2YKMA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPCLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
total genus 156
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ykmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ykmA05
4F4WA 1CSJA 4ELTA 3KD1E 1D9FA 5KFBA 3HP9A 4CEAA 3ZT4A 1REVB 3CJ3A 2BE2B 3JSMA 4WZMA 1JL1A 3VQAA 5HBMA 4O3RA 4MIAA 2HHWA 3G86A 4KFBB 5HROB 4DTRA 1IKXA 3OS1A 4EYHB 3G10A 2KFZA 4G1QB 4J2BA 1IKYB 3VQSA 4O5BA 2ITGA 1LW0A 4K4XA 4NRUA 5F9LA 5L1KA 3PW0A 4FK2A 3SJJA 2IS3A 5DMRA 1Z4UA 3K5MA 2JLEA 2YNIA 2G8HA 2DPIA 4R0EA 2ZE2B 3V6HA 3H2LA 2E6LA 1L3SA 3BSOA 2JEGA 3IG1A 1WSFA 4KB7A 3KMQA 3T5LA 3F9KA 2JC1A 1S1XA 2UVVA 2V4RA 3OLAA 4QW9A 4U6PA 3NBPB 1NHVA 1C0TA 1FK9A 5FROA 4CFDA 4J2EA 4ED6A 3MEDA 4CEFA 5KFPA 1NK6A 5DG7A 3PV8A 3SZ2A 2BQUA 2OZSA 2HHVA 4WE1A 3RB0A 1IH7A 3BQ1A 1N5YA 3K58A 2WOMA 3KJVA 2FVRA 1JLEB 3VQEA 3MR6A 3OS0A 3OS2A 4DTNA 1R0AB 4RZRA 1KVBA 1LWCB 2HHUA 1NKBA 1TAQA 4DLGA 3HO1A 3ZSYA 4PUOA 1NK7A 1CLQA 4KI4A 3KK3B 4CJRA 4C8KA 4ED3A 4J9MA 5J2MA 1U04A 3GV8B 3V4IB 4I2PB 2IM0A 3DI6B 5KI6A 4IG3B 2X6SA 4KHSA 1HYZA 4OKKA 4FM2A 4DU1A 3LWLA 2QKBA 4KB0A 1SH0A 4CGDA 4BACA 4ZP9A 3PW2A 1YVFA 4CHOA 1S48A 2R8JA 5KFGA 3T3FA 4NCBA 2KFNA 4TQRA 5EDWA 3V6KA 1QAJA 3RMBA 2XRIA 4ED7A 1REVA 4K4ZA 2BE2A 4J9SA 4CJWA 1JLAB 4CHYA 3OYAA 3WNGA 3GIIA 5SWMA 4ELUA 2B5JA 3LZIA 5KFFA 2OPPB 3CDWA 4KFBA 3ITHB 4I7FB 5HROA 1ZTWA 1QSLA 4FJGA 4G1QA 3M8RA 1IKYA 1WLJA 3AVCA 3T19A 4IKAA 2WK4A 1KRPA 2HW3A 4EYIB 4M3TA 1S97A 2XY8A 3IAYA 2ZE2A 4CF2A 4ZTJA 3SI8A 4B9VA 1L3TA 3VA0A 2IJFA 3SUPA 1A5XA 1WNSA 3OYBA 4QWDA 3NBPA 1MMLA 2HNYB 1VSEA 4B8AB 1S1TB 2DFFA 3AVBA 4DL5A 2GIRA 5KFLA 3VQCA 4CEEA 3DRPB 4OLAA 1BGXT 3PW4A 1JLEA 2HMIB 4RW8A 3BJYA 4CHQA 3H4BA 4DSEA 3V1OA 4ZVFA 1YTUA 1IM4A 1R0AA 1BCOA 2VA3A 1LWCA 3VA3A 4FJ8A 4ZVHA 3OLBA 1S0MA 3L8BA 4ECZA 4Y1DA 4CK3A 1NOYA 1T7PA 1IKWB 3KK3A 3I5BA 5F8HA 1SL2A 5KGXA 1HNIB 3BQ2A 3V4IA 5KT2A 2ALZA 4I2PA 4M3RA 4MFBB 3DI6A 1SKRA 4IG3A 1S1UB 4NLQA 4RW4B 3VN5A 1N4LA 3QIPB 2OPQB 1KFSA 1CXUA 4C8NA 4HUFA 4O44A 4CESA 2FC0A 1C2PA 4F4ZA 4AHVA 3FQLA 3HVRA 3SNNA 3OL9A 3OSNA 4BE0A 3S3MA 3O4NA 1K1QA 4CJQA 4Y1CA 2GC8A 2RDIA 4BDYA 2LSNA 2IM2A 4DQQA 1TL1A 3PW7A 1NK8A 3QLHB 3WNFA 2XY7A 1HRHA 2OPPA 1B92A 4Z0UA 3ITHA 3PVXA 5DGAA 2PYJA 1S9EB 1RDRA 1HARA 3MTKA 2YHAA 3KKRA 3T5JA 1S6PB 3NCIA 4R5PB 4KHYA 3SYZA 1JKHB 4CIGA 4TLRA 1VSDA 4K4UA 2DFHA 1RT1B 4FK4A 4AHTA 2G8VA 5HLFB 5SZTA 1T94A 4WXOA 3KLVA 4DU3A 4FJNA 2OZMA 4JUZA 3AVMA 3KLGB 1I39A 4J9NA 4B08A 3CJ5A 1QAIA 1T8EA 4E1NA 3AVNA 4DL4A 4CJTA 2HNYA 3PZPA 3CYMA 3PX6A 3PO4A 4N76A 1S1TA 2HNDB 3KD5E 1KVAA 3AVJA 3M8PB 4O55A 1YTAA 4KHUA 3VQBA 3PUFA 3DRPA 5DG8A 1TK0A 4H8KA 4DU4A 5HP1B 4FK0A 2HMIA 1CZBA 4TN2A 3AO5A 4ZP6A 3AO1A 3KLIB 3C94A 1RT4B 3RMDA 4CJUA 2DTUA 5KFVA 4EZ9A 4NLXA 5F8JA 4DFPA 2OPRB 3WNHA 5KFUA 5L1LA 3RAQA 4F4YA 5E41A 3DRRB 2BDPA 3OYEA 1Q9YA 4EO6A 3RRHA 5EWFA 3G0ZA 3TAFA 5KFZA 2D3UA 2VG5B 3FQKA 5L1IA 1HNIA 1NOZA 1JLQB 4FCYA 3GILA 3CFPA 1S1UA 2RKIB 4RW4A 3QIPA 2OPQA 4QWAA 5DQHA 4IRDA 2G8WA 3LPTA 3ZSXA 4EO8A 5F8GA 4OPJA 2J6TA 2UVUA 1S9GB 4H4OB 3P83D 3H98A 2ETJA 3NGIA 1BCMA 4F3TA 1ZBFA 3OYJA 3NAIA 1HJRA 4HUGA 2XI3A 4ID1A 1NHUA 3TWHA 4ECSA 3OYKA 2R2UA 3QLHA 2AGQA 4DL3A 3QEVA 4F8RA 1TKZB 4E7JA 2YV0X 2J6UA 3OHBA 1EP4B 1S9EA 1I3AA 1RT5B 2D5RA 2VA2A 3Q8PB 5EWEA 1S6PA 4IFYB 4RNHA 1WSEA 4K4YA 3HYFA 2ZKUA 1JKHA 3MFIA 4CFAA 3KTQA 3DM2B 4ICLB 3GQCA 2QXFA 4LSLB 1RT1A 4TYAA 5KFSA 3BQ0A 4K4WA 3B6OA 4BWJA 1XR7A 4ZVEA 3KLGA 3V9UA 1VRUB 3ISND 4DS4A 4FJLA 1D0EA 4EP4A 1NK5A 4IBNA 2KZMA 4LSNA 1VSJA 3AA3A 1NNDA 4M3WA 4OVLA 3SQ0A 2Z1IA 4CFCA 3PW5A 4ED0A 4O3NA 3GIJA 3M8PA 4OKEA 3TANA 1QSSA 4O3SA 3IRXB 2R7YA 3KMSA 1RBUA 2BR0A 5HP1A 3KLIA 1RT4A 2G8UA 4KAZA 3CG7A 3DLRA 1SL0A 3SFUA 1B9DA 2OPRA 3NGZA 4KO0B 4H54A 1RILA 1KTQA 4FJ5A 2PZSA 1RBVA 4EP5A 4J9OA 1ITGA 4RNOA 5KFOA 3P1GA 1JLQA 3IGNA 2RKIA 3DDKA 2YNGB 2FBYA 1RBRA 4LH5A 4DLEA 5CY4A 1EXQA 2IC3B 4IOBA 5HRNA 2YKNB 2A1SA 1S9GA 3HK2A 3HT3A 4DFMA 4H4OA 4KHNA 1T05B 4IH6A 3NGDA 3EZ5A 3RB6A 5C25B 5F8IA 4FJIA 4WFYA 4E7LA 4ECUA 3T1AA 3MEEB 1RBTA 1S6QB 5FRMA 4KTZA 2D41A 2UVRA 2XGQA 1UA1A 2IBKA 4CJSA 1TKZA 1EP4A 1RT5A 3OYCA 4IFYA 4YNQA 2B6AB 1KLMB 3NH2A 3DM2A 4ICLA 4LSLA 3E01B 4TY8A 4W5OA 3H08A 3CDUA 4NCGB 3AVKA 3LP0B 3ZT1A 3LZJA 1K1SA 3RR7A 2PY5A 5KTQA 1L3VA 5KT6A 5JS2A 4C8LA 1VRUA 4QAGA 1SKWA 5KFIA 1RDDA 4JRQA 4J9PA 3E51A 1GX5A 2J6SA 3PJXA 3Q8QB 1HNVB 3OYNA 1Q9XA 4QWBA 3RB4A 3IRXA 3MXIA 5KG2A 3Q8SB 3PX0A 3SCXA 3SUOA 4OPKA 3FFIB 3TAGA 3THVA 4CJVA 4KO0A 1RTDB 3K2PA 4X2BA 5L1JA 2OPSA 1SUQB 3QNNA 2R2SA 2XY6A 5DG9A 4EEYA 1A5WA 5KFMA 2EHGA 4I9QA 1FKPB 1QHTA 4ZPCA 2YNGA 4FS1A 4CECA 2IC3A 3D5MA 3CIZA 4WXWA 5F8LA 2YKNA 1RBSA 4CERA 3OY9A 2BGGA 3H59A 1T05A 2YNHB 4N56A 1RA6A 1VSFA 2OA8A 1RTIB 3LALA 1Z26A 4KKOB 4LH4A 1N6QA 3VQQA 3I8DA 2QK9A 3TI0A 1FXXA 1QUVA 5KFTA 4K4VA 3DOKB 3MEEA 1S6QA 1F21A 1VRTB 4HCBA 4F4XA 4CEQA 3HHKA 4FW1A 3RWUA 3L2RA 1JLFB 3MFHA 4CJFA 4CGFA 1RT3B 4DWIA 5J1EB 2W8KA 1LWEB 3S3NA 2B6AA 4RNNA 5KFKA 2Z1HA 2BQ3A 1KLMA 2E9ZA 3KOAA 4Z4CA 4Q44A 3E01A 4E7IA 2XY5A 1JLBB 4NCGA 4Q0BB 4GC6A 2ATQA 3LP0A 3AVLA 1D8YA 1TVRB 4DQRA 2BRLA 2I5JA 3KHRA 1RT6B 1WSHA 3OJUA 4FVMA 4KREA 4FLYA 1BQMB 3G6YA 5KG1A 4CFBA 1EETB 3MXMA 2VG7B 2KQ2A 3NFAA 1HNVA 5F8NA 4KTQA 5FDLB 4BDZA 4GC7A 4FXDA 1QQCA 1B9FA 4CGIA 2XCPA 4ECXA 3RBEA 1WNEA 4F2RA 3FFIA 3RBDA 3CFRA 4Q8FA 5T7BA 2R8KA 1RTDA 2VWKA 3TAEA 1ZYQA 5C24B 1SUQA 3GYNA 1U49A 2I1RA 1X9MA 5J2QB 4B3OB 3PY8A 5DK5A 2FVPA 5FRNA 1J54A 4O3OA 1FKPA 5HRPA 4O4GB 4DTUA 2IMWP 4FBTA 1U09A 2Y1JA 4NLUA 1VK0A 3AVGA 2X6NA 1X9SA 4BWMA 2DFEA 2FBXA 1HMVB 4M95A 4NLDA 2YNHA 4GW6A 3RAXA 1K6YA 1RTIA 4KKOA 4KE5A 3NF9A 2YNFB 4ZHRB 3K5OA 4JV1A 2B4JA 1BI4B 3M8SA 5KG7A 3DOKA 3HPOA 1VRTA 5I42B 3GV5B 1TKTB 5KFAA 4ECWA 3NAEA 4B9NA 4IH7A 4FW2A 4ZTFA 3HVWA 2JEIA 3QYYA 1JLFA 3RRGA 1RT3A 3M9MB 1DTQB 4KPYA 4FJKA 4IG0B 5J1EA 1EKEA 1WSGA 3AO2A 3HL8A 1LWEA 1W25A 1XHZA 5F9NA 1VSKA 4J9LA 3U3GA 3QIDA 2HHSA 4WYLA 3FRZA 1JLBA 3UIQA 3ZT2A 3BDPA 3N6LA 2V0NA 4O3PA 1S4FA 2PYLA 1TVRA 4BDPA 3SV4A 4NLSA 3KHHA 3OYIA 1FKOB 4RU9A 2R8IA 3OYLA 3L2UA 1RDBA 1BQMA 2WRMA 1GOCA 3DLKB 4EBEA 4RW6B 1X1PA 2HHQA 1GOAA 4CEOA 1EETA 1JLAA 4IRKA 1JLCB 2JEJA 3N6MA 2VG7A 3K59A 3MR3A 5C5JA 4B9LA 4DG1B 5FDLA 1QSYA 4I7FA 5KG3A 2AX0A 2V9WA 3D45A 3SI6A 5F8MA 3G6XA 4M42A 1RDAA 3DMJB 4DFJA 5T14A 3CJ2A 3KLFB 3VQ4A 3CDEA 4FLWA 4K4SA 5C24A 4DTOA 2IM3A 3NH0A 2Z1GA 4E7HA 3ZSZA 3GIKA 5J2QA 4B3OA 4NZ0A 4E89A 3EYZA 3EPGA 2HB5A 2FBVA 4RNFA 2Y1IA 3V6DB 4CJLA 4O4GA 3NAHA 3QEIA 2OH2A 2FVSA 1LAWA 2DY4A 1WN7A 4CK2A 4EBCA 4IH5A 4YQWA 4C8MA 3VQ6A 2ILZA 1TL3B 1HMVA 3IS9B 4MH8A 2B43A 3NMAA 2IJNA 4FJXA 3AVHA 3QGHA 3V1QA 3ICLA 3C95A 3BGRB 2YNFA 4CJPA 1C0UB 4ZHRA 4NLPA 3UQSA 1XWLA 1BI4A 4NLWA 4CGJA 3EZUA 3ISNC 1IO2A 5I42A 1TKTA 1IKWA 2IDOA 1RTHB 2F96A 1SV5B 1WAFA 1S49A 1DTQA 5J2NB 1CXQA 4IG0A 4KV8B 5HRSA 1NJYA 4MFBA 4PA1A 1LV5A 3FDSA 4QW8A 4FJ7A 4IRCA 1HPZB 4CEZA 2FVCA 1T3NA 2C2EA 3LP3A 4DEZA 4F2SA 1NJWA 1RAJA 2JEFA 2NUBA 2R2RA 4FLUA 4AHRA 2C22A 1T03B 4NLYA 3JYTB 2W9AA 3NHGA 4E19A 2A1RA 2FLNA 4O0JA 3NH1A 3DLBA 3H5XA 1C1BB 3OYMA 2R2TA 3DLKA 1ASUA 3KK1B 4RW6A 3AA2A 4E7KA 2P51A 2F8SA 3VQPA 3FSIA 1TK5A 4DG1A 2FLLA 5DGBA 5KRSA 4DSIA 4ZPDA 4K50A 4NYNA 3QO9B 2IM1A 3QGGA 3MAQA 3DMJA 4CHPA 4R5PA 3DLGB 3ZSOA 3KLFA 3MXJA 2XGPA 3VQ7A 2HWIA 5CYQB 3KK2B 1OS5A 4MK7A 1KHWA 1QE1B 5HLFA 4HHTA 4KI6A 2KZZA 3V6DA 3VQ8A 5KRTA 4NLVA 4C8OA 4CIFA 4IR9A 5KG0A 2ASJA 4Q8EA 4DFKA 4QOZB 4MKBA 4N41A 4AILC 1UA0A 4ZPBA 2HNDA 3CJ4A 2P5GA 3V6JA 3IS9A 2AU0A 1XR5A 5EWGA 4JV0A 4UQGA 3G6VA 4DQIA 2AX1A 5KFXA 4I2QB 5KFHA 3QEWA 3BGRA 1BIUA 1C0UA 3CQ8A 4Q5VA 4CIEA 2XCAA 3QEPA 2X74A 3I5CA 4TXSA 3AO4A 2HHXA 4BE2A 4CCHA 3EPIA 1EX4A 4DS5A 3LWMA 3DRRA 4W5QA 4AHCA 3U3YA 2YHBA 3OYGA 4L8RB 1RTHA 1SV5A 2VG5A 4DMNA 5KFCA 3K5LA 3QESA 4XO0A 4KBIA 2HVHA 4K8XA 4ZPAA 4J9QA 4B8CA 5EU7A 2HVIA 3S9HA 4KRFA 1T03A 3JYTA 4LQ3A 3KHGA 2O4GA 1S1VB 3LAKA 5KFJA 3TAMB 2V4QA 1S1XB 4FLVA 4B9UA 1C1BA 1XC9A 3KK1A 5KFQA 3RMCA 4M3ZA 1RTJB 4FM0A 1BISA 1KLNA 1IG9A 2VG6B 2JGUA 4XPEA 3LAMA 4LQ9A 2W7OA 3LDSA 2W9CB 4CF0A 1N5YB 3QO9A 3DYAB 2UVWA 4OLBA 1GX6A 3V81B 2IOCA 4KHMA 3TAQA 4URGA 1QS4A 1A5VA 2RDJA 4YR3A 1TP7A 4GMJB 5KFDA 5CYQA 3KK2A 3M8QB 3KLHB 3NF7A 2R8HA 1QE1A 4IQXA 1D9DA 5J2PB 1JXBA 1SH3A 2WHOA 2E9TA 1TAUA 3TAPA 2QKKA 3SQ2A 1BQNB 4IDKB 3CWJA 1LW2B 2WONB 4FLZA 4FJJA 3SUQA 3V1RA 4URSA 1SH2A 4YFUA 3QINA 4CJEA 1RT2B 2XC9A 3BSNA 1IKVB 4M94A 2GIQA 2O4IA 4I2QA 3T5HA 3HPGA 4W5RA 1N48A 2WTFA 4DSKA 3O3GA 4Z4HA 1I6JA 4DTSA 4M3UA 1UWBB 3AA4A 3Q8RB 1JIHA 3BSCA 3ZSRA 2B5JB 1HQUB 1DLOB 4KAIA 1HQEB 2QV6A 2FJXA 3MF5A 4QWEA 3MR2A 4CJ5A 3VQ9A 2ILYA 4Z4EA 3ZT0A 4B9TA 4NYZA 1L3UA 3UPFA 4RUAA 2AQ4A 3AVAA 3BSAA 3C6TB 3OL7A 1KVCA 3LP2B 2BQRA 3OYFA 1VSMA 1KCFA 3QNOA 3HVAA 4DL6A 1C1AA 2OYQA 1RDCA 2EX3A 3OVNA 4MQ3A 1S1VA 2ASDA 3TAMA 1S0OA 5C25A 4FJ9A 1RYSA 4KTWA 3MECB 4I9LA 4OGEA 3PO5A 5JXSA 2F8TA 1U47A 4FM1A 1RTJA 3MEGB 4K8ZA 2VG6A 3L3VA 2BANB 4AHUA 1NK0A 2ASLA 4W5NA 1JXLA 3KLEB 2W9CA 1J5OB 3NDKA 4Y34A 1S9FA 1XHXA 3DYAA 3UDLA 4RW8B 3V81A 4YP3A 4IR1A 4DSJA 3BREA 1JL2A 1C1CB 2D3ZA 1L5UA 3M8QA 3EY1A 3KLHA 4M45A 1NK9A 2G8FA 5J2PA 2XI2A 3KHLA 4F50A 3L2QA 2W42A 4CJKA 1ZTTA 4EZ6A 1BQNA 3N6NA 3C6UB 4IDKA 2XWYA 4HKQA 1LW2A 4YR0A 2WONA 3HM9A 3RTVA 2WCXA 3HPHA 1Q8IA 4O44B 1KHVA 4O3QA 2XO7A 4QCLA 3M9NB 1S1WB 1RT2A 4HYKA 1BL3A 1IKVA 1TK8A 2W9BB 2HNZB 3ZSVA 4CGGA 3QGIA 4FBUA 1KSPA 4ECQA 5D3GB 4ZVGA 2G8KA 4LY7A 3AA5X 2QE5A 3AVFA 4XIUA 1UWBA 3U6FA 3BR9A 1G15A 1TL1B 4Y3CA 5JUMA 3NF8A 4ECVA 2UUTA 2R8GA 1ZBUA 2W7PA 1HQUA 3TQ1A 4TQSA 1DLOA 3KNAA 4TYBA 5K14B 1HQEA 4DQPA 2HWHA 5KT7A 2XHBA 1ZETA 4ED2A 3ULDA 2E4LA 3ZT3A 4QWCA 3C6TA 5KFYA 5DQIA 3LP2A 4HCCA 4J2AA 4EBDA 4FJMA 1ZBHA 3HP6A 2FVQA 1YVUA 4XPCA 3D0PA 5EUHA 4W5TA 1RT7B 2WB4A 4BE1A 3CVKA 4NYFA 4RW9B 3NL0A 3O3FA 3RB3A 1HYVA 2D0CA 5KFRA 4RUCA 3MECA 5C42B 2JC0A 3V9WA 4Y2CA 5KG6A 3HSTB 1NKCA 4DTXA 1ASVA 3MEGA 4AH9A 4QPXA 4HVJA 3CJ0A 3HVTB 4NLTA 1JXEA 2BANA 3B6PA 2AGOA 3KLEA 4JS4A 1J5OA 4PWDB 3RR8A 4MK8A 4JV2A 1DTTB 3O3HA 1Y97A 1C1CA 4FYDA 4RW7B 1W9HA 3L3UA 3L2WA 4GVMA 2RN2A 1BIZA 5L9XA 5KFNA 3L2VA 3IN5A 4OL8A 2RF2B 3SUNA 4Q0BA 4IKFA 4KSEB 3H5SA 5JS1A 3LP1B 4NRTA 1RT6A 3C6UA 4MIBA 4URQU 1ZBLA 4DTMA 1O1WA 2AJQA 4J9KA 3RMAA 1WSJA 1TKXB 4NCAA 2FJVA 1W0HA 5CYMB 3VQDA 4CE9A 1XR6A 1S1WA 3H5YA 5KGWA 3NE6A 1JLGB 2W9BA 2HNZA 3QZ8A 3I0SB 5I3UB 3I5AA 2C2RA 1ZBIA 4MK9A 3KIOA 5D3GA 3ZSWA 2X78A 4F4KA 1SL1A 2D0BA 3CFOA 4DQSA 4KHRA 3OL8A 4R8UB 3SV3A 4CJ3A 2GV9A 5K14A 3QEXA 2G8IA 2VWJA 4WZQA 4H4MB 1GOBA 2F8EX 2BRKA 4N47A 3T5KA 1J53A 4KB1A 1TQLA 4WYWA 4IFVB 4DSLA 4Z4GA 5KT5A 3VQ5A 4LD0A 4ELVA 1YT3A 4Z4IA 5HRRA 1QTMA 5KG5A 1VSHA 2UUWA 3OL6A 3LANA 3AVIA 3HKWA 1RA7A 2DPJA 1RT7A 4RW9A 4AHSA 1S0NA 5KFEA 4FS2A 4HUEA 4ECTA 5C42A 4NLRA 2Z1JA 3QETA 4JLHA 4ECRA 4LSNB 1WSIA 1CZ9A 3TABA 4E0DA 4JS5A 1LWFB 3HVTA 4YMEA 2KW4A 1MU2B 4K4TA 4JRPA 3DLEB 4N5SA 2YKMB 3DRSB 1HYSB 3ASMA 4O0IA 3O4QA 4PWDA 3A2FA 3QIOA 1DTTA 2CJQA 4RW7A 4ZMMA 4TSXA 4J9RA 2D0AA 1U48A 3H5UA 4FJHA 3PX4A 1C0MA 4PQUB 5DLGA 2RF2A 1UOCA 3K5NA 3DOLB 4DL2A 3TR8A 3KKSA 3IGVA 3SPZA 1RNHA 3PHEA 2AGPA 1D1UA 2O5DA 4J2DA 3LP1A 1FKOA 4CHZA 4M3YA 4DTJA 4E1MA 4OJRA 1TKXA 2FBTA 1U4BA 4WFXA 3V9ZA 3SQ4A 1U45A 1JLCA 2KTQA 5CYMA 3NGYA 3HXMA 3H4DA 1C6VA 1JLGA 2GBZA 4CF1A 4TY9A 3I0SA 5I3UA 2CKWA 3OHAA 3CM5A 1TKDA 1NJZA 3OYHA 2IAJB 2W8LA 4ID5B 3I0RB 3AV9A 3H40A 3QERA 1TV6B 3UR0A 4MKAA 4R8UA 3DLHA 3S3OA 5KG4A 3NF6A 1X9WA 4HTUA 2C2DA 1VSLA 1BHLA 3SPYA 3TVKA 3MR5A 4B9MA 1S5JA 4M41A 4FZYA 4Q45A 3F73A 4H4MA 2ZD1B 1XI1A 4IFVA 2ATLA 1TGOA 4FLXA 4B9SA 4TY8B 4CEDA 1TL3A 1S10A 3OSPA 1VSIA 4O4RA 2HAIA 4FLTA 4CK1A 4YR2A 4RNMA 4NLGA 4KHWA 4CHNA 1KFDA 1SKSA 2E6MA 2Q3SA 3SFGA 3JSMB 5KT4A 4DTPA 4FZZA 2AWZA 5HBMB 1NKEA 4ED1A 3ZCMA 1NK4A 1LWFA 2ZQBA 1MU2A 2IGIA 3DLEA 4DL7A 2YKMA 3DRSA 1HYSA 1IKXB 4Y2AA 3AO3A 4CF8A 5J2NA 2EC0A 4Q43A 2P1JA 1NJXA 2RPIA 4KV8A 1LW0B 3D28A 4DF4A 3NKYA 4RG8A 3GV7B 2YNIB 3HJFA 1HPZA 4Z4FA 4ZP8A 4PQUA 2IA6A 4ECYA 5DQGA 3PR5B 2OPSB 1J9AA 3DOLA 3TARA 2P5OA 4WFZA 3M9OB 3IG1B 3OJSA 1WAJA 1N56A 5CZ1A 4F3OA 1JX4A 3PR4A 1C0TB 4CF9A 1FK9B 4FZXC 4DSFA 3WNEA 4G3IA 3MEDB 5DLFA 1D5AA 2C28A 3V9XA 3CO9A 4WE1B 3V9SA 4OKJA 2GUIA 4PY5A 2WOMB 3KJVB 3SQ1A 1N6QB 1RYRA 1UAXA 3OYDA 2IAJA 2FJWA 4ED8A 1ASWA 4ID5A 3I0RA 4ZP7A 3DLGA 2D7SA 1TV6A 1RCHA 3ZSQA 3PJWA 4CJ4A 5KFWA 1Z25A 4PUOB 3QZ7A 3K57A 2FLPA 4M3XA 5KT3A 4KHQA 4CGHA 5J2MB 2ZD1A 3P5JA 5CZ2A 2HHTA 1LAVA 3ALYA 4DF8A 2E9RX 4OGCA 3CM6A 4NLOA 4E3SA 3LPUA 3GIMA 4U7CA 4CEBA 2I5JB
chains in the Genus database with same CATH superfamily
2ADBA 3R1XA 4B3MF 1JJ4A 1CULA 3KD1E 4USIA 2NLXA 3HP9A 1NSAA 4BRCA 4CEAA 3JSMA 3F2KA 2Y1LB 3EZOA 2FZCB 2ZHOA 3QGPA 1IKXA 3OS1A 3G10A 2KFZA 4G1QB 3R1HA 4JI3J 1RU2A 4OI2A 2ITGA 5L1KA 3MK6A 4ZVOB 3EGNA 3A3NB 1NGIA 2QL5B 2C2KB 2LQBA 3PXGa 5HN0A 3MM7B 3JB9k 2O8DB 1X5SA 4DV6J 2E6LA 4LRFA 2JEGA 3IG1A 4J9UE 3NGKA 3FBBA 1S1XA 5L9NA 3SSSA 2ZH1A 5E3AA 4LF4K 1NHVA 5FROA 1XN9A 3MEDA 1DHMA 1NK6A 2OZSA 4WE1A 3VQEA 3ZX2A 3OS0A 2BUPA 4LF4F 2OEJA 1YBTA 4YDUC 1LWCB 2HHUA 1XNRJ 5E84A 4G1IA 1TAQA 1X4DA 2E1CA 3HO1A 3CCUN 4F3MA 1WKLA 3KK3B 4PG6A 2DIUA 4CJRA 1U26A 3SJHA 4ED3A 3MMVA 5J2MA 3HT0A 3V4IB 3GV8B 3VF6A 5JLHA 2IM0A 3VEXA 4PWWA 4KPCA 4DPOA 4RL1A 4ILHA 1HLWA 1L3KA 3UW1A 4USWA 1J5EJ 2X1FA 4OKKA 4DU1A 2XSJA 2QKBA 5ETVA 1SH0A 4CGDA 4ZP9A 2XMUA 5D78A 4LSZB 1UPMB 1S48A 4IOXA 1DRZA 3T3FA 4LVOP 1YI2N 3O1BA 2PT0A 3GG0A 3UN5A 3WZ0A 2FF6A 4ED7A 2A42A 2N7CA 4DL0C 1IWGA 3QJLA 2EG2A 5EY4A 4CHYA 3R7NB 2DY9A 3VEZA 3OYAA 2HZCA 3G82A 5SWMA 4ELUA 3WIUA 4MLEA 2OPPB 1QTNB 2XHCA 3HULA 1C0FA 1Y9OA 5AE1A 5IM0A 2XYGB 3CCSN 3AVCA 2YWGA 3T19A 3Q22A 1QY7A 3HCXA 3M32A 2QA1A 4M3TA 2XY8A 5HI7A 5L39A 2ZWPA 2ZE2A 4JI5K 3SI8A 3JS6A 3W2WA 2K06A 3QAEA 1A5XA 1QVGR 3M6WA 3Q2TC 1FJEB 2J0QD 3NBPA 2HNYB 4B8AB 1S1TB 5E3RA 4DPXA 3AVBA 2RHSB 4JI5F 3MUVP 3PW4A 4ES3A 2HLUA 4OZ1A 4I1TA 4M7XA 3ZZRA 4ZDNA 1YTUA 3D3BJ 1IM4A 3KJNB 2YWWA 4WFAL 2QTWA 2OTJS 3OLBA 1YJWN 4ECZA 3JXUA 4NZ7A 5IV4A 2V8VA 3I5BA 4JKEA 2F9DA 1YBAA 1HNIB 2ALZA 4I2PA 1RAIB 2MQLA 4A8OA 1N4LA 3WC0A 5M2UA 2OPQB 4GNIA 1KOHA 3CJCA 1CXUA 2MKCA 3POTA 5IT9Y 2GX9A 2J8AA 2FC0A 1C2PA 4F4ZA 4AHVA 4PKDB 3GJRB 3NNAA 3UKUB 4BC3A 4BE0A 5D0GA 3AHPA 2GC8A 2P9NB 4GY2B 4LIWA 2UXCJ 5GAGP 1Q5VA 2ZM6J 3PW7A 1RWNB 2W4CA 4OZ5A 3ZNJ1 2GWKA 2PYJA 3R2CJ 4M5JA 1RDRA 2NNWA 3KKRA 3W8GA 3UO0A 3I9ZA 2F65A 1S6PB 2FB0A 1VLOA 3CJQA 4KHYA 1JKHB 1WORA 2HFUA 3AXKA 4TLRA 1VDHA 1X4GA 4K4UA 3NLCA 2DFHA 4ILJA 1RT1B 4HDGA 5HMXA 3H6EA 1FDAA 2G8VA 1KNZA 2RJZA 3OVBA 1T94A 4CWBA 1R89A 3KLVA 4DU3A 3IR6B 4DX6A 5AFUA 2VQFJ 4DR2K 5T7LB 3CJ5A 2QSWA 2IY5B 3L7OA 3R9LA 3IBCB 2I0XA 2Q66A 5EXWA 2PMZD 1SPBP 2CQGA 1MROB 1VQON 1UVJA 4HH1A 1XNQJ 2OTLS 1TK0A 4DU4A 4DR2F 2HMIA 4TN2A 3AO5A 2POKA 3G25A 3VAHA 3L09A 4EZ9A 2NXCA 1P9YA 2AYEA 5L1LA 3RAQA 4F4YA 2BDPA 5EWFA 3G0ZA 2AYBA 3FQKA 3NS5A 4FCYA 3CFPA 2DGQA 4RW4A 5IS2A 1F0XA 4ZS6A 5TKYA 2RE1A 2L9WA 3UNGC 4OPJA 2AT1B 2V5HG 1UVKA 4BGBA 1SJQA 4A61A 2UVUA 4X66J 1JK9B 2FUG9 4F3TA 1ZBFA 3NAIA 5A0YA 2RE2A 2XI3A 4KH6A 4GO5X 1B3TA 3BGOP 2B7BB 5LXYA 3MCNA 2EFOA 3BH7B 2EG1A 1UETA 2YV0X 6AT1B 1EP4B 1SIWB 3W5ZA 2GEMA 1X4AA 1I3AA 2D5RA 3Q8PB 3MOZA 4IFYB 4DV2K 3DOMB 4CFAA 4R79A 1UCNA 3DM2B 4IDHA 3CERA 2Q6CA 5KFSA 4BWJA 2Y0BB 3P31A 4YOWA 3PG9A 3CPWM 4IO9L 1N5VA 3KLGA 1VRUB 3RSEB 2M4MA 1YHQS 2JSXA 2F1FA 4DV2F 4FJLA 3NWRA 3I9V9 3FZ2A 2KZMA 3SSQA 4HHJA 3AA3A 1RB0A 3BYRA 1MWMA 2Z1IA 4O3NA 1QSSA 2R7YA 2ZZMA 5CR4A 3KLIA 2IMOA 1OH8A 1PG5B 1RLDA 4W90B 1WHVA 2OPRA 3LDOA 5KPZA 4FJ5A 1RQ0A 2R9LA 2P5VA 3A12A 4IEIA 3J81Y 2RNEA 2B4OA 3CD6N 2RKIA 3PIOQ 3K2YA 2MPUA 4PZVA 2HPUA 3R3LA 3B4DA 3DWLA 3HK2A 1S9GA 4H4OA 1T05B 4IH6A 2V50A 3MAHA 3EZ5A 4BR4A 5C25B 1LFPA 2K7JA 3MWPA 3ZZPA 1SQEA 3T1AA 5EX3A 1S6QB 2D41A 2ZOGA 1TKZA 1RT5A 4Q7AA 3R5JB 2HIYA 1IM6A 4JP8A 2B6AB 1KLMB 1FESA 1IR1A 4LSLA 4TY8A 1OJ4A 2EBGA 2QEXS 4NCGB 4NO7A 1FRXA 4U67L 3AVKA 1RBAA 2DHXA 2J5AA 1JXVA 4B1VA 4B02A 5KFIA 4UW2A 3A8IA 8ATCB 3C7NB 3X3UA 1KAXA 4JD2B 1PO6A 2Z4PA 4CZKA 2GHWA 3GU0A 4TU7A 4DMZA 3OYNA 1Q9XA 4QWBA 4RUBA 3IRWP 3DXKB 2D69A 3MXIA 2KT3A 3R6LB 3JTOA 4LF6K 5GVQA 3PX0A 3RRKA 2CGLA 2HBKA 4JV5K 2K1RA 2L3MA 3UVJB 3LOUA 2E8AA 3PFOA 3QB0A 2KKZA 3NS7B 3CMES 1VFJA 2W24A 5IT4A 1NJIT 7AT1B 3UDVA 3DLLL 5DG9A 1A5WA 5KFMA 1N32K 4LF6F 4ZPCA 4YY3K 3CD7A 1H72C 4P75A 4JV5F 2ZGYA 5T41A 4A8WA 1FVQA 4LF9J 1H1VA 4WXWA 4I6WA 3CHWA 1ZBTA 2LQ5A 3J80U 3H59A 4H03B 3SK3A 2X7IA 2YNHB 4K0KJ 5HL7L 3FE1A 2BM1A 1NCLA 4G6VB 4FF2A 3H1VX 1N32F 4LH4A 1UZDA 4YY3F 1QLNA 5KFTA 1JCEA 4ID8A 1AUSL 4J91A 1BQXA 1VRTB 3KJFB 4UY8T 2ZH8A 2P6SA 3T6BA 4DZ6A 1JLFB 4ISGA 1XC3A 4USKA 4CJFA 4DHVA 1RT3B 3KYLA 3E9OA 5JMNA 1LWEB 2HMPA 2E9ZA 2DNKA 2CH6A 2NYIA 2XM3A 1P8ZA 3E01A 4JB8B 3EEQA 4ZN3A 2XY5A 1FHTA 4NZ6A 4BR9A 2D1KA 5BR9A 3LP0A 2MSTA 3SDEB 2YWHA 1TVRB 3CO0P 2MZJA 4RPFA 2DYAA 1CJVA 3OJUA 2E5HA 2MQNA 4KREA 4FLYA 1BQMB 3G6YA 5KG1A 2AW0A 2VG7B 1N33J 4GMKA 1H2UX 3KUGA 4KTQA 4BROA 1QQCA 2DEIA 1B9FA 2QTDA 2F8HA 1VS3A 2ZH3A 3Q0AA 1WNEA 2DHGA 2X51A 4PG5A 3TZWA 3RBDA 1QZ6A 3QWPA 1RTDA 3TAEA 1YTYA 4BRDA 4ANDA 4WCEL 4KHPK 1SUQA 3GYNA 2I1RA 1X9MA 2FVPA 2DITA 1E6VB 3M3ZA 5HRPA 5D4LA 3IMQJ 2UUBK 4DTUA 1YAGA 4AM6A 2RRNA 5F41A 2Y1JA 3ISZA 4NLUA 4R0JA 1X9SA 4BWMA 4KHPF 3NVKA 3HOSA 4FPIA 2M9KA 4X62J 4WQ4C 3CCQN 1HW9A 2YNFB 2HFSA 2UUBF 2YWFA 1PCAA 5AZIA 3DOKA 2HFNA 3D6FB 1MG7A 2E5GA 1QDUB 2PMWA 5I42B 2IRUA 5FLXO 2RQMA 4FW2A 3HVWA 2YX4A 3Q89A 2OKQA 1AB8A 2Q36A 4JI3K 3M9MB 2RS2A 4YB7A 2OSQA 2BOPA 3SSRA 1EKEA 2RIJA 1TYQA 3AO2A 1VSKA 2DR6A 4WYLA 1CC7A 3D0GE 2ZOMA 2DR9A 3AGRA 3N6LA 5D4NA 2V0NA 2QMUB 4O3PA 4EIAA 1DFDA 2AZ3A 4BDPA 4JI3F 2GELA 3SV4A 4NLSA 3KHHA 4CYUA 5BYSA 4OPHA 2GTDA 4EBEA 4RW6B 1R59O 1X1PA 2Y8YA 4CEOA 1EETA 1U0SA 1I3OB 1JLAA 2FHKA 1JLCB 3N6MA 4JEPA 3FEYB 3THWA 2V9WA 5EN1A 1KAYA 2IJRA 1UTAA 2WVCA 2V2KA 1TTHB 4M42A 2GO8A 2ZC3A 5AQGA 3KLFB 4I64A 2Q0UA 1XNRK 2GGPA 5C24A 2IM3A 3NH0A 2AEJA 5JJBA 2Z57B 3CUNA 3EPGA 2FBVA 4K5SA 2HBRB 5C15A 4DUYJ 2XLIA 2B51A 3LDNA 4CW7B 3QEIA 2O8FB 2KO1A 2KFYA 2HBQB 1KDNA 1J5EK 1XNRF 1HWUA 6FDRA 4YQWA 2ILZA 3T7ZA 1ZBSA 2DNRA 3QGHA 3V1QA 5ETLA 2Y0SD 2ZC4A 3WDOA 1A7GE 3C95A 1C0UB 3O8MA 4GKKF 2Z58B 1VQSA 1BI4A 1J5EF 2A3ZA 1IO2A 4C3MA 3PACA 3ZEUB 2J8SA 3GMGA 4LFCJ 1QVGM 2R7OA 1IKWA 2JFDA 1CXQA 4IG0A 1PC5A 3BM7A 4Y2MA 4CLKA 3AA8A 3ID6A 1NJIO 2CQ2A 5GADU 1T3NA 1T9WA 2JEFA 1T03B 3L95X 4AL7A 3EM1A 4GRSA 4O0JA 4CH7A 4C8YA 3DDNA 3DJCA 4MYUA 3E1YA 2H1YA 2GQCA 3P5TL 1GFWB 1VYAA 4W4MA 2QFJA 3W5XA 4NOHA 5B08A 2GVDB 4WFAQ 2KKHA 4B1UB 4ZPDA 3KWGA 3NS6A 2A1BA 2BM0A 2IDEA 5HMWA 3MAQA 1Q16B 2NCKL 3N5FA 3DMJA 1NM2A 4R5PA 4UY8O 3SLCA 5CYQB 1SXLA 3RU0A 4KH1B 1OS5A 2VFRA 3TZYA 3JTNA 1NGCA 1QE1B 2QA2A 3UKRB 4YDDB 2FQQB 2YCHA 4ZITA 1VC6A 1NB7A 4PQAA 1R8BA 1U0HA 4NLVA 5LOQA 4C8OA 4CNZA 1RUSA 5CCLA 4MKBA 4A8XA 1WG1A 2WTUA 2GW8A 4ZPBA 2HNDA 1V4SA 2E20A 1AXQA 1M90T 4ZCKA 1OY8A 2GZOA 1GAOA 1S5ZA 1MWZA 5EWGA 2PC6A 4DQIA 3G6VA 1IJEB 3E3XA 1N5SA 3QEWA 1BIUA 2UXCK 4UOGA 5AJ3J 3QEPA 3I5CA 4N7TA 2ZM6K 2NXUA 4FPBA 1MN9A 3CETA 1VMBA 1YJVA 3E8OA 3LWMA 3DRRA 4DZDA 4L8RB 1RTHA 2QWOA 1G6BA 1FRKA 2VCPA 2UXCF 4YDXA 2I38A 2ZM6F 3QESA 4FWOA 2HVHA 1WDTA 5LJ5Y 4ZPAA 2GA7A 5EU7A 3VV2B 2L08A 1HLUA 2GAGC 2VQFK 3KHGA 3H46O 3PTWA 4FLVA 2DRBA 2O8EB 5AQPA 1YZ6A 3U4LA 1RTJB 4F25A 4B9QA 2CGJA 2W01A 4FM0A 4GKJJ 1HBUA 1IG9A 4XPEA 1XNQK 4LQ9A 3L4QA 2VQFF 4YOXA 1N5YB 3QO9A 1S59A 5FPEA 1GX6A 2IOCA 2B9WA 4URGA 1QS4A 4YR3A 1TP7A 1FDBA 3R5DA 3M8QB 2GVZA 3IWLA 1WSVA 5AZJA 2CFXA 3TUJC 1SH3A 1XNQF 2E9TA 1TAUA 2ABYA 3B4MA 2OLWA 2QKKA 3SQ2A 2WONB 3AD7C 4LF2A 2KVQE 2MZRA 3A5LC 9ATCB 2QWLA 5H1SQ 2CQBA 4X66K 1XIQA 2P9IB 1RT2B 5E0OA 3BSNA 4X4OA 4BLGA 5A76A 3PIPQ 3HZGA 4Z4HA 2H3GX 2F9TA 2YTCA 4M5DA 1JCFA 1BD6A 1GXTA 2B5JB 4X66F 3AGKA 3B8AX 1BMQB 2AKWB 1AZSB 2H5EA 1WHXA 4Z4EA 4O8UA 2QA4N 2I8EA 1HD0A 2C3UA 3BN7A 3KVGA 3ZT0A 3MEKA 2HS4A 3BSAA 4IO9Q 1IQZA 4USVA 2VASA 3H45C 3LP2B 2G2OA 2BQRA 4M5KA 1VSMA 2E5LJ 3QNOA 4Y28C 3UD3P 3LPYA 2VL1A 1RDCA 3HFVA 2EX3A 1S1VA 2ASDA 1S0OA 3IFRA 2CNNB 1MDUB 1BUXA 4KTWA 1P6TA 1T95A 4X4RA 1HNZJ 3PO5A 2HSTA 3ENHA 2YH1A 3I56N 3IR5B 4ZA1A 3TP2A 4I67A 1V4TA 5AXMA 2HVDA 4K8ZA 1OQ6A 3IP0A 2NRZA 3L3VA 2NXNA 4AQYJ 2ASLA 4W5NA 1J5OB 3NDKA 3TQEA 4AM7A 5CD4H 3UDLA 4KGXB 2PIIA 2F3JA 4FYXB 1RAOA 2D3ZA 1L5UA 1KQFB 3BDEA 3EWGA 1NK9A 3N4PA 3KHLA 4F50A 1ZPVA 4A5AA 4TU8A 4WBFA 2V4JB 3L2QA 2N4DA 1UJ5A 4EZ6A 3G6ES 1VQLS 4PAAA 3B78A 1J2VA 4HKQA 1LW2A 3OXGA 2WCXA 3W63A 1Q8IA 3R7SB 2NZ4A 3DXSX 4O44B 3FZLA 1X7VA 5C12A 1VQ8S 2ASYA 1YG0A 3L9ZA 5IT9U 3ID8A 3ZSVA 1UP1A 4ECQA 5KOXA 3CCES 4LY7A 5G0RA 4FWRA 3AFGA 3VAFA 3CC4S 3NF8A 4DI6A 2R8GA 4Q2LA 3GPAA 2W7PA 5DM7Q 3BR8A 3J7AN 4EI2A 5C2GA 5K14B 3R1LA 1HQEA 3IR7B 3VHQA 2WVFA 3BZQA 5KT7A 2HQIA 4U67Q 1RFQA 3ZT3A 4U7BA 4RO0A 2DNOA 2HBLA 5KFYA 5DQIA 4MO5A 4HCCA 4EBDA 4B3TJ 3HP6A 1DBDA 3OVAA 4W5TA 2HZVA 3M2RA 3O3FA 2VF3A 1HYVA 2D0CA 3BF3A 3MECA 2C2NA 5E2QA 2IVYA 4Y2CA 5KG6A 1CQNA 1ZS6A 1M90O 1ZZFA 1NKCA 4F0KA 3OR2B 2ZWHA 3MEGA 4QPXA 1F2GA 4HVJA 3ILOA 5F2RA 2BJ1A 4A8MP 2BANA 4ITSA 4CLFA 4JS4A 2MQOA 3GZ7A 1VQ7N 4M7YA 3DLLQ 3TX8A 2MQPA 4JV2A 3O3HA 1Y97A 4FYDA 3L3UA 2GX8A 4M5GA 4JKGB 2RQKA 2P8IA 3L2WA 1KOOA 5LJVA 2RN2A 2CQDA 5KFNA 2FY1A 2RF2B 3CCJS 4Q0BA 4NE9C 2DH7A 3AB2B 3O2IA 2KDOA 3HD2A 4ZJOA 4D3GA 3MD3A 2KT2A 3C15A 4LF9K 2VQEJ 4KGVB 4RKUC 3CCTA 5BRDA 4CZIA 2OD6A 1OYDA 1S1WA 1RAHB 1PAEX 4USUA 4Y2KA 4K0KK 2V2ZA 5THWA 1JLGB 2MEWA 2W9BA 4PXCA 3I5AA 5I3UB 2DO4A 3OXLA 2HQ3A 4ETXA 2X78A 2HFOA 4ILMA 4LF9F 1JCGA 3ONQA 4DQSA 1BLUA 3SV3A 2XZWA 4CJ3A 3W9HA 3Q2SC 4BS2A 4K0KF 4L3QA 2PA3A 3MUTP 5M1QA 2YX7A 2VWJA 5MLCQ 1X5OA 4WZQA 4CRJA 3T5KA 2JL9A 2DH8A 2J9CA 1ILYA 2MDAA 4HWIA 1K73T 3MWBA 2VIHA 1YT3A 4PKGA 3T6JA 2XBPA 2UUWA 3LANA 1PJ6A 3WXLA 4PWUA 4RW9A 5KFEA 2AYMA 2UXDJ 2Q43A 3K7RA 4ZVUB 4EFHA 3G71N 3IFEA 4ECRA 4LSNB 1WSIA 2BJ3A 2I2YA 4H0OA 2R3VA 3W2VA 4H0VB 5ETPA 4N5SA 4QIWD 3ZYYX 4I6MB 4WCEQ 2YKMB 4NA3A 3ASMA 4O0IA 2ZBCA 1RDWX 2DGWA 1V5VA 4RW7A 3CJRA 4TSXA 2ZUGA 4FJHA 3PX4A 2JLFA 4TVAB 2E2OA 5DLGA 3R5AA 3SPZA 4QIVA 1RNHA 2ZJPQ 2AGPA 2AYGA 4DN9A 4K8RA 3BEGB 1NGHA 4DTJA 2BOAA 4DV3J 3QSIA 1TKXA 4L76A 3J81U 2FBTA 4CZMA 4C8ZA 4PXEA 4WFXA 3V9ZA 1NDLA 3RAMA 2KTQA 5CYMA 1QVFR 2HIQA 1PAUB 3H4DA 4B3SJ 1FRHA 1FNOA 4X62K 1SQKA 1S7HA 1XK8A 2CKWA 3CM5A 3UD4P 3AY0A 3OR1A 1X4EA 2WSCC 2IAJB 3WIVA 5B0EA 1U2RA 3AV9A 1R8PA 3D1HA 4CO1A 3NF6A 1X9WA 3H25A 1UJ6A 4DPWA 3OBWA 4X62F 3MR5A 5AQYA 2F40A 1S5JA 4Q45A 2HS3A 3MCMA 3TSPA 4H4MA 2E1ZA 3O9TA 4DOZA 4IFVA 5HAOA 5M1NA 1TGOA 1RHUB 3PYEA 2DNPA 4XH1A 4OI6A 1RXOB 2E1AA 4FLTA 2LMIA 2HWTA 4NLGA 2W1BA 1CULB 1H3DA 5IWAJ 1KFDA 2E6MA 1NAQA 3MX5A 3JSMB 3FEZA 2CWKA 2YQ0A 1DEJA 2NRHA 5E26A 1MU2A 3UN3A 3BF1A 1HYSA 2B4PA 1IKXB 4Y2AA 4LJMA 2YPZA 3B6BA 2FC8A 5J2NA 3HHNB 3MDQA 2EC0A 3DXMB 3W0LA 3VVUA 2V2VA 4DF4A 2RRBA 2E7XA 3I4PA 1HPZA 3NGRA 1GQEA 1J9AA 4BREA 3TARA 1SKUB 5BRHA 4DJBA 4F7VA 2PFFB 4UUXA 2ZH9A 1FRLA 3IG1B 3BUZB 2BW7A 3MZIA 2Y9HA 1X5PA 4EAHD 4FDFA 3VVTA 4DSFA 3WNEA 5BRFA 3MEDB 5DLFA 4WE1B 4ZVRB 4C4WA 3O44A 1HI0P 2EFVA 1HBOA 4CIOA 3PSIA 3Q23A 4FWLA 3I55S 3A13A 4ED8A 1ASWA 4ISFA 4FWPA 1P1TA 2CZVC 4QS8A 1RE1B 3ZSQA 4LFCK 2KHDA 1RHRB 2EK6A 2KG1A 5JICA 5J2MB 1UAWA 3ZTOA 4QS7A 2ZD1A 1LAVA 3ALYA 1GK8A 3PYDA 2IPOB 2OEKA 4DF8A 1BWEA 3OTBA 3GFXA 1BUPA 4LFCF 1X31C 3BO4A 1H98A 1U25A 3GIMA 4XDDA 3QNWB 4U7CA 2I5JB 2PFUA 2WAQD 4WWSA 4DXLA 1ZM2A 2AIRB 3ET6A 4WZMA 1JL1A 5I9EB 3MCSA 2XG8A 5HBMA 3LM2A 3R6MA 3G82B 1Q1KA 4YB6A 5GAHI 2W2QP 4FYWB 3NMRA 2HHWA 1SVDA 4DTRA 1CJUA 3FEXB 5IM0B 3S8SA 1HHQA 1LW0A 1EQ0A 3AD9C 4FK2A 5DMRA 3K5MA 3M32B 4QIFA 3CPEA 5A8WA 3CMAS 4QZVB 1N5QA 4K43A 2ZE2B 2OELA 3GJSB 3H2LA 3MTJA 3BSOA 3HF5A 4LFBJ 3W2WB 1WSFA 1WKKA 4KB7A 4LF1A 1R8AA 2NZCA 3T5LA 3KMQA 2V4RA 1SJ3P 1ZZNA 5HVFA 5AQJA 3VEYA 4QW9A 1K73O 3NBPB 3BGUA 1FK9A 4CFDA 4J2EA 1MLAA 3CT9A 4ED6A 4CEFA 2X3GA 3Q7BA 1VQ9S 3SZ2A 2BQUA 5LXRA 3UI3A 2LYVA 3K58A 4CT9A 3MR6A 3OS2A 5FIIA 1KVBA 1X3MA 4OHXA 2ACMA 3LTOA 5CYJA 3H42A 1CLQA 2MJUA 4LREA 3MUMP 1FE4A 3MPDA 4UZCA 4OHZA 4I2PB 3CCVS 3QPIA 3CCLS 1VQMS 5AQQA 1NDPA 4K41A 4FM2A 5LMUJ 4KB0A 2OHDA 1UWAA 4BACA 3KWMA 3NOGA 2R8JA 4CO3A 1VQ4N 4NCBA 1LFWA 2KFNA 4TQRA 2BMBA 4BR5A 1GNKA 3HHLA 4NXNJ 4F04B 2UUAJ 5C7PA 1REVA 1F3VA 4K4ZA 4J9SA 2BV3A 2DHAA 4CJWA 3QRRA 3WNGA 4DX5A 4GKJK 5KFFA 4QIGA 4I7FB 1DKGD 2OMLA 3MX2A 4FJGA 2E1RA 3DGVA 1WLJA 3VESA 4HLBA 1FRIA 1DY3A 2NRXA 1CBKA 1OO0B 1KRPA 3ENOA 3EL2A 3F56A 4EYIB 3UCUP 4GKJF 4C0OC 3IAYA 3EX7B 4P52A 4CF2A 4ZTJA 3OHRA 3D7EO 2FGOA 3VA0A 3BGFA 3SUPA 4DN0A 1RAFB 4OIXA 4N8NA 2W25A 4L72B 5GAHU 1WNSA 1VK3A 4NEZA 2CQIA 4OI3A 2PSZA 3MPVA 1MMLA 2XS2A 1Q81T 4AD6A 2DFFA 3L6QA 2GIRA 1W7WA 5D0RA 5KFLA 2NZTA 3VQCA 2J7KA 4CEEA 1NMNA 4OLAA 1BGXT 2AEFA 2HMIB 4RW8A 4CHQA 5JVGL 4DSEA 4IZ9A 4ZVFA 3GSDA 1BCOA 3IXQA 4FJ8A 4OYZA 2LP4A 1S0MA 3D0IE 3VZIA 4RU2A 3KNGA 3NCQA 2JX2A 3EN9A 1SL2A 3CXCM 3BQ2A 5B0CA 2BJ9A 5KT2A 3BN4A 4MFBB 2YX1A 4IG3A 4RW4B 4DR6F 3UCZP 1KFSA 3HSDA 4C8NA 2E5LK 2VBZA 1M1KT 1HWLA 1PYSB 3SNNA 1FWKA 3ENQA 1UW9A 4BRNA 3S3MA 3PLAA 3FMBA 2RQ4A 2XLKA 4JYAF 4Y1CA 5A0YB 1BE4A 1HNZK 5AQLA 1F60B 3Q8VA 2IM2A 4DQQA 2E5LF 4FWMA 3NCPA 3D6RA 3WNFA 1LK5A 4AQYK 2V67A 3ITHA 2VPWB 4OYXA 2YHAA 1HWIA 4XH4A 2P9LA 3UN2A 1HNZF 4K42A 4A8KA 3SYZA 3DU5A 3OTCA 4CIGA 5IC4B 3TO8A 4C9DA 4DB3A 3C6HA 1UFLA 4AQYF 1MMNA 5HLFB 5SZTA 2VGNA 3SCIE 1NU0A 4AL5A 2OZMA 4JUZA 1KD1T 3M5RA 4BCAA 3AVMA 3KLGB 4B08A 4CO2A 4KC5A 3AVNA 3NXZA 2CH5A 4CJTA 3CYMA 3PZPA 3PO4A 2R7RA 1V3RA 3KD5E 1KVAA 4KGZB 4O55A 3O1WA 2B0GA 3HSGA 2V9KA 2YQ3A 1RAAB 1QAXA 1SJ4P 5AR0A 1CZBA 2VDIA 1FX2A 3KLIB 3RMDA 3H90A 4CJUA 2D1CA 5KFVA 2OPRB 2VPXB 3WNHA 2M52A 1XTZA 1Y00A 3W3SA 5E41A 1Q9YA 4EO6A 3TAFA 2Q1NA 1PKUA 1RWKB 2D3UA 3RZAA 4WIQA 3MDFA 2OO4A 3W60A 4BG8A 4BR0A 2ZVIA 1S1UA 2RKIB 1Z05A 1BC6A 4QWAA 3VGVA 1FDNA 1FFGB 4B3TK 4EO8A 7FDRA 2EFPA 3P4UB 1WEXA 4D3HA 1WUAA 3UB5A 1S9GB 4H4OB 3H98A 2ETJA 3NGIA 2MKJA 3EXCX 3BPDA 1WSRA 4I6YA 1XUPO 4B3TF 3M8WA 3TWHA 4DV0J 4H5NA 2R2UA 4FWKA 3IAM9 3HHDA 4F8RA 4RCHA 1TKZB 2J6UA 3OHBA 1S9EA 2W41A 1RT5B 3GFHA 2ZDOA 2EFQA 4C0HA 1G1XA 1LK7A 1H2TZ 3N79A 1YWXA 2J7WA 4ZCIA 1MA9B 4DV1J 4LSLB 4TYAA 3B6OA 3IC1A 3IWXA 4HR2A 3W9IA 4Z7CA 3V9UA 1WC6A 3ISND 2KXFA 3HHLD 2VQEK 2WC9A 4EP4A 5K8OA 1YJ9N 2QZ8A 3SQ0A 4KYZA 5CHCB 1E4FT 4JK8A 5A8KA 3SMPA 4OKEA 3TANA 3MXHP 3KMSA 3U02A 2BR0A 1H38A 5HP1A 2XS7A 2E1PA 2R7WA 2VQEF 1KR4A 1N88A 3P3DA 3SFUA 1B9DA 2YJEA 2CA9A 2CNKB 1RILA 1KTQA 2PZSA 3CCUS 4EP5A 5JMVA 1TUYA 3FUYA 4NB4A 3SBMA 1JLQA 3UWTA 1XQSC 5AQNA 2MZQA 2FBYA 3DXBA 2QXLA 4ILGB 4LH5A 5CHIA 2BZ2A 4OX9J 1M5KC 5CY4A 4IOBA 2XMWA 3WQPA 5FPMA 3T41A 3HT3A 1K8KA 3VTHA 2Z2MA 3NGDA 3GB0A 2V68A 1YI2S 3RB6A 1RAEB 5F8IA 4I6AA 2UXDK 2O8CA 4X65J 3N28A 4JI4J 3DDIA 1Q81O 4QQBA 4KTZA 1F3FA 1UA1A 2HHHJ 2IBKA 2LXIA 4DCPB 4JN4A 2DGOA 2UXDF 4J9VA 1VAZA 2K2PA 4IOAL 1SQGA 3D68A 5GAGU 3G96A 3E01B 1GMUA 3I6PA 4W5OA 4A46A 3GBTA 2CQHA 3CDUA 3KZBA 3ULHA 3LP0B 5BXIA 2ASMA 5KT6A 1OKJA 5JS2A 4C8LA 1CJVB 4QAGA 1SKWA 4OO1J 4DV3K 1M1KO 1ZM3A 4AF1A 3GFZA 3E51A 4C3LA 2J6SA 4B3SK 1LXNA 1S7IA 3Q8QB 3RB4A 5AQZA 2IA0A 3CULA 2A41A 1AT1B 1FCAA 3U1MA 5D15A 3OTDA 1CPZA 4DV3F 2FLOA 3TAGA 2DIVA 4KO0A 1RTDB 1YJWS 2IVPA 4B3SF 2AJ0A 1SUQB 2AJ1A 5AQUA 2R2SA 2XY6A 4DPUA 1FE0A 2PMHA 2W2NP 4EEYA 2EHGA 1VBZA 2NUHA 3THYA 1H7WA 5K8PA 2A6OA 2IC3A 3D5MA 4NL5A 3CIZA 2LA4A 4ED5A 1RBSA 4CERA 3EJMA 3OY9A 2G2ZA 1KD1O 1T11A 4OV1A 3KDNA 3MURP 3LALA 3D3CJ 5IWAK 3VQQA 3P6YC 4BRIA 5CCMA 3TI0A 2WVEA 5AZIB 1NXIA 3DOKB 3MEEA 3TX0A 1MWQA 4FWSA 1UPPA 2CUYA 2QG9B 3PHTA 7FD1A 3G87A 2EKNA 2VBXA 4FW1A 1IJFB 3FMWA 1G3OA 5DJBA 1KQKA 5IWAF 1TYQB 2RVJA 2W8KA 3S3NA 2Z1HA 2KG0A 2BQ3A 1IVZA 4Q44A 2V8GA 3CIPA 2OI2A 1HA1A 4BRKA 3ZZOA 2ATQA 2VD3A 3AVLA 3DAWA 1YVNA 4DQRA 1N8RO 3SAHA 2P9CA 3JS9A 4CYUB 5IV3A 4FVMA 2IVOA 4XDCA 1EETB 5DDQC 5ADXA 3MXMA 2KQ2A 3N5BA 5F8NA 4FNHA 4CZGA 1VQOS 4IXCA 3THWB 4CGIA 4JK9A 1JQGA 4X4PA 4M1KA 2XCPA 4RWXA 3RBEA 1W2BR 4F2RA 5BPMA 3FFIA 4JKCA 3RGIA 2GGPB 2VWKA 3K8VA 5C24B 4EK2A 4WFBQ 3JSYA 3A5NC 4CJ7A 1M1GA 3VF4A 4JI8K 1RHQB 5FRNA 1Y10A 1J54A 5CZXA 4ENOA 4ES2A 4DR5J 3AT1B 3T1HK 4CBUA 3D4JA 4FBTA 3TSUA 2V8DA 3W5YA 5IT9O 2X6NA 3NG8A 2DFEA 2KHOA 2FBXA 5E33A 4JI8F 3SCJE 4BRQA 4GW6A 4AL6A 2LU1A 5LMNJ 1RTIA 4KKOA 4KE5A 2SXLA 3T1HF 4MYTA 5E3PA 4JV1A 1VBKA 3M8SA 1BI4B 4QR1A 2AMCB 1VQNN 1H74A 2W40A 3CNQP 3GV5B 3Q86A 4ECWA 4B9NA 1RDUA 4QU7A 4MTPA 2WFBA 2JEIA 2K8GA 3CQXA 4FJKA 4IG0B 4P9SA 1W25A 4DV2J 3WHIA 4J9LA 3OXFA 5HO4A 4P7VA 2G1HA 1JLBA 1TMJA 2COLA 3BDPA 4MIWA 4LFBK 3ADAC 1GXLA 1S4FA 2PYLA 3CJ8A 3OYIA 5A6PA 2R8IA 4A5BA 1R0CB 1RDBA 5AQXA 3LGMA 1GOAA 3BKFA 4IRKA 2R4FA 2JEJA 1NG9A 3K59A 3MR3A 4CLSA 2E66A 2GQ2A 4ISEA 1QSYA 4LFBF 2FYXA 3I82A 4IJNA 2KRBA 5F8MA 4NPOA 3DMJB 1RABB 3AY9A 4DTOA 3GIKA 3PEHA 5J2QA 4E89A 2HB5A 3TZZA 2HRYA 1VR6A 3CD6S 3NAHA 2OH2A 1U0HB 2F8MA 4RBUA 2DY4A 3TTFA 2R42A 1EJ7L 5LMUK 4HL9A 3EZWA 3L4BC 4C8MA 3S6EA 2BTFA 1TL3B 1HMVA 1DJ0A 3NMAA 2B43A 3ZZTA 1IXKA 4FJXA 2QM1A 3PIOL 3ICLA 3IKMA 2EBEA 4B17A 4OZNA 2JHEA 4OLPA 4ZHRA 3CJKA 3ZTQA 4NXNK 2UUAK 3WUHA 2P9UA 1MWYA 3UCGA 5JVHQ 3FSXA 4CGJA 5LMUF 1RAGB 3EZUA 2AP6A 3MMAA 2YKQA 1JWWA 2IDOA 1RTHB 1WAFA 1S49A 1HNXJ 3BV8A 1NJYA 4KV8B 3G4SN 4PA1A 4NXNF 1CJTA 2UUAF 1LV5A 3FDSA 4QW8A 4OYBA 4IRCA 4CEZA 5LY3A 1DQ9A 2UP1A 1FI4A 2CPFA 3LP3A 2C2EA 2FZKB 2KU7A 3GYGA 4WF9Q 2V63A 3ZNUA 4NLYA 2W9AA 3NHGA 2MQQA 3HDSA 1GLAG 2H65B 4E19A 3FR0A 2A1RA 1Y11A 4ZIVA 3H5XA 4FP9A 3VGUA 1AROP 3A0IX 4OZ3A 1HKBA 5JVGQ 1ZH5A 3WEEA 3FSIA 2H4WB 2AF6A 1S22A 2FLLA 1HBUB 4DSIA 2DNGA 3R97A 4K50A 2W4DA 1ZAXA 3QO9B 2J9DE 3SAGA 4CHPA 3ZSOA 3MXJA 4CLWA 2WVBA 5TKWA 2HWIA 3CJ1A 2GVZB 3SMZA 5AZJB 2KYXA 2CZ9A 4X4VA 5GAEI 1EARA 2KZZA 1BDGA 5AQRA 1U1OA 2C3OA 3VQ8A 1HW8A 3JTPA 5KRTA 4CIFA 5KG0A 2DK2A 3QFUA 4QOZB 3DHWC 2QJ3A 1UA0A 2M88A 3CJ4A 1Y0HA 1G4CA 1P9QC 2W4PA 3IS9A 3AH6A 3FBEA 1GLBG 4RR5A 4JV0A 3CJ9A 4DR4J 3A8KA 3BGRA 1G99A 4CIEA 4YDUA 5B0BA 2XCAA 2X74A 4NX9A 3MM9A 3AO4A 2VOOA 1ACMB 2O66A 3TJ8A 3C16A 1NSKL 3M8ZA 3OYGA 3W61A 5GAHP 5JLFA 2X3DA 4U9RA 3OTOJ 2E1MC 2GWJA 2MSSA 2UXBJ 3OFFA 3SBTA 1BHNA 2VONA 3Q7CA 4F9OA 5AQOA 4XO0A 1EIYB 1HL6A 4X4UA 2ZBIA 3PRVA 1XMQJ 3HZ6A 2BJEA 3FGUA 4B8CA 8AT1B 3D2EA 3N4QA 4YOVA 3S9HA 4KRFA 4HI1A 3RG6A 4LQ3A 1NEEA 2O4GA 1S1VB 3LAKA 1Q79A 2VJVA 1X5TA 2ZJRQ 4B9UA 4DDFA 1VJWA 4ANCA 1FX4A 4KH5A 4ILRA 3PDNA 2V2QA 2VYPA 2JGUA 2W7OA 4P2XA 4ZPWR 2R7XA 4KHMA 3TAQA 1A5VA 1WOQA 2RDJA 2HRUA 3K8WA 2M3DA 2B9XA 1XBWA 1JXBA 3MMCA 4I69A 2EI5A 3QT7A 2Z2ZA 3JSBA 1UVLA 2D9PA 3W8PA 1LW2B 2G0JA 2JRSA 4FJJA 3SUQA 1SH2A 3FCVA 1P90A 4CJEA 1U7LA 3K5PA 3VAJA 2O4IA 3CCQS 2N82B 3NWGA 4LRAA 2N3LA 5G0RB 5GAEU 3RW6A 4M3UA 1NSQA 4WKRA 4A62A 4DV0K 4DU8A 1BY9A 3AA4A 1JIHA 3ZSRA 2D74B 4KAIA 2YPYA 1F5AA 1HQEB 2QV6A 5I3QA 2VFUA 4QWEA 4CJ5A 3VQ9A 1WHYA 3WC2A 3EICA 3GE9A 4B9TA 4XEIA 2BKNA 4NYZA 3UPFA 4F26A 2QFIA 2ZDPA 5AQTA 2E2PA 4DV1K 4DV0F 2MKSA 1KVCA 1BA0A 3OYFA 1KCFA 4DL6A 1C1AA 3VGSA 4JK7A 5A8RA 3OVNA 3DLJA 3ZX0A 1TMMA 2ZBQA 2HOEA 4LF5J 3V2UC 5C25A 5IQ6A 3LL3A 3M2RB 1RYSA 4Z2XA 1WWHA 5DM6Q 3MECB 1FNMA 5JXSA 4DV1F 1RWMB 4FM1A 1HI8A 3MEGB 4C2MA 4IEEA 1RGVA 3IUCA 2HGLA 2XULA 2BANB 4AHUA 2DPNA 4M5MA 3DYAA 1URNA 3QWUA 1HJOA 2R7UA 1EWQA 4M45A 3UE5A 4FPAA 1OVQA 4NI2A 2CJYB 3AAQA 4PYDA 2W42A 4YOEA 1ZTTA 2FSKA 2NRTA 1BQNA 3N6NA 3A8JA 4IDKA 4GKKJ 2A6MA 4OX9K 3C15B 3THPA 3LUYA 1RWPB 1R7IA 1WTFA 1Y5NB 3M9NB 4BRMA 3TOQA 1S1WB 1OH5A 4K5RA 1UMJA 1IKVA 3OBYA 4Y00A 2W9BB 3ILJA 1GXUA 4X65K 1HQ2A 2MMYA 3EMTA 2W2PP 2JOQA 3QQCD 4ZVGA 4JI4K 4BRFA 4OX9F 3T9ZA 3AVFA 3GCWP 3MD1A 3U6FA 1G15A 1TL1B 4IOAQ 4DV4J 2MZSA 2HHHK 1HQUA 2VC1A 1J27A 2P9PA 2DGXA 1DLOA 2HK3A 2X1BA 3M8YA 3K9JA 2DHSA 4IJAA 4X65F 4ED2A 4FF1A 3ULDA 2Z2LA 4JI4F 4WFNL 5CE3A 5C2CA 4NXMJ 4QWCA 3C6TA 6FD1A 3OUYA 4J2AA 1ZBHA 4FJMA 5G4DA 2HHHF 4L73A 3R5GA 2CJKA 4XPCA 1GEHA 1OPZA 1ZXOA 3WXKA 4BE1A 4NYFA 4RW9B 4QJVA 1RP5A 3NL0A 3RB3A 1C0GA 3V9WA 5KFRA 2DGUA 3H3OB 4CLZA 1RBLA 3C14A 4DTXA 2H51B 1ASVA 4A8SA 3UNYA 3W66A 4V19S 5DO2A 1UFWA 3J7A1 3W2VB 2HBZB 4ZJQA 2V69A 2AGOA 2CPJA 1WB9A 2ROPA 4LFAF 2JWLA 1WBDA 3GR0A 4RW7B 5ADZA 1W9HA 1SZ2A 2WBMA 4OV6A 4LBPA 4IUFA 4GVMA 1Q7LB 3ELHA 3IN5A 2QWMA 2FHJD 3JAMO 5HK4A 2P9KA 3ATVA 4KSEB 2P2CB 2QLJB 3LQVA 4PL8A 2ALYB 2RQCA 3PEJA 1O1WA 3CC7N 3OFHA 2N7YA 4J9KA 2BJ7A 1TKXB 5EOYA 2FJVA 4YUDA 1P8GA 5CYMB 1NB2A 3VQDA 4CE9A 1XR6A 2M0GB 3H5YA 5KGWA 1H0HB 3NE6A 4OYMA 2HNZA 4P72A 2CZ4A 2C2RA 2A40A 1KWMA 4OI0A 3OR1B 2N3OA 3ZSWA 1NWKA 1XMOK 1SL1A 2XMAA 1YITN 2NRRA 1Y5IB 2YQ1A 3CJAA 2ZWOA 3QRQA 2IRYA 1F9HA 2I9SA 4F02A 4GVBB 4H4MB 2NRVA 2HURA 1XMOF 1RWWB 2MLZA 4Y0WA 3MPUB 4WYWA 3SCLE 4IFVB 4BRGA 4WQ5C 2BVZA 2DR8A 3VQ5A 3CC2N 1QTMA 4KBOA 5KG5A 3E9LA 1JJHA 2XQCA 1VSHA 2LDYA 3HKWA 5BR8J 1F5CA 1RT7A 5E3CA 4RBTA 4IYQA 2RD5C 2V7YA 2PGCA 5ETSA 4JNEA 5C42A 2OUGA 2P9EA 1FVSA 1S12A 1V6HA 1IBMK 4L6V3 1WC0A 4E0DA 1GLLO 4JS5A 1OWXA 4U8VA 4YMEA 1MU2B 4K4TA 4JI2J 5DRKA 3QFHA 1HYSB 1B4SA 3SXLA 3SIPB 3D6MB 3CSKA 3O4QA 4PWDA 3A2FA 1B0PA 4HTJA 2CJQA 4DQ8A 2VFVA 4J9RA 2FC9A 3NY0A 4HVZA 1IBMF 5K5MA 2V51B 1ATRA 4Z7YA 3L0QA 3X1LB 1U6ZA 1UOCA 2FDNA 1YDLA 4RUHA 4ZVQB 3AD8C 3IGVA 2CQCA 2O5DA 4LVNP 2CJ9A 1RWOB 4DR5K 1N5TA 4CHZA 2LDIA 4OJRA 3NCRA 2E88A 5MAOA 3SQ4A 1JLCA 2LEAA 1SAZA 5EVZA 3HXMA 3GR1A 2RU3A 1RK8A 1FT8A 4J8FA 2CVEA 3OTEA 4J37A 5LMNK 3I0SA 1HBOB 4B1XB 4DR5F 4BRLA 4DV5J 2ADCA 4IO8A 3CJSA 2EXUA 2W8LA 1VK8A 1ROFA 2BABA 1RHMB 4MKAA 1DT9A 1PJ7A 2W6KA 5F3ZA 1J6ZA 1VSLA 1BHLA 3SPYA 3PIPL 5LMNF 3KDOA 2QA4S 3OFGA 2W6LA 4M41A 4FZYA 3R27A 2ZD1B 3CCRN 3O6QA 1NM1A 2HAFA 4B9SA 4DCJB 1S10A 1Q8BA 1GMWA 2XMKA 2HAIA 1Q7YT 4CK1A 3C0BA 4V19J 4CHNA 2Q3SA 1YJTA 4CM0A 3SFGA 3ET6B 3I56S 4DTPA 4FZZA 2AWZA 5HBMB 1KBRA 4ED1A 2KN4A 5H9EJ 2F7TA 3GCXP 1LWFA 1B99A 3JSRA 3QMQA 4ES1A 3H8YA 1RLCL 2IGIA 1NU4A 1NPRA 3C2PA 5MLCV 2NLWA 3AO3A 1VC5A 4OX6A 4Q43A 2P1JA 3FZMA 1LW0B 4RG8A 1HX1A 2Z56B 3HJFA 2DXDA 2RUSA 4ECYA 3PR5B 3A3OB 2OPSB 3DOLA 5AQWA 2MZ1A 5LL6Z 3OJSA 3P39A 1N56A 2KHCA 2IIRA 2VV5A 4BGAA 3S1TA 3G9CA 1TL4A 3R2DJ 1FK9B 1A6LA 4FZXC 4OYPA 2C28A 3V9XA 2EWHA 5AQIA 4PY5A 2GUIA 1PC4A 3CCMN 3SQ1A 1N6QB 4Z37A 1KTVA 4ID5A 3N9UC 2D7SA 1PBAA 1RCHA 4E8UA 3T1YK 4CJ4A 3I33A 2FHMA 2HZAA 4CD1A 3QFWA 1HNXK 4M3XA 3JQKA 5D0HA 5CZ2A 4JHDA 2LQ8A 2HHTA 3BZCA 5DM7L 1RSCA 1DURA 2VFTA 3T1YF 2VICA 4WQ4A 3LPUA 1GTEA 2HG4A 2GFFA 1T9YA 1HNXF 2VODA 5LSLA 4CEBA 4F4WA 3KWIA 2PN6A 4OYIA 1TUGB 4P2MA 3HHLB 2MKKA 1REVB 5HQMA 4RX6A 2MHEA 3S41A 3VQAA 2D9OA 2KXHA 4MIAA 1Q86T 4Y6IA 2JWNA 3G86A 3BO2A 3PM9A 1VQ7S 4J2BA 3VQSA 4O5BA 3AODA 1WF2A 4K4XA 2QRRA 5C10A 3IO1A 1M1HA 2LA6A 3PW0A 1O13A 2GHVC 1Z4UA 2VUGA 2JLEA 1C4AA 2G8HA 2DPIA 1N36K 3CF5Q 4MT1A 3IWNC 2XB2D 4RWTA 2DHHA 1RKIA 1AYEA 5ITHA 5AQKA 3H2UB 3D7SB 3GDQA 3F9KA 2PE8A 4CLLA 2UVVA 1IN0A 3OLAA 4LRCA 4U6PA 1C0TA 1N36F 2VH7A 3TUIC 4NYPA 1UEKA 3J7YI 5KFPA 4CTAA 3PV8A 2HHVA 4DR4K 3QATA 3I32A 3G8SA 1IH7A 3BQ1A 1N5YA 5B7WA 1VBXA 3KJVA 1JB0C 1X3NA 2GO9A 4W92B 4RZRA 1NKBA 2CWXA 2GS8A 4PHTX 3OTOK 4DR4F 4H4KC 1FEHA 1YJNN 2UXBK 3TPQA 1WEZA 2ZHAA 1RZMA 2DEJA 4IG3B 1PGZA 4JOUA 2X6SA 3ATUA 1XMQK 3UDCA 1HYZA 3LWLA 1Y3JA 3EVOA 3PW2A 1YVFA 3DRYA 3OTOF 2CGKA 2CPIA 2DH9A 2KM8B 4CBWA 2UXBF 1BXNA 3GG4A 2PD1A 2MB0B 5GMKa 5AFUH 2ZOFA 3G71S 2BE2A 2JVRA 2WB1D 1XMQF 3GIIA 2B5JA 1WHWA 2M2BA 1FRJA 4KFBA 3ITHB 5HROA 1ZTWA 1QSLA 4PABA 3C3LA 3M8RA 2MLXA 1IKYA 2CG4A 2VDHA 4IKAA 2P9LB 3F41A 2E5IA 2H4YB 2HW3A 1QUPA 3MM8A 1NO8A 1S97A 2NSBA 3DGPA 2V94A 1WF1A 1MMDA 2GCFA 3FKBA 1GMWD 3W9JA 5D77A 1L3TA 2IJFA 3CMQA 4OJ1A 3GG1A 1Y64A 5LM7E 1V3ZA 1VSEA 1T9TA 2ZJPL 3QBWA 2U1AA 1Q7YO 1O6XA 4NWBA 3C46A 1Y5LB 1GH8A 3O9RA 1JLEA 3BJYA 1CZAN 3H4BA 4OYAA 1F1BB 2KYZA 3GWCA 3H20A 1HIYA 5M1FA 1R0AA 3AOBA 3GTYX 3VA3A 1VQ5N 5M1OA 4YEAA 4Y1DA 4CK3A 3ETOA 1NOYA 3IA0A 9RUBA 1WC3A 3AQOA 3EGWB 5AE2A 2F63A 4LC9B 4M3RA 3DI6A 3J7YU 1SKRA 1S1UB 3VN5A 4CM2A 4O44A 4CESA 5F1XA 3FQLA 2G13A 3HVRA 1JNZB 5IQQA 1W2IA 4LF5K 1KVIA 2MKIA 1RHJB 4EFAC 4FYVB 3R8EA 5CA5A 1M5SA 3N0VA 2JJ4D 2RDIA 1NGDA 1BO5O 1VHFA 4I56A 1PSDA 2EFGA 3CPWR 1KS2A 3V5RA 4DU7A 1NK8A 2XY7A 2MKHA 2XMTA 1HR0K 1B92A 5GIPA 4O0NA 3FCWA 4LF5F 3CW2C 1S9EB 3HTVA 5HJYA 1EQMA 5AQHA 1NBEB 4CH0S 2QWRA 2E7WA 4EHTA 2Q3PA 3NCIA 4P6QA 3R8YA 3NRBA 1VSDA 1FERA 1YBUA 1HR0F 1Q82O 2I7NA 1WC1A 3CGIA 1EKSA 2ASPA 1CJKA 1SJ1A 3M6XA 4J9NA 1I39A 5GAEP 4GKKK 1QAIA 2Y3YA 1SI9A 4LRBA 3HSZA 1ZOTA 2W2MP 3PX6A 3OR2A 2FJAB 5A8KB 3AVJA 3ZZYA 1YTAA 2WBNA 3VQBA 4KHUA 3PUFA 3B8HA 3DRPA 5DG8A 2OFHX 5HP1B 1U8SA 1QD1A 3AOCA 3AO1A 3MN6A 4DV4K 2IVFB 3ZETA 5F8JA 4WFNQ 1Q86O 4JAXA 2EVZA 3OYEA 2ZH4A 2DT9A 2VG5B 2OFGX 1JLQB 4FO0A 4NXMK 4UOCA 3QIPA 3W62A 1M0SA 2U2FA 4F67A 4DV4F 3LPTA 3ZSXA 4A8YA 1JMTA 4CLTA 3D54A 1K8KB 2XSFA 1BCMA 1N0UA 1T3VA 3OYJA 1U1PA 2O8CB 2XWXA 3DHXA 2V34A 4NXMF 1FFWB 5GIOA 4LBIA 1KVKA 4ZK7M 3FZBA 4ECSA 1VJQA 2ZBPA 1SCJB 2E7VA 3QLHA 2AGQA 3QEVA 4UT4A 4E7JA 5B0FA 4AT1B 1RU1A 1EZZB 3HYFA 2ZKUA 3MFIA 2IFXA 1NRKA 2VPZB 5IC6B 2CJXB 2FHOB 3KHYA 3GQCA 5LT5A 4LR7A 3VGTA 1UFKA 1NHKL 3BQ0A 4K4WA 5M1PA 1F9FA 2P9SA 2VC0A 3MM6A 4PKIA 2M8HA 4ZVEA 2XMJA 5B09A 1HD1A 1N0VC 1CEZA 2J7UA 2VKZG 2HEKA 4LSNA 1VSJA 4CD3A 4JI6J 5CH7B 4OVLA 4CFCA 3GIJA 3M8PA 1YF5L 3JQMA 1RBUA 1Q0NA 3NVMA 3VEWA 1RT4A 2G8UA 2HQFA 4KAZA 3HI0A 3CG7A 1S76D 1SL0A 3NGZA 4KO0B 1YRXA 2KJVA 1RBVA 4J9OA 1ITGA 1S79A 4CO0A 4F3QA 4OJHA 4PPZA 1AUDA 3S7RA 3THYB 2D0OA 2H5JB 3IGNA 4WTOB 1K47A 4FXVA 3OFEA 3CCZA 1EXQA 2IC3B 3M6GA 3TEGA 5HRNA 5HMZA 1DAXA 2QLBB 2A1SA 5BR8K 4A57A 1VQ4S 4W98A 3THXA 4WFYA 3N01A 2YWEA 4ECUA 1ESVA 2HFVA 3O5TB 3QT6A 1IBKJ 3MEEB 1RBTA 5FRMA 3FK4A 2UVRA 3NGSA 1VOMA 4WU3A 4JI2K 4CJSA 5BR8F 2GMLA 2C3PA 4A2BA 3KFWX 4KJIA 1U2CA 4ALZA 1CC8A 2YKPA 1Q18A 4J5OA 4YNQA 4DUZJ 4BBYA 3VGMA 3NH2A 4ICLA 2NREA 4JI2F 2O1PA 3LZJA 1WI8A 2QIFA 2PY5A 1S0VA 4ZIWA 1L3VA 1FD2A 2FSNA 3P49B 1ZA2B 3OD2A 3M7VA 5CZVA 4JRQA 1KN6A 1GX5A 5GMEA 3IRXA 2XZTB 5KG2A 4DV5K 2H48B 3Q8SB 2UZAA 3DXMA 5D4OA 1B7YB 4U96A 4DR6J 4WKYA 1KC8O 4OPKA 3FFIB 2AJ4A 4X2BA 3QNNA 4DV5F 4NLCA 4KIAA 4JYAJ 2Q2RA 2PEHA 2GJIA 1TU0B 2YNGA 3P5BP 2NSCA 5F8LA 2YKNA 1U1RA 2HSEB 5ELZA 2BGGA 3VMFB 4DBQA 1U6FA 5LL6d 1VQKN 1AFJA 4N56A 4FNIA 1TFWA 1RA6A 2OA8A 1RTIB 2EWSA 1Z26A 4KKOB 2ZJQQ 1T3OA 1FXXA 1QUVA 2MQ8A 5DDRC 4PG4A 1HBNA 4L75A 3BY5A 2QA4G 5H9EK 4OQJA 4HCBA 4F4XA 4CEQA 5B8HA 5U47A 4TLQA 3HHEA 3L2RA 4YHHJ 3MFHA 4HTIA 5M2RA 4C11A 1SC3B 2CPYA 2ZH6A 3KOAA 4XH5A 4WU2A 1ZPWX 4E7IA 1JLBB 4BVOA 2BYCA 1D8YA 5D6GA 3FZHA 1Z6RA 2I5JA 1S72N 3KHRA 1RT6B 4ZVTB 2HVZA 2ZBRA 3GFYA 3SMSA 4MO4A 3EVMA 4RWWA 1QQMA 2MY7A 1TR0A 1HNVA 4LF8J 1CLFA 4BDZA 3M6UA 4GV3A 3P96A 3SQGA 2MGZA 2BJDA 4K2XA 3DFEA 5HOOA 4OX8A 1OH7A 2VJUA 4ECXA 3SBGA 3CD5A 5T7BA 2H3EB 1OH6A 5CAAA 4ZLNA 1IQTA 5J2QB 3PY8A 1DARA 4O3OA 1FKPA 1T02A 1W26A 2IMWP 2QWNA 4PKHA 1U09A 1VK0A 1SC4B 2IYGA 2XZDB 3AA9A 3EE8A 1HMVB 4NLDA 1YJUA 4A2AA 2BJ8A 1K6YA 3QSYB 4CLUA 3QBXA 3NF9A 4ZHRB 3CJKB 3K5OA 4HEA9 2B4JA 2DXFA 2P9UB 2WW4A 4DPTA 2GQQA 4BC7A 5FJ4A 3HPOA 5KFAA 3NAEA 4IH7A 3MMAB 2B56A 4I68A 4ZTFA 3TA0A 4AYBD 3RRGA 2J0XA 4KPYA 4G1PA 2QMWA 3ULEA 5J1EA 4JKAA 3QAUA 1CJTB 3HL8A 4AE5A 1IG8A 1XHZA 3SQOP 3QIDA 2HHSA 5AE3A 2QSFA 1YXQA 5KPRA 2VFSA 4FKXA 3VAKA 2OEMA 2KXNB 2CPDA 3V4MA 3HD1A 1FKOB 4RU9A 2AP1A 3L2UA 1GOCA 1HKCA 2YKOA 2HHQA 3ENVA 1YJ9S 1S77D 3KXDA 3WEEB 5FD1A 2F4VJ 3IBWA 5C5JA 4B9LA 5FDLA 1B70B 4I7FA 2AX0A 4P2FA 4JKFA 3D45A 1SB6A 2MZTA 2WUSA 1OVYA 2GHPA 3VQ4A 2H9ZA 4X4TA 3CEDA 2F9JA 4K4SA 1APSA 3IDHA 2DD8S 3MWTA 5BJRA 5FPDA 5AXKA 3TRGA 2Z1GA 4B3OA 4NZ0A 2ZF5O 1TUWA 3EYZA 2IDLA 1R27B 2Y1IA 5A2QY 4O4GA 3GE1A 4DUTA 1NBWA 2XYPB 1LAWA 5BN8A 1WN7A 3QJJA 1SJRA 3MGJA 2HQGA 1ICEB 4EBCA 4IH5A 3QMLA 3VQ6A 3QRPA 4LRDA 3IS9B 1EWRA 4ZVPB 5K20B 1XMBA 1KKHA 3BGRB 3RUBL 4H5WA 3KK7A 1XWLA 3NOCA 1NZAA 5M2PA 3MM9B 3K89A 4NLWA 4G9ZA 1U1LA 1FD8A 1TKTA 4CZHA 1ZAVA 3C16B 1RBOB 4ZLJA 5A6WA 1DTQA 3PKMA 2E29A 5IT0A 4MFBA 3KG0A 4FJ7A 3ZFVA 2FVCA 3I4HX 4DEZA 3DC2A 3I31A 1RAJA 3GJQB 3D2EB 2R2RA 1VQ6N 4FLUA 2C22A 1FWPA 2LEBA 3TEHB 2XTJP 2OAUA 2FLNA 2WSFC 3NH1A 3DLBA 1TL7A 2R2TA 3DLKA 4LR8A 2A3JA 3AA2A 4CZCA 2K7KA 4E7KA 2F8SA 3MCAB 3IBFB 4QR0A 4DG1A 3LM9A 1GLEG 1HBMA 3MMBB 2MQMA 3TYTA 3BH6B 1YKWA 1FDDA 2IM1A 3QGGA 2IIHA 2I7PA 3DLGB 3VQ7A 4WK3A 5ETOA 5HLFA 2BA9A 3MMCB 4KI6A 3V6DA 3D2FA 1VQPN 4ZLLA 4X64K 2ASJA 4DFKA 3PCOB 1ZC6A 3O4WA 3FZKA 1Q78A 4AILC 1NSPA 1KAZA 2BACA