1LW0A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
512
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 146
structure length 512
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw0A05
4NLOA 5KFDA 1VSEA 4ZTFA 4KO0A 2D0AA 3Q8RB 4CHYA 2YKNA 2V4QA 4NLUA 1TV6A 2V0NA 1SV5B 3NF9A 4B3OB 2BRKA 2UVUA 2QV6A 5C42A 3MXIA 3QEIA 3QO9A 1RDBA 3UQSA 4TSXA 4HUEA 4J9SA 4F3TA 1WN7A 3V9ZA 3GYNA 3I0SA 3KLFA 4RUAA 1RBUA 4ZHRB 1ASVA 4TQRA 5KT7A 4KO0B 3E01B 2IAJA 3BSCA 1W0HA 3RBDA 3O4QA 3AVLA 2YKNB 4FK0A 2DFEA 3V9WA 5E41A 3MAQA 3RMDA 5F9LA 1VSLA 3ZCMA 1TV6B 5KFNA 2IC3B 4CJLA 4W5QA 4MFBB 4MK8A 4FJ5A 2XI3A 2KFNA 4FZZA 4CJSA 3PV8A 1N48A 5L1KA 4JRQA 4N76A 3I5AA 2IAJB 4ZPAA 4TYAA 3IS9B 1JLCA 4QOZB 3DI6A 2FBTA 4BDPA 2RKIB 1Q9XA 1W25A 1C0TA 3KLIA 1N5YA 4KB1A 1Z4UA 3SPYA 2X6NA 4E1MA 4CF2A 4DF4A 1J9AA 4O0IA 4FCYA 3KK2B 4ED6A 2E6LA 4CJUA 1TAQA 2A1SA 3SUPA 1SKWA 1HQUA 1GX5A 2J6UA 1DLOA 1S1TA 4E19A 3CJ3A 4K8ZA 4J9MA 4ECXA 2BANA 1NK9A 3TQ1A 1TL1B 3IS9A 2A1RA 2W7OA 3DI6B 3ZSRA 2OZSA 1WSEA 3O4NA 4Q44A 1JKHA 4CJ4A 3DLGA 3K2PA 1RYRA 1Z25A 2VG6A 5HRSA 3MEGB 1BL3A 3I5BA 1KLMB 2DTUA 5KG4A 2ILYA 4FJ7A 3L8BA 4ECZA 4E3SA 4CK3A 4WFXA 2FVCA 1FK9A 1DLOB 1S1TB 4K4TA 2B5JB 2BANB 5J1EA 5L1JA 1TL1A 1NK0A 3TAPA 2DPIA 2Z1HA 1U48A 3KMQA 3PUFA 4M3YA 3RR7A 3KJVB 4O3RA 3SI8A 1FKOA 3PW5A 4ZVGA 4ZP6A 4RNFA 3PJXA 2JC0A 4TQSA 2IDOA 1RTIB 2D0CA 4OLAA 1LWEB 2XO7A 5KFGA 4Q0BA 3ZT2A 3CJ5A 1C0MA 3CO9A 4CEEA 4KE5A 4CCHA 4HTUA 2FJVA 3K5NA 3FSIA 3VQ6A 4CEZA 4KHNA 1QSSA 2KQ2A 4W5NA 4YR2A 3SYZA 3DRRA 4Z4HA 3HP6A 2BQRA 4DF8A 2GBZA 4CESA 4CJPA 3C95A 3NL0A 3TAMA 4IH7A 1IH7A 1VSDA 2OPRA 3QLHB 4B9UA 4DU4A 2JLEA 1XR5A 2PZSA 4ZP9A 3GIIA 2VWKA 4M3TA 1HNVA 3AA5X 3OYIA 3KLVA 1VSHA 3KHGA 3VQAA 1YT3A 2AWZA 4J9OA 1U09A 4FLWA 1EKEA 2BR0A 5CY4A 4M42A 4EO6A 2EHGA 3VA0A 4E7LA 3OYGA 4ZTJA 3DRRB 2KZMA 1SL2A 1T3NA 1D5AA 4RNNA 1TAUA 3RBEA 4DU1A 1SH3A 4B9TA 3KHRA 1S9GA 1W9HA 4CGHA 5F9NA 5F8GA 5DQHA 3TAMB 5JS1A 3L3VA 4F4YA 3WNGA 2AGPA 2RPIA 5KI6A 4DSEA 1QE1A 3PX6A 2FBVA 1JLGA 4Q43A 3Q8QB 4IDKA 3F73A 2HHQA 2Z1GA 4EYHB 5DQIA 1L3TA 3H2LA 3LAMA 3TAQA 3H59A 4J2DA 3MR2A 2HHXA 1C0UB 4IG3A 4CIGA 1T03B 4U7CA 4QWCA 3B6PA 1RT1B 4C8NA 3S3OA 3QINA 3AVMA 2IM1A 4PQUA 3LPTA 4NYNA 3VQ5A 4DTXA 4CJEA 4O4RA 4CHQA 1QSYA 4DL5A 4H54A 5KFFA 5KGWA 4R5PB 3TR8A 4IR9A 3PX0A 1NNDA 4DQQA 2I5JA 3V6DA 4OLBA 4IDKB 4ELUA 3VQEA 3ISND 5DGBA 1L3VA 3DOLB 3QEVA 1BQNB 4MIBA 5DG8A 3SQ2A 2R2TA 4DTJA 4IG3B 1T03A 1HYSB 1GOBA 2D5RA 3PO4A 1DTTB 4DTUA 4ECTA 3NE6A 1WNEA 3ZT0A 3ALYA 4RW6B 3AVNA 4ED3A 4RU9A 4DS5A 3DLBA 1WSHA 4LD0A 4J2EA 1Q8IA 4IG0A 3OYMA 4ZP8A 1WSIA 3NH0A 1IG9A 3ISNC 1UAXA 3SZ2A 4IR1A 1X1PA 4KI4A 2B4JA 3LP1B 4ED8A 1HYSA 4DQPA 3AV9A 1DTTA 4FW1A 2HHSA 4RW8A 5DK5A 2O5DA 5C25A 2W9BB 4FLYA 3BQ2A 1BI4B 4G3IA 1ITGA 4RW6A 2IM3A 3OYJA 4YMEA 1IM4A 1RYSA 1KVAA 3CFPA 4Z0UA 3QIPA 4KHRA 4AHVA 3DLHA 4F4ZA 1JXBA 3NHGA 1L3UA 3RR8A 5DLFA 5HLFA 4Y2CA 4I2QB 2DFFA 3LP1A 5KT6A 1HMVB 2DY4A 5HBMB 4JRPA 1TKZA 3DOKA 3OYHA 4JV0A 4K4VA 5C25B 2W9BA 3O3FA 3LANA 5KFZA 1BI4A 4M95A 2QK9A 5KFYA 3RRGA 3KNAA 2Y1JA 4R8UB 4CK1A 3KLEB 4OJRA 3EZUA 4PY5A 1ASUA 2FVRA 2AX0A 5KG7A 3MECB 5L1LA 3DDKA 1KFSA 2O4IA 3QIPB 4CGDA 4NLRA 4G1QA 1C1BB 3AVBA 1IKWA 3AVJA 1ZBHA 4L8RB 3DM2A 1HMVA 3OYFA 1HPZB 2IM0A 2QE5A 4FS1A 3VQBA 2FJWA 1TKZB 3DOKB 5KT5A 3V81A 1T05A 1RT3B 2XRIA 1L3SA 5C24B 3H98A 2DPJA 3RMBA 1X9WA 2KZZA 3HO1A 3DLRA 4M94A 3QIOA 4ZVHA 4R8UA 4J2BA 2JC1A 4B9NA 4RW9B 4K4ZA 4FLTA 1NOZA 4CJQA 1NK7A 3PW7A 1XWLA 2C2RA 3MECA 4Y2AA 3ZT1A 4CF0A 2HMIA 4RW7B 3F9KA 2R7YA 4C8LA 3S3NA 1C1BA 1IKWB 3C6UA 3M9MB 3GIMA 5J2PB 4E89A 1HPZA 4MIAA 1TGOA 4ED0A 3OYAA 3K5LA 1T05B 1RTDB 4O44B 3MEDB 3TARA 5KG5A 4KKOB 1RT5A 4TN2A 3ULDA 4URQU 3HVTB 5KFRA 4FK4A 2VWJA 1Z26A 3AO3A 2OPSB 2R2UA 3HYFA 4RW9A 3SFUA 5JXSA 1WAJA 2ASLA 3V4IA 1S4FA 1LW0B 5KTQA 4K4UA 4NRUA 4OVLA 2RDJA 3TABA 2RF2B 3RB0A 4RW7A 2JEFA 4F3OA 4EO8A 4C8KA 2WK4A 3C6UB 2R8JA 1Y97A 4BDYA 3OYEA 1WAFA 1J5OB 3SQ0A 3QYYA 3FQKA 3HPHA 4NZ0A 4O3QA 1VSJA 1NKCA 2PY5A 5KFJA 4DQRA 3AVHA 4CECA 3D0PA 4O3OA 4UQGA 4R0EA 4ECUA 3KIOA 2D7SA 3AO5A 4I7FB 1NK6A 5KFXA 3MR5A 2IA6A 1TKTA 1U49A 4DMNA 1F21A 3MXMA 2ETJA 4HUGA 2J6SA 4O3SA 4FLVA 5KFHA 4DSLA 4FLUA 1NHVA 3OL8A 1S9EA 4XIUA 4M3XA 4DTRA 3OHAA 2GC8A 1WSGA 3HP9A 1C1CA 4ED1A 2ZKUA 2HVHA 4DG1A 1KVCA 1IKVB 2NUBA 4LSNA 2IJNA 5I3UB 3NAIA 1U45A 4CK2A 2G8VA 1REVA 4FJ9A 4ZP7A 4K4YA 2R8GA 2ZD1B 3ZSZA 5EWGA 4AHCA 5CYQB 1K1SA 4EEYA 4ZPCA 4GC6A 3V6KA 1IKXA 3OYBA 4YNQA 4DFPA 4O3PA 3QZ7A 1RTHB 3SV3A 2F96A 4CFAA 3TAFA 3HVWA 3C6TA 5KFCA 1JL1A 4KHYA 4Q8FA 4FW2A 1UWBA 3V6JA 4BACA 3ZSYA 3KLHB 3SFGA 5I3UA 4RNOA 3RTVA 1NJZA 2GIQA 1SL0A 1REVB 1HQEA 3IAYA 3ITHA 4EZ9A 4KB0A 2ZD1A 4DSJA 4IRDA 5F8JA 4DLGA 4TYBA 1ZBLA 3V1RA 3OL6A 2ZE2A 3A2FA 4Q45A 3QESA 4CEBA 3C6TB 3HM9A 4DTOA 2ILZA 1BIZA 3CWJA 4URGA 4NLDA 2FC0A 3LZJA 3LP2B 1XR6A 5HP1A 3BR9A 3KLHA 2R8IA 2WRMA 5KFLA 2ASJA 4H4OA 1ZYQA 4ZMMA 2W9AA 2XCAA 3TANA 3NDKA 1HQEB 3OLBA 1S97A 3VQ4A 3VQPA 3ZT4A 3SCXA 4NLWA 3OJSA 4KV8A 1IKYB 3LALA 5KG0A 1NJYA 4ECVA 2WOMB 2JEGA 3BGRB 3BSNA 3SUQA 4QCLA 2C22A 1RT4A 2VG7B 5CYMA 3H40A 1TKXA 1I6JA 3LP2A 4MK9A 3KK1B 1RCHA 1B9DA 1RBVA 3I8DA 4CGIA 4JUZA 4AHUA 4FJ8A 2G8KA 4IFVB 4IFYA 4Q5VA 1JXLA 4CF9A 4BE1A 4BDZA 2IOCA 3PVXA 1RA7A 3HKWA 2YNIB 1ZETA 1UOCA 3EPGA 4TY9A 3RAXA 3WNHA 2BE2B 3OS1A 1VRTA 3NGIA 3UDLA 4M41A 2XHBA 3ZSOA 4WYLA 4J9LA 3V9SA 5HRRA 1T8EA 2YHBA 4WFZA 1XC9A 5HROB 3KK1A 3GILA 4CHPA 1S6PA 1BQMB 1B9FA 3M8PB 2B43A 3ASMA 3DMJB 1KHVA 3H5SA 5KFVA 4WZMA 1C6VA 2XY8A 1BHLA 4FM1A 3BDPA 1CZ9A 2AGOA 1QTMA 3GV5B 3AA4A 5I42B 3I5CA 4NCBA 1S1UA 1JLFB 5KG1A 4CHZA 2AQ4A 3RB3A 2HNDA 4CIFA 3I0RB 5F8LA 4PUOA 4C8MA 4DL4A 4QWDA 3IGVA 4LH5A 4H8KA 4CJ5A 3M8SA 2G8UA 3NKYA 4KI6A 4C8OA 2WB4A 5KFUA 2XY7A 1S6PB 1BQMA 1ZTWA 4ECYA 1VRUB 5KGXA 2XY5A 3DMJA 4CGFA 3B6OA 3AVFA 4M45A 4CEAA 2J6TA 4Z4GA 1N56A 4J9QA 2W8KA 5I42A 4KFBA 1JLFA 3VQQA 3IRXB 1DTQB 3BQ1A 3G6VA 3ICLA 5J2NA 3HL8A 5J2MA 3G10A 3PW4A 5JUMA 5EDWA 3VQ8A 3RWUA 4IQXA 4CERA 4F2RA 1J54A 2C2EA 2HNYA 2ALZA 3IGNA 3KKSA 1VRUA 1S1VA 1C1AA 5KFIA 3TVKA 2P5GA 3CQ8A 3NF6A 3MEEB 4NRTA 2YNFB 2X78A 5J2QA 3OYDA 1YVFA 4CJTA 2KFZA 3PJWA 4DTMA 1LWFB 1TP7A 4E0DA 2O4GA 5DGAA 3IN5A 4K4SA 3IRXA 1DTQA 3NH1A 3PX4A 4NLPA 2JEJA 5EWEA 4AHRA 2P51A 3TWHA 1KSPA 4CJKA 4FK2A 1TL3A 1I39A 5JS2A 3RB6A 4OGEA 4YR0A 3ZT3A 4DSIA 2W9CB 1XI1A 1KHWA 5DG7A 1NHUA 3RB4A 2HNZA 4FJHA 3SQ1A 4ID5A 3MEEA 2YNFA 1EX4A 3E01A 3GV7B 3JSMB 1VSFA 3T5JA 1JX4A 3AO4A 2W8LA 4CFBA 3OS2A 4FYDA 3C94A 3PZPA 4MFBA 3QGHA 3BJYA 3QEXA 3BSAA 1IO2A 3LWMA 2ZQBA 1WSJA 1LV5A 3O3GA 3SJJA 4ED2A 1GOAA 2RN2A 2W9CA 2HNZB 4OPKA 4KHUA 3HVAA 1O1WA 4RG8A 3G86A 2DFHA 1JLCB 4MKBA 1LW2A 2X6SA 3JSMA 1SL1A 3KK3A 1CZBA 2RKIA 2OA8A 4FJIA 1C0TB 2C2DA 4AHSA 3QERA 1SV5A 3BREA 4B3OA 4FZYA 4M3RA 1BIUA 3MFIA 3H4DA 3CG7A 5C42B 1RBSA 3IG1A 4IRKA 4WXOA 1LAVA 4LH4A 4FJNA 1XHXA 4OGCA 3I0SB 4E7HA 1WSFA 4DL3A 2YNHA 4ZHRA 1WLJA 1QS4A 2E9TA 2EX3A 1KFDA 1LW2B 3KK3B 5FROA 3QNNA 1QQCA 4NLXA 4FBUA 4ECSA 3DLGB 3OYNA 2IC3A 4MK7A 3FDSA 4DL7A 3QGIA 4NLQA 1UA0A 4JLHA 4BWMA 3MEGA 4M3ZA 4ECRA 3IG1B 2XC9A 4CEQA 3SQ4A 2R2RA 3MTKA 4Y34A 3OLAA 4KTZA 2FVPA 5DG9A 3N6NA 2YNHB 3QZ8A 3KHLA 3P1GA 4WE1A 3NF8A 1TK8A 2B5JA 2D3UA 1JLQB 3TI0A 4ZVEA 3VQ9A 2UVWA 1KTQA 3WNEA 1FKOB 1YTAA 3KLIB 1N5YB 1VSIA 1BGXT 4DU3A 4DTPA 4GC7A 1SH2A 3KK2A 4ELTA 1LWEA 4NCGA 2Q3SA 3L2VA 3NBPA 5DMRA 1HQUB 3NCIA 4ELVA 2FVSA 2VA3A 3DRPA 3H5YA 2ATQA 4W5OA 3G6YA 5SWMA 4WE1B 4PWDB 3Q8SB 4HUFA 4LY7A 2E6MA 1JIHA 1JLQA 2HAIA 4DTNA 1YTUA 2LSNA 1D0EA 2AX1A 3N6LA 4FJJA 3BSOA 3RMCA 4TY8B 3QLHA 4KAZA 3S9HA 2FLPA 1JKHB 4J9NA 2VG6B 2FBXA 2IMWP 1FXXA 5K14B 4LQ3A 1KLMA 2GUIA 1HNVB 3OS0A 4NCGB 1Q9YA 4URSA 4M3UA 3FQLA 3NBPB 4I9LA 3NMAA 3DRPB 1FK9B 3AA3A 4E1NA 4PWDA 1RT2A 4NYZA 2OH2A 5J1EB 4ZPBA 5KG6A 3GIKA 4GVMA 1QAIA 2ASDA 3L2RA 1TK5A 2G8FA 4F2SA 3M8QB 3KJVA 1N6QA 5KT2A 2AGQA 4TY8A 5EWFA 3CVKA 3VQCA 3PY8A 4CHOA 4U6PA 5K14A 4J9PA 2ITGA 1RTIA 4JS4A 1QE1B 3SV4A 4Q0BB 4QAGA 4X2BA 1U47A 1VK0A 1C0UA 1MMLA 3DYAB 1RT2B 3LDSA 4F50A 3RRHA 4KBIA 4W5RA 2YHAA 3OYCA 3VQ7A 4PQUB 4FM2A 5KFOA 3KTQA 1S0OA 2B6AA 4B9SA 3M8QA 1N6QB 2OPRB 2WHOA 1NJXA 1TK0A 2FVQA 4IKAA 2JEIA 4R5PA 1TQLA 4MQ3A 4F4WA 1N4LA 2UUWA 3GIJA 3MXJA 2I5JB 1S49A 3V6DB 3AVAA 4DSKA 3H4BA 3HPGA 3QNOA 1RBTA 1BQNA 1RDRA 4WYWA 3CYMA 2IS3A 4O5BA 1B92A 1G15A 1T94A 1ZBUA 3NFAA 3DYAA 2JGUA 1LWCA 4DFJA 3M9OB 3UR0A 5F8NA 1S9FA 1S9GB 2B6AB 1RILA 1CXQA 4FJGA 4K8XA 1FKPA 3HK2A 2HHVA 2V9WA 3ZSVA 2YKMB 4BE2A 4KB7A 3ZSQA 1S48A 3K58A 1KVBA 2E9RX 2D3ZA 1J53A 4CEDA 1SKRA 3CFOA 1JLGB 2FJXA 4TLRA 1CXUA 4DS4A 2Z1JA 1NKEA 3U3GA 3CFRA 3L2QA 1HARA 3LZIA 1HYZA 3L2UA 1K1QA 4NLGA 4EYIB 1S0NA 1NK8A 1LWCB 1RT1A 4RW8B 5T7BA 3EZ5A 4BE0A 5L9XA 4CHNA 2F8EX 3VA3A 4ECQA 2UVRA 2V4RA 3FRZA 5KFEA 1FKPB 2D0BA 2YKMA 1NK5A 2C28A 3N6MA 4B8AB 3HSTB 3KHHA 1BCOA 2E4LA 4FM0A 4ECWA 1RTJA 3CDWA 2IM2A 3TAGA 3DOLA 4JV1A 5HLFB 3LP3A 4ID1A 2R8KA 5KFWA 5KG2A 4JS5A 1QHTA 3CDEA 4ZPDA 4IH6A 2Z1IA 1ZBIA 2BQUA 4KPYA 4O0JA 2ATLA 4CF8A 3VN5A 4DQSA 1QAJA 1A5VA 1EXQA 4RNHA 1S1WA 4IG0B 2HVIA 1NOYA 4I2PA 4QW8A 3T5HA 3D45A 3OSPA 3NF7A 4B08A 4WFYA 4E7IA 1OS5A 1RTJB 1SUQB 4RUCA 3PO5A 5F8MA 4KREA 1VSKA 3QEPA 1A5WA 3DM2B 4OKJA 4IRCA 3PR4A 2CKWA 5FRMA 3V81B 2XCPA 4KHMA 3HJFA 3RAQA 2G8IA 4CEOA 2OPQA 4TXSA 2HHWA 1K6YA 1RT7B 1RDAA 4DQIA 1U4BA 3RMAA 1R0AB 3HPOA 4HKQA 5HRPA 1JLEB 4EBDA 1RBRA 1S1WB 4KHQA 3EY1A 1XHZA 4I2PB 2UVVA 4J9RA 4HHTA 4DFMA 4FBTA 1SUQA 4LQ9A 3D28A 4RZRA 3PW2A 4FJXA 3HT3A 1QUVA 3M8RA 4I2QA 3S3MA 5J2PA 1JLAA 4B9VA 3H08A 5F8HA 5HBMA 2Y1IA 3CIZA 1RTDA 4Z4FA 4O44A 2OPQB 1MU2B 3VQDA 1RT7A 1RT6B 4OL8A 3O3HA 3DRSB 3PHEA 3EYZA 2OPSA 1R0AA 4B8CA 1JLEA 3KLEA 3U3YA 2BQ3A 3V4IB 5KFQA 4F4KA 2YNGA 4QWAA 3AVCA 2RF2A 4CJVA 4FZXC 4G1QB 2BGGA 4CF1A 4Z4IA 1SKSA 4HCBA 4AHTA 3NGYA 1JLAB 1J5OA 3NAEA 3D5MA 5T14A 4O3NA 1RT3A 4N56A 5C24A 4CFCA 4O55A 2HHTA 3V1QA 1MU2A 1RT6A 4HVJA 3T5KA 3DRSA 4EZ6A 5KFSA 1EP4A 1S6QB 3LWLA 1T7PA 1TVRA 3QGGA 3THVA 4WZQA 1SH0A 1HRHA 2YNGB 5EU7A 2RDIA 4WXWA 2HMIB 3M9NB 2HW3A 4XPEA 2WONB 4YP3A 5FRNA 3AA2A 2XGPA 3OY9A 5HRNA 5CZ2A 3T19A 2R2SA 1C1CB 3SPZA 1RAJA 1EETA 4DG1B 5C5JA 4F4XA 1IKVA 3MEDA 1ZBFA 3GQCA 4KKOA 3CDUA 1RT5B 4OKKA 5KFBA 4FVMA 2W42A 3HVTA 4YFUA 1JXEA 1EP4B 1S6QA 3K59A 3OVNA 1TVRB 2KW4A 3T1AA 2IJFA 3U6FA 1X9MA 4LSLB 5EUHA 1LW0A 4YR3A 3VQSA 1IKXB 3H5XA 2WONA 4CGJA 3K57A 4FJLA 4KTQA 3MR3A 2CJQA 4KAIA 4EP5A 4ED7A 3NH2A 3MFHA 3KMSA 1JL2A 2PYJA 1UWBB 4QPXA 1NJWA 1EETB 1X9SA 2XWYA 3UIQA 4J2AA 3NAHA 3AVIA 4PA1A 2E9ZA 1ASWA 4KHWA 3G6XA 3P5JA 3DLKA 4FS2A 1CLQA 2OYQA 4AILC 3DLEB 4DLEA 3ITHB 3V6HA 4I7FA 2UUTA 4LSLA 1VSMA 1TKTB 3HXMA 2G8WA 4IOBA 3QIDA 2ZE2B 3PW0A 1S9EB 1ZTTA 4GMJB 3MF5A 4FLXA 4QWEA 4B9LA 2YV0X 5F8IA 4NLTA 5KT4A 3KOAA 3TAEA 5HP1B 4E7JA 1JLBA 4LSNB 2VA2A 2AU0A 3DLKB 4H4OB 1RNHA 3L2WA 4B9MA 4E7KA 3DLEA 1RA6A 4XO0A 4FJKA 2AJQA 4H4MB 4YQWA 3V9XA 2QKBA 1RDDA 1U04A 5CYQA 3NGDA 1RTHA 4JV2A 2W7PA 1D9DA 4HYKA 2EC0A 2FBYA 1YVUA 1RT4B 3BQ0A 4AH9A 4Z4EA 1TKXB 4CE9A 4KHSA 1JLBB 4DTSA 1S10A 3OYLA 4F8RA 5KFMA 4DL2A 4W5TA 3AVKA 4RNMA 1C2PA 4IFYB 4IFVA 4NLSA 4KRFA 1UA1A 4IH5A 4FXDA 4H4MA 1BCMA 2YNIA 2OZMA 2R8HA 1D1UA 3V9UA 4IBNA 1GX6A 1TKDA 2BE2A 4ICLA 3CJ2A 1VRTB 5KFAA 3AO2A 3HHKA 3HVRA 4N41A 4NCAA 4CGGA 1XR7A 4DSFA 4KTWA 3K5OA 1D9FA 1I3AA 3KKRA 5CZ1A 3AVGA 2G8HA 5L1IA 1LAWA 4CJRA 1HNIB 1S1XA 4J9KA 4N5SA 3ZSXA 5DLGA 1NK4A 4O4GB 1S1UB 4MKAA 4NYFA 3OSNA 5FDLB 1HJRA 4KV8B 1IKYA 3KLGA 4NLVA 3I0RA 3PR5B 4ICLB 2WOMA 4PUOB 3CM5A 3BGRA 4MH8A 3ZSWA 4QW9A 3QEWA 4Z4CA 2PYLA 2VG7A 5CYMB 1A5XA 4K4WA 5D3GB 4CJFA 2WTFA 2QXFA 3WNFA 3JYTA 3OHBA 1BISA 1KRPA 5KRSA 1HNIA 1S1XB 1HYVA 1QSLA 3OL9A 1NKBA 3KD5E 3H5UA 4O4GA 3LP0A 3LPUA 2VG5B 4KFBB 4Q8EA 2GV9A 2IGIA 3LAKA 1WNSA 2I1RA 3OYKA 5KRTA 5FDLA 3NGZA 3SUNA 3KLGB 5J2NB 2X74A 2KTQA 3Q8PB 4M3WA 2F8TA 3OJUA 3T3FA 4FJMA 4EBEA 2HNYB 5HROA 5D3GA 4DWIA 2XY6A 3CM6A 4FLZA 3JYTB 3M8PA 3FFIA 2OPPB 4IKFA 1S1VB 2FLNA 4CFDA 1CSJA 5KT3A 4DEZA 3QETA 5J2QB 5KFTA 3V1OA 4Y3CA 3LP0B 2VG5A 1RDCA 1LWFA 2HNDB 2HB5A 4N47A 3OL7A 3L3UA 1GOCA 4NLYA 3CJ0A 2HHUA 4HCCA 4CJ3A 1TL3B 1S0MA 2BDPA 2D41A 3SUOA 1KLNA 4CEFA 3K5MA 4KSEB 2P5OA 2F8SA 4K50A 2BRLA 3SNNA 4RW4A 4OKEA 3AO1A 4QWBA 3MR6A 2IBKA 2XI2A 3FFIB 2OPPA 4Y1CA 4Y1DA 3UPFA 4BWJA 4ID5B 4DL6A 1KCFA 4I9QA 5SZTA 2FLLA 3KD1E 2HWHA 3G0ZA 2QKKA 1S5JA 5KFKA 2WCXA 2XGQA 3T5LA 4EP4A 3EPIA 3P83D 4GW6A 2GIRA 3GV8B 3CJ4A 4K4XA 5KG3A 4DFKA 5J2MB 1D8YA 2HWIA 4ZVFA 5KFPA 4XPCA 3QO9B 4CIEA 4EBCA 3E51A 4OPJA 4RW4B 3SI6A 4CJWA 1L5UA 3KLFB 5DQGA 2P1JA
chains in the Genus database with same CATH superfamily
2MHEA 3BM7A 2PMWA 3VF6A 1R31A 1BQXA 2ZBCA 2MKCA 4UUXA 5LOQA 1YDLA 5CR4A 2CQIA 3ELHA 1TV6A 2M0GB 4DR6F 2BRKA 2I7PA 5C42A 2P9UA 1RDBA 3BEXA 3CPWR 2E2PA 4X66K 4TSXA 3ZETB 4FWPA 4TU8A 4OPHA 4LF2A 4OZ0A 3VGUA 3EKSA 2W24A 4BRAA 1ASVA 3S8SA 3MD1A 5KT7A 1KXPA 2GJFA 1GH8A 1HBMB 3KWGA 3MAQA 3RMDA 3ZCMA 1EZZB 1TV6B 4JI4J 4IJNA 2WB1D 1X8DA 4MK8A 3IM8A 5F1XA 1Q4RA 3A8YA 2VQEJ 4CJSA 3PV8A 3GU0A 2V67A 3ZETA 5L1KA 2P9KA 2ZKTA 4DDFA 3D1HA 4FF3A 2IBOA 1X7VA 3CD6N 4TYAA 4FWKA 5ADXH 4FNIA 3R5CA 3A1YG 4ZDNA 4BDPA 3C3LA 1RBOB 2FJBB 4KB1A 1Z4UA 3MUVP 1HPMA 4E1MA 3TSUA 1WEYA 4FCYA 3KK2B 2OFHX 4OYAA 3ISZA 5KAKA 1N88A 1VK8A 4CJUA 5F3ZA 1SKWA 4ZLLA 3Q8YA 1DLOA 4IO8A 2OANA 4K8ZA 3CCVN 2UU9K 2BANA 3O6QA 1GT8A 1NZ8A 5AQNA 3ZSRA 3CCMS 3OW2M 2OZSA 1WSEA 2A6OA 4Q44A 1JKHA 3K2PA 2HQ3A 2VG6A 3MCMA 4XDCA 3PFOA 2IY5B 3I5BA 2DTUA 1VQKS 3DXBA 4N7TA 5AJ3K 4JHDB 1GLJO 4FJ7A 2PI4A 1MMNA 3L8BA 4ECZA 4E3SA 2WBRA 1HW8A 4TLQA 1DLOB 3FCHA 4U7UK 2ZGZA 2BANB 3WEEA 4MO4A 2DPIA 5KPZA 2DNLA 2DR8A 4X4RA 3J81j 3PUFA 3W66A 4M3YA 3M8YA 3KJVB 4O3RA 1FKOA 5EHHA 2R7TA 1VQYA 2OEMA 2XSJA 2FC9A 7FDRA 5AQYA 1PYOB 3SBMA 3PJXA 5AT1B 2JC0A 4TQSA 2IDOA 2XO7A 1RAOA 3EN9A 3EUNA 1C0MA 4JHDA 4KE5A 2FJVA 3FC9A 3VQ6A 4BRCA 2KQ2A 4YR2A 3HP6A 5ETLA 3C95A 3AD9C 1GLDG 1IH7A 1VSDA 1WF2A 1Q78A 4B9UA 3RSEA 2XSJB 4OZ2A 4HEA9 2PZSA 2VWKA 1HNVA 3OYIA 1DQAA 3KLVA 1VSHA 3KHGA 3VQAA 4OX6A 1YT3A 2C3PA 1PGZA 1V3ZA 6AT1B 3I33A 2M7SA 5CYJA 4JI5K 4R0JA 4E7LA 4ZTJA 3D1QA 2KXNB 5CE3A 1TAUA 2LA6A 2P5VA 1W9HA 3D7SB 1VFJA 2WFBA 4DUYK 1H6KX 2YKQA 4OI6A 2GJ2A 4HACA 4IO9L 3J81O 5KI6A 1TL7B 4CNZA 2JNJA 2FBVA 4OJHA 1XMQJ 4JD2B 3Q8QB 4IDKA 2LQ8A 5IC6B 4CT9A 2HHQA 5DQIA 3HHLD 1L3TA 3B4MA 3AB2B 1C0GA 3H2LA 2RMLA 3KJFB 3LAMA 3TAQA 4J2DA 3FE1A 2HHXA 4IG3A 1FRLA 4QWCA 3B6PA 1SVDA 4C8NA 4L73A 3S3OA 2IM1A 1FFWB 2A40A 1WG1A 2IVOA 2QW9A 3VQ5A 5FLXO 4CJEA 3U27A 4DL5A 5KGWA 2MTLA 2I38A 4HACB 8RUCA 4CJ7A 4DQQA 1TL7A 4JD2A 4IDKB 1OPIA 5DGBA 1WC1A 3QEVA 3TZYA 5DG8A 1R6VA 3OVAA 4IG3B 2O8FA 4U8VA 1U2VB 3HSJA 3PO4A 1FCAA 3MR7A 4YB1P 4ECTA 5B0GA 3NE6A 1WNEA 4TVAB 5TKYA 3MAHA 3AVNA 2OI2A 5C2DA 1YTYA 3N4QA 4ZJQA 4J2EA 1WSHA 3OXGA 2L9DA 3D6MB 1YITN 3IC1A 3TO8A 4ZP8A 3VGKA 3ISNC 4DV5F 2P9GA 3PEHA 5BPNA 3LP1B 2O8FB 3V2UC 3H45C 5MLCV 2F9JA 4FW1A 3VAFA 2MZJA 1Y00A 1Y5NB 4DCPB 5JVGL 2VQFK 2W9BB 1ITGA 4TKTA 2V51B 1YJNS 4P7VA 4F26A 3W3SA 1IM4A 1RYSA 1KVAA 5LY3A 1YZ7A 4OI0A 1EHWA 2OAUA 3NHGA 1L3UA 3RR8A 2LMIA 3KDOA 4Y2CA 3LP1A 5KT6A 2DY4A 2CG8A 1FDDA 5HBMB 2DB1A 3UI3A 5DDRC 2ZH4A 3DU5A 1IBMJ 2W9BA 3C16B 4PKGA 4OI2A 5LSLA 2DGSA 5KFYA 2Y1JA 3Q0AA 2HMPA 1MLAA 4CK1A 3KLEB 2V2VA 3EZUA 4X64F 3T1YJ 1SZ2A 4PY5A 3PYFA 4CZMA 1LK7A 5L1LA 5TKWA 4CGDA 2HFUA 3AVBA 1IKWA 4CW7B 2B4UA 1A7GE 3T41A 1YX2A 3L6QA 3CO0P 2QE5A 3CD6S 1F3FA 3Q24A 1UVNA 2XB2D 4DPYA 3H98A 1IR0A 4JI0F 1X9WA 3C16A 2KZZA 1RHRB 3EZWA 3H0PA 3IR7B 2JSXA 1VR6A 3O1LA 4FLTA 4YB5A 2YQ1A 4Y2AA 2BABA 4JKHA 3MOJB 1D09B 1HQ2A 3F9KA 1IKWB 3BBFA 3GIMA 1GEHA 1YIJN 1Y3KA 4MIAA 2X1AA 4K41A 2CDQA 2LEAA 1HWJA 3OYAA 2BM0A 2EWHA 2M9KA 4YHHK 3MEDB 4QR1A 2D69A 1RAAB 1RT5A 3VGLA 4TN2A 2FQQB 4BR0A 1KNZA 5KFRA 4UUWA 3NWGA 3SQGB 5B7WA 2VWJA 2OPSB 1YJ9N 3QMLA 2M4MA 1K0TA 3V4IA 2ZVSA 2KG1A 4NRUA 2RDJA 1WDTA 3TABA 2RF2B 3RB0A 2B8PA 2UV8G 3TRGA 4EO8A 3A8KA 2WK4A 1Y97A 3BS9A 1H3DA 3P5BP 5IV3A 2XYHB 1IBMK 4H5TA 1D8ZA 2RT3A 1S0VA 3HPHA 2W4PA 4NZ0A 3ZZPA 2O8EB 1FRHA 2PY5A 3D0PA 4BLGA 4O3OA 2ZZNA 5M2RA 2G13A 2KT3A 4I7FB 2LQBA 3FZLA 5KFXA 4MLHA 2IA6A 2VD3A 2JH3A 4YS2A 2BACA 1F21A 1N33K 1H2VZ 2DEIA 4FLUA 1E4FT 5BPMA 4M3XA 2Q1LA 1RKIA 4DG1A 5B0DA 3W9HA 1JB0C 1GMVA 3HOTA 1N5VA 3DHXA 3EGWB 2A3ZA 4M63C 3M05A 4OPAA 2QXLA 5CYQB 1GLBG 4EEYA 3ZTSA 4ZCMA 4YNQA 4DFPA 1CS4A 3BN7A 1N36J 3CJQA 2O66A 1APSA 4CFAA 3HVWA 4E2FB 5KFCA 4KHYA 5LL6d 1OVQA 4YB6A 2QWMA 2NRTA 1UWBA 4U7UD 2EG2A 3ZSYA 4ZN1A 2EBGA 5H9FK 2PFFB 4DR4F 2LDIA 5A6PA 1SL0A 5E84A 2VYPA 4I6AA 4H5RA 5A0YB 1QDUB 4EZ9A 2CQ3A 3V1RA 6FDRA 2Z58B 4I6WA 2Z57B 2ZE2A 1CS4B 2E5JA 3M2VA 3VZIA 4Q45A 2E5LJ 3SQOP 4CTAA 2IJRA 3HM9A 1NHKL 2D1CA 4DTOA 3GFHA 2VDHA 3LGNA 2NZ4A 4URGA 5C12A 4Q7AA 2HHPA 3BR9A 2ZVIA 4X4OA 4UZCA 1ELOA 4U67Q 4C4WA 4OI4A 5ADXA 3KNGA 4LF6F 1KD1T 3NDKA 5LMNK 3I96A 5HJXA 1S97A 3ZT4A 3VQPA 4ILJA 3A8EA 4K0KK 1BUXA 3Q8UA 5JMVA 1KAYA 2BE9B 4KV8A 1IKYB 3LALA 1YJTA 1NU4A 5KG0A 2PSZA 4O8KA 4ECVA 2HIQA 1HJOA 3BSNA 1H98A 1CQNA 9RUBA 1RT4A 3N79A 3H40A 4DR6J 1I6JA 1P9QC 5K8MA 3TVZA 1OO0B 4U8YA 4NLCA 3HHEA 2LQ5A 4AHUA 5IWAJ 4IFVB 4IFYA 2AEMA 5H1SV 4Q5VA 1JXLA 2G8KA 2LFVA 2IRUA 3HKWA 2YNIB 2IVFB 2XMWA 3PIPL 2DGVA 1VRTA 1VMBA 4H0TB 2OEJA 3FZ2A 3HHNB 3KJQB 3UDLA 2XHBA 4TU9A 3THXA 4WYLA 1RGVA 3DRYA 1T8EA 4A2AA 1VC0A 1T44A 1JK9B 5HROB 3EDRB 4JV5J 2HRYA 3OBYA 1B9FA 2HBLA 4ZVUB 4WBFA 4WFNQ 4DR1F 1C6VA 3QT6A 3QJLA 3ETMA 5BJRA 3BZQA 4UF4A 1DJ0A 1JLFB 2HPUA 4IOAQ 2XEXA 3I0RB 4CIFA 1W2BM 1SB6A 3A8IA 5F8LA 3IWLA 2U2FA 2OFGX 2B3TB 4DPTA 1IBLJ 2RUSA 3EL2A 2F9DA 2WB4A 2XLKA 2XY7A 4BBYA 4LJMA 5KGXA 1VRUB 1EJ7L 4CGFA 2LVWA 1IBKK 3AVFA 4RL1A 4ALZA 2EW9A 2J6TA 2FY8A 4Z4GA 3DGVA 1Q1KA 1URNA 1JLFA 1YGYA 5C2CA 1XK8A 5F41A 4OYXA 3IRXB 4X62K 1X4EA 4OQJA 4CI0B 3G10A 3PW4A 5C15A 1ATRA 4F2RA 4CERA 3TEGA 1J54A 1QJHA 3WX8A 4CYUA 1ZA1B 4NLBA 4JYAK 3B54A 4OZJA 1VRUA 4CLWA 1C4AA 3Q7BA 3NF6A 4NRTA 3EE3A 3GG0A 4DCJB 2ZHBA 4KHPJ 4CJTA 3PJWA 3ULEB 5CHIA 4DJBA 2O4GA 5DGAA 3IRXA 5LJ5Y 4L3KA 1X4GA 3CW2C 5KOWA 1KSPA 3HHLC 3CJSA 1I39A 5JS2A 2Q3PA 3CCRN 4PXEA 3IM9A 3RB6A 1TELA 1RB0A 4OGEA 2P8IA 3W65A 4YR0A 4GY2B 3GB0A 1NHUA 2HNZA 1AXQA 3GG4A 2CPIA 4ID5A 1EX4A 1W7WA 3M1VA 4P72A 3SDEB 3JSMB 1U2RA 2F5GA 4JKGA 3T5JA 1RWUA 1WC6A 5M1KA 3AJDA 3EKUA 4YY3J 5B0BA 1FD2A 1WSJA 1LV5A 3O3GA 1YWXA 3O9QA 2GHPA 3CMQA 2HNZB 2X3GA 4ZPVR 3HVAA 1QVFR 3M1VB 4ZA1A 1FHTA 4PYDA 3G86A 2UUCJ 1VAZA 2KRBA 1JLCB 1RP5A 3JSMA 1SL1A 1CZBA 2RKIA 4JKGB 1VQNS 1WSVA 4FJIA 4KGVB 3C0BA 4OZ5A 3HSGA 1YJUA 2X51A 4FZYA 3DWLA 1U1PA 1RWKB 3MFIA 1R8BA 4NEYA 3H4DA 1S99A 3IG1A 2MQOA 4DU7A 5G4DA 2HK3A 5A2QU 4LH4A 1RJJA 4FJNA 3UKRB 4OGCA 3I0SB 3G82B 4MKYA 4O5FA 1HNWK 2YNHA 4NPOA 2R3VA 1WLJA 3G6EN 2BEFA 4FVCA 4BGBA 2QWPA 4JK7A 1QQCA 3UO0A 3ONQA 4ECSA 1HWLA 3BO2A 3MCAB 3OYNA 2IC3A 5DM6Q 3M4XA 4BWMA 3MEGA 2Y0SD 1VOMA 4M3ZA 1YSJA 3IG1B 4KT0C 4CEQA 3OTOF 1Q53A 2HQGA 4BG9A 1Y64A 2YNHB 3KHLA 2B56A 2UXCJ 1LOTB 4XH4A 2VQFJ 2ROGA 1JLQB 2RQMA 1K9MT 2DNKA 4P71A 2BW2A 3VQ9A 3R97A 5F2RA 2PA3A 5DO2A 2Z2MA 5GINA 5F0WA 4R79A 1BGXT 3E3XA 4GC7A 4FWOA 3C6HA 1VQ5S 3T9ZA 4DV2J 2CRLA 3MCNA 1SQGA 4W5OA 3HD2A 3G6YA 1HBUB 3Q8SB 5ETSA 2E6MA 3IXQA 1JIHA 3A3OB 1JLQA 1YTUA 1F0XA 2Z2YB 4FJJA 2RAQA 3RMCA 3QLHA 2C3MA 1RUSA 3F41A 3MMAB 3I31A 1R7IA 4J9NA 2RILA 2ZF5O 2VOPA 2HRTA 2HF4A 2QZ8A 4URSA 5AXLA 3VEOA 3NGSA 1RHMB 2DNZA 4WFAQ 1RADB 1FK9B 3AA3A 1HBUA 1HI1A 4CLSA 1FJCA 1YRTA 4FKYA 1RT2A 2IRXA 2XZTB 4ZPBA 4A46A 4GVMA 4LSZB 2ASDA 1NH8A 3T6JA 1X0PA 3W5ZA 1VHXA 5AQUA 4Z94A 5I4MA 3CVKA 1UPMB 3PY8A 1VIOA 1QE1B 3O8MA 3SCKE 1NUEA 4WJBA 5T41A 1F6TA 1VK0A 1C0UA 2HZVA 1PJ6A 1RT2B 3RRHA 4KBIA 4PQUB 2PFUA 4FM2A 5KFOA 1C4CA 3RG6A 4UY85 1TK0A 4IKAA 4PL7A 2JEIA 3MM7B 1TQLA 2UUWA 1VYAA 1CLFA 4LF9F 3QFUA 1S49A 3V6DB 5BR9A 2RIJA 2VC0A 4P9SA 2ZH5A 4QBUA 1SQEA 1RBTA 3DGPB 1VLYA 4WYWA 1G15A 1PBAA 1KONA 2E2OA 2QFJA 2JHEA 3OFEA 4JEPA 5LT5A 4LF4K 2E5GA 1O6XA 4K2XA 1CXQA 1OQ6A 2MHNA 3ZSVA 2C2ZB 2UXBK 3PFEA 4BE2A 1CJKB 4EK2A 1L3KA 3X3UA 1KVBA 3TTFA 4CEDA 4CZIA 3EX7B 3CFRA 3GFZA 1CG2A 5AJ3J 1Y5IB 2DYAA 3L2UA 3RGIA 3A3NB 4NLGA 4EYIB 1RWNB 3CCMN 1RT1A 3P45B 3ENQA 1OH5A 3EZ5A 4DV7J 4X65K 5GIPA 3DOMA 1SJ3P 5K8NA 1XMOF 2QM1A 1VQKN 2C28A 1OJ4A 3HSTB 2XMVA 2IVNA 4F0HA 1XNRF 2HBJA 2AF6A 2G1HA 1HR0F 3CCTA 4FM0A 1FDNA 3GWCA 4ECWA 2CG4A 3TAGA 1WHVA 1HKBA 2NS1B 3VWSA 2VIHA 3BKFA 2CXEA 5IZHA 4C3MA 2VASA 4JS5A 3L4QA 4IH6A 4LC9B 1FRXA 4GNIA 5J1PA 2XMUA 1WKKA 3THWB 5DDQC 2GCFA 1UZHA 1SJ1A 1QAJA 1A6LA 1OKJA 4BRHA 4R25A 1NOYA 2J9CA 4I2PA 4RU2A 4FO0A 4USVA 1F60B 4B08A 1D3WA 4WFYA 2OUGA 4E7IA 4RUCA 3FVYA 1QTNB 4GRSA 5HVHA 2XMMA 4M5MA 4KREA 3QEPA 2CQ2A 2EPIA 4OKJA 2ZOGA 4P7TA 4X4UA 4UOCA 3PR4A 2J9EA 1F3VA 5FRMA 3PSFA 1DURA 2Y9HA 2XCPA 4KHMA 3RAQA 2OPQA 4A48A 3R1HA 1HI0P 1K6YA 1RDAA 2HGMA 2HIYA 4K7QA 1U4BA 1HNZK 4DR1K 5ETKA 4HTJA 2K3KA 4HKQA 1N34J 5HRPA 4I2PB 2Y8YA 2UVVA 2WUSA 4LRAA 4J9RA 4JI1J 4FBTA 4LQ9A 3D28A 1QUVA 3BYPA 4F3QA 4I2QA 2NRRA 2JVOA 2XULA 3H08A 4X65F 4HHJA 1YBTA 4DR5J 2KVQE 3NXZA 3DKDA 1RTDA 4Z4FA 2WTUA 2OPQB 3Q2SC 3J8AA 4DUZF 4C1NI 2GVDB 2ZM6J 2X3DA 4RUHA 3CJRA 3GPAA 4A8FA 4XAKA 3U3YA 2B4PA 1VQ7N 5E3CA 4QWAA 4PL8A 4U9RA 4FYVB 8ATCB 1J5OA 3NAEA 3R3TA 4F3MA 1DQ8A 5C24A 1JJ4A 2VOOA 3V1QA 1YAGA 4QQBA 4B3SK 4EZ6A 1FRIA 2E5LF 3S6EA 2EC2A 3D6HB 2Z8QA 4B3MF 1SH0A 1HRHA 2FHJA 1M5KC 2RDIA 4LF8J 2HW3A 4YP3A 2KHOA 2ASOA 2KRRA 4WFBQ 1DAXA 2ZH3A 5D0RA 2E7WA 5C5JA 1IKVA 1ZBFA 4KKOA 4YEAA 1QD1A 1QZ6A 2W42A 1JXEA 1Q8LA 1YHQN 2KW4A 3GIRA 1EO1A 3T1AA 5H9EJ 5EUHA 3JXUA 2DH7A 2O8DA 2ADCA 1NDPA 4FJLA 5DJBA 4WKYA 2CJQA 3NH2A 3MFHA 2EFGA 5CHCB 1RLCL 2PYJA 4IOXA 1NJWA 2XWYA 3GE1A 3MEKA 1CPZA 2MXYA 5ADZA 3CQYA 1YJ9S 4KGKA 3DLKA 3KUGA 2DJWA 1K73O 4A8OA 3KVGA 4V19J 3D6RA 3ITHB 4CT8A 3CCSS 5E3RA 1VSMA 4OO1J 1TKTB 3FR0A 4OJGA 2YKAA 2G8WA 3PW0A 4DV1K 5IWAF 3ENHA 1WHXA 1NGEA 4GMJB 1J2VA 4YHHF 4FLXA 1RTZA 2MGZB 2CQ0A 4QWEA 3R6MA 2AJ4A 5F8IA 4NLTA 1JLBA 3KHYA 3DLKB 2KYZA 3CPEA 4JI6F 4O23A 2ATCB 1CBKA 2EFOA 3V9XA 1BA1A 2WVCA 3VVTA 3FZHA 4WPAA 1D9DA 4K0KF 3MK6A 3MMBA 4CO3A 1U2CA 4Z4EA 5GAEP 2MZSA 1JLBB 1AZSA 2C2MB 2Z0GA 4W5TA 3W3DA 3M30B 4LT6A 2K2PA 4KRFA 4B3MK 3V9UA 4OHXA 1FNMA 1GX6A 3CB4A 1TKDA 4ICLA 3MCOA 5KFAA 2VKZG 1GQEA 1KBRA 3JQMA 1P9YA 1RAEB 1RWPB 4CH0S 3SMSA 1RAFB 3F0NA 1VQ9N 2KN4A 2DNOA 1HKCA 2ROEA 1ZH5A 3PEJA 4JOUA 4DSFA 4KTWA 1S77D 4OHZA 1AZSB 3K89A 3KKRA 5CZ1A 4RLEA 2G8HA 4TU7A 2IIHA 1VBYA 5HOOA 4L3NA 2GW8A 4N5SA 5DLGA 5U47A 4ILHA 1NBWA 4O4GB 3GMGA 1S72S 5L39A 1S1UB 4KIAA 1MWZA 4ICLB 2UU9J 3ZSWA 1HKAA 1HNWJ 2FZCB 1AUSL 2QWOA 4Z4CA 4ILRA 4K4WA 2WTFA 2CQBA 3JYTA 4GMKA 1RDUA 1BISA 1KRPA 5D8HB 1QSLA 1G1XA 3OL9A 1NKBA 1Z2ZA 4O4GA 1WC4A 3A5LC 2YXLA 3CD7A 3SK3A 2I1RA 3K9JA 2X74A 5BREA 1S6OA 3NMUA 1B0TA 2J8SA 3FBEA 3ZX3A 2O8BB 2A18A 3I56N 3H1VX 4DWIA 2M52A 2XY6A 3CM6A 5HO4A 4FLZA 3JYTB 3L9ZA 1H2TZ 3NG8A 3OR1A 2FLOA 4M7XA 2ALYB 3B8AX 2RD5C 2JZ5A 3V1OA 1M0SA 2RQ4A 2MKKA 1RDCA 1LKZA 5EN1A 3VAGA 1Q95G 1K47A 2HB5A 3OL7A 2GO8A 5BR8K 4NLYA 4CJ3A 2O8BA 1TL3B 4MTPA 4CNYA 4HT5A 2FJEB 4BR5A 1AA1B 1KLNA 2F8SA 2V2QA 3VVUA 1UTAA 4C6AA 3OW2R 4QWBA 4OYOA 3QRQA 1RHUB 4I9QA 5SZTA 1OIAA 2Q43A 3QFHA 4DV4J 5KFKA 3H3NO 2E88A 5AE1A 2DD8S 2L41A 3EPIA 4EP4A 2FSKA 4GW6A 3GV8B 3CJ4A 4K4XA 3T69A 1UFLA 2YWEA 2HWIA 4LVOP 4CH7A 5D4LA 1ZZNA 4LF7J 3VTHA 2LLZA 3MWTA 2UUBK 3D3CJ 3E51A 2BKPA 5KQDA 2CQHA 4KH6A 3U1NA 4HVZA 3ZFVA 1R8CA 5D4NA 4NLOA 2NLWA 4V19X 2MMYA 4MYTA 2HWTA 3Q8RB 2ERRA 4G1PA 2G4BA 3D4JA 1WTBA 4ANCA 2KXHA 1SV5B 3NF9A 4B3OB 3EE8A 2UVUA 1FFSB 3MXIA 2HBKA 5AZIB 3UQSA 5HMWA 4F3TA 1WN7A 2VUGA 4DR2J 2OCEA 4ILMA 3QDKA 5J1NA 4UOFA 4EIAA 1WBDA 2IAJA 2HAFA 3KUEA 3MN5A 3O4QA 3AVLA 3CJCA 4FK0A 4ZIVA 4K43A 1QLNA 4Y2KA 3V9WA 3WXLA 2FJAB 1VSLA 2E5LK 2POKA 2OTLS 4EI2A 3OBWA 5HVGA 4W5QA 2HQDA 4MFBB 2XI3A 4AT1B 2KFNA 3AXMA 5GMEA 1WUAA 3R8YA 3FSXA 2ZWHA 1J5EF 1WACA 3MXHP 4OJ1A 3R6GB 3LDQA 4X62F 2RE2A 2IAJB 4QOZB 3DI6A 5LJ3Y 3I6PA 2F65A 3GSIA 4DR4J 3E2EA 1Q9XA 5JVHL 1N5YA 2Y0BB 1X4FA 2CZ4A 4NI2B 4ZVSB 4CF2A 2ZDPA 2AIRB 4O0IA 1HNXK 4ED6A 3HBTA 4QIEA 2E6LA 1Y9OA 1TAQA 5BRFA 3SUPA 3TP2A 2VB6A 2GEMA 3CDAA 2J6UA 1S1TA 4E19A 3CJ3A 3V5RA 4J9MA 5CXTA 3H2VE 3M32A 2FIUA 3PKYA 2QWQA 2A1RA 2W7OA 3DI6B 4Q2LA 1ILYA 2NYHA 2E5HA 2PE8A 1SC1B 3H8YA 3CC7S 5K8PA 2IPOB 3DLGA 2FSNA 1GXUA 1X9JA 4KRWA 1BL3A 1KLMB 1BO5O 5KG4A 2ILYA 1Z2LA 1RHKB 1EX8A 2VGMA 4HDGA 5FLXY 2QMXA 4CK3A 1HBNA 1UVMA 2FVCA 1K73T 1S1TB 3GYXB 4ANEA 2VGNA 3D9BA 3M32B 5L1JA 3NCRA 3MOZA 1NK0A 3CT9A 5CCLA 3RR7A 3D66A 3PW5A 4ZVGA 5F0XA 2AZ1A 3OFHA 1I94F 4F7VA 4OLAA 4NE9C 1DGKN 1LWEB 1S22A 1YZ6A 3SIPB 3CO9A 4CEEA 2F9TA 4CCHA 4HTUA 3K5NA 5IFMA 4KHNA 1QSSA 1HHQA 2SXLA 4USUA 2N7YA 2VPWB 4W5NA 3SYZA 3DRRA 2QL9B 2D0PA 4Z4HA 2NCKL 2CJAA 3DC2A 3L7PA 2GBZA 1RAGB 3BB5A 1MWMA 1HR0K 4CBXA 3NNAA 3FZKA 2KLAA 2E1YA 3R5BA 2JLEA 4FOEA 2VJVA 3IR5B 3GIIA 2H5JB 3AA5X 4WIQA 1JJ2R 1X4BA 2KVIA 1FEEA 5DDPC 2AWZA 2Z2ZA 2Z30B 1U09A 1T9YA 5BXIA 3ZX2A 4MMOA 4EO6A 2EHGA 3VA0A 2NR0A 3ID6A 3DRRB 3PCOB 3M3ZA 2KZMA 1SL2A 4KHPK 1D5AA 4RNNA 2DCUB 3RBEA 1F5BA 2DR9A 4CGHA 4WP9A 1U02A 1RWVB 1YLXA 3HSCA 3L3VA 5C10A 2E8AA 3TZXA 5AQVA 1RWXB 4MIWA 2P2CB 4DR2F 4IXCA 4NX9A 4F4YA 3WNGA 4DSEA 3PX6A 2A41A 1J5EK 1JLGA 4Q43A 4YOTA 4CLKA 5E33A 5L38A 4ZCLA 4JI0K 2RH3A 4PRFA 3MR2A 4CIGA 1SIZA 3DXMA 3NVMA 4LR7A 4DTXA 5BYRA 4JI8F 2DHHA 1QSYA 5AQFA 2DXEA 4YUDA 4H54A 1B64A 5KFFA 4R5PB 3KKFA 1B3TA 3TR8A 3D6TB 3I56S 3CIMA 3PX0A 4QU6A 2I5JA 2E1MC 2E1AA 4PPZA 4OLBA 4ES3A 2CQPA 4ELUA 1QQOA 3VQEA 3ISND 3DOLB 2OJ3A 1MG7A 2PFDA 3SQ2A 2R2TA 2JOQA 4DTJA 3G6ES 2QMWA 3NGKA 1DTTB 3P4UB 4CQ1A 3QPIA 3BGOP 3W8GA 2DR7A 2W2QP 4RU9A 4WQ4C 3KFWX 4K2JA 2V2KA 5GADU 4IG0A 2CFXA 3OYMA 2ZH7A 3A5MC 3R2CJ 2BKNA 1WSIA 1IG9A 1M5VC 4AM7A 3SZ2A 3LQVA 4IR1A 3LO3A 5LSOA 4ED8A 3LF0A 2D3O1 2K1RA 3AV9A 1DTTA 3TA1A 1B0VA 4JI2J 3BGLA 2PN6A 3SSQA 2QLXA 1SJQA 2UXDJ 2MSTA 3BQ2A 1JCEA 2IM3A 2GMLA 1LFPA 1LQ9A 4J91A 2ZC3A 1YG0A 3MN9A 3I87A 5EVZA 4MLEA 1VI7A 4LIRA 3CD5A 4KHRA 3DLHA 1GNKA 3CNQP 2DIUA 3J7ZO 4NO7A 1VQMN 1HMVB 1R0BG 3K8VA 4BRFA 4EMDA 3A0IX 3TOQA 4AXJA 1TKZA 3DDNA 2ZH9A 5L9NA 5AQHA 3VEZA 3DJCA 3OTOJ 2KT5A 5C0YA 4UQTA 2VQEF 3RRGA 1NB2A 4R8UB 2L9NA 4OJRA 1VQSA 2AX0A 5KG7A 4CZJA 4ED4A 1KFSA 2NXCA 2J0XA 5FLXU 3AAPA 5LM7E 4NLRA 5ETPA 4G1QA 3DM2A 1HMVA 1HPZB 5IT0A 5KT5A 1TKZB 3V81A 1L3SA 3HD1A 1QY7A 2CJ9A 4CH1A 4JI0J 2OP5A 4M94A 1UPPA 4ZVHA 4R8UA 4B3RJ 2FHKA 4N8OA 2DGUA 4RW9B 2ZUGA 3PW7A 1XWLA 2OD4A 1R8HA 5AQIA 5AJ3F 3OR2B 1GMWD 4F36A 4C8LA 3W5XA 1RFQA 3ADAC 5EX5A 4JK8A 5B0FA 1HPZA 3FGVA 1VQON 4EFHA 3WIVA 1LCUA 3TARA 3ULDA 4URQU 1M1HA 3UWTA 2ASYA 2Q0UA 4QS9A 3HYFA 4RW9A 3SFUA 2C3YA 1S4FA 1VDHA 2F8HA 2G0CA 3C15A 1LW0B 4OVLA 4F3OA 2JEFA 5G0RA 2HZAA 1EAYC 3VQTA 2YX6A 3GDQA 3OYEA 1WAFA 3FBBA 4CM0A 4NEZA 4WK1A 3I8BA 2C2OB 2R7QA 1E6YB 4PR6A 4O3QA 1NKCA 1CJVA 3AVHA 3Q7CA 2E1CA 5C2FA 3BDEA 2QIFA 2AW0A 1NGJA 4CO2A 3MR5A 1NCLA 4BHQA 2ETJA 3IA0A 2J6SA 4O3SA 5KFHA 4DSLA 2K8GA 4XIUA 4DTRA 3D0HE 2PEBA 1WSGA 2GHVC 4F0KA 4ED1A 2QC3A 1E6YA 1VGYA 1M5PC 1VQ6S 4LSNA 2GFFA 2HSTA 1DZ5A 1UEKA 1U45A 5FPEA 1REVA 1UVIA 4ZP7A 4K4YA 4FJ9A 1O5JA 3AHPA 2R8GA 2ZD1B 4GO7X 5EWGA 1VHFA 4YOUA 3WXIA 3VGMA 1WOQA 2HHHJ 1GTHA 1FERA 1IKXA 1RTHB 1X5PA 3TAFA 2I9SA 1U1NA 3KUHA 4Q8FA 3H42A 3MDQA 2KJWA 4L3QA 4BACA 2B8QA 1K9MO 3R2DJ 5DM7L 1DKGD 1NJZA 4IQMA 4KYZA 1REVB 2MQLA 1N33F 3IR6B 7FD1A 2ZD1A 5F8JA 3HFVA 4TYBA 4DCHA 1F9FA 4DUTA 1T95A 1RCXB 2IVPA 3O6WA 3QESA 4CEBA 4G9ZA 1IWAA 1BIZA 3K7RA 4ZIWA 5AQLA 1MW7A 4NLDA 2FC0A 1UMJA 3RU0A 2UP1A 2V8DA 4CVNE 4PG7A 2ASJA 3J7YI 3ET6B 2RVJA 4H4OA 4ZMMA 2W9AA 2X1FA 1N36K 2J9DA 4P2MA 5LL6Z 2E66A 4NLWA 3EE9A 3OJSA 3I9V9 1B7FA 1RHQB 3ATVA 3SMZA 3BZCA 1KD1O 1NDCA 3N01A 1YI2S 3E66A 5E3AA 2VG7B 5CYMA 4KH0B 1TKXA 3M6XA 3CC2S 2Q6CA 1RCHA 1RBVA 3VESA 4BC9A 4GKKJ 2BV3A 4FJ8A 2GQCA 4CF9A 4BDZA 5FPNA 3VEYA 4TY9A 3SSSA 3UDVA 4DV3J 5D6GA 4F02A 3NGIA 4W4MA 5E26A 2DNNA 1TYQB 3V9SA 1HWKA 3GP9A 1VQPS 3U02A 3C6AA 3J7AP 2B43A 3DMJB 5AQRA 4AM6A 1LEOA 3UCZP 3JTPA 4K8RA 1BHLA 4QR0A 4OLOA 4FM1A 3AOAA 1FVSA 1Q7LB 4ISFA 3RB3A 2HNDA 2LCWA 4C8MA 5DDOC 4NMLA 4G1IA 3IGVA 3TJ9A 1TYQA 5LXRA 3M8SA 3E9LA 4KI6A 2ZM6K 3CCRS 4USHA 1ZTWA 3DMJA 4F4AA 1XBWA 3B6OA 3P49B 3HTVA 2MB0B 4M45A 4CEAA 1A9NB 3MCPA 2BBEA 4NMXA 4KFBA 2BYCA 1RDWX 5HI7A 3G6VA 2BOPA 2VPZB 3CJ7A 3HL8A 3J7YP 1S76D 5JUMA 4LF1A 2F8MA 3BN4A 2VBZA 1WORA 4IQXA 3AAWB 4LF6J 3EGZA 2JDJA 1WELA 2AEJA 4CZEA 2HNYA 5THWA 2N3LA 3IGNA 3KKSA 4A8MP 2XTJP 4IOCQ 1S1VA 1C1AA 3NS5A 5KFIA 3TVKA 5D4PA 3MEEB 3GONA 3P31A 2YX7A 2CGJA 1YVFA 2KFZA 4WFAL 1LWFB 1TP7A 4E0DA 4B1VA 5L46A 2ACMA 1BLUA 1RBAA 4B3MJ 1PG5B 3THYA 5EY4A 4FK2A 5IT9U 3NRBA 3PRVA 3CQXA 2AV5A 3ZO7A 1IBMF 2FHJD 4NOHA 2MPUA 4ZLJA 1I94J 3W1YC 3L4BC 4KR0B 1VQ4S 5CCMA 2W9CB 4DSIA 1XI1A 1NMDA 3CCES 3MEEA 4OLPA 3E01A 3R7BB 3GV7B 1YI2N 3BR8A 4L72B 2QL5B 3BJYA 3QEXA 3BSAA 1AFJA 5KPRA 4U95A 1QZ5A 1MNEA 2ZQBA 3TX8A 1U8SA 2LXFA 3HSZA 2W9CA 3CUNA 1FXRA 3R6LB 4H5NA 1NGFA 5LJWA 2DFHA 5HMZA 1XMQF 1C0TB 3ZZYA 3QERA 2HFNA 2YKPA 4LVNP 2QEXN 4M3RA 3VAHA 1FNOA 3CC2N 3CJKA 5C42B 1RBSA 2P9UB 4DV4K 2BTFA 2UUBF 3TQEA 3MX5A 8AT1B 1LAVA 2F9WA 3ILJA 5K20B 4AYBD 1O8BA 4JAXA 3WC0A 2CJYB 2LU1A 4A59A 5FROA 3QNNA 3Q86A 4BRQA 4NLXA 4FBUA 1RWOB 4IUFA 2V52B 3FDSA 1RWMB 4NLQA 1UA0A 5MAOA 4JLHA 2MKHA 2DR6A 3MPYA 3SQ4A 4L76A 2R2RA 3G87A 3U7JA 3FKBA 5CA5A 3QZ8A 4WE1A 2B5JA 2QA4S 2E1RA 4DV4F 3TI0A 1GLFO 1RLDA 3HMJG 4ZVEA 3AY0A 1KC8O 2UVWA 3VTIA 1KTVA 4DU3A 3TA2A 3CCUN 3KK2A 4ELTA 5KPTA 1X4HA 1R89A 1Q81T 2XHWA 5I9EB 2Q3SA 5HMXA 3L2VA 5DMRA 3PM9A 3ENWA 4ELVA 4ATNA 2VA3A 2LU2A 2X7IA 1UJ5A 1FXDA 6FD1A 3J80U 2ATQA 2Z4PA 1XNQK 4PEOA 4WE1B 4H5WA 2ZEJA 4HUFA 4HDHA 3FBFA 2HAIA 2DIVA 4IO9Q 2LSNA 1D0EA 4Y28C 3N6LA 5DZ7A 4GVLA 4TY8B 1JKHB 3UNYA 5A8WB 4JI3J 2VG6B 3C19A 1FXXA 5K14B 3UNGC 3WQPA 1HL6A 2GUIA 3I55N 4WQ5A 1U1RA 1NSPA 3FQLA 2UU9F 4I9LA 5A8RA 3QFWA 4IEEA 3AJ1A 3MUMP 1M90T 4AQYK 2R7UA 2OH2A 3CC7N 2V8PA 3WEEB 1AB8A 4CZKA 2AYGA 3H1QA 2D3OR 1HBOA 2CPXA 2BVZA 3VOVA 2W6KA 3KJVA 1N6QA 4P75A 5KT2A 4TY8A 3G9CA 4FF4A 1LXJA 2A6AA 1T9WA 1U26A 5K14A 2YQ3A 4WK3A 4JS4A 3SV4A 4QIVA 5MLCQ 2YI1A 5LXYA 5AQGA 1E6VB 4Z7CA 2YVSA 5A8RB 3O4WA 3SLCA 3V4MA 4DR6K 1WWHA 4DV1F 3W60A 1H2UX 3LDSA 2F7TA 2JWLA 4W92B 2F4VJ 1S0OA 4FVUA 3E8OA 2GQ2A 1HBOB 1YJRA 1N6QB 2FVQA 4DKWA 3RSEB 1OH7A 2CJKA 3GIJA 5ETVA 1NB7A 2QLJB 1NH7A 1PAUB 5ETRA 4UOHA 5IV4A 4ER8A 4FWQA 3QNOA 1MMDA 4UTGA 1BQNA 1RDRA 3N4WA 3CYMA 2FGOA 3RUBL 1ATSA 1T94A 2HYIB 1ZBUA 3PACA 3AD8C 1LWCA 3LA0A 1F5CA 4DFJA 2PC6A 5F8NA 5IQ6A 3HSDA 5BPLA 4P10A 2L08A 4WF9Q 1X0FA 4FJGA 3JAMU 1WI6A 2HS0A 1S48A 4DR5F 2YCHA 1Q7YO 3T6BA 4DV0F 2D3ZA 3CFOA 4TLRA 5A6WA 1CXUA 1ZXOA 1S12A 4F9OA 1NKEA 3U3GA 1W2IA 1YJNN 4GV3A 1HARA 4BR4A 4EUVA 4I68A 4IFEA 1HYZA 2M5YA 1SXLA 2ZH1A 5IWAK 1LWCB 4LF6K 3IBFB 3BGUA 4RW8B 4UY8T 4CHNA 3TTCA 2UVRA 2V4RA 5KFEA 3CCUS 2D0BA 2RQCA 1VS3A 3N6MA 4ZCKA 4IWVA 1V6HA 1BCOA 2DISA 1HHSA 1DEJA 1S6UA 1RTJA 1J27A 4DV5K 5AQQA 4MAKA 1NGDA 5HLFB 4DV7F 4ID1A 2R8KA 1W2BR 1FKAF 1U2VA 1TUUA 1ZBIA 4KPYA 4CF8A 3CCZA 2DGTA 2E7XA 2NPFA 3D0GE 4FF1A 3ILLA 4LFCJ 5M2UA 5T7LB 2RRNA 3L3CA 2YX1A 3OSPA 1XUPO 1RTJB 1SUQB 3LDLA 5AQPA 1A5WA 3QJPA 1OY8A 2DT9A 5IC4B 5CH7B 3HX9A 4M5HA 1GTEA 4X4PA 3N9UC 3Q83A 3DXKB 4DQIA 1ZM3A 1SPBP 1HNZF 2QEXS 3HPOA 4EBDA 1Q5YA 1RBRA 3BZKA 1VK3A 5T7LA 3BGFA 3K0JA 3IP0A 1XHZA 4B3SF 4LF8K 4LFBF 2B51A 1CJTA 4AXIA 4HHTA 4XH5A 1SUQA 3VF4A 4RZRA 3UE2A 2O01C 4Z37A 3M8RA 1P6TA 1OVYA 4A8SA 5J2PA 3WUHA 1JLAA 3CC4N 5HBMA 4QIGA 1IN0A 4PG6A 4V19S 1F2GA 1ZM4A 3CIZA 4O44A 1IG8A 5AFUH 1RT6B 3DRSB 3TA0A 3PHEA 2FUG9 1AROP 3R5JB 3KLEA 2MZQA 2HS4A 4DZ6A 3FZMA 3QT5A 1CJTB 4F4KA 3QWUA 3C46A 1XTZA 4FZXC 2BGGA 3ILIA 4CF1A 4Z4IA 2ZWPA 3FCWA 1JLAB 3KJNB 1X4AA 2CWXA 3U4LA 1WHYA 2H3GX 1F1BB 1FE0A 4CFCA 3Q23A 4K42A 1RT6A 3ZNJ1 3DRSA 5KFSA 1S6QB 1YVNA 3LWLA 1TVRA 4ES2A 2HQIA 2J9DE 2VPYB 3E9PA 4WZQA 4CZCA 4WXWA 2O8CB 3OTOK 4XPEA 2WONB 4NB4A 3TJAA 5FRNA 5GAEU 3I4HX 1UVKA 2P9LA 5HRNA 5CZ2A 3DCAA 3T19A 2RDDA 2R2SA 2ZOFA 1C1CB 5KOXA 1RAJA 3VCDA 2NREA 3MEDA 3GQCA 1RT5B 4GVBB 4YFUA 1S6QA 3BH7B 1TVRB 4M1KA 1SC6A 3U6FA 5FD1A 3W9JA 5H9FJ 2GS8A 1QQNA 2EBEA 4PXDA 1FVQA 4LRDA 5IT9O 2CADA 2Z2LA 2WONA 2G0IA 4JI6J 4EP5A 4K59A 3KMSA 1NGIA 3CCQS 3CJBA 2DNGA 4USMA 2NRWA 4A8XA 4J2AA 4C7QA 3R3LA 1ASWA 2DK2A 2K7KA 1T6DA 4KHWA 3G6XA 2H51B 3P5JA 4YHHJ 5ETMA 2GV1A 2WC9A 1CVJA 1SC3B 1CLQA 3GJQB 2HSEB 4WU3A 3CERA 4AILC 3DLEB 2XNRA 3V6HA 4JP8A 4WKRA 4I7FA 3CETA 3GLJA 4WTOB 3RJMB 4NWBA 5FIIA 3N4PA 1NMNA 3AY9A 1XNRK 3GOIA 1ZTTA 3MMCA 2W41A 3CEDA 3OBIA 3MD3A 1NPPA 2YV0X 4P73A 4QJVA 5KT4A 3KOAA 5HP1B 2W7AA 4OV1A 3G8TA 3M2RB 2AU0A 3CCSN 5HL7L 3A13A 3O80A 4PKIA 2FB0A 4E7KA 4BRPA 3DLEA 1RA6A 2W4DA 4FJKA 2AJQA 1LOUA 4YQWA 2QKBA 3CE8A 1RDDA 1PJ7A 5CYQA 3VGTA 3FSYA 5ETTA 2JFDA 4W98A 2W7PA 3ZNUA 3HRGA 2JFKA 3BQ0A 1S59A 4DPWA 2ASMA 4CE9A 1P27B 2PI5A 2DXDA 2MEWA 4H4KA 3F5TA 3CPWM 5KFMA 4DL2A 3AVKA 2I2YA 2CJBA 2KT2A 2K3IA 1UA1A 4IH5A 1BCMA 3HT0A 2NZCA 3SSRA 1EQ0A 2BE2A 2R7SA 3F9MA 2QLBB 1CULA 4RX6A 3HKZD 4N41A 1BA0A 2WVEA 4NCAA 3N28A 1VJWA 4Y00A 1R3NA 4KPCA 1FDAA 1YKWA 3K5OA 5JJBA 1T02A 1I3AA 2RS8A 2CVEA 2NUUG 3AVGA 2JRSA 4PWUA 2XBPA 4H03B 1IBKF 4M5IA 1HNIB 4K0KJ 1RHJB 1W26A 1IJFB 4DX8H 5GAEI 1T9VA 2VH7A 1ZC6A 2V68A 5FDLB 4KV8B 1IKYA 4A4JA 3L09A 4PUOB 1YJWS 4NXMK 3DAWA 1FFGB 4MH8A 3JAMO 3UD4P 4HWIA 1UETA 2C2NA 4QW9A 3ZTRA 1A5XA 2EI5A 1QVGR 3PYGA 1UVJA 2DHXA 5E5NA 4B02A 4GKJF 5AQTA 3ZEUA 3ENBA 1HNIA 4NXNF 3KZBA 4AL7A 4YN3B 3H5UA 4PKDB 1FJ7A 2VG5B 3LPUA 1KQGB 2GV9A 2IGIA 3LAKA 1WNSA 5FDLA 1LK5A 5J2NB 3CCQN 2OMLA 4ZVQB 2F8TA 4ITSA 3THXB 4CO5A 4C11B 2KH9A 1Z05A 1TTHB 1VQ6N 5HROA 3WDOA 2P9SB 2V63A 3AGKA 2VDIA 4JV5K 3FFIA 3SBTA 2UXBJ 3VPZA 2LXUA 1HWIA 3ZEUB 2AEFA 2VFUA 3QETA 5J2QB 5KFTA 3THPA 4I1TA 4Y3CA 4PKHA 3UN2A 2VG5A 5ELZA 3QBCA 1WD6A 1WBBA 4WFBL 1CC7A 4BRNA 4QYZK 3QAEA 2YPZA 3AFGA 1U6ZA 2BDPA 2EEYA 1XEZA 2D41A 3BO3A 4CEFA 2P9SA 2HBMA 1GAOA 2BRLA 4YORA 4RW4A 3AO1A 2IBKA 3FFIB 3T1HJ 2VODA 4Y1CA 4BWJA 4DL6A 1KCFA 2HWHA 2F4FA 2R7WA 3H2UB 1H1VA 2VFTA 1S5JA 2MYFA 1YRUA 3PG9A 2E29A 4A8KA 2GIRA 4X4NA 4CLFA 3U9DA 2E5IA 1CJUA 2YHYA 3MPVA 2V8VA 4EBCA 2XS5A 5B8HA 4RW4B 4OHVA 4CJWA 3FLCO 1ROFA 5DQGA 4DXLA 4I0WA 5KFDA 4BQZA 1VSEA 2HF3A 4KO0A 2V8HA 2N3OA 4LF5F 4CHYA 4CI6A 1DRZA 2LP4A 4NLUA 3R9LA 1FJGJ 5CZXA 2GMHA 3D67A 4OYZA 3HFZB 4QU7A 3GR0A 5AFUA 2RU3A 4K25A 3BPDA 4BY9C 4DUZJ 4J9SA 4DV6K 4ZHRB 2W4CA 5C7PA 2VPXB 3CC4S 4KO0B 1W0HA 4KBOA 1WF0A 4DHYA 5F9LA 3LTOA 2V7ZA 5KFNA 3BEGB 5K5MA 3JTNA 2FC8A 1WI8A 5M1PA 1JCFA 2QTDA 2ZM6F 2ZHAA 4FJ5A 4UT4A 3MGJA 1P8GA 2ASPA 2KB2A 4FZZA 3CCJS 3MM5B 1N48A 3LPYA 1EQMA 3FMWA 4N76A 3I5AA 1YIJS 1BWEA 2AD9A 3W2WA 1JLCA 1T3OA 2FBTA 4OFZA 1KC8T 4EAHD 2RKIB 1CQMA 3VERA 1W25A 3J7Z5 3KLIA 4BREA 2X6NA 2ZNYA 1J5EJ 3MPDA 2D4WA 1J9AA 3NS7B 3K5PA 3PJ9A 5JICA 3BYRA 3MM5A 2DY1A 4LFAF 2D74B 1HQUA 3UKRA 2YHWA 1GX5A 1UEUA 4F25A 5GAHP 2ZFHA 1U0HB 1G99A 3P8BB 1NK9A 3TQ1A 1TL1B 3ZC4A 3GL1A 1UZDA 3W2WB 2R7VA 3MDFA 3US5A 2HK2A 3O4NA 4CJ4A 1RYRA 1G2EA 3BKUA 1Z25A 1H38A 5HRSA 3MEGB 2ZBQA 5C2GA 3PIPQ 4NL5A 1Y11A 4DB3A 2XLJA 1WG4A 3PRDA 2RB7A 1DHMA 4K4TA 2WBMA 5M1QA 4YOVA 5J1EA 3J7ZT 1TL1A 4A5BA 1U48A 3DDIA 5AR0A 1IBLK 1Y3JA 2DO0A 4PPDA 3HDSA 5GMKa 2J7WA 2RUGA 2YH0A 1XMOJ 5AQWA 2XQCA 3HHLB 1RTIB 5KFGA 4Q0BA 1PILA 2GVZA 3ZT2A 3CJ5A 4F67A 3JB9k 1N8RT 3Q89A 2J5AA 2ZJRL 2BQRA 2GO9A 4J9UE 3NL0A 1IUJA 2DGXA 4CO4A 1ZM9A 1W7AA 3TAMA 4IH7A 2OPRA 3QLHB 3D1OA 2QWNA 3MMAA 1OYEA 1SJFA 1XR5A 3HHLA 4M3TA 2M2BA 4J9OA 1V3SA 1T6CA 5HK4A 1JJCB 4FLWA 1EKEA 2EFPA 2BR0A 5CY4A 3LW5C 3VENA 1WC5A 3OYGA 5AXKA 2RS2A 1WF1A 1KP6A 1X4DA 5IM0A 3WT0A 4DU1A 1SH3A 4B9TA 3KHRA 1S9GA 5F9NA 4A8YA 5F8GA 5DQHA 3TAMB 2PEHA 3CJ9A 2GAGC 5D0EA 3EVOA 1XIQA 4JI7K 3UR3C 4NA2A 2DNYA 4JI8J 4M5LA 1QE1A 1VQ8S 3F73A 1Y4ZB 2Z1GA 2Q36A 4EYHB 2LQJA 4D3GA 1FEHA 4DR3J 1C0UB 3H46O 1WHWA 2B0GA 4U7CA 3NOCA 5IM0B 4HLBA 4RBUA 3HOSA 4PQUA 3LPTA 4JKAA 1RK8A 4O4RA 2ZJQQ 3SAGA 1SC4B 1ITPA 2COLA 5JVGQ 1NG9A 2VBWA 4IR9A 1NNDA 1KS2A 3V6DA 3EGNA 1K8AT 2VQFF 4OHWA 3DGPA 4LFBJ 2PMHA 1HYSB 1GOBA 2D5RA 4DTUA 3S41A 2G2YA 3ALYA 4FOIA 4RW6B 3L0QA 4ISEA 3PNIA 1WC3A 3HCXA 3TJ8A 1BXNA 4HHUA 2JL9A 2HEKA 1UAXA 4FWRA 2W1BA 1E4GT 4GKJK 2JLFA 4OI3A 3R9PA 1HYSA 4DQPA 4I4BA 3IUCA 1FO1A 2HHSA 2CNKB 4CZLA 5C25A 1BI4B 4RW6A 2P9PB 1U2FA 3OYJA 5EX0A 2DBBA 4L6V3 4YMEA 1EB0A 5BYQA 4Z0UA 3F2KA 4AHVA 1JXBA 1VQLS 2GELA 1VQ7S 4I6MA 1NM1A 2KDOA 1EIYB 1KAZA 4JV0A 4E1JA 1GXTA 2FF3B 4X64K 5C25B 5LMNJ 2MSSA 3O3FA 3THWA 3LANA 1BI4A 4CDIA 2D0OA 2VKRA 2P9PA 3KNAA 1PBUA 4BC5A 3CF5Q 2L48A 2LA4A 1ASUA 2FVRA 1NEEA 3J81Y 2CPZA 3DDKA 2O4IA 5BRHA 1B99A 4OYWA 1I1GA 3AVJA 3ZTPA 1ZBHA 1TUVA 4B1YB 2CQ1A 2BXJA 3OYFA 3IWXA 1U1LA 2FJWA 1RT3B 1PSDA 2XRIA 2AYBA 4ZITA 3RMBA 3GR1A 5AQJA 5JLHA 3DLRA 3QIOA 4DPOA 4J2BA 2JC1A 3M6UA 1KOHA 4K4ZA 3H6EA 4FYYB 4M5KA 1FRMA 3WX4A 1NDLA 3W7BA 3TUPA 5JLFA 2BJEA 4CF0A 2HMIA 4RW7B 3LDNA 1B4SA 2R7YA 5I3PA 2PO4A 3S3NA 1NGHA 3C6UA 4HH1A 3LDOA 5L8RC 4ED0A 1YBUA 3QT8A 2QA4G 1DBDA 1X5TA 3IBWA 4B3RF 1RTDB 5KG5A 3GZ7A 3S1TA 4M7YA 3HVTB 2VHGA 4ENOA 3ZZ0A 3LM9A 1Z26A 3AO3A 2XSFA 4DR4K 2R2UA 4ILGB 3EMTA 1I94K 5JXSA 1WAJA 4RW7A 4UZBA 2Y8WA 4C8KA 5GAHU 3C6UB 2R8JA 4C98A 2BUPA 2H3EB 2OEKA 4B3TJ 4RPFA 1J5OB 3Q22A 3TU5A 3FQKA 1EWQA 4P74A 1BG3A 5DZ6A 1VSJA 3P39A 2XZWA 4M5JA 2NYIA 4DQRA 4R0EA 3AH6A 4ECUA 5CABA 2D7SA 4BC2A 3VEWA 3T9NA 1VRQC 5LMUF 3AO5A 1NK6A 1VQ5N 3DLJA 2NLXA 5E3QA 5D4OA 1NDKA 4I6YA 1U49A 3MMJA 2ZJPL 1QVGM 1TFWA 3OVBA 3MXMA 4FLVA 1HKGA 2OMOA 2I0XA 1S9EA 1ULRA 2UUAF 4KGXB 3B82A 2HVHA 3TYTA 4ZVPB 1IKVB 1M1KT 2NUBA 1DARA 1T11A 3TVYA 1X5OA 1Z1ZA 3NAIA 4FPBA 2F4VF 4CK2A 2G8VA 4ZK7M 4AHCA 1K1SA 4GC6A 4OZ3A 3QZ7A 2QT7A 4BR2A 3RW7A 3ZLJA 1I5OB 3SV3A 2F96A 4OYMA 4ES1A 2C3OA 1JL1A 3R7SB 4FW2A 3DLLL 4DHVA 1O51A 1PCAA 1DFDA 2IDEA 3PXGa 1WOPA 1ZZFA 3SFGA 3SAFA 1XJWB 2MZRA 4CWBA 2DITA 3RTVA 2GIQA 1HQEA 5BN8A 5AXNA 3HZGA 3IAYA 3ITHA 3ENOA 4DLGA 2EG1A 1ZBLA 2OD6A 4DV1J 3A2FA 5A76A 2K06A 4CLZA 1P1LA 2IFXA 3OHRA 3CWJA 2MGZA 3CMEN 2L3MA 2YWGA 2BM1A 3GJTB 3LZJA 3LP2B 1XR6A 3UFCX 1FNXH 3CF5L 4ZPTR 2DGQA 1ZYQA 3TANA 2XCAA 4X4TA 1HQEB 3OLBA 4ZJLA 7AT1B 3VQ4A 5GMDA 3TZWA 3SCXA 3AB4B 1NJYA 3EJMA 2JX2A 4ZOSA 2WOMB 2JEGA 3BGRB 3SUQA 3MM9A 2OTLN 3SAHA 2C22A 1IBKJ 3MMBB 1HR0J 1HLWA 2KJVA 3LP2A 4MK9A 2GHWA 2YBVA 1CEZA 4JBCA 3KK1B 2YWFA 3M8ZA 1B9DA 2BA9A 3CULA 3I8DA 3M30A 4CGIA 4JUZA 2CNNB 2UXDK 2QA2A 4BE1A 2Q79A 4BRGA 1QM9A 2DNHA 4AFFA 1RA7A 1ZETA 4LUBA 4G6VB 1UOCA 5D77A 1TUWA 4DV3F 1HX1A 3WNHA 1XMOK 5AQXA 3OS1A 3NOGA 1U6BA 3MTJA 2YTCA 3MM6B 4M41A 4ILLA 3MM9B 2I8EA 3MUTP 4JNEA 2YHBA 4LR9A 4WFZA 4GKKF 3LL3A 1S4EA 4CM2A 1XC9A 2NUHA 2RNEA 3KK1A 2GZOA 1IV0A 5HAOA 1S6PA 3M8PB 1NU0A 3MMVA 1KHVA 5IQQA 1BWVA 5KFVA 4FWNA 4WZMA 2XY8A 3BDPA 2AGOA 3GV5B 3C8YA 4NCBA 1S1UA 3ILOA 2NNWA 5KG1A 4CHZA 3NGUA 1B70B 3GFXA 1G6BA 5B09A 4DL4A 4LH5A 4DMZA 4U7BA 4H8KA 4CJ5A 4ZKAA 2E7VA 3E1YA 2G8UA 2XO6A 3NKYA 4PAAA 2CH5A 1I3OB 2OELA 1S6PB 4ECYA 1Q79A 2XY5A 4MDBA 4FDFA 2HS3A 5IXUA 1N56A 4J9QA 2IDLA 5I3QA 2N82B 3TNVA 4H4KC 1DTQB 3MCSA 3BQ1A 3O9UA 5J2MA 5GAGP 4P2XA 1UFWA 3VQ8A 1NGAA 2UXCK 2C2EA 2W25A 3EXCX 3O1BA 2ALZA 4AF1A 3CJTA 4E8UA 3O08A 3OR1B 4HT7A 2XMTA 2ZJRQ 3WXKA 1NPKA 1HNWF 4BRMA 1IM6A 1KAXA 3A3PB 4ISGA 3GBTA 3IN5A 4B9QA 1ZM2A 1DTQA 4NLPA 2JEJA 1N32F 5EWEA 1H0HB 3H25A 4AHRA 2QFIA 2LEBA 3TWHA 4CJKA 3P5TL 1TL3A 1OWXA 2BZ2A 3G4SN 4NXNK 2IIRA 1IVZA 3JXOA 3ZT3A 1KHWA 3NNCA 2YWWA 5HANA 3SQ1A 4S0MA 4ZPWR 2KO1A 3JSBA 2E2QA 1KN6A 3D2EB 2H48B 1HBMA 1VSFA 4FYDA 3P3DA 3AO4A 2W8LA 3C94A 2CPJA 3JS9A 3QGHA 1IO2A 2WVFA 3LWMA 3QMQA 4JKEA 4AQYF 2Q31A 3SJJA 4ED2A 4AUKA 2P9KB 1GOAA 2RN2A 1JQGA 2HZCA 2ACYA 1O1WA 1H72C 4A2BA 4I64A 3VEVA 2YWHA 3P96A 3D2EA 4DX6A 4QPTA 2QA4N 2OA8A 1NLKL 2LXIA 4NZ7A 2B9WA 1SV5A 4B3OA 1BIUA 3FBCA 2BE7D 3CG7A 4YOXA 3IDHA 1G7CB 1PJ5A 2OLWA 1HNXJ 2CJXB 3CCEN 2QYCA 1OMSA 1PC4A 1HA1A 3UN5A 2X1GA 4E7HA 1WSFA 4DL3A 2DY9A 1V9OA 1WUUA 2A2CA 4HI2A 2E9TA 2YH1A 3FNNA 2LKZA 1KFDA 1TMMA 2YPYA 5B0AA 3MAAB 2CH6A 4MK7A 1IQZA 3O44A 1LFWA 4KGMA 4LBPA 2KL8A 4ECRA 2WBNA 2XC9A 2CNLB 2WVBA 3MTKA 4Y34A 1YITS 2ZZTA 3OLAA 4KTZA 2FVPA 1BUPA 2CPEA 4M5NA 5DG9A 4LF4J 3AODA 3P1GA 2V9KA 2N7CA 4JI5J 1TK8A 1RU1A 3H90A 4C0BA 2O1PA 2YWKA 2A42A 3MAAA 1KTQA 1N5TA 3WNEA 1FKOB 1XMBA 1N5YB 4QYZJ 4AL5A 2HVEA 4DTPA 4YOEA 1SH2A 2FZGB 2H54B 2Q97A 1UKUA 3BF1A 4NCGA 1Y5LB 4X4QA 2CWKA 3OA9A 3OT9A 2XS2A 3FUYA 3NCIA 2HURA 2FVSA