2HNZA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 140
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnzA05
4OPJA 3I8DA 1BCMA 1JLBA 5CZ1A 1GX6A 3MECA 3NE6A 1C0TB 4DL3A 4YMEA 2PZSA 4OPKA 2WCXA 3DLEA 3P83D 5F9LA 3H08A 4RU9A 4N5SA 3MEDB 3SPYA 4KHYA 2HHQA 5DGBA 1D1UA 1HPZB 1SL2A 4DFKA 1RT2B 1KSPA 3SZ2A 4EYHB 5KFPA 1O1WA 2W42A 3O3GA 3B6PA 1KFSA 1WAFA 3AA4A 2DFEA 4C8KA 4NLOA 2BQUA 1C1AA 3NF8A 3PJWA 4QCLA 1SKRA 4HTUA 4ZPCA 3PX6A 2XGPA 3QETA 1L3SA 3TAFA 1S9FA 4LH5A 1T05A 3FFIA 3KLGA 3VQAA 4KHQA 1TP7A 2D0AA 5KTQA 4DTNA 4B08A 1C1CA 4CIGA 3RB6A 3VQDA 1IM4A 4WZQA 1T05B 4KSEB 2BQRA 4RNOA 4B9MA 3ITHB 4Q8EA 1U47A 1D0EA 1TAQA 4CJPA 2IM2A 2RPIA 4DTPA 4ED6A 3CFPA 4ECVA 4YR3A 1RTDA 1RNHA 2Y1IA 4F3OA 2DPIA 2W9BB 1SV5A 4DG1A 3VQ9A 4FS1A 5HROA 4DQSA 4B9SA 2W9AA 2F8TA 4ECSA 1ZTWA 1RTDB 4HVJA 4IH6A 4EEYA 3UR0A 2EHGA 3V1QA 1I39A 3EPGA 3OL6A 5HROB 3CG7A 3HYFA 4TN2A 2VG6B 3NDKA 2G8UA 1RBTA 3CJ0A 5KFCA 4IKFA 4O4GB 2ASJA 1HNVB 3V6JA 1Q9YA 5KT4A 3K59A 3N6LA 1NJZA 1RBSA 2G8WA 3DOKB 4FLVA 4DTSA 3TARA 3AVMA 4ZHRA 2IOCA 3NFAA 3O4QA 3L2WA 3SQ0A 4NLSA 3BR9A 1RDCA 4R8UB 1SL1A 3DLHA 4FK4A 4FLYA 1T03B 4K8ZA 2XCAA 5KFKA 2D0CA 1WSGA 1TKXB 1VSEA 5CYMB 3K57A 2IS3A 3A2FA 4KI6A 4CF8A 2IDOA 2IC3B 1I3AA 5C42B 1BIUA 1KHVA 3OYNA 3IGNA 4QOZB 1LW0B 3TI0A 5KFZA 1XHXA 3QGHA 3QZ8A 4B9LA 3OYHA 2HNYB 3TANA 2J6SA 1X9SA 3OYIA 1SH3A 1CLQA 4NYFA 1ASVA 1IKVB 4KHUA 3H98A 3TAPA 2ATLA 4CFAA 3CDWA 2OZMA 2KTQA 3I5AA 3LP3A 2R8IA 4CEFA 4E7KA 5KG2A 4MQ3A 3MR2A 1EKEA 4O3QA 3DRRA 2OPPA 3KIOA 4MFBB 3K5MA 4BWMA 2AGOA 2IMWP 2OPPB 3G6XA 4GC6A 1VSFA 5KRTA 3OHAA 1ZBIA 1FK9B 3SPZA 4NLQA 1C6VA 3E01A 4ID1A 3HVTA 2DPJA 1RT3B 1S6PB 3ALYA 5KFEA 1NK7A 4ECUA 3KMSA 1FK9A 4QWEA 4J9LA 4F4ZA 4E7LA 1S6PA 1MMLA 4RW6B 4R5PB 4YP3A 3SYZA 2QK9A 3RMBA 2XI3A 3EPIA 3ZT3A 5HLFB 3LALA 4RW4B 3M8RA 2OPSB 3NBPB 4ZP7A 4XPEA 3WNEA 3HVRA 4CJQA 3NH2A 1QAIA 2AX1A 5C25A 2UUTA 4ECXA 1N56A 3NH0A 5F8LA 3HP9A 5SWMA 5KG4A 5KFJA 1NK8A 2V0NA 2B43A 2D41A 3V6DB 3HO1A 4DSIA 4CFBA 3U3YA 4LSNB 1RT4B 1S1TA 3LZJA 1N5YA 1JLFA 4ZPBA 3JSMA 1JLCA 4KRFA 3GV7B 3SFUA 3SQ2A 4CHQA 4IDKB 4NRTA 2RF2A 1LWEB 1IKWA 1JLFB 3OY9A 3BJYA 4DQRA 4KO0B 2YNHA 2WK4A 2FVPA 4RZRA 1LWEA 3QEPA 4FYDA 1RDAA 4OVLA 4CHNA 3RAXA 1CZ9A 2HHUA 4KO0A 1JKHA 2XHBA 4F4XA 4CJKA 1KLNA 4ECYA 4F8RA 2R2UA 2KFNA 1KLMA 3RRHA 4CEAA 4B9VA 3GIJA 3MAQA 1NKBA 2IGIA 4YR0A 2UVWA 3AO3A 3V9SA 3S9HA 1BQMA 3L2QA 3DYAB 4TLRA 4FW1A 1XI1A 2WONB 3RWUA 4Q43A 3ZT0A 2W7OA 2XGQA 4FZXC 4RW9B 1BQMB 3OYKA 4O0IA 2R8GA 5J2NB 3QEXA 1S9EA 3OL9A 3T3FA 1HQEA 3AV9A 5J2QB 3M9MB 2RKIB 5KG6A 4NLRA 5D3GB 4I2PA 4E1MA 3OYEA 4YNQA 4MH8A 4J2EA 4RW7A 4NLPA 1HMVA 5JS1A 3DLGA 5DG7A 4KAZA 2PYJA 4FLUA 2IAJA 4NCGB 3KLGB 3KKRA 4NCAA 4AHVA 3C6UA 4M94A 3FSIA 3QGIA 5DG9A 3CFOA 3ZSWA 5KFYA 3G0ZA 1T8EA 4NCGA 1SH0A 5FDLB 5KRSA 3AVAA 4M42A 2O4IA 1KRPA 4J9RA 4RUCA 4DLEA 4LD0A 3PY8A 1RT5A 1TK8A 4DQPA 5FDLA 3G6VA 3NGIA 5KFQA 3D45A 1J5OA 1SKSA 4RUAA 3TAGA 3H5XA 4M3WA 3PVXA 3DRPB 3KK1B 5KT5A 4MK9A 4IRKA 4B9TA 4KB7A 3H4BA 3DRPA 1C2PA 1BI4B 3DRSB 1RILA 5DLFA 4ZP9A 4CHOA 1RTHA 3D5MA 4WFXA 3DRSA 3SI8A 1JLBB 2XI2A 2RDJA 4M3ZA 1QTMA 3G86A 4URSA 3KD1E 4N76A 1NK4A 5I42A 1TAUA 2C2EA 4CGGA 4JS4A 1RDBA 2CKWA 5FROA 3SUOA 1HPZA 4F4YA 1S1WA 3L3UA 3NAHA 1RT2A 1Y97A 3M8QA 4ELUA 4Q44A 2HHVA 3VQ7A 4CJUA 5CYMA 1QE1A 4OGCA 3NMAA 3V9XA 3HKWA 2BDPA 4HUEA 2I1RA 1RT1A 3AVNA 1DTTB 3DM2B 5KFNA 3ZSYA 1TGOA 3OYMA 4MKAA 1QSLA 1VSDA 3DDKA 4KBIA 1CZBA 3OYGA 3QEIA 3G10A 3PO5A 1VSMA 3TAQA 5KFRA 2GBZA 1LAVA 4CEBA 3BQ2A 4GC7A 4WXOA 4XPCA 5DQGA 4YQWA 4DQQA 3HPHA 4X2BA 1HNIB 2YV0X 3DRRB 1CXQA 2JGUA 4DSLA 2WOMB 4IFVB 1SV5B 1B92A 3RR7A 2OPRA 3GIIA 1KFDA 3VQPA 3TAMB 1RDRA 2VA3A 1VK0A 3KK2B 4CF1A 4L8RB 4MIBA 4TQRA 1HNIA 1K1SA 2ZE2B 1L3TA 5C24A 3V6KA 3V9ZA 4EZ6A 2FLPA 3E01B 4LH4A 4FM0A 3PO4A 2ZQBA 1S1VA 2VWJA 3OS0A 5L1LA 4DTRA 1KHWA 4O4GA 2B6AB 1RTIA 4Y1DA 1RT7B 1S1VB 2HAIA 5T14A 2RDIA 3RBDA 5KFSA 2BR0A 1BHLA 1WAJA 3MEGA 4FJ8A 1VRUA 2QV6A 4O4RA 4OJRA 2OPSA 3NBPA 4LSLB 3AVFA 1YT3A 3O3HA 4CJ5A 2EC0A 4XO0A 1VRTB 1T03A 4HHTA 4J9KA 3L8BA 3TQ1A 1TKXA 2XY5A 1S0NA 1WSJA 4RG8A 1KVAA 3NAIA 4DSJA 2IC3A 1IKYA 1S10A 3V6DA 4KHNA 1CSJA 3SUPA 3SNNA 1N5YB 1IKYB 3QLHB 1TL1A 2FVQA 4K50A 4KTQA 1NHUA 2C2RA 4ECTA 3OYBA 3QNNA 4C8NA 4G1QB 3V81B 1VSKA 1FKPB 5F8MA 3QLHA 2IM3A 2OZSA 2AWZA 1NKEA 2E9ZA 3T19A 3IRXB 2B5JA 1F21A 1FKPA 1ZBLA 4ELVA 3IS9A 1T3NA 2G8KA 1W9HA 5CYQB 3OLAA 2YHBA 3BREA 5E41A 3V9UA 4ZTJA 2BANB 1N6QB 4AH9A 2DY4A 4KHWA 2HB5A 2W9CB 2I5JA 3BSOA 3MR3A 2RN2A 2WTFA 3KLFB 2HMIA 3KLHA 4Q5VA 4CK3A 1LW2A 4Q0BA 3L2VA 3PW5A 2WONA 3OL8A 3K5NA 4MKBA 4TY8A 3KHGA 4CJTA 1EX4A 3LAKA 3OYAA 4QPXA 4Q0BB 5EU7A 1Z26A 4CJLA 1GOCA 2HVIA 4ZP6A 1HQEB 1UA1A 4URQU 1XR6A 4FS2A 5KFIA 4I2PB 2FBXA 3Q8QB 4K4XA 1G15A 1HMVB 4FCYA 2AU0A 4J2BA 4TQSA 3LP2A 3ZSQA 4BDZA 4ICLB 2VA2A 1S9GB 4CJWA 1N48A 4NLGA 3HSTB 3SUQA 5EWEA 1NKCA 4CHZA 3KNAA 2UUWA 3MTKA 3OSPA 1S9GA 4Z4EA 4NLDA 3UQSA 4BWJA 3FRZA 3AO1A 3H59A 4H4OA 4FLXA 3PUFA 1TV6A 2FJXA 2OH2A 1GOAA 1R0AA 3RB0A 5DMRA 2HNZA 4H4OB 2HHXA 1TQLA 2QXFA 4QW9A 2BRKA 4FBUA 1J5OB 1S6QA 3KK1A 1U09A 5J1EB 3IGVA 3LWLA 4IG0B 2JEIA 1S1UB 4CFCA 1JL1A 3NF6A 4W5QA 1WNSA 3LAMA 4CGHA 4O0JA 4F3TA 5J1EA 1XR7A 4NLXA 5HP1B 5KFOA 3VQCA 1LWFB 1KLMB 4DS5A 2O5DA 1S1UA 3AVKA 4DU4A 4JS5A 1RA7A 4ED8A 3PX0A 3RAQA 1J9AA 1GX5A 1LWFA 2NUBA 1B9FA 4TYAA 1X1PA 4N41A 4ZP8A 4O3SA 4J9OA 1LV5A 1B9DA 3SV3A 5I42B 4RW9A 5HRRA 3MEEA 5HRSA 4YR2A 1NOZA 3QERA 1U45A 2R8JA 1RT6A 4FJ7A 3WNFA 1C0UA 3MECB 4FJ5A 3HXMA 4M3UA 4WFZA 5J2QA 2RKIA 1MU2B 3AVHA 5D3GA 1NJXA 1SUQA 1RT6B 5KFGA 5J2MA 3AVJA 2FBYA 4ZPAA 3VQBA 4EYIB 3V1RA 1L5UA 4F4WA 5EWGA 3GV5B 1SUQB 4CEZA 4WXWA 5KGWA 3BGRB 1NJWA 2Q3SA 3K2PA 1FXXA 4CEEA 3KOAA 4FK0A 1ZTTA 3IG1B 3VQ8A 4QWAA 4HCBA 4BACA 4DFMA 3BGRA 1EETA 4KV8A 3FQLA 3K5LA 4Y1CA 3K5OA 4K4UA 3V6HA 4E89A 4YFUA 5L1IA 2YNGA 4FJJA 4BDPA 3HHKA 4DL6A 1HARA 1EETB 3CM6A 4I7FB 5JUMA 4HKQA 5HBMB 5KFBA 3OLBA 4IFVA 3CQ8A 3RR8A 3QGGA 1ZBFA 3TAMA 3EYZA 1UAXA 4FJXA 4I7FA 3TVKA 1TKZA 3PHEA 3LP1A 4E7JA 5HBMA 3KKSA 4J2DA 1FKOB 1WSEA 4DTOA 4GW6A 3HT3A 1JLGB 1BI4A 3LP1B 2ATQA 3OS2A 4ZTFA 1CXUA 2YNIB 3I5CA 4EO6A 1QQCA 1RBRA 1RTIB 3Q8PB 3GILA 3CVKA 1RT7A 1KCFA 1TL3A 4BE1A 1D9FA 5KFDA 3TAEA 2YKMB 4DS4A 1VRUB 4DTJA 4I9LA 2YNFA 5KT2A 1HYVA 3KJVB 4OL8A 3CWJA 4CK1A 3OYCA 4O3PA 1J53A 3HJFA 2YKNA 3M8QB 3DOLA 4DSKA 3I0RA 1S48A 2YNFB 3SI6A 4NZ0A 5KI6A 4EBCA 3IAYA 1QE1B 4AHSA 4R8UA 4FZYA 4QWBA 4J9QA 4C8LA 3PW2A 3BSCA 1RT1B 3VQSA 3VQ6A 1DTTA 3CO9A 3O4NA 5KFHA 3BDPA 1NK6A 1YVFA 3GV8B 5F8IA 3LPTA 2UVVA 2CJQA 3KLIB 4KTWA 4RNFA 2X74A 3CJ4A 4G1QA 3V81A 3VA3A 1XWLA 4CERA 4B3OB 5SZTA 4B8AB 1IKVA 1TK0A 3M8PA 3CIZA 1TVRB 2XO7A 4CJVA 3KK3A 4KPYA 3NGDA 4AHTA 4B3OA 4DWIA 4CFDA 3EY1A 3AA3A 2KFZA 4Y2AA 2FLNA 5DK5A 1GOBA 4O44B 4UQGA 5KG0A 3KD5E 3D28A 5C24B 4FK2A 4TSXA 1SKWA 2GC8A 2JLEA 3M8SA 4ZPDA 2I5JB 2Y1JA 1BQNB 2KW4A 3I0SB 4CF9A 4N56A 3UDLA 5KG5A 1U49A 4U6PA 4JRPA 3SUNA 2DTUA 4TY8B 3KHRA 2HHSA 5JS2A 4XIUA 5DLGA 2P1JA 3I0SA 4O3NA 3I5BA 5L1KA 1NJYA 2XRIA 3NL0A 4PQUA 3QINA 4M95A 3LP0B 3HVWA 4DFJA 3JYTB 3MXMA 2ZKUA 1T7PA 3MF5A 3DI6A 4R5PA 3PX4A 1TKTB 5HRNA 4EO8A 1JIHA 1VRTA 1JL2A 5HLFA 4NLVA 4FJNA 3KLEA 4ECRA 2E6LA 4E19A 4E3SA 2HWHA 4IKAA 2F8SA 4ICLA 2D3ZA 1S49A 5KFFA 3SCXA 1TKDA 4DEZA 5C25B 1W0HA 5HRPA 3NKYA 2BQ3A 3OSNA 4J9SA 3KLVA 3FQKA 3QNOA 3V4IA 1KVBA 1C0TA 4E7HA 4FJLA 3ZT2A 3NCIA 1TL1B 3PR5B 1X9MA 4W5RA 1RA6A 2W7PA 4RW8A 4CCHA 2ALZA 3L3VA 4Z4HA 4EP5A 1BGXT 1C0MA 4ZVHA 4URGA 2HNZB 5F8NA 1TK5A 4IRDA 4ZVFA 5J2PB 2R2RA 5KFAA 3MFIA 1U48A 1YTUA 1HQUB 4CGDA 4DF4A 1UOCA 3DLKB 4JV1A 2R2SA 3SJJA 2AGPA 3FFIB 3H5UA 1N6QA 2A1SA 2QKBA 4RNMA 1C1CB 3SV4A 4KI4A 3DLKA 2V4QA 3KLHB 2FJWA 3QYYA 1IG9A 4ID5B 1SL0A 2J6UA 1YVUA 4MK8A 1HJRA 3BQ0A 3VQ4A 4J9MA 3ZSXA 3DYAA 4W5NA 5FRMA 2W9BA 4CJRA 2D7SA 4CF2A 3HPOA 1VSLA 5L1JA 1W25A 4DLGA 4ED3A 2IJFA 1RBUA 2G8FA 2V4RA 3B6OA 4QWDA 4QAGA 5J2NA 4NRUA 2VG5A 2W8KA 2VG6A 2KQ2A 4HUFA 2X6NA 3ASMA 5K14B 4DTMA 4Z0UA 2VG5B 1VSHA 3DLGB 1HNVA 3EZ5A 3AO4A 4N47A 2XC9A 3RMDA 1Z25A 4FZZA 4CIEA 4ECQA 3QO9B 4HUGA 3DOKA 2XY7A 2R7YA 3C95A 3PW0A 4DMNA 3OVNA 4Z4IA 2OPQB 3BQ1A 3OJSA 3QO9A 1NNDA 3MXIA 4EP4A 2O4GA 4G3IA 4QW8A 3H4DA 4LQ3A 3PV8A 3H2LA 3KTQA 1K1QA 4IFYB 2XY6A 1S6QB 4M3YA 1RT5B 2X6SA 4IG3A 1S4FA 3RMAA 1D8YA 1LW0A 4JRQA 4FXDA 2HW3A 4IFYA 2FLLA 2HNYA 2YHAA 3TABA 2XWYA 1S5JA 4WYWA 4WFYA 5EDWA 4K8XA 1JX4A 3G6YA 4CEOA 4JLHA 4DSEA 2AGQA 3CJ2A 3SFGA 5KT7A 3AA2A 2ZD1B 3OJUA 2EX3A 2A1RA 4NLYA 3U6FA 2ILZA 5EWFA 4KB1A 3DMJA 4FJMA 4O3RA 1C0UB 2YKNB 3GQCA 2ZD1A 4FJKA 5CZ2A 1MU2A 3HVAA 4WZMA 2IM0A 3ULDA 2P51A 4CJFA 2FBTA 3DMJB 2HHWA 1LAWA 5KT3A 5J2MB 3GIKA 2R2TA 1BIZA 3RB4A 4RNNA 2FVRA 4K4TA 1OS5A 1ZBUA 2FVCA 2ASLA 1QUVA 2D3UA 1RTJB 3PJXA 3UPFA 1XHZA 4CK2A 2BGGA 4I2QA 3CJ3A 3DM2A 2Z1JA 1ZETA 2VG7A 5KG7A 3F9KA 1EP4B 4Z4GA 1QHTA 2HNDA 4LY7A 5KG3A 4CEQA 3SQ1A 2G8HA 3RRGA 4CEDA 3VA0A 1NOYA 3M8PB 1TVRA 5I3UB 1EP4A 4EBDA 3NH1A 4PA1A 2AQ4A 3ZSOA 1XC9A 1RYRA 2LSNA 3V9WA 1RCHA 3PW7A 1DLOB 5I3UA 1TKZB 2FVSA 1RBVA 5DQIA 3SQ4A 3ZT4A 4WE1B 1UA0A 2WOMA 1FKOA 4DTUA 2OPRB 4C8MA 5F9NA 3CM5A 1JLGA 3KK2A 4BDYA 4LSNA 3CJ5A 1WSHA 1S1TB 2JEJA 3NHGA 4TXSA 2D0BA 4DU3A 4FW2A 2YNIA 4WYLA 4PWDB 4R0EA 4J2AA 3H5SA 4GVMA 4DL5A 1D9DA 2RF2B 5DGAA 3HL8A 2QKKA 2JEFA 3T1AA 1C1BB 4KFBA 2KZMA 4CHPA 4M41A 2Z1IA 4FJGA 4O3OA 3JYTA 2IA6A 2JC1A 1NK9A 4KFBB 4FJIA 4AHCA 1JLEA 2BRLA 2FC0A 1L3UA 3OHBA 3AA5X 4KREA 1L3VA 1WLJA 3QEWA 4LSLA 3HP6A 2WHOA 4BE2A 3T5KA 2AX0A 4CGFA 3DLBA 3GYNA 4OLBA 1ZYQA 4B9NA 1IKXB 2HHTA 3AVBA 3V4IB 4IH5A 3LZIA 3VQ5A 5DQHA 3OYLA 4NYNA 4W5TA 4B8CA 3QZ7A 3OS1A 4IR1A 1A5WA 1KTQA 1WSFA 1J54A 4CGIA 2PYLA 3N6MA 4KAIA 3MEDA 4H8KA 4RW7B 3KHLA 4OGEA 5KFVA 4DL4A 1SH2A 1HQUA 4DQIA 4JV0A 3L2RA 3IRXA 4M3XA 1Z4UA 3D0PA 3IS9B 5F8JA 1REVA 2XCPA 4CGJA 4KE5A 5CYQA 4HCCA 2FBVA 4KTZA 3LPUA 3GIMA 3C6TA 4IQXA 3ZSZA 3CDEA 5KT6A 1VSJA 5JXSA 1REVB 3LWMA 4ID5A 3ISND 2HVHA 2W9CA 3EZUA 3MR5A 1WSIA 3NF7A 4J9PA 3ITHA 1IO2A 4KKOB 5KFLA 4PQUB 2R8KA 3LP0A 3ZT1A 4CJSA 4H4MB 3MFHA 1TKTA 2F8EX 4DG1B 4JV2A 4PUOB 1NK0A 4Y2CA 1KVCA 4E7IA 3KLEB 3S3OA 5L9XA 4H4MA 3L2UA 1DTQA 1RTHB 4ZVGA 1N4LA 4PUOA 2DFHA 4M3RA 2GIQA 1HYSA 1JLQB 3RMCA 4CJ4A 2P5OA 1DTQB 4OKEA 3LP2B 2E6MA 4F2RA 3LANA 2ITGA 4F2SA 4DL7A 1JXEA 4ECZA 3P1GA 4DTXA 3T5LA 2FJVA 2AJQA 1JLQA 4CF0A 3CDUA 4RW8B 2ASDA 3PW4A 1S1WB 3KHHA 3QIOA 1JXBA 5J2PA 3CYMA 2OYQA 4GMJB 3FDSA 1R0AB 4DSFA 4O5BA 4B9UA 3LDSA 3HM9A 2PY5A 4IOBA 4O55A 1RAJA 3OL7A 4K4VA 2XY8A 2B4JA 4K4YA 4IBNA 2IJNA 2Z1HA 4IG0A 2C28A 1BISA 1NK5A 4TYBA 3OYDA 4DFPA 1ASUA 1U4BA 4U7CA 4IH7A 4ZVEA 5HP1A 4Q8FA 5KG1A 4ECWA 2E9TA 3Q8SB 2JC0A 2KZZA 4TY9A 3S3MA 3MR6A 3MEEB 3OYFA 3HK2A 3NF9A 1UWBA 1RYSA 2ZE2A 1QSSA 4KHRA 1S0MA 4HYKA 1Q9XA 3S3NA 5K14A 1UWBB 5KFUA 2B6AA 2ETJA 2E4LA 1BCOA 1RTJA 1S1XB 3BSAA 3HVTB 4CJEA 4AHRA 3BSNA 1RT3A 5EUHA 4I2QB 1S97A 3M9NB 4LQ9A 3AO5A 3MEGB 1S1XA 3IG1A 4ED1A 2E9RX 1WNEA 2GUIA 2OPQA 4FM2A 1EXQA 4FLWA 5KFWA 5KFTA 4KV8B 4ZHRB 4FJHA 1A5XA 3M9OB 3QEVA 3ZSVA 3RB3A 2YNGB 1X9WA 3THVA 4IG3B 3VQQA 3C94A 4WE1A 2Z1GA 1BL3A 4E1NA 3P5JA 3WNGA 4DL2A 2G8IA 3AVLA 5F8GA 4NLTA 3VQEA 3QIDA 4H54A 5C42A 4J9NA 4F50A 1I6JA 4ZMMA 4OKKA 2OA8A 4NCBA 3T5JA 1QS4A 4BE0A 4PWDA 5KFXA 3DLRA 2P5GA 4CIFA 4RNHA 4F4KA 4NYZA 2UVUA 4FJ9A 2VWKA 3JSMB 1JLCB 1T94A 4FBTA 2C22A 4IDKA 2B5JB 4AHUA 1A5VA 3TR8A 1S0OA 1TL3B 3ZSRA 3ISNC 1JLEB 2QE5A 2V9WA 3CFRA 2G8VA 4CHYA 2YKMA 4QWCA 4Y34A 2R8HA 4IRCA 2IBKA 2GV9A 3K58A 3WNHA 3V1OA 4DU1A 2BANA 3E51A 4FLZA 3KJVA 4PY5A 4ELTA 3MXJA 3U3GA 4ED0A 3AVIA 3DOLB 4MFBA 3I0RB 5FRNA 3NGZA 4ED2A 2BE2B 3KLFA 5T7BA 2HMIB 3KMQA 2WB4A 2IM1A 1LW2B 1JLAB 4M3TA 3UIQA 3ZCMA 4EZ9A 3H40A 2ILYA 2BE2A 4CECA 4OKJA 4I9QA 1U04A 1JLAA 4FLTA 1YTAA 1Q8IA 2VG7B 4CESA 2GIRA 1JXLA 2HNDB 2D5RA 4DF8A 3KLIA 5DG8A 1HRHA 4CJ3A 4RW6A 3O3FA 4K4WA 1S9EB 5CY4A 2JEGA 3NGYA 4RW4A 1D5AA 1VSIA 2X78A 5KFMA 3TWHA 4ED7A 1QAJA 2HWIA 1DLOA 4MK7A 1QSYA 3AVGA 4K4ZA 3KK3B 3VN5A 1RDDA 1HYZA 3AO2A 3C6TB 2IAJB 4W5OA 4O44A 4Q45A 4NLWA 3QIPA 1TV6B 1XR5A 4K4SA 3NAEA 3C6UB 1ZBHA 4Z4CA 2UVRA 1BQNA 1RT4A 1ASWA 3Q8RB 3RTVA 4KHMA 4NLUA 3QIPB 1C1BA 5C5JA 2F96A 2J6TA 2WRMA 4KKOA 1WN7A 3QESA 4Z4FA 2W8LA 2DFFA 4FVMA 1IKWB 4Y3CA 1IH7A 3HPGA 4IR9A 3F73A 2YNHB 1LWCA 4E0DA 4OLAA 4KHSA 2C2DA 1ITGA 5KGXA 3OYJA 4JUZA 3DI6B 3PR4A 4FM1A 4EBEA 1JKHB 3IN5A 1LWCB 3T5HA 1HYSB 1K6YA 4CE9A 4C8OA 1IKXA 4AILC 3ICLA 4KB0A 3RBEA 3AVCA 3N6NA 4M45A 3H5YA 3DLEB 5F8HA 4MIAA 3PZPA 1NHVA
chains in the Genus database with same CATH superfamily
2E1YA 3I8DA 1HL6A 4BS2A 4BC7A 1WEYA 4YOUA 1P8ZA 2WCXA 3P45B 3DLEA 5F9LA 1E6VA 4RU9A 3MEDB 1TMJA 3SPYA 4LBHA 3TR5A 4M5KA 1D1UA 1HPZB 1HIYA 2FGOA 1SL2A 1KSPA 4OYPA 4LF4J 2HQIA 1KAYA 1CZAN 5KFPA 2P9IB 3LA0A 1KFSA 1WAFA 3AA4A 2HHHF 3AY9A 2IPOB 1C1AA 1X5TA 4LF9J 2WBRA 3TAFA 1T05A 2OANA 1FA0A 4ZJQA 4DTNA 4Q2MA 3VQDA 1BOTO 1IM4A 4E8UA 3NGKA 1VBYA 4RNOA 3TSQA 2L9WA 3R8YA 3ITHB 3PSIA 4YDUC 4MYTA 1TAQA 4CJPA 2E5LJ 2F9WA 4DTPA 4OFZA 4ED6A 3WQTA 3CFPA 1QJHA 3K0JA 4YR3A 1RNHA 2W9BB 1SV5A 3DLJA 3OXLA 2QWQA 3BM7A 2W9AA 2F8TA 2UXDK 4YB1P 2CVIA 2LQ5A 5A8KB 2LEBA 3KWGA 2EHGA 3V1QA 2ZNZA 3CG7A 3A13A 4TN2A 1I94K 2XZWA 5KFCA 3OW2R 2GFFA 2ASJA 1RHMB 4KT0C 1Q9YA 2H54B 3S8SA 5BPMA 1NJZA 4HWIA 1RBSA 4HI2A 3DOKB 1FFGB 3TARA 4ZHRA 3U1NA 4JI5J 2IOCA 3NFAA 4BRFA 2XBPA 2VQFK 3DLHA 2W24A 2FXUA 4FLYA 1RAHB 1ITPA 2BKOA 4A59A 5AQNA 1M90T 5HAOA 4ZA1A 3K57A 4KI6A 3A2FA 5D0GA 2IDOA 1JMTA 3NS7B 5C42B 1I3AA 4J5OA 1LW0B 2UXBJ 1XHXA 3O5BA 3QGHA 5BRFA 3OYHA 3LH2S 3WDOA 2M3DA 2GHVC 1ASVA 4K25A 2YY3A 4UUXA 3H98A 3TAPA 2ATLA 2K1RB 1HNXJ 1FNMA 3DXMA 2F65A 3LP3A 2R8IA 1HD0A 3VZIA 2C2OB 1WELA 3CMAS 2ZC4A 4E7KA 4K0KF 5LMNK 4MQ3A 1EKEA 3MPVA 2CQCA 2Q66A 2VBWA 2VDIA 4RCHA 2OPPA 2CQ0A 2ZJQL 4EI2A 2CYYA 1RBAA 4LSZB 3GTYX 3MUMP 3ULHA 1HKAA 1EHWA 3HI0A 3OHAA 1X4FA 3SQGB 3J7ZO 2A3JA 3A1YG 3HVTA 2MZQA 3QGPA 1RT3B 4B17A 1XMQK 4QWEA 3W0LA 4LF4K 1RWNB 4RKUC 3CC2S 4B3MF 3CB4A 4DN9A 4YP3A 3SYZA 1MSWD 2IFXA 3SLCA 1C4AA 3ZT3A 2CRLA 5HLFB 2P5VA 4FNIA 3D3BJ 2ZJRQ 2BJ3A 4ZP7A 3WNEA 1YJVA 4FOIA 2F3JA 3EGZA 3GSDA 1GTHA 2R7VA 1QAIA 4OZ2A 4QS9A 2UUTA 1WC1A 2LU1A 4NXMK 2MY7A 5KG4A 5KFJA 2CQGA 1NK8A 2B43A 1NRKA 2YXLA 2D41A 1HR0J 3N4QA 3HO1A 3POTA 2PA3A 2ZH6A 2GZOA 2EK6A 2MQ8A 3LZJA 2MKJA 3FLCO 4KRFA 3SFUA 5DETA 1G4CA 3HSDA 4CHQA 4V19J 2DGWA 2P6SA 4CLWA 4CZJA 1DAXA 2R7WA 3EWGA 4PXDA 4KO0B 3O08A 2AYMA 3BUZB 4RZRA 3QEPA 4OVLA 3RAXA 1CZ9A 1JKHA 2CWKA 2CPZA 3R1XA 1HWJA 4LF1A 5TKYA 1KLMA 4MO5A 1HNWJ 1NKBA 2UVWA 3AO3A 3V9SA 4ILHA 2ZGZA 2WONB 3RWUA 4Q43A 2XGQA 3CCVN 4FZXC 5HANA 3L7OA 1BQMB 3OYKA 1UMJA 4BC5A 3BGLA 2R8GA 4JKHA 3HM8A 1S9EA 2J9EA 1N32F 4Y65A 3OL9A 1HQEA 3AV9A 4EHTA 2RKIB 1BE4A 3WC0A 5KG6A 4NLRA 2ZH7A 4I2PA 3CCSS 5CAAA 1EKRA 4MH8A 2LMIA 4J2EA 4RW7A 3FK4A 1Y5IB 2BUNA 2KJVA 1Q0NA 1HUXA 2QWMA 5DG7A 1ZPVA 2HHPA 3AD9C 3BF4A 1HFEL 1H74A 1H3DA 2NSCA 1FVSA 3J80U 3HFKA 4NCAA 2N7YA 3U9DA 1CS4B 3GMGA 2BW7A 1FDDA 1T8EA 1SH0A 5FDLB 1YITS 3AVAA 1TUGB 4M42A 3BKTA 2HHHK 4AXJA 4BR2A 2DHXA 3D4JA 1FT8A 5KFQA 3D45A 3HHNB 1VQLS 4RUAA 1VQSA 3H5XA 3WQPA 3PVXA 3OFFA 5A2QO 3DRPB 3R97A 1JCFA 4OI1A 4LF5F 1VMBA 4X64K 1Q95G 2MZ1A 1AROP 1S72S 3ZTQA 4B9TA 2UXDJ 1LCUA 4A5BA 3GONA 4CHOA 1RTHA 2Q36A 1KOHA 4NA3A 2F4FA 3QICA 4CBWA 1FE4A 4URSA 4N76A 4BC9A 3H7HB 1NK4A 3KD1E 2C2EA 4WF9L 2Z30B 3R6MA 3HFVA 2W1BA 5E3CA 4HACB 4F4YA 4DR3F 4XAKA 3THXB 2DR5A 3U1MA 2RVJA 1NGBA 4CH1A 2EWHA 2ASYA 4L3KA 1OYEA 4Q44A 4ED4A 4OGCA 2O8EA 4B3SK 3H46O 2BDPA 5IZHA 1BA0A 2PEHA 1DTTB 1SC4B 3DM2B 3HTVA 3BPDA 3TPQA 2P9SA 4MKAA 1NU4A 1QM9A 3DDKA 4KBIA 5E3AA 2V63A 2VQFJ 2GBZA 3L6QA 2DD8S 5H9FK 3G4SS 4NA2A 4XH5A 2ZVIA 3HPHA 3CQYA 3D2FB 2ZEJA 3AA8A 4H0VB 4QYZJ 1TUUA 4CI6A 4OYZA 3CCES 4KGMA 1CXQA 2JGUA 3DXKB 1RAGB 2WOMB 4QIEA 4JBCA 5BPLA 3TAMB 2P6TA 1VK0A 4CF1A 4TQRA 1SIZA 2LYVA 3UCGA 2HLTA 3V6KA 3V9ZA 2FD2A 5L39A 2N3OA 2NXCA 3E01B 2Y8WA 3ET6B 1RGVA 2ZQBA 2VWJA 1F0XA 2OEMA 2YTCA 3R5BA 1RHQB 1K47A 3GDQA 4DQ8A 3QT8A 5D15A 1N8RT 4CQ1A 5T14A 3RBDA 2BR0A 1WAJA 2EI5A 1VRUA 1U02A 3NBPA 3FFKB 4PYDA 4H5RA 4PHTX 1S12A 1IBMF 4J9KA 3TQ1A 2KT3A 1U6FA 2GX8A 1S5ZA 4CW7B 2PBDA 1KVAA 1CC8A 4USWA 2NPFA 3V6DA 2MHEA 5AQIA 4WU2A 4X66J 2OIHA 2HRYA 3FC9A 2HQFA 3SNNA 4BRIA 2RT3A 1IKYB 1TL1A 1SC6A 4K50A 2L48A 1NHUA 1U2CA 3RW7A 3QLHA 2AWZA 1NKEA 2DGSA 5G0RB 2DNKA 1FKPA 5HATA 3KJFB 1TZ0A 5CYQB 2YHBA 4KPCA 2BANB 2X1FA 1N6QB 4K59A 2ZOMA 3NNAA 2XSJB 2XM3A 2DY4A 5T7LB 3G71N 2W9CB 1EKSA 2WTFA 1NWKA 2HEKA 4OHXA 1LW2A 3FNNA 3L2VA 2YWFA 1NBWA 5E3QA 2EFPA 3TOQA 3SMZA 4MKBA 2HZCA 4AF1A 4BC2A 1EX4A 2ZJPQ 5FPEA 2YKOA 4Q0BB 1VQ8N 2E7WA 2F4VK 1GFWB 3Q89A 1TMMA 1RDUA 2RHQB 2HFZA 1S77D 1ILYA 3H45C 3SSQA 1HMVB 1GMWA 2AU0A 3ISZA 3TX0A 4TQSA 3QSIA 3IWXA 1PYSB 3ZSQA 2VA2A 3ZZYA 4CJWA 2QYGA 1Q8LA 5EWEA 4DR6J 4H0YB 2GX9A 3G6EN 1N0UA 1RB0A 5LMNJ 1UKUA 1SJFA 4FYVB 1NZ8A 1M5KC 9ATCB 1XIQA 3AO1A 3C14A 1AZSB 3PUFA 1YWXA 3J7YU 3AJ2A 2VKRA 1R0AA 2EG1A 2M70A 2HNZA 5B0AA 2QGFB 2HHXA 1KAZA 2RE2A 2BRKA 1N5SA 3CC4S 3QPIA 4DMZA 4A8XA 1SI9A 4L74A 1K73O 1HX1A 1K8AT 2C2KB 3FMWA 4DR2K 3KK1A 3IGVA 2VFRA 9RUBA 5J1PA 1JL1A 4M5LA 3NF6A 2DRAA 3LAMA 3HD1A 4IXCA 1YIJS 5AZIB 5HP1B 3ID8A 4YOYA 1QZ6A 2O5DA 3OD2A 4AYBD 1S1UA 3AVKA 4JS5A 4ILRA 2OI2A 2QWOA 3RAQA 3JQMA 1J9AA 3P96A 4R0JA 2NUBA 4N41A 4JV5J 4JI8J 3E9LA 2B51A 1Q5VA 4O3SA 4O8UA 3KYLA 1B9DA 3A5NC 4RW9A 3MEEA 2H51B 3I87A 5HRSA 4YR2A 1RISA 5DM6Q 3QERA 2R8JA 3HSJA 1GLDG 2BJ7A 3IMXA 1FRLA 4ISFA 4WFZA 5J2QA 3AXMA 5M1NA 3AVHA 2EBEA 5D3GA 2BJEA 1NLVA 1VI7A 2H4YB 2FBYA 4CWBA 4IO1A 3CUNA 5GMKa 4CEZA 2W01A 4PG6A 3BGRB 4CVNE 3B78A 1IR2A 3IWNC 3VQ8A 1U0HB 4HCBA 4DFMA 1GXLA 4FPIA 2ZH9A 4F26A 2O1PA 5AFUA 4J37A 4Y1CA 3V6HA 1VC5A 2YNGA 2Z8QA 2B7BB 3R5DA 1H7WA 3HHKA 4I7FB 4NMLA 4QR0A 2ZZMA 5JUMA 4HKQA 3OLBA 4IFVA 5E3RA 2AD9A 4YY3F 3TEHB 1N33J 3K7RA 2LQ8A 1FKOB 1WSEA 4QZVB 2WSCC 4GW6A 1EX8A 2JOQA 3RW6A 3LP1B 1WHYA 2ATQA 3OS2A 3I5CA 3QNWB 2CJAA 4NXNK 2PA8D 4J90A 1ICEB 1VQ7N 3Q8PB 1RE1B 3VWSA 1X31C 4JOUA 3A3NB 4QIVA 4FPBA 5M1OA 2YKMB 5AQWA 4Y0WA 2B56A 2YNFA 1H0HB 2V4JA 4LR7A 3VAKA 2YKNA 4TVAB 2W2QP 3M8QB 4OI2A 1PBAA 1RDWX 3SI6A 1GLEG 1M5SA 2IY5B 3H2VE 4ZLNA 5CD4A 4J9QA 3BSCA 4K42A 2VFVA 4P75A 4FWKA 1NPPA 4JD2B 1M0SA 3BDPA 2ZUGA 4ZVPB 3P31A 5F8IA 3THYA 2CJQA 5JLHA 4JKCA 4OI0A 3V81A 4OZNA 3TUJC 1VQNN 5IXUA 4LC9B 1WF0A 1TVRB 2XO7A 2MKIA 5B0GA 1FCAA 3KK3A 1FWKA 3LM2A 3BZKA 3BZQA 3M6WA 4K0KJ 4EK2A 3EZOA 5KG0A 3GPAA 4H5WA 4FK2A 2XQCA 1SKWA 2GC8A 2H3EB 4ZPDA 2Y1JA 1BQNB 5AZJB 2D1KA 2DTUA 1FJGF 3SQGA 2V7ZA 3KHRA 3FEZA 2HOEA 4DV0J 4FYXB 4XIUA 2UU9J 5DLGA 3I0SA 3DGVA 1MW7A 2AF6A 4YB5A 2XRIA 3R5GA 4QU7A 3QINA 4DFJA 3MXMA 2ZKUA 1T7PA 4W4MA 5FLXU 4OZ3A 1WEZA 1VRTA 5HLFA 3P4UB 2FDNA 3KLEA 4ECRA 5IV4A 2CDRB 3N4PA 3TTFA 2C3PA 2W25A 3QFUA 1Q5YA 2D3ZA 3W65A 3NCQA 3GJTB 4TU7A 4TKTA 1JCGA 1DHMA 4J9SA 3QNOA 1T9VA 4YN3B 1KVBA 4BREA 3WXLA 1NB2A 3ZT2A 3VGLA 2JVOA 4DR5F 2VB6A 2VUGA 3A3OB 4CCHA 5CR4A 4AM6A 4Z4HA 4MKYA 1OWXA 5F8NA 4ZVFA 5C2FA 2XMTA 4GV6A 3SCLE 1ELOA 1N0VC 5EY4A 3TZZA 2HWTA 1KVIA 3BF1A 2AYBA 3R3LA 3DLKB 2XLIA 4JV1A 2GUPA 2HK2A 2MQQA 1WC3A 3FBEA 2R2SA 4CBXA 3SJJA 3FFIB 2QKBA 3SV4A 1YBAA 2GO8A 5AQSA 3I4PA 3MMCA 1VAZA 4DR7F 2WUSA 2FSJA 2KXNB 4OO1J 1SL0A 5HMWA 3DJCA 1HJRA 2VOOA 4H5NA 2V8DA 3VQ4A 4J9MA 2PMWA 4K0KK 4W5NA 3ULEB 3UO0A 2KDOA 4CF2A 2PGCA 1VSLA 4DV7F 3AD8C 5L1JA 1PC4A 2QFIA 4BR9A 4DV1F 4JKDA 1OPIA 1VC0A 3B6OA 3AB4B 3OR1B 4JI4K 2EG2A 2IJRA 4PXEA 5A8RA 3TA0A 1LEOA 1Q53A 3W3DA 5K14B 1JJHA 2BX6A 4Z0UA 2VOPA 3EZ5A 3P3DA 4N47A 3RMDA 3TNVA 1Z25A 3OA9A 4ECQA 4WYBA 3KG1A 5GAHU 2ZZNA 2G13A 2N4CA 4NL5A 4KJIA 2PAVA 2OPQB 3BQ1A 5M2PA 2GS8A 2O4GA 4DPOA 5E2QA 4WTOB 5JMVA 2ZBQA 3DN9A 4P74A 4M3YA 4ZK7M 2C1EB 1ZAVA 3QQCD 2X6SA 3AOBA 4B3TF 2DNOA 1E4FT 2HW3A 3G8QA 3J80Y 3PRVA 4P6QA 5ITHA 1I94F 2XWYA 4U7BA 2KN4A 1S5JA 5JVGL 2QA2A 4YUDA 4WQ5C 5EDWA 4ZN3A 1JX4A 2AGQA 3N0VA 3MM6B 3AA2A 5JVHL 1B7YB 1HQ2A 4Q2LA 4WP8A 3QJPA 2ILZA 4M7XA 3M32A 3FVYA 3SIPB 4ZCMA 3GQCA 2E1MC 3W2WA 4A57A 2ZD1A 2KB2A 5CZ2A 1N33K 2P51A 3WEEB 2KM8C 4OZLA 2FF6A 1WB9A 5J2MB 1Q81O 4KH6A 3KUEA 3GIKA 3E2EA 6FDRA 3E9PA 3RB4A 4JN4A 3T69A 1MWKA 5AQFA 2ASLA 3HF5A 3SAHA 3PJXA 3AA9A 4N8NA 3DM2A 1ZETA 5BN8A 4GV3A 3CJAA 3ZZ0A 4Z4GA 2XHCA 3O6WA 2HNDA 5KQDA 3DOMB 2FZGB 2G8HA 1NOYA 3M8PB 2L9NA 4BRNA 5B0CA 2QI2A 5I3UB 1X3NA 3UB5A 4NASA 2P9PB 3O44A 5AQVA 5I3PA 2AQ4A 4OX8A 4RU2A 2CGLA 1DLOB 1TKZB 2OFHX 3O6QA 1T11A 1JCEA 2WOMA 4JKFA 4C8MA 1XMOJ 5F9NA 2CJKA 2LVWA 1WSHA 2JEJA 4KGXB 1B99A 2YNIA 2V67A 2XWXA 1MWZA 3H5SA 1BUXA 3HL8A 2FF3B 3NWGA 2NS1B 2OGUA 2OTLN 3R27A 2HS4A 4M41A 2YX1A 2ZITA 4PAAA 4O23A 4DR4K 4AHCA 1JLEA 1L3UA 3AA5X 5AQOA 2X1AA 2KH9A 4FKXA 1M1GA 2OKQA 4CGFA 4PPZA 2IHR1 1VQ9N 1UVKA 3MM5A 4DV0K 1UJ5A 1IKXB 2OMOA 3VGKA 3LZIA 2YHYA 1P1LA 4C3KA 4NYNA 3OHRA 1S72N 3VZHA 2QA4S 2YJFA 4IR1A 5JJBA 3WXKA 3A4TA 1J54A 5ETLA 2Y1RI 4CGIA 2PYLA 4KAIA 1YHQS 5BR8J 3RSEB 4H8KA 3K8WA 3PEJA 2FLOA 1SH2A 4DV1K 4USKA 1WC5A 4H03B 1Z4UA 1FRIA 1R3NA 2HF4A 4CGJA 5HVHA 5CYQA 3A0IX 3LPUA 4PG7A 4USIA 2R7XA 5LMNF 3LDQA 4DR7K 4OX9F 1VSJA 3THTA 5JXSA 1GLFO 3LWMA 2CVEA 1HD1A 2RS8A 5E84A 2WAQD 2AP6A 3R9LA 2HAFA 2W9CA 2UV8A 3EZUA 3NF7A 4WTYA 2X1GA 1NPKA 2R8KA 3BH7B 4B1XB 2F8EX 4DG1B 1KVCA 4YEAA 4KY3A 4PCQA 5HK4A 2VQEJ 5DDOC 4LRCA 1UZDA 1WG5A 2GA7A 2R7RA 4GRSA 4PUOA 3F5TA 1M90O 2GIQA 4B9QA 5BJRA 1JLQB 3RMCA 5ETRA 1URRA 1K0VA 3KJQB 4F2RA 3LANA 2ITGA 3IAS9 1JXEA 3PYGA 3TZXA 4DDFA 4ENOA 2RJZA 1C4CA 1RWOB 3CJSA 2MGZA 1KP6A 4A8MP 4H0TB 3T9NA 2GMHA 4QPTA 1O51A 1O13A 3CYMA 2BKPA 4GMJB 1SIWB 4IOCL 1R0AB 4M63C 2O8FB 2PY5A 1IBKJ 2CQIA 2NZ4A 1F2GA 2C2NA 4K4YA 1NHKL 3M8WA 1WDTA 3FZMA 1Y64A 3CCRN 3OYDA 4JI0K 1ASUA 3CCQN 4U7CA 1BLUA 4ZVEA 5HP1A 3LF0A 4Q8FA 4FWSA 4DV7K 3KG0A 5KG1A 2ZOFA 2E9TA 1AFJA 1N88A 1UW9A 4CH7A 3MMAA 4IWVA 1HW9A 2BJDA 1IBMJ 2XG8A 1BO5O 4WQ4A 3MEEB 3OYFA 3NEKA 4OZ5A 3NF9A 1QHAA 2L9DA 1HI0P 1VFJA 2IYGA 2FY8A 4AXIA 3G6ES 5H9FJ 3W5XA 4NEZA 3QT5A 1UWBB 4PABA 4FF2A 3OTOF 3TEGA 2B6AA 2EKYA 4MDAA 1RTJA 1KD1T 1YLXA 1DZ5A 4AHRA 3BSNA 4I2QB 1DQAA 2A40A 4X4OA 4ILGB 4CLKA 4A8SA 2G2OA 3NMRA 1X9JA 2VWBA 1KQKA 2LXIA 2GUIA 2HFOA 3FE1A 1VIXA 1R8PA 4CLTA 3QEVA 2V50A 3ZSVA 3CC7N 2YNGB 2D9PA 4LF9F 1DGKN 4QOTA 4ZLLA 4WE1A 1BL3A 5HQLA 3PRBA 1LK5A 3L4QA 3P5JA 2G8IA 1X5PA 4PXBA 4CZIA 3PYEA 2G2ZA 2BXJA 4F50A 4ZMMA 3CMAN 4CD1A 3DAWA 3S6EA 3CCJS 1CJUA 5DJBA 2ZJQQ 2XHWA 1QVFM 1TL7B 4DV6F 1JLCB 5CYJA 4FPRA 2ZH5A 2C22A 4USJC 4I69A 4JI1K 4LF2A 2B3TB 4FF1A 2F40A 2CZ9A 5AR0A 3W2VA 2FC9A 5HL7Q 2G8VA 2YKMA 2ACYA 1XERA 4Y34A 4IRCA 1MWYA 4DU1A 4LF6J 5D6GA 1WKKA 5LSOA 1HBUB 1WEXA 2DGUA 4LFAK 2G0CA 3KLFA 5T7BA 2HMIB 1OO0B 4X4RA 3L09A 2E2PA 4WPAA 3UIQA 3UW1A 1QQOA 3Q23A 3ZEUB 2BE2A 2LQJA 2CA9A 1U04A 1YTAA 1Q8IA 4A62A 5M1PA 4HI1A 1HRHA 4RW6A 4K4WA 3SQOP 4NA1A 4RW4A 1D5AA 4GO5X 2QMUB 1VSIA 1IR0A 4LFBK 3AVGA 3KK3B 2CQ2A 2YQ0A 3UDVA 3CCJN 3F41A 3C6TB 3P5BP 3R5AA 1WORA 2ZJPL 3QIPA 1XR5A 3PG9A 3MK6A 1BQNA 1RT4A 3Q8RB 2DK2A 7AT1B 4WFNL 4NLUA 2F96A 1C1BA 2J6TA 4PKGA 2RMLA 3QESA 4Z4FA 2W8LA 3B6BA 3VAJA 1OQ6A 1SAZA 3F73A 2YNHB 1B0PA 4CO1A 4E0DA 3OYJA 2NCKL 3OFEA 3SBMA 2A6AA 2QTWA 3VAGA 3T5HA 4ZVTB 1K6YA 2NYHA 2PDAA 2DHAA 3AVCA 2J76E 2Q43A 1PC5A 1EIYB 4DR5J 4MIAA 2EWSA 2UUAF 1JLBA 5CZ1A 3SAGA 3HI9A 4P2SA 5AJ3F 3QMQA 1D4XA 2XNRA 4DL3A 2UUCK 3P83D 4GKKK 4E2FB 3CJ1A 1RT2B 3U02A 5AQKA 4EYHB 1O1WA 3CXCM 2W42A 3O3GA 2KI2A 3BR8A 3P38A 4WKRA 2N7CA 2BQUA 1NGIA 2ALYB 3PJWA 1SKRA 4BLGA 4ZPCA 2PSZA 3QETA 1RTZA 4N77A 1L3SA 1DKGD 2PN6A 1S9FA 2ZBRA 2V8GA 3BF3A 4MMOA 2J0WA 3CJTA 3TJ8A 3FFIA 4H0XB 3KLGA 1MROA 5HL7L 1TP7A 3VEXA 4HHUA 3AQPA 5HQMA 4CIGA 3RB6A 2LKZA 1QZ5A 4WZQA 1T05B 4YDUA 2ZDOA 4XTTA 2H5IB 3D6HB 2HIQA 2HGMA 1D0EA 2RPIA 2JJ4D 3ILIA 4ECVA 2Y1IA 2M88A 4F3OA 4U67Q 2DPIA 2UUCF 1Q16B 4FS1A 4DQSA 3F0NA 1QUPA 3C16A 5JVGQ 4EEYA 1VR6A 3OL6A 3FBBA 3FJ2A 2G8UA 3MN9A 1RBTA 3CJ0A 1P9QC 2X51A 3H1QA 3D7EO 2ZOGA 3QT6A 4LFCF 3MAHA 3ZTOA 2QEXS 4BRKA 2G0IA 1U1OA 2LDYA 2DXEA 2H3GX 3OW2M 3TX8A 2EW9A 2ZWPA 4HEA9 1VBXA 3SQ0A 1D9AA 4HTIA 1VQ6S 1T03B 3Q2SC 3M7VA 5CYMB 3IR5B 4CF8A 2IC3B 5GMEA 1KHVA 3OYNA 4QOZB 1F5CA 1B7FA 1Q82T 3CDAA 3DU6A 3MMVA 2VC1A 3QZ8A 3TANA 4X62J 1FVQA 1SH3A 4MO4A 2AZ1A 5D4LA 3OBIA 4NYFA 5M1KA 4CFAA 2ZNYA 3SSSA 3CDWA 2OZMA 2ROGA 3H25A 2H5EA 2IVPA 2BW2A 2ZH2A 2AYGA 2OJ3A 3G82B 2C3OA 8ATCB 1HPMA 2E5LK 3MR2A 1V4SA 2CDQA 4NI2A 4UF4A 3DRRA 3KIOA 3HSCA 5K8MA 4MFBB 2QLXA 4X4VA 3H2UB 4ANCA 1FRXA 2IYIA 2OPPB 2QL7B 3A3PB 1AYEA 1VSFA 3U8XA 2KKHA 1FK9B 4DV0F 4ID1A 5IT9Y 1FI4A 3J81O 2LECA 4YOTA 1S6PB 2A3ZA 5AQPA 1VQKS 3KMSA 1Q86T 4J9LA 5CE3A 2YX7A 4X65K 4F4ZA 4E7LA 3HHLD 4DV2K 4MJKA 4UTGA 3R7SB 3IR6B 3RMBA 3EPIA 3CSKA 3OBWA 2JZ5A 3LALA 3M8RA 1Z05A 2VIHA 3HVRA 3GFHA 5C25A 4P10A 2NNWA 2CG8A 4IOXA 2P9LA 2CADA 5F8LA 3HP9A 2P9NA 5SWMA 3GG4A 3I56S 2W7AA 1MG7A 1C0GA 1OKJA 4LRBA 4H5VA 2PIIA 4DSIA 2GVZB 4CFBA 1W7WA 3U3YA 1V5IB 1JLFA 1N34F 4K43A 3GV7B 2DBBA 2YCHA 3POTB 4IDKB 4NRTA 1LWEB 1VS3A 1IKWA 1HLWA 1FX2A 3BJYA 4CTAB 4DQRA 5RUBA 4Q7AA 4B3MK 2WK4A 3MMBB 1NDCA 4R79A 2HHUA 4KO0A 2RS2A 5IM0B 3H42A 3BPSP 4CJKA 2MEWA 4F8RA 1GK8A 2KFNA 3RRHA 4CEAA 1XMQF 1SC1B 2HBKA 3NVKA 3S9HA 5LM7E 3L2QA 4X66K 4FW1A 1XI1A 1NAQA 3JTNA 1T9WA 1SVDA 2GV1A 1F60B 3D6RA 3WXJA 5F1XA 5J2NB 1VQ4S 4C0HA 2DNQA 4LBPA 5K5MA 2P9IA 1N33F 3TUIC 3W1YC 1T3OA 5ELZA 3TVYA 1WHVA 4YNQA 3FZLA 3N4WA 4JB8B 5EVZA 4N7TA 5JS1A 4OIXA 3DLGA 4H0PA 4B3SF 2J5AA 3ILOA 5DRKA 2PYJA 1TUYA 2IAJA 3R3TA 3KKRA 2W2MP 3CC4N 4DR4F 4HLBA 4CLLA 1WHXA 3BZCA 4RR5A 3K9JA 3CCQS 2D9OA 3CF5Q 4J9VA 1T44A 4RUCA 1UPPA 1N52B 3IM8A 4DQPA 5FDLA 2CJ9A 2E44A 1YXQA 1J2VA 4HTJA 2QFJA 1HBMB 1LQ9A 2OAUA 3NVMA 4NMXA 3NOCA 2KU7A 4YHHK 3AD7C 3HLUA 3UN2A 2POKA 4HL9A 1E6YB 3DRPA 1BI4B 3DRSB 4ZP9A 1UWAA 1BWEA 4CO2A 4I6MB 3D5MA 4WFXA 3OTDA 1BA1A 2B8PA 4RTFD 2X1BA 2E5GA 2RDJA 5ADZA 1QTMA 3CCMS 4ZCKA 3GR0A 5I42A 2QIFA 1NSKL 5LMUK 2CKWA 5FROA 4TNOA 3SUOA 1B0VA 2CZ4A 3NAHA 1Y97A 3CT9A 4ELUA 2ZJRL 4BGAA 1X4CA 2A6OA 1IWAA 1J5EF 1QE1A 1FO1A 3JSBA 2M8DB 3HKWA 3I8BA 1RT1A 3NRBA 3IBFB 3B8HA 2LP4A 4WFNQ 1WDDA 4B1YB 1NGJA 4JAXA 2B4OA 3MCSA 4NOHA 3PO5A 3T1YF 5GAEU 1IBLK 3BQ2A 5DQGA 1MA9B 4F02A 1NO8A 4DQQA 1YX2A 4CNZA 1BXNA 2KO1A 2NLXA 4DSLA 4DCPB 4UOFA 3HBTA 3RR7A 2OPRA 3GIIA 2VA3A 1VQ5N 1VQ4N 4LF8F 1FEEA 3GFZA 3EGWB 2ZBIA 3IA0A 5C24A 3UKRB 2RQ4A 2OHDA 3MUVP 2FLPA 3J8AA 1HR0K 1VJQA 4LH4A 4DR5K 2VONA 1CG2A 1S1VA 5L1LA 1KHWA 4O4GA 1PSDA 3CO0P 2V8HA 2B6AB 3H0PA 1YKWA 2FHOB 3IWLA 4Y1DA 2LEAA 1HNZK 1ESVA 4M1KA 5AQRA 5KFSA 1T9XA 1BHLA 3WXIA 4FJ8A 4OJRA 2CUYA 3CD6S 3AVFA 1YT3A 1RWPB 2OELA 3OFGA 3O3HA 4FN5A 2M9KA 4BR4A 4ZPTR 1HNZF 1TKXA 7FDRA 5A2QU 4HH1A 4X65F 2MLXA 1HW8A 1NDKA 5JVHQ 4ES1A 4V19S 3O80A 2APOA 3AQOA 4C0BA 2C2RA 4ECTA 3OYBA 3QNNA 3AJ1A 2HMPA 4G1QB 1OSDA 2IM3A 1TL7A 2OZSA 1Y5NB 1S99A 1S3XA 4WP3A 3NWRA 2HZVA 3I82A 2QXLA 4A8QA 3J7AN 3O8MA 3T19A 4CZGA 3IRXB 4WQ4C 3PFEA 4J91A 2HBJA 5GMDA 2G8KA 1W9HA 4PKDB 4WQ5A 3KHYA 3DRXA 5G0RA 3GOIA 3CJ8A 3V9UA 2YWWA 3E9OA 1WBDA 1R89A 2I5JA 1VLYA 3MR3A 3BSOA 3KLFB 2HMIA 4CK3A 2LFVA 3PW5A 2WONA 3K5NA 2QJ3A 4TY8A 2DIVA 1LFPA 1FJCA 4FOEA 1F9EB 1HBOA 2MZRA 4X4UA 1GOCA 2MYFA 1JQGA 1HQEB 3TP2A 2Z2ZA 3CD0A 1RFQA 1XR6A 2HF3A 4FS2A 4M5DB 4I2PB 3PKMA 4A2AA 4K4XA 3R9PA 3DWLA 2Z2YB 2CPYA 3TZWA 4IZ9A 4J2BA 2HBZB 3LP2A 3MZIA 4UY8O 3K2YA 4ICLB 1S9GB 3JB9k 3MD1A 1IBCB 4CHZA 2IVOA 3MTKA 3EE8A 4DPUA 4NLDA 4BWJA 3UQSA 3FRZA 4H4OA 3CJ7A 3PJ9A 2OH2A 3SDEA 2VQFF 1GLCG 3X3UA 3AAQA 3RB0A 4JKBA 1AZSA 2KXFA 1TQLA 4EFHA 4OYOA 4DV5F 1MNEA 3MWTA 4FBUA 2L3MA 3A8IA 1RZMA 3C7NB 1U09A 1MWQA 3FGUA 2UV8G 4V1Ak 4IG0B 3MEKA 4CFCA 1F5AA 1Y3JA 1V3RA 3CPWR 4CGHA 1AA1B 3LO3A 1YJUA 2YH1A 2DRBA 1LWFB 1SJ4P 4DU4A 2BOAA 3J7YI 4DV1J 2UUAJ 3R2CJ 3VF2A 3MI7X 4NLCA 4NB4A 1GXTA 1X1PA 2W2PP 1RBLA 1LV5A 3EO3A 2RNEA 1RSCA 1RT6A 4FJ7A 1C0UA 1K8KA 3THXA 2W41A 5ETOA 5D8HB 1MU2B 2F63A 4C6AA 2B4VA 1SUQA 4CP5A 3AVJA 1FDAA 2V51B 3IRWP 3OUYB 4EYIB 3V1RA 1M1HA 2V94A 2ZUAA 2FGCA 1L5UA 4F4WA 4G65A 3GV5B 1U1RA 1PKUA 2VBXA 1NJWA 1MDUB 2P9SB 1G7CB 1FXXA 3CJ9A 5HQ8A 1Q8KA 1YJRA 1H2VZ 3BGRA 1EETA 3TVZA 4KV8A 2JLFA 4X64J 4DI6A 1MROB 3VHQA 4YFUA 2CGJA 1PBUA 1DEJA 4DL6A 5AQQA 3TJAA 3MM8B 1G99A 1TTHB 5HBMB 2HQCA 5A76A 3TAMA 4FJXA 1UAXA 4I7FA 3TVKA 1N34K 3KKSA 4J2DA 1PJ7A 3I55N 2AW0A 3Q2TC 1RI7A 1JLGB 2VYPA 3FRYA 4DV3J 1CXUA 2AA4A 4EO6A 4ZPVR 1QQCA 4AT1B 1RBRA 2J7UA 2JNJA 3M6UA 1TL3A 1D9FA 4A2BA 4DS4A 2MKYA 4RO0A 1VRUB 1PJ5A 8AT1B 4DTJA 4I9LA 2K2PA 4H0OA 4CK1A 4DSKA 1WF1A 2YNFB 5KI6A 4EBCA 3IAYA 1VQKN 2J9CA 3MCPA 4AHSA 4FZYA 1BD6A 2MDAA 2F4VF 3HHLC 3PW2A 2FC8A 2EFNA 2CIMA 3VQ6A 3CO9A 4EFAC 3OV7A 1B70B 1NK6A 1U25A 3GV8B 2YWGA 3LPTA 2GHPA 4AUKA 2UVVA 2A0FB 3FSYA 1OY9A 1LXJA 2JWLA 4H5TA 5G4DA 1LNQA 4RNFA 2C2ZB 5M2RA 1OH7A 3CCRS 2KG0A 2YBVA 5AJ3K 4CLPA 4JKGB 2QYCA 4CJVA 2NR0A 4LF6F 4AHTA 4DWIA 4LF5J 3EY1A 4CIOA 3G82A 2FLNA 5DK5A 3JTOA 5LSRA 3OR2A 2VDHA 3DHWC 1W26A 4NI2B 3HOSA 3U9ZA 3D28A 2QWPA 1F9HA 1UEUA 2JLEA 1SJ1A 2I38A 2WVDA 3M8SA 5T7LA 3S41A 3UDLA 2A18A 4U6PA 4JRPA 3SUNA 2HHSA 2P1JA 3BYPA 1U8WA 3NGTA 2UXCK 3PKYA 1IBLJ 5HJYA 4IJAA 5L1KA 4K5SA 4BCAA 3LP0B 1YI2N 4P9SA 3R6LB 4JI2K 3DI6A 2NYIA 1TKTB 4JI7F 3CMQA 2XMUA 4EO8A 1ZPWX 1JL2A 5BR8F 4E1JA 2E6LA 4E19A 1SZ2A 4IKAA 4PPDA 1S49A 5C25B 1RKIA 1W0HA 3DC2A 1G1XA 2LCWA 3OSNA 3KLVA 3B4MA 3FQKA 3V4IA 2FHMA 4ETXA 1KQSR 4FJLA 3PR5B 1X9MA 4WU3A 1RA6A 4W5RA 4RW8A 3L3VA 2GVZA 1ROFA 2HNZB 2MHNA 5ETTA 1ZH5A 1ZBSA 1PIEA 2PI5A 5J2PB 2YX6A 1IBKF 2UXBF 1U48A 3UWTA 4EU0A 4CTAA 1HQUB 2PD1A 3ZXWA 4DF4A 1HNZJ 1UOCA 2V5HG 2VJUA 2DGOA 2RUSA 3MMBA 3G9CA 3D0GE 3AXKA 5IM0A 4RNMA 5B0FA 3K9KA 3DLKA 2V4QA 5KQ8A 3KLHB 2FJWA 3UD5A 1Q86O 1IG9A 4ID5B 2VC0A 2M4MA 1FFSB 2J6UA 1YVUA 1XMOF 4BC4A 5LL6d 3U27A 3US5A 3MMCB 1RXOB 2J8AA 5FRMA 3VTIA 2HFUA 1UCNA 4PR6A 5K8NA 2JX2A 1FFWB 1ZAWA 2IJFA 3ETOA 2UUBF 3GLJA 1RBUA 2V4RA 1JNZB 1K44A 4QWDA 5J2NA 2VG5A 5IC4B 2KQ2A 1UL3A 4HUFA 4CRJA 2X6NA 3ASMA 5AQYA 4JKEA 3OR1A 4OYAA 3W7BA 1RWXB 1VSHA 3TSUA 4QQBA 3DLGB 2ZHOA 2XMMA 3VGMA 2HGLA 4DX6A 4FZZA 1VQOS 4CIEA 3MHYA 3SBTA 4I64A 4HUGA 4OZJA 2R7YA 3M5RA 3FSXA 4Z4IA 3OJSA 1NNDA 3EXCX 1T02A 1PYOB 3N5FA 4G3IA 4UZCA 2CPIA 5AE1A 3EM1A 4AL5A 3W60A 4B3RF 3DXBA 4DCHA 2XY6A 1S6QB 2Y8YA 5IC6B 1YRXA 2C3MA 4IG3A 3R8EA 4U96A 1Y7PA 4U95A 1V5VA 2WVCA 2YHAA 2MSTA 4LFBF 4PEOA 1BHNA 1Z6RA 3HZ6A 4YOEA 4ETZA 4WFYA 2M2BA 2DR6A 3G6YA 5E26A 4JLHA 4DSEA 3M6GA 4QIWD 3SFGA 2QX0A 2CJXB 1VBKA 3THWB 4C1NI 4PKHA 4NLYA 3U6FA 5U47A 5EWFA 4KB1A 2BJ1A 1NG9A 4O3RA 3C6AA 4XDDA 2YKNB 3K0SA 5THWA 2YKAA 2FBTA 1CJTA 1MN7A 2P9EA 3KDOA 1J6ZA 2R2TA 4OJHA 2FVRA 3WEEA 1VQ8S 1QUVA 4ALZA 2D3UA 4OLPA 1XHZA 2KFYA 1XNQF 4OJ1A 4BRCA 1HJOA 4CDIA 1GEHA 3M2UB 4G6VB 3F9KA 5AQTA 5KG3A 5CD4H 3RRGA 1AB8A 4CEDA 1S59A 3IBWA 3VVUA 3VA0A 4A48A 1K8AO 1TVRA 1T0TV 1IQZA 2YVSA 2WW8A 3TUZC 2E2NA 3G71S 2XMAA 4DR4J 3PW7A 3W3SA 5I3UA 2FVSA 5DQIA 3FBCA 3SQ4A 2QC3A 2OPRB 1YBTA 3CCSN 4NEYA 3CM5A 2DNGA 4I0WA 1PGZA 3CJ5A 5K20B 1S1TB 3NHGA 2DISA 3D54A 4TXSA 2D0BA 4DU3A 4WYLA 5D0RA 3HSGA 2ZWHA 1D9DA 2RF2B 2BVZA 2P9UB 5DGAA 1HWLA 1XQIA 2JEFA 1IBMK 4KFBA 5GAGI 4ES2A 3GJSB 2Z1IA 4BROA 3BEXA 4DUYF 3UDCA 3ZNUA 5CZVA 2JC1A 4BQZA 4TU9A 4KREA 2V52B 3FMBA 2DHSA 3CJKB 3OTOK 4RBTA 2AX0A 5DDQC 1PO6A 3GYNA 3EUNA 5IV3A 4OLBA 4B9NA 2HHTA 3AVBA 2W4PA 2LU2A 2MTLA 4IH5A 4OX9J 3CJCA 5GADP 2C42A 3ENQA 3I9V9 4B8CA 3QZ7A 1YJNS 3OS1A 1A5WA 3GCXP 1KVKA 2CNLB 2GVDB 3VAFA 4USMA 1VQMN 3MEDA 2F9JA 3VALA 2CG4A 2VD3A 3BBFA 1GT8A 2DHHA 4OGEA 1KAXA 4DQIA 4JV0A 2QL5B 3F44A 4DXLA 3IRXA 4M3XA 1OSCA 3GE9A 3LPEA 2CXEA 3MPYA 4NYPA 5AXNA 4KE5A 2FBVA 1FD2A 2WTUA 2Q3PA 3GIMA 3FZFA 1Q78A 5KT6A 3JS6A 2A42A 2Z58B 1AXQA 2MQNA 4QU6A 3AFGA 4CYUB 2R7UA 3MM9B 1NU0A 5L46A 4DR1F 1Z2ZA 3ITHA 1IO2A 4KKOB 2NREA 4PQUB 4BGBA 4H4MB 4EAHD 5C2GA 5KPZA 3HKZD 1ZM3A 1EB0A 4E7IA 1HR0F 4YS2A 5A8KA 2Y0BB 5L9XA 3BY5A 3L2UA 4C4WA 1S22A 1HNXK 2QSWA 2QA1A 3ENVA 2VODA 3NGRA 4CJ4A 4OKEA 4YORA 3LP2B 2E6MA 4LF5K 1VQMS 3T5LA 2FJVA 1JLQA 4OX6A 2ASDA 2NXUA 3BO2A 1S1WB 1KTVA 2I2YA 4IUFA 4PWUA 1HWIA 4BHQA 4B3MJ 1JXBA 2E7VA 2FQQB 3SDEB 5GAHP 3TJ9A 2JWNA 4O5BA 1PJ6A 2QMWA 4RWWA 4O55A 1RAJA 1DY3A 2VASA 4OX9K 3ELHA 3O9RA 4IBNA 1TU0B 2IJNA 4IG0A 5IS2A 4CO3A 3LUYA 4TYBA 4DFPA 1U4BA 3VR1A 3FZKA 2RRBA 4A61A 4RLEA 2Z4PA 3MM6A 2JC0A 1X0PA 3Q86A 4OMFG 4DL0C 3S3MA 1UFWA 1KONA 2MY8A 2VPXB 3IDHA 4UOCA 1RAOA 2ZE2A 2VPWB 1QSSA 4KHRA 2CAJA 1S0MA 1K8KB 4LR9A 3J80O 2YX4A 2XS2A 1NUEA 2GQ2A 1T6CA 1Y5LB 1YRUA 3OUYA 3HVTB 2HSTA 2CJYB 1RT3A 1HLUA 3AT1B 3AO5A 1HNWK 1J27A 1VIOA 3IR7B 2ROPA 2E9RX 2CQPA 4CO5A 1EXQA 2VGNA 5KFWA 4KV8B 4MT1A 4L72B 1SKUB 2P9PA 3DGPA 2ASOA 1X9WA 3P8BB 4I1TA 3THVA 4ZS6A 1VRQC 3B54A 2H1YA 2XLKA 4E1NA 5C7PA 3FBFA 3OTCA 3AVLA 4JV5F 3QIDA 2XZTB 2BMBA 4J9NA 4ES3A 1I6JA 3VOVA 4OKKA 4DZ6A 2QSFA 3T5JA 1QS4A 4BE0A 4FSVA 3FEXB 5KFXA 3CCUN 2NRXA 4NXMF 4NYZA 2VWKA 4FBTA 4C7QA 4I56A 2B5JB 1A5VA 3TR8A 3RUBL 1S0OA 1TL3B 2JL9A 3ISNC 1T3VA 1JLEB 2YJEA 2NXJA 4QWCA 2FUG9 2OTJS 3K58A 4PY5A 3W2VB 1Y3KA 5B0DA 3H1VX 3MXJA 3U3GA 4I6AA 3J7Z5 3UR3C 4WKYA 2VH7A 3KMQA 2WB4A 3ZCMA 1M5PC 2E88A 4EZ9A 4QR2A 4B1VA 4BRDA 4FWQA 4AL6A 4F0KA 3MCOA 4OKJA 4I9QA 2GGPB 3HT0A 2WW4A 2VG7B 1N5TA 1GNKA 5EX3A 4CESA 3ZEUA 4LIRA 1JXLA 2CPHA 1UJ4A 1V3ZA 2VGMA 1S9EB 3A5OC 1G6BA 2JEGA 1VISA 1DFDA 1G3OA 1XBWA 4Z37A 2M0GB 4I6YA 2X78A 3TWHA 2VV5A 5KFMA 4ED7A 3MWBA 1QAJA 2HURA 4MK7A 4KH5A 3CXCR 5DDPC 4AQYK 1APSA 5E33A 3CE8A 2HBMA 2K8GA 3D9BA 4V19X 3AJDA 4I6WA 4C9DA 3AO2A 4W5OA 3RGIA 4Q45A 4DPYA 4NLWA 1TV6B 4UUWA 4M5JA 3NAEA 2VFUA 3QRRA 4XH4A 2HFSA 3GYGA 4Y2KA 2ASPA 2YI1A 1ASWA 3ZETB 3QIPB 2E7XA 5KOXA 4DV2F 1E3MA 2BE7D 2JH3A 3X1LB 5C2CA 3V2UC 2DFFA 1ZZFA 2B4PA 2ATCB 3TYTA 4DU8A 4LFAF 1QTNB 1P6TA 1LWCA 3EE3A 1HKCA 4OLAA 1YJWN 1ITGA 5KGXA 4PZVA 3DI6B 2QTDA 1SB6A 1XK8A 3CIPA 3RBEA 3ILJA 4FYWB 3I56N 3N6NA 1IBLF 3LW5C 5F8HA 3PZPA 5HRNA 4OPJA 1BCMA 4Y2IA 3OQ2A 4MLEA 3M30B 5AJ3J 4KHYA 2AT1B 4QR1A 1FKAF 4DFKA 3CF5L 4K2JA 3SZ2A 1KS2A 3B6PA 4CZLA 4FZVA 2DFEA 4C8KA 1EQ0A 1YSJA 4ANDA 4Y0FA 4L73A 2ZZTA 3IFEA 2Q6CA 3NF8A 4QCLA 2NRVA 3PX6A 3VVTA 1UPMB 4LH5A 4IDHA 1WKLA 2D0AA 3KZBA 2HIYA 2ZM6J 4B08A 3PFOA 1S7IA 1RABB 3MMAB 4KSEB 4DR2J 2D74B 3THPA 1WJ9A 2IM2A 5E3PA 2O8CA 4FF4A 5CHIA 4DR2F 1RTDA 2E8AA 1R8HA 2QLJB 3VQ9A 4B9SA 5HROA 1JJ4A 4ECSA 4Z2XA 4B3TJ 3WZ0A 2NZTA 3A5MC 3ZX3A 1ZTWA 1Y10A 5IOLA 4IH6A 3UR0A 1I39A 3EPGA 3HYFA 5ETQA 4C0OC 3NDKA 3ET6A 4BQLA 2EBGA 4BG9A 2MSSA 4IOAL 3M8ZA 4LRFA 2HZAA 4ZITA 3CQXA 3V6JA 5KT4A 2GEMA 3TWZA 3K59A 1M1KT 1LXNA 1C0FA 3FR0A 2G8WA 3EXYA 4I67A 3L2WA 2H65B 3UKUA 4NLSA 4WF9Q 1YDLA 1RDCA 2W4CA 2F4VJ 1OJ4A 2CH6A 4K8ZA 1RHRB 2XCAA 2HQ3A 1H1VA 2D0CA 1WSGA 1VSEA 4PKIA 2MQOA 2ACMA 2IS3A 1FNOA 1RAAB 3WX8A 4JKAA 3TI0A 4QYRA 5KFZA 4B9LA 1CJUB 2J6SA 1CLQA 1U2RA 1R8AA 1U6BA 2BE9B 1NDPA 1IXKA 2QM1A 1S79A 2KTQA 2A6MA 1HI8A 5D78A 3P5TL 4CEFA 1U1LA 1X5OA 3C8YA 2Z0GA 4DV2J 3BN4A 2KHOA 4ZVRB 2M8HA 3AH6A 2ZM6K 2D3O1 2ZC3A 3OXGA 3K5MA 1HBNB 2CPJA 3N9UC 2IMWP 5AQGA 4G1PA 2OD6A 4GC6A 5KRTA 4CI0B 1ZBIA 3SPZA 2RQKA 1RKJA 4ZJLA 3ALYA 1WUUA 1NK7A 1NJIO 3O9UA 4X4PA 3S1TA 1FK9A 1VCTA 2HK3A 3W61A 1S6PA 1MMLA 3T7ZA 3KXDA 4RW6B 2ABYA 2YWKA 2DGTA 5DM7Q 4RW4B 2OPSB 2F5GA 4O0NA 4OHYA 1KXPA 1LOTB 2SXLA 3NH2A 2JSXA 2D4WA 1U8SA 3R5CA 1S6UA 3HJVA 3NNCA 4L6V3 4JI1J 1IV0A 1IJEB 3NH0A 1GLLO 5GAEP 2MPUA 5H9EK 2ZFHA 3CETA 3HD2A 1RT4B 1S1TA 1N5YA 4ZPBA 1FJGK 3JSMA 1VK8A 4USVA 1XNQK 2DHGA 2RF2A 1U2VA 3OTEA 1JLFB 4CBUA 3IKMA 2YNHA 1R0CB 2FVPA 5AXKA 1LWEA 3N28A 4FYDA 4BR7A 2O8DB 3DLLL 4KHPJ 4CHNA 2R7SA 4CO0A 1K9MO 2Q6BA 4F4XA 3MGJA 3SMPA 4RX6A 4DV5J 1KLNA 1ZA2B 2E1AA 3C15B 4ECYA 1V6HA 3C66A 3ETMA 1YI2S 2WC9A 3ZZRA 5AQUA 4B9VA 1FD8A 4YR0A 2IDLA 1MMDA 2V2VA 3DYAB 1N8RO 2MQPA 1CULB 3BDEA 1CQNA 3ZT0A 2W7OA 1HKGA 4DV4K 4RW9B 4PWWA 4O0IA 3D2WA 3CJBA 5LMUJ 3VESA 2QG9B 3ZFVA 3RAMA 5J2QB 3CCMN 5D3GB 2J0SD 4E1MA 3OYEA 1FF2A 4FXWA 4NLPA 3GJQB 1GAOA 2QZ8A 2BM0A 1PILA 1XNRJ 2V8PA 2B9YA 4WCEQ 3VPZA 4FLUA 2GIFA 4OI3A 4NCGB 4KIAA 4NXNJ 3KLGB 4AHVA 3C6UA 4M94A 3FSIA 3L4BC 3QGIA 5DG9A 5KFYA 2V68A 2GWKA 3A8JA 5KRSA 4LFCK 2F8HA 4YOWA 3ZX0A 2O4IA 4LD0A 2EK1A 3MM9A 1VQ9S 3NGIA 1RHJB 4IQMA 1J5OA 2OD4A 1SKSA 1BDGA 1WACA 3CCLS 3HRGA 1QVGM 1UVJA 4KB7A 4AD6A 1RILA 1IG8A 5DLFA 2KHDA 3BGFA 4Y2MA 1Q8BA 2I8EA 3ADAC 4C8YA 1I1GA 2EVZA 2KLAA 2Z56B 2VPYB 4ATNA 3DRSA 2MMYA 3SI8A 5B0BA 1KDNA 1NGAA 1YF5L 4M3ZA 1OY6A 3G86A 3BGOP 3D6MB 1TAUA 2V7YA 2UU9F 3MN6A 2IVYA 4CGGA 1HPZA 4PL7A 1S1WA 3L3UA 3SCKE 3WXMB 3M8QA 3BB5A 2F8MA 3GG0A 4L75A 3VQ7A 2BABA 1A7GE 5CYMA 4QJVA 2BH1A 3KG4A 4CLFA 2GQCA 5LL6Z 2I1RA 3AVNA 5EN1A 5KFNA 3ZSYA 3OYMA 1QSLA 3JAMO 1VSDA 3OYGA 1GH8A 3QEIA 3G10A 1YBUA 1VSMA 5KFRA 2I7PA 1LAVA 4CEBA 2E66A 3JXOA 4WWSA 3VAHA 4GC7A 2HYIB 4BG8A 1RCXB 4UT4A 4WXOA 4XPCA 4L3QA 4J9UE 4YQWA 4JYAK 2U2FA 1BWFO 1Y9OA 4X2BA 5BPNA 3D1QA 1HNIB 2YV0X 3DRRB 1SV5B 1B92A 1KFDA 1RDRA 4RL1A 3KK2B 4L8RB 4MIBA 1NSAA 1K1SA 2ZE2B 2CFXA 4FF3A 5AQXA 1L3TA 4QBUA 3VF0B 3BBBA 3PO4A 3PSFA 3T1HF 1NZAA 4J8FA 1RTIA 2PMZD 5I3QA 4JP8A 3HDSA 2AMCB 1RT7B 1S1VB 2HAIA 3QRPA 4EIAA 2RDIA 2RILA 2YHWA 3TW0A 2QV6A 3Q0AA 4O4RA 3E1YA 4DUZK 4LSLB 2E1ZA 1NH8A 4CJ5A 1UP1A 2GMJA 4XO0A 2E5JA 1VRTB 4HHTA 4BRMA 3AAWB 2XY5A 1M5HA 1S0NA 1WSJA 2P9LB 4ITSA 1D8ZA 1E4GT 1S10A 4OQJA 3EDRB 4CZEA 4PXCA 4DV3K 4KHNA 3ZTRA 1CSJA 4KBOA 3SUPA 4DHYA 3QJLA 2WBNA 2ZDPA 3GCWP 3J7ZT 2FVQA 1NEEA 1R43A 4C8NA 1UVMA 5F8MA 2PO4A 5KPRA 3DXMB 1FJGJ 3EN9A 3H6EA 1KC8T 1RBOB 2UUCJ 3JAMY 4BRHA 2E9ZA 1VJWA 3IM9A 5A0YA 1FTRA 1AFIA 1SJ3P 2B5JA 1FTCA 4LRAA 4C11A 1F21A 4ELVA 1ZBLA 1W2BR 1T3NA 4PRFA 3BREA 1P90A 1UZHA 3O3LA 4ZTJA 2DY1A 1KOOA 2CPFA 4AH9A 2KVQE 4JI0J 2O67A 3OBYA 4KHWA 1U7LA 2RN2A 4Q5VA 2P9KB 4KRWA 1W97L 2XLJA 2VPZB 5IQ6A 4CNYA 4CJTA 1FWLA 1EZZB 4KGKA 3LAKA 1NJIT 4QPXA 2XYPB 3SCJE 4ANEA 1TELA 1BUPA 5EU7A 3IO1A 8RUCA 2FB0A 4ZP6A 3ZZOA 1UA1A 5KFIA 2FBXA 1S4EA 3Q8QB 1ZM9A 1KC8O 4M5DA 2E5LF 1CPZA 3CCEN 3PYFA 2OMLA 3H3NO 1N48A 4NLGA 3HSTB 2RB7A 1NKCA 1Q18A 3KNAA 1IUJA 1S9GA 4JI7J 3M1VA 5D4NA 3DFEA 2R4FA 4JI6J 5MAOA 4FLXA 1TV6A 2FJXA 1AW0A 1X0FA 2B4UA 3UNGC 4DUZF 1UVLA 5KPTA 2UYTA 5DMRA 3J7A1 4H4OB 5ETSA 2QXFA 1U1NA 3UN5A 2K7JA 1CJVA 3W5ZA 2HFVA 5J1EB 1GMWD 2DB1A 3LWLA 2JEIA 3C19A 4W5QA 3TQEA 2FSKA 1WNSA 3GL1A 3PIPL 1FJEB 3UN3A 4NLXA 5KFOA 2BKNA 4LIWA 2O01C 4GKJF 1KLMB 2DNPA 2ZF5O 4ZDNA 4I6MA 2OFGX 1RA7A 4ED8A 5B8HA 2UUBJ 1UVIA 1LWFA 1B9FA 4NXNF 2DPNA 4ZP8A 4J9OA 4G9ZA 1N36K 5I42B 3EGNA 5HN0A 3I96A 3WUHA 3R6GB 4ZLPA 1NOZA 1Q7LB 3WNFA 1H72C 1KNZA 1SJRA 3K8VA 3HXMA 4M3UA 3FZHA 5AQZA 4AL7A 3OVAA 2MB0B 2RKIA 3TUPA 4GVBA 1RT6B 2CNNB 1V3SA 2WVFA 5KFGA 5J2MA 2NUHA 5A8WA 4ZPAA 2RE1A 2VBZA 4GKKJ 1K9MT 2OTJN 5EWGA 1SUQB 4OPHA 2DY9A 5KGWA 2LQ9A 4Y28C 5M1FA 1ZTTA 3IG1B 1RWKB 3Q83A 4QWAA 3ZZPA 4DV4F 5GINA 3IXQA 1KEKA 4K4UA 4E89A 4YDDB 4FJJA 2G1HA 1HARA 1EETB 1O5JA 4JK9A 3RR8A 1NM1A 4KHPF 3QGGA 4WFBL 3EYZA 1TKZA 3PHEA 1T9YA 4B3SJ 5HBMA 1GXUA 4DV6J 1WC4A 2OEJA 3R7BB 4LJMA 4DTOA 1RU1A 2PT0A 4D3GA 4L3NA 1VQ7S 5EGYA 4GKKF 4ZTFA 2YNIB 2A5XA 1F6TA 5FPDA 4RUHA 2HSEB 3GILA 3CVKA 1CQMA 2A2CA 4JI8F 4CZMA 4M5NA 1CEZA 4B1UB 3P6YC 1DT9A 4FVUA 4NWBA 1HYVA 3OYCA 3CWJA 1RHUB 5E7OB 4O3PA 2YWHA 1J53A 2AJ2A 3DOLA 3I0RA 1YJTA 3AY0A 1FJ7A 1S48A 1O0PA 4F4AA 4NZ0A 4DUYK 2KG1A 4JI7K 4QWBA 4C8LA 4Z7CA 2GWJA 3VQSA 1DTTA 1RAEB 3RZAA 2CNOB 3O4NA 5KFHA 4DX8H 4FYYB 5BYQA 4X62K 2EFGA 1QDUB 3BO4A 3KDNA 1T9TA 3MAAA 2IVFB 3CJ4A 2QL9B 4G1QA 3VA3A 3ID6A 4C23A 4WK1A 1CVJA 3Q8YA 2LA6A 4B3OB 2MKSA 5SZTA 4B8AB 3QBWA 4C3LA 3HOTA 5AE3A 3NGDA 2KFZA 2OEKA 3NP5A 3KD5E 4UW2A 4ZVOB 4TSXA 2CH5A 1VGYA 1EARA 1ULRA 1V9OA 1HBNA 2I5JB 4ER8A 1UW4A 2KW4A 4CF9A 5KG5A 5HSPA 2K06A 4TY8B 2KVIA 1DARA 1JB0C 4B3TK 5JS2A 1IBKK 4O3NA 4OHZA 4RBUA 4DJBA 3NXZA 3NL0A 2MKHA 4U7UD 4M95A 3BYRA 3JYTB 1MWMA 3Q8UA 3PX4A 2E29A 1LKZA 3L95X 2HBQB 3VEWA 4FJNA 1X4HA 4BRGA 2HWHA 2IIHA 2F8SA 2G9OA 3W62A 4ICLA 3SCXA 5KFFA 4JI5F 2XS5A 3HHLA 2DR7A 2E2OA 5HRPA 2BQ3A 2UP1A 3KNGA 1OMSA 2DH7A 4IEIA 1C0TA 1UAWA 4E7HA 5D0EA 2DNZA 3NCIA 3OXFA 4OI4A 1TL1B 2ALZA 4HVZA 3CCLN 1F3FA 4DHVA 1W2IA 4LUBA 2QA4G 1PAUB 4F3MA 1CC7A 1TK5A 2RUGA 2NZCA 2H4WB 3FCWA 2R2RA 2V2ZA 2QWLA 5DZ6A 3J81U 1VK3A 1VHFA 4DBQA 1KVJA 3C7NA 2Q79A 2R7TA 3KUGA 3MN7A 2VCPA 2CPEA 1DBDA 5HMYA 1XNRF 2Q0UA 2JRSA 1RAFB 3H5UA 3NOGA 1N6QA 2A1SA 3LGHA 1FWPA 1C1CB 5L8RC 4A8YA 1RU2A 3TA2A 2QT7A 2E1RA 1GMVA 5AT1B 3Q24A 3PDNA 4P52A 1RWWB 1SCJB 5CZXA 3ZSXA 3DYAA 2FZCB 4ZVSB