3BF3A

Type iii pantothenate kinase from thermotoga maritima complexed with product phosphopantothenate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf3A02
5AQKA 4H5VA 1MWKA 3VF2A 3CQYA 1TUYA 3LL3A 5BRFA 3U8XA 4JHDB 2P9NB 1EQYA 1K8KB 1C0FA 4BRNA 3B8AX 2FSJA 4HWIA 5BPLA 1RGIA 1NGEA 3CJ1A 4H0YB 2A40A 3L0QA 3BF1A 5AQJA 1GLEG 5AR0A 3ZEUB 2ASMA 2Q36A 2QWLA 5FPMA 4BC3A 4CBXA 2GEMA 2CH6A 3IDHA 3VGLA 3VENA 4CJ7A 2FSKA 4CD3A 1CZAN 4FWOA 3U4LA 5AQMA 3CIPA 3LDNA 4BRHA 5TKYA 5E84A 5AQYA 1NGGA 1NMDA 4EFHA 3EKUA 4PKGA 3EZWA 5BPNA 5JLFA 2A5XA 3TPQA 3WEEB 4CZMA 3A5NC 4KBOA 5KQDA 3FZKA 1Z6RA 4H0OA 3CERA 3VETA 1TYQA 3LDOA 3TU5A 1SZ2A 3FGUA 2P9KB 2GUPA 3S41A 3ZX2A 1KAXA 3ATUA 5AQUA 5F1XA 1S3XA 4BG8A 4M7YA 3A5MC 5F0XA 2AP1A 4B1ZA 3L4IA 4H5RA 3LM2A 5AZIA 3O08A 5AQOA 3VGKA 2YI1A 5BN8A 1NM1A 3P4IA 2I7NA 1SAZA 4JD2A 4H0VB 1T6CA 4JHDA 2P9NA 3O1WA 3ENHA 3U9ZA 1K8KA 1NGIA 1QZ6A 4YDUA 3C0BA 4YDUC 4DB3A 4BR7A 5KPZA 4QS8A 5EX5A 2E1YA 1YUWA 2EWSA 1Y64A 1ATRA 2BUPA 2QXLA 2P9SB 2A6AA 3VEVA 4CZKA 1LCUA 4BQZA 5AQLA 1U6ZA 1JCGA 4FOEA 4MO5A 4CZIA 5EOYA 4AM6A 1RDWX 5CE3A 3QFPA 1QQMA 1ATNA 4BC5A 2P9LA 4FWMA 3HM8A 5JMVA 2BTFA 2GWKA 3WEEA 4FWKA 3SJHA 3QDKA 3VESA 3WXLA 2GELA 4B1WB 3H3OB 1BA0A 3A8YA 3C7NB 1QQOA 4WQ5A 4WQ5C 3M3ZA 4IO8A 1P8ZA 2GWJA 3UE5A 4BR4A 5ADXH 4IXCA 1JCEA 1MDUB 2CGKA 3O5BA 4FOIA 1LOTB 2IIRA 4JN4A 4BR0A 1BU6O 3ULEA 4F9OA 3VEWA 2IVPA 3O1BA 3O80A 3CI5A 3WQUA 2YHXA 2ASPA 4DCHA 3MN9A 3ZX3A 3VPZA 2V7ZA 5EY4A 4BC4A 1WUAA 1HUXA 3FZFA 1QZ5A 4BRDA 2Q0RA 2E2OA 4RTFD 4BR5A 1HKBA 3J8AA 1X9JA 4H0TB 4XH5A 5AQHA 4FPBA 1HX1A 4K42A 1HPMA 3DXMA 2QWRA 3H6EA 4A2AA 2DPNA 2V51B 3MN7A 3VEZA 4FWNA 2QWOA 1NBWA 4BG9A 2Q97A 1TUUA 3MMVA 2P9SA 1SQKA 3A0IX 3CJBA 5ELZA 3W3DA 2E1ZA 4A62A 1S22A 2A3ZA 2D1KA 4JD2B 2Q0UA 3R9PA 1GLAG 3WXIA 3HI0A 2AA4A 1BWFO 5E26A 3U9DA 2YCHA 5BR9A 2ZWHA 3EKSA 1E4GT 4PL7A 1QHAA 1BG3A 3OHRA 3VEOA 4EIAA 3O4WA 3VEYA 4BRAA 3GDQA 5KQ8A 3VERA 3RSEB 3C7NA 3VF4A 4H5NA 1DKGD 3LDPA 4L3QA 2E2NA 2P9LB 1NGFA 4PKHA 5AQIA 2PAVA 4B1YB 2WUSA 2ZGZA 3GL1A 2IVOA 3WXJA 1BDGA 1G99A 1U2VA 3MDQA 1GLJO 4ISGA 4E1JA 5AFUA 1ATSA 2H3GX 5AQFA 1OKJA 4FSVA 3ULEB 1BA1A 2YHYA 3LDLA 3AARA 4JNEA 3EL2A 1NGJA 3I8BA 4QS9A 2KHOA 4DHYA 3IUCA 4K25A 3W0LA 4BVPA 1KAYA 1NGAA 4ISFA 1DEJA 5AQRA 1D4XA 4FWQA 4B1UB 3MK6A 4FWRA 1GLCG 2QWNA 4BROA 5JLHA 3H46O 1XC3A 3MN5A 5ADXA 3HBTA 2FSNA 3DXMB 4O5FA 3A5OC 1ESVA 1ZXOA 3D2EB 5FPNA 4EAHD 4CZGA 5LJVA 4FO0A 2A42A 4CBUA 4AM7A 3DXKB 1NGHA 2QWPA 3I33A 4BVOA 5BREA 3RSEA 4EHUA 3KHYA 3UKRA 4O8KA 4C23A 4PL8A 4BRIA 3R6MA 4XH4A 3AY9A 4IZ9A 5FPEA 1R59O 3F9MA 3SLCA 2GTDA 3WT0A 4CZFA 2ASOA 4BRLA 1BOTO 2YJFA 4H0XB 1DGKN 3JXUA 3DAWA 2P9PB 1NLVA 3L6QA 2OANA 5AQVA 3D2FA 4BR2A 4BQLA 3HZ6A 3H1QA 1JCFA 2D0OA 4CZEA 1HKCA 5EXWA 1NGCA 1U2VB 2HOEA 1KXPA 2VYPA 4XH1A 1HJOA 2ZGYA 5EVZA 4MLHA 3QB0A 4BC2A 4MLEA 4CZJA 5AZJA 4BR9A 2VWBA 2E20A 2NLXA 1V4SA 2NZTA 5BPMA 4LC9B 3CHWA 3SMSA 1V4TA 1C0GA 5I9EB 2NRHA 3GBTA 3D2EA 2FXUA 5B8HA 1X3MA 3R8EA 3CQXA 2CGLA 2F9TA 2A41A 2FF3B 4BRFA 5FPDA 1HLUA 3DXKA 3QMLA 3A5LC 4A2BA 4M63C 4B1XB 4M7XA 1MA9B 4BGBA 2PBDA 4HTLA 2ITMA 3GG4A 5AQZA 2I7PA 3VOVA 4BRPA 1E4FT 2D0PA 3SK3A 1H1VA 4RCHA 3VF6A 1WOQA 4I6MB 5BRHA 3UKRB 2QWMA 3VEXA 2VCPA 1NGBA 2P9PA 3H1VX 4H03B 2P9UA 1GLLO 1GLBG 2P9IA 1Z05A 2V7YA 4IJNA 3CJ9A 3ZX0A 2V52B 3UB5A 3CJAA 4MO4A 3M1FA 2CH5A 1IG8A 1ZBSA 3BP8A 3KVGA 5AQXA 3D2FB 2Q31A 5AQSA 3FFKB 4BRMA 2J4RA 3FE1A 4K41A 4ISEA 1YAGA 2QW9A 5AQNA 3VGMA 2QWQA 1RFQA 3D7EO 1Q18A 5AZJB 3M6GA 3WUHA 4B1VA 3MCPA 3GE1A 4CD1A 1YXQA 2CGJA 3AAPA 3FZHA 1KAZA 3IMXA 5AQPA 4CI6A 2F9WA 4QS7A 3UKUB 5LY3A 3AAQA 3QBXA 3WQTA 4FPAA 3LDQA 3FR0A 3H3NO 4EHTA 3MN6A 3EN9A 2FLOA 3O6WA 3FZMA 4NO7A 3G25A 4BGAA 4BRQA 3BEXA 4IJAA 3O8MA 4I6MA 4PKIA 3KZBA 4H0PA 3ID8A 3ZETB 5AQTA 5AQQA 4H5TA 4CZLA 3H45C 5KPRA 4BRGA 3QFUA 1BO5O 4BREA 4RWTA 4K43A 4BRCA 3ATVA 1YVNA 2HF4A 5AFUH 3ZEUA 1MWMA 1XUPO 3HTVA 3QICA 4Y0WA 4A61A 2P9UB 2QM1A 4FL9A 5F2RA 2P9IB 4JAXA 3BF3A 2FF6A 1GLFO 2Q1NA 1ZC6A 4NB4A 3CETA 4WQ4A 4WQ4C 1GLDG 2HF3A 5JICA 5AQWA 2D4WA 4GY2B 4BRKA 1X3NA 2W41A 2E2QA 5BRDA 3WXKA 3DWLA 2P9KA 2E2PA 4FWPA 3ENOA 1T6DA 2YJEA 4DQ8A 4Z94A 2E88A 3UKUA 1QQNA 3IFRA 4H5WA 4XEIA 1IJJA 2E8AA 4GNIA 2UYTA 3QBWA 4J8FA 1HKGA 3FLCO 3CJ7A 3LM9A 3FZLA 3CJCA 3HSCA 4B9QA 1TYQB 3JS6A 2IVNA 4CZHA 1J6ZA 3EO3A 3SMPA 5KPTA 5LJWA 5BN9A 1NWKA 2ZF5O 1T44A 2HMPA 4FWSA 4CBWA 3BUZB 2YHWA 3ZETA 4IWVA 1BUPA 1NGDA 5AZIB 1XQSC 3DJCA 4FWLA 2W40A 2Q2RA 3GOIA 5AQGA 4WYBA
chains in the Genus database with same CATH superfamily
3AO3A 3SQ4A 3PX0A 1ZYQA 4JI7K 4JHDB 1EQYA 1K8KB 2XRIA 2HHVA 1IBKK 4HWIA 4CGDA 3L0QA 4BACA 2Q36A 2QWLA 5FPMA 4BC3A 4ILGB 4CBXA 1K8AO 4V19S 3VENA 4CESA 3G6EN 3SQ2A 4CD3A 1CZAN 2OA8A 4IOCL 3U4LA 5AQMA 3LDNA 5TKYA 5AQYA 1SL0A 3D6RA 2XHBA 3EKUA 4CGHA 4DSJA 3O9TA 4M41A 1VSDA 3E9PA 4FJJA 3OYNA 4O8UA 1YTUA 2HVHA 4B9TA 3M5RA 4DKWA 4CJVA 2O8FB 3LDOA 1SZ2A 3VQQA 3KLFA 1KAXA 1VSKA 5LMNK 5F1XA 4BG8A 4KO0A 4CJEA 1OVYA 2A1RA 3OYBA 4CGFA 4NCBA 4IKFA 4AHSA 3SAGA 5AQOA 3MEGA 1U49A 3QERA 1D9DA 1NM1A 3F73A 3VQ6A 2OZMA 5A2QO 1T6CA 2P9NA 4DB3A 5C42A 1EKEA 5EX5A 1QTMA 4GKJK 3VQBA 1Y64A 3U3GA 1Q7YO 5KGWA 1S6PA 5AQLA 4CGJA 1JCGA 3CCQN 3ZT3A 4FJHA 2PYLA 2NRWA 5HRNA 3P31A 1GOAA 2O8CA 1C0MA 1NK8A 1U48A 4KHWA 4FWMA 1LWCA 2BTFA 3WEEA 4RW4A 1UA1A 3DYAA 4CJFA 3WXLA 2FC0A 2RKIA 5HOOA 3H3OB 1BA0A 3ZSWA 1QQOA 3O4QA 4YOWA 4IO8A 5ADXH 1P8ZA 4BR4A 3WNEA 1JCEA 1S6QA 1MDUB 3PIPL 4KB1A 1D8YA 4A59A 5H1SQ 2ITGA 4BR0A 3VEWA 1UA0A 4FJ9A 4DCHA 3A2FA 3ZX3A 1HNXK 3VPZA 5EY4A 1YI2N 1N8RO 3CCEN 1HUXA 3FZFA 3CC7N 4OO1J 2E2OA 1BCMA 2DFFA 4FLYA 4NCAA 1WNSA 3OA9A 4FPBA 4DUZK 2QWRA 4JKGB 4DTMA 3RWUA 1NBWA 4YY3K 2Q97A 3W3DA 4LSLA 3IS9A 4A62A 1RCHA 2YKMA 4JI6K 4CJ5A 4BE0A 5D3GA 2Q0UA 3R9PA 2QXFA 4CF0A 2E4LA 3WNGA 1EXQA 5BR9A 1E4GT 1QHAA 4CEQA 1S72N 3OHRA 4BRAA 4CHZA 3L2VA 2F4VK 4OJRA 3VERA 4H5NA 1ASWA 4LF8K 4FVUA 2QKKA 4L3QA 2P9LB 3U3YA 1TAUA 5AQIA 4LSNA 3LALA 1YITN 2PAVA 1A5WA 1HQUA 4GV9A 5K14A 2UXBK 5HLFA 3AVAA 2HHWA 1W97L 4ID5A 4C8NA 5AFUA 2H3GX 1B92A 4FSVA 3ULEB 4PY5A 1TKDA 1BA1A 3SBGA 3VQCA 4DS4A 3AA2A 3KKSA 1NGJA 3I8BA 1YT3A 4DUYK 1KAYA 1NGAA 5AQRA 4FWRA 3ULDA 1IO2A 5FRMA 2Z1IA 3ZSRA 1KVBA 2WC9A 2FSNA 4U67L 1ZXOA 3SJJA 1TL1A 3CCJN 4CZGA 5LJVA 2HSTA 4AM7A 3DXKB 1QSLA 1CZBA 4KPYA 1NJXA 2QWPA 4BVOA 4EHUA 1KSPA 4FZZA 2OTJN 1GOCA 4C23A 1JL2A 3DOLA 5FROA 1RDCA 3OYAA 2YKNA 4B9VA 5FPEA 5IWAK 3L4QA 1R59O 1TKXA 2IS3A 5M1FA 3RR7A 1S1UA 1HJRA 4TSXA 3TAFA 4IFVA 2ASOA 3HRGA 1T7PA 1BOTO 3JXUA 3L3VA 4OGEA 1NLVA 3CG7A 4Q5VA 1JXEA 3DLKA 4A5AA 5JVHL 4M3WA 4RW7A 4DV5K 1JCFA 2HHHK 3ZSVA 2YNIA 1C1AA 2ETJA 1U2VB 4E1MA 4O44A 2VYPA 1NOZA 4YOTA 5EVZA 3ZT0A 3QB0A 4BC2A 3NGYA 4FK2A 4DR4K 1K9MO 1U04A 4GMJB 4KFBA 2B4JA 4JI2K 4CECA 3CQXA 2CGLA 2F9TA 2A41A 3MWTA 5FPDA 4CJ4A 1VQON 5E41A 1FKOA 4A2BA 4B1XB 1VK0A 4JKBA 4E7JA 3CFPA 1WBDA 4BDZA 3MXMA 5AQZA 1WN7A 4N47A 4Z4CA 1C1CA 2QI2A 1YJNN 4B8CA 3SK3A 1B9FA 3VQDA 4CJUA 3AO5A 1DTQA 5GADP 3OS0A 1GLLO 1J5OA 2P9IA 2P5GA 1TL3A 3SBTA 3CJ9A 1WB9A 3VN5A 3D45A 3TSPA 4E1NA 3UB5A 1BISA 4I2QA 3M1FA 1A5XA 4DF8A 2CH5A 1JXBA 2B6AA 1ZBSA 4W5RA 2GBZA 3D2FB 5J2NA 4O5BA 1IBMK 3T1HK 2UXDK 3OYJA 1D9FA 2UUBK 3FE1A 4K41A 1N32K 1NK5A 4CIFA 3MX2A 4CD1A 1YXQA 2CGJA 3AAPA 3FZHA 3ZT1A 3UKUB 3VQEA 4AILC 4FPAA 1JLCA 1FK9A 4PHTX 3LDQA 3THWB 2G8VA 4EHTA 1JLQA 3MN6A 3DOKA 5SWMA 4DFKA 2HHSA 3O6WA 1IG9A 1EP4A 4NO7A 3TAGA 1XMOK 3BEXA 4N41A 4I6MA 3KK3A 4CJTA 3PSIA 5GAEP 3HO1A 4YORA 3KZBA 3LP3A 3ZETB 3O9UA 5KPRA 3NCIA 4FW2A 4RWTA 5CYQA 4BRCA 3G4SN 1BGXT 2YHAA 4DV6K 2Z1GA 3P1GA 5M1PA 3HTVA 4Y0WA 3KLEA 4FL9A 5F2RA 3CCRN 4J2AA 4QAGA 4E89A 1NKCA 4JKDA 3C6UA 3O3GA 3J7ZO 5FDLA 3PY8A 4WQ4A 4WQ4C 2F8SA 1GLDG 1K73O 2I5JA 4FJ8A 1T8EA 2KZZA 4BRKA 3HSTB 3WNHA 3I55N 1NJWA 5FRNA 4HUEA 3V9SA 3WXKA 2E2PA 2KQ2A 2Y1IA 1OH8A 4Z94A 4FW1A 4XEIA 4GNIA 1VQ6N 3J7AP 1N33K 2HB5A 3H08A 3FZLA 3KLIA 2BANA 3CJCA 1VQKN 2A1SA 4ELTA 1TYQB 3EE8A 3E01A 4PWDA 4JI5K 2HMIA 3K57A 5KPTA 4JI8K 2ZF5O 4LF5K 4CBWA 1S1VA 2YHWA 4FZYA 1NJZA 3MXIA 3SQ1A 1LAVA 3B6PA 1TK8A 5AZIB 4FWLA 2W40A 5AQGA 4WYBA 1HQEA 5AQKA 2DY4A 4DR6K 1MWKA 3VF2A 4FXDA 5KGXA 4ZTFA 2QEXN 2HHXA 3U8XA 2FSJA 1RGIA 4K0KK 1NGEA 3CJ1A 3SUNA 3ID6A 1I94K 3OJUA 3AGRA 3ZEUB 3TANA 2ASMA 3IDHA 4X65K 2D5RA 4HUGA 2NRVA 2ZJQL 4KHUA 4FLZA 3OVNA 3TABA 1Q8IA 4DR2K 5BPNA 4E0DA 3TPQA 4KBOA 5KQDA 3FZKA 1Z6RA 3AA4A 4FK4A 2WBNA 1BCOA 4LY7A 3VETA 2D0BA 3TU5A 2GUPA 1S9EA 3ZX2A 4JI3K 3PX6A 1G15A 1LWEA 5AQUA 1S3XA 3IG1A 2F96A 4JK8A 2XY5A 4B1ZA 3LWLA 3L2RA 3PO4A 1EWRA 2NUBA 1QHTA 4CHOA 4MDAA 3VGKA 2YI1A 4DV2K 3WXMB 3P4IA 1SAZA 1CXUA 4H0VB 3U9ZA 1NGIA 1QZ6A 4YDUA 4YDUC 3NGIA 3NH1A 5KPZA 3SAFA 2E1YA 4Q0BA 1Q9XA 3NF6A 4FJNA 4F2RA 1VSIA 4UQGA 2QXLA 1U4BA 2P9SB 4C1NK 3KWGA 4Z0UA 4E7IA 4MDBA 1LCUA 2X74A 1LAWA 1Q82O 4LF4K 5KRTA 5DK5A 2RN2A 1RDWX 3J80O 3E9LA 5CE3A 4DU1A 3PIOL 3THXA 3OBYA 4BC5A 2P9LA 5T7BA 1VSLA 1HRHA 4J2BA 2GWKA 3QDKA 4O4GA 1HYSA 2JLEA 3IAYA 3NBPA 3QINA 4B3RK 4B1WB 3C7NB 3M3ZA 3UE5A 2PFUA 1X9SA 4FOIA 3M8PA 1JLEA 4JN4A 3ULEA 4NCGA 1ZBHA 3O1BA 1FW6A 4HCCA 2HNZA 3KKRA 5CHIA 3DLGA 1YHQN 2V7ZA 2EHGA 3OYIA 1WUAA 4IFEA 3AA5X 4BRDA 5HBMA 4IDHA 4RTFD 5HL7L 1IKXA 5FLXO 2Z1HA 4X64K 3V9WA 3H6EA 3ALYA 5CZ2A 4F4KA 4FWNA 4JI1K 2QWOA 3T7ZA 5CY4A 3A0IX 3CJBA 3LAKA 5ELZA 1SL1A 2O8EB 3K2PA 3PV8A 4JKCA 2A3ZA 4JD2B 1RDUA 3CD6N 1GLAG 3WXIA 2AA4A 4WFAL 1T3VA 2HVIA 2YCHA 3TTFA 4DQQA 3K5MA 4PL7A 4Y1CA 4EIAA 4KKOA 3RSEB 3VF4A 4DV1K 1O13A 3LDPA 4R5PA 2E2NA 3NAEA 1YJWN 4DG1A 3SPYA 5SZTA 3GL1A 4FM1A 1BDGA 1G99A 1U2VA 3V81A 1GLJO 4JKEA 4FLTA 1XC9A 4ISGA 5CZ1A 2W42A 3C6AA 1VQMN 1ATSA 2DFHA 2YHYA 3AARA 1FXXA 4QS9A 4DHYA 3W0LA 4WFBL 3CQ8A 4ISFA 1D4XA 4FWQA 4KI4A 2DTUA 4N5SA 3CC2N 3THYB 1KLNA 1RTHA 1VSFA 4DSKA 3ZSOA 5GAGP 1XC3A 5C15A 3MN5A 1Z26A 3DXMB 3A5OC 1IKVA 5J2PA 4QCLA 1OH5A 2BDPA 4R79A 4GKKK 1EO1A 1GOBA 3S9HA 5HROA 4FVMA 3DRRA 1XNQK 3SUQA 1M90O 4PL8A 2UU9K 2QTDA 4IEEA 4XH4A 4DU4A 5AJ3K 2RPIA 3SLCA 2GTDA 2RHKA 4BRLA 3VA0A 2OPSA 2P9PB 4BE2A 3L6QA 4CEDA 3OYDA 5AQVA 3D2FA 4BR2A 4BQLA 4CZEA 4CHQA 3HM9A 1NGCA 2UXCK 2HOEA 1KXPA 4DTNA 4XH1A 3HVTA 2O8DB 2ZGYA 4CGIA 1C6VA 3C6HA 4MLEA 1OH7A 2VGNA 3QEPA 2VWBA 4F3TA 3QEXA 2E20A 1VQ9N 2NLXA 1V4SA 2WOMA 1BI4B 4LC9B 1V4TA 3MECA 1J54A 4FJ5A 3HPOA 4FJKA 4BWMA 4DFMA 5I9EB 1VQ5N 3D2EA 2FXUA 5B8HA 3R8EA 1XHXA 1JKHA 3CC4N 1L3UA 4DR5K 2VG6A 2X78A 3PLAA 1HNZK 2FF3B 1HLUA 4JK9A 5J2MA 3A5LC 1N5YA 4PUOA 4Z4EA 4DQPA 1YF5L 4CFAA 5GIPA 1MA9B 4YOXA 2FBVA 2I7PA 3PSFA 2D0PA 2OCEA 4CJRA 3CM6A 3QIPA 4NXMK 4RW9A 1S1XA 3UKRB 4DQSA 3VEXA 4JK7A 4AHUA 3WNFA 1GLBG 2G8HA 3O3FA 4AHVA 3AVHA 1QVGM 3B6OA 1F21A 1WSIA 1J53A 4KHPK 4MO4A 4CGGA 4DTRA 1DTTA 1IG8A 2ZM6K 3BP8A 2Q31A 2BE2A 2YV0X 2NRXA 5AQSA 4CFBA 3OYMA 3MEDA 1FJGK 1YAGA 3TAEA 2QWQA 3WUHA 4B1VA 1RT4A 2VQEK 1KAZA 3IMXA 4KH5A 2YX6A 5AQPA 4FM2A 2HW3A 3AVMA 1JLAA 3QLHA 3CPWM 1SUQA 3FR0A 3THVA 2FLOA 4UY8O 4E7LA 3TSQA 3G25A 4BGAA 3HK2A 4FJMA 4LFBK 4N56A 5DM7L 1CXQA 3O8MA 1KC8O 1SKRA 4IOAL 2ATQA 1HR0K 4H0PA 3ID8A 5AQTA 3SI6A 3H45C 4BRGA 2IGIA 4JLHA 2Q3SA 4NLBA 3SAHA 3HOTA 3EZ5A 1RTDA 3ATVA 4ELUA 1YVNA 4CF2A 1BIUA 3ZEUA 1QVFM 2VGMA 3QICA 5CR4A 2QM1A 1KLMA 3BF3A 4FJGA 3AVIA 2Q1NA 1TGOA 2RE2A 5LL6Z 4IDKA 5JICA 2D4WA 1WSFA 4NYFA 2P5OA 2W41A 4AH9A 3O9QA 3DWLA 4CJKA 3RRHA 1T6DA 2YJEA 4CHPA 4DQ8A 1IJJA 1J9AA 4AHRA 1NG9A 1J5EK 3QO9A 3FLCO 3KLGA 3K5NA 2FBXA 3LM9A 1W2BM 3HSCA 3NHGA 1KFDA 3E9OA 5J2QA 2HBJA 2XY7A 2GV9A 3TARA 1NWKA 4C8OA 3R1XA 3HT3A 1JJ2M 4M45A 1X9WA 1E3MA 2JWKA 1BUPA 1WLJA 3CFOA 2XY8A 1HYVA 1XQSC 5M1NA 3GOIA 1Y97A 4CHYA 4B3SK 3OY9A 4H5VA 1TUYA 2NNWA 5HRRA 4OPAA 2P9NB 5C24A 3RR8A 3F9KA 3B8AX 1RDBA 5BPLA 1TV6A 3PO5A 1IV0A 1TK5A 2OPQA 3I8DA 5AQJA 4FJIA 5AR0A 4QOZB 3VGLA 3AVNA 4FWOA 1NJIO 3CIPA 4BRHA 4I7FA 4EFHA 2O8CB 3QETA 1IKYA 2HHQA 3AVJA 4BDYA 2A5XA 3WEEB 4CZMA 4YOVA 3V6DA 4CIGA 1U47A 4H0OA 3CERA 3ATUA 4E19A 4FJXA 2JGUA 3CCLN 1WAFA 4NYNA 4JYAK 3HPHA 4GVMA 3L4IA 4NLCA 2G8UA 1WSEA 3HJFA 2UUCK 4B8AB 3VA3A 2O8BB 3O08A 4DTOA 2HHUA 1YVUA 2O8EA 4EP5A 2I7NA 3CM5A 4KTQA 4JD2A 3RVCA 3L3UA 4JHDA 3O1WA 3ENHA 1K8KA 4OKKA 1XI1A 5CYMA 4BR7A 2YNHA 4ID1A 2EWSA 3NVKA 2BUPA 1LW0A 3V9UA 3MEEA 1L3SA 1RT3A 3VEVA 4CZKA 4KRFA 4BQZA 3KK2A 1U6ZA 4MO5A 3FFIA 5EOYA 1HYZA 4AM6A 4CK2A 4J2DA 1QQMA 1OH6A 4H4OA 2PY5A 3HM8A 5JMVA 1KTQA 4AHTA 3ZT2A 3K5OA 2GELA 1NK0A 1KQSM 4BY9C 3A8YA 2O8FA 3ASMA 4JRQA 4IXCA 2CGKA 4BDPA 2IIRA 4WF9L 1BU6O 4F9OA 2IVPA 1HMVA 3O80A 3CI5A 3WQUA 2YHXA 1NKBA 4DSLA 4B3MK 3VQ8A 2W6KA 3KK7A 4FLXA 1QSSA 1WSGA 2IAJA 2OPRA 4BC4A 1QZ5A 1C0UA 4WCEL 3K59A 2Q0RA 3G71N 1CZ9A 4F8RA 3J8AA 4XH5A 4DSFA 2G8KA 3QNOA 1SKWA 2BGGA 4CF8A 2KZMA 1HX1A 4K42A 4B3TK 3DXMA 1DLOA 2X6SA 4A2AA 2DPNA 2V51B 4DTXA 5HP1A 1Z25A 1ZBFA 3DMJA 3HPGA 3RTVA 3ZSYA 1UAXA 1TUUA 3MMVA 1SQKA 2PZSA 4K8ZA 4JRPA 1XWLA 1X9MA 1S22A 3CCVN 1VQNN 2D1KA 4KHNA 2IDOA 3HI0A 2UUAK 3U9DA 3QESA 4FLVA 4M3UA 2ZWHA 3TR8A 1DT9A 3O4WA 3R3LA 3MX5A 1YJ9N 4YOYA 2GUIA 3QIOA 3OYKA 1NKEA 1O1WA 2NRRA 4PKHA 1NGFA 4B1YB 2WUSA 4FM0A 2ZGZA 5I3UA 3LAMA 4CJPA 2GX9A 2IVOA 3MDQA 2OTLN 3IKMA 4Y1DA 2O8DA 4OLBA 3AVLA 4C8LA 4E1JA 1RBRA 2HBKA 3KD5E 5AQFA 1OKJA 2D0CA 3LDLA 3C94A 4DV0K 4ZTJA 2KHOA 3IRXA 3IUCA 1SS6A 3OYLA 4E7KA 1DEJA 2FBYA 4JKGA 3NFAA 3T3FA 2E6LA 4CIEA 4KREA 1GLCG 1BHLA 2QWNA 2F7TA 3P38A 1UWBA 3EE9A 3ZCMA 3OYGA 4MQ3A 3ZYYX 3H46O 3P83D 3HBTA 4OPJA 4O5FA 1NNEA 4FO0A 3LDSA 2A42A 3TAPA 1LV5A 4B9NA 3T69A 3KHYA 3UKRA 4CK3A 4O8KA 1Q81O 3KK1A 4K8XA 4OKEA 4BRIA 1IKWA 3F9MA 2YJFA 4H0XB 2Y1JA 1DGKN 2HNDA 4F3OA 2OANA 3OW2M 4HVJA 3HVRA 3HZ6A 4JI0K 3H1QA 1BL3A 1CLQA 4IOXA 2G8WA 3KD1E 4CFDA 1LW2A 4CJQA 1VRTA 4OLAA 1HKCA 5EXWA 3OYEA 4MLHA 1TVRA 3VQ4A 3JYTA 4DU3A 1KCFA 4YOUA 4BR9A 4CERA 4DFJA 3LP0A 5MLCQ 1YTAA 2Z1JA 3LZIA 1RDDA 2NZTA 3ZLJA 3CHWA 2E5LK 1C0GA 2XY6A 2NRHA 3GBTA 2F8TA 4LF6K 4IG3A 3ZSZA 4BRFA 3DXKA 3MAQA 1OVQA 4GV3A 3N4PA 4M63C 4M7XA 1RTIA 4O55A 5HRSA 4HTLA 2ITMA 2R7YA 3N4QA 3ZT4A 3VOVA 2YNFA 2VWJA 4DV7K 4Z4IA 3T1YK 4E3SA 4IFYA 3K5LA 1C1BA 1H1VA 4RCHA 1XMQK 1WAJA 5DM6L 3RMCA 4I6MB 5BRHA 1NGBA 3BDPA 3H1VX 4H03B 4OVLA 3SQ0A 2G8FA 3KWIA 1RBTA 3VQPA 1L3TA 4B9MA 3AVGA 4FLUA 3CXCM 1SKSA 1R0AA 5KI6A 4M3TA 1VSMA 2OPPA 3KVGA 4YNQA 3HL8A 4BRMA 4CEZA 2J4RA 3E1YA 1S9GA 5TKWA 3SNNA 4HUFA 3O4NA 4FLWA 3DRSA 1BQNA 2QW9A 4PA1A 5AQNA 2ZE2A 3VGMA 1RFQA 2QKBA 4E7HA 1VRUA 3V9ZA 5AZJB 3MCPA 3LZJA 3GE1A 3K58A 2ZJRL 4DLGA 2VG5A 4DFPA 2F9WA 4QS7A 4GV6A 2DFEA 3TI0A 3AAQA 4CF9A 4DR7K 1NK6A 4IEIA 3ENBA 3DLRA 3AA3A 4CJ3A 2D0AA 3SV4A 1MU2A 5AQQA 1NJYA 1IBLK 3QFUA 4BREA 1HPZA 3ISNC 4CK1A 3ITHA 1ZBIA 4A61A 4M3RA 1C0TA 5C2FA 4DS5A 2P9UB 2HHTA 3VQAA 3JSMA 1GLFO 1QE1A 1ZC6A 4JS5A 1VQ4N 3CETA 4KTZA 2HF3A 3KTQA 5AQWA 4YHHK 4LFCK 1D5AA 1RT5A 4O0JA 1X3NA 4U7BA 3O9SA 3BZCA 2E2QA 5BRDA 4HCBA 4G9ZA 4FWPA 4OKJA 4CEAA 2E88A 3UKUA 1QQNA 3IFRA 4H5WA 1WBBA 1I39A 1QS4A 4CEFA 3KLHA 2UYTA 3QBWA 4BWJA 4J8FA 3THWA 1NK4A 4CJWA 3CJ7A 5KRSA 4HTUA 3NH2A 4DMNA 3NF8A 2VQFK 4CFCA 4Z4HA 4AQYK 3QEVA 2O8BA 2KKZA 4CZHA 4HHTA 3EO3A 2KW4A 5LJWA 5BN9A 4IBNA 1RDAA 1T44A 3BUZB 4CJSA 3ZETA 3JAMO 2AJQA 4IWVA 2LSNA 2NRTA 3CYMA 3DRPA 4B9LA 3DJCA 1KRPA 3DLLL 4CEOA 5DMRA 4FCYA 1WSJA 3CQYA 3F5TA 3LL3A 5J1EA 2KTQA 5BRFA 1C0FA 4BRNA 1TKTA 1RBSA 4LH5A 1RT1A 4H0YB 1KVAA 2A40A 3BF1A 1GLEG 4KH6A 4CI6A 4DTJA 2GEMA 2CH6A 2NRZA 2ZQBA 4CJ7A 3QEIA 2FSKA 5C25A 2KLAA 3M8RA 4WE1A 5E84A 1JLGA 1NGGA 1NMDA 3DLEA 3THXB 4PKGA 1HNVA 1X1PA 3EZWA 3RMDA 4H8KA 5JLFA 2XO7A 3A5NC 3LP1A 1HNIA 4JEPA 3LPUA 3NF7A 3OJSA 1KVCA 1L5UA 3Q7BA 1TYQA 3FGUA 2P9KB 4B9SA 2JWLA 4ILJA 2FBTA 3S41A 4FK0A 4RW6A 3OYCA 3UIQA 3PUFA 4M7YA 3A5MC 4F2SA 5F0XA 1BQMA 2AP1A 3AV9A 4DV4K 4ZHRA 4NXNK 4H5RA 4LF9K 4W5QA 3LM2A 5AZIA 3CF5L 5BN8A 3NVMA 4KI6A 3KIOA 3LANA 1NU0A 1Q9YA 3C6TA 4DSEA 3C0BA 4QS8A 2QK9A 1RTJA 1YUWA 1RBVA 3AVCA 1ATRA 3I0SA 2YNGA 2ZJPL 3V4IA 2A6AA 1S5JA 3V1QA 1TK0A 4LF7K 3LPTA 1JLFA 1W7AA 4FOEA 1XHZA 4CZIA 1RBUA 3QFPA 1ATNA 1FKPA 4DLEA 3MWPA 2P1JA 3NDKA 4G1QA 4FWKA 3SJHA 3VQ9A 3VESA 4C8KA 4WQ5A 4A57A 4WQ5C 4W5OA 2QA4N 1VSEA 2GWJA 4OGCA 2W6LA 3F2KA 5GIOA 2WFBA 3O5BA 1LOTB 3OYFA 3EYZA 1SL2A 3QEWA 4KH4A 4Z4FA 4CE9A 4L8RB 2ASPA 3CMEN 2IOCA 3OS2A 3SUPA 3MN9A 4CEEA 4GW6A 3TAMA 1EETA 1M1KO 1S1TA 1YIJN 1WSHA 3OYHA 5LMUK 4BR5A 1HKBA 1X9JA 4M42A 4H0TB 5AQHA 5C0YA 3VQ5A 1HPMA 4ELVA 4B3OA 3SYZA 1W0HA 3MN7A 3VEZA 3J81O 4I9QA 3AGKA 4BG9A 4Z4GA 2P9SA 4H4MA 1LWFA 2E1ZA 3LWMA 3AO2A 1NK9A 2HBMA 2KFZA 1I3AA 2O4IA 1BWFO 5E26A 1ZBLA 2BH1A 3AVFA 2X6NA 3EKSA 4DF4A 3PX4A 3P39A 1BG3A 3VEOA 3VEYA 3NE6A 3GDQA 5KQ8A 3C7NA 1DKGD 4AF1A 4DTSA 3HOSA 3TWHA 1VAZA 1RILA 3K9JA 2WTUA 3WXJA 4CVNE 1VSHA 3L8BA 1A5VA 4CJLA 3KJVA 4X66K 4JNEA 3EL2A 4JV5K 4OPHA 4K25A 4BVPA 3NH0A 5M1KA 3HXMA 4BE1A 3HYFA 4B1UB 3MK6A 3U6FA 4LD0A 4BROA 5JS1A 5JLHA 1VHXA 4LFAK 1BIZA 1VQPN 4OPKA 1VQ7N 5ADXA 3Q7CA 1EWQA 1ESVA 4CCHA 5C10A 3D2EB 5FPNA 4EAHD 4CF1A 3DLBA 2VWKA 4KHQA 3VMFB 4CBUA 3ZSQA 1NGHA 3P5JA 3K0SA 4EP4A 1VQLN 3I33A 5I42A 3AVKA 3D0PA 5BREA 3RSEA 5JVGL 4KB0A 3NGZA 4DV3K 3QNNA 3C65A 3OTOK 4C1NI 3R6MA 3AY9A 4IZ9A 2HBLA 3RMBA 3TSUA 4FJ7A 1K6YA 3ZSXA 3WT0A 4DQRA 3L2QA 4CZFA 1QSYA 3VTHA 4O0IA 4IG0A 3EEQA 3DLHA 4JI4K 3DAWA 4FZXC 4ILHA 3BZKA 2D0OA 1RT6A 3CFRA 3CCUN 3CCSN 3J7YP 3OS1A 3O9RA 1HJOA 1NMNA 3G0ZA 1ITGA 4N76A 4CZJA 4JKFA 5AZJA 3SPZA 3THYA 3RRGA 1L3VA 1NOYA 1ASVA 3VTIA 1QQCA 3DI6A 3C95A 5BPMA 4ICLA 3SMSA 3NMUA 2P51A 4GVEA 1X3MA 4KTWA 2YHBA 3CMAN 3AVBA 1ZBUA 3CCMN 2OZSA 2KFNA 3QMLA 3LP2A 4BGBA 2PBDA 5KTQA 3GG4A 4W5TA 4DWIA 1IH7A 1N6QA 2OYQA 2VG7A 4BRPA 5GINA 1E4FT 1ASUA 3V1OA 4DR3K 3L2UA 5BR8K 3VF6A 3M8QA 4FJLA 1WOQA 2QWMA 2VCPA 3BGRA 2P9PA 2P9UA 1Z05A 4KHSA 2V7YA 4IJNA 2EX3A 3DM2A 4C8MA 4WFNL 4YFUA 4M3XA 3MCAB 3ZX0A 4EZ9A 4J2EA 2V52B 3V1RA 1U45A 4DSIA 3RMAA 3SZ2A 3S3NA 3CJAA 1S1WA 1EX4A 4XIUA 4DTPA 4CEBA 5AQXA 1REVA 4PQUA 3T1AA 1RT7A 3FFKB 4A5BA 5C12A 1BI4A 1JL1A 3NF9A 5M1QA 3V9XA 4ISEA 1NK7A 3SV3A 3D7EO 3M8SA 1Q18A 3L2WA 3M6GA 1HNWK 2PYJA 2WONA 2ZD1A 4JKHA 5HRPA 5LY3A 3QBXA 4DQIA 3WQTA 3MXJA 4FYDA 3VQ7A 3H3NO 4RW8A 1RT2A 3SUOA 4RG8A 3EN9A 1KFSA 3SCXA 3FZMA 3CPEA 5JS2A 4BRQA 4JKAA 4CW7B 3EY1A 1B9DA 4IJAA 4PKIA 4KHYA 1ILYA 1TKZA 2RF2A 4H5TA 4CZLA 3HP6A 3O3HA 1BO5O 4K43A 1P90A 5C2DA 3S3MA 4I9LA 2HF4A 1XNRK 3K9KA 5AFUH 5IT9O 1MWMA 1XUPO 1JLBA 1SV5A 4B9UA 2P9IB 4JAXA 5M1OA 4KAZA 5EU7A 3BY5A 3T19A 2FF6A 1VQ8N 3E66A 1T05A 4JS4A 2O4GA 4NB4A 1N34K 4M3YA 4IO9L 4GY2B 4B08A 3AO4A 2HNYA 3TTDA 4OX9K 3HP9A 4AHCA 4W5NA 3S3OA 1T03A 4KV8A 2B5JA 3OBWA 2P9KA 3ENOA 4LH4A 4CHNA 2E8AA 1N36K 4M3ZA 5GAHP 1KD1O 4DR1K 1HKGA 1VSJA 3I56N 1Q86O 2IC3A 3TTCA 1TAQA 3G10A 4EZ6A 4B9QA 3JS6A 4X62K 2IVNA 4I2PA 4DTUA 1J6ZA 3SMPA 1W9HA 2E6MA 2G8IA 2HMPA 4FWSA 1UOCA 3TAQA 1RNHA 1NGDA 4MFBA 2Q2RA 3I0RA 3AO1A
chains in the Genus database with same CATH topology
5AQKA 4H5VA 1MWKA 3VF2A 3CQYA 1TUYA 3F5TA 2NNWA 2QEXN 3LL3A 4OPAA 5BRFA 3U8XA 4JHDB 2P9NB 1EQYA 1K8KB 1C0FA 4BRNA 3B8AX 2FSJA 4HWIA 5BPLA 1RGIA 1NGEA 3CJ1A 4H0YB 2A40A 3L0QA 3ID6A 3BF1A 3AGRA 5AQJA 1GLEG 4KH6A 5AR0A 2ASMA 2Q36A 2QWLA 5FPMA 4ILGB 3ZEUB 2GEMA 2CH6A 2NRZA 3IDHA 3VGLA 3VENA 4CBXA 2FSKA 4CD3A 1CZAN 4CJ7A 4FWOA 3G6EN 2KLAA 1NJIO 4IOCL 2NRVA 3U4LA 5AQMA 2ZJQL 3CIPA 3LDNA 4BRHA 5TKYA 5E84A 5AQYA 1NGGA 1NMDA 3D6RA 4EFHA 3EKUA 4PKGA 3EZWA 5BPNA 3O9TA 3E9PA 5JLFA 2A5XA 3TPQA 3WEEB 4CZMA 4YOVA 4O8UA 3A5NC 4KBOA 5KQDA 3FZKA 1Z6RA 4JEPA 4H0OA 2WBNA 3CERA 3VETA 3M5RA 3Q7BA 4DKWA 1TYQA 3LDOA 3TU5A 1SZ2A 3FGUA 2P9KB 2GUPA 2JWLA 4ILJA 3S41A 3ZX2A 1KAXA 3ATUA 5AQUA 5F1XA 1S3XA 4BG8A 4M7YA 3A5MC 5F0XA 4JK8A 2AP1A 1OVYA 3CCLN 4B1ZA 3L4IA 4H5RA 4NLCA 3LM2A 5AZIA 3SAGA 3O08A 3CF5L 4MDAA 5AQOA 3VGKA 2YI1A 5BN8A 3NVMA 3WXMB 1NM1A 3P4IA 2I7NA 1SAZA 4JD2A 3RVCA 4H0VB 1T6CA 4JHDA 2P9NA 3O1WA 3ENHA 3U9ZA 1K8KA 4YOWA 1NGIA 1QZ6A 4YDUA 3C0BA 4YDUC 4DB3A 4BR7A 5KPZA 4QS8A 5EX5A 2E1YA 3SAFA 1YUWA 2EWSA 1Y64A 1ATRA 2BUPA 1Q7YO 3NVKA 2QXLA 2P9SB 2ZJPL 2A6AA 3VEVA 4CZKA 4C1NK 3KWGA 4MDBA 1LCUA 1Q82O 4BQZA 5AQLA 1U6ZA 1JCGA 4FOEA 4MO5A 4CZIA 3CCQN 5EOYA 4AM6A 1RDWX 2NRWA 3E9LA 5CE3A 4BC3A 3PIOL 3P31A 3QFPA 1QQMA 3OBYA 1ATNA 4BC5A 2P9LA 3MWPA 4FWMA 3HM8A 5JMVA 2BTFA 2GWKA 3WEEA 4FWKA 3SJHA 3QDKA 3VESA 3WXLA 2GELA 1KQSM 4B1WB 5HOOA 3H3OB 1BA0A 3A8YA 3C7NB 1QQOA 4WQ5A 4WQ5C 4A57A 3M3ZA 4IO8A 1P8ZA 2GWJA 2PFUA 3UE5A 4BR4A 3F2KA 4IXCA 5ADXH 1JCEA 3PIPL 1MDUB 2CGKA 5GIOA 2WFBA 3O5BA 4A59A 4FOIA 5H1SQ 1LOTB 2IIRA 4WF9L 4JN4A 4BR0A 1BU6O 3ULEA 4KH4A 4F9OA 3VEWA 2IVPA 3O1BA 3O80A 3CI5A 3WQUA 2YHXA 2ASPA 3CMEN 4DCHA 2QA4N 3MN9A 3KK7A 3ZX3A 5CHIA 1YHQN 3VPZA 2V7ZA 1M1KO 5EY4A 1YI2N 4BC4A 1WUAA 1YIJN 4IFEA 1N8RO 1HUXA 3CCEN 3FZFA 1QZ5A 4BRDA 4WCEL 3CC7N 2Q0RA 3G71N 2E2OA 4OO1J 4IDHA 4RTFD 5HL7L 4BR5A 1HKBA 3J8AA 1X9JA 4H0TB 4XH5A 5AQHA 5C0YA 3OA9A 1HX1A 4FPBA 4K42A 1HPMA 3DXMA 2QWRA 3H6EA 4A2AA 2DPNA 2V51B 4JKGB 3MN7A 3VEZA 4FWNA 2QWOA 1NBWA 3T7ZA 3AGKA 4BG9A 2Q97A 1TUUA 3MMVA 2P9SA 1SQKA 3A0IX 3CJBA 5ELZA 3W3DA 2E1ZA 4A62A 1S22A 3CCVN 1VQNN 4JKCA 2A3ZA 2D1KA 4JD2B 1RDUA 2HBMA 3CD6N 2Q0UA 3R9PA 1GLAG 3WXIA 3HI0A 2AA4A 1BWFO 5E26A 3U9DA 2BH1A 4WFAL 1T3VA 2YCHA 3TTFA 5BR9A 2ZWHA 3EKSA 1E4GT 1DT9A 3P39A 4PL7A 1QHAA 1S72N 1BG3A 3OHRA 3VEOA 4EIAA 3O4WA 3R3LA 3MX5A 3VEYA 3GDQA 4BRAA 4YOYA 1YJ9N 5KQ8A 3VERA 3RSEB 3C7NA 3VF4A 4H5NA 1O13A 1DKGD 3LDPA 4FVUA 4AF1A 2NRRA 4L3QA 2E2NA 2P9LB 1NGFA 4PKHA 3HOSA 1VAZA 5AQIA 1YJWN 1YITN 2PAVA 4B1YB 2WUSA 3K9JA 2ZGZA 3GL1A 2GX9A 2IVOA 4GV9A 3WXJA 1BDGA 1G99A 1U2VA 3MDQA 1GLJO 4JKEA 2OTLN 3IKMA 4ISGA 4E1JA 1W97L 3C6AA 2HBKA 5AFUA 1VQMN 1ATSA 2H3GX 5AQFA 1OKJA 4FSVA 3ULEB 1BA1A 3SBGA 2YHYA 3LDLA 3AARA 4JNEA 3EL2A 1NGJA 3I8BA 4QS9A 2KHOA 4OPHA 4DHYA 3IUCA 4K25A 1SS6A 3W0LA 4BVPA 4WFBL 1KAYA 1NGAA 4ISFA 5M1KA 1DEJA 4JKGA 5AQRA 1K8AO 1D4XA 4FWQA 4B1UB 3MK6A 4FWRA 1GLCG 2QWNA 2F7TA 3CC2N 3P38A 4BROA 3EE9A 3ZYYX 3H46O 5JLHA 5GAGP 1XC3A 5C15A 3MN5A 1VQPN 1VQ7N 2WC9A 5ADXA 3HBTA 2FSNA 3DXMB 3Q7CA 3A5OC 1ESVA 4O5FA 4U67L 1ZXOA 5C10A 3D2EB 3CCJN 5FPNA 4EAHD 4CZGA 5LJVA 4FO0A 4R79A 2HSTA 2A42A 3VMFB 4CBUA 4AM7A 1EO1A 3DXKB 1NGHA 2QWPA 3I33A 3T69A 4BVOA 1VQLN 5BREA 3RSEA 4EHUA 3KHYA 3UKRA 4O8KA 1Q81O 2OTJN 5JVGL 3C65A 4C23A 1M90O 4PL8A 4BRIA 2QTDA 4IEEA 3R6MA 4XH4A 4C1NI 3AY9A 4IZ9A 2HBLA 5FPEA 3L4QA 3TSUA 1R59O 5M1FA 3F9MA 3SLCA 2GTDA 3WT0A 2RHKA 4CZFA 3VTHA 2ASOA 3HRGA 4BRLA 1BOTO 2YJFA 4H0XB 1DGKN 3JXUA 3DAWA 2P9PB 1NLVA 3L6QA 2OANA 5AQVA 3D2FA 4A5AA 4BR2A 3OW2M 4BQLA 3HZ6A 5JVHL 4ILHA 3H1QA 1JCFA 2D0OA 4IOXA 3CCUN 4CZEA 1HKCA 5EXWA 3CCSN 1NGCA 1U2VB 2HOEA 1KXPA 2VYPA 4XH1A 3O9RA 1HJOA 4YOTA 2ZGYA 5EVZA 4MLHA 3QB0A 4BC2A 3C6HA 4MLEA 4JKFA 4CZJA 5AZJA 2VGNA 4YOUA 4BR9A 2VWBA 1K9MO 5MLCQ 2E20A 3VTIA 1VQ9N 2NLXA 1V4SA 2NZTA 5BPMA 4LC9B 3CHWA 3NMUA 3SMSA 1V4TA 1C0GA 5I9EB 2NRHA 4GVEA 3GBTA 1VQ5N 3D2EA 2FXUA 5B8HA 1X3MA 3R8EA 3CC4N 3CQXA 2CGLA 3CMAN 3PLAA 2F9TA 2A41A 2FF3B 3MWTA 4BRFA 5FPDA 3CCMN 1HLUA 3DXKA 4JK9A 1VQON 3QMLA 3A5LC 4A2BA 4GV3A 3N4PA 4M63C 4B1XB 1YF5L 5GIPA 4JKBA 4M7XA 1MA9B 4BGBA 2PBDA 4HTLA 2ITMA 3GG4A 5AQZA 4YOXA 3N4QA 2I7PA 2QI2A 3VOVA 4BRPA 5GINA 1E4FT 1YJNN 2D0PA 3SK3A 1H1VA 4RCHA 3VF6A 5DM6L 1WOQA 4I6MB 5BRHA 3UKRB 2QWMA 3VEXA 5GADP 2VCPA 4JK7A 1NGBA 2P9PA 3H1VX 4H03B 2P9UA 1GLLO 1GLBG 2P9IA 1Z05A 2V7YA 4IJNA 3SBTA 4WFNL 3CJ9A 3KWIA 1QVGM 3MCAB 3ZX0A 2V52B 3TSPA 3CXCM 3UB5A 3CJAA 4MO4A 3M1FA 2CH5A 1IG8A 1ZBSA 3BP8A 3KVGA 5AQXA 3D2FB 2Q31A 2NRXA 5AQSA 3FFKB 4BRMA 2J4RA 3E1YA 5TKWA 4A5BA 5C12A 5M1QA 3FE1A 4K41A 4ISEA 1YAGA 2QW9A 5AQNA 3VGMA 2QWQA 1RFQA 3D7EO 1Q18A 3MX2A 5AZJB 3M6GA 3WUHA 4B1VA 3MCPA 3GE1A 2ZJRL 4CD1A 1YXQA 2CGJA 3AAPA 3FZHA 1KAZA 3IMXA 4KH5A 2YX6A 5AQPA 4CI6A 2F9WA 4JKHA 4QS7A 3UKUB 4GV6A 5LY3A 3AAQA 3QBXA 3WQTA 4FPAA 4PHTX 3LDQA 3CPWM 3FR0A 3H3NO 4EHTA 3MN6A 3EN9A 2FLOA 3O6WA 3FZMA 4NO7A 3TSQA 3CPEA 4UY8O 3G25A 4BGAA 4IEIA 4BRQA 4JKAA 3BEXA 5DM7L 4IJAA 3O8MA 1KC8O 4I6MA 4PKIA 3ENBA 5GAEP 4IOAL 1ILYA 4YORA 3KZBA 4H0PA 3ID8A 3ZETB 5AQTA 3O9UA 5AQQA 4H5TA 4CZLA 3H45C 5KPRA 4BRGA 3QFUA 1BO5O 4BREA 4RWTA 4K43A 4BRCA 1P90A 4NLBA 5C2DA 3SAHA 3HOTA 3G4SN 3ATVA 1YVNA 2HF4A 3K9KA 5AFUH 5M1PA 3ZEUA 1QVFM 1MWMA 1XUPO 2VGMA 3HTVA 3QICA 4Y0WA 5CR4A 4A61A 2P9UB 2QM1A 4FL9A 5C2FA 5F2RA 2P9IB 3CCRN 4JAXA 5M1OA 3BF3A 2FF6A 1VQ8N 4JKDA 1GLFO 3E66A 2Q1NA 1ZC6A 4NB4A 3J7ZO 1VQ4N 3CETA 2RE2A 4WQ4A 4WQ4C 1GLDG 2HF3A 5JICA 1K73O 4IO9L 5AQWA 2D4WA 4GY2B 4BRKA 3TTDA 3I55N 1X3NA 2W41A 4U7BA 3O9SA 3O9QA 2E2QA 5BRDA 3OBWA 3DWLA 2P9KA 3WXKA 2E2PA 4FWPA 4G9ZA 3ENOA 1T6DA 2YJEA 4DQ8A 4Z94A 2E88A 3UKUA 1QQNA 3IFRA 4H5WA 4XEIA 1IJJA 2E8AA 4GNIA 1VQ6N 5GAHP 2UYTA 3QBWA 1KD1O 4J8FA 1HKGA 3FLCO 3I56N 3CJ7A 1Q86O 3LM9A 3TTCA 3FZLA 1W2BM 3CJCA 1VQKN 3HSCA 4B9QA 1TYQB 3JS6A 3EE8A 2IVNA 3E9OA 4BY9C 2KKZA 4CZHA 1J6ZA 3EO3A 2HBJA 3SMPA 5KPTA 5LJWA 5BN9A 1NWKA 2ZF5O 3R1XA 1T44A 2HMPA 4FWSA 4CBWA 1JJ2M 3BUZB 2YHWA 3ZETA 4IWVA 2JWKA 1BUPA 2NRTA 1NGDA 5AZIB 1XQSC 3DJCA 4FWLA 5M1NA 2W40A 2Q2RA 3GOIA 5AQGA 4WYBA 3DLLL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQK A;  4H5V A;  1MWK A;  3VF2 A;  3CQY A;  1TUY A;  3LL3 A;  5BRF A;  3U8X A;  4JHD B;  2P9N B;  1EQY A;  1K8K B;  1C0F A;  4BRN A;  3B8A X;  2FSJ A;  4HWI A;  5BPL A;  1RGI A;  1NGE A;  3CJ1 A;  4H0Y B;  2A40 A;  3L0Q A;  3BF1 A;  5AQJ A;  1GLE G;  5AR0 A;  3ZEU B;  2ASM A;  2Q36 A;  2QWL A;  5FPM A;  4BC3 A;  4CBX A;  2GEM A;  2CH6 A;  3IDH A;  3VGL A;  3VEN A;  4CJ7 A;  2FSK A;  4CD3 A;  1CZA N;  4FWO A;  3U4L A;  5AQM A;  3CIP A;  3LDN A;  4BRH A;  5TKY A;  5E84 A;  5AQY A;  1NGG A;  1NMD A;  4EFH A;  3EKU A;  4PKG A;  3EZW A;  5BPN A;  5JLF A;  2A5X A;  3TPQ A;  3WEE B;  4CZM A;  3A5N C;  4KBO A;  5KQD A;  3FZK A;  1Z6R A;  4H0O A;  3CER A;  3VET A;  1TYQ A;  3LDO A;  3TU5 A;  1SZ2 A;  3FGU A;  2P9K B;  2GUP A;  3S41 A;  3ZX2 A;  1KAX A;  3ATU A;  5AQU A;  5F1X A;  1S3X A;  4BG8 A;  4M7Y A;  3A5M C;  5F0X A;  2AP1 A;  4B1Z A;  3L4I A;  4H5R A;  3LM2 A;  5AZI A;  3O08 A;  5AQO A;  3VGK A;  2YI1 A;  5BN8 A;  1NM1 A;  3P4I A;  2I7N A;  1SAZ A;  4JD2 A;  4H0V B;  1T6C A;  4JHD A;  2P9N A;  3O1W A;  3ENH A;  3U9Z A;  1K8K A;  1NGI A;  1QZ6 A;  4YDU A;  3C0B A;  4YDU C;  4DB3 A;  4BR7 A;  5KPZ A;  4QS8 A;  5EX5 A;  2E1Y A;  1YUW A;  2EWS A;  1Y64 A;  1ATR A;  2BUP A;  2QXL A;  2P9S B;  2A6A A;  3VEV A;  4CZK A;  1LCU A;  4BQZ A;  5AQL A;  1U6Z A;  1JCG A;  4FOE A;  4MO5 A;  4CZI A;  5EOY A;  4AM6 A;  1RDW X;  5CE3 A;  3QFP A;  1QQM A;  1ATN A;  4BC5 A;  2P9L A;  4FWM A;  3HM8 A;  5JMV A;  2BTF A;  2GWK A;  3WEE A;  4FWK A;  3SJH A;  3QDK A;  3VES A;  3WXL A;  2GEL A;  4B1W B;  3H3O B;  1BA0 A;  3A8Y A;  3C7N B;  1QQO A;  4WQ5 A;  4WQ5 C;  3M3Z A;  4IO8 A;  1P8Z A;  2GWJ A;  3UE5 A;  4BR4 A;  5ADX H;  4IXC A;  1JCE A;  1MDU B;  2CGK A;  3O5B A;  4FOI A;  1LOT B;  2IIR A;  4JN4 A;  4BR0 A;  1BU6 O;  3ULE A;  4F9O A;  3VEW A;  2IVP A;  3O1B A;  3O80 A;  3CI5 A;  3WQU A;  2YHX A;  2ASP A;  4DCH A;  3MN9 A;  3ZX3 A;  3VPZ A;  2V7Z A;  5EY4 A;  4BC4 A;  1WUA A;  1HUX A;  3FZF A;  1QZ5 A;  4BRD A;  2Q0R A;  2E2O A;  4RTF D;  4BR5 A;  1HKB A;  3J8A A;  1X9J A;  4H0T B;  4XH5 A;  5AQH A;  4FPB A;  1HX1 A;  4K42 A;  1HPM A;  3DXM A;  2QWR A;  3H6E A;  4A2A A;  2DPN A;  2V51 B;  3MN7 A;  3VEZ A;  4FWN A;  2QWO A;  1NBW A;  4BG9 A;  2Q97 A;  1TUU A;  3MMV A;  2P9S A;  1SQK A;  3A0I X;  3CJB A;  5ELZ A;  3W3D A;  2E1Z A;  4A62 A;  1S22 A;  2A3Z A;  2D1K A;  4JD2 B;  2Q0U A;  3R9P A;  1GLA G;  3WXI A;  3HI0 A;  2AA4 A;  1BWF O;  5E26 A;  3U9D A;  2YCH A;  5BR9 A;  2ZWH A;  3EKS A;  1E4G T;  4PL7 A;  1QHA A;  1BG3 A;  3OHR A;  3VEO A;  4EIA A;  3O4W A;  3VEY A;  4BRA A;  3GDQ A;  5KQ8 A;  3VER A;  3RSE B;  3C7N A;  3VF4 A;  4H5N A;  1DKG D;  3LDP A;  4L3Q A;  2E2N A;  2P9L B;  1NGF A;  4PKH A;  5AQI A;  2PAV A;  4B1Y B;  2WUS A;  2ZGZ A;  3GL1 A;  2IVO A;  3WXJ A;  1BDG A;  1G99 A;  1U2V A;  3MDQ A;  1GLJ O;  4ISG A;  4E1J A;  5AFU A;  1ATS A;  2H3G X;  5AQF A;  1OKJ A;  4FSV A;  3ULE B;  1BA1 A;  2YHY A;  3LDL A;  3AAR A;  4JNE A;  3EL2 A;  1NGJ A;  3I8B A;  4QS9 A;  2KHO A;  4DHY A;  3IUC A;  4K25 A;  3W0L A;  4BVP A;  1KAY A;  1NGA A;  4ISF A;  1DEJ A;  5AQR A;  1D4X A;  4FWQ A;  4B1U B;  3MK6 A;  4FWR A;  1GLC G;  2QWN A;  4BRO A;  5JLH A;  3H46 O;  1XC3 A;  3MN5 A;  5ADX A;  3HBT A;  2FSN A;  3DXM B;  4O5F A;  3A5O C;  1ESV A;  1ZXO A;  3D2E B;  5FPN A;  4EAH D;  4CZG A;  5LJV A;  4FO0 A;  2A42 A;  4CBU A;  4AM7 A;  3DXK B;  1NGH A;  2QWP A;  3I33 A;  4BVO A;  5BRE A;  3RSE A;  4EHU A;  3KHY A;  3UKR A;  4O8K A;  4C23 A;  4PL8 A;  4BRI A;  3R6M A;  4XH4 A;  3AY9 A;  4IZ9 A;  5FPE A;  1R59 O;  3F9M A;  3SLC A;  2GTD A;  3WT0 A;  4CZF A;  2ASO A;  4BRL A;  1BOT O;  2YJF A;  4H0X B;  1DGK N;  3JXU A;  3DAW A;  2P9P B;  1NLV A;  3L6Q A;  2OAN A;  5AQV A;  3D2F A;  4BR2 A;  4BQL A;  3HZ6 A;  3H1Q A;  1JCF A;  2D0O A;  4CZE A;  1HKC A;  5EXW A;  1NGC A;  1U2V B;  2HOE A;  1KXP A;  2VYP A;  4XH1 A;  1HJO A;  2ZGY A;  5EVZ A;  4MLH A;  3QB0 A;  4BC2 A;  4MLE A;  4CZJ A;  5AZJ A;  4BR9 A;  2VWB A;  2E20 A;  2NLX A;  1V4S A;  2NZT A;  5BPM A;  4LC9 B;  3CHW A;  3SMS A;  1V4T A;  1C0G A;  5I9E B;  2NRH A;  3GBT A;  3D2E A;  2FXU A;  5B8H A;  1X3M A;  3R8E A;  3CQX A;  2CGL A;  2F9T A;  2A41 A;  2FF3 B;  4BRF A;  5FPD A;  1HLU A;  3DXK A;  3QML A;  3A5L C;  4A2B A;  4M63 C;  4B1X B;  4M7X A;  1MA9 B;  4BGB A;  2PBD A;  4HTL A;  2ITM A;  3GG4 A;  5AQZ A;  2I7P A;  3VOV A;  4BRP A;  1E4F T;  2D0P A;  3SK3 A;  1H1V A;  4RCH A;  3VF6 A;  1WOQ A;  4I6M B;  5BRH A;  3UKR B;  2QWM A;  3VEX A;  2VCP A;  1NGB A;  2P9P A;  3H1V X;  4H03 B;  2P9U A;  1GLL O;  1GLB G;  2P9I A;  1Z05 A;  2V7Y A;  4IJN A;  3CJ9 A;  3ZX0 A;  2V52 B;  3UB5 A;  3CJA A;  4MO4 A;  3M1F A;  2CH5 A;  1IG8 A;  1ZBS A;  3BP8 A;  3KVG A;  5AQX A;  3D2F B;  2Q31 A;  5AQS A;  3FFK B;  4BRM A;  2J4R A;  3FE1 A;  4K41 A;  4ISE A;  1YAG A;  2QW9 A;  5AQN A;  3VGM A;  2QWQ A;  1RFQ A;  3D7E O;  1Q18 A;  5AZJ B;  3M6G A;  3WUH A;  4B1V A;  3MCP A;  3GE1 A;  4CD1 A;  1YXQ A;  2CGJ A;  3AAP A;  3FZH A;  1KAZ A;  3IMX A;  5AQP A;  4CI6 A;  2F9W A;  4QS7 A;  3UKU B;  5LY3 A;  3AAQ A;  3QBX A;  3WQT A;  4FPA A;  3LDQ A;  3FR0 A;  3H3N O;  4EHT A;  3MN6 A;  3EN9 A;  2FLO A;  3O6W A;  3FZM A;  4NO7 A;  3G25 A;  4BGA A;  4BRQ A;  3BEX A;  4IJA A;  3O8M A;  4I6M A;  4PKI A;  3KZB A;  4H0P A;  3ID8 A;  3ZET B;  5AQT A;  5AQQ A;  4H5T A;  4CZL A;  3H45 C;  5KPR A;  4BRG A;  3QFU A;  1BO5 O;  4BRE A;  4RWT A;  4K43 A;  4BRC A;  3ATV A;  1YVN A;  2HF4 A;  5AFU H;  3ZEU A;  1MWM A;  1XUP O;  3HTV A;  3QIC A;  4Y0W A;  4A61 A;  2P9U B;  2QM1 A;  4FL9 A;  5F2R A;  2P9I B;  4JAX A;  3BF3 A;  2FF6 A;  1GLF O;  2Q1N A;  1ZC6 A;  4NB4 A;  3CET A;  4WQ4 A;  4WQ4 C;  1GLD G;  2HF3 A;  5JIC A;  5AQW A;  2D4W A;  4GY2 B;  4BRK A;  1X3N A;  2W41 A;  2E2Q A;  5BRD A;  3WXK A;  3DWL A;  2P9K A;  2E2P A;  4FWP A;  3ENO A;  1T6D A;  2YJE A;  4DQ8 A;  4Z94 A;  2E88 A;  3UKU A;  1QQN A;  3IFR A;  4H5W A;  4XEI A;  1IJJ A;  2E8A A;  4GNI A;  2UYT A;  3QBW A;  4J8F A;  1HKG A;  3FLC O;  3CJ7 A;  3LM9 A;  3FZL A;  3CJC A;  3HSC A;  4B9Q A;  1TYQ B;  3JS6 A;  2IVN A;  4CZH A;  1J6Z A;  3EO3 A;  3SMP A;  5KPT A;  5LJW A;  5BN9 A;  1NWK A;  2ZF5 O;  1T44 A;  2HMP A;  4FWS A;  4CBW A;  3BUZ B;  2YHW A;  3ZET A;  4IWV A;  1BUP A;  1NGD A;  5AZI B;  1XQS C;  3DJC A;  4FWL A;  2W40 A;  2Q2R A;  3GOI A;  5AQG A;  4WYB A; 
#chains in the Genus database with same CATH topology
 3AO3 A;  3SQ4 A;  3PX0 A;  1ZYQ A;  4JI7 K;  4JHD B;  1EQY A;  1K8K B;  2XRI A;  2HHV A;  1IBK K;  4HWI A;  4CGD A;  3L0Q A;  4BAC A;  2Q36 A;  2QWL A;  5FPM A;  4BC3 A;  4ILG B;  4CBX A;  1K8A O;  4V19 S;  3VEN A;  4CES A;  3G6E N;  3SQ2 A;  4CD3 A;  1CZA N;  2OA8 A;  4IOC L;  3U4L A;  5AQM A;  3LDN A;  5TKY A;  5AQY A;  1SL0 A;  3D6R A;  2XHB A;  3EKU A;  4CGH A;  4DSJ A;  3O9T A;  4M41 A;  1VSD A;  3E9P A;  4FJJ A;  3OYN A;  4O8U A;  1YTU A;  2HVH A;  4B9T A;  3M5R A;  4DKW A;  4CJV A;  2O8F B;  3LDO A;  1SZ2 A;  3VQQ A;  3KLF A;  1KAX A;  1VSK A;  5LMN K;  5F1X A;  4BG8 A;  4KO0 A;  4CJE A;  1OVY A;  2A1R A;  3OYB A;  4CGF A;  4NCB A;  4IKF A;  4AHS A;  3SAG A;  5AQO A;  3MEG A;  1U49 A;  3QER A;  1D9D A;  1NM1 A;  3F73 A;  3VQ6 A;  2OZM A;  5A2Q O;  1T6C A;  2P9N A;  4DB3 A;  5C42 A;  1EKE A;  5EX5 A;  1QTM A;  4GKJ K;  3VQB A;  1Y64 A;  3U3G A;  1Q7Y O;  5KGW A;  1S6P A;  5AQL A;  4CGJ A;  1JCG A;  3CCQ N;  3ZT3 A;  4FJH A;  2PYL A;  2NRW A;  5HRN A;  3P31 A;  1GOA A;  2O8C A;  1C0M A;  1NK8 A;  1U48 A;  4KHW A;  4FWM A;  1LWC A;  2BTF A;  3WEE A;  4RW4 A;  1UA1 A;  3DYA A;  4CJF A;  3WXL A;  2FC0 A;  2RKI A;  5HOO A;  3H3O B;  1BA0 A;  3ZSW A;  1QQO A;  3O4Q A;  4YOW A;  4IO8 A;  5ADX H;  1P8Z A;  4BR4 A;  3WNE A;  1JCE A;  1S6Q A;  1MDU B;  3PIP L;  4KB1 A;  1D8Y A;  4A59 A;  5H1S Q;  2ITG A;  4BR0 A;  3VEW A;  1UA0 A;  4FJ9 A;  4DCH A;  3A2F A;  3ZX3 A;  1HNX K;  3VPZ A;  5EY4 A;  1YI2 N;  1N8R O;  3CCE N;  1HUX A;  3FZF A;  3CC7 N;  4OO1 J;  2E2O A;  1BCM A;  2DFF A;  4FLY A;  4NCA A;  1WNS A;  3OA9 A;  4FPB A;  4DUZ K;  2QWR A;  4JKG B;  4DTM A;  3RWU A;  1NBW A;  4YY3 K;  2Q97 A;  3W3D A;  4LSL A;  3IS9 A;  4A62 A;  1RCH A;  2YKM A;  4JI6 K;  4CJ5 A;  4BE0 A;  5D3G A;  2Q0U A;  3R9P A;  2QXF A;  4CF0 A;  2E4L A;  3WNG A;  1EXQ A;  5BR9 A;  1E4G T;  1QHA A;  4CEQ A;  1S72 N;  3OHR A;  4BRA A;  4CHZ A;  3L2V A;  2F4V K;  4OJR A;  3VER A;  4H5N A;  1ASW A;  4LF8 K;  4FVU A;  2QKK A;  4L3Q A;  2P9L B;  3U3Y A;  1TAU A;  5AQI A;  4LSN A;  3LAL A;  1YIT N;  2PAV A;  1A5W A;  1HQU A;  4GV9 A;  5K14 A;  2UXB K;  5HLF A;  3AVA A;  2HHW A;  1W97 L;  4ID5 A;  4C8N A;  5AFU A;  2H3G X;  1B92 A;  4FSV A;  3ULE B;  4PY5 A;  1TKD A;  1BA1 A;  3SBG A;  3VQC A;  4DS4 A;  3AA2 A;  3KKS A;  1NGJ A;  3I8B A;  1YT3 A;  4DUY K;  1KAY A;  1NGA A;  5AQR A;  4FWR A;  3ULD A;  1IO2 A;  5FRM A;  2Z1I A;  3ZSR A;  1KVB A;  2WC9 A;  2FSN A;  4U67 L;  1ZXO A;  3SJJ A;  1TL1 A;  3CCJ N;  4CZG A;  5LJV A;  2HST A;  4AM7 A;  3DXK B;  1QSL A;  1CZB A;  4KPY A;  1NJX A;  2QWP A;  4BVO A;  4EHU A;  1KSP A;  4FZZ A;  2OTJ N;  1GOC A;  4C23 A;  1JL2 A;  3DOL A;  5FRO A;  1RDC A;  3OYA A;  2YKN A;  4B9V A;  5FPE A;  5IWA K;  3L4Q A;  1R59 O;  1TKX A;  2IS3 A;  5M1F A;  3RR7 A;  1S1U A;  1HJR A;  4TSX A;  3TAF A;  4IFV A;  2ASO A;  3HRG A;  1T7P A;  1BOT O;  3JXU A;  3L3V A;  4OGE A;  1NLV A;  3CG7 A;  4Q5V A;  1JXE A;  3DLK A;  4A5A A;  5JVH L;  4M3W A;  4RW7 A;  4DV5 K;  1JCF A;  2HHH K;  3ZSV A;  2YNI A;  1C1A A;  2ETJ A;  1U2V B;  4E1M A;  4O44 A;  2VYP A;  1NOZ A;  4YOT A;  5EVZ A;  3ZT0 A;  3QB0 A;  4BC2 A;  3NGY A;  4FK2 A;  4DR4 K;  1K9M O;  1U04 A;  4GMJ B;  4KFB A;  2B4J A;  4JI2 K;  4CEC A;  3CQX A;  2CGL A;  2F9T A;  2A41 A;  3MWT A;  5FPD A;  4CJ4 A;  1VQO N;  5E41 A;  1FKO A;  4A2B A;  4B1X B;  1VK0 A;  4JKB A;  4E7J A;  3CFP A;  1WBD A;  4BDZ A;  3MXM A;  5AQZ A;  1WN7 A;  4N47 A;  4Z4C A;  1C1C A;  2QI2 A;  1YJN N;  4B8C A;  3SK3 A;  1B9F A;  3VQD A;  4CJU A;  3AO5 A;  1DTQ A;  5GAD P;  3OS0 A;  1GLL O;  1J5O A;  2P9I A;  2P5G A;  1TL3 A;  3SBT A;  3CJ9 A;  1WB9 A;  3VN5 A;  3D45 A;  3TSP A;  4E1N A;  3UB5 A;  1BIS A;  4I2Q A;  3M1F A;  1A5X A;  4DF8 A;  2CH5 A;  1JXB A;  2B6A A;  1ZBS A;  4W5R A;  2GBZ A;  3D2F B;  5J2N A;  4O5B A;  1IBM K;  3T1H K;  2UXD K;  3OYJ A;  1D9F A;  2UUB K;  3FE1 A;  4K41 A;  1N32 K;  1NK5 A;  4CIF A;  3MX2 A;  4CD1 A;  1YXQ A;  2CGJ A;  3AAP A;  3FZH A;  3ZT1 A;  3UKU B;  3VQE A;  4AIL C;  4FPA A;  1JLC A;  1FK9 A;  4PHT X;  3LDQ A;  3THW B;  2G8V A;  4EHT A;  1JLQ A;  3MN6 A;  3DOK A;  5SWM A;  4DFK A;  2HHS A;  3O6W A;  1IG9 A;  1EP4 A;  4NO7 A;  3TAG A;  1XMO K;  3BEX A;  4N41 A;  4I6M A;  3KK3 A;  4CJT A;  3PSI A;  5GAE P;  3HO1 A;  4YOR A;  3KZB A;  3LP3 A;  3ZET B;  3O9U A;  5KPR A;  3NCI A;  4FW2 A;  4RWT A;  5CYQ A;  4BRC A;  3G4S N;  1BGX T;  2YHA A;  4DV6 K;  2Z1G A;  3P1G A;  5M1P A;  3HTV A;  4Y0W A;  3KLE A;  4FL9 A;  5F2R A;  3CCR N;  4J2A A;  4QAG A;  4E89 A;  1NKC A;  4JKD A;  3C6U A;  3O3G A;  3J7Z O;  5FDL A;  3PY8 A;  4WQ4 A;  4WQ4 C;  2F8S A;  1GLD G;  1K73 O;  2I5J A;  4FJ8 A;  1T8E A;  2KZZ A;  4BRK A;  3HST B;  3WNH A;  3I55 N;  1NJW A;  5FRN A;  4HUE A;  3V9S A;  3WXK A;  2E2P A;  2KQ2 A;  2Y1I A;  1OH8 A;  4Z94 A;  4FW1 A;  4XEI A;  4GNI A;  1VQ6 N;  3J7A P;  1N33 K;  2HB5 A;  3H08 A;  3FZL A;  3KLI A;  2BAN A;  3CJC A;  1VQK N;  2A1S A;  4ELT A;  1TYQ B;  3EE8 A;  3E01 A;  4PWD A;  4JI5 K;  2HMI A;  3K57 A;  5KPT A;  4JI8 K;  2ZF5 O;  4LF5 K;  4CBW A;  1S1V A;  2YHW A;  4FZY A;  1NJZ A;  3MXI A;  3SQ1 A;  1LAV A;  3B6P A;  1TK8 A;  5AZI B;  4FWL A;  2W40 A;  5AQG A;  4WYB A;  1HQE A;  5AQK A;  2DY4 A;  4DR6 K;  1MWK A;  3VF2 A;  4FXD A;  5KGX A;  4ZTF A;  2QEX N;  2HHX A;  3U8X A;  2FSJ A;  1RGI A;  4K0K K;  1NGE A;  3CJ1 A;  3SUN A;  3ID6 A;  1I94 K;  3OJU A;  3AGR A;  3ZEU B;  3TAN A;  2ASM A;  3IDH A;  4X65 K;  2D5R A;  4HUG A;  2NRV A;  2ZJQ L;  4KHU A;  4FLZ A;  3OVN A;  3TAB A;  1Q8I A;  4DR2 K;  5BPN A;  4E0D A;  3TPQ A;  4KBO A;  5KQD A;  3FZK A;  1Z6R A;  3AA4 A;  4FK4 A;  2WBN A;  1BCO A;  4LY7 A;  3VET A;  2D0B A;  3TU5 A;  2GUP A;  1S9E A;  3ZX2 A;  4JI3 K;  3PX6 A;  1G15 A;  1LWE A;  5AQU A;  1S3X A;  3IG1 A;  2F96 A;  4JK8 A;  2XY5 A;  4B1Z A;  3LWL A;  3L2R A;  3PO4 A;  1EWR A;  2NUB A;  1QHT A;  4CHO A;  4MDA A;  3VGK A;  2YI1 A;  4DV2 K;  3WXM B;  3P4I A;  1SAZ A;  1CXU A;  4H0V B;  3U9Z A;  1NGI A;  1QZ6 A;  4YDU A;  4YDU C;  3NGI A;  3NH1 A;  5KPZ A;  3SAF A;  2E1Y A;  4Q0B A;  1Q9X A;  3NF6 A;  4FJN A;  4F2R A;  1VSI A;  4UQG A;  2QXL A;  1U4B A;  2P9S B;  4C1N K;  3KWG A;  4Z0U A;  4E7I A;  4MDB A;  1LCU A;  2X74 A;  1LAW A;  1Q82 O;  4LF4 K;  5KRT A;  5DK5 A;  2RN2 A;  1RDW X;  3J80 O;  3E9L A;  5CE3 A;  4DU1 A;  3PIO L;  3THX A;  3OBY A;  4BC5 A;  2P9L A;  5T7B A;  1VSL A;  1HRH A;  4J2B A;  2GWK A;  3QDK A;  4O4G A;  1HYS A;  2JLE A;  3IAY A;  3NBP A;  3QIN A;  4B3R K;  4B1W B;  3C7N B;  3M3Z A;  3UE5 A;  2PFU A;  1X9S A;  4FOI A;  3M8P A;  1JLE A;  4JN4 A;  3ULE A;  4NCG A;  1ZBH A;  3O1B A;  1FW6 A;  4HCC A;  2HNZ A;  3KKR A;  5CHI A;  3DLG A;  1YHQ N;  2V7Z A;  2EHG A;  3OYI A;  1WUA A;  4IFE A;  3AA5 X;  4BRD A;  5HBM A;  4IDH A;  4RTF D;  5HL7 L;  1IKX A;  5FLX O;  2Z1H A;  4X64 K;  3V9W A;  3H6E A;  3ALY A;  5CZ2 A;  4F4K A;  4FWN A;  4JI1 K;  2QWO A;  3T7Z A;  5CY4 A;  3A0I X;  3CJB A;  3LAK A;  5ELZ A;  1SL1 A;  2O8E B;  3K2P A;  3PV8 A;  4JKC A;  2A3Z A;  4JD2 B;  1RDU A;  3CD6 N;  1GLA G;  3WXI A;  2AA4 A;  4WFA L;  1T3V A;  2HVI A;  2YCH A;  3TTF A;  4DQQ A;  3K5M A;  4PL7 A;  4Y1C A;  4EIA A;  4KKO A;  3RSE B;  3VF4 A;  4DV1 K;  1O13 A;  3LDP A;  4R5P A;  2E2N A;  3NAE A;  1YJW N;  4DG1 A;  3SPY A;  5SZT A;  3GL1 A;  4FM1 A;  1BDG A;  1G99 A;  1U2V A;  3V81 A;  1GLJ O;  4JKE A;  4FLT A;  1XC9 A;  4ISG A;  5CZ1 A;  2W42 A;  3C6A A;  1VQM N;  1ATS A;  2DFH A;  2YHY A;  3AAR A;  1FXX A;  4QS9 A;  4DHY A;  3W0L A;  4WFB L;  3CQ8 A;  4ISF A;  1D4X A;  4FWQ A;  4KI4 A;  2DTU A;  4N5S A;  3CC2 N;  3THY B;  1KLN A;  1RTH A;  1VSF A;  4DSK A;  3ZSO A;  5GAG P;  1XC3 A;  5C15 A;  3MN5 A;  1Z26 A;  3DXM B;  3A5O C;  1IKV A;  5J2P A;  4QCL A;  1OH5 A;  2BDP A;  4R79 A;  4GKK K;  1EO1 A;  1GOB A;  3S9H A;  5HRO A;  4FVM A;  3DRR A;  1XNQ K;  3SUQ A;  1M90 O;  4PL8 A;  2UU9 K;  2QTD A;  4IEE A;  4XH4 A;  4DU4 A;  5AJ3 K;  2RPI A;  3SLC A;  2GTD A;  2RHK A;  4BRL A;  3VA0 A;  2OPS A;  2P9P B;  4BE2 A;  3L6Q A;  4CED A;  3OYD A;  5AQV A;  3D2F A;  4BR2 A;  4BQL A;  4CZE A;  4CHQ A;  3HM9 A;  1NGC A;  2UXC K;  2HOE A;  1KXP A;  4DTN A;  4XH1 A;  3HVT A;  2O8D B;  2ZGY A;  4CGI A;  1C6V A;  3C6H A;  4MLE A;  1OH7 A;  2VGN A;  3QEP A;  2VWB A;  4F3T A;  3QEX A;  2E20 A;  1VQ9 N;  2NLX A;  1V4S A;  2WOM A;  1BI4 B;  4LC9 B;  1V4T A;  3MEC A;  1J54 A;  4FJ5 A;  3HPO A;  4FJK A;  4BWM A;  4DFM A;  5I9E B;  1VQ5 N;  3D2E A;  2FXU A;  5B8H A;  3R8E A;  1XHX A;  1JKH A;  3CC4 N;  1L3U A;  4DR5 K;  2VG6 A;  2X78 A;  3PLA A;  1HNZ K;  2FF3 B;  1HLU A;  4JK9 A;  5J2M A;  3A5L C;  1N5Y A;  4PUO A;  4Z4E A;  4DQP A;  1YF5 L;  4CFA A;  5GIP A;  1MA9 B;  4YOX A;  2FBV A;  2I7P A;  3PSF A;  2D0P A;  2OCE A;  4CJR A;  3CM6 A;  3QIP A;  4NXM K;  4RW9 A;  1S1X A;  3UKR B;  4DQS A;  3VEX A;  4JK7 A;  4AHU A;  3WNF A;  1GLB G;  2G8H A;  3O3F A;  4AHV A;  3AVH A;  1QVG M;  3B6O A;  1F21 A;  1WSI A;  1J53 A;  4KHP K;  4MO4 A;  4CGG A;  4DTR A;  1DTT A;  1IG8 A;  2ZM6 K;  3BP8 A;  2Q31 A;  2BE2 A;  2YV0 X;  2NRX A;  5AQS A;  4CFB A;  3OYM A;  3MED A;  1FJG K;  1YAG A;  3TAE A;  2QWQ A;  3WUH A;  4B1V A;  1RT4 A;  2VQE K;  1KAZ A;  3IMX A;  4KH5 A;  2YX6 A;  5AQP A;  4FM2 A;  2HW3 A;  3AVM A;  1JLA A;  3QLH A;  3CPW M;  1SUQ A;  3FR0 A;  3THV A;  2FLO A;  4UY8 O;  4E7L A;  3TSQ A;  3G25 A;  4BGA A;  3HK2 A;  4FJM A;  4LFB K;  4N56 A;  5DM7 L;  1CXQ A;  3O8M A;  1KC8 O;  1SKR A;  4IOA L;  2ATQ A;  1HR0 K;  4H0P A;  3ID8 A;  5AQT A;  3SI6 A;  3H45 C;  4BRG A;  2IGI A;  4JLH A;  2Q3S A;  4NLB A;  3SAH A;  3HOT A;  3EZ5 A;  1RTD A;  3ATV A;  4ELU A;  1YVN A;  4CF2 A;  1BIU A;  3ZEU A;  1QVF M;  2VGM A;  3QIC A;  5CR4 A;  2QM1 A;  1KLM A;  3BF3 A;  4FJG A;  3AVI A;  2Q1N A;  1TGO A;  2RE2 A;  5LL6 Z;  4IDK A;  5JIC A;  2D4W A;  1WSF A;  4NYF A;  2P5O A;  2W41 A;  4AH9 A;  3O9Q A;  3DWL A;  4CJK A;  3RRH A;  1T6D A;  2YJE A;  4CHP A;  4DQ8 A;  1IJJ A;  1J9A A;  4AHR A;  1NG9 A;  1J5E K;  3QO9 A;  3FLC O;  3KLG A;  3K5N A;  2FBX A;  3LM9 A;  1W2B M;  3HSC A;  3NHG A;  1KFD A;  3E9O A;  5J2Q A;  2HBJ A;  2XY7 A;  2GV9 A;  3TAR A;  1NWK A;  4C8O A;  3R1X A;  3HT3 A;  1JJ2 M;  4M45 A;  1X9W A;  1E3M A;  2JWK A;  1BUP A;  1WLJ A;  3CFO A;  2XY8 A;  1HYV A;  1XQS C;  5M1N A;  3GOI A;  1Y97 A;  4CHY A;  4B3S K;  3OY9 A;  4H5V A;  1TUY A;  2NNW A;  5HRR A;  4OPA A;  2P9N B;  5C24 A;  3RR8 A;  3F9K A;  3B8A X;  1RDB A;  5BPL A;  1TV6 A;  3PO5 A;  1IV0 A;  1TK5 A;  2OPQ A;  3I8D A;  5AQJ A;  4FJI A;  5AR0 A;  4QOZ B;  3VGL A;  3AVN A;  4FWO A;  1NJI O;  3CIP A;  4BRH A;  4I7F A;  4EFH A;  2O8C B;  3QET A;  1IKY A;  2HHQ A;  3AVJ A;  4BDY A;  2A5X A;  3WEE B;  4CZM A;  4YOV A;  3V6D A;  4CIG A;  1U47 A;  4H0O A;  3CER A;  3ATU A;  4E19 A;  4FJX A;  2JGU A;  3CCL N;  1WAF A;  4NYN A;  4JYA K;  3HPH A;  4GVM A;  3L4I A;  4NLC A;  2G8U A;  1WSE A;  3HJF A;  2UUC K;  4B8A B;  3VA3 A;  2O8B B;  3O08 A;  4DTO A;  2HHU A;  1YVU A;  2O8E A;  4EP5 A;  2I7N A;  3CM5 A;  4KTQ A;  4JD2 A;  3RVC A;  3L3U A;  4JHD A;  3O1W A;  3ENH A;  1K8K A;  4OKK A;  1XI1 A;  5CYM A;  4BR7 A;  2YNH A;  4ID1 A;  2EWS A;  3NVK A;  2BUP A;  1LW0 A;  3V9U A;  3MEE A;  1L3S A;  1RT3 A;  3VEV A;  4CZK A;  4KRF A;  4BQZ A;  3KK2 A;  1U6Z A;  4MO5 A;  3FFI A;  5EOY A;  1HYZ A;  4AM6 A;  4CK2 A;  4J2D A;  1QQM A;  1OH6 A;  4H4O A;  2PY5 A;  3HM8 A;  5JMV A;  1KTQ A;  4AHT A;  3ZT2 A;  3K5O A;  2GEL A;  1NK0 A;  1KQS M;  4BY9 C;  3A8Y A;  2O8F A;  3ASM A;  4JRQ A;  4IXC A;  2CGK A;  4BDP A;  2IIR A;  4WF9 L;  1BU6 O;  4F9O A;  2IVP A;  1HMV A;  3O80 A;  3CI5 A;  3WQU A;  2YHX A;  1NKB A;  4DSL A;  4B3M K;  3VQ8 A;  2W6K A;  3KK7 A;  4FLX A;  1QSS A;  1WSG A;  2IAJ A;  2OPR A;  4BC4 A;  1QZ5 A;  1C0U A;  4WCE L;  3K59 A;  2Q0R A;  3G71 N;  1CZ9 A;  4F8R A;  3J8A A;  4XH5 A;  4DSF A;  2G8K A;  3QNO A;  1SKW A;  2BGG A;  4CF8 A;  2KZM A;  1HX1 A;  4K42 A;  4B3T K;  3DXM A;  1DLO A;  2X6S A;  4A2A A;  2DPN A;  2V51 B;  4DTX A;  5HP1 A;  1Z25 A;  1ZBF A;  3DMJ A;  3HPG A;  3RTV A;  3ZSY A;  1UAX A;  1TUU A;  3MMV A;  1SQK A;  2PZS A;  4K8Z A;  4JRP A;  1XWL A;  1X9M A;  1S22 A;  3CCV N;  1VQN N;  2D1K A;  4KHN A;  2IDO A;  3HI0 A;  2UUA K;  3U9D A;  3QES A;  4FLV A;  4M3U A;  2ZWH A;  3TR8 A;  1DT9 A;  3O4W A;  3R3L A;  3MX5 A;  1YJ9 N;  4YOY A;  2GUI A;  3QIO A;  3OYK A;  1NKE A;  1O1W A;  2NRR A;  4PKH A;  1NGF A;  4B1Y B;  2WUS A;  4FM0 A;  2ZGZ A;  5I3U A;  3LAM A;  4CJP A;  2GX9 A;  2IVO A;  3MDQ A;  2OTL N;  3IKM A;  4Y1D A;  2O8D A;  4OLB A;  3AVL A;  4C8L A;  4E1J A;  1RBR A;  2HBK A;  3KD5 E;  5AQF A;  1OKJ A;  2D0C A;  3LDL A;  3C94 A;  4DV0 K;  4ZTJ A;  2KHO A;  3IRX A;  3IUC A;  1SS6 A;  3OYL A;  4E7K A;  1DEJ A;  2FBY A;  4JKG A;  3NFA A;  3T3F A;  2E6L A;  4CIE A;  4KRE A;  1GLC G;  1BHL A;  2QWN A;  2F7T A;  3P38 A;  1UWB A;  3EE9 A;  3ZCM A;  3OYG A;  4MQ3 A;  3ZYY X;  3H46 O;  3P83 D;  3HBT A;  4OPJ A;  4O5F A;  1NNE A;  4FO0 A;  3LDS A;  2A42 A;  3TAP A;  1LV5 A;  4B9N A;  3T69 A;  3KHY A;  3UKR A;  4CK3 A;  4O8K A;  1Q81 O;  3KK1 A;  4K8X A;  4OKE A;  4BRI A;  1IKW A;  3F9M A;  2YJF A;  4H0X B;  2Y1J A;  1DGK N;  2HND A;  4F3O A;  2OAN A;  3OW2 M;  4HVJ A;  3HVR A;  3HZ6 A;  4JI0 K;  3H1Q A;  1BL3 A;  1CLQ A;  4IOX A;  2G8W A;  3KD1 E;  4CFD A;  1LW2 A;  4CJQ A;  1VRT A;  4OLA A;  1HKC A;  5EXW A;  3OYE A;  4MLH A;  1TVR A;  3VQ4 A;  3JYT A;  4DU3 A;  1KCF A;  4YOU A;  4BR9 A;  4CER A;  4DFJ A;  3LP0 A;  5MLC Q;  1YTA A;  2Z1J A;  3LZI A;  1RDD A;  2NZT A;  3ZLJ A;  3CHW A;  2E5L K;  1C0G A;  2XY6 A;  2NRH A;  3GBT A;  2F8T A;  4LF6 K;  4IG3 A;  3ZSZ A;  4BRF A;  3DXK A;  3MAQ A;  1OVQ A;  4GV3 A;  3N4P A;  4M63 C;  4M7X A;  1RTI A;  4O55 A;  5HRS A;  4HTL A;  2ITM A;  2R7Y A;  3N4Q A;  3ZT4 A;  3VOV A;  2YNF A;  2VWJ A;  4DV7 K;  4Z4I A;  3T1Y K;  4E3S A;  4IFY A;  3K5L A;  1C1B A;  1H1V A;  4RCH A;  1XMQ K;  1WAJ A;  5DM6 L;  3RMC A;  4I6M B;  5BRH A;  1NGB A;  3BDP A;  3H1V X;  4H03 B;  4OVL A;  3SQ0 A;  2G8F A;  3KWI A;  1RBT A;  3VQP A;  1L3T A;  4B9M A;  3AVG A;  4FLU A;  3CXC M;  1SKS A;  1R0A A;  5KI6 A;  4M3T A;  1VSM A;  2OPP A;  3KVG A;  4YNQ A;  3HL8 A;  4BRM A;  4CEZ A;  2J4R A;  3E1Y A;  1S9G A;  5TKW A;  3SNN A;  4HUF A;  3O4N A;  4FLW A;  3DRS A;  1BQN A;  2QW9 A;  4PA1 A;  5AQN A;  2ZE2 A;  3VGM A;  1RFQ A;  2QKB A;  4E7H A;  1VRU A;  3V9Z A;  5AZJ B;  3MCP A;  3LZJ A;  3GE1 A;  3K58 A;  2ZJR L;  4DLG A;  2VG5 A;  4DFP A;  2F9W A;  4QS7 A;  4GV6 A;  2DFE A;  3TI0 A;  3AAQ A;  4CF9 A;  4DR7 K;  1NK6 A;  4IEI A;  3ENB A;  3DLR A;  3AA3 A;  4CJ3 A;  2D0A A;  3SV4 A;  1MU2 A;  5AQQ A;  1NJY A;  1IBL K;  3QFU A;  4BRE A;  1HPZ A;  3ISN C;  4CK1 A;  3ITH A;  1ZBI A;  4A61 A;  4M3R A;  1C0T A;  5C2F A;  4DS5 A;  2P9U B;  2HHT A;  3VQA A;  3JSM A;  1GLF O;  1QE1 A;  1ZC6 A;  4JS5 A;  1VQ4 N;  3CET A;  4KTZ A;  2HF3 A;  3KTQ A;  5AQW A;  4YHH K;  4LFC K;  1D5A A;  1RT5 A;  4O0J A;  1X3N A;  4U7B A;  3O9S A;  3BZC A;  2E2Q A;  5BRD A;  4HCB A;  4G9Z A;  4FWP A;  4OKJ A;  4CEA A;  2E88 A;  3UKU A;  1QQN A;  3IFR A;  4H5W A;  1WBB A;  1I39 A;  1QS4 A;  4CEF A;  3KLH A;  2UYT A;  3QBW A;  4BWJ A;  4J8F A;  3THW A;  1NK4 A;  4CJW A;  3CJ7 A;  5KRS A;  4HTU A;  3NH2 A;  4DMN A;  3NF8 A;  2VQF K;  4CFC A;  4Z4H A;  4AQY K;  3QEV A;  2O8B A;  2KKZ A;  4CZH A;  4HHT A;  3EO3 A;  2KW4 A;  5LJW A;  5BN9 A;  4IBN A;  1RDA A;  1T44 A;  3BUZ B;  4CJS A;  3ZET A;  3JAM O;  2AJQ A;  4IWV A;  2LSN A;  2NRT A;  3CYM A;  3DRP A;  4B9L A;  3DJC A;  1KRP A;  3DLL L;  4CEO A;  5DMR A;  4FCY A;  1WSJ A;  3CQY A;  3F5T A;  3LL3 A;  5J1E A;  2KTQ A;  5BRF A;  1C0F A;  4BRN A;  1TKT A;  1RBS A;  4LH5 A;  1RT1 A;  4H0Y B;  1KVA A;  2A40 A;  3BF1 A;  1GLE G;  4KH6 A;  4CI6 A;  4DTJ A;  2GEM A;  2CH6 A;  2NRZ A;  2ZQB A;  4CJ7 A;  3QEI A;  2FSK A;  5C25 A;  2KLA A;  3M8R A;  4WE1 A;  5E84 A;  1JLG A;  1NGG A;  1NMD A;  3DLE A;  3THX B;  4PKG A;  1HNV A;  1X1P A;  3EZW A;  3RMD A;  4H8K A;  5JLF A;  2XO7 A;  3A5N C;  3LP1 A;  1HNI A;  4JEP A;  3LPU A;  3NF7 A;  3OJS A;  1KVC A;  1L5U A;  3Q7B A;  1TYQ A;  3FGU A;  2P9K B;  4B9S A;  2JWL A;  4ILJ A;  2FBT A;  3S41 A;  4FK0 A;  4RW6 A;  3OYC A;  3UIQ A;  3PUF A;  4M7Y A;  3A5M C;  4F2S A;  5F0X A;  1BQM A;  2AP1 A;  3AV9 A;  4DV4 K;  4ZHR A;  4NXN K;  4H5R A;  4LF9 K;  4W5Q A;  3LM2 A;  5AZI A;  3CF5 L;  5BN8 A;  3NVM A;  4KI6 A;  3KIO A;  3LAN A;  1NU0 A;  1Q9Y A;  3C6T A;  4DSE A;  3C0B A;  4QS8 A;  2QK9 A;  1RTJ A;  1YUW A;  1RBV A;  3AVC A;  1ATR A;  3I0S A;  2YNG A;  2ZJP L;  3V4I A;  2A6A A;  1S5J A;  3V1Q A;  1TK0 A;  4LF7 K;  3LPT A;  1JLF A;  1W7A A;  4FOE A;  1XHZ A;  4CZI A;  1RBU A;  3QFP A;  1ATN A;  1FKP A;  4DLE A;  3MWP A;  2P1J A;  3NDK A;  4G1Q A;  4FWK A;  3SJH A;  3VQ9 A;  3VES A;  4C8K A;  4WQ5 A;  4A57 A;  4WQ5 C;  4W5O A;  2QA4 N;  1VSE A;  2GWJ A;  4OGC A;  2W6L A;  3F2K A;  5GIO A;  2WFB A;  3O5B A;  1LOT B;  3OYF A;  3EYZ A;  1SL2 A;  3QEW A;  4KH4 A;  4Z4F A;  4CE9 A;  4L8R B;  2ASP A;  3CME N;  2IOC A;  3OS2 A;  3SUP A;  3MN9 A;  4CEE A;  4GW6 A;  3TAM A;  1EET A;  1M1K O;  1S1T A;  1YIJ N;  1WSH A;  3OYH A;  5LMU K;  4BR5 A;  1HKB A;  1X9J A;  4M42 A;  4H0T B;  5AQH A;  5C0Y A;  3VQ5 A;  1HPM A;  4ELV A;  4B3O A;  3SYZ A;  1W0H A;  3MN7 A;  3VEZ A;  3J81 O;  4I9Q A;  3AGK A;  4BG9 A;  4Z4G A;  2P9S A;  4H4M A;  1LWF A;  2E1Z A;  3LWM A;  3AO2 A;  1NK9 A;  2HBM A;  2KFZ A;  1I3A A;  2O4I A;  1BWF O;  5E26 A;  1ZBL A;  2BH1 A;  3AVF A;  2X6N A;  3EKS A;  4DF4 A;  3PX4 A;  3P39 A;  1BG3 A;  3VEO A;  3VEY A;  3NE6 A;  3GDQ A;  5KQ8 A;  3C7N A;  1DKG D;  4AF1 A;  4DTS A;  3HOS A;  3TWH A;  1VAZ A;  1RIL A;  3K9J A;  2WTU A;  3WXJ A;  4CVN E;  1VSH A;  3L8B A;  1A5V A;  4CJL A;  3KJV A;  4X66 K;  4JNE A;  3EL2 A;  4JV5 K;  4OPH A;  4K25 A;  4BVP A;  3NH0 A;  5M1K A;  3HXM A;  4BE1 A;  3HYF A;  4B1U B;  3MK6 A;  3U6F A;  4LD0 A;  4BRO A;  5JS1 A;  5JLH A;  1VHX A;  4LFA K;  1BIZ A;  1VQP N;  4OPK A;  1VQ7 N;  5ADX A;  3Q7C A;  1EWQ A;  1ESV A;  4CCH A;  5C10 A;  3D2E B;  5FPN A;  4EAH D;  4CF1 A;  3DLB A;  2VWK A;  4KHQ A;  3VMF B;  4CBU A;  3ZSQ A;  1NGH A;  3P5J A;  3K0S A;  4EP4 A;  1VQL N;  3I33 A;  5I42 A;  3AVK A;  3D0P A;  5BRE A;  3RSE A;  5JVG L;  4KB0 A;  3NGZ A;  4DV3 K;  3QNN A;  3C65 A;  3OTO K;  4C1N I;  3R6M A;  3AY9 A;  4IZ9 A;  2HBL A;  3RMB A;  3TSU A;  4FJ7 A;  1K6Y A;  3ZSX A;  3WT0 A;  4DQR A;  3L2Q A;  4CZF A;  1QSY A;  3VTH A;  4O0I A;  4IG0 A;  3EEQ A;  3DLH A;  4JI4 K;  3DAW A;  4FZX C;  4ILH A;  3BZK A;  2D0O A;  1RT6 A;  3CFR A;  3CCU N;  3CCS N;  3J7Y P;  3OS1 A;  3O9R A;  1HJO A;  1NMN A;  3G0Z A;  1ITG A;  4N76 A;  4CZJ A;  4JKF A;  5AZJ A;  3SPZ A;  3THY A;  3RRG A;  1L3V A;  1NOY A;  1ASV A;  3VTI A;  1QQC A;  3DI6 A;  3C95 A;  5BPM A;  4ICL A;  3SMS A;  3NMU A;  2P51 A;  4GVE A;  1X3M A;  4KTW A;  2YHB A;  3CMA N;  3AVB A;  1ZBU A;  3CCM N;  2OZS A;  2KFN A;  3QML A;  3LP2 A;  4BGB A;  2PBD A;  5KTQ A;  3GG4 A;  4W5T A;  4DWI A;  1IH7 A;  1N6Q A;  2OYQ A;  2VG7 A;  4BRP A;  5GIN A;  1E4F T;  1ASU A;  3V1O A;  4DR3 K;  3L2U A;  5BR8 K;  3VF6 A;  3M8Q A;  4FJL A;  1WOQ A;  2QWM A;  2VCP A;  3BGR A;  2P9P A;  2P9U A;  1Z05 A;  4KHS A;  2V7Y A;  4IJN A;  2EX3 A;  3DM2 A;  4C8M A;  4WFN L;  4YFU A;  4M3X A;  3MCA B;  3ZX0 A;  4EZ9 A;  4J2E A;  2V52 B;  3V1R A;  1U45 A;  4DSI A;  3RMA A;  3SZ2 A;  3S3N A;  3CJA A;  1S1W A;  1EX4 A;  4XIU A;  4DTP A;  4CEB A;  5AQX A;  1REV A;  4PQU A;  3T1A A;  1RT7 A;  3FFK B;  4A5B A;  5C12 A;  1BI4 A;  1JL1 A;  3NF9 A;  5M1Q A;  3V9X A;  4ISE A;  1NK7 A;  3SV3 A;  3D7E O;  3M8S A;  1Q18 A;  3L2W A;  3M6G A;  1HNW K;  2PYJ A;  2WON A;  2ZD1 A;  4JKH A;  5HRP A;  5LY3 A;  3QBX A;  4DQI A;  3WQT A;  3MXJ A;  4FYD A;  3VQ7 A;  3H3N O;  4RW8 A;  1RT2 A;  3SUO A;  4RG8 A;  3EN9 A;  1KFS A;  3SCX A;  3FZM A;  3CPE A;  5JS2 A;  4BRQ A;  4JKA A;  4CW7 B;  3EY1 A;  1B9D A;  4IJA A;  4PKI A;  4KHY A;  1ILY A;  1TKZ A;  2RF2 A;  4H5T A;  4CZL A;  3HP6 A;  3O3H A;  1BO5 O;  4K43 A;  1P90 A;  5C2D A;  3S3M A;  4I9L A;  2HF4 A;  1XNR K;  3K9K A;  5AFU H;  5IT9 O;  1MWM A;  1XUP O;  1JLB A;  1SV5 A;  4B9U A;  2P9I B;  4JAX A;  5M1O A;  4KAZ A;  5EU7 A;  3BY5 A;  3T19 A;  2FF6 A;  1VQ8 N;  3E66 A;  1T05 A;  4JS4 A;  2O4G A;  4NB4 A;  1N34 K;  4M3Y A;  4IO9 L;  4GY2 B;  4B08 A;  3AO4 A;  2HNY A;  3TTD A;  4OX9 K;  3HP9 A;  4AHC A;  4W5N A;  3S3O A;  1T03 A;  4KV8 A;  2B5J A;  3OBW A;  2P9K A;  3ENO A;  4LH4 A;  4CHN A;  2E8A A;  1N36 K;  4M3Z A;  5GAH P;  1KD1 O;  4DR1 K;  1HKG A;  1VSJ A;  3I56 N;  1Q86 O;  2IC3 A;  3TTC A;  1TAQ A;  3G10 A;  4EZ6 A;  4B9Q A;  3JS6 A;  4X62 K;  2IVN A;  4I2P A;  4DTU A;  1J6Z A;  3SMP A;  1W9H A;  2E6M A;  2G8I A;  2HMP A;  4FWS A;  1UOC A;  3TAQ A;  1RNH A;  1NGD A;  4MFB A;  2Q2R A;  3I0R A;  3AO1 A; 
#chains in the Genus database with same CATH homology
 5AQK A;  4H5V A;  1MWK A;  3VF2 A;  3CQY A;  1TUY A;  3F5T A;  2NNW A;  2QEX N;  3LL3 A;  4OPA A;  5BRF A;  3U8X A;  4JHD B;  2P9N B;  1EQY A;  1K8K B;  1C0F A;  4BRN A;  3B8A X;  2FSJ A;  4HWI A;  5BPL A;  1RGI A;  1NGE A;  3CJ1 A;  4H0Y B;  2A40 A;  3L0Q A;  3ID6 A;  3BF1 A;  3AGR A;  5AQJ A;  1GLE G;  4KH6 A;  5AR0 A;  2ASM A;  2Q36 A;  2QWL A;  5FPM A;  4ILG B;  3ZEU B;  2GEM A;  2CH6 A;  2NRZ A;  3IDH A;  3VGL A;  3VEN A;  4CBX A;  2FSK A;  4CD3 A;  1CZA N;  4CJ7 A;  4FWO A;  3G6E N;  2KLA A;  1NJI O;  4IOC L;  2NRV A;  3U4L A;  5AQM A;  2ZJQ L;  3CIP A;  3LDN A;  4BRH A;  5TKY A;  5E84 A;  5AQY A;  1NGG A;  1NMD A;  3D6R A;  4EFH A;  3EKU A;  4PKG A;  3EZW A;  5BPN A;  3O9T A;  3E9P A;  5JLF A;  2A5X A;  3TPQ A;  3WEE B;  4CZM A;  4YOV A;  4O8U A;  3A5N C;  4KBO A;  5KQD A;  3FZK A;  1Z6R A;  4JEP A;  4H0O A;  2WBN A;  3CER A;  3VET A;  3M5R A;  3Q7B A;  4DKW A;  1TYQ A;  3LDO A;  3TU5 A;  1SZ2 A;  3FGU A;  2P9K B;  2GUP A;  2JWL A;  4ILJ A;  3S41 A;  3ZX2 A;  1KAX A;  3ATU A;  5AQU A;  5F1X A;  1S3X A;  4BG8 A;  4M7Y A;  3A5M C;  5F0X A;  4JK8 A;  2AP1 A;  1OVY A;  3CCL N;  4B1Z A;  3L4I A;  4H5R A;  4NLC A;  3LM2 A;  5AZI A;  3SAG A;  3O08 A;  3CF5 L;  4MDA A;  5AQO A;  3VGK A;  2YI1 A;  5BN8 A;  3NVM A;  3WXM B;  1NM1 A;  3P4I A;  2I7N A;  1SAZ A;  4JD2 A;  3RVC A;  4H0V B;  1T6C A;  4JHD A;  2P9N A;  3O1W A;  3ENH A;  3U9Z A;  1K8K A;  4YOW A;  1NGI A;  1QZ6 A;  4YDU A;  3C0B A;  4YDU C;  4DB3 A;  4BR7 A;  5KPZ A;  4QS8 A;  5EX5 A;  2E1Y A;  3SAF A;  1YUW A;  2EWS A;  1Y64 A;  1ATR A;  2BUP A;  1Q7Y O;  3NVK A;  2QXL A;  2P9S B;  2ZJP L;  2A6A A;  3VEV A;  4CZK A;  4C1N K;  3KWG A;  4MDB A;  1LCU A;  1Q82 O;  4BQZ A;  5AQL A;  1U6Z A;  1JCG A;  4FOE A;  4MO5 A;  4CZI A;  3CCQ N;  5EOY A;  4AM6 A;  1RDW X;  2NRW A;  3E9L A;  5CE3 A;  4BC3 A;  3PIO L;  3P31 A;  3QFP A;  1QQM A;  3OBY A;  1ATN A;  4BC5 A;  2P9L A;  3MWP A;  4FWM A;  3HM8 A;  5JMV A;  2BTF A;  2GWK A;  3WEE A;  4FWK A;  3SJH A;  3QDK A;  3VES A;  3WXL A;  2GEL A;  1KQS M;  4B1W B;  5HOO A;  3H3O B;  1BA0 A;  3A8Y A;  3C7N B;  1QQO A;  4WQ5 A;  4WQ5 C;  4A57 A;  3M3Z A;  4IO8 A;  1P8Z A;  2GWJ A;  2PFU A;  3UE5 A;  4BR4 A;  3F2K A;  4IXC A;  5ADX H;  1JCE A;  3PIP L;  1MDU B;  2CGK A;  5GIO A;  2WFB A;  3O5B A;  4A59 A;  4FOI A;  5H1S Q;  1LOT B;  2IIR A;  4WF9 L;  4JN4 A;  4BR0 A;  1BU6 O;  3ULE A;  4KH4 A;  4F9O A;  3VEW A;  2IVP A;  3O1B A;  3O80 A;  3CI5 A;  3WQU A;  2YHX A;  2ASP A;  3CME N;  4DCH A;  2QA4 N;  3MN9 A;  3KK7 A;  3ZX3 A;  5CHI A;  1YHQ N;  3VPZ A;  2V7Z A;  1M1K O;  5EY4 A;  1YI2 N;  4BC4 A;  1WUA A;  1YIJ N;  4IFE A;  1N8R O;  1HUX A;  3CCE N;  3FZF A;  1QZ5 A;  4BRD A;  4WCE L;  3CC7 N;  2Q0R A;  3G71 N;  2E2O A;  4OO1 J;  4IDH A;  4RTF D;  5HL7 L;  4BR5 A;  1HKB A;  3J8A A;  1X9J A;  4H0T B;  4XH5 A;  5AQH A;  5C0Y A;  3OA9 A;  1HX1 A;  4FPB A;  4K42 A;  1HPM A;  3DXM A;  2QWR A;  3H6E A;  4A2A A;  2DPN A;  2V51 B;  4JKG B;  3MN7 A;  3VEZ A;  4FWN A;  2QWO A;  1NBW A;  3T7Z A;  3AGK A;  4BG9 A;  2Q97 A;  1TUU A;  3MMV A;  2P9S A;  1SQK A;  3A0I X;  3CJB A;  5ELZ A;  3W3D A;  2E1Z A;  4A62 A;  1S22 A;  3CCV N;  1VQN N;  4JKC A;  2A3Z A;  2D1K A;  4JD2 B;  1RDU A;  2HBM A;  3CD6 N;  2Q0U A;  3R9P A;  1GLA G;  3WXI A;  3HI0 A;  2AA4 A;  1BWF O;  5E26 A;  3U9D A;  2BH1 A;  4WFA L;  1T3V A;  2YCH A;  3TTF A;  5BR9 A;  2ZWH A;  3EKS A;  1E4G T;  1DT9 A;  3P39 A;  4PL7 A;  1QHA A;  1S72 N;  1BG3 A;  3OHR A;  3VEO A;  4EIA A;  3O4W A;  3R3L A;  3MX5 A;  3VEY A;  3GDQ A;  4BRA A;  4YOY A;  1YJ9 N;  5KQ8 A;  3VER A;  3RSE B;  3C7N A;  3VF4 A;  4H5N A;  1O13 A;  1DKG D;  3LDP A;  4FVU A;  4AF1 A;  2NRR A;  4L3Q A;  2E2N A;  2P9L B;  1NGF A;  4PKH A;  3HOS A;  1VAZ A;  5AQI A;  1YJW N;  1YIT N;  2PAV A;  4B1Y B;  2WUS A;  3K9J A;  2ZGZ A;  3GL1 A;  2GX9 A;  2IVO A;  4GV9 A;  3WXJ A;  1BDG A;  1G99 A;  1U2V A;  3MDQ A;  1GLJ O;  4JKE A;  2OTL N;  3IKM A;  4ISG A;  4E1J A;  1W97 L;  3C6A A;  2HBK A;  5AFU A;  1VQM N;  1ATS A;  2H3G X;  5AQF A;  1OKJ A;  4FSV A;  3ULE B;  1BA1 A;  3SBG A;  2YHY A;  3LDL A;  3AAR A;  4JNE A;  3EL2 A;  1NGJ A;  3I8B A;  4QS9 A;  2KHO A;  4OPH A;  4DHY A;  3IUC A;  4K25 A;  1SS6 A;  3W0L A;  4BVP A;  4WFB L;  1KAY A;  1NGA A;  4ISF A;  5M1K A;  1DEJ A;  4JKG A;  5AQR A;  1K8A O;  1D4X A;  4FWQ A;  4B1U B;  3MK6 A;  4FWR A;  1GLC G;  2QWN A;  2F7T A;  3CC2 N;  3P38 A;  4BRO A;  3EE9 A;  3ZYY X;  3H46 O;  5JLH A;  5GAG P;  1XC3 A;  5C15 A;  3MN5 A;  1VQP N;  1VQ7 N;  2WC9 A;  5ADX A;  3HBT A;  2FSN A;  3DXM B;  3Q7C A;  3A5O C;  1ESV A;  4O5F A;  4U67 L;  1ZXO A;  5C10 A;  3D2E B;  3CCJ N;  5FPN A;  4EAH D;  4CZG A;  5LJV A;  4FO0 A;  4R79 A;  2HST A;  2A42 A;  3VMF B;  4CBU A;  4AM7 A;  1EO1 A;  3DXK B;  1NGH A;  2QWP A;  3I33 A;  3T69 A;  4BVO A;  1VQL N;  5BRE A;  3RSE A;  4EHU A;  3KHY A;  3UKR A;  4O8K A;  1Q81 O;  2OTJ N;  5JVG L;  3C65 A;  4C23 A;  1M90 O;  4PL8 A;  4BRI A;  2QTD A;  4IEE A;  3R6M A;  4XH4 A;  4C1N I;  3AY9 A;  4IZ9 A;  2HBL A;  5FPE A;  3L4Q A;  3TSU A;  1R59 O;  5M1F A;  3F9M A;  3SLC A;  2GTD A;  3WT0 A;  2RHK A;  4CZF A;  3VTH A;  2ASO A;  3HRG A;  4BRL A;  1BOT O;  2YJF A;  4H0X B;  1DGK N;  3JXU A;  3DAW A;  2P9P B;  1NLV A;  3L6Q A;  2OAN A;  5AQV A;  3D2F A;  4A5A A;  4BR2 A;  3OW2 M;  4BQL A;  3HZ6 A;  5JVH L;  4ILH A;  3H1Q A;  1JCF A;  2D0O A;  4IOX A;  3CCU N;  4CZE A;  1HKC A;  5EXW A;  3CCS N;  1NGC A;  1U2V B;  2HOE A;  1KXP A;  2VYP A;  4XH1 A;  3O9R A;  1HJO A;  4YOT A;  2ZGY A;  5EVZ A;  4MLH A;  3QB0 A;  4BC2 A;  3C6H A;  4MLE A;  4JKF A;  4CZJ A;  5AZJ A;  2VGN A;  4YOU A;  4BR9 A;  2VWB A;  1K9M O;  5MLC Q;  2E20 A;  3VTI A;  1VQ9 N;  2NLX A;  1V4S A;  2NZT A;  5BPM A;  4LC9 B;  3CHW A;  3NMU A;  3SMS A;  1V4T A;  1C0G A;  5I9E B;  2NRH A;  4GVE A;  3GBT A;  1VQ5 N;  3D2E A;  2FXU A;  5B8H A;  1X3M A;  3R8E A;  3CC4 N;  3CQX A;  2CGL A;  3CMA N;  3PLA A;  2F9T A;  2A41 A;  2FF3 B;  3MWT A;  4BRF A;  5FPD A;  3CCM N;  1HLU A;  3DXK A;  4JK9 A;  1VQO N;  3QML A;  3A5L C;  4A2B A;  4GV3 A;  3N4P A;  4M63 C;  4B1X B;  1YF5 L;  5GIP A;  4JKB A;  4M7X A;  1MA9 B;  4BGB A;  2PBD A;  4HTL A;  2ITM A;  3GG4 A;  5AQZ A;  4YOX A;  3N4Q A;  2I7P A;  2QI2 A;  3VOV A;  4BRP A;  5GIN A;  1E4F T;  1YJN N;  2D0P A;  3SK3 A;  1H1V A;  4RCH A;  3VF6 A;  5DM6 L;  1WOQ A;  4I6M B;  5BRH A;  3UKR B;  2QWM A;  3VEX A;  5GAD P;  2VCP A;  4JK7 A;  1NGB A;  2P9P A;  3H1V X;  4H03 B;  2P9U A;  1GLL O;  1GLB G;  2P9I A;  1Z05 A;  2V7Y A;  4IJN A;  3SBT A;  4WFN L;  3CJ9 A;  3KWI A;  1QVG M;  3MCA B;  3ZX0 A;  2V52 B;  3TSP A;  3CXC M;  3UB5 A;  3CJA A;  4MO4 A;  3M1F A;  2CH5 A;  1IG8 A;  1ZBS A;  3BP8 A;  3KVG A;  5AQX A;  3D2F B;  2Q31 A;  2NRX A;  5AQS A;  3FFK B;  4BRM A;  2J4R A;  3E1Y A;  5TKW A;  4A5B A;  5C12 A;  5M1Q A;  3FE1 A;  4K41 A;  4ISE A;  1YAG A;  2QW9 A;  5AQN A;  3VGM A;  2QWQ A;  1RFQ A;  3D7E O;  1Q18 A;  3MX2 A;  5AZJ B;  3M6G A;  3WUH A;  4B1V A;  3MCP A;  3GE1 A;  2ZJR L;  4CD1 A;  1YXQ A;  2CGJ A;  3AAP A;  3FZH A;  1KAZ A;  3IMX A;  4KH5 A;  2YX6 A;  5AQP A;  4CI6 A;  2F9W A;  4JKH A;  4QS7 A;  3UKU B;  4GV6 A;  5LY3 A;  3AAQ A;  3QBX A;  3WQT A;  4FPA A;  4PHT X;  3LDQ A;  3CPW M;  3FR0 A;  3H3N O;  4EHT A;  3MN6 A;  3EN9 A;  2FLO A;  3O6W A;  3FZM A;  4NO7 A;  3TSQ A;  3CPE A;  4UY8 O;  3G25 A;  4BGA A;  4IEI A;  4BRQ A;  4JKA A;  3BEX A;  5DM7 L;  4IJA A;  3O8M A;  1KC8 O;  4I6M A;  4PKI A;  3ENB A;  5GAE P;  4IOA L;  1ILY A;  4YOR A;  3KZB A;  4H0P A;  3ID8 A;  3ZET B;  5AQT A;  3O9U A;  5AQQ A;  4H5T A;  4CZL A;  3H45 C;  5KPR A;  4BRG A;  3QFU A;  1BO5 O;  4BRE A;  4RWT A;  4K43 A;  4BRC A;  1P90 A;  4NLB A;  5C2D A;  3SAH A;  3HOT A;  3G4S N;  3ATV A;  1YVN A;  2HF4 A;  3K9K A;  5AFU H;  5M1P A;  3ZEU A;  1QVF M;  1MWM A;  1XUP O;  2VGM A;  3HTV A;  3QIC A;  4Y0W A;  5CR4 A;  4A61 A;  2P9U B;  2QM1 A;  4FL9 A;  5C2F A;  5F2R A;  2P9I B;  3CCR N;  4JAX A;  5M1O A;  3BF3 A;  2FF6 A;  1VQ8 N;  4JKD A;  1GLF O;  3E66 A;  2Q1N A;  1ZC6 A;  4NB4 A;  3J7Z O;  1VQ4 N;  3CET A;  2RE2 A;  4WQ4 A;  4WQ4 C;  1GLD G;  2HF3 A;  5JIC A;  1K73 O;  4IO9 L;  5AQW A;  2D4W A;  4GY2 B;  4BRK A;  3TTD A;  3I55 N;  1X3N A;  2W41 A;  4U7B A;  3O9S A;  3O9Q A;  2E2Q A;  5BRD A;  3OBW A;  3DWL A;  2P9K A;  3WXK A;  2E2P A;  4FWP A;  4G9Z A;  3ENO A;  1T6D A;  2YJE A;  4DQ8 A;  4Z94 A;  2E88 A;  3UKU A;  1QQN A;  3IFR A;  4H5W A;  4XEI A;  1IJJ A;  2E8A A;  4GNI A;  1VQ6 N;  5GAH P;  2UYT A;  3QBW A;  1KD1 O;  4J8F A;  1HKG A;  3FLC O;  3I56 N;  3CJ7 A;  1Q86 O;  3LM9 A;  3TTC A;  3FZL A;  1W2B M;  3CJC A;  1VQK N;  3HSC A;  4B9Q A;  1TYQ B;  3JS6 A;  3EE8 A;  2IVN A;  3E9O A;  4BY9 C;  2KKZ A;  4CZH A;  1J6Z A;  3EO3 A;  2HBJ A;  3SMP A;  5KPT A;  5LJW A;  5BN9 A;  1NWK A;  2ZF5 O;  3R1X A;  1T44 A;  2HMP A;  4FWS A;  4CBW A;  1JJ2 M;  3BUZ B;  2YHW A;  3ZET A;  4IWV A;  2JWK A;  1BUP A;  2NRT A;  1NGD A;  5AZI B;  1XQS C;  3DJC A;  4FWL A;  5M1N A;  2W40 A;  2Q2R A;  3GOI A;  5AQG A;  4WYB A;  3DLL L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...