3BF3A

Type iii pantothenate kinase from thermotoga maritima complexed with product phosphopantothenate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A02
1XUPO 3EKUA 3L6QA 5BR9A 2FSJA 4H0YB 5ADXA 2HOEA 1YUWA 3ZX3A 4B1UB 3DJCA 3H3OB 3LDNA 3QBWA 5BRFA 2ZGYA 1NGCA 1DKGD 4CZMA 1GLBG 2YJFA 4I6MA 4IJAA 2IVPA 1BA1A 3ENOA 2CGLA 3KZBA 2KHOA 5AQWA 3O08A 3M3ZA 1QQOA 4JD2A 1KAXA 5I9EB 3H46O 1ATRA 4BRNA 4BQLA 4BRQA 1JCFA 5AQIA 4I6MB 1BOTO 2D1KA 2YI1A 3LL3A 1IG8A 3H1QA 4ISGA 4BRAA 2E88A 1G99A 2GUPA 3D2FA 5AQJA 5AQMA 2E20A 3O8MA 1KAYA 3JXUA 4H0OA 3SJHA 4FWQA 4CZHA 2IVNA 3W0LA 3FZLA 2BTFA 4BGAA 2ASPA 2P9NA 1BG3A 4H5TA 4BQZA 1WOQA 5KQDA 2QWMA 3D2FB 5E84A 3KVGA 1BA0A 3ATUA 5BREA 3U4LA 3GL1A 2D4WA 1ZC6A 2W40A 5KPZA 2E8AA 1QHAA 2Q0RA 5B8HA 2CGJA 3GOIA 1LOTB 2P9NB 4NB4A 4RCHA 3HI0A 3ZX0A 4BR5A 4O8KA 1MA9B 1T6DA 3EO3A 4DQ8A 2QWPA 2QXLA 2CH5A 5LY3A 5AQSA 3FLCO 3GE1A 4PKGA 4CZGA 4FOEA 4B9QA 3CJBA 5AZIA 3CQYA 1RGIA 4BRGA 1HPMA 5AQHA 3LM2A 2YHYA 1WUAA 1Z05A 3FZKA 2FXUA 4CZFA 1NGFA 3WXIA 2Q0UA 2V7ZA 2A3ZA 3CHWA 2ZF5O 4J8FA 1KAZA 3EN9A 3J8AA 3MN9A 1X3MA 3FGUA 5AZIB 2QWLA 1DEJA 2E2QA 3SK3A 4FL9A 3HBTA 5AQLA 3VEOA 3DWLA 2F9WA 3U9ZA 5AQUA 1MDUB 3S41A 3VF2A 2P9UA 2HF3A 3CERA 4EFHA 5LJWA 5BRHA 1TUUA 1QZ5A 5EX5A 1J6ZA 1DGKN 4F9OA 3QFPA 2ITMA 4PKHA 2A40A 3H6EA 4BC3A 1NWKA 2FSKA 2E1YA 3DXKA 4H5WA 3QICA 3QFUA 4K41A 1NGGA 5AFUH 4FSVA 4BRLA 3O80A 3VPZA 4QS8A 3CIPA 5AQFA 3VEZA 2Q31A 1YXQA 1X9JA 3ID8A 1NM1A 1HJOA 3CJ9A 4HWIA 3F9MA 3FZMA 4XH1A 2VYPA 3O1WA 2QW9A 4BREA 1NGDA 5CE3A 3FZFA 3D2EA 5AR0A 4WYBA 2FF3B 2GELA 3I33A 3HZ6A 4FWKA 4B1VA 4CBXA 1NGAA 1JCEA 4PKIA 2OANA 3UKRA 1HUXA 4B1ZA 2QWNA 4FWLA 3ZETA 3UE5A 4A61A 2P9IA 3W3DA 2I7NA 3VGLA 4NO7A 1U2VA 5AQKA 5BPMA 2P9SA 1NLVA 4XEIA 3D2EB 5AQGA 4E1JA 4DHYA 1NGIA 1MWKA 3VETA 3VGKA 3A5LC 3IMXA 3FFKB 3UKRB 2E2PA 3ZETB 3LM9A 2DPNA 2J4RA 1E4FT 3HM8A 3WEEA 1U2VB 2P9SB 3R9PA 4BR7A 3MCPA 3O4WA 2NLXA 4PL7A 4JD2B 1RDWX 5AQPA 3OHRA 2V52B 4CZJA 1SZ2A 3LDQA 4IXCA 4BR0A 4IO8A 4CZIA 2Q1NA 5AQNA 3DXMA 3WEEB 1C0GA 2E2OA 1NGBA 5LJVA 4BG9A 3C0BA 1U6ZA 4WQ4C 4CZLA 4Y0WA 3AARA 2Q2RA 4L3QA 3U9DA 5BRDA 3AAQA 5TKYA 3EL2A 3CQXA 3VENA 2YJEA 3DXMB 3QB0A 4FPAA 4PL8A 3UKUA 4BVPA 4RTFD 1ZBSA 1V4SA 3CETA 4XH5A 4K42A 1Q18A 3CJAA 5ADXH 5E26A 1CZAN 4H5VA 4MO5A 3LDOA 2A41A 3JS6A 1MWMA 3TPQA 3UKUB 4B1WB 4FPBA 4A2BA 4CBWA 5EVZA 1LCUA 5AQQA 2ASOA 2E1ZA 3MDQA 1D4XA 5AQYA 5ELZA 4CZEA 4CI6A 1GLCG 1V4TA 2YCHA 2VWBA 5BPLA 5FPMA 4B1YB 1NGJA 4FWMA 5EOYA 1BDGA 4FWOA 4IZ9A 3KHYA 5JMVA 3HTVA 3CI5A 1GLAG 4FWSA 2ASMA 3LDPA 3ATVA 1Z6RA 1HX1A 4JNEA 2GTDA 1GLEG 3O5BA 2FF6A 3FR0A 3QDKA 1QZ6A 5BN9A 3M6GA 1NGEA 1K8KA 2P9UB 3VERA 3SLCA 5JLFA 4A62A 1NMDA 2D0PA 4A2AA 2ZGZA 4BG8A 3I8BA 4GY2B 4JAXA 4B1XB 1NGHA 4H0XB 3DXKB 1K8KB 4JHDA 4BROA 2E2NA 1ATSA 2Q97A 1ATNA 3MN7A 3MK6A 2YHWA 5F0XA 3IDHA 4H03B 2GWJA 3SMPA 4H0TB 2A6AA 1RFQA 1TYQA 3G25A 5FPEA 1QQNA 4YDUC 1ZXOA 4CD3A 4BRPA 2W41A 1GLFO 2H3GX 4AM6A 3P4IA 2ZWHA 2I7PA 2QWOA 4JHDB 3VESA 4FO0A 5FPDA 1EQYA 4BC2A 1TYQB 3WUHA 1TUYA 4XH4A 4YDUA 1GLJO 3BUZB 3GBTA 3VEXA 3WXLA 3MN5A 5AQZA 3WXKA 5KPRA 4M63C 5AQRA 4DCHA 4BRFA 2D0OA 3B8AX 4K43A 1SQKA 2EWSA 2P9IB 3H1VX 3MMVA 2P9KA 4C23A 2Q36A 3AAPA 5AQOA 3GDQA 2AA4A 2F9TA 4CBUA 2GWKA 3L0QA 3ULEA 2NRHA 3BP8A 3EKSA 4CZKA 4CJ7A 2P9LA 4BRDA 4RWTA 1QQMA 2P9KB 3M1FA 4BR4A 2YHXA 1HKBA 5EY4A 3BF1A 3H45C 4FWPA 3C7NA 3ULEB 1OKJA 2A42A 2A5XA 3O6WA 4IWVA 1GLDG 2P9LB 5AQXA 1P8ZA 5JICA 3H3NO 4IJNA 1Y64A 3A5OC 3TU5A 4FWRA 1HKGA 4WQ4A 3C7NB 1E4GT 3LDLA 2QWQA 4BRKA 5BN8A 2VCPA 2WUSA 3CJ1A 3DAWA 3WXJA 2BUPA 4EHTA 3UB5A 4BRHA 4LC9B 3VEWA 2NZTA 1JCGA 2FLOA 3CJCA 5AZJA 5AFUA 4GNIA 4DB3A 5JLHA 1YAGA 4H0PA 4M7YA 4BRMA 3GG4A 1SAZA 1HLUA 2UYTA 3EZWA 3WQUA 5F2RA 4KBOA 1HKCA 3O1BA 4MO4A 3SMSA 3AY9A 4Z94A 2IIRA 3A8YA 4ISEA 2HMPA 4EHUA 1IJJA 5AZJB 1T44A 3L4IA 2V51B 4M7XA 4AM7A 4BR2A 4CD1A 1S3XA 4FOIA 3FZHA 1R59O 4BC4A 2FSNA 3ENHA 4JN4A 4EIAA 5FPNA 4BRCA 4H5RA 2QM1A 4BGBA 5EXWA 3MN6A 1H1VA 3HSCA 5AQVA 3FE1A 1C0FA 1YVNA 2V7YA 2HF4A 3QBXA 1KXPA 1XC3A 1X3NA 4ISFA 3BF3A 3A5NC 4HTLA 3VF4A 1BUPA 1T6CA 3VGMA 1S22A 1BU6O 4H5NA 4QS9A 4QS7A 5F1XA 3VF6A 3WT0A 2AP1A 2CH6A 2PAVA 4MLEA 1XQSC 3A0IX 2QWRA 2P9PA 3WQTA 3CJ7A 3ZEUA 4EAHD 1GLLO 1BWFO 3ZX2A 2CGKA 5AQTA 3VEVA 4WQ5C 3RSEA 5KQ8A 2PBDA 2GEMA 5BPNA 3VOVA 4O5FA 4BVOA 4MLHA 2P9PB 2IVOA 4FWNA 5KPTA 3ZEUB 3A5MC 4K25A 3U8XA 3R6MA 1NBWA 4BRIA 4WQ5A 4H0VB 3RSEB 4BR9A 3QMLA 3IFRA 1ESVA 1BO5O 4BC5A 3IUCA 3VEYA 3BEXA 3D7EO 3R8EA
chains in the Genus database with same CATH superfamily
1TKTA 3J7YP 3EKUA 5BR9A 4ZHRA 4DTRA 4YNQA 3RTVA 3QEVA 1YUWA 3DRRA 5LL6Z 3ZX3A 2XY5A 4K8XA 3AVMA 4UQGA 3WNFA 3LDNA 3QBWA 3OYFA 4F2RA 1UA1A 5GIPA 4DV4K 2G8UA 4IJAA 3MEEA 1S1WA 4FJNA 3IG1A 3K59A 3KZBA 1XWLA 3TSPA 3O08A 3QO9A 3NF6A 1QQOA 5H1SQ 3HOTA 2P51A 4H8KA 4BQLA 4BRQA 1I94K 1JCFA 5AQIA 3LL3A 3G10A 3V9XA 4ISGA 2E88A 3HSTB 4DTMA 1YTAA 5AQJA 3VQCA 2VWJA 4DTJA 4F8RA 3O8MA 1YHQN 4B3OA 3AVGA 2WC9A 4DQIA 3MX2A 1X9MA 4IOXA 3FZLA 1QQCA 3SJJA 4BQZA 5J2PA 1WOQA 2G8VA 1SKRA 2NRXA 4JKAA 1W0HA 3U4LA 2D4WA 2E8AA 1HYZA 2Q0RA 4CGDA 3RMCA 4ELVA 2CGJA 1LOTB 1UWBA 4FJGA 2G8HA 1MA9B 1K9MO 3EO3A 2QWPA 2F7TA 3ID6A 4XIUA 3OS2A 1RILA 3OYLA 4CZGA 4FOEA 3CQYA 3T19A 4QOZB 2D0AA 1NK5A 1C6VA 2YHYA 1C0MA 2Q0UA 2A3ZA 3VQ4A 4G9ZA 4W5OA 1X3MA 1S1TA 3CFPA 1D9DA 4JKBA 2E2QA 1VQPN 4FL9A 4DQQA 5I42A 1MDUB 5DM7L 4OPKA 4C8NA 5LJWA 3CERA 1R0AA 4CGFA 5BRHA 3CMAN 1B9FA 1DGKN 4F9OA 4JKHA 3T1HK 1QSSA 2ITMA 1N34K 4YFUA 4RW6A 2NRVA 1P90A 1RT1A 1NWKA 5C12A 4DQRA 4KAZA 1RT4A 1KLNA 2HVHA 4K41A 5JVGL 1NGGA 4ZTFA 4Z0UA 4BRLA 3VPZA 2NUBA 1K73O 3NGIA 3HVTA 3CIPA 4CERA 3CJ9A 4IFYA 3S3OA 5CE3A 4DWIA 5AR0A 2E6MA 4CJSA 3I33A 3HZ6A 1NGAA 2Z1IA 3QEPA 3T1YK 2QWNA 4BWMA 2HBLA 1L3SA 3R3LA 4AHSA 2YHBA 2QK9A 1WSHA 4NO7A 3ZT1A 5BPMA 2P9SA 3QERA 1ZBUA 2W6LA 4DHYA 2F96A 4Y1DA 3VGKA 1OH7A 3IMXA 1BIUA 4J2BA 4E89A 3LM9A 1RBVA 2IC3A 4CJ4A 2J4RA 4ILGB 3VQPA 2P9SB 4CJRA 1TVRA 3BY5A 3CFOA 4OX9K 4JD2B 2HNZA 1VSHA 4CF0A 1VAZA 4NYNA 1SZ2A 4BR0A 4IXCA 4CJVA 4ILHA 4DR3K 2Q1NA 3JAMO 5AQNA 1JLFA 4CEAA 4DV5K 1U6ZA 4CZLA 4Y0WA 4CVNE 2YNIA 4L3QA 1SUQA 3V81A 3EL2A 5JS1A 3P83D 4FPAA 4CF9A 4KHPK 4UY8O 2BANA 2F8SA 4RTFD 1VQNN 3AO4A 1CZAN 3V1QA 3ZCMA 4A59A 1JLGA 1ASVA 1MWMA 4ELUA 1W7AA 4B1WB 4CBWA 2OTLN 3K9JA 3MXMA 2E1ZA 2ETJA 4BY9C 3CQ8A 5AQYA 2HNDA 3HP6A 2E5LK 4DTSA 1GLCG 2YCHA 2VWBA 3O9SA 2VGMA 4Y1CA 4B1YB 1GOBA 3U3GA 3J7AP 4FCYA 4IOAL 1NGJA 5EOYA 3OYJA 4DQPA 1FXXA 3CM6A 4DTOA 5C0YA 2KLAA 3E1YA 4FWSA 5C42A 4DSIA 4LF4K 4CK3A 1YJNN 2ASMA 3LDPA 4DS5A 3THVA 4HCBA 3K9KA 1HX1A 1VQ4N 4FZZA 2G8IA 5CYQA 3O5BA 3AVAA 2IAJA 1T03A 1ZBHA 3TTCA 3QDKA 2P9UB 4KH6A 3MWTA 3VERA 3SLCA 4B3TK 1TAQA 3ASMA 3E9LA 2ZQBA 4BG8A 1EXQA 3AVJA 3I8BA 4B1XB 3AGRA 1TK5A 5HOOA 2XRIA 3F9KA 3TAEA 4JHDA 3SUQA 3MN7A 2D5RA 3SQ4A 1B92A 1YITN 2YHWA 4LFBK 3IDHA 2GWJA 1HYSA 4WFAL 1VSLA 1HYVA 4YY3K 4YOYA 3M8RA 1WNSA 3SAGA 3J7ZO 4M45A 2W41A 4CF2A 1GLFO 2H3GX 4AM6A 3P4IA 3EY1A 2QWOA 4JHDB 3VESA 1A5VA 4FO0A 2D0CA 1I3AA 4DV3K 5FPDA 2VQEK 3TSQA 4BC2A 4CE9A 4E7IA 2DTUA 3VEXA 1GLJO 3E66A 4JS4A 3MN5A 3WXKA 3VA3A 4M63C 5KGXA 4BRFA 3B8AX 3MMVA 2P9KA 2Y1IA 1VSJA 2Q36A 2AA4A 2F9TA 3QINA 5C2DA 5J1EA 1JXBA 4J2DA 3BP8A 3EKSA 4CJ7A 3SAHA 1OVYA 3AA4A 2OPQA 1WSFA 4RWTA 1KVBA 3Q7BA 2P9KB 3M1FA 3N4QA 1HNVA 5J2MA 1QS4A 2IDOA 5EY4A 1RT7A 2ATQA 3U6FA 3PV8A 4FZXC 4OLBA 4DFPA 1OKJA 5A2QO 3K2PA 1N32K 5JICA 3F2KA 3DLLL 2BE2A 5C2FA 1IBMK 4JI8K 1VQ7N 1HKGA 1SKWA 1E4GT 1WSIA 2KQ2A 2WUSA 4EHTA 3E01A 4BRHA 4MFBA 2NZTA 2UXDK 3CJCA 5JVHL 3RRHA 3IS9A 3LALA 3OVNA 4GNIA 5AFUA 4B3RK 3TTFA 4FVMA 3MWPA 4M7YA 3DLRA 2LSNA 1BL3A 4U7BA 3ZT3A 4K0KK 1VQKN 2YHAA 4OKJA 3O1BA 3OYBA 3A8YA 4DU4A 4KFBA 4FLZA 1G15A 4M7XA 3CD6N 4BR2A 1KD1O 1S3XA 3FZHA 3HYFA 1VRUA 4M42A 2KW4A 5FPNA 1VQ6N 4BRCA 4H5RA 5EXWA 3MN6A 3FE1A 1C0FA 3VQ8A 1GOCA 4IBNA 3SBGA 1X9WA 1QHTA 4M3RA 2XO7A 4O0JA 5KRSA 3VF4A 4CGJA 1S22A 4CHZA 4H5NA 4QS9A 3I55N 2YX6A 2CH6A 1W9HA 4CK1A 2P9PA 3CJ7A 3ZEUA 3NE6A 1S6QA 3P39A 2CGKA 3NFAA 3SUOA 3RSEA 3C65A 5FROA 4JI1K 3AVKA 3OBYA 2YNHA 4MLHA 4NCBA 3LPUA 4I2QA 2P9PB 3ZEUB 3E9PA 1BHLA 4K25A 3R6MA 1X1PA 3RSEB 4CJKA 4IOCL 1XNRK 5C10A 3OW2M 5LMUK 1BO5O 3IUCA 1RTDA 1WBBA 3MX5A 4JKEA 1HRHA 4Q0BA 1GOAA 4N5SA 2HOEA 4B1UB 3DJCA 4OJRA 4FK2A 2E6LA 4JS5A 2ZGYA 4CZMA 4F2SA 1S1VA 4DR4K 4I7FA 4NCGA 4R5PA 5AQWA 2X6SA 3M3ZA 4G1QA 3DMJA 3H46O 2YKMA 5FLXO 1ZBLA 5M1OA 4X65K 2D1KA 4OGEA 1C1BA 1KLMA 1IG8A 2UU9K 2DFFA 4CHQA 2PYLA 4KHSA 4AHTA 1C1AA 4DUYK 4KI6A 2O8EB 1G99A 3NF9A 5AQMA 2O8CA 3JXUA 1KVCA 4QCLA 4FWQA 2NRWA 3W0LA 1VSKA 3HM9A 3L3UA 1RT6A 2P9NA 1XMOK 5KQDA 3KVGA 4FW1A 2O8CB 3ATUA 3AVBA 5EU7A 4FZYA 5KPZA 1EETA 5B8HA 3ZSZA 3DLKA 3ZSQA 2P9NB 2WBNA 1N5YA 1NK0A 2VG6A 4KHWA 4RCHA 4CJ5A 2HW3A 4RW4A 3ZX0A 3JSMA 4BR5A 4O8KA 2RF2A 3KWGA 3CYMA 5KRTA 4CGGA 3AA2A 2QXLA 4RW7A 3QESA 4DV0K 5LY3A 5AQSA 3GE1A 5K14A 3KKRA 4HUGA 1RGIA 1RDUA 4BRGA 1EX4A 3DLEA 3FZKA 4JI4K 3WNHA 3U3YA 3WXIA 3CHWA 3EN9A 3J8AA 2WTUA 3D0PA 3AVCA 3VEOA 4BE0A 2ZJPL 4EFHA 4GKKK 1TUUA 1QZ5A 4HUEA 1J6ZA 4DSLA 3QFPA 4A5BA 3ZSVA 2X78A 2A40A 3H6EA 4BC3A 3O3FA 3SQ2A 4B9SA 2DFEA 2FSKA 3NMUA 4EP5A 2HBJA 1VQON 3B6PA 5AFUH 4FSVA 4NXMK 5J2QA 1IKXA 1NJXA 2G8KA 3LANA 1E3MA 3F5TA 5AQFA 2Q31A 1X9JA 3ID8A 1NM1A 1RTIA 5AJ3K 5KTQA 3FZMA 2QW9A 3FZFA 4E7HA 1QVGM 4DFKA 4KRFA 1BISA 3IKMA 1VRTA 1QSLA 4B1VA 4PKIA 3UKRA 1U48A 4B1ZA 3M8PA 3ZETA 2P9IA 2JGUA 4DR1K 1VSFA 2I7NA 3TABA 1HJRA 4B9TA 1NLVA 4XEIA 1NKCA 4A57A 4C1NI 3A5LC 3UKRB 3ZETB 2DPNA 2ZD1A 4DR5K 3HM8A 5GADP 3OJSA 3PX4A 3A2FA 3R9PA 4BR7A 4O0IA 3BDPA 2NLXA 1WSGA 3C94A 1RDWX 2OZSA 4LFAK 4CF1A 3K58A 1NK6A 2JWKA 4CZJA 3LDQA 4IO8A 4CZIA 1ZBFA 2KFNA 3DXMA 2AJQA 1NGBA 5LJVA 4BG9A 3NDKA 1KSPA 3C0BA 2HB5A 3V6DA 3TAGA 3S3MA 3AARA 2Q2RA 4CEZA 1N33K 5TKYA 3CQXA 1RBRA 1DTTA 3DXMB 1V4SA 1Q18A 3NGZA 5E26A 4LF7K 4H5VA 1D5AA 4MO5A 4OLAA 3KK2A 1BI4A 1ASWA 2P1JA 3TPQA 1NK9A 1FJGK 3OYGA 3OYAA 4CHNA 3VQAA 4DV7K 1LCUA 5HRNA 4LH5A 4CJEA 3VMFB 1ILYA 3O3GA 3DRPA 2PFUA 3RWUA 1BI4B 3NH0A 4I2PA 1NOZA 4FWMA 5GINA 2GV9A 4DLEA 3NH2A 2O8BA 1LW2A 4OVLA 3QEIA 3RVCA 2W42A 4MDBA 4RG8A 3CCEN 5FRNA 4JNEA 1GLEG 3AVNA 2O8BB 4B08A 3CCJN 3SV3A 1ZBIA 3OY9A 4DV1K 1K8KA 3OS1A 3HVRA 1JLEA 3KD5E 2YNGA 2VG5A 5JLFA 3OBWA 3UIQA 2D0PA 4CJTA 3O4NA 3NF8A 4Z4HA 4CEEA 3OYKA 1K8KB 4KTZA 1ZYQA 2B6AA 4BROA 2GX9A 2Q97A 3ZT4A 3LP3A 4B9UA 4DKWA 5F0XA 2VQFK 1O1WA 4E19A 2A6AA 1RFQA 1TYQA 4YDUC 3G6EN 4A5AA 3BZCA 3QNNA 5GIOA 4Z4EA 4O8UA 3TR8A 3D6RA 4NLBA 3KKSA 1TYQB 3WUHA 4B8CA 4XH4A 3AGKA 3C6UA 5M1PA 5GAEP 3SI6A 1NMNA 4K43A 5HRSA 2EWSA 4GV6A 2FBYA 1NU0A 3AAPA 5AQOA 1VQMN 3L0QA 1C0UA 4ID1A 5GAGP 4WF9L 1IKVA 1VSMA 3HPGA 1C1CA 4BRDA 4FLXA 2YHXA 1HKBA 4C8MA 3BF1A 3H45C 3I0SA 1Q7YO 2FBXA 1GLDG 1BQMA 5AQXA 2FC0A 4DF4A 3DYAA 1D8YA 1P8ZA 3T3FA 3H3NO 4IJNA 3WNGA 4LSLA 3A5OC 1HR0K 1D9FA 3LDLA 5KGWA 3CJ1A 3WXJA 2XY7A 3UB5A 4IO9L 3F73A 1JCGA 3THXA 5HRRA 3PIOL 3VQQA 2NNWA 4BRMA 3SCXA 3DI6A 3PY8A 4B9NA 1HLUA 1JL1A 4YOTA 4JKGA 4KBOA 4CIGA 5IWAK 5SWMA 1HKCA 1JL2A 3AY9A 2G8FA 2OPPA 1LAVA 4EHUA 2HMPA 4EZ6A 3MAQA 5CHIA 4YOVA 3L4IA 1QE1A 3CCSN 4DR6K 4EP4A 2HNYA 4FOIA 4OPHA 4CFCA 2UXCK 4JKGB 4EIAA 2QM1A 3C95A 3CXCM 1KQSM 3HSCA 1YVNA 1KVAA 4E3SA 3QBXA 1N36K 2OTJN 1TK8A 4DTPA 2A1SA 3A5NC 3VN5A 1BUPA 3VGMA 4X66K 1BU6O 1N6QA 2IOCA 3VF6A 4Z4CA 1XQSC 4OPAA 2Q3SA 4EAHD 3T1AA 1GLLO 4O5BA 4BWJA 4YOXA 4WFBL 4DR7K 2P5OA 1S9GA 1RBTA 2PBDA 3DLGA 2GEMA 5BPNA 5E41A 3VOVA 4EZ9A 3I56N 3SUNA 1U47A 1HNXK 4LF9K 4BRIA 4Z4IA 4WQ5A 2OPSA 4H0VB 3LP0A 1WAFA 2QEXN 4DF8A 3TAFA 4BC5A 3D7EO 1EWRA 3QEWA 1XUPO 1JLAA 3SAFA 2FSJA 5ADXA 1WLJA 1KTQA 1NKEA 4W5NA 4CJ3A 1IG9A 4KHQA 5BRFA 1DKGD 2ZE2A 3HOSA 4JK9A 4I6MA 5KI6A 1YT3A 5C24A 4CEQA 2CGLA 5IT9O 5DMRA 4W5RA 1KAXA 5I9EB 1LW0A 4BRNA 2VG7A 4I6MB 1BOTO 2YI1A 3PLAA 1BCMA 1J54A 3H1QA 3ZSXA 4BRAA 4CF8A 2GUPA 1TV6A 4C1NK 2RHKA 1LV5A 3P31A 4JKFA 4C8KA 3LWMA 1FK9A 5HLFA 2UUCK 2BTFA 4BGAA 2OA8A 3VTIA 5E84A 3ISNC 1BA0A 3LZJA 1CZBA 3GL1A 1VSEA 1ZC6A 1EKEA 2NRZA 4CJQA 2EHGA 3CC4N 3ULDA 4DSKA 3KK1A 5DM6L 1OH5A 3GOIA 4CIEA 3HRGA 3HI0A 2X6NA 3NVMA 4DQ8A 2HVIA 3AA3A 3NAEA 4WE1A 4KHUA 1TL1A 3IRXA 4PKGA 3M8QA 3CPEA 3M8SA 3CJBA 4IDKA 3LZIA 2DY4A 1HPMA 5AQHA 1YIJN 1Z05A 3MECA 2FXUA 4CZFA 4AH9A 3ZSYA 3EZ5A 4AHVA 4E1MA 4J8FA 4CIFA 3OJUA 1KAZA 1T05A 5TKWA 3MN9A 1A5WA 2ZJQL 3FGUA 4DTXA 1Q9YA 1YJWN 4BDYA 1DEJA 4AHCA 3HBTA 1XI1A 2HHWA 3U9ZA 3CC7N 3S41A 4DU1A 4GVEA 3V1RA 1JLQA 1NOYA 4KB1A 4B9MA 2DFHA 3HL8A 4PKHA 1SL1A 1XNQK 3C6HA 3DXKA 1DLOA 4H5WA 4CEBA 1XMQK 3QICA 3QFUA 3K5MA 5M1NA 4IFVA 3DOLA 1RCHA 1L3UA 3O80A 1NG9A 4QS8A 4JRQA 1YXQA 4HWIA 1C0TA 4XH1A 4IG0A 1IV0A 3SV4A 2PY5A 3I0RA 3AVHA 1NGDA 1XHZA 1J5EK 3D2EA 4WYBA 2FF3B 2GELA 4NXNK 4FWKA 3H08A 2XY6A 1JCEA 3OA9A 3KWIA 4CJUA 4HTUA 4JKDA 5C25A 4FJ7A 4DUZK 2OCEA 1U2VA 3D2EB 1N8RO 4E7KA 4PHTX 4I9LA 3VETA 1DTQA 3MXJA 5HROA 1S72N 3ZSRA 1E4FT 3PX0A 3WEEA 1U2VB 4ILJA 3P1GA 3LAKA 3V9ZA 5D3GA 3O4WA 4PL7A 3S9HA 3K5OA 3OHRA 3RR8A 4DV6K 1ITGA 2V52B 3L2WA 3OTOK 2YNFA 3ZLJA 2YV0X 4CGHA 3WEEB 1L3TA 3O9QA 4LD0A 3THYA 3DLHA 1C0GA 2E2OA 2KTQA 2RPIA 5CZ2A 1NK8A 3LP2A 1TKZA 3SNNA 5BRDA 3AAQA 3RMAA 1KC8O 2KKZA 4N76A 3VENA 1RDAA 3UKUA 3THYB 4LF5K 1TKDA 1ZBSA 4OKEA 4K42A 4TSXA 5ADXH 4FJJA 3LDOA 3SPZA 5CYMA 1T8EA 3UKUB 1SKSA 2HSTA 1HQEA 4LF8K 3EEQA 4O4GA 5AQQA 5EVZA 3AO5A 3LWLA 3IAYA 2UUBK 4FJLA 3AO1A 3T7ZA 1SL0A 5FPMA 4BACA 4WFNL 3TWHA 4M3WA 4PUOA 4I9QA 4CEOA 1QVFM 4IZ9A 4KTWA 4DU3A 2E4LA 3HTVA 2QTDA 1SS6A 4AQYK 3ATVA 2RN2A 1HMVA 1Z6RA 4CJFA 2GTDA 1I39A 1HQUA 2FF6A 3FR0A 4FLTA 2JWLA 1QZ6A 5BN9A 1NGEA 3WNEA 4GW6A 3HJFA 4A62A 4YOUA 1U04A 4GY2B 4JAXA 1NGHA 1BGXT 1YI2N 3HP9A 4O44A 1VQ9N 3G71N 3AVIA 5CZ1A 1LWFA 3MEGA 1UA0A 4JI0K 1K6YA 2E2NA 1ATSA 4CGIA 3BGRA 3MK6A 5HL7L 3SMPA 3L8BA 4OGCA 4FJ9A 5FPEA 1BCOA 1ZXOA 2NRTA 4CD3A 4FJXA 3SQ1A 1LAWA 4YOWA 3LP1A 2PZSA 3QIPA 1L3VA 4Q5VA 3DOKA 4JI6K 3G4SN 1SV5A 1EQYA 2QI2A 1RDBA 3CCQN 4CJWA 5AQZA 4IFEA 1QSYA 3AO3A 5AQRA 4M3XA 3HPOA 1RBSA 1NJWA 1SQKA 2P9IB 3EE9A 4FJ5A 4CW7B 2GWKA 2Z1HA 3ULEA 4CZKA 1JJ2M 2P9LA 3DM2A 4AF1A 4CESA 1IKWA 4FLUA 1QTMA 3HK2A 3LPTA 1TL3A 3C7NA 1NK4A 3ULEB 2A42A 4IWVA 1F21A 2P9LB 4DS4A 4N41A 4FM0A 1WSJA 1Y64A 3T69A 3TU5A 3Q7CA 4FWRA 4WQ4A 3C7NB 5BN8A 2QWQA 3PX6A 1Q9XA 2VCPA 1EWQA 1IKYA 3LAMA 1J53A 2HBMA 3NH1A 4PQUA 4W5TA 3P38A 1WBDA 2FLOA 3AO2A 3OYMA 3RMBA 5AZJA 1LWEA 1NJIO 4KPYA 1RDDA 5JLHA 4BDZA 4E7LA 1YAGA 5F2RA 4JEPA 4Z94A 3SMSA 1CZ9A 3KD1E 3QNOA 4JK7A 3OYHA 5AZJB 1T44A 2V51B 2GBZA 4AM7A 4KREA 4CD1A 3AA5X 4BC4A 2HHVA 3PUFA 4JN4A 1JXEA 4JI3K 1RTJA 4CK2A 4FK0A 4MQ3A 5FRMA 2V7YA 2HF4A 2RKIA 2VWKA 1KXPA 1HNIA 4ISFA 2QKKA 3BF3A 1XC9A 4HTLA 5GAHP 1IO2A 4QS7A 5F1XA 3RMDA 3WT0A 1J9AA 2AP1A 2QWRA 4Z4GA 4LH4A 3WQTA 1S1UA 5M1QA 1EP4A 2VGNA 4KV8A 4FLWA 5KQ8A 3VQBA 4AHUA 2QXFA 5DK5A 1REVA 4BVOA 4M3TA 4KTQA 4RW8A 4FWNA 5KPTA 5I3UA 4FLVA 1NBWA 3PIPL 3TARA 4R79A 1U49A 3IFRA 3CFRA 2O4GA 4DMNA 5CR4A 3DLBA 1JLBA 4KH4A 3JYTA 4FJMA 3TANA 3VQ6A 3R8EA 3L2UA 3L6QA 5M1FA 4H0YB 3RRGA 1IBKK 4ZTJA 3EE8A 3L2QA 1KCFA 2WOMA 4CHYA 4GKJK 3H3OB 3KK3A 1NGCA 4KHNA 1GLBG 1Y97A 2YJFA 2IVPA 1BA1A 3FFIA 4CECA 3ENOA 4CHPA 4FJHA 2KHOA 3O9UA 3AVLA 2XY8A 3NF7A 3VQ9A 3NVKA 4NLCA 1MU2A 2F4VK 4JD2A 5HBMA 1ATRA 1NKBA 3OYDA 3O3HA 4LSNA 3D2FA 2E20A 4B3SK 1BQNA 1KAYA 4H0OA 3SJHA 3OYNA 4CZHA 4N47A 2IVNA 4DTNA 5J2NA 3CCVN 2ASPA 5LMNK 1BG3A 2OPRA 4H5TA 2QWMA 3D2FB 4DR2K 3THWA 5BREA 3PSIA 4V19S 4FLYA 5BR8K 1CXUA 1VQLN 2W40A 4QAGA 3V9UA 1QHAA 3CCUN 4FVUA 4NB4A 3THWB 3SUPA 4KH5A 3QLHA 2UXBK 1T6DA 1TKXA 3THXB 1VQ8N 1CLQA 2CH5A 3FLCO 1Q8IA 4CCHA 3HO1A 1VSDA 4B9QA 5AZIA 1M90O 1S6PA 3M5RA 3LM2A 1UOCA 3K5LA 2UUAK 1WUAA 1XHXA 1NGFA 3SZ2A 2V7ZA 2ZF5O 4BDPA 1TK0A 4KI4A 4E0DA 1NJYA 3V9SA 5AZIB 2QWLA 4JV5K 3VQDA 1S9EA 4JKCA 3CMEN 3OYCA 1RDCA 3SK3A 5AQLA 1NK7A 3DWLA 2F9WA 5AQUA 4U67L 4KKOA 3VF2A 2P9UA 3KLEA 2HF3A 3QEXA 2G8WA 5EX5A 4F4KA 5T7BA 3V9WA 1W97L 4B9LA 4GV9A 1Z25A 1A5XA 4M3ZA 1KFDA 4FJIA 3KLGA 1L5UA 1CXQA 2E1YA 3J80O 1T3VA 1WSEA 3TAMA 4X62K 4H4OA 1EO1A 2I5JA 1Q82O 4IG3A 3OYIA 3V1OA 2WONA 2HHSA 1RNHA 4LF6K 2Z1GA 3VEZA 1HJOA 3F9MA 3L2VA 2VYPA 3O1WA 4F3TA 4BREA 1RTHA 3VQ5A 2Z1JA 3TI0A 4JRPA 3HXMA 1NJZA 4CBXA 2OANA 4LFCK 3V4IA 1HUXA 3TTDA 4FWLA 3UE5A 3LDSA 4A61A 4J2AA 4PA1A 2OYQA 3NGYA 3W3DA 3J81O 1RT3A 3VGLA 5AQKA 3MCAB 4KHYA 1U4BA 5AQGA 3BZKA 1K8AO 4E1JA 1SL2A 3CCLN 1MWKA 1NGIA 4K8ZA 2BGGA 3FFKB 3ZSWA 4PWDA 2E2PA 4IEIA 3R1XA 2FBTA 1Q81O 3KLHA 4ELTA 3MCPA 4CJPA 5HP1A 5AQPA 2D0BA 3KIOA 4HHTA 3QETA 4B8AB 3ALYA 1HNZK 1TAUA 1T7PA 4WQ4C 4M41A 3U9DA 1RBUA 4JLHA 4C8LA 4BE2A 1VHXA 3VQ7A 2YJEA 4PL8A 3QB0A 3PO4A 4BVPA 4W5QA 4BE1A 1DT9A 3E9OA 2GUIA 3CETA 4XH5A 2KZMA 3CJAA 4FXDA 3NCIA 3SQ0A 2A41A 4L8RB 3JS6A 4CFBA 1Z26A 3I8DA 4FPBA 4A2BA 1VQ5N 2P5GA 2ASOA 3CF5L 3MDQA 1D4XA 4E1NA 4DSJA 5ELZA 5FDLA 4CZEA 4CI6A 1OH6A 4JK8A 1V4TA 3VTHA 4N56A 2NRRA 4CFAA 5BPLA 2O8DA 3MEDA 1ASUA 4FYDA 1BDGA 4FWOA 1X9SA 4GVMA 4J2EA 1M1KO 3KHYA 2W6KA 3ZT2A 5JMVA 3L3VA 3CI5A 1JKHA 1GLAG 2BDPA 1JLCA 4DFMA 2HMIA 3K5NA 3N4PA 2OZMA 4FW2A 2O8DB 3CCMN 1VSIA 4CFDA 2WFBA 2RE2A 3M6GA 3QIOA 2A1RA 4DTUA 3WXMB 1W2BM 3PSFA 4FM1A 2EX3A 1TGOA 5M1KA 3D45A 1NMDA 4A2AA 2ZGZA 4DLGA 3SBTA 4B3MK 4C8OA 4H0XB 4DV2K 3DXKB 4NCAA 1RT5A 1ATNA 1IH7A 4CHOA 1S5JA 3DRSA 1OH8A 4H03B 4M3UA 4IDHA 4H0TB 3VQEA 1WAJA 3G25A 1HPZA 1QQNA 3ENBA 3HPHA 4IEEA 2HHQA 4O55A 4BRPA 3OS0A 1HNWK 2ZWHA 3L4QA 4M3YA 2I7PA 2HHHK 3NHGA 3CCRN 3SYZA 1U45A 3PO5A 3MXIA 4JI7K 4DFJA 3CC2N 3EYZA 1TUYA 2JLEA 2ZJRL 4YDUA 3K0SA 3BUZB 3GBTA 3WXLA 5KPRA 3AV9A 2Y1JA 2O8FA 4DCHA 1WB9A 2D0OA 4FJKA 3KJVA 3H1VX 1YTUA 3ITHA 4DSEA 4B9VA 4C23A 3GDQA 2ZM6K 4CBUA 3KLFA 3O4QA 1UAXA 1YF5L 2NRHA 5SZTA 3CM5A 2O8EA 2HHTA 2O8FB 4FK4A 1RT2A 1IBLK 1QQMA 3VA0A 4BR4A 3KLIA 2IS3A 4FWPA 4AILC 4CJLA 2A5XA 3O6WA 4LY7A 4GMJB 4WCEL 4F3OA 4HUFA 3TAQA 1BIZA 1WN7A 3K57A 4X64K 4OKKA 1O13A 4CEDA 5HRPA 1LWCA 2IGIA 3S3NA 3L2RA 4CEFA 2O4IA 2F8TA 3TSUA 4BRKA 3DAWA 3AVFA 2BUPA 4OPJA 1FW6A 5JS2A 5C15A 2QKBA 4LC9B 3VEWA 1Q86O 3CPWM 2HBKA 2X74A 3B6OA 4DB3A 4RW9A 4H0PA 1KRPA 5CY4A 3GG4A 2R7YA 1VK0A 1SAZA 4DG1A 4PY5A 2UYTA 3EZWA 3WQUA 1OVQA 1KFSA 3P5JA 4MO4A 4DQSA 2IIRA 4ISEA 3HT3A 1IJJA 2XHBA 4DSFA 1NNEA 2ITGA 3NBPA 1R59O 2FSNA 3ENHA 2QA4N 4BGBA 1J5OA 4HVJA 1H1VA 4MDAA 5AQVA 3RR7A 1XC3A 1X3NA 3C6TA 1S1XA 3C6AA 3CG7A 4GV3A 1FKPA 4HCCA 4JI5K 3ZYYX 1T6CA 4YORA 4FM2A 1YVUA 2PAVA 4MLEA 1YJ9N 3A0IX 1B9DA 4OO1J 4E7JA 5MLCQ 3SPYA 2YKNA 3KK7A 4ICLA 4Z4FA 1BWFO 4KO0A 3ZX2A 4AHRA 3O9RA 4ID5A 5AQTA 1FKOA 3VEVA 4WQ5C 3OYEA 4JI2K 2BH1A 2B5JA 4H4MA 4KB0A 4IKFA 4O5FA 2HHUA 3TAPA 2KFZA 3KTQA 4JYAK 2IVOA 2B4JA 3O9TA 3A5MC 3U8XA 4NYFA 3ZSOA 4BR9A 3QMLA 4YHHK 2PYJA 1ESVA 3ZT0A 2HHXA 4FJ8A 3G0ZA 2KZZA 2FBVA 3VEYA 3BEXA
chains in the Genus database with same CATH topology
3MX5A 4JKEA 1XUPO 3EKUA 3L6QA 5BR9A 2FSJA 4H0YB 5ADXA 5M1FA 3SAFA 3CCQN 2HOEA 1YUWA 3EE8A 3ZX3A 4B1UB 3DJCA 3H3OB 3LDNA 3QBWA 5BRFA 2ZGYA 1NGCA 1DKGD 4CZMA 5GIPA 3HOSA 4JK9A 1GLBG 2YJFA 4I6MA 4IJAA 2IVPA 1BA1A 3ENOA 2CGLA 3KZBA 2KHOA 3O9UA 3TSPA 5AQWA 3O08A 3NVKA 4NLCA 3M3ZA 1QQOA 4JD2A 1KAXA 5I9EB 5H1SQ 3HOTA 3H46O 1ATRA 4BRNA 4BQLA 4BRQA 5M1OA 1JCFA 5AQIA 4I6MB 1BOTO 2D1KA 2YI1A 3LL3A 1IG8A 3PLAA 3H1QA 4ISGA 4BRAA 2E88A 1G99A 2GUPA 3D2FA 5AQJA 5AQMA 2E20A 4C1NK 2RHKA 3O8MA 1YHQN 2WC9A 3P31A 1KAYA 4JKFA 3JXUA 3MX2A 4H0OA 3SJHA 4IOXA 4FWQA 4CZHA 2IVNA 2NRWA 3W0LA 3FZLA 2BTFA 4BGAA 3CCVN 3VTIA 2ASPA 2P9NA 1BG3A 4H5TA 4BQZA 1WOQA 5KQDA 2QWMA 3D2FB 5E84A 3KVGA 1BA0A 3ATUA 5BREA 2NRXA 4JKAA 3U4LA 3GL1A 2D4WA 1VQLN 1ZC6A 2W40A 5KPZA 2NRZA 2E8AA 1QHAA 2Q0RA 5B8HA 3CC4N 2CGJA 5DM6L 3GOIA 3CCUN 1LOTB 2P9NB 2WBNA 4FVUA 4NB4A 4RCHA 3HRGA 3HI0A 3ZX0A 4KH5A 3NVMA 4BR5A 4O8KA 1MA9B 1T6DA 3KWGA 3EO3A 4DQ8A 1K9MO 2QWPA 1VQ8N 2QXLA 2CH5A 2F7TA 3ID6A 5LY3A 5AQSA 3FLCO 3GE1A 4PKGA 4CZGA 3CPEA 4FOEA 4B9QA 3CJBA 5AZIA 3CQYA 1RGIA 1RDUA 4BRGA 1M90O 3M5RA 1HPMA 5AQHA 3LM2A 2YHYA 1YIJN 1WUAA 1Z05A 3FZKA 2FXUA 4CZFA 1NGFA 3WXIA 2Q0UA 2V7ZA 2A3ZA 3CHWA 2ZF5O 4G9ZA 4J8FA 1KAZA 3EN9A 3J8AA 5TKWA 3MN9A 1X3MA 2ZJQL 3FGUA 5AZIB 2QWLA 4JKBA 1YJWN 4JKCA 3CMEN 1DEJA 2E2QA 3SK3A 1VQPN 4FL9A 3HBTA 5AQLA 3VEOA 3DWLA 2F9WA 3U9ZA 5AQUA 4U67L 1MDUB 5DM7L 3CC7N 3S41A 3VF2A 2ZJPL 2P9UA 2HF3A 3CERA 4GVEA 4EFHA 5LJWA 5BRHA 1TUUA 1QZ5A 5EX5A 3CMAN 1J6ZA 1W97L 1DGKN 4F9OA 4JKHA 4GV9A 3QFPA 4A5BA 2ITMA 4PKHA 2A40A 2NRVA 3H6EA 1P90A 4BC3A 1NWKA 5C12A 3C6HA 2FSKA 2E1YA 3NMUA 3DXKA 4H5WA 1T3VA 3QICA 3QFUA 2HBJA 1VQON 4K41A 5JVGL 1NGGA 5AFUH 5M1NA 1EO1A 1Q82O 4FSVA 4BRLA 3O80A 3VPZA 1K73O 4QS8A 3CIPA 3F5TA 5AQFA 3VEZA 2Q31A 1YXQA 1X9JA 3ID8A 1NM1A 1HJOA 3CJ9A 4HWIA 3F9MA 3FZMA 4XH1A 2VYPA 3O1WA 2QW9A 4BREA 1NGDA 5CE3A 3FZFA 3D2EA 5AR0A 4WYBA 2FF3B 2GELA 1QVGM 3I33A 3HZ6A 3IKMA 4FWKA 4B1VA 4CBXA 1NGAA 1JCEA 4PKIA 2OANA 3OA9A 3KWIA 1HUXA 3UKRA 3TTDA 4B1ZA 2QWNA 4FWLA 4JKDA 3ZETA 3UE5A 4A61A 2P9IA 2HBLA 3R3LA 3W3DA 2I7NA 3VGLA 4NO7A 1U2VA 3MCAB 5AQKA 2P9SA 1NLVA 5BPMA 4XEIA 3D2EB 5AQGA 1N8RO 4PHTX 1K8AO 4E1JA 4A57A 4DHYA 3CCLN 1NGIA 1MWKA 4C1NI 3VETA 3VGKA 3A5LC 3IMXA 3FFKB 3UKRB 2E2PA 4IEIA 3ZETB 3R1XA 3LM9A 1S72N 2DPNA 2J4RA 1E4FT 4ILGB 1Q81O 3HM8A 5GADP 3WEEA 1U2VB 4ILJA 2P9SB 3R9PA 4BR7A 3MCPA 3O4WA 2NLXA 4PL7A 4JD2B 1RDWX 5AQPA 1VAZA 3OHRA 2JWKA 2V52B 4CZJA 1SZ2A 3LDQA 4IXCA 4BR0A 4IO8A 4ILHA 4CZIA 2Q1NA 5AQNA 3DXMA 3WEEB 3O9QA 1C0GA 2E2OA 1NGBA 5LJVA 4BG9A 3C0BA 1U6ZA 4WQ4C 4CZLA 4Y0WA 3AARA 2Q2RA 4L3QA 3U9DA 5BRDA 3AAQA 1KC8O 2KKZA 5TKYA 3EL2A 3CQXA 3VENA 2YJEA 3DXMB 3QB0A 4FPAA 4PL8A 3UKUA 4UY8O 4BVPA 4RTFD 1DT9A 3E9OA 1ZBSA 1VQNN 1V4SA 3CETA 4XH5A 4K42A 1Q18A 3CJAA 5ADXH 5E26A 1CZAN 4H5VA 4MO5A 3LDOA 4A59A 2A41A 3JS6A 1MWMA 3TPQA 3UKUB 2HSTA 4B1WB 4FPBA 4A2BA 4CBWA 2OTLN 5EVZA 1LCUA 3K9JA 5AQQA 1VQ5N 2ASOA 2E1ZA 3CF5L 3MDQA 4BY9C 1D4XA 5AQYA 5ELZA 3VMFB 1ILYA 4CZEA 4CI6A 1GLCG 4JK8A 1V4TA 2PFUA 2YCHA 2VWBA 3O9SA 3VTHA 3T7ZA 2NRRA 2VGMA 5FPMA 5BPLA 4B1YB 4WFNL 4IOAL 1NGJA 4FWMA 5EOYA 5GINA 1BDGA 4FWOA 1QVFM 3RVCA 4IZ9A 1M1KO 3KHYA 5C0YA 5JMVA 2KLAA 3E1YA 3CI5A 1GLAG 2QTDA 3HTVA 4FWSA 1YJNN 2ASMA 3LDPA 1SS6A 3ATVA 4MDBA 3K9KA 3VEXA 1Z6RA 1HX1A 1VQ4N 3CCEN 3N4PA 2GTDA 4JNEA 1GLEG 3O5BA 2FF6A 3CCMN 3FR0A 3TTCA 2JWLA 3CCJN 3QDKA 1QZ6A 2WFBA 5BN9A 2RE2A 3M6GA 1NGEA 1K8KA 2P9UB 4KH6A 3WXMB 3MWTA 1W2BM 3VERA 3SLCA 5JLFA 3OBWA 4A62A 3E9LA 5M1KA 1NMDA 4YOUA 2D0PA 4A2AA 2ZGZA 4BG8A 3SBTA 3I8BA 4GY2B 4JAXA 3AGRA 1NGHA 4B1XB 1YI2N 5HOOA 1VQ9N 4H0XB 3G71N 3DXKB 1K8KB 4JHDA 4BROA 2E2NA 2GX9A 1ATSA 2Q97A 1ATNA 3MN7A 3MK6A 5HL7L 4DKWA 1YITN 2YHWA 5F0XA 3IDHA 4H03B 2GWJA 4IDHA 4H0TB 3SMPA 2A6AA 4WFAL 1RFQA 1TYQA 3G25A 5FPEA 4YOYA 1QQNA 3ENBA 4IEEA 4YDUC 1ZXOA 2NRTA 4A5AA 4CD3A 4BRPA 2W41A 3SAGA 5GIOA 1GLFO 2H3GX 4AM6A 3P4IA 2ZWHA 3L4QA 4O8UA 2I7PA 2QWOA 4JHDB 3CCRN 3VESA 4FO0A 4YOWA 3D6RA 4NLBA 5FPDA 3G4SN 1EQYA 2QI2A 3TSQA 4BC2A 3CC2N 1TYQB 3WUHA 1TUYA 2ZJRL 4XH4A 4YDUA 1GLJO 3AGKA 3BUZB 3E66A 3GBTA 3MN5A 5AQZA 4IFEA 3WXLA 3WXKA 5M1PA 4M63C 5KPRA 5AQRA 5GAEP 4DCHA 4BRFA 2D0OA 3B8AX 4K43A 1SQKA 2EWSA 2P9IB 3H1VX 3MMVA 4GV6A 2P9KA 3EE9A 4C23A 2Q36A 3AAPA 5AQOA 3GDQA 2AA4A 1VQMN 2F9TA 4CBUA 2GWKA 3L0QA 5C2DA 1YF5L 3ULEA 5GAGP 2NRHA 3BP8A 3EKSA 4CZKA 4WF9L 4CJ7A 1JJ2M 3SAHA 2P9LA 1OVYA 4AF1A 4BRDA 4RWTA 1QQMA 3Q7BA 2P9KB 3M1FA 3N4QA 4BR4A 2YHXA 1HKBA 5EY4A 3BF1A 3H45C 4FWPA 3C7NA 3ULEB 1OKJA 2A42A 2A5XA 3O6WA 4IWVA 1Q7YO 4WCEL 1GLDG 2P9LB 5AQXA 1P8ZA 5JICA 3H3NO 4IJNA 1O13A 3F2KA 1Y64A 3DLLL 5C2FA 3A5OC 3T69A 3TU5A 3Q7CA 4FWRA 1VQ7N 1HKGA 4WQ4A 3C7NB 1E4GT 3LDLA 2QWQA 3TSUA 4BRKA 5BN8A 2VCPA 2WUSA 2HBMA 3CJ1A 3DAWA 3WXJA 2BUPA 4EHTA 3UB5A 5C15A 4BRHA 3P38A 4LC9B 3VEWA 2NZTA 1JCGA 3CPWM 2FLOA 4IO9L 3CJCA 1Q86O 2HBKA 5JVHL 3PIOL 5AZJA 5AFUA 4GNIA 4DB3A 5JLHA 3TTFA 1NJIO 1YAGA 3MWPA 4H0PA 4M7YA 2NNWA 4BRMA 3GG4A 4U7BA 1SAZA 1VQKN 1HLUA 2UYTA 3EZWA 4JKGA 5F2RA 4YOTA 3WQUA 4KBOA 4JEPA 1HKCA 3O1BA 4MO4A 3SMSA 3AY9A 4Z94A 2IIRA 3A8YA 4ISEA 2HMPA 4EHUA 1IJJA 4JK7A 5CHIA 5AZJB 1T44A 4YOVA 3L4IA 2V51B 4M7XA 3CCSN 3CD6N 4AM7A 4BR2A 1KD1O 4CD1A 1S3XA 4FOIA 3FZHA 1R59O 4OPHA 4BC4A 2FSNA 4JKGB 3ENHA 4JN4A 4EIAA 5FPNA 1VQ6N 4BRCA 4H5RA 2QA4N 2QM1A 4BGBA 5EXWA 3MN6A 3CXCM 1H1VA 1KQSM 4MDAA 3HSCA 5AQVA 3FE1A 1C0FA 1YVNA 2V7YA 2HF4A 3QBXA 1KXPA 1XC3A 1X3NA 3SBGA 4ISFA 2OTJN 3BF3A 3C6AA 4GV3A 3A5NC 4HTLA 5GAHP 3ZYYX 3J7ZO 3VF4A 1BUPA 1T6CA 4YORA 1S22A 3VGMA 1BU6O 4H5NA 4QS9A 3I55N 4QS7A 2YX6A 5F1XA 3VF6A 3WT0A 2AP1A 2CH6A 2PAVA 4MLEA 1YJ9N 1XQSC 3A0IX 2QWRA 4OPAA 4OO1J 2P9PA 3WQTA 3CJ7A 3ZEUA 4EAHD 5MLCQ 3KK7A 3G6EN 1GLLO 1BWFO 3P39A 2VGNA 5M1QA 2CGKA 3ZX2A 4YOXA 4WFBL 3O9RA 5AQTA 3VEVA 4WQ5C 3RSEA 5KQ8A 2PBDA 3C65A 2GEMA 5BPNA 2BH1A 3OBYA 3VOVA 4O5FA 4BVOA 4MLHA 2P9PB 2IVOA 4FWNA 5KPTA 3ZEUB 3I56N 3O9TA 3A5MC 3E9PA 4K25A 3U8XA 3R6MA 1NBWA 4BRIA 3PIPL 4WQ5A 4H0VB 4R79A 3RSEB 4BR9A 3QMLA 3IFRA 2QEXN 1ESVA 4IOCL 5CR4A 5C10A 3OW2M 4KH4A 1BO5O 4BC5A 3IUCA 3VEYA 3BEXA 3D7EO 3R8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XUP O;  3EKU A;  3L6Q A;  5BR9 A;  2FSJ A;  4H0Y B;  5ADX A;  2HOE A;  1YUW A;  3ZX3 A;  4B1U B;  3DJC A;  3H3O B;  3LDN A;  3QBW A;  5BRF A;  2ZGY A;  1NGC A;  1DKG D;  4CZM A;  1GLB G;  2YJF A;  4I6M A;  4IJA A;  2IVP A;  1BA1 A;  3ENO A;  2CGL A;  3KZB A;  2KHO A;  5AQW A;  3O08 A;  3M3Z A;  1QQO A;  4JD2 A;  1KAX A;  5I9E B;  3H46 O;  1ATR A;  4BRN A;  4BQL A;  4BRQ A;  1JCF A;  5AQI A;  4I6M B;  1BOT O;  2D1K A;  2YI1 A;  3LL3 A;  1IG8 A;  3H1Q A;  4ISG A;  4BRA A;  2E88 A;  1G99 A;  2GUP A;  3D2F A;  5AQJ A;  5AQM A;  2E20 A;  3O8M A;  1KAY A;  3JXU A;  4H0O A;  3SJH A;  4FWQ A;  4CZH A;  2IVN A;  3W0L A;  3FZL A;  2BTF A;  4BGA A;  2ASP A;  2P9N A;  1BG3 A;  4H5T A;  4BQZ A;  1WOQ A;  5KQD A;  2QWM A;  3D2F B;  5E84 A;  3KVG A;  1BA0 A;  3ATU A;  5BRE A;  3U4L A;  3GL1 A;  2D4W A;  1ZC6 A;  2W40 A;  5KPZ A;  2E8A A;  1QHA A;  2Q0R A;  5B8H A;  2CGJ A;  3GOI A;  1LOT B;  2P9N B;  4NB4 A;  4RCH A;  3HI0 A;  3ZX0 A;  4BR5 A;  4O8K A;  1MA9 B;  1T6D A;  3EO3 A;  4DQ8 A;  2QWP A;  2QXL A;  2CH5 A;  5LY3 A;  5AQS A;  3FLC O;  3GE1 A;  4PKG A;  4CZG A;  4FOE A;  4B9Q A;  3CJB A;  5AZI A;  3CQY A;  1RGI A;  4BRG A;  1HPM A;  5AQH A;  3LM2 A;  2YHY A;  1WUA A;  1Z05 A;  3FZK A;  2FXU A;  4CZF A;  1NGF A;  3WXI A;  2Q0U A;  2V7Z A;  2A3Z A;  3CHW A;  2ZF5 O;  4J8F A;  1KAZ A;  3EN9 A;  3J8A A;  3MN9 A;  1X3M A;  3FGU A;  5AZI B;  2QWL A;  1DEJ A;  2E2Q A;  3SK3 A;  4FL9 A;  3HBT A;  5AQL A;  3VEO A;  3DWL A;  2F9W A;  3U9Z A;  5AQU A;  1MDU B;  3S41 A;  3VF2 A;  2P9U A;  2HF3 A;  3CER A;  4EFH A;  5LJW A;  5BRH A;  1TUU A;  1QZ5 A;  5EX5 A;  1J6Z A;  1DGK N;  4F9O A;  3QFP A;  2ITM A;  4PKH A;  2A40 A;  3H6E A;  4BC3 A;  1NWK A;  2FSK A;  2E1Y A;  3DXK A;  4H5W A;  3QIC A;  3QFU A;  4K41 A;  1NGG A;  5AFU H;  4FSV A;  4BRL A;  3O80 A;  3VPZ A;  4QS8 A;  3CIP A;  5AQF A;  3VEZ A;  2Q31 A;  1YXQ A;  1X9J A;  3ID8 A;  1NM1 A;  1HJO A;  3CJ9 A;  4HWI A;  3F9M A;  3FZM A;  4XH1 A;  2VYP A;  3O1W A;  2QW9 A;  4BRE A;  1NGD A;  5CE3 A;  3FZF A;  3D2E A;  5AR0 A;  4WYB A;  2FF3 B;  2GEL A;  3I33 A;  3HZ6 A;  4FWK A;  4B1V A;  4CBX A;  1NGA A;  1JCE A;  4PKI A;  2OAN A;  3UKR A;  1HUX A;  4B1Z A;  2QWN A;  4FWL A;  3ZET A;  3UE5 A;  4A61 A;  2P9I A;  3W3D A;  2I7N A;  3VGL A;  4NO7 A;  1U2V A;  5AQK A;  5BPM A;  2P9S A;  1NLV A;  4XEI A;  3D2E B;  5AQG A;  4E1J A;  4DHY A;  1NGI A;  1MWK A;  3VET A;  3VGK A;  3A5L C;  3IMX A;  3FFK B;  3UKR B;  2E2P A;  3ZET B;  3LM9 A;  2DPN A;  2J4R A;  1E4F T;  3HM8 A;  3WEE A;  1U2V B;  2P9S B;  3R9P A;  4BR7 A;  3MCP A;  3O4W A;  2NLX A;  4PL7 A;  4JD2 B;  1RDW X;  5AQP A;  3OHR A;  2V52 B;  4CZJ A;  1SZ2 A;  3LDQ A;  4IXC A;  4BR0 A;  4IO8 A;  4CZI A;  2Q1N A;  5AQN A;  3DXM A;  3WEE B;  1C0G A;  2E2O A;  1NGB A;  5LJV A;  4BG9 A;  3C0B A;  1U6Z A;  4WQ4 C;  4CZL A;  4Y0W A;  3AAR A;  2Q2R A;  4L3Q A;  3U9D A;  5BRD A;  3AAQ A;  5TKY A;  3EL2 A;  3CQX A;  3VEN A;  2YJE A;  3DXM B;  3QB0 A;  4FPA A;  4PL8 A;  3UKU A;  4BVP A;  4RTF D;  1ZBS A;  1V4S A;  3CET A;  4XH5 A;  4K42 A;  1Q18 A;  3CJA A;  5ADX H;  5E26 A;  1CZA N;  4H5V A;  4MO5 A;  3LDO A;  2A41 A;  3JS6 A;  1MWM A;  3TPQ A;  3UKU B;  4B1W B;  4FPB A;  4A2B A;  4CBW A;  5EVZ A;  1LCU A;  5AQQ A;  2ASO A;  2E1Z A;  3MDQ A;  1D4X A;  5AQY A;  5ELZ A;  4CZE A;  4CI6 A;  1GLC G;  1V4T A;  2YCH A;  2VWB A;  5BPL A;  5FPM A;  4B1Y B;  1NGJ A;  4FWM A;  5EOY A;  1BDG A;  4FWO A;  4IZ9 A;  3KHY A;  5JMV A;  3HTV A;  3CI5 A;  1GLA G;  4FWS A;  2ASM A;  3LDP A;  3ATV A;  1Z6R A;  1HX1 A;  4JNE A;  2GTD A;  1GLE G;  3O5B A;  2FF6 A;  3FR0 A;  3QDK A;  1QZ6 A;  5BN9 A;  3M6G A;  1NGE A;  1K8K A;  2P9U B;  3VER A;  3SLC A;  5JLF A;  4A62 A;  1NMD A;  2D0P A;  4A2A A;  2ZGZ A;  4BG8 A;  3I8B A;  4GY2 B;  4JAX A;  4B1X B;  1NGH A;  4H0X B;  3DXK B;  1K8K B;  4JHD A;  4BRO A;  2E2N A;  1ATS A;  2Q97 A;  1ATN A;  3MN7 A;  3MK6 A;  2YHW A;  5F0X A;  3IDH A;  4H03 B;  2GWJ A;  3SMP A;  4H0T B;  2A6A A;  1RFQ A;  1TYQ A;  3G25 A;  5FPE A;  1QQN A;  4YDU C;  1ZXO A;  4CD3 A;  4BRP A;  2W41 A;  1GLF O;  2H3G X;  4AM6 A;  3P4I A;  2ZWH A;  2I7P A;  2QWO A;  4JHD B;  3VES A;  4FO0 A;  5FPD A;  1EQY A;  4BC2 A;  1TYQ B;  3WUH A;  1TUY A;  4XH4 A;  4YDU A;  1GLJ O;  3BUZ B;  3GBT A;  3VEX A;  3WXL A;  3MN5 A;  5AQZ A;  3WXK A;  5KPR A;  4M63 C;  5AQR A;  4DCH A;  4BRF A;  2D0O A;  3B8A X;  4K43 A;  1SQK A;  2EWS A;  2P9I B;  3H1V X;  3MMV A;  2P9K A;  4C23 A;  2Q36 A;  3AAP A;  5AQO A;  3GDQ A;  2AA4 A;  2F9T A;  4CBU A;  2GWK A;  3L0Q A;  3ULE A;  2NRH A;  3BP8 A;  3EKS A;  4CZK A;  4CJ7 A;  2P9L A;  4BRD A;  4RWT A;  1QQM A;  2P9K B;  3M1F A;  4BR4 A;  2YHX A;  1HKB A;  5EY4 A;  3BF1 A;  3H45 C;  4FWP A;  3C7N A;  3ULE B;  1OKJ A;  2A42 A;  2A5X A;  3O6W A;  4IWV A;  1GLD G;  2P9L B;  5AQX A;  1P8Z A;  5JIC A;  3H3N O;  4IJN A;  1Y64 A;  3A5O C;  3TU5 A;  4FWR A;  1HKG A;  4WQ4 A;  3C7N B;  1E4G T;  3LDL A;  2QWQ A;  4BRK A;  5BN8 A;  2VCP A;  2WUS A;  3CJ1 A;  3DAW A;  3WXJ A;  2BUP A;  4EHT A;  3UB5 A;  4BRH A;  4LC9 B;  3VEW A;  2NZT A;  1JCG A;  2FLO A;  3CJC A;  5AZJ A;  5AFU A;  4GNI A;  4DB3 A;  5JLH A;  1YAG A;  4H0P A;  4M7Y A;  4BRM A;  3GG4 A;  1SAZ A;  1HLU A;  2UYT A;  3EZW A;  3WQU A;  5F2R A;  4KBO A;  1HKC A;  3O1B A;  4MO4 A;  3SMS A;  3AY9 A;  4Z94 A;  2IIR A;  3A8Y A;  4ISE A;  2HMP A;  4EHU A;  1IJJ A;  5AZJ B;  1T44 A;  3L4I A;  2V51 B;  4M7X A;  4AM7 A;  4BR2 A;  4CD1 A;  1S3X A;  4FOI A;  3FZH A;  1R59 O;  4BC4 A;  2FSN A;  3ENH A;  4JN4 A;  4EIA A;  5FPN A;  4BRC A;  4H5R A;  2QM1 A;  4BGB A;  5EXW A;  3MN6 A;  1H1V A;  3HSC A;  5AQV A;  3FE1 A;  1C0F A;  1YVN A;  2V7Y A;  2HF4 A;  3QBX A;  1KXP A;  1XC3 A;  1X3N A;  4ISF A;  3BF3 A;  3A5N C;  4HTL A;  3VF4 A;  1BUP A;  1T6C A;  3VGM A;  1S22 A;  1BU6 O;  4H5N A;  4QS9 A;  4QS7 A;  5F1X A;  3VF6 A;  3WT0 A;  2AP1 A;  2CH6 A;  2PAV A;  4MLE A;  1XQS C;  3A0I X;  2QWR A;  2P9P A;  3WQT A;  3CJ7 A;  3ZEU A;  4EAH D;  1GLL O;  1BWF O;  3ZX2 A;  2CGK A;  5AQT A;  3VEV A;  4WQ5 C;  3RSE A;  5KQ8 A;  2PBD A;  2GEM A;  5BPN A;  3VOV A;  4O5F A;  4BVO A;  4MLH A;  2P9P B;  2IVO A;  4FWN A;  5KPT A;  3ZEU B;  3A5M C;  4K25 A;  3U8X A;  3R6M A;  1NBW A;  4BRI A;  4WQ5 A;  4H0V B;  3RSE B;  4BR9 A;  3QML A;  3IFR A;  1ESV A;  1BO5 O;  4BC5 A;  3IUC A;  3VEY A;  3BEX A;  3D7E O;  3R8E A; 
#chains in the Genus database with same CATH topology
 1TKT A;  3J7Y P;  3EKU A;  5BR9 A;  4ZHR A;  4DTR A;  4YNQ A;  3RTV A;  3QEV A;  1YUW A;  3DRR A;  5LL6 Z;  3ZX3 A;  2XY5 A;  4K8X A;  3AVM A;  4UQG A;  3WNF A;  3LDN A;  3QBW A;  3OYF A;  4F2R A;  1UA1 A;  5GIP A;  4DV4 K;  2G8U A;  4IJA A;  3MEE A;  1S1W A;  4FJN A;  3IG1 A;  3K59 A;  3KZB A;  1XWL A;  3TSP A;  3O08 A;  3QO9 A;  3NF6 A;  1QQO A;  5H1S Q;  3HOT A;  2P51 A;  4H8K A;  4BQL A;  4BRQ A;  1I94 K;  1JCF A;  5AQI A;  3LL3 A;  3G10 A;  3V9X A;  4ISG A;  2E88 A;  3HST B;  4DTM A;  1YTA A;  5AQJ A;  3VQC A;  2VWJ A;  4DTJ A;  4F8R A;  3O8M A;  1YHQ N;  4B3O A;  3AVG A;  2WC9 A;  4DQI A;  3MX2 A;  1X9M A;  4IOX A;  3FZL A;  1QQC A;  3SJJ A;  4BQZ A;  5J2P A;  1WOQ A;  2G8V A;  1SKR A;  2NRX A;  4JKA A;  1W0H A;  3U4L A;  2D4W A;  2E8A A;  1HYZ A;  2Q0R A;  4CGD A;  3RMC A;  4ELV A;  2CGJ A;  1LOT B;  1UWB A;  4FJG A;  2G8H A;  1MA9 B;  1K9M O;  3EO3 A;  2QWP A;  2F7T A;  3ID6 A;  4XIU A;  3OS2 A;  1RIL A;  3OYL A;  4CZG A;  4FOE A;  3CQY A;  3T19 A;  4QOZ B;  2D0A A;  1NK5 A;  1C6V A;  2YHY A;  1C0M A;  2Q0U A;  2A3Z A;  3VQ4 A;  4G9Z A;  4W5O A;  1X3M A;  1S1T A;  3CFP A;  1D9D A;  4JKB A;  2E2Q A;  1VQP N;  4FL9 A;  4DQQ A;  5I42 A;  1MDU B;  5DM7 L;  4OPK A;  4C8N A;  5LJW A;  3CER A;  1R0A A;  4CGF A;  5BRH A;  3CMA N;  1B9F A;  1DGK N;  4F9O A;  4JKH A;  3T1H K;  1QSS A;  2ITM A;  1N34 K;  4YFU A;  4RW6 A;  2NRV A;  1P90 A;  1RT1 A;  1NWK A;  5C12 A;  4DQR A;  4KAZ A;  1RT4 A;  1KLN A;  2HVH A;  4K41 A;  5JVG L;  1NGG A;  4ZTF A;  4Z0U A;  4BRL A;  3VPZ A;  2NUB A;  1K73 O;  3NGI A;  3HVT A;  3CIP A;  4CER A;  3CJ9 A;  4IFY A;  3S3O A;  5CE3 A;  4DWI A;  5AR0 A;  2E6M A;  4CJS A;  3I33 A;  3HZ6 A;  1NGA A;  2Z1I A;  3QEP A;  3T1Y K;  2QWN A;  4BWM A;  2HBL A;  1L3S A;  3R3L A;  4AHS A;  2YHB A;  2QK9 A;  1WSH A;  4NO7 A;  3ZT1 A;  5BPM A;  2P9S A;  3QER A;  1ZBU A;  2W6L A;  4DHY A;  2F96 A;  4Y1D A;  3VGK A;  1OH7 A;  3IMX A;  1BIU A;  4J2B A;  4E89 A;  3LM9 A;  1RBV A;  2IC3 A;  4CJ4 A;  2J4R A;  4ILG B;  3VQP A;  2P9S B;  4CJR A;  1TVR A;  3BY5 A;  3CFO A;  4OX9 K;  4JD2 B;  2HNZ A;  1VSH A;  4CF0 A;  1VAZ A;  4NYN A;  1SZ2 A;  4BR0 A;  4IXC A;  4CJV A;  4ILH A;  4DR3 K;  2Q1N A;  3JAM O;  5AQN A;  1JLF A;  4CEA A;  4DV5 K;  1U6Z A;  4CZL A;  4Y0W A;  4CVN E;  2YNI A;  4L3Q A;  1SUQ A;  3V81 A;  3EL2 A;  5JS1 A;  3P83 D;  4FPA A;  4CF9 A;  4KHP K;  4UY8 O;  2BAN A;  2F8S A;  4RTF D;  1VQN N;  3AO4 A;  1CZA N;  3V1Q A;  3ZCM A;  4A59 A;  1JLG A;  1ASV A;  1MWM A;  4ELU A;  1W7A A;  4B1W B;  4CBW A;  2OTL N;  3K9J A;  3MXM A;  2E1Z A;  2ETJ A;  4BY9 C;  3CQ8 A;  5AQY A;  2HND A;  3HP6 A;  2E5L K;  4DTS A;  1GLC G;  2YCH A;  2VWB A;  3O9S A;  2VGM A;  4Y1C A;  4B1Y B;  1GOB A;  3U3G A;  3J7A P;  4FCY A;  4IOA L;  1NGJ A;  5EOY A;  3OYJ A;  4DQP A;  1FXX A;  3CM6 A;  4DTO A;  5C0Y A;  2KLA A;  3E1Y A;  4FWS A;  5C42 A;  4DSI A;  4LF4 K;  4CK3 A;  1YJN N;  2ASM A;  3LDP A;  4DS5 A;  3THV A;  4HCB A;  3K9K A;  1HX1 A;  1VQ4 N;  4FZZ A;  2G8I A;  5CYQ A;  3O5B A;  3AVA A;  2IAJ A;  1T03 A;  1ZBH A;  3TTC A;  3QDK A;  2P9U B;  4KH6 A;  3MWT A;  3VER A;  3SLC A;  4B3T K;  1TAQ A;  3ASM A;  3E9L A;  2ZQB A;  4BG8 A;  1EXQ A;  3AVJ A;  3I8B A;  4B1X B;  3AGR A;  1TK5 A;  5HOO A;  2XRI A;  3F9K A;  3TAE A;  4JHD A;  3SUQ A;  3MN7 A;  2D5R A;  3SQ4 A;  1B92 A;  1YIT N;  2YHW A;  4LFB K;  3IDH A;  2GWJ A;  1HYS A;  4WFA L;  1VSL A;  1HYV A;  4YY3 K;  4YOY A;  3M8R A;  1WNS A;  3SAG A;  3J7Z O;  4M45 A;  2W41 A;  4CF2 A;  1GLF O;  2H3G X;  4AM6 A;  3P4I A;  3EY1 A;  2QWO A;  4JHD B;  3VES A;  1A5V A;  4FO0 A;  2D0C A;  1I3A A;  4DV3 K;  5FPD A;  2VQE K;  3TSQ A;  4BC2 A;  4CE9 A;  4E7I A;  2DTU A;  3VEX A;  1GLJ O;  3E66 A;  4JS4 A;  3MN5 A;  3WXK A;  3VA3 A;  4M63 C;  5KGX A;  4BRF A;  3B8A X;  3MMV A;  2P9K A;  2Y1I A;  1VSJ A;  2Q36 A;  2AA4 A;  2F9T A;  3QIN A;  5C2D A;  5J1E A;  1JXB A;  4J2D A;  3BP8 A;  3EKS A;  4CJ7 A;  3SAH A;  1OVY A;  3AA4 A;  2OPQ A;  1WSF A;  4RWT A;  1KVB A;  3Q7B A;  2P9K B;  3M1F A;  3N4Q A;  1HNV A;  5J2M A;  1QS4 A;  2IDO A;  5EY4 A;  1RT7 A;  2ATQ A;  3U6F A;  3PV8 A;  4FZX C;  4OLB A;  4DFP A;  1OKJ A;  5A2Q O;  3K2P A;  1N32 K;  5JIC A;  3F2K A;  3DLL L;  2BE2 A;  5C2F A;  1IBM K;  4JI8 K;  1VQ7 N;  1HKG A;  1SKW A;  1E4G T;  1WSI A;  2KQ2 A;  2WUS A;  4EHT A;  3E01 A;  4BRH A;  4MFB A;  2NZT A;  2UXD K;  3CJC A;  5JVH L;  3RRH A;  3IS9 A;  3LAL A;  3OVN A;  4GNI A;  5AFU A;  4B3R K;  3TTF A;  4FVM A;  3MWP A;  4M7Y A;  3DLR A;  2LSN A;  1BL3 A;  4U7B A;  3ZT3 A;  4K0K K;  1VQK N;  2YHA A;  4OKJ A;  3O1B A;  3OYB A;  3A8Y A;  4DU4 A;  4KFB A;  4FLZ A;  1G15 A;  4M7X A;  3CD6 N;  4BR2 A;  1KD1 O;  1S3X A;  3FZH A;  3HYF A;  1VRU A;  4M42 A;  2KW4 A;  5FPN A;  1VQ6 N;  4BRC A;  4H5R A;  5EXW A;  3MN6 A;  3FE1 A;  1C0F A;  3VQ8 A;  1GOC A;  4IBN A;  3SBG A;  1X9W A;  1QHT A;  4M3R A;  2XO7 A;  4O0J A;  5KRS A;  3VF4 A;  4CGJ A;  1S22 A;  4CHZ A;  4H5N A;  4QS9 A;  3I55 N;  2YX6 A;  2CH6 A;  1W9H A;  4CK1 A;  2P9P A;  3CJ7 A;  3ZEU A;  3NE6 A;  1S6Q A;  3P39 A;  2CGK A;  3NFA A;  3SUO A;  3RSE A;  3C65 A;  5FRO A;  4JI1 K;  3AVK A;  3OBY A;  2YNH A;  4MLH A;  4NCB A;  3LPU A;  4I2Q A;  2P9P B;  3ZEU B;  3E9P A;  1BHL A;  4K25 A;  3R6M A;  1X1P A;  3RSE B;  4CJK A;  4IOC L;  1XNR K;  5C10 A;  3OW2 M;  5LMU K;  1BO5 O;  3IUC A;  1RTD A;  1WBB A;  3MX5 A;  4JKE A;  1HRH A;  4Q0B A;  1GOA A;  4N5S A;  2HOE A;  4B1U B;  3DJC A;  4OJR A;  4FK2 A;  2E6L A;  4JS5 A;  2ZGY A;  4CZM A;  4F2S A;  1S1V A;  4DR4 K;  4I7F A;  4NCG A;  4R5P A;  5AQW A;  2X6S A;  3M3Z A;  4G1Q A;  3DMJ A;  3H46 O;  2YKM A;  5FLX O;  1ZBL A;  5M1O A;  4X65 K;  2D1K A;  4OGE A;  1C1B A;  1KLM A;  1IG8 A;  2UU9 K;  2DFF A;  4CHQ A;  2PYL A;  4KHS A;  4AHT A;  1C1A A;  4DUY K;  4KI6 A;  2O8E B;  1G99 A;  3NF9 A;  5AQM A;  2O8C A;  3JXU A;  1KVC A;  4QCL A;  4FWQ A;  2NRW A;  3W0L A;  1VSK A;  3HM9 A;  3L3U A;  1RT6 A;  2P9N A;  1XMO K;  5KQD A;  3KVG A;  4FW1 A;  2O8C B;  3ATU A;  3AVB A;  5EU7 A;  4FZY A;  5KPZ A;  1EET A;  5B8H A;  3ZSZ A;  3DLK A;  3ZSQ A;  2P9N B;  2WBN A;  1N5Y A;  1NK0 A;  2VG6 A;  4KHW A;  4RCH A;  4CJ5 A;  2HW3 A;  4RW4 A;  3ZX0 A;  3JSM A;  4BR5 A;  4O8K A;  2RF2 A;  3KWG A;  3CYM A;  5KRT A;  4CGG A;  3AA2 A;  2QXL A;  4RW7 A;  3QES A;  4DV0 K;  5LY3 A;  5AQS A;  3GE1 A;  5K14 A;  3KKR A;  4HUG A;  1RGI A;  1RDU A;  4BRG A;  1EX4 A;  3DLE A;  3FZK A;  4JI4 K;  3WNH A;  3U3Y A;  3WXI A;  3CHW A;  3EN9 A;  3J8A A;  2WTU A;  3D0P A;  3AVC A;  3VEO A;  4BE0 A;  2ZJP L;  4EFH A;  4GKK K;  1TUU A;  1QZ5 A;  4HUE A;  1J6Z A;  4DSL A;  3QFP A;  4A5B A;  3ZSV A;  2X78 A;  2A40 A;  3H6E A;  4BC3 A;  3O3F A;  3SQ2 A;  4B9S A;  2DFE A;  2FSK A;  3NMU A;  4EP5 A;  2HBJ A;  1VQO N;  3B6P A;  5AFU H;  4FSV A;  4NXM K;  5J2Q A;  1IKX A;  1NJX A;  2G8K A;  3LAN A;  1E3M A;  3F5T A;  5AQF A;  2Q31 A;  1X9J A;  3ID8 A;  1NM1 A;  1RTI A;  5AJ3 K;  5KTQ A;  3FZM A;  2QW9 A;  3FZF A;  4E7H A;  1QVG M;  4DFK A;  4KRF A;  1BIS A;  3IKM A;  1VRT A;  1QSL A;  4B1V A;  4PKI A;  3UKR A;  1U48 A;  4B1Z A;  3M8P A;  3ZET A;  2P9I A;  2JGU A;  4DR1 K;  1VSF A;  2I7N A;  3TAB A;  1HJR A;  4B9T A;  1NLV A;  4XEI A;  1NKC A;  4A57 A;  4C1N I;  3A5L C;  3UKR B;  3ZET B;  2DPN A;  2ZD1 A;  4DR5 K;  3HM8 A;  5GAD P;  3OJS A;  3PX4 A;  3A2F A;  3R9P A;  4BR7 A;  4O0I A;  3BDP A;  2NLX A;  1WSG A;  3C94 A;  1RDW X;  2OZS A;  4LFA K;  4CF1 A;  3K58 A;  1NK6 A;  2JWK A;  4CZJ A;  3LDQ A;  4IO8 A;  4CZI A;  1ZBF A;  2KFN A;  3DXM A;  2AJQ A;  1NGB A;  5LJV A;  4BG9 A;  3NDK A;  1KSP A;  3C0B A;  2HB5 A;  3V6D A;  3TAG A;  3S3M A;  3AAR A;  2Q2R A;  4CEZ A;  1N33 K;  5TKY A;  3CQX A;  1RBR A;  1DTT A;  3DXM B;  1V4S A;  1Q18 A;  3NGZ A;  5E26 A;  4LF7 K;  4H5V A;  1D5A A;  4MO5 A;  4OLA A;  3KK2 A;  1BI4 A;  1ASW A;  2P1J A;  3TPQ A;  1NK9 A;  1FJG K;  3OYG A;  3OYA A;  4CHN A;  3VQA A;  4DV7 K;  1LCU A;  5HRN A;  4LH5 A;  4CJE A;  3VMF B;  1ILY A;  3O3G A;  3DRP A;  2PFU A;  3RWU A;  1BI4 B;  3NH0 A;  4I2P A;  1NOZ A;  4FWM A;  5GIN A;  2GV9 A;  4DLE A;  3NH2 A;  2O8B A;  1LW2 A;  4OVL A;  3QEI A;  3RVC A;  2W42 A;  4MDB A;  4RG8 A;  3CCE N;  5FRN A;  4JNE A;  1GLE G;  3AVN A;  2O8B B;  4B08 A;  3CCJ N;  3SV3 A;  1ZBI A;  3OY9 A;  4DV1 K;  1K8K A;  3OS1 A;  3HVR A;  1JLE A;  3KD5 E;  2YNG A;  2VG5 A;  5JLF A;  3OBW A;  3UIQ A;  2D0P A;  4CJT A;  3O4N A;  3NF8 A;  4Z4H A;  4CEE A;  3OYK A;  1K8K B;  4KTZ A;  1ZYQ A;  2B6A A;  4BRO A;  2GX9 A;  2Q97 A;  3ZT4 A;  3LP3 A;  4B9U A;  4DKW A;  5F0X A;  2VQF K;  1O1W A;  4E19 A;  2A6A A;  1RFQ A;  1TYQ A;  4YDU C;  3G6E N;  4A5A A;  3BZC A;  3QNN A;  5GIO A;  4Z4E A;  4O8U A;  3TR8 A;  3D6R A;  4NLB A;  3KKS A;  1TYQ B;  3WUH A;  4B8C A;  4XH4 A;  3AGK A;  3C6U A;  5M1P A;  5GAE P;  3SI6 A;  1NMN A;  4K43 A;  5HRS A;  2EWS A;  4GV6 A;  2FBY A;  1NU0 A;  3AAP A;  5AQO A;  1VQM N;  3L0Q A;  1C0U A;  4ID1 A;  5GAG P;  4WF9 L;  1IKV A;  1VSM A;  3HPG A;  1C1C A;  4BRD A;  4FLX A;  2YHX A;  1HKB A;  4C8M A;  3BF1 A;  3H45 C;  3I0S A;  1Q7Y O;  2FBX A;  1GLD G;  1BQM A;  5AQX A;  2FC0 A;  4DF4 A;  3DYA A;  1D8Y A;  1P8Z A;  3T3F A;  3H3N O;  4IJN A;  3WNG A;  4LSL A;  3A5O C;  1HR0 K;  1D9F A;  3LDL A;  5KGW A;  3CJ1 A;  3WXJ A;  2XY7 A;  3UB5 A;  4IO9 L;  3F73 A;  1JCG A;  3THX A;  5HRR A;  3PIO L;  3VQQ A;  2NNW A;  4BRM A;  3SCX A;  3DI6 A;  3PY8 A;  4B9N A;  1HLU A;  1JL1 A;  4YOT A;  4JKG A;  4KBO A;  4CIG A;  5IWA K;  5SWM A;  1HKC A;  1JL2 A;  3AY9 A;  2G8F A;  2OPP A;  1LAV A;  4EHU A;  2HMP A;  4EZ6 A;  3MAQ A;  5CHI A;  4YOV A;  3L4I A;  1QE1 A;  3CCS N;  4DR6 K;  4EP4 A;  2HNY A;  4FOI A;  4OPH A;  4CFC A;  2UXC K;  4JKG B;  4EIA A;  2QM1 A;  3C95 A;  3CXC M;  1KQS M;  3HSC A;  1YVN A;  1KVA A;  4E3S A;  3QBX A;  1N36 K;  2OTJ N;  1TK8 A;  4DTP A;  2A1S A;  3A5N C;  3VN5 A;  1BUP A;  3VGM A;  4X66 K;  1BU6 O;  1N6Q A;  2IOC A;  3VF6 A;  4Z4C A;  1XQS C;  4OPA A;  2Q3S A;  4EAH D;  3T1A A;  1GLL O;  4O5B A;  4BWJ A;  4YOX A;  4WFB L;  4DR7 K;  2P5O A;  1S9G A;  1RBT A;  2PBD A;  3DLG A;  2GEM A;  5BPN A;  5E41 A;  3VOV A;  4EZ9 A;  3I56 N;  3SUN A;  1U47 A;  1HNX K;  4LF9 K;  4BRI A;  4Z4I A;  4WQ5 A;  2OPS A;  4H0V B;  3LP0 A;  1WAF A;  2QEX N;  4DF8 A;  3TAF A;  4BC5 A;  3D7E O;  1EWR A;  3QEW A;  1XUP O;  1JLA A;  3SAF A;  2FSJ A;  5ADX A;  1WLJ A;  1KTQ A;  1NKE A;  4W5N A;  4CJ3 A;  1IG9 A;  4KHQ A;  5BRF A;  1DKG D;  2ZE2 A;  3HOS A;  4JK9 A;  4I6M A;  5KI6 A;  1YT3 A;  5C24 A;  4CEQ A;  2CGL A;  5IT9 O;  5DMR A;  4W5R A;  1KAX A;  5I9E B;  1LW0 A;  4BRN A;  2VG7 A;  4I6M B;  1BOT O;  2YI1 A;  3PLA A;  1BCM A;  1J54 A;  3H1Q A;  3ZSX A;  4BRA A;  4CF8 A;  2GUP A;  1TV6 A;  4C1N K;  2RHK A;  1LV5 A;  3P31 A;  4JKF A;  4C8K A;  3LWM A;  1FK9 A;  5HLF A;  2UUC K;  2BTF A;  4BGA A;  2OA8 A;  3VTI A;  5E84 A;  3ISN C;  1BA0 A;  3LZJ A;  1CZB A;  3GL1 A;  1VSE A;  1ZC6 A;  1EKE A;  2NRZ A;  4CJQ A;  2EHG A;  3CC4 N;  3ULD A;  4DSK A;  3KK1 A;  5DM6 L;  1OH5 A;  3GOI A;  4CIE A;  3HRG A;  3HI0 A;  2X6N A;  3NVM A;  4DQ8 A;  2HVI A;  3AA3 A;  3NAE A;  4WE1 A;  4KHU A;  1TL1 A;  3IRX A;  4PKG A;  3M8Q A;  3CPE A;  3M8S A;  3CJB A;  4IDK A;  3LZI A;  2DY4 A;  1HPM A;  5AQH A;  1YIJ N;  1Z05 A;  3MEC A;  2FXU A;  4CZF A;  4AH9 A;  3ZSY A;  3EZ5 A;  4AHV A;  4E1M A;  4J8F A;  4CIF A;  3OJU A;  1KAZ A;  1T05 A;  5TKW A;  3MN9 A;  1A5W A;  2ZJQ L;  3FGU A;  4DTX A;  1Q9Y A;  1YJW N;  4BDY A;  1DEJ A;  4AHC A;  3HBT A;  1XI1 A;  2HHW A;  3U9Z A;  3CC7 N;  3S41 A;  4DU1 A;  4GVE A;  3V1R A;  1JLQ A;  1NOY A;  4KB1 A;  4B9M A;  2DFH A;  3HL8 A;  4PKH A;  1SL1 A;  1XNQ K;  3C6H A;  3DXK A;  1DLO A;  4H5W A;  4CEB A;  1XMQ K;  3QIC A;  3QFU A;  3K5M A;  5M1N A;  4IFV A;  3DOL A;  1RCH A;  1L3U A;  3O80 A;  1NG9 A;  4QS8 A;  4JRQ A;  1YXQ A;  4HWI A;  1C0T A;  4XH1 A;  4IG0 A;  1IV0 A;  3SV4 A;  2PY5 A;  3I0R A;  3AVH A;  1NGD A;  1XHZ A;  1J5E K;  3D2E A;  4WYB A;  2FF3 B;  2GEL A;  4NXN K;  4FWK A;  3H08 A;  2XY6 A;  1JCE A;  3OA9 A;  3KWI A;  4CJU A;  4HTU A;  4JKD A;  5C25 A;  4FJ7 A;  4DUZ K;  2OCE A;  1U2V A;  3D2E B;  1N8R O;  4E7K A;  4PHT X;  4I9L A;  3VET A;  1DTQ A;  3MXJ A;  5HRO A;  1S72 N;  3ZSR A;  1E4F T;  3PX0 A;  3WEE A;  1U2V B;  4ILJ A;  3P1G A;  3LAK A;  3V9Z A;  5D3G A;  3O4W A;  4PL7 A;  3S9H A;  3K5O A;  3OHR A;  3RR8 A;  4DV6 K;  1ITG A;  2V52 B;  3L2W A;  3OTO K;  2YNF A;  3ZLJ A;  2YV0 X;  4CGH A;  3WEE B;  1L3T A;  3O9Q A;  4LD0 A;  3THY A;  3DLH A;  1C0G A;  2E2O A;  2KTQ A;  2RPI A;  5CZ2 A;  1NK8 A;  3LP2 A;  1TKZ A;  3SNN A;  5BRD A;  3AAQ A;  3RMA A;  1KC8 O;  2KKZ A;  4N76 A;  3VEN A;  1RDA A;  3UKU A;  3THY B;  4LF5 K;  1TKD A;  1ZBS A;  4OKE A;  4K42 A;  4TSX A;  5ADX H;  4FJJ A;  3LDO A;  3SPZ A;  5CYM A;  1T8E A;  3UKU B;  1SKS A;  2HST A;  1HQE A;  4LF8 K;  3EEQ A;  4O4G A;  5AQQ A;  5EVZ A;  3AO5 A;  3LWL A;  3IAY A;  2UUB K;  4FJL A;  3AO1 A;  3T7Z A;  1SL0 A;  5FPM A;  4BAC A;  4WFN L;  3TWH A;  4M3W A;  4PUO A;  4I9Q A;  4CEO A;  1QVF M;  4IZ9 A;  4KTW A;  4DU3 A;  2E4L A;  3HTV A;  2QTD A;  1SS6 A;  4AQY K;  3ATV A;  2RN2 A;  1HMV A;  1Z6R A;  4CJF A;  2GTD A;  1I39 A;  1HQU A;  2FF6 A;  3FR0 A;  4FLT A;  2JWL A;  1QZ6 A;  5BN9 A;  1NGE A;  3WNE A;  4GW6 A;  3HJF A;  4A62 A;  4YOU A;  1U04 A;  4GY2 B;  4JAX A;  1NGH A;  1BGX T;  1YI2 N;  3HP9 A;  4O44 A;  1VQ9 N;  3G71 N;  3AVI A;  5CZ1 A;  1LWF A;  3MEG A;  1UA0 A;  4JI0 K;  1K6Y A;  2E2N A;  1ATS A;  4CGI A;  3BGR A;  3MK6 A;  5HL7 L;  3SMP A;  3L8B A;  4OGC A;  4FJ9 A;  5FPE A;  1BCO A;  1ZXO A;  2NRT A;  4CD3 A;  4FJX A;  3SQ1 A;  1LAW A;  4YOW A;  3LP1 A;  2PZS A;  3QIP A;  1L3V A;  4Q5V A;  3DOK A;  4JI6 K;  3G4S N;  1SV5 A;  1EQY A;  2QI2 A;  1RDB A;  3CCQ N;  4CJW A;  5AQZ A;  4IFE A;  1QSY A;  3AO3 A;  5AQR A;  4M3X A;  3HPO A;  1RBS A;  1NJW A;  1SQK A;  2P9I B;  3EE9 A;  4FJ5 A;  4CW7 B;  2GWK A;  2Z1H A;  3ULE A;  4CZK A;  1JJ2 M;  2P9L A;  3DM2 A;  4AF1 A;  4CES A;  1IKW A;  4FLU A;  1QTM A;  3HK2 A;  3LPT A;  1TL3 A;  3C7N A;  1NK4 A;  3ULE B;  2A42 A;  4IWV A;  1F21 A;  2P9L B;  4DS4 A;  4N41 A;  4FM0 A;  1WSJ A;  1Y64 A;  3T69 A;  3TU5 A;  3Q7C A;  4FWR A;  4WQ4 A;  3C7N B;  5BN8 A;  2QWQ A;  3PX6 A;  1Q9X A;  2VCP A;  1EWQ A;  1IKY A;  3LAM A;  1J53 A;  2HBM A;  3NH1 A;  4PQU A;  4W5T A;  3P38 A;  1WBD A;  2FLO A;  3AO2 A;  3OYM A;  3RMB A;  5AZJ A;  1LWE A;  1NJI O;  4KPY A;  1RDD A;  5JLH A;  4BDZ A;  4E7L A;  1YAG A;  5F2R A;  4JEP A;  4Z94 A;  3SMS A;  1CZ9 A;  3KD1 E;  3QNO A;  4JK7 A;  3OYH A;  5AZJ B;  1T44 A;  2V51 B;  2GBZ A;  4AM7 A;  4KRE A;  4CD1 A;  3AA5 X;  4BC4 A;  2HHV A;  3PUF A;  4JN4 A;  1JXE A;  4JI3 K;  1RTJ A;  4CK2 A;  4FK0 A;  4MQ3 A;  5FRM A;  2V7Y A;  2HF4 A;  2RKI A;  2VWK A;  1KXP A;  1HNI A;  4ISF A;  2QKK A;  3BF3 A;  1XC9 A;  4HTL A;  5GAH P;  1IO2 A;  4QS7 A;  5F1X A;  3RMD A;  3WT0 A;  1J9A A;  2AP1 A;  2QWR A;  4Z4G A;  4LH4 A;  3WQT A;  1S1U A;  5M1Q A;  1EP4 A;  2VGN A;  4KV8 A;  4FLW A;  5KQ8 A;  3VQB A;  4AHU A;  2QXF A;  5DK5 A;  1REV A;  4BVO A;  4M3T A;  4KTQ A;  4RW8 A;  4FWN A;  5KPT A;  5I3U A;  4FLV A;  1NBW A;  3PIP L;  3TAR A;  4R79 A;  1U49 A;  3IFR A;  3CFR A;  2O4G A;  4DMN A;  5CR4 A;  3DLB A;  1JLB A;  4KH4 A;  3JYT A;  4FJM A;  3TAN A;  3VQ6 A;  3R8E A;  3L2U A;  3L6Q A;  5M1F A;  4H0Y B;  3RRG A;  1IBK K;  4ZTJ A;  3EE8 A;  3L2Q A;  1KCF A;  2WOM A;  4CHY A;  4GKJ K;  3H3O B;  3KK3 A;  1NGC A;  4KHN A;  1GLB G;  1Y97 A;  2YJF A;  2IVP A;  1BA1 A;  3FFI A;  4CEC A;  3ENO A;  4CHP A;  4FJH A;  2KHO A;  3O9U A;  3AVL A;  2XY8 A;  3NF7 A;  3VQ9 A;  3NVK A;  4NLC A;  1MU2 A;  2F4V K;  4JD2 A;  5HBM A;  1ATR A;  1NKB A;  3OYD A;  3O3H A;  4LSN A;  3D2F A;  2E20 A;  4B3S K;  1BQN A;  1KAY A;  4H0O A;  3SJH A;  3OYN A;  4CZH A;  4N47 A;  2IVN A;  4DTN A;  5J2N A;  3CCV N;  2ASP A;  5LMN K;  1BG3 A;  2OPR A;  4H5T A;  2QWM A;  3D2F B;  4DR2 K;  3THW A;  5BRE A;  3PSI A;  4V19 S;  4FLY A;  5BR8 K;  1CXU A;  1VQL N;  2W40 A;  4QAG A;  3V9U A;  1QHA A;  3CCU N;  4FVU A;  4NB4 A;  3THW B;  3SUP A;  4KH5 A;  3QLH A;  2UXB K;  1T6D A;  1TKX A;  3THX B;  1VQ8 N;  1CLQ A;  2CH5 A;  3FLC O;  1Q8I A;  4CCH A;  3HO1 A;  1VSD A;  4B9Q A;  5AZI A;  1M90 O;  1S6P A;  3M5R A;  3LM2 A;  1UOC A;  3K5L A;  2UUA K;  1WUA A;  1XHX A;  1NGF A;  3SZ2 A;  2V7Z A;  2ZF5 O;  4BDP A;  1TK0 A;  4KI4 A;  4E0D A;  1NJY A;  3V9S A;  5AZI B;  2QWL A;  4JV5 K;  3VQD A;  1S9E A;  4JKC A;  3CME N;  3OYC A;  1RDC A;  3SK3 A;  5AQL A;  1NK7 A;  3DWL A;  2F9W A;  5AQU A;  4U67 L;  4KKO A;  3VF2 A;  2P9U A;  3KLE A;  2HF3 A;  3QEX A;  2G8W A;  5EX5 A;  4F4K A;  5T7B A;  3V9W A;  1W97 L;  4B9L A;  4GV9 A;  1Z25 A;  1A5X A;  4M3Z A;  1KFD A;  4FJI A;  3KLG A;  1L5U A;  1CXQ A;  2E1Y A;  3J80 O;  1T3V A;  1WSE A;  3TAM A;  4X62 K;  4H4O A;  1EO1 A;  2I5J A;  1Q82 O;  4IG3 A;  3OYI A;  3V1O A;  2WON A;  2HHS A;  1RNH A;  4LF6 K;  2Z1G A;  3VEZ A;  1HJO A;  3F9M A;  3L2V A;  2VYP A;  3O1W A;  4F3T A;  4BRE A;  1RTH A;  3VQ5 A;  2Z1J A;  3TI0 A;  4JRP A;  3HXM A;  1NJZ A;  4CBX A;  2OAN A;  4LFC K;  3V4I A;  1HUX A;  3TTD A;  4FWL A;  3UE5 A;  3LDS A;  4A61 A;  4J2A A;  4PA1 A;  2OYQ A;  3NGY A;  3W3D A;  3J81 O;  1RT3 A;  3VGL A;  5AQK A;  3MCA B;  4KHY A;  1U4B A;  5AQG A;  3BZK A;  1K8A O;  4E1J A;  1SL2 A;  3CCL N;  1MWK A;  1NGI A;  4K8Z A;  2BGG A;  3FFK B;  3ZSW A;  4PWD A;  2E2P A;  4IEI A;  3R1X A;  2FBT A;  1Q81 O;  3KLH A;  4ELT A;  3MCP A;  4CJP A;  5HP1 A;  5AQP A;  2D0B A;  3KIO A;  4HHT A;  3QET A;  4B8A B;  3ALY A;  1HNZ K;  1TAU A;  1T7P A;  4WQ4 C;  4M41 A;  3U9D A;  1RBU A;  4JLH A;  4C8L A;  4BE2 A;  1VHX A;  3VQ7 A;  2YJE A;  4PL8 A;  3QB0 A;  3PO4 A;  4BVP A;  4W5Q A;  4BE1 A;  1DT9 A;  3E9O A;  2GUI A;  3CET A;  4XH5 A;  2KZM A;  3CJA A;  4FXD A;  3NCI A;  3SQ0 A;  2A41 A;  4L8R B;  3JS6 A;  4CFB A;  1Z26 A;  3I8D A;  4FPB A;  4A2B A;  1VQ5 N;  2P5G A;  2ASO A;  3CF5 L;  3MDQ A;  1D4X A;  4E1N A;  4DSJ A;  5ELZ A;  5FDL A;  4CZE A;  4CI6 A;  1OH6 A;  4JK8 A;  1V4T A;  3VTH A;  4N56 A;  2NRR A;  4CFA A;  5BPL A;  2O8D A;  3MED A;  1ASU A;  4FYD A;  1BDG A;  4FWO A;  1X9S A;  4GVM A;  4J2E A;  1M1K O;  3KHY A;  2W6K A;  3ZT2 A;  5JMV A;  3L3V A;  3CI5 A;  1JKH A;  1GLA G;  2BDP A;  1JLC A;  4DFM A;  2HMI A;  3K5N A;  3N4P A;  2OZM A;  4FW2 A;  2O8D B;  3CCM N;  1VSI A;  4CFD A;  2WFB A;  2RE2 A;  3M6G A;  3QIO A;  2A1R A;  4DTU A;  3WXM B;  1W2B M;  3PSF A;  4FM1 A;  2EX3 A;  1TGO A;  5M1K A;  3D45 A;  1NMD A;  4A2A A;  2ZGZ A;  4DLG A;  3SBT A;  4B3M K;  4C8O A;  4H0X B;  4DV2 K;  3DXK B;  4NCA A;  1RT5 A;  1ATN A;  1IH7 A;  4CHO A;  1S5J A;  3DRS A;  1OH8 A;  4H03 B;  4M3U A;  4IDH A;  4H0T B;  3VQE A;  1WAJ A;  3G25 A;  1HPZ A;  1QQN A;  3ENB A;  3HPH A;  4IEE A;  2HHQ A;  4O55 A;  4BRP A;  3OS0 A;  1HNW K;  2ZWH A;  3L4Q A;  4M3Y A;  2I7P A;  2HHH K;  3NHG A;  3CCR N;  3SYZ A;  1U45 A;  3PO5 A;  3MXI A;  4JI7 K;  4DFJ A;  3CC2 N;  3EYZ A;  1TUY A;  2JLE A;  2ZJR L;  4YDU A;  3K0S A;  3BUZ B;  3GBT A;  3WXL A;  5KPR A;  3AV9 A;  2Y1J A;  2O8F A;  4DCH A;  1WB9 A;  2D0O A;  4FJK A;  3KJV A;  3H1V X;  1YTU A;  3ITH A;  4DSE A;  4B9V A;  4C23 A;  3GDQ A;  2ZM6 K;  4CBU A;  3KLF A;  3O4Q A;  1UAX A;  1YF5 L;  2NRH A;  5SZT A;  3CM5 A;  2O8E A;  2HHT A;  2O8F B;  4FK4 A;  1RT2 A;  1IBL K;  1QQM A;  3VA0 A;  4BR4 A;  3KLI A;  2IS3 A;  4FWP A;  4AIL C;  4CJL A;  2A5X A;  3O6W A;  4LY7 A;  4GMJ B;  4WCE L;  4F3O A;  4HUF A;  3TAQ A;  1BIZ A;  1WN7 A;  3K57 A;  4X64 K;  4OKK A;  1O13 A;  4CED A;  5HRP A;  1LWC A;  2IGI A;  3S3N A;  3L2R A;  4CEF A;  2O4I A;  2F8T A;  3TSU A;  4BRK A;  3DAW A;  3AVF A;  2BUP A;  4OPJ A;  1FW6 A;  5JS2 A;  5C15 A;  2QKB A;  4LC9 B;  3VEW A;  1Q86 O;  3CPW M;  2HBK A;  2X74 A;  3B6O A;  4DB3 A;  4RW9 A;  4H0P A;  1KRP A;  5CY4 A;  3GG4 A;  2R7Y A;  1VK0 A;  1SAZ A;  4DG1 A;  4PY5 A;  2UYT A;  3EZW A;  3WQU A;  1OVQ A;  1KFS A;  3P5J A;  4MO4 A;  4DQS A;  2IIR A;  4ISE A;  3HT3 A;  1IJJ A;  2XHB A;  4DSF A;  1NNE A;  2ITG A;  3NBP A;  1R59 O;  2FSN A;  3ENH A;  2QA4 N;  4BGB A;  1J5O A;  4HVJ A;  1H1V A;  4MDA A;  5AQV A;  3RR7 A;  1XC3 A;  1X3N A;  3C6T A;  1S1X A;  3C6A A;  3CG7 A;  4GV3 A;  1FKP A;  4HCC A;  4JI5 K;  3ZYY X;  1T6C A;  4YOR A;  4FM2 A;  1YVU A;  2PAV A;  4MLE A;  1YJ9 N;  3A0I X;  1B9D A;  4OO1 J;  4E7J A;  5MLC Q;  3SPY A;  2YKN A;  3KK7 A;  4ICL A;  4Z4F A;  1BWF O;  4KO0 A;  3ZX2 A;  4AHR A;  3O9R A;  4ID5 A;  5AQT A;  1FKO A;  3VEV A;  4WQ5 C;  3OYE A;  4JI2 K;  2BH1 A;  2B5J A;  4H4M A;  4KB0 A;  4IKF A;  4O5F A;  2HHU A;  3TAP A;  2KFZ A;  3KTQ A;  4JYA K;  2IVO A;  2B4J A;  3O9T A;  3A5M C;  3U8X A;  4NYF A;  3ZSO A;  4BR9 A;  3QML A;  4YHH K;  2PYJ A;  1ESV A;  3ZT0 A;  2HHX A;  4FJ8 A;  3G0Z A;  2KZZ A;  2FBV A;  3VEY A;  3BEX A; 
#chains in the Genus database with same CATH homology
 3MX5 A;  4JKE A;  1XUP O;  3EKU A;  3L6Q A;  5BR9 A;  2FSJ A;  4H0Y B;  5ADX A;  5M1F A;  3SAF A;  3CCQ N;  2HOE A;  1YUW A;  3EE8 A;  3ZX3 A;  4B1U B;  3DJC A;  3H3O B;  3LDN A;  3QBW A;  5BRF A;  2ZGY A;  1NGC A;  1DKG D;  4CZM A;  5GIP A;  3HOS A;  4JK9 A;  1GLB G;  2YJF A;  4I6M A;  4IJA A;  2IVP A;  1BA1 A;  3ENO A;  2CGL A;  3KZB A;  2KHO A;  3O9U A;  3TSP A;  5AQW A;  3O08 A;  3NVK A;  4NLC A;  3M3Z A;  1QQO A;  4JD2 A;  1KAX A;  5I9E B;  5H1S Q;  3HOT A;  3H46 O;  1ATR A;  4BRN A;  4BQL A;  4BRQ A;  5M1O A;  1JCF A;  5AQI A;  4I6M B;  1BOT O;  2D1K A;  2YI1 A;  3LL3 A;  1IG8 A;  3PLA A;  3H1Q A;  4ISG A;  4BRA A;  2E88 A;  1G99 A;  2GUP A;  3D2F A;  5AQJ A;  5AQM A;  2E20 A;  4C1N K;  2RHK A;  3O8M A;  1YHQ N;  2WC9 A;  3P31 A;  1KAY A;  4JKF A;  3JXU A;  3MX2 A;  4H0O A;  3SJH A;  4IOX A;  4FWQ A;  4CZH A;  2IVN A;  2NRW A;  3W0L A;  3FZL A;  2BTF A;  4BGA A;  3CCV N;  3VTI A;  2ASP A;  2P9N A;  1BG3 A;  4H5T A;  4BQZ A;  1WOQ A;  5KQD A;  2QWM A;  3D2F B;  5E84 A;  3KVG A;  1BA0 A;  3ATU A;  5BRE A;  2NRX A;  4JKA A;  3U4L A;  3GL1 A;  2D4W A;  1VQL N;  1ZC6 A;  2W40 A;  5KPZ A;  2NRZ A;  2E8A A;  1QHA A;  2Q0R A;  5B8H A;  3CC4 N;  2CGJ A;  5DM6 L;  3GOI A;  3CCU N;  1LOT B;  2P9N B;  2WBN A;  4FVU A;  4NB4 A;  4RCH A;  3HRG A;  3HI0 A;  3ZX0 A;  4KH5 A;  3NVM A;  4BR5 A;  4O8K A;  1MA9 B;  1T6D A;  3KWG A;  3EO3 A;  4DQ8 A;  1K9M O;  2QWP A;  1VQ8 N;  2QXL A;  2CH5 A;  2F7T A;  3ID6 A;  5LY3 A;  5AQS A;  3FLC O;  3GE1 A;  4PKG A;  4CZG A;  3CPE A;  4FOE A;  4B9Q A;  3CJB A;  5AZI A;  3CQY A;  1RGI A;  1RDU A;  4BRG A;  1M90 O;  3M5R A;  1HPM A;  5AQH A;  3LM2 A;  2YHY A;  1YIJ N;  1WUA A;  1Z05 A;  3FZK A;  2FXU A;  4CZF A;  1NGF A;  3WXI A;  2Q0U A;  2V7Z A;  2A3Z A;  3CHW A;  2ZF5 O;  4G9Z A;  4J8F A;  1KAZ A;  3EN9 A;  3J8A A;  5TKW A;  3MN9 A;  1X3M A;  2ZJQ L;  3FGU A;  5AZI B;  2QWL A;  4JKB A;  1YJW N;  4JKC A;  3CME N;  1DEJ A;  2E2Q A;  3SK3 A;  1VQP N;  4FL9 A;  3HBT A;  5AQL A;  3VEO A;  3DWL A;  2F9W A;  3U9Z A;  5AQU A;  4U67 L;  1MDU B;  5DM7 L;  3CC7 N;  3S41 A;  3VF2 A;  2ZJP L;  2P9U A;  2HF3 A;  3CER A;  4GVE A;  4EFH A;  5LJW A;  5BRH A;  1TUU A;  1QZ5 A;  5EX5 A;  3CMA N;  1J6Z A;  1W97 L;  1DGK N;  4F9O A;  4JKH A;  4GV9 A;  3QFP A;  4A5B A;  2ITM A;  4PKH A;  2A40 A;  2NRV A;  3H6E A;  1P90 A;  4BC3 A;  1NWK A;  5C12 A;  3C6H A;  2FSK A;  2E1Y A;  3NMU A;  3DXK A;  4H5W A;  1T3V A;  3QIC A;  3QFU A;  2HBJ A;  1VQO N;  4K41 A;  5JVG L;  1NGG A;  5AFU H;  5M1N A;  1EO1 A;  1Q82 O;  4FSV A;  4BRL A;  3O80 A;  3VPZ A;  1K73 O;  4QS8 A;  3CIP A;  3F5T A;  5AQF A;  3VEZ A;  2Q31 A;  1YXQ A;  1X9J A;  3ID8 A;  1NM1 A;  1HJO A;  3CJ9 A;  4HWI A;  3F9M A;  3FZM A;  4XH1 A;  2VYP A;  3O1W A;  2QW9 A;  4BRE A;  1NGD A;  5CE3 A;  3FZF A;  3D2E A;  5AR0 A;  4WYB A;  2FF3 B;  2GEL A;  1QVG M;  3I33 A;  3HZ6 A;  3IKM A;  4FWK A;  4B1V A;  4CBX A;  1NGA A;  1JCE A;  4PKI A;  2OAN A;  3OA9 A;  3KWI A;  1HUX A;  3UKR A;  3TTD A;  4B1Z A;  2QWN A;  4FWL A;  4JKD A;  3ZET A;  3UE5 A;  4A61 A;  2P9I A;  2HBL A;  3R3L A;  3W3D A;  2I7N A;  3VGL A;  4NO7 A;  1U2V A;  3MCA B;  5AQK A;  2P9S A;  1NLV A;  5BPM A;  4XEI A;  3D2E B;  5AQG A;  1N8R O;  4PHT X;  1K8A O;  4E1J A;  4A57 A;  4DHY A;  3CCL N;  1NGI A;  1MWK A;  4C1N I;  3VET A;  3VGK A;  3A5L C;  3IMX A;  3FFK B;  3UKR B;  2E2P A;  4IEI A;  3ZET B;  3R1X A;  3LM9 A;  1S72 N;  2DPN A;  2J4R A;  1E4F T;  4ILG B;  1Q81 O;  3HM8 A;  5GAD P;  3WEE A;  1U2V B;  4ILJ A;  2P9S B;  3R9P A;  4BR7 A;  3MCP A;  3O4W A;  2NLX A;  4PL7 A;  4JD2 B;  1RDW X;  5AQP A;  1VAZ A;  3OHR A;  2JWK A;  2V52 B;  4CZJ A;  1SZ2 A;  3LDQ A;  4IXC A;  4BR0 A;  4IO8 A;  4ILH A;  4CZI A;  2Q1N A;  5AQN A;  3DXM A;  3WEE B;  3O9Q A;  1C0G A;  2E2O A;  1NGB A;  5LJV A;  4BG9 A;  3C0B A;  1U6Z A;  4WQ4 C;  4CZL A;  4Y0W A;  3AAR A;  2Q2R A;  4L3Q A;  3U9D A;  5BRD A;  3AAQ A;  1KC8 O;  2KKZ A;  5TKY A;  3EL2 A;  3CQX A;  3VEN A;  2YJE A;  3DXM B;  3QB0 A;  4FPA A;  4PL8 A;  3UKU A;  4UY8 O;  4BVP A;  4RTF D;  1DT9 A;  3E9O A;  1ZBS A;  1VQN N;  1V4S A;  3CET A;  4XH5 A;  4K42 A;  1Q18 A;  3CJA A;  5ADX H;  5E26 A;  1CZA N;  4H5V A;  4MO5 A;  3LDO A;  4A59 A;  2A41 A;  3JS6 A;  1MWM A;  3TPQ A;  3UKU B;  2HST A;  4B1W B;  4FPB A;  4A2B A;  4CBW A;  2OTL N;  5EVZ A;  1LCU A;  3K9J A;  5AQQ A;  1VQ5 N;  2ASO A;  2E1Z A;  3CF5 L;  3MDQ A;  4BY9 C;  1D4X A;  5AQY A;  5ELZ A;  3VMF B;  1ILY A;  4CZE A;  4CI6 A;  1GLC G;  4JK8 A;  1V4T A;  2PFU A;  2YCH A;  2VWB A;  3O9S A;  3VTH A;  3T7Z A;  2NRR A;  2VGM A;  5FPM A;  5BPL A;  4B1Y B;  4WFN L;  4IOA L;  1NGJ A;  4FWM A;  5EOY A;  5GIN A;  1BDG A;  4FWO A;  1QVF M;  3RVC A;  4IZ9 A;  1M1K O;  3KHY A;  5C0Y A;  5JMV A;  2KLA A;  3E1Y A;  3CI5 A;  1GLA G;  2QTD A;  3HTV A;  4FWS A;  1YJN N;  2ASM A;  3LDP A;  1SS6 A;  3ATV A;  4MDB A;  3K9K A;  3VEX A;  1Z6R A;  1HX1 A;  1VQ4 N;  3CCE N;  3N4P A;  2GTD A;  4JNE A;  1GLE G;  3O5B A;  2FF6 A;  3CCM N;  3FR0 A;  3TTC A;  2JWL A;  3CCJ N;  3QDK A;  1QZ6 A;  2WFB A;  5BN9 A;  2RE2 A;  3M6G A;  1NGE A;  1K8K A;  2P9U B;  4KH6 A;  3WXM B;  3MWT A;  1W2B M;  3VER A;  3SLC A;  5JLF A;  3OBW A;  4A62 A;  3E9L A;  5M1K A;  1NMD A;  4YOU A;  2D0P A;  4A2A A;  2ZGZ A;  4BG8 A;  3SBT A;  3I8B A;  4GY2 B;  4JAX A;  3AGR A;  1NGH A;  4B1X B;  1YI2 N;  5HOO A;  1VQ9 N;  4H0X B;  3G71 N;  3DXK B;  1K8K B;  4JHD A;  4BRO A;  2E2N A;  2GX9 A;  1ATS A;  2Q97 A;  1ATN A;  3MN7 A;  3MK6 A;  5HL7 L;  4DKW A;  1YIT N;  2YHW A;  5F0X A;  3IDH A;  4H03 B;  2GWJ A;  4IDH A;  4H0T B;  3SMP A;  2A6A A;  4WFA L;  1RFQ A;  1TYQ A;  3G25 A;  5FPE A;  4YOY A;  1QQN A;  3ENB A;  4IEE A;  4YDU C;  1ZXO A;  2NRT A;  4A5A A;  4CD3 A;  4BRP A;  2W41 A;  3SAG A;  5GIO A;  1GLF O;  2H3G X;  4AM6 A;  3P4I A;  2ZWH A;  3L4Q A;  4O8U A;  2I7P A;  2QWO A;  4JHD B;  3CCR N;  3VES A;  4FO0 A;  4YOW A;  3D6R A;  4NLB A;  5FPD A;  3G4S N;  1EQY A;  2QI2 A;  3TSQ A;  4BC2 A;  3CC2 N;  1TYQ B;  3WUH A;  1TUY A;  2ZJR L;  4XH4 A;  4YDU A;  1GLJ O;  3AGK A;  3BUZ B;  3E66 A;  3GBT A;  3MN5 A;  5AQZ A;  4IFE A;  3WXL A;  3WXK A;  5M1P A;  4M63 C;  5KPR A;  5AQR A;  5GAE P;  4DCH A;  4BRF A;  2D0O A;  3B8A X;  4K43 A;  1SQK A;  2EWS A;  2P9I B;  3H1V X;  3MMV A;  4GV6 A;  2P9K A;  3EE9 A;  4C23 A;  2Q36 A;  3AAP A;  5AQO A;  3GDQ A;  2AA4 A;  1VQM N;  2F9T A;  4CBU A;  2GWK A;  3L0Q A;  5C2D A;  1YF5 L;  3ULE A;  5GAG P;  2NRH A;  3BP8 A;  3EKS A;  4CZK A;  4WF9 L;  4CJ7 A;  1JJ2 M;  3SAH A;  2P9L A;  1OVY A;  4AF1 A;  4BRD A;  4RWT A;  1QQM A;  3Q7B A;  2P9K B;  3M1F A;  3N4Q A;  4BR4 A;  2YHX A;  1HKB A;  5EY4 A;  3BF1 A;  3H45 C;  4FWP A;  3C7N A;  3ULE B;  1OKJ A;  2A42 A;  2A5X A;  3O6W A;  4IWV A;  1Q7Y O;  4WCE L;  1GLD G;  2P9L B;  5AQX A;  1P8Z A;  5JIC A;  3H3N O;  4IJN A;  1O13 A;  3F2K A;  1Y64 A;  3DLL L;  5C2F A;  3A5O C;  3T69 A;  3TU5 A;  3Q7C A;  4FWR A;  1VQ7 N;  1HKG A;  4WQ4 A;  3C7N B;  1E4G T;  3LDL A;  2QWQ A;  3TSU A;  4BRK A;  5BN8 A;  2VCP A;  2WUS A;  2HBM A;  3CJ1 A;  3DAW A;  3WXJ A;  2BUP A;  4EHT A;  3UB5 A;  5C15 A;  4BRH A;  3P38 A;  4LC9 B;  3VEW A;  2NZT A;  1JCG A;  3CPW M;  2FLO A;  4IO9 L;  3CJC A;  1Q86 O;  2HBK A;  5JVH L;  3PIO L;  5AZJ A;  5AFU A;  4GNI A;  4DB3 A;  5JLH A;  3TTF A;  1NJI O;  1YAG A;  3MWP A;  4H0P A;  4M7Y A;  2NNW A;  4BRM A;  3GG4 A;  4U7B A;  1SAZ A;  1VQK N;  1HLU A;  2UYT A;  3EZW A;  4JKG A;  5F2R A;  4YOT A;  3WQU A;  4KBO A;  4JEP A;  1HKC A;  3O1B A;  4MO4 A;  3SMS A;  3AY9 A;  4Z94 A;  2IIR A;  3A8Y A;  4ISE A;  2HMP A;  4EHU A;  1IJJ A;  4JK7 A;  5CHI A;  5AZJ B;  1T44 A;  4YOV A;  3L4I A;  2V51 B;  4M7X A;  3CCS N;  3CD6 N;  4AM7 A;  4BR2 A;  1KD1 O;  4CD1 A;  1S3X A;  4FOI A;  3FZH A;  1R59 O;  4OPH A;  4BC4 A;  2FSN A;  4JKG B;  3ENH A;  4JN4 A;  4EIA A;  5FPN A;  1VQ6 N;  4BRC A;  4H5R A;  2QA4 N;  2QM1 A;  4BGB A;  5EXW A;  3MN6 A;  3CXC M;  1H1V A;  1KQS M;  4MDA A;  3HSC A;  5AQV A;  3FE1 A;  1C0F A;  1YVN A;  2V7Y A;  2HF4 A;  3QBX A;  1KXP A;  1XC3 A;  1X3N A;  3SBG A;  4ISF A;  2OTJ N;  3BF3 A;  3C6A A;  4GV3 A;  3A5N C;  4HTL A;  5GAH P;  3ZYY X;  3J7Z O;  3VF4 A;  1BUP A;  1T6C A;  4YOR A;  1S22 A;  3VGM A;  1BU6 O;  4H5N A;  4QS9 A;  3I55 N;  4QS7 A;  2YX6 A;  5F1X A;  3VF6 A;  3WT0 A;  2AP1 A;  2CH6 A;  2PAV A;  4MLE A;  1YJ9 N;  1XQS C;  3A0I X;  2QWR A;  4OPA A;  4OO1 J;  2P9P A;  3WQT A;  3CJ7 A;  3ZEU A;  4EAH D;  5MLC Q;  3KK7 A;  3G6E N;  1GLL O;  1BWF O;  3P39 A;  2VGN A;  5M1Q A;  2CGK A;  3ZX2 A;  4YOX A;  4WFB L;  3O9R A;  5AQT A;  3VEV A;  4WQ5 C;  3RSE A;  5KQ8 A;  2PBD A;  3C65 A;  2GEM A;  5BPN A;  2BH1 A;  3OBY A;  3VOV A;  4O5F A;  4BVO A;  4MLH A;  2P9P B;  2IVO A;  4FWN A;  5KPT A;  3ZEU B;  3I56 N;  3O9T A;  3A5M C;  3E9P A;  4K25 A;  3U8X A;  3R6M A;  1NBW A;  4BRI A;  3PIP L;  4WQ5 A;  4H0V B;  4R79 A;  3RSE B;  4BR9 A;  3QML A;  3IFR A;  2QEX N;  1ESV A;  4IOC L;  5CR4 A;  5C10 A;  3OW2 M;  4KH4 A;  1BO5 O;  4BC5 A;  3IUC A;  3VEY A;  3BEX A;  3D7E O;  3R8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...