1RBSA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEACEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbsA00
2VWJA 1KLNA 5KGXA 5T7BA 1N6QA 3OYHA 3LWMA 4Y1CA 4KRFA 1JKHA 3M8SA 4M3ZA 3ZSWA 3DMJA 2P5OA 1TVRA 1RDDA 1TL3A 3ALYA 4FZXC 5CZ2A 3WNEA 3LPUA 3ZSQA 1VSHA 1T7PA 4ELUA 1XHXA 4NYFA 1C0UA 1KSPA 4CGGA 2QKKA 2D0CA 1S1TA 2HHVA 1A5VA 3SNNA 2HHWA 4BWJA 4M3UA 2YNHA 3ZT2A 4FJ8A 4CEAA 2HHSA 1JLQA 4CEFA 1X9WA 4HHTA 1BI4B 5KTQA 4CGJA 4B08A 4CJQA 4E89A 2E6MA 1Y97A 1S9EA 1VSFA 2FBVA 2ITGA 4KKOA 4EP5A 1NJWA 1TK5A 3U3GA 3TABA 3C6TA 1J9AA 4O0JA 3OJUA 4M3TA 3ZCMA 2A1SA 4JS4A 2D0BA 3SQ4A 4CCHA 1RILA 4E1MA 4Z4HA 4CJLA 2DTUA 4FZYA 4IKFA 1GOCA 1CLQA 1WN7A 4ZTFA 5KRTA 5HP1A 3HVTA 2G8WA 4C8MA 4HCCA 3TAPA 3JYTA 1VSEA 2JGUA 1SL2A 3PY8A 4QOZB 3F73A 4E7IA 4DS5A 1HJRA 2HW3A 1SL1A 1RT7A 3F9KA 3NH2A 1QS4A 1RT1A 1RTIA 1Z26A 4FLYA 2R7YA 4DTMA 4KAZA 4DSEA 4E1NA 3DLKA 3AA4A 1S5JA 3KJVA 5I42A 4M42A 2HVHA 1CXUA 4DFMA 1HNIA 3PX0A 1GOBA 4AHVA 4L8RB 2PZSA 3MEGA 4DSKA 3DLHA 2Y1JA 2YHAA 5FDLA 3SUQA 4FJLA 1TAQA 1QQCA 3KLIA 5FRNA 1VK0A 4IG0A 3VQ4A 3HP9A 4CK1A 5KRSA 3QEXA 1FKPA 3SJJA 2VG5A 4FJGA 4C8NA 1C6VA 3HJFA 3KLHA 4CHPA 4DLGA 4IDKA 1LAVA 3AVNA 1JXBA 4JRPA 1K6YA 3RMCA 5HLFA 2A1RA 4FJKA 1LW0A 3PUFA 4B9VA 3K59A 2YNIA 3LDSA 4FJ7A 3VQDA 4GVMA 4E3SA 4HTUA 3HPGA 3ITHA 1U04A 4F2RA 1TGOA 4F4KA 1RBSA 2X74A 1C1BA 2XO7A 3KK3A 1NK8A 3T3FA 4Q0BA 1TAUA 3TAMA 1WNSA 2HNDA 3NF6A 4CE9A 3QINA 3HT3A 4I2QA 3T1AA 2KW4A 4I9QA 4JS5A 3HP6A 3AVCA 1UAXA 4R5PA 2WONA 1U48A 4W5OA 2P51A 4CJTA 3SQ2A 2EX3A 3DOLA 2D0AA 1CZ9A 4H8KA 4CJWA 3AVMA 2XY7A 3C94A 3L8BA 3SPYA 1XHZA 5HRPA 1U4BA 3NH1A 1NK5A 4DSLA 1S1UA 1QSSA 2HHUA 4CFAA 1IKVA 4FCYA 3L2UA 3U3YA 1SKRA 1R0AA 3AO5A 4CF1A 1HQEA 2OZSA 1HYZA 1ZBHA 3OYBA 3IS9A 3NBPA 4DLEA 4UQGA 3SUNA 1NK9A 3MXMA 4FM0A 4LSNA 1S6PA 2EHGA 3HPHA 4Z0UA 1Q9YA 1B9DA 4G1QA 4OVLA 3AVKA 1ZBIA 4LH4A 3JSMA 4N76A 5D3GA 1D5AA 3ZSRA 3ZSVA 3RWUA 4FJXA 4Z4IA 1UA0A 4CF9A 4KHYA 2I5JA 4K8ZA 3V9SA 3TAGA 4DQRA 4DQPA 1XC9A 4F2SA 1JLFA 3AO1A 3VQCA 2IS3A 4WE1A 3NDKA 1KRPA 4I9LA 1WSGA 4B9SA 4CGFA 1C0TA 4Z4EA 4OGCA 1RBUA 3KK2A 4OLAA 2HHQA 3OYJA 4DTNA 1LAWA 2KQ2A 4IFYA 5C42A 4M3YA 2HB5A 3L2WA 3AVJA 2BDPA 4CJVA 1J5OA 2PYLA 4DS4A 1HPZA 4CJ3A 2XY5A 3P5JA 4DFJA 3AO3A 1S1VA 3HYFA 3QETA 4F8RA 1N5YA 2HHXA 4CEBA 3RMDA 4B9LA 1NK4A 1JLAA 2XY8A 4KREA 1T05A 4KHSA 4FJHA 1SV5A 4FLUA 4J2DA 4DTSA 1J53A 4CHYA 3MAQA 2OYQA 4YFUA 3HL8A 3QO9A 1I39A 4KHWA 3NF9A 3ZSZA 2YV0X 3L3UA 1LWEA 3QIOA 5HRRA 4CEEA 2Z1IA 4RG8A 1ZBLA 4DU3A 4TSXA 4OPJA 2OPSA 5C25A 2X6NA 3HXMA 4W5TA 3CM5A 4XIUA 2IC3A 1RT6A 4K8XA 3OYCA 4BDYA 4Z4FA 3AVGA 2OZMA 3ZT3A 3M8QA 4CJFA 2ZD1A 3VA0A 4EP4A 2KZZA 4BE1A 2YKNA 4Z4GA 2DFHA 3QIPA 2Z1HA 3QEWA 3V9ZA 3CQ8A 4OKJA 1JLCA 2YHBA 1L3TA 4E7HA 3S3MA 4I2PA 3LP3A 3KD5E 3DLRA 2G8IA 2WOMA 3VN5A 4ELVA 4IG3A 4O4GA 1DTQA 2W42A 5J2PA 1L3VA 4KB1A 4AHSA 4BE0A 3IG1A 4FVMA 4DTXA 1VRTA 3VQEA 4BE2A 1YT3A 4DFPA 1U45A 4CECA 3SV4A 1GOAA 3AVAA 1ASVA 2F96A 4CFDA 2PYJA 3TR8A 4RW4A 4CFBA 2GV9A 2G8UA 3QERA 3SQ1A 4NCAA 1HQUA 4KHUA 1S1XA 3I8DA 3RRGA 4H4OA 3QNNA 4KO0A 1KVBA 3BDPA 3NF7A 3TAEA 2BE2A 1EXQA 1TKXA 4FLZA 4FJJA 3K2PA 3AO4A 4E7JA 4E0DA 5J2MA 3NFAA 4ID5A 4LD0A 4CJKA 1T03A 3NGIA 1HYVA 1S1WA 3D0PA 1Q9XA 4PWDA 1BIZA 1ITGA 2YKMA 3L2RA 4CEOA 3SI6A 5HROA 3AO2A 1QE1A 3G10A 4CHZA 1A5WA 4BDZA 4KI4A 1Z25A 4FW2A 4KV8A 3RR8A 1JLGA 4FLVA 4Z4CA 4DSJA 2ETJA 3TANA 1HMVA 4OPKA 2IDOA 3S3OA 1FK9A 2LSNA 3V1OA 3B6PA 2X78A 3ZT4A 5SWMA 1FKOA 1KVAA 4LSLA 2B4JA 3SV3A 2G8FA 3BGRA 4IBNA 4DFKA 1VSKA 4DTUA 3I0RA 4DTJA 3ASMA 4KTZA 1BCOA 3NGZA 4J2BA 3LAMA 3HK2A 4F3TA 3K57A 4W5RA 1YTAA 3TARA 4MQ3A 4CGHA 1EP4A 3QEVA 1WSHA 3MXIA 3ZSOA 4KB0A 2FBYA 3WNHA 3MXJA 2RN2A 5JS2A 4CJUA 4FM2A 3PX4A 4KHNA 4ELTA 3L2VA 1NOZA 1BI4A 4RW8A 1W0HA 3O4NA 3ZT1A 1EX4A 2E4LA 4HVJA 1TKZA 2QKBA 5CY4A 4BWMA 2D5RA 1JL2A 3OYDA 3TI0A 4DF4A 3EY1A 3KLGA 4BACA 1U47A 1X9SA 1C1CA 1MU2A 4CESA 4N5SA 4E7KA 4AHRA 4KTWA 1NK7A 1WSIA 1L5UA 3DOKA 1A5XA 1WLJA 4PQUA 1SUQA 1WAJA 4PA1A 2XHBA 3QEIA 1C1AA 4M3RA 3OJSA 4KHQA 3FFIA 3NAEA 3QEPA 1NJYA 4ZHRA 1BISA 4M41A 3A2FA 3K58A 4M3XA 1NJZA 1WAFA 2ATQA 1NKEA 1RDAA 2E6LA 1X9MA 4N41A 1IKXA 4N56A 3MECA 4FLTA 3SYZA 4FYDA 3LANA 4CF2A 4E19A 3DRSA 1TKDA 3OYKA 2X6SA 1ZYQA 2HVIA 3VQAA 4CHNA 4CIGA 2FC0A 3VQ8A 3K5LA 3HM9A 3KIOA 1NK0A 4B9UA 3KKSA 3CFPA 1NKCA 4CJ4A 1RNHA 1DTTA 1KTQA 2HNZA 3DM2A 3C95A 1IO2A 3LPTA 5SZTA 3OS0A 3OYIA 1NJXA 3MEEA 3AVLA 2B5JA 3H08A 5E41A 4I7FA 1IH7A 4CGIA 4CIEA 3AA2A 2Y1IA 3V9UA 3VQPA 1D8YA 2HHTA 2ZQBA 4FXDA 1HYSA 4CF8A 2FBTA 4H4MA 4AILC 3VQBA 4FK4A 3S9HA 3OYGA 1BL3A 4O44A 1VSJA 4C8LA 1QSLA 1NK6A 3QLHA 3O3GA 1S6QA 5CYQA 1LV5A 3VQ7A 3NGYA 1XI1A 5FROA 3DYAA 4J2EA 5J2NA 3OYAA 5KI6A 3E01A 3SUOA 2P5GA 2O4IA 1BIUA 3M8PA 4NYNA 3WNGA 4CFCA 4CK3A 3V9WA 4BDPA 4KPYA 2VG7A 3VA3A 2B6AA 3VQ9A 3P83D 3CYMA 4FK0A 1XWLA 3B6OA 5EU7A 4CIFA 1TK8A 3HO1A 3MEDA 3PO4A 5CYMA 3C6UA 5DK5A 3V1RA 4C8KA 1RTDA 4B9MA 4LH5A 1TL1A 4HCBA 5KGWA 4M3WA 3NHGA 1TK0A 3ISNC 3RMBA 3SCXA 1IG9A 1HNVA 4CJRA 5C24A 5HRNA 3CFOA 4CJEA 2OA8A 4LY7A 4B8CA 4FK2A 3K5MA 1QHTA 4HUFA 1HRHA 1RBVA 2IOCA 3LP1A 3NCIA 4KI6A 3DI6A 4DTOA 3DLBA 4MFBA 4OKKA 2YNGA 3S3NA 3ZSXA 4FLWA 1NOYA 3K5OA 1ASWA 1RT5A 1B9FA 1BQNA 5CZ1A 3PV8A 3I0SA 1L3UA 3EZ5A 3KD1E 2OPPA 3RR7A 1IKYA 2XY6A 4ZTJA 4OKEA 2RPIA 4DQIA 4DWIA 4DQSA 4RW6A 1RBRA 2Z1JA 1YTUA 4B8AB 1SKWA 3DRPA 4FJIA 4AHUA 1ASUA 3L3VA 5K14A 4HUGA 1T8EA 1F21A 2QXFA 3DRRA 1WSJA 3M8RA 3TWHA 4FW1A 1LW2A 4JRQA 4C8OA 1JLBA 3THVA 4CJPA 4DF8A 4CEDA 1YVUA 1KFDA 1BQMA 3RRHA 1VSDA 2OPRA 3IAYA 3OYEA 4NCBA 2GBZA 3RMAA 2QK9A 1Q8IA 1CZBA 1RDBA 1O1WA 5HRSA 1UOCA 3WNFA 2G8KA 4N47A 4OJRA 2GUIA 3OYFA 3HVRA 1RBTA 1SL0A 3KTQA 3KLFA 4IFVA 4Y1DA 1WSFA 1D9DA 2AJQA 1ZBUA 4W5NA 3QNOA 2PY5A 5DMRA 5HBMA 4ID1A 4HUEA 3VQQA 1LWFA 3LALA 1VRUA 3NE6A 3U6FA 1EKEA 2RKIA 3EYZA 2BGGA 4EZ6A 3OY9A 2HMIA 1IKWA 4OGEA 3AV9A 1KVCA 3LZIA 4EZ9A 2FBXA 2G8VA 3PO5A 1BGXT 1QSYA 3V9XA 3KKRA 5JS1A 3QESA 4DMNA 2YNFA 2DFEA 2VWKA 1B92A 4GMJB 3PX6A 2KZMA 2OPQA 4RW9A 3LP2A 1EETA 2KTQA 3TAQA 4CK2A 3NH0A 1KCFA 4NCGA 4AHTA 1TV6A 1VSLA 3AVFA 3AA3A 3VQ5A 2Z1GA 4DU1A 3SQ0A 5J2QA 1UA1A 3NF8A 2BANA 4OLBA 2F8SA 3T19A 3KK1A 4B9TA 1WSEA 4AH9A 3SZ2A 1RDCA 3OYLA 3CFRA 4DSFA 2G8HA 1KLMA 1KFSA 1VSIA 2KFZA 4QAGA 3SUPA 3UIQA 3AA5X 4DQQA 3IRXA 1JLEA 4CF0A 3ZT0A 3V4IA 3ULDA 4DSIA 1SKSA 3O4QA 3CM6A 1QTMA 3RTVA 2DFFA 1C0MA 1REVA 3OS1A 3OYNA 1RT4A 4CHQA 4DTRA 4QCLA 4CERA 1DLOA 4CHOA 2IAJA 4YNQA 3L2QA 2XRIA 2KFNA 2O4GA 4J2AA 4E7LA 3ZSYA 1D9FA 2IGIA 3OS2A 3SPZA 1UWBA 4B3OA 3VQ6A 1BHLA 4ICLA 4PY5A 1J54A 3HPOA 4RW7A 2Q3SA 3O3FA 1I3AA 3DLEA 4KFBA 2ZE2A 4O55A 1X1PA 1RT3A 4AHCA 1VSMA 4CGDA 1TKTA 3OVNA 4W5QA 3LZJA 4DTPA 3LAKA 3V6DA 4FZZA 3AVBA 4O5BA 3P1GA 1L3SA 4B9NA 3TAFA 3LWLA 1FXXA 1U49A 2HNYA 3CG7A 4CEQA 3V81A 3HSTB 1S9GA 1RTJA 1RCHA 1BCMA 4DG1A 3O3HA 2VG6A 2P1JA 3D45A 4GW6A 4JLHA 4FJ9A 5FRMA 3AVHA 4KTQA 2DY4A 4FJNA 1LWCA 4M45A 1JL1A 4CJSA 4O0IA 1NKBA 3LP0A 2JLEA 2NUBA 3DLGA 4F3OA 5I3UA 2F8TA 3G0ZA 4FJ5A 4Q5VA 3OYMA 1W9HA 4FM1A 4DU4A 1RT2A 3AVIA 1RTHA 1JXEA 2RF2A 4CEZA 1CXQA 3KLEA 5J1EA 3K5NA 4FJMA 1ZBFA 3V1QA 1G15A 4PUOA 4CJ5A 4FLXA
chains in the Genus database with same CATH superfamily
5T7BA 3OW2M 4WYBA 3LWMA 4Y1CA 3SLCA 3O6WA 3UB5A 4M3ZA 3KVGA 4LF7K 2ASMA 3DMJA 3DAWA 2D4WA 3WNEA 4ELUA 1XHXA 2QKKA 3U9DA 4GKKK 5BR8K 2YNHA 4FJ8A 2GWJA 3CHWA 1IBKK 4HTLA 4BVPA 2HHSA 4HHTA 1BI4B 3D2FB 4E89A 2QM1A 2FBVA 4KKOA 1HR0K 3G4SN 4UY8O 5M1PA 4KH4A 3SQ4A 4CCHA 4CBUA 3MWPA 4CJLA 4B3MK 1CZAN 5HP1A 3HVTA 1Q86O 2G8WA 4C8MA 2JGUA 1HJRA 2F9WA 3T69A 2R7YA 3MN7A 3DLKA 3EE8A 3KJVA 2QXLA 2WTUA 4DFMA 1GOBA 4DSKA 2Y1JA 2YHAA 5FRNA 4IG0A 3VQ4A 3HP9A 5BREA 3GOIA 2A6AA 1SAZA 2QWQA 1JXBA 5HLFA 1K6YA 4FJKA 4GV9A 3BZKA 2YNIA 3LDSA 2ZJRL 2QWMA 3ENHA 4BGBA 3U9ZA 4HTUA 1RBSA 4JI4K 1NK8A 4CZFA 3CC7N 2KW4A 4JS5A 3HP6A 3ZX0A 2EX3A 3P31A 3VF2A 4JKBA 3C94A 5AQGA 1U4BA 1J6ZA 3NH1A 4DSLA 1QSSA 1N32K 4CFAA 3L2UA 4GV6A 4B1WB 1HQEA 2OZSA 4JK9A 3OYBA 5GAHP 4DLEA 4UQGA 3MXMA 1VHXA 2O8EA 1GLCG 2PAVA 4Z0UA 1XNRK 3JSMA 2QTDA 2QEXN 3TAGA 5BRHA 1XC9A 1X9JA 3H45C 1OH6A 3VQCA 4WE1A 1X3NA 1KRPA 3O1BA 4OGCA 4OLAA 2GX9A 2HHQA 1LAWA 2KQ2A 5C42A 4LFBK 3L2WA 2PYLA 3AVJA 5M1QA 1GLDG 4H0PA 3P5JA 3AO3A 1S1VA 3HYFA 2HHXA 4CEBA 1VQPN 1JLAA 2XY8A 4H5NA 4KHSA 4FJHA 1SV5A 1J53A 1NGJA 4YFUA 2O8DA 1EWRA 3QIOA 4CEEA 3J80O 4DU3A 4OPJA 2OPSA 3CCRN 2NRHA 4CZHA 3TU5A 1TUYA 4JKGB 4K8XA 4Z4FA 4DUYK 3AVGA 4DV3K 1HLUA 1VQNN 5BN9A 2E88A 1C0GA 3AGRA 2KZZA 3H1QA 3CCQN 5JLFA 3V9ZA 3QEWA 5AJ3K 4OKJA 1Q18A 2ASOA 4JD2A 4O4GA 4KB1A 4BE0A 1YT3A 4DFPA 1GOAA 2F96A 4CFDA 4RW4A 1N33K 1BA0A 4NCAA 3ZETA 3FZLA 4KHUA 1S1XA 4X66K 3RRGA 3QNNA 3MCAB 4KO0A 3BDPA 2BE2A 2Q97A 3R9PA 3AO4A 2WBNA 4E0DA 5J2MA 1Q9XA 3NGIA 3D0PA 3CCVN 4YOVA 2YKMA 1ITGA 2E2PA 4CEOA 3SI6A 3CIPA 5HROA 4JI2K 4DR6K 1Z25A 3RR8A 4DR5K 4JHDA 2DPNA 4FPAA 3S3OA 1FK9A 2LSNA 3SV3A 4F2RA 2B4JA 2G8FA 1VSKA 3CI5A 3I0RA 3ASMA 3NGZA 3VEVA 3FZFA 4BC2A 4F3TA 1N8RO 1QHAA 3TARA 4MQ3A 5M1NA 5JVGL 4I6MB 4CZKA 1WSHA 4KB0A 2FBYA 3UKRA 4FM2A 4ELTA 3H46O 4HVJA 3KK7A 1JL2A 1U47A 1C1CA 3BEXA 4QS7A 1WLJA 4PA1A 3SAHA 4JI3K 4ZHRA 3M3ZA 3CCJN 3K58A 3MDQA 1NJZA 1WAFA 2E6LA 1X9MA 5F0XA 4A61A 3TTDA 4DQ8A 1DKGD 3VQ8A 3CMAN 2E8AA 1NKCA 3G6EN 3DM2A 1IO2A 3LPTA 5SZTA 1IV0A 4I7FA 1IH7A 4CIEA 3EN9A 2QA4N 1K8AO 3E9OA 3LDOA 4LF8K 3OYGA 1BL3A 4BC4A 4JV5K 1XQSC 4J2EA 3OYAA 2WUSA 4AM6A 4NYNA 5AQXA 1DT9A 3CYMA 3B6OA 3HO1A 1YVNA 3BZCA 3PIOL 1RTDA 5KGWA 4WQ5C 3ISNC 4WQ4A 4CJEA 3K5MA 1MWKA 1HRHA 3NCIA 3HBTA 5GIOA 2UUBK 2O8FB 3ZSXA 1ASWA 2NNWA 1BQNA 3KD1E 2OPPA 3QMLA 2P9UA 4FO0A 4DQIA 4BGAA 1YTUA 3DXKA 3DRPA 1ASUA 4YORA 5K14A 1F21A 2E2OA 2QXFA 3DRRA 3M8RA 1LW2A 4C8OA 3Q7CA 5AQFA 1YVUA 4ILGB 3RRHA 4YHHK 3AY9A 4NCBA 4JKEA 2GBZA 3ID6A 4O5FA 1CZBA 5HRSA 4FPBA 4OJRA 2GUIA 1SL0A 3KTQA 4IO9L 2AJQA 2HBLA 1ZBUA 2PY5A 4FWNA 4BRQA 4ID1A 2QWNA 4JI6K 1K8KB 1VRUA 2HBMA 3U6FA 2NRRA 2RKIA 3VGLA 1ATNA 4BR2A 4H0VB 3ZLJA 1IKWA 3WXLA 3AV9A 2FBXA 1MA9B 4KHPK 5JS1A 1EO1A 4BC5A 2V7YA 3BF3A 2VWKA 4GMJB 2KZMA 3PX6A 3BF1A 3LDPA 3NH0A 4CZJA 4IDHA 3VQ5A 2Z1GA 3HI0A 2GEMA 1O13A 4OLBA 3MK6A 3FLCO 3GE1A 4B9TA 4JI5K 3OYLA 3RVCA 1KFSA 4HWIA 3UIQA 3AA5X 4DQQA 2YX6A 3JAMO 3V4IA 3O4QA 3CM6A 4C23A 1C0MA 3OYNA 4DTRA 4CERA 1DLOA 2XRIA 4B1UB 3G25A 3NVMA 1Y64A 4IJAA 2FSJA 3VQ6A 4ICLA 4K25A 4RW7A 5TKYA 3S3MA 1VSMA 1BA1A 3LZJA 4JKCA 4BRIA 3CCEN 3V6DA 3SMPA 3QFPA 1BU6O 3CG7A 3E1YA 3DLLL 4DR3K 1S9GA 1Z6RA 1RTJA 3C7NA 3JS6A 1BCMA 4DG1A 3O3HA 3QICA 4GW6A 3D45A 4FJ9A 3IUCA 3AVHA 3C0BA 4IOCL 4F3OA 2IVOA 1RT2A 3R6MA 2YCHA 4FL9A 1KAXA 1JXEA 2ZM6K 3K5NA 1CXQA 3KLEA 4FJMA 1YF5L 3V1QA 1G15A 4FLXA 2VWJA 1N6QA 4MLEA 3S41A 3M8SA 3ZSWA 3OTOK 1TL3A 5CZ2A 3ZSQA 1C0UA 5C10A 4JK8A 5AZJA 3ZEUB 1JLQA 4CEFA 1X9WA 4CI6A 3I33A 4X62K 3C6HA 5AQYA 4B08A 2E6MA 4A2BA 1TK5A 1VSFA 3TABA 3VESA 4M3TA 2QW9A 1SQKA 3D2EB 2A1SA 3ZCMA 3GBTA 2DTUA 3MCPA 1NGCA 1ATRA 3B8AX 4ZTFA 4L3QA 4LC9B 3O9SA 3FZMA 2Q0RA 3F73A 4LFAK 3EL2A 2HW3A 1SL1A 1RT7A 1K9MO 4FLYA 4KAZA 5KPTA 3THXA 3M1FA 3VTHA 3AA4A 1HNWK 4L8RB 4IXCA 5BPNA 2PZSA 3DLHA 5FDLA 4ILJA 1TAQA 2E2NA 3M5RA 5BPMA 2H3GX 1KAZA 2P9LB 4YDUC 5KRSA 3I55N 3SJJA 2VG5A 5JMVA 1C6VA 4BRMA 3KLHA 4IDKA 4JRPA 1G99A 4B9VA 4FJ7A 3SMSA 4XH4A 4GVMA 4E3SA 5AQHA 3HPGA 4K41A 4F4KA 1TGOA 2X74A 1C1BA 4FWLA 1WNSA 2HNDA 4CE9A 3QINA 2HMPA 3HT3A 2O8BA 1UAXA 2WFBA 4B1ZA 3SQ2A 2P51A 1VQON 3DOLA 2XY7A 1BG3A 3L8BA 5AQKA 4BR7A 5HRPA 4IOXA 1S1UA 4BR5A 3IS9A 3SUNA 3RSEB 3CF5L 4E1JA 4FM0A 3T1YK 1QZ6A 3DJCA 4JKDA 2EHGA 3HPHA 4G1QA 4DV5K 1ZBIA 4N76A 1D5AA 4FJXA 5AQIA 4CF9A 2I5JA 3O80A 4K8ZA 4B1YB 3PSFA 1HX1A 1E4FT 3NDKA 4BR4A 1Z05A 4B9SA 4CGFA 3WQTA 1ZXOA 3KK2A 4CZIA 3H6EA 4IFYA 3R1XA 4M3YA 1H1VA 1JCFA 3A5NC 4MDAA 1ILYA 1JJ2M 4AF1A 4ISFA 3RMDA 4B9LA 4F9OA 3KZBA 1T05A 1EQYA 4IZ9A 1NMDA 3HL8A 3QO9A 3ZSZA 2O8CA 3L3UA 1ZBLA 2Z1IA 2E1ZA 3F2KA 5FLXO 2X6NA 1OH8A 2UUCK 4BDYA 3WEEA 3ZT3A 4CJFA 2ZD1A 3VA0A 4EP4A 3ULEA 3OHRA 2YKNA 3OA9A 4Z4GA 2W6LA 5BR9A 1S22A 5LY3A 2HBJA 4E7HA 4I2PA 1QQMA 3KD5E 3DLRA 5J2PA 1DTQA 1L3VA 3IG1A 4FVMA 1BO5O 3DXMB 3AVAA 3O9TA 2W6KA 3TR8A 3NMUA 5AQNA 1HQUA 2P9SB 1KVBA 1YJ9N 3UKUB 3TAEA 1EXQA 3MWTA 4B9QA 2BTFA 3CERA 1QE1A 4CHZA 3A0IX 4FW2A 1JLGA 4FLVA 4DSJA 2ETJA 5SWMA 3ZT4A 4LSLA 3H1VX 4EHTA 5I9EB 3ENOA 4KH5A 1BCOA 3HK2A 4IO8A 1YTAA 4K42A 4JKGA 3MXIA 4LFCK 2RN2A 3EE9A 1QQNA 2GWKA 4WQ5A 4KHNA 1GLLO 1NOZA 4DR1K 1K73O 4RW8A 2OTJN 4NXMK 3SAGA 2E5LK 3KLGA 2ZWHA 1X9SA 5E84A 4N5SA 4BRGA 2NRXA 5LL6Z 1L5UA 4PQUA 1A5XA 1WAJA 3QEIA 1C1AA 3OJSA 3CCMN 4KHQA 2E20A 3FFIA 2HF4A 2ZGZA 3CD6N 4M41A 2W41A 1NKEA 5CHIA 1TUUA 1NNEA 2AP1A 4N41A 3P39A 2I7NA 3MECA 4N56A 3SYZA 4FYDA 4CF2A 4OPAA 1TKDA 1EWQA 4X64K 1ZYQA 2OANA 2HVIA 2QWPA 3K5LA 4FOIA 1NK0A 1TYQA 4M63C 1RNHA 1KTQA 2HNZA 4ISEA 3C95A 3EEQA 1NJXA 3I56N 2P9KB 5E41A 4CGIA 3VMFB 1DEJA 2FBTA 3VQBA 4DCHA 1NG9A 3WXJA 5FPMA 4FWSA 5F1XA 2HHHK 5AQOA 3VOVA 5BRDA 4OPHA 3NGYA 1XI1A 3HZ6A 3E01A 2P5GA 2O4IA 3WNGA 5AQSA 4CK3A 4LF4K 2B6AA 3D6RA 3VQ9A 3P83D 4FK0A 5TKWA 5EU7A 1NGEA 1TK8A 4H0XB 2IVNA 4C8KA 3ATVA 4B9MA 4LH5A 1WUAA 1TK0A 3RMBA 3SCXA 2AA4A 3AAPA 5C24A 2OA8A 4LY7A 4FK2A 3VEWA 4EAHD 3DI6A 3CQYA 2P9NA 3DLBA 2Q2RA 4OKKA 2YNGA 3S3NA 1NGFA 1RT5A 1B9FA 4GNIA 3HSCA 1HNXK 4ZTJA 1LCUA 3C6AA 5AR0A 4BG9A 1S72N 3CJ7A 1IBLK 4DWIA 2Z1JA 4B8AB 1SKWA 3WQUA 1GLEG 3TWHA 4FW1A 4JRQA 1HKBA 3VENA 4EIAA 1BQMA 1GLFO 3FR0A 5GINA 3OYEA 4A57A 3L6QA 5LJVA 3RMAA 1Q8IA 1RDBA 3P4IA 3T7ZA 1YIJN 3WNFA 2YI1A 3F5TA 3OYFA 1RBTA 3HVRA 2O8EB 4R79A 3KLFA 4Y1DA 2V52B 4HUEA 3VQQA 1LWFA 3PIPL 4BQZA 1VQ8N 2BGGA 4EZ6A 2HMIA 4OGEA 3FE1A 3V9XA 3KKRA 3SBTA 3HOTA 4X65K 4BRCA 3E66A 1B92A 2OPQA 4RW9A 4A5BA 3TAQA 4NCGA 3AGKA 1TV6A 3AVFA 4DU1A 2FXUA 1UA1A 1WBDA 3T19A 2OCEA 3KK1A 4AH9A 2KFZA 1VSIA 3SUPA 1NGIA 3VGMA 4CJ7A 2A42A 3IRXA 1M90O 3AAQA 2A40A 3ZT0A 3ULDA 2O8DB 4IFEA 3OS1A 1RT4A 2CGLA 1VQ4N 3WXMB 4YNQA 2O4GA 5AQVA 2IGIA 1UWBA 4AQYK 3HPOA 2HSTA 5AQMA 3O3FA 1X1PA 4AHCA 4DTPA 4CZMA 4JD2B 1YAGA 3R8EA 4B9NA 4KBOA 1FXXA 1U49A 3V81A 4CEQA 3TSPA 3HSTB 3H3NO 5M1FA 3ZETB 4YDUA 2VG6A 2P1JA 5GAEP 4JLHA 5FRMA 1OVYA 5H1SQ 2DY4A 1N34K 1LWCA 4M45A 4O0IA 1NKBA 5I3UA 3G0ZA 1NM1A 1W9HA 4DU4A 1NJIO 2NRVA 3I8BA 4O8UA 5J1EA 4CJ5A 5KGXA 3OYHA 1VQ7N 1JKHA 2QWRA 4RWTA 1TVRA 4BRLA 3ALYA 4FZXC 1T7PA 3LPUA 1U6ZA 4NYFA 2GTDA 2D0CA 1S1TA 2HHVA 1A5VA 3SNNA 2HHWA 4BWJA 4M3UA 4JKAA 4PL8A 3ZT2A 3QBWA 3UKRB 4JKHA 4YOUA 5KTQA 4JI0K 3O9UA 1Y97A 5AQWA 4EP5A 2ITGA 1NJWA 3U3GA 4BY9C 3C6TA 4O0JA 3OJUA 4JS4A 2D0BA 1RILA 4IKFA 1GOCA 1CLQA 1XUPO 1WN7A 5KRTA 3GG4A 3LDQA 3CC2N 1VQMN 4HCCA 1W97L 3JYTA 1VSEA 1SL2A 3IDHA 1YHQN 1RT1A 1NGHA 1Z26A 4JI1K 4E1NA 2HVHA 1CXUA 3PX0A 4AHVA 1GLBG 2YHXA 3MEGA 3SUQA 4B3TK 1QQCA 1VK0A 4BRFA 3QEXA 2NRZA 4FWKA 4C8NA 2YHWA 5AZIA 1LW0A 4JI7K 3VQDA 3FFKB 3SJHA 2XO7A 3T3FA 3TAMA 5AFUH 4CZEA 3J7ZO 3T1AA 4I9QA 3THYA 4DKWA 3UE5A 2PBDA 1U48A 2UUAK 2D0AA 1CZ9A 4H8KA 4CJWA 3AVMA 3SAFA 1VQ5N 1XHZA 1NK5A 5LJWA 3CCUN 2HHUA 1IKVA 4FCYA 1R0AA 4DR7K 1HYZA 2F7TA 3CPWM 3N4PA 3LDNA 4LSNA 1S6PA 2P9PA 4BRHA 5EX5A 5D3GA 3ZSRA 4Z4IA 3RWUA 2JWLA 4KHYA 4MO5A 2P9UB 4DQRA 4DQPA 4F2SA 1JLFA 2RE2A 3AO1A 5AQQA 2IS3A 3DXKB 4I9LA 1WSGA 3CJ9A 3EO3A 5B8HA 4H0OA 5KQDA 4DTNA 4J8FA 3J7AP 2HB5A 1KC8O 2BDPA 4A5AA 4DS4A 2XY5A 4DFJA 3QETA 3HTVA 1QZ5A 4BR0A 3L0QA 4JN4A 4KREA 4H5VA 4FLUA 4DTSA 4CHYA 2OYQA 2JWKA 4BVOA 4KHWA 4CZLA 2CGJA 4TSXA 4FWOA 2F9TA 5C25A 4W5TA 5BRFA 3CM5A 3OYCA 5FPNA 1VQ6N 3WXKA 4BE1A 3O9QA 4JK7A 2DFHA 3QIPA 2Z1HA 3BP8A 3CQ8A 2RHKA 4CD3A 4RCHA 4DUZK 1NU0A 4CBXA 1L3TA 3VN5A 4ELVA 2W42A 2ZGYA 4AHSA 1VRTA 3VQEA 1U45A 3U8XA 3SV4A 1ASVA 3A8YA 5AQPA 4A62A 2GV9A 4CFBA 2G8UA 1U2VA 3QERA 3SQ1A 4K43A 3A5LC 1NGDA 1V4SA 3NF7A 1TKXA 4YOTA 2ITMA 1Q82O 2QI2A 4B3SK 3K2PA 3O4WA 4E7JA 3NFAA 1NGGA 4ID5A 1T03A 4PWDA 2P9IB 1BIZA 3L2RA 1SS6A 4BDZA 3TSUA 3TPQA 5JLHA 1T44A 3LM2A 1QVGM 4Z4CA 4LF9K 4WFAL 1HMVA 4OPKA 3CQXA 2IDOA 3V1OA 2X78A 1FKOA 3QBXA 3BGRA 3MN9A 3FZKA 4DTJA 2CGKA 4J2BA 3CC4N 2UXDK 4W5RA 4CGHA 1EP4A 3J81O 3QEVA 4IEIA 1VQLN 4PKHA 4CJUA 3PX4A 3L2VA 3K0SA 4WCEL 3C7NB 1BI4A 3D2FA 1W0HA 3O4NA 1EX4A 2E4LA 2QKBA 1ATSA 4BWMA 3TI0A 3EY1A 4E7KA 2KHOA 2BH1A 4BC3A 1NK7A 2ASPA 3VGKA 3CJCA 3DOKA 4NB4A 4JEPA 1SUQA 1D4XA 3CPEA 1NJYA 1BISA 1LOTB 3A2FA 3U4LA 4A2AA 2VQEK 4K0KK 2VGMA 3A5OC 4E19A 2A3ZA 4YOYA 3N4QA 3VQAA 1VQKN 4B9UA 3HM9A 4IWVA 4CJ4A 5AZJB 1DTTA 3OS0A 4GV3A 3OYIA 5ADXH 2B5JA 3H08A 3AA2A 3H3OB 3VQPA 3THWB 3HRGA 2HHTA 2ZQBA 1HYSA 2FSKA 4AILC 4FK4A 3S9HA 4O44A 5HL7L 1NK6A 3QLHA 1S6QA 5CYQA 3VQ7A 5FROA 3DYAA 3GL1A 3VEZA 5J2NA 3SUOA 5KI6A 3M8PA 4CFCA 4BDPA 4KPYA 2KLAA 5C2DA 3VA3A 3IMXA 1YI2N 4CIFA 1FJGK 3KWIA 2E2QA 1E4GT 3MEDA 3PO4A 5CYMA 3VEYA 5DK5A 3V1RA 4AM7A 1N36K 1TL1A 4U67L 4M3WA 5JICA 3NHGA 1IG9A 1HNVA 4CJRA 1OH5A 3DWLA 4KH6A 1RGIA 5ELZA 1KD1O 1RBVA 2IOCA 4H5WA 4DTOA 4MFBA 3T1HK 4FLWA 1NOYA 1ZBSA 4BROA 3W3DA 1Q7YO 3K5OA 4QOZB 5CZ1A 1OKJA 3RR7A 3EKSA 1IKYA 4H5RA 3Q7BA 4OKEA 4NXNK 1RBRA 2P9KA 4FJIA 2O8BB 4B3RK 1T8EA 1P8ZA 4M7XA 1JLBA 3THVA 4CJPA 4DF8A 1M1KO 5M1KA 3P38A 1KFDA 1T3VA 1VSDA 3IAYA 4DV4K 2QK9A 2GELA 3VTIA 2G8KA 4DB3A 3VEXA 4IFVA 1V4TA 1WOQA 1WSFA 1SZ2A 1D9DA 4C1NI 1QVFM 4JYAK 2YJEA 5HBMA 3LALA 3NE6A 1EKEA 5IT9O 3EYZA 2A5XA 1E3MA 4DR4K 4EZ9A 2G8VA 3K9KA 3PO5A 1QSYA 3EKUA 3QESA 5EOYA 3VERA 4H03B 4DMNA 4BG8A 2DFEA 5LMNK 3ATUA 1KCFA 4AHTA 4H0YB 1VSLA 1WBBA 4FWPA 1YUWA 3NF8A 2BANA 3TTFA 1QQOA 1WSEA 2WC9A 3MX2A 1RDCA 3CFRA 3VPZA 1JLEA 4CF0A 3FGUA 3RTVA 2DFFA 1RDUA 1JCGA 1REVA 4YY3K 2O8CB 1RFQA 4J2AA 4XH1A 4E7LA 3WEEB 3SPZA 4B3OA 3ENBA 4PKGA 4PL7A 3ULEB 4PY5A 1NGAA 2FLOA 2Q3SA 1I3AA 1XC3A 3DLEA 3EZWA 5EY4A 2NZTA 1TKTA 1BUPA 1HKGA 3W0LA 3AVBA 4CD1A 4I6MA 5AQRA 1NWKA 4V19S 1NGBA 4NLCA 5AFUA 1I94K 1BWFO 1NBWA 5FPEA 3E9LA 4U7BA 4KTQA 1JL1A 4CJSA 3LP0A 2JLEA 2F8TA 3DLGA 4Q5VA 4FM1A 5A2QO 5CR4A 4OX9K 2RF2A 4CEZA 2F4VK 4Z94A 5KQ8A 1KLNA 5F2RA 4KRFA 3MN5A 2P5OA 1BDGA 4DV1K 3WUHA 1RDDA 3MMVA 2VQFK 2NLXA 1VSHA 3NVKA 1KSPA 4CGGA 4WF9L 5MLCQ 4CEAA 4G9ZA 3E9PA 3MN6A 3ZX3A 4FOEA 4CGJA 4CJQA 1S9EA 1J9AA 4E1MA 4Z4HA 4JI8K 5GAGP 1KQSM 3CCSN 4FZYA 4IEEA 2EWSA 4RTFD 3TAPA 3PY8A 2UU9K 2A41A 4E7IA 4DS5A 3F9KA 3NH2A 1QS4A 1RTIA 4DTMA 2YHYA 4DSEA 4M42A 5I42A 1S5JA 1KXPA 1HNIA 4FJLA 4BR9A 1TYQB 3KLIA 4CK1A 1FKPA 3J7YP 4DR2K 4FJGA 4CHPA 4DLGA 4CBWA 1LAVA 2NRTA 3AVNA 3RMCA 2YJFA 2O8FA 2A1RA 4YOXA 3PUFA 5KPRA 3K59A 1YJNN 3ID8A 4MDBA 3ITHA 1U04A 3KK3A 1TAUA 4Q0BA 1HKCA 3NF6A 4I2QA 4BRPA 4NO7A 2W40A 3AVCA 4R5PA 2WONA 1VAZA 4W5OA 4CJTA 4DV2K 3SPYA 3GDQA 3JXUA 5JVHL 2UXCK 3U3YA 1SKRA 3AARA 3AO5A 4CF1A 1ZBHA 3NBPA 1NK9A 1S3XA 2KKZA 1XMOK 1Q9YA 3CJ1A 1B9DA 2P9NB 1IBMK 4OVLA 3AVKA 3C65A 1K8KA 5KPZA 4LH4A 3CXCM 3ZSVA 3O8MA 1UA0A 1R59O 3V9SA 4FWRA 3SK3A 3G71N 5BN8A 1WB9A 5C12A 2PFUA 4Z4EA 1C0TA 1RBUA 3OYJA 5DM6L 4CJVA 1J5OA 4B1XB 3KWGA 1HPZA 4CJ3A 1BOTO 4WFBL 4EHUA 4F8RA 3MX5A 1N5YA 1NK4A 2NRWA 4JHDB 5C2FA 4DHYA 4J2DA 3MAQA 1I39A 3NF9A 2YV0X 1YXQA 1LWEA 5HRRA 4RG8A 3HXMA 2ZJQL 4XIUA 2IC3A 1RT6A 5M1OA 2OZMA 3M8QA 5ADXA 4EFHA 4BRDA 3TTCA 1JLCA 2YHBA 2FF3B 3WXIA 2G8IA 4BRAA 3LP3A 2WOMA 1IJJA 4IG3A 4DTXA 5AQLA 4BE2A 3HM8A 4CECA 2VCPA 2PYJA 3FZHA 3I8DA 5HOOA 4H4OA 3CJAA 5FPDA 1MDUB 3LDLA 4FLZA 4NLBA 1OH7A 4FJJA 4GVEA 4ILHA 4LD0A 4CJKA 3PLAA 1HYVA 1S1WA 5GIPA 3LM9A 3O08A 3AO2A 4KI4A 3G10A 1C0FA 1A5WA 4KV8A 1YITN 4GKJK 3TANA 2I7PA 3B6PA 1KVAA 4IBNA 4DFKA 2UYTA 3QDKA 4DTUA 4LF5K 5BPLA 2QWOA 4KTZA 2OTLN 3LAMA 4A59A 3K57A 4CVNE 4C1NK 3O5BA 3R3LA 3ZEUA 5IWAK 3ZSOA 3M6GA 3WNHA 3MXJA 5JS2A 3VF4A 3QB0A 4BQLA 4ISGA 5LMUK 1FW6A 3ZT1A 1TKZA 5CY4A 4QS9A 2D5RA 3OYDA 4DF4A 5EXWA 3KHYA 3O1WA 4BACA 1MU2A 4CESA 5AQJA 3D2EA 4AHRA 4KTWA 1WSIA 2VYPA 3BUZB 2XHBA 4M3RA 1RDWX 4PKIA 3NAEA 3QEPA 2BUPA 3IKMA 4M3XA 4YOWA 2ATQA 4DV6K 2QWLA 1RDAA 1DGKN 3QFUA 1IKXA 2VWBA 4FLTA 3CMEN 1IG8A 3LANA 4DV7K 4JAXA 3DRSA 3OYKA 2X6SA 2P9IA 4CHNA 4CIGA 3F9MA 2FC0A 1Q81O 3KIOA 3CETA 3KKSA 3CFPA 2P9LA 3O9RA 4BREA 2IIRA 3HJFA 5CE3A 3MEEA 3AVLA 2E1YA 2CH5A 2VGNA 4OO1J 4JNEA 4DV0K 3V9UA 2Y1IA 1D8YA 3CJBA 4FXDA 2FF6A 4H5TA 4CF8A 4LF6K 4H4MA 3ZX2A 1VSJA 4WFNL 4C8LA 1QSLA 3L4IA 3O3GA 4GY2B 1LV5A 4IJNA 3CCLN 4B1VA 1BIUA 3V9WA 1HPMA 2VG7A 1XWLA 2Q1NA 2IVPA 3WT0A 3C6UA 2Q36A 4HCBA 1W7AA 3VETA 5AQZA 2Q0UA 4Y0WA 5HRNA 3CFOA 3RSEA 2D0PA 5AQUA 4B8CA 3J8AA 1QHTA 4HUFA 1J5EK 3LP1A 4KI6A 3BY5A 3ZYYX 4JKFA 1HUXA 5EVZA 4PHTX 5AZIB 3PV8A 1L3UA 3I0SA 3EZ5A 3TSQA 2XY6A 3K9JA 1T6CA 4MO4A 2RPIA 1OVQA 4DQSA 4RW6A 1GLJO 4AHUA 3L3VA 3THYB 4HUGA 3THWA 1WSJA 4CEDA 4XEIA 2V51B 1XMQK 2OPRA 2HBKA 4FWMA 5DM7L 1JCEA 1O1WA 1X3MA 1UOCA 4MLHA 4IOAL 2UXBK 4N47A 4BRKA 2P9PB 3L4QA 4W5NA 3OBYA 3QNOA 5DMRA 1GLAG 4BRNA 3OBWA 2ZF5O 3OY9A 4FVUA 1YJWN 1KVCA 3LZIA 2D0OA 1BGXT 3LL3A 2YNFA 1HJOA 1T6DA 3LP2A 1EETA 2KTQA 4FWQA 4CK2A 4XH5A 3DXMA 1P90A 3HOSA 2V7ZA 3D7EO 1KAYA 3AA3A 1VQ9N 3SQ0A 5J2QA 4WQ4C 2F8SA 5GADP 2P9SA 3UKUA 3SZ2A 4DSFA 2G8HA 5C0YA 1KLMA 4QAGA 3VF6A 4DSIA 1SKSA 2CH6A 1QTMA 2J4RA 3IFRA 1ESVA 1NLVA 4CHQA 4QCLA 4CHOA 2IAJA 3PSIA 3L2QA 2KFNA 1MWMA 3ZSYA 1D9FA 2HOEA 3OS2A 2GUPA 4CW7B 1BHLA 1J54A 4H0TB 4KFBA 2ZE2A 4O55A 4CGDA 1RT3A 4W5QA 3OVNA 3LAKA 4FZZA 4O5BA 3P1GA 1L3SA 1W2BM 4M7YA 3TAFA 3LWLA 4O8KA 5AQTA 2HNYA 5E26A 1U2VB 1RCHA 2Q31A 4QS8A 3VEOA 4FSVA 1HNZK 4FJNA 5C15A 3SBGA 2ZJPL 2NUBA 4FJ5A 2D1KA 3THXB 3A5MC 3OYMA 2HF3A 1NMNA 3AVIA 1RTHA 1ZC6A 2FSNA 4CZGA 1XNQK 4PUOA 1ZBFA
chains in the Genus database with same CATH topology
2VWJA 1KLNA 5KGXA 5T7BA 1N6QA 3OYHA 3LWMA 4Y1CA 4KRFA 1JKHA 3M8SA 4M3ZA 3ZSWA 3DMJA 2P5OA 1TVRA 1RDDA 1TL3A 3ALYA 4FZXC 5CZ2A 3WNEA 3LPUA 3ZSQA 1VSHA 1T7PA 4ELUA 1XHXA 4NYFA 1C0UA 1KSPA 4CGGA 2QKKA 2D0CA 1S1TA 2HHVA 1A5VA 3SNNA 2HHWA 4BWJA 4M3UA 2YNHA 3ZT2A 4FJ8A 4CEAA 2HHSA 1JLQA 4CEFA 1X9WA 4HHTA 1BI4B 5KTQA 4CGJA 4B08A 4CJQA 4E89A 2E6MA 1Y97A 1S9EA 1VSFA 2FBVA 2ITGA 4KKOA 4EP5A 1NJWA 1TK5A 3U3GA 3TABA 3C6TA 1J9AA 4O0JA 3OJUA 4M3TA 3ZCMA 2A1SA 4JS4A 2D0BA 3SQ4A 4CCHA 1RILA 4E1MA 4Z4HA 4CJLA 2DTUA 4FZYA 4IKFA 1GOCA 1CLQA 1WN7A 4ZTFA 5KRTA 5HP1A 3HVTA 2G8WA 4C8MA 4HCCA 3TAPA 3JYTA 1VSEA 2JGUA 1SL2A 3PY8A 4QOZB 3F73A 4E7IA 4DS5A 1HJRA 2HW3A 1SL1A 1RT7A 3F9KA 3NH2A 1QS4A 1RT1A 1RTIA 1Z26A 4FLYA 2R7YA 4DTMA 4KAZA 4DSEA 4E1NA 3DLKA 3AA4A 1S5JA 3KJVA 5I42A 4M42A 2HVHA 1CXUA 4DFMA 1HNIA 3PX0A 1GOBA 4AHVA 4L8RB 2PZSA 3MEGA 4DSKA 3DLHA 2Y1JA 2YHAA 5FDLA 3SUQA 4FJLA 1TAQA 1QQCA 3KLIA 5FRNA 1VK0A 4IG0A 3VQ4A 3HP9A 4CK1A 5KRSA 3QEXA 1FKPA 3SJJA 2VG5A 4FJGA 4C8NA 1C6VA 3HJFA 3KLHA 4CHPA 4DLGA 4IDKA 1LAVA 3AVNA 1JXBA 4JRPA 1K6YA 3RMCA 5HLFA 2A1RA 4FJKA 1LW0A 3PUFA 4B9VA 3K59A 2YNIA 3LDSA 4FJ7A 3VQDA 4GVMA 4E3SA 4HTUA 3HPGA 3ITHA 1U04A 4F2RA 1TGOA 4F4KA 1RBSA 2X74A 1C1BA 2XO7A 3KK3A 1NK8A 3T3FA 4Q0BA 1TAUA 3TAMA 1WNSA 2HNDA 3NF6A 4CE9A 3QINA 3HT3A 4I2QA 3T1AA 2KW4A 4I9QA 4JS5A 3HP6A 3AVCA 1UAXA 4R5PA 2WONA 1U48A 4W5OA 2P51A 4CJTA 3SQ2A 2EX3A 3DOLA 2D0AA 1CZ9A 4H8KA 4CJWA 3AVMA 2XY7A 3C94A 3L8BA 3SPYA 1XHZA 5HRPA 1U4BA 3NH1A 1NK5A 4DSLA 1S1UA 1QSSA 2HHUA 4CFAA 1IKVA 4FCYA 3L2UA 3U3YA 1SKRA 1R0AA 3AO5A 4CF1A 1HQEA 2OZSA 1HYZA 1ZBHA 3OYBA 3IS9A 3NBPA 4DLEA 4UQGA 3SUNA 1NK9A 3MXMA 4FM0A 4LSNA 1S6PA 2EHGA 3HPHA 4Z0UA 1Q9YA 1B9DA 4G1QA 4OVLA 3AVKA 1ZBIA 4LH4A 3JSMA 4N76A 5D3GA 1D5AA 3ZSRA 3ZSVA 3RWUA 4FJXA 4Z4IA 1UA0A 4CF9A 4KHYA 2I5JA 4K8ZA 3V9SA 3TAGA 4DQRA 4DQPA 1XC9A 4F2SA 1JLFA 3AO1A 3VQCA 2IS3A 4WE1A 3NDKA 1KRPA 4I9LA 1WSGA 4B9SA 4CGFA 1C0TA 4Z4EA 4OGCA 1RBUA 3KK2A 4OLAA 2HHQA 3OYJA 4DTNA 1LAWA 2KQ2A 4IFYA 5C42A 4M3YA 2HB5A 3L2WA 3AVJA 2BDPA 4CJVA 1J5OA 2PYLA 4DS4A 1HPZA 4CJ3A 2XY5A 3P5JA 4DFJA 3AO3A 1S1VA 3HYFA 3QETA 4F8RA 1N5YA 2HHXA 4CEBA 3RMDA 4B9LA 1NK4A 1JLAA 2XY8A 4KREA 1T05A 4KHSA 4FJHA 1SV5A 4FLUA 4J2DA 4DTSA 1J53A 4CHYA 3MAQA 2OYQA 4YFUA 3HL8A 3QO9A 1I39A 4KHWA 3NF9A 3ZSZA 2YV0X 3L3UA 1LWEA 3QIOA 5HRRA 4CEEA 2Z1IA 4RG8A 1ZBLA 4DU3A 4TSXA 4OPJA 2OPSA 5C25A 2X6NA 3HXMA 4W5TA 3CM5A 4XIUA 2IC3A 1RT6A 4K8XA 3OYCA 4BDYA 4Z4FA 3AVGA 2OZMA 3ZT3A 3M8QA 4CJFA 2ZD1A 3VA0A 4EP4A 2KZZA 4BE1A 2YKNA 4Z4GA 2DFHA 3QIPA 2Z1HA 3QEWA 3V9ZA 3CQ8A 4OKJA 1JLCA 2YHBA 1L3TA 4E7HA 3S3MA 4I2PA 3LP3A 3KD5E 3DLRA 2G8IA 2WOMA 3VN5A 4ELVA 4IG3A 4O4GA 1DTQA 2W42A 5J2PA 1L3VA 4KB1A 4AHSA 4BE0A 3IG1A 4FVMA 4DTXA 1VRTA 3VQEA 4BE2A 1YT3A 4DFPA 1U45A 4CECA 3SV4A 1GOAA 3AVAA 1ASVA 2F96A 4CFDA 2PYJA 3TR8A 4RW4A 4CFBA 2GV9A 2G8UA 3QERA 3SQ1A 4NCAA 1HQUA 4KHUA 1S1XA 3I8DA 3RRGA 4H4OA 3QNNA 4KO0A 1KVBA 3BDPA 3NF7A 3TAEA 2BE2A 1EXQA 1TKXA 4FLZA 4FJJA 3K2PA 3AO4A 4E7JA 4E0DA 5J2MA 3NFAA 4ID5A 4LD0A 4CJKA 1T03A 3NGIA 1HYVA 1S1WA 3D0PA 1Q9XA 4PWDA 1BIZA 1ITGA 2YKMA 3L2RA 4CEOA 3SI6A 5HROA 3AO2A 1QE1A 3G10A 4CHZA 1A5WA 4BDZA 4KI4A 1Z25A 4FW2A 4KV8A 3RR8A 1JLGA 4FLVA 4Z4CA 4DSJA 2ETJA 3TANA 1HMVA 4OPKA 2IDOA 3S3OA 1FK9A 2LSNA 3V1OA 3B6PA 2X78A 3ZT4A 5SWMA 1FKOA 1KVAA 4LSLA 2B4JA 3SV3A 2G8FA 3BGRA 4IBNA 4DFKA 1VSKA 4DTUA 3I0RA 4DTJA 3ASMA 4KTZA 1BCOA 3NGZA 4J2BA 3LAMA 3HK2A 4F3TA 3K57A 4W5RA 1YTAA 3TARA 4MQ3A 4CGHA 1EP4A 3QEVA 1WSHA 3MXIA 3ZSOA 4KB0A 2FBYA 3WNHA 3MXJA 2RN2A 5JS2A 4CJUA 4FM2A 3PX4A 4KHNA 4ELTA 3L2VA 1NOZA 1BI4A 4RW8A 1W0HA 3O4NA 3ZT1A 1EX4A 2E4LA 4HVJA 1TKZA 2QKBA 5CY4A 4BWMA 2D5RA 1JL2A 3OYDA 3TI0A 4DF4A 3EY1A 3KLGA 4BACA 1U47A 1X9SA 1C1CA 1MU2A 4CESA 4N5SA 4E7KA 4AHRA 4KTWA 1NK7A 1WSIA 1L5UA 3DOKA 1A5XA 1WLJA 4PQUA 1SUQA 1WAJA 4PA1A 2XHBA 3QEIA 1C1AA 4M3RA 3OJSA 4KHQA 3FFIA 3NAEA 3QEPA 1NJYA 4ZHRA 1BISA 4M41A 3A2FA 3K58A 4M3XA 1NJZA 1WAFA 2ATQA 1NKEA 1RDAA 2E6LA 1X9MA 4N41A 1IKXA 4N56A 3MECA 4FLTA 3SYZA 4FYDA 3LANA 4CF2A 4E19A 3DRSA 1TKDA 3OYKA 2X6SA 1ZYQA 2HVIA 3VQAA 4CHNA 4CIGA 2FC0A 3VQ8A 3K5LA 3HM9A 3KIOA 1NK0A 4B9UA 3KKSA 3CFPA 1NKCA 4CJ4A 1RNHA 1DTTA 1KTQA 2HNZA 3DM2A 3C95A 1IO2A 3LPTA 5SZTA 3OS0A 3OYIA 1NJXA 3MEEA 3AVLA 2B5JA 3H08A 5E41A 4I7FA 1IH7A 4CGIA 4CIEA 3AA2A 2Y1IA 3V9UA 3VQPA 1D8YA 2HHTA 2ZQBA 4FXDA 1HYSA 4CF8A 2FBTA 4H4MA 4AILC 3VQBA 4FK4A 3S9HA 3OYGA 1BL3A 4O44A 1VSJA 4C8LA 1QSLA 1NK6A 3QLHA 3O3GA 1S6QA 5CYQA 1LV5A 3VQ7A 3NGYA 1XI1A 5FROA 3DYAA 4J2EA 5J2NA 3OYAA 5KI6A 3E01A 3SUOA 2P5GA 2O4IA 1BIUA 3M8PA 4NYNA 3WNGA 4CFCA 4CK3A 3V9WA 4BDPA 4KPYA 2VG7A 3VA3A 2B6AA 3VQ9A 3P83D 3CYMA 4FK0A 1XWLA 3B6OA 5EU7A 4CIFA 1TK8A 3HO1A 3MEDA 3PO4A 5CYMA 3C6UA 5DK5A 3V1RA 4C8KA 1RTDA 4B9MA 4LH5A 1TL1A 4HCBA 5KGWA 4M3WA 3NHGA 1TK0A 3ISNC 3RMBA 3SCXA 1IG9A 1HNVA 4CJRA 5C24A 5HRNA 3CFOA 4CJEA 2OA8A 4LY7A 4B8CA 4FK2A 3K5MA 1QHTA 4HUFA 1HRHA 1RBVA 2IOCA 3LP1A 3NCIA 4KI6A 3DI6A 4DTOA 3DLBA 4MFBA 4OKKA 2YNGA 3S3NA 3ZSXA 4FLWA 1NOYA 3K5OA 1ASWA 1RT5A 1B9FA 1BQNA 5CZ1A 3PV8A 3I0SA 1L3UA 3EZ5A 3KD1E 2OPPA 3RR7A 1IKYA 2XY6A 4ZTJA 4OKEA 2RPIA 4DQIA 4DWIA 4DQSA 4RW6A 1RBRA 2Z1JA 1YTUA 4B8AB 1SKWA 3DRPA 4FJIA 4AHUA 1ASUA 3L3VA 5K14A 4HUGA 1T8EA 1F21A 2QXFA 3DRRA 1WSJA 3M8RA 3TWHA 4FW1A 1LW2A 4JRQA 4C8OA 1JLBA 3THVA 4CJPA 4DF8A 4CEDA 1YVUA 1KFDA 1BQMA 3RRHA 1VSDA 2OPRA 3IAYA 3OYEA 4NCBA 2GBZA 3RMAA 2QK9A 1Q8IA 1CZBA 1RDBA 1O1WA 5HRSA 1UOCA 3WNFA 2G8KA 4N47A 4OJRA 2GUIA 3OYFA 3HVRA 1RBTA 1SL0A 3KTQA 3KLFA 4IFVA 4Y1DA 1WSFA 1D9DA 2AJQA 1ZBUA 4W5NA 3QNOA 2PY5A 5DMRA 5HBMA 4ID1A 4HUEA 3VQQA 1LWFA 3LALA 1VRUA 3NE6A 3U6FA 1EKEA 2RKIA 3EYZA 2BGGA 4EZ6A 3OY9A 2HMIA 1IKWA 4OGEA 3AV9A 1KVCA 3LZIA 4EZ9A 2FBXA 2G8VA 3PO5A 1BGXT 1QSYA 3V9XA 3KKRA 5JS1A 3QESA 4DMNA 2YNFA 2DFEA 2VWKA 1B92A 4GMJB 3PX6A 2KZMA 2OPQA 4RW9A 3LP2A 1EETA 2KTQA 3TAQA 4CK2A 3NH0A 1KCFA 4NCGA 4AHTA 1TV6A 1VSLA 3AVFA 3AA3A 3VQ5A 2Z1GA 4DU1A 3SQ0A 5J2QA 1UA1A 3NF8A 2BANA 4OLBA 2F8SA 3T19A 3KK1A 4B9TA 1WSEA 4AH9A 3SZ2A 1RDCA 3OYLA 3CFRA 4DSFA 2G8HA 1KLMA 1KFSA 1VSIA 2KFZA 4QAGA 3SUPA 3UIQA 3AA5X 4DQQA 3IRXA 1JLEA 4CF0A 3ZT0A 3V4IA 3ULDA 4DSIA 1SKSA 3O4QA 3CM6A 1QTMA 3RTVA 2DFFA 1C0MA 1REVA 3OS1A 3OYNA 1RT4A 4CHQA 4DTRA 4QCLA 4CERA 1DLOA 4CHOA 2IAJA 4YNQA 3L2QA 2XRIA 2KFNA 2O4GA 4J2AA 4E7LA 3ZSYA 1D9FA 2IGIA 3OS2A 3SPZA 1UWBA 4B3OA 3VQ6A 1BHLA 4ICLA 4PY5A 1J54A 3HPOA 4RW7A 2Q3SA 3O3FA 1I3AA 3DLEA 4KFBA 2ZE2A 4O55A 1X1PA 1RT3A 4AHCA 1VSMA 4CGDA 1TKTA 3OVNA 4W5QA 3LZJA 4DTPA 3LAKA 3V6DA 4FZZA 3AVBA 4O5BA 3P1GA 1L3SA 4B9NA 3TAFA 3LWLA 1FXXA 1U49A 2HNYA 3CG7A 4CEQA 3V81A 3HSTB 1S9GA 1RTJA 1RCHA 1BCMA 4DG1A 3O3HA 2VG6A 2P1JA 3D45A 4GW6A 4JLHA 4FJ9A 5FRMA 3AVHA 4KTQA 2DY4A 4FJNA 1LWCA 4M45A 1JL1A 4CJSA 4O0IA 1NKBA 3LP0A 2JLEA 2NUBA 3DLGA 4F3OA 5I3UA 2F8TA 3G0ZA 4FJ5A 4Q5VA 3OYMA 1W9HA 4FM1A 4DU4A 1RT2A 3AVIA 1RTHA 1JXEA 2RF2A 4CEZA 1CXQA 3KLEA 5J1EA 3K5NA 4FJMA 1ZBFA 3V1QA 1G15A 4PUOA 4CJ5A 4FLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWJ A;  1KLN A;  5KGX A;  5T7B A;  1N6Q A;  3OYH A;  3LWM A;  4Y1C A;  4KRF A;  1JKH A;  3M8S A;  4M3Z A;  3ZSW A;  3DMJ A;  2P5O A;  1TVR A;  1RDD A;  1TL3 A;  3ALY A;  4FZX C;  5CZ2 A;  3WNE A;  3LPU A;  3ZSQ A;  1VSH A;  1T7P A;  4ELU A;  1XHX A;  4NYF A;  1C0U A;  1KSP A;  4CGG A;  2QKK A;  2D0C A;  1S1T A;  2HHV A;  1A5V A;  3SNN A;  2HHW A;  4BWJ A;  4M3U A;  2YNH A;  3ZT2 A;  4FJ8 A;  4CEA A;  2HHS A;  1JLQ A;  4CEF A;  1X9W A;  4HHT A;  1BI4 B;  5KTQ A;  4CGJ A;  4B08 A;  4CJQ A;  4E89 A;  2E6M A;  1Y97 A;  1S9E A;  1VSF A;  2FBV A;  2ITG A;  4KKO A;  4EP5 A;  1NJW A;  1TK5 A;  3U3G A;  3TAB A;  3C6T A;  1J9A A;  4O0J A;  3OJU A;  4M3T A;  3ZCM A;  2A1S A;  4JS4 A;  2D0B A;  3SQ4 A;  4CCH A;  1RIL A;  4E1M A;  4Z4H A;  4CJL A;  2DTU A;  4FZY A;  4IKF A;  1GOC A;  1CLQ A;  1WN7 A;  4ZTF A;  5KRT A;  5HP1 A;  3HVT A;  2G8W A;  4C8M A;  4HCC A;  3TAP A;  3JYT A;  1VSE A;  2JGU A;  1SL2 A;  3PY8 A;  4QOZ B;  3F73 A;  4E7I A;  4DS5 A;  1HJR A;  2HW3 A;  1SL1 A;  1RT7 A;  3F9K A;  3NH2 A;  1QS4 A;  1RT1 A;  1RTI A;  1Z26 A;  4FLY A;  2R7Y A;  4DTM A;  4KAZ A;  4DSE A;  4E1N A;  3DLK A;  3AA4 A;  1S5J A;  3KJV A;  5I42 A;  4M42 A;  2HVH A;  1CXU A;  4DFM A;  1HNI A;  3PX0 A;  1GOB A;  4AHV A;  4L8R B;  2PZS A;  3MEG A;  4DSK A;  3DLH A;  2Y1J A;  2YHA A;  5FDL A;  3SUQ A;  4FJL A;  1TAQ A;  1QQC A;  3KLI A;  5FRN A;  1VK0 A;  4IG0 A;  3VQ4 A;  3HP9 A;  4CK1 A;  5KRS A;  3QEX A;  1FKP A;  3SJJ A;  2VG5 A;  4FJG A;  4C8N A;  1C6V A;  3HJF A;  3KLH A;  4CHP A;  4DLG A;  4IDK A;  1LAV A;  3AVN A;  1JXB A;  4JRP A;  1K6Y A;  3RMC A;  5HLF A;  2A1R A;  4FJK A;  1LW0 A;  3PUF A;  4B9V A;  3K59 A;  2YNI A;  3LDS A;  4FJ7 A;  3VQD A;  4GVM A;  4E3S A;  4HTU A;  3HPG A;  3ITH A;  1U04 A;  4F2R A;  1TGO A;  4F4K A;  1RBS A;  2X74 A;  1C1B A;  2XO7 A;  3KK3 A;  1NK8 A;  3T3F A;  4Q0B A;  1TAU A;  3TAM A;  1WNS A;  2HND A;  3NF6 A;  4CE9 A;  3QIN A;  3HT3 A;  4I2Q A;  3T1A A;  2KW4 A;  4I9Q A;  4JS5 A;  3HP6 A;  3AVC A;  1UAX A;  4R5P A;  2WON A;  1U48 A;  4W5O A;  2P51 A;  4CJT A;  3SQ2 A;  2EX3 A;  3DOL A;  2D0A A;  1CZ9 A;  4H8K A;  4CJW A;  3AVM A;  2XY7 A;  3C94 A;  3L8B A;  3SPY A;  1XHZ A;  5HRP A;  1U4B A;  3NH1 A;  1NK5 A;  4DSL A;  1S1U A;  1QSS A;  2HHU A;  4CFA A;  1IKV A;  4FCY A;  3L2U A;  3U3Y A;  1SKR A;  1R0A A;  3AO5 A;  4CF1 A;  1HQE A;  2OZS A;  1HYZ A;  1ZBH A;  3OYB A;  3IS9 A;  3NBP A;  4DLE A;  4UQG A;  3SUN A;  1NK9 A;  3MXM A;  4FM0 A;  4LSN A;  1S6P A;  2EHG A;  3HPH A;  4Z0U A;  1Q9Y A;  1B9D A;  4G1Q A;  4OVL A;  3AVK A;  1ZBI A;  4LH4 A;  3JSM A;  4N76 A;  5D3G A;  1D5A A;  3ZSR A;  3ZSV A;  3RWU A;  4FJX A;  4Z4I A;  1UA0 A;  4CF9 A;  4KHY A;  2I5J A;  4K8Z A;  3V9S A;  3TAG A;  4DQR A;  4DQP A;  1XC9 A;  4F2S A;  1JLF A;  3AO1 A;  3VQC A;  2IS3 A;  4WE1 A;  3NDK A;  1KRP A;  4I9L A;  1WSG A;  4B9S A;  4CGF A;  1C0T A;  4Z4E A;  4OGC A;  1RBU A;  3KK2 A;  4OLA A;  2HHQ A;  3OYJ A;  4DTN A;  1LAW A;  2KQ2 A;  4IFY A;  5C42 A;  4M3Y A;  2HB5 A;  3L2W A;  3AVJ A;  2BDP A;  4CJV A;  1J5O A;  2PYL A;  4DS4 A;  1HPZ A;  4CJ3 A;  2XY5 A;  3P5J A;  4DFJ A;  3AO3 A;  1S1V A;  3HYF A;  3QET A;  4F8R A;  1N5Y A;  2HHX A;  4CEB A;  3RMD A;  4B9L A;  1NK4 A;  1JLA A;  2XY8 A;  4KRE A;  1T05 A;  4KHS A;  4FJH A;  1SV5 A;  4FLU A;  4J2D A;  4DTS A;  1J53 A;  4CHY A;  3MAQ A;  2OYQ A;  4YFU A;  3HL8 A;  3QO9 A;  1I39 A;  4KHW A;  3NF9 A;  3ZSZ A;  2YV0 X;  3L3U A;  1LWE A;  3QIO A;  5HRR A;  4CEE A;  2Z1I A;  4RG8 A;  1ZBL A;  4DU3 A;  4TSX A;  4OPJ A;  2OPS A;  5C25 A;  2X6N A;  3HXM A;  4W5T A;  3CM5 A;  4XIU A;  2IC3 A;  1RT6 A;  4K8X A;  3OYC A;  4BDY A;  4Z4F A;  3AVG A;  2OZM A;  3ZT3 A;  3M8Q A;  4CJF A;  2ZD1 A;  3VA0 A;  4EP4 A;  2KZZ A;  4BE1 A;  2YKN A;  4Z4G A;  2DFH A;  3QIP A;  2Z1H A;  3QEW A;  3V9Z A;  3CQ8 A;  4OKJ A;  1JLC A;  2YHB A;  1L3T A;  4E7H A;  3S3M A;  4I2P A;  3LP3 A;  3KD5 E;  3DLR A;  2G8I A;  2WOM A;  3VN5 A;  4ELV A;  4IG3 A;  4O4G A;  1DTQ A;  2W42 A;  5J2P A;  1L3V A;  4KB1 A;  4AHS A;  4BE0 A;  3IG1 A;  4FVM A;  4DTX A;  1VRT A;  3VQE A;  4BE2 A;  1YT3 A;  4DFP A;  1U45 A;  4CEC A;  3SV4 A;  1GOA A;  3AVA A;  1ASV A;  2F96 A;  4CFD A;  2PYJ A;  3TR8 A;  4RW4 A;  4CFB A;  2GV9 A;  2G8U A;  3QER A;  3SQ1 A;  4NCA A;  1HQU A;  4KHU A;  1S1X A;  3I8D A;  3RRG A;  4H4O A;  3QNN A;  4KO0 A;  1KVB A;  3BDP A;  3NF7 A;  3TAE A;  2BE2 A;  1EXQ A;  1TKX A;  4FLZ A;  4FJJ A;  3K2P A;  3AO4 A;  4E7J A;  4E0D A;  5J2M A;  3NFA A;  4ID5 A;  4LD0 A;  4CJK A;  1T03 A;  3NGI A;  1HYV A;  1S1W A;  3D0P A;  1Q9X A;  4PWD A;  1BIZ A;  1ITG A;  2YKM A;  3L2R A;  4CEO A;  3SI6 A;  5HRO A;  3AO2 A;  1QE1 A;  3G10 A;  4CHZ A;  1A5W A;  4BDZ A;  4KI4 A;  1Z25 A;  4FW2 A;  4KV8 A;  3RR8 A;  1JLG A;  4FLV A;  4Z4C A;  4DSJ A;  2ETJ A;  3TAN A;  1HMV A;  4OPK A;  2IDO A;  3S3O A;  1FK9 A;  2LSN A;  3V1O A;  3B6P A;  2X78 A;  3ZT4 A;  5SWM A;  1FKO A;  1KVA A;  4LSL A;  2B4J A;  3SV3 A;  2G8F A;  3BGR A;  4IBN A;  4DFK A;  1VSK A;  4DTU A;  3I0R A;  4DTJ A;  3ASM A;  4KTZ A;  1BCO A;  3NGZ A;  4J2B A;  3LAM A;  3HK2 A;  4F3T A;  3K57 A;  4W5R A;  1YTA A;  3TAR A;  4MQ3 A;  4CGH A;  1EP4 A;  3QEV A;  1WSH A;  3MXI A;  3ZSO A;  4KB0 A;  2FBY A;  3WNH A;  3MXJ A;  2RN2 A;  5JS2 A;  4CJU A;  4FM2 A;  3PX4 A;  4KHN A;  4ELT A;  3L2V A;  1NOZ A;  1BI4 A;  4RW8 A;  1W0H A;  3O4N A;  3ZT1 A;  1EX4 A;  2E4L A;  4HVJ A;  1TKZ A;  2QKB A;  5CY4 A;  4BWM A;  2D5R A;  1JL2 A;  3OYD A;  3TI0 A;  4DF4 A;  3EY1 A;  3KLG A;  4BAC A;  1U47 A;  1X9S A;  1C1C A;  1MU2 A;  4CES A;  4N5S A;  4E7K A;  4AHR A;  4KTW A;  1NK7 A;  1WSI A;  1L5U A;  3DOK A;  1A5X A;  1WLJ A;  4PQU A;  1SUQ A;  1WAJ A;  4PA1 A;  2XHB A;  3QEI A;  1C1A A;  4M3R A;  3OJS A;  4KHQ A;  3FFI A;  3NAE A;  3QEP A;  1NJY A;  4ZHR A;  1BIS A;  4M41 A;  3A2F A;  3K58 A;  4M3X A;  1NJZ A;  1WAF A;  2ATQ A;  1NKE A;  1RDA A;  2E6L A;  1X9M A;  4N41 A;  1IKX A;  4N56 A;  3MEC A;  4FLT A;  3SYZ A;  4FYD A;  3LAN A;  4CF2 A;  4E19 A;  3DRS A;  1TKD A;  3OYK A;  2X6S A;  1ZYQ A;  2HVI A;  3VQA A;  4CHN A;  4CIG A;  2FC0 A;  3VQ8 A;  3K5L A;  3HM9 A;  3KIO A;  1NK0 A;  4B9U A;  3KKS A;  3CFP A;  1NKC A;  4CJ4 A;  1RNH A;  1DTT A;  1KTQ A;  2HNZ A;  3DM2 A;  3C95 A;  1IO2 A;  3LPT A;  5SZT A;  3OS0 A;  3OYI A;  1NJX A;  3MEE A;  3AVL A;  2B5J A;  3H08 A;  5E41 A;  4I7F A;  1IH7 A;  4CGI A;  4CIE A;  3AA2 A;  2Y1I A;  3V9U A;  3VQP A;  1D8Y A;  2HHT A;  2ZQB A;  4FXD A;  1HYS A;  4CF8 A;  2FBT A;  4H4M A;  4AIL C;  3VQB A;  4FK4 A;  3S9H A;  3OYG A;  1BL3 A;  4O44 A;  1VSJ A;  4C8L A;  1QSL A;  1NK6 A;  3QLH A;  3O3G A;  1S6Q A;  5CYQ A;  1LV5 A;  3VQ7 A;  3NGY A;  1XI1 A;  5FRO A;  3DYA A;  4J2E A;  5J2N A;  3OYA A;  5KI6 A;  3E01 A;  3SUO A;  2P5G A;  2O4I A;  1BIU A;  3M8P A;  4NYN A;  3WNG A;  4CFC A;  4CK3 A;  3V9W A;  4BDP A;  4KPY A;  2VG7 A;  3VA3 A;  2B6A A;  3VQ9 A;  3P83 D;  3CYM A;  4FK0 A;  1XWL A;  3B6O A;  5EU7 A;  4CIF A;  1TK8 A;  3HO1 A;  3MED A;  3PO4 A;  5CYM A;  3C6U A;  5DK5 A;  3V1R A;  4C8K A;  1RTD A;  4B9M A;  4LH5 A;  1TL1 A;  4HCB A;  5KGW A;  4M3W A;  3NHG A;  1TK0 A;  3ISN C;  3RMB A;  3SCX A;  1IG9 A;  1HNV A;  4CJR A;  5C24 A;  5HRN A;  3CFO A;  4CJE A;  2OA8 A;  4LY7 A;  4B8C A;  4FK2 A;  3K5M A;  1QHT A;  4HUF A;  1HRH A;  1RBV A;  2IOC A;  3LP1 A;  3NCI A;  4KI6 A;  3DI6 A;  4DTO A;  3DLB A;  4MFB A;  4OKK A;  2YNG A;  3S3N A;  3ZSX A;  4FLW A;  1NOY A;  3K5O A;  1ASW A;  1RT5 A;  1B9F A;  1BQN A;  5CZ1 A;  3PV8 A;  3I0S A;  1L3U A;  3EZ5 A;  3KD1 E;  2OPP A;  3RR7 A;  1IKY A;  2XY6 A;  4ZTJ A;  4OKE A;  2RPI A;  4DQI A;  4DWI A;  4DQS A;  4RW6 A;  1RBR A;  2Z1J A;  1YTU A;  4B8A B;  1SKW A;  3DRP A;  4FJI A;  4AHU A;  1ASU A;  3L3V A;  5K14 A;  4HUG A;  1T8E A;  1F21 A;  2QXF A;  3DRR A;  1WSJ A;  3M8R A;  3TWH A;  4FW1 A;  1LW2 A;  4JRQ A;  4C8O A;  1JLB A;  3THV A;  4CJP A;  4DF8 A;  4CED A;  1YVU A;  1KFD A;  1BQM A;  3RRH A;  1VSD A;  2OPR A;  3IAY A;  3OYE A;  4NCB A;  2GBZ A;  3RMA A;  2QK9 A;  1Q8I A;  1CZB A;  1RDB A;  1O1W A;  5HRS A;  1UOC A;  3WNF A;  2G8K A;  4N47 A;  4OJR A;  2GUI A;  3OYF A;  3HVR A;  1RBT A;  1SL0 A;  3KTQ A;  3KLF A;  4IFV A;  4Y1D A;  1WSF A;  1D9D A;  2AJQ A;  1ZBU A;  4W5N A;  3QNO A;  2PY5 A;  5DMR A;  5HBM A;  4ID1 A;  4HUE A;  3VQQ A;  1LWF A;  3LAL A;  1VRU A;  3NE6 A;  3U6F A;  1EKE A;  2RKI A;  3EYZ A;  2BGG A;  4EZ6 A;  3OY9 A;  2HMI A;  1IKW A;  4OGE A;  3AV9 A;  1KVC A;  3LZI A;  4EZ9 A;  2FBX A;  2G8V A;  3PO5 A;  1BGX T;  1QSY A;  3V9X A;  3KKR A;  5JS1 A;  3QES A;  4DMN A;  2YNF A;  2DFE A;  2VWK A;  1B92 A;  4GMJ B;  3PX6 A;  2KZM A;  2OPQ A;  4RW9 A;  3LP2 A;  1EET A;  2KTQ A;  3TAQ A;  4CK2 A;  3NH0 A;  1KCF A;  4NCG A;  4AHT A;  1TV6 A;  1VSL A;  3AVF A;  3AA3 A;  3VQ5 A;  2Z1G A;  4DU1 A;  3SQ0 A;  5J2Q A;  1UA1 A;  3NF8 A;  2BAN A;  4OLB A;  2F8S A;  3T19 A;  3KK1 A;  4B9T A;  1WSE A;  4AH9 A;  3SZ2 A;  1RDC A;  3OYL A;  3CFR A;  4DSF A;  2G8H A;  1KLM A;  1KFS A;  1VSI A;  2KFZ A;  4QAG A;  3SUP A;  3UIQ A;  3AA5 X;  4DQQ A;  3IRX A;  1JLE A;  4CF0 A;  3ZT0 A;  3V4I A;  3ULD A;  4DSI A;  1SKS A;  3O4Q A;  3CM6 A;  1QTM A;  3RTV A;  2DFF A;  1C0M A;  1REV A;  3OS1 A;  3OYN A;  1RT4 A;  4CHQ A;  4DTR A;  4QCL A;  4CER A;  1DLO A;  4CHO A;  2IAJ A;  4YNQ A;  3L2Q A;  2XRI A;  2KFN A;  2O4G A;  4J2A A;  4E7L A;  3ZSY A;  1D9F A;  2IGI A;  3OS2 A;  3SPZ A;  1UWB A;  4B3O A;  3VQ6 A;  1BHL A;  4ICL A;  4PY5 A;  1J54 A;  3HPO A;  4RW7 A;  2Q3S A;  3O3F A;  1I3A A;  3DLE A;  4KFB A;  2ZE2 A;  4O55 A;  1X1P A;  1RT3 A;  4AHC A;  1VSM A;  4CGD A;  1TKT A;  3OVN A;  4W5Q A;  3LZJ A;  4DTP A;  3LAK A;  3V6D A;  4FZZ A;  3AVB A;  4O5B A;  3P1G A;  1L3S A;  4B9N A;  3TAF A;  3LWL A;  1FXX A;  1U49 A;  2HNY A;  3CG7 A;  4CEQ A;  3V81 A;  3HST B;  1S9G A;  1RTJ A;  1RCH A;  1BCM A;  4DG1 A;  3O3H A;  2VG6 A;  2P1J A;  3D45 A;  4GW6 A;  4JLH A;  4FJ9 A;  5FRM A;  3AVH A;  4KTQ A;  2DY4 A;  4FJN A;  1LWC A;  4M45 A;  1JL1 A;  4CJS A;  4O0I A;  1NKB A;  3LP0 A;  2JLE A;  2NUB A;  3DLG A;  4F3O A;  5I3U A;  2F8T A;  3G0Z A;  4FJ5 A;  4Q5V A;  3OYM A;  1W9H A;  4FM1 A;  4DU4 A;  1RT2 A;  3AVI A;  1RTH A;  1JXE A;  2RF2 A;  4CEZ A;  1CXQ A;  3KLE A;  5J1E A;  3K5N A;  4FJM A;  1ZBF A;  3V1Q A;  1G15 A;  4PUO A;  4CJ5 A;  4FLX A; 
#chains in the Genus database with same CATH topology
 5T7B A;  3OW2 M;  4WYB A;  3LWM A;  4Y1C A;  3SLC A;  3O6W A;  3UB5 A;  4M3Z A;  3KVG A;  4LF7 K;  2ASM A;  3DMJ A;  3DAW A;  2D4W A;  3WNE A;  4ELU A;  1XHX A;  2QKK A;  3U9D A;  4GKK K;  5BR8 K;  2YNH A;  4FJ8 A;  2GWJ A;  3CHW A;  1IBK K;  4HTL A;  4BVP A;  2HHS A;  4HHT A;  1BI4 B;  3D2F B;  4E89 A;  2QM1 A;  2FBV A;  4KKO A;  1HR0 K;  3G4S N;  4UY8 O;  5M1P A;  4KH4 A;  3SQ4 A;  4CCH A;  4CBU A;  3MWP A;  4CJL A;  4B3M K;  1CZA N;  5HP1 A;  3HVT A;  1Q86 O;  2G8W A;  4C8M A;  2JGU A;  1HJR A;  2F9W A;  3T69 A;  2R7Y A;  3MN7 A;  3DLK A;  3EE8 A;  3KJV A;  2QXL A;  2WTU A;  4DFM A;  1GOB A;  4DSK A;  2Y1J A;  2YHA A;  5FRN A;  4IG0 A;  3VQ4 A;  3HP9 A;  5BRE A;  3GOI A;  2A6A A;  1SAZ A;  2QWQ A;  1JXB A;  5HLF A;  1K6Y A;  4FJK A;  4GV9 A;  3BZK A;  2YNI A;  3LDS A;  2ZJR L;  2QWM A;  3ENH A;  4BGB A;  3U9Z A;  4HTU A;  1RBS A;  4JI4 K;  1NK8 A;  4CZF A;  3CC7 N;  2KW4 A;  4JS5 A;  3HP6 A;  3ZX0 A;  2EX3 A;  3P31 A;  3VF2 A;  4JKB A;  3C94 A;  5AQG A;  1U4B A;  1J6Z A;  3NH1 A;  4DSL A;  1QSS A;  1N32 K;  4CFA A;  3L2U A;  4GV6 A;  4B1W B;  1HQE A;  2OZS A;  4JK9 A;  3OYB A;  5GAH P;  4DLE A;  4UQG A;  3MXM A;  1VHX A;  2O8E A;  1GLC G;  2PAV A;  4Z0U A;  1XNR K;  3JSM A;  2QTD A;  2QEX N;  3TAG A;  5BRH A;  1XC9 A;  1X9J A;  3H45 C;  1OH6 A;  3VQC A;  4WE1 A;  1X3N A;  1KRP A;  3O1B A;  4OGC A;  4OLA A;  2GX9 A;  2HHQ A;  1LAW A;  2KQ2 A;  5C42 A;  4LFB K;  3L2W A;  2PYL A;  3AVJ A;  5M1Q A;  1GLD G;  4H0P A;  3P5J A;  3AO3 A;  1S1V A;  3HYF A;  2HHX A;  4CEB A;  1VQP N;  1JLA A;  2XY8 A;  4H5N A;  4KHS A;  4FJH A;  1SV5 A;  1J53 A;  1NGJ A;  4YFU A;  2O8D A;  1EWR A;  3QIO A;  4CEE A;  3J80 O;  4DU3 A;  4OPJ A;  2OPS A;  3CCR N;  2NRH A;  4CZH A;  3TU5 A;  1TUY A;  4JKG B;  4K8X A;  4Z4F A;  4DUY K;  3AVG A;  4DV3 K;  1HLU A;  1VQN N;  5BN9 A;  2E88 A;  1C0G A;  3AGR A;  2KZZ A;  3H1Q A;  3CCQ N;  5JLF A;  3V9Z A;  3QEW A;  5AJ3 K;  4OKJ A;  1Q18 A;  2ASO A;  4JD2 A;  4O4G A;  4KB1 A;  4BE0 A;  1YT3 A;  4DFP A;  1GOA A;  2F96 A;  4CFD A;  4RW4 A;  1N33 K;  1BA0 A;  4NCA A;  3ZET A;  3FZL A;  4KHU A;  1S1X A;  4X66 K;  3RRG A;  3QNN A;  3MCA B;  4KO0 A;  3BDP A;  2BE2 A;  2Q97 A;  3R9P A;  3AO4 A;  2WBN A;  4E0D A;  5J2M A;  1Q9X A;  3NGI A;  3D0P A;  3CCV N;  4YOV A;  2YKM A;  1ITG A;  2E2P A;  4CEO A;  3SI6 A;  3CIP A;  5HRO A;  4JI2 K;  4DR6 K;  1Z25 A;  3RR8 A;  4DR5 K;  4JHD A;  2DPN A;  4FPA A;  3S3O A;  1FK9 A;  2LSN A;  3SV3 A;  4F2R A;  2B4J A;  2G8F A;  1VSK A;  3CI5 A;  3I0R A;  3ASM A;  3NGZ A;  3VEV A;  3FZF A;  4BC2 A;  4F3T A;  1N8R O;  1QHA A;  3TAR A;  4MQ3 A;  5M1N A;  5JVG L;  4I6M B;  4CZK A;  1WSH A;  4KB0 A;  2FBY A;  3UKR A;  4FM2 A;  4ELT A;  3H46 O;  4HVJ A;  3KK7 A;  1JL2 A;  1U47 A;  1C1C A;  3BEX A;  4QS7 A;  1WLJ A;  4PA1 A;  3SAH A;  4JI3 K;  4ZHR A;  3M3Z A;  3CCJ N;  3K58 A;  3MDQ A;  1NJZ A;  1WAF A;  2E6L A;  1X9M A;  5F0X A;  4A61 A;  3TTD A;  4DQ8 A;  1DKG D;  3VQ8 A;  3CMA N;  2E8A A;  1NKC A;  3G6E N;  3DM2 A;  1IO2 A;  3LPT A;  5SZT A;  1IV0 A;  4I7F A;  1IH7 A;  4CIE A;  3EN9 A;  2QA4 N;  1K8A O;  3E9O A;  3LDO A;  4LF8 K;  3OYG A;  1BL3 A;  4BC4 A;  4JV5 K;  1XQS C;  4J2E A;  3OYA A;  2WUS A;  4AM6 A;  4NYN A;  5AQX A;  1DT9 A;  3CYM A;  3B6O A;  3HO1 A;  1YVN A;  3BZC A;  3PIO L;  1RTD A;  5KGW A;  4WQ5 C;  3ISN C;  4WQ4 A;  4CJE A;  3K5M A;  1MWK A;  1HRH A;  3NCI A;  3HBT A;  5GIO A;  2UUB K;  2O8F B;  3ZSX A;  1ASW A;  2NNW A;  1BQN A;  3KD1 E;  2OPP A;  3QML A;  2P9U A;  4FO0 A;  4DQI A;  4BGA A;  1YTU A;  3DXK A;  3DRP A;  1ASU A;  4YOR A;  5K14 A;  1F21 A;  2E2O A;  2QXF A;  3DRR A;  3M8R A;  1LW2 A;  4C8O A;  3Q7C A;  5AQF A;  1YVU A;  4ILG B;  3RRH A;  4YHH K;  3AY9 A;  4NCB A;  4JKE A;  2GBZ A;  3ID6 A;  4O5F A;  1CZB A;  5HRS A;  4FPB A;  4OJR A;  2GUI A;  1SL0 A;  3KTQ A;  4IO9 L;  2AJQ A;  2HBL A;  1ZBU A;  2PY5 A;  4FWN A;  4BRQ A;  4ID1 A;  2QWN A;  4JI6 K;  1K8K B;  1VRU A;  2HBM A;  3U6F A;  2NRR A;  2RKI A;  3VGL A;  1ATN A;  4BR2 A;  4H0V B;  3ZLJ A;  1IKW A;  3WXL A;  3AV9 A;  2FBX A;  1MA9 B;  4KHP K;  5JS1 A;  1EO1 A;  4BC5 A;  2V7Y A;  3BF3 A;  2VWK A;  4GMJ B;  2KZM A;  3PX6 A;  3BF1 A;  3LDP A;  3NH0 A;  4CZJ A;  4IDH A;  3VQ5 A;  2Z1G A;  3HI0 A;  2GEM A;  1O13 A;  4OLB A;  3MK6 A;  3FLC O;  3GE1 A;  4B9T A;  4JI5 K;  3OYL A;  3RVC A;  1KFS A;  4HWI A;  3UIQ A;  3AA5 X;  4DQQ A;  2YX6 A;  3JAM O;  3V4I A;  3O4Q A;  3CM6 A;  4C23 A;  1C0M A;  3OYN A;  4DTR A;  4CER A;  1DLO A;  2XRI A;  4B1U B;  3G25 A;  3NVM A;  1Y64 A;  4IJA A;  2FSJ A;  3VQ6 A;  4ICL A;  4K25 A;  4RW7 A;  5TKY A;  3S3M A;  1VSM A;  1BA1 A;  3LZJ A;  4JKC A;  4BRI A;  3CCE N;  3V6D A;  3SMP A;  3QFP A;  1BU6 O;  3CG7 A;  3E1Y A;  3DLL L;  4DR3 K;  1S9G A;  1Z6R A;  1RTJ A;  3C7N A;  3JS6 A;  1BCM A;  4DG1 A;  3O3H A;  3QIC A;  4GW6 A;  3D45 A;  4FJ9 A;  3IUC A;  3AVH A;  3C0B A;  4IOC L;  4F3O A;  2IVO A;  1RT2 A;  3R6M A;  2YCH A;  4FL9 A;  1KAX A;  1JXE A;  2ZM6 K;  3K5N A;  1CXQ A;  3KLE A;  4FJM A;  1YF5 L;  3V1Q A;  1G15 A;  4FLX A;  2VWJ A;  1N6Q A;  4MLE A;  3S41 A;  3M8S A;  3ZSW A;  3OTO K;  1TL3 A;  5CZ2 A;  3ZSQ A;  1C0U A;  5C10 A;  4JK8 A;  5AZJ A;  3ZEU B;  1JLQ A;  4CEF A;  1X9W A;  4CI6 A;  3I33 A;  4X62 K;  3C6H A;  5AQY A;  4B08 A;  2E6M A;  4A2B A;  1TK5 A;  1VSF A;  3TAB A;  3VES A;  4M3T A;  2QW9 A;  1SQK A;  3D2E B;  2A1S A;  3ZCM A;  3GBT A;  2DTU A;  3MCP A;  1NGC A;  1ATR A;  3B8A X;  4ZTF A;  4L3Q A;  4LC9 B;  3O9S A;  3FZM A;  2Q0R A;  3F73 A;  4LFA K;  3EL2 A;  2HW3 A;  1SL1 A;  1RT7 A;  1K9M O;  4FLY A;  4KAZ A;  5KPT A;  3THX A;  3M1F A;  3VTH A;  3AA4 A;  1HNW K;  4L8R B;  4IXC A;  5BPN A;  2PZS A;  3DLH A;  5FDL A;  4ILJ A;  1TAQ A;  2E2N A;  3M5R A;  5BPM A;  2H3G X;  1KAZ A;  2P9L B;  4YDU C;  5KRS A;  3I55 N;  3SJJ A;  2VG5 A;  5JMV A;  1C6V A;  4BRM A;  3KLH A;  4IDK A;  4JRP A;  1G99 A;  4B9V A;  4FJ7 A;  3SMS A;  4XH4 A;  4GVM A;  4E3S A;  5AQH A;  3HPG A;  4K41 A;  4F4K A;  1TGO A;  2X74 A;  1C1B A;  4FWL A;  1WNS A;  2HND A;  4CE9 A;  3QIN A;  2HMP A;  3HT3 A;  2O8B A;  1UAX A;  2WFB A;  4B1Z A;  3SQ2 A;  2P51 A;  1VQO N;  3DOL A;  2XY7 A;  1BG3 A;  3L8B A;  5AQK A;  4BR7 A;  5HRP A;  4IOX A;  1S1U A;  4BR5 A;  3IS9 A;  3SUN A;  3RSE B;  3CF5 L;  4E1J A;  4FM0 A;  3T1Y K;  1QZ6 A;  3DJC A;  4JKD A;  2EHG A;  3HPH A;  4G1Q A;  4DV5 K;  1ZBI A;  4N76 A;  1D5A A;  4FJX A;  5AQI A;  4CF9 A;  2I5J A;  3O80 A;  4K8Z A;  4B1Y B;  3PSF A;  1HX1 A;  1E4F T;  3NDK A;  4BR4 A;  1Z05 A;  4B9S A;  4CGF A;  3WQT A;  1ZXO A;  3KK2 A;  4CZI A;  3H6E A;  4IFY A;  3R1X A;  4M3Y A;  1H1V A;  1JCF A;  3A5N C;  4MDA A;  1ILY A;  1JJ2 M;  4AF1 A;  4ISF A;  3RMD A;  4B9L A;  4F9O A;  3KZB A;  1T05 A;  1EQY A;  4IZ9 A;  1NMD A;  3HL8 A;  3QO9 A;  3ZSZ A;  2O8C A;  3L3U A;  1ZBL A;  2Z1I A;  2E1Z A;  3F2K A;  5FLX O;  2X6N A;  1OH8 A;  2UUC K;  4BDY A;  3WEE A;  3ZT3 A;  4CJF A;  2ZD1 A;  3VA0 A;  4EP4 A;  3ULE A;  3OHR A;  2YKN A;  3OA9 A;  4Z4G A;  2W6L A;  5BR9 A;  1S22 A;  5LY3 A;  2HBJ A;  4E7H A;  4I2P A;  1QQM A;  3KD5 E;  3DLR A;  5J2P A;  1DTQ A;  1L3V A;  3IG1 A;  4FVM A;  1BO5 O;  3DXM B;  3AVA A;  3O9T A;  2W6K A;  3TR8 A;  3NMU A;  5AQN A;  1HQU A;  2P9S B;  1KVB A;  1YJ9 N;  3UKU B;  3TAE A;  1EXQ A;  3MWT A;  4B9Q A;  2BTF A;  3CER A;  1QE1 A;  4CHZ A;  3A0I X;  4FW2 A;  1JLG A;  4FLV A;  4DSJ A;  2ETJ A;  5SWM A;  3ZT4 A;  4LSL A;  3H1V X;  4EHT A;  5I9E B;  3ENO A;  4KH5 A;  1BCO A;  3HK2 A;  4IO8 A;  1YTA A;  4K42 A;  4JKG A;  3MXI A;  4LFC K;  2RN2 A;  3EE9 A;  1QQN A;  2GWK A;  4WQ5 A;  4KHN A;  1GLL O;  1NOZ A;  4DR1 K;  1K73 O;  4RW8 A;  2OTJ N;  4NXM K;  3SAG A;  2E5L K;  3KLG A;  2ZWH A;  1X9S A;  5E84 A;  4N5S A;  4BRG A;  2NRX A;  5LL6 Z;  1L5U A;  4PQU A;  1A5X A;  1WAJ A;  3QEI A;  1C1A A;  3OJS A;  3CCM N;  4KHQ A;  2E20 A;  3FFI A;  2HF4 A;  2ZGZ A;  3CD6 N;  4M41 A;  2W41 A;  1NKE A;  5CHI A;  1TUU A;  1NNE A;  2AP1 A;  4N41 A;  3P39 A;  2I7N A;  3MEC A;  4N56 A;  3SYZ A;  4FYD A;  4CF2 A;  4OPA A;  1TKD A;  1EWQ A;  4X64 K;  1ZYQ A;  2OAN A;  2HVI A;  2QWP A;  3K5L A;  4FOI A;  1NK0 A;  1TYQ A;  4M63 C;  1RNH A;  1KTQ A;  2HNZ A;  4ISE A;  3C95 A;  3EEQ A;  1NJX A;  3I56 N;  2P9K B;  5E41 A;  4CGI A;  3VMF B;  1DEJ A;  2FBT A;  3VQB A;  4DCH A;  1NG9 A;  3WXJ A;  5FPM A;  4FWS A;  5F1X A;  2HHH K;  5AQO A;  3VOV A;  5BRD A;  4OPH A;  3NGY A;  1XI1 A;  3HZ6 A;  3E01 A;  2P5G A;  2O4I A;  3WNG A;  5AQS A;  4CK3 A;  4LF4 K;  2B6A A;  3D6R A;  3VQ9 A;  3P83 D;  4FK0 A;  5TKW A;  5EU7 A;  1NGE A;  1TK8 A;  4H0X B;  2IVN A;  4C8K A;  3ATV A;  4B9M A;  4LH5 A;  1WUA A;  1TK0 A;  3RMB A;  3SCX A;  2AA4 A;  3AAP A;  5C24 A;  2OA8 A;  4LY7 A;  4FK2 A;  3VEW A;  4EAH D;  3DI6 A;  3CQY A;  2P9N A;  3DLB A;  2Q2R A;  4OKK A;  2YNG A;  3S3N A;  1NGF A;  1RT5 A;  1B9F A;  4GNI A;  3HSC A;  1HNX K;  4ZTJ A;  1LCU A;  3C6A A;  5AR0 A;  4BG9 A;  1S72 N;  3CJ7 A;  1IBL K;  4DWI A;  2Z1J A;  4B8A B;  1SKW A;  3WQU A;  1GLE G;  3TWH A;  4FW1 A;  4JRQ A;  1HKB A;  3VEN A;  4EIA A;  1BQM A;  1GLF O;  3FR0 A;  5GIN A;  3OYE A;  4A57 A;  3L6Q A;  5LJV A;  3RMA A;  1Q8I A;  1RDB A;  3P4I A;  3T7Z A;  1YIJ N;  3WNF A;  2YI1 A;  3F5T A;  3OYF A;  1RBT A;  3HVR A;  2O8E B;  4R79 A;  3KLF A;  4Y1D A;  2V52 B;  4HUE A;  3VQQ A;  1LWF A;  3PIP L;  4BQZ A;  1VQ8 N;  2BGG A;  4EZ6 A;  2HMI A;  4OGE A;  3FE1 A;  3V9X A;  3KKR A;  3SBT A;  3HOT A;  4X65 K;  4BRC A;  3E66 A;  1B92 A;  2OPQ A;  4RW9 A;  4A5B A;  3TAQ A;  4NCG A;  3AGK A;  1TV6 A;  3AVF A;  4DU1 A;  2FXU A;  1UA1 A;  1WBD A;  3T19 A;  2OCE A;  3KK1 A;  4AH9 A;  2KFZ A;  1VSI A;  3SUP A;  1NGI A;  3VGM A;  4CJ7 A;  2A42 A;  3IRX A;  1M90 O;  3AAQ A;  2A40 A;  3ZT0 A;  3ULD A;  2O8D B;  4IFE A;  3OS1 A;  1RT4 A;  2CGL A;  1VQ4 N;  3WXM B;  4YNQ A;  2O4G A;  5AQV A;  2IGI A;  1UWB A;  4AQY K;  3HPO A;  2HST A;  5AQM A;  3O3F A;  1X1P A;  4AHC A;  4DTP A;  4CZM A;  4JD2 B;  1YAG A;  3R8E A;  4B9N A;  4KBO A;  1FXX A;  1U49 A;  3V81 A;  4CEQ A;  3TSP A;  3HST B;  3H3N O;  5M1F A;  3ZET B;  4YDU A;  2VG6 A;  2P1J A;  5GAE P;  4JLH A;  5FRM A;  1OVY A;  5H1S Q;  2DY4 A;  1N34 K;  1LWC A;  4M45 A;  4O0I A;  1NKB A;  5I3U A;  3G0Z A;  1NM1 A;  1W9H A;  4DU4 A;  1NJI O;  2NRV A;  3I8B A;  4O8U A;  5J1E A;  4CJ5 A;  5KGX A;  3OYH A;  1VQ7 N;  1JKH A;  2QWR A;  4RWT A;  1TVR A;  4BRL A;  3ALY A;  4FZX C;  1T7P A;  3LPU A;  1U6Z A;  4NYF A;  2GTD A;  2D0C A;  1S1T A;  2HHV A;  1A5V A;  3SNN A;  2HHW A;  4BWJ A;  4M3U A;  4JKA A;  4PL8 A;  3ZT2 A;  3QBW A;  3UKR B;  4JKH A;  4YOU A;  5KTQ A;  4JI0 K;  3O9U A;  1Y97 A;  5AQW A;  4EP5 A;  2ITG A;  1NJW A;  3U3G A;  4BY9 C;  3C6T A;  4O0J A;  3OJU A;  4JS4 A;  2D0B A;  1RIL A;  4IKF A;  1GOC A;  1CLQ A;  1XUP O;  1WN7 A;  5KRT A;  3GG4 A;  3LDQ A;  3CC2 N;  1VQM N;  4HCC A;  1W97 L;  3JYT A;  1VSE A;  1SL2 A;  3IDH A;  1YHQ N;  1RT1 A;  1NGH A;  1Z26 A;  4JI1 K;  4E1N A;  2HVH A;  1CXU A;  3PX0 A;  4AHV A;  1GLB G;  2YHX A;  3MEG A;  3SUQ A;  4B3T K;  1QQC A;  1VK0 A;  4BRF A;  3QEX A;  2NRZ A;  4FWK A;  4C8N A;  2YHW A;  5AZI A;  1LW0 A;  4JI7 K;  3VQD A;  3FFK B;  3SJH A;  2XO7 A;  3T3F A;  3TAM A;  5AFU H;  4CZE A;  3J7Z O;  3T1A A;  4I9Q A;  3THY A;  4DKW A;  3UE5 A;  2PBD A;  1U48 A;  2UUA K;  2D0A A;  1CZ9 A;  4H8K A;  4CJW A;  3AVM A;  3SAF A;  1VQ5 N;  1XHZ A;  1NK5 A;  5LJW A;  3CCU N;  2HHU A;  1IKV A;  4FCY A;  1R0A A;  4DR7 K;  1HYZ A;  2F7T A;  3CPW M;  3N4P A;  3LDN A;  4LSN A;  1S6P A;  2P9P A;  4BRH A;  5EX5 A;  5D3G A;  3ZSR A;  4Z4I A;  3RWU A;  2JWL A;  4KHY A;  4MO5 A;  2P9U B;  4DQR A;  4DQP A;  4F2S A;  1JLF A;  2RE2 A;  3AO1 A;  5AQQ A;  2IS3 A;  3DXK B;  4I9L A;  1WSG A;  3CJ9 A;  3EO3 A;  5B8H A;  4H0O A;  5KQD A;  4DTN A;  4J8F A;  3J7A P;  2HB5 A;  1KC8 O;  2BDP A;  4A5A A;  4DS4 A;  2XY5 A;  4DFJ A;  3QET A;  3HTV A;  1QZ5 A;  4BR0 A;  3L0Q A;  4JN4 A;  4KRE A;  4H5V A;  4FLU A;  4DTS A;  4CHY A;  2OYQ A;  2JWK A;  4BVO A;  4KHW A;  4CZL A;  2CGJ A;  4TSX A;  4FWO A;  2F9T A;  5C25 A;  4W5T A;  5BRF A;  3CM5 A;  3OYC A;  5FPN A;  1VQ6 N;  3WXK A;  4BE1 A;  3O9Q A;  4JK7 A;  2DFH A;  3QIP A;  2Z1H A;  3BP8 A;  3CQ8 A;  2RHK A;  4CD3 A;  4RCH A;  4DUZ K;  1NU0 A;  4CBX A;  1L3T A;  3VN5 A;  4ELV A;  2W42 A;  2ZGY A;  4AHS A;  1VRT A;  3VQE A;  1U45 A;  3U8X A;  3SV4 A;  1ASV A;  3A8Y A;  5AQP A;  4A62 A;  2GV9 A;  4CFB A;  2G8U A;  1U2V A;  3QER A;  3SQ1 A;  4K43 A;  3A5L C;  1NGD A;  1V4S A;  3NF7 A;  1TKX A;  4YOT A;  2ITM A;  1Q82 O;  2QI2 A;  4B3S K;  3K2P A;  3O4W A;  4E7J A;  3NFA A;  1NGG A;  4ID5 A;  1T03 A;  4PWD A;  2P9I B;  1BIZ A;  3L2R A;  1SS6 A;  4BDZ A;  3TSU A;  3TPQ A;  5JLH A;  1T44 A;  3LM2 A;  1QVG M;  4Z4C A;  4LF9 K;  4WFA L;  1HMV A;  4OPK A;  3CQX A;  2IDO A;  3V1O A;  2X78 A;  1FKO A;  3QBX A;  3BGR A;  3MN9 A;  3FZK A;  4DTJ A;  2CGK A;  4J2B A;  3CC4 N;  2UXD K;  4W5R A;  4CGH A;  1EP4 A;  3J81 O;  3QEV A;  4IEI A;  1VQL N;  4PKH A;  4CJU A;  3PX4 A;  3L2V A;  3K0S A;  4WCE L;  3C7N B;  1BI4 A;  3D2F A;  1W0H A;  3O4N A;  1EX4 A;  2E4L A;  2QKB A;  1ATS A;  4BWM A;  3TI0 A;  3EY1 A;  4E7K A;  2KHO A;  2BH1 A;  4BC3 A;  1NK7 A;  2ASP A;  3VGK A;  3CJC A;  3DOK A;  4NB4 A;  4JEP A;  1SUQ A;  1D4X A;  3CPE A;  1NJY A;  1BIS A;  1LOT B;  3A2F A;  3U4L A;  4A2A A;  2VQE K;  4K0K K;  2VGM A;  3A5O C;  4E19 A;  2A3Z A;  4YOY A;  3N4Q A;  3VQA A;  1VQK N;  4B9U A;  3HM9 A;  4IWV A;  4CJ4 A;  5AZJ B;  1DTT A;  3OS0 A;  4GV3 A;  3OYI A;  5ADX H;  2B5J A;  3H08 A;  3AA2 A;  3H3O B;  3VQP A;  3THW B;  3HRG A;  2HHT A;  2ZQB A;  1HYS A;  2FSK A;  4AIL C;  4FK4 A;  3S9H A;  4O44 A;  5HL7 L;  1NK6 A;  3QLH A;  1S6Q A;  5CYQ A;  3VQ7 A;  5FRO A;  3DYA A;  3GL1 A;  3VEZ A;  5J2N A;  3SUO A;  5KI6 A;  3M8P A;  4CFC A;  4BDP A;  4KPY A;  2KLA A;  5C2D A;  3VA3 A;  3IMX A;  1YI2 N;  4CIF A;  1FJG K;  3KWI A;  2E2Q A;  1E4G T;  3MED A;  3PO4 A;  5CYM A;  3VEY A;  5DK5 A;  3V1R A;  4AM7 A;  1N36 K;  1TL1 A;  4U67 L;  4M3W A;  5JIC A;  3NHG A;  1IG9 A;  1HNV A;  4CJR A;  1OH5 A;  3DWL A;  4KH6 A;  1RGI A;  5ELZ A;  1KD1 O;  1RBV A;  2IOC A;  4H5W A;  4DTO A;  4MFB A;  3T1H K;  4FLW A;  1NOY A;  1ZBS A;  4BRO A;  3W3D A;  1Q7Y O;  3K5O A;  4QOZ B;  5CZ1 A;  1OKJ A;  3RR7 A;  3EKS A;  1IKY A;  4H5R A;  3Q7B A;  4OKE A;  4NXN K;  1RBR A;  2P9K A;  4FJI A;  2O8B B;  4B3R K;  1T8E A;  1P8Z A;  4M7X A;  1JLB A;  3THV A;  4CJP A;  4DF8 A;  1M1K O;  5M1K A;  3P38 A;  1KFD A;  1T3V A;  1VSD A;  3IAY A;  4DV4 K;  2QK9 A;  2GEL A;  3VTI A;  2G8K A;  4DB3 A;  3VEX A;  4IFV A;  1V4T A;  1WOQ A;  1WSF A;  1SZ2 A;  1D9D A;  4C1N I;  1QVF M;  4JYA K;  2YJE A;  5HBM A;  3LAL A;  3NE6 A;  1EKE A;  5IT9 O;  3EYZ A;  2A5X A;  1E3M A;  4DR4 K;  4EZ9 A;  2G8V A;  3K9K A;  3PO5 A;  1QSY A;  3EKU A;  3QES A;  5EOY A;  3VER A;  4H03 B;  4DMN A;  4BG8 A;  2DFE A;  5LMN K;  3ATU A;  1KCF A;  4AHT A;  4H0Y B;  1VSL A;  1WBB A;  4FWP A;  1YUW A;  3NF8 A;  2BAN A;  3TTF A;  1QQO A;  1WSE A;  2WC9 A;  3MX2 A;  1RDC A;  3CFR A;  3VPZ A;  1JLE A;  4CF0 A;  3FGU A;  3RTV A;  2DFF A;  1RDU A;  1JCG A;  1REV A;  4YY3 K;  2O8C B;  1RFQ A;  4J2A A;  4XH1 A;  4E7L A;  3WEE B;  3SPZ A;  4B3O A;  3ENB A;  4PKG A;  4PL7 A;  3ULE B;  4PY5 A;  1NGA A;  2FLO A;  2Q3S A;  1I3A A;  1XC3 A;  3DLE A;  3EZW A;  5EY4 A;  2NZT A;  1TKT A;  1BUP A;  1HKG A;  3W0L A;  3AVB A;  4CD1 A;  4I6M A;  5AQR A;  1NWK A;  4V19 S;  1NGB A;  4NLC A;  5AFU A;  1I94 K;  1BWF O;  1NBW A;  5FPE A;  3E9L A;  4U7B A;  4KTQ A;  1JL1 A;  4CJS A;  3LP0 A;  2JLE A;  2F8T A;  3DLG A;  4Q5V A;  4FM1 A;  5A2Q O;  5CR4 A;  4OX9 K;  2RF2 A;  4CEZ A;  2F4V K;  4Z94 A;  5KQ8 A;  1KLN A;  5F2R A;  4KRF A;  3MN5 A;  2P5O A;  1BDG A;  4DV1 K;  3WUH A;  1RDD A;  3MMV A;  2VQF K;  2NLX A;  1VSH A;  3NVK A;  1KSP A;  4CGG A;  4WF9 L;  5MLC Q;  4CEA A;  4G9Z A;  3E9P A;  3MN6 A;  3ZX3 A;  4FOE A;  4CGJ A;  4CJQ A;  1S9E A;  1J9A A;  4E1M A;  4Z4H A;  4JI8 K;  5GAG P;  1KQS M;  3CCS N;  4FZY A;  4IEE A;  2EWS A;  4RTF D;  3TAP A;  3PY8 A;  2UU9 K;  2A41 A;  4E7I A;  4DS5 A;  3F9K A;  3NH2 A;  1QS4 A;  1RTI A;  4DTM A;  2YHY A;  4DSE A;  4M42 A;  5I42 A;  1S5J A;  1KXP A;  1HNI A;  4FJL A;  4BR9 A;  1TYQ B;  3KLI A;  4CK1 A;  1FKP A;  3J7Y P;  4DR2 K;  4FJG A;  4CHP A;  4DLG A;  4CBW A;  1LAV A;  2NRT A;  3AVN A;  3RMC A;  2YJF A;  2O8F A;  2A1R A;  4YOX A;  3PUF A;  5KPR A;  3K59 A;  1YJN N;  3ID8 A;  4MDB A;  3ITH A;  1U04 A;  3KK3 A;  1TAU A;  4Q0B A;  1HKC A;  3NF6 A;  4I2Q A;  4BRP A;  4NO7 A;  2W40 A;  3AVC A;  4R5P A;  2WON A;  1VAZ A;  4W5O A;  4CJT A;  4DV2 K;  3SPY A;  3GDQ A;  3JXU A;  5JVH L;  2UXC K;  3U3Y A;  1SKR A;  3AAR A;  3AO5 A;  4CF1 A;  1ZBH A;  3NBP A;  1NK9 A;  1S3X A;  2KKZ A;  1XMO K;  1Q9Y A;  3CJ1 A;  1B9D A;  2P9N B;  1IBM K;  4OVL A;  3AVK A;  3C65 A;  1K8K A;  5KPZ A;  4LH4 A;  3CXC M;  3ZSV A;  3O8M A;  1UA0 A;  1R59 O;  3V9S A;  4FWR A;  3SK3 A;  3G71 N;  5BN8 A;  1WB9 A;  5C12 A;  2PFU A;  4Z4E A;  1C0T A;  1RBU A;  3OYJ A;  5DM6 L;  4CJV A;  1J5O A;  4B1X B;  3KWG A;  1HPZ A;  4CJ3 A;  1BOT O;  4WFB L;  4EHU A;  4F8R A;  3MX5 A;  1N5Y A;  1NK4 A;  2NRW A;  4JHD B;  5C2F A;  4DHY A;  4J2D A;  3MAQ A;  1I39 A;  3NF9 A;  2YV0 X;  1YXQ A;  1LWE A;  5HRR A;  4RG8 A;  3HXM A;  2ZJQ L;  4XIU A;  2IC3 A;  1RT6 A;  5M1O A;  2OZM A;  3M8Q A;  5ADX A;  4EFH A;  4BRD A;  3TTC A;  1JLC A;  2YHB A;  2FF3 B;  3WXI A;  2G8I A;  4BRA A;  3LP3 A;  2WOM A;  1IJJ A;  4IG3 A;  4DTX A;  5AQL A;  4BE2 A;  3HM8 A;  4CEC A;  2VCP A;  2PYJ A;  3FZH A;  3I8D A;  5HOO A;  4H4O A;  3CJA A;  5FPD A;  1MDU B;  3LDL A;  4FLZ A;  4NLB A;  1OH7 A;  4FJJ A;  4GVE A;  4ILH A;  4LD0 A;  4CJK A;  3PLA A;  1HYV A;  1S1W A;  5GIP A;  3LM9 A;  3O08 A;  3AO2 A;  4KI4 A;  3G10 A;  1C0F A;  1A5W A;  4KV8 A;  1YIT N;  4GKJ K;  3TAN A;  2I7P A;  3B6P A;  1KVA A;  4IBN A;  4DFK A;  2UYT A;  3QDK A;  4DTU A;  4LF5 K;  5BPL A;  2QWO A;  4KTZ A;  2OTL N;  3LAM A;  4A59 A;  3K57 A;  4CVN E;  4C1N K;  3O5B A;  3R3L A;  3ZEU A;  5IWA K;  3ZSO A;  3M6G A;  3WNH A;  3MXJ A;  5JS2 A;  3VF4 A;  3QB0 A;  4BQL A;  4ISG A;  5LMU K;  1FW6 A;  3ZT1 A;  1TKZ A;  5CY4 A;  4QS9 A;  2D5R A;  3OYD A;  4DF4 A;  5EXW A;  3KHY A;  3O1W A;  4BAC A;  1MU2 A;  4CES A;  5AQJ A;  3D2E A;  4AHR A;  4KTW A;  1WSI A;  2VYP A;  3BUZ B;  2XHB A;  4M3R A;  1RDW X;  4PKI A;  3NAE A;  3QEP A;  2BUP A;  3IKM A;  4M3X A;  4YOW A;  2ATQ A;  4DV6 K;  2QWL A;  1RDA A;  1DGK N;  3QFU A;  1IKX A;  2VWB A;  4FLT A;  3CME N;  1IG8 A;  3LAN A;  4DV7 K;  4JAX A;  3DRS A;  3OYK A;  2X6S A;  2P9I A;  4CHN A;  4CIG A;  3F9M A;  2FC0 A;  1Q81 O;  3KIO A;  3CET A;  3KKS A;  3CFP A;  2P9L A;  3O9R A;  4BRE A;  2IIR A;  3HJF A;  5CE3 A;  3MEE A;  3AVL A;  2E1Y A;  2CH5 A;  2VGN A;  4OO1 J;  4JNE A;  4DV0 K;  3V9U A;  2Y1I A;  1D8Y A;  3CJB A;  4FXD A;  2FF6 A;  4H5T A;  4CF8 A;  4LF6 K;  4H4M A;  3ZX2 A;  1VSJ A;  4WFN L;  4C8L A;  1QSL A;  3L4I A;  3O3G A;  4GY2 B;  1LV5 A;  4IJN A;  3CCL N;  4B1V A;  1BIU A;  3V9W A;  1HPM A;  2VG7 A;  1XWL A;  2Q1N A;  2IVP A;  3WT0 A;  3C6U A;  2Q36 A;  4HCB A;  1W7A A;  3VET A;  5AQZ A;  2Q0U A;  4Y0W A;  5HRN A;  3CFO A;  3RSE A;  2D0P A;  5AQU A;  4B8C A;  3J8A A;  1QHT A;  4HUF A;  1J5E K;  3LP1 A;  4KI6 A;  3BY5 A;  3ZYY X;  4JKF A;  1HUX A;  5EVZ A;  4PHT X;  5AZI B;  3PV8 A;  1L3U A;  3I0S A;  3EZ5 A;  3TSQ A;  2XY6 A;  3K9J A;  1T6C A;  4MO4 A;  2RPI A;  1OVQ A;  4DQS A;  4RW6 A;  1GLJ O;  4AHU A;  3L3V A;  3THY B;  4HUG A;  3THW A;  1WSJ A;  4CED A;  4XEI A;  2V51 B;  1XMQ K;  2OPR A;  2HBK A;  4FWM A;  5DM7 L;  1JCE A;  1O1W A;  1X3M A;  1UOC A;  4MLH A;  4IOA L;  2UXB K;  4N47 A;  4BRK A;  2P9P B;  3L4Q A;  4W5N A;  3OBY A;  3QNO A;  5DMR A;  1GLA G;  4BRN A;  3OBW A;  2ZF5 O;  3OY9 A;  4FVU A;  1YJW N;  1KVC A;  3LZI A;  2D0O A;  1BGX T;  3LL3 A;  2YNF A;  1HJO A;  1T6D A;  3LP2 A;  1EET A;  2KTQ A;  4FWQ A;  4CK2 A;  4XH5 A;  3DXM A;  1P90 A;  3HOS A;  2V7Z A;  3D7E O;  1KAY A;  3AA3 A;  1VQ9 N;  3SQ0 A;  5J2Q A;  4WQ4 C;  2F8S A;  5GAD P;  2P9S A;  3UKU A;  3SZ2 A;  4DSF A;  2G8H A;  5C0Y A;  1KLM A;  4QAG A;  3VF6 A;  4DSI A;  1SKS A;  2CH6 A;  1QTM A;  2J4R A;  3IFR A;  1ESV A;  1NLV A;  4CHQ A;  4QCL A;  4CHO A;  2IAJ A;  3PSI A;  3L2Q A;  2KFN A;  1MWM A;  3ZSY A;  1D9F A;  2HOE A;  3OS2 A;  2GUP A;  4CW7 B;  1BHL A;  1J54 A;  4H0T B;  4KFB A;  2ZE2 A;  4O55 A;  4CGD A;  1RT3 A;  4W5Q A;  3OVN A;  3LAK A;  4FZZ A;  4O5B A;  3P1G A;  1L3S A;  1W2B M;  4M7Y A;  3TAF A;  3LWL A;  4O8K A;  5AQT A;  2HNY A;  5E26 A;  1U2V B;  1RCH A;  2Q31 A;  4QS8 A;  3VEO A;  4FSV A;  1HNZ K;  4FJN A;  5C15 A;  3SBG A;  2ZJP L;  2NUB A;  4FJ5 A;  2D1K A;  3THX B;  3A5M C;  3OYM A;  2HF3 A;  1NMN A;  3AVI A;  1RTH A;  1ZC6 A;  2FSN A;  4CZG A;  1XNQ K;  4PUO A;  1ZBF A; 
#chains in the Genus database with same CATH homology
 2VWJ A;  1KLN A;  5KGX A;  5T7B A;  1N6Q A;  3OYH A;  3LWM A;  4Y1C A;  4KRF A;  1JKH A;  3M8S A;  4M3Z A;  3ZSW A;  3DMJ A;  2P5O A;  1TVR A;  1RDD A;  1TL3 A;  3ALY A;  4FZX C;  5CZ2 A;  3WNE A;  3LPU A;  3ZSQ A;  1VSH A;  1T7P A;  4ELU A;  1XHX A;  4NYF A;  1C0U A;  1KSP A;  4CGG A;  2QKK A;  2D0C A;  1S1T A;  2HHV A;  1A5V A;  3SNN A;  2HHW A;  4BWJ A;  4M3U A;  2YNH A;  3ZT2 A;  4FJ8 A;  4CEA A;  2HHS A;  1JLQ A;  4CEF A;  1X9W A;  4HHT A;  1BI4 B;  5KTQ A;  4CGJ A;  4B08 A;  4CJQ A;  4E89 A;  2E6M A;  1Y97 A;  1S9E A;  1VSF A;  2FBV A;  2ITG A;  4KKO A;  4EP5 A;  1NJW A;  1TK5 A;  3U3G A;  3TAB A;  3C6T A;  1J9A A;  4O0J A;  3OJU A;  4M3T A;  3ZCM A;  2A1S A;  4JS4 A;  2D0B A;  3SQ4 A;  4CCH A;  1RIL A;  4E1M A;  4Z4H A;  4CJL A;  2DTU A;  4FZY A;  4IKF A;  1GOC A;  1CLQ A;  1WN7 A;  4ZTF A;  5KRT A;  5HP1 A;  3HVT A;  2G8W A;  4C8M A;  4HCC A;  3TAP A;  3JYT A;  1VSE A;  2JGU A;  1SL2 A;  3PY8 A;  4QOZ B;  3F73 A;  4E7I A;  4DS5 A;  1HJR A;  2HW3 A;  1SL1 A;  1RT7 A;  3F9K A;  3NH2 A;  1QS4 A;  1RT1 A;  1RTI A;  1Z26 A;  4FLY A;  2R7Y A;  4DTM A;  4KAZ A;  4DSE A;  4E1N A;  3DLK A;  3AA4 A;  1S5J A;  3KJV A;  5I42 A;  4M42 A;  2HVH A;  1CXU A;  4DFM A;  1HNI A;  3PX0 A;  1GOB A;  4AHV A;  4L8R B;  2PZS A;  3MEG A;  4DSK A;  3DLH A;  2Y1J A;  2YHA A;  5FDL A;  3SUQ A;  4FJL A;  1TAQ A;  1QQC A;  3KLI A;  5FRN A;  1VK0 A;  4IG0 A;  3VQ4 A;  3HP9 A;  4CK1 A;  5KRS A;  3QEX A;  1FKP A;  3SJJ A;  2VG5 A;  4FJG A;  4C8N A;  1C6V A;  3HJF A;  3KLH A;  4CHP A;  4DLG A;  4IDK A;  1LAV A;  3AVN A;  1JXB A;  4JRP A;  1K6Y A;  3RMC A;  5HLF A;  2A1R A;  4FJK A;  1LW0 A;  3PUF A;  4B9V A;  3K59 A;  2YNI A;  3LDS A;  4FJ7 A;  3VQD A;  4GVM A;  4E3S A;  4HTU A;  3HPG A;  3ITH A;  1U04 A;  4F2R A;  1TGO A;  4F4K A;  1RBS A;  2X74 A;  1C1B A;  2XO7 A;  3KK3 A;  1NK8 A;  3T3F A;  4Q0B A;  1TAU A;  3TAM A;  1WNS A;  2HND A;  3NF6 A;  4CE9 A;  3QIN A;  3HT3 A;  4I2Q A;  3T1A A;  2KW4 A;  4I9Q A;  4JS5 A;  3HP6 A;  3AVC A;  1UAX A;  4R5P A;  2WON A;  1U48 A;  4W5O A;  2P51 A;  4CJT A;  3SQ2 A;  2EX3 A;  3DOL A;  2D0A A;  1CZ9 A;  4H8K A;  4CJW A;  3AVM A;  2XY7 A;  3C94 A;  3L8B A;  3SPY A;  1XHZ A;  5HRP A;  1U4B A;  3NH1 A;  1NK5 A;  4DSL A;  1S1U A;  1QSS A;  2HHU A;  4CFA A;  1IKV A;  4FCY A;  3L2U A;  3U3Y A;  1SKR A;  1R0A A;  3AO5 A;  4CF1 A;  1HQE A;  2OZS A;  1HYZ A;  1ZBH A;  3OYB A;  3IS9 A;  3NBP A;  4DLE A;  4UQG A;  3SUN A;  1NK9 A;  3MXM A;  4FM0 A;  4LSN A;  1S6P A;  2EHG A;  3HPH A;  4Z0U A;  1Q9Y A;  1B9D A;  4G1Q A;  4OVL A;  3AVK A;  1ZBI A;  4LH4 A;  3JSM A;  4N76 A;  5D3G A;  1D5A A;  3ZSR A;  3ZSV A;  3RWU A;  4FJX A;  4Z4I A;  1UA0 A;  4CF9 A;  4KHY A;  2I5J A;  4K8Z A;  3V9S A;  3TAG A;  4DQR A;  4DQP A;  1XC9 A;  4F2S A;  1JLF A;  3AO1 A;  3VQC A;  2IS3 A;  4WE1 A;  3NDK A;  1KRP A;  4I9L A;  1WSG A;  4B9S A;  4CGF A;  1C0T A;  4Z4E A;  4OGC A;  1RBU A;  3KK2 A;  4OLA A;  2HHQ A;  3OYJ A;  4DTN A;  1LAW A;  2KQ2 A;  4IFY A;  5C42 A;  4M3Y A;  2HB5 A;  3L2W A;  3AVJ A;  2BDP A;  4CJV A;  1J5O A;  2PYL A;  4DS4 A;  1HPZ A;  4CJ3 A;  2XY5 A;  3P5J A;  4DFJ A;  3AO3 A;  1S1V A;  3HYF A;  3QET A;  4F8R A;  1N5Y A;  2HHX A;  4CEB A;  3RMD A;  4B9L A;  1NK4 A;  1JLA A;  2XY8 A;  4KRE A;  1T05 A;  4KHS A;  4FJH A;  1SV5 A;  4FLU A;  4J2D A;  4DTS A;  1J53 A;  4CHY A;  3MAQ A;  2OYQ A;  4YFU A;  3HL8 A;  3QO9 A;  1I39 A;  4KHW A;  3NF9 A;  3ZSZ A;  2YV0 X;  3L3U A;  1LWE A;  3QIO A;  5HRR A;  4CEE A;  2Z1I A;  4RG8 A;  1ZBL A;  4DU3 A;  4TSX A;  4OPJ A;  2OPS A;  5C25 A;  2X6N A;  3HXM A;  4W5T A;  3CM5 A;  4XIU A;  2IC3 A;  1RT6 A;  4K8X A;  3OYC A;  4BDY A;  4Z4F A;  3AVG A;  2OZM A;  3ZT3 A;  3M8Q A;  4CJF A;  2ZD1 A;  3VA0 A;  4EP4 A;  2KZZ A;  4BE1 A;  2YKN A;  4Z4G A;  2DFH A;  3QIP A;  2Z1H A;  3QEW A;  3V9Z A;  3CQ8 A;  4OKJ A;  1JLC A;  2YHB A;  1L3T A;  4E7H A;  3S3M A;  4I2P A;  3LP3 A;  3KD5 E;  3DLR A;  2G8I A;  2WOM A;  3VN5 A;  4ELV A;  4IG3 A;  4O4G A;  1DTQ A;  2W42 A;  5J2P A;  1L3V A;  4KB1 A;  4AHS A;  4BE0 A;  3IG1 A;  4FVM A;  4DTX A;  1VRT A;  3VQE A;  4BE2 A;  1YT3 A;  4DFP A;  1U45 A;  4CEC A;  3SV4 A;  1GOA A;  3AVA A;  1ASV A;  2F96 A;  4CFD A;  2PYJ A;  3TR8 A;  4RW4 A;  4CFB A;  2GV9 A;  2G8U A;  3QER A;  3SQ1 A;  4NCA A;  1HQU A;  4KHU A;  1S1X A;  3I8D A;  3RRG A;  4H4O A;  3QNN A;  4KO0 A;  1KVB A;  3BDP A;  3NF7 A;  3TAE A;  2BE2 A;  1EXQ A;  1TKX A;  4FLZ A;  4FJJ A;  3K2P A;  3AO4 A;  4E7J A;  4E0D A;  5J2M A;  3NFA A;  4ID5 A;  4LD0 A;  4CJK A;  1T03 A;  3NGI A;  1HYV A;  1S1W A;  3D0P A;  1Q9X A;  4PWD A;  1BIZ A;  1ITG A;  2YKM A;  3L2R A;  4CEO A;  3SI6 A;  5HRO A;  3AO2 A;  1QE1 A;  3G10 A;  4CHZ A;  1A5W A;  4BDZ A;  4KI4 A;  1Z25 A;  4FW2 A;  4KV8 A;  3RR8 A;  1JLG A;  4FLV A;  4Z4C A;  4DSJ A;  2ETJ A;  3TAN A;  1HMV A;  4OPK A;  2IDO A;  3S3O A;  1FK9 A;  2LSN A;  3V1O A;  3B6P A;  2X78 A;  3ZT4 A;  5SWM A;  1FKO A;  1KVA A;  4LSL A;  2B4J A;  3SV3 A;  2G8F A;  3BGR A;  4IBN A;  4DFK A;  1VSK A;  4DTU A;  3I0R A;  4DTJ A;  3ASM A;  4KTZ A;  1BCO A;  3NGZ A;  4J2B A;  3LAM A;  3HK2 A;  4F3T A;  3K57 A;  4W5R A;  1YTA A;  3TAR A;  4MQ3 A;  4CGH A;  1EP4 A;  3QEV A;  1WSH A;  3MXI A;  3ZSO A;  4KB0 A;  2FBY A;  3WNH A;  3MXJ A;  2RN2 A;  5JS2 A;  4CJU A;  4FM2 A;  3PX4 A;  4KHN A;  4ELT A;  3L2V A;  1NOZ A;  1BI4 A;  4RW8 A;  1W0H A;  3O4N A;  3ZT1 A;  1EX4 A;  2E4L A;  4HVJ A;  1TKZ A;  2QKB A;  5CY4 A;  4BWM A;  2D5R A;  1JL2 A;  3OYD A;  3TI0 A;  4DF4 A;  3EY1 A;  3KLG A;  4BAC A;  1U47 A;  1X9S A;  1C1C A;  1MU2 A;  4CES A;  4N5S A;  4E7K A;  4AHR A;  4KTW A;  1NK7 A;  1WSI A;  1L5U A;  3DOK A;  1A5X A;  1WLJ A;  4PQU A;  1SUQ A;  1WAJ A;  4PA1 A;  2XHB A;  3QEI A;  1C1A A;  4M3R A;  3OJS A;  4KHQ A;  3FFI A;  3NAE A;  3QEP A;  1NJY A;  4ZHR A;  1BIS A;  4M41 A;  3A2F A;  3K58 A;  4M3X A;  1NJZ A;  1WAF A;  2ATQ A;  1NKE A;  1RDA A;  2E6L A;  1X9M A;  4N41 A;  1IKX A;  4N56 A;  3MEC A;  4FLT A;  3SYZ A;  4FYD A;  3LAN A;  4CF2 A;  4E19 A;  3DRS A;  1TKD A;  3OYK A;  2X6S A;  1ZYQ A;  2HVI A;  3VQA A;  4CHN A;  4CIG A;  2FC0 A;  3VQ8 A;  3K5L A;  3HM9 A;  3KIO A;  1NK0 A;  4B9U A;  3KKS A;  3CFP A;  1NKC A;  4CJ4 A;  1RNH A;  1DTT A;  1KTQ A;  2HNZ A;  3DM2 A;  3C95 A;  1IO2 A;  3LPT A;  5SZT A;  3OS0 A;  3OYI A;  1NJX A;  3MEE A;  3AVL A;  2B5J A;  3H08 A;  5E41 A;  4I7F A;  1IH7 A;  4CGI A;  4CIE A;  3AA2 A;  2Y1I A;  3V9U A;  3VQP A;  1D8Y A;  2HHT A;  2ZQB A;  4FXD A;  1HYS A;  4CF8 A;  2FBT A;  4H4M A;  4AIL C;  3VQB A;  4FK4 A;  3S9H A;  3OYG A;  1BL3 A;  4O44 A;  1VSJ A;  4C8L A;  1QSL A;  1NK6 A;  3QLH A;  3O3G A;  1S6Q A;  5CYQ A;  1LV5 A;  3VQ7 A;  3NGY A;  1XI1 A;  5FRO A;  3DYA A;  4J2E A;  5J2N A;  3OYA A;  5KI6 A;  3E01 A;  3SUO A;  2P5G A;  2O4I A;  1BIU A;  3M8P A;  4NYN A;  3WNG A;  4CFC A;  4CK3 A;  3V9W A;  4BDP A;  4KPY A;  2VG7 A;  3VA3 A;  2B6A A;  3VQ9 A;  3P83 D;  3CYM A;  4FK0 A;  1XWL A;  3B6O A;  5EU7 A;  4CIF A;  1TK8 A;  3HO1 A;  3MED A;  3PO4 A;  5CYM A;  3C6U A;  5DK5 A;  3V1R A;  4C8K A;  1RTD A;  4B9M A;  4LH5 A;  1TL1 A;  4HCB A;  5KGW A;  4M3W A;  3NHG A;  1TK0 A;  3ISN C;  3RMB A;  3SCX A;  1IG9 A;  1HNV A;  4CJR A;  5C24 A;  5HRN A;  3CFO A;  4CJE A;  2OA8 A;  4LY7 A;  4B8C A;  4FK2 A;  3K5M A;  1QHT A;  4HUF A;  1HRH A;  1RBV A;  2IOC A;  3LP1 A;  3NCI A;  4KI6 A;  3DI6 A;  4DTO A;  3DLB A;  4MFB A;  4OKK A;  2YNG A;  3S3N A;  3ZSX A;  4FLW A;  1NOY A;  3K5O A;  1ASW A;  1RT5 A;  1B9F A;  1BQN A;  5CZ1 A;  3PV8 A;  3I0S A;  1L3U A;  3EZ5 A;  3KD1 E;  2OPP A;  3RR7 A;  1IKY A;  2XY6 A;  4ZTJ A;  4OKE A;  2RPI A;  4DQI A;  4DWI A;  4DQS A;  4RW6 A;  1RBR A;  2Z1J A;  1YTU A;  4B8A B;  1SKW A;  3DRP A;  4FJI A;  4AHU A;  1ASU A;  3L3V A;  5K14 A;  4HUG A;  1T8E A;  1F21 A;  2QXF A;  3DRR A;  1WSJ A;  3M8R A;  3TWH A;  4FW1 A;  1LW2 A;  4JRQ A;  4C8O A;  1JLB A;  3THV A;  4CJP A;  4DF8 A;  4CED A;  1YVU A;  1KFD A;  1BQM A;  3RRH A;  1VSD A;  2OPR A;  3IAY A;  3OYE A;  4NCB A;  2GBZ A;  3RMA A;  2QK9 A;  1Q8I A;  1CZB A;  1RDB A;  1O1W A;  5HRS A;  1UOC A;  3WNF A;  2G8K A;  4N47 A;  4OJR A;  2GUI A;  3OYF A;  3HVR A;  1RBT A;  1SL0 A;  3KTQ A;  3KLF A;  4IFV A;  4Y1D A;  1WSF A;  1D9D A;  2AJQ A;  1ZBU A;  4W5N A;  3QNO A;  2PY5 A;  5DMR A;  5HBM A;  4ID1 A;  4HUE A;  3VQQ A;  1LWF A;  3LAL A;  1VRU A;  3NE6 A;  3U6F A;  1EKE A;  2RKI A;  3EYZ A;  2BGG A;  4EZ6 A;  3OY9 A;  2HMI A;  1IKW A;  4OGE A;  3AV9 A;  1KVC A;  3LZI A;  4EZ9 A;  2FBX A;  2G8V A;  3PO5 A;  1BGX T;  1QSY A;  3V9X A;  3KKR A;  5JS1 A;  3QES A;  4DMN A;  2YNF A;  2DFE A;  2VWK A;  1B92 A;  4GMJ B;  3PX6 A;  2KZM A;  2OPQ A;  4RW9 A;  3LP2 A;  1EET A;  2KTQ A;  3TAQ A;  4CK2 A;  3NH0 A;  1KCF A;  4NCG A;  4AHT A;  1TV6 A;  1VSL A;  3AVF A;  3AA3 A;  3VQ5 A;  2Z1G A;  4DU1 A;  3SQ0 A;  5J2Q A;  1UA1 A;  3NF8 A;  2BAN A;  4OLB A;  2F8S A;  3T19 A;  3KK1 A;  4B9T A;  1WSE A;  4AH9 A;  3SZ2 A;  1RDC A;  3OYL A;  3CFR A;  4DSF A;  2G8H A;  1KLM A;  1KFS A;  1VSI A;  2KFZ A;  4QAG A;  3SUP A;  3UIQ A;  3AA5 X;  4DQQ A;  3IRX A;  1JLE A;  4CF0 A;  3ZT0 A;  3V4I A;  3ULD A;  4DSI A;  1SKS A;  3O4Q A;  3CM6 A;  1QTM A;  3RTV A;  2DFF A;  1C0M A;  1REV A;  3OS1 A;  3OYN A;  1RT4 A;  4CHQ A;  4DTR A;  4QCL A;  4CER A;  1DLO A;  4CHO A;  2IAJ A;  4YNQ A;  3L2Q A;  2XRI A;  2KFN A;  2O4G A;  4J2A A;  4E7L A;  3ZSY A;  1D9F A;  2IGI A;  3OS2 A;  3SPZ A;  1UWB A;  4B3O A;  3VQ6 A;  1BHL A;  4ICL A;  4PY5 A;  1J54 A;  3HPO A;  4RW7 A;  2Q3S A;  3O3F A;  1I3A A;  3DLE A;  4KFB A;  2ZE2 A;  4O55 A;  1X1P A;  1RT3 A;  4AHC A;  1VSM A;  4CGD A;  1TKT A;  3OVN A;  4W5Q A;  3LZJ A;  4DTP A;  3LAK A;  3V6D A;  4FZZ A;  3AVB A;  4O5B A;  3P1G A;  1L3S A;  4B9N A;  3TAF A;  3LWL A;  1FXX A;  1U49 A;  2HNY A;  3CG7 A;  4CEQ A;  3V81 A;  3HST B;  1S9G A;  1RTJ A;  1RCH A;  1BCM A;  4DG1 A;  3O3H A;  2VG6 A;  2P1J A;  3D45 A;  4GW6 A;  4JLH A;  4FJ9 A;  5FRM A;  3AVH A;  4KTQ A;  2DY4 A;  4FJN A;  1LWC A;  4M45 A;  1JL1 A;  4CJS A;  4O0I A;  1NKB A;  3LP0 A;  2JLE A;  2NUB A;  3DLG A;  4F3O A;  5I3U A;  2F8T A;  3G0Z A;  4FJ5 A;  4Q5V A;  3OYM A;  1W9H A;  4FM1 A;  4DU4 A;  1RT2 A;  3AVI A;  1RTH A;  1JXE A;  2RF2 A;  4CEZ A;  1CXQ A;  3KLE A;  5J1E A;  3K5N A;  4FJM A;  1ZBF A;  3V1Q A;  1G15 A;  4PUO A;  4CJ5 A;  4FLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...