2HNZA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 140
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnzA05
5FRNA 3RTVA 4ED1A 3H5XA 4ZPDA 4WZQA 3MEEA 2XI3A 1IKYB 4I2PA 3MXJA 4O4GB 2XCPA 5KI6A 3OYBA 4HUGA 4B8CA 1ASWA 1RTIA 1VRTB 4O55A 2QXFA 3M9NB 4FLUA 2PYJA 4N56A 3T5KA 5KFNA 5DQIA 5HBMB 4KO0B 3KLGA 4N47A 4FJMA 5KFUA 3RBEA 3KLIA 3HVTA 2J6SA 4CJ3A 1TAQA 5EU7A 3FRZA 3CJ5A 2R2UA 1HARA 5CZ2A 3I0SB 4LH4A 2HVHA 5HP1B 5F8NA 4CGDA 1N5YB 2FVSA 4KB1A 3AA2A 4MK8A 3BQ1A 4FJXA 2OA8A 2FJXA 4DU1A 4F4KA 1T05A 1S0OA 4ECYA 3QO9B 4CK2A 4DTSA 5KG0A 4EEYA 4GC7A 1TV6A 4W5QA 1Z25A 1ZTWA 4IQXA 3TAQA 4KB7A 3KLHA 4NRTA 2W7PA 3VQ7A 1NOZA 1TL1B 1S6PA 3DM2B 2IDOA 1IKVB 1KHVA 4QWBA 3MXMA 2YKMB 3H2LA 4WXWA 4E7LA 5KT2A 1NK9A 1S6PB 5KTQA 3OYKA 3NFAA 3MECA 1J54A 4MFBB 1C6VA 1TV6B 1CZBA 2ALZA 5KFJA 4WFXA 3T3FA 1RT6A 3QIPA 3CJ2A 3T5LA 3OYJA 3OVNA 4B8AB 2HNYA 1RT6B 2WTFA 3S3NA 1RDAA 1VSDA 1TVRA 2B5JB 2DY4A 5DQHA 4E7IA 4ELUA 1HQEA 3KLHB 1VRUA 3KK2B 1S1TB 2IAJA 1WNEA 2V0NA 4WXOA 4O0IA 2ZD1A 3HP9A 3I0SA 3M8QA 5DK5A 2C28A 4DFKA 4M3WA 4NCGB 4E19A 4IRKA 4CGJA 1ASUA 4DL3A 3FFIB 4W5RA 4CJEA 1EX4A 1KLNA 4DLEA 5KT7A 3LP3A 3RAXA 1X9WA 4LSNA 4K4TA 4JS5A 4Z4GA 4TY8B 3EZ5A 4YNQA 3KK3B 1MU2B 4FYDA 1B9FA 4J2EA 5KFWA 3TAMA 3VQ6A 4DSLA 4CCHA 5HP1A 2YKNB 3EY1A 2V4QA 4CJKA 4FJNA 4JV0A 4OKJA 1S48A 2YNHA 2YNIA 2R2RA 4J9KA 3TAGA 1S1WB 3JYTB 4CEEA 4CJUA 4KHSA 4ECWA 4ECTA 1RYSA 2W8KA 1S97A 3SI8A 4I7FB 2QKBA 3ZT3A 3SI6A 4HKQA 3OS0A 3C94A 4BE0A 1GOAA 3Q8RB 2IOCA 1BQMA 3NGYA 4DWIA 4KI4A 1KFSA 4DSEA 1IKYA 5HLFB 5L9XA 3RRGA 2R8KA 4NYFA 2B5JA 3V1RA 1BQMB 2J6UA 1WAJA 3NF6A 4CHYA 1ZYQA 1UA1A 2XGPA 4CJSA 2ITGA 3V9SA 5F8IA 3FFIA 1RTJB 4MH8A 3NAIA 4Z4IA 2RF2A 1ZBHA 1HPZB 3KIOA 3VQCA 3M8QB 2HHTA 5KFSA 1KTQA 1S1UA 3HPOA 2D41A 4Y2AA 4JV2A 2XWYA 4R8UA 4FK2A 1FXXA 4LQ9A 4B9UA 1KFDA 3ZT1A 2F96A 3KK1A 2BRKA 2V4RA 3AVLA 1HQUA 2B43A 3L2RA 2ZE2B 1N5YA 5HRSA 1N48A 4CFBA 2GUIA 3WNHA 3NGZA 4NLYA 4FXDA 1S49A 3C6TB 3AVJA 3GIJA 3HKWA 3HYFA 2D5RA 3KLFA 2KFNA 1BHLA 1JLQA 1QS4A 5CYMB 4URSA 5KT4A 4W5NA 3NL0A 3NH0A 4YQWA 2Z1GA 3ISNC 4B9MA 4RW9A 1QTMA 3KHRA 1S1XA 2E6MA 4B3OB 3H5YA 3VQ8A 2IAJB 4N76A 3KLEA 5I3UA 1TL3A 1TKZA 3DOLA 3HVRA 2VA2A 3MEGB 3D28A 1HYVA 4ZVHA 2HW3A 1ASVA 4FVMA 4M45A 5CY4A 5DLFA 3UR0A 4LD0A 4AHTA 1FKOB 4CFDA 4KBIA 4KRFA 4H54A 4ICLB 4NYZA 4DL5A 4M42A 2WOMB 4F8RA 2VG5B 3ITHA 3VA0A 4FM1A 3S3MA 4KHWA 3KNAA 3RMAA 2IM3A 2J6TA 3N6MA 4FM2A 4CF8A 4ID5B 5J2NB 3SV4A 3NF9A 3QLHB 3AA4A 4ZP8A 1REVA 1JIHA 4FW1A 2BR0A 4KTWA 2EHGA 1QAIA 1S0MA 3MEEB 1TKTB 3CM6A 1LV5A 1REVB 2WOMA 3G10A 1TKXB 2KTQA 4OLBA 1LWEB 1FKOA 1WSEA 2D0AA 4KFBB 1TKXA 4IKFA 1WSHA 4AHVA 4B08A 4DFJA 3HSTB 4FLYA 3RR8A 2YKNA 3QEPA 3H59A 3OHBA 1IH7A 3RB3A 3ZCMA 4Q44A 4DEZA 1T8EA 2WRMA 3RRHA 1LWCA 3KLEB 2OPPB 3MR2A 2FLLA 3PZPA 3CVKA 3KD5E 4KHUA 3VQPA 4NCAA 4PY5A 5HBMA 2KFZA 3MAQA 4C8NA 3IG1A 2YNGA 3I0RA 3IN5A 4KE5A 3I5CA 1JKHA 3V4IA 2FVCA 4IOBA 4CHPA 4W5TA 5C24A 2YNFB 2VG5A 2BE2B 2D7SA 2BQ3A 3SQ4A 4Q8FA 1ZBUA 2WCXA 1RTDB 1HNVA 5C25B 4J9OA 4U7CA 4IFVA 2YHBA 5J2QA 2VA3A 4R5PA 3NBPA 1TL1A 5J2MB 5DG8A 3PX0A 3T5JA 1S9GA 3OL9A 2HAIA 3C6UA 4IBNA 5KT6A 3AVIA 3PW7A 3MR3A 4CJ4A 4PQUB 3LPUA 3M8RA 4MFBA 4CECA 4O44A 1RBRA 5C5JA 2E6LA 5C25A 3OLAA 3AVMA 4CJTA 3RMDA 4GC6A 3KTQA 4IDKA 4K4VA 3K2PA 4Q0BB 1HJRA 4PQUA 3CM5A 2FJVA 2GIRA 4EBEA 4HUEA 4QCLA 4K4SA 4ED8A 1SKRA 1RT7A 5KFBA 3DLKA 2IM1A 4QPXA 1EKEA 3SUOA 4DTJA 2Z1HA 2OPPA 4ECQA 2XHBA 4YR3A 1JXLA 3RB6A 1LW0A 4R5PB 3PJWA 2VG6A 2FC0A 4FJIA 1ZBFA 1JLBA 3NGIA 2IJFA 2BRLA 2DFHA 3QZ8A 5KFHA 2KZZA 1ZBIA 1Q8IA 5KFFA 3BREA 2FBTA 4KFBA 4O5BA 3IRXB 4CHQA 4JRPA 2DFFA 1FK9B 1SV5B 2Z1JA 1C0MA 3V4IB 4CJQA 4J9PA 1U49A 3F73A 3CDEA 3AO3A 4J2BA 3NBPB 4BDYA 3TAFA 4ZP7A 3C95A 3KJVB 4FS1A 3G6XA 3BGRB 4E1MA 1DTTA 3OL6A 4QAGA 2RDJA 4FLZA 1U47A 4PWDB 1N56A 2Q3SA 4Y3CA 1TP7A 3AVNA 3AO4A 1A5WA 4FZYA 3SJJA 1HMVA 1S1VB 1BQNB 4F4ZA 3IS9B 4CIEA 2YNHB 2P5GA 1MMLA 1NJYA 3NKYA 4Y1DA 1GOCA 5J2QB 4LSNB 5JS2A 2X6SA 4J9LA 4CEZA 2RPIA 4WYWA 4XIUA 2HB5A 4HYKA 2RDIA 3NCIA 4M3TA 1RAJA 5KG1A 2EC0A 3O3FA 4TY8A 1C1BB 1RT2A 5EWEA 3QZ7A 4X2BA 2P1JA 3SFGA 1I3AA 3V9ZA 1XHZA 5JUMA 3QINA 3MR6A 3NMAA 4KTZA 2AGOA 5KT5A 4C8MA 1QUVA 2O4IA 4TN2A 2GBZA 3AO5A 5EUHA 1S0NA 4ZVEA 3OYCA 4OKKA 3MEDA 1S6QA 2DTUA 4CFAA 4RNMA 5DGBA 5JS1A 4KB0A 4TSXA 4GMJB 4MIBA 1D8YA 4MIAA 3L8BA 4E7JA 5DQGA 2X6NA 3L3UA 4JUZA 4GW6A 4FLVA 4O3OA 3KLVA 4NLTA 3PO4A 1JLQB 4IH5A 3Q8QB 4ZHRB 3DRRA 1Z4UA 4RUAA 1U4BA 1LWFB 4FJJA 1GX6A 1K1QA 1RBUA 4OVLA 4MK7A 4ZPAA 2HHUA 2OPSA 1C1CA 1WLJA 2OH2A 3N6LA 1XWLA 5F8HA 2FBVA 3D45A 4FZXC 5HLFA 4BACA 1CSJA 4RW9B 3U3GA 4NCBA 4IR9A 1RT5A 3UIQA 4DQSA 1RT1B 4LSLB 3THVA 2ATLA 5CYMA 1TK5A 2D0BA 4H4MA 3ISND 3EPIA 4ECUA 3KLFB 5DLGA 1IG9A 4O3SA 3ZT2A 4BE1A 1S6QB 4G1QB 1NJZA 1S10A 4NLQA 4KHYA 1DTQB 3M9OB 3PX6A 3SUQA 4EP4A 3ZSYA 3EPGA 4AHUA 3AA5X 2F8EX 2P51A 1NJWA 4O4RA 1RT3A 2XY5A 3HVWA 3CDWA 5KG2A 3FDSA 4CJVA 4J9RA 3NDKA 4M94A 4DF8A 4G3IA 4TYBA 4E7HA 4PUOA 4HUFA 2BDPA 3KHGA 4TQRA 3LPTA 4FZZA 4CHOA 4CJRA 1HYSA 2QKKA 2KQ2A 1RT1A 2P5OA 4PUOB 2W9CB 1G15A 4CESA 1QAJA 4RW4A 3Q8PB 3H08A 4FJ8A 4YFUA 2IMWP 1LAVA 2JEJA 1Q9YA 1NK8A 5HROB 2W9CA 4ECRA 4RNHA 3OSNA 1W0HA 2AX0A 5KFDA 4CIFA 3LWLA 1W9HA 4PWDA 4DF4A 4QW8A 3NF8A 4J9MA 4TYAA 1S5JA 2I5JA 4EZ6A 3HO1A 1XHXA 2F8TA 3M8SA 4G1QA 3DI6B 4CGFA 3KMSA 4RW6A 4CJWA 5CZ1A 4RW7B 4OLAA 1F21A 3LP0B 4DU3A 5FDLA 4JRQA 4HCBA 2RKIA 3E51A 4M3XA 3QIPB 1RNHA 2DFEA 3TVKA 5HRNA 4DTPA 3C6TA 3DRPA 3GYNA 4URQU 3DYAA 1TK8A 3AVKA 4O44B 4J2AA 1IKXB 3IAYA 3GILA 3G6VA 3M8PB 3VQDA 3SYZA 2G8UA 4BE2A 1IKVA 4AILC 2Z1IA 1RTDA 4BWMA 3O4NA 4RNOA 1BCOA 4FLTA 2QK9A 1RBTA 3CJ0A 3L2QA 4ZVGA 4WFZA 4NYNA 1X1PA 3HHKA 5KG7A 4Q45A 3AV9A 3O3GA 3DRSB 4C8KA 4FLWA 4GVMA 3CFOA 4Q43A 1RTJA 1J5OA 3H40A 4I7FA 2FLPA 4E0DA 3CQ8A 3K5OA 2YNFA 3MR5A 4I2PB 3BR9A 4F4YA 4EZ9A 3AO1A 1GOBA 3V6DB 4QWCA 2JC0A 3PX4A 2ILZA 2IM2A 3QYYA 5KFYA 2VG7A 4IH6A 3TABA 1HMVB 1S4FA 3HVAA 4YP3A 1VSLA 4EP5A 1RTHA 3DRRB 4OL8A 4DQQA 3P5JA 1XR5A 4NLWA 3SUPA 2R8IA 5KFTA 1TK0A 3LANA 2I1RA 3C6UB 1RCHA 1KLMB 4CEFA 1L3VA 4ED3A 4RU9A 3TAPA 4YMEA 1BCMA 1SH2A 3VQAA 1ZTTA 1NK0A 1NK6A 4FJ5A 4FLXA 3NH2A 3SQ0A 1KSPA 4CGHA 4EO8A 5JXSA 4JV1A 3RWUA 4ID1A 4FBUA 2HHQA 1VRUB 4KAZA 3K57A 3SPYA 4CEOA 2WB4A 2AJQA 4F50A 2AU0A 4LY7A 5SZTA 2XO7A 4DTRA 4Z4HA 2HVIA 3LDSA 1RTHB 1VK0A 1JLGB 1QQCA 1CZ9A 1I39A 5F8JA 3UPFA 3IRXA 3RR7A 2B6AB 1EP4A 5KG5A 1QSLA 3DLHA 3PW2A 3QGIA 3NGDA 4NLSA 1S9FA 3G0ZA 5J2PB 4RNNA 4FK0A 4TLRA 5KT3A 3ZT4A 3HXMA 4KPYA 4FS2A 2BQUA 3KJVA 2R8JA 1NK7A 4FJHA 1SUQA 4O3PA 4CJLA 1HNIA 4BWJA 4DL7A 1VSKA 3VQ5A 1S9GB 1JLCB 4DQPA 4ED0A 1X9MA 1YT3A 4K8ZA 3BGRA 1RDRA 3M8PA 3VQ9A 4Z4EA 5SWMA 3CFRA 3JSMA 3SQ1A 4KI6A 3ZT0A 1HQUB 3DLEA 1W25A 3DOKB 5KFEA 1WSIA 3BSOA 5KGWA 3AVAA 1HQEB 1HNVB 2PZSA 1EETA 2JC1A 3DLKB 1WSFA 3LP0A 3EZUA 3BJYA 2YV0X 2KZMA 1J5OB 2HNYB 2ATQA 1T03A 2E4LA 3QESA 4C8LA 5L1IA 2DPIA 1HRHA 3LAKA 2OPSB 4KHRA 5T7BA 3GIIA 4HHTA 1T03B 3JSMB 1D1UA 5DMRA 3HL8A 4H4OA 4E7KA 4FK4A 3T1AA 4O4GA 1VSHA 1EP4B 4H4OB 2C2RA 1KHWA 4CK1A 1WNSA 4R0EA 2YKMA 4OKEA 1X9SA 2HNDB 3HP6A 4WE1A 5KG4A 4URGA 1BI4B 1B92A 3OYEA 1QSYA 4IFYA 1LW2A 4CF0A 1RA6A 3DLGA 4TXSA 1IKWB 1LAWA 1RBVA 4M95A 3BQ2A 2DPJA 2ASDA 2YNGB 4E89A 1C0UA 3QEVA 4DTUA 4E3SA 2I5JB 3DLEB 3TAEA 2QE5A 2VG7B 3N6NA 1SH3A 3TAMB 3U6FA 2R2TA 4CF1A 1UAXA 3DOLB 3QNOA 2AGPA 5DG7A 3VQ4A 2NUBA 3QNNA 1CXUA 2BANB 1T7PA 3SPZA 3CJ4A 1S1XB 4F3TA 3ULDA 2Y1IA 1BIZA 1JLBB 3TQ1A 3NH1A 3K5MA 3ZSXA 4NLDA 1LWEA 1ZBLA 5KFPA 4NLXA 1SH0A 2V9WA 4IG3B 3ZSOA 3B6PA 3FQKA 1RYRA 1T3NA 2UVVA 1NHUA 2WONB 4Z4FA 5I3UB 1YVUA 3GV5B 4U6PA 3TI0A 2AX1A 3DLGB 4O3QA 4DTXA 5C42A 1NNDA 1C0TB 1KCFA 1FKPA 1K6YA 3OS2A 1BI4A 1S9EA 3LAMA 3QGGA 5KFCA 3K5NA 4DG1B 3V81A 3CFPA 1TL3B 4I2QA 2JEIA 1SKWA 4M3ZA 4MKAA 4RG8A 5E41A 4ED2A 3LP1B 4B9NA 3IGVA 3DMJA 1EETB 2G8KA 3DYAB 3OL7A 5KRSA 4M3YA 1RDDA 1WSJA 5FROA 1YVFA 1XC9A 2OZSA 2W9AA 1L3TA 1IKWA 3DRPB 4CJFA 4ZVFA 5D3GA 1HPZA 2FBXA 4ZTFA 3UQSA 2ZQBA 1L5UA 3DRSA 1RT4B 3HPGA 4N41A 2AGQA 4IDKB 1JL2A 3OYAA 1SKSA 4Q8EA 3MEGA 4OJRA 3MECB 3PHEA 4IFVB 3H4DA 3JYTA 3BQ0A 3V9WA 1RT7B 1BL3A 1RA7A 3OL8A 2FVQA 4WYLA 3VQEA 3L3VA 2HMIB 1JX4A 2ZE2A 3ICLA 2IC3A 3VQBA 3KOAA 5HRPA 5F9LA 2JGUA 3OY9A 1EXQA 4ELVA 3H5SA 2E9RX 3MEDB 1S1UB 3GIKA 2IS3A 3D0PA 4DU4A 1B9DA 4F2RA 3T19A 3VQQA 3I0RB 4KV8A 3BSNA 4NLVA 5KFKA 4NRUA 2XY7A 4O0JA 3I8DA 1FKPB 3SQ2A 5C24B 1VSJA 3MTKA 2R7YA 5F8GA 3L2WA 3OJUA 1WN7A 3QETA 1U48A 4CHZA 3M9MB 1L3SA 1RILA 4KHMA 2C2DA 3AVCA 3V9XA 4K4WA 2UUWA 4HVJA 5KRTA 4CEBA 3QIDA 3V9UA 1JLAB 2OPQB 4DTMA 2W8LA 1O1WA 4NLOA 4RW4B 2OYQA 3SZ2A 2F8SA 2JLEA 1JLCA 4HCCA 5DGAA 5HROA 2FVRA 2G8WA 4KHQA 3GV8B 1D9DA 2D3UA 5KFIA 1C1BA 1RT2B 3IG1B 4WFYA 1U04A 4DL4A 4MKBA 5F8LA 1HYSB 3KHLA 4K50A 2IM0A 4AHSA 4DS4A 5J2PA 2FLNA 3QLHA 4CJ5A 3OYNA 3SUNA 5KFGA 1TKZB 1NHVA 1S1WA 2W42A 1UWBA 3CIZA 1R0AB 3PW4A 3GIMA 4RNFA 3NAHA 4DQIA 3K59A 5FRMA 3LP2B 4KO0A 4ZTJA 4IKAA 3TR8A 1HYZA 1BISA 3KKSA 3OYLA 4C8OA 3HM9A 4M3UA 1D0EA 1C1AA 4KTQA 4BDZA 5KFMA 1GX5A 1K1SA 2YNIB 3IGNA 3TWHA 4CEAA 3H98A 1JLAA 2OPQA 2E9ZA 5L1KA 4IRCA 1TAUA 4CGGA 1UA0A 4B9SA 3SCXA 4IG0A 3QEWA 1XI1A 3GQCA 3MF5A 4Z0UA 4LQ3A 2O4GA 2G8IA 3U3YA 4PA1A 5FDLB 4BDPA 4FJ9A 1XR7A 5D3GB 3PW0A 3S9HA 4J9SA 1DLOB 3O4QA 3E01B 4MK9A 3DM2A 3PW5A 3KLIB 5L1JA 3KMQA 3H4BA 3ZSRA 1J53A 3I5AA 3DLBA 4I2QB 4K8XA 4LSLA 2ZD1B 1NKBA 5EWGA 1JXBA 2G8FA 3SV3A 3OHAA 1N6QA 4FJ7A 2VWKA 2RKIB 2AWZA 3HVTB 4L8RB 4AH9A 5KFRA 2Y1JA 4B9VA 4I9QA 3NE6A 3RBDA 3OYHA 1UWBB 2XY6A 3OYGA 2FVPA 3NAEA 2HNZA 2FBYA 4XO0A 3HT3A 4DSJA 4AHRA 3LP2A 3IS9A 2HNZB 1CLQA 2UVRA 1VSFA 1KVBA 2D0CA 1C2PA 4CERA 4FM0A 4ECVA 4JLHA 4HTUA 3QO9A 3WNFA 4KREA 2ASLA 3DI6A 1TGOA 1JLFA 2RF2B 2ILYA 4RZRA 4XPEA 3PR5B 4ED6A 3UDLA 3HPHA 3ALYA 3CYMA 3PV8A 2UVUA 5KFAA 5J1EA 1JXEA 2D3ZA 3E01A 2HHSA 2HWIA 3ZSZA 4J9NA 2BE2A 1JL1A 3DDKA 4F4WA 3VN5A 3LALA 1KRPA 1KVCA 3PO5A 1TKDA 1TQLA 1A5VA 4H8KA 1QSSA 2CKWA 1UOCA 4OPJA 1T94A 3OYIA 1Q9XA 4EBDA 3RB0A 3K5LA 4Z4CA 2CJQA 1SL0A 1LWCB 4DL6A 3VA3A 1RT3B 3BSAA 3KK3A 3G86A 2EX3A 4EBCA 1N6QB 1VSIA 3BSCA 1S9EB 4ECZA 4OPKA 5CYQB 3RB4A 4YR2A 4ZMMA 3AVFA 4DLGA 3FQLA 2JEFA 1DTQA 4NLUA 3B6OA 4KHNA 4H4MB 1SL2A 3L2VA 5KFZA 5F8MA 2ETJA 2BANA 4J9QA 1LW2B 2R2SA 1S1TA 3V1QA 3ASMA 3CWJA 2HMIA 3F9KA 1NK4A 4DL2A 3KKRA 3CO9A 1RBSA 4IG0B 4NCGA 1QHTA 5J2MA 2PYLA 4WE1B 1IKXA 3TANA 1L3UA 2R8HA 4TQSA 3KK2A 4LH5A 1SL1A 3GV7B 4N5SA 2FJWA 5I42B 3PJXA 4QW9A 3PVXA 4FJGA 3V6KA 4CGIA 4DTOA 4FW2A 4F2SA 4Y2CA 5EWFA 4NLGA 4B9TA 1RDBA 5DG9A 5I42A 4ZPCA 4F4XA 4FJKA 3DMJB 1SUQB 2PY5A 5K14A 4QOZB 4DFMA 3DOKA 4K4UA 4Y1CA 3QERA 1NK5A 3V6JA 2HHVA 1JLEA 4J2DA 1ZETA 4K4YA 2IA6A 1LW0B 1LWFA 4CHNA 1WSGA 3CG7A 4OGCA 3D5MA 4CE9A 2QV6A 1DLOA 3ZSVA 1NJXA 3LP1A 2ZKUA 1XR6A 3OYMA 5HRRA 4DSKA 4M3RA 1FK9A 1RT4A 1J9AA 5K14B 2C22A 4RW8A 2BGGA 4IG3A 2HNDA 3WNEA 2GV9A 4RW7A 3L2UA 2IJNA 3A2FA 2XRIA 4MQ3A 2E9TA 4DSIA 4W5OA 1U45A 4CEQA 1JLGA 2HHXA 1DTTB 4Q5VA 3V81B 4FBTA 1IM4A 2B4JA 5F9NA 5KFOA 4NZ0A 3EYZA 1JLEB 4QWEA 5KFVA 2LSNA 1YTAA 1JKHB 2YHAA 2WONA 2AQ4A 4NLRA 3SNNA 4ZP6A 2OPRA 1NKEA 3OYDA 4XPCA 3QEIA 1RTIB 2A1SA 3OLBA 5L1LA 3AA3A 1BGXT 2W9BA 1RDCA 1U09A 2XCAA 2OPRB 1R0AA 5KG3A 4K4XA 1T05B 2IGIA 1QE1B 1HNIB 3PY8A 2KW4A 4IFYB 3AVBA 4DFPA 3KLGB 4K4ZA 4B9LA 4F3OA 3RAQA 1VSEA 2IC3B 4DMNA 4ECSA 3NHGA 3LZJA 5J1EB 1MU2A 3ZSQA 3SFUA 3OSPA 1N4LA 2G8VA 4CJPA 4KV8B 1A5XA 3O3HA 2XI2A 4TY9A 4RW8B 4E1NA 3AO2A 4Q0BA 4EO6A 4DS5A 1Y97A 4CK3A 4M41A 4CF9A 2W7OA 4CFCA 1IO2A 3OJSA 4AHCA 2GIQA 2WHOA 3LWMA 1RT5B 1D9FA 1BIUA 4QWAA 1OS5A 4ID5A 5J2NA 4KKOB 5EDWA 2X74A 2IBKA 3OYFA 3MFHA 4O3RA 3G6YA 3OS1A 4ICLA 5T14A 1QE1A 1C1CB 3FSIA 1KVAA 4ELTA 3RMCA 4NLPA 2XGQA 2ASJA 2UVWA 1TVRB 4FCYA 3V6DA 3I5BA 3BDPA 4ECXA 1S1VA 1Z26A 2VWJA 4EYHB 2XC9A 4DTNA 4DG1A 1KLMA 3ITHB 4ZP9A 3S3OA 4KKOA 4EYIB 2X78A 5KFXA 4ZPBA 5KG6A 1TKTA 2RN2A 4KAIA 4Y34A 5C42B 4CF2A 4FJLA 2OZMA 3VQSA 3WNGA 2UUTA 1YTUA 2XY8A 2VG6B 2WK4A 2GC8A 4QWDA 5KFLA 4JS4A 5CYQA 1C0UB 3MXIA 3KK1B 4WZMA 2HWHA 3Q8SB 4B3OA 1SV5A 3KHHA 1D5AA 4IR1A 4OGEA 3PUFA 3DLRA 4CIGA 3AVGA 4ZHRA 3H5UA 4CEDA 3T5HA 2B6AA 4RW6B 1VSMA 3CDUA 1ITGA 3CJ3A 4YR0A 4IRDA 1CXQA 2A1RA 3P1GA 3QEXA 5KGXA 4R8UB 3QIOA 1NOYA 3K58A 3PR4A 1I6JA 2R8GA 3KD1E 5KFQA 2HHWA 4IH7A 3V1OA 4KSEB 4DQRA 2BQRA 3P83D 3NF7A 3LZIA 3QGHA 4ED7A 2C2EA 4RUCA 2O5DA 3V6HA 4UQGA 2G8HA 3HJFA 1BQNA 1WAFA 3TARA 4I9LA 2W9BB 3HK2A 1JLFB 4DSFA 3ZSWA 1VRTA 1NKCA 3AVHA 3RMBA 4O3NA 3MFIA 2JEGA 1C0TA
chains in the Genus database with same CATH superfamily
5FRNA 1DBDA 2ZGYA 4ZITA 4QQBA 4BR5A 2W2MP 2XI3A 1HNWF 4I2PA 1VFJA 5BRFA 2ZOFA 1Q8LA 4ZCIA 3CI5A 2J9DE 1VBZA 1RTIA 4JKDA 1CJTB 2OKQA 4OI6A 1KQKA 2QXFA 1HBNA 3R1LA 3BGOP 2MJNA 4N56A 4V19J 3M6VA 3PIOQ 3C3LA 2HIQA 4UOHA 1V5VA 3A8EA 5DQIA 5HBMB 4G9ZA 3KXDA 4N47A 3PEHA 5EXWA 1T95A 1RBLA 3KLIA 1VDHA 2J6SA 4CJ3A 3FUYA 3FRZA 1HNZK 1R43A 4NWBA 1HARA 1YKWA 3C15B 1N5QA 1Y3JA 1GLLO 4CGDA 2UU9F 2MQOA 4KB1A 4DOZA 2FJXA 1U8WA 4F4KA 1T05A 3F9MA 2BKPA 3UCUP 3QO9B 4CK2A 7FDRA 1HW9A 2VFSA 2GZOA 1WC3A 4ITSA 3WXMB 5IM0B 4W5QA 3TAQA 4P2SA 4MIWA 2WVBA 1NOZA 1TL1B 1S6PA 3FSYA 1IKVB 1AFIA 2Q1NA 1GXTA 1ZS6A 5KT2A 1Z1ZA 2MHEA 3OYKA 5A8KB 3RAMA 1WC4A 1Q8BA 4TVAB 3NFAA 3E9PA 2RH3A 1TYQB 2FHOB 3JSBA 1RAHB 1N8RT 1HD1A 1C6VA 5GADI 4OJGA 5GIOA 1OO0B 4WFXA 3PRBA 3QIPA 3CJ2A 3T5LA 1OWXA 3OVNA 3A5NC 1RT6B 2IIRA 2HQCA 1TVRA 2MKHA 1LOTB 2BW7A 1YG0A 1MSWD 1RWUA 4BC2A 2IAJA 3GU0A 1TZ0A 2ZF5O 1WNEA 4CZJA 4FXWA 5DK5A 4M3WA 4Y6IA 3NCPA 4IRKA 1ASUA 4W5RA 1XNQJ 4CJEA 1ZH5A 3LP3A 2XBPA 3CDAA 4RBVA 2Q0RA 4RLEA 5K9FA 1YRTA 4Z4GA 4MYUA 5GAEI 4YNQA 2O8BB 1HUXA 4AQYK 4ISGA 1B9FA 5KFWA 5C2DA 3TAMA 1QVGM 5L39A 3V5RA 2BA9A 3W8GA 5M2RA 3EY1A 4CJKA 4ES3A 4JV0A 2PFDA 1VLOA 1IBLF 4ECTA 4YOTA 1ZAWA 2W8KA 1S97A 3U4LA 4I7FB 3R5BA 2QM1A 3OS0A 4BLGA 3C94A 1SCJB 2VV5A 4KGZB 3GB0A 1G1XA 3NGYA 3D1QA 1YITS 1N36F 4OYBA 3RRGA 2CNLB 3V1RA 3IWNC 1BQMB 3W66A 1HBUA 3NF6A 5GAHU 4BGBA 4CJSA 2ROPA 4MH8A 2HBYB 3KIOA 1JCGA 1U25A 1KTQA 4KYZA 2D41A 3MPDA 4R8UA 1NSKL 2CQGA 2V2QA 4B9UA 5AQXA 3PM9A 2P9KB 2CRLA 4PABA 2V4RA 4BROA 4B3RF 1G99A 3L2RA 5HRSA 4CFBA 3WNHA 3OFFA 4H0OA 4NLYA 1NAQA 1S99A 3ZZOA 4C1NI 3Q7CA 4DV1F 5CABA 2B56A 5LOQA 1AW0A 3VAHA 1KC8O 1JLQA 3HHLA 2W24A 5B0AA 1BOTO 2VB6A 5BPNA 2QN6B 3WXLA 4B9MA 4M5IA 4RW9A 3HI0A 2E6MA 5IXUA 1HWJA 3FEXB 4FPAA 5HSPA 2VA2A 2E5LF 4EK2A 3ZTOA 1HYVA 4ZVHA 1R7IA 4FVMA 4QYRA 1WTFA 3P5BP 1K73O 3LDQA 1FKOB 5D4PA 3E66A 4KBIA 4KRFA 1YJRA 4CIOA 4BRHA 4FSVA 2YWHA 2VG5B 3ITHA 1RBOB 3VA0A 2ZWHA 3S3MA 3BKFA 4JK8A 4FM2A 4ID5B 4DV0F 1H73A 2JX2A 3E1YA 3SIPB 3AA4A 2ZWOA 1JIHA 4FW1A 2DBBA 2BR0A 3MM8A 1QAIA 1KQGB 2GJIA 5IM0A 2CPEA 2UZAA 1BA1A 3MEEB 1REVB 1D3WA 4X4QA 3G10A 1TKXB 4UUXA 3SMSA 3H3NO 2A10A 2LECA 5LJVA 3R1XA 5D0HA 2CA9A 4DPTA 4IKFA 3HSTB 4JKBA 2V2VA 1G7CB 1O6XA 2F9WA 3OHBA 1IH7A 3RB3A 1Q18A 3ZCMA 3W65A 5CHCB 4DV1K 3ZFVA 2JWKA 3KLEB 2GHWA 2DY9A 3PZPA 4NCAA 3AQOA 5GAHP 4JKEA 1HWIA 4Y2MA 2PI5A 5J1PA 3T41A 2GAHC 3V4IA 4IOBA 3K0JA 4W5TA 3M2RB 2D7SA 4MTPA 2YHYA 2V8DA 3MR7A 4QS7A 3SQ4A 1DZ5A 2BE7D 5C25B 1BC6A 2YHBA 4JP8A 4P75A 4R5PA 4ZJOA 5E0OA 2ZFHA 4OI3A 1EIYB 2CZ4A 3LDPA 2HAIA 4IBNA 2HIYA 3MR3A 3M8RA 2KN4A 3OTOJ 1RBRA 4AFFA 1YITN 3K2PA 1WUAA 4PQUA 5DRKA 1SJQA 3CM5A 1NMEB 4DR2K 4HUEA 2QMWA 4UW2A 1SKRA 4OZ5A 2Z1HA 2XHBA 1UAWA 1JXLA 3FGVA 3DCAA 2FC0A 3U1MA 4FJIA 1ZBFA 1TUVA 1Q8IA 2HHHK 3IRXB 4JRPA 4ZVSB 1HBNB 3IBFB 1K9MT 1C0MA 3VGUA 4J9PA 1WTBA 5LSLA 4J2BA 3B54A 1Q0NA 3C46A 4KGKA 1YTYA 4ZP7A 4FS1A 2XYHB 1CJVA 2RHQB 5EVZA 3DHWC 4DR2F 1DTTA 2I38A 4QAGA 1VQ9S 3CMQA 4ZCLA 3DNCA 4FLZA 2MZSA 4QOTA 1U47A 3I55S 4NE9C 1TP7A 3VQTA 3O4WA 3AVNA 3JQKA 3AO4A 2YKAA 2RJZA 2HG4A 3ET6A 1RWPB 4NL5A 4CIEA 2RHKA 1MMLA 4Y1DA 4H0XB 1RKJA 4IWVA 5JS2A 2X1BA 4BC3A 1LXNA 1XMQK 1FX4A 5AQFA 3N01A 1IBKJ 5C2FA 3CD7A 2HB5A 4XH4A 1FRIA 2P6SA 2PMHA 5HQMA 2XNQA 1RAJA 2P9PB 2EC0A 4ILHA 1YIJS 4TY8A 5EWEA 3SFGA 5FLXU 3MDFA 4IO1A 4X62F 5JUMA 1NDKA 1N8RO 1SKUB 5KT5A 4C8MA 2O4IA 3A8JA 4Y0FA 2H3EB 3AO5A 5EUHA 3OYCA 1FESA 2YKQA 3LGHA 4CFAA 2DTUA 3OBYA 4LF5J 1NHKL 3HULA 4DXLA 4MIAA 3QPIA 2OMLA 2HBJA 3CNQP 3BB5A 4GW6A 1NMDA 4NB4A 1OQ3A 4IH5A 4ZHRB 4RUAA 1A9NB 3BN4A 1DKGD 4C11B 2JFDA 3NXZA 1GX6A 4DV0K 1RBUA 4PL7A 2KJVA 2LLZA 4DDFA 2ZJRL 1C1CA 1WLJA 1XWLA 5F8HA 1HL6A 4FZXC 2YJFA 3OUYA 3IM8A 1T6DA 2BX6A 4IR9A 2RILA 2KXFA 3W5ZA 3CPWM 2VGNA 3R5JB 3R9LA 5E5NA 3K17A 1U1OA 2NQPA 1X4HA 4K5RA 4H4MA 4M5DA 3CCSN 4HT7A 2GQ2A 1R3NA 4ECUA 5DLGA 2P9NB 4O3SA 4K0KF 2CXEA 3AJ2A 1YUWA 2HPUA 5ETOA 1UEUA 2CQHA 3BM7A 2MKKA 3GCWP 4G1QB 3ISZA 3SCKE 1DTQB 3I56S 3GJSB 1Q4RA 4JOUA 1NU0A 1CS4B 1K47A 4EP4A 3CCVN 1N33J 3K0SA 5BXIA 1MN7A 1XMBA 4G1PA 4AHUA 3CUNA 3PIPQ 5JVGL 1RT3A 5ADXH 4L72B 5MLCQ 1SVDA 1ROFA 5IT9U 4I67A 3F5TA 1CC8A 3KWMA 5F3TA 4JKGA 2OJ3A 4TYBA 2QSWA 2MDAA 4E7HA 4PUOA 4PR6A 4CHOA 1HYSA 2QKKA 4ILLA 1RT1A 1SJ1A 2P5OA 1QDUB 4JV5F 1G15A 3Q8PB 2DGWA 4PHTX 3H08A 2Y8YA 4AL6A 4JI4F 1NK8A 5HROB 3HHLB 4DX8H 4OZJA 1P27B 3GFHA 5GADP 4RNHA 1W26A 2Z58B 5IZHA 1UEKA 4CIFA 2EBEA 4MJKA 4OI0A 3NCQA 4FPIA 4DF4A 4J9MA 1EO1A 3QWPA 2RRBA 1KDNA 1VIOA 1YJ9N 3W9JA 2ZZMA 3M8SA 1BHNA 3Q2TC 1I3OB 3P6YC 4A8YA 2UXBF 4RW7B 1RAAB 5CZ1A 1F21A 3LP0B 4KH5A 1NGGA 2CH6A 1X7VA 2N4DA 2GHVC 4A8MP 3L95X 2PSZA 3KK7A 3W62A 1TK8A 4A59A 4O44B 1FRLA 4J2AA 4CZLA 4I0WA 3G6VA 3VQDA 3SYZA 2FZKB 1VAZA 3UDCA 5AQPA 4DUZJ 4YY3J 3C15A 4BWMA 2NYIA 3OXGA 2V7ZA 4FLTA 2QK9A 1WJ9A 5EN1A 1RBTA 2GQCA 1URNA 2CH5A 3HHKA 4JB8B 3SEOA 3AV9A 2J9EA 3OPKA 1Y7PA 2MGZA 4GVMA 4GNIA 4RL1A 4Q43A 1D4XA 4YOUA 3C19A 3X1LB 5FLXO 4I7FA 2V8GA 3J81O 4USKA 3ELHA 3B4MA 3U27A 3CQ8A 3JAMU 4PZVA 1NDPA 2OTLS 5T41A 2HLUA 3PX4A 1S57A 3AGRA 4HHUA 3HVAA 4YP3A 1VSLA 1WEXA 1KBRA 4CH1A 1RTHA 3P5JA 1DURA 2DISA 5KFTA 2RNEA 2KT3A 2ZOGA 3C6UB 4EHUA 4U67Q 1L3VA 4WQ5A 2F4FA 3TAPA 4KT0C 1C4AA 2D3OR 2HSTA 1XMOJ 3VQAA 4FJ5A 3BBCA 1BQXA 1WHYA 1RWMB 3SQ0A 1SQFA 1TELA 1YAGA 2HGMA 4DR3J 1BUPA 3BO2A 4FF3A 1QUPA 4B3SF 4LIRA 2W40A 2BJ8A 2RQCA 3HBTA 3T69A 2NRZA 2RSQA 4DTRA 3G6EN 3CDBA 1TMJA 4C3MA 3AAQA 3AXKA 1R8HA 3CD5A 2YWGA 1XNQF 1UVIA 1QQCA 4CZGA 3M32B 5F8JA 3UPFA 1CJVB 4MAKA 2VF3A 1EP4A 4CQ1A 2ZNZA 5DJBA 3DC2A 5KG5A 3DLHA 2IYGA 4NLSA 1KAYA 1EKRA 2VUGA 4TLRA 5KT3A 3ZT4A 2E1MC 3CXCR 1NK7A 2R8JA 1HWKA 3ZZRA 3PG9A 1IV0A 3UCGA 1HNIA 4BWJA 3VF4A 1S6UA 2LDYA 5LMUF 5C12A 4WFNQ 2ZH9A 2YQ1A 1VQNS 1X9MA 2P9IB 4CLTA 2R7RA 3O1BA 1RDRA 1Z2ZA 3VQ9A 3BPDA 4Z4EA 5SWMA 3L9ZA 4XAKA 2VBYA 3D66A 4B3SJ 2PMZD 4P10A 1MWKA 2R4FA 1WSIA 1W2BR 3BSOA 3A3PB 3HHLC 3VTHA 2PZSA 2AZ3A 3THPA 4R0JA 1WOQA 2M3DA 2JC1A 2QLWA 4CLYA 4UOGA 3TUZC 3PRVA 1TYQA 2HNYB 2E4LA 2HFSA 5L1IA 4B1WB 3LAKA 3JSMB 3W2VB 4UZBA 4X4NA 4FWKA 4E7KA 3BH7B 4O4GA 1EP4B 1VGYA 3DXMA 4CH0S 4R0EA 1VBXA 4TU8A 1X9SA 1Z6RA 3HP6A 3D67A 2W41A 5JICA 3OYEA 4YDUC 4CF0A 3DLGA 1IKWB 3GYXB 4TNOA 4M95A 3KJFB 3C6HA 4E89A 1C0UA 3VHQA 4BG8A 1S76D 1VC5A 5AXLA 5LJ5Y 3BDEA 4C6AA 2JOQA 1P8ZA 4Z37A 3I9V9 3N6NA 3TAMB 3U6FA 2CPIA 1SC4B 2AGPA 3VQ4A 2G2YA 2W1BA 2P9UA 4M63C 3MCNA 1K73T 1Q53A 1ZPVA 3CJ4A 3DOMB 3CE8A 4V19S 3ULDA 1ZM3A 4FZVA 1BIZA 1JLBB 3EN9A 3TQ1A 3NH1A 5ETKA 4NLDA 3P8BB 3SJHA 5KFPA 2ZBQA 3ZSOA 3J80O 1RYRA 4ED4A 3PACA 1NHUA 2Q43A 3TX8A 1VQ7N 1TUUA 3GV5B 2QWQA 4CZFA 4JK9A 1D8ZA 1U2CA 4O3QA 2W7AA 5C42A 1M90T 3HF5A 2XMMA 1H74A 3NVMA 2JVRA 3HHDA 1FEEA 4LC9B 4GV9A 3V81A 5AQKA 9RUBA 4PXEA 4MMOA 1R0BG 2N4CA 4M3ZA 4ED2A 1ACMB 2P9SB 4X62K 3IGVA 1EETB 2G8KA 3OL7A 1QM9A 2M7SA 1IG8A 1YVFA 4QIEA 4U7BA 1XC9A 2XYPB 4EWTA 1L3TA 1Q81O 4GO5X 1K44A 3DRPB 4ZTFA 4FOEA 2HRTA 4DR1J 4A46A 1I94F 3DRSA 1AZSB 1MROA 1UFKA 1FRMA 1P90A 1JL2A 2DR9A 3EDRB 1IM6A 2DNRA 4OJRA 5AQIA 4ZPTR 3DRXA 4DU8A 2ZH6A 1GLEG 3CC7N 2FVQA 2FGOA 4WYLA 3VQEA 3ICLA 3KWIA 1RXOB 1UZHA 3ZNJ1 3KOAA 3CT9A 5HRPA 2JGUA 3OY9A 4ELVA 1WD6A 3H5SA 1HBOB 2E9RX 1RHRB 1S1UB 1OPIA 3GIKA 3BZKA 2ZHAA 1NRKA 2M5YA 4DU4A 3SMPA 1B9DA 4IO9L 4A8WA 3T19A 2H5IB 5IWAJ 4J91A 4NRUA 4LF4J 1XBWA 4DV4K 3SQ2A 2EFOA 4OJ1A 1VSJA 1J5EK 2LKZA 5F8GA 5LMNJ 1L3SA 4HVJA 2XS5A 3QIDA 3SAFA 1WF1A 1O1WA 2O8FA 4B3MJ 3SZ2A 2YX7A 2HBLA 2JLEA 4A57A 1JLCA 4IEIA 1CULB 2LMIA 4BR7A 3H2VE 3M7VA 3FJ2A 4ZVQB 1D9DA 2D3UA 1VQLS 5IQ6A 4NI2A 4JI6K 3MM9A 4DL4A 5E84A 4KH6A 1PJ7A 2DCLA 3A5LC 2BE9B 3KUHA 1TKZB 1YHQS 3CIZA 3PW4A 3N4PA 2O67A 4DUYJ 4GY2B 2ZBCA 2W2OP 4RTFD 3K59A 2LA4A 4KO0A 2G9OA 4IKAA 2RB7A 3PYGA 1Y00A 3MM7A 3HM9A 1HPMA 1SJFA 1RHKB 1D0EA 1C1AA 5AQQA 4KTQA 4TLQA 4A2AA 1BE4A 5K8PA 3IGNA 2QTDA 2CQ2A 3FZKA 3N4WA 1TAUA 2ZC3A 1YI2N 4IG0A 3QEWA 1MMDA 4A8SA 3GQCA 4Z0UA 2O4GA 2QI2A 4BVOA 2NZ4A 5FDLB 1XIQA 2G0CA 1YIJN 1ITPA 1DLOB 4H5WA 2NZCA 4MK9A 3DM2A 4MKVA 1OH6A 1J53A 3NNCA 3DLBA 3HFVA 4R79A 2HQGA 2IIHA 2G8FA 5ETTA 3PIPL 1N6QA 5LL6Z 4DR6F 1FDAA 4O23A 4IOAQ 2ZVIA 3HVTB 4USTA 2QG9B 4L8RB 3G4SN 3B8AX 1NM1A 5JMVA 1M5VC 3L0QA 2XSJA 3MI7X 3NAEA 1EQYA 3BO4A 4AHRA 1F6TA 3IS9A 2V51B 4LF6K 2HNZB 3VZIA 1WUUA 1J27A 5D4NA 3M8WA 1VHXA 2ALYB 2D0CA 1C2PA 2F63A 4ECVA 3AXMA 3M2UB 3QO9A 2XMVA 1TGOA 3TSQA 2ZEJA 5AQSA 5D0RA 3PNIA 4F04B 4ED6A 3MK6A 1EJ7L 3CYMA 3A8YA 5GAEP 3CXCM 3CMES 2HHSA 1F3FA 3L7OA 1N0VC 2QO3A 3VN5A 3H6EA 5HQLA 4YOYA 2CKWA 4OPJA 4JI3J 4BRAA 4I6AA 1N52B 3K8VA 3W8PA 3K5LA 2AF6A 4OX9J 1SL0A 4J8FA 3VA3A 4DX6A 1S6OA 3BZQA 4CLSA 2ZBPA 1BWFO 3BSCA 4JI1F 4OPKA 4DLGA 3FQLA 3OTBA 2JEFA 4KHNA 2E88A 1JJ2M 3IFRA 1SL2A 3L2VA 3G2XA 5KFZA 4ED5A 4PYAA 1U1NA 2A3JA 2QC3A 1CJUA 4NEZA 2MZJA 1HI1A 1BWVA 4LFAK 1O8BA 2VH7A 1QHTA 2PYLA 4WE1B 4LF5K 3LQVA 1IKXA 3CJ1A 2P9NA 2QT7A 3CCLN 5EX5A 4NI2B 1CC7A 2EFPA 5J1NA 4DHVA 2M88A 2FJWA 3PVXA 4FW2A 3AY9A 4HL9A 1NSAA 2H4WB 3AOCA 4FJKA 5K14A 4QOZB 3DOKA 4Y1CA 3CPWR 5GAEU 1JLEA 2WUSA 3OVSA 2FZGB 5F41A 1YWXA 4MO5A 2UUCK 4CHNA 3UN2A 2XB2D 3FEZA 4OGCA 3VAMA 3OD2A 5ETRA 3ZSVA 3WXKA 2RDDA 1XR6A 2PGCA 2M8DB 1XNRJ 1BA0A 4GVBB 1FK9A 1RT4A 5A2QO 2OP5A 4NA3A 2BGGA 3Q24A 1FVQA 4IG3A 2HNDA 2A6MA 4DR3K 3A2FA 2PO4A 4MQ3A 2NLXA 2GVDB 1U45A 2D4WA 1K9MO 3UO0A 3OTOK 3V81B 4FBTA 4WU3A 5F9NA 5KFOA 4NZ0A 5HJXA 5B0DA 3GG0A 4QWEA 2LSNA 1JKHB 3J7ZT 1X4CA 2RU3A 2GGPA 3THWA 4QR0A 2I6WA 4XPCA 3QEIA 1RTIB 2A1SA 2KM8B 2ACYA 2W9BA 3CETA 4I64A 2OPRB 1R0AA 4K4XA 2DNOA 2IGIA 1PG5B 1VJWA 2GQQA 1HNIB 3L4IA 1Q82T 3I6PA 2KHCA 3M30A 4YOXA 4F3OA 1VSEA 2IC3B 2VFVA 4DPWA 1RAGB 3UD5A 4ECSA 2VPZB 3J81j 1X60A 4ILJA 1SC6A 4CJPA 2HHPA 3CJTA 4EO6A 4DS5A 4H5TA 1NGIA 3CCMN 3P4UB 2WHOA 3LWMA 1RT5B 1D9FA 3RUBL 3ULEA 3MFHA 1Q7YT 1RUSA 5T14A 1QE1A 1VQ5S 1BD6A 4LFCK 4ELTA 2XGQA 2HQIA 4DR4K 2G1DA 2FHJD 3CEDA 5C2GA 2R7QA 3I5BA 2AJ0A 4ECXA 1Y0HA 4OX9F 2XC9A 3H90A 2F8HA 2E1AA 2AA4A 2R7UA 2X78A 4BRIA 1VQ4N 5KFXA 4ER8A 1IQTA 4FYVB 4B1XB 3LOUA 2OZMA 2OUGA 3FKBA 3WNGA 2CWKA 1YTUA 2GVZB 2VG6B 3O44A 5KFLA 3NEKA 4HI1A 1C0UB 5DM7Q 3MN9A 5EGYA 1UFWA 2V8HA 3I33A 4DUZF 4Y65A 4LF7K 4C4WA 3IR6B 2E5LJ 4IR1A 1D5AA 4DUYF 1XNRK 3DLRA 3ILJA 3H5UA 5M2PA 5AQGA 4RW6B 1CBKA 1RDUA 3VEVA 2OEMA 3GONA 3PR4A 1I6JA 2VGMA 1HKGA 3TU5A 3VF2A 2XMUA 2W25A 2PEBA 3O8WA 5I3PA 4HI2A 1DQ9A 4YDUA 2MMYA 3QGHA 2VKRA 4ILGB 2O5DA 3TARA 5KPRA 1WELA 1HKCA 2IBOA 4ZIVA 3AVHA 1X4BA 3RMBA 4DUYK 1BO5O 4IJNA 3HJVA 3SBGA 3BR8A 4ED1A 1ZM4A 3H5XA 5CHIA 1PAUB 3SMZA 1NSQA 2G0JA 2RRAA 1RCOB 1VQKN 4CLUA 4HUGA 4B8CA 3AHPA 3ZZUA 1X8DA 3VF0B 5IS2A 1HR0F 2Q31A 4O55A 1H7XA 1NM2A 1PCAA 4NEYA 3VGLA 1UMJA 3T5KA 2E1ZA 3TYTA 3WDOA 1YBAA 4H5RA 3KLGA 4FJMA 3WQTA 2PEHA 5KFUA 1YJNS 3J7AN 2R2UA 2RMLA 3I0SB 4LH4A 3WBZA 2FHKA 3U02A 1FD2A 2M52A 1PKUA 1RP5A 5IWAF 1H1VA 4MK8A 2OA8A 2DEJA 2B7CB 3BEGB 4ECYA 1BG3A 2C3MA 1MN9A 2KT5A 2B9WA 2YQ3A 3VAKA 3TVZA 4BY9C 1H38A 3VMFB 3DM2B 1S7HA 2IDOA 4QWBA 2CQ0A 2YKMB 3H2LA 3D2FA 3O08A 3C6AA 2HBMA 1NK9A 1S6PB 5KTQA 5CR4A 3O6WA 2VKZG 1OY9A 4CO0A 1OH7A 1J54A 4LF4K 4Y00A 3OVAA 3NOGA 3J81Y 2ALZA 2DK2A 5KFJA 5GINA 3T3FA 3TTFA 4F3QA 3OYJA 1MWQA 3Q8YA 4O0NA 3T6BA 2Y8WA 3DGVA 1FRXA 2WTFA 1NH7A 5DDRC 5AE3A 4E7IA 2O8CA 2B51A 4GVLA 3JXOA 3KK2B 2YTCA 3FR0A 3T1YK 4BHQA 3LM9A 4O0IA 2DNGA 2KI2A 3FCVA 1BWEA 4DFKA 2CGLA 4NCGB 3J80Y 1FE4A 2HGNA 2NXUA 1GLJO 1RU2A 4FKXA 2KHDA 1RKIA 4K59A 1EX4A 1GEHA 1YJUA 4F67A 4DX7A 3OR2A 4DUZK 3RAXA 1UWAA 4JS5A 2CJBA 3DGPB 4Y0WA 2F65A 1MU2B 3PXGa 4FYDA 4J2EA 4OPAA 4CCHA 5HP1A 3D6RA 4NYOA 4FJNA 3MMAA 5ETVA 4OKJA 1S48A 2YNHA 4J9KA 1HNWJ 1WF0A 3M05A 2ZJQQ 4CEEA 4CJUA 2VHGA 4ECWA 1S12A 1Y5NB 1XN9A 3N5FA 1W97L 2QKBA 1Z2LA 4HKQA 2MY8A 1UVJA 4BE0A 1U2VB 2E2NA 3SQGA 2FC8A 2HBRB 2J7KA 1P1LA 2UUAF 4KI4A 1IKYA 4RO0A 5L9XA 4DHYA 1DQ8A 3MMJA 1HNZJ 4NYFA 2B5JA 1G3OA 1O51A 4JKFA 3KYLA 4CWBA 1X4FA 3G25A 2XGPA 1LK5A 1RTJB 4Z4IA 2RF2A 1S7IA 2QRRA 1HPZB 3L09A 3C0BA 2V2ZA 1S1UA 1WEYA 3PEJA 4LQ9A 5HVGA 3C16A 2O3DA 4UF4A 3G82B 2HVZA 2F96A 6FDRA 3HX9A 3PIOL 4LF8F 1KP6A 1T44A 2ZE2B 1N5YA 1X4EA 3PFOA 3NGZA 5HVFA 4LIWA 4FXDA 2DHXA 3GIJA 3HYFA 3TA0A 3CJQA 1VHIA 1QS4A 5CYMB 4W5NA 3C14A 3NL0A 3IMQJ 3VAJA 4L75A 3M3ZA 3M6WA 2UV8G 2Z1GA 5BR8K 2C2MB 3PYDA 1QTMA 3OQ2A 2A5XA 3DOMA 4FYXB 3PYFA 4B3OB 2E2PA 3PLAA 1WB9A 4L3NA 4N76A 2EC2A 5I3UA 3HHEA 4I6MB 3WEEA 4BRMA 1N32J 1TKZA 3DOLA 4CH7A 1HA1A 2VU5A 2HW3A 3HOTA 2M70A 1ASVA 4M45A 5CY4A 3UR0A 4LD0A 1YJNN 5HMZA 3CCSS 3UN3A 4AHTA 4ISFA 1ZA2B 1VQLN 4BGAA 3MHYA 3ETOA 3T1HK 1J5EJ 4NYZA 4M5JA 1IBKK 4F8RA 2E7VA 4P52A 4ZIWA 2VIHA 1JK9B 1LXJA 2C3YA 3LA0A 4P73A 5A6WA 2J6TA 4YB5A 1ZC6A 1X4AA 3MEKA 4NXMK 2RRNA 3U9ZA 3H3OB 3SV4A 1HI0P 3NF9A 3J7A1 4CYUA 1DQAA 1REVA 1FFWB 2QEXN 1N0UA 2BOAA 1LV5A 3J7YU 1WF2A 2KTQA 1WSEA 4BR2A 3M5RA 3B8HA 6AT1B 1WSHA 2KB2A 1WC6A 3H59A 4JI4J 3QT6A 3HOSA 3IXQA 4KQZA 1LFWA 2GHPA 2WRMA 2FLLA 1FI4A 3CVKA 4DR5K 4KHUA 3VQPA 1DT9A 2LP4A 4IEEA 4C8NA 3RU0A 3IG1A 3HFKA 4HHHA 2JWNA 1F5CA 3WHIA 4I68A 3U7JA 2FVCA 5IC6B 2YNFB 2ZH5A 2BE2B 2L9WA 3KWGA 5AXNA 4DV2F 3KUEA 2FF3B 3D0HE 2H4YB 1UW4A 1O13A 4M5KA 1Q7YO 4BBYA 4M5LA 1HNVA 1RACB 4J9OA 1GXLA 3R3TA 1H2VZ 2O01C 2VA3A 4HWIA 4H0VB 3NBPA 2M9KA 4F26A 1WBBA 1WWHA 5J2MB 3CCQN 5HMXA 5CZVA 5DG8A 5AFUH 4QIWD 3PX0A 1A0OB 1VISA 1ZXOA 4Y2IA 3OL9A 3VWSA 1YZ6A 4WQ5C 3PW7A 1FNOA 1EKSA 3FLCO 1F9FA 4PQUB 3LPUA 4CECA 3W7BA 1Q81T 4GC6A 3WC2A 2WSFC 4IDKA 4K4VA 1K8KA 4U96A 3UVJB 2FLOA 1S22A 3DDNA 1RT7A 3DLKA 3SUOA 3G6ES 2A0FB 4C7QA 3AJDA 5AZJA 5B0FA 2VG6A 4JYAF 1CLFA 2X7IA 1P6TA 4X64K 3NGIA 3MM5B 3O6QA 2RS8A 4DMZA 3HSJA 4O5BA 2ZJQL 1SV5B 2E5GA 2Z1JA 2R9LA 3LDLA 3R1HA 3H46O 5D6GA 8RUCA 3CDEA 3SQOP 3C95A 3G6XA 2Y0SD 2VOPA 1QQOA 5THWA 4M63A 3OL6A 1ATSA 1VJQA 2G4BA 2NZTA 1N56A 2W4PA 3KDNA 4EGLA 4Y3CA 4YN3B 2CPZA 1A5WA 4FZYA 3SJJA 3NY0A 3TZZA 1HMVA 1S1VB 3HSCA 2JLFA 3FBCA 1BQNB 3NKYA 1NJIO 4J5OA 1FA0A 4CP5A 2LQ5A 4LSNB 3K9KA 3EJMA 5FJ4A 2E7WA 1HWUA 4WK3A 3TR5A 4XIUA 4DV1J 1YBTA 3NCIA 1K8AO 2F4VJ 1M0SA 3M32A 1DFDA 2YI1A 2E8AA 5B08A 1LKZA 3NMAA 2AGOA 4DV5F 3MD3A 4TN2A 2QEXS 3RVCA 3EGWB 4A8OA 2GBZA 1VQYA 5BYQA 3MEDA 1Q8KA 5DGBA 5LL6d 4KB0A 5DO2A 1X0FA 2CJYB 2POKA 4MIBA 4AXJA 4BS2A 1H7WA 1F0XA 1S59A 5DQGA 2X6NA 4JUZA 3N9UC 4FLVA 1VI7A 1IR1A 3KLVA 1HLUA 2Z2LA 1KD1O 2DXDA 4HH1A 4XK8C 3DLLL 4NXMF 3K5PA 3MPVA 1LWFB 4BR9A 1K1QA 4FVCA 2LVWA 5CXTA 2VASA 1RLDA 3L3CA 3IM9A 3HM8A 2WW4A 4DV0J 3D1HA 2Q0UA 1KEKA 2F4VF 2FBVA 4OO1J 3K89A 3D45A 4LF7J 5HLFA 3A0IX 3EXYA 4CT9A 1CSJA 5D4OA 3QB0A 4NCBA 2Y9HA 4AL5A 1KS2A 2OCEA 2QWOA 3CCZA 3Q83A 1HFEL 3THVA 1F3VA 5EHHA 2MLXA 1ZAXA 2CFXA 5DM6L 2PE8A 5K8OA 4IUFA 2D0BA 3GJQB 4DCJB 5BR8F 4PWUA 2XULA 1T9VA 3KLFB 4HACB 1YQHA 5BREA 1NJZA 4DR6K 1S10A 3GFYA 1VOMA 4NLQA 3ZEUB 3O2IA 3M8YA 3M9OB 2EEYA 2DGSA 4NYPA 2FJAB 3FZMA 4QPTA 3PX6A 3CCJN 2ROGA 3SUQA 3ZSYA 2DGQA 2F8EX 3O8MA 4IOXA 3JTNA 5KAKA 4K2XA 2UV8A 1JXVA 4O4RA 4C98A 3HVWA 5CH7B 1KQSR 5KG2A 3FDSA 4CJVA 3NDKA 5CZXA 5GAGP 4PPDA 4P2FA 4NX9A 3Q23A 3KHGA 4FZZA 3WIUA 3CD0A 4CJRA 3I55N 3S7RA 3PSIA 2O8DB 4EU0A 4USMA 1VBYA 1HIYA 2JJ4D 1SC3B 2BZ2A 1NPKA 3CO0P 2EFQA 1QVGR 1IBMF 4JHDB 1GTEA 3OSNA 5KFDA 2VICA 3P3DA 4ENOA 1AUDA 4PWDA 5AQVA 4OZ1A 1NBEB 1PC5A 3ILLA 5HMYA 2DNNA 3H7HB 3FNNA 3SAGA 2HQ3A 3DWLA 4ZLLA 3BUZB 2I5JA 2J7WA 4EZ6A 2VFUA 3TP2A 2UUAK 1ZZFA 3CCVS 3Q8UA 2XZWA 3VESA 1XHXA 4NO7A 1XMQJ 2EFVA 4OLAA 4JI7J 4FOIA 2IVFB 2RKIA 3E51A 5KQDA 3H8YA 3QIPB 5LXRA 2K3KA 2C42A 2P8IA 3W2WB 2RQ4A 4A4JA 4E98A 3G71N 3AARA 4DL0C 3GILA 1EZZB 3M8PB 3DGPA 4BE2A 4QYZK 4V19X 1RTDA 3JSRA 3O4NA 1BCOA 5KOWA 4Q7AA 3L2QA 1F5BA 4WFZA 4DV4J 2M2BA 3O3GA 2LXUA 3OR1A 3DRSB 1AZSA 1MROB 2W6KA 3FRYA 1RTJA 1J5OA 3VGSA 2XLIA 3C7NB 1RGVA 2FLPA 5HL7L 5F3ZA 2J76E 3K5OA 2YNFA 4I2PB 4OIXA 3AO1A 3AQPA 1WDTA 4ATNA 4RWTA 4ISEA 3N0VA 1JNRB 1NPPA 1EX8A 2IM2A 4IH6A 4ZJQA 4EP5A 2UUCF 4OL8A 2FJBB 1VQPN 4Y28C 4USHA 2ZKTA 3BKTA 4ALZA 1KQSM 4ED3A 2YPYA 1T3VA 1SH2A 2K1RA 2XLJA 1I94K 4RWWA 2JSXA 2JRSA 1DJ0A 4H0PA 4EO8A 2J4RA 3HZGA 4ID1A 1NGBA 1VRUB 2C2NA 3QGPA 4X65K 2WB4A 2XO7A 2V8VA 2X1AA 1N5SA 2R7TA 4LFAF 2QLJB 2ZHBA 1U26A 1JLGB 4JYAJ 1CZ9A 3NGTA 1I39A 4NPOA 5A8WB 2DGXA 3C2PA 3RR7A 1IXKA 4DV4F 2B4VA 1R31A 2FDNA 2GMHA 3R7BB 3PW2A 1S9FA 1K8KB 3KKFA 4RNNA 4FK0A 2O66A 3HXMA 4FS2A 3ADAC 2BQUA 3KJVA 4FJHA 2UUAJ 2Q2RA 4DL7A 3M4XA 2ASOA 1VSKA 2MQNA 3VQ5A 4ETZA 2XMTA 3A13A 4ED0A 4C97A 1RHMB 4C0BA 1IWGA 4ZCKA 1T3OA 4ILRA 3CFRA 2HAFA 3SQ1A 2IYIA 4KI6A 3ZT0A 1HQUB 5CAAA 2WVCA 4GKJF 1HNVB 2HGLA 3PJ9A 1CQNA 4YY3F 1F2GA 3UD4P 1WSFA 2Y1LB 2QL9B 2MJUA 2YWKA 2KZMA 2F9JA 3G8TA 4K25A 1TU0B 2DPIA 1EB0A 1HRHA 1S72S 2IVOA 5HK4A 4UZCA 3DRYA 3GIIA 1D1UA 1WI8A 2EFGA 3KUGA 4H4OA 3TJ9A 4CZCA 2XG8A 3CC2N 3T1AA 3UNGC 3E9OA 3ZYYX 8AT1B 3GPAA 3O9QA 2YKMA 3EGVA 4OKEA 1LFPA 4WE1A 5KG4A 1BI4B 1B92A 5IOLA 1QSYA 1F9EB 2HVEA 1VQMS 2CPFA 3OXLA 1FEHA 2WVFA 1X5SA 2DPJA 4I56A 3B78A 4DTUA 2I5JB 2CNNB 2ZH2A 3TAEA 2VG7B 4ZK7M 1RHUB 2ZWPA 1IBLJ 5DZ6A 3VZHA 3POTA 2RHSB 1NJIT 4CF1A 3QNOA 4OZ3A 4IDHA 2VC0A 2ZJPL 2VC1A 2BANB 3SPZA 4OJHA 1X5PA 4YOVA 2A40A 4F0MA 2FSNA 2Y1IA 5BYRA 3BF4A 3K5MA 2YWFA 1ZBLA 4CZMA 4NLXA 1SH0A 3B6PA 1T3NA 2WONB 2BJ3A 3QRRA 4X4OA 5I3UB 2ASMA 2E5HA 5DETA 3BEXA 1N88A 1JWWA 3S1TA 4YHHF 1GLFO 4DTXA 3AY0A 4K42A 4IO9Q 1URRA 1BI4A 2LEAA 3KJQB 4LR8A 3LAMA 3TSUA 1AFJA 1FT8A 3VOVA 4A61A 3O9RA 4B1UB 2JEIA 4DZDA 1H2UX 1NO8A 4MKAA 4DPUA 4IJAA 2HHHJ 3IC1A 1VRQC 4K8RA 3Q86A 1WSJA 2VZ9A 1RGIA 3JS9A 2W9AA 1VIXA 1VQ9N 2QYCA 5D0GA 3ZETA 1PGZA 4PXBA 1FDBA 4ZVFA 5D3GA 2DH8A 4BQZA 1DARA 2DRBA 1HPZA 2P9KA 4PWWA 3CULA 1VQNN 5A6PA 1BY9A 2VWBA 3H2UB 3R9PA 3VEZA 3HPGA 4B1ZA 4IO8A 2AGQA 4IDKB 2DH7A 5IQQA 3IFEA 1SKSA 4Q8EA 3DN9A 4WP8A 2HFOA 4MLHA 1BL3A 1RA7A 4DPYA 3W2WA 5F9LA 2C3OA 1YJWS 1NLVA 2AJ1A 1EAYC 1NB2A 2KHOA 4F2RA 1WHVA 4LMZA 3BSNA 5KFKA 5AQTA 1IWAA 3I8DA 5KOXA 2X3DA 3ZZTA 2XMKA 1V5IB 2NPIA 3QETA 1NGCA 5C2CA 3AVCA 4K4WA 2UUWA 3VAIA 3MX2A 2J0WA 3KG0A 5KRTA 1JLAB 1VQ5N 3O1LA 4C0HA 3J7Z5 5H9FJ 4RW4B 5F0XA 1KQFB 5DGAA 5HROA 2QA4G 4B3MK 4KHQA 3F56A 1RTZA 2UXDF 5KFIA 1ZA1B 1C1BA 1RT2B 2OEJA 4CVNE 4MKBA 5F8LA 2UUBK 5GAHI 3KHLA 1Y4ZB 2IM0A 1S5ZA 5J2PA 4DS4A 5BJRA 2PAVA 3QLHA 4YDXA 2GIFA 1VQ7S 1U6BA 4RNFA 1HD0A 3AODA 2JNJA 3J80U 3LP2B 4ZTJA 3TR8A 1BISA 1VQON 2HURA 4C8OA 1JCEA 4GKKF 3MM6B 1JJ2R 3TJ8A 4BDZA 4BR0A 4USUA 2JZ5A 5ETQA 2QYGA 4B3TF 4XDDA 2GV1A 1U1LA 3BGUA 1D9AA 5D15A 2OPQA 5L1KA 3UVJA 2IA0A 3FBFA 3PTWA 2L48A 4C9DA 3D0IE 3CSKA 4BDPA 1FJCA 2MQ8A 3T9NA 3PW0A 2DNLA 3S9HA 4J9SA 4JAXA 3KMQA 3KLIB 1V9OA 2GVZA 2WSEC 1T9UA 2KXHA 4OX6A 3H4BA 1FF2A 4I2QB 4K8XA 2P9GA 1Q78A 4K41A 1ULRA 1NKBA 3BGFA 3TTDA 1NDCA 4WF9Q 4ES2A 3OHAA 4MKYA 4FJ7A 5G0RA 3H1QA 2MKYA 2RKIB 5JVGQ 1B99A 1LWXA 3M2VA 3J7AP 2Y1JA 4I9QA 3NE6A 1X4GA 4FNHA 4GKKJ 2I7NA 4IOCQ 2HNZA 2MZRA 1IBMJ 1VQKS 3VV2B 5GMDA 3BF3A 4RJVA 4DSJA 4PKIA 3LP2A 3PRDA 1FFGB 2UVRA 2GELA 2DITA 3W63A 4MDAA 2LXFA 5M1QA 1KVBA 1F9HA 3QDKA 3JXUA 4JEPA 4KREA 3DI6A 1UJ5A 3SLCA 1JLFA 3OW2R 4RZRA 4XPEA 2M8HA 3T7ZA 3QBXA 4CLZA 3UDLA 2CJXB 3ALYA 3Q2SC 2HBQB 4ANEA 4B3RJ 5HJYA 1B64A 2N3OA 4YORA 3KG4A 3W64A 4J9NA 1JL1A 2CNKB 4D3HA 2RVJA 4F4WA 2FY8A 1KVCA 3ZNUA 1TKDA 1TQLA 1UVKA 1A5VA 4H8KA 4CZKA 3F44A 1UOCA 2GNKA 4DR4F 1T94A 3OYIA 1Y11A 4EBDA 4JI3K 4DI6A 1U2VA 1LWCB 1XJWB 3I32A 1ZBSA 4LRAA 3KK3A 4YS2A 3A3NB 1HNXK 3KZBA 1JMTA 2BBEA 2UYTA 4C0OC 4EBCA 4MDBA 2NXJA 2MKSA 5DM7L 5CYQB 3RB4A 1UTAA 4ZMMA 3AVFA 1UKUA 1OY6A 4BC9A 1UZDA 3HHLD 1WORA 4P7VA 4F0KA 5F8MA 2BACA 2NRHA 1S1TA 4JI5J 1MDUB 1Y64A 3CWJA 1E6VA 3B6BA 1NK4A 4HEA9 1U1QA 2UUBF 1GT8A 1RBSA 3WUHA 4L3KA 1L3UA 3GDQA 4XH5A 3PJXA 4QW9A 4FJGA 4CGIA 2Z2ZA 4ETXA 1HQ2A 4DTOA 3WIVA 4OLOA 4Y2CA 2VDIA 1RDBA 1W7AA 5I42A 4ZPCA 1X31C 1WC5A 2KRRA 5FPEA 4J9UE 1AXQA 3UKUA 2ZJPQ 2OSQA 1NK5A 1MG7A 3ZZZA 2YHXA 1LWFA 2ZITA 2GO9A 3MAAA 1FVSA 2QV6A 5C0YA 3V4MA 1NJXA 3LP1A 1P9YA 2B8PA 3MMBB 4DSKA 4BC5A 4JKAA 3VF6A 3SK3A 2D69A 1TL7A 3ET6B 2W6LA 2AIRB 1CJTA 4OHYA 1VLYA 3L2UA 1CJKB 4WQ4C 5BR8J 2RAQA 1DTTB 4Q5VA 5AQOA 3MM6A 2YHAA 5C15A 3N5BA 1B7YB 2AQ4A 3SNNA 3GZ7A 2O8EB 1NKEA 2OPRA 2P6TA 3OYDA 3R7NB 2BABA 1TL4A 5GVQA 4A62A 3ZTPA 3QQCD 1RDCA 4KGMA 2YH1A 5KG3A 1T05B 1FX2A 3PY8A 2KW4A 4IFYB 8ATCB 4JKCA 4DFPA 3KLGB 4K4ZA 4DV6J 4DMNA 1Y3KA 7FD1A 2XQCA 4I69A 3U9DA 2CPDA 3WC0A 4DCPB 4YOWA 3LZJA 2HS4A 2V34A 1MU2A 5AXMA 3OSPA 1N4LA 2J0SD 4RR5A 4PL8A 3CMEN 4IFEA 4TY9A 3AO2A 4LF1A 3KDOA 1RI7A 4M41A 2NRXA 4CFCA 2NUUG 2NS1B 3QJJA 4CZIA 4ZA1A 4AHCA 1LCUA 4QS9A 4QWAA 5J2NA 4CNZA 4KKOB 2IBKA 3OYFA 4O3RA 1FJGK 3G6YA 3OBIA 3OS1A 2JFKA 3QATA 1FO1A 2KO1A 3MM8B 4UY8T 2KH9A 2WZ1A 2FJEB 3ONQA 3J7ZO 5IT9O 4DR4J 3BDPA 2AT1B 3GTYX 5IT4A 2KG0A 2VWJA 1Z26A 4EYHB 4DTNA 3IKMA 5GMEA 3RW6A 4DG1A 2QW9A 1KLMA 3ITHB 4J37A 4ZLJA 4ZPBA 1EWRA 2AYEA 1TKTA 1GH8A 4KAIA 3T1YJ 4NZ6A 4YHHK 3VQSA 4F36A 3VAGA 2UUTA 1R0CB 2QWNA 2XY8A 4DV2K 4QWDA 2B4UA 4LF6F 2VBWA 4WZMA 2PIIA 4B3OA 3C14B 3KHHA 4KH0B 2EW9A 1IBKF 3AVGA 4DV7K 2EK1A 4OYPA 3EWGA 5LM7E 1M90O 1VQPS 2B6AA 1VSMA 1FDNA 4HH0A 4OPHA 3OTCA 4GVEA 3CJ3A 4YR0A 2APOA 2DH9A 3R2DJ 5KGXA 2Q36A 7AT1B 4HHJA 2CZVC 3MPYA 4CW7B 5M1NA 4KSEB 1N5TA 3OFGA 3TA1A 3CF5Q 3W3SA 1TUYA 2C2EA 5ETSA 2QTWA 3AFGA 2G8HA 5M1PA 2W9BB 3HK2A 5ETMA 3ZSWA 4JKHA 3MFIA 4KH1B 2JEGA 2ADCA 1PC4A 2HS3A 1UFLA 4ZN3A 4LF9J 3FFKB 5AQLA 1IKYB 2QLXA 1PJ5A 4LF9K 2DIUA 3CJ7A 4JI1J 4WTYA 1ASWA 4K0KK 3M9NB 1NNEA 3EL2A 4FDFA 2ZM6J 2QL5B 1NDLA 1FW6A 3CCRN 5E3RA 3MM5A 3T1HF 1KOOA 4TU9A 4QU7A 3RBEA 3HVTA 1TAQA 1WACA 3NLCA 3CJ5A 1OKJA 2VOOA 1YRXA 2HVHA 5HP1B 2ERRA 1MWZA 3WXIA 5E2QA 1N5YB 1Q5VA 1R6VA 3MMAB 4W98A 4FJXA 4DU1A 2QSFA 4USIA 1XNRF 4AYBD 1S0OA 3D68A 2COLA 1GFWB 4F25A 2ZC4A 1TV6A 4JI7K 3SBTA 3UKRA 1ZTWA 5HO4A 3FEYB 4IQXA 1WG1A 3KLHA 4KB7A 4NRTA 2W7PA 5BN8A 3VQ7A 2HFNA 4NMLA 1KHVA 3MXMA 1N32F 1YLXA 4FVUA 5I9EB 4U8YA 4JI8K 3BP8A 5A8RA 1LQ9A 4CM2A 4MO4A 1Q1KA 3MECA 4MFBB 4FF2A 1KOHA 2CJKA 5HQ8A 2DGVA 5G0RB 5HN0A 3Q89A 3QFHA 1V3SA 4FWLA 4N7TA 2RQKA 4I4BA 4CLFA 5B7WA 2MLYA 3ENQA 1NSPA 2NSBA 1VSDA 1RK8A 3ENVA 2QL7B 1ZPWX 3KLHB 1MMNA 1S1TB 4NXNK 3MOJB 3SBMA 2CYYA 2V0NA 3HP9A 3HKZD 1TR0A 4E19A 1QY7A 4DL3A 2XLKA 1KLNA 2JVOA 1MWMA 3S6EA 5KT7A 2EFNA 4AQYJ 1X9WA 4K4TA 3GFZA 2BV3A 2F7TA 4TY8B 1HHQA 2A42A 1P1TA 2L9NA 4P9SA 3VQ6A 3CJKB 4J7CA 1OPZA 1YX2A 2YKNB 2V4QA 2DXFA 2YNIA 2R2RA 2CDRB 4OFZA 3TAGA 1S1WB 2M4MA 3JYTB 4KHSA 4BRFA 1SJ3P 2NNWA 2HFUA 3CCUS 1OVQA 5IV3A 4B17A 4C8ZA 2HVDA 3ZXWA 2DYAA 4LBPA 4QBUA 2XHCA 5E26A 2MKCA 2RUGA 3CCWA 1GOAA 2YKOA 3Q8RB 1SI9A 1RQ0A 4DWIA 4LRCA 1KFSA 4RCHA 4DSEA 2O8BA 1VYAA 3PDNA 5H1SV 3MTJA 1B3TA 2B9EA 1WAJA 2J6UA 4CHYA 1ZYQA 1UA1A 3JTPA 3V9SA 5F8IA 2M0GB 4O8KA 3NAIA 1U2FA 2YQ0A 1O0PA 1GMUA 3VQCA 3HPOA 4Y2AA 2KT2A 3NMUA 2XWYA 3R27A 2I2YA 3IWLA 3T6JA 4FK2A 1HW8A 1FXXA 2FTRA 3W2VA 2GUPA 3ZETB 3CC4N 2EG2A 3KK1A 4M8LA 1YJ9S 3AVLA 2KVQE 1WHWA 1VMBA 2E29A 2NRTA 2BW2A 2ATCB 2GUIA 4OX8A 1S49A 3TZXA 3C6TB 3AVJA 3IO1A 2BJDA 1Q5YA 3HKWA 4DV6F 4ZS6A 1T11A 2KFNA 2VQEF 3OR2B 4X4SA 4CTAB 4YQWA 1VR6A 3QMQA 2HS0A 3MMBA 3LGMA 1S1XA 1PO6A 4NLCA 2MQQA 4ZN1A 4DR1K 4RUHA 3H5YA 3VQ8A 3L4QA 3KLEA 4OYAA 2B4OA 2X3GA 3OHRA 4F02A 3D28A 2CGKA 2DR8A 5GMKa 3CJ9A 1N36J 4WKRA 1ZM9A 2LU2A 5EY4A 4H54A 2J9DA 4ICLB 4DL5A 4M42A 2WOMB 5FIIA 3L4BC 2NXEA 2O8EA 4NXMJ 3R5DA 2IM3A 4U95A 2CQ1A 2IVPA 3WX8A 3N6MA 2B4PA 5J2NB 3VEOA 3NNAA 3QLHB 4DKWA 5BPMA 4ZP8A 3J7YP 4KTWA 3R6LB 2EHGA 1S0MA 5ADXA 4P74A 4F4AA 3UKRB 3ULEB 3O1WA 2ZVSA 1LWEB 5MLCV 2DPNA 3VCDA 3A3OB 1FKOA 4KFBB 3VTIA 4B08A 3BV8A 3QRPA 4FWMA 4FLYA 3RR8A 2IRUA 3KFWX 1WKKA 1QVFR 1NLKL 3LDOA 4KHPK 2R7WA 3RRHA 1LWCA 2CZ9A 1RFQA 2OPPB 3FSXA 1XMOK 3KD5E 3THXB 2KFZA 3MAQA 2CQCA 2IRXA 4UTGA 5LJWA 1NMNA 2WVDA 2YNGA 4NASA 3I0RA 3IN5A 3IA0A 4KE5A 3I5CA 3U1NA 4PKDB 4X65J 4CHPA 3E9LA 2VG5A 3MD1A 4OHXA 4UOFA 4WQ4A 4C23A 2P9LA 2F1FA 3MX5A 2ZJRQ 2BMBA 2WCXA 4LBIA 5T7LB 2KYXA 4U7CA 1RWWB 4IFVA 2B9YA 4D3GA 4JYAK 1I5OB 2K1RB 1PILA 2EKNA 1RAOA 1RU1A 3T5JA 3C6UA 3QJLA 4WF9L 5KT6A 1C0GA 1PSDA 5FD1A 1GK8A 4CJ4A 3M6GA 5C5JA 2WC9A 2E6LA 3RMDA 1JQGA 4CJTA 3A12A 1AYEA 2DVIA 2FJVA 2GIRA 4CLLA 1FXLA 2QLBB 1U6ZA 1BDGA 2IM1A 4PG5A 1EKEA 4G6VB 3CJRA 4DTJA 2OPPA 2QJ3A 4ECQA 4LFCF 4CO3A 3RB6A 1LW0A 4HLBA 1NGJA 1X0PA 4R5PB 2QA2A 2B9XA 1JLBA 5KFHA 2KZZA 1ZBIA 2FBTA 2P9PA 4JD2A 4CHQA 4CLPA 4CZHA 2V4JB 4NA1A 3FE1A 3V4IB 2F5GA 3BF1A 4CJQA 2F8MA 3WEEB 2DB1A 1U49A 4LREA 3F73A 3AO3A 5LMNK 4XTTA 1GMVA 3BGRB 2UXDK 2RDJA 4K5SA 4WCEL 4JV5K 4NXNF 2Z8QA 5H9FK 4F0HA 3MWTA 4KBOA 2P9IA 3NGUA 1R8BA 5HI7A 2H3GX 1N33K 3TVYA 1Q7LB 3ZX3A 4HTJA 2EBGA 4NMXA 2MXYA 4M5HA 2YNHB 1GLCG 3LO3A 4YB1P 1GOCA 5J2QB 4X66K 4DCHA 4J9LA 3IMXA 3FMWA 4WYWA 4KHPJ 3TUPA 2EXUA 2MEWA 4W4MA 2RDIA 4AE5A 1DGKN 1SIWB 1WSRA 2XSFA 1C1BB 1RT2A 4Z7YA 3QZ7A 2XM3A 3WQUA 3CC2S 1I3AA 4GV3A 3V9ZA 1XHZA 3QINA 3MR6A 3UD3P 4KTZA 1X9JA 1WKLA 4LFBJ 1RWKB 1QUVA 3EXCX 3CCQS 1S0NA 2O8FB 4GKJK 2OELA 2ASYA 2CGJA 4OKKA 1S6QA 2FGCA 1VQ6S 4FXVA 2UUBJ 1ATNA 5L9NA 4TSXA 3V2UC 4GMJB 3VEWA 2GTDA 2X51A 1YVNA 3MAAB 3B4DA 4E7JA 3EICA 4V1Ak 2QA4S 3SDEA 2GWKA 2AKWB 2CQDA 3M2UA 4C1NK 4KR0B 3A8KA 1J5EF 1AB8A 3Q8QB 1OQ6A 4L3QA 1U4BA 3I8BA 2PA8D 4DV2J 1R59O 2MZTA 4ZPAA 2OPSA 1C4CA 5HVHA 1Y5IB 3N6LA 1L3KA 1J2VA 4HDHA 4OMFG 3FZBA 3S41A 4LUBA 1PYSB 4DV7J 2X1FA 1RT5A 2N7CA 3UIQA 3LTOA 4DQSA 4FO0A 1RT1B 4LSLB 2ATLA 1TUWA 2AV5A 2Q3PA 2DO0A 2WAQD 3CJ8A 1TK5A 3NRBA 3A8IA 4PEOA 5AJ3K 3ZC4A 1NEEA 3ISND 3CGIA 3ZT2A 3FC9A 3HT0A 2GX8A 1S6QB 3TOQA 5IV4A 3ZTQA 2MY7A 3MUVP 3JQMA 2LEBA 4E1JA 4RX6A 4B9QA 2LQJA 2N3LA 2CG8A 4CI0B 1PYTA 3EKSA 2P51A 2P2CB 2CQ4A 2A6OA 2XY5A 3MZIA 3CQYA 1T02A 4OX9K 4M94A 1FD8A 2H1YA 2CPJA 4WTOB 3MMVA 2BKOA 4TQRA 1T9YA 2LA6A 2V4JA 2ZM6K 2KQ2A 5CYJA 4WWSA 5GIPA 2H51B 4RU2A 1QAJA 4RW4A 4N8NA 5EOYA 4A8QA 4FJ8A 4YFUA 3GJRB 3E2EA 1LAVA 4B3SK 2X1GA 1Q9YA 3CCEN 1FJGJ 2W9CA 1UETA 3OVBA 3CIPA 4ECRA 4JI6F 1M5KC 1W0HA 3HSDA 2BJ7A 1TFWA 3NF8A 3JQJA 3P96A 4OHZA 4WPAA 3CB4A 4DR7J 2B7BB 4O5FA 3DXKB 2F8TA 3TTCA 4G1QA 3KMSA 3R3LA 4RW6A 4CJWA 1OH8A 2Y0BB 4YHHJ 2VDHA 5B0CA 4JRQA 3A4TA 1RNHA 3ENWA 5AQNA 1W7WA 4DTPA 3GYNA 4URQU 4DV5J 1SS6A 3AVKA 4A47A 2H54B 3IAYA 1N36K 2LEPA 1IKVA 2DHAA 3NWRA 4YEAA 3IWXA 4EUVA 3UDVA 5AQHA 3TSPA 4RNOA 1GLDG 4OV6A 3D1OA 1TUGB 4ZVGA 4NYNA 1X1PA 4Q45A 2XZDB 4E8UA 2ZBIA 4BRKA 4FLWA 2NYHA 4WCEQ 1QZ5A 3H40A 2WTUA 2J8SA 4AM7A 3RRKA 5FPNA 3MR5A 3BR9A 5LMUJ 1B0VA 2HQFA 5AJ3J 4DV3F 4QWCA 2QA4N 5TKWA 2IMOA 3QYYA 2VG7A 2H5JB 5HMWA 3TABA 4FL9A 2KL8A 1HMVB 1S4FA 3FMBA 3LDNA 4CM0A 4DQQA 4YOEA 3NS7B 1XR5A 4EHTA 2HWTA 1WG5A 1VQ6N 2NRRA 3CMAS 3SUPA 2R8IA 1S77D 2E2OA 3CIMA 4UOCA 1TK0A 3UDEA 1KLMB 5AQJA 4RU9A 3CF5L 2E2QA 4C48A 1BCMA 4LR9A 1NK0A 1ZTTA 4H0TB 1NK6A 2JLGA 2HK3A 2N7YA 3TRGA 2LU1A 3FCHA 1V4TA 1NPRA 5A0YA 1TFYA 4JV1A 5A2QY 4FBUA 2HHQA 3K57A 3SPYA 4CEOA 2VCPA 2AJQA 2K8GA 1NGHA 3GP9A 4FWPA 2OI2A 4LY7A 4JI0F 2KVIA 3SXLA 2HVIA 1U0HA 2AYGA 4RBUA 2UXDJ 3LDSA 1RTHB 1H98A 1VK0A 4B3RK 2NPFA 4OZ2A 5HOOA 3IRXA 2B6AB 4WK1A 3IBWA 1VQOS 3TWZA 2BH1A 1QSLA 3QGIA 1N34J 5J2PB 4KH4A 4KPYA 2R7OA 4DQ8A 1JJHA 1SUQA 2DNPA 2FHMA 1HNXJ 3FZHA 4CBWA 2K3IA 1JLCB 2GEMA 3JAMY 4K8ZA 3ID6A 3PHTA 3WXJA 1SJ4P 1OSCA 3M8PA 5AZJB 2XSJB 2RU9A 3DLEA 5KFEA 4JI5F 5KGWA 1AA1B 4J90A 5D4LA 2LXIA 2OFGX 5C10A 3DU6A 1OJ4A 2A3ZA 3BJYA 2DXEA 3OV7A 2YV0X 1WEZA 1J5OB 3QESA 4C8LA 3D6HB 1X3NA 1X5OA 3CCTA 4KHRA 1QJHA 5T7BA 1R27B 1T03B 4WIIA 5DMRA 3LPYA 3HHNB 4B3TJ 3FCWA 1HWLA 4FK4A 1HKAA 1X5TA 2J5AA 1VSHA 4B3TK 2N82B 4H4OB 2C2RA 1KHWA 1M1HA 2KJWA 3RG6A 3MN6A 1YZ7A 2HNDB 2C1EB 1MW7A 3FZFA 2QWLA 1RA6A 2UUCJ 4OYXA 2LQ9A 1LAWA 5LY3A 3THXA 1RBVA 5M1OA 5A8WA 4WBFA 3BQ2A 1BXNA 2ASDA 2BVZA 3AD7C 2YNGB 3QEVA 4DR5J 3J81U 3P5TL 3DLEB 5L38A 4CD3A 1HHTP 3G9CA 1SH3A 2A6AA 2R2TA 1UAXA 3CCMS 2UXCJ 2H5EA 5DG7A 2DT9A 2NUBA 3QNNA 1CEZA 2MZQA 1OMSA 2G13A 3D2EA 4RKUC 2J8AA 3EMTA 1HHSA 3W9HA