4OJRA

Crystal structure of the hiv-1 integrase catalytic domain with gsk1264
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
131
Chain Sequence
PGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 Integrase
publication title Allosteric Inhibition of Human Immunodeficiency Virus Integrase: LATE BLOCK DURING VIRAL REPLICATION AND ABNORMAL MULTIMERIZATION INVOLVING SPECIFIC PROTEIN DOMAINS.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 50
structure length 131
sequence length 150
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ojrA00
1XHXA 3TARA 2ZQBA 2JGUA 3HVTA 3QIPA 1L5UA 1Y97A 4OJRA 4R5PA 3RMAA 3VQ8A 4DQQA 1LWFA 3RMBA 1RBSA 1KTQA 3NDKA 1ZBHA 3C94A 3SUOA 3PX4A 2F8SA 1RTJA 5KTQA 3M8PA 1I3AA 4CK2A 4OLBA 2YNIA 1WSJA 1TL1A 2IC3A 3V4IA 3AA4A 1IH7A 1CZ9A 3MEGA 2X74A 2YNFA 3K5OA 2WONA 3PUFA 1ITGA 4FW1A 2G8HA 3QESA 2DY4A 3A2FA 3VN5A 4EP4A 3KJVA 3AVIA 3SV3A 4FM1A 5EU7A 3QNNA 5HRNA 4EZ6A 3SJJA 1EP4A 1B9DA 1IKWA 1FXXA 4KHQA 4G1QA 4I9QA 2Z1IA 4FJNA 3V9ZA 4FLWA 3V9XA 4J2EA 3SNNA 1WAJA 4M3XA 1JL2A 4F3TA 3V9WA 2IGIA 3K2PA 2OZMA 3TAFA 3AO4A 4AHTA 3AVNA 4BACA 3DLHA 3QERA 1TKXA 4DTUA 3OJUA 1RDCA 2P5OA 1NK7A 3VQBA 3HPOA 5HRSA 3OVNA 3AO5A 1RDAA 2VG7A 1VSMA 1BI4A 1RBTA 3K5LA 5KGXA 4FZYA 4NCAA 2JLEA 3K57A 4YNQA 3TAMA 4UQGA 4DLGA 1NK8A 4N56A 3NBPA 1JLQA 3NGZA 3NH1A 4KHSA 3MXIA 1BQNA 4FM0A 4B9TA 2OPPA 3QETA 4KREA 4CJKA 4CJUA 4DQRA 2YKMA 3AA5X 1JLGA 3OYKA 1T7PA 3KD1E 5E41A 1SKRA 4FJIA 3DOLA 1JLEA 1BI4B 4KFBA 2Q3SA 3AVKA 3LAMA 3OYCA 2YHBA 3ULDA 4CF8A 1D8YA 3EZ5A 3QLHA 1VK0A 4O5BA 1F21A 3KLFA 4DSFA 1IG9A 2EHGA 4N47A 3H08A 3MEDA 4CIGA 4W5RA 4C8OA 3LWMA 3K5MA 4HCBA 2HHXA 3MXJA 4ZTJA 4FLZA 3CYMA 3HPHA 3VQ9A 2FBXA 3B6OA 3DLRA 4E0DA 3QEWA 4IG0A 1RT4A 1BIZA 5J2QA 4KHWA 4CJRA 3V9UA 2HHTA 2Z1JA 3T19A 2XY7A 3OJSA 5J2NA 3QEVA 3O4NA 4FZZA 3HK2A 3LANA 2D5RA 3LP1A 4JRPA 4B8CA 2W42A 4RW9A 3T1AA 4DTMA 3QEIA 1BHLA 1IKYA 3ZT4A 1CXQA 4CEOA 2XY5A 1JXEA 3K5NA 3VQDA 1XI1A 4F8RA 1UA1A 5K14A 1J9AA 4CIFA 2F8TA 1RDBA 4AHVA 1U49A 1VSEA 2ATQA 3OYIA 4E7IA 3PV8A 1NKBA 2HMIA 1L3VA 4CEFA 1C1CA 1U48A 1LAWA 1S1WA 1IKVA 1RT1A 3KKRA 1C0UA 2I5JA 1HQUA 3MEEA 3V1QA 1CLQA 1YTAA 1BCOA 1ZBFA 1Z25A 3SPYA 4LY7A 1IO2A 4CF1A 4DMNA 3OS0A 2E6LA 3SQ2A 2OYQA 4FLXA 5HP1A 2HVIA 3PO5A 2B6AA 3AVBA 4CGJA 1TL3A 5CY4A 4W5QA 4Z4CA 3KLGA 3HYFA 1TK8A 1KSPA 3RR7A 1LWCA 2GBZA 4M3TA 4PQUA 3QNOA 1XWLA 1S6QA 4ZTFA 3DLGA 5CZ2A 3VA3A 3L2VA 3TI0A 2D0CA 4O0JA 3LP2A 1SKSA 1RTDA 4EZ9A 1S1XA 1RTHA 4B9LA 1QSLA 3OYBA 2Z1HA 1S9EA 4Z4GA 1ZBLA 3AVMA 3D0PA 4FLUA 2P5GA 1HPZA 4O0IA 3AVCA 3I0RA 4I2QA 1NJWA 4DF8A 3C6UA 1HNVA 1HJRA 1EKEA 1RNHA 4CEBA 4CK3A 1Q9YA 3KD5E 4CJ5A 4FCYA 3NFAA 1GOAA 5FDLA 3OS2A 1S1VA 2HB5A 3TAPA 3DMJA 4H4MA 3NGIA 1L3SA 1IKXA 3L3UA 4CGGA 2GUIA 3AVHA 1BL3A 4OGEA 3PX6A 3ZSXA 2HHWA 1HNIA 3M8RA 4FK0A 4BDPA 3ZSOA 1YTUA 1VRTA 1TGOA 4PUOA 3HM9A 4DU4A 3ZSVA 3I0SA 3LP3A 4FJ5A 4Z0UA 1D9DA 4KHYA 1BGXT 4KTWA 4DS4A 1DLOA 1LWEA 1Z26A 2O4GA 3OY9A 3KLEA 4Q0BA 1RBVA 3MAQA 1LV5A 2HHVA 4CESA 3LP0A 3AA2A 4E7LA 1KRPA 1VSLA 1T05A 4AHCA 3F73A 3SV4A 1RT5A 3VQ4A 5DMRA 4K8ZA 5D3GA 3VQEA 3V6DA 2F96A 3HPGA 2X78A 5J2PA 4W5TA 3S9HA 1U47A 1SKWA 3L8BA 1O1WA 4LSNA 2RN2A 3G0ZA 5CYMA 2ITGA 1S9GA 2R7YA 1U45A 1KFSA 3PY8A 4NCBA 3AV9A 4XIUA 4FK2A 4E3SA 3ZSZA 1RT7A 3O4QA 4W5NA 3C6TA 2E6MA 1TKTA 4NCGA 4Q5VA 3SQ4A 4QCLA 5JS2A 2Y1JA 2X6SA 3HP6A 1U04A 4ID1A 4CGDA 3OYNA 3L2QA 3SPZA 1FKPA 4RW7A 2G8KA 3RR8A 1TAUA 4FJ7A 4F2RA 3L2WA 5HBMA 3QINA 1NK5A 3CG7A 3LPTA 3HJFA 2FC0A 4HUEA 1KVAA 3CM6A 4KI6A 4DFJA 1VSKA 4JRQA 3RRGA 2XO7A 1X9MA 3TWHA 1WNSA 2YV0X 2G8FA 1BIUA 1QSYA 3I8DA 4J2BA 4IBNA 4B9NA 2IOCA 3HP9A 1ZBUA 4BWMA 3VQCA 4CGFA 2XRIA 1A5XA 4ICLA 4RW8A 4PWDA 4CJEA 4M45A 3CM5A 1HYSA 3KLIA 3VQPA 1QHTA 4LH5A 4M3UA 4CEDA 3ALYA 4FJHA 4FJKA 3HSTB 4I2PA 4OKEA 3LWLA 3K59A 3ASMA 2HW3A 2VG6A 1JL1A 4J2DA 2KZMA 3SQ1A 4CJ3A 4HHTA 3JYTA 3CFRA 2O4IA 1K6YA 4I9LA 3QEPA 4FM2A 4B9UA 1LW0A 5HRPA 4DSJA 3HO1A 2VWJA 2D0BA 1MU2A 1CXUA 4ELUA 1EXQA 3KK2A 4OLAA 4DSKA 2QKKA 2HHSA 4CHPA 3OYHA 4AHSA 4ID5A 1D9FA 3G10A 1QSSA 1WSIA 3L3VA 4FW2A 4AILC 4CF0A 1BCMA 2YNGA 3TR8A 5SWMA 4B9SA 4FJ9A 1EX4A 3VQQA 2BGGA 5KRTA 1RTIA 3OYAA 4E7KA 2FBYA 2FBTA 2X6NA 1UA0A 3QEXA 4J2AA 4Y1DA 5KI6A 1BISA 2G8WA 1HQEA 4YFUA 2OPSA 3M8SA 3RRHA 4DSIA 2ETJA 4AHUA 5I42A 3EYZA 3KLHA 2B5JA 1HRHA 4CJSA 5HLFA 2HNDA 4CCHA 3WNGA 3S3MA 4E1NA 4CEEA 4CJFA 1QQCA 3HL8A 4E19A 3VQAA 3AVJA 2FBVA 4OGCA 2LSNA 4HVJA 1TKDA 4LD0A 4CF9A 4GVMA 1C6VA 4CEAA 2YKNA 2QXFA 4HTUA 3BGRA 4E1MA 3KIOA 1C0MA 5CYQA 1TKZA 4O55A 3UIQA 1G15A 2IAJA 3DOKA 1S1UA 4JLHA 1YT3A 3OYDA 4HUFA 1KLNA 4M3ZA 4QOZB 3B6PA 4DG1A 1NK9A 4RG8A 4CHYA 1XC9A 5J2MA 1X9WA 4N41A 3OYGA 3NHGA 4M3YA 1WSFA 3OYMA 1U4BA 1ZYQA 1FKOA 3CFPA 3HVRA 3VQ5A 4CEQA 4KPYA 5FRMA 4CGIA 4TSXA 4LH4A 3QIOA 4FXDA 4KRFA 3OYFA 1SL0A 1C1BA 3V1RA 3DRSA 3TAEA 4KHNA 3F9KA 3S3NA 3SI6A 4JS4A 1RCHA 2EX3A 1KFDA 3ISNC 4CHZA 2PZSA 4KTQA 3JSMA 1ASWA 4BE2A 3QO9A 4H8KA 2Y1IA 4C8LA 4DSLA 3O3HA 4FJLA 2PY5A 1WSHA 4JS5A 1NOZA 5HRRA 4E7JA 2IDOA 1NJXA 4NYFA 4DFPA 2KZZA 1RT3A 4DFMA 1NKEA 4LSLA 4CFAA 5KRSA 1J53A 4C8NA 2G8UA 4DQPA 4DTJA 1RT6A 4Z4FA 4PY5A 4KB0A 3AVAA 4DFKA 4DTPA 1TV6A 4DS5A 4B8AB 4F4KA 2XHBA 1NJYA 1HMVA 4AH9A 1FK9A 5FRNA 2HHQA 3CFOA 3AVLA 1A5VA 3L2UA 3C95A 4CJQA 4CE9A 3RMDA 4HCCA 4CJPA 1GOCA 3OYJA 3OS1A 1J5OA 3RTVA 4DTXA 1LW2A 4KTZA 3S3OA 2AJQA 3VQ7A 3LDSA 4CF2A 3ZSRA 1QE1A 2RPIA 4BDZA 3V1OA 1UAXA 3ZT1A 1RBUA 1J54A 2KTQA 1CZBA 3ZT3A 1L3UA 3P1GA 4CEZA 1WN7A 4N5SA 4DSEA 3WNHA 1SV5A 2ZD1A 4RW4A 2PYLA 1VSJA 4O4GA 3HXMA 3MXMA 4CERA 1NOYA 4IFVA 2WOMA 3AVFA 2GV9A 1N6QA 4QAGA 3ZSQA 3DLEA 3IG1A 1SL1A 2PYJA 3IRXA 4KAZA 3T3FA 1DTTA 4CJLA 4ZHRA 2KFNA 2KFZA 4H4OA 4FVMA 3DYAA 4KKOA 2DTUA 1KVCA 4C8MA 2YHAA 1DTQA 4O44A 3NCIA 3THVA 2HHUA 4AHRA 2G8VA 1S1TA 1C0TA 3NE6A 1QTMA 4CJWA 2G8IA 3TAGA 3NF8A 3NF7A 4W5OA 3V81A 1L3TA 2OZSA 2HNZA 3ZT2A 3MECA 4B08A 2XY6A 3VA0A 4CGHA 3NF6A 1UOCA 3IS9A 1VRUA 2VWKA 3KTQA 3PX0A 3E01A 4DU1A 3IAYA 1ZBIA 1XHZA 1VSFA 3RWUA 2VG5A 5FROA 3U3GA 1Q9XA 3ZSYA 1JXBA 1S6PA 5DK5A 4PA1A 2E4LA 1R0AA 4CHQA 2QK9A 4B9MA 2OPRA 3EY1A 3SUPA 1W9HA 3HT3A 1HYVA 2HVHA 3SUNA 3SCXA 1Q8IA 3DM2A 1VSIA 3AA3A 1NK6A 4MQ3A 3SZ2A 1TK0A 2YNHA 3KK3A 4IFYA 1B92A 4CJTA 1JLAA 1EETA 4CK1A 2OPQA 4ELTA 4EP5A 5J1EA 4BDYA 3BDPA 1I39A 1VSDA 3NAEA 4DTNA 1T8EA 3O3GA 4DQIA 1NK0A 3O3FA 1LAVA 4BE1A 3LAKA 4IG3A 4RW6A 5C24A 3LZJA 4FLTA 1D5AA 1TAQA 3D45A 1ASVA 4FJGA 3PO4A 1JLCA 3AVGA 2QKBA 4DU3A 3TANA 4FJMA 2P51A 4FJXA 3LPUA 4E7HA 3RMCA 4K8XA 4IDKA 4NYNA 4E89A 4F3OA 4FK4A 2ZE2A 2DFHA 3WNEA 3OYLA 1YVUA 3LZIA 1JLBA 4OKKA 4KI4A 1TVRA 2B4JA 3SYZA 4CECA 4DLEA 1WLJA 3M8QA 2HNYA 4B3OA 4BE0A 3NGYA 2D0AA 2P1JA 1KCFA 1WAFA 1SUQA 3CQ8A 3V9SA 5SZTA 2KW4A 4M41A 4FYDA 4Y1CA 4OKJA 3AO2A 3NH2A 4KHUA 4ELVA 2NUBA 2XY8A 3U3YA 4KB1A 1B9FA 4GMJB 2A1SA 2Z1GA 5I3UA 2RKIA 3ZT0A 1T03A 1X1PA 1S5JA 4L8RB 3DI6A 4M3WA 1JKHA 4CFBA 4CFDA 3DRPA 4KV8A 3KK1A 1GOBA 4CFCA 5HROA 1TK5A 4Z4IA 2BANA 3NF9A 4FJJA 4BWJA 2A1RA 3WNFA 3AO1A 5C25A 1W0HA 4WE1A 3DLBA 3AO3A 3SQ0A 4CIEA 4Z4HA 3P5JA 4M3RA 1UWBA 4FZXC 4Z4EA 5T7BA 3KKSA 3VQ6A 3NH0A 1SL2A 2DFEA 5KGWA 4DTRA 5CZ1A 1REVA 1ASUA 2DFFA 3U6FA 1A5WA 2KQ2A 1WSEA 4KO0A 4FLVA 4C8KA 4OPKA 1JLFA 3ZCMA 4CHOA 2OA8A 4F2SA 1RDDA 5C42A 4N76A 4DWIA 3OYEA 1X9SA 4OPJA 1VSHA 3DRRA 4CHNA 4HUGA 1C1AA 2BE2A 4DTOA 1WSGA 4OVLA 4GW6A 3K58A 4DQSA 4IKFA 2RF2A 2BDPA 1RT2A 4CJVA 3TABA 3TAQA 4FLYA 1RBRA 3DLKA 3FFIA 1HYZA 4CJ4A 1BQMA 3ZSWA 1KVBA 4I7FA 1KLMA 4FJ8A 3P83D 1NKCA 4MFBA 3LALA 1QS4A 3L2RA 2IS3A 4DF4A 5JS1A 1N5YA 4B9VA 3SUQA 1NK4A 1RILA 3ITHA 1NJZA 4M42A 4DTSA
chains in the Genus database with same CATH superfamily
1XHXA 3FFKB 3TARA 2JGUA 3HVTA 3VGKA 1VHXA 1ZBHA 2P9NA 3CI5A 1LWFA 3O1WA 3VQ8A 4E1JA 3C94A 3SLCA 5KTQA 1I3AA 2YNIA 1WSJA 2HF4A 2Q31A 5LMNK 3V4IA 1YXQA 3AA4A 3QFPA 1IH7A 4FW1A 2X74A 3K5OA 3CXCM 2WONA 4NB4A 1ITGA 2OCEA 3QESA 1Q18A 2DY4A 1V4SA 2P9SA 5AQKA 3SV3A 2P9NB 3QNNA 4EZ6A 3U9ZA 3CCQN 1B9DA 1FXXA 4KHQA 4JI8K 4I9QA 4FWOA 2O4IA 4C1NK 4BACA 4KHPK 1RDCA 2QW9A 4BR4A 2P5OA 1NK7A 2P9SB 1RDAA 2O8DA 2KHOA 4NCAA 5AQIA 2JLEA 4H0XB 4YNQA 3HBTA 4WQ5A 1NK8A 4N56A 1K9MO 4A5BA 3NGZA 1MA9B 4CI6A 1U2VA 4BROA 3QETA 4CJKA 4IJAA 2YKMA 3LDOA 3ENHA 4EAHD 5E41A 5GAEP 1XQSC 2O8DB 3H46O 3LAMA 1D8YA 1NM1A 3EZ5A 4O5BA 2W6LA 2O8EA 4C8OA 4IEIA 5AQJA 3LWMA 2HMPA 4WQ4A 3HPHA 3I8BA 3VQ9A 4FWMA 3DLRA 5J2QA 4CJRA 4CJ7A 2XY7A 2HSTA 3OJSA 3EN9A 2QTDA 3O4NA 4FPAA 4PKGA 3QEVA 2D5RA 4FZZA 3PIPL 4K42A 3BUZB 4DTMA 3ENBA 2F8TA 1RDBA 4E7IA 2HMIA 1TYQB 1C1CA 1U48A 4DHYA 1IO2A 3OS0A 5AQSA 5C2FA 2GEMA 3A5LC 5LJWA 4FLXA 3CQXA 2J4RA 3ATUA 4FPBA 4M3TA 1LWCA 1ATRA 3QNOA 4H5NA 3TI0A 1RTDA 3ZX3A 1QSLA 3OYBA 3U9DA 3CF5L 3ZX0A 4O0IA 1T6CA 1HNVA 1GOAA 3AARA 3CPWM 3TAPA 2H3GX 2A5XA 2NRXA 3L3UA 1BL3A 5C2DA 4BDPA 3A5OC 1S3XA 4DU4A 4FJ5A 4PUOA 4KHYA 4Z0UA 3B8AX 2W6KA 1LWEA 3KLEA 3MAQA 3E9PA 1GLAG 3AA2A 3DLLL 1VSLA 3HM8A 4AHCA 1Q82O 3SV4A 4YY3K 3O08A 5DMRA 4K8ZA 2W41A 4JK9A 2X78A 2CH5A 3FZFA 1SKWA 1O1WA 3EO3A 3G0ZA 4FK2A 4IZ9A 3UKUB 3ZSZA 1RT7A 4W5NA 2E6MA 3CERA 2X6SA 4CGDA 4JKEA 2UU9K 4FJ7A 3ZETB 4JI3K 2A40A 1OH7A 3WEEB 3VEYA 3CG7A 3LPTA 1VSKA 4O5FA 3F5TA 3EKSA 1NGAA 3QBXA 1U6ZA 4B9NA 3HP9A 4BWMA 5BN9A 3VQCA 4CGFA 2XRIA 1Z05A 1WB9A 3CCUN 2UXDK 1QHTA 3S41A 3ALYA 4FJKA 3LWLA 3ASMA 2HW3A 2KZMA 2QI2A 4WFNL 4YOVA 4I9LA 3N4PA 2QWPA 3LDLA 4BRLA 1T3VA 4R79A 5TKWA 3EKUA 4FWPA 3TR8A 5SWMA 4CZJA 4B9SA 4FJ9A 5F1XA 1MDUB 3FZLA 3OYAA 1VQMN 4JEPA 2G8WA 2OPSA 3M8SA 2ETJA 3RVCA 4AM6A 3KLHA 1HRHA 4CJSA 4IO9L 4JN4A 5BPLA 4CCHA 2RE2A 4CJFA 3VQAA 3GDQA 4HVJA 1R59O 2P9LA 2HOEA 4GVMA 2QXFA 3KIOA 1BU6O 5CYQA 3DOKA 3O8MA 5AZJA 1YT3A 3OYDA 4QOZB 3IUCA 4WFBL 3B6PA 4DG1A 1BOTO 4M3YA 1ZBSA 1ZYQA 3EEQA 4CEQA 2E2OA 4O8UA 4KRFA 1SL0A 2P9LB 4QS7A 1C1BA 4DV1K 2ZGYA 4CHZA 3CJCA 5AZJB 4DSLA 2UXBK 3RSEA 3KWGA 2KZZA 3SBGA 5CR4A 4GVEA 4LSLA 4C8NA 3LM2A 5FPMA 4PY5A 4IJNA 1KXPA 1TV6A 3UE5A 2UUAK 1NGFA 1NBWA 1KC8O 4AH9A 5FRNA 2HHQA 3CC7N 3AVLA 1A5VA 4BY9C 3C95A 3RSEB 4NXNK 3ZEUA 5KPZA 3OYJA 2Q1NA 3HI0A 4A5AA 3S3OA 4EFHA 3LDSA 3ZT1A 1BWFO 1L3UA 3P1GA 4DSEA 1MWMA 3WNHA 1SV5A 2A42A 1GLBG 4RW4A 2NLXA 4BRPA 3CJAA 3ZEUB 1BA1A 3AVFA 4IXCA 3ZSQA 3J7ZO 1SL1A 5AQVA 4BG9A 4JKBA 4FVMA 1K8AO 1DTQA 3PLAA 3ATVA 3NE6A 3V81A 3ZT2A 3M5RA 1UOCA 3R8EA 1VRUA 2VWKA 4L3QA 3O9QA 5FROA 1QHAA 3WT0A 4BQLA 1S6PA 1R0AA 2QK9A 4B9MA 3HT3A 5BR8K 1OH8A 1YJWN 1TK0A 1GLCG 4B3MK 1EETA 2OPQA 3GL1A 1I39A 1VSDA 3NAEA 1T8EA 3O3GA 2QXLA 3J81O 1LAVA 4RW6A 3LZJA 5C24A 2QKBA 4FJMA 2P51A 4E7HA 1OKJA 4E89A 2DFHA 2EWSA 4DR4K 3VESA 1TVRA 2B4JA 3M8QA 4B3OA 1ZC6A 1WAFA 1SUQA 1HPMA 4FYDA 3AO2A 1OH6A 4ELVA 3U3YA 3VEWA 4GMJB 5I3UA 4L8RB 1NMDA 1NGDA 4CFDA 2Q97A 3DRPA 4Z4IA 5HROA 5AQYA 2BANA 4BWJA 2A1RA 3AO1A 3P38A 3DLBA 5F0XA 4FZXC 2E2QA 4Z4EA 3VQ6A 5KGWA 1REVA 1HX1A 2DFFA 3CJBA 2KQ2A 3QBWA 2ZJRL 4FLVA 1LCUA 5TKYA 3ZCMA 3TSUA 2OA8A 3OYEA 5JLFA 3DRRA 4CHNA 2BE2A 4DTOA 3K58A 2RF2A 5BREA 1BQMA 4K43A 4H0OA 3ZSWA 3ZYYX 1HNZK 1KVBA 1NKCA 4MFBA 1Q81O 3NVKA 1XC3A 2IVPA 3ITHA 1NJZA 1E3MA 5JMVA 2ZQBA 4XH4A 3QIPA 4B3SK 4OJRA 4R5PA 1RBSA 1KTQA 3NDKA 1RTJA 2NRTA 4OLBA 1H1VA 4PL7A 1TL1A 3R6MA 2IC3A 4WCEL 2G8HA 2YNFA 3SMPA 3IMXA 4LFAK 3A2FA 4EP4A 3AVIA 5EU7A 5HRNA 1HKCA 1IKWA 3O80A 4BC5A 4FLWA 4H5WA 4LF4K 4CBWA 4H0TB 4M3XA 4F3TA 3AO4A 4AHTA 3C6HA 1TKXA 2NRRA 3JXUA 3VEZA 4DTUA 3QERA 3VQBA 3MK6A 1J6ZA 3Q7CA 2VG7A 2HBLA 4BRGA 3D6RA 4JI4K 4XEIA 1JLQA 2P9UA 2OPPA 3O9SA 4CJUA 5BPMA 5EXWA 1T7PA 3KD1E 1XMOK 4CZGA 4YOXA 2Q0RA 4JAXA 4KFBA 3AVKA 3ENOA 3QLHA 1F21A 3KLFA 4DSFA 2D0PA 2EHGA 4N47A 3DAWA 2P9UB 2FF3B 4WF9L 2HHXA 4ZTJA 1NGJA 3CYMA 2FBXA 3B6OA 4BC4A 4IO8A 4NO7A 1LOTB 3H3NO 3T19A 2QA4N 1K73O 3HK2A 2VGNA 4B8CA 3DWLA 3T1AA 1BHLA 2E2NA 4OPHA 2QWMA 1XI1A 4GV6A 1JXEA 1D4XA 4GV3A 5BN8A 5K14A 4CIFA 3H6EA 4AHVA 3OYIA 1P90A 5FLXO 1S1WA 1SAZA 3BEXA 1T6DA 1HQUA 3V1QA 1WBDA 3A5NC 3SPYA 4DMNA 3SQ2A 5HP1A 2HVIA 2B6AA 3WUHA 1TL3A 5CY4A 4Z4CA 1KSPA 1S6QA 4ZTFA 3L2VA 3FLCO 2D0CA 1SKSA 2YHXA 4OO1J 1RTHA 1X3MA 4B9LA 2HF3A 3D0PA 4A61A 5GINA 1HPZA 3MN9A 3C6UA 4CK3A 1HJRA 2YCHA 5BPNA 4K25A 3SAHA 4CJ5A 4C23A 3SAGA 5FDLA 1S1VA 4H4MA 3NGIA 1IKXA 3PX6A 1YTUA 3VENA 1VRTA 1VAZA 4H5RA 5JICA 1BUPA 3I0SA 3LP3A 4KTWA 3THXA 1LV5A 4CESA 2QEXN 1KRPA 1RDUA 1NMNA 3V6DA 3HPGA 1YIJN 3S9HA 4W5TA 1MWKA 3L8BA 4NCBA 2VQEK 2ITGA 3PY8A 4E3SA 3THXB 3O4QA 4B3TK 1TKTA 4Q5VA 3SPZA 2G8KA 3CCVN 4BRHA 1TAUA 2VWBA 3CMEN 5HBMA 1T44A 2FC0A 4HUEA 5LJVA 1GLJO 4LF8K 1WNSA 3HOSA 4JYAK 3I8DA 5A2QO 3VGLA 2NRWA 4XH5A 1A5XA 3CCLN 4CJEA 4X62K 3VQPA 4LH5A 4DR2K 4FJHA 2Q2RA 4OKEA 2E5LK 4BC3A 1U2VB 3SQ1A 1K6YA 3QEPA 4B9UA 1LW0A 1W7AA 2D0BA 4DQ8A 4ELUA 1EXQA 3IKMA 4OLAA 4DSKA 4CHPA 3OYHA 3MN6A 1WSIA 2ZWHA 4GV9A 4AILC 3OW2M 4EHUA 1BCMA 2O8EB 4IEEA 1EX4A 4DV3K 2HHHK 4FWQA 5JLHA 2FBTA 4JKHA 1X3NA 1UA0A 3QEXA 5KI6A 4H0VB 1XUPO 4DSIA 4AHUA 2B5JA 5HLFA 2HNDA 2UUBK 3F9MA 1XNRK 3S3MA 4E1NA 1QQCA 3HL8A 3AVJA 4B1YB 4DV0K 5AQQA 2Q36A 4O55A 3UIQA 1G15A 2KLAA 4JLHA 1BDGA 5AQRA 1XC9A 4N41A 2V51B 1WSFA 4A2BA 5C15A 4KPYA 3QICA 1G99A 4TSXA 4LH4A 2WTUA 4FXDA 3F2KA 3A5MC 4PHTX 3V1RA 4LFBK 3SI6A 1RCHA 3ISNC 1KFDA 2WBNA 2PZSA 3JSMA 1ASWA 2Y1IA 3QO9A 4FJLA 3LL3A 2PY5A 4X64K 1WSHA 5C0YA 4E7JA 1YJNN 4NYFA 1IJJA 1RT3A 3TTFA 1J53A 3H1QA 3I33A 1RT6A 4Z4FA 4KB0A 4DFKA 4KH5A 4DS5A 2ZF5O 1C0GA 2XHBA 4B1XB 1NJYA 1FK9A 2YHWA 3CFOA 5IWAK 1OVQA 4HCCA 3KHYA 3RTVA 4DTXA 4KTZA 3EL2A 3CCMN 4BDZA 2RPIA 5C12A 1RBUA 1J54A 2YHYA 1WN7A 1Q86O 4C1NI 5FPEA 4O4GA 5M1PA 2FSKA 1BA0A 4JK8A 5AQHA 1RGIA 3U4LA 4CJLA 4H4OA 3I55N 3GE1A 1KVCA 2YHAA 4O44A 3NMUA 1YAGA 2I7NA 4CJWA 3TSPA 3NF8A 3TAGA 1L3TA 2HNZA 3MECA 2XY6A 3VA0A 3NF6A 3IS9A 3E01A 4DU1A 1ZBIA 2HBMA 2VG5A 3U3GA 1JXBA 4KH6A 3OHRA 1K8KA 2E4LA 2F4VK 5GIOA 1HYVA 2HVHA 5M1NA 4RCHA 3SCXA 1Q8IA 4CZLA 4MQ3A 4JNEA 1EWQA 2YNHA 5BR9A 4IFYA 1B92A 1HJOA 4CJTA 3CMAN 4CK1A 5J1EA 3BDPA 4DTNA 2O8CA 4BRIA 1K8KB 2HBKA 4FLTA 4NLBA 4FWRA 3AVGA 4BRQA 4BRNA 2QWQA 3LPUA 3RMCA 4NYNA 3WNEA 4X65K 4Y0WA 1JLBA 4WYBA 4BE0A 1IBMK 4ISGA 1CZAN 2O8CB 1KCFA 1HKBA 3CQ8A 1DKGD 1QVGM 4Y1CA 4OKJA 2NUBA 4KB1A 1B9FA 2A1SA 2RKIA 3ZT0A 1X1PA 1GLEG 4CBXA 2O8FA 4M3WA 1JKHA 2D0OA 2I7PA 3H3OB 5H1SQ 1DGKN 2GX9A 1GOBA 2BUPA 1TK5A 4FJJA 1VQON 5C25A 3P39A 4WE1A 3CCJN 3AO3A 3SQ0A 3MMVA 4Z4HA 5M1KA 1J5EK 1I94K 2ASOA 4PKIA 2BTFA 3KKSA 3QB0A 4DTRA 2UXCK 2O8FB 4JHDA 3H1VX 4K41A 1BG3A 1WSEA 4KO0A 4DR6K 4N76A 3UKRA 3SMSA 5GADP 5BRFA 3VOVA 3O1BA 1C1AA 1WSGA 4OVLA 4GW6A 4DQSA 4IKFA 3HZ6A 3GBTA 4CJVA 3TABA 4FLYA 3DLKA 3FFIA 4CJ4A 4JHDB 4MLHA 3P83D 4FJ8A 1QS4A 3L2RA 2RHKA 4BRFA 4DF4A 3UKRB 4FOIA 2AA4A 2Q0UA 1NK6A 2IIRA 4DV4K 4CZHA 1IBKK 3KZBA 3HO1A 4DQQA 1YHQN 4GY2B 2UUCK 3PX4A 2F8SA 2YJEA 3K0SA 3M8PA 4NLCA 4CK2A 4FWNA 2VCPA 3PUFA 1CZ9A 3MEGA 4M63C 3T7ZA 1Q7YO 1JJ2M 3VN5A 3KJVA 3SJJA 1EP4A 4G1QA 4FJNA 2Z1IA 2YI1A 3V9ZA 3V9XA 4J2EA 2OANA 3K2PA 3TAFA 4CD1A 3DLHA 3E66A 3KVGA 3GG4A 4DR5K 3OJUA 2CGKA 5HRSA 3CC2N 3AO5A 4CZMA 1RBTA 3K5LA 5AFUH 3MX5A 3MWPA 4FZYA 3K57A 3A8YA 4UQGA 4DLGA 5AQPA 3L0QA 3NH1A 2W40A 3MXIA 2A6AA 1IG8A 1OVYA 4KREA 4DQRA 2FSJA 2E1YA 1JLGA 3OYKA 2E8AA 3DOLA 4JD2A 1VQKN 4CF8A 1QVFM 1NLVA 3O9UA 3JAMO 3CC4N 1IG9A 1WBBA 4B1UB 3H08A 3MEDA 4CIGA 3O9TA 5ADXH 1N32K 1QQNA 2QWRA 5E84A 3C65A 3BP8A 3WXKA 4DV6K 4E0DA 3QEWA 2ZJQL 4CD3A 2P9KA 4LC9B 1BIZA 3QDKA 4BGAA 5FPDA 2BH1A 2HHTA 2Z1JA 1N8RO 5J2NA 4DCHA 4WFAL 4YHHK 3QEIA 1IKYA 3ZT4A 4CEOA 3J8AA 2QWOA 1U49A 1VSEA 2P9KB 3T69A 4A2AA 4JI1K 1NKBA 2GTDA 5BRHA 4AM7A 4CEFA 1IKVA 1KAYA 1RT1A 3KKRA 3EZWA 3BF1A 3OBYA 4BC2A 1Z25A 2VGMA 3LDNA 4CF1A 2E6LA 1NG9A 2YJFA 1NGEA 3AVBA 4CGJA 4W5QA 1TK8A 2GBZA 3AAQA 3DJCA 1NJIO 1VQ8N 3DLGA 5CZ2A 3VA3A 4J8FA 4O0JA 4EZ9A 1S1XA 1ZBLA 3AVMA 4FLUA 2P5GA 2JWKA 3AVCA 4I2QA 1NJWA 4CEBA 1RNHA 3KD5E 1EKEA 4IDHA 1DT9A 4FCYA 4UY8O 3OS2A 1L3SA 3E1YA 1X9JA 2GUIA 3AVHA 3UB5A 2HHWA 4FK0A 3ZSOA 1N34K 1M1KO 1D9DA 3WXIA 4DS4A 1DLOA 3PIOL 3OBWA 3OY9A 4Q0BA 4JKCA 2HHVA 4E7LA 3F73A 1RT5A 3MX2A 5D3GA 1HLUA 3VEVA 5J2PA 1U47A 3C7NA 2R7YA 4LSNA 2CGLA 1QZ6A 2RN2A 4EHTA 1S9GA 4MO5A 3AV9A 4NCGA 3SQ4A 2OTJN 4QCLA 5JS2A 2Y1JA 1U04A 3RR8A 5AJ3K 3D7EO 4BVPA 3L2WA 3C7NB 4DV2K 3LDPA 3HJFA 3CM6A 4KI6A 4DFJA 1NGHA 2XO7A 4KH4A 3TWHA 5DM7L 2YV0X 5CE3A 2G8FA 1S72N 1BIUA 4IBNA 2IOCA 3DXKA 1XMQK 4RW8A 4PWDA 5AR0A 4M45A 1FW6A 3HSTB 4BR9A 3K59A 3BY5A 4K0KK 4Z94A 1JCGA 4CJ3A 2A3ZA 3CFRA 1E4GT 4FM2A 2VWJA 1CXUA 1JCEA 2HHSA 1NGCA 2QWNA 3G10A 4FW2A 5AZIA 4CF0A 1GLFO 3VQQA 5LY3A 4GKJK 5KRTA 2CH6A 1RTIA 3KK7A 5GAGP 4B1WB 4RWTA 1EQYA 4BRDA 3CCSN 1ATSA 3THWA 5I42A 2FF6A 3EYZA 3VTHA 3C0BA 4FSVA 4CEEA 4E19A 2F9TA 5AQFA 2FBVA 3J7AP 2VQFK 4LD0A 4CF9A 1C6VA 4HTUA 3BGRA 1C0MA 1RFQA 3THWB 4HUFA 1KLNA 4RG8A 4CHYA 1ESVA 3N4QA 3WQTA 4EIAA 3NHGA 3CFPA 4A57A 4BR2A 3G71N 3LDQA 3DXMA 3ZX2A 4BRMA 3DRSA 2GWJA 3TAEA 4YDUC 4KHNA 3F9KA 4JS4A 4QS8A 4KTQA 2ZGZA 4A59A 4HTLA 4BE2A 4C8LA 4H8KA 3O3HA 4ISFA 4GKKK 4JI5K 1NOZA 3L6QA 1OH5A 1HR0K 5JVGL 4CBUA 1M90O 1VQ5N 4DFPA 1ILYA 3WXJA 4DFMA 1NKEA 3DXMB 2NRHA 1EWRA 4CFAA 1YITN 4DQPA 3CCRN 4DTJA 3AVAA 4DTPA 3TPQA 1HMVA 3L4QA 3OA9A 3BF3A 3RMDA 3G6EN 4CJPA 1J5OA 2WC9A 1IV0A 1LW2A 3VPZA 2AJQA 3VQ7A 3ZSRA 3BZKA 3V1OA 1UAXA 4BRKA 2KTQA 1CZBA 3ZT3A 1NGBA 4CEZA 2ZD1A 4DUZK 5EX5A 2PYLA 1VSJA 1W2BM 4CERA 1NOYA 2ITMA 2WOMA 4DR1K 3K9KA 1N6QA 4QAGA 3DLEA 4H0PA 3CIPA 2PYJA 4LFCK 4KAZA 3T3FA 1DTTA 4ZHRA 1XNQK 4KKOA 3SJHA 3NCIA 3THVA 4AHRA 1S1TA 1QTMA 1YUWA 4W5OA 3NF7A 2OZSA 4B08A 5I9EB 3CETA 2V7YA 1HKGA 3PX0A 3AGKA 4B9QA 1XHZA 3RWUA 4PA1A 4CHQA 2OPRA 3EY1A 3K9JA 1W9HA 3LM9A 3SUNA 3DM2A 3QMLA 1VSIA 3FE1A 1KQSM 1VQ9N 4M7XA 4EP5A 3CJ7A 5KPRA 4LF7K 1D5AA 1TAQA 3D45A 1ASVA 4FJGA 1JLCA 2FXUA 4DU3A 1QQOA 4FK4A 3J80O 5F2RA 1Z6RA 3MN7A 1YVUA 1VQNN 3D2EA 1VQ6N 3LZIA 5KPTA 4KI4A 3SYZA 4CECA 1WLJA 3W3DA 5C10A 3NGYA 1HUXA 3V9SA 1SQKA 2P9PA 2KW4A 4M41A 1TYQA 4KHUA 2XY8A 4FVUA 3DI6A 3ID6A 4ILJA 4QS9A 4IOAL 4KV8A 3D2EB 5AQWA 4ISEA 4FWKA 4CZEA 4CZFA 5AQOA 2P9PB 4CIEA 3P5JA 4PKHA 1GLDG 1UWBA 3NH0A 1SL2A 4LF9K 4BR7A 3FGUA 1ASUA 3U6FA 4C8KA 4CHOA 2P9IA 1RDDA 5C42A 3MN5A 4DWIA 3P31A 3M6GA 1X9SA 4OPJA 1KAZA 3O9RA 4LF5K 3THYA 1RBRA 4ILHA 4I7FA 2WFBA 1QQMA 3LALA 2IS3A 2P9IB 3SAFA 5JS1A 1N5YA 4B9VA 4XH1A 1FJGK 1VQ7N 4DTSA 4JK7A 5GIPA 3TTCA 1L5UA 3THYB 4DKWA 1Y97A 3RMAA 1U45A 3RMBA 4CVNE 3SUOA 4IOXA 3CJ9A 4HWIA 3T1YK 3TTDA 4H5TA 2WUSA 3UKUA 4YOWA 2F7TA 4OX9K 2VYPA 3A0IX 3ID8A 1BO5O 4CZIA 4FM1A 3WXMB 1E4FT 3ZETA 2D1KA 3WEEA 3SNNA 1WAJA 1JL2A 3V9WA 2IGIA 2OZMA 4BQZA 3AVNA 4X66K 1HNXK 3IDHA 3HPOA 2D4WA 3OVNA 3D2FA 1VSMA 1BI4A 5KGXA 4AF1A 3AY9A 3TAMA 3W0LA 3NBPA 4WQ5C 3VF6A 4CZKA 4KHSA 1BQNA 4FM0A 4B9TA 3T1HK 3VERA 4FWSA 3AA5X 4JI7K 5DM6L 3D2FB 3O4WA 1SKRA 4FJIA 1KAXA 1JLEA 1BI4B 3CJ1A 2Q3SA 3ULDA 3OYCA 2YHBA 1N36K 5FPNA 1VK0A 4I6MA 4W5RA 3K5MA 4HCBA 3MXJA 4FLZA 3CCEN 5JVHL 4WQ4C 4DB3A 1O13A 4H0YB 5AFUA 5LMUK 4IG0A 1RT4A 3E9OA 4KHWA 1DEJA 2IVOA 3V9UA 4I6MB 3LANA 3R1XA 3LP1A 4JRPA 2W42A 4RW9A 5KQDA 3FZMA 3VF4A 1CXQA 2XY5A 5AQZA 4F8RA 3K5NA 3VQDA 3ZLJA 1UA1A 1J9AA 2FLOA 4BGBA 2ATQA 3PV8A 3Q7BA 3WQUA 3WXLA 1YJ9N 4FO0A 1L3VA 5ADXA 4O8KA 1LAWA 4JKGA 1C0UA 2I5JA 4IFEA 3TU5A 3MEEA 5AQNA 1CLQA 1YTAA 5EVZA 1BCOA 1ZBFA 4ILGB 4LY7A 1NU0A 3VEOA 2OYQA 3FZKA 5AQXA 3PO5A 4M7YA 3KLGA 1Y64A 3HYFA 2NNWA 3RR7A 4PQUA 1XWLA 3H45C 4JKGB 1HNWK 3LP2A 5IT9O 3QFUA 4YOYA 1VQPN 5LL6Z 1GLLO 5CHIA 2Z1HA 1S9EA 4Z4GA 3I0RA 3U8XA 4DF8A 1Q9YA 3NFAA 1NGIA 2HB5A 4BVOA 3DMJA 3MCAB 5AQMA 4FL9A 4CGGA 1KD1O 2E1ZA 2NRVA 4OGEA 4BRCA 5GAHP 3ZSXA 1HNIA 3M8RA 1TGOA 3HM9A 2KFZA 3ZSVA 4JI2K 2E2PA 1BGXT 2KKZA 4H5VA 2O4GA 1Z26A 1RBVA 3O6WA 3LP0A 1T05A 1SZ2A 5M1FA 3VQ4A 3VQEA 3PSIA 1VQLN 2F96A 5CYMA 1KFSA 4XIUA 3C6TA 3HP6A 4ID1A 3L2QA 3OYNA 3M3ZA 1FKPA 4RW7A 3J7YP 1C0FA 4F2RA 2ASPA 1YVNA 3QINA 1NK5A 4YOTA 2ZJPL 1KVAA 4JRQA 3RRGA 1X9MA 5B8HA 4OPAA 1QSYA 4J2BA 3VEXA 3KWIA 1ZBUA 4FWLA 4JI6K 3MWTA 4ICLA 3CM5A 1HYSA 3KLIA 4M3UA 4YOUA 4CEDA 1VQ4N 4JI0K 4I2PA 2VG6A 1JL1A 4BG8A 4J2DA 3VTIA 3SBTA 2PBDA 4HHTA 3JYTA 4DSJA 5HRPA 2A41A 4IOCL 1MU2A 3KK2A 4JD2B 2QKKA 3HSCA 1JCFA 2QWLA 4ID5A 4AHSA 1D9FA 1QSSA 3L3VA 1WUAA 2YNGA 1V4TA 2BGGA 3CQYA 4E7KA 2FBYA 3L4IA 2X6NA 1SS6A 5MLCQ 4J2AA 4Y1DA 1BISA 1HQEA 4YFUA 3RRHA 4G9ZA 3O5BA 3WNGA 2GUPA 4JKAA 2QM1A 4DV5K 4OGCA 2LSNA 1TKDA 1NNEA 2DPNA 5M1OA 3E9LA 4CEAA 3VF2A 2YKNA 3FZHA 1N33K 4E1MA 1TKZA 5M1QA 2IAJA 1S1UA 2UYTA 4DR3K 4M3ZA 1NK9A 3GOIA 5J2MA 1X9WA 3OYGA 1U4BA 3OYMA 1FKOA 3HVRA 3VQ5A 5FRMA 3EE8A 1YI2N 4CGIA 4DR7K 2V7ZA 1TUYA 2NZTA 3QIOA 2HBJA 3OYFA 4YDUA 2GWKA 4CW7B 5EOYA 3S3NA 2EX3A 4DV7K 5EY4A 4JS5A 5HRRA 2IDOA 1NJXA 3TSQA 5KRSA 1YF5L 4A62A 2G8UA 1W97L 4B1ZA 3R9PA 3FR0A 3HTVA 4H03B 4B8AB 5HL7L 3VGMA 2CGJA 4AQYK 4F4KA 3G4SN 2YX6A 5AQUA 3L2UA 4CJQA 4CE9A 4BR5A 1GOCA 3OS1A 3G25A 4B3RK 4CF2A 1QE1A 2AP1A 4MDBA 4N5SA 2NRZA 4B1VA 1P8ZA 4KBOA 3HXMA 3JS6A 3MXMA 4IWVA 4IFVA 4JV5K 2GV9A 4PL8A 1QZ5A 3IG1A 3IRXA 5ELZA 5AQLA 2ZM6K 2KFNA 2PFUA 3DYAA 2DTUA 4C8MA 4BREA 2HHUA 2G8VA 1C0TA 1NWKA 2G8IA 1NGGA 4MLEA 1ZXOA 1WOQA 4CGHA 2IVNA 3SK3A 3KTQA 2V52B 3IAYA 1VSFA 5BRDA 1Q9XA 2O8BA 3ZSYA 5DK5A 3HOTA 3MDQA 2OTLN 3SUPA 2GELA 3ULEA 3DXKB 3AA3A 5E26A 3SZ2A 4JKDA 3KK3A 3EE9A 3OTOK 1JLAA 1S22A 4MDAA 4ELTA 1EO1A 4BDYA 2O8BB 4DQIA 1NK0A 3O3FA 4F9OA 1ATNA 2ASMA 3LAKA 4IG3A 3AAPA 4BE1A 3HRGA 3PO4A 4JKFA 4GNIA 3ULEB 3TANA 3R3LA 4FJXA 4K8XA 4IDKA 4F3OA 2ZE2A 3AGRA 3OYLA 4LF6K 4OKKA 4DLEA 5AZIB 2HNYA 1RDWX 2D0AA 2P1JA 4V19S 5SZTA 2JWLA 3NH2A 4FOEA 2Z1GA 3VETA 4BR0A 1T03A 1S5JA 2FSNA 5KQ8A 4CFBA 4BRAA 3KK1A 4CFCA 3NF9A 3WNFA 5HOOA 1W0HA 4DUYK 3MCPA 3PSFA 4MO4A 4M3RA 2F9WA 5T7BA 1IBLK 2DFEA 3P4IA 5CZ1A 3CPEA 3CD6N 1A5WA 2E88A 4YORA 3I56N 4OPKA 1JLFA 4NXMK 4F2SA 5AQGA 3CHWA 3M1FA 1VSHA 4HUGA 2BDPA 3C6AA 1RT2A 3TAQA 3NVMA 1HYZA 3IFRA 1KLMA 4U67L 2PAVA 3BZCA 5AQTA 2E20A 4U7BA 3SUQA 1NK4A 1TUUA 1RILA 3VMFB 4M42A 4RTFD
chains in the Genus database with same CATH topology
1XHXA 3TARA 2ZQBA 2JGUA 3HVTA 3QIPA 1L5UA 1Y97A 4OJRA 4R5PA 3RMAA 3VQ8A 4DQQA 1LWFA 3RMBA 1RBSA 1KTQA 3NDKA 1ZBHA 3C94A 3SUOA 3PX4A 2F8SA 1RTJA 5KTQA 3M8PA 1I3AA 4CK2A 4OLBA 2YNIA 1WSJA 1TL1A 2IC3A 3V4IA 3AA4A 1IH7A 1CZ9A 3MEGA 2X74A 2YNFA 3K5OA 2WONA 3PUFA 1ITGA 4FW1A 2G8HA 3QESA 2DY4A 3A2FA 3VN5A 4EP4A 3KJVA 3AVIA 3SV3A 4FM1A 5EU7A 3QNNA 5HRNA 4EZ6A 3SJJA 1EP4A 1B9DA 1IKWA 1FXXA 4KHQA 4G1QA 4I9QA 2Z1IA 4FJNA 3V9ZA 4FLWA 3V9XA 4J2EA 3SNNA 1WAJA 4M3XA 1JL2A 4F3TA 3V9WA 2IGIA 3K2PA 2OZMA 3TAFA 3AO4A 4AHTA 3AVNA 4BACA 3DLHA 3QERA 1TKXA 4DTUA 3OJUA 1RDCA 2P5OA 1NK7A 3VQBA 3HPOA 5HRSA 3OVNA 3AO5A 1RDAA 2VG7A 1VSMA 1BI4A 1RBTA 3K5LA 5KGXA 4FZYA 4NCAA 2JLEA 3K57A 4YNQA 3TAMA 4UQGA 4DLGA 1NK8A 4N56A 3NBPA 1JLQA 3NGZA 3NH1A 4KHSA 3MXIA 1BQNA 4FM0A 4B9TA 2OPPA 3QETA 4KREA 4CJKA 4CJUA 4DQRA 2YKMA 3AA5X 1JLGA 3OYKA 1T7PA 3KD1E 5E41A 1SKRA 4FJIA 3DOLA 1JLEA 1BI4B 4KFBA 2Q3SA 3AVKA 3LAMA 3OYCA 2YHBA 3ULDA 4CF8A 1D8YA 3EZ5A 3QLHA 1VK0A 4O5BA 1F21A 3KLFA 4DSFA 1IG9A 2EHGA 4N47A 3H08A 3MEDA 4CIGA 4W5RA 4C8OA 3LWMA 3K5MA 4HCBA 2HHXA 3MXJA 4ZTJA 4FLZA 3CYMA 3HPHA 3VQ9A 2FBXA 3B6OA 3DLRA 4E0DA 3QEWA 4IG0A 1RT4A 1BIZA 5J2QA 4KHWA 4CJRA 3V9UA 2HHTA 2Z1JA 3T19A 2XY7A 3OJSA 5J2NA 3QEVA 3O4NA 4FZZA 3HK2A 3LANA 2D5RA 3LP1A 4JRPA 4B8CA 2W42A 4RW9A 3T1AA 4DTMA 3QEIA 1BHLA 1IKYA 3ZT4A 1CXQA 4CEOA 2XY5A 1JXEA 3K5NA 3VQDA 1XI1A 4F8RA 1UA1A 5K14A 1J9AA 4CIFA 2F8TA 1RDBA 4AHVA 1U49A 1VSEA 2ATQA 3OYIA 4E7IA 3PV8A 1NKBA 2HMIA 1L3VA 4CEFA 1C1CA 1U48A 1LAWA 1S1WA 1IKVA 1RT1A 3KKRA 1C0UA 2I5JA 1HQUA 3MEEA 3V1QA 1CLQA 1YTAA 1BCOA 1ZBFA 1Z25A 3SPYA 4LY7A 1IO2A 4CF1A 4DMNA 3OS0A 2E6LA 3SQ2A 2OYQA 4FLXA 5HP1A 2HVIA 3PO5A 2B6AA 3AVBA 4CGJA 1TL3A 5CY4A 4W5QA 4Z4CA 3KLGA 3HYFA 1TK8A 1KSPA 3RR7A 1LWCA 2GBZA 4M3TA 4PQUA 3QNOA 1XWLA 1S6QA 4ZTFA 3DLGA 5CZ2A 3VA3A 3L2VA 3TI0A 2D0CA 4O0JA 3LP2A 1SKSA 1RTDA 4EZ9A 1S1XA 1RTHA 4B9LA 1QSLA 3OYBA 2Z1HA 1S9EA 4Z4GA 1ZBLA 3AVMA 3D0PA 4FLUA 2P5GA 1HPZA 4O0IA 3AVCA 3I0RA 4I2QA 1NJWA 4DF8A 3C6UA 1HNVA 1HJRA 1EKEA 1RNHA 4CEBA 4CK3A 1Q9YA 3KD5E 4CJ5A 4FCYA 3NFAA 1GOAA 5FDLA 3OS2A 1S1VA 2HB5A 3TAPA 3DMJA 4H4MA 3NGIA 1L3SA 1IKXA 3L3UA 4CGGA 2GUIA 3AVHA 1BL3A 4OGEA 3PX6A 3ZSXA 2HHWA 1HNIA 3M8RA 4FK0A 4BDPA 3ZSOA 1YTUA 1VRTA 1TGOA 4PUOA 3HM9A 4DU4A 3ZSVA 3I0SA 3LP3A 4FJ5A 4Z0UA 1D9DA 4KHYA 1BGXT 4KTWA 4DS4A 1DLOA 1LWEA 1Z26A 2O4GA 3OY9A 3KLEA 4Q0BA 1RBVA 3MAQA 1LV5A 2HHVA 4CESA 3LP0A 3AA2A 4E7LA 1KRPA 1VSLA 1T05A 4AHCA 3F73A 3SV4A 1RT5A 3VQ4A 5DMRA 4K8ZA 5D3GA 3VQEA 3V6DA 2F96A 3HPGA 2X78A 5J2PA 4W5TA 3S9HA 1U47A 1SKWA 3L8BA 1O1WA 4LSNA 2RN2A 3G0ZA 5CYMA 2ITGA 1S9GA 2R7YA 1U45A 1KFSA 3PY8A 4NCBA 3AV9A 4XIUA 4FK2A 4E3SA 3ZSZA 1RT7A 3O4QA 4W5NA 3C6TA 2E6MA 1TKTA 4NCGA 4Q5VA 3SQ4A 4QCLA 5JS2A 2Y1JA 2X6SA 3HP6A 1U04A 4ID1A 4CGDA 3OYNA 3L2QA 3SPZA 1FKPA 4RW7A 2G8KA 3RR8A 1TAUA 4FJ7A 4F2RA 3L2WA 5HBMA 3QINA 1NK5A 3CG7A 3LPTA 3HJFA 2FC0A 4HUEA 1KVAA 3CM6A 4KI6A 4DFJA 1VSKA 4JRQA 3RRGA 2XO7A 1X9MA 3TWHA 1WNSA 2YV0X 2G8FA 1BIUA 1QSYA 3I8DA 4J2BA 4IBNA 4B9NA 2IOCA 3HP9A 1ZBUA 4BWMA 3VQCA 4CGFA 2XRIA 1A5XA 4ICLA 4RW8A 4PWDA 4CJEA 4M45A 3CM5A 1HYSA 3KLIA 3VQPA 1QHTA 4LH5A 4M3UA 4CEDA 3ALYA 4FJHA 4FJKA 3HSTB 4I2PA 4OKEA 3LWLA 3K59A 3ASMA 2HW3A 2VG6A 1JL1A 4J2DA 2KZMA 3SQ1A 4CJ3A 4HHTA 3JYTA 3CFRA 2O4IA 1K6YA 4I9LA 3QEPA 4FM2A 4B9UA 1LW0A 5HRPA 4DSJA 3HO1A 2VWJA 2D0BA 1MU2A 1CXUA 4ELUA 1EXQA 3KK2A 4OLAA 4DSKA 2QKKA 2HHSA 4CHPA 3OYHA 4AHSA 4ID5A 1D9FA 3G10A 1QSSA 1WSIA 3L3VA 4FW2A 4AILC 4CF0A 1BCMA 2YNGA 3TR8A 5SWMA 4B9SA 4FJ9A 1EX4A 3VQQA 2BGGA 5KRTA 1RTIA 3OYAA 4E7KA 2FBYA 2FBTA 2X6NA 1UA0A 3QEXA 4J2AA 4Y1DA 5KI6A 1BISA 2G8WA 1HQEA 4YFUA 2OPSA 3M8SA 3RRHA 4DSIA 2ETJA 4AHUA 5I42A 3EYZA 3KLHA 2B5JA 1HRHA 4CJSA 5HLFA 2HNDA 4CCHA 3WNGA 3S3MA 4E1NA 4CEEA 4CJFA 1QQCA 3HL8A 4E19A 3VQAA 3AVJA 2FBVA 4OGCA 2LSNA 4HVJA 1TKDA 4LD0A 4CF9A 4GVMA 1C6VA 4CEAA 2YKNA 2QXFA 4HTUA 3BGRA 4E1MA 3KIOA 1C0MA 5CYQA 1TKZA 4O55A 3UIQA 1G15A 2IAJA 3DOKA 1S1UA 4JLHA 1YT3A 3OYDA 4HUFA 1KLNA 4M3ZA 4QOZB 3B6PA 4DG1A 1NK9A 4RG8A 4CHYA 1XC9A 5J2MA 1X9WA 4N41A 3OYGA 3NHGA 4M3YA 1WSFA 3OYMA 1U4BA 1ZYQA 1FKOA 3CFPA 3HVRA 3VQ5A 4CEQA 4KPYA 5FRMA 4CGIA 4TSXA 4LH4A 3QIOA 4FXDA 4KRFA 3OYFA 1SL0A 1C1BA 3V1RA 3DRSA 3TAEA 4KHNA 3F9KA 3S3NA 3SI6A 4JS4A 1RCHA 2EX3A 1KFDA 3ISNC 4CHZA 2PZSA 4KTQA 3JSMA 1ASWA 4BE2A 3QO9A 4H8KA 2Y1IA 4C8LA 4DSLA 3O3HA 4FJLA 2PY5A 1WSHA 4JS5A 1NOZA 5HRRA 4E7JA 2IDOA 1NJXA 4NYFA 4DFPA 2KZZA 1RT3A 4DFMA 1NKEA 4LSLA 4CFAA 5KRSA 1J53A 4C8NA 2G8UA 4DQPA 4DTJA 1RT6A 4Z4FA 4PY5A 4KB0A 3AVAA 4DFKA 4DTPA 1TV6A 4DS5A 4B8AB 4F4KA 2XHBA 1NJYA 1HMVA 4AH9A 1FK9A 5FRNA 2HHQA 3CFOA 3AVLA 1A5VA 3L2UA 3C95A 4CJQA 4CE9A 3RMDA 4HCCA 4CJPA 1GOCA 3OYJA 3OS1A 1J5OA 3RTVA 4DTXA 1LW2A 4KTZA 3S3OA 2AJQA 3VQ7A 3LDSA 4CF2A 3ZSRA 1QE1A 2RPIA 4BDZA 3V1OA 1UAXA 3ZT1A 1RBUA 1J54A 2KTQA 1CZBA 3ZT3A 1L3UA 3P1GA 4CEZA 1WN7A 4N5SA 4DSEA 3WNHA 1SV5A 2ZD1A 4RW4A 2PYLA 1VSJA 4O4GA 3HXMA 3MXMA 4CERA 1NOYA 4IFVA 2WOMA 3AVFA 2GV9A 1N6QA 4QAGA 3ZSQA 3DLEA 3IG1A 1SL1A 2PYJA 3IRXA 4KAZA 3T3FA 1DTTA 4CJLA 4ZHRA 2KFNA 2KFZA 4H4OA 4FVMA 3DYAA 4KKOA 2DTUA 1KVCA 4C8MA 2YHAA 1DTQA 4O44A 3NCIA 3THVA 2HHUA 4AHRA 2G8VA 1S1TA 1C0TA 3NE6A 1QTMA 4CJWA 2G8IA 3TAGA 3NF8A 3NF7A 4W5OA 3V81A 1L3TA 2OZSA 2HNZA 3ZT2A 3MECA 4B08A 2XY6A 3VA0A 4CGHA 3NF6A 1UOCA 3IS9A 1VRUA 2VWKA 3KTQA 3PX0A 3E01A 4DU1A 3IAYA 1ZBIA 1XHZA 1VSFA 3RWUA 2VG5A 5FROA 3U3GA 1Q9XA 3ZSYA 1JXBA 1S6PA 5DK5A 4PA1A 2E4LA 1R0AA 4CHQA 2QK9A 4B9MA 2OPRA 3EY1A 3SUPA 1W9HA 3HT3A 1HYVA 2HVHA 3SUNA 3SCXA 1Q8IA 3DM2A 1VSIA 3AA3A 1NK6A 4MQ3A 3SZ2A 1TK0A 2YNHA 3KK3A 4IFYA 1B92A 4CJTA 1JLAA 1EETA 4CK1A 2OPQA 4ELTA 4EP5A 5J1EA 4BDYA 3BDPA 1I39A 1VSDA 3NAEA 4DTNA 1T8EA 3O3GA 4DQIA 1NK0A 3O3FA 1LAVA 4BE1A 3LAKA 4IG3A 4RW6A 5C24A 3LZJA 4FLTA 1D5AA 1TAQA 3D45A 1ASVA 4FJGA 3PO4A 1JLCA 3AVGA 2QKBA 4DU3A 3TANA 4FJMA 2P51A 4FJXA 3LPUA 4E7HA 3RMCA 4K8XA 4IDKA 4NYNA 4E89A 4F3OA 4FK4A 2ZE2A 2DFHA 3WNEA 3OYLA 1YVUA 3LZIA 1JLBA 4OKKA 4KI4A 1TVRA 2B4JA 3SYZA 4CECA 4DLEA 1WLJA 3M8QA 2HNYA 4B3OA 4BE0A 3NGYA 2D0AA 2P1JA 1KCFA 1WAFA 1SUQA 3CQ8A 3V9SA 5SZTA 2KW4A 4M41A 4FYDA 4Y1CA 4OKJA 3AO2A 3NH2A 4KHUA 4ELVA 2NUBA 2XY8A 3U3YA 4KB1A 1B9FA 4GMJB 2A1SA 2Z1GA 5I3UA 2RKIA 3ZT0A 1T03A 1X1PA 1S5JA 4L8RB 3DI6A 4M3WA 1JKHA 4CFBA 4CFDA 3DRPA 4KV8A 3KK1A 1GOBA 4CFCA 5HROA 1TK5A 4Z4IA 2BANA 3NF9A 4FJJA 4BWJA 2A1RA 3WNFA 3AO1A 5C25A 1W0HA 4WE1A 3DLBA 3AO3A 3SQ0A 4CIEA 4Z4HA 3P5JA 4M3RA 1UWBA 4FZXC 4Z4EA 5T7BA 3KKSA 3VQ6A 3NH0A 1SL2A 2DFEA 5KGWA 4DTRA 5CZ1A 1REVA 1ASUA 2DFFA 3U6FA 1A5WA 2KQ2A 1WSEA 4KO0A 4FLVA 4C8KA 4OPKA 1JLFA 3ZCMA 4CHOA 2OA8A 4F2SA 1RDDA 5C42A 4N76A 4DWIA 3OYEA 1X9SA 4OPJA 1VSHA 3DRRA 4CHNA 4HUGA 1C1AA 2BE2A 4DTOA 1WSGA 4OVLA 4GW6A 3K58A 4DQSA 4IKFA 2RF2A 2BDPA 1RT2A 4CJVA 3TABA 3TAQA 4FLYA 1RBRA 3DLKA 3FFIA 1HYZA 4CJ4A 1BQMA 3ZSWA 1KVBA 4I7FA 1KLMA 4FJ8A 3P83D 1NKCA 4MFBA 3LALA 1QS4A 3L2RA 2IS3A 4DF4A 5JS1A 1N5YA 4B9VA 3SUQA 1NK4A 1RILA 3ITHA 1NJZA 4M42A 4DTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHX A;  3TAR A;  2ZQB A;  2JGU A;  3HVT A;  3QIP A;  1L5U A;  1Y97 A;  4OJR A;  4R5P A;  3RMA A;  3VQ8 A;  4DQQ A;  1LWF A;  3RMB A;  1RBS A;  1KTQ A;  3NDK A;  1ZBH A;  3C94 A;  3SUO A;  3PX4 A;  2F8S A;  1RTJ A;  5KTQ A;  3M8P A;  1I3A A;  4CK2 A;  4OLB A;  2YNI A;  1WSJ A;  1TL1 A;  2IC3 A;  3V4I A;  3AA4 A;  1IH7 A;  1CZ9 A;  3MEG A;  2X74 A;  2YNF A;  3K5O A;  2WON A;  3PUF A;  1ITG A;  4FW1 A;  2G8H A;  3QES A;  2DY4 A;  3A2F A;  3VN5 A;  4EP4 A;  3KJV A;  3AVI A;  3SV3 A;  4FM1 A;  5EU7 A;  3QNN A;  5HRN A;  4EZ6 A;  3SJJ A;  1EP4 A;  1B9D A;  1IKW A;  1FXX A;  4KHQ A;  4G1Q A;  4I9Q A;  2Z1I A;  4FJN A;  3V9Z A;  4FLW A;  3V9X A;  4J2E A;  3SNN A;  1WAJ A;  4M3X A;  1JL2 A;  4F3T A;  3V9W A;  2IGI A;  3K2P A;  2OZM A;  3TAF A;  3AO4 A;  4AHT A;  3AVN A;  4BAC A;  3DLH A;  3QER A;  1TKX A;  4DTU A;  3OJU A;  1RDC A;  2P5O A;  1NK7 A;  3VQB A;  3HPO A;  5HRS A;  3OVN A;  3AO5 A;  1RDA A;  2VG7 A;  1VSM A;  1BI4 A;  1RBT A;  3K5L A;  5KGX A;  4FZY A;  4NCA A;  2JLE A;  3K57 A;  4YNQ A;  3TAM A;  4UQG A;  4DLG A;  1NK8 A;  4N56 A;  3NBP A;  1JLQ A;  3NGZ A;  3NH1 A;  4KHS A;  3MXI A;  1BQN A;  4FM0 A;  4B9T A;  2OPP A;  3QET A;  4KRE A;  4CJK A;  4CJU A;  4DQR A;  2YKM A;  3AA5 X;  1JLG A;  3OYK A;  1T7P A;  3KD1 E;  5E41 A;  1SKR A;  4FJI A;  3DOL A;  1JLE A;  1BI4 B;  4KFB A;  2Q3S A;  3AVK A;  3LAM A;  3OYC A;  2YHB A;  3ULD A;  4CF8 A;  1D8Y A;  3EZ5 A;  3QLH A;  1VK0 A;  4O5B A;  1F21 A;  3KLF A;  4DSF A;  1IG9 A;  2EHG A;  4N47 A;  3H08 A;  3MED A;  4CIG A;  4W5R A;  4C8O A;  3LWM A;  3K5M A;  4HCB A;  2HHX A;  3MXJ A;  4ZTJ A;  4FLZ A;  3CYM A;  3HPH A;  3VQ9 A;  2FBX A;  3B6O A;  3DLR A;  4E0D A;  3QEW A;  4IG0 A;  1RT4 A;  1BIZ A;  5J2Q A;  4KHW A;  4CJR A;  3V9U A;  2HHT A;  2Z1J A;  3T19 A;  2XY7 A;  3OJS A;  5J2N A;  3QEV A;  3O4N A;  4FZZ A;  3HK2 A;  3LAN A;  2D5R A;  3LP1 A;  4JRP A;  4B8C A;  2W42 A;  4RW9 A;  3T1A A;  4DTM A;  3QEI A;  1BHL A;  1IKY A;  3ZT4 A;  1CXQ A;  4CEO A;  2XY5 A;  1JXE A;  3K5N A;  3VQD A;  1XI1 A;  4F8R A;  1UA1 A;  5K14 A;  1J9A A;  4CIF A;  2F8T A;  1RDB A;  4AHV A;  1U49 A;  1VSE A;  2ATQ A;  3OYI A;  4E7I A;  3PV8 A;  1NKB A;  2HMI A;  1L3V A;  4CEF A;  1C1C A;  1U48 A;  1LAW A;  1S1W A;  1IKV A;  1RT1 A;  3KKR A;  1C0U A;  2I5J A;  1HQU A;  3MEE A;  3V1Q A;  1CLQ A;  1YTA A;  1BCO A;  1ZBF A;  1Z25 A;  3SPY A;  4LY7 A;  1IO2 A;  4CF1 A;  4DMN A;  3OS0 A;  2E6L A;  3SQ2 A;  2OYQ A;  4FLX A;  5HP1 A;  2HVI A;  3PO5 A;  2B6A A;  3AVB A;  4CGJ A;  1TL3 A;  5CY4 A;  4W5Q A;  4Z4C A;  3KLG A;  3HYF A;  1TK8 A;  1KSP A;  3RR7 A;  1LWC A;  2GBZ A;  4M3T A;  4PQU A;  3QNO A;  1XWL A;  1S6Q A;  4ZTF A;  3DLG A;  5CZ2 A;  3VA3 A;  3L2V A;  3TI0 A;  2D0C A;  4O0J A;  3LP2 A;  1SKS A;  1RTD A;  4EZ9 A;  1S1X A;  1RTH A;  4B9L A;  1QSL A;  3OYB A;  2Z1H A;  1S9E A;  4Z4G A;  1ZBL A;  3AVM A;  3D0P A;  4FLU A;  2P5G A;  1HPZ A;  4O0I A;  3AVC A;  3I0R A;  4I2Q A;  1NJW A;  4DF8 A;  3C6U A;  1HNV A;  1HJR A;  1EKE A;  1RNH A;  4CEB A;  4CK3 A;  1Q9Y A;  3KD5 E;  4CJ5 A;  4FCY A;  3NFA A;  1GOA A;  5FDL A;  3OS2 A;  1S1V A;  2HB5 A;  3TAP A;  3DMJ A;  4H4M A;  3NGI A;  1L3S A;  1IKX A;  3L3U A;  4CGG A;  2GUI A;  3AVH A;  1BL3 A;  4OGE A;  3PX6 A;  3ZSX A;  2HHW A;  1HNI A;  3M8R A;  4FK0 A;  4BDP A;  3ZSO A;  1YTU A;  1VRT A;  1TGO A;  4PUO A;  3HM9 A;  4DU4 A;  3ZSV A;  3I0S A;  3LP3 A;  4FJ5 A;  4Z0U A;  1D9D A;  4KHY A;  1BGX T;  4KTW A;  4DS4 A;  1DLO A;  1LWE A;  1Z26 A;  2O4G A;  3OY9 A;  3KLE A;  4Q0B A;  1RBV A;  3MAQ A;  1LV5 A;  2HHV A;  4CES A;  3LP0 A;  3AA2 A;  4E7L A;  1KRP A;  1VSL A;  1T05 A;  4AHC A;  3F73 A;  3SV4 A;  1RT5 A;  3VQ4 A;  5DMR A;  4K8Z A;  5D3G A;  3VQE A;  3V6D A;  2F96 A;  3HPG A;  2X78 A;  5J2P A;  4W5T A;  3S9H A;  1U47 A;  1SKW A;  3L8B A;  1O1W A;  4LSN A;  2RN2 A;  3G0Z A;  5CYM A;  2ITG A;  1S9G A;  2R7Y A;  1U45 A;  1KFS A;  3PY8 A;  4NCB A;  3AV9 A;  4XIU A;  4FK2 A;  4E3S A;  3ZSZ A;  1RT7 A;  3O4Q A;  4W5N A;  3C6T A;  2E6M A;  1TKT A;  4NCG A;  4Q5V A;  3SQ4 A;  4QCL A;  5JS2 A;  2Y1J A;  2X6S A;  3HP6 A;  1U04 A;  4ID1 A;  4CGD A;  3OYN A;  3L2Q A;  3SPZ A;  1FKP A;  4RW7 A;  2G8K A;  3RR8 A;  1TAU A;  4FJ7 A;  4F2R A;  3L2W A;  5HBM A;  3QIN A;  1NK5 A;  3CG7 A;  3LPT A;  3HJF A;  2FC0 A;  4HUE A;  1KVA A;  3CM6 A;  4KI6 A;  4DFJ A;  1VSK A;  4JRQ A;  3RRG A;  2XO7 A;  1X9M A;  3TWH A;  1WNS A;  2YV0 X;  2G8F A;  1BIU A;  1QSY A;  3I8D A;  4J2B A;  4IBN A;  4B9N A;  2IOC A;  3HP9 A;  1ZBU A;  4BWM A;  3VQC A;  4CGF A;  2XRI A;  1A5X A;  4ICL A;  4RW8 A;  4PWD A;  4CJE A;  4M45 A;  3CM5 A;  1HYS A;  3KLI A;  3VQP A;  1QHT A;  4LH5 A;  4M3U A;  4CED A;  3ALY A;  4FJH A;  4FJK A;  3HST B;  4I2P A;  4OKE A;  3LWL A;  3K59 A;  3ASM A;  2HW3 A;  2VG6 A;  1JL1 A;  4J2D A;  2KZM A;  3SQ1 A;  4CJ3 A;  4HHT A;  3JYT A;  3CFR A;  2O4I A;  1K6Y A;  4I9L A;  3QEP A;  4FM2 A;  4B9U A;  1LW0 A;  5HRP A;  4DSJ A;  3HO1 A;  2VWJ A;  2D0B A;  1MU2 A;  1CXU A;  4ELU A;  1EXQ A;  3KK2 A;  4OLA A;  4DSK A;  2QKK A;  2HHS A;  4CHP A;  3OYH A;  4AHS A;  4ID5 A;  1D9F A;  3G10 A;  1QSS A;  1WSI A;  3L3V A;  4FW2 A;  4AIL C;  4CF0 A;  1BCM A;  2YNG A;  3TR8 A;  5SWM A;  4B9S A;  4FJ9 A;  1EX4 A;  3VQQ A;  2BGG A;  5KRT A;  1RTI A;  3OYA A;  4E7K A;  2FBY A;  2FBT A;  2X6N A;  1UA0 A;  3QEX A;  4J2A A;  4Y1D A;  5KI6 A;  1BIS A;  2G8W A;  1HQE A;  4YFU A;  2OPS A;  3M8S A;  3RRH A;  4DSI A;  2ETJ A;  4AHU A;  5I42 A;  3EYZ A;  3KLH A;  2B5J A;  1HRH A;  4CJS A;  5HLF A;  2HND A;  4CCH A;  3WNG A;  3S3M A;  4E1N A;  4CEE A;  4CJF A;  1QQC A;  3HL8 A;  4E19 A;  3VQA A;  3AVJ A;  2FBV A;  4OGC A;  2LSN A;  4HVJ A;  1TKD A;  4LD0 A;  4CF9 A;  4GVM A;  1C6V A;  4CEA A;  2YKN A;  2QXF A;  4HTU A;  3BGR A;  4E1M A;  3KIO A;  1C0M A;  5CYQ A;  1TKZ A;  4O55 A;  3UIQ A;  1G15 A;  2IAJ A;  3DOK A;  1S1U A;  4JLH A;  1YT3 A;  3OYD A;  4HUF A;  1KLN A;  4M3Z A;  4QOZ B;  3B6P A;  4DG1 A;  1NK9 A;  4RG8 A;  4CHY A;  1XC9 A;  5J2M A;  1X9W A;  4N41 A;  3OYG A;  3NHG A;  4M3Y A;  1WSF A;  3OYM A;  1U4B A;  1ZYQ A;  1FKO A;  3CFP A;  3HVR A;  3VQ5 A;  4CEQ A;  4KPY A;  5FRM A;  4CGI A;  4TSX A;  4LH4 A;  3QIO A;  4FXD A;  4KRF A;  3OYF A;  1SL0 A;  1C1B A;  3V1R A;  3DRS A;  3TAE A;  4KHN A;  3F9K A;  3S3N A;  3SI6 A;  4JS4 A;  1RCH A;  2EX3 A;  1KFD A;  3ISN C;  4CHZ A;  2PZS A;  4KTQ A;  3JSM A;  1ASW A;  4BE2 A;  3QO9 A;  4H8K A;  2Y1I A;  4C8L A;  4DSL A;  3O3H A;  4FJL A;  2PY5 A;  1WSH A;  4JS5 A;  1NOZ A;  5HRR A;  4E7J A;  2IDO A;  1NJX A;  4NYF A;  4DFP A;  2KZZ A;  1RT3 A;  4DFM A;  1NKE A;  4LSL A;  4CFA A;  5KRS A;  1J53 A;  4C8N A;  2G8U A;  4DQP A;  4DTJ A;  1RT6 A;  4Z4F A;  4PY5 A;  4KB0 A;  3AVA A;  4DFK A;  4DTP A;  1TV6 A;  4DS5 A;  4B8A B;  4F4K A;  2XHB A;  1NJY A;  1HMV A;  4AH9 A;  1FK9 A;  5FRN A;  2HHQ A;  3CFO A;  3AVL A;  1A5V A;  3L2U A;  3C95 A;  4CJQ A;  4CE9 A;  3RMD A;  4HCC A;  4CJP A;  1GOC A;  3OYJ A;  3OS1 A;  1J5O A;  3RTV A;  4DTX A;  1LW2 A;  4KTZ A;  3S3O A;  2AJQ A;  3VQ7 A;  3LDS A;  4CF2 A;  3ZSR A;  1QE1 A;  2RPI A;  4BDZ A;  3V1O A;  1UAX A;  3ZT1 A;  1RBU A;  1J54 A;  2KTQ A;  1CZB A;  3ZT3 A;  1L3U A;  3P1G A;  4CEZ A;  1WN7 A;  4N5S A;  4DSE A;  3WNH A;  1SV5 A;  2ZD1 A;  4RW4 A;  2PYL A;  1VSJ A;  4O4G A;  3HXM A;  3MXM A;  4CER A;  1NOY A;  4IFV A;  2WOM A;  3AVF A;  2GV9 A;  1N6Q A;  4QAG A;  3ZSQ A;  3DLE A;  3IG1 A;  1SL1 A;  2PYJ A;  3IRX A;  4KAZ A;  3T3F A;  1DTT A;  4CJL A;  4ZHR A;  2KFN A;  2KFZ A;  4H4O A;  4FVM A;  3DYA A;  4KKO A;  2DTU A;  1KVC A;  4C8M A;  2YHA A;  1DTQ A;  4O44 A;  3NCI A;  3THV A;  2HHU A;  4AHR A;  2G8V A;  1S1T A;  1C0T A;  3NE6 A;  1QTM A;  4CJW A;  2G8I A;  3TAG A;  3NF8 A;  3NF7 A;  4W5O A;  3V81 A;  1L3T A;  2OZS A;  2HNZ A;  3ZT2 A;  3MEC A;  4B08 A;  2XY6 A;  3VA0 A;  4CGH A;  3NF6 A;  1UOC A;  3IS9 A;  1VRU A;  2VWK A;  3KTQ A;  3PX0 A;  3E01 A;  4DU1 A;  3IAY A;  1ZBI A;  1XHZ A;  1VSF A;  3RWU A;  2VG5 A;  5FRO A;  3U3G A;  1Q9X A;  3ZSY A;  1JXB A;  1S6P A;  5DK5 A;  4PA1 A;  2E4L A;  1R0A A;  4CHQ A;  2QK9 A;  4B9M A;  2OPR A;  3EY1 A;  3SUP A;  1W9H A;  3HT3 A;  1HYV A;  2HVH A;  3SUN A;  3SCX A;  1Q8I A;  3DM2 A;  1VSI A;  3AA3 A;  1NK6 A;  4MQ3 A;  3SZ2 A;  1TK0 A;  2YNH A;  3KK3 A;  4IFY A;  1B92 A;  4CJT A;  1JLA A;  1EET A;  4CK1 A;  2OPQ A;  4ELT A;  4EP5 A;  5J1E A;  4BDY A;  3BDP A;  1I39 A;  1VSD A;  3NAE A;  4DTN A;  1T8E A;  3O3G A;  4DQI A;  1NK0 A;  3O3F A;  1LAV A;  4BE1 A;  3LAK A;  4IG3 A;  4RW6 A;  5C24 A;  3LZJ A;  4FLT A;  1D5A A;  1TAQ A;  3D45 A;  1ASV A;  4FJG A;  3PO4 A;  1JLC A;  3AVG A;  2QKB A;  4DU3 A;  3TAN A;  4FJM A;  2P51 A;  4FJX A;  3LPU A;  4E7H A;  3RMC A;  4K8X A;  4IDK A;  4NYN A;  4E89 A;  4F3O A;  4FK4 A;  2ZE2 A;  2DFH A;  3WNE A;  3OYL A;  1YVU A;  3LZI A;  1JLB A;  4OKK A;  4KI4 A;  1TVR A;  2B4J A;  3SYZ A;  4CEC A;  4DLE A;  1WLJ A;  3M8Q A;  2HNY A;  4B3O A;  4BE0 A;  3NGY A;  2D0A A;  2P1J A;  1KCF A;  1WAF A;  1SUQ A;  3CQ8 A;  3V9S A;  5SZT A;  2KW4 A;  4M41 A;  4FYD A;  4Y1C A;  4OKJ A;  3AO2 A;  3NH2 A;  4KHU A;  4ELV A;  2NUB A;  2XY8 A;  3U3Y A;  4KB1 A;  1B9F A;  4GMJ B;  2A1S A;  2Z1G A;  5I3U A;  2RKI A;  3ZT0 A;  1T03 A;  1X1P A;  1S5J A;  4L8R B;  3DI6 A;  4M3W A;  1JKH A;  4CFB A;  4CFD A;  3DRP A;  4KV8 A;  3KK1 A;  1GOB A;  4CFC A;  5HRO A;  1TK5 A;  4Z4I A;  2BAN A;  3NF9 A;  4FJJ A;  4BWJ A;  2A1R A;  3WNF A;  3AO1 A;  5C25 A;  1W0H A;  4WE1 A;  3DLB A;  3AO3 A;  3SQ0 A;  4CIE A;  4Z4H A;  3P5J A;  4M3R A;  1UWB A;  4FZX C;  4Z4E A;  5T7B A;  3KKS A;  3VQ6 A;  3NH0 A;  1SL2 A;  2DFE A;  5KGW A;  4DTR A;  5CZ1 A;  1REV A;  1ASU A;  2DFF A;  3U6F A;  1A5W A;  2KQ2 A;  1WSE A;  4KO0 A;  4FLV A;  4C8K A;  4OPK A;  1JLF A;  3ZCM A;  4CHO A;  2OA8 A;  4F2S A;  1RDD A;  5C42 A;  4N76 A;  4DWI A;  3OYE A;  1X9S A;  4OPJ A;  1VSH A;  3DRR A;  4CHN A;  4HUG A;  1C1A A;  2BE2 A;  4DTO A;  1WSG A;  4OVL A;  4GW6 A;  3K58 A;  4DQS A;  4IKF A;  2RF2 A;  2BDP A;  1RT2 A;  4CJV A;  3TAB A;  3TAQ A;  4FLY A;  1RBR A;  3DLK A;  3FFI A;  1HYZ A;  4CJ4 A;  1BQM A;  3ZSW A;  1KVB A;  4I7F A;  1KLM A;  4FJ8 A;  3P83 D;  1NKC A;  4MFB A;  3LAL A;  1QS4 A;  3L2R A;  2IS3 A;  4DF4 A;  5JS1 A;  1N5Y A;  4B9V A;  3SUQ A;  1NK4 A;  1RIL A;  3ITH A;  1NJZ A;  4M42 A;  4DTS A; 
#chains in the Genus database with same CATH topology
 1XHX A;  3FFK B;  3TAR A;  2JGU A;  3HVT A;  3VGK A;  1VHX A;  1ZBH A;  2P9N A;  3CI5 A;  1LWF A;  3O1W A;  3VQ8 A;  4E1J A;  3C94 A;  3SLC A;  5KTQ A;  1I3A A;  2YNI A;  1WSJ A;  2HF4 A;  2Q31 A;  5LMN K;  3V4I A;  1YXQ A;  3AA4 A;  3QFP A;  1IH7 A;  4FW1 A;  2X74 A;  3K5O A;  3CXC M;  2WON A;  4NB4 A;  1ITG A;  2OCE A;  3QES A;  1Q18 A;  2DY4 A;  1V4S A;  2P9S A;  5AQK A;  3SV3 A;  2P9N B;  3QNN A;  4EZ6 A;  3U9Z A;  3CCQ N;  1B9D A;  1FXX A;  4KHQ A;  4JI8 K;  4I9Q A;  4FWO A;  2O4I A;  4C1N K;  4BAC A;  4KHP K;  1RDC A;  2QW9 A;  4BR4 A;  2P5O A;  1NK7 A;  2P9S B;  1RDA A;  2O8D A;  2KHO A;  4NCA A;  5AQI A;  2JLE A;  4H0X B;  4YNQ A;  3HBT A;  4WQ5 A;  1NK8 A;  4N56 A;  1K9M O;  4A5B A;  3NGZ A;  1MA9 B;  4CI6 A;  1U2V A;  4BRO A;  3QET A;  4CJK A;  4IJA A;  2YKM A;  3LDO A;  3ENH A;  4EAH D;  5E41 A;  5GAE P;  1XQS C;  2O8D B;  3H46 O;  3LAM A;  1D8Y A;  1NM1 A;  3EZ5 A;  4O5B A;  2W6L A;  2O8E A;  4C8O A;  4IEI A;  5AQJ A;  3LWM A;  2HMP A;  4WQ4 A;  3HPH A;  3I8B A;  3VQ9 A;  4FWM A;  3DLR A;  5J2Q A;  4CJR A;  4CJ7 A;  2XY7 A;  2HST A;  3OJS A;  3EN9 A;  2QTD A;  3O4N A;  4FPA A;  4PKG A;  3QEV A;  2D5R A;  4FZZ A;  3PIP L;  4K42 A;  3BUZ B;  4DTM A;  3ENB A;  2F8T A;  1RDB A;  4E7I A;  2HMI A;  1TYQ B;  1C1C A;  1U48 A;  4DHY A;  1IO2 A;  3OS0 A;  5AQS A;  5C2F A;  2GEM A;  3A5L C;  5LJW A;  4FLX A;  3CQX A;  2J4R A;  3ATU A;  4FPB A;  4M3T A;  1LWC A;  1ATR A;  3QNO A;  4H5N A;  3TI0 A;  1RTD A;  3ZX3 A;  1QSL A;  3OYB A;  3U9D A;  3CF5 L;  3ZX0 A;  4O0I A;  1T6C A;  1HNV A;  1GOA A;  3AAR A;  3CPW M;  3TAP A;  2H3G X;  2A5X A;  2NRX A;  3L3U A;  1BL3 A;  5C2D A;  4BDP A;  3A5O C;  1S3X A;  4DU4 A;  4FJ5 A;  4PUO A;  4KHY A;  4Z0U A;  3B8A X;  2W6K A;  1LWE A;  3KLE A;  3MAQ A;  3E9P A;  1GLA G;  3AA2 A;  3DLL L;  1VSL A;  3HM8 A;  4AHC A;  1Q82 O;  3SV4 A;  4YY3 K;  3O08 A;  5DMR A;  4K8Z A;  2W41 A;  4JK9 A;  2X78 A;  2CH5 A;  3FZF A;  1SKW A;  1O1W A;  3EO3 A;  3G0Z A;  4FK2 A;  4IZ9 A;  3UKU B;  3ZSZ A;  1RT7 A;  4W5N A;  2E6M A;  3CER A;  2X6S A;  4CGD A;  4JKE A;  2UU9 K;  4FJ7 A;  3ZET B;  4JI3 K;  2A40 A;  1OH7 A;  3WEE B;  3VEY A;  3CG7 A;  3LPT A;  1VSK A;  4O5F A;  3F5T A;  3EKS A;  1NGA A;  3QBX A;  1U6Z A;  4B9N A;  3HP9 A;  4BWM A;  5BN9 A;  3VQC A;  4CGF A;  2XRI A;  1Z05 A;  1WB9 A;  3CCU N;  2UXD K;  1QHT A;  3S41 A;  3ALY A;  4FJK A;  3LWL A;  3ASM A;  2HW3 A;  2KZM A;  2QI2 A;  4WFN L;  4YOV A;  4I9L A;  3N4P A;  2QWP A;  3LDL A;  4BRL A;  1T3V A;  4R79 A;  5TKW A;  3EKU A;  4FWP A;  3TR8 A;  5SWM A;  4CZJ A;  4B9S A;  4FJ9 A;  5F1X A;  1MDU B;  3FZL A;  3OYA A;  1VQM N;  4JEP A;  2G8W A;  2OPS A;  3M8S A;  2ETJ A;  3RVC A;  4AM6 A;  3KLH A;  1HRH A;  4CJS A;  4IO9 L;  4JN4 A;  5BPL A;  4CCH A;  2RE2 A;  4CJF A;  3VQA A;  3GDQ A;  4HVJ A;  1R59 O;  2P9L A;  2HOE A;  4GVM A;  2QXF A;  3KIO A;  1BU6 O;  5CYQ A;  3DOK A;  3O8M A;  5AZJ A;  1YT3 A;  3OYD A;  4QOZ B;  3IUC A;  4WFB L;  3B6P A;  4DG1 A;  1BOT O;  4M3Y A;  1ZBS A;  1ZYQ A;  3EEQ A;  4CEQ A;  2E2O A;  4O8U A;  4KRF A;  1SL0 A;  2P9L B;  4QS7 A;  1C1B A;  4DV1 K;  2ZGY A;  4CHZ A;  3CJC A;  5AZJ B;  4DSL A;  2UXB K;  3RSE A;  3KWG A;  2KZZ A;  3SBG A;  5CR4 A;  4GVE A;  4LSL A;  4C8N A;  3LM2 A;  5FPM A;  4PY5 A;  4IJN A;  1KXP A;  1TV6 A;  3UE5 A;  2UUA K;  1NGF A;  1NBW A;  1KC8 O;  4AH9 A;  5FRN A;  2HHQ A;  3CC7 N;  3AVL A;  1A5V A;  4BY9 C;  3C95 A;  3RSE B;  4NXN K;  3ZEU A;  5KPZ A;  3OYJ A;  2Q1N A;  3HI0 A;  4A5A A;  3S3O A;  4EFH A;  3LDS A;  3ZT1 A;  1BWF O;  1L3U A;  3P1G A;  4DSE A;  1MWM A;  3WNH A;  1SV5 A;  2A42 A;  1GLB G;  4RW4 A;  2NLX A;  4BRP A;  3CJA A;  3ZEU B;  1BA1 A;  3AVF A;  4IXC A;  3ZSQ A;  3J7Z O;  1SL1 A;  5AQV A;  4BG9 A;  4JKB A;  4FVM A;  1K8A O;  1DTQ A;  3PLA A;  3ATV A;  3NE6 A;  3V81 A;  3ZT2 A;  3M5R A;  1UOC A;  3R8E A;  1VRU A;  2VWK A;  4L3Q A;  3O9Q A;  5FRO A;  1QHA A;  3WT0 A;  4BQL A;  1S6P A;  1R0A A;  2QK9 A;  4B9M A;  3HT3 A;  5BR8 K;  1OH8 A;  1YJW N;  1TK0 A;  1GLC G;  4B3M K;  1EET A;  2OPQ A;  3GL1 A;  1I39 A;  1VSD A;  3NAE A;  1T8E A;  3O3G A;  2QXL A;  3J81 O;  1LAV A;  4RW6 A;  3LZJ A;  5C24 A;  2QKB A;  4FJM A;  2P51 A;  4E7H A;  1OKJ A;  4E89 A;  2DFH A;  2EWS A;  4DR4 K;  3VES A;  1TVR A;  2B4J A;  3M8Q A;  4B3O A;  1ZC6 A;  1WAF A;  1SUQ A;  1HPM A;  4FYD A;  3AO2 A;  1OH6 A;  4ELV A;  3U3Y A;  3VEW A;  4GMJ B;  5I3U A;  4L8R B;  1NMD A;  1NGD A;  4CFD A;  2Q97 A;  3DRP A;  4Z4I A;  5HRO A;  5AQY A;  2BAN A;  4BWJ A;  2A1R A;  3AO1 A;  3P38 A;  3DLB A;  5F0X A;  4FZX C;  2E2Q A;  4Z4E A;  3VQ6 A;  5KGW A;  1REV A;  1HX1 A;  2DFF A;  3CJB A;  2KQ2 A;  3QBW A;  2ZJR L;  4FLV A;  1LCU A;  5TKY A;  3ZCM A;  3TSU A;  2OA8 A;  3OYE A;  5JLF A;  3DRR A;  4CHN A;  2BE2 A;  4DTO A;  3K58 A;  2RF2 A;  5BRE A;  1BQM A;  4K43 A;  4H0O A;  3ZSW A;  3ZYY X;  1HNZ K;  1KVB A;  1NKC A;  4MFB A;  1Q81 O;  3NVK A;  1XC3 A;  2IVP A;  3ITH A;  1NJZ A;  1E3M A;  5JMV A;  2ZQB A;  4XH4 A;  3QIP A;  4B3S K;  4OJR A;  4R5P A;  1RBS A;  1KTQ A;  3NDK A;  1RTJ A;  2NRT A;  4OLB A;  1H1V A;  4PL7 A;  1TL1 A;  3R6M A;  2IC3 A;  4WCE L;  2G8H A;  2YNF A;  3SMP A;  3IMX A;  4LFA K;  3A2F A;  4EP4 A;  3AVI A;  5EU7 A;  5HRN A;  1HKC A;  1IKW A;  3O80 A;  4BC5 A;  4FLW A;  4H5W A;  4LF4 K;  4CBW A;  4H0T B;  4M3X A;  4F3T A;  3AO4 A;  4AHT A;  3C6H A;  1TKX A;  2NRR A;  3JXU A;  3VEZ A;  4DTU A;  3QER A;  3VQB A;  3MK6 A;  1J6Z A;  3Q7C A;  2VG7 A;  2HBL A;  4BRG A;  3D6R A;  4JI4 K;  4XEI A;  1JLQ A;  2P9U A;  2OPP A;  3O9S A;  4CJU A;  5BPM A;  5EXW A;  1T7P A;  3KD1 E;  1XMO K;  4CZG A;  4YOX A;  2Q0R A;  4JAX A;  4KFB A;  3AVK A;  3ENO A;  3QLH A;  1F21 A;  3KLF A;  4DSF A;  2D0P A;  2EHG A;  4N47 A;  3DAW A;  2P9U B;  2FF3 B;  4WF9 L;  2HHX A;  4ZTJ A;  1NGJ A;  3CYM A;  2FBX A;  3B6O A;  4BC4 A;  4IO8 A;  4NO7 A;  1LOT B;  3H3N O;  3T19 A;  2QA4 N;  1K73 O;  3HK2 A;  2VGN A;  4B8C A;  3DWL A;  3T1A A;  1BHL A;  2E2N A;  4OPH A;  2QWM A;  1XI1 A;  4GV6 A;  1JXE A;  1D4X A;  4GV3 A;  5BN8 A;  5K14 A;  4CIF A;  3H6E A;  4AHV A;  3OYI A;  1P90 A;  5FLX O;  1S1W A;  1SAZ A;  3BEX A;  1T6D A;  1HQU A;  3V1Q A;  1WBD A;  3A5N C;  3SPY A;  4DMN A;  3SQ2 A;  5HP1 A;  2HVI A;  2B6A A;  3WUH A;  1TL3 A;  5CY4 A;  4Z4C A;  1KSP A;  1S6Q A;  4ZTF A;  3L2V A;  3FLC O;  2D0C A;  1SKS A;  2YHX A;  4OO1 J;  1RTH A;  1X3M A;  4B9L A;  2HF3 A;  3D0P A;  4A61 A;  5GIN A;  1HPZ A;  3MN9 A;  3C6U A;  4CK3 A;  1HJR A;  2YCH A;  5BPN A;  4K25 A;  3SAH A;  4CJ5 A;  4C23 A;  3SAG A;  5FDL A;  1S1V A;  4H4M A;  3NGI A;  1IKX A;  3PX6 A;  1YTU A;  3VEN A;  1VRT A;  1VAZ A;  4H5R A;  5JIC A;  1BUP A;  3I0S A;  3LP3 A;  4KTW A;  3THX A;  1LV5 A;  4CES A;  2QEX N;  1KRP A;  1RDU A;  1NMN A;  3V6D A;  3HPG A;  1YIJ N;  3S9H A;  4W5T A;  1MWK A;  3L8B A;  4NCB A;  2VQE K;  2ITG A;  3PY8 A;  4E3S A;  3THX B;  3O4Q A;  4B3T K;  1TKT A;  4Q5V A;  3SPZ A;  2G8K A;  3CCV N;  4BRH A;  1TAU A;  2VWB A;  3CME N;  5HBM A;  1T44 A;  2FC0 A;  4HUE A;  5LJV A;  1GLJ O;  4LF8 K;  1WNS A;  3HOS A;  4JYA K;  3I8D A;  5A2Q O;  3VGL A;  2NRW A;  4XH5 A;  1A5X A;  3CCL N;  4CJE A;  4X62 K;  3VQP A;  4LH5 A;  4DR2 K;  4FJH A;  2Q2R A;  4OKE A;  2E5L K;  4BC3 A;  1U2V B;  3SQ1 A;  1K6Y A;  3QEP A;  4B9U A;  1LW0 A;  1W7A A;  2D0B A;  4DQ8 A;  4ELU A;  1EXQ A;  3IKM A;  4OLA A;  4DSK A;  4CHP A;  3OYH A;  3MN6 A;  1WSI A;  2ZWH A;  4GV9 A;  4AIL C;  3OW2 M;  4EHU A;  1BCM A;  2O8E B;  4IEE A;  1EX4 A;  4DV3 K;  2HHH K;  4FWQ A;  5JLH A;  2FBT A;  4JKH A;  1X3N A;  1UA0 A;  3QEX A;  5KI6 A;  4H0V B;  1XUP O;  4DSI A;  4AHU A;  2B5J A;  5HLF A;  2HND A;  2UUB K;  3F9M A;  1XNR K;  3S3M A;  4E1N A;  1QQC A;  3HL8 A;  3AVJ A;  4B1Y B;  4DV0 K;  5AQQ A;  2Q36 A;  4O55 A;  3UIQ A;  1G15 A;  2KLA A;  4JLH A;  1BDG A;  5AQR A;  1XC9 A;  4N41 A;  2V51 B;  1WSF A;  4A2B A;  5C15 A;  4KPY A;  3QIC A;  1G99 A;  4TSX A;  4LH4 A;  2WTU A;  4FXD A;  3F2K A;  3A5M C;  4PHT X;  3V1R A;  4LFB K;  3SI6 A;  1RCH A;  3ISN C;  1KFD A;  2WBN A;  2PZS A;  3JSM A;  1ASW A;  2Y1I A;  3QO9 A;  4FJL A;  3LL3 A;  2PY5 A;  4X64 K;  1WSH A;  5C0Y A;  4E7J A;  1YJN N;  4NYF A;  1IJJ A;  1RT3 A;  3TTF A;  1J53 A;  3H1Q A;  3I33 A;  1RT6 A;  4Z4F A;  4KB0 A;  4DFK A;  4KH5 A;  4DS5 A;  2ZF5 O;  1C0G A;  2XHB A;  4B1X B;  1NJY A;  1FK9 A;  2YHW A;  3CFO A;  5IWA K;  1OVQ A;  4HCC A;  3KHY A;  3RTV A;  4DTX A;  4KTZ A;  3EL2 A;  3CCM N;  4BDZ A;  2RPI A;  5C12 A;  1RBU A;  1J54 A;  2YHY A;  1WN7 A;  1Q86 O;  4C1N I;  5FPE A;  4O4G A;  5M1P A;  2FSK A;  1BA0 A;  4JK8 A;  5AQH A;  1RGI A;  3U4L A;  4CJL A;  4H4O A;  3I55 N;  3GE1 A;  1KVC A;  2YHA A;  4O44 A;  3NMU A;  1YAG A;  2I7N A;  4CJW A;  3TSP A;  3NF8 A;  3TAG A;  1L3T A;  2HNZ A;  3MEC A;  2XY6 A;  3VA0 A;  3NF6 A;  3IS9 A;  3E01 A;  4DU1 A;  1ZBI A;  2HBM A;  2VG5 A;  3U3G A;  1JXB A;  4KH6 A;  3OHR A;  1K8K A;  2E4L A;  2F4V K;  5GIO A;  1HYV A;  2HVH A;  5M1N A;  4RCH A;  3SCX A;  1Q8I A;  4CZL A;  4MQ3 A;  4JNE A;  1EWQ A;  2YNH A;  5BR9 A;  4IFY A;  1B92 A;  1HJO A;  4CJT A;  3CMA N;  4CK1 A;  5J1E A;  3BDP A;  4DTN A;  2O8C A;  4BRI A;  1K8K B;  2HBK A;  4FLT A;  4NLB A;  4FWR A;  3AVG A;  4BRQ A;  4BRN A;  2QWQ A;  3LPU A;  3RMC A;  4NYN A;  3WNE A;  4X65 K;  4Y0W A;  1JLB A;  4WYB A;  4BE0 A;  1IBM K;  4ISG A;  1CZA N;  2O8C B;  1KCF A;  1HKB A;  3CQ8 A;  1DKG D;  1QVG M;  4Y1C A;  4OKJ A;  2NUB A;  4KB1 A;  1B9F A;  2A1S A;  2RKI A;  3ZT0 A;  1X1P A;  1GLE G;  4CBX A;  2O8F A;  4M3W A;  1JKH A;  2D0O A;  2I7P A;  3H3O B;  5H1S Q;  1DGK N;  2GX9 A;  1GOB A;  2BUP A;  1TK5 A;  4FJJ A;  1VQO N;  5C25 A;  3P39 A;  4WE1 A;  3CCJ N;  3AO3 A;  3SQ0 A;  3MMV A;  4Z4H A;  5M1K A;  1J5E K;  1I94 K;  2ASO A;  4PKI A;  2BTF A;  3KKS A;  3QB0 A;  4DTR A;  2UXC K;  2O8F B;  4JHD A;  3H1V X;  4K41 A;  1BG3 A;  1WSE A;  4KO0 A;  4DR6 K;  4N76 A;  3UKR A;  3SMS A;  5GAD P;  5BRF A;  3VOV A;  3O1B A;  1C1A A;  1WSG A;  4OVL A;  4GW6 A;  4DQS A;  4IKF A;  3HZ6 A;  3GBT A;  4CJV A;  3TAB A;  4FLY A;  3DLK A;  3FFI A;  4CJ4 A;  4JHD B;  4MLH A;  3P83 D;  4FJ8 A;  1QS4 A;  3L2R A;  2RHK A;  4BRF A;  4DF4 A;  3UKR B;  4FOI A;  2AA4 A;  2Q0U A;  1NK6 A;  2IIR A;  4DV4 K;  4CZH A;  1IBK K;  3KZB A;  3HO1 A;  4DQQ A;  1YHQ N;  4GY2 B;  2UUC K;  3PX4 A;  2F8S A;  2YJE A;  3K0S A;  3M8P A;  4NLC A;  4CK2 A;  4FWN A;  2VCP A;  3PUF A;  1CZ9 A;  3MEG A;  4M63 C;  3T7Z A;  1Q7Y O;  1JJ2 M;  3VN5 A;  3KJV A;  3SJJ A;  1EP4 A;  4G1Q A;  4FJN A;  2Z1I A;  2YI1 A;  3V9Z A;  3V9X A;  4J2E A;  2OAN A;  3K2P A;  3TAF A;  4CD1 A;  3DLH A;  3E66 A;  3KVG A;  3GG4 A;  4DR5 K;  3OJU A;  2CGK A;  5HRS A;  3CC2 N;  3AO5 A;  4CZM A;  1RBT A;  3K5L A;  5AFU H;  3MX5 A;  3MWP A;  4FZY A;  3K57 A;  3A8Y A;  4UQG A;  4DLG A;  5AQP A;  3L0Q A;  3NH1 A;  2W40 A;  3MXI A;  2A6A A;  1IG8 A;  1OVY A;  4KRE A;  4DQR A;  2FSJ A;  2E1Y A;  1JLG A;  3OYK A;  2E8A A;  3DOL A;  4JD2 A;  1VQK N;  4CF8 A;  1QVF M;  1NLV A;  3O9U A;  3JAM O;  3CC4 N;  1IG9 A;  1WBB A;  4B1U B;  3H08 A;  3MED A;  4CIG A;  3O9T A;  5ADX H;  1N32 K;  1QQN A;  2QWR A;  5E84 A;  3C65 A;  3BP8 A;  3WXK A;  4DV6 K;  4E0D A;  3QEW A;  2ZJQ L;  4CD3 A;  2P9K A;  4LC9 B;  1BIZ A;  3QDK A;  4BGA A;  5FPD A;  2BH1 A;  2HHT A;  2Z1J A;  1N8R O;  5J2N A;  4DCH A;  4WFA L;  4YHH K;  3QEI A;  1IKY A;  3ZT4 A;  4CEO A;  3J8A A;  2QWO A;  1U49 A;  1VSE A;  2P9K B;  3T69 A;  4A2A A;  4JI1 K;  1NKB A;  2GTD A;  5BRH A;  4AM7 A;  4CEF A;  1IKV A;  1KAY A;  1RT1 A;  3KKR A;  3EZW A;  3BF1 A;  3OBY A;  4BC2 A;  1Z25 A;  2VGM A;  3LDN A;  4CF1 A;  2E6L A;  1NG9 A;  2YJF A;  1NGE A;  3AVB A;  4CGJ A;  4W5Q A;  1TK8 A;  2GBZ A;  3AAQ A;  3DJC A;  1NJI O;  1VQ8 N;  3DLG A;  5CZ2 A;  3VA3 A;  4J8F A;  4O0J A;  4EZ9 A;  1S1X A;  1ZBL A;  3AVM A;  4FLU A;  2P5G A;  2JWK A;  3AVC A;  4I2Q A;  1NJW A;  4CEB A;  1RNH A;  3KD5 E;  1EKE A;  4IDH A;  1DT9 A;  4FCY A;  4UY8 O;  3OS2 A;  1L3S A;  3E1Y A;  1X9J A;  2GUI A;  3AVH A;  3UB5 A;  2HHW A;  4FK0 A;  3ZSO A;  1N34 K;  1M1K O;  1D9D A;  3WXI A;  4DS4 A;  1DLO A;  3PIO L;  3OBW A;  3OY9 A;  4Q0B A;  4JKC A;  2HHV A;  4E7L A;  3F73 A;  1RT5 A;  3MX2 A;  5D3G A;  1HLU A;  3VEV A;  5J2P A;  1U47 A;  3C7N A;  2R7Y A;  4LSN A;  2CGL A;  1QZ6 A;  2RN2 A;  4EHT A;  1S9G A;  4MO5 A;  3AV9 A;  4NCG A;  3SQ4 A;  2OTJ N;  4QCL A;  5JS2 A;  2Y1J A;  1U04 A;  3RR8 A;  5AJ3 K;  3D7E O;  4BVP A;  3L2W A;  3C7N B;  4DV2 K;  3LDP A;  3HJF A;  3CM6 A;  4KI6 A;  4DFJ A;  1NGH A;  2XO7 A;  4KH4 A;  3TWH A;  5DM7 L;  2YV0 X;  5CE3 A;  2G8F A;  1S72 N;  1BIU A;  4IBN A;  2IOC A;  3DXK A;  1XMQ K;  4RW8 A;  4PWD A;  5AR0 A;  4M45 A;  1FW6 A;  3HST B;  4BR9 A;  3K59 A;  3BY5 A;  4K0K K;  4Z94 A;  1JCG A;  4CJ3 A;  2A3Z A;  3CFR A;  1E4G T;  4FM2 A;  2VWJ A;  1CXU A;  1JCE A;  2HHS A;  1NGC A;  2QWN A;  3G10 A;  4FW2 A;  5AZI A;  4CF0 A;  1GLF O;  3VQQ A;  5LY3 A;  4GKJ K;  5KRT A;  2CH6 A;  1RTI A;  3KK7 A;  5GAG P;  4B1W B;  4RWT A;  1EQY A;  4BRD A;  3CCS N;  1ATS A;  3THW A;  5I42 A;  2FF6 A;  3EYZ A;  3VTH A;  3C0B A;  4FSV A;  4CEE A;  4E19 A;  2F9T A;  5AQF A;  2FBV A;  3J7A P;  2VQF K;  4LD0 A;  4CF9 A;  1C6V A;  4HTU A;  3BGR A;  1C0M A;  1RFQ A;  3THW B;  4HUF A;  1KLN A;  4RG8 A;  4CHY A;  1ESV A;  3N4Q A;  3WQT A;  4EIA A;  3NHG A;  3CFP A;  4A57 A;  4BR2 A;  3G71 N;  3LDQ A;  3DXM A;  3ZX2 A;  4BRM A;  3DRS A;  2GWJ A;  3TAE A;  4YDU C;  4KHN A;  3F9K A;  4JS4 A;  4QS8 A;  4KTQ A;  2ZGZ A;  4A59 A;  4HTL A;  4BE2 A;  4C8L A;  4H8K A;  3O3H A;  4ISF A;  4GKK K;  4JI5 K;  1NOZ A;  3L6Q A;  1OH5 A;  1HR0 K;  5JVG L;  4CBU A;  1M90 O;  1VQ5 N;  4DFP A;  1ILY A;  3WXJ A;  4DFM A;  1NKE A;  3DXM B;  2NRH A;  1EWR A;  4CFA A;  1YIT N;  4DQP A;  3CCR N;  4DTJ A;  3AVA A;  4DTP A;  3TPQ A;  1HMV A;  3L4Q A;  3OA9 A;  3BF3 A;  3RMD A;  3G6E N;  4CJP A;  1J5O A;  2WC9 A;  1IV0 A;  1LW2 A;  3VPZ A;  2AJQ A;  3VQ7 A;  3ZSR A;  3BZK A;  3V1O A;  1UAX A;  4BRK A;  2KTQ A;  1CZB A;  3ZT3 A;  1NGB A;  4CEZ A;  2ZD1 A;  4DUZ K;  5EX5 A;  2PYL A;  1VSJ A;  1W2B M;  4CER A;  1NOY A;  2ITM A;  2WOM A;  4DR1 K;  3K9K A;  1N6Q A;  4QAG A;  3DLE A;  4H0P A;  3CIP A;  2PYJ A;  4LFC K;  4KAZ A;  3T3F A;  1DTT A;  4ZHR A;  1XNQ K;  4KKO A;  3SJH A;  3NCI A;  3THV A;  4AHR A;  1S1T A;  1QTM A;  1YUW A;  4W5O A;  3NF7 A;  2OZS A;  4B08 A;  5I9E B;  3CET A;  2V7Y A;  1HKG A;  3PX0 A;  3AGK A;  4B9Q A;  1XHZ A;  3RWU A;  4PA1 A;  4CHQ A;  2OPR A;  3EY1 A;  3K9J A;  1W9H A;  3LM9 A;  3SUN A;  3DM2 A;  3QML A;  1VSI A;  3FE1 A;  1KQS M;  1VQ9 N;  4M7X A;  4EP5 A;  3CJ7 A;  5KPR A;  4LF7 K;  1D5A A;  1TAQ A;  3D45 A;  1ASV A;  4FJG A;  1JLC A;  2FXU A;  4DU3 A;  1QQO A;  4FK4 A;  3J80 O;  5F2R A;  1Z6R A;  3MN7 A;  1YVU A;  1VQN N;  3D2E A;  1VQ6 N;  3LZI A;  5KPT A;  4KI4 A;  3SYZ A;  4CEC A;  1WLJ A;  3W3D A;  5C10 A;  3NGY A;  1HUX A;  3V9S A;  1SQK A;  2P9P A;  2KW4 A;  4M41 A;  1TYQ A;  4KHU A;  2XY8 A;  4FVU A;  3DI6 A;  3ID6 A;  4ILJ A;  4QS9 A;  4IOA L;  4KV8 A;  3D2E B;  5AQW A;  4ISE A;  4FWK A;  4CZE A;  4CZF A;  5AQO A;  2P9P B;  4CIE A;  3P5J A;  4PKH A;  1GLD G;  1UWB A;  3NH0 A;  1SL2 A;  4LF9 K;  4BR7 A;  3FGU A;  1ASU A;  3U6F A;  4C8K A;  4CHO A;  2P9I A;  1RDD A;  5C42 A;  3MN5 A;  4DWI A;  3P31 A;  3M6G A;  1X9S A;  4OPJ A;  1KAZ A;  3O9R A;  4LF5 K;  3THY A;  1RBR A;  4ILH A;  4I7F A;  2WFB A;  1QQM A;  3LAL A;  2IS3 A;  2P9I B;  3SAF A;  5JS1 A;  1N5Y A;  4B9V A;  4XH1 A;  1FJG K;  1VQ7 N;  4DTS A;  4JK7 A;  5GIP A;  3TTC A;  1L5U A;  3THY B;  4DKW A;  1Y97 A;  3RMA A;  1U45 A;  3RMB A;  4CVN E;  3SUO A;  4IOX A;  3CJ9 A;  4HWI A;  3T1Y K;  3TTD A;  4H5T A;  2WUS A;  3UKU A;  4YOW A;  2F7T A;  4OX9 K;  2VYP A;  3A0I X;  3ID8 A;  1BO5 O;  4CZI A;  4FM1 A;  3WXM B;  1E4F T;  3ZET A;  2D1K A;  3WEE A;  3SNN A;  1WAJ A;  1JL2 A;  3V9W A;  2IGI A;  2OZM A;  4BQZ A;  3AVN A;  4X66 K;  1HNX K;  3IDH A;  3HPO A;  2D4W A;  3OVN A;  3D2F A;  1VSM A;  1BI4 A;  5KGX A;  4AF1 A;  3AY9 A;  3TAM A;  3W0L A;  3NBP A;  4WQ5 C;  3VF6 A;  4CZK A;  4KHS A;  1BQN A;  4FM0 A;  4B9T A;  3T1H K;  3VER A;  4FWS A;  3AA5 X;  4JI7 K;  5DM6 L;  3D2F B;  3O4W A;  1SKR A;  4FJI A;  1KAX A;  1JLE A;  1BI4 B;  3CJ1 A;  2Q3S A;  3ULD A;  3OYC A;  2YHB A;  1N36 K;  5FPN A;  1VK0 A;  4I6M A;  4W5R A;  3K5M A;  4HCB A;  3MXJ A;  4FLZ A;  3CCE N;  5JVH L;  4WQ4 C;  4DB3 A;  1O13 A;  4H0Y B;  5AFU A;  5LMU K;  4IG0 A;  1RT4 A;  3E9O A;  4KHW A;  1DEJ A;  2IVO A;  3V9U A;  4I6M B;  3LAN A;  3R1X A;  3LP1 A;  4JRP A;  2W42 A;  4RW9 A;  5KQD A;  3FZM A;  3VF4 A;  1CXQ A;  2XY5 A;  5AQZ A;  4F8R A;  3K5N A;  3VQD A;  3ZLJ A;  1UA1 A;  1J9A A;  2FLO A;  4BGB A;  2ATQ A;  3PV8 A;  3Q7B A;  3WQU A;  3WXL A;  1YJ9 N;  4FO0 A;  1L3V A;  5ADX A;  4O8K A;  1LAW A;  4JKG A;  1C0U A;  2I5J A;  4IFE A;  3TU5 A;  3MEE A;  5AQN A;  1CLQ A;  1YTA A;  5EVZ A;  1BCO A;  1ZBF A;  4ILG B;  4LY7 A;  1NU0 A;  3VEO A;  2OYQ A;  3FZK A;  5AQX A;  3PO5 A;  4M7Y A;  3KLG A;  1Y64 A;  3HYF A;  2NNW A;  3RR7 A;  4PQU A;  1XWL A;  3H45 C;  4JKG B;  1HNW K;  3LP2 A;  5IT9 O;  3QFU A;  4YOY A;  1VQP N;  5LL6 Z;  1GLL O;  5CHI A;  2Z1H A;  1S9E A;  4Z4G A;  3I0R A;  3U8X A;  4DF8 A;  1Q9Y A;  3NFA A;  1NGI A;  2HB5 A;  4BVO A;  3DMJ A;  3MCA B;  5AQM A;  4FL9 A;  4CGG A;  1KD1 O;  2E1Z A;  2NRV A;  4OGE A;  4BRC A;  5GAH P;  3ZSX A;  1HNI A;  3M8R A;  1TGO A;  3HM9 A;  2KFZ A;  3ZSV A;  4JI2 K;  2E2P A;  1BGX T;  2KKZ A;  4H5V A;  2O4G A;  1Z26 A;  1RBV A;  3O6W A;  3LP0 A;  1T05 A;  1SZ2 A;  5M1F A;  3VQ4 A;  3VQE A;  3PSI A;  1VQL N;  2F96 A;  5CYM A;  1KFS A;  4XIU A;  3C6T A;  3HP6 A;  4ID1 A;  3L2Q A;  3OYN A;  3M3Z A;  1FKP A;  4RW7 A;  3J7Y P;  1C0F A;  4F2R A;  2ASP A;  1YVN A;  3QIN A;  1NK5 A;  4YOT A;  2ZJP L;  1KVA A;  4JRQ A;  3RRG A;  1X9M A;  5B8H A;  4OPA A;  1QSY A;  4J2B A;  3VEX A;  3KWI A;  1ZBU A;  4FWL A;  4JI6 K;  3MWT A;  4ICL A;  3CM5 A;  1HYS A;  3KLI A;  4M3U A;  4YOU A;  4CED A;  1VQ4 N;  4JI0 K;  4I2P A;  2VG6 A;  1JL1 A;  4BG8 A;  4J2D A;  3VTI A;  3SBT A;  2PBD A;  4HHT A;  3JYT A;  4DSJ A;  5HRP A;  2A41 A;  4IOC L;  1MU2 A;  3KK2 A;  4JD2 B;  2QKK A;  3HSC A;  1JCF A;  2QWL A;  4ID5 A;  4AHS A;  1D9F A;  1QSS A;  3L3V A;  1WUA A;  2YNG A;  1V4T A;  2BGG A;  3CQY A;  4E7K A;  2FBY A;  3L4I A;  2X6N A;  1SS6 A;  5MLC Q;  4J2A A;  4Y1D A;  1BIS A;  1HQE A;  4YFU A;  3RRH A;  4G9Z A;  3O5B A;  3WNG A;  2GUP A;  4JKA A;  2QM1 A;  4DV5 K;  4OGC A;  2LSN A;  1TKD A;  1NNE A;  2DPN A;  5M1O A;  3E9L A;  4CEA A;  3VF2 A;  2YKN A;  3FZH A;  1N33 K;  4E1M A;  1TKZ A;  5M1Q A;  2IAJ A;  1S1U A;  2UYT A;  4DR3 K;  4M3Z A;  1NK9 A;  3GOI A;  5J2M A;  1X9W A;  3OYG A;  1U4B A;  3OYM A;  1FKO A;  3HVR A;  3VQ5 A;  5FRM A;  3EE8 A;  1YI2 N;  4CGI A;  4DR7 K;  2V7Z A;  1TUY A;  2NZT A;  3QIO A;  2HBJ A;  3OYF A;  4YDU A;  2GWK A;  4CW7 B;  5EOY A;  3S3N A;  2EX3 A;  4DV7 K;  5EY4 A;  4JS5 A;  5HRR A;  2IDO A;  1NJX A;  3TSQ A;  5KRS A;  1YF5 L;  4A62 A;  2G8U A;  1W97 L;  4B1Z A;  3R9P A;  3FR0 A;  3HTV A;  4H03 B;  4B8A B;  5HL7 L;  3VGM A;  2CGJ A;  4AQY K;  4F4K A;  3G4S N;  2YX6 A;  5AQU A;  3L2U A;  4CJQ A;  4CE9 A;  4BR5 A;  1GOC A;  3OS1 A;  3G25 A;  4B3R K;  4CF2 A;  1QE1 A;  2AP1 A;  4MDB A;  4N5S A;  2NRZ A;  4B1V A;  1P8Z A;  4KBO A;  3HXM A;  3JS6 A;  3MXM A;  4IWV A;  4IFV A;  4JV5 K;  2GV9 A;  4PL8 A;  1QZ5 A;  3IG1 A;  3IRX A;  5ELZ A;  5AQL A;  2ZM6 K;  2KFN A;  2PFU A;  3DYA A;  2DTU A;  4C8M A;  4BRE A;  2HHU A;  2G8V A;  1C0T A;  1NWK A;  2G8I A;  1NGG A;  4MLE A;  1ZXO A;  1WOQ A;  4CGH A;  2IVN A;  3SK3 A;  3KTQ A;  2V52 B;  3IAY A;  1VSF A;  5BRD A;  1Q9X A;  2O8B A;  3ZSY A;  5DK5 A;  3HOT A;  3MDQ A;  2OTL N;  3SUP A;  2GEL A;  3ULE A;  3DXK B;  3AA3 A;  5E26 A;  3SZ2 A;  4JKD A;  3KK3 A;  3EE9 A;  3OTO K;  1JLA A;  1S22 A;  4MDA A;  4ELT A;  1EO1 A;  4BDY A;  2O8B B;  4DQI A;  1NK0 A;  3O3F A;  4F9O A;  1ATN A;  2ASM A;  3LAK A;  4IG3 A;  3AAP A;  4BE1 A;  3HRG A;  3PO4 A;  4JKF A;  4GNI A;  3ULE B;  3TAN A;  3R3L A;  4FJX A;  4K8X A;  4IDK A;  4F3O A;  2ZE2 A;  3AGR A;  3OYL A;  4LF6 K;  4OKK A;  4DLE A;  5AZI B;  2HNY A;  1RDW X;  2D0A A;  2P1J A;  4V19 S;  5SZT A;  2JWL A;  3NH2 A;  4FOE A;  2Z1G A;  3VET A;  4BR0 A;  1T03 A;  1S5J A;  2FSN A;  5KQ8 A;  4CFB A;  4BRA A;  3KK1 A;  4CFC A;  3NF9 A;  3WNF A;  5HOO A;  1W0H A;  4DUY K;  3MCP A;  3PSF A;  4MO4 A;  4M3R A;  2F9W A;  5T7B A;  1IBL K;  2DFE A;  3P4I A;  5CZ1 A;  3CPE A;  3CD6 N;  1A5W A;  2E88 A;  4YOR A;  3I56 N;  4OPK A;  1JLF A;  4NXM K;  4F2S A;  5AQG A;  3CHW A;  3M1F A;  1VSH A;  4HUG A;  2BDP A;  3C6A A;  1RT2 A;  3TAQ A;  3NVM A;  1HYZ A;  3IFR A;  1KLM A;  4U67 L;  2PAV A;  3BZC A;  5AQT A;  2E20 A;  4U7B A;  3SUQ A;  1NK4 A;  1TUU A;  1RIL A;  3VMF B;  4M42 A;  4RTF D; 
#chains in the Genus database with same CATH homology
 1XHX A;  3TAR A;  2ZQB A;  2JGU A;  3HVT A;  3QIP A;  1L5U A;  1Y97 A;  4OJR A;  4R5P A;  3RMA A;  3VQ8 A;  4DQQ A;  1LWF A;  3RMB A;  1RBS A;  1KTQ A;  3NDK A;  1ZBH A;  3C94 A;  3SUO A;  3PX4 A;  2F8S A;  1RTJ A;  5KTQ A;  3M8P A;  1I3A A;  4CK2 A;  4OLB A;  2YNI A;  1WSJ A;  1TL1 A;  2IC3 A;  3V4I A;  3AA4 A;  1IH7 A;  1CZ9 A;  3MEG A;  2X74 A;  2YNF A;  3K5O A;  2WON A;  3PUF A;  1ITG A;  4FW1 A;  2G8H A;  3QES A;  2DY4 A;  3A2F A;  3VN5 A;  4EP4 A;  3KJV A;  3AVI A;  3SV3 A;  4FM1 A;  5EU7 A;  3QNN A;  5HRN A;  4EZ6 A;  3SJJ A;  1EP4 A;  1B9D A;  1IKW A;  1FXX A;  4KHQ A;  4G1Q A;  4I9Q A;  2Z1I A;  4FJN A;  3V9Z A;  4FLW A;  3V9X A;  4J2E A;  3SNN A;  1WAJ A;  4M3X A;  1JL2 A;  4F3T A;  3V9W A;  2IGI A;  3K2P A;  2OZM A;  3TAF A;  3AO4 A;  4AHT A;  3AVN A;  4BAC A;  3DLH A;  3QER A;  1TKX A;  4DTU A;  3OJU A;  1RDC A;  2P5O A;  1NK7 A;  3VQB A;  3HPO A;  5HRS A;  3OVN A;  3AO5 A;  1RDA A;  2VG7 A;  1VSM A;  1BI4 A;  1RBT A;  3K5L A;  5KGX A;  4FZY A;  4NCA A;  2JLE A;  3K57 A;  4YNQ A;  3TAM A;  4UQG A;  4DLG A;  1NK8 A;  4N56 A;  3NBP A;  1JLQ A;  3NGZ A;  3NH1 A;  4KHS A;  3MXI A;  1BQN A;  4FM0 A;  4B9T A;  2OPP A;  3QET A;  4KRE A;  4CJK A;  4CJU A;  4DQR A;  2YKM A;  3AA5 X;  1JLG A;  3OYK A;  1T7P A;  3KD1 E;  5E41 A;  1SKR A;  4FJI A;  3DOL A;  1JLE A;  1BI4 B;  4KFB A;  2Q3S A;  3AVK A;  3LAM A;  3OYC A;  2YHB A;  3ULD A;  4CF8 A;  1D8Y A;  3EZ5 A;  3QLH A;  1VK0 A;  4O5B A;  1F21 A;  3KLF A;  4DSF A;  1IG9 A;  2EHG A;  4N47 A;  3H08 A;  3MED A;  4CIG A;  4W5R A;  4C8O A;  3LWM A;  3K5M A;  4HCB A;  2HHX A;  3MXJ A;  4ZTJ A;  4FLZ A;  3CYM A;  3HPH A;  3VQ9 A;  2FBX A;  3B6O A;  3DLR A;  4E0D A;  3QEW A;  4IG0 A;  1RT4 A;  1BIZ A;  5J2Q A;  4KHW A;  4CJR A;  3V9U A;  2HHT A;  2Z1J A;  3T19 A;  2XY7 A;  3OJS A;  5J2N A;  3QEV A;  3O4N A;  4FZZ A;  3HK2 A;  3LAN A;  2D5R A;  3LP1 A;  4JRP A;  4B8C A;  2W42 A;  4RW9 A;  3T1A A;  4DTM A;  3QEI A;  1BHL A;  1IKY A;  3ZT4 A;  1CXQ A;  4CEO A;  2XY5 A;  1JXE A;  3K5N A;  3VQD A;  1XI1 A;  4F8R A;  1UA1 A;  5K14 A;  1J9A A;  4CIF A;  2F8T A;  1RDB A;  4AHV A;  1U49 A;  1VSE A;  2ATQ A;  3OYI A;  4E7I A;  3PV8 A;  1NKB A;  2HMI A;  1L3V A;  4CEF A;  1C1C A;  1U48 A;  1LAW A;  1S1W A;  1IKV A;  1RT1 A;  3KKR A;  1C0U A;  2I5J A;  1HQU A;  3MEE A;  3V1Q A;  1CLQ A;  1YTA A;  1BCO A;  1ZBF A;  1Z25 A;  3SPY A;  4LY7 A;  1IO2 A;  4CF1 A;  4DMN A;  3OS0 A;  2E6L A;  3SQ2 A;  2OYQ A;  4FLX A;  5HP1 A;  2HVI A;  3PO5 A;  2B6A A;  3AVB A;  4CGJ A;  1TL3 A;  5CY4 A;  4W5Q A;  4Z4C A;  3KLG A;  3HYF A;  1TK8 A;  1KSP A;  3RR7 A;  1LWC A;  2GBZ A;  4M3T A;  4PQU A;  3QNO A;  1XWL A;  1S6Q A;  4ZTF A;  3DLG A;  5CZ2 A;  3VA3 A;  3L2V A;  3TI0 A;  2D0C A;  4O0J A;  3LP2 A;  1SKS A;  1RTD A;  4EZ9 A;  1S1X A;  1RTH A;  4B9L A;  1QSL A;  3OYB A;  2Z1H A;  1S9E A;  4Z4G A;  1ZBL A;  3AVM A;  3D0P A;  4FLU A;  2P5G A;  1HPZ A;  4O0I A;  3AVC A;  3I0R A;  4I2Q A;  1NJW A;  4DF8 A;  3C6U A;  1HNV A;  1HJR A;  1EKE A;  1RNH A;  4CEB A;  4CK3 A;  1Q9Y A;  3KD5 E;  4CJ5 A;  4FCY A;  3NFA A;  1GOA A;  5FDL A;  3OS2 A;  1S1V A;  2HB5 A;  3TAP A;  3DMJ A;  4H4M A;  3NGI A;  1L3S A;  1IKX A;  3L3U A;  4CGG A;  2GUI A;  3AVH A;  1BL3 A;  4OGE A;  3PX6 A;  3ZSX A;  2HHW A;  1HNI A;  3M8R A;  4FK0 A;  4BDP A;  3ZSO A;  1YTU A;  1VRT A;  1TGO A;  4PUO A;  3HM9 A;  4DU4 A;  3ZSV A;  3I0S A;  3LP3 A;  4FJ5 A;  4Z0U A;  1D9D A;  4KHY A;  1BGX T;  4KTW A;  4DS4 A;  1DLO A;  1LWE A;  1Z26 A;  2O4G A;  3OY9 A;  3KLE A;  4Q0B A;  1RBV A;  3MAQ A;  1LV5 A;  2HHV A;  4CES A;  3LP0 A;  3AA2 A;  4E7L A;  1KRP A;  1VSL A;  1T05 A;  4AHC A;  3F73 A;  3SV4 A;  1RT5 A;  3VQ4 A;  5DMR A;  4K8Z A;  5D3G A;  3VQE A;  3V6D A;  2F96 A;  3HPG A;  2X78 A;  5J2P A;  4W5T A;  3S9H A;  1U47 A;  1SKW A;  3L8B A;  1O1W A;  4LSN A;  2RN2 A;  3G0Z A;  5CYM A;  2ITG A;  1S9G A;  2R7Y A;  1U45 A;  1KFS A;  3PY8 A;  4NCB A;  3AV9 A;  4XIU A;  4FK2 A;  4E3S A;  3ZSZ A;  1RT7 A;  3O4Q A;  4W5N A;  3C6T A;  2E6M A;  1TKT A;  4NCG A;  4Q5V A;  3SQ4 A;  4QCL A;  5JS2 A;  2Y1J A;  2X6S A;  3HP6 A;  1U04 A;  4ID1 A;  4CGD A;  3OYN A;  3L2Q A;  3SPZ A;  1FKP A;  4RW7 A;  2G8K A;  3RR8 A;  1TAU A;  4FJ7 A;  4F2R A;  3L2W A;  5HBM A;  3QIN A;  1NK5 A;  3CG7 A;  3LPT A;  3HJF A;  2FC0 A;  4HUE A;  1KVA A;  3CM6 A;  4KI6 A;  4DFJ A;  1VSK A;  4JRQ A;  3RRG A;  2XO7 A;  1X9M A;  3TWH A;  1WNS A;  2YV0 X;  2G8F A;  1BIU A;  1QSY A;  3I8D A;  4J2B A;  4IBN A;  4B9N A;  2IOC A;  3HP9 A;  1ZBU A;  4BWM A;  3VQC A;  4CGF A;  2XRI A;  1A5X A;  4ICL A;  4RW8 A;  4PWD A;  4CJE A;  4M45 A;  3CM5 A;  1HYS A;  3KLI A;  3VQP A;  1QHT A;  4LH5 A;  4M3U A;  4CED A;  3ALY A;  4FJH A;  4FJK A;  3HST B;  4I2P A;  4OKE A;  3LWL A;  3K59 A;  3ASM A;  2HW3 A;  2VG6 A;  1JL1 A;  4J2D A;  2KZM A;  3SQ1 A;  4CJ3 A;  4HHT A;  3JYT A;  3CFR A;  2O4I A;  1K6Y A;  4I9L A;  3QEP A;  4FM2 A;  4B9U A;  1LW0 A;  5HRP A;  4DSJ A;  3HO1 A;  2VWJ A;  2D0B A;  1MU2 A;  1CXU A;  4ELU A;  1EXQ A;  3KK2 A;  4OLA A;  4DSK A;  2QKK A;  2HHS A;  4CHP A;  3OYH A;  4AHS A;  4ID5 A;  1D9F A;  3G10 A;  1QSS A;  1WSI A;  3L3V A;  4FW2 A;  4AIL C;  4CF0 A;  1BCM A;  2YNG A;  3TR8 A;  5SWM A;  4B9S A;  4FJ9 A;  1EX4 A;  3VQQ A;  2BGG A;  5KRT A;  1RTI A;  3OYA A;  4E7K A;  2FBY A;  2FBT A;  2X6N A;  1UA0 A;  3QEX A;  4J2A A;  4Y1D A;  5KI6 A;  1BIS A;  2G8W A;  1HQE A;  4YFU A;  2OPS A;  3M8S A;  3RRH A;  4DSI A;  2ETJ A;  4AHU A;  5I42 A;  3EYZ A;  3KLH A;  2B5J A;  1HRH A;  4CJS A;  5HLF A;  2HND A;  4CCH A;  3WNG A;  3S3M A;  4E1N A;  4CEE A;  4CJF A;  1QQC A;  3HL8 A;  4E19 A;  3VQA A;  3AVJ A;  2FBV A;  4OGC A;  2LSN A;  4HVJ A;  1TKD A;  4LD0 A;  4CF9 A;  4GVM A;  1C6V A;  4CEA A;  2YKN A;  2QXF A;  4HTU A;  3BGR A;  4E1M A;  3KIO A;  1C0M A;  5CYQ A;  1TKZ A;  4O55 A;  3UIQ A;  1G15 A;  2IAJ A;  3DOK A;  1S1U A;  4JLH A;  1YT3 A;  3OYD A;  4HUF A;  1KLN A;  4M3Z A;  4QOZ B;  3B6P A;  4DG1 A;  1NK9 A;  4RG8 A;  4CHY A;  1XC9 A;  5J2M A;  1X9W A;  4N41 A;  3OYG A;  3NHG A;  4M3Y A;  1WSF A;  3OYM A;  1U4B A;  1ZYQ A;  1FKO A;  3CFP A;  3HVR A;  3VQ5 A;  4CEQ A;  4KPY A;  5FRM A;  4CGI A;  4TSX A;  4LH4 A;  3QIO A;  4FXD A;  4KRF A;  3OYF A;  1SL0 A;  1C1B A;  3V1R A;  3DRS A;  3TAE A;  4KHN A;  3F9K A;  3S3N A;  3SI6 A;  4JS4 A;  1RCH A;  2EX3 A;  1KFD A;  3ISN C;  4CHZ A;  2PZS A;  4KTQ A;  3JSM A;  1ASW A;  4BE2 A;  3QO9 A;  4H8K A;  2Y1I A;  4C8L A;  4DSL A;  3O3H A;  4FJL A;  2PY5 A;  1WSH A;  4JS5 A;  1NOZ A;  5HRR A;  4E7J A;  2IDO A;  1NJX A;  4NYF A;  4DFP A;  2KZZ A;  1RT3 A;  4DFM A;  1NKE A;  4LSL A;  4CFA A;  5KRS A;  1J53 A;  4C8N A;  2G8U A;  4DQP A;  4DTJ A;  1RT6 A;  4Z4F A;  4PY5 A;  4KB0 A;  3AVA A;  4DFK A;  4DTP A;  1TV6 A;  4DS5 A;  4B8A B;  4F4K A;  2XHB A;  1NJY A;  1HMV A;  4AH9 A;  1FK9 A;  5FRN A;  2HHQ A;  3CFO A;  3AVL A;  1A5V A;  3L2U A;  3C95 A;  4CJQ A;  4CE9 A;  3RMD A;  4HCC A;  4CJP A;  1GOC A;  3OYJ A;  3OS1 A;  1J5O A;  3RTV A;  4DTX A;  1LW2 A;  4KTZ A;  3S3O A;  2AJQ A;  3VQ7 A;  3LDS A;  4CF2 A;  3ZSR A;  1QE1 A;  2RPI A;  4BDZ A;  3V1O A;  1UAX A;  3ZT1 A;  1RBU A;  1J54 A;  2KTQ A;  1CZB A;  3ZT3 A;  1L3U A;  3P1G A;  4CEZ A;  1WN7 A;  4N5S A;  4DSE A;  3WNH A;  1SV5 A;  2ZD1 A;  4RW4 A;  2PYL A;  1VSJ A;  4O4G A;  3HXM A;  3MXM A;  4CER A;  1NOY A;  4IFV A;  2WOM A;  3AVF A;  2GV9 A;  1N6Q A;  4QAG A;  3ZSQ A;  3DLE A;  3IG1 A;  1SL1 A;  2PYJ A;  3IRX A;  4KAZ A;  3T3F A;  1DTT A;  4CJL A;  4ZHR A;  2KFN A;  2KFZ A;  4H4O A;  4FVM A;  3DYA A;  4KKO A;  2DTU A;  1KVC A;  4C8M A;  2YHA A;  1DTQ A;  4O44 A;  3NCI A;  3THV A;  2HHU A;  4AHR A;  2G8V A;  1S1T A;  1C0T A;  3NE6 A;  1QTM A;  4CJW A;  2G8I A;  3TAG A;  3NF8 A;  3NF7 A;  4W5O A;  3V81 A;  1L3T A;  2OZS A;  2HNZ A;  3ZT2 A;  3MEC A;  4B08 A;  2XY6 A;  3VA0 A;  4CGH A;  3NF6 A;  1UOC A;  3IS9 A;  1VRU A;  2VWK A;  3KTQ A;  3PX0 A;  3E01 A;  4DU1 A;  3IAY A;  1ZBI A;  1XHZ A;  1VSF A;  3RWU A;  2VG5 A;  5FRO A;  3U3G A;  1Q9X A;  3ZSY A;  1JXB A;  1S6P A;  5DK5 A;  4PA1 A;  2E4L A;  1R0A A;  4CHQ A;  2QK9 A;  4B9M A;  2OPR A;  3EY1 A;  3SUP A;  1W9H A;  3HT3 A;  1HYV A;  2HVH A;  3SUN A;  3SCX A;  1Q8I A;  3DM2 A;  1VSI A;  3AA3 A;  1NK6 A;  4MQ3 A;  3SZ2 A;  1TK0 A;  2YNH A;  3KK3 A;  4IFY A;  1B92 A;  4CJT A;  1JLA A;  1EET A;  4CK1 A;  2OPQ A;  4ELT A;  4EP5 A;  5J1E A;  4BDY A;  3BDP A;  1I39 A;  1VSD A;  3NAE A;  4DTN A;  1T8E A;  3O3G A;  4DQI A;  1NK0 A;  3O3F A;  1LAV A;  4BE1 A;  3LAK A;  4IG3 A;  4RW6 A;  5C24 A;  3LZJ A;  4FLT A;  1D5A A;  1TAQ A;  3D45 A;  1ASV A;  4FJG A;  3PO4 A;  1JLC A;  3AVG A;  2QKB A;  4DU3 A;  3TAN A;  4FJM A;  2P51 A;  4FJX A;  3LPU A;  4E7H A;  3RMC A;  4K8X A;  4IDK A;  4NYN A;  4E89 A;  4F3O A;  4FK4 A;  2ZE2 A;  2DFH A;  3WNE A;  3OYL A;  1YVU A;  3LZI A;  1JLB A;  4OKK A;  4KI4 A;  1TVR A;  2B4J A;  3SYZ A;  4CEC A;  4DLE A;  1WLJ A;  3M8Q A;  2HNY A;  4B3O A;  4BE0 A;  3NGY A;  2D0A A;  2P1J A;  1KCF A;  1WAF A;  1SUQ A;  3CQ8 A;  3V9S A;  5SZT A;  2KW4 A;  4M41 A;  4FYD A;  4Y1C A;  4OKJ A;  3AO2 A;  3NH2 A;  4KHU A;  4ELV A;  2NUB A;  2XY8 A;  3U3Y A;  4KB1 A;  1B9F A;  4GMJ B;  2A1S A;  2Z1G A;  5I3U A;  2RKI A;  3ZT0 A;  1T03 A;  1X1P A;  1S5J A;  4L8R B;  3DI6 A;  4M3W A;  1JKH A;  4CFB A;  4CFD A;  3DRP A;  4KV8 A;  3KK1 A;  1GOB A;  4CFC A;  5HRO A;  1TK5 A;  4Z4I A;  2BAN A;  3NF9 A;  4FJJ A;  4BWJ A;  2A1R A;  3WNF A;  3AO1 A;  5C25 A;  1W0H A;  4WE1 A;  3DLB A;  3AO3 A;  3SQ0 A;  4CIE A;  4Z4H A;  3P5J A;  4M3R A;  1UWB A;  4FZX C;  4Z4E A;  5T7B A;  3KKS A;  3VQ6 A;  3NH0 A;  1SL2 A;  2DFE A;  5KGW A;  4DTR A;  5CZ1 A;  1REV A;  1ASU A;  2DFF A;  3U6F A;  1A5W A;  2KQ2 A;  1WSE A;  4KO0 A;  4FLV A;  4C8K A;  4OPK A;  1JLF A;  3ZCM A;  4CHO A;  2OA8 A;  4F2S A;  1RDD A;  5C42 A;  4N76 A;  4DWI A;  3OYE A;  1X9S A;  4OPJ A;  1VSH A;  3DRR A;  4CHN A;  4HUG A;  1C1A A;  2BE2 A;  4DTO A;  1WSG A;  4OVL A;  4GW6 A;  3K58 A;  4DQS A;  4IKF A;  2RF2 A;  2BDP A;  1RT2 A;  4CJV A;  3TAB A;  3TAQ A;  4FLY A;  1RBR A;  3DLK A;  3FFI A;  1HYZ A;  4CJ4 A;  1BQM A;  3ZSW A;  1KVB A;  4I7F A;  1KLM A;  4FJ8 A;  3P83 D;  1NKC A;  4MFB A;  3LAL A;  1QS4 A;  3L2R A;  2IS3 A;  4DF4 A;  5JS1 A;  1N5Y A;  4B9V A;  3SUQ A;  1NK4 A;  1RIL A;  3ITH A;  1NJZ A;  4M42 A;  4DTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...