1LW0A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
512
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 146
structure length 512
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw0A05
1KCFA 1LW2B 5KG1A 3PR5B 5F9NA 3NAEA 3V6DA 5I3UA 2QKKA 3QEPA 1ZYQA 4E7LA 4IRDA 4RW8B 3C6UB 3G0ZA 3CYMA 1L3UA 4K4WA 1TK5A 4OVLA 1RA6A 3V9SA 3H2LA 2WTFA 2JEGA 2DFHA 2E6LA 1HMVA 1TL1A 3KMQA 3G6VA 3UDLA 4O3QA 3KD1E 3OSPA 1SL0A 4C8OA 1NNDA 1S6PB 1WNEA 2HAIA 1BIZA 4DWIA 4N56A 2OZSA 1ZBHA 3IS9A 4K8XA 1RTDA 4CFAA 4MKAA 3IG1B 5J2NA 4WXOA 1DTQB 4FCYA 4M3TA 4J9NA 4HUEA 3S3NA 1BI4B 1N5YB 2FVQA 4PQUB 2ZKUA 4IH6A 3BSAA 2F8EX 5KFJA 4N5SA 4C8NA 2V9WA 5HLFB 4CCHA 4DSIA 4FJHA 4BE0A 1NJYA 1I3AA 4MIBA 4Y34A 3RMAA 1JIHA 4ZPAA 2DTUA 4K50A 2YNFA 4PWDA 2XHBA 3OYBA 1VSIA 4KB7A 3GIJA 3LPUA 4U7CA 2ILZA 4Q8EA 5KT5A 3K2PA 4ED1A 1B9FA 5JS1A 4ZP9A 4DL6A 4I2PA 4DL7A 4ZPDA 1LWCA 4E1MA 3ZSXA 4CERA 1SL1A 1X9WA 3VQEA 1ASVA 4EO6A 4W5RA 1HNVA 4CK2A 3CFRA 1HNVB 2D3UA 5I42A 3NAHA 1CSJA 4M3WA 1W0HA 2JEJA 3MXIA 3KK3B 5KRTA 5F8MA 3CWJA 3PV8A 2GC8A 1IKWB 3QINA 4RW7B 2FJWA 1LWCB 3FQLA 1JX4A 1TAQA 3DMJA 4FK4A 3EZ5A 1FKOA 4CJUA 1JKHB 4CEQA 1D0EA 4O0JA 3MEDB 1VSFA 4CJ3A 1HYZA 3C95A 4YP3A 3RR7A 1JLAB 1RTJB 5KGWA 1EX4A 2FC0A 4ZP7A 3MECB 4WZMA 2B6AB 1FK9B 3V1QA 1JXEA 1NK5A 3UIQA 2G8UA 1ZETA 2HHVA 1N5YA 5HBMA 5KFWA 2IC3B 1G15A 4DS5A 4C8KA 2FVSA 4Q0BA 3SI8A 5HLFA 1QE1A 3SYZA 3SPZA 3BQ1A 1RDRA 2O4GA 2C2DA 4CEZA 3DOKB 2ASDA 1EP4B 4IH5A 4FLTA 3QERA 4FJMA 2BRLA 5KT7A 2P5OA 3MXMA 2F96A 3GV8B 1HYSA 4CEEA 1C0MA 1S1XB 1RDCA 3VQPA 3OSNA 2IC3A 2YHBA 4O3NA 4OKEA 4C8LA 3CJ4A 4B08A 3WNHA 4R8UA 3PUFA 4DMNA 2YKNB 3G6YA 1RYSA 3D28A 4IR9A 1JLAA 1QTMA 2ETJA 3MF5A 4J9KA 3MR6A 4FS1A 3H98A 2G8IA 4ZPCA 4IH7A 4R0EA 4B9SA 1GX6A 3DMJB 4QW9A 5DG8A 1TQLA 3HL8A 3U3GA 4XIUA 2VA2A 3FQKA 1X9MA 2D7SA 3C6UA 1WSHA 1VRUB 4KFBB 2ATQA 3K5MA 4KHQA 4CHOA 1JLGA 5KFQA 3VQBA 4DTSA 2G8HA 4NLUA 3RTVA 4DSJA 4NYNA 1S9GB 3OS2A 4KO0A 4LH5A 5KFEA 4O0IA 4J9LA 5L9XA 3TR8A 3UPFA 2QK9A 3E01A 4CJWA 1HNIB 3OL8A 3NF7A 4B9MA 3AVGA 4OGEA 3OS0A 4XO0A 3M9NB 4LQ9A 5CYQB 1DLOB 4FJ9A 5KFZA 4K4ZA 1SKWA 4IKFA 4ZHRB 4Z4HA 4H4OA 5C42B 3SQ0A 2C28A 3GIMA 1C1CA 5KG6A 3FSIA 4FLVA 1SH2A 1UAXA 4ZVEA 5FDLA 4RNFA 3QLHA 3AVIA 4W5TA 4AHUA 4CJKA 4I7FA 3KK2B 4FJKA 5KFHA 4B9NA 1XR5A 1IKYB 4E7IA 1XR7A 4BE1A 4RW9A 2XGPA 3IRXB 4F8RA 4CIEA 4RW4B 3ZT0A 3NBPA 3NF9A 1RTHB 3QNOA 1T7PA 4C8MA 1RTIA 2R2TA 4J2AA 1S4FA 1JL2A 1S1TB 4OJRA 2E6MA 4RG8A 2VG7B 3PW4A 1RT5B 4KI6A 3H5XA 2C2RA 2XRIA 4M94A 4NLGA 4G3IA 3NE6A 2R8JA 1EETA 1CZBA 1SV5A 3QYYA 1RTHA 4Y1CA 3EY1A 4FJ8A 3ZSYA 4MKBA 3SZ2A 3KJVB 4PUOA 4HCBA 5FRMA 4QCLA 1VSJA 5C24A 1U09A 3EZUA 3VQCA 4CF8A 5KT6A 4DF8A 4LSNB 4CF2A 3NMAA 4OPKA 4B9VA 4AHTA 3SUPA 1D8YA 1S48A 3OYFA 4CF1A 1C1CB 1NK4A 2HNDA 3QIPB 3RRHA 3JSMB 1KVCA 3HVRA 4NLTA 4GC6A 1K1QA 3SUQA 1S6QA 1CZ9A 1NKBA 1I39A 4BWMA 3N6LA 1JLCB 3BSNA 4KAIA 1RA7A 2ZD1B 1HPZB 3KK1A 3CG7A 3H40A 4Z4CA 1L3SA 4HUGA 4TYBA 2OPRA 4MFBB 4ECZA 2ALZA 2D0CA 2UVWA 2P51A 2VA3A 1JLCA 3HJFA 3V9UA 5KFYA 3RB3A 1C1BB 3F73A 5KFNA 3OLAA 1R0AB 3PO5A 3AVKA 4FYDA 3NH1A 1T05B 4B8AB 2BQ3A 4CEFA 4NRTA 1MMLA 2QV6A 3WNEA 3K59A 2HMIA 3LDSA 4CGIA 4FJGA 4B3OB 2JEFA 4DLEA 5CYMB 4ZPBA 2HMIB 3HVTB 3HPOA 1FKPA 3ISNC 3VQSA 3TAQA 5F8NA 1W9HA 1NK8A 5HRSA 3ASMA 2GIQA 2DFFA 3E01B 4O55A 4KB1A 2ASJA 1HARA 1YVFA 4CF9A 3KLFB 2GIRA 1YVUA 3PW2A 4E19A 2WOMA 2FJVA 4CESA 2AGPA 1EETB 1JLGB 3QIDA 3PHEA 4CJ4A 1SH0A 2IA6A 4CFDA 1NHVA 4FLUA 4CJTA 2I1RA 2O5DA 4ELUA 1RT4B 3DLRA 2XO7A 2HVIA 4OKKA 2RN2A 5J2PB 2O4IA 4HYKA 2IOCA 3RRGA 1S6QB 3AO3A 3KK2A 2UUWA 4NCBA 3CJ2A 2R7YA 1RBTA 4ICLA 1WSEA 1TKXA 1JLFA 3NHGA 4FZZA 2W7OA 2HHTA 2YNIA 4KRFA 4NCGB 4H4OB 2IGIA 3DYAB 1RTIB 1RT2B 1A5WA 3NGIA 4ECYA 1TKZB 3I0SB 4KTWA 4RZRA 2X74A 3AVNA 3ZT2A 1BCMA 5KT3A 1K1SA 4DSLA 2HNZA 2IAJB 4M3RA 3V9XA 3O3HA 1C1AA 4YMEA 4EO8A 2R8KA 3VA0A 1IH7A 3L2WA 5C42A 4KPYA 3B6OA 1ASUA 1S1TA 3SQ4A 3HYFA 1D1UA 3RBDA 3LAKA 3JYTA 3SNNA 3SUOA 4KHUA 5J2MA 2D41A 1FK9A 1S1WA 1NJWA 3IRXA 4ECUA 4RW9B 4WYWA 1A5VA 4FJNA 4AHCA 4TY8A 4DF4A 4PA1A 4DLGA 2J6TA 1J54A 4DTRA 5T7BA 2W9CB 3T19A 4K8ZA 1L5UA 1KFDA 4H4MA 1KLNA 2UVUA 3C6TA 3OJUA 4WE1A 4TY9A 3QZ8A 4AH9A 3D0PA 5DQGA 2JC1A 4O3SA 4CHQA 2F8TA 1A5XA 1RT1A 2CKWA 2BE2B 2UVRA 1RT7A 4FXDA 4CFCA 5SWMA 1NJZA 3L8BA 4M3ZA 1LAWA 2J6UA 3TQ1A 4RW6A 4JLHA 4I2QB 3TAFA 1UWBA 4IDKA 3PVXA 4OL8A 1QSYA 1T03B 3K5NA 5KFTA 3DOLB 4ED0A 3KKRA 3V81B 3HKWA 3MXJA 3DOLA 2HNZB 4RNNA 4CHNA 1TKTA 3OL6A 1U48A 1XWLA 2R8IA 2LSNA 3U3YA 4H4MB 1TKZA 3VA3A 3AO4A 2VG5A 4DFJA 1KSPA 3DYAA 1OS5A 4URQU 2HWIA 4AHRA 2XY6A 4ECRA 4B9UA 4JRPA 1X1PA 3EPGA 2Y1IA 2VWKA 5EDWA 4EP5A 3DLEB 4EZ6A 2FLPA 3IGVA 4DTJA 4Z0UA 1R0AA 3MEDA 4FLYA 2P5GA 4NLXA 4RU9A 3QESA 5HROA 3NAIA 3MR3A 4KHWA 2BR0A 3VQQA 5L1JA 4IKAA 4EEYA 3HVWA 1RT7B 3RBEA 3FDSA 4E0DA 1ZTTA 1NOZA 4EYIB 4W5QA 2G8VA 5CYMA 5KFXA 3RB6A 4MIAA 3M9OB 5EU7A 3AVMA 3DLKA 2W9BB 4BWJA 2R2SA 4DL5A 4TYAA 3LP1B 4TN2A 5KFFA 4M41A 1NJXA 4FW1A 4I2PB 1IKXA 2OPSA 1S9EA 5E41A 4M3UA 3LZJA 4ECWA 1T94A 4JV2A 1S5JA 3V81A 4KHMA 1SKRA 1L3TA 3ULDA 2X78A 5L1IA 1Z25A 3RMCA 5J2MB 3L2RA 4Z4FA 1RBSA 2OPQB 3KLEA 1DTQA 4WFYA 1IO2A 4CF0A 2IM0A 5F8LA 5KFKA 1XHXA 4RNMA 3H4DA 3MFIA 2GUIA 4Y2AA 3AA5X 4YFUA 4ECSA 1RBUA 2UVVA 3K5OA 2HHWA 3LP3A 4DSFA 3DI6A 1RT1B 3H59A 4K4TA 3IS9B 5KG3A 2IMWP 2X6SA 3ZT1A 3TVKA 4ID1A 1RTDB 1BQNB 3C6TB 1SUQB 1Y97A 3SUNA 1KHVA 3OHAA 4IRKA 3CM6A 3QGGA 2ZQBA 1X9SA 5K14A 4IRCA 3PJXA 2A1RA 5C25B 3PX4A 1J5OB 2QE5A 1QQCA 2WCXA 4DL4A 3KK1B 4Y1DA 1S1UA 3Q8PB 3KMSA 4O3RA 1FKPB 4DQRA 3N6MA 4CHPA 2G8FA 4F4XA 5KFIA 2FBTA 4R5PA 4Q43A 4EBCA 4RNHA 3L3UA 4EBEA 3RAXA 1S97A 5C25A 5F9LA 3CDWA 2XCPA 3ZSOA 4KE5A 2P1JA 4K4SA 3ZSVA 5DLGA 3B6PA 4M95A 1C0TA 3OYJA 4KFBA 2VWJA 5F8IA 5JXSA 4KKOB 3MR5A 5JS2A 1REVA 1ZBFA 2B43A 4NLSA 2OPPA 2WK4A 4FBUA 3CQ8A 4CHZA 4JS4A 4Q5VA 1YTAA 1KTQA 4L8RB 5KFRA 4CJQA 4EYHB 4CK1A 1QSLA 3JSMA 2PY5A 3H5SA 3L2QA 4F4KA 2BANB 1J9AA 4FJ5A 4MK7A 1RBVA 4O5BA 1BQMA 3K57A 4K4XA 3OYEA 1HQEB 3GIIA 4LY7A 3AVLA 2Z1IA 5L1KA 3G10A 5J2PA 4R5PB 2D3ZA 4JV1A 4DEZA 3S3OA 5EWEA 4B9LA 3RWUA 3BSOA 4F50A 1YTUA 3C94A 2QKBA 1TV6B 1S0MA 4DL3A 4CJEA 5KT4A 2BANA 1RYRA 5FDLB 1QE1B 1JL1A 2JLEA 1N4LA 5L1LA 3T5LA 1Z26A 1RDBA 4TSXA 5F8JA 4IFVA 2D0AA 2Y1JA 2B5JA 5CZ2A 2HW3A 2OPQA 4F3TA 1U49A 1QS4A 1KLMB 4E7JA 3V4IB 1WSFA 1MU2B 4UQGA 4RUCA 3BREA 2AGQA 2NUBA 3CJ0A 1HQUA 3LANA 4YQWA 3QLHB 1WSIA 3PW0A 3KHGA 3DRSA 3TAMB 1JLBA 4ZHRA 5DLFA 2FLLA 4X2BA 3LP1A 4RW6B 4O44A 3QGIA 1IKWA 3KNAA 4F2RA 1S9FA 3O4QA 2J6SA 3DLBA 4QW8A 2R2RA 4NYFA 3OS1A 2Z1JA 1QAIA 4BDZA 1RCHA 3OYKA 3LAMA 4J9OA 4FJJA 3RMBA 4ED2A 4KBIA 2A1SA 5HP1B 4QOZB 1D9DA 5J2QA 3OL7A 3ITHB 3V6JA 3RMDA 1N6QB 3OYMA 3RAQA 2OA8A 4IG3A 3VQ8A 3M8SA 3VN5A 4IG0A 3G86A 4OGCA 4TXSA 5DQHA 4HVJA 4JUZA 3V6HA 4OPJA 5C24B 4DFPA 4CGHA 3BGRA 4G1QB 3NH2A 3TANA 1S49A 1C0UA 4ZTJA 4PY5A 4FJXA 5DGBA 4N41A 1S1WB 3ZSRA 3QEWA 1TKDA 3QGHA 4MK8A 2EHGA 3TAGA 3T1AA 4DFKA 4K4YA 1CXUA 2ITGA 3D45A 4O3PA 4CECA 4NLWA 3SFGA 3PX6A 2XI3A 5K14B 5HROB 1RT6A 3LP0B 2XC9A 1SKSA 2AWZA 5KFPA 1VSDA 3H4BA 2D0BA 3QO9A 1S1XA 4OLBA 1JLEA 2JGUA 3P1GA 3I0RA 4O4RA 4ZVHA 1N56A 4QWBA 2ZE2B 2V0NA 1KHWA 4XPCA 1S9EB 1I6JA 4BDPA 3DOKA 2JC0A 3HT3A 4ZP8A 4CFBA 2ASLA 1LWFA 3PZPA 3GQCA 1RBRA 3T5KA 4KTZA 1U4BA 1RT5A 1RT6B 3TAEA 3ZSWA 2OH2A 1JLFB 4Q0BB 3AVCA 1UOCA 4URGA 3ZT3A 4KI4A 1BCOA 1ITGA 2BE2A 5KG2A 3CVKA 2C22A 1GOBA 3CM5A 4RNOA 2FBYA 5CY4A 4HCCA 3Q8SB 4LSLA 2IS3A 2GV9A 3SI6A 3BSCA 1S10A 4I9QA 3NDKA 1TK0A 4KHYA 1NKCA 3BR9A 4ZP6A 4CGJA 1O1WA 5HRRA 5KFAA 3K58A 5EUHA 1WSJA 4FK0A 2F8SA 2AQ4A 2V4QA 4E89A 4ZVGA 3HK2A 2KTQA 2ZE2A 3PJWA 3DLEA 4Z4IA 1C2PA 3NGDA 4B8CA 3NL0A 1BIUA 4WYLA 5J2QB 2HNYA 3UQSA 4FJ7A 4ED3A 3T5HA 2W9CA 3KK3A 1JLQA 4ZMMA 3CJ5A 4DQPA 2KW4A 4B3OA 3OY9A 1ASWA 5DGAA 5I42B 3ALYA 3VQ6A 3MEGA 2W8KA 2RPIA 4O3OA 5T14A 4IR1A 2HHQA 1HJRA 3TAPA 4QWEA 2VG6A 3AA2A 4R8UB 1CLQA 4QWDA 2HNYB 2XY7A 4YNQA 3SCXA 3KLIB 4J9PA 5FROA 3FFIA 1RDAA 1VSKA 2XWYA 1W25A 4DU3A 4O44B 3LZIA 3HHKA 4DQSA 4IG0B 3O3FA 4Z4GA 3V4IA 4QWAA 2WHOA 4KREA 4DTMA 2FVCA 4BACA 4JRQA 3I5BA 1IKVB 3DM2B 3ICLA 4M3YA 4GMJB 1TKXB 1S1VA 2FBXA 3TAMA 3I0RB 4CEDA 3DRSB 5KFBA 3KKSA 3OYIA 5J2NB 2X6NA 2B5JB 4CJSA 4W5OA 3MECA 1BI4A 1RT4A 3DRRA 3Q8QB 2CJQA 3V6DB 4I9LA 4PWDB 1KLMA 1RILA 4CGDA 3VQ5A 2FVRA 4NLOA 3OYNA 4J2DA 4NRUA 3KJVA 4IFYA 4FZXC 3AVBA 1S6PA 1RDDA 4IFVB 2C2EA 4E3SA 2WOMB 2OYQA 4HUFA 2YNIB 4XPEA 1GX5A 4CJVA 1RNHA 1T8EA 3ITHA 1SH3A 1S0NA 1JLEB 4DTPA 2YHAA 4O4GA 3SV3A 4ZVFA 1MU2A 1VSEA 4F2SA 5KFUA 4QWCA 1TL3B 3LP0A 4LQ3A 1B92A 2KZMA 5KTQA 3LPTA 2FLNA 2YNGB 2G8WA 4QAGA 1N6QA 3BGRB 4G1QA 3KLFA 4NLDA 4WE1B 3AVAA 3AV9A 3DLHA 2KQ2A 2G8KA 5SZTA 2D5RA 1K6YA 3N6NA 2E9ZA 3M8QA 3F9KA 2ATLA 1EXQA 3VQ7A 3VQ4A 1REVB 2PYLA 4TQSA 2IAJA 1XHZA 5KFLA 1JXBA 4RW8A 3OHBA 3M8RA 4DTNA 1XR6A 1LV5A 1DLOA 5KGXA 3QETA 3AVFA 1U47A 3P83D 3OYLA 2E4LA 1BQMB 1LW2A 1VK0A 2EX3A 4B9TA 3HXMA 4LD0A 2RKIA 2GBZA 3NKYA 2YV0X 3IGNA 4K4VA 4LH4A 2ZD1A 3QEIA 3SV4A 5JUMA 1ZTWA 4LSNA 2OPRB 5DG7A 1NK0A 3QIOA 3KLHB 3QNNA 5KFOA 3THVA 4FM1A 4KHNA 4GVMA 1QSSA 1CXQA 2HNDB 3QIPA 4J2EA 5F8HA 4FJIA 4CJLA 2RF2B 1HQUB 3NGZA 2DPIA 1FXXA 1RT3B 1QAJA 4DS4A 2R8GA 2IBKA 1RAJA 3BQ2A 3HSTB 4CIFA 4CGFA 3Q8RB 3P5JA 2E9TA 1D9FA 4FJLA 4J2BA 5HRNA 4ID5A 4ZTFA 3LWMA 4J9QA 3O4NA 1QUVA 4CEOA 3CO9A 3VQDA 3OLBA 2KFZA 1LWEA 3CFOA 1TL3A 2DFEA 4CJFA 2RF2A 4DTUA 1IKYA 4OLAA 3VQ9A 3V9WA 3S9HA 2R8HA 4H54A 3HPHA 3ISND 5KG7A 3GYNA 3V6KA 3AA4A 2OPSB 3NBPB 4CJPA 2KZZA 3DDKA 4FM0A 3ZCMA 1BL3A 2W7PA 5KRSA 3AVJA 4CJRA 4EP4A 3HM9A 4I7FB 4DL2A 3CFPA 3KLIA 3I5AA 1IKXB 3DI6B 5CYQA 4KSEB 4JV0A 4J9SA 2B4JA 1NK6A 4F4WA 3T3FA 4IQXA 4ED6A 4KKOA 4MQ3A 3MEGB 2RKIB 1ZBIA 1RT3A 3OVNA 4CE9A 2OPPB 1KVAA 3U6FA 4NZ0A 5KT2A 3PW7A 4DTXA 4DU4A 3H08A 4FLWA 2PYJA 1Q9YA 1TK8A 2W8LA 2V4RA 4Y3CA 3HO1A 4DSEA 4PUOB 3RB4A 3M8QB 4Y2CA 4O4GB 3AO5A 4TQRA 3TARA 4AILC 4FM2A 3LALA 3RR8A 1HNIA 3QZ7A 1ZBUA 1J53A 4ELVA 4DFMA 4NLVA 1LW0B 3L3VA 5F8GA 3DLKB 1SL2A 1SUQA 4F4YA 2VG7A 2YNHA 4BE2A 3NH0A 1S9GA 1WN7A 4Z4EA 4YR3A 5HBMB 3TABA 2VG5B 2W42A 1Q9XA 5EWGA 3M8PB 1NHUA 3VQAA 3GV5B 1S1VB 4E1NA 4Q45A 3DLGB 1C6VA 1HYSB 2E9RX 3KLEB 4IFYB 1TVRA 1BQNA 3AO2A 2XGQA 1VSLA 2WONB 1HRHA 5KFSA 3DRRB 3CDUA 3GV7B 1TP7A 3M8PA 5DMRA 2Z1HA 2FVPA 1EP4A 4DG1A 3FRZA 4RW4A 4I2QA 3IG1A 2EC0A 5KG0A 1F21A 1BHLA 3I8DA 2Q3SA 2HVHA 2QXFA 3KTQA 4KO0B 3O3GA 3KD5E 1IKVA 3DM2A 3RB0A 3SPYA 3KLGB 2HHUA 5KFMA 5KI6A 3T5JA 4H8KA 3NCIA 3IAYA 2BGGA 3PW5A 2W9BA 2AU0A 4DSKA 4Q44A 4N76A 4CEAA 3NF8A 5KFVA 4RW7A 2XY8A 2YKMA 3KLVA 3SQ1A 1YT3A 1TAUA 5HRPA 3MFHA 4IDKB 3CJ3A 1U04A 4F4ZA 2VG6B 4E7HA 5J1EA 3OYCA 1VRTB 4KV8A 4FLXA 2AX1A 1VRTA 1NKEA 2YNGA 2YKNA 1GOAA 1BGXT 3GILA 1IG9A 3PX0A 1UA0A 4NCAA 4W5NA 4DQIA 4ECTA 5C5JA 2IJFA 5DK5A 4NLPA 4CJ5A 3HVAA 1T03A 3WNFA 2BRKA 3HP6A 1WAJA 2R2UA 1GOCA 2IDOA 1TVRB 2AGOA 3QEXA 3OL9A 1KRPA 4M3XA 1RT2A 1HMVB 2BQRA 3GIKA 4ED7A 3PR4A 1S0OA 4OKJA 2IM2A 3A2FA 4FLZA 1TGOA 4DG1B 1UA1A 2PZSA 2XCAA 1WSGA 1RTJA 2HB5A 1TKTB 1UWBB 4YR2A 2RDIA 4IOBA 4CIGA 1N48A 1NOYA 2YNHB 2IM1A 4Q8FA 4ELTA 1JKHA 3G6XA 2WONA 1FKOB 1WNSA 3D5MA 2XI2A 1KVBA 4LSLB 3KHLA 3AA3A 3DLGA 1IM4A 1T3NA 3KIOA 4DU1A 4IBNA 1LAVA 4CK3A 4KAZA 2B6AA 3QO9B 3DRPB 1TL1B 1ZBLA 1L3VA 1VSHA 4EZ9A 1EKEA 4DQQA 4NCGA 3OYAA 5J1EB 3TWHA 4TY8B 4HKQA 3LWLA 4N47A 4GW6A 3ZSQA 5KFDA 1LW0A 1JLQB 4NYZA 3NF6A 4M45A 1JXLA 2JEIA 4KTQA 4FVMA 5KG4A 3OJSA 2YKMB 1D5AA 1C0UB 4M42A 4MFBA 3LP2A 3EPIA 2W9AA 1C1BA 2YNFB 2I5JA 3M9MB 2DY4A 3SJJA 3KLGA 4HTUA 3CDEA 3I0SA 4BDYA 5KFGA 3L2VA 4U6PA 2XY5A 3OYHA 4KV8B 5HP1A 3JYTB 2BDPA 3KHHA 1NK7A 4KHRA 1DTTA 4PQUA 1HYVA 5EWFA 4RUAA 1LWEB 3AO1A 3L2UA 2I5JB 3TI0A 4E7KA 1WLJA 1T05A 3V9ZA 1JLBB 4NLRA 4FZYA 1HPZA 1LWFB 1C0TB 3ZSZA 4IG3B 4ECVA 3AVHA 2WRMA 4CEBA 3WNGA 2ILYA 5DG9A 5KFCA 4FK2A 3IN5A 1Q8IA 4URSA 3SQ2A 1B9DA 4J9RA 3NGYA 3HP9A 5CZ1A 2UUTA 4KB0A 3S3MA 4ICLB 3MAQA 5KG5A 3H5UA 1SV5B 3H5YA 4TLRA 1S1UB 3KLHA 2HWHA 2AX0A 2IM3A 2HHXA 3ZT4A 3MEEA 5D3GA 1U45A 3KOAA 2BQUA 1DTTB 4QPXA 2RDJA 4GC7A 3BQ0A 3MEEB 5D3GB 2HHSA 4ID5B 3CIZA 3OYDA 3V1OA 4EBDA 4YR0A 4K4UA 4MH8A 4JS5A 4ED8A 3K5LA 2FBVA 1TV6A 1KFSA 1XC9A 4FS2A 1NK9A 4WFXA 4FW2A 4ECXA 2IJNA 4WFZA 5DQIA 4HHTA 3MR2A 3SFUA 1Z4UA 3PO4A 3HVTA 5I3UB 4NLQA 1VSMA 1HQEA 3I5CA 3MTKA 2DPJA 4MK9A 3HPGA 2FJXA 4WZQA 4FBTA 4CGGA 3NFAA 1WAFA 4AHSA 4DTOA 4J9MA 3EYZA 4AHVA 3DRPA 4KHSA 3LP2B 3OYGA 2OZMA 4CHYA 5FRNA 3QEVA 1QHTA 2Z1GA 1XI1A 4NLYA 3BJYA 3V1RA 3PY8A 4ECQA 3UR0A 1J5OA 3FFIB 4F3OA 3E51A 3BDPA 3KHRA 2WB4A 1VRUA 2KFNA 4WXWA 2AJQA 1BISA
chains in the Genus database with same CATH superfamily
3X1LB 3CCJS 5AQKA 3L4BC 1IBLK 5GAGU 2D3OR 1K73O 2U2FA 5F9NA 4X65J 3V6DA 3MM8B 4E7LA 4IRDA 2EEYA 4RW8B 3GOIA 1L3UA 2ZNZA 3H2LA 3BS9A 1UJ4A 2RUGA 2DFHA 4P52A 1HMVA 2MGZA 1WC3A 2V67A 2Q36A 4O3QA 4CLFA 2NZ4A 3HX9A 3AY0A 3OSPA 1WNEA 1ZBHA 4CFAA 3E9PA 1IV0A 2E1RA 3HLUA 4Q2LA 4JKGA 4HUEA 2Q2RA 4PQUB 4DR2J 2F8EX 2A42A 4C8NA 2AYMA 3W2WA 3WIUA 3M5RA 1O8BA 1TUUA 1NDCA 4DSIA 1F2GA 2QL7B 5AQMA 4Y34A 2RNEA 2NNWA 2DTUA 2HHHK 4CLUA 2MKJA 1VQPN 2CQPA 2G1DA 5GAEI 2I2YA 5TKYA 1P8ZA 1R3NA 2MY8A 2KVQE 5AXLA 5BREA 5KT5A 4OYXA 2QTWA 2P8IA 5CH7B 2RB7A 1YK9A 5G0RA 4JI2F 1QZ5A 2J7WA 1ELOA 3ZSXA 4E1MA 1M5VC 5ETKA 4X66F 1ASVA 4W5RA 3MOZA 1FO1A 1GH8A 4CK2A 1W2BM 4DHYA 2G0JA 4HH1A 4RBUA 3PRVA 1J5EF 3CFRA 2VPZB 2Z2YB 3W2VB 4M3WA 3A5OC 2GIFA 3VTHA 4XH1A 3KK3B 5KRTA 2WW8A 3QINA 4UOFA 1XQSC 2AEFA 3C46A 5IZHA 1LWCB 1NGJA 1J6ZA 3DMJA 3EZ5A 2JL9A 3CCLS 2MQLA 3TZXA 3G82A 2ZZMA 2V2QA 1VSFA 4YP3A 1X0FA 5KGWA 5IXUA 2FC0A 4ZP7A 3DNCA 4WZMA 2I8EA 5BN9A 1YAGA 1FK9B 1B3TA 1NWKA 4PG4A 3QDKA 1EHWA 1ZETA 3KG0A 4BRFA 2Z8QA 2IC3B 2C3UA 3NWRA 2FVSA 3OVSA 1UFKA 1OVYA 3BQ1A 1YJUA 2C2DA 5AQTA 2PN6A 4QOTA 3CJ9A 4RTFD 2BRLA 2XMWA 2P5OA 4QR2A 1HYSA 1W2BR 4HHHA 3VQPA 3CCQN 2IC3A 5ADXA 4P2SA 1MWKA 4C8LA 3SQGA 3WNHA 4R8UA 4FWLA 3PUFA 2DH7A 4DMNA 3G6YA 3MPUB 5E33A 3D28A 4LF1A 3J7AN 1YF5L 1QTMA 3MF5A 2NUHA 3HCXA 2DO4A 2CJAA 1FXLA 2E1AA 4ZPCA 5E3QA 4IH7A 2KL8A 2J8AA 2WSFC 1GX6A 4WIIA 4QW9A 5DG8A 5F3ZA 1TQLA 3HL8A 5BPLA 4XIUA 1AFJA 3NXZA 4KH1B 2VA2A 1X9MA 1UCNA 2ZWHA 2XM3A 2D7SA 1YITN 5JVGL 4KFBB 3VQBA 4LF7J 3C15B 5DJBA 4WCEL 2QFIA 3L7UA 5L9XA 1WF1A 2QK9A 3NVMA 4CJWA 3NS7B 4LF6J 4RKUC 2C2KB 3AVGA 3ULHA 4ZLPA 4LF2A 3CC7N 3N79A 1UVLA 4JI3F 3LGMA 4UF4A 4KYZA 2DNOA 2OD4A 4K4ZA 3CJKA 3J7Z5 4IKFA 2F40A 5C42B 3SMPA 3GIMA 2RJZA 2V94A 3FSIA 2QM1A 2E7WA 2DRAA 3QLHA 2QA2A 4W5TA 1TMJA 4CJKA 4I7FA 3MMVA 4JKGB 3A8JA 4BE1A 4NASA 3CCUN 1S76D 3MWBA 2R7TA 1UEKA 3ZT0A 3F44A 1JCEA 5HMZA 4OLPA 1MDUB 1RP5A 3G6ES 4J7CA 1VC5A 4FN5A 3W3DA 2E6MA 4NMXA 2WVFA 2XRIA 4G3IA 4DV6K 3GSDA 2AYGA 1RCOB 1SV5A 2K2PA 2U1AA 2CDQA 4Y1CA 2MKKA 1VSJA 2VDIA 5C24A 3VQCA 3UD5A 5CE3A 4DV0K 4LSNB 2DISA 4EK2A 4OPKA 1H1VA 2W1BA 4IO8A 3CC7S 3OYFA 1E6YA 1NK4A 3HVRA 1KVCA 2IIRA 1K1QA 3W61A 2VDHA 1S6QA 3MURP 1SQFA 1KD1T 5AQOA 1SQGA 2ZD1B 2POKA 1M1KT 2WFBA 2UUAK 3H0PA 3CG7A 2X3GA 4PG8A 2BE7D 4CI0B 2E5IA 4FVUA 1RWMB 3VGVA 4HUGA 2B56A 4QYZJ 2D0CA 2P51A 3FGVA 3LM9A 3RB3A 4JV5F 1RAEB 1R0AB 3AVKA 3AA8A 1WHVA 3JSYA 2VASA 1U8WA 2HMIA 3LDSA 4CGIA 4FJGA 5DZ7A 5CYMB 3HPOA 4I6WA 3VQSA 3TAQA 1W9HA 4ENOA 1U0HB 2PT0A 1GLDG 1SJ4P 3FC9A 2IRXA 4ER8A 2GEMA 4KB1A 3MM7B 4ANDA 4DPWA 4UZBA 3LGHA 2GIRA 2PSZA 3HD2A 2R7WA 3MI7X 4YB5A 4GY2B 5FIIA 4CESA 1VQMS 1EETB 1SH0A 3OTOF 1IBKF 4FLUA 4CLYA 3DLRA 1MROB 3BF1A 3OQ2A 2GGPA 4V1Ak 3NCQA 3VGLA 3CJ2A 1RBTA 4ICLA 1VRQC 3MX2A 4FZZA 2W7OA 2E7VA 3DXBA 4DR3J 3VEYA 3CCJN 2GX9A 4H4OB 2CFXA 1WI6A 4AXIA 1Y3JA 1X60A 3NVKA 4RZRA 3W65A 1K47A 4JEPA 4Y2IA 1K1SA 1T3OA 2A2CA 1GTHA 3ENBA 2Q0RA 2LKZA 3FZMA 2XMUA 1KQSM 3ILLA 3L2WA 4B3SF 4L76A 4KPYA 2DR6A 5LMUK 3O6QA 5AE1A 2D1KA 1S1TA 3U1LA 3L09A 3RBDA 3KFWX 2DITA 3FBEA 1FK9A 2ZH1A 2MZJA 1RK8A 4FJNA 5B0FA 4B3RJ 2ZUGA 3O8WA 5CCLA 3HHLD 4TU9A 2NLXA 2DKOB 2J6TA 2NRWA 5EOYA 2BW2A 2MQPA 2V8PA 1FJGK 3R5CA 1KVJA 4NXMK 3ZTSA 1L5UA 1VMBA 1YHQN 4H4MA 3QRQA 3LDPA 5IT9O 3GMGA 3QZ8A 4FWKA 3WT0A 4AH9A 5AFUH 4P75A 3OR1B 2F8TA 2L41A 2HRUA 2WSCC 4DB3A 3KVGA 1RT7A 4CFCA 1K8AT 5SWMA 3VEZA 2NYIA 3KG4A 3TYTA 1LAWA 5FPMA 4AT1B 5CCMA 1EARA 3TSPA 1K44A 3ET6A 1M5SA 5BRFA 1RWPB 3FZLA 4C6AA 5KFTA 2ZOGA 4ED0A 3VQTA 4AQYF 1U48A 2LXFA 5CD4H 1XWLA 4PXDA 1IUJA 2H65B 2FF6A 3AO4A 5RUBA 2D3O1 2VG5A 4DFJA 3MMAA 2D0OA 1KSPA 4AUKA 3B54A 1OSDA 3VVUA 4OX6A 1SXLA 4PWWA 3NLCA 4LF8K 3GIRA 3IBCB 1VQLN 3VAGA 4ZN3A 2VWKA 3FNNA 5HMWA 1RHMB 2J9CA 5EDWA 1MW7A 1SPBP 2VYPA 2DGUA 3W8PA 4EZ6A 4UOCA 3FVYA 1P9YA 3D4JA 4NLXA 3HHLC 3R9LA 3HZGA 2LQ5A 2BR0A 4IKAA 4EEYA 4USIA 4DR6J 3SCJE 3HVWA 1XMQF 3CD6N 4E0DA 4JYAK 1NOZA 4EYIB 2OUGA 3J81j 2FY8A 1NH8A 1QVFR 4MIAA 4JK7A 5THWA 1RBLA 3THYB 4DR2K 2R2SA 1IR0A 4DL5A 2A41A 3TPQA 1IVZA 3LP1B 3C8YA 4TN2A 5KFFA 1E4FT 3PKYA 3W63A 2ZKTA 1IJJA 2CGKA 1D8ZA 2OGUA 1FDBA 4QR1A 3W8GA 1KAZA 3ATVA 3V81A 1OH6A 3EVMA 1PBAA 2N4DA 3M4XA 5BRHA 3E9LA 3L2RA 1V5IB 2GAHC 5ETMA 4W4MA 4Z4FA 4CDIA 2OPQB 3KLEA 1DTQA 2Z2ZA 2JWNA 5KFKA 2CQCA 2OLWA 4OPAA 4WU2A 3MFIA 2GUIA 2G4BA 4YFUA 4FPIA 3K5OA 2YWHA 4DSFA 1ZXOA 3GL1A 3HJVA 5HN0A 3D68A 3IS9B 4ILLA 5KG3A 4YDUC 1X4DA 1F3VA 3WX8A 1BC6A 1RTDB 3C6TB 4ZLJA 2H54B 1TUGB 3A8YA 4XK8C 4JI6J 2G2ZA 3M6WA 4IRKA 1HNWK 4IEEA 1C0GA 3DXMB 2E2NA 2LDYA 2ZQBA 4FL9A 3IR7B 2NREA 1E3MA 1J5OB 3ZTPA 1UPPA 2NXEA 1QQCA 3R1XA 4DL4A 2CQDA 2Z57B 1VQ4N 3IBFB 2VBWA 3KMSA 1MROA 1HNXJ 4A2BA 1FKPB 1NDPA 4CHPA 3VPZA 2ZJRL 4CTAB 4JI1J 4R5PA 2GQQA 2HBYB 4EBCA 2B3TB 5F9LA 2XCPA 5T41A 4K4SA 4RWTA 3IWNC 5B09A 1C0TA 2WTUA 4K43A 5F8IA 2XNRA 1JQGA 4ES1A 5BR8J 4WCEQ 1CPZA 1ZBFA 2BJ1A 4FBUA 3CQ8A 2QA1A 3FBBA 4CHZA 3EE3A 1KTQA 3ZTOA 2RU9A 4DPUA 1HJOA 1APSA 2XYPB 3UDCA 1QSLA 3JSMA 4W92B 3CC4N 1DZ5A 4FJ5A 3D1OA 3K57A 3TZWA 3BH6B 2M9KA 2Z1IA 2F4VJ 5J2PA 3UR3C 2HVEA 4ANCA 2R9LA 2VQFJ 2V51B 1JJ4A 4KH4A 5G4DA 3FZBA 4CZHA 4OX8A 4ERDA 1T9XA 1YTUA 3P49B 4GV6A 5LXYA 4MT1A 5D0HA 3J80Y 2CA9A 4CJEA 3RU0A 1QE1B 4DI6A 4IJAA 2JLEA 1DT9A 5L1LA 4M7YA 1T3VA 2ZOFA 3MN6A 1VAZA 1Z26A 3VGTA 5ETOA 4TSXA 4WKYA 4IFVA 5I3QA 3SMZA 1PAUB 1HWKA 2CWKA 2W4CA 4LRDA 4PKDB 4USTA 1N33F 1U49A 1QS4A 4E7JA 2Z0GA 2O66A 1U6FA 4RUCA 3BREA 2P9NA 2H9ZA 2PI5A 5C7PA 1KP6A 1FTRA 4DV7F 1HIYA 2OD6A 3DLLL 3DRSA 4RL1A 1N32J 3TAMB 4LF9F 3VEVA 2FLLA 3CXCM 2GWJA 1CQNA 3QGIA 1IKWA 5HOOA 3O4QA 5I3PA 3DLBA 4GV3A 4QW8A 2BH1A 4Y00A 1WWHA 5M1NA 3THXA 3ZZ0A 2Y3YA 4LFCK 3CCUS 2YX4A 3LO3A 1D9DA 4DDFA 4NX9A 4PYAA 2EFPA 3VQ8A 3VN5A 4TXSA 1DGKN 2HFNA 4LF9J 2QA4G 4G1QB 3NH2A 3HFVA 1S49A 3JXOA 2G9OA 5F3TA 1WOSA 4C3MA 3D66A 3TA0A 5AQWA 4B1XB 3QGHA 5FLXO 4MK8A 3Q24A 4JN4A 3T1AA 4DFKA 4K4YA 2ITGA 3QBWA 4CZEA 3A1YG 3MUTP 5K14B 4CP5A 2XC9A 4A8KA 3UN5A 1SKSA 4L3QA 1VSDA 3QO9A 2DGSA 4YORA 1VCTA 3T9ZA 2BBEA 2UU9F 3CCQS 2DNHA 3I0RA 4O4RA 1N56A 4QWBA 2ZE2B 3MM6B 1CJTA 4XPCA 1QUPA 4JI7F 3MDQA 4DL0C 4K0KJ 3BYPA 4BC7A 3HT3A 4WP8A 2DNQA 4CFBA 5HK4A 1NPRA 4OI0A 2KI2A 5JVGQ 4CBWA 4KTZA 4WQ4C 2XHCA 4X4NA 3A5NC 1P9QC 4K8RA 3AVCA 3U4LA 2M4MA 4RLEA 1UOCA 1Q95G 4URGA 1ITGA 5KG2A 3CVKA 3CM5A 1GXLA 4RNOA 2O8FA 3DDIA 3SI6A 1YITS 2Q0UA 2CWXA 2OO4A 4KHYA 1NGGA 4X62F 4CGJA 4NEYA 1ILYA 1O1WA 3VF6A 5HRRA 5KFAA 2HSEB 3W9HA 3K58A 1XMOK 3TO8A 3GJQB 3HK2A 4U7UD 3NGDA 2CJXB 3MAHA 3NL0A 5BJRA 4WYLA 1N36K 3UQSA 2OELA 3UCZP 2AJFE 4ED3A 4JKDA 4YB7A 2W9CA 1JLQA 4DQPA 4LMZA 3EZOA 1KAXA 3OY9A 1ASWA 1AT1B 3ALYA 1BLUA 2APOA 2O8BB 5T14A 2HHQA 2CPJA 2VG6A 4BRQA 3AA2A 4OX9F 1HI1A 2HNYB 1VC6A 4YNQA 4DV0J 2YWGA 2UU9K 3KLIB 3A3PB 3G9CA 3IAM9 1W25A 2GJ2A 3UW1A 1SKUB 2WHOA 1XMBA 2FVCA 3QFWA 1ITPA 4BACA 4JRQA 1NXIA 3I5BA 3DM2B 1EWQA 1Q7YO 4HL9A 1WG1A 4QS7A 3W2WB 4JAXA 4KGMA 4JOUA 3DRSB 1Q82O 1UFLA 1JJCB 3OYIA 1RWKB 5J2NB 5IFMA 3D6HB 1U1QA 3DRRA 2Q1LA 4DR5J 2VFSA 1JCGA 3AVBA 3Q7CA 1RDDA 4IFVB 5ETLA 2WOMB 2YNIB 3MCNA 4CJVA 3H25A 1RNHA 3ITHA 1S0NA 1JLEB 1B0TA 4DTPA 1VSEA 5LJ3Y 5M1FA 2YQ0A 1TL3B 1B92A 1RKJA 1WKJA 1RWVB 2UV8G 4CO0A 2VQFF 4U7BA 2YNGB 3BGRB 3KLFA 3DC2A 1HA1A 3AV9A 2KQ2A 3KKFA 3GLJA 1JXVA 5HSPA 1FRLA 1XMQJ 2ATLA 1EXQA 3I9ZA 1P27B 1BUXA 3EGWB 2PYLA 1F9HA 4I4BA 3OHBA 4L75A 2AF6A 3I56N 5KGXA 1XC3A 2E1ZA 4QYRA 1RAGB 4EFAC 4M7XA 5AQLA 3NKYA 2YV0X 3TX8A 2CYYA 4O5FA 1HBMB 2FYXA 5JUMA 5DG7A 1FFWB 2A0FB 1A0OB 3SMSA 1MMNA 1W26A 1M1HA 2M2BA 2XSJB 4KHNA 4QBUA 1CXQA 3QIPA 5KQDA 2CPIA 3P5BP 5CABA 2RF2B 1I94K 2QFJA 1HQUB 2A6OA 1LFPA 2R8GA 5ELZA 1YWXA 5GMKa 2P9GA 2ZZTA 3HI9A 3P6YC 1LOUA 2J8SA 4JKAA 2RMLA 4YY3J 5C0YA 1YBTA 1Y5LB 3KZBA 2XYHB 3IR5B 2LDIA 1VQ8N 3VQDA 5CHCB 1LWEA 4DV1J 3QPIA 2RF2A 3KNGA 3T6JA 2W6KA 2AP1A 1HI8A 4OYAA 4OLAA 3VQ9A 2P9LB 4JI7J 1SJ1A 3V9WA 4AL7A 4TKTA 5B0DA 4H54A 3ISND 5KG7A 3GYNA 2UU9J 3ZETB 3V6KA 3AA4A 3NBPB 1RB0A 2WVEA 4DUTA 2W7PA 1HHSA 3VGSA 2B7BB 1AA1B 4A46A 3PIOQ 1XNQK 4DL2A 3CFPA 3ZZRA 3I5AA 3DI6B 1UZHA 5CYQA 2B4JA 2QGFB 1NU0A 3DHXA 2H48B 3GJSB 4IQXA 3E2EA 2DIVA 2ZBCA 3J7ZT 1V4TA 2RKIB 1ZH5A 2J0SD 1J27A 2VC1A 1HWUA 2ZJQL 2RILA 3VF2A 4DTXA 4FLWA 2PYJA 1U7LA 2ACYA 1KR4A 3AO5A 1MMDA 4HT5A 1E6VB 4DR6F 5A6WA 4Y65A 3S8SA 3JTOA 3LOUA 1SL2A 5F8GA 3PNIA 2YNHA 4C97A 2CZVC 4Z4EA 3M30B 2W2PP 3THWA 3W60A 1URRA 3TABA 2VG5B 1RQ0A 2XZWA 1N32F 4WQ4A 5AQHA 3LUYA 1RWUA 3C65A 1NHUA 2Z4PA 4JBCA 1WBBA 4Q45A 3ZEUA 1TVRA 2VQEJ 4DV5J 2XGQA 1CBKA 5M2UA 3C16B 1KC8O 2E7XA 5E5NA 3DRRB 3CDUA 4MO5A 2VL1A 4X64K 2C2MB 3VVTA 2Z1HA 1F5CA 3Q22A 2ERRA 4UOHA 4DR1F 5GAEP 2GVZA 4DG1A 3TEHB 3NG8A 1IBLJ 4RW4A 3RZAA 2WBNA 3IG1A 2EC0A 3D0HE 2Q3SA 3FKBA 4C8YA 2P9UB 4IYQA 4KGVB 3HTVA 3RB0A 2QWRA 5HANA 3VAJA 2MYFA 3T5JA 2QI2A 3NCIA 3IAYA 1U1PA 2BGGA 2F4VF 3IDHA 4YDXA 2W9BA 2FLOA 2AU0A 4C7QA 5ADXH 3VF0B 1IR1A 1YJTA 5KFVA 2OEMA 4KR0B 4RW7A 2YKMA 1T95A 3W3SA 4OO1J 1WC5A 2GMHA 5HRPA 3U27A 4FNIA 2DR5A 1VISA 2H5JB 2VG6B 1VRTB 3Q23A 1X4HA 5LY3A 4GO7X 1PO6A 5T7LB 2KKZA 2M7SA 3HHLA 4V19J 1X4BA 2KB2A 4L3NA 2IRYA 5K8MA 1BD6A 3P8BB 4ECTA 1VYAA 4DV6J 4ZPTR 5C5JA 2W2OP 3DCAA 5ETRA 4IO9L 1RBOB 1EO1A 4NLPA 5K9FA 4CJ5A 4CW7B 5K8OA 3WUHA 2IDOA 2JVOA 2EFNA 3CB4A 4PRFA 3AAQA 4M3XA 2GHPA 4BGAA 1S0VA 3GCXP 3PR4A 3VEOA 1RWNB 4OKJA 2WBMA 3A2FA 2LA4A 2BJ9A 4RX6A 4X4RA 2VCPA 4AYBD 2XCAA 2MKSA 2HB5A 5C10A 1UWBB 4CIGA 4DZDA 1N48A 3MWTA 2IM1A 1H98A 3G6XA 2WONA 1CJTB 4DR3F 5IM0A 2OANA 3CJQA 1WNSA 4H5TA 3E8OA 2XI2A 2E1CA 3HKZD 4ZVQB 3KHLA 3DLGA 1T3NA 5CAAA 4DU1A 3B4MA 4A61A 1QHAA 2XO6A 2HURA 5F1XA 3OTOJ 1ZBLA 1VSHA 2DPNA 1VBKA 4WKRA 3H7HB 4DQQA 4NCGA 1EKEA 3OYAA 5J1EB 4OIXA 5B7WA 2CQ1A 5LMNK 4TY8B 3LWLA 4JHDB 2HBKA 5LL6Z 1JXLA 2JEIA 5KG4A 1RHRB 2YX1A 4L73A 3ZX3A 1C0UB 2JJ4D 4M42A 5DM7L 1X5PA 2LQ9A 3CMES 2I5JA 2AA4A 2DY4A 3SJJA 2RQKA 2GFFA 3TUJC 4HTUA 5KFGA 1HBUB 4U6PA 2XY5A 1U6BA 1A6LA 1U1LA 2FZCB 4KV8B 1X4FA 2JFDA 1RAOA 1P6TA 1VS3A 3T1YJ 3IM8A 1T44A 1VDHA 4XH4A 4RUAA 3NGKA 1FJGF 3L2UA 3TI0A 2PIIA 1IR2A 4E7KA 2FJBB 3VR1A 2K8GA 2EPIA 4F4AA 5D0RA 5E3PA 2KHCA 4FOIA 3W7BA 3UKUB 3ZEUB 4FK2A 1Q86T 1FRJA 1Q8IA 4J9VA 5JMNA 4CJ7A 3J7A1 3IC1A 4J9RA 1UMJA 1C0FA 3ZX0A 3UKRB 1SV5B 1S1UB 2IM3A 4IOAL 4LT6A 5D3GA 1U45A 4H0OA 4M5MA 1CJVB 2CAJA 3CIZA 1UWAA 4LR8A 4K4UA 4HR2A 3CO0P 3MM5B 1Q53A 3QICA 5H9FK 2O01C 3K5LA 3PACA 4FS2A 3VEWA 1NK9A 3UO0A 4WFXA 3O9RA 4ECXA 2DGQA 2VOPA 4WF9L 3MR2A 1Z4UA 2QLWA 1TYQB 1VSMA 2WVDA 2DPJA 2IFXA 4YOYA 4MK9A 2FJXA 5DM7Q 4WZQA 2NSBA 2CZ4A 2QA4N 2EVZA 1HX1A 4K5RA 1U1KA 1FERA 3NFAA 3VALA 3EYZA 3L7PA 3W5XA 4KHSA 2ZHAA 5JVHQ 4WIQA 3QEVA 4JI3J 3N28A 2IVYA 3BJYA 3PY8A 3V1RA 2I7NA 1J5OA 3QFHA 3PRBA 3DLLQ 3AT1B 1F2HA 3ELHA 2FJDB 1MWYA 2WB4A 2YHWA 4WXWA 1BISA 1RADB 4M5IA 1LW2B 4LF7F 4DCPB 1U1OA 3R1HA 3PR5B 3NAEA 2WZ1A 5I3UA 2QKKA 1GLJO 4IO9Q 1TK5A 3V9SA 4DX7A 2V4JA 3J7ZO 3KMQA 2OP5A 3UDLA 2PC6A 3D1HA 3SCKE 1RWXB 1S6PB 1Z2ZA 2A6AA 2DHHA 2HAIA 4CM0A 1RLCL 4K8XA 2M0GB 2M8DB 2MKYA 3OFHA 4MKAA 2GJFA 4J9NA 5IT0A 4YOEA 3S3NA 2FVQA 2ZKUA 4UT4A 3M8WA 4LRAA 3A8IA 2P6TA 3TSUA 3OD2A 4XEIA 4FJHA 2HWTA 4NPOA 2HGNA 3F41A 4MIBA 2W24A 2CIMA 3RMAA 1JIHA 1PAEX 1IBKJ 3MUVP 4K50A 2YNFA 4CO3A 1GLAG 3K2PA 4C9DA 5EN1A 3G71S 5IQQA 4ZP9A 1QQMA 1L3KA 3RUBL 4C48A 3N4QA 4QJVA 4ZPDA 4IZ9A 4JI0J 4CERA 1SL1A 2V52B 1XBWA 5GIPA 2G1HA 4WTYA 3C6AA 1FRMA 1HNVB 5BPNA 1U1MA 1R43A 2Q97A 2COLA 2M3DA 3CPWM 3HI0A 3FMBA 1G7CB 2AW0A 4ZCMA 5F8MA 1D09B 2GC8A 1IKWB 2BKOA 2VU5A 2FJWA 1TAQA 2CG8A 2CQIA 1BQXA 4PHTX 1DQAA 3HSJA 3K5PA 2LQJA 4ILJA 4CJ3A 1HYZA 2GX8A 1RTJB 4F25A 3V1QA 5IV4A 3UIQA 1N0VC 4BS2A 3VAKA 4YEAA 4ZVPB 5KFWA 1NGIA 4PL7A 4DV4F 5KQ8A 2M8HA 2CPFA 2O4GA 4C4WA 2ASDA 1EP4B 4IH5A 2P9EA 4ETZA 1K8KA 4YDDB 2KH9A 2K1RA 2Z58B 3MXMA 1NRKA 3GV8B 3CJ7A 1VQNN 4CEEA 5LSLA 2N7YA 2HPUA 3EXCX 3LH2S 3BO2A 1FWPA 4X4TA 4CLZA 2YHBA 4DR3K 4OKEA 3CJ4A 2JZ5A 3FJ2A 2YKNB 1RYSA 4NXMJ 4IR9A 1JLAA 3SBMA 2XBPA 1Q16B 1ICEB 4FF4A 3MR6A 3H98A 5ETQA 3L9ZA 3PYDA 1VQOS 4HI1A 2QO3A 1X4AA 1WG5A 1GLEG 4CLLA 2C2NA 4JKEA 3FQKA 3I56S 3HSDA 4H5VA 4CHOA 2LYVA 1JLGA 1DY3A 2G8HA 3QBCA 2ZBRA 2HLTA 4JI0F 1Y9OA 4KO0A 2MGZB 5KFEA 4LH5A 2L3MA 4J9LA 2O8EA 3UPFA 3ZO7A 4LF6F 3O80A 4IOXA 1E6VA 4WP3A 3NF7A 5E2QA 3CJCA 4YOWA 1WEZA 2E1MC 1VQNS 3OS0A 3SDEA 3ENWA 2ZM6K 2ZM6J 4LF6K 4ZHRB 3BPDA 4QYZK 2RHSB 2W25A 2DEJA 1C1CA 4FLVA 4ES2A 5LSRA 2QZ8A 5BN8A 1YZ7A 3FK4A 3ZXWA 1XR5A 4E7IA 1XR7A 4QS9A 4RW9A 1GMWD 2XGPA 4F8RA 3P45B 2B9XA 3SSQA 4CIEA 4QS8A 3NBPA 3BZQA 1RTHB 3ZETA 2N3OA 1RTIA 2R2TA 1VHFA 1JMTA 3WC2A 3AQPA 4J2AA 1U2FA 3ATUA 1CJKB 1EQYA 2VG7B 1PJ7A 4CNYA 2R8JA 4BC9A 3QYYA 5LJVA 3EXYA 5HMYA 3EY1A 3MM9B 4FJ8A 3ZSYA 4MKBA 4PUOA 4G6VB 2KG1A 1YXQA 5F0UA 3EZUA 2QG9B 4H4KA 3ZC4A 5KT6A 4DF8A 2DXFA 4DV4J 3DU5A 4B9VA 1NH7A 3SUPA 1S48A 4CF1A 5D77A 3NNCA 4BR0A 4K41A 3MAAB 3SUQA 5GINA 1QVGM 2MHNA 4KY3A 1CZ9A 2VKRA 4BWMA 1I39A 3THXB 5LJWA 3N6LA 3NGTA 3BGLA 3BSNA 4KAIA 1RA7A 4BROA 4DR7K 1HPZB 2XMJA 1KNZA 3R3LA 3GSIA 3P31A 5KAKA 3H40A 4TYBA 3I4PA 4MFBB 4ZOSA 1T9YA 2ALZA 3T7ZA 2VA3A 3OBYA 2BJ7A 2RUSA 4AFFA 3VGMA 2OMLA 3GBTA 1C1BB 2XQCA 4BQLA 1WBDA 3QQCD 4DU8A 4FYDA 1T05B 2BQ3A 3WNEA 3K59A 2YH0A 4B3OB 4X66J 2QYGA 4QIWD 3IUCA 5DETA 1CJUA 3S41A 4O55A 4H5NA 2ASJA 1OQ3A 1D3WA 4GVLA 3WEEA 4CF9A 1GAOA 1NLVA 4E19A 4PYDA 4RU2A 5IS2A 4BHQA 4NLBA 2FJVA 4FKXA 1KONA 2AGPA 5BPMA 1HWJA 2I7PA 1JLGB 4H0VB 2YI1A 4D3GA 4CRJA 2IA6A 4CFDA 4BC5A 2VQEF 4DV5F 4ELUA 1RT4B 2OTJN 4OX7A 4OKKA 3CCMS 2KFYA 2RN2A 1YRXA 2O4IA 1S6QB 1WB9A 3AO3A 3KK2A 2UUWA 4ITSA 3LPYA 5EX3A 3NHGA 4EGLA 2HHTA 1CEZA 1E6YB 1SBRA 4NL5A 3P3DA 3DYAB 2VPYB 4KTWA 2X74A 2DGOA 2B51A 4DR5K 2JNJA 1BCMA 1HNWJ 4H0TB 2ZDPA 5AZIB 4DSLA 4GVBB 2HNZA 2IAJB 3IWLA 1FVSA 4GNIA 3FEXB 2P9PA 4LRCA 3QT5A 1J5EK 5C42A 3C15A 3B6OA 3R97A 5HQMA 3SQ4A 2DTJA 3HYFA 1D1UA 4DPYA 4KHUA 1KWMA 5J2MA 3DKDA 4CO5A 1S1WA 2QMXA 3HRGA 4CQ1A 2KKHA 2FQQB 2UZAA 3AY9A 4GO5X 2RS2A 4TY8A 4DF4A 4PA1A 2H4YB 4DLGA 1HNZF 1J54A 3B8AX 3C0BA 2GNKA 5T7BA 5HVHA 2JH3A 4CYUA 4K8ZA 3OFGA 2ZH9A 3VENA 2BTFA 3FZFA 1KLNA 3CXCR 1U2VB 2UVUA 3C6TA 4NI2A 3OJUA 4K5SA 4WE1A 3D0PA 3GG1A 5DRKA 3AXMA 2JC1A 3M32A 4CHQA 1YIJN 3V5RA 1FFGB 2GZOA 4OYIA 1GLFO 4JKBA 2CKWA 4UY8O 2WB1D 3P4UB 2BE2B 4QR0A 3CUNA 1NJZA 4ISEA 3VGUA 3L8BA 5L8RC 2ZUAA 4ZVRB 3TQ1A 3TAFA 2V50A 1UWBA 2QEXN 5HQLA 4IDKA 3HSCA 4Y28C 2C3YA 3PVXA 2UXCK 1FEEA 4H5WA 3DOLB 1OQ6A 1HBNB 3SAFA 2R7VA 1OYEA 2CVIA 4CZCA 2RU3A 3OL6A 3TNVA 4ILMA 2LSNA 4BR4A 5DDPC 3D6RA 1TKZA 1NLKL 4GKJF 1NUEA 3K0JA 3TR5A 3G4SN 1IXKA 2PD1A 8AT1B 2DXDA 1X1PA 4AM7A 2ZGYA 4H0XB 3EPGA 1FF2A 1S12A 2Y1IA 2XMAA 1V4SA 4DV6F 5H1SQ 4EP5A 2BKNA 2HK2A 5T7LA 4ILGB 1R0AA 2B0GA 3OFFA 3G82B 2M70A 3MR3A 1UEVA 1NGFA 1SC4B 4H5RA 1HKAA 3BEXA 2CUYA 3G8TA 1ZTTA 4W5QA 1VQ5S 3M32B 5CYMA 3M9OB 2XLIA 4C3KA 2DVIA 3EICA 9RUBA 3SSRA 3AAWB 1AXQA 1N8RO 2C2ZB 4M41A 3M2UB 4PG7A 4I2PB 4ZN1A 3CT9A 3M05A 2C3MA 1WHWA 5E41A 3BR8A 4OI1A 4OZJA 2P5VA 3LZJA 2P9NB 1N33K 3CHWA 1SKRA 3D0IE 2DNPA 2J4RA 2X78A 2V69A 3RRKA 2EFOA 5J2MB 4RO0A 1OJ4A 2H4WB 3VCDA 4WFYA 1IO2A 1UL3A 1XHXA 3VWSA 2ZVIA 2MQOA 4Y2AA 3WQUA 4FWOA 1UZDA 2HHWA 3LP3A 4A59A 4UQTA 5ETTA 3FEYB 2Y0BB 3JSBA 4EUVA 3O3LA 3ZT1A 3TVKA 3UE2A 4ID1A 1R59O 1BQNB 1SUQB 2CJBA 5GAHP 4PG6A 3C66A 3CM6A 4CLKA 3CMAS 1NGCA 1X9SA 4DHVA 4IRCA 5C15A 1FDDA 5C25B 2HBLA 3FCWA 1B7YB 4IOCQ 1S1UA 2F8MA 3Q8PB 5K5MA 3N6MA 3BKUA 4F4XA 2LECA 4MYUA 5KFIA 2F9WA 4U67Q 3TA1A 3RAXA 1WOPA 3TUIC 1S97A 3ZSOA 3ZSVA 2FZKB 1FTCA 1S77D 1O6XA 2MB0B 4RWWA 2O3DA 3DOMB 2OPPA 2B9YA 4JS4A 4WP9A 3L6QA 1M5KC 1FW6A 1CC8A 1IBMK 1T6CA 5KFRA 3KJFB 4DR4K 4JI5K 3IP0A 4WF9Q 3CD7A 5A76A 1K0TA 2BANB 1J9AA 3HZ6A 1RBVA 2E5JA 2PDAA 3QWPA 2GV1A 2I9SA 1HQEB 4LY7A 1SJ3P 3SAGA 5IT4A 1KC8T 4NE9C 4CTAA 3ENVA 1FCAA 4DV1F 1X3MA 1OY9A 4JI4K 1Q82T 3AJ2A 4F50A 4K0KF 1REGX 2HQFA 1S0MA 5ETVA 4BR5A 4G9ZA 4DL3A 4PWUA 2QYCA 1OYDA 3DGPA 1WEYA 4M5NA 2LEAA 2BANA 4DR1J 5FDLB 1JL1A 3CD0A 3T5LA 2F4VK 5HQ8A 4BR9A 1HW8A 4H4KC 4NA2A 3GFYA 3KDNA 2R7SA 5CZ2A 1N36F 1OPZA 3J80U 1FJ7A 1K0VA 4DV7K 4F3TA 1FXDA 3V4IB 2Z2LA 3R5JB 2JRSA 3HOTA 3BF4A 2UYTA 4X4QA 1HQUA 3LANA 2BABA 3PW0A 3ZZYA 2P6SA 2AIRB 2HF4A 3THYA 2JSXA 4ZHRA 3LP1A 4RW6B 4BRIA 1B99A 5AQPA 2VQFK 3KNAA 1FDNA 4USMA 2KXFA 1RCHA 4FWPA 3OW2M 3LAMA 5LMUF 2WUSA 2BVZA 3EE8A 5HP1B 1F1BB 5A8RB 4ZCIA 3EGNA 4IDHA 5FPEA 2CPYA 3OL7A 4X4VA 3V6JA 3TOQA 3UE5A 2E20A 3KUEA 3G6EN 2MQNA 4KHPF 4IG0A 2DNYA 5DQHA 4TLQA 5C24B 4DFPA 2GMLA 4CGHA 3LQVA 2D9PA 4USKA 1TUVA 1PIEA 3R5GA 4KHPK 3QEWA 2EHGA 1UW4A 4JI2K 2D0PA 3CCTA 4CECA 4LR7A 3SFGA 3PX6A 1MA9B 3J7YI 3LP0B 4AQYK 1Y5IB 2F9DA 3H4BA 3R2DJ 3H90A 2Y8YA 2CQ4A 4ZVHA 1WKKA 2MPUA 4C11A 2CVEA 2YQ1A 6FDRA 3HSZA 2ASLA 5C2CA 3GQCA 3TX0A 1UAWA 1RBRA 4HTIA 1P8GA 1ZM4A 2NRHA 3TAEA 3NGSA 5C2DA 3ZSWA 1JLFB 4Q0BB 1YX2A 1F5BA 1GOBA 2C22A 4QIEA 4TNOA 4DJBA 5CY4A 3O5TB 2CPZA 1UEUA 4OPHA 2J0WA 2X51A 1S10A 4BGBA 1BDGA 1H2UX 3UNYA 1NKCA 3BR9A 4MLHA 1H73A 1S72S 3ET6B 5HI7A 3MWPA 1WC4A 1HHQA 5EUHA 3SJHA 4HHJA 4E89A 1RAHB 1XJWB 2DHXA 3PJWA 2DNNA 3R5DA 3JSRA 1VQPS 4OV1A 4CD1A 4B8CA 3PSFA 1KVKA 1Y10A 2OFGX 5M1QA 5AZJA 4FJ7A 2VHGA 4DV2F 1F6TA 1Y4ZB 3T5HA 1FDAA 1Q5YA 3CJ5A 4B3OA 3HSGA 4CZLA 2LFVA 3FCHA 3AARA 5I42B 3VQ6A 3MEGA 4M5LA 3QT7A 2XLKA 4O3OA 4IR1A 3LM2A 4HWIA 4NMLA 3TAPA 1QY7A 4QWDA 4LFAF 5GAEU 2NR0A 1S4EA 3KDOA 5SUHA 4DQSA 4IG0B 1X5OA 2R7QA 1IKVB 4AF1A 3ICLA 1OH5A 1VQ6N 1YRTA 3KUHA 4M3YA 3MDFA 2FB0A 1DJ0A 3WX4A 1UP1A 3D54A 1R0CB 5KFBA 3T41A 4CZKA 1KQFB 1RU2A 2X6NA 2GQ2A 3CCSS 1LOTB 1BI4A 3AJDA 4LSZB 3Q8QB 3NCPA 3M6UA 4CGDA 2FVRA 4OYZA 4OZ1A 3OR2B 2KRRA 4NRUA 2CGJA 4FZXC 4HUFA 3F0NA 4Q7AA 1GX5A 4KRWA 2YX7A 4ZVFA 2L48A 4F2SA 3BYRA 5KFUA 4GMKA 1R6VA 2KZMA 4B3TF 5KTQA 2YHXA 3VETA 3GFXA 4F0MA 4G1QA 4WE1B 4H0YB 3OFEA 1FX4A 2G8KA 3R8YA 3EEQA 1CZAN 2D5RA 2NXUA 2AEMA 1YJ9N 1K6YA 3BUZB 4OI4A 4CO1A 3VQ7A 3HFKA 1HLUA 4PPDA 5AQFA 3VQ4A 2AZ3A 5LMUJ 1HL6A 2IAJA 2X1BA 1JXBA 3M8RA 2ZHBA 1VIXA 4CBUA 2XZTB 1U47A 1Q0NA 1LW2A 2ZOMA 3BP8A 2EX3A 1NGHA 4DV7J 1QTNB 3IGNA 4K4VA 2N7CA 3VHQA 5DM6Q 3QT6A 1EQMA 3BN7A 1T11A 1WUUA 3QEIA 2CQGA 4LSNA 3MMBB 2QT7A 1NK0A 3QNNA 2E1PA 1EAYC 2YTCA 2CQ2A 4X62J 3I32A 3NOCA 4A48A 4OLOA 1F9FA 2GVDA 4AQYJ 3I9V9 1RT3B 1QAJA 4DS4A 1W7AA 3UD4P 4UUXA 1D9FA 4FJLA 5HRNA 4ZTFA 1QUVA 2HFZA 2EW9A 4L3KA 1TL3A 1FEHA 3DU6A 1IKYA 3ETMA 4P6QA 3WXJA 4LUBA 4HHUA 3O2IA 2DK2A 2R8HA 4WJBA 2C1EB 3D6TB 2PMHA 2OPSB 2CDRB 3CERA 5E3CA 2KZZA 4KH0B 1Q7LB 1NAQA 2JHEA 5AXKA 3NMUA 3NNHA 5KRSA 3F2KA 3CTRA 2Z2MA 2EWHA 3KLIA 2HRYA 4PABA 4CWBA 3N4PA 5GMDA 4F4WA 4ED6A 1YDLA 4KKOA 3MN5A 1RWWB 1NPPA 2ROPA 2HQGA 1TUWA 2HVZA 4FDFA 1QZ6A 4FXWA 1S7HA 2AJ4A 4CH7A 3OTOK 5KT2A 2FHOB 3KG1A 4HACB 3PW7A 3H08A 1HNXF 1O13A 4MLEA 2KT2A 1TK8A 1MWZA 3SBGA 1FKAF 4P10A 3HO1A 4Y2CA 2FTRA 3NMRA 4TQRA 4O23A 3H42A 1QJHA 2NXNA 3RR8A 1HNIA 3QZ7A 1QLNA 1ZBUA 2EK1A 3OTCA 4PL8A 1T9WA 3S6EA 4DFMA 4LF9K 1H2VZ 1VFJA 2EG1A 1ZC6A 2NRVA 2VG7A 3NH0A 1VR6A 4JI6F 4ZITA 3CJAA 4YR3A 1ESVA 5HL7Q 5HBMB 2W01A 4A5AA 4A8YA 2MKCA 1NGEA 5I9EB 3VQAA 4KPCA 4E1NA 1S99A 1HYSB 3KLEB 4B1ZA 4NXNJ 3DAWA 4BRAA 3AO2A 1N33J 3W5YA 2QL9B 4JK8A 1HRHA 3SQOP 3C3LA 5KFSA 2YJEA 2XSJA 1TP7A 3F9MA 3M8PA 3EUNA 3TJ9A 3ULEB 4BG9A 5I4MA 1GXTA 1HBMA 3FRZA 2OSQA 2YVSA 4A8QA 4RWXA 4BBYA 4YY3K 1BHLA 2YQ3A 3GZ7A 2ALYB 3KTQA 3KD5E 1V3SA 5C12A 1NMDA 3G71N 2HHUA 3UDEA 5KFMA 5KI6A 4H8KA 3M1FA 5AQGA 4DUZJ 3A8EA 4JV5J 1SI9A 5AXMA 2VBYA 4Q44A 1ZPVA 3TVZA 5E3RA 2H3EB 2FSKA 3KLVA 2DJWA 1YT3A 3BN4A 2BMBA 2V63A 4IDKB 1FRKA 2X1AA 3TU5A 3FZ2A 4FNHA 3VTIA 1BMQB 2AYBA 2AX1A 2YNGA 1Y0HA 2YKNA 4IOAQ 3WC0A 1SIWB 1QDUB 4NCAA 1IN0A 2UXBJ 2A1BA 3IFRA 5D78A 3D2EB 1N5SA 1ZAVA 2BEFA 2FHJD 1WDTA 2K7JA 1RLDA 1V3RA 4BC3A 4ZVOB 3BBCA 2BRKA 3HP6A 1K8KB 3O08A 4DKWA 1TVRB 2P9UA 1KRPA 3A12A 2BOAA 2BQRA 3O9QA 1I51B 4I69A 2HQ3A 4C8ZA 1ZPWX 2NXCA 1S0OA 4M63A 2IM2A 1TGOA 4DG1B 1RBAA 1VQ6S 2NS1B 1WSGA 4GVBA 2HZCA 4USWA 2AJ1A 2CJYB 4UZCA 4BRPA 2RDIA 4FWQA 4DUYK 2OKQA 2ATCB 3AAPA 1NOYA 2YNHB 1GNKA 4Q8FA 1XN9A 3LF0A 3AB2B 3C16A 2E2OA 1I5OB 5CZXA 2RT3A 4DX6A 1KVBA 4LSLB 1RTZA 2DNLA 3AD8C 3KIOA 3M2RB 4ZCKA 1NGBA 3DWLA 4M8LA 1LAVA 4CK3A 2VJVA 4KAZA 4L6V3 1TL1B 2ZWOA 2LLZA 4U7UK 3TWHA 2LXUA 1OVQA 4HKQA 4H0PA 3A3NB 3ZSQA 3CJ1A 4OHYA 4IFEA 4KTQA 3KJNB 2GA7A 2CQ0A 3OJSA 2MJUA 4MFBA 1MN9A 3LP2A 4BRCA 3PYGA 5AJ3K 1C1BA 4LF4J 5L46A 3M6XA 3I0SA 5CXTA 4BDYA 2J9DE 3J7YP 5HP1A 2BDPA 3R9PA 3J7AP 3I96A 1DTTA 3H8YA 2DRDA 1F9EB 3QAEA 4ZS6A 3ZLJA 2I5JB 3MCPA 4HLBA 4C0HA 1E4GT 1G3OA 4DV2K 4Z2XA 1HPZA 4KGXB 2Z30B 1C0TB 1H7WA 3ZSZA 2MZ1A 2ILYA 1R7IA 3WDOA 5KFCA 1CQMA 1VQ9S 4DZ6A 4LBIA 1DFDA 1B9DA 3SK3A 2Q6CA 2E2PA 4GVEA 2UUTA 4ICLB 3MAQA 3BO3A 1S72N 5KG5A 1F0XA 4V19S 4DV4K 5AQSA 5A8KB 3AH6A 5KPRA 4TLRA 4A2AA 3KLHA 2JVRA 5LM7E 3MEEA 3KOAA 2IYIA 4QPXA 2MQQA 2HEKA 3P38A 3BQ0A 4DX8H 1CJKA 3V1OA 2GQCA 4N8NA 4FOEA 4MH8A 2GGPB 3PIPL 4JS5A 4ZIVA 5ADZA 3CC2N 1RJJA 3PJ9A 2Q31A 4ILHA 3M7VA 2RQCA 5H9FJ 3AQOA 1RAIB 1KFSA 3C19A 2EKYA 3PM9A 5DQIA 4HHTA 3PO4A 2B8QA 2VV5A 3NS6A 1C4CA 2HS0A 4OJ1A 1HQEA 3WIVA 4FPBA 3MTKA 3KWMA 2RH3A 2W40A 3FGUA 2K3IA 1IJEB 4FBTA 3L95X 2VUGA 1X4EA 4CGGA 1VQON 2GCFA 1J5EJ 1WAFA 3M8YA 1Y7PA 1YJRA 3DRPA 1TTHB 2C2OB 3OYGA 4CHYA 3O44A 4ZPVR 4K42A 2P9KA 1XI1A 2ZH4A 3UR0A 5HJXA 3FFIB 2AYEA 2PA3A 4KH6A 4GKJK 4RJVA 3E51A 4B3RF 2EBEA 2UUAF 1VRUA 2KFNA 1NSAA 4Y2MA 2AJQA 2ASOA 2ZZNA 5CZVA 1KCFA 5CYJA 2XS7A 5KG1A 2E5LK 2LA6A 5M1PA 1OMSA 1ZYQA 4LFBJ 3C6UB 4OMFG 1B7FA 3CYMA 3D6MB 4OVLA 2KYXA 2KG0A 3O9SA 3CSKA 2B7CB 1DAXA 4CVNE 3UDVA 2MZSA 1TL1A 2W2MP 3MM5A 1N5QA 1KOOA 4EMDA 3DXKB 4DCJB 4JD2B 3TWZA 2V68A 5LMNJ 3IG1B 5J2NA 4WXOA 4FCYA 3T69A 4M3TA 3Q0AA 2H5EA 2MZRA 4PG5A 1N5YB 1JCFA 3BSAA 5KFJA 2BZ2A 1R8BA 5B0GA 2NUUG 3M3ZA 3H20A 4JI4F 1FJCA 5HLFB 2XS2A 4ZKAA 1O5JA 1HKCA 1NJYA 4B3TK 2O1PA 1FA0A 4ZPAA 5K20B 4J5OA 4P9SA 2YWKA 3OYBA 4KB7A 3GIJA 1UVNA 3PIOL 2BE9B 2OMOA 3LPUA 4U7CA 2V9KA 3ILOA 1YG0A 4G1IA 4Q8EA 5DDQC 4ED1A 4V19X 1B9FA 4E8UA 5JS1A 4DL6A 2E2QA 3D6FB 4I2PA 4DL7A 4PZVA 3SLCA 4LF5K 2KLAA 1X9WA 3VQEA 4ZJQA 2JOQA 2XSFA 1HNVA 1R8PA 4X84A 3JS6A 2F63A 2D3UA 5A2QU 4F04B 1SB6A 3EGVA 1XNRK 3MK6A 3TTCA 1OY8A 1F60B 3CWJA 3PV8A 2ZC3A 3AA9A 3CGIA 2HQCA 3G96A 2AZ1A 2AJ2A 4DOZA 1FKOA 4CJUA 1QM9A 5LT5A 5MAOA 4CEQA 4O0JA 4NXNK 1VLOA 2YWWA 2NZCA 2D74B 3C95A 3RR7A 1P1LA 3GFZA 3AHPA 3IMQJ 3ENQA 2VONA 2B6AB 1GXUA 3HZEA 2DB1A 2G8UA 1GMUA 1G15A 5HBMA 2A18A 3T1HF 3NEKA 1H0HB 2HS3A 4X62K 3SYZA 1HKGA 4CEZA 3NCRA 2V7ZA 5IWAK 2ASYA 5LOQA 5KT7A 4PKIA 2F96A 3K9KA 2V7YA 2UXDK 3S7RA 1S1XB 3IM9A 1RDCA 4UW2A 2IYGA 3OSNA 2ZH3A 3M8ZA 3AGKA 4USVA 1K8AO 4B08A 4NZ6A 4OJ3A 4U9RA 3B6BA 3GDQA 1OKJA 3W9JA 1UVIA 4FS1A 1HR0F 1WJ9A 2KHDA 1N5TA 4DPTA 2G8IA 1U2VA 3QRPA 3K2YA 4P71A 2XB2D 4DV1K 3DMJB 3AOCA 1HBNA 5EY4A 4OJGA 2QL5B 4ZLLA 4YUDA 2HZAA 1Q8KA 1K9MT 5KPZA 4DUYF 4QPTA 1RACB 4OYPA 3K5MA 5KFQA 3GP9A 3TSQA 3GPAA 1S9GB 2JLGA 3OS2A 4O0IA 4B1UB 2IVPA 4N8OA 2A6MA 3TR8A 1O51A 1HNIB 4OFZA 3W9IA 5FLXY 4B9MA 4NYPA 4OGEA 3K17A 4DCHA 5M2RA 4XO0A 7AT1B 4LQ9A 4FJ9A 1DLOB 5KFZA 1TZ0A 4FWSA 2F1FA 3SQ0A 2P9IA 3ENOA 4C0BA 1SH2A 2L9WA 4RNFA 3V2UC 3IWXA 3K8WA 3M2VB 3KK2B 2ZGZA 2G2YA 5ETNA 3MCAB 4FJKA 1MNEA 5KFHA 1IKYB 4LF4K 2RVJA 3EO3A 1NM2A 3IRXB 1NJIT 2DNGA 4FF1A 4RW4B 3NF9A 1K73T 4DU7A 4C8MA 3JS9A 1JL2A 4OJRA 1HR0K 4RG8A 1RT5B 2C2RA 4CZGA 3MGJA 4Z7YA 3NE6A 5IQ6A 2D69A 1FE0A 1CZBA 9ATCB 2M88A 2RHKA 2R3VA 2AD9A 1VHIA 3PCOB 3SZ2A 3KJVB 3F5TA 2ZC4A 5FRMA 4QCLA 2VICA 4X65F 1WC6A 4CF8A 4BR7A 4CF2A 3NMAA 3ZZTA 4AHTA 1LWXA 1ZZFA 2HNDA 3RRHA 3JSMB 4NLTA 4LJMA 5JMVA 2CQ3A 3DDNA 3M6VA 3GTYX 1NKBA 3GE1A 4BRLA 1JLCB 5AQXA 1VIOA 4XDDA 3UFCX 3KK1A 3PEHA 3DN9A 4G1PA 1WF2A 1YJ9S 3E1YA 2HFVA 4JKHA 2DNZA 3E3XA 3UVJA 2W6LA 3HJFA 4ES3A 5D4LA 3F73A 3OLAA 3K9JA 4OI6A 4OQJA 2UV8A 3PO5A 4LF8J 3QATA 4IXCA 3NH1A 4CEFA 4NRTA 3CJ8A 2LEBA 2HOEA 3R7NB 3D0GE 5D4PA 1BO5O 1XNQF 1TMMA 3HVTB 1FKPA 3ISNC 5F8NA 1NHKL 1NK8A 5HRSA 4TU8A 1CS4A 2GIQA 2RSQA 2DFFA 4TVAB 3IMXA 4F26A 1HARA 2DR8A 1YVFA 4BRHA 1X8DA 3GB0A 3PW2A 4FWRA 3PHEA 4CJ4A 1WG4A 1NHVA 1ZA1B 1T6DA 2G0IA 2XO7A 2A3JA 1LXJA 1ZM2A 1TELA 1YJ7A 2IOCA 3RRGA 1YHQS 4DQ8A 2BYCA 3GE9A 3FMWA 4NCBA 3I55N 1WSEA 1TKXA 4USHA 4NCGB 2ZFHA 2IGIA 1RTIB 1RT2B 1A5WA 3NGIA 1TKZB 3I0SB 1W2IA 1PGZA 1UPMB 1WC1A 3ZT2A 1FJGJ 4ID8A 4M3RA 3FEZA 2QSWA 2YWFA 3NRBA 3O3HA 1C1AA 4YMEA 2R8KA 4A8FA 1IH7A 1OPIA 1TR0A 2PGCA 1ZAXA 4EFHA 2PAVA 1R89A 3EDRB 1T9UA 2E5LF 1GLLO 2O8EB 3JQJA 3JYTA 2ZEJA 1RHUB 5B0AA 3I33A 3R5BA 4OYMA 1QVFM 2QLXA 2R7OA 1NJWA 2QWMA 4ECUA 4DN9A 4RW9B 1YUWA 3G8QA 1N34F 2O8DA 3CCMN 8ATCB 3R27A 3N01A 3TJ8A 2VBZA 2RRNA 1YJNS 3GU0A 3EMTA 3LA0A 2VWBA 1KFDA 1Z2LA 1VJWA 4ZPWR 2DD8S 3P96A 2DIUA 2C3OA 4AE5A 1VI7A 1U02A 4TU7A 3U1NA 5DQGA 1A5XA 2IVNA 2K7KA 1RT1A 1AUDA 4IOCL 5MLCV 5D0EA 2UVRA 1WDDA 2YXLA 4LF5F 4P2XA 2RQ4A 2NRZA 2MQMA 2KO1A 3EJMA 5AQVA 4JLHA 4I2QB 7FDRA 2L08A 4OHVA 5F0XA 4LFCJ 4JV5K 3RSEA 4OL8A 3I31A 5DS7A 1IQZA 3IRWP 1QSYA 4MDBA 1WACA 1T03B 3M2RA 3K8VA 1SVDA 3KKRA 2E1YA 2DHAA 3MXJA 2HNZB 4RNNA 2QWLA 4EHUA 2IDEA 4M63C 3L7OA 3U3YA 3R7SB 4H4MB 3AOAA 4B1WB 2IA0A 4WK1A 3H3NO 2HQIA 1DQ9A 4F3MA 3QRRA 3DYAA 1OS5A 4URQU 2HWIA 2XY6A 4B9UA 3MMCB 3R8EA 1XNRJ 4OZNA 1SQEA 5AQNA 4WFAL 1HUXA 1Q8BA 1Q86O 1X7VA 3DLEB 4DTJA 4Z0UA 1TL7B 1LKZA 3MEDA 1EB0A 4RU9A 3QESA 1V9OA 1PYSB 2DRBA 1FE4A 2V5HG 3VQQA 5DZ6A 3OVBA 5A8RA 3NP5A 4A8OA 1RT7B 2CADA 1CVJA 2HRTA 3G87A 2UXDF 2ROEA 1NDKA 4Y2KA 2LXIA 3RB6A 2CH5A 3MN9A 2MJNA 5EU7A 1PYOB 2QMUB 2Q79A 5A2QO 3N0VA 3CIMA 4BWJA 1PSDA 1VLYA 4TYAA 3M1VB 4B3SK 3A5MC 2DH8A 1RGIA 1Q5VA 3PFOA 4QIGA 4M3UA 3EE9A 2Y1RI 4ECWA 4JV2A 3VOVA 1S5ZA 4EI2A 4Y6IA 1L3TA 5H1SV 3ULDA 5L1IA 3RMCA 3O1WA 1VQSA 4PPZA 4OZ2A 3CCSN 4CF0A 3OUYB 2K3KA 3RBXA 1DURA 3HOSA 1NCLA 2UUCJ 2F5GA 3H4DA 5CHIA 3AA5X 3FUYA 3CIPA 1G1XA 1RBUA 3LDLA 2ZITA 2UVVA 3DI6A 3H59A 3OW2R 3FZKA 4DR4J 4LR9A 1IBMJ 2CJKA 5GVQA 4NI2B 5M2PA 4ATNA 2GUPA 3I8BA 2Y9HA 3KWIA 1SCJB 2EBGA 3SUNA 2R42A 1Q1KA 3QGGA 3CCVS 2G0CA 5K14A 3Q8VA 1Y00A 2V4JB 3PJXA 2A1RA 3D3CJ 1VBXA 2WCXA 1WUAA 3KK1B 4Y1DA 3BGFA 4BRGA 4O3RA 2DHSA 2RS8A 2DHGA 1NEEA 3ADAC 1M0SA 2V34A 4Q43A 4M5DB 4RNHA 3R6MA 3L3UA 1VQKN 3QMLA 5HJYA 4FWMA 5U47A 2W2QP 5C25A 3CDWA 3W1YC 4KE5A 5DLGA 3B6PA 1S6UA 2QX0A 3OYJA 2VWJA 4KKOB 2FJAB 5KOWA 4PR6A 2DGVA 5LL6d 1YIJS 2E5GA 1NGDA 1EKSA 4Q5VA 3H46O 1YTAA 4L8RB 4CJQA 4RPFA 2B4UA 3BH7B 2JDJA 3H5SA 3L2QA 1BHNA 2HAFA 2VQEK 4DV5K 4O5BA 1XMOF 2MZTA 2ABYA 3MCSA 4A8SA 4K4XA 1MSWD 1RDUA 3GIIA 3UD3P 2BJ3A 3A5LC 2WBRA 4PXBA 1N0UA 2MSTA 4B9LA 3RWUA 3BSOA 1KEKA 4JI1K 2K1RB 3C94A 2QKBA 1TV6B 4YY3F 4J37A 1YJVA 3R2CJ 4F02A 2ASPA 2YKQA 3US5A 5J1NA 4RBVA 3WQPA 5KT4A 2VFVA 2YCHA 1N4LA 1RDBA 5F8JA 2D0AA 1O0PA 2Y1JA 2HW3A 1BWFO 5K8PA 2XMMA 1G4CA 1KLMB 3W62A 1WSFA 4WBFA 4LBHA 1MU2B 1U26A 2AGQA 2KVIA 5ETPA 1CC7A 3QLHB 4JI8F 2FJEB 3KHGA 4FF2A 1RAFB 4B02A 4X2BA 4O44A 4F2RA 2P9IB 1S9FA 2J6SA 3EDQB 2R2RA 3OS1A 2R4FA 2Z1JA 4CT9A 4J9OA 3OXGA 1U24A 3RMBA 4ED2A 4LFAJ 4KBIA 5D4OA 2A1SA 2MQ8A 4QOZB 4Y0WA 4J9UE 5AE2A 1JJ2R 3RMDA 1ZBTA 3UCGA 1N6QB 3RAQA 4IG3A 4MJKA 2HHHJ 3M8SA 1AYEA 3RYLA 3G86A 4OGCA 4HVJA 1DHMA 3TJAA 4CD3A 5L39A 5A8WB 3SAHA 1RZMA 4ISFA 3O4WA 1YJNN 1C0UA 3A3OB 4ZTJA 4PY5A 2CNLB 5DGBA 4N41A 4KGKA 1CXUA 4NO7A 1LQ9A 1HKBA 1OY6A 4O3PA 3G8SA 4HVZA 5HROB 2QSFA 1RT6A 4DR5F 4BRDA 4BRMA 3TTFA 2CJ9A 5KFPA 3VEXA 4P7VA 1S1XA 4EIAA 3CW2C 4OLBA 2JGUA 1W97L 3CJBA 5E26A 1OWXA 1N34K 4ZLNA 2V0NA 3CPWR 3GFHA 1FJEB 2FF3B 4NOHA 4YN3B 1KHWA 4AM6A 1I6JA 4YOTA 4BDPA 2AKWB 1FHTA 2JC0A 4ZP8A 2QIFA 4U96A 1LWFA 3PZPA 3C7NA 1LCUA 3T5KA 3SBTA 3CJRA 1LXNA 1RT6B 3HDSA 4J90A 4CO4A 3ENAA 4C0OC 2OH2A 4AD6A 4A8MP 4WFNQ 3SCIE 1BCOA 2BE2A 4ZJLA 4FWNA 5BYQA 1M1KO 1R8HA 3O9TA 3ILIA 3J81U 2GV9A 3K7RA 3NDKA 1BXNA 4OX9J 1WSRA 3C7NB 1TK0A 2RD5C 1XMQK 3I4HX 2ROGA 1HD0A