4OJRA

Crystal structure of the hiv-1 integrase catalytic domain with gsk1264
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
131
Chain Sequence
PGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Inhibition of Human Immunodeficiency Virus Integrase: LATE BLOCK DURING VIRAL REPLICATION AND ABNORMAL MULTIMERIZATION INVOLVING SPECIFIC PROTEIN DOMAINS.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords HIV-1 Integrase
total genus 50
structure length 131
sequence length 150
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ojrA00
1REVA 4OLBA 4CK1A 2IS3A 2YNHA 4M3WA 3THVA 4O44A 3HP6A 1HNIA 4KHQA 1JXEA 2KTQA 4KI4A 4LH4A 5J2QA 1WAFA 3AVAA 4KHUA 3PUFA 1C0MA 4C8NA 4CCHA 1S6QA 3D45A 1TAQA 5KGXA 1RDBA 1UA0A 1DTTA 3V1RA 3DLKA 3WNHA 2OPSA 4FJ9A 3TANA 3V9XA 1JLGA 5KTQA 1HYSA 2HNYA 1FKPA 4H4OA 4B9MA 4FJXA 4M3YA 3IG1A 3AVKA 1RTHA 3TR8A 1RDDA 1EXQA 1IG9A 1NOYA 3DLRA 3M8SA 4O4GA 1TL1A 1Z26A 4H4MA 4EP4A 2YKMA 1RT3A 3KJVA 5HRRA 3OJUA 3F9KA 2RN2A 1KVBA 1UWBA 3WNEA 3AA2A 4CJUA 2HHWA 3VQ8A 4BWJA 1J53A 4CIEA 3V9SA 1NK7A 3OYIA 3CYMA 3SQ1A 3PX4A 3ZT1A 4BE1A 3AO3A 1QHTA 2XHBA 1RT5A 4OVLA 1KRPA 1BI4B 4HVJA 3KD1E 4I2PA 3JSMA 2Q3SA 4E7HA 4J2EA 3AVBA 1VRTA 4RW6A 1LAVA 1MU2A 4DTSA 1C1CA 3NF8A 4Y1CA 4FJMA 4OGCA 4QAGA 3VQ5A 3OYLA 1C1BA 3RMAA 4B9UA 4DU4A 5JS1A 3KIOA 3B6OA 1UOCA 3L2RA 1FKOA 1Y97A 1KFDA 3VQ9A 5C42A 2OPPA 2R7YA 1C0UA 1HYZA 3OYNA 3OYJA 3LDSA 3ZSWA 3AVFA 2G8VA 4F2RA 4M3TA 3WNGA 2DY4A 1KLMA 4CJ4A 3LP3A 4FJLA 2QKBA 3DYAA 4F8RA 1IKXA 4E7KA 2HMIA 4Z4FA 1S5JA 1R0AA 3DLBA 2IGIA 4RW7A 2FBXA 3AO2A 1IKVA 4DLEA 3QEXA 2DTUA 2YHAA 3AO4A 3QINA 4ID1A 3LP0A 4E0DA 3G0ZA 1XWLA 1IO2A 1YT3A 3VQ6A 4BE2A 1DLOA 1CZ9A 1UA1A 1QQCA 3DRPA 4CHYA 3KK2A 4QOZB 2XY5A 2KQ2A 4CFAA 2GV9A 3H08A 3NAEA 1UAXA 1HRHA 4RW8A 1RNHA 2GUIA 1D8YA 4KTQA 1KCFA 1W0HA 3K5NA 3U3GA 2NUBA 4HHTA 1N5YA 2ATQA 1BI4A 1JLBA 4BDZA 1GOAA 1VSHA 5I3UA 3NF7A 4CJVA 1NJXA 4FK0A 4PUOA 1NKCA 4AHCA 1VSJA 3RMBA 1LWFA 3QERA 1WLJA 3HVTA 3RWUA 5FRMA 2VWKA 1B9DA 4EP5A 4CEEA 3OYFA 3DI6A 1L3TA 2KFNA 1HPZA 1CZBA 3DRSA 1BCMA 2HB5A 1A5VA 3HVRA 4JS4A 1S1WA 3SJJA 1NK4A 4NYFA 1WNSA 4IFYA 3VQEA 3EZ5A 4G1QA 4O0IA 4JRQA 1TV6A 4MQ3A 3ZT2A 3HPHA 1HNVA 3NGZA 3HPOA 1JXBA 1BL3A 3KKSA 2YNIA 3ITHA 4DSKA 4E7LA 2BGGA 4FXDA 3G10A 1LW0A 2RF2A 4CE9A 4E1MA 1RBTA 3C6UA 4LSLA 4C8MA 5CYQA 3DOKA 1RDAA 1IH7A 1RTJA 2ZQBA 5SZTA 3LAKA 1SL0A 4CEZA 1J9AA 3C6TA 3HM9A 4FLWA 1ASUA 4I9LA 3TWHA 2Z1HA 4Z0UA 4DQQA 2VG7A 2D0AA 3QIPA 1VSDA 4JLHA 3ZSRA 3I0SA 3L2WA 1X9MA 2F96A 4CESA 3EY1A 4IKFA 3B6PA 2HHSA 2HHXA 4DTJA 1EETA 3NFAA 4DMNA 4KB1A 1HYVA 4NYNA 4CGHA 4M3UA 3OYBA 4NCBA 2D0CA 3AA3A 2DFFA 4FW2A 1TK8A 1TVRA 3QEWA 2OPRA 1NJYA 1JKHA 2XRIA 1RCHA 3AVLA 5J1EA 1NOZA 4TSXA 4C8OA 3S3OA 4CFCA 4CJEA 3O3FA 5C25A 3MAQA 2YNGA 3PX0A 4DTRA 1TK0A 3SV4A 2OA8A 3AVGA 2RPIA 4O55A 1ZBLA 3QIOA 5HLFA 3TAGA 4B9SA 1S6PA 4CFDA 2FBTA 3ZT0A 3TAEA 4FVMA 1TKZA 4RW9A 3OY9A 4NCAA 3VA0A 3VQ4A 2G8IA 4CIFA 3V6DA 2OYQA 5I42A 4I7FA 3M8PA 3K58A 1ASVA 4AILC 3HYFA 3VQBA 3V9UA 4CHNA 2QK9A 4FJKA 3KTQA 1XC9A 1CXUA 3CFRA 4N47A 4N41A 1VSEA 3ASMA 3SPZA 4ZTJA 4FZZA 3LP2A 1KVCA 2HVHA 4H8KA 4OLAA 3HPGA 5DMRA 2BE2A 1N6QA 4FYDA 3M8QA 5J2PA 5HBMA 1RBRA 3F73A 2EX3A 1U45A 1A5WA 4XIUA 2Z1IA 2BDPA 1LW2A 2XY8A 2G8WA 4CJKA 4PWDA 5HRNA 3P83D 3PO5A 4FZXC 2HW3A 3T3FA 1RTDA 3O3HA 4I2QA 4CFBA 4FLUA 4DU1A 3PY8A 3ZSQA 3V1QA 3OYGA 3LAMA 4CF9A 3RMCA 5HROA 4K8ZA 3K59A 1VSLA 3V9ZA 3RMDA 4CF8A 3SI6A 1B92A 3NH2A 4CIGA 3OYEA 3VQPA 3OJSA 3S3MA 1NJZA 4KREA 4DWIA 1Q9XA 3QO9A 3KLEA 3OYAA 4QCLA 3D0PA 3P5JA 4FK2A 3O3GA 4Z4GA 3MECA 3LZIA 4FLYA 4FLXA 3VA3A 3ZSVA 3AO1A 4AHRA 1I39A 4B8CA 4M3ZA 2XY7A 1T8EA 2IAJA 1L3UA 1KLNA 3ZT4A 5HRSA 4DTXA 4CJRA 1J5OA 2E4LA 2OPQA 2HHQA 1FK9A 4DTUA 3CM6A 1VSMA 3AVIA 4F2SA 1S9GA 3NH1A 1BQMA 1D9FA 5E41A 3SQ0A 1ZBFA 4UQGA 4DFMA 4F3TA 4CEFA 3T19A 1HQUA 3C94A 4CECA 4E7IA 1ZYQA 4B8AB 3TAMA 1HQEA 1LWCA 2YNFA 4DF8A 2HHVA 4BDPA 2G8KA 3CM5A 2B6AA 4DQSA 3AVHA 4DTMA 3ZT3A 3A2FA 3SUPA 1VRUA 2G8UA 2EHGA 3FFIA 4M3RA 1S1TA 4FM2A 5CYMA 1JL1A 1Q9YA 2O4IA 1JL2A 1TGOA 4NCGA 2X6NA 3OS2A 4OKKA 4Q5VA 3KLFA 5KI6A 4E7JA 1SL2A 3DLGA 4FJ5A 1TKXA 1LV5A 1DTQA 1XHZA 1WSGA 1VSIA 3BGRA 4AHVA 4J2AA 2IC3A 5KGWA 3WNFA 3NF9A 3I8DA 1U04A 3KLIA 3P1GA 4DTOA 3TAPA 2PYLA 4F3OA 1CXQA 4M41A 4AHUA 4O0JA 1U4BA 1ZBIA 4IDKA 4KTZA 1HJRA 1SKRA 4FW1A 3OS0A 1RT2A 3NF6A 4GVMA 2XY6A 4HUGA 4CGDA 2DFHA 1TK5A 4GW6A 4FK4A 3OYCA 2G8HA 3NHGA 3TABA 1B9FA 4FLVA 1RTIA 3HP9A 1TKDA 4I9QA 3TI0A 4CGJA 2OZMA 1NJWA 3NDKA 3ZSYA 3DMJA 4ICLA 3U3YA 1EX4A 1KTQA 1K6YA 4GMJB 1L3SA 4RW4A 4CK2A 2PYJA 3PV8A 4KRFA 4RG8A 1I3AA 4O5BA 4E89A 4DU3A 3LPUA 2PZSA 4OKJA 2B4JA 2WONA 4ELVA 4W5OA 1QSLA 2F8TA 3RTVA 4J2DA 4AH9A 5J2NA 3PO4A 3VQCA 2ETJA 1TL3A 3KLHA 4KO0A 3NGYA 4IBNA 4DSFA 4KB0A 4CEDA 1O1WA 3SQ4A 3KK1A 4DS4A 3V9WA 2AJQA 3LALA 4CJSA 4DSEA 4DFJA 1XHXA 2DFEA 1NK6A 1SKWA 4OKEA 4N56A 4FJ7A 3K5MA 1VK0A 4CEQA 3V1OA 1BQNA 4CGGA 3SQ2A 4PA1A 2FBYA 1JLCA 4FLTA 2Y1IA 4OJRA 3SNNA 3AVJA 4KHYA 4ID5A 4CF0A 3LP1A 4DQIA 3L8BA 1QSYA 1JLQA 4MFBA 4OGEA 4CJLA 4FCYA 5J2MA 5D3GA 1SV5A 1VSFA 1YTAA 3QESA 3EYZA 2D5RA 1EKEA 2IOCA 4R5PA 4DS5A 3CG7A 3VQAA 1L5UA 2B5JA 3LANA 3AO5A 1YTUA 3NCIA 3I0RA 4CJTA 3K2PA 3MEDA 4Z4EA 2ZE2A 3L2QA 3ZSOA 3V4IA 5KRTA 3K5LA 2RKIA 4DFPA 1KVAA 5C24A 1QS4A 1SUQA 5DK5A 4YNQA 1S1XA 4OPJA 3TARA 3IAYA 4KPYA 1FXXA 4B08A 4KFBA 1ZBUA 3QEVA 4HTUA 4KHSA 4B3OA 2P5GA 1U47A 2HHUA 4W5TA 3VQDA 1IKWA 4DSIA 4M3XA 4KV8A 1QE1A 2KFZA 3QEPA 1WAJA 4KTWA 3KLGA 2BANA 4N5SA 3SUOA 4F4KA 4CHQA 2YKNA 4DG1A 2ITGA 3ULDA 4CF1A 1YVUA 4FJGA 4L8RB 4FJIA 3LWMA 3IS9A 3O4QA 2Z1JA 5CZ2A 4HCCA 1RBUA 4FJJA 4FJHA 4KHWA 4AHSA 4DTNA 1JLEA 2FBVA 2LSNA 1ZBHA 1WSEA 1RBVA 2KW4A 2QXFA 3U6FA 1WSJA 3DLEA 3NBPA 4BE0A 3SUQA 4CJPA 2QKKA 3SPYA 1IKYA 3HSTB 3ZSXA 3JYTA 2X6SA 2A1RA 3OYKA 3MEEA 3PX6A 4CHPA 5SWMA 3VN5A 3KD5E 2Y1JA 2E6LA 4CEOA 3RR8A 2HNDA 3L2VA 3S3NA 4YFUA 4FM0A 1D9DA 4W5RA 4OPKA 3MEGA 5CZ1A 1QTMA 1C6VA 1U49A 4EZ6A 3OYMA 4CF2A 1SKSA 4Y1DA 4E19A 1D5AA 3L3UA 1T05A 3HO1A 4CGIA 4BACA 4WE1A 3OYDA 3K57A 5HP1A 3LPTA 1RT4A 3DLHA 1NKBA 4E3SA 1KSPA 3MXJA 3MXIA 2HVIA 1W9HA 1U48A 1SL1A 1X9SA 4M42A 1VSKA 4DTPA 3AVMA 3LZJA 4CEBA 4DSLA 1RBSA 1G15A 5HRPA 4DQRA 4B9NA 3HJFA 2P1JA 4LSNA 5FROA 2YV0X 3AV9A 4CHZA 3VQ7A 2HHTA 3T1AA 4ZHRA 1T03A 3AVNA 3KKRA 4CGFA 4ELTA 5T7BA 2O4GA 1RDCA 5EU7A 4DLGA 4IG0A 3SUNA 3DOLA 1TKTA 1S1UA 4B9LA 5FRNA 2VWJA 4JRPA 4C8KA 1GOBA 4KHNA 2JGUA 4CHOA 1BISA 4CJQA 5CY4A 3OYHA 5KRSA 4FM1A 3SYZA 4DFKA 3S9HA 4J2BA 1HMVA 3RR7A 3HK2A 2X78A 3NE6A 1NK9A 4FJ8A 1ITGA 2A1SA 1WSHA 2D0BA 1NK5A 3BDPA 4LD0A 4DF4A 4Z4IA 4M45A 2ZD1A 2KZZA 1BHLA 3C95A 4CJWA 3HL8A 2JLEA 1WSFA 3HT3A 1BIUA 3RRHA 2G8FA 3KK3A 1T7PA 2KZMA 1TAUA 1RT7A 1S1VA 3HXMA 1L3VA 1A5XA 3L3VA 4C8LA 3NH0A 3TAFA 3IRXA 3ALYA 3SV3A 3DM2A 3CFPA 3NGIA 4CJ3A 4Q0BA 4BWMA 1XI1A 1RILA 2P51A 1QSSA 2E6MA 2Z1GA 1BGXT 2FC0A 1NK8A 5FDLA 1KFSA 4PY5A 3QETA 4HUEA 3SZ2A 1GOCA 3OS1A 3SCXA 1RT6A 1RT1A 4K8XA 1WSIA 3ZSZA 3RRGA 4FJNA 1J54A 1S9EA 4B9TA 4ELUA 4ZTFA 3M8RA 3LWLA 2VG5A 4Z4CA 2I5JA 4IFVA 1JLFA 4HUFA 4JS5A 1WN7A 3UIQA 4W5NA 1F21A 2GBZA 4CERA 4LH5A 2VG6A 3QEIA 2IDOA 3AA5X 4DQPA 5K14A 4KI6A 1Z25A 1C1AA 1X1PA 4N76A 1NK0A 3CFOA 2X74A 1X9WA 4CK3A 4W5QA 3MXMA 2OZSA 3K5OA 1LWEA 3QNOA 1NKEA 1JLAA 2XO7A 2W42A 4CJ5A 4E1NA 1EP4A 2HNZA 4DSJA 4EZ9A 2F8SA 4IG3A 4CJFA 3DRRA 3AVCA 4BDYA 3V81A 4LY7A 3TAQA 3O4NA 2PY5A 2P5OA 3QLHA 1ASWA 1LAWA 3CQ8A 3L2UA 4AHTA 3QNNA 4FLZA 4Z4HA 4CEAA 4KKOA 3VQQA 3E01A 5JS2A 2WOMA 4PQUA 1Q8IA 1BCOA 1C0TA 2YHBA 4KAZA 4HCBA 3ISNC 4FZYA 3AA4A 3ZCMA 3OVNA 4B9VA 1CLQA 1BIZA
chains in the Genus database with same CATH superfamily
4OLBA 2YNHA 4O44A 4JNEA 3HP6A 4KI4A 4LH4A 1BU6O 4KHUA 3PUFA 1NMDA 2HHHK 2IVNA 2Q97A 2OPSA 3DXMB 3TANA 5KTQA 4IDHA 1HYSA 4CI6A 5AQIA 4LF9K 3TR8A 1IG9A 3M8SA 1Z26A 4O8KA 3DXKB 1VQKN 4PHTX 4CD1A 2WTUA 2FSKA 3WNEA 4CJUA 1HX1A 3BY5A 3OYIA 3CYMA 4GV9A 4OPAA 3ZT1A 5JICA 3O5BA 1RT5A 4OVLA 4HVJA 2CH6A 1NGDA 2Q3SA 3UKRB 3H3NO 3LM9A 3MK6A 1OKJA 4OGCA 1QQMA 1C1BA 3B6OA 4BRQA 1Y97A 5M1QA 1C0GA 1C0UA 2QXLA 3OYNA 5AQVA 2G8VA 3K0SA 3KVGA 4CJ4A 5C0YA 1NM1A 4F8RA 2PBDA 3VESA 1R0AA 2IGIA 3M6GA 3QINA 4ID1A 4FWMA 4CZEA 3G0ZA 1IO2A 4BE2A 4CBXA 5KQ8A 1QQCA 1LOTB 4GKKK 2KQ2A 2GV9A 3NAEA 5KPTA 1IV0A 5FPNA 4HHTA 1N5YA 1JCGA 3CJCA 3G6EN 3TSQA 5I3UA 4PUOA 1NJXA 3IKMA 1VSJA 1HR0K 5FRMA 4ILHA 1WLJA 5LJVA 3ID6A 5C12A 1OVQA 2D0OA 2KFNA 1CZBA 1HPZA 3DRSA 3H6EA 1A5VA 3HVRA 1YXQA 3CCRN 1S1WA 4JS4A 4IFYA 2PAVA 3A5NC 4BR5A 5DM6L 2I7NA 4MQ3A 3ZT2A 3NGZA 1BOTO 1JXBA 1BL3A 4B1YB 3CC4N 3G10A 2RF2A 3C6UA 4C8MA 3MWTA 3Q7CA 3LAKA 2O8FB 4JD2A 4WFNL 3TWHA 2Z1HA 3J8AA 2VG7A 4H0VB 1VSDA 1X9MA 4IKFA 5AQZA 1E4GT 5EX5A 1HNZK 4Z94A 3NFAA 1NGFA 5LMUK 1HYVA 4KB1A 3VF6A 4CZKA 4YDUA 2QW9A 4NCBA 2DFFA 4FW2A 3HSCA 2XRIA 4DR6K 4OO1J 1RCHA 4B9QA 4BRGA 3AGKA 3SAFA 3PX0A 3SV4A 2OA8A 2RPIA 1ZBLA 4LFBK 1S6PA 1OH8A 4RW9A 1GLAG 2D0PA 2OYQA 5I42A 4YOXA 4BGBA 4FJKA 3KTQA 1XC9A 3CFRA 1WUAA 3ASMA 4FOIA 3LP2A 2HVHA 4H8KA 5DMRA 2BE2A 1W97L 2QWRA 3EL2A 2HSTA 5J2PA 4H5VA 2EX3A 2CGJA 3P83D 1EWQA 4CFBA 3LDNA 4C1NK 3PY8A 3CCEN 3V1QA 3OYGA 4BY9C 4K8ZA 1VSLA 3R9PA 4CF8A 3SI6A 3NH2A 2P9NB 3RVCA 3OJSA 1NJZA 1ATSA 4DWIA 2ZF5O 3QO9A 3CCVN 3OYAA 5AJ3K 3P5JA 5BRFA 4FK2A 3MN7A 4K43A 4JI5K 4JEPA 3AO1A 4B8CA 1L3UA 1E4FT 5M1KA 3HBTA 2OPQA 1T44A 3VEOA 5E26A 1FK9A 3T7ZA 2GELA 3WUHA 1S9GA 1BQMA 1MWMA 5AQYA 2YHXA 4M63C 1K8KB 4F3TA 4RCHA 4E7IA 4B8AB 1FJGK 3TAMA 2HHVA 3WEEB 3CMAN 4H0PA 2GTDA 3AVHA 3DXMA 3ZT3A 3A2FA 1RDWX 3FFIA 3M1FA 1JL2A 4ISGA 3OS2A 3KLFA 5KI6A 1TKXA 3ENHA 4JD2B 4A5AA 1U04A 3P1GA 3TAPA 4KTZA 3ENOA 4FVUA 1RT2A 4GVMA 3CCSN 4CGDA 2G8HA 3NHGA 3TABA 1B9FA 1KAXA 1RTIA 4CGJA 5AQRA 3SMSA 4DUZK 3DMJA 4BRHA 1VQ8N 1KTQA 1U2VB 2UUBK 4RW4A 4JI8K 3AARA 3A5OC 3C6AA 1I3AA 2UUAK 4OKJA 3O9RA 1QSLA 3B8AX 3D2FB 3ZYYX 3F9MA 4IBNA 4KB0A 4CEDA 1O1WA 1SS6A 3PIOL 3V9WA 2AJQA 5C10A 2ITMA 5KPRA 4DSEA 1IG8A 4FJ7A 4DV1K 1VK0A 3MX2A 4PA1A 3AVJA 4KHYA 4CF0A 3L8BA 4H0XB 4OGEA 1VSFA 3R6MA 4BQLA 2D5RA 1EKEA 2O8BB 3CG7A 3VQAA 3NCIA 3I0RA 3EKUA 4Z4EA 3ZSOA 3V4IA 3M3ZA 2W6LA 5KRTA 2QWOA 2RKIA 4OPHA 5C24A 1SUQA 4YNQA 3IAYA 1FXXA 4B08A 3QEVA 2E1ZA 1V4TA 2QWNA 3HM8A 1IBMK 1QE1A 4EAHD 3KLGA 2BANA 4K42A 4YDUC 1GLDG 3LWMA 5CZ2A 4IFEA 4FJHA 3Q7BA 4K0KK 1ZBHA 3WQUA 1WSEA 1RBVA 4ISFA 3U6FA 3DLEA 4FWSA 3CMEN 4B1ZA 1H1VA 3E9PA 3O08A 4FWRA 1IKYA 3JYTA 3SPYA 3FFKB 3MEEA 5M1OA 5M1FA 3OYKA 4V19S 2ZJQL 3O9SA 4BC3A 2HNDA 4OPKA 1QTMA 1SKSA 3O80A 3K57A 5HP1A 3R8EA 1BA1A 1D4XA 1V4SA 1W9HA 3J7YP 2ZM6K 2QWLA 2P9KA 4CEBA 1RBSA 4B9NA 3HJFA 1U6ZA 2YV0X 1KAYA 1VQLN 2HHTA 2F9TA 3AGRA 2A41A 1T03A 1VAZA 3KKRA 5AQTA 5EU7A 4DLGA 3DOLA 5LMNK 1TKTA 4JRPA 1GOBA 4CHOA 5CE3A 5AQSA 2OCEA 1XMQK 1QVGM 4GKJK 3RR7A 1O13A 3HK2A 1BWFO 1ITGA 2VYPA 4FWNA 2KZZA 4DV5K 3HL8A 3HT3A 1WSFA 3FR0A 2W40A 3QBXA 1TAUA 1A5XA 3L3VA 3U4LA 3TAFA 4YOWA 2NRVA 2P9IB 4CJ3A 4BWMA 1NK8A 1Y64A 4HUEA 1RT6A 1RT1A 3GOIA 3D7EO 2FSJA 1J54A 3M8RA 3LWLA 3CF5L 4HUFA 4IFVA 4LH5A 1Q18A 5K14A 1Z25A 3OBYA 3ZETA 5MLCQ 5F0XA 3JAMO 1X9WA 4AM7A 2UXDK 3QBWA 2A3ZA 2OZSA 2W42A 4IJAA 1EP4A 3C65A 4DSJA 1HKBA 4CJFA 5C2FA 4LY7A 1DT9A 3QLHA 1LAWA 3LL3A 3KWGA 1BCOA 1C0TA 3ZCMA 3CCLN 2QKBA 1REVA 2VGMA 1NNEA 1P90A 2KTQA 1JXEA 2UU9K 1WAFA 1P8ZA 4CCHA 1YF5L 1DTTA 4A5BA 4DHYA 1KC8O 1OVYA 2HNYA 1NMNA 3CCQN 2Q2RA 4FJXA 3IG1A 1SQKA 1NOYA 1EXQA 3VENA 2V7YA 5GADP 3ULEB 3F5TA 3DLLL 2ASOA 1TL1A 3U8XA 3H3OB 3OJUA 3F9KA 2RN2A 1KVBA 1UWBA 3QFPA 3AA2A 3K9KA 1ILYA 1J53A 3VOVA 1K8AO 4BE1A 3AO3A 1N33K 1QHTA 1T3VA 2XHBA 3HI0A 4CZGA 3JSMA 4E7HA 1VQMN 4J2EA 4A2AA 1LAVA 1MU2A 4DTSA 1C1CA 3NF8A 4MDAA 4QAGA 4LC9B 3KZBA 1UOCA 1VQ9N 5F2RA 1KFDA 3VQ9A 2OPPA 2R7YA 5BRDA 3OYJA 4F2RA 4M3TA 5BPLA 3WNGA 3VF2A 4DV7K 2DY4A 4DV6K 3DYAA 2QEXN 2HMIA 3AO2A 1IKVA 4DLEA 3QEXA 2DTUA 4BC2A 2A42A 4B3TK 1CZ9A 3KK2A 3P31A 4QOZB 4CFAA 1HRHA 4Y0WA 2FLOA 2GUIA 1D8YA 3UKUB 4KTQA 1KCFA 3AAPA 5AR0A 4GV3A 2NUBA 4DB3A 3VTHA 2ATQA 4WFBL 1BI4A 4BDZA 1GOAA 4FK0A 4IO8A 1NKCA 4RWTA 3EEQA 3HVTA 5GAHP 3ZLJA 4A62A 3TSPA 3VQEA 3EZ5A 4O0IA 3FZMA 3HPHA 3O6WA 1Q86O 1JJ2M 2YNIA 3ITHA 4LFCK 3GE1A 1LW0A 3VPZA 4E1MA 4YOTA 4BRFA 1SL0A 4YOUA 1J9AA 3C6TA 2E20A 2WFBA 5AZJA 4DQQA 2NRWA 5CR4A 4JLHA 3B6PA 5JVHL 5IT9O 2HHXA 4DMNA 4YHHK 3SLCA 2D0CA 2V51B 1NJYA 1HKGA 1JKHA 1ATNA 5J1EA 3LDLA 4TSXA 4PKIA 4CJEA 3BZCA 3CJ1A 3TTFA 2YX6A 4H03B 5C25A 5FPEA 4FOEA 4KH6A 3RSEA 3AVGA 4O55A 5HLFA 4B9SA 3H1VX 4A61A 4CFDA 1TKZA 4I7FA 3K58A 4AILC 3HYFA 3M5RA 3VQBA 3HOSA 2V7ZA 3V9UA 4N41A 4JN4A 1VSEA 5EVZA 1HNWK 2VWBA 5GIPA 1KVCA 2PFUA 3M8QA 2BDPA 2XY8A 2G8WA 4PWDA 4CJKA 1ATRA 3CCMN 2HW3A 1C0FA 2NRXA 3SMPA 4CZLA 1RTDA 2YJFA 1YVNA 3RMCA 2P9PB 1X3NA 4H5WA 3CXCM 3VQPA 2F7TA 3DJCA 4IJNA 3MECA 3LZIA 4KH5A 2KKZA 4AHRA 1I39A 3CCJN 2IAJA 4BR4A 1KLNA 1NGEA 2HHQA 1VQ5N 3GL1A 2WUSA 1U2VA 5AQLA 5E41A 2ZJPL 4DFMA 4ILJA 4CEFA 1HQUA 2E2OA 4H0OA 3THXA 5AQKA 4BDPA 3CCUN 2P9LB 3SUPA 1HUXA 3EO3A 5CYMA 1JL1A 2BUPA 5HOOA 2X6NA 5AQHA 4E7JA 5AZIB 1DTQA 3BP8A 1VSIA 5AQUA 5KGWA 3I8DA 3NF9A 3KLIA 2YI1A 1CXQA 1ZBIA 2AP1A 2XY6A 4FK4A 4GW6A 4DUYK 4I9QA 4FLVA 3HP9A 1SZ2A 4EFHA 1EX4A 4GMJB 2F4VK 3PV8A 1T6CA 4LF8K 4RG8A 4NLBA 4KRFA 3CQXA 3QFUA 1BUPA 4ELVA 4W5OA 2F8TA 5J2NA 3PO4A 2ETJA 3KLHA 4KO0A 3NGYA 4CVNE 2CGLA 4DS4A 3THYB 3LALA 1Q81O 1T6DA 3I56N 2E2NA 3K5MA 2E88A 2J4RA 4CEQA 4CJ7A 1BQNA 4XEIA 1X9JA 3BF3A 5GAGP 2FBYA 4FLTA 1R59O 4MFBA 4CJLA 5J2MA 5D3GA 3K9JA 3EYZA 3HZ6A 2HOEA 4R5PA 4B1VA 4X65K 1L5UA 3AO5A 3C0BA 5E84A 3IUCA 2P9UA 3O8MA 4DFPA 4NB4A 3CI5A 4FPAA 1QZ6A 4KFBA 4HTUA 1U47A 2HHUA 3VQDA 4DSIA 4XH4A 2KFZA 4AQYK 3QEPA 3U9ZA 3GBTA 2Q0RA 4F4KA 4CHQA 5H1SQ 4L8RB 4CF1A 4FJGA 1YITN 4CD3A 3W3DA 3IS9A 4BRDA 5AQQA 4JHDB 4OX9K 2P9SA 1W7AA 2GWKA 4AHSA 4DTNA 2FBVA 4F9OA 3E1YA 1WSJA 3NBPA 5KQDA 3SUQA 5HL7L 1JCFA 4IOXA 3PX6A 4IO9L 3VN5A 2Y1JA 2E6LA 4CEOA 1DKGD 3HRGA 3RR8A 1D9DA 4EZ6A 3MEGA 2ZGZA 5CZ1A 1C6VA 3T1HK 1U49A 3OYMA 4CF2A 3HO1A 1D5AA 1T05A 5JLHA 3OYDA 2AA4A 3CJ9A 4JI0K 3O9QA 5AZIA 1RT4A 1NKBA 5JMVA 1S72N 4JAXA 2HVIA 4WFAL 1VSKA 4DSLA 1G15A 5HRPA 1ESVA 4NLCA 5EY4A 1HNXK 2P1JA 3THWA 3AV9A 3THXB 2A5XA 4ZHRA 3A5MC 3AVNA 4CGFA 4ELTA 5T7BA 1GLCG 1RDCA 2VQEK 1S1UA 4B9LA 4C8KA 1NGIA 4FM1A 4FZZA 4M7YA 3OYHA 5KRSA 1QHAA 4DFKA 1HMVA 2YHWA 2X78A 1NK9A 2A1SA 1WSHA 1NK5A 1DGKN 4DF4A 4M45A 2ZD1A 4CJWA 4JI3K 3RRHA 1BIUA 4C1NI 2VCPA 4BG8A 1J5EK 4BVPA 3O4WA 3DM2A 2P51A 4HWIA 5FDLA 4LF7K 1HPMA 3QETA 3O1WA 3I33A 3SZ2A 3OS1A 3SCXA 4K8XA 3VETA 5AQOA 3WXMB 2FXUA 2UXBK 3CJAA 4CZHA 4B9TA 4ELUA 2VG5A 4Z4CA 1JLFA 1WN7A 3DAWA 4WYBA 1F21A 4CERA 3QEIA 4DQPA 1RDUA 1C1AA 3C6HA 1WB9A 3MDQA 3BF1A 4W5QA 1LWEA 2OTJN 1JLAA 3SBTA 4BVOA 4CJ5A 4E1NA 1YJNN 4JV5K 3G4SN 4EZ9A 5AFUH 2F8SA 3AVCA 3V81A 4JI4K 2PY5A 3O4NA 5FLXO 3CQ8A 3QNNA 1NG9A 4Z4HA 4JKFA 4CEAA 3VQQA 5BN9A 2EWSA 4KAZA 4HCBA 3ISNC 3AA4A 2KLAA 4JKCA 3ENBA 2NLXA 3QEWA 1CLQA 2ASMA 2IS3A 1KAZA 1NGHA 4WCEL 3THVA 1HNIA 4KHQA 5J2QA 2WC9A 3CC2N 2O8CA 3VF4A 4HTLA 4JKBA 1S6QA 3D45A 1TAQA 5KGXA 1VQON 1RDBA 3V1RA 3DLKA 4FJ9A 1YHQN 3F2KA 4H4OA 4B9MA 4K41A 1XNRK 1RDDA 3DLRA 4O4GA 1X3MA 4EP4A 5BPMA 2YKMA 1WOQA 4B3MK 2NNWA 1NGCA 1SAZA 2YJEA 3KJVA 3PSFA 2VQFK 1BO5O 4GVEA 2NRHA 4DR7K 3QMLA 4CIEA 3CIPA 3SQ1A 2QA4N 3IMXA 3SJHA 3N4PA 5LY3A 4PKGA 1BI4B 3KD1E 4I2PA 3AVBA 4RW6A 3UKUA 4X64K 4Y1CA 1ZBSA 2E5LK 3OYLA 3RMAA 4B9UA 3CJ7A 4DU4A 5JS1A 3ATUA 3ZSWA 3LP3A 1IJJA 3FZLA 1IKXA 4Z4FA 4QS8A 2W6KA 2F9WA 1LCUA 2FBXA 1RFQA 2YHAA 3AO4A 5LL6Z 3LP0A 4IXCA 3WT0A 3T1YK 1XWLA 4QS7A 3L4IA 3DRPA 4CHYA 3ZEUA 3OBWA 1UAXA 4RW8A 4YOVA 1EWRA 5TKYA 3T69A 4CW7B 2QI2A 2ZGYA 1YI2N 2YCHA 2A40A 1BA0A 1JLBA 2RE2A 4CJVA 4AHCA 1QZ5A 3RMBA 3QERA 4O8UA 1NJIO 2O8EB 4JKGB 1B9DA 1K9MO 1L3TA 1BCMA 3UE5A 4NYFA 2GWJA 4G1QA 3O9UA 3VEZA 3A8YA 1HNVA 3HPOA 2W41A 3KKSA 2BGGA 4FXDA 4CE9A 1RBTA 5CYQA 3DOKA 1RDAA 1IH7A 3MWPA 4CEZA 3HM9A 4WQ4C 4FLWA 1ASUA 4Z0UA 2D0AA 4BRNA 4DR3K 3L2WA 2F96A 3EY1A 2HHSA 4DR4K 2FF6A 4NYNA 4CGHA 4M3UA 3OYBA 3AA3A 2WBNA 5B8HA 3EN9A 3AVLA 4C8OA 3O3FA 3EZWA 4JI6K 4DTRA 4IOCL 1M1KO 1IBKK 3WXLA 5BR8K 3QIOA 5C15A 1VQNN 2FBTA 3TAEA 4FVMA 1NGBA 4NCAA 3VA0A 3VQ4A 3V6DA 1MDUB 4KH4A 1HKCA 2QK9A 1CXUA 4DR1K 4N47A 4B1WB 5ADXA 3ZETB 3SPZA 4ZTJA 4GY2B 4OLAA 3HPGA 4BRIA 1N6QA 5HBMA 1RBRA 1EO1A 1A5WA 4H0TB 2BH1A 2Z1IA 4XIUA 3NMUA 4FO0A 1M90O 3PO5A 4I2QA 4FLUA 2Q1NA 4O5FA 3LAMA 4CF9A 5HROA 3D2EA 3V9ZA 3RMDA 4CIGA 2E8AA 3S3MA 3FZHA 1Q9XA 3BEXA 3KLEA 4QCLA 4Z4GA 3VGKA 4WQ5C 4FLYA 4FLXA 5IWAK 3VGLA 4M3ZA 1T8EA 3ZT4A 5HRSA 4DTXA 4CJRA 1J5OA 2E4LA 4B3RK 1MWKA 1QQOA 4DTUA 3CM6A 3AVIA 3NH1A 4B1UB 1D9FA 4UQGA 4NXNK 3FGUA 1GLBG 1S3XA 1ZYQA 1HQEA 1LWCA 2YNFA 4JK9A 4DF8A 3HTVA 1OH6A 3CM5A 4DQSA 4DTMA 1VRUA 2EHGA 4M3RA 1S1TA 1ZC6A 2P9KB 4FM2A 1Q9YA 1YJ9N 4NCGA 5I9EB 4OKKA 4Q5VA 3E9OA 4FJ5A 3D6RA 1SL2A 1LV5A 1WSGA 3BGRA 4J2AA 3KWIA 1XQSC 2JWKA 3WNFA 5BN8A 3JS6A 4DTOA 4M41A 4AHUA 4YOYA 4IDKA 1HJRA 1SKRA 4FW1A 2CGKA 3NF6A 3FE1A 1TK5A 4HUGA 2DFHA 1TKDA 3TI0A 4FL9A 2OZMA 1NJWA 3ZSYA 4DR5K 4ICLA 3U3YA 4CK2A 3CPEA 4DU3A 3TPQA 3LPUA 2B4JA 2WONA 3MN5A 4J2DA 4AH9A 4CZIA 3HOTA 3SQ4A 3KK1A 2KHOA 3CQYA 1XHXA 2DPNA 4DFJA 1E3MA 1HJOA 4N56A 3V1OA 5ELZA 4I6MA 1TYQB 2Q0UA 4ID5A 3LP1A 1QSYA 4FWPA 3EE8A 4FCYA 1SV5A 3QESA 2NRRA 2IOCA 4DS5A 2B5JA 3LANA 1YTUA 4CJTA 1Z05A 3MEDA 1VHXA 2ZE2A 3C7NB 3ID8A 1KVAA 3SK3A 1QS4A 1S1XA 3TARA 1IBLK 1ZBUA 4B3OA 2YHYA 4IOAL 2P5GA 5LJWA 1IKWA 4M3XA 1WAJA 5AQMA 4KTWA 3VERA 2HMPA 4N5SA 3SUOA 2HF4A 2YKNA 2ITGA 5DM7L 1OH5A 4FJIA 3O4QA 3D2FA 2Z1JA 2FF3B 4MO4A 4HCCA 3CC7N 3N4QA 1RBUA 4FJJA 1N32K 3THWB 2LSNA 3P39A 4B3SK 3R1XA 2QXFA 4BE0A 5BPNA 3QB0A 4CJPA 3P4IA 3BZKA 5SWMA 1CZAN 4FSVA 3KD5E 3VGMA 3S3NA 4W5RA 4DV2K 4E19A 3L3UA 4JK7A 4BACA 4L3QA 4A57A 4BRCA 3LPTA 2UXCK 3MXIA 1U48A 4GV6A 2O8CB 2NZTA 4DTPA 4CBUA 3LZJA 4JKDA 3J80O 4NO7A 1YIJN 4PKHA 5FROA 2HBMA 3L0QA 2P9SB 3L6QA 1QQNA 2VGNA 4JHDA 3WEEA 3T1AA 2OANA 2O4GA 3VEWA 1K8KA 4LF6K 4JKEA 5FRNA 4KHNA 2JGUA 4CJQA 5CY4A 4ISEA 1N8RO 4FJ8A 2D0BA 3W0LA 3P38A 1BHLA 2P9UB 1XNQK 3KK3A 2KZMA 1S1VA 1L3VA 2GEMA 3VMFB 3NH0A 3ALYA 3CFPA 2P9NA 3KK7A 3NGIA 4Q0BA 2IVPA 1RILA 3E66A 1BGXT 2FC0A 1KFSA 1G99A 4BR9A 3A0IX 3ZSZA 3RRGA 1S9EA 4DCHA 4ZTFA 2I5JA 3UIQA 4JS5A 2QWMA 3QICA 2VG6A 3THYA 4IWVA 4KI6A 3VEVA 1NU0A 3DWLA 1TUYA 3MXMA 3K5OA 2D4WA 2IVOA 3QNOA 2XO7A 4BRAA 3UB5A 4IG3A 1ASWA 3FZKA 4AHTA 4FLZA 3PIPL 3TSUA 2UYTA 2YHBA 5A2QO 3OVNA 4CK1A 4M3WA 3GG4A 5GAEP 3AVAA 2UUCK 1C0MA 4C8NA 4U67L 1DEJA 4PL7A 1UA0A 2P9LA 3WNHA 1BDGA 3V9XA 2O8FA 4JKAA 1JLGA 3CD6N 1FKPA 5AQPA 1I94K 3SBGA 4M3YA 3AVKA 1RTHA 4BRPA 1YJWN 3MN9A 4WQ4A 4H4MA 2GUPA 1RT3A 3L4QA 5GIOA 1VQ4N 5HRRA 3VTIA 4M7XA 2HHWA 3VQ8A 4BWJA 3V9SA 3CETA 1NK7A 4JI2K 3PX4A 1EQYA 1KRPA 4BRLA 1VRTA 4PL8A 3SAHA 2QWQA 4FJMA 1GLLO 3VQ5A 4DV4K 4GNIA 1NGGA 3KIOA 3I55N 3GDQA 3L2RA 1FKOA 5C42A 1HYZA 3LDSA 3AVFA 1J6ZA 4KHPK 1GLEG 1KLMA 4FJLA 3MMVA 4ILGB 4E7KA 1YAGA 3LDPA 5AQXA 4BC4A 1S5JA 3DLBA 4RW7A 4E0DA 4QS9A 1YT3A 3VQ6A 1DLOA 1UA1A 2ZJRL 4CBWA 2XY5A 3H08A 1RNHA 4K25A 3AAQA 3NVMA 1W0HA 5BRHA 3UKRA 4BR2A 3K5NA 3U3GA 4X66K 4JK8A 5JLFA 1XMOK 1VSHA 3TTDA 3NF7A 4KREA 3MX5A 3I8BA 1LWFA 4FWKA 3RWUA 2VWKA 4EP5A 4YY3K 4CEEA 3OYFA 3DI6A 1FW6A 2HB5A 3PSIA 1NK4A 1VQ7N 3SJJA 1WNSA 4IZ9A 4H5TA 4LF5K 3DXKA 4JRQA 1TV6A 1GLJO 1QVFM 4DSKA 3MCPA 4E7LA 3H45C 3IDHA 4JYAK 4LSLA 1W2BM 1RTJA 2ZQBA 5SZTA 3O9TA 2Q31A 3AY9A 4I9LA 2HBLA 4J8FA 3QIPA 3ZSRA 3I0SA 4CESA 1BG3A 4DTJA 1EETA 2RHKA 3PLAA 1RGIA 3A5LC 1TK8A 1TVRA 5EOYA 2OPRA 3G25A 4R79A 4E1JA 3IFRA 1NOZA 3S3OA 3ZX3A 4CFCA 4H5RA 3MAQA 2YNGA 2OTLN 2IIRA 1TK0A 4BR0A 3TAGA 3QDKA 3ZT0A 3OY9A 2NRTA 5GINA 2G8IA 3VEYA 4CIFA 3M8PA 1ASVA 1NWKA 1JCEA 3WXKA 2FSNA 4CHNA 5AQWA 2O8DA 3C7NA 3WXJA 1KQSM 2H3GX 4WF9L 4BQZA 4FYDA 3F73A 1U45A 1NGJA 1LW2A 3CPWM 2P9PA 5HRNA 3ATVA 4FZXC 3T3FA 5BR9A 3O3HA 4NXMK 4DU1A 3ZSQA 2QM1A 1TYQA 4I6MB 3K59A 1B92A 3OYEA 4BROA 4X62K 3D0PA 3O3GA 3VA3A 3MN6A 4EIAA 3ZSVA 2XY7A 4JI7K 3TU5A 5C2DA 4F2SA 1VSMA 4EHTA 3RSEB 3SQ0A 1ZBFA 3FZFA 3ULEA 3T19A 4EHUA 4JKHA 1N36K 3C94A 4CECA 3WXIA 1Q82O 4U7BA 2G8KA 2B6AA 1OH7A 2G8UA 3R3LA 5F1XA 2O4IA 4A59A 1TGOA 4AM6A 4BRKA 3DLGA 5AZJB 1XHZA 4AHVA 3JXUA 2IC3A 2D1KA 2PYLA 4F3OA 4O0JA 1U4BA 1S22A 4DV3K 3OS0A 4DR2K 3OYCA 1XUPO 4CZMA 1N34K 3NDKA 4BREA 1L3SA 1K6YA 2PYJA 3OA9A 3KHYA 4O5BA 4E89A 4BG9A 2PZSA 3RTVA 3VQCA 1TL3A 3LDOA 4IEEA 5M1NA 4DSFA 4CJSA 1NK6A 2DFEA 5ADXH 1SKWA 4OKEA 3D2EB 4CGGA 3SQ2A 2Y1IA 1JLCA 4MO5A 3SNNA 4OJRA 3CJBA 4DQIA 1JLQA 4FPBA 1YTAA 2P9IA 1NGAA 4MLEA 4YORA 1Q7YO 3K2PA 5TKWA 3L2QA 4KBOA 2A6AA 1MA9B 3K5LA 3OTOK 4OPJA 5DK5A 2E2PA 2ZWHA 4KPYA 5JVGL 4KHSA 2BTFA 3E9LA 4W5TA 3LDQA 3BUZB 4KV8A 4G9ZA 5AQJA 3ULDA 4DG1A 1YVUA 4BGAA 4FWOA 2Q36A 4MLHA 4KHWA 1JLEA 2QWPA 2KW4A 4LF4K 5AQFA 2E1YA 2ASPA 2QKKA 4IEIA 3G71N 3HSTB 3ZSXA 2X6SA 2A1RA 4CHPA 3L2VA 3SAGA 4YFUA 4FM0A 4BR7A 1HLUA 4DV0K 1Z6RA 4Y1DA 1WBBA 4CGIA 4WE1A 2JWLA 3LM2A 3DLHA 1NBWA 1GLFO 4XH5A 4E3SA 1KSPA 3MXJA 3WQTA 1SL1A 4M42A 1X9SA 3AVMA 4H5NA 4B1XB 4DQRA 4UY8O 5FPMA 4LSNA 4FWLA 4JKGA 3EKSA 2O8EA 4CHZA 2HBJA 4LFAK 3VQ7A 3O1BA 4IG0A 2CH5A 3SUNA 3J81O 2E2QA 4RTFD 3OHRA 5M1PA 2VWJA 3J7ZO 1XC3A 5KPZA 4DQ8A 3MCAB 1BISA 4J2BA 3SYZA 3S9HA 4WQ5A 4CZFA 3ZEUB 4JI1K 2HF3A 5BREA 5AQGA 3NE6A 3BDPA 4Z4IA 4LD0A 2GX9A 3VEXA 3C95A 1KXPA 2JLEA 1WBDA 2G8FA 1VQ6N 1T7PA 5CHIA 1RT7A 3HXMA 1KD1O 4C8LA 3IRXA 3SV3A 3U9DA 2I7PA 3J7AP 2O8BA 4A2BA 1XI1A 3EE9A 1QSSA 2E6MA 2Z1GA 3NVKA 3H1QA 4PY5A 3ZX2A 1GOCA 1WSIA 2V52B 4FJNA 4CZJA 4XH1A 1VQPN 5EXWA 4C23A 4W5NA 4FWQA 2GBZA 4H0YB 4BRMA 3ZX0A 1K73O 2NRZA 2IDOA 3AA5X 1X1PA 4N76A 3H46O 1NK0A 3CFOA 2HBKA 2X74A 4CK3A 2O8DB 4AF1A 1NKEA 5FPDA 3TTCA 3FLCO 2HNZA 3CHWA 3OW2M 1TUUA 5AQNA 4MDBA 3DRRA 4BDYA 3TAQA 3S41A 2P5OA 4BC5A 5AFUA 3L2UA 4DKWA 4KKOA 3E01A 5JS2A 2WOMA 4PQUA 3CERA 1Q8IA 1YUWA 1ZXOA 4FZYA 1NLVA 2QTDA 4B9VA 1BIZA
chains in the Genus database with same CATH topology
1REVA 4OLBA 4CK1A 2IS3A 2YNHA 4M3WA 3THVA 4O44A 3HP6A 1HNIA 4KHQA 1JXEA 2KTQA 4KI4A 4LH4A 5J2QA 1WAFA 3AVAA 4KHUA 3PUFA 1C0MA 4C8NA 4CCHA 1S6QA 3D45A 1TAQA 5KGXA 1RDBA 1UA0A 1DTTA 3V1RA 3DLKA 3WNHA 2OPSA 4FJ9A 3TANA 3V9XA 1JLGA 5KTQA 1HYSA 2HNYA 1FKPA 4H4OA 4B9MA 4FJXA 4M3YA 3IG1A 3AVKA 1RTHA 3TR8A 1RDDA 1EXQA 1IG9A 1NOYA 3DLRA 3M8SA 4O4GA 1TL1A 1Z26A 4H4MA 4EP4A 2YKMA 1RT3A 3KJVA 5HRRA 3OJUA 3F9KA 2RN2A 1KVBA 1UWBA 3WNEA 3AA2A 4CJUA 2HHWA 3VQ8A 4BWJA 1J53A 4CIEA 3V9SA 1NK7A 3OYIA 3CYMA 3SQ1A 3PX4A 3ZT1A 4BE1A 3AO3A 1QHTA 2XHBA 1RT5A 4OVLA 1KRPA 1BI4B 4HVJA 3KD1E 4I2PA 3JSMA 2Q3SA 4E7HA 4J2EA 3AVBA 1VRTA 4RW6A 1LAVA 1MU2A 4DTSA 1C1CA 3NF8A 4Y1CA 4FJMA 4OGCA 4QAGA 3VQ5A 3OYLA 1C1BA 3RMAA 4B9UA 4DU4A 5JS1A 3KIOA 3B6OA 1UOCA 3L2RA 1FKOA 1Y97A 1KFDA 3VQ9A 5C42A 2OPPA 2R7YA 1C0UA 1HYZA 3OYNA 3OYJA 3LDSA 3ZSWA 3AVFA 2G8VA 4F2RA 4M3TA 3WNGA 2DY4A 1KLMA 4CJ4A 3LP3A 4FJLA 2QKBA 3DYAA 4F8RA 1IKXA 4E7KA 2HMIA 4Z4FA 1S5JA 1R0AA 3DLBA 2IGIA 4RW7A 2FBXA 3AO2A 1IKVA 4DLEA 3QEXA 2DTUA 2YHAA 3AO4A 3QINA 4ID1A 3LP0A 4E0DA 3G0ZA 1XWLA 1IO2A 1YT3A 3VQ6A 4BE2A 1DLOA 1CZ9A 1UA1A 1QQCA 3DRPA 4CHYA 3KK2A 4QOZB 2XY5A 2KQ2A 4CFAA 2GV9A 3H08A 3NAEA 1UAXA 1HRHA 4RW8A 1RNHA 2GUIA 1D8YA 4KTQA 1KCFA 1W0HA 3K5NA 3U3GA 2NUBA 4HHTA 1N5YA 2ATQA 1BI4A 1JLBA 4BDZA 1GOAA 1VSHA 5I3UA 3NF7A 4CJVA 1NJXA 4FK0A 4PUOA 1NKCA 4AHCA 1VSJA 3RMBA 1LWFA 3QERA 1WLJA 3HVTA 3RWUA 5FRMA 2VWKA 1B9DA 4EP5A 4CEEA 3OYFA 3DI6A 1L3TA 2KFNA 1HPZA 1CZBA 3DRSA 1BCMA 2HB5A 1A5VA 3HVRA 4JS4A 1S1WA 3SJJA 1NK4A 4NYFA 1WNSA 4IFYA 3VQEA 3EZ5A 4G1QA 4O0IA 4JRQA 1TV6A 4MQ3A 3ZT2A 3HPHA 1HNVA 3NGZA 3HPOA 1JXBA 1BL3A 3KKSA 2YNIA 3ITHA 4DSKA 4E7LA 2BGGA 4FXDA 3G10A 1LW0A 2RF2A 4CE9A 4E1MA 1RBTA 3C6UA 4LSLA 4C8MA 5CYQA 3DOKA 1RDAA 1IH7A 1RTJA 2ZQBA 5SZTA 3LAKA 1SL0A 4CEZA 1J9AA 3C6TA 3HM9A 4FLWA 1ASUA 4I9LA 3TWHA 2Z1HA 4Z0UA 4DQQA 2VG7A 2D0AA 3QIPA 1VSDA 4JLHA 3ZSRA 3I0SA 3L2WA 1X9MA 2F96A 4CESA 3EY1A 4IKFA 3B6PA 2HHSA 2HHXA 4DTJA 1EETA 3NFAA 4DMNA 4KB1A 1HYVA 4NYNA 4CGHA 4M3UA 3OYBA 4NCBA 2D0CA 3AA3A 2DFFA 4FW2A 1TK8A 1TVRA 3QEWA 2OPRA 1NJYA 1JKHA 2XRIA 1RCHA 3AVLA 5J1EA 1NOZA 4TSXA 4C8OA 3S3OA 4CFCA 4CJEA 3O3FA 5C25A 3MAQA 2YNGA 3PX0A 4DTRA 1TK0A 3SV4A 2OA8A 3AVGA 2RPIA 4O55A 1ZBLA 3QIOA 5HLFA 3TAGA 4B9SA 1S6PA 4CFDA 2FBTA 3ZT0A 3TAEA 4FVMA 1TKZA 4RW9A 3OY9A 4NCAA 3VA0A 3VQ4A 2G8IA 4CIFA 3V6DA 2OYQA 5I42A 4I7FA 3M8PA 3K58A 1ASVA 4AILC 3HYFA 3VQBA 3V9UA 4CHNA 2QK9A 4FJKA 3KTQA 1XC9A 1CXUA 3CFRA 4N47A 4N41A 1VSEA 3ASMA 3SPZA 4ZTJA 4FZZA 3LP2A 1KVCA 2HVHA 4H8KA 4OLAA 3HPGA 5DMRA 2BE2A 1N6QA 4FYDA 3M8QA 5J2PA 5HBMA 1RBRA 3F73A 2EX3A 1U45A 1A5WA 4XIUA 2Z1IA 2BDPA 1LW2A 2XY8A 2G8WA 4CJKA 4PWDA 5HRNA 3P83D 3PO5A 4FZXC 2HW3A 3T3FA 1RTDA 3O3HA 4I2QA 4CFBA 4FLUA 4DU1A 3PY8A 3ZSQA 3V1QA 3OYGA 3LAMA 4CF9A 3RMCA 5HROA 4K8ZA 3K59A 1VSLA 3V9ZA 3RMDA 4CF8A 3SI6A 1B92A 3NH2A 4CIGA 3OYEA 3VQPA 3OJSA 3S3MA 1NJZA 4KREA 4DWIA 1Q9XA 3QO9A 3KLEA 3OYAA 4QCLA 3D0PA 3P5JA 4FK2A 3O3GA 4Z4GA 3MECA 3LZIA 4FLYA 4FLXA 3VA3A 3ZSVA 3AO1A 4AHRA 1I39A 4B8CA 4M3ZA 2XY7A 1T8EA 2IAJA 1L3UA 1KLNA 3ZT4A 5HRSA 4DTXA 4CJRA 1J5OA 2E4LA 2OPQA 2HHQA 1FK9A 4DTUA 3CM6A 1VSMA 3AVIA 4F2SA 1S9GA 3NH1A 1BQMA 1D9FA 5E41A 3SQ0A 1ZBFA 4UQGA 4DFMA 4F3TA 4CEFA 3T19A 1HQUA 3C94A 4CECA 4E7IA 1ZYQA 4B8AB 3TAMA 1HQEA 1LWCA 2YNFA 4DF8A 2HHVA 4BDPA 2G8KA 3CM5A 2B6AA 4DQSA 3AVHA 4DTMA 3ZT3A 3A2FA 3SUPA 1VRUA 2G8UA 2EHGA 3FFIA 4M3RA 1S1TA 4FM2A 5CYMA 1JL1A 1Q9YA 2O4IA 1JL2A 1TGOA 4NCGA 2X6NA 3OS2A 4OKKA 4Q5VA 3KLFA 5KI6A 4E7JA 1SL2A 3DLGA 4FJ5A 1TKXA 1LV5A 1DTQA 1XHZA 1WSGA 1VSIA 3BGRA 4AHVA 4J2AA 2IC3A 5KGWA 3WNFA 3NF9A 3I8DA 1U04A 3KLIA 3P1GA 4DTOA 3TAPA 2PYLA 4F3OA 1CXQA 4M41A 4AHUA 4O0JA 1U4BA 1ZBIA 4IDKA 4KTZA 1HJRA 1SKRA 4FW1A 3OS0A 1RT2A 3NF6A 4GVMA 2XY6A 4HUGA 4CGDA 2DFHA 1TK5A 4GW6A 4FK4A 3OYCA 2G8HA 3NHGA 3TABA 1B9FA 4FLVA 1RTIA 3HP9A 1TKDA 4I9QA 3TI0A 4CGJA 2OZMA 1NJWA 3NDKA 3ZSYA 3DMJA 4ICLA 3U3YA 1EX4A 1KTQA 1K6YA 4GMJB 1L3SA 4RW4A 4CK2A 2PYJA 3PV8A 4KRFA 4RG8A 1I3AA 4O5BA 4E89A 4DU3A 3LPUA 2PZSA 4OKJA 2B4JA 2WONA 4ELVA 4W5OA 1QSLA 2F8TA 3RTVA 4J2DA 4AH9A 5J2NA 3PO4A 3VQCA 2ETJA 1TL3A 3KLHA 4KO0A 3NGYA 4IBNA 4DSFA 4KB0A 4CEDA 1O1WA 3SQ4A 3KK1A 4DS4A 3V9WA 2AJQA 3LALA 4CJSA 4DSEA 4DFJA 1XHXA 2DFEA 1NK6A 1SKWA 4OKEA 4N56A 4FJ7A 3K5MA 1VK0A 4CEQA 3V1OA 1BQNA 4CGGA 3SQ2A 4PA1A 2FBYA 1JLCA 4FLTA 2Y1IA 4OJRA 3SNNA 3AVJA 4KHYA 4ID5A 4CF0A 3LP1A 4DQIA 3L8BA 1QSYA 1JLQA 4MFBA 4OGEA 4CJLA 4FCYA 5J2MA 5D3GA 1SV5A 1VSFA 1YTAA 3QESA 3EYZA 2D5RA 1EKEA 2IOCA 4R5PA 4DS5A 3CG7A 3VQAA 1L5UA 2B5JA 3LANA 3AO5A 1YTUA 3NCIA 3I0RA 4CJTA 3K2PA 3MEDA 4Z4EA 2ZE2A 3L2QA 3ZSOA 3V4IA 5KRTA 3K5LA 2RKIA 4DFPA 1KVAA 5C24A 1QS4A 1SUQA 5DK5A 4YNQA 1S1XA 4OPJA 3TARA 3IAYA 4KPYA 1FXXA 4B08A 4KFBA 1ZBUA 3QEVA 4HTUA 4KHSA 4B3OA 2P5GA 1U47A 2HHUA 4W5TA 3VQDA 1IKWA 4DSIA 4M3XA 4KV8A 1QE1A 2KFZA 3QEPA 1WAJA 4KTWA 3KLGA 2BANA 4N5SA 3SUOA 4F4KA 4CHQA 2YKNA 4DG1A 2ITGA 3ULDA 4CF1A 1YVUA 4FJGA 4L8RB 4FJIA 3LWMA 3IS9A 3O4QA 2Z1JA 5CZ2A 4HCCA 1RBUA 4FJJA 4FJHA 4KHWA 4AHSA 4DTNA 1JLEA 2FBVA 2LSNA 1ZBHA 1WSEA 1RBVA 2KW4A 2QXFA 3U6FA 1WSJA 3DLEA 3NBPA 4BE0A 3SUQA 4CJPA 2QKKA 3SPYA 1IKYA 3HSTB 3ZSXA 3JYTA 2X6SA 2A1RA 3OYKA 3MEEA 3PX6A 4CHPA 5SWMA 3VN5A 3KD5E 2Y1JA 2E6LA 4CEOA 3RR8A 2HNDA 3L2VA 3S3NA 4YFUA 4FM0A 1D9DA 4W5RA 4OPKA 3MEGA 5CZ1A 1QTMA 1C6VA 1U49A 4EZ6A 3OYMA 4CF2A 1SKSA 4Y1DA 4E19A 1D5AA 3L3UA 1T05A 3HO1A 4CGIA 4BACA 4WE1A 3OYDA 3K57A 5HP1A 3LPTA 1RT4A 3DLHA 1NKBA 4E3SA 1KSPA 3MXJA 3MXIA 2HVIA 1W9HA 1U48A 1SL1A 1X9SA 4M42A 1VSKA 4DTPA 3AVMA 3LZJA 4CEBA 4DSLA 1RBSA 1G15A 5HRPA 4DQRA 4B9NA 3HJFA 2P1JA 4LSNA 5FROA 2YV0X 3AV9A 4CHZA 3VQ7A 2HHTA 3T1AA 4ZHRA 1T03A 3AVNA 3KKRA 4CGFA 4ELTA 5T7BA 2O4GA 1RDCA 5EU7A 4DLGA 4IG0A 3SUNA 3DOLA 1TKTA 1S1UA 4B9LA 5FRNA 2VWJA 4JRPA 4C8KA 1GOBA 4KHNA 2JGUA 4CHOA 1BISA 4CJQA 5CY4A 3OYHA 5KRSA 4FM1A 3SYZA 4DFKA 3S9HA 4J2BA 1HMVA 3RR7A 3HK2A 2X78A 3NE6A 1NK9A 4FJ8A 1ITGA 2A1SA 1WSHA 2D0BA 1NK5A 3BDPA 4LD0A 4DF4A 4Z4IA 4M45A 2ZD1A 2KZZA 1BHLA 3C95A 4CJWA 3HL8A 2JLEA 1WSFA 3HT3A 1BIUA 3RRHA 2G8FA 3KK3A 1T7PA 2KZMA 1TAUA 1RT7A 1S1VA 3HXMA 1L3VA 1A5XA 3L3VA 4C8LA 3NH0A 3TAFA 3IRXA 3ALYA 3SV3A 3DM2A 3CFPA 3NGIA 4CJ3A 4Q0BA 4BWMA 1XI1A 1RILA 2P51A 1QSSA 2E6MA 2Z1GA 1BGXT 2FC0A 1NK8A 5FDLA 1KFSA 4PY5A 3QETA 4HUEA 3SZ2A 1GOCA 3OS1A 3SCXA 1RT6A 1RT1A 4K8XA 1WSIA 3ZSZA 3RRGA 4FJNA 1J54A 1S9EA 4B9TA 4ELUA 4ZTFA 3M8RA 3LWLA 2VG5A 4Z4CA 2I5JA 4IFVA 1JLFA 4HUFA 4JS5A 1WN7A 3UIQA 4W5NA 1F21A 2GBZA 4CERA 4LH5A 2VG6A 3QEIA 2IDOA 3AA5X 4DQPA 5K14A 4KI6A 1Z25A 1C1AA 1X1PA 4N76A 1NK0A 3CFOA 2X74A 1X9WA 4CK3A 4W5QA 3MXMA 2OZSA 3K5OA 1LWEA 3QNOA 1NKEA 1JLAA 2XO7A 2W42A 4CJ5A 4E1NA 1EP4A 2HNZA 4DSJA 4EZ9A 2F8SA 4IG3A 4CJFA 3DRRA 3AVCA 4BDYA 3V81A 4LY7A 3TAQA 3O4NA 2PY5A 2P5OA 3QLHA 1ASWA 1LAWA 3CQ8A 3L2UA 4AHTA 3QNNA 4FLZA 4Z4HA 4CEAA 4KKOA 3VQQA 3E01A 5JS2A 2WOMA 4PQUA 1Q8IA 1BCOA 1C0TA 2YHBA 4KAZA 4HCBA 3ISNC 4FZYA 3AA4A 3ZCMA 3OVNA 4B9VA 1CLQA 1BIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1REV A;  4OLB A;  4CK1 A;  2IS3 A;  2YNH A;  4M3W A;  3THV A;  4O44 A;  3HP6 A;  1HNI A;  4KHQ A;  1JXE A;  2KTQ A;  4KI4 A;  4LH4 A;  5J2Q A;  1WAF A;  3AVA A;  4KHU A;  3PUF A;  1C0M A;  4C8N A;  4CCH A;  1S6Q A;  3D45 A;  1TAQ A;  5KGX A;  1RDB A;  1UA0 A;  1DTT A;  3V1R A;  3DLK A;  3WNH A;  2OPS A;  4FJ9 A;  3TAN A;  3V9X A;  1JLG A;  5KTQ A;  1HYS A;  2HNY A;  1FKP A;  4H4O A;  4B9M A;  4FJX A;  4M3Y A;  3IG1 A;  3AVK A;  1RTH A;  3TR8 A;  1RDD A;  1EXQ A;  1IG9 A;  1NOY A;  3DLR A;  3M8S A;  4O4G A;  1TL1 A;  1Z26 A;  4H4M A;  4EP4 A;  2YKM A;  1RT3 A;  3KJV A;  5HRR A;  3OJU A;  3F9K A;  2RN2 A;  1KVB A;  1UWB A;  3WNE A;  3AA2 A;  4CJU A;  2HHW A;  3VQ8 A;  4BWJ A;  1J53 A;  4CIE A;  3V9S A;  1NK7 A;  3OYI A;  3CYM A;  3SQ1 A;  3PX4 A;  3ZT1 A;  4BE1 A;  3AO3 A;  1QHT A;  2XHB A;  1RT5 A;  4OVL A;  1KRP A;  1BI4 B;  4HVJ A;  3KD1 E;  4I2P A;  3JSM A;  2Q3S A;  4E7H A;  4J2E A;  3AVB A;  1VRT A;  4RW6 A;  1LAV A;  1MU2 A;  4DTS A;  1C1C A;  3NF8 A;  4Y1C A;  4FJM A;  4OGC A;  4QAG A;  3VQ5 A;  3OYL A;  1C1B A;  3RMA A;  4B9U A;  4DU4 A;  5JS1 A;  3KIO A;  3B6O A;  1UOC A;  3L2R A;  1FKO A;  1Y97 A;  1KFD A;  3VQ9 A;  5C42 A;  2OPP A;  2R7Y A;  1C0U A;  1HYZ A;  3OYN A;  3OYJ A;  3LDS A;  3ZSW A;  3AVF A;  2G8V A;  4F2R A;  4M3T A;  3WNG A;  2DY4 A;  1KLM A;  4CJ4 A;  3LP3 A;  4FJL A;  2QKB A;  3DYA A;  4F8R A;  1IKX A;  4E7K A;  2HMI A;  4Z4F A;  1S5J A;  1R0A A;  3DLB A;  2IGI A;  4RW7 A;  2FBX A;  3AO2 A;  1IKV A;  4DLE A;  3QEX A;  2DTU A;  2YHA A;  3AO4 A;  3QIN A;  4ID1 A;  3LP0 A;  4E0D A;  3G0Z A;  1XWL A;  1IO2 A;  1YT3 A;  3VQ6 A;  4BE2 A;  1DLO A;  1CZ9 A;  1UA1 A;  1QQC A;  3DRP A;  4CHY A;  3KK2 A;  4QOZ B;  2XY5 A;  2KQ2 A;  4CFA A;  2GV9 A;  3H08 A;  3NAE A;  1UAX A;  1HRH A;  4RW8 A;  1RNH A;  2GUI A;  1D8Y A;  4KTQ A;  1KCF A;  1W0H A;  3K5N A;  3U3G A;  2NUB A;  4HHT A;  1N5Y A;  2ATQ A;  1BI4 A;  1JLB A;  4BDZ A;  1GOA A;  1VSH A;  5I3U A;  3NF7 A;  4CJV A;  1NJX A;  4FK0 A;  4PUO A;  1NKC A;  4AHC A;  1VSJ A;  3RMB A;  1LWF A;  3QER A;  1WLJ A;  3HVT A;  3RWU A;  5FRM A;  2VWK A;  1B9D A;  4EP5 A;  4CEE A;  3OYF A;  3DI6 A;  1L3T A;  2KFN A;  1HPZ A;  1CZB A;  3DRS A;  1BCM A;  2HB5 A;  1A5V A;  3HVR A;  4JS4 A;  1S1W A;  3SJJ A;  1NK4 A;  4NYF A;  1WNS A;  4IFY A;  3VQE A;  3EZ5 A;  4G1Q A;  4O0I A;  4JRQ A;  1TV6 A;  4MQ3 A;  3ZT2 A;  3HPH A;  1HNV A;  3NGZ A;  3HPO A;  1JXB A;  1BL3 A;  3KKS A;  2YNI A;  3ITH A;  4DSK A;  4E7L A;  2BGG A;  4FXD A;  3G10 A;  1LW0 A;  2RF2 A;  4CE9 A;  4E1M A;  1RBT A;  3C6U A;  4LSL A;  4C8M A;  5CYQ A;  3DOK A;  1RDA A;  1IH7 A;  1RTJ A;  2ZQB A;  5SZT A;  3LAK A;  1SL0 A;  4CEZ A;  1J9A A;  3C6T A;  3HM9 A;  4FLW A;  1ASU A;  4I9L A;  3TWH A;  2Z1H A;  4Z0U A;  4DQQ A;  2VG7 A;  2D0A A;  3QIP A;  1VSD A;  4JLH A;  3ZSR A;  3I0S A;  3L2W A;  1X9M A;  2F96 A;  4CES A;  3EY1 A;  4IKF A;  3B6P A;  2HHS A;  2HHX A;  4DTJ A;  1EET A;  3NFA A;  4DMN A;  4KB1 A;  1HYV A;  4NYN A;  4CGH A;  4M3U A;  3OYB A;  4NCB A;  2D0C A;  3AA3 A;  2DFF A;  4FW2 A;  1TK8 A;  1TVR A;  3QEW A;  2OPR A;  1NJY A;  1JKH A;  2XRI A;  1RCH A;  3AVL A;  5J1E A;  1NOZ A;  4TSX A;  4C8O A;  3S3O A;  4CFC A;  4CJE A;  3O3F A;  5C25 A;  3MAQ A;  2YNG A;  3PX0 A;  4DTR A;  1TK0 A;  3SV4 A;  2OA8 A;  3AVG A;  2RPI A;  4O55 A;  1ZBL A;  3QIO A;  5HLF A;  3TAG A;  4B9S A;  1S6P A;  4CFD A;  2FBT A;  3ZT0 A;  3TAE A;  4FVM A;  1TKZ A;  4RW9 A;  3OY9 A;  4NCA A;  3VA0 A;  3VQ4 A;  2G8I A;  4CIF A;  3V6D A;  2OYQ A;  5I42 A;  4I7F A;  3M8P A;  3K58 A;  1ASV A;  4AIL C;  3HYF A;  3VQB A;  3V9U A;  4CHN A;  2QK9 A;  4FJK A;  3KTQ A;  1XC9 A;  1CXU A;  3CFR A;  4N47 A;  4N41 A;  1VSE A;  3ASM A;  3SPZ A;  4ZTJ A;  4FZZ A;  3LP2 A;  1KVC A;  2HVH A;  4H8K A;  4OLA A;  3HPG A;  5DMR A;  2BE2 A;  1N6Q A;  4FYD A;  3M8Q A;  5J2P A;  5HBM A;  1RBR A;  3F73 A;  2EX3 A;  1U45 A;  1A5W A;  4XIU A;  2Z1I A;  2BDP A;  1LW2 A;  2XY8 A;  2G8W A;  4CJK A;  4PWD A;  5HRN A;  3P83 D;  3PO5 A;  4FZX C;  2HW3 A;  3T3F A;  1RTD A;  3O3H A;  4I2Q A;  4CFB A;  4FLU A;  4DU1 A;  3PY8 A;  3ZSQ A;  3V1Q A;  3OYG A;  3LAM A;  4CF9 A;  3RMC A;  5HRO A;  4K8Z A;  3K59 A;  1VSL A;  3V9Z A;  3RMD A;  4CF8 A;  3SI6 A;  1B92 A;  3NH2 A;  4CIG A;  3OYE A;  3VQP A;  3OJS A;  3S3M A;  1NJZ A;  4KRE A;  4DWI A;  1Q9X A;  3QO9 A;  3KLE A;  3OYA A;  4QCL A;  3D0P A;  3P5J A;  4FK2 A;  3O3G A;  4Z4G A;  3MEC A;  3LZI A;  4FLY A;  4FLX A;  3VA3 A;  3ZSV A;  3AO1 A;  4AHR A;  1I39 A;  4B8C A;  4M3Z A;  2XY7 A;  1T8E A;  2IAJ A;  1L3U A;  1KLN A;  3ZT4 A;  5HRS A;  4DTX A;  4CJR A;  1J5O A;  2E4L A;  2OPQ A;  2HHQ A;  1FK9 A;  4DTU A;  3CM6 A;  1VSM A;  3AVI A;  4F2S A;  1S9G A;  3NH1 A;  1BQM A;  1D9F A;  5E41 A;  3SQ0 A;  1ZBF A;  4UQG A;  4DFM A;  4F3T A;  4CEF A;  3T19 A;  1HQU A;  3C94 A;  4CEC A;  4E7I A;  1ZYQ A;  4B8A B;  3TAM A;  1HQE A;  1LWC A;  2YNF A;  4DF8 A;  2HHV A;  4BDP A;  2G8K A;  3CM5 A;  2B6A A;  4DQS A;  3AVH A;  4DTM A;  3ZT3 A;  3A2F A;  3SUP A;  1VRU A;  2G8U A;  2EHG A;  3FFI A;  4M3R A;  1S1T A;  4FM2 A;  5CYM A;  1JL1 A;  1Q9Y A;  2O4I A;  1JL2 A;  1TGO A;  4NCG A;  2X6N A;  3OS2 A;  4OKK A;  4Q5V A;  3KLF A;  5KI6 A;  4E7J A;  1SL2 A;  3DLG A;  4FJ5 A;  1TKX A;  1LV5 A;  1DTQ A;  1XHZ A;  1WSG A;  1VSI A;  3BGR A;  4AHV A;  4J2A A;  2IC3 A;  5KGW A;  3WNF A;  3NF9 A;  3I8D A;  1U04 A;  3KLI A;  3P1G A;  4DTO A;  3TAP A;  2PYL A;  4F3O A;  1CXQ A;  4M41 A;  4AHU A;  4O0J A;  1U4B A;  1ZBI A;  4IDK A;  4KTZ A;  1HJR A;  1SKR A;  4FW1 A;  3OS0 A;  1RT2 A;  3NF6 A;  4GVM A;  2XY6 A;  4HUG A;  4CGD A;  2DFH A;  1TK5 A;  4GW6 A;  4FK4 A;  3OYC A;  2G8H A;  3NHG A;  3TAB A;  1B9F A;  4FLV A;  1RTI A;  3HP9 A;  1TKD A;  4I9Q A;  3TI0 A;  4CGJ A;  2OZM A;  1NJW A;  3NDK A;  3ZSY A;  3DMJ A;  4ICL A;  3U3Y A;  1EX4 A;  1KTQ A;  1K6Y A;  4GMJ B;  1L3S A;  4RW4 A;  4CK2 A;  2PYJ A;  3PV8 A;  4KRF A;  4RG8 A;  1I3A A;  4O5B A;  4E89 A;  4DU3 A;  3LPU A;  2PZS A;  4OKJ A;  2B4J A;  2WON A;  4ELV A;  4W5O A;  1QSL A;  2F8T A;  3RTV A;  4J2D A;  4AH9 A;  5J2N A;  3PO4 A;  3VQC A;  2ETJ A;  1TL3 A;  3KLH A;  4KO0 A;  3NGY A;  4IBN A;  4DSF A;  4KB0 A;  4CED A;  1O1W A;  3SQ4 A;  3KK1 A;  4DS4 A;  3V9W A;  2AJQ A;  3LAL A;  4CJS A;  4DSE A;  4DFJ A;  1XHX A;  2DFE A;  1NK6 A;  1SKW A;  4OKE A;  4N56 A;  4FJ7 A;  3K5M A;  1VK0 A;  4CEQ A;  3V1O A;  1BQN A;  4CGG A;  3SQ2 A;  4PA1 A;  2FBY A;  1JLC A;  4FLT A;  2Y1I A;  4OJR A;  3SNN A;  3AVJ A;  4KHY A;  4ID5 A;  4CF0 A;  3LP1 A;  4DQI A;  3L8B A;  1QSY A;  1JLQ A;  4MFB A;  4OGE A;  4CJL A;  4FCY A;  5J2M A;  5D3G A;  1SV5 A;  1VSF A;  1YTA A;  3QES A;  3EYZ A;  2D5R A;  1EKE A;  2IOC A;  4R5P A;  4DS5 A;  3CG7 A;  3VQA A;  1L5U A;  2B5J A;  3LAN A;  3AO5 A;  1YTU A;  3NCI A;  3I0R A;  4CJT A;  3K2P A;  3MED A;  4Z4E A;  2ZE2 A;  3L2Q A;  3ZSO A;  3V4I A;  5KRT A;  3K5L A;  2RKI A;  4DFP A;  1KVA A;  5C24 A;  1QS4 A;  1SUQ A;  5DK5 A;  4YNQ A;  1S1X A;  4OPJ A;  3TAR A;  3IAY A;  4KPY A;  1FXX A;  4B08 A;  4KFB A;  1ZBU A;  3QEV A;  4HTU A;  4KHS A;  4B3O A;  2P5G A;  1U47 A;  2HHU A;  4W5T A;  3VQD A;  1IKW A;  4DSI A;  4M3X A;  4KV8 A;  1QE1 A;  2KFZ A;  3QEP A;  1WAJ A;  4KTW A;  3KLG A;  2BAN A;  4N5S A;  3SUO A;  4F4K A;  4CHQ A;  2YKN A;  4DG1 A;  2ITG A;  3ULD A;  4CF1 A;  1YVU A;  4FJG A;  4L8R B;  4FJI A;  3LWM A;  3IS9 A;  3O4Q A;  2Z1J A;  5CZ2 A;  4HCC A;  1RBU A;  4FJJ A;  4FJH A;  4KHW A;  4AHS A;  4DTN A;  1JLE A;  2FBV A;  2LSN A;  1ZBH A;  1WSE A;  1RBV A;  2KW4 A;  2QXF A;  3U6F A;  1WSJ A;  3DLE A;  3NBP A;  4BE0 A;  3SUQ A;  4CJP A;  2QKK A;  3SPY A;  1IKY A;  3HST B;  3ZSX A;  3JYT A;  2X6S A;  2A1R A;  3OYK A;  3MEE A;  3PX6 A;  4CHP A;  5SWM A;  3VN5 A;  3KD5 E;  2Y1J A;  2E6L A;  4CEO A;  3RR8 A;  2HND A;  3L2V A;  3S3N A;  4YFU A;  4FM0 A;  1D9D A;  4W5R A;  4OPK A;  3MEG A;  5CZ1 A;  1QTM A;  1C6V A;  1U49 A;  4EZ6 A;  3OYM A;  4CF2 A;  1SKS A;  4Y1D A;  4E19 A;  1D5A A;  3L3U A;  1T05 A;  3HO1 A;  4CGI A;  4BAC A;  4WE1 A;  3OYD A;  3K57 A;  5HP1 A;  3LPT A;  1RT4 A;  3DLH A;  1NKB A;  4E3S A;  1KSP A;  3MXJ A;  3MXI A;  2HVI A;  1W9H A;  1U48 A;  1SL1 A;  1X9S A;  4M42 A;  1VSK A;  4DTP A;  3AVM A;  3LZJ A;  4CEB A;  4DSL A;  1RBS A;  1G15 A;  5HRP A;  4DQR A;  4B9N A;  3HJF A;  2P1J A;  4LSN A;  5FRO A;  2YV0 X;  3AV9 A;  4CHZ A;  3VQ7 A;  2HHT A;  3T1A A;  4ZHR A;  1T03 A;  3AVN A;  3KKR A;  4CGF A;  4ELT A;  5T7B A;  2O4G A;  1RDC A;  5EU7 A;  4DLG A;  4IG0 A;  3SUN A;  3DOL A;  1TKT A;  1S1U A;  4B9L A;  5FRN A;  2VWJ A;  4JRP A;  4C8K A;  1GOB A;  4KHN A;  2JGU A;  4CHO A;  1BIS A;  4CJQ A;  5CY4 A;  3OYH A;  5KRS A;  4FM1 A;  3SYZ A;  4DFK A;  3S9H A;  4J2B A;  1HMV A;  3RR7 A;  3HK2 A;  2X78 A;  3NE6 A;  1NK9 A;  4FJ8 A;  1ITG A;  2A1S A;  1WSH A;  2D0B A;  1NK5 A;  3BDP A;  4LD0 A;  4DF4 A;  4Z4I A;  4M45 A;  2ZD1 A;  2KZZ A;  1BHL A;  3C95 A;  4CJW A;  3HL8 A;  2JLE A;  1WSF A;  3HT3 A;  1BIU A;  3RRH A;  2G8F A;  3KK3 A;  1T7P A;  2KZM A;  1TAU A;  1RT7 A;  1S1V A;  3HXM A;  1L3V A;  1A5X A;  3L3V A;  4C8L A;  3NH0 A;  3TAF A;  3IRX A;  3ALY A;  3SV3 A;  3DM2 A;  3CFP A;  3NGI A;  4CJ3 A;  4Q0B A;  4BWM A;  1XI1 A;  1RIL A;  2P51 A;  1QSS A;  2E6M A;  2Z1G A;  1BGX T;  2FC0 A;  1NK8 A;  5FDL A;  1KFS A;  4PY5 A;  3QET A;  4HUE A;  3SZ2 A;  1GOC A;  3OS1 A;  3SCX A;  1RT6 A;  1RT1 A;  4K8X A;  1WSI A;  3ZSZ A;  3RRG A;  4FJN A;  1J54 A;  1S9E A;  4B9T A;  4ELU A;  4ZTF A;  3M8R A;  3LWL A;  2VG5 A;  4Z4C A;  2I5J A;  4IFV A;  1JLF A;  4HUF A;  4JS5 A;  1WN7 A;  3UIQ A;  4W5N A;  1F21 A;  2GBZ A;  4CER A;  4LH5 A;  2VG6 A;  3QEI A;  2IDO A;  3AA5 X;  4DQP A;  5K14 A;  4KI6 A;  1Z25 A;  1C1A A;  1X1P A;  4N76 A;  1NK0 A;  3CFO A;  2X74 A;  1X9W A;  4CK3 A;  4W5Q A;  3MXM A;  2OZS A;  3K5O A;  1LWE A;  3QNO A;  1NKE A;  1JLA A;  2XO7 A;  2W42 A;  4CJ5 A;  4E1N A;  1EP4 A;  2HNZ A;  4DSJ A;  4EZ9 A;  2F8S A;  4IG3 A;  4CJF A;  3DRR A;  3AVC A;  4BDY A;  3V81 A;  4LY7 A;  3TAQ A;  3O4N A;  2PY5 A;  2P5O A;  3QLH A;  1ASW A;  1LAW A;  3CQ8 A;  3L2U A;  4AHT A;  3QNN A;  4FLZ A;  4Z4H A;  4CEA A;  4KKO A;  3VQQ A;  3E01 A;  5JS2 A;  2WOM A;  4PQU A;  1Q8I A;  1BCO A;  1C0T A;  2YHB A;  4KAZ A;  4HCB A;  3ISN C;  4FZY A;  3AA4 A;  3ZCM A;  3OVN A;  4B9V A;  1CLQ A;  1BIZ A; 
#chains in the Genus database with same CATH topology
 4OLB A;  2YNH A;  4O44 A;  4JNE A;  3HP6 A;  4KI4 A;  4LH4 A;  1BU6 O;  4KHU A;  3PUF A;  1NMD A;  2HHH K;  2IVN A;  2Q97 A;  2OPS A;  3DXM B;  3TAN A;  5KTQ A;  4IDH A;  1HYS A;  4CI6 A;  5AQI A;  4LF9 K;  3TR8 A;  1IG9 A;  3M8S A;  1Z26 A;  4O8K A;  3DXK B;  1VQK N;  4PHT X;  4CD1 A;  2WTU A;  2FSK A;  3WNE A;  4CJU A;  1HX1 A;  3BY5 A;  3OYI A;  3CYM A;  4GV9 A;  4OPA A;  3ZT1 A;  5JIC A;  3O5B A;  1RT5 A;  4OVL A;  4HVJ A;  2CH6 A;  1NGD A;  2Q3S A;  3UKR B;  3H3N O;  3LM9 A;  3MK6 A;  1OKJ A;  4OGC A;  1QQM A;  1C1B A;  3B6O A;  4BRQ A;  1Y97 A;  5M1Q A;  1C0G A;  1C0U A;  2QXL A;  3OYN A;  5AQV A;  2G8V A;  3K0S A;  3KVG A;  4CJ4 A;  5C0Y A;  1NM1 A;  4F8R A;  2PBD A;  3VES A;  1R0A A;  2IGI A;  3M6G A;  3QIN A;  4ID1 A;  4FWM A;  4CZE A;  3G0Z A;  1IO2 A;  4BE2 A;  4CBX A;  5KQ8 A;  1QQC A;  1LOT B;  4GKK K;  2KQ2 A;  2GV9 A;  3NAE A;  5KPT A;  1IV0 A;  5FPN A;  4HHT A;  1N5Y A;  1JCG A;  3CJC A;  3G6E N;  3TSQ A;  5I3U A;  4PUO A;  1NJX A;  3IKM A;  1VSJ A;  1HR0 K;  5FRM A;  4ILH A;  1WLJ A;  5LJV A;  3ID6 A;  5C12 A;  1OVQ A;  2D0O A;  2KFN A;  1CZB A;  1HPZ A;  3DRS A;  3H6E A;  1A5V A;  3HVR A;  1YXQ A;  3CCR N;  1S1W A;  4JS4 A;  4IFY A;  2PAV A;  3A5N C;  4BR5 A;  5DM6 L;  2I7N A;  4MQ3 A;  3ZT2 A;  3NGZ A;  1BOT O;  1JXB A;  1BL3 A;  4B1Y B;  3CC4 N;  3G10 A;  2RF2 A;  3C6U A;  4C8M A;  3MWT A;  3Q7C A;  3LAK A;  2O8F B;  4JD2 A;  4WFN L;  3TWH A;  2Z1H A;  3J8A A;  2VG7 A;  4H0V B;  1VSD A;  1X9M A;  4IKF A;  5AQZ A;  1E4G T;  5EX5 A;  1HNZ K;  4Z94 A;  3NFA A;  1NGF A;  5LMU K;  1HYV A;  4KB1 A;  3VF6 A;  4CZK A;  4YDU A;  2QW9 A;  4NCB A;  2DFF A;  4FW2 A;  3HSC A;  2XRI A;  4DR6 K;  4OO1 J;  1RCH A;  4B9Q A;  4BRG A;  3AGK A;  3SAF A;  3PX0 A;  3SV4 A;  2OA8 A;  2RPI A;  1ZBL A;  4LFB K;  1S6P A;  1OH8 A;  4RW9 A;  1GLA G;  2D0P A;  2OYQ A;  5I42 A;  4YOX A;  4BGB A;  4FJK A;  3KTQ A;  1XC9 A;  3CFR A;  1WUA A;  3ASM A;  4FOI A;  3LP2 A;  2HVH A;  4H8K A;  5DMR A;  2BE2 A;  1W97 L;  2QWR A;  3EL2 A;  2HST A;  5J2P A;  4H5V A;  2EX3 A;  2CGJ A;  3P83 D;  1EWQ A;  4CFB A;  3LDN A;  4C1N K;  3PY8 A;  3CCE N;  3V1Q A;  3OYG A;  4BY9 C;  4K8Z A;  1VSL A;  3R9P A;  4CF8 A;  3SI6 A;  3NH2 A;  2P9N B;  3RVC A;  3OJS A;  1NJZ A;  1ATS A;  4DWI A;  2ZF5 O;  3QO9 A;  3CCV N;  3OYA A;  5AJ3 K;  3P5J A;  5BRF A;  4FK2 A;  3MN7 A;  4K43 A;  4JI5 K;  4JEP A;  3AO1 A;  4B8C A;  1L3U A;  1E4F T;  5M1K A;  3HBT A;  2OPQ A;  1T44 A;  3VEO A;  5E26 A;  1FK9 A;  3T7Z A;  2GEL A;  3WUH A;  1S9G A;  1BQM A;  1MWM A;  5AQY A;  2YHX A;  4M63 C;  1K8K B;  4F3T A;  4RCH A;  4E7I A;  4B8A B;  1FJG K;  3TAM A;  2HHV A;  3WEE B;  3CMA N;  4H0P A;  2GTD A;  3AVH A;  3DXM A;  3ZT3 A;  3A2F A;  1RDW X;  3FFI A;  3M1F A;  1JL2 A;  4ISG A;  3OS2 A;  3KLF A;  5KI6 A;  1TKX A;  3ENH A;  4JD2 B;  4A5A A;  1U04 A;  3P1G A;  3TAP A;  4KTZ A;  3ENO A;  4FVU A;  1RT2 A;  4GVM A;  3CCS N;  4CGD A;  2G8H A;  3NHG A;  3TAB A;  1B9F A;  1KAX A;  1RTI A;  4CGJ A;  5AQR A;  3SMS A;  4DUZ K;  3DMJ A;  4BRH A;  1VQ8 N;  1KTQ A;  1U2V B;  2UUB K;  4RW4 A;  4JI8 K;  3AAR A;  3A5O C;  3C6A A;  1I3A A;  2UUA K;  4OKJ A;  3O9R A;  1QSL A;  3B8A X;  3D2F B;  3ZYY X;  3F9M A;  4IBN A;  4KB0 A;  4CED A;  1O1W A;  1SS6 A;  3PIO L;  3V9W A;  2AJQ A;  5C10 A;  2ITM A;  5KPR A;  4DSE A;  1IG8 A;  4FJ7 A;  4DV1 K;  1VK0 A;  3MX2 A;  4PA1 A;  3AVJ A;  4KHY A;  4CF0 A;  3L8B A;  4H0X B;  4OGE A;  1VSF A;  3R6M A;  4BQL A;  2D5R A;  1EKE A;  2O8B B;  3CG7 A;  3VQA A;  3NCI A;  3I0R A;  3EKU A;  4Z4E A;  3ZSO A;  3V4I A;  3M3Z A;  2W6L A;  5KRT A;  2QWO A;  2RKI A;  4OPH A;  5C24 A;  1SUQ A;  4YNQ A;  3IAY A;  1FXX A;  4B08 A;  3QEV A;  2E1Z A;  1V4T A;  2QWN A;  3HM8 A;  1IBM K;  1QE1 A;  4EAH D;  3KLG A;  2BAN A;  4K42 A;  4YDU C;  1GLD G;  3LWM A;  5CZ2 A;  4IFE A;  4FJH A;  3Q7B A;  4K0K K;  1ZBH A;  3WQU A;  1WSE A;  1RBV A;  4ISF A;  3U6F A;  3DLE A;  4FWS A;  3CME N;  4B1Z A;  1H1V A;  3E9P A;  3O08 A;  4FWR A;  1IKY A;  3JYT A;  3SPY A;  3FFK B;  3MEE A;  5M1O A;  5M1F A;  3OYK A;  4V19 S;  2ZJQ L;  3O9S A;  4BC3 A;  2HND A;  4OPK A;  1QTM A;  1SKS A;  3O80 A;  3K57 A;  5HP1 A;  3R8E A;  1BA1 A;  1D4X A;  1V4S A;  1W9H A;  3J7Y P;  2ZM6 K;  2QWL A;  2P9K A;  4CEB A;  1RBS A;  4B9N A;  3HJF A;  1U6Z A;  2YV0 X;  1KAY A;  1VQL N;  2HHT A;  2F9T A;  3AGR A;  2A41 A;  1T03 A;  1VAZ A;  3KKR A;  5AQT A;  5EU7 A;  4DLG A;  3DOL A;  5LMN K;  1TKT A;  4JRP A;  1GOB A;  4CHO A;  5CE3 A;  5AQS A;  2OCE A;  1XMQ K;  1QVG M;  4GKJ K;  3RR7 A;  1O13 A;  3HK2 A;  1BWF O;  1ITG A;  2VYP A;  4FWN A;  2KZZ A;  4DV5 K;  3HL8 A;  3HT3 A;  1WSF A;  3FR0 A;  2W40 A;  3QBX A;  1TAU A;  1A5X A;  3L3V A;  3U4L A;  3TAF A;  4YOW A;  2NRV A;  2P9I B;  4CJ3 A;  4BWM A;  1NK8 A;  1Y64 A;  4HUE A;  1RT6 A;  1RT1 A;  3GOI A;  3D7E O;  2FSJ A;  1J54 A;  3M8R A;  3LWL A;  3CF5 L;  4HUF A;  4IFV A;  4LH5 A;  1Q18 A;  5K14 A;  1Z25 A;  3OBY A;  3ZET A;  5MLC Q;  5F0X A;  3JAM O;  1X9W A;  4AM7 A;  2UXD K;  3QBW A;  2A3Z A;  2OZS A;  2W42 A;  4IJA A;  1EP4 A;  3C65 A;  4DSJ A;  1HKB A;  4CJF A;  5C2F A;  4LY7 A;  1DT9 A;  3QLH A;  1LAW A;  3LL3 A;  3KWG A;  1BCO A;  1C0T A;  3ZCM A;  3CCL N;  2QKB A;  1REV A;  2VGM A;  1NNE A;  1P90 A;  2KTQ A;  1JXE A;  2UU9 K;  1WAF A;  1P8Z A;  4CCH A;  1YF5 L;  1DTT A;  4A5B A;  4DHY A;  1KC8 O;  1OVY A;  2HNY A;  1NMN A;  3CCQ N;  2Q2R A;  4FJX A;  3IG1 A;  1SQK A;  1NOY A;  1EXQ A;  3VEN A;  2V7Y A;  5GAD P;  3ULE B;  3F5T A;  3DLL L;  2ASO A;  1TL1 A;  3U8X A;  3H3O B;  3OJU A;  3F9K A;  2RN2 A;  1KVB A;  1UWB A;  3QFP A;  3AA2 A;  3K9K A;  1ILY A;  1J53 A;  3VOV A;  1K8A O;  4BE1 A;  3AO3 A;  1N33 K;  1QHT A;  1T3V A;  2XHB A;  3HI0 A;  4CZG A;  3JSM A;  4E7H A;  1VQM N;  4J2E A;  4A2A A;  1LAV A;  1MU2 A;  4DTS A;  1C1C A;  3NF8 A;  4MDA A;  4QAG A;  4LC9 B;  3KZB A;  1UOC A;  1VQ9 N;  5F2R A;  1KFD A;  3VQ9 A;  2OPP A;  2R7Y A;  5BRD A;  3OYJ A;  4F2R A;  4M3T A;  5BPL A;  3WNG A;  3VF2 A;  4DV7 K;  2DY4 A;  4DV6 K;  3DYA A;  2QEX N;  2HMI A;  3AO2 A;  1IKV A;  4DLE A;  3QEX A;  2DTU A;  4BC2 A;  2A42 A;  4B3T K;  1CZ9 A;  3KK2 A;  3P31 A;  4QOZ B;  4CFA A;  1HRH A;  4Y0W A;  2FLO A;  2GUI A;  1D8Y A;  3UKU B;  4KTQ A;  1KCF A;  3AAP A;  5AR0 A;  4GV3 A;  2NUB A;  4DB3 A;  3VTH A;  2ATQ A;  4WFB L;  1BI4 A;  4BDZ A;  1GOA A;  4FK0 A;  4IO8 A;  1NKC A;  4RWT A;  3EEQ A;  3HVT A;  5GAH P;  3ZLJ A;  4A62 A;  3TSP A;  3VQE A;  3EZ5 A;  4O0I A;  3FZM A;  3HPH A;  3O6W A;  1Q86 O;  1JJ2 M;  2YNI A;  3ITH A;  4LFC K;  3GE1 A;  1LW0 A;  3VPZ A;  4E1M A;  4YOT A;  4BRF A;  1SL0 A;  4YOU A;  1J9A A;  3C6T A;  2E20 A;  2WFB A;  5AZJ A;  4DQQ A;  2NRW A;  5CR4 A;  4JLH A;  3B6P A;  5JVH L;  5IT9 O;  2HHX A;  4DMN A;  4YHH K;  3SLC A;  2D0C A;  2V51 B;  1NJY A;  1HKG A;  1JKH A;  1ATN A;  5J1E A;  3LDL A;  4TSX A;  4PKI A;  4CJE A;  3BZC A;  3CJ1 A;  3TTF A;  2YX6 A;  4H03 B;  5C25 A;  5FPE A;  4FOE A;  4KH6 A;  3RSE A;  3AVG A;  4O55 A;  5HLF A;  4B9S A;  3H1V X;  4A61 A;  4CFD A;  1TKZ A;  4I7F A;  3K58 A;  4AIL C;  3HYF A;  3M5R A;  3VQB A;  3HOS A;  2V7Z A;  3V9U A;  4N41 A;  4JN4 A;  1VSE A;  5EVZ A;  1HNW K;  2VWB A;  5GIP A;  1KVC A;  2PFU A;  3M8Q A;  2BDP A;  2XY8 A;  2G8W A;  4PWD A;  4CJK A;  1ATR A;  3CCM N;  2HW3 A;  1C0F A;  2NRX A;  3SMP A;  4CZL A;  1RTD A;  2YJF A;  1YVN A;  3RMC A;  2P9P B;  1X3N A;  4H5W A;  3CXC M;  3VQP A;  2F7T A;  3DJC A;  4IJN A;  3MEC A;  3LZI A;  4KH5 A;  2KKZ A;  4AHR A;  1I39 A;  3CCJ N;  2IAJ A;  4BR4 A;  1KLN A;  1NGE A;  2HHQ A;  1VQ5 N;  3GL1 A;  2WUS A;  1U2V A;  5AQL A;  5E41 A;  2ZJP L;  4DFM A;  4ILJ A;  4CEF A;  1HQU A;  2E2O A;  4H0O A;  3THX A;  5AQK A;  4BDP A;  3CCU N;  2P9L B;  3SUP A;  1HUX A;  3EO3 A;  5CYM A;  1JL1 A;  2BUP A;  5HOO A;  2X6N A;  5AQH A;  4E7J A;  5AZI B;  1DTQ A;  3BP8 A;  1VSI A;  5AQU A;  5KGW A;  3I8D A;  3NF9 A;  3KLI A;  2YI1 A;  1CXQ A;  1ZBI A;  2AP1 A;  2XY6 A;  4FK4 A;  4GW6 A;  4DUY K;  4I9Q A;  4FLV A;  3HP9 A;  1SZ2 A;  4EFH A;  1EX4 A;  4GMJ B;  2F4V K;  3PV8 A;  1T6C A;  4LF8 K;  4RG8 A;  4NLB A;  4KRF A;  3CQX A;  3QFU A;  1BUP A;  4ELV A;  4W5O A;  2F8T A;  5J2N A;  3PO4 A;  2ETJ A;  3KLH A;  4KO0 A;  3NGY A;  4CVN E;  2CGL A;  4DS4 A;  3THY B;  3LAL A;  1Q81 O;  1T6D A;  3I56 N;  2E2N A;  3K5M A;  2E88 A;  2J4R A;  4CEQ A;  4CJ7 A;  1BQN A;  4XEI A;  1X9J A;  3BF3 A;  5GAG P;  2FBY A;  4FLT A;  1R59 O;  4MFB A;  4CJL A;  5J2M A;  5D3G A;  3K9J A;  3EYZ A;  3HZ6 A;  2HOE A;  4R5P A;  4B1V A;  4X65 K;  1L5U A;  3AO5 A;  3C0B A;  5E84 A;  3IUC A;  2P9U A;  3O8M A;  4DFP A;  4NB4 A;  3CI5 A;  4FPA A;  1QZ6 A;  4KFB A;  4HTU A;  1U47 A;  2HHU A;  3VQD A;  4DSI A;  4XH4 A;  2KFZ A;  4AQY K;  3QEP A;  3U9Z A;  3GBT A;  2Q0R A;  4F4K A;  4CHQ A;  5H1S Q;  4L8R B;  4CF1 A;  4FJG A;  1YIT N;  4CD3 A;  3W3D A;  3IS9 A;  4BRD A;  5AQQ A;  4JHD B;  4OX9 K;  2P9S A;  1W7A A;  2GWK A;  4AHS A;  4DTN A;  2FBV A;  4F9O A;  3E1Y A;  1WSJ A;  3NBP A;  5KQD A;  3SUQ A;  5HL7 L;  1JCF A;  4IOX A;  3PX6 A;  4IO9 L;  3VN5 A;  2Y1J A;  2E6L A;  4CEO A;  1DKG D;  3HRG A;  3RR8 A;  1D9D A;  4EZ6 A;  3MEG A;  2ZGZ A;  5CZ1 A;  1C6V A;  3T1H K;  1U49 A;  3OYM A;  4CF2 A;  3HO1 A;  1D5A A;  1T05 A;  5JLH A;  3OYD A;  2AA4 A;  3CJ9 A;  4JI0 K;  3O9Q A;  5AZI A;  1RT4 A;  1NKB A;  5JMV A;  1S72 N;  4JAX A;  2HVI A;  4WFA L;  1VSK A;  4DSL A;  1G15 A;  5HRP A;  1ESV A;  4NLC A;  5EY4 A;  1HNX K;  2P1J A;  3THW A;  3AV9 A;  3THX B;  2A5X A;  4ZHR A;  3A5M C;  3AVN A;  4CGF A;  4ELT A;  5T7B A;  1GLC G;  1RDC A;  2VQE K;  1S1U A;  4B9L A;  4C8K A;  1NGI A;  4FM1 A;  4FZZ A;  4M7Y A;  3OYH A;  5KRS A;  1QHA A;  4DFK A;  1HMV A;  2YHW A;  2X78 A;  1NK9 A;  2A1S A;  1WSH A;  1NK5 A;  1DGK N;  4DF4 A;  4M45 A;  2ZD1 A;  4CJW A;  4JI3 K;  3RRH A;  1BIU A;  4C1N I;  2VCP A;  4BG8 A;  1J5E K;  4BVP A;  3O4W A;  3DM2 A;  2P51 A;  4HWI A;  5FDL A;  4LF7 K;  1HPM A;  3QET A;  3O1W A;  3I33 A;  3SZ2 A;  3OS1 A;  3SCX A;  4K8X A;  3VET A;  5AQO A;  3WXM B;  2FXU A;  2UXB K;  3CJA A;  4CZH A;  4B9T A;  4ELU A;  2VG5 A;  4Z4C A;  1JLF A;  1WN7 A;  3DAW A;  4WYB A;  1F21 A;  4CER A;  3QEI A;  4DQP A;  1RDU A;  1C1A A;  3C6H A;  1WB9 A;  3MDQ A;  3BF1 A;  4W5Q A;  1LWE A;  2OTJ N;  1JLA A;  3SBT A;  4BVO A;  4CJ5 A;  4E1N A;  1YJN N;  4JV5 K;  3G4S N;  4EZ9 A;  5AFU H;  2F8S A;  3AVC A;  3V81 A;  4JI4 K;  2PY5 A;  3O4N A;  5FLX O;  3CQ8 A;  3QNN A;  1NG9 A;  4Z4H A;  4JKF A;  4CEA A;  3VQQ A;  5BN9 A;  2EWS A;  4KAZ A;  4HCB A;  3ISN C;  3AA4 A;  2KLA A;  4JKC A;  3ENB A;  2NLX A;  3QEW A;  1CLQ A;  2ASM A;  2IS3 A;  1KAZ A;  1NGH A;  4WCE L;  3THV A;  1HNI A;  4KHQ A;  5J2Q A;  2WC9 A;  3CC2 N;  2O8C A;  3VF4 A;  4HTL A;  4JKB A;  1S6Q A;  3D45 A;  1TAQ A;  5KGX A;  1VQO N;  1RDB A;  3V1R A;  3DLK A;  4FJ9 A;  1YHQ N;  3F2K A;  4H4O A;  4B9M A;  4K41 A;  1XNR K;  1RDD A;  3DLR A;  4O4G A;  1X3M A;  4EP4 A;  5BPM A;  2YKM A;  1WOQ A;  4B3M K;  2NNW A;  1NGC A;  1SAZ A;  2YJE A;  3KJV A;  3PSF A;  2VQF K;  1BO5 O;  4GVE A;  2NRH A;  4DR7 K;  3QML A;  4CIE A;  3CIP A;  3SQ1 A;  2QA4 N;  3IMX A;  3SJH A;  3N4P A;  5LY3 A;  4PKG A;  1BI4 B;  3KD1 E;  4I2P A;  3AVB A;  4RW6 A;  3UKU A;  4X64 K;  4Y1C A;  1ZBS A;  2E5L K;  3OYL A;  3RMA A;  4B9U A;  3CJ7 A;  4DU4 A;  5JS1 A;  3ATU A;  3ZSW A;  3LP3 A;  1IJJ A;  3FZL A;  1IKX A;  4Z4F A;  4QS8 A;  2W6K A;  2F9W A;  1LCU A;  2FBX A;  1RFQ A;  2YHA A;  3AO4 A;  5LL6 Z;  3LP0 A;  4IXC A;  3WT0 A;  3T1Y K;  1XWL A;  4QS7 A;  3L4I A;  3DRP A;  4CHY A;  3ZEU A;  3OBW A;  1UAX A;  4RW8 A;  4YOV A;  1EWR A;  5TKY A;  3T69 A;  4CW7 B;  2QI2 A;  2ZGY A;  1YI2 N;  2YCH A;  2A40 A;  1BA0 A;  1JLB A;  2RE2 A;  4CJV A;  4AHC A;  1QZ5 A;  3RMB A;  3QER A;  4O8U A;  1NJI O;  2O8E B;  4JKG B;  1B9D A;  1K9M O;  1L3T A;  1BCM A;  3UE5 A;  4NYF A;  2GWJ A;  4G1Q A;  3O9U A;  3VEZ A;  3A8Y A;  1HNV A;  3HPO A;  2W41 A;  3KKS A;  2BGG A;  4FXD A;  4CE9 A;  1RBT A;  5CYQ A;  3DOK A;  1RDA A;  1IH7 A;  3MWP A;  4CEZ A;  3HM9 A;  4WQ4 C;  4FLW A;  1ASU A;  4Z0U A;  2D0A A;  4BRN A;  4DR3 K;  3L2W A;  2F96 A;  3EY1 A;  2HHS A;  4DR4 K;  2FF6 A;  4NYN A;  4CGH A;  4M3U A;  3OYB A;  3AA3 A;  2WBN A;  5B8H A;  3EN9 A;  3AVL A;  4C8O A;  3O3F A;  3EZW A;  4JI6 K;  4DTR A;  4IOC L;  1M1K O;  1IBK K;  3WXL A;  5BR8 K;  3QIO A;  5C15 A;  1VQN N;  2FBT A;  3TAE A;  4FVM A;  1NGB A;  4NCA A;  3VA0 A;  3VQ4 A;  3V6D A;  1MDU B;  4KH4 A;  1HKC A;  2QK9 A;  1CXU A;  4DR1 K;  4N47 A;  4B1W B;  5ADX A;  3ZET B;  3SPZ A;  4ZTJ A;  4GY2 B;  4OLA A;  3HPG A;  4BRI A;  1N6Q A;  5HBM A;  1RBR A;  1EO1 A;  1A5W A;  4H0T B;  2BH1 A;  2Z1I A;  4XIU A;  3NMU A;  4FO0 A;  1M90 O;  3PO5 A;  4I2Q A;  4FLU A;  2Q1N A;  4O5F A;  3LAM A;  4CF9 A;  5HRO A;  3D2E A;  3V9Z A;  3RMD A;  4CIG A;  2E8A A;  3S3M A;  3FZH A;  1Q9X A;  3BEX A;  3KLE A;  4QCL A;  4Z4G A;  3VGK A;  4WQ5 C;  4FLY A;  4FLX A;  5IWA K;  3VGL A;  4M3Z A;  1T8E A;  3ZT4 A;  5HRS A;  4DTX A;  4CJR A;  1J5O A;  2E4L A;  4B3R K;  1MWK A;  1QQO A;  4DTU A;  3CM6 A;  3AVI A;  3NH1 A;  4B1U B;  1D9F A;  4UQG A;  4NXN K;  3FGU A;  1GLB G;  1S3X A;  1ZYQ A;  1HQE A;  1LWC A;  2YNF A;  4JK9 A;  4DF8 A;  3HTV A;  1OH6 A;  3CM5 A;  4DQS A;  4DTM A;  1VRU A;  2EHG A;  4M3R A;  1S1T A;  1ZC6 A;  2P9K B;  4FM2 A;  1Q9Y A;  1YJ9 N;  4NCG A;  5I9E B;  4OKK A;  4Q5V A;  3E9O A;  4FJ5 A;  3D6R A;  1SL2 A;  1LV5 A;  1WSG A;  3BGR A;  4J2A A;  3KWI A;  1XQS C;  2JWK A;  3WNF A;  5BN8 A;  3JS6 A;  4DTO A;  4M41 A;  4AHU A;  4YOY A;  4IDK A;  1HJR A;  1SKR A;  4FW1 A;  2CGK A;  3NF6 A;  3FE1 A;  1TK5 A;  4HUG A;  2DFH A;  1TKD A;  3TI0 A;  4FL9 A;  2OZM A;  1NJW A;  3ZSY A;  4DR5 K;  4ICL A;  3U3Y A;  4CK2 A;  3CPE A;  4DU3 A;  3TPQ A;  3LPU A;  2B4J A;  2WON A;  3MN5 A;  4J2D A;  4AH9 A;  4CZI A;  3HOT A;  3SQ4 A;  3KK1 A;  2KHO A;  3CQY A;  1XHX A;  2DPN A;  4DFJ A;  1E3M A;  1HJO A;  4N56 A;  3V1O A;  5ELZ A;  4I6M A;  1TYQ B;  2Q0U A;  4ID5 A;  3LP1 A;  1QSY A;  4FWP A;  3EE8 A;  4FCY A;  1SV5 A;  3QES A;  2NRR A;  2IOC A;  4DS5 A;  2B5J A;  3LAN A;  1YTU A;  4CJT A;  1Z05 A;  3MED A;  1VHX A;  2ZE2 A;  3C7N B;  3ID8 A;  1KVA A;  3SK3 A;  1QS4 A;  1S1X A;  3TAR A;  1IBL K;  1ZBU A;  4B3O A;  2YHY A;  4IOA L;  2P5G A;  5LJW A;  1IKW A;  4M3X A;  1WAJ A;  5AQM A;  4KTW A;  3VER A;  2HMP A;  4N5S A;  3SUO A;  2HF4 A;  2YKN A;  2ITG A;  5DM7 L;  1OH5 A;  4FJI A;  3O4Q A;  3D2F A;  2Z1J A;  2FF3 B;  4MO4 A;  4HCC A;  3CC7 N;  3N4Q A;  1RBU A;  4FJJ A;  1N32 K;  3THW B;  2LSN A;  3P39 A;  4B3S K;  3R1X A;  2QXF A;  4BE0 A;  5BPN A;  3QB0 A;  4CJP A;  3P4I A;  3BZK A;  5SWM A;  1CZA N;  4FSV A;  3KD5 E;  3VGM A;  3S3N A;  4W5R A;  4DV2 K;  4E19 A;  3L3U A;  4JK7 A;  4BAC A;  4L3Q A;  4A57 A;  4BRC A;  3LPT A;  2UXC K;  3MXI A;  1U48 A;  4GV6 A;  2O8C B;  2NZT A;  4DTP A;  4CBU A;  3LZJ A;  4JKD A;  3J80 O;  4NO7 A;  1YIJ N;  4PKH A;  5FRO A;  2HBM A;  3L0Q A;  2P9S B;  3L6Q A;  1QQN A;  2VGN A;  4JHD A;  3WEE A;  3T1A A;  2OAN A;  2O4G A;  3VEW A;  1K8K A;  4LF6 K;  4JKE A;  5FRN A;  4KHN A;  2JGU A;  4CJQ A;  5CY4 A;  4ISE A;  1N8R O;  4FJ8 A;  2D0B A;  3W0L A;  3P38 A;  1BHL A;  2P9U B;  1XNQ K;  3KK3 A;  2KZM A;  1S1V A;  1L3V A;  2GEM A;  3VMF B;  3NH0 A;  3ALY A;  3CFP A;  2P9N A;  3KK7 A;  3NGI A;  4Q0B A;  2IVP A;  1RIL A;  3E66 A;  1BGX T;  2FC0 A;  1KFS A;  1G99 A;  4BR9 A;  3A0I X;  3ZSZ A;  3RRG A;  1S9E A;  4DCH A;  4ZTF A;  2I5J A;  3UIQ A;  4JS5 A;  2QWM A;  3QIC A;  2VG6 A;  3THY A;  4IWV A;  4KI6 A;  3VEV A;  1NU0 A;  3DWL A;  1TUY A;  3MXM A;  3K5O A;  2D4W A;  2IVO A;  3QNO A;  2XO7 A;  4BRA A;  3UB5 A;  4IG3 A;  1ASW A;  3FZK A;  4AHT A;  4FLZ A;  3PIP L;  3TSU A;  2UYT A;  2YHB A;  5A2Q O;  3OVN A;  4CK1 A;  4M3W A;  3GG4 A;  5GAE P;  3AVA A;  2UUC K;  1C0M A;  4C8N A;  4U67 L;  1DEJ A;  4PL7 A;  1UA0 A;  2P9L A;  3WNH A;  1BDG A;  3V9X A;  2O8F A;  4JKA A;  1JLG A;  3CD6 N;  1FKP A;  5AQP A;  1I94 K;  3SBG A;  4M3Y A;  3AVK A;  1RTH A;  4BRP A;  1YJW N;  3MN9 A;  4WQ4 A;  4H4M A;  2GUP A;  1RT3 A;  3L4Q A;  5GIO A;  1VQ4 N;  5HRR A;  3VTI A;  4M7X A;  2HHW A;  3VQ8 A;  4BWJ A;  3V9S A;  3CET A;  1NK7 A;  4JI2 K;  3PX4 A;  1EQY A;  1KRP A;  4BRL A;  1VRT A;  4PL8 A;  3SAH A;  2QWQ A;  4FJM A;  1GLL O;  3VQ5 A;  4DV4 K;  4GNI A;  1NGG A;  3KIO A;  3I55 N;  3GDQ A;  3L2R A;  1FKO A;  5C42 A;  1HYZ A;  3LDS A;  3AVF A;  1J6Z A;  4KHP K;  1GLE G;  1KLM A;  4FJL A;  3MMV A;  4ILG B;  4E7K A;  1YAG A;  3LDP A;  5AQX A;  4BC4 A;  1S5J A;  3DLB A;  4RW7 A;  4E0D A;  4QS9 A;  1YT3 A;  3VQ6 A;  1DLO A;  1UA1 A;  2ZJR L;  4CBW A;  2XY5 A;  3H08 A;  1RNH A;  4K25 A;  3AAQ A;  3NVM A;  1W0H A;  5BRH A;  3UKR A;  4BR2 A;  3K5N A;  3U3G A;  4X66 K;  4JK8 A;  5JLF A;  1XMO K;  1VSH A;  3TTD A;  3NF7 A;  4KRE A;  3MX5 A;  3I8B A;  1LWF A;  4FWK A;  3RWU A;  2VWK A;  4EP5 A;  4YY3 K;  4CEE A;  3OYF A;  3DI6 A;  1FW6 A;  2HB5 A;  3PSI A;  1NK4 A;  1VQ7 N;  3SJJ A;  1WNS A;  4IZ9 A;  4H5T A;  4LF5 K;  3DXK A;  4JRQ A;  1TV6 A;  1GLJ O;  1QVF M;  4DSK A;  3MCP A;  4E7L A;  3H45 C;  3IDH A;  4JYA K;  4LSL A;  1W2B M;  1RTJ A;  2ZQB A;  5SZT A;  3O9T A;  2Q31 A;  3AY9 A;  4I9L A;  2HBL A;  4J8F A;  3QIP A;  3ZSR A;  3I0S A;  4CES A;  1BG3 A;  4DTJ A;  1EET A;  2RHK A;  3PLA A;  1RGI A;  3A5L C;  1TK8 A;  1TVR A;  5EOY A;  2OPR A;  3G25 A;  4R79 A;  4E1J A;  3IFR A;  1NOZ A;  3S3O A;  3ZX3 A;  4CFC A;  4H5R A;  3MAQ A;  2YNG A;  2OTL N;  2IIR A;  1TK0 A;  4BR0 A;  3TAG A;  3QDK A;  3ZT0 A;  3OY9 A;  2NRT A;  5GIN A;  2G8I A;  3VEY A;  4CIF A;  3M8P A;  1ASV A;  1NWK A;  1JCE A;  3WXK A;  2FSN A;  4CHN A;  5AQW A;  2O8D A;  3C7N A;  3WXJ A;  1KQS M;  2H3G X;  4WF9 L;  4BQZ A;  4FYD A;  3F73 A;  1U45 A;  1NGJ A;  1LW2 A;  3CPW M;  2P9P A;  5HRN A;  3ATV A;  4FZX C;  3T3F A;  5BR9 A;  3O3H A;  4NXM K;  4DU1 A;  3ZSQ A;  2QM1 A;  1TYQ A;  4I6M B;  3K59 A;  1B92 A;  3OYE A;  4BRO A;  4X62 K;  3D0P A;  3O3G A;  3VA3 A;  3MN6 A;  4EIA A;  3ZSV A;  2XY7 A;  4JI7 K;  3TU5 A;  5C2D A;  4F2S A;  1VSM A;  4EHT A;  3RSE B;  3SQ0 A;  1ZBF A;  3FZF A;  3ULE A;  3T19 A;  4EHU A;  4JKH A;  1N36 K;  3C94 A;  4CEC A;  3WXI A;  1Q82 O;  4U7B A;  2G8K A;  2B6A A;  1OH7 A;  2G8U A;  3R3L A;  5F1X A;  2O4I A;  4A59 A;  1TGO A;  4AM6 A;  4BRK A;  3DLG A;  5AZJ B;  1XHZ A;  4AHV A;  3JXU A;  2IC3 A;  2D1K A;  2PYL A;  4F3O A;  4O0J A;  1U4B A;  1S22 A;  4DV3 K;  3OS0 A;  4DR2 K;  3OYC A;  1XUP O;  4CZM A;  1N34 K;  3NDK A;  4BRE A;  1L3S A;  1K6Y A;  2PYJ A;  3OA9 A;  3KHY A;  4O5B A;  4E89 A;  4BG9 A;  2PZS A;  3RTV A;  3VQC A;  1TL3 A;  3LDO A;  4IEE A;  5M1N A;  4DSF A;  4CJS A;  1NK6 A;  2DFE A;  5ADX H;  1SKW A;  4OKE A;  3D2E B;  4CGG A;  3SQ2 A;  2Y1I A;  1JLC A;  4MO5 A;  3SNN A;  4OJR A;  3CJB A;  4DQI A;  1JLQ A;  4FPB A;  1YTA A;  2P9I A;  1NGA A;  4MLE A;  4YOR A;  1Q7Y O;  3K2P A;  5TKW A;  3L2Q A;  4KBO A;  2A6A A;  1MA9 B;  3K5L A;  3OTO K;  4OPJ A;  5DK5 A;  2E2P A;  2ZWH A;  4KPY A;  5JVG L;  4KHS A;  2BTF A;  3E9L A;  4W5T A;  3LDQ A;  3BUZ B;  4KV8 A;  4G9Z A;  5AQJ A;  3ULD A;  4DG1 A;  1YVU A;  4BGA A;  4FWO A;  2Q36 A;  4MLH A;  4KHW A;  1JLE A;  2QWP A;  2KW4 A;  4LF4 K;  5AQF A;  2E1Y A;  2ASP A;  2QKK A;  4IEI A;  3G71 N;  3HST B;  3ZSX A;  2X6S A;  2A1R A;  4CHP A;  3L2V A;  3SAG A;  4YFU A;  4FM0 A;  4BR7 A;  1HLU A;  4DV0 K;  1Z6R A;  4Y1D A;  1WBB A;  4CGI A;  4WE1 A;  2JWL A;  3LM2 A;  3DLH A;  1NBW A;  1GLF O;  4XH5 A;  4E3S A;  1KSP A;  3MXJ A;  3WQT A;  1SL1 A;  4M42 A;  1X9S A;  3AVM A;  4H5N A;  4B1X B;  4DQR A;  4UY8 O;  5FPM A;  4LSN A;  4FWL A;  4JKG A;  3EKS A;  2O8E A;  4CHZ A;  2HBJ A;  4LFA K;  3VQ7 A;  3O1B A;  4IG0 A;  2CH5 A;  3SUN A;  3J81 O;  2E2Q A;  4RTF D;  3OHR A;  5M1P A;  2VWJ A;  3J7Z O;  1XC3 A;  5KPZ A;  4DQ8 A;  3MCA B;  1BIS A;  4J2B A;  3SYZ A;  3S9H A;  4WQ5 A;  4CZF A;  3ZEU B;  4JI1 K;  2HF3 A;  5BRE A;  5AQG A;  3NE6 A;  3BDP A;  4Z4I A;  4LD0 A;  2GX9 A;  3VEX A;  3C95 A;  1KXP A;  2JLE A;  1WBD A;  2G8F A;  1VQ6 N;  1T7P A;  5CHI A;  1RT7 A;  3HXM A;  1KD1 O;  4C8L A;  3IRX A;  3SV3 A;  3U9D A;  2I7P A;  3J7A P;  2O8B A;  4A2B A;  1XI1 A;  3EE9 A;  1QSS A;  2E6M A;  2Z1G A;  3NVK A;  3H1Q A;  4PY5 A;  3ZX2 A;  1GOC A;  1WSI A;  2V52 B;  4FJN A;  4CZJ A;  4XH1 A;  1VQP N;  5EXW A;  4C23 A;  4W5N A;  4FWQ A;  2GBZ A;  4H0Y B;  4BRM A;  3ZX0 A;  1K73 O;  2NRZ A;  2IDO A;  3AA5 X;  1X1P A;  4N76 A;  3H46 O;  1NK0 A;  3CFO A;  2HBK A;  2X74 A;  4CK3 A;  2O8D B;  4AF1 A;  1NKE A;  5FPD A;  3TTC A;  3FLC O;  2HNZ A;  3CHW A;  3OW2 M;  1TUU A;  5AQN A;  4MDB A;  3DRR A;  4BDY A;  3TAQ A;  3S41 A;  2P5O A;  4BC5 A;  5AFU A;  3L2U A;  4DKW A;  4KKO A;  3E01 A;  5JS2 A;  2WOM A;  4PQU A;  3CER A;  1Q8I A;  1YUW A;  1ZXO A;  4FZY A;  1NLV A;  2QTD A;  4B9V A;  1BIZ A; 
#chains in the Genus database with same CATH homology
 1REV A;  4OLB A;  4CK1 A;  2IS3 A;  2YNH A;  4M3W A;  3THV A;  4O44 A;  3HP6 A;  1HNI A;  4KHQ A;  1JXE A;  2KTQ A;  4KI4 A;  4LH4 A;  5J2Q A;  1WAF A;  3AVA A;  4KHU A;  3PUF A;  1C0M A;  4C8N A;  4CCH A;  1S6Q A;  3D45 A;  1TAQ A;  5KGX A;  1RDB A;  1UA0 A;  1DTT A;  3V1R A;  3DLK A;  3WNH A;  2OPS A;  4FJ9 A;  3TAN A;  3V9X A;  1JLG A;  5KTQ A;  1HYS A;  2HNY A;  1FKP A;  4H4O A;  4B9M A;  4FJX A;  4M3Y A;  3IG1 A;  3AVK A;  1RTH A;  3TR8 A;  1RDD A;  1EXQ A;  1IG9 A;  1NOY A;  3DLR A;  3M8S A;  4O4G A;  1TL1 A;  1Z26 A;  4H4M A;  4EP4 A;  2YKM A;  1RT3 A;  3KJV A;  5HRR A;  3OJU A;  3F9K A;  2RN2 A;  1KVB A;  1UWB A;  3WNE A;  3AA2 A;  4CJU A;  2HHW A;  3VQ8 A;  4BWJ A;  1J53 A;  4CIE A;  3V9S A;  1NK7 A;  3OYI A;  3CYM A;  3SQ1 A;  3PX4 A;  3ZT1 A;  4BE1 A;  3AO3 A;  1QHT A;  2XHB A;  1RT5 A;  4OVL A;  1KRP A;  1BI4 B;  4HVJ A;  3KD1 E;  4I2P A;  3JSM A;  2Q3S A;  4E7H A;  4J2E A;  3AVB A;  1VRT A;  4RW6 A;  1LAV A;  1MU2 A;  4DTS A;  1C1C A;  3NF8 A;  4Y1C A;  4FJM A;  4OGC A;  4QAG A;  3VQ5 A;  3OYL A;  1C1B A;  3RMA A;  4B9U A;  4DU4 A;  5JS1 A;  3KIO A;  3B6O A;  1UOC A;  3L2R A;  1FKO A;  1Y97 A;  1KFD A;  3VQ9 A;  5C42 A;  2OPP A;  2R7Y A;  1C0U A;  1HYZ A;  3OYN A;  3OYJ A;  3LDS A;  3ZSW A;  3AVF A;  2G8V A;  4F2R A;  4M3T A;  3WNG A;  2DY4 A;  1KLM A;  4CJ4 A;  3LP3 A;  4FJL A;  2QKB A;  3DYA A;  4F8R A;  1IKX A;  4E7K A;  2HMI A;  4Z4F A;  1S5J A;  1R0A A;  3DLB A;  2IGI A;  4RW7 A;  2FBX A;  3AO2 A;  1IKV A;  4DLE A;  3QEX A;  2DTU A;  2YHA A;  3AO4 A;  3QIN A;  4ID1 A;  3LP0 A;  4E0D A;  3G0Z A;  1XWL A;  1IO2 A;  1YT3 A;  3VQ6 A;  4BE2 A;  1DLO A;  1CZ9 A;  1UA1 A;  1QQC A;  3DRP A;  4CHY A;  3KK2 A;  4QOZ B;  2XY5 A;  2KQ2 A;  4CFA A;  2GV9 A;  3H08 A;  3NAE A;  1UAX A;  1HRH A;  4RW8 A;  1RNH A;  2GUI A;  1D8Y A;  4KTQ A;  1KCF A;  1W0H A;  3K5N A;  3U3G A;  2NUB A;  4HHT A;  1N5Y A;  2ATQ A;  1BI4 A;  1JLB A;  4BDZ A;  1GOA A;  1VSH A;  5I3U A;  3NF7 A;  4CJV A;  1NJX A;  4FK0 A;  4PUO A;  1NKC A;  4AHC A;  1VSJ A;  3RMB A;  1LWF A;  3QER A;  1WLJ A;  3HVT A;  3RWU A;  5FRM A;  2VWK A;  1B9D A;  4EP5 A;  4CEE A;  3OYF A;  3DI6 A;  1L3T A;  2KFN A;  1HPZ A;  1CZB A;  3DRS A;  1BCM A;  2HB5 A;  1A5V A;  3HVR A;  4JS4 A;  1S1W A;  3SJJ A;  1NK4 A;  4NYF A;  1WNS A;  4IFY A;  3VQE A;  3EZ5 A;  4G1Q A;  4O0I A;  4JRQ A;  1TV6 A;  4MQ3 A;  3ZT2 A;  3HPH A;  1HNV A;  3NGZ A;  3HPO A;  1JXB A;  1BL3 A;  3KKS A;  2YNI A;  3ITH A;  4DSK A;  4E7L A;  2BGG A;  4FXD A;  3G10 A;  1LW0 A;  2RF2 A;  4CE9 A;  4E1M A;  1RBT A;  3C6U A;  4LSL A;  4C8M A;  5CYQ A;  3DOK A;  1RDA A;  1IH7 A;  1RTJ A;  2ZQB A;  5SZT A;  3LAK A;  1SL0 A;  4CEZ A;  1J9A A;  3C6T A;  3HM9 A;  4FLW A;  1ASU A;  4I9L A;  3TWH A;  2Z1H A;  4Z0U A;  4DQQ A;  2VG7 A;  2D0A A;  3QIP A;  1VSD A;  4JLH A;  3ZSR A;  3I0S A;  3L2W A;  1X9M A;  2F96 A;  4CES A;  3EY1 A;  4IKF A;  3B6P A;  2HHS A;  2HHX A;  4DTJ A;  1EET A;  3NFA A;  4DMN A;  4KB1 A;  1HYV A;  4NYN A;  4CGH A;  4M3U A;  3OYB A;  4NCB A;  2D0C A;  3AA3 A;  2DFF A;  4FW2 A;  1TK8 A;  1TVR A;  3QEW A;  2OPR A;  1NJY A;  1JKH A;  2XRI A;  1RCH A;  3AVL A;  5J1E A;  1NOZ A;  4TSX A;  4C8O A;  3S3O A;  4CFC A;  4CJE A;  3O3F A;  5C25 A;  3MAQ A;  2YNG A;  3PX0 A;  4DTR A;  1TK0 A;  3SV4 A;  2OA8 A;  3AVG A;  2RPI A;  4O55 A;  1ZBL A;  3QIO A;  5HLF A;  3TAG A;  4B9S A;  1S6P A;  4CFD A;  2FBT A;  3ZT0 A;  3TAE A;  4FVM A;  1TKZ A;  4RW9 A;  3OY9 A;  4NCA A;  3VA0 A;  3VQ4 A;  2G8I A;  4CIF A;  3V6D A;  2OYQ A;  5I42 A;  4I7F A;  3M8P A;  3K58 A;  1ASV A;  4AIL C;  3HYF A;  3VQB A;  3V9U A;  4CHN A;  2QK9 A;  4FJK A;  3KTQ A;  1XC9 A;  1CXU A;  3CFR A;  4N47 A;  4N41 A;  1VSE A;  3ASM A;  3SPZ A;  4ZTJ A;  4FZZ A;  3LP2 A;  1KVC A;  2HVH A;  4H8K A;  4OLA A;  3HPG A;  5DMR A;  2BE2 A;  1N6Q A;  4FYD A;  3M8Q A;  5J2P A;  5HBM A;  1RBR A;  3F73 A;  2EX3 A;  1U45 A;  1A5W A;  4XIU A;  2Z1I A;  2BDP A;  1LW2 A;  2XY8 A;  2G8W A;  4CJK A;  4PWD A;  5HRN A;  3P83 D;  3PO5 A;  4FZX C;  2HW3 A;  3T3F A;  1RTD A;  3O3H A;  4I2Q A;  4CFB A;  4FLU A;  4DU1 A;  3PY8 A;  3ZSQ A;  3V1Q A;  3OYG A;  3LAM A;  4CF9 A;  3RMC A;  5HRO A;  4K8Z A;  3K59 A;  1VSL A;  3V9Z A;  3RMD A;  4CF8 A;  3SI6 A;  1B92 A;  3NH2 A;  4CIG A;  3OYE A;  3VQP A;  3OJS A;  3S3M A;  1NJZ A;  4KRE A;  4DWI A;  1Q9X A;  3QO9 A;  3KLE A;  3OYA A;  4QCL A;  3D0P A;  3P5J A;  4FK2 A;  3O3G A;  4Z4G A;  3MEC A;  3LZI A;  4FLY A;  4FLX A;  3VA3 A;  3ZSV A;  3AO1 A;  4AHR A;  1I39 A;  4B8C A;  4M3Z A;  2XY7 A;  1T8E A;  2IAJ A;  1L3U A;  1KLN A;  3ZT4 A;  5HRS A;  4DTX A;  4CJR A;  1J5O A;  2E4L A;  2OPQ A;  2HHQ A;  1FK9 A;  4DTU A;  3CM6 A;  1VSM A;  3AVI A;  4F2S A;  1S9G A;  3NH1 A;  1BQM A;  1D9F A;  5E41 A;  3SQ0 A;  1ZBF A;  4UQG A;  4DFM A;  4F3T A;  4CEF A;  3T19 A;  1HQU A;  3C94 A;  4CEC A;  4E7I A;  1ZYQ A;  4B8A B;  3TAM A;  1HQE A;  1LWC A;  2YNF A;  4DF8 A;  2HHV A;  4BDP A;  2G8K A;  3CM5 A;  2B6A A;  4DQS A;  3AVH A;  4DTM A;  3ZT3 A;  3A2F A;  3SUP A;  1VRU A;  2G8U A;  2EHG A;  3FFI A;  4M3R A;  1S1T A;  4FM2 A;  5CYM A;  1JL1 A;  1Q9Y A;  2O4I A;  1JL2 A;  1TGO A;  4NCG A;  2X6N A;  3OS2 A;  4OKK A;  4Q5V A;  3KLF A;  5KI6 A;  4E7J A;  1SL2 A;  3DLG A;  4FJ5 A;  1TKX A;  1LV5 A;  1DTQ A;  1XHZ A;  1WSG A;  1VSI A;  3BGR A;  4AHV A;  4J2A A;  2IC3 A;  5KGW A;  3WNF A;  3NF9 A;  3I8D A;  1U04 A;  3KLI A;  3P1G A;  4DTO A;  3TAP A;  2PYL A;  4F3O A;  1CXQ A;  4M41 A;  4AHU A;  4O0J A;  1U4B A;  1ZBI A;  4IDK A;  4KTZ A;  1HJR A;  1SKR A;  4FW1 A;  3OS0 A;  1RT2 A;  3NF6 A;  4GVM A;  2XY6 A;  4HUG A;  4CGD A;  2DFH A;  1TK5 A;  4GW6 A;  4FK4 A;  3OYC A;  2G8H A;  3NHG A;  3TAB A;  1B9F A;  4FLV A;  1RTI A;  3HP9 A;  1TKD A;  4I9Q A;  3TI0 A;  4CGJ A;  2OZM A;  1NJW A;  3NDK A;  3ZSY A;  3DMJ A;  4ICL A;  3U3Y A;  1EX4 A;  1KTQ A;  1K6Y A;  4GMJ B;  1L3S A;  4RW4 A;  4CK2 A;  2PYJ A;  3PV8 A;  4KRF A;  4RG8 A;  1I3A A;  4O5B A;  4E89 A;  4DU3 A;  3LPU A;  2PZS A;  4OKJ A;  2B4J A;  2WON A;  4ELV A;  4W5O A;  1QSL A;  2F8T A;  3RTV A;  4J2D A;  4AH9 A;  5J2N A;  3PO4 A;  3VQC A;  2ETJ A;  1TL3 A;  3KLH A;  4KO0 A;  3NGY A;  4IBN A;  4DSF A;  4KB0 A;  4CED A;  1O1W A;  3SQ4 A;  3KK1 A;  4DS4 A;  3V9W A;  2AJQ A;  3LAL A;  4CJS A;  4DSE A;  4DFJ A;  1XHX A;  2DFE A;  1NK6 A;  1SKW A;  4OKE A;  4N56 A;  4FJ7 A;  3K5M A;  1VK0 A;  4CEQ A;  3V1O A;  1BQN A;  4CGG A;  3SQ2 A;  4PA1 A;  2FBY A;  1JLC A;  4FLT A;  2Y1I A;  4OJR A;  3SNN A;  3AVJ A;  4KHY A;  4ID5 A;  4CF0 A;  3LP1 A;  4DQI A;  3L8B A;  1QSY A;  1JLQ A;  4MFB A;  4OGE A;  4CJL A;  4FCY A;  5J2M A;  5D3G A;  1SV5 A;  1VSF A;  1YTA A;  3QES A;  3EYZ A;  2D5R A;  1EKE A;  2IOC A;  4R5P A;  4DS5 A;  3CG7 A;  3VQA A;  1L5U A;  2B5J A;  3LAN A;  3AO5 A;  1YTU A;  3NCI A;  3I0R A;  4CJT A;  3K2P A;  3MED A;  4Z4E A;  2ZE2 A;  3L2Q A;  3ZSO A;  3V4I A;  5KRT A;  3K5L A;  2RKI A;  4DFP A;  1KVA A;  5C24 A;  1QS4 A;  1SUQ A;  5DK5 A;  4YNQ A;  1S1X A;  4OPJ A;  3TAR A;  3IAY A;  4KPY A;  1FXX A;  4B08 A;  4KFB A;  1ZBU A;  3QEV A;  4HTU A;  4KHS A;  4B3O A;  2P5G A;  1U47 A;  2HHU A;  4W5T A;  3VQD A;  1IKW A;  4DSI A;  4M3X A;  4KV8 A;  1QE1 A;  2KFZ A;  3QEP A;  1WAJ A;  4KTW A;  3KLG A;  2BAN A;  4N5S A;  3SUO A;  4F4K A;  4CHQ A;  2YKN A;  4DG1 A;  2ITG A;  3ULD A;  4CF1 A;  1YVU A;  4FJG A;  4L8R B;  4FJI A;  3LWM A;  3IS9 A;  3O4Q A;  2Z1J A;  5CZ2 A;  4HCC A;  1RBU A;  4FJJ A;  4FJH A;  4KHW A;  4AHS A;  4DTN A;  1JLE A;  2FBV A;  2LSN A;  1ZBH A;  1WSE A;  1RBV A;  2KW4 A;  2QXF A;  3U6F A;  1WSJ A;  3DLE A;  3NBP A;  4BE0 A;  3SUQ A;  4CJP A;  2QKK A;  3SPY A;  1IKY A;  3HST B;  3ZSX A;  3JYT A;  2X6S A;  2A1R A;  3OYK A;  3MEE A;  3PX6 A;  4CHP A;  5SWM A;  3VN5 A;  3KD5 E;  2Y1J A;  2E6L A;  4CEO A;  3RR8 A;  2HND A;  3L2V A;  3S3N A;  4YFU A;  4FM0 A;  1D9D A;  4W5R A;  4OPK A;  3MEG A;  5CZ1 A;  1QTM A;  1C6V A;  1U49 A;  4EZ6 A;  3OYM A;  4CF2 A;  1SKS A;  4Y1D A;  4E19 A;  1D5A A;  3L3U A;  1T05 A;  3HO1 A;  4CGI A;  4BAC A;  4WE1 A;  3OYD A;  3K57 A;  5HP1 A;  3LPT A;  1RT4 A;  3DLH A;  1NKB A;  4E3S A;  1KSP A;  3MXJ A;  3MXI A;  2HVI A;  1W9H A;  1U48 A;  1SL1 A;  1X9S A;  4M42 A;  1VSK A;  4DTP A;  3AVM A;  3LZJ A;  4CEB A;  4DSL A;  1RBS A;  1G15 A;  5HRP A;  4DQR A;  4B9N A;  3HJF A;  2P1J A;  4LSN A;  5FRO A;  2YV0 X;  3AV9 A;  4CHZ A;  3VQ7 A;  2HHT A;  3T1A A;  4ZHR A;  1T03 A;  3AVN A;  3KKR A;  4CGF A;  4ELT A;  5T7B A;  2O4G A;  1RDC A;  5EU7 A;  4DLG A;  4IG0 A;  3SUN A;  3DOL A;  1TKT A;  1S1U A;  4B9L A;  5FRN A;  2VWJ A;  4JRP A;  4C8K A;  1GOB A;  4KHN A;  2JGU A;  4CHO A;  1BIS A;  4CJQ A;  5CY4 A;  3OYH A;  5KRS A;  4FM1 A;  3SYZ A;  4DFK A;  3S9H A;  4J2B A;  1HMV A;  3RR7 A;  3HK2 A;  2X78 A;  3NE6 A;  1NK9 A;  4FJ8 A;  1ITG A;  2A1S A;  1WSH A;  2D0B A;  1NK5 A;  3BDP A;  4LD0 A;  4DF4 A;  4Z4I A;  4M45 A;  2ZD1 A;  2KZZ A;  1BHL A;  3C95 A;  4CJW A;  3HL8 A;  2JLE A;  1WSF A;  3HT3 A;  1BIU A;  3RRH A;  2G8F A;  3KK3 A;  1T7P A;  2KZM A;  1TAU A;  1RT7 A;  1S1V A;  3HXM A;  1L3V A;  1A5X A;  3L3V A;  4C8L A;  3NH0 A;  3TAF A;  3IRX A;  3ALY A;  3SV3 A;  3DM2 A;  3CFP A;  3NGI A;  4CJ3 A;  4Q0B A;  4BWM A;  1XI1 A;  1RIL A;  2P51 A;  1QSS A;  2E6M A;  2Z1G A;  1BGX T;  2FC0 A;  1NK8 A;  5FDL A;  1KFS A;  4PY5 A;  3QET A;  4HUE A;  3SZ2 A;  1GOC A;  3OS1 A;  3SCX A;  1RT6 A;  1RT1 A;  4K8X A;  1WSI A;  3ZSZ A;  3RRG A;  4FJN A;  1J54 A;  1S9E A;  4B9T A;  4ELU A;  4ZTF A;  3M8R A;  3LWL A;  2VG5 A;  4Z4C A;  2I5J A;  4IFV A;  1JLF A;  4HUF A;  4JS5 A;  1WN7 A;  3UIQ A;  4W5N A;  1F21 A;  2GBZ A;  4CER A;  4LH5 A;  2VG6 A;  3QEI A;  2IDO A;  3AA5 X;  4DQP A;  5K14 A;  4KI6 A;  1Z25 A;  1C1A A;  1X1P A;  4N76 A;  1NK0 A;  3CFO A;  2X74 A;  1X9W A;  4CK3 A;  4W5Q A;  3MXM A;  2OZS A;  3K5O A;  1LWE A;  3QNO A;  1NKE A;  1JLA A;  2XO7 A;  2W42 A;  4CJ5 A;  4E1N A;  1EP4 A;  2HNZ A;  4DSJ A;  4EZ9 A;  2F8S A;  4IG3 A;  4CJF A;  3DRR A;  3AVC A;  4BDY A;  3V81 A;  4LY7 A;  3TAQ A;  3O4N A;  2PY5 A;  2P5O A;  3QLH A;  1ASW A;  1LAW A;  3CQ8 A;  3L2U A;  4AHT A;  3QNN A;  4FLZ A;  4Z4H A;  4CEA A;  4KKO A;  3VQQ A;  3E01 A;  5JS2 A;  2WOM A;  4PQU A;  1Q8I A;  1BCO A;  1C0T A;  2YHB A;  4KAZ A;  4HCB A;  3ISN C;  4FZY A;  3AA4 A;  3ZCM A;  3OVN A;  4B9V A;  1CLQ A;  1BIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...