3I0RA 4OZLA 2CPFA 3MFHA 2VWBA 4DV5K 2GVZB 3FBEA 2OD4A 4OX6A 3H5YA 4UZCA 4CJ7A 2HOEA 2WONA 2MMYA 1VQ4N 4FJKA 5HLFB 5LMNF 3NF9A 4DQQA 3BYPA 3JYTA 4DUYK 1VSIA 4IKFA 4O3SA 2ATCB 3R7NB 2NNWA 3TAFA 4LUBA 3C6TA 1N5VA 4AT1B 3V1RA 2IGIA 3T6BA 4KE5A 5M1KA 4DMZA 3AVCA 5KOWA 5IC4B 5I3PA 3R9PA 3EY1A 3IBWA 4EEYA 3ENVA 1RBVA 4DPWA 4O3QA 2D69A 4A2AA 3Q7CA 4HHTA 4JI5K 1WOSA 3CWJA 5L38A 1UZHA 4RX6A 1HBNB 2HS0A 1S48A 1DQAA 4MIAA 2QL5B 3GJSB 2PE8A 2CGLA 2BR0A 5F8GA 4DR7J 5HL7L 3EE8A 1MU2B 4V1Ak 4E3SA 1ZAWA 4KKOB 4DI6A 3DLBA 3CCLN 2HNYB 2IJRA 4WKRA 3AVLA 3G6YA 5HQLA 1IBMJ 1ZAVA 4X84A 1XMOF 4WP3A 3GLJA 3Q2TC 4HL9A 3H3OB 2OPSB 2GIFA 3E2EA 4DB3A 1K6YA 3GOIA 2KO1A 2FBXA 2LDIA 3M9MB 4F3MA 4K8ZA 3A2FA 2ALZA 4MJKA 5E3PA 3ICLA 3UB5A 4KHPK 4PYDA 2FVQA 1HBNA 3OR1B 1EQMA 2N82B 2HGMA 1HWUA 5AQNA 3CJQA 2V63A 3I5CA 4E7IA 3DOKB 3DHXA 4HT5A 2ZFHA 1B4SA 5KFVA 1P9YA 4M5DA 2R7SA 3OXGA 1MMNA 3PKYA 3D6RA 4LD0A 1KQKA 4NYPA 1U25A 1HL6A 2CH6A 3LP3A 2YTCA 1WLJA 4TU7A 3SAFA 3MD3A 3C3LA 2JEIA 3UPFA 3KG4A 1A5WA 5BREA 3TEHB 1NK6A 4LFAJ 2VONA 4I67A 4FK0A 3M8WA 4DU8A 2OO4A 1KQFB 3PSIA 5D4OA 4LF9K 2HPUA 3QEIA 3E66A 2BJ7A 1QHAA 4I7FB 3ISNC 4JK8A 4IO9Q 2QM1A 1X9JA 2XG8A 3MMCA 3CHWA 1IJEB 4RUHA 1GOCA 1HNWF 3KOAA 3C65A 2E8AA 2I0XA 5KFNA 5CD4A 2ZHBA 1VK0A 1S1WA 1HWKA 4DS5A 5BRHA 3C8YA 3RBZA 1VRUA 3SPYA 3BO4A 1AZSA 4JI0K 2VG6A 4CHOA 5KFLA 4PPZA 4CD1A 4M3UA 1DY3A 2CPJA 1CBKA 3K9JA 3U4LA 3MWPA 3TZXA 1MROA 4O23A 5AQPA 4FM0A 3TI0A 3VA0A 5A76A 3MD1A 4IH7A 3HMJG 2A40A 1Q9XA 4QOTA 4DV7J 3J81U 2XO6A 3MCAB 1FD2A 4RLEA 3F73A 2CWKA 3RBEA 1VS3A 1RT3A 1D9FA 2FJDB 1X4CA 2CZVC 3RG6A 1RT1A 4BDYA 3NGDA 4OYXA 1JXLA 3R6GB 2P6SA 3SMZA 4LRCA 1MMLA 1DRZA 3BQ2A 2O8CA 3QFHA 1EB0A 3AJ2A 1S1WB 3BBCA 1JXEA 5CYMA 4IR1A 3T1HJ 3KG0A 3THXA 3IMXA 5F8HA 4CI0B 1IO2A 4IOCL 2G2OA 1FRIA 4UOCA 2GMLA 1FO1A 2K8GA 3NGSA 5ETNA 4W5RA 5GAGU 4CP5A 2FB0A 4LFCF 2KQ2A 2ZD1A 1XMQJ 2DH7A 2BANA 4WFNQ