3BF3A

Type iii pantothenate kinase from thermotoga maritima complexed with product phosphopantothenate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
248
Chain Sequence
b'MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A02
3JS6A 5BRFA 3EZWA 4H0PA 2E2PA 4QS7A 4FWPA 3O08A 1SZ2A 3U8XA 4K41A 4H5TA 2FSJA 3A5LC 4EHTA 1D4XA 2GTDA 2CGLA 3GOIA 4XH4A 1E4FT 1HJOA 3LDLA 3C7NA 2V7ZA 2ITMA 4A62A 3W3DA 1RGIA 4PKHA 2A41A 3SMPA 4CJ7A 4BR9A 5KPTA 1LCUA 3O4WA 3D7EO 5F1XA 3CETA 1HX1A 4L3QA 2HMPA 5AFUA 4F9OA 2V51B 1GLCG 4M7XA 4B1XB 3WEEA 2YHXA 3UKRB 4ISGA 1HPMA 2IVOA 2E8AA 2QM1A 4PL7A 3DXMA 5AQTA 3FR0A 4PL8A 1MA9B 1K8KB 4EFHA 1WOQA 2P9KA 3VEXA 4BRPA 1R59O 3VEYA 4B1ZA 4IZ9A 2Q97A 3KZBA 4A61A 4JAXA 3DAWA 3MMVA 4MO4A 1H1VA 5AR0A 3IMXA 2A6AA 3IFRA 1NGFA 2FLOA 3MN9A 5LJWA 2E2QA 4PKIA 4BRKA 3MN6A 4H0TB 4Z94A 4XEIA 1DEJA 4FOIA 3SMSA 3ZX3A 2D4WA 5BRDA 3S41A 4E1JA 5F2RA 1GLDG 3M6GA 1MDUB 1YVNA 3C0BA 4YDUA 2BTFA 3DWLA 4CZGA 2VYPA 4IO8A 3VGKA 1TYQA 3R9PA 3A5MC 5AQIA 4BG8A 1MWMA 1ATSA 3ATVA 5BPLA 1X9JA 2QWRA 1SQKA 3WXJA 5FPEA 3D2FB 3ATUA 4JNEA 4YDUC 4BR0A 4AM6A 4CI6A 5KPZA 5KPRA 2I7PA 2OANA 3H1VX 5ADXA 3D2EB 4BRLA 4RCHA 4JD2A 4BROA 1C0FA 3F9MA 4BR4A 2P9NB 2YCHA 4FO0A 4J8FA 4DCHA 5BR9A 3EN9A 3SJHA 5BREA 2F9TA 3G25A 5EY4A 1JCFA 1KAZA 3FLCO 1ESVA 2E20A 2V7YA 5FPMA 3GL1A 2HOEA 3KVGA 1ZC6A 2GEMA 4CBWA 2CGJA 3A5NC 4XH1A 5BRHA 3WUHA 5AQKA 4CZHA 4B1UB 4BRIA 5F0XA 1XUPO 1Z05A 2GELA 2A42A 4BRDA 1E4GT 3VEZA 5FPNA 2HF3A 3J8AA 3VGMA 1JCEA 5AQFA 2IVPA 2Q0UA 4QS9A 5EOYA 1G99A 4FWNA 4QS8A 1HLUA 4IJAA 3H45C 3ZEUB 4H03B 3DXKA 1NGEA 1YUWA 3GBTA 2GWKA 4WQ5A 2KHOA 3FFKB 4IJNA 3VEWA 3I8BA 2P9IB 5E26A 2ASMA 1KAXA 3CQXA 4EIAA 3MK6A 2I7NA 1XQSC 3VF2A 4A2BA 1GLJO 2J4RA 3ID8A 3WXLA 3UB5A 1DKGD 1QQMA 2NZTA 3BP8A 4WQ5C 1V4SA 1RDWX 3LDQA 4JHDB 2QWLA 4CD1A 1GLAG 1YXQA 3QB0A 3QDKA 2GUPA 1HUXA 1T6DA 2ZGZA 3H1QA 3UE5A 2ASOA 4BRAA 4DQ8A 3FZFA 3HM8A 3M3ZA 5AQLA 2A40A 1T6CA 1HKBA 5LY3A 4CZIA 1DGKN 4M63C 4I6MB 1U2VB 3MDQA 3UKRA 1RFQA 3GDQA 3BF3A 4WQ4C 2D0PA 3P4IA 1GLLO 2FXUA 5JLHA 4FWKA 1YAGA 4BC2A 5AQMA 2FF6A 3TPQA 1K8KA 5AQOA 4FPAA 4RTFD 1BUPA 5JLFA 4FL9A 3EL2A 5AQJA 3WXKA 3CQYA 3FE1A 4B1YB 3CJ9A 4BRGA 3CJBA 4BC3A 1BG3A 3CJ7A 1WUAA 1NGIA 3LL3A 1QQNA 3FZMA 3WXIA 1IJJA 3MN5A 2NRHA 2QXLA 3L0QA 3ULEB 3M1FA 4ISEA 3VENA 4C23A 1BA0A 3GG4A 3L6QA 3ZETB 2YHYA 1HKCA 2AA4A 4O8KA 1NGDA 5AQUA 2IIRA 4BC5A 4B1WB 4BRCA 3ZX0A 4BRHA 3CJ1A 2QW9A 5AZIB 1TUYA 3O80A 2DPNA 2P9SB 5FPDA 4XH5A 3D2FA 4BRMA 2ZGYA 2FF3B 3O8MA 3D2EA 3DJCA 3VERA 2IVNA 1NLVA 4H0OA 1X3MA 2QWMA 3IUCA 4HTLA 2P9NA 1J6ZA 2ZF5O 5AQWA 3H46O 3R8EA 4BG9A 2P9PB 2QWQA 1KXPA 5EVZA 1TUUA 5BN8A 3H6EA 2FSKA 3ZX2A 5AFUH 3A5OC 2VCPA 4MO5A 2YJFA 1OKJA 1QZ6A 2P9LB 1QHAA 1HKGA 1QQOA 4BRFA 3JXUA 4IWVA 5KQDA 1BO5O 3RSEB 3KHYA 4MLHA 3QMLA 4B1VA 3HI0A 1ZXOA 5AQNA 2AP1A 3FGUA 4FWLA 3WQTA 4K43A 4KBOA 2E1ZA 3EO3A 1BA1A 3O5BA 4FPBA 3ZEUA 2GWJA 3I33A 1X3NA 4CD3A 4O5FA 3AAPA 5AQGA 5AQXA 3VF4A 4FWRA 4AM7A 4CZJA 2P9UB 2P9IA 2CH6A 3R6MA 1JCGA 4BR5A 4BRQA 4H5NA 1T44A 1C0GA 3AARA 1NM1A 4DHYA 3O1WA 3BF1A 3QBWA 2E2NA 5AQHA 2Q1NA 4JHDA 3UKUB 3VESA 4BC4A 4WQ4A 1NGJA 2QWPA 2WUSA 3QFUA 2Q36A 5AZJB 4BVPA 3EKSA 3HTVA 4CZKA 2EWSA 4CZLA 4Y0WA 4FWMA 1NGHA 3CJCA 3VOVA 1NGBA 4I6MA 5ADXH 4H5WA 1U2VA 3CHWA 5EX5A 4BR2A 3IDHA 5BPNA 4FWOA 4CBUA 4FSVA 3VETA 5AQSA 4K25A 3O6WA 5E84A 2Q0RA 3L4IA 5EXWA 1BDGA 3C7NB 3HSCA 4DB3A 2Q31A 1SAZA 3AY9A 2QWOA 3W0LA 4JN4A 3H3NO 2YJEA 3QICA 2D1KA 3TU5A 1EQYA 5CE3A 2FSNA 3GE1A 2BUPA 4EHUA 3WEEB 3FZKA 2YI1A 1NGCA 2YHWA 1Q18A 3DXMB 1BWFO 4CZMA 1XC3A 1NBWA 1QZ5A 3ULEA 5AQPA 5LJVA 2E1YA 4BR7A 5KQ8A 3WQUA 1Z6RA 3U4LA 1GLFO 2P9KB 2Q2RA 3ZETA 4CZEA 3B8AX 3A0IX 3WT0A 3OHRA 3QFPA 4FWSA 1S22A 2CGKA 3SK3A 5AZIA 3LDOA 2E2OA 3VEVA 2VWBA 3CIPA 1P8ZA 2P9SA 3FZLA 5BN9A 1GLEG 1GLBG 2PAVA 5JICA 1ATRA 2E88A 3CI5A 4WYBA 4BREA 4HWIA 4IXCA 1S3XA 3CJAA 3LDPA 1TYQB 5AQZA 3AAQA 2P9PA 3SLCA 2D0OA 3U9ZA 4BGBA 1NWKA 5AQYA 3BEXA 2HF4A 3LDNA 2QWNA 3LM2A 2W41A 5JMVA 4GY2B 1Y64A 4H5VA 1NGAA 4RWTA 2F9WA 3QBXA 2V52B 4A2AA 2P9LA 4JD2B 3BUZB 4H0XB 3O1BA 5BPMA 4MLEA 4K42A 3RSEA 3VEOA 4EAHD 3A8YA 1CZAN 3VF6A 4BRNA 3LM9A 4BQLA 1NMDA 2CH5A 3HBTA 1KAYA 4GNIA 1V4TA 4CZFA 5I9EB 1NGGA 4FWQA 4CBXA 1ZBSA 1U6ZA 2A3ZA 1BU6O 4H0VB 4B9QA 1LOTB 5AQRA 2P9UA 5TKYA 1ATNA 2ZWHA 4BGAA 2PBDA 1IG8A 2W40A 2UYTA 2ASPA 4M7YA 5AQVA 4H5RA 4NB4A 3MCPA 4LC9B 4BVOA 3ENHA 3U9DA 5ELZA 3H3OB 1MWKA 2A5XA 4H0YB 2NLXA 3UKUA 3VPZA 3EKUA 4NO7A 4BQZA 3DXKB 2H3GX 3MN7A 1BOTO 5AZJA 4FOEA 3FZHA 5AQQA 3VGLA 5B8HA 3CERA 3HZ6A 4PKGA 4ISFA 3ENOA
chains in the Genus database with same CATH superfamily
3MEDA 3EZWA 3LP1A 4K8XA 4WFNL 1FK9A 3O3FA 3QO9A 4H5TA 4EHTA 2GTDA 2W6KA 3LANA 1HJOA 3ZSQA 4CECA 5M1KA 2O8BA 4LD0A 4JI7K 1RGIA 4OJRA 2NRVA 2KLAA 1VSFA 4DFMA 1HX1A 1HNIA 2V51B 1GLCG 2OA8A 3CCUN 3WEEA 1GOAA 1HPMA 3CD6N 5DMRA 4CW7B 3OYBA 3ALYA 4KH6A 3VEXA 1R59O 2RHKA 1W2BM 1LWFA 5T7BA 4C8KA 5AR0A 4ILHA 3THXB 3IFRA 5TKWA 3S41A 4JKGB 3M6GA 1MDUB 1RDDA 2OCEA 4CZGA 2VYPA 3O3HA 4Q0BA 3KLGA 2D5RA 5HRRA 3RR8A 1TGOA 5FPEA 4U7BA 3AGRA 3D2FB 3ATUA 4JNEA 4YDUC 4CI6A 5KPRA 4IO9L 4CHPA 1WBDA 1LAWA 3D2EB 1RDBA 4BRLA 4RCHA 3DOLA 1VQ8N 1WAFA 5KRSA 3SQ0A 1A5VA 4FO0A 4DCHA 4JS4A 1NJIO 3SPZA 3SJHA 2F9TA 3G25A 4WF9L 1ESVA 2V7YA 5FPMA 3ENBA 2UXDK 2GEMA 3F2KA 2CGJA 3HP6A 4B1UB 4BRIA 2A42A 4E7HA 5FPNA 4E0DA 3SV3A 5AQFA 1IKXA 2VG7A 4FW2A 5C24A 3H45C 2HNZA 4DF4A 3QNOA 1HMVA 4H03B 2BANA 3HVRA 2G8VA 3AO3A 1YUWA 3GBTA 4WQ5A 2IGIA 1BGXT 2KHOA 4KTZA 2P9IB 1NK5A 4FJMA 1T8EA 3TSUA 3DI6A 1YVUA 2ZJRL 4YFUA 4OKEA 1QQMA 3BP8A 4DQIA 5EU7A 1RDAA 1V4SA 3PO5A 4JHDB 4CD1A 3QDKA 4JKEA 4HHTA 5BR8K 3ZSVA 4E7IA 1Q9YA 2A40A 1T6CA 5LY3A 3SUQA 4N41A 4I6MB 3RWUA 3CMEN 1RFQA 2D0PA 1GLLO 1T7PA 4A57A 1SS6A 3G6EN 4DTSA 2PYLA 1YAGA 2FF6A 3AVKA 5AQOA 3VQCA 1YTUA 4Q5VA 4DV5K 4DTXA 1U04A 3VQAA 1KVAA 4RW4A 4B3MK 3THXA 3WNFA 4BC3A 4DSEA 1HPZA 1BG3A 3LL3A 4DR7K 4JKDA 3V81A 1K6YA 3FZMA 1KSPA 3C6TA 4QCLA 2QXLA 3AVFA 3VQEA 3KKRA 4FJ7A 5GAEP 3L6QA 3J80O 1HKCA 3E9OA 4JKFA 3C6UA 3ZX0A 4BRHA 3CJ1A 2DPNA 3IRXA 1FKPA 2F8TA 1S6PA 2P9SB 4W5OA 3D2FA 4W5TA 2P51A 2ZGYA 5C42A 3D2EA 2EX3A 3VERA 1JLBA 4JS5A 1NLVA 4BY9C 2KFZA 4HCCA 1X3MA 2ZF5O 4E1NA 3H46O 3KJVA 4N5SA 3VQ8A 3V9ZA 1VQ6N 2QTDA 1TUUA 3H6EA 3ZX2A 5AFUH 3A5OC 2OTJN 3PSIA 4MO5A 3L2WA 4DV7K 3VTHA 1C1BA 1QQOA 2X78A 5KQDA 3RSEB 4YOTA 4JV5K 3KHYA 1GOCA 4B1VA 1UA0A 4CHOA 4KHSA 4M3YA 3FGUA 1LWCA 3CYMA 1UOCA 2ITGA 3EO3A 4AHVA 2BGGA 1RTDA 4TSXA 2OYQA 4JI2K 4H4OA 3AAPA 3Q7CA 3AGKA 2G8HA 4JI1K 2HW3A 4FWRA 3VA3A 1HYZA 4AHTA 1RT7A 2P9IA 2CH6A 3V6DA 1JCGA 4DSJA 3JYTA 4OPHA 3AARA 3QEPA 3O1WA 3QBWA 2E2NA 4FM0A 4JHDA 4JI6K 3CCSN 4ELTA 4B9TA 1WBBA 2NRWA 1TK5A 3QFUA 2D0AA 3EKSA 4DQPA 4CZLA 4B9UA 3DLGA 3CPEA 4CJTA 4I6MA 4KO0A 5K14A 4CFDA 3CHWA 5EX5A 3DM2A 2DY4A 3IG1A 2O8FB 2DFHA 2Q0RA 3WNEA 4DB3A 1J5OA 5HLFA 2KZZA 4DV3K 4JN4A 3MAQA 2F8SA 1EQYA 4LFCK 5CE3A 4OPKA 3GE1A 4EHUA 4IG3A 3EE8A 4IOCL 1S1XA 4ILGB 1T05A 5IT9O 3DLKA 2YHWA 1Q18A 1OVQA 4OKJA 3I8DA 1BWFO 1XC3A 4PQUA 5AQPA 2WOMA 1T03A 2KFNA 2Q2RA 4Z4IA 3WT0A 1WSGA 2P5GA 3OHRA 4J2EA 3KIOA 1S22A 3SK3A 2CGKA 1MU2A 3VEVA 3CCRN 2P1JA 5LMNK 2P9SA 1RTJA 4CGDA 1GLEG 1GLBG 1NK9A 4CJWA 4FJIA 4M45A 4DSFA 1S3XA 4IFEA 4I9QA 4CJSA 3TR8A 5AQZA 1JXBA 1G15A 3TANA 4R5PA 4FVUA 4DR1K 3AVJA 4FLVA 3LDNA 4CJ5A 3LM2A 2W41A 3NFAA 4CESA 1Y64A 2F9WA 1LV5A 1UAXA 2V52B 4A2AA 1HYSA 4H0XB 4KV8A 2NRTA 3C6AA 4NCAA 4AF1A 3PO4A 4DTOA 4FK2A 3RSEA 5M1QA 1C0MA 1WLJA 2UU9K 5DK5A 1NMDA 2CH5A 1IBMK 3HBTA 5M1NA 2IS3A 3PIPL 4GNIA 3RTVA 4CGJA 1VRTA 4OLAA 1W7AA 3PY8A 4GVMA 1U6ZA 2A3ZA 1BU6O 2R7YA 4FLUA 1N33K 4Z4GA 3I0RA 4M3XA 4OO1J 1IG8A 2ASPA 4M7YA 2YHAA 3MCPA 2OPQA 1TAUA 2A5XA 2NLXA 4CCHA 3ZSOA 4CK2A 4LF6K 3DXKB 3HO1A 2QA4N 2F7TA 1UWBA 4FOEA 5AQQA 5C2FA 4FZYA 3VGLA 3HZ6A 3HT3A 4CEEA 3SBTA 4CHZA 3CXCM 3ENOA 1YT3A 2B6AA 3JS6A 4X64K 5BRFA 4FWPA 2O8EB 3O08A 1WSHA 1SZ2A 3CF5L 3U8XA 4K41A 4KKOA 4JKBA 3GOIA 4XH4A 3IAYA 2O8FA 3EEQA 2IOCA 1IG9A 1CXQA 2WFBA 3SMPA 5KRTA 2HBLA 3MXJA 5F1XA 1C0TA 1DTTA 5AJ3K 4M7XA 3NGIA 4B1XB 4DLGA 3G10A 3L2QA 1ASWA 4F2RA 2D0BA 4DWIA 4FCYA 1D9DA 1I94K 3NVMA 3FR0A 1X9WA 3C65A 3HPGA 1RT2A 4DU3A 1WOQA 3C95A 4B1ZA 1X1PA 3RMCA 3KZBA 1CLQA 4JAXA 1YF5L 3WNHA 4MO4A 4KI4A 1NGFA 3T1HK 1NK0A 5LJWA 4BRKA 3MN6A 4Z94A 2QKBA 4NXNK 4FOIA 4RW9A 3ZX3A 1Q8IA 4E1JA 5F2RA 1GLDG 2YNHA 1XHXA 3DWLA 1VSHA 2YNIA 2HMIA 1Q86O 4BG8A 4JLHA 1MWMA 3OYCA 1S1VA 3NBPA 1VAZA 2IAJA 3LPTA 4PHTX 4YORA 5C25A 3NF6A 4ILJA 2OANA 4OPAA 1ZYQA 4GV9A 3AO1A 5ADXA 1KCFA 1QE1A 4BROA 1K9MO 3L2VA 3Q7BA 3BZKA 4FLYA 2OPRA 3SQ4A 4FJJA 2VG5A 3ZT0A 3TI0A 2QKKA 2E20A 3KVGA 3KD5E 3L4QA 1ZC6A 4CBWA 4XH1A 3WUHA 3U3GA 1SUQA 5F0XA 1XUPO 4CERA 4JK8A 1KLMA 4DMNA 3HYFA 1HNVA 3VEZA 3F9KA 2RE2A 1JCEA 5CYQA 2IVPA 2Q0UA 5FLXO 5EOYA 3TAEA 3P38A 4JRQA 4FK0A 4AQYK 5LMUK 3D0PA 3DXKA 1NGEA 1XWLA 3VQ9A 2GWKA 3OTOK 2YHBA 1S5JA 3I8BA 2ASMA 1YIJN 2YNFA 4KPYA 4KHYA 3D6RA 4A2BA 1KVBA 3O4NA 2O8EA 4NLBA 3BDPA 1GLJO 2J4RA 3WXLA 1DKGD 2NZTA 4WQ5C 1U49A 4LFAK 4C8OA 4ID1A 1GLAG 1YXQA 1JLGA 1NK4A 2GUPA 3HPHA 2ZGZA 3H1QA 2ASOA 4JI0K 3HM8A 1U45A 3PX0A 1O1WA 2ETJA 2X6NA 1HKBA 4CJUA 3MDQA 1YTAA 1HYVA 3C94A 2I5JA 5JLHA 1XC9A 4JYAK 5HRNA 4FWKA 5AQMA 3DRSA 4DQQA 3SAGA 4B9VA 1VQPN 3PUFA 3RRHA 3CFRA 4DV4K 4RTFD 3OVNA 1U47A 3U3YA 4DTNA 3FE1A 4CGGA 1J5EK 1X9MA 3S3NA 1O13A 1HNXK 1QQNA 4LF7K 5GAGP 3MN5A 3L0QA 4ID5A 1KLNA 4C23A 3GG4A 4FJXA 3KLIA 1SL2A 1TV6A 3OBWA 4CFBA 2AA4A 2IIRA 4ELVA 3K58A 2Z1IA 1EO1A 3ID6A 3V4IA 4CF8A 1S72N 1N5YA 3D45A 4BRMA 3O8MA 2FF3B 1BIUA 1BHLA 3DJCA 2IVNA 3QINA 3LWLA 3IUCA 1Q82O 2WONA 1J6ZA 3HM9A 3B6PA 4NLCA 2LSNA 4CJ3A 1RT3A 3VQDA 2QWQA 3QEIA 3KK1A 2FSKA 4DSKA 4AHRA 2NRXA 4XIUA 2YKNA 3TTCA 3AVBA 3SQ2A 1NK8A 4FJLA 1S6QA 1J53A 4IWVA 3DLEA 2RN2A 3ZCMA 4CHNA 1VQ7N 4MLHA 4U67L 4LF8K 2AP1A 3B6OA 4JKCA 3WQTA 3HJFA 3NGYA 4FW1A 2E1ZA 2FBXA 3HK2A 1IBKK 1ITGA 3AVIA 1X3NA 4CD3A 3HP9A 2YX6A 3VQ7A 1CXUA 3CQ8A 3KLEA 5AQGA 4YHHK 5JS1A 1HNWK 2GUIA 2FBVA 1F21A 2GBZA 4BR5A 1HR0K 1S1WA 4CF1A 3E9PA 3AVMA 4CE9A 1M1KO 4DHYA 1I3AA 5FDLA 3J7AP 4PA1A 3NVKA 2Q1NA 1L3TA 4JKAA 4BC4A 3M8RA 4M3ZA 1NGJA 2QWPA 1RTHA 3HTVA 4CZKA 1XMOK 1JLQA 1NKBA 4FLTA 1NGHA 3EZ5A 3CJCA 3VOVA 5C2DA 4H5WA 5HROA 2HNDA 1RCHA 5BPNA 4FWOA 3AVAA 4CBUA 1EWQA 5AQSA 2G8KA 3CCMN 1VQ5N 5E84A 4EZ9A 1BDGA 3HSCA 1WAJA 1VSLA 1CZBA 2Q31A 1SAZA 2E4LA 3AY9A 3KK2A 3H3NO 3QICA 5CHIA 3L8BA 4KHPK 2HHVA 3TU5A 2PYJA 4X65K 2FSNA 4PWDA 1JXEA 1NNEA 3FZKA 1W9HA 1NGCA 2YI1A 1Y97A 1C6VA 4LFBK 3NH2A 1JL2A 4CIEA 1QZ5A 5LJVA 3HXMA 2E1YA 4NYNA 3WQUA 1Z6RA 4DQSA 2P9KB 2HNYA 4I7FA 3QEXA 2NNWA 3A0IX 3LALA 1WB9A 4CEBA 1W97L 4F3TA 3O9TA 4W5NA 2VQEK 4ZTJA 4MQ3A 3AV9A 2HHXA 5IWAK 3DLHA 3FZLA 5BN9A 1A5WA 3AO5A 4KHUA 1ATRA 2E88A 3CI5A 4C8NA 4BREA 4IXCA 5FROA 5KGXA 3TTDA 1BQMA 1TYQB 1HRHA 5FRMA 3AAQA 3SYZA 5AQYA 3WXMB 4FZZA 5JMVA 3LZIA 1NGAA 1IKYA 1NKCA 2W6LA 4JD2B 2HHQA 2OPPA 4MLEA 4DTJA 1JKHA 2O4GA 4J2AA 3VEOA 3OYFA 3A8YA 1L3VA 4DG1A 1ZBFA 3VF6A 2XY5A 4IBNA 3LM9A 4BQLA 4Y1CA 4B9SA 3VMFB 1Z26A 2UXBK 3OYKA 1XI1A 1V4TA 1NGGA 4CBXA 2KKZA 1NK6A 1VQ4N 4H0VB 3ZSWA 4DU4A 1LOTB 3AA5X 1ZBHA 5I3UA 5AQRA 4CFAA 1VSDA 2ZWHA 3E1YA 1HNZK 3JAMO 3CCQN 2KZMA 2W40A 4H5RA 2KQ2A 4NB4A 3SUNA 3VQ4A 3MCAB 3RRGA 2XRIA 3L3VA 3TARA 1LWEA 4H0YB 1NJZA 3TABA 1NK7A 4FM2A 1NKEA 3VPZA 4OPJA 4NO7A 4E7JA 4B3OA 3T7ZA 4JI8K 4NCBA 3TAPA 2H3GX 3OYJA 3FZHA 3AA2A 5B8HA 3CERA 3KTQA 3RVCA 4LF9K 3OS1A 3HOSA 3VQ6A 1YI2N 4H0PA 5J2QA 4QS7A 3CC7N 1BCMA 2CGLA 1E4FT 5HBMA 1TKXA 3TSQA 2V7ZA 4YOWA 4A62A 2G8FA 4Y1DA 4PKHA 3LDSA 5HP1A 5J2NA 5KPTA 2BH1A 1S9GA 3D7EO 3OYHA 3CETA 4L3QA 4DR4K 2HMPA 4CGFA 2WC9A 3QLHA 3MXMA 3UKRB 4KH4A 2E8AA 3THYB 4PL7A 3THVA 5GIOA 3E66A 4KH5A 5AQTA 3T1AA 2KTQA 2UUAK 4CHYA 2A1RA 3LP0A 3K5LA 1K8KB 4EFHA 2PY5A 2P9KA 1UA1A 2Q3SA 4IZ9A 3PV8A 2Q97A 3SUOA 1RNHA 1JJ2M 1D9FA 4FVMA 4YOUA 4BE0A 3VQQA 3TTFA 1QTMA 3R3LA 4FJ5A 1H1VA 5J1EA 4PUOA 1WSFA 2A6AA 1LW0A 3MN9A 3OJSA 4A5BA 4DTRA 3F5TA 4FZXC 4R79A 3TWHA 3RMBA 3OW2M 3THWB 4FJ8A 3BY5A 3SMSA 3M8QA 5BRDA 3NF8A 4CJKA 2HBKA 4KTQA 2QXFA 5DM6L 2EHGA 2HBJA 3ULDA 3HRGA 4IO8A 1VQNN 3NCIA 1TYQA 5AQIA 3QEVA 2W42A 1TVRA 4J2DA 3DYAA 3SAFA 3VQBA 4FJNA 2ZQBA 1SQKA 1K73O 3KD1E 5KPZA 4AM6A 1QSSA 2I7PA 4C8LA 3H1VX 2G8UA 2VQFK 3K5OA 4JD2A 3LPUA 3N4PA 1C0FA 3F9MA 2P9NB 5BR9A 4CEFA 5BREA 1SL0A 5EY4A 1JCFA 1KAZA 3ITHA 4FXDA 1D5AA 4O4GA 1VSIA 2HOEA 2F96A 4CEQA 4CGHA 1JLCA 2VWKA 4O0JA 3SCXA 1N36K 5BRHA 3LP2A 5C12A 1IKWA 4DV1K 3V9SA 4E3SA 1NOYA 3T69A 4WFAL 2HHUA 4C8MA 3EE9A 3OYNA 3K59A 4F2SA 4Z4EA 3J8AA 1KD1O 3VGMA 4IFYA 5GADP 4N47A 5JVGL 1G99A 4FWNA 4QS8A 1YJWN 3DLRA 4RW7A 4M3WA 4B9NA 4KFBA 2KW4A 3L3UA 2B5JA 4O44A 4Z4CA 3FFKB 4IJNA 3VEWA 4KB0A 4CGIA 3KK7A 5E26A 3SUPA 4EIAA 3MK6A 2E6MA 2BDPA 1XQSC 1ILYA 4DLEA 2Y1JA 3AA3A 1BI4B 4B8CA 1RDWX 4AHCA 5C15A 4JRPA 2YV0X 4A59A 3UE5A 1SKWA 3FZFA 3M3ZA 5AQLA 4OKKA 4YOVA 4DFKA 1N6QA 3PSFA 1NJXA 1VSJA 3O4QA 1U2VB 3PX4A 3UKRA 4FLWA 3THYA 3BF3A 5GAHP 4O0IA 4CFCA 4N56A 3BZCA 5FRNA 3TPQA 1K8KA 3PLAA 1VSEA 4JK9A 5KGWA 1K8AO 4FPAA 4KTWA 1BQNA 1SKSA 4LF4K 5J2MA 1BUPA 5M1PA 5JLFA 2UUCK 3OBYA 3EL2A 4OGCA 3CCVN 5AQJA 4CHQA 3WXKA 3CQYA 2E5LK 4LSLA 4BRGA 3CJBA 1Q9XA 1WUAA 5H1SQ 3S3MA 3DLBA 5I42A 4CJQA 3EYZA 1IJJA 3E9LA 3THWA 4FYDA 1IV0A 4ISEA 3ZT1A 5JVHL 4DSLA 2FBTA 3OYMA 2O8CB 3ZETB 2GX9A 2YHYA 3P39A 4O8KA 3OYEA 3M5RA 4HTUA 4BC5A 4BRCA 2JGUA 5AZIB 2OZMA 1TUYA 4DUZK 4CJRA 4DQRA 4C1NK 4XH5A 1EP4A 1EWRA 1VK0A 1JLEA 4J2BA 3PX6A 1SKRA 4BDYA 1QHTA 3K2PA 1N8RO 3V9WA 2HHHK 1C1AA 4H0OA 3ZSXA 4OLBA 4FLXA 2G8WA 2QWMA 1VQ9N 2P9NA 4DKWA 4EP5A 3P5JA 4DV2K 2JLEA 1HQUA 4GKKK 3R8EA 4BWJA 4M3UA 3OS2A 2P9PB 1L3SA 4RW6A 5SZTA 1KXPA 5EVZA 5BN8A 1OH6A 4B8AB 4AILC 3CC4N 4CJLA 2VCPA 1OKJA 1QZ6A 1TAQA 2PZSA 4DTMA 4UY8O 1QHAA 1HKGA 1T3VA 4BRFA 1BO5O 2HSTA 2OPSA 3QMLA 3FFIA 3SI6A 1TKZA 4Z4FA 5AQNA 4LH5A 5CY4A 1EX4A 1QSLA 4Z0UA 4FPBA 5KTQA 2X74A 3NGZA 3I33A 3HSTB 3CC2N 4DF8A 4O5FA 4F3OA 3ASMA 3VF4A 4NYFA 3SAHA 3L2RA 4CZJA 3CCEN 4CK1A 3R6MA 4BRQA 2UXCK 4IG0A 1T44A 1C0GA 1NM1A 3AVLA 1BI4A 3AO2A 3BF1A 5AQHA 4Z4HA 4QOZB 3UKUB 3PIOL 1VQON 4GV6A 3VESA 1WSIA 2Q36A 5AZJB 4BVPA 4CF9A 2HVHA 3LWMA 2PFUA 4GVEA 1NGBA 5ADXH 2HBMA 1U2VA 4LY7A 4JEPA 3IDHA 1GOBA 3NDKA 4DFPA 4FSVA 2HHSA 4LSNA 3VETA 2NUBA 3J7YP 5EXWA 1L5UA 3C7NB 4CJFA 4FM1A 3S3OA 1EETA 2YJEA 2FC0A 3QIPA 2D1KA 3QESA 3K0SA 4CK3A 3ZT4A 1WSJA 1OH8A 1Q7YO 2XHBA 1OVYA 4MDAA 3DXMB 1ZBUA 4B3RK 1KFDA 4DS5A 1NBWA 4B3SK 4V19S 4WE1A 4BR7A 2ZJQL 1GLFO 2O8CA 3ZETA 2AJQA 4KI6A 1RDCA 4AH9A 4O8UA 3IS9A 1X9SA 2Z1GA 4B3TK 3BGRA 1QVGM 5D3GA 4FWSA 3G4SN 5AZIA 4CF2A 4ZTFA 1TKTA 5M1FA 2E6LA 3CIPA 2RPIA 3I0SA 1YHQN 4DR2K 4BDPA 4IOAL 2PAVA 3O9UA 3I55N 4WYBA 4W5QA 4CJEA 4HWIA 1B9FA 5C10A 1RILA 3F73A 2GV9A 1VQKN 3VTIA 4GMJB 4O55A 3V1OA 2IDOA 3U9ZA 2P9PA 3CM5A 2YNGA 3SLCA 3BEXA 2HF4A 5CZ1A 3DRPA 2QWNA 5C0YA 3NMUA 2WTUA 4YNQA 3CMAN 5CYMA 3QEWA 4H5VA 3ZSYA 4RWTA 2RKIA 3BUZB 1JL1A 3O1BA 5BPMA 1U48A 4K42A 2NRZA 4I9LA 2D0CA 4BRNA 2XY8A 1P90A 4DV0K 1BL3A 5HOOA 3KLHA 2HHWA 1JLFA 5I9EB 4AHSA 4FWQA 3LAKA 1ZBSA 2JWLA 3A2FA 3I56N 1YJNN 5TKYA 1QS4A 4CEZA 4LF5K 3OYAA 3HOTA 5AQVA 1XNRK 4CIFA 4NCGA 4LC9B 4BVOA 1RT5A 3ENHA 5ELZA 4QAGA 3AVCA 4YOYA 3UKUA 3EKUA 4PY5A 1RBVA 3DLLL 4BQZA 1TKDA 1ZBLA 3CFOA 3O9RA 1FXXA 5M1OA 5AZJA 4K0KK 1BOTO 1VRUA 4JI5K 4FJKA 4ISFA 3CCJN 3KWGA 3NH0A 5JS2A 2E2PA 3CCLN 3MWPA 4CJVA 2FSJA 3A5LC 1D4XA 4E7KA 5CR4A 4YOXA 3KWIA 3KK3A 3RMDA 2ZJPL 4BE1A 3LDLA 3OA9A 3C7NA 1VHXA 2ITMA 3W3DA 4HCBA 5E41A 2A41A 4CJ7A 4BR9A 4CEAA 4DV6K 2HB5A 1LCUA 3O4WA 5AFUA 1C0UA 4F9OA 3O9QA 3NH1A 1FJGK 2YHXA 4DTUA 4ISGA 3ZSZA 5HRPA 2IVOA 4KHNA 2QM1A 4IKFA 3DXMA 2G8IA 3SV4A 3RMAA 4PL8A 3ZT2A 1TK0A 1DT9A 3P31A 1MA9B 2B4JA 4BRPA 3VEYA 1J9AA 4N76A 2QK9A 1RT1A 4EP4A 1VSKA 4A61A 3P83D 3DAWA 3MMVA 1LW2A 3IMXA 2DFEA 2FLOA 3MX5A 4RW8A 2E2QA 4PKIA 4H0TB 4FJGA 3IKMA 4XEIA 1DEJA 2O4IA 2D4WA 4JKGA 1RBRA 1RBTA 1SL1A 1YVNA 3C0BA 3TAFA 4YDUA 2BTFA 1XHZA 3VGKA 3MEGA 3R9PA 3A5MC 2ZD1A 1ATSA 3ATVA 5BPLA 5GINA 1M90O 5KI6A 1X9JA 3DRRA 4HUGA 2QWRA 4JI4K 3E01A 3RR7A 3WXJA 2XY7A 4BR0A 1TK8A 3ZYYX 1LAVA 1VQLN 1OH5A 3V1QA 1U4BA 3ZSRA 1KVCA 2QEXN 1WN7A 4BR4A 1HJRA 4FLZA 2YCHA 4J8FA 2IC3A 3EN9A 4ZHRA 3OS0A 3FLCO 1RBUA 1EXQA 4IDKA 4GKJK 3GL1A 3TSPA 2ATQA 3LZJA 3A5NC 5AQKA 4MFBA 4CZHA 4E1MA 3QNNA 1N32K 1Z05A 4M3TA 2GELA 3NE6A 4BRDA 1E4GT 1SV5A 4OX9K 4I2PA 3TAQA 2HF3A 4B9MA 2DFFA 4QS9A 3VQPA 3L2UA 4KAZA 2OZSA 1HLUA 4IJAA 3ZEUB 4HUFA 3CFPA 1WSEA 1BCOA 3J81O 1RBSA 1REVA 4DU1A 2ZM6K 1ASUA 3CQXA 1KAXA 2VGNA 4CEOA 3VA0A 2I7NA 1KQSM 3VF2A 3JSMA 4JI3K 3O3GA 3ID8A 3UB5A 2A1SA 3LDQA 2QWLA 1S1UA 3QB0A 1HUXA 1T6DA 4BRAA 3CM6A 1KC8O 5HRSA 4DQ8A 3S9HA 4DR6K 4YY3K 4CZIA 3K57A 4H8KA 1DGKN 4M63C 3AVHA 3HPOA 3V9XA 3GDQA 4WQ4C 3P4IA 2Z1HA 5DM7L 2FXUA 2YKMA 4DTPA 4BC2A 4RG8A 1Z25A 4X62K 1FW6A 2ZE2A 4FL9A 2JWKA 3DOKA 3N4QA 4WCEL 4B1YB 2XO7A 3CJ9A 4KREA 2Y1IA 3VQ5A 3CJ7A 1NGIA 4DUYK 3WXIA 1RTIA 3ULEB 1R0AA 2NRHA 1DLOA 3M1FA 3VENA 3V9UA 1BA0A 3TAMA 5CZ2A 3NF9A 3KKSA 5AQUA 3M8SA 1NGDA 3T1YK 4NXMK 1XNQK 4E19A 4B1WB 2QW9A 3O80A 4DR5K 3OYDA 3MXIA 4JKHA 5FPDA 3MX2A 3LP3A 1NU0A 1NMNA 4C1NI 4KHWA 4E89A 2O8DB 4JK7A 4DR3K 3K5MA 3SBGA 3OYGA 4MDBA 4AHUA 5GIPA 4HTLA 5AQWA 1YITN 3VN5A 3K5NA 4DFJA 4BG9A 1ZBIA 3SQ1A 1QVFM 3SJJA 1NG9A 3ZLJA 4FK4A 3K9JA 1B9DA 1EKEA 2YJFA 3MWTA 3AVGA 2P9LB 4M42A 2NRRA 3JXUA 5A2QO 1BIZA 3HI0A 1ZXOA 4B08A 1JLAA 1D8YA 4FWLA 3QIOA 3R1XA 4K43A 4KBOA 3C6HA 2RF2A 1BA1A 1RT4A 3O5BA 3ZEUA 3OJUA 1C1CA 2GWJA 3DMJA 4BWMA 1E3MA 4ICLA 5AQXA 4AM7A 4GV3A 2P9UB 4K8ZA 3QETA 5LL6Z 2OTLN 4IOXA 3P1GA 4H5NA 3SPYA 4BACA 3K9KA 5SWMA 1DTQA 4G9ZA 3M8PA 4IEEA 1CZ9A 4WQ4A 2WUSA 2DTUA 2EWSA 2Z1JA 4CJPA 4Y0WA 1YJ9N 3HL8A 4FWMA 1TL1A 4FJ9A 3AVNA 1L3UA 2BE2A 4BR2A 4CF0A 1TL3A 3SNNA 3QERA 4K25A 3OYLA 4F4KA 3O6WA 3L4IA 2O8BB 3T3FA 1W0HA 3CPWM 4DS4A 3MECA 2QWOA 3W0LA 4FJHA 4H4MA 4M41A 1NOZA 3J7ZO 2BUPA 1B92A 4M3RA 2X6SA 3WEEB 4A5AA 3G71N 3SZ2A 2HVIA 4I2QA 1VQMN 2QI2A 3UIQA 4CZMA 3ULEA 5KQ8A 1RT6A 3U4LA 4WFBL 4CJ4A 1XMQK 4CZEA 4CIGA 3T19A 1FKOA 3B8AX 3AA4A 3HVTA 2VGMA 4CVNE 4KB1A 4O5BA 2XY6A 3NHGA 3QFPA 4E7LA 4IDHA 3LDOA 2E2OA 3H08A 4X66K 2VWBA 1NJWA 4KRFA 4LH4A 4CEDA 1P8ZA 2F4VK 5JICA 1KFSA 1IBLK 2O8DA 1KRPA 4GW6A 4KHQA 1VSMA 4B9LA 5MLCQ 4IEIA 1J54A 3CJAA 3LDPA 4OVLA 1S9EA 5HL7L 3NAEA 4HUEA 1RDUA 4BGBA 2D0OA 3V1RA 1NWKA 2FBYA 5J2PA 3WNGA 3CG7A 1NJYA 4EZ6A 4GY2B 1QSYA 3EY1A 3QBXA 2P9LA 4L8RB 3ZT3A 3G0ZA 4HVJA 4EAHD 3OY9A 1Q81O 1CZAN 2VG6A 1N34K 3TAGA 3OYIA 4BE2A 3AO4A 1KAYA 3U6FA 4BDZA 1QQCA 4CZFA 3ISNC 3KLFA 1I39A 4G1QA 1IKVA 4ELUA 1HQEA 1OH7A 4B9QA 3O9SA 3MEEA 3LAMA 2P9UA 1WNSA 2P5OA 1S1TA 1ATNA 4BGAA 2PBDA 2VWJA 1IO2A 4OGEA 2UYTA 2WBNA 2UUBK 1ASVA 4UQGA 4F8RA 3U9DA 3H3OB 1MWKA 2HHTA 1A5XA 1KTQA 3NF7A 4DSIA 3MN7A 1IH7A 1BISA 4PKGA 4IFVA 4W5RA
chains in the Genus database with same CATH topology
3JS6A 3HOSA 3KWGA 3EZWA 5BRFA 4H0PA 1YI2N 2E2PA 3CCLN 4QS7A 4WFNL 4FWPA 3CC7N 3MWPA 3O08A 1SZ2A 3CF5L 3U8XA 4K41A 4H5TA 2FSJA 3A5LC 4JKBA 4EHTA 1D4XA 2GTDA 2CGLA 5CR4A 3GOIA 4XH4A 4YOXA 1E4FT 3KWIA 1HJOA 5M1KA 2ZJPL 3LDLA 3OA9A 3C7NA 3TSQA 2V7ZA 4YOWA 2ITMA 4A62A 3W3DA 1RGIA 4PKHA 2A41A 2WFBA 2NRVA 2KLAA 3SMPA 4CJ7A 4BR9A 2HBLA 5KPTA 1LCUA 2BH1A 3O4WA 3D7EO 5F1XA 3CETA 1HX1A 4L3QA 2HMPA 5AFUA 2WC9A 3O9QA 4F9OA 2V51B 1GLCG 4M7XA 3CCUN 4B1XB 3WEEA 2YHXA 3UKRB 4ISGA 1HPMA 2IVOA 4KH4A 2E8AA 2QM1A 4PL7A 3CD6N 3DXMA 5GIOA 3E66A 3NVMA 4KH5A 5AQTA 3FR0A 4PL8A 3C65A 1DT9A 3P31A 4KH6A 1MA9B 1K8KB 4EFHA 1WOQA 2P9KA 3VEXA 4BRPA 1R59O 3VEYA 4B1ZA 2RHKA 1W2BM 4IZ9A 2Q97A 3KZBA 1JJ2M 4YOUA 4A61A 4JAXA 1YF5L 3TTFA 3DAWA 3MMVA 3R3LA 4MO4A 1H1VA 5AR0A 4ILHA 3IMXA 2A6AA 3IFRA 1NGFA 2FLOA 3MN9A 3MX5A 5LJWA 2E2QA 4A5BA 4PKIA 4BRKA 3F5TA 3MN6A 4H0TB 4Z94A 4R79A 3IKMA 5TKWA 4XEIA 1DEJA 4FOIA 3SMSA 3ZX3A 2D4WA 3OW2M 5BRDA 3S41A 4JKGA 4JKGB 4E1JA 2HBKA 5F2RA 1GLDG 3M6GA 1MDUB 1YVNA 3C0BA 5DM6L 4YDUA 2BTFA 2HBJA 3DWLA 4CZGA 2VYPA 3HRGA 4IO8A 3VGKA 4U7BA 1VQNN 1TYQA 3R9PA 3A5MC 5AQIA 4BG8A 1Q86O 1MWMA 1ATSA 3ATVA 5BPLA 3SAFA 5GINA 1M90O 1X9JA 2QWRA 1VAZA 1SQKA 3WXJA 4PHTX 5FPEA 3AGRA 3D2FB 3ATUA 4JNEA 4YDUC 4YORA 4AM6A 4BR0A 4CI6A 4ILJA 2I7PA 2OANA 3H1VX 4OPAA 3ZYYX 4IO9L 1VQLN 4GV9A 5ADXA 3D2EB 4BRLA 1VQ8N 4RCHA 4JD2A 2QEXN 3N4PA 4BROA 1C0FA 3F9MA 4BR4A 1K9MO 2P9NB 2YCHA 3Q7BA 4FO0A 4J8FA 4DCHA 5BR9A 1NJIO 3EN9A 3SJHA 5BREA 2F9TA 3G25A 5EY4A 4WF9L 1JCFA 1KAZA 3FLCO 1ESVA 2E20A 2V7YA 5FPMA 3GL1A 3TSPA 2HOEA 3KVGA 3L4QA 1ZC6A 3ENBA 2GEMA 4CBWA 3F2KA 2CGJA 3A5NC 4XH1A 5BRHA 3WUHA 5AQKA 5C12A 4CZHA 4B1UB 4BRIA 5F0XA 1XUPO 4JK8A 1Z05A 3T69A 2GELA 4WFAL 2A42A 4BRDA 1E4GT 3EE9A 3VEZA 5FPNA 2HF3A 2RE2A 3J8AA 1KD1O 3VGMA 1JCEA 5AQFA 2IVPA 2Q0UA 4QS9A 5GADP 5JVGL 5EOYA 1G99A 4FWNA 4QS8A 1YJWN 3P38A 1HLUA 4IJAA 3H45C 3ZEUB 4H03B 3DXKA 1NGEA 1YUWA 3GBTA 2GWKA 4WQ5A 2KHOA 3FFKB 4IJNA 3VEWA 3KK7A 3I8BA 2P9IB 5E26A 2ASMA 2VGNA 1KAXA 3CQXA 3MK6A 3TSUA 4EIAA 1YIJN 2I7NA 1KQSM 1XQSC 3VF2A 3D6RA 4A2BA 1ILYA 4NLBA 1GLJO 2J4RA 3ID8A 3WXLA 2ZJRL 3UB5A 1DKGD 1QQMA 2NZTA 3BP8A 4WQ5C 1V4SA 1RDWX 3LDQA 4JHDB 2QWLA 5C15A 4CD1A 1GLAG 1YXQA 3QB0A 3QDKA 2GUPA 4JKEA 1HUXA 1T6DA 2ZGZA 3H1QA 3UE5A 2ASOA 4A59A 4BRAA 4DQ8A 1KC8O 3FZFA 3HM8A 3M3ZA 5AQLA 4YOVA 2A40A 1T6CA 1HKBA 5LY3A 4CZIA 1DGKN 4M63C 4I6MB 1U2VB 3MDQA 3UKRA 3CMEN 1RFQA 3GDQA 3BF3A 4WQ4C 2D0PA 5GAHP 3P4IA 1GLLO 5DM7L 2FXUA 4A57A 5JLHA 1SS6A 3G6EN 4FWKA 1YAGA 4BC2A 5AQMA 2FF6A 3TPQA 1K8KA 3SAGA 5AQOA 1VQPN 3PLAA 4JK9A 1K8AO 4FPAA 4RTFD 5KPRA 1BUPA 5M1PA 5JLFA 3OBYA 4FL9A 3EL2A 2JWKA 3CCVN 5AQJA 3WXKA 3CQYA 3FE1A 3N4QA 4WCEL 4B1YB 3CJ9A 4BRGA 3CJBA 1O13A 4BC3A 1BG3A 3CJ7A 1WUAA 1NGIA 3LL3A 4JKDA 1QQNA 5H1SQ 5GAGP 3FZMA 3WXIA 1IJJA 3E9LA 2NRHA 2QXLA 3L0QA 3MN5A 3ULEB 3M1FA 4ISEA 3VENA 4C23A 5JVHL 1BA0A 5GAEP 3GG4A 3L6QA 3ZETB 2GX9A 2YHYA 3OBWA 1HKCA 2AA4A 3E9OA 1NGDA 3M5RA 3P39A 2IIRA 4JKFA 4O8KA 5AQUA 4BC5A 4B1WB 4BRCA 3ZX0A 4BRHA 3ID6A 3CJ1A 2QW9A 5AZIB 1EO1A 1TUYA 3O80A 2DPNA 1S72N 2P9SB 4JKHA 5FPDA 4C1NK 4XH5A 3D2FA 3MX2A 4BRMA 4C1NI 2ZGYA 2FF3B 3O8MA 4JK7A 3D2EA 3SBGA 3DJCA 3VERA 2IVNA 1N8RO 1NLVA 4H0OA 4BY9C 1X3MA 4MDBA 2QWMA 3IUCA 5GIPA 4HTLA 2P9NA 1Q82O 1VQ9N 1J6ZA 2ZF5O 5AQWA 4DKWA 3H46O 1YITN 4NLCA 3R8EA 4BG9A 2P9PB 1QVFM 2QWQA 1KXPA 3K9JA 1VQ6N 2QTDA 1TUUA 5EVZA 5BN8A 3H6EA 2FSKA 3ZX2A 5AFUH 3A5OC 2OTJN 2NRXA 3CC4N 3TTCA 2VCPA 4MO5A 2YJFA 3MWTA 1OKJA 1QZ6A 3VTHA 2P9LB 4UY8O 1QHAA 1HKGA 1QQOA 1T3VA 2NRRA 3JXUA 4BRFA 4IWVA 5KQDA 1BO5O 3RSEB 4YOTA 1VQ7N 2HSTA 3KHYA 4MLHA 3QMLA 4B1VA 3HI0A 4U67L 1ZXOA 5AQNA 2AP1A 3FGUA 4FWLA 4JKCA 3WQTA 3R1XA 4K43A 4KBOA 3C6HA 2E1ZA 3EO3A 1K73O 1BA1A 3O5BA 4FPBA 3ZEUA 2GWJA 3I33A 1X3NA 4CD3A 3CC2N 4O5FA 2YX6A 3AAPA 3Q7CA 3AGKA 5AQGA 5AQXA 3VF4A 4FWRA 4AM7A 3SAHA 4CZJA 3CCEN 4GV3A 2P9UB 2P9IA 2CH6A 2OTLN 3R6MA 1JCGA 4BR5A 4IOXA 4BRQA 4H5NA 1T44A 1C0GA 3E9PA 4OPHA 3AARA 1NM1A 3K9KA 1M1KO 4DHYA 3O1WA 3BF1A 3QBWA 2E2NA 5AQHA 3NVKA 2Q1NA 4JHDA 3CCSN 4G9ZA 3UKUB 3PIOL 1VQON 4GV6A 4IEEA 2NRWA 3VESA 4JKAA 4BC4A 4WQ4A 1NGJA 2QWPA 2WUSA 3QFUA 2Q36A 5AZJB 4BVPA 3EKSA 3HTVA 4CZKA 2EWSA 4CZLA 2PFUA 4GVEA 4Y0WA 1YJ9N 4FWMA 1NGHA 3CJCA 3CPEA 3VOVA 1NGBA 4I6MA 5ADXH 4H5WA 2HBMA 5C2DA 1U2VA 3CHWA 5EX5A 4JEPA 3IDHA 4BR2A 4FWOA 5BPNA 4CBUA 4FSVA 3VETA 5AQSA 4K25A 3O6WA 3CCMN 1VQ5N 5E84A 2Q0RA 3L4IA 5EXWA 1BDGA 3C7NB 3HSCA 4DB3A 2Q31A 3CPWM 1SAZA 3AY9A 2QWOA 3W0LA 4JN4A 3H3NO 2YJEA 3QICA 5CHIA 2D1KA 3TU5A 1EQYA 5CE3A 2FSNA 3GE1A 2BUPA 4EHUA 3J7ZO 3EE8A 3WEEB 3FZKA 4ILGB 4A5AA 3G71N 2YI1A 1NGCA 2YHWA 4IOCL 1Q7YO 1OVYA 4MDAA 1VQMN 2QI2A 1Q18A 3DXMB 1BWFO 4CZMA 1XC3A 1NBWA 1QZ5A 3ULEA 5AQPA 5LJVA 2E1YA 4BR7A 5KQ8A 2ZJQL 3WQUA 1Z6RA 3U4LA 4WFBL 1GLFO 2P9KB 2Q2RA 3ZETA 4CZEA 2NNWA 3B8AX 3A0IX 4O8UA 1W97L 2VGMA 3WT0A 1QVGM 3O9TA 3OHRA 3QFPA 4FWSA 3G4SN 1S22A 2CGKA 4IDHA 5AZIA 3LDOA 2E2OA 3SK3A 3VEVA 2VWBA 3CCRN 5M1FA 3CIPA 1P8ZA 2P9SA 3FZLA 5BN9A 1YHQN 1GLEG 1GLBG 4IOAL 2PAVA 3O9UA 5JICA 3I55N 1ATRA 2E88A 3CI5A 4WYBA 4BREA 5MLCQ 4HWIA 4IXCA 4IEIA 5C10A 1S3XA 3CJAA 3LDPA 4IFEA 3TTDA 5HL7L 1VQKN 1TYQB 5AQZA 3VTIA 1RDUA 2P9PA 3AAQA 2D0OA 3SLCA 3U9ZA 1NWKA 5AQYA 3WXMB 4BGBA 3BEXA 4FVUA 2HF4A 3LDNA 2QWNA 3LM2A 3NMUA 5C0YA 2W41A 5JMVA 3CMAN 4GY2B 1Y64A 4H5VA 1NGAA 4RWTA 2F9WA 3QBXA 2V52B 4A2AA 2P9LA 4JD2B 3BUZB 4H0XB 3O1BA 5BPMA 2NRTA 4MLEA 3C6AA 4K42A 4AF1A 2NRZA 5M1QA 3RSEA 3VEOA 4EAHD 3A8YA 1Q81O 1CZAN 3VF6A 4BRNA 3LM9A 4BQLA 1NMDA 3VMFB 1P90A 2CH5A 3HBTA 5M1NA 5HOOA 1KAYA 3PIPL 4GNIA 1V4TA 4CZFA 5I9EB 1NGGA 4FWQA 4CBXA 2KKZA 1ZBSA 1U6ZA 2A3ZA 1BU6O 2JWLA 4H0VB 1VQ4N 4B9QA 3O9SA 3I56N 1LOTB 1YJNN 5AQRA 2P9UA 5TKYA 1ATNA 2ZWHA 4BGAA 3E1YA 2PBDA 4OO1J 1IG8A 3CCQN 3HOTA 2W40A 2UYTA 2ASPA 4M7YA 2WBNA 4H5RA 5AQVA 4NB4A 3MCPA 3MCAB 4LC9B 4BVOA 3ENHA 3U9DA 5ELZA 3H3OB 1MWKA 2A5XA 4H0YB 2NLXA 4YOYA 3UKUA 3VPZA 3EKUA 4NO7A 3DLLL 4BQZA 3DXKB 3T7ZA 3O9RA 5KPZA 2F7TA 5M1OA 2QA4N 2H3GX 3MN7A 1BOTO 5AZJA 4FOEA 3FZHA 5AQQA 5C2FA 3VGLA 5B8HA 3CERA 3HZ6A 4PKGA 3RVCA 3SBTA 4ISFA 3CXCM 3CCJN 3ENOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JS6 A;  5BRF A;  3EZW A;  4H0P A;  2E2P A;  4QS7 A;  4FWP A;  3O08 A;  1SZ2 A;  3U8X A;  4K41 A;  4H5T A;  2FSJ A;  3A5L C;  4EHT A;  1D4X A;  2GTD A;  2CGL A;  3GOI A;  4XH4 A;  1E4F T;  1HJO A;  3LDL A;  3C7N A;  2V7Z A;  2ITM A;  4A62 A;  3W3D A;  1RGI A;  4PKH A;  2A41 A;  3SMP A;  4CJ7 A;  4BR9 A;  5KPT A;  1LCU A;  3O4W A;  3D7E O;  5F1X A;  3CET A;  1HX1 A;  4L3Q A;  2HMP A;  5AFU A;  4F9O A;  2V51 B;  1GLC G;  4M7X A;  4B1X B;  3WEE A;  2YHX A;  3UKR B;  4ISG A;  1HPM A;  2IVO A;  2E8A A;  2QM1 A;  4PL7 A;  3DXM A;  5AQT A;  3FR0 A;  4PL8 A;  1MA9 B;  1K8K B;  4EFH A;  1WOQ A;  2P9K A;  3VEX A;  4BRP A;  1R59 O;  3VEY A;  4B1Z A;  4IZ9 A;  2Q97 A;  3KZB A;  4A61 A;  4JAX A;  3DAW A;  3MMV A;  4MO4 A;  1H1V A;  5AR0 A;  3IMX A;  2A6A A;  3IFR A;  1NGF A;  2FLO A;  3MN9 A;  5LJW A;  2E2Q A;  4PKI A;  4BRK A;  3MN6 A;  4H0T B;  4Z94 A;  4XEI A;  1DEJ A;  4FOI A;  3SMS A;  3ZX3 A;  2D4W A;  5BRD A;  3S41 A;  4E1J A;  5F2R A;  1GLD G;  3M6G A;  1MDU B;  1YVN A;  3C0B A;  4YDU A;  2BTF A;  3DWL A;  4CZG A;  2VYP A;  4IO8 A;  3VGK A;  1TYQ A;  3R9P A;  3A5M C;  5AQI A;  4BG8 A;  1MWM A;  1ATS A;  3ATV A;  5BPL A;  1X9J A;  2QWR A;  1SQK A;  3WXJ A;  5FPE A;  3D2F B;  3ATU A;  4JNE A;  4YDU C;  4BR0 A;  4AM6 A;  4CI6 A;  5KPZ A;  5KPR A;  2I7P A;  2OAN A;  3H1V X;  5ADX A;  3D2E B;  4BRL A;  4RCH A;  4JD2 A;  4BRO A;  1C0F A;  3F9M A;  4BR4 A;  2P9N B;  2YCH A;  4FO0 A;  4J8F A;  4DCH A;  5BR9 A;  3EN9 A;  3SJH A;  5BRE A;  2F9T A;  3G25 A;  5EY4 A;  1JCF A;  1KAZ A;  3FLC O;  1ESV A;  2E20 A;  2V7Y A;  5FPM A;  3GL1 A;  2HOE A;  3KVG A;  1ZC6 A;  2GEM A;  4CBW A;  2CGJ A;  3A5N C;  4XH1 A;  5BRH A;  3WUH A;  5AQK A;  4CZH A;  4B1U B;  4BRI A;  5F0X A;  1XUP O;  1Z05 A;  2GEL A;  2A42 A;  4BRD A;  1E4G T;  3VEZ A;  5FPN A;  2HF3 A;  3J8A A;  3VGM A;  1JCE A;  5AQF A;  2IVP A;  2Q0U A;  4QS9 A;  5EOY A;  1G99 A;  4FWN A;  4QS8 A;  1HLU A;  4IJA A;  3H45 C;  3ZEU B;  4H03 B;  3DXK A;  1NGE A;  1YUW A;  3GBT A;  2GWK A;  4WQ5 A;  2KHO A;  3FFK B;  4IJN A;  3VEW A;  3I8B A;  2P9I B;  5E26 A;  2ASM A;  1KAX A;  3CQX A;  4EIA A;  3MK6 A;  2I7N A;  1XQS C;  3VF2 A;  4A2B A;  1GLJ O;  2J4R A;  3ID8 A;  3WXL A;  3UB5 A;  1DKG D;  1QQM A;  2NZT A;  3BP8 A;  4WQ5 C;  1V4S A;  1RDW X;  3LDQ A;  4JHD B;  2QWL A;  4CD1 A;  1GLA G;  1YXQ A;  3QB0 A;  3QDK A;  2GUP A;  1HUX A;  1T6D A;  2ZGZ A;  3H1Q A;  3UE5 A;  2ASO A;  4BRA A;  4DQ8 A;  3FZF A;  3HM8 A;  3M3Z A;  5AQL A;  2A40 A;  1T6C A;  1HKB A;  5LY3 A;  4CZI A;  1DGK N;  4M63 C;  4I6M B;  1U2V B;  3MDQ A;  3UKR A;  1RFQ A;  3GDQ A;  3BF3 A;  4WQ4 C;  2D0P A;  3P4I A;  1GLL O;  2FXU A;  5JLH A;  4FWK A;  1YAG A;  4BC2 A;  5AQM A;  2FF6 A;  3TPQ A;  1K8K A;  5AQO A;  4FPA A;  4RTF D;  1BUP A;  5JLF A;  4FL9 A;  3EL2 A;  5AQJ A;  3WXK A;  3CQY A;  3FE1 A;  4B1Y B;  3CJ9 A;  4BRG A;  3CJB A;  4BC3 A;  1BG3 A;  3CJ7 A;  1WUA A;  1NGI A;  3LL3 A;  1QQN A;  3FZM A;  3WXI A;  1IJJ A;  3MN5 A;  2NRH A;  2QXL A;  3L0Q A;  3ULE B;  3M1F A;  4ISE A;  3VEN A;  4C23 A;  1BA0 A;  3GG4 A;  3L6Q A;  3ZET B;  2YHY A;  1HKC A;  2AA4 A;  4O8K A;  1NGD A;  5AQU A;  2IIR A;  4BC5 A;  4B1W B;  4BRC A;  3ZX0 A;  4BRH A;  3CJ1 A;  2QW9 A;  5AZI B;  1TUY A;  3O80 A;  2DPN A;  2P9S B;  5FPD A;  4XH5 A;  3D2F A;  4BRM A;  2ZGY A;  2FF3 B;  3O8M A;  3D2E A;  3DJC A;  3VER A;  2IVN A;  1NLV A;  4H0O A;  1X3M A;  2QWM A;  3IUC A;  4HTL A;  2P9N A;  1J6Z A;  2ZF5 O;  5AQW A;  3H46 O;  3R8E A;  4BG9 A;  2P9P B;  2QWQ A;  1KXP A;  5EVZ A;  1TUU A;  5BN8 A;  3H6E A;  2FSK A;  3ZX2 A;  5AFU H;  3A5O C;  2VCP A;  4MO5 A;  2YJF A;  1OKJ A;  1QZ6 A;  2P9L B;  1QHA A;  1HKG A;  1QQO A;  4BRF A;  3JXU A;  4IWV A;  5KQD A;  1BO5 O;  3RSE B;  3KHY A;  4MLH A;  3QML A;  4B1V A;  3HI0 A;  1ZXO A;  5AQN A;  2AP1 A;  3FGU A;  4FWL A;  3WQT A;  4K43 A;  4KBO A;  2E1Z A;  3EO3 A;  1BA1 A;  3O5B A;  4FPB A;  3ZEU A;  2GWJ A;  3I33 A;  1X3N A;  4CD3 A;  4O5F A;  3AAP A;  5AQG A;  5AQX A;  3VF4 A;  4FWR A;  4AM7 A;  4CZJ A;  2P9U B;  2P9I A;  2CH6 A;  3R6M A;  1JCG A;  4BR5 A;  4BRQ A;  4H5N A;  1T44 A;  1C0G A;  3AAR A;  1NM1 A;  4DHY A;  3O1W A;  3BF1 A;  3QBW A;  2E2N A;  5AQH A;  2Q1N A;  4JHD A;  3UKU B;  3VES A;  4BC4 A;  4WQ4 A;  1NGJ A;  2QWP A;  2WUS A;  3QFU A;  2Q36 A;  5AZJ B;  4BVP A;  3EKS A;  3HTV A;  4CZK A;  2EWS A;  4CZL A;  4Y0W A;  4FWM A;  1NGH A;  3CJC A;  3VOV A;  1NGB A;  4I6M A;  5ADX H;  4H5W A;  1U2V A;  3CHW A;  5EX5 A;  4BR2 A;  3IDH A;  5BPN A;  4FWO A;  4CBU A;  4FSV A;  3VET A;  5AQS A;  4K25 A;  3O6W A;  5E84 A;  2Q0R A;  3L4I A;  5EXW A;  1BDG A;  3C7N B;  3HSC A;  4DB3 A;  2Q31 A;  1SAZ A;  3AY9 A;  2QWO A;  3W0L A;  4JN4 A;  3H3N O;  2YJE A;  3QIC A;  2D1K A;  3TU5 A;  1EQY A;  5CE3 A;  2FSN A;  3GE1 A;  2BUP A;  4EHU A;  3WEE B;  3FZK A;  2YI1 A;  1NGC A;  2YHW A;  1Q18 A;  3DXM B;  1BWF O;  4CZM A;  1XC3 A;  1NBW A;  1QZ5 A;  3ULE A;  5AQP A;  5LJV A;  2E1Y A;  4BR7 A;  5KQ8 A;  3WQU A;  1Z6R A;  3U4L A;  1GLF O;  2P9K B;  2Q2R A;  3ZET A;  4CZE A;  3B8A X;  3A0I X;  3WT0 A;  3OHR A;  3QFP A;  4FWS A;  1S22 A;  2CGK A;  3SK3 A;  5AZI A;  3LDO A;  2E2O A;  3VEV A;  2VWB A;  3CIP A;  1P8Z A;  2P9S A;  3FZL A;  5BN9 A;  1GLE G;  1GLB G;  2PAV A;  5JIC A;  1ATR A;  2E88 A;  3CI5 A;  4WYB A;  4BRE A;  4HWI A;  4IXC A;  1S3X A;  3CJA A;  3LDP A;  1TYQ B;  5AQZ A;  3AAQ A;  2P9P A;  3SLC A;  2D0O A;  3U9Z A;  4BGB A;  1NWK A;  5AQY A;  3BEX A;  2HF4 A;  3LDN A;  2QWN A;  3LM2 A;  2W41 A;  5JMV A;  4GY2 B;  1Y64 A;  4H5V A;  1NGA A;  4RWT A;  2F9W A;  3QBX A;  2V52 B;  4A2A A;  2P9L A;  4JD2 B;  3BUZ B;  4H0X B;  3O1B A;  5BPM A;  4MLE A;  4K42 A;  3RSE A;  3VEO A;  4EAH D;  3A8Y A;  1CZA N;  3VF6 A;  4BRN A;  3LM9 A;  4BQL A;  1NMD A;  2CH5 A;  3HBT A;  1KAY A;  4GNI A;  1V4T A;  4CZF A;  5I9E B;  1NGG A;  4FWQ A;  4CBX A;  1ZBS A;  1U6Z A;  2A3Z A;  1BU6 O;  4H0V B;  4B9Q A;  1LOT B;  5AQR A;  2P9U A;  5TKY A;  1ATN A;  2ZWH A;  4BGA A;  2PBD A;  1IG8 A;  2W40 A;  2UYT A;  2ASP A;  4M7Y A;  5AQV A;  4H5R A;  4NB4 A;  3MCP A;  4LC9 B;  4BVO A;  3ENH A;  3U9D A;  5ELZ A;  3H3O B;  1MWK A;  2A5X A;  4H0Y B;  2NLX A;  3UKU A;  3VPZ A;  3EKU A;  4NO7 A;  4BQZ A;  3DXK B;  2H3G X;  3MN7 A;  1BOT O;  5AZJ A;  4FOE A;  3FZH A;  5AQQ A;  3VGL A;  5B8H A;  3CER A;  3HZ6 A;  4PKG A;  4ISF A;  3ENO A; 
#chains in the Genus database with same CATH topology
 3MED A;  3EZW A;  3LP1 A;  4K8X A;  4WFN L;  1FK9 A;  3O3F A;  3QO9 A;  4H5T A;  4EHT A;  2GTD A;  2W6K A;  3LAN A;  1HJO A;  3ZSQ A;  4CEC A;  5M1K A;  2O8B A;  4LD0 A;  4JI7 K;  1RGI A;  4OJR A;  2NRV A;  2KLA A;  1VSF A;  4DFM A;  1HX1 A;  1HNI A;  2V51 B;  1GLC G;  2OA8 A;  3CCU N;  3WEE A;  1GOA A;  1HPM A;  3CD6 N;  5DMR A;  4CW7 B;  3OYB A;  3ALY A;  4KH6 A;  3VEX A;  1R59 O;  2RHK A;  1W2B M;  1LWF A;  5T7B A;  4C8K A;  5AR0 A;  4ILH A;  3THX B;  3IFR A;  5TKW A;  3S41 A;  4JKG B;  3M6G A;  1MDU B;  1RDD A;  2OCE A;  4CZG A;  2VYP A;  3O3H A;  4Q0B A;  3KLG A;  2D5R A;  5HRR A;  3RR8 A;  1TGO A;  5FPE A;  4U7B A;  3AGR A;  3D2F B;  3ATU A;  4JNE A;  4YDU C;  4CI6 A;  5KPR A;  4IO9 L;  4CHP A;  1WBD A;  1LAW A;  3D2E B;  1RDB A;  4BRL A;  4RCH A;  3DOL A;  1VQ8 N;  1WAF A;  5KRS A;  3SQ0 A;  1A5V A;  4FO0 A;  4DCH A;  4JS4 A;  1NJI O;  3SPZ A;  3SJH A;  2F9T A;  3G25 A;  4WF9 L;  1ESV A;  2V7Y A;  5FPM A;  3ENB A;  2UXD K;  2GEM A;  3F2K A;  2CGJ A;  3HP6 A;  4B1U B;  4BRI A;  2A42 A;  4E7H A;  5FPN A;  4E0D A;  3SV3 A;  5AQF A;  1IKX A;  2VG7 A;  4FW2 A;  5C24 A;  3H45 C;  2HNZ A;  4DF4 A;  3QNO A;  1HMV A;  4H03 B;  2BAN A;  3HVR A;  2G8V A;  3AO3 A;  1YUW A;  3GBT A;  4WQ5 A;  2IGI A;  1BGX T;  2KHO A;  4KTZ A;  2P9I B;  1NK5 A;  4FJM A;  1T8E A;  3TSU A;  3DI6 A;  1YVU A;  2ZJR L;  4YFU A;  4OKE A;  1QQM A;  3BP8 A;  4DQI A;  5EU7 A;  1RDA A;  1V4S A;  3PO5 A;  4JHD B;  4CD1 A;  3QDK A;  4JKE A;  4HHT A;  5BR8 K;  3ZSV A;  4E7I A;  1Q9Y A;  2A40 A;  1T6C A;  5LY3 A;  3SUQ A;  4N41 A;  4I6M B;  3RWU A;  3CME N;  1RFQ A;  2D0P A;  1GLL O;  1T7P A;  4A57 A;  1SS6 A;  3G6E N;  4DTS A;  2PYL A;  1YAG A;  2FF6 A;  3AVK A;  5AQO A;  3VQC A;  1YTU A;  4Q5V A;  4DV5 K;  4DTX A;  1U04 A;  3VQA A;  1KVA A;  4RW4 A;  4B3M K;  3THX A;  3WNF A;  4BC3 A;  4DSE A;  1HPZ A;  1BG3 A;  3LL3 A;  4DR7 K;  4JKD A;  3V81 A;  1K6Y A;  3FZM A;  1KSP A;  3C6T A;  4QCL A;  2QXL A;  3AVF A;  3VQE A;  3KKR A;  4FJ7 A;  5GAE P;  3L6Q A;  3J80 O;  1HKC A;  3E9O A;  4JKF A;  3C6U A;  3ZX0 A;  4BRH A;  3CJ1 A;  2DPN A;  3IRX A;  1FKP A;  2F8T A;  1S6P A;  2P9S B;  4W5O A;  3D2F A;  4W5T A;  2P51 A;  2ZGY A;  5C42 A;  3D2E A;  2EX3 A;  3VER A;  1JLB A;  4JS5 A;  1NLV A;  4BY9 C;  2KFZ A;  4HCC A;  1X3M A;  2ZF5 O;  4E1N A;  3H46 O;  3KJV A;  4N5S A;  3VQ8 A;  3V9Z A;  1VQ6 N;  2QTD A;  1TUU A;  3H6E A;  3ZX2 A;  5AFU H;  3A5O C;  2OTJ N;  3PSI A;  4MO5 A;  3L2W A;  4DV7 K;  3VTH A;  1C1B A;  1QQO A;  2X78 A;  5KQD A;  3RSE B;  4YOT A;  4JV5 K;  3KHY A;  1GOC A;  4B1V A;  1UA0 A;  4CHO A;  4KHS A;  4M3Y A;  3FGU A;  1LWC A;  3CYM A;  1UOC A;  2ITG A;  3EO3 A;  4AHV A;  2BGG A;  1RTD A;  4TSX A;  2OYQ A;  4JI2 K;  4H4O A;  3AAP A;  3Q7C A;  3AGK A;  2G8H A;  4JI1 K;  2HW3 A;  4FWR A;  3VA3 A;  1HYZ A;  4AHT A;  1RT7 A;  2P9I A;  2CH6 A;  3V6D A;  1JCG A;  4DSJ A;  3JYT A;  4OPH A;  3AAR A;  3QEP A;  3O1W A;  3QBW A;  2E2N A;  4FM0 A;  4JHD A;  4JI6 K;  3CCS N;  4ELT A;  4B9T A;  1WBB A;  2NRW A;  1TK5 A;  3QFU A;  2D0A A;  3EKS A;  4DQP A;  4CZL A;  4B9U A;  3DLG A;  3CPE A;  4CJT A;  4I6M A;  4KO0 A;  5K14 A;  4CFD A;  3CHW A;  5EX5 A;  3DM2 A;  2DY4 A;  3IG1 A;  2O8F B;  2DFH A;  2Q0R A;  3WNE A;  4DB3 A;  1J5O A;  5HLF A;  2KZZ A;  4DV3 K;  4JN4 A;  3MAQ A;  2F8S A;  1EQY A;  4LFC K;  5CE3 A;  4OPK A;  3GE1 A;  4EHU A;  4IG3 A;  3EE8 A;  4IOC L;  1S1X A;  4ILG B;  1T05 A;  5IT9 O;  3DLK A;  2YHW A;  1Q18 A;  1OVQ A;  4OKJ A;  3I8D A;  1BWF O;  1XC3 A;  4PQU A;  5AQP A;  2WOM A;  1T03 A;  2KFN A;  2Q2R A;  4Z4I A;  3WT0 A;  1WSG A;  2P5G A;  3OHR A;  4J2E A;  3KIO A;  1S22 A;  3SK3 A;  2CGK A;  1MU2 A;  3VEV A;  3CCR N;  2P1J A;  5LMN K;  2P9S A;  1RTJ A;  4CGD A;  1GLE G;  1GLB G;  1NK9 A;  4CJW A;  4FJI A;  4M45 A;  4DSF A;  1S3X A;  4IFE A;  4I9Q A;  4CJS A;  3TR8 A;  5AQZ A;  1JXB A;  1G15 A;  3TAN A;  4R5P A;  4FVU A;  4DR1 K;  3AVJ A;  4FLV A;  3LDN A;  4CJ5 A;  3LM2 A;  2W41 A;  3NFA A;  4CES A;  1Y64 A;  2F9W A;  1LV5 A;  1UAX A;  2V52 B;  4A2A A;  1HYS A;  4H0X B;  4KV8 A;  2NRT A;  3C6A A;  4NCA A;  4AF1 A;  3PO4 A;  4DTO A;  4FK2 A;  3RSE A;  5M1Q A;  1C0M A;  1WLJ A;  2UU9 K;  5DK5 A;  1NMD A;  2CH5 A;  1IBM K;  3HBT A;  5M1N A;  2IS3 A;  3PIP L;  4GNI A;  3RTV A;  4CGJ A;  1VRT A;  4OLA A;  1W7A A;  3PY8 A;  4GVM A;  1U6Z A;  2A3Z A;  1BU6 O;  2R7Y A;  4FLU A;  1N33 K;  4Z4G A;  3I0R A;  4M3X A;  4OO1 J;  1IG8 A;  2ASP A;  4M7Y A;  2YHA A;  3MCP A;  2OPQ A;  1TAU A;  2A5X A;  2NLX A;  4CCH A;  3ZSO A;  4CK2 A;  4LF6 K;  3DXK B;  3HO1 A;  2QA4 N;  2F7T A;  1UWB A;  4FOE A;  5AQQ A;  5C2F A;  4FZY A;  3VGL A;  3HZ6 A;  3HT3 A;  4CEE A;  3SBT A;  4CHZ A;  3CXC M;  3ENO A;  1YT3 A;  2B6A A;  3JS6 A;  4X64 K;  5BRF A;  4FWP A;  2O8E B;  3O08 A;  1WSH A;  1SZ2 A;  3CF5 L;  3U8X A;  4K41 A;  4KKO A;  4JKB A;  3GOI A;  4XH4 A;  3IAY A;  2O8F A;  3EEQ A;  2IOC A;  1IG9 A;  1CXQ A;  2WFB A;  3SMP A;  5KRT A;  2HBL A;  3MXJ A;  5F1X A;  1C0T A;  1DTT A;  5AJ3 K;  4M7X A;  3NGI A;  4B1X B;  4DLG A;  3G10 A;  3L2Q A;  1ASW A;  4F2R A;  2D0B A;  4DWI A;  4FCY A;  1D9D A;  1I94 K;  3NVM A;  3FR0 A;  1X9W A;  3C65 A;  3HPG A;  1RT2 A;  4DU3 A;  1WOQ A;  3C95 A;  4B1Z A;  1X1P A;  3RMC A;  3KZB A;  1CLQ A;  4JAX A;  1YF5 L;  3WNH A;  4MO4 A;  4KI4 A;  1NGF A;  3T1H K;  1NK0 A;  5LJW A;  4BRK A;  3MN6 A;  4Z94 A;  2QKB A;  4NXN K;  4FOI A;  4RW9 A;  3ZX3 A;  1Q8I A;  4E1J A;  5F2R A;  1GLD G;  2YNH A;  1XHX A;  3DWL A;  1VSH A;  2YNI A;  2HMI A;  1Q86 O;  4BG8 A;  4JLH A;  1MWM A;  3OYC A;  1S1V A;  3NBP A;  1VAZ A;  2IAJ A;  3LPT A;  4PHT X;  4YOR A;  5C25 A;  3NF6 A;  4ILJ A;  2OAN A;  4OPA A;  1ZYQ A;  4GV9 A;  3AO1 A;  5ADX A;  1KCF A;  1QE1 A;  4BRO A;  1K9M O;  3L2V A;  3Q7B A;  3BZK A;  4FLY A;  2OPR A;  3SQ4 A;  4FJJ A;  2VG5 A;  3ZT0 A;  3TI0 A;  2QKK A;  2E20 A;  3KVG A;  3KD5 E;  3L4Q A;  1ZC6 A;  4CBW A;  4XH1 A;  3WUH A;  3U3G A;  1SUQ A;  5F0X A;  1XUP O;  4CER A;  4JK8 A;  1KLM A;  4DMN A;  3HYF A;  1HNV A;  3VEZ A;  3F9K A;  2RE2 A;  1JCE A;  5CYQ A;  2IVP A;  2Q0U A;  5FLX O;  5EOY A;  3TAE A;  3P38 A;  4JRQ A;  4FK0 A;  4AQY K;  5LMU K;  3D0P A;  3DXK A;  1NGE A;  1XWL A;  3VQ9 A;  2GWK A;  3OTO K;  2YHB A;  1S5J A;  3I8B A;  2ASM A;  1YIJ N;  2YNF A;  4KPY A;  4KHY A;  3D6R A;  4A2B A;  1KVB A;  3O4N A;  2O8E A;  4NLB A;  3BDP A;  1GLJ O;  2J4R A;  3WXL A;  1DKG D;  2NZT A;  4WQ5 C;  1U49 A;  4LFA K;  4C8O A;  4ID1 A;  1GLA G;  1YXQ A;  1JLG A;  1NK4 A;  2GUP A;  3HPH A;  2ZGZ A;  3H1Q A;  2ASO A;  4JI0 K;  3HM8 A;  1U45 A;  3PX0 A;  1O1W A;  2ETJ A;  2X6N A;  1HKB A;  4CJU A;  3MDQ A;  1YTA A;  1HYV A;  3C94 A;  2I5J A;  5JLH A;  1XC9 A;  4JYA K;  5HRN A;  4FWK A;  5AQM A;  3DRS A;  4DQQ A;  3SAG A;  4B9V A;  1VQP N;  3PUF A;  3RRH A;  3CFR A;  4DV4 K;  4RTF D;  3OVN A;  1U47 A;  3U3Y A;  4DTN A;  3FE1 A;  4CGG A;  1J5E K;  1X9M A;  3S3N A;  1O13 A;  1HNX K;  1QQN A;  4LF7 K;  5GAG P;  3MN5 A;  3L0Q A;  4ID5 A;  1KLN A;  4C23 A;  3GG4 A;  4FJX A;  3KLI A;  1SL2 A;  1TV6 A;  3OBW A;  4CFB A;  2AA4 A;  2IIR A;  4ELV A;  3K58 A;  2Z1I A;  1EO1 A;  3ID6 A;  3V4I A;  4CF8 A;  1S72 N;  1N5Y A;  3D45 A;  4BRM A;  3O8M A;  2FF3 B;  1BIU A;  1BHL A;  3DJC A;  2IVN A;  3QIN A;  3LWL A;  3IUC A;  1Q82 O;  2WON A;  1J6Z A;  3HM9 A;  3B6P A;  4NLC A;  2LSN A;  4CJ3 A;  1RT3 A;  3VQD A;  2QWQ A;  3QEI A;  3KK1 A;  2FSK A;  4DSK A;  4AHR A;  2NRX A;  4XIU A;  2YKN A;  3TTC A;  3AVB A;  3SQ2 A;  1NK8 A;  4FJL A;  1S6Q A;  1J53 A;  4IWV A;  3DLE A;  2RN2 A;  3ZCM A;  4CHN A;  1VQ7 N;  4MLH A;  4U67 L;  4LF8 K;  2AP1 A;  3B6O A;  4JKC A;  3WQT A;  3HJF A;  3NGY A;  4FW1 A;  2E1Z A;  2FBX A;  3HK2 A;  1IBK K;  1ITG A;  3AVI A;  1X3N A;  4CD3 A;  3HP9 A;  2YX6 A;  3VQ7 A;  1CXU A;  3CQ8 A;  3KLE A;  5AQG A;  4YHH K;  5JS1 A;  1HNW K;  2GUI A;  2FBV A;  1F21 A;  2GBZ A;  4BR5 A;  1HR0 K;  1S1W A;  4CF1 A;  3E9P A;  3AVM A;  4CE9 A;  1M1K O;  4DHY A;  1I3A A;  5FDL A;  3J7A P;  4PA1 A;  3NVK A;  2Q1N A;  1L3T A;  4JKA A;  4BC4 A;  3M8R A;  4M3Z A;  1NGJ A;  2QWP A;  1RTH A;  3HTV A;  4CZK A;  1XMO K;  1JLQ A;  1NKB A;  4FLT A;  1NGH A;  3EZ5 A;  3CJC A;  3VOV A;  5C2D A;  4H5W A;  5HRO A;  2HND A;  1RCH A;  5BPN A;  4FWO A;  3AVA A;  4CBU A;  1EWQ A;  5AQS A;  2G8K A;  3CCM N;  1VQ5 N;  5E84 A;  4EZ9 A;  1BDG A;  3HSC A;  1WAJ A;  1VSL A;  1CZB A;  2Q31 A;  1SAZ A;  2E4L A;  3AY9 A;  3KK2 A;  3H3N O;  3QIC A;  5CHI A;  3L8B A;  4KHP K;  2HHV A;  3TU5 A;  2PYJ A;  4X65 K;  2FSN A;  4PWD A;  1JXE A;  1NNE A;  3FZK A;  1W9H A;  1NGC A;  2YI1 A;  1Y97 A;  1C6V A;  4LFB K;  3NH2 A;  1JL2 A;  4CIE A;  1QZ5 A;  5LJV A;  3HXM A;  2E1Y A;  4NYN A;  3WQU A;  1Z6R A;  4DQS A;  2P9K B;  2HNY A;  4I7F A;  3QEX A;  2NNW A;  3A0I X;  3LAL A;  1WB9 A;  4CEB A;  1W97 L;  4F3T A;  3O9T A;  4W5N A;  2VQE K;  4ZTJ A;  4MQ3 A;  3AV9 A;  2HHX A;  5IWA K;  3DLH A;  3FZL A;  5BN9 A;  1A5W A;  3AO5 A;  4KHU A;  1ATR A;  2E88 A;  3CI5 A;  4C8N A;  4BRE A;  4IXC A;  5FRO A;  5KGX A;  3TTD A;  1BQM A;  1TYQ B;  1HRH A;  5FRM A;  3AAQ A;  3SYZ A;  5AQY A;  3WXM B;  4FZZ A;  5JMV A;  3LZI A;  1NGA A;  1IKY A;  1NKC A;  2W6L A;  4JD2 B;  2HHQ A;  2OPP A;  4MLE A;  4DTJ A;  1JKH A;  2O4G A;  4J2A A;  3VEO A;  3OYF A;  3A8Y A;  1L3V A;  4DG1 A;  1ZBF A;  3VF6 A;  2XY5 A;  4IBN A;  3LM9 A;  4BQL A;  4Y1C A;  4B9S A;  3VMF B;  1Z26 A;  2UXB K;  3OYK A;  1XI1 A;  1V4T A;  1NGG A;  4CBX A;  2KKZ A;  1NK6 A;  1VQ4 N;  4H0V B;  3ZSW A;  4DU4 A;  1LOT B;  3AA5 X;  1ZBH A;  5I3U A;  5AQR A;  4CFA A;  1VSD A;  2ZWH A;  3E1Y A;  1HNZ K;  3JAM O;  3CCQ N;  2KZM A;  2W40 A;  4H5R A;  2KQ2 A;  4NB4 A;  3SUN A;  3VQ4 A;  3MCA B;  3RRG A;  2XRI A;  3L3V A;  3TAR A;  1LWE A;  4H0Y B;  1NJZ A;  3TAB A;  1NK7 A;  4FM2 A;  1NKE A;  3VPZ A;  4OPJ A;  4NO7 A;  4E7J A;  4B3O A;  3T7Z A;  4JI8 K;  4NCB A;  3TAP A;  2H3G X;  3OYJ A;  3FZH A;  3AA2 A;  5B8H A;  3CER A;  3KTQ A;  3RVC A;  4LF9 K;  3OS1 A;  3HOS A;  3VQ6 A;  1YI2 N;  4H0P A;  5J2Q A;  4QS7 A;  3CC7 N;  1BCM A;  2CGL A;  1E4F T;  5HBM A;  1TKX A;  3TSQ A;  2V7Z A;  4YOW A;  4A62 A;  2G8F A;  4Y1D A;  4PKH A;  3LDS A;  5HP1 A;  5J2N A;  5KPT A;  2BH1 A;  1S9G A;  3D7E O;  3OYH A;  3CET A;  4L3Q A;  4DR4 K;  2HMP A;  4CGF A;  2WC9 A;  3QLH A;  3MXM A;  3UKR B;  4KH4 A;  2E8A A;  3THY B;  4PL7 A;  3THV A;  5GIO A;  3E66 A;  4KH5 A;  5AQT A;  3T1A A;  2KTQ A;  2UUA K;  4CHY A;  2A1R A;  3LP0 A;  3K5L A;  1K8K B;  4EFH A;  2PY5 A;  2P9K A;  1UA1 A;  2Q3S A;  4IZ9 A;  3PV8 A;  2Q97 A;  3SUO A;  1RNH A;  1JJ2 M;  1D9F A;  4FVM A;  4YOU A;  4BE0 A;  3VQQ A;  3TTF A;  1QTM A;  3R3L A;  4FJ5 A;  1H1V A;  5J1E A;  4PUO A;  1WSF A;  2A6A A;  1LW0 A;  3MN9 A;  3OJS A;  4A5B A;  4DTR A;  3F5T A;  4FZX C;  4R79 A;  3TWH A;  3RMB A;  3OW2 M;  3THW B;  4FJ8 A;  3BY5 A;  3SMS A;  3M8Q A;  5BRD A;  3NF8 A;  4CJK A;  2HBK A;  4KTQ A;  2QXF A;  5DM6 L;  2EHG A;  2HBJ A;  3ULD A;  3HRG A;  4IO8 A;  1VQN N;  3NCI A;  1TYQ A;  5AQI A;  3QEV A;  2W42 A;  1TVR A;  4J2D A;  3DYA A;  3SAF A;  3VQB A;  4FJN A;  2ZQB A;  1SQK A;  1K73 O;  3KD1 E;  5KPZ A;  4AM6 A;  1QSS A;  2I7P A;  4C8L A;  3H1V X;  2G8U A;  2VQF K;  3K5O A;  4JD2 A;  3LPU A;  3N4P A;  1C0F A;  3F9M A;  2P9N B;  5BR9 A;  4CEF A;  5BRE A;  1SL0 A;  5EY4 A;  1JCF A;  1KAZ A;  3ITH A;  4FXD A;  1D5A A;  4O4G A;  1VSI A;  2HOE A;  2F96 A;  4CEQ A;  4CGH A;  1JLC A;  2VWK A;  4O0J A;  3SCX A;  1N36 K;  5BRH A;  3LP2 A;  5C12 A;  1IKW A;  4DV1 K;  3V9S A;  4E3S A;  1NOY A;  3T69 A;  4WFA L;  2HHU A;  4C8M A;  3EE9 A;  3OYN A;  3K59 A;  4F2S A;  4Z4E A;  3J8A A;  1KD1 O;  3VGM A;  4IFY A;  5GAD P;  4N47 A;  5JVG L;  1G99 A;  4FWN A;  4QS8 A;  1YJW N;  3DLR A;  4RW7 A;  4M3W A;  4B9N A;  4KFB A;  2KW4 A;  3L3U A;  2B5J A;  4O44 A;  4Z4C A;  3FFK B;  4IJN A;  3VEW A;  4KB0 A;  4CGI A;  3KK7 A;  5E26 A;  3SUP A;  4EIA A;  3MK6 A;  2E6M A;  2BDP A;  1XQS C;  1ILY A;  4DLE A;  2Y1J A;  3AA3 A;  1BI4 B;  4B8C A;  1RDW X;  4AHC A;  5C15 A;  4JRP A;  2YV0 X;  4A59 A;  3UE5 A;  1SKW A;  3FZF A;  3M3Z A;  5AQL A;  4OKK A;  4YOV A;  4DFK A;  1N6Q A;  3PSF A;  1NJX A;  1VSJ A;  3O4Q A;  1U2V B;  3PX4 A;  3UKR A;  4FLW A;  3THY A;  3BF3 A;  5GAH P;  4O0I A;  4CFC A;  4N56 A;  3BZC A;  5FRN A;  3TPQ A;  1K8K A;  3PLA A;  1VSE A;  4JK9 A;  5KGW A;  1K8A O;  4FPA A;  4KTW A;  1BQN A;  1SKS A;  4LF4 K;  5J2M A;  1BUP A;  5M1P A;  5JLF A;  2UUC K;  3OBY A;  3EL2 A;  4OGC A;  3CCV N;  5AQJ A;  4CHQ A;  3WXK A;  3CQY A;  2E5L K;  4LSL A;  4BRG A;  3CJB A;  1Q9X A;  1WUA A;  5H1S Q;  3S3M A;  3DLB A;  5I42 A;  4CJQ A;  3EYZ A;  1IJJ A;  3E9L A;  3THW A;  4FYD A;  1IV0 A;  4ISE A;  3ZT1 A;  5JVH L;  4DSL A;  2FBT A;  3OYM A;  2O8C B;  3ZET B;  2GX9 A;  2YHY A;  3P39 A;  4O8K A;  3OYE A;  3M5R A;  4HTU A;  4BC5 A;  4BRC A;  2JGU A;  5AZI B;  2OZM A;  1TUY A;  4DUZ K;  4CJR A;  4DQR A;  4C1N K;  4XH5 A;  1EP4 A;  1EWR A;  1VK0 A;  1JLE A;  4J2B A;  3PX6 A;  1SKR A;  4BDY A;  1QHT A;  3K2P A;  1N8R O;  3V9W A;  2HHH K;  1C1A A;  4H0O A;  3ZSX A;  4OLB A;  4FLX A;  2G8W A;  2QWM A;  1VQ9 N;  2P9N A;  4DKW A;  4EP5 A;  3P5J A;  4DV2 K;  2JLE A;  1HQU A;  4GKK K;  3R8E A;  4BWJ A;  4M3U A;  3OS2 A;  2P9P B;  1L3S A;  4RW6 A;  5SZT A;  1KXP A;  5EVZ A;  5BN8 A;  1OH6 A;  4B8A B;  4AIL C;  3CC4 N;  4CJL A;  2VCP A;  1OKJ A;  1QZ6 A;  1TAQ A;  2PZS A;  4DTM A;  4UY8 O;  1QHA A;  1HKG A;  1T3V A;  4BRF A;  1BO5 O;  2HST A;  2OPS A;  3QML A;  3FFI A;  3SI6 A;  1TKZ A;  4Z4F A;  5AQN A;  4LH5 A;  5CY4 A;  1EX4 A;  1QSL A;  4Z0U A;  4FPB A;  5KTQ A;  2X74 A;  3NGZ A;  3I33 A;  3HST B;  3CC2 N;  4DF8 A;  4O5F A;  4F3O A;  3ASM A;  3VF4 A;  4NYF A;  3SAH A;  3L2R A;  4CZJ A;  3CCE N;  4CK1 A;  3R6M A;  4BRQ A;  2UXC K;  4IG0 A;  1T44 A;  1C0G A;  1NM1 A;  3AVL A;  1BI4 A;  3AO2 A;  3BF1 A;  5AQH A;  4Z4H A;  4QOZ B;  3UKU B;  3PIO L;  1VQO N;  4GV6 A;  3VES A;  1WSI A;  2Q36 A;  5AZJ B;  4BVP A;  4CF9 A;  2HVH A;  3LWM A;  2PFU A;  4GVE A;  1NGB A;  5ADX H;  2HBM A;  1U2V A;  4LY7 A;  4JEP A;  3IDH A;  1GOB A;  3NDK A;  4DFP A;  4FSV A;  2HHS A;  4LSN A;  3VET A;  2NUB A;  3J7Y P;  5EXW A;  1L5U A;  3C7N B;  4CJF A;  4FM1 A;  3S3O A;  1EET A;  2YJE A;  2FC0 A;  3QIP A;  2D1K A;  3QES A;  3K0S A;  4CK3 A;  3ZT4 A;  1WSJ A;  1OH8 A;  1Q7Y O;  2XHB A;  1OVY A;  4MDA A;  3DXM B;  1ZBU A;  4B3R K;  1KFD A;  4DS5 A;  1NBW A;  4B3S K;  4V19 S;  4WE1 A;  4BR7 A;  2ZJQ L;  1GLF O;  2O8C A;  3ZET A;  2AJQ A;  4KI6 A;  1RDC A;  4AH9 A;  4O8U A;  3IS9 A;  1X9S A;  2Z1G A;  4B3T K;  3BGR A;  1QVG M;  5D3G A;  4FWS A;  3G4S N;  5AZI A;  4CF2 A;  4ZTF A;  1TKT A;  5M1F A;  2E6L A;  3CIP A;  2RPI A;  3I0S A;  1YHQ N;  4DR2 K;  4BDP A;  4IOA L;  2PAV A;  3O9U A;  3I55 N;  4WYB A;  4W5Q A;  4CJE A;  4HWI A;  1B9F A;  5C10 A;  1RIL A;  3F73 A;  2GV9 A;  1VQK N;  3VTI A;  4GMJ B;  4O55 A;  3V1O A;  2IDO A;  3U9Z A;  2P9P A;  3CM5 A;  2YNG A;  3SLC A;  3BEX A;  2HF4 A;  5CZ1 A;  3DRP A;  2QWN A;  5C0Y A;  3NMU A;  2WTU A;  4YNQ A;  3CMA N;  5CYM A;  3QEW A;  4H5V A;  3ZSY A;  4RWT A;  2RKI A;  3BUZ B;  1JL1 A;  3O1B A;  5BPM A;  1U48 A;  4K42 A;  2NRZ A;  4I9L A;  2D0C A;  4BRN A;  2XY8 A;  1P90 A;  4DV0 K;  1BL3 A;  5HOO A;  3KLH A;  2HHW A;  1JLF A;  5I9E B;  4AHS A;  4FWQ A;  3LAK A;  1ZBS A;  2JWL A;  3A2F A;  3I56 N;  1YJN N;  5TKY A;  1QS4 A;  4CEZ A;  4LF5 K;  3OYA A;  3HOT A;  5AQV A;  1XNR K;  4CIF A;  4NCG A;  4LC9 B;  4BVO A;  1RT5 A;  3ENH A;  5ELZ A;  4QAG A;  3AVC A;  4YOY A;  3UKU A;  3EKU A;  4PY5 A;  1RBV A;  3DLL L;  4BQZ A;  1TKD A;  1ZBL A;  3CFO A;  3O9R A;  1FXX A;  5M1O A;  5AZJ A;  4K0K K;  1BOT O;  1VRU A;  4JI5 K;  4FJK A;  4ISF A;  3CCJ N;  3KWG A;  3NH0 A;  5JS2 A;  2E2P A;  3CCL N;  3MWP A;  4CJV A;  2FSJ A;  3A5L C;  1D4X A;  4E7K A;  5CR4 A;  4YOX A;  3KWI A;  3KK3 A;  3RMD A;  2ZJP L;  4BE1 A;  3LDL A;  3OA9 A;  3C7N A;  1VHX A;  2ITM A;  3W3D A;  4HCB A;  5E41 A;  2A41 A;  4CJ7 A;  4BR9 A;  4CEA A;  4DV6 K;  2HB5 A;  1LCU A;  3O4W A;  5AFU A;  1C0U A;  4F9O A;  3O9Q A;  3NH1 A;  1FJG K;  2YHX A;  4DTU A;  4ISG A;  3ZSZ A;  5HRP A;  2IVO A;  4KHN A;  2QM1 A;  4IKF A;  3DXM A;  2G8I A;  3SV4 A;  3RMA A;  4PL8 A;  3ZT2 A;  1TK0 A;  1DT9 A;  3P31 A;  1MA9 B;  2B4J A;  4BRP A;  3VEY A;  1J9A A;  4N76 A;  2QK9 A;  1RT1 A;  4EP4 A;  1VSK A;  4A61 A;  3P83 D;  3DAW A;  3MMV A;  1LW2 A;  3IMX A;  2DFE A;  2FLO A;  3MX5 A;  4RW8 A;  2E2Q A;  4PKI A;  4H0T B;  4FJG A;  3IKM A;  4XEI A;  1DEJ A;  2O4I A;  2D4W A;  4JKG A;  1RBR A;  1RBT A;  1SL1 A;  1YVN A;  3C0B A;  3TAF A;  4YDU A;  2BTF A;  1XHZ A;  3VGK A;  3MEG A;  3R9P A;  3A5M C;  2ZD1 A;  1ATS A;  3ATV A;  5BPL A;  5GIN A;  1M90 O;  5KI6 A;  1X9J A;  3DRR A;  4HUG A;  2QWR A;  4JI4 K;  3E01 A;  3RR7 A;  3WXJ A;  2XY7 A;  4BR0 A;  1TK8 A;  3ZYY X;  1LAV A;  1VQL N;  1OH5 A;  3V1Q A;  1U4B A;  3ZSR A;  1KVC A;  2QEX N;  1WN7 A;  4BR4 A;  1HJR A;  4FLZ A;  2YCH A;  4J8F A;  2IC3 A;  3EN9 A;  4ZHR A;  3OS0 A;  3FLC O;  1RBU A;  1EXQ A;  4IDK A;  4GKJ K;  3GL1 A;  3TSP A;  2ATQ A;  3LZJ A;  3A5N C;  5AQK A;  4MFB A;  4CZH A;  4E1M A;  3QNN A;  1N32 K;  1Z05 A;  4M3T A;  2GEL A;  3NE6 A;  4BRD A;  1E4G T;  1SV5 A;  4OX9 K;  4I2P A;  3TAQ A;  2HF3 A;  4B9M A;  2DFF A;  4QS9 A;  3VQP A;  3L2U A;  4KAZ A;  2OZS A;  1HLU A;  4IJA A;  3ZEU B;  4HUF A;  3CFP A;  1WSE A;  1BCO A;  3J81 O;  1RBS A;  1REV A;  4DU1 A;  2ZM6 K;  1ASU A;  3CQX A;  1KAX A;  2VGN A;  4CEO A;  3VA0 A;  2I7N A;  1KQS M;  3VF2 A;  3JSM A;  4JI3 K;  3O3G A;  3ID8 A;  3UB5 A;  2A1S A;  3LDQ A;  2QWL A;  1S1U A;  3QB0 A;  1HUX A;  1T6D A;  4BRA A;  3CM6 A;  1KC8 O;  5HRS A;  4DQ8 A;  3S9H A;  4DR6 K;  4YY3 K;  4CZI A;  3K57 A;  4H8K A;  1DGK N;  4M63 C;  3AVH A;  3HPO A;  3V9X A;  3GDQ A;  4WQ4 C;  3P4I A;  2Z1H A;  5DM7 L;  2FXU A;  2YKM A;  4DTP A;  4BC2 A;  4RG8 A;  1Z25 A;  4X62 K;  1FW6 A;  2ZE2 A;  4FL9 A;  2JWK A;  3DOK A;  3N4Q A;  4WCE L;  4B1Y B;  2XO7 A;  3CJ9 A;  4KRE A;  2Y1I A;  3VQ5 A;  3CJ7 A;  1NGI A;  4DUY K;  3WXI A;  1RTI A;  3ULE B;  1R0A A;  2NRH A;  1DLO A;  3M1F A;  3VEN A;  3V9U A;  1BA0 A;  3TAM A;  5CZ2 A;  3NF9 A;  3KKS A;  5AQU A;  3M8S A;  1NGD A;  3T1Y K;  4NXM K;  1XNQ K;  4E19 A;  4B1W B;  2QW9 A;  3O80 A;  4DR5 K;  3OYD A;  3MXI A;  4JKH A;  5FPD A;  3MX2 A;  3LP3 A;  1NU0 A;  1NMN A;  4C1N I;  4KHW A;  4E89 A;  2O8D B;  4JK7 A;  4DR3 K;  3K5M A;  3SBG A;  3OYG A;  4MDB A;  4AHU A;  5GIP A;  4HTL A;  5AQW A;  1YIT N;  3VN5 A;  3K5N A;  4DFJ A;  4BG9 A;  1ZBI A;  3SQ1 A;  1QVF M;  3SJJ A;  1NG9 A;  3ZLJ A;  4FK4 A;  3K9J A;  1B9D A;  1EKE A;  2YJF A;  3MWT A;  3AVG A;  2P9L B;  4M42 A;  2NRR A;  3JXU A;  5A2Q O;  1BIZ A;  3HI0 A;  1ZXO A;  4B08 A;  1JLA A;  1D8Y A;  4FWL A;  3QIO A;  3R1X A;  4K43 A;  4KBO A;  3C6H A;  2RF2 A;  1BA1 A;  1RT4 A;  3O5B A;  3ZEU A;  3OJU A;  1C1C A;  2GWJ A;  3DMJ A;  4BWM A;  1E3M A;  4ICL A;  5AQX A;  4AM7 A;  4GV3 A;  2P9U B;  4K8Z A;  3QET A;  5LL6 Z;  2OTL N;  4IOX A;  3P1G A;  4H5N A;  3SPY A;  4BAC A;  3K9K A;  5SWM A;  1DTQ A;  4G9Z A;  3M8P A;  4IEE A;  1CZ9 A;  4WQ4 A;  2WUS A;  2DTU A;  2EWS A;  2Z1J A;  4CJP A;  4Y0W A;  1YJ9 N;  3HL8 A;  4FWM A;  1TL1 A;  4FJ9 A;  3AVN A;  1L3U A;  2BE2 A;  4BR2 A;  4CF0 A;  1TL3 A;  3SNN A;  3QER A;  4K25 A;  3OYL A;  4F4K A;  3O6W A;  3L4I A;  2O8B B;  3T3F A;  1W0H A;  3CPW M;  4DS4 A;  3MEC A;  2QWO A;  3W0L A;  4FJH A;  4H4M A;  4M41 A;  1NOZ A;  3J7Z O;  2BUP A;  1B92 A;  4M3R A;  2X6S A;  3WEE B;  4A5A A;  3G71 N;  3SZ2 A;  2HVI A;  4I2Q A;  1VQM N;  2QI2 A;  3UIQ A;  4CZM A;  3ULE A;  5KQ8 A;  1RT6 A;  3U4L A;  4WFB L;  4CJ4 A;  1XMQ K;  4CZE A;  4CIG A;  3T19 A;  1FKO A;  3B8A X;  3AA4 A;  3HVT A;  2VGM A;  4CVN E;  4KB1 A;  4O5B A;  2XY6 A;  3NHG A;  3QFP A;  4E7L A;  4IDH A;  3LDO A;  2E2O A;  3H08 A;  4X66 K;  2VWB A;  1NJW A;  4KRF A;  4LH4 A;  4CED A;  1P8Z A;  2F4V K;  5JIC A;  1KFS A;  1IBL K;  2O8D A;  1KRP A;  4GW6 A;  4KHQ A;  1VSM A;  4B9L A;  5MLC Q;  4IEI A;  1J54 A;  3CJA A;  3LDP A;  4OVL A;  1S9E A;  5HL7 L;  3NAE A;  4HUE A;  1RDU A;  4BGB A;  2D0O A;  3V1R A;  1NWK A;  2FBY A;  5J2P A;  3WNG A;  3CG7 A;  1NJY A;  4EZ6 A;  4GY2 B;  1QSY A;  3EY1 A;  3QBX A;  2P9L A;  4L8R B;  3ZT3 A;  3G0Z A;  4HVJ A;  4EAH D;  3OY9 A;  1Q81 O;  1CZA N;  2VG6 A;  1N34 K;  3TAG A;  3OYI A;  4BE2 A;  3AO4 A;  1KAY A;  3U6F A;  4BDZ A;  1QQC A;  4CZF A;  3ISN C;  3KLF A;  1I39 A;  4G1Q A;  1IKV A;  4ELU A;  1HQE A;  1OH7 A;  4B9Q A;  3O9S A;  3MEE A;  3LAM A;  2P9U A;  1WNS A;  2P5O A;  1S1T A;  1ATN A;  4BGA A;  2PBD A;  2VWJ A;  1IO2 A;  4OGE A;  2UYT A;  2WBN A;  2UUB K;  1ASV A;  4UQG A;  4F8R A;  3U9D A;  3H3O B;  1MWK A;  2HHT A;  1A5X A;  1KTQ A;  3NF7 A;  4DSI A;  3MN7 A;  1IH7 A;  1BIS A;  4PKG A;  4IFV A;  4W5R A; 
#chains in the Genus database with same CATH homology
 3JS6 A;  3HOS A;  3KWG A;  3EZW A;  5BRF A;  4H0P A;  1YI2 N;  2E2P A;  3CCL N;  4QS7 A;  4WFN L;  4FWP A;  3CC7 N;  3MWP A;  3O08 A;  1SZ2 A;  3CF5 L;  3U8X A;  4K41 A;  4H5T A;  2FSJ A;  3A5L C;  4JKB A;  4EHT A;  1D4X A;  2GTD A;  2CGL A;  5CR4 A;  3GOI A;  4XH4 A;  4YOX A;  1E4F T;  3KWI A;  1HJO A;  5M1K A;  2ZJP L;  3LDL A;  3OA9 A;  3C7N A;  3TSQ A;  2V7Z A;  4YOW A;  2ITM A;  4A62 A;  3W3D A;  1RGI A;  4PKH A;  2A41 A;  2WFB A;  2NRV A;  2KLA A;  3SMP A;  4CJ7 A;  4BR9 A;  2HBL A;  5KPT A;  1LCU A;  2BH1 A;  3O4W A;  3D7E O;  5F1X A;  3CET A;  1HX1 A;  4L3Q A;  2HMP A;  5AFU A;  2WC9 A;  3O9Q A;  4F9O A;  2V51 B;  1GLC G;  4M7X A;  3CCU N;  4B1X B;  3WEE A;  2YHX A;  3UKR B;  4ISG A;  1HPM A;  2IVO A;  4KH4 A;  2E8A A;  2QM1 A;  4PL7 A;  3CD6 N;  3DXM A;  5GIO A;  3E66 A;  3NVM A;  4KH5 A;  5AQT A;  3FR0 A;  4PL8 A;  3C65 A;  1DT9 A;  3P31 A;  4KH6 A;  1MA9 B;  1K8K B;  4EFH A;  1WOQ A;  2P9K A;  3VEX A;  4BRP A;  1R59 O;  3VEY A;  4B1Z A;  2RHK A;  1W2B M;  4IZ9 A;  2Q97 A;  3KZB A;  1JJ2 M;  4YOU A;  4A61 A;  4JAX A;  1YF5 L;  3TTF A;  3DAW A;  3MMV A;  3R3L A;  4MO4 A;  1H1V A;  5AR0 A;  4ILH A;  3IMX A;  2A6A A;  3IFR A;  1NGF A;  2FLO A;  3MN9 A;  3MX5 A;  5LJW A;  2E2Q A;  4A5B A;  4PKI A;  4BRK A;  3F5T A;  3MN6 A;  4H0T B;  4Z94 A;  4R79 A;  3IKM A;  5TKW A;  4XEI A;  1DEJ A;  4FOI A;  3SMS A;  3ZX3 A;  2D4W A;  3OW2 M;  5BRD A;  3S41 A;  4JKG A;  4JKG B;  4E1J A;  2HBK A;  5F2R A;  1GLD G;  3M6G A;  1MDU B;  1YVN A;  3C0B A;  5DM6 L;  4YDU A;  2BTF A;  2HBJ A;  3DWL A;  4CZG A;  2VYP A;  3HRG A;  4IO8 A;  3VGK A;  4U7B A;  1VQN N;  1TYQ A;  3R9P A;  3A5M C;  5AQI A;  4BG8 A;  1Q86 O;  1MWM A;  1ATS A;  3ATV A;  5BPL A;  3SAF A;  5GIN A;  1M90 O;  1X9J A;  2QWR A;  1VAZ A;  1SQK A;  3WXJ A;  4PHT X;  5FPE A;  3AGR A;  3D2F B;  3ATU A;  4JNE A;  4YDU C;  4YOR A;  4AM6 A;  4BR0 A;  4CI6 A;  4ILJ A;  2I7P A;  2OAN A;  3H1V X;  4OPA A;  3ZYY X;  4IO9 L;  1VQL N;  4GV9 A;  5ADX A;  3D2E B;  4BRL A;  1VQ8 N;  4RCH A;  4JD2 A;  2QEX N;  3N4P A;  4BRO A;  1C0F A;  3F9M A;  4BR4 A;  1K9M O;  2P9N B;  2YCH A;  3Q7B A;  4FO0 A;  4J8F A;  4DCH A;  5BR9 A;  1NJI O;  3EN9 A;  3SJH A;  5BRE A;  2F9T A;  3G25 A;  5EY4 A;  4WF9 L;  1JCF A;  1KAZ A;  3FLC O;  1ESV A;  2E20 A;  2V7Y A;  5FPM A;  3GL1 A;  3TSP A;  2HOE A;  3KVG A;  3L4Q A;  1ZC6 A;  3ENB A;  2GEM A;  4CBW A;  3F2K A;  2CGJ A;  3A5N C;  4XH1 A;  5BRH A;  3WUH A;  5AQK A;  5C12 A;  4CZH A;  4B1U B;  4BRI A;  5F0X A;  1XUP O;  4JK8 A;  1Z05 A;  3T69 A;  2GEL A;  4WFA L;  2A42 A;  4BRD A;  1E4G T;  3EE9 A;  3VEZ A;  5FPN A;  2HF3 A;  2RE2 A;  3J8A A;  1KD1 O;  3VGM A;  1JCE A;  5AQF A;  2IVP A;  2Q0U A;  4QS9 A;  5GAD P;  5JVG L;  5EOY A;  1G99 A;  4FWN A;  4QS8 A;  1YJW N;  3P38 A;  1HLU A;  4IJA A;  3H45 C;  3ZEU B;  4H03 B;  3DXK A;  1NGE A;  1YUW A;  3GBT A;  2GWK A;  4WQ5 A;  2KHO A;  3FFK B;  4IJN A;  3VEW A;  3KK7 A;  3I8B A;  2P9I B;  5E26 A;  2ASM A;  2VGN A;  1KAX A;  3CQX A;  3MK6 A;  3TSU A;  4EIA A;  1YIJ N;  2I7N A;  1KQS M;  1XQS C;  3VF2 A;  3D6R A;  4A2B A;  1ILY A;  4NLB A;  1GLJ O;  2J4R A;  3ID8 A;  3WXL A;  2ZJR L;  3UB5 A;  1DKG D;  1QQM A;  2NZT A;  3BP8 A;  4WQ5 C;  1V4S A;  1RDW X;  3LDQ A;  4JHD B;  2QWL A;  5C15 A;  4CD1 A;  1GLA G;  1YXQ A;  3QB0 A;  3QDK A;  2GUP A;  4JKE A;  1HUX A;  1T6D A;  2ZGZ A;  3H1Q A;  3UE5 A;  2ASO A;  4A59 A;  4BRA A;  4DQ8 A;  1KC8 O;  3FZF A;  3HM8 A;  3M3Z A;  5AQL A;  4YOV A;  2A40 A;  1T6C A;  1HKB A;  5LY3 A;  4CZI A;  1DGK N;  4M63 C;  4I6M B;  1U2V B;  3MDQ A;  3UKR A;  3CME N;  1RFQ A;  3GDQ A;  3BF3 A;  4WQ4 C;  2D0P A;  5GAH P;  3P4I A;  1GLL O;  5DM7 L;  2FXU A;  4A57 A;  5JLH A;  1SS6 A;  3G6E N;  4FWK A;  1YAG A;  4BC2 A;  5AQM A;  2FF6 A;  3TPQ A;  1K8K A;  3SAG A;  5AQO A;  1VQP N;  3PLA A;  4JK9 A;  1K8A O;  4FPA A;  4RTF D;  5KPR A;  1BUP A;  5M1P A;  5JLF A;  3OBY A;  4FL9 A;  3EL2 A;  2JWK A;  3CCV N;  5AQJ A;  3WXK A;  3CQY A;  3FE1 A;  3N4Q A;  4WCE L;  4B1Y B;  3CJ9 A;  4BRG A;  3CJB A;  1O13 A;  4BC3 A;  1BG3 A;  3CJ7 A;  1WUA A;  1NGI A;  3LL3 A;  4JKD A;  1QQN A;  5H1S Q;  5GAG P;  3FZM A;  3WXI A;  1IJJ A;  3E9L A;  2NRH A;  2QXL A;  3L0Q A;  3MN5 A;  3ULE B;  3M1F A;  4ISE A;  3VEN A;  4C23 A;  5JVH L;  1BA0 A;  5GAE P;  3GG4 A;  3L6Q A;  3ZET B;  2GX9 A;  2YHY A;  3OBW A;  1HKC A;  2AA4 A;  3E9O A;  1NGD A;  3M5R A;  3P39 A;  2IIR A;  4JKF A;  4O8K A;  5AQU A;  4BC5 A;  4B1W B;  4BRC A;  3ZX0 A;  4BRH A;  3ID6 A;  3CJ1 A;  2QW9 A;  5AZI B;  1EO1 A;  1TUY A;  3O80 A;  2DPN A;  1S72 N;  2P9S B;  4JKH A;  5FPD A;  4C1N K;  4XH5 A;  3D2F A;  3MX2 A;  4BRM A;  4C1N I;  2ZGY A;  2FF3 B;  3O8M A;  4JK7 A;  3D2E A;  3SBG A;  3DJC A;  3VER A;  2IVN A;  1N8R O;  1NLV A;  4H0O A;  4BY9 C;  1X3M A;  4MDB A;  2QWM A;  3IUC A;  5GIP A;  4HTL A;  2P9N A;  1Q82 O;  1VQ9 N;  1J6Z A;  2ZF5 O;  5AQW A;  4DKW A;  3H46 O;  1YIT N;  4NLC A;  3R8E A;  4BG9 A;  2P9P B;  1QVF M;  2QWQ A;  1KXP A;  3K9J A;  1VQ6 N;  2QTD A;  1TUU A;  5EVZ A;  5BN8 A;  3H6E A;  2FSK A;  3ZX2 A;  5AFU H;  3A5O C;  2OTJ N;  2NRX A;  3CC4 N;  3TTC A;  2VCP A;  4MO5 A;  2YJF A;  3MWT A;  1OKJ A;  1QZ6 A;  3VTH A;  2P9L B;  4UY8 O;  1QHA A;  1HKG A;  1QQO A;  1T3V A;  2NRR A;  3JXU A;  4BRF A;  4IWV A;  5KQD A;  1BO5 O;  3RSE B;  4YOT A;  1VQ7 N;  2HST A;  3KHY A;  4MLH A;  3QML A;  4B1V A;  3HI0 A;  4U67 L;  1ZXO A;  5AQN A;  2AP1 A;  3FGU A;  4FWL A;  4JKC A;  3WQT A;  3R1X A;  4K43 A;  4KBO A;  3C6H A;  2E1Z A;  3EO3 A;  1K73 O;  1BA1 A;  3O5B A;  4FPB A;  3ZEU A;  2GWJ A;  3I33 A;  1X3N A;  4CD3 A;  3CC2 N;  4O5F A;  2YX6 A;  3AAP A;  3Q7C A;  3AGK A;  5AQG A;  5AQX A;  3VF4 A;  4FWR A;  4AM7 A;  3SAH A;  4CZJ A;  3CCE N;  4GV3 A;  2P9U B;  2P9I A;  2CH6 A;  2OTL N;  3R6M A;  1JCG A;  4BR5 A;  4IOX A;  4BRQ A;  4H5N A;  1T44 A;  1C0G A;  3E9P A;  4OPH A;  3AAR A;  1NM1 A;  3K9K A;  1M1K O;  4DHY A;  3O1W A;  3BF1 A;  3QBW A;  2E2N A;  5AQH A;  3NVK A;  2Q1N A;  4JHD A;  3CCS N;  4G9Z A;  3UKU B;  3PIO L;  1VQO N;  4GV6 A;  4IEE A;  2NRW A;  3VES A;  4JKA A;  4BC4 A;  4WQ4 A;  1NGJ A;  2QWP A;  2WUS A;  3QFU A;  2Q36 A;  5AZJ B;  4BVP A;  3EKS A;  3HTV A;  4CZK A;  2EWS A;  4CZL A;  2PFU A;  4GVE A;  4Y0W A;  1YJ9 N;  4FWM A;  1NGH A;  3CJC A;  3CPE A;  3VOV A;  1NGB A;  4I6M A;  5ADX H;  4H5W A;  2HBM A;  5C2D A;  1U2V A;  3CHW A;  5EX5 A;  4JEP A;  3IDH A;  4BR2 A;  4FWO A;  5BPN A;  4CBU A;  4FSV A;  3VET A;  5AQS A;  4K25 A;  3O6W A;  3CCM N;  1VQ5 N;  5E84 A;  2Q0R A;  3L4I A;  5EXW A;  1BDG A;  3C7N B;  3HSC A;  4DB3 A;  2Q31 A;  3CPW M;  1SAZ A;  3AY9 A;  2QWO A;  3W0L A;  4JN4 A;  3H3N O;  2YJE A;  3QIC A;  5CHI A;  2D1K A;  3TU5 A;  1EQY A;  5CE3 A;  2FSN A;  3GE1 A;  2BUP A;  4EHU A;  3J7Z O;  3EE8 A;  3WEE B;  3FZK A;  4ILG B;  4A5A A;  3G71 N;  2YI1 A;  1NGC A;  2YHW A;  4IOC L;  1Q7Y O;  1OVY A;  4MDA A;  1VQM N;  2QI2 A;  1Q18 A;  3DXM B;  1BWF O;  4CZM A;  1XC3 A;  1NBW A;  1QZ5 A;  3ULE A;  5AQP A;  5LJV A;  2E1Y A;  4BR7 A;  5KQ8 A;  2ZJQ L;  3WQU A;  1Z6R A;  3U4L A;  4WFB L;  1GLF O;  2P9K B;  2Q2R A;  3ZET A;  4CZE A;  2NNW A;  3B8A X;  3A0I X;  4O8U A;  1W97 L;  2VGM A;  3WT0 A;  1QVG M;  3O9T A;  3OHR A;  3QFP A;  4FWS A;  3G4S N;  1S22 A;  2CGK A;  4IDH A;  5AZI A;  3LDO A;  2E2O A;  3SK3 A;  3VEV A;  2VWB A;  3CCR N;  5M1F A;  3CIP A;  1P8Z A;  2P9S A;  3FZL A;  5BN9 A;  1YHQ N;  1GLE G;  1GLB G;  4IOA L;  2PAV A;  3O9U A;  5JIC A;  3I55 N;  1ATR A;  2E88 A;  3CI5 A;  4WYB A;  4BRE A;  5MLC Q;  4HWI A;  4IXC A;  4IEI A;  5C10 A;  1S3X A;  3CJA A;  3LDP A;  4IFE A;  3TTD A;  5HL7 L;  1VQK N;  1TYQ B;  5AQZ A;  3VTI A;  1RDU A;  2P9P A;  3AAQ A;  2D0O A;  3SLC A;  3U9Z A;  1NWK A;  5AQY A;  3WXM B;  4BGB A;  3BEX A;  4FVU A;  2HF4 A;  3LDN A;  2QWN A;  3LM2 A;  3NMU A;  5C0Y A;  2W41 A;  5JMV A;  3CMA N;  4GY2 B;  1Y64 A;  4H5V A;  1NGA A;  4RWT A;  2F9W A;  3QBX A;  2V52 B;  4A2A A;  2P9L A;  4JD2 B;  3BUZ B;  4H0X B;  3O1B A;  5BPM A;  2NRT A;  4MLE A;  3C6A A;  4K42 A;  4AF1 A;  2NRZ A;  5M1Q A;  3RSE A;  3VEO A;  4EAH D;  3A8Y A;  1Q81 O;  1CZA N;  3VF6 A;  4BRN A;  3LM9 A;  4BQL A;  1NMD A;  3VMF B;  1P90 A;  2CH5 A;  3HBT A;  5M1N A;  5HOO A;  1KAY A;  3PIP L;  4GNI A;  1V4T A;  4CZF A;  5I9E B;  1NGG A;  4FWQ A;  4CBX A;  2KKZ A;  1ZBS A;  1U6Z A;  2A3Z A;  1BU6 O;  2JWL A;  4H0V B;  1VQ4 N;  4B9Q A;  3O9S A;  3I56 N;  1LOT B;  1YJN N;  5AQR A;  2P9U A;  5TKY A;  1ATN A;  2ZWH A;  4BGA A;  3E1Y A;  2PBD A;  4OO1 J;  1IG8 A;  3CCQ N;  3HOT A;  2W40 A;  2UYT A;  2ASP A;  4M7Y A;  2WBN A;  4H5R A;  5AQV A;  4NB4 A;  3MCP A;  3MCA B;  4LC9 B;  4BVO A;  3ENH A;  3U9D A;  5ELZ A;  3H3O B;  1MWK A;  2A5X A;  4H0Y B;  2NLX A;  4YOY A;  3UKU A;  3VPZ A;  3EKU A;  4NO7 A;  3DLL L;  4BQZ A;  3DXK B;  3T7Z A;  3O9R A;  5KPZ A;  2F7T A;  5M1O A;  2QA4 N;  2H3G X;  3MN7 A;  1BOT O;  5AZJ A;  4FOE A;  3FZH A;  5AQQ A;  5C2F A;  3VGL A;  5B8H A;  3CER A;  3HZ6 A;  4PKG A;  3RVC A;  3SBT A;  4ISF A;  3CXC M;  3CCJ N;  3ENO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...