1RBSA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEACEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbsA00
1JXBA 3V1OA 2YNIA 3KLEA 4L8RB 1RT6A 4Y1DA 4RW4A 3HP6A 3WNEA 4CJUA 1VSIA 3L2UA 2A1RA 5CYMA 1TKTA 4KHQA 2OYQA 4FVMA 1D9FA 1WN7A 1NJYA 3KK1A 1LWFA 3FFIA 4LSNA 4HUEA 3LP0A 3L2QA 1LWEA 5EU7A 4CJTA 3DYAA 1GOAA 4FJXA 1S1XA 1RCHA 3VQ6A 3OS1A 4DTXA 3LWMA 4KTZA 1VSLA 3U3YA 3TAQA 1FXXA 2D5RA 3KTQA 4E19A 4DG1A 1XWLA 4N5SA 1NKCA 4LH5A 2HVIA 2P1JA 3DRRA 1BI4B 2XY7A 4CF2A 3OY9A 3L2RA 4E7HA 1RNHA 1Q9XA 3KD5E 1L3VA 4CJVA 2KZZA 4CF8A 1BL3A 4DQIA 5KRSA 4YNQA 3AVBA 1HYZA 3SV3A 1S9GA 1T8EA 4ELVA 2E6MA 4G1QA 1LW2A 1VSJA 4BDPA 3SYZA 2RPIA 1HNVA 3G0ZA 2PY5A 1SL1A 3PO4A 2P51A 3OYBA 4M3XA 3I0RA 4H4MA 1JLGA 3M8RA 4FZXC 1D8YA 4CECA 3MEGA 4CERA 4FJHA 2XRIA 4DTRA 3AVLA 3HPGA 3ZSOA 3MEEA 1GOCA 3NGYA 4GMJB 4Z0UA 4CJFA 3KLGA 1BIUA 4DU3A 2F96A 3OYMA 3TAEA 3DLHA 3IRXA 4DTSA 2XY5A 4W5NA 1ASWA 3HP9A 3SV4A 3AVFA 2IGIA 4AHVA 2KQ2A 4YFUA 3HVRA 1EXQA 1REVA 2EX3A 1UOCA 3QERA 4FW1A 1U49A 3NF9A 3VQCA 4HCCA 1WNSA 3SQ4A 4KHWA 4HTUA 2X74A 4DFKA 4OGEA 4CJ5A 3SPZA 2I5JA 2IDOA 3DOKA 4M3UA 2HVHA 1WSIA 3AO4A 4B8AB 2HNZA 4KTWA 2DFHA 1B92A 4FJGA 2KZMA 4E7KA 1IKYA 1C0UA 3KK2A 3AA5X 3RR7A 4F4KA 3AO2A 1L3SA 3DRPA 2IAJA 1YTAA 4DTPA 3SUNA 4AILC 1U45A 3DOLA 3KLHA 4CEQA 3V9XA 1VSFA 4FLVA 3S9HA 3L2VA 1A5VA 4DSLA 1RBRA 1UAXA 4LY7A 4DLGA 5HLFA 4CGFA 4W5TA 2Z1JA 3TAPA 1VSMA 1IKVA 1WLJA 4OKKA 4DU4A 3QEVA 1C6VA 4WE1A 4O5BA 4CGDA 4FLWA 1NK5A 3RMBA 1R0AA 4KAZA 5CYQA 2G8HA 1NKEA 1ASUA 4AH9A 2E6LA 3TWHA 1NOYA 4F3TA 3OS2A 4W5RA 3NH2A 3I8DA 4OKEA 3SPYA 3NGZA 3THVA 4ID5A 4KO0A 3AVIA 3LANA 3HT3A 4DSKA 1TK5A 2G8KA 1TV6A 4NCBA 3OYEA 3NGIA 4J2DA 1RBUA 1RILA 1XHXA 4IG3A 4LD0A 4FM2A 3JYTA 3L8BA 3OYHA 4KHNA 3LALA 3U3GA 3WNFA 3LAMA 4CJLA 3OYGA 3DLEA 3BGRA 4CJRA 2R7YA 4NCGA 4JS5A 2DFFA 3ZSYA 1RBTA 3ZT2A 4CJWA 1T7PA 2HMIA 3PY8A 1F21A 1SKRA 3RRGA 4RW7A 3NBPA 1RBVA 3NH1A 4H8KA 4IG0A 5KTQA 1FKOA 2E4LA 2OPSA 5HROA 1BGXT 3NH0A 2O4GA 3PO5A 4Z4EA 1JLFA 1VSEA 4DQQA 4M41A 4B9UA 4DQSA 1C0TA 2KFZA 1D5AA 4ICLA 3C6UA 1TK0A 4Q0BA 4FJJA 1U4BA 3DLBA 3MXMA 1U47A 5HRRA 4B9SA 4Y1CA 4CJSA 1RDDA 1LW0A 3PUFA 3VQ5A 1X1PA 2Z1IA 1QSSA 4CEEA 2FBVA 1QQCA 3K59A 2P5OA 4FJ9A 4FXDA 4FW2A 4LSLA 1Q8IA 2HNDA 3VQPA 3HPOA 4B9VA 5E41A 2P5GA 1HYVA 4W5QA 3AVHA 4CFCA 2GUIA 3KKRA 3VQBA 4BWMA 3VA0A 3V9WA 3U6FA 3IS9A 4CHZA 4JLHA 4FJ5A 2OZMA 4PUOA 2HHSA 3KJVA 3OYIA 3DRSA 1KSPA 4PQUA 4ZTJA 3HSTB 4F2RA 1S1TA 3LZJA 1WSGA 3O3HA 3P1GA 1NKBA 2BE2A 4K8ZA 3AA3A 1JLCA 2VG6A 3L3UA 1G15A 2ZE2A 4KHSA 3PV8A 4HUFA 4C8MA 3OYFA 1J5OA 3LP2A 1HMVA 1X9SA 3AVJA 4QOZB 4CGJA 4MQ3A 1YTUA 1CZBA 3SQ0A 3AV9A 4NYFA 1ZBFA 3BDPA 3HK2A 4FJLA 4IDKA 2G8WA 3G10A 3NAEA 2YNFA 3O3GA 3QIPA 3V6DA 4FCYA 3TI0A 4CIEA 3IG1A 4ELTA 4IFYA 4CHYA 4FM1A 1EKEA 1HQUA 4FJNA 1RBSA 2HHVA 3KK3A 2VWJA 4FJ8A 4I7FA 3OS0A 3OYCA 3K58A 1TL3A 4CFDA 1I3AA 2YNHA 2PYLA 1BQNA 3AA4A 1RT7A 4CF0A 4E3SA 1HNIA 4Z4IA 2Y1IA 1N5YA 2WOMA 4HCBA 3S3NA 4BE0A 1ZBIA 2Q3SA 2EHGA 2KW4A 4CEAA 3OJSA 1T05A 3HXMA 1NK0A 4M42A 3HJFA 2W42A 4CIFA 5J2MA 1NOZA 1B9FA 3F73A 3QEWA 2HHTA 3DLGA 3JSMA 1L3TA 3MEDA 4OGCA 4DLEA 1BQMA 5FDLA 4AHUA 4Z4HA 2DY4A 3QESA 4HVJA 3MXIA 1WAJA 2ITGA 3ZSXA 2QXFA 3OYJA 4KB1A 1ZYQA 1C1CA 4CFAA 3CFPA 4F8RA 2GV9A 3ULDA 4FLZA 2G8IA 1VSHA 2XHBA 1A5XA 3VQ7A 5J2QA 4C8LA 3VA3A 1J53A 2FBYA 1NK9A 3NF6A 3DM2A 5D3GA 3P83D 4B9MA 3AVAA 4E89A 3OVNA 4K8XA 5DMRA 4GVMA 2HHQA 3C6TA 1RTJA 4EZ9A 1WSJA 4FLUA 3S3OA 1A5WA 1CXQA 1EP4A 5J1EA 4DTNA 1DTQA 3QO9A 3AVKA 2HNYA 4N47A 4CEDA 4DSEA 1T03A 1TAQA 4H4OA 5KGXA 3DLKA 4DMNA 2YV0X 3HL8A 4C8KA 1TAUA 3CFRA 3DLRA 3I0SA 4O44A 5FRNA 4CJ4A 4AHCA 3WNGA 1BI4A 4Z4FA 4CGGA 3CQ8A 2LSNA 3TAGA 3LWLA 3WNHA 3OYKA 5FRMA 4CHPA 3VQAA 1RT4A 3ZSVA 4E7JA 3QINA 3QLHA 3L2WA 1C1BA 2KFNA 1UA0A 4M3TA 1C0MA 3TABA 5CY4A 4DFJA 5I3UA 5CZ2A 2HHXA 4EP5A 4OVLA 3ZSZA 4CJKA 2FBTA 3NF8A 3SQ1A 1GOBA 3TANA 2BDPA 1KCFA 2OZSA 4FK2A 2B6AA 4N56A 1X9WA 4FK4A 4KREA 4MFBA 4CE9A 2QKKA 1SKWA 3M8SA 3NE6A 1IKXA 4EP4A 1SUQA 2RN2A 4BDZA 4DQRA 4DFMA 4TSXA 4CCHA 2YKMA 3O4NA 3MECA 5C42A 4E1MA 4OKJA 4J2BA 2KTQA 3KKSA 3SUQA 1HYSA 4FLYA 3PX4A 5SWMA 3VQDA 4KI6A 1KLNA 2RKIA 3QNNA 1VRTA 3LP3A 5HRNA 4XIUA 3K57A 4DQPA 3AVGA 4M3WA 4DS4A 4E1NA 2AJQA 2Z1HA 1JL1A 3OJUA 4AHTA 1S5JA 4CGIA 1NK8A 4Z4GA 3ZSQA 3RMCA 1QE1A 3V9UA 1S1VA 5KGWA 3SUPA 3NCIA 4DSFA 4CEBA 4F2SA 2D0CA 1JLEA 1KRPA 3K5MA 3RMAA 4FZZA 1BHLA 1MU2A 2VG7A 1EX4A 3LP1A 1KTQA 1NJZA 3ZSWA 4HUGA 4B8CA 2FC0A 3RMDA 3T19A 3OYNA 4JRPA 1S6QA 1TK8A 1IO2A 1HQEA 4NYNA 1IH7A 1Z26A 4PWDA 5C25A 3SZ2A 4FJMA 5J2NA 3ZT4A 3LDSA 1TVRA 3LPUA 3TAMA 1NJWA 4EZ6A 1Y97A 4ZTFA 3AA2A 1QHTA 2VG5A 3K5NA 4CEFA 4B3OA 1JL2A 3QETA 1RT2A 3SCXA 1Q9YA 4FLXA 2ATQA 2ZD1A 4B9LA 2ZQBA 4CJQA 4FM0A 3E01A 4OJRA 4Q5VA 3AO1A 4E7LA 1XC9A 1D9DA 1SKSA 2HB5A 4CHNA 2HHWA 4PY5A 1YT3A 4AHSA 4FYDA 2D0AA 4KB0A 4RG8A 2IS3A 3V9SA 4DWIA 1IKWA 4M3YA 4OPKA 4CK3A 3TARA 3ITHA 2XY8A 5C24A 4LH4A 4M3ZA 3NFAA 3LAKA 3MXJA 4M3RA 3B6PA 3HPHA 3L3VA 3M8QA 1QSYA 3CYMA 4N41A 1VSDA 1S9EA 1WAFA 1K6YA 3DI6A 4KKOA 4CEZA 5HRPA 4FLTA 3K5LA 4DFPA 1KVBA 2YHAA 4IKFA 1ITGA 1I39A 3A2FA 2D0BA 4GW6A 1WSHA 4QAGA 3LPTA 3LZIA 3V9ZA 3T3FA 4B9TA 3EYZA 4KFBA 4CF1A 3RRHA 4KHUA 4HHTA 3SI6A 2IOCA 5CZ1A 1RDBA 1FK9A 2DFEA 1IG9A 4NCAA 3TR8A 1U48A 4DS5A 3O3FA 4ID1A 3S3MA 4RW8A 1N6QA 1U04A 1SV5A 1S6PA 4RW6A 2X6SA 3VQEA 3QEXA 1S1UA 2FBXA 5I42A 3HVTA 2JLEA 1JLQA 2YKNA 1LAVA 2ETJA 3CM5A 4N76A 3C94A 3TAFA 4DSIA 4I2QA 4ZHRA 4DF8A 3VQ8A 3C95A 1SL0A 1TGOA 4DTJA 4CJEA 2X6NA 2RF2A 4O4GA 2OA8A 5K14A 3MAQA 1B9DA 1UA1A 1EETA 3QNOA 2B5JA 1HJRA 3QIOA 4CHQA 1RTIA 1RT1A 3V1RA 3QEIA 2NUBA 4R5PA 1DTTA 2HW3A 4UQGA 4PA1A 1TKXA 3VQ4A 1TKZA 1UWBA 3AVCA 4I2PA 4I9LA 4BE1A 3OYDA 3SNNA 4CJPA 4DSJA 4I9QA 4C8NA 2O4IA 1JKHA 3PX6A 3SQ2A 4IFVA 4C8OA 4FZYA 4F3OA 3RWUA 1KVAA 1RT5A 4W5OA 1O1WA 4CHOA 3OYLA 1J9AA 4JRQA 3ZCMA 3SJJA 3ALYA 3HYFA 3EZ5A 2PZSA 2DTUA 2JGUA 3AVNA 3M8PA 3ZT3A 1ZBLA 3AO3A 1CXUA 3ASMA 3K5OA 1Z25A 3V1QA 4DTMA 3H08A 5J2PA 2IC3A 4B08A 1DLOA 2GBZA 4O55A 4BWJA 4CK2A 3OYAA 5HRSA 5HP1A 2OPQA 3DMJA 3ZSRA 4KI4A 2X78A 3NDKA 3O4QA 5DK5A 1HRHA 4FJKA 1BCOA 1S1WA 4Z4CA 1XHZA 2BGGA 3K2PA 3VQ9A 3HM9A 2BANA 2Y1JA 1TKDA 4BDYA 1NK7A 4CK1A 2G8UA 1FKPA 3ZT0A 1NK4A 4CESA 1J54A 4DTUA 1WSFA 4KPYA 4KTQA 1VK0A 1RDAA 2B4JA 2YNGA 3NHGA 1SL2A 1QSLA 2YHBA 3D45A 2F8TA 4RW9A 3UIQA 1JLBA 4E0DA 4CFBA 4J2EA 1ZBHA 5JS2A 3F9KA 3ISNC 4QCLA 3RTVA 4DF4A 1W9HA 4FK0A 3KIOA 4FJIA 1QTMA 5T7BA 5SZTA 1X9MA 3CM6A 1KVCA 3B6OA 2QK9A 5FROA 4DTOA 1KFDA 1JLAA 2G8FA 1RDCA 5JS1A 1BIZA 1LV5A 2PYJA 4FJ7A 4J2AA 4CIGA 3KD1E 5HBMA 4BACA 1VRUA 1JXEA 4KRFA 1XI1A 5KRTA 4JS4A 4ELUA 3AO5A 1C1AA 2A1SA 4AHRA 1VSKA 1LWCA 4OPJA 4CGHA 3HO1A 2OPPA 3KLIA 3AVMA 4E7IA 4CJ3A 1BCMA 4KHYA 1WSEA 3D0PA 2OPRA 3ZT1A 3QEPA 1KLMA 3V81A 3VN5A 4IBNA 2G8VA 3V4IA 1RT3A 3PX0A 4DU1A 3KLFA 1ASVA 2Z1GA 1YVUA 2WONA 5KI6A 3CFOA 1LAWA 1NK6A 4O0JA 3NF7A 1HPZA 1RTDA 3CG7A 4KV8A 1L5UA 4B9NA 4OLBA 4CEOA 1BISA 2F8SA 2HHUA 4M45A 3EY1A 3SUOA 1QS4A 1TL1A 2VWKA 1CZ9A 1CLQA 3T1AA 4OLAA 2XY6A 1ZBUA 4O0IA 1NJXA 1KFSA 1W0HA 3VQQA 4BE2A 1RTHA 2QKBA 3RR8A 3IAYA 4CF9A 3P5JA 2XO7A 1L3UA
chains in the Genus database with same CATH superfamily
5BREA 4L8RB 1RT6A 1T6DA 1SQKA 2E5LK 2A1RA 5CYMA 1TKTA 4I6MA 3L0QA 1GLBG 1D9FA 3E9OA 2E2OA 3TTDA 1LWFA 4HUEA 3L2QA 4CJTA 4FJXA 1NGIA 3M6GA 3OS1A 3TAQA 5KQ8A 4N5SA 1K8AO 3D2FA 1HNXK 4LH5A 2HVIA 4CF2A 4B3SK 3L2RA 1RNHA 1Q9XA 3KD5E 2KZZA 4JHDB 3JXUA 3AVBA 4BRHA 1S9GA 2WFBA 4B3TK 2QWQA 1HNVA 3G0ZA 3NMUA 4M3XA 2YX6A 3I0RA 1VQPN 3MEGA 4PKIA 4FJHA 3CJ7A 5C2FA 3NGYA 2F96A 2A6AA 4A5AA 4BC3A 4HTLA 2IGIA 3EN9A 5JLHA 1REVA 1UOCA 4M7YA 1U49A 5AQPA 1WNSA 3BEXA 2IDOA 3GOIA 1WSIA 5IT9O 3KK2A 3AA5X 1HUXA 1YTAA 3SUNA 4AILC 1E3MA 3KLHA 5I9EB 1VSFA 3IUCA 3S9HA 1H1VA 4LC9B 2P9UB 2UXDK 4DU4A 1T6CA 4WE1A 4O5BA 4CGDA 1NK5A 1R0AA 1NKEA 1ASUA 2E6LA 4F3TA 2O8FB 1SS6A 1GLCG 5B8HA 4KO0A 3D7EO 1OH7A 2G8KA 3OYEA 3MWPA 1RBUA 4BRAA 1X9JA 2P9KA 4QS9A 4CJLA 4WQ4A 2R7YA 4CJRA 2HMIA 4JS5A 1U2VA 3ZSYA 3ZX3A 5AFUH 4IG0A 2W6KA 2GELA 4Z4EA 4M41A 4DQSA 4YORA 1TK0A 3MXMA 1U47A 3OA9A 3R6MA 2O8CA 4WF9L 3SMPA 3VQ5A 4PHTX 1X1PA 3KHYA 1K9MO 4CEEA 2BH1A 1QSSA 3WEEA 4IDHA 4LF5K 2P5OA 4LSLA 1C0GA 3VQPA 2ZM6K 5JMVA 5E41A 2FSJA 4IWVA 4BWMA 3RSEA 1WB9A 1DEJA 3IS9A 4BROA 3CCSN 2OZMA 4BR2A 3DRSA 1Q86O 3HSTB 3H3NO 3THYA 1EQYA 3O3HA 2BE2A 4K8ZA 4DV5K 1JCFA 4KHSA 2KHOA 4HUFA 1X9SA 1BU6O 1YTUA 1CZBA 4NYFA 4JKEA 3HK2A 1P8ZA 4DV2K 3NAEA 3V6DA 4LFAK 3IG1A 4BRKA 4ELTA 3P4IA 4CHYA 4FM1A 1EKEA 1TYQB 4PL7A 4JKGB 3R8EA 3OYCA 4WQ5C 1TL3A 2GTDA 5AQYA 1I3AA 2PYLA 3AA4A 1RT7A 3ZYYX 5MLCQ 4UY8O 3FZHA 2GX9A 4Z4IA 3FZKA 5CE3A 1GLEG 4CEAA 4CIFA 3H6EA 1L3TA 1HX1A 4WFAL 4Z4HA 3MXIA 2EWSA 3ZSXA 4MLHA 4M63C 3SK3A 2CGLA 1VSHA 3Q7BA 1A5XA 3VQ7A 3VA3A 3DWLA 2FBYA 4DUZK 1K8KA 1NK9A 4OPHA 5D3GA 3P83D 1LOTB 4E89A 1QVGM 4IJNA 1NNEA 1KXPA 1DTQA 3GBTA 1XC3A 1T03A 2YV0X 4O44A 5FRNA 4BRPA 4CJ4A 4AHCA 4DR6K 4XH1A 3IMXA 4RWTA 3CQ8A 2E2PA 4CHPA 2QWLA 1RT4A 2ZGYA 5C12A 4E7JA 4JHDA 4M3TA 1C0FA 5CR4A 4LF4K 1GOBA 5EVZA 4BRIA 2OZSA 2B6AA 2HOEA 5AQFA 4MFBA 2UU9K 1SKWA 3VGLA 3HM8A 1IKXA 4MLEA 4A62A 2RN2A 4DQRA 4DFMA 4CCHA 1HNWK 3MECA 5C42A 2NZTA 4OKJA 4YY3K 3R3LA 5TKYA 3QBWA 4FLYA 2KKZA 1KLNA 2RKIA 3WXIA 4NXMK 4JI3K 1T3VA 2E8AA 4CGIA 3ZSQA 3MN5A 3V9UA 1ATRA 5BN8A 3PIPL 4DSFA 5AQQA 1JLEA 3LL3A 3RMAA 2VG7A 3TSQA 2FF6A 3P38A 4H0YB 4B8CA 1TK8A 1NGJA 3HRGA 4FWOA 1Z26A 4B1YB 1N33K 2O8FA 5J2NA 1TVRA 3LPUA 4EZ6A 2YHWA 4ZTFA 3VTHA 1QHTA 3K5NA 5BPNA 4O8UA 2VGNA 3SCXA 4BRDA 4FLXA 2ZD1A 4CJQA 4FM0A 4OJRA 4NO7A 1SKSA 2HB5A 4CHNA 1YT3A 2D0AA 4KB0A 3V9SA 1IKWA 4OPKA 5C15A 4M3ZA 3NFAA 2JWKA 3L3VA 3CYMA 1VSDA 3R9PA 5AQTA 1K6YA 2YHXA 3QBXA 5HRPA 3H46O 3P31A 4DFPA 4CBWA 4WCEL 3A2FA 2D0BA 4IEEA 4QAGA 3T3FA 3V9ZA 4JKFA 1M90O 1ATNA 3ZLJA 2DFEA 1FK9A 3VF6A 5KPZA 1N32K 3DAWA 3VEYA 1U04A 2YI1A 1IG8A 2X6SA 1HR0K 4IEIA 5I42A 2YKNA 3CM5A 1LAVA 4H5NA 4I2QA 3F2KA 4CBUA 1NMDA 2O8EA 4RCHA 4O4GA 4A59A 2QWNA 4H0XB 3WXLA 2IVNA 3QIOA 4KH5A 1DTTA 4UQGA 2Q36A 1X3MA 1TKXA 1TYQA 1NGEA 4I2PA 1XNQK 2O4IA 1JKHA 3PX6A 1VQ5N 3SQ2A 4F3OA 3RWUA 1KVAA 1RT5A 3PO4A 2IIRA 1BDGA 3HYFA 1D4XA 3AO3A 3GG4A 1CXUA 2HSTA 3K5OA 1Z25A 4CZGA 3V1QA 5J2PA 2IVPA 1DLOA 2GBZA 4A57A 3E9PA 2OPQA 4KI4A 3NDKA 5DK5A 1HRHA 4H5TA 1BCOA 1S1WA 4Z4CA 2BGGA 3CCRN 3G6EN 3VQ9A 2WTUA 5AQGA 2VYPA 5AQKA 2G8UA 1Y64A 1WSFA 2ASMA 4X65K 4KTQA 1VK0A 1SL2A 4GNIA 4RW9A 3MCPA 1JLBA 3A0IX 3U9DA 2JWLA 3RTVA 4FK0A 4K25A 3KIOA 4IXCA 1QTMA 1XMQK 4DTOA 1KFDA 2G8FA 1RDCA 5JS1A 3ZEUA 2PYJA 4AM7A 4LFBK 3BZCA 4CIGA 3OBWA 1VRUA 1JXEA 4KRFA 5KRTA 4JS4A 3AO5A 4JV5K 1VSKA 5AZIA 4EAHD 3HOTA 2OPPA 3HO1A 3AVMA 3L4IA 4EIAA 1YI2N 3V81A 4LF7K 2G8VA 1YXQA 1RT3A 3PX0A 3KLFA 1ASVA 2YHYA 1NMNA 4WQ5A 4IOCL 2HHUA 3CJAA 1QS4A 3CCUN 2VWKA 4DKWA 5F0XA 4JKBA 2XY6A 2HMPA 2HBJA 3VQQA 4BR5A 1RTHA 4X62K 3U4LA 1L3UA 2E1ZA 1JXBA 4DV6K 2ZJPL 3MDQA 4GVEA 5LL6Z 2GEMA 1XMOK 4KHQA 2FXUA 4FVMA 5GAHP 1NJYA 3LP0A 4FWQA 4KTZA 3OTOK 3ZX0A 4E19A 4H0OA 2P1JA 4B9QA 3OY9A 4CF8A 5KRSA 1T8EA 3J80O 3CMAN 1LW2A 1VSJA 3SYZA 2RPIA 4JK7A 3OYBA 4H4MA 4CECA 4CERA 3HPGA 1GOCA 3BF1A 5FPMA 3J7ZO 5C10A 3KLGA 3I8BA 3OYMA 4W5NA 5GADP 2EX3A 2GUPA 4MO5A 2QWMA 3VQCA 3NVKA 3SQ4A 4CD3A 4CZLA 4U7BA 5A2QO 4JI6K 3DOKA 3AO4A 4B8AB 4H0TB 4KTWA 5M1FA 1Q18A 2KZMA 4E7KA 1IKYA 1C0UA 3RR7A 4ISFA 4F4KA 3QDKA 1L3SA 4BC5A 4DTPA 5C0YA 1E4FT 1A5VA 4KH6A 1UAXA 5HLFA 3EKUA 4DHYA 4FOEA 2Z1JA 1VSMA 1WLJA 4OKKA 3QEVA 1C6VA 3UE5A 3RMBA 2QI2A 2G8HA 3OS2A 1YJWN 4BRCA 3I8DA 4DV4K 3SPYA 3LANA 3UB5A 3K0SA 4J2DA 2UXBK 3O1WA 1MDUB 3LALA 3U3GA 3WNFA 3LAMA 2DFFA 3KZBA 2P9SA 3PY8A 1SKRA 1BA1A 3SAFA 4H8KA 5KTQA 3CMEN 1HPMA 1BGXT 3T7ZA 4DQQA 2P9LA 3EE9A 2A5XA 1WBBA 2KFZA 4YOWA 4WFBL 4Q0BA 3C6UA 2Q1NA 1S22A 3DLBA 3L4QA 5AQVA 3CCLN 1RDDA 3PUFA 2NRXA 4ISGA 4FJ9A 4FW2A 2P5GA 4W5QA 3AGRA 3KKRA 3O80A 3AAQA 5HL7L 3V9WA 3U6FA 4JD2B 1W7AA 1FW6A 2HHSA 1KSPA 3VF4A 4DR3K 3WQTA 1S1TA 3A5OC 4JEPA 2VG6A 1G15A 2P9NB 4FWSA 3O8MA 1RFQA 1GLJO 4QOZB 1SAZA 3SQ0A 4BREA 3BDPA 4CZIA 4BQZA 3G10A 3QIPA 4Z94A 2A3ZA 5KPRA 4DV3K 1RBSA 3KK3A 4XEIA 4CF0A 3L6QA 2Y1IA 3S3NA 3K9KA 2QM1A 5AQMA 2EHGA 3OJSA 3HJFA 3D6RA 3CXCM 3TU5A 1NOZA 3F73A 3H1VX 3QEWA 3DLGA 3HOSA 3JSMA 1YHQN 1BQMA 4B1WB 3QESA 2ITGA 2QXFA 1QHAA 2VGMA 3CFPA 2G8IA 3ZETB 3ULDA 3LM9A 2XHBA 4MDAA 1J53A 3MWTA 3DM2A 3FE1A 3AVAA 5DMRA 4GVMA 4EZ9A 2D0PA 1WSJA 3CHWA 4FLUA 1A5WA 2UUCK 3BZKA 1EP4A 5J1EA 4DTNA 4N47A 2HNYA 2F4VK 2F9WA 3G25A 2VWBA 3MMVA 1HKBA 1TAUA 3CFRA 3I0SA 3J81O 3WNGA 4Z4FA 4CGGA 4QS7A 3LWLA 1IBLK 5BPMA 3C0BA 3VQAA 1C1BA 3VEXA 2KFNA 1UA0A 5CY4A 4NB4A 5I3UA 4JKHA 1NGCA 4BY9C 4CJKA 3CCMN 3SQ1A 2GWKA 1KCFA 5F2RA 3QMLA 4FK2A 4N56A 2QKKA 4H0PA 2A42A 5HOOA 1SUQA 4YOVA 4JNEA 4TSXA 5JVHL 4CVNE 4YOUA 1NWKA 5AQSA 5AJ3K 4E1MA 2KTQA 4IOAL 3PX4A 2QWRA 3VQDA 3BF3A 4FL9A 4KI6A 4DCHA 4DQPA 3K57A 3T1YK 1NGFA 4E1NA 2AJQA 2Z1HA 3OJUA 1G99A 1S5JA 4K0KK 3RMCA 3EEQA 4F9OA 1S1VA 3SUPA 3NCIA 4F2SA 2D0CA 3K5MA 2ASOA 1NJZA 1KTQA 3VPZA 3RMDA 4JRPA 1S6QA 1HQEA 5KPTA 3M5RA 4PWDA 3ZT4A 1W97L 1Y97A 2VG5A 1N8RO 4B3OA 1JL2A 3QETA 1Q9YA 5AQXA 2ATQA 1XC9A 4Q5VA 3CCJN 4E7LA 2HHWA 3O1BA 4FYDA 4GKKK 4DWIA 4M3YA 2V52B 1MWKA 2NRVA 3PSFA 2CH6A 3B6PA 3M8QA 1QSYA 4N41A 1S9EA 3O9SA 4QS8A 3ULEB 1ZXOA 1KVBA 1ITGA 1E4GT 1I39A 1WSHA 3LZIA 3EYZA 4CF1A 4HHTA 3SI6A 4NCAA 3O3FA 4ID1A 4RW8A 1N6QA 4JD2A 1OH8A 1IJJA 4RW6A 4H03B 2WBNA 1WBDA 5AZJA 3HVTA 2JLEA 1JLQA 1YJNN 2ETJA 4YHHK 2RE2A 3T69A 3C94A 4DSIA 4ILHA 1FJGK 1EWRA 1VQ9N 4DF8A 1OVQA 3C95A 1SL0A 1VQKN 4DTJA 2CGKA 2B5JA 2BUPA 1RTIA 1RT1A 3QICA 3V1RA 3THXB 5BR8K 3TTCA 5JVGL 2ZJRL 1TKZA 4CZEA 3OBYA 4I9LA 1T44A 4C8NA 4C8OA 4FZYA 3WUHA 2HHVA 2J4RA 4B1XB 3LDPA 4CHOA 4W5OA 4DV0K 2DTUA 2FLOA 1RDUA 3ZT3A 1N34K 3ASMA 4BR4A 4LFCK 1BOTO 1NGDA 4B08A 4BWJA 5GINA 3J8AA 4DV7K 5HRSA 4DR4K 3ZETA 4H5RA 2X78A 1Q81O 3O4QA 1KAZA 1QQMA 3C6HA 2BANA 3FZLA 1NK4A 4CESA 1J54A 4DTUA 3LDQA 2VCPA 5BRFA 3NHGA 1RDAA 2YHBA 2F8TA 4E0DA 4CFBA 4J2EA 3A5MC 5JS2A 1ATSA 3F9KA 2D1KA 4BR9A 5AQWA 1X9MA 3CM6A 1NLVA 3B6OA 2FF3B 3PIOL 4HWIA 2P9UA 1NBWA 3ENOA 5GIPA 5DM7L 5HBMA 3MN7A 4CI6A 4CGHA 4BGBA 5H1SQ 4CJ3A 1BCMA 4KHYA 4YDUA 2E2QA 2OPRA 3ZT1A 3CCQN 3QEPA 4IBNA 3V4IA 3EKSA 4DV1K 4DR1K 2E1YA 3M1FA 1RGIA 2WONA 1LAWA 1NK6A 4C1NK 3CG7A 4B9NA 4CEOA 3VETA 4M45A 3W0LA 3CCEN 1CZ9A 3W3DA 4ISEA 1ZBUA 4IFEA 1KFSA 2WC9A 3MN9A 3P5JA 4Y1DA 4BRQA 4X66K 2UYTA 4RW4A 4K41A 3HSCA 4B1ZA 4X64K 3HP6A 4CJUA 1VSIA 3L2UA 2HBMA 3G4SN 2OYQA 2QEXN 1IBMK 1HKGA 3VEWA 3THWB 4FOIA 1WN7A 3EL2A 3KK1A 3FFIA 2I7NA 4JK9A 1RCHA 3VQ6A 4DTXA 1VSLA 1FXXA 2D5RA 3R1XA 3WT0A 1N36K 1NKCA 4BR0A 1NJIO 3DRRA 2XY7A 1L3VA 4DQIA 1BL3A 1LCUA 4YNQA 1HYZA 3SV3A 3F5TA 4FVUA 2PY5A 3HTVA 1SL1A 2P51A 1JLGA 2XRIA 1HNZK 3H45C 4JKGA 3T1HK 1YF5L 4GV9A 3TAEA 2XY5A 3LM2A 1ASWA 3C7NB 3HP9A 4AHVA 4YFUA 4V19S 5BRHA 4FW1A 1NM1A 4KHWA 4HTUA 2X74A 3O9QA 2HVHA 1MWMA 1QQOA 2ZWHA 3VOVA 3DRPA 2IAJA 1U45A 1KAXA 3DOLA 4CEQA 3JAMO 3V9XA 4DSLA 1RBRA 4LY7A 4J8FA 4CGFA 3TAPA 4CZHA 5CYQA 1X3NA 3CC4N 4BG9A 1NOYA 3IFRA 5ADXA 3TWHA 4W5RA 4IO8A 4E1JA 3N4QA 4OKEA 3THXA 4DSKA 3HT3A 5M1NA 1TK5A 3NGIA 1RILA 1XHXA 4FM2A 3JYTA 4CW7B 3L8BA 5BN9A 3OYHA 5KQDA 3VERA 3S41A 4KHNA 2H3GX 3OYGA 3BGRA 1T7PA 4NCGA 4CJWA 3ZT2A 1F21A 4BQLA 4RW7A 3NBPA 1RBVA 3NH1A 5LJWA 1FKOA 5HROA 3NH0A 2O4GA 3PO5A 1VSEA 4B9UA 1C0TA 4ICLA 4FJJA 5JLFA 4Y1CA 1BG3A 1LW0A 2Z1IA 5LJVA 2FBVA 1QQCA 3K59A 3A5NC 4I6MB 1Q8IA 1M1KO 2HNDA 4B9VA 3J7YP 3FZMA 3VMFB 1HYVA 4CFCA 1V4TA 2GUIA 4BRFA 3QB0A 3VQBA 4JKAA 4CHZA 4FJ5A 3KVGA 5GAGP 4PKGA 4B3MK 4R79A 3D2EB 4ZTJA 3TSUA 3D2FB 4F2RA 1BWFO 3P1GA 4L3QA 1VAZA 1NKBA 3A5LC 4BRMA 3AA3A 1JLCA 3L3UA 3PV8A 4DR7K 3VEVA 4C8MA 3OYFA 3LP2A 1HMVA 2CGJA 4CGJA 3AV9A 3FLCO 1ZBFA 4FJLA 4IDKA 4EHUA 3DXMB 5AQZA 3O3GA 5E26A 4JI8K 3TI0A 4CIEA 2KLAA 1HQUA 3HBTA 5AQLA 3SAHA 4FJ8A 4I7FA 4FSVA 3OS0A 3K58A 3VTIA 4K43A 2YNHA 4E3SA 1HNIA 4A2AA 4BE0A 1ZBIA 2KW4A 1NK0A 2HHHK 5CHIA 2ITMA 3MX5A 5J2MA 2HHTA 5AQHA 3CC2N 4OGCA 3U9ZA 5FDLA 3UKRB 1ZBSA 4CZJA 3OYJA 4KHPK 2E88A 2YJFA 1C1CA 2GV9A 4FLZA 3A8YA 4IJAA 4C8LA 1Z05A 1OH5A 2E20A 4B9MA 2F9TA 3SLCA 4JI2K 3THWA 2HHQA 4KH4A 3C6TA 1XNRK 3S3OA 1CXQA 5FPDA 4H4OA 5KGXA 4AQYK 3B8AX 4DMNA 4BRNA 2LSNA 3WNHA 3ZSVA 2OANA 3QLHA 4NLCA 3TABA 5AQRA 3BY5A 4DFJA 5CZ2A 4EP5A 4OVLA 2D4WA 3ZSZA 4YOXA 2HBKA 2FBTA 4GKJK 4B1UB 3TANA 2BDPA 1NG9A 4AM6A 3VENA 2O8CB 3M8SA 3NE6A 4EP4A 4BDZA 4CZMA 3AARA 1CZAN 3C7NA 2I7PA 2YKMA 3O4NA 4JKDA 2YJEA 3CF5L 2ZGZA 3KKSA 1OKJA 3SUQA 4BC2A 2UUAK 4EFHA 5SWMA 1DT9A 1HLUA 3RSEB 2ZJQL 3QNNA 3LP3A 5FLXO 5HRNA 4XIUA 4DUYK 3AVGA 4M3WA 2NRTA 4AHTA 2V7YA 3I33A 1NK8A 3CD6N 3LDOA 1ESVA 4IO9L 3SBTA 2V51B 4CEBA 1KRPA 4FZZA 1BHLA 3LP1A 3ZSWA 3AAPA 4HUGA 2FC0A 3T19A 1IO2A 4NYNA 1YUWA 1VQMN 5C25A 4FJMA 1J6ZA 3TAMA 1OH6A 4LF9K 3TTFA 3LDNA 4LF6K 1RT2A 1YITN 2QWOA 3AO1A 1QZ5A 3MX2A 1EWQA 2QWPA 2IS3A 2P9IB 4DR2K 4C23A 4CK3A 3TARA 3ITHA 5C24A 4LH4A 4YDUC 3CC7N 3VGKA 3MXJA 1HJOA 3NVMA 2YCHA 2VQEK 1WAFA 3DI6A 4KKOA 5AQIA 4FLTA 3ENBA 3K5LA 4FWNA 2YHAA 4IKFA 4GW6A 1KD1O 3LPTA 4B9TA 1K8KB 2D0OA 3ATUA 3CIPA 1BO5O 3RRHA 2IOCA 1RDBA 1IG9A 4JI0K 1U48A 3ZX2A 5BRDA 4DS5A 5M1QA 1SV5A 1KC8O 3QEXA 3VQEA 3D2EA 4RTFD 2Q2RA 1QZ6A 3OHRA 3M3ZA 4N76A 2OTJN 4ZHRA 4LF8K 4G9ZA 3VQ8A 1ZC6A 1YJ9N 1ILYA 2OA8A 4CJEA 3MAQA 1B9DA 1UA1A 1EETA 3QNOA 3DXMA 3QEIA 2NUBA 2PBDA 3UKUB 2ASPA 3SAGA 4BE1A 3C6AA 5E84A 3OYDA 4CJPA 3DXKB 3I55N 4O8KA 2W41A 4IFVA 3H3OB 2A40A 4JRQA 3SJJA 1K73O 3ZCMA 4FPBA 2JGUA 3AVNA 5EXWA 3H08A 3UKRA 3CPWM 4CK2A 5HP1A 1XHZA 3K2PA 2NRRA 5M1PA 1IV0A 3HM9A 2Y1JA 1TKDA 3CCVN 3ZT0A 2OTLN 4BR7A 4KPYA 2YNGA 1QSLA 4KBOA 3D45A 3UIQA 3CJ9A 1VQLN 3ISNC 4QCLA 3E66A 1W9HA 1V4SA 4FJIA 4PL8A 2Q31A 4CD1A 4A5BA 4M7XA 1BIZA 1LV5A 4FJ7A 4J2AA 4OPAA 3WXMB 1VQNN 1C1AA 4AHRA 1LWCA 3KLIA 3PSIA 5LMNK 4O5FA 3VN5A 1QVFM 3ID6A 3LDLA 2QW9A 4DU1A 1S3XA 5KI6A 3CFOA 1HPZA 4OLBA 2F8SA 3EY1A 3KWGA 1CLQA 3T1AA 4OLAA 3O08A 1NJXA 1YAGA 4JKCA 3IAYA 4YOTA 1Q7YO 4OO1J 1VHXA 2XO7A 5M1KA 4OX9K 3O9UA 3V1OA 2YNIA 3KLEA 3WNEA 2O8BB 2O8EB 3ID8A 4LSNA 1VQ6N 1LWEA 2P9PB 5EU7A 3DYAA 1GOAA 1S1XA 3H1QA 2ZF5O 3U3YA 3LWMA 3KTQA 4DG1A 1XWLA 4JAXA 5FPNA 1BI4B 3BP8A 4E7HA 2P9NA 3WXKA 5IWAK 2NRWA 4CJVA 4ELVA 4GV3A 2E6MA 4G1QA 4BDPA 1MA9B 2P9IA 2Q0UA 1NGHA 3M8RA 4FZXC 1D8YA 2QTDA 4DTRA 3AVLA 3ZSOA 3MEEA 4GMJB 2AP1A 4Z0UA 4CJFA 2NRZA 1BIUA 4DU3A 3DLHA 3IRXA 4DTSA 3SV4A 3AVFA 2KQ2A 3HVRA 1EXQA 5GIOA 5AQNA 3QERA 3NF9A 1NGGA 4MDBA 3CQXA 4DFKA 4OGEA 4CJ5A 3SPZA 2I5JA 1EO1A 3CJ1A 5TKWA 4M3UA 5LY3A 2HNZA 2DFHA 1B92A 4FJGA 4BRGA 3AO2A 1GLLO 3N4PA 3EO3A 4A2BA 1NGBA 4JI7K 3MN6A 3TSPA 4FLVA 3L2VA 3DJCA 4DLGA 3DLLL 1SZ2A 3ZEUB 4W5TA 1IKVA 5GAEP 4FLWA 5AFUA 3FZFA 4KAZA 2HF3A 4AH9A 3WXJA 5AZIB 2NNWA 5M1OA 3NH2A 5LMUK 1GLDG 2V7ZA 4H5VA 3NGZA 3THVA 4ID5A 3CJCA 3AVIA 3UKUA 4Y0WA 1TV6A 4NCBA 4LD0A 4IG3A 3DXKA 1VQ7N 3OW2M 4B1VA 2FSKA 3DLEA 4FWLA 4HCCA 3O9TA 1RBTA 4NLBA 5AQUA 3RRGA 2E4LA 2OPSA 5ADXH 1JLFA 1D5AA 1O13A 2W6LA 2F7TA 1U4BA 5HRRA 4B9SA 4CJSA 2UUBK 1BUPA 4FXDA 3HPOA 1IBKK 3ATVA 4FO0A 3AVHA 4H5WA 3VA0A 4JK8A 3O9RA 1VQ8N 4JLHA 4PUOA 3KJVA 4C1NI 3OYIA 4PQUA 3U8XA 2O8DB 2HF4A 3HI0A 3LZJA 1WSGA 4CZFA 2ZE2A 3MCAB 4U67L 4FWRA 1J5OA 3AVJA 4MQ3A 2G8WA 4ILGB 2AA4A 2Q0RA 2YNFA 5EX5A 1S72N 4JYAK 3F9MA 3QFUA 4FCYA 4IFYA 4FJNA 5JICA 2VWJA 4B3RK 4FWPA 4PKHA 4CFDA 1Q82O 1NGAA 1HKCA 1BQNA 2IVOA 3EE8A 1N5YA 4HCBA 2WOMA 2Q3SA 1T05A 4IOXA 3AY9A 3WQUA 3HXMA 4M42A 2W42A 3J7AP 3HZ6A 1B9FA 1I94K 5BR9A 3EZWA 3MEDA 1TUYA 4DLEA 4AHUA 2DY4A 4HVJA 1WAJA 1Z6RA 5AQJA 4KB1A 2VQFK 1ZYQA 4CFAA 4F8RA 3ULEA 5J2QA 3QFPA 3VEZA 2O8BA 3NF6A 3OVNA 4K8XA 1RTJA 4DR5K 2NRHA 2P9PA 3QO9A 3AVKA 4CEDA 4DSEA 1TAQA 3DLKA 2RHKA 3HL8A 4DB3A 4C8KA 3DLRA 3KK7A 3E9LA 1BI4A 3TAGA 1U6ZA 3OYKA 5FRMA 3GL1A 1NU0A 3O6WA 3QINA 3L2WA 2P9SB 1C0MA 2HHXA 4CJ7A 2P9LB 3NF8A 2BTFA 1WUAA 4FK4A 1X9WA 4KREA 4CE9A 4BGAA 2W40A 1YIJN 3FR0A 3SBGA 5EY4A 1KQSM 4WYBA 4J2BA 3RVCA 1XUPO 4JI4K 1HYSA 1VRTA 4DS4A 1JL1A 4Z4GA 1DKGD 2Q97A 2OCEA 1QE1A 1OVYA 5KGWA 1VQON 4WFNL 1MU2A 1EX4A 2GWJA 2DPNA 3CI5A 3OYNA 3VESA 4CZKA 4FPAA 3E1YA 1IH7A 4XH4A 4FWMA 3SZ2A 4FWKA 2WUSA 3I56N 3LDSA 1NJWA 3BUZB 4JI1K 3AA2A 4CEFA 4WQ4C 4B9LA 1XQSC 2ZQBA 3E01A 3CPEA 1D9DA 1P90A 5EOYA 4JN4A 3FGUA 4PY5A 4AHSA 4RG8A 3IKMA 2XY8A 1KAYA 2HBLA 3LAKA 4M3RA 3HPHA 3GE1A 3IDHA 2CH5A 4CEZA 4XH5A 3JS6A 2QA4N 4KFBA 3G71N 4KHUA 5CZ1A 3TR8A 3Q7CA 4CBXA 5FPEA 4K42A 3S3MA 4NXNK 1S6PA 1S1UA 2E2NA 2O8DA 2FBXA 1WOQA 5F1XA 3TAFA 5C2DA 3CJBA 3FFKB 2A41A 2PFUA 1TGOA 4DQ8A 2X6NA 2RF2A 3P39A 5K14A 1QQNA 3VGMA 3GDQA 1HJRA 3O4WA 4CHQA 5BPLA 2HW3A 4BG8A 4R5PA 4PA1A 3C65A 3VQ4A 1UWBA 3AVCA 5ELZA 3SNNA 1JCGA 4DSJA 4I9QA 2P9KB 1RDWX 1VQ4N 2UXCK 1JJ2M 1U2VB 4IZ9A 1O1WA 3OYLA 1J9AA 3PLAA 3CQYA 2PZSA 3ALYA 3EZ5A 3SJHA 3M8PA 1W2BM 1ZBLA 1GLAG 4BC4A 3ENHA 4DTMA 2IC3A 4JI5K 3OYAA 4O55A 3SMSA 3DMJA 3ZSRA 4BVPA 4GV6A 4FJKA 3WEEB 4BDYA 1NK7A 4CK1A 1FKPA 2B4JA 1JCEA 1R59O 2PAVA 3VF2A 1ZBHA 2FSNA 3O5BA 1BA0A 4DF4A 3CETA 5T7BA 5SZTA 3THYB 5DM6L 3TPQA 1KVCA 2QK9A 5FROA 4YOYA 1J5EK 1JLAA 3KD1E 4BACA 4EHTA 3AGKA 1XI1A 4ELUA 2A1SA 4OPJA 5AR0A 4E7IA 5AQOA 1WSEA 3KWIA 3D0PA 4ILJA 4BVOA 3MK6A 1KLMA 2NLXA 1DGKN 3K9JA 2QXLA 1YVNA 2Z1GA 1YVUA 4H0VB 4O0JA 3NF7A 1RTDA 4KV8A 3CERA 1L5UA 1BISA 3VEOA 3SUOA 1TL1A 4MO4A 4O0IA 4GY2B 1W0HA 4BE2A 2QKBA 3RR8A 4BRLA 1TUUA 4AF1A 4CF9A 1GLFO 4A61A 5AZJB
chains in the Genus database with same CATH topology
1JXBA 3V1OA 2YNIA 3KLEA 4L8RB 1RT6A 4Y1DA 4RW4A 3HP6A 3WNEA 4CJUA 1VSIA 3L2UA 2A1RA 5CYMA 1TKTA 4KHQA 2OYQA 4FVMA 1D9FA 1WN7A 1NJYA 3KK1A 1LWFA 3FFIA 4LSNA 4HUEA 3LP0A 3L2QA 1LWEA 5EU7A 4CJTA 3DYAA 1GOAA 4FJXA 1S1XA 1RCHA 3VQ6A 3OS1A 4DTXA 3LWMA 4KTZA 1VSLA 3U3YA 3TAQA 1FXXA 2D5RA 3KTQA 4E19A 4DG1A 1XWLA 4N5SA 1NKCA 4LH5A 2HVIA 2P1JA 3DRRA 1BI4B 2XY7A 4CF2A 3OY9A 3L2RA 4E7HA 1RNHA 1Q9XA 3KD5E 1L3VA 4CJVA 2KZZA 4CF8A 1BL3A 4DQIA 5KRSA 4YNQA 3AVBA 1HYZA 3SV3A 1S9GA 1T8EA 4ELVA 2E6MA 4G1QA 1LW2A 1VSJA 4BDPA 3SYZA 2RPIA 1HNVA 3G0ZA 2PY5A 1SL1A 3PO4A 2P51A 3OYBA 4M3XA 3I0RA 4H4MA 1JLGA 3M8RA 4FZXC 1D8YA 4CECA 3MEGA 4CERA 4FJHA 2XRIA 4DTRA 3AVLA 3HPGA 3ZSOA 3MEEA 1GOCA 3NGYA 4GMJB 4Z0UA 4CJFA 3KLGA 1BIUA 4DU3A 2F96A 3OYMA 3TAEA 3DLHA 3IRXA 4DTSA 2XY5A 4W5NA 1ASWA 3HP9A 3SV4A 3AVFA 2IGIA 4AHVA 2KQ2A 4YFUA 3HVRA 1EXQA 1REVA 2EX3A 1UOCA 3QERA 4FW1A 1U49A 3NF9A 3VQCA 4HCCA 1WNSA 3SQ4A 4KHWA 4HTUA 2X74A 4DFKA 4OGEA 4CJ5A 3SPZA 2I5JA 2IDOA 3DOKA 4M3UA 2HVHA 1WSIA 3AO4A 4B8AB 2HNZA 4KTWA 2DFHA 1B92A 4FJGA 2KZMA 4E7KA 1IKYA 1C0UA 3KK2A 3AA5X 3RR7A 4F4KA 3AO2A 1L3SA 3DRPA 2IAJA 1YTAA 4DTPA 3SUNA 4AILC 1U45A 3DOLA 3KLHA 4CEQA 3V9XA 1VSFA 4FLVA 3S9HA 3L2VA 1A5VA 4DSLA 1RBRA 1UAXA 4LY7A 4DLGA 5HLFA 4CGFA 4W5TA 2Z1JA 3TAPA 1VSMA 1IKVA 1WLJA 4OKKA 4DU4A 3QEVA 1C6VA 4WE1A 4O5BA 4CGDA 4FLWA 1NK5A 3RMBA 1R0AA 4KAZA 5CYQA 2G8HA 1NKEA 1ASUA 4AH9A 2E6LA 3TWHA 1NOYA 4F3TA 3OS2A 4W5RA 3NH2A 3I8DA 4OKEA 3SPYA 3NGZA 3THVA 4ID5A 4KO0A 3AVIA 3LANA 3HT3A 4DSKA 1TK5A 2G8KA 1TV6A 4NCBA 3OYEA 3NGIA 4J2DA 1RBUA 1RILA 1XHXA 4IG3A 4LD0A 4FM2A 3JYTA 3L8BA 3OYHA 4KHNA 3LALA 3U3GA 3WNFA 3LAMA 4CJLA 3OYGA 3DLEA 3BGRA 4CJRA 2R7YA 4NCGA 4JS5A 2DFFA 3ZSYA 1RBTA 3ZT2A 4CJWA 1T7PA 2HMIA 3PY8A 1F21A 1SKRA 3RRGA 4RW7A 3NBPA 1RBVA 3NH1A 4H8KA 4IG0A 5KTQA 1FKOA 2E4LA 2OPSA 5HROA 1BGXT 3NH0A 2O4GA 3PO5A 4Z4EA 1JLFA 1VSEA 4DQQA 4M41A 4B9UA 4DQSA 1C0TA 2KFZA 1D5AA 4ICLA 3C6UA 1TK0A 4Q0BA 4FJJA 1U4BA 3DLBA 3MXMA 1U47A 5HRRA 4B9SA 4Y1CA 4CJSA 1RDDA 1LW0A 3PUFA 3VQ5A 1X1PA 2Z1IA 1QSSA 4CEEA 2FBVA 1QQCA 3K59A 2P5OA 4FJ9A 4FXDA 4FW2A 4LSLA 1Q8IA 2HNDA 3VQPA 3HPOA 4B9VA 5E41A 2P5GA 1HYVA 4W5QA 3AVHA 4CFCA 2GUIA 3KKRA 3VQBA 4BWMA 3VA0A 3V9WA 3U6FA 3IS9A 4CHZA 4JLHA 4FJ5A 2OZMA 4PUOA 2HHSA 3KJVA 3OYIA 3DRSA 1KSPA 4PQUA 4ZTJA 3HSTB 4F2RA 1S1TA 3LZJA 1WSGA 3O3HA 3P1GA 1NKBA 2BE2A 4K8ZA 3AA3A 1JLCA 2VG6A 3L3UA 1G15A 2ZE2A 4KHSA 3PV8A 4HUFA 4C8MA 3OYFA 1J5OA 3LP2A 1HMVA 1X9SA 3AVJA 4QOZB 4CGJA 4MQ3A 1YTUA 1CZBA 3SQ0A 3AV9A 4NYFA 1ZBFA 3BDPA 3HK2A 4FJLA 4IDKA 2G8WA 3G10A 3NAEA 2YNFA 3O3GA 3QIPA 3V6DA 4FCYA 3TI0A 4CIEA 3IG1A 4ELTA 4IFYA 4CHYA 4FM1A 1EKEA 1HQUA 4FJNA 1RBSA 2HHVA 3KK3A 2VWJA 4FJ8A 4I7FA 3OS0A 3OYCA 3K58A 1TL3A 4CFDA 1I3AA 2YNHA 2PYLA 1BQNA 3AA4A 1RT7A 4CF0A 4E3SA 1HNIA 4Z4IA 2Y1IA 1N5YA 2WOMA 4HCBA 3S3NA 4BE0A 1ZBIA 2Q3SA 2EHGA 2KW4A 4CEAA 3OJSA 1T05A 3HXMA 1NK0A 4M42A 3HJFA 2W42A 4CIFA 5J2MA 1NOZA 1B9FA 3F73A 3QEWA 2HHTA 3DLGA 3JSMA 1L3TA 3MEDA 4OGCA 4DLEA 1BQMA 5FDLA 4AHUA 4Z4HA 2DY4A 3QESA 4HVJA 3MXIA 1WAJA 2ITGA 3ZSXA 2QXFA 3OYJA 4KB1A 1ZYQA 1C1CA 4CFAA 3CFPA 4F8RA 2GV9A 3ULDA 4FLZA 2G8IA 1VSHA 2XHBA 1A5XA 3VQ7A 5J2QA 4C8LA 3VA3A 1J53A 2FBYA 1NK9A 3NF6A 3DM2A 5D3GA 3P83D 4B9MA 3AVAA 4E89A 3OVNA 4K8XA 5DMRA 4GVMA 2HHQA 3C6TA 1RTJA 4EZ9A 1WSJA 4FLUA 3S3OA 1A5WA 1CXQA 1EP4A 5J1EA 4DTNA 1DTQA 3QO9A 3AVKA 2HNYA 4N47A 4CEDA 4DSEA 1T03A 1TAQA 4H4OA 5KGXA 3DLKA 4DMNA 2YV0X 3HL8A 4C8KA 1TAUA 3CFRA 3DLRA 3I0SA 4O44A 5FRNA 4CJ4A 4AHCA 3WNGA 1BI4A 4Z4FA 4CGGA 3CQ8A 2LSNA 3TAGA 3LWLA 3WNHA 3OYKA 5FRMA 4CHPA 3VQAA 1RT4A 3ZSVA 4E7JA 3QINA 3QLHA 3L2WA 1C1BA 2KFNA 1UA0A 4M3TA 1C0MA 3TABA 5CY4A 4DFJA 5I3UA 5CZ2A 2HHXA 4EP5A 4OVLA 3ZSZA 4CJKA 2FBTA 3NF8A 3SQ1A 1GOBA 3TANA 2BDPA 1KCFA 2OZSA 4FK2A 2B6AA 4N56A 1X9WA 4FK4A 4KREA 4MFBA 4CE9A 2QKKA 1SKWA 3M8SA 3NE6A 1IKXA 4EP4A 1SUQA 2RN2A 4BDZA 4DQRA 4DFMA 4TSXA 4CCHA 2YKMA 3O4NA 3MECA 5C42A 4E1MA 4OKJA 4J2BA 2KTQA 3KKSA 3SUQA 1HYSA 4FLYA 3PX4A 5SWMA 3VQDA 4KI6A 1KLNA 2RKIA 3QNNA 1VRTA 3LP3A 5HRNA 4XIUA 3K57A 4DQPA 3AVGA 4M3WA 4DS4A 4E1NA 2AJQA 2Z1HA 1JL1A 3OJUA 4AHTA 1S5JA 4CGIA 1NK8A 4Z4GA 3ZSQA 3RMCA 1QE1A 3V9UA 1S1VA 5KGWA 3SUPA 3NCIA 4DSFA 4CEBA 4F2SA 2D0CA 1JLEA 1KRPA 3K5MA 3RMAA 4FZZA 1BHLA 1MU2A 2VG7A 1EX4A 3LP1A 1KTQA 1NJZA 3ZSWA 4HUGA 4B8CA 2FC0A 3RMDA 3T19A 3OYNA 4JRPA 1S6QA 1TK8A 1IO2A 1HQEA 4NYNA 1IH7A 1Z26A 4PWDA 5C25A 3SZ2A 4FJMA 5J2NA 3ZT4A 3LDSA 1TVRA 3LPUA 3TAMA 1NJWA 4EZ6A 1Y97A 4ZTFA 3AA2A 1QHTA 2VG5A 3K5NA 4CEFA 4B3OA 1JL2A 3QETA 1RT2A 3SCXA 1Q9YA 4FLXA 2ATQA 2ZD1A 4B9LA 2ZQBA 4CJQA 4FM0A 3E01A 4OJRA 4Q5VA 3AO1A 4E7LA 1XC9A 1D9DA 1SKSA 2HB5A 4CHNA 2HHWA 4PY5A 1YT3A 4AHSA 4FYDA 2D0AA 4KB0A 4RG8A 2IS3A 3V9SA 4DWIA 1IKWA 4M3YA 4OPKA 4CK3A 3TARA 3ITHA 2XY8A 5C24A 4LH4A 4M3ZA 3NFAA 3LAKA 3MXJA 4M3RA 3B6PA 3HPHA 3L3VA 3M8QA 1QSYA 3CYMA 4N41A 1VSDA 1S9EA 1WAFA 1K6YA 3DI6A 4KKOA 4CEZA 5HRPA 4FLTA 3K5LA 4DFPA 1KVBA 2YHAA 4IKFA 1ITGA 1I39A 3A2FA 2D0BA 4GW6A 1WSHA 4QAGA 3LPTA 3LZIA 3V9ZA 3T3FA 4B9TA 3EYZA 4KFBA 4CF1A 3RRHA 4KHUA 4HHTA 3SI6A 2IOCA 5CZ1A 1RDBA 1FK9A 2DFEA 1IG9A 4NCAA 3TR8A 1U48A 4DS5A 3O3FA 4ID1A 3S3MA 4RW8A 1N6QA 1U04A 1SV5A 1S6PA 4RW6A 2X6SA 3VQEA 3QEXA 1S1UA 2FBXA 5I42A 3HVTA 2JLEA 1JLQA 2YKNA 1LAVA 2ETJA 3CM5A 4N76A 3C94A 3TAFA 4DSIA 4I2QA 4ZHRA 4DF8A 3VQ8A 3C95A 1SL0A 1TGOA 4DTJA 4CJEA 2X6NA 2RF2A 4O4GA 2OA8A 5K14A 3MAQA 1B9DA 1UA1A 1EETA 3QNOA 2B5JA 1HJRA 3QIOA 4CHQA 1RTIA 1RT1A 3V1RA 3QEIA 2NUBA 4R5PA 1DTTA 2HW3A 4UQGA 4PA1A 1TKXA 3VQ4A 1TKZA 1UWBA 3AVCA 4I2PA 4I9LA 4BE1A 3OYDA 3SNNA 4CJPA 4DSJA 4I9QA 4C8NA 2O4IA 1JKHA 3PX6A 3SQ2A 4IFVA 4C8OA 4FZYA 4F3OA 3RWUA 1KVAA 1RT5A 4W5OA 1O1WA 4CHOA 3OYLA 1J9AA 4JRQA 3ZCMA 3SJJA 3ALYA 3HYFA 3EZ5A 2PZSA 2DTUA 2JGUA 3AVNA 3M8PA 3ZT3A 1ZBLA 3AO3A 1CXUA 3ASMA 3K5OA 1Z25A 3V1QA 4DTMA 3H08A 5J2PA 2IC3A 4B08A 1DLOA 2GBZA 4O55A 4BWJA 4CK2A 3OYAA 5HRSA 5HP1A 2OPQA 3DMJA 3ZSRA 4KI4A 2X78A 3NDKA 3O4QA 5DK5A 1HRHA 4FJKA 1BCOA 1S1WA 4Z4CA 1XHZA 2BGGA 3K2PA 3VQ9A 3HM9A 2BANA 2Y1JA 1TKDA 4BDYA 1NK7A 4CK1A 2G8UA 1FKPA 3ZT0A 1NK4A 4CESA 1J54A 4DTUA 1WSFA 4KPYA 4KTQA 1VK0A 1RDAA 2B4JA 2YNGA 3NHGA 1SL2A 1QSLA 2YHBA 3D45A 2F8TA 4RW9A 3UIQA 1JLBA 4E0DA 4CFBA 4J2EA 1ZBHA 5JS2A 3F9KA 3ISNC 4QCLA 3RTVA 4DF4A 1W9HA 4FK0A 3KIOA 4FJIA 1QTMA 5T7BA 5SZTA 1X9MA 3CM6A 1KVCA 3B6OA 2QK9A 5FROA 4DTOA 1KFDA 1JLAA 2G8FA 1RDCA 5JS1A 1BIZA 1LV5A 2PYJA 4FJ7A 4J2AA 4CIGA 3KD1E 5HBMA 4BACA 1VRUA 1JXEA 4KRFA 1XI1A 5KRTA 4JS4A 4ELUA 3AO5A 1C1AA 2A1SA 4AHRA 1VSKA 1LWCA 4OPJA 4CGHA 3HO1A 2OPPA 3KLIA 3AVMA 4E7IA 4CJ3A 1BCMA 4KHYA 1WSEA 3D0PA 2OPRA 3ZT1A 3QEPA 1KLMA 3V81A 3VN5A 4IBNA 2G8VA 3V4IA 1RT3A 3PX0A 4DU1A 3KLFA 1ASVA 2Z1GA 1YVUA 2WONA 5KI6A 3CFOA 1LAWA 1NK6A 4O0JA 3NF7A 1HPZA 1RTDA 3CG7A 4KV8A 1L5UA 4B9NA 4OLBA 4CEOA 1BISA 2F8SA 2HHUA 4M45A 3EY1A 3SUOA 1QS4A 1TL1A 2VWKA 1CZ9A 1CLQA 3T1AA 4OLAA 2XY6A 1ZBUA 4O0IA 1NJXA 1KFSA 1W0HA 3VQQA 4BE2A 1RTHA 2QKBA 3RR8A 3IAYA 4CF9A 3P5JA 2XO7A 1L3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXB A;  3V1O A;  2YNI A;  3KLE A;  4L8R B;  1RT6 A;  4Y1D A;  4RW4 A;  3HP6 A;  3WNE A;  4CJU A;  1VSI A;  3L2U A;  2A1R A;  5CYM A;  1TKT A;  4KHQ A;  2OYQ A;  4FVM A;  1D9F A;  1WN7 A;  1NJY A;  3KK1 A;  1LWF A;  3FFI A;  4LSN A;  4HUE A;  3LP0 A;  3L2Q A;  1LWE A;  5EU7 A;  4CJT A;  3DYA A;  1GOA A;  4FJX A;  1S1X A;  1RCH A;  3VQ6 A;  3OS1 A;  4DTX A;  3LWM A;  4KTZ A;  1VSL A;  3U3Y A;  3TAQ A;  1FXX A;  2D5R A;  3KTQ A;  4E19 A;  4DG1 A;  1XWL A;  4N5S A;  1NKC A;  4LH5 A;  2HVI A;  2P1J A;  3DRR A;  1BI4 B;  2XY7 A;  4CF2 A;  3OY9 A;  3L2R A;  4E7H A;  1RNH A;  1Q9X A;  3KD5 E;  1L3V A;  4CJV A;  2KZZ A;  4CF8 A;  1BL3 A;  4DQI A;  5KRS A;  4YNQ A;  3AVB A;  1HYZ A;  3SV3 A;  1S9G A;  1T8E A;  4ELV A;  2E6M A;  4G1Q A;  1LW2 A;  1VSJ A;  4BDP A;  3SYZ A;  2RPI A;  1HNV A;  3G0Z A;  2PY5 A;  1SL1 A;  3PO4 A;  2P51 A;  3OYB A;  4M3X A;  3I0R A;  4H4M A;  1JLG A;  3M8R A;  4FZX C;  1D8Y A;  4CEC A;  3MEG A;  4CER A;  4FJH A;  2XRI A;  4DTR A;  3AVL A;  3HPG A;  3ZSO A;  3MEE A;  1GOC A;  3NGY A;  4GMJ B;  4Z0U A;  4CJF A;  3KLG A;  1BIU A;  4DU3 A;  2F96 A;  3OYM A;  3TAE A;  3DLH A;  3IRX A;  4DTS A;  2XY5 A;  4W5N A;  1ASW A;  3HP9 A;  3SV4 A;  3AVF A;  2IGI A;  4AHV A;  2KQ2 A;  4YFU A;  3HVR A;  1EXQ A;  1REV A;  2EX3 A;  1UOC A;  3QER A;  4FW1 A;  1U49 A;  3NF9 A;  3VQC A;  4HCC A;  1WNS A;  3SQ4 A;  4KHW A;  4HTU A;  2X74 A;  4DFK A;  4OGE A;  4CJ5 A;  3SPZ A;  2I5J A;  2IDO A;  3DOK A;  4M3U A;  2HVH A;  1WSI A;  3AO4 A;  4B8A B;  2HNZ A;  4KTW A;  2DFH A;  1B92 A;  4FJG A;  2KZM A;  4E7K A;  1IKY A;  1C0U A;  3KK2 A;  3AA5 X;  3RR7 A;  4F4K A;  3AO2 A;  1L3S A;  3DRP A;  2IAJ A;  1YTA A;  4DTP A;  3SUN A;  4AIL C;  1U45 A;  3DOL A;  3KLH A;  4CEQ A;  3V9X A;  1VSF A;  4FLV A;  3S9H A;  3L2V A;  1A5V A;  4DSL A;  1RBR A;  1UAX A;  4LY7 A;  4DLG A;  5HLF A;  4CGF A;  4W5T A;  2Z1J A;  3TAP A;  1VSM A;  1IKV A;  1WLJ A;  4OKK A;  4DU4 A;  3QEV A;  1C6V A;  4WE1 A;  4O5B A;  4CGD A;  4FLW A;  1NK5 A;  3RMB A;  1R0A A;  4KAZ A;  5CYQ A;  2G8H A;  1NKE A;  1ASU A;  4AH9 A;  2E6L A;  3TWH A;  1NOY A;  4F3T A;  3OS2 A;  4W5R A;  3NH2 A;  3I8D A;  4OKE A;  3SPY A;  3NGZ A;  3THV A;  4ID5 A;  4KO0 A;  3AVI A;  3LAN A;  3HT3 A;  4DSK A;  1TK5 A;  2G8K A;  1TV6 A;  4NCB A;  3OYE A;  3NGI A;  4J2D A;  1RBU A;  1RIL A;  1XHX A;  4IG3 A;  4LD0 A;  4FM2 A;  3JYT A;  3L8B A;  3OYH A;  4KHN A;  3LAL A;  3U3G A;  3WNF A;  3LAM A;  4CJL A;  3OYG A;  3DLE A;  3BGR A;  4CJR A;  2R7Y A;  4NCG A;  4JS5 A;  2DFF A;  3ZSY A;  1RBT A;  3ZT2 A;  4CJW A;  1T7P A;  2HMI A;  3PY8 A;  1F21 A;  1SKR A;  3RRG A;  4RW7 A;  3NBP A;  1RBV A;  3NH1 A;  4H8K A;  4IG0 A;  5KTQ A;  1FKO A;  2E4L A;  2OPS A;  5HRO A;  1BGX T;  3NH0 A;  2O4G A;  3PO5 A;  4Z4E A;  1JLF A;  1VSE A;  4DQQ A;  4M41 A;  4B9U A;  4DQS A;  1C0T A;  2KFZ A;  1D5A A;  4ICL A;  3C6U A;  1TK0 A;  4Q0B A;  4FJJ A;  1U4B A;  3DLB A;  3MXM A;  1U47 A;  5HRR A;  4B9S A;  4Y1C A;  4CJS A;  1RDD A;  1LW0 A;  3PUF A;  3VQ5 A;  1X1P A;  2Z1I A;  1QSS A;  4CEE A;  2FBV A;  1QQC A;  3K59 A;  2P5O A;  4FJ9 A;  4FXD A;  4FW2 A;  4LSL A;  1Q8I A;  2HND A;  3VQP A;  3HPO A;  4B9V A;  5E41 A;  2P5G A;  1HYV A;  4W5Q A;  3AVH A;  4CFC A;  2GUI A;  3KKR A;  3VQB A;  4BWM A;  3VA0 A;  3V9W A;  3U6F A;  3IS9 A;  4CHZ A;  4JLH A;  4FJ5 A;  2OZM A;  4PUO A;  2HHS A;  3KJV A;  3OYI A;  3DRS A;  1KSP A;  4PQU A;  4ZTJ A;  3HST B;  4F2R A;  1S1T A;  3LZJ A;  1WSG A;  3O3H A;  3P1G A;  1NKB A;  2BE2 A;  4K8Z A;  3AA3 A;  1JLC A;  2VG6 A;  3L3U A;  1G15 A;  2ZE2 A;  4KHS A;  3PV8 A;  4HUF A;  4C8M A;  3OYF A;  1J5O A;  3LP2 A;  1HMV A;  1X9S A;  3AVJ A;  4QOZ B;  4CGJ A;  4MQ3 A;  1YTU A;  1CZB A;  3SQ0 A;  3AV9 A;  4NYF A;  1ZBF A;  3BDP A;  3HK2 A;  4FJL A;  4IDK A;  2G8W A;  3G10 A;  3NAE A;  2YNF A;  3O3G A;  3QIP A;  3V6D A;  4FCY A;  3TI0 A;  4CIE A;  3IG1 A;  4ELT A;  4IFY A;  4CHY A;  4FM1 A;  1EKE A;  1HQU A;  4FJN A;  1RBS A;  2HHV A;  3KK3 A;  2VWJ A;  4FJ8 A;  4I7F A;  3OS0 A;  3OYC A;  3K58 A;  1TL3 A;  4CFD A;  1I3A A;  2YNH A;  2PYL A;  1BQN A;  3AA4 A;  1RT7 A;  4CF0 A;  4E3S A;  1HNI A;  4Z4I A;  2Y1I A;  1N5Y A;  2WOM A;  4HCB A;  3S3N A;  4BE0 A;  1ZBI A;  2Q3S A;  2EHG A;  2KW4 A;  4CEA A;  3OJS A;  1T05 A;  3HXM A;  1NK0 A;  4M42 A;  3HJF A;  2W42 A;  4CIF A;  5J2M A;  1NOZ A;  1B9F A;  3F73 A;  3QEW A;  2HHT A;  3DLG A;  3JSM A;  1L3T A;  3MED A;  4OGC A;  4DLE A;  1BQM A;  5FDL A;  4AHU A;  4Z4H A;  2DY4 A;  3QES A;  4HVJ A;  3MXI A;  1WAJ A;  2ITG A;  3ZSX A;  2QXF A;  3OYJ A;  4KB1 A;  1ZYQ A;  1C1C A;  4CFA A;  3CFP A;  4F8R A;  2GV9 A;  3ULD A;  4FLZ A;  2G8I A;  1VSH A;  2XHB A;  1A5X A;  3VQ7 A;  5J2Q A;  4C8L A;  3VA3 A;  1J53 A;  2FBY A;  1NK9 A;  3NF6 A;  3DM2 A;  5D3G A;  3P83 D;  4B9M A;  3AVA A;  4E89 A;  3OVN A;  4K8X A;  5DMR A;  4GVM A;  2HHQ A;  3C6T A;  1RTJ A;  4EZ9 A;  1WSJ A;  4FLU A;  3S3O A;  1A5W A;  1CXQ A;  1EP4 A;  5J1E A;  4DTN A;  1DTQ A;  3QO9 A;  3AVK A;  2HNY A;  4N47 A;  4CED A;  4DSE A;  1T03 A;  1TAQ A;  4H4O A;  5KGX A;  3DLK A;  4DMN A;  2YV0 X;  3HL8 A;  4C8K A;  1TAU A;  3CFR A;  3DLR A;  3I0S A;  4O44 A;  5FRN A;  4CJ4 A;  4AHC A;  3WNG A;  1BI4 A;  4Z4F A;  4CGG A;  3CQ8 A;  2LSN A;  3TAG A;  3LWL A;  3WNH A;  3OYK A;  5FRM A;  4CHP A;  3VQA A;  1RT4 A;  3ZSV A;  4E7J A;  3QIN A;  3QLH A;  3L2W A;  1C1B A;  2KFN A;  1UA0 A;  4M3T A;  1C0M A;  3TAB A;  5CY4 A;  4DFJ A;  5I3U A;  5CZ2 A;  2HHX A;  4EP5 A;  4OVL A;  3ZSZ A;  4CJK A;  2FBT A;  3NF8 A;  3SQ1 A;  1GOB A;  3TAN A;  2BDP A;  1KCF A;  2OZS A;  4FK2 A;  2B6A A;  4N56 A;  1X9W A;  4FK4 A;  4KRE A;  4MFB A;  4CE9 A;  2QKK A;  1SKW A;  3M8S A;  3NE6 A;  1IKX A;  4EP4 A;  1SUQ A;  2RN2 A;  4BDZ A;  4DQR A;  4DFM A;  4TSX A;  4CCH A;  2YKM A;  3O4N A;  3MEC A;  5C42 A;  4E1M A;  4OKJ A;  4J2B A;  2KTQ A;  3KKS A;  3SUQ A;  1HYS A;  4FLY A;  3PX4 A;  5SWM A;  3VQD A;  4KI6 A;  1KLN A;  2RKI A;  3QNN A;  1VRT A;  3LP3 A;  5HRN A;  4XIU A;  3K57 A;  4DQP A;  3AVG A;  4M3W A;  4DS4 A;  4E1N A;  2AJQ A;  2Z1H A;  1JL1 A;  3OJU A;  4AHT A;  1S5J A;  4CGI A;  1NK8 A;  4Z4G A;  3ZSQ A;  3RMC A;  1QE1 A;  3V9U A;  1S1V A;  5KGW A;  3SUP A;  3NCI A;  4DSF A;  4CEB A;  4F2S A;  2D0C A;  1JLE A;  1KRP A;  3K5M A;  3RMA A;  4FZZ A;  1BHL A;  1MU2 A;  2VG7 A;  1EX4 A;  3LP1 A;  1KTQ A;  1NJZ A;  3ZSW A;  4HUG A;  4B8C A;  2FC0 A;  3RMD A;  3T19 A;  3OYN A;  4JRP A;  1S6Q A;  1TK8 A;  1IO2 A;  1HQE A;  4NYN A;  1IH7 A;  1Z26 A;  4PWD A;  5C25 A;  3SZ2 A;  4FJM A;  5J2N A;  3ZT4 A;  3LDS A;  1TVR A;  3LPU A;  3TAM A;  1NJW A;  4EZ6 A;  1Y97 A;  4ZTF A;  3AA2 A;  1QHT A;  2VG5 A;  3K5N A;  4CEF A;  4B3O A;  1JL2 A;  3QET A;  1RT2 A;  3SCX A;  1Q9Y A;  4FLX A;  2ATQ A;  2ZD1 A;  4B9L A;  2ZQB A;  4CJQ A;  4FM0 A;  3E01 A;  4OJR A;  4Q5V A;  3AO1 A;  4E7L A;  1XC9 A;  1D9D A;  1SKS A;  2HB5 A;  4CHN A;  2HHW A;  4PY5 A;  1YT3 A;  4AHS A;  4FYD A;  2D0A A;  4KB0 A;  4RG8 A;  2IS3 A;  3V9S A;  4DWI A;  1IKW A;  4M3Y A;  4OPK A;  4CK3 A;  3TAR A;  3ITH A;  2XY8 A;  5C24 A;  4LH4 A;  4M3Z A;  3NFA A;  3LAK A;  3MXJ A;  4M3R A;  3B6P A;  3HPH A;  3L3V A;  3M8Q A;  1QSY A;  3CYM A;  4N41 A;  1VSD A;  1S9E A;  1WAF A;  1K6Y A;  3DI6 A;  4KKO A;  4CEZ A;  5HRP A;  4FLT A;  3K5L A;  4DFP A;  1KVB A;  2YHA A;  4IKF A;  1ITG A;  1I39 A;  3A2F A;  2D0B A;  4GW6 A;  1WSH A;  4QAG A;  3LPT A;  3LZI A;  3V9Z A;  3T3F A;  4B9T A;  3EYZ A;  4KFB A;  4CF1 A;  3RRH A;  4KHU A;  4HHT A;  3SI6 A;  2IOC A;  5CZ1 A;  1RDB A;  1FK9 A;  2DFE A;  1IG9 A;  4NCA A;  3TR8 A;  1U48 A;  4DS5 A;  3O3F A;  4ID1 A;  3S3M A;  4RW8 A;  1N6Q A;  1U04 A;  1SV5 A;  1S6P A;  4RW6 A;  2X6S A;  3VQE A;  3QEX A;  1S1U A;  2FBX A;  5I42 A;  3HVT A;  2JLE A;  1JLQ A;  2YKN A;  1LAV A;  2ETJ A;  3CM5 A;  4N76 A;  3C94 A;  3TAF A;  4DSI A;  4I2Q A;  4ZHR A;  4DF8 A;  3VQ8 A;  3C95 A;  1SL0 A;  1TGO A;  4DTJ A;  4CJE A;  2X6N A;  2RF2 A;  4O4G A;  2OA8 A;  5K14 A;  3MAQ A;  1B9D A;  1UA1 A;  1EET A;  3QNO A;  2B5J A;  1HJR A;  3QIO A;  4CHQ A;  1RTI A;  1RT1 A;  3V1R A;  3QEI A;  2NUB A;  4R5P A;  1DTT A;  2HW3 A;  4UQG A;  4PA1 A;  1TKX A;  3VQ4 A;  1TKZ A;  1UWB A;  3AVC A;  4I2P A;  4I9L A;  4BE1 A;  3OYD A;  3SNN A;  4CJP A;  4DSJ A;  4I9Q A;  4C8N A;  2O4I A;  1JKH A;  3PX6 A;  3SQ2 A;  4IFV A;  4C8O A;  4FZY A;  4F3O A;  3RWU A;  1KVA A;  1RT5 A;  4W5O A;  1O1W A;  4CHO A;  3OYL A;  1J9A A;  4JRQ A;  3ZCM A;  3SJJ A;  3ALY A;  3HYF A;  3EZ5 A;  2PZS A;  2DTU A;  2JGU A;  3AVN A;  3M8P A;  3ZT3 A;  1ZBL A;  3AO3 A;  1CXU A;  3ASM A;  3K5O A;  1Z25 A;  3V1Q A;  4DTM A;  3H08 A;  5J2P A;  2IC3 A;  4B08 A;  1DLO A;  2GBZ A;  4O55 A;  4BWJ A;  4CK2 A;  3OYA A;  5HRS A;  5HP1 A;  2OPQ A;  3DMJ A;  3ZSR A;  4KI4 A;  2X78 A;  3NDK A;  3O4Q A;  5DK5 A;  1HRH A;  4FJK A;  1BCO A;  1S1W A;  4Z4C A;  1XHZ A;  2BGG A;  3K2P A;  3VQ9 A;  3HM9 A;  2BAN A;  2Y1J A;  1TKD A;  4BDY A;  1NK7 A;  4CK1 A;  2G8U A;  1FKP A;  3ZT0 A;  1NK4 A;  4CES A;  1J54 A;  4DTU A;  1WSF A;  4KPY A;  4KTQ A;  1VK0 A;  1RDA A;  2B4J A;  2YNG A;  3NHG A;  1SL2 A;  1QSL A;  2YHB A;  3D45 A;  2F8T A;  4RW9 A;  3UIQ A;  1JLB A;  4E0D A;  4CFB A;  4J2E A;  1ZBH A;  5JS2 A;  3F9K A;  3ISN C;  4QCL A;  3RTV A;  4DF4 A;  1W9H A;  4FK0 A;  3KIO A;  4FJI A;  1QTM A;  5T7B A;  5SZT A;  1X9M A;  3CM6 A;  1KVC A;  3B6O A;  2QK9 A;  5FRO A;  4DTO A;  1KFD A;  1JLA A;  2G8F A;  1RDC A;  5JS1 A;  1BIZ A;  1LV5 A;  2PYJ A;  4FJ7 A;  4J2A A;  4CIG A;  3KD1 E;  5HBM A;  4BAC A;  1VRU A;  1JXE A;  4KRF A;  1XI1 A;  5KRT A;  4JS4 A;  4ELU A;  3AO5 A;  1C1A A;  2A1S A;  4AHR A;  1VSK A;  1LWC A;  4OPJ A;  4CGH A;  3HO1 A;  2OPP A;  3KLI A;  3AVM A;  4E7I A;  4CJ3 A;  1BCM A;  4KHY A;  1WSE A;  3D0P A;  2OPR A;  3ZT1 A;  3QEP A;  1KLM A;  3V81 A;  3VN5 A;  4IBN A;  2G8V A;  3V4I A;  1RT3 A;  3PX0 A;  4DU1 A;  3KLF A;  1ASV A;  2Z1G A;  1YVU A;  2WON A;  5KI6 A;  3CFO A;  1LAW A;  1NK6 A;  4O0J A;  3NF7 A;  1HPZ A;  1RTD A;  3CG7 A;  4KV8 A;  1L5U A;  4B9N A;  4OLB A;  4CEO A;  1BIS A;  2F8S A;  2HHU A;  4M45 A;  3EY1 A;  3SUO A;  1QS4 A;  1TL1 A;  2VWK A;  1CZ9 A;  1CLQ A;  3T1A A;  4OLA A;  2XY6 A;  1ZBU A;  4O0I A;  1NJX A;  1KFS A;  1W0H A;  3VQQ A;  4BE2 A;  1RTH A;  2QKB A;  3RR8 A;  3IAY A;  4CF9 A;  3P5J A;  2XO7 A;  1L3U A; 
#chains in the Genus database with same CATH topology
 5BRE A;  4L8R B;  1RT6 A;  1T6D A;  1SQK A;  2E5L K;  2A1R A;  5CYM A;  1TKT A;  4I6M A;  3L0Q A;  1GLB G;  1D9F A;  3E9O A;  2E2O A;  3TTD A;  1LWF A;  4HUE A;  3L2Q A;  4CJT A;  4FJX A;  1NGI A;  3M6G A;  3OS1 A;  3TAQ A;  5KQ8 A;  4N5S A;  1K8A O;  3D2F A;  1HNX K;  4LH5 A;  2HVI A;  4CF2 A;  4B3S K;  3L2R A;  1RNH A;  1Q9X A;  3KD5 E;  2KZZ A;  4JHD B;  3JXU A;  3AVB A;  4BRH A;  1S9G A;  2WFB A;  4B3T K;  2QWQ A;  1HNV A;  3G0Z A;  3NMU A;  4M3X A;  2YX6 A;  3I0R A;  1VQP N;  3MEG A;  4PKI A;  4FJH A;  3CJ7 A;  5C2F A;  3NGY A;  2F96 A;  2A6A A;  4A5A A;  4BC3 A;  4HTL A;  2IGI A;  3EN9 A;  5JLH A;  1REV A;  1UOC A;  4M7Y A;  1U49 A;  5AQP A;  1WNS A;  3BEX A;  2IDO A;  3GOI A;  1WSI A;  5IT9 O;  3KK2 A;  3AA5 X;  1HUX A;  1YTA A;  3SUN A;  4AIL C;  1E3M A;  3KLH A;  5I9E B;  1VSF A;  3IUC A;  3S9H A;  1H1V A;  4LC9 B;  2P9U B;  2UXD K;  4DU4 A;  1T6C A;  4WE1 A;  4O5B A;  4CGD A;  1NK5 A;  1R0A A;  1NKE A;  1ASU A;  2E6L A;  4F3T A;  2O8F B;  1SS6 A;  1GLC G;  5B8H A;  4KO0 A;  3D7E O;  1OH7 A;  2G8K A;  3OYE A;  3MWP A;  1RBU A;  4BRA A;  1X9J A;  2P9K A;  4QS9 A;  4CJL A;  4WQ4 A;  2R7Y A;  4CJR A;  2HMI A;  4JS5 A;  1U2V A;  3ZSY A;  3ZX3 A;  5AFU H;  4IG0 A;  2W6K A;  2GEL A;  4Z4E A;  4M41 A;  4DQS A;  4YOR A;  1TK0 A;  3MXM A;  1U47 A;  3OA9 A;  3R6M A;  2O8C A;  4WF9 L;  3SMP A;  3VQ5 A;  4PHT X;  1X1P A;  3KHY A;  1K9M O;  4CEE A;  2BH1 A;  1QSS A;  3WEE A;  4IDH A;  4LF5 K;  2P5O A;  4LSL A;  1C0G A;  3VQP A;  2ZM6 K;  5JMV A;  5E41 A;  2FSJ A;  4IWV A;  4BWM A;  3RSE A;  1WB9 A;  1DEJ A;  3IS9 A;  4BRO A;  3CCS N;  2OZM A;  4BR2 A;  3DRS A;  1Q86 O;  3HST B;  3H3N O;  3THY A;  1EQY A;  3O3H A;  2BE2 A;  4K8Z A;  4DV5 K;  1JCF A;  4KHS A;  2KHO A;  4HUF A;  1X9S A;  1BU6 O;  1YTU A;  1CZB A;  4NYF A;  4JKE A;  3HK2 A;  1P8Z A;  4DV2 K;  3NAE A;  3V6D A;  4LFA K;  3IG1 A;  4BRK A;  4ELT A;  3P4I A;  4CHY A;  4FM1 A;  1EKE A;  1TYQ B;  4PL7 A;  4JKG B;  3R8E A;  3OYC A;  4WQ5 C;  1TL3 A;  2GTD A;  5AQY A;  1I3A A;  2PYL A;  3AA4 A;  1RT7 A;  3ZYY X;  5MLC Q;  4UY8 O;  3FZH A;  2GX9 A;  4Z4I A;  3FZK A;  5CE3 A;  1GLE G;  4CEA A;  4CIF A;  3H6E A;  1L3T A;  1HX1 A;  4WFA L;  4Z4H A;  3MXI A;  2EWS A;  3ZSX A;  4MLH A;  4M63 C;  3SK3 A;  2CGL A;  1VSH A;  3Q7B A;  1A5X A;  3VQ7 A;  3VA3 A;  3DWL A;  2FBY A;  4DUZ K;  1K8K A;  1NK9 A;  4OPH A;  5D3G A;  3P83 D;  1LOT B;  4E89 A;  1QVG M;  4IJN A;  1NNE A;  1KXP A;  1DTQ A;  3GBT A;  1XC3 A;  1T03 A;  2YV0 X;  4O44 A;  5FRN A;  4BRP A;  4CJ4 A;  4AHC A;  4DR6 K;  4XH1 A;  3IMX A;  4RWT A;  3CQ8 A;  2E2P A;  4CHP A;  2QWL A;  1RT4 A;  2ZGY A;  5C12 A;  4E7J A;  4JHD A;  4M3T A;  1C0F A;  5CR4 A;  4LF4 K;  1GOB A;  5EVZ A;  4BRI A;  2OZS A;  2B6A A;  2HOE A;  5AQF A;  4MFB A;  2UU9 K;  1SKW A;  3VGL A;  3HM8 A;  1IKX A;  4MLE A;  4A62 A;  2RN2 A;  4DQR A;  4DFM A;  4CCH A;  1HNW K;  3MEC A;  5C42 A;  2NZT A;  4OKJ A;  4YY3 K;  3R3L A;  5TKY A;  3QBW A;  4FLY A;  2KKZ A;  1KLN A;  2RKI A;  3WXI A;  4NXM K;  4JI3 K;  1T3V A;  2E8A A;  4CGI A;  3ZSQ A;  3MN5 A;  3V9U A;  1ATR A;  5BN8 A;  3PIP L;  4DSF A;  5AQQ A;  1JLE A;  3LL3 A;  3RMA A;  2VG7 A;  3TSQ A;  2FF6 A;  3P38 A;  4H0Y B;  4B8C A;  1TK8 A;  1NGJ A;  3HRG A;  4FWO A;  1Z26 A;  4B1Y B;  1N33 K;  2O8F A;  5J2N A;  1TVR A;  3LPU A;  4EZ6 A;  2YHW A;  4ZTF A;  3VTH A;  1QHT A;  3K5N A;  5BPN A;  4O8U A;  2VGN A;  3SCX A;  4BRD A;  4FLX A;  2ZD1 A;  4CJQ A;  4FM0 A;  4OJR A;  4NO7 A;  1SKS A;  2HB5 A;  4CHN A;  1YT3 A;  2D0A A;  4KB0 A;  3V9S A;  1IKW A;  4OPK A;  5C15 A;  4M3Z A;  3NFA A;  2JWK A;  3L3V A;  3CYM A;  1VSD A;  3R9P A;  5AQT A;  1K6Y A;  2YHX A;  3QBX A;  5HRP A;  3H46 O;  3P31 A;  4DFP A;  4CBW A;  4WCE L;  3A2F A;  2D0B A;  4IEE A;  4QAG A;  3T3F A;  3V9Z A;  4JKF A;  1M90 O;  1ATN A;  3ZLJ A;  2DFE A;  1FK9 A;  3VF6 A;  5KPZ A;  1N32 K;  3DAW A;  3VEY A;  1U04 A;  2YI1 A;  1IG8 A;  2X6S A;  1HR0 K;  4IEI A;  5I42 A;  2YKN A;  3CM5 A;  1LAV A;  4H5N A;  4I2Q A;  3F2K A;  4CBU A;  1NMD A;  2O8E A;  4RCH A;  4O4G A;  4A59 A;  2QWN A;  4H0X B;  3WXL A;  2IVN A;  3QIO A;  4KH5 A;  1DTT A;  4UQG A;  2Q36 A;  1X3M A;  1TKX A;  1TYQ A;  1NGE A;  4I2P A;  1XNQ K;  2O4I A;  1JKH A;  3PX6 A;  1VQ5 N;  3SQ2 A;  4F3O A;  3RWU A;  1KVA A;  1RT5 A;  3PO4 A;  2IIR A;  1BDG A;  3HYF A;  1D4X A;  3AO3 A;  3GG4 A;  1CXU A;  2HST A;  3K5O A;  1Z25 A;  4CZG A;  3V1Q A;  5J2P A;  2IVP A;  1DLO A;  2GBZ A;  4A57 A;  3E9P A;  2OPQ A;  4KI4 A;  3NDK A;  5DK5 A;  1HRH A;  4H5T A;  1BCO A;  1S1W A;  4Z4C A;  2BGG A;  3CCR N;  3G6E N;  3VQ9 A;  2WTU A;  5AQG A;  2VYP A;  5AQK A;  2G8U A;  1Y64 A;  1WSF A;  2ASM A;  4X65 K;  4KTQ A;  1VK0 A;  1SL2 A;  4GNI A;  4RW9 A;  3MCP A;  1JLB A;  3A0I X;  3U9D A;  2JWL A;  3RTV A;  4FK0 A;  4K25 A;  3KIO A;  4IXC A;  1QTM A;  1XMQ K;  4DTO A;  1KFD A;  2G8F A;  1RDC A;  5JS1 A;  3ZEU A;  2PYJ A;  4AM7 A;  4LFB K;  3BZC A;  4CIG A;  3OBW A;  1VRU A;  1JXE A;  4KRF A;  5KRT A;  4JS4 A;  3AO5 A;  4JV5 K;  1VSK A;  5AZI A;  4EAH D;  3HOT A;  2OPP A;  3HO1 A;  3AVM A;  3L4I A;  4EIA A;  1YI2 N;  3V81 A;  4LF7 K;  2G8V A;  1YXQ A;  1RT3 A;  3PX0 A;  3KLF A;  1ASV A;  2YHY A;  1NMN A;  4WQ5 A;  4IOC L;  2HHU A;  3CJA A;  1QS4 A;  3CCU N;  2VWK A;  4DKW A;  5F0X A;  4JKB A;  2XY6 A;  2HMP A;  2HBJ A;  3VQQ A;  4BR5 A;  1RTH A;  4X62 K;  3U4L A;  1L3U A;  2E1Z A;  1JXB A;  4DV6 K;  2ZJP L;  3MDQ A;  4GVE A;  5LL6 Z;  2GEM A;  1XMO K;  4KHQ A;  2FXU A;  4FVM A;  5GAH P;  1NJY A;  3LP0 A;  4FWQ A;  4KTZ A;  3OTO K;  3ZX0 A;  4E19 A;  4H0O A;  2P1J A;  4B9Q A;  3OY9 A;  4CF8 A;  5KRS A;  1T8E A;  3J80 O;  3CMA N;  1LW2 A;  1VSJ A;  3SYZ A;  2RPI A;  4JK7 A;  3OYB A;  4H4M A;  4CEC A;  4CER A;  3HPG A;  1GOC A;  3BF1 A;  5FPM A;  3J7Z O;  5C10 A;  3KLG A;  3I8B A;  3OYM A;  4W5N A;  5GAD P;  2EX3 A;  2GUP A;  4MO5 A;  2QWM A;  3VQC A;  3NVK A;  3SQ4 A;  4CD3 A;  4CZL A;  4U7B A;  5A2Q O;  4JI6 K;  3DOK A;  3AO4 A;  4B8A B;  4H0T B;  4KTW A;  5M1F A;  1Q18 A;  2KZM A;  4E7K A;  1IKY A;  1C0U A;  3RR7 A;  4ISF A;  4F4K A;  3QDK A;  1L3S A;  4BC5 A;  4DTP A;  5C0Y A;  1E4F T;  1A5V A;  4KH6 A;  1UAX A;  5HLF A;  3EKU A;  4DHY A;  4FOE A;  2Z1J A;  1VSM A;  1WLJ A;  4OKK A;  3QEV A;  1C6V A;  3UE5 A;  3RMB A;  2QI2 A;  2G8H A;  3OS2 A;  1YJW N;  4BRC A;  3I8D A;  4DV4 K;  3SPY A;  3LAN A;  3UB5 A;  3K0S A;  4J2D A;  2UXB K;  3O1W A;  1MDU B;  3LAL A;  3U3G A;  3WNF A;  3LAM A;  2DFF A;  3KZB A;  2P9S A;  3PY8 A;  1SKR A;  1BA1 A;  3SAF A;  4H8K A;  5KTQ A;  3CME N;  1HPM A;  1BGX T;  3T7Z A;  4DQQ A;  2P9L A;  3EE9 A;  2A5X A;  1WBB A;  2KFZ A;  4YOW A;  4WFB L;  4Q0B A;  3C6U A;  2Q1N A;  1S22 A;  3DLB A;  3L4Q A;  5AQV A;  3CCL N;  1RDD A;  3PUF A;  2NRX A;  4ISG A;  4FJ9 A;  4FW2 A;  2P5G A;  4W5Q A;  3AGR A;  3KKR A;  3O80 A;  3AAQ A;  5HL7 L;  3V9W A;  3U6F A;  4JD2 B;  1W7A A;  1FW6 A;  2HHS A;  1KSP A;  3VF4 A;  4DR3 K;  3WQT A;  1S1T A;  3A5O C;  4JEP A;  2VG6 A;  1G15 A;  2P9N B;  4FWS A;  3O8M A;  1RFQ A;  1GLJ O;  4QOZ B;  1SAZ A;  3SQ0 A;  4BRE A;  3BDP A;  4CZI A;  4BQZ A;  3G10 A;  3QIP A;  4Z94 A;  2A3Z A;  5KPR A;  4DV3 K;  1RBS A;  3KK3 A;  4XEI A;  4CF0 A;  3L6Q A;  2Y1I A;  3S3N A;  3K9K A;  2QM1 A;  5AQM A;  2EHG A;  3OJS A;  3HJF A;  3D6R A;  3CXC M;  3TU5 A;  1NOZ A;  3F73 A;  3H1V X;  3QEW A;  3DLG A;  3HOS A;  3JSM A;  1YHQ N;  1BQM A;  4B1W B;  3QES A;  2ITG A;  2QXF A;  1QHA A;  2VGM A;  3CFP A;  2G8I A;  3ZET B;  3ULD A;  3LM9 A;  2XHB A;  4MDA A;  1J53 A;  3MWT A;  3DM2 A;  3FE1 A;  3AVA A;  5DMR A;  4GVM A;  4EZ9 A;  2D0P A;  1WSJ A;  3CHW A;  4FLU A;  1A5W A;  2UUC K;  3BZK A;  1EP4 A;  5J1E A;  4DTN A;  4N47 A;  2HNY A;  2F4V K;  2F9W A;  3G25 A;  2VWB A;  3MMV A;  1HKB A;  1TAU A;  3CFR A;  3I0S A;  3J81 O;  3WNG A;  4Z4F A;  4CGG A;  4QS7 A;  3LWL A;  1IBL K;  5BPM A;  3C0B A;  3VQA A;  1C1B A;  3VEX A;  2KFN A;  1UA0 A;  5CY4 A;  4NB4 A;  5I3U A;  4JKH A;  1NGC A;  4BY9 C;  4CJK A;  3CCM N;  3SQ1 A;  2GWK A;  1KCF A;  5F2R A;  3QML A;  4FK2 A;  4N56 A;  2QKK A;  4H0P A;  2A42 A;  5HOO A;  1SUQ A;  4YOV A;  4JNE A;  4TSX A;  5JVH L;  4CVN E;  4YOU A;  1NWK A;  5AQS A;  5AJ3 K;  4E1M A;  2KTQ A;  4IOA L;  3PX4 A;  2QWR A;  3VQD A;  3BF3 A;  4FL9 A;  4KI6 A;  4DCH A;  4DQP A;  3K57 A;  3T1Y K;  1NGF A;  4E1N A;  2AJQ A;  2Z1H A;  3OJU A;  1G99 A;  1S5J A;  4K0K K;  3RMC A;  3EEQ A;  4F9O A;  1S1V A;  3SUP A;  3NCI A;  4F2S A;  2D0C A;  3K5M A;  2ASO A;  1NJZ A;  1KTQ A;  3VPZ A;  3RMD A;  4JRP A;  1S6Q A;  1HQE A;  5KPT A;  3M5R A;  4PWD A;  3ZT4 A;  1W97 L;  1Y97 A;  2VG5 A;  1N8R O;  4B3O A;  1JL2 A;  3QET A;  1Q9Y A;  5AQX A;  2ATQ A;  1XC9 A;  4Q5V A;  3CCJ N;  4E7L A;  2HHW A;  3O1B A;  4FYD A;  4GKK K;  4DWI A;  4M3Y A;  2V52 B;  1MWK A;  2NRV A;  3PSF A;  2CH6 A;  3B6P A;  3M8Q A;  1QSY A;  4N41 A;  1S9E A;  3O9S A;  4QS8 A;  3ULE B;  1ZXO A;  1KVB A;  1ITG A;  1E4G T;  1I39 A;  1WSH A;  3LZI A;  3EYZ A;  4CF1 A;  4HHT A;  3SI6 A;  4NCA A;  3O3F A;  4ID1 A;  4RW8 A;  1N6Q A;  4JD2 A;  1OH8 A;  1IJJ A;  4RW6 A;  4H03 B;  2WBN A;  1WBD A;  5AZJ A;  3HVT A;  2JLE A;  1JLQ A;  1YJN N;  2ETJ A;  4YHH K;  2RE2 A;  3T69 A;  3C94 A;  4DSI A;  4ILH A;  1FJG K;  1EWR A;  1VQ9 N;  4DF8 A;  1OVQ A;  3C95 A;  1SL0 A;  1VQK N;  4DTJ A;  2CGK A;  2B5J A;  2BUP A;  1RTI A;  1RT1 A;  3QIC A;  3V1R A;  3THX B;  5BR8 K;  3TTC A;  5JVG L;  2ZJR L;  1TKZ A;  4CZE A;  3OBY A;  4I9L A;  1T44 A;  4C8N A;  4C8O A;  4FZY A;  3WUH A;  2HHV A;  2J4R A;  4B1X B;  3LDP A;  4CHO A;  4W5O A;  4DV0 K;  2DTU A;  2FLO A;  1RDU A;  3ZT3 A;  1N34 K;  3ASM A;  4BR4 A;  4LFC K;  1BOT O;  1NGD A;  4B08 A;  4BWJ A;  5GIN A;  3J8A A;  4DV7 K;  5HRS A;  4DR4 K;  3ZET A;  4H5R A;  2X78 A;  1Q81 O;  3O4Q A;  1KAZ A;  1QQM A;  3C6H A;  2BAN A;  3FZL A;  1NK4 A;  4CES A;  1J54 A;  4DTU A;  3LDQ A;  2VCP A;  5BRF A;  3NHG A;  1RDA A;  2YHB A;  2F8T A;  4E0D A;  4CFB A;  4J2E A;  3A5M C;  5JS2 A;  1ATS A;  3F9K A;  2D1K A;  4BR9 A;  5AQW A;  1X9M A;  3CM6 A;  1NLV A;  3B6O A;  2FF3 B;  3PIO L;  4HWI A;  2P9U A;  1NBW A;  3ENO A;  5GIP A;  5DM7 L;  5HBM A;  3MN7 A;  4CI6 A;  4CGH A;  4BGB A;  5H1S Q;  4CJ3 A;  1BCM A;  4KHY A;  4YDU A;  2E2Q A;  2OPR A;  3ZT1 A;  3CCQ N;  3QEP A;  4IBN A;  3V4I A;  3EKS A;  4DV1 K;  4DR1 K;  2E1Y A;  3M1F A;  1RGI A;  2WON A;  1LAW A;  1NK6 A;  4C1N K;  3CG7 A;  4B9N A;  4CEO A;  3VET A;  4M45 A;  3W0L A;  3CCE N;  1CZ9 A;  3W3D A;  4ISE A;  1ZBU A;  4IFE A;  1KFS A;  2WC9 A;  3MN9 A;  3P5J A;  4Y1D A;  4BRQ A;  4X66 K;  2UYT A;  4RW4 A;  4K41 A;  3HSC A;  4B1Z A;  4X64 K;  3HP6 A;  4CJU A;  1VSI A;  3L2U A;  2HBM A;  3G4S N;  2OYQ A;  2QEX N;  1IBM K;  1HKG A;  3VEW A;  3THW B;  4FOI A;  1WN7 A;  3EL2 A;  3KK1 A;  3FFI A;  2I7N A;  4JK9 A;  1RCH A;  3VQ6 A;  4DTX A;  1VSL A;  1FXX A;  2D5R A;  3R1X A;  3WT0 A;  1N36 K;  1NKC A;  4BR0 A;  1NJI O;  3DRR A;  2XY7 A;  1L3V A;  4DQI A;  1BL3 A;  1LCU A;  4YNQ A;  1HYZ A;  3SV3 A;  3F5T A;  4FVU A;  2PY5 A;  3HTV A;  1SL1 A;  2P51 A;  1JLG A;  2XRI A;  1HNZ K;  3H45 C;  4JKG A;  3T1H K;  1YF5 L;  4GV9 A;  3TAE A;  2XY5 A;  3LM2 A;  1ASW A;  3C7N B;  3HP9 A;  4AHV A;  4YFU A;  4V19 S;  5BRH A;  4FW1 A;  1NM1 A;  4KHW A;  4HTU A;  2X74 A;  3O9Q A;  2HVH A;  1MWM A;  1QQO A;  2ZWH A;  3VOV A;  3DRP A;  2IAJ A;  1U45 A;  1KAX A;  3DOL A;  4CEQ A;  3JAM O;  3V9X A;  4DSL A;  1RBR A;  4LY7 A;  4J8F A;  4CGF A;  3TAP A;  4CZH A;  5CYQ A;  1X3N A;  3CC4 N;  4BG9 A;  1NOY A;  3IFR A;  5ADX A;  3TWH A;  4W5R A;  4IO8 A;  4E1J A;  3N4Q A;  4OKE A;  3THX A;  4DSK A;  3HT3 A;  5M1N A;  1TK5 A;  3NGI A;  1RIL A;  1XHX A;  4FM2 A;  3JYT A;  4CW7 B;  3L8B A;  5BN9 A;  3OYH A;  5KQD A;  3VER A;  3S41 A;  4KHN A;  2H3G X;  3OYG A;  3BGR A;  1T7P A;  4NCG A;  4CJW A;  3ZT2 A;  1F21 A;  4BQL A;  4RW7 A;  3NBP A;  1RBV A;  3NH1 A;  5LJW A;  1FKO A;  5HRO A;  3NH0 A;  2O4G A;  3PO5 A;  1VSE A;  4B9U A;  1C0T A;  4ICL A;  4FJJ A;  5JLF A;  4Y1C A;  1BG3 A;  1LW0 A;  2Z1I A;  5LJV A;  2FBV A;  1QQC A;  3K59 A;  3A5N C;  4I6M B;  1Q8I A;  1M1K O;  2HND A;  4B9V A;  3J7Y P;  3FZM A;  3VMF B;  1HYV A;  4CFC A;  1V4T A;  2GUI A;  4BRF A;  3QB0 A;  3VQB A;  4JKA A;  4CHZ A;  4FJ5 A;  3KVG A;  5GAG P;  4PKG A;  4B3M K;  4R79 A;  3D2E B;  4ZTJ A;  3TSU A;  3D2F B;  4F2R A;  1BWF O;  3P1G A;  4L3Q A;  1VAZ A;  1NKB A;  3A5L C;  4BRM A;  3AA3 A;  1JLC A;  3L3U A;  3PV8 A;  4DR7 K;  3VEV A;  4C8M A;  3OYF A;  3LP2 A;  1HMV A;  2CGJ A;  4CGJ A;  3AV9 A;  3FLC O;  1ZBF A;  4FJL A;  4IDK A;  4EHU A;  3DXM B;  5AQZ A;  3O3G A;  5E26 A;  4JI8 K;  3TI0 A;  4CIE A;  2KLA A;  1HQU A;  3HBT A;  5AQL A;  3SAH A;  4FJ8 A;  4I7F A;  4FSV A;  3OS0 A;  3K58 A;  3VTI A;  4K43 A;  2YNH A;  4E3S A;  1HNI A;  4A2A A;  4BE0 A;  1ZBI A;  2KW4 A;  1NK0 A;  2HHH K;  5CHI A;  2ITM A;  3MX5 A;  5J2M A;  2HHT A;  5AQH A;  3CC2 N;  4OGC A;  3U9Z A;  5FDL A;  3UKR B;  1ZBS A;  4CZJ A;  3OYJ A;  4KHP K;  2E88 A;  2YJF A;  1C1C A;  2GV9 A;  4FLZ A;  3A8Y A;  4IJA A;  4C8L A;  1Z05 A;  1OH5 A;  2E20 A;  4B9M A;  2F9T A;  3SLC A;  4JI2 K;  3THW A;  2HHQ A;  4KH4 A;  3C6T A;  1XNR K;  3S3O A;  1CXQ A;  5FPD A;  4H4O A;  5KGX A;  4AQY K;  3B8A X;  4DMN A;  4BRN A;  2LSN A;  3WNH A;  3ZSV A;  2OAN A;  3QLH A;  4NLC A;  3TAB A;  5AQR A;  3BY5 A;  4DFJ A;  5CZ2 A;  4EP5 A;  4OVL A;  2D4W A;  3ZSZ A;  4YOX A;  2HBK A;  2FBT A;  4GKJ K;  4B1U B;  3TAN A;  2BDP A;  1NG9 A;  4AM6 A;  3VEN A;  2O8C B;  3M8S A;  3NE6 A;  4EP4 A;  4BDZ A;  4CZM A;  3AAR A;  1CZA N;  3C7N A;  2I7P A;  2YKM A;  3O4N A;  4JKD A;  2YJE A;  3CF5 L;  2ZGZ A;  3KKS A;  1OKJ A;  3SUQ A;  4BC2 A;  2UUA K;  4EFH A;  5SWM A;  1DT9 A;  1HLU A;  3RSE B;  2ZJQ L;  3QNN A;  3LP3 A;  5FLX O;  5HRN A;  4XIU A;  4DUY K;  3AVG A;  4M3W A;  2NRT A;  4AHT A;  2V7Y A;  3I33 A;  1NK8 A;  3CD6 N;  3LDO A;  1ESV A;  4IO9 L;  3SBT A;  2V51 B;  4CEB A;  1KRP A;  4FZZ A;  1BHL A;  3LP1 A;  3ZSW A;  3AAP A;  4HUG A;  2FC0 A;  3T19 A;  1IO2 A;  4NYN A;  1YUW A;  1VQM N;  5C25 A;  4FJM A;  1J6Z A;  3TAM A;  1OH6 A;  4LF9 K;  3TTF A;  3LDN A;  4LF6 K;  1RT2 A;  1YIT N;  2QWO A;  3AO1 A;  1QZ5 A;  3MX2 A;  1EWQ A;  2QWP A;  2IS3 A;  2P9I B;  4DR2 K;  4C23 A;  4CK3 A;  3TAR A;  3ITH A;  5C24 A;  4LH4 A;  4YDU C;  3CC7 N;  3VGK A;  3MXJ A;  1HJO A;  3NVM A;  2YCH A;  2VQE K;  1WAF A;  3DI6 A;  4KKO A;  5AQI A;  4FLT A;  3ENB A;  3K5L A;  4FWN A;  2YHA A;  4IKF A;  4GW6 A;  1KD1 O;  3LPT A;  4B9T A;  1K8K B;  2D0O A;  3ATU A;  3CIP A;  1BO5 O;  3RRH A;  2IOC A;  1RDB A;  1IG9 A;  4JI0 K;  1U48 A;  3ZX2 A;  5BRD A;  4DS5 A;  5M1Q A;  1SV5 A;  1KC8 O;  3QEX A;  3VQE A;  3D2E A;  4RTF D;  2Q2R A;  1QZ6 A;  3OHR A;  3M3Z A;  4N76 A;  2OTJ N;  4ZHR A;  4LF8 K;  4G9Z A;  3VQ8 A;  1ZC6 A;  1YJ9 N;  1ILY A;  2OA8 A;  4CJE A;  3MAQ A;  1B9D A;  1UA1 A;  1EET A;  3QNO A;  3DXM A;  3QEI A;  2NUB A;  2PBD A;  3UKU B;  2ASP A;  3SAG A;  4BE1 A;  3C6A A;  5E84 A;  3OYD A;  4CJP A;  3DXK B;  3I55 N;  4O8K A;  2W41 A;  4IFV A;  3H3O B;  2A40 A;  4JRQ A;  3SJJ A;  1K73 O;  3ZCM A;  4FPB A;  2JGU A;  3AVN A;  5EXW A;  3H08 A;  3UKR A;  3CPW M;  4CK2 A;  5HP1 A;  1XHZ A;  3K2P A;  2NRR A;  5M1P A;  1IV0 A;  3HM9 A;  2Y1J A;  1TKD A;  3CCV N;  3ZT0 A;  2OTL N;  4BR7 A;  4KPY A;  2YNG A;  1QSL A;  4KBO A;  3D45 A;  3UIQ A;  3CJ9 A;  1VQL N;  3ISN C;  4QCL A;  3E66 A;  1W9H A;  1V4S A;  4FJI A;  4PL8 A;  2Q31 A;  4CD1 A;  4A5B A;  4M7X A;  1BIZ A;  1LV5 A;  4FJ7 A;  4J2A A;  4OPA A;  3WXM B;  1VQN N;  1C1A A;  4AHR A;  1LWC A;  3KLI A;  3PSI A;  5LMN K;  4O5F A;  3VN5 A;  1QVF M;  3ID6 A;  3LDL A;  2QW9 A;  4DU1 A;  1S3X A;  5KI6 A;  3CFO A;  1HPZ A;  4OLB A;  2F8S A;  3EY1 A;  3KWG A;  1CLQ A;  3T1A A;  4OLA A;  3O08 A;  1NJX A;  1YAG A;  4JKC A;  3IAY A;  4YOT A;  1Q7Y O;  4OO1 J;  1VHX A;  2XO7 A;  5M1K A;  4OX9 K;  3O9U A;  3V1O A;  2YNI A;  3KLE A;  3WNE A;  2O8B B;  2O8E B;  3ID8 A;  4LSN A;  1VQ6 N;  1LWE A;  2P9P B;  5EU7 A;  3DYA A;  1GOA A;  1S1X A;  3H1Q A;  2ZF5 O;  3U3Y A;  3LWM A;  3KTQ A;  4DG1 A;  1XWL A;  4JAX A;  5FPN A;  1BI4 B;  3BP8 A;  4E7H A;  2P9N A;  3WXK A;  5IWA K;  2NRW A;  4CJV A;  4ELV A;  4GV3 A;  2E6M A;  4G1Q A;  4BDP A;  1MA9 B;  2P9I A;  2Q0U A;  1NGH A;  3M8R A;  4FZX C;  1D8Y A;  2QTD A;  4DTR A;  3AVL A;  3ZSO A;  3MEE A;  4GMJ B;  2AP1 A;  4Z0U A;  4CJF A;  2NRZ A;  1BIU A;  4DU3 A;  3DLH A;  3IRX A;  4DTS A;  3SV4 A;  3AVF A;  2KQ2 A;  3HVR A;  1EXQ A;  5GIO A;  5AQN A;  3QER A;  3NF9 A;  1NGG A;  4MDB A;  3CQX A;  4DFK A;  4OGE A;  4CJ5 A;  3SPZ A;  2I5J A;  1EO1 A;  3CJ1 A;  5TKW A;  4M3U A;  5LY3 A;  2HNZ A;  2DFH A;  1B92 A;  4FJG A;  4BRG A;  3AO2 A;  1GLL O;  3N4P A;  3EO3 A;  4A2B A;  1NGB A;  4JI7 K;  3MN6 A;  3TSP A;  4FLV A;  3L2V A;  3DJC A;  4DLG A;  3DLL L;  1SZ2 A;  3ZEU B;  4W5T A;  1IKV A;  5GAE P;  4FLW A;  5AFU A;  3FZF A;  4KAZ A;  2HF3 A;  4AH9 A;  3WXJ A;  5AZI B;  2NNW A;  5M1O A;  3NH2 A;  5LMU K;  1GLD G;  2V7Z A;  4H5V A;  3NGZ A;  3THV A;  4ID5 A;  3CJC A;  3AVI A;  3UKU A;  4Y0W A;  1TV6 A;  4NCB A;  4LD0 A;  4IG3 A;  3DXK A;  1VQ7 N;  3OW2 M;  4B1V A;  2FSK A;  3DLE A;  4FWL A;  4HCC A;  3O9T A;  1RBT A;  4NLB A;  5AQU A;  3RRG A;  2E4L A;  2OPS A;  5ADX H;  1JLF A;  1D5A A;  1O13 A;  2W6L A;  2F7T A;  1U4B A;  5HRR A;  4B9S A;  4CJS A;  2UUB K;  1BUP A;  4FXD A;  3HPO A;  1IBK K;  3ATV A;  4FO0 A;  3AVH A;  4H5W A;  3VA0 A;  4JK8 A;  3O9R A;  1VQ8 N;  4JLH A;  4PUO A;  3KJV A;  4C1N I;  3OYI A;  4PQU A;  3U8X A;  2O8D B;  2HF4 A;  3HI0 A;  3LZJ A;  1WSG A;  4CZF A;  2ZE2 A;  3MCA B;  4U67 L;  4FWR A;  1J5O A;  3AVJ A;  4MQ3 A;  2G8W A;  4ILG B;  2AA4 A;  2Q0R A;  2YNF A;  5EX5 A;  1S72 N;  4JYA K;  3F9M A;  3QFU A;  4FCY A;  4IFY A;  4FJN A;  5JIC A;  2VWJ A;  4B3R K;  4FWP A;  4PKH A;  4CFD A;  1Q82 O;  1NGA A;  1HKC A;  1BQN A;  2IVO A;  3EE8 A;  1N5Y A;  4HCB A;  2WOM A;  2Q3S A;  1T05 A;  4IOX A;  3AY9 A;  3WQU A;  3HXM A;  4M42 A;  2W42 A;  3J7A P;  3HZ6 A;  1B9F A;  1I94 K;  5BR9 A;  3EZW A;  3MED A;  1TUY A;  4DLE A;  4AHU A;  2DY4 A;  4HVJ A;  1WAJ A;  1Z6R A;  5AQJ A;  4KB1 A;  2VQF K;  1ZYQ A;  4CFA A;  4F8R A;  3ULE A;  5J2Q A;  3QFP A;  3VEZ A;  2O8B A;  3NF6 A;  3OVN A;  4K8X A;  1RTJ A;  4DR5 K;  2NRH A;  2P9P A;  3QO9 A;  3AVK A;  4CED A;  4DSE A;  1TAQ A;  3DLK A;  2RHK A;  3HL8 A;  4DB3 A;  4C8K A;  3DLR A;  3KK7 A;  3E9L A;  1BI4 A;  3TAG A;  1U6Z A;  3OYK A;  5FRM A;  3GL1 A;  1NU0 A;  3O6W A;  3QIN A;  3L2W A;  2P9S B;  1C0M A;  2HHX A;  4CJ7 A;  2P9L B;  3NF8 A;  2BTF A;  1WUA A;  4FK4 A;  1X9W A;  4KRE A;  4CE9 A;  4BGA A;  2W40 A;  1YIJ N;  3FR0 A;  3SBG A;  5EY4 A;  1KQS M;  4WYB A;  4J2B A;  3RVC A;  1XUP O;  4JI4 K;  1HYS A;  1VRT A;  4DS4 A;  1JL1 A;  4Z4G A;  1DKG D;  2Q97 A;  2OCE A;  1QE1 A;  1OVY A;  5KGW A;  1VQO N;  4WFN L;  1MU2 A;  1EX4 A;  2GWJ A;  2DPN A;  3CI5 A;  3OYN A;  3VES A;  4CZK A;  4FPA A;  3E1Y A;  1IH7 A;  4XH4 A;  4FWM A;  3SZ2 A;  4FWK A;  2WUS A;  3I56 N;  3LDS A;  1NJW A;  3BUZ B;  4JI1 K;  3AA2 A;  4CEF A;  4WQ4 C;  4B9L A;  1XQS C;  2ZQB A;  3E01 A;  3CPE A;  1D9D A;  1P90 A;  5EOY A;  4JN4 A;  3FGU A;  4PY5 A;  4AHS A;  4RG8 A;  3IKM A;  2XY8 A;  1KAY A;  2HBL A;  3LAK A;  4M3R A;  3HPH A;  3GE1 A;  3IDH A;  2CH5 A;  4CEZ A;  4XH5 A;  3JS6 A;  2QA4 N;  4KFB A;  3G71 N;  4KHU A;  5CZ1 A;  3TR8 A;  3Q7C A;  4CBX A;  5FPE A;  4K42 A;  3S3M A;  4NXN K;  1S6P A;  1S1U A;  2E2N A;  2O8D A;  2FBX A;  1WOQ A;  5F1X A;  3TAF A;  5C2D A;  3CJB A;  3FFK B;  2A41 A;  2PFU A;  1TGO A;  4DQ8 A;  2X6N A;  2RF2 A;  3P39 A;  5K14 A;  1QQN A;  3VGM A;  3GDQ A;  1HJR A;  3O4W A;  4CHQ A;  5BPL A;  2HW3 A;  4BG8 A;  4R5P A;  4PA1 A;  3C65 A;  3VQ4 A;  1UWB A;  3AVC A;  5ELZ A;  3SNN A;  1JCG A;  4DSJ A;  4I9Q A;  2P9K B;  1RDW X;  1VQ4 N;  2UXC K;  1JJ2 M;  1U2V B;  4IZ9 A;  1O1W A;  3OYL A;  1J9A A;  3PLA A;  3CQY A;  2PZS A;  3ALY A;  3EZ5 A;  3SJH A;  3M8P A;  1W2B M;  1ZBL A;  1GLA G;  4BC4 A;  3ENH A;  4DTM A;  2IC3 A;  4JI5 K;  3OYA A;  4O55 A;  3SMS A;  3DMJ A;  3ZSR A;  4BVP A;  4GV6 A;  4FJK A;  3WEE B;  4BDY A;  1NK7 A;  4CK1 A;  1FKP A;  2B4J A;  1JCE A;  1R59 O;  2PAV A;  3VF2 A;  1ZBH A;  2FSN A;  3O5B A;  1BA0 A;  4DF4 A;  3CET A;  5T7B A;  5SZT A;  3THY B;  5DM6 L;  3TPQ A;  1KVC A;  2QK9 A;  5FRO A;  4YOY A;  1J5E K;  1JLA A;  3KD1 E;  4BAC A;  4EHT A;  3AGK A;  1XI1 A;  4ELU A;  2A1S A;  4OPJ A;  5AR0 A;  4E7I A;  5AQO A;  1WSE A;  3KWI A;  3D0P A;  4ILJ A;  4BVO A;  3MK6 A;  1KLM A;  2NLX A;  1DGK N;  3K9J A;  2QXL A;  1YVN A;  2Z1G A;  1YVU A;  4H0V B;  4O0J A;  3NF7 A;  1RTD A;  4KV8 A;  3CER A;  1L5U A;  1BIS A;  3VEO A;  3SUO A;  1TL1 A;  4MO4 A;  4O0I A;  4GY2 B;  1W0H A;  4BE2 A;  2QKB A;  3RR8 A;  4BRL A;  1TUU A;  4AF1 A;  4CF9 A;  1GLF O;  4A61 A;  5AZJ B; 
#chains in the Genus database with same CATH homology
 1JXB A;  3V1O A;  2YNI A;  3KLE A;  4L8R B;  1RT6 A;  4Y1D A;  4RW4 A;  3HP6 A;  3WNE A;  4CJU A;  1VSI A;  3L2U A;  2A1R A;  5CYM A;  1TKT A;  4KHQ A;  2OYQ A;  4FVM A;  1D9F A;  1WN7 A;  1NJY A;  3KK1 A;  1LWF A;  3FFI A;  4LSN A;  4HUE A;  3LP0 A;  3L2Q A;  1LWE A;  5EU7 A;  4CJT A;  3DYA A;  1GOA A;  4FJX A;  1S1X A;  1RCH A;  3VQ6 A;  3OS1 A;  4DTX A;  3LWM A;  4KTZ A;  1VSL A;  3U3Y A;  3TAQ A;  1FXX A;  2D5R A;  3KTQ A;  4E19 A;  4DG1 A;  1XWL A;  4N5S A;  1NKC A;  4LH5 A;  2HVI A;  2P1J A;  3DRR A;  1BI4 B;  2XY7 A;  4CF2 A;  3OY9 A;  3L2R A;  4E7H A;  1RNH A;  1Q9X A;  3KD5 E;  1L3V A;  4CJV A;  2KZZ A;  4CF8 A;  1BL3 A;  4DQI A;  5KRS A;  4YNQ A;  3AVB A;  1HYZ A;  3SV3 A;  1S9G A;  1T8E A;  4ELV A;  2E6M A;  4G1Q A;  1LW2 A;  1VSJ A;  4BDP A;  3SYZ A;  2RPI A;  1HNV A;  3G0Z A;  2PY5 A;  1SL1 A;  3PO4 A;  2P51 A;  3OYB A;  4M3X A;  3I0R A;  4H4M A;  1JLG A;  3M8R A;  4FZX C;  1D8Y A;  4CEC A;  3MEG A;  4CER A;  4FJH A;  2XRI A;  4DTR A;  3AVL A;  3HPG A;  3ZSO A;  3MEE A;  1GOC A;  3NGY A;  4GMJ B;  4Z0U A;  4CJF A;  3KLG A;  1BIU A;  4DU3 A;  2F96 A;  3OYM A;  3TAE A;  3DLH A;  3IRX A;  4DTS A;  2XY5 A;  4W5N A;  1ASW A;  3HP9 A;  3SV4 A;  3AVF A;  2IGI A;  4AHV A;  2KQ2 A;  4YFU A;  3HVR A;  1EXQ A;  1REV A;  2EX3 A;  1UOC A;  3QER A;  4FW1 A;  1U49 A;  3NF9 A;  3VQC A;  4HCC A;  1WNS A;  3SQ4 A;  4KHW A;  4HTU A;  2X74 A;  4DFK A;  4OGE A;  4CJ5 A;  3SPZ A;  2I5J A;  2IDO A;  3DOK A;  4M3U A;  2HVH A;  1WSI A;  3AO4 A;  4B8A B;  2HNZ A;  4KTW A;  2DFH A;  1B92 A;  4FJG A;  2KZM A;  4E7K A;  1IKY A;  1C0U A;  3KK2 A;  3AA5 X;  3RR7 A;  4F4K A;  3AO2 A;  1L3S A;  3DRP A;  2IAJ A;  1YTA A;  4DTP A;  3SUN A;  4AIL C;  1U45 A;  3DOL A;  3KLH A;  4CEQ A;  3V9X A;  1VSF A;  4FLV A;  3S9H A;  3L2V A;  1A5V A;  4DSL A;  1RBR A;  1UAX A;  4LY7 A;  4DLG A;  5HLF A;  4CGF A;  4W5T A;  2Z1J A;  3TAP A;  1VSM A;  1IKV A;  1WLJ A;  4OKK A;  4DU4 A;  3QEV A;  1C6V A;  4WE1 A;  4O5B A;  4CGD A;  4FLW A;  1NK5 A;  3RMB A;  1R0A A;  4KAZ A;  5CYQ A;  2G8H A;  1NKE A;  1ASU A;  4AH9 A;  2E6L A;  3TWH A;  1NOY A;  4F3T A;  3OS2 A;  4W5R A;  3NH2 A;  3I8D A;  4OKE A;  3SPY A;  3NGZ A;  3THV A;  4ID5 A;  4KO0 A;  3AVI A;  3LAN A;  3HT3 A;  4DSK A;  1TK5 A;  2G8K A;  1TV6 A;  4NCB A;  3OYE A;  3NGI A;  4J2D A;  1RBU A;  1RIL A;  1XHX A;  4IG3 A;  4LD0 A;  4FM2 A;  3JYT A;  3L8B A;  3OYH A;  4KHN A;  3LAL A;  3U3G A;  3WNF A;  3LAM A;  4CJL A;  3OYG A;  3DLE A;  3BGR A;  4CJR A;  2R7Y A;  4NCG A;  4JS5 A;  2DFF A;  3ZSY A;  1RBT A;  3ZT2 A;  4CJW A;  1T7P A;  2HMI A;  3PY8 A;  1F21 A;  1SKR A;  3RRG A;  4RW7 A;  3NBP A;  1RBV A;  3NH1 A;  4H8K A;  4IG0 A;  5KTQ A;  1FKO A;  2E4L A;  2OPS A;  5HRO A;  1BGX T;  3NH0 A;  2O4G A;  3PO5 A;  4Z4E A;  1JLF A;  1VSE A;  4DQQ A;  4M41 A;  4B9U A;  4DQS A;  1C0T A;  2KFZ A;  1D5A A;  4ICL A;  3C6U A;  1TK0 A;  4Q0B A;  4FJJ A;  1U4B A;  3DLB A;  3MXM A;  1U47 A;  5HRR A;  4B9S A;  4Y1C A;  4CJS A;  1RDD A;  1LW0 A;  3PUF A;  3VQ5 A;  1X1P A;  2Z1I A;  1QSS A;  4CEE A;  2FBV A;  1QQC A;  3K59 A;  2P5O A;  4FJ9 A;  4FXD A;  4FW2 A;  4LSL A;  1Q8I A;  2HND A;  3VQP A;  3HPO A;  4B9V A;  5E41 A;  2P5G A;  1HYV A;  4W5Q A;  3AVH A;  4CFC A;  2GUI A;  3KKR A;  3VQB A;  4BWM A;  3VA0 A;  3V9W A;  3U6F A;  3IS9 A;  4CHZ A;  4JLH A;  4FJ5 A;  2OZM A;  4PUO A;  2HHS A;  3KJV A;  3OYI A;  3DRS A;  1KSP A;  4PQU A;  4ZTJ A;  3HST B;  4F2R A;  1S1T A;  3LZJ A;  1WSG A;  3O3H A;  3P1G A;  1NKB A;  2BE2 A;  4K8Z A;  3AA3 A;  1JLC A;  2VG6 A;  3L3U A;  1G15 A;  2ZE2 A;  4KHS A;  3PV8 A;  4HUF A;  4C8M A;  3OYF A;  1J5O A;  3LP2 A;  1HMV A;  1X9S A;  3AVJ A;  4QOZ B;  4CGJ A;  4MQ3 A;  1YTU A;  1CZB A;  3SQ0 A;  3AV9 A;  4NYF A;  1ZBF A;  3BDP A;  3HK2 A;  4FJL A;  4IDK A;  2G8W A;  3G10 A;  3NAE A;  2YNF A;  3O3G A;  3QIP A;  3V6D A;  4FCY A;  3TI0 A;  4CIE A;  3IG1 A;  4ELT A;  4IFY A;  4CHY A;  4FM1 A;  1EKE A;  1HQU A;  4FJN A;  1RBS A;  2HHV A;  3KK3 A;  2VWJ A;  4FJ8 A;  4I7F A;  3OS0 A;  3OYC A;  3K58 A;  1TL3 A;  4CFD A;  1I3A A;  2YNH A;  2PYL A;  1BQN A;  3AA4 A;  1RT7 A;  4CF0 A;  4E3S A;  1HNI A;  4Z4I A;  2Y1I A;  1N5Y A;  2WOM A;  4HCB A;  3S3N A;  4BE0 A;  1ZBI A;  2Q3S A;  2EHG A;  2KW4 A;  4CEA A;  3OJS A;  1T05 A;  3HXM A;  1NK0 A;  4M42 A;  3HJF A;  2W42 A;  4CIF A;  5J2M A;  1NOZ A;  1B9F A;  3F73 A;  3QEW A;  2HHT A;  3DLG A;  3JSM A;  1L3T A;  3MED A;  4OGC A;  4DLE A;  1BQM A;  5FDL A;  4AHU A;  4Z4H A;  2DY4 A;  3QES A;  4HVJ A;  3MXI A;  1WAJ A;  2ITG A;  3ZSX A;  2QXF A;  3OYJ A;  4KB1 A;  1ZYQ A;  1C1C A;  4CFA A;  3CFP A;  4F8R A;  2GV9 A;  3ULD A;  4FLZ A;  2G8I A;  1VSH A;  2XHB A;  1A5X A;  3VQ7 A;  5J2Q A;  4C8L A;  3VA3 A;  1J53 A;  2FBY A;  1NK9 A;  3NF6 A;  3DM2 A;  5D3G A;  3P83 D;  4B9M A;  3AVA A;  4E89 A;  3OVN A;  4K8X A;  5DMR A;  4GVM A;  2HHQ A;  3C6T A;  1RTJ A;  4EZ9 A;  1WSJ A;  4FLU A;  3S3O A;  1A5W A;  1CXQ A;  1EP4 A;  5J1E A;  4DTN A;  1DTQ A;  3QO9 A;  3AVK A;  2HNY A;  4N47 A;  4CED A;  4DSE A;  1T03 A;  1TAQ A;  4H4O A;  5KGX A;  3DLK A;  4DMN A;  2YV0 X;  3HL8 A;  4C8K A;  1TAU A;  3CFR A;  3DLR A;  3I0S A;  4O44 A;  5FRN A;  4CJ4 A;  4AHC A;  3WNG A;  1BI4 A;  4Z4F A;  4CGG A;  3CQ8 A;  2LSN A;  3TAG A;  3LWL A;  3WNH A;  3OYK A;  5FRM A;  4CHP A;  3VQA A;  1RT4 A;  3ZSV A;  4E7J A;  3QIN A;  3QLH A;  3L2W A;  1C1B A;  2KFN A;  1UA0 A;  4M3T A;  1C0M A;  3TAB A;  5CY4 A;  4DFJ A;  5I3U A;  5CZ2 A;  2HHX A;  4EP5 A;  4OVL A;  3ZSZ A;  4CJK A;  2FBT A;  3NF8 A;  3SQ1 A;  1GOB A;  3TAN A;  2BDP A;  1KCF A;  2OZS A;  4FK2 A;  2B6A A;  4N56 A;  1X9W A;  4FK4 A;  4KRE A;  4MFB A;  4CE9 A;  2QKK A;  1SKW A;  3M8S A;  3NE6 A;  1IKX A;  4EP4 A;  1SUQ A;  2RN2 A;  4BDZ A;  4DQR A;  4DFM A;  4TSX A;  4CCH A;  2YKM A;  3O4N A;  3MEC A;  5C42 A;  4E1M A;  4OKJ A;  4J2B A;  2KTQ A;  3KKS A;  3SUQ A;  1HYS A;  4FLY A;  3PX4 A;  5SWM A;  3VQD A;  4KI6 A;  1KLN A;  2RKI A;  3QNN A;  1VRT A;  3LP3 A;  5HRN A;  4XIU A;  3K57 A;  4DQP A;  3AVG A;  4M3W A;  4DS4 A;  4E1N A;  2AJQ A;  2Z1H A;  1JL1 A;  3OJU A;  4AHT A;  1S5J A;  4CGI A;  1NK8 A;  4Z4G A;  3ZSQ A;  3RMC A;  1QE1 A;  3V9U A;  1S1V A;  5KGW A;  3SUP A;  3NCI A;  4DSF A;  4CEB A;  4F2S A;  2D0C A;  1JLE A;  1KRP A;  3K5M A;  3RMA A;  4FZZ A;  1BHL A;  1MU2 A;  2VG7 A;  1EX4 A;  3LP1 A;  1KTQ A;  1NJZ A;  3ZSW A;  4HUG A;  4B8C A;  2FC0 A;  3RMD A;  3T19 A;  3OYN A;  4JRP A;  1S6Q A;  1TK8 A;  1IO2 A;  1HQE A;  4NYN A;  1IH7 A;  1Z26 A;  4PWD A;  5C25 A;  3SZ2 A;  4FJM A;  5J2N A;  3ZT4 A;  3LDS A;  1TVR A;  3LPU A;  3TAM A;  1NJW A;  4EZ6 A;  1Y97 A;  4ZTF A;  3AA2 A;  1QHT A;  2VG5 A;  3K5N A;  4CEF A;  4B3O A;  1JL2 A;  3QET A;  1RT2 A;  3SCX A;  1Q9Y A;  4FLX A;  2ATQ A;  2ZD1 A;  4B9L A;  2ZQB A;  4CJQ A;  4FM0 A;  3E01 A;  4OJR A;  4Q5V A;  3AO1 A;  4E7L A;  1XC9 A;  1D9D A;  1SKS A;  2HB5 A;  4CHN A;  2HHW A;  4PY5 A;  1YT3 A;  4AHS A;  4FYD A;  2D0A A;  4KB0 A;  4RG8 A;  2IS3 A;  3V9S A;  4DWI A;  1IKW A;  4M3Y A;  4OPK A;  4CK3 A;  3TAR A;  3ITH A;  2XY8 A;  5C24 A;  4LH4 A;  4M3Z A;  3NFA A;  3LAK A;  3MXJ A;  4M3R A;  3B6P A;  3HPH A;  3L3V A;  3M8Q A;  1QSY A;  3CYM A;  4N41 A;  1VSD A;  1S9E A;  1WAF A;  1K6Y A;  3DI6 A;  4KKO A;  4CEZ A;  5HRP A;  4FLT A;  3K5L A;  4DFP A;  1KVB A;  2YHA A;  4IKF A;  1ITG A;  1I39 A;  3A2F A;  2D0B A;  4GW6 A;  1WSH A;  4QAG A;  3LPT A;  3LZI A;  3V9Z A;  3T3F A;  4B9T A;  3EYZ A;  4KFB A;  4CF1 A;  3RRH A;  4KHU A;  4HHT A;  3SI6 A;  2IOC A;  5CZ1 A;  1RDB A;  1FK9 A;  2DFE A;  1IG9 A;  4NCA A;  3TR8 A;  1U48 A;  4DS5 A;  3O3F A;  4ID1 A;  3S3M A;  4RW8 A;  1N6Q A;  1U04 A;  1SV5 A;  1S6P A;  4RW6 A;  2X6S A;  3VQE A;  3QEX A;  1S1U A;  2FBX A;  5I42 A;  3HVT A;  2JLE A;  1JLQ A;  2YKN A;  1LAV A;  2ETJ A;  3CM5 A;  4N76 A;  3C94 A;  3TAF A;  4DSI A;  4I2Q A;  4ZHR A;  4DF8 A;  3VQ8 A;  3C95 A;  1SL0 A;  1TGO A;  4DTJ A;  4CJE A;  2X6N A;  2RF2 A;  4O4G A;  2OA8 A;  5K14 A;  3MAQ A;  1B9D A;  1UA1 A;  1EET A;  3QNO A;  2B5J A;  1HJR A;  3QIO A;  4CHQ A;  1RTI A;  1RT1 A;  3V1R A;  3QEI A;  2NUB A;  4R5P A;  1DTT A;  2HW3 A;  4UQG A;  4PA1 A;  1TKX A;  3VQ4 A;  1TKZ A;  1UWB A;  3AVC A;  4I2P A;  4I9L A;  4BE1 A;  3OYD A;  3SNN A;  4CJP A;  4DSJ A;  4I9Q A;  4C8N A;  2O4I A;  1JKH A;  3PX6 A;  3SQ2 A;  4IFV A;  4C8O A;  4FZY A;  4F3O A;  3RWU A;  1KVA A;  1RT5 A;  4W5O A;  1O1W A;  4CHO A;  3OYL A;  1J9A A;  4JRQ A;  3ZCM A;  3SJJ A;  3ALY A;  3HYF A;  3EZ5 A;  2PZS A;  2DTU A;  2JGU A;  3AVN A;  3M8P A;  3ZT3 A;  1ZBL A;  3AO3 A;  1CXU A;  3ASM A;  3K5O A;  1Z25 A;  3V1Q A;  4DTM A;  3H08 A;  5J2P A;  2IC3 A;  4B08 A;  1DLO A;  2GBZ A;  4O55 A;  4BWJ A;  4CK2 A;  3OYA A;  5HRS A;  5HP1 A;  2OPQ A;  3DMJ A;  3ZSR A;  4KI4 A;  2X78 A;  3NDK A;  3O4Q A;  5DK5 A;  1HRH A;  4FJK A;  1BCO A;  1S1W A;  4Z4C A;  1XHZ A;  2BGG A;  3K2P A;  3VQ9 A;  3HM9 A;  2BAN A;  2Y1J A;  1TKD A;  4BDY A;  1NK7 A;  4CK1 A;  2G8U A;  1FKP A;  3ZT0 A;  1NK4 A;  4CES A;  1J54 A;  4DTU A;  1WSF A;  4KPY A;  4KTQ A;  1VK0 A;  1RDA A;  2B4J A;  2YNG A;  3NHG A;  1SL2 A;  1QSL A;  2YHB A;  3D45 A;  2F8T A;  4RW9 A;  3UIQ A;  1JLB A;  4E0D A;  4CFB A;  4J2E A;  1ZBH A;  5JS2 A;  3F9K A;  3ISN C;  4QCL A;  3RTV A;  4DF4 A;  1W9H A;  4FK0 A;  3KIO A;  4FJI A;  1QTM A;  5T7B A;  5SZT A;  1X9M A;  3CM6 A;  1KVC A;  3B6O A;  2QK9 A;  5FRO A;  4DTO A;  1KFD A;  1JLA A;  2G8F A;  1RDC A;  5JS1 A;  1BIZ A;  1LV5 A;  2PYJ A;  4FJ7 A;  4J2A A;  4CIG A;  3KD1 E;  5HBM A;  4BAC A;  1VRU A;  1JXE A;  4KRF A;  1XI1 A;  5KRT A;  4JS4 A;  4ELU A;  3AO5 A;  1C1A A;  2A1S A;  4AHR A;  1VSK A;  1LWC A;  4OPJ A;  4CGH A;  3HO1 A;  2OPP A;  3KLI A;  3AVM A;  4E7I A;  4CJ3 A;  1BCM A;  4KHY A;  1WSE A;  3D0P A;  2OPR A;  3ZT1 A;  3QEP A;  1KLM A;  3V81 A;  3VN5 A;  4IBN A;  2G8V A;  3V4I A;  1RT3 A;  3PX0 A;  4DU1 A;  3KLF A;  1ASV A;  2Z1G A;  1YVU A;  2WON A;  5KI6 A;  3CFO A;  1LAW A;  1NK6 A;  4O0J A;  3NF7 A;  1HPZ A;  1RTD A;  3CG7 A;  4KV8 A;  1L5U A;  4B9N A;  4OLB A;  4CEO A;  1BIS A;  2F8S A;  2HHU A;  4M45 A;  3EY1 A;  3SUO A;  1QS4 A;  1TL1 A;  2VWK A;  1CZ9 A;  1CLQ A;  3T1A A;  4OLA A;  2XY6 A;  1ZBU A;  4O0I A;  1NJX A;  1KFS A;  1W0H A;  3VQQ A;  4BE2 A;  1RTH A;  2QKB A;  3RR8 A;  3IAY A;  4CF9 A;  3P5J A;  2XO7 A;  1L3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...