2HNZA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 140
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnzA05
5J2MB 3KLFB 3UPFA 2O5DA 2QK9A 4FVMA 3ZT4A 4B9NA 1JL1A 2BANA 4NZ0A 3K5NA 4DTJA 1DTTA 2RKIA 1NKCA 3OHBA 5KG3A 1S1VB 1S6QA 3LP2B 3T19A 4ECYA 2RF2B 3PW2A 5KFBA 3QEIA 5F8MA 4KB0A 1IKYB 2GIRA 5T14A 3VQBA 3KNAA 3N6NA 1J9AA 4Z4HA 4R5PB 4CERA 3LP2A 2FJVA 1A5VA 5EUHA 4CGFA 2JLEA 2IJNA 2GC8A 2WRMA 2RF2A 1U47A 1C1BB 4O0JA 1U45A 4EP4A 3IAYA 3MEEB 1REVA 3LPUA 5HRRA 1N6QB 4C8LA 1WSFA 3UQSA 4PUOB 3ZSQA 3QZ8A 2XWYA 3BQ0A 3GV8B 3RMBA 4OJRA 3G10A 4EP5A 2QE5A 3HYFA 4CE9A 2YHBA 1J5OB 1Q9YA 1C1CA 4FJLA 4IDKA 3KOAA 3HM9A 3NGIA 4J9SA 1WSHA 1RYRA 1S9GA 3HPHA 3LWLA 4DL3A 4JV2A 3G6XA 1S10A 1RDCA 2D0CA 2E6LA 2IJFA 3DOKB 1SV5B 2R2UA 3NF9A 4IRCA 2C2EA 1BCOA 3DLGB 4ZHRB 4URQU 2WHOA 3WNFA 4DS4A 3V4IB 4W5QA 1S9EA 3VQAA 4F4WA 4LY7A 2G8UA 1RYSA 3SQ2A 4CHNA 3K2PA 3CIZA 1LW0B 2F96A 3AVGA 3AVLA 3ZT3A 4CHOA 2F8TA 1S9FA 4EEYA 4FS1A 3L2RA 4F50A 3L2VA 2R2RA 3KKRA 2OZMA 3QINA 4ELVA 4DTXA 3H59A 1LW0A 2FVPA 3QETA 1RTDA 4FM0A 4I9LA 3H98A 4AHCA 1EETA 3PR4A 4Y2AA 4BWJA 3MEDB 3IN5A 5EU7A 2HHSA 1IKVA 3K5LA 4KHSA 3AA5X 1SL0A 1HNIB 3V9WA 1RTHB 4CF2A 1RT4A 5KFGA 1HYSB 4CIFA 4ECRA 1Y97A 2R2SA 5DG8A 4CGDA 1XR5A 1YVUA 4KFBA 2YHAA 4CJTA 5KI6A 3AO2A 3QNNA 1LW2A 1B9FA 1SKRA 3CJ2A 5KT5A 5DK5A 4CEEA 4E7HA 3MF5A 1TV6A 3FSIA 4MK8A 2B43A 3N6MA 1MMLA 2OPPA 3KHRA 1Z26A 4QAGA 1VRTA 1HNIA 4ECZA 5DMRA 3O4QA 2Q3SA 3SUPA 4ID5A 1RT5A 4EZ9A 4ED1A 4NCAA 4CF1A 1OS5A 1KHWA 3G6YA 4NLOA 2ETJA 1R0AB 3PO5A 3LP1A 3KK1A 4PQUA 4DQPA 4J9MA 2V9WA 2BE2B 3SV3A 1I6JA 3RR8A 1HNVB 3V1QA 3O4NA 4YP3A 4KPYA 5KT3A 3AVKA 4MK9A 1KVBA 5KFTA 3I5AA 4H8KA 3OL7A 5F9LA 1S1XB 4E1NA 4IBNA 4FJMA 5E41A 3OYAA 3KKSA 1T3NA 1R0AA 4RUCA 2DFFA 3NHGA 1TKZB 3HP9A 1ZBIA 4F4YA 4OKJA 1BL3A 3D5MA 2XO7A 2UVWA 1U48A 1RTJA 1UA1A 4MK7A 4ZVEA 1TP7A 3CFPA 2OPSA 3CJ0A 4LSNA 3I0SA 1S5JA 3DM2A 4NCBA 3AO4A 2YV0X 4FJIA 4CJUA 4EZ6A 3NL0A 4AHRA 1RT6B 3SPZA 4ECQA 4MIBA 4XIUA 3MXIA 4NLXA 1TL1A 3L3VA 2YKMA 4I2QB 3DRPA 5KFNA 2FLNA 4DQSA 3TARA 4I7FB 3IS9A 4ECVA 2VWJA 1CXQA 3V9UA 4DMNA 1KCFA 4Z4GA 1VSHA 1Z4UA 2W9CA 4HVJA 5KFCA 3HVWA 1TKTA 3AVJA 2BRKA 3DRSB 3TAQA 4I2QA 1MU2B 5KFMA 2ZE2B 3KHLA 1GX6A 3DLRA 5JS2A 3U3GA 4DLEA 1IM4A 2OPQA 4FLWA 4K4YA 3KHGA 1TGOA 3C6UA 3DI6A 3K5OA 3ZSOA 3V6JA 1ZBFA 1SUQA 4Z4FA 5KG4A 3CFRA 3RAQA 4IH6A 4QWBA 5KG7A 2W9AA 3HSTB 1FKOB 1RT2B 4KTWA 3VQ5A 3OYHA 3LDSA 3P1GA 3ZT0A 4K4VA 1FK9B 4CGJA 3RBDA 2HB5A 3V9SA 2UUWA 2R8HA 4DF8A 1N5YB 3CM6A 5KFVA 2P1JA 4RW8B 4WFYA 3TAMB 3OY9A 1D5AA 2OYQA 4KTQA 2W9BA 4FJNA 5CYMB 4OKEA 1X9MA 4WZQA 3IRXB 1C0UA 5KGWA 1NJZA 3H08A 3OYLA 4FLXA 3AVMA 4FJGA 3SQ4A 5HRPA 4B3OB 4IR1A 1IKWA 3MEGB 5I3UA 4ICLB 4YQWA 3BSNA 5T7BA 4O5BA 4KV8B 2R8GA 3OYEA 2C22A 3MR2A 2ZD1B 1O1WA 3I0RA 3KLHB 1RDAA 3A2FA 1T7PA 3NH0A 4CGHA 2VG7A 3QIPB 2FVQA 4OGCA 3HT3A 2OA8A 1HMVB 2A1RA 5DGBA 2ILYA 2KFNA 4CEQA 4LD0A 4CFCA 3RRGA 2DFEA 4BDZA 3P83D 4JV0A 1KLMA 3SUQA 5F8HA 4IG3A 4KI4A 2WONB 5C25B 1BIUA 3CFOA 3T3FA 3VQ7A 2PY5A 2YKNA 2XI3A 3OYDA 4JRQA 4DL5A 4M45A 4O0IA 2YNGA 3RR7A 1HMVA 2XY6A 1RTIB 3GYNA 4JS4A 1A5WA 3RMAA 5F8GA 3G0ZA 1GOCA 4GC6A 4AHTA 4EYIB 2P51A 4E7KA 4QWAA 4K4XA 5KRTA 1HARA 1S48A 4RG8A 3SV4A 2D0BA 4CIEA 1IG9A 2CKWA 3PW5A 1VRUB 3ZSRA 2R8JA 3FFIA 3NMAA 4FLUA 1RTIA 1S0MA 2HHWA 4CEDA 4CCHA 2IS3A 2R7YA 3HKWA 3M8QB 1LWCB 4O3NA 1U49A 4IH7A 1WAJA 1CZ9A 3Q8QB 4IRKA 4DSLA 1BQMA 3THVA 3SPYA 4IFVA 4KKOA 3H4DA 2BGGA 2XRIA 3RB4A 3LPTA 3DOLB 2XY7A 2AX1A 3NH2A 1VRUA 4O3PA 3PVXA 4G1QB 4CEAA 4LQ3A 4CF8A 5KFPA 3M8QA 1LWCA 3HHKA 3RB0A 3OYFA 4KSEB 1KVAA 1JKHB 3LZJA 2KTQA 3CO9A 3M9MB 3ISND 1LWFA 3EZ5A 3V6KA 3NF8A 1SH3A 3AVHA 4JS5A 4MQ3A 2W8KA 3RWUA 5J2NB 2YNFB 3NFAA 5EWGA 4E19A 1JLFB 3DMJA 4F4ZA 4F3TA 4G1QA 3QO9B 1UA0A 4FJJA 4QWEA 4E89A 2XC9A 5KGXA 4DTOA 5K14B 3P5JA 4L8RB 1HQUB 3OYJA 3NAIA 4CK2A 4NYNA 4PY5A 4J2BA 3IG1B 1LV5A 2GV9A 4RW7B 3IGVA 1JLFA 1BHLA 3NCIA 1DTQB 2IA6A 1NK7A 4HUEA 3H5YA 1NK5A 3M8PB 4NYZA 2X6SA 4J9NA 3GV5B 2RPIA 4E7IA 4B9SA 3WNHA 3MECA 1CSJA 2HWHA 2G8KA 4CF0A 2I5JA 1JIHA 3S3MA 4DU1A 3OL9A 3KLEB 4RW7A 5KT7A 4Y1CA 1C0TB 3NKYA 1DLOA 5KFOA 2W42A 1DTQA 4OLAA 4M3YA 4IKAA 4DTPA 5I42B 4EBEA 1YVFA 1XI1A 3OLAA 1TL3A 5HP1B 4M3TA 5C5JA 3VA3A 2D41A 1WSGA 4Q43A 4ZTJA 4FBTA 1ASUA 3V9ZA 3PW0A 3NDKA 2ZQBA 1RA6A 1XR6A 4J2DA 1C0TA 2VG6A 4B9LA 3K59A 4I2PA 2D5RA 2D3UA 3LP0B 4TYAA 3QGHA 2BR0A 2A1SA 4RZRA 2V4QA 3AO5A 2E4LA 4DLGA 3Q8PB 4KO0A 4CECA 2AJQA 4ED6A 2B6AB 3SYZA 3E01A 3PX6A 4XPCA 1C2PA 3PHEA 4QOZB 4CEBA 2C2DA 1JLBA 1WN7A 4DL2A 2DY4A 3GIJA 4JV1A 4PA1A 3KLFA 5J2MA 2AU0A 3SUOA 3VQ6A 3HPOA 2RDIA 1XHZA 2HHXA 2HNDB 1S6PB 3QEWA 3T5HA 2BQUA 2DPIA 4HCBA 1S1VA 3OLBA 2AGQA 2O4IA 4RW6B 2JEGA 2XY8A 4KBIA 4G3IA 5FRMA 5KG6A 3T5JA 3CJ5A 3DLKB 1IKYA 4TSXA 2LSNA 2W7PA 1RDRA 1T03B 1NK6A 4E7LA 4U6PA 4JRPA 1FKPB 1VSIA 4R5PA 3L8BA 3ASMA 4J9RA 3O3HA 2P5GA 5HROB 1RAJA 1C1BA 4HCCA 3MEEA 4CJQA 4QW9A 1N6QA 4JUZA 4RW9B 3QIDA 1NOZA 2Z1IA 4PUOA 4M3RA 1S1TB 3DLEB 1J53A 4DG1B 4W5RA 4CESA 5L1IA 2FBXA 3V1OA 4IR9A 3ALYA 4C8MA 4ED3A 4TY8B 1J5OA 4ZTFA 1U04A 4LH5A 3PJXA 4FK2A 3RBEA 1JLCB 1RT7B 1T05B 4FXDA 3TANA 3AVIA 4CGIA 3OL8A 3OVNA 1S1TA 1T94A 1BI4B 1L5UA 2KZMA 3F73A 1BCMA 3VQSA 4KB7A 3DOKA 5KFKA 4E3SA 1SV5A 2Z1JA 5EWEA 2J6TA 3VQEA 3DLGA 4ZHRA 3V4IA 2B5JB 1S1WB 3FQLA 3M9OB 3H40A 1ZTTA 4HHTA 1RILA 4CHYA 4F2SA 1BI4A 3SI8A 4IQXA 4DFJA 5C42B 4LSLB 4CJLA 4Z4EA 1K1QA 1NJWA 4N41A 3DYAB 3LWMA 3K5MA 3BGRB 3HVAA 4Y34A 1NJYA 4NLTA 4CJVA 1JL2A 1JXEA 1RBVA 4AHVA 2ASLA 3D0PA 1CXUA 2VWKA 4BDPA 4HUGA 3CDUA 5KTQA 3AVBA 3UIQA 4BWMA 3BGRA 2UUTA 3C94A 3MEDA 3VQCA 3QGIA 1RT1B 1JLEB 2IGIA 1J54A 1NK8A 4O4GB 1RTHA 4FCYA 4FLVA 4Y1DA 3CG7A 4YFUA 4ZVGA 1HYSA 3T1AA 4NCGB 3LZIA 4B9TA 2FJWA 3QEXA 4FZZA 3KLGB 1QE1B 3CJ3A 3PY8A 5F8LA 4ZPDA 1RBRA 4ED7A 4O4GA 2E9RX 1UWBB 3OL6A 3OYGA 3AA3A 2X6NA 1X9WA 4BACA 2HHVA 5KFEA 4KREA 2JC1A 4KTZA 4GVMA 4F2RA 2BE2A 3E51A 2D3ZA 2FBVA 4J9QA 4RW4B 3T5LA 1HNVA 4ED2A 4I9QA 2ALZA 2O4GA 4DTMA 1S1XA 4FJ7A 3S3NA 4ECXA 3C6TB 1VSMA 5KFFA 3VQDA 1TKZA 1L3VA 4NLPA 5KT2A 4NLRA 4F4KA 3KD5E 5FRNA 1VSEA 3BSOA 1X9SA 3BREA 3SFGA 5J2PB 2DFHA 4DL6A 1LAWA 4DFMA 1HQEB 3C6TA 1NHUA 3ZSVA 5DGAA 1RT6A 3QEPA 1NOYA 2XCAA 4E1MA 1TVRB 4KHNA 1NK0A 1A5XA 1RT3B 4OPJA 2ATLA 4N56A 3V6DB 4I7FA 3EPGA 2JC0A 5L1JA 2IAJB 2VG5B 1SH2A 5KG1A 4ECWA 4HUFA 4Q44A 3MR6A 4B9UA 3MTKA 4H4MB 4CHPA 1BISA 4X2BA 3DRSA 4W5TA 3KD1E 1MU2A 4F3OA 1K1SA 3GQCA 2ZE2A 3AV9A 2E9TA 2XY5A 1ZBUA 2IAJA 5KFRA 3LP3A 3VQ9A 3AVFA 3GILA 3H2LA 4EYHB 2HW3A 3V81B 3ZSYA 4XO0A 4OVLA 4DSKA 4Y2CA 3JSMB 3KHHA 2RN2A 4DU3A 3NF7A 4GW6A 5D3GB 1S0OA 2AGOA 4YNQA 4Y3CA 5KFSA 2KFZA 1FKOA 1RT2A 2BQ3A 2X74A 3G6VA 1Q9XA 1C6VA 4J9PA 3NGZA 4B8AB 4QCLA 4FZYA 3DRRB 4CJ3A 4ZPCA 1FK9A 3CJ4A 3WNEA 4Q45A 1KSPA 2B4JA 4IFYB 1N5YA 4R8UB 2W8LA 1QSYA 4RW8A 3TAMA 1WSJA 4CIGA 5CYMA 1JLGB 3RTVA 4DSIA 3IRXA 2ITGA 4DFKA 4PWDB 5KFQA 3VQQA 1HYVA 4Q5VA 3AO1A 4K4SA 4FJHA 4NRUA 4B3OA 3MEGA 5HRSA 4ICLA 3KLIB 4TN2A 4ELTA 1ZTWA 5KFJA 4WZMA 4KAZA 4KV8A 5DG7A 1HPZB 3TVKA 1N56A 2HNYB 2ZD1A 4K8XA 4CJ4A 4NLWA 5C24B 3KLHA 2WTFA 1D1UA 2HWIA 3EY1A 4C8KA 2HHUA 3KTQA 5DQIA 3QIPA 4K4ZA 2EHGA 2XI2A 3OS2A 3H5UA 3RRHA 4MIAA 4K4WA 3HP6A 3RB3A 3PUFA 3GV7B 3H5XA 4DL7A 2KQ2A 1VK0A 4NLGA 4B08A 3VQ4A 2HNYA 1WLJA 3CDEA 1EP4B 2JEIA 2FVSA 4E0DA 2WONA 5C25A 1SKSA 3TABA 5KT4A 3OSNA 1BGXT 2ILZA 5KRSA 4FW2A 4FLTA 4CEZA 2EX3A 1ASVA 1YTAA 3FRZA 1XHXA 2OZSA 4FJ9A 3HVRA 4FK0A 3CYMA 2DPJA 4TXSA 5J1EB 1JLAB 2WOMB 5CYQB 4FBUA 4J9KA 3BSAA 4KAIA 1RDBA 3GIIA 3ZSZA 1XC9A 3DOLA 4WYLA 4U7CA 1D8YA 3KK2B 4TYBA 1D0EA 1VSFA 1L3TA 5DLFA 4M3UA 1JLAA 4HYKA 1ZBLA 1U4BA 4IG0B 3KK3B 4CFAA 2GBZA 2X78A 1JKHA 3M9NB 5L9XA 3JYTB 4ELUA 4WYWA 1TKXB 2AQ4A 4DU4A 3HVTB 1S97A 2YNIB 3QZ7A 4DQRA 4NLUA 5J2NA 2YNFA 1KTQA 3OYIA 3BQ1A 2IDOA 2HVHA 1L3UA 2C2RA 1ASWA 3HL8A 3BDPA 3TR8A 3QO9A 3GIMA 3AVAA 1S1UB 4OPKA 3PV8A 3TAEA 3ZSXA 4IH5A 5K14A 3NE6A 1TAQA 3QYYA 1G15A 1HQUA 2XGPA 1C1AA 1WNSA 4OKKA 3OHAA 1NKEA 2HMIB 2YNIA 1BIZA 3IG1A 2QXFA 4CJKA 4RU9A 4DSFA 2E9ZA 1NK4A 1IH7A 3S3OA 4KHYA 4M42A 3C95A 2BQRA 2OPRB 1HRHA 3M8PA 1TQLA 4CJRA 4ECTA 5HBMB 3DLHA 1QSSA 2HVIA 1IKXB 2IMWP 3OS1A 3KLEA 4M3WA 2F8EX 5J2QB 3CVKA 2NUBA 3B6OA 5I42A 4ZMMA 5KFUA 5KFDA 1B9DA 5HP1A 4ED8A 3ITHB 1DTTB 4B9MA 2P5OA 2XHBA 2AX0A 5CZ2A 3OYBA 1JLQB 4B9VA 1S6QB 2VA2A 2Y1JA 1TAUA 5J2QA 4URSA 3LP0A 3KLVA 2R8KA 1KRPA 2HHQA 4KHQA 4CJEA 3NF6A 3ITHA 2B6AA 5DQGA 4R0EA 2G8WA 3BQ2A 3AA4A 1ZYQA 2IBKA 3SNNA 3GIKA 3QLHB 1WSIA 4GMJB 1SL1A 4W5OA 4OL8A 1JLQA 3ZSWA 4UQGA 1EX4A 4CK1A 3ZCMA 4AILC 1I3AA 1REVB 3HO1A 3QEVA 2BRLA 2HNDA 3IGNA 4QWCA 3CQ8A 1S6PA 2AGPA 3BJYA 3QLHA 4K4UA 3TAFA 1VSLA 4DFPA 3S9HA 1WNEA 1KLNA 4DSJA 4RW6A 2R8IA 4K50A 3K58A 3G86A 2IM3A 3OJSA 1C1CB 3DLKA 5JS1A 1S4FA 4Z4IA 1T03A 2FVRA 2V0NA 4IDKB 1TK8A 2D0AA 3UDLA 1FKPA 3ULDA 5KFIA 3OJUA 4ZPBA 4CHZA 1S9GB 5KG2A 2BDPA 2Z1GA 2PYJA 4YMEA 4CK3A 4KRFA 5HROA 3EPIA 3MFIA 3L2QA 1L3SA 1T8EA 1K6YA 5DG9A 4F8RA 1S49A 4RW9A 3QNOA 1GOBA 3QERA 1S9EB 4CJ5A 3HPGA 4K4TA 3V6HA 3V9XA 2G8HA 3DLEA 3SI6A 4DG1A 3KMQA 1VSDA 1LWEB 4M41A 1NJXA 4TY8A 1VSKA 4DS5A 4WE1B 2XCPA 4DSEA 2PYLA 2QV6A 1JLCA 4DTRA 4O3RA 1RT7A 1T05A 2FVCA 5HRNA 4KHWA 5DQHA 5KT6A 1RTDB 4O4RA 1TK5A 1CLQA 1EETB 1LWEA 1RBTA 4ZP9A 4N5SA 4WE1A 1F21A 1YT3A 2IC3B 2I1RA 1IKVB 5L1KA 4W5NA 2GUIA 2IM1A 1Z25A 3RB6A 2B5JA 1S1WA 1XWLA 2AWZA 1RT4B 4DQQA 1NHVA 4FYDA 3PW4A 5C42A 3LANA 4LSLA 4KFBB 2ZKUA 3EZUA 1LW2B 4BE2A 1RA7A 5KFAA 5FROA 2V4RA 3DYAA 2IC3A 1TV6B 1SKWA 3SJJA 2OPPB 1VRTB 5KG5A 2CJQA 5EDWA 4ID5B 1RT5B 2WB4A 3NAHA 2UVUA 1KFDA 4ZPAA 4DTSA 3U6FA 4IKFA 1IO2A 4EBCA 3LP1B 3KK1B 4PQUB 5KFWA 4O55A 2FBYA 1WSEA 1QHTA 1CZBA 3SZ2A 3H5SA 3AVNA 3VQPA 1RT1A 1JLEA 4JLHA 3KIOA 4KE5A 2KW4A 4FJ8A 2ASJA 1HJRA 4NCGA 2QKKA 4KI6A 4LQ9A 2OH2A 1QTMA 3OYCA 4ECUA 5KG0A 4YR0A 3KLGA 1QE1A 4CEFA 4FJ5A 5KFLA 2FBTA 3HK2A 2G8FA 4NLYA 3NGDA 3V1RA 4BDYA 1RTJB 4RNFA 3CM5A 1UWBA 3L2UA 1BQNB 4M3XA 2OPSB 3QGGA 4LSNB 3I0SB 3DM2B 4MH8A 4CJPA 2YNHB 3TWHA 5FDLB 4BE1A 2G8VA 1D9FA 4IRDA 3HJFA 3TAGA 4RW4A 1Q8IA 3AO3A 4BE0A 1TL1B 2YKMB 3MFHA 3QIOA 4K8ZA 3DRPB 5KFXA 1BQNA 1KFSA 3SCXA 4N47A 4OGEA 3QESA 4DF4A 4CJFA 2YNHA 3IS9B 1YTUA 3SUNA 2PZSA 5FDLA 2ASDA 4RNHA 4DL4A 2Y1IA 3FQKA 4ECSA 3Q8SB 3N6LA 2G8IA 2W9CB 4OLBA 1TKTB 1U09A 2J6UA 4YR3A 4NLSA 3OYNA 2XGQA 3O3GA 4KHUA 4HKQA 4DTUA 5J2PA 3NAEA 1QAJA 1HQEA 3PW7A 5F8IA 2C28A 2OPQB 3M8SA 3EYZA 3DDKA 3C6UB 4FM2A 3DI6B 4WFXA 4KHMA 1TVRA 2IM2A 5CZ1A 2WK4A 1ZBHA 4TY9A 3VA0A 1SUQB 4FM1A 3TI0A 4FJXA 1RT3A 2JEFA 3NH1A 3V6DA 4AHSA 2HNZB 4E7JA 3M8RA 2F8SA 2VG5A 5CY4A 4NYFA 4FLYA 1QS4A 3PX0A 2JGUA 1GX5A 2UVVA 4QPXA 3H4BA 4H4MA 5SWMA 1JXBA 3PJWA 1NK9A 4RNMA 4NLVA 3CWJA 2W9BB 4N76A 3L3UA 3PX4A 1ITGA 2HNZA 1C0UB 1EXQA 4WXWA 4CJWA 1FXXA 4J9LA 3CDWA 1IKWB 3BR9A 5JXSA 4J2AA 4DWIA 2R2TA 5I3UB 4RNOA 3FDSA 5KFHA 3V81A 4M3ZA 4H4OB 4DTNA 3ISNC 1W0HA 3JSMA 3F9KA 1KHVA 2VA3A 4B8CA 4O3QA 3BSCA 5D3GA 3I0RB 3KMSA 3DLBA 4ZP6A 4QW8A 2ATQA 1W9HA 2FJXA 2VG7B 4CJSA 1TKDA 3RMCA 3PO4A 3DRRA 2DTUA 4H4OA 4IFYA 4R8UA 1GOAA 5KFYA 3O3FA 1SH0A 4KHRA 4ZP7A 2QKBA 4CGGA 1KLMB 2E6MA 1EKEA 1SL2A 1JLGA 4IG3B 4M94A 5F8NA 4PWDA 4FLZA 4ZVHA 2YKNB 4FS2A 3Q8RB 1HYZA 2YNGB 4ID1A 1WAFA 3KLIA 3TAPA 5L1LA 2FLLA 2EC0A 4Q0BB 3D28A 4M95A 3KJVB 1HPZA 4C8NA 2IM0A 3K57A 5C24A 1XR7A 3SFUA 4LH4A 1QQCA 4RNNA 4KB1A 3OS0A 4MFBB 3FFIB 4NRTA 3I8DA 5HLFB 4CFBA 1TK0A 4O3SA 3LAMA 3PR5B 1JX4A 4FW1A 4Q0BA 1BQMB 4URGA 4IFVB 4HTUA 4KKOB 3KJVA 3I5CA 4WFZA 1RDDA 3WNGA 3MR5A 2J6SA 3UR0A 1EP4A 3RMDA 1QSLA 3B6PA 4MFBA 3LAKA 3VQ8A 4FJKA 5HLFA 4DEZA 3TQ1A 4IOBA 3I5BA 4AH9A 1NNDA 4CHQA 1B92A 3T5KA 2KZZA 4FK4A 1LWFB 2FC0A 4J9OA 4QWDA 4Z0UA 4Q8EA 3DMJB 3MXJA 4DQIA 4XPEA 5J1EA 1W25A 4ZP8A 2WOMA 3NGYA 4EBDA 1RCHA 5CYQA 2FLPA 1N48A 3HXMA 1C0MA 4RUAA 3U3YA 4EO8A 3SQ1A 4WXOA 1N4LA 3KK2A 4NLQA 4FZXC 2WCXA 3NBPB 3ICLA 4AHUA 1NKBA 3LALA 1RNHA 2Z1HA 4IG0A 3KK3A 1ZETA 4TQSA 3MR3A 4CFDA 4ZVFA 4O3OA 1D9DA 3OSPA 3JYTA 4F4XA 4Q8FA 1VSJA 1TKXA 3MECB 2IOCA 3ZT2A 3MAQA 4YR2A 3HVTA 5F8JA 2I5JB 1KVCA 4MKBA 4TQRA 1JXLA 3NBPA 5EWFA 1DLOB 5JUMA 1RBSA 1X1PA 1S1UA 3D45A 4TLRA 5SZTA 5DLGA 3MXMA 2HHTA 4CF9A 1S0NA 1UOCA 4GC7A 2D7SA 1TL3B 5KFZA 4Z4CA 1QAIA 2HMIA 3AVCA 4O44B 1UAXA 1RBUA 2VG6B 5F9NA 4I2PB 4MKAA 1QUVA 2GIQA 2OPRA 2JEJA 4CEOA 4J2EA 3VN5A 3AA2A 1I39A 3ZT1A 2BANB 4KO0B 4C8OA 2UVRA 3E01B 3OYKA 3SQ0A 4NLDA 5HBMA 4ED0A 2RDJA 1IKXA 3L2WA 2RKIB 4EO6A 3OYMA 4O44A 1LAVA 1JLBB 3PZPA 2W7OA 4H54A 2HAIA 3RAXA
chains in the Genus database with same CATH superfamily
1NBWA 1NMNA 2BJ1A 4JKDA 1HUXA 2YJEA 1N36K 2BANA 2JFKA 4NZ0A 2ZM6J 3K5NA 3CD0A 4FF4A 1NKCA 1N8RT 2GVDB 3OHBA 1PYTA 1NWKA 5KG3A 2B4OA 4DX5A 1S6QA 4XDCA 2MGZA 3P49B 3T19A 2NPFA 4ECYA 3QEIA 3FCVA 4JI7F 3CEDA 2QWQA 3VQBA 3KNAA 2GWJA 1U0SA 2QGFB 2C3PA 3PIOL 4Y28C 2WBMA 3WXIA 2FJVA 3PLAA 4CGFA 1GLJO 1U47A 4EP4A 3MTJA 3OXFA 4OYAA 3IXQA 4MKVA 4JKCA 4BG8A 2E29A 4HTJA 5I3QA 3LDLA 2FIUA 4A62A 4ZPWR 5AFUA 5AQIA 3BQ0A 3GV8B 3RMBA 2XHCA 3TR5A 1RHQB 4OJRA 2FZGB 1S77D 3THXA 2YHBA 1J5OB 1C1CA 1QZ6A 4CLZA 3KOAA 2VPWB 1S9GA 4C23A 5B0CA 4JV2A 4Q7AA 1S12A 3G6XA 3G82B 4BQZA 5AJ3F 2D3O1 2QA4N 4IOXA 1SV5B 2R2UA 2ROGA 3U27A 3CC7N 1BCOA 1DGKN 1PSDA 3D2EB 3V4IB 2OD4A 4ILHA 4OJ3A 3VQAA 4DV7K 2QA4S 1XC3A 1P1TA 3CC7S 4LF5K 4CHNA 1P8GA 3K2PA 4JKFA 2F96A 3AVGA 2JFDA 2ZITA 3HFKA 1M5HA 1YWXA 4X4OA 3D2EA 1ZM9A 3R1LA 3QINA 2A40A 4FWNA 2QWRA 4I9LA 5F41A 3R2DJ 3THYA 4AHCA 4BC9A 2OFHX 2Z0GA 1GH8A 3IN5A 4CYUA 3M7VA 2HHSA 3K5LA 2EFQA 2YPZA 1SL0A 2P9LA 3V9WA 2VIHA 1RTHB 1AROP 2G2OA 4CF2A 2RDDA 1RT4A 5KFGA 3QJLA 4BBYA 1QY7A 4ECRA 2R2SA 1Y97A 5DG8A 4CGDA 1XR5A 4OMFG 4KFBA 5D6GA 3AXMA 3AO2A 3VGSA 1B9FA 1RAFB 1SKRA 3UB5A 4ZN3A 3N6MA 3CJKB 2IVPA 4V19J 4ECZA 2DGVA 2LA6A 4USHA 4OI4A 5DMRA 2WFBA 2Q3SA 3SUPA 1TFYA 4NCAA 2N4CA 3HJVA 3G6YA 3W65A 4NLOA 2IBOA 2V52B 4JI5F 1UCNA 5C2DA 2E88A 5A2QY 3TW0A 2UP1A 2V9WA 1YJWN 4K59A 3KXDA 3V1QA 1X31C 3R5GA 2KT2A 4MK9A 2IPOB 2BMBA 1YJWS 1S1XB 4RU2A 2WSEC 2GHWA 1VBKA 1M0SA 1TKZB 4L73A 1RHJB 2PEBA 1ZS6A 3ZZOA 1VBYA 5DDRC 1RFQA 2BH1A 2L9NA 1M90T 4LSNA 4HWIA 3I0SA 4Y65A 1BE4A 1S5JA 2B7CB 5HN0A 1RHUB 4ERDA 2RVJA 1CJTA 2Q79A 3CO0P 4FJIA 3O3LA 1TUWA 2XMWA 2E2NA 1RT6B 3A5LC 2IIRA 4DV7J 4ECQA 4DUYK 4NLXA 1TL1A 3L3VA 1HKGA 5KFNA 3MAAA 3EWGA 2WVCA 4PG6A 4ECVA 1QQOA 3W60A 3V9UA 1U0HB 2O8DB 3FZHA 4BVOA 3IR7B 1NB2A 3GJTB 1BU6O 1WKLA 2ZVIA 3OFFA 1B0PA 3TAQA 2W01A 1VYAA 3UVJA 2ZE2B 3GIRA 4DV5F 2QX0A 2DH7A 4Y0WA 1GX6A 2CQ2A 3VF0B 4DLEA 1IM4A 1X4AA 2IRYA 3M05A 2E5LK 4FLWA 3OFHA 4Y2MA 2XS5A 4B1WB 3C6UA 3CUNA 1W26A 4H0TB 3V6JA 4C1NK 3MD1A 5KG4A 4HHUA 3C15B 4ZLJA 3VQ5A 4CJ7A 1RUSA 2VD3A 3JAMU 1XN9A 3JQMA 2V2QA 3RBDA 2HB5A 3V9SA 4DF8A 3FBBA 1XMQF 3CM6A 1KS2A 1PC5A 2QIFA 4RW8B 3TAMB 2ZVSA 2M88A 1D5AA 2OYQA 4KTQA 2BM1A 4OKEA 3IRXB 1NJZA 5KGWA 3NGUA 3H08A 3D54A 4I69A 4FLXA 5HRPA 1K44A 4C3MA 5J1NA 5I3UA 4GKJJ 1AW0A 2CQDA 1GLFO 2MSTA 4K0KJ 2EEYA 2R8GA 4P72A 4GKKK 2QG9B 3GB0A 2FGCA 1O1WA 3KLHB 5DZ7A 1RDAA 2DVIA 1T7PA 3NH0A 3Q86A 2BM0A 3QIPB 4JI6K 4BC4A 3ETOA 3BKUA 2A1RA 3M2UB 2ILYA 1XK8A 1PCAA 1NUEA 1R8PA 3Q7CA 1Y9OA 4BDZA 1ATRA 3SUQA 4CBUA 5F8HA 1REGX 3G8TA 2OJ3A 4KI4A 3E1YA 1VK3A 1WDDA 2HZCA 5K9FA 4DUYJ 3OYDA 2YNGA 3W5XA 4KQZA 1RJJA 2KVIA 1Z05A 3G0ZA 4HI1A 4OI3A 1GOCA 2YHYA 1F5AA 2DNOA 1YJRA 2HZAA 3C3LA 3BB5A 3CDBA 4ZVRB 5BR8J 3DLJA 4DV0J 2D0BA 4CIEA 2CKWA 1VRUB 3LDOA 3N5FA 3NMUA 5HMWA 2UXBJ 4FLUA 1Y10A 1S0MA 5GAGI 2IS3A 4WQ5A 1U49A 3A8YA 1LWCB 4EAHD 2W4DA 1WAJA 1CZ9A 1LWXA 1RWWB 3Q8QB 3THVA 4KKOA 1S57A 4CO4A 2E5LJ 2XRIA 1SKUB 2AX1A 4B3RF 3W66A 4Z37A 1VRUA 2ZJQL 3PVXA 3O08A 2P9SB 5AE2A 4IWVA 1LWCA 5G4DA 3OYFA 3UD4P 1KVAA 3M9MB 4K5RA 4DR5K 3AVHA 4U67Q 3DLLQ 2YNFB 3N9UC 5BYRA 3G4SN 4F4ZA 3W5ZA 1KQSM 2OP5A 2V2VA 1IM6A 3MPVA 4WFNL 4CZHA 3CC4N 4L8RB 3RW7A 2GEMA 3G4SS 3FZFA 4U7UD 1KVKA 3CJCA 4CK2A 3D2FB 3IG1B 2M0GB 2GV9A 2UZAA 3LUYA 3TU5A 3CC4S 4RW7B 5FJ4A 4OYBA 4NA3A 4RUHA 2XQCA 4GKKJ 3M8PB 1MLAA 1ZA1B 2KKZA 3GV5B 4B9SA 2FJBB 4CF0A 2I5JA 4JI6J 3S3MA 3ZFVA 4Y0FA 4RW7A 5KT7A 1C0TB 2AEJA 1B64A 4NI2A 4FWRA 4MLHA 2W42A 4O5FA 4OLAA 3QJPA 3M32B 5I42B 3PYDA 4EBEA 1XI1A 5DETA 1TL3A 4M3TA 2D41A 3U1NA 4Q43A 3NCQA 2R7XA 4FBTA 2AP1A 4O0NA 4J2DA 1C0TA 1Q4RA 3GE1A 2QL5B 4FNHA 4TYAA 3CQXA 4ZCMA 4O8UA 3LDNA 3Q8PB 4KO0A 3BO4A 5HJYA 1N33F 3PX6A 4P7TA 4JI8K 2EK6A 4I6YA 3VAKA 1YJTA 1VR6A 5M1OA 4QJVA 4JV1A 4YOEA 4PA1A 4OHYA 2X1FA 1FVSA 3SUOA 1FRLA 3MMBA 4UY8O 2HHXA 2GHPA 3KDNA 1HNWK 2KYZA 1S6PB 3ZX2A 5L8RC 4QPTA 1N32K 4HCBA 2FC9A 4OZNA 1WSRA 1OY6A 4OQJA 4AXIA 3TEGA 2MKKA 3CF5Q 2JEGA 1D4XA 2I6WA 2V8GA 2ZJQQ 5FRMA 4FWSA 3HBTA 1IKYA 2FHMA 3EMTA 1NK6A 3S01A 4B1UB 5D78A 4U6PA 4X62F 2OKQA 3MUMP 1FKPB 1UW4A 4MYTA 4IO1A 4R5PA 3BR8A 2W4PA 2P5GA 1RLDA 1XNRK 2X1AA 4XAKA 5JVHQ 3OA9A 1C1BA 2BOPA 2GELA 2ZH2A 3MEEA 3ENHA 4QW9A 3IFRA 2MPUA 3D7SB 2CJKA 2CYYA 4FPIA 1TTHB 2GJIA 1UJ5A 2PMWA 1VBZA 4M3RA 4JBCA 2H5IB 3UDEA 2JLFA 1J53A 2W41A 4W5RA 4CESA 5CD4A 4IFEA 3V1OA 2A5XA 3ALYA 4ED3A 3R8EA 3N0VA 3CC2N 4ZTFA 2H48B 2CJBA 3VOVA 5B0FA 4NA2A 1T05B 1SZ2A 1YKWA 3CC2S 1Y5NB 3OVNA 4HTIA 1L5UA 3A0IX 3O1LA 4DR3K 1QTNB 2FLOA 3DOKA 5KFKA 1CJKA 2CADA 5EWEA 2J6TA 3VQEA 2M2BA 2B5JB 3H40A 3W9HA 1RILA 1A9NB 3SI8A 4IQXA 3GYXB 5EN1A 4U8YA 4LSLB 1CS4B 3KKFA 3MWTA 3B54A 3R6LB 4CTAB 4N41A 3ILIA 3BGRB 5CR4A 2EK1A 3LGMA 2QLJB 3W5YA 4NL5A 2CQIA 2LXIA 3D0PA 4L3KA 1KC8O 1S7IA 3A12A 4WU2A 4BDPA 2IVYA 1CS4A 1HNWJ 2J9CA 4CTAA 4P7VA 3BGRA 1N32J 4NLBA 1IWAA 1NMEB 1J54A 3QGPA 1NK8A 4O4GB 2HRYA 4FCYA 4FLVA 2RHKA 4JV5F 2W2MP 3T1AA 3LGHA 5B0EA 3LZIA 4PQAA 2JWKA 4B9TA 3US5A 4W92B 3UKRA 3D6FB 1QE1B 1HBNB 2V94A 1WC4A 2LCWA 3MM7B 5F8LA 2IRXA 1KN6A 4O4GA 2A42A 3SLCA 4F0MA 4ZS6A 2LA4A 3ULHA 3CJ9A 4BACA 2D1CA 2KO1A 2L3MA 4GVMA 3HDSA 2EI5A 2BABA 3U9DA 4ED2A 4YB1P 4I9QA 1TL7A 2A3ZA 3S3NA 1QD1A 5EX5A 4ECXA 1K9MT 4NXNK 1UFWA 1M5OC 4ZPTR 5HQLA 3IAS9 1EIYB 1IXKA 1J2VA 2LMIA 4NB4A 5H9EJ 2KT5A 3KD5E 5GMKa 2PFFB 2KVQE 1CJVA 3W61A 4DR3J 5FRNA 2EXUA 2MZTA 4CI0B 4WFBQ 5LT5A 3SFGA 2DY1A 4IEEA 1XNQJ 2VU5A 5LSLA 3M6VA 3NEKA 2QMWA 3CCRN 4CLWA 3ZSVA 2BW7A 5D77A 1S7HA 2NZTA 1RU1A 3FZLA 3PKYA 3NNAA 3LOUA 4A59A 3IWLA 3CCRS 1IG8A 3BGUA 1RT3B 1X5OA 1NEEA 3K5PA 3EPGA 5L1JA 3CJBA 3TVZA 2IAJB 1B7YB 2P9CA 1KD1O 2AYBA 3MR6A 3O9QA 4CHPA 4ZJLA 5AQTA 4F3OA 1MU2A 3AJDA 3EX7B 2E9TA 2XY5A 3H20A 4BRAA 1ZBUA 3J7YI 2IAJA 3TA1A 2HYIB 4QIEA 3SIPB 3GILA 2ZM6F 2DCUB 2AKWB 2BA9A 2YY3A 4OVLA 2G0JA 2OHDA 3ENBA 3KHHA 2RN2A 5JLFA 2XTJP 5GINA 4WIIA 5E7OB 2R4FA 5LJ3Y 3JTPA 2BQ3A 4YS2A 4X4RA 4UZBA 1F9EB 4ZPCA 2ZH9A 4PPZA 3WNEA 1KSPA 2IHR1 3UCGA 4JI1J 2VQFK 2O67A 3UI3A 3K89A 1UJ6A 2GV1A 2MHEA 1JLGB 3RTVA 4DFKA 5KFQA 1WC3A 4K4SA 4FJHA 4NRUA 3MEGA 5B08A 4ELTA 1LFWA 2B9YA 1Q78A 3QWUA 2MKCA 1HPZB 4OX9J 3MN6A 5C24B 4A8YA 4YOWA 2HWIA 4ISFA 4C8KA 3KTQA 1RBLA 4BC5A 2HGLA 2EHGA 2R42A 3RRHA 3ATUA 1T3OA 4AXJA 3RB3A 1G6BA 1VK0A 1RWPB 2HFSA 5IXUA 3UD3P 3GFYA 4YDUA 1HBUA 2VPZB 2WONA 3KWGA 5C25A 3ZETB 4CBWA 2ZC4A 2DNQA 3OD2A 5KRSA 4LBPA 4E2FB 1YTAA 3O80A 2WB1D 1IR1A 3RJMB 3CYMA 1NDPA 1IV0A 4P6QA 1WUAA 3AFGA 3ZETA 5J1EB 1PKUA 4ES3A 2WOMB 4J7CA 1TUGB 4YB6A 3BV8A 5CYQB 3HHLA 2I0XA 3K0JA 3CXCM 3J8AA 3KJNB 3FC9A 3AA8A 1K47A 4EWTA 4WYLA 5LJVA 4TYBA 4ZVPB 2HBYB 1NGHA 3QAEA 5DM6L 3W1YC 1M1HA 1GLDG 3GG0A 4ELUA 1LQ9A 5TKWA 4F0KA 2BV3A 3HVTB 2FJAB 1S97A 5J2NA 2DNLA 2PIIA 4BG9A 1ROFA 2HVHA 3BDPA 2HFVA 1AUDA 3TR8A 3GIMA 2VQFJ 3BF4A 2FYXA 4IH5A 4JD2B 5A6PA 1RABB 1FX4A 1HQUA 2ZFHA 2V51B 5AQGA 4FF1A 1NKEA 3RSEB 2ZF5O 1Q8LA 5D4OA 1BIZA 2RD5C 2QXFA 4CJKA 1DQ9A 1NK4A 1IH7A 2NYIA 2JWNA 5E84A 4KHYA 2BQRA 1HRHA 2YX6A 1U2RA 2ZZTA 4XH1A 4JD2A 4ZLPA 2MB0B 6FDRA 4Y00A 2Z57B 4ECTA 2N4DA 4QZVB 3DLHA 4OZ3A 1HD0A 1ESVA 2MHNA 2BJDA 4M5DB 4UY85 1OSDA 3NVMA 3QT5A 5ITHA 1KWMA 2P9PA 5HP1A 2QEXN 2MTLA 4OYIA 4FSVA 3OYBA 4DV7F 2E2PA 5GMDA 4OJ1A 2RILA 3D0HE 2QEXS 4LF5F 3U02A 3LPEA 1GMVA 1WF1A 1AA1B 5B0BA 1UEUA 5M1FA 3PRVA 1SC3B 2Z58B 2U1AA 3SNNA 1K8KA 1WSIA 4RTFD 4LVOP 1NGDA 4OL8A 3D2WA 5D0EA 1ZXOA 4LFCK 2YKPA 4CO5A 5JMNA 3MMVA 4U9RA 1AFJA 4AILC 4HR2A 2Y3YA 3EGVA 1REVB 3SMPA 3HO1A 2FSNA 4DI6A 1H3DA 3IGNA 2EBGA 3CQ8A 1Q0NA 2AGPA 2ZBQA 2OGUA 1XERA 3N01A 3B8AX 2CXEA 4RW6A 3MMCA 4Y6IA 4ILMA 1PAEX 3FBCA 1FNXH 1HBOA 4P71A 3DLKA 3TZZA 1RB0A 2G2YA 2MLXA 5KPRA 1T03A 2V0NA 4IDKB 2HFNA 3QPIA 2PI5A 1UEVA 2QA1A 4YMEA 2EFPA 4CK3A 4KRFA 5HROA 2N7CA 3MFIA 1L3SA 1T8EA 1ZAVA 2V4JA 4YOVA 4F8RA 4UOHA 1HD1A 1S49A 2OELA 3W8PA 2XSFA 1ZM3A 1ILYA 2QA2A 4CJ5A 2MZRA 3HPGA 3HOTA 2AJ2A 4AF1A 2YJFA 4OZ1A 3V9XA 2G8HA 3DLEA 4GKJF 4DG1A 3E8OA 3AODA 2GMHA 2MY8A 4K0KF 4CT9A 2VC0A 1NJXA 1VC5A 2XCPA 5K8NA 2PYLA 1FNOA 4OHXA 2H1YA 4O3RA 1Q53A 2YQ1A 2GJFA 2XYGB 3HT0A 2CPXA 1MWQA 1RTDB 2NXEA 4O4RA 4WF9L 1B70B 5IQQA 1TK5A 5RUBA 4EFHA 4ZP9A 2GVZB 4M5JA 2IC3B 2D4WA 1GMWD 3R8YA 5L1KA 2GUIA 1U25A 4A2BA 2PFUA 1S1WA 1XWLA 4DUYF 2BKPA 1TMJA 2AWZA 1TUUA 4DR4K 1CC8A 4DQQA 2SXLA 2Y1LB 1LKZA 5C42A 3LANA 3W64A 3QSYB 5FPMA 3MCPA 4BE2A 1BOTO 1B4SA 2GVZA 3GONA 3CJRA 2A6AA 1FKAF 3CIPA 3DYAA 2IC3A 4LF8K 3G71N 2P6TA 2CQ4A 4DV0F 5BR8F 2CJQA 1TR0A 4ZVUB 4RKUC 4ER8A 4R0JA 5SUHA 4TNOA 5EDWA 2UXBF 2HHHJ 2WB4A 1RT5B 2UVUA 3NAHA 2Q43A 5B0DA 1HNZK 3G71S 1B0VA 2DHHA 4EBCA 3CD7A 3LP1B 3KK1B 1VIOA 4PQUB 5KFWA 4O55A 2N3LA 3MM6A 1QHTA 1CZBA 2F7TA 2E5LF 3CNQP 3AVNA 3VQPA 2NS1B 1RT1A 5M2PA 1NLKL 2JHEA 1JLEA 3LA0A 2ZDPA 2KW4A 2ASJA 2M3DA 2QN6B 1HJRA 4NCGA 2OH2A 4NWBA 1TFWA 4ECUA 2KXHA 3H1QA 2AP6A 3KLGA 2P9IB 4PAAA 3QFWA 1WBBA 2GO8A 1PC4A 1R59O 3CM5A 4G1IA 2HBQB 2YNHB 3L4BC 4CNYA 3WT0A 5A0YA 4IOAQ 1WG4A 3CW2C 4ZLNA 1SPBP 3R5JB 1D9FA 3DDNA 1Q8IA 4EMDA 4X64K 3SCXA 3GOIA 4H5NA 4N47A 5K8OA 4OGEA 1RQ0A 4BGBA 2YNHA 4GKKF 5H9FK 5GVQA 2Y1IA 4ECSA 3Q8SB 2YCHA 1Y3KA 4JI6F 1TKTB 2CPFA 2J6UA 5BRHA 1OY8A 3OYNA 1KQKA 2BUNA 2XGQA 3O3GA 4KHUA 4HKQA 1W2IA 4DTUA 1SQGA 4D3HA 2ZWPA 4OLOA 4LF7K 2QWPA 2NXJA 1HQEA 2E7VA 5F8IA 2C28A 2OPQB 2DJWA 2O8BA 4WF9Q 2M8DB 4DR4J 1IUJA 4F26A 5CZ1A 4TY9A 3VA0A 2FGOA 4FM1A 2WUSA 3DN9A 3V6DA 4AHSA 2V63A 3M8RA 3EVMA 3PEJA 2F8SA 1S3XA 3D3BJ 4NYFA 4FLYA 1NRKA 4OYMA 1QAXA 3R6GB 5JVGL 4BS2A 2N3OA 3DXKA 2R7TA 5BXIA 5F1XA 4RNMA 1Q5VA 2W9BB 4N76A 3L3UA 1C0UB 2IVNA 3UDVA 2VYPA 4B9QA 3BR9A 3HLUA 4RNOA 3MM5B 4JN4A 3V81A 5FLXY 2BKOA 3GSIA 4B02A 3JSMA 4YUDA 4FP9A 2DGUA 4WTYA 2VA3A 3KG4A 4AE5A 3BSCA 3R1XA 1P9QC 2FSKA 4CJSA 3PO4A 1Y5IB 3C14A 2M4MA 2OTJN 1SH0A 4XDDA 2NLWA 4KHRA 2QKBA 1EKEA 4ZN1A 1HKBA 4ISEA 4DR6K 4PWDA 2OTJS 3ETMA 1E4GT 5CAAA 3Q8RB 1NHKL 4X64J 5GAGP 2DXFA 3KLIA 4QIFA 3ENVA 2EC0A 3D28A 5ETVA 3TUJC 5H9FJ 2HSEB 2H5EA 2AZ3A 5A2QU 2GTDA 3ULEB 1DBDA 2KM8C 1IJJA 1B3TA 3OS0A 3THWA 4RBVA 4NRTA 3RU0A 1N52B 4CFBA 1IBKK 2J8AA 4YHHK 2NXUA 2QSWA 3DOMB 3N79A 4CZFA 1ZM4A 4URGA 4IFVB 4HTUA 4LF7J 3EEQA 3OTEA 3UKUA 3WNGA 1SJ4P 3GR0A 3UR0A 1EP4A 3OQ2A 1QSLA 3FSYA 1E6VA 1F9FA 1EKSA 2E5GA 1PJ6A 2V8VA 1Q82O 1RHKB 1RISA 2LQ9A 4AH9A 4CHQA 4K2JA 1B92A 2B9EA 2VONA 1LWFB 1Q81O 1UVNA 4J9OA 2HAFA 3E3XA 5C7PA 3O9TA 4Q8EA 1N8RO 4USVA 4M63A 1FDDA 4DX7A 5KQ8A 1JK9B 3ET6B 1XQSC 2YWWA 5DO2A 5H1SV 1RCHA 2FLPA 1TYQB 1C0MA 1A6LA 4USTA 5JVGQ 1HNWF 3AOAA 3BF1A 4KT0C 1KVIA 1N4LA 5C10A 1N32F 1MWZA 4AHUA 3ET6A 2BE7D 3OVAA 2DGQA 2HFUA 1CEZA 3OSPA 2K3IA 1VSJA 1TKXA 2EFNA 1WDTA 2IOCA 3ZT2A 2IVOA 2IA0A 4U7BA 3ENWA 1N0VC 4MKBA 3VGTA 3JTOA 3JAMO 2KI2A 2F9TA 1DLOB 1MW7A 4FOEA 3AAPA 3G9CA 5JUMA 1X1PA 1S1UA 1NH7A 1W97L 5LSOA 1UZHA 5EX3A 4C3LA 4DR6J 2CG4A 1WC5A 4L3NA 3GLJA 4U7UK 1OH5A 4B1ZA 2P9NB 3AVCA 1U2FA 2G0CA 4B3MK 4WK1A 1UAXA 3MUTP 5F9NA 4OX8A 4G1PA 4MKAA 2ZH6A 3AH6A 2WW8A 2GIQA 3FR0A 2GZOA 3IWNC 1VLYA 4AL7A 3F56A 4LREA 2W6KA 1T9YA 3OYKA 2RDJA 2PN6A 4OI1A 3L2WA 3OYMA 1LAVA 4L76A 3QFPA 4DUZK 2QWLA 1GEHA 4DSKA 4YHHJ 2ROPA 3VWSA 2O5DA 2QK9A 4DR3F 4FVMA 3ZT4A 1H2VZ 2DGOA 5G0RB 3WEEA 1XNQF 1VQKN 2HQFA 3MPDA 3DU5A 4ZVOB 1Y0HA 2ACYA 4FVCA 1N34J 4FWOA 1S1VB 3NRBA 2V50A 1VQKS 3A5NC 1VHXA 1NGEA 3PW2A 5L38A 5KFBA 4MT1A 2HSTA 5LY3A 3T6BA 3SSSA 5JLHA 2XG8A 3N6NA 4CBXA 3ZX0A 1J9AA 5E0OA 4C6AA 4Z4HA 2GGPB 1BXNA 2Q6BA 5EUHA 5F3TA 4DV2K 1U45A 2MKHA 3LPUA 1N6QB 3MMAA 2MQNA 1H7XA 1CVJA 3UQSA 3GE9A 4PUOB 3ZSQA 1R8CA 5KQDA 1XMOK 1OQ3A 2XWYA 4BCAA 3C6AA 4AQYK 2QE5A 1Q9YA 4FKXA 3D66A 2QA4G 2BZ2A 3L7UA 2JL9A 3T69A 4J9SA 3KNGA 3UWTA 3EXYA 4DL3A 4JI1F 2E6LA 3MPUB 2AYEA 3HSCA 1JXVA 3NF9A 3BKFA 2KFYA 4URQU 4DS4A 4ZVTB 1EAYC 2ZBCA 2VZ9A 3Q2SC 3SXLA 2BE9B 2XSJB 1RYSA 4DPUA 1LW0B 2O1PA 1V9OA 3P96A 2P8IA 1G3OA 3FGVA 4OX9F 2CZ4A 4F50A 3L2VA 2R7UA 3MM9A 3D9BA 2YX4A 3RW6A 3MMJA 4PWWA 4IJNA 1LW0A 3QETA 3CTRA 4UY8T 1GLAG 1VQ7N 1OQ6A 2QW9A 1H98A 1IKVA 3IO1A 4DU7A 1URNA 4A48A 2QWMA 2HLTA 1VQ7S 3EM1A 3ONQA 4PYAA 2Z56B 1HYSB 1U2VB 2ZC3A 1ATNA 2YHAA 5KI6A 1X5SA 3VCDA 5KT5A 1ZM2A 3CDAA 4FN5A 3MF5A 3ZTOA 3FSIA 4MK8A 5GAHU 2OPPA 1Z26A 1M5PC 4AL5A 3A5OC 4J8FA 4KHPK 3MUVP 2RRAA 2KM8B 4DV2J 2XULA 3O4QA 2FHKA 2RRBA 5GAEI 1OS5A 4W4MA 2WZ1A 2ETJA 1R0AB 2A10A 3PO5A 1DURA 2DPNA 2BE2B 1V3SA 3IC1A 3RR8A 1HNVB 2CQ0A 5A8RB 4H0PA 3AVKA 5KFTA 3EO3A 1F6TA 4AQYJ 3I5AA 3M8YA 4JYAJ 3O8MA 3KKSA 4FWMA 1R0AA 1VQNN 4RUCA 3QT7A 3HP9A 4OKJA 1BL3A 4PXBA 2XO7A 2EKYA 1HI8A 1VQNS 4JI3K 1RTJA 2CDQA 3SQOP 2VQFF 2OPSA 3CJ0A 2HQ3A 5MAOA 3AO4A 4BRLA 4EZ6A 2ITMA 4AHRA 4V19X 2ZHOA 2EWSA 4EI2A 1YQHA 4CLLA 4MIBA 4JKGB 2Y8YA 1JNRB 4FYYB 4HACA 2CH6A 4J37A 1OSCA 5AXNA 3Q0AA 1F9HA 3J7ZO 3DDIA 5HK4A 3TARA 1I1GA 2HBJA 2QZ8A 1VOMA 1CQNA 3J7YP 3KJFB 4BRMA 1KCFA 4Z4GA 2W9CA 3ELHA 3PCOB 5LL6Z 3QMLA 2BRKA 3HX9A 2JJ4D 3DRSB 1KC8T 2HLUA 1JJCB 4M1KA 1KQGB 3KHLA 3DLRA 4JEPA 4AYBD 3U3GA 3L09A 1EQ0A 1TL4A 1FXRA 2RHQB 4WKYA 2ZJRL 1KAZA 2V7ZA 1ZBFA 3VVUA 5AZJB 5CCLA 3VTHA 2B8QA 3CFRA 1YAGA 5KG7A 4JI5K 3F5TA 1RT2B 4N8OA 5C15A 3P1GA 2CZ9A 4KHPJ 4MLEA 4CGJA 2HRUA 2R8HA 1N5YB 2P1JA 4MTPA 3ATVA 4CZLA 4FJNA 2RHSB 1X9MA 4WZQA 2VDHA 2YVSA 2VWBA 1RHMB 1IKWA 1VJQA 3CT9A 3ZZYA 4ICLB 3WXKA 5CHIA 3P38A 1RLCL 2DHXA 2UUBK 5T7BA 4O5BA 3NS5A 3I0RA 1YXQA 2OO4A 2KDOA 4BR4A 2FZKB 2JZ5A 3J7AN 2H9ZA 3S1TA 2VG7A 1TELA 2BJ8A 4JI3J 2OA8A 2DITA 4BHQA 5DGBA 2GQCA 3P8BB 5E3QA 2KFNA 5ELZA 4LD0A 1B7FA 4CFCA 1R8BA 4JV0A 1KLMA 4IG3A 3FZBA 3K7RA 3A3PB 5KOXA 3Q24A 1VIXA 1BIUA 2PY5A 2GQ2A 5LJ5Y 3U8XA 4GV9A 1SJRA 3GYNA 4CIOA 4JS4A 1SIZA 4KGXB 1SXLA 4DV5K 3M3ZA 4ZDNA 3EE8A 2P51A 4QWAA 3RAMA 2W6LA 2E66A 5KRTA 1HARA 1S48A 1VS3A 3SV4A 4RG8A 4LBHA 3PW5A 4I6MB 1NGJA 1KD1T 3FFIA 3NMAA 3ZLJA 2HHWA 2MQMA 4CCHA 4CRJA 2R7YA 1ZZNA 1KBRA 1YDLA 4DSLA 1BQMA 4DV4J 2QFJA 4RPFA 3DOLB 2H65B 4I6MA 4C97A 2C2NA 4O3PA 1NZ8A 3E9OA 2HK2A 4G1QB 2VBZA 1OVQA 1QVFM 2KHCA 4CEAA 1VQ4N 4DZDA 4EHTA 5KFPA 3I87A 2X1GA 4PL8A 3RBZA 3W63A 2EG1A 1VQ4S 1SH3A 4JS5A 5CA5A 2P9KB 3NFAA 2HQCA 3DMJA 1KQSR 4F3TA 4G1QA 4FJJA 2ZH7A 3B82A 4QWEA 1GXTA 3VQTA 5KGXA 4QS7A 5K14B 1JCEA 3ZEUA 2HHHF 3NAIA 4LF1A 4USJC 4NYNA 4PY5A 4NASA 1NCLA 4NEZA 1DTQB 2E7WA 1NK7A 2IFXA 3VF4A 1P6TA 1NK5A 5TKYA 2X6SA 2PMZD 4RR5A 2RPIA 2DNNA 3MECA 2G8KA 1JIHA 2QT7A 5T41A 3KLEB 4DCPB 1VLOA 2DGSA 1FEEA 5KFOA 1DTQA 3W2WB 3VZIA 4M3YA 2DH8A 4IKAA 1UVIA 5AQOA 2EVZA 3LF0A 4BRCA 3AJ2A 2B4VA 5C5JA 2ROEA 4ZTJA 5IOLA 3X3UA 3OPKA 3IWXA 1RA6A 1XR6A 2WAQD 4I2PA 2A3JA 2DK2A 4U8VA 2GS8A 4BQLA 4LRFA 2DR5A 2B6AB 3E01A 4XPCA 3PHEA 4QOZB 5AQMA 4CEBA 2C2DA 2J5AA 1N88A 3KLFA 5J2MA 2RB7A 2HF4A 2ZHAA 4TU7A 5C2FA 2XLJA 1BWVA 1QQNA 2DPIA 3NGTA 3C46A 3Q22A 4O23A 3SAFA 2QFIA 4X4NA 4DR4F 3JTNA 3MX2A 1M5VC 5KG6A 4A8OA 4ZK7M 1F2GA 1RDRA 4E7LA 4OFZA 3MN9A 5EVZA 2ASYA 2BJ3A 5LMNK 1HI1A 2G0IA 4TLQA 3L8BA 1IJFB 1G99A 3W2VA 3ASMA 1JWWA 4PKDB 5F0UA 1RAHB 3MCOA 2N82B 4NO7A 1RAJA 2ADBA 3VENA 2CDRB 2E2QA 3J81Y 4PKGA 4PXEA 5KPZA 1H2UX 2A18A 2MXYA 4IO9L 1S1TB 3SCLE 4FDFA 3HTVA 4TY8B 2I7PA 5AQKA 2ZUAA 1U04A 3TSPA 4QYZK 3PJXA 3RBEA 1T9VA 1RT7B 4TVAB 6AT1B 3HKZD 2JVRA 3OL8A 1S1TA 1BI4B 1SI9A 4C0BA 3F73A 2XWXA 1P9YA 4KB7A 1K9MO 1YSJA 3IAM9 4NA1A 1N33K 2DCLA 2NZCA 2Z1JA 3DLGA 4ZHRA 2D9PA 1CULA 3M9OB 3FQLA 4WTOB 4HHTA 4CHYA 1BI4A 4ZKAA 4X64F 5M1PA 2R7WA 4NZ7A 3AB2B 5AQJA 4Z4EA 1HLWA 1K1QA 3IBFB 2JDJA 4G65A 3DRYA 3LWMA 3K5MA 2DNRA 3HVAA 2MY7A 2J8SA 4C7QA 2H4WB 4NLTA 4CJVA 1JXEA 1RBVA 4WCEQ 2ASLA 4QS9A 1Q7YT 1CXUA 2GW8A 3CDUA 1R89A 3AVBA 3JB9k 3NXZA 1UWAA 1CBKA 5D0GA 4LF7F 2UUTA 4X62K 3MEDA 3FZ2A 3Q23A 4I4BA 3QGIA 3C7NB 3VV2B 4IQMA 3R1HA 2W7AA 4Y1DA 4YFUA 1ZBTA 1NH8A 4LRAA 4ID8A 3M30B 4DZ6A 2A2CA 5LMNJ 4ZPDA 3C7NA 3UN5A 1ZOTA 3H0PA 2E9RX 3OL6A 4YY3K 3OYGA 3CJQA 5ETQA 2DNHA 2HHVA 5KFEA 1FW6A 5A8KB 1RAOA 4KTZA 4OV6A 2MQLA 2XS2A 4C48A 1FRIA 4F2RA 3E51A 5AZIB 4RW4B 3T5LA 2BX6A 4W90B 3QRRA 1NGGA 4OPAA 1JJ2M 2FZCB 1LCUA 1HKCA 4FJ7A 2KYXA 4DV1J 3B8HA 4QYZJ 4IO9Q 3C6TB 2CQBA 6FD1A 3DRXA 4JHDA 4HEA9 5KT2A 4F4KA 1SJQA 2FDNA 4RL1A 4OLPA 1U26A 1VSEA 3HZEA 3BSOA 3F0NA 3BREA 2HS3A 2PFDA 3KG1A 4WP3A 1J27A 2YWEA 1FRJA 5EOYA 4DFMA 3C6TA 4DR6F 1QLNA 3GDQA 1RGIA 3QEPA 2Z2YB 1SIWB 1C4AA 2CFXA 1NOYA 5AQZA 4Y2IA 4E1MA 4LIRA 1TVRB 1UFKA 3PIPL 1NK0A 2O8EA 1A5XA 1IBMJ 1Q18A 4I7FA 2EC2A 3D6RA 3EGNA 5HVFA 1SH2A 2HIYA 3EICA 3M6WA 4B9UA 4DU8A 3DC2A 2BACA 4RBUA 1Q79A 1IBKF 4M5LA 4YHHF 1Q5YA 3Q89A 5DDPC 3OXGA 1ZPVA 3T9NA 1R3NA 3VQ9A 3AVFA 4EYHB 2HW3A 4ANCA 2IJRA 1LEOA 1N34F 4Y2CA 3MI7X 2QMXA 3ZO7A 3NF7A 5D3GB 5KFSA 3QFUA 2KFZA 4FF3A 3BO3A 2QTWA 1FKOA 4M5KA 1HWUA 1N0UA 2V67A 1C6VA 4B8AB 4FZYA 2J7KA 3DRRB 3WXJA 2J0WA 4YY3J 1FK9A 4Q45A 2B4JA 4R8UB 5D4NA 2W40A 5AQLA 1QSYA 3MCAB 1FWLA 1IBCB 4CIGA 3AHPA 5MLCQ 3PACA 5CYMA 2RQMA 3HOSA 3VQQA 3D6MB 1UETA 5D15A 1HW8A 4B3OA 4TN2A 5FIIA 1BDGA 3QATA 5KFJA 4WZMA 2L41A 2V7YA 4KAZA 4KV8A 5DG7A 4H5VA 2ZD1A 2P2CB 2AJ4A 2DXEA 4NLWA 2MYFA 3ZZZA 3PRBA 2HHUA 1Y11A 2E1MC 1ZZFA 3DHWC 2ZOFA 3HP6A 3IM9A 4CLPA 3KJQB 2D3OR 4UUWA 3H5XA 3BGOP 2JOQA 4DL7A 2KQ2A 2UXDK 3CDEA 2NR0A 2K7KA 2JEIA 2B0GA 1SKSA 4B3MF 1XQIA 4AUKA 3O2IA 4BREA 3J7AP 4FW2A 4FLTA 2X1BA 1H38A 1ASVA 3L0QA 2BVZA 2GAGC 4FJ9A 2JVOA 1KAXA 5LL6d 4FK0A 3H8YA 1MNEA 2ZM6K 3TZWA 3ZTRA 2J4RA 4G9ZA 2YPYA 2ZHBA 3CXCR 5IWAJ 4A8XA 2PAVA 4J9KA 2HQGA 3BSAA 3QBXA 4KAIA 3KVGA 1RDBA 1OYEA 3SSRA 1RBOB 4U95A 1WOQA 2NXNA 3M6GA 1D8YA 1D0EA 1NSQA 3L7OA 2Q6CA 3PEHA 3W9JA 2GHVC 3OXLA 2HBKA 4A61A 1U4BA 4IG0B 3KK3B 4CFAA 2GBZA 4JB8B 1JKHA 4WYWA 1YBAA 2AQ4A 2MZ1A 1XTZA 2HPUA 1D8ZA 3SDEB 3OYIA 2RS2A 3BQ1A 1ASWA 4YOYA 3QO9A 5ETKA 1X4DA 3TAEA 2B8PA 5B0GA 4FF2A 1RTZA 3QYYA 4DV2F 1WNSA 4OKKA 3CB4A 1EKRA 3IMXA 2HMIB 1T9XA 1SJ1A 2RE1A 5AQRA 3SDEA 2VGMA 3BZCA 2G9OA 2E9ZA 1CQMA 4HL9A 1X4EA 1QVGM 3C0BA 4CH7A 2OPRB 1EX8A 4KH6A 1H2TZ 3S6EA 4AQYF 4QU7A 4CDIA 4CJRA 2GX9A 4JYAF 2NYHA 2HVIA 3AD8C 1IKXB 5M1KA 4WK3A 4DCOB 5A8WB 1PO6A 3OS1A 4A8FA 1GQEA 1WWHA 2V8PA 5FLXU 5LXYA 2AD9A 1PBUA 3O44A 1QM9A 2F8EX 5J2QB 1RWUA 2UXDJ 2O01C 1WEYA 1X5TA 1FFGB 4ED8A 4B9MA 3GFXA 4KJIA 3VVTA 1S6QB 2VA2A 5J2QA 2MGZB 1Q82T 2Z4PA 3K0SA 2NZ4A 3LP0A 4IO8A 4USUA 1RGVA 1Q81T 4PXCA 2FD2A 5DQGA 2ZH3A 3BQ2A 1ZYQA 2IBKA 5A2QO 3BN7A 3GIKA 1YUWA 4GMJB 3SBGA 1ELOA 3W3DA 3OUYA 3ZCMA 2EG2A 3AT1B 1VQ9N 3QEVA 2BRLA 2HNDA 4QWCA 2MZQA 1NLVA 5DS7A 4DFPA 1QUPA 1RDWX 1VQ9S 2AJ0A 1KLNA 1WNEA 3J81j 2VOOA 4M7XA 1RAIB 4DSJA 2CPDA 2AF6A 1G2EA 3KYLA 3THXB 1YBTA 3OJSA 1C1CB 5JS1A 1S4FA 2FY8A 3WIVA 2HRTA 3WBZA 4WQ5C 2Q1LA 2YX7A 1HR0K 2D0AA 3UDLA 4ZPBA 3V4MA 1S9GB 2E20A 3ZZRA 4KHPF 4NE9C 2PYJA 5HQMA 2YQ0A 4XH5A 2PGCA 4ALZA 1KONA 3L2QA 1K6YA 3AY9A 4CQ1A 4EGLA 2DNZA 4RW9A 2H3EB 2HG4A 3R2CJ 3MHYA 4OYXA 4P74A 1FVQA 4PYDA 3KMQA 2C3MA 3DU6A 4JKHA 4M41A 2MLZA 4WE1B 2QYCA 1PYSB 4PR6A 4WKRA 2AYGA 2LECA 1JLCA 2UU9J 2VCPA 4DTRA 1HW9A 2FVCA 4L74A 4YOXA 5DQHA 3DXBA 1T6DA 4JI3F 5KT6A 4JOUA 3THYB 2I9SA 3M8ZA 4N5SA 4WE1A 1YT3A 5IV4A 1VISA 2I1RA 4P9SA 4CYUB 1VHIA 2CPHA 5HL7Q 1ULRA 4PG7A 1Z25A 3CJ1A 2P9LB 1T9TA 1RT4B 4H0OA 4FYDA 3PW4A 2D1KA 5GAEP 4KFBB 3EZUA 1KVJA 1RA7A 5KFAA 3OTOJ 1MG7A 3SJHA 4Z2XA 5J1PA 4JK9A 4F67A 2CQ3A 1YGYA 5M1QA 1K0VA 4DTSA 4IKFA 1M1GA 4DV4F 2KH9A 4FKYA 4KH5A 3H5SA 5BN8A 5ETPA 4JLHA 2XS7A 1OWXA 4KE5A 4Z7YA 1URRA 3O6QA 3FMWA 3HHEA 2V68A 4PG8A 4LIWA 5KG0A 1HR0J 2NSCA 4FJ5A 2ZUGA 1GLCG 4YOTA 3EDRB 2G8FA 1H73A 2KB2A 4GKJK 1UWBA 4ZCIA 1BQNB 4M3XA 2VKZG 5KAKA 4LSNB 3I0SB 3DGPA 3P31A 4MH8A 4K0KK 1CJTB 5FDLB 5GADI 1RZMA 3TSQA 1YI2N 3LGNA 2VKRA 4IRDA 2QLWA 2LDIA 1T6CA 1TL1B 1EQYA 3MFHA 4K8ZA 1D3WA 1BQNA 3MAAB 1YI2S 2I8EA 2UUBF 1QJHA 1RADB 3SUNA 5FDLA 5IZHA 2GIFA 2XO6A 2AIRB 3FQKA 3N6LA 4OLBA 1XJWB 1FJGJ 4YR3A 3PYGA 3FCHA 3UVJB 1S76D 5J2PA 3TPQA 1BD6A 2I38A 5IM0B 5CZVA 3H3NO 1QHAA 3PW7A 2QSFA 1IQZA 4Q2MA 3EYZA 4DV0K 5BR8K 1BA1A 2AW0A 5HO4A 3C6UB 4QR2A 2QLFB 2IM2A 2UXBK 2D0PA 3MWPA 1WUUA 2JEFA 3S8SA 1M5KC 2HNZB 5IM0A 2NUUG 3I96A 2VG5A 4LJMA 1QS4A 3H6EA 3OVSA 4QPXA 4P75A 3H4BA 1VC6A 4U67L 3ZTQA 3DLLL 4H4MA 4JI0K 3M1VA 4MMOA 2G2ZA 1NG9A 3OTCA 1NU0A 3R7NB 3BGFA 1F3FA 2HNZA 3FEYB 1AB8A 3VMFB 4WXWA 2V5HG 2QO3A 4A8QA 4J9LA 4BY9C 5EY4A 5I3UB 4M3ZA 2CVIA 3C16A 2PA3A 4LF6J 2PI4A 1W0HA 5L39A 4B8CA 3TTCA 1T0TV 3G25A 3DLBA 5B09A 4QW8A 2FJXA 3N4PA 1TKDA 3A3OB 1I94K 3RRKA 2DTUA 2JNJA 1XMBA 4IFYA 5KFYA 3AARA 3SBMA 1EARA 3QBWA 4CGGA 3HZGA 1SL2A 1K0TA 3O9RA 1FWPA 2AZ1A 4NYOA 3V5RA 2CPZA 2YNGB 4ID1A 2DNPA 4ISGA 1WAFA 3F41A 4X65J 3TAPA 4RWTA 3J7ZT 1HHTP 4Z94A 4HLBA 1QAYA 1M1KO 4M95A 3O6WA 3K57A 3B78A 1XR7A 3SFUA 4EFAC 4M5NA 4RNNA 4MFBB 5BR9A 1V4TA 1TK0A 3PR5B 1U6BA 4KKOB 3FLCO 2CPIA 3I5CA 4WFZA 3MR5A 1SJ3P 2R7RA 2J9EA 1NDKA 2Z8QA 1FRHA 3C6HA 3B6PA 4MFBA 3LAKA 3MM8A 1W2BR 1O51A 3TQ1A 4DEZA 5K8MA 4P2FA 3T5KA 1RE1B 1U1LA 4FK4A 5AQPA 2FC0A 2VGNA 1T3VA 2H5JB 2HOEA 3CF5L 4Y2KA 1HWLA 3MXJA 3I33A 4DQIA 4JI0J 4XPEA 3NNCA 3DXMA 5EHHA 1W25A 2XB2D 4EBDA 5CHCB 2B4UA 5E3CA 3VPZA 1NDCA 3HXMA 4NPOA 1CG2A 3M2RA 4EO8A 3N4WA 1FJCA 5JVHL 4WXOA 1J5EK 3KK2A 4FZXC 1E6YA 3T6JA 2WCXA 2J9DA 1NKBA 3CCLN 1F2HA 3TA0A 3CD6N 2ATCB 3VEWA 4TQSA 4A57A 2QL9B 3MR3A 1M5SA 4ZVFA 4H4KA 3JYTA 5D0RA 4Q8FA 3EXCX 3CCLS 3R5AA 3CD6S 2I5JB 1KVCA 2DBBA 4B3SK 1SQEA 1I94J 4NI2B 5LMNF 3HZ6A 1RBSA 2VPYB 2HVZA 4GC7A 5K5MA 3Q2TC 1TL3B 4Z4CA 1QAIA 2J0SD 3FUYA 4O44B 3BZQA 4AFFA 1RBUA 4QIVA 4HH1A 4J2EA 3MZIA 2DR7A 2XNRA 3VN5A 3TX0A 1KR4A 4P2SA 1I39A 4UOGA 1NM2A 4KO0B 2UVRA 3SQ0A 4NLDA 5HBMA 4ED0A 4FOIA 5HVGA 4DV1F 2RKIB 4EO6A 4O44A 3I32A 4JKAA 2W7OA 2RT3A 2ASOA 5AQNA 3UPFA 2AA4A 3TTFA 4FNIA 1IR2A 3PSFA 3MMBB 1NDLA 3VGUA 4B9NA 1JL1A 1G7CB 1DTTA 4BR0A 2RQCA 1BHNA 1Z2ZA 1Q86T 2RKIA 2V69A 5MLCV 3PJ9A 4I0WA 2HFZA 5F8MA 3FJ2A 4C11A 1IKYB 4WBFA 2GIRA 3K17A 1IBMF 4YOUA 3D67A 4R5PB 4CERA 5E3RA 2NPIA 1A5VA 4C98A 7FDRA 2O66A 2WRMA 3N5BA 3BY5A 1C1BB 4O0JA 4YDUC 3IAYA 2QTDA 3MEEB 2RSQA 1R6VA 1PJ5A 1J5EJ 1WSFA 1FDAA 2OEJA 4UZCA 3D6TB 1LOTB 1HJOA 3H90A 2R9LA 3QZ8A 1FRKA 2UV8G 2VQEJ 2I7NA 3AAQA 4AM7A 3G10A 4B3SJ 4KGMA 2O8CA 2DD8S 4FJLA 3HHLC 3NGIA 1UEKA 1WSHA 2YWKA 3HPHA 3LWLA 4GY2B 3SEOA 4YY3F 3LO3A 4DPOA 1S99A 5E2QA 1S10A 4M8LA 4V1Ak 1RDCA 2D0CA 3GCXP 1ACMB 3ILOA 1T02A 2IJFA 2AJFE 3DOKB 2UUCJ 1X7VA 1CJKB 5IFMA 4WFBL 2C2EA 4BROA 8RUCA 5FPEA 3WNFA 4ILJA 5IS2A 1S9EA 3VGMA 1T9WA 5H9EK 4CH0S 4ED5A 3SQ2A 3AXKA 3AVLA 3F44A 3ZT3A 4CHOA 2O8FB 1W7AA 3W62A 1XNQK 3OTDA 2MJNA 4FL9A 1FE4A 2QLXA 4KRWA 3TZXA 2HEKA 3DJCA 2R2RA 3KKRA 4CO2A 3GMGA 2OZMA 4ELVA 4BRHA 2GAHC 1T11A 2POKA 2O8FA 3H98A 2V8HA 1EETA 2MQQA 1RKIA 1NGBA 2RNEA 1FD8A 4GO5X 4AM6A 4KHSA 3AA5X 3L4IA 1LK7A 5E3PA 3ZZPA 1Z1ZA 4X66K 3I8BA 2F4VK 1HNXK 3VF2A 4CIFA 3VERA 2G1DA 1YVUA 1LW2A 3UKRB 4CZKA 3D7EO 2BJEA 1TV6A 2FHJA 5D8HB 2B43A 2AMCB 2CNNB 1MMLA 3KHRA 2OMLA 1VRTA 3U1MA 3WZ0A 3NGKA 3J80Y 3SQGA 2UUAJ 1J6ZA 2A2DA 4ID5A 4EZ9A 5M2RA 4ED1A 5IWAF 4CF1A 1KHWA 3AD9C 3CERA 1WSVA 2XYHB 3BF3A 3FBFA 1BO5O 3MAHA 1NPPA 2FC8A 1PG5B 1K73O 3KUEA 1L3KA 4JKEA 4OYZA 4YORA 4KPYA 5KT3A 1KVBA 1CJUA 1WOSA 1TL7B 3NCRA 1FJEB 4LFBJ 4JI1K 4A2AA 4H8KA 5F9LA 4IBNA 3QBCA 4FJMA 5E41A 3OYAA 2ZJPQ 2BEFA 1S59A 3UO0A 1YJ9N 3NHGA 3P4IA 1WHYA 3WUHA 3D5MA 4EHUA 3V2UC 1CJVB 2UVWA 1UA1A 4MK7A 3B6BA 4ZVEA 1YJ9S 1TP7A 3CFPA 2BYCA 3MCMA 1VQYA 3DM2A 3TQEA 2YV0X 3NL0A 4JI2K 4OX9K 3HMJG 3SPZA 2NLXA 1RAEB 4XIUA 3AD7C 1GLEG 1Q8BA 3TJ8A 3HHDA 2F5GA 2YKMA 3IKMA 4I2QB 3DRPA 1X3NA 2RIJA 1ZAWA 4J91A 3KWMA 3UN2A 3NS7B 3IS9A 2VWJA 3PRDA 1CXQA 1WD6A 5A76A 3AOBA 1UPPA 1VSHA 1IWGA 1Z4UA 5KFCA 3T1HK 4I2QA 1MU2B 2XZTB 2F8MA 2EFVA 2QM1A 3EL2A 5JS2A 2UXDF 2YH0A 3CHWA 4CZMA 4BR2A 2VASA 4K4YA 1BUPA 4BRFA 1TGOA 3TTDA 3M4XA 3DI6A 4X66J 3KG0A 2F4VJ 1HNXJ 3ZSOA 3QFHA 1XIQA 2YHXA 1P90A 1SUQA 4Z4FA 2W9AA 3HSTB 2C1EB 4L3QA 1AUSL 3OYHA 4OO1J 3LDSA 3ZT0A 4K4VA 2CPEA 4NX9A 2NCKL 1V6HA 3M6UA 1N5TA 5IT4A 4K43A 2YBVA 3OYLA 4C4WA 1X0PA 5T7LA 1Q1KA 2F9DA 3SQ4A 4IR1A 3MEGB 4QYRA 4ZLLA 4C8ZA 3TVYA 3EKUA 1X4BA 1IR0A 2C22A 1HWJA 1X60A 2KU7A 2FVQA 4PEOA 3Q83A 5HMZA 3EZWA 1U8WA 3R5BA 3VEVA 1RWVB 3CQYA 1PGZA 4M5MA 3AQPA 2DFEA 4JI2J 2XZWA 3P83D 3JXOA 4WP9A 3BBBA 3WHIA 5CE3A 1HBUB 2WONB 5C25B 2CQ1A 3QSIA 2AJ1A 3CFOA 3VESA 2YKNA 2F9JA 4M45A 4O0IA 3RR7A 2XY6A 3HSDA 4F9OA 5F0XA 1AYEA 3RMAA 2FPHX 3CCSN 2MMYA 1R43A 1MROA 4GC6A 1SVDA 4AHTA 2DNYA 1FHTA 4E7KA 4FPRA 2FJEB 3R5DA 4KH0B 3ZC4A 3CCSS 3T1HJ 2R8JA 4DJBA 3FK4A 2UU9F 4CEDA 2G13A 2B9WA 4O3NA 3HHLB 4IH7A 1WC0A 1S22A 4IRKA 4OJGA 4MYUA 3H4DA 4MKYA 4ILGB 2CA9A 4DR7K 3LPTA 4X4TA 1WG5A 1QVFR 3NH2A 4OYOA 4M5GA 4YB5A 4LF4J 2DYAA 2KHDA 2KLAA 3BKTA 4LQ3A 3RB0A 2KTQA 3CO9A 2WW4A 1T95A 1IBLK 4QBUA 3D3CJ 3EZ5A 2KT3A 2VBYA 4BGAA 2VF3A 2W8KA 3R27A 5J2NB 3BGLA 1UA0A 4GV3A 4E89A 1H72C 4DTOA 1HQUB 1WACA 1XBWA 2PBDA 3OYJA 1FFWB 1YLXA 3CMAN 4J2BA 4WQ4A 4J90A 3IGVA 2DR8A 2CJXB 1WB9A 3CGIA 1R31A 3P6YC 1YZ7A 3CMAS 3NCIA 4XTTA 2IA6A 1VK8A 3CPEA 3P39A 3H5YA 4NYZA 4J9NA 2PE8A 2RU9A 1V3ZA 1CSJA 2HWHA 3OW2M 4HT5A 2P9UB 1U1MA 1HR0F 3NKYA 5JJBA 1U6FA 5HJXA 2J7WA 1NSKL 4DTPA 3UW1A 2P9PB 5HP1B 1KNZA 1WSGA 2P9UA 2FY1A 1ASUA 2DTJA 3NDKA 2ZQBA 2RQKA 2VG6A 2E7XA 4B9LA 3K59A 2D5RA 2L08A 3QGHA 2BR0A 1C4CA 2A1SA 4KC5A 2C2KB 2V4QA 2E4LA 4PCQA 2AJQA 2LQJA 3JS6A 3SYZA 1Y64A 4UUXA 2XMJA 1K8KB 3CJTA 1JLBA 4DPWA 4DL2A 1WN7A 1Y7PA 4RLEA 5AT1B 2DY4A 3GIJA 2FB0A 1HFEL 1FJGF 1AT1B 2ZH1A 1UZDA 4DR7J 3VQ6A 3HPOA 4CLYA 2Q31A 1XHZA 1CC7A 1SQFA 3FZKA 3PXGa 3T5HA 4CZIA 2VFUA 2BQUA 2VB6A 2GVDA 2BTFA 2CZVC 3OLBA 3NNHA 1Q7YO 2F40A 2O4IA 5KOWA 4RW6B 3MMCB 1IBLJ 1UVKA 2HHHK 1VQ6N 2W25A 3ZZTA 1HBOB 2DHGA 3DLKB 3CJ5A 4TSXA 2LSNA 1T03B 1KDNA 1VQSA 4F0HA 1UKUA 4HVZA 3WX4A 1VQ6S 1VSIA 3I55N 3R97A 1A0OB 3C19A 4GRSA 4DCJB 5HROB 2OI2A 3R3LA 4HCCA 3I55S 4CJQA 2V4JB 5C2GA 1FA0A 2DH9A 4NLCA 3KUHA 4UF4A 4IOCL 1NOZA 2Z1IA 5IT9Y 4IOAL 4F7VA 2GA7A 3DLEB 3T41A 4DG1B 4HHHA 5L1IA 4IR9A 4LF6F 4H5TA 5JMVA 3CJAA 4M63C 1J5OA 4MO4A 3PFEA 1S4EA 2V34A 3M1FA 3TANA 1YVNA 3AVIA 3BP8A 3LM2A 2KKHA 3AQOA 2KZMA 3G82A 1BCMA 3VQSA 2O3DA 4LR7A 2K7JA 4E3SA 1SV5A 4GVBB 3V4IA 2E1PA 4CW7B 2DGXA 1S1WB 4KYZA 1ZC6A 1WKKA 2GJ2A 5C42B 4RWXA 4X65F 1N36J 5M1NA 4CJLA 5GAGU 3VAFA 5AXLA 1NJWA 3DYAB 4GVBA 4Y34A 1NJYA 3BPSP 3VAHA 3IMQJ 5K20B 1YJVA 5FLXO 2IDLA 4HUGA 1UPMB 1H1VA 1FTCA 2MZJA 5KTQA 3RGIA 3UIQA 2KJVA 1UVMA 4ZJQA 3MM6B 3VQCA 3I56N 1RT1B 3O9SA 1JLEB 4RUBA 1RTHA 3Q8VA 4NCGB 3I56S 2XNQA 3PIOQ 5IC6B 5GADP 3QEXA 1F0XA 2RQ4A 3IP0A 3LQVA 3KLGB 1X3MA 4JP8A 2IIHA 1DY3A 3PY8A 4KH4A 4NEYA 2ZZMA 2XMAA 1FNMA 3CJKA 1RBRA 3EDQB 5ETMA 3HHLD 4JI0F 5HMXA 5IT0A 3POTB 2F63A 3AA3A 2X6NA 4DPXA 3LDQA 4KREA 5A0YB 2JC1A 3ENQA 1X5PA 2VH7A 3EE3A 4DV3K 2M9KA 2D3ZA 3C8YA 4J9QA 2FBVA 1JJ2R 2HURA 5ETLA 2KRRA 2O4GA 3POTA 4L6V3 4IOCQ 3NWRA 2ADCA 1S1XA 4I56A 2ZNZA 4LC9B 1TKZA 1AFIA 1MN9A 1I94F 1L3VA 4NLPA 4LF5J 1X9SA 2YHWA 1O8BA 3PM9A 2VV5A 2DFHA 3HSZA 1LAWA 1RAGB 2E1RA 1YRXA 1HQEB 1NHUA 1KOOA 4FYVB 5DGAA 1RT6A 1WOOA 3BBFA 4LF2A 2O8BB 1T9UA 3HI9A 2XMMA 3B4MA 3JQJA 1RACB 2R7VA 4KHNA 2UXCK 4GMKA 2Z2LA 4N56A 4WWSA 3V6DB 1O0PA 3ZTSA 1DAXA 3FNNA 2KG1A 2WBNA 4CO3A 2K2PA 4TU8A 2OSQA 1U0HA 5KG1A 2O8DA 4ECWA 2XHWA 4HUFA 3ZZ0A 2NQPA 4CI6A 5DRKA 1LFPA 3ZYYX 3DFEA 2ZKTA 3DXKB 3AAWB 4X2BA 2ZH5A 1K1SA 1HKAA 3GQCA 4QU6A 4BC2A 2ZE2A 3AV9A 2PA8D 4C2MA 3VF6A 2DB1A 3TYTA 1UW9A 5KFRA 3LP3A 1H0HB 2DGWA 3H2LA 1WI6A 3V81B 4XO0A 4UQTA 3GFHA 1O5JA 3JSMB 4DU3A 2QRRA 4GW6A 3AY0A 1S0OA 2AGOA 4YNQA 3C15A 2XMVA 2I2YA 4DN9A 3ENOA 4WPAA 1X4FA 4F4AA 1X0FA 3NGZA 3FCWA 3C65A 3MPWA 3C14B 1TL5A 2W8LA 3OBYA 2ALYB 3BUZB 4RW8A 3AA9A 3TAMA 4ATNA 4H5WA 1U24A 4B1YB 1V5VA 5LM7E 4TU9A 1WSJA 3LM9A 2DHAA 4DSIA 4AL6A 3IRXA 2ITGA 4PWDB 3SMSA 4DV3J 1HYVA 1S6OA 3AO1A 1J5EF 4CD1A 2AT1B 2XEXA 3IA0A 5HRSA 5ADXA 3KLIB 4RCHA 1ZTWA 3IUCA 5BYQA 2HNYB 2VQEF 4K8XA 4CJ4A 3KLHA 2WTFA 3CCVN 1B99A 4OX7A 1D1UA 1Y3JA 3EY1A 1RU2A 4B3SF 5DQIA 2CPJA 3QIPA 3THWB 3O8WA 3H5UA 3M2UA 4MIAA 2X3DA 3CCVS 4K4WA