2YKMA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYSTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPCLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 156
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ykmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ykmA05
3CQ8A 1SKWA 2OPRB 4LSNA 4O0IA 4FJ5A 5J1EA 2JEFA 4H4OB 4O44B 4RW8B 2AQ4A 1QQCA 1ZBHA 3CM6A 4OJRA 3TWHA 3K5OA 2DFFA 4ECSA 1HQEB 3SPYA 5L1KA 2G8KA 1S6PB 4CJRA 1C0MA 4J9RA 4IH6A 4F4YA 2IAJA 3ZSXA 3IGVA 3AA3A 3AVGA 3E51A 3SQ1A 2WCXA 4J9MA 3K5MA 1S1XA 1X1PA 1XI1A 4YFUA 5KT7A 4RW7A 1ZYQA 2ALZA 4F4XA 3DM2A 1KFDA 3NHGA 3PY8A 4CGFA 5D3GB 2W42A 3AVJA 2V4QA 4CK1A 3RMCA 1I39A 2UVWA 4CJPA 3S3MA 1RT4A 3TI0A 3MECB 1TL1A 3H4BA 1T03B 2W9BA 1JLQA 1HPZB 1RT7B 2ZE2A 3VQ6A 3OLAA 2IOCA 1T05B 2YNIA 1LWFA 1RT6A 1JLGA 4TY9A 3NH1A 4GW6A 2EC0A 3DYAA 3K59A 2O5DA 2YNFB 3C94A 1C1BA 3PX6A 4RW6A 1Z4UA 2D3ZA 3VN5A 4MFBB 2FBYA 1JLEB 3QGGA 3RAXA 3PHEA 3VQ5A 2Z1GA 3KK3A 1N6QB 1RCHA 3MFIA 3NF8A 4NLTA 4KPYA 3N6LA 3C6UA 3A2FA 3G6XA 2ASLA 1JLAB 3SFGA 4ECZA 5CYMB 3KK2A 1FXXA 1IH7A 1W0HA 2HHUA 2FBVA 2CJQA 4C8MA 3MF5A 1XR5A 4F4WA 1QE1A 2BANB 4DQPA 3E01A 3MFHA 4Q45A 4ICLB 4IG0B 2RF2A 1S1WB 4WFZA 4J2BA 3AO2A 5KFUA 4YMEA 5FDLA 2XO7A 2KQ2A 3KD1E 3AVIA 2FVPA 5L1LA 2BQUA 1NNDA 3S3NA 1N56A 3DI6A 3KLEA 3MTKA 3DLEB 3OHAA 4DTUA 4CJUA 2DTUA 1XC9A 4QW8A 1C0UA 4CJFA 3CM5A 2IDOA 2A1SA 4NLRA 5JS1A 3H4DA 3DMJA 1SH0A 3JYTA 4TQSA 3H5SA 1WSFA 1W9HA 1JLCA 3O3HA 2J6UA 4NRUA 4HUFA 4IFYB 3H5YA 2X78A 4DTSA 4J9OA 1D0EA 3ZT1A 3V81B 1KFSA 3SI6A 1NOZA 3QESA 3V1OA 2FVSA 1JLBA 4O3QA 3SUQA 3HYFA 5KT4A 4LSLA 1SUQB 2KW4A 1ZBLA 2VA3A 2WONA 2X74A 2QXFA 1XR7A 4HKQA 1QSYA 3LPTA 4O3NA 1J53A 5KFNA 1IKYB 4AH9A 1KHWA 3LZJA 5F8MA 3ZT0A 3RRHA 1XWLA 1TVRA 1RTIA 1B9FA 2FLPA 5HRPA 4KBIA 4ZTFA 4LH5A 3FSIA 4E3SA 1CSJA 4FLUA 4DFMA 4YQWA 3OYKA 4CJKA 1XHZA 2D0CA 1S1VB 3FQLA 3ZT3A 4FYDA 3V9UA 3DRRA 3ZT2A 4TYAA 3PW7A 4PWDA 1LAVA 3HVRA 1U47A 3HHKA 1VSDA 4DFJA 3VQDA 5J2QA 5EDWA 2OPPB 4ZVGA 3U3GA 2HNYB 3Q8QB 3V1RA 5KFBA 4URGA 4F2RA 2V4RA 3V6JA 3MEEA 4FZXC 3LAMA 4J2AA 1WSGA 3G6YA 4XPEA 4NLVA 1WSHA 1S49A 4YP3A 4CEBA 1YT3A 4KSEB 5KG6A 4OLAA 5J2PB 1TL3B 4LSNB 3PR5B 4HUEA 4HHTA 4ECXA 3OJUA 4N56A 5HLFA 4CGGA 4F50A 1S6QA 4TY8B 2D0AA 1U04A 2Y1JA 3EZUA 1HNIB 2FLLA 4M3YA 4Z4CA 1C0TB 1BCMA 3KKRA 1ZBIA 4DSJA 3DLBA 3OL8A 3EY1A 4YR0A 1JX4A 3JSMB 4F4KA 3V9XA 1DLOB 4ZMMA 3PZPA 3EZ5A 4RW7B 1JXEA 5EWEA 2XY5A 2HHQA 1NJWA 3T1AA 5DK5A 5KG2A 4Q8EA 4NRTA 1S9EA 4KTZA 3QEPA 5KG4A 1YTUA 1BGXT 3MR3A 1LW0B 3CDUA 2UVRA 4IR9A 4JV2A 3QZ8A 1TKZA 1HQUA 3L2VA 1TL1B 1U49A 4FZYA 2ZE2B 4G1QA 2HAIA 2XCPA 4KRFA 1RA7A 1RT3A 4DL4A 1BISA 3O3GA 1L5UA 3NGYA 1VSFA 3KIOA 3AA4A 1RTHA 4Q43A 1LWFB 1L3TA 1K1SA 5E41A 3PO4A 1QAIA 2G8VA 1UWBA 3GIIA 4DEZA 3SPZA 3KJVB 5HRSA 4TXSA 2OPQA 3NCIA 2X6SA 2D7SA 4N47A 5KFPA 5F8GA 3OHBA 2D3UA 1HJRA 1S9GB 1IG9A 3M8QA 2XY7A 2OZSA 3BQ0A 3IN5A 1KSPA 3KHGA 4FCYA 4IG3A 3L2WA 1YVFA 2LSNA 1LV5A 3KK2B 3I0RB 3DLKA 3LP3A 3MXIA 1TAQA 5KFEA 4CJSA 3KK1A 1NKBA 3DOLA 1S48A 4MK9A 3L2RA 3QO9A 2B5JA 4LQ9A 3TARA 2X6NA 3ISND 3OL6A 1KHVA 1IKVB 1RBSA 4KAIA 1TKXA 1REVB 3CJ4A 2RF2B 3IRXB 4BWJA 4CJ3A 3OJSA 4DTPA 4LH4A 4FJKA 3MEGB 1K1QA 4L8RB 4GMJB 1LAWA 3KLEB 4RW9B 2B43A 1R0AB 1RYSA 3IS9A 3DOKA 4GC6A 4K4TA 3PV8A 1S4FA 3HSTB 5J2MA 5KT3A 1HNVB 1CXQA 2FLNA 4H54A 3PVXA 2QK9A 4CJVA 5C42B 4NCAA 1VSMA 2WTFA 3IG1B 3HL8A 3RB6A 2R8JA 3AV9A 4ZVFA 1C1AA 5CY4A 2E6MA 3OYBA 3QGIA 1C1CA 1S1UA 1EETA 4TYBA 4CHOA 5DMRA 4W5QA 1DTTA 2UVUA 2W9AA 4J9QA 1JLBB 4B3OB 2W9CA 4ID1A 3NGIA 4KKOB 2XHBA 4FM1A 2WONB 3BQ1A 4FJ9A 2UVVA 4M3ZA 2G8UA 4W5TA 3MR5A 4JUZA 2V0NA 3RMDA 2D5RA 4MQ3A 2Q3SA 1RTIB 2D0BA 5KTQA 4ID5A 1A5WA 3TAGA 2YNGA 4DMNA 4ZVEA 2R2TA 4IRKA 3D0PA 1TV6B 4R8UA 2VG7B 4Q0BA 2FBXA 4WYLA 1S10A 3QIOA 2ZKUA 2D41A 3H08A 1MMLA 3BQ2A 4BE1A 2HHTA 3OLBA 4RNHA 2HVIA 1MU2A 5F8LA 3OY9A 5J2QB 1NK8A 1WNSA 3LP2A 2F96A 3CJ0A 4FVMA 1SL2A 1RNHA 4W5OA 1L3SA 4KTQA 1VSHA 2ZD1A 5KFFA 3PW5A 3THVA 3MEEB 5DQHA 5T14A 4K4VA 3QETA 1HMVB 4GVMA 4KHNA 3NH2A 4DU4A 5F9LA 3D45A 2B4JA 4FJMA 4Y34A 4DFKA 4FLZA 1VSIA 1SV5B 4ED2A 2Z1IA 3KLGA 3RTVA 3DRSA 4CERA 5KG1A 2UUTA 3RB4A 4C8OA 4ZHRB 1S9FA 4J9SA 4CGJA 1N5YA 4KB1A 1VRTA 4ZP8A 3PUFA 1I6JA 4CECA 3BDPA 4M3XA 1T94A 3TAQA 4FJIA 3TAMA 3GV5B 4IH7A 2I5JB 3HXMA 2YNHA 2BRLA 4FLVA 1J5OB 1XHXA 4ECTA 2HWIA 5JUMA 3SZ2A 3NBPA 4DTXA 1EKEA 1S9EB 1EP4A 4Z0UA 5T7BA 4KHWA 3MXMA 2WK4A 4KI6A 4E7IA 5HBMA 1ASWA 3KLHA 1HQUB 3L3VA 4YR3A 5EWGA 3QEWA 4FLTA 3C6TA 3MXJA 4FW1A 4W5RA 3HKWA 1QUVA 2EX3A 4MKAA 4ED0A 2G8IA 2JC0A 5KT2A 4B8AB 3QIDA 5C5JA 1OS5A 1TKTB 2BR0A 3VQEA 1UWBB 1KVAA 5FROA 3M9MB 3AO3A 4EP4A 4CHYA 3CDEA 4CIFA 4BDYA 4Y2CA 2WOMA 2QKBA 5KT5A 3OS0A 4KO0B 5KG0A 4IG3B 1C2PA 2AGQA 3T3FA 2BE2A 4CK2A 4WFYA 1I3AA 4B9TA 3KK1B 2ILZA 4ECQA 1J54A 3KLFA 2HNZA 1RT5B 2VWKA 1FKPB 3KNAA 4QWCA 4CESA 3FFIB 2IA6A 3BSOA 4F2SA 4RG8A 2HHXA 5EWFA 1NK9A 3G86A 3BREA 2RPIA 4B9VA 1U4BA 3LAKA 3IS9B 3DOKB 4M95A 4Y2AA 4FJ7A 4BE0A 3NMAA 1IKXA 4K4UA 5J2MB 4U7CA 5KFMA 4CJQA 4I2PA 3U6FA 4M3WA 3SV3A 4WE1A 3M8RA 5HROB 2OPSA 2C2EA 2GC8A 5K14A 4DTMA 1ASVA 2EHGA 3RMAA 1F21A 5KRSA 4YNQA 2XCAA 1WSJA 1JLFA 4BDPA 3WNFA 1SKSA 1L3VA 2HB5A 1DTTB 4PUOA 1IKWA 4FLWA 4ED7A 4NCGA 3L3UA 4XIUA 4CF8A 5DG8A 3T5LA 3QLHA 3LP1B 4DF4A 1RYRA 1T3NA 4Q8FA 4FW2A 3O4QA 4QW9A 4CEZA 1CXUA 1RT1A 4IFVB 5KFHA 4QWBA 3K57A 3T5JA 2IGIA 3SQ4A 1LW2B 5KT6A 3LP0B 3TABA 4JS5A 1WNEA 3ALYA 3B6PA 5KFAA 4ELTA 4ZP7A 1W25A 4DSIA 2KZMA 4ID5B 5HP1A 2YNGB 3QEVA 2B6AA 2R2SA 1FKOB 4Z4FA 3HVWA 1GX5A 2FJWA 1VRUA 1SH2A 5KFDA 4FBTA 1RAJA 2YHBA 3VQAA 4F8RA 3TAEA 2FJVA 4Z4GA 2Z1HA 2RN2A 4FJNA 3TVKA 4DQQA 3TAPA 1BQMB 2QE5A 3H59A 1ZBUA 4KV8B 2W8LA 4RNNA 5F9NA 4CFCA 4FM2A 1RDDA 3HVAA 2A1RA 1HYSB 3NF9A 3BSAA 3OYGA 2GIRA 2E9TA 3B6OA 5FRMA 4OGEA 4HVJA 3VQBA 1UAXA 4JS4A 2HMIA 2VG5B 4E7JA 1KLMB 1YTAA 3DRSB 4ZPBA 2YKNA 2C2DA 5I42A 4PA1A 1X9MA 1S5JA 5KFTA 3QIPB 3LANA 1QSSA 4ED1A 3PW4A 3M8PA 4QOZB 3H2LA 1RTJA 4NYFA 1NJXA 2AGPA 4MKBA 3F9KA 1DTQB 5KFZA 2W7PA 3WNHA 4N41A 3T5KA 4CJEA 4LQ3A 4QPXA 3P1GA 5C25A 3KHLA 3SUNA 1SH3A 2XGQA 3RAQA 5I3UB 3M9OB 5KG7A 3ULDA 2YNHB 1ZTTA 3H98A 3ZT4A 4PQUA 4KFBA 2UUWA 4LD0A 3NBPB 4DQIA 4DS4A 1NJZA 4M94A 3LZIA 3K58A 2YKMB 4BACA 3KLIA 4KHQA 2IJNA 5HBMB 2F8SA 4IH5A 4CJ4A 3ZSZA 5J1EB 1RBRA 3KLHB 4IKFA 2WRMA 3CIZA 4J9LA 2GIQA 1TK5A 1CZBA 4CIGA 1EX4A 4FZZA 5DLGA 3RBEA 4IQXA 1BI4A 3O4NA 3U3YA 3MR6A 2IAJB 1KCFA 1S1TA 4CIEA 5KFWA 5KFCA 3I5AA 5KI6A 3ZCMA 2ATQA 2IC3A 1RT2A 4F4ZA 4Z4IA 1S1XB 3AO1A 4CK3A 4MIBA 3QGHA 3SUOA 4MIAA 4WZQA 3DM2B 4OGCA 3L8BA 1S0MA 1RA6A 4EZ6A 3CJ3A 4NLSA 3AO5A 4NCBA 4M41A 4WZMA 4BDZA 1BCOA 1RT4B 3SQ2A 3VQPA 4W5NA 2W9BB 1JLQB 3DLHA 5L1JA 4JV1A 3OL7A 5F8HA 3I0SA 1TK0A 2YNIB 1RT6B 1JLGB 4QWDA 1O1WA 3LDSA 3H5UA 1TP7A 2OPRA 4O4RA 3GV7B 2E6LA 3DYAB 4NYZA 4H4OA 4RW8A 3K5NA 3RWUA 1C1BB 1NHVA 3BSNA 1Y97A 3HM9A 4IDKA 1VSEA 4RW6B 3OYJA 4B9LA 1IKXB 1UA0A 1HQEA 1CZ9A 3KK3B 3AVLA 4ED6A 1D5AA 4WE1B 4FJGA 5JXSA 2HW3A 3C6UB 4K4ZA 5F8NA 3ISNC 3AVKA 1T8EA 2PZSA 3SJJA 4DF8A 1RBTA 3KMSA 3NGDA 2RKIA 1LWEA 2QV6A 1QE1B 3CFOA 4CJLA 4Q44A 3TAFA 3E01B 4DWIA 5C24A 3NH0A 1NJYA 1VK0A 2G8HA 2KFZA 1EXQA 1Q9XA 2IM0A 5FDLB 4DL7A 1VSLA 4DFPA 3OS2A 3DI6B 3HP9A 5F8JA 3MECA 1RT7A 4RNOA 5JS2A 4ZPDA 1C0UB 3HVTA 4CFBA 4KHRA 2J6SA 5DGBA 2DPJA 4O0JA 1T05A 4J9NA 4EBCA 3G0ZA 2JEJA 3DMJB 3JYTB 4H8KA 4E19A 2J6TA 1JLCB 2YNFA 2AGOA 2B6AB 3OYFA 3CFRA 3EPIA 3NE6A 4MFBA 5F8IA 2DFHA 3SI8A 1VRUB 4O3PA 1U09A 3VQ8A 1JLAA 5CYMA 3MEDA 3QYYA 3Q8RB 3DRPA 4LSLB 2XWYA 5KGWA 3BGRA 2GUIA 4URQU 4M45A 2BANA 1JL2A 3FRZA 1D9DA 4DSKA 3AA2A 4OKKA 4IG0A 3T19A 4DL3A 1S1WA 4NZ0A 2C22A 4CEAA 1GOCA 4DQRA 1TVRB 1T7PA 2P1JA 3I8DA 4JLHA 2G8WA 3DLEA 4Q5VA 2BDPA 4AHVA 4J2EA 2JC1A 3HPGA 2E9ZA 3WNEA 2NUBA 4FBUA 1ZTWA 3NF7A 4RU9A 3QINA 2CKWA 2BGGA 4URSA 4B9UA 3DRRB 1N4LA 4FJLA 1RDAA 4CGDA 4FS2A 4PWDB 4E0DA 1RTJB 4CF9A 4RNMA 2ILYA 4IFYA 4I7FA 2WHOA 3QEXA 4TQRA 3OYMA 4CEOA 4N5SA 3HP6A 3PW0A 4TLRA 4TN2A 3VA3A 3PJXA 1SUQA 4K4WA 3KLIB 3AO4A 3OYIA 3IAYA 3SV4A 4EZ9A 4KHSA 1ZBFA 4CHNA 3WNGA 5HLFB 4K4SA 2AX0A 3L2UA 4HYKA 1S6QB 3V6DA 2VWJA 5KGXA 3CG7A 1BI4B 4F3OA 4I9QA 2ITGA 3KHHA 3KOAA 4JRQA 4HUGA 3PJWA 3SUPA 5KFYA 3HO1A 3LALA 2IC3B 3K5LA 4Z4HA 3LWLA 3N6MA 4DSLA 3F73A 3UIQA 4KB7A 1ZETA 4EYHB 1VSJA 2OPPA 1QS4A 2HNYA 4ECWA 2FVRA 3CVKA 4ED3A 1B9DA 4AHCA 1SKRA 1TKZB 4EP5A 3AVNA 4OPKA 5EU7A 4C8NA 4G1QB 3GQCA 4B8CA 2KZZA 1ITGA 1RT3B 4FK0A 4AHSA 4FK4A 1RTHB 4IRCA 2VG6A 5J2PA 1C6VA 1TL3A 4XPCA 2PY5A 4QCLA 3RRGA 5DG7A 1D8YA 3RBDA 2OA8A 4IDKB 2R2RA 3Q8SB 2OPQB 4TY8A 3V1QA 4C8LA 1LWCA 3DDKA 4Y3CA 3SQ0A 3BSCA 4HCCA 5SZTA 3VQCA 3M8QB 1HNIA 5KFGA 2YV0X 3NDKA 1C0TA 3RB0A 4DLEA 3DLKB 2XI3A 3TR8A 2IM1A 4ELUA 4IR1A 2RKIB 4FJXA 1LWEB 2XI2A 4FM0A 3JSMA 2IS3A 3OYHA 3DOLB 1DLOA 2R8IA 3QO9B 2B5JB 2W8KA 1G15A 4RNFA 5C24B 2IJFA 4MK7A 2DFEA 4CEDA 1TKXB 1BL3A 5KFQA 4MH8A 3I5BA 1NHUA 4EO8A 5DGAA 1LW0A 4ZP6A 3GILA 3FDSA 1RILA 3SNNA 1FK9A 1RTDA 5KFJA 4NLDA 3PX0A 4TSXA 4ZTJA 3HT3A 3NL0A 4DTNA 3KTQA 3HVTB 4CJ5A 4JRPA 2P5OA 1CLQA 3FQKA 4ECUA 5J2NA 4HTUA 2C28A 2KFNA 4AHRA 3OSPA 4FJ8A 1U48A 1NK6A 4NLGA 2XY8A 3KJVA 4FS1A 1C1CB 4DU3A 3SFUA 3OYAA 1S1UB 3OYEA 3RMBA 1EETB 4O3OA 4U6PA 3H5XA 1QHTA 4E7LA 4DL5A 4O4GA 3KMQA 1S9GA 4EBEA 4CCHA 4G3IA 4M42A 3AVFA 4OKJA 3MEDB 3V6HA 3I0RA 1YVUA 3DRPB 4DG1A 4PY5A 3ITHA 2XRIA 4HCBA 2W9CB 2JEIA 1HRHA 1GX6A 3BGRB 1X9WA 1J9AA 2FJXA 5DLFA 4CEEA 1TKDA 1JXBA 5SWMA 4ELVA 4B9SA 3V6KA 5HRRA 4DTOA 1IKVA 4ECRA 3AA5X 1REVA 3IRXA 2ASJA 4WXOA 1JL1A 1A5VA 3S9HA 1WAJA 4CGIA 3MEGA 1TQLA 1D1UA 3CO9A 3SYZA 1UOCA 1GOBA 4RW9A 1R0AA 2R2UA 1BQNA 2HHVA 4CFAA 3KLVA 4R8UB 3UR0A 4Q0BB 1HNVA 4K50A 2AX1A 2R7YA 5C42A 3LPUA 4EO6A 3CFPA 1TAUA 4NLYA 4IKAA 2F8TA 3IG1A 4NYNA 4KHYA 3Q8PB 1MU2B 4R5PA 2ETJA 3MAQA 2AWZA 5DG9A 5KFOA 5L1IA 1B92A 2O4IA 3LP2B 4I7FB 4K8ZA 4KTWA 4QWAA 3KKSA 2ZD1B 2O4GA 4NLXA 2PYJA 1VSKA 1D9FA 4B3OA 2FBTA 4DTRA 2XC9A 1JXLA 5KG5A 2HHWA 4CE9A 1Z25A 3P5JA 4KKOA 4CHZA 4RZRA 4ZP9A 4OKEA 3OYDA 4KAZA 2V9WA 2OYQA 3KLGB 3ASMA 1K6YA 4R0EA 4DTJA 3NKYA 3V6DB 4I2QA 5CZ1A 1N5YB 1VRTB 4H4MA 2IM2A 3UDLA 4E89A 1TV6A 1QTMA 1BIZA 2VG7A 1Q8IA 1KVCA 1QSLA 3TAMB 4B9NA 2HWHA 3OYNA 2I1RA 4O3RA 4CF0A 4KHMA 4BWMA 2RDIA 3RB3A 3O3FA 4O5BA 4DL6A 3BJYA 1EP4B 3G6VA 1BIUA 3HPHA 2W7OA 3NAEA 3KD5E 2BRKA 3I5CA 4NLOA 4CJTA 4E1NA 4CF1A 3LWMA 2HHSA 3S3OA 3QNOA 3C6TB 3DLGA 3M8SA 2DY4A 4Y1DA 1HMVA 4NLUA 3EPGA 4RW4A 3OYLA 5KFXA 4KI4A 3RR8A 4X2BA 2VG6B 3HK2A 3AVMA 3ZSYA 1SV5A 4FXDA 4CEQA 2XGPA 3NGZA 3KHRA 2GV9A 5DQIA 1WSIA 4ZPCA 4F3TA 1RBVA 3HPOA 4AILC 4CHPA 4ZHRA 1NKEA 2WOMB 1LWCB 1BHLA 2G8FA 2HVHA 1KVBA 1XR6A 4LY7A 2HNDA 1IM4A 3QERA 1GOAA 3ZSQA 4ECYA 3EYZA 2BE2B 4FJJA 2I5JA 3IGNA 2DPIA 4O3SA 3UQSA 2ZQBA 4B08A 1JKHA 1J5OA 4DSEA 3KLFB 2HNZB 3V4IA 5CYQA 3NFAA 3QZ7A 4DS5A 5KFLA 1QAJA 1HYZA 3P83D 3VQQA 3OYCA 4O44A 1FK9B 1RTDB 4DLGA 2KTQA 1A5XA 3GIKA 4CJWA 1KLNA 1S0NA 4CF2A 4N76A 3VQ9A 4DL2A 5FRNA 1S6PA 4M3TA 4CEFA 4I2PB 3CDWA 2F8EX 4JV0A 3PR4A 5J2NB 4J2DA 2OPSB 1RBUA 1TKTA 5K14B 4OPJA 1S97A 3G10A 4EBDA 1JLFB 5KG3A 3TANA 3V9WA 1RDRA 3CJ2A 3AVHA 5KFIA 1IO2A 4O4GB 4PUOB 4OL8A 1IKWB 4KO0A 4ECVA 2JEGA 3PW2A 2IBKA 2P51A 1NK5A 4NCGB 5D3GA 1NK7A 4DG1B 3ITHB 2IMWP 3QLHB 3H40A 4E7HA 1Z26A 3ICLA 1T03A 4Y1CA 2AU0A 2XY6A 1HPZA 1JIHA 1RT5A 4DQSA 2BQ3A 1FKPA 1RT1B 3GV8B 4EYIB 3FFIA 4CHQA 1KRPA 2WB4A 2JGUA 3CYMA 4CGHA 3V9SA 1ASUA 1TK8A 2R8GA 3ZSWA 4K4XA 2GBZA 4NLPA 5KFRA 5HP1B 3HJFA 1SL0A 2BQRA 3AVAA 1BQNB 1WLJA 3MR2A 4ED8A 2OZMA 4Z4EA 1JLEA 4EEYA 3OS1A 3M9NB 1N6QA 4BE2A 4IBNA 4AHUA 3ZSRA 5HROA 2R8KA 1TGOA 3SCXA 2FVCA 4R5PB 1Q9YA 4KB0A 2P5GA 4YR2A 3CWJA 1U45A 3VQSA 3GYNA 4ICLA 3N6NA 4M3RA 4C8KA 2PYLA 2OH2A 3LP1A 1HARA 4M3UA 4FLYA 3GIMA 3CJ5A 4B9MA 4FK2A 4IFVA 3DLRA 2HMIB 4UQGA 2VA2A 4KE5A 4DU1A 1LW2A 2YKNB 3LP0A 5I42B 3VA0A 1NOYA 1WAFA 3L2QA 2E4LA 3M8PB 4I2QB 4J9KA 2YHAA 1NK4A 4H4MB 1FKOA 5KFKA 4E7KA 5DQGA 3VQ7A 5C25B 2IM3A 3C95A 5KRTA 4AHTA 3V81A 5EUHA 3V9ZA 1S0OA 4K8XA 5KFVA 3ZSVA 4KHUA 4PQUB 4KFBB 2Y1IA 3QEIA 3AVCA 4E1MA 5HRNA 2RDJA 4QAGA 2R8HA 1WN7A 1BQMA 1N48A 1X9SA 2JLEA 2FVQA 3D28A 2QKKA 1HYVA 4KV8A 3UPFA 1IKYA 3D5MA 1RDBA 5KFSA 3QNNA 3DLGB 4OLBA 3AVBA 4NLQA 2C2RA 4RW4B 2ASDA 3VQ4A 1HYSA 4MK8A 1SL1A 1KTQA 4NLWA 1RDCA 4QWEA 3BR9A 4DSFA 1L3UA 1S1TB 4XO0A 2E9RX 2VG5A 3GIJA 2ATLA 1KLMA 2AJQA 4ZPAA 1S1VA 3T5HA 1RT2B 3PX4A 3QIPA 4WXWA 4ZVHA 3NAIA 3RR7A 5L9XA 1WSEA 4J9PA 4OVLA 3ZSOA 3OSNA 1NKCA 1DTQA 5CZ2A 4FLXA 4IRDA 4FJHA 4RUCA 2HNDB 3PO5A 2Z1JA 1UA1A 1NK0A 4K4YA 5I3UA 4RUAA 4GC7A 4KREA 4WYWA 3TQ1A 3OVNA 4CFDA 3NF6A 1JKHB 3NAHA 4IOBA 3V4IB 4O55A 5CYQB 3K2PA 3I0SB 4WFXA 3OL9A 4I9LA 2FC0A 2YKMA
chains in the Genus database with same CATH superfamily
1HNZF 1OY8A 4JI5K 2FDNA 2OTJS 4LSNA 4FJ5A 4ZVQB 5J1EA 2KHCA 1T9TA 3RYLA 1ZBHA 1WJ9A 2CA9A 8RUCA 2H4WB 2GMJA 1U2CA 1Q4RA 4K0KJ 3K5OA 2FY1A 4YS2A 5L1KA 4F9OA 4NL5A 4OZNA 4F4YA 1U0HA 2IAJA 3THTA 3JS6A 3AY9A 4CZMA 2HLTA 3E51A 4CLTA 5EX0A 2U1AA 5BXIA 4H0YB 5KT7A 1ZYQA 2ALZA 3DM2A 2NXUA 1RADB 3AVJA 4CK1A 2KDOA 1CS4A 2UVWA 2WZ1A 1RT4A 4TU8A 1REGX 2MJUA 3H4BA 2W9BA 1HPZB 1RT7B 4FOEA 3WIUA 4N77A 4WIQA 3VQ6A 3OLAA 2IOCA 2YNIA 1LWFA 3ONQA 2EC0A 1HI8A 3K59A 3IAS9 2O5DA 2YNFB 3C94A 2BKPA 3TYTA 1F0XA 3OR2B 2VFUA 4I6MA 3VN5A 4MFBB 3RUBL 3QGGA 1Q86O 2Z1GA 1N6QB 1RCHA 3DDNA 1GMVA 2AT1B 3A2FA 3G6XA 2ASLA 3SFGA 3AOAA 4ECZA 4LBPA 2HHUA 4PHTX 3ZTSA 1RISA 1CZAN 4F4WA 1QE1A 2BANB 1TMJA 2HBMA 3E01A 3H25A 3MFHA 3CIMA 3VZIA 4ICLB 4IG0B 4UY8O 1S1WB 4ISFA 2ZUAA 5GMEA 2CPDA 4XAKA 2KRBA 5KFUA 4YMEA 2KQ2A 3KD1E 3AVIA 2FVPA 3A13A 3S3NA 2LFVA 3KLEA 4CJUA 2EFOA 2DTUA 1NM2A 1XC9A 2JLGA 4QW8A 1C0UA 4JK9A 5AQVA 1A9NB 5BR8F 2MQMA 3CCUN 5GVQA 2XBPA 3THWA 3U1LA 2HQGA 1WSFA 3GE9A 4LF8J 4ERDA 3PKMA 1HQ2A 2ASPA 4IO8A 4CI0B 4NMLA 1HKAA 4K7QA 2LXIA 4DTSA 1D0EA 2VCPA 1KFSA 3EEQA 2PMZD 4LF8F 4LBIA 2YH1A 4PRFA 4BROA 2GHPA 3M6GA 1SUQB 2QA2A 2KW4A 3Q24A 2IVFB 1XR7A 4CNYA 2OEJA 4IWVA 2ZH6A 2K2PA 4DV4K 3VF6A 3LPTA 3MCMA 4O3NA 2CNLB 2FYXA 3CC2S 1KHWA 1R27B 2AKWB 3VHQA 5F8MA 4C1NK 1OQ6A 1YKWA 1HNWJ 3BUZB 4AF1A 2VKZG 2DBBA 4KBIA 1VQKN 3MWTA 4ZTFA 2K1RA 1H7XA 4HL9A 4OX9K 4DFMA 1XHZA 2YCHA 4CLPA 4FYDA 1NRKA 1FJ7A 3IWLA 4BRLA 2BJEA 2FGCA 3AJ2A 4PWDA 1NDCA 4ZVPB 4H0OA 1VSDA 3VQDA 1GQEA 5J2QA 4KH0B 5EDWA 4ZVGA 2P9KA 3FLCO 3QBCA 4K0KK 5KFBA 2XSJB 4URGA 2V4RA 1Q81O 4CZGA 2J0WA 5D4NA 2IY5B 1HR0J 3G6YA 1S49A 4YP3A 4P75A 2FB0A 2F8MA 1RU1A 2GGPA 5AQZA 2AIRB 4LSNB 1VBZA 4HUEA 5AQXA 4DHYA 4ECXA 3TTFA 2BBEA 1CEZA 3VEYA 1B0VA 2YQ0A 4C98A 4DI6A 4DPOA 1U0HB 2FLLA 1H2VZ 1YVNA 2BOPA 1BCMA 1ZBIA 2D1CA 3ENAA 4DN0A 4LF1A 4ZMMA 3S7RA 3PZPA 4DR2F 5KG2A 3VAKA 1S9EA 4KTZA 1BO5O 4C2MA 3DOMA 2GMHA 2IDEA 3L2VA 3VESA 3OW2M 5HVGA 4G1QA 2XCPA 1KKHA 3EZOA 1L5UA 1VSFA 2OSRA 4P52A 1LWFB 3N0VA 3TEHB 5M1KA 3W2WA 2WW8A 3QWPA 5JLHA 2LQ9A 3UKUA 2G8VA 4DEZA 3SPZA 2G1DA 4DV0J 2DY9A 1YXQA 4IEIA 4TXSA 2BJ7A 2OPQA 2R4FA 2Z4PA 3NCIA 3OPKA 2BE9B 1H74A 2P9SB 5F8GA 2D3UA 2FZGB 4UOGA 2XY7A 4F02A 3ETMA 3IN5A 4IG3A 4W4MA 1LV5A 2LSNA 4DV0F 1GXLA 2CPFA 1TAQA 2YI1A 2MKYA 2XHCA 2Y9HA 2HZVA 2QL7B 3QO9A 3TARA 3ISND 3OL6A 1KHVA 1IKVB 4KAIA 4LF8K 1NSPA 1REVB 2ZH7A 1TFYA 3J7YU 1PG5B 2UXDJ 1K1QA 2CJAA 1LAWA 3KLEB 1R0AB 1M1KT 1FVQA 3PV8A 1S4FA 2V8DA 5J2MA 2B7BB 1CXQA 1YUWA 1UZHA 2YVSA 2UXDF 1VSMA 3W5ZA 2FF3B 3GFYA 3IG1B 3HL8A 3UE2A 1W2BM 3MMAB 4FDFA 2DGOA 5CY4A 2E6MA 3QGIA 4B1UB 1HNWK 1EETA 4TYBA 4CHOA 3O1WA 3AAQA 2W9AA 2C2ZB 5HL7Q 3WT0A 2K3KA 1LWXA 1XJWB 3T6JA 3QGPA 1N33J 1RCOB 1U2VA 4L75A 5AQYA 1P9QC 4HHHA 4FJ9A 4M3ZA 2G2ZA 4YN3B 2YX7A 1N33F 4DX6A 2CQ2A 4JI1F 1AROP 1TFWA 1XQSC 4ID5A 2YNGA 3ILLA 3EGZA 2R2TA 1GT8A 1TV6B 4PG6A 6AT1B 1HR0K 4GV9A 4Q0BA 1HNXJ 3VALA 2ACMA 2V67A 3H08A 4QS8A 3BQ2A 4M63A 4S0MA 1HA1A 4RNHA 4YORA 3HHLD 1P6TA 1WDTA 3ATVA 5J2QB 2DIUA 3CMAS 3D2EA 4ID8A 1SL2A 1R6VA 2ZD1A 3THVA 5DQHA 4KYZA 1VQ5N 1DGKN 3EVMA 3NH2A 2KFYA 2FHOB 4FJMA 2GGPB 2QW9A 1B0TA 2AZ1A 2ZBIA 1NBWA 1SV5B 3KLGA 3RTVA 1U02A 4DR7F 2W25A 4WQ4A 1S9FA 4WFAQ 3G8SA 3DDIA 1N5YA 2P9IA 4ZP8A 3ULHA 3FCWA 3BDPA 2W2OP 3R2DJ 1T94A 4P10A 3TA0A 2MZ1A 4CLSA 3TAMA 3GV5B 5AQPA 4BY9C 3R9PA 1URNA 3OTCA 3E1YA 5H1SQ 2BRLA 1J5OB 2YX1A 3GJRB 3VGVA 2XMUA 1S9EB 3WC0A 4Z0UA 5T7BA 4DV0K 4GKKF 4KI6A 3BF1A 3DOMB 3UO0A 4CLUA 1GLJO 4QIGA 4IO9Q 4FWQA 1D4XA 4C8YA 2AW0A 2C3MA 3I4PA 3V2UC 2QYGA 5G4DA 1YJRA 4B8AB 2KXNB 4HTIA 2GJFA 3VQEA 4OHYA 3M9MB 4M8LA 1FJGF 2JH3A 3WXKA 2EG1A 1WC0A 2UXDK 2HBQB 3OS0A 4CZFA 4IG3B 4OJ3A 2H65B 5H1SV 2CGLA 4OYAA 4CK2A 3GG4A 2E1RA 1PC4A 3K0SA 4C1NI 4B9TA 1WOPA 1FRMA 4RBTA 3SAFA 2VWKA 1FKPB 1B99A 3IM9A 1DJ0A 3POTB 3SMZA 2GWKA 4ZJOA 2HHXA 4MKYA 4WJBA 3F0NA 5EWFA 4ZLNA 2HRTA 4TU7A 2A1BA 1U4BA 4M95A 3T1YF 4BE0A 4XEIA 3NMAA 3C8YA 1N33K 5J2MB 5ETQA 5KFMA 1FFSB 3U6FA 1YWXA 3G8QA 4DR1J 3IP0A 2C2EA 5K14A 4DTMA 1MMNA 1RJJA 4WP8A 3TSUA 4YNQA 2XCAA 1WSJA 3AQPA 2B9WA 4DR6J 1F9EB 1SKSA 2HB5A 3CC4S 1NU0A 4AYBD 1RB0A 4XIUA 1U2VB 3IR6B 4X4PA 1HNXK 4ILHA 4DF4A 2E2NA 4DR6F 2E20A 3J7YI 4MTPA 2IVNA 1VC0A 2E5JA 4CH0S 1UWAA 4FWRA 4FWOA 2IGIA 4J8FA 2QTWA 3TABA 4IOAQ 2WW4A 4DSIA 1HBMA 6FD1A 2HF3A 4ID5B 1IM6A 2YNGB 3QEVA 2B6AA 1HBNA 3B78A 2R2SA 1FKOB 4CD3A 1GX5A 2PEBA 3TP2A 4NE9C 3D4JA 1VRUA 3DGVA 2XMKA 4OPHA 3VQAA 1SJQA 3QJLA 2Z1HA 2RN2A 3O80A 2VBYA 2XYHB 3AODA 4JI7J 4CH7A 3AA9A 2KJVA 1BQMB 2XLJA 1NSQA 2JL9A 3H59A 1ZBUA 2W8LA 4RNNA 2DXEA 3ZTOA 4CFCA 4FM2A 3R5GA 4IO1A 4JI7F 3K7RA 2OD6A 2F40A 1M1GA 3B6OA 4HVJA 2M5YA 1UAXA 4AD6A 5K20B 4DV7F 4FVUA 4JS4A 2HMIA 4E7JA 1KLMB 4CO5A 1YTAA 3WDOA 4WU2A 2GO9A 1S5JA 2BW7A 4IO9L 1N34J 3IUCA 4ED1A 3H2LA 1QDUB 2KG0A 3F9KA 3KVGA 1DTQB 2W7PA 4CJEA 4LQ3A 1Q0NA 3NLCA 4PKHA 5C25A 3FBFA 3M9OB 1N34F 3P6YC 5KG7A 2BZ2A 3ULDA 2E44A 4K25A 3TZWA 1PYOB 3JSBA 2GELA 4FNIA 5IOLA 2ZBRA 3G96A 2KU7A 3ZSZA 1RBRA 2WRMA 3CIZA 1FDDA 2GIQA 5F0XA 1SBRA 1EX4A 5A76A 2GQQA 4FZZA 5DLGA 1VK8A 4CM2A 5ETVA 2VONA 2NZTA 3O4NA 3Q2TC 3VGMA 3U3YA 2HBYB 4X65J 4MAKA 1X4HA 4CZIA 4CIEA 1ZOTA 2MGZB 1WACA 2LLZA 2RQCA 2PO4A 3I5AA 3L4QA 2IC3A 2LQBA 2NCKL 5T41A 4QS7A 4L3QA 1C0GA 4X62F 3SUOA 2KYXA 5IT9O 5MAOA 4OHZA 4L76A 2DJWA 2HBRB 1S0VA 2FJBB 3ULEA 1RA6A 3L8BA 3R5BA 1PJ7A 1BCOA 1N5VA 1RAOA 4DR1K 4M5DA 1VAZA 3ZFVA 3I9ZA 3A5OC 1WF2A 4LFAJ 5F8HA 3I0SA 1GTHA 2KT5A 1CJKB 5KPZA 2I9SA 1WF0A 3H5UA 1TP7A 4O4RA 3DYAB 4DR6K 4H4OA 3HSGA 3L09A 1IQZA 4X4RA 1C1BB 3HM9A 2M3DA 3D6RA 4B9LA 4OHXA 3EWGA 3KKFA 1CZ9A 3KK3B 1D5AA 4FJGA 3D2FA 5F8NA 3AVKA 4IOAL 2PZSA 3SJJA 2CIMA 3Q8UA 3CMQA 5ETRA 4DV5F 3Q0AA 2LP4A 3ENQA 3TAFA 4DWIA 2DKOB 5CYJA 2QA4N 1VK0A 2HQCA 1EXQA 1HUXA 1V6HA 2HBKA 1VQOS 2IM0A 2RH3A 2H5JB 1VSLA 4ILJA 4DFPA 4DV2J 2RHSB 4RNOA 3BN7A 2YTCA 5DETA 4ZPDA 3FNNA 3OTBA 4DB3A 1EIYB 4KHRA 5DGBA 2DPJA 4P71A 1NGDA 1T05A 1QVFM 4JI7K 3JYTB 3G82A 2P9PA 1XC3A 3A8YA 2CG4A 4E19A 5B09A 1V3RA 1J5EF 2B6AB 4BRFA 3K89A 2MLZA 3CFRA 2JSXA 1NGJA 1YI2S 5E3CA 1DKGD 5F8IA 2OKQA 1VRUB 5J1PA 2HGLA 4RPFA 3VQ8A 3SCIE 2K7JA 5CYMA 3MEDA 3O08A 4P73A 2UUBF 4LSLB 4BS2A 3MM6B 2G0JA 3BGRA 2GUIA 4M45A 2QIFA 3UFCX 1JL2A 3MDQA 2AHOB 3IBCB 2ACYA 5CZVA 1N34K 2QA1A 4BR5A 3AA2A 5M1PA 4C0HA 5GIOA 2L48A 2DH7A 3SLCA 4DL3A 1R3NA 4NZ0A 2KXHA 1KWMA 5E3AA 3I33A 3ZETB 1KVIA 4AHVA 1RDWX 5CHIA 2I38A 1VQ6S 2E9ZA 3WNEA 5F1XA 2NUBA 2MLYA 3NF7A 4CLYA 4HT7A 3Q2SC 3SDEA 4FS2A 2HURA 1VQYA 3VZHA 4RNMA 2CQHA 4M63C 3AHPA 2UU9J 1U1QA 5F0UA 1WSRA 1FW6A 4GNIA 4TQRA 1K47A 1YQHA 4UOFA 3HSDA 1OKJA 4X65K 5IM0B 4OPAA 2DYAA 3PJXA 4USWA 2UU9F 2BTFA 3CJQA 3IAYA 3TQEA 2EFNA 1VQ8N 4FKYA 1VQLN 3OVAA 3SV4A 1XERA 1EWRA 1ZBFA 2DNQA 4CZHA 2VV5A 2RU3A 1R89A 4ZN3A 2N3OA 3TZYA 2DT9A 3CG7A 2LQ5A 4OYMA 1J27A 2M4MA 2VIHA 1YBTA 3C66A 2GO8A 3KOAA 4WQ4C 4JRQA 4HUGA 3MM8A 3PJWA 1IBLF 3SUPA 4LFAK 2RUGA 2IC3B 5DDPC 3TZXA 1EQYA 4WIIA 2F9JA 3HM8A 3FZFA 4EYHB 3OUYA 5LSOA 1XNRF 1LOTB 1VSJA 2OPPA 1Y10A 4ECWA 4ED3A 5GADP 4JI2J 2HGMA 1TKZB 4HTJA 5ETNA 2GW8A 2MJNA 1QVGM 1ITGA 3H2VE 4FK0A 4FK4A 5L46A 1RTHB 3R1HA 4N8NA 4XPCA 4QCLA 5DG7A 1D8YA 3JTOA 5JVHQ 1RKIA 5EXWA 3V1QA 2VASA 2O8EB 5JMVA 3VENA 3HD1A 3D2FB 3AT1B 2E2OA 5SZTA 3VQCA 1HNIA 4DV2K 2IIHA 2BXJA 3PHTA 5EOYA 1R8CA 2VJUA 4DLEA 5ETPA 3ZX0A 1T95A 1HWUA 2IRUA 2XI2A 3J7ZT 3W63A 5K8NA 3MMVA 4L72B 3D68A 1DLOA 2DCLA 2R8IA 3RBZA 1E6VA 1RWKB 2B5JB 4GO5X 2ZJPL 2YX4A 4JI3F 1HIYA 1PILA 1M5PC 1TKXB 3I5BA 1H73A 1RWNB 4CM0A 2OO4A 4GKJF 4NLDA 4ZTJA 2YJFA 3VAFA 2BJ9A 3NL0A 1RZMA 4DTNA 2ZJRL 4JRPA 1GNKA 1NU4A 5J2NA 2D4WA 4AHRA 3EVOA 1IJJA 2YH0A 4IZ9A 1TYQB 3R5CA 1KAYA 3OTDA 4MJKA 3KJVA 3M7VA 1HL6A 1YJWS 3RMBA 4U6PA 4DPYA 4DL5A 3D1QA 4XDCA 2FZCB 3QAUA 1UW9A 3MEDB 1ZBTA 5GAGU 1YVUA 1VQSA 1TUUA 3B8HA 2XRIA 1BE4A 3BGRB 2A6OA 3WQPA 2YJEA 2KN4A 1CC7A 5HRRA 4K42A 2ASJA 2QFJA 1OSCA 4A8XA 3S9HA 2UU9K 3ET6A 3CO9A 4F67A 1GOBA 4RW9A 1CLFA 2H1YA 3ZX2A 1BQNA 4I1TA 2EFPA 4HHUA 4R8UB 3R2CJ 3BGLA 1UPMB 2NREA 2AX1A 5HK4A 4XH1A 5C42A 5AQJA 4EO6A 1VQ4S 4MT1A 2F8TA 3SDEB 3W65A 4G65A 3G6ES 4KGZB 2EFGA 2NXCA 3Q83A 3J7Z5 2F3JA 3THPA 3MAQA 5DM6Q 5L1IA 3LP2B 2CPJA 2B0GA 4ES3A 1D9FA 4B3OA 2XC9A 1JMTA 1JXLA 5B0FA 2HHWA 2V68A 1Z25A 2GWJA 4GV6A 4CYUA 3DFEA 3L7UA 4WWSA 4FVCA 4BC9A 4MLEA 3Q86A 2V63A 4P72A 5ADZA 3AXMA 1NGAA 3R9LA 3ETOA 1K6YA 2RHKA 1RHKB 4DTJA 3CCJN 1VRTB 1G6BA 3UDLA 4JI2K 4E89A 1VBXA 3BN4A 1QTMA 1DURA 1XUPO 2QO3A 4H5TA 4ZLJA 4USTA 4J37A 3MMBB 5ETTA 3DU6A 1MWKA 5JVHL 1YAGA 4DR3J 3RB3A 3W62A 4Z7CA 2JHEA 3CD5A 3OUYB 3CCSS 1UVNA 2MZQA 2W7OA 4B1YB 1WB9A 3KD5E 2BRKA 3P31A 3BEXA 4IDHA 3I5CA 4ZVUB 1TMMA 1IXKA 4Y2MA 3QNOA 1CC8A 4Y1DA 3EPGA 2E29A 4LF9J 2G1HA 1T6CA 4F0KA 4DV3F 5LL6d 3NGZA 3CB4A 4NXNJ 2CQ4A 4LF9F 5DQIA 4AILC 3AJ1A 2LEPA 2O3DA 2HVHA 2G8FA 3KDNA 4ILRA 4LY7A 3PEHA 3H45C 5F2RA 3QERA 1GLDG 3A0IX 3EE3A 3H6EA 3HFKA 4DU7A 1NHKL 2I5JA 4HH0A 1O5JA 4E1JA 4O3SA 1UJ4A 1M1HA 2IDLA 4DSEA 1E6VB 4HTLA 2V2KA 1R8HA 4YHHF 4F36A 3QZ7A 4BHQA 1Y3KA 4NEYA 3P5BP 4JV5F 2GTDA 2RJZA 2WBMA 3DU5A 4J5OA 4DR5J 5B0BA 1H2TZ 1MROB 3KK7A 1S0NA 2ZEJA 4L74A 4DL2A 3FBBA 1S6PA 4CEFA 1PGZA 2F8EX 4DMZA 4JV0A 5J2NB 2MZRA 3NOCA 2PD1A 3TSPA 4OX6A 3EICA 1TELA 1YBAA 5D0HA 1PBUA 2RILA 3HSJA 3V9WA 3CJ2A 2R7WA 3UI3A 5HO4A 2M9KA 4C8ZA 4KO0A 2JEGA 5I4MA 4NCGB 3WHIA 1S12A 2Q43A 3CPWM 3QLHB 2OTLS 4LRCA 1H3DA 5BREA 2Y8YA 1MNEA 1RT5A 4DQSA 1G4CA 2JGUA 1S57A 3V9SA 1ASUA 1FRJA 3OVBA 4DOZA 1ITPA 2CPHA 3ZSWA 3ET6B 4B3SF 1O0PA 5KFRA 1UVIA 2MQPA 3JAMO 2AEFA 3AVAA 1BQNB 3DRXA 4Z7YA 2F9WA 3HJVA 4JKHA 3OS1A 3H2UB 4AHUA 1K9MT 1NZ8A 1WELA 5HROA 3QQCD 1TGOA 5KPRA 3KJFB 1Q9YA 3D0HE 3W8GA 5B7WA 1C0FA 5GAGI 3O44A 1XMQJ 1U45A 4M5MA 4IOXA 2HBZB 2N7YA 1OO0B 2KB2A 3MPUB 2PI4A 4CYUB 1N5QA 4KHPJ 2Y0BB 3CUNA 3JQKA 3WXJA 2OELA 4FK2A 1Y7PA 4IFVA 3DLRA 1GH8A 4UQGA 2QLXA 1LW2A 1W2BR 2DB1A 3VA0A 2EBEA 1NOYA 1WAFA 1MWMA 2E4LA 4Q7AA 3X3UA 4J9KA 5BN9A 2IYGA 2J0QD 3VPZA 5FIIA 5KRTA 4LF9K 5EUHA 3ZZTA 4K8XA 5CA5A 3DXKA 3ZSVA 4KHUA 3W1YC 3AVCA 4QS9A 2WTUA 3OV7A 4DCOB 2V4JA 4DU8A 4NXNK 3O3LA 1X9SA 2JLEA 2VDHA 3T69A 2FD2A 3D5MA 1X5SA 3MAHA 3DLLQ 4OLBA 3AVBA 4BRPA 2J5AA 4JHDB 1HYSA 4MK8A 4ZCKA 2CJ9A 1KTQA 5L8RC 1SL1A 4NLWA 3EM1A 3HOSA 2HSEB 4P2MA 4QWEA 1VQPN 1ZC6A 3GIJA 4A46A 2ATLA 2ASMA 2HSTA 3RW6A 1S1VA 4ITSA 2DNZA 3WXIA 3BYPA 2HWTA 1CULA 3QIPA 2L9NA 3GG1A 4WXWA 3NAIA 5ETMA 3RR7A 3CDAA 4B3MJ 4DR5K 2R7QA 3ZSOA 2YQ3A 2ZOFA 1NKCA 4FLXA 2ITMA 3U8XA 3UNGC 1Q7YT 1NG9A 3PO5A 4BREA 3AB2B 1NK0A 5I3UA 4KREA 3R7NB 1HD1A 4ZVTB 1SC1B 2AYEA 3CCQS 1NGFA 3K2PA 4WKRA 4WFXA 2LQ8A 2ZC4A 4I9LA 2KT3A 2OPRB 3BPDA 4YDDB 4O0IA 2AJ0A 2Q31A 4RW8B 1IWAA 3A8EA 4HACA 3TWHA 3VAGA 2DFFA 4ECSA 1FD2A 1S6PB 1QAYA 3PJ9A 5AT1B 2PDAA 3ZSXA 3IGVA 2CJXB 2Q1LA 3QWUA 3QFHA 3H8YA 2FXUA 2HG4A 3BM7A 2DGSA 3CCLN 3K5MA 2NSCA 3L0QA 4CT8A 4F4XA 1C4AA 1NGBA 3NHGA 2FHJA 3UNYA 3H3NO 4CGFA 5C12A 3DKDA 3RMCA 2YPZA 1UVMA 1I39A 2XS2A 4HVZA 4JKGA 3S3MA 4OYXA 3C7NA 2M2BA 4ED5A 4OJ1A 3GSDA 1ZPVA 1RT6A 4X4OA 3NH1A 1X5PA 4GW6A 2RS2A 1OJ4A 3E2EA 1FERA 1P9YA 1XMQK 5AQGA 2NRWA 5AE3A 3TJ9A 3W66A 4LVNP 3PHEA 4DL0C 3CXCM 3MFIA 3W8PA 1XIQA 1NZAA 4ZS6A 4H5VA 3C6UA 4KHPK 1YZ7A 4LRBA 1G1XA 1JLAB 1IH7A 4C8MA 5E3QA 5AQSA 4XH5A 1RWXB 1VOMA 3P3DA 2NLXA 4DQPA 1C4CA 5A8KB 3MGJA 2V8GA 4L3KA 4Q45A 2FLOA 3M2VB 1SJRA 2RF2A 4WFZA 4J2BA 2E7WA 2P2CB 5FDLA 1NNDA 3G4SN 4PWWA 3MTKA 3QFUA 3MCNA 2B4PA 3THXA 4DUTA 4CJFA 2IDOA 2A1SA 4GV3A 2IRXA 3DMJA 1SH0A 3DLLL 3H5SA 2E5GA 3B4MA 1PKUA 4CQ1A 3A8JA 1LNQA 2J6UA 4B3RF 4LR9A 2IBOA 4V19X 1FE4A 4IFYB 2X78A 4J9OA 3SI6A 2FVSA 1JLBA 3VAMA 3DXKB 4H5WA 2PMWA 5B8HA 3SUQA 2RIJA 3HYFA 2ZUGA 4BR4A 1N8RT 1CBKA 2J9DE 3S6EA 1ZBLA 2V4JB 2X74A 1TL7B 3IBWA 1MMDA 4PKDB 5HOOA 1QSYA 3PM9A 4PCQA 4B3MK 3OXLA 4AH9A 3LZJA 3ZT0A 1OPZA 2DXFA 3RRHA 2CQGA 1V4TA 1CJUA 1TVRA 1RTIA 3O9TA 4BRAA 3I31A 2FLPA 1YJ7A 4B1XB 2QI2A 3QFPA 4USUA 4E3SA 5D77A 5LJWA 2IPOB 1W2IA 1Q5VA 1FWKA 1T0TV 4CJKA 1Q1KA 3IXQA 1S1VB 4LVOP 3V9UA 4JI0J 3DRRA 1NEEA 1X4EA 1RQ0A 4TYAA 3ENVA 1SCJB 2DNGA 3HHKA 2CPIA 2O8CA 2OAUA 2J8SA 2HNYB 3Q8QB 3V1RA 4OZ1A 3V6JA 2QYCA 4J2AA 2O67A 4NLVA 2BJDA 1WSHA 3UKRA 1LFPA 2ZZTA 5J2PB 3FEYB 2CUYA 5HQ8A 3VTHA 1U1MA 3OJUA 4N56A 4HACB 5HLFA 4NI2B 2OANA 2D69A 4F50A 3BF4A 4JEPA 2KG1A 2D0AA 3EZUA 4M3YA 3NEKA 1U8WA 1KNZA 2MZJA 3KKRA 4DSJA 3DLBA 3A3PB 3W60A 3WXLA 5EGYA 2IRYA 2W41A 4F4KA 1GTEA 1NPRA 4R79A 1NJWA 3T1AA 3QEPA 3H42A 5KG4A 2NNWA 1V5IB 2Q6CA 1RACB 2W01A 4X4SA 2UVRA 4JV2A 3RSEB 1GFWB 1WC3A 3C7NB 3CCVS 1B3TA 3CC2N 1UP1A 4FZYA 3QFWA 4OI4A 1UJ5A 3I4HX 1RT3A 3KIOA 1GLEG 3AA4A 1KOOA 2XB2D 1P1TA 1K1SA 5E41A 4EU0A 3O6WA 3PO4A 1K44A 2YWFA 1HKBA 3BH6B 5C2CA 3ILJA 2BUPA 2RSQA 4E2FB 3EGNA 1SB6A 2W40A 2X6SA 2D7SA 4N47A 5KFPA 4CBWA 3OHBA 1HJRA 1S9GB 1IG9A 2A5XA 3M8QA 2ZZMA 1VIXA 2DR6A 4M5LA 3QJJA 3CGIA 4LR7A 3CC7S 2VWBA 1NKBA 3DOLA 1S48A 2RS8A 1WKLA 4K41A 4LQ9A 2X6NA 2X51A 2RF2B 3IO1A 3IRXB 1NNEA 1Z6RA 2W6LA 4DTPA 4FJKA 4L8RB 4GMJB 1QM9A 3IS9A 4K4TA 3THXB 4F4AA 1NJIO 1HNVB 2GVDA 3IFEA 4NCAA 1VC6A 5KQ8A 2BJ3A 3WX4A 5E84A 3BZCA 2R8JA 4QPTA 1C1AA 1L3KA 2ZVSA 2QWQA 1C1CA 1FX2A 1S1UA 4NB4A 3TEGA 2CQ0A 1XEZA 2VBXA 5JMNA 2ZF5O 3W0LA 3ZZYA 1DTTA 2F4FA 4J9QA 5AQRA 3FEXB 1JLBB 3LDPA 2WSFC 2VQFJ 3VAJA 5THWA 1ZM2A 5DM7L 4KKOB 2E7VA 2XHBA 2UP1A 4FM1A 4P7TA 5AXKA 2ASOA 4JI0K 3BQ1A 2UVVA 1QVFR 1VJWA 2VPYB 1QQMA 2VQFF 2G8UA 4W5TA 4DV1F 5FPEA 4MQ3A 2Q3SA 1W7AA 1RTIB 2CRLA 2DH9A 2RNEA 2XTJP 1ILYA 4ANEA 1FWPA 4A8FA 2K8GA 4IRKA 4FYWB 3HZEA 3LDNA 3GMGA 1O6XA 2G0CA 1S10A 2ZKUA 1MMLA 1WC4A 3O6QA 2NXJA 5LXYA 4H5NA 4CJ7A 1MU2A 5F8LA 2RVJA 4KPCA 2JJ4D 2O8CB 3TTCA 2E5LF 3CJ0A 2HS4A 1RNHA 4USMA 5FLXY 4JI6F 2NPFA 3PRVA 3BGFA 5EN1A 1VJQA 3QETA 1HMVB 1YDLA 4DU4A 1BDGA 2RE1A 3MCSA 2B4JA 3UKRB 1X0PA 3O2IA 1VSIA 4ED2A 5LMNJ 4FF1A 3DRSA 4PABA 2DXDA 5KG1A 1WTBA 2LA6A 2UUTA 4C8OA 2KI2A 4ZHRB 4J9SA 2E8AA 3T9ZA 2DRAA 4KB1A 1I6JA 4CECA 4R0JA 4BC2A 3JS9A 1AZSB 3K8WA 2R7SA 3UCGA 1WHXA 4PWUA 3HBTA 1P8ZA 5A6WA 4UOHA 4FLVA 1FTCA 4DQ8A 1XHXA 3GG0A 2HWIA 5JUMA 2HS3A 3NBPA 4DTXA 1OWXA 1BU6O 4KHWA 1S79A 4E7IA 2ZH1A 1ASWA 3M2RA 2AJ2A 7FDRA 5HMXA 4ZJQA 1ICEB 4P6QA 4NXMJ 3AA8A 2DGWA 4ETXA 1ZZNA 4FLTA 3C6TA 3MXJA 2H54B 4HDHA 3CCWA 2EX3A 1FFWB 3DNCA 4ED0A 2G8IA 2JC0A 5KT2A 3DGPA 3KWMA 2VZ9A 2MKSA 3AO3A 4A8QA 3FVYA 5AQKA 3MUVP 2WOMA 3BEGB 2QKBA 2DTJA 3PG9A 2Z57B 4GRSA 1C2PA 5B0GA 2AGQA 2JWNA 3CMAN 3KNGA 2BE2A 3T3FA 1LK5A 3EZWA 1RP5A 1I3AA 5K8PA 1QVGR 2HRYA 2ILZA 1D09B 3KLFA 2HNZA 2M8HA 5A8RA 2XS7A 3MM7B 3FFIB 3D0GE 4YOYA 2BM1A 2B8QA 4LC9B 3MAAA 2G9OA 3CJAA 3O1LA 2CYYA 3FZMA 3BREA 3AGKA 1NB7A 3IS9B 3DAWA 5D0GA 2VQFK 4BGAA 1IKXA 3DN9A 3IMQJ 4I2PA 1GLFO 5BR9A 2V6AA 2MZSA 2XZDB 2UUCJ 3SMPA 1S5ZA 5CD4A 4JYAJ 1KD1O 3M8RA 1ASVA 2VQEJ 3DWLA 3GR0A 3ZZRA 3W64A 1JLFA 4BDPA 3WNFA 1DTTB 4HLBA 4JYAF 1RDUA 1HKCA 1R6YA 2WSCC 3CPEA 3LDQA 3LOUA 3L3UA 4B3TJ 3IBFB 4CF8A 3C16B 4JI8F 4JK8A 3VTIA 1RYRA 4YDXA 1PYSB 5CAAA 4CLZA 3O4QA 2I7NA 1SVDA 4CEZA 3SEOA 1CVJA 3K57A 3T5JA 1EARA 1PIEA 4LFBJ 3LP0B 2I2YA 1U1RA 2EXUA 3B6PA 5KFAA 2CVIA 5U47A 2VD3A 2A42A 1T6DA 5IWAF 1SPBP 3ENWA 3OXFA 5FLXU 4Z4FA 4L3NA 2DNRA 3CCEN 5KFDA 3UE5A 2CDRB 3PKYA 4F8RA 3CMES 4MMOA 4PL7A 3TAEA 1I1GA 1UVKA 2FJVA 4Z4GA 1EJ7L 5LMNK 5G0RA 3VV2B 3HFZB 4ZOSA 5E3RA 2MHEA 4DQQA 3TAPA 3H0PA 3M32A 2CADA 4JBCA 4NA3A 1RWUA 3THYA 2ZBCA 3CCZA 5HJYA 5F9NA 2ZVIA 1M5KC 3BH7B 3R3TA 3I9V9 1MLAA 2VG5B 3CJBA 4QR0A 3DRSB 2D1KA 2YKNA 1KQSM 4PA1A 1X9MA 4FF3A 2DGQA 2ATCB 3SAGA 1QSSA 1SQFA 2HGNA 3PW4A 3DRYA 3WQTA 1RTJA 2C3OA 4NYFA 1ULRA 2HHHJ 3T5KA 1N36F 4NXMK 3P1GA 3U1NA 1HHTP 3RAQA 5E33A 3AB4B 1F9FA 2YKOA 3H98A 4PQUA 2UUWA 2XQCA 3C3LA 2HHHF 3NBPB 1BLUA 1F3VA 3ILOA 4DS4A 4UUWA 1NJZA 4BACA 3LZIA 5B0DA 4Y2IA 3KJNB 4IH5A 4CJ4A 3M2RB 1R0BG 4CH1A 3RBXA 1FF2A 1TK5A 4BGBA 4X66J 3MDFA 3J80Y 2GUPA 3RBEA 2LMIA 2UUAJ 4DCJB 1ELOA 4X64F 5IT4A 4Y2KA 1KCFA 4KT0C 5KFWA 5KFCA 5D78A 1P1LA 1SC6A 4X66F 2JZ5A 3E9PA 4JK7A 2F4VJ 4F4ZA 4Z4IA 1S1XB 3QGHA 2MY7A 4OGCA 3GOIA 1NMDA 3W3SA 5DJBA 3UW1A 5AXNA 3FGVA 3AO5A 4M41A 2F4VF 2DRDA 3VQPA 4W5NA 1OY9A 2QN6B 5LJVA 2UUCK 4JI4F 1TTHB 1JLQB 3DLHA 4JYAK 2DVIA 1WEYA 1F60B 1T9UA 2VQEK 4NX9A 1TL4A 4A8YA 1WHYA 1MSWD 1JLGB 1A7GE 2D3OR 2E6LA 4NYZA 3W61A 2KHDA 2B4VA 2DNHA 4WTOB 1VSEA 4RW6B 3OYJA 1IKXB 3UD3P 1UA0A 2XZWA 4B3TK 2H51B 4GVBA 3I8BA 2HW3A 5JXSA 3MPWA 2IMOA 1X0FA 3N4PA 3ISNC 3MK6A 5TKWA 3TX0A 1VCTA 3KMSA 4DV6J 4GY2B 1FRXA 4I67A 2W2QP 4LFBK 4Q44A 2DITA 1ATNA 4CD1A 5DO2A 4EHUA 5LMUF 1Q9XA 2X3GA 3KWIA 4DL7A 4ALZA 3DI6B 3HP9A 5F8JA 1RK8A 4PQAA 4KJIA 1RT7A 5JS2A 4ZPTR 5GADU 4A4JA 2SXLA 2C2OB 4CFBA 4LMZA 4J9NA 1IJEB 4ILMA 3G0ZA 3NS5A 4U67L 4H8KA 3P45B 4G1IA 1JLCB 2YNFA 4C11A 3OYFA 3OR2A 3NE6A 4MFBA 4FXWA 5M2UA 3QB0A 3SI8A 4O3PA 4C9DA 1JJ2M 4OO1J 2NR0A 3Q8RB 3EKUA 5G0RB 3PIOQ 2XWYA 4URQU 2BANA 4BC4A 3FRZA 1D9DA 1Z05A 4CLLA 1Y5NB 4IG0A 2XEXA 5AXLA 1HLWA 1S1WA 5B0EA 3THYB 5B08A 2C22A 2HHHK 4B17A 1GOCA 1NUEA 4DQRA 4CLWA 4JLHA 2G8WA 2VBWA 2DHXA 4Q5VA 2BDPA 2R7VA 3MPVA 5AQFA 3HHLC 3HPGA 1F1BB 3LH2S 2A10A 4LF5F 4RU9A 1FT8A 1U2RA 4URSA 1N4LA 4FJLA 1RDAA 2RRNA 4F26A 3LDLA 3LPYA 1RTJB 3ZTPA 1T02A 3C14A 4X66K 4NPOA 3GBTA 1OH8A 2J7UA 2XULA 2W1BA 2UUAK 4N5SA 3J80U 4TLRA 1M5SA 1VQON 2I6WA 2BW2A 1SUQA 2KHOA 3PRBA 3PCOB 2F4VK 2HQDA 4EZ9A 2DNPA 3BKTA 2JNJA 2NYHA 3K9KA 5B0AA 1N54B 3R5AA 3WNGA 3FK4A 1S6QB 1NDPA 5KAKA 5E7OB 2H5IB 3P4UB 3KHHA 4TVAB 4HHJA 5HQLA 1YI2N 5DS7A 4DSLA 4UW2A 3HF5A 5ELZA 3BS9A 3UIQA 4OHVA 3PDNA 3B82A 1ZETA 4OFZA 5EX5A 2VB6A 5AE2A 4ZA1A 1QS4A 1VMBA 1HNZJ 3CVKA 1WC5A 4FNHA 1QJHA 3FMBA 4OPKA 5IS2A 2W4DA 3GQCA 1NSKL 2KZZA 2CPZA 4AHSA 4DV6K 3QPIA 1C6VA 2PY5A 4CO4A 3NOGA 4KC5A 1KVKA 1VQ6N 2OA8A 2R2RA 2I8EA 2OP5A 3Q8SB 4YEAA 4GVBB 1RWVB 4USVA 3NDKA 3DLKB 2OUGA 3CT9A 1TZ0A 2IM1A 4ELUA 2NRRA 1K0VA 2B51A 3EL2A 3KJQB 5CHCB 2IS3A 4M7XA 3OYHA 2AYMA 2ZH8A 1F3FA 4RNFA 2RQ4A 4MK7A 2WVFA 4MH8A 1T9VA 4OX8A 5DGAA 3IAM9 5C10A 2AV5A 1RAFB 3GILA 1RILA 3SNNA 3GU0A 2N4CA 3PX0A 3ZEUA 3PIOL 4HEA9 5AFUA 3V5RA 3KTQA 1PC5A 3DXMB 3VERA 1OH5A 2FHJD 3BP8A 4HTUA 2J9CA 3OSPA 2QLJB 4I56A 2MSSA 3BO4A 3MM5B 3NWGA 1VLYA 4C11B 1BUPA 1QD1A 4FS1A 3D9BA 3SFUA 3OYAA 4WTYA 3HX9A 4O3OA 4YB1P 2ALYB 2W24A 2P9SA 3GL1A 4CCHA 4A57A 3AARA 3TRGA 3AVFA 1AW0A 4ZPVR 1H38A 4FZVA 4PY5A 4HCBA 2W9CB 1X9WA 1CQNA 4Y00A 5DLFA 4CEEA 4ELVA 5SWMA 4LRFA 4B9SA 2AP6A 3HI9A 3V6KA 2XMVA 1IKVA 1IBKF 1REVA 2QWRA 2LXFA 5BR8J 3QRQA 4WXOA 2UV8A 4HWIA 5GAHP 5GADI 1WAJA 1VHIA 3SYZA 1UOCA 2J76E 1R0AA 3ZNJ1 4WFBQ 4CFAA 3CXCR 3D0IE 3UR0A 3M4XA 2RUSA 3QBWA 4G9ZA 1TAUA 1ATSA 1Y4ZB 4NLYA 4DJBA 5EHHA 4FPIA 3KG0A 4IKAA 3IG1A 1S6OA 5HI7A 4JKEA 1OPIA 4KHYA 3MMAA 4OZ2A 5A2QY 2BE7D 3L7OA 2ETJA 3C14B 2H9ZA 5KFOA 2O4IA 4BR9A 3KKSA 4NLXA 3VAHA 1B7FA 2FBTA 4DTRA 3CHWA 2K7KA 1D8ZA 3CW2C 5K8MA 2DEJA 2HFSA 2Y1LB 2DH8A 1K8AT 3FZHA 1ZM4A 2R7OA 3ASMA 1PSDA 4LF2A 1VS3A 4OI6A 1HHSA 1B4SA 1HNZK 5JJBA 3TOQA 3U1MA 1YIJN 4KH5A 2YX6A 3L4IA 5IQ6A 2IM2A 2YHYA 1TV6A 4OJHA 1BIZA 2V7YA 1XMOF 1KVCA 3A5NC 1YJWN 4B9NA 2OIHA 3OYNA 2I1RA 1U24A 4CF0A 3O3FA 4O5BA 2A40A 4Y0FA 3PIPQ 2E1MC 1NLVA 3BJYA 1N52B 1EP4B 3G6VA 1BIUA 3NAEA 2CJYB 2VBZA 2HFNA 4NLOA 2QJ3A 4CJTA 3IR7B 1NM1A 3MWBA 4PG4A 5I3PA 3LWMA 2DRBA 3S3OA 5KFXA 2DNLA 3LO3A 1XNQF 2DNOA 4KI4A 3RR8A 4X2BA 1VYAA 3MD1A 2DEIA 2MQ8A 3AVMA 2VPZB 1SV5A 5AJ3F 4PAAA 2E2QA 4YUDA 4DUZF 1WSIA 2C3PA 1VQ4N 2VU5A 3ZZPA 3MOZA 3WEEB 1AFIA 3EE8A 3FBEA 4F25A 1HWLA 3GJQB 3J81O 3AFGA 4DR2J 1XR6A 2Y3YA 2HNDA 1IM4A 2M70A 1WUUA 4OYWA 4ECYA 3EYZA 3IGNA 3UDCA 4A2BA 2E7XA 2WFBA 3K17A 3FZLA 1JKHA 2GA7A 1J5OA 2O01C 3H3OB 2XO6A 4OV6A 4DS5A 3A8KA 1HYZA 2GFFA 2P9EA 4O44A 3C6AA 1FNXH 3ZEUB 2VPXB 1VRQC 4MDBA 4M7YA 4CF2A 2ZHBA 2PGCA 1RWWB 4M3TA 4ZIWA 3CDWA 1FD8A 2NZ4A 3VEZA 2IFXA 2OPSB 5AZJA 1HW9A 2VYPA 4I6YA 4OYIA 5C2GA 4EBDA 2ZZNA 5BR8K 4BRNA 1U26A 4WFBL 4P7VA 4PKGA 3AVHA 4KY3A 1W26A 2Z2MA 4PUOB 5JICA 1IKWB 2FPHX 3C15A 3CCSN 3A3OB 3HTVA 2IBKA 1NK5A 4PG8A 5D3GA 1NK7A 4CDIA 1X5TA 3UCZP 1FRIA 2NXEA 3W2VB 1O13A 3CJRA 5C7PA 4Y1CA 3T7ZA 2XY6A 1FKPA 1RT1B 3BBFA 3POTA 2GAGC 5A2QU 2UXCJ 1TK8A 1KC8T 1PYTA 2GBZA 5HP1B 3VF2A 4WFNQ 3SCLE 1SL0A 2AZ3A 7AT1B 1WLJA 4A47A 4Z4EA 1CQMA 4FWLA 4U95A 1U1PA 4EAHD 2UXCF 4BE2A 4IBNA 4H0TB 4LF7F 3ZSRA 4K59A 4OHWA 3SCXA 2FVCA 3NGKA 3J8AA 2DNMA 3CCTA 5D0EA 3ZNUA 2PC6A 1U6ZA 2XYGB 4H5RA 2P5GA 3BGUA 1ZS6A 3GYNA 1R59O 3HOTA 4PEOA 2AP1A 4JI1J 4LREA 2PYLA 1HARA 1H72C 1WOOA 3I56N 4M3UA 5I9EB 3PIPL 4FLYA 3GIMA 3CJ5A 4FWSA 4B9MA 3OR1A 3RGIA 1GLBG 2KT2A 1ZAVA 4FOIA 3HHEA 4DU1A 5I42B 4PYAA 5H9EJ 2CNOB 4BR0A 4LR8A 4QU7A 1XK8A 1S77D 3L2QA 3X1LB 2IVPA 1X7VA 3M8PB 2UXBF 1VQ7N 4ZCIA 3PSFA 2BM0A 3MX2A 4CVNE 1FKOA 3AD9C 5DQGA 4YY3F 3QRPA 2IM3A 5AQWA 2ZWOA 4AHTA 2CJKA 3V81A 5HMWA 1N32J 3L95X 5BRHA 1GLLO 4OYOA 5JVGQ 2AJ4A 4OI1A 4KFBB 4F7VA 2CQCA 4E1MA 5HRNA 2RDJA 4QAGA 2JFKA 4WQ5A 1WN7A 2OTLN 1KOHA 2OGUA 1BQMA 1N48A 1VBYA 1N32F 2FVQA 4C4WA 3QICA 1IKYA 1GXUA 1RDBA 5KFSA 3QNNA 4BCAA 4DR2K 1DZ5A 4NLQA 3KYLA 2C2RA 4DR7J 1FXLA 2ASDA 4IEEA 3O1BA 1FHTA 1ROFA 4JN4A 1S1TB 5FPMA 4XO0A 3C19A 3ATUA 4JKBA 3MR7A 1MW7A 1RLCL 2UV8G 1KLMA 3DHWC 1RT2B 2XZTB 3BB5A 2EC2A 1F2GA 2BX6A 3DLJA 4X4QA 1M5OC 4OVLA 1DTQA 2F63A 4IRDA 4FJHA 4RKUC 3O9SA 2HNDB 2Z1JA 1NO8A 4K4YA 4GKKJ 4GC7A 2FY8A 1N0VC 3TQ1A 4NLCA 3NF6A 1JKHB 3NAHA 3CNQP 1CPZA 3F5TA 3OL9A 4DDFA 2FC0A 3LTOA 3CQ8A 1SKWA 2ZM6J 2QGFB 4O44B 1QQCA 2FUG9 3N79A 1G2EA 2DNNA 1Q16B 3CM6A 3E66A 2FC8A 4D3GA 3NCRA 3CJ9A 1HQEB 1FJGJ 2G8KA 4CJRA 2LU2A 3O9RA 2RHQB 3TO8A 2ZM6F 3CJ8A 4J9RA 3M2UB 2HHPA 4EFHA 2NSBA 5AZJB 2MGZA 3AA3A 3AVGA 2QEXS 3D54A 4BRIA 2ZC3A 4AXIA 2CXEA 2GX8A 2MYFA 2VFTA 4WFNL 3OT9A 1S7HA 3J7AP 1H98A 2UXCK 4YFUA 2W2MP 4RW7A 1HPMA 3C15B 2WUSA 3PY8A 5D3GB 2W42A 2V4QA 3SBGA 3TW0A 1KBRA 2D9PA 3MECB 1TL1A 2CAJA 5BYSA 4AT1B 2ZE2A 1YTYA 3T1YJ 1CJKA 5HN0A 4ZN1A 4TY9A 2HMPA 1T3OA 1E6YA 3DYAA 1SS6A 2XYPB 2B8PA 1UFLA 2J9EA 1Q8KA 4K43A 1C1BA 2HKEA 1UPPA 2HVDA 3BBCA 2XSFA 2V8HA 3TVYA 3P8BB 4JI1K 3UVJB 3VQ5A 3KK3A 1RAGB 2X1FA 3NF8A 4NLTA 4KPYA 3N6LA 4IQMA 3KK2A 1FXXA 2FBVA 4B1ZA 1RXOB 3MMCB 3MF5A 1XR5A 3LDOA 4M5IA 5H9EK 3R6GB 4AXJA 3IKMA 2MKKA 1VLOA 1E4FT 4ATNA 3KZBA 5D4PA 4CI6A 3CCQN 3QDKA 1A6LA 3NVMA 4I6AA 2DR9A 5JVGL 3SSRA 3ISZA 1FFGB 1N56A 2HBJA 1N32K 3DLEB 3UD4P 5A0YB 3OR1B 4WKYA 1AUDA 4NLRA 5JS1A 3H4DA 1VQ9S 1WC6A 3NWRA 1HD0A 3JYTA 4TQSA 2Q79A 4IJAA 1WF1A 3KUEA 1W9HA 3M8ZA 3ZZZA 4UUXA 2GIFA 3FSYA 3U7JA 4OI3A 4HUFA 3ZT1A 3G25A 2QMWA 3V81B 4DR7K 5AQOA 8ATCB 4F04B 1OVYA 3V1OA 3QESA 4O3QA 4V19S 1X4FA 3R97A 5KT4A 2OMLA 4LSLA 4RUBA 3MM6A 3HDSA 1JB0C 1VQNN 4OLPA 4HKQA 1S76D 1RCXB 5KFNA 4DV7J 1IKYB 2LA4A 2XNQA 4DPWA 3WQUA 2CQDA 3OD2A 1WKKA 1XWLA 1GAOA 5HRPA 3ZETA 4GKKK 4LH5A 4DX7A 2HYIB 1U25A 1UMJA 2GVZB 2QSFA 3OYKA 2D0CA 2JX2A 3FQLA 4DUYF 2DGUA 4W98A 3ZT2A 1FRHA 3CD6S 2V2QA 3PW7A 2KKZA 1Q95G 2ZM6K 1U47A 1VISA 3GYXB 2BUNA 2HFOA 2KRRA 1ZM3A 2HEKA 3U3GA 3SAHA 4NA1A 3SCJE 1LEOA 5F0WA 1FJGK 2AJFE 3MEEA 4UQTA 1RAEB 3LAMA 2ROGA 2D3O1 4XPEA 5IM0A 3M30B 2ZDOA 3CCRS 1TL3B 1KQSR 3PR5B 4HHTA 1YF5L 2LDYA 4EI2A 2WBRA 4CW7B 1VBKA 2XWXA 5AQNA 2Z0GA 2FJEB 4TY8B 4X62J 2F65A 2CQBA 2FHMA 4EUVA 4A62A 3QSYB 5IV4A 1C0TB 2V34A 1VC5A 1URRA 4NWBA 3T1YK 3EY1A 3N01A 4QIWD 4ANDA 2V7ZA 1EWQA 3M6XA 3JSMB 3AAWB 3V9XA 5BRDA 3QRRA 4RW7B 2HZCA 4LFCF 2XY5A 3G8TA 4Q8EA 2NRVA 1MN7A 4E98A 1AA1B 1YTUA 2MKCA 3MR3A 1LW0B 1FKAF 1TKZA 3LQVA 1TL1B 1KC8O 1U49A 3EGWB 2ZE2B 1X4CA 2HAIA 4KRFA 2EK6A 1RA7A 1M1KO 4DL4A 2GZOA 2XMWA 1BISA 3O3GA 1RTHA 1HBOB 4Q43A 2WVBA 1L3TA 3NXZA 3IM8A 1E6YB 3MUTP 3Q7BA 1UWBA 2JRSA 4YB7A 5IC4B 2ZH4A 4DV5J 1WHVA 2O8EA 3O8WA 2O8BB 2JDJA 2OZSA 3BQ0A 1PCAA 1KSPA 3KK2B 1ZPWX 5TKYA 3I0RB 2KM8B 4JI5F 3FBCA 1Q79A 1U1NA 4CJSA 3GLJA 3L2RA 2B5JA 1OYDA 4Z94A 2UYTA 1TKXA 2VJVA 1HBUB 3CJ4A 1UJ6A 1BHNA 3GJSB 1SI9A 4BWJA 3CIPA 4CJ3A 3OJSA 1I51B 4LH4A 2H48B 3MEGB 5HATA 3HHNB 3F9MA 1ZA2B 2B43A 1RYSA 2WVEA 1J5EJ 2Z2ZA 3HSTB 2IIRA 5KT3A 2FLNA 3NS7B 1LXNA 2QK9A 4CJVA 2HK2A 5CCLA 3EJMA 2WTFA 1RE1B 2OD4A 1TYQA 3QT8A 3U27A 4AFFA 4CWBA 3EMTA 5M2RA 1X3MA 2P9LB 4DX8H 1LCUA 4DV7K 2UUBJ 3TUJC 4PXEA 3SIPB 3CJCA 1YGYA 2ZJPQ 3F56A 5DMRA 4W5QA 2H5EA 2UVUA 1UEKA 2E1ZA 5ADXA 2Q66A 1YJNS 3K8VA 4OV1A 4ID1A 7FD1A 2M88A 2ZJRQ 3MUMP 2DR8A 3VVUA 2ZOMA 5GMDA 3O9UA 2V51B 3MR5A 4JUZA 2V0NA 3GIRA 3RMDA 4YOXA 2GNKA 1PBAA 4N7TA 3WC2A 2D0BA 4BRKA 2P9GA 1A5WA 3TAGA 4BR7A 4DMNA 4ZVEA 5AQUA 5LM7E 5M1FA 1UTAA 2NUUG 4R8UA 4DZ6A 2VG7B 2FBXA 3QIOA 3LW5C 4HR2A 2HHTA 3OLBA 3AY0A 4FWPA 4I0WA 3UD5A 3OY9A 3US5A 3T1HJ 3MCOA 3M6UA 1NK8A 1WNSA 3LP2A 2XG8A 2IHR1 3CC7N 4FVMA 4WQ5C 3MEEB 1WBBA 4ILLA 4X62K 1F6TA 4QIFA 3T1HF 1QUPA 4QJVA 2VKRA 3AGRA 4GVMA 4KHNA 5F9LA 3GZ7A 2V5HG 3LF0A 2VDIA 3Q23A 1X4DA 2C1EB 4FLZA 2Z1IA 1RBAA 1BUXA 2WVCA 1IBLJ 1JJ4A 4O8UA 1UW4A 1UEVA 2MTLA 4CGJA 1K0TA 1VRTA 2GJIA 4O5FA 2FC9A 1NH7A 1FDAA 1XNRJ 4M3XA 3A5MC 3TAQA 1FCAA 4FJIA 3MMBA 3JB9k 1K73T 3ZTQA 4IH7A 3HXMA 4DV4F 3VEXA 2YKQA 4ECTA 1WORA 1MWQA 5AXMA 1EKEA 1KDNA 3GR1A 2WK4A 2HOEA 4BQZA 3G4SS 4Y65A 3KLHA 3M6VA 4JKFA 4OX9F 4DV5K 1D9AA 3L3VA 4QYRA 2KXFA 5J1NA 3PNIA 4AUKA 4W5RA 4MKAA 1WTFA 3EE9A 3QSIA 1Z1ZA 1TKTB 5LSLA 1UWBB 4K0KF 1KVAA 2A3JA 2EBGA 2ABYA 3CDEA 4CIFA 4BDYA 1RI7A 5ETSA 4Y2CA 5KT5A 2EWHA 4JI3J 3EGVA 1J5EK 2ZH5A 5LJ3Y 4HI2A 2VFRA 3GSIA 2E5IA 4GKJJ 1H6KX 2ZHOA 2EKNA 3KNAA 3IWXA 2FZKB 3KG4A 2IA6A 4YOTA 3BSOA 1R8AA 4NO7A 2UUBK 3FZKA 4PPDA 1R7IA 3R27A 5CH7B 2PFUA 1NK9A 3RVCA 1MROA 2L41A 2RPIA 3LAKA 1YITN 2C3UA 4Y2AA 3CEDA 1EAYC 2QLWA 5DRKA 2Q0UA 2HF4A 5IT9Y 4CJQA 4A5AA 1WDDA 2MDAA 2C2NA 2GC8A 2GQCA 2EHGA 3RMAA 3PFEA 1F21A 5KRSA 3GPAA 2D0OA 3SSQA 2KM8C 4K5RA 5JLFA 3Q89A 3NGUA 4NCGA 1BWVA 3HZ6A 5DG8A 3T5LA 3QLHA 3LP1B 4RL1A 3M1VB 2QZ8A 2EI5A 1T3NA 3WZ0A 1BD6A 4Q8FA 4FW2A 4QW9A 1UCNA 2QWPA 5KFHA 4ETZA 4QWBA 2ZDPA 1X5OA 3T1HK 4UZCA 2WAQD 1WNEA 4ELTA 2E1YA 2B9YA 1W25A 2KZMA 4Q2LA 2ZH9A 2QSWA 2QC3A 1RU2A 5ETOA 4IUFA 3VGKA 2R7UA 2FJWA 1QAXA 1SH2A 3E8OA 2YHBA 2FJDB 3MCAB 4CO0A 2R7TA 2U2FA 4M5KA 4OX7A 1E3MA 1IBLK 4C6AA 2XMJA 1NH8A 1G99A 2QE5A 4HDGA 4MDAA 1Q82T 1YJ9S 4JD2A 2QA4G 4KV8B 2OSQA 3MPDA 3L9ZA 1XNRK 3L7PA 3HVAA 2A1RA 3NF9A 4OIXA 3OYGA 3NP5A 1Z2LA 4OGEA 1IV0A 2QLBB 4TNOA 1HNWF 4ZPBA 1SC3B 4ZVRB 3SK3A 2BABA 5KFTA 5AQHA 3LANA 5D0RA 4FPAA 2BEFA 4JNEA 5HJXA 1YJTA 1N88A 2ZNYA 3CCMN 3SUNA 2XGQA 3MN5A 3BF3A 1ZTTA 2CVEA 3ZT4A 5HANA 1NMNA 3PYGA 2C42A 4I69A 4DQIA 2EKYA 5KOWA 2YKMB 1Q8LA 4USHA 4KHQA 3C65A 2IJNA 1IN0A 4IKFA 5J1EB 3KLHB 2B56A 1HR0F 3JTNA 4CZLA 4DV3J 1CZBA 2XMTA 4CIGA 4JI3K 1RLDA 5FPDA 4C3KA 4JHDA 2RQMA 2IAJB 3CD0A 4GKJK 2NQPA 1DAXA 3GTYX 3NCQA 4KGVB 3WX8A 5IFMA 3TUZC 2RD5C 1NXIA 1IR0A 3VEWA 2ZJQQ 4MIBA 3CMEN 5AQMA 3VGUA 3DM2B 3B6BA 4YHHJ 4QIVA 2GV1A 3CJ3A 4JV5J 1IJFB 1CS4B 1AXQA 3QT6A 4BDZA 1RT4B 2HVEA 5BPNA 5IT9U 5KQDA 2W9BB 4YOVA 1OH7A 1QZ5A 4UTGA 1TK0A 2DHSA 2YNIB 4F3QA 4QWDA 2JLFA 3D6MB 3LDSA 3W3DA 2OPRA 3PEJA 4DPTA 4RW8A 3TVZA 1P90A 1Y97A 4QU6A 4I6MB 4NOHA 5C15A 4QR1A 1YLXA 3OQ2A 4K4ZA 1GXTA 1T8EA 4RBUA 2GMLA 1RBTA 2RKIA 1SQGA 3AJDA 2QV6A 3LGHA 1QE1B 3OXGA 1KP6A 3TSQA 3E01B 2C3YA 4PPZA 1XBWA 1NJYA 1ZBSA 2LCWA 2ZHAA 3OW2R 4RCHA 2L9DA 2EW9A 4B3SJ 1C0UB 3HVTA 3EX7B 2J6SA 3OFEA 4O0JA 4PG7A 4EBCA 3M5RA 3THWB 1WWHA 4ZITA 4I4BA 3BKUA 3VETA 1T9YA 1DQAA 2J6TA 1R31A 1GMWA 4A8WA 4M5NA 3EPIA 3G2XA 3R7BB 2BYCA 4YOWA 1U09A 3G87A 5D4OA 1JLAA 3CQXA 5T7LA 2GX9A 3QYYA 2ZWPA 3ILIA 3PTWA 3OTOJ 3DRPA 1IG8A 4Y28C 1NBEB 2DGTA 2F7VA 4MYUA 1TR0A 5A8KA 4OKKA 4X4VA 4JD2B 2CH6A 3M2VA 1VR6A 3OTOF 1YHQN 2CZ9A 1UEUA 4CEAA 2HZAA 1T7PA 2CPEA 2P1JA 2K1RB 2QTDA 2YWWA 4J2EA 4CIOA 4G1PA 5AZIA 2IA0A 4FBUA 2HPUA 2BGGA 2HRUA 4B9UA 1K73O 1DQ8A 3MN6A 3QATA 4PWDB 2FSNA 2M52A 4E0DA 4YB6A 2XMAA 2CNKB 4CF9A 1HNXF 3KWGA 4DV3K 1OIAA 4IFYA 1LKZA 2P9KB 2WHOA 2LQJA 2ZITA 2EWSA 1VHXA 2COLA 4LF4J 3QEXA 3OYMA 3BV8A 1V5VA 1HI1A