3BF3A

Type iii pantothenate kinase from thermotoga maritima complexed with product phosphopantothenate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 77
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A02
1KAXA 3UKRB 4H5VA 4WQ5C 3VETA 2NZTA 2D1KA 4CZEA 5FPDA 4LC9B 3IDHA 2FF6A 4B1ZA 4BRCA 1Z6RA 3BUZB 3LM9A 4IO8A 2E2NA 4GY2B 5AQPA 2V7YA 3QMLA 1SQKA 1E4FT 5FPEA 4IJAA 3BF1A 3H46O 2P9SB 3IUCA 3MN9A 3L0QA 4NO7A 4PKGA 2QW9A 2F9WA 2A40A 1TUYA 4H5TA 3M3ZA 1Q18A 3L4IA 3QFUA 3WEEA 3VERA 2A3ZA 4PL8A 4H0TB 2Q97A 1GLAG 4NB4A 2P9NB 3VF2A 2P9PB 4CZJA 3SLCA 3CJCA 3LDOA 4FWRA 4J8FA 4EAHD 3VGMA 4AM7A 3FZHA 3CQYA 2FSKA 3AAQA 5AZIB 3ZEUA 1BOTO 2P9IA 3LL3A 3OHRA 1NGGA 4M63C 4GNIA 2GUPA 5E26A 4B1UB 1BO5O 2YCHA 2W41A 5AQLA 3SJHA 1ZXOA 2P9KB 3WQUA 2QM1A 3EKSA 4CZGA 1BU6O 1T44A 5EX5A 4B9QA 4K43A 4BR9A 1X3NA 4BRGA 1U2VB 4FPAA 4HWIA 3DXKA 5KPTA 2P9LB 3H1VX 3UB5A 2F9TA 4CJ7A 1QZ5A 3JXUA 4CD1A 2KHOA 5TKYA 4I6MA 4BR7A 2AP1A 3EKUA 3UKUA 1Z05A 4JHDB 1NM1A 2GEMA 3O5BA 3AAPA 1R59O 2QWNA 1NGAA 3BEXA 4BC4A 1YVNA 1ATSA 1YAGA 4CD3A 3ATUA 2D0OA 1U6ZA 4EHUA 3FZLA 3GE1A 4YDUA 4O8KA 3CJ1A 3W3DA 3C0BA 5EY4A 3VPZA 4BR0A 5BRFA 5AQSA 2E88A 5AQIA 4BGBA 4Y0WA 4BRMA 4PKHA 1TYQA 5AQOA 3MN5A 3A8YA 4BRHA 4FWMA 4IJNA 2W40A 4XH5A 3DWLA 3WXIA 5EXWA 3S41A 4BRFA 4EHTA 5BPNA 2GWJA 4FL9A 1J6ZA 4BRAA 3WXLA 2Q0RA 4B1YB 2CGKA 3LDLA 4JNEA 2IVPA 4IWVA 4CBWA 1NBWA 4RCHA 4QS8A 2OANA 3EO3A 4L3QA 3H1QA 2FLOA 2ZWHA 2QXLA 3VEXA 4RWTA 1H1VA 2YHYA 5CE3A 2QWPA 3H45C 5JLHA 1NWKA 3RSEA 3QDKA 3I33A 5AFUA 1XQSC 3QB0A 3VOVA 4BVPA 1NLVA 1QQNA 1TUUA 2Q31A 1HKCA 2V51B 5EVZA 3B8AX 3I8BA 4DQ8A 1P8ZA 3VEZA 3WEEB 2HF4A 2EWSA 4BR5A 3MN7A 1NGHA 1NGCA 3A5NC 3A5LC 1Y64A 2YJEA 4A61A 4MO4A 2E2OA 4FWOA 4BG9A 3KZBA 1OKJA 3MCPA 2V52B 2QWQA 5AFUH 2IVOA 4YDUC 2NLXA 3R8EA 5AQVA 2PBDA 4BRPA 4PKIA 4WYBA 3GG4A 3O1BA 3VEVA 4C23A 3ZEUB 5FPMA 2P9IB 3WQTA 3ENOA 1V4SA 3AARA 4EFHA 1JCFA 1QQMA 1EQYA 3O08A 4IXCA 4M7XA 3LDNA 1HX1A 3HTVA 3FR0A 1MWMA 1HPMA 3DXKB 3J8AA 4Z94A 3ENHA 1NMDA 5AR0A 3CJ9A 3ZETA 3UKUB 1X3MA 1HKGA 1SZ2A 3VGLA 2CGLA 4CZKA 1HJOA 1WOQA 2Q0UA 2QWMA 4JAXA 2CH5A 5JICA 3CIPA 4CZHA 1T6DA 2VYPA 3DXMA 4K41A 2QWOA 5BPMA 3A0IX 2FXUA 2YI1A 4FSVA 3BP8A 3H6EA 5F0XA 1XUPO 1D4XA 2GWKA 2IVNA 4BRNA 1ZBSA 4BRLA 5LJWA 5AQZA 1GLJO 2AA4A 4FWPA 4DB3A 3TU5A 2CGJA 1ZC6A 1GLLO 3HBTA 4MLEA 3QBWA 1KAZA 2NRHA 4H0VB 5AQKA 2ASMA 4BC3A 4CBUA 1TYQB 2FSJA 3VF4A 3ULEA 4BC5A 1HLUA 3QFPA 5AZJA 3G25A 3LDPA 2H3GX 1LOTB 2Q36A 4H0YB 1QZ6A 5F1XA 5AQUA 1QQOA 5AQFA 1NGIA 5AQJA 4BVOA 3LM2A 1KXPA 1CZAN 2GTDA 4BC2A 5ELZA 5I9EB 3ZX0A 4JD2A 2I7NA 4H0OA 5B8HA 3EL2A 3TPQA 1JCEA 1E4GT 3GL1A 3QBXA 4BROA 3O4WA 4FWNA 4BRDA 4CBXA 3D7EO 3VEWA 1YXQA 5JLFA 5KQ8A 4WQ4A 4PL7A 4H0PA 3KVGA 1GLEG 3EZWA 4ISGA 4A62A 4XH1A 4AM6A 1DEJA 5KQDA 3R9PA 2HOEA 5AQHA 1C0FA 4H03B 2HF3A 5AQQA 5AQWA 3ID8A 3H3OB 2A42A 3O1WA 3MMVA 3H3NO 3HSCA 4KBOA 4RTFD 1HUXA 3A5MC 3D2EA 4A2AA 1WUAA 3U8XA 4K42A 2E2PA 3A5OC 2ZGYA 4H5NA 2FF3B 1NGBA 4H0XB 2WUSA 1S22A 3ZX3A 5AQMA 2E20A 4FWSA 1NGFA 4FO0A 3HZ6A 1RDWX 2A6AA 1NGEA 2E1ZA 4MO5A 5BREA 2YHWA 2Q1NA 4BRQA 3FZMA 3ZETB 2ASOA 2P9UA 1BG3A 4BQLA 3CJAA 2J4RA 1GLDG 2A5XA 4IZ9A 5BRHA 1LCUA 3FZKA 3LDQA 4HTLA 3DAWA 3VEOA 1K8KA 3DXMB 1ATRA 3D2FA 4JN4A 4QS9A 3HM8A 4XH4A 3C7NA 3M6GA 2E8AA 3R6MA 3VEYA 1G99A 2BTFA 1DKGD 4WQ4C 5BPLA 3SMSA 3VESA 2A41A 1V4TA 2Q2RA 4BG8A 4BREA 5EOYA 3FE1A 2ZGZA 4FPBA 1BDGA 1KAYA 3M1FA 3ULEB 4I6MB 5AQYA 5JMVA 2I7PA 1RGIA 3MK6A 3GBTA 5AZJB 4H5RA 1ESVA 2CH6A 3IFRA 4FOIA 4B1WB 4EIAA 3JS6A 2FSNA 1GLBG 3MDQA 5BN9A 5KPRA 3CJBA 3U9DA 4CZIA 4JD2B 4ISFA 1XC3A 4E1JA 2IIRA 3UKRA 5AQTA 5AQNA 5AQXA 4F9OA 5KPZA 5BN8A 4BR4A 2HMPA 3AY9A 3F9MA 3VGKA 1GLCG 1MWKA 3EN9A 4BRKA 4BR2A 5BRDA 3W0LA 1JCGA 1BA1A 1YUWA 3UE5A 4MLHA 4FWKA 3BF3A 2P9SA 4DCHA 3VENA 3SMPA 3U4LA 4QS7A 2BUPA 3ZX2A 2YHXA 4O5FA 1HKBA 4DHYA 1C0GA 4A2BA 3WXKA 4FWQA 4BQZA 4XEIA 4CZMA 2D4WA 2P9NA 2QWRA 2P9PA 3D2EB 3GOIA 5E84A 3O6WA 3RSEB 3U9ZA 5FPNA 3QICA 2DPNA 3CQXA 3L6QA 3P4IA 4WQ5A 1DGKN 1S3XA 4B1VA 5AZIA 3CETA 2VCPA 1QHAA 2UYTA 2ASPA 3FGUA 3VF6A 4CZLA 2E2QA 3KHYA 2P9UB 2P9KA 3ATVA 1X9JA 4M7YA 1U2VA 3FLCO 2P9LA 1ATNA 5LY3A 1K8KB 3D2FB 1GLFO 1RFQA 4H5WA 3IMXA 3O8MA 3C7NB 5F2RA 3SK3A 4JHDA 1BUPA 2ZF5O 5LJVA 1NGDA 2YJFA 1IJJA 1T6CA 5BR9A 5ADXA 2VWBA 4CI6A 3MN6A 3O80A 3CHWA 1SAZA 3HI0A 5AQRA 4BRIA 1BWFO 3FZFA 3WUHA 3WXJA 2GELA 2PAVA 1MA9B 3CERA 3FFKB 3WT0A 4BGAA 3GDQA 3DJCA 4FOEA 1BA0A 1MDUB 3CJ7A 2V7ZA 5AQGA 4K25A 1IG8A 2E1YA 2D0PA 2QWLA 4ISEA 5ADXH 4B1XB 2ITMA 4CZFA 3CI5A 4FWLA 1NGJA
chains in the Genus database with same CATH superfamily
1MU2A 3SQ0A 1HNZK 3CCMN 2D0AA 4OVLA 3TTCA 4B1ZA 1VAZA 3OYNA 3H08A 4JS5A 1E4FT 3DLBA 5FPEA 3BF1A 2ZJQL 3MN9A 3HSTB 3M8SA 3AA3A 4PKGA 4HHTA 1LW2A 1RDAA 1TVRA 4O0IA 1ZBLA 1TAQA 3D6RA 3J7YP 1UOCA 3PO5A 3WEEA 3V9ZA 2HHUA 1RTIA 3NMUA 3TSPA 4BWJA 1RTDA 4H0TB 3DMJA 2Q97A 3VF2A 2P9NB 3OBWA 2P9PB 4MDBA 2XY6A 3SLCA 1TAUA 1VQNN 3CJCA 3QLHA 4FWRA 3NF9A 3ZSZA 4FM0A 4CEBA 3O9SA 2EX3A 2HNYA 1S1TA 3FZHA 3CQYA 1Q86O 2FBVA 1NGGA 1ILYA 4M63C 4BE1A 4K8ZA 5E26A 4DSJA 4CECA 1J9AA 4U7BA 2P9KB 3EKSA 4BR9A 4GVMA 1X3NA 4BRGA 2XO7A 3DXKA 3QEWA 3UB5A 2F9TA 4CGDA 3JXUA 1U45A 1EWQA 3VTIA 2B6AA 4O44A 2XHBA 1Z05A 4JHDB 1NM1A 4B9NA 3MWPA 4BC4A 4LY7A 4JKGB 5FLXO 1YVNA 4HTUA 2QKKA 4FK0A 4CD3A 4JK9A 4M3TA 3QETA 4FVMA 1S1VA 3T19A 4I7FA 4OLAA 3FZLA 3GE1A 2O8FA 3SUNA 4O8KA 3W3DA 3C0BA 5EY4A 4BDYA 5AQSA 4FJLA 3MAQA 5AQIA 3VQ9A 4BRMA 3C95A 5J1EA 1XNQK 4XH5A 3NH1A 2O8CA 3SUOA 3S41A 4EZ6A 4M3UA 2PFUA 4FL9A 4B3SK 2Q0RA 4RW9A 5KGWA 3LDLA 4IWVA 3KK3A 1NBWA 1ITGA 1U47A 2OANA 3CFOA 3VQBA 1ZBUA 2FLOA 5SWMA 5EU7A 3P83D 3U3GA 1VSJA 2HNDA 3LP1A 5JLHA 2HHHK 2Z1JA 3I33A 2NRRA 3AVFA 1NLVA 1N6QA 4O5BA 2V51B 3I8BA 4CF2A 4W5RA 1IKWA 3A5NC 1Y64A 2YJEA 2XY5A 4DF8A 1QVFM 2ZD1A 2QWQA 1C0TA 2PBDA 4BRPA 4DFMA 3GG4A 3O1BA 3C6UA 1RCHA 3IRXA 5FPMA 3WQTA 3ENOA 4WF9L 4M3XA 3AARA 1JCFA 1QQMA 4O0JA 4JI6K 4IXCA 3VQQA 1HR0K 4LSLA 1XNRK 3AO4A 3HTVA 1VQ6N 1HPMA 3V4IA 5D3GA 4IOAL 3ENHA 1RNHA 3VQCA 3QNOA 1NMDA 4Z4FA 5TKWA 3ZETA 1X9WA 1VQ7N 3UKUB 3G71N 1U4BA 3VGLA 3HP9A 2IOCA 3J81O 1HJOA 4HUEA 4MDAA 2QWMA 4JAXA 2CH5A 5JICA 3CIPA 4CZHA 4DUYK 3DXMA 4DLGA 4DV7K 5CR4A 3BP8A 5F0XA 1Q7YO 1D4XA 2IVNA 3V1RA 3DOKA 2OTLN 3K58A 4DV1K 2CGJA 3WNGA 3PY8A 3I55N 3AV9A 1VQ9N 1TYQB 2BE2A 4OKEA 3ZSVA 3VF4A 3QFPA 4V19S 5C24A 5AZJA 4Z4IA 4H0YB 1QQOA 3OYCA 3AVAA 1NGIA 3P31A 5AQJA 2O8EB 3ITHA 4BVOA 1CZAN 4A59A 4BC2A 4JV5K 4JK7A 2NNWA 2DY4A 1QHTA 3TAQA 1JCEA 3GL1A 2OZSA 3THYB 2I5JA 4BRDA 4FWNA 4O4GA 3VEWA 3PSIA 4PL7A 1VQLN 4OKJA 4B08A 4GV9A 5KQDA 3R9PA 3C65A 3IKMA 3SUPA 2HF3A 5AQWA 1RBTA 4CHOA 4YORA 3MMVA 3TTFA 3VN5A 3HSCA 3J7ZO 1S5JA 4NXMK 1FW6A 3A5MC 3D2EA 4A2AA 5I3UA 2OPPA 4KH4A 3TTDA 3A5OC 1E3MA 2O8DB 1F21A 3NVKA 5H1SQ 1RT3A 4EZ9A 4FVUA 3ZX3A 4FO0A 3V1OA 5BR8K 4YFUA 5C2DA 4CF0A 1JLEA 3THVA 2ASOA 4KTQA 3AVKA 4FXDA 3TAMA 4LFBK 4HTLA 3NH2A 3SYZA 3CCQN 1ATRA 3D2FA 4JN4A 4A5AA 3HVTA 3M6GA 4LSNA 2PYJA 3VEYA 1VK0A 4R5PA 5JVGL 3O9RA 3MCAB 2A41A 1RBUA 1B92A 3EYZA 3E9OA 4BREA 4PY5A 1EWRA 4LF8K 4YHHK 1KFSA 1BDGA 4I6MB 5CYMA 2I7PA 3GBTA 3NVMA 4BDZA 3AO5A 3CCRN 4H5RA 3S3MA 3IFRA 3RVCA 1QSSA 4E7JA 1GLBG 5KPRA 3ALYA 1NKCA 1BCMA 3THXB 4BY9C 3UKRA 4FJXA 5AQTA 5AQXA 5HRSA 3SAFA 4BR4A 3EN9A 4BRKA 4M3ZA 2P51A 2HHXA 3G4SN 4OKKA 3F2KA 2KLAA 3HP6A 5HOOA 3S3NA 1VQPN 1BI4A 4CHPA 4FWKA 1S9GA 1XWLA 3SMPA 4QS7A 3DRSA 4F8RA 1JXBA 2YHXA 3HPHA 3VQ7A 4JYAK 2Q3SA 1C0GA 3WXKA 4Z4CA 4FWQA 1SL0A 1K6YA 1QTMA 4FM1A 3SAGA 4XEIA 4KKOA 2IGIA 3PUFA 3QICA 4LF9K 3HYFA 5CYQA 3IG1A 3V81A 3CQXA 3L6QA 4F2RA 4KI6A 1JLAA 1K9MO 1W9HA 4EP4A 4KO0A 4NYNA 3VF6A 3ZYYX 2E2QA 1WBBA 2RHKA 4CIGA 3FLCO 2OCEA 3O9TA 1K8KB 3IMXA 3O8MA 4YOWA 5F2RA 3D0PA 3P39A 1ASVA 2GBZA 1W97L 1NGDA 3O4NA 2ZJRL 3Q7CA 4FLVA 4FW2A 5ADXA 3MN6A 4CF8A 1QSLA 1RTJA 3CHWA 1IKVA 3AA4A 3K0SA 1BIZA 1J53A 1NG9A 3FZFA 1ZYQA 1CLQA 1JLCA 1MA9B 4BGAA 1I94K 3DJCA 3LP0A 1B9FA 3LP3A 1T7PA 1ZBFA 1UA0A 5C25A 1TK0A 1NK7A 4ISEA 4B1XB 4X66K 4BE2A 2UU9K 4QAGA 1KAXA 4H5VA 4LD0A 3VETA 3HJFA 4FZYA 1Q82O 1TKDA 1WLJA 5FPDA 5FRNA 2NRVA 5SZTA 2KQ2A 1VSHA 4C1NK 1Z6RA 3LM9A 4IO8A 3EY1A 5AQPA 3OS0A 1HRHA 1SQKA 3L0QA 4NO7A 4DV2K 2IDOA 2A40A 3CD6N 1XHZA 2ZJPL 1TUYA 4H5TA 4UY8O 5JVHL 3QFUA 3L4IA 4DR6K 3VERA 4DSKA 1VSKA 1GLAG 4C8OA 1NNEA 2YNGA 1TL3A 4JI0K 2JWLA 2PY5A 4NXNK 3ZSXA 3VQ5A 2QTDA 1QE1A 3KTQA 3NCIA 4DV6K 2QXFA 2FSKA 3AAQA 2DTUA 3LL3A 1P90A 4CJ4A 3K5LA 2GUPA 4B1UB 3SJHA 2W41A 2YCHA 1FK9A 4CZGA 1BU6O 3E9PA 5EX5A 4K43A 5KPTA 4E7LA 3T3FA 4E3SA 4KHWA 3LPUA 4CD1A 5TKYA 4I6MA 3LPTA 2AP1A 1C1CA 4CJEA 1IKXA 4E1MA 1JL2A 1NGAA 3F5TA 1Z25A 4DTMA 1A5XA 3MEGA 4F2SA 3OYKA 3TAFA 1KVAA 4FJHA 3ATUA 1TKXA 2HHWA 1XI1A 2D0OA 1IO2A 2NRTA 1EKEA 3KLGA 4FJMA 3G0ZA 5LMUK 3AA2A 4I2QA 3VPZA 5BRFA 1HJRA 3CG7A 5FROA 4BGBA 1YJ9N 1LWCA 5AQOA 2ETJA 1SV5A 4FWMA 4IJNA 3WXIA 2G8KA 3VQ8A 4BRFA 5BPNA 4KH5A 4DR4K 4BRAA 1C1BA 3WXLA 4OPJA 4U67L 4B1YB 2CGKA 4DQRA 2IVPA 3K57A 4FCYA 4RW6A 3EO3A 3H1QA 2ZWHA 5C0YA 3VEXA 1BCOA 3I0RA 3AVCA 3H45C 3E66A 3P5JA 2D0CA 1R0AA 4GV6A 2VQEK 1XQSC 3VOVA 1TUUA 2Q31A 3AGRA 1VQON 1HKCA 4KHPK 2BGGA 2HF4A 4BR5A 2AJQA 4OPAA 2WBNA 2E2OA 1ASWA 1OKJA 3MCPA 2V52B 4IEEA 3CXCM 3HVRA 5AFUH 4DR3K 2IVOA 2Z1GA 4YDUC 2NLXA 5AQVA 3SJJA 4M45A 4KH6A 1TK8A 5J2QA 2KTQA 4DSFA 2RPIA 3VEVA 4FJKA 3ZEUB 2P9IB 4ELTA 3SV4A 2D5RA 2YKNA 1EQYA 3O08A 2G8IA 4M7XA 1HX1A 3FR0A 1MWMA 1ZBIA 1T8EA 1GOCA 4CJ5A 4NCBA 3S9HA 1HKGA 3OTOK 5J2NA 1SZ2A 2RN2A 3VQ6A 2CGLA 3S3OA 1VQKN 2Q0UA 4XIUA 1VSDA 4K41A 4CK3A 5BPMA 3KKRA 2FXUA 4FSVA 1NKEA 3K5MA 3AVNA 4KRFA 3ZSWA 1XUPO 1SL2A 4I9LA 4BRLA 1SKSA 3TR8A 5AQZA 4E19A 1A5WA 4CVNE 4ZTJA 4DB3A 1ZC6A 1LV5A 5GAGP 1C0UA 2NRHA 1X9SA 4H0VB 1JLGA 4BC3A 4A57A 3OYAA 4F4KA 4FLYA 3ULEA 4BC5A 2HHQA 1S1UA 2WTUA 2Q36A 1QZ6A 1L3SA 1C6VA 1RT5A 4G1QA 1L3UA 2A1RA 1KLMA 2GTDA 4OGCA 5ELZA 4CERA 3AVGA 3K9JA 3ZT0A 1G15A 3ZX0A 4JD2A 2HHVA 2I7NA 3OYDA 2G8VA 1RT1A 2UUBK 4CJLA 3TPQA 4BROA 3K5OA 3G10A 2F4VK 4DV3K 4JI8K 4CBXA 1GOBA 1YXQA 5JLFA 1GLEG 4H4MA 3EZWA 4WCEL 3ZSOA 3PX6A 4DUZK 4DTJA 2D0BA 2UXDK 4NLCA 1C0FA 5AQQA 3SUQA 2A42A 3O1WA 3DLHA 4JKFA 3H3NO 4JI4K 2YX6A 1EX4A 2HBLA 2FC0A 4DSLA 3JSMA 3SBGA 4OPHA 4B8AB 2ZGYA 4H5NA 2FF3B 4DR5K 2P1JA 2QKBA 3AVJA 2HB5A 1BL3A 4CJFA 5KRSA 4FLZA 1HNIA 3V9SA 4N41A 3VMFB 4FWSA 1NGFA 3HZ6A 2XRIA 1RDWX 2A6AA 2E1ZA 4MO5A 4DR7K 5BREA 2YHWA 3ENBA 3FZMA 4AHCA 3L2QA 3THWA 2P9UA 2J4RA 1GLDG 2A5XA 3KK1A 4B9LA 3HPOA 4IZ9A 5BRHA 3FZKA 3TABA 3VEOA 4IFYA 3HM8A 4HCCA 3C7NA 5CY4A 4M3YA 1G99A 3L4QA 2RF2A 4FLTA 2O8BB 5BPLA 1TK5A 1KLNA 3WNFA 3VESA 1Q8IA 1V4TA 4KREA 1D9DA 3L3UA 4OJRA 3ZSQA 4CJWA 3FE1A 2ZGZA 3OJSA 4X65K 1WSIA 5C42A 3M1FA 4E7HA 1REVA 1HMVA 1OH7A 3CPEA 5C12A 1C1AA 2UUAK 4EIAA 1O13A 3JS6A 2FSNA 5BN9A 4FLXA 3U9DA 4O55A 4ISFA 3NDKA 3Q7BA 1YIJN 3LZJA 1VSLA 1GLCG 3NGZA 1OH8A 3DLKA 4BR2A 5HRNA 5BRDA 5GAHP 1WNSA 3W0LA 4W5NA 1SL1A 3G6EN 2FBTA 3LAMA 1YUWA 4LF5K 4Z4EA 2PZSA 4WE1A 3BF3A 4DCHA 3VENA 3NGYA 2VQFK 2BUPA 4A2BA 2BH1A 3A2FA 1IBLK 3LALA 3OY9A 4DQQA 3NBPA 3KIOA 1FJGK 4CZMA 2YHBA 2D4WA 3PIPL 2P9NA 3GOIA 2P9PA 5E41A 5IWAK 3RSEB 3U9ZA 4B3TK 5FPNA 3HOTA 2DPNA 4B9VA 2HHSA 4CFDA 5HL7L 3RRGA 3OYMA 2ZM6K 2YNIA 4FJ7A 3O9UA 4CIEA 1BQNA 4DMNA 2ASPA 5DK5A 3KHYA 4Y1DA 2OPQA 2P9KA 1X9JA 3E1YA 5JS2A 4KHNA 1ATNA 3NFAA 3P38A 1U49A 4H5WA 4FJNA 1FKPA 3OVNA 4KHQA 1KSPA 4JHDA 2ZF5O 1VRUA 4JKDA 4DTSA 4J2BA 4JKGA 4B3RK 1T6CA 4YOVA 3KD1E 3M8QA 4PHTX 1SAZA 3HI0A 3E01A 5AQRA 4BRIA 1BWFO 3WXJA 2ATQA 3HM9A 3WT0A 1WB9A 4FOEA 1XMQK 3SPYA 1MDUB 1W0HA 3PLAA 5KI6A 2D0PA 3M8RA 4CE9A 2ITMA 1XMOK 3O9QA 4FWLA 3OYFA 3JYTA 4JKHA 1TGOA 1S1WA 4DTNA 4KFBA 4B9TA 1Y97A 4WQ5C 3AVLA 4W5OA 3QEXA 3RMCA 2NZTA 2D1KA 1NK6A 4CZEA 4LC9B 3NAEA 1KCFA 2FF6A 4DR2K 1BIUA 3ZT3A 3BUZB 4BRCA 4CGJA 1K8AO 2E2NA 4C8NA 2V7YA 3CM5A 3K5NA 3K59A 2UXCK 1KRPA 4DU3A 1WSHA 1T03A 4IJAA 3TANA 5CZ2A 2P9SB 1S1XA 4CHNA 3NF6A 2F9WA 4NCGA 3TAEA 3RMBA 3M3ZA 4CEQA 1YTUA 4CEZA 2A3ZA 4PL8A 4CEOA 5HP1A 3O3GA 1RBSA 4CZJA 4ID1A 3AA5X 1S72N 1OH6A 2WONA 3LDOA 4N47A 3QEPA 4J8FA 3OS1A 4E7IA 1LWFA 3VGMA 4AM7A 1WSFA 3L2UA 5AZIB 1BOTO 3OHRA 4Z0UA 1NJXA 2Z1IA 1Q9YA 1ZXOA 4CW7B 3BZCA 2OPRA 3T1YK 3L3VA 1U2VB 4HWIA 1RBRA 2P9LB 4CGGA 1QZ5A 3DLLL 2KHOA 4BR7A 3EKUA 3UKUA 1HQEA 2GEMA 2HSTA 1R59O 1EETA 3ZT4A 2QWNA 3CC4N 3TWHA 5GINA 4DQSA 4G9ZA 1DTQA 3PX0A 3SV3A 3K9KA 1DTTA 4YDUA 1NK0A 4W5QA 1NK9A 4BR0A 4DV5K 4Z4HA 4OGEA 1YJNN 1LAVA 4Y0WA 4PKHA 1TYQA 3A8YA 4B3OA 3WXMB 3DWLA 4JI1K 5EXWA 3OYLA 1T3VA 4FJ9A 1J6ZA 2GV9A 4CEFA 5AJ3K 2HNZA 3CCVN 2O8EA 4JNEA 1KC8O 4CBWA 3SAHA 4QS8A 3L2WA 2OTJN 4RWTA 1H1VA 3V9WA 2IS3A 5CE3A 3P1GA 2Y1JA 5HROA 4IO9L 3AVMA 3RSEA 1VSEA 3THYA 3QDKA 4DFPA 5AFUA 4CHQA 5KTQA 2OPSA 1KFDA 3QB0A 3HO1A 1SKWA 1HYZA 5EVZA 3T1HK 4DQ8A 3AGKA 1P8ZA 3WEEB 4M3RA 3VA0A 3QEVA 2EWSA 2HVIA 2FBXA 4KHUA 4F3TA 3BGRA 3MN7A 4ICLA 1NGHA 4E7KA 4BDPA 4MO4A 4CF1A 4FWOA 4BG9A 4HUGA 3KZBA 4FM2A 3SPZA 3MX2A 1S9EA 2RE2A 3QNNA 3SNNA 4C23A 4DTRA 4ILGB 2O8DA 1V4SA 4EFHA 3NGIA 1L3TA 3LDNA 4KAZA 4DFKA 4Q0BA 3DXKB 3J8AA 3KD5E 3LANA 4JI2K 4Z94A 1IH7A 5AR0A 2HBKA 5LMNK 3OYBA 5C10A 1JLBA 1WOQA 3ID6A 2HMIA 3DOLA 1T6DA 5HLFA 1KD1O 4LFCK 1WAFA 3SBTA 2QWOA 3QESA 4E89A 2YI1A 4N5SA 3H6EA 2GWKA 1ZBSA 4JKEA 3RR8A 5LJWA 2AA4A 4DKWA 4B9SA 1GLLO 1RT2A 3QBWA 1ZBHA 5C2FA 5AQKA 4CJUA 4CBUA 2FSJA 1HLUA 1QSYA 2O8CB 4C8KA 1HYSA 4HCBA 2A1SA 1RT7A 2VWJA 2H3GX 2KZMA 5F1XA 5AQUA 4DQIA 5AQFA 1LAWA 4B8CA 4KB0A 3PIOL 3T69A 4EP5A 3LM2A 1KXPA 3D45A 5I9EB 3M8PA 2OYQA 1C0MA 5B8HA 3THXA 2BDPA 3EL2A 3I0SA 2F96A 3QBXA 3CCEN 1I39A 4ELUA 4YNQA 2NRXA 3RRHA 4DLEA 4ELVA 3D7EO 3PO4A 1UA1A 5KQ8A 4H0PA 4Z4GA 3KVGA 4IDKA 3CCJN 4FZZA 1WBDA 4A62A 2KFNA 3LDSA 4XH1A 4AM6A 3OYHA 5AQHA 4JLHA 2YV0X 4QOZB 2F8SA 1GOAA 1OVYA 1WSGA 3V6DA 2E6LA 4JI3K 4IKFA 2W6LA 4KBOA 4MQ3A 4GKJK 2NRZA 1HUXA 4DFJA 1WUAA 3F9KA 2B4JA 3ZSRA 1U48A 2E2PA 3TAPA 4AF1A 4ILHA 3OYIA 1BISA 1KVCA 3J80O 4CHZA 4DSEA 4CJTA 3SCXA 1VQMN 4BRQA 1L5UA 3AVIA 1NU0A 4CJVA 2P5OA 4NLBA 2YNFA 4JI7K 3ZETB 3B6OA 2FBYA 1RT4A 1NOZA 3OJUA 3LWLA 3V9UA 3LDQA 3LWMA 1K8KA 3DXMB 4QS9A 3OW2M 3PV8A 1D8YA 1RBVA 2E8AA 3R6MA 1QS4A 4CFAA 2BTFA 4LH5A 4WQ4C 5M1PA 1K73O 3L2RA 3C94A 3SMSA 3R1XA 4BG8A 2E6MA 3V9XA 3TI0A 5EOYA 4L8RB 1WAJA 3JAMO 4KHSA 4IFEA 3VQPA 1EXQA 3ISNC 5AQYA 5JMVA 1RGIA 3MK6A 4DR1K 3N4QA 5AZJB 4IG0A 2XY8A 3CCUN 3R3LA 2WC9A 1ESVA 2KW4A 4B1WB 2YKMA 2OA8A 1NMNA 2B5JA 3CJBA 1A5VA 5M1NA 3C6HA 2IIRA 2VG6A 4KB1A 4F9OA 5AQNA 3T1AA 5KPZA 4BWMA 5BN8A 3OYEA 3SQ1A 2JWKA 2HMPA 3MEDA 5GIOA 3AY9A 4JS4A 3CC2N 3C6TA 3VGKA 4PA1A 2EHGA 1HYVA 4GVEA 1VSFA 3NE6A 1EP4A 4AHRA 4DTOA 1VQ5N 5HRPA 1SUQA 3UE5A 4B9UA 4MLHA 4C8MA 4WFAL 1NKBA 4KI4A 4AHTA 5DM6L 5FRMA 5HRRA 3VQAA 3U4LA 4LFAK 1WN7A 3ZX2A 3KJVA 1HQUA 4CJRA 4DHYA 3LAKA 4GKKK 2HHTA 4CIFA 4W5TA 3RMAA 4BQZA 4KTWA 4NYFA 1W7AA 4DQPA 2QWRA 3D2EB 3V1QA 1U04A 3O6WA 1NJYA 4FJIA 4HUFA 1YF5L 3DYAA 4PUOA 5MLCQ 3P4IA 2X6SA 4UQGA 4WQ5A 1YJWN 3N4PA 3CQ8A 1S3XA 4X62K 2VCPA 3LP2A 4AHUA 3FGUA 4CZLA 4RW7A 5KGXA 1QVGM 4FLUA 5K14A 1RT6A 2JGUA 4CJPA 1Q81O 3CF5L 5LY3A 3CMEN 3D2FB 1GLFO 4OPKA 4DS5A 2KZZA 2PYLA 3TSUA 4YY3K 4RW8A 4ID5A 5LJVA 2YJFA 3CM6A 4GV3A 1IJJA 1YITN 4CI6A 3ZT2A 4YOYA 3L2VA 1FXXA 1JL1A 1X9MA 2G8UA 4J2AA 3FFKB 3CYMA 2X6NA 4I9QA 4MFBA 3AO2A 3CJ7A 4N56A 2ITGA 5KRTA 3QO9A 3OA9A 4K25A 2VGNA 1IG8A 2E1YA 2ZE2A 4AHVA 1JLFA 4CZFA 4CEEA 1Q9XA 1NGJA 3UKRB 1B9DA 3WNEA 4RG8A 1YI2N 3IDHA 1DT9A 4GY2B 3QMLA 3J7AP 1KVBA 3RWUA 3CPWM 1BI4B 3H46O 3IUCA 3I8DA 3CC7N 1D9FA 1I3AA 2QW9A 3MXIA 3QIOA 3QERA 3FFIA 1Q18A 5CHIA 4M41A 3AO1A 4WFNL 3KK7A 3AVBA 4NB4A 1T05A 4JI5K 1EO1A 3OBYA 2VG7A 1S6PA 1VSMA 1N5YA 4EAHD 4I2PA 1N36K 3TSQA 4J2EA 2VG5A 4OLBA 3KWGA 4JEPA 3ZEUA 2P9IA 5CZ1A 1HPZA 5A2QO 1KTQA 4GNIA 5GADP 1BO5O 5AQLA 3WQUA 2QM1A 3BY5A 1T44A 1VRTA 4B9QA 4CK1A 1CXQA 4FPAA 3H1VX 4CFBA 4H4OA 2W42A 2QA4N 4CJ7A 1JJ2M 1VHXA 1XC9A 3BDPA 3O5BA 4IOXA 4JKAA 3AAPA 4JKCA 2DFHA 4CFCA 1NK8A 1N33K 3BEXA 4DV0K 1OVQA 1ATSA 1YAGA 1TL1A 4IBNA 3MX5A 4FYDA 3KWIA 3HPGA 2GX9A 1U6ZA 3ULDA 4NCAA 4EHUA 4M42A 3NF7A 1LWEA 3CJ1A 4K8XA 3PX4A 2E88A 4DSIA 4RW4A 4BRHA 3MN5A 4N76A 3L8BA 5FDLA 2W40A 2WFBA 1NK4A 3ASMA 4EHTA 2GWJA 1YTAA 4OX9K 2R7YA 3NF8A 5JS1A 3KLEA 1UWBA 3EEQA 2XY7A 2YNHA 4RCHA 2O4GA 4L3QA 2QXLA 3EE8A 4LF4K 1IKYA 2Y1IA 3DLRA 4J2DA 2YHYA 4DTXA 1VQ4N 2QWPA 1WSJA 1YVUA 1JKHA 1SS6A 1NWKA 4JRPA 2NUBA 3VA3A 3CFPA 1YT3A 4FK2A 4A5BA 1IV0A 1NJIO 4AH9A 1QQNA 4BVPA 4CJKA 3B8AX 3VEZA 5GIPA 2O4IA 5M1OA 1NJZA 1N32K 2BANA 4QCLA 1NGCA 2VGMA 4YOTA 4OO1J 1X1PA 3A5LC 4A61A 5DM7L 3CMAN 1JLQA 3OYGA 4JRQA 3R8EA 4CGIA 4PKIA 4WYBA 1NJWA 4FZXC 4FLWA 3RTVA 2G8HA 4B9MA 3PSFA 3OYJA 4AHSA 4DG1A 3HK2A 4GW6A 2HW3A 5M1KA 3SI6A 2JLEA 3VQ4A 3RMDA 4K0KK 3CFRA 4IG3A 2Z1HA 4GMJB 3NHGA 3CJ9A 4JK8A 3SZ2A 1X3MA 3DLEA 2E5LK 4CZKA 1BGXT 1RDCA 1FKOA 2VYPA 3IS9A 3ZSYA 4R79A 1XHXA 2X74A 3A0IX 3SQ4A 4PWDA 3MECA 1W2BM 4BRNA 4AILC 1N34K 2O8BA 1GLJO 1IBMK 4FWPA 1J54A 3TU5A 4C1NI 3QEIA 1RDUA 3HBTA 4MLEA 2OZMA 1KAZA 4X64K 4BACA 2HBMA 2ASMA 2YHAA 3VTHA 3M5RA 3DRPA 1LW0A 1CXUA 3G25A 3LDPA 4ZTFA 1LOTB 4FJ5A 2KFZA 4LF7K 4YOXA 3EZ5A 2F8TA 2UUCK 3ZLJA 4H0OA 1L3VA 4DU1A 1DLOA 4C8LA 1E4GT 4CCHA 4ILJA 2RKIA 3KLHA 4IOCL 3O4WA 3QINA 4WQ4A 4CJQA 2W6KA 3T7ZA 4ISGA 1VQ8N 4DV4K 1HNXK 3F73A 1DEJA 2HOEA 4AQYK 3DRRA 4H03B 4BE0A 2DFEA 2QI2A 1TKTA 3ID8A 1Z26A 1BHLA 3H3OB 4CGHA 4LH4A 2KKZA 2E4LA 3E9LA 3VQEA 4RTFD 3HXMA 1QQCA 3U8XA 4K42A 4YOUA 3HRGA 2WOMA 3CCLN 3MXJA 5M1FA 1RDDA 1NGBA 1RDBA 3LZIA 4H0XB 2WUSA 3WNHA 2GUIA 3BZKA 1S22A 1NOYA 2UXBK 4DS4A 5AQMA 2E20A 1IBKK 2IC3A 5J2PA 2VWKA 4H8KA 3U6FA 1NGEA 3TARA 2Q1NA 1IG9A 1N8RO 4BQLA 1BG3A 2ZQBA 3AO3A 3CJAA 3DM2A 5M1QA 4ZHRA 4DTUA 1LCUA 1CZ9A 3OS2A 3DAWA 5IT9O 4E0DA 4E1NA 3RR7A 4XH4A 3KLIA 1RTHA 1DKGD 3K2PA 2Q2RA 4DF4A 2LSNA 1ASUA 3HOSA 4FPBA 4CEAA 4Y1CA 5J2MA 1KAYA 3ULEB 2HVHA 5LL6Z 3HL8A 4KPYA 3AVHA 4FJ8A 2QK9A 1TKZA 3KKSA 4FJJA 4HVJA 2CH6A 4B3MK 4PQUA 4FOIA 4KTZA 3MDQA 1J5EK 3MWTA 4CZIA 4JD2B 1XC3A 4CHYA 4E1JA 3I56N 2G8FA 2P5GA 2O8FB 3C6AA 4DTPA 3F9MA 1JXEA 3B6PA 3O4QA 1MWKA 3SQ2A 4KV8A 3KK2A 3UIQA 3MXMA 1JCGA 1BA1A 3DI6A 1YHQN 1KQSM 2G8WA 1HNVA 1VSIA 1TV6A 3MEEA 3O3HA 2P9SA 1NK5A 2NRWA 4DU4A 3EE9A 1M1KO 5DMRA 1UAXA 4O5FA 4DWIA 1HKBA 5GAEP 1S6QA 3ZCMA 3DLGA 2QEXN 5HBMA 4O8UA 3QIPA 5E84A 4TSXA 4M3WA 1D5AA 4CEDA 1J5OA 3TAGA 1HNWK 3IAYA 3ZT1A 3VQDA 1DGKN 3NH0A 1O1WA 4B1VA 5AZIA 3U3YA 4IEIA 3CETA 4CF9A 5T7BA 1QHAA 4WFBL 2UYTA 3THWB 3O3FA 2DFFA 4CESA 2P9UB 3ATVA 4CGFA 4FJGA 4M7YA 2X78A 1U2VA 2P9LA 1BQMA 4CJ3A 1RFQA 3C7NB 3SK3A 4KHYA 1SKRA 2F7TA 4Q5VA 1BUPA 3HT3A 1CZBA 4JKBA 4FW1A 5BR9A 2VWBA 3KLFA 1M90O 4FK4A 3O80A 1WSEA 3CCSN 4IDHA 4CK2A 3WUHA 2GELA 2PAVA 3CERA 3GDQA 2IAJA 4F3OA 4LF6K 1BA0A 1OH5A 2V7ZA 4IFVA 4CJSA 5C15A 5AQGA 2QWLA 2HBJA 5ADXH 3CI5A 5I42A 1RILA
chains in the Genus database with same CATH topology
1KAXA 3UKRB 4H5VA 4WQ5C 3VETA 1Q82O 2NZTA 2D1KA 3CCMN 4CZEA 5FPDA 1YI2N 4LC9B 3TTCA 2NRVA 3IDHA 2FF6A 1DT9A 4B1ZA 1VAZA 4BRCA 1Z6RA 3BUZB 3LM9A 4IO8A 4C1NK 2E2NA 1K8AO 4GY2B 5AQPA 2V7YA 3QMLA 1SQKA 1E4FT 5FPEA 4IJAA 3BF1A 3CPWM 2ZJQL 3H46O 2P9SB 3IUCA 3MN9A 3L0QA 3CC7N 4NO7A 4PKGA 2QW9A 2F9WA 2A40A 3D6RA 3CD6N 2ZJPL 1TUYA 4H5TA 4UY8O 5JVHL 3M3ZA 1Q18A 3L4IA 3QFUA 3WEEA 5CHIA 3NMUA 3VERA 3TSPA 2A3ZA 4PL8A 4WFNL 4H0TB 2Q97A 1GLAG 3KK7A 2P9NB 3OBWA 2P9PB 4NB4A 3VF2A 1EO1A 3OBYA 4MDBA 4CZJA 3SLCA 2JWLA 1VQNN 1S72N 3CJCA 3LDOA 4FWRA 4J8FA 2QTDA 4EAHD 3O9SA 3TSQA 3VGMA 4AM7A 3KWGA 3FZHA 3CQYA 1Q86O 4JEPA 2FSKA 3AAQA 5AZIB 3ZEUA 1BOTO 2P9IA 3LL3A 3OHRA 1NGGA 1P90A 4M63C 1ILYA 4GNIA 5GADP 2GUPA 5E26A 4B1UB 1BO5O 2YCHA 2W41A 5AQLA 3SJHA 1ZXOA 4U7BA 2P9KB 3WQUA 2QM1A 3EKSA 4CZGA 1BU6O 1T44A 3E9PA 5EX5A 4K43A 4B9QA 4BR9A 1X3NA 4BRGA 1U2VB 4FPAA 4HWIA 3DXKA 5KPTA 2P9LB 3H1VX 3UB5A 2F9TA 2QA4N 4CJ7A 1QZ5A 3JXUA 3DLLL 1JJ2M 4CD1A 2KHOA 5TKYA 4I6MA 3VTIA 4BR7A 2AP1A 3EKUA 3UKUA 1Z05A 4JHDB 1NM1A 2GEMA 3O5BA 4IOXA 3AAPA 2HSTA 1R59O 4JKAA 4JKCA 2QWNA 3CC4N 1NGAA 5GINA 3BEXA 3MWPA 4BC4A 4JKGB 3F5TA 1YVNA 1ATSA 1YAGA 4G9ZA 4CD3A 4JK9A 3MX5A 3ATUA 3K9KA 3KWIA 2D0OA 2GX9A 2NRTA 1U6ZA 4EHUA 3FZLA 3GE1A 4YDUA 4O8KA 3CJ1A 3W3DA 3C0BA 5EY4A 3VPZA 4BR0A 5BRFA 5AQSA 1YJNN 2E88A 5AQIA 4BGBA 4Y0WA 1YJ9N 4BRMA 4PKHA 1TYQA 5AQOA 3MN5A 3A8YA 4BRHA 4FWMA 4IJNA 2W40A 4XH5A 2WFBA 3DWLA 3WXMB 3WXIA 5EXWA 3S41A 4BRFA 4EHTA 5BPNA 1T3VA 2GWJA 4KH5A 2PFUA 4FL9A 1J6ZA 4BRAA 3WXLA 4U67L 2Q0RA 4B1YB 2CGKA 3LDLA 3CCVN 4JNEA 2IVPA 4IWVA 1KC8O 4CBWA 1NBWA 4RCHA 3SAHA 4QS8A 2OANA 2OTJN 3EO3A 4L3QA 3H1QA 2FLOA 2ZWHA 5C0YA 2QXLA 3VEXA 4RWTA 1H1VA 3EE8A 2YHYA 5CE3A 1VQ4N 2QWPA 3H45C 4IO9L 3E66A 5JLHA 1SS6A 1NWKA 3RSEA 3QDKA 4GV6A 3I33A 4A5BA 5AFUA 2NRRA 1NJIO 1XQSC 3QB0A 3VOVA 4BVPA 1NLVA 1QQNA 1TUUA 2Q31A 3AGRA 1VQON 1HKCA 2V51B 5EVZA 3B8AX 3I8BA 4DQ8A 3AGKA 1P8ZA 3VEZA 5GIPA 3WEEB 2HF4A 2EWSA 4BR5A 5M1OA 3MN7A 1NGHA 1NGCA 2VGMA 4OPAA 3A5NC 4YOTA 4OO1J 3A5LC 1Y64A 2YJEA 4A61A 2WBNA 4MO4A 2E2OA 5DM7L 4FWOA 4BG9A 1QVFM 3KZBA 1OKJA 3MCPA 2V52B 4IEEA 3CMAN 2QWQA 3CXCM 5AFUH 2IVOA 4YDUC 2NLXA 3MX2A 3R8EA 5AQVA 2PBDA 2RE2A 4BRPA 4KH6A 4PKIA 4WYBA 3GG4A 3O1BA 3VEVA 4C23A 3ZEUB 5FPMA 2P9IB 4ILGB 3WQTA 3ENOA 4WF9L 1V4SA 3AARA 4EFHA 1JCFA 1QQMA 1EQYA 3O08A 4IXCA 5M1KA 4M7XA 3LDNA 1HX1A 3HTVA 3FR0A 1VQ6N 1MWMA 1HPMA 3DXKB 3J8AA 4Z94A 4IOAL 3ENHA 1NMDA 5AR0A 2HBKA 3CJ9A 4JK8A 5TKWA 3ZETA 1VQ7N 3UKUB 3G71N 1X3MA 1HKGA 5C10A 1SZ2A 3VGLA 2CGLA 4CZKA 1HJOA 1VQKN 1WOQA 2Q0UA 3ID6A 2QWMA 4JAXA 2CH5A 4MDAA 3CIPA 4CZHA 5JICA 1T6DA 1KD1O 2VYPA 3DXMA 3SBTA 4R79A 4K41A 2QWOA 5BPMA 3A0IX 2FXUA 2YI1A 4FSVA 5CR4A 3BP8A 3H6EA 5F0XA 1Q7YO 1XUPO 1D4XA 2GWKA 2IVNA 4BRNA 1W2BM 1ZBSA 4JKEA 4BRLA 5LJWA 5AQZA 1GLJO 2AA4A 4FWPA 4DKWA 2OTLN 4DB3A 4C1NI 3TU5A 2CGJA 1ZC6A 5GAGP 1GLLO 1RDUA 3HBTA 4MLEA 3QBWA 1KAZA 2NRHA 5C2FA 4H0VB 2HBMA 5AQKA 2ASMA 4BC3A 4CBUA 3I55N 3VTHA 4A57A 1TYQB 1VQ9N 3M5RA 2FSJA 3VF4A 3ULEA 4BC5A 1HLUA 3QFPA 5AZJA 3G25A 3LDPA 2H3GX 1LOTB 2Q36A 4H0YB 1QZ6A 5F1XA 5AQUA 1QQOA 5AQFA 1NGIA 3P31A 5AQJA 3T69A 3PIOL 4BVOA 3LM2A 1KXPA 4YOXA 1CZAN 2GTDA 4A59A 5ELZA 4BC2A 3K9JA 4JK7A 2NNWA 3ZX0A 4JD2A 5I9EB 2I7NA 4H0OA 5B8HA 3EL2A 3TPQA 1JCEA 1E4GT 3GL1A 3QBXA 4ILJA 4BROA 3CCEN 4IOCL 2NRXA 3O4WA 4FWNA 4BRDA 4CBXA 3D7EO 3VEWA 1YXQA 5JLFA 5KQ8A 4WQ4A 4PL7A 4H0PA 3KVGA 1GLEG 3EZWA 4WCEL 1VQLN 3T7ZA 3CCJN 4ISGA 4A62A 1VQ8N 4XH1A 4AM6A 4GV9A 1DEJA 5KQDA 3R9PA 3C65A 3IKMA 4NLCA 2HOEA 5AQHA 1C0FA 4H03B 2HF3A 5AQQA 2QI2A 5AQWA 3ID8A 4YORA 3H3OB 2A42A 1OVYA 3O1WA 3MMVA 4JKFA 3TTFA 3H3NO 3HSCA 3J7ZO 2KKZA 3E9LA 2YX6A 4KBOA 2HBLA 4RTFD 2NRZA 1HUXA 3A5MC 3D2EA 3SBGA 1WUAA 4OPHA 3U8XA 4A2AA 4KH4A 4K42A 3TTDA 4YOUA 3HRGA 2E2PA 3A5OC 3CCLN 2ZGYA 4H5NA 4AF1A 2FF3B 4ILHA 5M1FA 1NGBA 4H0XB 2WUSA 3NVKA 5H1SQ 4FVUA 1S22A 3ZX3A 3VMFB 5AQMA 2E20A 4FWSA 1NGFA 4FO0A 3HZ6A 1RDWX 5C2DA 2A6AA 1NGEA 2E1ZA 4MO5A 5BREA 2YHWA 1VQMN 2Q1NA 4BRQA 3ENBA 3FZMA 4NLBA 3ZETB 2ASOA 1N8RO 2P9UA 1BG3A 4BQLA 3CJAA 2J4RA 1GLDG 2A5XA 5M1QA 4IZ9A 5BRHA 1LCUA 3FZKA 3LDQA 4HTLA 3DAWA 3VEOA 3CCQN 1K8KA 3DXMB 1ATRA 3D2FA 4JN4A 4QS9A 4A5AA 3HM8A 3OW2M 4XH4A 3C7NA 3M6GA 2E8AA 3R6MA 3VEYA 1G99A 2BTFA 1DKGD 3L4QA 4WQ4C 5M1PA 5BPLA 1K73O 3SMSA 3VESA 5JVGL 3O9RA 3MCAB 2A41A 3R1XA 1V4TA 2Q2RA 3E9OA 4BG8A 4BREA 5EOYA 3FE1A 2ZGZA 3HOSA 4FPBA 4IFEA 1BDGA 1KAYA 3M1FA 3ULEB 4I6MB 5AQYA 5JMVA 2I7PA 1RGIA 3MK6A 3GBTA 3NVMA 3N4QA 5AZJB 3CCRN 4H5RA 3CPEA 3CCUN 3R3LA 2WC9A 1ESVA 2CH6A 3IFRA 5C12A 3RVCA 4FOIA 4B1WB 4EIAA 1O13A 3JS6A 2FSNA 1GLBG 3MDQA 5BN9A 5KPRA 3CJBA 3U9DA 3MWTA 4CZIA 4JD2B 4ISFA 1XC3A 3Q7BA 4E1JA 3C6HA 5M1NA 3I56N 2IIRA 1YIJN 4BY9C 3UKRA 5AQTA 5AQNA 5AQXA 4F9OA 5KPZA 5BN8A 3SAFA 3C6AA 4BR4A 2JWKA 2HMPA 5GIOA 3AY9A 3F9MA 3CC2N 3VGKA 1GLCG 1MWKA 3EN9A 4BRKA 4GVEA 3G4SN 4BR2A 5BRDA 5GAHP 3W0LA 1VQ5N 3G6EN 1JCGA 1BA1A 1YUWA 3F2KA 2KLAA 3UE5A 1YHQN 5HOOA 1KQSM 4MLHA 4WFAL 1VQPN 5DM6L 4FWKA 3BF3A 2P9SA 2NRWA 3VENA 4DCHA 3EE9A 3SMPA 3U4LA 4QS7A 1M1KO 2BUPA 3ZX2A 2YHXA 4O5FA 1HKBA 4DHYA 1C0GA 4A2BA 5GAEP 2BH1A 3WXKA 2QEXN 4FWQA 4BQZA 3SAGA 4XEIA 4CZMA 2D4WA 4O8UA 3PIPL 2P9NA 2QWRA 2P9PA 3D2EB 3GOIA 5E84A 3O6WA 3RSEB 3U9ZA 5FPNA 1YF5L 3HOTA 3QICA 2DPNA 5HL7L 3CQXA 5MLCQ 3L6QA 3P4IA 3O9UA 4WQ5A 1K9MO 1YJWN 1DGKN 3N4PA 1S3XA 4B1VA 5AZIA 4IEIA 3CETA 2VCPA 1QHAA 4WFBL 2UYTA 2ASPA 3FGUA 3VF6A 4CZLA 3ZYYX 2E2QA 3KHYA 2P9UB 2P9KA 3ATVA 1QVGM 2RHKA 1X9JA 3E1YA 4M7YA 1U2VA 1Q81O 3FLCO 3CF5L 2P9LA 1ATNA 3O9TA 5LY3A 3CMEN 3P38A 1K8KB 3D2FB 1GLFO 1RFQA 4H5WA 3IMXA 3O8MA 4YOWA 3C7NB 3TSUA 5F2RA 3SK3A 2F7TA 4JHDA 3P39A 1BUPA 2ZF5O 5LJVA 4JKDA 1W97L 1NGDA 2YJFA 4JKBA 2ZJRL 4GV3A 1IJJA 3Q7CA 1YITN 4JKGA 1T6CA 5BR9A 5ADXA 2VWBA 4CI6A 4YOVA 1M90O 3MN6A 4YOYA 3O80A 3CHWA 4PHTX 4IDHA 3CCSN 1SAZA 3HI0A 5AQRA 4BRIA 1BWFO 3FZFA 3WUHA 3WXJA 2GELA 2PAVA 1MA9B 3CERA 3FFKB 3WT0A 4BGAA 3GDQA 3DJCA 4FOEA 1BA0A 1MDUB 3CJ7A 2V7ZA 5C15A 5AQGA 3OA9A 3PLAA 4K25A 2VGNA 1IG8A 2E1YA 2D0PA 2QWLA 4ISEA 2HBJA 5ADXH 4B1XB 2ITMA 4CZFA 3CI5A 3O9QA 4FWLA 4JKHA 1NGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAX A;  3UKR B;  4H5V A;  4WQ5 C;  3VET A;  2NZT A;  2D1K A;  4CZE A;  5FPD A;  4LC9 B;  3IDH A;  2FF6 A;  4B1Z A;  4BRC A;  1Z6R A;  3BUZ B;  3LM9 A;  4IO8 A;  2E2N A;  4GY2 B;  5AQP A;  2V7Y A;  3QML A;  1SQK A;  1E4F T;  5FPE A;  4IJA A;  3BF1 A;  3H46 O;  2P9S B;  3IUC A;  3MN9 A;  3L0Q A;  4NO7 A;  4PKG A;  2QW9 A;  2F9W A;  2A40 A;  1TUY A;  4H5T A;  3M3Z A;  1Q18 A;  3L4I A;  3QFU A;  3WEE A;  3VER A;  2A3Z A;  4PL8 A;  4H0T B;  2Q97 A;  1GLA G;  4NB4 A;  2P9N B;  3VF2 A;  2P9P B;  4CZJ A;  3SLC A;  3CJC A;  3LDO A;  4FWR A;  4J8F A;  4EAH D;  3VGM A;  4AM7 A;  3FZH A;  3CQY A;  2FSK A;  3AAQ A;  5AZI B;  3ZEU A;  1BOT O;  2P9I A;  3LL3 A;  3OHR A;  1NGG A;  4M63 C;  4GNI A;  2GUP A;  5E26 A;  4B1U B;  1BO5 O;  2YCH A;  2W41 A;  5AQL A;  3SJH A;  1ZXO A;  2P9K B;  3WQU A;  2QM1 A;  3EKS A;  4CZG A;  1BU6 O;  1T44 A;  5EX5 A;  4B9Q A;  4K43 A;  4BR9 A;  1X3N A;  4BRG A;  1U2V B;  4FPA A;  4HWI A;  3DXK A;  5KPT A;  2P9L B;  3H1V X;  3UB5 A;  2F9T A;  4CJ7 A;  1QZ5 A;  3JXU A;  4CD1 A;  2KHO A;  5TKY A;  4I6M A;  4BR7 A;  2AP1 A;  3EKU A;  3UKU A;  1Z05 A;  4JHD B;  1NM1 A;  2GEM A;  3O5B A;  3AAP A;  1R59 O;  2QWN A;  1NGA A;  3BEX A;  4BC4 A;  1YVN A;  1ATS A;  1YAG A;  4CD3 A;  3ATU A;  2D0O A;  1U6Z A;  4EHU A;  3FZL A;  3GE1 A;  4YDU A;  4O8K A;  3CJ1 A;  3W3D A;  3C0B A;  5EY4 A;  3VPZ A;  4BR0 A;  5BRF A;  5AQS A;  2E88 A;  5AQI A;  4BGB A;  4Y0W A;  4BRM A;  4PKH A;  1TYQ A;  5AQO A;  3MN5 A;  3A8Y A;  4BRH A;  4FWM A;  4IJN A;  2W40 A;  4XH5 A;  3DWL A;  3WXI A;  5EXW A;  3S41 A;  4BRF A;  4EHT A;  5BPN A;  2GWJ A;  4FL9 A;  1J6Z A;  4BRA A;  3WXL A;  2Q0R A;  4B1Y B;  2CGK A;  3LDL A;  4JNE A;  2IVP A;  4IWV A;  4CBW A;  1NBW A;  4RCH A;  4QS8 A;  2OAN A;  3EO3 A;  4L3Q A;  3H1Q A;  2FLO A;  2ZWH A;  2QXL A;  3VEX A;  4RWT A;  1H1V A;  2YHY A;  5CE3 A;  2QWP A;  3H45 C;  5JLH A;  1NWK A;  3RSE A;  3QDK A;  3I33 A;  5AFU A;  1XQS C;  3QB0 A;  3VOV A;  4BVP A;  1NLV A;  1QQN A;  1TUU A;  2Q31 A;  1HKC A;  2V51 B;  5EVZ A;  3B8A X;  3I8B A;  4DQ8 A;  1P8Z A;  3VEZ A;  3WEE B;  2HF4 A;  2EWS A;  4BR5 A;  3MN7 A;  1NGH A;  1NGC A;  3A5N C;  3A5L C;  1Y64 A;  2YJE A;  4A61 A;  4MO4 A;  2E2O A;  4FWO A;  4BG9 A;  3KZB A;  1OKJ A;  3MCP A;  2V52 B;  2QWQ A;  5AFU H;  2IVO A;  4YDU C;  2NLX A;  3R8E A;  5AQV A;  2PBD A;  4BRP A;  4PKI A;  4WYB A;  3GG4 A;  3O1B A;  3VEV A;  4C23 A;  3ZEU B;  5FPM A;  2P9I B;  3WQT A;  3ENO A;  1V4S A;  3AAR A;  4EFH A;  1JCF A;  1QQM A;  1EQY A;  3O08 A;  4IXC A;  4M7X A;  3LDN A;  1HX1 A;  3HTV A;  3FR0 A;  1MWM A;  1HPM A;  3DXK B;  3J8A A;  4Z94 A;  3ENH A;  1NMD A;  5AR0 A;  3CJ9 A;  3ZET A;  3UKU B;  1X3M A;  1HKG A;  1SZ2 A;  3VGL A;  2CGL A;  4CZK A;  1HJO A;  1WOQ A;  2Q0U A;  2QWM A;  4JAX A;  2CH5 A;  5JIC A;  3CIP A;  4CZH A;  1T6D A;  2VYP A;  3DXM A;  4K41 A;  2QWO A;  5BPM A;  3A0I X;  2FXU A;  2YI1 A;  4FSV A;  3BP8 A;  3H6E A;  5F0X A;  1XUP O;  1D4X A;  2GWK A;  2IVN A;  4BRN A;  1ZBS A;  4BRL A;  5LJW A;  5AQZ A;  1GLJ O;  2AA4 A;  4FWP A;  4DB3 A;  3TU5 A;  2CGJ A;  1ZC6 A;  1GLL O;  3HBT A;  4MLE A;  3QBW A;  1KAZ A;  2NRH A;  4H0V B;  5AQK A;  2ASM A;  4BC3 A;  4CBU A;  1TYQ B;  2FSJ A;  3VF4 A;  3ULE A;  4BC5 A;  1HLU A;  3QFP A;  5AZJ A;  3G25 A;  3LDP A;  2H3G X;  1LOT B;  2Q36 A;  4H0Y B;  1QZ6 A;  5F1X A;  5AQU A;  1QQO A;  5AQF A;  1NGI A;  5AQJ A;  4BVO A;  3LM2 A;  1KXP A;  1CZA N;  2GTD A;  4BC2 A;  5ELZ A;  5I9E B;  3ZX0 A;  4JD2 A;  2I7N A;  4H0O A;  5B8H A;  3EL2 A;  3TPQ A;  1JCE A;  1E4G T;  3GL1 A;  3QBX A;  4BRO A;  3O4W A;  4FWN A;  4BRD A;  4CBX A;  3D7E O;  3VEW A;  1YXQ A;  5JLF A;  5KQ8 A;  4WQ4 A;  4PL7 A;  4H0P A;  3KVG A;  1GLE G;  3EZW A;  4ISG A;  4A62 A;  4XH1 A;  4AM6 A;  1DEJ A;  5KQD A;  3R9P A;  2HOE A;  5AQH A;  1C0F A;  4H03 B;  2HF3 A;  5AQQ A;  5AQW A;  3ID8 A;  3H3O B;  2A42 A;  3O1W A;  3MMV A;  3H3N O;  3HSC A;  4KBO A;  4RTF D;  1HUX A;  3A5M C;  3D2E A;  4A2A A;  1WUA A;  3U8X A;  4K42 A;  2E2P A;  3A5O C;  2ZGY A;  4H5N A;  2FF3 B;  1NGB A;  4H0X B;  2WUS A;  1S22 A;  3ZX3 A;  5AQM A;  2E20 A;  4FWS A;  1NGF A;  4FO0 A;  3HZ6 A;  1RDW X;  2A6A A;  1NGE A;  2E1Z A;  4MO5 A;  5BRE A;  2YHW A;  2Q1N A;  4BRQ A;  3FZM A;  3ZET B;  2ASO A;  2P9U A;  1BG3 A;  4BQL A;  3CJA A;  2J4R A;  1GLD G;  2A5X A;  4IZ9 A;  5BRH A;  1LCU A;  3FZK A;  3LDQ A;  4HTL A;  3DAW A;  3VEO A;  1K8K A;  3DXM B;  1ATR A;  3D2F A;  4JN4 A;  4QS9 A;  3HM8 A;  4XH4 A;  3C7N A;  3M6G A;  2E8A A;  3R6M A;  3VEY A;  1G99 A;  2BTF A;  1DKG D;  4WQ4 C;  5BPL A;  3SMS A;  3VES A;  2A41 A;  1V4T A;  2Q2R A;  4BG8 A;  4BRE A;  5EOY A;  3FE1 A;  2ZGZ A;  4FPB A;  1BDG A;  1KAY A;  3M1F A;  3ULE B;  4I6M B;  5AQY A;  5JMV A;  2I7P A;  1RGI A;  3MK6 A;  3GBT A;  5AZJ B;  4H5R A;  1ESV A;  2CH6 A;  3IFR A;  4FOI A;  4B1W B;  4EIA A;  3JS6 A;  2FSN A;  1GLB G;  3MDQ A;  5BN9 A;  5KPR A;  3CJB A;  3U9D A;  4CZI A;  4JD2 B;  4ISF A;  1XC3 A;  4E1J A;  2IIR A;  3UKR A;  5AQT A;  5AQN A;  5AQX A;  4F9O A;  5KPZ A;  5BN8 A;  4BR4 A;  2HMP A;  3AY9 A;  3F9M A;  3VGK A;  1GLC G;  1MWK A;  3EN9 A;  4BRK A;  4BR2 A;  5BRD A;  3W0L A;  1JCG A;  1BA1 A;  1YUW A;  3UE5 A;  4MLH A;  4FWK A;  3BF3 A;  2P9S A;  4DCH A;  3VEN A;  3SMP A;  3U4L A;  4QS7 A;  2BUP A;  3ZX2 A;  2YHX A;  4O5F A;  1HKB A;  4DHY A;  1C0G A;  4A2B A;  3WXK A;  4FWQ A;  4BQZ A;  4XEI A;  4CZM A;  2D4W A;  2P9N A;  2QWR A;  2P9P A;  3D2E B;  3GOI A;  5E84 A;  3O6W A;  3RSE B;  3U9Z A;  5FPN A;  3QIC A;  2DPN A;  3CQX A;  3L6Q A;  3P4I A;  4WQ5 A;  1DGK N;  1S3X A;  4B1V A;  5AZI A;  3CET A;  2VCP A;  1QHA A;  2UYT A;  2ASP A;  3FGU A;  3VF6 A;  4CZL A;  2E2Q A;  3KHY A;  2P9U B;  2P9K A;  3ATV A;  1X9J A;  4M7Y A;  1U2V A;  3FLC O;  2P9L A;  1ATN A;  5LY3 A;  1K8K B;  3D2F B;  1GLF O;  1RFQ A;  4H5W A;  3IMX A;  3O8M A;  3C7N B;  5F2R A;  3SK3 A;  4JHD A;  1BUP A;  2ZF5 O;  5LJV A;  1NGD A;  2YJF A;  1IJJ A;  1T6C A;  5BR9 A;  5ADX A;  2VWB A;  4CI6 A;  3MN6 A;  3O80 A;  3CHW A;  1SAZ A;  3HI0 A;  5AQR A;  4BRI A;  1BWF O;  3FZF A;  3WUH A;  3WXJ A;  2GEL A;  2PAV A;  1MA9 B;  3CER A;  3FFK B;  3WT0 A;  4BGA A;  3GDQ A;  3DJC A;  4FOE A;  1BA0 A;  1MDU B;  3CJ7 A;  2V7Z A;  5AQG A;  4K25 A;  1IG8 A;  2E1Y A;  2D0P A;  2QWL A;  4ISE A;  5ADX H;  4B1X B;  2ITM A;  4CZF A;  3CI5 A;  4FWL A;  1NGJ A; 
#chains in the Genus database with same CATH topology
 1MU2 A;  3SQ0 A;  1HNZ K;  3CCM N;  2D0A A;  4OVL A;  3TTC A;  4B1Z A;  1VAZ A;  3OYN A;  3H08 A;  4JS5 A;  1E4F T;  3DLB A;  5FPE A;  3BF1 A;  2ZJQ L;  3MN9 A;  3HST B;  3M8S A;  3AA3 A;  4PKG A;  4HHT A;  1LW2 A;  1RDA A;  1TVR A;  4O0I A;  1ZBL A;  1TAQ A;  3D6R A;  3J7Y P;  1UOC A;  3PO5 A;  3WEE A;  3V9Z A;  2HHU A;  1RTI A;  3NMU A;  3TSP A;  4BWJ A;  1RTD A;  4H0T B;  3DMJ A;  2Q97 A;  3VF2 A;  2P9N B;  3OBW A;  2P9P B;  4MDB A;  2XY6 A;  3SLC A;  1TAU A;  1VQN N;  3CJC A;  3QLH A;  4FWR A;  3NF9 A;  3ZSZ A;  4FM0 A;  4CEB A;  3O9S A;  2EX3 A;  2HNY A;  1S1T A;  3FZH A;  3CQY A;  1Q86 O;  2FBV A;  1NGG A;  1ILY A;  4M63 C;  4BE1 A;  4K8Z A;  5E26 A;  4DSJ A;  4CEC A;  1J9A A;  4U7B A;  2P9K B;  3EKS A;  4BR9 A;  4GVM A;  1X3N A;  4BRG A;  2XO7 A;  3DXK A;  3QEW A;  3UB5 A;  2F9T A;  4CGD A;  3JXU A;  1U45 A;  1EWQ A;  3VTI A;  2B6A A;  4O44 A;  2XHB A;  1Z05 A;  4JHD B;  1NM1 A;  4B9N A;  3MWP A;  4BC4 A;  4LY7 A;  4JKG B;  5FLX O;  1YVN A;  4HTU A;  2QKK A;  4FK0 A;  4CD3 A;  4JK9 A;  4M3T A;  3QET A;  4FVM A;  1S1V A;  3T19 A;  4I7F A;  4OLA A;  3FZL A;  3GE1 A;  2O8F A;  3SUN A;  4O8K A;  3W3D A;  3C0B A;  5EY4 A;  4BDY A;  5AQS A;  4FJL A;  3MAQ A;  5AQI A;  3VQ9 A;  4BRM A;  3C95 A;  5J1E A;  1XNQ K;  4XH5 A;  3NH1 A;  2O8C A;  3SUO A;  3S41 A;  4EZ6 A;  4M3U A;  2PFU A;  4FL9 A;  4B3S K;  2Q0R A;  4RW9 A;  5KGW A;  3LDL A;  4IWV A;  3KK3 A;  1NBW A;  1ITG A;  1U47 A;  2OAN A;  3CFO A;  3VQB A;  1ZBU A;  2FLO A;  5SWM A;  5EU7 A;  3P83 D;  3U3G A;  1VSJ A;  2HND A;  3LP1 A;  5JLH A;  2HHH K;  2Z1J A;  3I33 A;  2NRR A;  3AVF A;  1NLV A;  1N6Q A;  4O5B A;  2V51 B;  3I8B A;  4CF2 A;  4W5R A;  1IKW A;  3A5N C;  1Y64 A;  2YJE A;  2XY5 A;  4DF8 A;  1QVF M;  2ZD1 A;  2QWQ A;  1C0T A;  2PBD A;  4BRP A;  4DFM A;  3GG4 A;  3O1B A;  3C6U A;  1RCH A;  3IRX A;  5FPM A;  3WQT A;  3ENO A;  4WF9 L;  4M3X A;  3AAR A;  1JCF A;  1QQM A;  4O0J A;  4JI6 K;  4IXC A;  3VQQ A;  1HR0 K;  4LSL A;  1XNR K;  3AO4 A;  3HTV A;  1VQ6 N;  1HPM A;  3V4I A;  5D3G A;  4IOA L;  3ENH A;  1RNH A;  3VQC A;  3QNO A;  1NMD A;  4Z4F A;  5TKW A;  3ZET A;  1X9W A;  1VQ7 N;  3UKU B;  3G71 N;  1U4B A;  3VGL A;  3HP9 A;  2IOC A;  3J81 O;  1HJO A;  4HUE A;  4MDA A;  2QWM A;  4JAX A;  2CH5 A;  5JIC A;  3CIP A;  4CZH A;  4DUY K;  3DXM A;  4DLG A;  4DV7 K;  5CR4 A;  3BP8 A;  5F0X A;  1Q7Y O;  1D4X A;  2IVN A;  3V1R A;  3DOK A;  2OTL N;  3K58 A;  4DV1 K;  2CGJ A;  3WNG A;  3PY8 A;  3I55 N;  3AV9 A;  1VQ9 N;  1TYQ B;  2BE2 A;  4OKE A;  3ZSV A;  3VF4 A;  3QFP A;  4V19 S;  5C24 A;  5AZJ A;  4Z4I A;  4H0Y B;  1QQO A;  3OYC A;  3AVA A;  1NGI A;  3P31 A;  5AQJ A;  2O8E B;  3ITH A;  4BVO A;  1CZA N;  4A59 A;  4BC2 A;  4JV5 K;  4JK7 A;  2NNW A;  2DY4 A;  1QHT A;  3TAQ A;  1JCE A;  3GL1 A;  2OZS A;  3THY B;  2I5J A;  4BRD A;  4FWN A;  4O4G A;  3VEW A;  3PSI A;  4PL7 A;  1VQL N;  4OKJ A;  4B08 A;  4GV9 A;  5KQD A;  3R9P A;  3C65 A;  3IKM A;  3SUP A;  2HF3 A;  5AQW A;  1RBT A;  4CHO A;  4YOR A;  3MMV A;  3TTF A;  3VN5 A;  3HSC A;  3J7Z O;  1S5J A;  4NXM K;  1FW6 A;  3A5M C;  3D2E A;  4A2A A;  5I3U A;  2OPP A;  4KH4 A;  3TTD A;  3A5O C;  1E3M A;  2O8D B;  1F21 A;  3NVK A;  5H1S Q;  1RT3 A;  4EZ9 A;  4FVU A;  3ZX3 A;  4FO0 A;  3V1O A;  5BR8 K;  4YFU A;  5C2D A;  4CF0 A;  1JLE A;  3THV A;  2ASO A;  4KTQ A;  3AVK A;  4FXD A;  3TAM A;  4LFB K;  4HTL A;  3NH2 A;  3SYZ A;  3CCQ N;  1ATR A;  3D2F A;  4JN4 A;  4A5A A;  3HVT A;  3M6G A;  4LSN A;  2PYJ A;  3VEY A;  1VK0 A;  4R5P A;  5JVG L;  3O9R A;  3MCA B;  2A41 A;  1RBU A;  1B92 A;  3EYZ A;  3E9O A;  4BRE A;  4PY5 A;  1EWR A;  4LF8 K;  4YHH K;  1KFS A;  1BDG A;  4I6M B;  5CYM A;  2I7P A;  3GBT A;  3NVM A;  4BDZ A;  3AO5 A;  3CCR N;  4H5R A;  3S3M A;  3IFR A;  3RVC A;  1QSS A;  4E7J A;  1GLB G;  5KPR A;  3ALY A;  1NKC A;  1BCM A;  3THX B;  4BY9 C;  3UKR A;  4FJX A;  5AQT A;  5AQX A;  5HRS A;  3SAF A;  4BR4 A;  3EN9 A;  4BRK A;  4M3Z A;  2P51 A;  2HHX A;  3G4S N;  4OKK A;  3F2K A;  2KLA A;  3HP6 A;  5HOO A;  3S3N A;  1VQP N;  1BI4 A;  4CHP A;  4FWK A;  1S9G A;  1XWL A;  3SMP A;  4QS7 A;  3DRS A;  4F8R A;  1JXB A;  2YHX A;  3HPH A;  3VQ7 A;  4JYA K;  2Q3S A;  1C0G A;  3WXK A;  4Z4C A;  4FWQ A;  1SL0 A;  1K6Y A;  1QTM A;  4FM1 A;  3SAG A;  4XEI A;  4KKO A;  2IGI A;  3PUF A;  3QIC A;  4LF9 K;  3HYF A;  5CYQ A;  3IG1 A;  3V81 A;  3CQX A;  3L6Q A;  4F2R A;  4KI6 A;  1JLA A;  1K9M O;  1W9H A;  4EP4 A;  4KO0 A;  4NYN A;  3VF6 A;  3ZYY X;  2E2Q A;  1WBB A;  2RHK A;  4CIG A;  3FLC O;  2OCE A;  3O9T A;  1K8K B;  3IMX A;  3O8M A;  4YOW A;  5F2R A;  3D0P A;  3P39 A;  1ASV A;  2GBZ A;  1W97 L;  1NGD A;  3O4N A;  2ZJR L;  3Q7C A;  4FLV A;  4FW2 A;  5ADX A;  3MN6 A;  4CF8 A;  1QSL A;  1RTJ A;  3CHW A;  1IKV A;  3AA4 A;  3K0S A;  1BIZ A;  1J53 A;  1NG9 A;  3FZF A;  1ZYQ A;  1CLQ A;  1JLC A;  1MA9 B;  4BGA A;  1I94 K;  3DJC A;  3LP0 A;  1B9F A;  3LP3 A;  1T7P A;  1ZBF A;  1UA0 A;  5C25 A;  1TK0 A;  1NK7 A;  4ISE A;  4B1X B;  4X66 K;  4BE2 A;  2UU9 K;  4QAG A;  1KAX A;  4H5V A;  4LD0 A;  3VET A;  3HJF A;  4FZY A;  1Q82 O;  1TKD A;  1WLJ A;  5FPD A;  5FRN A;  2NRV A;  5SZT A;  2KQ2 A;  1VSH A;  4C1N K;  1Z6R A;  3LM9 A;  4IO8 A;  3EY1 A;  5AQP A;  3OS0 A;  1HRH A;  1SQK A;  3L0Q A;  4NO7 A;  4DV2 K;  2IDO A;  2A40 A;  3CD6 N;  1XHZ A;  2ZJP L;  1TUY A;  4H5T A;  4UY8 O;  5JVH L;  3QFU A;  3L4I A;  4DR6 K;  3VER A;  4DSK A;  1VSK A;  1GLA G;  4C8O A;  1NNE A;  2YNG A;  1TL3 A;  4JI0 K;  2JWL A;  2PY5 A;  4NXN K;  3ZSX A;  3VQ5 A;  2QTD A;  1QE1 A;  3KTQ A;  3NCI A;  4DV6 K;  2QXF A;  2FSK A;  3AAQ A;  2DTU A;  3LL3 A;  1P90 A;  4CJ4 A;  3K5L A;  2GUP A;  4B1U B;  3SJH A;  2W41 A;  2YCH A;  1FK9 A;  4CZG A;  1BU6 O;  3E9P A;  5EX5 A;  4K43 A;  5KPT A;  4E7L A;  3T3F A;  4E3S A;  4KHW A;  3LPU A;  4CD1 A;  5TKY A;  4I6M A;  3LPT A;  2AP1 A;  1C1C A;  4CJE A;  1IKX A;  4E1M A;  1JL2 A;  1NGA A;  3F5T A;  1Z25 A;  4DTM A;  1A5X A;  3MEG A;  4F2S A;  3OYK A;  3TAF A;  1KVA A;  4FJH A;  3ATU A;  1TKX A;  2HHW A;  1XI1 A;  2D0O A;  1IO2 A;  2NRT A;  1EKE A;  3KLG A;  4FJM A;  3G0Z A;  5LMU K;  3AA2 A;  4I2Q A;  3VPZ A;  5BRF A;  1HJR A;  3CG7 A;  5FRO A;  4BGB A;  1YJ9 N;  1LWC A;  5AQO A;  2ETJ A;  1SV5 A;  4FWM A;  4IJN A;  3WXI A;  2G8K A;  3VQ8 A;  4BRF A;  5BPN A;  4KH5 A;  4DR4 K;  4BRA A;  1C1B A;  3WXL A;  4OPJ A;  4U67 L;  4B1Y B;  2CGK A;  4DQR A;  2IVP A;  3K57 A;  4FCY A;  4RW6 A;  3EO3 A;  3H1Q A;  2ZWH A;  5C0Y A;  3VEX A;  1BCO A;  3I0R A;  3AVC A;  3H45 C;  3E66 A;  3P5J A;  2D0C A;  1R0A A;  4GV6 A;  2VQE K;  1XQS C;  3VOV A;  1TUU A;  2Q31 A;  3AGR A;  1VQO N;  1HKC A;  4KHP K;  2BGG A;  2HF4 A;  4BR5 A;  2AJQ A;  4OPA A;  2WBN A;  2E2O A;  1ASW A;  1OKJ A;  3MCP A;  2V52 B;  4IEE A;  3CXC M;  3HVR A;  5AFU H;  4DR3 K;  2IVO A;  2Z1G A;  4YDU C;  2NLX A;  5AQV A;  3SJJ A;  4M45 A;  4KH6 A;  1TK8 A;  5J2Q A;  2KTQ A;  4DSF A;  2RPI A;  3VEV A;  4FJK A;  3ZEU B;  2P9I B;  4ELT A;  3SV4 A;  2D5R A;  2YKN A;  1EQY A;  3O08 A;  2G8I A;  4M7X A;  1HX1 A;  3FR0 A;  1MWM A;  1ZBI A;  1T8E A;  1GOC A;  4CJ5 A;  4NCB A;  3S9H A;  1HKG A;  3OTO K;  5J2N A;  1SZ2 A;  2RN2 A;  3VQ6 A;  2CGL A;  3S3O A;  1VQK N;  2Q0U A;  4XIU A;  1VSD A;  4K41 A;  4CK3 A;  5BPM A;  3KKR A;  2FXU A;  4FSV A;  1NKE A;  3K5M A;  3AVN A;  4KRF A;  3ZSW A;  1XUP O;  1SL2 A;  4I9L A;  4BRL A;  1SKS A;  3TR8 A;  5AQZ A;  4E19 A;  1A5W A;  4CVN E;  4ZTJ A;  4DB3 A;  1ZC6 A;  1LV5 A;  5GAG P;  1C0U A;  2NRH A;  1X9S A;  4H0V B;  1JLG A;  4BC3 A;  4A57 A;  3OYA A;  4F4K A;  4FLY A;  3ULE A;  4BC5 A;  2HHQ A;  1S1U A;  2WTU A;  2Q36 A;  1QZ6 A;  1L3S A;  1C6V A;  1RT5 A;  4G1Q A;  1L3U A;  2A1R A;  1KLM A;  2GTD A;  4OGC A;  5ELZ A;  4CER A;  3AVG A;  3K9J A;  3ZT0 A;  1G15 A;  3ZX0 A;  4JD2 A;  2HHV A;  2I7N A;  3OYD A;  2G8V A;  1RT1 A;  2UUB K;  4CJL A;  3TPQ A;  4BRO A;  3K5O A;  3G10 A;  2F4V K;  4DV3 K;  4JI8 K;  4CBX A;  1GOB A;  1YXQ A;  5JLF A;  1GLE G;  4H4M A;  3EZW A;  4WCE L;  3ZSO A;  3PX6 A;  4DUZ K;  4DTJ A;  2D0B A;  2UXD K;  4NLC A;  1C0F A;  5AQQ A;  3SUQ A;  2A42 A;  3O1W A;  3DLH A;  4JKF A;  3H3N O;  4JI4 K;  2YX6 A;  1EX4 A;  2HBL A;  2FC0 A;  4DSL A;  3JSM A;  3SBG A;  4OPH A;  4B8A B;  2ZGY A;  4H5N A;  2FF3 B;  4DR5 K;  2P1J A;  2QKB A;  3AVJ A;  2HB5 A;  1BL3 A;  4CJF A;  5KRS A;  4FLZ A;  1HNI A;  3V9S A;  4N41 A;  3VMF B;  4FWS A;  1NGF A;  3HZ6 A;  2XRI A;  1RDW X;  2A6A A;  2E1Z A;  4MO5 A;  4DR7 K;  5BRE A;  2YHW A;  3ENB A;  3FZM A;  4AHC A;  3L2Q A;  3THW A;  2P9U A;  2J4R A;  1GLD G;  2A5X A;  3KK1 A;  4B9L A;  3HPO A;  4IZ9 A;  5BRH A;  3FZK A;  3TAB A;  3VEO A;  4IFY A;  3HM8 A;  4HCC A;  3C7N A;  5CY4 A;  4M3Y A;  1G99 A;  3L4Q A;  2RF2 A;  4FLT A;  2O8B B;  5BPL A;  1TK5 A;  1KLN A;  3WNF A;  3VES A;  1Q8I A;  1V4T A;  4KRE A;  1D9D A;  3L3U A;  4OJR A;  3ZSQ A;  4CJW A;  3FE1 A;  2ZGZ A;  3OJS A;  4X65 K;  1WSI A;  5C42 A;  3M1F A;  4E7H A;  1REV A;  1HMV A;  1OH7 A;  3CPE A;  5C12 A;  1C1A A;  2UUA K;  4EIA A;  1O13 A;  3JS6 A;  2FSN A;  5BN9 A;  4FLX A;  3U9D A;  4O55 A;  4ISF A;  3NDK A;  3Q7B A;  1YIJ N;  3LZJ A;  1VSL A;  1GLC G;  3NGZ A;  1OH8 A;  3DLK A;  4BR2 A;  5HRN A;  5BRD A;  5GAH P;  1WNS A;  3W0L A;  4W5N A;  1SL1 A;  3G6E N;  2FBT A;  3LAM A;  1YUW A;  4LF5 K;  4Z4E A;  2PZS A;  4WE1 A;  3BF3 A;  4DCH A;  3VEN A;  3NGY A;  2VQF K;  2BUP A;  4A2B A;  2BH1 A;  3A2F A;  1IBL K;  3LAL A;  3OY9 A;  4DQQ A;  3NBP A;  3KIO A;  1FJG K;  4CZM A;  2YHB A;  2D4W A;  3PIP L;  2P9N A;  3GOI A;  2P9P A;  5E41 A;  5IWA K;  3RSE B;  3U9Z A;  4B3T K;  5FPN A;  3HOT A;  2DPN A;  4B9V A;  2HHS A;  4CFD A;  5HL7 L;  3RRG A;  3OYM A;  2ZM6 K;  2YNI A;  4FJ7 A;  3O9U A;  4CIE A;  1BQN A;  4DMN A;  2ASP A;  5DK5 A;  3KHY A;  4Y1D A;  2OPQ A;  2P9K A;  1X9J A;  3E1Y A;  5JS2 A;  4KHN A;  1ATN A;  3NFA A;  3P38 A;  1U49 A;  4H5W A;  4FJN A;  1FKP A;  3OVN A;  4KHQ A;  1KSP A;  4JHD A;  2ZF5 O;  1VRU A;  4JKD A;  4DTS A;  4J2B A;  4JKG A;  4B3R K;  1T6C A;  4YOV A;  3KD1 E;  3M8Q A;  4PHT X;  1SAZ A;  3HI0 A;  3E01 A;  5AQR A;  4BRI A;  1BWF O;  3WXJ A;  2ATQ A;  3HM9 A;  3WT0 A;  1WB9 A;  4FOE A;  1XMQ K;  3SPY A;  1MDU B;  1W0H A;  3PLA A;  5KI6 A;  2D0P A;  3M8R A;  4CE9 A;  2ITM A;  1XMO K;  3O9Q A;  4FWL A;  3OYF A;  3JYT A;  4JKH A;  1TGO A;  1S1W A;  4DTN A;  4KFB A;  4B9T A;  1Y97 A;  4WQ5 C;  3AVL A;  4W5O A;  3QEX A;  3RMC A;  2NZT A;  2D1K A;  1NK6 A;  4CZE A;  4LC9 B;  3NAE A;  1KCF A;  2FF6 A;  4DR2 K;  1BIU A;  3ZT3 A;  3BUZ B;  4BRC A;  4CGJ A;  1K8A O;  2E2N A;  4C8N A;  2V7Y A;  3CM5 A;  3K5N A;  3K59 A;  2UXC K;  1KRP A;  4DU3 A;  1WSH A;  1T03 A;  4IJA A;  3TAN A;  5CZ2 A;  2P9S B;  1S1X A;  4CHN A;  3NF6 A;  2F9W A;  4NCG A;  3TAE A;  3RMB A;  3M3Z A;  4CEQ A;  1YTU A;  4CEZ A;  2A3Z A;  4PL8 A;  4CEO A;  5HP1 A;  3O3G A;  1RBS A;  4CZJ A;  4ID1 A;  3AA5 X;  1S72 N;  1OH6 A;  2WON A;  3LDO A;  4N47 A;  3QEP A;  4J8F A;  3OS1 A;  4E7I A;  1LWF A;  3VGM A;  4AM7 A;  1WSF A;  3L2U A;  5AZI B;  1BOT O;  3OHR A;  4Z0U A;  1NJX A;  2Z1I A;  1Q9Y A;  1ZXO A;  4CW7 B;  3BZC A;  2OPR A;  3T1Y K;  3L3V A;  1U2V B;  4HWI A;  1RBR A;  2P9L B;  4CGG A;  1QZ5 A;  3DLL L;  2KHO A;  4BR7 A;  3EKU A;  3UKU A;  1HQE A;  2GEM A;  2HST A;  1R59 O;  1EET A;  3ZT4 A;  2QWN A;  3CC4 N;  3TWH A;  5GIN A;  4DQS A;  4G9Z A;  1DTQ A;  3PX0 A;  3SV3 A;  3K9K A;  1DTT A;  4YDU A;  1NK0 A;  4W5Q A;  1NK9 A;  4BR0 A;  4DV5 K;  4Z4H A;  4OGE A;  1YJN N;  1LAV A;  4Y0W A;  4PKH A;  1TYQ A;  3A8Y A;  4B3O A;  3WXM B;  3DWL A;  4JI1 K;  5EXW A;  3OYL A;  1T3V A;  4FJ9 A;  1J6Z A;  2GV9 A;  4CEF A;  5AJ3 K;  2HNZ A;  3CCV N;  2O8E A;  4JNE A;  1KC8 O;  4CBW A;  3SAH A;  4QS8 A;  3L2W A;  2OTJ N;  4RWT A;  1H1V A;  3V9W A;  2IS3 A;  5CE3 A;  3P1G A;  2Y1J A;  5HRO A;  4IO9 L;  3AVM A;  3RSE A;  1VSE A;  3THY A;  3QDK A;  4DFP A;  5AFU A;  4CHQ A;  5KTQ A;  2OPS A;  1KFD A;  3QB0 A;  3HO1 A;  1SKW A;  1HYZ A;  5EVZ A;  3T1H K;  4DQ8 A;  3AGK A;  1P8Z A;  3WEE B;  4M3R A;  3VA0 A;  3QEV A;  2EWS A;  2HVI A;  2FBX A;  4KHU A;  4F3T A;  3BGR A;  3MN7 A;  4ICL A;  1NGH A;  4E7K A;  4BDP A;  4MO4 A;  4CF1 A;  4FWO A;  4BG9 A;  4HUG A;  3KZB A;  4FM2 A;  3SPZ A;  3MX2 A;  1S9E A;  2RE2 A;  3QNN A;  3SNN A;  4C23 A;  4DTR A;  4ILG B;  2O8D A;  1V4S A;  4EFH A;  3NGI A;  1L3T A;  3LDN A;  4KAZ A;  4DFK A;  4Q0B A;  3DXK B;  3J8A A;  3KD5 E;  3LAN A;  4JI2 K;  4Z94 A;  1IH7 A;  5AR0 A;  2HBK A;  5LMN K;  3OYB A;  5C10 A;  1JLB A;  1WOQ A;  3ID6 A;  2HMI A;  3DOL A;  1T6D A;  5HLF A;  1KD1 O;  4LFC K;  1WAF A;  3SBT A;  2QWO A;  3QES A;  4E89 A;  2YI1 A;  4N5S A;  3H6E A;  2GWK A;  1ZBS A;  4JKE A;  3RR8 A;  5LJW A;  2AA4 A;  4DKW A;  4B9S A;  1GLL O;  1RT2 A;  3QBW A;  1ZBH A;  5C2F A;  5AQK A;  4CJU A;  4CBU A;  2FSJ A;  1HLU A;  1QSY A;  2O8C B;  4C8K A;  1HYS A;  4HCB A;  2A1S A;  1RT7 A;  2VWJ A;  2H3G X;  2KZM A;  5F1X A;  5AQU A;  4DQI A;  5AQF A;  1LAW A;  4B8C A;  4KB0 A;  3PIO L;  3T69 A;  4EP5 A;  3LM2 A;  1KXP A;  3D45 A;  5I9E B;  3M8P A;  2OYQ A;  1C0M A;  5B8H A;  3THX A;  2BDP A;  3EL2 A;  3I0S A;  2F96 A;  3QBX A;  3CCE N;  1I39 A;  4ELU A;  4YNQ A;  2NRX A;  3RRH A;  4DLE A;  4ELV A;  3D7E O;  3PO4 A;  1UA1 A;  5KQ8 A;  4H0P A;  4Z4G A;  3KVG A;  4IDK A;  3CCJ N;  4FZZ A;  1WBD A;  4A62 A;  2KFN A;  3LDS A;  4XH1 A;  4AM6 A;  3OYH A;  5AQH A;  4JLH A;  2YV0 X;  4QOZ B;  2F8S A;  1GOA A;  1OVY A;  1WSG A;  3V6D A;  2E6L A;  4JI3 K;  4IKF A;  2W6L A;  4KBO A;  4MQ3 A;  4GKJ K;  2NRZ A;  1HUX A;  4DFJ A;  1WUA A;  3F9K A;  2B4J A;  3ZSR A;  1U48 A;  2E2P A;  3TAP A;  4AF1 A;  4ILH A;  3OYI A;  1BIS A;  1KVC A;  3J80 O;  4CHZ A;  4DSE A;  4CJT A;  3SCX A;  1VQM N;  4BRQ A;  1L5U A;  3AVI A;  1NU0 A;  4CJV A;  2P5O A;  4NLB A;  2YNF A;  4JI7 K;  3ZET B;  3B6O A;  2FBY A;  1RT4 A;  1NOZ A;  3OJU A;  3LWL A;  3V9U A;  3LDQ A;  3LWM A;  1K8K A;  3DXM B;  4QS9 A;  3OW2 M;  3PV8 A;  1D8Y A;  1RBV A;  2E8A A;  3R6M A;  1QS4 A;  4CFA A;  2BTF A;  4LH5 A;  4WQ4 C;  5M1P A;  1K73 O;  3L2R A;  3C94 A;  3SMS A;  3R1X A;  4BG8 A;  2E6M A;  3V9X A;  3TI0 A;  5EOY A;  4L8R B;  1WAJ A;  3JAM O;  4KHS A;  4IFE A;  3VQP A;  1EXQ A;  3ISN C;  5AQY A;  5JMV A;  1RGI A;  3MK6 A;  4DR1 K;  3N4Q A;  5AZJ B;  4IG0 A;  2XY8 A;  3CCU N;  3R3L A;  2WC9 A;  1ESV A;  2KW4 A;  4B1W B;  2YKM A;  2OA8 A;  1NMN A;  2B5J A;  3CJB A;  1A5V A;  5M1N A;  3C6H A;  2IIR A;  2VG6 A;  4KB1 A;  4F9O A;  5AQN A;  3T1A A;  5KPZ A;  4BWM A;  5BN8 A;  3OYE A;  3SQ1 A;  2JWK A;  2HMP A;  3MED A;  5GIO A;  3AY9 A;  4JS4 A;  3CC2 N;  3C6T A;  3VGK A;  4PA1 A;  2EHG A;  1HYV A;  4GVE A;  1VSF A;  3NE6 A;  1EP4 A;  4AHR A;  4DTO A;  1VQ5 N;  5HRP A;  1SUQ A;  3UE5 A;  4B9U A;  4MLH A;  4C8M A;  4WFA L;  1NKB A;  4KI4 A;  4AHT A;  5DM6 L;  5FRM A;  5HRR A;  3VQA A;  3U4L A;  4LFA K;  1WN7 A;  3ZX2 A;  3KJV A;  1HQU A;  4CJR A;  4DHY A;  3LAK A;  4GKK K;  2HHT A;  4CIF A;  4W5T A;  3RMA A;  4BQZ A;  4KTW A;  4NYF A;  1W7A A;  4DQP A;  2QWR A;  3D2E B;  3V1Q A;  1U04 A;  3O6W A;  1NJY A;  4FJI A;  4HUF A;  1YF5 L;  3DYA A;  4PUO A;  5MLC Q;  3P4I A;  2X6S A;  4UQG A;  4WQ5 A;  1YJW N;  3N4P A;  3CQ8 A;  1S3X A;  4X62 K;  2VCP A;  3LP2 A;  4AHU A;  3FGU A;  4CZL A;  4RW7 A;  5KGX A;  1QVG M;  4FLU A;  5K14 A;  1RT6 A;  2JGU A;  4CJP A;  1Q81 O;  3CF5 L;  5LY3 A;  3CME N;  3D2F B;  1GLF O;  4OPK A;  4DS5 A;  2KZZ A;  2PYL A;  3TSU A;  4YY3 K;  4RW8 A;  4ID5 A;  5LJV A;  2YJF A;  3CM6 A;  4GV3 A;  1IJJ A;  1YIT N;  4CI6 A;  3ZT2 A;  4YOY A;  3L2V A;  1FXX A;  1JL1 A;  1X9M A;  2G8U A;  4J2A A;  3FFK B;  3CYM A;  2X6N A;  4I9Q A;  4MFB A;  3AO2 A;  3CJ7 A;  4N56 A;  2ITG A;  5KRT A;  3QO9 A;  3OA9 A;  4K25 A;  2VGN A;  1IG8 A;  2E1Y A;  2ZE2 A;  4AHV A;  1JLF A;  4CZF A;  4CEE A;  1Q9X A;  1NGJ A;  3UKR B;  1B9D A;  3WNE A;  4RG8 A;  1YI2 N;  3IDH A;  1DT9 A;  4GY2 B;  3QML A;  3J7A P;  1KVB A;  3RWU A;  3CPW M;  1BI4 B;  3H46 O;  3IUC A;  3I8D A;  3CC7 N;  1D9F A;  1I3A A;  2QW9 A;  3MXI A;  3QIO A;  3QER A;  3FFI A;  1Q18 A;  5CHI A;  4M41 A;  3AO1 A;  4WFN L;  3KK7 A;  3AVB A;  4NB4 A;  1T05 A;  4JI5 K;  1EO1 A;  3OBY A;  2VG7 A;  1S6P A;  1VSM A;  1N5Y A;  4EAH D;  4I2P A;  1N36 K;  3TSQ A;  4J2E A;  2VG5 A;  4OLB A;  3KWG A;  4JEP A;  3ZEU A;  2P9I A;  5CZ1 A;  1HPZ A;  5A2Q O;  1KTQ A;  4GNI A;  5GAD P;  1BO5 O;  5AQL A;  3WQU A;  2QM1 A;  3BY5 A;  1T44 A;  1VRT A;  4B9Q A;  4CK1 A;  1CXQ A;  4FPA A;  3H1V X;  4CFB A;  4H4O A;  2W42 A;  2QA4 N;  4CJ7 A;  1JJ2 M;  1VHX A;  1XC9 A;  3BDP A;  3O5B A;  4IOX A;  4JKA A;  3AAP A;  4JKC A;  2DFH A;  4CFC A;  1NK8 A;  1N33 K;  3BEX A;  4DV0 K;  1OVQ A;  1ATS A;  1YAG A;  1TL1 A;  4IBN A;  3MX5 A;  4FYD A;  3KWI A;  3HPG A;  2GX9 A;  1U6Z A;  3ULD A;  4NCA A;  4EHU A;  4M42 A;  3NF7 A;  1LWE A;  3CJ1 A;  4K8X A;  3PX4 A;  2E88 A;  4DSI A;  4RW4 A;  4BRH A;  3MN5 A;  4N76 A;  3L8B A;  5FDL A;  2W40 A;  2WFB A;  1NK4 A;  3ASM A;  4EHT A;  2GWJ A;  1YTA A;  4OX9 K;  2R7Y A;  3NF8 A;  5JS1 A;  3KLE A;  1UWB A;  3EEQ A;  2XY7 A;  2YNH A;  4RCH A;  2O4G A;  4L3Q A;  2QXL A;  3EE8 A;  4LF4 K;  1IKY A;  2Y1I A;  3DLR A;  4J2D A;  2YHY A;  4DTX A;  1VQ4 N;  2QWP A;  1WSJ A;  1YVU A;  1JKH A;  1SS6 A;  1NWK A;  4JRP A;  2NUB A;  3VA3 A;  3CFP A;  1YT3 A;  4FK2 A;  4A5B A;  1IV0 A;  1NJI O;  4AH9 A;  1QQN A;  4BVP A;  4CJK A;  3B8A X;  3VEZ A;  5GIP A;  2O4I A;  5M1O A;  1NJZ A;  1N32 K;  2BAN A;  4QCL A;  1NGC A;  2VGM A;  4YOT A;  4OO1 J;  1X1P A;  3A5L C;  4A61 A;  5DM7 L;  3CMA N;  1JLQ A;  3OYG A;  4JRQ A;  3R8E A;  4CGI A;  4PKI A;  4WYB A;  1NJW A;  4FZX C;  4FLW A;  3RTV A;  2G8H A;  4B9M A;  3PSF A;  3OYJ A;  4AHS A;  4DG1 A;  3HK2 A;  4GW6 A;  2HW3 A;  5M1K A;  3SI6 A;  2JLE A;  3VQ4 A;  3RMD A;  4K0K K;  3CFR A;  4IG3 A;  2Z1H A;  4GMJ B;  3NHG A;  3CJ9 A;  4JK8 A;  3SZ2 A;  1X3M A;  3DLE A;  2E5L K;  4CZK A;  1BGX T;  1RDC A;  1FKO A;  2VYP A;  3IS9 A;  3ZSY A;  4R79 A;  1XHX A;  2X74 A;  3A0I X;  3SQ4 A;  4PWD A;  3MEC A;  1W2B M;  4BRN A;  4AIL C;  1N34 K;  2O8B A;  1GLJ O;  1IBM K;  4FWP A;  1J54 A;  3TU5 A;  4C1N I;  3QEI A;  1RDU A;  3HBT A;  4MLE A;  2OZM A;  1KAZ A;  4X64 K;  4BAC A;  2HBM A;  2ASM A;  2YHA A;  3VTH A;  3M5R A;  3DRP A;  1LW0 A;  1CXU A;  3G25 A;  3LDP A;  4ZTF A;  1LOT B;  4FJ5 A;  2KFZ A;  4LF7 K;  4YOX A;  3EZ5 A;  2F8T A;  2UUC K;  3ZLJ A;  4H0O A;  1L3V A;  4DU1 A;  1DLO A;  4C8L A;  1E4G T;  4CCH A;  4ILJ A;  2RKI A;  3KLH A;  4IOC L;  3O4W A;  3QIN A;  4WQ4 A;  4CJQ A;  2W6K A;  3T7Z A;  4ISG A;  1VQ8 N;  4DV4 K;  1HNX K;  3F73 A;  1DEJ A;  2HOE A;  4AQY K;  3DRR A;  4H03 B;  4BE0 A;  2DFE A;  2QI2 A;  1TKT A;  3ID8 A;  1Z26 A;  1BHL A;  3H3O B;  4CGH A;  4LH4 A;  2KKZ A;  2E4L A;  3E9L A;  3VQE A;  4RTF D;  3HXM A;  1QQC A;  3U8X A;  4K42 A;  4YOU A;  3HRG A;  2WOM A;  3CCL N;  3MXJ A;  5M1F A;  1RDD A;  1NGB A;  1RDB A;  3LZI A;  4H0X B;  2WUS A;  3WNH A;  2GUI A;  3BZK A;  1S22 A;  1NOY A;  2UXB K;  4DS4 A;  5AQM A;  2E20 A;  1IBK K;  2IC3 A;  5J2P A;  2VWK A;  4H8K A;  3U6F A;  1NGE A;  3TAR A;  2Q1N A;  1IG9 A;  1N8R O;  4BQL A;  1BG3 A;  2ZQB A;  3AO3 A;  3CJA A;  3DM2 A;  5M1Q A;  4ZHR A;  4DTU A;  1LCU A;  1CZ9 A;  3OS2 A;  3DAW A;  5IT9 O;  4E0D A;  4E1N A;  3RR7 A;  4XH4 A;  3KLI A;  1RTH A;  1DKG D;  3K2P A;  2Q2R A;  4DF4 A;  2LSN A;  1ASU A;  3HOS A;  4FPB A;  4CEA A;  4Y1C A;  5J2M A;  1KAY A;  3ULE B;  2HVH A;  5LL6 Z;  3HL8 A;  4KPY A;  3AVH A;  4FJ8 A;  2QK9 A;  1TKZ A;  3KKS A;  4FJJ A;  4HVJ A;  2CH6 A;  4B3M K;  4PQU A;  4FOI A;  4KTZ A;  3MDQ A;  1J5E K;  3MWT A;  4CZI A;  4JD2 B;  1XC3 A;  4CHY A;  4E1J A;  3I56 N;  2G8F A;  2P5G A;  2O8F B;  3C6A A;  4DTP A;  3F9M A;  1JXE A;  3B6P A;  3O4Q A;  1MWK A;  3SQ2 A;  4KV8 A;  3KK2 A;  3UIQ A;  3MXM A;  1JCG A;  1BA1 A;  3DI6 A;  1YHQ N;  1KQS M;  2G8W A;  1HNV A;  1VSI A;  1TV6 A;  3MEE A;  3O3H A;  2P9S A;  1NK5 A;  2NRW A;  4DU4 A;  3EE9 A;  1M1K O;  5DMR A;  1UAX A;  4O5F A;  4DWI A;  1HKB A;  5GAE P;  1S6Q A;  3ZCM A;  3DLG A;  2QEX N;  5HBM A;  4O8U A;  3QIP A;  5E84 A;  4TSX A;  4M3W A;  1D5A A;  4CED A;  1J5O A;  3TAG A;  1HNW K;  3IAY A;  3ZT1 A;  3VQD A;  1DGK N;  3NH0 A;  1O1W A;  4B1V A;  5AZI A;  3U3Y A;  4IEI A;  3CET A;  4CF9 A;  5T7B A;  1QHA A;  4WFB L;  2UYT A;  3THW B;  3O3F A;  2DFF A;  4CES A;  2P9U B;  3ATV A;  4CGF A;  4FJG A;  4M7Y A;  2X78 A;  1U2V A;  2P9L A;  1BQM A;  4CJ3 A;  1RFQ A;  3C7N B;  3SK3 A;  4KHY A;  1SKR A;  2F7T A;  4Q5V A;  1BUP A;  3HT3 A;  1CZB A;  4JKB A;  4FW1 A;  5BR9 A;  2VWB A;  3KLF A;  1M90 O;  4FK4 A;  3O80 A;  1WSE A;  3CCS N;  4IDH A;  4CK2 A;  3WUH A;  2GEL A;  2PAV A;  3CER A;  3GDQ A;  2IAJ A;  4F3O A;  4LF6 K;  1BA0 A;  1OH5 A;  2V7Z A;  4IFV A;  4CJS A;  5C15 A;  5AQG A;  2QWL A;  2HBJ A;  5ADX H;  3CI5 A;  5I42 A;  1RIL A; 
#chains in the Genus database with same CATH homology
 1KAX A;  3UKR B;  4H5V A;  4WQ5 C;  3VET A;  1Q82 O;  2NZT A;  2D1K A;  3CCM N;  4CZE A;  5FPD A;  1YI2 N;  4LC9 B;  3TTC A;  2NRV A;  3IDH A;  2FF6 A;  1DT9 A;  4B1Z A;  1VAZ A;  4BRC A;  1Z6R A;  3BUZ B;  3LM9 A;  4IO8 A;  4C1N K;  2E2N A;  1K8A O;  4GY2 B;  5AQP A;  2V7Y A;  3QML A;  1SQK A;  1E4F T;  5FPE A;  4IJA A;  3BF1 A;  3CPW M;  2ZJQ L;  3H46 O;  2P9S B;  3IUC A;  3MN9 A;  3L0Q A;  3CC7 N;  4NO7 A;  4PKG A;  2QW9 A;  2F9W A;  2A40 A;  3D6R A;  3CD6 N;  2ZJP L;  1TUY A;  4H5T A;  4UY8 O;  5JVH L;  3M3Z A;  1Q18 A;  3L4I A;  3QFU A;  3WEE A;  5CHI A;  3NMU A;  3VER A;  3TSP A;  2A3Z A;  4PL8 A;  4WFN L;  4H0T B;  2Q97 A;  1GLA G;  3KK7 A;  2P9N B;  3OBW A;  2P9P B;  4NB4 A;  3VF2 A;  1EO1 A;  3OBY A;  4MDB A;  4CZJ A;  3SLC A;  2JWL A;  1VQN N;  1S72 N;  3CJC A;  3LDO A;  4FWR A;  4J8F A;  2QTD A;  4EAH D;  3O9S A;  3TSQ A;  3VGM A;  4AM7 A;  3KWG A;  3FZH A;  3CQY A;  1Q86 O;  4JEP A;  2FSK A;  3AAQ A;  5AZI B;  3ZEU A;  1BOT O;  2P9I A;  3LL3 A;  3OHR A;  1NGG A;  1P90 A;  4M63 C;  1ILY A;  4GNI A;  5GAD P;  2GUP A;  5E26 A;  4B1U B;  1BO5 O;  2YCH A;  2W41 A;  5AQL A;  3SJH A;  1ZXO A;  4U7B A;  2P9K B;  3WQU A;  2QM1 A;  3EKS A;  4CZG A;  1BU6 O;  1T44 A;  3E9P A;  5EX5 A;  4K43 A;  4B9Q A;  4BR9 A;  1X3N A;  4BRG A;  1U2V B;  4FPA A;  4HWI A;  3DXK A;  5KPT A;  2P9L B;  3H1V X;  3UB5 A;  2F9T A;  2QA4 N;  4CJ7 A;  1QZ5 A;  3JXU A;  3DLL L;  1JJ2 M;  4CD1 A;  2KHO A;  5TKY A;  4I6M A;  3VTI A;  4BR7 A;  2AP1 A;  3EKU A;  3UKU A;  1Z05 A;  4JHD B;  1NM1 A;  2GEM A;  3O5B A;  4IOX A;  3AAP A;  2HST A;  1R59 O;  4JKA A;  4JKC A;  2QWN A;  3CC4 N;  1NGA A;  5GIN A;  3BEX A;  3MWP A;  4BC4 A;  4JKG B;  3F5T A;  1YVN A;  1ATS A;  1YAG A;  4G9Z A;  4CD3 A;  4JK9 A;  3MX5 A;  3ATU A;  3K9K A;  3KWI A;  2D0O A;  2GX9 A;  2NRT A;  1U6Z A;  4EHU A;  3FZL A;  3GE1 A;  4YDU A;  4O8K A;  3CJ1 A;  3W3D A;  3C0B A;  5EY4 A;  3VPZ A;  4BR0 A;  5BRF A;  5AQS A;  1YJN N;  2E88 A;  5AQI A;  4BGB A;  4Y0W A;  1YJ9 N;  4BRM A;  4PKH A;  1TYQ A;  5AQO A;  3MN5 A;  3A8Y A;  4BRH A;  4FWM A;  4IJN A;  2W40 A;  4XH5 A;  2WFB A;  3DWL A;  3WXM B;  3WXI A;  5EXW A;  3S41 A;  4BRF A;  4EHT A;  5BPN A;  1T3V A;  2GWJ A;  4KH5 A;  2PFU A;  4FL9 A;  1J6Z A;  4BRA A;  3WXL A;  4U67 L;  2Q0R A;  4B1Y B;  2CGK A;  3LDL A;  3CCV N;  4JNE A;  2IVP A;  4IWV A;  1KC8 O;  4CBW A;  1NBW A;  4RCH A;  3SAH A;  4QS8 A;  2OAN A;  2OTJ N;  3EO3 A;  4L3Q A;  3H1Q A;  2FLO A;  2ZWH A;  5C0Y A;  2QXL A;  3VEX A;  4RWT A;  1H1V A;  3EE8 A;  2YHY A;  5CE3 A;  1VQ4 N;  2QWP A;  3H45 C;  4IO9 L;  3E66 A;  5JLH A;  1SS6 A;  1NWK A;  3RSE A;  3QDK A;  4GV6 A;  3I33 A;  4A5B A;  5AFU A;  2NRR A;  1NJI O;  1XQS C;  3QB0 A;  3VOV A;  4BVP A;  1NLV A;  1QQN A;  1TUU A;  2Q31 A;  3AGR A;  1VQO N;  1HKC A;  2V51 B;  5EVZ A;  3B8A X;  3I8B A;  4DQ8 A;  3AGK A;  1P8Z A;  3VEZ A;  5GIP A;  3WEE B;  2HF4 A;  2EWS A;  4BR5 A;  5M1O A;  3MN7 A;  1NGH A;  1NGC A;  2VGM A;  4OPA A;  3A5N C;  4YOT A;  4OO1 J;  3A5L C;  1Y64 A;  2YJE A;  4A61 A;  2WBN A;  4MO4 A;  2E2O A;  5DM7 L;  4FWO A;  4BG9 A;  1QVF M;  3KZB A;  1OKJ A;  3MCP A;  2V52 B;  4IEE A;  3CMA N;  2QWQ A;  3CXC M;  5AFU H;  2IVO A;  4YDU C;  2NLX A;  3MX2 A;  3R8E A;  5AQV A;  2PBD A;  2RE2 A;  4BRP A;  4KH6 A;  4PKI A;  4WYB A;  3GG4 A;  3O1B A;  3VEV A;  4C23 A;  3ZEU B;  5FPM A;  2P9I B;  4ILG B;  3WQT A;  3ENO A;  4WF9 L;  1V4S A;  3AAR A;  4EFH A;  1JCF A;  1QQM A;  1EQY A;  3O08 A;  4IXC A;  5M1K A;  4M7X A;  3LDN A;  1HX1 A;  3HTV A;  3FR0 A;  1VQ6 N;  1MWM A;  1HPM A;  3DXK B;  3J8A A;  4Z94 A;  4IOA L;  3ENH A;  1NMD A;  5AR0 A;  2HBK A;  3CJ9 A;  4JK8 A;  5TKW A;  3ZET A;  1VQ7 N;  3UKU B;  3G71 N;  1X3M A;  1HKG A;  5C10 A;  1SZ2 A;  3VGL A;  2CGL A;  4CZK A;  1HJO A;  1VQK N;  1WOQ A;  2Q0U A;  3ID6 A;  2QWM A;  4JAX A;  2CH5 A;  4MDA A;  3CIP A;  4CZH A;  5JIC A;  1T6D A;  1KD1 O;  2VYP A;  3DXM A;  3SBT A;  4R79 A;  4K41 A;  2QWO A;  5BPM A;  3A0I X;  2FXU A;  2YI1 A;  4FSV A;  5CR4 A;  3BP8 A;  3H6E A;  5F0X A;  1Q7Y O;  1XUP O;  1D4X A;  2GWK A;  2IVN A;  4BRN A;  1W2B M;  1ZBS A;  4JKE A;  4BRL A;  5LJW A;  5AQZ A;  1GLJ O;  2AA4 A;  4FWP A;  4DKW A;  2OTL N;  4DB3 A;  4C1N I;  3TU5 A;  2CGJ A;  1ZC6 A;  5GAG P;  1GLL O;  1RDU A;  3HBT A;  4MLE A;  3QBW A;  1KAZ A;  2NRH A;  5C2F A;  4H0V B;  2HBM A;  5AQK A;  2ASM A;  4BC3 A;  4CBU A;  3I55 N;  3VTH A;  4A57 A;  1TYQ B;  1VQ9 N;  3M5R A;  2FSJ A;  3VF4 A;  3ULE A;  4BC5 A;  1HLU A;  3QFP A;  5AZJ A;  3G25 A;  3LDP A;  2H3G X;  1LOT B;  2Q36 A;  4H0Y B;  1QZ6 A;  5F1X A;  5AQU A;  1QQO A;  5AQF A;  1NGI A;  3P31 A;  5AQJ A;  3T69 A;  3PIO L;  4BVO A;  3LM2 A;  1KXP A;  4YOX A;  1CZA N;  2GTD A;  4A59 A;  5ELZ A;  4BC2 A;  3K9J A;  4JK7 A;  2NNW A;  3ZX0 A;  4JD2 A;  5I9E B;  2I7N A;  4H0O A;  5B8H A;  3EL2 A;  3TPQ A;  1JCE A;  1E4G T;  3GL1 A;  3QBX A;  4ILJ A;  4BRO A;  3CCE N;  4IOC L;  2NRX A;  3O4W A;  4FWN A;  4BRD A;  4CBX A;  3D7E O;  3VEW A;  1YXQ A;  5JLF A;  5KQ8 A;  4WQ4 A;  4PL7 A;  4H0P A;  3KVG A;  1GLE G;  3EZW A;  4WCE L;  1VQL N;  3T7Z A;  3CCJ N;  4ISG A;  4A62 A;  1VQ8 N;  4XH1 A;  4AM6 A;  4GV9 A;  1DEJ A;  5KQD A;  3R9P A;  3C65 A;  3IKM A;  4NLC A;  2HOE A;  5AQH A;  1C0F A;  4H03 B;  2HF3 A;  5AQQ A;  2QI2 A;  5AQW A;  3ID8 A;  4YOR A;  3H3O B;  2A42 A;  1OVY A;  3O1W A;  3MMV A;  4JKF A;  3TTF A;  3H3N O;  3HSC A;  3J7Z O;  2KKZ A;  3E9L A;  2YX6 A;  4KBO A;  2HBL A;  4RTF D;  2NRZ A;  1HUX A;  3A5M C;  3D2E A;  3SBG A;  1WUA A;  4OPH A;  3U8X A;  4A2A A;  4KH4 A;  4K42 A;  3TTD A;  4YOU A;  3HRG A;  2E2P A;  3A5O C;  3CCL N;  2ZGY A;  4H5N A;  4AF1 A;  2FF3 B;  4ILH A;  5M1F A;  1NGB A;  4H0X B;  2WUS A;  3NVK A;  5H1S Q;  4FVU A;  1S22 A;  3ZX3 A;  3VMF B;  5AQM A;  2E20 A;  4FWS A;  1NGF A;  4FO0 A;  3HZ6 A;  1RDW X;  5C2D A;  2A6A A;  1NGE A;  2E1Z A;  4MO5 A;  5BRE A;  2YHW A;  1VQM N;  2Q1N A;  4BRQ A;  3ENB A;  3FZM A;  4NLB A;  3ZET B;  2ASO A;  1N8R O;  2P9U A;  1BG3 A;  4BQL A;  3CJA A;  2J4R A;  1GLD G;  2A5X A;  5M1Q A;  4IZ9 A;  5BRH A;  1LCU A;  3FZK A;  3LDQ A;  4HTL A;  3DAW A;  3VEO A;  3CCQ N;  1K8K A;  3DXM B;  1ATR A;  3D2F A;  4JN4 A;  4QS9 A;  4A5A A;  3HM8 A;  3OW2 M;  4XH4 A;  3C7N A;  3M6G A;  2E8A A;  3R6M A;  3VEY A;  1G99 A;  2BTF A;  1DKG D;  3L4Q A;  4WQ4 C;  5M1P A;  5BPL A;  1K73 O;  3SMS A;  3VES A;  5JVG L;  3O9R A;  3MCA B;  2A41 A;  3R1X A;  1V4T A;  2Q2R A;  3E9O A;  4BG8 A;  4BRE A;  5EOY A;  3FE1 A;  2ZGZ A;  3HOS A;  4FPB A;  4IFE A;  1BDG A;  1KAY A;  3M1F A;  3ULE B;  4I6M B;  5AQY A;  5JMV A;  2I7P A;  1RGI A;  3MK6 A;  3GBT A;  3NVM A;  3N4Q A;  5AZJ B;  3CCR N;  4H5R A;  3CPE A;  3CCU N;  3R3L A;  2WC9 A;  1ESV A;  2CH6 A;  3IFR A;  5C12 A;  3RVC A;  4FOI A;  4B1W B;  4EIA A;  1O13 A;  3JS6 A;  2FSN A;  1GLB G;  3MDQ A;  5BN9 A;  5KPR A;  3CJB A;  3U9D A;  3MWT A;  4CZI A;  4JD2 B;  4ISF A;  1XC3 A;  3Q7B A;  4E1J A;  3C6H A;  5M1N A;  3I56 N;  2IIR A;  1YIJ N;  4BY9 C;  3UKR A;  5AQT A;  5AQN A;  5AQX A;  4F9O A;  5KPZ A;  5BN8 A;  3SAF A;  3C6A A;  4BR4 A;  2JWK A;  2HMP A;  5GIO A;  3AY9 A;  3F9M A;  3CC2 N;  3VGK A;  1GLC G;  1MWK A;  3EN9 A;  4BRK A;  4GVE A;  3G4S N;  4BR2 A;  5BRD A;  5GAH P;  3W0L A;  1VQ5 N;  3G6E N;  1JCG A;  1BA1 A;  1YUW A;  3F2K A;  2KLA A;  3UE5 A;  1YHQ N;  5HOO A;  1KQS M;  4MLH A;  4WFA L;  1VQP N;  5DM6 L;  4FWK A;  3BF3 A;  2P9S A;  2NRW A;  3VEN A;  4DCH A;  3EE9 A;  3SMP A;  3U4L A;  4QS7 A;  1M1K O;  2BUP A;  3ZX2 A;  2YHX A;  4O5F A;  1HKB A;  4DHY A;  1C0G A;  4A2B A;  5GAE P;  2BH1 A;  3WXK A;  2QEX N;  4FWQ A;  4BQZ A;  3SAG A;  4XEI A;  4CZM A;  2D4W A;  4O8U A;  3PIP L;  2P9N A;  2QWR A;  2P9P A;  3D2E B;  3GOI A;  5E84 A;  3O6W A;  3RSE B;  3U9Z A;  5FPN A;  1YF5 L;  3HOT A;  3QIC A;  2DPN A;  5HL7 L;  3CQX A;  5MLC Q;  3L6Q A;  3P4I A;  3O9U A;  4WQ5 A;  1K9M O;  1YJW N;  1DGK N;  3N4P A;  1S3X A;  4B1V A;  5AZI A;  4IEI A;  3CET A;  2VCP A;  1QHA A;  4WFB L;  2UYT A;  2ASP A;  3FGU A;  3VF6 A;  4CZL A;  3ZYY X;  2E2Q A;  3KHY A;  2P9U B;  2P9K A;  3ATV A;  1QVG M;  2RHK A;  1X9J A;  3E1Y A;  4M7Y A;  1U2V A;  1Q81 O;  3FLC O;  3CF5 L;  2P9L A;  1ATN A;  3O9T A;  5LY3 A;  3CME N;  3P38 A;  1K8K B;  3D2F B;  1GLF O;  1RFQ A;  4H5W A;  3IMX A;  3O8M A;  4YOW A;  3C7N B;  3TSU A;  5F2R A;  3SK3 A;  2F7T A;  4JHD A;  3P39 A;  1BUP A;  2ZF5 O;  5LJV A;  4JKD A;  1W97 L;  1NGD A;  2YJF A;  4JKB A;  2ZJR L;  4GV3 A;  1IJJ A;  3Q7C A;  1YIT N;  4JKG A;  1T6C A;  5BR9 A;  5ADX A;  2VWB A;  4CI6 A;  4YOV A;  1M90 O;  3MN6 A;  4YOY A;  3O80 A;  3CHW A;  4PHT X;  4IDH A;  3CCS N;  1SAZ A;  3HI0 A;  5AQR A;  4BRI A;  1BWF O;  3FZF A;  3WUH A;  3WXJ A;  2GEL A;  2PAV A;  1MA9 B;  3CER A;  3FFK B;  3WT0 A;  4BGA A;  3GDQ A;  3DJC A;  4FOE A;  1BA0 A;  1MDU B;  3CJ7 A;  2V7Z A;  5C15 A;  5AQG A;  3OA9 A;  3PLA A;  4K25 A;  2VGN A;  1IG8 A;  2E1Y A;  2D0P A;  2QWL A;  4ISE A;  2HBJ A;  5ADX H;  4B1X B;  2ITM A;  4CZF A;  3CI5 A;  3O9Q A;  4FWL A;  4JKH A;  1NGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...