1LW0A

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
512
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 512
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lw0A05
3MAQA 1SV5A 1XR5A 1GOBA 3QO9B 3H5XA 4HUFA 4O4RA 1NJWA 1WSEA 2B5JB 2FJWA 1L3VA 4CGFA 1TK5A 3L3UA 1HMVA 5F8GA 1JLGB 4U6PA 3NKYA 3JYTB 4B9MA 3QGIA 4Z4CA 4Y34A 3KOAA 4RW7B 1CZ9A 1WN7A 1QE1A 3H40A 4E89A 2XCAA 4J9MA 4F3OA 3IS9A 2YNGA 2JEIA 1BIZA 3DYAB 1CXUA 4WE1B 4M3TA 1S5JA 2ALZA 1VSJA 4ID1A 4Y1CA 3P1GA 3OYHA 4QWBA 4N76A 1TVRA 1S1XA 2JGUA 5KFXA 2IBKA 2D0BA 3QEVA 4DSEA 3MTKA 3AA5X 1SKSA 3MF5A 3O3FA 4O55A 2IC3B 4KTWA 4KFBB 1TKZB 4I2QB 4O3SA 2VWJA 3DLKB 3UDLA 2VG6B 4ICLB 2WCXA 3QLHB 5EWGA 4ECQA 3VQ7A 4IOBA 2XI3A 3E01B 3T5JA 3V6HA 1HRHA 1EETA 3DOKB 2BR0A 4MFBB 4IFVB 1N6QB 2XY5A 4K4VA 2CKWA 3CFPA 3JSMB 4NCBA 3H5YA 4ID5A 1KHWA 1C0UB 5J2NA 3PR5B 4CEOA 2ZKUA 3DLHA 3CJ4A 2W8LA 4MKBA 2DPIA 1K1SA 4YR0A 4NLUA 1HYSA 4O3NA 4CJRA 2C2RA 5C25A 4FYDA 4ZVHA 5KG6A 4FJ9A 1ZBIA 3H4DA 4DFMA 3G6YA 4IBNA 2GV9A 4CHOA 3SZ2A 1DTTB 4RW6A 4FJGA 3VQEA 2KQ2A 3LPTA 2FBVA 1OS5A 5CYMB 4CK3A 2OPSB 4KKOB 1RTDB 2QXFA 4O44A 1VSLA 4WFXA 3HP6A 5J2MB 3LAMA 4DL4A 3QIDA 3RB6A 3DDKA 4O0IA 1RTHB 3NBPA 4KV8B 3A2FA 2GIRA 3RBDA 1D8YA 2OA8A 2O5DA 4JS4A 3AVKA 3C6TA 1XI1A 1JLEB 1C1BA 1UA1A 4CEEA 2IS3A 2VA3A 3GIJA 5DQHA 3HXMA 1RDCA 2R7YA 3DI6B 1Q8IA 3QESA 3DLBA 3I5CA 1SKWA 1FXXA 4HTUA 4CJWA 1BQNB 5KG7A 1NK9A 4XO0A 3V9UA 3RMCA 3P83D 3CVKA 3NGZA 1K1QA 3TVKA 4DLEA 3AVBA 2AGPA 3ZT0A 4FJKA 1C1CB 4CJQA 1LW0B 4HYKA 2EX3A 3KHRA 1SUQB 3BQ0A 3MXIA 4E1NA 3V6DB 3THVA 3AVLA 2A1RA 1D0EA 3CYMA 4E7HA 4FCYA 3S3MA 4DG1B 4JLHA 3M8QA 1IO2A 2IJFA 3AO1A 1TL1B 4IG0B 3L3VA 2HW3A 1ZETA 4YR3A 5DG7A 4GW6A 1HPZB 4CFAA 4NZ0A 4RW9B 4WYLA 3TAMA 1S49A 3HJFA 4B08A 3M8SA 4CGDA 5DGBA 5I3UB 1TK8A 5KT3A 3EY1A 4CF8A 4DTSA 4Y2CA 4CHQA 4JV2A 3LWMA 4CHPA 1S1TA 4DQSA 3FRZA 4DL7A 5KG2A 1BI4A 1KFSA 1NOZA 1X1PA 1IKVB 3KLEA 4KI4A 2F8TA 4DF4A 4LY7A 4URSA 4DF8A 4YR2A 5KTQA 2G8FA 2Z1IA 1X9SA 5T14A 4IDKA 1LWCA 1RT2A 3D28A 3PR4A 5KFOA 2ILYA 1TKTB 3OVNA 2VA2A 4Q43A 3I0RB 4LSLA 1XR7A 1KSPA 3K57A 1NK7A 4NLYA 4F50A 3ISNC 5KFQA 1ASVA 3KK2B 5EWFA 4OVLA 1JLCA 3SUQA 4YNQA 1RT5B 2PY5A 4FJIA 1LAVA 4XIUA 4AH9A 1RT7B 3QGGA 3NH1A 1Q9YA 3SV4A 2BQRA 3UR0A 2W9BA 2F8EX 3MECB 3ZSVA 3AVAA 5KFVA 5HLFB 1RT6B 4Q45A 5J2QA 4Z0UA 3OYKA 1J54A 1S1WA 4ED7A 1JLBA 1VSHA 4NCGB 1WNEA 4K8XA 4Q0BA 5I42A 2YNIA 2KZZA 3O4QA 4F8RA 1XR6A 4CECA 1C0TA 4J9QA 2AGQA 3DRPB 4KPYA 4EYIB 4DSFA 5HBMB 4IKAA 2RF2A 3VQ9A 4OKEA 3V4IB 1HNIB 4ZPCA 4CJVA 1RBSA 3CDEA 3WNGA 3DLRA 3DOLA 5KFUA 1VRTA 4KB7A 4H4OA 2ASDA 3CDWA 1VSMA 3T1AA 3DRSA 3ICLA 4FK2A 3K2PA 1JLFA 2HMIA 4TY8A 5KFAA 1J9AA 1T05B 1SH0A 3G6VA 2RKIB 3G0ZA 3HSTB 1U49A 2IM0A 5SZTA 4M3RA 3OJSA 4DQRA 5KFKA 3NHGA 1Z26A 5DK5A 1RBUA 1HNVA 3OYEA 2ETJA 2XY7A 4PWDA 1B9DA 4DL3A 3KMQA 1FK9A 4LSNA 1NK4A 4Z4FA 1IH7A 5FDLB 1YTUA 3QEPA 4PUOB 2YKMA 3V6JA 3PW5A 3ZSWA 3KLHA 3E51A 4N47A 4O4GA 3MEEA 4FBUA 4MK8A 5KFGA 4EBEA 2HAIA 1RDRA 2D41A 3NF6A 2BDPA 5HP1B 4CJTA 3LP2A 2V4RA 4RNMA 4RW8B 4K4XA 3VQ5A 1W0HA 4I9LA 1S1VA 1Y97A 4B9UA 3K5NA 3IG1B 1VK0A 1IKXA 4Y3CA 5KFBA 3DLEB 4WFZA 2FLLA 2D7SA 2WHOA 2ASLA 3V1RA 1QSLA 3M8PA 4JV1A 2IOCA 5L9XA 4CF1A 4ZP8A 2J6UA 5KFNA 1MU2B 3FFIB 1JLQA 4NLVA 4I7FB 4EO6A 4DQPA 4WXWA 3VQQA 1VSDA 4IG3B 4RW4B 1GOAA 3BQ1A 1QHTA 3LP0B 1EXQA 2OPPA 1RYSA 4QWEA 4JUZA 4W5TA 1R0AA 1KVAA 3OYAA 3T5KA 2AJQA 4HKQA 2PYJA 4CGJA 3MXMA 3SI8A 2W42A 2YNFB 3KK3A 3SUPA 4MIBA 2XY8A 3KIOA 3RMAA 3GV7B 4CK2A 4BWMA 3IRXA 3V1QA 4XPCA 1I3AA 4FXDA 1HQUA 4MK7A 5KT2A 1S0NA 1NOYA 4FS1A 2AX0A 4B9LA 2R2SA 4I2PB 4Q5VA 4YQWA 2HNDA 3VQBA 4DU1A 3MFHA 4ZPBA 4BDZA 4FZXC 4NLRA 1WLJA 3WNFA 4CIGA 2FLPA 1DLOB 3ZSOA 4FJHA 5C24B 3G10A 5KG5A 3AVFA 1J5OB 1J53A 3D5MA 1F21A 4J2BA 4FBTA 4F4ZA 3WNEA 4DU4A 2A1SA 4KAIA 3O3HA 2R8HA 4DL6A 3QNNA 1T94A 2IAJA 1RA7A 1TK0A 1RTJA 1FKOB 2J6TA 2G8IA 1A5VA 1K6YA 4K4SA 4TYAA 4H8KA 5KRTA 3OY9A 2IM1A 4RU9A 4FLVA 4HUGA 2XGQA 3BDPA 1D9DA 3ZCMA 2KFNA 3C6UB 1ZBHA 3I8DA 4E0DA 5HRSA 2VG7B 4ZVEA 1XHXA 4M3WA 4R5PA 4ECUA 3QEXA 3ALYA 1S9GB 4CEDA 3ZT2A 3PVXA 1ITGA 4C8MA 2IDOA 1JLAB 2KFZA 3NAEA 4W5QA 3BSAA 4PQUB 1N4LA 2FBYA 3ULDA 4CEAA 2BQ3A 2G8UA 1L3TA 3KMSA 2BGGA 2G8KA 3DM2B 3P5JA 4KO0B 4KHMA 3BGRB 5KFHA 3PW7A 1TL3A 1RT3A 2NUBA 5KFZA 2BRLA 5J2PA 3SQ4A 4BACA 4ZPDA 1WAJA 1RT4B 2E9RX 1S6PA 5J2NB 3HPHA 3OS2A 1VRUB 2YHAA 2J6SA 2WTFA 2R2RA 2KZMA 4LH5A 1X9WA 5CYQB 1ZTWA 1RNHA 3SQ2A 5CZ1A 3HKWA 1EX4A 1S4FA 4IKFA 2HHVA 2CJQA 2UVRA 3O3GA 4EEYA 3KK1A 5KFDA 1WSGA 2AU0A 2ATLA 4CFBA 4W5RA 3NFAA 3RR7A 5DG8A 3I0SA 1REVA 3KHLA 4CGHA 1A5WA 1BGXT 3QIPA 4NRUA 2PYLA 4EZ6A 3S9HA 1EKEA 4LD0A 2UUTA 4ELTA 1KVCA 3I5BA 4R8UA 5D3GB 4M41A 2GUIA 4DFKA 4RZRA 1TV6A 1B92A 3L8BA 1C0MA 1NKBA 2YKNB 4CEFA 3M8RA 3PV8A 5KG4A 1D5AA 3KLIB 3QO9A 1SKRA 3HHKA 1HQEB 2I5JB 5L1KA 4Y1DA 5HRNA 1QSSA 2B5JA 4CHZA 5HROB 4G1QB 1JLGA 4KHQA 3JYTA 2OPQB 4YMEA 1U48A 4RW7A 2RDIA 3PY8A 3MR2A 4K8ZA 3IAYA 2GC8A 4CF9A 2D0CA 4WFYA 4CJPA 4LQ9A 1Z25A 4ELVA 1W9HA 3DYAA 3RB3A 4WE1A 3ZT3A 4NLXA 5KFLA 4CIEA 4M94A 3LANA 4N41A 4CJSA 4ZHRB 3OL8A 5F8IA 4B3OB 3CJ3A 4WZMA 4C8NA 1UA0A 4ECXA 5KT7A 2BE2B 3FSIA 4O3QA 4F2SA 4HHTA 3MEGA 4ECVA 2JEGA 3ZSZA 3V9ZA 3TAFA 2R8JA 3ZSXA 2IC3A 3KHHA 3V1OA 2HNZB 4KFBA 1TKZA 2DPJA 4UQGA 4YFUA 3TAPA 4I2QA 5EU7A 3DLKA 3V6KA 4ICLA 4TQRA 1NHUA 3QLHA 5KFIA 4KI6A 3BREA 3E01A 2IMWP 4OPJA 4K4ZA 1UWBB 3DOKA 4DL5A 5HRPA 4ZTFA 4FM1A 3Q8RB 4MFBA 2DFEA 4IFVA 1N6QA 2G8VA 1T03B 3JSMA 2EC0A 3UPFA 3VA0A 4CIFA 4AILC 1C0UA 3T3FA 1KLMB 5KT5A 4PY5A 4ECTA 4IR1A 3SUOA 4CJEA 4MKAA 3S3OA 4C8KA 3QEIA 3TARA 2OPRB 1BQMB 3PHEA 3ASMA 3OYDA 3SQ0A 3KJVB 4QWDA 2GIQA 4HVJA 3SPZA 1U45A 1FKPB 1VSEA 3DRRB 1IKWB 3VQDA 4ZVFA 4FLTA 4FJ8A 2XO7A 3AVNA 1YVFA 1DTTA 3L2VA 4OLBA 2VG5B 4QW8A 4DU3A 4RNFA 3CM6A 5CYMA 1RTIB 4M95A 2OPSA 4AHVA 5KFMA 4KTQA 4KKOA 1RTDA 5EWEA 4M3ZA 4WZQA 1SH3A 3KLGB 1C1AA 3OHAA 3SPYA 3TAEA 5J2MA 4KHRA 3PX0A 1N5YB 3LP3A 1HYZA 4JV0A 5DQGA 2QKBA 4ELUA 1RTHA 1QSYA 1KFDA 4KV8A 3HVTB 4OKKA 5FRMA 3CDUA 1S9EB 3ITHB 1NKEA 2OH2A 5FRNA 3UIQA 1JLEA 4CJLA 3Q8PB 1KCFA 3OL7A 1TKXB 3SNNA 3PW0A 3BJYA 3DI6A 1S97A 3CM5A 2RF2B 4QWAA 4E7LA 5KFRA 2XI2A 4CF0A 4L8RB 1IM4A 3KLFB 4BDPA 2HWIA 1BQNA 4QW9A 4ED3A 2FBTA 4FJJA 1QAIA 3CQ8A 5C42B 2UUWA 4AHTA 1WAFA 1C1CA 1EP4B 2WONB 3OS1A 2QV6A 1LW0A 1IKYB 1NJYA 1QTMA 3QIOA 1SUQA 4O3RA 3OYMA 4QPXA 2O4IA 4DEZA 3L2RA 3AO2A 2E4LA 3TAGA 1S1UB 2OYQA 4CJUA 2JC1A 4DG1A 4KB0A 1SL0A 3VQPA 4URGA 1TL1A 4IG0A 1KVBA 3K5LA 4HCBA 4RUCA 1HYVA 5JUMA 1NKCA 5KG0A 3EPGA 3NL0A 2FJVA 4OLAA 5DG9A 4ECRA 1HPZA 3PJXA 3G86A 4O3OA 3EPIA 3LP1B 2HHXA 2HNYB 4RW9A 5CY4A 4DSLA 4DS4A 2BANB 4FW2A 1RT1B 4J9OA 3VQSA 2HWHA 3NE6A 1RBTA 5HRRA 2G8WA 3MEDB 5I3UA 3DLGB 2W9CB 1GX5A 3RB0A 2C28A 1L3UA 1U47A 3RRHA 3LPUA 1NK6A 3NF7A 2V4QA 1QS4A 1IKVA 4KREA 4U7CA 4IH7A 4ZVGA 1S10A 2DFHA 2UVWA 3OS0A 4DSKA 4CFCA 4N5SA 3LWLA 3AA2A 3M8PB 5F8MA 5K14B 4E19A 2YV0X 2FVCA 1TKTA 4K4UA 3HVAA 1JLQB 1U4BA 3I0RA 2D3ZA 1LWFB 1JKHB 3PX4A 1NK0A 2E6LA 1W25A 3V9SA 5F8NA 3KK2A 4NLGA 3F73A 1ASWA 1TQLA 4Q44A 1RT5A 2R8GA 2Z1HA 3OYLA 4E7JA 3MXJA 4MIAA 4IQXA 1RT7A 5KFFA 4C8OA 3B6PA 2F96A 1DTQA 1RAJA 4GVMA 4KBIA 3MECA 5HLFA 1RT6A 3T19A 3WNHA 4M3YA 3HYFA 4O5BA 4B9VA 2FVRA 2B4JA 2D0AA 5J1EB 4H4MA 4ZTJA 4KHYA 2HHUA 4NCGA 4B8AB 3RB4A 2GBZA 3V81B 4J9PA 2I1RA 3N6NA 5KGXA 3RAQA 3OYIA 3T5HA 2EHGA 3PW2A 4J2DA 4FJLA 4IFYB 4OL8A 3DRPA 3GILA 3CFOA 2ZE2B 5HBMA 3QETA 3V4IA 2E6MA 1HNIA 3H5SA 1RDDA 3AVJA 2B6AB 4B9NA 3OYNA 2LSNA 3NH0A 4FZYA 5DLFA 3NH2A 3VQ4A 3CJ2A 3DMJB 3NF9A 4B9TA 1KLNA 3OJUA 3VQCA 1U04A 1TKDA 2WOMB 1S0OA 1T05A 2RKIA 2R8KA 1LW2B 2ZD1B 1LWEB 1NK5A 4CGGA 2KTQA 5F8JA 5EUHA 2HB5A 1BCMA 3NCIA 2P5OA 3OSNA 4KHNA 4KSEB 1ZBLA 3D0PA 2W8KA 4AHCA 4TLRA 5FDLA 3C94A 4PUOA 3QZ7A 3NAIA 4FK4A 1YT3A 1RDBA 1WSIA 3UQSA 3RMDA 3CWJA 2C22A 3LDSA 2Z1GA 4K4WA 4FLZA 2YNHA 4AHUA 1SV5B 4RW8A 1HMVB 4J2AA 3IG1A 3N6LA 1QQCA 3MR3A 3NGDA 3TI0A 3PJWA 4FVMA 5DLGA 3TAQA 3DLEA 1T7PA 1QE1B 2F8SA 3ZSYA 3IS9B 4QCLA 2YNGB 2DY4A 4F4XA 4CEQA 1RBRA 3VQ6A 2Z1JA 2W7PA 4O0JA 1MU2A 3SYZA 3FFIA 4I7FA 3QYYA 3OYFA 2IGIA 3HPOA 1KTQA 5KFPA 4QWCA 2QKKA 4IG3A 3CJ5A 4RW4A 1TVRB 1S1XB 5F8HA 3GQCA 3SFGA 4J9RA 4FLUA 5KGWA 3LP0A 3O4NA 3U3GA 4YP3A 4CE9A 4OKJA 5KFWA 1LAWA 4DFJA 2HHWA 2YNFA 4DTJA 4DWIA 4GMJB 3FDSA 3M9OB 1EETB 2HHTA 3T5LA 4FJXA 1KHVA 4WXOA 4I2PA 4E7KA 5L1IA 1UAXA 1WNSA 3VN5A 4ZP9A 2ATQA 4ID5B 1RA6A 3GIKA 4F4YA 3NGYA 1JXLA 4NLSA 2JC0A 3RMBA 1DLOA 4ED8A 3L2UA 5C24A 3FQLA 4I9QA 1J5OA 4CJ4A 4Z4EA 2FJXA 1Z4UA 4TXSA 3MFIA 1HYSB 4DQQA 3QINA 3HT3A 5C25B 4KE5A 3HO1A 5KRSA 1N48A 4K4YA 4IRKA 1S6QA 1FKOA 4TYBA 3HVWA 5KFEA 4ED0A 2XGPA 4N56A 5E41A 4RW6B 2R2TA 3C6UA 3OL9A 2VG7A 1CLQA 4OJRA 1S9GA 2FVSA 1IG9A 1XC9A 4O44B 3TANA 4Z4GA 4RUAA 4KTZA 4BWJA 1JLAA 5FROA 3MEGB 3OYCA 2P5GA 4PQUA 3L2QA 1B9FA 3K59A 1S9FA 4G3IA 3H98A 3PUFA 4QOZB 4ECWA 4MH8A 4FS2A 4DTNA 3NBPB 4JRQA 4M3UA 3U3YA 3ZT1A 3DM2A 4KO0A 3GIMA 3BGRA 3C6TB 2QE5A 1C1BB 4ZMMA 1C6VA 2UVVA 3OYJA 4BDYA 3SQ1A 4K4TA 2YHBA 1RT4A 4RNHA 3RR8A 1UOCA 4CJ5A 4CEBA 1VRUA 3RWUA 1D1UA 2RN2A 2AQ4A 4AHSA 5CYQA 4CF2A 3KKSA 1NJXA 1GOCA 5KFJA 2D5RA 5JS1A 2ZQBA 3AVHA 4DTOA 3IN5A 5KG3A 1JX4A 3GYNA 1LV5A 4FJNA 4IH5A 4CK1A 4NYNA 3SUNA 3M8QB 4DQIA 2FC0A 2WRMA 4NYZA 2G8HA 3U6FA 4DL2A 3K58A 2JEJA 4KAZA 1WSHA 3OLAA 4Z4HA 3RRGA 2VG6A 4OPKA 4ZP6A 4FLXA 3QGHA 2R8IA 3K5OA 1O1WA 5D3GA 3TAMB 1L5UA 3AVIA 1L3SA 3KD5E 1N56A 2FVQA 1RDAA 4F4WA 2YKNA 5L1LA 3H59A 3KLIA 2OZMA 3KKRA 5JXSA 1HQEA 4FJMA 2I5JA 1S1TB 4DSJA 4CJ3A 5HROA 3BQ2A 1BI4B 4G1QA 3RAXA 3TWHA 3FQKA 2OPQA 3KLEB 1BCOA 4TY9A 2WK4A 5KG1A 3NAHA 3PW4A 4IDKB 1LWCB 4KB1A 1RT2B 1NK8A 2XY6A 4NLQA 3HM9A 4Z4IA 2XCPA 4J9SA 3AO4A 4MQ3A 4LSLB 1C2PA 4B9SA 4KHUA 4NLOA 3QERA 4EZ9A 4OGCA 4ZHRA 3I5AA 4B3OA 4K50A 1RBVA 3VQAA 3IGVA 4DSIA 1ZBFA 1JLCB 4FM2A 2AX1A 2BE2A 3CFRA 5KFTA 3H4BA 5KFSA 4ECZA 2X78A 1G15A 2Y1IA 3BSNA 2W9BB 4LQ3A 4DMNA 2HNZA 4BE1A 5J2QB 3H2LA 1NNDA 4E7IA 1TP7A 5C5JA 1S1WB 5KT4A 1VSKA 3AO3A 1ZBUA 1JLBB 4CHNA 4BE0A 4Q0BB 3NDKA 5I42B 1UWBA 2YNIB 1XHZA 4IH6A 3MR5A 1C0TB 3AO5A 5JS2A 4EYHB 2X74A 3KD1E 4NLWA 1T03A 2AGOA 2V0NA 3PZPA 3TABA 2FVPA 2V9WA 4ECYA 3M9NB 1YTAA 1KLMA 1BHLA 3B6OA 3GV5B 3ZT4A 3DOLB 1VRTB 4AHRA 3OSPA 4CERA 4CESA 4ZPAA 5KI6A 4H4OB 3AA4A 2OZSA 3HP9A 2QK9A 4W5OA 3HK2A 2R2UA 3DRSB 3PO5A 2OPRA 1BQMA 1JLFB 2HMIB 3HPGA 4TY8B 4KHWA 3KJVA 4CFDA 5T7BA 5F9NA 1VSIA 3ZSQA 3OYGA 1FKPA 4WYWA 2KW4A 1ASUA 3V6DA 4DTPA 5F9LA 3QEWA 3DRRA 2XWYA 2JLEA 3KNAA 1IKWA 1HNVB 2W9AA 3RTVA 4PWDB 4E3SA 3F9KA 1FK9B 2VG5A 4LSNB 1I6JA 1RTIA 4IR9A 4CGIA 1JIHA 4X2BA 4FJ5A 4IRCA 1SH2A 2YKMB 4RNOA 4Y2AA 1GX6A 3KLGA 3IGNA 4IRDA 4ED6A 3KLHB 1ZTTA 4O4GB 1DTQB 3MEEB 3AA3A 3BSOA 1N5YA 3ISND 3V9XA 4GC6A 5KFCA 4ECSA 1JXEA 4KRFA 1MMLA 3LP2B 3LAKA 1TAQA 4DTXA 3KTQA 3HVTA 4H4MB 1S1VB 4CCHA 4M42A 1S9EA 3AVCA 3ITHA 5EDWA 1QUVA 2XRIA 3AVGA 4TSXA 4NLTA 3KHGA 3OL6A 1IKXB 1TKXA 1JL1A 4FM0A 4ZP7A 1S48A 2VWKA 4M3XA 3H5UA 3HVRA 3CO9A 5CZ2A 2P51A 4HUEA 3KLFA 3LZIA 3SFUA 2PZSA 4URQU 3LZJA 3L2WA 2IA6A 2IJNA 3MR6A 1WSFA 5C42A 3G6XA 2BRKA 3TR8A 5F8LA 1D9FA 4E1MA 5DGAA 4EBCA 1EP4A 3C95A 2WONA 4FZZA 1IKYA 5KFYA 2OPPB 3EZ5A 4CEZA 5DMRA 4J9NA 1R0AB 1S1UA 4NLDA 2JEFA 3SCXA 1TAUA 3AV9A 3Q8SB 5SWMA 3SJJA 3KK3B 1U09A 1KRPA 3GIIA 4NLPA 3OYBA 3IRXB 1HARA 1JL2A 1HQUB 4MK9A 2C2EA 3OLBA 2X6SA 4EP4A 3LP1A 4EO8A 4TN2A 1A5XA 2HNYA 4KHSA 2ILZA 3TQ1A 4ED1A 2BANA 1RT1A 2HNDB 2Q3SA 3VQ8A 3S3NA 2YNHB 4C8LA 4ED2A 3RBEA 3MEDA 3QNOA 4CJFA 2D3UA 4O3PA 3DLGA 2W9CA 3SI6A 3AVMA 4RNNA 4DLGA 3QZ8A 1T3NA 1I39A 3M9MB 4F3TA 3EZUA 2BQUA 3V9WA 4EP5A 4Q8EA 2E9TA 4TQSA 3GV8B 2IAJB 3LALA 4J9KA 4LH4A 5K14A 1RTJB 1NJZA 4F2RA 3PO4A 4QAGA 3Q8QB 4DTRA 4F4KA 4J2EA 2FLNA 2XHBA 1RYRA 2HHQA 1HJRA 1SL2A 4NCAA 1LWFA 3KLVA 1JKHA 4FK0A 4R5PB 3CG7A 2IM3A 3N6MA 1T8EA 4CHYA 3EYZA 3CIZA 2B43A 4EBDA 4DTMA 3NF8A 4B8CA 3CJ0A 4W5NA 5KT6A 1BIUA 3BSCA 5HP1A 1Q9XA 1CZBA 2X6NA 4OGEA 1BL3A 5J1EA 2ASJA 3PX6A 3OHBA 4NYFA 3D45A 4PA1A 1TGOA 1TL3B 1RT3B 3V81A 5L1JA 3VA3A 2HVHA 5J2PB 2C2DA 4M45A 4IFYA 4FLYA 4FLWA 2ZE2A 4JS5A 1S6PB 5DQIA 4J9LA 2Y1JA 4DFPA 1VSFA 4R0EA 2B6AA 2DFFA 1RILA 4DTUA 4CJKA 1X9MA 2AWZA 2DTUA 4HCCA 3DMJA 2WB4A 2XC9A 2RDJA 1YVUA 1JXBA 3NGIA 1RCHA 2HHSA 2WOMA 4H54A 4RG8A 1ZYQA 1S6QB 1XWLA 1NHVA 1LW2A 2ZD1A 3NMAA 1LWEA 1CSJA 1BISA 4JRPA 3HL8A 3KK1B 3ZSRA 4XPEA 2E9ZA 1QAJA 4DS5A 4GC7A 2W7OA 2RPIA 2P1JA 3I0SB 2FBXA 2HVIA 3BR9A 1WSJA 1REVB 2O4GA 4Q8FA 1SL1A 4BE2A 3QIPB 2IM2A 1S0MA 1CXQA 4NRTA 4R8UB 2UVUA 3K5MA 4FJ7A 3SV3A 2ITGA 1TV6B 4FW1A 3H08A
chains in the Genus database with same CATH superfamily
1NJIO 3NG8A 3MAQA 4CI6A 1R0BG 2CPHA 1SV5A 3QO9B 1HUXA 3H5XA 2UUAF 1T9VA 1NJWA 2B5JB 3CD5A 4CGFA 1TK5A 2MLYA 3ZZRA 2I6WA 1JLGB 3FGVA 3NKYA 1S5ZA 4LR9A 3QGIA 4Z4CA 4Y34A 2P9LA 4L75A 2G4BA 1CZ9A 2AJ0A 2AJFE 1K73O 2CQPA 4B1WB 5G0RB 2FHJD 3SK3A 2XG8A 2XCAA 3QRPA 2JEIA 2E1ZA 4DV3F 2HBLA 1WDTA 4QS7A 2QYCA 4QIVA 4ID1A 3P1GA 1NSPA 1FNXH 2J0WA 5D6GA 1TVRA 2EW9A 2ZH8A 2Q31A 2CQBA 4I2QB 4GNIA 1YZ7A 1FESA 2GVDB 1QZ6A 1MWQA 3PIPL 2WCXA 4NYPA 4CM0A 3VQ7A 4IOBA 3E01B 3V6HA 5T41A 3DOKB 2KLAA 2KVQE 2O66A 1DBDA 2EC2A 2LMIA 4K4VA 3JSMB 2VGNA 3G87A 4ZPTR 3HSCA 4GO5X 2VPZB 3GSDA 2CPIA 3UDCA 2DPIA 3CCMN 2Q1NA 1HYSA 4CJRA 4C48A 2QJ3A 5C25A 5KG6A 2GMLA 1Q81T 2ZOMA 3AD7C 4B3MF 4X66K 1FDDA 1WG1A 2JSXA 3VQEA 4OZ3A 2KQ2A 3BPDA 3OFHA 2OPSB 2C2OB 2B4UA 4UZBA 1RKJA 1NSKL 5HQLA 1AUDA 2M8DB 4HT7A 3TZZA 2BM1A 1TTHB 4OHYA 3CIPA 2K3IA 4JI4J 1MNEA 1N0UA 4PWUA 4JI1J 4K2XA 3K5PA 3RBDA 4QIFA 1YBUA 3C6TA 4DR7J 5LJWA 2YTCA 2VC1A 1WEXA 2IS3A 5DQHA 4ENOA 4ZVQB 3F44A 3OBYA 3TR5A 1FXXA 4JV5J 4A46A 2PDAA 3NVKA 1Q8BA 2QWQA 1BQNB 4C0HA 1FJ7A 1NK9A 2LQJA 5BYRA 4XO0A 3MMBA 4YOXA 1WKJA 4DLEA 2AGPA 2GQ2A 3OFEA 1BWVA 2EX3A 3KHRA 1F9FA 5LJ3Y 1HHTP 4FZVA 1KQKA 1D0EA 1O51A 1SZ2A 1IO2A 4F26A 2F4FA 1U1QA 4HDGA 2FD2A 3JAMY 4C9DA 3D6FB 2NRWA 5DG7A 3W64A 3MUMP 3PIOQ 2VOPA 2KO1A 4ZVOB 1X3NA 1M5OC 4PR6A 2CJ9A 4B08A 1S4EA 3M8SA 4JD2A 4CGDA 3K17A 4WKYA 1G4CA 1VHFA 4CF8A 4QS8A 2CQ0A 1MG7A 3O8MA 1BI4A 1IKVB 2OEKA 2F8TA 5KTQA 2VODA 3FMBA 1RHQB 1DT9A 3A3NB 1RT2A 2QL7B 4BG8A 1SC4B 3M2UB 1S77D 4LJMA 3MK6A 5KFOA 2ILYA 4BRLA 2DY9A 2XMAA 4OX9K 3OVNA 1PYTA 2VA2A 3MX5A 1XR7A 1NDCA 3CCUN 1DY3A 4B3SK 5B0BA 2ZH7A 2ZDPA 3H1QA 4H0TB 4ZCLA 1SI9A 3GSIA 1LAVA 4OLOA 2HFZA 3LW5C 1RFQA 1OY6A 1V3SA 1RDUA 2BQRA 3E3XA 1H7WA 2EKYA 2COLA 1M1KO 3OYKA 1RSCA 5BR8K 1J54A 3CGIA 3Q8UA 3U9DA 2P9IB 3W9IA 1DGKN 1T3OA 5I42A 1NBWA 3T9ZA 4J9QA 2AGQA 2JOQA 5IQQA 4KPYA 5HBMB 3P5TL 4IKAA 1AFIA 1KS2A 3VQ9A 2FJDB 2DR5A 4CJVA 4P73A 2ZGYA 4QR2A 4B3RF 4Q2MA 2QZ8A 4X66J 2AIRB 4H4OA 4B3TK 4ISFA 2P9NA 4X4TA 4AUKA 1MLAA 1T6CA 1JLFA 1OVYA 2YY3A 1J9AA 1T05B 1SH0A 3CW2C 2WBMA 3G0ZA 2IM0A 5SZTA 3CF5L 3NHGA 1Z26A 2HLUA 5AXMA 1QVGR 3BBFA 1YHQN 3OYEA 1HNVA 2AEFA 2ETJA 4PWDA 2QMXA 3OTOK 3S8SA 1SQFA 4CLUA 4BLGA 5FDLB 4A8FA 3A3PB 2W40A 3CD7A 3KLHA 1UCNA 4N47A 3NEKA 1K8KB 1QVFR 4EBEA 1P27B 3EICA 2V4RA 3Q2TC 1V9OA 4RTFD 4K4XA 3RW7A 4I9LA 4LF9J 3WZ0A 1Y97A 4B9UA 5A2QY 3QWPA 4WFAL 3VTHA 5KPZA 4Y3CA 3UN2A 5AR0A 3DLEB 2DHHA 2PN6A 2FLLA 2D7SA 1PILA 1D9AA 2WHOA 3L95X 4BR5A 2LDIA 2YKOA 2R7VA 2I2YA 4I6MA 3PRBA 2IOCA 2Z2LA 2KYZA 5L9XA 3M1FA 1HI8A 1MU2B 3FFIB 3TA2A 2WVFA 1JLQA 1ZS6A 1LK5A 4F9OA 3VQQA 2B9EA 1RBLA 1GOAA 5BXIA 3BQ1A 2CNKB 2ZUAA 2HZVA 2AJ1A 5D0GA 3M32A 4A61A 3CJTA 2DXFA 2VYPA 1RYSA 4QWEA 4JUZA 4W5TA 1R0AA 5LY3A 3OYAA 3KKFA 2VPXB 5AXLA 2HSEB 3U1NA 2NYHA 2W42A 2Z56B 3GBTA 2VGMA 4MIBA 2DHSA 2GUPA 4OI2A 3I31A 3IRXA 3C6HA 1HQUA 2QWLA 4AQYK 1S0NA 3H20A 3DXKA 4B9LA 3HSDA 2YXLA 1WHWA 4P7TA 4DV0F 3UKRA 1BE4A 2V6AA 1RWUA 2H5JB 4ES2A 4BDZA 1Q7YO 1ZH5A 2HGLA 1WTBA 3CCJN 3PKMA 3P8BB 1DLOB 4AFFA 1V6HA 3IAS9 4A8YA 2YKPA 1J5OB 1UZDA 1J53A 2VQFF 4J91A 1S0VA 2EBEA 4WKRA 1Z2ZA 1G7CB 4DU4A 1FDAA 2W2MP 2E7WA 1TUUA 1T94A 1K8AT 1RTJA 2EWSA 4NZ7A 1FKOB 3FCHA 4LFCF 4K41A 4K4SA 4NA3A 5AQFA 4H8KA 2OCEA 3OY9A 1HR0K 4HUGA 2VONA 2QA4N 3C6UB 1IM6A 4CW7B 3OTDA 4JI7K 1ZBHA 2VG7B 4R5PA 3EWGA 4ECUA 3QEXA 1S9GB 4CEDA 2AZ1A 4BGAA 2IDOA 2KFZA 2UXBF 1Q78A 3R1HA 4C97A 2OD4A 3MCPA 3O3LA 3VF6A 1N5QA 2ZWHA 2FBYA 3ULDA 2CDQA 1FD8A 4F02A 2HURA 1RWVB 5ETNA 2V8HA 4KHMA 3DXSX 1O5JA 1TL3A 5ETPA 2BOPA 2NUBA 5A6PA 1TELA 4B3TJ 4YORA 2GQCA 4BACA 2HG4A 1VK3A 4I6AA 2HF3A 4EHTA 5J2NB 3G25A 1VRUB 3P49B 4Z7YA 1J2VA 3A5OC 3M2VA 4IOAQ 4RWXA 1RLCL 4CO1A 2J6SA 3DGVA 3IBFB 4RLEA 2WTFA 4OI0A 2R2RA 2BMBA 3WQUA 4GKJK 2NXJA 1WELA 2XS5A 3OTOJ 5CZ1A 5AQMA 5B7WA 1EX4A 1QVGM 1Y3JA 4IKFA 5B0DA 2CWKA 1XNRF 2PE8A 4K7QA 2EFVA 2KXNB 1BD6A 4FSVA 3ULEB 4CLYA 2LECA 4BVOA 1RXOB 5M1KA 1U2RA 4W5RA 2VPWB 2MDAA 1UVLA 4CGHA 1LQ9A 5CAAA 1QVFM 1VAZA 3PIPQ 4NRUA 1ESVA 3S9HA 3CTRA 4LD0A 4RPFA 1FCAA 2XNRA 2YVSA 2UUTA 4X4SA 4M41A 1Y10A 3WQPA 2GHPA 3L8BA 4AM6A 1WOQA 2E7XA 4YOEA 1B0VA 5KG4A 1UETA 4PG6A 5IXUA 1YI2S 1QSSA 3CE8A 1GXUA 4J5OA 1SB6A 2UXDF 2LQ5A 2VBXA 3EGWB 3SSQA 1U6ZA 2XMVA 3PY8A 6AT1B 2GX9A 3IAYA 2D0CA 4LQ9A 3MOJB 4ELVA 2V8GA 1W9HA 1HX1A 3RB3A 3ZT3A 3P3DA 2GWKA 2JL9A 2Y8WA 4DV4K 4CIEA 4QIWD 4N41A 4CJSA 3E9OA 2RB7A 3OL8A 3F2KA 3BDEA 3OFGA 1PYSB 3G71S 2ZVIA 3U9ZA 4RX6A 3BM7A 4JYAK 5LL6Z 2QXLA 4F2SA 2MQQA 4ECVA 3V9ZA 3TAFA 3ZSXA 2IC3A 2NSCA 3TAPA 3DLKA 4QQBA 3KG1A 1R43A 1WF1A 1VQPS 4FF3A 1CQNA 3QGPA 2L9NA 3JTPA 2VFRA 1VQ9S 5KFIA 4KI6A 3Q2SC 4OPJA 1ATRA 5HRPA 4ZTFA 3Q8RB 4IFVA 2HBKA 3MN5A 1T03B 2RHKA 3WXIA 2EC0A 2QGFB 1FRIA 3T3FA 2ZH5A 1J5EK 4PY5A 3HKZD 4C3MA 4CJEA 1HR0J 4C8KA 3SBMA 5RUBA 1BQMB 1B7YB 5GVQA 3OYDA 3KUEA 1F0XA 2GIQA 5AQNA 3RAMA 1U45A 2IHR1 3C16A 4QR1A 1FKPB 3J8AA 3DRRB 1O6XA 3M2RA 5DJBA 1H3DA 2KVIA 3EO3A 3DOMA 5C2CA 2KT3A 1S59A 2QM1A 5CYMA 2KB2A 5HVHA 4M5NA 1RTDA 4WZQA 3VCDA 4DV7F 2G2YA 2J8AA 3OHAA 4PKHA 3R5GA 1WD6A 1FJGK 3PX0A 3MPVA 1N5YB 2IVFB 1VQ8N 1HYZA 3MURP 1SC3B 2QKBA 3WEEB 4NLCA 1F5CA 4OKKA 3MN9A 1G1XA 2V2QA 4PG8A 4NZ6A 5FRNA 3UIQA 2E5HA 4GKJJ 1JLEA 4CJLA 1ICEB 1TKXB 3POTA 2QLWA 3DI6A 3CJKA 5LSOA 3CM5A 2RF2B 4QWAA 4E7LA 1S6OA 2XI2A 3KWIA 2DHGA 2VKZG 1IM4A 4CO2A 2HWIA 5BRFA 4ED3A 3O1LA 4FJJA 4U7BA 3W2VA 1HLUA 3TZYA 5IT9U 3HCXA 2W4CA 4DR2K 1AZSB 1LW0A 1IKYB 5AQYA 4O3RA 4H5TA 3L2RA 3AO2A 4DZDA 4MLHA 1RJJA 1YITS 4KB0A 1SL0A 4IG0A 1GK8A 1NKCA 2RQ4A 1IR2A 1HYVA 3EPGA 3NL0A 3ENQA 3AXMA 3PJXA 3G86A 2IJRA 2KM8B 3MPDA 2OTJN 3VV2B 4LMZA 4DS4A 1RB0A 2BANB 5E2QA 1VBKA 3NE6A 2G8WA 2C1EB 1AXQA 2ROGA 3DLGB 2C28A 5E3QA 1OMSA 4RU2A 5CYJA 4KREA 2C2KB 4X4OA 3D2FB 2X3DA 4IH7A 1QLNA 3NRBA 2DFHA 1VJWA 4CFCA 1YLXA 2NPIA 4E19A 4GV9A 3CF5Q 1U4BA 2BYCA 4FKYA 2ZH2A 2J0SD 2PIIA 5LT5A 1LWFB 3PX4A 1H6KX 3KK2A 2GA7A 1ASWA 3MPWA 1TQLA 1NGHA 1Z05A 3C0BA 5GADU 2R8GA 2Z1HA 5K9FA 3EZWA 3MN6A 2DGWA 4JNEA 1Q81O 1ZBSA 4NMXA 1DTQA 4FYWB 3R5BA 3N0VA 1I51B 4ZLNA 1NLKL 4KBIA 3MECA 2GO8A 5HLFA 5FLXY 4LRBA 4B9VA 4O5BA 2KKZA 2GVZA 4H4MA 3M4XA 3ILIA 1S22A 4KHYA 2JVRA 1G99A 2XULA 4PZVA 4FWQA 1HNWF 2EHGA 3PW2A 4FJLA 3GILA 2CH6A 1N5TA 4ILRA 1HNIA 2FZGB 3AVJA 1DHMA 1VGYA 2J9EA 3IWNC 1HWJA 2BXJA 4PABA 5DLFA 2EK6A 3ZX2A 5CHCB 3FZBA 1VR6A 1NGCA 3HSGA 2RS8A 1H98A 3J80U 4FWPA 3VQCA 3VVTA 2ZC3A 3F9MA 5AQJA 2RKIA 2LFVA 2R8KA 2ZD1B 4R0JA 2M8HA 3AD8C 3PCOB 5AFUH 1Y5IB 1FJGJ 3TTCA 1BCMA 3C7NB 3OBWA 4FNIA 5AE1A 1ZBLA 2WC9A 2MSTA 4TLRA 3C94A 4FK4A 1VC5A 2O8FA 3VVUA 2C22A 4C0OC 2ADCA 3ZNUA 1GMWA 2J9DE 3R8EA 4X84A 1KTVA 4FLZA 4AHUA 1DQ8A 1SV5B 2Z2MA 1YIJN 1N52B 4AT1B 1CPZA 3BEXA 1RUSA 4HEA9 3IG1A 3N6LA 3M6VA 2P9LB 3O9UA 3MR3A 2UUAK 3CCQS 3TI0A 1NGIA 2LA4A 1P1LA 4CZFA 4FVMA 1SCJB 3UR3C 5I3QA 2H9ZA 3CI5A 4NASA 5U47A 4F4XA 4LSZB 4F36A 2Z1JA 4O0JA 3BV8A 2EEYA 4BQZA 4HWIA 2H4YB 3OR1A 2HBMA 3PEJA 1WSRA 3SQGA 2CH5A 3BZKA 1HWKA 3SMSA 4DV3K 3CJ5A 2NLWA 4EWTA 3IUCA 1TVRB 3GQCA 4QU7A 3VGKA 3ZZTA 2XHWA 3LP0A 2ZF5O 3SAFA 2I7NA 2L48A 1Q4RA 4N7TA 3U3GA 4IOCL 2XZTB 3OXFA 3AAPA 5KFWA 1LAWA 1KKHA 2HHWA 1X5OA 1MN9A 3TSUA 3QT8A 1H0HB 3MWPA 3PDNA 2H5EA 4LBPA 4FJXA 3US5A 1UJ6A 4FYYB 2GIFA 2IMOA 3AAQA 3GIKA 1R31A 3GL1A 3NGYA 1JXLA 2A2CA 1VQON 4KC5A 4ED8A 1RHUB 4QZVB 4IYQA 2MHNA 1QAXA 4TXSA 3MFIA 2AT1B 1HYSB 3QAEA 1HBOA 5C25B 5M2RA 3HO1A 5KRSA 1C0GA 2GCFA 4NE9C 4CT8A 5AQUA 2QA1A 4K2JA 2P2CB 1VQ7N 2DO4A 4TKTA 3CJ1A 3HVWA 4Y2KA 3OL9A 3VGMA 2XLIA 2KG1A 4B3MK 1ZAXA 1CLQA 4GVEA 4OJRA 5AJ3K 4O5FA 2UV8A 3R5JB 3TVYA 1OYDA 3T41A 4KTZA 3RGIA 1UPMB 3HFZB 1B64A 4YOYA 1B9FA 3NVMA 4QOZB 2QTDA 2Z2YB 5FPEA 2WVCA 3EE9A 4M3UA 3U3YA 1B3TA 1XC3A 3ZT1A 3VGVA 2LVWA 5GIPA 2HF4A 2J4RA 3C6TB 1HKGA 3C15A 2P9EA 1YRTA 4KH4A 5FPMA 5JVHL 3GE1A 5C2GA 4CJ5A 3OVBA 3TJAA 1D1UA 2IYIA 5ADZA 2AQ4A 3MMBB 3B82A 5CYQA 2VOOA 5HL7L 4CF2A 1JJ4A 3KKSA 1NJXA 1GOCA 2F8MA 1IQTA 2R7TA 3GJSB 1EB0A 2EG2A 1WEZA 3MUTP 1AUSL 3H2UB 3W3SA 3GYNA 2VUGA 1LV5A 3E1YA 1IUJA 4BC9A 4CK1A 4NYNA 1T02A 3SUNA 1VQNN 5EY4A 1R89A 4W90B 2G8HA 3U6FA 4DL2A 2JEJA 2WVBA 3OLAA 4Z4HA 4J37A 2HFOA 4DI6A 3THTA 2DR8A 3PYFA 1EIYB 1L5UA 2UUAJ 2IIRA 1Z6RA 1L3SA 3KD5E 3I32A 1N56A 2FHOB 2YKNA 1BO5O 4WQ5C 4JD2B 2E1YA 4DKWA 4HTIA 2F63A 2XMKA 5HROA 1BI4B 1FI4A 3FQKA 2OPQA 4TNOA 4YB7A 2CPFA 2ZEJA 3G96A 1C4AA 3NAHA 4DV3J 5AQRA 1XNQK 3PW4A 2JWLA 2W1BA 3W5YA 3IBCB 1RT2B 1RAGB 2A10A 1FE4A 4NLQA 3M8YA 2XCPA 3HM9A 2KXHA 2A41A 2VCPA 4KHUA 3FJ2A 4NLOA 3QERA 4CD1A 3DHXA 2UUBJ 1RBVA 2BE2A 4OZ0A 4JI8F 3CFRA 4LF7F 2A18A 2C2MB 2GS8A 4ECZA 2X78A 2Y1IA 3BSNA 4LF4F 4KGKA 4JHDA 2KG0A 4LQ3A 4D3GA 1I3OB 4FDFA 1E6YA 5C5JA 3TU5A 3CDAA 1P8GA 3AO3A 1ZBUA 1M5HA 4CHNA 3EKUA 4BE0A 4EIAA 5I42B 1XHZA 2B8PA 4IH6A 1SJ3P 1CVJA 2IVYA 4LRDA 3PZPA 1RWXB 3CCVS 3J81O 2EKNA 4ID8A 1AYEA 4OFZA 3M9NB 3BGLA 1MWKA 1HI0P 3L09A 1DRZA 3C8YA 5BN8A 4H4OB 4W5OA 2P9NB 2R2UA 1KQFB 1VJQA 1JLFB 3U02A 3HPGA 4B3RK 3K8VA 5F9NA 3VEVA 2Q97A 2AEMA 5M1QA 4WYWA 3FZKA 5F9LA 3N5BA 1T11A 1HNVB 4ZLLA 2IFXA 4PWDB 4E3SA 2CZ9A 3CJBA 4RUHA 1JIHA 4X2BA 4N8OA 4Y2AA 3KLHB 4BRFA 3BSOA 3ISND 4ECSA 1KC8T 2CWXA 3W63A 3LAKA 1TAQA 4RBTA 4K0KJ 3GP9A 1BWFO 2E5LF 3U4LA 1X4CA 1U0SA 1NBEB 2QIFA 4FM0A 4ZP7A 1S48A 3N79A 2Q6CA 4I6MB 5FD1A 4ES1A 3W9HA 4J9VA 4DR3F 1CC7A 1VIXA 2L9WA 1VLYA 4NXMK 1WSFA 5C42A 4BC5A 4NXNF 2V2KA 2BRKA 4A8XA 3MTJA 5DDOC 1X31C 3C95A 4DPTA 5D8HB 1OSCA 1Y4ZB 1PBAA 4A8WA 3M32B 2OUGA 3ILOA 2PEHA 4X65F 2DNHA 1R0AB 3Q89A 4NLDA 3ETMA 2D9OA 1TAUA 1VS3A 4L6V3 3SJJA 1TMJA 4U95A 3IRXB 1JL2A 1HQUB 3M5RA 3DXKB 3OLBA 3LP1A 2UP1A 1A5XA 4KHSA 3TQ1A 2D0PA 2DR9A 1RT1A 4M63C 3UKRB 2FDNA 2FY1A 1RTZA 1NPRA 3NS7B 3VQ8A 2YNHB 2MY7A 5C10A 3MEDA 3C46A 3R9PA 4DV0K 1IBKF 5GINA 4KHPF 1QHAA 4NPOA 2CUYA 4RNNA 1T3NA 1I39A 3UDVA 3IXQA 3EZUA 5BYQA 2DTJA 3DFEA 4Q8EA 2E9TA 2VQFK 1RCOB 3PFOA 5K14A 1RTJB 1NJZA 3PO4A 1D4XA 2ZBPA 3TSPA 1NH8A 1U2CA 4F4KA 3D0GE 2HFSA 4CLSA 2K1RA 2HHQA 1RAOA 4GVBA 3ENVA 3CJQA 1FWLA 2B51A 1JKHA 4R5PB 4P2XA 3O5BA 1S72N 1SJ4P 2OSQA 1X8DA 4LRAA 4PG4A 2JDJA 1V3RA 3B8AX 4B8CA 4F4AA 2HFVA 3CDBA 3CJ0A 5K20B 2J8SA 3I9ZA 4YUDA 4WFBL 2QL5B 4Z37A 5HJYA 1Q9XA 1IG8A 3NS6A 3MOZA 4AXIA 3MM9A 1Y5NB 2V69A 1RGVA 3MDQA 2ZKTA 1TL3B 3IBWA 2HVHA 1Q7LB 2GGPA 4M45A 4IFYA 4V19S 2MZTA 4B3RJ 4FLWA 2P9SA 5IV3A 5DQIA 4J9LA 3QBWA 2Y1JA 3OW2R 4OHWA 3M2VB 2D3OR 4DCOB 3WX8A 3FE1A 3CJ7A 2UXCF 2KL8A 5HQ8A 3T6BA 2HWTA 2RILA 1YVUA 3NGIA 3QJJA 2WOMA 1WBBA 4M5KA 4RG8A 1J6ZA 2CJBA 3LOUA 1S6QB 3TUIC 4BVPA 3NMAA 1CSJA 3I4PA 4BRQA 1CJTA 3B6BA 4IOCQ 1QAJA 4DS5A 3SMPA 1XNRK 3CCZA 3QT7A 2W7OA 5HMYA 3BR9A 5HVGA 2QFIA 2R7OA 1KQGB 3M6GA 3CMQA 3HF5A 4NRTA 2JX2A 3E9PA 7AT1B 2ITGA 4FW1A 2RHSB 1FA0A 4B1UB 5IV4A 1XR5A 3W7BA 1K9MT 1WWHA 1KQSR 2IRUA 1H7XA 4O4RA 4JKDA 1WSEA 1ZOTA 2ACYA 2MZSA 3JXOA 3HTVA 3LM9A 4B9MA 3TUZC 3GE9A 3QRRA 1FDBA 5CZVA 1IJEB 1FEEA 4LF6F 5E33A 3R6GB 3H40A 1VQ5S 2K8GA 4E89A 2UXDK 4AL6A 3BF1A 3IS9A 1MROA 2YNGA 2XTJP 3W1YC 3TYTA 2NXEA 2HQ3A 2XBPA 4WQ4C 2J9DA 3OYHA 2NS1B 4LIWA 3MWTA 4QWBA 1S1XA 1WOPA 5KFXA 2D0BA 3RVCA 1SPBP 3NNHA 3M1VA 3MTKA 2OMOA 3O3FA 2MKYA 4KPCA 2IC3B 1TL7A 3FEXB 2O8EA 4KTWA 1WI8A 1W2IA 3G6ES 1IVZA 1YJNS 2HHHF 3DLKB 2B8QA 4KIAA 3L7UA 2VG6B 4CI0B 1S79A 1XBWA 4DV0J 2XI3A 2P9CA 2BR0A 1X5SA 4IFVB 3DLLL 4NCBA 2GQQA 5JVHQ 2VQFJ 3R1XA 1KHWA 2BUPA 4I0WA 3O80A 1T9WA 3TO8A 4CBXA 1RLDA 2WVEA 4RKUC 5HL7Q 2YH1A 2E1RA 3VEXA 4LFCJ 2C2RA 1Y64A 5BN9A 3KUHA 4FYDA 3HFKA 1D8ZA 4B1YB 4CDIA 3C16B 2B7CB 3M2RB 2JVOA 1OSDA 4DR6F 2GV9A 3P6YC 3SZ2A 4FJGA 3DOMB 4OX7A 5GAGU 2UXBJ 1KP6A 1ZM2A 4FWMA 2FBVA 5CYMB 2F9WA 1QUPA 4H5WA 2ASYA 1RTDB 3UN3A 1QTNB 4WFXA 1IR1A 3HP6A 3LAMA 3NS5A 3FVYA 1X9JA 3NBPA 4A4JA 3A2FA 2GIRA 2OA8A 1JJCB 2PFFB 3F56A 4DBQA 1UVIA 2Q66A 2XS2A 4ZA1A 5DM7L 3T1HF 1XI1A 3OW2M 1JLEB 1G6BA 5JVGL 4CEEA 4USTA 4LFBF 3POTB 2VA3A 1KAXA 2NNWA 3WDOA 4WFNL 3DI6B 3AB2B 2M7SA 3QESA 3L7PA 2PI5A 4IUFA 1SKWA 3FFKB 1VC6A 3OTBA 4HTUA 4CJWA 1X4HA 5KG7A 3GLJA 1YZ6A 3KFWX 4UT4A 1GEHA 2Z57B 3RMCA 2QL9B 4ILMA 3W2VB 1XNRJ 1DQAA 1K1QA 3TVKA 1GLBG 3MCNA 3AVBA 3ZT0A 4FJKA 3BF3A 4CJQA 1LW0B 1F5BA 4OJGA 4HYKA 2EXUA 5A76A 1KONA 3TZXA 3THVA 2Q3PA 1X0PA 2XMWA 3DRYA 5L46A 3MUVP 4FKXA 4IG0B 3L3VA 2HW3A 2GJIA 4Z7CA 5AQIA 2C3MA 4UOCA 4YR3A 4CFAA 3GFZA 1JNZB 1KQSM 4H0YB 3OT9A 4WIQA 1U8SA 3PYDA 2UXDJ 1TL4A 1HI1A 5KT3A 4Y2CA 2DIUA 4NA2A 3CCRS 2W2QP 4MMOA 1BWEA 3LDLA 3GYXB 5KG2A 1X1PA 2HIQA 3BO3A 4LY7A 4URSA 4DF8A 4YR2A 4WK1A 5F3ZA 5T14A 2HS4A 1PJ5A 5HK4A 3LH2S 3B4MA 1MA9B 2V68A 2PFUA 4OYBA 2VC0A 1U1NA 2Y1RI 1RU1A 1Q5VA 4LSLA 3R7SB 4NLYA 1FWKA 3ISNC 1BHNA 1ASVA 5EOYA 2AKWB 3KK2B 1FVSA 3D3CJ 2RU9A 2PY5A 4FJIA 3TP2A 4Y00A 2JZ5A 4XIUA 4AH9A 4EUVA 4X4VA 2BX6A 3NH1A 5DDPC 3UR0A 3WXKA 2W9BA 2V51B 5LJVA 3MECB 4OZ1A 3AVAA 1E3MA 5HLFB 1ROFA 1H74A 4G65A 3UCGA 4BCAA 1IJJA 2GVZB 2CQHA 1KVKA 5F2RA 4FWKA 1VSHA 1Y5LB 1VQKS 3ET6A 2ROPA 4Q0BA 2KZZA 5ADXA 2A6AA 3GFYA 4F8RA 4DR4K 1C0TA 3JS9A 3WX4A 2AEJA 1F3VA 4EYIB 4E98A 2NPFA 1HNIB 1NDLA 5E5NA 4ZPCA 1HNWK 1WUAA 3CDEA 3WNGA 3DOLA 1YSJA 3AGKA 1GNKA 4FL9A 2K2PA 1H1VA 2YX6A 3ICLA 3K2PA 4OX9F 2GHWA 3ZFVA 1OPZA 4PG5A 4DPOA 3UVJA 3TA0A 2RKIB 3G6VA 5F1XA 4B3SF 5JMNA 2HBJA 4DQRA 5KFKA 3FCWA 4L3KA 4DHVA 3FBBA 2XYPB 2Z2ZA 3BKUA 4I69A 1B9DA 4DV7J 3KMQA 3D9BA 3FEZA 2BZ2A 4LF5F 4LSNA 4Z4FA 2OHDA 5AZIA 4YOTA 1FX2A 2MHEA 1APSA 1GH8A 5BR8F 2O8FB 3MEEA 4FBUA 4MK8A 5KFGA 2HAIA 3VAKA 2NYIA 5HP1B 4CJTA 1ATSA 2QYGA 3LP2A 1W0HA 2Q6BA 4OZNA 5EX3A 1S1VA 5T7LA 1ZBTA 3FSXA 2AD9A 3IG1B 2PA8D 5CCMA 5KFBA 4P10A 5IC4B 2DH7A 4WFZA 1FE0A 1T0TV 1MN7A 3VEYA 3PNIA 5E7OB 1UAWA 4ZP8A 2J6UA 1BMQB 2LKZA 3OR1B 4NLVA 4AYBD 3ENAA 3SQGB 4WXWA 3OUYA 5C2FA 1FERA 2DGUA 3FZHA 1CJVA 1QHTA 3LP0B 3VWSA 3P38A 4FPAA 1VQ6S 1U24A 2E88A 2OPPA 4CYUA 1PBUA 1WKKA 3I56N 2EBGA 4ZN1A 2PYJA 1YI2N 4PXBA 3SUPA 3KK3A 3HD2A 4WFBQ 3HZEA 1VQ4S 5JJBA 3MWBA 1F2HA 3V1QA 4FXDA 2ZUGA 4ZVSB 2CNOB 5KT2A 1B70B 4PHTX 3GWCA 4YQWA 1CEZA 3MFHA 3G2XA 4NLRA 1EWQA 4C8YA 2MQPA 2FY8A 2RSQA 3BO2A 3G10A 2W2OP 4X4NA 2CQGA 1F21A 2E2QA 3D0HE 3G71N 4F4ZA 2E29A 4FF1A 1HBOB 2A1SA 5ETOA 4KAIA 2XNQA 3VR1A 2DNNA 3QNNA 4IEEA 1GT8A 2HQDA 2RU3A 3TUJC 2N4DA 1TK0A 4ZIVA 2ERRA 2J6TA 3ZTOA 3AQPA 1G2EA 2HLTA 4TYAA 5KRTA 3LDQA 3G4SS 2P9KA 4FLVA 2J0XA 1VQPN 2KFNA 3ZCMA 2V63A 5HRSA 1VQ9N 1VYAA 4ZVEA 4F67A 1NB2A 2MTLA 3ALYA 2U2FA 1WTFA 3PVXA 2DK2A 3QT6A 2DBBA 4OZ2A 2Q79A 3BGFA 3W9JA 4W5QA 1BUPA 5K8PA 1IV0A 3N28A 2E20A 2HS0A 3SDEA 2CG4A 4CEAA 4AQYF 2G8UA 3MPUB 4JI6F 5EX0A 2DNPA 3KMSA 4DXLA 2G8KA 3EXYA 3P5JA 2XMJA 2Y0SD 1CS4A 2YWKA 2QC3A 2HS3A 1HA1A 2RMLA 2CGLA 3C15B 2NRZA 5M1PA 5KFZA 5D4NA 2DNYA 2W01A 4ZPDA 4ZVTB 4BRGA 4Y0FA 2ZITA 4UY8T 1S6PA 1KC8O 3HPHA 2UV8G 2GX8A 5LL6d 4ZOSA 4FXWA 5CYQB 1YRUA 1ZTWA 1CG2A 3RG6A 1F9HA 2ASMA 3SQ2A 3DU6A 1S4FA 1XUPO 2N82B 3PG9A 2BM0A 4JI7F 1DEJA 1ZXOA 3G8SA 2CQ3A 3O3GA 2M70A 1WSGA 2AJ4A 4A8SA 3GG1A 3OHRA 7FD1A 4JBCA 3GJQB 4CNZA 2CRLA 3LO3A 3QIPA 2JNJA 3K89A 1KD1T 3TTFA 1KVCA 2V94A 4C23A 5JMVA 1NO8A 4RZRA 1B92A 3DLLQ 5IT9Y 2AJ2A 1WC0A 1NKBA 2YKNB 4CEFA 1F5AA 2MJUA 5M1OA 4DPUA 1MW7A 2BJDA 1X3MA 3CEDA 4ERDA 4JKGA 5HROB 4L73A 2OJ3A 3Q86A 3JYTA 2OPQB 1Q0NA 2FJEB 3RYLA 2PC6A 2KT2A 4YDUC 3H8YA 1JQGA 2IA0A 2QWPA 2GC8A 4CF9A 1GLJO 4F7VA 4CJPA 1Z25A 3GZ7A 4USWA 1JB0C 1YITN 3DYAA 3B4DA 3FZ2A 3ZTPA 5CZXA 4M5MA 3LANA 3DGPB 3MD3A 3ZO7A 4QOTA 3GR1A 3MCSA 3CJ3A 4ECXA 2BE2B 4O3QA 4HHTA 1C4CA 4X62J 1LOTB 1XIQA 4FPBA 4M8LA 2JEGA 3O2IA 5BJRA 2YH0A 4JHDB 4F25A 1RAHB 1TKZA 5F0WA 4LF7K 4YFUA 1OO0B 2V8DA 1E6YB 2I7PA 4LF4K 4KH0B 1NHUA 5LM7E 5DM7Q 2N3LA 4MFBA 1N6QA 2G8VA 1TR0A 3ATVA 5GAHI 4WFNQ 2ROEA 5E3CA 4EFAC 1H73A 3GFXA 4BC3A 3QEIA 1UMJA 2X1BA 1IN0A 2F5GA 3A5LC 2NUHA 2Z4PA 3BN7A 3PHEA 3ASMA 5DS7A 4QWDA 4DV4F 3AARA 5KPRA 2X7IA 1YF5L 4CO5A 1VSEA 2DGXA 1R8BA 4E2FB 2XLJA 3M3ZA 1VDHA 4M5JA 1IBLF 4FJ8A 4ZVFA 2XO7A 3LPEA 5A6WA 4JYAF 1GFWB 4DPXA 1UPPA 3R27A 1QJHA 3BKFA 4OI3A 4RNFA 4QYZK 3EJMA 2DY1A 3UW1A 3OVAA 4KTQA 4KKOA 5EWEA 4WQ4A 3PJ9A 4OV6A 3EKSA 2YWGA 4OYXA 4U96A 4DX6A 1HW8A 4KHRA 1FKAF 3CMAN 1U7LA 3KWMA 3O9SA 3J80Y 3TTDA 4KV8A 2EPIA 4JK9A 3CMES 2M4MA 5FRMA 1IJFB 2N7CA 1DFDA 1KCFA 3OL7A 2O01C 1OY8A 1J5EF 3PW0A 3SLCA 4J9UE 3QT5A 5KFRA 2E5LK 1K9MO 4CF0A 1EQMA 3W3DA 4OZ5A 5E3RA 2GJ2A 4QW9A 1QAIA 2GAGC 5C42B 2MKSA 5A8WA 2V52B 1BA1A 4DR3K 4AHTA 2LA6A 1WAFA 2DITA 3OPKA 3QDKA 4OHXA 4NXNK 3OYMA 4B02A 2KJVA 3LUYA 3TAGA 2OYQA 3WXJA 2YPYA 1JMTA 3KK7A 3SCLE 3D2EA 4X65K 2E8AA 4URGA 2XLKA 2YI1A 5JUMA 5KG0A 1N88A 1WC4A 2JLGA 3KXDA 5DG9A 4ECRA 1MDUB 3CCQN 5AQTA 4O3OA 3H2VE 4ETZA 3LP1B 4LR8A 2HHXA 1RT1B 2HWHA 3MEDB 1HNXJ 3VAHA 4OV1A 4CRJA 1GMWD 3AY0A 3M8WA 4DV2F 4LFAF 3CB4A 5LOQA 3LPUA 1WORA 1B0TA 3OXLA 4U7CA 4OLPA 4ALZA 2DNGA 3EDQB 4ZVGA 1RAFB 4KHPK 4ZKAA 2RRBA 4B17A 3OS0A 2UVWA 4DSKA 1BLUA 4N5SA 3NGUA 2I0XA 3AA2A 3M8PB 5K14B 2K7KA 1TKTA 3I0RA 2K1RB 3L9ZA 4DJBA 3V4MA 4GVBB 4JI8J 4LF7J 3H3OB 2L9DA 4UUWA 1JKHB 2E6LA 3ZZPA 4NEYA 5F8NA 2AW0A 4LF4J 4G1PA 4NLGA 3F73A 4MYUA 2BE9B 1RT7A 3ONQA 4WIIA 4GVMA 2WSFC 3T19A 3I9V9 3MM9B 4NCGA 4B8AB 3RB4A 4USJC 2GBZA 2I1RA 2Z30B 3T5HA 2GGPB 3C6AA 4IFYB 3AJDA 2P9SB 2RHQB 3DXMA 2X1FA 3QETA 3MAAA 2E6MA 2KT5A 2R3VA 4A8MP 4FZYA 4YOVA 1LK7A 3MGJA 5DZ7A 4DB3A 1RAEB 4QYRA 1RHMB 3NH2A 2LEAA 2YHXA 4HACA 4QYZJ 3OJUA 4O23A 4F3MA 3ZXWA 2WOMB 1S0OA 1SQEA 4HI2A 4DV1J 5A8KA 2AV5A 2CZ4A 1CJTB 3RJMB 2KTQA 5F8JA 2VZ9A 4QBUA 3D7SB 1P1TA 2HB5A 3NCIA 2P5OA 4ED4A 4FYXB 4KSEB 1N8RT 4IO9Q 2DR7A 2M9KA 5LSRA 4C7QA 3KJFB 3QZ7A 2YCHA 2GMHA 4BR2A 1VHIA 3N4WA 3FLCO 1UW9A 3CWJA 2MMYA 2ZBRA 3LDSA 2RQCA 2YX4A 4H5VA 4K4WA 2E5LJ 4F0HA 9RUBA 1QAYA 1NXIA 4QIEA 4ILGB 1YDLA 2R7XA 5BYSA 1AFJA 2HOEA 1LFWA 4Z2XA 3C2PA 4DR3J 2B4VA 3PJWA 1X4EA 3TAQA 2ATCB 1ZA1B 1YXQA 5AQQA 3ZSYA 2VF3A 3BYPA 3IS9B 1MROB 2YNGB 1K0VA 2VB6A 2G2OA 1A0OB 4CEQA 2JRSA 1WACA 3BB5A 5HATA 3R8YA 4LF6K 1IXKA 5AQLA 1FRJA 5EGYA 4NA1A 2PMHA 4I7FA 3QYYA 3OYFA 3HPOA 3TJ8A 4X65J 2VFUA 4U7UD 4IG3A 4RW4A 3E8OA 1NM1A 1S1XB 4ZCMA 3M1VB 2ACMA 2IBOA 4ANDA 3MX2A 1E6VA 2JLFA 5K8OA 2CQ4A 2NRHA 2O8EB 3J7ZT 1FVQA 3KDOA 2HEKA 4CE9A 2VDIA 3GB0A 5DDQC 4DFJA 2RUGA 2MEWA 1C0FA 2LDYA 4IXCA 2YNFA 4P72A 4GMJB 3FDSA 3P4IA 2HHHK 3AA9A 2H5IB 1KHVA 1R59O 1IBKJ 4I2PA 1P9QC 2MZRA 4KHPJ 4ZP9A 4BR0A 3G82A 1R0CB 1FFSB 3GJRB 3D1QA 2JC0A 1R3NA 1L3KA 3FQLA 3M7VA 2UYTA 4Z4EA 2RH3A 4P71A 3KYLA 3VTIA 1NSAA 4HDHA 3HT3A 1NG9A 3ZLJA 1N48A 4K4YA 1EJ7L 1ZAVA 4JKEA 4IOAL 3D7EO 4BRPA 3UE2A 2D4WA 4N56A 1EO1A 1FW6A 3GYGA 2LQ9A 5HI7A 3IKMA 5C7PA 1I94F 1RBOB 3A3OB 1W26A 4MT1A 4LRCA 3B8HA 4DR6K 4C1NK 2FVSA 2C3PA 1V4SA 3UNGC 1XC9A 2JHEA 4CVNE 3MEGB 2P5GA 4Y6IA 3J7Z5 3C14A 3L2QA 3CCVN 1GLAG 3K59A 1RK8A 2J5AA 4C0BA 4G3IA 3H98A 3A8EA 2ADBA 3I4HX 4YY3F 3NBPB 5BR9A 1U6BA 3U7JA 3VEOA 2NSBA 4KO0A 5CA5A 1N32F 2CYYA 2QE5A 4USHA 2CIMA 4ZMMA 2VFTA 2UVVA 3SQ1A 2NRTA 2NZCA 4WJBA 4ES3A 1Q86T 3RR8A 3T1HK 2KN4A 2UXCJ 1UOCA 4LF8J 4CEBA 2BJ3A 4LFBK 3FUYA 4ED5A 2G13A 1T3VA 2QEXS 5KFJA 4KT0C 4AM7A 2ZQBA 2BJ8A 2PMWA 2DRDA 5DRKA 4DTOA 2H51B 3IN5A 4DZ6A 5KG3A 2GW8A 5DM6Q 2WW4A 2RQKA 2ZZTA 3VGSA 2HQIA 5AJ3F 1FJEB 2GELA 2QFJA 2UZAA 1HLWA 2WRMA 5ETKA 1XJWB 3B78A 3RRGA 4IDHA 5M1FA 4OPKA 4H0OA 4EMDA 4FLXA 3S1TA 5D3GA 5DO2A 4JKBA 2ZNZA 3D1HA 3MZIA 5L1LA 2OFGX 5GAEU 3H59A 5D0HA 1YAGA 2OZMA 5JXSA 4CLFA 3FMWA 1E4GT 2AMCB 4GVLA 1HKCA 4DSJA 2V7YA 4CJ3A 2E1MC 4PXEA 2DGQA 2V7ZA 2J7UA 2WK4A 2P9PA 1NK8A 2XY6A 4YB5A 3CQXA 3TRGA 2ZJPQ 2VU5A 1QDUB 3AO4A 1HNZF 5GIOA 3ISZA 4LSLB 3CUNA 1WOOA 4WU2A 3L4QA 4FWLA 4EZ9A 4OGCA 4ZHRA 1NGBA 3V2UC 2KH9A 5BPMA 4IO8A 3WIUA 2AX1A 2XB2D 2HHHJ 3IM8A 5KFSA 4DMZA 1G15A 4BRCA 3CCLS 2KKHA 2DXDA 2W9BB 2FHMA 4USVA 3GCXP 2LEPA 1O0PA 1R6YA 3QICA 4BY9C 3MM6A 3O08A 5KT4A 3M6XA 4CZCA 5AE2A 4XEIA 5B09A 3ET6B 3CSKA 3O9TA 4Q0BB 3NDKA 1UWBA 1KR4A 1C0TB 3AO5A 4GV6A 3KD1E 2CNLB 2AGOA 2V0NA 4KH5A 1VISA 3DWLA 4ZITA 2WSCC 3KJNB 4ECYA 3ZZZA 5H9FK 1W2BR 1KLMA 3IWXA 3AODA 3DOLB 1XNQF 4AHRA 4CESA 2VFVA 2POKA 3AA4A 3HP9A 2QK9A 2HQGA 3HK2A 3HSZA 4CNYA 2NXNA 3QPIA 3J81U 4PKIA 3EM1A 4JB8B 4UY8O 5JICA 3UVJB 4DR6J 2G1DA 4CFDA 3OYGA 4YDUA 5GMEA 3PYEA 1TFYA 2EFNA 3R1LA 4OI4A 2DT9A 1IKWA 1UFWA 2MPUA 2DNLA 4D3HA 1FRXA 4LSNB 3F0NA 4KGMA 1SQGA 4IR9A 4CGIA 3SCJE 5AZIB 1GLDG 1SH2A 3IR7B 4MDBA 1GX6A 3KLGA 3H42A 2P6SA 4IRDA 4LF5K 3PHTA 3O1BA 3MEEB 4DUYF 3AA3A 5KFCA 2XMTA 2VDHA 5H9EK 3T1HJ 1X4DA 3LP2B 5DDRC 3H7HB 3KTQA 3HVTA 4LFBJ 1WC5A 5T7LB 1S1VB 1S9EA 1KD1O 5EDWA 3AVGA 4JI3K 3KHGA 5MLCV 3OL6A 4FF2A 2BE7D 3HVRA 1JCGA 3ZX0A 4L76A 5CZ2A 2P51A 3AOAA 1YG0A 4ZJQA 3SFUA 2PZSA 4URQU 3LZJA 2CZVC 2IA6A 5GAHP 2ZHBA 2IJNA 5ETLA 3OUYB 3MR6A 3UKUA 1FO1A 2QLFB 4USMA 5C2DA 5THWA 1D9FA 4E1MA 5DGAA 1EP4A 1CJVB 1XQSC 2WONA 4FZZA 3VAIA 3DN9A 2OPPB 4CYUB 3EZ5A 2EVZA 5ETRA 1S1UA 2JEFA 1GLCG 3SCXA 2Z8QA 1GLLO 2K06A 4KY3A 2YWHA 3TPQA 3KK3B 3HHEA 1RHRB 4V19X 4ZN3A 2C2EA 3K9KA 4HVZA 4FVUA 1YJUA 1VQ5N 2YX1A 5I4MA 3AY9A 1BUXA 2Q3SA 1D09B 4C8LA 1XN9A 4ED2A 4ZVPB 3CPEA 2CPDA 3J7AP 3DNCA 4CJFA 4O3PA 3SI6A 1TUVA 1XERA 4U8YA 3W5ZA 4XH4A 3THXA 4DQ8A 3HULA 3GV8B 3LALA 4J9KA 4NXMF 2E1PA 3KZBA 3FNNA 4K5SA 1CULA 3ENHA 3G6EN 1YJNN 2P9KB 1HJRA 3KLVA 4NOHA 4JI5F 1U1MA 3N6MA 1T8EA 2BEFA 2C42A 3EYZA 1JCFA 3CIZA 2RRNA 3VAMA 3UN5A 1WG5A 4DTMA 3NF8A 3SIPB 3R7BB 3SDEB 3O1WA 4W5NA 2ZH6A 1U26A 2RJZA 2HRTA 2F1FA 2X6NA 5H9FJ 3MMVA 1BL3A 3OHBA 1CS4B 4YHHF 4OPHA 1TGOA 3CO0P 3FBEA 1CC8A 1EKRA 4JI6K 3V81A 1WUUA 5L1JA 1W2BM 3L0QA 4H0XB 3IFEA 3GCWP 5HSPA 1S6PB 1M1GA 1NGFA 5AQHA 1GLEG 4R0EA 3VQTA 3D2WA 2B4OA 2DFFA 5GMDA 3QFPA 4OX9J 3LDOA 5AQZA 4RL1A 4B3SJ 2ZBCA 3ILJA 2XC9A 4B1VA 2RDJA 3OV7A 1JXBA 1KXPA 2KHDA 1PO6A 2F3JA 4K59A 3D4JA 1XWLA 2JH3A 1NHVA 1LW2A 4LF5J 1GTEA 1PJ7A 4EI2A 1UKUA 1XMQF 2IY5B 3AOBA 3ZSRA 4XPEA 4GC7A 2RPIA 2P1JA 5H9EJ 2KFYA 2IRXA 2OI2A 1SL1A 5BR8J 2Y3YA 3VAGA 3QIPB 3FBFA 4E8UA 2ZOGA 2UVUA 2OLWA 3NOCA 3K5MA 1DKGD 4X4PA 3SV3A 4M5DA 2YJFA 2M52A 4OI6A 3EDRB 1GOBA 1FXDA 2HSTA 2V9KA 3CD0A 2PD1A 2FJWA 4JKGB 4K5RA 3L3UA 5F8GA 3PRVA 3JYTB 2HMPA 4IEIA 4NB4A 3KOAA 1NMDA 4DV5F 2QWRA 3AJ1A 4J9MA 4USIA 4BR4A 2BBEA 3DYAB 1CXUA 4M3TA 1S5JA 2R7WA 4A5BA 2ALZA 4X64K 1VSJA 2O8BA 5HVFA 1QY7A 1M1KT 1NGGA 4N76A 2JGUA 4PPDA 4ILJA 2WSEC 2QG9B 3QEVA 4DSEA 3AA5X 2Z0GA 4OHVA 4PXCA 2GHVC 3PSIA 4QR0A 1TKZB 1ATNA 2LXUA 2G0IA 4O3SA 2VWJA 3BS9A 3CCRN 1EKSA 3R6LB 4DX7A 2DB1A 4ANEA 5EWGA 4ECQA 4ZVUB 1CBKA 5B0EA 4R79A 4O8UA 4MFBB 2EI5A 1N6QB 2XY5A 2FSJA 2CKWA 3HZGA 4PYAA 1N36F 4ID5A 3PKYA 2MLZA 4ZDNA 4U9RA 5B0CA 3PR5B 5J2NA 5CXTA 4NLBA 2H54B 1B4SA 4C98A 2ZKUA 3DLHA 3CJ4A 1TUGB 2W8LA 2E5GA 4PXDA 2ABYA 4YR0A 1BA0A 4NLUA 2K3KA 1FXLA 2H48B 4FJ9A 4K8RA 1HKBA 3H4DA 4HI1A 4DFMA 2FC9A 4IBNA 2RD5C 4CQ1A 5I9EB 1YX2A 2B3TB 4RW6A 4IO1A 8ATCB 3LPTA 5A0YA 2FF6A 1UL3A 1DURA 1OS5A 4CK3A 1VQKN 1UFLA 1IBLK 2V4JB 1OYEA 1FWPA 4KKOB 4O44A 4AQYJ 1EWRA 4JI6J 3MMCA 2RNEA 4DL4A 2B4PA 3J7A1 2FTRA 2XMMA 2DJWA 4O0IA 4DHYA 3WT0A 3W60A 4KV8B 1WJ9A 2DYAA 4ZPWR 1N8RO 1OH5A 1D8YA 3FSYA 3VF4A 3AVKA 1UA1A 3CJ8A 2BV3A 3IC1A 3GIJA 1RDCA 1KDNA 2HQCA 2QA4G 3DLBA 3I5CA 1FRMA 3CULA 4Y2IA 3MM8A 3OD2A 1RHKB 1REGX 5A8WB 3NGZA 4JI7J 1VRQC 4PKGA 1YJ7A 1PC5A 1WF0A 5CABA 4CWBA 3BQ0A 2MLXA 1KAYA 3V6DB 4MJKA 1S3XA 3AVLA 1KNZA 3CYMA 4JLHA 3M8QA 2D9PA 3D2EB 2IJFA 1NB7A 1S99A 3AO1A 4ILHA 1NGAA 1RWPB 1YGYA 1ZETA 4CZKA 4L72B 4BRNA 4NZ0A 4GY2B 4LF2A 4WYLA 3IM9A 3TAMA 4MO4A 1B99A 3J7ZO 1X0FA 5ADXH 1U1OA 4NO7A 3H46O 1M0SA 4RJVA 5DGBA 3EN9A 4H0PA 3UWTA 2HBQB 4DTSA 4JV2A 3LWMA 4CHPA 3QMQA 4CO4A 4DL7A 1X60A 3D66A 1NOZA 4CZIA 3KLEA 4KI4A 2FGCA 1Y3KA 2YJEA 5IWAF 4DV2K 2V8PA 4LFAK 2Z1IA 1VQ6N 1X9SA 4IDKA 3PR4A 2R42A 1TZ0A 4N8NA 2DNKA 4WTOB 4XDCA 3KNGA 1TKTB 1VBYA 1FF2A 4Q43A 3I0RB 5HJXA 1YWXA 1KSPA 3R7NB 1VQ4N 2ZHOA 1NK7A 4KH1B 4Y2MA 5EWFA 4OVLA 1JLCA 1HD0A 4YNQA 4CLLA 1RT7B 1UJ4A 1Q9YA 3CNQP 3HHLC 5ETMA 4WTYA 1VQNS 1S1WA 4ED7A 2FF3B 3D0IE 1WBDA 5F3TA 4NCGB 1WNEA 4K8XA 2BKNA 1SIZA 2YNIA 2FHKA 2C3OA 1YQHA 3DXMB 2CJXB 2RF2A 3D68A 4OKEA 3MAAB 5KOXA 4Y65A 4G1IA 2CPEA 4H5RA 4CH1A 2BW7A 3TJ9A 3DLRA 2YHYA 1VRTA 3N9UC 4KB7A 4DV4J 3T1AA 1WB9A 4HACB 3ENBA 4FK2A 2W41A 4TY8A 5CH7B 1Q86O 1X4AA 4JYAJ 2WB1D 3HSTB 5A8KB 1U1PA 2BACA 3OJSA 4M3RA 4C1NI 3VENA 5DK5A 1NRKA 4CLTA 3A8IA 1P9YA 4M5GA 3PM9A 1U2FA 1HHSA 1T9TA 1NK4A 5ETTA 1BXNA 1YTUA 3QEPA 3PW5A 4GKKF 4DOZA 4TLQA 5D15A 3HHDA 5EVZA 3NF6A 3MI7X 3QAUA 4KGXB 4LUBA 2CG8A 4DR4F 3JAMO 1J5EJ 3EVOA 3K5NA 3NGRA 3WC0A 4FWOA 5K8NA 1I1GA 4DN0A 4BRDA 3SCIE 4BG9A 3QB0A 3EZOA 2ASLA 5GADI 3V1RA 4KR0B 2LCWA 3DHWC 3GR0A 3HD1A 3Q8VA 5C15A 2QW9A 1PC4A 5FPNA 4M7XA 2M5YA 5KFNA 4I7FB 4DQPA 3KDNA 3CCWA 4IG3B 4RW4B 4A59A 3TNVA 4DCPB 3W62A 3VF0B 1RWOB 1E6VB 3D6HB 2HPUA 5IT0A 2YKQA 2VHGA 2O67A 1PG5B 3PEHA 3T5KA 2LQBA 3U27A 4HKQA 3E9LA 3BH6B 1W97L 4CGJA 3CC2S 3SI8A 1GLFO 1U02A 2YNFB 2IIHA 1JCEA 3RMAA 4CK2A 2CNNB 4BWMA 2DNRA 4XPCA 1I3AA 3HJVA 3R97A 1NOYA 4FS1A 5F41A 2OD6A 1Q95G 2YKAA 2R2SA 4I2PB 4I6WA 4DV2J 4LFAJ 3G82B 1YJWN 3BKTA 1VIOA 3N5FA 4WU3A 4CIGA 2FLPA 3ZSOA 4FJHA 2VJVA 4DPYA 2H4WB 2AP6A 4J2BA 4FBTA 3AAWB 4PAAA 1FT8A 2R8HA 4DR2J 2CQ1A 2IAJA 1YJ9N 1UP1A 1Y0HA 4X4RA 5HMZA 3D67A 4KGVB 4U8VA 2A42A 3FRYA 4BRIA 1K6YA 4USKA 1GTHA 2IM1A 1K0TA 2GNKA 4RU9A 2DHXA 2XGQA 3BDPA 1D9DA 2QLBB 3I8DA 4E0DA 2CQDA 1U2VA 2XHCA 4M3WA 4IJAA 5KQ8A 3BR8A 5KPTA 1ITGA 1WI6A 4C8MA 2XSFA 1EARA 3FEYB 4Y0WA 1I94K 3R6MA 4P2MA 4WCEL 3C14B 1N4LA 3CJRA 1BQXA 5CHIA 4DV6F 2IVOA 5IC6B 1FTRA 4BQLA 3BPSP 4J8FA 1WC6A 4KO0B 2XM3A 4YY3K 2JWNA 4EGLA 3D3BJ 5KFHA 3PW7A 1RT3A 1IWAA 5DZ6A 4WK3A 6FDRA 3IMXA 5KQDA 5AQGA 2LU2A 1HJOA 1WAJA 1N32K 2E9RX 1HW9A 3QFUA 4K42A 1SC1B 5E3PA 2NQPA 3A5NC 2KZMA 4LH5A 2B7BB 1R8AA 5A2QO 4LIRA 3GONA 3NWRA 2OKQA 4CH0S 2CJQA 2UVRA 4I6YA 2UUBF 3KK1A 5KFDA 1UEKA 4CLZA 2CGJA 2FGOA 3CMEN 4YB6A 3NFAA 5DG8A 3KHLA 1TUWA 1A5WA 2Y1LB 2LLZA 2PYLA 3KJQB 3VF2A 2EFGA 1EKEA 1K47A 3HFVA 4ELTA 5G4DA 1S72S 5D3GB 2LQ8A 1TV6A 1HQ2A 1C0MA 3PV8A 4P2SA 1FTCA 1D5AA 1SKRA 4MDAA 3HHKA 5L1KA 5HRNA 3CD6S 3EVMA 1UWAA 4CHZA 3KUGA 4C4WA 3VAFA 1OH8A 4RW7A 4OYPA 2P9PB 3MR2A 4H5NA 1RZMA 4A57A 4WF9L 4CLPA 2RDDA 2FC8A 1R8PA 3RZAA 3I8BA 5IM0A 4WE1A 2EFOA 4ZLJA 4M94A 4J90A 2OANA 4ZHRB 5F8IA 1HNZK 3CCES 4XDDA 4OO1J 4WZMA 1UA0A 2XWXA 5KT7A 2XMUA 3NCRA 3TVZA 4BRMA 2R8JA 3KHHA 3DKDA 3V1OA 4BR9A 4KFBA 4UQGA 5FJ4A 3PTWA 2RIJA 3H6EA 3MM6B 4YOWA 2AYBA 1BC6A 3V6KA 4ICLA 4TQRA 3QLHA 2HIYA 3F5TA 3UD5A 1E4FT 1QQNA 4K4ZA 1UWBB 4DL5A 3M05A 4FM1A 1VCTA 1B7FA 4KBOA 1SVDA 4DU8A 3VPZA 4K0KF 3UPFA 5ETQA 1C0UA 4KH6A 2XYHB 1KLMB 4C6AA 5KT5A 4ECTA 4LF9K 4IR1A 3SUOA 1TL5A 4MKAA 3S3OA 5BPNA 2W2NP 1FDNA 4FPIA 3TARA 1P6TA 3MM5A 3MN7A 1RDWX 3SQ0A 2BJEA 2DEIA 3MMAA 4HVJA 3SPZA 1T9YA 2GWJA 1Y9OA 1Q53A 2PAVA 1I94J 1MMDA 4MAKA 2MQNA 2K7JA 1IKWB 3CXCR 3VQDA 4I1TA 4FOEA 3BP8A 3FZFA 1DTTA 1U1KA 2HAFA 2W6LA 3L2VA 4OLBA 1AA1B 4QW8A 3CM6A 4AHVA 2N3OA 5KFMA 1K8AO 3M30A 3I87A 4FP9A 4M3ZA 3KLGB 1C1AA 4YY3J 3SPYA 2J7KA 2P9UA 4EAHD 5J2MA 3LP3A 3VETA 2N7YA 5B08A 1N32J 1RTHA 2D1KA 1QSYA 1KFDA 2E1CA 4DUYK 3HVTB 1S12A 1S9EB 5HAOA 4Y28C 2VBYA 3T1YF 2RRAA 5AT1B 2NZ4A 2OH2A 4MTPA 1M5KC 2WUSA 1CJUA 4YEAA 3O4WA 1H2UX 1FEHA 4L8RB 2AZ3A 4BDPA 1N34F 5BRDA 3NLCA 2F9TA 1A9NB 1ZA2B 3UKUB 3HMJG 3AHPA 2R4FA 4ZIWA 4B3MJ 1C1CA 1EP4B 5AJ3J 2WONB 2OTLS 2KRRA 2QV6A 1QTMA 3QIOA 1SUQA 4QPXA 2O4IA 4DEZA 5TKYA 1S1UB 1SXLA 2RAQA 3W61A 4CJUA 5J1NA 2A3ZA 4DG1A 4OYOA 4CZEA 2D74B 1FJCA 3QFWA 1TL1A 2E5IA 5F0UA 3K5LA 1KVBA 4HCBA 4RUCA 3EGNA 1NDPA 1UTAA 2FJVA 1RWKB 4OLAA 4WBFA 3GDQA 1HPZA 3EPIA 2Y0BB 3FGUA 4RW9A 5CY4A 4DSLA 5AQSA 2MKIA 4BHQA 3VQSA 2W24A 2YWWA 5I3UA 2JWKA 3FKBA 1GX5A 2XYGB 1L3UA 1U47A 1X7VA 3NF7A 3THXB 4BGBA 1S10A 1HNZJ 3SAHA 4FXVA 2ZC4A 5F8MA 4OX6A 4A48A 3P45B 4YDDB 4JP8A 1CULB 2E1AA 1JLQB 2VQEF 2HBZB 4MKVA 1B0PA 1NZAA 1OWXA 3AH6A 1R7IA 1PYOB 1NK0A 3V9SA 1GAOA 4CP5A 3RUBL 4AD6A 2F4VF 4ATNA 4HT5A 3B54A 4Q44A 1RT5A 4FYV