1RBSA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEACEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbsA00
3AA2A 3VQ5A 4B08A 4CEDA 4CIEA 3HP9A 5KI6A 3QEXA 4FJMA 4OKKA 1U48A 1S1UA 1TK0A 1O1WA 1VSLA 3OYGA 4FLVA 3NH0A 4I2QA 2VWKA 1Q9YA 4M3YA 2KZZA 3KLHA 1RTHA 3MEEA 1RCHA 4CJSA 3OJUA 1EXQA 2YHAA 4B9NA 5C42A 4BE1A 1SKSA 4B9TA 4DFPA 4N41A 3P5JA 4FLUA 3NDKA 1JLCA 3QESA 1XWLA 4CF2A 4DTXA 3QERA 4M3WA 3MEGA 2RPIA 1FK9A 3MXMA 3L2VA 4GVMA 3E01A 3OYJA 1ASUA 3MECA 1S9EA 1XHZA 1DLOA 3TI0A 4BDPA 3ZT3A 4J2AA 4PA1A 4KO0A 5KGWA 5JS1A 4F8RA 3HVRA 3O4QA 1G15A 3OYAA 3LP3A 3AO3A 4O0JA 4WE1A 1REVA 3AVNA 3VQQA 1MU2A 5FRMA 1L5UA 3WNFA 3V9WA 2XRIA 2KZMA 2X74A 4CFDA 4OGEA 1C6VA 3RRGA 3AVAA 4CHPA 5KTQA 3WNHA 5KRTA 2P1JA 4DF8A 1NKCA 3VQPA 4M3XA 3CFRA 2HHQA 3EY1A 4I9LA 3ULDA 2IDOA 1LWFA 2HHSA 1T8EA 2G8HA 4LY7A 3SNNA 3AA3A 3LWLA 3EZ5A 2OPQA 2FBTA 4K8ZA 4B8CA 3RMCA 2RKIA 2E6LA 4F2SA 1ASWA 4FJIA 1HQEA 3NF7A 1JXBA 3K5OA 3SI6A 4FJ9A 2D0AA 2OZSA 1FKPA 3O3FA 1BCMA 1LWEA 3TR8A 3HXMA 1W9HA 3VQAA 1RBRA 1RBVA 2VG6A 3QLHA 4OPJA 3KLEA 3MXIA 4M42A 3AVKA 1RT1A 3ZT4A 1XHXA 3VQDA 4RW9A 1QE1A 2XHBA 1ZBLA 3HL8A 4FXDA 3PV8A 4CECA 3AVGA 1RBSA 1TK5A 2G8VA 4O4GA 3CG7A 5HRSA 3NCIA 3OY9A 3V9SA 1J54A 1BIZA 2BANA 1GOCA 1WAFA 4IG0A 1KSPA 5J2QA 4DF4A 4M45A 1B9FA 1BIUA 4I9QA 4TSXA 4EP4A 4CF1A 4E3SA 4DU4A 4B8AB 1NKEA 3K5MA 1RDBA 4DSIA 4KTQA 3AVBA 4KFBA 4C8MA 2WONA 4B9MA 2P5OA 2G8WA 1UAXA 3ZSQA 3V1QA 4FZXC 4BWMA 4DG1A 2IGIA 3ZSXA 4DQRA 4O55A 1A5XA 1CZ9A 1RBUA 3QEVA 4KHNA 1TKXA 3DRPA 3DI6A 1C1CA 3NH2A 3LALA 4RG8A 2G8UA 4DU3A 3DOLA 1CLQA 4BWJA 4PQUA 3TAQA 1CXQA 4HUFA 1NK6A 2RF2A 1JLFA 4XIUA 3OYMA 4DU1A 3KK3A 1U45A 2OZMA 1HNVA 1U4BA 4DSFA 1WNSA 1NK4A 4J2BA 3PX0A 4DTUA 4HHTA 2HVIA 3BGRA 4LH4A 2YNGA 4E7JA 4DTMA 4DWIA 3RTVA 3DLKA 4C8OA 1IKWA 3NH1A 2IAJA 1TAQA 1NOYA 3K5NA 3SYZA 4YNQA 4QCLA 1IH7A 4C8NA 1X9MA 3LDSA 4DFKA 3CM6A 4DQPA 1ZBHA 4FYDA 1BQNA 1EETA 2KFZA 1EP4A 4JRQA 3RMBA 4F3TA 3TWHA 4N56A 1LAWA 1K6YA 4CJRA 4RW8A 2DFFA 1J53A 1TV6A 1X1PA 4CGHA 1S9GA 4CHYA 1C1AA 2D0CA 3AO4A 1NK5A 1RT5A 3BDPA 3UIQA 1KFDA 3DLRA 3QINA 1C1BA 4CEFA 1NOZA 4ICLA 4NCGA 4FJJA 2Z1JA 1X9WA 1S5JA 1KLNA 5CYQA 1BI4B 1RDCA 2Q3SA 1S1VA 4CJLA 1YT3A 5KGXA 3U3YA 3KD1E 4KB1A 3KLGA 1NK0A 1Z26A 4FM0A 1C0TA 5J2MA 5HROA 3M8RA 2HB5A 4H4MA 4FJKA 1VSKA 3NF6A 1JLBA 4DSJA 3C6TA 1VRTA 4KV8A 3OYKA 3K2PA 3NGIA 5I42A 2QKBA 3ASMA 4HVJA 3DMJA 1WSGA 1VRUA 2VG5A 3AVLA 1VSHA 4CJFA 4CK2A 3SQ1A 3HK2A 1D8YA 4KHWA 4W5NA 1VSMA 3P1GA 2JGUA 3NFAA 2RN2A 1NK7A 2XY5A 3V4IA 2G8FA 1RNHA 5HP1A 4AHUA 2FBVA 3WNEA 3AV9A 4BE0A 1LWCA 2IS3A 4UQGA 2HHVA 3I0RA 2ZD1A 3B6OA 4AHVA 2HHXA 4OPKA 4FJ7A 1UWBA 3HT3A 4IFVA 3C6UA 3ZT0A 1WSIA 4CESA 3F9KA 1IKXA 3IG1A 3TANA 1NJYA 1IO2A 4MFBA 4E7HA 4FLWA 2BGGA 4KRFA 1BI4A 4KHQA 4IBNA 4FLZA 4OLAA 2Z1IA 3AVIA 1DTTA 3RMDA 1TAUA 3KKRA 1RBTA 2PZSA 2O4GA 3D45A 3RR7A 4C8KA 1L3TA 2P51A 4CERA 4Z4CA 3LZJA 3THVA 4KI6A 1UA0A 4CFCA 3L3UA 3SCXA 4Y1CA 1JLEA 3DYAA 4O0IA 4CJ3A 2PYJA 2XY8A 4CJ4A 4FW1A 3SUQA 3MEDA 4AHCA 2NUBA 2R7YA 4FM1A 1KTQA 3AA4A 1GOAA 2VG7A 1TL3A 5HRPA 3OYBA 3CFPA 3QETA 4B9LA 4FZYA 3SQ4A 2HW3A 3OJSA 2KW4A 4KHUA 2ZE2A 1NK8A 4E1MA 1U04A 5HLFA 1HPZA 2OPPA 2OYQA 2DFEA 3ZT2A 5C24A 4Q5VA 1WSEA 2B6AA 2GBZA 1YVUA 3QEIA 1HJRA 5T7BA 2YNFA 3DRSA 4YFUA 4E7KA 3JYTA 4CJWA 3LPUA 4F4KA 2B5JA 3OS0A 1XI1A 4AH9A 3SUOA 3JSMA 3FFIA 4OLBA 1U49A 4DQQA 5CY4A 3V81A 4N47A 1S1TA 3QNNA 4CFBA 4DSKA 4W5TA 3VQ7A 4KHYA 4DFMA 1S6QA 4ZHRA 3AVJA 1I3AA 3M8QA 1RT3A 1GOBA 1Q8IA 3HM9A 1W0HA 1SV5A 4OKJA 4HUGA 2QKKA 2YKMA 3HO1A 3PX6A 1LV5A 3OS2A 3AVCA 3IS9A 5HRNA 4DLGA 2Z1HA 4BDYA 3AO5A 4LH5A 2FBXA 3NBPA 1XC9A 2DTUA 4C8LA 2BDPA 1KVAA 2X78A 4PWDA 2D5RA 2HNYA 1JXEA 3SQ0A 1TK8A 1SKWA 4B9VA 2HVHA 2HHTA 1JL2A 1J5OA 4ID1A 4M41A 2WOMA 4CGDA 1DTQA 3ZT1A 1SL1A 5FRNA 3L8BA 3IAYA 3H08A 1RDDA 4CJPA 4FJ8A 4AILC 3OYCA 4FZZA 3LP1A 1N6QA 4OVLA 3VQ4A 1NKBA 1JLQA 1QQCA 3AA5X 4CHQA 3RR8A 4CJEA 1HMVA 1WSFA 4OJRA 3LP2A 4RW4A 1NJZA 1KRPA 4J2EA 2BE2A 4LD0A 3S3NA 3MAQA 3F73A 3LAMA 4DTSA 2PYLA 3QIPA 3ZSZA 3ZSYA 5FDLA 4GMJB 4CK1A 3O4NA 1HRHA 4AHSA 2Y1IA 3SV3A 2HNDA 2KTQA 1JL1A 3ZSRA 3S9HA 4FLXA 2GUIA 5SWMA 3AVHA 4IDKA 4IG3A 5I3UA 1RILA 1WAJA 3B6PA 3DRRA 4ZTFA 1D9FA 4Q0BA 3NGYA 2I5JA 1QS4A 4JRPA 3C94A 4BACA 3I0SA 3TAFA 1S1WA 4HUEA 4FJHA 1KLMA 4DSEA 4DTNA 3IRXA 4L8RB 4NCAA 1TKTA 3HPOA 5JS2A 1SL0A 4Z4GA 5HBMA 3HPGA 2XY7A 1T05A 1BL3A 1EX4A 3U6FA 3PY8A 3DM2A 1YTUA 4OGCA 4I2PA 1QTMA 2X6NA 1JLGA 3ZSOA 3OYNA 3KKSA 4FJ5A 3QEPA 4KREA 2EX3A 1VSDA 4W5QA 1LW2A 1RTIA 4DQIA 1UA1A 1RT2A 2YNHA 2EHGA 2YV0X 4OKEA 3VQBA 3K59A 1QSYA 4M3TA 2AJQA 4O44A 1HYSA 3HPHA 4RW6A 1QSLA 1HNIA 1D5AA 3LAKA 3KK1A 3M8SA 1C0UA 1VSJA 3M8PA 4AHTA 4DS4A 1IKYA 1D9DA 1Y97A 4CGFA 4CEQA 4CK3A 3AO2A 1BGXT 1VSFA 3G0ZA 4CHOA 3SQ2A 3OYFA 4B9UA 4EZ9A 3V9ZA 4RW7A 1TGOA 2DFHA 4FCYA 1SKRA 1ASVA 3HVTA 3P83D 5C25A 4BDZA 3CFOA 4CE9A 2ATQA 3V9XA 2IOCA 1BCOA 2E4LA 1C0MA 4CCHA 3OS1A 4CGGA 3NF9A 4CIGA 1NJWA 1N5YA 2HHWA 4LSNA 3TAPA 4QAGA 4H8KA 1YTAA 5HRRA 4HTUA 3A2FA 1S6PA 4E19A 3VQEA 3VQ6A 3V9UA 3QEWA 3TAEA 3TAMA 5J2NA 4DTJA 3LP0A 4KI4A 1S1XA 5CYMA 3HJFA 1RT4A 4E0DA 4QOZB 1B9DA 3SPZA 4EZ6A 1A5WA 4ZTJA 4KTZA 2OPRA 4O5BA 4FVMA 1WSHA 5K14A 1HQUA 1ZBIA 1BHLA 4FK0A 4Z0UA 3L2WA 4CFAA 4ELVA 4FJNA 3DLEA 5CZ2A 4HCBA 1WSJA 4Y1DA 3PUFA 4JLHA 3RMAA 4CF0A 1TVRA 3LWMA 3L3VA 4DLEA 2FBYA 1BQMA 1FKOA 4ELTA 2B4JA 1RTJA 3LPTA 4JS5A 1QSSA 3ZSWA 4CF9A 4CJUA 1KVBA 4CJ5A 3NGZA 2OPSA 3OYIA 4FLTA 4B9SA 1ZBUA 4AHRA 3V6DA 3T3FA 4E89A 3SJJA 3AVMA 3I8DA 1LAVA 3ISNC 2FC0A 3WNGA 3L2QA 3KK2A 1VK0A 4DTOA 1RT6A 2X6SA 4KHSA 1Z25A 2YKNA 4KKOA 4CF8A 1U47A 1HYZA 2ETJA 2DY4A 3T19A 1R0AA 3S3OA 1ZYQA 2HMIA 3KTQA 3VQ9A 1J9AA 2KQ2A 3HSTB 4I7FA 3PO4A 4M3ZA 4Z4FA 4B3OA 4Z4HA 4CEBA 2HNZA 4FJGA 2JLEA 3U3GA 1NJXA 5J2PA 3HP6A 1L3VA 1VSEA 2QK9A 3ZSVA 3G10A 1SL2A 3KJVA 1ZBFA 4FJLA 4M3RA 3RRHA 3SPYA 1EKEA 3OYHA 1KFSA 4KAZA 4KB0A 4W5OA 3KD5E 4Z4EA 5SZTA 1I39A 1JLAA 4MQ3A 2F8TA 2F8SA 4M3UA 3RWUA 2D0BA 4CEZA 3V1OA 2E6MA 4KPYA 2ITGA 1RTDA 1VSIA 3LANA 4KTWA 1T03A 1WN7A 2KFNA 3QIOA 3T1AA 1L3UA 1B92A 4CJQA 1FXXA 3K5LA 4J2DA 2F96A 5CZ1A 3K58A 3PX4A 1HYVA 4FK4A 4DQSA 3S3MA 3OYLA 1F21A 1TKDA 1IKVA 4R5PA 3D0PA 4CEOA 2OA8A 3MXJA 3OVNA 2P5GA 1JKHA 3L2UA 2Y1JA 1NK9A 4ELUA 1KVCA 3OYEA 1QHTA 3NE6A 4F3OA 3SUPA 1Q9XA 4NYNA 4CEEA 3DOKA 4Z4IA 3O3GA 5EU7A 4DTRA 3HYFA 1KCFA 1L3SA 4CGIA 1TKZA 4F2RA 2VWJA 4BE2A 4E7LA 3NHGA 2O4IA 3VN5A 5KRSA 3AVFA 4DTPA 4N76A 4CHNA 3VA3A 4HCCA 2G8IA 4CJKA 4LSLA 3AO1A 4E1NA 3LZIA 4PY5A 4ID5A 1T7PA 3DLBA 5FROA 4NCBA 3ITHA 3VA0A 3K57A 4DSLA 4CGJA 4DFJA 4FJXA 1ITGA 3SZ2A 4H4OA 1X9SA 5DK5A 4FLYA 4PUOA 1LW0A 2IC3A 3TAGA 2HHUA 3O3HA 1CXUA 3ZCMA 3SUNA 2YNIA 3KLFA 4NYFA 3VQ8A 4IKFA 2LSNA 2ZQBA 3NF8A 3OYDA 4FK2A 4E7IA 3EYZA 1IG9A 1TL1A 2A1SA 2W42A 1A5VA 2QXFA 4FW2A 3L2RA 3C95A 3KLIA 2XO7A 4CIFA 4G1QA 1UOCA 4K8XA 2XY6A 2A1RA 3PO5A 4W5RA 4DS5A 2G8KA 2YHBA 3CYMA 3ALYA 1RT7A 5DMRA 3QO9A 4CJTA 4CJVA 4JS4A 3NAEA 3CQ8A 2GV9A 4CEAA 3CM5A 4CHZA 3QNOA 1CZBA 1SUQA 4GW6A 1WLJA 3TABA 4DMNA 5D3GA 3DLGA 1BISA 4N5SA 2PY5A 5E41A 3DLHA 2Z1GA 3TARA 1RDAA 4IFYA 5J1EA 3VQCA 3SV4A 3V1RA 3KIOA 4FM2A 4EP5A
chains in the Genus database with same CATH superfamily
1HJOA 3VQ5A 3B8AX 4CEDA 3QEXA 3LM2A 3H3OB 4OKKA 4XH5A 3RSEB 3F9MA 4NXNK 1O1WA 1VSLA 1HNZK 4I2QA 4M3YA 2FSJA 1RCHA 1SKSA 4N41A 4DFPA 1W7AA 3NDKA 1JLCA 4DTXA 1JCEA 2WFBA 3QERA 4M3WA 2BUPA 1FK9A 4B9QA 4CZIA 4WFNL 3L2VA 3MXMA 4GVMA 3E01A 1ASUA 4BDPA 4J2AA 3CPWM 4KO0A 5KGWA 2YCHA 4F8RA 1NGIA 2FSKA 1G15A 3OYAA 2UXDK 3AVNA 3VQQA 1MU2A 5FRMA 1L5UA 2KZMA 5F2RA 4CFDA 4OGEA 3CXCM 3RRGA 3O08A 1NKCA 4DF8A 1YAGA 2HHQA 4DR1K 2HHSA 1WUAA 1NGFA 4EHTA 3A5NC 2G8HA 5E26A 1MWKA 2GWJA 2DPNA 4F2SA 4FJIA 3K5OA 2H3GX 3H45C 1FJGK 1BCMA 1LWEA 3CQYA 2VG6A 1RBVA 1RT1A 3N4QA 1XHXA 4FXDA 4BC3A 3MMVA 1TK5A 2G8VA 4O4GA 3CG7A 3P4IA 1DEJA 1VQ4N 1J54A 4IG0A 1KSPA 1ATRA 1B9FA 4TSXA 4EP4A 1NKEA 2E8AA 1HPMA 3K5MA 4C8MA 2G8WA 3L0QA 4BWMA 3ULEA 2IGIA 3QEVA 3DRPA 4ISFA 3NH2A 3LALA 4RG8A 4DU3A 1CLQA 4PQUA 5DM7L 1CXQA 4JI0K 4FWKA 3G6EN 1XQSC 4DU1A 1OH7A 1U4BA 4CI6A 4DSFA 1NK4A 4HHTA 5BN8A 3BGRA 4E7JA 4DTMA 3RTVA 3DLKA 3UKUB 4C8OA 4BRQA 4DV1K 4C8NA 3L4IA 1ZBHA 4FYDA 1BQNA 1EP4A 5KPRA 3CJ1A 4JRQA 4JI2K 2YJEA 1LAWA 4CJRA 2DFFA 1C1AA 1NK5A 3BDPA 2E2PA 1C1BA 4ICLA 5HL7L 2NRRA 1RDCA 2Q3SA 1YT3A 4ISEA 1VQNN 1JCGA 4FM0A 3M8RA 2HB5A 1NG9A 3ZETA 4MDBA 3C6TA 1D4XA 3NGIA 3ASMA 3GDQA 1VRUA 3ZEUB 2JGUA 3VOVA 1NK7A 1WBDA 4CZGA 2E2OA 4DV2K 4QS9A 3ZX2A 3CCSN 4BE0A 1LWCA 3KHYA 4GY2B 4A61A 3B6OA 4OPKA 2W41A 2OTLN 3ZT0A 4CESA 1IKXA 3IG1A 3TANA 4IO8A 4KHQA 2D0OA 4FLZA 2Z1IA 4DHYA 1DTTA 3RMDA 1TAUA 3KKRA 2P51A 4Z4CA 1UA0A 5FPEA 3SCXA 1JJ2M 2YX6A 4CJ3A 1K8KA 4OO1J 5AZIA 2R7YA 2P9SB 4IFEA 3AA4A 2VG7A 2D1KA 3CFPA 4KHUA 2ZE2A 2OPPA 2OYQA 3ZT2A 3QEIA 5CR4A 1HJRA 4YFUA 1W97L 4F4KA 1ZC6A 2BTFA 4JI6K 3JSMA 5LMNK 4OLBA 1U49A 5CY4A 3DXMA 1HNXK 4DFMA 4YY3K 3VTIA 4C1NI 2QKKA 1SV5A 1J5EK 3MX5A 4A5BA 4GV6A 3C6AA 3QFUA 4DV5K 4BDYA 1K73O 3NBPA 1XC9A 2BDPA 3P39A 5AQUA 3R8EA 4B9VA 4M41A 3ATVA 1XNQK 5FRNA 1SL1A 4CJPA 3LP1A 3SAGA 1N6QA 4OVLA 4DR2K 3A0IX 4OJRA 5EOYA 3LP2A 3HZ6A 3GG4A 1EQYA 3F73A 3CCRN 2VGNA 3QIPA 4AHSA 3MN9A 2KTQA 4FLXA 2VYPA 4CW7B 5GAGP 4IG3A 5I3UA 1RILA 3B6PA 4B3SK 3DRRA 1VQLN 5CE3A 4NXMK 4KI4A 1YF5L 4GVEA 4HUEA 3O9SA 1YVNA 2WTUA 3ZX0A 4DSEA 1DT9A 2P9IA 3CCJN 1SL0A 4Z4GA 2XY7A 4K41A 2NNWA 3PY8A 3CD6N 3VEVA 1JLGA 3OYNA 4FJ5A 1VSDA 1RTIA 1U6ZA 3CERA 2YV0X 2HOEA 1BU6O 4RW6A 2FSNA 3CC4N 1QSLA 3LAKA 3M8SA 4JKGB 2E1ZA 4UY8O 4AHTA 1U2VA 1TUUA 1KAZA 1D9DA 4DR3K 3AO2A 3OYFA 4B9UA 3DAWA 4RW7A 3HVTA 4CE9A 1BCOA 1C0MA 1R59O 4CIGA 1NJWA 3LDQA 2HHWA 4LSNA 3OTOK 1Q82O 4E19A 4JHDB 4BRPA 3GL1A 3QEWA 3TAMA 2CGLA 4JKFA 5CYMA 3HJFA 4E0DA 4ZTJA 2OPRA 3E1YA 4O5BA 4X65K 5K14A 1HQUA 1ZBIA 2CH6A 4FK0A 3L2WA 3DLEA 3T69A 2P9NA 4FWOA 3PUFA 5CHIA 3UKRA 3BUZB 5C15A 4DR6K 1YUWA 3IFRA 5EXWA 1Z6RA 4B9SA 3KWGA 5FPDA 3ISNC 3IKMA 3O4WA 1LOTB 1HKGA 4CZLA 1IBMK 2ETJA 2DY4A 3T19A 3ZYYX 5B8HA 1ZYQA 1NGDA 2VQEK 3VQ9A 1J9AA 3PO4A 4M3ZA 4Z4FA 4B3OA 1QQOA 2HNZA 4JN4A 4EFHA 2HBJA 5J2PA 2PFUA 4CZMA 4M3RA 1KFSA 3OYHA 3O9UA 3KD5E 2KLAA 1JLAA 3H46O 2F8TA 3VPZA 1EO1A 3R9PA 2RHKA 4IZ9A 4CEZA 4KPYA 2ITGA 3LANA 1RGIA 4IDHA 2KFNA 1VQ6N 2NLXA 3QIOA 3PIPL 3PX4A 4FK4A 3OYLA 1IKVA 3OVNA 1JKHA 3FZLA 4ELUA 1KVCA 1WB9A 3G71N 1QHTA 4F3OA 4BRMA 4NYNA 1SZ2A 4Z4IA 5EU7A 2P9KB 3HYFA 1L3SA 1TKZA 1NGGA 4BE2A 3NHGA 3VN5A 4DTPA 2G8IA 4HCCA 3FZFA 4CJKA 3AO1A 4E1NA 4PY5A 1T7PA 5FROA 3ITHA 3VA0A 1YXQA 4DSLA 4FJXA 2VGMA 3QFPA 4M63C 3ZCMA 3SUNA 3KLFA 3VQ8A 1NMDA 3R1XA 1VQ7N 4MO5A 1IG9A 5AFUH 1BUPA 4CIFA 1NBWA 2A1RA 2QM1A 4DS5A 4CJ7A 1RT7A 4JS4A 4CJTA 3R3LA 3CQ8A 3CM5A 4DKWA 3AGRA 3A5OC 5D3GA 1VQON 2PY5A 2Z1GA 3KIOA 2O8DB 4EP5A 3HP9A 2UXBK 4CZKA 1U48A 3H1VX 2VWKA 4IEEA 3U4LA 4JI4K 3KLHA 5BN9A 1WBBA 1VQ8N 2YHAA 3P5JA 4CF2A 2RPIA 3OYJA 3LDOA 3OA9A 3TI0A 2A40A 3THYB 4JKGA 4GKJK 3HVRA 3O4QA 3CJAA 4O0JA 2NRXA 4WE1A 2Q36A 3V9WA 4FVUA 4GV3A 4CHPA 3VGMA 1NGEA 4M3XA 2VCPA 3ULDA 4DV6K 2YI1A 1T3VA 4PKIA 4JK9A 4FOIA 3LWLA 4AQYK 2E6LA 1HQEA 1I94K 3VEWA 5EVZA 4WQ5A 3TR8A 3HXMA 1W9HA 1HNWK 3QLHA 2O8CB 3AVKA 1QE1A 3PV8A 2OANA 4CECA 4BGBA 4A2BA 4DB3A 4LF4K 3VEXA 4LC9B 2QWRA 4H5WA 2ZWHA 3VERA 2BANA 1GOCA 4DF4A 2O8BB 4E3SA 4DU4A 3HTVA 4KHPK 2FF3B 1HLUA 4NLCA 3VEZA 1NMNA 5BPNA 4B9MA 5E84A 3ZSQA 4LF5K 3V1QA 2QWPA 1P8ZA 5BPMA 3ZSXA 4I6MB 4DUZK 3DI6A 1C1CA 1HR0K 2G8UA 3NVKA 4CBUA 2E88A 2IVOA 3Q7BA 4JD2B 5KPZA 3WT0A 1XMOK 3LDPA 4XIUA 3KK3A 4BRLA 4JI1K 1KQSM 2OZMA 1HNVA 1VHXA 4J2BA 1WNSA 3KVGA 3P38A 2YNGA 4DWIA 5AQOA 3NH1A 2IAJA 3HOSA 3SYZA 1IH7A 4H5RA 2NRWA 3GBTA 2KFZA 2PAVA 3RMBA 3TPQA 3TWHA 4FWQA 4RW8A 1X1PA 5BR9A 2D0CA 3AO4A 1NOZA 1RFQA 5MLCQ 1X9WA 1S5JA 1KLNA 3HSCA 5KGXA 3KZBA 4KB1A 1NK0A 1Z26A 3CCUN 1VSKA 3NF6A 1JLBA 4YOTA 4DSJA 1T6DA 4KV8A 4IEIA 3OYKA 5H1SQ 5I42A 1T44A 4IJAA 4CK2A 1VSHA 3DJCA 4PL8A 1D8YA 2Q97A 3NFAA 4NB4A 2XY5A 4IXCA 3V4IA 1RNHA 3M6GA 2FBVA 1ATSA 3I0RA 2ZD1A 4FJ7A 1UWBA 3HT3A 5AQGA 3M3ZA 1WSIA 3F9KA 1QQNA 1NJYA 4KRFA 4FLWA 1BI4A 4IBNA 3QMLA 4H0PA 1NGCA 1CZAN 2O4GA 3RR7A 4WQ4C 4CERA 4FO0A 3WQUA 1KAXA 5KQ8A 4A59A 4B3MK 1G99A 1JLEA 4R79A 4GNIA 4ILGB 4CJ4A 3SUQA 3MEDA 3T1HK 4O8UA 2NUBA 2V52B 1RDUA 3QETA 1TL3A 5HRPA 4B9LA 4JK8A 4IWVA 1Z05A 3VF6A 3IMXA 3SQ4A 2HW3A 4B1ZA 3CCVN 5LJVA 5HLFA 1HPZA 3AAQA 5M1FA 5C24A 1WSEA 3VF2A 2GBZA 1XMQK 4E7KA 3E9OA 3JYTA 1SQKA 1IBLK 3V81A 4N47A 2P9IB 3QNNA 3VQ7A 5JLHA 4KHYA 4H0XB 1RT3A 4H0OA 3I55N 3HM9A 3BY5A 3HRGA 5AZIB 3PX6A 5M1OA 1LV5A 3OS2A 3IS9A 4WFAL 2Z1HA 4C1NK 2DTUA 1MWMA 1FW6A 2WBNA 4PWDA 2HVHA 2GELA 3MN5A 1J5OA 5JMVA 4CGDA 1DTQA 1U2VB 4K25A 1RDDA 4FJ8A 3OYCA 5IWAK 3WEEB 3VF4A 1QQCA 4BRCA 1V4SA 4CJEA 1XUPO 2QWQA 2GX9A 4CHQA 3A8YA 4JK7A 3VETA 3THWB 1N33K 2BE2A 4LD0A 3LAMA 5GINA 5C2DA 3PLAA 4GMJB 4CK1A 1MA9B 1JL1A 2GUIA 1N32K 5SWMA 3AVHA 3L4QA 4Q0BA 4DV7K 1S22A 2I5JA 1QS4A 3C94A 3TAFA 3CHWA 1TKTA 5JS2A 3J7ZO 4B1XB 1YTUA 1GLJO 4BY9C 2HF4A 1QTMA 3ZSOA 3KKSA 3P31A 1XC3A 3QEPA 3O80A 4W5QA 5GIOA 4JKBA 1RT2A 1UA1A 1RDWX 2AJQA 1QSYA 4HWIA 4O44A 2P9UA 1HYSA 2CGJA 1HKCA 1VQMN 1VSJA 1Y97A 4CK3A 4CEQA 4ISGA 1BGXT 4CHOA 3G0ZA 3SQ2A 2HBKA 2W40A 4EZ9A 1K8KB 1ASVA 5AQVA 2ATQA 5AFUA 3V9XA 3SLCA 4LFBK 3NF9A 3SAHA 1VQ9N 1KAYA 2W6KA 4QAGA 1NGAA 1YTAA 5HRRA 3A2FA 4HTUA 4ILHA 1YJWN 3TAEA 1O13A 2P9KA 4BC2A 4V19S 3SPZA 4KTZA 2A41A 1NGHA 1BHLA 4X66K 4FJNA 4ELVA 3CJCA 1WSJA 3L3VA 4YOWA 3MK6A 1BQMA 1FKOA 5F1XA 1RTJA 2HBLA 3ZSWA 4F9OA 4YOVA 3O1BA 4CF9A 1KVBA 1J6ZA 3NGZA 5GIPA 4JKAA 1NWKA 1ZBUA 3K9JA 4PKGA 2FC0A 3ENHA 1X9JA 2X6SA 3O8MA 4KKOA 1U47A 5LL6Z 1HYZA 1R0AA 3FZHA 3KTQA 3HSTB 1GLEG 4Z4HA 2JLEA 3WXJA 1M90O 3ZSVA 1NM1A 1SL2A 1ZBFA 4FJLA 1NGBA 1EKEA 4W5OA 4Z4EA 2Q0RA 1OH5A 2V7ZA 2F8SA 3RWUA 2D0BA 2E6MA 3CCEN 4FSVA 3D2EB 1WN7A 4CBWA 1GLLO 3Q7CA 4KBOA 1L3UA 4J2DA 5CZ1A 1HYVA 5BPLA 3NMUA 3CJBA 1F21A 3T7ZA 3MN6A 1DGKN 3MXJA 2QW9A 3LL3A 3O5BA 3NE6A 1IV0A 3SUPA 3EZWA 1IJJA 5M1QA 4CEEA 3K9KA 3DOKA 5ELZA 4DV3K 5AQZA 4DTRA 1KCFA 3CF5L 4XEIA 4CGIA 3FZKA 3HI0A 5KRSA 3AVFA 5BRDA 4N76A 4CHNA 4DV4K 3DLBA 4Z94A 4DFJA 3SZ2A 2PBDA 5DK5A 3QBXA 5AQLA 1CXUA 4NYFA 4IKFA 3F2KA 2ZQBA 4I6MA 3OYDA 2QI2A 2A1SA 2W42A 1A5VA 3L2RA 2A6AA 3SBGA 4K8XA 4FWNA 2XY6A 3PO5A 4W5RA 2YHBA 3CYMA 5DMRA 2JWKA 4CHZA 3QNOA 1SUQA 4FWLA 4B1YB 3NVMA 3TARA 1P90A 1RDAA 3V1RA 2V7YA 3A5MC 4FM2A 2HBMA 4CIEA 4JEPA 4FJMA 2FXUA 1S1UA 3I33A 4WYBA 3NH0A 2KZZA 2V51B 3O9QA 3RVCA 3OJUA 4B9NA 5C42A 4H0TB 5FLXO 4FLUA 3QESA 2ZGZA 4DR5K 4RTFD 1BWFO 3C65A 3MECA 1HUXA 2BH1A 3C6HA 3MX2A 3LP3A 5BRHA 1REVA 3WNFA 2XRIA 1C6VA 3AVAA 3EEQA 3U9ZA 3WNHA 4DUYK 3VQPA 3DXKA 3CFRA 2NRHA 4K0KK 2IDOA 1YJ9N 1LWFA 4BRKA 3CC2N 1T8EA 4IJNA 4DQ8A 2I7PA 5AQJA 3F5TA 2OPQA 3J7AP 3RMCA 2RKIA 2CGKA 1ASWA 2ZGYA 3CMEN 3NF7A 3SI6A 4FJ9A 2D0AA 3CETA 2AA4A 4X64K 3PIOL 2ASMA 3VQAA 1RBRA 3KLEA 4OPJA 3ZT4A 5AQWA 4B3TK 5FPMA 3VQDA 4RW9A 2Q0UA 3AVGA 1RBSA 4OX9K 3NCIA 1QQMA 3OY9A 4BRHA 5J2QA 1BIUA 4I9QA 4DR7K 3VEYA 3OW2M 3N4PA 3VENA 3AVBA 4KFBA 2WONA 5C2FA 1UAXA 3OHRA 1JCFA 4O55A 1A5XA 1CZ9A 1TKXA 3DOLA 3ENOA 3TAQA 2RF2A 1U45A 3OYMA 3ZLJA 4U67L 3PX0A 1YJNN 2HVIA 4LH4A 5AQPA 1TAQA 1Y64A 1VQPN 1NOYA 3K5NA 4AM7A 1X9MA 3LDSA 4DFKA 3CM6A 2UUAK 4QS7A 4H5VA 1EETA 3DLLL 1C0FA 3E9LA 4RCHA 5ADXA 1K6YA 5KPTA 3HM8A 1J53A 2O8BA 4CGHA 4DV0K 4CHYA 1KFDA 3QINA 4NCGA 2IIRA 1BO5O 1HX1A 4CJLA 3H6EA 3KD1E 3TSPA 4KH6A 4BRGA 5HROA 4B1VA 4H4MA 3TTFA 1BDGA 2UU9K 3CI5A 3K2PA 2QKBA 1WSGA 3DMJA 4A57A 2VG5A 3AVLA 4CJFA 4KHWA 4W5NA 3UKRB 2RN2A 4HTLA 2G8FA 3J7YP 4AHUA 3WNEA 3AV9A 3O6WA 2IS3A 4UQGA 2HHVA 3ID6A 3L6QA 2D4WA 4AHVA 4CZJA 2E2NA 4IOCL 5LY3A 2I7NA 4E7HA 5AJ3K 4JI7K 4OLAA 3AVIA 4WQ5C 1ILYA 2PZSA 5AQFA 3ULEB 1L3TA 5TKYA 3CCQN 5C12A 3WUHA 1EWRA 4FW1A 3JXUA 4AHCA 4KH5A 1KTQA 2E5LK 1GOAA 4FZYA 2KW4A 1ESVA 1U04A 2D0PA 4E1MA 5AQSA 4YOUA 1TUYA 1YVUA 5T7BA 2YNFA 4OPHA 3FFIA 4H03B 4DQQA 2JWLA 2ASPA 1YHQN 4ZHRA 1I3AA 3UIQA 4OKJA 3PSIA 2YKMA 3HO1A 4GKKK 3H3NO 3SJHA 3SAFA 3AO5A 4BQZA 2FBXA 1KVAA 2HNYA 2FF6A 1JXEA 3SQ0A 1SKWA 2HHTA 1JL2A 1OVYA 2WOMA 1K8AO 2HSTA 3H08A 4FPBA 4BRNA 1JLQA 1QHAA 1WSFA 1NJZA 3EN9A 2HF3A 2GTDA 3ZSZA 3ZSYA 5FDLA 5AQYA 3O4NA 2A3ZA 2Q1NA 3C7NA 4IDKA 1D9FA 2Q31A 3CPEA 3NGYA 4JRPA 4BACA 3IRXA 4BRFA 4L8RB 4NCAA 4CD1A 3HPOA 5HBMA 3HPGA 3TSQA 1T05A 1BL3A 3O9TA 3SBTA 3U6FA 4OGCA 4FPAA 1Q81O 2EX3A 4DQIA 1LW2A 3VQBA 2EHGA 3J80O 2NZTA 3RR8A 1HNIA 3KK1A 1C0UA 2QWLA 3VTHA 3DWLA 3MN7A 1VSFA 3EO3A 1TGOA 2DFHA 4FCYA 1SKRA 3P83D 3CFOA 5TKWA 2IOCA 2E4LA 1VQ5N 5HOOA 4CGGA 1N5YA 2ASOA 4C23A 2A5XA 5I9EB 1SAZA 3HBTA 4PL7A 4LFCK 5AQXA 2VWBA 3LP0A 1S1XA 1QZ5A 2HMPA 3R6MA 5BREA 2F4VK 4QOZB 3BZCA 1B9DA 5AQRA 4EZ6A 4FVMA 1WSHA 2YHWA 4CFAA 1S72N 2O8DA 5CZ2A 3IUCA 3W3DA 4A2AA 4JLHA 3RMAA 4CF0A 3LWMA 1S3XA 4PKHA 2B4JA 3LPTA 4JS5A 4H5NA 4CJUA 4CJ5A 4FLTA 2YJFA 1YIJN 3V6DA 1ZBSA 1OKJA 3O1WA 4WQ4A 1LAVA 3T1YK 3WXIA 2P9LB 5JLFA 3D2EA 1VK0A 3THYA 3TTCA 1RT6A 4DTOA 4JI8K 3QICA 4JAXA 4CF8A 2HHHK 4M7XA 2F9WA 2HMIA 4I7FA 3D6RA 2RE2A 4BGAA 4JI5K 4CEBA 4FJGA 4BG8A 3U3GA 3HP6A 1VSEA 2P9SA 2QK9A 3G10A 3KJVA 5FPNA 4FWSA 2J4RA 2GEMA 4M3UA 4IO9L 4KTWA 2QA4N 1T03A 1DKGD 3QB0A 4CJQA 1FXXA 3DXKB 3K58A 4O5FA 1TKDA 1NJIO 5AR0A 5M1NA 2OA8A 1NK9A 3L2UA 4JKDA 3OYEA 3TTDA 1C0GA 4H0YB 2QWNA 1N36K 5GAHP 3BF3A 1Q9XA 5AZJA 2YHYA 4E7LA 2O4IA 4WFBL 3ZEUA 1LCUA 4O8KA 4LSLA 2QWOA 4ID5A 3ATUA 1GLDG 3K57A 2P9LA 1ITGA 5M1PA 3THWA 1W2BM 3FR0A 1LW0A 3MCPA 4PUOA 3TAGA 3O3HA 3CC7N 4EHUA 5KQDA 1X3MA 2LSNA 3NF8A 4FK2A 3BZKA 4E7IA 4DCHA 4B1WB 1Q86O 2QXFA 4J8FA 4E1JA 2XO7A 4G1QA 1UOCA 3PSFA 1HKBA 1V4TA 2G8KA 3ALYA 3QO9A 2GV9A 4CEAA 1CZBA 1BA0A 1WLJA 3M5RA 4JKHA 3DLGA 4N5SA 1N8RO 5E41A 1IBKK 3DLHA 3S41A 4IFYA 5J1EA 4BC4A 3ENBA 5EY4A 4M7YA 3AA2A 4B08A 5KI6A 2UUBK 4FL9A 3CQXA 1TK0A 2NRTA 5ADXH 3OYGA 4FLVA 5AQQA 1Q9YA 4YDUC 3AAPA 1RTHA 3MEEA 4CJSA 1EXQA 4B9TA 4BE1A 4YORA 2QWMA 3C7NB 3AY9A 1XWLA 2FLOA 3MEGA 1QVFM 4JV5K 1VQKN 1S9EA 1XHZA 1DLOA 4LF6K 2QTDA 3J8AA 3ZT3A 4PA1A 5JS1A 2Q2RA 3AO3A 2O8FA 4X62K 2E20A 5C0YA 5AQHA 2X74A 5KTQA 3J81O 5KRTA 3WEEA 2P1JA 1E4GT 2VQFK 3EY1A 2UYTA 4I9LA 5JICA 4LY7A 3EE8A 3AA3A 4A62A 3EZ5A 3SNNA 3VGKA 4BRAA 2FBTA 4K8ZA 4B8CA 4AM6A 4KH4A 4BC5A 3G25A 1JXBA 2IVNA 4JHDA 2OZSA 1FKPA 3O3FA 3VEOA 4LF9K 4YDUA 3MXIA 3LM9A 4M42A 3JAMO 1Q18A 3EKSA 4H0VB 1KD1O 1E4FT 2XHBA 1ZBLA 3HL8A 1IG8A 5A2QO 4LF7K 5HRSA 4YHHK 3V9SA 3I8BA 1BIZA 1WAFA 3IDHA 4YOXA 3GOIA 2O8FB 4M45A 3CMAN 4CF1A 4JKCA 3LDNA 2ITMA 4B8AB 4BRDA 1RDBA 4DSIA 4KTQA 4ILJA 2P5OA 4FZXC 4DG1A 4DQRA 1RBUA 1ZXOA 4KHNA 2P9UB 4BWJA 3G4SN 1NK6A 1NLVA 4HUFA 1JLFA 3AGKA 2O8CA 3EE9A 5C10A 3BP8A 3RSEA 4DTUA 1YITN 1IKWA 4EIAA 4OPAA 4YNQA 4QCLA 1OH6A 1VAZA 4DQPA 5AZJB 1OVQA 4F3TA 3WXMB 1TYQB 4N56A 4FWPA 2UUCK 1TV6A 1S9GA 1T6CA 1RT5A 4CEFA 3DLRA 4MLEA 2ZJRL 4PHTX 4FJJA 2Z1JA 4A5AA 5CYQA 1BI4B 3U3YA 1S1VA 1K9MO 3KLGA 1E3MA 3W0LA 1C0TA 5J2MA 1NGJA 1X3NA 4FJKA 3D2FB 1VRTA 5AQNA 4HVJA 3K0SA 3SQ1A 3HK2A 3FGUA 1VSMA 4CZFA 3P1GA 1QZ6A 4WF9L 3MDQA 3THXB 5HP1A 1WOQA 4L3QA 2F7TA 5AQTA 1SS6A 1GLFO 3UKUA 2HHXA 4IFVA 3C6UA 4JNEA 2BGGA 1IO2A 4MFBA 2A42A 4BR9A 1BG3A 4CD3A 1EWQA 1NU0A 1RBTA 4BRIA 1KC8O 3D45A 4C8KA 2O8EB 4EAHD 3LZJA 3THVA 4KI6A 4JI3K 4CFCA 2UXCK 3L3UA 5EX5A 4Y1CA 4O0IA 3DYAA 2PYJA 2XY8A 4CVNE 4FM1A 2EWSA 4B1UB 3OYBA 4IOXA 3OJSA 3MWTA 1NK8A 3CIPA 4YOYA 2DFEA 3TSUA 4K42A 4Q5VA 2B6AA 3WQTA 4G9ZA 3OBWA 4H5TA 3DRSA 4CJWA 3LPUA 2B5JA 3OS0A 1XI1A 1BA1A 4AH9A 5M1KA 3SUOA 3OBYA 3O9RA 3SK3A 5F0XA 1S1TA 1N34K 4FOEA 5JVHL 4CFBA 4DSKA 4W5TA 4BR4A 1S6QA 3AVJA 3M8QA 4HUGA 1GOBA 1Q8IA 3EKUA 4CZHA 1W0HA 1H1VA 4BROA 2GWKA 3AVCA 2P9PA 5HRNA 4DLGA 4LH5A 4C8LA 2X78A 2D5RA 1TK8A 5BR8K 4ID1A 3VMFB 3ZT1A 3FE1A 3L8BA 3IAYA 4AILC 4FZZA 3VQ4A 1NKBA 3AA5X 1HMVA 2ZM6K 4RW4A 1KRPA 4J2EA 3S3NA 3MAQA 4DTSA 2PYLA 3AARA 4DR4K 3H1QA 5GAEP 1HRHA 2Y1IA 4MLHA 2HNDA 3SV3A 3ZSRA 3S9HA 3UB5A 5IT9O 4RWTA 4ZTFA 1WAJA 3I56N 4MDAA 3I0SA 4FJHA 1S1WA 4MO4A 1KLMA 4BVPA 4DTNA 4WCEL 1NNEA 1MDUB 1EX4A 3D7EO 3DM2A 3GE1A 5LJWA 3FZMA 4I2PA 2X6NA 4NO7A 4B3RK 4KREA 3ZETB 2OCEA 3U8XA 2YNHA 3K59A 4OKEA 1GLAG 4M3TA 3HPHA 5BRFA 1D5AA 3M8PA 3KK7A 4DS4A 1IKYA 4CGFA 4BR5A 3V9ZA 5AQKA 3ZX3A 5C25A 4BDZA 4QS8A 2O8EA 4CCHA 3OS1A 4BR7A 4BR2A 3TAPA 4H8KA 1S6PA 3ID8A 3VQEA 3VQ6A 2E2QA 3V9UA 4GV9A 4FWRA 1YI2N 3BF1A 5J2NA 4DTJA 2E1YA 1RT4A 1A5WA 4Z0UA 4BG9A 1BOTO 4JD2A 4HCBA 4Y1DA 4XH4A 2IVPA 3JS6A 1TVRA 4DLEA 3LDLA 2FBYA 4NLBA 4U7BA 4ELTA 1QSSA 3CCMN 1GLBG 3D2FA 2OPSA 3OYIA 1KXPA 4AHRA 2ZJQL 3T3FA 4E89A 3SJJA 3AVMA 3I8DA 1XNRK 3WNGA 3L2QA 3E66A 2NRZA 3KK2A 1GLCG 3HOTA 5LMUK 1Z25A 2YKNA 4KHSA 4LF8K 4JYAK 2QEXN 3S3OA 2YHXA 3C0BA 2KQ2A 3THXA 3CJ7A 3WXLA 3WXKA 1NJXA 1L3VA 5AQMA 3KWIA 4BREA 2F9TA 4JKEA 3RRHA 3SPYA 4KAZA 4KB0A 2QXLA 5SZTA 5JVGL 1I39A 4MQ3A 4BVOA 4CZEA 3BEXA 2KKZA 2KHOA 2GUPA 3TU5A 3V1OA 2WUSA 1RTDA 1VSIA 3T1AA 1B92A 3QBWA 2CH5A 3K5LA 2F96A 3E9PA 3FLCO 4DQSA 1TYQA 3S3MA 4R5PA 3D0PA 4LFAK 4CEOA 2AP1A 3SMSA 3VESA 2P5GA 2Y1JA 4XH1A 2W6LA 4AF1A 3MCAB 4FWMA 3FFKB 3CCLN 1OH8A 4K43A 2NRVA 5DM6L 2OTJN 3O3GA 2P9PB 2ZJPL 3DXMB 4F2RA 2VWJA 3VA3A 3LZIA 4NCBA 3EL2A 4CGJA 4H4OA 1X9SA 3U9DA 4FLYA 3MWPA 2IC3A 4BR0A 2HHUA 3UE5A 5GADP 2YNIA 3SMPA 3EYZA 1TL1A 1QVGM 4FW2A 3C95A 3KLIA 2WC9A 3CJ9A 4BQLA 4IOAL 2P9NB 4CBXA 4CJVA 3NAEA 1M1KO 3M1FA 1ATNA 2ZF5O 3QDKA 4GW6A 3TABA 4DMNA 1BISA 3VGLA 5AQIA 1Q7YO 3VQCA 3SV4A 3A5LC 4Y0WA
chains in the Genus database with same CATH topology
3AA2A 3VQ5A 4B08A 4CEDA 4CIEA 3HP9A 5KI6A 3QEXA 4FJMA 4OKKA 1U48A 1S1UA 1TK0A 1O1WA 1VSLA 3OYGA 4FLVA 3NH0A 4I2QA 2VWKA 1Q9YA 4M3YA 2KZZA 3KLHA 1RTHA 3MEEA 1RCHA 4CJSA 3OJUA 1EXQA 2YHAA 4B9NA 5C42A 4BE1A 1SKSA 4B9TA 4DFPA 4N41A 3P5JA 4FLUA 3NDKA 1JLCA 3QESA 1XWLA 4CF2A 4DTXA 3QERA 4M3WA 3MEGA 2RPIA 1FK9A 3MXMA 3L2VA 4GVMA 3E01A 3OYJA 1ASUA 3MECA 1S9EA 1XHZA 1DLOA 3TI0A 4BDPA 3ZT3A 4J2AA 4PA1A 4KO0A 5KGWA 5JS1A 4F8RA 3HVRA 3O4QA 1G15A 3OYAA 3LP3A 3AO3A 4O0JA 4WE1A 1REVA 3AVNA 3VQQA 1MU2A 5FRMA 1L5UA 3WNFA 3V9WA 2XRIA 2KZMA 2X74A 4CFDA 4OGEA 1C6VA 3RRGA 3AVAA 4CHPA 5KTQA 3WNHA 5KRTA 2P1JA 4DF8A 1NKCA 3VQPA 4M3XA 3CFRA 2HHQA 3EY1A 4I9LA 3ULDA 2IDOA 1LWFA 2HHSA 1T8EA 2G8HA 4LY7A 3SNNA 3AA3A 3LWLA 3EZ5A 2OPQA 2FBTA 4K8ZA 4B8CA 3RMCA 2RKIA 2E6LA 4F2SA 1ASWA 4FJIA 1HQEA 3NF7A 1JXBA 3K5OA 3SI6A 4FJ9A 2D0AA 2OZSA 1FKPA 3O3FA 1BCMA 1LWEA 3TR8A 3HXMA 1W9HA 3VQAA 1RBRA 1RBVA 2VG6A 3QLHA 4OPJA 3KLEA 3MXIA 4M42A 3AVKA 1RT1A 3ZT4A 1XHXA 3VQDA 4RW9A 1QE1A 2XHBA 1ZBLA 3HL8A 4FXDA 3PV8A 4CECA 3AVGA 1RBSA 1TK5A 2G8VA 4O4GA 3CG7A 5HRSA 3NCIA 3OY9A 3V9SA 1J54A 1BIZA 2BANA 1GOCA 1WAFA 4IG0A 1KSPA 5J2QA 4DF4A 4M45A 1B9FA 1BIUA 4I9QA 4TSXA 4EP4A 4CF1A 4E3SA 4DU4A 4B8AB 1NKEA 3K5MA 1RDBA 4DSIA 4KTQA 3AVBA 4KFBA 4C8MA 2WONA 4B9MA 2P5OA 2G8WA 1UAXA 3ZSQA 3V1QA 4FZXC 4BWMA 4DG1A 2IGIA 3ZSXA 4DQRA 4O55A 1A5XA 1CZ9A 1RBUA 3QEVA 4KHNA 1TKXA 3DRPA 3DI6A 1C1CA 3NH2A 3LALA 4RG8A 2G8UA 4DU3A 3DOLA 1CLQA 4BWJA 4PQUA 3TAQA 1CXQA 4HUFA 1NK6A 2RF2A 1JLFA 4XIUA 3OYMA 4DU1A 3KK3A 1U45A 2OZMA 1HNVA 1U4BA 4DSFA 1WNSA 1NK4A 4J2BA 3PX0A 4DTUA 4HHTA 2HVIA 3BGRA 4LH4A 2YNGA 4E7JA 4DTMA 4DWIA 3RTVA 3DLKA 4C8OA 1IKWA 3NH1A 2IAJA 1TAQA 1NOYA 3K5NA 3SYZA 4YNQA 4QCLA 1IH7A 4C8NA 1X9MA 3LDSA 4DFKA 3CM6A 4DQPA 1ZBHA 4FYDA 1BQNA 1EETA 2KFZA 1EP4A 4JRQA 3RMBA 4F3TA 3TWHA 4N56A 1LAWA 1K6YA 4CJRA 4RW8A 2DFFA 1J53A 1TV6A 1X1PA 4CGHA 1S9GA 4CHYA 1C1AA 2D0CA 3AO4A 1NK5A 1RT5A 3BDPA 3UIQA 1KFDA 3DLRA 3QINA 1C1BA 4CEFA 1NOZA 4ICLA 4NCGA 4FJJA 2Z1JA 1X9WA 1S5JA 1KLNA 5CYQA 1BI4B 1RDCA 2Q3SA 1S1VA 4CJLA 1YT3A 5KGXA 3U3YA 3KD1E 4KB1A 3KLGA 1NK0A 1Z26A 4FM0A 1C0TA 5J2MA 5HROA 3M8RA 2HB5A 4H4MA 4FJKA 1VSKA 3NF6A 1JLBA 4DSJA 3C6TA 1VRTA 4KV8A 3OYKA 3K2PA 3NGIA 5I42A 2QKBA 3ASMA 4HVJA 3DMJA 1WSGA 1VRUA 2VG5A 3AVLA 1VSHA 4CJFA 4CK2A 3SQ1A 3HK2A 1D8YA 4KHWA 4W5NA 1VSMA 3P1GA 2JGUA 3NFAA 2RN2A 1NK7A 2XY5A 3V4IA 2G8FA 1RNHA 5HP1A 4AHUA 2FBVA 3WNEA 3AV9A 4BE0A 1LWCA 2IS3A 4UQGA 2HHVA 3I0RA 2ZD1A 3B6OA 4AHVA 2HHXA 4OPKA 4FJ7A 1UWBA 3HT3A 4IFVA 3C6UA 3ZT0A 1WSIA 4CESA 3F9KA 1IKXA 3IG1A 3TANA 1NJYA 1IO2A 4MFBA 4E7HA 4FLWA 2BGGA 4KRFA 1BI4A 4KHQA 4IBNA 4FLZA 4OLAA 2Z1IA 3AVIA 1DTTA 3RMDA 1TAUA 3KKRA 1RBTA 2PZSA 2O4GA 3D45A 3RR7A 4C8KA 1L3TA 2P51A 4CERA 4Z4CA 3LZJA 3THVA 4KI6A 1UA0A 4CFCA 3L3UA 3SCXA 4Y1CA 1JLEA 3DYAA 4O0IA 4CJ3A 2PYJA 2XY8A 4CJ4A 4FW1A 3SUQA 3MEDA 4AHCA 2NUBA 2R7YA 4FM1A 1KTQA 3AA4A 1GOAA 2VG7A 1TL3A 5HRPA 3OYBA 3CFPA 3QETA 4B9LA 4FZYA 3SQ4A 2HW3A 3OJSA 2KW4A 4KHUA 2ZE2A 1NK8A 4E1MA 1U04A 5HLFA 1HPZA 2OPPA 2OYQA 2DFEA 3ZT2A 5C24A 4Q5VA 1WSEA 2B6AA 2GBZA 1YVUA 3QEIA 1HJRA 5T7BA 2YNFA 3DRSA 4YFUA 4E7KA 3JYTA 4CJWA 3LPUA 4F4KA 2B5JA 3OS0A 1XI1A 4AH9A 3SUOA 3JSMA 3FFIA 4OLBA 1U49A 4DQQA 5CY4A 3V81A 4N47A 1S1TA 3QNNA 4CFBA 4DSKA 4W5TA 3VQ7A 4KHYA 4DFMA 1S6QA 4ZHRA 3AVJA 1I3AA 3M8QA 1RT3A 1GOBA 1Q8IA 3HM9A 1W0HA 1SV5A 4OKJA 4HUGA 2QKKA 2YKMA 3HO1A 3PX6A 1LV5A 3OS2A 3AVCA 3IS9A 5HRNA 4DLGA 2Z1HA 4BDYA 3AO5A 4LH5A 2FBXA 3NBPA 1XC9A 2DTUA 4C8LA 2BDPA 1KVAA 2X78A 4PWDA 2D5RA 2HNYA 1JXEA 3SQ0A 1TK8A 1SKWA 4B9VA 2HVHA 2HHTA 1JL2A 1J5OA 4ID1A 4M41A 2WOMA 4CGDA 1DTQA 3ZT1A 1SL1A 5FRNA 3L8BA 3IAYA 3H08A 1RDDA 4CJPA 4FJ8A 4AILC 3OYCA 4FZZA 3LP1A 1N6QA 4OVLA 3VQ4A 1NKBA 1JLQA 1QQCA 3AA5X 4CHQA 3RR8A 4CJEA 1HMVA 1WSFA 4OJRA 3LP2A 4RW4A 1NJZA 1KRPA 4J2EA 2BE2A 4LD0A 3S3NA 3MAQA 3F73A 3LAMA 4DTSA 2PYLA 3QIPA 3ZSZA 3ZSYA 5FDLA 4GMJB 4CK1A 3O4NA 1HRHA 4AHSA 2Y1IA 3SV3A 2HNDA 2KTQA 1JL1A 3ZSRA 3S9HA 4FLXA 2GUIA 5SWMA 3AVHA 4IDKA 4IG3A 5I3UA 1RILA 1WAJA 3B6PA 3DRRA 4ZTFA 1D9FA 4Q0BA 3NGYA 2I5JA 1QS4A 4JRPA 3C94A 4BACA 3I0SA 3TAFA 1S1WA 4HUEA 4FJHA 1KLMA 4DSEA 4DTNA 3IRXA 4L8RB 4NCAA 1TKTA 3HPOA 5JS2A 1SL0A 4Z4GA 5HBMA 3HPGA 2XY7A 1T05A 1BL3A 1EX4A 3U6FA 3PY8A 3DM2A 1YTUA 4OGCA 4I2PA 1QTMA 2X6NA 1JLGA 3ZSOA 3OYNA 3KKSA 4FJ5A 3QEPA 4KREA 2EX3A 1VSDA 4W5QA 1LW2A 1RTIA 4DQIA 1UA1A 1RT2A 2YNHA 2EHGA 2YV0X 4OKEA 3VQBA 3K59A 1QSYA 4M3TA 2AJQA 4O44A 1HYSA 3HPHA 4RW6A 1QSLA 1HNIA 1D5AA 3LAKA 3KK1A 3M8SA 1C0UA 1VSJA 3M8PA 4AHTA 4DS4A 1IKYA 1D9DA 1Y97A 4CGFA 4CEQA 4CK3A 3AO2A 1BGXT 1VSFA 3G0ZA 4CHOA 3SQ2A 3OYFA 4B9UA 4EZ9A 3V9ZA 4RW7A 1TGOA 2DFHA 4FCYA 1SKRA 1ASVA 3HVTA 3P83D 5C25A 4BDZA 3CFOA 4CE9A 2ATQA 3V9XA 2IOCA 1BCOA 2E4LA 1C0MA 4CCHA 3OS1A 4CGGA 3NF9A 4CIGA 1NJWA 1N5YA 2HHWA 4LSNA 3TAPA 4QAGA 4H8KA 1YTAA 5HRRA 4HTUA 3A2FA 1S6PA 4E19A 3VQEA 3VQ6A 3V9UA 3QEWA 3TAEA 3TAMA 5J2NA 4DTJA 3LP0A 4KI4A 1S1XA 5CYMA 3HJFA 1RT4A 4E0DA 4QOZB 1B9DA 3SPZA 4EZ6A 1A5WA 4ZTJA 4KTZA 2OPRA 4O5BA 4FVMA 1WSHA 5K14A 1HQUA 1ZBIA 1BHLA 4FK0A 4Z0UA 3L2WA 4CFAA 4ELVA 4FJNA 3DLEA 5CZ2A 4HCBA 1WSJA 4Y1DA 3PUFA 4JLHA 3RMAA 4CF0A 1TVRA 3LWMA 3L3VA 4DLEA 2FBYA 1BQMA 1FKOA 4ELTA 2B4JA 1RTJA 3LPTA 4JS5A 1QSSA 3ZSWA 4CF9A 4CJUA 1KVBA 4CJ5A 3NGZA 2OPSA 3OYIA 4FLTA 4B9SA 1ZBUA 4AHRA 3V6DA 3T3FA 4E89A 3SJJA 3AVMA 3I8DA 1LAVA 3ISNC 2FC0A 3WNGA 3L2QA 3KK2A 1VK0A 4DTOA 1RT6A 2X6SA 4KHSA 1Z25A 2YKNA 4KKOA 4CF8A 1U47A 1HYZA 2ETJA 2DY4A 3T19A 1R0AA 3S3OA 1ZYQA 2HMIA 3KTQA 3VQ9A 1J9AA 2KQ2A 3HSTB 4I7FA 3PO4A 4M3ZA 4Z4FA 4B3OA 4Z4HA 4CEBA 2HNZA 4FJGA 2JLEA 3U3GA 1NJXA 5J2PA 3HP6A 1L3VA 1VSEA 2QK9A 3ZSVA 3G10A 1SL2A 3KJVA 1ZBFA 4FJLA 4M3RA 3RRHA 3SPYA 1EKEA 3OYHA 1KFSA 4KAZA 4KB0A 4W5OA 3KD5E 4Z4EA 5SZTA 1I39A 1JLAA 4MQ3A 2F8TA 2F8SA 4M3UA 3RWUA 2D0BA 4CEZA 3V1OA 2E6MA 4KPYA 2ITGA 1RTDA 1VSIA 3LANA 4KTWA 1T03A 1WN7A 2KFNA 3QIOA 3T1AA 1L3UA 1B92A 4CJQA 1FXXA 3K5LA 4J2DA 2F96A 5CZ1A 3K58A 3PX4A 1HYVA 4FK4A 4DQSA 3S3MA 3OYLA 1F21A 1TKDA 1IKVA 4R5PA 3D0PA 4CEOA 2OA8A 3MXJA 3OVNA 2P5GA 1JKHA 3L2UA 2Y1JA 1NK9A 4ELUA 1KVCA 3OYEA 1QHTA 3NE6A 4F3OA 3SUPA 1Q9XA 4NYNA 4CEEA 3DOKA 4Z4IA 3O3GA 5EU7A 4DTRA 3HYFA 1KCFA 1L3SA 4CGIA 1TKZA 4F2RA 2VWJA 4BE2A 4E7LA 3NHGA 2O4IA 3VN5A 5KRSA 3AVFA 4DTPA 4N76A 4CHNA 3VA3A 4HCCA 2G8IA 4CJKA 4LSLA 3AO1A 4E1NA 3LZIA 4PY5A 4ID5A 1T7PA 3DLBA 5FROA 4NCBA 3ITHA 3VA0A 3K57A 4DSLA 4CGJA 4DFJA 4FJXA 1ITGA 3SZ2A 4H4OA 1X9SA 5DK5A 4FLYA 4PUOA 1LW0A 2IC3A 3TAGA 2HHUA 3O3HA 1CXUA 3ZCMA 3SUNA 2YNIA 3KLFA 4NYFA 3VQ8A 4IKFA 2LSNA 2ZQBA 3NF8A 3OYDA 4FK2A 4E7IA 3EYZA 1IG9A 1TL1A 2A1SA 2W42A 1A5VA 2QXFA 4FW2A 3L2RA 3C95A 3KLIA 2XO7A 4CIFA 4G1QA 1UOCA 4K8XA 2XY6A 2A1RA 3PO5A 4W5RA 4DS5A 2G8KA 2YHBA 3CYMA 3ALYA 1RT7A 5DMRA 3QO9A 4CJTA 4CJVA 4JS4A 3NAEA 3CQ8A 2GV9A 4CEAA 3CM5A 4CHZA 3QNOA 1CZBA 1SUQA 4GW6A 1WLJA 3TABA 4DMNA 5D3GA 3DLGA 1BISA 4N5SA 2PY5A 5E41A 3DLHA 2Z1GA 3TARA 1RDAA 4IFYA 5J1EA 3VQCA 3SV4A 3V1RA 3KIOA 4FM2A 4EP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA2 A;  3VQ5 A;  4B08 A;  4CED A;  4CIE A;  3HP9 A;  5KI6 A;  3QEX A;  4FJM A;  4OKK A;  1U48 A;  1S1U A;  1TK0 A;  1O1W A;  1VSL A;  3OYG A;  4FLV A;  3NH0 A;  4I2Q A;  2VWK A;  1Q9Y A;  4M3Y A;  2KZZ A;  3KLH A;  1RTH A;  3MEE A;  1RCH A;  4CJS A;  3OJU A;  1EXQ A;  2YHA A;  4B9N A;  5C42 A;  4BE1 A;  1SKS A;  4B9T A;  4DFP A;  4N41 A;  3P5J A;  4FLU A;  3NDK A;  1JLC A;  3QES A;  1XWL A;  4CF2 A;  4DTX A;  3QER A;  4M3W A;  3MEG A;  2RPI A;  1FK9 A;  3MXM A;  3L2V A;  4GVM A;  3E01 A;  3OYJ A;  1ASU A;  3MEC A;  1S9E A;  1XHZ A;  1DLO A;  3TI0 A;  4BDP A;  3ZT3 A;  4J2A A;  4PA1 A;  4KO0 A;  5KGW A;  5JS1 A;  4F8R A;  3HVR A;  3O4Q A;  1G15 A;  3OYA A;  3LP3 A;  3AO3 A;  4O0J A;  4WE1 A;  1REV A;  3AVN A;  3VQQ A;  1MU2 A;  5FRM A;  1L5U A;  3WNF A;  3V9W A;  2XRI A;  2KZM A;  2X74 A;  4CFD A;  4OGE A;  1C6V A;  3RRG A;  3AVA A;  4CHP A;  5KTQ A;  3WNH A;  5KRT A;  2P1J A;  4DF8 A;  1NKC A;  3VQP A;  4M3X A;  3CFR A;  2HHQ A;  3EY1 A;  4I9L A;  3ULD A;  2IDO A;  1LWF A;  2HHS A;  1T8E A;  2G8H A;  4LY7 A;  3SNN A;  3AA3 A;  3LWL A;  3EZ5 A;  2OPQ A;  2FBT A;  4K8Z A;  4B8C A;  3RMC A;  2RKI A;  2E6L A;  4F2S A;  1ASW A;  4FJI A;  1HQE A;  3NF7 A;  1JXB A;  3K5O A;  3SI6 A;  4FJ9 A;  2D0A A;  2OZS A;  1FKP A;  3O3F A;  1BCM A;  1LWE A;  3TR8 A;  3HXM A;  1W9H A;  3VQA A;  1RBR A;  1RBV A;  2VG6 A;  3QLH A;  4OPJ A;  3KLE A;  3MXI A;  4M42 A;  3AVK A;  1RT1 A;  3ZT4 A;  1XHX A;  3VQD A;  4RW9 A;  1QE1 A;  2XHB A;  1ZBL A;  3HL8 A;  4FXD A;  3PV8 A;  4CEC A;  3AVG A;  1RBS A;  1TK5 A;  2G8V A;  4O4G A;  3CG7 A;  5HRS A;  3NCI A;  3OY9 A;  3V9S A;  1J54 A;  1BIZ A;  2BAN A;  1GOC A;  1WAF A;  4IG0 A;  1KSP A;  5J2Q A;  4DF4 A;  4M45 A;  1B9F A;  1BIU A;  4I9Q A;  4TSX A;  4EP4 A;  4CF1 A;  4E3S A;  4DU4 A;  4B8A B;  1NKE A;  3K5M A;  1RDB A;  4DSI A;  4KTQ A;  3AVB A;  4KFB A;  4C8M A;  2WON A;  4B9M A;  2P5O A;  2G8W A;  1UAX A;  3ZSQ A;  3V1Q A;  4FZX C;  4BWM A;  4DG1 A;  2IGI A;  3ZSX A;  4DQR A;  4O55 A;  1A5X A;  1CZ9 A;  1RBU A;  3QEV A;  4KHN A;  1TKX A;  3DRP A;  3DI6 A;  1C1C A;  3NH2 A;  3LAL A;  4RG8 A;  2G8U A;  4DU3 A;  3DOL A;  1CLQ A;  4BWJ A;  4PQU A;  3TAQ A;  1CXQ A;  4HUF A;  1NK6 A;  2RF2 A;  1JLF A;  4XIU A;  3OYM A;  4DU1 A;  3KK3 A;  1U45 A;  2OZM A;  1HNV A;  1U4B A;  4DSF A;  1WNS A;  1NK4 A;  4J2B A;  3PX0 A;  4DTU A;  4HHT A;  2HVI A;  3BGR A;  4LH4 A;  2YNG A;  4E7J A;  4DTM A;  4DWI A;  3RTV A;  3DLK A;  4C8O A;  1IKW A;  3NH1 A;  2IAJ A;  1TAQ A;  1NOY A;  3K5N A;  3SYZ A;  4YNQ A;  4QCL A;  1IH7 A;  4C8N A;  1X9M A;  3LDS A;  4DFK A;  3CM6 A;  4DQP A;  1ZBH A;  4FYD A;  1BQN A;  1EET A;  2KFZ A;  1EP4 A;  4JRQ A;  3RMB A;  4F3T A;  3TWH A;  4N56 A;  1LAW A;  1K6Y A;  4CJR A;  4RW8 A;  2DFF A;  1J53 A;  1TV6 A;  1X1P A;  4CGH A;  1S9G A;  4CHY A;  1C1A A;  2D0C A;  3AO4 A;  1NK5 A;  1RT5 A;  3BDP A;  3UIQ A;  1KFD A;  3DLR A;  3QIN A;  1C1B A;  4CEF A;  1NOZ A;  4ICL A;  4NCG A;  4FJJ A;  2Z1J A;  1X9W A;  1S5J A;  1KLN A;  5CYQ A;  1BI4 B;  1RDC A;  2Q3S A;  1S1V A;  4CJL A;  1YT3 A;  5KGX A;  3U3Y A;  3KD1 E;  4KB1 A;  3KLG A;  1NK0 A;  1Z26 A;  4FM0 A;  1C0T A;  5J2M A;  5HRO A;  3M8R A;  2HB5 A;  4H4M A;  4FJK A;  1VSK A;  3NF6 A;  1JLB A;  4DSJ A;  3C6T A;  1VRT A;  4KV8 A;  3OYK A;  3K2P A;  3NGI A;  5I42 A;  2QKB A;  3ASM A;  4HVJ A;  3DMJ A;  1WSG A;  1VRU A;  2VG5 A;  3AVL A;  1VSH A;  4CJF A;  4CK2 A;  3SQ1 A;  3HK2 A;  1D8Y A;  4KHW A;  4W5N A;  1VSM A;  3P1G A;  2JGU A;  3NFA A;  2RN2 A;  1NK7 A;  2XY5 A;  3V4I A;  2G8F A;  1RNH A;  5HP1 A;  4AHU A;  2FBV A;  3WNE A;  3AV9 A;  4BE0 A;  1LWC A;  2IS3 A;  4UQG A;  2HHV A;  3I0R A;  2ZD1 A;  3B6O A;  4AHV A;  2HHX A;  4OPK A;  4FJ7 A;  1UWB A;  3HT3 A;  4IFV A;  3C6U A;  3ZT0 A;  1WSI A;  4CES A;  3F9K A;  1IKX A;  3IG1 A;  3TAN A;  1NJY A;  1IO2 A;  4MFB A;  4E7H A;  4FLW A;  2BGG A;  4KRF A;  1BI4 A;  4KHQ A;  4IBN A;  4FLZ A;  4OLA A;  2Z1I A;  3AVI A;  1DTT A;  3RMD A;  1TAU A;  3KKR A;  1RBT A;  2PZS A;  2O4G A;  3D45 A;  3RR7 A;  4C8K A;  1L3T A;  2P51 A;  4CER A;  4Z4C A;  3LZJ A;  3THV A;  4KI6 A;  1UA0 A;  4CFC A;  3L3U A;  3SCX A;  4Y1C A;  1JLE A;  3DYA A;  4O0I A;  4CJ3 A;  2PYJ A;  2XY8 A;  4CJ4 A;  4FW1 A;  3SUQ A;  3MED A;  4AHC A;  2NUB A;  2R7Y A;  4FM1 A;  1KTQ A;  3AA4 A;  1GOA A;  2VG7 A;  1TL3 A;  5HRP A;  3OYB A;  3CFP A;  3QET A;  4B9L A;  4FZY A;  3SQ4 A;  2HW3 A;  3OJS A;  2KW4 A;  4KHU A;  2ZE2 A;  1NK8 A;  4E1M A;  1U04 A;  5HLF A;  1HPZ A;  2OPP A;  2OYQ A;  2DFE A;  3ZT2 A;  5C24 A;  4Q5V A;  1WSE A;  2B6A A;  2GBZ A;  1YVU A;  3QEI A;  1HJR A;  5T7B A;  2YNF A;  3DRS A;  4YFU A;  4E7K A;  3JYT A;  4CJW A;  3LPU A;  4F4K A;  2B5J A;  3OS0 A;  1XI1 A;  4AH9 A;  3SUO A;  3JSM A;  3FFI A;  4OLB A;  1U49 A;  4DQQ A;  5CY4 A;  3V81 A;  4N47 A;  1S1T A;  3QNN A;  4CFB A;  4DSK A;  4W5T A;  3VQ7 A;  4KHY A;  4DFM A;  1S6Q A;  4ZHR A;  3AVJ A;  1I3A A;  3M8Q A;  1RT3 A;  1GOB A;  1Q8I A;  3HM9 A;  1W0H A;  1SV5 A;  4OKJ A;  4HUG A;  2QKK A;  2YKM A;  3HO1 A;  3PX6 A;  1LV5 A;  3OS2 A;  3AVC A;  3IS9 A;  5HRN A;  4DLG A;  2Z1H A;  4BDY A;  3AO5 A;  4LH5 A;  2FBX A;  3NBP A;  1XC9 A;  2DTU A;  4C8L A;  2BDP A;  1KVA A;  2X78 A;  4PWD A;  2D5R A;  2HNY A;  1JXE A;  3SQ0 A;  1TK8 A;  1SKW A;  4B9V A;  2HVH A;  2HHT A;  1JL2 A;  1J5O A;  4ID1 A;  4M41 A;  2WOM A;  4CGD A;  1DTQ A;  3ZT1 A;  1SL1 A;  5FRN A;  3L8B A;  3IAY A;  3H08 A;  1RDD A;  4CJP A;  4FJ8 A;  4AIL C;  3OYC A;  4FZZ A;  3LP1 A;  1N6Q A;  4OVL A;  3VQ4 A;  1NKB A;  1JLQ A;  1QQC A;  3AA5 X;  4CHQ A;  3RR8 A;  4CJE A;  1HMV A;  1WSF A;  4OJR A;  3LP2 A;  4RW4 A;  1NJZ A;  1KRP A;  4J2E A;  2BE2 A;  4LD0 A;  3S3N A;  3MAQ A;  3F73 A;  3LAM A;  4DTS A;  2PYL A;  3QIP A;  3ZSZ A;  3ZSY A;  5FDL A;  4GMJ B;  4CK1 A;  3O4N A;  1HRH A;  4AHS A;  2Y1I A;  3SV3 A;  2HND A;  2KTQ A;  1JL1 A;  3ZSR A;  3S9H A;  4FLX A;  2GUI A;  5SWM A;  3AVH A;  4IDK A;  4IG3 A;  5I3U A;  1RIL A;  1WAJ A;  3B6P A;  3DRR A;  4ZTF A;  1D9F A;  4Q0B A;  3NGY A;  2I5J A;  1QS4 A;  4JRP A;  3C94 A;  4BAC A;  3I0S A;  3TAF A;  1S1W A;  4HUE A;  4FJH A;  1KLM A;  4DSE A;  4DTN A;  3IRX A;  4L8R B;  4NCA A;  1TKT A;  3HPO A;  5JS2 A;  1SL0 A;  4Z4G A;  5HBM A;  3HPG A;  2XY7 A;  1T05 A;  1BL3 A;  1EX4 A;  3U6F A;  3PY8 A;  3DM2 A;  1YTU A;  4OGC A;  4I2P A;  1QTM A;  2X6N A;  1JLG A;  3ZSO A;  3OYN A;  3KKS A;  4FJ5 A;  3QEP A;  4KRE A;  2EX3 A;  1VSD A;  4W5Q A;  1LW2 A;  1RTI A;  4DQI A;  1UA1 A;  1RT2 A;  2YNH A;  2EHG A;  2YV0 X;  4OKE A;  3VQB A;  3K59 A;  1QSY A;  4M3T A;  2AJQ A;  4O44 A;  1HYS A;  3HPH A;  4RW6 A;  1QSL A;  1HNI A;  1D5A A;  3LAK A;  3KK1 A;  3M8S A;  1C0U A;  1VSJ A;  3M8P A;  4AHT A;  4DS4 A;  1IKY A;  1D9D A;  1Y97 A;  4CGF A;  4CEQ A;  4CK3 A;  3AO2 A;  1BGX T;  1VSF A;  3G0Z A;  4CHO A;  3SQ2 A;  3OYF A;  4B9U A;  4EZ9 A;  3V9Z A;  4RW7 A;  1TGO A;  2DFH A;  4FCY A;  1SKR A;  1ASV A;  3HVT A;  3P83 D;  5C25 A;  4BDZ A;  3CFO A;  4CE9 A;  2ATQ A;  3V9X A;  2IOC A;  1BCO A;  2E4L A;  1C0M A;  4CCH A;  3OS1 A;  4CGG A;  3NF9 A;  4CIG A;  1NJW A;  1N5Y A;  2HHW A;  4LSN A;  3TAP A;  4QAG A;  4H8K A;  1YTA A;  5HRR A;  4HTU A;  3A2F A;  1S6P A;  4E19 A;  3VQE A;  3VQ6 A;  3V9U A;  3QEW A;  3TAE A;  3TAM A;  5J2N A;  4DTJ A;  3LP0 A;  4KI4 A;  1S1X A;  5CYM A;  3HJF A;  1RT4 A;  4E0D A;  4QOZ B;  1B9D A;  3SPZ A;  4EZ6 A;  1A5W A;  4ZTJ A;  4KTZ A;  2OPR A;  4O5B A;  4FVM A;  1WSH A;  5K14 A;  1HQU A;  1ZBI A;  1BHL A;  4FK0 A;  4Z0U A;  3L2W A;  4CFA A;  4ELV A;  4FJN A;  3DLE A;  5CZ2 A;  4HCB A;  1WSJ A;  4Y1D A;  3PUF A;  4JLH A;  3RMA A;  4CF0 A;  1TVR A;  3LWM A;  3L3V A;  4DLE A;  2FBY A;  1BQM A;  1FKO A;  4ELT A;  2B4J A;  1RTJ A;  3LPT A;  4JS5 A;  1QSS A;  3ZSW A;  4CF9 A;  4CJU A;  1KVB A;  4CJ5 A;  3NGZ A;  2OPS A;  3OYI A;  4FLT A;  4B9S A;  1ZBU A;  4AHR A;  3V6D A;  3T3F A;  4E89 A;  3SJJ A;  3AVM A;  3I8D A;  1LAV A;  3ISN C;  2FC0 A;  3WNG A;  3L2Q A;  3KK2 A;  1VK0 A;  4DTO A;  1RT6 A;  2X6S A;  4KHS A;  1Z25 A;  2YKN A;  4KKO A;  4CF8 A;  1U47 A;  1HYZ A;  2ETJ A;  2DY4 A;  3T19 A;  1R0A A;  3S3O A;  1ZYQ A;  2HMI A;  3KTQ A;  3VQ9 A;  1J9A A;  2KQ2 A;  3HST B;  4I7F A;  3PO4 A;  4M3Z A;  4Z4F A;  4B3O A;  4Z4H A;  4CEB A;  2HNZ A;  4FJG A;  2JLE A;  3U3G A;  1NJX A;  5J2P A;  3HP6 A;  1L3V A;  1VSE A;  2QK9 A;  3ZSV A;  3G10 A;  1SL2 A;  3KJV A;  1ZBF A;  4FJL A;  4M3R A;  3RRH A;  3SPY A;  1EKE A;  3OYH A;  1KFS A;  4KAZ A;  4KB0 A;  4W5O A;  3KD5 E;  4Z4E A;  5SZT A;  1I39 A;  1JLA A;  4MQ3 A;  2F8T A;  2F8S A;  4M3U A;  3RWU A;  2D0B A;  4CEZ A;  3V1O A;  2E6M A;  4KPY A;  2ITG A;  1RTD A;  1VSI A;  3LAN A;  4KTW A;  1T03 A;  1WN7 A;  2KFN A;  3QIO A;  3T1A A;  1L3U A;  1B92 A;  4CJQ A;  1FXX A;  3K5L A;  4J2D A;  2F96 A;  5CZ1 A;  3K58 A;  3PX4 A;  1HYV A;  4FK4 A;  4DQS A;  3S3M A;  3OYL A;  1F21 A;  1TKD A;  1IKV A;  4R5P A;  3D0P A;  4CEO A;  2OA8 A;  3MXJ A;  3OVN A;  2P5G A;  1JKH A;  3L2U A;  2Y1J A;  1NK9 A;  4ELU A;  1KVC A;  3OYE A;  1QHT A;  3NE6 A;  4F3O A;  3SUP A;  1Q9X A;  4NYN A;  4CEE A;  3DOK A;  4Z4I A;  3O3G A;  5EU7 A;  4DTR A;  3HYF A;  1KCF A;  1L3S A;  4CGI A;  1TKZ A;  4F2R A;  2VWJ A;  4BE2 A;  4E7L A;  3NHG A;  2O4I A;  3VN5 A;  5KRS A;  3AVF A;  4DTP A;  4N76 A;  4CHN A;  3VA3 A;  4HCC A;  2G8I A;  4CJK A;  4LSL A;  3AO1 A;  4E1N A;  3LZI A;  4PY5 A;  4ID5 A;  1T7P A;  3DLB A;  5FRO A;  4NCB A;  3ITH A;  3VA0 A;  3K57 A;  4DSL A;  4CGJ A;  4DFJ A;  4FJX A;  1ITG A;  3SZ2 A;  4H4O A;  1X9S A;  5DK5 A;  4FLY A;  4PUO A;  1LW0 A;  2IC3 A;  3TAG A;  2HHU A;  3O3H A;  1CXU A;  3ZCM A;  3SUN A;  2YNI A;  3KLF A;  4NYF A;  3VQ8 A;  4IKF A;  2LSN A;  2ZQB A;  3NF8 A;  3OYD A;  4FK2 A;  4E7I A;  3EYZ A;  1IG9 A;  1TL1 A;  2A1S A;  2W42 A;  1A5V A;  2QXF A;  4FW2 A;  3L2R A;  3C95 A;  3KLI A;  2XO7 A;  4CIF A;  4G1Q A;  1UOC A;  4K8X A;  2XY6 A;  2A1R A;  3PO5 A;  4W5R A;  4DS5 A;  2G8K A;  2YHB A;  3CYM A;  3ALY A;  1RT7 A;  5DMR A;  3QO9 A;  4CJT A;  4CJV A;  4JS4 A;  3NAE A;  3CQ8 A;  2GV9 A;  4CEA A;  3CM5 A;  4CHZ A;  3QNO A;  1CZB A;  1SUQ A;  4GW6 A;  1WLJ A;  3TAB A;  4DMN A;  5D3G A;  3DLG A;  1BIS A;  4N5S A;  2PY5 A;  5E41 A;  3DLH A;  2Z1G A;  3TAR A;  1RDA A;  4IFY A;  5J1E A;  3VQC A;  3SV4 A;  3V1R A;  3KIO A;  4FM2 A;  4EP5 A; 
#chains in the Genus database with same CATH topology
 1HJO A;  3VQ5 A;  3B8A X;  4CED A;  3QEX A;  3LM2 A;  3H3O B;  4OKK A;  4XH5 A;  3RSE B;  3F9M A;  4NXN K;  1O1W A;  1VSL A;  1HNZ K;  4I2Q A;  4M3Y A;  2FSJ A;  1RCH A;  1SKS A;  4N41 A;  4DFP A;  1W7A A;  3NDK A;  1JLC A;  4DTX A;  1JCE A;  2WFB A;  3QER A;  4M3W A;  2BUP A;  1FK9 A;  4B9Q A;  4CZI A;  4WFN L;  3L2V A;  3MXM A;  4GVM A;  3E01 A;  1ASU A;  4BDP A;  4J2A A;  3CPW M;  4KO0 A;  5KGW A;  2YCH A;  4F8R A;  1NGI A;  2FSK A;  1G15 A;  3OYA A;  2UXD K;  3AVN A;  3VQQ A;  1MU2 A;  5FRM A;  1L5U A;  2KZM A;  5F2R A;  4CFD A;  4OGE A;  3CXC M;  3RRG A;  3O08 A;  1NKC A;  4DF8 A;  1YAG A;  2HHQ A;  4DR1 K;  2HHS A;  1WUA A;  1NGF A;  4EHT A;  3A5N C;  2G8H A;  5E26 A;  1MWK A;  2GWJ A;  2DPN A;  4F2S A;  4FJI A;  3K5O A;  2H3G X;  3H45 C;  1FJG K;  1BCM A;  1LWE A;  3CQY A;  2VG6 A;  1RBV A;  1RT1 A;  3N4Q A;  1XHX A;  4FXD A;  4BC3 A;  3MMV A;  1TK5 A;  2G8V A;  4O4G A;  3CG7 A;  3P4I A;  1DEJ A;  1VQ4 N;  1J54 A;  4IG0 A;  1KSP A;  1ATR A;  1B9F A;  4TSX A;  4EP4 A;  1NKE A;  2E8A A;  1HPM A;  3K5M A;  4C8M A;  2G8W A;  3L0Q A;  4BWM A;  3ULE A;  2IGI A;  3QEV A;  3DRP A;  4ISF A;  3NH2 A;  3LAL A;  4RG8 A;  4DU3 A;  1CLQ A;  4PQU A;  5DM7 L;  1CXQ A;  4JI0 K;  4FWK A;  3G6E N;  1XQS C;  4DU1 A;  1OH7 A;  1U4B A;  4CI6 A;  4DSF A;  1NK4 A;  4HHT A;  5BN8 A;  3BGR A;  4E7J A;  4DTM A;  3RTV A;  3DLK A;  3UKU B;  4C8O A;  4BRQ A;  4DV1 K;  4C8N A;  3L4I A;  1ZBH A;  4FYD A;  1BQN A;  1EP4 A;  5KPR A;  3CJ1 A;  4JRQ A;  4JI2 K;  2YJE A;  1LAW A;  4CJR A;  2DFF A;  1C1A A;  1NK5 A;  3BDP A;  2E2P A;  1C1B A;  4ICL A;  5HL7 L;  2NRR A;  1RDC A;  2Q3S A;  1YT3 A;  4ISE A;  1VQN N;  1JCG A;  4FM0 A;  3M8R A;  2HB5 A;  1NG9 A;  3ZET A;  4MDB A;  3C6T A;  1D4X A;  3NGI A;  3ASM A;  3GDQ A;  1VRU A;  3ZEU B;  2JGU A;  3VOV A;  1NK7 A;  1WBD A;  4CZG A;  2E2O A;  4DV2 K;  4QS9 A;  3ZX2 A;  3CCS N;  4BE0 A;  1LWC A;  3KHY A;  4GY2 B;  4A61 A;  3B6O A;  4OPK A;  2W41 A;  2OTL N;  3ZT0 A;  4CES A;  1IKX A;  3IG1 A;  3TAN A;  4IO8 A;  4KHQ A;  2D0O A;  4FLZ A;  2Z1I A;  4DHY A;  1DTT A;  3RMD A;  1TAU A;  3KKR A;  2P51 A;  4Z4C A;  1UA0 A;  5FPE A;  3SCX A;  1JJ2 M;  2YX6 A;  4CJ3 A;  1K8K A;  4OO1 J;  5AZI A;  2R7Y A;  2P9S B;  4IFE A;  3AA4 A;  2VG7 A;  2D1K A;  3CFP A;  4KHU A;  2ZE2 A;  2OPP A;  2OYQ A;  3ZT2 A;  3QEI A;  5CR4 A;  1HJR A;  4YFU A;  1W97 L;  4F4K A;  1ZC6 A;  2BTF A;  4JI6 K;  3JSM A;  5LMN K;  4OLB A;  1U49 A;  5CY4 A;  3DXM A;  1HNX K;  4DFM A;  4YY3 K;  3VTI A;  4C1N I;  2QKK A;  1SV5 A;  1J5E K;  3MX5 A;  4A5B A;  4GV6 A;  3C6A A;  3QFU A;  4DV5 K;  4BDY A;  1K73 O;  3NBP A;  1XC9 A;  2BDP A;  3P39 A;  5AQU A;  3R8E A;  4B9V A;  4M41 A;  3ATV A;  1XNQ K;  5FRN A;  1SL1 A;  4CJP A;  3LP1 A;  3SAG A;  1N6Q A;  4OVL A;  4DR2 K;  3A0I X;  4OJR A;  5EOY A;  3LP2 A;  3HZ6 A;  3GG4 A;  1EQY A;  3F73 A;  3CCR N;  2VGN A;  3QIP A;  4AHS A;  3MN9 A;  2KTQ A;  4FLX A;  2VYP A;  4CW7 B;  5GAG P;  4IG3 A;  5I3U A;  1RIL A;  3B6P A;  4B3S K;  3DRR A;  1VQL N;  5CE3 A;  4NXM K;  4KI4 A;  1YF5 L;  4GVE A;  4HUE A;  3O9S A;  1YVN A;  2WTU A;  3ZX0 A;  4DSE A;  1DT9 A;  2P9I A;  3CCJ N;  1SL0 A;  4Z4G A;  2XY7 A;  4K41 A;  2NNW A;  3PY8 A;  3CD6 N;  3VEV A;  1JLG A;  3OYN A;  4FJ5 A;  1VSD A;  1RTI A;  1U6Z A;  3CER A;  2YV0 X;  2HOE A;  1BU6 O;  4RW6 A;  2FSN A;  3CC4 N;  1QSL A;  3LAK A;  3M8S A;  4JKG B;  2E1Z A;  4UY8 O;  4AHT A;  1U2V A;  1TUU A;  1KAZ A;  1D9D A;  4DR3 K;  3AO2 A;  3OYF A;  4B9U A;  3DAW A;  4RW7 A;  3HVT A;  4CE9 A;  1BCO A;  1C0M A;  1R59 O;  4CIG A;  1NJW A;  3LDQ A;  2HHW A;  4LSN A;  3OTO K;  1Q82 O;  4E19 A;  4JHD B;  4BRP A;  3GL1 A;  3QEW A;  3TAM A;  2CGL A;  4JKF A;  5CYM A;  3HJF A;  4E0D A;  4ZTJ A;  2OPR A;  3E1Y A;  4O5B A;  4X65 K;  5K14 A;  1HQU A;  1ZBI A;  2CH6 A;  4FK0 A;  3L2W A;  3DLE A;  3T69 A;  2P9N A;  4FWO A;  3PUF A;  5CHI A;  3UKR A;  3BUZ B;  5C15 A;  4DR6 K;  1YUW A;  3IFR A;  5EXW A;  1Z6R A;  4B9S A;  3KWG A;  5FPD A;  3ISN C;  3IKM A;  3O4W A;  1LOT B;  1HKG A;  4CZL A;  1IBM K;  2ETJ A;  2DY4 A;  3T19 A;  3ZYY X;  5B8H A;  1ZYQ A;  1NGD A;  2VQE K;  3VQ9 A;  1J9A A;  3PO4 A;  4M3Z A;  4Z4F A;  4B3O A;  1QQO A;  2HNZ A;  4JN4 A;  4EFH A;  2HBJ A;  5J2P A;  2PFU A;  4CZM A;  4M3R A;  1KFS A;  3OYH A;  3O9U A;  3KD5 E;  2KLA A;  1JLA A;  3H46 O;  2F8T A;  3VPZ A;  1EO1 A;  3R9P A;  2RHK A;  4IZ9 A;  4CEZ A;  4KPY A;  2ITG A;  3LAN A;  1RGI A;  4IDH A;  2KFN A;  1VQ6 N;  2NLX A;  3QIO A;  3PIP L;  3PX4 A;  4FK4 A;  3OYL A;  1IKV A;  3OVN A;  1JKH A;  3FZL A;  4ELU A;  1KVC A;  1WB9 A;  3G71 N;  1QHT A;  4F3O A;  4BRM A;  4NYN A;  1SZ2 A;  4Z4I A;  5EU7 A;  2P9K B;  3HYF A;  1L3S A;  1TKZ A;  1NGG A;  4BE2 A;  3NHG A;  3VN5 A;  4DTP A;  2G8I A;  4HCC A;  3FZF A;  4CJK A;  3AO1 A;  4E1N A;  4PY5 A;  1T7P A;  5FRO A;  3ITH A;  3VA0 A;  1YXQ A;  4DSL A;  4FJX A;  2VGM A;  3QFP A;  4M63 C;  3ZCM A;  3SUN A;  3KLF A;  3VQ8 A;  1NMD A;  3R1X A;  1VQ7 N;  4MO5 A;  1IG9 A;  5AFU H;  1BUP A;  4CIF A;  1NBW A;  2A1R A;  2QM1 A;  4DS5 A;  4CJ7 A;  1RT7 A;  4JS4 A;  4CJT A;  3R3L A;  3CQ8 A;  3CM5 A;  4DKW A;  3AGR A;  3A5O C;  5D3G A;  1VQO N;  2PY5 A;  2Z1G A;  3KIO A;  2O8D B;  4EP5 A;  3HP9 A;  2UXB K;  4CZK A;  1U48 A;  3H1V X;  2VWK A;  4IEE A;  3U4L A;  4JI4 K;  3KLH A;  5BN9 A;  1WBB A;  1VQ8 N;  2YHA A;  3P5J A;  4CF2 A;  2RPI A;  3OYJ A;  3LDO A;  3OA9 A;  3TI0 A;  2A40 A;  3THY B;  4JKG A;  4GKJ K;  3HVR A;  3O4Q A;  3CJA A;  4O0J A;  2NRX A;  4WE1 A;  2Q36 A;  3V9W A;  4FVU A;  4GV3 A;  4CHP A;  3VGM A;  1NGE A;  4M3X A;  2VCP A;  3ULD A;  4DV6 K;  2YI1 A;  1T3V A;  4PKI A;  4JK9 A;  4FOI A;  3LWL A;  4AQY K;  2E6L A;  1HQE A;  1I94 K;  3VEW A;  5EVZ A;  4WQ5 A;  3TR8 A;  3HXM A;  1W9H A;  1HNW K;  3QLH A;  2O8C B;  3AVK A;  1QE1 A;  3PV8 A;  2OAN A;  4CEC A;  4BGB A;  4A2B A;  4DB3 A;  4LF4 K;  3VEX A;  4LC9 B;  2QWR A;  4H5W A;  2ZWH A;  3VER A;  2BAN A;  1GOC A;  4DF4 A;  2O8B B;  4E3S A;  4DU4 A;  3HTV A;  4KHP K;  2FF3 B;  1HLU A;  4NLC A;  3VEZ A;  1NMN A;  5BPN A;  4B9M A;  5E84 A;  3ZSQ A;  4LF5 K;  3V1Q A;  2QWP A;  1P8Z A;  5BPM A;  3ZSX A;  4I6M B;  4DUZ K;  3DI6 A;  1C1C A;  1HR0 K;  2G8U A;  3NVK A;  4CBU A;  2E88 A;  2IVO A;  3Q7B A;  4JD2 B;  5KPZ A;  3WT0 A;  1XMO K;  3LDP A;  4XIU A;  3KK3 A;  4BRL A;  4JI1 K;  1KQS M;  2OZM A;  1HNV A;  1VHX A;  4J2B A;  1WNS A;  3KVG A;  3P38 A;  2YNG A;  4DWI A;  5AQO A;  3NH1 A;  2IAJ A;  3HOS A;  3SYZ A;  1IH7 A;  4H5R A;  2NRW A;  3GBT A;  2KFZ A;  2PAV A;  3RMB A;  3TPQ A;  3TWH A;  4FWQ A;  4RW8 A;  1X1P A;  5BR9 A;  2D0C A;  3AO4 A;  1NOZ A;  1RFQ A;  5MLC Q;  1X9W A;  1S5J A;  1KLN A;  3HSC A;  5KGX A;  3KZB A;  4KB1 A;  1NK0 A;  1Z26 A;  3CCU N;  1VSK A;  3NF6 A;  1JLB A;  4YOT A;  4DSJ A;  1T6D A;  4KV8 A;  4IEI A;  3OYK A;  5H1S Q;  5I42 A;  1T44 A;  4IJA A;  4CK2 A;  1VSH A;  3DJC A;  4PL8 A;  1D8Y A;  2Q97 A;  3NFA A;  4NB4 A;  2XY5 A;  4IXC A;  3V4I A;  1RNH A;  3M6G A;  2FBV A;  1ATS A;  3I0R A;  2ZD1 A;  4FJ7 A;  1UWB A;  3HT3 A;  5AQG A;  3M3Z A;  1WSI A;  3F9K A;  1QQN A;  1NJY A;  4KRF A;  4FLW A;  1BI4 A;  4IBN A;  3QML A;  4H0P A;  1NGC A;  1CZA N;  2O4G A;  3RR7 A;  4WQ4 C;  4CER A;  4FO0 A;  3WQU A;  1KAX A;  5KQ8 A;  4A59 A;  4B3M K;  1G99 A;  1JLE A;  4R79 A;  4GNI A;  4ILG B;  4CJ4 A;  3SUQ A;  3MED A;  3T1H K;  4O8U A;  2NUB A;  2V52 B;  1RDU A;  3QET A;  1TL3 A;  5HRP A;  4B9L A;  4JK8 A;  4IWV A;  1Z05 A;  3VF6 A;  3IMX A;  3SQ4 A;  2HW3 A;  4B1Z A;  3CCV N;  5LJV A;  5HLF A;  1HPZ A;  3AAQ A;  5M1F A;  5C24 A;  1WSE A;  3VF2 A;  2GBZ A;  1XMQ K;  4E7K A;  3E9O A;  3JYT A;  1SQK A;  1IBL K;  3V81 A;  4N47 A;  2P9I B;  3QNN A;  3VQ7 A;  5JLH A;  4KHY A;  4H0X B;  1RT3 A;  4H0O A;  3I55 N;  3HM9 A;  3BY5 A;  3HRG A;  5AZI B;  3PX6 A;  5M1O A;  1LV5 A;  3OS2 A;  3IS9 A;  4WFA L;  2Z1H A;  4C1N K;  2DTU A;  1MWM A;  1FW6 A;  2WBN A;  4PWD A;  2HVH A;  2GEL A;  3MN5 A;  1J5O A;  5JMV A;  4CGD A;  1DTQ A;  1U2V B;  4K25 A;  1RDD A;  4FJ8 A;  3OYC A;  5IWA K;  3WEE B;  3VF4 A;  1QQC A;  4BRC A;  1V4S A;  4CJE A;  1XUP O;  2QWQ A;  2GX9 A;  4CHQ A;  3A8Y A;  4JK7 A;  3VET A;  3THW B;  1N33 K;  2BE2 A;  4LD0 A;  3LAM A;  5GIN A;  5C2D A;  3PLA A;  4GMJ B;  4CK1 A;  1MA9 B;  1JL1 A;  2GUI A;  1N32 K;  5SWM A;  3AVH A;  3L4Q A;  4Q0B A;  4DV7 K;  1S22 A;  2I5J A;  1QS4 A;  3C94 A;  3TAF A;  3CHW A;  1TKT A;  5JS2 A;  3J7Z O;  4B1X B;  1YTU A;  1GLJ O;  4BY9 C;  2HF4 A;  1QTM A;  3ZSO A;  3KKS A;  3P31 A;  1XC3 A;  3QEP A;  3O80 A;  4W5Q A;  5GIO A;  4JKB A;  1RT2 A;  1UA1 A;  1RDW X;  2AJQ A;  1QSY A;  4HWI A;  4O44 A;  2P9U A;  1HYS A;  2CGJ A;  1HKC A;  1VQM N;  1VSJ A;  1Y97 A;  4CK3 A;  4CEQ A;  4ISG A;  1BGX T;  4CHO A;  3G0Z A;  3SQ2 A;  2HBK A;  2W40 A;  4EZ9 A;  1K8K B;  1ASV A;  5AQV A;  2ATQ A;  5AFU A;  3V9X A;  3SLC A;  4LFB K;  3NF9 A;  3SAH A;  1VQ9 N;  1KAY A;  2W6K A;  4QAG A;  1NGA A;  1YTA A;  5HRR A;  3A2F A;  4HTU A;  4ILH A;  1YJW N;  3TAE A;  1O13 A;  2P9K A;  4BC2 A;  4V19 S;  3SPZ A;  4KTZ A;  2A41 A;  1NGH A;  1BHL A;  4X66 K;  4FJN A;  4ELV A;  3CJC A;  1WSJ A;  3L3V A;  4YOW A;  3MK6 A;  1BQM A;  1FKO A;  5F1X A;  1RTJ A;  2HBL A;  3ZSW A;  4F9O A;  4YOV A;  3O1B A;  4CF9 A;  1KVB A;  1J6Z A;  3NGZ A;  5GIP A;  4JKA A;  1NWK A;  1ZBU A;  3K9J A;  4PKG A;  2FC0 A;  3ENH A;  1X9J A;  2X6S A;  3O8M A;  4KKO A;  1U47 A;  5LL6 Z;  1HYZ A;  1R0A A;  3FZH A;  3KTQ A;  3HST B;  1GLE G;  4Z4H A;  2JLE A;  3WXJ A;  1M90 O;  3ZSV A;  1NM1 A;  1SL2 A;  1ZBF A;  4FJL A;  1NGB A;  1EKE A;  4W5O A;  4Z4E A;  2Q0R A;  1OH5 A;  2V7Z A;  2F8S A;  3RWU A;  2D0B A;  2E6M A;  3CCE N;  4FSV A;  3D2E B;  1WN7 A;  4CBW A;  1GLL O;  3Q7C A;  4KBO A;  1L3U A;  4J2D A;  5CZ1 A;  1HYV A;  5BPL A;  3NMU A;  3CJB A;  1F21 A;  3T7Z A;  3MN6 A;  1DGK N;  3MXJ A;  2QW9 A;  3LL3 A;  3O5B A;  3NE6 A;  1IV0 A;  3SUP A;  3EZW A;  1IJJ A;  5M1Q A;  4CEE A;  3K9K A;  3DOK A;  5ELZ A;  4DV3 K;  5AQZ A;  4DTR A;  1KCF A;  3CF5 L;  4XEI A;  4CGI A;  3FZK A;  3HI0 A;  5KRS A;  3AVF A;  5BRD A;  4N76 A;  4CHN A;  4DV4 K;  3DLB A;  4Z94 A;  4DFJ A;  3SZ2 A;  2PBD A;  5DK5 A;  3QBX A;  5AQL A;  1CXU A;  4NYF A;  4IKF A;  3F2K A;  2ZQB A;  4I6M A;  3OYD A;  2QI2 A;  2A1S A;  2W42 A;  1A5V A;  3L2R A;  2A6A A;  3SBG A;  4K8X A;  4FWN A;  2XY6 A;  3PO5 A;  4W5R A;  2YHB A;  3CYM A;  5DMR A;  2JWK A;  4CHZ A;  3QNO A;  1SUQ A;  4FWL A;  4B1Y B;  3NVM A;  3TAR A;  1P90 A;  1RDA A;  3V1R A;  2V7Y A;  3A5M C;  4FM2 A;  2HBM A;  4CIE A;  4JEP A;  4FJM A;  2FXU A;  1S1U A;  3I33 A;  4WYB A;  3NH0 A;  2KZZ A;  2V51 B;  3O9Q A;  3RVC A;  3OJU A;  4B9N A;  5C42 A;  4H0T B;  5FLX O;  4FLU A;  3QES A;  2ZGZ A;  4DR5 K;  4RTF D;  1BWF O;  3C65 A;  3MEC A;  1HUX A;  2BH1 A;  3C6H A;  3MX2 A;  3LP3 A;  5BRH A;  1REV A;  3WNF A;  2XRI A;  1C6V A;  3AVA A;  3EEQ A;  3U9Z A;  3WNH A;  4DUY K;  3VQP A;  3DXK A;  3CFR A;  2NRH A;  4K0K K;  2IDO A;  1YJ9 N;  1LWF A;  4BRK A;  3CC2 N;  1T8E A;  4IJN A;  4DQ8 A;  2I7P A;  5AQJ A;  3F5T A;  2OPQ A;  3J7A P;  3RMC A;  2RKI A;  2CGK A;  1ASW A;  2ZGY A;  3CME N;  3NF7 A;  3SI6 A;  4FJ9 A;  2D0A A;  3CET A;  2AA4 A;  4X64 K;  3PIO L;  2ASM A;  3VQA A;  1RBR A;  3KLE A;  4OPJ A;  3ZT4 A;  5AQW A;  4B3T K;  5FPM A;  3VQD A;  4RW9 A;  2Q0U A;  3AVG A;  1RBS A;  4OX9 K;  3NCI A;  1QQM A;  3OY9 A;  4BRH A;  5J2Q A;  1BIU A;  4I9Q A;  4DR7 K;  3VEY A;  3OW2 M;  3N4P A;  3VEN A;  3AVB A;  4KFB A;  2WON A;  5C2F A;  1UAX A;  3OHR A;  1JCF A;  4O55 A;  1A5X A;  1CZ9 A;  1TKX A;  3DOL A;  3ENO A;  3TAQ A;  2RF2 A;  1U45 A;  3OYM A;  3ZLJ A;  4U67 L;  3PX0 A;  1YJN N;  2HVI A;  4LH4 A;  5AQP A;  1TAQ A;  1Y64 A;  1VQP N;  1NOY A;  3K5N A;  4AM7 A;  1X9M A;  3LDS A;  4DFK A;  3CM6 A;  2UUA K;  4QS7 A;  4H5V A;  1EET A;  3DLL L;  1C0F A;  3E9L A;  4RCH A;  5ADX A;  1K6Y A;  5KPT A;  3HM8 A;  1J53 A;  2O8B A;  4CGH A;  4DV0 K;  4CHY A;  1KFD A;  3QIN A;  4NCG A;  2IIR A;  1BO5 O;  1HX1 A;  4CJL A;  3H6E A;  3KD1 E;  3TSP A;  4KH6 A;  4BRG A;  5HRO A;  4B1V A;  4H4M A;  3TTF A;  1BDG A;  2UU9 K;  3CI5 A;  3K2P A;  2QKB A;  1WSG A;  3DMJ A;  4A57 A;  2VG5 A;  3AVL A;  4CJF A;  4KHW A;  4W5N A;  3UKR B;  2RN2 A;  4HTL A;  2G8F A;  3J7Y P;  4AHU A;  3WNE A;  3AV9 A;  3O6W A;  2IS3 A;  4UQG A;  2HHV A;  3ID6 A;  3L6Q A;  2D4W A;  4AHV A;  4CZJ A;  2E2N A;  4IOC L;  5LY3 A;  2I7N A;  4E7H A;  5AJ3 K;  4JI7 K;  4OLA A;  3AVI A;  4WQ5 C;  1ILY A;  2PZS A;  5AQF A;  3ULE B;  1L3T A;  5TKY A;  3CCQ N;  5C12 A;  3WUH A;  1EWR A;  4FW1 A;  3JXU A;  4AHC A;  4KH5 A;  1KTQ A;  2E5L K;  1GOA A;  4FZY A;  2KW4 A;  1ESV A;  1U04 A;  2D0P A;  4E1M A;  5AQS A;  4YOU A;  1TUY A;  1YVU A;  5T7B A;  2YNF A;  4OPH A;  3FFI A;  4H03 B;  4DQQ A;  2JWL A;  2ASP A;  1YHQ N;  4ZHR A;  1I3A A;  3UIQ A;  4OKJ A;  3PSI A;  2YKM A;  3HO1 A;  4GKK K;  3H3N O;  3SJH A;  3SAF A;  3AO5 A;  4BQZ A;  2FBX A;  1KVA A;  2HNY A;  2FF6 A;  1JXE A;  3SQ0 A;  1SKW A;  2HHT A;  1JL2 A;  1OVY A;  2WOM A;  1K8A O;  2HST A;  3H08 A;  4FPB A;  4BRN A;  1JLQ A;  1QHA A;  1WSF A;  1NJZ A;  3EN9 A;  2HF3 A;  2GTD A;  3ZSZ A;  3ZSY A;  5FDL A;  5AQY A;  3O4N A;  2A3Z A;  2Q1N A;  3C7N A;  4IDK A;  1D9F A;  2Q31 A;  3CPE A;  3NGY A;  4JRP A;  4BAC A;  3IRX A;  4BRF A;  4L8R B;  4NCA A;  4CD1 A;  3HPO A;  5HBM A;  3HPG A;  3TSQ A;  1T05 A;  1BL3 A;  3O9T A;  3SBT A;  3U6F A;  4OGC A;  4FPA A;  1Q81 O;  2EX3 A;  4DQI A;  1LW2 A;  3VQB A;  2EHG A;  3J80 O;  2NZT A;  3RR8 A;  1HNI A;  3KK1 A;  1C0U A;  2QWL A;  3VTH A;  3DWL A;  3MN7 A;  1VSF A;  3EO3 A;  1TGO A;  2DFH A;  4FCY A;  1SKR A;  3P83 D;  3CFO A;  5TKW A;  2IOC A;  2E4L A;  1VQ5 N;  5HOO A;  4CGG A;  1N5Y A;  2ASO A;  4C23 A;  2A5X A;  5I9E B;  1SAZ A;  3HBT A;  4PL7 A;  4LFC K;  5AQX A;  2VWB A;  3LP0 A;  1S1X A;  1QZ5 A;  2HMP A;  3R6M A;  5BRE A;  2F4V K;  4QOZ B;  3BZC A;  1B9D A;  5AQR A;  4EZ6 A;  4FVM A;  1WSH A;  2YHW A;  4CFA A;  1S72 N;  2O8D A;  5CZ2 A;  3IUC A;  3W3D A;  4A2A A;  4JLH A;  3RMA A;  4CF0 A;  3LWM A;  1S3X A;  4PKH A;  2B4J A;  3LPT A;  4JS5 A;  4H5N A;  4CJU A;  4CJ5 A;  4FLT A;  2YJF A;  1YIJ N;  3V6D A;  1ZBS A;  1OKJ A;  3O1W A;  4WQ4 A;  1LAV A;  3T1Y K;  3WXI A;  2P9L B;  5JLF A;  3D2E A;  1VK0 A;  3THY A;  3TTC A;  1RT6 A;  4DTO A;  4JI8 K;  3QIC A;  4JAX A;  4CF8 A;  2HHH K;  4M7X A;  2F9W A;  2HMI A;  4I7F A;  3D6R A;  2RE2 A;  4BGA A;  4JI5 K;  4CEB A;  4FJG A;  4BG8 A;  3U3G A;  3HP6 A;  1VSE A;  2P9S A;  2QK9 A;  3G10 A;  3KJV A;  5FPN A;  4FWS A;  2J4R A;  2GEM A;  4M3U A;  4IO9 L;  4KTW A;  2QA4 N;  1T03 A;  1DKG D;  3QB0 A;  4CJQ A;  1FXX A;  3DXK B;  3K58 A;  4O5F A;  1TKD A;  1NJI O;  5AR0 A;  5M1N A;  2OA8 A;  1NK9 A;  3L2U A;  4JKD A;  3OYE A;  3TTD A;  1C0G A;  4H0Y B;  2QWN A;  1N36 K;  5GAH P;  3BF3 A;  1Q9X A;  5AZJ A;  2YHY A;  4E7L A;  2O4I A;  4WFB L;  3ZEU A;  1LCU A;  4O8K A;  4LSL A;  2QWO A;  4ID5 A;  3ATU A;  1GLD G;  3K57 A;  2P9L A;  1ITG A;  5M1P A;  3THW A;  1W2B M;  3FR0 A;  1LW0 A;  3MCP A;  4PUO A;  3TAG A;  3O3H A;  3CC7 N;  4EHU A;  5KQD A;  1X3M A;  2LSN A;  3NF8 A;  4FK2 A;  3BZK A;  4E7I A;  4DCH A;  4B1W B;  1Q86 O;  2QXF A;  4J8F A;  4E1J A;  2XO7 A;  4G1Q A;  1UOC A;  3PSF A;  1HKB A;  1V4T A;  2G8K A;  3ALY A;  3QO9 A;  2GV9 A;  4CEA A;  1CZB A;  1BA0 A;  1WLJ A;  3M5R A;  4JKH A;  3DLG A;  4N5S A;  1N8R O;  5E41 A;  1IBK K;  3DLH A;  3S41 A;  4IFY A;  5J1E A;  4BC4 A;  3ENB A;  5EY4 A;  4M7Y A;  3AA2 A;  4B08 A;  5KI6 A;  2UUB K;  4FL9 A;  3CQX A;  1TK0 A;  2NRT A;  5ADX H;  3OYG A;  4FLV A;  5AQQ A;  1Q9Y A;  4YDU C;  3AAP A;  1RTH A;  3MEE A;  4CJS A;  1EXQ A;  4B9T A;  4BE1 A;  4YOR A;  2QWM A;  3C7N B;  3AY9 A;  1XWL A;  2FLO A;  3MEG A;  1QVF M;  4JV5 K;  1VQK N;  1S9E A;  1XHZ A;  1DLO A;  4LF6 K;  2QTD A;  3J8A A;  3ZT3 A;  4PA1 A;  5JS1 A;  2Q2R A;  3AO3 A;  2O8F A;  4X62 K;  2E20 A;  5C0Y A;  5AQH A;  2X74 A;  5KTQ A;  3J81 O;  5KRT A;  3WEE A;  2P1J A;  1E4G T;  2VQF K;  3EY1 A;  2UYT A;  4I9L A;  5JIC A;  4LY7 A;  3EE8 A;  3AA3 A;  4A62 A;  3EZ5 A;  3SNN A;  3VGK A;  4BRA A;  2FBT A;  4K8Z A;  4B8C A;  4AM6 A;  4KH4 A;  4BC5 A;  3G25 A;  1JXB A;  2IVN A;  4JHD A;  2OZS A;  1FKP A;  3O3F A;  3VEO A;  4LF9 K;  4YDU A;  3MXI A;  3LM9 A;  4M42 A;  3JAM O;  1Q18 A;  3EKS A;  4H0V B;  1KD1 O;  1E4F T;  2XHB A;  1ZBL A;  3HL8 A;  1IG8 A;  5A2Q O;  4LF7 K;  5HRS A;  4YHH K;  3V9S A;  3I8B A;  1BIZ A;  1WAF A;  3IDH A;  4YOX A;  3GOI A;  2O8F B;  4M45 A;  3CMA N;  4CF1 A;  4JKC A;  3LDN A;  2ITM A;  4B8A B;  4BRD A;  1RDB A;  4DSI A;  4KTQ A;  4ILJ A;  2P5O A;  4FZX C;  4DG1 A;  4DQR A;  1RBU A;  1ZXO A;  4KHN A;  2P9U B;  4BWJ A;  3G4S N;  1NK6 A;  1NLV A;  4HUF A;  1JLF A;  3AGK A;  2O8C A;  3EE9 A;  5C10 A;  3BP8 A;  3RSE A;  4DTU A;  1YIT N;  1IKW A;  4EIA A;  4OPA A;  4YNQ A;  4QCL A;  1OH6 A;  1VAZ A;  4DQP A;  5AZJ B;  1OVQ A;  4F3T A;  3WXM B;  1TYQ B;  4N56 A;  4FWP A;  2UUC K;  1TV6 A;  1S9G A;  1T6C A;  1RT5 A;  4CEF A;  3DLR A;  4MLE A;  2ZJR L;  4PHT X;  4FJJ A;  2Z1J A;  4A5A A;  5CYQ A;  1BI4 B;  3U3Y A;  1S1V A;  1K9M O;  3KLG A;  1E3M A;  3W0L A;  1C0T A;  5J2M A;  1NGJ A;  1X3N A;  4FJK A;  3D2F B;  1VRT A;  5AQN A;  4HVJ A;  3K0S A;  3SQ1 A;  3HK2 A;  3FGU A;  1VSM A;  4CZF A;  3P1G A;  1QZ6 A;  4WF9 L;  3MDQ A;  3THX B;  5HP1 A;  1WOQ A;  4L3Q A;  2F7T A;  5AQT A;  1SS6 A;  1GLF O;  3UKU A;  2HHX A;  4IFV A;  3C6U A;  4JNE A;  2BGG A;  1IO2 A;  4MFB A;  2A42 A;  4BR9 A;  1BG3 A;  4CD3 A;  1EWQ A;  1NU0 A;  1RBT A;  4BRI A;  1KC8 O;  3D45 A;  4C8K A;  2O8E B;  4EAH D;  3LZJ A;  3THV A;  4KI6 A;  4JI3 K;  4CFC A;  2UXC K;  3L3U A;  5EX5 A;  4Y1C A;  4O0I A;  3DYA A;  2PYJ A;  2XY8 A;  4CVN E;  4FM1 A;  2EWS A;  4B1U B;  3OYB A;  4IOX A;  3OJS A;  3MWT A;  1NK8 A;  3CIP A;  4YOY A;  2DFE A;  3TSU A;  4K42 A;  4Q5V A;  2B6A A;  3WQT A;  4G9Z A;  3OBW A;  4H5T A;  3DRS A;  4CJW A;  3LPU A;  2B5J A;  3OS0 A;  1XI1 A;  1BA1 A;  4AH9 A;  5M1K A;  3SUO A;  3OBY A;  3O9R A;  3SK3 A;  5F0X A;  1S1T A;  1N34 K;  4FOE A;  5JVH L;  4CFB A;  4DSK A;  4W5T A;  4BR4 A;  1S6Q A;  3AVJ A;  3M8Q A;  4HUG A;  1GOB A;  1Q8I A;  3EKU A;  4CZH A;  1W0H A;  1H1V A;  4BRO A;  2GWK A;  3AVC A;  2P9P A;  5HRN A;  4DLG A;  4LH5 A;  4C8L A;  2X78 A;  2D5R A;  1TK8 A;  5BR8 K;  4ID1 A;  3VMF B;  3ZT1 A;  3FE1 A;  3L8B A;  3IAY A;  4AIL C;  4FZZ A;  3VQ4 A;  1NKB A;  3AA5 X;  1HMV A;  2ZM6 K;  4RW4 A;  1KRP A;  4J2E A;  3S3N A;  3MAQ A;  4DTS A;  2PYL A;  3AAR A;  4DR4 K;  3H1Q A;  5GAE P;  1HRH A;  2Y1I A;  4MLH A;  2HND A;  3SV3 A;  3ZSR A;  3S9H A;  3UB5 A;  5IT9 O;  4RWT A;  4ZTF A;  1WAJ A;  3I56 N;  4MDA A;  3I0S A;  4FJH A;  1S1W A;  4MO4 A;  1KLM A;  4BVP A;  4DTN A;  4WCE L;  1NNE A;  1MDU B;  1EX4 A;  3D7E O;  3DM2 A;  3GE1 A;  5LJW A;  3FZM A;  4I2P A;  2X6N A;  4NO7 A;  4B3R K;  4KRE A;  3ZET B;  2OCE A;  3U8X A;  2YNH A;  3K59 A;  4OKE A;  1GLA G;  4M3T A;  3HPH A;  5BRF A;  1D5A A;  3M8P A;  3KK7 A;  4DS4 A;  1IKY A;  4CGF A;  4BR5 A;  3V9Z A;  5AQK A;  3ZX3 A;  5C25 A;  4BDZ A;  4QS8 A;  2O8E A;  4CCH A;  3OS1 A;  4BR7 A;  4BR2 A;  3TAP A;  4H8K A;  1S6P A;  3ID8 A;  3VQE A;  3VQ6 A;  2E2Q A;  3V9U A;  4GV9 A;  4FWR A;  1YI2 N;  3BF1 A;  5J2N A;  4DTJ A;  2E1Y A;  1RT4 A;  1A5W A;  4Z0U A;  4BG9 A;  1BOT O;  4JD2 A;  4HCB A;  4Y1D A;  4XH4 A;  2IVP A;  3JS6 A;  1TVR A;  4DLE A;  3LDL A;  2FBY A;  4NLB A;  4U7B A;  4ELT A;  1QSS A;  3CCM N;  1GLB G;  3D2F A;  2OPS A;  3OYI A;  1KXP A;  4AHR A;  2ZJQ L;  3T3F A;  4E89 A;  3SJJ A;  3AVM A;  3I8D A;  1XNR K;  3WNG A;  3L2Q A;  3E66 A;  2NRZ A;  3KK2 A;  1GLC G;  3HOT A;  5LMU K;  1Z25 A;  2YKN A;  4KHS A;  4LF8 K;  4JYA K;  2QEX N;  3S3O A;  2YHX A;  3C0B A;  2KQ2 A;  3THX A;  3CJ7 A;  3WXL A;  3WXK A;  1NJX A;  1L3V A;  5AQM A;  3KWI A;  4BRE A;  2F9T A;  4JKE A;  3RRH A;  3SPY A;  4KAZ A;  4KB0 A;  2QXL A;  5SZT A;  5JVG L;  1I39 A;  4MQ3 A;  4BVO A;  4CZE A;  3BEX A;  2KKZ A;  2KHO A;  2GUP A;  3TU5 A;  3V1O A;  2WUS A;  1RTD A;  1VSI A;  3T1A A;  1B92 A;  3QBW A;  2CH5 A;  3K5L A;  2F96 A;  3E9P A;  3FLC O;  4DQS A;  1TYQ A;  3S3M A;  4R5P A;  3D0P A;  4LFA K;  4CEO A;  2AP1 A;  3SMS A;  3VES A;  2P5G A;  2Y1J A;  4XH1 A;  2W6L A;  4AF1 A;  3MCA B;  4FWM A;  3FFK B;  3CCL N;  1OH8 A;  4K43 A;  2NRV A;  5DM6 L;  2OTJ N;  3O3G A;  2P9P B;  2ZJP L;  3DXM B;  4F2R A;  2VWJ A;  3VA3 A;  3LZI A;  4NCB A;  3EL2 A;  4CGJ A;  4H4O A;  1X9S A;  3U9D A;  4FLY A;  3MWP A;  2IC3 A;  4BR0 A;  2HHU A;  3UE5 A;  5GAD P;  2YNI A;  3SMP A;  3EYZ A;  1TL1 A;  1QVG M;  4FW2 A;  3C95 A;  3KLI A;  2WC9 A;  3CJ9 A;  4BQL A;  4IOA L;  2P9N B;  4CBX A;  4CJV A;  3NAE A;  1M1K O;  3M1F A;  1ATN A;  2ZF5 O;  3QDK A;  4GW6 A;  3TAB A;  4DMN A;  1BIS A;  3VGL A;  5AQI A;  1Q7Y O;  3VQC A;  3SV4 A;  3A5L C;  4Y0W A; 
#chains in the Genus database with same CATH homology
 3AA2 A;  3VQ5 A;  4B08 A;  4CED A;  4CIE A;  3HP9 A;  5KI6 A;  3QEX A;  4FJM A;  4OKK A;  1U48 A;  1S1U A;  1TK0 A;  1O1W A;  1VSL A;  3OYG A;  4FLV A;  3NH0 A;  4I2Q A;  2VWK A;  1Q9Y A;  4M3Y A;  2KZZ A;  3KLH A;  1RTH A;  3MEE A;  1RCH A;  4CJS A;  3OJU A;  1EXQ A;  2YHA A;  4B9N A;  5C42 A;  4BE1 A;  1SKS A;  4B9T A;  4DFP A;  4N41 A;  3P5J A;  4FLU A;  3NDK A;  1JLC A;  3QES A;  1XWL A;  4CF2 A;  4DTX A;  3QER A;  4M3W A;  3MEG A;  2RPI A;  1FK9 A;  3MXM A;  3L2V A;  4GVM A;  3E01 A;  3OYJ A;  1ASU A;  3MEC A;  1S9E A;  1XHZ A;  1DLO A;  3TI0 A;  4BDP A;  3ZT3 A;  4J2A A;  4PA1 A;  4KO0 A;  5KGW A;  5JS1 A;  4F8R A;  3HVR A;  3O4Q A;  1G15 A;  3OYA A;  3LP3 A;  3AO3 A;  4O0J A;  4WE1 A;  1REV A;  3AVN A;  3VQQ A;  1MU2 A;  5FRM A;  1L5U A;  3WNF A;  3V9W A;  2XRI A;  2KZM A;  2X74 A;  4CFD A;  4OGE A;  1C6V A;  3RRG A;  3AVA A;  4CHP A;  5KTQ A;  3WNH A;  5KRT A;  2P1J A;  4DF8 A;  1NKC A;  3VQP A;  4M3X A;  3CFR A;  2HHQ A;  3EY1 A;  4I9L A;  3ULD A;  2IDO A;  1LWF A;  2HHS A;  1T8E A;  2G8H A;  4LY7 A;  3SNN A;  3AA3 A;  3LWL A;  3EZ5 A;  2OPQ A;  2FBT A;  4K8Z A;  4B8C A;  3RMC A;  2RKI A;  2E6L A;  4F2S A;  1ASW A;  4FJI A;  1HQE A;  3NF7 A;  1JXB A;  3K5O A;  3SI6 A;  4FJ9 A;  2D0A A;  2OZS A;  1FKP A;  3O3F A;  1BCM A;  1LWE A;  3TR8 A;  3HXM A;  1W9H A;  3VQA A;  1RBR A;  1RBV A;  2VG6 A;  3QLH A;  4OPJ A;  3KLE A;  3MXI A;  4M42 A;  3AVK A;  1RT1 A;  3ZT4 A;  1XHX A;  3VQD A;  4RW9 A;  1QE1 A;  2XHB A;  1ZBL A;  3HL8 A;  4FXD A;  3PV8 A;  4CEC A;  3AVG A;  1RBS A;  1TK5 A;  2G8V A;  4O4G A;  3CG7 A;  5HRS A;  3NCI A;  3OY9 A;  3V9S A;  1J54 A;  1BIZ A;  2BAN A;  1GOC A;  1WAF A;  4IG0 A;  1KSP A;  5J2Q A;  4DF4 A;  4M45 A;  1B9F A;  1BIU A;  4I9Q A;  4TSX A;  4EP4 A;  4CF1 A;  4E3S A;  4DU4 A;  4B8A B;  1NKE A;  3K5M A;  1RDB A;  4DSI A;  4KTQ A;  3AVB A;  4KFB A;  4C8M A;  2WON A;  4B9M A;  2P5O A;  2G8W A;  1UAX A;  3ZSQ A;  3V1Q A;  4FZX C;  4BWM A;  4DG1 A;  2IGI A;  3ZSX A;  4DQR A;  4O55 A;  1A5X A;  1CZ9 A;  1RBU A;  3QEV A;  4KHN A;  1TKX A;  3DRP A;  3DI6 A;  1C1C A;  3NH2 A;  3LAL A;  4RG8 A;  2G8U A;  4DU3 A;  3DOL A;  1CLQ A;  4BWJ A;  4PQU A;  3TAQ A;  1CXQ A;  4HUF A;  1NK6 A;  2RF2 A;  1JLF A;  4XIU A;  3OYM A;  4DU1 A;  3KK3 A;  1U45 A;  2OZM A;  1HNV A;  1U4B A;  4DSF A;  1WNS A;  1NK4 A;  4J2B A;  3PX0 A;  4DTU A;  4HHT A;  2HVI A;  3BGR A;  4LH4 A;  2YNG A;  4E7J A;  4DTM A;  4DWI A;  3RTV A;  3DLK A;  4C8O A;  1IKW A;  3NH1 A;  2IAJ A;  1TAQ A;  1NOY A;  3K5N A;  3SYZ A;  4YNQ A;  4QCL A;  1IH7 A;  4C8N A;  1X9M A;  3LDS A;  4DFK A;  3CM6 A;  4DQP A;  1ZBH A;  4FYD A;  1BQN A;  1EET A;  2KFZ A;  1EP4 A;  4JRQ A;  3RMB A;  4F3T A;  3TWH A;  4N56 A;  1LAW A;  1K6Y A;  4CJR A;  4RW8 A;  2DFF A;  1J53 A;  1TV6 A;  1X1P A;  4CGH A;  1S9G A;  4CHY A;  1C1A A;  2D0C A;  3AO4 A;  1NK5 A;  1RT5 A;  3BDP A;  3UIQ A;  1KFD A;  3DLR A;  3QIN A;  1C1B A;  4CEF A;  1NOZ A;  4ICL A;  4NCG A;  4FJJ A;  2Z1J A;  1X9W A;  1S5J A;  1KLN A;  5CYQ A;  1BI4 B;  1RDC A;  2Q3S A;  1S1V A;  4CJL A;  1YT3 A;  5KGX A;  3U3Y A;  3KD1 E;  4KB1 A;  3KLG A;  1NK0 A;  1Z26 A;  4FM0 A;  1C0T A;  5J2M A;  5HRO A;  3M8R A;  2HB5 A;  4H4M A;  4FJK A;  1VSK A;  3NF6 A;  1JLB A;  4DSJ A;  3C6T A;  1VRT A;  4KV8 A;  3OYK A;  3K2P A;  3NGI A;  5I42 A;  2QKB A;  3ASM A;  4HVJ A;  3DMJ A;  1WSG A;  1VRU A;  2VG5 A;  3AVL A;  1VSH A;  4CJF A;  4CK2 A;  3SQ1 A;  3HK2 A;  1D8Y A;  4KHW A;  4W5N A;  1VSM A;  3P1G A;  2JGU A;  3NFA A;  2RN2 A;  1NK7 A;  2XY5 A;  3V4I A;  2G8F A;  1RNH A;  5HP1 A;  4AHU A;  2FBV A;  3WNE A;  3AV9 A;  4BE0 A;  1LWC A;  2IS3 A;  4UQG A;  2HHV A;  3I0R A;  2ZD1 A;  3B6O A;  4AHV A;  2HHX A;  4OPK A;  4FJ7 A;  1UWB A;  3HT3 A;  4IFV A;  3C6U A;  3ZT0 A;  1WSI A;  4CES A;  3F9K A;  1IKX A;  3IG1 A;  3TAN A;  1NJY A;  1IO2 A;  4MFB A;  4E7H A;  4FLW A;  2BGG A;  4KRF A;  1BI4 A;  4KHQ A;  4IBN A;  4FLZ A;  4OLA A;  2Z1I A;  3AVI A;  1DTT A;  3RMD A;  1TAU A;  3KKR A;  1RBT A;  2PZS A;  2O4G A;  3D45 A;  3RR7 A;  4C8K A;  1L3T A;  2P51 A;  4CER A;  4Z4C A;  3LZJ A;  3THV A;  4KI6 A;  1UA0 A;  4CFC A;  3L3U A;  3SCX A;  4Y1C A;  1JLE A;  3DYA A;  4O0I A;  4CJ3 A;  2PYJ A;  2XY8 A;  4CJ4 A;  4FW1 A;  3SUQ A;  3MED A;  4AHC A;  2NUB A;  2R7Y A;  4FM1 A;  1KTQ A;  3AA4 A;  1GOA A;  2VG7 A;  1TL3 A;  5HRP A;  3OYB A;  3CFP A;  3QET A;  4B9L A;  4FZY A;  3SQ4 A;  2HW3 A;  3OJS A;  2KW4 A;  4KHU A;  2ZE2 A;  1NK8 A;  4E1M A;  1U04 A;  5HLF A;  1HPZ A;  2OPP A;  2OYQ A;  2DFE A;  3ZT2 A;  5C24 A;  4Q5V A;  1WSE A;  2B6A A;  2GBZ A;  1YVU A;  3QEI A;  1HJR A;  5T7B A;  2YNF A;  3DRS A;  4YFU A;  4E7K A;  3JYT A;  4CJW A;  3LPU A;  4F4K A;  2B5J A;  3OS0 A;  1XI1 A;  4AH9 A;  3SUO A;  3JSM A;  3FFI A;  4OLB A;  1U49 A;  4DQQ A;  5CY4 A;  3V81 A;  4N47 A;  1S1T A;  3QNN A;  4CFB A;  4DSK A;  4W5T A;  3VQ7 A;  4KHY A;  4DFM A;  1S6Q A;  4ZHR A;  3AVJ A;  1I3A A;  3M8Q A;  1RT3 A;  1GOB A;  1Q8I A;  3HM9 A;  1W0H A;  1SV5 A;  4OKJ A;  4HUG A;  2QKK A;  2YKM A;  3HO1 A;  3PX6 A;  1LV5 A;  3OS2 A;  3AVC A;  3IS9 A;  5HRN A;  4DLG A;  2Z1H A;  4BDY A;  3AO5 A;  4LH5 A;  2FBX A;  3NBP A;  1XC9 A;  2DTU A;  4C8L A;  2BDP A;  1KVA A;  2X78 A;  4PWD A;  2D5R A;  2HNY A;  1JXE A;  3SQ0 A;  1TK8 A;  1SKW A;  4B9V A;  2HVH A;  2HHT A;  1JL2 A;  1J5O A;  4ID1 A;  4M41 A;  2WOM A;  4CGD A;  1DTQ A;  3ZT1 A;  1SL1 A;  5FRN A;  3L8B A;  3IAY A;  3H08 A;  1RDD A;  4CJP A;  4FJ8 A;  4AIL C;  3OYC A;  4FZZ A;  3LP1 A;  1N6Q A;  4OVL A;  3VQ4 A;  1NKB A;  1JLQ A;  1QQC A;  3AA5 X;  4CHQ A;  3RR8 A;  4CJE A;  1HMV A;  1WSF A;  4OJR A;  3LP2 A;  4RW4 A;  1NJZ A;  1KRP A;  4J2E A;  2BE2 A;  4LD0 A;  3S3N A;  3MAQ A;  3F73 A;  3LAM A;  4DTS A;  2PYL A;  3QIP A;  3ZSZ A;  3ZSY A;  5FDL A;  4GMJ B;  4CK1 A;  3O4N A;  1HRH A;  4AHS A;  2Y1I A;  3SV3 A;  2HND A;  2KTQ A;  1JL1 A;  3ZSR A;  3S9H A;  4FLX A;  2GUI A;  5SWM A;  3AVH A;  4IDK A;  4IG3 A;  5I3U A;  1RIL A;  1WAJ A;  3B6P A;  3DRR A;  4ZTF A;  1D9F A;  4Q0B A;  3NGY A;  2I5J A;  1QS4 A;  4JRP A;  3C94 A;  4BAC A;  3I0S A;  3TAF A;  1S1W A;  4HUE A;  4FJH A;  1KLM A;  4DSE A;  4DTN A;  3IRX A;  4L8R B;  4NCA A;  1TKT A;  3HPO A;  5JS2 A;  1SL0 A;  4Z4G A;  5HBM A;  3HPG A;  2XY7 A;  1T05 A;  1BL3 A;  1EX4 A;  3U6F A;  3PY8 A;  3DM2 A;  1YTU A;  4OGC A;  4I2P A;  1QTM A;  2X6N A;  1JLG A;  3ZSO A;  3OYN A;  3KKS A;  4FJ5 A;  3QEP A;  4KRE A;  2EX3 A;  1VSD A;  4W5Q A;  1LW2 A;  1RTI A;  4DQI A;  1UA1 A;  1RT2 A;  2YNH A;  2EHG A;  2YV0 X;  4OKE A;  3VQB A;  3K59 A;  1QSY A;  4M3T A;  2AJQ A;  4O44 A;  1HYS A;  3HPH A;  4RW6 A;  1QSL A;  1HNI A;  1D5A A;  3LAK A;  3KK1 A;  3M8S A;  1C0U A;  1VSJ A;  3M8P A;  4AHT A;  4DS4 A;  1IKY A;  1D9D A;  1Y97 A;  4CGF A;  4CEQ A;  4CK3 A;  3AO2 A;  1BGX T;  1VSF A;  3G0Z A;  4CHO A;  3SQ2 A;  3OYF A;  4B9U A;  4EZ9 A;  3V9Z A;  4RW7 A;  1TGO A;  2DFH A;  4FCY A;  1SKR A;  1ASV A;  3HVT A;  3P83 D;  5C25 A;  4BDZ A;  3CFO A;  4CE9 A;  2ATQ A;  3V9X A;  2IOC A;  1BCO A;  2E4L A;  1C0M A;  4CCH A;  3OS1 A;  4CGG A;  3NF9 A;  4CIG A;  1NJW A;  1N5Y A;  2HHW A;  4LSN A;  3TAP A;  4QAG A;  4H8K A;  1YTA A;  5HRR A;  4HTU A;  3A2F A;  1S6P A;  4E19 A;  3VQE A;  3VQ6 A;  3V9U A;  3QEW A;  3TAE A;  3TAM A;  5J2N A;  4DTJ A;  3LP0 A;  4KI4 A;  1S1X A;  5CYM A;  3HJF A;  1RT4 A;  4E0D A;  4QOZ B;  1B9D A;  3SPZ A;  4EZ6 A;  1A5W A;  4ZTJ A;  4KTZ A;  2OPR A;  4O5B A;  4FVM A;  1WSH A;  5K14 A;  1HQU A;  1ZBI A;  1BHL A;  4FK0 A;  4Z0U A;  3L2W A;  4CFA A;  4ELV A;  4FJN A;  3DLE A;  5CZ2 A;  4HCB A;  1WSJ A;  4Y1D A;  3PUF A;  4JLH A;  3RMA A;  4CF0 A;  1TVR A;  3LWM A;  3L3V A;  4DLE A;  2FBY A;  1BQM A;  1FKO A;  4ELT A;  2B4J A;  1RTJ A;  3LPT A;  4JS5 A;  1QSS A;  3ZSW A;  4CF9 A;  4CJU A;  1KVB A;  4CJ5 A;  3NGZ A;  2OPS A;  3OYI A;  4FLT A;  4B9S A;  1ZBU A;  4AHR A;  3V6D A;  3T3F A;  4E89 A;  3SJJ A;  3AVM A;  3I8D A;  1LAV A;  3ISN C;  2FC0 A;  3WNG A;  3L2Q A;  3KK2 A;  1VK0 A;  4DTO A;  1RT6 A;  2X6S A;  4KHS A;  1Z25 A;  2YKN A;  4KKO A;  4CF8 A;  1U47 A;  1HYZ A;  2ETJ A;  2DY4 A;  3T19 A;  1R0A A;  3S3O A;  1ZYQ A;  2HMI A;  3KTQ A;  3VQ9 A;  1J9A A;  2KQ2 A;  3HST B;  4I7F A;  3PO4 A;  4M3Z A;  4Z4F A;  4B3O A;  4Z4H A;  4CEB A;  2HNZ A;  4FJG A;  2JLE A;  3U3G A;  1NJX A;  5J2P A;  3HP6 A;  1L3V A;  1VSE A;  2QK9 A;  3ZSV A;  3G10 A;  1SL2 A;  3KJV A;  1ZBF A;  4FJL A;  4M3R A;  3RRH A;  3SPY A;  1EKE A;  3OYH A;  1KFS A;  4KAZ A;  4KB0 A;  4W5O A;  3KD5 E;  4Z4E A;  5SZT A;  1I39 A;  1JLA A;  4MQ3 A;  2F8T A;  2F8S A;  4M3U A;  3RWU A;  2D0B A;  4CEZ A;  3V1O A;  2E6M A;  4KPY A;  2ITG A;  1RTD A;  1VSI A;  3LAN A;  4KTW A;  1T03 A;  1WN7 A;  2KFN A;  3QIO A;  3T1A A;  1L3U A;  1B92 A;  4CJQ A;  1FXX A;  3K5L A;  4J2D A;  2F96 A;  5CZ1 A;  3K58 A;  3PX4 A;  1HYV A;  4FK4 A;  4DQS A;  3S3M A;  3OYL A;  1F21 A;  1TKD A;  1IKV A;  4R5P A;  3D0P A;  4CEO A;  2OA8 A;  3MXJ A;  3OVN A;  2P5G A;  1JKH A;  3L2U A;  2Y1J A;  1NK9 A;  4ELU A;  1KVC A;  3OYE A;  1QHT A;  3NE6 A;  4F3O A;  3SUP A;  1Q9X A;  4NYN A;  4CEE A;  3DOK A;  4Z4I A;  3O3G A;  5EU7 A;  4DTR A;  3HYF A;  1KCF A;  1L3S A;  4CGI A;  1TKZ A;  4F2R A;  2VWJ A;  4BE2 A;  4E7L A;  3NHG A;  2O4I A;  3VN5 A;  5KRS A;  3AVF A;  4DTP A;  4N76 A;  4CHN A;  3VA3 A;  4HCC A;  2G8I A;  4CJK A;  4LSL A;  3AO1 A;  4E1N A;  3LZI A;  4PY5 A;  4ID5 A;  1T7P A;  3DLB A;  5FRO A;  4NCB A;  3ITH A;  3VA0 A;  3K57 A;  4DSL A;  4CGJ A;  4DFJ A;  4FJX A;  1ITG A;  3SZ2 A;  4H4O A;  1X9S A;  5DK5 A;  4FLY A;  4PUO A;  1LW0 A;  2IC3 A;  3TAG A;  2HHU A;  3O3H A;  1CXU A;  3ZCM A;  3SUN A;  2YNI A;  3KLF A;  4NYF A;  3VQ8 A;  4IKF A;  2LSN A;  2ZQB A;  3NF8 A;  3OYD A;  4FK2 A;  4E7I A;  3EYZ A;  1IG9 A;  1TL1 A;  2A1S A;  2W42 A;  1A5V A;  2QXF A;  4FW2 A;  3L2R A;  3C95 A;  3KLI A;  2XO7 A;  4CIF A;  4G1Q A;  1UOC A;  4K8X A;  2XY6 A;  2A1R A;  3PO5 A;  4W5R A;  4DS5 A;  2G8K A;  2YHB A;  3CYM A;  3ALY A;  1RT7 A;  5DMR A;  3QO9 A;  4CJT A;  4CJV A;  4JS4 A;  3NAE A;  3CQ8 A;  2GV9 A;  4CEA A;  3CM5 A;  4CHZ A;  3QNO A;  1CZB A;  1SUQ A;  4GW6 A;  1WLJ A;  3TAB A;  4DMN A;  5D3G A;  3DLG A;  1BIS A;  4N5S A;  2PY5 A;  5E41 A;  3DLH A;  2Z1G A;  3TAR A;  1RDA A;  4IFY A;  5J1E A;  3VQC A;  3SV4 A;  3V1R A;  3KIO A;  4FM2 A;  4EP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...