1LW0A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
512
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 512
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw0A05
1C1CB 1JL1A 3DI6A 4KO0A 4LD0A 3ZSOA 4B9TA 4ZVEA 1ITGA 2WOMB 1YVFA 5KG0A 4QOZB 3KLHB 3LP1A 3OL9A 2Y1JA 2IA6A 3NGZA 2W9BB 4LQ3A 3M8RA 3ZT0A 3SZ2A 2E9TA 5HLFB 3V1QA 4G3IA 1IH7A 4M45A 4F2SA 4DL7A 3H4DA 4NLXA 2AX0A 3LP2B 3WNHA 4TYBA 4FJKA 4FBTA 3SCXA 2IJNA 1ZETA 4YR0A 5KT6A 3ZT4A 1RT1A 1U4BA 3TVKA 3MXJA 4AHVA 4NYNA 3O4NA 1QQCA 4AHRA 1T7PA 2GBZA 5J2NB 1TL1B 1ZTWA 3KD1E 1RA7A 2WONB 3P83D 1KTQA 4XPCA 3OSNA 3BSCA 3EPGA 4GC7A 3KKRA 4O3SA 4FJHA 3D28A 5DLGA 4B08A 2GV9A 4NLGA 1RBTA 3OSPA 1S6QB 3BREA 3HVRA 1IM4A 4NLSA 2XGQA 2PYJA 1WAJA 1RDDA 3C6TB 1RNHA 2A1RA 4FVMA 4ZTFA 1SV5A 1BIZA 1C1BB 1HYSB 1S1XB 1CXQA 2B5JA 4H54A 5KFZA 1CZ9A 3QEXA 1GOCA 4K8ZA 3RBDA 5KFYA 4NLOA 1A5WA 1S10A 3AVCA 3DLRA 3KJVA 4EBCA 3OYMA 4IR9A 4CIFA 1TGOA 1LAWA 4OVLA 3IS9B 4FS1A 4ZMMA 4DL5A 4ZPDA 2ILYA 1S97A 4ED2A 3TARA 1RDRA 1TK0A 4I2PA 5CYQB 1S1TB 5KFSA 4RNNA 5SWMA 1S9GB 3NF9A 1TK5A 4B3OA 3RMCA 4KHYA 4G1QB 3TABA 2W7PA 1YTAA 4FLXA 4QPXA 3MFHA 1JLCA 4LSLA 4ED8A 4J9SA 2EC0A 2IOCA 4AHTA 4M3YA 3ZSXA 1JIHA 4N76A 2YNGA 2IMWP 2FJXA 2IDOA 4KB7A 1YT3A 3RAQA 2FVQA 3HJFA 4KHMA 4NLPA 3RB4A 4IRDA 2ITGA 1LW2A 1K1QA 4HUEA 3LZJA 5F8HA 5KFQA 5F9NA 3OYFA 1WSFA 1C0TA 2KZZA 3A2FA 2WB4A 4CECA 4OPKA 1JXLA 2D3ZA 3MEDB 3O4QA 4TN2A 3UR0A 3T5KA 3T5JA 4IQXA 3VQAA 2NUBA 2FVPA 4CJTA 2DY4A 4CJRA 2FLNA 4RW6B 4R0EA 3OYCA 4RW4B 3SFGA 1LW0B 1W25A 2O4IA 1SUQA 4Z4HA 4O55A 1ZBUA 4O4RA 1N5YA 1J5OB 4CE9A 1NJZA 3N6NA 3DMJA 2C2RA 2HHQA 2HHUA 3SNNA 3PW2A 4OKKA 3VA3A 4OKEA 4E7HA 2KW4A 3SUOA 4FZXC 3KHGA 1RT7B 3V9WA 2WRMA 5KG4A 3V6KA 1VSMA 1NKCA 2C2DA 5DG9A 1XR6A 4Z4EA 2E4LA 5DK5A 3S3NA 2XCPA 2KQ2A 1NK7A 1WSHA 4NLTA 4ICLA 3BGRA 3NAIA 4BWJA 1FK9A 1C1AA 3BJYA 3DRSA 4HYKA 4IBNA 1C0UA 2RN2A 3GIJA 4RZRA 4FJ8A 2OA8A 3TAMB 3PJWA 2D41A 3I5AA 4BDPA 4FM0A 3HPOA 1JLGA 2VG5A 3KD5E 3IGVA 5SZTA 3GYNA 3AA3A 4TY8B 3V6JA 4CCHA 1TKTA 1UAXA 2HMIB 3GIKA 4RUCA 3KK3B 1JLAA 3QERA 4F4KA 3QIPA 2PZSA 5KT3A 4L8RB 4ID5B 1BQNA 2HNZB 4F4WA 4QWAA 3TR8A 3T19A 2QKKA 3F9KA 4MK9A 5HRPA 3VQ5A 1EP4A 3SQ1A 4Y3CA 4UQGA 3NDKA 5L1KA 5CZ2A 1IKWA 3VQPA 3OYJA 2IC3B 1N56A 5HP1A 5JUMA 2B6AB 5KFIA 3AVLA 5CZ1A 4IRKA 3V9ZA 3OLBA 3WNEA 1FXXA 4CJUA 4M3WA 2G8KA 4RW7B 1RT6A 2D0BA 1I39A 1Z25A 1RTHA 1TV6B 3NGYA 3FDSA 3VQ7A 5HRSA 1FKOA 4NCAA 4KAIA 5C24B 2ZE2B 1TAUA 3HVAA 4WFXA 3ISND 3M8PB 4IOBA 3EZ5A 3H59A 2W42A 4K8XA 4JV2A 5DQIA 3ZCMA 2X78A 5I42A 4Z4GA 2OPQA 1EKEA 4CESA 1JKHB 5I3UB 3JYTB 2ZKUA 4M3ZA 4F8RA 1RCHA 4XPEA 3AO4A 3NL0A 3G6YA 2AX1A 4ZHRA 4CJFA 1ZBIA 5DMRA 2JGUA 4PWDA 5J2PB 4CF1A 3I8DA 1ZYQA 1RT2B 3QESA 3V1OA 1KLNA 4RW9B 4CFAA 4KKOB 3VQCA 4DTSA 3ASMA 4MQ3A 4EZ9A 2G8VA 1JLEA 3CJ4A 2YNHB 2HNYA 3KLFB 1TKXA 4TLRA 3L8BA 1RT4A 1S1VA 3VQ6A 3VQSA 1QS4A 3F73A 1BHLA 1JLFB 1S9EB 4M3RA 1NNDA 1NKEA 2UVWA 3ITHA 3CDEA 5EWFA 4FJ5A 4CFBA 3RMAA 4PUOB 1VK0A 3NGIA 4CHQA 1Q9XA 3U6FA 4O44A 1JLBA 4BDYA 4CJEA 3H40A 3ZSYA 1XR5A 4KTQA 4CEBA 5HROB 3V6DB 4CGGA 4KB1A 1QE1A 2ASLA 2OZSA 1RTIB 2XY8A 4IH5A 4IR1A 3QEPA 3LWMA 1S49A 3RB6A 2FBTA 3CDUA 1ASWA 2XO7A 2BQUA 2P5OA 1X9MA 5KFOA 4Q0BB 2J6SA 3HVTA 1TL3A 3JSMA 4NLDA 4RW8B 4FK2A 4PQUA 1TKDA 3LP0B 4F4YA 2QXFA 1MU2A 1GX6A 4DL3A 4B9SA 2EX3A 3BR9A 1T05B 1LWCB 3OS1A 2JEIA 4NCBA 3V81B 4IDKA 2I5JA 4KHNA 1SKSA 3QIDA 3GV8B 4K50A 3NFAA 3VQEA 4Z4FA 3CJ5A 3PZPA 3HM9A 1RTJA 2C22A 1RBUA 1T03A 5KFWA 4CJLA 2HWIA 3QZ8A 3K5MA 4CEDA 4FLZA 1L3SA 2XHBA 5FRNA 2J6UA 3M9MB 4E7KA 4JRQA 2AGPA 1IG9A 3RB3A 3IG1B 3PO5A 2OPSB 1HYVA 5DQGA 1C1CA 1L5UA 2FC0A 1T94A 2IM0A 2LSNA 1KLMB 3G10A 4ED1A 4QW8A 1CZBA 4CK3A 2WOMA 4J9RA 3HK2A 1HRHA 2D0CA 4I2QB 3OYKA 2YKMB 3KLHA 4J9KA 2W9BA 2FBYA 4KHWA 1WSJA 3NH2A 2YKNB 4K4TA 5HLFA 5KRSA 4N5SA 1QSYA 3M9NB 3UIQA 1GX5A 3OL8A 4IG3B 2ATLA 3LP2A 1KVBA 3NH0A 5KFAA 4DU4A 4DS4A 2BQRA 1QHTA 4K4WA 3ZSQA 4B9MA 2IAJB 2I1RA 3PW0A 4O0JA 4NLUA 5J2NA 4FJ7A 1VSIA 1TL1A 3M8SA 2R8KA 2WONA 4FM1A 4I9QA 1S6PB 1W0HA 2B43A 3KLIB 5KG3A 1S6QA 4DQSA 3OYBA 3SI8A 4RG8A 3CQ8A 4B9UA 5FDLB 2UVUA 4JRPA 4M41A 3C6TA 4XIUA 1BI4B 5L9XA 2UUWA 1REVB 2WCXA 4IFVB 3MECB 2RPIA 4YR2A 1C1BA 1HYSA 1S1XA 4DU1A 3CFRA 3QGHA 3RTVA 2PY5A 2R2TA 3MTKA 2WK4A 4ZPAA 4F4ZA 3I0SB 2E6MA 4J9QA 3T5HA 3NF7A 3NKYA 1LAVA 3IGNA 1UOCA 2FBXA 5KFJA 1ZBFA 4C8MA 4DTNA 1K6YA 1SH3A 1TK8A 4CGDA 1TAQA 4JS4A 2UUTA 3NGDA 4QWDA 5J1EB 3LPTA 1T8EA 1KFSA 3IS9A 1NOZA 4ECZA 4CJSA 1DTQB 3AA2A 3ICLA 3DLEB 4NYFA 3V9UA 3SUNA 5CYQA 1S1TA 1S4FA 4YMEA 2IS3A 1S9GA 2X74A 3QGIA 3V1RA 3K57A 4ELVA 1RDBA 2BR0A 4G1QA 4HVJA 4DL4A 1D5AA 4R5PB 4RNMA 4DSIA 4FK4A 3HXMA 4FM2A 2G8HA 4RNOA 4O3NA 2R2UA 3PR5B 1TVRB 3BSOA 5KFXA 1FKPB 4DFPA 4I9LA 2Z1JA 4ECUA 4DWIA 1LWEB 3G6VA 3MEDA 4EEYA 2OPPB 4MK7A 3RR8A 4GVMA 1UWBB 3M8QB 4HCBA 4CJ5A 4KBIA 4TQSA 2XY5A 4J2AA 4RW6A 5F8IA 2ATQA 3I5CA 2IJFA 4NYZA 3VQ4A 3DLBA 4KPYA 3NAHA 4RW4A 3OYIA 3TAQA 5CYMB 3ALYA 4KHUA 2QK9A 1LW0A 4J9PA 2AJQA 2HW3A 1LWFB 1NHUA 2O5DA 5KGWA 3FSIA 5KG6A 4FJXA 1J5OA 1X9SA 2BANB 1HJRA 4B8CA 4F50A 4O0IA 3KTQA 4O5BA 1R0AB 1J53A 1BQMB 1RT7A 5KFDA 3UQSA 4AHCA 1BISA 2R8GA 4M3XA 1VSFA 2RKIB 2ILZA 2UVVA 3T1AA 3L2VA 4E7JA 2FVCA 5KFVA 3MR5A 3B6OA 4HKQA 3HYFA 3DM2B 1QAJA 4DSEA 1Y97A 4U6PA 2G8FA 3SUQA 4KHQA 1RAJA 3BSNA 3KHHA 3TAMA 1QUVA 4ZPCA 3PJXA 3DRRB 2XWYA 1NK4A 4C8LA 4CHYA 4FJMA 4PY5A 3DRPB 3V9XA 2JLEA 3EYZA 1RILA 3KLGB 4TY8A 3QLHB 4WXWA 2HAIA 3QIOA 3O3HA 2F8SA 4ZVHA 3RB0A 2HMIA 3KK3A 4YQWA 3MEEB 4ID5A 3L2RA 2GIRA 4DG1B 2HNZA 4W5QA 3AVMA 4YP3A 4CF0A 4CHOA 3PUFA 1X9WA 4O3OA 5F8LA 3AO1A 2JEJA 2IC3A 4CGHA 2B6AA 4FLTA 1HPZB 4M42A 3H5YA 2Z1GA 4IFYB 4NRUA 3LALA 4NCGB 4RW7A 3GIMA 1XHXA 2F8EX 4IH7A 3LDSA 1N6QB 1TP7A 4URGA 5KT4A 2AGOA 4LY7A 3HP6A 1TV6A 5FRMA 3IRXB 4B8AB 4K4SA 3DLKB 5C24A 4FJ9A 4QWBA 2ZE2A 1HQEB 1S9FA 3OLAA 4H4OB 4WXOA 3M8PA 3PW4A 3D0PA 4R8UB 2KFNA 2R7YA 1U48A 5F8JA 5KT2A 4C8OA 4DSJA 5DLFA 1JKHA 5I3UA 2OZMA 3ZT3A 4OLBA 1S5JA 3JYTA 3OHAA 4ED3A 1QSLA 5C42B 2YNIB 2JC1A 2C28A 4K4VA 3E01B 4ID1A 4E19A 1LV5A 1EX4A 2FJVA 5J2PA 5KFCA 1JXEA 3S3OA 4FLVA 2P5GA 4E3SA 1RT2A 3H08A 4RW9A 4KKOA 1VSHA 3KIOA 1VSLA 4DTMA 1WLJA 4DSFA 2YNHA 3KMQA 5T14A 1NK5A 3KLFA 3EY1A 3MR6A 3MEGB 4EZ6A 3HHKA 1JLQB 3KK2B 1RTDB 3QEWA 1QSSA 3ZSZA 4HUGA 2BE2B 1NJYA 1DLOB 1JLFA 1S9EA 1U49A 1ZBLA 4F3TA 4ECXA 3HP9A 4KREA 4PUOA 2RF2B 4Z4IA 3DOKB 5EDWA 1HMVB 2C2EA 3ZT1A 2KTQA 3RWUA 1U45A 2YV0X 4MKBA 1ZBHA 5HROA 3M9OB 2G8IA 2HWHA 3V6DA 4H8KA 2G8WA 1IKXB 3QNNA 3NAEA 3VQBA 3NE6A 3PX6A 1CLQA 1RTIA 2X6NA 3FQKA 2XI3A 5HRRA 2YNFB 3AVFA 2QV6A 3RR7A 4JLHA 4Q5VA 1DTTB 4Q0BA 2Z1HA 3L2QA 4RW8A 3HL8A 1S0NA 3LANA 3LP0A 2GUIA 3QEVA 1A5XA 3MR2A 4O4GB 3K2PA 1T3NA 5KI6A 3RRGA 4CHPA 1T05A 4ECYA 2V4RA 2YHBA 1LWCA 4QCLA 4FJLA 3V81A 1NKBA 4RNFA 4K4YA 1NK8A 1GOAA 3OVNA 1SL1A 3KLVA 2IM1A 5KFNA 4B9NA 1JX4A 2W9CB 3TAGA 4OGCA 1VSEA 5D3GB 3OL7A 3FQLA 2HHSA 3TAFA 4N41A 3PVXA 3K5NA 3QO9B 3C6UB 4DL2A 2JEFA 4OGEA 3OYHA 5KG2A 3H4BA 5KG1A 3DYAB 1ASVA 3OJUA 3VQDA 4JUZA 3UDLA 3IG1A 2OPSA 4FW2A 3G6XA 4E7IA 1BL3A 4OL8A 4J9NA 5KT7A 1VRTB 1KLMA 1KHWA 5DG7A 3CYMA 2XY7A 2AGQA 4GC6A 4I2QA 4EBDA 1RT5B 2YKMA 4PA1A 2R8JA 3QINA 3HPGA 2OPRB 4NLWA 1N4LA 1K1SA 3MFIA 3O3FA 2YKNA 3P5JA 2DPIA 4K4XA 4MIAA 4IG3A 3OYAA 1NK6A 4J2BA 4I7FB 1SL2A 4OKJA 1RDCA 1HNIB 4BE0A 1VSJA 5KRTA 2IAJA 4H4MB 4ZP9A 4DS5A 1SKWA 5J2QB 4CGJA 2DTUA 3TAPA 2ZQBA 2FLPA 1I3AA 3L3VA 1S6PA 4DEZA 3KLIA 1IKYB 4WFZA 3HO1A 1NK0A 4DFMA 2VA3A 1IKVB 4MFBB 5FDLA 2IM3A 4EYIB 1SL0A 1WSIA 4CERA 4FLYA 1YTUA 3SQ0A 5JS1A 1UA0A 2OH2A 1BI4A 4FJJA 4FJNA 1REVA 2J6TA 4IFVA 5EU7A 3MECA 2OYQA 4HUFA 4CGFA 3HKWA 3OYGA 3VQ9A 1S1UB 4FXDA 3I0SA 3D5MA 4Q45A 2KFZA 4WZMA 3RAXA 1CSJA 2G8UA 4ECTA 3H5XA 5KT5A 3LAKA 3TQ1A 5C5JA 5KFMA 1VSKA 4CGIA 3DLHA 4Q8EA 5J1EA 4ECSA 4KHRA 1B9DA 4ZVFA 3DLGB 4CJVA 2EHGA 4CJQA 1RT3B 3OJSA 4JV0A 1DTQA 3H5SA 3H5UA 4Y1DA 3MXIA 1S1WB 3DLEA 5KTQA 2GIQA 3PW7A 1KVCA 1Z4UA 4IKAA 3SUPA 1B92A 1BIUA 1W9HA 3OHBA 3HVWA 4XO0A 3KLEB 1VRUB 4R5PA 5J2MB 1HNVB 4J9MA 3L2UA 3CFOA 4Z4CA 4AHUA 5EWEA 4YNQA 1TVRA 5KG7A 2ZD1B 1FKPA 4N47A 5HBMB 4AHSA 2YHAA 4IG0B 4DSLA 3U3YA 2RDIA 4M3UA 1KRPA 3LWLA 4KV8B 3FFIB 5KGXA 1LWEA 4Q43A 3OL6A 1HQUB 4CJ3A 4DU3A 2OPPA 1UWBA 4DMNA 1KFDA 2HVHA 3O3GA 2WTFA 1SH2A 1G15A 3G86A 4WYLA 3QGGA 3SQ2A 4ECQA 2O4GA 4O3QA 1KHVA 1RA6A 5CYMA 3AA5X 1D0EA 2W8LA 5KFPA 4HHTA 1LWFA 3KMSA 3MF5A 4ECWA 1KCFA 3V4IB 4KFBB 2BANA 3NBPB 2KZMA 4CFCA 3DOLB 1R0AA 2AQ4A 1EETB 1XWLA 3CFPA 4KHSA 1BQMA 2VG6B 5C25B 1ASUA 3IN5A 2XGPA 4LSNB 3MXMA 2RKIA 3CJ3A 4E0DA 3AVKA 4BWMA 4U7CA 2D3UA 5KFKA 4FW1A 3UPFA 2HB5A 2W9AA 5K14B 3OYNA 2BQ3A 3I0RB 3AVNA 1NJXA 2JC0A 3DM2A 3AVJA 4E1MA 2VG7B 3KK1B 4QWCA 4F3OA 1TKZB 3THVA 3S3MA 3KKSA 1C2PA 4KSEB 4CEEA 5HRNA 3DRRA 4BDZA 4ZPBA 2DPJA 4MH8A 3DRPA 3CM6A 3B6PA 3OS2A 2IBKA 3T3FA 3KLGA 3QLHA 2HNDB 4ZVGA 3ZT2A 4TXSA 5KFLA 3SV3A 3G0ZA 4FZYA 3MEEA 4URSA 2BGGA 4WE1B 2WHOA 1MMLA 4M3TA 4DG1A 3CIZA 3AVAA 3K5LA 3S9HA 3PO4A 2R2SA 3DI6B 4KO0B 4TSXA 4MK8A 1RDAA 1HPZA 4DF4A 4DLGA 4IFYA 3LP1B 3SPYA 4NCGA 4KE5A 3GV7B 4URQU 4EO8A 4WZQA 4QWEA 5F8NA 3K58A 3AVGA 4EP5A 4J2EA 2IM2A 4DTUA 3AV9A 4CEFA 1N6QA 4OLAA 3HPHA 3IRXA 2V4QA 4JV1A 3PHEA 3DLKA 4ED6A 4FCYA 1HQEA 2Q3SA 3FRZA 4CF9A 4LH4A 4H4OA 4M94A 1X1PA 3Q8PB 4ELUA 4DQPA 1RBSA 3Q8SB 2XRIA 4R8UA 3SJJA 1RT1B 3VQ8A 3N6MA 3CJ2A 4CF2A 5KFTA 1BGXT 3OYEA 1WN7A 1CXUA 1L3VA 3DDKA 1O1WA 5C42A 4LH5A 4CEQA 4O3PA 2YNIA 2R8IA 5CY4A 3VN5A 1WNSA 3E01A 4DLEA 3GILA 1S0MA 4CF8A 1SV5B 4CHNA 4W5TA 4N56A 4DTRA 2D7SA 2FJWA 4RU9A 3MEGA 3KHRA 3RMBA 1JLQA 3KK2A 2B5JB 1RTDA 3QZ7A 4CJWA 2DFHA 2BE2A 1DLOA 3TI0A 5DGAA 3AVHA 1Q8IA 4GMJB 3RRHA 1L3UA 4OJRA 2VWKA 5EUHA 2D0AA 2AU0A 2RF2A 2HHVA 3DOKA 2XY6A 2E9RX 3KJVB 2ASDA 4IKFA 1HMVA 3H2LA 1NHVA 3V6HA 4DQIA 2R8HA 3GV5B 3Q8RB 4CJKA 5KFEA 2W8KA 1IKXA 4FZZA 3QETA 4I2PB 4B9VA 5KFRA 2YNFA 4CIEA 4FS2A 3I5BA 4B3OB 5KFUA 1DTTA 5F8MA 4WYWA 4CIGA 4AH9A 2BRLA 1JLCB 4LSLB 4CJ4A 4DQRA 4K4UA 1RBVA 3SPZA 2P1JA 2YNGB 5DG8A 3AO5A 4X2BA 3ZSWA 1D9DA 4O4GA 3Q8QB 4NLRA 4GW6A 4ELTA 3L3UA 1Z26A 3CO9A 4W5RA 1LW2B 5KFHA 4Q44A 1RYRA 1C0TB 4BE2A 1B9FA 3LP3A 5JS2A 2V9WA 4E1NA 3PR4A 2W9CA 3C94A 5JXSA 5D3GA 4EBEA 2A1SA 4M95A 3QO9A 3C6UA 4Y2AA 4HCCA 3T5LA 3EPIA 2DFFA 1JXBA 3CG7A 1J54A 3DYAA 1RBRA 3NCIA 1HARA 3OYDA 2AWZA 3TAEA 3VA0A 1BCOA 2IGIA 4FJIA 1SUQB 1VRTA 1ZTTA 3RMDA 2DFEA 1C6VA 1N5YB 5L1LA 1D8YA 3DMJB 1RT5A 2E9ZA 2OPRA 4RUAA 5KFFA 1XI1A 2XCAA 4CEOA 4CEAA 3WNFA 4Y34A 4ZTJA 2V0NA 4NLVA 4ZP8A 4I7FA 4EO6A 1HNIA 1XR7A 4KAZA 4KI6A 2HHTA 4ICLB 5L1IA 1XHZA 5E41A 3BGRB 5F9LA 3BSAA 4H4MA 4OPJA 4QW9A 1FK9B 4JS5A 5J2QA 4CJPA 2F96A 4TYAA 3DRSB 4DTJA 1XC9A 5KFGA 2VA2A 3HSTB 1C0UB 1S48A 4DTPA 4FLWA 3PY8A 4DTOA 1IKYA 3AVBA 4NLYA 4W5OA 3QEIA 3N6LA 1IKVA 4MFBA 1JLGB 2VG5B 3NF6A 3ZSRA 3L2WA 4Y2CA 5L1JA 3AO2A 1IO2A 4FK0A 5DGBA 2HHXA 1TKTB 4KRFA 2E6LA 4CEZA 1N48A 4HTUA 1UA1A 1JLAB 3SV4A 3QIPB 4FYDA 1RYSA 3SYZA 4J9OA 1BQNB 4BE1A 2FVSA 3CM5A 4KB0A 3LPUA 1S1UA 3GIIA 4ZP6A 1EP4B 4ECRA 3NHGA 1IKWB 5HP1B 3QNOA 4C8KA 4CHZA 2D5RA 2XC9A 3E51A 4EP4A 4MKAA 3CWJA 3DLGA 1RT6B 1RT3A 4Z0UA 4Q8FA 3SQ4A 1S1WA 4FJGA 1RTHB 4O3RA 5T7BA 2QE5A 3VQQA 1SKRA 1FKOB 4K4ZA 1QAIA 4TQRA 3PX4A 3KLEA 2FVRA 4ED7A 4CFDA 3LAMA 2R2RA 1VRUA 3TANA 1YVUA 4E7LA 4J9LA 1JL2A 1GOBA 3WNGA 2BRKA 5J2MA 1HNVA 4ZP7A 1J9AA 5I42B 3PW5A 4DL6A 2FBVA 2OPQB 2ASJA 1QTMA 4NRTA 3P1GA 4C8NA 1L3TA 2ZD1A 1KSPA 4J2DA 4CK1A 5HBMA 4DQQA 4IG0A 3PX0A 2HHWA 4NLQA 3OY9A 1D1UA 3AA4A 4KV8A 4ZHRB 3ULDA 2X6SA 3SI6A 2FLLA 1BCMA 2W7OA 1WNEA 3FFIA 3PV8A 1U04A 4PWDB 3EZUA 1HQUA 4FBUA 4ECVA 3MR3A 1D9FA 3ZSVA 3BQ0A 4IH6A 2Z1IA 5F8GA 2CJQA 3BQ1A 3NMAA 4F2RA 4Y1CA 4YR3A 3OYLA 1JLEB 4DTXA 4QAGA 3H98A 2HNYB 3CDWA 1TKXB 3HT3A 3TWHA 3CVKA 1RT4B 1S1VB 1C0MA 1TQLA 3OS0A 3MAQA 4YFUA 2UVRA 3ITHB 4CK2A 1A5VA 3V4IA 2VWJA 3GQCA 5EWGA 3QYYA 3K5OA 4KFBA 2ETJA 3NBPA 3BDPA 4O44B 1VSDA 3NH1A 3AVIA 1NOYA 3CJ0A 1JLBB 3DOLA 1EXQA 3U3GA 1EETA 4IRCA 4DF8A 1S0OA 3KHLA 1U09A 2VG6A 5C25A 3C95A 1F21A 2GC8A 1OS5A 2P51A 4DFJA 1QE1B 1KVAA 4LSNA 4LQ9A 4FLUA 1SH0A 4ED0A 2HVIA 1U47A 3HVTB 1TL3B 5K14A 4RNHA 4EYHB 3JSMB 1WSGA 4DSKA 3V9SA 2CKWA 3K59A 4PQUB 2XI2A 4W5NA 3KNAA 3I0RA 2B4JA 1MU2B 3ISNC 4B9LA 1HYZA 3AO3A 2VG7A 4AILC 3KK1A 3RBEA 3NF8A 1NK9A 1TKZA 2F8TA 2Y1IA 4DFKA 5KFBA 4BACA 4WFYA 4IDKB 1NJWA 3KOAA 2I5JB 4KTZA 5FROA 3M8QA 2JEGA 1Q9YA 1WAFA 4NZ0A 2HNDA 2RDJA 3IAYA 2ALZA 1RTJB 1I6JA 1T03B 4E89A 4MIBA 3D45A 3SFUA 1WSEA 4KI4A 5DQHA 2PYLA 4WE1A 3BQ2A 4KTWA 4TY9A 2QKBA 3LZIA 2BDPA 5KG5A 4F4XA
chains in the Genus database with same CATH superfamily
1AW0A 2DNOA 4Y00A 1C1CB 2H48B 3ZZ0A 3PIOL 1F5BA 3DI6A 2LEAA 4Z7CA 3CPWM 2R7QA 5LJ3Y 2FJBB 4B9TA 4DCJB 1NG9A 3ULHA 2OSQA 1YVFA 5KG0A 2KT3A 4A8FA 2ZJPL 1BA1A 2G4BA 1TL7A 1WOQA 4NA1A 1PBUA 3CMES 4F0KA 2E9TA 3SCJE 1U2RA 5GAHI 4BRPA 1GMWD 3H4DA 2AX0A 3LP2B 5K8PA 2AJ1A 3C16B 1SB6A 4TYBA 3W1YC 1WEXA 3DHXA 1WF2A 4X65K 3F44A 2CNLB 2P9PA 1P90A 4YR0A 2YJFA 3TEHB 3O8MA 3ZT4A 3TVKA 3QQCD 1HQ2A 1JNRB 1ZTWA 4DMZA 3TUIC 4JEPA 2HBLA 4DUYK 2H51B 4BRKA 1B0VA 3AFGA 3CCMN 2JL9A 4B08A 1J2VA 2BW2A 1RAIB 3H90A 3C19A 5LM7E 1RBTA 2ZOFA 3OPKA 3CCVS 2XGQA 2PYJA 3Q24A 1WAJA 1YJRA 3DHWC 4USKA 1NU4A 4BRCA 3IBWA 3IAS9 2A1RA 4FVMA 4ZTFA 3E8OA 1U24A 1SV5A 3T41A 2ZWOA 1YVNA 4NI2A 2OHDA 1BU6O 4H54A 1CZ9A 1ULRA 4HHJA 4K8ZA 5KFYA 1A5WA 3TPQA 5E5NA 4DV3F 2ASPA 1ZM4A 4HI1A 4AL7A 4FS1A 3TR5A 1VHXA 2LEBA 2V63A 2ILYA 5HMZA 1SJFA 3PEJA 2E1PA 2YH1A 1TK0A 5CYQB 4B1XB 2ZBRA 2VPWB 5I3PA 1TK5A 3M1FA 4B3OA 2RQCA 2WBNA 3TYTA 5M1OA 3N4QA 2W7PA 1QZ6A 4AHTA 1UP1A 1JIHA 2XHCA 4N76A 4DR4J 1S7HA 3H0PA 1ATNA 2FJXA 3ZTPA 3WXMB 3RAQA 3THWB 4NZ6A 3SDEB 4HUEA 3HHDA 1YTYA 1HR0J 3EZOA 1CC8A 8ATCB 5KFQA 3G8SA 4WK1A 4OI4A 1C0TA 2G0IA 3A2FA 1CQNA 1JXLA 2FHJD 3MEDB 4OYAA 1RWUA 3UR0A 3T5KA 2DY4A 2FVPA 4CJTA 3O1LA 2HQ3A 4A8OA 4OV1A 2B8PA 4IZ9A 3SFGA 4ZCMA 1LW0B 2RQMA 2ZVSA 3M30B 3W65A 4O4RA 1N5YA 1NWKA 2CQHA 1HW9A 2C2RA 2HHQA 3ZX2A 1N32J 3PW2A 5F0WA 4E7HA 4FZXC 3ZTRA 3T9NA 1MROA 3OUYB 4ANCA 5DG9A 4U7BA 2MKJA 4M63A 1NEEA 4C48A 2H3GX 2HLTA 1FX2A 2PEHA 5AQHA 3IR6B 2J0XA 3GP9A 1EZZB 2QL5B 5E3PA 1FK9A 1HHTP 1FWLA 3DRSA 2DHXA 2I6WA 4HYKA 4IBNA 1BWVA 2FB0A 2VPXB 4QYRA 2A42A 1R3NA 3ILOA 1NGCA 2EFOA 4BDPA 4DPXA 4NXNJ 3AA3A 4CCHA 1U1OA 2KG0A 3TQEA 2PC6A 2VWBA 2Y9HA 5D77A 4TVAB 1XMOJ 2HBJA 5KT3A 4L8RB 1MSWD 2CPEA 2I38A 1HA1A 1VI7A 5AQTA 2PFFB 4QWAA 4KH4A 3F9KA 2G2ZA 1J27A 5JICA 5HOOA 5GADP 3NDKA 4JYAJ 3VQPA 1IR0A 2IC3B 2K8GA 3AXMA 3OXLA 4NE9C 5JUMA 2W24A 1FXXA 2CG4A 4DR4F 3W2WA 4RW7B 1S5ZA 4LFAJ 2QWNA 1D9AA 1MNEA 1RTHA 1ZH5A 4B1YB 3FDSA 1OSDA 4KAIA 2VGNA 4U67L 1TAUA 2BJ9A 3M8PB 4HDGA 3H1VX 4DU7A 2HYIB 1K9MO 2Q2RA 3MCNA 3I55S 1IBLJ 3IXQA 1YJTA 2F9JA 1EKEA 4CESA 2QM1A 4YOWA 5DM7L 1JNZB 3CJQA 2ZKUA 4V19X 4YN3B 1FFGB 1IN0A 3VESA 1RCHA 5AQUA 1LEOA 1Q53A 5CHIA 1QUPA 3POTA 3G6YA 4ZLNA 5AZJB 5J1PA 4CZEA 5J2PB 1NAQA 3TJ9A 3QESA 1KLNA 4MYTA 3AGRA 2ZC3A 1N32F 3VQCA 4QYZK 5CZVA 1JLEA 2E44A 1VQPN 3KLFB 2LYVA 3HOSA 3VQSA 3F73A 1BHLA 1JLFB 4Y0WA 1ZAXA 3VVUA 1V5IB 4CFBA 3RMAA 4C23A 1U1KA 5H9FJ 3AH6A 1VQOS 4CHQA 3U6FA 4PWUA 1LXNA 1NU0A 3P4UB 5B09A 3ZSYA 2ZKTA 1XR5A 3SMZA 1VQ8S 1EARA 4JKGB 4DR2K 3BEXA 4NMXA 2FBTA 2MZTA 3AY9A 3D1OA 2BQUA 2R3VA 1X9MA 3HVTA 2PMWA 5KQDA 4RW8B 4PQUA 1XMOF 3WT0A 3BH7B 3PACA 3ZX0A 3C7NA 1GX6A 3J81O 1BUXA 3MCSA 4DL3A 4C1NI 3BR9A 1T05B 4ZJOA 3F56A 3EZWA 4Y6IA 3OS1A 2JEIA 3V81B 4QIGA 2VV5A 1YSJA 3QIDA 5JLHA 4DV2K 3VAMA 3NFAA 3VQEA 4WF9Q 4JKBA 3CC2N 1UETA 1T03A 5B0FA 1WC4A 3H42A 2UU9J 3QZ8A 2M0GB 4LFAF 1L3SA 1YUWA 3CJRA 2XHBA 3ZZPA 4GVLA 5CYJA 4E7KA 1IG9A 3RB3A 2IFXA 1N34K 2ZC4A 5ETKA 1L5UA 3M6WA 2FC0A 2IM0A 2MKCA 4OX9K 2HGMA 1CZBA 2QW9A 4CK3A 1XN9A 3A0IX 1YBTA 2D0CA 4I2QB 4F3QA 3KLHA 1RBLA 2W9BA 2HVDA 1WI6A 2YKNB 1DY3A 4UY85 4LBIA 4ATNA 4OI3A 4N5SA 2LXUA 1KVBA 3J81U 2BE7D 1YJNN 1VBXA 4DS4A 5B0EA 5D4NA 1QQOA 4O0JA 3PIPL 4FJ7A 1NPKA 2ZF5O 2CG8A 3UCUP 4I9QA 1W0HA 3KLIB 3B54A 1NZAA 3Q8YA 4OHWA 3CD5A 3L95X 1R43A 2ZJPQ 3OYBA 3HHLC 4B9UA 3BYPA 4RR5A 4OYMA 1UJ4A 4X62J 4M41A 2IRXA 1KD1O 1RBAA 1REVB 4IFVB 2XMJA 3MECB 3K9JA 2CZ4A 1C1BA 1HYSA 1D4XA 4FWLA 1S1XA 1FA0A 4CO0A 3QRRA 1S79A 4BR9A 4ZPAA 3O4WA 3I0SB 5CH7B 3CIMA 4RU2A 4J9QA 2LFVA 5GMDA 3NKYA 4YOTA 3IGNA 3WXKA 1UOCA 2KLAA 4C8MA 4JKFA 1K6YA 4DTNA 3FBCA 1AT1B 4JS4A 1F3VA 3W9IA 2RHKA 3FJ2A 2CPXA 2N4DA 5HMWA 3SMSA 1IR1A 4RBVA 4ECZA 4CJSA 4A8SA 1DARA 3CD7A 3DLEB 5BREA 2Y3YA 5C2FA 1S4FA 4YMEA 2IS3A 1S9GA 3OTOJ 3QGIA 3K57A 1XMBA 1YBAA 1RDBA 4P2MA 1H2VZ 1CJUB 1UEVA 1D5AA 4R5PB 4FK4A 2UU9F 4FM2A 4MDBA 4GV6A 4WWSA 2PE8A 3PR5B 5L9NA 4DFPA 4K7QA 1RAGB 2RUGA 5IT9O 2O01C 5CCMA 2RDDA 1E4GT 4DWIA 2U1AA 4IWVA 3M8QB 1Z05A 1SIZA 4TQSA 1V4SA 4LIRA 2ATQA 2A10A 3WEEB 3OYIA 2AJQA 1LWFB 1NHUA 5I9EB 1JJCB 3UDEA 3VCDA 3FSIA 3D1QA 3FBEA 5IQQA 2DNQA 4FJXA 1J5OA 2PA8D 1X9SA 2GVZA 2BANB 3D4JA 1YIJS 4O0IA 1VHFA 4FVUA 5AQMA 1IBKJ 5KFDA 3NP5A 5D6GA 1PAEX 3FSYA 4B3TK 5FIIA 2IVPA 2GA7A 2R8GA 4A2AA 1N52B 1VSFA 1E6YA 2RKIB 3PG9A 2ILZA 4OI0A 4JI7K 1WBBA 2UVVA 3GFHA 3L2VA 2FVCA 2VASA 4X62F 4KC5A 2IYIA 3A13A 1T11A 2D9PA 4FYXB 4PWWA 2Q6CA 3G4SS 3DM2B 4RWWA 3D3BJ 1CG2A 1Q78A 4DSEA 3TA2A 5AQRA 1PBAA 1WDTA 2VICA 3VGSA 3TAMA 4ZVOB 4ZPCA 2DRDA 3QBXA 4C8LA 2DTJA 2DGSA 2CNOB 3BBBA 4I69A 3QIOA 3O3HA 3RB0A 1HWLA 3W3DA 1V3ZA 4C6AA 3IRWP 3AA8A 1VQLS 4JI4K 2NCKL 2R7WA 4FKYA 3MUMP 3N01A 3UDCA 3EWGA 4CF0A 3PUFA 4O3OA 2KG1A 5DM6Q 3AO1A 3TEGA 3OTOF 2Q3PA 5C2GA 4FLTA 3OBIA 1HUXA 2NXUA 3MPYA 2CQIA 1TU0B 3OHRA 1F3FA 1S99A 2KYZA 1F5CA 4RUHA 3IFEA 3GIMA 2HQCA 2QEXN 4RPFA 4EWTA 1YRXA 2KHDA 5KT4A 1TV6A 3R6LB 2R7OA 1F6TA 1XJWB 2DXEA 4YHHK 1O13A 1S9FA 4MYUA 3OVBA 3PFOA 2MEWA 2NXJA 4R8UB 2R7YA 1TELA 1VIXA 1Q5VA 4DSJA 2DXDA 5DLFA 4HI2A 2QRRA 3CJAA 5CQGA 4O5FA 2MKKA 4ED3A 2MQMA 1QSLA 5AJ3J 2B4PA 5C42B 1RQ0A 2YNIB 4JBCA 4J37A 2YWKA 1JXEA 3S3OA 2Q79A 4A8MP 4E3SA 1RT2A 2HGLA 4DV4J 4DSFA 1IBKF 2XS7A 2GVDB 3MEGB 1JLQB 2O8DA 1RTDB 4CLFA 1QSSA 4H5RA 1NJYA 2P9NB 1DLOB 1S9EA 1CZAN 2FYXA 2CQGA 4ILJA 4ECXA 4PUOA 2RF2B 4AFFA 5LJWA 1HMVB 3ZT1A 2KTQA 1AZSB 1S59A 1U45A 4MKBA 5HL7L 4CZLA 4PHTX 1DQ9A 2L08A 2CADA 2DNKA 3PX6A 2G1HA 4OX8A 4FYWB 3GSIA 1NNEA 2H3EB 4QZVB 1MWMA 2QMXA 1DTTB 4BR2A 4Q0BA 1TMMA 3A5LC 4WFNL 3CJ8A 2CPZA 3HZGA 2GUIA 4W98A 2LQBA 1OY6A 5G4DA 1T3NA 3P39A 4ECYA 1YBUA 1FESA 2H9ZA 4K4YA 1GOAA 3KLVA 3NVMA 3ZO7A 1JX4A 2W9CB 4B1VA 3TAGA 3VEVA 5D3GB 2P8IA 5AQQA 3GG1A 3K5NA 1SCJB 1D3WA 1KQGB 5KG1A 3M32A 2YWEA 3BGUA 5A8KB 3IG1A 3FEXB 2XNRA 2DH8A 2F9DA 3OXGA 3FZKA 4FW2A 1KVIA 1I5OB 2FSNA 2XZWA 2AGQA 3JTNA 3T6BA 5B0DA 2B9XA 3I56S 3VAHA 1LOTB 3MTJA 2GW8A 1K1SA 3BB5A 1Q4RA 5LXRA 2UXBJ 4MIAA 1NK6A 3OYAA 5AJ3F 5FPMA 1H74A 5MAOA 1RDCA 1HNIB 4H4KC 3NRBA 3TO8A 1N88A 4H03B 1VSJA 3Q2TC 1GLCG 2VQEF 4H4MB 3MX5A 3L3CA 3HSZA 4DV4F 1SKWA 5J2QB 3LOUA 4HH1A 1FD2A 2CDQA 2K06A 1HI0P 2IPOB 1N54B 2CQ0A 5I3QA 2ZQBA 2JZ5A 2Q31A 3A8YA 3CW2C 5CD4A 1IKYB 1WWHA 2K2PA 2B51A 1T95A 4DFMA 2VA3A 3Q0AA 4MFBB 1FDBA 3SQGB 4CERA 3GCXP 3HZ6A 5JS1A 2OH2A 2V2KA 1BI4A 1JJHA 2J6TA 5EU7A 2KL8A 1YZ7A 2F9TA 3HKWA 1RUSA 2NYIA 4M5HA 3OYGA 3VQ9A 3SSQA 5A8WA 2Q1LA 4DHYA 4OMFG 2EPIA 3UKRA 3HOTA 4ECTA 3G96A 2XS2A 5J1EA 4DUZJ 4KHRA 2FY8A 3DLGB 4CJVA 2EHGA 1RT3B 2KHCA 3H5SA 1FJGK 1OSCA 3KG0A 3SXLA 4CLWA 5IFMA 3CCTA 3KUEA 3J7ZO 3SUPA 3MCPA 1M5OC 3KLEB 4WFAQ 2QZ8A 2BV3A 1VRUB 4DV7J 3B82A 2ZEJA 4K59A 4L72B 2COLA 2GAHC 1RU1A 3EL2A 4YNQA 1TVRA 2HHHK 2CJAA 1U1LA 4N47A 5HBMB 2YHAA 4DSLA 3M8ZA 3AOBA 3U3YA 2RDIA 2VFRA 1KRPA 3FFIB 4CM2A 4FNIA 3OL6A 4CJ3A 2OPPA 1FNOA 3D68A 2BM0A 2HVHA 3A8KA 1BUPA 3O3GA 5LMUJ 1AUDA 3GBTA 1SH2A 4HHHA 1HNWK 2E20A 2O4GA 4L3NA 4DV6K 2UXBF 5CYMA 3Q89A 1D0EA 2W8LA 1VDHA 4DR5J 1UEKA 4C2MA 4GKJK 3CCQS 1S72S 3BBFA 1VJWA 3HZEA 3V4IB 4TKTA 3NBPB 3WQPA 2MGZA 3QPIA 2F4FA 1FVQA 2ZUGA 5B0BA 4CFCA 3CCLN 4PXBA 2AQ4A 1EETB 1B7YB 3CFPA 4CNYA 3HHLA 2VG6B 3FBFA 2RE1A 1YK9A 3IN5A 3E66A 2XGPA 3MM6B 4ZIWA 3Q22A 2MKSA 4BWMA 4U7CA 3P45B 2D3UA 2OI2A 1BDGA 5FPDA 3CCMS 5K14B 3AQOA 4DPTA 2FF6A 2AJ4A 2BJDA 4A8XA 4YY3J 1MWQA 2BQ3A 2NRRA 2JC0A 2LMIA 1S77D 4WFBQ 1KAXA 4CM0A 2E8AA 4F3OA 1TKZB 3S3MA 4K2XA 5HRNA 4XAKA 3DRRA 1GLAG 4ZPBA 3W63A 3M7VA 4DOZA 3D0GE 3W8PA 3T3FA 3KLGA 3A8JA 4P2XA 3QLHA 3HRGA 4TXSA 4O0NA 4ZVUB 5KFLA 3G0ZA 2J0SD 2B56A 4DUZF 2E5LK 4URSA 2BGGA 1MMLA 5IC4B 4M3TA 4DG1A 4B1UB 4JHDA 2BJ8A 3S9HA 3HSCA 1X4BA 1N0VC 5AQNA 2V8DA 4KO0B 1R8HA 2VQFJ 1ZZFA 1MMDA 4DV7F 4DLGA 2DGXA 5K20B 1S0VA 4CYUA 2LXFA 3AVGA 2ASOA 4DTUA 4KHPK 4CEFA 3U02A 3S1TA 4X4PA 2V4QA 4JV1A 1FFWB 5E26A 3JTPA 1UL3A 2YWFA 3PHEA 1Y00A 2W2QP 2DNPA 2Q3SA 3GONA 1WSVA 4M94A 3SMPA 1KBRA 4DQPA 1MN7A 3A3PB 2A6OA 3SJJA 3Q83A 3T9ZA 5LMUF 2AYGA 4HT5A 3H20A 4J5OA 1JXVA 2JJ4D 3NS6A 1WN7A 2MY8A 4H5WA 4DR5F 3W61A 3E01A 3MPUB 4CF8A 3EMTA 3OR1A 1K73T 2P6TA 1FW6A 2M8HA 4KRWA 4JI5K 2DD8S 2XMWA 2HKEA 3CEDA 2ASMA 4RU9A 1UVJA 4USHA 1W2BR 2ADCA 1QJHA 2QA4N 1IBMK 3KK2A 1N0UA 2V67A 1YJWS 4CJWA 5BYRA 1RHMB 3TI0A 4R79A 1RCOB 1Q8IA 1L3UA 4OJRA 2BJ7A 3RVCA 3UVJA 4ILMA 3L7UA 4WCEQ 1IQTA 5EY4A 2XSJB 4CLPA 1E6VA 4YY3F 3H2LA 4IO9Q 1NHVA 1FO1A 3M1VB 3VTIA 1R8AA 4EHTA 2R8HA 1TR0A 4LRFA 2RU9A 4BRDA 4CJKA 5KFEA 3WUHA 4B9VA 5KFRA 1RB0A 4CIEA 3J80O 1Q95G 3DNCA 4CIGA 4BR0A 4ZCLA 2GQQA 4C8YA 2FZGB 4K4UA 3EGZA 2RQKA 3UD3P 3PDNA 2YNGB 2YQ0A 1LKZA 5A2QY 4O4GA 3IMXA 4HTLA 4QS7A 3CO9A 2P5VA 3W66A 4CLYA 5D4PA 1RYRA 3CCJN 3I4HX 1GK8A 2YWWA 3ZETA 2BJ1A 1B9FA 3BO3A 2VQFF 3CMAS 3PR4A 3N9UC 5AQVA 2C1EB 1P8GA 4BGAA 3QRPA 2IIRA 4M95A 4IOXA 3MN5A 3T5LA 3EPIA 2DFFA 1JXBA 1VGYA 3HULA 5MLCV 2NRTA 3DYAA 1RBOB 3QT6A 3FZHA 2AWZA 1KVJA 1BCOA 1T6CA 3P4IA 2ITMA 2P9UA 1FKAF 1ZTTA 3HJVA 2Y1LB 4ISFA 1UPMB 2DFEA 2LA4A 3WIVA 4MO4A 1X3NA 2AZ1A 3BBCA 3J80U 2RS2A 5KFFA 3CCSN 2XYGB 4ZTJA 2V0NA 3DOMA 3NNCA 4KIAA 5E3CA 4NLVA 3ZYYX 4I7FA 2NSBA 4KI6A 4ICLB 8RUCA 5L1IA 4ZDNA 1XHZA 4Q2MA 3BGRB 4DR6J 1FF2A 5JVGQ 2P9LB 4JKAA 1FE4A 1TFWA 1HBNB 1S48A 3PY8A 3THXB 3C6HA 2V68A 1FE0A 3N6LA 1IKVA 3NF6A 2LQ9A 1OYEA 1H6KX 4FK0A 4YS2A 4KRFA 4CEZA 1VQ5N 4DI6A 3SV4A 2DGUA 5LOQA 4A59A 1BQNB 2R7SA 5CABA 2FVSA 2F7TA 1NDKA 2ZBPA 5GINA 2DHGA 4ZP6A 1FI4A 2O8BA 3NHGA 3R27A 3LDOA 3BF3A 3R8EA 4IOAL 5IT0A 2R7UA 2CPHA 1YXQA 4EP4A 3MHYA 2BEFA 4K8RA 3CWJA 2RE2A 4UUWA 3HMJG 1FRJA 4FJGA 4WU2A 4DCHA 1SKRA 5IM0B 2LECA 2VYPA 1FKOB 9ATCB 4TQRA 1XNQJ 2A3JA 3J7AP 4AXJA 4ED7A 5M1KA 1OKJA 4CLSA 4J9VA 5J2MA 3MWPA 1HNVA 4ZP7A 5IZHA 1AB8A 3PW5A 4KH6A 4QU6A 2QFIA 2FBVA 1QTMA 3W3SA 3CC2S 4NRTA 2RHQB 4FPIA 4J2DA 3A3OB 3MM8B 3DXKB 3OY9A 3IM8A 2EVZA 3OVSA 4ZHRB 2X6SA 2FLLA 2W7OA 1WNEA 4GY2B 4PWDB 4FBUA 3O1BA 3MR3A 3ZSVA 3EE3A 2Z1IA 2CJQA 3NCPA 1O6XA 4I4BA 3MI7X 3NMAA 2DO0A 3FCVA 1U1NA 1CLFA 1RTZA 2HNYB 3H98A 1VK8A 4H4KA 1TKXB 5G0RA 3R5CA 1M90O 3CVKA 4H0OA 3EO3A 1KQSM 1C0MA 3SLCA 3VF2A 2UVRA 3ITHB 4CK2A 4FWQA 4PG5A 3QYYA 4P9SA 4WU3A 2BOAA 4DR6F 3NS5A 3BDPA 3CERA 4GKKK 4QR1A 2CZVC 2GIFA 1EXQA 5BR8K 1NDCA 5C25A 3BDEA 4MKYA 4ZKAA 1XBWA 2JRSA 1OY9A 4DV1J 4NA3A 5AQGA 2VFUA 3SQOP 4I64A 1VBYA 1IVZA 1YF5L 1GT8A 2Z2YB 2NRXA 3KUHA 1WSGA 3JSMB 4W5NA 1RWVB 3KNAA 1V3RA 3I0RA 1MU2B 4HL9A 4B9LA 2JFDA 2VBZA 3LM9A 1S6UA 1NK9A 1X5OA 3QNWB 1N36J 2F8TA 4PAAA 3NXZA 4WFYA 2I5JB 2DCUB 4ZA1A 3M8QA 1W97L 2J76E 2RDJA 2WSFC 3OA9A 2IDLA 3CE8A 1RGIA 3D54A 1AUSL 3SFUA 4PKHA 5BRHA 1GXTA 2XM3A 3B8AX 2QKBA 1G7CB 1CJVA 2DNLA 2DNRA 4HEA9 2BDPA 3T6JA 3G71N 2ZOMA 4CO5A 2P9IA 3PRBA 1NJIO 2V2QA 2X1FA 1XC3A 4JV5J 1JL1A 3HCXA 3ZSOA 5H9EJ 3H7HB 1B99A 1ITGA 2WOMB 4A48A 4CO4A 3FZLA 4QOZB 3OL9A 1NPPA 4BLGA 3NGZA 4W4MA 1RU2A 2AJ0A 1X31C 3KYLA 5HLFB 1UEUA 4G3IA 1T6DA 3UI3A 1E4FT 4F2SA 5ELZA 2N3LA 1WHYA 3QATA 3RU0A 2VHGA 3R5BA 3CD0A 3SCXA 4CZHA 2PO4A 1ZETA 2GO9A 4HACB 4BC9A 2V8HA 3BGLA 1PYSB 1U4BA 2QG9B 4AHVA 4NYNA 3CMEN 3O4NA 1YG0A 1T7PA 5CD4H 5J2NB 3A5NC 1RA7A 2WONB 4F7VA 3OSNA 3BSCA 2VODA 3KKRA 1NUEA 4O3SA 3CPEA 4MMOA 5DLGA 4LF4J 4NLGA 4TU8A 3MMCA 3O1WA 1S6QB 4M7XA 3LH2S 3DDNA 4JKEA 3DAWA 4NLSA 2A40A 3AOCA 4C11B 3PYGA 1FJEB 1PYOB 1KN6A 3VTHA 5LY3A 2ZZNA 1BIZA 1RACB 2VH7A 1VQ4N 2OEKA 1WOOA 3QT5A 1CXQA 1H2UX 1WF1A 4JK8A 5KFZA 2J8SA 4DV5J 4DV1F 3W0LA 2ZJQQ 1GOCA 3CCVN 1M1KT 3DLRA 1HIYA 3G8QA 3VAJA 2C2MB 1QM9A 4CIFA 4M5DB 4OJGA 4OVLA 4A5AA 4DL5A 4NPOA 1S97A 4JI1K 3TARA 1N36F 4FSVA 4IUFA 3M2UB 2RJZA 4ES3A 4I2PA 1KWMA 2IVFB 2BJEA 3THYB 2YHWA 5SWMA 5CCLA 3NF9A 2ZM6K 3RMCA 4UUXA 4O23A 2DR8A 2X51A 4G1QB 1RWXB 3TABA 4FLXA 4QPXA 1JLCA 4ED8A 3L09A 4M3YA 3ZSXA 1R0BG 2HFVA 4NASA 1P1TA 3JS9A 2IMWP 1ATSA 4KB7A 2V2ZA 3HJFA 4KHMA 4NLPA 2Q43A 1YRUA 3ENOA 2ITGA 1LW2A 1K1QA 2UUAJ 1TUWA 3BKFA 2DNZA 2HS3A 5F8HA 2J0QD 4JV5F 3EDQB 2MJNA 3ZNJ1 2WB4A 4TLQA 1QAYA 1TYQA 2NSCA 3VEXA 9RUBA 1HKBA 4M5IA 3T5JA 3K0JA 2HF4A 4CJRA 4CLKA 5LMNJ 3CJKA 4R0EA 4GVBA 4RW4B 2MQLA 2OFHX 1Z2ZA 3GCWP 5K5MA 2ACMA 2IVNA 1SUQA 4Y28C 1MWKA 3KZBA 1FNXH 4WP9A 3E1YA 1LK7A 4Q2LA 3DMJA 5C2CA 2HHUA 3U1LA 2C42A 4BC2A 3VA3A 4JI8K 1RT7B 1Q7YT 3V9WA 2VDIA 4FNHA 4PRFA 1QHAA 1NDLA 3V6KA 3R9PA 1VSMA 2C2DA 4LF4F 1XR6A 4Z4EA 2VPYB 1YKWA 2RMLA 4ZLLA 5DK5A 4IJAA 2FLOA 1WG5A 1BY9A 2H5EA 2XCPA 1WC6A 2CQPA 4FYVB 3NAIA 4BWJA 2X3GA 4P2SA 3T1YF 2M2BA 1R6YA 4M5NA 1UAWA 4FO0A 3H3NO 2JLFA 1C0UA 5JMVA 4JK7A 4FJ8A 4DV5F 3PJWA 1UW4A 2D41A 2IY5B 1WC3A 3TZXA 3HPOA 3R7SB 4BROA 1VR6A 5SZTA 1FDDA 2PIIA 3V6JA 4F26A 2DIVA 1TKTA 2HMIB 3GIKA 4RUCA 4L73A 2PZSA 3QWPA 2O8EA 2HNZB 5JLFA 1M5HA 3T19A 3MAAA 5HRPA 2VOOA 2J9CA 4PZVA 1EP4A 3VQ5A 3SQ1A 5L1KA 4MIWA 2B6AB 5B0CA 2O67A 5KFIA 3AVLA 5CZ1A 1YWXA 4IRKA 3ENHA 3CJCA 1M1GA 1FDNA 1Z25A 4C4WA 3OTCA 3NGYA 3TRGA 4X64K 5IWAK 2K3IA 1T3OA 3HVAA 2DISA 4UW2A 2QL7B 4AE5A 5E2QA 3EVOA 5LSRA 4JV2A 1RWNB 3ZCMA 4OHZA 2KYXA 5I42A 4Z4GA 2XMKA 5I3UB 2YKPA 2DH9A 4M3ZA 2DKOB 4IOAQ 4L76A 1GAOA 5IXUA 4XPEA 2PA3A 1ZBIA 5DMRA 2JGUA 6FDRA 1ZPWX 1NMEB 2ZBQA 3FZFA 4RW9B 4CFAA 4KKOB 2WW8A 3TUZC 4MQ3A 2OD6A 2G8VA 4WK3A 5L46A 2YNHB 2HHPA 3OFHA 1RHKB 4TLRA 5D4LA 3L8BA 2AT1B 2CUYA 4WBFA 1RT4A 5HMYA 1NKEA 2D0PA 4A47A 3CDEA 1K8AO 1AFJA 3I82A 4KH0B 1PSDA 2O8FA 1PJ5A 3NGIA 3J81Y 2UXCJ 2UUCK 1XMQJ 4O44A 1KR4A 4BDYA 4BC4A 2VFTA 4CJEA 3H40A 2XMAA 5HROB 3V6DB 4CGGA 2G0CA 5EOYA 4BR7A 3A4TA 2ASLA 4LR9A 2GAGC 4I6YA 2XB2D 1RTIB 3LWMA 3IBCB 1VQON 2P5OA 2J6SA 2HFSA 4FK2A 1TKDA 4I56A 3CCWA 2QXFA 3AB4B 3PXGa 3OD2A 2VIHA 2HFOA 4KR0B 5HVGA 1LWCB 2OMLA 1SKSA 3S01A 4HWIA 1CBKA 3VZIA 4DDFA 4X65J 2VONA 2C22A 4DV0K 3EDRB 5KFWA 3ILLA 4FKXA 2GV1A 4CJLA 2CA9A 3QJJA 4U7UD 2GGPB 4C1NK 4A5BA 4P72A 2OPSB 5C12A 3LTOA 2BBEA 4DUYJ 3HM8A 1HWKA 3CDBA 3HSJA 5F0UA 2FHOB 4MAKA 3N5FA 4OYZA 2V50A 1HRHA 1NMDA 1F60B 3ET6A 2YKMB 1X4GA 1RGVA 1I1GA 3ENVA 1ELOA 5KPZA 4P2FA 4CO2A 3KXDA 2HQGA 2B4OA 3F2KA 4DR1J 2A0FB 2LQ8A 4ILRA 1QSYA 3UIQA 3D6HB 1X4HA 1RABB 1I94K 2P9SB 3AJDA 2BQRA 4ENOA 1FWKA 4K4WA 1GTEA 3MM9B 4DR3K 2I1RA 3ADAC 4PG4A 2QTWA 3W64A 3CXCR 1OVQA 1VSIA 1TL1A 3RW6A 4JKCA 4IDHA 1G3OA 1FRKA 2E1ZA 4DQSA 3CQ8A 1JQGA 2FC9A 4JRPA 2Z2LA 3C6TA 2B8QA 2UXCF 1HBMA 2V7YA 4YR2A 4U9RA 4RJVA 3MCOA 3MOZA 3CFRA 3QGHA 3RTVA 1SQKA 1JCGA 4BVPA 2YQ3A 3CCUN 3ENBA 2WK4A 1LQ9A 3IFRA 5ETQA 3NF7A 1NRKA 1EQYA 4R25A 2C3YA 1SH3A 1VFJA 3GR0A 2B9EA 1TAQA 2F40A 2UYTA 3DCAA 2V7ZA 1BC6A 1KFSA 3IS9A 5IT9Y 1NOZA 1XEZA 3QFHA 1NGDA 1AFIA 3V9UA 2QA4G 2H1YA 3ATVA 3ZZTA 2E2OA 2GZOA 4I68A 3OVAA 3DLLL 3ID8A 1S1TA 3TJAA 1LK5A 2X74A 4DQ8A 3CXCM 4PPZA 4OHXA 3NEKA 4O8UA 4ILGB 4PR6A 5HO4A 4RNOA 3AARA 3FVYA 3PNIA 2LKZA 4O3NA 1RSCA 1GFWB 4KT0C 1FKPB 2DGVA 1X5TA 3AD8C 1UVKA 3M2RB 3RSEA 3BZQA 1OPZA 1CJKA 1YJ9N 1LWEB 3NWRA 3G6VA 3M6GA 1PIEA 2FJAB 4GVMA 1UWBB 2LXIA 1RAFB 2ZWHA 4RW6A 2UUBJ 1SIWB 3I5CA 4NYZA 4KPYA 4I6MB 3NAHA 4DR1F 2DGQA 5EX0A 4KHUA 5ETVA 3SSSA 1WDDA 2HW3A 3DRXA 4MJKA 5AZIB 3RYLA 4OZLA 1A0OB 2O5DA 4CH1A 5KGWA 3P6YC 3VAFA 5KG6A 3D3CJ 2Z58B 1XTZA 4CI6A 2KJWA 4F50A 4M1KA 1J53A 1FXRA 2AYEA 1HHQA 3WZ0A 4JI2K 4QBUA 4YOUA 2GQ2A 3GR1A 2KRBA 2FD2A 4X62K 1BISA 4M3XA 3JTOA 1NZ8A 3B6BA 3PTWA 1YIJN 3ZTQA 4E7JA 3LGNA 4X4OA 3DLJA 4DB3A 1HBOA 5KFVA 1R59O 5DDOC 2QX0A 3B6OA 2H4YB 3E2EA 3HYFA 2NUHA 4H0PA 3OFEA 1U25A 1Y97A 3BR8A 4KHQA 3ZX3A 2XULA 2MB0B 1QUVA 5H1SV 3FMWA 4WIQA 4K42A 3LGMA 3DRPB 5AXNA 2JLEA 4NYPA 4EK2A 3EYZA 2QA4S 1RILA 4TY8A 4WXWA 3LDNA 1VBZA 3G4SN 5DRKA 3KK3A 2FC8A 3MEEB 4ID5A 5B0GA 1KC8O 2GIRA 2AW0A 2A2DA 3MPDA 1GLDG 2PT0A 1X9WA 3K8WA 2L3MA 1J5EK 2CFXA 1U0HA 2A41A 4E8UA 1UPPA 4CGHA 4M42A 1XQIA 4IFYB 1F2GA 2W6LA 3LALA 4NCGB 1VQLN 2OAUA 5GAGU 1XHXA 3GE1A 1H98A 1N6QB 1TP7A 2YHYA 4URGA 4QYZJ 3PKMA 5FRMA 3IRXB 1IJEB 4K4SA 2V52B 3DLKB 5C24A 4QWBA 2ZE2A 1HQEB 1Q8LA 4H4OB 2KFNA 2G9OA 4TU7A 1W26A 3QJLA 3C15B 4C8OA 2UUBF 1VK3A 1NCLA 1JKHA 3CJBA 4M7YA 1K9MT 3JYTA 4OX6A 2GFFA 2KB2A 4DZDA 2C28A 1SQGA 3W2VA 3H3OB 4RO0A 4ID1A 1LV5A 3ILIA 2FJVA 4DR2J 5KFCA 2IVYA 3GYGA 2GELA 2E66A 2QWPA 3H08A 1IR2A 2ZHOA 4B1ZA 3H1QA 4P71A 5T14A 4ETZA 3O9SA 3QEWA 3N4WA 3ZSZA 2BE2B 5BPLA 1KNZA 4N8NA 3VGVA 1ZBLA 3HP9A 4IYQA 5CHCB 3J7AN 4Z4IA 3DOKB 5EDWA 4DV2J 1F9FA 5AR0A 1QVGR 2H5JB 4C3MA 1O0PA 3RWUA 4Z2XA 4OHVA 2UXDK 3M9OB 2BACA 4BRGA 4USTA 4IEIA 1IKXB 3OTEA 4RBTA 3R6MA 2X6NA 3MMBA 2XI3A 5B0AA 1N34J 5HRRA 5LL6Z 1YITS 1UVMA 1K44A 3AVFA 1VLYA 2C3PA 4JLHA 3C8YA 4OX9J 3RBXA 4C7QA 1X60A 1S0NA 2EK1A 3LP0A 3QEVA 1RLDA 3SAHA 1T9TA 1UJ6A 3K2PA 3I31A 2VDHA 1MW7A 3HHLD 4OQJA 3O8WA 1VQ5S 3VF4A 2JH3A 1NKBA 4X4NA 1WBDA 3OVNA 2BZ2A 3CT9A 2KKHA 2QA2A 4OGCA 3FQLA 5D15A 3GJTB 3QO9B 1V3SA 3C6UB 4UY8O 1B70B 4L6V3 1CJTB 4OJHA 5AXLA 3F0NA 1LNQA 1EKRA 5DDQC 4MLHA 3OJUA 1N33J 5C2DA 4JUZA 3C14A 2Q6BA 4XTTA 4OHYA 3G6XA 4E7IA 1BL3A 1RDUA 5KT7A 1QVGM 1KLMA 2VU5A 5DG7A 4CZJA 3I96A 3OQ2A 3CI5A 5E3RA 4EBDA 1KDNA 2NLWA 4WP8A 3QINA 2R42A 3M6XA 2H65B 2OPRB 3ULEB 1N4LA 3O3FA 2W2OP 5M1PA 3VGLA 1FNMA 5E0OA 1XNRJ 2DPIA 3HF5A 4IG3A 3UKUA 2WBRA 4YUDA 4HDHA 2OTJS 3PSFA 2VQEK 4DR7F 2EEYA 3DKDA 3I56N 2ACYA 2OGUA 4CZGA 1R89A 1AA1B 3N28A 1RLCL 5KRTA 1UVNA 2IAJA 1XQSC 1H38A 4DS5A 2B4UA 4YB5A 1WEYA 3DGVA 2O1PA 4CGJA 3UD4P 3TAPA 2KVIA 1I3AA 2BKOA 1F2HA 1S6PA 2X1AA 3EJMA 4KQZA 1SBRA 2QWRA 2MSTA 2K1RB 3PSIA 3UWTA 5FDLA 4EYIB 4U8YA 4DV2F 1T9WA 4YOYA 3FK4A 4FJJA 3LL3A 3CJTA 4FPRA 2GS8A 1SC6A 4J9UE 1KD1T 1KP6A 3D5MA 4Q45A 1N34F 5LJ5Y 3GYXB 4WKYA 2KFZA 4PKGA 3EICA 1P6TA 3VVTA 4FWPA 3RAXA 1CSJA 4OX9F 3G9CA 5KT5A 3LAKA 3MN7A 2IRYA 5C5JA 1MA9B 5KPRA 4M5KA 3CPWR 1VHIA 4RLEA 1DTQA 2XYPB 3H5UA 1Y0HA 1HBUB 5EXWA 3PW7A 1KVCA 2ZZMA 2VBYA 4LFCF 1Z4UA 4FF4A 3ZEUB 1B92A 4RCHA 1W9HA 3OHBA 1EJ7L 4XO0A 4P10A 4F0HA 2QLJB 2C2NA 4AQYJ 2YJEA 3CFOA 2FF3B 2GQCA 4XK8C 5EWEA 2NQPA 5K9FA 2AA4A 4CH0S 1N33F 3ZZRA 2RB7A 4AHSA 4NYOA 4IG0B 1UTAA 4B3TJ 5DJBA 3LWLA 1G4CA 1HI8A 3AOAA 3G71S 4OZ0A 2XMMA 3KHYA 2O8CA 1HQUB 3QDKA 4JI7J 2CQBA 2N7CA 1KFDA 3THTA 3BP8A 2DH7A 3RUBL 3EXCX 3QGGA 3R8YA 4XH1A 3DLLQ 3U9DA 5HN0A 2M3DA 1XNRF 3AQPA 3QMQA 3M2VA 1DGKN 5JJBA 2D3O1 4ANDA 2XTJP 3TVYA 4ECWA 1K8KA 2MQPA 3G8TA 2DO4A 2M8DB 4KFBB 2HLUA 5T7LB 1GLLO 2EFGA 3LF0A 2KZMA 2GMLA 3DOLB 1R0AA 4W92B 1BQMA 3MR7A 3CCQN 1S72N 1IBCB 5IV3A 3CQXA 4LSNB 1ZZNA 3MXMA 5JVHL 2C3UA 4J7CA 3AVKA 4H0TB 2HVEA 3CTRA 3N0VA 1BE4A 4MDAA 1NJXA 3E9PA 1GXLA 1WACA 1R8BA 1C2PA 4BC7A 4KSEB 3VPZA 1VQ4S 5LL6d 4CZCA 4MH8A 4DUZK 4YHHJ 4RUBA 3B6PA 2KN4A 3OS2A 3MN6A 4LT6A 3ZT2A 3SV3A 2M5YA 4WE1B 3DRYA 4NEYA 2V4JA 4I1TA 3CIZA 5AFUA 3DJCA 2KXFA 3I9ZA 3K5LA 4D3GA 4Y0FA 2ZJRL 4HLBA 2HRUA 2HZCA 2FPHX 2MKHA 3DI6B 4GO7X 2ZH8A 2MHNA 3WC2A 3BF4A 5CZXA 3KWMA 1RDAA 1HPZA 4AQYF 3GV7B 4YOEA 1TL7B 3IWLA 3K2YA 4EP5A 3SAFA 2IM2A 1ZXOA 3MURP 2MZ1A 2CIMA 1H1VA 1EO1A 4B3TF 5M2RA 1SJ1A 1EQMA 1S12A 2AZ3A 4LC9B 2QMWA 3FRZA 4CF9A 2VKZG 3Q8PB 3HFZB 1WUUA 4OI6A 4JI7F 2P9PB 2QMUB 2XRIA 2NZTA 3NLCA 4WYBA 4DR5K 2VC1A 2PFDA 3VQ8A 3DC2A 2N3OA 3T1HK 2M9KA 3PKYA 3OYEA 1O51A 1O1WA 4LH5A 4CEQA 4ZOSA 2R8IA 3VN5A 1WNSA 1FVSA 4DLEA 1VQYA 2NZCA 4ZPWR 2IHR1 5GIPA 2BKPA 4YOXA 1VBKA 2QYCA 3SJHA 2GEMA 2DNGA 1SV5B 2WVFA 1Q79A 3CC4S 4NI2B 1U1MA 2RQ4A 2QL9B 3QZ7A 2XS5A 1M5VC 2DFHA 5BYSA 5LSLA 4YY3K 1YHQS 2VWKA 5FLXO 1PKUA 2XY6A 5CA5A 3DXMA 2E9RX 4IKFA 3FE1A 2VUGA 3O3LA 3OBWA 3V6HA 2ZNZA 2ZITA 1YJWN 1RP5A 3MM5A 3Q8RB 1XERA 4FZZA 3U27A 3JSYA 1DT9A 1NDPA 5IOLA 2JDJA 3KJQB 3MZIA 2ZVIA 2YNFA 2HGNA 3I5BA 2QSWA 4B3OB 2W01A 3S8SA 3JSBA 4AH9A 2CGJA 4DQRA 1FT8A 3ISZA 2VFSA 3AHPA 4G6VB 1FRIA 3ELHA 5DG8A 2YH0A 4X2BA 1G99A 4CDIA 2VQFK 1B0PA 2BXJA 3HDSA 1C0TB 1B3TA 3QB0A 3C94A 3O6WA 2N82B 4EBEA 2RSQA 1FJCA 5FLXU 4HCCA 3CG7A 1DAXA 5ETTA 1RBRA 1HARA 4FL9A 2RT3A 3OYDA 2IGIA 2I0XA 4FJIA 3CMAN 4WTOB 1VRTA 2B9WA 3NGTA 5GAGP 3OTBA 1N5YB 2WAQD 5L1LA 1Y4ZB 2ZH3A 4X66K 1RT5A 3SEOA 2ZH4A 4OPHA 2OD4A 3JXUA 1T9XA 4CEAA 1P27B 3BO2A 4B1WB 1MROB 1LXJA 6FD1A 2Z2MA 1X3MA 2IMOA 2HURA 2P9KA 2X7IA 1HR0F 2YHXA 3O80A 1SC1B 1XR7A 1PILA 2XQCA 2HHTA 1VJQA 3MM7A 3FEYB 2DT9A 4QW9A 3ID6A 1FK9B 5DDRC 3SIPB 4CJPA 3DRSB 4CI0B 5KFGA 3LGHA 4FLWA 4G65A 1FJGJ 2GWJA 5AQKA 4X84A 4PEOA 2ZOGA 1IO2A 5DGBA 3ZZUA 5EGYA 1N48A 1LCUA 1UA1A 4FYDA 4KY3A 3ONQA 3LPUA 1S1UA 5GMEA 3BO4A 2GO8A 1GXUA 4JI3K 2HHHJ 3IKMA 1N8RO 2NPFA 3QGPA 2XC9A 3E51A 3CF5Q 4UZBA 3HSGA 5AXKA 3W2WB 3FNNA 2JX2A 3OT9A 3W9JA 1VC5A 4EIAA 1S1WA 4PCQA 1RTHB 2B7CB 4K5RA 5T7BA 2QE5A 3VQQA 2KFYA 3A8IA 1Q82O 4NLBA 2XWXA 1PC4A 4GKJJ 3A5OC 1O8BA 3LAMA 1GOBA 1WKJA 3J7ZT 3CJ9A 3JAMO 4NXNF 1DEJA 4CD1A 1J9AA 3QWUA 4DL6A 2OANA 2IRUA 4C8NA 1L3TA 1KSPA 2ZD1A 5HMXA 1PO6A 1N5QA 3PX0A 4WQ4C 4BHQA 4IOCL 3POTB 4KV8A 1XK8A 3LPYA 1BCMA 4N8OA 3PV8A 1U04A 4PPDA 4JYAF 3OR2A 1D9FA 5FPNA 2HIQA 1R27B 5F8GA 1UZDA 3BQ1A 1M5KC 4ZIVA 2Q36A 3MN9A 2A6MA 1JLEB 4DTXA 1Q8BA 2QT7A 1U2VA 2RILA 1LFWA 4LF9J 1N5SA 1GTHA 3FZMA 1VC6A 3GQCA 2JWLA 3TX0A 1YI2N 3R7BB 1VSDA 3NH1A 3Q8VA 2GJFA 4IRCA 3X3UA 4DF8A 3TUPA 1U6BA 3C95A 1WB9A 1IBLF 1OS5A 3JAMU 1ACMB 3NCRA 2CPYA 1FJGF 4FLUA 2FZKB 1CVJA 2M70A 3HVTB 4RNHA 2RS8A 3V9SA 4B3MK 4PQUB 4B3RJ 3QSIA 4BRLA 3ZFVA 5HSPA 3ISNC 3C7NB 1GLEG 3AO3A 2VG7A 1T9VA 1B0TA 3KK1A 4KHPJ 3RBEA 2Q0RA 3NF8A 2Y1IA 3PIOQ 5KFBA 2HAFA 1FRXA 4CZMA 1RWKB 3KOAA 2V2VA 5FROA 3NGRA 2JEGA 1Q9YA 3DGPA 3CCUS 1AXQA 4YDDB 2HNDA 3IAYA 2FHKA 4QIFA 1GLFO 1T03B 2KM8B 3G25A 3D45A 1WSEA 4KI4A 4ZVQB 2PYLA 4CTAA 1RHQB 3BYRA 3UO0A 2ZBCA 3HT0A 4B3SJ 5B08A 1I51B 2ZFHA 2ZDPA 1SJ3P 2QLXA 3FGUA 4GKJF 1VQMS 1T3VA 3RJMB 4ZLPA 3IUCA 3KLHB 3LP1A 2Y1JA 4U95A 2IA6A 1BG3A 2D69A 3M8RA 2W9BB 2DRAA 3ZT0A 3FZ2A 4JI5J 3V1QA 1IH7A 3MK6A 3NCQA 4LR8A 7AT1B 3WNHA 1IBMJ 3AY0A 3JS6A 4FBTA 3MEKA 2J5AA 2J0WA 1M0SA 2IJNA 4LR7A 2EFQA 5KT6A 1RT1A 3C46A 3MXJA 3WXIA 2DNHA 1QQCA 4FPBA 4TNOA 1YJ9S 2E7VA 1DFDA 2MSSA 3P83D 4IXCA 1KTQA 4XPCA 4OLPA 3N5BA 4KYZA 4FJHA 3UN2A 3D28A 2A6AA 3OSPA 4S0MA 3HVRA 1IM4A 4LF9F 3QFUA 1K0VA 3A1YG 4BC5A 4C0HA 2X1BA 1MWZA 1RDDA 1FXLA 2L9NA 5KQ8A 1C1BB 1HYSB 1S1XB 3N4PA 3VQTA 2ROGA 3AXKA 2GUPA 2B5JA 3M8WA 4ZVSB 3WQTA 1RWMB 3IR5B 4NLOA 1ZA1B 3GJSB 3KK7A 2E1RA 5HK4A 3KJVA 4ZJQA 4EBCA 4P7TA 4IR9A 4B3RF 3MDFA 1TGOA 4JKDA 2OEMA 1HNXJ 4ZMMA 2DGTA 4KHPF 4JD2A 4ED2A 5A8RA 4RNNA 1JMTA 1GLBG 3VAKA 1S9GB 4LF8K 2OJ3A 1REGX 1WF0A 3MFHA 4LSLA 1A6LA 5AQYA 4EUVA 4B3SF 2PBDA 2OO4A 3IMQJ 1YT3A 2HSTA 2FVQA 5H9EK 1ZBSA 3RB4A 2BUNA 4DX5A 4IRDA 3NWGA 3LZJA 3TZZA 2Z0GA 5F9NA 3OYFA 2BM1A 3TJ8A 1KAYA 2JNJA 2KZZA 4CECA 1CULA 2XMVA 3O4QA 2A1BA 4TN2A 1C0FA 1BLUA 1M1KO 3O9RA 2NUBA 3D2EA 3LDQA 1SQEA 1FDAA 2AJ2A 3WX8A 4Z4HA 2Z2ZA 4O55A 1URNA 4ZITA 3LM2A 1U1QA 2LDYA 1BXNA 1J5OB 3GSDA 3N6NA 2GVZB 5K8MA 1QZ5A 3SNNA 3G82A 2DEIA 4OKEA 4LVOP 4HVZA 1Y10A 4F0MA 3W60A 2ZH9A 2WRMA 2E1CA 4I6WA 3K9KA 2E4LA 5ADXA 3T1YK 1E6YB 2K7JA 3E9OA 1WSHA 3MMAA 2HZVA 2A18A 2AMCB 2XHWA 4FN5A 2LEPA 3ILJA 4ZVRB 4X4VA 2OA8A 3TAMB 1KAZA 2R7XA 2POKA 5DO2A 2J7WA 3I5AA 2NRWA 3FRYA 1S57A 2W41A 4FM0A 1JLGA 2VG5A 3KD5E 3IGVA 1VAZA 3JQKA 3TSUA 3BPSP 2Q97A 4DPOA 1UAXA 5AFUH 1JLAA 4F4KA 3QIPA 1HNXF 1UFKA 2YX7A 3TR8A 4H0XB 5F2RA 2QKKA 4MK9A 3KFWX 4UQGA 4U67Q 2VCPA 1Q7YO 1IKWA 2F5GA 3OYJA 4U7UK 5HP1A 1NMNA 4GV3A 1U6ZA 4HH0A 3UE2A 2DXFA 3OLBA 3V9ZA 1H72C 1B64A 4M3WA 1IG8A 1ZBTA 1RT6A 4DU8A 5DM7Q 2D0BA 1I39A 3RRKA 1TV6B 3JQMA 2O3DA 1UKUA 4OZ1A 3EZ5A 2W42A 2XLJA 4V19S 4K8XA 5DQIA 4FPAA 1VS3A 3O08A 4KJIA 2KXHA 2AJFE 4H5VA 5ITHA 2W7AA 3EVMA 8AT1B 3O2IA 2OPQA 4GKKJ 5U47A 5BR8J 1U8WA 2XLKA 1U2CA 4DZ6A 1SPBP 3UE5A 4P52A 5L38A 3NL0A 2KJVA 3QRQA 5M2UA 5GVQA 1VQNS 1CPZA 1ZYQA 3SAGA 1RT2B 4V19J 5K8OA 3MX2A 3V1OA 4DTSA 5LJVA 2R4FA 5A0YA 2O8DB 4AD6A 1S1VA 5GMKa 1CS4A 3R1LA 3E3XA 1QS4A 1S9EB 1NNDA 1FX4A 5EWFA 4AL5A 5D0RA 2DHSA 4PUOB 1WC5A 1M90T 1QVFR 5GAEI 4UOFA 1Q9XA 1JLBA 5ETNA 4CEBA 3BM7A 4X4TA 7FDRA 1QE1A 1HKGA 1Y11A 2OZSA 2XY8A 4IH5A 1QQNA 3QEPA 2RAQA 1S49A 1ASWA 4Q0BB 1TL3A 3FLCO 4DL0C 1LFPA 4V1Ak 4F4YA 1FTCA 2OLWA 1Y64A 3GB0A 1J6ZA 4EFHA 3MUVP 4B9SA 2EX3A 1T9UA 4NCBA 1JWWA 3U7JA 2E88A 2B4VA 4IDKA 3GV8B 1R7IA 4QOTA 4K50A 1TZ0A 3HM9A 2C2ZB 1RTJA 1RBUA 2BE9B 1IJFB 3Q2SC 3D2FA 4FLZA 2Y8YA 5FRNA 4IFEA 3M32B 1RK8A 4JRQA 1XIQA 1Y5LB 3IG1B 3C3LA 3PO5A 1QVFM 3VZHA 3Q8UA 1C1CA 2F63A 2LSNA 5ETMA 4ED1A 4QW8A 2CYYA 4A61A 4WF9L 1FFSB 3OYKA 1ZOTA 4J9KA 1NJIT 4WQ4A 3PIPQ 4KHWA 3NH2A 1RWWB 4GKKF 4I67A 5BR8F 5KRSA 3M9NB 2MPUA 2ATLA 3LP2A 3C16A 3NH0A 5GAHU 2CWKA 4JI0K 4DU4A 4JI6J 1KXPA 1EIYB 4BRNA 5F41A 1S7IA 3S7RA 3ZSQA 4B9MA 4E98A 2K7KA 3VOVA 2PSZA 4NLUA 2R8KA 4KGKA 1WKLA 3R2CJ 2CQ1A 4FM1A 5KG3A 4DN0A 5C0YA 4JI1J 2EW9A 2BOPA 2B9YA 3QAEA 2PN6A 1SS6A 2ZM6J 5JMNA 1QLNA 4XIUA 1KOHA 1Q18A 2BMBA 1BI4B 4BGBA 2UUWA 2WCXA 4DCOB 1WTBA 4PG6A 3BPDA 1FEEA 4B9QA 5A8WB 4F4ZA 3TX8A 2NS1B 2D4WA 3T5HA 2FTRA 3I32A 1LAVA 5F1XA 2WB1D 3ZZYA 2FBXA 5KFJA 3UKRB 4ES2A 2B7BB 4CGDA 4U96A 1IUJA 2UUTA 4QWDA 5J1EB 4OYXA 3TTDA 1TUGB 1GH8A 2WVDA 3AA2A 2G0JA 2A3ZA 4NYFA 3FGVA 7FD1A 5HJXA 5IC6B 3SUNA 5CYQA 3CJSA 2ZUAA 1SXLA 1Q1KA 3FZBA 4QIWD 4PG7A 3W62A 4DL4A 3C0BA 4DSIA 3P8BB 5EVZA 2DHHA 1MN9A 2BUPA 2G8HA 1W7WA 3THWA 2R2UA 1TVRB 3SDEA 1VQ9N 4JI8J 1VLOA 2V8VA 4I9LA 2Z1JA 3RZAA 4ECUA 4LF6K 2PMHA 1U0SA 2ZGYA 1RKIA 3MEDA 4EEYA 2OPPB 2W4CA 4DR1K 2D74B 4HCBA 4CJ5A 2XY5A 4J2AA 5F8IA 2IJFA 4LFBK 1NHKL 3TAQA 5CYMB 1LW0A 4J9PA 5HVHA 3LDPA 3EVWA 3GG4A 1OJ4A 3M30A 2L9WA 5A6WA 4JI6F 4K5SA 2YCHA 3VALA 1WJ9A 3X1LB 2MGZB 4B8CA 4O5BA 4OYPA 3MUTP 5HAOA 3HHLB 1WELA 2HWTA 3OUYA 4A57A 4BQLA 3H45C 2QIFA 3UQSA 4AHCA 4JI1F 4M8LA 3T1AA 2LU2A 2V94A 1A7GE 2ABYA 2ZM6F 5M1NA 4C97A 4F9OA 2DB1A 3MR5A 4USUA 3UNGC 1U02A 3GE9A 4HKQA 1X0PA 1QAJA 1ICEB 2G8FA 2EKYA 3SUQA 1RAJA 3BSNA 3KHHA 4PQAA 2WVBA 2KH9A 1VQ7N 2MLXA 3PJXA 1H7WA 3DRRB 2XWYA 2DRBA 1NK4A 4CHYA 4X64J 3DN9A 5ETLA 5IWAJ 3V9XA 2GTDA 2ADBA 3GL1A 3KLGB 2NXCA 3QLHB 1FD8A 2HAIA 3GPAA 3P49B 4ZVHA 3S6EA 3TUJC 3CNQP 3HTVA 1YJUA 3L2RA 2J8AA 1OH8A 3H2VE 4DG1B 4W5QA 4CRJA 3AVMA 4JHDB 3C6AA 4CHOA 2CJXB 3D6TB 3HSDA 4BR4A 2JEJA 3DU5A 2IC3A 3QBWA 3PRDA 2Z1GA 4Y65A 4NRUA 1RAAB 4CYUB 5HQ8A 2L9DA 4RW7A 2YVSA 4RWXA 4LY7A 3HP6A 4JI8F 4B8AB 2EG2A 2B3TB 3FC9A 3VENA 5DM6L 4FJ9A 3OLAA 3M8PA 2UUBK 2WBMA 3O9TA 3OV7A 1X4DA 1SZ2A 1A9NB 3D0PA 1BWFO 1UZHA 5F8JA 5KT2A 3BF1A 2UUCJ 4FWRA 4F04B 2GHVC 4F67A 1DHMA 3OHAA 4ZVTB 4ZN3A 4A2BA 4MO5A 1R0CB 2JC1A 4K4VA 4E19A 3E01B 1W2IA 3NGKA 1EWRA 1V9OA 4PL7A 5AZJA 2DPNA 5J2PA 2NRHA 2FGOA 4KH5A 4FLVA 2P5GA 3OR1B 3R5DA 5SUHA 2VD3A 2HBRB 2MMYA 5I4MA 3KIOA 5HL7Q 4DTMA 2W6KA 4FF3A 1NK5A 3KLFA 3EY1A 3MR6A 3KK2B 4FWSA 2NXEA 4HUGA 1JLFA 5DDPC 4CZIA 5L8RC 1VRQC 3G6EN 2IBOA 4F3TA 4WIIA 5HVFA 2AYMA 2BH1A 3UVJB 3A5MC 3CQYA 1Y5IB 4WFNQ 1E6VB 2AV5A 2C2EA 4OV6A 2XEXA 1K8AT 2YV0X 4DV0J 3KDOA 4X4QA 3GZ7A 5AQPA 4H8KA 5ETSA 3NAEA 4LF7J 3J7YI 4JKGA 1BD6A 1CLQA 2GJIA 4X64F 3VEYA 5IWAF 2U2FA 4C0OC 4Q5VA 1RZMA 2FHMA 3THPA 4RW8A 3SCKE 4NXMJ 3GFXA 3LANA 4M5MA 2CVIA 2MXYA 1V5VA 4O4GB 3TTCA 2L41A 3PYFA 3RRGA 4CHPA 3SBMA 1T05A 4ZPTR 3A8EA 2YHBA 1YITN 4QCLA 1BOTO 3V81A 3ZETB 1NK8A 4JN4A 4B9NA 1X4EA 2NNWA 1I94J 1R31A 1PG5B 1ATRA 3OL7A 3U1NA 3PVXA 4DL2A 2L48A 4DR3J 3OYHA 2MQ8A 5KG2A 1FRLA 3H4BA 3DYAB 3VQDA 3UDLA 1TFYA 4WKRA 1NGFA 4NB4A 2P9UB 1OWXA 4OL8A 4J9NA 2QJ3A 5AXMA 1KHWA 3CD6S 5M1FA 5TKYA 4EHUA 4I2QA 2RRAA 5C10A 4PABA 4PA1A 2R8JA 2ROPA 1HWIA 1KQFB 1KQSR 2GCFA 4LF1A 4NLWA 5BR9A 3HI9A 2UUCF 3LW5C 3MFIA 2YKNA 5AQJA 1CC7A 4DR7K 3P5JA 1IJJA 1HLWA 5ADXH 4K4XA 3DOMB 2WFBA 2YBVA 1RKJA 3C2PA 4H0VB 4I7FB 3F9MA 1WORA 1SL2A 4OKJA 4PG8A 4BE0A 2DR7A 3GOIA 2DJWA 4ZP9A 2BTFA 1OIAA 3QFWA 4LRAA 1U7LA 4LMZA 2OTJN 2NR0A 3M6UA 4DEZA 3KLIA 3R5GA 4UT4A 4BC3A 2AEJA 3HO1A 1IKVB 1RADB 3JXOA 4GV9A 2IM3A 4FLYA 1UA0A 3IDHA 4FJNA 1REVA 4IFVA 1T02A 3MECA 1X5PA 4DV0F 2RD5C 5D78A 3VEZA 5E3QA 1YI2S 3LPEA 4FXDA 2KDOA 4E1JA 4W90B 4LF7F 3I0SA 4CBWA 2O8BB 3VGMA 2GHPA 3IA0A 4K0KJ 2KKZA 3GMGA 3CSK