2HNZA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnzA05
2AQ4A 4FJ9A 3L3VA 4IRCA 4B3OA 5JUMA 1RT3A 2RDIA 1RBVA 3AVIA 4KE5A 1RT6A 1I6JA 3HPOA 2G8HA 4O4RA 3C6UA 1KLMA 3QIPB 1U45A 4ZP6A 3NBPB 4E0DA 3SUQA 1BQNA 3V6DA 2FBTA 4FW1A 2HWHA 5KG7A 3MXIA 2V4QA 3ICLA 3RB3A 2XY8A 4KV8B 3V6JA 1FKOA 1RILA 1HQUB 1IKYB 3KIOA 4ID5B 2R2RA 3KD1E 3H4DA 3KLVA 4E7IA 3OJUA 1YT3A 4CESA 2J6UA 3GIIA 2RKIB 1RTJB 1U4BA 4DS5A 3DOKB 4BE1A 2AGQA 4FJJA 4MK8A 3TAMA 1X1PA 2HVIA 4I2QB 3OS0A 1RAJA 3H40A 1RBRA 3KJVA 3KLEA 5KFRA 4FJNA 2RF2B 2E6MA 1J54A 3M8PA 3PHEA 3IRXA 3TAEA 4CJTA 4PWDA 4CJRA 4ED7A 3VN5A 4HHTA 2DTUA 1RTDB 5I3UA 4RW8B 1S49A 3JSMB 3QYYA 5KFGA 3OJSA 3ZT3A 1RDBA 1WSJA 2W9AA 2XRIA 1KVCA 4CGIA 4H4OB 1NK7A 3KTQA 4IR1A 1TKTA 3IG1A 1J5OA 5KFXA 4FLZA 4DG1B 2G8KA 4K50A 3AA2A 3DI6A 2C2EA 1S1XA 5DK5A 4KB1A 4CF1A 3PX6A 3AVLA 1ZBIA 3G10A 1S10A 4GVMA 2O4GA 5DG7A 4ED6A 1B9DA 4IG3B 1C1BB 4ZPBA 3DOLA 3WNGA 5KFZA 4X2BA 3G6XA 1HYSB 3ZSYA 3EYZA 5K14A 3NF6A 1EETB 2C2RA 2NUBA 1HJRA 3IAYA 2OPPA 5F8NA 5J2NA 3SPYA 5C42A 3AO2A 4FLWA 1SH0A 3HK2A 4NLQA 3ZT4A 3BJYA 1BGXT 2DY4A 3M8QB 4KHQA 4R5PB 3KD5E 4KRFA 4B3OB 1JLGB 3T5HA 5F8GA 4GC7A 2EHGA 4CK1A 3VQBA 3OHBA 4FLVA 1RT6B 2Q3SA 1TK0A 1TL3A 3H5UA 3AVHA 2GBZA 3C95A 1BQNB 3B6PA 1DTQA 2YHAA 4B9NA 3KOAA 3OYKA 3VQSA 1JX4A 3U3GA 1C0TB 1QS4A 2IAJB 3V1OA 5DGBA 4ZMMA 4DSLA 1TVRA 2YV0X 4YQWA 4FJ7A 4ZTFA 2AGOA 4CJ3A 1ASUA 4RU9A 2D0CA 3I0SB 1VRUA 1KHVA 5EUHA 3PX0A 2D0BA 5DG8A 4GMJB 3PR5B 4ECXA 4AHCA 4RW9A 4FJXA 3TWHA 2OYQA 3VQ5A 3BGRB 3HKWA 3KLEB 5HRSA 3M8PB 1SKRA 3MECA 4PWDB 1QSLA 5I3UB 1D0EA 2IS3A 5KT3A 2BRKA 1R0AA 3QIOA 5KG4A 4O0IA 4FBTA 3ZSRA 4DTXA 3PZPA 5KFAA 4ZP7A 1S1XB 2VG6B 3SPZA 3HO1A 4KKOB 1KVAA 4Q5VA 4J9QA 4NYNA 3G0ZA 4CF9A 4RNMA 5KT7A 1U49A 3Q8SB 3DOLB 3ULDA 3K5NA 5HROA 3LWLA 4O3SA 4WXOA 4O3NA 1NK9A 4Z4CA 1D9FA 2ZKUA 4DL3A 2OH2A 5J2NB 3PJWA 1TL1B 3ZSOA 4F3OA 3T5KA 2VWKA 3OYAA 4FLXA 4IH7A 5KFNA 1GX5A 4K8ZA 3T1AA 2GV9A 3VQ4A 4KI4A 4Y2AA 3K59A 4E7JA 4MFBB 2X78A 2FBVA 4OLBA 4O0JA 2HMIB 2QKKA 5DLFA 5KFEA 3QNOA 1BCMA 3LANA 2IM2A 3CJ4A 5HRRA 4NLSA 1L5UA 5KFJA 4DTJA 3GV8B 4Z4FA 5KT6A 3LAMA 1TKXB 2OPRA 4FJ5A 2WONA 1RT2B 2JGUA 1S97A 1TAQA 4N41A 3IS9A 4F2RA 5KFYA 3DMJA 1GX6A 4KTWA 2PZSA 4ELTA 3QZ7A 2YNFA 4WYWA 1N48A 4DFKA 5D3GB 3DRPB 4W5QA 3OYDA 1S1TB 1HPZA 2IM3A 1JLEB 1RDRA 2E9TA 4TY8B 1NJXA 3SQ0A 3LP0B 1RT5A 4CFDA 3P5JA 2W9CB 1R0AB 4I2PA 4J9LA 2UVWA 3LALA 1HNVA 4DF4A 3RRHA 1C1CB 5DQHA 3BR9A 4M94A 2V9WA 1QTMA 4WXWA 4CJFA 5CZ1A 3K58A 5KFKA 1SH3A 3BQ1A 1S1UA 5J2MA 4FK2A 5HROB 1IG9A 4DQIA 1NKEA 1DLOA 2FVRA 4J9OA 3AO3A 4Y34A 3AVBA 3UQSA 1S6PA 2IM1A 1RCHA 4W5TA 3LWMA 4IRDA 2WCXA 1T03A 3N6MA 4CF8A 4O3RA 1SV5A 2BRLA 5DG9A 1S1WA 2BDPA 4K4XA 3OS2A 4HKQA 2EX3A 3MF5A 1GOCA 3IGVA 3BSOA 5KFCA 5KG3A 2CJQA 4FLYA 4E7LA 5CYMA 3E01A 3KK2B 4CJQA 1VSFA 5T14A 3QINA 1JXEA 4H4MB 2HNZB 1IH7A 2B6AB 2O4IA 4QWAA 4FM1A 3LP2A 3K57A 4ECRA 4DFMA 2WB4A 3SUNA 1S9GA 4E1NA 4DQQA 3RAQA 4FW2A 4M3WA 3F9KA 1DTTA 2WRMA 2ASLA 3NH2A 4IDKA 3IS9B 1RBUA 3ISND 2BANB 4DEZA 4DL2A 4RW7A 2XY5A 3QGIA 3N6NA 1C0UA 2XGQA 1FKPA 3BREA 3Q8PB 4N47A 4E7KA 2J6SA 1XR7A 3DM2B 2JEGA 4OPJA 5FDLB 4H8KA 2B4JA 4G1QB 4F4WA 1T05A 2QV6A 1S9EA 4HYKA 5J2QA 2G8VA 4ZVEA 2BQUA 3PR4A 4NYFA 3TVKA 1HNVB 1LW2A 4BWMA 2VG7A 4DTNA 4TQRA 3FQKA 5KT2A 4U7CA 3F73A 4JRPA 5KRSA 1LAWA 4YR2A 4NLWA 2QXFA 2R2SA 4ZVHA 5J2MB 1D1UA 3CDWA 4MH8A 2FJWA 2UVVA 4ZPDA 3NAHA 3HL8A 3I5AA 1J53A 4CCHA 1LWFB 2IJFA 5KFSA 2P5OA 3QLHA 2FVCA 5CZ2A 2IBKA 4CE9A 4IFVB 1MMLA 2D3ZA 4KB7A 1IKVB 1S1VA 3QO9B 1D8YA 3THVA 3GILA 4LQ3A 1RT1B 1QAJA 3FFIA 3CFPA 4CJWA 4KHRA 1FXXA 4EP5A 4DTOA 4FLUA 3KKRA 4IG0A 3KLGA 1WSFA 1NJZA 4M3ZA 3D0PA 4NCAA 3C6TA 1ZETA 4EO8A 1SKWA 3LP2B 3HXMA 3GIKA 2XO7A 4ECYA 1HNIA 1RTHB 5EU7A 4DSKA 2FLPA 1W9HA 1S0MA 1DTTB 4LSLA 3NL0A 4CJEA 2E6LA 4IDKB 1XHZA 4QOZB 3NF8A 5EWEA 3NGYA 4NCBA 3QESA 3S3OA 1JLAB 2BR0A 3KLIB 4HUGA 1C0UB 3SYZA 1WSHA 4NRTA 4TLRA 1S5JA 2YKNA 3LZIA 2DPIA 1WSEA 4ZP9A 3T19A 3I8DA 4ICLA 2IDOA 3AVFA 3VQDA 3T3FA 3PO5A 1CLQA 4F8RA 3NF7A 3O4NA 4Z4EA 3V9ZA 1SUQA 1S9EB 4EYIB 5J2QB 4MIAA 2VA2A 1MU2B 4C8NA 4L8RB 1LW2B 2AU0A 4PQUA 4DTPA 4CHOA 4U6PA 2HW3A 3I0RB 1OS5A 4PY5A 4W5RA 3VQ7A 3CWJA 1RBSA 1ZBUA 2F8TA 4F50A 3IN5A 3OYLA 2D5RA 1REVB 4ZHRA 5KGXA 1SKSA 3AVKA 4IFYA 1D5AA 3BQ0A 2WOMA 4DTSA 3ZSZA 5KG0A 2BQ3A 4CEAA 1WNSA 2XHBA 4B9VA 3HVRA 1J9AA 3SV3A 3MFHA 3QLHB 3RR8A 4XPEA 4WFYA 4ED8A 4J9KA 4I9LA 4N56A 5JXSA 4B9TA 1BIZA 2WK4A 4J2EA 3QIDA 4NLGA 4ED1A 5HLFA 3G86A 4Q44A 5FRMA 3RMCA 4BDPA 2X6SA 2AJQA 1LWCB 1CZ9A 2HHVA 3LP1B 3FFIB 1TV6A 1TKZA 3BSAA 1NJWA 3KLGB 5KFDA 4JRQA 4TSXA 1RT7B 1WAJA 1I3AA 4DU1A 2FVPA 4CFAA 3C6TB 2W42A 3KLHB 1SL2A 4C8LA 4E7HA 4YP3A 1HNIB 3LP3A 4LSNA 4TYBA 3ZT1A 1S6QA 1WAFA 4MKAA 1UWBA 4WE1B 5J1EB 4M3UA 4CFBA 2YNGA 2ZD1A 1L3UA 4OVLA 4QWDA 4Q0BB 4DF8A 2YKNB 3D28A 3FRZA 1JLFB 3VA3A 4KFBB 5FROA 3NGIA 2R2TA 1S0OA 2UUTA 1U09A 4O55A 1SUQB 1A5VA 2HNDB 2F8EX 4TQSA 1EP4A 3M9NB 2B43A 4K4TA 3RBEA 1HQEA 5F8HA 4ECSA 4NLDA 1VRTA 3OYGA 1RT3B 4Q43A 1KVBA 4KAIA 4IBNA 4CEEA 2OA8A 2PYJA 1CXQA 4ZHRB 4N76A 4H54A 3DLGA 3MEGA 4JLHA 4DQRA 1YVFA 1IKXA 3C6UB 1KLMB 3HT3A 3M8SA 5KFTA 1JXBA 3HP9A 4FLTA 3CM5A 5KFUA 3CJ2A 3V6DB 4KTZA 3RB0A 5HBMA 4O4GA 3HJFA 3H59A 4JV0A 3RB4A 4CK3A 1FKOB 3CFOA 2XGPA 4Q45A 2HB5A 4DTRA 1T94A 3GIMA 3VQ9A 1XWLA 4B9UA 3HPGA 2V0NA 4TN2A 3AVGA 1K1QA 4R8UA 2HHUA 3KKSA 4NYZA 4CK2A 1QSSA 5F9LA 2WHOA 3LZJA 2OPSA 4I7FA 3RTVA 3TR8A 3MAQA 4EBCA 3NCIA 3GYNA 4YMEA 4MK7A 4KAZA 3DLEA 4ECUA 2I5JA 2FLLA 2YNIA 3TAMB 4B8AB 4F4KA 4Y1DA 3V81A 3EY1A 3MR6A 3NH0A 1HMVA 4F4ZA 3KJVB 3SI6A 4RUAA 3EPIA 3IRXB 3DYAA 1Z4UA 2Z1HA 4RW4A 4M95A 2HNYA 3HM9A 3CJ3A 3PW4A 2OPQA 4FZYA 3H98A 1XI1A 1BHLA 5KFVA 3MXMA 4LSNB 2A1SA 1U48A 3JYTA 4CJLA 4BACA 3NAIA 1TKTB 1KFSA 1S6QB 3IG1B 1J5OB 4FJ8A 3H5XA 4FZZA 1ZTTA 3V1QA 1S0NA 1RA6A 4DU4A 4DL6A 3DI6B 3CM6A 1B92A 1W0HA 3LAKA 2G8UA 1QQCA 3ZSVA 2BQRA 4CIFA 4O3OA 4QWBA 4FXDA 3KK3A 5SZTA 2OZMA 1RNHA 4Y3CA 5K14B 2XCPA 1U04A 4QCLA 1EP4B 4O3QA 4OGEA 2OPPB 3SFGA 4HVJA 3DDKA 3S9HA 4C8MA 3EZ5A 3O3FA 4NLOA 5C42B 1JLQA 3RWUA 4YNQA 1HARA 5EWGA 1Q9XA 4Z0UA 1C2PA 1VRTB 5KFBA 1U47A 1FK9A 2JEFA 2YHBA 2AWZA 4B9LA 3DLGB 3MEGB 2I1RA 3UPFA 1TL3B 1F21A 3OYFA 3ISNC 3T5JA 1T7PA 3V4IA 4LH4A 4CHZA 2FBYA 1DTQB 3BQ2A 4RG8A 2ILYA 3H5SA 5FRNA 3OY9A 1TK8A 3MR5A 3K2PA 1TVRB 3RBDA 1SH2A 1S4FA 4CGHA 2A1RA 4B8CA 3FQLA 3TAPA 4WYLA 1KRPA 3QEXA 3CDUA 4Z4GA 4I7FB 2F96A 4M3XA 3KMSA 4RNFA 1VRUB 3L3UA 4FM0A 3O3HA 4ED3A 4FJMA 4B9SA 4CIGA 3V81B 4RW9B 1RDDA 4CHPA 1HMVB 2AGPA 1ITGA 3PJXA 2EC0A 3DYAB 1ASWA 4IRKA 3MECB 5KI6A 3LDSA 4CJPA 4JV1A 3PVXA 2W8KA 3JYTB 3K5OA 2HAIA 2VA3A 5EDWA 4NCGA 2FBXA 4F2SA 1RT4A 5KFMA 3NDKA 1NK5A 5KTQA 4PUOA 1IKWA 3ZSXA 1EKEA 1KHWA 4BE0A 4OJRA 2AX1A 2E4LA 3AO4A 5KG6A 3KHGA 3PV8A 2D7SA 4M3TA 1NOZA 2RN2A 2Z1IA 5C25A 2ATLA 1HYVA 4RNHA 2KW4A 1WN7A 1QE1A 4NLTA 4DLEA 3OSNA 4CFCA 2R8KA 4WZMA 3HVWA 3OYIA 4DMNA 3PW7A 2ITGA 4FZXC 3AV9A 4WZQA 3L2RA 2IC3A 4BDZA 3M9OB 4FBUA 2W7OA 3C94A 3PW5A 2D0AA 2VG5A 4UQGA 4NLUA 3E51A 3CJ0A 1T8EA 1RBTA 4MIBA 3KLFA 3NGDA 4CJUA 4Y2CA 2OPRB 2FVSA 3OLBA 1VSHA 2WONB 4CF0A 5E41A 1NK6A 3M9MB 1RDCA 3DMJB 3NH1A 4K4ZA 2W8LA 3HVTA 3CVKA 3KHLA 4ECQA 1N56A 4EYHB 2YNFB 5CYQA 2X74A 1N5YA 1D9DA 3SNNA 1ASVA 4LH5A 3MEDA 4RW6A 1HPZB 2YKMA 1TQLA 5C24A 4GW6A 1L3TA 1BL3A 5HRPA 4DL4A 2FLNA 1RT5B 4CJVA 4CHQA 4I2PB 1JLBA 3GV5B 3WNHA 2W7PA 4FM2A 1VSLA 4OLAA 3RR7A 3IGNA 4KO0A 5L1JA 5J2PA 1Y97A 4URGA 5KT5A 4DS4A 3SV4A 3DRSA 3CJ5A 2LSNA 1S1UB 1TGOA 3QERA 4F3TA 3OL9A 4XIUA 4C8KA 4IQXA 1LAVA 2HHXA 1DLOB 1JLCA 1IM4A 3L8BA 3KK1A 5CY4A 1S6PB 1NK0A 5DLGA 3V1RA 5C25B 2HHSA 2G8IA 1T03B 2FJVA 1S9FA 4F4YA 1SV5B 4CECA 4HTUA 1S1WB 3QIPA 1KCFA 3KHHA 1C0MA 2HVHA 3NBPA 3QEIA 2KZZA 3TAGA 3L2VA 2CKWA 4O5BA 5F8JA 4KV8A 1HQUA 5CYMB 3E01B 4IH6A 1VK0A 3VQAA 4QAGA 3T5LA 2J6TA 3OHAA 2XI2A 3L2QA 2RKIA 2BE2A 1N6QA 1RTJA 1YTAA 3VQ6A 3KNAA 3DOKA 1S9GB 4ELUA 1BCOA 4NLVA 4AHSA 4I2QA 2RDJA 4NRUA 5F8IA 3PX4A 2B5JA 3B6OA 2DFHA 2C28A 4AHRA 4QWCA 4RW7B 1RTDA 4CEBA 3JSMA 5EWFA 2QE5A 1FKPB 3RAXA 3D5MA 3SZ2A 4H4OA 1NHUA 2YKMB 4TY9A 4FYDA 2ZE2A 5C24B 3VQEA 2R2UA 4CEFA 3ITHA 4DSEA 1T05B 3NGZA 3OLAA 1ZTWA 4CGJA 3PY8A 5KFFA 3QEWA 2FJXA 2VG7B 3SCXA 4IG3A 1JKHA 4DFJA 3NF9A 2Y1JA 3HYFA 5F8MA 1WNEA 3ZSQA 4DU3A 3PO4A 4DTUA 3PW0A 4Q8EA 1HYSA 3GV7B 2ASDA 3BDPA 4QPXA 1LV5A 5F9NA 4EO6A 1EETA 3FSIA 3TANA 2E9ZA 4URSA 4KB0A 4KTQA 2ETJA 1JLCB 5JS1A 3KK1B 3M8QA 4R5PA 1WLJA 3TAFA 3DLRA 4MKBA 5L1IA 1JLGA 3QNNA 3CYMA 3TAQA 1S1VB 3P83D 5HP1A 4OPKA 1RYRA 2GUIA 1L3SA 2HHTA 4M42A 4JS5A 4ED2A 4LY7A 5SWMA 4FJIA 4IG0B 3L2WA 2D3UA 1C0TA 2IAJA 5T7BA 2FVQA 4RZRA 1CXUA 4O44A 3CIZA 3AO1A 3AVMA 1QHTA 4YR3A 2BE2B 1N6QB 2AX0A 3I0SA 1VSDA 5L1KA 3AA5X 3V9XA 1QSYA 3TQ1A 3NFAA 4W5OA 2HHWA 2XY7A 1A5WA 4LSLB 1NKBA 5DQIA 4LD0A 3S3NA 3BGRA 4J9SA 4URQU 3NMAA 3H08A 3OYJA 3A2FA 2B5JB 2PYLA 3Q8RB 4FK4A 3M8RA 2IJNA 4ZVGA 4XPCA 4K4WA 4MQ3A 4EZ6A 1UA1A 4JV2A 2XI3A 2ZE2B 4ZVFA 2PY5A 1LW0A 4DQSA 3ITHB 1Z25A 4F4XA 4ICLB 3FDSA 3VQPA 2WTFA 5C5JA 2VG6A 2R8IA 4KKOA 4XO0A 3UR0A 4CF2A 3SUOA 4PQUB 3O4QA 4HCCA 1K6YA 2ALZA 3AVJA 1JKHB 4KHSA 4ECWA 1UA0A 1QAIA 3CQ8A 4WFZA 4BWJA 4E1MA 3SQ4A 2R8GA 4CGFA 1NJYA 3OL8A 2W9BA 4IFYB 3QZ8A 3SQ2A 2WOMB 1KLNA 4K4VA 1TL1A 4ECTA 4AH9A 4CJ5A 4EP4A 5KFWA 2RPIA 3HHKA 2YNHA 4FJGA 4E19A 4DL5A 4Y1CA 4M41A 4KHWA 4MFBA 4C8OA 3BSNA 1N4LA 4J9NA 3V9SA 2XC9A 5KG5A 1ZBHA 2HHQA 2HMIA 3CO9A 5HLFB 5HP1B 3LPTA 4TXSA 1HYZA 3G6VA 2JC0A 4DFPA 2KFNA 1TV6B 4RNNA 1VSMA 1TKZB 4ED0A 1XR5A 1KTQA 1S48A 3K5MA 4QW8A 1TKXA 1RT2A 3VQQA 4O44B 1WSGA 3OYNA 3V9WA 4KPYA 4GC6A 5KFIA 2IA6A 2XCAA 4AHVA 3K5LA 2KQ2A 4J9MA 3P1GA 4CEQA 4HUFA 4J2DA 1TKDA 4OGCA 5D3GA 1UWBB 3DRPA 1S1TA 4IH5A 1JL1A 2GC8A 1JLEA 2YNGB 2ZD1B 4TY8A 2IOCA 5HRNA 4BDYA 2ATQA 4DLGA 3CG7A 4AHUA 3AVAA 1O1WA 4G3IA 3LP0A 1JL2A 2W9CA 4IR9A 2XWYA 1IO2A 3PW2A 1VSJA 3MEEA 1C1CA 1Q8IA 1LW0B 3KHRA 3GIJA 4NZ0A 1C6VA 3MTKA 4W5NA 3DLKA 2KFZA 3AVCA 3NHGA 2G8WA 4J9PA 5KRTA 1BQMA 1BI4A 1NK8A 4ECZA 1NNDA 3ZT2A 1HQEB 4DWIA 2DFEA 4BE2A 2E9RX 2UVUA 2F8SA 2UUWA 5F8LA 2W9BB 1IKXB 3CFRA 1X9SA 4M45A 1NOYA 2JLEA 3WNFA 3O3GA 3QEVA 3I5CA 3CDEA 3ALYA 4JS4A 5HBMB 2YNHB 4O4GB 3NKYA 1TAUA 3H2LA 2P1JA 2JC1A 4I9QA 5KFOA 4MK9A 3OL7A 4E3SA 4R8UB 4RNOA 3KK2A 4IKAA 3HVAA 2GIQA 4K4UA 1A5XA 2R8JA 2XY6A 3RMDA 2OPSB 4H4MA 1ZBLA 4CJ4A 3GQCA 2HNZA 4DSFA 2B6AA 1UAXA 3DLEB 2JEIA 2I5JB 4DL7A 2YNIB 3ASMA 4CJSA 3RB6A 3UIQA 5I42A 4RW4B 4EBDA 2BANA 4JUZA 2V4RA 4LQ9A 2HNYB 3RRGA 4AILC 3AA4A 3VQCA 2OPQB 4AHTA 4M3RA 4FJHA 2VWJA 3TI0A 4CEOA 3QEPA 1XC9A 5DGAA 2Z1JA 4KSEB 1UOCA 3SFUA 1RTIA 3DM2A 1JXLA 4YR0A 3MXJA 3S3MA 5FDLA 4KREA 4DQPA 4G1QA 2D41A 1EXQA 5DQGA 3I5BA 1XR6A 4ECVA 2R8HA 1GOAA 3ZT0A 3D45A 2BGGA 1NHVA 4NLPA 3MEEB 4EZ9A 1Z26A 3KK3B 3Q8QB 4ZTJA 4CGDA 5KGWA 3DLKB 1EX4A 5KFHA 3LPUA 1VSKA 3N6LA 3AO5A 3HP6A 1VSEA 2P5GA 1NK4A 1BQMB 4Z4HA 1B9FA 3OYCA 1BI4B 3EPGA 5DMRA 4J2AA 1JLQB 4KHUA 5KFLA 1C1AA 5KFQA 1RDAA 1YVUA 1LWFA 2QKBA 4O3PA 4CIEA 4HCBA 2Y1IA 1FK9B 4EEYA 1YTUA 5L1LA 3TABA 4K4YA 1GOBA 4IFVA 1IKVA 4KHMA 4NLXA 4OL8A 3QO9A 3V4IB 4FS2A 1I39A 4K4SA 1KSPA 3V6KA 3OSPA 1RA7A 1RT1A 2IGIA 2G8FA 1X9WA 4FCYA 3AVNA 3ZSWA 4FK0A 3OYBA 4J9RA 4FJLA 3U6FA 2OZSA 3SI8A 3OL6A 1TP7A 3H4BA 4KBIA 4NLRA 1WSIA 2DPJA 3HSTB 1RTHA 2ASJA 4CHNA 2C2DA 1KFDA 4N5SA 2P51A 5I42B 4OKEA 3SJJA 4QWEA 5KG1A 4RUCA 1QUVA 3OYHA 4B08A 1X9MA 1JLAA 2KZMA 3KLIA 3SUPA 4KHYA 1TK5A 3MFIA 4FVMA 3QETA 4OKJA 4NCGB 1RT4B 1LWEA 2IMWP 1RTIB 3DRRA 2DFFA 1JIHA 3OVNA 4B9MA 4ZPAA 4PUOB 2QK9A 3AA3A 3VA0A 1IKWB 3MR2A 3MR3A 5L9XA 2ZQBA 1MU2A 2R7YA 2ILZA 3U3YA 1L3VA 1K1SA 4WFXA 3L2UA 4ZP8A 3I0RA 4IOBA 2FC0A 2O5DA 4FS1A 1NKCA 1REVA 1QE1B 2C22A 3V9UA 1W25A 1SL0A 4KI6A 1VSIA 4FJKA 2X6NA 3NAEA 2GIRA 1HRHA 3EZUA 4K8XA 4CGGA 3VQ8A 3QGHA 2IC3B 1CSJA 4PA1A 1T3NA 3RMAA 4J2BA 3BSCA 2IM0A 3RMBA 4Z4IA 4CHYA 1IKYA 4TYAA 4IKFA 3HPHA 3OYMA 4ID5A 2VG5B 3NE6A 1CZBA 2Z1GA 3QGGA 3OYEA 3UDLA 2JEJA 4R0EA 4ELVA 4CERA 1LWCA 1ZBFA 3LP1A 3KLFB 4EBEA 1XHXA 4DTMA 1RT7A 1G15A 5JS2A 4YFUA 2RF2A 4NLYA 4CJKA 3HVTB 4QW9A 4E89A 3KLHA 1RYSA 3SQ1A 3WNEA 5KT4A 3OS1A 5CYQB 4RW8A 4OKKA 1N5YB 3ZCMA 5KG2A 4ID1A 4DSJA 3H5YA 3MEDB 4RW6B 3TARA 5KFPA 2UVRA 3KMQA 4WE1A 5J1EA 4DG1A 4CEDA 1ZYQA 3PUFA 1Q9YA 1JLBB 2HWIA 1SL1A 4DSIA 4Q0BA 1BISA 1C1BA 1JLFA 1LWEB 4KO0B 3DRRB 3DLBA 4KHNA 5J2PB 4HUEA 4KFBA 1BIUA 3V6HA 3G6YA 4ZPCA 2KTQA 3DRSB 3DLHA 4M3YA 2HNDA 4Q8FA 4CEZA
chains in the Genus database with same CATH superfamily
4NYPA 1QLNA 3IRWP 3PNIA 3J81O 3LL3A 4C48A 1VJQA 1J2VA 3L3VA 2XYHB 1I1GA 3VHQA 4IRCA 5KPTA 1WI6A 4M5NA 1RT3A 4JV5F 4J91A 1RT6A 1I6JA 3C6UA 2XYGB 4B1VA 4ES3A 1P8GA 4E8UA 2VKZG 4PG4A 4BRKA 3SUQA 1BQNA 2P9KB 2CQBA 2BABA 5KG7A 1HWKA 3ICLA 5GAGP 3S7RA 3RB3A 4KV8B 1RILA 2OMLA 5FLXY 4FNIA 4DR3F 2R2RA 3H4DA 2ABYA 1MMNA 3KLVA 4GV9A 4E7IA 2KFYA 4CESA 1VK8A 2K1RB 3HHEA 3G4SN 2AKWB 4LF9F 1XNQF 1RTJB 2PDAA 3FGVA 3DOKB 1P90A 1X1PA 2HVIA 3L7OA 5HI7A 2B4PA 3HHLC 1TUUA 1RBRA 3KLEA 3UW1A 3R3TA 2RF2B 2YWHA 3SQGA 2E2NA 3AARA 3VN5A 4K0KJ 1S49A 3JSMB 1IUJA 4KC5A 5IQQA 2VFRA 5IZHA 2P9GA 2XMVA 2A42A 2KJWA 1J5OA 2CQ0A 5HL7L 4FLZA 1GH8A 3JSBA 3MM9B 4HI1A 3PRBA 2MPUA 3TPQA 2BKOA 2C2EA 3CCEN 5HANA 4CF1A 2RNEA 1G2EA 1B9DA 4F0KA 3QWUA 3P4UB 3DOLA 3JAMU 4NB4A 4YEAA 2NXUA 3VGLA 3D3CJ 4TU8A 2MQNA 4K2XA 4RPFA 2C2RA 1HJRA 1N5SA 3CCES 3J7Z5 5C42A 3AO2A 1U25A 3EXYA 4NLQA 1JXVA 3ZT4A 3BJYA 2DY4A 3A1YG 4KRFA 1KS2A 2EHGA 5ETMA 1SQEA 4FLVA 2AYMA 1VBZA 4JI1J 1TK0A 1TL3A 4X4OA 4WWSA 3MX5A 3CCTA 1VQLS 2GBZA 4NL5A 3T41A 3ULEA 1CBKA 2DK2A 2COLA 4MAKA 3DXMA 2DH9A 1NSAA 2IAJB 2YHXA 3GYXB 5BR8F 1TVRA 4YQWA 8ATCB 2BXJA 4FJ7A 1RQ0A 2AGOA 2PMHA 4ZIVA 3QJJA 2AP1A 2VU5A 2P9UA 4A46A 2MKHA 5HSPA 1MG7A 2A2CA 2D0BA 1HKCA 1B70B 3BBCA 1SQGA 2I8EA 4FPAA 3VQ5A 4TKTA 5HRSA 1QAXA 3M8PB 4DR1J 2I0XA 1SKRA 1J5EK 1PBAA 3O44A 4LF6F 2VL1A 1K8AT 3PRDA 1AUSL 3I56N 1R0AA 5AQTA 3BPDA 5KG4A 5LJ3Y 1WELA 3EVMA 2O8DB 2NUHA 4O0IA 3J7YI 2UUCJ 3ZSRA 2E7XA 4ZP7A 1ZM3A 4DV6F 4DR7F 4H4KA 3FUYA 4RUBA 1KVAA 3NGUA 1G6BA 2XMTA 4CF9A 2YH0A 3FBBA 4RNMA 5KT7A 1HHTP 4WKRA 3D1HA 2HBQB 4WCEQ 4B1UB 2D1CA 3R8EA 4MJKA 2N7YA 4MLHA 3D0HE 5ETRA 2OEMA 2ZKUA 3UE2A 2DIUA 3PJWA 2Q36A 5ADZA 3T5KA 4M7XA 2B9EA 3G8TA 2NRHA 2O3DA 1NXIA 4K8ZA 3LTOA 4DR4J 4GV6A 3VQ4A 4Y2AA 3K59A 2BJ9A 1YZ7A 1CS4A 1WHYA 3W2VA 5DLFA 4FPRA 2MXYA 3WQUA 2IM2A 2E5JA 2B7BB 3IO1A 2MQPA 4FZVA 5KFJA 1SJQA 3GV8B 3G25A 2XNRA 1Y5IB 3LAMA 2OPRA 2XMAA 3BGLA 4V19J 1OPIA 4LF8K 5CA5A 3IS9A 3DMJA 5FPMA 4P7VA 4DV0J 2DISA 2YNFA 4WYWA 3HF5A 3U1LA 3DRPB 1HBMA 1P27B 1S1TB 2AMCB 2JLFA 1HPZA 1HFEL 1CQNA 2D69A 4TY8B 3SQ0A 4EIAA 5F0WA 2DITA 2FDNA 2MKSA 4J9LA 2UVWA 1HNVA 2HKEA 3ZZYA 3F5TA 3ZTOA 4FWNA 5GAHU 3ZEUB 3T1YJ 3CMAN 1DEJA 2EWHA 1M5VC 3Q7CA 4NXNF 1VQNN 4UOFA 4QYRA 1IG9A 2Y0SD 3VEXA 3AO3A 4U7UD 3HJVA 4NZ6A 1FD2A 1PILA 3L95X 3N6MA 1UEKA 4O3RA 5ELZA 4OMFG 1G3OA 5DG9A 1S1WA 4K4XA 3OS2A 3CQYA 2CQ2A 1CULB 4PPDA 4CZKA 3O6WA 4JI8J 4FF1A 1IV0A 5MAOA 4LBHA 2VBXA 4F67A 2HPUA 3DJCA 1MROB 5CYMA 3KK2B 2KKZA 3N4QA 4CJQA 2BUNA 2YWEA 4MO5A 2YPYA 3ET6A 1VSFA 5LSLA 5LOQA 2N4DA 2HNZB 2R7RA 2B6AB 1FE4A 1R89A 2YKPA 3AAQA 1S9GA 4DPUA 4DQQA 3RAQA 5GADU 4M3WA 3N5BA 4HHJA 1DTTA 2QT7A 2L9DA 4JI5F 2ASLA 1RBUA 4DEZA 2BANB 3BH7B 5F3ZA 1IBLK 3MCMA 3ZNUA 1LNQA 4PXCA 2XY5A 3QGIA 3N6NA 3C7NA 5AZIA 1V4TA 4N47A 2ZH4A 4BS2A 1XR7A 4JV5J 4C2MA 1U1NA 2QV6A 1YDLA 1U2CA 1S9EA 3SDEA 4HYKA 2G8VA 1E6YB 3NNHA 3PR4A 5M1KA 1RHUB 2VG7A 2ROEA 4FKXA 5KT2A 2KRRA 2ADCA 3CCMN 2DGWA 4JRPA 1LAWA 4YOVA 1XNQJ 4C11A 3FCHA 2UVVA 3NAHA 1FRKA 3MWBA 3HL8A 1VIOA 3T69A 1HX1A 4CCHA 4KPCA 5KFSA 2P5OA 3ZYYX 3D3BJ 4OLPA 3QT7A 4DV2F 1MMLA 2D3ZA 1T95A 4KB7A 1IKVB 4ZVRB 3QO9B 3DHWC 2LEBA 3GILA 3G8SA 1RT1B 4OPAA 1MN7A 4NA2A 2FZCB 3IC1A 4L3KA 3UDEA 2HBLA 4FLUA 2V52B 3K9JA 4M3ZA 3D0PA 4A48A 4UUWA 3WEEA 4LF1A 3H45C 1MLAA 1HNIA 3AODA 3OFHA 1PGZA 2LFVA 1R8BA 4DSKA 3CE8A 2FLPA 4H0OA 1S0MA 2WB1D 2N7CA 4LSLA 4WFAQ 3NL0A 4IDKB 2J8AA 3V2UC 5A8KB 1QQOA 3O9UA 1R8PA 2CQDA 3TP2A 3S3OA 1JLAB 3SAHA 3KLIB 3WX8A 3D2FA 4JKFA 1C0UB 3GFYA 1KAYA 4WIIA 1FEHA 4TLRA 1S5JA 3CJAA 2DPIA 3D54A 2M70A 3TX0A 2G0CA 3G8QA 3I8DA 5A6WA 2MJNA 3PO5A 3NF7A 2X1BA 1KVJA 4Z4EA 5J2QB 4MIAA 2VA2A 2OELA 4KGVB 2KG1A 4NMLA 3HSCA 1LW2B 4JI7J 4PQUA 2J9EA 4U6PA 3I0RB 1OS5A 4PY5A 1RJJA 4W5RA 3HRGA 1VCTA 2MLZA 3R6LB 1MWMA 2YQ1A 3IN5A 3B8AX 2E1MC 4IOCQ 1O13A 2D5RA 1REVB 4ZHRA 1SPBP 1SKSA 3AVKA 2UV8G 3BQ0A 3KWGA 3CF5Q 3ZSZA 5KG0A 1RBOB 4CEAA 3PKMA 4HDHA 1FRMA 3GSDA 2J8SA 2IVPA 4XPEA 3KZBA 4I9LA 5JXSA 1R43A 1WWHA 3NWRA 1BIZA 2V51B 4LF6J 1XQIA 3I9V9 2VIHA 4JKBA 1VQOS 3W2WA 5FRMA 1NSKL 3FLCO 1FT8A 1OMSA 1CZ9A 2HHVA 4PL7A 1K9MT 3CCJN 4EUVA 1TKZA 2K2PA 4ED4A 4DV6J 5EHHA 4DR7J 5LL6d 4J7CA 2FHJA 3Q2SC 3WXJA 4DPWA 1I3AA 3N4PA 5HQMA 4LF4K 4A57A 1SL2A 1KQSR 3NCRA 3BYRA 4CLFA 1N0UA 4CLLA 3C6AA 4BR4A 5BYQA 3ZT1A 1S6QA 1TYQA 4MKAA 3BF3A 2QMWA 1J6ZA 4CFBA 4IYQA 5ETTA 1HNXF 4CP5A 2GMJA 3B78A 3MAAA 5BXIA 4DF8A 3UO0A 1RKIA 1JLFB 1P1TA 4DX6A 1ULRA 1EQYA 2KJVA 5FROA 2BMBA 2GJFA 4F4AA 2UUTA 1X5TA 1SUQB 2HNDB 2F8EX 5A8WA 1VHIA 1WC0A 1PC5A 4Y6IA 1NJIT 3R6GB 4ZJQA 3GLJA 1VRTA 2CPEA 2L9NA 3BS9A 3MM6B 4KAIA 4LF7K 2IDEA 2OA8A 1IR0A 1CXQA 4H54A 1T11A 1KLMB 2QA4N 4QOTA 1JXBA 3HP9A 3L3CA 2G2YA 3GL1A 4KTZA 3GG0A 5C2FA 4JV0A 2XG8A 4CK3A 4Q45A 2QWOA 4DTRA 3R7BB 4ANDA 4M5DA 3VQ9A 3J7YU 4C1NI 4TN2A 5BREA 1C0FA 2J7KA 4NYZA 3MAHA 1I5OB 2IVNA 4EBCA 3NCIA 3GYNA 5C0YA 2QTWA 4B8AB 4Z7CA 4F4KA 4Y1DA 5GMDA 3MMAA 1M5HA 4F4ZA 3KJVB 1SJRA 3NOGA 4ZPTR 2EG1A 4NXNJ 3HTVA 2P2CB 3HM9A 1QY7A 4PZVA 4FXWA 4KYZA 2JLGA 3PW4A 4LSNB 2BA9A 1U48A 4CJLA 4BACA 2DR6A 2ZH8A 3H5XA 3HSZA 2Z30B 1S0NA 2Q66A 3NMRA 1XNRK 1WOSA 2OCEA 4DU4A 3DI6B 2CPYA 2P9IA 3J80O 3I33A 3LAKA 1K44A 2G8UA 4DCOB 3K7RA 3W7BA 1QQCA 2HQ3A 4JI2F 3ADAC 4O3OA 3ENBA 3C16A 4F3MA 2NXCA 3KK3A 4X4NA 4Y3CA 1S79A 1BWVA 3SFGA 3LM2A 3NGSA 3DDKA 4C8MA 1W7AA 4NLOA 1Y10A 2W2MP 4V19X 5CABA 3RWUA 1ZM2A 4YNQA 3VEYA 1Q9XA 4Z0UA 4JI5J 4BC7A 1FESA 1VQSA 3N4WA 2YQ3A 5LMUK 1X0FA 3ISNC 3KG1A 3T5JA 2ZZNA 3V4IA 3F56A 2A3ZA 3RW6A 2ZH3A 2CYYA 2ILYA 4W4MA 5FRNA 1TK8A 3MR5A 3K2PA 3RBDA 1HI8A 2AIRB 1S4FA 3H46O 3ZZUA 4P2MA 3FQLA 4KGXB 4OZ3A 4WYLA 1KRPA 2CADA 1RHQB 3FBEA 3CD0A 3MCSA 3QICA 4CIGA 1RDDA 3EKUA 2P6SA 5D77A 4M63C 4CHPA 1Q78A 4JBCA 2HBYB 3FVYA 4LVOP 4IRKA 1VQ4N 1VLYA 2MZ1A 1XUPO 5HN0A 2V7YA 4OJGA 2E7WA 1M5PC 3K5OA 2KT2A 5H9EJ 2VA3A 2FBXA 4XH5A 2HK2A 4DV2J 2Y3YA 5KFMA 1BOTO 1CJUB 3NDKA 3BF1A 1XEZA 2ROPA 4PWWA 3W8GA 1A0OB 1VQ4S 3PTWA 3ZSXA 2YKQA 1EKEA 1URNA 1FVSA 2DNZA 1UETA 2H48B 3RU0A 1XMOJ 1Y0HA 2D7SA 3KKFA 2OHDA 3PIOQ 7FDRA 2WFBA 3K5PA 3CPEA 2MQQA 5C25A 2ATLA 2VV5A 2KW4A 2ZM6F 2HIQA 4CFCA 3RW7A 4WZMA 4LSZB 4AQYF 3PW7A 2ITGA 4FZXC 3FZBA 4CM0A 5DJBA 2F63A 2Q0RA 1IJEB 4Y0FA 4FF3A 3PW5A 2D0AA 4UQGA 2ZHAA 1G1XA 4NLUA 2OI2A 3CJ0A 3S41A 2OTJN 2YKAA 2FVSA 4CF0A 4OZ5A 3THTA 1QJHA 5E41A 1NK6A 1FRLA 1R27B 1RDCA 2WAQD 3U9ZA 1DZ5A 1N56A 4Y00A 3O80A 3MUVP 2MKJA 2F8HA 4B3MF 4L76A 4G1IA 3SNNA 1UVJA 4LH5A 3MEDA 1TQLA 5C24A 2YKOA 2KL8A 4GVBA 2R7TA 2P9NA 4JI0K 4F04B 1AXQA 4I2PB 4FM2A 4P10A 1VSLA 2VQEK 1NGEA 2J9DE 2MGZB 4LF5K 3AJ1A 4JKAA 3D7SB 1T02A 4F3TA 3BPSP 5E26A 1HNWK 2RVJA 4XIUA 4C8KA 4AFFA 2HHXA 4HLBA 3UFCX 3HHLB 2HHSA 2GMLA 3TJ9A 4X65K 3MZIA 1MWQA 2HVHA 2ASOA 2KZZA 2P9KA 2CKWA 1YVNA 3UNYA 3IFRA 2MKCA 4KV8A 5F8JA 2RRNA 4A8SA 4YOYA 2GAHC 4IH6A 3W5YA 2RUSA 1FWPA 1HNXJ 2VQFK 5AE3A 4A8FA 2DHGA 5AE1A 2EK1A 4H0PA 2K1RA 3D68A 3OHAA 4ZVSB 2BE2A 1RTJA 3RVCA 4K7QA 2KXFA 3DOKA 3J81j 4ELUA 2ZBPA 5GAHP 3T6JA 1UVLA 1JMTA 4NRUA 2E29A 2F7VA 2B5JA 3A8YA 4A8YA 2J0QD 4AHRA 4QWCA 1QVGR 3JSMA 4RWXA 3J81U 3GR1A 4BC4A 1YAGA 1NHUA 4CRJA 4YN3B 1PCAA 5E3RA 2KO1A 3NGZA 4WQ5A 4D3HA 3UB5A 1TU0B 5CZXA 1HNZF 3CERA 4UY8O 3TVYA 3SCKE 3PY8A 4J5OA 1WORA 4DFJA 5EOYA 3NF9A 4DU3A 5HK4A 1N5VA 3QBXA 1KVIA 3DXKB 1E6VB 1I94F 1BA1A 3FSIA 2BV3A 4RL1A 4KB0A 3DGVA 4KTQA 5K20B 2ALYB 1F9EB 1F5BA 1UCNA 2ZGZA 3KK1B 5AQIA 3UKRB 2E1ZA 3TAFA 3DLRA 4FWQA 5GADP 1R6YA 2MZTA 5HMXA 3TAQA 4K0KK 4OPKA 4XH1A 2E5LF 2HHTA 5EY4A 2WVDA 3MHYA 4JS5A 4ED2A 4LY7A 4CLSA 4IG0B 2IAJA 4L75A 1UWAA 4RZRA 4W92B 2YY3A 3CIZA 3AO1A 2B51A 3I55S 3B6BA 2AX0A 2WBNA 1VSDA 3ENQA 3AA5X 4CZEA 1QSYA 3TQ1A 4L3QA 2PA3A 2XY7A 2NS1B 3WXKA 3THXB 1FA0A 2PEBA 3H7HB 1RHMB 1QVFR 1WOOA 2Q1NA 2YX1A 2QW9A 3IWXA 2IJNA 4FWKA 3SSRA 4ZVGA 3LGMA 2J7UA 3WIVA 1KD1T 4K4WA 1H2UX 4K25A 4EZ6A 4ES1A 3I87A 4JV2A 1S59A 2O8DA 4JI1K 2PY5A 3ITHB 3EXCX 4F4XA 2GA7A 4ZVQB 4U67Q 3VQPA 5C5JA 1RU1A 4FP9A 1ATNA 4OYOA 3UR0A 3SUOA 3AVJA 1JKHB 2VKRA 3TUPA 3I32A 1UA0A 1T0TV 1S6OA 2HBKA 4CZGA 1V5IB 2H4YB 3WT0A 1DKGD 1NM2A 5BRDA 1B0VA 2XZWA 3QFHA 2WOMB 4K4VA 1OYDA 2PFFB 2MKKA 2NYHA 3VEVA 4EP4A 5I9EB 4ZJOA 4DR1K 3BSNA 3V9SA 2XC9A 5KG5A 3QFWA 5HP1B 4GKJJ 4A8OA 2BX6A 2D9OA 2W1BA 2RS2A 3RZAA 1VQ6N 1RLDA 1VC6A 4DFPA 2UUCK 1S99A 5AQLA 4H5VA 4DXLA 2O8EA 2WBMA 3K5MA 3VTIA 1RZMA 1X4FA 3AGKA 4QBUA 3D6TB 1W2BR 2E2PA 3V9WA 1V6HA 3GONA 4UT4A 2YH1A 1GXUA 1VQ6S 2ZDOA 2V2VA 1U1KA 1B4SA 2UXDF 3DRPA 2Y1LB 3R7SB 1YBUA 1S1TA 4A4JA 1HR0J 2YNGB 1FDDA 3KXDA 5J1PA 4TY8A 2XS7A 2GTDA 2ATQA 3M2RB 4DR4K 2EFVA 3MN7A 3AVAA 4BRNA 2HAFA 3MEEA 3UN2A 3GIJA 1DY3A 2FSKA 3ZEUA 1WDTA 4W5NA 5E3QA 2KFZA 1YJVA 2GO9A 1HKBA 5LY3A 3NHGA 4Z37A 4Y28C 5KRTA 1NK8A 1A7GE 3AB2B 1DAXA 5AXLA 4QS8A 4JKCA 1H38A 2E9RX 1VQ7S 2GEMA 3GG4A 2W9BB 2SXLA 1IKXB 2FZGB 4DV0K 2BW7A 1M90O 4JS4A 5HBMB 2YNHB 1CULA 3NKYA 2MHEA 3WC0A 3P38A 5EX0A 3P5TL 1VI7A 2GHVC 4YUDA 1OO0B 4MK9A 4A2AA 4R8UB 3KK2A 2B4UA 3HVAA 4K4UA 2M3DA 4WKYA 4CNYA 1NPPA 2R8JA 4CJ4A 4PG5A 2HNZA 3O5TB 2B6AA 4RUHA 3DLEB 3EX7B 2YNIB 5E5NA 3T1YK 5I3PA 2XSJA 3UIQA 1X4BA 4HL9A 5AQQA 1PAEX 2BANA 2QYCA 3KDOA 1RWMB 2OPQB 1YRUA 2VWJA 3CCUN 3TI0A 2U1AA 2EEYA 2QA2A 1UOCA 1RTIA 3RG6A 3WC2A 4DQPA 3BGUA 4DPXA 5IT9Y 1BQXA 2K7KA 1EXQA 4JI8K 4ECVA 4BR7A 4CI0B 2BGGA 3MEKA 6AT1B 4EZ9A 2GVZB 3Q8QB 4ZTJA 5KGWA 3DLKB 2BKPA 3CCSS 1GLEG 3J7YP 1VSKA 2I7PA 1VSEA 1VQ9S 4M5LA 1BQMB 3OYCA 5DMRA 3OV7A 1WDDA 2MJUA 5KFQA 1JCEA 4PYAA 4HCBA 4WTYA 1GOBA 5AFUA 1IKVA 4KHMA 3QO9A 4P74A 4PEOA 4FS2A 1Q81T 2GELA 1S3XA 3O8WA 1RT1A 1SC6A 1T9TA 1TL5A 4JV5K 1LQ9A 4FWOA 1UZHA 5HJXA 3UD4P 5AXNA 3E1YA 1HNZJ 3U02A 1FVQA 4FJLA 5B0DA 3GU0A 4CLYA 2RU9A 2B9WA 3H4BA 4KBIA 4NLRA 1WSIA 5HVFA 2DPJA 1WF0A 2AA4A 3VOVA 1O0PA 2ASJA 3I6PA 1I94J 4OO1J 2DNYA 3OFEA 2P51A 5A8KA 1XNQK 4PRFA 3O08A 3JXOA 4M5GA 4RUCA 4B08A 1JLAA 3KLIA 1Y64A 4KHYA 2CQ1A 5ADXH 4L3NA 1P1LA 3MCPA 2JNJA 4NCGB 4I67A 4BGAA 3A3NB 2DFFA 2IMWP 1Z2LA 3UI3A 4TVAB 4ZPAA 1ZPWX 4MT1A 3MR2A 1EHWA 4BCAA 1U02A 2ZC4A 4IDHA 2MB0B 3ZX0A 3THWB 4WQ4A 3IUCA 3DFEA 3C15B 3I0RA 2O5DA 2ZDPA 1KQKA 2Q79A 2QEXS 4KRWA 1REVA 1YIJN 2W4DA 1D4XA 2QYGA 5JLFA 5GAGI 1RB0A 2IC3B 1CSJA 3BSCA 4Q7AA 2FHJD 3RMBA 4Z4IA 2HG4A 1IKYA 4TYAA 4IKFA 2VG5B 3M2VA 1KBRA 3AD8C 2JEJA 4R0EA 1VC5A 4XEIA 4C3MA 3VCDA 5K8MA 1KOHA 3K8VA 3U9DA 3HD2A 3RYLA 3H3OB 1WHVA 1SIWB 3RRKA 1Q7LB 4CJKA 2GHPA 4JI7K 3N0VA 4E89A 4KH5A 1RYSA 3SQ1A 3OS1A 5AJ3F 4RW8A 4OKKA 3AHPA 4ID1A 3H5YA 1U1RA 1YSJA 3VGUA 3DN9A 1NZ8A 3OVSA 4DUYF 1OPZA 3VAGA 1JLBB 2R9LA 4CO4A 4CZIA 4LIRA 4OQJA 3D2WA 1U0HA 1CJKB 1JLFA 4KO0B 3DRRB 4KHNA 5J2PB 2J9DA 2NUUG 3IM8A 1RDUA 3L4BC 4HUEA 1VQPN 2BJ3A 4LF6K 3V6HA 3G6YA 4YB5A 3LM9A 2ZITA 1BHNA 2HNDA 3N9UC 2BEFA 3VVTA 2CGJA 2AQ4A 3ZETB 3OXGA 1G99A 3G2XA 4DR7K 5AE2A 2F5GA 4WJBA 2OANA 4B3OA 4QYZJ 4N77A 5D6GA 5JUMA 2RDIA 3MM6A 3O9QA 4KE5A 3K89A 1YJUA 2G8HA 1KLMA 4ZP6A 3CJCA 3PSFA 2MQOA 4C8ZA 2FBTA 3ZO7A 2UXDJ 4EI2A 3SCIE 5DO2A 2XY8A 4ER8A 4OX9J 1F1BB 2CH6A 3SMSA 1H7WA 3KD1E 2AV5A 3PYDA 4KH1B 2GO8A 1Q8KA 3R27A 3OJUA 1VQKS 3IMQJ 2ZFHA 2J6UA 1NM1A 4OZ2A 2R7OA 4DX8H 2LDYA 2AZ1A 1U4BA 1XQSC 4BE1A 2AGQA 5AQOA 1LFWA 4DUTA 5ETPA 1SXLA 2NYIA 2ZKTA 3OS0A 1RAJA 2BOPA 2CUYA 3KJVA 5KFRA 2E6MA 1U6FA 1KQGB 3PHEA 3W62A 2C3MA 4CJTA 4ED7A 1B7FA 4HHTA 4CO2A 3MM8B 5KFGA 1HIYA 2DHSA 4FF2A 1NK7A 4IR1A 2HQIA 1REGX 3IP0A 1BWFO 2QWLA 3B54A 3TJ8A 5ETQA 3P5BP 1U1LA 3AA2A 3DI6A 1S1XA 4CZJA 4DPOA 3HD1A 1ZBIA 1N33F 3AA9A 4GVMA 4WFNQ 4JEPA 3MN6A 1C1BB 2L08A 3M6GA 2UUBF 5KFZA 3M6UA 1GLCG 1J27A 1KD1O 3EYZA 4RU2A 2CPZA 2UXBJ 1EETB 2OEKA 1TUVA 3JAMY 2DXEA 4A5BA 2EWSA 1SH0A 2C2OB 3CCVS 3MOZA 3ILJA 3O1BA 1JLGB 4GC7A 5AQRA 2RU3A 3OHBA 1Z2ZA 3FRYA 3E66A 1RT6B 5AQXA 4NXNK 1VJWA 2Q3SA 1WF1A 3OBWA 3H5UA 2DKOB 1UJ4A 3IR7B 3C95A 1DRZA 1BQNB 4IQMA 4Y0WA 4A8XA 4OI6A 3TUJC 1ZZFA 1FCAA 1JX4A 3U3GA 3CCRN 4FSVA 5H1SV 5JMVA 4WCEL 1BLUA 2P9CA 2AT1B 1ASUA 1BG3A 3J80U 3I0SB 2BACA 2OAUA 3HMJG 2G0JA 3PX0A 1NG9A 4H5NA 5DG8A 2X3GA 4ECXA 1X9JA 1PAUB 5LJVA 5KOWA 1IQZA 3T6BA 3KLEB 2KU7A 1S77D 1K8KB 4DQ8A 3SQGB 2DHHA 2YWKA 1IG8A 1C0GA 5KT3A 1PJ6A 2BRKA 4JI5K 1I51B 5JVHL 3FC9A 4I6WA 3VWSA 3D6MB 1CJUA 4FWPA 4HHUA 2VG6B 5KOXA 5AQMA 3HO1A 5LJ5Y 3G0ZA 4JNEA 2NXEA 5DM6Q 3DOLB 1O51A 3Q8SB 5E0OA 4O3SA 2LVWA 4USUA 1D9FA 2KHDA 4DJBA 3CTRA 2HHPA 3NVKA 2OH2A 4I68A 5CXTA 2VWKA 3GFZA 3AD9C 4IH7A 5KFNA 4KT0C 2BTFA 3D2EB 2RSQA 2WBRA 4KI4A 2XSFA 4KGMA 1QDUB 1HW8A 1GFWB 2UU9J 4NEZA 2X78A 2FBVA 1YUWA 3AOCA 2HMIB 3D4JA 3CC7N 3NGRA 1Q5VA 3EGWB 3QNOA 1M1HA 5H9EK 2XHWA 2NNWA 1L5UA 3QNWB 4DV2K 1EKSA 1M5KC 4JK8A 2JFDA 2V8VA 3E9LA 3UDCA 2W2PP 2JGUA 3FEZA 3C3LA 4OV6A 2RHKA 3O9TA 1JJ2M 3WXMB 4N41A 1HBNB 3CC7S 4F2RA 4BR5A 1N54B 1S5ZA 5B7WA 4ELTA 2P9UB 1XMOK 1N48A 3SSQA 2BW2A 2IPOB 2LXUA 1JB0C 3MMCB 1JLEB 2E9TA 4CBXA 1WHWA 3P5JA 1R0AB 3KFWX 2E1RA 4I2PA 2CVEA 3D67A 4ID8A 3RRHA 1U1PA 1CC8A 2B8PA 3BH6B 3R5AA 2H65B 5HVGA 3MWPA 5K8NA 3P6YC 1EQ0A 2MGZA 1BC6A 1YLXA 5CZ1A 2RRBA 3M1FA 1Q7YT 3I8BA 3NCQA 2NR0A 4FK2A 4DV1F 1EWQA 4LBPA 3FBFA 4A8MP 2I9SA 3UQSA 3HHLA 4W5TA 2EFGA 1F6TA 3LWMA 2WCXA 3M32A 3UN3A 5AJ3J 3EICA 2QMXA 1S6UA 3IGVA 3PKYA 4J9VA 1CS4B 2DO4A 4DUYJ 1YJ9S 1JXEA 4H4MB 1IH7A 2O4IA 4FM1A 1MDUB 3LP2A 4ECRA 2V8GA 2WB4A 1Q0NA 3SUNA 1T6DA 3IWNC 4FW2A 3F9KA 4F9OA 3MK6A 2Q1LA 3CXCR 2DH7A 3IS9B 1M5SA 1OWXA 2RHSB 3HX9A 2P8IA 3GP9A 3BREA 1UTAA 4PYDA 1U7LA 2KYXA 2JEGA 3R2CJ 3G6EN 4H8KA 4K8RA 4USJC 3VGVA 3NS7B 4F4WA 2JL9A 2OP5A 2OD4A 3L0QA 4F7VA 4U7UK 1U6BA 3ENAA 2DJWA 3AY0A 2BQUA 2RJZA 1HNVB 2XQCA 1HBOB 1IR2A 1HNXK 4U7CA 1NO8A 1EB0A 2W2NP 1HJOA 4MH8A 2FJWA 4WFAL 2LKZA 3I5AA 2LQ9A 1N8RT 3GCXP 1LXJA 1Y3JA 3QLHA 1YJWN 2FVCA 2YI1A 4IFVB 3PYGA 3HOTA 1RSCA 4LQ3A 1IN0A 1VGYA 1EIYB 3FFIA 3LOUA 3ETMA 4KHRA 3PACA 4IG0A 3KLGA 1YJWS 3ID8A 3ET6B 1NJZA 1N33J 3M3ZA 4RBUA 3C6TA 1ZETA 1K73T 4EO8A 1SKWA 5G0RB 2XO7A 2UUBJ 4ECYA 4IOCL 1CPZA 1WB9A 4HDGA 1UJ5A 3Q2TC 1VMBA 5EU7A 1LEOA 4OHWA 4HH1A 3CF5L 1DTTB 1VAZA 4CJEA 1AZSB 3THXA 2JWNA 5DETA 4JYAF 5DDPC 1RAFB 1H98A 3Q83A 5CYJA 2JDJA 3RSEB 3RJMB 2CGLA 3SYZA 3TTDA 1WSHA 5BYRA 2YKNA 3B4MA 4YOEA 3T3FA 2FZKB 3AVFA 2C2ZB 4B02A 1S9EB 3SDEB 3EGZA 4L8RB 4GO5X 2VB6A 2M88A 3X3UA 3KUHA 2G4BA 3OTBA 4YHHF 4BRQA 3ILLA 1V9OA 4F0HA 3JXUA 1RBSA 4KQZA 4F50A 1AT1B 3Q24A 3OYLA 3R9LA 2QZ8A 4CLZA 5IOLA 5KGXA 2WOMA 4DTSA 1U2VA 4DZ6A 5KQDA 4JK9A 2BKNA 3MFHA 3SXLA 4B3TF 5IT0A 3RR8A 4ED8A 3D6HB 5BYSA 4N56A 2GZOA 1BU6O 4P2SA 3QBCA 2WK4A 1HLUA 2P9LB 4HEA9 4J2EA 4NLGA 3CSKA 4P6QA 4BDPA 4FPBA 4B3RF 2X6SA 2JSXA 2AJQA 1EARA 2VOPA 1C4CA 2NZTA 2C1EB 4IEIA 4AUKA 3P4IA 3TO8A 4I6MA 1UW9A 1YJRA 4CT9A 4HACA 2W42A 2UP1A 1EO1A 4XTTA 1HNIB 4NXMF 4TYBA 1X4GA 1HW9A 1ZXOA 4ZDNA 2YNGA 3M2RA 3D2FB 3W64A 3ZFVA 5L38A 5LXRA 3CD6N 2FGCA 3VA3A 3NGIA 2R2TA 4GKJK 1HWLA 2HGMA 1U09A 2J76E 4O55A 3DNCA 4B9QA 4TQSA 4X62F 1EP4A 3M9NB 2F4VF 4DOZA 4A8QA 4Y2MA 4DR2F 4FYVB 1KC8O 4K4TA 4M7YA 1YHQN 4OV1A 1N0VC 3CD6S 3OYGA 1KVBA 4CEEA 4ZHRB 3MEGA 4JLHA 4DQRA 1N36F 1IKXA 3JTNA 3HT3A 3CC2N 5KFTA 1Y00A 3CM5A 3VGSA 4C3KA 3V6DB 3IWLA 3TA0A 5HBMA 2NCKL 1YHQS 3H59A 2QWMA 2GS8A 1FKOB 2VBWA 3QWPA 2XGPA 1HR0K 1KDNA 2M5YA 2AJ1A 3BZKA 4B9UA 3HPGA 4CZMA 3AVGA 2HHUA 4R8UA 1ZBTA 1R8CA 2P9SA 2P6TA 4FWMA 4I7FA 3MAQA 4KAZA 3DLEA 4KHPF 3A8IA 2YNIA 4CT8A 3MN9A 3MR6A 5M1QA 1HMVA 4RUAA 4NLBA 3IRXB 1Z4UA 3B82A 1PC4A 5E33A 1RXOB 2PMZD 4DV1J 2LEPA 3Q8UA 2OPQA 2DR5A 3H98A 4FZYA 3MXMA 1TKTB 1KFSA 1S6QB 1VR6A 4FJ8A 4FZZA 1TYQB 1S7IA 2CJ9A 2DXDA 3FZKA 4YORA 3TYTA 3IAS9 1RA6A 4J37A 3SBMA 5HVHA 4DL6A 1NSPA 3MAAB 3ULHA 1YI2N 3HSDA 2YBVA 2BQRA 1R8AA 4QWBA 4X4UA 4JD2B 4XK8C 4NLCA 4FXDA 4U7BA 2OZMA 2D3O1 1RNHA 5K14B 5A8WB 2XCPA 1U04A 2F1FA 2W4CA 1ACMB 2OPPB 4HVJA 3J7ZO 3M6XA 2RD5C 2VC0A 4TLQA 1R0BG 5EWGA 2QGFB 1C2PA 4I56A 3HULA 1VRTB 4IO1A 5KFBA 4GMKA 2DY1A 5LXYA 3NG8A 1U47A 4B9LA 2WVBA 3TX8A 1HWIA 4A62A 2FBYA 1DTQB 3W66A 1JCFA 2HVDA 4CGHA 3KVGA 4B8CA 2ZH2A 4WP9A 3OTDA 3TAPA 3PIOL 1ITPA 3CDUA 3NP5A 1E4FT 4Z4GA 2F96A 3DXBA 3KMSA 1VRUB 4FM0A 1YX2A 1PJ5A 4FJMA 2AJ0A 3ZTQA 2AGPA 3PJXA 1ASWA 2EPIA 2V4JB 3LDQA 5KI6A 2HS0A 3D0IE 2XULA 3W9IA 2HAIA 1VBXA 4NCGA 1OIAA 4ILMA 4LFCK 1IVZA 1AFIA 3O3LA 5CHIA 4IUFA 2Z56B 2Y0BB 4S0MA 3HI0A 3OHRA 2QA1A 2DNRA 3THWA 2MHNA 4P52A 2E20A 2E4LA 1RADB 3AO4A 1EJ7L 5DM7Q 3KHGA 1OH6A 3PV8A 1GNKA 1NLVA 3WQPA 1HNZK 1NOZA 2CZVC 2RN2A 2Z1IA 3BBFA 5LMNF 1UPPA 1FJ7A 4OI0A 2FJBB 4DKWA 4RNHA 2X3DA 3OXLA 1WN7A 4YY3F 2J0SD 3HVWA 4USTA 2EVZA 3OYIA 4DMNA 1Y5LB 3H1QA 1I94K 3L2RA 2IC3A 2R7VA 3C19A 4BVOA 2LECA 1UVNA 2LQ5A 4CZCA 4FBUA 2VG5A 2CFXA 2VPXB 5GAHI 1KQSM 2XLIA 1J5EF 1RBTA 3M2UA 2GNKA 4MIBA 3NGDA 3TU5A 4M5KA 1X4HA 4C97A 2DVIA 2WONB 3BY5A 1HKAA 3M9MB 3NH1A 2W8LA 3CVKA 3KHLA 4ECQA 3WUHA 2VUGA 4YHHJ 1RI7A 4EYHB 3MCAB 2X74A 1D9DA 1ZC6A 2YKMA 3QMQA 1BL3A 4DL4A 1RT5B 5AQPA 4CJVA 1JLBA 3R6MA 4OLAA 1CJKA 4KO0A 2A6OA 5J2PA 2V6AA 5KT5A 1X4CA 1WEYA 2WVCA 4CLPA 1MMDA 3M6VA 4B3RJ 5GINA 3I9ZA 1S1UB 3QERA 3E9OA 3OL9A 3ZETA 2EFQA 4IQXA 5GADI 3HFVA 1LAVA 4PR6A 1JLCA 2FIUA 3V1RA 3BDEA 4PCQA 5C25B 2G8IA 5C2DA 1HQ2A 2QI2A 1SV5B 2DHAA 4CECA 2J4RA 4HTUA 4DN9A 2O8CB 4NXMJ 3CC4S 3ZZPA 4O8KA 3EVOA 3QEIA 2VPYB 4LF8F 2C3YA 3JB9k 4O5BA 1QAYA 2OIHA 1VK0A 3DU6A 1YJ7A 3JS6A 4MKYA 3CJ7A 4JI6J 3L2QA 3R5JB 3PM9A 1N6QA 2QG9B 5F41A 3H20A 2ZH1A 4QIEA 1Q8BA 3IM9A 4NLVA 4X62J 2F4VJ 4DV5F 3PX4A 5LM7E 3SCLE 4FVCA 4DUZF 4FYYB 1QUPA 1FRHA 3AQOA 4CO1A 3MM8A 5K5MA 1FKPB 1K73O 2A10A 4FYDA 2ZE2A 1RISA 3T1HJ 5C24B 2DRDA 4GVBB 2CJBA 2R7UA 1KN6A 1WF2A 2P9NB 3J81Y 4JI4F 1F3VA 4ILGB 2UXDK 4ZIWA 2FJXA 5L8RC 2QWNA 4OX9K 1WNEA 3ZSQA 2HFUA 4DTUA 3ATUA 4ZS6A 1GK8A 1LV5A 1M1KT 1Q18A 1UVKA 1EETA 4KHPJ 2GV1A 4RBTA 2ETJA 2Z2MA 1IR1A 4M63A 2R42A 1WLJA 3CEDA 3QNNA 1JLGA 5GAEI 4IOXA 3CJ9A 1PG5B 2XS2A 3P83D 1E4GT 1YRXA 2JHEA 4ENOA 1L3SA 2CDQA 4M42A 5KQ8A 1FJGK 4IEEA 3CCZA 4FKYA 4U67L 2QFIA 2VZ9A 3OFFA 3S01A 5A2QO 1IBLF 2DBBA 4B17A 4F02A 3N01A 5C2GA 1FX4A 3D0GE 1CXUA 4O44A 1QHTA 4YR3A 2BE2B 4ZN1A 3I0SA 5D4OA 5L1KA 4GV3A 4W5OA 2HHWA 3FSYA 3FNNA 1IJFB 4RWTA 2UXBK 4LD0A 4J9SA 3EZOA 3H08A 4UOHA 1K8KA 2B5JB 2PYLA 3Q8RB 1XTZA 1HD0A 3DKDA 4DHYA 1NUEA 4GKKJ 5E3AA 2CGKA 1JNZB 4QIFA 4Q2MA 2JOQA 5LSRA 3N5FA 1FJEB 1LW0A 1Z25A 1FFGB 3CGIA 4ICLB 4PKDB 1KNZA 3R8YA 3FDSA 2XNQA 2WTFA 2VG6A 4USKA 3POTA 4CF2A 4ZPWR 3R5CA 1K6YA 3CETA 4KHSA 2CQ4A 4BG8A 4DR6J 1RBLA 4CIOA 3G71S 4BWJA 4E1MA 3SQ4A 3R2DJ 2R8GA 1XJWB 1NJYA 4IFYB 1VQLN 1TR0A 3SQ2A 2QLFB 3W9JA 3NXZA 3EKSA 2RPIA 3D2EA 2LQ8A 3HHKA 4DL5A 4Y1CA 1KXPA 3QGPA 5HO4A 2PO4A 4H5WA 1HWJA 4PXDA 3MPYA 1IWAA 3PIPQ 2RILA 2HMIA 3CO9A 2E7VA 3FR0A 5KPRA 1HYZA 3ENOA 4OPHA 3MOJB 2JC0A 1TV6B 1VSMA 4ZVPB 2FPHX 1RACB 1KTQA 1S48A 1NGJA 2H1YA 2EG2A 4QW8A 2H5EA 4V19S 1HBNA 4X66J 2XCAA 2KDOA 3TNVA 3K5LA 4AHVA 3VZIA 2NRWA 2KQ2A 2QL9B 2XM3A 2I38A 4J9MA 1VBYA 3BUZB 2GGPA 5LMNJ 4K2JA 2VH7A 3W60A 1RAOA 1JL1A 2LEAA 4C9DA 1YK9A 2GC8A 2OTLS 3MMCA 4YY3J 1JLEA 4ZCMA 4QR1A 2IOCA 2OSQA 2V2KA 2DNMA 4DLGA 4BDYA 3CG7A 4AHUA 2CH5A 4G3IA 1JL2A 4IR9A 2UU9K 2XWYA 3PW2A 1A6LA 1AYEA 3MUMP 1VSJA 2MSTA 3KHRA 2V63A 3HHLD 3I4HX 4NZ0A 5A0YA 5K9FA 3AVCA 1ZAXA 3HZEA 1NGDA 1N5QA 2VF3A 2NRXA 2DPNA 1X3NA 3CJRA 2M7SA 4ECZA 1NNDA 1HQEB 2CJKA 2DFEA 2QN6B 2NRVA 2Z2LA 5IC6B 4DBQA 3LDPA 4EAHD 4HT7A 3Q22A 4ZOSA 4DX7A 1X9SA 3X1LB 3QEVA 3I5CA 3W5XA 3CDEA 2VCPA 2ZZMA 1GTHA 3CB4A 3A5MC 4LF4F 2K3IA 3HSGA 2B3TB 2QLXA 4KJIA 2P1JA 2JC1A 4FF4A 4I9QA 1HL6A 3OL7A 4DV7J 4E3SA 4IKAA 5IWAF 2OPSB 4H4MA 1ZBLA 3GQCA 1S0VA 3SMZA 1UAXA 4A59A 3CMES 2CZ4A 3VAFA 2JEIA 2O8EB 3BO3A 5JICA 1R3NA 1NGCA 4CJSA 4OYAA 2VONA 2RUGA 1FXDA 4YB6A 2A40A 3TA2A 5I42A 5A6PA 5JVGQ 2OKQA 4LQ9A 2HNYB 2HHHJ 1IBKJ 3VQCA 1W97L 4AHTA 4FJHA 4CEOA 4J90A 3U8XA 1XC9A 2Z1JA 2FHOB 5JLHA 1CC7A 3BO4A 4WBFA 3SFUA 2CG8A 5AJ3K 3S3MA 4KREA 3TEGA 2CVIA 5TKWA 3E9PA 5DQGA 4LF7F 1GOAA 4JAXA 3MEEB 3WZ0A 3LF0A 1KOOA 1Z26A 3UCGA 4DUYK 1HBOA 3W3SA 1P9QC 1NU0A 3LPUA 3AO5A 2P5GA 1NK4A 1B9FA 4K42A 3JSRA 4LUBA 4KHUA 1RDAA 4P2XA 4O3PA 3RBXA 2Y1IA 1FK9B 4EEYA 1YTUA 4DV5J 3O4WA 1FEEA 4IFVA 2FLOA 4DUZJ 4QU6A 4WK3A 4YB1P 3AAPA 1KSPA 4P72A 3V6KA 3OSPA 1RA7A 1WOQA 4AL7A 3THPA 4EGLA 2DEIA 2XMKA 2PEHA 3M6WA 2AJFE 3JQMA 5E84A 3OYBA 4JI4J 2FJEB 2ZF5O 3U6FA 5ADXA 3SI8A 1QVFM 3VPZA 3MDQA 5G0RA 1XNRF 2XLJA 4BR2A 2FC8A 3OR2B 4HI2A 3UKUB 2XSJB 3TSPA 4BRIA 4CHNA 1T6CA 2C2DA 3IBFB 2MDAA 2HQDA 3D6FB 5HQLA 2C2NA 1AZSA 5B0BA 3VF4A 4U9RA 3OYHA 3HM8A 1KKHA 1Y9OA 1NZAA 2HF3A 3A3PB 3MFIA 1CJVA 2DNHA 4RLEA 3CJSA 4JHDA 3RSEA 1GLBG 1FXRA 2ZH5A 1RT4B 3DLLQ 1RTIB 2WW8A 3T7ZA 1OSCA 2CNNB 3RBZA 2QK9A 1IKWB 1UMJA 3LGNA 4H5TA 4CTAB 1NMEB 2ILZA 1L3VA 3U3YA 1IXKA 2C3UA 2OFGX 2RQCA 1WC5A 4IOBA 5LMUF 5IXUA 1WSRA 4DR3J 2HS4A 2ADBA 1N33K 2FY8A 2VHGA 3OTCA 4LF9J 2UUBK 3GOIA 5CZVA 4YDDB 1VSIA 3R97A 2GIRA 1BD6A 3EZUA 3H8YA 4K8XA 4CGGA 3QGHA 5D4PA 1X60A 5LSOA 4IJAA 2KI2A 3BBBA 1D9AA 4CHYA 5D0GA 3OYMA 4ID5A 2P9LA 2Z1GA 3OYEA 1W2BM 4ELVA 4CERA 3ZTSA 3FKBA 4RR5A 1RWXB 2GQQA 1ZM9A 3H90A 3FZLA 3R1XA 4L74A 4NLYA 4QW9A 3VV2B 2MQ8A 2JFKA 5KT4A 2ZUAA 5CYQB 2DHXA 3IKMA 1NWKA 5KFPA 2UVRA 2OUGA 4DG1A 2Q31A 5GAEU 1LXNA 1N5TA 1Q9YA 5AQWA 3VEWA 2DGOA 2DCLA 1SL1A 3WXLA 3CPWM 2AD9A 1BISA 1CJTB 2MLXA 3R7NB 2FJAB 5DZ6A 4ZITA 3LDLA 3FEXB 4O5FA 3CNQP 2WVFA 3QRQA 2OSRA 4ZKAA 4QR0A 2KTQA 3DRSB 3DLHA 4X4QA 2C2MB 4Q8FA 2NRRA 2C3PA 5CQGA 3EDRB 4CD3A 3H6EA 1MN9A 4LRBA 3HKZD 3JTOA 3SAGA 3UCZP 5BR8J 3GJTB 4ZPVR 1RBVA 3CMQA 4I1TA 3AVIA 1VQON 3HPOA 2W25A 4O4RA 3QIPB 1XERA 1HBUB 2GFFA 4F3QA 1OYEA 2HIYA 2LXIA 4RWWA 4ZCLA 3NBPB 4E0DA 2DGVA 3V6DA 2ZH6A 1WEXA 1FNMA 1LKZA 3Q89A 4PAAA 2V4QA 1RAIB 2APOA 5HMZA 1FKOA 1HQUB 1UW4A 1IKYB 4WFNL 3QATA 3KIOA 2YWGA 3M2VB 2BM1A 5L46A 1YT3A 2FHMA 8AT1B 2I6WA 1VDHA 3GIIA 3QSIA 4FNHA 4JI3F 2GQCA 4DS5A 3GG1A 1ZA2B 4FJJA 4MK8A 4OYBA 4JI0F 2HVZA 3H40A 5AZJB 1R59O 1J54A 4OHYA 4HVZA 5I3QA 3IRXA 3UD3P 4PWDA 1A9NB 3CW2C 1RTDB 5I3UA 4RW8B 3QYYA 4LF5F 3OJSA 1BUPA 4QIVA 2W9AA 1KVCA 4UOCA 4CGIA 4H4OB 1TKTA 5KFXA 2QLWA 2FB0A 2X1FA 2CDRB 2QXLA 5DK5A 1S10A 1R0CB 2O4GA 4YDUA 3GR0A 4IO9Q 4ED6A 4IG3B 1U0HB 4ZPBA 3WNGA 4X65F 1O5JA 4X2BA 4JD2A 4X4TA 3SLCA 1BWEA 1HYSB 1MSWD 3G96A 5IWAJ 5H1SQ 1SIZA 5K14A 3NF6A 2NUBA 3IAYA 1FDBA 1EAYC 3IXQA 2Q6BA 2OPPA 5F8NA 5J2NA 3DRYA 2BH1A 2BM0A 1T3OA 4Y65A 2VQFF 3M8QB 4KHQA 1P6TA 3KD5E 4B3OB 3ENVA 3T5HA 3F44A 4X64F 1YF5L 2DRAA 2IVYA 4I69A 4CK1A 4KH0B 2QWPA 3OQ2A 4H5RA 4DV1K 2DNOA 5CD4A 1Z1ZA 3AVHA 3HZ6A 3MM7B 2AW0A 3PHTA 4B1WB 1DTQA 3ISZA 1V4SA 4X4VA 3P3DA 4ES2A 1C0TB 1QS4A 3V1OA 5DGBA 2YV0X 5DM6L 1RK8A 2DGTA 4ZTFA 3ETOA 2D0CA 1VRUA 1KHVA 3PR5B 4FJXA 3TWHA 1S7HA 2OYQA 3BGRB 3HKWA 3A0IX 2HQCA 3J80Y 3PDNA 2H3GX 2V4JA 1D0EA 2B4VA 5B0CA 2IS3A 3IAM9 3LUYA 3NY0A 2FD2A 2DR8A 1Q1KA 2CPDA 4ISFA 4DTXA 3PZPA 5KFAA 1S72S 4E98A 1YWXA 1KAZA 2C2KB 2RMLA 2B9YA 4UOGA 1S1XB 3SPZA 4Q5VA 4NYNA 2IY5B 2GVDB 1TFWA 2ZBQA 5IV3A 2CPXA 3Q8YA 4Z94A 4OZ0A 5D0RA 3DGPB 2QWRA 3M1VA 5HROA 3OTEA 3LWLA 1K8AO 1XN9A 1TELA 3AA8A 1NK9A 1XMQF 3BZCA 4DL3A 2MQMA 5D15A 4F3OA 1XNRJ 4FLXA 3T1AA 2GV9A 3WQTA 4U95A 1FDAA 4NEYA 5D78A 4JP8A 1N34F 4E7JA 4MFBB 1LOUA 3VETA 4O0JA 2QKKA 1IBMF 5KFEA 2VFTA 2VFVA 4AL5A 1BCMA 3LANA 1NBWA 2KYZA 3QAUA 2EBEA 1M1GA 4X4SA 3VF6A 4DTJA 4Z4FA 1FO1A 2WONA 1S97A 2V8PA 1TAQA 4C1NK 5KFYA 4FOIA 2PZSA 1RAEB 1TMMA 3QZ7A 3KJQB 5LMUJ 5CCLA 2ACMA 5GMEA 1JJCB 5K8OA 3Q86A 4DFKA 5D3GB 3GZ7A 4AM6A 2IM3A 5E2QA 1RDRA 1RHRB 2HGNA 4FYXB 1NJXA 2Q3PA 1PSDA 1RT5A 2W9CB 5ETVA 5HQ8A 3LALA 4DF4A 2CQCA 5DQHA 2XMWA 3BR9A 4NASA 1QTMA 4BHQA 3H42A 4WXWA 4ANEA 4CH0S 2IDLA 2HS3A 2G0IA 2BJEA 5KFKA 1SH3A 1S1UA 5J2MA 5L9NA 2P9PB 5DS7A 2O01C 4QR2A 4DQIA 2A18A 4FL9A 4J9OA 4RBVA 3D9BA 4BQLA 3AT1B 5JMNA 3AVBA 4CO5A 1WD6A 2UUCF 4IRDA 4C0BA 2GHWA 4ZN3A 2KM8B 1NGAA 4CF8A 4YHHK 5B0FA 2IIHA 1SV5A 4I6AA 3HFZB 2O8CA 3HHDA 4QQBA 4LF2A 1V3ZA 4J9UE 2ZHOA 4F25A 4CBWA 3IR6B 3QRRA 3FZMA 5KG3A 2CJQA 4FLYA 4E7LA 1GQEA 3C8YA 2PI5A 2DCUB 2JX2A 3K57A 3O9RA 4DFMA 3FZFA 4LJMA 2HQGA 3FZHA 2QIFA 3MDFA 3CT9A 4B3RK 4Y2IA 1PIEA 2WRMA 3NH2A 4P75A 3BEGB 3ISND 1U6ZA 1RU2A 3A8EA 4DL2A 1W26A 2YPZA 1FKPA 2XGQA 3UVJB 5ETSA 3Q8PB 2DTJA 3JQJA 4ZLNA 5BR9A 4NOHA 2RT3A 2B4JA 4NXMK 5AQYA 2YVSA 2HVEA 3A5LC 4NYFA 3TWZA 2FHKA 2GJIA 4ISGA 3LA0A 4BWMA 1FHTA 4DTNA 4TQRA 1YQHA 3DCAA 4DV0F 3FQKA 1XK8A 2B0GA 5KRSA 4LFBF 4RTFD 4JI6K 2QXFA 2R2SA 1D1UA 1RWUA 3CDWA 2EW9A 4JI3J 1K0TA 3D66A 4FDFA 4ZLJA 4CW7B 4XH4A 1QZ6A 1AUDA 1J53A 4JI0J 4O23A 4X62K 4JKEA 4LRAA 1K47A 3HCXA 3M32B 4CE9A 2ZNYA 1D8YA 3L6QA 4KGZB 3THVA 2DNPA 2ZJPQ 2XZTB 1LFPA 3DAWA 1HI0P 1SAZA 3T1HK 2MKYA 4CJWA 4DTOA 2IMOA 4IZ9A 3KKRA 1QZ5A 4C0OC 1WSFA 2MY7A 4GVEA 1IQTA 4NCAA 1UKUA 2HFOA 1U8SA 3OD2A 1VQ8N 3LP2B 3HXMA 3H2VE 3GIKA 1TFYA 1RAGB 2K7JA 2V2QA 3J7A1 2HEKA 2E6LA 3R5BA 1H1VA 1XHZA 4QOZB 3QBWA 2XEXA 3EL2A 4NCBA 3QESA 4KHPK 4HTIA 3R1HA 3D1OA 4F26A 2Q6CA 2GWKA 4HUGA 2VQFJ 3NGKA 1VQ8S 3ZTPA 4X64J 5DDOC 1WSEA 1F5CA 4WP3A 3T19A 1NSQA 4ICLA 3VQDA 2QO3A 4F8RA 3V9ZA 4NPOA 5U47A 2POKA 1VQ5S 4DTPA 5AXMA 3MMBB 3SSSA 2J0XA 5AQGA 3VQ7A 3CWJA 3PRVA 2RS8A 2V68A 5A2QU 3TOQA 3CCLN 4AM7A 4IFYA 1D5AA 5AT1B 2VC1A 3BB5A 2XHBA 2D0OA 4AT1B 3SV3A 5DZ7A 2QSFA 1SS6A 3N79A 3QLHB 3QDKA 4A8KA 4WFYA 1TTHB 3OW2M 3CCLS 4ED1A 4GKKK 3EMTA 3G86A 3I55N 5HJYA 3GE9A 5D4NA 1FRIA 2BVZA 4UZBA 3GBTA 3FFIB 1LK5A 1TV6A 1WKJA 3KUEA 3Q7BA 1NJWA 3KLGB 4CQ1A 4TSXA 1RT7B 2HMPA 2UYTA 4P7TA 5FLXO 2FVPA 3C6TB 2RIJA 3PYEA 4JI2J 5A76A 4ILHA 4DR6K 2WVEA 5FPDA 4PXEA 4ANCA 2LU2A 3G4SS 3SJHA 1SI9A 1EKRA 2FF6A 1XMQJ 3MPDA 1TL7A 1K9MO 5J1EB 4M3UA 3LPEA 4LRFA 3KK7A 1NEEA 1L3UA 4X4RA 4OVLA 1FD8A 4DV4F 2PFUA 2ZJQQ 4QWDA 1RLCL 1N34J 2YKNB 2GW8A 3D28A 1NDPA 4KFBB 3H0PA 1IBMJ 1OQ6A 1A5VA 2PC6A 1YG0A 3M8WA 2RE2A 3RGIA 2MYFA 1UFKA 2B43A 3RBEA 1VFJA 1HQEA 5F8HA 3CCQN 1KWMA 2QC3A 3O2IA 1GEHA 4ECSA 4B3SF 2Q2RA 3VGTA 3DRXA 1H0HB 2KT3A 1HHQA 4X66K 5FIIA 4N76A 3DLGA 1U2VB 3A8KA 3CJ2A 4V1Ak 2YJFA 5LMNK 3RB0A 4JI7F 4FWSA 1NJIO 3P96A 3CCQS 3KNGA 4YY3K 4BC9A 2NLXA 3M7VA 2LYVA 2ZWPA 2NLWA 3IFEA 2V0NA 3KKSA 1GMVA 5GAEP 3CXCM 4CK2A 2V8DA 2M4MA 5F9LA 2GIFA 1GXTA 4IOAQ 3LZJA 3KYLA 2OPSA 3KUGA 3TR8A 2EI5A 3V5RA 3GE1A 3P39A 1F2HA 1F2GA 4MK7A 3CIPA 3ZZTA 2FLLA 2ZEJA 3TAMB 1JWWA 3V81A 3VAKA 3EY1A 3NH0A 4H0VB 4I6MB 3EPIA 3GPAA 4HACB 3DYAA 5A8RB 2HNYA 3CJ3A 2VJVA 2HURA 1BHLA 3JYTA 2VPWB 3IG1B 1WACA 2CPHA 3DOMB 3C46A 1WC3A 4BGBA 2ZM6J 3GFXA 4P73A 2R7SA 4LFAF 5M1PA 2W7AA 4JKGB 2G2ZA 1FJCA 4AQYJ 5B0EA 1B92A 1W0HA 5DDQC 4EHUA 2DXFA 2H51B 2EFPA 5B0GA 4CIFA 2ASPA 3I56S 1VQ7N 4DV7K 2Y9HA 4KH6A 3ENHA 1ZBSA 4QCLA 1EP4B 4O3QA 4OGEA 2X1GA 1YZ6A 1HARA 2GAGC 1HUXA 4DB3A 1FF2A 2WC9A 1N32F 1FK9A 2JEFA 2YHBA 1SC3B 2AWZA 3MEGB 2JJ4D 3UPFA 2HHHK 1IBKK 5JVHQ 1T7PA 1WKLA 2QLBB 2AYGA 1NMDA 1RP5A 4B3MJ 3AJDA 1KQFB 3BQ2A 2E1AA 4AYBD 2HZAA 3NNAA 4NA3A 4OJHA 5F0UA 1FERA 2RRAA 4OX7A 1SH2A 2ZH7A 2A1RA 4W90B 3A13A 5DM7L 2P9SB 3QEXA 4I7FB 3BO2A 4M3XA 3BGOP 3L3UA 3O3HA 2MY8A 4ERDA 4RW9B 1AA1B 1F5AA 3OR2A 4NA1A 3UKUA 1HMVB 3T9ZA 4LFBJ 1T9WA 2H9ZA 1UAWA 3MECB 2RQ4A 4XDDA 4ZK7M 4Q2LA 4ILRA 3LDSA 1P8ZA 4CJPA 4JV1A 4JKDA 3PVXA 2W8KA 3EUNA 4AXIA 4XAKA 4DV5K 3LPYA 2V2ZA 1KVKA 2DNQA 3CCSN 1RT4A 1RCOB 2W24A 2VODA 4DUZK 1VQ9N 5KTQA 4QU7A 2V34A 3DWLA 1IKWA 2O8BA 4CTAA 1KHWA 3NCPA 6FD1A 3SAFA 1RABB 3MD1A 4JI4K 3FMBA 4X4PA 1YKWA 4FVUA 3GSIA 3VGKA 4JOUA 4DLEA 4ETXA 3SCJE 2R8KA 4RJVA 3CMAS 4WF9L 2PA8D 5AQSA 3AV9A 2AJ4A 1S12A 1VQNS 1RWKB 4BDZA 3GWCA 1NBEB 3M9OB 4WFBQ 3KJFB 2A6MA 4DN0A 2W7OA 3UWTA 3CJBA 2HFZA 3C66A 2ERRA 5C2CA 2MZSA 3KHYA 1X4DA 1KTVA 1T8EA 2Q97A 2Z0GA 2ZOFA 1X31C 4I6YA 2ZJRQ 2XYPB 1N88A 4OZLA 5EGYA 2BJ8A 3B8HA 3BV8A 3QFPA 4K4ZA 3J7AN 3M5RA 3P45B 5J1NA 5L39A 1MNEA 5CYQA 1FE0A 4DR3K 2HYIB 3NEKA 1ASVA 3HBTA 4LF9K 4LRDA 4GW6A 1L3TA 3FE1A 4DI6A 5HRPA 5EX3A 4H03B 4WU2A 4ITSA 2V9KA 3C65A 1KEKA 1CJTA 3IMXA 3RR7A 2W2OP 2XZDB 1YTYA 2RHQB 3BEXA 2QEXN 1Y97A 2BJDA 4LIWA