4OJRA

Crystal structure of the hiv-1 integrase catalytic domain with gsk1264
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
131
Chain Sequence
PGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Integrase
publication title Allosteric Inhibition of Human Immunodeficiency Virus Integrase: LATE BLOCK DURING VIRAL REPLICATION AND ABNORMAL MULTIMERIZATION INVOLVING SPECIFIC PROTEIN DOMAINS.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 50
structure length 131
sequence length 150
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ojrA00
2OPRA 4M41A 4DLGA 1L3VA 3HP9A 3DRSA 3L2RA 3QERA 3VQ7A 2HMIA 2VWKA 3OS1A 2KZZA 3HP6A 3K5LA 3QEVA 4BACA 1IKVA 1RTIA 1S6PA 3ASMA 3VQ5A 4IG3A 3DLKA 1Q9YA 4N41A 1VSJA 3AVJA 1YTUA 3NGYA 2XO7A 3SCXA 1WAJA 5J1EA 4W5QA 2JLEA 4QAGA 4FXDA 4GMJB 4F3TA 3PO4A 4B9SA 5HRSA 3RWUA 1IO2A 3K58A 1S1VA 1Q9XA 4K8ZA 2WOMA 1JLBA 3B6PA 4BE2A 1WAFA 2Q3SA 3RMAA 4DTRA 1LAVA 1SV5A 5KRTA 4DG1A 5FRNA 2G8FA 4B9TA 2HVHA 1U47A 3VN5A 1LAWA 2P1JA 1WSHA 3P83D 5FDLA 1RILA 1LW2A 2JGUA 4CEQA 3QEPA 1U48A 1N6QA 2QK9A 3OYDA 1D9FA 4KV8A 3MXJA 3AO4A 1L3TA 5C25A 4J2DA 1NK9A 3AV9A 3T3FA 4J2AA 4DF4A 3MXMA 1RT4A 3C95A 1D9DA 4M3WA 5KTQA 4DTPA 1C6VA 3HSTB 1RBRA 3V81A 3ITHA 1S1TA 3NF6A 3F9KA 3KKRA 3KLIA 4M3YA 5C42A 2HHTA 1RT6A 5JS2A 1HPZA 2D0BA 3SPYA 4KTWA 4KI6A 1RTDA 1RNHA 4NCGA 4C8KA 4HCBA 1NJWA 3CM6A 1VSKA 3C6UA 3CFOA 3DOKA 4B8CA 4KHWA 4OPKA 2D5RA 2DY4A 3LPUA 1XC9A 3AVAA 2AJQA 3DLGA 3NHGA 1VSLA 3VQAA 2A1RA 3DLBA 4AHCA 4CJQA 4CFDA 5HRRA 3QNOA 4K8XA 2QKBA 1X9MA 3A2FA 3AVIA 4O4GA 2KW4A 2D0CA 4CJ4A 4B9VA 4HUGA 1ASWA 5J2QA 3S3OA 2OA8A 3D0PA 4PUOA 1IKXA 4KTQA 3IAYA 4FM2A 4CJPA 2EHGA 4UQGA 3U3YA 5T7BA 3AO5A 4DTUA 4F2SA 1EKEA 4KB1A 3SI6A 1XHZA 1BIUA 4GVMA 1C0UA 3WNFA 3S9HA 3AVBA 3WNHA 1QSLA 1B92A 4RG8A 1TL3A 1S1XA 4KB0A 4PWDA 1HJRA 2GBZA 4DU4A 3ZSXA 3NE6A 1A5VA 3VQBA 3O3HA 2X74A 4FJHA 1C1BA 2ETJA 1RDCA 4CK1A 1RDDA 4ELVA 4HUFA 4DS4A 1CLQA 3EYZA 3TAMA 3TAQA 2HW3A 1K6YA 1RT2A 3ZT0A 5KRSA 3AO3A 4FCYA 4W5TA 4KTZA 1JKHA 1FKPA 4CFAA 2I5JA 1QE1A 4DQSA 3TABA 3DYAA 1R0AA 1KVCA 3ZSVA 3SV4A 3QEWA 4B9MA 2HHVA 1TKTA 3SYZA 4CJFA 1CXQA 3HM9A 4OGCA 1F21A 1LW0A 3AVKA 3IRXA 3THVA 2G8HA 4FJXA 1JLAA 3LZJA 3ULDA 3QEXA 3PO5A 3AO1A 4CFCA 5HBMA 1NOYA 1BI4B 1VSHA 1XHXA 2Z1HA 3L3VA 4CESA 2BANA 4CHZA 4Z4CA 4E7KA 2WONA 2IDOA 4DTMA 1BL3A 4O44A 1ZBIA 3B6OA 2ZD1A 2ATQA 3KD1E 1T8EA 3MXIA 5KGWA 3V9SA 3QO9A 1LWFA 2YHAA 1UA1A 1EX4A 3PY8A 3TAGA 3HVTA 1WSIA 3NF8A 4G1QA 4DQIA 2KTQA 1RDAA 4CGIA 1TL1A 1NJZA 1CXUA 3ZSZA 2P5OA 4EZ9A 3RR8A 3OYNA 4B9NA 1UAXA 4B9LA 1QHTA 4B8AB 3MEGA 4CERA 1UWBA 4M3RA 4CK3A 2PYJA 4EP4A 3NH2A 3KTQA 4KI4A 2X78A 4FW2A 4IDKA 4ZTFA 1NK5A 4FLYA 4CJTA 1VSIA 4FZZA 3HPHA 1EP4A 4O55A 1VSFA 1TKXA 5CZ1A 1TAUA 3LP1A 3AVFA 2BDPA 2LSNA 4CF9A 4CGGA 4CGJA 1LV5A 3LZIA 1WLJA 3L2UA 1NKEA 3V1QA 3CFRA 1IG9A 4CE9A 4CFBA 3RRHA 2B4JA 3AA2A 3L8BA 3OYMA 4DWIA 4E0DA 3PUFA 4ID5A 3HT3A 2ITGA 4BWMA 1TK5A 3K2PA 4DSIA 1GOAA 3SQ0A 3NF9A 3C6TA 3HVRA 3ZT3A 3KLFA 3L3UA 3P1GA 4M3ZA 3ZT2A 4FJ9A 4Z4FA 1BISA 3HPOA 1VSMA 4ELUA 1S1WA 3MECA 1HQUA 2RF2A 1WNSA 1RT5A 3M8RA 3ISNC 4B9UA 4RW8A 3PX0A 3RR7A 3KD5E 1T05A 3OYLA 3KKSA 4PY5A 4FJLA 2QKKA 1SL1A 4OLAA 3HJFA 3LAKA 2DTUA 3LPTA 5JS1A 4FYDA 2XY6A 4FK4A 5DK5A 4CIEA 3OS0A 1S9EA 4I2PA 1XWLA 4XIUA 2X6NA 3L2WA 4ELTA 1VK0A 1EXQA 4FM0A 2O4GA 4H4OA 5K14A 4CGHA 3NFAA 3OJUA 4Y1CA 4HCCA 1KLMA 5KI6A 5J2MA 1D8YA 1TV6A 2E6LA 4Y1DA 3LAMA 4IG0A 4E7HA 1Y97A 1TAQA 3LALA 4DTXA 1HMVA 1SKRA 2YV0X 1ZBFA 4J2EA 1HNVA 2DFFA 1I3AA 4CHPA 4O0JA 4R5PA 4DSJA 5D3GA 1HYSA 2P51A 3BDPA 1J53A 3KJVA 3PX4A 3CM5A 4FZXC 4CEEA 4W5RA 2Z1GA 4W5OA 4CHOA 5SZTA 4DF8A 2Y1JA 2G8UA 4CJ3A 2E4LA 1ASVA 4E7JA 4BE1A 3LP3A 3OYGA 2OZMA 1YT3A 3CG7A 3LWLA 4OKEA 3OY9A 1ZYQA 2OPPA 4IBNA 2YKMA 2KZMA 3HL8A 4AHVA 3OYKA 1WSJA 3KK2A 3IG1A 3M8PA 1X1PA 1T03A 4BDPA 1CZBA 1FXXA 1W0HA 1NJYA 4E19A 3HXMA 4OLBA 4E89A 5I42A 3F73A 4F3OA 1BHLA 3RMBA 1JLGA 1FKOA 3TAEA 3OYCA 4I9QA 1RBSA 1X9WA 1U49A 3OYFA 2XY8A 3T19A 1NKCA 4Z0UA 4Z4EA 4W5NA 3OYHA 4FJ7A 2F8TA 1ZBUA 4B3OA 4PA1A 4FJKA 3DRPA 4CEBA 4CCHA 4OVLA 2HHXA 3QESA 1BCMA 1QSYA 4CJWA 3AA4A 1HYZA 3P5JA 1VSDA 1RTJA 4EZ6A 4NYFA 1DTTA 3ZSQA 4DU1A 3HK2A 3I0RA 4DSFA 1YTAA 4DTOA 4M3TA 2YNIA 4AHUA 4L8RB 2FC0A 4KFBA 4H8KA 3I0SA 1SL0A 2ZE2A 1RT1A 4E3SA 5HRPA 1J5OA 1BIZA 1J54A 1C0MA 4GW6A 3K5MA 2PYLA 3VQPA 2OPSA 4H4MA 4LH4A 1B9DA 1O1WA 3ZCMA 2OZSA 4FVMA 3OYEA 2KQ2A 1NKBA 3AVHA 1X9SA 1A5WA 2G8VA 1RBVA 4DSEA 5J2NA 4FJGA 2F96A 2E6MA 1ASUA 2FBXA 3K5OA 4CJUA 4N47A 1JLFA 1XI1A 2YKNA 3PX6A 1TK8A 3RMCA 2IS3A 4JS4A 2PY5A 3NGZA 4LY7A 4ZHRA 4CGDA 4AHRA 4AILC 3O3GA 2EX3A 5HLFA 4YFUA 3SUQA 4FJJA 3HYFA 4N56A 1REVA 3V9ZA 3RMDA 2VWJA 4KHQA 5C24A 2KFZA 1NK0A 3HO1A 4Q5VA 5J2PA 1TGOA 4CECA 4CK2A 1I39A 1JLQA 3TI0A 1KLNA 1LWCA 2YNHA 3VQQA 4HTUA 3TWHA 4CJEA 2ZQBA 3DI6A 4CF8A 2DFEA 3VA0A 1SL2A 4DSLA 4BWJA 2D0AA 4TSXA 2BGGA 1KTQA 3QEIA 2B5JA 4FJIA 1NK8A 3UIQA 4PQUA 1Q8IA 2HHWA 4IFYA 3QIPA 4FK2A 5CYMA 1S5JA 3C94A 4CIGA 3OYJA 3LP2A 3DMJA 3AO2A 4DFKA 3SUPA 1NK7A 1TKDA 2FBYA 4OKJA 1U45A 4KREA 3TAPA 1HQEA 3KK1A 1QQCA 3SJJA 1GOBA 4QOZB 1UA0A 4DQPA 3S3MA 2VG5A 3VA3A 2HHQA 3G0ZA 3OYBA 4Q0BA 4NYNA 3O4NA 2G8WA 5HP1A 3MEDA 4LSNA 4CEOA 1SKWA 2G8IA 4CIFA 3VQCA 1HYVA 1FK9A 1BI4A 2GV9A 1YVUA 4NCAA 2IC3A 4CJLA 4YNQA 3IS9A 4AHTA 4CJRA 3NCIA 3SQ2A 4J2BA 4RW7A 4DFPA 3OVNA 1L3UA 4CGFA 4M42A 4OGEA 1RBTA 3VQ6A 5FROA 3TANA 3AVGA 3KLHA 1J9AA 1Z26A 3QNNA 4EP5A 2OPQA 1RT3A 4LH5A 3KK3A 2HNYA 4E1NA 1LWEA 4I9LA 1WSGA 3DLEA 1ITGA 1T7PA 3VQ4A 3NDKA 1NOZA 3S3NA 4F8RA 1IKWA 1CZ9A 5CZ2A 1L3SA 3FFIA 3TARA 4FK0A 1TK0A 1BQNA 4IFVA 1JLCA 2VG7A 1WSEA 4QCLA 4JRPA 4B08A 3L2VA 3LANA 4HVJA 4DQRA 3ZSOA 3SQ1A 4CHQA 4Z4IA 3QIOA 3AA5X 4OPJA 4AHSA 2IAJA 4O0IA 3OYIA 3V9UA 3OJSA 4Z4GA 4JS5A 1QS4A 1C1CA 4KPYA 4FZYA 3K5NA 3NH0A 2VG6A 4FM1A 2Z1JA 1D5AA 2XY5A 2QXFA 1BCOA 3TR8A 4FLWA 4FLTA 1NJXA 2PZSA 4FJ5A 4OJRA 4C8LA 2YHBA 3ZT1A 3V6DA 1TVRA 4CEZA 3M8QA 3V1RA 1WSFA 1WN7A 3V1OA 3MAQA 2XY7A 4DU3A 1KVBA 3SQ4A 4C8NA 1NK6A 2RKIA 4E7LA 5HROA 5CYQA 2RN2A 4FJ8A 1JL2A 4ICLA 3WNGA 4AH9A 4CHNA 2XRIA 3V9XA 4DMNA 1NK4A 1HNIA 3JSMA 3G10A 2NUBA 1Z25A 1JLEA 3ZSYA 2HHSA 2B6AA 4MQ3A 1TKZA 4BE0A 3M8SA 2YNFA 4DLEA 1KFSA 3V4IA 4FLXA 1JXEA 1C0TA 4N76A 2FBVA 4ID1A 3DRRA 4CEAA 4RW4A 2KFNA 3OYAA 3RRGA 4DTJA 4KKOA 3MEEA 4KO0A 4DTNA 1VSEA 4WE1A 4I7FA 2RPIA 3OS2A 4DFMA 3PV8A 4O5BA 2HHUA 3CQ8A 4NCBA 1QTMA 3VQDA 4FJMA 3QLHA 4KHSA 1RT7A 3O3FA 3KLEA 5I3UA 1A5XA 3NH1A 3AA3A 3ZT4A 3LWMA 2OYQA 4FJNA 5E41A 1BGXT 3SUNA 1DLOA 2FBTA 3EZ5A 1KSPA 4CF1A 3LDSA 3BGRA 4DTSA 1VRTA 1B9FA 3DM2A 4CF0A 2F8SA 3I8DA 2IOCA 3SZ2A 3LP0A 2GUIA 3L2QA 3SV3A 3AVNA 5FRMA 1GOCA 2X6SA 1IKYA 3K59A 4CEDA 3HPGA 2HNDA 1N5YA 4RW9A 1S6QA 3CFPA 5KGXA 4DQQA 2W42A 2HVIA 3VQEA 1UOCA 5EU7A 4CHYA 3NBPA 3TAFA 3AVLA 2G8KA 3NAEA 3NF7A 4CJVA 4E1MA 3QETA 3AVMA 3RTVA 3DLRA 4M3XA 2P5GA 3NGIA 1S9GA 3O4QA 2IGIA 2DFHA 3K57A 4N5SA 4F4KA 4C8MA 3ZSRA 1RCHA 5DMRA 3JYTA 4DS5A 4FLUA 1G15A 5HRNA 1SKSA 3ALYA 3ZSWA 1IH7A 1U4BA 1QSSA 3EY1A 2O4IA 4BDZA 5SWMA 1RBUA 1U04A 1EETA 1HRHA 1MU2A 3H08A 2Z1IA 3SPZA 3E01A 1KCFA 4FW1A 4KAZA 5CY4A 3VQ9A 1W9HA 3V9WA 4KHUA 4HUEA 2HB5A 4BDYA 3KLGA 1KVAA 4C8OA 1ZBLA 4KRFA 4CJ5A 1KFDA 2BE2A 4DSKA 1DTQA 2A1SA 1SUQA 3QINA 4OKKA 4CEFA 4CJSA 4M3UA 1JXBA 2Y1IA 3KIOA 3SUOA 4M45A 3DLHA 1BQMA 3T1AA 3AVCA 4CJKA 4I2QA 4MFBA 4FLZA 4E7IA 3U6FA 2YNGA 2XHBA 4ZTJA 1L5UA 4HHTA 1RDBA 4LSLA 3D45A 3SNNA 4KHYA 3DOLA 4JLHA 3VQ8A 3WNEA 4FLVA 4KHNA 4IKFA 2R7YA 1C1AA 4Z4HA 1RTHA 1KRPA 4RW6A 4LD0A 3U3GA 4F2RA 1S1UA 4CF2A 3CYMA 4JRQA 1ZBHA 2HNZA 1VRUA 4DFJA 1JL1A
chains in the Genus database with same CATH superfamily
4AM7A 4M41A 3HP9A 3OS1A 2KZZA 3A5OC 2CGKA 2EWSA 4IG3A 1YTUA 2XO7A 5J1EA 3O9SA 4QAGA 2JWKA 1C0GA 2ZF5O 5BR9A 3T1HK 3CI5A 3RSEA 5IT9O 1LAVA 1SV5A 3CJ7A 4B9TA 3QDKA 4BRLA 3O9RA 1OH6A 4B3SK 1ESVA 1RILA 2JGUA 3QEPA 4MDAA 3OYDA 3P38A 1L3TA 3AO4A 5C25A 4EIAA 3AV9A 1M90O 1RBRA 3OW2M 4GKKK 4DHYA 3R9PA 3CPWM 4M3YA 3KKRA 3KLIA 5JS2A 4KI6A 3P4IA 4C8KA 4ILHA 3C6UA 1J5EK 3AVAA 2E2QA 1VSLA 1U2VB 4K25A 4JKDA 3A2FA 3UE5A 4JI4K 5AQQA 4B9VA 4H5RA 4HUGA 2A6AA 4PL8A 4GY2B 3IAYA 2VYPA 3SMSA 5FPDA 1QQMA 4CJPA 4C1NK 3VOVA 4F2SA 4KB1A 4OX9K 3SI6A 1XHZA 3C6AA 2O8EB 3WNHA 4CW7B 3O9TA 4C1NI 1HJRA 2PBDA 3E9OA 3FZKA 4BRGA 1RDCA 4ELVA 1TYQA 2FSNA 3MCAB 2Q0RA 3AO3A 4W5TA 1FKPA 4PKIA 2I5JA 3AARA 3DYAA 3T1YK 4JKAA 5LL6Z 3QEWA 1TKTA 4OGCA 1F21A 3AVKA 3THVA 2G8HA 4FJXA 1JLAA 3ULDA 3QBWA 4U67L 1BI4B 1VSHA 1XHXA 3VF2A 3ZYYX 4O44A 1ZBIA 5B8HA 5CHIA 2QW9A 1YAGA 4B1VA 3V9SA 3NMUA 1LWFA 3PY8A 3CPEA 3VEOA 1WSIA 3C6HA 3NF8A 1IJJA 3UKRB 3A5LC 1DGKN 4PL7A 1EO1A 1YITN 1VQ4N 3DWLA 1SS6A 5AQVA 1ILYA 5AZJB 4BC2A 4B9NA 1QHTA 4B8AB 1UWBA 4X64K 3NH2A 3KTQA 1QQOA 4KI4A 2X78A 4FO0A 3VGKA 3G25A 4FZZA 3HPHA 2BDPA 1VQMN 4CF9A 4X62K 4YOVA 1NKEA 4EHUA 3WXIA 4CE9A 4JN4A 2AP1A 2QWLA 4LF6K 4E0DA 2VGMA 3HT3A 2ITGA 3FLCO 4BWMA 1XUPO 1LOTB 3P1GA 3ZT3A 1BISA 2PAVA 2RF2A 1RT5A 3CCRN 3KD5E 2P9SA 1U6ZA 4H0PA 4FJLA 2QKKA 4OLAA 2ITMA 2E88A 1C0FA 3TTFA 4LFAK 1S9EA 4XIUA 1GLBG 3AY9A 1N32K 4AF1A 3R1XA 4CGHA 1KLMA 5J2MA 1TV6A 2YHYA 1TAQA 3Q7BA 4J2EA 4IZ9A 5AR0A 3PX4A 4IJAA 3LDLA 2UU9K 4CHOA 5SZTA 5KPTA 1ASVA 3MWPA 3CMEN 4OKEA 1ZYQA 2OPPA 2W6KA 2NRVA 3HL8A 1T03A 4LC9B 2D1KA 3IG1A 1W0HA 1HX1A 4E89A 3CJ1A 5I42A 3F73A 4F3OA 4BRPA 1FKOA 1G99A 1RBSA 3IFRA 1VQ5N 2XY8A 1NKCA 1SZ2A 2F8TA 4PA1A 4FJKA 4OVLA 3I33A 1RTJA 2VQEK 4NYFA 2VQFK 2ASOA 1YTAA 4DTOA 4B3RK 4AHUA 3ULEA 5DM7L 1RT1A 5HRPA 5IWAK 5I9EB 1BIZA 3WXLA 5BR8K 4H4MA 3BEXA 1QHAA 1KXPA 2NRHA 3FE1A 5AQMA 3AVHA 2FSJA 4BRKA 4DSEA 2F96A 3CCQN 3K5OA 4LF4K 3RMCA 4XH4A 5ADXH 4AHRA 3ZEUB 2EX3A 1VQ8N 4YFUA 3CXCM 3HYFA 4KHQA 1REVA 3Q7CA 3HO1A 1JLQA 1X9JA 1KLNA 3TWHA 4CJEA 4PHTX 1QZ6A 5AFUH 4CD3A 3VA0A 4DB3A 4JI3K 4CBWA 2D0AA 2FSKA 2B5JA 1NK8A 3UIQA 3D2EA 5BRFA 3VERA 4IFYA 2F7TA 3BY5A 1YXQA 4DFKA 3SUPA 3DMJA 3AO2A 3CQXA 4OKJA 4WF9L 3GDQA 3TAPA 1HQEA 1QQCA 3SJJA 4JKGB 1XMQK 1YI2N 3QFPA 5HP1A 4NO7A 1N36K 2A40A 3DXKB 5GADP 4KH5A 1T3VA 4NCAA 3ID6A 5TKWA 3CCVN 4J2BA 4AQYK 4OGEA 3CETA 5FROA 3TSQA 1J9AA 1Z26A 3J7AP 4EP5A 3KK3A 2YCHA 3AAQA 1LWEA 3VQ4A 3NDKA 3THYB 3H1QA 1JLCA 2VG7A 1WSEA 3L2VA 4FWNA 3SQ1A 1ATNA 4Z4IA 4FWPA 4OPJA 4A2AA 5F1XA 3V9UA 4Z4GA 4KPYA 4FZYA 1D5AA 1NJXA 3LM2A 3HI0A 4DV1K 3V1RA 2HMPA 3HSCA 3V1OA 5AQSA 2I7NA 3SQ4A 1E4FT 2RKIA 4E7LA 5CYQA 2RN2A 1NGAA 4DR5K 4BG9A 1HNIA 1VQLN 3ZSYA 2UUBK 4JKFA 3VENA 3G71N 4BE0A 3J80O 1KFSA 2NZTA 3V4IA 4N76A 4JK9A 4RW4A 3T7ZA 3RRGA 2O8DA 1NMNA 4DTJA 1T6CA 4KBOA 4G9ZA 4WE1A 4I7FA 2RPIA 3OS2A 3CQ8A 2NRZA 2P9PA 2WBNA 3LWMA 2OYQA 5E41A 3SUNA 5AQYA 4CF1A 3ENHA 1B9FA 4CF0A 2F8SA 4DKWA 3SV3A 3D7EO 1GOCA 2X6SA 3C65A 3LDNA 3K59A 3HPGA 2HNDA 5KQ8A 5KGXA 4DQQA 2W42A 4MO4A 2HVIA 3AGRA 5AQUA 3TAFA 4AM6A 3AVLA 2G8KA 3OA9A 3NAEA 3NF7A 4M3XA 5BRHA 2IGIA 4BQLA 4N5SA 5DMRA 3PSIA 3JYTA 4FLUA 1G15A 2P9IB 3ALYA 3ZSWA 4BDZA 2P9KB 4JD2A 3H6EA 1VHXA 2Z1IA 3G4SN 4BG8A 4KAZA 3V9WA 4KRFA 1KFDA 4OKKA 4M45A 4E7IA 4FLZA 2YNGA 1BDGA 4ZTJA 1L5UA 1XQSC 1JCGA 4JLHA 3WNEA 1C1AA 1RTHA 5LJVA 4RW6A 1KRPA 4NXMK 1ZC6A 1S1UA 4F2RA 3A0IX 1EWQA 1ZBHA 1ASWA 4FWMA 4JKCA 1L3VA 3L2RA 4BACA 1IKVA 1S6PA 3ASMA 3VQ5A 3JS6A 1VSJA 3AVJA 3LL3A 3L0QA 4FXDA 4GMJB 4F3TA 4B9SA 1IO2A 3K58A 1Q9XA 4LF7K 1QVGM 1JLBA 2HF3A 2Q3SA 4BC4A 5KRTA 1JCFA 5FRNA 4H5TA 1HKCA 3U4LA 1TUUA 1GLCG 1LAWA 3FFKB 5FDLA 1N6QA 2QK9A 1U48A 5M1KA 3DXMA 4KV8A 1NK9A 2O8FA 3MXMA 4MLHA 1D9DA 4DTPA 3V81A 3HSTB 3NF6A 3D2FB 5C42A 2HHTA 1HPZA 2D0BA 5AQFA 4YOYA 1RTDA 2F9TA 3DOKA 4OPKA 2DY4A 3ZX3A 2AJQA 3DLGA 3NHGA 3DLBA 4AHCA 4CJQA 1WB9A 2O8CB 2OA8A 1YJ9N 3J81O 4DR1K 2CGJA 4UQGA 5T7BA 3U3YA 4QS9A 5BN9A 3P31A 3VPZA 1TL3A 4DU4A 1NGJA 3O4WA 3NE6A 2P9LA 4XEIA 3VQBA 2YHWA 3BZCA 3CC7N 4FJHA 1Z05A 1C1BA 1RDDA 3FR0A 4KH6A 3VEZA 2D0PA 3O9UA 3TAMA 4BGAA 1D4XA 4GKJK 1VQKN 4KTZA 1JKHA 1QE1A 3OBWA 4CZFA 4B9MA 1EQYA 4IFEA 5AQKA 3SV4A 2HHVA 3HM9A 1LW0A 3IRXA 4CBXA 1HNZK 3LZJA 5FPMA 3QEXA 3PO5A 4DV0K 2IIRA 4Z4CA 3L3VA 3ID8A 4DTMA 2BANA 4E7KA 2IDOA 1T8EA 3MXIA 1QZ5A 3QO9A 3O8MA 3T69A 4G1QA 3FZFA 4CGIA 3ZSZA 4BRHA 2NLXA 2QWRA 4B9LA 2WFBA 2PYJA 4CK3A 3G6EN 5AQZA 5C0YA 4CJTA 1VQPN 3OHRA 1VSFA 5AQHA 1EWRA 2ZWHA 3AVFA 1LV5A 3LZIA 1WLJA 3L2UA 3V1QA 3CFRA 1IG9A 3M6GA 3L8BA 4BR4A 3C6TA 4M3ZA 3S41A 3ZT2A 4FJ9A 3HPOA 3UKUA 1HQUA 1WNSA 3ISNC 4JK7A 4RW8A 3CERA 3PX0A 1S72N 2HBMA 3MK6A 3RR7A 3OYLA 4PY5A 5AQOA 4DQ8A 3HJFA 2XY6A 5DK5A 1V4TA 3SAGA 3L2WA 4I2PA 2X6NA 4FL9A 1VK0A 1EXQA 2O4GA 4H4OA 5K14A 3OJUA 3WT0A 4Y1CA 5FLXO 4I6MB 2HBLA 4DTXA 1YF5L 1SKRA 2YV0X 1ZBFA 2DFFA 4CHPA 1MWKA 4O0JA 1HYSA 2P51A 4B1WB 4FZXC 3MWTA 3MMVA 4W5RA 2YI1A 3SAHA 3RVCA 2QWPA 4W5OA 2OZMA 3VGMA 1YT3A 3LWLA 1OKJA 4MDBA 4GNIA 4OLBA 4BY9C 1BHLA 3RMBA 1JLGA 3TAEA 5GIOA 4I9QA 1XNRK 1X9WA 3OYFA 4CZJA 4WFNL 4W5NA 1DEJA 4B3OA 2KHOA 2V7ZA 4LFCK 2QM1A 3DRPA 4CEBA 3R8EA 2HHXA 1P90A 3AA4A 2ZJQL 1VSDA 1DTTA 4DU1A 3EL2A 4BR5A 2FC0A 4H8KA 2ZE2A 1J5OA 1J54A 2OPSA 4LH4A 1U2VA 1B9DA 1O1WA 2OZSA 4FVMA 3OYEA 5GAHP 2G8VA 5J2NA 5EX5A 4LF5K 2E6MA 1ASUA 2FBXA 3CCMN 1HJOA 4N47A 4MO5A 1M1KO 3PX6A 2IS3A 4JS4A 3CC4N 3NGZA 1KQSM 1HUXA 2O8BB 4CGDA 4FWKA 3RMDA 3M5RA 2VWJA 5C24A 2NRWA 4Q5VA 1TGOA 2O8EA 1I39A 4BR2A 2YNHA 1SL2A 2HF4A 4DSLA 4BWJA 3THXB 1RFQA 2BGGA 1Q8IA 5F2RA 5LMNK 4FSVA 2CH6A 3MN9A 1S5JA 4CIGA 1RDWX 3OYJA 5JLFA 4H0TB 1U45A 4KREA 4E1JA 4QOZB 1UA0A 3E9PA 4DR3K 4DQPA 3S3MA 2VG5A 2HHQA 3G0ZA 4K43A 2G8WA 2CGLA 4CIFA 2E5LK 1ZXOA 1BI4A 1YVUA 3ZX0A 1VQ9N 1NU0A 2KLAA 4UY8O 3IS9A 5AZIB 4RW7A 4DFPA 2IVNA 4CGFA 4IJNA 3U8XA 3K0SA 3ZETB 2ZJRL 2A42A 3QNNA 2OPQA 3H3OB 3UKRA 4I9LA 2V52B 4DV7K 4BQZA 1NOZA 4F8RA 4BR0A 1CZ9A 5CZ2A 1L3SA 3TARA 4BRQA 5AZJA 1WBDA 4IFVA 4B1XB 4DQRA 4JV5K 2AA4A 3IUCA 4IWVA 1BG3A 4DUZK 2DPNA 3QIOA 3AA5X 4O0IA 1FJGK 4LFBK 3NH0A 2VG6A 4FM1A 3MDQA 4A5BA 2PZSA 4FLTA 4A57A 4FLWA 3F9MA 3ZT1A 1TVRA 5TKYA 4CEZA 3CCJN 3U9ZA 3MAQA 2Q97A 4YOWA 4O8UA 1BUPA 4C8NA 3HOTA 4H0OA 2ZM6K 1NK6A 4FJ8A 1T6DA 3V9XA 3O1BA 3G10A 1NGGA 4CZIA 2HHSA 1RGIA 5MLCQ 3M8SA 2YNFA 4DLEA 1JXEA 2FBVA 4ID1A 3DRRA 3NVMA 3CC2N 2FLOA 3MEEA 1VSEA 4FWSA 4NCBA 3TSPA 4FJMA 3I8BA 1RT7A 4BR9A 1A5XA 3I55N 3NH1A 4FJNA 2UXCK 2FBTA 5JMVA 3EZ5A 5AQNA 3LDSA 3TTCA 3VEXA 3LP0A 3L2QA 3GE1A 3AVNA 5ELZA 1IKYA 5M1FA 4FVUA 5JVGL 4WYBA 1UOCA 4CHYA 3NBPA 4XH5A 3RTVA 2HSTA 3NVKA 3NGIA 1S9GA 4WCEL 2Q0UA 3K57A 4F4KA 4C8MA 4BRDA 2VCPA 1U4BA 3EY1A 1GLDG 1EETA 1U04A 1MU2A 3H08A 3SPZA 4R79A 1KCFA 5BPMA 3VQ9A 1W9HA 4KHUA 2QI2A 2HB5A 2OCEA 3KLGA 1KVAA 4B3TK 4C8OA 3TSUA 4CJ5A 2BE2A 4A62A 1DTQA 2A1SA 1SUQA 3QINA 4CEFA 4CJSA 5AQLA 3ZX2A 1NJIO 1JXBA 2Y1IA 3KIOA 3SUOA 1KC8O 1KAXA 3AVCA 4Y0WA 3JAMO 4YDUC 1RDBA 3D45A 3CCSN 4DV5K 4M63C 4KHNA 4IKFA 2R7YA 3QMLA 4GV6A 3CYMA 2HNZA 3WUHA 2OPRA 3CHWA 3HM8A 3LDQA 1ATRA 1KD1O 3VQ7A 3ZEUA 4BR7A 3J7ZO 2NRXA 5BPNA 3HP6A 3K5LA 3QEVA 3VETA 4CBUA 3WXMB 3DLKA 4N41A 3NGYA 1WAJA 3RWUA 5DM6L 3VEWA 4BGBA 5BRDA 4K8ZA 2WOMA 3B6PA 4ILJA 1WAFA 1QVFM 3RMAA 3IDHA 1N33K 4DG1A 3K9JA 1K9MO 2E1ZA 1W2BM 2HVHA 2P1JA 4JNEA 1WSHA 3P83D 3MN7A 4JKGA 4JKHA 1D9FA 3MXJA 4J2DA 3QBXA 3T3FA 5GAGP 1RT4A 3C95A 3D6RA 3DXKA 1C6VA 3ITHA 4FWOA 1S1TA 4OO1J 3F9KA 4IEEA 1RNHA 4NCGA 4HCBA 1NJWA 3CM6A 4K42A 4DV3K 4KHWA 2D5RA 3LPUA 1XC9A 3SBTA 3VQAA 5KPRA 1IBLK 4CFDA 5HRRA 3QNOA 4K8XA 2QKBA 3R6MA 4O4GA 3A5MC 3QB0A 4XH1A 5J2QA 3S3OA 3ZLJA 3VGLA 1NGDA 3HTVA 3D0PA 1YJWN 1IKXA 3THYA 1K8KB 3SK3A 4KTQA 4LF8K 4FM2A 2EHGA 3AO5A 4DTUA 1EKEA 3L4QA 3FZHA 4CZLA 1YIJN 4NLBA 2QWMA 4YHHK 4GVMA 3S9HA 1C0UA 1NGBA 3WNFA 3N4QA 1YJNN 3C7NB 1B92A 4KB0A 4PWDA 4V19S 4CD1A 3O3HA 4DUYK 1Z6RA 5LJWA 3CQYA 3ATUA 1CLQA 3EYZA 3TAQA 2HW3A 1RT2A 3ZT0A 5KRSA 3IMXA 3EKUA 5AQIA 3TABA 4IO8A 1NMDA 4B9QA 4H5NA 4M7XA 4CFCA 5HBMA 1NOYA 2Z1HA 4CHZA 1BL3A 5JLHA 2ZD1A 3EN9A 2ATQA 3KD1E 3I56N 4X65K 4B1ZA 3WQUA 2YHAA 1IV0A 1EX4A 4NLCA 2KTQA 3HOSA 1YVNA 4DQIA 1RDAA 5FPEA 4C23A 1NJZA 2Q31A 3AGKA 1CXUA 2P5OA 1GLFO 3TU5A 3RR8A 3DAWA 2F9WA 2GX9A 3OYNA 1UAXA 3MEGA 4M3RA 4FW2A 4IDKA 4ZTFA 4YDUA 1S22A 4FLYA 1VSIA 1EP4A 1TKXA 2VWBA 5C15A 3LP1A 4ISFA 1BU6O 4CGGA 4CGJA 2UUAK 1BO5O 4DV2K 3IKMA 3KHYA 4CFBA 3PIOL 2NNWA 3AA2A 4RWTA 2P9IA 4H0XB 1VQ7N 2QWNA 2P9KA 4ID5A 3ATVA 4DSIA 1HPMA 3KLFA 4Z4FA 4IDHA 4ELUA 3MECA 1TUYA 5F0XA 2QTDA 3M8RA 1NLVA 3CF5L 3WEEB 3KKSA 3UB5A 4DCHA 3O1WA 4OPAA 4FK4A 4ISGA 5H1SQ 4ELTA 4FM0A 1W97L 4OPHA 4HCCA 2E2NA 5KI6A 1D8YA 4CZKA 2E6LA 4Y1DA 4E7HA 4JI1K 3LALA 5GINA 2I7PA 1HNVA 5AQTA 1I3AA 4R5PA 4KHPK 1J53A 3KJVA 3CM5A 5JVHL 4CEEA 3FZLA 2Z1GA 4DR2K 2Y1JA 4JYAK 1OH8A 2QWOA 3SLCA 2E4LA 3QFUA 4E7JA 3LP3A 3OYGA 5KQDA 3OY9A 4A59A 4IBNA 2YKMA 2KZMA 4AHVA 3F5TA 4FWQA 1X1PA 2P9NB 1CZBA 1FXXA 4IXCA 1E3MA 4E19A 3CMAN 4ILGB 4JI6K 2W41A 1U49A 4Z4EA 4YOUA 1ZBUA 2YJEA 2YJFA 1IG8A 4M7YA 2WTUA 4CCHA 4FPBA 2UYTA 4LF9K 1HYZA 3P5JA 3ZSQA 3D2FA 1BWFO 3I0RA 5M1OA 1SL0A 3I0SA 3WXKA 1NM1A 4E3SA 4K41A 4JKBA 2PYLA 3O5BA 3ZCMA 1RBVA 2O8CA 4FJGA 3J7YP 4CJUA 1JLFA 2ZGZA 1XI1A 1FW6A 4AILC 3O3GA 1VAZA 2P9NA 4N56A 3V9ZA 2KFZA 1HNWK 3VTIA 1IBMK 4JI7K 4CK2A 1WOQA 5JICA 3TI0A 1OVYA 1LWCA 3VQQA 1R59O 4IOCL 3DI6A 3M3ZA 3RSEB 1KTQA 2GWJA 4PQUA 3BUZB 2HHWA 3CCLN 4FK2A 5CYMA 3C94A 4JI2K 3J8AA 3LP2A 4JI0K 2IVOA 1TKDA 5C2FA 2IVPA 2FBYA 3A5NC 3KK1A 4O8KA 4CZMA 1NGHA 3O4NA 4LSNA 3R3LA 2G8IA 2V51B 3VQCA 1HYVA 1FK9A 2IC3A 4CJLA 2RHKA 4AHTA 4CJRA 3VF4A 3SQ2A 5GAEP 3OVNA 1L3UA 1RBTA 4YY3K 3CIPA 3VQ6A 3AVGA 4LH5A 3BF1A 4WQ5A 1WSGA 4JHDB 3S3NA 1IKWA 3FFIA 4QCLA 3LANA 4HVJA 3ZSOA 5HOOA 2UUCK 2IAJA 4JS5A 3K5NA 1J6ZA 2XY5A 2QXFA 2WC9A 5FPNA 3LDOA 3TR8A 1Q86O 4FJ5A 4C8LA 5A2QO 3M8QA 1TYQB 4DU3A 1KVBA 1GLJO 4CZHA 3C0BA 1SAZA 5HROA 1JL2A 4ICLA 3WNGA 4CHNA 1NK4A 2XRIA 3KWIA 4DV6K 2B6AA 4MQ3A 4CZEA 2A41A 2WUSA 1CZAN 4FLXA 4EAHD 2Q2RA 4JHDA 4CEAA 2KFNA 1GLEG 3E1YA 3BZKA 1LCUA 4DTNA 3EO3A 2HHHK 4O5BA 3O6WA 4BC5A 3GBTA 1QTMA 3VQDA 1VQ6N 3AAPA 3QLHA 4I6MA 5E26A 3CJ9A 3O3FA 3AA3A 3ZT4A 1BGXT 4DR4K 1HNXK 1KSPA 3BGRA 3DLLL 5AJ3K 1VRTA 3DM2A 4ISEA 3I8DA 2IOCA 3SZ2A 5FRMA 2GUIA 5M1NA 2E2PA 4RW9A 3CFPA 1K8AO 3M1FA 3VQEA 5EU7A 4BROA 3KZBA 4DV4K 2P5GA 2UXBK 1HLUA 1WUAA 4X66K 3O4QA 2DFHA 3VEYA 4A61A 1RCHA 4BRFA 1MDUB 5HRNA 2O4IA 1QSSA 3EE9A 5SWMA 1RBUA 2FXUA 1NGCA 1MWMA 4FW1A 5CE3A 4H5WA 4HUEA 4IO9L 3VEVA 4BDYA 4M3UA 2P9SB 3DLHA 4CJKA 3T1AA 2OTLN 4I2QA 3U6FA 3ENOA 4BREA 1HR0K 4KHYA 1XC3A 4FLVA 4Z4HA 3BP8A 4LD0A 2QA4N 1QQNA 3U3GA 3MX2A 4CF2A 5BPLA 4O5FA 1DKGD 1VRUA 4DLGA 2A3ZA 2O8BA 3DRSA 3QERA 2HMIA 2VWKA 3H3NO 1RTIA 2GELA 5AQPA 1Q9YA 3SCXA 3K9KA 3EE8A 4W5QA 2JLEA 3HBTA 3DJCA 4PKHA 3PO4A 5HRSA 3THXA 1S1VA 3E9LA 5EVZA 4BE2A 4A5AA 4DTRA 1OVQA 3CCEN 2G8FA 1Q18A 4YORA 1U47A 3L6QA 3VN5A 1LW2A 1JCEA 2H3GX 4CEQA 4HTLA 4BRMA 3FGUA 3THWB 1NNEA 4J2AA 4DF4A 5M1PA 5KTQA 3OTOK 4M3WA 4YOXA 3MN6A 4IOAL 1ATSA 1RT6A 1GLLO 3EEQA 4JI5K 3SPYA 4KTWA 3WQTA 3ULEB 1NGIA 5AZIA 1VSKA 3CFOA 4B8CA 2A1RA 2ZGYA 3ZETA 4H03B 1X9MA 4H5VA 3AVIA 2KW4A 2D0CA 4CJ4A 1T44A 4JAXA 3SBGA 2GWKA 4GV3A 4PUOA 4BRCA 3W0LA 4GV9A 5AQXA 2JWLA 5LY3A 5C2DA 1BIUA 5KPZA 3AVBA 1QSLA 4FPAA 4RG8A 1S1XA 1N8RO 2GBZA 3F2KA 3ZSXA 4FOEA 1A5VA 3THWA 5AQJA 2ASMA 3D2EB 2X74A 2ETJA 4CK1A 4HUFA 4NB4A 4DS4A 4JK8A 1K6YA 1MA9B 4FCYA 5AQWA 4CFAA 4DQSA 1R0AA 1BOTO 2UXDK 1KVCA 3ZSVA 3SYZA 4CJFA 1CXQA 2D0OA 3FZMA 5C12A 3MX5A 3AO1A 4YOTA 4CESA 2WONA 3B6OA 3U9DA 4B3MK 5KGWA 5LMUK 4EHTA 1UA1A 2E8AA 4JKEA 4BVPA 3HVTA 3TAGA 4NXNK 1TL1A 5HL7L 1E4GT 1SQKA 3KK7A 4EZ9A 3CD6N 2D4WA 2ZJPL 3VMFB 1GLAG 1XNQK 4CERA 4EP4A 4IOXA 4WQ4C 3BF3A 4BRIA 1NK5A 3HZ6A 1Y64A 5GIPA 4O55A 1KAYA 5CZ1A 1TAUA 2E20A 2LSNA 3MN5A 4MLEA 2ASPA 3RRHA 2B4JA 2Q36A 3OYMA 4DWIA 1YHQN 3PUFA 1TK5A 1X3MA 3K2PA 1GOAA 3SQ0A 3NF9A 3L3UA 1VSMA 1S1WA 3KVGA 4FWRA 4B9UA 3ENBA 3O08A 1T05A 1SL1A 3LAKA 2DTUA 3LPTA 1I94K 5JS1A 5EY4A 4HWIA 4FYDA 2O8DB 4CIEA 3OS0A 2E1YA 1XWLA 2OANA 3E66A 3PSFA 2E2OA 4H0YB 3NFAA 1JJ2M 2P9PB 3W3DA 3LAMA 4IG0A 1Y97A 1HMVA 5D3GA 2BUPA 4DSJA 5M1QA 3BDPA 4DR6K 4DF8A 3VF6A 2G8UA 4CJ3A 4BE1A 3VTHA 4BRNA 3SJHA 1X3NA 3CG7A 3GG4A 4DR7K 4IEIA 3PIPL 3OYKA 3KK2A 1WSJA 3M8PA 5EOYA 4BDPA 1NJYA 3HXMA 3H45C 1W7AA 2QEXN 1NBWA 3OYCA 2BTFA 1KAZA 3T19A 4Z0UA 3OYHA 4FJ7A 4JD2B 1DT9A 3QESA 1BCMA 1QSYA 4CJWA 5AQGA 4BC3A 4EZ6A 3P39A 3HK2A 3EZWA 3LDPA 4DSFA 4M3TA 4BVOA 2YNIA 4L8RB 4KFBA 5E84A 1C0MA 4GW6A 3K5MA 3EKSA 3VQPA 4GVEA 3L4IA 1ZBSA 2KQ2A 1NKBA 3PLAA 1X9SA 1A5WA 1NGEA 2NRTA 2W40A 2YKNA 1K8KA 1TK8A 2PY5A 3GOIA 4LY7A 4PKGA 4ZHRA 4FJJA 5HLFA 3SUQA 4J8FA 3SMPA 5CR4A 1NK0A 3OBYA 5J2PA 4CECA 2Q1NA 4HTUA 2QXLA 3C7NA 4FWLA 4EFHA 2ZQBA 4CF8A 1H1VA 2DFEA 1RDUA 4TSXA 2PFUA 3QEIA 4FJIA 3QIPA 2V7YA 3O80A 1NG9A 4KH4A 1NK7A 3HRGA 2A5XA 4QS7A 3SAFA 1GOBA 1BA1A 3DXMB 3JXUA 3VA3A 4WQ4A 3CJBA 3OYBA 5AQRA 4Q0BA 4NYNA 4RCHA 1K73O 2O8FB 3MEDA 4CEOA 4B1UB 1N34K 5BREA 1SKWA 3TPQA 2GV9A 4FOIA 4YNQA 4WQ5C 4CZGA 3NCIA 2HBJA 4M42A 1V4SA 3VESA 4WFBL 2QWQA 3H1VX 3TANA 1VQON 1HKGA 3KLHA 1O13A 1P8ZA 1RT3A 2HNYA 4E1NA 5ADXA 1T7PA 3DLEA 1ITGA 3H46O 4QS8A 4FK0A 3CJCA 1BQNA 1TK0A 4JRPA 4B08A 5AFUA 4CHQA 4AHSA 4BRAA 3OYIA 3OJSA 1QS4A 2FF3B 1C1CA 4JEPA 3GL1A 2BH1A 2Z1JA 1BCOA 2P9LB 3O9QA 4OJRA 2YHBA 3V6DA 4A2BA 2F4VK 1WSFA 1WN7A 2P9UB 2XY7A 4JI8K 2OTJN 2VGNA 4AH9A 4B1YB 4DMNA 5EXWA 3JSMA 1IBKK 2GUPA 2NUBA 1Z25A 1JLEA 1OH7A 1TKZA 3WEEA 1XMOK 3B8AX 1C0TA 4Z94A 3WXJA 2J4RA 3OYAA 2HOEA 3CJAA 1WBBA 4KKOA 4KO0A 2YHXA 4DFMA 3PV8A 4K0KK 2HHUA 4CI6A 2RE2A 4KHSA 3KLEA 5I3UA 4RTFD 2CH5A 3TTDA 3A8YA 1OH5A 1Q81O 1DLOA 3QICA 4DTSA 3MCPA 4F9OA 4CEDA 1N5YA 5BN8A 1S6QA 2P9UA 4H0VB 4CJVA 4E1MA 3QETA 2FF6A 3AVMA 3DLRA 1NWKA 4CJ7A 2NRRA 3ZSRA 2KKZA 1Q82O 4DS5A 1SKSA 1VQNN 1IH7A 1NGFA 1HRHA 1YUWA 3E01A 5C10A 4WFAL 5CY4A 3N4PA 4U7BA 4CVNE 1S3XA 3UKUB 1HKBA 1ZBLA 4DSKA 3CCUN 3KWGA 1BQMA 4MFBA 2YX6A 2HBKA 2XHBA 1BA0A 4HHTA 4LSLA 4L3QA 3SNNA 3DOLA 1Q7YO 3VQ8A 2GTDA 2GEMA 2W6LA 3LM9A 4JRQA 3HVRA 4DFJA 1JL1A
chains in the Genus database with same CATH topology
2OPRA 4M41A 4DLGA 1L3VA 3HP9A 3DRSA 3L2RA 3QERA 3VQ7A 2HMIA 2VWKA 3OS1A 2KZZA 3HP6A 3K5LA 3QEVA 4BACA 1IKVA 1RTIA 1S6PA 3ASMA 3VQ5A 4IG3A 3DLKA 1Q9YA 4N41A 1VSJA 3AVJA 1YTUA 3NGYA 2XO7A 3SCXA 1WAJA 5J1EA 4W5QA 2JLEA 4QAGA 4FXDA 4GMJB 4F3TA 3PO4A 4B9SA 5HRSA 3RWUA 1IO2A 3K58A 1S1VA 1Q9XA 4K8ZA 2WOMA 1JLBA 3B6PA 4BE2A 1WAFA 2Q3SA 3RMAA 4DTRA 1LAVA 1SV5A 5KRTA 4DG1A 5FRNA 2G8FA 4B9TA 2HVHA 1U47A 3VN5A 1LAWA 2P1JA 1WSHA 3P83D 5FDLA 1RILA 1LW2A 2JGUA 4CEQA 3QEPA 1U48A 1N6QA 2QK9A 3OYDA 1D9FA 4KV8A 3MXJA 3AO4A 1L3TA 5C25A 4J2DA 1NK9A 3AV9A 3T3FA 4J2AA 4DF4A 3MXMA 1RT4A 3C95A 1D9DA 4M3WA 5KTQA 4DTPA 1C6VA 3HSTB 1RBRA 3V81A 3ITHA 1S1TA 3NF6A 3F9KA 3KKRA 3KLIA 4M3YA 5C42A 2HHTA 1RT6A 5JS2A 1HPZA 2D0BA 3SPYA 4KTWA 4KI6A 1RTDA 1RNHA 4NCGA 4C8KA 4HCBA 1NJWA 3CM6A 1VSKA 3C6UA 3CFOA 3DOKA 4B8CA 4KHWA 4OPKA 2D5RA 2DY4A 3LPUA 1XC9A 3AVAA 2AJQA 3DLGA 3NHGA 1VSLA 3VQAA 2A1RA 3DLBA 4AHCA 4CJQA 4CFDA 5HRRA 3QNOA 4K8XA 2QKBA 1X9MA 3A2FA 3AVIA 4O4GA 2KW4A 2D0CA 4CJ4A 4B9VA 4HUGA 1ASWA 5J2QA 3S3OA 2OA8A 3D0PA 4PUOA 1IKXA 4KTQA 3IAYA 4FM2A 4CJPA 2EHGA 4UQGA 3U3YA 5T7BA 3AO5A 4DTUA 4F2SA 1EKEA 4KB1A 3SI6A 1XHZA 1BIUA 4GVMA 1C0UA 3WNFA 3S9HA 3AVBA 3WNHA 1QSLA 1B92A 4RG8A 1TL3A 1S1XA 4KB0A 4PWDA 1HJRA 2GBZA 4DU4A 3ZSXA 3NE6A 1A5VA 3VQBA 3O3HA 2X74A 4FJHA 1C1BA 2ETJA 1RDCA 4CK1A 1RDDA 4ELVA 4HUFA 4DS4A 1CLQA 3EYZA 3TAMA 3TAQA 2HW3A 1K6YA 1RT2A 3ZT0A 5KRSA 3AO3A 4FCYA 4W5TA 4KTZA 1JKHA 1FKPA 4CFAA 2I5JA 1QE1A 4DQSA 3TABA 3DYAA 1R0AA 1KVCA 3ZSVA 3SV4A 3QEWA 4B9MA 2HHVA 1TKTA 3SYZA 4CJFA 1CXQA 3HM9A 4OGCA 1F21A 1LW0A 3AVKA 3IRXA 3THVA 2G8HA 4FJXA 1JLAA 3LZJA 3ULDA 3QEXA 3PO5A 3AO1A 4CFCA 5HBMA 1NOYA 1BI4B 1VSHA 1XHXA 2Z1HA 3L3VA 4CESA 2BANA 4CHZA 4Z4CA 4E7KA 2WONA 2IDOA 4DTMA 1BL3A 4O44A 1ZBIA 3B6OA 2ZD1A 2ATQA 3KD1E 1T8EA 3MXIA 5KGWA 3V9SA 3QO9A 1LWFA 2YHAA 1UA1A 1EX4A 3PY8A 3TAGA 3HVTA 1WSIA 3NF8A 4G1QA 4DQIA 2KTQA 1RDAA 4CGIA 1TL1A 1NJZA 1CXUA 3ZSZA 2P5OA 4EZ9A 3RR8A 3OYNA 4B9NA 1UAXA 4B9LA 1QHTA 4B8AB 3MEGA 4CERA 1UWBA 4M3RA 4CK3A 2PYJA 4EP4A 3NH2A 3KTQA 4KI4A 2X78A 4FW2A 4IDKA 4ZTFA 1NK5A 4FLYA 4CJTA 1VSIA 4FZZA 3HPHA 1EP4A 4O55A 1VSFA 1TKXA 5CZ1A 1TAUA 3LP1A 3AVFA 2BDPA 2LSNA 4CF9A 4CGGA 4CGJA 1LV5A 3LZIA 1WLJA 3L2UA 1NKEA 3V1QA 3CFRA 1IG9A 4CE9A 4CFBA 3RRHA 2B4JA 3AA2A 3L8BA 3OYMA 4DWIA 4E0DA 3PUFA 4ID5A 3HT3A 2ITGA 4BWMA 1TK5A 3K2PA 4DSIA 1GOAA 3SQ0A 3NF9A 3C6TA 3HVRA 3ZT3A 3KLFA 3L3UA 3P1GA 4M3ZA 3ZT2A 4FJ9A 4Z4FA 1BISA 3HPOA 1VSMA 4ELUA 1S1WA 3MECA 1HQUA 2RF2A 1WNSA 1RT5A 3M8RA 3ISNC 4B9UA 4RW8A 3PX0A 3RR7A 3KD5E 1T05A 3OYLA 3KKSA 4PY5A 4FJLA 2QKKA 1SL1A 4OLAA 3HJFA 3LAKA 2DTUA 3LPTA 5JS1A 4FYDA 2XY6A 4FK4A 5DK5A 4CIEA 3OS0A 1S9EA 4I2PA 1XWLA 4XIUA 2X6NA 3L2WA 4ELTA 1VK0A 1EXQA 4FM0A 2O4GA 4H4OA 5K14A 4CGHA 3NFAA 3OJUA 4Y1CA 4HCCA 1KLMA 5KI6A 5J2MA 1D8YA 1TV6A 2E6LA 4Y1DA 3LAMA 4IG0A 4E7HA 1Y97A 1TAQA 3LALA 4DTXA 1HMVA 1SKRA 2YV0X 1ZBFA 4J2EA 1HNVA 2DFFA 1I3AA 4CHPA 4O0JA 4R5PA 4DSJA 5D3GA 1HYSA 2P51A 3BDPA 1J53A 3KJVA 3PX4A 3CM5A 4FZXC 4CEEA 4W5RA 2Z1GA 4W5OA 4CHOA 5SZTA 4DF8A 2Y1JA 2G8UA 4CJ3A 2E4LA 1ASVA 4E7JA 4BE1A 3LP3A 3OYGA 2OZMA 1YT3A 3CG7A 3LWLA 4OKEA 3OY9A 1ZYQA 2OPPA 4IBNA 2YKMA 2KZMA 3HL8A 4AHVA 3OYKA 1WSJA 3KK2A 3IG1A 3M8PA 1X1PA 1T03A 4BDPA 1CZBA 1FXXA 1W0HA 1NJYA 4E19A 3HXMA 4OLBA 4E89A 5I42A 3F73A 4F3OA 1BHLA 3RMBA 1JLGA 1FKOA 3TAEA 3OYCA 4I9QA 1RBSA 1X9WA 1U49A 3OYFA 2XY8A 3T19A 1NKCA 4Z0UA 4Z4EA 4W5NA 3OYHA 4FJ7A 2F8TA 1ZBUA 4B3OA 4PA1A 4FJKA 3DRPA 4CEBA 4CCHA 4OVLA 2HHXA 3QESA 1BCMA 1QSYA 4CJWA 3AA4A 1HYZA 3P5JA 1VSDA 1RTJA 4EZ6A 4NYFA 1DTTA 3ZSQA 4DU1A 3HK2A 3I0RA 4DSFA 1YTAA 4DTOA 4M3TA 2YNIA 4AHUA 4L8RB 2FC0A 4KFBA 4H8KA 3I0SA 1SL0A 2ZE2A 1RT1A 4E3SA 5HRPA 1J5OA 1BIZA 1J54A 1C0MA 4GW6A 3K5MA 2PYLA 3VQPA 2OPSA 4H4MA 4LH4A 1B9DA 1O1WA 3ZCMA 2OZSA 4FVMA 3OYEA 2KQ2A 1NKBA 3AVHA 1X9SA 1A5WA 2G8VA 1RBVA 4DSEA 5J2NA 4FJGA 2F96A 2E6MA 1ASUA 2FBXA 3K5OA 4CJUA 4N47A 1JLFA 1XI1A 2YKNA 3PX6A 1TK8A 3RMCA 2IS3A 4JS4A 2PY5A 3NGZA 4LY7A 4ZHRA 4CGDA 4AHRA 4AILC 3O3GA 2EX3A 5HLFA 4YFUA 3SUQA 4FJJA 3HYFA 4N56A 1REVA 3V9ZA 3RMDA 2VWJA 4KHQA 5C24A 2KFZA 1NK0A 3HO1A 4Q5VA 5J2PA 1TGOA 4CECA 4CK2A 1I39A 1JLQA 3TI0A 1KLNA 1LWCA 2YNHA 3VQQA 4HTUA 3TWHA 4CJEA 2ZQBA 3DI6A 4CF8A 2DFEA 3VA0A 1SL2A 4DSLA 4BWJA 2D0AA 4TSXA 2BGGA 1KTQA 3QEIA 2B5JA 4FJIA 1NK8A 3UIQA 4PQUA 1Q8IA 2HHWA 4IFYA 3QIPA 4FK2A 5CYMA 1S5JA 3C94A 4CIGA 3OYJA 3LP2A 3DMJA 3AO2A 4DFKA 3SUPA 1NK7A 1TKDA 2FBYA 4OKJA 1U45A 4KREA 3TAPA 1HQEA 3KK1A 1QQCA 3SJJA 1GOBA 4QOZB 1UA0A 4DQPA 3S3MA 2VG5A 3VA3A 2HHQA 3G0ZA 3OYBA 4Q0BA 4NYNA 3O4NA 2G8WA 5HP1A 3MEDA 4LSNA 4CEOA 1SKWA 2G8IA 4CIFA 3VQCA 1HYVA 1FK9A 1BI4A 2GV9A 1YVUA 4NCAA 2IC3A 4CJLA 4YNQA 3IS9A 4AHTA 4CJRA 3NCIA 3SQ2A 4J2BA 4RW7A 4DFPA 3OVNA 1L3UA 4CGFA 4M42A 4OGEA 1RBTA 3VQ6A 5FROA 3TANA 3AVGA 3KLHA 1J9AA 1Z26A 3QNNA 4EP5A 2OPQA 1RT3A 4LH5A 3KK3A 2HNYA 4E1NA 1LWEA 4I9LA 1WSGA 3DLEA 1ITGA 1T7PA 3VQ4A 3NDKA 1NOZA 3S3NA 4F8RA 1IKWA 1CZ9A 5CZ2A 1L3SA 3FFIA 3TARA 4FK0A 1TK0A 1BQNA 4IFVA 1JLCA 2VG7A 1WSEA 4QCLA 4JRPA 4B08A 3L2VA 3LANA 4HVJA 4DQRA 3ZSOA 3SQ1A 4CHQA 4Z4IA 3QIOA 3AA5X 4OPJA 4AHSA 2IAJA 4O0IA 3OYIA 3V9UA 3OJSA 4Z4GA 4JS5A 1QS4A 1C1CA 4KPYA 4FZYA 3K5NA 3NH0A 2VG6A 4FM1A 2Z1JA 1D5AA 2XY5A 2QXFA 1BCOA 3TR8A 4FLWA 4FLTA 1NJXA 2PZSA 4FJ5A 4OJRA 4C8LA 2YHBA 3ZT1A 3V6DA 1TVRA 4CEZA 3M8QA 3V1RA 1WSFA 1WN7A 3V1OA 3MAQA 2XY7A 4DU3A 1KVBA 3SQ4A 4C8NA 1NK6A 2RKIA 4E7LA 5HROA 5CYQA 2RN2A 4FJ8A 1JL2A 4ICLA 3WNGA 4AH9A 4CHNA 2XRIA 3V9XA 4DMNA 1NK4A 1HNIA 3JSMA 3G10A 2NUBA 1Z25A 1JLEA 3ZSYA 2HHSA 2B6AA 4MQ3A 1TKZA 4BE0A 3M8SA 2YNFA 4DLEA 1KFSA 3V4IA 4FLXA 1JXEA 1C0TA 4N76A 2FBVA 4ID1A 3DRRA 4CEAA 4RW4A 2KFNA 3OYAA 3RRGA 4DTJA 4KKOA 3MEEA 4KO0A 4DTNA 1VSEA 4WE1A 4I7FA 2RPIA 3OS2A 4DFMA 3PV8A 4O5BA 2HHUA 3CQ8A 4NCBA 1QTMA 3VQDA 4FJMA 3QLHA 4KHSA 1RT7A 3O3FA 3KLEA 5I3UA 1A5XA 3NH1A 3AA3A 3ZT4A 3LWMA 2OYQA 4FJNA 5E41A 1BGXT 3SUNA 1DLOA 2FBTA 3EZ5A 1KSPA 4CF1A 3LDSA 3BGRA 4DTSA 1VRTA 1B9FA 3DM2A 4CF0A 2F8SA 3I8DA 2IOCA 3SZ2A 3LP0A 2GUIA 3L2QA 3SV3A 3AVNA 5FRMA 1GOCA 2X6SA 1IKYA 3K59A 4CEDA 3HPGA 2HNDA 1N5YA 4RW9A 1S6QA 3CFPA 5KGXA 4DQQA 2W42A 2HVIA 3VQEA 1UOCA 5EU7A 4CHYA 3NBPA 3TAFA 3AVLA 2G8KA 3NAEA 3NF7A 4CJVA 4E1MA 3QETA 3AVMA 3RTVA 3DLRA 4M3XA 2P5GA 3NGIA 1S9GA 3O4QA 2IGIA 2DFHA 3K57A 4N5SA 4F4KA 4C8MA 3ZSRA 1RCHA 5DMRA 3JYTA 4DS5A 4FLUA 1G15A 5HRNA 1SKSA 3ALYA 3ZSWA 1IH7A 1U4BA 1QSSA 3EY1A 2O4IA 4BDZA 5SWMA 1RBUA 1U04A 1EETA 1HRHA 1MU2A 3H08A 2Z1IA 3SPZA 3E01A 1KCFA 4FW1A 4KAZA 5CY4A 3VQ9A 1W9HA 3V9WA 4KHUA 4HUEA 2HB5A 4BDYA 3KLGA 1KVAA 4C8OA 1ZBLA 4KRFA 4CJ5A 1KFDA 2BE2A 4DSKA 1DTQA 2A1SA 1SUQA 3QINA 4OKKA 4CEFA 4CJSA 4M3UA 1JXBA 2Y1IA 3KIOA 3SUOA 4M45A 3DLHA 1BQMA 3T1AA 3AVCA 4CJKA 4I2QA 4MFBA 4FLZA 4E7IA 3U6FA 2YNGA 2XHBA 4ZTJA 1L5UA 4HHTA 1RDBA 4LSLA 3D45A 3SNNA 4KHYA 3DOLA 4JLHA 3VQ8A 3WNEA 4FLVA 4KHNA 4IKFA 2R7YA 1C1AA 4Z4HA 1RTHA 1KRPA 4RW6A 4LD0A 3U3GA 4F2RA 1S1UA 4CF2A 3CYMA 4JRQA 1ZBHA 2HNZA 1VRUA 4DFJA 1JL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPR A;  4M41 A;  4DLG A;  1L3V A;  3HP9 A;  3DRS A;  3L2R A;  3QER A;  3VQ7 A;  2HMI A;  2VWK A;  3OS1 A;  2KZZ A;  3HP6 A;  3K5L A;  3QEV A;  4BAC A;  1IKV A;  1RTI A;  1S6P A;  3ASM A;  3VQ5 A;  4IG3 A;  3DLK A;  1Q9Y A;  4N41 A;  1VSJ A;  3AVJ A;  1YTU A;  3NGY A;  2XO7 A;  3SCX A;  1WAJ A;  5J1E A;  4W5Q A;  2JLE A;  4QAG A;  4FXD A;  4GMJ B;  4F3T A;  3PO4 A;  4B9S A;  5HRS A;  3RWU A;  1IO2 A;  3K58 A;  1S1V A;  1Q9X A;  4K8Z A;  2WOM A;  1JLB A;  3B6P A;  4BE2 A;  1WAF A;  2Q3S A;  3RMA A;  4DTR A;  1LAV A;  1SV5 A;  5KRT A;  4DG1 A;  5FRN A;  2G8F A;  4B9T A;  2HVH A;  1U47 A;  3VN5 A;  1LAW A;  2P1J A;  1WSH A;  3P83 D;  5FDL A;  1RIL A;  1LW2 A;  2JGU A;  4CEQ A;  3QEP A;  1U48 A;  1N6Q A;  2QK9 A;  3OYD A;  1D9F A;  4KV8 A;  3MXJ A;  3AO4 A;  1L3T A;  5C25 A;  4J2D A;  1NK9 A;  3AV9 A;  3T3F A;  4J2A A;  4DF4 A;  3MXM A;  1RT4 A;  3C95 A;  1D9D A;  4M3W A;  5KTQ A;  4DTP A;  1C6V A;  3HST B;  1RBR A;  3V81 A;  3ITH A;  1S1T A;  3NF6 A;  3F9K A;  3KKR A;  3KLI A;  4M3Y A;  5C42 A;  2HHT A;  1RT6 A;  5JS2 A;  1HPZ A;  2D0B A;  3SPY A;  4KTW A;  4KI6 A;  1RTD A;  1RNH A;  4NCG A;  4C8K A;  4HCB A;  1NJW A;  3CM6 A;  1VSK A;  3C6U A;  3CFO A;  3DOK A;  4B8C A;  4KHW A;  4OPK A;  2D5R A;  2DY4 A;  3LPU A;  1XC9 A;  3AVA A;  2AJQ A;  3DLG A;  3NHG A;  1VSL A;  3VQA A;  2A1R A;  3DLB A;  4AHC A;  4CJQ A;  4CFD A;  5HRR A;  3QNO A;  4K8X A;  2QKB A;  1X9M A;  3A2F A;  3AVI A;  4O4G A;  2KW4 A;  2D0C A;  4CJ4 A;  4B9V A;  4HUG A;  1ASW A;  5J2Q A;  3S3O A;  2OA8 A;  3D0P A;  4PUO A;  1IKX A;  4KTQ A;  3IAY A;  4FM2 A;  4CJP A;  2EHG A;  4UQG A;  3U3Y A;  5T7B A;  3AO5 A;  4DTU A;  4F2S A;  1EKE A;  4KB1 A;  3SI6 A;  1XHZ A;  1BIU A;  4GVM A;  1C0U A;  3WNF A;  3S9H A;  3AVB A;  3WNH A;  1QSL A;  1B92 A;  4RG8 A;  1TL3 A;  1S1X A;  4KB0 A;  4PWD A;  1HJR A;  2GBZ A;  4DU4 A;  3ZSX A;  3NE6 A;  1A5V A;  3VQB A;  3O3H A;  2X74 A;  4FJH A;  1C1B A;  2ETJ A;  1RDC A;  4CK1 A;  1RDD A;  4ELV A;  4HUF A;  4DS4 A;  1CLQ A;  3EYZ A;  3TAM A;  3TAQ A;  2HW3 A;  1K6Y A;  1RT2 A;  3ZT0 A;  5KRS A;  3AO3 A;  4FCY A;  4W5T A;  4KTZ A;  1JKH A;  1FKP A;  4CFA A;  2I5J A;  1QE1 A;  4DQS A;  3TAB A;  3DYA A;  1R0A A;  1KVC A;  3ZSV A;  3SV4 A;  3QEW A;  4B9M A;  2HHV A;  1TKT A;  3SYZ A;  4CJF A;  1CXQ A;  3HM9 A;  4OGC A;  1F21 A;  1LW0 A;  3AVK A;  3IRX A;  3THV A;  2G8H A;  4FJX A;  1JLA A;  3LZJ A;  3ULD A;  3QEX A;  3PO5 A;  3AO1 A;  4CFC A;  5HBM A;  1NOY A;  1BI4 B;  1VSH A;  1XHX A;  2Z1H A;  3L3V A;  4CES A;  2BAN A;  4CHZ A;  4Z4C A;  4E7K A;  2WON A;  2IDO A;  4DTM A;  1BL3 A;  4O44 A;  1ZBI A;  3B6O A;  2ZD1 A;  2ATQ A;  3KD1 E;  1T8E A;  3MXI A;  5KGW A;  3V9S A;  3QO9 A;  1LWF A;  2YHA A;  1UA1 A;  1EX4 A;  3PY8 A;  3TAG A;  3HVT A;  1WSI A;  3NF8 A;  4G1Q A;  4DQI A;  2KTQ A;  1RDA A;  4CGI A;  1TL1 A;  1NJZ A;  1CXU A;  3ZSZ A;  2P5O A;  4EZ9 A;  3RR8 A;  3OYN A;  4B9N A;  1UAX A;  4B9L A;  1QHT A;  4B8A B;  3MEG A;  4CER A;  1UWB A;  4M3R A;  4CK3 A;  2PYJ A;  4EP4 A;  3NH2 A;  3KTQ A;  4KI4 A;  2X78 A;  4FW2 A;  4IDK A;  4ZTF A;  1NK5 A;  4FLY A;  4CJT A;  1VSI A;  4FZZ A;  3HPH A;  1EP4 A;  4O55 A;  1VSF A;  1TKX A;  5CZ1 A;  1TAU A;  3LP1 A;  3AVF A;  2BDP A;  2LSN A;  4CF9 A;  4CGG A;  4CGJ A;  1LV5 A;  3LZI A;  1WLJ A;  3L2U A;  1NKE A;  3V1Q A;  3CFR A;  1IG9 A;  4CE9 A;  4CFB A;  3RRH A;  2B4J A;  3AA2 A;  3L8B A;  3OYM A;  4DWI A;  4E0D A;  3PUF A;  4ID5 A;  3HT3 A;  2ITG A;  4BWM A;  1TK5 A;  3K2P A;  4DSI A;  1GOA A;  3SQ0 A;  3NF9 A;  3C6T A;  3HVR A;  3ZT3 A;  3KLF A;  3L3U A;  3P1G A;  4M3Z A;  3ZT2 A;  4FJ9 A;  4Z4F A;  1BIS A;  3HPO A;  1VSM A;  4ELU A;  1S1W A;  3MEC A;  1HQU A;  2RF2 A;  1WNS A;  1RT5 A;  3M8R A;  3ISN C;  4B9U A;  4RW8 A;  3PX0 A;  3RR7 A;  3KD5 E;  1T05 A;  3OYL A;  3KKS A;  4PY5 A;  4FJL A;  2QKK A;  1SL1 A;  4OLA A;  3HJF A;  3LAK A;  2DTU A;  3LPT A;  5JS1 A;  4FYD A;  2XY6 A;  4FK4 A;  5DK5 A;  4CIE A;  3OS0 A;  1S9E A;  4I2P A;  1XWL A;  4XIU A;  2X6N A;  3L2W A;  4ELT A;  1VK0 A;  1EXQ A;  4FM0 A;  2O4G A;  4H4O A;  5K14 A;  4CGH A;  3NFA A;  3OJU A;  4Y1C A;  4HCC A;  1KLM A;  5KI6 A;  5J2M A;  1D8Y A;  1TV6 A;  2E6L A;  4Y1D A;  3LAM A;  4IG0 A;  4E7H A;  1Y97 A;  1TAQ A;  3LAL A;  4DTX A;  1HMV A;  1SKR A;  2YV0 X;  1ZBF A;  4J2E A;  1HNV A;  2DFF A;  1I3A A;  4CHP A;  4O0J A;  4R5P A;  4DSJ A;  5D3G A;  1HYS A;  2P51 A;  3BDP A;  1J53 A;  3KJV A;  3PX4 A;  3CM5 A;  4FZX C;  4CEE A;  4W5R A;  2Z1G A;  4W5O A;  4CHO A;  5SZT A;  4DF8 A;  2Y1J A;  2G8U A;  4CJ3 A;  2E4L A;  1ASV A;  4E7J A;  4BE1 A;  3LP3 A;  3OYG A;  2OZM A;  1YT3 A;  3CG7 A;  3LWL A;  4OKE A;  3OY9 A;  1ZYQ A;  2OPP A;  4IBN A;  2YKM A;  2KZM A;  3HL8 A;  4AHV A;  3OYK A;  1WSJ A;  3KK2 A;  3IG1 A;  3M8P A;  1X1P A;  1T03 A;  4BDP A;  1CZB A;  1FXX A;  1W0H A;  1NJY A;  4E19 A;  3HXM A;  4OLB A;  4E89 A;  5I42 A;  3F73 A;  4F3O A;  1BHL A;  3RMB A;  1JLG A;  1FKO A;  3TAE A;  3OYC A;  4I9Q A;  1RBS A;  1X9W A;  1U49 A;  3OYF A;  2XY8 A;  3T19 A;  1NKC A;  4Z0U A;  4Z4E A;  4W5N A;  3OYH A;  4FJ7 A;  2F8T A;  1ZBU A;  4B3O A;  4PA1 A;  4FJK A;  3DRP A;  4CEB A;  4CCH A;  4OVL A;  2HHX A;  3QES A;  1BCM A;  1QSY A;  4CJW A;  3AA4 A;  1HYZ A;  3P5J A;  1VSD A;  1RTJ A;  4EZ6 A;  4NYF A;  1DTT A;  3ZSQ A;  4DU1 A;  3HK2 A;  3I0R A;  4DSF A;  1YTA A;  4DTO A;  4M3T A;  2YNI A;  4AHU A;  4L8R B;  2FC0 A;  4KFB A;  4H8K A;  3I0S A;  1SL0 A;  2ZE2 A;  1RT1 A;  4E3S A;  5HRP A;  1J5O A;  1BIZ A;  1J54 A;  1C0M A;  4GW6 A;  3K5M A;  2PYL A;  3VQP A;  2OPS A;  4H4M A;  4LH4 A;  1B9D A;  1O1W A;  3ZCM A;  2OZS A;  4FVM A;  3OYE A;  2KQ2 A;  1NKB A;  3AVH A;  1X9S A;  1A5W A;  2G8V A;  1RBV A;  4DSE A;  5J2N A;  4FJG A;  2F96 A;  2E6M A;  1ASU A;  2FBX A;  3K5O A;  4CJU A;  4N47 A;  1JLF A;  1XI1 A;  2YKN A;  3PX6 A;  1TK8 A;  3RMC A;  2IS3 A;  4JS4 A;  2PY5 A;  3NGZ A;  4LY7 A;  4ZHR A;  4CGD A;  4AHR A;  4AIL C;  3O3G A;  2EX3 A;  5HLF A;  4YFU A;  3SUQ A;  4FJJ A;  3HYF A;  4N56 A;  1REV A;  3V9Z A;  3RMD A;  2VWJ A;  4KHQ A;  5C24 A;  2KFZ A;  1NK0 A;  3HO1 A;  4Q5V A;  5J2P A;  1TGO A;  4CEC A;  4CK2 A;  1I39 A;  1JLQ A;  3TI0 A;  1KLN A;  1LWC A;  2YNH A;  3VQQ A;  4HTU A;  3TWH A;  4CJE A;  2ZQB A;  3DI6 A;  4CF8 A;  2DFE A;  3VA0 A;  1SL2 A;  4DSL A;  4BWJ A;  2D0A A;  4TSX A;  2BGG A;  1KTQ A;  3QEI A;  2B5J A;  4FJI A;  1NK8 A;  3UIQ A;  4PQU A;  1Q8I A;  2HHW A;  4IFY A;  3QIP A;  4FK2 A;  5CYM A;  1S5J A;  3C94 A;  4CIG A;  3OYJ A;  3LP2 A;  3DMJ A;  3AO2 A;  4DFK A;  3SUP A;  1NK7 A;  1TKD A;  2FBY A;  4OKJ A;  1U45 A;  4KRE A;  3TAP A;  1HQE A;  3KK1 A;  1QQC A;  3SJJ A;  1GOB A;  4QOZ B;  1UA0 A;  4DQP A;  3S3M A;  2VG5 A;  3VA3 A;  2HHQ A;  3G0Z A;  3OYB A;  4Q0B A;  4NYN A;  3O4N A;  2G8W A;  5HP1 A;  3MED A;  4LSN A;  4CEO A;  1SKW A;  2G8I A;  4CIF A;  3VQC A;  1HYV A;  1FK9 A;  1BI4 A;  2GV9 A;  1YVU A;  4NCA A;  2IC3 A;  4CJL A;  4YNQ A;  3IS9 A;  4AHT A;  4CJR A;  3NCI A;  3SQ2 A;  4J2B A;  4RW7 A;  4DFP A;  3OVN A;  1L3U A;  4CGF A;  4M42 A;  4OGE A;  1RBT A;  3VQ6 A;  5FRO A;  3TAN A;  3AVG A;  3KLH A;  1J9A A;  1Z26 A;  3QNN A;  4EP5 A;  2OPQ A;  1RT3 A;  4LH5 A;  3KK3 A;  2HNY A;  4E1N A;  1LWE A;  4I9L A;  1WSG A;  3DLE A;  1ITG A;  1T7P A;  3VQ4 A;  3NDK A;  1NOZ A;  3S3N A;  4F8R A;  1IKW A;  1CZ9 A;  5CZ2 A;  1L3S A;  3FFI A;  3TAR A;  4FK0 A;  1TK0 A;  1BQN A;  4IFV A;  1JLC A;  2VG7 A;  1WSE A;  4QCL A;  4JRP A;  4B08 A;  3L2V A;  3LAN A;  4HVJ A;  4DQR A;  3ZSO A;  3SQ1 A;  4CHQ A;  4Z4I A;  3QIO A;  3AA5 X;  4OPJ A;  4AHS A;  2IAJ A;  4O0I A;  3OYI A;  3V9U A;  3OJS A;  4Z4G A;  4JS5 A;  1QS4 A;  1C1C A;  4KPY A;  4FZY A;  3K5N A;  3NH0 A;  2VG6 A;  4FM1 A;  2Z1J A;  1D5A A;  2XY5 A;  2QXF A;  1BCO A;  3TR8 A;  4FLW A;  4FLT A;  1NJX A;  2PZS A;  4FJ5 A;  4OJR A;  4C8L A;  2YHB A;  3ZT1 A;  3V6D A;  1TVR A;  4CEZ A;  3M8Q A;  3V1R A;  1WSF A;  1WN7 A;  3V1O A;  3MAQ A;  2XY7 A;  4DU3 A;  1KVB A;  3SQ4 A;  4C8N A;  1NK6 A;  2RKI A;  4E7L A;  5HRO A;  5CYQ A;  2RN2 A;  4FJ8 A;  1JL2 A;  4ICL A;  3WNG A;  4AH9 A;  4CHN A;  2XRI A;  3V9X A;  4DMN A;  1NK4 A;  1HNI A;  3JSM A;  3G10 A;  2NUB A;  1Z25 A;  1JLE A;  3ZSY A;  2HHS A;  2B6A A;  4MQ3 A;  1TKZ A;  4BE0 A;  3M8S A;  2YNF A;  4DLE A;  1KFS A;  3V4I A;  4FLX A;  1JXE A;  1C0T A;  4N76 A;  2FBV A;  4ID1 A;  3DRR A;  4CEA A;  4RW4 A;  2KFN A;  3OYA A;  3RRG A;  4DTJ A;  4KKO A;  3MEE A;  4KO0 A;  4DTN A;  1VSE A;  4WE1 A;  4I7F A;  2RPI A;  3OS2 A;  4DFM A;  3PV8 A;  4O5B A;  2HHU A;  3CQ8 A;  4NCB A;  1QTM A;  3VQD A;  4FJM A;  3QLH A;  4KHS A;  1RT7 A;  3O3F A;  3KLE A;  5I3U A;  1A5X A;  3NH1 A;  3AA3 A;  3ZT4 A;  3LWM A;  2OYQ A;  4FJN A;  5E41 A;  1BGX T;  3SUN A;  1DLO A;  2FBT A;  3EZ5 A;  1KSP A;  4CF1 A;  3LDS A;  3BGR A;  4DTS A;  1VRT A;  1B9F A;  3DM2 A;  4CF0 A;  2F8S A;  3I8D A;  2IOC A;  3SZ2 A;  3LP0 A;  2GUI A;  3L2Q A;  3SV3 A;  3AVN A;  5FRM A;  1GOC A;  2X6S A;  1IKY A;  3K59 A;  4CED A;  3HPG A;  2HND A;  1N5Y A;  4RW9 A;  1S6Q A;  3CFP A;  5KGX A;  4DQQ A;  2W42 A;  2HVI A;  3VQE A;  1UOC A;  5EU7 A;  4CHY A;  3NBP A;  3TAF A;  3AVL A;  2G8K A;  3NAE A;  3NF7 A;  4CJV A;  4E1M A;  3QET A;  3AVM A;  3RTV A;  3DLR A;  4M3X A;  2P5G A;  3NGI A;  1S9G A;  3O4Q A;  2IGI A;  2DFH A;  3K57 A;  4N5S A;  4F4K A;  4C8M A;  3ZSR A;  1RCH A;  5DMR A;  3JYT A;  4DS5 A;  4FLU A;  1G15 A;  5HRN A;  1SKS A;  3ALY A;  3ZSW A;  1IH7 A;  1U4B A;  1QSS A;  3EY1 A;  2O4I A;  4BDZ A;  5SWM A;  1RBU A;  1U04 A;  1EET A;  1HRH A;  1MU2 A;  3H08 A;  2Z1I A;  3SPZ A;  3E01 A;  1KCF A;  4FW1 A;  4KAZ A;  5CY4 A;  3VQ9 A;  1W9H A;  3V9W A;  4KHU A;  4HUE A;  2HB5 A;  4BDY A;  3KLG A;  1KVA A;  4C8O A;  1ZBL A;  4KRF A;  4CJ5 A;  1KFD A;  2BE2 A;  4DSK A;  1DTQ A;  2A1S A;  1SUQ A;  3QIN A;  4OKK A;  4CEF A;  4CJS A;  4M3U A;  1JXB A;  2Y1I A;  3KIO A;  3SUO A;  4M45 A;  3DLH A;  1BQM A;  3T1A A;  3AVC A;  4CJK A;  4I2Q A;  4MFB A;  4FLZ A;  4E7I A;  3U6F A;  2YNG A;  2XHB A;  4ZTJ A;  1L5U A;  4HHT A;  1RDB A;  4LSL A;  3D45 A;  3SNN A;  4KHY A;  3DOL A;  4JLH A;  3VQ8 A;  3WNE A;  4FLV A;  4KHN A;  4IKF A;  2R7Y A;  1C1A A;  4Z4H A;  1RTH A;  1KRP A;  4RW6 A;  4LD0 A;  3U3G A;  4F2R A;  1S1U A;  4CF2 A;  3CYM A;  4JRQ A;  1ZBH A;  2HNZ A;  1VRU A;  4DFJ A;  1JL1 A; 
#chains in the Genus database with same CATH topology
 4AM7 A;  4M41 A;  3HP9 A;  3OS1 A;  2KZZ A;  3A5O C;  2CGK A;  2EWS A;  4IG3 A;  1YTU A;  2XO7 A;  5J1E A;  3O9S A;  4QAG A;  2JWK A;  1C0G A;  2ZF5 O;  5BR9 A;  3T1H K;  3CI5 A;  3RSE A;  5IT9 O;  1LAV A;  1SV5 A;  3CJ7 A;  4B9T A;  3QDK A;  4BRL A;  3O9R A;  1OH6 A;  4B3S K;  1ESV A;  1RIL A;  2JGU A;  3QEP A;  4MDA A;  3OYD A;  3P38 A;  1L3T A;  3AO4 A;  5C25 A;  4EIA A;  3AV9 A;  1M90 O;  1RBR A;  3OW2 M;  4GKK K;  4DHY A;  3R9P A;  3CPW M;  4M3Y A;  3KKR A;  3KLI A;  5JS2 A;  4KI6 A;  3P4I A;  4C8K A;  4ILH A;  3C6U A;  1J5E K;  3AVA A;  2E2Q A;  1VSL A;  1U2V B;  4K25 A;  4JKD A;  3A2F A;  3UE5 A;  4JI4 K;  5AQQ A;  4B9V A;  4H5R A;  4HUG A;  2A6A A;  4PL8 A;  4GY2 B;  3IAY A;  2VYP A;  3SMS A;  5FPD A;  1QQM A;  4CJP A;  4C1N K;  3VOV A;  4F2S A;  4KB1 A;  4OX9 K;  3SI6 A;  1XHZ A;  3C6A A;  2O8E B;  3WNH A;  4CW7 B;  3O9T A;  4C1N I;  1HJR A;  2PBD A;  3E9O A;  3FZK A;  4BRG A;  1RDC A;  4ELV A;  1TYQ A;  2FSN A;  3MCA B;  2Q0R A;  3AO3 A;  4W5T A;  1FKP A;  4PKI A;  2I5J A;  3AAR A;  3DYA A;  3T1Y K;  4JKA A;  5LL6 Z;  3QEW A;  1TKT A;  4OGC A;  1F21 A;  3AVK A;  3THV A;  2G8H A;  4FJX A;  1JLA A;  3ULD A;  3QBW A;  4U67 L;  1BI4 B;  1VSH A;  1XHX A;  3VF2 A;  3ZYY X;  4O44 A;  1ZBI A;  5B8H A;  5CHI A;  2QW9 A;  1YAG A;  4B1V A;  3V9S A;  3NMU A;  1LWF A;  3PY8 A;  3CPE A;  3VEO A;  1WSI A;  3C6H A;  3NF8 A;  1IJJ A;  3UKR B;  3A5L C;  1DGK N;  4PL7 A;  1EO1 A;  1YIT N;  1VQ4 N;  3DWL A;  1SS6 A;  5AQV A;  1ILY A;  5AZJ B;  4BC2 A;  4B9N A;  1QHT A;  4B8A B;  1UWB A;  4X64 K;  3NH2 A;  3KTQ A;  1QQO A;  4KI4 A;  2X78 A;  4FO0 A;  3VGK A;  3G25 A;  4FZZ A;  3HPH A;  2BDP A;  1VQM N;  4CF9 A;  4X62 K;  4YOV A;  1NKE A;  4EHU A;  3WXI A;  4CE9 A;  4JN4 A;  2AP1 A;  2QWL A;  4LF6 K;  4E0D A;  2VGM A;  3HT3 A;  2ITG A;  3FLC O;  4BWM A;  1XUP O;  1LOT B;  3P1G A;  3ZT3 A;  1BIS A;  2PAV A;  2RF2 A;  1RT5 A;  3CCR N;  3KD5 E;  2P9S A;  1U6Z A;  4H0P A;  4FJL A;  2QKK A;  4OLA A;  2ITM A;  2E88 A;  1C0F A;  3TTF A;  4LFA K;  1S9E A;  4XIU A;  1GLB G;  3AY9 A;  1N32 K;  4AF1 A;  3R1X A;  4CGH A;  1KLM A;  5J2M A;  1TV6 A;  2YHY A;  1TAQ A;  3Q7B A;  4J2E A;  4IZ9 A;  5AR0 A;  3PX4 A;  4IJA A;  3LDL A;  2UU9 K;  4CHO A;  5SZT A;  5KPT A;  1ASV A;  3MWP A;  3CME N;  4OKE A;  1ZYQ A;  2OPP A;  2W6K A;  2NRV A;  3HL8 A;  1T03 A;  4LC9 B;  2D1K A;  3IG1 A;  1W0H A;  1HX1 A;  4E89 A;  3CJ1 A;  5I42 A;  3F73 A;  4F3O A;  4BRP A;  1FKO A;  1G99 A;  1RBS A;  3IFR A;  1VQ5 N;  2XY8 A;  1NKC A;  1SZ2 A;  2F8T A;  4PA1 A;  4FJK A;  4OVL A;  3I33 A;  1RTJ A;  2VQE K;  4NYF A;  2VQF K;  2ASO A;  1YTA A;  4DTO A;  4B3R K;  4AHU A;  3ULE A;  5DM7 L;  1RT1 A;  5HRP A;  5IWA K;  5I9E B;  1BIZ A;  3WXL A;  5BR8 K;  4H4M A;  3BEX A;  1QHA A;  1KXP A;  2NRH A;  3FE1 A;  5AQM A;  3AVH A;  2FSJ A;  4BRK A;  4DSE A;  2F96 A;  3CCQ N;  3K5O A;  4LF4 K;  3RMC A;  4XH4 A;  5ADX H;  4AHR A;  3ZEU B;  2EX3 A;  1VQ8 N;  4YFU A;  3CXC M;  3HYF A;  4KHQ A;  1REV A;  3Q7C A;  3HO1 A;  1JLQ A;  1X9J A;  1KLN A;  3TWH A;  4CJE A;  4PHT X;  1QZ6 A;  5AFU H;  4CD3 A;  3VA0 A;  4DB3 A;  4JI3 K;  4CBW A;  2D0A A;  2FSK A;  2B5J A;  1NK8 A;  3UIQ A;  3D2E A;  5BRF A;  3VER A;  4IFY A;  2F7T A;  3BY5 A;  1YXQ A;  4DFK A;  3SUP A;  3DMJ A;  3AO2 A;  3CQX A;  4OKJ A;  4WF9 L;  3GDQ A;  3TAP A;  1HQE A;  1QQC A;  3SJJ A;  4JKG B;  1XMQ K;  1YI2 N;  3QFP A;  5HP1 A;  4NO7 A;  1N36 K;  2A40 A;  3DXK B;  5GAD P;  4KH5 A;  1T3V A;  4NCA A;  3ID6 A;  5TKW A;  3CCV N;  4J2B A;  4AQY K;  4OGE A;  3CET A;  5FRO A;  3TSQ A;  1J9A A;  1Z26 A;  3J7A P;  4EP5 A;  3KK3 A;  2YCH A;  3AAQ A;  1LWE A;  3VQ4 A;  3NDK A;  3THY B;  3H1Q A;  1JLC A;  2VG7 A;  1WSE A;  3L2V A;  4FWN A;  3SQ1 A;  1ATN A;  4Z4I A;  4FWP A;  4OPJ A;  4A2A A;  5F1X A;  3V9U A;  4Z4G A;  4KPY A;  4FZY A;  1D5A A;  1NJX A;  3LM2 A;  3HI0 A;  4DV1 K;  3V1R A;  2HMP A;  3HSC A;  3V1O A;  5AQS A;  2I7N A;  3SQ4 A;  1E4F T;  2RKI A;  4E7L A;  5CYQ A;  2RN2 A;  1NGA A;  4DR5 K;  4BG9 A;  1HNI A;  1VQL N;  3ZSY A;  2UUB K;  4JKF A;  3VEN A;  3G71 N;  4BE0 A;  3J80 O;  1KFS A;  2NZT A;  3V4I A;  4N76 A;  4JK9 A;  4RW4 A;  3T7Z A;  3RRG A;  2O8D A;  1NMN A;  4DTJ A;  1T6C A;  4KBO A;  4G9Z A;  4WE1 A;  4I7F A;  2RPI A;  3OS2 A;  3CQ8 A;  2NRZ A;  2P9P A;  2WBN A;  3LWM A;  2OYQ A;  5E41 A;  3SUN A;  5AQY A;  4CF1 A;  3ENH A;  1B9F A;  4CF0 A;  2F8S A;  4DKW A;  3SV3 A;  3D7E O;  1GOC A;  2X6S A;  3C65 A;  3LDN A;  3K59 A;  3HPG A;  2HND A;  5KQ8 A;  5KGX A;  4DQQ A;  2W42 A;  4MO4 A;  2HVI A;  3AGR A;  5AQU A;  3TAF A;  4AM6 A;  3AVL A;  2G8K A;  3OA9 A;  3NAE A;  3NF7 A;  4M3X A;  5BRH A;  2IGI A;  4BQL A;  4N5S A;  5DMR A;  3PSI A;  3JYT A;  4FLU A;  1G15 A;  2P9I B;  3ALY A;  3ZSW A;  4BDZ A;  2P9K B;  4JD2 A;  3H6E A;  1VHX A;  2Z1I A;  3G4S N;  4BG8 A;  4KAZ A;  3V9W A;  4KRF A;  1KFD A;  4OKK A;  4M45 A;  4E7I A;  4FLZ A;  2YNG A;  1BDG A;  4ZTJ A;  1L5U A;  1XQS C;  1JCG A;  4JLH A;  3WNE A;  1C1A A;  1RTH A;  5LJV A;  4RW6 A;  1KRP A;  4NXM K;  1ZC6 A;  1S1U A;  4F2R A;  3A0I X;  1EWQ A;  1ZBH A;  1ASW A;  4FWM A;  4JKC A;  1L3V A;  3L2R A;  4BAC A;  1IKV A;  1S6P A;  3ASM A;  3VQ5 A;  3JS6 A;  1VSJ A;  3AVJ A;  3LL3 A;  3L0Q A;  4FXD A;  4GMJ B;  4F3T A;  4B9S A;  1IO2 A;  3K58 A;  1Q9X A;  4LF7 K;  1QVG M;  1JLB A;  2HF3 A;  2Q3S A;  4BC4 A;  5KRT A;  1JCF A;  5FRN A;  4H5T A;  1HKC A;  3U4L A;  1TUU A;  1GLC G;  1LAW A;  3FFK B;  5FDL A;  1N6Q A;  2QK9 A;  1U48 A;  5M1K A;  3DXM A;  4KV8 A;  1NK9 A;  2O8F A;  3MXM A;  4MLH A;  1D9D A;  4DTP A;  3V81 A;  3HST B;  3NF6 A;  3D2F B;  5C42 A;  2HHT A;  1HPZ A;  2D0B A;  5AQF A;  4YOY A;  1RTD A;  2F9T A;  3DOK A;  4OPK A;  2DY4 A;  3ZX3 A;  2AJQ A;  3DLG A;  3NHG A;  3DLB A;  4AHC A;  4CJQ A;  1WB9 A;  2O8C B;  2OA8 A;  1YJ9 N;  3J81 O;  4DR1 K;  2CGJ A;  4UQG A;  5T7B A;  3U3Y A;  4QS9 A;  5BN9 A;  3P31 A;  3VPZ A;  1TL3 A;  4DU4 A;  1NGJ A;  3O4W A;  3NE6 A;  2P9L A;  4XEI A;  3VQB A;  2YHW A;  3BZC A;  3CC7 N;  4FJH A;  1Z05 A;  1C1B A;  1RDD A;  3FR0 A;  4KH6 A;  3VEZ A;  2D0P A;  3O9U A;  3TAM A;  4BGA A;  1D4X A;  4GKJ K;  1VQK N;  4KTZ A;  1JKH A;  1QE1 A;  3OBW A;  4CZF A;  4B9M A;  1EQY A;  4IFE A;  5AQK A;  3SV4 A;  2HHV A;  3HM9 A;  1LW0 A;  3IRX A;  4CBX A;  1HNZ K;  3LZJ A;  5FPM A;  3QEX A;  3PO5 A;  4DV0 K;  2IIR A;  4Z4C A;  3L3V A;  3ID8 A;  4DTM A;  2BAN A;  4E7K A;  2IDO A;  1T8E A;  3MXI A;  1QZ5 A;  3QO9 A;  3O8M A;  3T69 A;  4G1Q A;  3FZF A;  4CGI A;  3ZSZ A;  4BRH A;  2NLX A;  2QWR A;  4B9L A;  2WFB A;  2PYJ A;  4CK3 A;  3G6E N;  5AQZ A;  5C0Y A;  4CJT A;  1VQP N;  3OHR A;  1VSF A;  5AQH A;  1EWR A;  2ZWH A;  3AVF A;  1LV5 A;  3LZI A;  1WLJ A;  3L2U A;  3V1Q A;  3CFR A;  1IG9 A;  3M6G A;  3L8B A;  4BR4 A;  3C6T A;  4M3Z A;  3S41 A;  3ZT2 A;  4FJ9 A;  3HPO A;  3UKU A;  1HQU A;  1WNS A;  3ISN C;  4JK7 A;  4RW8 A;  3CER A;  3PX0 A;  1S72 N;  2HBM A;  3MK6 A;  3RR7 A;  3OYL A;  4PY5 A;  5AQO A;  4DQ8 A;  3HJF A;  2XY6 A;  5DK5 A;  1V4T A;  3SAG A;  3L2W A;  4I2P A;  2X6N A;  4FL9 A;  1VK0 A;  1EXQ A;  2O4G A;  4H4O A;  5K14 A;  3OJU A;  3WT0 A;  4Y1C A;  5FLX O;  4I6M B;  2HBL A;  4DTX A;  1YF5 L;  1SKR A;  2YV0 X;  1ZBF A;  2DFF A;  4CHP A;  1MWK A;  4O0J A;  1HYS A;  2P51 A;  4B1W B;  4FZX C;  3MWT A;  3MMV A;  4W5R A;  2YI1 A;  3SAH A;  3RVC A;  2QWP A;  4W5O A;  2OZM A;  3VGM A;  1YT3 A;  3LWL A;  1OKJ A;  4MDB A;  4GNI A;  4OLB A;  4BY9 C;  1BHL A;  3RMB A;  1JLG A;  3TAE A;  5GIO A;  4I9Q A;  1XNR K;  1X9W A;  3OYF A;  4CZJ A;  4WFN L;  4W5N A;  1DEJ A;  4B3O A;  2KHO A;  2V7Z A;  4LFC K;  2QM1 A;  3DRP A;  4CEB A;  3R8E A;  2HHX A;  1P90 A;  3AA4 A;  2ZJQ L;  1VSD A;  1DTT A;  4DU1 A;  3EL2 A;  4BR5 A;  2FC0 A;  4H8K A;  2ZE2 A;  1J5O A;  1J54 A;  2OPS A;  4LH4 A;  1U2V A;  1B9D A;  1O1W A;  2OZS A;  4FVM A;  3OYE A;  5GAH P;  2G8V A;  5J2N A;  5EX5 A;  4LF5 K;  2E6M A;  1ASU A;  2FBX A;  3CCM N;  1HJO A;  4N47 A;  4MO5 A;  1M1K O;  3PX6 A;  2IS3 A;  4JS4 A;  3CC4 N;  3NGZ A;  1KQS M;  1HUX A;  2O8B B;  4CGD A;  4FWK A;  3RMD A;  3M5R A;  2VWJ A;  5C24 A;  2NRW A;  4Q5V A;  1TGO A;  2O8E A;  1I39 A;  4BR2 A;  2YNH A;  1SL2 A;  2HF4 A;  4DSL A;  4BWJ A;  3THX B;  1RFQ A;  2BGG A;  1Q8I A;  5F2R A;  5LMN K;  4FSV A;  2CH6 A;  3MN9 A;  1S5J A;  4CIG A;  1RDW X;  3OYJ A;  5JLF A;  4H0T B;  1U45 A;  4KRE A;  4E1J A;  4QOZ B;  1UA0 A;  3E9P A;  4DR3 K;  4DQP A;  3S3M A;  2VG5 A;  2HHQ A;  3G0Z A;  4K43 A;  2G8W A;  2CGL A;  4CIF A;  2E5L K;  1ZXO A;  1BI4 A;  1YVU A;  3ZX0 A;  1VQ9 N;  1NU0 A;  2KLA A;  4UY8 O;  3IS9 A;  5AZI B;  4RW7 A;  4DFP A;  2IVN A;  4CGF A;  4IJN A;  3U8X A;  3K0S A;  3ZET B;  2ZJR L;  2A42 A;  3QNN A;  2OPQ A;  3H3O B;  3UKR A;  4I9L A;  2V52 B;  4DV7 K;  4BQZ A;  1NOZ A;  4F8R A;  4BR0 A;  1CZ9 A;  5CZ2 A;  1L3S A;  3TAR A;  4BRQ A;  5AZJ A;  1WBD A;  4IFV A;  4B1X B;  4DQR A;  4JV5 K;  2AA4 A;  3IUC A;  4IWV A;  1BG3 A;  4DUZ K;  2DPN A;  3QIO A;  3AA5 X;  4O0I A;  1FJG K;  4LFB K;  3NH0 A;  2VG6 A;  4FM1 A;  3MDQ A;  4A5B A;  2PZS A;  4FLT A;  4A57 A;  4FLW A;  3F9M A;  3ZT1 A;  1TVR A;  5TKY A;  4CEZ A;  3CCJ N;  3U9Z A;  3MAQ A;  2Q97 A;  4YOW A;  4O8U A;  1BUP A;  4C8N A;  3HOT A;  4H0O A;  2ZM6 K;  1NK6 A;  4FJ8 A;  1T6D A;  3V9X A;  3O1B A;  3G10 A;  1NGG A;  4CZI A;  2HHS A;  1RGI A;  5MLC Q;  3M8S A;  2YNF A;  4DLE A;  1JXE A;  2FBV A;  4ID1 A;  3DRR A;  3NVM A;  3CC2 N;  2FLO A;  3MEE A;  1VSE A;  4FWS A;  4NCB A;  3TSP A;  4FJM A;  3I8B A;  1RT7 A;  4BR9 A;  1A5X A;  3I55 N;  3NH1 A;  4FJN A;  2UXC K;  2FBT A;  5JMV A;  3EZ5 A;  5AQN A;  3LDS A;  3TTC A;  3VEX A;  3LP0 A;  3L2Q A;  3GE1 A;  3AVN A;  5ELZ A;  1IKY A;  5M1F A;  4FVU A;  5JVG L;  4WYB A;  1UOC A;  4CHY A;  3NBP A;  4XH5 A;  3RTV A;  2HST A;  3NVK A;  3NGI A;  1S9G A;  4WCE L;  2Q0U A;  3K57 A;  4F4K A;  4C8M A;  4BRD A;  2VCP A;  1U4B A;  3EY1 A;  1GLD G;  1EET A;  1U04 A;  1MU2 A;  3H08 A;  3SPZ A;  4R79 A;  1KCF A;  5BPM A;  3VQ9 A;  1W9H A;  4KHU A;  2QI2 A;  2HB5 A;  2OCE A;  3KLG A;  1KVA A;  4B3T K;  4C8O A;  3TSU A;  4CJ5 A;  2BE2 A;  4A62 A;  1DTQ A;  2A1S A;  1SUQ A;  3QIN A;  4CEF A;  4CJS A;  5AQL A;  3ZX2 A;  1NJI O;  1JXB A;  2Y1I A;  3KIO A;  3SUO A;  1KC8 O;  1KAX A;  3AVC A;  4Y0W A;  3JAM O;  4YDU C;  1RDB A;  3D45 A;  3CCS N;  4DV5 K;  4M63 C;  4KHN A;  4IKF A;  2R7Y A;  3QML A;  4GV6 A;  3CYM A;  2HNZ A;  3WUH A;  2OPR A;  3CHW A;  3HM8 A;  3LDQ A;  1ATR A;  1KD1 O;  3VQ7 A;  3ZEU A;  4BR7 A;  3J7Z O;  2NRX A;  5BPN A;  3HP6 A;  3K5L A;  3QEV A;  3VET A;  4CBU A;  3WXM B;  3DLK A;  4N41 A;  3NGY A;  1WAJ A;  3RWU A;  5DM6 L;  3VEW A;  4BGB A;  5BRD A;  4K8Z A;  2WOM A;  3B6P A;  4ILJ A;  1WAF A;  1QVF M;  3RMA A;  3IDH A;  1N33 K;  4DG1 A;  3K9J A;  1K9M O;  2E1Z A;  1W2B M;  2HVH A;  2P1J A;  4JNE A;  1WSH A;  3P83 D;  3MN7 A;  4JKG A;  4JKH A;  1D9F A;  3MXJ A;  4J2D A;  3QBX A;  3T3F A;  5GAG P;  1RT4 A;  3C95 A;  3D6R A;  3DXK A;  1C6V A;  3ITH A;  4FWO A;  1S1T A;  4OO1 J;  3F9K A;  4IEE A;  1RNH A;  4NCG A;  4HCB A;  1NJW A;  3CM6 A;  4K42 A;  4DV3 K;  4KHW A;  2D5R A;  3LPU A;  1XC9 A;  3SBT A;  3VQA A;  5KPR A;  1IBL K;  4CFD A;  5HRR A;  3QNO A;  4K8X A;  2QKB A;  3R6M A;  4O4G A;  3A5M C;  3QB0 A;  4XH1 A;  5J2Q A;  3S3O A;  3ZLJ A;  3VGL A;  1NGD A;  3HTV A;  3D0P A;  1YJW N;  1IKX A;  3THY A;  1K8K B;  3SK3 A;  4KTQ A;  4LF8 K;  4FM2 A;  2EHG A;  3AO5 A;  4DTU A;  1EKE A;  3L4Q A;  3FZH A;  4CZL A;  1YIJ N;  4NLB A;  2QWM A;  4YHH K;  4GVM A;  3S9H A;  1C0U A;  1NGB A;  3WNF A;  3N4Q A;  1YJN N;  3C7N B;  1B92 A;  4KB0 A;  4PWD A;  4V19 S;  4CD1 A;  3O3H A;  4DUY K;  1Z6R A;  5LJW A;  3CQY A;  3ATU A;  1CLQ A;  3EYZ A;  3TAQ A;  2HW3 A;  1RT2 A;  3ZT0 A;  5KRS A;  3IMX A;  3EKU A;  5AQI A;  3TAB A;  4IO8 A;  1NMD A;  4B9Q A;  4H5N A;  4M7X A;  4CFC A;  5HBM A;  1NOY A;  2Z1H A;  4CHZ A;  1BL3 A;  5JLH A;  2ZD1 A;  3EN9 A;  2ATQ A;  3KD1 E;  3I56 N;  4X65 K;  4B1Z A;  3WQU A;  2YHA A;  1IV0 A;  1EX4 A;  4NLC A;  2KTQ A;  3HOS A;  1YVN A;  4DQI A;  1RDA A;  5FPE A;  4C23 A;  1NJZ A;  2Q31 A;  3AGK A;  1CXU A;  2P5O A;  1GLF O;  3TU5 A;  3RR8 A;  3DAW A;  2F9W A;  2GX9 A;  3OYN A;  1UAX A;  3MEG A;  4M3R A;  4FW2 A;  4IDK A;  4ZTF A;  4YDU A;  1S22 A;  4FLY A;  1VSI A;  1EP4 A;  1TKX A;  2VWB A;  5C15 A;  3LP1 A;  4ISF A;  1BU6 O;  4CGG A;  4CGJ A;  2UUA K;  1BO5 O;  4DV2 K;  3IKM A;  3KHY A;  4CFB A;  3PIO L;  2NNW A;  3AA2 A;  4RWT A;  2P9I A;  4H0X B;  1VQ7 N;  2QWN A;  2P9K A;  4ID5 A;  3ATV A;  4DSI A;  1HPM A;  3KLF A;  4Z4F A;  4IDH A;  4ELU A;  3MEC A;  1TUY A;  5F0X A;  2QTD A;  3M8R A;  1NLV A;  3CF5 L;  3WEE B;  3KKS A;  3UB5 A;  4DCH A;  3O1W A;  4OPA A;  4FK4 A;  4ISG A;  5H1S Q;  4ELT A;  4FM0 A;  1W97 L;  4OPH A;  4HCC A;  2E2N A;  5KI6 A;  1D8Y A;  4CZK A;  2E6L A;  4Y1D A;  4E7H A;  4JI1 K;  3LAL A;  5GIN A;  2I7P A;  1HNV A;  5AQT A;  1I3A A;  4R5P A;  4KHP K;  1J53 A;  3KJV A;  3CM5 A;  5JVH L;  4CEE A;  3FZL A;  2Z1G A;  4DR2 K;  2Y1J A;  4JYA K;  1OH8 A;  2QWO A;  3SLC A;  2E4L A;  3QFU A;  4E7J A;  3LP3 A;  3OYG A;  5KQD A;  3OY9 A;  4A59 A;  4IBN A;  2YKM A;  2KZM A;  4AHV A;  3F5T A;  4FWQ A;  1X1P A;  2P9N B;  1CZB A;  1FXX A;  4IXC A;  1E3M A;  4E19 A;  3CMA N;  4ILG B;  4JI6 K;  2W41 A;  1U49 A;  4Z4E A;  4YOU A;  1ZBU A;  2YJE A;  2YJF A;  1IG8 A;  4M7Y A;  2WTU A;  4CCH A;  4FPB A;  2UYT A;  4LF9 K;  1HYZ A;  3P5J A;  3ZSQ A;  3D2F A;  1BWF O;  3I0R A;  5M1O A;  1SL0 A;  3I0S A;  3WXK A;  1NM1 A;  4E3S A;  4K41 A;  4JKB A;  2PYL A;  3O5B A;  3ZCM A;  1RBV A;  2O8C A;  4FJG A;  3J7Y P;  4CJU A;  1JLF A;  2ZGZ A;  1XI1 A;  1FW6 A;  4AIL C;  3O3G A;  1VAZ A;  2P9N A;  4N56 A;  3V9Z A;  2KFZ A;  1HNW K;  3VTI A;  1IBM K;  4JI7 K;  4CK2 A;  1WOQ A;  5JIC A;  3TI0 A;  1OVY A;  1LWC A;  3VQQ A;  1R59 O;  4IOC L;  3DI6 A;  3M3Z A;  3RSE B;  1KTQ A;  2GWJ A;  4PQU A;  3BUZ B;  2HHW A;  3CCL N;  4FK2 A;  5CYM A;  3C94 A;  4JI2 K;  3J8A A;  3LP2 A;  4JI0 K;  2IVO A;  1TKD A;  5C2F A;  2IVP A;  2FBY A;  3A5N C;  3KK1 A;  4O8K A;  4CZM A;  1NGH A;  3O4N A;  4LSN A;  3R3L A;  2G8I A;  2V51 B;  3VQC A;  1HYV A;  1FK9 A;  2IC3 A;  4CJL A;  2RHK A;  4AHT A;  4CJR A;  3VF4 A;  3SQ2 A;  5GAE P;  3OVN A;  1L3U A;  1RBT A;  4YY3 K;  3CIP A;  3VQ6 A;  3AVG A;  4LH5 A;  3BF1 A;  4WQ5 A;  1WSG A;  4JHD B;  3S3N A;  1IKW A;  3FFI A;  4QCL A;  3LAN A;  4HVJ A;  3ZSO A;  5HOO A;  2UUC K;  2IAJ A;  4JS5 A;  3K5N A;  1J6Z A;  2XY5 A;  2QXF A;  2WC9 A;  5FPN A;  3LDO A;  3TR8 A;  1Q86 O;  4FJ5 A;  4C8L A;  5A2Q O;  3M8Q A;  1TYQ B;  4DU3 A;  1KVB A;  1GLJ O;  4CZH A;  3C0B A;  1SAZ A;  5HRO A;  1JL2 A;  4ICL A;  3WNG A;  4CHN A;  1NK4 A;  2XRI A;  3KWI A;  4DV6 K;  2B6A A;  4MQ3 A;  4CZE A;  2A41 A;  2WUS A;  1CZA N;  4FLX A;  4EAH D;  2Q2R A;  4JHD A;  4CEA A;  2KFN A;  1GLE G;  3E1Y A;  3BZK A;  1LCU A;  4DTN A;  3EO3 A;  2HHH K;  4O5B A;  3O6W A;  4BC5 A;  3GBT A;  1QTM A;  3VQD A;  1VQ6 N;  3AAP A;  3QLH A;  4I6M A;  5E26 A;  3CJ9 A;  3O3F A;  3AA3 A;  3ZT4 A;  1BGX T;  4DR4 K;  1HNX K;  1KSP A;  3BGR A;  3DLL L;  5AJ3 K;  1VRT A;  3DM2 A;  4ISE A;  3I8D A;  2IOC A;  3SZ2 A;  5FRM A;  2GUI A;  5M1N A;  2E2P A;  4RW9 A;  3CFP A;  1K8A O;  3M1F A;  3VQE A;  5EU7 A;  4BRO A;  3KZB A;  4DV4 K;  2P5G A;  2UXB K;  1HLU A;  1WUA A;  4X66 K;  3O4Q A;  2DFH A;  3VEY A;  4A61 A;  1RCH A;  4BRF A;  1MDU B;  5HRN A;  2O4I A;  1QSS A;  3EE9 A;  5SWM A;  1RBU A;  2FXU A;  1NGC A;  1MWM A;  4FW1 A;  5CE3 A;  4H5W A;  4HUE A;  4IO9 L;  3VEV A;  4BDY A;  4M3U A;  2P9S B;  3DLH A;  4CJK A;  3T1A A;  2OTL N;  4I2Q A;  3U6F A;  3ENO A;  4BRE A;  1HR0 K;  4KHY A;  1XC3 A;  4FLV A;  4Z4H A;  3BP8 A;  4LD0 A;  2QA4 N;  1QQN A;  3U3G A;  3MX2 A;  4CF2 A;  5BPL A;  4O5F A;  1DKG D;  1VRU A;  4DLG A;  2A3Z A;  2O8B A;  3DRS A;  3QER A;  2HMI A;  2VWK A;  3H3N O;  1RTI A;  2GEL A;  5AQP A;  1Q9Y A;  3SCX A;  3K9K A;  3EE8 A;  4W5Q A;  2JLE A;  3HBT A;  3DJC A;  4PKH A;  3PO4 A;  5HRS A;  3THX A;  1S1V A;  3E9L A;  5EVZ A;  4BE2 A;  4A5A A;  4DTR A;  1OVQ A;  3CCE N;  2G8F A;  1Q18 A;  4YOR A;  1U47 A;  3L6Q A;  3VN5 A;  1LW2 A;  1JCE A;  2H3G X;  4CEQ A;  4HTL A;  4BRM A;  3FGU A;  3THW B;  1NNE A;  4J2A A;  4DF4 A;  5M1P A;  5KTQ A;  3OTO K;  4M3W A;  4YOX A;  3MN6 A;  4IOA L;  1ATS A;  1RT6 A;  1GLL O;  3EEQ A;  4JI5 K;  3SPY A;  4KTW A;  3WQT A;  3ULE B;  1NGI A;  5AZI A;  1VSK A;  3CFO A;  4B8C A;  2A1R A;  2ZGY A;  3ZET A;  4H03 B;  1X9M A;  4H5V A;  3AVI A;  2KW4 A;  2D0C A;  4CJ4 A;  1T44 A;  4JAX A;  3SBG A;  2GWK A;  4GV3 A;  4PUO A;  4BRC A;  3W0L A;  4GV9 A;  5AQX A;  2JWL A;  5LY3 A;  5C2D A;  1BIU A;  5KPZ A;  3AVB A;  1QSL A;  4FPA A;  4RG8 A;  1S1X A;  1N8R O;  2GBZ A;  3F2K A;  3ZSX A;  4FOE A;  1A5V A;  3THW A;  5AQJ A;  2ASM A;  3D2E B;  2X74 A;  2ETJ A;  4CK1 A;  4HUF A;  4NB4 A;  4DS4 A;  4JK8 A;  1K6Y A;  1MA9 B;  4FCY A;  5AQW A;  4CFA A;  4DQS A;  1R0A A;  1BOT O;  2UXD K;  1KVC A;  3ZSV A;  3SYZ A;  4CJF A;  1CXQ A;  2D0O A;  3FZM A;  5C12 A;  3MX5 A;  3AO1 A;  4YOT A;  4CES A;  2WON A;  3B6O A;  3U9D A;  4B3M K;  5KGW A;  5LMU K;  4EHT A;  1UA1 A;  2E8A A;  4JKE A;  4BVP A;  3HVT A;  3TAG A;  4NXN K;  1TL1 A;  5HL7 L;  1E4G T;  1SQK A;  3KK7 A;  4EZ9 A;  3CD6 N;  2D4W A;  2ZJP L;  3VMF B;  1GLA G;  1XNQ K;  4CER A;  4EP4 A;  4IOX A;  4WQ4 C;  3BF3 A;  4BRI A;  1NK5 A;  3HZ6 A;  1Y64 A;  5GIP A;  4O55 A;  1KAY A;  5CZ1 A;  1TAU A;  2E20 A;  2LSN A;  3MN5 A;  4MLE A;  2ASP A;  3RRH A;  2B4J A;  2Q36 A;  3OYM A;  4DWI A;  1YHQ N;  3PUF A;  1TK5 A;  1X3M A;  3K2P A;  1GOA A;  3SQ0 A;  3NF9 A;  3L3U A;  1VSM A;  1S1W A;  3KVG A;  4FWR A;  4B9U A;  3ENB A;  3O08 A;  1T05 A;  1SL1 A;  3LAK A;  2DTU A;  3LPT A;  1I94 K;  5JS1 A;  5EY4 A;  4HWI A;  4FYD A;  2O8D B;  4CIE A;  3OS0 A;  2E1Y A;  1XWL A;  2OAN A;  3E66 A;  3PSF A;  2E2O A;  4H0Y B;  3NFA A;  1JJ2 M;  2P9P B;  3W3D A;  3LAM A;  4IG0 A;  1Y97 A;  1HMV A;  5D3G A;  2BUP A;  4DSJ A;  5M1Q A;  3BDP A;  4DR6 K;  4DF8 A;  3VF6 A;  2G8U A;  4CJ3 A;  4BE1 A;  3VTH A;  4BRN A;  3SJH A;  1X3N A;  3CG7 A;  3GG4 A;  4DR7 K;  4IEI A;  3PIP L;  3OYK A;  3KK2 A;  1WSJ A;  3M8P A;  5EOY A;  4BDP A;  1NJY A;  3HXM A;  3H45 C;  1W7A A;  2QEX N;  1NBW A;  3OYC A;  2BTF A;  1KAZ A;  3T19 A;  4Z0U A;  3OYH A;  4FJ7 A;  4JD2 B;  1DT9 A;  3QES A;  1BCM A;  1QSY A;  4CJW A;  5AQG A;  4BC3 A;  4EZ6 A;  3P39 A;  3HK2 A;  3EZW A;  3LDP A;  4DSF A;  4M3T A;  4BVO A;  2YNI A;  4L8R B;  4KFB A;  5E84 A;  1C0M A;  4GW6 A;  3K5M A;  3EKS A;  3VQP A;  4GVE A;  3L4I A;  1ZBS A;  2KQ2 A;  1NKB A;  3PLA A;  1X9S A;  1A5W A;  1NGE A;  2NRT A;  2W40 A;  2YKN A;  1K8K A;  1TK8 A;  2PY5 A;  3GOI A;  4LY7 A;  4PKG A;  4ZHR A;  4FJJ A;  5HLF A;  3SUQ A;  4J8F A;  3SMP A;  5CR4 A;  1NK0 A;  3OBY A;  5J2P A;  4CEC A;  2Q1N A;  4HTU A;  2QXL A;  3C7N A;  4FWL A;  4EFH A;  2ZQB A;  4CF8 A;  1H1V A;  2DFE A;  1RDU A;  4TSX A;  2PFU A;  3QEI A;  4FJI A;  3QIP A;  2V7Y A;  3O80 A;  1NG9 A;  4KH4 A;  1NK7 A;  3HRG A;  2A5X A;  4QS7 A;  3SAF A;  1GOB A;  1BA1 A;  3DXM B;  3JXU A;  3VA3 A;  4WQ4 A;  3CJB A;  3OYB A;  5AQR A;  4Q0B A;  4NYN A;  4RCH A;  1K73 O;  2O8F B;  3MED A;  4CEO A;  4B1U B;  1N34 K;  5BRE A;  1SKW A;  3TPQ A;  2GV9 A;  4FOI A;  4YNQ A;  4WQ5 C;  4CZG A;  3NCI A;  2HBJ A;  4M42 A;  1V4S A;  3VES A;  4WFB L;  2QWQ A;  3H1V X;  3TAN A;  1VQO N;  1HKG A;  3KLH A;  1O13 A;  1P8Z A;  1RT3 A;  2HNY A;  4E1N A;  5ADX A;  1T7P A;  3DLE A;  1ITG A;  3H46 O;  4QS8 A;  4FK0 A;  3CJC A;  1BQN A;  1TK0 A;  4JRP A;  4B08 A;  5AFU A;  4CHQ A;  4AHS A;  4BRA A;  3OYI A;  3OJS A;  1QS4 A;  2FF3 B;  1C1C A;  4JEP A;  3GL1 A;  2BH1 A;  2Z1J A;  1BCO A;  2P9L B;  3O9Q A;  4OJR A;  2YHB A;  3V6D A;  4A2B A;  2F4V K;  1WSF A;  1WN7 A;  2P9U B;  2XY7 A;  4JI8 K;  2OTJ N;  2VGN A;  4AH9 A;  4B1Y B;  4DMN A;  5EXW A;  3JSM A;  1IBK K;  2GUP A;  2NUB A;  1Z25 A;  1JLE A;  1OH7 A;  1TKZ A;  3WEE A;  1XMO K;  3B8A X;  1C0T A;  4Z94 A;  3WXJ A;  2J4R A;  3OYA A;  2HOE A;  3CJA A;  1WBB A;  4KKO A;  4KO0 A;  2YHX A;  4DFM A;  3PV8 A;  4K0K K;  2HHU A;  4CI6 A;  2RE2 A;  4KHS A;  3KLE A;  5I3U A;  4RTF D;  2CH5 A;  3TTD A;  3A8Y A;  1OH5 A;  1Q81 O;  1DLO A;  3QIC A;  4DTS A;  3MCP A;  4F9O A;  4CED A;  1N5Y A;  5BN8 A;  1S6Q A;  2P9U A;  4H0V B;  4CJV A;  4E1M A;  3QET A;  2FF6 A;  3AVM A;  3DLR A;  1NWK A;  4CJ7 A;  2NRR A;  3ZSR A;  2KKZ A;  1Q82 O;  4DS5 A;  1SKS A;  1VQN N;  1IH7 A;  1NGF A;  1HRH A;  1YUW A;  3E01 A;  5C10 A;  4WFA L;  5CY4 A;  3N4P A;  4U7B A;  4CVN E;  1S3X A;  3UKU B;  1HKB A;  1ZBL A;  4DSK A;  3CCU N;  3KWG A;  1BQM A;  4MFB A;  2YX6 A;  2HBK A;  2XHB A;  1BA0 A;  4HHT A;  4LSL A;  4L3Q A;  3SNN A;  3DOL A;  1Q7Y O;  3VQ8 A;  2GTD A;  2GEM A;  2W6L A;  3LM9 A;  4JRQ A;  3HVR A;  4DFJ A;  1JL1 A; 
#chains in the Genus database with same CATH homology
 2OPR A;  4M41 A;  4DLG A;  1L3V A;  3HP9 A;  3DRS A;  3L2R A;  3QER A;  3VQ7 A;  2HMI A;  2VWK A;  3OS1 A;  2KZZ A;  3HP6 A;  3K5L A;  3QEV A;  4BAC A;  1IKV A;  1RTI A;  1S6P A;  3ASM A;  3VQ5 A;  4IG3 A;  3DLK A;  1Q9Y A;  4N41 A;  1VSJ A;  3AVJ A;  1YTU A;  3NGY A;  2XO7 A;  3SCX A;  1WAJ A;  5J1E A;  4W5Q A;  2JLE A;  4QAG A;  4FXD A;  4GMJ B;  4F3T A;  3PO4 A;  4B9S A;  5HRS A;  3RWU A;  1IO2 A;  3K58 A;  1S1V A;  1Q9X A;  4K8Z A;  2WOM A;  1JLB A;  3B6P A;  4BE2 A;  1WAF A;  2Q3S A;  3RMA A;  4DTR A;  1LAV A;  1SV5 A;  5KRT A;  4DG1 A;  5FRN A;  2G8F A;  4B9T A;  2HVH A;  1U47 A;  3VN5 A;  1LAW A;  2P1J A;  1WSH A;  3P83 D;  5FDL A;  1RIL A;  1LW2 A;  2JGU A;  4CEQ A;  3QEP A;  1U48 A;  1N6Q A;  2QK9 A;  3OYD A;  1D9F A;  4KV8 A;  3MXJ A;  3AO4 A;  1L3T A;  5C25 A;  4J2D A;  1NK9 A;  3AV9 A;  3T3F A;  4J2A A;  4DF4 A;  3MXM A;  1RT4 A;  3C95 A;  1D9D A;  4M3W A;  5KTQ A;  4DTP A;  1C6V A;  3HST B;  1RBR A;  3V81 A;  3ITH A;  1S1T A;  3NF6 A;  3F9K A;  3KKR A;  3KLI A;  4M3Y A;  5C42 A;  2HHT A;  1RT6 A;  5JS2 A;  1HPZ A;  2D0B A;  3SPY A;  4KTW A;  4KI6 A;  1RTD A;  1RNH A;  4NCG A;  4C8K A;  4HCB A;  1NJW A;  3CM6 A;  1VSK A;  3C6U A;  3CFO A;  3DOK A;  4B8C A;  4KHW A;  4OPK A;  2D5R A;  2DY4 A;  3LPU A;  1XC9 A;  3AVA A;  2AJQ A;  3DLG A;  3NHG A;  1VSL A;  3VQA A;  2A1R A;  3DLB A;  4AHC A;  4CJQ A;  4CFD A;  5HRR A;  3QNO A;  4K8X A;  2QKB A;  1X9M A;  3A2F A;  3AVI A;  4O4G A;  2KW4 A;  2D0C A;  4CJ4 A;  4B9V A;  4HUG A;  1ASW A;  5J2Q A;  3S3O A;  2OA8 A;  3D0P A;  4PUO A;  1IKX A;  4KTQ A;  3IAY A;  4FM2 A;  4CJP A;  2EHG A;  4UQG A;  3U3Y A;  5T7B A;  3AO5 A;  4DTU A;  4F2S A;  1EKE A;  4KB1 A;  3SI6 A;  1XHZ A;  1BIU A;  4GVM A;  1C0U A;  3WNF A;  3S9H A;  3AVB A;  3WNH A;  1QSL A;  1B92 A;  4RG8 A;  1TL3 A;  1S1X A;  4KB0 A;  4PWD A;  1HJR A;  2GBZ A;  4DU4 A;  3ZSX A;  3NE6 A;  1A5V A;  3VQB A;  3O3H A;  2X74 A;  4FJH A;  1C1B A;  2ETJ A;  1RDC A;  4CK1 A;  1RDD A;  4ELV A;  4HUF A;  4DS4 A;  1CLQ A;  3EYZ A;  3TAM A;  3TAQ A;  2HW3 A;  1K6Y A;  1RT2 A;  3ZT0 A;  5KRS A;  3AO3 A;  4FCY A;  4W5T A;  4KTZ A;  1JKH A;  1FKP A;  4CFA A;  2I5J A;  1QE1 A;  4DQS A;  3TAB A;  3DYA A;  1R0A A;  1KVC A;  3ZSV A;  3SV4 A;  3QEW A;  4B9M A;  2HHV A;  1TKT A;  3SYZ A;  4CJF A;  1CXQ A;  3HM9 A;  4OGC A;  1F21 A;  1LW0 A;  3AVK A;  3IRX A;  3THV A;  2G8H A;  4FJX A;  1JLA A;  3LZJ A;  3ULD A;  3QEX A;  3PO5 A;  3AO1 A;  4CFC A;  5HBM A;  1NOY A;  1BI4 B;  1VSH A;  1XHX A;  2Z1H A;  3L3V A;  4CES A;  2BAN A;  4CHZ A;  4Z4C A;  4E7K A;  2WON A;  2IDO A;  4DTM A;  1BL3 A;  4O44 A;  1ZBI A;  3B6O A;  2ZD1 A;  2ATQ A;  3KD1 E;  1T8E A;  3MXI A;  5KGW A;  3V9S A;  3QO9 A;  1LWF A;  2YHA A;  1UA1 A;  1EX4 A;  3PY8 A;  3TAG A;  3HVT A;  1WSI A;  3NF8 A;  4G1Q A;  4DQI A;  2KTQ A;  1RDA A;  4CGI A;  1TL1 A;  1NJZ A;  1CXU A;  3ZSZ A;  2P5O A;  4EZ9 A;  3RR8 A;  3OYN A;  4B9N A;  1UAX A;  4B9L A;  1QHT A;  4B8A B;  3MEG A;  4CER A;  1UWB A;  4M3R A;  4CK3 A;  2PYJ A;  4EP4 A;  3NH2 A;  3KTQ A;  4KI4 A;  2X78 A;  4FW2 A;  4IDK A;  4ZTF A;  1NK5 A;  4FLY A;  4CJT A;  1VSI A;  4FZZ A;  3HPH A;  1EP4 A;  4O55 A;  1VSF A;  1TKX A;  5CZ1 A;  1TAU A;  3LP1 A;  3AVF A;  2BDP A;  2LSN A;  4CF9 A;  4CGG A;  4CGJ A;  1LV5 A;  3LZI A;  1WLJ A;  3L2U A;  1NKE A;  3V1Q A;  3CFR A;  1IG9 A;  4CE9 A;  4CFB A;  3RRH A;  2B4J A;  3AA2 A;  3L8B A;  3OYM A;  4DWI A;  4E0D A;  3PUF A;  4ID5 A;  3HT3 A;  2ITG A;  4BWM A;  1TK5 A;  3K2P A;  4DSI A;  1GOA A;  3SQ0 A;  3NF9 A;  3C6T A;  3HVR A;  3ZT3 A;  3KLF A;  3L3U A;  3P1G A;  4M3Z A;  3ZT2 A;  4FJ9 A;  4Z4F A;  1BIS A;  3HPO A;  1VSM A;  4ELU A;  1S1W A;  3MEC A;  1HQU A;  2RF2 A;  1WNS A;  1RT5 A;  3M8R A;  3ISN C;  4B9U A;  4RW8 A;  3PX0 A;  3RR7 A;  3KD5 E;  1T05 A;  3OYL A;  3KKS A;  4PY5 A;  4FJL A;  2QKK A;  1SL1 A;  4OLA A;  3HJF A;  3LAK A;  2DTU A;  3LPT A;  5JS1 A;  4FYD A;  2XY6 A;  4FK4 A;  5DK5 A;  4CIE A;  3OS0 A;  1S9E A;  4I2P A;  1XWL A;  4XIU A;  2X6N A;  3L2W A;  4ELT A;  1VK0 A;  1EXQ A;  4FM0 A;  2O4G A;  4H4O A;  5K14 A;  4CGH A;  3NFA A;  3OJU A;  4Y1C A;  4HCC A;  1KLM A;  5KI6 A;  5J2M A;  1D8Y A;  1TV6 A;  2E6L A;  4Y1D A;  3LAM A;  4IG0 A;  4E7H A;  1Y97 A;  1TAQ A;  3LAL A;  4DTX A;  1HMV A;  1SKR A;  2YV0 X;  1ZBF A;  4J2E A;  1HNV A;  2DFF A;  1I3A A;  4CHP A;  4O0J A;  4R5P A;  4DSJ A;  5D3G A;  1HYS A;  2P51 A;  3BDP A;  1J53 A;  3KJV A;  3PX4 A;  3CM5 A;  4FZX C;  4CEE A;  4W5R A;  2Z1G A;  4W5O A;  4CHO A;  5SZT A;  4DF8 A;  2Y1J A;  2G8U A;  4CJ3 A;  2E4L A;  1ASV A;  4E7J A;  4BE1 A;  3LP3 A;  3OYG A;  2OZM A;  1YT3 A;  3CG7 A;  3LWL A;  4OKE A;  3OY9 A;  1ZYQ A;  2OPP A;  4IBN A;  2YKM A;  2KZM A;  3HL8 A;  4AHV A;  3OYK A;  1WSJ A;  3KK2 A;  3IG1 A;  3M8P A;  1X1P A;  1T03 A;  4BDP A;  1CZB A;  1FXX A;  1W0H A;  1NJY A;  4E19 A;  3HXM A;  4OLB A;  4E89 A;  5I42 A;  3F73 A;  4F3O A;  1BHL A;  3RMB A;  1JLG A;  1FKO A;  3TAE A;  3OYC A;  4I9Q A;  1RBS A;  1X9W A;  1U49 A;  3OYF A;  2XY8 A;  3T19 A;  1NKC A;  4Z0U A;  4Z4E A;  4W5N A;  3OYH A;  4FJ7 A;  2F8T A;  1ZBU A;  4B3O A;  4PA1 A;  4FJK A;  3DRP A;  4CEB A;  4CCH A;  4OVL A;  2HHX A;  3QES A;  1BCM A;  1QSY A;  4CJW A;  3AA4 A;  1HYZ A;  3P5J A;  1VSD A;  1RTJ A;  4EZ6 A;  4NYF A;  1DTT A;  3ZSQ A;  4DU1 A;  3HK2 A;  3I0R A;  4DSF A;  1YTA A;  4DTO A;  4M3T A;  2YNI A;  4AHU A;  4L8R B;  2FC0 A;  4KFB A;  4H8K A;  3I0S A;  1SL0 A;  2ZE2 A;  1RT1 A;  4E3S A;  5HRP A;  1J5O A;  1BIZ A;  1J54 A;  1C0M A;  4GW6 A;  3K5M A;  2PYL A;  3VQP A;  2OPS A;  4H4M A;  4LH4 A;  1B9D A;  1O1W A;  3ZCM A;  2OZS A;  4FVM A;  3OYE A;  2KQ2 A;  1NKB A;  3AVH A;  1X9S A;  1A5W A;  2G8V A;  1RBV A;  4DSE A;  5J2N A;  4FJG A;  2F96 A;  2E6M A;  1ASU A;  2FBX A;  3K5O A;  4CJU A;  4N47 A;  1JLF A;  1XI1 A;  2YKN A;  3PX6 A;  1TK8 A;  3RMC A;  2IS3 A;  4JS4 A;  2PY5 A;  3NGZ A;  4LY7 A;  4ZHR A;  4CGD A;  4AHR A;  4AIL C;  3O3G A;  2EX3 A;  5HLF A;  4YFU A;  3SUQ A;  4FJJ A;  3HYF A;  4N56 A;  1REV A;  3V9Z A;  3RMD A;  2VWJ A;  4KHQ A;  5C24 A;  2KFZ A;  1NK0 A;  3HO1 A;  4Q5V A;  5J2P A;  1TGO A;  4CEC A;  4CK2 A;  1I39 A;  1JLQ A;  3TI0 A;  1KLN A;  1LWC A;  2YNH A;  3VQQ A;  4HTU A;  3TWH A;  4CJE A;  2ZQB A;  3DI6 A;  4CF8 A;  2DFE A;  3VA0 A;  1SL2 A;  4DSL A;  4BWJ A;  2D0A A;  4TSX A;  2BGG A;  1KTQ A;  3QEI A;  2B5J A;  4FJI A;  1NK8 A;  3UIQ A;  4PQU A;  1Q8I A;  2HHW A;  4IFY A;  3QIP A;  4FK2 A;  5CYM A;  1S5J A;  3C94 A;  4CIG A;  3OYJ A;  3LP2 A;  3DMJ A;  3AO2 A;  4DFK A;  3SUP A;  1NK7 A;  1TKD A;  2FBY A;  4OKJ A;  1U45 A;  4KRE A;  3TAP A;  1HQE A;  3KK1 A;  1QQC A;  3SJJ A;  1GOB A;  4QOZ B;  1UA0 A;  4DQP A;  3S3M A;  2VG5 A;  3VA3 A;  2HHQ A;  3G0Z A;  3OYB A;  4Q0B A;  4NYN A;  3O4N A;  2G8W A;  5HP1 A;  3MED A;  4LSN A;  4CEO A;  1SKW A;  2G8I A;  4CIF A;  3VQC A;  1HYV A;  1FK9 A;  1BI4 A;  2GV9 A;  1YVU A;  4NCA A;  2IC3 A;  4CJL A;  4YNQ A;  3IS9 A;  4AHT A;  4CJR A;  3NCI A;  3SQ2 A;  4J2B A;  4RW7 A;  4DFP A;  3OVN A;  1L3U A;  4CGF A;  4M42 A;  4OGE A;  1RBT A;  3VQ6 A;  5FRO A;  3TAN A;  3AVG A;  3KLH A;  1J9A A;  1Z26 A;  3QNN A;  4EP5 A;  2OPQ A;  1RT3 A;  4LH5 A;  3KK3 A;  2HNY A;  4E1N A;  1LWE A;  4I9L A;  1WSG A;  3DLE A;  1ITG A;  1T7P A;  3VQ4 A;  3NDK A;  1NOZ A;  3S3N A;  4F8R A;  1IKW A;  1CZ9 A;  5CZ2 A;  1L3S A;  3FFI A;  3TAR A;  4FK0 A;  1TK0 A;  1BQN A;  4IFV A;  1JLC A;  2VG7 A;  1WSE A;  4QCL A;  4JRP A;  4B08 A;  3L2V A;  3LAN A;  4HVJ A;  4DQR A;  3ZSO A;  3SQ1 A;  4CHQ A;  4Z4I A;  3QIO A;  3AA5 X;  4OPJ A;  4AHS A;  2IAJ A;  4O0I A;  3OYI A;  3V9U A;  3OJS A;  4Z4G A;  4JS5 A;  1QS4 A;  1C1C A;  4KPY A;  4FZY A;  3K5N A;  3NH0 A;  2VG6 A;  4FM1 A;  2Z1J A;  1D5A A;  2XY5 A;  2QXF A;  1BCO A;  3TR8 A;  4FLW A;  4FLT A;  1NJX A;  2PZS A;  4FJ5 A;  4OJR A;  4C8L A;  2YHB A;  3ZT1 A;  3V6D A;  1TVR A;  4CEZ A;  3M8Q A;  3V1R A;  1WSF A;  1WN7 A;  3V1O A;  3MAQ A;  2XY7 A;  4DU3 A;  1KVB A;  3SQ4 A;  4C8N A;  1NK6 A;  2RKI A;  4E7L A;  5HRO A;  5CYQ A;  2RN2 A;  4FJ8 A;  1JL2 A;  4ICL A;  3WNG A;  4AH9 A;  4CHN A;  2XRI A;  3V9X A;  4DMN A;  1NK4 A;  1HNI A;  3JSM A;  3G10 A;  2NUB A;  1Z25 A;  1JLE A;  3ZSY A;  2HHS A;  2B6A A;  4MQ3 A;  1TKZ A;  4BE0 A;  3M8S A;  2YNF A;  4DLE A;  1KFS A;  3V4I A;  4FLX A;  1JXE A;  1C0T A;  4N76 A;  2FBV A;  4ID1 A;  3DRR A;  4CEA A;  4RW4 A;  2KFN A;  3OYA A;  3RRG A;  4DTJ A;  4KKO A;  3MEE A;  4KO0 A;  4DTN A;  1VSE A;  4WE1 A;  4I7F A;  2RPI A;  3OS2 A;  4DFM A;  3PV8 A;  4O5B A;  2HHU A;  3CQ8 A;  4NCB A;  1QTM A;  3VQD A;  4FJM A;  3QLH A;  4KHS A;  1RT7 A;  3O3F A;  3KLE A;  5I3U A;  1A5X A;  3NH1 A;  3AA3 A;  3ZT4 A;  3LWM A;  2OYQ A;  4FJN A;  5E41 A;  1BGX T;  3SUN A;  1DLO A;  2FBT A;  3EZ5 A;  1KSP A;  4CF1 A;  3LDS A;  3BGR A;  4DTS A;  1VRT A;  1B9F A;  3DM2 A;  4CF0 A;  2F8S A;  3I8D A;  2IOC A;  3SZ2 A;  3LP0 A;  2GUI A;  3L2Q A;  3SV3 A;  3AVN A;  5FRM A;  1GOC A;  2X6S A;  1IKY A;  3K59 A;  4CED A;  3HPG A;  2HND A;  1N5Y A;  4RW9 A;  1S6Q A;  3CFP A;  5KGX A;  4DQQ A;  2W42 A;  2HVI A;  3VQE A;  1UOC A;  5EU7 A;  4CHY A;  3NBP A;  3TAF A;  3AVL A;  2G8K A;  3NAE A;  3NF7 A;  4CJV A;  4E1M A;  3QET A;  3AVM A;  3RTV A;  3DLR A;  4M3X A;  2P5G A;  3NGI A;  1S9G A;  3O4Q A;  2IGI A;  2DFH A;  3K57 A;  4N5S A;  4F4K A;  4C8M A;  3ZSR A;  1RCH A;  5DMR A;  3JYT A;  4DS5 A;  4FLU A;  1G15 A;  5HRN A;  1SKS A;  3ALY A;  3ZSW A;  1IH7 A;  1U4B A;  1QSS A;  3EY1 A;  2O4I A;  4BDZ A;  5SWM A;  1RBU A;  1U04 A;  1EET A;  1HRH A;  1MU2 A;  3H08 A;  2Z1I A;  3SPZ A;  3E01 A;  1KCF A;  4FW1 A;  4KAZ A;  5CY4 A;  3VQ9 A;  1W9H A;  3V9W A;  4KHU A;  4HUE A;  2HB5 A;  4BDY A;  3KLG A;  1KVA A;  4C8O A;  1ZBL A;  4KRF A;  4CJ5 A;  1KFD A;  2BE2 A;  4DSK A;  1DTQ A;  2A1S A;  1SUQ A;  3QIN A;  4OKK A;  4CEF A;  4CJS A;  4M3U A;  1JXB A;  2Y1I A;  3KIO A;  3SUO A;  4M45 A;  3DLH A;  1BQM A;  3T1A A;  3AVC A;  4CJK A;  4I2Q A;  4MFB A;  4FLZ A;  4E7I A;  3U6F A;  2YNG A;  2XHB A;  4ZTJ A;  1L5U A;  4HHT A;  1RDB A;  4LSL A;  3D45 A;  3SNN A;  4KHY A;  3DOL A;  4JLH A;  3VQ8 A;  3WNE A;  4FLV A;  4KHN A;  4IKF A;  2R7Y A;  1C1A A;  4Z4H A;  1RTH A;  1KRP A;  4RW6 A;  4LD0 A;  3U3G A;  4F2R A;  1S1U A;  4CF2 A;  3CYM A;  4JRQ A;  1ZBH A;  2HNZ A;  1VRU A;  4DFJ A;  1JL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...