2HNZA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
516
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnzA05
3VQ9A 2JLEA 2YNHA 1JLAB 3VQDA 4DL4A 1BGXT 3NDKA 2WB4A 4K4SA 1HMVA 1CXUA 4CEBA 4DQQA 4B8AB 3HHKA 1TGOA 2WONA 1QAIA 1DTQA 4KREA 3EYZA 3KLEA 1IH7A 3GIIA 3KK3A 4QWBA 2B6AA 1GOBA 1C1AA 3IS9A 5KFUA 4DL7A 4ZVGA 1NK7A 1Q9XA 4E7KA 4O3PA 3NMAA 4E7JA 3NL0A 3V9XA 2HNZB 3RB3A 1Z26A 4FM2A 1RT3B 4IQXA 3M8QB 4J9OA 1JLEB 2F96A 1XR6A 3DLGA 2V4RA 4CHYA 5KFIA 4GC7A 3O3HA 4CGIA 4DFKA 4FJ9A 1FK9A 4LY7A 4E1MA 3OS1A 3OYNA 2RPIA 3D28A 1I3AA 1JKHB 1RTIA 4KTWA 4NLTA 3KK1A 4PQUA 4DL3A 4DF8A 1RYSA 3DM2B 1WSJA 3QLHA 1LAVA 3RB4A 3CDUA 3TR8A 1QQCA 3HPOA 3VQBA 1VRTA 3AO4A 1SL0A 1YVFA 1SUQB 2BQUA 2WOMB 1S1UB 1VRUA 4Q5VA 4K8XA 3DMJB 5CYMB 1K1SA 4RW6A 2QKBA 4CEEA 5KRSA 3NGZA 3SUQA 1C1CB 4NCBA 3OYAA 3RMCA 3S3OA 2ASJA 4DTOA 3ZSWA 1C0UB 1TAUA 4HUFA 3BQ1A 3OYIA 1D0EA 4FCYA 1JLAA 3NF9A 3VA0A 1S9GB 3HP6A 3TVKA 3IN5A 4F50A 1WSEA 4NRUA 3KHGA 2RKIA 5L1LA 2JC1A 1NK4A 3N6NA 4WXOA 1S1VB 1REVA 2HHVA 2E9ZA 2YNGB 2W7OA 1HYVA 3CJ5A 1WSFA 2V9WA 4ZP8A 4AHRA 1KLMA 1LWEB 2HNZA 2I1RA 5KFAA 2C22A 3M8QA 1JLEA 4N47A 4GC6A 3QIPB 1J5OB 1D1UA 5CZ1A 4FJJA 3KJVB 3DRRA 5FDLB 3PUFA 3F73A 1XC9A 1ZBLA 4IG0B 3MEDB 3T1AA 3O3FA 3ZT4A 3DYAB 3GV8B 1N4LA 5KG4A 2JEJA 1ASUA 4OPKA 4NYNA 2P5OA 3SI8A 5KFVA 3OLBA 3V4IB 4OKKA 3MTKA 5T14A 2YKMB 2AX0A 5JS1A 4ECWA 1RT5B 4HCBA 2WOMA 3BQ0A 2UUTA 4KHQA 1IKYB 1J54A 4FLXA 4YR2A 3ITHB 3G6VA 2GBZA 3DMJA 3NF8A 4IRDA 2KZZA 2R2TA 3O4QA 1BL3A 2W42A 4IRKA 1IO2A 4N56A 4MKBA 5KFWA 3E01B 3D5MA 1UAXA 4ZVFA 5KFDA 4EBDA 1RT7B 5I3UB 5HLFB 2R2RA 2XI3A 1NJXA 4Q45A 3P1GA 2WRMA 3B6PA 2EHGA 1S9GA 2D3ZA 3V1QA 3H4DA 4AH9A 4WFXA 2HHQA 1F21A 4CEAA 4C8LA 3N6LA 3RAQA 3LPUA 3CJ4A 4Q8EA 4XIUA 3QEIA 2UUWA 1VSFA 4M3RA 1JLGB 4KHYA 1HJRA 3MR3A 4M3ZA 5J2PA 1RTJB 1R0AA 4EP5A 3HPGA 4KAZA 2VWJA 4GVMA 3Q8PB 5SWMA 4RW8B 2J6TA 2BANB 1J5OA 3B6OA 4HVJA 4QCLA 4ZTFA 4N5SA 1SH0A 4KTZA 3V6DB 3QNNA 1RT6B 4RZRA 3KJVA 4DTJA 2W9CB 3PX0A 3MECB 4NYZA 1L5UA 2XCPA 4KBIA 2PY5A 2E6LA 2XI2A 1EX4A 4IG0A 1HARA 3MEDA 1U04A 4ZVHA 3DYAA 4LQ9A 1S97A 3AVCA 3BGRA 3LWMA 4ZP6A 5J2MA 1RTDA 3BJYA 3MAQA 1N6QA 3LP3A 3V4IA 1EETB 2C2EA 4DTUA 4DEZA 3AO2A 2G8IA 2YKMA 2FBVA 1J53A 4ZPAA 4K50A 4RW7B 3K2PA 3H08A 1IKYA 5HRNA 4FZZA 1NK0A 3AVJA 4CK1A 3HVWA 4DQIA 1BQMA 3AVKA 3UIQA 1S6PB 1RT2B 1KHVA 2BE2B 4CGDA 1C0TB 4B9LA 3V81B 5F8GA 2R8HA 1HNVA 1RT7A 2R8GA 5I3UA 1WAFA 3P5JA 1UWBA 4BDZA 2OPSA 3DRSA 3RBDA 4HTUA 4CJLA 4E0DA 1XI1A 3KNAA 4J9MA 2Z1IA 4JRQA 4QWEA 5KFNA 1D9DA 4CJUA 3I5CA 4TY9A 5DGBA 4EBEA 3NE6A 4E7HA 5L9XA 2JEIA 1VSLA 2OPRB 5HRSA 1LW0A 4RW8A 1RCHA 3EPGA 2RF2B 4Q0BB 3S3NA 1RBRA 4DL6A 3KLIA 4M3UA 1QSSA 1BQNA 4B8CA 1JLCB 2IMWP 3MECA 4E1NA 5F8NA 4E19A 3OYGA 1NKEA 1BHLA 3HXMA 3CDEA 2RDIA 4FS1A 3MEEA 2E6MA 5EU7A 4OLBA 4LSNB 5KT2A 4EO6A 3HPHA 4WZQA 4TYBA 1EETA 1Z4UA 2GIRA 3GQCA 2HHTA 3PX6A 3OSNA 3C6UB 3AVAA 5KG0A 2FVPA 2DTUA 3G0ZA 4H4MA 4CJ4A 4L8RB 2HHUA 4TQRA 4NLXA 4RNMA 2UVVA 3DOLA 1S6PA 5KFRA 4EEYA 1JL2A 4DU1A 4ICLB 2AU0A 3LP1A 3V81A 3ZSXA 3K5MA 5CY4A 3SFUA 4URSA 5DMRA 4DMNA 3QEWA 3QYYA 4K4TA 1GOAA 3KHHA 3GILA 3WNEA 5DLGA 2R8IA 3TAFA 1JLQB 5KFKA 4BWJA 2XCAA 3UQSA 4MIBA 2YKNB 3H4BA 1TKZB 4Y1CA 2YNFB 1C1BA 5DG7A 1IM4A 4DU4A 4AHSA 3JSMB 4IFVB 4CCHA 3MR2A 4NZ0A 4FW1A 2JEGA 4CIGA 3VQQA 3CG7A 4KI4A 4TY8B 3LAMA 4O0IA 5J2NB 4EYIB 3RRHA 3OL6A 4M3TA 2FVCA 3L2WA 4YP3A 2XY6A 2X74A 2RF2A 4Q0BA 2FJWA 4KHMA 1KRPA 1LWCA 1VK0A 2YNHB 3PW0A 4E89A 3BSCA 2AGPA 2O4GA 3RAXA 2BRKA 1GX6A 3OL7A 1SH3A 3PR5B 4C8OA 3AA2A 1HMVB 4ED1A 1T3NA 4FJ7A 2WONB 3AVBA 3CYMA 1L3SA 4FLTA 4KHRA 3KLEB 4WFZA 3KK3B 1S0NA 2B6AB 3DI6A 5KFLA 1S1XA 3C6UA 4DF4A 4YMEA 3PZPA 5SZTA 2QE5A 4U6PA 4AHTA 4NLOA 4J9PA 1NK8A 2ILYA 3NBPB 3HK2A 2VG6A 4M41A 4ECSA 4C8MA 5KTQA 3DLGB 3TAQA 3CJ3A 5L1JA 3PW4A 2KQ2A 4ICLA 3THVA 1IKWB 1SKSA 1FK9B 3PO4A 3VQPA 4RG8A 3OVNA 2IGIA 2W8LA 3VQAA 3H5SA 1TKTB 4J2DA 3OHBA 4O5BA 3KK1B 3CVKA 5FROA 4DSEA 4RU9A 4M95A 1KFDA 3HM9A 1JLQA 2D0AA 1TQLA 1QHTA 1X9MA 3T5JA 1J9AA 1TKZA 2VWKA 2JC0A 4DFPA 4KFBA 4W5TA 1D8YA 2YNFA 4ECXA 3L2VA 3JSMA 1S10A 1FKOB 3MR6A 5FRNA 3CDWA 1T03A 2ASLA 1VRUB 1NNDA 4C8NA 3QEXA 4TY8A 1NHUA 3E51A 1JXLA 4ID5B 5J2NA 4M45A 1YVUA 4TYAA 3NH0A 2Q3SA 4WFYA 3KLGB 3ALYA 4RUAA 4ELUA 3QETA 2D7SA 1VSIA 1WSGA 3OYLA 4MFBB 4Z0UA 4B9NA 3SI6A 3CIZA 3EPIA 4M3XA 3HL8A 4CF9A 4TLRA 2PYLA 1W25A 2RKIB 3NAHA 4GMJB 2HHXA 2ILZA 1REVB 2YHAA 2OPQA 2FBXA 4ID1A 4YQWA 1ZBHA 5KFEA 5KFOA 1TK5A 2VG5B 4G3IA 3NAIA 4QAGA 4KB0A 2DPIA 3DLKB 1KLMB 1T94A 3BQ2A 3LP0A 2J6SA 3CO9A 3GIKA 1W9HA 2P5GA 3NBPA 1OS5A 2I5JA 4ECRA 1EP4B 2E9RX 1IKWA 2D0CA 4DWIA 2F8SA 4CEQA 3DRRB 4NLQA 2D5RA 4JV1A 5DQGA 1Z25A 3GV5B 3AVIA 1TKTA 3V1OA 3DOKA 1NK6A 4IFYA 3O4NA 1CZBA 4IBNA 5EWFA 4EYHB 4RW4B 4KV8A 3ZSOA 2HWHA 4BWMA 5KFBA 3U3GA 1UOCA 4RNNA 1NKCA 3G10A 3CFOA 4DTPA 4DL5A 4CK3A 3AO5A 1FKOA 4NLYA 2BQRA 2ATQA 2WCXA 4OL8A 2RDJA 1SKWA 3C6TA 4Z4IA 4ID5A 1S0OA 4F2SA 1TK8A 4B08A 2IDOA 3L3VA 4M94A 3LP2A 3KLGA 3H5UA 3QERA 4URQU 4E7IA 1DTTA 3I0SA 2BRLA 3H98A 5J2QB 4MFBA 4NLGA 3AVMA 1WSIA 4Z4GA 4O3NA 4CFAA 5KG3A 1JX4A 3SYZA 4F4WA 1T05A 2W8KA 2W9AA 3VN5A 2G8HA 3HJFA 1MU2A 4K4YA 1JIHA 3C94A 3KD5E 1SH2A 5J2PB 4KO0A 3F9KA 1R0AB 4O3OA 2VG5A 4O55A 3MEGA 3TWHA 4AHVA 2JEFA 3DLKA 2IJFA 4IKFA 1RNHA 4CIEA 3NHGA 4LD0A 4DFMA 4J9RA 3OYCA 1EP4A 1S9EA 3IG1B 4FW2A 2W7PA 2AWZA 3LPTA 3LANA 3QIDA 3MXMA 1D9FA 4CJKA 4W5QA 3AO1A 4HKQA 1L3UA 4YNQA 3G6YA 4U7CA 3WNGA 2P1JA 3BGRB 1ITGA 4RW4A 1NJYA 4FJNA 3AVLA 5J2MB 1RTDB 5KG5A 2WTFA 4CHZA 4XO0A 2G8FA 1N6QB 5T7BA 4O44B 5KGXA 3SZ2A 4NCGA 4AHCA 4B3OB 4BDYA 3DLBA 4F2RA 2QK9A 3C95A 1BQMB 4KHSA 4CFBA 1IG9A 3OL8A 3KLHA 4FXDA 3AVHA 4CGGA 4TQSA 3PX4A 2G8VA 2YV0X 2OH2A 1HNVB 2ZD1A 3OLAA 5J2QA 1S4FA 1UWBB 4I2QA 1U49A 1U47A 2OPSB 4ZTJA 3DRSB 5KFYA 4CESA 4H4OB 2Y1JA 4HYKA 3HVAA 1UA0A 4M3WA 2VA3A 2IC3A 2VG7A 2FJVA 3KK2A 3NFAA 3K58A 2HMIB 1X9SA 2ZE2B 1I6JA 4FJ8A 3OJSA 4FK4A 3H40A 5KT4A 4FLVA 2B5JA 4CJTA 4Q43A 3NH1A 1RDDA 1WNEA 1N48A 2GC8A 3PO5A 1LW0B 3DLRA 4JV2A 4I7FA 4FLZA 2IJNA 5KGWA 3IG1A 1QUVA 3H5XA 3BR9A 4EO8A 3KLIB 2QKKA 4B9MA 1BQNB 4RUCA 4UQGA 3H2LA 1VSHA 4F4XA 1O1WA 1U4BA 2BQ3A 3KD1E 4DL2A 4WYLA 2X6NA 3FFIB 1T7PA 4JS5A 3G6XA 3MEEB 3ISNC 3CFPA 4IH6A 4DLEA 4O44A 4MKAA 3D45A 1WSHA 2HVHA 1C6VA 3ZT3A 2IAJA 2CKWA 3AVFA 4B3OA 1CLQA 1SV5B 4Z4EA 4MK8A 1D5AA 4CGJA 1T8EA 1QSLA 3OJUA 5DGAA 4H4MB 3A2FA 4EZ6A 3DLHA 4IKAA 3DOLB 4DTXA 5KT6A 3S3MA 4FM1A 4KE5A 4KPYA 3TAPA 3LP1B 1XR7A 1CSJA 5F8MA 1GOCA 4I9QA 5FRMA 2OYQA 2BGGA 2EC0A 4J9SA 5DLFA 2ATLA 2RN2A 2HB5A 4CECA 5HRPA 1HPZA 3OHAA 4H4OA 5KFGA 2XHBA 1NOZA 2FBTA 4RNHA 1C1BB 1I39A 3FQLA 2GIQA 1S6QB 5KG7A 4E7LA 2OZMA 2HMIA 3I0RA 1NJWA 2ZE2A 4CGFA 3GV7B 3VQ8A 4J2EA 4GW6A 4OVLA 1ZBUA 4DLGA 1SL1A 1LWCB 1YT3A 2E4LA 3MXJA 4KHWA 3SFGA 3AVGA 4IDKB 3ZSZA 2W9BA 2BR0A 1EKEA 3EY1A 3FFIA 4KRFA 1IKXB 4R5PA 1FKPB 1JXBA 3VA3A 1KLNA 4NRTA 5EWGA 3PW5A 4Y3CA 2C28A 4F4ZA 3DI6B 1RBVA 4J9KA 1S1XB 5DG9A 2FVRA 2IBKA 1SV5A 4Q8FA 3I5BA 2VG6B 4MK9A 1TV6B 2CJQA 5KT3A 4J9QA 4OJRA 3PR4A 4ZMMA 4O4GB 4ECZA 4K8ZA 4FYDA 5F9LA 3PJXA 1TK0A 4FJKA 4YR0A 3LZIA 1NK9A 5HRRA 4EBCA 4KFBB 4ED8A 4EP4A 1U48A 3QO9B 3U3YA 4DSLA 1BISA 1S6QA 2UVUA 3KLFB 1T03B 2DPJA 4CEOA 4WE1B 1K6YA 1KHWA 4CJQA 3OYKA 2XC9A 5CYQA 4R8UB 2R7YA 4IOBA 3LZJA 4W5NA 3Q8QB 4HHTA 1S1TA 3MR5A 4CK2A 3M8RA 3BSAA 3P83D 3ZSYA 4KSEB 4DU3A 1UA1A 3UR0A 5KG2A 1KCFA 2GUIA 4QW8A 2OZSA 2XGPA 3H5YA 2HAIA 1ZTWA 4IDKA 1IKXA 4CHNA 1FKPA 1MMLA 3M9NB 1RT4B 5KFCA 5DQHA 2OPQB 5KFXA 4DFJA 2HNDB 4FJGA 1RT1A 3AA4A 2XWYA 1KVCA 1ZBIA 5DK5A 3LP0B 5C25A 1WLJA 2A1RA 1TL1B 3ZT0A 2ALZA 1TV6A 2I5JB 3KKRA 3BREA 4CE9A 5KFQA 5JS2A 4NLDA 3IRXA 4CHPA 4O4GA 4CJFA 5C5JA 4CHQA 1HQUB 1DLOB 4Y2AA 3DOKB 3KMSA 4DQRA 3RMAA 5F8HA 4PWDB 4IFYB 1GX5A 2HHSA 4CEZA 2AQ4A 3OYMA 1RA7A 1ZYQA 4KV8B 3I5AA 2VA2A 3RR8A 4K4ZA 4FVMA 3CFRA 4BDPA 3QO9A 4BE2A 1KSPA 4O3QA 4ZHRA 3SQ4A 4FJ5A 5C24A 3KLFA 2QV6A 3NF7A 3SQ1A 4WE1A 2YHBA 3QZ7A 1NJZA 3C6TB 4IH5A 4KB7A 1JLFA 3BSNA 3MXIA 4FBUA 2O4IA 3RMDA 4FJMA 4OLAA 3K5OA 4W5RA 5HROB 4R8UA 1QS4A 1A5VA 4I2PA 3BDPA 3LP2B 3QZ8A 3GIJA 3DRPA 3ZSRA 4ED6A 1DTTB 3KMQA 3OYEA 3I0SB 1HQEA 1U45A 4CJVA 1HRHA 5J1EB 2D0BA 1C2PA 3HYFA 1TP7A 1W0HA 3VQ5A 4NLUA 4WZMA 3PVXA 3SJJA 4KI6A 5KT5A 1RILA 1T05B 4ELVA 2XO7A 1MU2B 4FJHA 1RT4A 2KW4A 5HP1A 2HNDA 3QNOA 4KO0B 1Y97A 3MEGB 2KFZA 5EWEA 1VSMA 2OPPA 2HHWA 4ECQA 2XRIA 1TL1A 4IR1A 1QE1B 4JLHA 1S9EB 3AA5X 2X6SA 4O3RA 5KG1A 2Z1GA 3ZT2A 2KFNA 3M9MB 4BACA 3KTQA 3IAYA 1K1QA 3OY9A 4HCCA 2IM3A 3NKYA 1HQUA 1S9FA 1DLOA 1SKRA 4G1QB 1X1PA 4PWDA 2Z1HA 4WYWA 3S9HA 3NGIA 4Z4FA 5HBMB 3EZUA 4JUZA 1CZ9A 4CHOA 3NH2A 3T5HA 2IM2A 5KFFA 3ZSVA 4DTNA 2ASDA 3NF6A 4FZYA 1IKVA 2HVIA 4NCGB 4CJ5A 1BIUA 2FLNA 4RNFA 4F3OA 3L2UA 4IR9A 1VSKA 3FDSA 4CF8A 4NLWA 2Z1JA 4FLWA 4YFUA 3SQ2A 3GYNA 2G8UA 3DLEA 3V9SA 4CJEA 5HROA 4IRCA 3HKWA 1ASWA 4B9UA 3KLHB 3MFIA 4CJPA 4LSLA 3T5LA 4KAIA 2ETJA 3L2RA 1NOYA 4FJIA 1U09A 4M3YA 2ZD1B 4JV0A 5J1EA 4RW9B 3SUOA 4I2QB 3DDKA 3AVNA 3SPZA 4URGA 3I8DA 4KHUA 2F8EX 2C2DA 2HNYB 2AJQA 4DSKA 3VQEA 3PY8A 2R2UA 2F8TA 1WNSA 2IC3B 3M8PB 2VG7B 4MIAA 3KK2B 1XHXA 4E3SA 3FSIA 2NUBA 1L3TA 3QIOA 4LH5A 3IGVA 2B5JB 2PYJA 5JUMA 3SCXA 4QOZB 1JL1A 5KFSA 4C8KA 4I7FB 3VQSA 4B9TA 5E41A 1S1WB 1QE1A 2O5DA 3HVRA 4R0EA 4CEDA 2GV9A 4FS2A 4ECVA 3KKSA 3U6FA 3Q8SB 4J9LA 4G1QA 3Q8RB 3KHRA 3L8BA 1JLBB 3WNFA 1WN7A 4KB1A 1RT3A 2D3UA 1RTHB 5HBMA 2BDPA 5F8LA 4OKEA 3HT3A 3V6JA 4H54A 1TAQA 4ZPBA 1L3VA 3TAMB 2IM0A 2FVSA 4DSIA 2IAJB 4QWAA 1JKHA 2OA8A 4KHNA 5EUHA 3VQ6A 3ISND 3L2QA 3H59A 3DM2A 5EDWA 4W5OA 1RDAA 3OS2A 3RR7A 4QWCA 1EXQA 4LH4A 1RDBA 4K4WA 4HUEA 2X78A 5CZ2A 3TABA 4K4VA 4DG1B 1YTUA 1SUQA 4NCAA 1S1UA 5K14B 2FLLA 3PW7A 1BIZA 4RW9A 5L1KA 5CYMA 4CF0A 3QGIA 1HPZB 3ZCMA 1C1CA 1RBUA 2HNYA 3LAKA 1TKDA 4NLPA 4QW9A 1LV5A 1C0UA 4OGEA 3M8PA 4OKJA 1ZTTA 4AHUA 4PY5A 3RRGA 3V9WA 2P51A 3I0RB 5KFPA 1VSDA 4CEFA 2ZQBA 2WK4A 4CERA 4Y2CA 3OSPA 1RAJA 4M42A 2UVRA 4DTMA 3HO1A 1S1WA 4WXWA 1S1VA 3K59A 3QEVA 2V4QA 4F4YA 2DFFA 3QGGA 4YR3A 3JYTB 4IH7A 2YNGA 3ICLA 3CM5A 3RTVA 1LWEA 1JLBA 4ED2A 1N56A 4PA1A 2W9BB 2YNIB 1ZBFA 4CFCA 1RTHA 3QIPA 1HNIB 4R5PB 4CF2A 4Z4CA 3SV3A 5C42B 1C0MA 3TAMA 5FDLA 4ED7A 2UVWA 1ZETA 3CQ8A 3KIOA 1BCMA 3ASMA 3QGHA 4F8RA 2KTQA 1QSYA 4K4UA 2KZMA 4DSJA 3LDSA 3RMBA 1Q9YA 2D41A 4B9VA 5KRTA 3SUNA 4ED3A 3SQ0A 4QPXA 2ZKUA 3EZ5A 5KT7A 1RT5A 4CJWA 4DG1A 1A5WA 3RWUA 4FZXC 2XY7A 5K14A 3KOAA 1LW2B 3HP9A 2R8KA 1RBSA 3ITHA 3O3GA 3M9OB 1S5JA 4JRPA 4QWDA 4XPCA 3ZT1A 3LWLA 4F4KA 4CFDA 4N76A 4Y1DA 3E01A 1TKXB 3CJ0A 5KFTA 2DFHA 3QINA 1CXQA 4N41A 5HLFA 4ZP7A 4FJXA 2DFEA 1SL2A 3RBEA 1LWFB 1HYZA 4CGHA 3NCIA 4DSFA 4ZP9A 4J2BA 3PHEA 3TARA 1YTAA 5CYQB 2HWIA 2FJXA 3VQ7A 1TL3B 1S1TB 2WHOA 1JLGA 3OYJA 3QEPA 3SV4A 4KKOB 3G86A 3AO3A 2HW3A 3JYTA 4FLYA 4DS5A 1RTJA 3WNHA 3D0PA 4AILC 5JXSA 3MF5A 1QTMA 3ULDA 4CF1A 2FBYA 1TVRB 1QAJA 4O4RA 2YNIA 4CIFA 1N5YB 4FK0A 2BANA 4ECUA 3K5NA 1HNIA 3ZSQA 4BE1A 1NK5A 2DY4A 2AGOA 5C42A 4K4XA 3V6DA 3PV8A 1RT6A 5KI6A 2XY5A 2W9CA 1RT1B 2IS3A 2JGUA 4CJ3A 4TXSA 4ECYA 5KFMA 3OL9A 2EX3A 5C25B 4ZPCA 1XHZA 1S48A 3NGDA 3CM6A 3SNNA 4FLUA 3IRXB 1KTQA 3T3FA 4RW7A 2V0NA 4XPEA 4ZPDA 4NLSA 1LW2A 1B9DA 2XY8A 3L3UA 5DQIA 4Q44A 1VSEA 2R2SA 3T5KA 3TAEA 1S49A 4F3TA 4DTSA 4ZVEA 1RT2A 3TI0A 1BCOA 1RYRA 2BE2A 1RBTA 5KG6A 1TKXA 1C0TA 4ZHRB 4PUOB 1KFSA 2G8WA 2FVQA 5C24B 4KTQA 4Z4HA 4HUGA 3NGYA 2LSNA 1LWFA 5F9NA 1B92A 1JLFB 5D3GB 1VSJA 1HYSB 2IM1A 4MQ3A 4IG3B 1X9WA 2E9TA 3UPFA 1TL3A 4I2PB 3OYDA 3DRPB 4ECTA 4LQ3A 4EZ9A 4KKOA 1HQEB 2Y1IA 3HVTB 3OYHA 3T19A 5KFHA 3KLVA 4J2AA 4JS4A 1TVRA 1G15A 2OPRA 2B43A 4OGCA 1BI4B 4FJLA 1N5YA 2QXFA 4OPJA 5I42B 1RA6A 4MH8A 4CJRA 1NHVA 3CJ2A 5KFJA 4CJSA 3MFHA 5HP1B 1JLCA 3V9ZA 4NYFA 4DS4A 4ED0A 1ASVA 4DQPA 4Y34A 3TANA 1WAJA 2OPPB 4X2BA 3K57A 3PW2A 1B9FA 3OYBA 1DTQB 4FM0A 2IA6A 3SPYA 3AV9A 4LSNA 1Q8IA 4FBTA 3PJWA 2IOCA 5F8JA 3IS9B 3FRZA 5KFZA 2J6UA 4FK2A 3V6KA 2FLPA 1KVBA 3AA3A 2FC0A 1LAWA 2XGQA 3BSOA 3QESA 4TN2A 3TQ1A 1S0MA 1A5XA 3GIMA 3OS0A 2R8JA 3CWJA 4O0JA 2B4JA 3OYFA 3KHLA 4O3SA 1XR5A 2AX1A 3HSTB 4H8KA 5L1IA 3VQ4A 3K5LA 4B9SA 3LALA 1IKVB 4PUOA 3VQCA 1RTIB 1FXXA 3SUPA 4RNOA 4PQUB 1KVAA 4ELTA 5D3GA 2YKNA 3TAGA 1HYSA 2AGQA 3DLEB 3QLHB 4IG3A 3IGNA 2ITGA 4J9NA 3V1RA 4LSLB 2C2RA 4IFVA 4MK7A 4DQSA 3FQKA 1VRTB 4TSXA 3NAEA 1RDCA 3V9UA 1XWLA 3HVTA 4DTRA 3RB6A 4RW6B 2A1SA 5F8IA 4NLVA 4BE0A 4I9LA 1BI4A 4NLRA 3V6HA 5I42A 5DG8A 1JXEA 3UDLA 1RDRA 3M8SA 3RB0A 1NKBA 2G8KA 3N6MA 2PZSA
chains in the Genus database with same CATH superfamily
3VQ9A 3I32A 2KL8A 1FESA 2EG2A 5F0WA 1BGXT 2J76E 3DWLA 4CEBA 1MN7A 4DQQA 4B8AB 1QAIA 3H2UB 3B82A 1VQ5S 3TWZA 2DGTA 3EYZA 1IH7A 1Q82T 3KK3A 2UXCJ 1FWLA 2B6AA 1H1VA 3R8EA 2LQJA 2P9IA 4ZVGA 5HL7Q 2BXJA 2EXUA 4O3PA 1RT3B 2E1RA 4CT8A 2F96A 5CD4H 2HRYA 3DLGA 2VONA 4CHYA 4GC7A 1PC4A 4CGIA 5KOWA 2WSEC 1I3AA 1APSA 3KK1A 1DHMA 3TZXA 3W66A 4DL3A 4FSVA 1YK9A 5D0HA 1WSJA 2ZJQQ 4OYZA 3VHQA 2ZWOA 1VRTA 3CNQP 3U27A 5IWAF 1VRUA 4DUZK 5KAKA 2QKBA 2YKPA 4C6AA 3BKFA 4K43A 3NGZA 3SUQA 1C1CB 3ZETB 1WBDA 2JVOA 2VF3A 3GJQB 3CETA 3S3OA 1ROFA 3A8EA 1T95A 2LQBA 1A6LA 1KQGB 5A8WB 2AYBA 2CQCA 2W6KA 1VQMS 4OI1A 3U9DA 3D0HE 3KHGA 1HNXK 1WKLA 4DPUA 4ZJLA 1NK4A 4DPWA 2UXBJ 7FDRA 2DPNA 1NH8A 4WXOA 2MLXA 1FRJA 1UVMA 1H0HB 2CG4A 4AM6A 3DRYA 3IMQJ 5CCLA 2F7VA 1WC0A 1KLMA 4ALZA 5KFAA 5FIIA 3E8OA 1XMQK 3W64A 2MQ8A 4NI2B 2VQFK 4CZFA 1JWWA 3LO3A 4CH0S 2G4BA 3MXHP 1MN9A 3F73A 3T7ZA 4U67L 2G2OA 5ETRA 3R5GA 2GHWA 3T1AA 1HI0P 5KG4A 4OPKA 4A8XA 5F0XA 1NDKA 4ZVUB 2E5IA 3OLBA 1FFGB 3GFZA 3CMEN 4ZLJA 5T14A 4PKIA 1SC1B 2YKMB 2GFFA 1GXTA 2AX0A 5JS1A 5BPMA 4HCBA 1KQSM 4FVCA 4YHHF 4FLXA 4YR2A 2A3JA 3R97A 4X4UA 4IRDA 2KZZA 3LDPA 5B0DA 4PYAA 1S4EA 1NPPA 4IRKA 3E01B 1WC5A 3D5MA 4ZVFA 1NGAA 4EBDA 4B3RF 1RT7B 5HLFB 4LBHA 1UTAA 1RP5A 3CSKA 3WZ0A 3B6PA 5A8WA 5HK4A 5LJ3Y 4DI6A 2F5GA 2D3ZA 1IG8A 4QS7A 3UCUP 3D7SB 4K5SA 2A41A 3RAQA 3CJ4A 3BY5A 2LU2A 3QEIA 1JLGB 1RCOB 1GLJO 3KXDA 4WFAQ 1R0AA 2VASA 2QL7B 2VWJA 5HQMA 4ES3A 3W0LA 3HBTA 2CQDA 1X4EA 3MMBB 2DK2A 4ES2A 4ZVOB 4DR2F 4NI2A 1YIJN 4P2FA 3B6OA 2XZWA 4XDDA 4ZTFA 4N5SA 1SH0A 4B3SF 2IMOA 3V6DB 4H03B 3QNNA 1RT6B 1BLUA 2W9CB 3TA1A 2IYGA 4KBIA 2R7XA 2XI2A 1HARA 1G99A 4JI5K 2AA4A 3NGKA 3BGRA 3LWMA 2RQMA 5ETVA 3BJYA 1SKUB 1RSCA 1EETB 4IXCA 3AO2A 2G8IA 2YKMA 2FBVA 1J53A 4K50A 1U2RA 3K2PA 2ZZTA 1U6ZA 1VR6A 3HCXA 5MLCV 2CG8A 2HQ3A 3EDQB 4CK1A 3WIUA 4CO1A 4DQIA 1BQMA 2FJAB 3AVKA 3QT6A 4BRKA 3UIQA 1S6PB 1KHVA 1RAEB 4MO4A 2BE2B 1R31A 4B9LA 5A8KB 3V81B 5F8GA 2H5IB 2OD6A 2R8GA 1RT7A 4YDUA 1WD6A 4ATNA 1WAFA 3OBYA 3FC9A 4DV1K 3DRSA 3RBDA 4HTUA 4JYAF 4E0DA 2BTFA 3RW6A 3TOQA 3K7RA 3E1YA 4U67Q 1KDNA 4TY9A 4CO3A 4L3KA 2VQEK 1MMNA 2GJIA 2FY8A 1VSLA 1MA9B 4BRGA 5HRSA 2NS1B 2DH8A 3TUIC 5CABA 2ZH9A 4Q0BB 3AD9C 4V19S 3HHLD 3S3NA 1RBRA 1I51B 4DL6A 4MJKA 3KLIA 1LKZA 4ILMA 1BQNA 2IYIA 4HHJA 3AAPA 2Q79A 5F8NA 3S41A 4GRSA 1BHLA 3CE8A 5DM6L 2RDIA 2I2YA 1E6YB 2HURA 1FWPA 4WCEL 3MEEA 2E6MA 4OLBA 5KT2A 3HPHA 2HVDA 1EETA 2HVEA 1RDWX 1U6BA 1YWXA 1FWKA 3IM9A 1HNXF 2RD5C 2HHTA 3PX6A 1OH7A 1NXIA 1OKJA 1QTNB 1KQFB 2FVPA 2DTUA 2P9NB 1X5TA 4H4MA 2MQOA 4RNMA 2XMKA 2UVVA 1NMEB 3R3TA 3DOLA 1S6PA 4CBUA 4DU1A 2OANA 2XLJA 2R9LA 3V81A 3MCNA 3RJMB 1XMQF 5DMRA 2ZM6J 4DMNA 3QEWA 1GOAA 3GILA 1JK9B 4Y65A 1SJ3P 1IBCB 3PCOB 5EX3A 3NS6A 4C3MA 2HGLA 3F56A 3UQSA 3EVWA 4K8RA 4TU8A 4C23A 2UUBK 4QZVB 1B7FA 3TRGA 1C1BA 3FUYA 5DG7A 1IM4A 3PKMA 3MR2A 1N36J 3HZEA 1VQ6S 4FW1A 4CIGA 3CJ9A 3VQQA 3CG7A 4CVNE 2KT5A 4C1NK 3A3OB 3NS7B 4BR5A 3TW0A 2DIUA 3DJCA 3J81O 2MQLA 2FVCA 1FDBA 4Q0BA 1UWAA 2HBRB 3EVOA 2LDYA 4LF6J 3OUYA 1KTVA 2DNMA 4WQ5C 4LRCA 3UCGA 2O4GA 1M0SA 1EIYB 2XS2A 3RAXA 1GX6A 2XHCA 3HSZA 4C8OA 1GMWA 1FHTA 2A10A 2MKYA 3B78A 1T3NA 3EE3A 5E84A 3O8MA 3DHWC 3P45B 3IFRA 1UFWA 2RUSA 3OQ2A 1R8AA 3OA9A 3QICA 3BP8A 2B7CB 2P9NA 2M5YA 4NLOA 1N5TA 3G8TA 1TUYA 4AHTA 4ETXA 5KTQA 3CEDA 3TSPA 3TAQA 4DUYK 3D6FB 1B64A 2AV5A 5L1JA 2GJFA 3PW4A 4YY3K 1SKSA 3HHNB 4BRIA 4IO8A 3OVNA 3ETOA 3H46O 2W8LA 4O5BA 5A76A 4M95A 3HM9A 2KLAA 1MWKA 1TQLA 2HBQB 4JHDB 2E5GA 1X9MA 2VWKA 2JC0A 2OLWA 4W5TA 5FJ4A 3DNCA 1U0HA 5DM7L 5DM6Q 2ASLA 4WCEQ 3N01A 4LFBJ 1ZPWX 2X1AA 4NA3A 2ZH8A 4M45A 1YVUA 2CNLB 2QA1A 2Q3SA 3ALYA 5AQNA 3JQJA 2CQ4A 3KWMA 4ZKAA 2ZJRL 2BVZA 3OYLA 2BUNA 2BH1A 4B9NA 3MM8A 3SI6A 2Y9HA 3MCPA 2HS4A 4JK9A 2ZOFA 1W25A 2RKIB 2YHAA 1I94J 4LRBA 1IWAA 3CC2N 4ID1A 2AP6A 2VZ9A 1ZBHA 5KFEA 4OV1A 3SBMA 2FLOA 1HHQA 1WC3A 2YWGA 3LP0A 1W9HA 2P5GA 2QSWA 1VJWA 3J80O 8AT1B 2MPUA 4DWIA 3NY0A 4FZVA 4DR6K 4NLQA 1ZZFA 4JV1A 2OCEA 1Z25A 1JJ2R 3V1OA 2GVZA 3O4NA 3FJ2A 4NB4A 1TELA 1CZBA 2DT9A 4DZDA 5GMKa 4ZCMA 3ZSOA 4M63A 1SJQA 1U26A 1NKCA 3HF5A 2MGZA 3EDRB 4OLPA 4DTPA 3CC7N 4CK3A 3AO5A 2XNQA 4NLYA 2F8MA 2BQRA 3LPYA 4D3GA 3C6TA 3W8PA 1U1NA 3SQOP 2E5LK 1SAZA 1TK8A 2W25A 4K2JA 4P9SA 1GFWB 3H5UA 4ED4A 4RL1A 2VBYA 2NLXA 2F8HA 4J90A 3AVMA 5BN9A 5CR4A 5IV3A 2F9WA 4PYDA 1IJFB 3K5PA 2NQPA 3NNAA 4GVBB 3ZZZA 2DH7A 4XAKA 2QFJA 4DN0A 2K06A 4LF7J 1E4FT 4K4YA 1JIHA 3IM8A 1NU0A 2UUBF 2VFTA 1SH2A 4KO0A 2FIUA 1QVGR 2Z57B 2GMHA 3G9CA 3SBTA 3BM7A 4CIEA 4LD0A 1WF1A 2VHGA 4J9RA 3OYCA 4OYXA 2MLZA 3MK6A 2J4RA 3ULEB 4YOVA 2CPXA 4DV0F 5HVHA 3LPTA 3I8BA 1D9FA 2F4VJ 3AO1A 4F0MA 1M1KT 4YNQA 2BKPA 1BUPA 2EVZA 3H0PA 2P1JA 3PLAA 2RUGA 1NJYA 3NGUA 4K59A 5KG5A 3H42A 3R5DA 2ZJRQ 4ITSA 3ONQA 1FW6A 4NXNF 1Q18A 4FKYA 3O5TB 3QBXA 3D3CJ 5LOQA 3VWSA 1N34K 3DLBA 4BDYA 3BGOP 3C95A 3MM6B 2A6OA 4KHSA 3RSEA 2VD3A 4JI3K 1H72C 4ZITA 2YV0X 5IT9Y 1HNVB 1VOMA 2XSJB 3AARA 3U1MA 5BYQA 3H6EA 4I2QA 4YY3F 1XQSC 4CESA 3KJFB 2K1RB 1WELA 4B3TJ 2LQ5A 3C66A 5MAOA 1X9JA 4HYKA 3OVSA 3IO1A 4M3WA 2VA3A 2IC3A 3PJ9A 4ZVPB 2FJVA 1GLLO 3KK2A 2MKCA 3A1YG 2HMIB 2C2MB 2RRNA 5FPNA 5BXIA 4OHXA 4M5LA 3H40A 4FLVA 3Q2SC 4CJTA 4Q43A 3W9JA 2BJEA 2DBBA 5D4PA 1N48A 3PO5A 2QWOA 5AQZA 5LT5A 4CZEA 3HHLB 3CO0P 2QJ3A 3H5XA 4EO8A 3ULEA 4P6QA 1T9XA 1ZXOA 1CJUB 1P6TA 1RGVA 2OEJA 3H2LA 1YHQN 2V34A 4M5NA 2CQ1A 1JJHA 3R2DJ 3US5A 1MLAA 2BQ3A 1AUDA 3KD1E 2LEPA 4DL2A 2V7YA 1T7PA 3LQVA 3I9ZA 4YOXA 4FL9A 2KXNB 4BR4A 3BGFA 4MKAA 4JV5F 3D45A 2XEXA 1WSHA 1AROP 1C6VA 1HPMA 3ZT3A 2IAJA 2DEJA 3VAJA 1MSWD 3CMES 3R5AA 4IUFA 1F2GA 3OFGA 1BWVA 3MM6A 4M5DB 4AM7A 4EZ6A 3HOTA 4ES1A 1WHYA 4DTXA 5KT6A 3S3MA 5BPLA 4F04B 1CBKA 1VYAA 3ULHA 3AY9A 1N5QA 4GVEA 3FVYA 1MDUB 5IOLA 5AQPA 4J9SA 4NL5A 2ATLA 5LL6Z 1RTZA 5HRPA 5KFGA 2QYCA 1T9VA 1LQ9A 1BA0A 5GIPA 3FQLA 3OXGA 4DUTA 2D4WA 1M5KC 4RBTA 3A3PB 2HMIA 3LF0A 1KEKA 4DV7K 2H54B 1WHWA 2QMWA 2ZVIA 2MZTA 3CCJN 1FD2A 2M0GB 1ESVA 4FWLA 2E5LF 4I64A 4JB8B 1SL1A 3K89A 3RYLA 1CJUA 1YIJS 2BKOA 2WSFC 3LDQA 1U24A 1YX2A 4RU2A 3AVGA 4QJVA 5E3AA 4PR6A 3T1HJ 1RB0A 1K9MT 2XB2D 4R5PA 1FKPB 1JXBA 2AYMA 1KLNA 4NRTA 3QT8A 3PFOA 2VFRA 1U1RA 3UB5A 2OO4A 3NMRA 1RBVA 1S1XB 2ERRA 3L9ZA 2FVRA 1BMQB 3OPKA 2HQFA 1W97L 2D9PA 2CJXB 4M5DA 1MMDA 5KT3A 4J9QA 5BRDA 4Q2MA 4U8VA 2PSZA 3O9UA 2FC8A 4ZN3A 1HBNA 4O8KA 4GY2B 3HTVA 2MYFA 3PJXA 2B8PA 2JOQA 3GJTB 4KGXB 4DHVA 1VQ9S 3E3XA 2YKQA 3ELHA 2O1PA 4EP4A 1U48A 1W2BR 1CJTB 4UY85 1KNZA 1FXLA 2UVUA 4JKBA 3KLFB 2DPJA 3C65A 4L75A 3M30A 3G4SN 4CO5A 3GG4A 2MSTA 4CJQA 5LSOA 1P27B 4ZVQB 2MLYA 4R8UB 3QAEA 3GSDA 4IOBA 4AL5A 3Q8QB 5M1KA 2QZ8A 2R7TA 1Q8BA 3BSAA 4X65K 2KHDA 4YOYA 4KSEB 4DX8H 4DU3A 5RUBA 2PMWA 5KG2A 3CCSN 1KCFA 4QW8A 1PCAA 4BLGA 2XHWA 1GMWD 3D1OA 1DAXA 1TYQA 1YLXA 1VC5A 1FKPA 1MMLA 3C0BA 5KFCA 4DFJA 4DV2F 3UD4P 4BC5A 2J9DA 4NZ6A 1F3FA 6FDRA 3BBBA 1ZBIA 5GINA 5C25A 3ZZPA 1WLJA 1RAGB 3C2PA 3ZT0A 4UUWA 3BREA 5IT4A 2D74B 1V3RA 5JS2A 4NLDA 4CP5A 3IRXA 1XNRK 2KT3A 1HQUB 3SEOA 3RU0A 1M5SA 1TU0B 3DOKB 1C0GA 2RRBA 4OYOA 3J7AN 2IIHA 1Y4ZB 1R43A 1ZYQA 3I5AA 2VA2A 2SXLA 1CJKA 2NR0A 3AGKA 1CJTA 1VHIA 3SQ4A 3KLFA 2QV6A 3SIPB 2GMJA 2YHBA 3QZ7A 1NJZA 4IH5A 2O4IA 4FJMA 1YBUA 5HROB 1E4GT 4R8UA 1A5VA 2J8AA 1BHNA 2ZDOA 3OR2B 4I2PA 3GIJA 4QBUA 3DRPA 3ZSRA 1DTTB 3I0SB 1JQGA 3VQ5A 3PVXA 2CQ3A 3MD1A 4CZCA 1YF5L 1CQMA 1GXLA 1S76D 1N33K 1RILA 1T05B 4Z7YA 5ETQA 2Q31A 3O9TA 1MU2B 4FJHA 2O8DA 4DR5K 2DEIA 3F2KA 5J1NA 5H1SV 2C3PA 4HVZA 4FWSA 4NYPA 3MEGB 2KFZA 2P9LB 3Q8YA 4OHVA 4XDCA 2OPPA 4WFBL 1QE1B 3AA5X 2X6SA 2B9EA 4KRWA 3ZT2A 5KPRA 4BACA 3OY9A 2IM3A 2YHWA 2EC2A 3W7BA 4P2XA 1HQUA 2CDQA 2C3UA 4MO5A 1K8KA 1QAYA 1NDLA 4WYWA 2Z1HA 2E2QA 4R79A 3NGIA 3G8SA 1VQ7N 2CPEA 4CHOA 2F40A 3T5HA 5KFFA 1EARA 4YS2A 2RT3A 5AQHA 1IKVA 5FPMA 2HVIA 1U1KA 4K0KK 5LMNF 1VSKA 4NLWA 2OP5A 5CYJA 3GYNA 5ETTA 2G8UA 3DLEA 5HROA 2CVIA 4IRCA 3KLHB 5AQRA 3T5LA 3OR2A 3MD3A 3R5CA 1GLCG 1KN6A 4O0NA 1VDHA 2ZD1B 4LFAJ 2AEJA 1F0XA 2P9KA 1BUXA 3BKTA 2HNYB 2FJBB 2Q36A 2YCHA 5GAGP 3PY8A 1UVKA 2R2UA 4ZIWA 2F8TA 3M8PB 1HKCA 4K41A 1B99A 2IDLA 3CC2S 3IFEA 2B5JB 5JUMA 1JL1A 5KFSA 4RUBA 3Q23A 2JH3A 2NLWA 1S1WB 1QE1A 4HEA9 1BWFO 2H51B 3VENA 4LF9J 1KC8O 5D0EA 1JNZB 2CNNB 4ECVA 3RG6A 3KKSA 5JLFA 1K0TA 3V5RA 2H65B 4LT6A 4FYWB 5F8LA 2YWHA 4OKEA 3V6JA 3N79A 5GAHI 2VOOA 1WC4A 4QWAA 3R5BA 4MLHA 3NWGA 5IXUA 3CC7S 2AYGA 3EKUA 4XK8C 5EDWA 4DX6A 4DR7J 2ZGZA 5B7WA 1NSPA 3MAHA 1WB9A 1RDBA 1VQLS 4K4WA 3F44A 2DYAA 5BRHA 4K4VA 3HDSA 2DRDA 1S1UA 1X4DA 2KM8B 3PW7A 1LFPA 5L1KA 1HLWA 1IBKF 1XNRF 3ZCMA 4ZK7M 2HNYA 1TKDA 5AXMA 3I55N 2LXFA 4QW9A 1Y11A 1C0UA 2MZJA 3M8PA 2OELA 1W7WA 4AHUA 3R7BB 3V9WA 3I0RB 1Q4RA 3VMFB 3S7RA 5BRFA 3CQYA 3VCDA 3OSPA 2UUCK 1S1WA 5AZJA 4WXWA 1S1VA 1DY3A 2UU9F 1FCAA 3O9SA 3VZIA 2V4QA 4F4YA 2DFFA 3KDNA 4IH7A 5BN8A 3AY0A 5HAOA 1SQFA 3W2VA 1PG5B 1HNWK 2MMYA 4PA1A 2KVQE 2XMWA 2HEKA 4GV6A 1GMUA 1ZBFA 2OKQA 1XMBA 4DKWA 4G6VB 3QIPA 2CUYA 2JL9A 1K44A 3MAAB 1OH8A 4Z4CA 3SV3A 5TKWA 5DS7A 2GW8A 1FNXH 4JKAA 3MPYA 4QR2A 4C9DA 1KOHA 3KIOA 1GLBG 2RHQB 1FXRA 1QSYA 3ZYYX 4X4QA 5KRTA 2KU7A 2A3ZA 5LXYA 3SDEB 3CI5A 2IRUA 5JMVA 1FERA 4HI1A 3VESA 2XY7A 2R8KA 2CJBA 4ZN1A 3D0IE 3ITHA 4IEIA 3M9OB 2MQNA 2CFXA 4JRPA 2KXHA 2AEFA 2AF6A 4QWDA 3LWLA 4V1Ak 2W4CA 1BG3A 2K3KA 1TKXB 3CJ0A 1HI8A 1CXQA 4PG4A 3L0QA 1RXOB 5AQJA 4ZP7A 1Q7YO 2XYGB 2RVJA 2DFEA 4DSFA 4ZP9A 3PHEA 4U8YA 1Y00A 4KGVB 4DCPB 4WP8A 4X4TA 3J7A1 4QPTA 3VQ7A 2XMTA 1TL3B 1E3MA 2C2OB 1FJEB 3OYJA 3J7Z5 1YJ9N 4DS5A 1RTJA 4X66J 4FXVA 1PYTA 3MF5A 4CF1A 5AXNA 1QAJA 3JXOA 3CMAN 2LXIA 3WXMB 4BRLA 2DXEA 1WC6A 1E6VB 1N5YB 2AJ1A 1YHQS 4F67A 3C46A 4ECUA 3MAAA 2DY4A 3B6BA 3JSYA 4Y6IA 4CJ3A 4ECYA 5KFMA 4BRHA 4AL7A 1XHZA 2NRZA 2G0IA 3NGDA 1K8AT 3CM6A 4ENOA 3SDEA 3C14B 4TLQA 1IR2A 1YJTA 1KTQA 3T3FA 4RW7A 3AXMA 4XPEA 2MHEA 2VDIA 2UXDK 1X5PA 4NLSA 2BJ3A 5HATA 5LJVA 4IZ9A 2R2SA 4YDUC 3DKDA 1N32J 3QAUA 3THPA 3TI0A 1TKXA 4ZLPA 5BYSA 4USUA 5C24B 1R6VA 3PYEA 1BWEA 2LSNA 1WWHA 1ZS6A 3ETMA 1Q7YT 5D3GB 4UUXA 1DKGD 3H3NO 2IM1A 1UVIA 4MQ3A 4IG3B 3DFEA 4FWRA 3MN6A 1TL5A 1TL3A 4CI6A 2FZGB 4NEYA 4C4WA 2PEBA 4DU7A 1VI7A 4EZ9A 2DNLA 2KHCA 3CCJS 1BDGA 4YB6A 2RU9A 3TA0A 1EWQA 2GEMA 1QVGM 2B43A 2G1HA 2LLZA 1N5YA 2QXFA 5CQGA 3J81j 5I42B 1Y0HA 5JVGL 4FOIA 3CJ2A 4B02A 1TUVA 3AAQA 3CCQN 4DUZJ 4DS4A 4ED0A 3MDFA 1ASVA 4JI0K 3A8IA 1OQ6A 4CZHA 4Y34A 1OY9A 4B1XB 1K73O 2X3GA 1AT1B 3DC2A 1DTQB 3D54A 3SPYA 3CPWR 1Q8IA 4I67A 4BC3A 3EL2A 2I6WA 3PJWA 3C14A 3PIPL 3FRZA 1BA1A 2ZFHA 2UUCF 2XYPB 3OXFA 3X1LB 5M2RA 2FC0A 1YDLA 4DPOA 2XGQA 3BSOA 1VQ4N 4IJNA 2QIFA 3QESA 4TN2A 1S0MA 4OIXA 2CGKA 4OX8A 2B4JA 4OI6A 1HNWF 3KHLA 2DHHA 4H8KA 3IAS9 5L1IA 4KGKA 4F0HA 4B9SA 2DXFA 4OJ3A 1BY9A 3MUTP 4NXMF 3SUPA 4U95A 4PQUB 3G2XA 2V8DA 4ELTA 5D3GA 1DZ5A 3RZAA 2AGQA 4MTPA 3QLHB 4IG3A 2Y1LB 4AXJA 3G4SS 2BZ2A 5GADU 2VQFJ 2RILA 2M8DB 3FQKA 4H4KA 2PE8A 2FJEB 4RW6B 5DO2A 1NGEA 5F8IA 4NLVA 4BE0A 1DFDA 1JCFA 1OO0B 4NLRA 3CCSS 1HL6A 4B3MK 5I42A 4UY8O 1HHTP 3BZKA 1NM1A 5K20B 4ZLLA 3R3LA 1JLAB 1R0CB 3OTOF 1DQAA 2DRBA 2QEXN 4DL4A 4CO2A 2XG8A 3OTCA 4K4SA 1HMVA 2WONA 4J91A 1DTQA 4N8OA 2FHKA 1K73T 3KLEA 3GIIA 1X5OA 4WTOB 1IBLK 2MHNA 2EK6A 1GOBA 2LYVA 4DL7A 5KFUA 1Q9XA 2UUAJ 2D1KA 3MN9A 3EEQA 2CQHA 3NL0A 1Z26A 1HLUA 4FM2A 3HFVA 2DGVA 2VBZA 4ILGB 1M5VC 4DFKA 2DO0A 4FJ9A 1FK9A 4LY7A 4E1MA 5LM7E 1JKHB 2ZDPA 5A8RB 4KTWA 3NCPA 1QY7A 4OYWA 3ISZA 4PQUA 2BACA 4B17A 3G71S 1T6CA 4DF8A 1H7XA 5AQLA 3M2RA 3QLHA 4M5HA 3TR8A 2O8FB 4CI0B 1WEZA 1NGHA 2V68A 3AO4A 1YVFA 2CWKA 1SUQB 4K25A 4P10A 2ZITA 2QO3A 4JI5J 4RW6A 5IT9O 5M2PA 4NCBA 3PIPQ 3OYAA 3FZLA 3QT7A 3PHTA 2ASJA 2HZVA 4DTOA 2J7UA 1PBUA 2ZJPQ 3RAMA 1TAUA 1SQKA 4UY8T 4FCYA 3D9BA 2HFUA 1JLAA 2W4PA 1S9GB 4F4AA 4L6V3 4A8QA 2M4MA 3NVMA 4YEAA 1WSEA 1WC1A 1WEXA 5L1LA 2JC1A 3R27A 5CA5A 2NPIA 1REVA 2GELA 4DQ8A 3LOUA 4QU7A 4AFFA 2KRBA 5AJ3J 3O6WA 4DV1J 1U8WA 2W7OA 4ZP8A 4AHRA 3M1VA 2X51A 5C10A 2K3IA 3AOCA 4HTIA 2XMUA 4N47A 5JLHA 3KZBA 4G1PA 4A61A 1VQ7S 3W5YA 3KJVB 3DRRA 1XBWA 3VOVA 3IBFB 4M63C 1XC9A 3MI7X 2VQEJ 2XBPA 3GWCA 2FSNA 2ZEJA 3O3FA 2E1ZA 3R6GB 3GV8B 2JEJA 1ASUA 5EOYA 1DT9A 2OJ3A 3FZKA 3CJAA 3SI8A 5KFVA 1RKJA 4OKKA 4FF3A 2JLGA 1KS2A 3MTKA 5H9FJ 3MX5A 4CLUA 3F41A 4BC7A 1RT5B 4ECWA 5HJYA 1YRUA 3BQ0A 2P9SB 3JB9k 3R5JB 4JK7A 1TL4A 2OFGX 3UN5A 1BOTO 3TJ8A 3O4QA 1BL3A 2GHPA 3HZ6A 2W42A 3ZZOA 3NVKA 3ET6A 1TUUA 5IQ6A 1CLFA 5KFDA 2L41A 3MR7A 1FTCA 1VBYA 1M90O 4Q45A 8RUCA 4LF5K 3FKBA 2D0PA 2P9CA 2EHGA 1S9GA 1HUXA 4PG6A 1WOOA 4EFHA 3V1QA 2HHQA 4CEAA 3Q8VA 4Q8EA 3MMAB 4KHYA 1RWUA 1XN9A 4U7UD 1HJRA 2C3OA 4YOWA 3G8QA 4H0YB 3VERA 1SQGA 3UDEA 4EP5A 2I0XA 1P90A 4NLBA 5SWMA 5BR9A 2R7RA 3IRWP 2BANB 5EXWA 3OTBA 3BEGB 1PAUB 3W63A 3KJVA 5DDPC 4O23A 1L5UA 5AT1B 1J5EF 3D2EB 2NRWA 3FK4A 5DETA 1ZM9A 2YPYA 2LEAA 5C2DA 4ZP6A 4E98A 1RTDA 2DTJA 2IIRA 3MAQA 1DQ8A 3GBTA 1ICEB 3VV2B 2GS8A 2DNGA 5AQSA 3UKRB 5KQ8A 1QZ5A 3BPSP 2R7OA 2MJNA 4FZZA 1XEZA 4W4MA 4XTTA 3NWRA 3PIOQ 1YJWN 4LC9B 2H3GX 4IDHA 1RT2B 2YHXA 2EW9A 2D0OA 4P2SA 4LRFA 4P75A 5LXRA 4OV6A 3MZIA 4L76A 4JI2K 4RX6A 3I55S 2JWNA 1T11A 1NB7A 1M90T 1W26A 1XI1A 2A40A 3KNAA 1KP6A 4J9MA 4DUYJ 1EX8A 2W1BA 5CCMA 3MUVP 3MMAA 1Y3KA 1RADB 1D9DA 1X31C 1ATNA 4CJUA 2DNRA 5DGBA 4EBEA 3NE6A 2AJ0A 5GAEP 1URNA 3IXQA 4YB1P 4ZJOA 2OPRB 1G1XA 1LW0A 4J7CA 2DGWA 3EPGA 2BJ9A 3BGUA 2JFDA 3CCUN 4I6MB 4LMZA 4DMZA 4EWTA 4B1ZA 2MTLA 4JI6K 3C16B 1QSSA 3GTYX 2PMZD 4NWBA 3KUGA 2O8CB 3D2EA 3HXMA 4DPYA 2PMHA 4C8YA 1WBBA 4WZQA 5K5MA 1Z4UA 3CJQA 1SJ4P 4YOUA 1HW9A 3BN4A 4RCHA 1OH6A 1X0FA 3UKRA 3A12A 2WBMA 5K8OA 5BR8F 4A8YA 1YITN 2ASPA 4CLYA 4CO0A 1VQNN 4PL7A 4EEYA 1JL2A 3IWLA 3DXKB 5HO4A 3PTWA 2AU0A 1VCTA 4K4TA 3R9LA 2P9UA 5DLGA 2HBJA 1FJGK 1JLQB 5KFKA 2PFFB 2B9YA 2YKNB 3DU5A 1RCXB 4NO7A 4Y1CA 2V2KA 2YNFB 2ASYA 5GAHU 4DR6J 4NZ0A 2HSTA 1BU6O 3CQXA 4KI4A 4DX5A 3UN3A 2Y1RI 5J2NB 1EWRA 2QWPA 4JI8K 3RRHA 5LMUK 2PA8D 3WXJA 4YP3A 2XY6A 2X74A 3DXMA 3MPDA 2HG4A 3CMAS 2I7NA 2JDJA 3Q83A 2BE9B 1XK8A 4UF4A 1VK0A 2YNHB 3C16A 4USHA 4CM0A 2C1EB 3OL7A 1SCJB 3TR5A 4ED1A 3O1WA 2W6LA 4DR1K 4FJ7A 4QU6A 3PEJA 3AVBA 2QTWA 2R3VA 1L3SA 3J7ZO 2V52B 2Y3YA 3W62A 3J8AA 3VETA 3S6EA 1NGBA 1EQYA 1ATRA 4QIVA 4DF4A 1UCNA 3PZPA 1NU4A 4DV3K 4BRAA 2ITMA 1S79A 2ZNZA 4M41A 4ECSA 1UVNA 1PILA 1IBMK 1XMOF 3DXKA 5I9EB 3VQPA 4RG8A 2IGIA 3EO3A 2EFGA 1FI4A 3VEOA 1VLOA 4LFCJ 1U2FA 1TKTB 3H5SA 2E20A 2BX6A 4JEPA 3GJRB 3JQMA 4RU9A 1JLQA 1HKGA 1QHTA 4DV4F 1NBWA 1HBUA 1J9AA 2N3OA 2VGNA 4OYAA 4KFBA 2YNFA 1PKUA 1EKRA 1PYSB 2QXLA 1NAQA 3PSIA 2L9NA 4HI2A 1LWXA 3QSIA 1T03A 4C8NA 3E51A 4HTLA 5FPDA 5J2NA 4F9OA 1YBAA 3NH0A 3EN9A 3LL3A 4ELUA 2FYXA 4BC4A 4OLOA 2D7SA 2EI5A 1WSGA 4A47A 1N34J 3CIZA 3HI0A 2WC9A 3CCQS 2PYLA 2V8HA 4JI3J 2HHXA 2XMMA 1RBOB 4F26A 1VQPN 1IM6A 4IO9Q 4B1YB 1U1MA 5KFOA 2VG5B 2CPFA 4KB0A 3BQ2A 3G82B 3CO9A 3MPUB 2G2YA 5H9EK 2J0QD 3W61A 1EP4B 4YOEA 1JXVA 1GQEA 1VQ4S 2E9RX 2D0CA 2F8SA 3OD2A 1PSDA 2D5RA 3N5BA 3AVIA 1TKTA 3AJDA 2P9GA 2IHR1 3N4QA 4IBNA 2V2QA 2O8BB 4JI6F 4RW4B 5D78A 4BWMA 4A4JA 2FHJA 2QFIA 4QYZK 2WVEA 4DL5A 1P9YA 8ATCB 1FJ7A 3DCAA 5ETSA 2WCXA 1YTYA 1SKWA 3CJ8A 4Z4IA 1KXPA 2VPWB 1S0OA 3QFWA 4BRFA 4B08A 5E0OA 2IDOA 5AQUA 4GKKJ 2NRRA 3L3VA 3LP2A 3QERA 4I69A 3IR7B 2BRLA 3H98A 4OO1J 1TL7A 3P4UB 4P7VA 2PFUA 3ZEUB 1VK3A 2GNKA 2YX6A 1KD1O 3Q7CA 5KG3A 4F4WA 4KR0B 2JWKA 1Z6RA 2QEXS 4UT4A 4X64K 4AF1A 1LK5A 2DD8S 3M6VA 5J2PB 5D4OA 2VG5A 3OFFA 4O55A 5D0RA 4FDFA 2XWXA 2QC3A 3JTNA 4QIGA 4E8UA 3NHGA 1YJRA 4C98A 3CF5Q 4LF8K 1EP4A 3IG1B 3LM9A 3CD7A 2AWZA 2E2OA 2L48A 1EQ0A 3BF4A 1V4SA 1L3UA 1RABB 3A4TA 4U7CA 4DV7J 1SC4B 4V19X 3CB4A 1YJUA 4RW4A 3AVLA 5J2MB 3UE5A 1IQTA 1RWMB 3DOMB 1N6QB 2MSSA 2DNZA 4PWWA 4MIWA 1O0PA 4CLLA 3SZ2A 5KGXA 4NCGA 3M3ZA 2E5HA 3ZX2A 5D6GA 3THWB 2A0FB 1N0VC 2J7WA 3TEGA 3M5RA 2CJ9A 2A5XA 2MKKA 2R7VA 1AZSA 2IPOB 5C2CA 2XS5A 3AVHA 4CGGA 4TQSA 2W2MP 2X1BA 2YX1A 1O5JA 3OLAA 1S4FA 2BBEA 3ZX3A 1UWBB 1U47A 2OPSB 2CPIA 2PD1A 2R42A 5CH7B 2XULA 3GJSB 2B4VA 2O8EB 2M52A 2VG7A 1VHXA 1KR4A 2OAUA 2N7YA 3K58A 3NFAA 3D6TB 4X4RA 1X9SA 2AMCB 4DN9A 3CCRN 1GTEA 5KT4A 4K5RA 2Y0SD 2P8IA 4CTAA 1RDDA 1WNEA 3DLRA 4JV2A 4I7FA 3LTOA 1HJOA 3VGSA 3FGVA 3IG1A 3TX0A 3ZTOA 3CPWM 2QKKA 4B9MA 4UQGA 3NXZA 1VSHA 2HBKA 3W5ZA 1DGKN 4LR8A 4TNOA 2MDAA 1MWQA 2QG9B 3FFIB 2DRAA 3CFPA 3OHRA 3DOMA 4DLEA 2OUGA 4BG8A 2HK2A 5IM0B 2VICA 4X65J 2LU1A 3JTPA 4JI1K 3TYTA 1CLQA 4OJGA 1T02A 4CGJA 3NCQA 2ZBQA 3TUZC 1O8BA 1LCUA 3D2WA 3THTA 1HBMA 3DLHA 4IKAA 4FM1A 1KOOA 4KE5A 4KPYA 2NCKL 3LP1B 4I9QA 4NA2A 5FRMA 2HZAA 2Q66A 5E33A 4Y28C 2EK1A 1H3DA 2HHHF 2RN2A 4RPFA 1HPZA 3OHAA 1NOZA 2C42A 2FBTA 1JMTA 1ATSA 1T3VA 2O8EA 2BJ8A 3P38A 2VBXA 1V5VA 3WXKA 2N4DA 4J2EA 2FQQB 4UOGA 4GW6A 2QLBB 2ZHBA 4LVNP 4UQTA 4DLGA 3DN9A 3QMLA 4B1VA 3IA0A 1LWCB 3F0NA 3GG1A 2E4LA 1NNEA 4BGAA 4IDKB 2BR0A 1EKEA 4IOCQ 2V50A 3FFIA 4KRFA 1IKXB 1YRTA 1D4XA 2AEMA 1WORA 3PW5A 4Y3CA 5IM0A 3LH2S 4CZLA 3DI6B 4J9KA 3HOSA 2Q2RA 1U2VB 2IBKA 2HMPA 2VB6A 2FF6A 4ETZA 4Q8FA 1U1PA 5C0YA 2BUPA 2VG6B 2HYIB 1TV6B 4DR4F 1N33J 2CJQA 2BMBA 4OJRA 1CC8A 4C11A 5IV4A 3PR4A 4LUBA 1UW4A 1F5AA 4HACA 1YJWS 4LF1A 4DR5J 3FZFA 1TTHB 2F3JA 4ECZA 1D3WA 5F9LA 3IAM9 1TK0A 2NXCA 3MN5A 4C48A 4A8WA 2AJ4A 4F3MA 4USVA 3U3YA 3CCEN 1BISA 4WP9A 3CXCR 5B08A 2AHOB 3BR8A 4JKGB 3ZC4A 5E3PA 1KHWA 1V6HA 4KJIA 5AZIB 4OYBA 3RW7A 2XMVA 3TSQA 1Q16B 5CYQA 1NO8A 2HK3A 5IZHA 3B8AX 2VFUA 4HHTA 3MWPA 1S1TA 3MMJA 4A48A 1UEKA 3QJJA 2RB7A 3MR5A 4CK2A 2R7SA 2BKNA 4I4BA 3E2EA 4L3NA 4K0KJ 2Z0GA 5J1PA 3CCUS 4RLEA 5C2GA 2ZWHA 2GUIA 2OZSA 2XGPA 3H5YA 4D3HA 3QSYB 3P31A 2UXCF 4IDKA 2M8HA 3HSCA 4PABA 3H8YA 1IKXA 3UVJA 4C8ZA 2HBYB 1WHXA 5DQHA 2OPQB 1ZA2B 5KFXA 1YAGA 4YB7A 3RRKA 2ZUGA 3T6JA 2G0JA 4M1KA 3NNCA 3TA2A 5DK5A 3M05A 1TV6A 2I5JB 3KKRA 4YHHK 5K8MA 1YITS 3BYRA 2QMUB 1VQNS 2CADA 4CJFA 5C5JA 1H2TZ 4Y2AA 1ZAXA 4PWDB 1W2IA 2QM1A 4IFYB 2V8GA 4H5VA 2BW2A 2HHSA 4CEZA 4KV8B 5AR0A 4K4ZA 4BDPA 1R59O 5I3PA 4BE2A 4O3QA 1NRKA 4JKGA 3U02A 3GMGA 1JLFA 3BF1A 3GYXB 4OLAA 4HWIA 3BKUA 3K5OA 1P8ZA 4W5RA 1F60B 1UZHA 4HT5A 3QZ8A 2VODA 1YJNN 4ED6A 3VGKA 1BO5O 1HQEA 3WQUA 3VF4A 1N54B 4DR2K 2UXBF 2L08A 3L6QA 3HYFA 3VGLA 4NLUA 4B3SK 2RJZA 4ELVA 5A6WA 2DKOB 4FO0A 1WTBA 3QNOA 3T1YJ 2F1FA 3H7HB 3Q0AA 1FO1A 1VSMA 4BQLA 1XTZA 2WW4A 7AT1B 3M6GA 1SJFA 3ZZTA 1FDAA 2H3EB 1S9EB 1HA1A 2Z1GA 4HCCA 2IVNA 1K1QA 3IAYA 3CW2C 1N36K 3MOJB 3DHXA 4TKTA 1X1PA 4PWDA 2MZRA 3BZCA 2RE2A 2OGUA 3ZZUA 3ZSVA 3DGPA 1OVYA 4JYAK 3NF6A 4FZYA 3ZXWA 3K2YA 3P3DA 3POTB 4BRMA 2PO4A 4RNFA 3FDSA 4CF8A 1Y3JA 4DV5J 3SQ2A 2NUUG 2PDAA 2GQQA 1X8DA 3V9SA 4H4KC 5IC6B 3HKWA 4B9UA 1ASWA 4K2XA 3Q7BA 2GO8A 3MFIA 4LSLA 5K8NA 4KAIA 3UD5A 2ETJA 4JV0A 3FBCA 3SUOA 3AVNA 5LSRA 3HD1A 4URGA 2UP1A 3I8DA 5JMNA 2AJQA 2DCUB 5DDOC 5A6PA 3M6WA 1WNSA 3MM7B 2R4FA 3SXLA 2NUBA 1L3TA 3QIOA 4JKFA 3IGVA 1NM2A 2PYJA 3U1LA 3VALA 3Q86A 4QOZB 1WG5A 2KYZA 2XMAA 3FNNA 1NMNA 4PG8A 3WX8A 2E88A 5HQLA 4GMKA 4USMA 4CEDA 3O9QA 5CD4A 2A2DA 4FS2A 3Q8SB 3KHRA 3D2FB 3L8BA 3WNFA 1WN7A 1IR1A 1RT3A 2K7KA 1U8SA 2BDPA 4KHPJ 3CULA 3UKUB 1CQNA 4H54A 2EKNA 2P5VA 3MPVA 1VQOS 2IM0A 2FVSA 3VF2A 4DSIA 4OZJA 3POTA 5EUHA 3VQ6A 4LF4J 3R1XA 5IFMA 5G4DA 4W5OA 3ENVA 4QWCA 4DR3J 1EXQA 2YWFA 4DV6J 1I94K 4P74A 4DG1B 3QNWB 1RHQB 3CCTA 4WF9L 4BR9A 3IR6B 1C1CA 3ZETA 4L72B 2XO6A 1Q7LB 2YJFA 2DY1A 1LV5A 4OGEA 3ZNJ1 2EG1A 4OKJA 4PY5A 1EHWA 2UXDJ 3Q8UA 1X4AA 3JQKA 4CEFA 3EGVA 4CERA 1BC6A 3AODA 5C15A 2W41A 4M42A 1XNQJ 3K59A 4PZVA 4NLCA 3CM5A 1XERA 3FMBA 1VQSA 1NLVA 1WJ9A 2W9BB 2YNIB 1UZDA 3SSSA 4CFCA 4GNIA 3UKUA 3CDAA 2JZ5A 1HR0J 3I56N 1PYOB 1WSRA 2MZ1A 5HQ8A 2WBNA 1F1BB 1FNMA 4MKVA 4ED7A 3BO4A 5AQWA 3CQ8A 1FNOA 1BCMA 3ASMA 2XYHB 3VTHA 4K4UA 4DSJA 1Q9YA 2ZM6F 2D41A 4QIEA 3NRBA 1MWZA 4LF7K 3SQ0A 4CD1A 1ZC6A 2ABYA 2O67A 4AE5A 4ERDA 4DG1A 3O5BA 1V3SA 4JI0J 4FYYB 3HP9A 3GCWP 3O3GA 2F9DA 1S5JA 3IMXA 1L3KA 2WBRA 1T3OA 2DNHA 1N36F 3SCLE 4F4KA 4N76A 4Y1DA 4JI4J 3HRGA 2LEBA 9ATCB 4MYUA 4PCQA 3E01A 2PT0A 3C7NB 5DZ7A 3QINA 2DFHA 5HLFA 2M70A 2F4VK 4BGBA 3I33A 3RBEA 1HYZA 4CGHA 4LF6F 3TUPA 3CCRS 2AD9A 1M5PC 1JLGA 4KKOB 3G86A 3AO3A 1ULRA 1VQ8N 2G2ZA 3WNHA 4P52A 3D0PA 4AILC 5JXSA 1RHKB 2YH1A 1TVRB 2ZH3A 2GHVC 2ZUAA 2B7BB 1WOQA 3GLJA 3MMBA 2YNIA 4CIFA 4FN5A 2BJ7A 3LGNA 1F9HA 2V6AA 3ZSQA 4BE1A 3V6DA 1AA1B 1RT6A 2NZCA 4OMFG 2W9CA 4WF9Q 1UKUA 1RT1B 2EBGA 4CQ1A 2IS3A 2E7WA 4UZBA 4DCOB 3OV7A 3WC2A 2K7JA 4ZPCA 2H4WB 3BH7B 1JCGA 2A2CA 1S48A 3SAHA 4DCJB 4B3MJ 3SNNA 4DPTA 2ACYA 1QQOA 1NDPA 1VISA 3MGJA 4OFZA 2WAQD 2V0NA 3J7YI 2LQ9A 1R27B 4OX9J 3KJNB 3VTIA 2Q6BA 1SI9A 1RWWB 4DTSA 2BE2A 5KG6A 3C7NA 1YUWA 2DNKA 4LFBF 5A8KA 1KQSR 3HMJG 1IBLJ 1VMBA 4ZHRB 1Y5NB 4UZCA 3NGYA 2BEFA 1VFJA 1VSJA 1HYSB 2B9WA 3UPFA 3G6EN 3B54A 4ECTA 4LQ3A 2XLKA 4KKOA 1M5HA 3C19A 3OYHA 3T9ZA 3T19A 2RQ4A 5KFHA 2Q6CA 2ZHOA 2QWLA 2ZC4A 4J2AA 1I94F 1TVRA 1G15A 3DLLL 4DV0K 4FJLA 3H90A 4OPJA 4ZS6A 3S1TA 1RA6A 3MM9B 3PYGA 2QX0A 3MFHA 4LIRA 5HP1B 3KHYA 5M1NA 3V9ZA 3VQTA 4G9ZA 5LJWA 1WAJA 1JCEA 1VQ5N 1AYEA 4NXNK 3K57A 1E6YA 3GSIA 3EWGA 4WWSA 2IA6A 3AV9A 2QA4G 1OQ3A 2HWTA 1IV0A 5F8JA 3IS9B 4QS9A 5KFZA 2J6UA 1U6FA 1Y7PA 3AA3A 2M9KA 4C3LA 5C7PA 1SQEA 2GQCA 5GVQA 1T44A 1A5XA 3GIMA 3OS0A 2R8JA 1RAFB 1BE4A 3CWJA 1NJIO 3AD7C 3FMWA 1S0VA 3HSGA 2AX1A 2YY3A 4BR2A 1FD8A 3W2WB 2I38A 5DRKA 1RTIB 1FXXA 4RR5A 3CCES 2NZ4A 1HYSA 1NH7A 4A8SA 2ITGA 3V1RA 2RIJA 3WBZA 2C2RA 4MK7A 2QLJB 1VS3A 3NAEA 4WU2A 3V9UA 9RUBA 1R8CA 2HS0A 1FX2A 2GA7A 1SBRA 4BS2A 4LF7F 4FWKA 1HI1A 4UW2A 4DTRA 2A1SA 2NRXA 4R0JA 3TUJC 4ZIVA 3TTCA 3W60A 2Z8QA 2E7XA 3V6HA 1JXEA 1RDRA 3ENHA 2JLEA 1IJEB 3VQDA 4E1JA 1NDCA 4JV5K 2BOPA 3NDKA 4LRAA 2G0CA 1CXUA 2F4VF 3I96A 3T9NA 3MTJA 1B70B 2IVOA 3OVAA 1C1AA 3IS9A 3GFYA 3TU5A 4LF5J 3BO2A 4E7KA 1X4HA 3O4WA 3NMAA 3RBXA 4E7JA 4Y2KA 4OPAA 4J37A 5HANA 4DOZA 3M8QB 5D77A 1SC6A 1XR6A 1HNZJ 2D69A 2V4RA 2V63A 1OY6A 3O3HA 1M1KO 1X0PA 3OYNA 3D28A 1NJIT 2DNQA 3D6HB 3DLLQ 1RTIA 1HIYA 3P5BP 2X3DA 1RYSA 3DM2B 4JHDA 4U7UK 1FDDA 3N28A 2B0GA 3GIRA 1NGIA 1FX4A 1VAZA 1QQCA 3HPOA 4EK2A 4AQYJ 3QRPA 3R7SB 2BQUA 1A9NB 1NBEB 2WOMB 4OHZA 4B3TF 4Q5VA 4C0HA 1T9UA 3ID6A 2FGCA 1YJNS 3DMJB 5CYMB 1K1SA 2DR8A 4FF1A 4WBFA 3AQPA 3KG0A 1NGJA 5KRSA 4FNIA 2D3O1 3RMCA 3ZSWA 5BJRA 4OI4A 3BQ1A 3NF9A 3VA0A 2QL5B 4J9UE 3IN5A 1H98A 1RFQA 4I6WA 1FE4A 2RKIA 5F1XA 3N6NA 4CRJA 5AQMA 4USIA 3CJTA 4JI2J 2E2PA 2YNGB 1OPIA 1IVZA 2GJ2A 3CJ5A 1WSFA 2V9WA 2YKOA 3DGVA 1CJVB 1LWEB 1T9YA 2MKJA 2LVWA 2C22A 3M8QA 5DM7Q 1RWPB 1J5OB 2V8PA 1D1UA 5CZ1A 4A8MP 3ZLJA 4EHUA 1H2UX 1WUUA 4FJJA 5FDLB 3BO3A 3CJRA 2EFVA 4IG0B 1AFIA 3MEDB 2B3TB 1QAXA 5HJXA 2V69A 4GKJJ 4NYNA 3JSBA 1Z1ZA 5T7LB 4F36A 4JI7J 2WW8A 4KH5A 4QOTA 2WOMA 3BBCA 2UUTA 4KHQA 1J54A 2YJEA 1NGCA 3CXCM 2NUHA 3G6VA 2EWSA 3DMJA 2R2TA 2F9TA 1ILYA 1IO2A 2KT2A 4LR9A 1URRA 1UAXA 4BQZA 2QRRA 4OI2A 2KHOA 1PO6A 5I3UB 2R2RA 2CA9A 1G6BA 4WP3A 1S5ZA 1Q78A 4GVBA 3H4DA 4AH9A 1ITPA 2Q1NA 4DV2K 3LPUA 5LSLA 4KYZA 1GLAG 2CH5A 3T1HF 3MR3A 4X4PA 4M3ZA 4FNHA 3ILLA 1Q1KA 2YX4A 4PXDA 2ATCB 5CZXA 3LDLA 1FJGJ 3L7OA 1ZM2A 5AQYA 3CDBA 2HIYA 2ASOA 3OR1B 2JJ4D 1J5OA 3FCVA 1X4FA 2FB0A 3ZZYA 4DTJA 3MECB 1FEEA 2PY5A 1K9MO 4IG0A 3O08A 3MEDA 1U04A 4ZVHA 2LA4A 4LQ9A 2DO4A 3GFHA 1S97A 4JI8J 5LMUJ 2YQ1A 2OMOA 4A57A 1DJ0A 1LOUA 1CEZA 2BJ1A 1U1LA 3LM2A 2C2EA 4DEZA 3CD6N 1RHJB 3SK3A 3CTRA 3H08A 5HRNA 1R8HA 2PFDA 4UOCA 1IJJA 1HKAA 4USWA 4DR1J 3BUZB 1X3MA 2V2ZA 2CH6A 4CGDA 1C0TB 2JFKA 4J8FA 1HNVA 1Q79A 2VU5A 5I3UA 2XSJA 4EHTA 4ANDA 4DV3J 4CJLA 2K1RA 2P6SA 2KKZA 2Z1IA 1P1TA 4JRQA 3T41A 2EPIA 4K42A 1IBMJ 5SUHA 3GE1A 2QLXA 5KFNA 2CNKB 4RUHA 5M1FA 4CYUB 4A2BA 4E7HA 5L9XA 3A8JA 5ETKA 2JEIA 4KC5A 1RCHA 2ZH7A 2RF2B 2B51A 3HHLA 3H20A 1RUSA 4M3UA 1N8RT 4B8CA 1JLCB 2IMWP 3MECA 3I56S 1WDDA 2IVYA 4JN4A 2KDOA 4WPAA 5EX0A 1D8ZA 4C0BA 3JS6A 1QQNA 1UFKA 2MB0B 5LMNK 5EU7A 2PI4A 3O80A 1V5IB 4LSNB 1S3XA 4EO6A 5A2QU 3QPIA 2R7QA 2GIRA 2V4JB 3GQCA 5ETLA 3OSNA 2G1DA 2WB1D 1WG4A 2A42A 3ZNUA 4CJ4A 3MPWA 5HN0A 5KFRA 3U9ZA 3TP2A 1LXNA 3ZSXA 3K5MA 5CY4A 3SFUA 3QYYA 1QQMA 3WNEA 2R8IA 1JB0C 1CVJA 1HWKA 4RBVA 4BWJA 3GG0A 2XCAA 4MIBA 5HL7L 1TKZB 5ETNA 5ETPA 4ZCIA 1Q8LA 1GAOA 3MN7A 2DH9A 3JSMB 4IFVB 2DR9A 2QWQA 4EMDA 5B0BA 2JEGA 1YGYA 3GOIA 1FF2A 3UR3C 3CJCA 4TY8B 3LAMA 3VAFA 3TQEA 1Q95G 4CBXA 4EYIB 2E66A 4NOHA 4M3TA 3L2WA 2KYXA 1FJCA 2RF2A 2RNEA 2EFNA 3NGSA 1H73A 4WQ4A 2ZJQL 2FJWA 4KHMA 3UD3P 4E89A 3BSCA 1S77D 2BRKA 1SH3A 4FP9A 4WU3A 3AA2A 3EICA 3G96A 2GWJA 1RKIA 2GX8A 4X4SA 4KHRA 4WFZA 3KK3B 2B6AB 3C3LA 2VJUA 2P9IB 4B9QA 4LREA 1S1XA 4FWNA 3DDIA 3EGNA 1FXDA 4YMEA 2ROEA 5HMYA 2QWMA 2QE5A 4J9PA 1NK8A 3HK2A 4C8MA 3DLGB 3WT0A 3GR1A 3CJ3A 4X64J 2KQ2A 1IBKK 3THVA 2GO9A 5L38A 3PO4A 3DXBA 5L8RC 1HHSA 3VQAA 3EE9A 3KK1B 3CVKA 2BM0A 1B7YB 3GFXA 3EMTA 2Z2ZA 3T5JA 1TKZA 4DFPA 2GAGC 1D8YA 4LFAF 4LF8J 5D15A 3OVBA 3L2VA 2CQIA 2ZC3A 3JSMA 4C2MA 4MKYA 1FKOB 5FRNA 3CDWA 3G6ES 1VRUB 2WZ1A 2P2CB 4TY8A 1NHUA 1RE1B 1QZ6A 5KPZA 4CH7A 2UU9K 1S59A 5GMDA 1UJ4A 2E8AA 4BROA 4TYAA 4WFYA 2MKSA 4NA1A 4XH1A 3TO8A 2E1MC 4OQJA 1VSIA 4MFBB 1R6YA 2YX7A 4RJVA 4HL9A 5ELZA 4LF9F 2WVFA 2HPUA 3HL8A 4Z2XA 4CF9A 5F41A 4TLRA 4OYIA 3H1QA 2RSQA 1LOTB 1N32K 2NXJA 2ILZA 2IJRA 1HWIA 2B4OA 2DGOA 1B0TA 2W2NP 1NLKL 3LW5C 3L4IA 4G3IA 4NEZA 5HMZA 4V19J 1NGGA 1MWYA 3DLKB 1KLMB 1T94A 2J6SA 3GIKA 4AD6A 4ECRA 2VGMA 1TR0A 3FZHA 2Q0RA 4DR7F 4DX7A 5DQGA 3GV5B 3DOKA 1NK6A 3EXCX 1SJRA 1PC5A 4WFAL 5EWFA 4EYHB 2HWHA 5KFBA 1M1HA 5K8PA 1IWGA 4RNNA 3CFOA 1FKOA 4OL8A 4JNEA 3NLCA 2CJKA 5D0GA 4CWBA 4F2SA 1FFWB 4M94A 2ZF5O 4URQU 2ZZNA 4E7IA 1DTTA 4DJBA 3I0SA 2IVFB 3J7YU 4H0VB 4JI1J 4MFBA 1WSIA 4Z4GA 4XH4A 3JTOA 1JX4A 1T05A 3UN2A 5E2QA 5AE1A 1MU2A 3MMVA 4OYPA 3C94A 1KBRA 4X62J 3F9KA 2MXYA 1R0AB 1ZBSA 2XSFA 4ZVRB 3MEGA 4KH1B 2P9LA 3DLKA 2ZH4A 4TU7A 4PG7A 5ETMA 4IKFA 1RNHA 2H1YA 3R6LB 4CO4A 1IQZA 1RLCL 1U0SA 4ILJA 2W7PA 2F63A 2VKZG 3LDNA 4ISEA 2E1YA 4CLTA 3QIDA 3MXMA 1NMDA 4CJKA 4HKQA 3VF0B 3G6YA 3SQGB 4M7YA 3WNGA 5AQGA 3BGRB 4FJNA 1Y5IB 4HDHA 3AAWB 4CHZA 4XO0A 3SMZA 2G8FA 1OJ4A 5T7BA 1ELOA 3GB0A 1N52B 3UWTA 2JLFA 5I3QA 3EJMA 4AHCA 3W8GA 4Y0FA 3UW1A 4F2RA 4HH1A 3THYB 1BQMB 4CFBA 3OL8A 3KLHA 4RWWA 3SBGA 3PX4A 4BRCA 3CJKB 2P6TA 2DHGA 3K9JA 1P8GA 1EB0A 2ZD1A 2ZH6A 4H0OA 2CQBA 3AOAA 3J7AP 2UUAK 4WFBQ 1U49A 3WDOA 5M1QA 3DRSB 4C1NI 1TMMA 4A46A 3TEHB 1RWVB 5IWAJ 2W40A 3HD2A 3P8BB 4X66F 1M5OC 1UL3A 3HVAA 2YKAA 4Y00A 2LKZA 3RBZA 5F0UA 3WXLA 2JHEA 1QVFR 3IC1A 4KT0C 2ZE2B 4PHTX 1I6JA 3OJSA 1KONA 3AFGA 2B5JA 2DISA 5GADP 2GC8A 1SVDA 5B0GA 3E66A 4FLZA 2IJNA 5KGWA 1QUVA 3BR9A 4F3QA 3KLIB 1CZAN 4F7VA 1BQNB 4OZ5A 3PRDA 3D4JA 2DITA 4F4XA 3SQGA 1U4BA 3LGHA 4WYLA 2KFYA 3VZHA 4JS5A 4RWXA 3G6XA 3MEEB 3ISNC 5FLXU 3H1VX 4NXMK 4EAHD 1RHRB 2LCWA 2HVHA 2GZOA 2CAJA 2J0XA 1N32F 3IR5B 3AVFA 3P96A 3RVCA 3DXSX 4CT9A 4MK8A 4Z4EA 3HJVA 1D5AA 1ZPVA 1K8AO 1X3NA 4H4MB 1RWXB 2DB1A 4M5JA 3EE8A 2RS8A 3THYA 3ADAC 4CM2A 3DOLB 2IDEA 2HLUA 3I4HX 1T0TV 3CJKA 3FFKB 2Z2LA 5F8MA 1GOCA 2RAQA 2ROPA 1FT8A 1ZBTA 5AJ3K 1VQ9N 4LBPA 2EC0A 1GTHA 2HB5A 4CECA 2WTUA 2A6AA 3CCVN 3KUHA 3I4PA 3NMUA 4DL0C 1SJ1A 2QGFB 2GUPA 1C1BB 3OTOK 4YHHJ 4ISGA 3TTFA 1I39A 3GP9A 1TZ0A 3VAIA 3FBFA 2GGPB 4ANEA 2GIQA 1NB2A 1S6QB 3D6MB 4KGMA 1NZ8A 2OZMA 2E5JA 3I0RA 1YSJA 2ZE2A 4CGFA 4PG5A 4B3RJ 3FCWA 3GV7B 1FDNA 1QHAA 3A5NC 1XIQA 4DUZF 3NG8A 4K7QA 2DJWA 5H9FK 3OUYB 3AA9A 1YZ7A 4KHWA 3SFGA 2CXEA 3DU6A 2VCPA 2IRXA 3QRQA 2DHSA 3EY1A 1F2HA 3HLUA 1HQ2A 3BDEA 4M5GA 4YN3B 1S7IA 2DCLA 4Z7CA 2C28A 1C0FA 2HQCA 2VWBA 3QJPA 3NOCA 4DR2J 2XMJA 1J27A 3CD6S 1JJ2M 4B3SJ 3L95X 4Y2IA 3I5BA 2PBDA 1F5CA 1FRIA 5L46A 4WIQA 1BD6A 4CZMA 5AE2A 3I31A 1WI6A 4ZMMA 3CC4N 2MQQA 2A1BA 2VQFF 4K8ZA 4I68A 4FJKA 5HRRA 3SLCA 1HWLA 1HWJA 3IBWA 4ED8A 3R6MA 1MROB 2HFSA 4N8NA 1U0HB 2GGPA 1S6QA 1GXUA 4WE1B 4OZNA 1R7IA 3R1LA 2DNPA 1K6YA 1UPPA 1S72N 3ZTSA 1FA0A 4FOEA 5LL6d 4G1IA 2GWKA 3DRXA 2VDHA 4P72A 4JYAJ 4C3KA 4ZOSA 3M8RA 3ZSYA 3W65A 3RGIA