2YKMA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPCLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 156
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ykmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ykmA05
1C2PA 1TL3B 2WOMA 3LZIA 1NK7A 4CEAA 2E9RX 1RT4A 2IC3A 4DTMA 4TQRA 3RB0A 1NK5A 1UAXA 2YNHA 3ALYA 1IH7A 1BQNB 2JEFA 2DTUA 2DFFA 1LWFA 5C24B 2X6NA 4K4WA 3LAKA 3K58A 1S48A 3TARA 3AO5A 2R2TA 2ASDA 3ZSQA 4C8KA 3GIMA 1RYSA 2OPRB 2FBVA 4CJPA 5HP1A 1LW2B 3SFGA 3MR6A 3NAEA 2YNFB 4RNNA 1JKHA 3SV3A 5J1EB 1TK0A 1JXLA 4NLVA 4FK2A 3K2PA 2V0NA 4TYBA 3IS9A 4RW8B 5EDWA 4TQSA 1LWCB 4CFDA 3HJFA 1GOAA 3M8SA 3L2RA 4HUEA 1HNIA 4WXOA 1FK9A 4KFBA 1RTJB 5KFVA 4F4YA 1JL2A 3KD1E 4FLVA 3PVXA 2BGGA 1JLGA 1JLCB 2HHSA 2FVCA 4NCAA 1JLBB 3ZCMA 5L1IA 3DLKB 4KTWA 4K8XA 4PUOB 3H5XA 2YNGB 4E1NA 4RW6B 2WB4A 3C6UB 4U7CA 4K4XA 3CVKA 4J2BA 2E6LA 4ZP6A 3NH2A 1NNDA 3T5JA 2RN2A 4E19A 2RPIA 2ETJA 3QYYA 4FLYA 1WNEA 1KHVA 2FVRA 2GBZA 4NLUA 3DOLB 3GV7B 4EP4A 2G8FA 3KLHA 3AVMA 1QUVA 3G6VA 3IAYA 1LV5A 4CEOA 1KFSA 2VG7A 4DLEA 3DLEB 4WYLA 1NJXA 4B9TA 2KTQA 4FJ9A 1XR7A 1TP7A 1S9FA 2RKIA 2R2SA 4B8AB 4KV8B 1RT7B 3QGGA 1NK8A 4LQ9A 5KRTA 3H08A 1C1AA 1KVCA 4YFUA 3DLRA 4CHYA 3HKWA 3HL8A 4KB7A 5KFHA 4GC6A 5DGAA 3QEWA 4IG3B 1MU2B 3GV5B 4IG0A 4PWDB 3NE6A 3OYHA 4Q8FA 1S5JA 2C2DA 3F9KA 2J6UA 3L8BA 4QPXA 3VN5A 3V6HA 4OL8A 4DS4A 3AA3A 4C8LA 4ZTFA 4Y3CA 4N41A 2B5JA 3CDWA 4GW6A 3V1OA 4CF2A 4FJKA 4FBTA 1N5YB 3HP9A 2JEIA 1REVA 3IRXA 3V81B 1C1BA 3CJ2A 4ECUA 3NF9A 3NAHA 5KFBA 4JS5A 3OS0A 2XY7A 4O0IA 3OYNA 3S3OA 1NHVA 4MK7A 4JV2A 3QEIA 4CCHA 2WK4A 4FS2A 4BWMA 2AGOA 1TKZB 3S3NA 2OPSB 4E7KA 2XY5A 4FW1A 4MIBA 4O3RA 4DTRA 1HARA 4NYFA 2D0AA 1I39A 5K14B 4BE1A 4FJNA 3C95A 1RT1B 1RT6A 1RTIA 1J5OA 5C42A 4TLRA 1VRUA 4CGDA 1TL1B 3VQ9A 2DY4A 4ZHRB 4KHUA 3DLHA 3MECA 5CYMA 4RNMA 4CGGA 3DRPB 3PY8A 3KLGB 4H4OB 2E9TA 1JLEA 4NCGA 1S6QB 4DL3A 4EP5A 3SQ2A 1RT5A 5E41A 3OYMA 4FJMA 2KZZA 1JLFA 3HXMA 3K5MA 1GOCA 1L3TA 4KB0A 1RT2B 1VRTA 3RMDA 4FVMA 3B6PA 3VQ6A 1QQCA 3OYGA 3JYTB 1YTUA 2R8KA 2B4JA 3AVNA 3ITHA 4KHMA 4CIEA 4YNQA 5DQIA 4J9MA 3QETA 2OPPA 4K4VA 1S10A 4W5NA 4M3TA 4ELVA 3MR3A 4DU1A 4R8UB 2OPQA 3KK1B 3M9MB 2C28A 4CERA 3QGIA 4DSKA 1LW0B 2IJFA 4ID5A 4CEEA 2BANB 4RZRA 1VRTB 4DSEA 3SCXA 4C8OA 3I8DA 2D5RA 3IGNA 4ECXA 2XY8A 1JLFB 1ZBLA 4Q5VA 1R0AB 2HNDA 2UUWA 3MR5A 3VQAA 4DTOA 2R7YA 1S6QA 1S1VB 4RNHA 2B43A 1ZYQA 4HKQA 4XO0A 4CEFA 3DMJA 4IDKB 4ECWA 1N6QA 4AHRA 4ZMMA 2A1RA 1TAQA 1TQLA 5KFZA 1RBRA 3NHGA 1TL1A 5KFLA 1RTDA 2IS3A 3L3UA 3PR4A 1TAUA 3OHBA 5J2NA 2FVQA 4F3TA 1N4LA 1D5AA 1LWEB 2HB5A 4MIAA 3O3HA 3LALA 2R8JA 3V9ZA 1TKZA 2RF2A 2PY5A 3ZSZA 5KGXA 3NKYA 2Y1IA 4CFCA 1N48A 4LSNB 4J9QA 5KFXA 4FM0A 3M8RA 4I2QA 4CEQA 4FZZA 1D9FA 4B8CA 1VSLA 3GYNA 4KHQA 1ASWA 4KTQA 3WNHA 1T05A 5J2QA 4M94A 3GQCA 3UDLA 2W9BB 2QXFA 3OYLA 5KT6A 4KKOB 3VQ8A 3HK2A 2PZSA 2A1SA 1GX6A 1T3NA 1JLQA 2VA2A 3OS1A 1IKYB 4QW9A 4B08A 4FLZA 4F2RA 4Z0UA 2VG5A 4LY7A 1U45A 1XHXA 4O5BA 4G3IA 3ISNC 2XCPA 5KFJA 1C1CA 2IGIA 1BGXT 1DTQA 4CGFA 1CZ9A 3SUOA 1WSJA 4Z4CA 2YHAA 1RA6A 4PA1A 2D0BA 5J2MA 1I6JA 1WSGA 3EZUA 5JS2A 1ZTTA 4DSFA 3KHHA 2VWJA 2FVSA 3QIOA 4HUGA 3V9WA 4M3XA 2YNIB 5KFYA 2GIQA 5CY4A 3AVLA 1FKPB 4IQXA 1RTHA 1RT7A 1BISA 4IFVB 4YP3A 1WNSA 1IKVA 2CJQA 4MKBA 4QWCA 1HYZA 2YKNB 3V4IB 4ZP9A 4K4UA 4DMNA 4FLTA 1W0HA 1KLMA 3H5YA 3U3GA 4IFYB 3H5SA 4K4TA 4NLGA 4I7FA 2YKMA 4WE1A 4J9KA 1GOBA 1S9GA 2W9CA 1RDAA 5CYQB 3BQ0A 3D5MA 2LSNA 4O55A 1SV5B 3LP0B 3RBEA 4Q8EA 1TVRB 1BL3A 4RW6A 5KGWA 1U4BA 5KFUA 4R0EA 3K5NA 3SUQA 3L3VA 2ZD1B 1EP4B 4TY9A 2XRIA 3LPTA 3SFUA 3DLKA 3JSMB 4NYNA 3KKRA 2IAJA 3M8QB 1JLBA 3PW7A 3OS2A 3FSIA 2IM0A 1XHZA 3NGYA 3ZSRA 5I3UA 4FZYA 3NBPA 3P1GA 4NLSA 5I42A 3LAMA 4Z4FA 3RMAA 4ICLB 2XY6A 1SL1A 4DSJA 3VQBA 3VQSA 3RWUA 2GIRA 1LWCA 3DRRB 4KHYA 3CWJA 2P1JA 1F21A 3HYFA 5KFSA 3RB3A 4MK9A 3AVCA 3VA0A 3AVIA 2FBXA 4RW4A 3CJ3A 3AA4A 4F4XA 4W5OA 5HROB 1LW2A 4GC7A 2Y1JA 3BSCA 4NLYA 2XCAA 4KHRA 2AQ4A 3PO5A 3KD5E 5C24A 1LWFB 3KJVA 2JC1A 2V4RA 1HQUB 1SH2A 5KG5A 3AVBA 3FFIB 3DOKB 1BQNA 2J6TA 2YNHB 3H40A 3BSOA 2G8WA 3KLEA 4U6PA 2JGUA 3I0SB 3DI6B 3HVAA 4Y34A 3M9NB 5L9XA 5DG9A 3DOKA 2Z1JA 1RDBA 2GV9A 2R8GA 2HNYB 2XWYA 4DU4A 1DLOA 3NGZA 2HHQA 4ZP8A 2C2RA 4DL7A 3AO4A 3NGIA 2OYQA 1IO2A 3ZSVA 4DL2A 3NCIA 1TKDA 1DTTA 1TV6A 5KI6A 3OYBA 3SI6A 4ZPDA 4CIGA 2IBKA 4ED2A 5J2PB 1U47A 4RW7A 2C2EA 5F8NA 4O4GB 4CJ4A 3DRRA 2W7OA 4M45A 1VSDA 1Y97A 3LDSA 4EZ9A 4Z4HA 1N56A 1T8EA 4M41A 1RT3B 5KG4A 3PZPA 3WNGA 1NK9A 5I42B 4NYZA 2FC0A 3VQ4A 4O0JA 4IR9A 2KQ2A 3NBPB 4DSIA 4CHQA 4O4RA 2B6AA 1JLAA 4Q45A 2FBYA 2WONA 2IM2A 5L1JA 4JV0A 4J9PA 2BE2B 3E01B 3CDUA 4QWBA 5DQHA 3C6TB 4B3OB 2WONB 3P5JA 4WZQA 2AGPA 3JSMA 3RRGA 1JLAB 1BIUA 1EP4A 2D7SA 2V9WA 3G0ZA 5C25A 3PX4A 1UA1A 4KAZA 1T03A 4AHTA 4ED3A 1KVBA 1TVRA 4AHSA 1X9SA 3BQ1A 4KPYA 1SV5A 3LP0A 1ITGA 4M3YA 5KG2A 4EZ6A 1S9GB 3QEXA 2PYLA 4KTZA 2YKMB 5J2PA 1ASUA 3ZT3A 1KLNA 2O4GA 2P51A 4IFYA 4Y2AA 2I1RA 5KFNA 1NKBA 2D0CA 5DLFA 2XGPA 1ZETA 4AHCA 3QO9A 1D9DA 3V4IA 4IBNA 3ZSWA 4DTXA 5KG1A 3N6LA 4ZPAA 1DLOB 2HNYA 1IKXB 2DFEA 1S49A 3S9HA 4IFVA 1RTHB 3CM5A 1FKPA 3L2WA 3T19A 3KLIB 2YNIA 4J9NA 4O3PA 2FJXA 2CKWA 3I0SA 3OHAA 3ZT4A 3CIZA 3KLEB 5J2MB 2QE5A 4K8ZA 4LSLB 2Z1IA 4URGA 1X9WA 3TANA 1VSEA 1K6YA 3T5KA 4CHZA 1RBVA 2IM1A 2X78A 1S0MA 1DTQB 4CFBA 5KFDA 4IRKA 2RDIA 3C94A 3G6YA 1C1CB 3KKSA 4KE5A 3QEVA 5FRMA 3SUPA 2VG5B 2Q3SA 1IKYA 1JLQB 3HP6A 5HROA 3O4QA 4DQIA 4CGIA 3PUFA 2D41A 3HVTB 1RCHA 3SZ2A 5HRRA 4LH5A 4JRPA 5J2QB 1IG9A 4OJRA 3QESA 3CG7A 4WFXA 4ECYA 4JRQA 4ICLA 5CZ1A 5KG6A 4K4YA 2PYJA 2ZKUA 3BSNA 2W8LA 1HJRA 4I2QB 3PR5B 4LSNA 3OL9A 3LPUA 2IDOA 4ECZA 4CF1A 3RRHA 3H2LA 3LP2B 4BE2A 2IAJB 5CZ2A 1U09A 2HNZA 3DDKA 3RR7A 5J2NB 1RYRA 3MF5A 1EETB 1Z25A 3PO4A 4NZ0A 1RTDB 2RDJA 2QV6A 3EPIA 2DPIA 1QSSA 3ASMA 3OYCA 3LP1B 3DMJB 2W9CB 1RBTA 1HRHA 1L5UA 3HSTB 3V1QA 2D3ZA 4F4ZA 5KFPA 5D3GA 2HHWA 4ZVGA 1KLMB 3O3FA 2AX0A 1RDDA 4FJHA 4CHOA 2AWZA 4O44A 2E9ZA 1SKRA 3QERA 5JXSA 4JV1A 4AILC 3AV9A 4R8UA 4CJKA 4KAIA 1FKOB 4E1MA 3I0RA 4ZP7A 4DEZA 2FLNA 1WAFA 4MQ3A 5KFEA 2I5JA 4FJ5A 4GVMA 5FDLB 1K1SA 4FLUA 3ITHB 1G15A 4F2SA 2OZMA 3JYTA 2KZMA 3IG1A 4OPKA 2XGQA 3TAQA 3O4NA 4OLAA 4CJEA 1S97A 3VQPA 3HT3A 1T94A 3H59A 5KFGA 4URSA 2R2UA 4E7LA 2HHVA 2WHOA 1TKTB 2OA8A 2UVUA 4CECA 3PJWA 2IA6A 3LZJA 4TY8B 3OSPA 4DL4A 1HYVA 4H4OA 4M3RA 4W5TA 1HMVA 4CJUA 4E0DA 5CYMB 4ZHRA 3ULDA 2HAIA 3EYZA 4Q0BA 2ATQA 2JC0A 2ZE2B 4JLHA 2EHGA 4XIUA 3K5OA 4KKOA 1TGOA 4OKEA 2W9BA 4WFZA 1NOZA 3CFPA 2Z1HA 1BCMA 2GC8A 4CJWA 4DFPA 2OPSA 3I5AA 1C6VA 3QEPA 4KHSA 3PW2A 1HNVB 3U6FA 3MTKA 4O3OA 1NK0A 5KT5A 2ATLA 2D3UA 4NLWA 3H4DA 2QKBA 1HNVA 3UIQA 2FVPA 1A5WA 3P83D 5DGBA 3G86A 1NKEA 1X9MA 4YMEA 3AVHA 4RW9A 3RAQA 4CE9A 3CQ8A 1C1BB 3OVNA 3V81A 3WNFA 2C22A 1RA7A 2ZE2A 4IR1A 3SNNA 4EBCA 3DRSB 2WCXA 3SUNA 2YV0X 4QAGA 4IDKA 3TAPA 3I5CA 4Q44A 3SV4A 4F3OA 4OLBA 4OGCA 3KLVA 1QSLA 1Q8IA 4Z4GA 4TY8A 3PW4A 1MU2A 3QIDA 1BHLA 3K5LA 1QTMA 1OS5A 2O5DA 2W9AA 1C0UB 3RMBA 3CFRA 4ID5B 2E6MA 2W7PA 2OZSA 3FDSA 4ED7A 1VK0A 3LANA 3IG1B 2OPQB 3KK1A 4HUFA 5EUHA 1ASVA 4KB1A 4YR3A 5FDLA 1ZTWA 1QAIA 3LP3A 2I5JB 2OPPB 3AO2A 3NGDA 2RKIB 3ZT0A 4HCBA 3I0RB 1NJZA 4YR0A 3EY1A 3CDEA 4KRFA 4JS4A 4NLQA 3AO3A 4X2BA 1UOCA 2W8KA 1HYSA 2F8SA 2FLLA 4BDZA 1SH3A 4CGJA 1RT2A 4FJLA 3V9XA 3OL7A 3KLHB 3BREA 5D3GB 4W5RA 2UVRA 3SI8A 1SL0A 4FZXC 4NLTA 4G1QB 1JLEB 4NCGB 4DWIA 3VQ7A 1I3AA 2UUTA 4E7HA 1BCOA 3MECB 3T5HA 2V4QA 4NLOA 1YTAA 5F8IA 4RUAA 4CESA 2YNGA 1J5OB 3TQ1A 2ASJA 4ZTJA 2QK9A 4PUOA 4HYKA 1EETA 4FS1A 1RT6B 5EWEA 4TSXA 3V6KA 3OJUA 5K14A 2AJQA 3OL8A 4B9VA 4J2AA 4NRUA 3PJXA 5F8JA 5FRNA 1JLCA 1KVAA 2HHUA 1S1WB 3MEDB 1L3SA 1RTJA 4KFBB 1FK9B 3LWLA 2XC9A 1TK5A 2QKKA 1QHTA 1CSJA 1NK6A 5KFQA 4HTUA 2HVIA 1KFDA 3VQ5A 1KSPA 2UVWA 5KT3A 1YVFA 3HVTA 3QGHA 3VQQA 5J1EA 3IRXB 1REVB 4RNFA 4DTPA 4ZPCA 1LAVA 2OH2A 1ZBIA 1L3VA 2OPRA 3K57A 3MR2A 4J2EA 4YQWA 1S6PB 5KT2A 4FLXA 3RB6A 1RDCA 2G8HA 4IG0B 2O4IA 4IG3A 1BQMA 2BQ3A 1XI1A 1WN7A 4HHTA 3WNEA 3D0PA 1FXXA 4LSLA 2IC3B 3T1AA 5F8HA 3IN5A 4KHWA 1JX4A 3V9SA 3AO1A 3HHKA 3KLIA 2WOMB 4ED8A 3D28A 1TL3A 4ECQA 1S9EA 2XHBA 4ZPBA 1IKXA 1W9HA 3N6MA 4BDPA 1GX5A 3SQ0A 1JL1A 1IM4A 5KG0A 3OYJA 1HQEB 2ASLA 2VG7B 3OYDA 3QZ8A 5KT4A 4B9UA 5F8MA 5KTQA 4KREA 3MXMA 3RMCA 4RNOA 4DTJA 3QZ7A 2VG6A 3FQLA 5DG7A 3UR0A 4CEZA 1C0MA 3H5UA 1KHWA 2EC0A 2EX3A 3HVWA 2BDPA 3Q8SB 1SL2A 1WAJA 4QOZB 1T03B 3BGRA 5F9LA 5C25B 4E7JA 4I9LA 3OJSA 4OVLA 3MFHA 4DU3A 4M42A 4DF8A 2KW4A 1SUQA 3PX6A 3E01A 2BE2A 4E3SA 3G6XA 4DQSA 4B9LA 4ED1A 1SUQB 5HRNA 2B6AB 4IKAA 3PX0A 2HMIB 1HNIB 4N56A 3CJ4A 1RT3A 4HCCA 1XWLA 5HBMA 2ILYA 3AVKA 2P5GA 4QWDA 1NHUA 3KMQA 4RW7B 3IGVA 3UQSA 1JIHA 2XI2A 5KG3A 3OL6A 2VG6B 1TV6B 4ZVFA 3OY9A 1LAWA 1WSEA 4H4MB 2VWKA 3FQKA 2IMWP 2HWHA 4MK8A 4YR2A 3ZSOA 2JLEA 4C8NA 4ZVHA 2NUBA 4ELUA 4RG8A 3GIIA 1VSIA 4UQGA 2AX1A 1A5XA 3V1RA 2DPJA 4B9SA 1QE1B 3HPOA 4PQUB 4CK1A 4Y1DA 1RT4B 3RB4A 3DI6A 1UA0A 3TR8A 4WFYA 3EZ5A 4DFJA 3THVA 4DFMA 3FFIA 2E4LA 5DLGA 1BQMB 4H8KA 3DLGB 1RBUA 4GMJB 3MEEA 1HQUA 3F73A 3KJVB 4R5PB 3OYEA 4B9MA 4URQU 5FROA 3Q8PB 1B9FA 1WSHA 4DTNA 3H98A 1QS4A 3OYFA 3QLHB 1EXQA 2XI3A 1S6PA 3ZT1A 4LQ3A 4CJVA 4CF8A 4CJ3A 4J9LA 3KHRA 1W25A 4RW4B 1BIZA 5F9NA 4DG1B 2BQUA 4AH9A 3DM2A 3KOAA 3NAIA 5C5JA 4F4WA 2J6SA 4DSLA 2W42A 3ISND 4JUZA 5HRSA 2HVHA 3OYKA 1RBSA 1B92A 4WZMA 3BQ2A 3V6DA 4O3NA 1S1WA 3MEDA 2R2RA 1VSHA 4KHNA 5I3UB 3M8QA 3BSAA 4FJGA 3B6OA 1MMLA 3CM6A 4DFKA 2ZD1A 1S1TB 4FJJA 3M8PA 4NLDA 3U3YA 1S1UA 4Z4IA 3CFOA 4CJQA 2DFHA 3M9OB 5CYQA 3MEGB 4WE1B 3Q8QB 4I7FB 3KIOA 4G1QA 3SJJA 4M3WA 3KK2A 2G8UA 1VSJA 5HLFA 1S4FA 4EBEA 4DQQA 1KRPA 3N6NA 1HPZB 4AHUA 4K50A 4IKFA 4TXSA 4C8MA 4NLXA 3TAMA 4EO8A 3SPYA 4ECRA 1HYSB 3GIKA 2YKNA 4CHNA 1K1QA 3DLBA 1IKVB 1NJWA 3NH0A 1B9DA 4MFBB 3GIJA 4M3ZA 4I2PB 1D1UA 1CZBA 3QIPB 2BRLA 3DYAB 3KK3A 2IOCA 1C0TA 2FJWA 1TKXA 4Z4EA 1Q9YA 1C0UA 1NK4A 4ECTA 3AVFA 4E7IA 2BQRA 2X74A 4MKAA 1RNHA 3SQ4A 3MAQA 1S1XB 2YHBA 3ZSXA 4DLGA 3E51A 3A2FA 1RDRA 3NMAA 3GILA 3QNOA 1ZBFA 3DRSA 3KNAA 4CHPA 4NCBA 1S0NA 5EWGA 2WTFA 4F50A 3VA3A 1Z4UA 2R8HA 2JEGA 5KFOA 4FK4A 4BWJA 2AU0A 3OYAA 5KFWA 4IH5A 1BI4A 1KTQA 4EYHB 4E89A 2X6SA 5JUMA 4RUCA 3HM9A 2IJNA 3CJ0A 4L8RB 4RW9B 1T05B 4N47A 4DQRA 4WYWA 2UVVA 3H4BA 3PV8A 3KLFA 4CF0A 4KO0A 4KO0B 4CJLA 2ITGA 1SKWA 1SH0A 3KLFB 3OLBA 2RF2B 1IKWB 4DL5A 4CJRA 4MH8A 4XPCA 2GUIA 1LWEA 2F96A 5JS1A 3O3GA 3BJYA 4J2DA 4DL6A 4NLPA 1D0EA 5DG8A 3NF7A 4CEDA 3HO1A 4Y1CA 4Q0BB 1WLJA 4J9RA 1N6QB 5KRSA 1HMVB 3TAEA 2ILZA 4NLRA 1EKEA 5T14A 1S1VA 1S1XA 5KFCA 1YT3A 2HNDB 1UWBA 1R0AA 3AVGA 1VSKA 4F8RA 3QNNA 1TKTA 3OLAA 4Y2CA 4CFAA 4CEBA 2BANA 4J9OA 1TKXB 1C0TB 1S0OA 4OKKA 1LW0A 2BR0A 2G8KA 2F8EX 2WRMA 4CJ5A 3KK3B 1NKCA 3NH1A 4I2PA 4IRCA 4ELTA 5L1KA 3RR8A 2FBTA 4LH4A 4OGEA 3TAFA 4MFBA 1U48A 4FJ8A 1WSFA 4NRTA 3AVAA 1ZBHA 1O1WA 5DQGA 1FKOA 5EWFA 3CJ5A 3L2UA 4CK2A 4CIFA 2ALZA 3TABA 1CLQA 3TAMB 3NDKA 1XR6A 3TVKA 4O44B 4FM2A 1Q9XA 1XC9A 3RBDA 4DS5A 4EEYA 4EBDA 5KFAA 3KK2B 1UWBB 4FJIA 3TI0A 1RT5B 2VA3A 5SWMA 1YVUA 3KHLA 1T7PA 3PW0A 3MEGA 3KLGA 2HHXA 3DRPA 3LP1A 3SPZA 3VQCA 3FRZA 2R8IA 1S1UB 3KTQA 1ZBUA 4I9QA 1VRUB 1VSMA 5C42B 3CO9A 5SZTA 3G10A 4FJXA 4W5QA 3HVRA 1RTIB 1RT1A 4QWAA 2HNZB 4FBUA 4EO6A 1J9AA 3LP2A 3MXJA 5KFIA 1IKWA 3OYIA 3I5BA 3MFIA 4LD0A 1J54A 3NL0A 2IM3A 4FYDA 2KFZA 4DF4A 4FLWA 3PW5A 4QW8A 4FW2A 1RAJA 1XR5A 5KFRA 1SKSA 4WXWA 4DG1A 4BE0A 1BI4B 5KG7A 3L2VA 1N5YA 4M3UA 2B5JB 3S3MA 4O3QA 4FXDA 5F8LA 3QLHA 4FJ7A 1U04A 4IOBA 4AHVA 4BACA 4IH7A 4TN2A 1Z26A 3ZSYA 4CJTA 4PWDA 1JXBA 4OKJA 3V9UA 3MXIA 4TYAA 3MEEB 3DLGA 4EYIB 1RILA 4J9SA 4XPEA 2HW3A 3KHGA 3RTVA 3T5LA 5KFKA 3NF6A 3UPFA 4KBIA 3HPGA 3QINA 4QCLA 4N76A 4ID1A 5HRPA 3DYAA 3QIPA 4BDYA 5T7BA 4PQUA 4KSEB 1QE1A 2AGQA 4FCYA 4KV8A 2G8VA 1A5VA 1WSIA 2FLPA 2P5OA 4ZVEA 2Z1GA 4QWEA 3GV8B 3D45A 3V6JA 3DLEA 3QO9B 3ZT2A 3LWMA 4HVJA 3SYZA 3KMSA 5L1LA 3Q8RB 4N5SA 1HPZA 1NOYA 4IH6A 1TK8A 5KT7A 2F8TA 5HLFB 4H4MA 1QAJA 5DK5A 2ZQBA 3DOLA 1CXQA 2HHTA 4ED6A 3ICLA 3VQEA 4DTUA 3BDPA 4FK0A 1QSYA 5HBMB 4CJSA 3K59A 5KFFA 3C6UA 1KCFA 4Q43A 3M8PB 1S1TA 4CK3A 2HMIA 3RAXA 4O3SA 4F4KA 3SQ1A 3NF8A 4B3OA 3C6TA 1CXUA 3TAGA 4ECVA 3HPHA 3VQDA 2KFNA 1L3UA 1JLGB 4CF9A 2HWIA 4M95A 1X1PA 4CJFA 3CYMA 2G8IA 1U49A 4RU9A 4ECSA 3V6DB 2BRKA 5EU7A 2XO7A 1D8YA 3BGRB 4KI6A 1VSFA 4B9NA 2JEJA 4K4SA 4KI4A 1J53A 5DMRA 3AA5X 3NFAA 4RW8A 2FJVA 3IS9B 4O4GA 1NJYA 3AVJA 3DM2B 4PY5A 4DTSA 4H54A 4IRDA 4CGHA 1JKHB 2YNFA 1EX4A 5HP1B 3TWHA 1DTTB 3EPGA 3T3FA 3AA2A 4OPJA 3BR9A 3OSNA 5KFTA 1HQEA 4ED0A 3L2QA 5F8GA 4K4ZA 4FM1A 5KFMA 3PHEA 4DQPA 4R5PA 1JXEA 1S9EB
chains in the Genus database with same CATH superfamily
1V5IB 1C2PA 2QGFB 2WOMA 3LZIA 2F8HA 4DV5K 4CEAA 3I31A 3AAPA 1RT4A 4DTMA 4TQRA 3KWIA 2YNHA 1KONA 3ALYA 1IH7A 3Q7CA 2JEFA 1RAOA 1V4TA 2DFFA 3BB5A 4LRCA 4X66F 5C24B 4K4WA 5CAAA 1VJWA 4OHZA 4X65J 4BRFA 3TARA 4ILRA 4DR6K 2ASDA 4C8KA 3GIMA 3JTNA 4QIFA 2HLTA 5B0CA 4UZCA 4RNNA 1JKHA 3FUYA 5J1EB 2E7XA 4MYUA 1WKJA 1B0VA 2EC2A 1K9MT 2CQ1A 1T3OA 2V0NA 3IS9A 2P9NB 3DOMB 4TQSA 3HJFA 1U0HA 5BYRA 5KFVA 4F4YA 2WW8A 2OO4A 1KOHA 2UU9J 4IOAQ 4WQ4C 3ILIA 2RB7A 4KTWA 2A0FB 2HQ3A 4PUOB 4QR2A 2C3PA 2DGXA 2HFVA 1AW0A 2B0GA 4ZP6A 3NH2A 2XQCA 1R8CA 2B8PA 4BQLA 3A3NB 1T9UA 3CMES 5DZ7A 2ETJA 3DU6A 2FVRA 2GBZA 4NLUA 3O8WA 1QUVA 5IZHA 3G6VA 1Q81T 2V5HG 3ZX2A 3O9QA 4CLKA 2HF4A 3K9KA 1VBXA 1NJXA 4PL7A 1XR7A 3CCJS 1M1KT 3MAAA 2RKIA 2I8EA 4KV8B 3KUHA 1RT7B 4CO4A 3QGGA 1NK8A 3H08A 3I87A 1CS4B 3ZZYA 3MMAB 3X3UA 3WBZA 3HL8A 4OLPA 1U2VB 2GX8A 2HAFA 2V8PA 1DY3A 3MXHP 3P45B 1TL4A 4IG3B 3EDQB 2UUCJ 3NE6A 3OYHA 4DV5J 4Q8FA 3F9KA 2J6UA 3L8BA 4HT7A 3BYPA 3VN5A 4QOTA 4LF5J 3H45C 3D7SB 3AA3A 2W4CA 3OFFA 5DDOC 4HH1A 4C8LA 4ZTFA 4Y3CA 5A8RB 4N41A 1FFGB 5CE3A 1NMNA 4GW6A 4AT1B 2PI5A 3HZ6A 3N5FA 2JFDA 3CJ2A 1U2FA 2G1DA 3NAHA 2ABYA 5LSLA 3OS0A 2AYBA 5D6GA 5IT9O 3DDNA 1IBLJ 3OYNA 1JXVA 3HZGA 3MWTA 1FDBA 4NZ6A 1W2BM 3CXCR 1VQKS 1ITPA 3S3NA 2OPSB 4OMFG 3PLAA 4E7KA 2YWHA 2D0AA 4DPXA 3C95A 4RR5A 1RTIA 4AXIA 2QA4G 5C42A 3W2WB 4JI0J 1TL1B 1VRQC 3VQ9A 2DY4A 2J0WA 2J0SD 4U8VA 5HANA 2O67A 1R3NA 3DRPB 4DV0K 3KLGB 5LXYA 1JLEA 4NCGA 2E9TA 3SQ2A 4J7CA 2PMHA 2NRWA 4E2FB 1N52B 3HXMA 1GOCA 1RT2B 1VRTA 2P9GA 1HI0P 1D4XA 4FVMA 3EICA 1WUUA 1QQCA 4CNYA 3OYGA 1YTUA 2R8KA 3AVNA 4KQZA 4KHMA 3WQUA 2V94A 1BWVA 1SI9A 4J9MA 4F3QA 2NRZA 2P5VA 2VDHA 1S10A 4W5NA 2KH9A 4DU1A 1Q8BA 3AT1B 2E44A 2F7TA 5AT1B 2HQDA 2OPQA 3KK1B 2UXDJ 3SCIE 2IJFA 2DCLA 4RZRA 1VRTB 1FDNA 4OI4A 2V2KA 1ZBLA 2VPXB 1R0AB 2O3DA 3OFGA 2CWKA 4JN4A 3MR5A 1X5OA 1S6QA 1S1VB 2PFFB 2B43A 1ZYQA 4CEFA 3DMJA 3BGUA 1N6QA 1VQ4S 4ZMMA 1LEOA 5KFLA 1RTDA 3L3UA 3AD9C 3PR4A 3CJRA 1TAUA 4CZJA 1P9QC 4F3TA 4U67Q 5K9FA 4MIAA 3GTYX 2X7IA 3O3HA 1PAEX 3D54A 2RF2A 4ZVTB 5H9EJ 2PGCA 4KH6A 4LSNB 5KFXA 3QBXA 4CEQA 4FZZA 3H2UB 3DLLQ 2OMOA 1UETA 1ASWA 2WTUA 1T05A 3BM7A 1YG0A 1RZMA 1X4HA 2DJWA 3GFHA 2DITA 3OYLA 3EZWA 2A3ZA 5KT6A 1S3XA 3VQ8A 4CTAA 2ATCB 2M8HA 3T9NA 1T3NA 4IO1A 5AQFA 2WSEC 4BRQA 2VA2A 3OS1A 1IKYB 4B08A 2KT3A 4NLCA 2UUBJ 1RBOB 4U67L 3MMCA 4OZ5A 2QSFA 5FPEA 3SCKE 4L73A 2ZBQA 1X4GA 1DTQA 2WBRA 1CZ9A 2UUAK 1RA6A 1IWGA 1I6JA 1RAFB 3Q2SC 3EZUA 1WSGA 4JK8A 1NSQA 1ZTTA 3AD8C 5JS2A 3MM8B 3V9WA 2YNIB 2VODA 4CDIA 4KHPF 5FPDA 1HWJA 4JI5K 1RTHA 4UUWA 4R0JA 3PYEA 4DUZJ 3OTOJ 1IKVA 3QRRA 2CJQA 2D9PA 1URRA 1V3ZA 2R42A 1CJVB 3MD3A 3V4IB 4ZP9A 4JYAF 3UR3C 1VFJA 1FD2A 4HHJA 2VU5A 3NS7B 1X4EA 3H5YA 3U3GA 3D2WA 3C7NB 4KJIA 5AZIA 4WE1A 1KN6A 2BJ8A 3SK3A 5CYQB 2DY1A 1SV5B 3LP0B 1RHUB 1FJEB 2DRDA 1TVRB 2D1CA 1EARA 4HL9A 1RWVB 3LPTA 3G8TA 5DZ6A 4NO7A 4YORA 4BY9C 3O9RA 3R2DJ 1UWAA 3J7AP 2NRRA 3FSIA 1J6ZA 3VV2B 1TU0B 3C19A 1OH6A 3NBPA 4P74A 1NGJA 3LAMA 2HRTA 3EKSA 2YPYA 3VQSA 2AV5A 4DV3J 3DRRB 3HYFA 2NXCA 2QZ8A 3VA0A 3G6EN 3N28A 2FBXA 1N0UA 1ESVA 1WSVA 2ZH1A 1NGHA 4K59A 2PE8A 1YIJN 4NLYA 1HBUB 2D9OA 4IO9L 2BKNA 5GAHU 2CQDA 2VC0A 3UN2A 5CXTA 3C15A 5C24A 2JC1A 3M8WA 4PPDA 2ASMA 1BQNA 1M5PC 3E9PA 2YNHB 2MQ8A 3H40A 3GSDA 2GQQA 2VBZA 2QX0A 3I32A 2QXLA 3D0HE 3I0SB 4WQ5C 1RCOB 2HQIA 3UVJB 2GV9A 2R8GA 2HNYB 4DU4A 1YJRA 1Q5YA 2VOPA 3J7YP 3FRYA 2C2RA 1Y00A 3BEGB 4DL7A 2OYQA 3N4PA 2JZ5A 1FJCA 4X4NA 1DT9A 4OZ1A 1ZS6A 5D15A 3BKUA 3RU0A 4A47A 4LVNP 3EL2A 3ZNUA 4CWBA 5C2DA 2C2EA 2E1RA 4ILLA 3AB4B 5AQOA 3PRDA 2DB1A 3UD5A 3GCWP 3EXCX 1SJ1A 2W7OA 3GB0A 4USKA 4NASA 5B0EA 4JD2A 4Z4HA 1N56A 4GV6A 1RT3B 2BW2A 2RDDA 1U6ZA 2EVZA 4LMZA 2GW8A 4Z7CA 3CW2C 3C66A 2ZM6J 1FKAF 2WONA 3NG8A 4KRWA 4JV0A 3VZIA 2BE2B 2BH1A 3C6TB 3QQCD 1T9TA 3P5JA 3IWNC 2CDQA 2NYIA 3EDRB 3AXKA 1EP4A 3QFPA 2CVIA 4CH7A 1UA1A 3HZEA 1I94J 1T03A 1KVBA 4KY3A 1NM1A 2K8GA 3A4TA 4CLZA 4KPYA 4FF3A 4PEOA 4M3YA 4LRAA 5BREA 3R7NB 4KTZA 1N36K 1KLNA 3U02A 4IFYA 4E8UA 5KFNA 1NKBA 4LRFA 2YX4A 3C46A 4FOEA 3E3XA 4C3LA 1A7GE 2XGPA 4WFAL 3ET6B 2HRUA 4MKYA 3VAGA 1Z1ZA 3V4IA 3CDAA 2N4DA 4DR1F 3N6LA 1DLOB 2ZKTA 1KD1T 4OI6A 2HQGA 5LMUJ 3PEJA 2LQJA 2K1RA 1RTHB 3P38A 3DHXA 4QIWD 1T44A 2FJXA 4HHHA 3ZT4A 3CIZA 4DUZK 4K8ZA 2U2FA 4LSLB 4URGA 3TANA 1VSEA 3T5KA 1ZAXA 3SLCA 1S0MA 4K25A 4CFBA 5KFDA 5B0BA 3V2UC 4AQYJ 4CBWA 5L46A 4LF8K 1V4SA 3QEVA 3L7OA 3SUPA 4OYAA 5JVGQ 5HL7L 3M2UB 5G4DA 2Q3SA 2Y8YA 3TZYA 4I67A 2VGNA 2EK6A 1TUUA 3FZFA 1X60A 1JLQB 3PXGa 5HROA 2OTJS 3PUFA 2MKSA 4ZK7M 5HRRA 1KXPA 3WQPA 4JRPA 3MM6B 4OJRA 4Y2KA 5A8WA 1EIYB 4LFCF 1NO8A 2YH0A 3HHNB 2DY9A 2XS5A 2EG2A 4WJBA 3UNYA 2HURA 4ETZA 4I2QB 3PR5B 4LSNA 3CCWA 4K0KK 4CF1A 1BD6A 4AL5A 2QO3A 3KFWX 1U09A 4ILGB 4LF9J 3DDKA 1Z25A 3PO4A 4U7UK 3OTCA 2AF6A 2QV6A 3NGRA 3MN7A 2M4MA 1M90T 3R5GA 3CC4S 1JJ2M 3OYCA 2W9CB 1L5UA 2Q6BA 3HHLD 1KEKA 1E6YA 5D3GA 2HHWA 5DM6Q 3O3FA 2AX0A 2GHVC 2H1YA 2AWZA 3Q24A 3CF5L 2P9IB 5ADZA 3KNGA 3AV9A 4P2MA 3GFXA 3VPZA 5DDQC 4ZP7A 1WAFA 4MQ3A 3AY0A 4FJ5A 4GVMA 3CDBA 5FDLB 3VGUA 2GQ2A 5GAGU 3ITHB 5DO2A 2OZMA 3JYTA 3IG1A 4OPKA 1E4GT 2IDLA 1PIEA 2C42A 5A0YA 4URSA 3CD5A 5C12A 2HHVA 3CHWA 4AD6A 1EWQA 4AYBD 1KC8O 2ALYB 1NAQA 5LXRA 1WDDA 4OZ3A 3PIOQ 3UFCX 3VENA 4TY8B 3UCGA 3G4SS 4W5TA 4I4BA 3MMCB 4RBVA 3AJ1A 4JHDB 4FNHA 3WIVA 3WC2A 4BRIA 4Q0BA 5HSPA 3BGFA 2NUUG 2JC0A 2ZE2B 3BH6B 4JLHA 2H5JB 4DPTA 4BS2A 2VFSA 3W9IA 3K0SA 4OPHA 2NZ4A 2Z1HA 3D9BA 3VGSA 1RFQA 3U6FA 1NK0A 3WZ0A 2CJYB 4AXJA 3PFOA 2DCUB 3SQOP 2EKYA 2Z8QA 2QKBA 3UIQA 3HOSA 1R6VA 5DGBA 3BBCA 1M5OC 3G86A 4PG4A 2ZNZA 1LQ9A 3OVNA 4DR5J 2JJ4D 2GAGC 2ZE2A 2HQFA 2DPNA 3WHIA 5F41A 4IR1A 3DRSB 2WCXA 2DO0A 2EBEA 2XSJB 3I5CA 4Q44A 1M5KC 1Q8IA 1Z2ZA 2GX9A 4JI6F 3FE1A 3ISZA 3R5BA 4RWTA 3K5LA 5EXWA 2W9AA 1QUPA 1C0UB 3RMBA 2OZSA 1BLUA 3M6UA 2LU1A 4I6MA 2CA9A 1ASVA 1NH7A 4KB1A 5FDLA 1WC3A 1ZTWA 4NXMK 3ZZRA 2OPPB 4K7QA 1IR1A 3IC1A 1HBOA 3M6WA 3ZT0A 3E8OA 1NJZA 1ZAVA 3QGPA 5DM7Q 4X2BA 2W8KA 3GOIA 1GLLO 4MIWA 1V6HA 2ZBCA 2GIFA 3HULA 2XO6A 3V9XA 3OL7A 5JVHL 1FXLA 1UVNA 1KKHA 3OBWA 2ZHOA 1E6YB 3W5ZA 4FZXC 1Q1KA 4NX9A 3QJJA 1RDUA 2VQEK 2Q0UA 4K42A 3L4QA 3VQ7A 1I3AA 1BCOA 3J7YU 4EGLA 3T5HA 1IV0A 3QMLA 4DR2K 5F8IA 4NZ7A 2ASJA 3QT6A 2QK9A 4HYKA 1EETA 1CBKA 4FS1A 2G2ZA 2YH1A 4DJBA 3OJUA 3BBFA 4KH5A 3J81j 3OL8A 2EFGA 4B9VA 3NNHA 1N8RO 5E3AA 3CCQN 2DNNA 3G71S 3DJCA 2J9DA 3J7AN 1FK9B 3GE9A 2MSTA 3H0PA 1K47A 3IR6B 3K17A 1UJ4A 2W2OP 2HVIA 1YJWN 3M8ZA 2UVWA 5KT3A 1YVFA 2VPYB 3M2VB 5J1EA 4RNFA 1O13A 4A62A 3DGPB 2RU9A 2Z57B 2DGQA 2QWNA 4J2EA 4DR4K 1S6PB 1HNZJ 4JK9A 1Q8KA 3R5CA 1RHJB 1C4AA 4IG0B 2MKCA 4FWPA 4Y65A 2XMTA 1VQYA 3WNEA 1LKZA 1IBLF 1FXXA 5JVHQ 4WTOB 2IC3B 3T1AA 3M6GA 4ISFA 4WQ5A 1JX4A 3AO1A 2ADCA 3ZEUB 3HHKA 1IN0A 4BRLA 1JB0C 1K8AO 2N82B 1S9EA 1WEZA 4ZPBA 1M0SA 1FD8A 2QA1A 1JL1A 5JLHA 3QRQA 4F0HA 2ASLA 1TUYA 3CD0A 2Y0BB 4DN0A 4DR1J 3G8SA 5F8MA 4B9UA 5K8NA 4CZIA 3TOQA 3I82A 1MWMA 1S76D 3Q22A 1IR0A 1PSDA 1NJIO 1KVIA 3ILLA 2EC0A 4ILHA 3Q8SB 1SL2A 1Y5LB 3U27A 3BGRA 4I9LA 4ZLPA 1HLWA 3OPKA 4M42A 1F9HA 4DF8A 4MTPA 1IBCB 1RU1A 3J7Z5 8AT1B 3E01A 2BE2A 4CQ1A 3G96A 1KC8T 5HMYA 2V4JA 4B9LA 2VC1A 5BYQA 1ILYA 4QYRA 1RT3A 1DQ8A 3TA0A 2YJFA 3LDOA 5AZJB 5GMEA 5HBMA 2H4YB 3J80O 5EVZA 2ILYA 3AVKA 3VAHA 4QWDA 4RW7B 3IGVA 1L3KA 4ZLJA 2XI2A 2WAQD 2HVZA 4ERDA 2J8SA 4LFBJ 2AIRB 2A6AA 4YR2A 3CIPA 3TEGA 3J81Y 3THXA 5HOOA 4PCQA 2V68A 3GIIA 1S77D 2AX1A 3V1RA 2FLOA 4M5DB 2DPJA 2NRVA 3MM7B 5HQMA 2QLBB 1QE1B 3QATA 2R7WA 4PQUB 3OR1B 1RT4B 3JQJA 1ZM2A 3L3CA 4LIWA 3DHWC 2IMOA 2JNJA 1VIXA 3S01A 5ETLA 2DISA 3THVA 4DFMA 2RUGA 3FFIA 1N33J 3DLGB 3MEEA 3UNGC 3JTOA 2GJFA 3TX8A 1KQFB 1KAYA 4DTNA 3OYFA 4JI5F 3QLHB 4EMDA 2Q79A 1WEYA 1GLAG 3KXDA 4CF8A 4CJ3A 2NXUA 1N32F 2QM1A 4J9LA 1YBUA 1NRKA 3OBYA 1CULB 4WFAQ 3DM2A 1M1HA 5C5JA 2J6SA 4PRFA 1YITS 3VEVA 4ZCIA 3TNVA 3CI5A 1RBSA 4JV5K 1B92A 1RP5A 3V6DA 1T3VA 3IA0A 1H3DA 3W65A 3M8QA 3BSAA 2UXCF 1YF5L 5LL6Z 3B6OA 3MM9B 1MMLA 3CM6A 1QQOA 2OJ3A 1S1TB 3M8PA 3HJVA 4NLDA 1HPMA 2F8MA 4CJQA 2NSCA 5DETA 5AQXA 1VYAA 3KYLA 2LDYA 2ZM6K 4I7FB 4M3WA 2G8UA 4JKGA 1S4FA 2A2CA 1KRPA 1FFSB 3I4HX 3TP2A 3GMGA 2NRHA 4TXSA 4A8YA 1H2TZ 3BKTA 3SPYA 2VYPA 2YKNA 2A42A 2J7KA 3CCLN 2YX6A 1VQ6S 4RPFA 4A8SA 1J2VA 3ATVA 3D2EB 1VQKN 4M3ZA 5A2QY 2HS0A 4I2PB 2IVOA 1Q79A 3QIPB 4FPBA 4M5JA 1FTRA 3OTOF 2FJWA 2FQQB 1TKXA 4USUA 2LECA 2IJRA 4FN5A 4RUBA 2J9EA 2GEMA 2RHKA 1NK4A 4JI3K 3DRYA 3VAKA 1RNHA 2VL1A 2YHBA 1S1XB 4DOZA 2AJ0A 2ZOFA 1RDRA 2XSJA 1EQMA 4DHYA 3KNAA 4NCBA 5EWGA 3LA0A 2N7YA 2R8HA 3H6EA 4FK4A 9RUBA 2GGPA 4LRBA 1KTQA 2M3DA 2X6SA 3ENOA 1QAYA 2R7UA 3A3PB 2H3GX 2HEKA 4LFCK 3ENVA 4DQRA 2B9WA 1XQSC 2QWLA 4CF0A 4DDFA 3IMQJ 4BRGA 4CJLA 4YB5A 3ID6A 2O8BA 3BYRA 2CH5A 4AL7A 1SKWA 1YIJS 3F2KA 2RF2B 1WD6A 2DT9A 2CPJA 3GYGA 3R9LA 5JS1A 4OI1A 1RWNB 5F0WA 5G0RB 4DV3F 2E1YA 4DR5F 2VB6A 4Y1CA 2V63A 2F9WA 1WLJA 2H48B 1HR0K 3NOGA 3KWMA 1S1VA 5C2FA 3VAMA 2XYPB 4F36A 1VSKA 1PYTA 3QNNA 2C1EB 1TKTA 2F3JA 2OAUA 4CH0S 4J9OA 1U0SA 4V19J 1LW0A 3TSQA 1OSCA 1NKCA 4I2PA 1HBNA 2FBTA 4CZKA 3AOAA 4LH4A 4OGEA 4KGZB 3CJKB 1U48A 3CNQP 3L95X 4O8UA 2NZTA 1FKOA 1NSKL 3ZLJA 3CJ5A 3I8BA 4CK2A 5EOYA 1I94F 2ALZA 3F44A 3TW0A 3TABA 5GAGP 1CLQA 1SB6A 3NDKA 3D68A 3TVKA 3NOCA 3M6VA 3TUPA 2B7BB 3ILOA 3ULEB 4FJIA 3CMAS 1RT5B 3KHLA 1U26A 3BF1A 5K8PA 3GBTA 1FX4A 4OZ0A 1HNZK 3SPZA 1S6OA 1AT1B 3UN5A 3FRZA 2R8IA 3KTQA 4DR4J 1VSMA 5C42B 3CO9A 3W2WA 3NVMA 2BXJA 1ZC6A 5G0RA 2XM3A 4QWAA 1PC4A 4FBUA 1J9AA 4LF7J 2P9KB 2ZH2A 5I9EB 3G87A 1IKWA 3U1NA 1J54A 2MKHA 1FRJA 2YX1A 3K7RA 4FYDA 1JMTA 1MMNA 4FLWA 1O0PA 3PW5A 3GJQB 1PC5A 4U7UD 2P9UA 4FW2A 2CQIA 4MLHA 4CLTA 4IOAL 1XR5A 2HMPA 3CC2S 5KFRA 2X3GA 2BUNA 1NG9A 2FXUA 4ID8A 2UUAJ 5KG7A 3PKMA 3W5XA 5F1XA 1HBMB 1XMQK 2FZKB 4WIIA 2PN6A 3NS6A 3FMBA 1JNZB 4FXDA 3ZXWA 3MN9A 5F8LA 4FJ7A 3K8WA 1EWRA 1BA0A 4AHVA 2WSFC 4YOYA 4IH7A 3ZSYA 1JXBA 1KQKA 4TYAA 3FZBA 1DARA 4GO5X 3DLGA 1QDUB 3W2VB 2FHKA 1OKJA 3T5LA 5KFKA 3NF6A 3HPGA 1TFYA 5B8HA 1FA0A 4DV2F 4B1YB 2ZJPL 4OZNA 5K5MA 1YK9A 4M7XA 3MR7A 1YJ7A 4X65K 3D2EA 4LF4J 1M5HA 3Q8VA 3DXSX 4KV8A 4O23A 1A5VA 3MAAB 2MEWA 4EU0A 2Z1GA 2NCKL 2OI2A 3GV8B 3D45A 2XNRA 5KOXA 4IH6A 1TK8A 1NMDA 3VWSA 2P9LB 1QAJA 3DOLA 3VQEA 2UXBK 3BKFA 3BDPA 3BN4A 4FK0A 5HBMB 2GO8A 1KAZA 4HDGA 1VDHA 3TO8A 3WX4A 1NGBA 5HI7A 3RAXA 1YLXA 5I3PA 3NF8A 2ASOA 4B3OA 1EKRA 5LY3A 2DKOB 3HPHA 3VQDA 1JLGB 4CF9A 3US5A 4M95A 2WUSA 4IEEA 4RU9A 1SIZA 3V6DB 2XEXA 4LF5K 3BGRB 3CJQA 1RWUA 3A8YA 2Z4PA 3AA5X 1P1LA 4USIA 1NJYA 2P9SA 5FLXU 4GVBB 1AROP 4OYWA 1Y0HA 3T3FA 4L72B 4MMOA 3AA2A 1XIQA 2UXCJ 1OY8A 4FM1A 1D8ZA 3PHEA 4DQPA 5FJ4A 3THPA 1HNWF 4IOXA 3CCRS 1YJTA 1TL3B 3U8XA 1LNQA 1UJ6A 1NSAA 4DV6J 3PIPL 5F3TA 4ANDA 2IC3A 1RKJA 3ADAC 3RB0A 1NK5A 4DPUA 4P72A 3D2FB 4B1WB 4M5DA 4KHPJ 2OKQA 1F0XA 2LXUA 4JI2K 2E5JA 3HKZD 3LAKA 2XWXA 4R25A 3AO5A 3W64A 2R2TA 1SVDA 1RYSA 2OPRB 2G4BA 1R43A 2D1KA 3DLJA 4MDAA 5AQKA 1LW2B 3SFGA 3MR6A 3NAEA 1QVFR 2YNFB 1GK8A 3BUZB 1UAWA 1JXLA 2O8DA 4FK2A 3K2PA 3L4IA 5ETOA 4FKYA 3ENHA 3THYB 3Q86A 3M8SA 2RH3A 3L2RA 1HNIA 4WXOA 2VQEJ 2VBWA 3KD1E 3JTPA 3MOZA 2V4JB 3ID8A 3RW7A 3IDHA 2QLXA 4NCAA 1JLBB 2UYTA 3Q89A 1YVNA 1S72N 3BZQA 3TU5A 1FWPA 3D6TB 1BU6O 3HHDA 4RW6B 2GCFA 2OLWA 2YWEA 3C6UB 3ZZZA 3NS5A 4K4XA 4J2BA 2R7VA 4QZVB 2RN2A 3OUYB 1F3FA 4X62K 1DRZA 5KOWA 3MN5A 3CCTA 3QYYA 4FLYA 3PKYA 3KLHA 3AVMA 1UJ5A 3IAYA 2IYIA 1LV5A 3UE5A 4CEOA 2VFVA 4DLEA 3L6QA 2QL7B 4JKFA 4WYLA 2AYEA 2OFHX 5IWAK 1TP7A 2R2SA 3T6JA 2DNGA 1S99A 1HNXF 3MUMP 4YFUA 2CQ3A 3ZEUA 4BRAA 1RB0A 4Y6IA 5I4MA 5KPTA 5KFHA 2H65B 1NGGA 3QEWA 4DU8A 3GJSB 1MU2B 4DV6K 2E2NA 2JWKA 4IWVA 5AR0A 1Q7YT 2B5JA 1MWQA 3DGPA 2V9KA 2JEIA 2W01A 3K8VA 1REVA 3CPEA 3OTEA 1VC5A 3ENWA 4W92B 2LXIA 4IYQA 2HBZB 3MGJA 2I9SA 3Q8UA 2D4WA 5BN9A 5KFBA 1N5QA 4JI4F 2XY7A 3EE9A 3AD7C 2KVQE 2RT3A 4PG5A 5AXMA 2CADA 4CCHA 3H90A 2WK4A 5CCLA 5D0EA 5FPNA 2L9NA 4BWMA 2AGOA 4PKIA 1TUVA 1FT8A 2XY5A 3QJLA 4O3RA 4DTRA 1HARA 1I39A 1VAZA 2YWFA 3CJ9A 3B78A 2DYAA 5CH7B 1WOSA 1J5OA 1HKBA 4CGDA 1FRIA 2LYVA 2Y3YA 3QWUA 5CYMA 5AQGA 4RNMA 4I6WA 4H4OB 1O5JA 1S6QB 3P6YC 1GLBG 1RT5A 1WACA 3IWLA 3J81U 4LJMA 2IVMA 2ZBPA 1JLFA 3CMAN 2ZHAA 2B7CB 1L3TA 4KB0A 4PABA 1RAEB 2WW4A 4XH5A 3S8SA 2ACMA 3VQ6A 3KJNB 4WK1A 2B4JA 3VEYA 3C65A 1VQ5N 1WKLA 4YNQA 3VGVA 4NMLA 5BR9A 4LIRA 1HBNB 1ZBTA 1E6VA 3MR3A 2JFKA 2QSWA 2C28A 2YVSA 4DSKA 1RWKB 3OR2B 2HBKA 3D7EO 4ID5A 2HBQB 4DSEA 3SCXA 2DR8A 1NDCA 4ECXA 2XY8A 1JLFB 2GMJA 3IRWP 2UUWA 4DTOA 4CM0A 1JCGA 2XSFA 2ZJRL 4ECWA 3BP8A 1Y11A 3BPSP 5JLFA 5KFZA 1Y5IB 1RBRA 4AM7A 1TL1A 4JK7A 4RJVA 3OHBA 2FVQA 1YDLA 3CTRA 3SEOA 1D5AA 1LWEB 4EWTA 1HHSA 1TKZA 1R8BA 2BE7D 5T7LB 4BR5A 3ZSZA 5AQUA 3VF6A 2Y1IA 5AXNA 4CFCA 1N48A 2W25A 4J9QA 4FM0A 2FJDB 3UDCA 1GLCG 2W6LA 4PXEA 5IT9Y 5IM0B 2B51A 4B8CA 3UDEA 1CLFA 1UPPA 2LCWA 2W9BB 1QVGM 3JAMO 2LEAA 2PZSA 2A1SA 4ZVQB 5M2RA 1GX6A 2HKEA 2IFXA 3O5TB 4QW9A 4XH4A 1XC3A 4Y00A 2OTLS 4FDFA 2W2QP 4DV1J 2CPXA 3CMQA 4AF1A 1UPMB 2IGIA 1BGXT 4CGFA 2J9DE 4K43A 1YJUA 4X64K 1APSA 2YHAA 3W3SA 4PA1A 1U6FA 1YI2N 5J2MA 5LMNJ 4D3HA 1MWKA 2DR7A 1H2VZ 3KHHA 5GIPA 2IRXA 2J0XA 2CPEA 4V19X 4M3XA 2CGJA 2NYHA 2P6TA 3BBBA 3W3DA 1R8PA 4OZLA 1IG8A 3EEQA 2F1FA 4MKBA 4QU6A 3ZZPA 4JI3F 5CZXA 1VOMA 1YZ6A 1NBWA 4I69A 3MDFA 4A8XA 5AQZA 2EWSA 4OX6A 1HNWJ 3SJHA 2AEFA 4K4TA 4GMKA 4NLGA 1S12A 4UUXA 4I7FA 3UDVA 4X4PA 2CVEA 4J9KA 1GOBA 1S9GA 1RDAA 3CULA 4GKJF 3D5MA 3IKMA 3CCLS 4Q8EA 1BL3A 4RW6A 3VR1A 5KFUA 3K5NA 4CZEA 5A2QO 3L3VA 2P8IA 1EP4B 1RAGB 4TY9A 2VCPA 1XMBA 3JSMB 4NYNA 3O4WA 3KKRA 2IAJA 1JLBA 4H0OA 3PW7A 3OS2A 3WXIA 1YRTA 1JJCB 2LXFA 4B17A 4OV1A 3AGRA 2LU2A 1REGX 1WHYA 3RUBL 5AQQA 3VGKA 3C2PA 3EMTA 3RMAA 2XY6A 5C7PA 2H54B 1SL1A 4DSJA 2MHEA 1RGVA 3VQBA 4FOIA 3RWUA 1Y3KA 1Y64A 4KHYA 1UVJA 3CWJA 2RQCA 4IOCQ 1F21A 4CZFA 2UUBK 3AVCA 4H4KC 3AA4A 4F4XA 3HSCA 2BEFA 3VESA 1CC7A 2XCAA 3R1LA 1NPRA 2EFOA 1LWFB 1YITN 1VK3A 4B3SK 3UVJA 3FFIB 3DOKB 3T1YK 1KWMA 4OYOA 4KHPK 3BSOA 2G8WA 4OJ3A 2CJXB 4U6PA 3M9NB 4H5TA 3K0JA 1PJ7A 3FFKB 2UZAA 2Z1JA 3R8EA 2K1RB 3TUIC 2B4VA 2W24A 2XWYA 3NGZA 4DX8H 1EX8A 1ZA2B 3GZ7A 3AO4A 1IO2A 3OW2M 3NCIA 1DTTA 4EAHD 3OVAA 3MX5A 2QWMA 3CCVS 4GVBA 2H5EA 3SI6A 3TJ8A 4CIGA 4PAAA 2IBKA 1U47A 4RW7A 4RO0A 1AZSA 4DV0J 4DR5K 1YBTA 1BUXA 4CJ4A 4DBQA 1BA1A 1VSDA 1Y97A 4DHVA 4ED5A 3LDSA 2WVCA 2IIHA 1UEKA 3WNGA 2FC0A 5I42B 3VQ4A 4DI6A 5HL7Q 4O0JA 2KQ2A 4DSIA 4CHQA 4ZPVR 2B6AA 2FBYA 2V7ZA 1FNXH 2GWKA 3MMJA 2QJ3A 2CJAA 4W90B 2JX2A 4D3GA 3AXMA 1FJGJ 3W0LA 4B3OB 4WZQA 3T6BA 3SBTA 1BIUA 2IVNA 3M32A 4KAZA 4AHTA 1RUSA 1Q5VA 2FC8A 4QJVA 3IUCA 1C4CA 1T9WA 4JD2B 1F5BA 2VQFK 5KG2A 3GCXP 3D0IE 1KVJA 2YKMB 4UT4A 2E29A 5AQLA 4Y2AA 2A2DA 2I1RA 3F0NA 4PXCA 1U1KA 9ATCB 1MLAA 1F3VA 3O5BA 4BG9A 4CBXA 3ZSWA 3T69A 3R5DA 1CJVA 2UUCK 1U1QA 5B0AA 1IKXB 4ZCMA 2VASA 3L2WA 3PRBA 4C3MA 6FD1A 3U1LA 3KLIB 2YNIA 3I0SA 3D3BJ 1HNXJ 2I7NA 4B3SJ 2QE5A 1XK8A 1X9WA 4DUYF 1K6YA 3W2VA 2IM1A 4P2SA 5M2PA 2X78A 4RBTA 4FPRA 2CPYA 4IRKA 4WU3A 2RDIA 5DDRC 1C1CB 3C15B 3KKSA 1N34F 2M0GB 4DX5A 5AQJA 4P10A 2V8DA 5AE1A 5CD4A 1IKYA 1MDUB 3MCPA 5GMDA 2HSTA 1AUDA 3HP6A 1HBMA 4YDDB 4CGIA 3CPWM 3P39A 1RCHA 3SZ2A 3RRKA 4LH5A 5GAGI 5J2QB 2KDOA 1DHMA 2M9KA 3CG7A 4DV2J 4JI7F 4ECYA 1NZAA 3PIOL 4ZN3A 1VQ8S 3BGLA 4K4YA 2PYJA 4BC3A 2W8LA 1N5SA 3OL9A 3LPUA 1G3OA 1NDKA 3H2LA 2LEBA 4BE2A 5J2NB 1VBKA 3MF5A 4BRMA 3HOTA 1RTDB 1U24A 1QSSA 3SMPA 3ASMA 1FX2A 1RBTA 3HSTB 2RE1A 4BLGA 4DV4F 4F4ZA 2HBRB 5L39A 1R0CB 5F0XA 4ZVGA 2JHEA 3SBMA 4O44A 1G4CA 1NDLA 5KAKA 3BO3A 4G6VB 1DBDA 3IAS9 5JXSA 1C0FA 1VQ9S 4JV1A 1I94K 4XDCA 1E6VB 4KAIA 1FKOB 2OEKA 4BR7A 1PKUA 3IR7B 5KFEA 2I5JA 4OIXA 1SJ3P 5BN8A 2BM1A 4LF7K 3BDEA 2CGLA 1FRKA 3HT3A 1S97A 4PKGA 3CD7A 3H59A 3M05A 2Q43A 2R2UA 3WX8A 2RS8A 3UKUB 4MJKA 4M5IA 2X1BA 1FJ7A 2SXLA 2GQCA 3CJAA 2IA6A 1M1KO 4DU7A 3OSPA 4H4OA 4CJUA 5BPMA 1HX1A 3ULDA 2HAIA 2ROGA 2D3O1 3ELHA 2E1AA 2O01C 4YS2A 4JYAJ 4XIUA 2V8GA 2HG4A 2E66A 3IBCB 1NGIA 4WFZA 3A8IA 3ZYYX 2QL9B 3QEPA 4KHSA 1HNVB 2Z56B 2ZDOA 2O8BB 3W66A 4O3OA 3O6WA 2Y0SD 3GR0A 4NLWA 2F40A 1HNVA 3TA2A 2FVPA 3H3NO 2W1BA 3EM1A 1U1MA 5HATA 1F5AA 3N5BA 2BUPA 5M1OA 3CJ8A 2XMUA 3RAQA 1RHQB 3HCXA 4IEIA 1AXQA 2KXFA 1VQ5S 4KC5A 4F3OA 4OGCA 3KLVA 4Z4GA 1JK9B 3PW4A 2GV1A 5FPMA 1BHLA 3LL3A 3P3DA 1UFKA 4DR2J 1QTMA 4JP8A 2O8EA 3FZLA 4ID5B 2DEJA 4ED7A 1VK0A 5L38A 3LANA 4OYZA 2RS2A 2MQNA 4HUFA 5AE3A 1HW9A 3J7ZT 1XUPO 1QAIA 4CBUA 3AO2A 3NGDA 2GHPA 1QZ5A 1Y5NB 1P6TA 4YR0A 3EY1A 3CDEA 2MLYA 1UOCA 1OSDA 2X1GA 5E2QA 3AFGA 1SH3A 4JNEA 4CGJA 3AA8A 4DCOB 1FVSA 3CJ7A 3BREA 4EI2A 3AARA 2YPZA 4G1QB 1I1GA 1MMDA 2V4QA 1GQEA 1YKWA 4XAKA 1FXRA 3CC4N 1ATNA 4PUOA 1DAXA 4TSXA 5EWEA 3PACA 3V6KA 5K14A 1BQXA 1AYEA 3FZ2A 1SIWB 3PJXA 5FRNA 1JLCA 3A3OB 1KVAA 4K0KF 1WHVA 1S1WB 3MEDB 4WP8A 1RTJA 3ZTRA 3VAIA 3G82A 2DHXA 1TFWA 1TK5A 1Q78A 1WG5A 1X4DA 1CSJA 1GTEA 3LDQA 3RBXA 2F4VJ 3MM6A 4FKXA 2ZH9A 3IRXB 4FZVA 3A5MC 1NWKA 4Y2MA 1XQIA 4ZPCA 1NBEB 3O3LA 2C2OB 1L3VA 2G2OA 3MR2A 2PA8D 4BREA 1NDPA 3RB6A 1RDCA 4JI8F 3F41A 1URNA 1YXQA 4P71A 3N4WA 4JYAK 2EI5A 1BQMA 2WVBA 1XI1A 3RBZA 3T1HF 5MAOA 1S7IA 3HHEA 4FVUA 3PSIA 1ZZFA 3O1LA 4DR7F 4QS8A 5F8HA 5IOLA 1RWMB 2CWXA 1CG2A 1NH8A 1NZ8A 3KLIA 4L3QA 1Q86T 3MPUB 4FYXB 1VCTA 1TL3A 4FO0A 2M5YA 2IRUA 5CD4H 2DNPA 4J9VA 2XHBA 3DCAA 5H9EK 1GX5A 3THXB 4TU8A 3SQ0A 1VK8A 5CZVA 4PZVA 3AH6A 4B3RJ 5KG0A 1ZM3A 1VHFA 2VG7B 3OYDA 5KTQA 2CQHA 1VJQA 5DJBA 2NR0A 3LDNA 2CRLA 3C16B 3FQLA 5DG7A 4QYZK 3UR0A 4CEZA 2P9SB 2YQ3A 3PTWA 5TKYA 3OUYA 2KRRA 1KHWA 1XMOK 2CQ0A 2BDPA 4V19S 1N54B 5AZJA 1WAJA 4QOZB 4FYWB 1YTYA 3NMRA 5F9LA 1FRLA 5CCMA 3OJSA 1YAGA 4OVLA 4DU3A 1CJUB 2KW4A 5J1NA 4FWRA 2WB1D 3MWBA 1GMWA 3G6XA 3CIMA 3AB2B 1IBKJ 2B6AB 1X5PA 4C2MA 4DCPB 5D77A 2C2ZB 4HCCA 1RKIA 1XWLA 3NP5A 3OQ2A 4GKKK 2P5GA 1NHUA 3KMQA 3KZBA 3UQSA 1JIHA 2VG6B 3C16A 1U25A 3FQKA 2IBOA 4AFFA 1PJ5A 3ZSOA 2F9JA 2JLEA 4S0MA 1GLDG 4C8NA 4X4OA 4OI2A 4ZVHA 2UXDK 2NUBA 4RG8A 1VSIA 1EJ7L 1A5XA 3KJFB 2AP1A 5JVGL 3H2VE 4OHYA 1OPIA 4CK1A 2B4PA 3TR8A 1B70B 3CCZA 1VQ8N 3A8EA 3CCUN 3ZZOA 5DM6L 2L41A 3U9ZA 3HDSA 5AXLA 3QT8A 5DLGA 1FNMA 3SQGA 3F73A 3S41A 3FZMA 3Q8PB 4BRKA 1ULRA 4HACA 1QS4A 1EXQA 5BR8J 4PYDA 1YZ7A 5U47A 3KJQB 4LQ3A 4CJVA 5FD1A 2P9PA 3KHRA 4JV5F 4HLBA 1ZAWA 2HS3A 4FYYB 1NNEA 3CCRN 3GJRB 2GMLA 4TKTA 2XMWA 5IS2A 2HVHA 3OYKA 2P9UB 4OHVA 3F5TA 4BR0A 3BQ2A 4O3NA 4K41A 1WEXA 1N36F 2D3OR 5I3UB 2FY1A 2VZ9A 5ITHA 3DAWA 2ZD1A 2JH3A 4XK8C 5D4PA 2CH6A 3CFOA 5HQ8A 4F26A 2B9XA 3LGMA 4WE1B 1TTHB 3CD6N 3KK2A 2VF3A 3ULEA 4A8OA 1V9OA 1RXOB 1VSJA 2YQ1A 1HPZB 4AHUA 4K50A 1GT8A 1RLCL 2L9DA 4KH4A 4H5WA 1P27B 4C8MA 4NLXA 1X4AA 5B0GA 5JJBA 2WVEA 2QC3A 3P4UB 2MQPA 4P2FA 5AQHA 1N33F 2CPHA 4CI6A 1IKVB 1NJWA 1J5EK 1I51B 3EO3A 4IQMA 4ZVUB 3GFZA 1VLYA 3FLCO 1FW6A 1CZBA 2BRLA 3DYAB 3KK3A 3CJSA 3KWGA 4DPOA 2B4UA 1C0TA 1G7CB 3SXLA 2CNOB 4Q2LA 1C0UA 3UO0A 4E7IA 3IFRA 3IO1A 1Q82T 4JKEA 5HMZA 3SQ4A 5H1SQ 4DLGA 3QBWA 4HI2A 2H9ZA 3E51A 1UL3A 3QNOA 1BMQB 1UKUA 2WTFA 1WELA 4NA1A 1BG3A 3AOCA 2CNNB 4A61A 4YHHK 3OYAA 4IH5A 2HFOA 4E89A 3HM9A 3VVTA 2IJNA 4GRSA 2DR5A 3VGMA 1T05B 4N47A 4WYWA 2QEXN 1G1XA 1RK8A 3KLFA 2MHNA 3OVBA 5KQDA 4GVEA 2LVWA 5LSRA 2RNEA 4Z37A 3Q2TC 1GFWB 3KLFB 3OFHA 1FESA 1R59O 1IKWB 5HMWA 4B1UB 5BJRA 3BJYA 4DR7J 3O80A 1D0EA 5DG8A 4CLPA 4J9RA 2DNRA 3A12A 1R6YA 1WDTA 2ILZA 3ENBA 4NXMF 4OX9J 1KP6A 4LF2A 1OH7A 3VTIA 1SJ4P 2GJ2A 2MPUA 2VKZG 1WOQA 2G0IA 3FCVA 5ETMA 5EX3A 4EUVA 4DR2F 4OYMA 5HVHA 2UP1A 3IXQA 2F8EX 2WRMA 4H5NA 1BO5O 5L1KA 3RR8A 4LUBA 2WFBA 4CZMA 1HJOA 4QQBA 2OGUA 4FJ8A 2K7JA 2GS8A 4NRTA 4IUFA 5C15A 4OYXA 1O1WA 5DQGA 1N36J 2NRXA 3OTBA 3BEXA 1UVIA 2MJNA 2QRRA 2JWLA 3TAMB 1XR6A 4O44B 3THWA 3GL1A 1Q9XA 1XC9A 4C8ZA 4DS5A 5KFAA 3CJBA 3KK2B 3O1BA 2OTLN 2VA3A 1R7IA 3PW0A 4K5SA 2V2ZA 2KHCA 3KLGA 1BWEA 3MPDA 3NRBA 1WG1A 3VQCA 3TQEA 5GINA 1ZBUA 4UZBA 3SBGA 1VRUB 3DU5A 3G10A 4FJXA 2V52B 4W5QA 3N79A 1VQMN 2UV8G 4EO6A 5KFIA 4DMZA 2A1BA 3PYGA 4A8QA 5CR4A 3MFIA 1UVLA 3MPWA 2G9OA 1WF1A 2LLZA 2KFZA 4I0WA 4DF4A 4K0KJ 4EHUA 3SAHA 2HVDA 2YQ0A 1Q82O 4E1JA 1RAJA 4CM2A 1B7YB 1SKSA 5GMKa 4BE0A 1YBAA 4ETXA 3S7RA 2VD3A 5IFMA 2DRAA 3P5BP 4NB4A 2B5JB 3S3MA 4C1NK 3VEWA 5ETTA 1O8BA 3CC7N 3QLHA 4RL1A 1TL7B 2EPIA 2V7YA 3TJAA 1U04A 1WI6A 4BACA 4TN2A 4MLEA 2CXEA 4OKJA 2C3UA 3TRGA 2CQBA 2HHHK 1WC4A 2DTJA 1Y10A 4EYIB 2BJ1A 2HW3A 3RTVA 2QMXA 3QINA 1IM6A 4QCLA 2CDRB 1IUJA 3CC2N 4M1KA 3DYAA 5ETPA 3OR1A 4PQUA 4KSEB 1QAXA 2E2PA 4Z2XA 3NWGA 2FLPA 1VQMS 2XS2A 4LF6F 3TEHB 1YJWS 2FJEB 1KQSM 2J7WA 4V1Ak 3FJ2A 5L1LA 1SBRA 4N5SA 4CO3A 4CJ7A 2Q66A 4GKJJ 5KT7A 4ALZA 2F8TA 4H4MA 4KGXB 2EWHA 1CXQA 1IBMJ 4BG8A 5ADXA 3LM9A 4DTUA 5BRDA 2LFVA 2ZC4A 4RUHA 2CGKA 1VBZA 3K59A 2KT5A 2LQBA 3C6UA 1KCFA 2ZWHA 1X0PA 4Q43A 1M5SA 3DFEA 4RLEA 4JI5J 2DXFA 5E0OA 3ZTSA 3EKUA 3C6TA 5AQWA 1CXUA 1FHTA 3PM9A 1L3UA 2JWNA 2BOAA 1X1PA 4CJFA 3CYMA 1H98A 3SMZA 3KG0A 2BRKA 2ZFHA 4USMA 4B9NA 4PG6A 3RW6A 1J53A 1K44A 2P9NA 1FWLA 3MD1A 4YDUC 4PY5A 7FDRA 5EHHA 4DTSA 2FTRA 4CGHA 3POTB 2YNFA 2AA4A 1EX4A 3CQXA 5HP1B 3TWHA 1DTTB 2MYFA 3R27A 3IFEA 4M5LA 4DV4J 4ED4A 1DGKN 4UW2A 3B8AX 4JI2F 5KFMA 4R5PA 1GAOA 2RSQA 3BH7B 3GG4A 2ACYA 4L74A 3D2FA 1GTHA 4RKUC 5T41A 1NK7A 3GWCA 3B4DA 2D69A 2E9RX 4PR6A 4WBFA 4PG7A 4A8MP 2WBMA 1F9FA 4L3NA 2IA0A 1YHQN 1F6TA 2DTUA 2H4WB 3QJPA 1LWFA 3CEDA 1GLFO 2X6NA 2Q97A 4J37A 2HFSA 1CC8A 4LF4K 4LBPA 2FZCB 3K58A 1HBUA 3CCSS 2FPHX 3ZSQA 4CJPA 1NSPA 2JL9A 1RHKB 2NQPA 5HP1A 1SC6A 1YJ9N 4FXVA 3SV3A 4DPWA 1P9YA 3LM2A 3LDPA 1TMMA 2RD5C 4NOHA 4CI0B 2DNKA 3HRGA 4TYBA 4RW8B 2DGWA 2HVEA 1LWCB 3QFHA 1FI4A 4B9QA 4CFDA 4BGBA 4HUEA 3HM8A 1FK9A 4KFBA 3WXJA 1RTJB 2ZZTA 2VBYA 1FDAA 1DZ5A 2CG8A 2ZWPA 3PVXA 2MZJA 1JLCB 4N8NA 4JKAA 2FVCA 5AQTA 4X4RA 3IBWA 2MDAA 3ZCMA 2RHQB 3RAMA 4WIQA 4CZGA 3LW5C 1N32J 4K8XA 1NJIT 3TVZA 3H5XA 1T0TV 1FE4A 4E1NA 3NGTA 3TZZA 2WB4A 3OBIA 5A76A 4OHXA 2E6LA 4C3KA 3T5JA 4CT9A 4P7TA 1VHIA 4E19A 5AZIB 1CJKA 4O5FA 3GONA 4ANEA 2C3MA 1LFPA 2FF6A 1VQNN 2G8FA 3DOLB 4ZVOB 1FRMA 3B54A 3PDNA 1WJ9A 4UY8T 3MPVA 1OIAA 2N3OA 1OH5A 1KFSA 2VG7A 2UV8A 2VICA 4ZN1A 1JJ2R 2KTQA 4FJ9A 3C14A 2BJEA 1S9FA 1YJNS 1HBOB 4Y0FA 4B8AB 2A3JA 1YJ9S 1KOOA 2Q1LA 5KRTA 1T95A 1C1AA 3DLRA 4I6MB 5M1NA 4DV2K 2AJFE 3BS9A 3HKWA 4NXMJ 4BRNA 4KB7A 4BR4A 2IDEA 2AHOB 4WWSA 3TA1A 4Y2IA 2V51B 4O8KA 3D1QA 4IG0A 2KVIA 3TZWA 5B08A 4QPXA 3V6HA 4OL8A 1IXKA 4DS4A 3HT0A 4JI6K 1VI7A 3BN7A 3CDWA 1YJNN 1XMQF 4Z94A 4BC2A 4FJKA 5ETNA 1N5YB 3IRXA 3UKRB 1C1BA 2BKPA 1KD1O 3NF9A 4F9OA 2ZJQL 2CPIA 4NA3A 4JS5A 2APOA 4JI2J 1X5SA 4O0IA 3O6QA 2ZJQQ 3QDKA 3S3OA 5FLXO 4JV2A 3QEIA 2U1AA 2LEPA 1NB7A 4GNIA 3T41A 5EN1A 3A8JA 5EY4A 4F3MA 4FS2A 2FUG9 1TKZB 1PAUB 2A40A 4NYFA 3AAQA 2KYXA 3KK7A 2R7QA 5E3PA 4BE1A 4TU9A 4FJNA 1RT1B 3I9ZA 1FXDA 4G65A 4YB7A 2PI4A 1WC5A 1ZPWX 4ZPWR 1MSWD 4ZHRB 1OYEA 2E7VA 2BW7A 4KHUA 4JHDA 4LF9K 3MECA 1X0FA 1GXUA 1MROA 3SMSA 2LQ5A 1VQ7S 2M70A 2QLFB 1GXLA 5HMXA 2IRYA 3OYMA 3AQOA 1WKKA 3D66A 1Q7YO 4ZJOA 1KR4A 1WORA 2MZ1A 4FPAA 3G2XA 5IWAF 4HTJA 1DEJA 3GLJA 4CNZA 2H51B 3JYTB 3ITHA 4H0VB 3WUHA 4CIEA 1RE1B 2L48A 2DGOA 4DX6A 2E2QA 2DNMA 3CJTA 4JI3J 4C9DA 2P9IA 3M9MB 2Q31A 4CERA 1KNZA 4UQTA 2BANB 4C8OA 4C11A 3I8DA 2D5RA 3IGNA 2B3TB 4Q5VA 2BTFA 2X1FA 2HNDA 1S72S 3BR8A 3VQAA 1IWAA 2HYIB 2R7YA 3V4MA 4RNHA 2FHOB 4ZVSB 4XO0A 5FIIA 4XDDA 4IDKB 2DEIA 2AZ1A 5K20B 4AHRA 2K7KA 3N9UC 2A1RA 4LFAK 1TAQA 4EFHA 3NHGA 3OA9A 2YKQA 2IS3A 3U9DA 4QBUA 3EE3A 2FDNA 4MO5A 4LF6J 3W1YC 4G1IA 3TTFA 2Z58B 2ZDPA 2OSRA 3NKYA 3FEYB 1XBWA 1ROFA 2AP6A 3AODA 4C8YA 4WF9Q 1X5TA 4B3TK 2DXDA 4JI4K 2R3VA 2FHJD 3GYNA 5E26A 4KHQA 5BYSA 3CSKA 4KTQA 1T11A 3B8HA 3GQCA 2W2MP 2HFZA 2QXFA 3FK4A 3S6EA 1U02A 4KKOB 3CQYA 3HK2A 1EB0A 4YHHF 1U1NA 1JJ4A 3THTA 4YY3J 4NYPA 4Z0UA 2VG5A 3EN9A 1ZPVA 4A8KA 4O5BA 1NLVA 1D09B 2XCPA 2YWWA 2YBVA 1QY7A 2PFUA 1U2CA 2DHSA 3C6AA 3O08A 3SUOA 1GMUA 2D0BA 2QYCA 4DSFA 2VWJA 2NNWA 3QIOA 4HUGA 2OTJN 5KFYA 3H42A 2WVFA 5CY4A 3AVLA 4ER8A 4IQXA 1RT7A 1BISA 4IFVB 4YP3A 5CQGA 2KG0A 4JOUA 3W8PA 2AJ1A 1N33K 1HYZA 5AQPA 2JVOA 2E5HA 1WB9A 1H6KX 3K89A 2M52A 4HWIA 2PT0A 1KLMA 3OHRA 4DV0F 4IFYB 1SQEA 3BPDA 3H5SA 1QJHA 3G71N 2PFDA 1FEHA 4LR8A 4UOGA 3BQ0A 2LSNA 3H7HB 4O55A 3RBEA 2ZOGA 2GHWA 1IQTA 2E5GA 1R0BG 5KGWA 1VQ9N 4R0EA 4Y0WA 3CCMS 5E84A 2EFQA 2GMHA 2M8DB 3L7PA 1T9VA 4W4MA 2IM0A 5I3UA 4UF4A 4FZYA 5AQSA 4E98A 3P1GA 3VERA 4NLSA 3W60A 5I42A 3MMVA 2R7RA 2GFFA 4Z4FA 4ICLB 5THWA 3CO0P 3FNNA 4GO7X 1MN9A 2GIRA 1LWCA 3HFVA 4OJHA 4P7VA 1Y3JA 4ZOSA 1TYQB 2E88A 2RJZA 2FD2A 5KFSA 3RB3A 4MK9A 1WBDA 2VPWB 4ZIVA 4A8WA 1W2IA 2ZH3A 4W5OA 3TVYA 2ASPA 5IV3A 1GNKA 2R7OA 5KPZA 2AQ4A 2BJ3A 2E5LJ 4NA2A 1K9MO 2B56A 3KJVA 1HQUB 3UD3P 2Q1NA 4PXBA 2VOOA 2OANA 3LPYA 2MJUA 4JI1F 4IZ9A 1GLJO 3EGNA 3FC9A 4KIAA 4OPAA 3KLEA 1NXIA 2JGUA 2G2YA 5LMUK 3HVAA 2MLZA 4MO4A 2UUBF 2XLIA 4DR4F 3VALA 2MKKA 1MN7A 3MM7A 1KBRA 5CABA 3M6XA 2OD4A 5HVGA 2PC6A 1U8SA 1DLOA 2HHQA 3SIPB 2O8CB 4ZP8A 2CQ2A 3NGIA 3ZSVA 3LH2S 4DKWA 1U1PA 2YI1A 1TKDA 2DIVA 2EFNA 4KH0B 2KU7A 2ZBIA 1Q18A 1TV6A 4AUKA 2MQOA 2UU9K 4ZPDA 4USHA 2CG4A 2V67A 2VBXA 2RILA 4JKHA 5EX0A 5F8NA 4O4GB 1X4FA 4M45A 2RQMA 1T8EA 4M41A 2CPDA 5KG4A 2R7XA 4ZCLA 3OW2R 1NK9A 1FWKA 3MN6A 3NBPB 4DQ8A 2GA7A 4Q45A 3B4MA 4GV9A 3QAUA 1M1GA 5BPNA 4QU7A 2IM2A 4H0YB 3R6MA 4Y28C 2F7VA 3E01B 4FP9A 3VOVA 1CZAN 4LF8J 1FRHA 2AGPA 3JSMA 2CQ4A 2DXEA 2VJVA 3TTDA 4BVPA 5AQYA 2D7SA 2MXYA 3G0ZA 2OFGX 5C25A 2ZC3A 3PX4A 3A8KA 3NCPA 3BQ1A 2X3DA 1SV5A 3LP0A 1ITGA 4EZ6A 3QEXA 4C6AA 3NGSA 5J2PA 1W7AA 2BJDA 2O4GA 3R3TA 2DH7A 2GVDA 1RHRB 1QVGR 2D0CA 1ZETA 4AHCA 3IWXA 4IBNA 1N34K 3VEZA 4C0BA 2HNYA 1S49A 4YY3K 4DUYK 1D9AA 1FKPA 2DNHA 3H1VX 1HLUA 4M7YA 2CKWA 1CJTA 3KLEB 3M2RB 4WFBL 3BF4A 2ZITA 4MYTA 2Z1IA 3N4QA 2I38A 4CHZA 2MY8A 2BJ7A 1R31A 3F56A 3C94A 3G6YA 2BKOA 3ZO7A 4KE5A 1UTAA 2F63A 3NGKA 1E4FT 5FRMA 2AEJA 1OVQA 1RADB 3HF5A 3PYDA 2P9EA 5EGYA 2JRSA 2J9CA 3U4LA 3CC7S 2D41A 3HVTB 3R8YA 1IG9A 4NLBA 1FERA 3QESA 1NMEB 2IVYA 3A1YG 4ICLA 4JRQA 1WF0A 1NEEA 3HD1A 2DR6A 1ELOA 1TR0A 1NPPA 2IDOA 3CCJN 1DQAA 2LQ8A 4ECZA 3AA9A 3RRHA 3LP2B 2NS1B 1UVKA 2IAJB 2HNZA 2E8AA 2AKWB 1EETB 3DRXA 1MW7A 1PBAA 3EPIA 2DPIA 2PEHA 4ZIWA 2MQMA 3DMJB 1HRHA 5CA5A 3V1QA 1SC3B 1SC1B 4MKVA 3MZIA 4FWKA 3C7NA 4CYUA 4HI1A 1VQOS 1FTCA 1RDDA 4FJHA 2LA6A 2MGZA 1XNQJ 4M63C 3JAMU 2CYYA 1SQFA 3BO4A 2KI2A 4H4KA 4ES3A 2HBMA 1R89A 1F2HA 1SKRA 3OTOK 1QQNA 1OJ4A 4AILC 4R8UA 4P75A 4CJKA 3I0RA 4DEZA 2FLNA 1N88A 4OFZA 1K1SA 1KQSR 1G15A 4F2SA 1WC6A 2KZMA 4C97A 3EVWA 2XGQA 4DV3K 3TAQA 4OLAA 4CJEA 3VQPA 1T94A 5GIOA 1N5VA 1GEHA 2OA8A 2FB0A 3PJWA 3LZJA 4P6QA 5AQNA 1HYVA 1LCUA 3QNWB 3W7BA 2O8FA 4LBIA 4X66J 1JWWA 1YWXA 3ZX3A 2BYCA 2EHGA 3IMXA 4LSZB 3K5OA 2KM8C 4A57A 2QWOA 4P9SA 5LOQA 5LSOA 2W9BA 1NOZA 3OV7A 4ZJLA 1BCMA 2GC8A 4CJWA 4FWNA 2OPSA 1AFIA 1EKSA 4DV7J 3PW2A 4OZJA 1WSRA 1K73O 3MTKA 2CQGA 1FJGF 5IC6B 5KT5A 1RTZA 2Z2ZA 2ATLA 3C6HA 2G0JA 2VPZB 2D3UA 3P83D 3LGNA 4QIEA 1NKEA 4FWMA 4RW9A 3QB0A 3CCSN 5AJ3F 4CE9A 2HPUA 3CQ8A 3V81A 3WNFA 2C22A 1RA7A 2VIHA 1ICEB 1N5TA 3SNNA 4EBCA 1RWXB 3J81O 4QAGA 5LJVA 4DL0C 4IDKA 3TAPA 3SV4A 2YCHA 4B3MF 4OLBA 1QSLA 1RABB 5M1KA 3C0BA 4TY8A 3M5RA 4BC4A 1MU2A 4ILMA 2MY7A 5C0YA 1OS5A 3O9TA 2DNYA 4YOEA 3PEHA 4U9RA 2E6MA 3FGVA 3FDSA 3OR2A 1UW4A 5A0YB 3MMAA 4YN3B 4C48A 3TSUA 1VC6A 3GYXB 4LBHA 5EUHA 2MZQA 3TJ9A 4NE9C 4JBCA 2FGCA 3LP3A 2I5JB 3D6HB 4I56A 2RKIB 1RWPB 2W7AA 3I0RB 5M2UA 3CCQS 4KRFA 4JS4A 1F2GA 1HYSA 2F8SA 2CZ4A 2FLLA 4ZVPB 4DB3A 2RRNA 3VETA 1B7FA 1OY6A 5D3GB 1UEVA 4ISEA 4W5RA 2UVRA 3WC0A 1X3NA 4CYUB 1SL0A 1ZXOA 1JLEB 4NCGB 3EWGA 4DWIA 3AGKA 3DWLA 4E7HA 3VGTA 2HSEB 4NLOA 1LOTB 4CESA 2YNGA 3O8MA 2R7TA 4ZTJA 4LF5F 1EHWA 1RT6B 1WG4A 1S22A 2IHR1 4J2AA 4NRUA 1RLDA 2HZCA 5LM7E 4CZLA 1HWIA 2HHUA 2QFJA 2F9TA 1GMWD 2XC9A 2RRAA 2QKKA 4LR9A 3THYA 3NY0A 1NK6A 4HTUA 1KFDA 4C1NI 1KSPA 3FSYA 3HSGA 2H3EB