1LW0A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
512
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 146
structure length 512
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw0A05
4ZVHA 1IKVA 4FJXA 4CHQA 3NCIA 4ED2A 4Z0UA 4CJRA 5KFCA 4IDKB 1KVBA 4N5SA 3C95A 3NKYA 4W5TA 3KD5E 5FDLA 3CDUA 4G3IA 4FW1A 2YNHB 2O5DA 2J6TA 2E9RX 4FLWA 5KG2A 3KLHB 5SWMA 2FBTA 1CXQA 2ATLA 2JLEA 1RT3A 4RU9A 3NAIA 4KO0B 3CFRA 4FK4A 3PW7A 3CJ5A 4ELUA 3H5UA 5I3UA 1HYVA 4FVMA 4Q43A 3M8QB 4X2BA 1D9DA 1J9AA 1TKDA 2G8IA 4Z4CA 5F8IA 2G8FA 2YNFB 5DGBA 4CFDA 1Q9XA 3HO1A 4KE5A 5F8GA 3HVAA 4LH5A 3FDSA 2XO7A 2IAJB 3IN5A 3QNNA 4XO0A 3TANA 4KHRA 4FJ8A 1JLFB 3LALA 5DQGA 4FJNA 4J9OA 2YKMA 4U6PA 4PWDB 4FLYA 3DLGA 1RT6A 1U48A 2NUBA 1KRPA 2OYQA 3WNEA 3OS0A 3I0SB 5JXSA 5KTQA 4R8UA 3SUNA 4O3SA 1T8EA 4IFVA 3OHAA 4MIBA 4CERA 3C6TA 1RBUA 3QZ7A 1SUQB 4NCBA 4BDPA 1BHLA 3LZJA 4L8RB 4B8AB 3OYLA 3ISND 3VQBA 4FJGA 3EZUA 4CF0A 1NK7A 1BGXT 4F50A 4E7LA 3HP6A 2PZSA 3QGGA 1LAWA 5J1EB 1UWBA 1SL2A 1TL3B 3SZ2A 1EP4B 2R8KA 2PYJA 3OYAA 2R2RA 3DMJB 2XGQA 1KVCA 5KFDA 2ZD1A 3PW4A 4DSLA 4CESA 2V9WA 2FVQA 3NGIA 2JEGA 2XHBA 3QEPA 2QXFA 3VQ4A 4ED8A 3T5JA 1RT4B 5SZTA 1C0TA 3ZSQA 3ZSXA 1ZBIA 4RNFA 3KK1B 3KLIB 4FLTA 4M42A 3NDKA 2VG6A 3V9ZA 3I0RB 2BE2B 1SV5B 2UVRA 2VG5B 1HQEB 1I3AA 3ALYA 4MQ3A 3IAYA 4CJ5A 3BSCA 3D45A 3OYKA 3AVIA 4CGDA 4J2BA 1U04A 5C5JA 3AVFA 4BE2A 4BE1A 3CWJA 1XR5A 3BSAA 3THVA 4B08A 5DG7A 2YNIB 2HB5A 2VWJA 1GOCA 4ECYA 5KFBA 1S97A 1IM4A 3NBPA 2F8EX 5KRSA 3UDLA 2RPIA 4LD0A 4LH4A 3ZT4A 4B9TA 4C8KA 5C24B 4GVMA 3OL9A 3M9MB 5I3UB 3V6DB 3AVJA 3HM9A 2R8HA 1SH2A 1IKWB 1IKYB 4NLXA 2B5JB 4IR1A 1S1WA 1X9WA 4JRQA 2ASDA 1JLGB 1WSIA 1HARA 5KRTA 1C1AA 2HAIA 4I2QA 5I42A 4W5OA 1S4FA 1TQLA 3IRXB 4FS2A 3VQ5A 2YNGB 1QE1A 3TAEA 4ICLB 1CZ9A 3BJYA 4C8NA 2X6NA 4FS1A 4DQRA 3AA3A 4ECVA 1S1VB 4E7KA 1WSJA 1S0OA 2FBYA 4FLVA 1RTHB 3AA5X 4KFBA 4R8UB 3PV8A 4ED3A 3V9XA 1SH0A 4K4VA 4DSIA 1RA6A 4H54A 4M3UA 4TY9A 1HPZB 3DRSB 5JUMA 4WZQA 4RW4B 3M8PB 2I5JA 3MXJA 4PUOB 3ZSOA 1TVRA 1RNHA 4ZPBA 3IS9A 1YT3A 3OYJA 3IGVA 3EYZA 2BGGA 3C6UA 2W9BB 5D3GA 3OHBA 3KHRA 3OYHA 1JLQA 2ZD1B 1VRUA 3T5LA 3SPYA 1RT7A 1GOAA 2BANA 1DLOB 5FRMA 3BGRA 4MKAA 3PO5A 2KFNA 4IRDA 2FVSA 4ECQA 2OPSA 3QERA 4KAIA 5HRRA 3CQ8A 2IGIA 2FLNA 1S9GB 4ECTA 1RBRA 4M94A 4H4MA 3ZSVA 4URGA 1RTDB 3V9WA 4OKEA 4KB1A 3QO9A 4RW7B 1IKXB 4DTJA 2FBVA 1D5AA 4C8MA 3GV5B 3PR5B 3GIKA 1VK0A 3SQ0A 3RR7A 3DLKA 3RB0A 4PY5A 2HVHA 3H59A 1S5JA 1C2PA 4M45A 4CFBA 4EO6A 4ZTJA 3TABA 3VQ7A 4CEQA 3ITHA 3WNHA 4JRPA 4K8XA 4WFXA 4FM0A 2BRKA 1WSGA 5HBMB 3QZ8A 3KMQA 1C0UB 1VSMA 4E0DA 3MR3A 1A5VA 3GILA 1D1UA 3HT3A 2ASJA 3Q8PB 4I2PB 1TKZB 3KKSA 4Y1CA 1LW0A 4NLTA 3DM2B 4KI6A 4ZVFA 4R0EA 4KTWA 1RA7A 4CGJA 1J5OA 3IG1A 2GUIA 4CEZA 3CDEA 4M3RA 4J9SA 4I2QB 2ZQBA 2UUWA 3BDPA 2IM3A 4KHNA 3QEWA 1S48A 3KLGA 1JLBA 3TQ1A 1BISA 4NYFA 4DQSA 1B9DA 2YKNB 2OPPA 2O4GA 3TAMB 1QAJA 3TAGA 4JV0A 1MU2A 1HYSA 3TARA 1T05B 4CK2A 3MXMA 4IG3B 3PHEA 4CHYA 3NH2A 4YFUA 5C42A 1C1BA 3PY8A 3TI0A 3UQSA 4KFBB 5KFIA 3TVKA 1RDDA 1BL3A 1KFSA 3C94A 2GC8A 4IRCA 1JLCB 3NHGA 2OA8A 2P5OA 1J53A 3LP3A 1ZBHA 5KG3A 1BQNB 1EXQA 4J2DA 2HVIA 4KO0A 1N56A 1S0MA 2WONA 5EDWA 4CJFA 4URQU 4FBTA 3IS9B 3VQ9A 1YVUA 3LAMA 4IG0B 1CZBA 2XY7A 4FYDA 2ATQA 5KFNA 3AV9A 3ZSWA 1JXEA 3M8QA 5HROA 4E89A 4QW8A 3HPOA 3VQAA 3SNNA 4QWCA 3GIIA 2YNFA 4CHNA 4BDZA 3EZ5A 4IOBA 2JEIA 3ISNC 4Q5VA 2V0NA 1IG9A 4CK3A 2BQRA 3H40A 2G8WA 4LSLB 1JLFA 4CJKA 1RAJA 3T3FA 3BQ0A 3L2WA 3KKRA 1F21A 3DOKB 3I0SA 3OL8A 1JLAA 2AGOA 5DK5A 2WB4A 2UVWA 3PUFA 1QHTA 3NF7A 5KFTA 1A5WA 4FXDA 5KFUA 2PYLA 1SUQA 5F9LA 2QKBA 5J2NB 4Y3CA 2HW3A 3BREA 3SUQA 3HVRA 4R5PA 1RT5B 3PX4A 4LQ9A 5J1EA 3JSMB 3LP0A 1TL3A 1HYZA 1EP4A 4XIUA 2G8KA 4DSJA 4KB7A 4CF2A 3K57A 3DMJA 3AO3A 3VQDA 3QIDA 5KFVA 2DFEA 1TKTA 3SCXA 1RBTA 3M9OB 3PR4A 1B92A 3NH1A 2LSNA 4PA1A 4H4OB 3FFIB 3OYCA 2UUTA 1RTJB 1NK9A 3NGYA 3VQQA 4QW9A 4GC6A 4ZMMA 3S3MA 3L3UA 4YQWA 2BR0A 4NZ0A 1RT4A 1WSHA 1ZTTA 2HNZB 3KK1A 3HKWA 5F9NA 4NLRA 3I0RA 4O55A 5CZ1A 1NJXA 3I8DA 2QKKA 2VG5A 1HQEA 3V4IB 1UOCA 4FZXC 1C1CB 2C2RA 4AHCA 3NL0A 3PW0A 4JUZA 5KT4A 4F4KA 4CJLA 3BSNA 2J6SA 3TR8A 1RDCA 4MFBA 5T7BA 4DTRA 3NH0A 5KFQA 3S3NA 2IMWP 3AA4A 4OGEA 1KLMB 2YNIA 5KFSA 4QCLA 4FK0A 2WRMA 1NOZA 2XI3A 4FZZA 3PW5A 3KIOA 4XPEA 5L1IA 1TK5A 2AX1A 5C24A 1SKWA 1LW2B 2WONB 1NK6A 1XR6A 2YHAA 3V6DA 3VQCA 1RT2B 1QQCA 1IKWA 1IKYA 3E01B 1B9FA 4KB0A 5HROB 3MF5A 2B5JA 2WHOA 4I9QA 3KHGA 4CIGA 4ECUA 1JLGA 4DEZA 4O3OA 1TKXB 4RNOA 3KK2A 3SI8A 3V1OA 1YVFA 3IRXA 4CJWA 4B9UA 4XPCA 2YNGA 5KFRA 3D5MA 1LWFB 4TQSA 4F4YA 1KLNA 4ICLA 4CGHA 5E41A 5HLFB 2FJWA 1S1VA 1T94A 3I5CA 2JC1A 3OVNA 3BQ2A 4EBDA 2XC9A 1QTMA 5K14B 3QIPA 1JLAB 1RTHA 2HMIA 1GOBA 5J2MB 3F73A 1XC9A 5C25B 4ZP8A 4BE0A 3Q8RB 1NKBA 1HPZA 2WCXA 3DRSA 4ED0A 4DTMA 2G8UA 3GIMA 3S3OA 4K4UA 4RW4A 4CCHA 3M8PA 4FJ5A 4R5PB 1HJRA 4PUOA 4CEAA 4B3OB 1DTQB 1HMVB 3QEIA 2VG7A 3LP0B 1SKRA 2HNDB 4O44B 4QPXA 4CGGA 4KI4A 4RNHA 4KRFA 4IH7A 3CO9A 1NJYA 2W9BA 1TKTB 1BCMA 4MIAA 2ALZA 2J6UA 2OPRA 4RNNA 3QEXA 4Q0BB 1DLOA 1K6YA 4CIFA 2ZE2B 1VSFA 3V6HA 2R8JA 5KFJA 2X74A 1WN7A 2Q3SA 2VWKA 5DLGA 2XWYA 4J9QA 2KFZA 4HUEA 2RF2B 4WXWA 1S9GA 4KKOB 1L3TA 1RTDA 4ED7A 4RW7A 1IKXA 4Q8EA 2DPIA 5KI6A 4TN2A 3OSNA 3TAFA 1S0NA 3CIZA 4QAGA 4CJTA 4M3ZA 4Z4FA 1S49A 5DQIA 3H2LA 4MFBB 4CEBA 2ILZA 1FKOB 5KFWA 3CFOA 4AHRA 3AVLA 4O3NA 3MFHA 2IM0A 5HBMA 4JV2A 5EU7A 1C0UA 3KMSA 4I9LA 3BSOA 4DTNA 5KFKA 3NAEA 3MXIA 2IC3B 1T7PA 3OYEA 3MFIA 4J2AA 1BQMB 4ID5B 3OY9A 4PQUB 1SKSA 4I2PA 1TKZA 5KG4A 1HNIB 4TYAA 3SV4A 3DM2A 4ECSA 4RNMA 4ZP7A 4LQ3A 4H8KA 5F8LA 1U47A 5J2QB 5JS2A 2F8TA 3KK2B 4Y1DA 2KZMA 4NLOA 3DOLA 1S1TA 1VRTB 2CJQA 3SV3A 3HHKA 4MH8A 2XY8A 2KQ2A 2YKNA 3TAMA 4OL8A 3HP9A 2DFFA 3V81B 4HUGA 4F2RA 1T05A 2D5RA 4AHSA 4DU4A 5KFFA 3LDSA 4DSEA 5L1LA 4E7IA 4IG3A 3L2RA 3HXMA 3QIPB 3PZPA 2HMIB 2FBXA 3EPGA 4B8CA 4O4GB 4ECXA 4EP5A 4WFZA 4ZVEA 3V9SA 3P1GA 4O3QA 5DQHA 1JLCA 4CEFA 4O0JA 4HVJA 4CJVA 1S1XB 5F8HA 4WYLA 5F8JA 4NLPA 4IKAA 1BQNA 5KG5A 1KTQA 1JKHB 1Z25A 4RZRA 3AO4A 1ZBLA 2VG7B 2HWHA 4G1QA 4DWIA 5KG7A 4DS5A 4KHWA 1RDBA 3HVTB 4IG0A 4FCYA 3HL8A 3OL6A 4CF9A 2AWZA 2IA6A 5HRPA 2YV0X 2OPRB 3NE6A 4M3XA 2A1SA 3L2UA 1Q9YA 3Q8SB 4NLYA 5CZ2A 1WNSA 4DL4A 1UA0A 3H5YA 3MR5A 4LSLA 3O4QA 4NRUA 4CEOA 1KHWA 2Z1HA 2YHBA 3DI6A 3G10A 3DOKA 2FVCA 4CF1A 4RW9B 1ZYQA 3TAPA 4OVLA 4FJKA 4N47A 5J2PB 1ZBUA 3BR9A 2IM2A 2I1RA 2BDPA 4MK9A 5J2NA 3AVAA 4LY7A 3OYDA 3D28A 1Q8IA 1T03A 3MEDA 3H4BA 2KTQA 3CJ2A 3L3VA 4KHSA 1RT5A 1BI4B 3JSMA 4TY8A 1TL1B 1UA1A 3PX6A 4ED6A 2JC0A 5EWFA 2HNYB 4AHUA 3K59A 3SQ4A 3ZT0A 3AO2A 4FZYA 1C0MA 4HTUA 2B4JA 3NGZA 3O4NA 4KAZA 3T5HA 4HHTA 1EETB 4Y34A 3RAQA 3ZT1A 4H4OA 3FFIA 4LSNB 4OKJA 1RTJA 1HQUA 1TV6B 4TQRA 4C8LA 1REVA 3KJVB 5KFXA 3QLHB 3RMCA 1W9HA 3RRGA 2RKIB 4E1MA 1S1UB 3O3HA 3Q8QB 4NLGA 1WSFA 2HNZA 3DOLB 2EHGA 1S1TB 5KFAA 3O3GA 3K5NA 3ICLA 3MECB 3T1AA 3MEEB 2JEFA 3V4IA 3N6NA 1U4BA 3LANA 1C1CA 1TK8A 1R0AB 4CGFA 2F8SA 3AO1A 3CDWA 5KFYA 4IR9A 5EWEA 4RW6B 4DFKA 2Y1JA 3ZCMA 4YP3A 5CYMB 2CKWA 5DGAA 3QETA 5FRNA 3AVBA 4EZ9A 1KLMA 1ASWA 3NF6A 1HRHA 3RR8A 4MK8A 3G6VA 2B6AB 4BACA 3NF8A 2D3ZA 4NCAA 4G1QB 2BQ3A 1LW2A 1KFDA 4ZHRB 2Y1IA 1RT2A 3GV8B 2QV6A 1SL1A 3DLEA 3E01A 2DTUA 4DMNA 4TXSA 4IFYB 4K4SA 1IH7A 2DPJA 2IJFA 2ETJA 1TKXA 1VSKA 3V6KA 3AVGA 2AGQA 4K4YA 4DL2A 2HHTA 4U7CA 3PJXA 1LV5A 4K8ZA 2EX3A 4DU3A 4M3WA 1LWFA 2W7OA 5HLFA 2FJVA 1I39A 3DI6B 4DU1A 4EYIB 4K4TA 3V1QA 4IH6A 3QGHA 4FLZA 5K14A 4DS4A 4RW8B 2RDIA 4Q8FA 5J2MA 5C25A 3K5MA 3DLHA 3I5AA 2C22A 4DG1B 3AVNA 3CJ3A 4K4WA 5F8NA 2GIQA 1NHUA 5T14A 1T03B 2F96A 3MEDB 4DQQA 4DSKA 4F8RA 4I7FA 3FRZA 3G86A 3DYAA 4N41A 4B3OA 1DTQA 1HMVA 1ASUA 4MKBA 5DG8A 4TY8B 3KLEB 4B9SA 2HNDA 3QNOA 4O44A 3PX0A 3OYNA 4KHQA 4NLQA 4WXOA 4CHPA 3SI6A 4Z4EA 3KLFB 5L1KA 3ZSRA 4F4XA 3WNFA 2R8GA 1NK0A 4HCBA 4O5BA 1NK8A 1RYRA 1O1WA 1GX6A 2WTFA 4Y2CA 1HQUB 4Q0BA 3AO5A 1KVAA 1REVB 1BIZA 2ZE2A 5KT3A 4O0IA 1U45A 2WOMA 4JV1A 4HUFA 4QWDA 1ZTWA 1X9MA 3GIJA 2R8IA 4C8OA 2IS3A 2JGUA 3LP1A 4B9VA 1JLEB 1BIUA 4TSXA 2RF2A 4EBEA 1JX4A 3OJSA 4KKOA 5DLFA 4Q45A 2B43A 1X1PA 4E19A 2DFHA 3DRRB 3CM6A 5HP1A 3KHLA 1UAXA 3UR0A 4ECWA 4NYZA 4ECZA 4MK7A 2FLLA 1Z4UA 4DL6A 1Z26A 2AU0A 3S9HA 3GYNA 4NLWA 2GBZA 1ASVA 2W9CB 1L3VA 1VSJA 4QOZB 1FKOA 3LZIA 2A1RA 2HHSA 5KFPA 4QWBA 4CIEA 3E51A 4URSA 4YR3A 4CE9A 4B9MA 3RAXA 2HHQA 2W8KA 2ASLA 2VA3A 4WE1B 4OPKA 4FW2A 1NOYA 3OSPA 2IC3A 4M41A 3UPFA 1RT1B 1RDRA 4E3SA 3FSIA 3DDKA 1BQMA 4ID5A 3MTKA 4DTSA 4PQUA 3KLVA 3B6OA 1QS4A 2V4QA 3H4DA 5JS1A 3DLEB 1IO2A 3H5XA 1HNIA 3H08A 3KOAA 1WAFA 1CSJA 1TP7A 3K2PA 4EEYA 1FK9A 4N56A 2G8VA 3TWHA 3JYTB 3QIOA 1EX4A 2BRLA 5J2QA 2E4LA 3U3GA 2W8LA 4BDYA 4NLSA 1LWEB 4BWJA 4ECRA 1VRTA 1XR7A 2W7PA 4CFAA 1S6QA 3LWLA 4RUCA 1S10A 2UVVA 3V81A 4IKFA 1HNVB 4W5RA 1RTIB 3P5JA 4TYBA 2FVRA 4ZTFA 4B9LA 2E6LA 1QSYA 4DTOA 4GMJB 4IH5A 4J9LA 1NHVA 3NF9A 3AVKA 1VSDA 4F2SA 4GC7A 4ZVGA 3K5LA 4O4GA 3ASMA 4YR0A 4B9NA 4OPJA 4OGCA 3RWUA 4CJUA 2O4IA 3KK3B 3M9NB 2R7YA 1S1XA 4I7FB 5EWGA 1MMLA 3DYAB 1QSSA 4F3TA 1JKHA 4M95A 1N4LA 4FJ9A 3HJFA 3QYYA 4EBCA 4FJ7A 3AVHA 4M3YA 2WK4A 3HVTA 4KREA 2FC0A 3PO4A 4HKQA 4KTQA 1L3SA 1J54A 2ZKUA 2P1JA 4KHYA 4KBIA 1A5XA 1GX5A 1LAVA 3VA3A 5L1JA 2WOMB 2IBKA 3PVXA 2D0CA 4KHMA 1TGOA 1YTAA 3LP1B 1OS5A 4DQIA 1SH3A 3QINA 1N6QB 4DTXA 3DRPB 1VSLA 2FVPA 4AILC 4CGIA 1G15A 5CYQB 5HP1B 4RW9A 1N5YB 3H98A 1JL2A 1RBSA 5J2PA 3RBEA 2P51A 2W9AA 3VQPA 4O4RA 3LWMA 4YR2A 3SUOA 2D7SA 3CJ4A 5KG1A 4CJPA 4UQGA 1Y97A 3CFPA 3U3YA 3SFGA 3OYIA 2E9ZA 3KHHA 1NK5A 4CJ3A 1BI4A 4ZPDA 4WYWA 1KHVA 4ZPCA 1TL1A 4FJJA 2C28A 4NCGB 3V6JA 4F4ZA 4Z4GA 2AJQA 1IKVB 2HNYA 4NLDA 2HWIA 4FJHA 1D8YA 4J9PA 3G0ZA 3SPZA 1RCHA 5FDLB 1EETA 2G8HA 2E9TA 2X78A 4FM2A 4LSNA 4DL3A 1C6VA 1FK9B 2Z1IA 1TV6A 3KJVA 3BQ1A 3QLHA 1RT3B 3V1RA 4Q44A 2RKIA 2XY5A 4KHUA 1S1UA 2XGPA 3VQEA 3HPHA 1S6QB 4W5QA 3SFUA 4F3OA 5KFGA 4K4ZA 3MECA 2D3UA 1KSPA 3MEEA 4AHTA 3G6XA 4DFJA 3WNGA 2C2DA 4ELTA 2ITGA 3P83D 1R0AA 4CEEA 3NMAA 3N6MA 1I6JA 4RUAA 4O3PA 1ZBFA 4AH9A 4DLGA 1NJWA 1S9EA 3DLBA 4RW6A 4JS5A 2RDJA 1S6PA 1S9FA 4FJLA 4J9RA 3AA2A 5CYMA 3OLAA 2YKMB 3TAQA 5KGWA 3RRHA 3DLGB 1RT6B 2Z1GA 4CFCA 2AX0A 2B6AA 2D0BA 3OLBA 3ZSYA 4K50A 4IFVB 4JS4A 3O3FA 3C6TB 4ZHRA 3LP2A 4CJEA 3NGDA 3LAKA 3QESA 3K58A 1XI1A 1SL0A 1QAIA 4CJSA 3OYGA 3AVMA 4IFYA 4J9NA 2AQ4A 3HVWA 4NRTA 2ILYA 1UWBB 1JIHA 2QK9A 4Z4IA 2OPQA 5KFHA 4FK2A 1RBVA 4QWEA 3H5SA 3OYFA 4OJRA 4HCCA 3G6YA 1XHXA 4Z4HA 4KSEB 5DMRA 4EZ6A 3RB3A 1NK4A 1NKEA 4YNQA 1WNEA 3A2FA 3QGIA 1KCFA 3RB6A 1NKCA 1VSEA 1W0HA 4RW8A 2W42A 1C0TB 4CEDA 3HSTB 1D9FA 3CM5A 4OKKA 2VG6B 2EC0A 1RDAA 4EO8A 5HRNA 4DG1A 2R2SA 1BCOA 3RMDA 1VSIA 2IOCA 3RMAA 4DF8A 3HYFA 1L5UA 1ZETA 4CJ4A 1K1SA 3HK2A 3KLEA 3MAQA 1W25A 5KG6A 2KZZA 5EUHA 4F4WA 2HHWA 3IGNA 3M8RA 3MEGA 4KTZA 3KLFA 3T5KA 4DL7A 1K1QA 2HHVA 4FLUA 3NBPB 2HHXA 1EKEA 4ZPAA 3N6LA 4J2EA 3CYMA 2GV9A 4O3RA 2Z1JA 5KT2A 3I5BA 5KT5A 3ZT2A 3HPGA 4DFMA 3RMBA 3KD1E 1JLEA 4FBUA 1NJZA 1DTTA 5KFLA 4JLHA 3SQ1A 1ITGA 4DTUA 1S1WB 1QUVA 4J9MA 3CVKA 1XHZA 1X9SA 4ID1A 5KFMA 3OS2A 2R2UA 3DRRA 3EY1A 3QEVA 1CLQA 2VA2A 3GV7B 5I42B 3SQ2A 4KV8A 1S9EB 3VQSA 3ZSZA 1S6PB 1FKPA 3KTQA 4N76A 4CF8A 2DY4A 4FJMA 1QE1B 4IRKA 3VA0A 1TAUA 2XI2A 3VQ8A 2OZSA 2C2EA 4DTPA 2W9CA 3KNAA 4HYKA 1WSEA 1VSHA 4CHOA 2P5GA 1LWCA 2PY5A 4WE1A 4CHZA 3K5OA 3M8SA 1RT1A 1U49A 2BQUA 3LP2B 4IDKA 2XY6A 4NYNA 4QWAA 2YNHA 1D0EA 2I5JB 3U6FA 2QE5A 2OH2A 3KLHA 4ZP6A 3MR2A 3JYTA 3FQLA 5KT6A 3OL7A 1JXLA 4FJIA 3L2VA 2OPQB 2GIRA 3GQCA 4RG8A 1TVRB 4KPYA 2X6SA 1T3NA 1RILA 1U09A 1LWEA 3MR6A 4CECA 3C6UB 4CK1A 3RBDA 5D3GB 4WFYA 1JLQB 3DLRA 5CY4A 4ELVA 2KW4A 1XWLA 3ZT3A 2IJNA 1VRUB 1HNVA 1RT7B 1RTIA 3L2QA 4EYHB 2BANB 5KFOA 4OLBA 3BGRB 2IAJA 3SYZA 2JEJA 2OPSB 5KT7A 1QSLA 1JXBA 2HHUA 3D0PA 2IDOA 4H4MB 2V4RA 4EP4A 3AVCA 2XRIA 4DSFA 4PWDA 4K4XA 3LPUA 3NAHA 3QO9B 4DQPA 3OJUA 3CJ0A 5DG9A 3KK3A 2OZMA 3SUPA 5HRSA 1N48A 3DLKB 3VN5A 4DF4A 4IBNA 3OS1A 4FLXA 3RTVA 2D41A 3L8BA 4IQXA 3B6PA 5KG0A 4CJQA 3F9KA 3ITHB 2R2TA 4W5NA 4DL5A 2AGPA 3MEGB 3OYBA 5KFEA 4TLRA 1YTUA 3ULDA 4Y2AA 5L9XA 5FROA 4E1NA 1RYSA 1FXXA 4NLVA 4ZP9A 4YMEA 4E7JA 2FLPA 3LPTA 1TAQA 1L3UA 4ED1A 4AHVA 3SJJA 2UVUA 4J9KA 1DTTB 1LW0B 1N6QA 1NNDA 4FM1A 3CG7A 1JL1A 1WLJA 3DRPA 4BWMA 1J5OB 3UIQA 3IG1B 5CYQA 1CXUA 3PJWA 1N5YA 3V9UA 2RN2A 4DLEA 2FJXA 1TK0A 2IM1A 4KV8B 5F8MA 5KGXA 3NFAA 5KFZA 1FKPB 3KLGB 3KLIA 1JLBB 4OLAA 2OPPB 2BE2A 3T19A 1SV5A 4E7HA 3RB4A 2D0AA 1MU2B 3VQ6A 4GW6A 1HYSB 2E6MA 4NLUA 4DFPA 2XCAA 3OYMA 4M3TA 3FQKA 3EPIA 5C42B 1LWCB 3PW2A 1C1BB 1WAJA 4WZMA 2XCPA 4NCGA
chains in the Genus database with same CATH superfamily
2GS8A 1U25A 1VMBA 4ZVHA 3LM9A 2VQEK 1LCUA 3WX4A 3RW6A 4ISFA 4CJRA 1XERA 2DR5A 3ZZPA 3KD5E 3UFCX 1X4CA 3UCZP 4G3IA 3FK4A 2POKA 1YX2A 2W6LA 3KLHB 2ATLA 9RUBA 1RT3A 3CFRA 4H0OA 3PW7A 4ELUA 3H5UA 5I3UA 5GAEP 1QVFM 5ETLA 5JICA 1J9AA 2BW7A 2G8IA 2M70A 1GQEA 5DGBA 1UMJA 2FQQB 3R5DA 2X1FA 4LH5A 3HVAA 2QMUB 2VQFJ 2FJAB 2MZQA 3OW2R 1CJUA 1UZDA 3CC7N 2BVZA 3D6MB 2AJFE 1PKUA 1ZM2A 2CQIA 3CIMA 3Q22A 3HSGA 4XO0A 3VESA 4KHRA 1VIOA 2Y8WA 2OUGA 1V5IB 4FLYA 4OZ1A 5BREA 3KUEA 3AXKA 3JXUA 5E84A 1KRPA 4J5OA 5JXSA 3KHYA 5CD4H 5HSPA 4Z7YA 3IKMA 1T8EA 2LQBA 1H3DA 1TU0B 4MIBA 3QZ7A 1OPIA 4CLLA 4NCBA 3TX0A 2BKOA 1BHLA 3OYLA 3ISND 3IO1A 2X7IA 3EZUA 2Y0SD 4JI5F 1RKJA 1MN7A 3SQGB 1NK7A 3EGNA 3OTCA 2VL1A 3HP6A 2PZSA 3QGGA 2IIRA 2ALYB 5JLFA 2IVFB 2PYJA 3GE1A 2VB6A 3OYAA 1KVCA 2PEHA 3ONQA 2GW8A 2ZD1A 3W8PA 4CLTA 5KPTA 3IWXA 2FVQA 3BM7A 4WIIA 4DX6A 3M2UA 2DHSA 2Y9HA 2NREA 2V2VA 3A8KA 3MMAB 1RT4B 2JL9A 3ZSXA 4RNFA 3I55S 2HS4A 4MDBA 3KLIB 5CCMA 1XMOK 2UVRA 3AHPA 1I3AA 2KDOA 4MQ3A 1FERA 4CJ5A 4JI6F 4OX6A 5HJYA 1NGCA 3A5NC 1X4HA 4LFAK 3PFEA 3IAS9 2O8EA 1S76D 5C5JA 3HKZD 2ZJQQ 3S6EA 2EFNA 4HTLA 1KP6A 3R27A 5DG7A 2FZCB 2FB0A 3CQXA 1S3XA 3UDLA 4FPIA 4LD0A 3ZT4A 1GLFO 5LJ3Y 3L4QA 3OL9A 4Q2LA 4E98A 3LDPA 4JHDB 1YBAA 4JRQA 3W8GA 4X62J 4DPOA 2NXUA 2HAIA 5D4PA 5I42A 3P49B 3C6HA 3V5RA 1S6OA 1U2RA 1WKKA 2JZ5A 1SBRA 2G1HA 3P3DA 4FS1A 1OVYA 2CJ9A 4DQRA 1S1VB 1V3SA 1U1MA 2EPIA 1R8HA 4E7KA 4GRSA 1S0OA 4EK2A 4V19S 2RH3A 3J7YI 4FLVA 3CPWR 1RTHB 4BC5A 2YWKA 4ED3A 1D4XA 1CEZA 4GO5X 1HNXK 1YLXA 4H54A 5HVFA 4ENOA 1HBMA 4TY9A 3UKRB 1H2UX 2EG2A 1SJ1A 4RW4B 3BB5A 4JV5K 2YI1A 3MXJA 4FF2A 4F3MA 1YBTA 2VQEF 4HH0A 1NGIA 3M2RB 4YDUC 2ROPA 3MPVA 1Q86T 2ZZNA 1T9XA 3UD5A 4ZPBA 1YT3A 3VGTA 2HBQB 3EYZA 3C6UA 2VC1A 1XNQK 4F67A 2E1PA 3T5LA 1RT7A 3P5BP 3SCJE 3CXCM 1J27A 2XMAA 4JD2B 2BANA 1FWPA 3PO5A 3IM8A 2KFNA 4CZFA 4KAIA 2KO1A 1W97L 3OR2A 4RJVA 1M5HA 2IGIA 4BC9A 1S9GB 4ECTA 4M94A 1RBRA 4H4MA 3ZSVA 1RTDB 1DAXA 1Z6RA 4DTJA 1TUWA 1IKXB 3IR5B 4PKGA 4ILHA 3PR5B 5MLCQ 2B56A 4JK9A 2YX6A 3DLKA 4H4KA 2HVHA 2R7SA 3CDAA 1S5JA 4LSZB 4ZTJA 3CCQN 3ITHA 3K0JA 1WG4A 2GQCA 4FM0A 2KH9A 3EKUA 4CIOA 3KMQA 1BA0A 4I6WA 3R5GA 1VSMA 1PAEX 4H0TB 3MR3A 4PEOA 4JB8B 4BRDA 2EK1A 4AXJA 3NMUA 4V1Ak 4UUXA 3D68A 3BR8A 3DM2B 2B4UA 3FBEA 1VQ9S 3Q23A 3MMCA 2DR7A 2RE2A 3CDEA 3DXKB 2UUWA 3BDPA 1T9VA 4JI3K 1JLBA 3TQ1A 4DQSA 4D3HA 2OPPA 3TAMB 4JV0A 1MU2A 5IOLA 1G7CB 5B0CA 1WJ9A 2QMWA 4CK2A 2PA8D 4P7VA 4AL5A 4NXMJ 1WDDA 4IDHA 3PHEA 3R7SB 4HL9A 3TI0A 5KOWA 4P2SA 1BL3A 2AJ4A 4A8MP 2DNNA 2BEFA 3EZOA 3PIPL 1N34K 4A47A 3E8OA 5CABA 4LFAF 2LXFA 3JAMU 2OA8A 2DISA 3DLJA 4CTAB 2P5OA 4HTJA 4WQ5A 2PI5A 4J8FA 1EQ0A 4BY9C 1WI6A 2HVIA 2HVDA 4KO0A 5AQYA 4LF2A 4CJFA 4URQU 3QATA 4B3MK 5DO2A 3LAMA 3AV9A 3M8QA 2V2ZA 3HPOA 1BUPA 1NBEB 4LFCK 2YNFA 5HMZA 1GLCG 4IO9L 4IOBA 4BRQA 1DBDA 3TTDA 4KH4A 4QR2A 1IG9A 1SAZA 4QIEA 2G8WA 4JBCA 1JLFA 4GY2B 4CJKA 1U6BA 1GTEA 4OYWA 3T3FA 3G82A 1VQ5N 4G9ZA 1Q82T 3M4XA 4Z2XA 1IBKK 1FXRA 1JLAA 2Q36A 3LDLA 4FWMA 1QHTA 5KFTA 1A5WA 2EFQA 2XSFA 3CCTA 4UT4A 2QKBA 2XMUA 5J2NB 4Y3CA 1EIYB 3K2YA 2HW3A 3P96A 2MKJA 4R5PA 5DDRC 4AL6A 3VEXA 4B1XB 1YRTA 4B3SJ 1HNXF 2P9UA 2IHR1 3LP0A 1HYZA 4XIUA 5A8WA 2G8KA 4MMOA 4KB7A 2UV8A 5GADI 2IRXA 3R6LB 4JV5F 4DR6J 5KFVA 4DV6J 3BGFA 2ZJPQ 2GUPA 2CZ4A 3M9OB 1B92A 4PA1A 5K5MA 1NK9A 3NGYA 5DDOC 3GFYA 4RX6A 4YQWA 2BR0A 4NZ0A 1HWLA 1XNQF 3OPKA 4YHHJ 3HKWA 3MMVA 3GU0A 3WXLA 5CZ1A 2Z30B 4DR3J 3I8DA 1FRLA 1R0CB 1HQEA 5AQUA 3V4IB 1QJHA 4UZCA 3HCXA 2C2RA 3JXOA 2A2DA 3PW0A 5GAHU 1WOOA 4A2BA 3P4UB 5AE1A 2BBEA 4HLBA 1D8ZA 3VGVA 3HSZA 3HHLC 4GV3A 3C2PA 5EXWA 4HACB 1RWXB 2X1GA 3VWSA 3OUYA 4Y65A 2ZH9A 3AA4A 4OGEA 4GVBA 5KFSA 4CH0S 1U0HA 4FK0A 3NGTA 1U2FA 2E2NA 3SBMA 4WWSA 4RBUA 5M1PA 5L1IA 2AX1A 4ZVSB 3SK3A 2WONB 2F7TA 3VQCA 1RT2B 4M5HA 2H5IB 1IKWA 3SCIE 2CG8A 2DGQA 3MF5A 4M1KA 3TUZC 4CIGA 1F9EB 1V6HA 5AJ3K 4DEZA 3SI8A 2BUNA 4USUA 2XBPA 4M8LA 1X4EA 3IRXA 2DB1A 4XPCA 2PFFB 1QD1A 1RWKB 4TQSA 1KLNA 2YQ3A 4ICLA 1KDNA 4CGHA 3OV7A 5E41A 5HLFB 3BO4A 2KXNB 3OVNA 1ULRA 3BQ2A 4JI3F 2W25A 5K14B 3ZTSA 2I8EA 2DHHA 5J2MB 2AT1B 3Q8RB 2AJ0A 1NKBA 2GQ2A 1HPZA 1ZPWX 3VAFA 3GIMA 2X3DA 2LLZA 1URRA 4XH5A 4CCHA 3FKBA 4DR7K 2Z8QA 1AXQA 5LL6Z 1N0VC 4ES2A 4NEYA 3VEZA 1HMVB 2XMJA 3ISZA 3QEIA 4C6AA 4JKDA 1N34F 2LECA 4PXCA 1J5EK 5A2QU 5G0RB 1OH6A 3CO9A 2LFVA 2W9BA 1UEVA 2J6UA 1WBBA 3NNHA 3IBCB 2RILA 3SSSA 4B3MF 2ZE2B 1DKGD 1M1GA 2VWKA 3LTOA 5DLGA 3BN7A 2HBZB 4OFZA 4WXWA 1UJ5A 3BYRA 3HTVA 2CQ0A 1YJWN 4RW7A 4Q8EA 5EGYA 3LQVA 3R5CA 2ZJRQ 3CDBA 3O6WA 2D74B 3WC2A 3M30B 1C4AA 3L7UA 1DY3A 3TAFA 4CJTA 2LQ5A 3O44A 3MGJA 3H2LA 2E66A 2ILZA 2OSRA 1IBKF 3BZQA 3CFOA 1EX8A 4AHRA 4QYZJ 4O3NA 1U7LA 2IM0A 4G65A 4RPFA 4JV2A 3CQYA 3KMSA 4I9LA 4KYZA 1RWUA 1T7PA 4M5IA 4PQUB 2YKPA 3CCUS 2ZVIA 3AGRA 3KWIA 4BREA 5KG4A 3I55N 1HNIB 4TYAA 2FC8A 4ECSA 2C3PA 4DR5J 4CD3A 4LQ3A 2OAUA 5JS2A 1UW9A 4ZK7M 2KZMA 3BY5A 1H98A 2V8VA 1M5VC 1DJ0A 2HQIA 3CULA 1XN9A 2HF4A 2FJBB 3VR1A 4OL8A 2H4WB 3MHYA 2K06A 1E6VB 2ABYA 4ZVTB 1K73O 1T05A 3VAMA 4DU4A 2M3DA 3N5BA 3W64A 2A40A 1UJ4A 3HSJA 3QIPB 3PZPA 2HMIB 1MROB 2FBXA 1WELA 4B8CA 1GEHA 2MQ8A 5AXLA 2OD6A 2VQFK 4JKGA 3I6PA 4WFZA 1G4CA 4MDAA 3THWA 2V8DA 4CEFA 4ZLLA 4IKAA 5KG5A 2PMHA 2M88A 4I4BA 3ZZYA 2V67A 2ZNZA 5KG7A 4Y0FA 2MQMA 4KHWA 3RSEA 4IG0A 4FCYA 4CF9A 2J5AA 2IA6A 4I6YA 4TVAB 2YV0X 1ILYA 4L72B 2HF3A 1FJGJ 4OI1A 4M3XA 1N32J 5LY3A 4DN0A 1EJ7L 2GO9A 2EFOA 5TKWA 3DOMA 2ASYA 1MWYA 2VPYB 4DL4A 1UA0A 3AQOA 1YJRA 2PBDA 2F1FA 3MR5A 2G2OA 2LDIA 5AQKA 1DURA 5AJ3F 2FJEB 1KHWA 2Z1HA 3GB0A 1RTZA 2BV3A 1PO6A 3G10A 3O9UA 4H5TA 1ELOA 2F4VJ 4RW9B 1ZYQA 4DUZK 2GAGC 4FJKA 4IWVA 5AQVA 4Q2MA 3W60A 3EM1A 3FCHA 2HGNA 3AVAA 3OYDA 2DNHA 4ZJLA 1F5BA 2QX0A 2B9EA 4KHSA 4USIA 1BI4B 1ESVA 3A4TA 2E88A 1TL1B 1L3KA 5DM6L 1UA1A 4ED6A 5D4LA 3CTRA 2XZTB 4AHUA 4NZ6A 4FZYA 1FDBA 4L3NA 3OFHA 1VQSA 4KAZA 2GEMA 5E0OA 4Y28C 4CZEA 4M5NA 5LMNJ 1J5EF 4UY8O 3Q8VA 1TV6B 4P9SA 3PRBA 5KFXA 2JLGA 2FZKB 3CCSS 2AIRB 1W9HA 3M8WA 4E1MA 1S1UB 1VR6A 3Q8QB 3X1LB 2HNZA 3DOLB 2EHGA 1S1TB 3MECB 4LF5J 3G96A 5JVHQ 4WQ4A 3N6NA 2ZH6A 2CQ4A 2HQGA 4LBPA 1SJQA 2MZTA 3AA8A 4IR9A 3N79A 1S7HA 4RW6B 2BJ3A 1WG5A 3OFEA 4X62K 1JJHA 1RAFB 1P9QC 1SQGA 2VBYA 3ZCMA 4PRFA 4FWSA 2V7ZA 2CKWA 3QETA 5FRNA 3D7EO 1T9UA 3H3NO 1KLMA 2AJ2A 3NF6A 3UKUA 3RR8A 2CG4A 2WB1D 2B6AB 1OVQA 1CZAN 3IMXA 3U1MA 4JKCA 4G1QB 2BQ3A 1LW2A 4EFAC 5IZHA 1KFDA 1T02A 4XDCA 3GV8B 1T11A 1SL1A 3DLEA 2QN6B 2DTUA 2W4DA 3O9QA 2H5JB 3AT1B 1FRIA 2IJFA 4DU7A 3GDQA 1XNRF 4HHUA 1ICEB 5A8RA 3AVGA 5HMXA 2EBGA 5AZIA 2O8CB 1PAUB 2DNQA 2IVYA 3FZMA 4FYVB 1VLOA 4NXNJ 3OTOK 3MD1A 2P9PB 1S57A 2AF6A 2FJVA 3DI6B 3PEHA 1SKUB 2CRLA 4JKBA 4DU1A 4EYIB 4FLZA 5DZ6A 4OHZA 4F0HA 2RDIA 5A2QY 4U95A 2YQ0A 5CHCB 2C3OA 2HKEA 3AVNA 3W3SA 4K4WA 2DGVA 1T03B 5H9EJ 2YXLA 1HBOA 4I7FA 2W24A 5DM7L 5C2CA 2VQFF 4A62A 4MKBA 5FIIA 1VBXA 4WCEL 3X3UA 2HNDA 3H25A 3CC4N 4CHPA 3SI6A 1QDUB 3IWNC 4H5NA 3HX9A 4K8RA 5L1KA 1AFJA 3WNFA 2R8GA 2IYGA 4X4PA 2B9XA 2MLYA 2ROEA 4WPAA 1HQUB 4O0IA 5ADXA 2JGUA 3LP1A 1D3WA 1FT8A 1OY8A 1JX4A 2D0OA 4BR5A 3M6VA 1OH8A 3UD3P 1X1PA 3DRRB 4OZ3A 5HP1A 4ZVOB 3KHLA 2P5VA 4ECWA 2GNKA 2MSSA 5M1KA 5KQ8A 2FLLA 1Z4UA 2M4MA 3QT5A 3S9HA 3KUGA 3POTA 3EXCX 1FRMA 1ASVA 1L3VA 4OIXA 4QWBA 2HOEA 5AQMA 2R7WA 3E51A 5AE2A 3W9HA 4CE9A 4H03B 4NA2A 1HLUA 3OSPA 1VQMN 1XMQJ 2IC3A 1KAZA 2WVBA 2DT9A 4MTPA 3BO2A 2RRBA 4OZ0A 2XLJA 4NXMK 4ID5A 1P6TA 3MCSA 4LRBA 5JS1A 3LH2S 2ZF5O 2YPZA 2PGCA 1CSJA 3N28A 4BGAA 5CQGA 1FESA 4IFEA 4PKHA 3TWHA 3PACA 2K7KA 1EX4A 2E7WA 2W8LA 3TRGA 3TVYA 5EVZA 3MMBA 2B8PA 4NLSA 4ECRA 1S6QA 2QL7B 3RZAA 3CNQP 1IJJA 1RTIB 3P5JA 2Q97A 4PG6A 4B9LA 1QSYA 2P9LA 2O8FA 1VSDA 1N36J 4ANDA 4O4GA 4PCQA 1H2VZ 4YR0A 4IUFA 4X65J 5HOOA 4I6AA 2VFSA 2WTUA 3BZKA 2O4IA 2MKSA 4HTIA 5EWGA 1MMLA 3DYAB 4X62F 5M1QA 1VQYA 2EFPA 1QSSA 2QWLA 4F3TA 3HM8A 1YITS 1IV0A 4EBCA 2WAQD 1RAHB 3HVTA 4K42A 3H90A 3PO4A 4PG8A 4KHYA 2OJ3A 1A5XA 1GX5A 3T9ZA 2CDRB 1NLVA 2HFVA 4UF4A 4CJ7A 1SJFA 2WOMB 2CPHA 1YTAA 5E26A 4B3SK 1OS5A 4QS8A 3RRKA 1QUPA 2XMWA 4PWWA 3UW1A 1EO1A 3DRPB 1TL7B 4CGIA 4I6MB 1G15A 4DR6K 4DV6K 1X9JA 1N5YB 1JL2A 5J2PA 1VK3A 3RBEA 2P51A 4O4RA 3SUOA 3CJ4A 4CZJA 1Y97A 1HBUB 1YI2S 2UXDJ 3KVGA 2FZGB 3D1HA 4YHHK 5KPZA 2E9ZA 4QIWD 4AYBD 3OYIA 2PSZA 4FKYA 4L6V3 2P9IB 4DR3K 4ZPDA 4WYWA 4ZPCA 1VQKS 3FFKB 4P52A 4KPCA 2RRNA 3O8WA 2C28A 4NCGB 1GLDG 1IKVB 1QTNB 4KGMA 1D8YA 3TUJC 3G0ZA 1TUGB 5FDLB 3F56A 3KXDA 4LSNA 5KAKA 1A9NB 4BRAA 4J7CA 4E8UA 3KJVA 4YB1P 5HO4A 2E2PA 3EJMA 2CXEA 5B0EA 3W2WA 3VQEA 2MJNA 4W5QA 5KFGA 4UUWA 3OTBA 3H1VX 2LQ9A 4ELTA 1BQXA 3LF0A 3R9LA 1R0AA 3S01A 4P71A 1TUYA 4DLGA 3CMQA 2VBXA 4Z94A 1S9EA 2Q3PA 2RDJA 1S6PA 4DPWA 1IVZA 2GWKA 1CULA 3W2VA 5CYMA 3CCWA 3HSDA 2DCLA 4XH4A 3T1HJ 1SQKA 5JVGQ 1H1VA 1NHKL 3DLGB 2Z1GA 4PPZA 3DAWA 3TTCA 3O3FA 3C6TB 3M6WA 4NYPA 4EWTA 3QT8A 3NGDA 3LAKA 1X4GA 3K58A 1SL0A 1R8PA 4BRKA 5DRKA 1OH7A 3D3CJ 2DXEA 1HR0J 4NXMF 1TZ0A 1V4SA 3P39A 3BGUA 4NB4A 3LDNA 4FK2A 4QIGA 2HIQA 3OXLA 1WC0A 1FFWB 1WF2A 3RG6A 2W1BA 5DMRA 4EZ6A 3RB3A 1NKEA 2NLXA 1FEHA 1NBWA 1WC3A 3CJTA 3SBGA 2DGOA 3EGWB 2J7UA 3R1LA 4DG1A 2J0WA 3M8ZA 1BCOA 3RMDA 2IOCA 3I31A 4B1WB 4WJBA 4Y2KA 3NWGA 3VGUA 1EKRA 5JMNA 2LDYA 4L76A 2MYFA 3PM9A 4CT8A 2ZHBA 2OCEA 4KTZA 3FBBA 1K1QA 4NMLA 2ATCB 2HHVA 3QT7A 3NBPB 2HEKA 1EKEA 2RD5C 4ZPAA 2C2ZB 3WT0A 4USJC 3A12A 2GV9A 5F0WA 3I5BA 3NGUA 5KT5A 3KD1E 2KT2A 2RT3A 3EVMA 2ZWOA 4JLHA 2P9CA 2P9NA 3SQ1A 3TEGA 2YX1A 4DTUA 3CVKA 1X9SA 4ID1A 5KFMA 3EY1A 3WEEB 4DQ8A 4B3SF 3VGMA 2VA2A 2NXJA 4DR5K 4X4UA 4N76A 3DGVA 4IRKA 3VA0A 3DGPA 3ENWA 3O1WA 4C1NK 3WXJA 4DR6F 2W9CA 4DV6F 3ILIA 5LXRA 1WSEA 3JTNA 5D0RA 1VSHA 5T7LB 2K3KA 2HZVA 3CD6S 2PY5A 5AQFA 3ZC4A 3M8YA 5H1SV 1NGFA 2XMTA 4YHHF 2F7VA 3CCSN 2A41A 3MM5B 4MLEA 2XY6A 1X5OA 5HK4A 1QY7A 4DR3F 2OD4A 3TR5A 1YJNN 3TQEA 1D0EA 3U6FA 4OLPA 4JI2J 4ZP6A 1V3ZA 3MR2A 3JYTA 3FQLA 3L2VA 2GIRA 1TVRB 2VUGA 4KPYA 1RILA 1U09A 1LWEA 1VBZA 5D3GB 2CWXA 3MCOA 1JLQB 2DHXA 5HANA 2KW4A 1XWLA 2ADBA 3D54A 1RI7A 2Q1LA 2AA4A 2AP6A 4U67Q 1Y7PA 2YKOA 2IAJA 3E9PA 2JVOA 4M7XA 1S72S 2OPSB 3M5RA 5KT7A 3QWUA 2AZ1A 1FJGK 3CCES 1N32K 1U2CA 3HFKA 1JB0C 2XRIA 2DY9A 4YEAA 4FPBA 2RVJA 2NRTA 2LXUA 4YOTA 4I1TA 5C15A 3VN5A 2G1DA 3OS1A 2UUBJ 3D2FB 2E2QA 5ADXH 2AYGA 4CJQA 4DL5A 3DFEA 3OYBA 2YVSA 1YTUA 3TJ9A 4Y2AA 4YORA 4DV5J 4NLVA 2DEJA 4NA1A 3ENHA 2P9KA 2K1RB 1OKJA 3LPTA 2AV5A 2J8AA 2Q79A 1AA1B 1L3UA 2J4RA 3U9ZA 1IM6A 1TYQB 4K5RA 3SJJA 2EXUA 2UVUA 4CZLA 1Y4ZB 1JL1A 5K20B 1K8KB 4CH1A 3Q24A 3IG1B 2GIFA 3SJHA 4GO7X 4DLEA 2IM1A 5LMNK 2AEFA 1VBKA 4X66J 3M05A 3KLGB 4QJVA 2UV8G 3T19A 2G2ZA 3RB4A 1T3VA 1HYSB 3VVTA 2X1BA 2E6MA 4NLUA 2NRZA 3TOQA 3FQKA 3CI5A 1P1LA 3J8AA 3K89A 2ZBIA 1P9YA 1FX2A 4CP5A 1FRJA 3I56S 2WVEA 4ED2A 4IDKB 1KVBA 4ZDNA 3UR3C 1WSRA 4FW1A 2YNHB 4FLWA 3MDQA 4BQLA 3IAM9 2MY7A 5SWMA 2FBTA 2QA4S 3NAIA 4FK4A 3OR1A 1H72C 2WSCC 2YH0A 1QZ5A 4Q43A 4X2BA 3AY0A 5L39A 1TKDA 4Z4CA 3MD3A 1Q9XA 2WSFC 4KE5A 5F8GA 3FDSA 3OD2A 3IN5A 1U2VB 2GQQA 1PYTA 1QAXA 2ZH1A 3NS5A 3LALA 3TJAA 4FJNA 2YKMA 2A42A 4PWDB 1RT6A 1R8CA 4PKDB 4DR5F 2D1KA 5ETVA 3OS0A 1GLEG 1NMEB 4CZIA 2QA1A 2DJWA 4AE5A 4R8UA 4DV7J 4ZPWR 4OI0A 4DI6A 2UU9J 1VISA 4BDPA 3PG9A 1SC6A 3FGVA 4JYAK 3ZNJ1 2V2KA 1JJ2M 1BGXT 3THXB 1B3TA 4E7LA 4ILMA 2JX2A 2L3MA 3ET6B 3DWLA 1LAWA 5J1EB 1TL3B 5GMDA 1DT9A 5LL6d 5ETRA 4LRCA 3H45C 2CVIA 3TTFA 2JRSA 1N0UA 3DMJB 3VEWA 5F41A 5BN8A 4ZPTR 4FO0A 1FO1A 5KFDA 3UN3A 1APSA 2KU7A 4L74A 1M5PC 3NGIA 3HI9A 3S41A 2XHBA 3QEPA 2QXFA 4ED8A 3GFZA 1UTAA 2D9OA 1C0TA 3VGKA 2CPIA 1KC8O 3KK1B 3NDKA 1YITN 2VG6A 3V9ZA 3G6ES 1FA0A 1SV5B 2VG5B 4DR2J 3BSCA 1KOHA 3OYKA 1FJGF 2O8BA 3BF1A 3Q0AA 1N32F 3AVIA 1U04A 3UE5A 5A0YA 3VHQA 4U7UK 2ZH2A 3OA9A 3HFZB 4BE1A 1XR5A 4KR0B 4NO7A 4B08A 3C0BA 3QWPA 4L3KA 2L48A 3ZO7A 3ULHA 2B4VA 3UE2A 4LRAA 4LH4A 1U6FA 1X4BA 2E7VA 3RBXA 5C24B 5I3UB 2OFGX 3AVJA 3BUZB 1VBYA 5IFMA 1XMQK 2LQ8A 2B5JB 4IR1A 2HSTA 3HD2A 1R6VA 2SXLA 2XEXA 3FVYA 5LJWA 2BACA 3K5PA 4DV2J 2OSQA 4I2QA 3EXYA 4YOWA 3QRRA 4W5OA 1S4FA 2C2MB 5HVGA 2R7OA 2YNGB 5HL7Q 1X60A 2L41A 1VQKN 1CZ9A 4KBOA 4YUDA 3TU5A 4RWXA 3FE1A 4ECVA 2XSJA 1M1KT 3ZTQA 5LMNF 1WSJA 2BE7D 3JB9k 2GGPB 2FBYA 1IBCB 2ZC4A 1Y9OA 3KZBA 4EU0A 3V9XA 2KFYA 3P45B 3CD0A 5AQGA 4IOCQ 1YK9A 2VCPA 3DRSB 1N36K 5AE3A 4LF5F 4WZQA 3MR7A 4C11B 5JLHA 2V9KA 2I5JA 2KLAA 4ZCIA 4X65K 4N8OA 3IUCA 3D67A 2OI2A 3A8YA 1RNHA 3IS9A 1QZ6A 3KDOA 1S99A 3IGVA 2F9TA 3CJ8A 5L46A 1UWAA 2ZBPA 3KHRA 4OX8A 2ZD1B 3SPYA 3GJRB 1GOAA 1BA1A 4D3GA 4IRDA 2FVSA 2ZOMA 4ECQA 1NGJA 5HRRA 3TVZA 2X1AA 2FLNA 1ZAWA 4FN5A 3PYDA 3V9WA 4EHTA 1SC4B 2K7JA 3C7NA 2FBVA 1D5AA 2BKPA 1SIZA 3RU0A 1VK0A 1HQ2A 3SQ0A 1VLYA 2VOOA 3UDEA 4PG4A 3TO8A 3O80A 4DX8H 3BEGB 3OVAA 3NY0A 2HBLA 2V51B 4IZ9A 2GJFA 4K5SA 3CEDA 4EO6A 3TABA 4CEQA 1WHVA 4OZJA 4NXNF 4WFXA 3Q2SC 4CO3A 5IT9Y 2BRKA 1WSGA 5HBMB 1VRQC 1C0UB 2JDJA 3WIVA 1YZ7A 1ROFA 4E0DA 1A5VA 2OTJS 3CT9A 2ASJA 3Q8PB 2RDDA 4JYAF 4LF9K 3AODA 4I2PB 1MWZA 1JQGA 2JWLA 3M1FA 1LW0A 2DD8S 2QTDA 4KI6A 4ZVFA 3FZLA 2KJWA 1J5OA 1HI8A 1HI1A 4CEZA 3OVSA 1FXLA 4J9SA 2J0QD 2IM3A 1ZBSA 3PEJA 2A3JA 2DNMA 4I68A 4NYFA 3OXFA 1B9DA 2YKNB 2O4GA 1VHIA 4HHJA 3MCAB 3TARA 4EGLA 1OO0B 4IG3B 1ZAVA 2H1YA 5C42A 5D8HB 4ZIWA 2CPXA 1C1BA 2YWGA 1QQOA 3F0NA 1KFSA 1HBMB 1JLCB 2UXBJ 1B99A 4Q7AA 3E9LA 3MPDA 2C42A 3T1HK 1M90T 1S59A 1S0MA 5EDWA 4F02A 1G2EA 4FYDA 1TMMA 2ATQA 1JXEA 5HROA 4E89A 3MUVP 3VQAA 1N33J 2ZDPA 2E20A 3EZ5A 3D0IE 5ADZA 3AJ1A 4X4SA 2JNJA 2Y0BB 1EARA 4DB3A 3KNGA 2AYEA 2ZNYA 1XMQF 3CD6N 3VENA 2BQRA 1R8BA 3G87A 4LSLB 2CJKA 4F9OA 2AJ1A 3R7NB 2E1YA 1KAXA 1I1GA 3W5XA 4TU7A 3L0QA 4FSVA 3DOKB 4LF7J 2CQPA 3OL8A 5IQQA 5DK5A 2B8QA 3PUFA 2W40A 3THTA 4FXDA 2GMHA 3D2EA 3MM9B 5KFUA 3ZZTA 2I2YA 2MPUA 3BREA 3LPYA 3SQGA 2QWOA 1RT5B 2HPUA 3JSMB 2F8MA 1N36F 4MO5A 2LVWA 4CF2A 3GONA 3CGIA 1MWKA 4ILRA 1S72N 4B1VA 5C2FA 1TKTA 3SCXA 4X65F 2KHDA 3C15A 4DV1J 4DV0J 3CCEN 4H4OB 1EAYC 3MMCB 5E3RA 1NPKA 2CH6A 2QL9B 4QW9A 4GC6A 3S3MA 4ZPVR 3MPYA 3CCZA 3MMAA 1RT4A 2QWPA 2KYXA 9ATCB 1FFGB 4NLRA 3PTWA 4OLOA 3P6YC 5L9NA 2QKKA 1RUSA 4HI2A 1FDDA 3WHIA 3FMWA 3ELHA 4JUZA 1VHFA 5AXMA 2HZAA 2VH7A 2UP1A 5AQSA 3D1QA 3GCWP 2XM3A 3BSNA 3LGHA 2J6SA 4JI7J 3MOZA 4MFBA 4LF6J 1RDCA 3NH0A 3R6GB 4QCLA 3RBZA 1BMQB 2VU5A 1HD1A 1NOZA 3PW5A 4XPEA 3GZ7A 4R0JA 1XUPO 1SKWA 2E5JA 4NASA 2YHAA 1F5CA 1B9FA 2NR0A 4A8FA 2UXDF 3NP5A 3NMRA 2EFGA 3M1VB 3GOIA 1RWOB 1ZBTA 4DV3J 4RNOA 1N5VA 3V1OA 1YVFA 2GX9A 4CJWA 2E1ZA 4QU7A 4ILLA 2X51A 2HQCA 2J8SA 4ZA1A 1S1VA 2AZ3A 4ZS6A 4LRFA 2YCHA 2JC1A 2P9GA 2I9SA 2XC9A 1JLAB 1FD2A 1RTHA 1XC9A 4U9RA 4BE0A 2QA4N 3IP0A 1R27B 4L73A 5L8RC 4FXVA 2QC3A 2WCXA 4DTMA 3S3OA 4RW4A 3CUNA 5D77A 2Z57B 1RDUA 4FJ5A 4R5PB 1HJRA 1AB8A 2QFJA 3M2RA 2VG7A 3LP0B 3BH6B 1WSVA 3E1YA 1FDAA 4IH7A 2UUBK 1FE0A 1BCMA 4MIAA 3T1HF 3I82A 2OPRA 4RNNA 5CD4A 4JD2A 3QEXA 5AQWA 2M0GB 3V6HA 5KFJA 1WN7A 1QVGM 4DV5K 2XWYA 1X5PA 2KFZA 2RF2B 1WHYA 1S9GA 1RTDA 2CUYA 4YOEA 1U0SA 1IKXA 3CJ1A 2VJVA 3BF3A 4DR4J 2Q6BA 3HZEA 1UVJA 4A8QA 2ZM6K 3N4WA 2C3MA 5KI6A 1NM2A 2P9EA 4TN2A 1CJKB 1S0NA 4QAGA 2V52B 2PD1A 4PPDA 4Z4FA 3CCLS 4BRIA 4CEBA 2NRWA 1FKOB 5KFWA 2PIIA 1YRXA 1I51B 3BSOA 1KN6A 1KKHA 5KFKA 2XZWA 3IXQA 3NAEA 2CQCA 3I8BA 3MFIA 2D3O1 2Z2MA 2J7KA 3G9CA 4QOTA 1P27B 3T69A 4FDFA 3OT9A 3RUBL 3DM2A 2LQJA 2Y8YA 3K8VA 2UYTA 3ZTOA 1JCGA 2HRUA 5F8LA 2F8TA 3JQMA 4Y1DA 4DCHA 2PEBA 1JMTA 3DXKA 2VIHA 3GL1A 4ZITA 1NXIA 2RHSB 3PIPQ 4QPTA 3ID8A 3C65A 4LBIA 2XY8A 2KQ2A 3TAMA 1Y0HA 3HP9A 1U1PA 3TW0A 2DFFA 2H54B 4DSEA 3LDSA 4E7IA 1S22A 1MN9A 2CJXB 2ZHAA 5GINA 4FWPA 1O5JA 3CJSA 1PBAA 4NEZA 1ZOTA 3SAFA 3KDNA 1BU6O 4X4VA 4ETZA 4EP5A 4ZVEA 2VBZA 3L6QA 1CJVB 1PILA 4O3QA 2U1AA 5DQHA 1RXOB 1N8RT 3L09A 3N4PA 4IO9Q 1S1XB 4O5FA 4WYLA 3U7JA 1WTFA 4NLPA 1JKHB 4RLEA 3AO4A 3DXMB 4A59A 2NRHA 2HWHA 5K9FA 4CYUB 4DS5A 4FF3A 2O1PA 1ATSA 3HL8A 2AWZA 4DV7K 2LU2A 2W6KA 5HATA 1QM9A 2VFTA 3CJBA 1NDPA 3HRGA 2HVEA 3H7HB 2A1SA 1HW9A 3NCQA 3Q8SB 2XQCA 1IR2A 3MM8B 4NLYA 3TUIC 1DFDA 3H5YA 4NRUA 1XC3A 4CEOA 5K8PA 4HWIA 4CF1A 1GMUA 4JI2F 4U7UD 1WEYA 4OVLA 2WFBA 1ZBUA 5H9FJ 3AOCA 2JLFA 2PA3A 5J2NA 4FOEA 4E1JA 4BLGA 1Q8IA 3D28A 2UXCJ 2NPIA 4CZGA 4QIVA 3SCKE 4TY8A 2L08A 4DR2K 2N3OA 4OYMA 2HNYB 3O4WA 3AO2A 3K0SA 4HTUA 4JI4J 1YQHA 1EETB 4Y34A 3GIRA 2YJEA 2FHKA 3QLHB 2UUBF 4RO0A 3FNNA 4BS2A 1K8AT 5KFAA 3PIOL 4CLPA 3O3GA 1JJCB 2PI4A 3MEEB 4LF8J 4BR0A 2JEFA 3V4IA 2B0GA 4DV5F 2ZBCA 1UVNA 2F8SA 3AO1A 5KFYA 2N82B 5EWEA 2NNWA 5AQTA 2L9NA 1FX4A 4DV2K 4HACA 5DGAA 1OJ4A 3AVBA 1W26A 1ASWA 3J7AN 3PKYA 2MKYA 4DX7A 2QLWA 3OTDA 3G6VA 2WBMA 4OI3A 3MTJA 4XTTA 1RJJA 4O0NA 2D3ZA 2DNKA 2H3GX 4X66F 1ZH5A 3SSQA 2HFNA 2Y1IA 4ZHRB 1RBAA 1RT2A 2QV6A 3JSRA 1LOUA 4KGZB 1HNZJ 4H4KC 4IFYB 1VSKA 5LMUJ 1NDKA 3BKFA 4DL2A 2E1AA 2IA0A 4LR8A 4U7CA 2V8HA 5AR0A 2MQLA 1PC4A 3CMES 4M3WA 3EE3A 1NZAA 2O8DB 5HLFA 1Y64A 2ZKTA 3JTPA 3QGHA 4K59A 5K14A 5DETA 2ZH4A 5F0XA 1GMVA 4DS4A 4RW8B 5J2MA 1UCNA 2V50A 1RHMB 1F3FA 5T14A 4ED4A 3P5TL 3FRZA 3ZTRA 2HIYA 3G86A 4HT5A 4N41A 3DLLL 1H0HB 4BR7A 1PJ5A 1HMVA 1ASUA 1RABB 3HZ6A 3CHWA 2H65B 3CIPA 1QHAA 3O1LA 5G0RA 2GELA 4Z4EA 3KLFB 1RAAB 1FD8A 3TJ8A 3WXKA 1YKWA 1NK8A 3O6QA 1O1WA 1MWMA 1GX6A 2WTFA 2CPDA 4FWQA 3Q8YA 2FYXA 1U45A 2ZE2A 1GAOA 1BIZA 4CZKA 2LA6A 3GIJA 2R8IA 4WQ5C 4DV7F 1AW0A 2WC9A 1JLEB 2UU9F 4EBEA 1CS4B 5DLFA 4Q45A 1RCOB 2BMBA 3CM6A 4LR9A 1YBUA 5FPMA 5D0EA 4NYZA 3M30A 1CC7A 4DR1J 3VAHA 1ZC6A 4ZLPA 3NRBA 2Z58B 4YR3A 4B9MA 2HSEB 3RAXA 2HHQA 2EC2A 3S8SA 2VA3A 1BUXA 4WE1B 4DUTA 3D4JA 4DHVA 1A7GE 2QI2A 3H3OB 2ZGZA 1RT1B 4E3SA 3ZETA 3MTKA 4PQUA 2AMCB 4N8NA 3B6OA 3H4DA 3DLEB 1IO2A 3H5XA 1HNIA 1CG2A 2F9WA 1WHXA 4DR2F 2N4CA 1WAFA 4K2JA 2G8VA 3NEKA 4LVOP 3U3GA 2LP4A 2UXBK 5BYSA 1HIYA 4BDYA 3QFHA 3C16A 5ELZA 4BWJA 2W7PA 3LWLA 1U1RA 4RUCA 4JI0J 1FRKA 3A8IA 1S10A 2UVVA 1E6VA 2W41A 4UOCA 1N5TA 1UAWA 3NOCA 2DRDA 5DDQC 3QICA 1P8GA 4TYBA 1XMBA 3N0VA 3RJMB 3HHLB 4GMJB 3R97A 3WQUA 3UCGA 1N33K 1RGIA 4GC7A 1NNEA 3QDKA 3QRPA 3ASMA 1NCLA 2E2OA 3R8EA 2DKOB 1VQ8S 2HFZA 5A6WA 4QS7A 5C2GA 2R7XA 1PG5B 3M9NB 1HBOB 4M5DA 4I7FB 2I0XA 4A57A 3TX8A 4M95A 4DV2F 2DR9A 1N4LA 2HFOA 1KS2A 1Y3JA 3HJFA 4FJ9A 1YJWS 1WTBA 4LF7K 4NWBA 4KREA 3AD7C 3DC2A 4KTQA 1J54A 2P1JA 4DMZA 3FMBA 2G0IA 4KBIA 4RWWA 4CW7B 1SJRA 2HFUA 3VA3A 4KHMA 2RMLA 5BJRA 4WFBL 2YX7A 3VERA 3LP1B 1MW7A 5B0FA 4DQIA 5I4MA 2NLWA 1VSLA 2O67A 2FVPA 3I9V9 2RIJA 5HP1B 4RW9A 2CQHA 5DM6Q 3SMZA 4QIFA 3H98A 1F1BB 1RBSA 2G13A 3VQPA 3LWMA 5ITHA 2D7SA 3HJVA 5KG1A 4CJPA 3CC2S 1HHSA 3H0PA 3POTB 2K8GA 3SFGA 1BXNA 3QMQA 3KHHA 1NK5A 4WYBA 4OZ5A 2HQ3A 5AZJB 2HBMA 1BI4A 1KHVA 1PYOB 1TL1A 4ZIVA 3JQKA 4FJJA 2HHHJ 3BBCA 3B78A 4CWBA 2EW9A 4F4ZA 2AJQA 4NLDA 4FJHA 2ZZMA 4J9PA 3BZCA 2XYHB 4TU9A 1NGEA 1F6TA 2G8HA 3NLCA 2E9TA 4DL3A 3MCPA 2AW0A 4JI7K 2Z1IA 1TV6A 2CNOB 4PKIA 4QQBA 2XY5A 1FJCA 1S1UA 2CNKB 4DCJB 2W2QP 1YUWA 3TPQA 4RTFD 3HPHA 4WK3A 1S6QB 3SFUA 4F3OA 1URNA 3MECA 2D3UA 4K4ZA 4OHWA 1KSPA 1HBNB 4AHTA 5HQMA 2C2DA 3CCLN 2QWNA 3MPWA 2ITGA 3P83D 3QJLA 4CEEA 4RUAA 2E1RA 4IQMA 4O3PA 4AH9A 1QQMA 4RW6A 1MMDA 1S9FA 4IXCA 5D0GA 3B8AX 1SB6A 2MZRA 4DV3K 1F2GA 1T9WA 4F04B 1YZ6A 2KVQE 4NOHA 3NNCA 3EE8A 4H0PA 7AT1B 2B6AA 2D0BA 2I6WA 4N77A 4UY85 4IFVB 3LGMA 1R7IA 1RHKB 1C0GA 3ZZ0A 3M7VA 4BVPA 4CJEA 1V5VA 1Y5NB 2H48B 2HG4A 5HJXA 1KD1O 1O0PA 1RACB 4NRTA 1UWBB 1FVSA 1HKAA 5KFHA 3MAAA 1WC5A 3FZFA 2O8CA 1U1LA 3VPZA 2N7YA 3A5LC 1SQFA 2VFVA 3G6YA 1YIJS 2CQBA 1NK4A 2UXBF 5DM7Q 1OQ3A 2CPJA 4USTA 3ZXWA 1WNEA 4C8YA 3RB6A 2OMLA 4WCEQ 1X3MA 2ZOFA 2DO4A 4ZVRB 2W42A 2JHEA 3CM5A 4OKKA 5GADU 1UJ6A 1X3NA 1RWPB 4EO8A 5HRNA 2R2SA 3EZWA 4J91A 3AH6A 3SEOA 1N33F 1WUAA 4KJIA 3RMAA 2NSBA 2F5GA 3HYFA 1O6XA 1ZETA 4QYRA 2XHCA 4H5WA 1OY9A 4F4AA 1T9YA 1IR0A 2KZZA 4DR4K 4ZCMA 5EUHA 2HHWA 1GMWD 5F2RA 3WC0A 1H7WA 2AD9A 1SPBP 2QO3A 2JFDA 4LF7F 5KT2A 3ZT2A 2HYIB 4DZ6A 4DFMA 2QXLA 1DTTA 5KFLA 1KQGB 2MB0B 1JCFA 1S1WB 4J9MA 1XHZA 4FWRA 2R9LA 2R42A 3OS2A 3DRRA 4CO1A 3M2VA 6FD1A 1AZSB 2DRAA 1CLQA 5K8MA 2MHNA 4NMXA 5AXNA 1S9EB 1S6PB 1Q53A 1Y00A 4CF8A 2DY4A 1QE1B 3OXGA 2XTJP 4CBXA 1VQ6S 2XI2A 3W2VB 4AD6A 4DTPA 4CM0A 5C10A 4DV1F 4DZDA 4DV0F 1W2BR 1YTYA 1X7VA 3VALA 1XIQA 2I7NA 1LWCA 4GKJJ 3K5OA 2C1EB 2FUG9 2OEKA 3UNGC 5BR9A 2KG0A 1N5QA 2BQUA 2HAFA 4Z37A 1Y10A 3P8BB 1VCTA 4ILGB 3KK7A 3LM2A 1Q81O 2HK2A 4EIAA 2QE5A 2OH2A 4ZCKA 2JVRA 2XS5A 3ULEB 1T3NA 3TSUA 2F8HA 1TFWA 3HULA 1IQTA 1EB0A 4WFYA 4DUYJ 5EY4A 4JI7F 2CJBA 4LF6F 4CO2A 3ZT3A 1VJWA 1VRUB 1RTIA 3B6BA 5LOQA 1P1TA 3BGRB 3CC4S 3SYZA 1QVFR 4P2MA 2W01A 2DH8A 3QBWA 2XLKA 1PBUA 3MDFA 1QSLA 1Q7LB 4W4MA 3D0PA 2MLXA 4EP4A 1N88A 4W98A 2VONA 2ZFHA 3DKDA 3I87A 1FJEB 3NAHA 3QO9B 2GWJA 2MZJA 2OZMA 1S6UA 5HRSA 3OHRA 4DV3F 3EO3A 2BYCA 4WQ4C 4DF4A 2DNPA 1GXLA 3RTVA 3F5TA 2B4OA 2V8GA 4IQXA 1UFKA 4PL8A 5KG0A 3IBWA 4OJ1A 1N54B 4W5NA 1PC5A 5KFEA 4TLRA 1NGDA 3CMEN 3ZTPA 1F60B 3IR6B 3ULDA 1GLAG 1FXXA 1ZAXA 4LT6A 2LEBA 4ZP9A 4W90B 1WOQA 1T9TA 1XMOJ 1WUUA 4XAKA 1TUVA 4IO1A 4J9KA 1AUDA 2P9NB 2EWSA 4FM1A 2CAJA 2IVMA 1VQMS 3DRPA 1RHUB 1TL7A 4I6MA 4GVLA 2ZVSA 1N5YA 1YJUA 2Q31A 4JI4K 3CD7A 2NQPA 5ETNA 3NFAA 5KFZA 5A8KA 3MUMP 2RJZA 1HBUA 2BE2A 1RLDA 4GW6A 2V68A 3D6HB 4PG5A 3EPIA 4S0MA 3FGUA 2P9IA 3M3ZA 4CZCA 4WZMA 3TA1A 4QR0A 4OJ3A 4NCGA 1FRHA 1IKVA 4FJXA 3NCIA 1KVJA 4N5SA 3C95A 3NKYA 1NH8A 5GMEA 5FDLA 3CDUA 1ZZNA 2O5DA 3VQTA 2UZAA 5E3PA 1NLKL 5KG2A 4DR4F 1CXQA 3QJJA 2JLEA 2B4PA 2QYCA 2P9SB 4RU9A 2CGKA 5GAGU 5I3PA 3CJ5A 4I0WA 1IJFB 2B3TB 3FEYB 3F2KA 1D9DA 2CQDA 1U24A 2M52A 3HO1A 3DRYA 1UKUA 4HH1A 1HNZK 2IAJB 3CJ7A 3CF5Q 3QNNA 4BRLA 2RHKA 2AEMA 3L3CA 2HLUA 3R5JB 4FJ8A 3SBTA 5IM0A 5LMUK 3PHTA 4J9OA 4U6PA 2R7VA 3DLGA 4TLQA 2NUBA 3KG0A 3VEVA 1T95A 3AB4B 4YB7A 2OYQA 2MKKA 3I0SB 3H1QA 2W2OP 1IQZA 5KTQA 3Q83A 4OJHA 4JK8A 4O3SA 3BO3A 4G1PA 4CERA 3C6TA 1RBUA 1B0VA 1SUQB 3VAKA 2XMMA 1IWAA 1U1QA 3LZJA 1YGYA 3VQBA 2YWHA 3DHWC 5AQJA 1UFWA 1R0BG 2FC9A 2DNLA 1SL2A 4HEA9 3SZ2A 3T6BA 1EP4B 2ZWPA 4GV9A 4ZJOA 2E44A 3G8SA 3BS9A 3C8YA 1YHQS 2R2RA 4OYBA 2XGQA 3PW4A 5E33A 4DSLA 3C14B 2HS3A 4CESA 2GVZB 2V9WA 1VQ8N 4O23A 4M63A 1FWKA 5JMVA 3VQ4A 4J90A 3ZSQA 1ZBIA 3CXCR 4OQJA 4FLTA 1VAZA 3I0RB 5ETOA 4IO8A 1B64A 3BBBA 2AKWB 2L9WA 3UVJA 1P8ZA 1FW6A 4ZOSA 5HQ8A 3A8JA 4FZVA 5GAEI 4CGDA 2CGLA 2O66A 4BE2A 3CWJA 2CPEA 5DDPC 4L3QA 3BSAA 3ZX0A 5HQLA 1VGYA 1F3VA 1FNOA 2YNIB 2HB5A 1RISA 1O8BA 1GOCA 4ECYA 2LEPA 4DR1K 1S97A 2DPNA 3NBPA 2F8EX 5KRSA 4BCAA 2GVDB 2OP5A 2RPIA 3ZEUB 3I4PA 4B9TA 3ATUA 4GVMA 1XNRK 3M9MB 3V6DB 3HM9A 1RADB 2HBRB 1SH2A 1IKYB 4NLXA 3OW2M 4RUBA 3AGKA 1EHWA 3CC2N 3HHLD 2UXCF 1YJ9N 4MLHA 1JLGB 1M5OC 1HARA 2DXDA 5KRTA 1C1AA 3WEEA 1RAEB 2M2BA 1TQLA 2LMIA 4O8UA 4FS2A 3VQ5A 3TAEA 5D0HA 4P74A 3JAMY 3BJYA 3H2UB 3BP8A 4C2MA 2X6NA 2RNEA 4OHXA 2NUUG 1N5SA 2VDHA 4JI4F 2VKZG 4JI0K 1SCJB 3UDCA 4KFBA 2VD3A 4R8UB 4YOVA 5BXIA 4DJBA 2FHJD 4DSIA 3TUPA 2HBKA 1XK8A 4LFCJ 3A5OC 4M3UA 4BR9A 1BWVA 1Q86O 5JUMA 4LF8F 3QFUA 1XBWA 3M8PB 4KRWA 4PUOB 1TVRA 2MSTA 4TNOA 3U8XA 3U4LA 3ETMA 2IVNA 5D3GA 3OHBA 3OYHA 1JLQA 4DKWA 1LXNA 2PMZD 3PYFA 4C98A 3VV2B 3THYA 1WBDA 4OX7A 4CZHA 2CJYB 3GG4A 1UFLA 1DLOB 4ES1A 5FRMA 4MKAA 3UDVA 1E3MA 3B4DA 1XQSC 2NYIA 2OPSA 3HD1A 5ETQA 1K0TA 1HWKA 3S1TA 1A0OB 1VC0A 4WK1A 4BBYA 1JJ4A 5MLCV 4URGA 1HNZF 4KB1A 2PN6A 1S5ZA 2FDNA 2N4DA 3GIKA 2WVFA 1Y11A 3RR7A 5FD1A 2O8BB 2DGWA 3GMGA 3RB0A 2D1CA 5LMUF 4H5VA 3SAHA 3AAPA 3H59A 3QGPA 1C2PA 3TSPA 4CFBA 2GJ2A 2HURA 2J9CA 4N7TA 3ENAA 4ZN3A 1YIJN 2K1RA 5IV4A 4WP3A 1FNXH 2I38A 3CCJS 2I7PA 3FEXB 1NMNA 2H4YB 4JEPA 1D1UA 4P7TA 1G6BA 8AT1B 3T7ZA 1EZZB 4QU6A 1TYQA 2FJDB 1TKZB 4Y1CA 2RQ4A 4NLTA 2HHHK 5B0BA 5EX0A 1NPPA 1K8KA 2Z0GA 2ZITA 1RA7A 2QA4G 2H3EB 3IG1A 1P90A 2GUIA 4I2QB 4KHNA 2KJVA 3KLGA 4BG9A 1YJNS 1QAJA 4OZNA 1WWHA 4A8YA 4JKEA 3CPWM 1HYSA 3BGOP 3MXMA 3A3OB 4USHA 3PY8A 1B70B 5KFIA 1RDDA 1RAGB 3C94A 3JSYA 3KWGA 1FE4A 4OHVA 1J53A 1EWRA 1OH5A 4QBUA 1BQNB 1UL3A 2QEXN 1QLNA 3I4HX 1N56A 1MLAA 3IS9B 2IDLA 4DR1F 1CZBA 4U8YA 5KFNA 3MMJA 4QW8A 1X31C 3SNNA 1VQ6N 2KRRA 4CHNA 3U1NA 3MEKA 1U2VA 3ISNC 4GMKA 3NWRA 2DGTA 5BPLA 2V0NA 1UZHA 1Q82O 4CK3A 3EMTA 4DR7J 2Q0UA 2XB2D 2LXIA 4Y0WA 1RHRB 2C2KB 2HQFA 2QLBB 2ZEJA 3C7NB 1H2TZ 2H51B 3KKRA 3W5YA 2MQQA 2AGOA 2WB4A 5F3ZA 2UVWA 3IC1A 3MX2A 3L4BC 2DK2A 4BRHA 3DNCA 3J7ZO 5F9LA 3W0LA 2ERRA 4JI0F 4RWTA 3KG1A 1X4DA 5B7WA 3NVMA 3THXA 2CWKA 3PRVA 3H8YA 3CE8A 2OEJA 3ET6A 4LQ9A 3FBFA 5J1EA 1TL3A 1CPZA 3KG4A 4DSJA 3K57A 2FTRA 2ASOA 3DMJA 3AO3A 4Z7CA 3VQDA 3QIDA 2DFEA 1RBTA 4O8KA 3NH1A 2GFFA 3WZ0A 2NXCA 3FFIB 3OYCA 2UUTA 1RTJB 3BGLA 3PFOA 4GVEA 3PYGA 1GT8A 1VQPS 3NGKA 4P2XA 3BBFA 1WSHA 3KK1A 5F9NA 1EWQA 1BHNA 4NA3A 4O55A 2VG5A 4C3MA 1UOCA 1C1CB 5AQZA 2IDEA 5E3AA 5KT4A 1FNMA 2YPYA 1HX1A 3EEQA 4CJLA 3DDNA 4CD1A 2BOAA 3GR0A 2VGNA 2BXJA 5T7BA 1VOMA 2RU3A 3S3NA 2W2MP 2OTLS 1D09B 3HDSA 1YWXA 2QFIA 2WRMA 1T0TV 4FNHA 1X4AA 5M1FA 3KIOA 3D6RA 1TK5A 4IOAL 2NZTA 5C24A 4CBWA 1NK6A 2MQPA 1QAYA 1HKGA 2M8DB 4GKJK 1QQCA 2R7UA 3E01B 1BWEA 4PHTX 2J0SD 5HROB 2B5JA 2WHOA 4I9QA 3JTOA 3G4SN 3PCOB 1HPMA 4MYUA 1TKXB 3AAWB 3KK2A 1VYAA 2HHHF 2YNGA 3MM7A 2Z4PA 1LWFB 2FJWA 1PCAA 1R8AA 4A5AA 5AQOA 1NUEA 1U26A 3I5CA 4RBVA 4DUYK 2BM1A 2GGPA 1QTMA 4JAXA 5GAHP 3TSQA 1HWUA 1ATNA 1PGZA 2VPZB 3F73A 5C25B 4ZP8A 3BH7B 3D2EB 1MNEA 5AQLA 3J81O 4NI2B 3DRSA 4ED0A 4WFAL 2YH1A 4K2XA 1H7XA 5AXKA 4C11A 1GFWB 4CEAA 5B08A 2CH5A 4B3OB 1DTQB 3D66A 1RE1B 3HT0A 3MWBA 2VOPA 1SKRA 4DX5A 3DU6A 2VYPA 4O44B 4CGGA 4KI4A 4KRFA 5GAGP 2J9EA 1RQ0A 1TKTB 2HVZA 2KI2A 4DUZJ 3OBYA 3C15B 2ALZA 2YWFA 4Q0BB 2BJ8A 4A48A 4RUHA 4JKHA 1VSFA 2R8JA 2X74A 4XH1A 2Q3SA 5AQQA 1WC6A 2ADCA 2G4BA 4J9QA 4FWKA 2IFXA 2ITMA 4KKOB 3IMQJ 2EI5A 4M5JA 2GJIA 2HK3A 1KTVA 4FYYB 1HLWA 5IS2A 3R2CJ 4GKKJ 2VZ9A 1UPMB 1CLFA 3CIZA 3HF5A 1S49A 5DQIA 2IY5B 4MFBB 1CJTB 1YHQN 3VGSA 1AUSL 3VAJA 3FUYA 3PKMA 5HBMA 3A3PB 1C0UA 2MKCA 5BYQA 3AJDA 3MXIA 3G8QA 3OYEA 4OPAA 5FLXO 2FF6A 1BQMB 1GLBG 4FPAA 4IEIA 3O8MA 4I2PA 1HL6A 3KWMA 1KR4A 2DTJA 2QLXA 4OI6A 4C8ZA 4RU2A 3D0HE 5RUBA 4WFNL 4H8KA 4HT7A 2MTLA 5J2QB 4NLOA 4XK8C 1CQMA 1VRTB 3HHKA 4MH8A 2YKNA 3V81B 2D5RA 1NU4A 2OFHX 7FD1A 4YB6A 3EUNA 3SAGA 2CGJA 2KYZA 3CD5A 4IG3A 2NRXA 2E1MC 1U1KA 3TNVA 2V5HG 3L2RA 4F26A 3OBWA 1J2VA 3AD9C 1DRZA 4PL7A 4ECXA 1K73T 2PMWA 4JI1J 1LXJA 3LO3A 1XQIA 3V9SA 2DIVA 3LL3A 1JLCA 4O0JA 4BC7A 3N01A 2NSCA 4OI4A 5F8HA 5F8JA 2AYMA 3SMSA 2CNLB 4BRFA 2QIFA 3CJRA 1KTQA 2PE8A 1Z25A 4RZRA 3U02A 2VG7B 3CF5L 3VAIA 3OTOJ 1RDBA 1FTRA 3OL6A 2CVEA 5HRPA 1NJIO 3UNYA 2JJ4D 2OPRB 1HFEL 2YX4A 3NE6A 1ACMB 4TU8A 2NZ4A 1U1OA 4GKJF 1Q9YA 1NAQA 1KEKA 5CZ2A 2CZ9A 1RWMB 1ZA1B 4LSLA 3HHDA 3C46A 3Q8UA 2HHPA 1S79A 1VQ4N 1OSDA 2YHBA 3CMAN 3DOKA 3DDIA 4C48A 1VHXA 3TAPA 4N47A 4IYQA 3G2XA 2Z56B 3MM9A 4A46A 3BR9A 3BN4A 4MK9A 4HVZA 3R5BA 5CH7B 4DUYF 1RBOB 2ZBRA 4LY7A 4AQYJ 2MY8A 4LFBJ 3EKSA 3MEDA 3H4BA 2KTQA 2HQDA 5IT9O 1Q78A 1RT5A 3JSMA 5EWFA 3K59A 3SQ4A 4BC4A 1C0MA 2VODA 2B4JA 3O4NA 3T5HA 4HHTA 3AXMA 3RAQA 5IV3A 4H4OA 1Q1KA 1TL5A 2COLA 4C8LA 1REVA 3RMCA 1I3OB 2RKIB 4QYZK 4ZVQB 1RSCA 2CPZA 4NLGA 1WSFA 3CCVN 4ZVUB 4UY8T 2QSWA 3T1AA 2FXUA 5E5NA 3LANA 3C66A 4F3QA 1S4EA 1TK8A 4J9UE 4CGFA 3R3LA 4K0KJ 3IWLA 3BV8A 5DS7A 1XMOF 1U6ZA 3CCJN 2Y1JA 4USVA 4YP3A 3WQTA 3ZX2A 5THWA 3GCXP 4I56A 2YHXA 4X4NA 3EX7B 1HKCA 2ZGYA 1NRKA 2MHEA 1HRHA 1T6DA 2EBEA 4MK8A 1KVKA 5BR8J 4BACA 5AQNA 3NXZA 3GP9A 3FCWA 3VEYA 2ZHOA 2PC6A 4RBTA 1DEJA 5AFUA 1GNKA 4DMNA 3L95X 4C1NI 3QJPA 3U1LA 1Y3KA 2RQCA 4CM2A 4Y2IA 3ZX3A 4K4SA 1IH7A 3M1VA 2DPJA 1E6YA 3OBIA 3ADAC 3RAMA 2MGZB 2HLTA 2WBRA 3V6KA 2AGQA 1VC5A 3M6GA 2HWTA 3OTEA 2HHTA 3CB4A 4K8ZA 4ZLJA 5IXUA 1UVIA 4DU3A 2A6MA 2RB7A 5EN1A 3U9DA 2C3UA 4UQTA 4KGXB 3THPA 1PJ6A 3MN5A 3SDEA 2CQGA 2C3YA 2IYIA 3PNIA 4IH6A 2VC0A 4FVUA 2E5HA 1PSDA 3GSDA 2DVIA 2DBBA 3K5MA 4CNYA 2F63A 3DLHA 5LJ5Y 3LDOA 5F8NA 2GIQA 1G3OA 1NHUA 4DQQA 4DSKA 2A5XA 1HNWJ 2OHDA 5FPEA 3J7ZT