1RBSA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEACEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbsA00
2F96A 3M8QA 4CF9A 3PX0A 3SPYA 1ZBIA 3KKSA 2G8WA 4FLVA 1TKTA 1KRPA 2QXFA 4E3SA 3V9UA 4E7LA 1NK6A 4LH4A 4KRFA 3CFPA 4KV8A 3ZSQA 1CZ9A 4NYFA 1RTIA 5FROA 1T7PA 4M42A 3OYFA 2OPQA 4AILC 1RT5A 5KI6A 1QSSA 4CJPA 1NK5A 2DY4A 4R5PA 2RF2A 4FZXC 4FJKA 3NF7A 4EP4A 3MEEA 4OKJA 4E19A 4DU1A 3SUQA 4CJTA 4DQQA 1SKWA 3KK2A 3P5JA 3AVCA 3SQ1A 2Z1JA 1JLAA 1NKCA 3T19A 3NAEA 3AA4A 4IFYA 3SUNA 1RDCA 1VSKA 2Z1HA 4ZTFA 3NF9A 1VK0A 3AVKA 1VSJA 3V6DA 2DTUA 1C0UA 3SQ4A 4FYDA 3ZSOA 1RT4A 4YNQA 1WSJA 3B6PA 4O5BA 2HHXA 1NJYA 3LP1A 4CJUA 4KAZA 4FCYA 4IFVA 1J5OA 3ZT3A 4Y1DA 2QKKA 1HNVA 4M3UA 2ZE2A 4I2PA 5KRTA 3DOKA 2HHSA 3IS9A 4IDKA 4ZTJA 4G1QA 4B9SA 4E7HA 1XC9A 1UA1A 4BWMA 4ICLA 3TWHA 3V1OA 3B6OA 4CJSA 4UQGA 4F4KA 4E7IA 4HCBA 4M3RA 3QIPA 4CJEA 5HRSA 4B9VA 1JLCA 3VQ6A 4FJXA 4B9TA 1I39A 2IOCA 1VRUA 4OJRA 1JL2A 1DTQA 3HJFA 1Z26A 1SL0A 4FJIA 1LAVA 2KFNA 1T05A 4W5NA 3WNHA 4I2QA 4CECA 2QKBA 2B4JA 4M45A 2ITGA 4CJRA 2EHGA 2KQ2A 1ZBLA 4QAGA 3IG1A 3VQ9A 2D0CA 3AVNA 3S3MA 2IC3A 4RW4A 4CEFA 3KTQA 4M3ZA 3E01A 5CZ1A 3DLBA 3K57A 2LSNA 3CFRA 5CYQA 2HVIA 1TL3A 5J2MA 2FBXA 4RW7A 4B9NA 4B8CA 2ZQBA 1HYVA 2FBTA 3ZCMA 2W42A 4KFBA 4JRQA 4E1MA 2YHAA 3WNEA 1JXBA 2O4IA 4FVMA 5HBMA 2JGUA 3HL8A 4NCGA 5J2NA 2RN2A 4OLBA 1LV5A 2P1JA 2F8TA 4O44A 3O3HA 3CFOA 3P83D 4TSXA 4CEZA 1TAQA 4OGCA 2RKIA 4DU3A 1BIUA 1WSEA 3DOLA 1W0HA 3A2FA 4BWJA 4DLEA 3O4QA 3V9SA 2Y1JA 1Q9XA 4K8ZA 4M3XA 4CHQA 1RT2A 3AVAA 4ELUA 3DRRA 1D9DA 4FJGA 2HHWA 3HP9A 3H08A 3ZSVA 3QETA 1U48A 3MXMA 4EZ9A 3OYGA 2GUIA 3VQBA 1J53A 5CY4A 3M8SA 1YVUA 4O4GA 4CCHA 1QSLA 2HVHA 1RT6A 2KW4A 1NK4A 4KO0A 2XY6A 4DSLA 4J2EA 1HNIA 1VRTA 3OJUA 1QQCA 4N76A 4Q0BA 3RRGA 3KIOA 1JKHA 2D0AA 2IAJA 3HPHA 4GVMA 3OJSA 2WOMA 3VA0A 4N56A 2XHBA 1TKDA 4Y1CA 3D45A 2E6LA 3TANA 4PWDA 4AH9A 1D5AA 1TKZA 2ETJA 1G15A 3BGRA 1KFDA 3NFAA 1Y97A 4NYNA 1QE1A 3VQPA 4W5QA 4FLWA 1NK7A 4Z4FA 3OYIA 4DWIA 3RMCA 1N6QA 4FLUA 4DTRA 4CIEA 1GOAA 1HMVA 5HRRA 3ZT2A 3ZT0A 1EXQA 5HRPA 3L3UA 3ZSZA 4BACA 3LAMA 3KLFA 1SKRA 4N41A 3ZSRA 3RTVA 3EZ5A 1VSDA 3CM5A 3L2UA 3AO3A 3AVMA 5KGXA 2HNYA 1C1CA 1VSEA 2WONA 4W5TA 3TAPA 1XWLA 3VQ5A 4WE1A 5SWMA 1TVRA 1ASWA 2HHVA 4CEOA 2HNZA 4HHTA 2YKMA 4NCBA 4N5SA 2XRIA 4CGFA 4FLTA 5EU7A 4CFAA 3HT3A 4LH5A 3NCIA 3QERA 4M41A 4CFBA 4CF2A 1C1BA 4JLHA 4CGJA 2HB5A 3BDPA 4KTQA 5KGWA 3LAKA 1WSIA 1I3AA 1VSMA 1U47A 4DFMA 5C24A 2OYQA 1RBRA 3VQ7A 3ZSXA 4FM2A 2OZSA 1HPZA 3JSMA 3IAYA 1ITGA 3NH2A 3ULDA 1KLNA 1C0TA 4E0DA 2YKNA 4M3TA 4DMNA 4E1NA 1BI4B 1UAXA 4RW6A 1JXEA 3VQDA 4CJLA 1HYSA 3KLEA 1L3VA 3KKRA 4C8MA 4XIUA 2QK9A 3ZSYA 2IS3A 1FKOA 2JLEA 4DFKA 1O1WA 1UA0A 3I0RA 4CJFA 4JS5A 3MECA 1Q9YA 4B9MA 4OPJA 3TARA 2Q3SA 2GV9A 3FFIA 2X6SA 3L2WA 1L3UA 3HPGA 3VQEA 1N5YA 3PO5A 4J2DA 3AVIA 4IKFA 4KREA 5J1EA 3QEPA 4CJKA 2E6MA 2PYLA 3LDSA 3S3OA 1D9FA 3RR7A 1TAUA 1QHTA 3F9KA 1TL1A 3HPOA 1S1UA 3QINA 3QNOA 1J9AA 3NHGA 1RBTA 4PA1A 1NK0A 5J2PA 1KVAA 4DSFA 4KHYA 3AA3A 4CIGA 2BE2A 4KI4A 1CLQA 4Z4IA 4KTWA 4CGDA 2YNFA 4AHTA 1ZBFA 5I42A 1L3TA 1HYZA 3ZT4A 3SPZA 4F2RA 4C8OA 3LWLA 4DTUA 2YHBA 4AHRA 1HQEA 3TAEA 3KK3A 1X1PA 1WSGA 3S3NA 4Z0UA 4EZ6A 2FC0A 4KKOA 4KI6A 1C6VA 4F2SA 4AHVA 3KD5E 3K5OA 3SUPA 4KB0A 4KPYA 4CGHA 4W5OA 5CYMA 3AVGA 3AO2A 1JLGA 4JRPA 3RWUA 4CK1A 4FJ7A 1S9EA 1WSHA 4CJVA 3RMDA 3HVTA 2HMIA 3U3GA 3KLHA 5C42A 3O4NA 1LWEA 4OKKA 4FJ9A 5HROA 4BDZA 4FJNA 4J2BA 1YTUA 1LW0A 1XHZA 2YV0X 3K5LA 4E7JA 4LSLA 4FK0A 3AV9A 4OGEA 1SKSA 5JS2A 3DLRA 4FLXA 4PQUA 1UOCA 1L3SA 1BIZA 1RCHA 5JS1A 1FXXA 3I0SA 4CJQA 1YT3A 2VWJA 3WNFA 3SUOA 1BI4A 3V1RA 3K59A 3HO1A 3AO5A 3NGIA 4DF4A 1BHLA 2B6AA 3LPUA 4B9LA 3TR8A 3L2VA 3AVLA 1RTHA 2OPRA 3D0PA 3O3GA 1CXQA 2F8SA 3AA5X 1BQMA 4E89A 3MAQA 4H4MA 3DI6A 4CFDA 4KHUA 3DMJA 4IBNA 2XO7A 3CG7A 3DLGA 1KVBA 3AVJA 4DSJA 4CHYA 3HK2A 2HHQA 1R0AA 3OS0A 3DRSA 4DSKA 3RRHA 4MQ3A 5T7BA 2VG6A 4FW2A 1J54A 1S1XA 4Z4EA 4CK2A 1ASVA 1IKXA 3DLKA 4Q5VA 1KSPA 1EX4A 3LP3A 3MEGA 2I5JA 4CF0A 3KLGA 1BISA 5SZTA 3K5NA 4DTPA 1WN7A 1QSYA 1TKXA 3IRXA 4YFUA 1NK9A 3QO9A 4CHZA 5FRNA 4FLYA 1TGOA 3PX6A 2IDOA 5J2QA 1RDAA 4LD0A 4KHWA 1T8EA 1JLFA 2YNHA 2G8KA 4ID1A 5DMRA 4DS5A 1FKPA 4BE1A 3QEVA 3S9HA 1IH7A 3OYLA 1X9WA 3ALYA 3TAFA 3SQ2A 1C1AA 3CYMA 2EX3A 3SZ2A 2NUBA 4FJJA 3LALA 4DTMA 1S9GA 4DLGA 2IGIA 4CJWA 4FM1A 2B5JA 1BL3A 1RT3A 4DQRA 3V4IA 3RMAA 3I8DA 1LAWA 4FZYA 3M8RA 1RILA 4PY5A 3OVNA 3RMBA 2OPSA 1A5WA 1IKWA 3KLIA 4AHCA 4OVLA 4CE9A 3F73A 1WSFA 1ASUA 5DK5A 3ITHA 2BANA 3VN5A 4B8AB 4FM0A 4C8LA 4NCAA 1IKVA 4HUFA 3UIQA 4I9QA 1ZBUA 3DRPA 1JL1A 4DF8A 1WAJA 4B3OA 4M3YA 3HM9A 1MU2A 3LP0A 3VA3A 3L8BA 4DSEA 2BGGA 1RNHA 1BCOA 1S6PA 4DFJA 1NJWA 1A5XA 1ZYQA 4KB1A 1A5VA 1RBVA 4CF8A 3QNNA 1T03A 4FZZA 2BDPA 2DFFA 1HJRA 2Z1GA 3AVHA 3JYTA 1HQUA 4CIFA 4ZHRA 4BDYA 4FLZA 4F3OA 2KZZA 2ATQA 4Z4GA 1FK9A 4C8NA 4CJ4A 4CK3A 4MFBA 2A1RA 4FK2A 1S6QA 1IO2A 1F21A 2HHTA 2PYJA 3NDKA 4HCCA 3NGYA 4FW1A 4HUEA 1LWCA 1VSFA 4IG0A 3AVBA 1TK5A 4RG8A 4OPKA 5I3UA 1SL2A 3ISNC 1IG9A 3OYDA 4FJ8A 4AHUA 3TAMA 1BCMA 4I7FA 2D0BA 3OYJA 1GOBA 2XY5A 2YNGA 3KJVA 4J2AA 3NBPA 3PO4A 3ASMA 3NF8A 4PUOA 2PY5A 4AHSA 2R7YA 2XY7A 4CF1A 2G8IA 3PUFA 4CERA 3K2PA 4DTJA 5HP1A 4OLAA 4F3TA 3O3FA 4CEQA 1XI1A 1U45A 1JLEA 4DQSA 1KTQA 2E4LA 4Z4CA 5FRMA 3HVRA 1LWFA 3MXIA 3OS2A 3QEWA 4KHQA 3OS1A 4N47A 4DQPA 3P1GA 4F8RA 1KLMA 4ELVA 3G10A 5D3GA 3QEXA 3C94A 3DLHA 1CZBA 2ZD1A 3CQ8A 4ELTA 3LPTA 4DTSA 3DLEA 2G8HA 4CEBA 3NE6A 3PV8A 1VSHA 1UWBA 2VG5A 3SQ0A 4CGGA 3RR8A 1RDBA 1WAFA 1RBSA 3OYNA 2A1SA 3LP2A 2VWKA 2P51A 4QCLA 3AO4A 1B9DA 2DFEA 3OYHA 4DSIA 2D5RA 5FDLA 4FXDA 2AJQA 1U4BA 3EY1A 2GBZA 1KVCA 4DQIA 1B92A 2VG7A 1LW2A 4CHNA 3SV3A 5E41A 4E7KA 1QTMA 1VSIA 4Z4HA 4M3WA 3C6TA 3V9ZA 1NOZA 4DTOA 4DTXA 4H4OA 4O0JA 2FBYA 1DTTA 3VQCA 1VSLA 1RDDA 3OYAA 3AO1A 1TK8A 2P5OA 1RTJA 4HTUA 1EP4A 3QESA 3V1QA 1SL1A 4JS4A 1DLOA 2X78A 1IKYA 1GOCA 4H8KA 4CFCA 1NJZA 2OPPA 4LY7A 2RPIA 2HW3A 3C6UA 4BE0A 3TABA 3T3FA 3QEIA 1NK8A 5K14A 3T1AA 3SYZA 4K8XA 1WNSA 3NF6A 3LZIA 3TAGA 1JLBA 3HYFA 1B9FA 4HVJA 4B9UA 3V9WA 1EKEA 1Q8IA 3M8PA 1XHXA 3AA2A 4DU4A 4B08A 1U49A 4KHNA 4QOZB 3SJJA 1S1TA 3LANA 4HUGA 3V9XA 1U04A 4GMJB 4BDPA 3C95A 2O4GA 2XY8A 5C25A 2OA8A 1S5JA 3CM6A 3VQQA 3NGZA 3HXMA 2Y1IA 1REVA 1X9MA 1Z25A 2HNDA 3VQ8A 3V81A 4CHPA 1RT1A 2Z1IA 4CEEA 5KRSA 1S1WA 3VQAA 4FJLA 2HHUA 3SI6A 2FBVA 3DM2A 4RW8A 3SV4A 1RBUA 4BE2A 3PY8A 4FK4A 2DFHA 4CGIA 1S1VA 3NH0A 4DS4A 1JLQA 3QIOA 1W9HA 3OY9A 2G8VA 4LSNA 3HP6A 1CXUA 5KTQA 4L8RB 2PZSA 4W5RA 4C8KA 2KFZA 3QLHA 4KTZA 4ID5A 2KZMA 3OYBA 1BGXT 3U6FA 1NKEA 1QS4A 2X6NA 5HLFA 1D8YA 1NOYA 3OYEA 4EP5A 3EYZA 3U3YA 3TI0A 3NH1A 4CHOA 1NKBA 1RTDA 3L2RA 3VQ4A 4FJMA 1RT7A 3DYAA 3OYKA 1NJXA 2YNIA 4CJ5A 1WLJA 4O55A 4CEAA 4IG3A 1SV5A 3OYMA 1X9SA 3AVFA 5CZ2A 4DTNA 3L3VA 4CEDA 2X74A 3PX4A 4GW6A 4FJ5A 4KHSA 3KK1A 4CESA 4FJHA 3L2QA 1ZBHA 1YTAA 3ZT1A 3MEDA 4DG1A 1KCFA 4OKEA 1K6YA 2KTQA 3LWMA 4CJ3A 1L5UA 4O0IA 3WNGA 1TV6A 3OYCA 1SUQA 4DFPA 2G8FA 3ZSWA 1C0MA 4I9LA 5HRNA 1KFSA 2OZMA 1HRHA 1BQNA 2P5GA 3G0ZA 3KD1E 3MXJA 3THVA 3LZJA 3SCXA 3K5MA 2G8UA 4RW9A 3SNNA 3TAQA 3K58A 1TK0A 1EETA 3HSTB
chains in the Genus database with same CATH superfamily
3SPYA 1FJGK 3UKUB 1Q81O 4LH4A 4B1ZA 1CZ9A 4A5BA 4NYFA 3CC7N 1RTIA 2A40A 1NMDA 2OPQA 4X66K 2HOEA 1V4SA 3VEOA 2Q2RA 3NF7A 4EP4A 4OKJA 4CJTA 4DQQA 1SKWA 3KK2A 3AA4A 3WUHA 2FLOA 4OX9K 2Z1HA 3D7EO 3TU5A 1VK0A 4IWVA 1VSJA 3DXMB 4A2AA 2JWLA 5C10A 1RT4A 4YNQA 3ATVA 3LP1A 4BRDA 4FCYA 4Y1DA 3KK7A 2QKKA 2ZE2A 1OVYA 1QVGM 3DOKA 3IS9A 3EEQA 2CGLA 3F9MA 3NVKA 4FO0A 4CJSA 4CZMA 2UUAK 3E9LA 4B9VA 4FJXA 1I39A 2IOCA 1JL2A 3H46O 3HJFA 3I8BA 4FJIA 4H5VA 3ENOA 4CECA 2QKBA 3VOVA 4CJRA 5KPTA 2KQ2A 4NXMK 1EQYA 4M7YA 3QFUA 2I7NA 2A5XA 5JLFA 3DLBA 1YI2N 3UKUA 4FOIA 4A57A 2ZQBA 2W42A 1KD1O 5AQOA 2YHAA 4CBXA 1JXBA 4E1MA 2O4IA 2YHXA 2JGUA 3HL8A 2BH1A 4NCGA 4CZIA 1LV5A 3VEZA 2P1JA 1I94K 3P83D 1TAQA 4ILHA 1KAXA 2RKIA 3FZHA 4DU3A 3CCUN 3FE1A 1W0HA 4M3XA 4BQLA 2HHWA 3DRRA 2VGMA 4FJGA 3R8EA 3DXMA 3CF5L 1U48A 4EZ9A 2QI2A 3M8SA 1OH6A 1RT6A 4KO0A 5KQ8A 4DSLA 1QQCA 4DV6K 3OJSA 2WOMA 4YOVA 2CH5A 3TANA 3D45A 1G15A 5LY3A 3BGRA 1NK7A 1U6ZA 2QWQA 1MWMA 3LDOA 3IUCA 1Q7YO 1VQLN 2BUPA 5HRPA 1TYQB 4BACA 3RTVA 2F9WA 3EZ5A 3L2UA 4LF7K 5BPLA 4CEOA 2HNZA 1IBKK 4NCBA 4N5SA 4CGFA 5JLHA 3DAWA 3NCIA 4LH5A 1T6DA 4GVEA 4CFBA 1VQ8N 3H1QA 5KGWA 1HKGA 1VSMA 4DFMA 5C24A 5BN8A 1RBRA 2ASPA 2YJFA 4FM2A 3ULDA 2GWKA 1KLNA 1C0TA 4E0DA 4M3TA 4E1NA 4WQ5A 1JXEA 3FZFA 3KLEA 1L3VA 4ISGA 4U67L 4UY8O 3VEYA 2IS3A 2JLEA 3GOIA 2Q3SA 3FFIA 1L3UA 4J2DA 3VQEA 3PO5A 4DB3A 1BA1A 3SK3A 3F9KA 1NMNA 1TL1A 1NU0A 4BRHA 3AA3A 5EY4A 2IIRA 3D2FB 2YNFA 4AHTA 4F2RA 1VQ4N 4AHRA 3S3NA 1TYQA 4F9OA 4KI6A 3RVCA 4JNEA 4MDAA 4W5OA 4FWLA 4JRPA 1JLGA 4CJVA 1SS6A 2E2QA 2VQFK 5BRFA 2HMIA 3U3GA 5HROA 4BDZA 1YTUA 1YVNA 4LSLA 5JS2A 5JS1A 1UOCA 3SMPA 1YF5L 1YT3A 3K0SA 2QA4N 4DV2K 3WNFA 3V1RA 1NGJA 4FWMA 1GLLO 4IDHA 3AO5A 3NGIA 3LPUA 1RTHA 3O3GA 1BQMA 3VGLA 1HNWK 1GLAG 3DLGA 4A61A 1XUPO 3THXB 4CHYA 4YOYA 3HK2A 3DRSA 3MCPA 1J54A 1ASVA 3LP3A 4WCEL 3D2FA 3GG4A 1TGOA 4BQZA 3PX6A 2F7TA 2G8KA 1JLFA 4IEEA 3QEVA 3QICA 3OYLA 3ALYA 2NRVA 4DR5K 3SZ2A 3A5LC 3V4IA 2QEXN 2B5JA 1RT3A 4FZYA 2WUSA 3RMBA 2OPSA 1IBLK 1A5WA 1IKWA 4AHCA 3F73A 1ASUA 5DK5A 1C0FA 4B8AB 3ID8A 4JKFA 3DRPA 4A5AA 5E26A 1WAJA 4M3YA 4DV4K 3L8BA 4XH4A 3ZYYX 4DFJA 1NJWA 1A5XA 3VGKA 4QS8A 1HQUA 2ATQA 1FK9A 4CJ4A 3O9TA 2ZGYA 2ZM6K 4BREA 1D4XA 3WXIA 4HCCA 2HF3A 2YHWA 4IG0A 3AVBA 1SL2A 4RG8A 4KH6A 1NBWA 4FJ8A 1IJJA 3O9UA 5EX5A 3O9SA 2XY5A 3KJVA 3THXA 3NBPA 3ASMA 3NF8A 4OO1J 4AHSA 2R7YA 4CF1A 1VQMN 1TUYA 4CEQA 1U45A 1JLEA 1KTQA 3E9OA 3OS1A 4DQPA 3CJAA 4WQ4A 5D3GA 3QEXA 3DLHA 4ELTA 3LPTA 3PV8A 1VSHA 1BWFO 5AFUH 1OH8A 4JI8K 1JCFA 1RDBA 1RBSA 3J7ZO 3CCQN 2VWKA 2P51A 5AQWA 2D5RA 3E9PA 1VQ5N 5CHIA 2O8CB 2E1ZA 3WT0A 1B92A 1LW2A 5E41A 4M3WA 3C6TA 2VWBA 3P39A 5AFUA 4DTOA 4H4OA 4K41A 2FBYA 1XNRK 3OBWA 3AO1A 4C23A 3O08A 1EP4A 3QESA 4IJNA 1DGKN 4JEPA 1GOCA 4LY7A 3C6UA 3T7ZA 3T3FA 4BGBA 1NK8A 3SYZA 4WFNL 1JLBA 1ATNA 3M8PA 4H0PA 1S1TA 4HUGA 1U04A 3R6MA 4FWKA 1C0GA 5F2RA 3HXMA 1X9MA 3HOTA 1REVA 4PKGA 4CHPA 1RT1A 3I56N 3VQAA 3SI6A 4CBWA 3H6EA 3CI5A 2DFHA 4CGIA 3EKUA 2G8VA 3CCLN 4H5NA 1WBDA 4JI7K 3VMFB 2E2PA 1QS4A 2X6NA 3U3YA 3EYZA 5GIOA 4CHOA 1NKBA 3ULEB 1RTDA 1NGIA 3CJ7A 4XH5A 3CQYA 4FJMA 2E1YA 4DV7K 2IVNA 4CJ5A 1WLJA 4CZEA 1SV5A 3ENHA 2O8CA 2P9UB 3L3VA 4GW6A 3VESA 4FJ5A 3KK1A 3L2QA 1E4GT 3LWMA 4CJ3A 3PLAA 4O0IA 1C0MA 5HRNA 1KFSA 2P9KB 2P5GA 2BTFA 4FL9A 5ADXA 4MO4A 4BGAA 3LZJA 3U8XA 2F96A 4DR6K 3IDHA 2FF6A 3CXCM 2QXFA 4JHDB 3V9UA 1Q86O 4JKEA 3CFPA 4KV8A 3VENA 4X65K 2ZJPL 5FROA 1T7PA 3ZETB 5LJVA 1RT5A 2HBMA 4DV0K 2HF4A 4CJPA 3CC2N 2DY4A 3O8MA 5CE3A 4R5PA 2RF2A 4FJKA 4DU1A 3SUQA 3KVGA 3LDLA 3T69A 3T19A 4IFYA 1RDCA 1VSKA 1DKGD 2O8BB 2W6LA 3NF9A 2DTUA 2I7PA 3T1HK 3SQ4A 5FLXO 2J4RA 3ULEA 3B6PA 4O5BA 2V7ZA 3DLLL 3FFKB 4KAZA 1NNEA 1J5OA 1HNVA 2RHKA 2P9UA 5KRTA 1M90O 5AQPA 4GV6A 1XC9A 4MLEA 1ZXOA 4ICLA 4F4KA 1J6ZA 1JLCA 5FPEA 1V4TA 1GLCG 3QDKA 1DTQA 1LAVA 3QB0A 1ZBSA 3WNHA 1MDUB 4I2QA 4M45A 2P9KA 4BC2A 2EHGA 4QAGA 3IG1A 3VQ9A 2D0CA 3AVNA 3S3MA 4RW4A 2QWRA 1EWRA 4M3ZA 3E01A 5CZ1A 1JJ2M 2HVIA 4BRAA 5J2MA 2FBXA 4JHDA 1HYVA 2FBTA 3ZCMA 4KFBA 4O5FA 1KQSM 2Q36A 4PKHA 4JI6K 5HBMA 3ZETA 4EAHD 4NLCA 2F8TA 4O44A 2QTDA 3HZ6A 5AQNA 3KZBA 3M1FA 1NGFA 3V9SA 4BWJA 2D4WA 4DLEA 3A5MC 1RT2A 2O8BA 3SBGA 4ELUA 4DKWA 3H08A 3SJHA 3QETA 1ZC6A 3MXMA 2GUIA 3VQBA 1GLBG 4BC4A 3HRGA 1NGCA 5GAGP 2ASOA 1YVUA 5BREA 4O4GA 4CCHA 1JKHA 2IAJA 3HPHA 4GVMA 4N56A 3PIPL 4FSVA 5M1NA 4Y1CA 1QQMA 2DPNA 5AQFA 1KFDA 3DWLA 4Z4FA 4W5QA 1QE1A 3VQPA 4PWDA 3J7AP 1N32K 1HKBA 4DWIA 4FLUA 4DTRA 1OH7A 2FXUA 4CIEA 1XNQK 3ZT0A 1EXQA 1SKRA 4N41A 4FVUA 3LAMA 2ZJRL 3ZSRA 1X3NA 3B8AX 3CM5A 3AO3A 1KXPA 5KGXA 2WONA 1RDWX 1VSEA 3W3DA 3TAPA 3CC4N 1XWLA 4WE1A 5SWMA 4CZHA 3O1BA 4BR7A 4EHUA 2YKMA 2F4VK 1DEJA 4FLTA 2QW9A 4B3MK 3QERA 1C1BA 5EVZA 3O9QA 2HB5A 4KTQA 3D2EB 1I3AA 1HR0K 3VQ7A 3ZSXA 4K43A 1ITGA 2KHOA 3TSUA 4H5TA 5IT9O 2A42A 5EXWA 4BRPA 1UAXA 4RW6A 4LFAK 3VQDA 1HYSA 3KKRA 5AQRA 5AQJA 1Q18A 4DQ8A 3ZSYA 4DFKA 4B9MA 3I0RA 4CJFA 3TSQA 3TARA 3EKSA 2UXCK 3L2WA 1ESVA 3R9PA 4BRFA 1N5YA 3AVIA 4IKFA 1NWKA 4KREA 5J1EA 3QEPA 4CJKA 3LDSA 3S3OA 3RR7A 4IOCL 5J2PA 1K9MO 5HOOA 5GAHP 2BE2A 4FWRA 4KTWA 1ZBFA 3LDNA 5I42A 1S3XA 3SPZA 3LWLA 4OPHA 3C6HA 2E2OA 3GBTA 4C1NK 5LMNK 1C6VA 4F2SA 3J8AA 3K5OA 4YDUA 3AVGA 3AO2A 4CK1A 1YITN 4FJ7A 1S9EA 3MN5A 3HVTA 5EOYA 1NLVA 5M1FA 3KLHA 5LL6Z 4BR2A 4WYBA 1LWEA 4BRIA 5ELZA 4J2BA 3OHRA 4FK0A 3K5LA 3D2EA 1SKSA 4PQUA 1T44A 2NLXA 3BZCA 3LM2A 3ID6A 3K59A 2B6AA 3L2VA 1SQKA 4I6MB 4H0TB 5CR4A 3PSIA 3MAQA 4DHYA 2QWMA 4CFDA 3DMJA 5JVGL 2XO7A 1IG8A 2WBNA 1N36K 1KVBA 1K8AO 2HHQA 1RGIA 1DT9A 2VG6A 4AM7A 4CF0A 2I5JA 3KLGA 1BISA 5SZTA 1WN7A 1QSYA 3IRXA 3TTFA 4YFUA 3CJ9A 1NK9A 4FLYA 1RFQA 4LD0A 4KHWA 4BVPA 2YNHA 1X9WA 1FKPA 4BE1A 2CH6A 3QFPA 4JI3K 2E5LK 3TAFA 1NJIO 3RSEB 2EX3A 2NUBA 3LALA 4ILJA 4DLGA 4DTMA 4CJWA 3RMAA 1LAWA 3M8RA 1RILA 4PY5A 4GKKK 3CCSN 3LDQA 4WQ5C 5F0XA 4BRQA 4FWNA 5AQZA 5BRDA 4NCAA 3ITHA 2BANA 2KKZA 4I9QA 1JL1A 4B3OA 2IVPA 3LP0A 5KPRA 4YOUA 1S6PA 3MX5A 4KB1A 1A5VA 1RBVA 4CF8A 5DM6L 1YAGA 2DFFA 2Z1GA 3JYTA 4BDYA 2KZZA 4Z4GA 4CK3A 4I6MA 4MFBA 2HHTA 1IO2A 2PYJA 3NDKA 2ZF5O 4FW1A 4HUEA 2O8EB 1TK5A 3L0QA 4XEIA 5TKWA 1IG9A 3OYJA 4J2AA 3PO4A 2UU9K 4PUOA 1FW6A 3HBTA 3TTDA 3N4PA 4DTJA 4OLAA 3I55N 5HP1A 3E66A 4B9QA 3VGMA 3OS2A 3QEWA 4N47A 3P1GA 3ENBA 1KLMA 5BR9A 3G10A 2W40A 3CQ8A 3LM9A 3WQUA 1M1KO 1SZ2A 3RSEA 4DTSA 3DLEA 3WXLA 4NXNK 2E8AA 1E3MA 3OYNA 3H3OB 2A1SA 3ZLJA 2HSTA 3O6WA 3OYHA 5GIPA 1N8RO 1U4BA 2AJQA 2GBZA 4DV3K 5AQVA 4Z4HA 2ZGZA 3AGRA 4DR7K 2GX9A 3SMSA 4O0JA 3VQCA 1VSLA 3OYAA 1TK8A 4B3RK 3W0LA 3EN9A 3OW2M 1DLOA 1IKYA 4CFCA 2HW3A 2RPIA 1NGBA 1KAZA 1SAZA 5C15A 2O8EA 3LL3A 1WNSA 3TAGA 4B9UA 3HYFA 4HVJA 2AP1A 4IOXA 1Q8IA 1U49A 1XHXA 4KHNA 2Q0UA 4E1JA 4QOZB 3LANA 3V9XA 4J8FA 4GMJB 2XY8A 2OA8A 1Z25A 3VQ8A 1BU6O 2Z1IA 4CEEA 1BG3A 5AJ3K 2HHUA 2FBVA 3DM2A 3SV4A 4BE2A 3FLCO 1S1VA 1JLQA 1HX1A 3ATUA 4LSNA 3HP6A 1CXUA 5KTQA 3QLHA 4KTZA 2OTJN 3OYBA 1BGXT 4CD1A 5HLFA 3OYEA 4EP5A 5BN9A 3VQ4A 3O80A 3DYAA 4B1WB 1X9SA 3OYMA 3FZKA 3AVFA 4ISFA 4KHSA 2X74A 1HNXK 4JI2K 3VF4A 1ZBHA 2VYPA 3MEDA 4DG1A 1KCFA 3JAMO 2KTQA 5AQYA 4LFBK 4DFPA 2G8FA 3ZSWA 1W7AA 1VQ6N 1HRHA 3G0ZA 3MXJA 2G8UA 3K5MA 2H3GX 2PFUA 1S72N 1W2BM 3HSTB 3BF1A 3M8QA 1ZBIA 2G8WA 4FLVA 4B3TK 4B1YB 4JKGB 4E3SA 2GUPA 4WQ4C 4E7LA 4R79A 2W6KA 5BR8K 4M42A 3O4WA 3OYFA 1GLEG 4AILC 1QSSA 3ZX0A 3ZEUB 4CZKA 4FOEA 3MEEA 4C1NI 4E19A 3N4QA 3AVCA 5JVHL 3SQ1A 2Z1JA 5C0YA 1JLAA 5H1SQ 5B8HA 4H03B 1NKCA 3SAGA 1VAZA 4ZTFA 2FF3B 1NGDA 1C0UA 4FYDA 4KH4A 1WSJA 2HHXA 4BC5A 4CJUA 3VETA 4IFVA 3CJ1A 3ZT3A 4M3UA 5C12A 2HBJA 4GV3A 4IDKA 4ZTJA 4YOXA 4E7HA 1UA1A 3A8YA 3TWHA 3B6OA 1HJOA 4UQGA 4E7IA 4X62K 2GELA 4LF8K 4M3RA 3QIPA 4CJEA 5HRSA 4BROA 4NB4A 4LC9B 4OJRA 4DR1K 1Z26A 2ITGA 1ZBLA 2NZTA 2IC3A 4CEFA 4A2BA 4WFAL 3CFRA 5CYQA 3P38A 5HL7L 4RW7A 4B9NA 4JKGA 4CVNE 3IFRA 4JRQA 4FVMA 1NGGA 5J2NA 1N33K 2RN2A 4OLBA 1XQSC 3CFOA 3ZEUA 5GINA 5F1XA 1WB9A 2Y1JA 3DOLA 3BDPA 3O4QA 1Q9XA 4CHQA 1D9DA 3ZSVA 3IMXA 3OYGA 1J53A 5CY4A 3VTIA 3OTOK 2XY6A 4N76A 1VRTA 3VPZA 4M63C 3RRGA 1W97L 2D0AA 3VA0A 2P9LB 3KHYA 1TKDA 3MWPA 1S22A 4IO8A 1TKZA 2ETJA 5ADXH 4FLWA 3TSPA 3OYIA 3RMCA 1HMVA 2FSNA 5HRRA 4BR5A 3G71N 3ZSZA 4FPBA 1O13A 3KLFA 1NGEA 5AQSA 2HNYA 3A5OC 4W5TA 5AQHA 4K0KK 1TVRA 2YX6A 3GL1A 4HHTA 1YJNN 2XRIA 2WFBA 4CFAA 1QQNA 3HT3A 3I33A 4M41A 4CF2A 4JN4A 3LAKA 1WSIA 3SAHA 4A62A 3JSMA 1HPMA 3IAYA 3NH2A 5BPMA 4DMNA 2EWSA 2OANA 4CJLA 4C8MA 1O1WA 4JS5A 2Q1NA 4OPJA 4RWTA 5DM7L 4LF9K 2GV9A 2QM1A 2OTLN 2E6MA 1TAUA 3CPWM 2P9LA 1QHTA 3CCMN 1S1UA 1J9AA 1H1VA 4H0YB 3NHGA 1KVAA 2P9SB 4DSFA 1YJ9N 3LDPA 4KI4A 1CLQA 2YJEA 1L3TA 4C8OA 3UE5A 3TAEA 3KK3A 1X1PA 4EZ6A 2FC0A 4KKOA 3KD5E 4KB0A 3SUPA 4JKDA 4KPYA 3HSCA 4BRMA 3RMDA 2V51B 5C42A 4MLHA 4FJ9A 1XHZA 2QWNA 4E7JA 3AV9A 2QWLA 1OKJA 4FLXA 2A3ZA 1L3SA 3TPQA 2VWJA 3R1XA 3WXJA 3SUOA 4DF4A 3M5RA 3HTVA 4CZGA 5I9EB 2D0OA 4BVOA 2F8SA 4E89A 1X9JA 2GEMA 4JI1K 4H4MA 3IKMA 3MMVA 1BO5O 1XC3A 3K9KA 4DSJA 5AQXA 1R0AA 3OS0A 4DSKA 4AF1A 4MQ3A 5T7BA 2P9SA 4CK2A 4Z4EA 1IKXA 4Q5VA 4CJ7A 1EX4A 4DTPA 2AA4A 3F2KA 1TKXA 4DV1K 3MN9A 2IDOA 1RDAA 3E1YA 3Q7BA 1T8EA 2NRTA 4DR4K 4ID1A 4DS5A 3S9HA 1IH7A 3SQ2A 3CYMA 4FJJA 2JWKA 2RE2A 1S9GA 2IGIA 4FM1A 5M1KA 4DQRA 1BL3A 3NMUA 4O8KA 3I8DA 4BE0A 3KLIA 4CE9A 1WSFA 3U9ZA 1IKVA 4HUFA 2WTUA 1ZBUA 4GY2B 5M1OA 2Q0RA 3CIPA 3HM9A 2BGGA 1RNHA 1VQON 2BDPA 3AVHA 1HJRA 5C2DA 4FLZA 4CIFA 4F3OA 1YJWN 3WEEB 1HLUA 5AZJB 2A1RA 1GLJO 1BDGA 2E2NA 2ZWHA 1VSFA 3HOSA 4OPKA 4MO5A 3OYDA 4AHUA 4I7FA 5KPZA 2D0BA 4OPAA 2P9IB 3BF3A 4BRGA 2YNGA 3WXKA 1QHAA 2PY5A 2NRXA 4EIAA 2XY7A 1OH5A 5BPNA 4YDUC 2G8IA 3R3LA 3PUFA 3K2PA 3O3FA 1XI1A 2VCPA 4Z4CA 5FRMA 4X64K 1LWFA 4IEIA 3MXIA 4DR3K 4IOAL 1KAYA 2ZJQL 4K42A 4H5RA 1YIJN 4NO7A 3A5NC 3MDQA 1CZBA 1P90A 4CEBA 2VG5A 3SQ0A 3RR8A 1WAFA 4PL7A 4V19S 4B1UB 3LP2A 4CZLA 3P4IA 4JI0K 4QCLA 4Y0WA 1B9DA 2DFEA 5AQGA 3F5TA 5FDLA 5LJWA 1NM1A 3FGUA 2VG7A 4CHNA 3CD6N 1VSIA 1X3MA 3M6GA 3CETA 5AQQA 1DTTA 3C7NB 1RDDA 3O9RA 1RTJA 3EE8A 4HTUA 3T1YK 2D1KA 3ZX3A 3WEEA 3S41A 2P9PB 4JS4A 2X78A 2UXBK 3OA9A 4H8KA 5AZJA 1NJZA 2OPPA 1VQNN 3BZKA 3QEIA 5K14A 4K8XA 1BUPA 4PKIA 3OBYA 4H0XB 3G6EN 3AARA 1MA9B 1B9FA 4CZFA 4HWIA 3V9WA 1HKCA 4B08A 3UKRB 4AM6A 2P9IA 3SJJA 4BDPA 3C95A 2O4GA 5M1QA 2Y1IA 3NGZA 3TTCA 3AAPA 2HNDA 5AQUA 1IBMK 2CGKA 3VTHA 5KRSA 4PHTX 4RW8A 1RBUA 2V52B 3CPEA 4FK4A 4BR9A 3NH0A 4DS4A 3CQXA 4L8RB 2PZSA 4W5RA 4C8KA 2KZMA 3U6FA 1NGAA 2FSKA 1NOYA 3L2RA 4AQYK 1IV0A 3AAQA 1NJXA 1OVQA 4O55A 4CEAA 4IG3A 4DTNA 3KWIA 3MN7A 3PX4A 1Q82O 3J80O 3AY9A 2UUCK 4CESA 2GWJA 3SAFA 3ZT1A 3C7NA 1JCGA 3EO3A 4FWQA 1L5UA 5JICA 3U9DA 2E20A 2P9PA 3OYCA 4H5WA 1BOTO 4I9LA 2OZMA 4JKAA 1BQNA 4LF5K 3THVA 3JS6A 2YCHA 3K58A 1EETA 4CF9A 1MWKA 3PX0A 1N34K 4H0OA 3KKSA 4JAXA 3UKRA 1TKTA 1KRPA 2D0PA 1NK6A 4KRFA 3ZSQA 3BUZB 2UUBK 5KI6A 3BY5A 3O5BA 1NK5A 4FZXC 4QS7A 2ITMA 3DJCA 3P5JA 4HTLA 1LCUA 3K9JA 3NAEA 3SUNA 3AVKA 4BRCA 3V6DA 4CI6A 3ZSOA 4IZ9A 2QWPA 1NJYA 5FPMA 3CJCA 4I2PA 2HHSA 4JI5K 4DUZK 3Q7CA 4G1QA 4B9SA 2NRWA 4BWMA 1RDUA 3V1OA 4HCBA 2UXDK 3VQ6A 4B9TA 1VRUA 1K73O 1SL0A 2KFNA 1T05A 4K25A 4W5NA 4DUYK 2B4JA 3C65A 3WQTA 3KTQA 1J5EK 3K57A 2LSNA 4A59A 3CJBA 1TL3A 1U2VB 3THYB 3VEWA 4B8CA 1T6CA 3HM8A 3WNEA 4B3SK 4CBUA 1TUUA 1E4FT 4IFEA 3O3HA 4TSXA 4CEZA 4JK9A 3GDQA 4OGCA 2A6AA 1BIUA 1WSEA 3A2FA 4BRKA 4K8ZA 4G9ZA 1WUAA 2GTDA 4LFCK 3AVAA 3D6RA 4JKHA 3HP9A 1QZ6A 2E88A 1QSLA 2HVHA 4B1XB 5AQLA 2KW4A 1NK4A 4O8UA 4J2EA 4Q0BA 1HNIA 3C6AA 3OJUA 3FZLA 3KIOA 1WOQA 3A0IX 4LF4K 2XHBA 2WC9A 4BY9C 2E6LA 1YUWA 4AH9A 1D5AA 5JMVA 3M3ZA 3NFAA 1Y97A 4NYNA 3DXKB 2YHYA 4IO9L 2O8FB 1N6QA 1ATSA 1GOAA 3ZT2A 3BP8A 3L3UA 1YXQA 1VSDA 5LMUK 3AVMA 1C1CA 4H0VB 2HBKA 3VQ5A 1R59O 1U2VA 3THYA 4L3QA 1ASWA 3MCAB 2HHVA 1LOTB 1Z05A 5EU7A 4LF6K 3PIOL 1JCEA 2HBLA 3CMAN 4JLHA 1BA0A 4CGJA 1VQPN 1U47A 1QQOA 4WFBL 4PL8A 2OYQA 2OZSA 1HPZA 4BG8A 3EL2A 1ATRA 2YKNA 2NNWA 4GKJK 1BI4B 1XMOK 2F9TA 4XIUA 2QK9A 1FKOA 1UA0A 1Q9YA 3MECA 3L4IA 4BG9A 2X6SA 3C0BA 4EFHA 3HPGA 1QZ5A 1WBBA 4WF9L 2O8DB 2PYLA 5MLCQ 3MWTA 1D9FA 3HPOA 3EE9A 3QINA 3QNOA 3G25A 1NK0A 1RBTA 4PA1A 3VF6A 1NG9A 4KHYA 4CIGA 3CCRN 4Z4IA 4CGDA 4BRNA 3DXKA 4FWPA 1HYZA 3ZT4A 2O8FA 2VQEK 2YHBA 4DTUA 1HQEA 1WSGA 3FZMA 4Z0UA 4U7BA 1T3VA 4AHVA 4CGHA 2IVOA 5CYMA 3RWUA 1WSHA 3L6QA 3VF2A 3O4NA 1HNZK 4OKKA 5FPNA 5M1PA 4FJNA 1EWQA 4FWOA 1LW0A 4Z94A 2YV0X 1KC8O 4OGEA 4ISEA 3DLRA 1BIZA 1RCHA 4CW7B 1FXXA 3I0SA 4JKCA 4CJQA 4KBOA 5AQIA 5GAEP 3THWB 4JK8A 1Y64A 1BI4A 3HO1A 1BHLA 4B9LA 3TR8A 4IXCA 3AVLA 4B1VA 3CHWA 2W41A 2OPRA 3D0PA 1CXQA 3AA5X 2UYTA 3DI6A 4KHUA 4IBNA 3CG7A 2O8DA 3AVJA 1VQ9N 2PBDA 3O1WA 5IWAK 3RRHA 4FW2A 1S1XA 2HMPA 2Q31A 3DLKA 4ILGB 1KSPA 3MEGA 4BC3A 3K5NA 3G4SN 3QO9A 4CHZA 5FRNA 3PSFA 5J2QA 1VHXA 4XH1A 5DMRA 2QWOA 2ASMA 3VERA 3JXUA 1C1AA 2Q97A 4JI4K 4DCHA 3OVNA 2A41A 3MK6A 3QBWA 3TAQA 4OVLA 4FWSA 3VN5A 1Z6RA 4FM0A 4C8LA 3UIQA 4DF8A 3GE1A 5KQDA 1MU2A 3VA3A 3J81O 1K8KB 4DSEA 1BCOA 1ILYA 3THWA 1ZYQA 3QNNA 4FZZA 1T03A 4RCHA 1P8ZA 3QBXA 4ZHRA 4CZJA 4MDBA 4C8NA 3VEXA 4FK2A 1S6QA 1F21A 5AZIB 3FR0A 4FPAA 3NGYA 1LWCA 5FPDA 5I3UA 1GLDG 4DV5K 3ISNC 3TAMA 1BCMA 5BRHA 5TKYA 1GOBA 4CD3A 3BEXA 5E84A 4CERA 4F3TA 3H3NO 4DQSA 2E4LA 3HVRA 4KHQA 4JKBA 4F8RA 5A2QO 4ELVA 3C94A 2ZD1A 2G8HA 3SLCA 3NE6A 1UWBA 4CGGA 1XMQK 3L4QA 3CCEN 5AQTA 4JK7A 3AO4A 4DSIA 4FXDA 2P9NB 4M7XA 3EY1A 3HI0A 3J7YP 1KVCA 3MN6A 5C2FA 4DQIA 1QTMA 3SV3A 4E7KA 1VQKN 4RTFD 1K8KA 3V9ZA 1NOZA 3NVMA 4GV9A 4DR2K 3UB5A 4DTXA 2NRZA 3P31A 4GNIA 2P5OA 2YI1A 2HHHK 3CCVN 3V1QA 1VQ7N 1SL1A 4JD2B 4KH5A 5AZIA 3TABA 3MX2A 3T1AA 2QXLA 4YY3K 3NF6A 3LZIA 2CGJA 1GLFO 4BR4A 1EKEA 2NRRA 4DU4A 3AA2A 4YOTA 4NLBA 1YHQN 4JV5K 3SBTA 3WXMB 1HUXA 5C25A 3CMEN 1EO1A 1S5JA 3CM6A 3VQQA 4EHTA 5AR0A 3QMLA 3V81A 4FJLA 1S1WA 3U4LA 3PY8A 2FSJA 3VEVA 2OCEA 2KLAA 3QIOA 1W9HA 3OY9A 2KFZA 1CZAN 3ZX2A 5AQMA 4ID5A 3CCJN 2V7YA 3H1VX 4YORA 1NKEA 4YOWA 1D8YA 3TI0A 3NH1A 3AGKA 4JYAK 4IJAA 1QVFM 1RT7A 3OYKA 3CERA 2YNIA 2NRHA 5GADP 2P9NA 4QS9A 5CZ2A 4CEDA 4YHHK 4FJHA 3H45C 2VGNA 1YTAA 4OKEA 1K6YA 4BR0A 3EZWA 3WNGA 1TV6A 4JD2A 1SUQA 2PAVA 5AQKA 3KD1E 4KHPK 3SCXA 4RW9A 3SNNA 1G99A 1NGHA 3KWGA 4BRLA 1TK0A
chains in the Genus database with same CATH topology
2F96A 3M8QA 4CF9A 3PX0A 3SPYA 1ZBIA 3KKSA 2G8WA 4FLVA 1TKTA 1KRPA 2QXFA 4E3SA 3V9UA 4E7LA 1NK6A 4LH4A 4KRFA 3CFPA 4KV8A 3ZSQA 1CZ9A 4NYFA 1RTIA 5FROA 1T7PA 4M42A 3OYFA 2OPQA 4AILC 1RT5A 5KI6A 1QSSA 4CJPA 1NK5A 2DY4A 4R5PA 2RF2A 4FZXC 4FJKA 3NF7A 4EP4A 3MEEA 4OKJA 4E19A 4DU1A 3SUQA 4CJTA 4DQQA 1SKWA 3KK2A 3P5JA 3AVCA 3SQ1A 2Z1JA 1JLAA 1NKCA 3T19A 3NAEA 3AA4A 4IFYA 3SUNA 1RDCA 1VSKA 2Z1HA 4ZTFA 3NF9A 1VK0A 3AVKA 1VSJA 3V6DA 2DTUA 1C0UA 3SQ4A 4FYDA 3ZSOA 1RT4A 4YNQA 1WSJA 3B6PA 4O5BA 2HHXA 1NJYA 3LP1A 4CJUA 4KAZA 4FCYA 4IFVA 1J5OA 3ZT3A 4Y1DA 2QKKA 1HNVA 4M3UA 2ZE2A 4I2PA 5KRTA 3DOKA 2HHSA 3IS9A 4IDKA 4ZTJA 4G1QA 4B9SA 4E7HA 1XC9A 1UA1A 4BWMA 4ICLA 3TWHA 3V1OA 3B6OA 4CJSA 4UQGA 4F4KA 4E7IA 4HCBA 4M3RA 3QIPA 4CJEA 5HRSA 4B9VA 1JLCA 3VQ6A 4FJXA 4B9TA 1I39A 2IOCA 1VRUA 4OJRA 1JL2A 1DTQA 3HJFA 1Z26A 1SL0A 4FJIA 1LAVA 2KFNA 1T05A 4W5NA 3WNHA 4I2QA 4CECA 2QKBA 2B4JA 4M45A 2ITGA 4CJRA 2EHGA 2KQ2A 1ZBLA 4QAGA 3IG1A 3VQ9A 2D0CA 3AVNA 3S3MA 2IC3A 4RW4A 4CEFA 3KTQA 4M3ZA 3E01A 5CZ1A 3DLBA 3K57A 2LSNA 3CFRA 5CYQA 2HVIA 1TL3A 5J2MA 2FBXA 4RW7A 4B9NA 4B8CA 2ZQBA 1HYVA 2FBTA 3ZCMA 2W42A 4KFBA 4JRQA 4E1MA 2YHAA 3WNEA 1JXBA 2O4IA 4FVMA 5HBMA 2JGUA 3HL8A 4NCGA 5J2NA 2RN2A 4OLBA 1LV5A 2P1JA 2F8TA 4O44A 3O3HA 3CFOA 3P83D 4TSXA 4CEZA 1TAQA 4OGCA 2RKIA 4DU3A 1BIUA 1WSEA 3DOLA 1W0HA 3A2FA 4BWJA 4DLEA 3O4QA 3V9SA 2Y1JA 1Q9XA 4K8ZA 4M3XA 4CHQA 1RT2A 3AVAA 4ELUA 3DRRA 1D9DA 4FJGA 2HHWA 3HP9A 3H08A 3ZSVA 3QETA 1U48A 3MXMA 4EZ9A 3OYGA 2GUIA 3VQBA 1J53A 5CY4A 3M8SA 1YVUA 4O4GA 4CCHA 1QSLA 2HVHA 1RT6A 2KW4A 1NK4A 4KO0A 2XY6A 4DSLA 4J2EA 1HNIA 1VRTA 3OJUA 1QQCA 4N76A 4Q0BA 3RRGA 3KIOA 1JKHA 2D0AA 2IAJA 3HPHA 4GVMA 3OJSA 2WOMA 3VA0A 4N56A 2XHBA 1TKDA 4Y1CA 3D45A 2E6LA 3TANA 4PWDA 4AH9A 1D5AA 1TKZA 2ETJA 1G15A 3BGRA 1KFDA 3NFAA 1Y97A 4NYNA 1QE1A 3VQPA 4W5QA 4FLWA 1NK7A 4Z4FA 3OYIA 4DWIA 3RMCA 1N6QA 4FLUA 4DTRA 4CIEA 1GOAA 1HMVA 5HRRA 3ZT2A 3ZT0A 1EXQA 5HRPA 3L3UA 3ZSZA 4BACA 3LAMA 3KLFA 1SKRA 4N41A 3ZSRA 3RTVA 3EZ5A 1VSDA 3CM5A 3L2UA 3AO3A 3AVMA 5KGXA 2HNYA 1C1CA 1VSEA 2WONA 4W5TA 3TAPA 1XWLA 3VQ5A 4WE1A 5SWMA 1TVRA 1ASWA 2HHVA 4CEOA 2HNZA 4HHTA 2YKMA 4NCBA 4N5SA 2XRIA 4CGFA 4FLTA 5EU7A 4CFAA 3HT3A 4LH5A 3NCIA 3QERA 4M41A 4CFBA 4CF2A 1C1BA 4JLHA 4CGJA 2HB5A 3BDPA 4KTQA 5KGWA 3LAKA 1WSIA 1I3AA 1VSMA 1U47A 4DFMA 5C24A 2OYQA 1RBRA 3VQ7A 3ZSXA 4FM2A 2OZSA 1HPZA 3JSMA 3IAYA 1ITGA 3NH2A 3ULDA 1KLNA 1C0TA 4E0DA 2YKNA 4M3TA 4DMNA 4E1NA 1BI4B 1UAXA 4RW6A 1JXEA 3VQDA 4CJLA 1HYSA 3KLEA 1L3VA 3KKRA 4C8MA 4XIUA 2QK9A 3ZSYA 2IS3A 1FKOA 2JLEA 4DFKA 1O1WA 1UA0A 3I0RA 4CJFA 4JS5A 3MECA 1Q9YA 4B9MA 4OPJA 3TARA 2Q3SA 2GV9A 3FFIA 2X6SA 3L2WA 1L3UA 3HPGA 3VQEA 1N5YA 3PO5A 4J2DA 3AVIA 4IKFA 4KREA 5J1EA 3QEPA 4CJKA 2E6MA 2PYLA 3LDSA 3S3OA 1D9FA 3RR7A 1TAUA 1QHTA 3F9KA 1TL1A 3HPOA 1S1UA 3QINA 3QNOA 1J9AA 3NHGA 1RBTA 4PA1A 1NK0A 5J2PA 1KVAA 4DSFA 4KHYA 3AA3A 4CIGA 2BE2A 4KI4A 1CLQA 4Z4IA 4KTWA 4CGDA 2YNFA 4AHTA 1ZBFA 5I42A 1L3TA 1HYZA 3ZT4A 3SPZA 4F2RA 4C8OA 3LWLA 4DTUA 2YHBA 4AHRA 1HQEA 3TAEA 3KK3A 1X1PA 1WSGA 3S3NA 4Z0UA 4EZ6A 2FC0A 4KKOA 4KI6A 1C6VA 4F2SA 4AHVA 3KD5E 3K5OA 3SUPA 4KB0A 4KPYA 4CGHA 4W5OA 5CYMA 3AVGA 3AO2A 1JLGA 4JRPA 3RWUA 4CK1A 4FJ7A 1S9EA 1WSHA 4CJVA 3RMDA 3HVTA 2HMIA 3U3GA 3KLHA 5C42A 3O4NA 1LWEA 4OKKA 4FJ9A 5HROA 4BDZA 4FJNA 4J2BA 1YTUA 1LW0A 1XHZA 2YV0X 3K5LA 4E7JA 4LSLA 4FK0A 3AV9A 4OGEA 1SKSA 5JS2A 3DLRA 4FLXA 4PQUA 1UOCA 1L3SA 1BIZA 1RCHA 5JS1A 1FXXA 3I0SA 4CJQA 1YT3A 2VWJA 3WNFA 3SUOA 1BI4A 3V1RA 3K59A 3HO1A 3AO5A 3NGIA 4DF4A 1BHLA 2B6AA 3LPUA 4B9LA 3TR8A 3L2VA 3AVLA 1RTHA 2OPRA 3D0PA 3O3GA 1CXQA 2F8SA 3AA5X 1BQMA 4E89A 3MAQA 4H4MA 3DI6A 4CFDA 4KHUA 3DMJA 4IBNA 2XO7A 3CG7A 3DLGA 1KVBA 3AVJA 4DSJA 4CHYA 3HK2A 2HHQA 1R0AA 3OS0A 3DRSA 4DSKA 3RRHA 4MQ3A 5T7BA 2VG6A 4FW2A 1J54A 1S1XA 4Z4EA 4CK2A 1ASVA 1IKXA 3DLKA 4Q5VA 1KSPA 1EX4A 3LP3A 3MEGA 2I5JA 4CF0A 3KLGA 1BISA 5SZTA 3K5NA 4DTPA 1WN7A 1QSYA 1TKXA 3IRXA 4YFUA 1NK9A 3QO9A 4CHZA 5FRNA 4FLYA 1TGOA 3PX6A 2IDOA 5J2QA 1RDAA 4LD0A 4KHWA 1T8EA 1JLFA 2YNHA 2G8KA 4ID1A 5DMRA 4DS5A 1FKPA 4BE1A 3QEVA 3S9HA 1IH7A 3OYLA 1X9WA 3ALYA 3TAFA 3SQ2A 1C1AA 3CYMA 2EX3A 3SZ2A 2NUBA 4FJJA 3LALA 4DTMA 1S9GA 4DLGA 2IGIA 4CJWA 4FM1A 2B5JA 1BL3A 1RT3A 4DQRA 3V4IA 3RMAA 3I8DA 1LAWA 4FZYA 3M8RA 1RILA 4PY5A 3OVNA 3RMBA 2OPSA 1A5WA 1IKWA 3KLIA 4AHCA 4OVLA 4CE9A 3F73A 1WSFA 1ASUA 5DK5A 3ITHA 2BANA 3VN5A 4B8AB 4FM0A 4C8LA 4NCAA 1IKVA 4HUFA 3UIQA 4I9QA 1ZBUA 3DRPA 1JL1A 4DF8A 1WAJA 4B3OA 4M3YA 3HM9A 1MU2A 3LP0A 3VA3A 3L8BA 4DSEA 2BGGA 1RNHA 1BCOA 1S6PA 4DFJA 1NJWA 1A5XA 1ZYQA 4KB1A 1A5VA 1RBVA 4CF8A 3QNNA 1T03A 4FZZA 2BDPA 2DFFA 1HJRA 2Z1GA 3AVHA 3JYTA 1HQUA 4CIFA 4ZHRA 4BDYA 4FLZA 4F3OA 2KZZA 2ATQA 4Z4GA 1FK9A 4C8NA 4CJ4A 4CK3A 4MFBA 2A1RA 4FK2A 1S6QA 1IO2A 1F21A 2HHTA 2PYJA 3NDKA 4HCCA 3NGYA 4FW1A 4HUEA 1LWCA 1VSFA 4IG0A 3AVBA 1TK5A 4RG8A 4OPKA 5I3UA 1SL2A 3ISNC 1IG9A 3OYDA 4FJ8A 4AHUA 3TAMA 1BCMA 4I7FA 2D0BA 3OYJA 1GOBA 2XY5A 2YNGA 3KJVA 4J2AA 3NBPA 3PO4A 3ASMA 3NF8A 4PUOA 2PY5A 4AHSA 2R7YA 2XY7A 4CF1A 2G8IA 3PUFA 4CERA 3K2PA 4DTJA 5HP1A 4OLAA 4F3TA 3O3FA 4CEQA 1XI1A 1U45A 1JLEA 4DQSA 1KTQA 2E4LA 4Z4CA 5FRMA 3HVRA 1LWFA 3MXIA 3OS2A 3QEWA 4KHQA 3OS1A 4N47A 4DQPA 3P1GA 4F8RA 1KLMA 4ELVA 3G10A 5D3GA 3QEXA 3C94A 3DLHA 1CZBA 2ZD1A 3CQ8A 4ELTA 3LPTA 4DTSA 3DLEA 2G8HA 4CEBA 3NE6A 3PV8A 1VSHA 1UWBA 2VG5A 3SQ0A 4CGGA 3RR8A 1RDBA 1WAFA 1RBSA 3OYNA 2A1SA 3LP2A 2VWKA 2P51A 4QCLA 3AO4A 1B9DA 2DFEA 3OYHA 4DSIA 2D5RA 5FDLA 4FXDA 2AJQA 1U4BA 3EY1A 2GBZA 1KVCA 4DQIA 1B92A 2VG7A 1LW2A 4CHNA 3SV3A 5E41A 4E7KA 1QTMA 1VSIA 4Z4HA 4M3WA 3C6TA 3V9ZA 1NOZA 4DTOA 4DTXA 4H4OA 4O0JA 2FBYA 1DTTA 3VQCA 1VSLA 1RDDA 3OYAA 3AO1A 1TK8A 2P5OA 1RTJA 4HTUA 1EP4A 3QESA 3V1QA 1SL1A 4JS4A 1DLOA 2X78A 1IKYA 1GOCA 4H8KA 4CFCA 1NJZA 2OPPA 4LY7A 2RPIA 2HW3A 3C6UA 4BE0A 3TABA 3T3FA 3QEIA 1NK8A 5K14A 3T1AA 3SYZA 4K8XA 1WNSA 3NF6A 3LZIA 3TAGA 1JLBA 3HYFA 1B9FA 4HVJA 4B9UA 3V9WA 1EKEA 1Q8IA 3M8PA 1XHXA 3AA2A 4DU4A 4B08A 1U49A 4KHNA 4QOZB 3SJJA 1S1TA 3LANA 4HUGA 3V9XA 1U04A 4GMJB 4BDPA 3C95A 2O4GA 2XY8A 5C25A 2OA8A 1S5JA 3CM6A 3VQQA 3NGZA 3HXMA 2Y1IA 1REVA 1X9MA 1Z25A 2HNDA 3VQ8A 3V81A 4CHPA 1RT1A 2Z1IA 4CEEA 5KRSA 1S1WA 3VQAA 4FJLA 2HHUA 3SI6A 2FBVA 3DM2A 4RW8A 3SV4A 1RBUA 4BE2A 3PY8A 4FK4A 2DFHA 4CGIA 1S1VA 3NH0A 4DS4A 1JLQA 3QIOA 1W9HA 3OY9A 2G8VA 4LSNA 3HP6A 1CXUA 5KTQA 4L8RB 2PZSA 4W5RA 4C8KA 2KFZA 3QLHA 4KTZA 4ID5A 2KZMA 3OYBA 1BGXT 3U6FA 1NKEA 1QS4A 2X6NA 5HLFA 1D8YA 1NOYA 3OYEA 4EP5A 3EYZA 3U3YA 3TI0A 3NH1A 4CHOA 1NKBA 1RTDA 3L2RA 3VQ4A 4FJMA 1RT7A 3DYAA 3OYKA 1NJXA 2YNIA 4CJ5A 1WLJA 4O55A 4CEAA 4IG3A 1SV5A 3OYMA 1X9SA 3AVFA 5CZ2A 4DTNA 3L3VA 4CEDA 2X74A 3PX4A 4GW6A 4FJ5A 4KHSA 3KK1A 4CESA 4FJHA 3L2QA 1ZBHA 1YTAA 3ZT1A 3MEDA 4DG1A 1KCFA 4OKEA 1K6YA 2KTQA 3LWMA 4CJ3A 1L5UA 4O0IA 3WNGA 1TV6A 3OYCA 1SUQA 4DFPA 2G8FA 3ZSWA 1C0MA 4I9LA 5HRNA 1KFSA 2OZMA 1HRHA 1BQNA 2P5GA 3G0ZA 3KD1E 3MXJA 3THVA 3LZJA 3SCXA 3K5MA 2G8UA 4RW9A 3SNNA 3TAQA 3K58A 1TK0A 1EETA 3HSTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F96 A;  3M8Q A;  4CF9 A;  3PX0 A;  3SPY A;  1ZBI A;  3KKS A;  2G8W A;  4FLV A;  1TKT A;  1KRP A;  2QXF A;  4E3S A;  3V9U A;  4E7L A;  1NK6 A;  4LH4 A;  4KRF A;  3CFP A;  4KV8 A;  3ZSQ A;  1CZ9 A;  4NYF A;  1RTI A;  5FRO A;  1T7P A;  4M42 A;  3OYF A;  2OPQ A;  4AIL C;  1RT5 A;  5KI6 A;  1QSS A;  4CJP A;  1NK5 A;  2DY4 A;  4R5P A;  2RF2 A;  4FZX C;  4FJK A;  3NF7 A;  4EP4 A;  3MEE A;  4OKJ A;  4E19 A;  4DU1 A;  3SUQ A;  4CJT A;  4DQQ A;  1SKW A;  3KK2 A;  3P5J A;  3AVC A;  3SQ1 A;  2Z1J A;  1JLA A;  1NKC A;  3T19 A;  3NAE A;  3AA4 A;  4IFY A;  3SUN A;  1RDC A;  1VSK A;  2Z1H A;  4ZTF A;  3NF9 A;  1VK0 A;  3AVK A;  1VSJ A;  3V6D A;  2DTU A;  1C0U A;  3SQ4 A;  4FYD A;  3ZSO A;  1RT4 A;  4YNQ A;  1WSJ A;  3B6P A;  4O5B A;  2HHX A;  1NJY A;  3LP1 A;  4CJU A;  4KAZ A;  4FCY A;  4IFV A;  1J5O A;  3ZT3 A;  4Y1D A;  2QKK A;  1HNV A;  4M3U A;  2ZE2 A;  4I2P A;  5KRT A;  3DOK A;  2HHS A;  3IS9 A;  4IDK A;  4ZTJ A;  4G1Q A;  4B9S A;  4E7H A;  1XC9 A;  1UA1 A;  4BWM A;  4ICL A;  3TWH A;  3V1O A;  3B6O A;  4CJS A;  4UQG A;  4F4K A;  4E7I A;  4HCB A;  4M3R A;  3QIP A;  4CJE A;  5HRS A;  4B9V A;  1JLC A;  3VQ6 A;  4FJX A;  4B9T A;  1I39 A;  2IOC A;  1VRU A;  4OJR A;  1JL2 A;  1DTQ A;  3HJF A;  1Z26 A;  1SL0 A;  4FJI A;  1LAV A;  2KFN A;  1T05 A;  4W5N A;  3WNH A;  4I2Q A;  4CEC A;  2QKB A;  2B4J A;  4M45 A;  2ITG A;  4CJR A;  2EHG A;  2KQ2 A;  1ZBL A;  4QAG A;  3IG1 A;  3VQ9 A;  2D0C A;  3AVN A;  3S3M A;  2IC3 A;  4RW4 A;  4CEF A;  3KTQ A;  4M3Z A;  3E01 A;  5CZ1 A;  3DLB A;  3K57 A;  2LSN A;  3CFR A;  5CYQ A;  2HVI A;  1TL3 A;  5J2M A;  2FBX A;  4RW7 A;  4B9N A;  4B8C A;  2ZQB A;  1HYV A;  2FBT A;  3ZCM A;  2W42 A;  4KFB A;  4JRQ A;  4E1M A;  2YHA A;  3WNE A;  1JXB A;  2O4I A;  4FVM A;  5HBM A;  2JGU A;  3HL8 A;  4NCG A;  5J2N A;  2RN2 A;  4OLB A;  1LV5 A;  2P1J A;  2F8T A;  4O44 A;  3O3H A;  3CFO A;  3P83 D;  4TSX A;  4CEZ A;  1TAQ A;  4OGC A;  2RKI A;  4DU3 A;  1BIU A;  1WSE A;  3DOL A;  1W0H A;  3A2F A;  4BWJ A;  4DLE A;  3O4Q A;  3V9S A;  2Y1J A;  1Q9X A;  4K8Z A;  4M3X A;  4CHQ A;  1RT2 A;  3AVA A;  4ELU A;  3DRR A;  1D9D A;  4FJG A;  2HHW A;  3HP9 A;  3H08 A;  3ZSV A;  3QET A;  1U48 A;  3MXM A;  4EZ9 A;  3OYG A;  2GUI A;  3VQB A;  1J53 A;  5CY4 A;  3M8S A;  1YVU A;  4O4G A;  4CCH A;  1QSL A;  2HVH A;  1RT6 A;  2KW4 A;  1NK4 A;  4KO0 A;  2XY6 A;  4DSL A;  4J2E A;  1HNI A;  1VRT A;  3OJU A;  1QQC A;  4N76 A;  4Q0B A;  3RRG A;  3KIO A;  1JKH A;  2D0A A;  2IAJ A;  3HPH A;  4GVM A;  3OJS A;  2WOM A;  3VA0 A;  4N56 A;  2XHB A;  1TKD A;  4Y1C A;  3D45 A;  2E6L A;  3TAN A;  4PWD A;  4AH9 A;  1D5A A;  1TKZ A;  2ETJ A;  1G15 A;  3BGR A;  1KFD A;  3NFA A;  1Y97 A;  4NYN A;  1QE1 A;  3VQP A;  4W5Q A;  4FLW A;  1NK7 A;  4Z4F A;  3OYI A;  4DWI A;  3RMC A;  1N6Q A;  4FLU A;  4DTR A;  4CIE A;  1GOA A;  1HMV A;  5HRR A;  3ZT2 A;  3ZT0 A;  1EXQ A;  5HRP A;  3L3U A;  3ZSZ A;  4BAC A;  3LAM A;  3KLF A;  1SKR A;  4N41 A;  3ZSR A;  3RTV A;  3EZ5 A;  1VSD A;  3CM5 A;  3L2U A;  3AO3 A;  3AVM A;  5KGX A;  2HNY A;  1C1C A;  1VSE A;  2WON A;  4W5T A;  3TAP A;  1XWL A;  3VQ5 A;  4WE1 A;  5SWM A;  1TVR A;  1ASW A;  2HHV A;  4CEO A;  2HNZ A;  4HHT A;  2YKM A;  4NCB A;  4N5S A;  2XRI A;  4CGF A;  4FLT A;  5EU7 A;  4CFA A;  3HT3 A;  4LH5 A;  3NCI A;  3QER A;  4M41 A;  4CFB A;  4CF2 A;  1C1B A;  4JLH A;  4CGJ A;  2HB5 A;  3BDP A;  4KTQ A;  5KGW A;  3LAK A;  1WSI A;  1I3A A;  1VSM A;  1U47 A;  4DFM A;  5C24 A;  2OYQ A;  1RBR A;  3VQ7 A;  3ZSX A;  4FM2 A;  2OZS A;  1HPZ A;  3JSM A;  3IAY A;  1ITG A;  3NH2 A;  3ULD A;  1KLN A;  1C0T A;  4E0D A;  2YKN A;  4M3T A;  4DMN A;  4E1N A;  1BI4 B;  1UAX A;  4RW6 A;  1JXE A;  3VQD A;  4CJL A;  1HYS A;  3KLE A;  1L3V A;  3KKR A;  4C8M A;  4XIU A;  2QK9 A;  3ZSY A;  2IS3 A;  1FKO A;  2JLE A;  4DFK A;  1O1W A;  1UA0 A;  3I0R A;  4CJF A;  4JS5 A;  3MEC A;  1Q9Y A;  4B9M A;  4OPJ A;  3TAR A;  2Q3S A;  2GV9 A;  3FFI A;  2X6S A;  3L2W A;  1L3U A;  3HPG A;  3VQE A;  1N5Y A;  3PO5 A;  4J2D A;  3AVI A;  4IKF A;  4KRE A;  5J1E A;  3QEP A;  4CJK A;  2E6M A;  2PYL A;  3LDS A;  3S3O A;  1D9F A;  3RR7 A;  1TAU A;  1QHT A;  3F9K A;  1TL1 A;  3HPO A;  1S1U A;  3QIN A;  3QNO A;  1J9A A;  3NHG A;  1RBT A;  4PA1 A;  1NK0 A;  5J2P A;  1KVA A;  4DSF A;  4KHY A;  3AA3 A;  4CIG A;  2BE2 A;  4KI4 A;  1CLQ A;  4Z4I A;  4KTW A;  4CGD A;  2YNF A;  4AHT A;  1ZBF A;  5I42 A;  1L3T A;  1HYZ A;  3ZT4 A;  3SPZ A;  4F2R A;  4C8O A;  3LWL A;  4DTU A;  2YHB A;  4AHR A;  1HQE A;  3TAE A;  3KK3 A;  1X1P A;  1WSG A;  3S3N A;  4Z0U A;  4EZ6 A;  2FC0 A;  4KKO A;  4KI6 A;  1C6V A;  4F2S A;  4AHV A;  3KD5 E;  3K5O A;  3SUP A;  4KB0 A;  4KPY A;  4CGH A;  4W5O A;  5CYM A;  3AVG A;  3AO2 A;  1JLG A;  4JRP A;  3RWU A;  4CK1 A;  4FJ7 A;  1S9E A;  1WSH A;  4CJV A;  3RMD A;  3HVT A;  2HMI A;  3U3G A;  3KLH A;  5C42 A;  3O4N A;  1LWE A;  4OKK A;  4FJ9 A;  5HRO A;  4BDZ A;  4FJN A;  4J2B A;  1YTU A;  1LW0 A;  1XHZ A;  2YV0 X;  3K5L A;  4E7J A;  4LSL A;  4FK0 A;  3AV9 A;  4OGE A;  1SKS A;  5JS2 A;  3DLR A;  4FLX A;  4PQU A;  1UOC A;  1L3S A;  1BIZ A;  1RCH A;  5JS1 A;  1FXX A;  3I0S A;  4CJQ A;  1YT3 A;  2VWJ A;  3WNF A;  3SUO A;  1BI4 A;  3V1R A;  3K59 A;  3HO1 A;  3AO5 A;  3NGI A;  4DF4 A;  1BHL A;  2B6A A;  3LPU A;  4B9L A;  3TR8 A;  3L2V A;  3AVL A;  1RTH A;  2OPR A;  3D0P A;  3O3G A;  1CXQ A;  2F8S A;  3AA5 X;  1BQM A;  4E89 A;  3MAQ A;  4H4M A;  3DI6 A;  4CFD A;  4KHU A;  3DMJ A;  4IBN A;  2XO7 A;  3CG7 A;  3DLG A;  1KVB A;  3AVJ A;  4DSJ A;  4CHY A;  3HK2 A;  2HHQ A;  1R0A A;  3OS0 A;  3DRS A;  4DSK A;  3RRH A;  4MQ3 A;  5T7B A;  2VG6 A;  4FW2 A;  1J54 A;  1S1X A;  4Z4E A;  4CK2 A;  1ASV A;  1IKX A;  3DLK A;  4Q5V A;  1KSP A;  1EX4 A;  3LP3 A;  3MEG A;  2I5J A;  4CF0 A;  3KLG A;  1BIS A;  5SZT A;  3K5N A;  4DTP A;  1WN7 A;  1QSY A;  1TKX A;  3IRX A;  4YFU A;  1NK9 A;  3QO9 A;  4CHZ A;  5FRN A;  4FLY A;  1TGO A;  3PX6 A;  2IDO A;  5J2Q A;  1RDA A;  4LD0 A;  4KHW A;  1T8E A;  1JLF A;  2YNH A;  2G8K A;  4ID1 A;  5DMR A;  4DS5 A;  1FKP A;  4BE1 A;  3QEV A;  3S9H A;  1IH7 A;  3OYL A;  1X9W A;  3ALY A;  3TAF A;  3SQ2 A;  1C1A A;  3CYM A;  2EX3 A;  3SZ2 A;  2NUB A;  4FJJ A;  3LAL A;  4DTM A;  1S9G A;  4DLG A;  2IGI A;  4CJW A;  4FM1 A;  2B5J A;  1BL3 A;  1RT3 A;  4DQR A;  3V4I A;  3RMA A;  3I8D A;  1LAW A;  4FZY A;  3M8R A;  1RIL A;  4PY5 A;  3OVN A;  3RMB A;  2OPS A;  1A5W A;  1IKW A;  3KLI A;  4AHC A;  4OVL A;  4CE9 A;  3F73 A;  1WSF A;  1ASU A;  5DK5 A;  3ITH A;  2BAN A;  3VN5 A;  4B8A B;  4FM0 A;  4C8L A;  4NCA A;  1IKV A;  4HUF A;  3UIQ A;  4I9Q A;  1ZBU A;  3DRP A;  1JL1 A;  4DF8 A;  1WAJ A;  4B3O A;  4M3Y A;  3HM9 A;  1MU2 A;  3LP0 A;  3VA3 A;  3L8B A;  4DSE A;  2BGG A;  1RNH A;  1BCO A;  1S6P A;  4DFJ A;  1NJW A;  1A5X A;  1ZYQ A;  4KB1 A;  1A5V A;  1RBV A;  4CF8 A;  3QNN A;  1T03 A;  4FZZ A;  2BDP A;  2DFF A;  1HJR A;  2Z1G A;  3AVH A;  3JYT A;  1HQU A;  4CIF A;  4ZHR A;  4BDY A;  4FLZ A;  4F3O A;  2KZZ A;  2ATQ A;  4Z4G A;  1FK9 A;  4C8N A;  4CJ4 A;  4CK3 A;  4MFB A;  2A1R A;  4FK2 A;  1S6Q A;  1IO2 A;  1F21 A;  2HHT A;  2PYJ A;  3NDK A;  4HCC A;  3NGY A;  4FW1 A;  4HUE A;  1LWC A;  1VSF A;  4IG0 A;  3AVB A;  1TK5 A;  4RG8 A;  4OPK A;  5I3U A;  1SL2 A;  3ISN C;  1IG9 A;  3OYD A;  4FJ8 A;  4AHU A;  3TAM A;  1BCM A;  4I7F A;  2D0B A;  3OYJ A;  1GOB A;  2XY5 A;  2YNG A;  3KJV A;  4J2A A;  3NBP A;  3PO4 A;  3ASM A;  3NF8 A;  4PUO A;  2PY5 A;  4AHS A;  2R7Y A;  2XY7 A;  4CF1 A;  2G8I A;  3PUF A;  4CER A;  3K2P A;  4DTJ A;  5HP1 A;  4OLA A;  4F3T A;  3O3F A;  4CEQ A;  1XI1 A;  1U45 A;  1JLE A;  4DQS A;  1KTQ A;  2E4L A;  4Z4C A;  5FRM A;  3HVR A;  1LWF A;  3MXI A;  3OS2 A;  3QEW A;  4KHQ A;  3OS1 A;  4N47 A;  4DQP A;  3P1G A;  4F8R A;  1KLM A;  4ELV A;  3G10 A;  5D3G A;  3QEX A;  3C94 A;  3DLH A;  1CZB A;  2ZD1 A;  3CQ8 A;  4ELT A;  3LPT A;  4DTS A;  3DLE A;  2G8H A;  4CEB A;  3NE6 A;  3PV8 A;  1VSH A;  1UWB A;  2VG5 A;  3SQ0 A;  4CGG A;  3RR8 A;  1RDB A;  1WAF A;  1RBS A;  3OYN A;  2A1S A;  3LP2 A;  2VWK A;  2P51 A;  4QCL A;  3AO4 A;  1B9D A;  2DFE A;  3OYH A;  4DSI A;  2D5R A;  5FDL A;  4FXD A;  2AJQ A;  1U4B A;  3EY1 A;  2GBZ A;  1KVC A;  4DQI A;  1B92 A;  2VG7 A;  1LW2 A;  4CHN A;  3SV3 A;  5E41 A;  4E7K A;  1QTM A;  1VSI A;  4Z4H A;  4M3W A;  3C6T A;  3V9Z A;  1NOZ A;  4DTO A;  4DTX A;  4H4O A;  4O0J A;  2FBY A;  1DTT A;  3VQC A;  1VSL A;  1RDD A;  3OYA A;  3AO1 A;  1TK8 A;  2P5O A;  1RTJ A;  4HTU A;  1EP4 A;  3QES A;  3V1Q A;  1SL1 A;  4JS4 A;  1DLO A;  2X78 A;  1IKY A;  1GOC A;  4H8K A;  4CFC A;  1NJZ A;  2OPP A;  4LY7 A;  2RPI A;  2HW3 A;  3C6U A;  4BE0 A;  3TAB A;  3T3F A;  3QEI A;  1NK8 A;  5K14 A;  3T1A A;  3SYZ A;  4K8X A;  1WNS A;  3NF6 A;  3LZI A;  3TAG A;  1JLB A;  3HYF A;  1B9F A;  4HVJ A;  4B9U A;  3V9W A;  1EKE A;  1Q8I A;  3M8P A;  1XHX A;  3AA2 A;  4DU4 A;  4B08 A;  1U49 A;  4KHN A;  4QOZ B;  3SJJ A;  1S1T A;  3LAN A;  4HUG A;  3V9X A;  1U04 A;  4GMJ B;  4BDP A;  3C95 A;  2O4G A;  2XY8 A;  5C25 A;  2OA8 A;  1S5J A;  3CM6 A;  3VQQ A;  3NGZ A;  3HXM A;  2Y1I A;  1REV A;  1X9M A;  1Z25 A;  2HND A;  3VQ8 A;  3V81 A;  4CHP A;  1RT1 A;  2Z1I A;  4CEE A;  5KRS A;  1S1W A;  3VQA A;  4FJL A;  2HHU A;  3SI6 A;  2FBV A;  3DM2 A;  4RW8 A;  3SV4 A;  1RBU A;  4BE2 A;  3PY8 A;  4FK4 A;  2DFH A;  4CGI A;  1S1V A;  3NH0 A;  4DS4 A;  1JLQ A;  3QIO A;  1W9H A;  3OY9 A;  2G8V A;  4LSN A;  3HP6 A;  1CXU A;  5KTQ A;  4L8R B;  2PZS A;  4W5R A;  4C8K A;  2KFZ A;  3QLH A;  4KTZ A;  4ID5 A;  2KZM A;  3OYB A;  1BGX T;  3U6F A;  1NKE A;  1QS4 A;  2X6N A;  5HLF A;  1D8Y A;  1NOY A;  3OYE A;  4EP5 A;  3EYZ A;  3U3Y A;  3TI0 A;  3NH1 A;  4CHO A;  1NKB A;  1RTD A;  3L2R A;  3VQ4 A;  4FJM A;  1RT7 A;  3DYA A;  3OYK A;  1NJX A;  2YNI A;  4CJ5 A;  1WLJ A;  4O55 A;  4CEA A;  4IG3 A;  1SV5 A;  3OYM A;  1X9S A;  3AVF A;  5CZ2 A;  4DTN A;  3L3V A;  4CED A;  2X74 A;  3PX4 A;  4GW6 A;  4FJ5 A;  4KHS A;  3KK1 A;  4CES A;  4FJH A;  3L2Q A;  1ZBH A;  1YTA A;  3ZT1 A;  3MED A;  4DG1 A;  1KCF A;  4OKE A;  1K6Y A;  2KTQ A;  3LWM A;  4CJ3 A;  1L5U A;  4O0I A;  3WNG A;  1TV6 A;  3OYC A;  1SUQ A;  4DFP A;  2G8F A;  3ZSW A;  1C0M A;  4I9L A;  5HRN A;  1KFS A;  2OZM A;  1HRH A;  1BQN A;  2P5G A;  3G0Z A;  3KD1 E;  3MXJ A;  3THV A;  3LZJ A;  3SCX A;  3K5M A;  2G8U A;  4RW9 A;  3SNN A;  3TAQ A;  3K58 A;  1TK0 A;  1EET A;  3HST B; 
#chains in the Genus database with same CATH topology
 3SPY A;  1FJG K;  3UKU B;  1Q81 O;  4LH4 A;  4B1Z A;  1CZ9 A;  4A5B A;  4NYF A;  3CC7 N;  1RTI A;  2A40 A;  1NMD A;  2OPQ A;  4X66 K;  2HOE A;  1V4S A;  3VEO A;  2Q2R A;  3NF7 A;  4EP4 A;  4OKJ A;  4CJT A;  4DQQ A;  1SKW A;  3KK2 A;  3AA4 A;  3WUH A;  2FLO A;  4OX9 K;  2Z1H A;  3D7E O;  3TU5 A;  1VK0 A;  4IWV A;  1VSJ A;  3DXM B;  4A2A A;  2JWL A;  5C10 A;  1RT4 A;  4YNQ A;  3ATV A;  3LP1 A;  4BRD A;  4FCY A;  4Y1D A;  3KK7 A;  2QKK A;  2ZE2 A;  1OVY A;  1QVG M;  3DOK A;  3IS9 A;  3EEQ A;  2CGL A;  3F9M A;  3NVK A;  4FO0 A;  4CJS A;  4CZM A;  2UUA K;  3E9L A;  4B9V A;  4FJX A;  1I39 A;  2IOC A;  1JL2 A;  3H46 O;  3HJF A;  3I8B A;  4FJI A;  4H5V A;  3ENO A;  4CEC A;  2QKB A;  3VOV A;  4CJR A;  5KPT A;  2KQ2 A;  4NXM K;  1EQY A;  4M7Y A;  3QFU A;  2I7N A;  2A5X A;  5JLF A;  3DLB A;  1YI2 N;  3UKU A;  4FOI A;  4A57 A;  2ZQB A;  2W42 A;  1KD1 O;  5AQO A;  2YHA A;  4CBX A;  1JXB A;  4E1M A;  2O4I A;  2YHX A;  2JGU A;  3HL8 A;  2BH1 A;  4NCG A;  4CZI A;  1LV5 A;  3VEZ A;  2P1J A;  1I94 K;  3P83 D;  1TAQ A;  4ILH A;  1KAX A;  2RKI A;  3FZH A;  4DU3 A;  3CCU N;  3FE1 A;  1W0H A;  4M3X A;  4BQL A;  2HHW A;  3DRR A;  2VGM A;  4FJG A;  3R8E A;  3DXM A;  3CF5 L;  1U48 A;  4EZ9 A;  2QI2 A;  3M8S A;  1OH6 A;  1RT6 A;  4KO0 A;  5KQ8 A;  4DSL A;  1QQC A;  4DV6 K;  3OJS A;  2WOM A;  4YOV A;  2CH5 A;  3TAN A;  3D45 A;  1G15 A;  5LY3 A;  3BGR A;  1NK7 A;  1U6Z A;  2QWQ A;  1MWM A;  3LDO A;  3IUC A;  1Q7Y O;  1VQL N;  2BUP A;  5HRP A;  1TYQ B;  4BAC A;  3RTV A;  2F9W A;  3EZ5 A;  3L2U A;  4LF7 K;  5BPL A;  4CEO A;  2HNZ A;  1IBK K;  4NCB A;  4N5S A;  4CGF A;  5JLH A;  3DAW A;  3NCI A;  4LH5 A;  1T6D A;  4GVE A;  4CFB A;  1VQ8 N;  3H1Q A;  5KGW A;  1HKG A;  1VSM A;  4DFM A;  5C24 A;  5BN8 A;  1RBR A;  2ASP A;  2YJF A;  4FM2 A;  3ULD A;  2GWK A;  1KLN A;  1C0T A;  4E0D A;  4M3T A;  4E1N A;  4WQ5 A;  1JXE A;  3FZF A;  3KLE A;  1L3V A;  4ISG A;  4U67 L;  4UY8 O;  3VEY A;  2IS3 A;  2JLE A;  3GOI A;  2Q3S A;  3FFI A;  1L3U A;  4J2D A;  3VQE A;  3PO5 A;  4DB3 A;  1BA1 A;  3SK3 A;  3F9K A;  1NMN A;  1TL1 A;  1NU0 A;  4BRH A;  3AA3 A;  5EY4 A;  2IIR A;  3D2F B;  2YNF A;  4AHT A;  4F2R A;  1VQ4 N;  4AHR A;  3S3N A;  1TYQ A;  4F9O A;  4KI6 A;  3RVC A;  4JNE A;  4MDA A;  4W5O A;  4FWL A;  4JRP A;  1JLG A;  4CJV A;  1SS6 A;  2E2Q A;  2VQF K;  5BRF A;  2HMI A;  3U3G A;  5HRO A;  4BDZ A;  1YTU A;  1YVN A;  4LSL A;  5JS2 A;  5JS1 A;  1UOC A;  3SMP A;  1YF5 L;  1YT3 A;  3K0S A;  2QA4 N;  4DV2 K;  3WNF A;  3V1R A;  1NGJ A;  4FWM A;  1GLL O;  4IDH A;  3AO5 A;  3NGI A;  3LPU A;  1RTH A;  3O3G A;  1BQM A;  3VGL A;  1HNW K;  1GLA G;  3DLG A;  4A61 A;  1XUP O;  3THX B;  4CHY A;  4YOY A;  3HK2 A;  3DRS A;  3MCP A;  1J54 A;  1ASV A;  3LP3 A;  4WCE L;  3D2F A;  3GG4 A;  1TGO A;  4BQZ A;  3PX6 A;  2F7T A;  2G8K A;  1JLF A;  4IEE A;  3QEV A;  3QIC A;  3OYL A;  3ALY A;  2NRV A;  4DR5 K;  3SZ2 A;  3A5L C;  3V4I A;  2QEX N;  2B5J A;  1RT3 A;  4FZY A;  2WUS A;  3RMB A;  2OPS A;  1IBL K;  1A5W A;  1IKW A;  4AHC A;  3F73 A;  1ASU A;  5DK5 A;  1C0F A;  4B8A B;  3ID8 A;  4JKF A;  3DRP A;  4A5A A;  5E26 A;  1WAJ A;  4M3Y A;  4DV4 K;  3L8B A;  4XH4 A;  3ZYY X;  4DFJ A;  1NJW A;  1A5X A;  3VGK A;  4QS8 A;  1HQU A;  2ATQ A;  1FK9 A;  4CJ4 A;  3O9T A;  2ZGY A;  2ZM6 K;  4BRE A;  1D4X A;  3WXI A;  4HCC A;  2HF3 A;  2YHW A;  4IG0 A;  3AVB A;  1SL2 A;  4RG8 A;  4KH6 A;  1NBW A;  4FJ8 A;  1IJJ A;  3O9U A;  5EX5 A;  3O9S A;  2XY5 A;  3KJV A;  3THX A;  3NBP A;  3ASM A;  3NF8 A;  4OO1 J;  4AHS A;  2R7Y A;  4CF1 A;  1VQM N;  1TUY A;  4CEQ A;  1U45 A;  1JLE A;  1KTQ A;  3E9O A;  3OS1 A;  4DQP A;  3CJA A;  4WQ4 A;  5D3G A;  3QEX A;  3DLH A;  4ELT A;  3LPT A;  3PV8 A;  1VSH A;  1BWF O;  5AFU H;  1OH8 A;  4JI8 K;  1JCF A;  1RDB A;  1RBS A;  3J7Z O;  3CCQ N;  2VWK A;  2P51 A;  5AQW A;  2D5R A;  3E9P A;  1VQ5 N;  5CHI A;  2O8C B;  2E1Z A;  3WT0 A;  1B92 A;  1LW2 A;  5E41 A;  4M3W A;  3C6T A;  2VWB A;  3P39 A;  5AFU A;  4DTO A;  4H4O A;  4K41 A;  2FBY A;  1XNR K;  3OBW A;  3AO1 A;  4C23 A;  3O08 A;  1EP4 A;  3QES A;  4IJN A;  1DGK N;  4JEP A;  1GOC A;  4LY7 A;  3C6U A;  3T7Z A;  3T3F A;  4BGB A;  1NK8 A;  3SYZ A;  4WFN L;  1JLB A;  1ATN A;  3M8P A;  4H0P A;  1S1T A;  4HUG A;  1U04 A;  3R6M A;  4FWK A;  1C0G A;  5F2R A;  3HXM A;  1X9M A;  3HOT A;  1REV A;  4PKG A;  4CHP A;  1RT1 A;  3I56 N;  3VQA A;  3SI6 A;  4CBW A;  3H6E A;  3CI5 A;  2DFH A;  4CGI A;  3EKU A;  2G8V A;  3CCL N;  4H5N A;  1WBD A;  4JI7 K;  3VMF B;  2E2P A;  1QS4 A;  2X6N A;  3U3Y A;  3EYZ A;  5GIO A;  4CHO A;  1NKB A;  3ULE B;  1RTD A;  1NGI A;  3CJ7 A;  4XH5 A;  3CQY A;  4FJM A;  2E1Y A;  4DV7 K;  2IVN A;  4CJ5 A;  1WLJ A;  4CZE A;  1SV5 A;  3ENH A;  2O8C A;  2P9U B;  3L3V A;  4GW6 A;  3VES A;  4FJ5 A;  3KK1 A;  3L2Q A;  1E4G T;  3LWM A;  4CJ3 A;  3PLA A;  4O0I A;  1C0M A;  5HRN A;  1KFS A;  2P9K B;  2P5G A;  2BTF A;  4FL9 A;  5ADX A;  4MO4 A;  4BGA A;  3LZJ A;  3U8X A;  2F96 A;  4DR6 K;  3IDH A;  2FF6 A;  3CXC M;  2QXF A;  4JHD B;  3V9U A;  1Q86 O;  4JKE A;  3CFP A;  4KV8 A;  3VEN A;  4X65 K;  2ZJP L;  5FRO A;  1T7P A;  3ZET B;  5LJV A;  1RT5 A;  2HBM A;  4DV0 K;  2HF4 A;  4CJP A;  3CC2 N;  2DY4 A;  3O8M A;  5CE3 A;  4R5P A;  2RF2 A;  4FJK A;  4DU1 A;  3SUQ A;  3KVG A;  3LDL A;  3T69 A;  3T19 A;  4IFY A;  1RDC A;  1VSK A;  1DKG D;  2O8B B;  2W6L A;  3NF9 A;  2DTU A;  2I7P A;  3T1H K;  3SQ4 A;  5FLX O;  2J4R A;  3ULE A;  3B6P A;  4O5B A;  2V7Z A;  3DLL L;  3FFK B;  4KAZ A;  1NNE A;  1J5O A;  1HNV A;  2RHK A;  2P9U A;  5KRT A;  1M90 O;  5AQP A;  4GV6 A;  1XC9 A;  4MLE A;  1ZXO A;  4ICL A;  4F4K A;  1J6Z A;  1JLC A;  5FPE A;  1V4T A;  1GLC G;  3QDK A;  1DTQ A;  1LAV A;  3QB0 A;  1ZBS A;  3WNH A;  1MDU B;  4I2Q A;  4M45 A;  2P9K A;  4BC2 A;  2EHG A;  4QAG A;  3IG1 A;  3VQ9 A;  2D0C A;  3AVN A;  3S3M A;  4RW4 A;  2QWR A;  1EWR A;  4M3Z A;  3E01 A;  5CZ1 A;  1JJ2 M;  2HVI A;  4BRA A;  5J2M A;  2FBX A;  4JHD A;  1HYV A;  2FBT A;  3ZCM A;  4KFB A;  4O5F A;  1KQS M;  2Q36 A;  4PKH A;  4JI6 K;  5HBM A;  3ZET A;  4EAH D;  4NLC A;  2F8T A;  4O44 A;  2QTD A;  3HZ6 A;  5AQN A;  3KZB A;  3M1F A;  1NGF A;  3V9S A;  4BWJ A;  2D4W A;  4DLE A;  3A5M C;  1RT2 A;  2O8B A;  3SBG A;  4ELU A;  4DKW A;  3H08 A;  3SJH A;  3QET A;  1ZC6 A;  3MXM A;  2GUI A;  3VQB A;  1GLB G;  4BC4 A;  3HRG A;  1NGC A;  5GAG P;  2ASO A;  1YVU A;  5BRE A;  4O4G A;  4CCH A;  1JKH A;  2IAJ A;  3HPH A;  4GVM A;  4N56 A;  3PIP L;  4FSV A;  5M1N A;  4Y1C A;  1QQM A;  2DPN A;  5AQF A;  1KFD A;  3DWL A;  4Z4F A;  4W5Q A;  1QE1 A;  3VQP A;  4PWD A;  3J7A P;  1N32 K;  1HKB A;  4DWI A;  4FLU A;  4DTR A;  1OH7 A;  2FXU A;  4CIE A;  1XNQ K;  3ZT0 A;  1EXQ A;  1SKR A;  4N41 A;  4FVU A;  3LAM A;  2ZJR L;  3ZSR A;  1X3N A;  3B8A X;  3CM5 A;  3AO3 A;  1KXP A;  5KGX A;  2WON A;  1RDW X;  1VSE A;  3W3D A;  3TAP A;  3CC4 N;  1XWL A;  4WE1 A;  5SWM A;  4CZH A;  3O1B A;  4BR7 A;  4EHU A;  2YKM A;  2F4V K;  1DEJ A;  4FLT A;  2QW9 A;  4B3M K;  3QER A;  1C1B A;  5EVZ A;  3O9Q A;  2HB5 A;  4KTQ A;  3D2E B;  1I3A A;  1HR0 K;  3VQ7 A;  3ZSX A;  4K43 A;  1ITG A;  2KHO A;  3TSU A;  4H5T A;  5IT9 O;  2A42 A;  5EXW A;  4BRP A;  1UAX A;  4RW6 A;  4LFA K;  3VQD A;  1HYS A;  3KKR A;  5AQR A;  5AQJ A;  1Q18 A;  4DQ8 A;  3ZSY A;  4DFK A;  4B9M A;  3I0R A;  4CJF A;  3TSQ A;  3TAR A;  3EKS A;  2UXC K;  3L2W A;  1ESV A;  3R9P A;  4BRF A;  1N5Y A;  3AVI A;  4IKF A;  1NWK A;  4KRE A;  5J1E A;  3QEP A;  4CJK A;  3LDS A;  3S3O A;  3RR7 A;  4IOC L;  5J2P A;  1K9M O;  5HOO A;  5GAH P;  2BE2 A;  4FWR A;  4KTW A;  1ZBF A;  3LDN A;  5I42 A;  1S3X A;  3SPZ A;  3LWL A;  4OPH A;  3C6H A;  2E2O A;  3GBT A;  4C1N K;  5LMN K;  1C6V A;  4F2S A;  3J8A A;  3K5O A;  4YDU A;  3AVG A;  3AO2 A;  4CK1 A;  1YIT N;  4FJ7 A;  1S9E A;  3MN5 A;  3HVT A;  5EOY A;  1NLV A;  5M1F A;  3KLH A;  5LL6 Z;  4BR2 A;  4WYB A;  1LWE A;  4BRI A;  5ELZ A;  4J2B A;  3OHR A;  4FK0 A;  3K5L A;  3D2E A;  1SKS A;  4PQU A;  1T44 A;  2NLX A;  3BZC A;  3LM2 A;  3ID6 A;  3K59 A;  2B6A A;  3L2V A;  1SQK A;  4I6M B;  4H0T B;  5CR4 A;  3PSI A;  3MAQ A;  4DHY A;  2QWM A;  4CFD A;  3DMJ A;  5JVG L;  2XO7 A;  1IG8 A;  2WBN A;  1N36 K;  1KVB A;  1K8A O;  2HHQ A;  1RGI A;  1DT9 A;  2VG6 A;  4AM7 A;  4CF0 A;  2I5J A;  3KLG A;  1BIS A;  5SZT A;  1WN7 A;  1QSY A;  3IRX A;  3TTF A;  4YFU A;  3CJ9 A;  1NK9 A;  4FLY A;  1RFQ A;  4LD0 A;  4KHW A;  4BVP A;  2YNH A;  1X9W A;  1FKP A;  4BE1 A;  2CH6 A;  3QFP A;  4JI3 K;  2E5L K;  3TAF A;  1NJI O;  3RSE B;  2EX3 A;  2NUB A;  3LAL A;  4ILJ A;  4DLG A;  4DTM A;  4CJW A;  3RMA A;  1LAW A;  3M8R A;  1RIL A;  4PY5 A;  4GKK K;  3CCS N;  3LDQ A;  4WQ5 C;  5F0X A;  4BRQ A;  4FWN A;  5AQZ A;  5BRD A;  4NCA A;  3ITH A;  2BAN A;  2KKZ A;  4I9Q A;  1JL1 A;  4B3O A;  2IVP A;  3LP0 A;  5KPR A;  4YOU A;  1S6P A;  3MX5 A;  4KB1 A;  1A5V A;  1RBV A;  4CF8 A;  5DM6 L;  1YAG A;  2DFF A;  2Z1G A;  3JYT A;  4BDY A;  2KZZ A;  4Z4G A;  4CK3 A;  4I6M A;  4MFB A;  2HHT A;  1IO2 A;  2PYJ A;  3NDK A;  2ZF5 O;  4FW1 A;  4HUE A;  2O8E B;  1TK5 A;  3L0Q A;  4XEI A;  5TKW A;  1IG9 A;  3OYJ A;  4J2A A;  3PO4 A;  2UU9 K;  4PUO A;  1FW6 A;  3HBT A;  3TTD A;  3N4P A;  4DTJ A;  4OLA A;  3I55 N;  5HP1 A;  3E66 A;  4B9Q A;  3VGM A;  3OS2 A;  3QEW A;  4N47 A;  3P1G A;  3ENB A;  1KLM A;  5BR9 A;  3G10 A;  2W40 A;  3CQ8 A;  3LM9 A;  3WQU A;  1M1K O;  1SZ2 A;  3RSE A;  4DTS A;  3DLE A;  3WXL A;  4NXN K;  2E8A A;  1E3M A;  3OYN A;  3H3O B;  2A1S A;  3ZLJ A;  2HST A;  3O6W A;  3OYH A;  5GIP A;  1N8R O;  1U4B A;  2AJQ A;  2GBZ A;  4DV3 K;  5AQV A;  4Z4H A;  2ZGZ A;  3AGR A;  4DR7 K;  2GX9 A;  3SMS A;  4O0J A;  3VQC A;  1VSL A;  3OYA A;  1TK8 A;  4B3R K;  3W0L A;  3EN9 A;  3OW2 M;  1DLO A;  1IKY A;  4CFC A;  2HW3 A;  2RPI A;  1NGB A;  1KAZ A;  1SAZ A;  5C15 A;  2O8E A;  3LL3 A;  1WNS A;  3TAG A;  4B9U A;  3HYF A;  4HVJ A;  2AP1 A;  4IOX A;  1Q8I A;  1U49 A;  1XHX A;  4KHN A;  2Q0U A;  4E1J A;  4QOZ B;  3LAN A;  3V9X A;  4J8F A;  4GMJ B;  2XY8 A;  2OA8 A;  1Z25 A;  3VQ8 A;  1BU6 O;  2Z1I A;  4CEE A;  1BG3 A;  5AJ3 K;  2HHU A;  2FBV A;  3DM2 A;  3SV4 A;  4BE2 A;  3FLC O;  1S1V A;  1JLQ A;  1HX1 A;  3ATU A;  4LSN A;  3HP6 A;  1CXU A;  5KTQ A;  3QLH A;  4KTZ A;  2OTJ N;  3OYB A;  1BGX T;  4CD1 A;  5HLF A;  3OYE A;  4EP5 A;  5BN9 A;  3VQ4 A;  3O80 A;  3DYA A;  4B1W B;  1X9S A;  3OYM A;  3FZK A;  3AVF A;  4ISF A;  4KHS A;  2X74 A;  1HNX K;  4JI2 K;  3VF4 A;  1ZBH A;  2VYP A;  3MED A;  4DG1 A;  1KCF A;  3JAM O;  2KTQ A;  5AQY A;  4LFB K;  4DFP A;  2G8F A;  3ZSW A;  1W7A A;  1VQ6 N;  1HRH A;  3G0Z A;  3MXJ A;  2G8U A;  3K5M A;  2H3G X;  2PFU A;  1S72 N;  1W2B M;  3HST B;  3BF1 A;  3M8Q A;  1ZBI A;  2G8W A;  4FLV A;  4B3T K;  4B1Y B;  4JKG B;  4E3S A;  2GUP A;  4WQ4 C;  4E7L A;  4R79 A;  2W6K A;  5BR8 K;  4M42 A;  3O4W A;  3OYF A;  1GLE G;  4AIL C;  1QSS A;  3ZX0 A;  3ZEU B;  4CZK A;  4FOE A;  3MEE A;  4C1N I;  4E19 A;  3N4Q A;  3AVC A;  5JVH L;  3SQ1 A;  2Z1J A;  5C0Y A;  1JLA A;  5H1S Q;  5B8H A;  4H03 B;  1NKC A;  3SAG A;  1VAZ A;  4ZTF A;  2FF3 B;  1NGD A;  1C0U A;  4FYD A;  4KH4 A;  1WSJ A;  2HHX A;  4BC5 A;  4CJU A;  3VET A;  4IFV A;  3CJ1 A;  3ZT3 A;  4M3U A;  5C12 A;  2HBJ A;  4GV3 A;  4IDK A;  4ZTJ A;  4YOX A;  4E7H A;  1UA1 A;  3A8Y A;  3TWH A;  3B6O A;  1HJO A;  4UQG A;  4E7I A;  4X62 K;  2GEL A;  4LF8 K;  4M3R A;  3QIP A;  4CJE A;  5HRS A;  4BRO A;  4NB4 A;  4LC9 B;  4OJR A;  4DR1 K;  1Z26 A;  2ITG A;  1ZBL A;  2NZT A;  2IC3 A;  4CEF A;  4A2B A;  4WFA L;  3CFR A;  5CYQ A;  3P38 A;  5HL7 L;  4RW7 A;  4B9N A;  4JKG A;  4CVN E;  3IFR A;  4JRQ A;  4FVM A;  1NGG A;  5J2N A;  1N33 K;  2RN2 A;  4OLB A;  1XQS C;  3CFO A;  3ZEU A;  5GIN A;  5F1X A;  1WB9 A;  2Y1J A;  3DOL A;  3BDP A;  3O4Q A;  1Q9X A;  4CHQ A;  1D9D A;  3ZSV A;  3IMX A;  3OYG A;  1J53 A;  5CY4 A;  3VTI A;  3OTO K;  2XY6 A;  4N76 A;  1VRT A;  3VPZ A;  4M63 C;  3RRG A;  1W97 L;  2D0A A;  3VA0 A;  2P9L B;  3KHY A;  1TKD A;  3MWP A;  1S22 A;  4IO8 A;  1TKZ A;  2ETJ A;  5ADX H;  4FLW A;  3TSP A;  3OYI A;  3RMC A;  1HMV A;  2FSN A;  5HRR A;  4BR5 A;  3G71 N;  3ZSZ A;  4FPB A;  1O13 A;  3KLF A;  1NGE A;  5AQS A;  2HNY A;  3A5O C;  4W5T A;  5AQH A;  4K0K K;  1TVR A;  2YX6 A;  3GL1 A;  4HHT A;  1YJN N;  2XRI A;  2WFB A;  4CFA A;  1QQN A;  3HT3 A;  3I33 A;  4M41 A;  4CF2 A;  4JN4 A;  3LAK A;  1WSI A;  3SAH A;  4A62 A;  3JSM A;  1HPM A;  3IAY A;  3NH2 A;  5BPM A;  4DMN A;  2EWS A;  2OAN A;  4CJL A;  4C8M A;  1O1W A;  4JS5 A;  2Q1N A;  4OPJ A;  4RWT A;  5DM7 L;  4LF9 K;  2GV9 A;  2QM1 A;  2OTL N;  2E6M A;  1TAU A;  3CPW M;  2P9L A;  1QHT A;  3CCM N;  1S1U A;  1J9A A;  1H1V A;  4H0Y B;  3NHG A;  1KVA A;  2P9S B;  4DSF A;  1YJ9 N;  3LDP A;  4KI4 A;  1CLQ A;  2YJE A;  1L3T A;  4C8O A;  3UE5 A;  3TAE A;  3KK3 A;  1X1P A;  4EZ6 A;  2FC0 A;  4KKO A;  3KD5 E;  4KB0 A;  3SUP A;  4JKD A;  4KPY A;  3HSC A;  4BRM A;  3RMD A;  2V51 B;  5C42 A;  4MLH A;  4FJ9 A;  1XHZ A;  2QWN A;  4E7J A;  3AV9 A;  2QWL A;  1OKJ A;  4FLX A;  2A3Z A;  1L3S A;  3TPQ A;  2VWJ A;  3R1X A;  3WXJ A;  3SUO A;  4DF4 A;  3M5R A;  3HTV A;  4CZG A;  5I9E B;  2D0O A;  4BVO A;  2F8S A;  4E89 A;  1X9J A;  2GEM A;  4JI1 K;  4H4M A;  3IKM A;  3MMV A;  1BO5 O;  1XC3 A;  3K9K A;  4DSJ A;  5AQX A;  1R0A A;  3OS0 A;  4DSK A;  4AF1 A;  4MQ3 A;  5T7B A;  2P9S A;  4CK2 A;  4Z4E A;  1IKX A;  4Q5V A;  4CJ7 A;  1EX4 A;  4DTP A;  2AA4 A;  3F2K A;  1TKX A;  4DV1 K;  3MN9 A;  2IDO A;  1RDA A;  3E1Y A;  3Q7B A;  1T8E A;  2NRT A;  4DR4 K;  4ID1 A;  4DS5 A;  3S9H A;  1IH7 A;  3SQ2 A;  3CYM A;  4FJJ A;  2JWK A;  2RE2 A;  1S9G A;  2IGI A;  4FM1 A;  5M1K A;  4DQR A;  1BL3 A;  3NMU A;  4O8K A;  3I8D A;  4BE0 A;  3KLI A;  4CE9 A;  1WSF A;  3U9Z A;  1IKV A;  4HUF A;  2WTU A;  1ZBU A;  4GY2 B;  5M1O A;  2Q0R A;  3CIP A;  3HM9 A;  2BGG A;  1RNH A;  1VQO N;  2BDP A;  3AVH A;  1HJR A;  5C2D A;  4FLZ A;  4CIF A;  4F3O A;  1YJW N;  3WEE B;  1HLU A;  5AZJ B;  2A1R A;  1GLJ O;  1BDG A;  2E2N A;  2ZWH A;  1VSF A;  3HOS A;  4OPK A;  4MO5 A;  3OYD A;  4AHU A;  4I7F A;  5KPZ A;  2D0B A;  4OPA A;  2P9I B;  3BF3 A;  4BRG A;  2YNG A;  3WXK A;  1QHA A;  2PY5 A;  2NRX A;  4EIA A;  2XY7 A;  1OH5 A;  5BPN A;  4YDU C;  2G8I A;  3R3L A;  3PUF A;  3K2P A;  3O3F A;  1XI1 A;  2VCP A;  4Z4C A;  5FRM A;  4X64 K;  1LWF A;  4IEI A;  3MXI A;  4DR3 K;  4IOA L;  1KAY A;  2ZJQ L;  4K42 A;  4H5R A;  1YIJ N;  4NO7 A;  3A5N C;  3MDQ A;  1CZB A;  1P90 A;  4CEB A;  2VG5 A;  3SQ0 A;  3RR8 A;  1WAF A;  4PL7 A;  4V19 S;  4B1U B;  3LP2 A;  4CZL A;  3P4I A;  4JI0 K;  4QCL A;  4Y0W A;  1B9D A;  2DFE A;  5AQG A;  3F5T A;  5FDL A;  5LJW A;  1NM1 A;  3FGU A;  2VG7 A;  4CHN A;  3CD6 N;  1VSI A;  1X3M A;  3M6G A;  3CET A;  5AQQ A;  1DTT A;  3C7N B;  1RDD A;  3O9R A;  1RTJ A;  3EE8 A;  4HTU A;  3T1Y K;  2D1K A;  3ZX3 A;  3WEE A;  3S41 A;  2P9P B;  4JS4 A;  2X78 A;  2UXB K;  3OA9 A;  4H8K A;  5AZJ A;  1NJZ A;  2OPP A;  1VQN N;  3BZK A;  3QEI A;  5K14 A;  4K8X A;  1BUP A;  4PKI A;  3OBY A;  4H0X B;  3G6E N;  3AAR A;  1MA9 B;  1B9F A;  4CZF A;  4HWI A;  3V9W A;  1HKC A;  4B08 A;  3UKR B;  4AM6 A;  2P9I A;  3SJJ A;  4BDP A;  3C95 A;  2O4G A;  5M1Q A;  2Y1I A;  3NGZ A;  3TTC A;  3AAP A;  2HND A;  5AQU A;  1IBM K;  2CGK A;  3VTH A;  5KRS A;  4PHT X;  4RW8 A;  1RBU A;  2V52 B;  3CPE A;  4FK4 A;  4BR9 A;  3NH0 A;  4DS4 A;  3CQX A;  4L8R B;  2PZS A;  4W5R A;  4C8K A;  2KZM A;  3U6F A;  1NGA A;  2FSK A;  1NOY A;  3L2R A;  4AQY K;  1IV0 A;  3AAQ A;  1NJX A;  1OVQ A;  4O55 A;  4CEA A;  4IG3 A;  4DTN A;  3KWI A;  3MN7 A;  3PX4 A;  1Q82 O;  3J80 O;  3AY9 A;  2UUC K;  4CES A;  2GWJ A;  3SAF A;  3ZT1 A;  3C7N A;  1JCG A;  3EO3 A;  4FWQ A;  1L5U A;  5JIC A;  3U9D A;  2E20 A;  2P9P A;  3OYC A;  4H5W A;  1BOT O;  4I9L A;  2OZM A;  4JKA A;  1BQN A;  4LF5 K;  3THV A;  3JS6 A;  2YCH A;  3K58 A;  1EET A;  4CF9 A;  1MWK A;  3PX0 A;  1N34 K;  4H0O A;  3KKS A;  4JAX A;  3UKR A;  1TKT A;  1KRP A;  2D0P A;  1NK6 A;  4KRF A;  3ZSQ A;  3BUZ B;  2UUB K;  5KI6 A;  3BY5 A;  3O5B A;  1NK5 A;  4FZX C;  4QS7 A;  2ITM A;  3DJC A;  3P5J A;  4HTL A;  1LCU A;  3K9J A;  3NAE A;  3SUN A;  3AVK A;  4BRC A;  3V6D A;  4CI6 A;  3ZSO A;  4IZ9 A;  2QWP A;  1NJY A;  5FPM A;  3CJC A;  4I2P A;  2HHS A;  4JI5 K;  4DUZ K;  3Q7C A;  4G1Q A;  4B9S A;  2NRW A;  4BWM A;  1RDU A;  3V1O A;  4HCB A;  2UXD K;  3VQ6 A;  4B9T A;  1VRU A;  1K73 O;  1SL0 A;  2KFN A;  1T05 A;  4K25 A;  4W5N A;  4DUY K;  2B4J A;  3C65 A;  3WQT A;  3KTQ A;  1J5E K;  3K57 A;  2LSN A;  4A59 A;  3CJB A;  1TL3 A;  1U2V B;  3THY B;  3VEW A;  4B8C A;  1T6C A;  3HM8 A;  3WNE A;  4B3S K;  4CBU A;  1TUU A;  1E4F T;  4IFE A;  3O3H A;  4TSX A;  4CEZ A;  4JK9 A;  3GDQ A;  4OGC A;  2A6A A;  1BIU A;  1WSE A;  3A2F A;  4BRK A;  4K8Z A;  4G9Z A;  1WUA A;  2GTD A;  4LFC K;  3AVA A;  3D6R A;  4JKH A;  3HP9 A;  1QZ6 A;  2E88 A;  1QSL A;  2HVH A;  4B1X B;  5AQL A;  2KW4 A;  1NK4 A;  4O8U A;  4J2E A;  4Q0B A;  1HNI A;  3C6A A;  3OJU A;  3FZL A;  3KIO A;  1WOQ A;  3A0I X;  4LF4 K;  2XHB A;  2WC9 A;  4BY9 C;  2E6L A;  1YUW A;  4AH9 A;  1D5A A;  5JMV A;  3M3Z A;  3NFA A;  1Y97 A;  4NYN A;  3DXK B;  2YHY A;  4IO9 L;  2O8F B;  1N6Q A;  1ATS A;  1GOA A;  3ZT2 A;  3BP8 A;  3L3U A;  1YXQ A;  1VSD A;  5LMU K;  3AVM A;  1C1C A;  4H0V B;  2HBK A;  3VQ5 A;  1R59 O;  1U2V A;  3THY A;  4L3Q A;  1ASW A;  3MCA B;  2HHV A;  1LOT B;  1Z05 A;  5EU7 A;  4LF6 K;  3PIO L;  1JCE A;  2HBL A;  3CMA N;  4JLH A;  1BA0 A;  4CGJ A;  1VQP N;  1U47 A;  1QQO A;  4WFB L;  4PL8 A;  2OYQ A;  2OZS A;  1HPZ A;  4BG8 A;  3EL2 A;  1ATR A;  2YKN A;  2NNW A;  4GKJ K;  1BI4 B;  1XMO K;  2F9T A;  4XIU A;  2QK9 A;  1FKO A;  1UA0 A;  1Q9Y A;  3MEC A;  3L4I A;  4BG9 A;  2X6S A;  3C0B A;  4EFH A;  3HPG A;  1QZ5 A;  1WBB A;  4WF9 L;  2O8D B;  2PYL A;  5MLC Q;  3MWT A;  1D9F A;  3HPO A;  3EE9 A;  3QIN A;  3QNO A;  3G25 A;  1NK0 A;  1RBT A;  4PA1 A;  3VF6 A;  1NG9 A;  4KHY A;  4CIG A;  3CCR N;  4Z4I A;  4CGD A;  4BRN A;  3DXK A;  4FWP A;  1HYZ A;  3ZT4 A;  2O8F A;  2VQE K;  2YHB A;  4DTU A;  1HQE A;  1WSG A;  3FZM A;  4Z0U A;  4U7B A;  1T3V A;  4AHV A;  4CGH A;  2IVO A;  5CYM A;  3RWU A;  1WSH A;  3L6Q A;  3VF2 A;  3O4N A;  1HNZ K;  4OKK A;  5FPN A;  5M1P A;  4FJN A;  1EWQ A;  4FWO A;  1LW0 A;  4Z94 A;  2YV0 X;  1KC8 O;  4OGE A;  4ISE A;  3DLR A;  1BIZ A;  1RCH A;  4CW7 B;  1FXX A;  3I0S A;  4JKC A;  4CJQ A;  4KBO A;  5AQI A;  5GAE P;  3THW B;  4JK8 A;  1Y64 A;  1BI4 A;  3HO1 A;  1BHL A;  4B9L A;  3TR8 A;  4IXC A;  3AVL A;  4B1V A;  3CHW A;  2W41 A;  2OPR A;  3D0P A;  1CXQ A;  3AA5 X;  2UYT A;  3DI6 A;  4KHU A;  4IBN A;  3CG7 A;  2O8D A;  3AVJ A;  1VQ9 N;  2PBD A;  3O1W A;  5IWA K;  3RRH A;  4FW2 A;  1S1X A;  2HMP A;  2Q31 A;  3DLK A;  4ILG B;  1KSP A;  3MEG A;  4BC3 A;  3K5N A;  3G4S N;  3QO9 A;  4CHZ A;  5FRN A;  3PSF A;  5J2Q A;  1VHX A;  4XH1 A;  5DMR A;  2QWO A;  2ASM A;  3VER A;  3JXU A;  1C1A A;  2Q97 A;  4JI4 K;  4DCH A;  3OVN A;  2A41 A;  3MK6 A;  3QBW A;  3TAQ A;  4OVL A;  4FWS A;  3VN5 A;  1Z6R A;  4FM0 A;  4C8L A;  3UIQ A;  4DF8 A;  3GE1 A;  5KQD A;  1MU2 A;  3VA3 A;  3J81 O;  1K8K B;  4DSE A;  1BCO A;  1ILY A;  3THW A;  1ZYQ A;  3QNN A;  4FZZ A;  1T03 A;  4RCH A;  1P8Z A;  3QBX A;  4ZHR A;  4CZJ A;  4MDB A;  4C8N A;  3VEX A;  4FK2 A;  1S6Q A;  1F21 A;  5AZI B;  3FR0 A;  4FPA A;  3NGY A;  1LWC A;  5FPD A;  5I3U A;  1GLD G;  4DV5 K;  3ISN C;  3TAM A;  1BCM A;  5BRH A;  5TKY A;  1GOB A;  4CD3 A;  3BEX A;  5E84 A;  4CER A;  4F3T A;  3H3N O;  4DQS A;  2E4L A;  3HVR A;  4KHQ A;  4JKB A;  4F8R A;  5A2Q O;  4ELV A;  3C94 A;  2ZD1 A;  2G8H A;  3SLC A;  3NE6 A;  1UWB A;  4CGG A;  1XMQ K;  3L4Q A;  3CCE N;  5AQT A;  4JK7 A;  3AO4 A;  4DSI A;  4FXD A;  2P9N B;  4M7X A;  3EY1 A;  3HI0 A;  3J7Y P;  1KVC A;  3MN6 A;  5C2F A;  4DQI A;  1QTM A;  3SV3 A;  4E7K A;  1VQK N;  4RTF D;  1K8K A;  3V9Z A;  1NOZ A;  3NVM A;  4GV9 A;  4DR2 K;  3UB5 A;  4DTX A;  2NRZ A;  3P31 A;  4GNI A;  2P5O A;  2YI1 A;  2HHH K;  3CCV N;  3V1Q A;  1VQ7 N;  1SL1 A;  4JD2 B;  4KH5 A;  5AZI A;  3TAB A;  3MX2 A;  3T1A A;  2QXL A;  4YY3 K;  3NF6 A;  3LZI A;  2CGJ A;  1GLF O;  4BR4 A;  1EKE A;  2NRR A;  4DU4 A;  3AA2 A;  4YOT A;  4NLB A;  1YHQ N;  4JV5 K;  3SBT A;  3WXM B;  1HUX A;  5C25 A;  3CME N;  1EO1 A;  1S5J A;  3CM6 A;  3VQQ A;  4EHT A;  5AR0 A;  3QML A;  3V81 A;  4FJL A;  1S1W A;  3U4L A;  3PY8 A;  2FSJ A;  3VEV A;  2OCE A;  2KLA A;  3QIO A;  1W9H A;  3OY9 A;  2KFZ A;  1CZA N;  3ZX2 A;  5AQM A;  4ID5 A;  3CCJ N;  2V7Y A;  3H1V X;  4YOR A;  1NKE A;  4YOW A;  1D8Y A;  3TI0 A;  3NH1 A;  3AGK A;  4JYA K;  4IJA A;  1QVF M;  1RT7 A;  3OYK A;  3CER A;  2YNI A;  2NRH A;  5GAD P;  2P9N A;  4QS9 A;  5CZ2 A;  4CED A;  4YHH K;  4FJH A;  3H45 C;  2VGN A;  1YTA A;  4OKE A;  1K6Y A;  4BR0 A;  3EZW A;  3WNG A;  1TV6 A;  4JD2 A;  1SUQ A;  2PAV A;  5AQK A;  3KD1 E;  4KHP K;  3SCX A;  4RW9 A;  3SNN A;  1G99 A;  1NGH A;  3KWG A;  4BRL A;  1TK0 A; 
#chains in the Genus database with same CATH homology
 2F96 A;  3M8Q A;  4CF9 A;  3PX0 A;  3SPY A;  1ZBI A;  3KKS A;  2G8W A;  4FLV A;  1TKT A;  1KRP A;  2QXF A;  4E3S A;  3V9U A;  4E7L A;  1NK6 A;  4LH4 A;  4KRF A;  3CFP A;  4KV8 A;  3ZSQ A;  1CZ9 A;  4NYF A;  1RTI A;  5FRO A;  1T7P A;  4M42 A;  3OYF A;  2OPQ A;  4AIL C;  1RT5 A;  5KI6 A;  1QSS A;  4CJP A;  1NK5 A;  2DY4 A;  4R5P A;  2RF2 A;  4FZX C;  4FJK A;  3NF7 A;  4EP4 A;  3MEE A;  4OKJ A;  4E19 A;  4DU1 A;  3SUQ A;  4CJT A;  4DQQ A;  1SKW A;  3KK2 A;  3P5J A;  3AVC A;  3SQ1 A;  2Z1J A;  1JLA A;  1NKC A;  3T19 A;  3NAE A;  3AA4 A;  4IFY A;  3SUN A;  1RDC A;  1VSK A;  2Z1H A;  4ZTF A;  3NF9 A;  1VK0 A;  3AVK A;  1VSJ A;  3V6D A;  2DTU A;  1C0U A;  3SQ4 A;  4FYD A;  3ZSO A;  1RT4 A;  4YNQ A;  1WSJ A;  3B6P A;  4O5B A;  2HHX A;  1NJY A;  3LP1 A;  4CJU A;  4KAZ A;  4FCY A;  4IFV A;  1J5O A;  3ZT3 A;  4Y1D A;  2QKK A;  1HNV A;  4M3U A;  2ZE2 A;  4I2P A;  5KRT A;  3DOK A;  2HHS A;  3IS9 A;  4IDK A;  4ZTJ A;  4G1Q A;  4B9S A;  4E7H A;  1XC9 A;  1UA1 A;  4BWM A;  4ICL A;  3TWH A;  3V1O A;  3B6O A;  4CJS A;  4UQG A;  4F4K A;  4E7I A;  4HCB A;  4M3R A;  3QIP A;  4CJE A;  5HRS A;  4B9V A;  1JLC A;  3VQ6 A;  4FJX A;  4B9T A;  1I39 A;  2IOC A;  1VRU A;  4OJR A;  1JL2 A;  1DTQ A;  3HJF A;  1Z26 A;  1SL0 A;  4FJI A;  1LAV A;  2KFN A;  1T05 A;  4W5N A;  3WNH A;  4I2Q A;  4CEC A;  2QKB A;  2B4J A;  4M45 A;  2ITG A;  4CJR A;  2EHG A;  2KQ2 A;  1ZBL A;  4QAG A;  3IG1 A;  3VQ9 A;  2D0C A;  3AVN A;  3S3M A;  2IC3 A;  4RW4 A;  4CEF A;  3KTQ A;  4M3Z A;  3E01 A;  5CZ1 A;  3DLB A;  3K57 A;  2LSN A;  3CFR A;  5CYQ A;  2HVI A;  1TL3 A;  5J2M A;  2FBX A;  4RW7 A;  4B9N A;  4B8C A;  2ZQB A;  1HYV A;  2FBT A;  3ZCM A;  2W42 A;  4KFB A;  4JRQ A;  4E1M A;  2YHA A;  3WNE A;  1JXB A;  2O4I A;  4FVM A;  5HBM A;  2JGU A;  3HL8 A;  4NCG A;  5J2N A;  2RN2 A;  4OLB A;  1LV5 A;  2P1J A;  2F8T A;  4O44 A;  3O3H A;  3CFO A;  3P83 D;  4TSX A;  4CEZ A;  1TAQ A;  4OGC A;  2RKI A;  4DU3 A;  1BIU A;  1WSE A;  3DOL A;  1W0H A;  3A2F A;  4BWJ A;  4DLE A;  3O4Q A;  3V9S A;  2Y1J A;  1Q9X A;  4K8Z A;  4M3X A;  4CHQ A;  1RT2 A;  3AVA A;  4ELU A;  3DRR A;  1D9D A;  4FJG A;  2HHW A;  3HP9 A;  3H08 A;  3ZSV A;  3QET A;  1U48 A;  3MXM A;  4EZ9 A;  3OYG A;  2GUI A;  3VQB A;  1J53 A;  5CY4 A;  3M8S A;  1YVU A;  4O4G A;  4CCH A;  1QSL A;  2HVH A;  1RT6 A;  2KW4 A;  1NK4 A;  4KO0 A;  2XY6 A;  4DSL A;  4J2E A;  1HNI A;  1VRT A;  3OJU A;  1QQC A;  4N76 A;  4Q0B A;  3RRG A;  3KIO A;  1JKH A;  2D0A A;  2IAJ A;  3HPH A;  4GVM A;  3OJS A;  2WOM A;  3VA0 A;  4N56 A;  2XHB A;  1TKD A;  4Y1C A;  3D45 A;  2E6L A;  3TAN A;  4PWD A;  4AH9 A;  1D5A A;  1TKZ A;  2ETJ A;  1G15 A;  3BGR A;  1KFD A;  3NFA A;  1Y97 A;  4NYN A;  1QE1 A;  3VQP A;  4W5Q A;  4FLW A;  1NK7 A;  4Z4F A;  3OYI A;  4DWI A;  3RMC A;  1N6Q A;  4FLU A;  4DTR A;  4CIE A;  1GOA A;  1HMV A;  5HRR A;  3ZT2 A;  3ZT0 A;  1EXQ A;  5HRP A;  3L3U A;  3ZSZ A;  4BAC A;  3LAM A;  3KLF A;  1SKR A;  4N41 A;  3ZSR A;  3RTV A;  3EZ5 A;  1VSD A;  3CM5 A;  3L2U A;  3AO3 A;  3AVM A;  5KGX A;  2HNY A;  1C1C A;  1VSE A;  2WON A;  4W5T A;  3TAP A;  1XWL A;  3VQ5 A;  4WE1 A;  5SWM A;  1TVR A;  1ASW A;  2HHV A;  4CEO A;  2HNZ A;  4HHT A;  2YKM A;  4NCB A;  4N5S A;  2XRI A;  4CGF A;  4FLT A;  5EU7 A;  4CFA A;  3HT3 A;  4LH5 A;  3NCI A;  3QER A;  4M41 A;  4CFB A;  4CF2 A;  1C1B A;  4JLH A;  4CGJ A;  2HB5 A;  3BDP A;  4KTQ A;  5KGW A;  3LAK A;  1WSI A;  1I3A A;  1VSM A;  1U47 A;  4DFM A;  5C24 A;  2OYQ A;  1RBR A;  3VQ7 A;  3ZSX A;  4FM2 A;  2OZS A;  1HPZ A;  3JSM A;  3IAY A;  1ITG A;  3NH2 A;  3ULD A;  1KLN A;  1C0T A;  4E0D A;  2YKN A;  4M3T A;  4DMN A;  4E1N A;  1BI4 B;  1UAX A;  4RW6 A;  1JXE A;  3VQD A;  4CJL A;  1HYS A;  3KLE A;  1L3V A;  3KKR A;  4C8M A;  4XIU A;  2QK9 A;  3ZSY A;  2IS3 A;  1FKO A;  2JLE A;  4DFK A;  1O1W A;  1UA0 A;  3I0R A;  4CJF A;  4JS5 A;  3MEC A;  1Q9Y A;  4B9M A;  4OPJ A;  3TAR A;  2Q3S A;  2GV9 A;  3FFI A;  2X6S A;  3L2W A;  1L3U A;  3HPG A;  3VQE A;  1N5Y A;  3PO5 A;  4J2D A;  3AVI A;  4IKF A;  4KRE A;  5J1E A;  3QEP A;  4CJK A;  2E6M A;  2PYL A;  3LDS A;  3S3O A;  1D9F A;  3RR7 A;  1TAU A;  1QHT A;  3F9K A;  1TL1 A;  3HPO A;  1S1U A;  3QIN A;  3QNO A;  1J9A A;  3NHG A;  1RBT A;  4PA1 A;  1NK0 A;  5J2P A;  1KVA A;  4DSF A;  4KHY A;  3AA3 A;  4CIG A;  2BE2 A;  4KI4 A;  1CLQ A;  4Z4I A;  4KTW A;  4CGD A;  2YNF A;  4AHT A;  1ZBF A;  5I42 A;  1L3T A;  1HYZ A;  3ZT4 A;  3SPZ A;  4F2R A;  4C8O A;  3LWL A;  4DTU A;  2YHB A;  4AHR A;  1HQE A;  3TAE A;  3KK3 A;  1X1P A;  1WSG A;  3S3N A;  4Z0U A;  4EZ6 A;  2FC0 A;  4KKO A;  4KI6 A;  1C6V A;  4F2S A;  4AHV A;  3KD5 E;  3K5O A;  3SUP A;  4KB0 A;  4KPY A;  4CGH A;  4W5O A;  5CYM A;  3AVG A;  3AO2 A;  1JLG A;  4JRP A;  3RWU A;  4CK1 A;  4FJ7 A;  1S9E A;  1WSH A;  4CJV A;  3RMD A;  3HVT A;  2HMI A;  3U3G A;  3KLH A;  5C42 A;  3O4N A;  1LWE A;  4OKK A;  4FJ9 A;  5HRO A;  4BDZ A;  4FJN A;  4J2B A;  1YTU A;  1LW0 A;  1XHZ A;  2YV0 X;  3K5L A;  4E7J A;  4LSL A;  4FK0 A;  3AV9 A;  4OGE A;  1SKS A;  5JS2 A;  3DLR A;  4FLX A;  4PQU A;  1UOC A;  1L3S A;  1BIZ A;  1RCH A;  5JS1 A;  1FXX A;  3I0S A;  4CJQ A;  1YT3 A;  2VWJ A;  3WNF A;  3SUO A;  1BI4 A;  3V1R A;  3K59 A;  3HO1 A;  3AO5 A;  3NGI A;  4DF4 A;  1BHL A;  2B6A A;  3LPU A;  4B9L A;  3TR8 A;  3L2V A;  3AVL A;  1RTH A;  2OPR A;  3D0P A;  3O3G A;  1CXQ A;  2F8S A;  3AA5 X;  1BQM A;  4E89 A;  3MAQ A;  4H4M A;  3DI6 A;  4CFD A;  4KHU A;  3DMJ A;  4IBN A;  2XO7 A;  3CG7 A;  3DLG A;  1KVB A;  3AVJ A;  4DSJ A;  4CHY A;  3HK2 A;  2HHQ A;  1R0A A;  3OS0 A;  3DRS A;  4DSK A;  3RRH A;  4MQ3 A;  5T7B A;  2VG6 A;  4FW2 A;  1J54 A;  1S1X A;  4Z4E A;  4CK2 A;  1ASV A;  1IKX A;  3DLK A;  4Q5V A;  1KSP A;  1EX4 A;  3LP3 A;  3MEG A;  2I5J A;  4CF0 A;  3KLG A;  1BIS A;  5SZT A;  3K5N A;  4DTP A;  1WN7 A;  1QSY A;  1TKX A;  3IRX A;  4YFU A;  1NK9 A;  3QO9 A;  4CHZ A;  5FRN A;  4FLY A;  1TGO A;  3PX6 A;  2IDO A;  5J2Q A;  1RDA A;  4LD0 A;  4KHW A;  1T8E A;  1JLF A;  2YNH A;  2G8K A;  4ID1 A;  5DMR A;  4DS5 A;  1FKP A;  4BE1 A;  3QEV A;  3S9H A;  1IH7 A;  3OYL A;  1X9W A;  3ALY A;  3TAF A;  3SQ2 A;  1C1A A;  3CYM A;  2EX3 A;  3SZ2 A;  2NUB A;  4FJJ A;  3LAL A;  4DTM A;  1S9G A;  4DLG A;  2IGI A;  4CJW A;  4FM1 A;  2B5J A;  1BL3 A;  1RT3 A;  4DQR A;  3V4I A;  3RMA A;  3I8D A;  1LAW A;  4FZY A;  3M8R A;  1RIL A;  4PY5 A;  3OVN A;  3RMB A;  2OPS A;  1A5W A;  1IKW A;  3KLI A;  4AHC A;  4OVL A;  4CE9 A;  3F73 A;  1WSF A;  1ASU A;  5DK5 A;  3ITH A;  2BAN A;  3VN5 A;  4B8A B;  4FM0 A;  4C8L A;  4NCA A;  1IKV A;  4HUF A;  3UIQ A;  4I9Q A;  1ZBU A;  3DRP A;  1JL1 A;  4DF8 A;  1WAJ A;  4B3O A;  4M3Y A;  3HM9 A;  1MU2 A;  3LP0 A;  3VA3 A;  3L8B A;  4DSE A;  2BGG A;  1RNH A;  1BCO A;  1S6P A;  4DFJ A;  1NJW A;  1A5X A;  1ZYQ A;  4KB1 A;  1A5V A;  1RBV A;  4CF8 A;  3QNN A;  1T03 A;  4FZZ A;  2BDP A;  2DFF A;  1HJR A;  2Z1G A;  3AVH A;  3JYT A;  1HQU A;  4CIF A;  4ZHR A;  4BDY A;  4FLZ A;  4F3O A;  2KZZ A;  2ATQ A;  4Z4G A;  1FK9 A;  4C8N A;  4CJ4 A;  4CK3 A;  4MFB A;  2A1R A;  4FK2 A;  1S6Q A;  1IO2 A;  1F21 A;  2HHT A;  2PYJ A;  3NDK A;  4HCC A;  3NGY A;  4FW1 A;  4HUE A;  1LWC A;  1VSF A;  4IG0 A;  3AVB A;  1TK5 A;  4RG8 A;  4OPK A;  5I3U A;  1SL2 A;  3ISN C;  1IG9 A;  3OYD A;  4FJ8 A;  4AHU A;  3TAM A;  1BCM A;  4I7F A;  2D0B A;  3OYJ A;  1GOB A;  2XY5 A;  2YNG A;  3KJV A;  4J2A A;  3NBP A;  3PO4 A;  3ASM A;  3NF8 A;  4PUO A;  2PY5 A;  4AHS A;  2R7Y A;  2XY7 A;  4CF1 A;  2G8I A;  3PUF A;  4CER A;  3K2P A;  4DTJ A;  5HP1 A;  4OLA A;  4F3T A;  3O3F A;  4CEQ A;  1XI1 A;  1U45 A;  1JLE A;  4DQS A;  1KTQ A;  2E4L A;  4Z4C A;  5FRM A;  3HVR A;  1LWF A;  3MXI A;  3OS2 A;  3QEW A;  4KHQ A;  3OS1 A;  4N47 A;  4DQP A;  3P1G A;  4F8R A;  1KLM A;  4ELV A;  3G10 A;  5D3G A;  3QEX A;  3C94 A;  3DLH A;  1CZB A;  2ZD1 A;  3CQ8 A;  4ELT A;  3LPT A;  4DTS A;  3DLE A;  2G8H A;  4CEB A;  3NE6 A;  3PV8 A;  1VSH A;  1UWB A;  2VG5 A;  3SQ0 A;  4CGG A;  3RR8 A;  1RDB A;  1WAF A;  1RBS A;  3OYN A;  2A1S A;  3LP2 A;  2VWK A;  2P51 A;  4QCL A;  3AO4 A;  1B9D A;  2DFE A;  3OYH A;  4DSI A;  2D5R A;  5FDL A;  4FXD A;  2AJQ A;  1U4B A;  3EY1 A;  2GBZ A;  1KVC A;  4DQI A;  1B92 A;  2VG7 A;  1LW2 A;  4CHN A;  3SV3 A;  5E41 A;  4E7K A;  1QTM A;  1VSI A;  4Z4H A;  4M3W A;  3C6T A;  3V9Z A;  1NOZ A;  4DTO A;  4DTX A;  4H4O A;  4O0J A;  2FBY A;  1DTT A;  3VQC A;  1VSL A;  1RDD A;  3OYA A;  3AO1 A;  1TK8 A;  2P5O A;  1RTJ A;  4HTU A;  1EP4 A;  3QES A;  3V1Q A;  1SL1 A;  4JS4 A;  1DLO A;  2X78 A;  1IKY A;  1GOC A;  4H8K A;  4CFC A;  1NJZ A;  2OPP A;  4LY7 A;  2RPI A;  2HW3 A;  3C6U A;  4BE0 A;  3TAB A;  3T3F A;  3QEI A;  1NK8 A;  5K14 A;  3T1A A;  3SYZ A;  4K8X A;  1WNS A;  3NF6 A;  3LZI A;  3TAG A;  1JLB A;  3HYF A;  1B9F A;  4HVJ A;  4B9U A;  3V9W A;  1EKE A;  1Q8I A;  3M8P A;  1XHX A;  3AA2 A;  4DU4 A;  4B08 A;  1U49 A;  4KHN A;  4QOZ B;  3SJJ A;  1S1T A;  3LAN A;  4HUG A;  3V9X A;  1U04 A;  4GMJ B;  4BDP A;  3C95 A;  2O4G A;  2XY8 A;  5C25 A;  2OA8 A;  1S5J A;  3CM6 A;  3VQQ A;  3NGZ A;  3HXM A;  2Y1I A;  1REV A;  1X9M A;  1Z25 A;  2HND A;  3VQ8 A;  3V81 A;  4CHP A;  1RT1 A;  2Z1I A;  4CEE A;  5KRS A;  1S1W A;  3VQA A;  4FJL A;  2HHU A;  3SI6 A;  2FBV A;  3DM2 A;  4RW8 A;  3SV4 A;  1RBU A;  4BE2 A;  3PY8 A;  4FK4 A;  2DFH A;  4CGI A;  1S1V A;  3NH0 A;  4DS4 A;  1JLQ A;  3QIO A;  1W9H A;  3OY9 A;  2G8V A;  4LSN A;  3HP6 A;  1CXU A;  5KTQ A;  4L8R B;  2PZS A;  4W5R A;  4C8K A;  2KFZ A;  3QLH A;  4KTZ A;  4ID5 A;  2KZM A;  3OYB A;  1BGX T;  3U6F A;  1NKE A;  1QS4 A;  2X6N A;  5HLF A;  1D8Y A;  1NOY A;  3OYE A;  4EP5 A;  3EYZ A;  3U3Y A;  3TI0 A;  3NH1 A;  4CHO A;  1NKB A;  1RTD A;  3L2R A;  3VQ4 A;  4FJM A;  1RT7 A;  3DYA A;  3OYK A;  1NJX A;  2YNI A;  4CJ5 A;  1WLJ A;  4O55 A;  4CEA A;  4IG3 A;  1SV5 A;  3OYM A;  1X9S A;  3AVF A;  5CZ2 A;  4DTN A;  3L3V A;  4CED A;  2X74 A;  3PX4 A;  4GW6 A;  4FJ5 A;  4KHS A;  3KK1 A;  4CES A;  4FJH A;  3L2Q A;  1ZBH A;  1YTA A;  3ZT1 A;  3MED A;  4DG1 A;  1KCF A;  4OKE A;  1K6Y A;  2KTQ A;  3LWM A;  4CJ3 A;  1L5U A;  4O0I A;  3WNG A;  1TV6 A;  3OYC A;  1SUQ A;  4DFP A;  2G8F A;  3ZSW A;  1C0M A;  4I9L A;  5HRN A;  1KFS A;  2OZM A;  1HRH A;  1BQN A;  2P5G A;  3G0Z A;  3KD1 E;  3MXJ A;  3THV A;  3LZJ A;  3SCX A;  3K5M A;  2G8U A;  4RW9 A;  3SNN A;  3TAQ A;  3K58 A;  1TK0 A;  1EET A;  3HST B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...