2HNZA

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 140
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hnzA05
4FJIA 3QIPA 4ICLB 1LWFA 4QWDA 3PVXA 3PUFA 3OJUA 1HQEB 3KK1A 2EC0A 3NDKA 3MEEA 3ITHB 4FLZA 1LAWA 3TAGA 2HB5A 3V6HA 1RT4B 1TVRA 4C8KA 3G6XA 4LH4A 1TV6B 2OZMA 2FC0A 1SV5A 4H4OB 1IKWB 4FCYA 4ECRA 3H5XA 1JLGA 4DSFA 4E7IA 4BDYA 2DY4A 1RILA 4WXOA 4CF8A 3T3FA 4JV2A 1RT7A 4FS2A 3VQAA 2XCAA 2EX3A 1JLEA 2R2SA 4KBIA 3EY1A 4K4ZA 1RTHB 1S6QA 1S0NA 3K5OA 4RW6A 2ILZA 4IKAA 3DM2B 1ITGA 3CDWA 3AVAA 1REVB 3G6YA 3DOLA 4ED8A 2UVWA 1D9FA 3HKWA 3OYGA 4YMEA 5I42B 3BQ2A 1IO2A 4DTJA 3BQ1A 4DFPA 3DLHA 5KFJA 1R0AB 4CEOA 3T19A 1IKYB 1S0MA 3THVA 4CJQA 3NGDA 4RUAA 4ZHRA 4IDKB 2FLNA 1RA7A 5EU7A 2WK4A 4CE9A 1LWCA 5FDLA 4YR0A 2V9WA 3DRPA 2VG6A 4DQIA 3HVRA 3GV5B 1SL1A 4JV1A 1UWBA 1T7PA 4OKKA 1FKPB 1RA6A 1REVA 3CQ8A 3AVMA 1K6YA 1Q8IA 1CLQA 2IM1A 4DTXA 2FVPA 3QIOA 4NRTA 1EP4A 2OZSA 4DQQA 3HVTA 1X9WA 3MEEB 1JL2A 1TKXA 3GIIA 3OYAA 4KTWA 2D41A 4CESA 2BANA 4DL3A 2P1JA 5DQHA 4DL7A 1C6VA 5DG8A 5DLFA 1WSFA 3BJYA 1RBUA 3NKYA 5J2NA 3IS9A 4AHRA 4Y2AA 5JS1A 4R5PA 3LPUA 2DPIA 1JXBA 5HLFA 3NBPA 4GC6A 2KTQA 3LDSA 3KKRA 4R8UA 1EX4A 4DTSA 3T5KA 4QW9A 2Y1IA 4FLVA 1K1SA 4B9SA 3DLBA 1DTQB 4RW8A 1LAVA 4Y1CA 1NOYA 1BHLA 4G3IA 5F8JA 1S49A 2ZQBA 1WSHA 4K4VA 4FZZA 3KJVB 4CGHA 3WNEA 3FDSA 4EBDA 4GC7A 3UIQA 1HARA 3UQSA 4DG1A 4FM1A 3TAEA 3CG7A 4KHSA 5EWEA 3G6VA 2J6SA 2IM0A 4IFYB 2IDOA 3E51A 1T05B 4IG0A 3OS2A 3DOKA 4JLHA 1NHUA 2WTFA 5F8MA 1HYVA 2UUTA 2B5JB 1JLAA 4B9NA 3VQQA 4NCAA 5CYMA 1TKZB 4LSLB 2RDIA 3PW2A 4TXSA 1FK9A 4ED0A 4EP4A 3PV8A 3KLEA 3LAKA 1RT2B 3NH1A 2VA2A 4XPEA 1S1XB 2G8WA 3G86A 3S3NA 3CJ2A 1CZBA 1VRUA 4M3YA 1L3VA 1FXXA 3V6DB 4ZVFA 1D5AA 4HKQA 2W9CA 3IG1B 4IG0B 3ASMA 3ZT0A 2AJQA 2JC1A 1DTQA 4CGFA 1HPZA 1LWEA 5KFEA 3V1QA 4NYZA 2UVRA 3HXMA 1Z4UA 4IRDA 3KKSA 4MKBA 3LP2A 3AVCA 2IS3A 4DMNA 1T05A 1HQEA 3RMCA 4ID5B 4O4GB 1KVAA 5FRMA 4RW8B 3HO1A 4MH8A 2QE5A 1U04A 2I1RA 3OYBA 3KLEB 5HBMB 4FJXA 4AHTA 4FZYA 4TSXA 4DU3A 4ED7A 3SUPA 3KJVA 1IG9A 4W5OA 1FK9B 1EP4B 3BSOA 1N6QA 4J9SA 4PQUA 1S10A 1TKTA 4E7JA 2R7YA 4EBCA 5DMRA 1JLBB 2PY5A 4KO0A 1SKWA 4CHNA 3SI8A 3NL0A 3TAFA 2VG5A 1QS4A 3QIDA 3V81B 2ASDA 2WOMA 3HK2A 3I0SA 4ZP8A 2HHWA 3H08A 4ED1A 2HVHA 4ECXA 1SUQB 4F8RA 5J2PB 3QYYA 1NNDA 2OPQA 1W9HA 3QEPA 3RBDA 5KT5A 1U09A 3D45A 1QE1A 4B08A 1SH3A 2AWZA 1EETA 1T8EA 2XGQA 1Q9XA 3HP9A 3D5MA 4F4WA 4F3OA 3DLEA 5L1IA 2AQ4A 1YVUA 2WHOA 4AHSA 1NK4A 4ZHRB 2VA3A 4J2EA 4CJLA 2YNFA 1B9FA 1LW0A 1BGXT 1VRTA 1Q9YA 4ZVGA 4OJRA 3QO9B 4OPKA 2R8HA 4OKEA 4O3RA 3FQLA 3JYTA 4E7LA 2AGPA 5J1EA 2IAJA 3DLKB 3DM2A 4EYHB 3KOAA 5KFAA 3TQ1A 2Z1IA 1TAQA 2BQRA 3I5AA 2YHBA 4ZPDA 5F8IA 2JEIA 4DSEA 4HTUA 3KLHB 1TL1A 1O1WA 2WONA 4DLEA 3GIJA 3RB4A 1LWCB 5FDLB 4Z4GA 2FJWA 1VSMA 4C8OA 4FLWA 1TKTB 2JGUA 3QINA 3P1GA 4CHPA 3QETA 4DU4A 1HRHA 3DLGA 5KG2A 1RT6A 3V81A 4H4MA 3ZSXA 4CF2A 1KHWA 3L2WA 3QLHB 4DFJA 5EDWA 3L2VA 1NJXA 1QSLA 3S9HA 2E6MA 2FLLA 3MF5A 4WZMA 1NHVA 2E9RX 4RNHA 4Z4EA 2UVVA 4DSJA 4NYFA 1RT5A 4IQXA 3I0SB 4FBUA 3IAYA 2XY6A 3DYAB 1YT3A 5KFQA 3C6TB 3MR3A 4IH5A 1S9FA 5KFDA 5D3GB 2ASJA 4B3OB 1CZ9A 5KG1A 1X9SA 4KV8A 4ECTA 2YNFB 5KFYA 1BISA 3QZ8A 1ZTTA 4DWIA 2D3UA 4KHQA 1LW2A 2FBTA 1NKBA 1BQMB 1N5YA 3QGHA 3KD5E 3OYKA 3I8DA 2X6SA 1WSGA 4M42A 3V4IA 1QSYA 5F8NA 1RT3A 1S9GB 3V6JA 3ITHA 1S1XA 5HRPA 1NK8A 5KT2A 4EO6A 4U6PA 3ALYA 4E19A 1C1AA 3DOKB 4Z4HA 2IA6A 3KHGA 4Y1DA 5J2QA 4NLUA 5KFMA 4E0DA 5KFCA 2DPJA 3QZ7A 2ATQA 3ZSRA 1HNVB 2G8IA 5F9NA 2DTUA 2V0NA 5DG7A 3O3FA 2HNZA 5KFVA 4CIEA 2W9BA 3SFUA 2KZZA 2DFEA 3O3HA 4FVMA 3UR0A 4FLTA 2B43A 3I5BA 2VWKA 3BREA 3AO4A 5SZTA 4K8ZA 1A5VA 4ZP7A 2IAJB 3IGVA 5FRNA 5JUMA 1T3NA 4CF9A 3OYNA 3RAXA 3CDEA 4NLTA 2W8KA 4YFUA 2XY5A 3V9WA 3OYIA 3K5MA 1LWEB 5K14B 5DQIA 3K2PA 2ATLA 3SFGA 1WAFA 4I2QA 2YV0X 2KW4A 3RR8A 5I3UB 1JXEA 2GV9A 1ZBFA 1RDDA 2AU0A 5EUHA 1VSHA 1TP7A 4BACA 5KFZA 4Q0BB 5E41A 1C0MA 1S4FA 3D28A 4QOZB 2WRMA 4J2BA 4Y2CA 3PW7A 2HWHA 1MMLA 3PW0A 1YVFA 2ZD1B 4BDPA 5F9LA 1RTJB 3PZPA 4FJLA 2YKNB 2OPSA 3TWHA 3BDPA 4CEFA 2UVUA 4DL4A 3OHAA 4NYNA 5J1EB 4N41A 1RT5B 3OY9A 4OL8A 3WNGA 1C0TA 1OS5A 4DSKA 1EETB 4FW2A 1KSPA 1S9GA 3QO9A 2BE2A 1BIUA 3VA0A 2IM2A 3MEDB 4ED6A 4CHQA 2EHGA 2VG5B 1VSLA 5KGWA 2KQ2A 4QWEA 1U45A 3V6KA 4AHVA 2YKNA 1GOAA 2R8KA 3TAQA 1HMVB 3PR5B 4TN2A 1WSIA 5DLGA 1RT7B 4CIGA 4EBEA 4CIFA 1LW0B 2ZE2A 3C6UB 2ETJA 4TYBA 4IH6A 5J2PA 3UPFA 1J54A 4LSLA 4BE2A 1JL1A 1L3UA 1S5JA 1YTAA 3H5UA 3DMJB 4ECWA 4C8MA 2C2DA 4R5PB 1J9AA 5CY4A 4ELUA 1RTIA 1C2PA 3VQSA 2IJNA 2RF2B 4KB1A 1WN7A 4M3RA 4W5QA 4HCCA 4K4WA 2QV6A 3ZSVA 1RBTA 4URQU 4O3NA 4CJ5A 3I0RA 4N47A 3NAHA 1SL2A 1TK5A 4CF1A 1GX5A 4AH9A 2XGPA 3KLVA 5KG0A 4QAGA 1RT2A 1CXQA 4CEBA 3HT3A 1B92A 3CO9A 4DTNA 1IKYA 4QWCA 5HROB 3SV3A 4NLDA 4WXWA 4XIUA 5D3GA 3KK1B 2PZSA 1L5UA 1L3SA 2ZD1A 4RG8A 3BGRA 4GMJB 5I42A 2F96A 1ZTWA 4CGIA 4C8NA 1VK0A 1NOZA 2UUWA 2V4RA 4KHUA 4Y34A 3M8QA 4CFBA 5EWFA 4Q5VA 4WFZA 4FK0A 3KTQA 3ISND 2BRKA 5SWMA 3TAMB 4DL5A 4ID5A 3KNAA 4WYWA 4LH5A 4MK8A 3E01A 3HM9A 4J9NA 3VQBA 3HHKA 4NLVA 3NGZA 4CJTA 3FFIA 4KAZA 4WFYA 4EZ6A 1T03A 2FVCA 4ECUA 4IR9A 3PO5A 1HYSA 5DGAA 2G8HA 1QUVA 1QAIA 3HP6A 4I2PA 3LP0B 1UWBB 1JKHA 2HNYA 4CJFA 2W8LA 1JXLA 1RNHA 3AVNA 3NGIA 1K1QA 2HNZB 3L3UA 4MFBB 4QW8A 3HL8A 4PY5A 1CSJA 2OPRA 2JEFA 3MR5A 2GC8A 5JXSA 4K4UA 2X78A 1S1TB 1WNSA 3DRRB 5J2QB 5F8HA 2YKMA 4KAIA 2LSNA 2FVSA 5F8GA 2IJFA 3TARA 2GIQA 4KB0A 2I5JB 1TKDA 3ZSZA 3LANA 4RW4A 3SPYA 2FBXA 3MEGB 3TR8A 5J2MB 4CHYA 3LAMA 3MR6A 4TY8A 4PWDA 1F21A 2JC0A 2R2TA 2JEJA 4CEDA 2C22A 3RBEA 3KHRA 4KFBB 4YR3A 4OGCA 3M8PA 3LP1B 3TVKA 1I39A 4BDZA 1S6PA 2W9BB 1ASVA 3MECA 3NCIA 4LY7A 1YTUA 3LWLA 3BSAA 3P5JA 3SV4A 2R2UA 4M3ZA 4DSLA 3M8SA 2WCXA 4FJNA 2W9AA 2J6TA 4NLYA 4KTZA 4ELTA 3KHLA 1VSFA 3QGIA 1BIZA 2IC3B 1NKEA 3IRXA 1C0UA 5DG9A 3AO3A 3V9UA 3O4NA 2HWIA 2QKBA 3M9MB 2R2RA 4ECYA 5KT6A 4O44A 4CJKA 3OL7A 2PYLA 4ZPCA 3MXIA 5KFRA 4JRPA 1QTMA 1JKHB 3EYZA 1J5OB 3DOLB 3I5CA 1RT6B 4ID1A 3GILA 5L1KA 3MECB 4PWDB 2WB4A 3L2QA 2E9ZA 3RMBA 3HYFA 4IG3A 4IRCA 3KK3A 5J2MA 3KMQA 4LQ3A 2E6LA 3GQCA 4IR1A 4DTPA 1RYSA 2W7PA 3OYLA 3C94A 4AHCA 3DMJA 3GIKA 3MXMA 3OL8A 3CWJA 2IC3A 3LPTA 3GV8B 3RTVA 3QEIA 4DF4A 3AVGA 4JS4A 1KLNA 2V4QA 4O3SA 3VQ8A 4KO0B 2W9CB 1JLEB 4EYIB 4URGA 4ZVEA 3OL9A 3SNNA 2VG6B 3ISNC 1RT3B 1N6QB 4UQGA 2GIRA 4KFBA 3KLFB 1VSEA 4RNFA 1NKCA 1RDCA 4H4MB 3O4QA 2Y1JA 1VSJA 1LV5A 2XWYA 4Z4FA 4FS1A 3SQ4A 1XR7A 3BQ0A 3CJ3A 2B6AA 1ZETA 4F4YA 4U7CA 1SL0A 3CVKA 4X2BA 2BRLA 2GUIA 2F8SA 4K4SA 3CDUA 1JLFB 4I9LA 3V9XA 1S6PB 4ED2A 3OS1A 4DS5A 4OPJA 1DTTA 5KFXA 4KREA 5C25A 3KLIB 3JSMB 1ASUA 4FJJA 1TKXB 2RDJA 4DTUA 3IGNA 4J9PA 4CJRA 4NLXA 2YNGB 4RW7B 2HHUA 1IKVB 4CEEA 4DF8A 3H5YA 3VQ6A 4KI4A 1QHTA 4PUOB 4RNOA 4ECSA 3AV9A 4TY9A 5CZ1A 3QGGA 2HNYB 4K4XA 3CJ0A 3HPOA 4FW1A 2G8FA 5KG5A 1C1BA 3CYMA 1KCFA 4RW9B 3OS0A 4JV0A 3BGRB 3SUNA 1RTDB 1FKOA 2BGGA 4FJHA 2B5JA 4BE0A 1DLOB 2HHVA 3NBPB 3AVHA 4NLGA 1QAJA 3KLGA 3OYHA 2BR0A 3VA3A 3NH2A 3HJFA 3NH0A 5I3UA 1U4BA 5FROA 1TK8A 3LALA 4DSIA 2BE2B 2A1SA 3RAQA 4CERA 3ULDA 3TAMA 2O4GA 3M9NB 4RNNA 3QEXA 5L1LA 4B8AB 3LP2B 4Q45A 3HVAA 4CJPA 4OLAA 4CGGA 2XY7A 4NZ0A 4TYAA 1N48A 5KT4A 3NF7A 5CYMB 1Z25A 4KKOB 4W5NA 3V6DA 3F73A 1TKZA 3JYTB 2GBZA 3EPGA 3OVNA 2D0CA 4B8CA 2ALZA 5KFTA 1HPZB 1RTJA 4DEZA 3V9SA 3E01B 4CECA 5DK5A 1G15A 3U3YA 4O0IA 1X1PA 4G1QA 4B9VA 3LP1A 1VRUB 4K4YA 4DFMA 3BR9A 2IOCA 3O3GA 1KVBA 2CKWA 3AO5A 1UA0A 3MXJA 4NCGA 3AVFA 3UDLA 3JSMA 3AVJA 4J2AA 1D1UA 4BWMA 4CJUA 3Q8SB 1IKXB 1WAJA 4KB7A 1S1WB 1IM4A 4QCLA 4LSNB 4WZQA 4CFCA 3IRXB 1WSEA 1DLOA 2QKKA 4IFVA 3SI6A 2HNDA 3GV7B 1C1CA 4WYLA 1S97A 2RN2A 3B6OA 3HVTB 3SJJA 1EKEA 3H2LA 3CIZA 3G0ZA 3OYFA 5C42B 4CFDA 4KHYA 1NK5A 1IKVA 4B9MA 1JLQB 5HRRA 4HYKA 4O5BA 3QNOA 4Q8FA 4YP3A 1S1VA 4NLRA 1XC9A 4IKFA 5KFLA 2RKIA 2VG7B 4I7FA 4ZPAA 1NJYA 1I6JA 1BQMA 1N5YB 3H98A 5KT3A 3Q8QB 4PA1A 2OPPB 1J5OA 3NHGA 4M3XA 4TQRA 2J6UA 4FLUA 2P5GA 4TQSA 3ZSOA 4H8KA 4XO0A 3DLKA 4HUFA 4FLXA 2OPQB 3U6FA 3CFRA 4FJMA 4J9RA 1S1WA 4O3PA 1N56A 3GYNA 4RW6B 3NAIA 3PJWA 2AGOA 3PHEA 2HMIA 1NK0A 4CJWA 2YNHA 5KGXA 4NLOA 4CEAA 3DLEB 4LSNA 1S48A 3RWUA 3Q8RB 1Y97A 4N56A 2WOMB 1FKPA 2IBKA 2OPPA 1VSDA 4PQUB 2HAIA 2C28A 4FXDA 4IG3B 3RB6A 3VQ7A 1VRTB 3QEWA 4M94A 4KRFA 3HPGA 2HHSA 1QQCA 5T14A 3CFOA 4O55A 3S3OA 4R0EA 4QPXA 3C95A 1GOCA 1NK7A 4RUCA 2OH2A 3WNHA 1VSKA 4Q0BA 4J9KA 4CGJA 4F4KA 3KLFA 3CJ4A 1RYRA 3CM6A 4WFXA 1HNIB 1TL1B 4GVMA 4Z4IA 1RT1B 1S6QB 3T5JA 3ZCMA 4E89A 1HQUB 1C0TB 4YQWA 3OYJA 2HW3A 3H5SA 4MIBA 3KK3B 4QWBA 2XHBA 3NF8A 2DFFA 2JLEA 1W25A 5HP1A 1XHZA 4M3WA 3DLRA 2XI3A 3T1AA 4CEZA 3QNNA 1XR6A 2XRIA 1S1VB 5KFHA 1BCMA 2Z1GA 3RMDA 3LWMA 1XWLA 1IKWA 2FBYA 2D0AA 3KLIA 2W7OA 3OYMA 5DQGA 4IBNA 3BSCA 4DQPA 3KHHA 4LD0A 4W5RA 4F2RA 3DRRA 4DL2A 4I9QA 5C25B 5KFKA 2B6AB 3L8BA 1ZBUA 1A5WA 4FJ9A 3KLGB 1XI1A 4AILC 2C2EA 4FJKA 4ED3A 4CJ4A 2Z1JA 1RTDA 3VQ5A 5L9XA 3FSIA 2F8EX 4TY8B 4J9QA 2O5DA 4KV8B 3V4IB 4KE5A 1JLGB 3N6MA 4L8RB 4O4RA 1ZBLA 4O3QA 3PY8A 4DTRA 4B3OA 3MTKA 4NLWA 1NJZA 4YNQA 1NK9A 4CK1A 1KLMA 4CK2A 5KFNA 5C5JA 4KHNA 5KFFA 2YHAA 4B9UA 3AA4A 1JLBA 5KFPA 4ECVA 4N5SA 4FBTA 4O3OA 5K14A 5HP1B 3F9KA 1RBSA 4FLYA 1RAJA 5KTQA 1SKSA 3RMAA 3NFAA 4WE1A 4ZMMA 2RPIA 5KT7A 1D9DA 2OA8A 3I0RB 4NCBA 1S9EA 1ZBIA 4MFBA 4O4GA 2P51A 2A1RA 3K59A 4FM2A 1RTIB 3TI0A 5KFGA 3MFIA 4XPCA 2W42A 4HVJA 4JUZA 1JLCB 4CHOA 1RT1A 2IMWP 2YNGA 1C1CB 1QE1B 1I3AA 5HRNA 5HLFB 3ZSWA 3PX4A 1L3TA 3QLHA 2FVRA 4J9LA 4CHZA 4MIAA 3EPIA 1SKRA 3L3VA 2VG7A 4I7FB 4QWAA 2X74A 3LZJA 1WSJA 2YNHB 1TQLA 3PJXA 2AGQA 4IRKA 4CFAA 4DFKA 2JEGA 3DI6B 4M41A 3RB0A 4RNMA 4E7KA 1SV5B 1IH7A 2G8VA 4ZTFA 2YNIA 3TAPA 3AVLA 3SZ2A 4FJ5A 1RBVA 2XY8A 1TAUA 1S9EB 1TK0A 4RZRA 3KK2B 1JLCA 3N6NA 3H4BA 1TV6A 3IG1A 2R8JA 2OPRB 1T94A 1BL3A 4LQ9A 3ZSYA 1J53A 3ZT4A 5C24A 1EXQA 3CM5A 2FVQA 3T5HA 4DLGA 5KI6A 2BANB 3OLBA 1CXUA 4FJ7A 3K57A 4FK4A 2D5RA 5HRSA 1UAXA 4CJSA 3M8RA 1R0AA 3Q8PB 4C8LA 3PW4A 4EP5A 2FJXA 5KG4A 4TLRA 1RBRA 4MQ3A 4DQRA 3AA5X 2HHXA 3PX0A 3V1RA 4NLPA 5EWGA 5KG7A 4F4XA 4CJEA 3HSTB 3ICLA 2BDPA 3CJ5A 4MK7A 4M45A 1GX6A 2R8GA 4I2QB 4NLQA 3DRSB 1BI4B 4G1QB 3RB3A 2FLPA 3QESA 4ELVA 4F3TA 1LWFB 4DL6A 2ITGA 1VSIA 3WNFA 5F8LA 4HCBA 4M95A 3AVIA 2O4IA 3V9ZA 1SH0A 4ZP6A 2C2RA 1KVCA 1TL3A 4CK3A 3SQ1A 1JLAB 1BCOA 3U3GA 2G8KA 3FFIB 2IM3A 4J9OA 3OL6A 4ZPBA 1S1UA 2AX1A 1X9MA 4GW6A 1A5XA 3AA2A 1B9DA 3L2UA 5J2NB 1JLQA 3QERA 4IFVB 3OHBA 2ZKUA 2OYQA 4Z4CA 1HNVA 4I2PB 4EZ9A 2AX0A 4KKOA 1S0OA 2XCPA 2D0BA 4KHWA 4CGDA 4EEYA 3AA3A 5KFOA 1XHXA 3K58A 4ECQA 3L2RA 3OYDA 4J2DA 1ASWA 3AVKA 3KIOA 1UOCA 4E1MA 4N76A 3LP0A 3FRZA 3VQPA 4IOBA 1FKOB 3MR2A 3TANA 1T03B 3NMAA 1UA1A 4KHMA 3DYAA 1TL3B 5KG3A 1RT4A 5L1JA 3VQEA 3VQ9A 1KFDA 4E1NA 2RKIB 4FK2A 4URSA 4ZP9A 3IN5A 3SPZA 3GIMA 4IFYA 1C1BB 3EZUA 4OVLA 1TGOA 1WLJA 3SYZA 3PO4A 5C24B 4DQSA 4DTMA 2PYJA 4W5TA 3PW5A 1WNEA 1LW2B 1BI4A 3AO2A 3KLHA 2X6NA 4IH7A 2E9TA 1S1TA 3VQ4A 4K8XA 3DDKA 2Q3SA 1N4LA 3SUOA 4JS5A 4MKAA 2IGIA 3VQCA 3T5LA 4F2SA 3SQ2A 1GOBA 2ZE2B 3C6UA 4BE1A 2DFHA 3BSNA 4KTQA 3DLGB 1QSSA 5KG6A 2Z1HA 2BQ3A 4KI6A 1RTHA 4NCGB 4PUOA 1HQUA 1D8YA 2B4JA 4F4ZA 3C6TA 3NF9A 2CJQA 1U47A 3SCXA 2RF2A 4CCHA 3S3MA 4R8UB 4Y3CA 3PR4A 4H54A 3ZT3A 1KRPA 4ZVHA 2I5JA 3DI6A 1RDBA 1NJWA 1HJRA 2XI2A 4Z0UA 1SUQA 3NAEA 3DRSA 4O44B 4O0JA 3H4DA 3FQKA 5CYQB 3OSNA 4ECZA 3SUQA 1KFSA 3AVBA 4OGEA 1ZYQA 1RCHA 3QEVA 2D3ZA 3OSPA 3H59A 4DTOA 3NGYA 4ZTJA 4K50A 4FZXC 4OLBA 3KMSA 2HHTA 3M8PB 2YNIB 1U48A 5KRSA 4J9MA 3TABA 3RRGA 2ASLA 3N6LA 5HROA 4RU9A 3MFHA 2R8IA 5KRTA 5CZ2A 3VN5A 2P5OA 4HHTA 1BQNB 3SQ0A 1JIHA 3K5LA 4MK9A 3DRPB 1HMVA 1D0EA 5KFUA 1W0HA 1MU2B 1HYZA 3V1OA 4CF0A 3RR7A 2QXFA 3EZ5A 4FJ8A 1C0UB 1NK6A 3IS9B 1KHVA 5C42A 3VQDA 3D0PA 4KPYA 1IKXA 4OKJA 4BWJA 4F50A 3M9OB 4NLSA 3M8QB 4WE1B 1TVRB 2BQUA 3NE6A 4FM0A 3KK2A 1SH2A 2E4LA 1RDAA 3NF6A 2VWJA 2HNDB 1DTTB 5T7BA 3LP3A 4HUEA 5KFSA 2OPSB 4RW4B 5JS2A 1JLFA 1ZBHA 2KZMA 3ZT1A 4M3UA 2D7SA 3KD1E 3OYEA 3RRHA 4M3TA 3ZT2A 3G10A 4E3SA 1KLMB 4Q8EA 3PX6A 3OJSA 4CEQA 3K5NA 2FJVA 5KFWA 1U49A 1RDRA 4B9LA 3HVWA 4DU1A 3P83D 5CYQA 2NUBA 4FYDA 1Z26A 3MEGA 3MEDA 2F8TA 4B9TA 1XR5A 4Q44A 2FBVA 4HUGA 4KSEB 2ILYA 4DG1B 2QK9A 1MU2A 5DGBA 3A2FA 3QIPB 4ICLA 5HBMA 2XO7A 3LZIA 4YR2A 2YKMB 2HHQA 4RW9A 2HVIA 3ZSQA 1BQNA 1KTQA 4Q43A 4JRQA 4E7HA 4K4TA 3AO1A 2KFNA 4FJGA 2G8UA 2WONB 4NRUA 1S1UB 3B6PA 4RW7A 5KFBA 3OYCA 2XC9A 4H4OA 4CJ3A 4CJVA 4IDKA 1HYSB 4EO8A 3CFPA 4AHUA 2HMIB 1JX4A 2KFZA 5KFIA 3H40A 3HPHA 3MAQA 4DS4A 3OLAA 4KHRA 1HNIA
chains in the Genus database with same CATH superfamily
3FKBA 4FJIA 3QIPA 4ICLB 1LWFA 4QWDA 1UWAA 4A2BA 2X3DA 1YJ7A 2CNOB 2DY1A 1Q8BA 4CI0B 1IWAA 2NRWA 2HB5A 1RT4B 2XULA 2GJIA 4P2FA 2UV8A 1TVRA 1NCLA 4PYDA 2Z2YB 4LH4A 2BBEA 1SV5A 1IKWB 2Q66A 1YJ9N 1AB8A 3LL3A 3NS7B 3H5XA 4JD2B 2A6AA 4FVUA 4BQZA 1FWLA 1CJVA 3MM5A 1U2VB 3MWTA 1VQYA 2XCAA 3M30A 4KBIA 3EY1A 4K4ZA 1RTHB 5CCMA 1S0NA 2XS5A 2DH8A 3ET6A 3GR1A 1IBLK 2QSFA 3CDWA 1WUUA 1EQ0A 1R6VA 5AQOA 1DKGD 3EDRB 3OVBA 4ED8A 3E66A 3OYGA 5I42B 2V94A 2HF4A 1VHXA 3DLHA 2RQCA 3HSDA 4K0KF 1E3MA 3T19A 2CQ4A 2H5EA 3P5BP 4CJQA 4RTFD 5DETA 1RKJA 2WK4A 4Q7AA 2P9NB 4RWTA 1FJGK 2V9WA 4WFAL 3Q0AA 2V68A 2WVFA 1X4GA 4DQIA 4OI1A 3DU5A 5IFMA 4B1XB 3CCTA 3EE9A 3W64A 2CVIA 1REVA 3CQ8A 4JI3K 4PKHA 2W2NP 5M1NA 2GHWA 1K6YA 1FRKA 2IM1A 3QIOA 2R7UA 2OZSA 3C66A 2DR8A 3MEEB 1JL2A 3EKUA 1XMOF 3MN7A 3CGIA 4CESA 2P1JA 1RXOB 1C6VA 5DLFA 1WSFA 3BJYA 3PIOL 3UB5A 3ATVA 1KP6A 4JKHA 5JS1A 3LPUA 2GMHA 4PCQA 5HLFA 2UXDJ 5LM7E 3GG4A 3C15B 3DXKA 3CW2C 4QW9A 2Y1IA 2BW2A 1K1SA 4B9SA 1FNMA 1DTQB 2K1RB 1KDNA 4B1ZA 2IIRA 3BN4A 2VZ9A 2QWOA 3P6YC 2O3DA 1B0TA 4PG8A 2K3IA 3AJ2A 3MPWA 4K4VA 5DDQC 4B3MK 3FVYA 4FZZA 3WNEA 2A3JA 1VI7A 2WFBA 2BW7A 4CNZA 4KHSA 3AXKA 2WSCC 3O1BA 1NG9A 4FSVA 3OHRA 4IFYB 2R9LA 3BYPA 2ZDOA 3DOKA 1O0PA 1URRA 4JLHA 2B7CB 1N5QA 5F8MA 2C1EB 4DV3J 2ZJQQ 2B5JB 2MY8A 1JLAA 4HR2A 3TVYA 4B9NA 3HRGA 1SJ1A 4NCAA 5CYMA 1TKZB 1N5SA 3D2EB 4JK7A 1CULB 3KHYA 5BPMA 1H6KX 2CDQA 4YDDB 4JKEA 1X4DA 4CD1A 5DM6L 3PV8A 2E20A 4X4UA 3KLEA 3LAKA 1RT2B 3NH1A 2G8WA 4Q2LA 4M3YA 4LIWA 3BH7B 1N52B 5J1PA 3CB4A 1NGAA 1QZ5A 3OPKA 1T9TA 1U1KA 1D5AA 2W9CA 3BB5A 4GMKA 3FZFA 3ASMA 2Z0GA 4X4QA 2JC1A 5DM7Q 4CGFA 3PRDA 2DNLA 2RE1A 3Q2TC 3H42A 1YIJN 5KFEA 3G8QA 1Q5VA 1PYOB 4ID8A 5GADU 3C6AA 3N01A 2DR6A 1HHTP 2DXEA 2HG4A 1IJJA 3T41A 4M63C 4DMNA 3R1HA 3E9LA 5HAOA 2QLFB 4MH8A 1SQKA 1UJ4A 2GNKA 3VALA 1UEUA 4AHTA 4TSXA 1QQNA 4LF4K 3K0SA 1NMDA 1M1GA 3D67A 3SUPA 3SBMA 3KJVA 1VQ8N 1MLAA 2ZUAA 1FW6A 3MCMA 3M2VA 2R7YA 4UTGA 3CMEN 1JLBB 4KO0A 3C16A 3SI8A 3NL0A 2P9PB 3THTA 1A6LA 2P9IB 3H08A 4Y65A 4GVBA 4OZJA 1K73O 5J2PB 4R0JA 2C2MB 4IOCL 2OPQA 4DV6F 2UXBJ 4ZLPA 1QE1A 2H4YB 4FWOA 1EETA 1U6FA 1Q9XA 4LT6A 4F4WA 3G6ES 4WYBA 3JSRA 4AQYJ 1UPMB 3KJQB 3UVJB 2WHOA 3FCWA 2LCWA 2QA2A 4D3HA 2NRZA 1NGGA 3UNYA 3FE1A 3VV2B 2EBGA 2AP1A 2LU2A 2YQ0A 2ZBRA 2VC0A 4RUBA 2R8HA 3M6VA 3UD5A 1MDUB 2W41A 1R8HA 3DLKB 2NXCA 2ZZMA 3G71N 3DM2A 4EYHB 4PWUA 4DV5F 2Z1IA 3O08A 2O8FB 1PYSB 2MZRA 4DSEA 4LREA 2WTUA 4HTUA 1O1WA 3MAAB 1PBUA 1Z2ZA 3GIJA 1U2VA 1LWCB 3T1HJ 3T1YK 2GHPA 4BR5A 5KPTA 1VSMA 4C8OA 2P6TA 2MKSA 5FLXO 1WELA 3TVZA 4CZHA 5AQSA 3P1GA 2XBPA 4FWRA 3OR2B 4KHPJ 5KG2A 1HRHA 4OMFG 3ZSXA 4H4MA 4JYAF 4FP9A 4I6MB 1Q1KA 3CD5A 5EDWA 3S9HA 3BR8A 4WZMA 1NHVA 2E1CA 2E9RX 4Z4EA 2JL9A 2UXBK 1Q0NA 5E2QA 2UVVA 2CAJA 3BEXA 2BOPA 3J7AP 4NYFA 4IQXA 4H0OA 3DYAB 1X5TA 4EWTA 1UTAA 3NCRA 5FJ4A 4IH5A 2KT2A 3MR7A 2OTJN 2YNFB 2B9XA 3QT5A 1LW2A 2FBTA 4CLWA 1N5YA 1HLWA 3O6QA 3KD5E 3DLLL 4ALZA 3I8DA 3KUEA 4M42A 5F8NA 1S9GB 3ITHA 1HNWF 1NK8A 5KT2A 4BRKA 2MZTA 4JOUA 2IA6A 3G4SS 3KHGA 1N0UA 3DRYA 3QZ7A 3CMAN 3FMBA 2ATQA 3ZSRA 4DV4J 2O8DB 2G8IA 3K9KA 3ID6A 2DTUA 4ZVSB 2ZBQA 2V0NA 5DG7A 1A0OB 2GUPA 3O3FA 5CHCB 3G25A 2HLUA 2HNZA 2J7UA 2DR9A 3CF5L 1GK8A 1NDKA 5ETQA 4KHPK 3R5AA 2DFEA 1GQEA 1YG0A 2NREA 3VGTA 2NPFA 3WQPA 4FLTA 4JI5J 5M2RA 1HBNB 1T3NA 2HS4A 2SXLA 2XY5A 3OYIA 3K5MA 3K2PA 2ATLA 4IEEA 3I6PA 2KW4A 4F4AA 5I3UB 3TW0A 4DXLA 2EG2A 1G7CB 1APSA 2UXCF 3MOZA 2AU0A 1NGJA 4BACA 3M7VA 1S4FA 5KAKA 2D69A 2H3GX 3D28A 3MK6A 4GVLA 4JKDA 3JXOA 3PIPQ 1QY7A 3A8IA 5CABA 1MMLA 3W9HA 2ZWOA 3LM9A 2H51B 5AQQA 1BA1A 2MKKA 3AARA 3O6WA 3VF0B 1CG2A 1P9QC 3BDPA 4CEFA 4DX8H 2UVUA 1U8SA 3EMTA 5KPZA 1WTBA 3IFRA 5AQFA 2UXBF 4CLTA 5J1EB 4N41A 1WC0A 3MM6A 1MROB 3WNGA 2CGJA 1OS5A 3NNAA 4DV4K 4NYOA 4CHQA 1NXIA 2ACMA 2VH7A 5JJBA 4I1TA 2KQ2A 1U45A 2WBNA 2R8KA 1WSIA 1Q18A 4FYWB 2DKOB 2DR7A 4EBEA 2EK6A 3Q7BA 3OUYA 1RWXB 1R8BA 1CJTA 4JBCA 2XG8A 5J2PA 3TUJC 4RBTA 1SCJB 1L3UA 3D66A 1RE1B 4CH0S 3VEOA 5B8HA 2LXFA 3L0QA 4C8MA 1J9AA 4C11A 5CY4A 4ELUA 1RTIA 2RF2B 4MLHA 1XMQF 5IWAK 4NE9C 1QQMA 4K4WA 1ZA1B 2BJ9A 4LR7A 1T3VA 4EI2A 2YKAA 1F9HA 2O67A 1J27A 4RX6A 2EKYA 1SL2A 1GX5A 4AH9A 2ZFHA 3KLVA 3A3NB 2EFNA 2B9EA 3AH6A 4QAGA 3WEEB 3IDHA 1FDBA 3NG8A 5C2CA 1S99A 3CCUN 5HROB 3SV3A 4NLDA 4WXWA 1H38A 2XHWA 3G9CA 4GMJB 4DV3F 1R89A 2CPXA 3HHEA 1VDHA 1ZM9A 2V4RA 3ZFVA 4KHUA 4Y34A 2HBJA 3KTQA 3SMZA 2X3GA 2DCLA 1X60A 3RZAA 2XLIA 4F67A 3HHKA 1X3MA 5I4MA 1RAGB 4CJTA 3QBCA 2E5JA 2OLWA 1BXNA 2EFOA 1CLFA 4H0VB 2QT7A 2ROEA 2MLZA 4FF4A 2Q0UA 3AJ1A 3QJLA 1HYSA 2G8HA 3LP0B 1JNRB 5K8OA 2KN4A 2VYPA 3PG9A 2HNZB 3EZOA 1B7FA 3L3UA 1BLUA 1QUPA 3JSBA 4PY5A 1FT8A 2DT9A 2OPRA 5JXSA 5AJ3J 1NSKL 3CC4N 3DRRB 2XS7A 2ZHOA 2GIQA 1VLYA 2I5JB 4XK8C 4CO3A 3FZMA 1CVJA 4K42A 4AYBD 1HNXK 2FBXA 4M5DB 1TUUA 3LAMA 1WKJA 1RLCL 3GJQB 5IZHA 1F21A 5A2QY 3EXYA 3DDNA 4PL7A 2C22A 4Y6IA 3KWGA 3RBEA 1VQNN 2VKZG 1I39A 4BDZA 2ZC4A 4EIAA 5AQUA 1ASVA 3PCOB 2UUBF 2E29A 1HW8A 1U1PA 2QGFB 3BSAA 4OI2A 4EAHD 5MAOA 2PEBA 4K2JA 4JI5F 3UKUB 4NLYA 4ELTA 4KTZA 3KHLA 1VSFA 1JWWA 3A12A 3FEXB 1Y11A 2W6KA 3ZTQA 3FEZA 1N34F 4LF8J 3V9UA 1RZMA 1F2HA 5GAGU 4O44A 2DGUA 1HUXA 3MXIA 5KFRA 4OZ3A 2PA8D 4WFNL 1HBNA 2UU9F 4LFBJ 1RBAA 3MECB 1TUVA 5AQZA 2QG9B 5B0AA 4OYXA 3W63A 1DY3A 4F0KA 2FTRA 4IG3A 4IRCA 1S4EA 2F7TA 2E6LA 4DTPA 5JICA 2W7PA 3GFXA 3DMJA 5GMDA 3MXMA 3IWLA 2I9SA 2VFUA 3S8SA 4DBQA 2BKPA 4IXCA 1FE4A 2VDIA 4UOHA 3VQ8A 1PAUB 1HNXJ 2EFPA 1GNKA 1SIWB 3BYRA 4A59A 3OL9A 2GIRA 4KFBA 3KLFB 1NKCA 4BGAA 4AF1A 3OTCA 1Q7YT 4BQLA 2O8CB 2H5JB 1GXLA 2XWYA 3GLJA 4Z4FA 1XR7A 3CJ3A 2VFVA 2HHHJ 1PIEA 1SL0A 3S1TA 2DY9A 1LKZA 1NZ8A 2GUIA 4A8YA 3V9XA 3NCPA 3NLCA 1FJEB 4RR5A 3I4HX 3M8WA 5KFXA 3MPVA 4KREA 2BE7D 5C25A 3GG0A 2L08A 1ASUA 5F2RA 4CVNE 4FJJA 3IGNA 1RHQB 1FWPA 1XUPO 3CHWA 1IV0A 3HD2A 4H03B 4DQ8A 4UF4A 3VQ6A 1YXQA 4PUOB 3IP0A 4ECSA 4TY9A 3M2VB 3BZKA 3IR5B 3M1VB 2VD3A 1NO8A 1X5PA 4RW9B 2L9DA 1YHQN 3SUNA 1FKOA 2B5JA 4FL9A 2MSSA 3NBPB 1FRJA 2CG8A 5FROA 2XMUA 2BE2B 2A1SA 3RAQA 4CERA 3J7ZT 2O4GA 4BRFA 1EKRA 4B8AB 1WI8A 1FA0A 3ID8A 2CQ3A 1VQ7N 3X3UA 4P74A 5ELZA 4ZJQA 3PYGA 1U1NA 4IUFA 4IQMA 3EPGA 4A8FA 1FXDA 5KFTA 4Y2KA 1RTJA 3LGMA 1KOOA 4DEZA 1VIOA 3V9SA 1G15A 4O0IA 2MZJA 3A3PB 4K25A 1NB2A 4B9VA 3BPDA 1CC7A 2ACYA 3BF3A 3ETMA 3MMCB 1UA0A 4M5MA 1FESA 3UDLA 1FD8A 4KGVB 1I51B 4BWMA 9RUBA 4CJUA 3CCZA 2YVSA 3BUZB 3HCXA 1IM4A 4QCLA 4I6WA 4LSNB 4WZQA 1YQHA 1VK3A 4H5RA 4PKDB 4AT1B 3SI6A 3GV7B 4C1NK 2HIYA 3V2UC 3HULA 2ZJRL 3SJJA 1OPZA 1EKEA 3U02A 3QGPA 1VC0A 5LMUJ 3ULEB 1HI0P 4OZ2A 1UJ5A 4KHYA 1IKVA 4FKXA 4JI6J 4YP3A 1S1VA 4NLRA 1XC9A 4HTLA 2RKIA 2VG7B 2QYCA 1BQMA 5KT3A 4PA1A 1WC3A 1PJ7A 3ZZUA 2J6UA 4FLUA 4DR1F 2P5GA 4TQSA 4CZGA 3DLKA 1SJ3P 5A2QO 3CMQA 1WEZA 4IO9Q 2E5IA 4AFFA 4JKCA 3TEHB 3CFRA 4FJMA 4KHPF 1Y3JA 3NAIA 2AGOA 1HI1A 3HTVA 4M7YA 3VZIA 4DOZA 1NK0A 4OYOA 3PEJA 1N34J 4ILJA 4CEAA 8RUCA 1S48A 1VISA 4P9SA 4USWA 4N56A 2IBKA 1VSDA 1XIQA 2F7VA 4FXDA 3RB6A 2ERRA 4A8SA 1JK9B 3QEWA 2VPZB 4C0OC 2HAFA 4HTJA 3CFOA 5GAEU 2FJAB 2HHPA 4RUCA 3G8SA 4Q0BA 2J8SA 3TTCA 3VAIA 1AYEA 3G2XA 2KRRA 2QX0A 2DGXA 5HSPA 1F9FA 4GVMA 1Y9OA 1GLDG 4I6MA 1RT1B 2R3VA 1S6QB 3CJ7A 4USJC 4E89A 1AUDA 3OYJA 4MIBA 4ED4A 2A2CA 3CNQP 1FF2A 2MQLA 4PHTX 3RVCA 1RP5A 2HS0A 1B7YB 3DLRA 3W8GA 1S57A 2XI3A 4FVCA 1XR6A 4G1PA 3AD8C 2NLXA 3J7Z5 2V2ZA 4WTYA 5IM0B 4BG9A 3EGWB 1D8ZA 1QD1A 1X4HA 1QLNA 1N34K 2HKEA 3US5A 5AQTA 1PKUA 4J9UE 2LQ5A 1I1GA 2MGZA 5KFKA 2KM8B 3L8BA 1ZBUA 4V19X 4FJ9A 3KLGB 1XI1A 1S22A 4RBUA 1RTDA 3FSIA 4TY8B 3AFGA 3V4IB 4KE5A 3RRKA 1MWMA 3QBWA 1BC6A 3JQKA 3N6MA 3O8MA 1HBMB 4FPIA 4O4RA 3VAKA 3MTKA 1P6TA 2D0PA 5GAHI 1VC5A 3A4TA 3SXLA 4PYAA 4CK2A 2Z57B 3PLAA 2M7SA 5KFFA 2YHAA 1H7WA 3MPYA 3D6RA 3AA4A 1JLBA 1ZM3A 4IEIA 2ZH9A 3LQVA 4ZA1A 4P10A 4FLYA 3AQOA 2NLWA 4ZMMA 1IR2A 2W25A 3C7NA 1KVJA 4M1KA 3SCKE 3IBCB 4NCBA 1JQGA 4MFBA 2EI5A 2P51A 4J90A 4CP5A 2VPXB 5A8WA 1RTIB 1X3NA 2PT0A 3Q24A 2CNLB 2W42A 1OKJA 1RHRB 1Y5NB 1JLCB 1X5OA 2IMWP 3MCNA 2IVMA 2DGTA 5HLFB 1DQAA 1NPPA 2GIFA 3ZSWA 3QLHA 2LQJA 3I55S 5GINA 1U24A 1M5VC 3P8BB 3HZ6A 1I5OB 3TSUA 2QW9A 3DWLA 4Y00A 4KH6A 1KN6A 2QWMA 3W8PA 1WSJA 4TLQA 3VEVA 1OH5A 3S7RA 2CNKB 5G0RA 5EX5A 4ZVQB 3CJ8A 3R8EA 3MAAA 4QIGA 1MN7A 2JEGA 3HSZA 1PBAA 3MMAB 1SV5B 2G8VA 2DCUB 2UUAK 2HBLA 3TAPA 2PBDA 4CW7B 4CO1A 2YJEA 4ENOA 4U8VA 4ED5A 1RBVA 2XY8A 4WIIA 5EX0A 1TK0A 2QLXA 3ULEA 2AYEA 3KK2B 1JLCA 2R8JA 3CCQN 1KC8O 3CCWA 1T94A 4LQ9A 3ZSYA 4Y2IA 1CXUA 4KBOA 3K57A 2F4VF 3F44A 2X1AA 2D5RA 3P4UB 1UAXA 3NY0A 4JKGB 1VQMS 3SMPA 1T95A 5CE3A 2OO4A 3PW4A 4QPTA 2Z30B 3GFZA 3KKFA 1HW9A 3MD3A 4CM2A 3JB9k 2HHXA 2ZH5A 4NLPA 3UWTA 3GFHA 1Q82T 4QBUA 2KL8A 1AFIA 4F4XA 1XNRF 3HSTB 4N8OA 2MSTA 3ICLA 3BP8A 4M45A 1LCUA 3VTHA 1GX6A 2VCPA 2D4WA 1PG5B 4I2QB 4NLQA 5AE3A 3QRRA 1BI4B 4H4KA 3D0HE 1S7HA 2GW8A 3O1LA 2ITGA 3WNFA 1BMQB 4HCBA 4M95A 4AE5A 2RAQA 1HNWJ 4J8FA 2C2RA 2DGWA 3J81O 2G0IA 2QXLA 2O8DA 3SQ1A 2UUAJ 4QZVB 2G8KA 1XQSC 4MDAA 5BR9A 4WP3A 3W7BA 1FE0A 2Z2MA 1X9MA 1A5XA 1B9DA 3BPSP 2D9OA 4IFVB 2OYQA 4YUDA 4EZ9A 1S0OA 5IOLA 2AF6A 5GVQA 4ZKAA 4B3TJ 4YDXA 1VQPS 3GWCA 3R7NB 5EY4A 4J2DA 1E6VB 4IOBA 2FHKA 3CJQA 4B3TF 4GVEA 1ITPA 3TANA 1UA1A 4Y0WA 1YJWN 1YX2A 3M2RB 2BKNA 2MJUA 5KG3A 4PG7A 1RT4A 3VQEA 1OVYA 3D1HA 1KFDA 4QR2A 4E1NA 3NGSA 3D2EA 3IN5A 3T6BA 1FD2A 4DPWA 4K0KJ 2ZBIA 1N33F 1GLJO 3QQCD 1WNEA 2PO4A 4K5RA 4NEYA 2KXNB 3DFEA 3DDKA 4C3LA 3J81Y 4JS5A 5K8MA 3LOUA 1SZ2A 2DBBA 2UUCK 3T5LA 1HNWK 4IOCQ 1IWGA 2ZE2B 2E2OA 2RHQB 2YBVA 2QRRA 5A2QU 3A8JA 2MQNA 1QSSA 4WCEQ 2EFQA 2CG4A 1WJ9A 2XYGB 2B4JA 2ZVIA 5HMXA 1IN0A 2IBOA 2CJQA 2HFNA 1RAAB 1U47A 4JI1J 1LK7A 4R8UB 3CETA 4OHVA 1E6YA 3PR4A 1FO1A 2VFTA 5BRDA 2I5JA 1NJWA 2EK1A 3VVUA 2A0FB 3OSNA 3E8OA 4ECZA 3SUQA 1S59A 2R7WA 1HHSA 1C4AA 1GLLO 3ONQA 5IM0A 2Q43A 4NB4A 3OSPA 1K44A 3H59A 4DTOA 4CYUA 4IO8A 4K50A 1Q86O 1WF2A 2PSZA 4ZCKA 4FN5A 1U48A 2GQCA 4F36A 5F3ZA 5E26A 4X64K 4HACA 4RU9A 1JXVA 5DM7L 1WBBA 2P5OA 1JIHA 3K5LA 3DRPB 1HMVA 1XMQK 3BBFA 1D0EA 5KFUA 2NQPA 4JK8A 1CBKA 3U1LA 4FYXB 1NK6A 3J7AN 3UFCX 2E2PA 3SAHA 1IKXA 4OKJA 1P8ZA 2VGMA 4BWJA 1K8KA 5ETPA 3M8QB 4WE1B 4FM0A 2E4LA 4OPHA 3JAMY 2UUCF 2L48A 1TUGB 3UCZP 1Q8KA 1U2CA 1NGBA 5LMNJ 3PHTA 3LP3A 3LDQA 5KFSA 4RW4B 5JS2A 1JLFA 2J5AA 4M3UA 2D7SA 3OYEA 4JI1K 2X1GA 4F25A 4E3SA 2HS3A 3ILIA 1KLMB 4DX7A 1WKLA 2FJVA 3CEDA 1RDRA 1RHJB 4RCHA 2AD9A 4UW2A 1Z26A 4K43A 2F8TA 1YJWS 4A8KA 2J8AA 4HUGA 1SC3B 3M2UB 2NZCA 4BHQA 2AJ0A 1RHUB 3W5XA 2MDAA 1EB0A 3A2FA 4ISEA 2XO7A 3LZIA 1LNQA 4X62F 1BQNA 4ZCLA 3MMCA 4HVZA 4ZVRB 3BGOP 4Q43A 2A41A 4JRQA 4BC7A 1U1RA 2KFNA 5GMKa 1XMQJ 4FJGA 4WKYA 1S1UB 3MPDA 3OYCA 2XC9A 1IBMF 4H4OA 2EPIA 4CJ3A 4QIEA 3I55N 1RDWX 4EO8A 2ASMA 2B51A 2QL5B 4KGZB 5GAHP 4AHUA 1JX4A 5KFIA 4U7BA 3OLAA 4HHJA 1HNIA 3ZX0A 2CJ9A 2ZM6K 5LL6Z 3O9RA 1HQEB 3KK1A 1H7XA 2EC0A 4MIWA 3MEEA 3AOBA 4FKYA 4OYIA 4WP8A 1NRKA 4OI0A 3THWB 3P49B 1RAEB 2YX1A 4QR1A 3V6HA 5M1OA 2V8VA 3NMUA 4PQAA 4C8KA 1YWXA 2OZMA 2AJ2A 2FC0A 4ECRA 1XMOJ 1JLGA 4DSFA 2DHGA 3ZEUB 4E7IA 1XNRK 4WXOA 4B9QA 4CF8A 3T3FA 2QWRA 4JV2A 3C15A 2B4VA 4DPXA 3VQAA 1JLEA 1NDPA 1S6QA 2VFRA 2ILZA 4IKAA 4FO0A 4CWBA 2CZVC 4Z37A 1NMEB 1E6YB 1H73A 1IO2A 5KFJA 2I7PA 1WKKA 2F4VK 4A61A 1QQOA 3CO0P 4TU9A 2F63A 4ZVTB 3THVA 1X8DA 3NGDA 2CFXA 5DRKA 1TMMA 2HOEA 2FLNA 5EU7A 4CE9A 4C23A 1LWCA 4U67Q 3PRVA 4YR0A 2O66A 3HVRA 5IV3A 1SL1A 4U7UK 4WQ5A 2OANA 1NUEA 1RA6A 5ITHA 3CC4S 3OFHA 3AVMA 1CLQA 2ASPA 2ZH2A 1DURA 4NRTA 1X9WA 3G82A 2QA4G 3OYAA 1RFQA 4KTWA 2NRHA 3CCMS 4DL3A 5DQHA 5D4LA 1NDCA 1S7IA 1RBUA 3NKYA 2HFVA 3PFEA 5CAAA 4R5PA 2DPNA 1JXBA 2DHXA 2WVEA 1VQNS 3THYB 3KKRA 3EGZA 4R8UA 4DTSA 1XNRJ 3R5DA 5T7LB 3M6XA 4NXNJ 3DLBA 2E5GA 1KQSR 1NOYA 2E44A 4G3IA 2ZQBA 2C3YA 2NXEA 1WSHA 4OHXA 3KJVB 4P2MA 1V4TA 3EN9A 3HZEA 4GC7A 4LF5K 3QSIA 2GMJA 9ATCB 4W4MA 5IS2A 4CTAB 4FM1A 4DCJB 1GLFO 3TAEA 4OX9J 2HGMA 3CG7A 1R8PA 2DH7A 2OFHX 1NHKL 2HQDA 3CCLN 2F4VJ 3G6VA 1AZSA 4QYRA 4O0NA 1T05B 4IG0A 3OS2A 4ILLA 1RU2A 1HYVA 2UUTA 1YJTA 5HJYA 2DK2A 3JSYA 2RRNA 2RDIA 4JV5K 3O5TB 4TXSA 1FK9A 2PIIA 2QYGA 3VETA 1UEKA 3CC7S 3UE2A 2HVDA 4EP4A 3IR6B 1N5VA 2OEKA 3HOSA 2V9KA 2VA2A 4U9RA 3WXIA 3S3NA 2XLJA 4JI4F 1T9WA 1CZBA 3V6DB 2C2NA 4HKQA 1KTVA 2B56A 3IG1B 1DTQA 2GMLA 2LMIA 1HBMA 2J4RA 2VFSA 5HL7Q 2UVRA 3FZHA 1Z4UA 4IRDA 4P75A 3MXHP 4MKBA 2FD2A 1C0GA 3LDPA 3AVCA 2Q1NA 4A57A 1T05A 1HQEA 2IA0A 4YB7A 4LVOP 2DRAA 5FRMA 1HKGA 2QE5A 3OYBA 3KLEB 3GB0A 3QICA 2J9DE 5IT9Y 2FLOA 4U95A 1DRZA 4BC3A 1IG9A 4W5OA 1FK9B 4ETZA 1N6QA 4PQUA 3MCOA 3G87A 1E4FT 4LF5J 1NSQA 3G96A 4EBCA 3H6EA 3L6QA 5IV4A 3CC2N 2VG5A 2KO1A 2ASDA 2WOMA 2M70A 4LBPA 2Y8WA 2HHWA 4OJGA 1U02A 4AXJA 4ECXA 2RNEA 4F8RA 1UP1A 3MUVP 2E1AA 5D77A 1RHMB 2PAVA 1U09A 2MKHA 2V69A 3P96A 1R59O 1Y7PA 3CDAA 1VQ9N 1T8EA 4E1JA 3HP9A 3DU6A 2MXYA 2V7ZA 3D5MA 3DLEA 4YOVA 2AQ4A 2LA4A 2VWBA 1YVUA 2RSQA 1RDUA 5K20B 4W90B 1K9MT 4O8UA 4J2EA 4CJLA 3FZKA 2YNFA 1B9FA 1BGXT 3I56N 4ZVGA 3IWXA 1HHQA 4OPKA 2H9ZA 4OKEA 1HWIA 4PWWA 2AIRB 3M32A 2YX6A 3W9JA 3JYTA 4E7LA 4OFZA 2C3OA 2AGPA 2UP1A 2IAJA 2QM1A 4KGXB 1CJTB 5HQ8A 3AA9A 3VMFB 3J7YI 1TAQA 1Y00A 5KQDA 2BQRA 2CZ9A 2K8GA 4ZPDA 2JEIA 1ZBSA 2YKQA 4P71A 2NCKL 2MZQA 1YK9A 2XYHB 5AQLA 3D6HB 5M1QA 4DUYK 1TKTB 2R7SA 4NX9A 3DLJA 1MWYA 1FDNA 1HR0F 3MEKA 4CF2A 4N8NA 2QIFA 3ZZRA 3SSSA 3LDLA 2OIHA 3QLHB 3L2VA 1NJXA 2R7RA 2E6MA 3GSDA 1FI4A 5HVGA 2XNRA 3MMJA 4RNHA 3W65A 2P9LA 1BHNA 3C6HA 4DSJA 1RT5A 3DNCA 3I0SB 4PXCA 5M2UA 3PXGa 1EWRA 4I4BA 3C6TB 4G65A 5KFDA 5D3GB 4B3OB 2G2YA 1K8AO 3CSKA 4LUBA 2OFGX 3R9LA 4ECTA 1UVIA 1S72N 1ZTTA 2D3UA 4KHQA 2VDHA 1NKBA 4KPCA 3BN7A 3W5ZA 1VBXA 5LSOA 1BQMB 3QGHA 2HSEB 2PN6A 2VGNA 3CI5A 3D9BA 1VQ4S 1WSGA 3V4IA 4YDUA 4DX6A 1RT3A 3V6JA 2P9GA 1T6CA 5HRPA 3ALYA 3EVWA 4Y1DA 3FGUA 4NLUA 2YHYA 5AFUH 3FBEA 2DNKA 1V4SA 3QAUA 3CMES 4KGMA 5J1NA 1NPRA 4RU2A 2Q97A 4OJ1A 3UR0A 3CIMA 1VQOS 3I5BA 2VWKA 1OH8A 1WHWA 3AO4A 5SZTA 4K8ZA 3U7JA 4ZP7A 3CDEA 4NLTA 2W8KA 1T9UA 4E98A 3MCAB 3V9WA 1LWEB 5K14B 1X4BA 5DQIA 3KJNB 1T0TV 3QRQA 4I2QA 2YV0X 3C3LA 3RR8A 1JXEA 1ZC6A 4GKKK 2CDRB 3IAM9 5HMZA 3R5BA 1MWKA 1BG3A 1ATRA 1C0MA 3L09A 1YKWA 4QOZB 1YRUA 2WRMA 4JNEA 7FD1A 4J2BA 3PFOA 4X4PA 1JCFA 1SC4B 4M7XA 2ZD1B 3NGTA 4BDPA 1RTJB 1F5AA 1WWHA 3PZPA 2YKNB 1B0PA 5CQGA 1VQ6N 1HWJA 3D2FB 2HURA 1WOSA 2G1HA 4OL8A 4I6YA 4F7VA 1RWKB 1C4CA 4LF7K 4DSKA 1MG7A 1TL4A 4JV5F 3CD0A 3VA0A 2IM2A 3MEDB 1AXQA 3EGVA 2D74B 2GQQA 3UR3C 3CCUS 4DHYA 4CTAA 2W4PA 4NI2B 1HMVB 2HMPA 4TN2A 3EEQA 5DLGA 2LQ9A 3N9UC 4OQJA 4DCOB 4YOWA 3GIRA 4M63A 3QJJA 2B8PA 3CC2S 2Z8QA 3C6UB 4IH6A 3HSJA 3FBCA 1J54A 3HKZD 2DNMA 4JKGA 4BE2A 2VC1A 2XMAA 4BRDA 3DHXA 3CCRN 1UZDA 1YTAA 4IOAQ 3NVKA 2C2DA 5HJXA 5A8KB 2YH0A 4X66F 2AW0A 3L4BC 2UU9K 1FNXH 3WIVA 3ZSVA 4RO0A 4O3NA 4CJ5A 5E3RA 3I0RA 5BPLA 3HM8A 5IQQA 1MROA 3DOMA 4LRBA 4AXIA 2DHHA 4CJ7A 2LQ8A 1KBRA 3UE5A 1CXQA 2MQMA 4LFCF 3M1VA 2BEFA 4MYTA 4RWXA 5AXNA 4QWCA 4DV1K 1PJ6A 2VODA 5D3GA 2CPFA 3KK1B 1VLOA 4USIA 2PZSA 3IBFB 2F40A 3LA0A 3D68A 1ZTWA 1S72S 2IRXA 2C42A 4C8NA 1NOZA 3LPEA 4DR5J 2BJ8A 3CD6S 1CJUA 2QA4N 1CQMA 3H7HB 2NNWA 2JNJA 2HRYA 5SWMA 3R6MA 1KQSM 3D6FB 1IJEB 3FFKB 1U2FA 4WYWA 4LH5A 4CDIA 3VQBA 3W60A 4NLVA 3ATUA 2VUGA 1RWUA 1VR6A 3HSCA 4IR9A 4GKJJ 3KFWX 1WF1A 1KOHA 2HBKA 3UN2A 1KVKA 2HNYA 4UZCA 1UFLA 2W8LA 4CLYA 1RWNB 1RNHA 2W7AA 2RQMA 2GWKA 4QW8A 3OTOJ 2JEFA 3MR5A 1MW7A 1BO5O 2HRUA 2LA6A 4JKBA 1S1TB 4UOCA 2UU9J 2E5LJ 4JYAJ 2MZ1A 2ASOA 2LSNA 5BR8K 3TARA 1WB9A 3MPUB 4KB0A 3QJPA 1EARA 1TKDA 2UUAF 3ZSZA 3LANA 4RW4A 2ATCB 4KH4A 3SPYA 1CZAN 3P31A 4CHYA 1CULA 3NGRA 2UV8G 1R0BG 2JC0A 4DV1J 1RWPB 2R2TA 2A10A 4Y2MA 4F02A 3KHRA 4KFBB 1NGCA 4CO5A 2L9WA 2Q3PA 3DXBA 3F0NA 3LP1B 1IBKK 1S6PA 3HOTA 1VQ9S 4DR5K 2W9BB 2QTWA 4NA2A 5HQMA 2XB2D 3M2UA 2XNQA 2RMLA 3LWLA 5AQHA 2K7KA 2R2UA 3ZZPA 4ZITA 5LL6d 2WCXA 3DXMA 5H1SQ 4QOTA 1QDUB 2DNNA 2CQGA 4BRQA 5AE1A 4JI7J 3O9UA 3WZ0A 5DG9A 2LP4A 3AO3A 4K5SA 1ATNA 3M9MB 4PXEA 1QHAA 3H3NO 2IJRA 4XH4A 1UAWA 4YOTA 1QTMA 1JKHB 3EYZA 5B7WA 4B1VA 5CYJA 1RT6B 1SKUB 4BRNA 2D1KA 4ID1A 3MZIA 2ZZTA 3DGPB 2AA4A 4OZNA 3RMBA 3KMQA 4LQ3A 3VPZA 1RYSA 1V5VA 3DHWC 1X0FA 1HNZK 1CJVB 3E1YA 2E5LK 1M1KO 5BR8J 2HLTA 3LPTA 2O8FA 1T9VA 4YS2A 4JS4A 1DHMA 1HKCA 3JTOA 4O3SA 3NNCA 2ZHAA 2NZ4A 4URGA 4OYPA 4ZVEA 4WBFA 3MMVA 4JI2F 3SNNA 2VG6B 1RT3B 3PKMA 2FGOA 1VSEA 1KWMA 3W2WB 4HTIA 1S79A 4H4MB 2DNZA 1IBKJ 3LUYA 2AP6A 1LFPA 4FS1A 4LF9J 2P9NA 4MMOA 2OMOA 3AD7C 4F4YA 4U7CA 2JLGA 2BRLA 1YSJA 2F8SA 4K4SA 1JLFB 4I9LA 3ZNJ1 2ZHBA 1NBEB 4XAKA 1NH8A 1W2BM 3CT9A 1E6VA 4E8UA 3JSMB 4J9PA 4CJRA 5M1FA 1J5EJ 3B54A 2GQ2A 3N5FA 3PTWA 1XNQF 4DF8A 4ILHA 3H5YA 2HF3A 4ZJOA 1SS6A 3AV9A 2EBEA 3HPOA 3CYMA 3OS0A 3BGRB 1RTDB 2AEJA 4BRMA 3AOAA 5A6PA 1DLOB 1QAJA 3KLGA 1FCAA 2BR0A 2B0GA 3VA3A 3HJFA 2FJEB 3NH0A 4YB5A 3Q83A 2ZUGA 3FCHA 2BA9A 3TAMA 3M9NB 4RNNA 4G6VB 2LKZA 5L1LA 4Q45A 5F0UA 2KRBA 4RJVA 2XY7A 4NZ0A 4TYAA 5BJRA 3I32A 4W5NA 3V6DA 2XZWA 3OVNA 2D0CA 2AJ1A 3B8AX 3E01B 4CO4A 4DL0C 3BGFA 3UDVA 4LF9K 3KXDA 1VRUB 1D9AA 4K4YA 4DFMA 3Q2SC 2N7CA 4V19J 2IOCA 2GO8A 4USTA 3TR5A 5C2FA 3AO5A 1WDTA 3MXJA 3AVFA 2E66A 3JSMA 3AVJA 4J2AA 3Q8SB 1DFDA 2VV5A 4LRCA 3IRXB 1UMJA 3KUGA 4I68A 1WSEA 1RADB 7FDRA 2QKKA 1VQ6S 1S97A 2RN2A 5AQGA 3ENAA 3H2LA 3VEYA 1K8KB 5H9FK 4C6AA 3AT1B 3QBXA 2CNNB 4JK9A 4PXBA 1NK5A 2Q79A 1TYQA 4HYKA 4O5BA 3QNOA 4ZJLA 3JAMU 2NSBA 5B0FA 4R25A 3Q8QB 1VCTA 2AJFE 2OPPB 4USUA 3KZBA 4M3XA 1ULRA 2HSTA 1UFWA 1B64A 4R79A 3GJTB 4HUFA 4JI4K 4C0BA 2AYGA 4DUTA 3J7A1 2YI1A 4J9RA 1WTFA 3VGVA 4WF9L 3GYNA 3PJWA 3AA8A 3C65A 1CJUB 4BROA 2W1BA 1HNZF 1VQLN 4LSNA 2AZ3A 3I4PA 2CWXA 2ADCA 2B4OA 1FKPA 2JZ5A 3WXMB 2GGPB 4PQUB 1PYTA 2O8EB 4DR1J 2C28A 3WQTA 3EUNA 3VQ7A 1VRTB 2W40A 4M94A 2XMKA 3WEEA 5JMNA 2HHSA 1AA1B 1QQCA 5C10A 4QPXA 4TU8A 2XSJB 2ITMA 5D6GA 2OH2A 2G0JA 1VSKA 3WNHA 4J9KA 1R3NA 4F4KA 1IM6A 3CJ4A 1K73T 2DYAA 1U2RA 3GE9A 1HNIB 1ACMB 1TL1B 1M1HA 4DJBA 4AM6A 1Y0HA 3ZZZA 2ZH3A 2J0SD 4DR6F 3ZCMA 2LDIA 1S76D 1HQUB 3VGUA 2OP5A 5FLXY 2FSJA 2AMCB 3H5SA 2MHEA 3UNGC 1YJRA 5TKWA 3NF8A 2QZ8A 2JLEA 4GV6A 1W25A 2N82B 1XHZA 5IXUA 1EWQA 2WSEC 2XRIA 3QFUA 3M1FA 4WF9Q 5U47A 1FRIA 3VAHA 3RMDA 3VEWA 1IKWA 2VB6A 3KLIA 3KUHA 3TJ9A 1WHYA 4OIXA 1BUXA 5A8RB 3TPQA 4H5WA 4PZVA 3BDEA 3DRRA 1BWEA 5HVFA 3A8YA 3EKSA 2G1DA 2PGCA 1EIYB 2PD1A 4OI4A 2LECA 2ROPA 3VR1A 5D78A 1A5WA 4ZN1A 2UXCJ 3Q7CA 4M5KA 4CLZA 1TELA 4J9QA 4IO1A 2OTLS 3IMQJ 4A48A 4B3RJ 4O3QA 3PY8A 3CC7N 3AQPA 3MURP 4YNQA 1NK9A 4BC2A 2QC3A 2VBXA 1KLMA 1GMVA 4JI8K 4NXNF 5C5JA 1OY6A 4B9UA 4P2XA 3C16B 2FZKB 2ZH6A 5KFPA 4N5SA 1N36J 4QQBA 4LF2A 5K14A 4ES2A 5HP1B 3JS6A 1RBSA 5KTQA 4JB8B 1U25A 4DPTA 1D9DA 2W2MP 2I0XA 2OA8A 2FZGB 1ATSA 1S9EA 3D0IE 4FWNA 4O4GA 2DNQA 4V1Ak 2P9UB 3NWGA 5AZJA 4FM2A 4DR7K 3MFIA 3GSIA 2ZH8A 2VBWA 1JMTA 2EWSA 3SCLE 4ZK7M 4N7TA 3F5TA 4HVJA 4JUZA 3DAWA 1RT1A 2NS1B 1C1CB 1DEJA 1YJNS 4PKGA 1PC4A 4IWVA 5DDPC 2QTDA 1RK8A 1X31C 1RGIA 2UXCK 1SVDA 2MB0B 3GU0A 2CRLA 4MIAA 4FWMA 4CYUB 2CJXB 3J80U 4LF7F 1S0VA 4M5NA 1VIXA 4I7FB 4WFBL 3PJXA 1UW4A 3CMAS 4PG5A 4DZ6A 5BN8A 2L9NA 4B3SF 4B3RK 2M88A 4M41A 4RNMA 1HFEL 1IH7A 3CUNA 3O9TA 1X4AA 5DJBA 2HQGA 4H5TA 3AVLA 2M8DB 5AZJB 4JI8J 4OHWA 2ZKTA 3ILJA 1HPMA 5CR4A 5BRHA 3A8EA 5ETMA 3ENBA 4RZRA 3FJ2A 3N6NA 1TV6A 3IG1A 2XSJA 1E4GT 2GX9A 1TMJA 3ZT4A 5C24A 2AHOB 1NGFA 2CQ0A 1U0HB 4S0MA 4DLGA 2MPUA 2BANB 3OR1A 4FJ7A 4FK4A 4DV5J 3MDQA 1BA0A 4LC9B 2PI5A 5B0DA 1NGEA 2A5XA 2I8EA 2FJXA 3VF6A 5AXMA 4EFHA 2AV5A 4W92B 1F3FA 1TZ0A 2DISA 3TX8A 3QFPA 3PX0A 3S6EA 1PAEX 5EWGA 2MQOA 5EHHA 2XSFA 1KNZA 3RJMB 2GJ2A 3ZETA 3H1VX 4CJEA 1H74A 2VF3A 2MTLA 3CJ5A 1VQMN 4K8RA 3WUHA 3HZGA 3A0IX 4JI3J 2RJZA 2R8GA 4A47A 5B0BA 3DRSB 1WI6A 4G1QB 5AQPA 2FLPA 1VC6A 5AJ3F 3VCDA 1WUAA 4DL6A 1IJFB 1H3DA 4F0HA 4BVPA 3C46A 2CJAA 2CQPA 3P3DA 1SH0A 4ZP6A 1TL3A 4UOGA 5B08A 4CK3A 1RSCA 3CCVS 5K8PA 3U3GA 3THYA 5HMWA 3E3XA 2KKZA 4J9OA 5HI7A 4CO0A 1S1UA 3AA2A 2GO9A 3QERA 3MCSA 2ZKUA 4MO4A 4ZIWA 4Z4CA 3FZBA 1HNVA 1RWWB 1GFWB 2AX0A 2XCPA 1ZZNA 3SAFA 5FPDA 2M8HA 1W2BR 2F8MA 1KR4A 5KFOA 4FYVB 3VHQA 1Z1ZA 1OSDA 4DV5K 3CPWM 3FNNA 1ASWA 3KIOA 1GAOA 3FRZA 4DMZA 2D1CA 2CZ4A 1WBDA 1FKOB 2GX8A 3MR2A 2R4FA 4KHMA 3FLCO 1XERA 1VQSA 2FGCA 5HK4A 1TL3B 5HVHA 1OQ3A 1OYEA 2RKIB 2FZCB 2E1MC 1GMUA 4L6V3 1YF5L 2GGPA 3GIMA 2P8IA 4CZKA 1C1BB 4OVLA 1TGOA 2KXFA 2YWKA 2KB2A 3HI0A 2ZWPA 3SAGA 2CGKA 3P38A 2E7VA 2V8PA 2WVBA 3VF4A 3VQ4A 4CQ1A 3KG4A 2Q3SA 1RBOB 4LFAF 3SUOA 1R7IA 4MKAA 4BY9C 5BXIA 1HWLA 4FPRA 2CQDA 4NYPA 4ZLLA 3I8BA 3L7UA 4UY85 1DARA 2K2PA 2BQ3A 1WOQA 4KI6A 4I69A 3OQ2A 2MKCA 1HQUA 4NI2A 1DQ9A 1R8AA 4DU8A 2ZH1A 1MN9A 3GCWP 3NF9A 5EGYA 4CIOA 4CCHA 4H54A 1KRPA 4ZVHA 1HJRA 6FD1A 2XI2A 1SUQA 2F9JA 2IVNA 3VERA 4QS8A 2YHXA 1SBRA 3AVBA 3WC2A 2JFKA 2XTJP 3FMWA 1B70B 5EXWA 2LEPA 1QVGM 4FZXC 4DZDA 2VQFK 4OLBA 1Q4RA 3KMSA 1WACA 2HHTA 1VQKS 3C2PA 2V5HG 2ASLA 4DUZF 5KRTA 1YRTA 5AR0A 1BQNB 2BTFA 3SQ0A 3MN9A 2QLJB 2JVOA 2XMVA 3AJDA 4P52A 1FXLA 3V1OA 3RR7A 5GMEA 3EZ5A 4FJ8A 1SJQA 1F60B 1GTEA 4AQYK 3TZWA 5C42A 3D0PA 2Z4PA 4DR2J 4W98A 4ISFA 4F50A 4NLSA 3UDCA 1TVRB 2BQUA 3NWRA 1KQGB 2OUGA 1RDAA 1NGHA 2VWJA 1HKAA 3KYLA 2HNDB 1J6ZA 1CPZA 1MMNA 2KKHA 1YHQS 1F9EB 1OJ4A 1B3TA 4HDGA 3NS5A 2OEJA 3DXSX 1F2GA 3ZT1A 3W2VB 1OQ6A 3MM5B 3ELHA 4IDHA 4M3TA 3ZT2A 2YTCA 3PX6A 1F5CA 4L3NA 1U49A 3DDIA 5A76A 4B9LA 3HVWA 3W0LA 5CYQA 2NUBA 1VQ8S 3MEGA 1MNEA 5KOXA 1P90A 1EJ7L 5AQIA 1HJOA 2FBVA 3R6GB 3R2CJ 4GV3A 3CD6N 2CJBA 2QK9A 2VQFJ 1W26A 3BGUA 4YR2A 1J2VA 1RACB 5LSRA 4DV0F 1N88A 2DGOA 2UUBJ 4E7HA 2Z56B 2WONB 4Z7CA 3B6PA 4MLEA 1EQYA 5EOYA 3W2VA 5KFBA 3I87A 1ZPWX 2RVJA 2LXUA 1EHWA 3OTOF 3CQXA 3CFPA 5GAGI 5A0YA 3IM8A 2EC2A 1AFJA 2OTJS 2FF3B 4KHRA 4DR2K 3NEKA 3BF1A 1S6OA 3PVXA 5E0OA 3PUFA 5AQMA 3OJUA 5AT1B 4RWWA 4DUZJ 3ITHB 4DX5A 4YY3K 3TAGA 3W66A 3DXKB 1YLXA 2AT1B 4CM0A 3G6XA 1TV6B 3R8YA 1UVJA 4H4OB 4FCYA 4CH7A 3I96A 2DGQA 1P1TA 1U0HA 1RILA 2DY4A 4BR7A 2FF6A 8AT1B 3GFYA 1RT7A 4FS2A 4DV6K 3QT7A 3L9ZA 5KPRA 3K5OA 3DM2B 3TJAA 1ITGA 2EFVA 3FBFA 2FHJD 3J80O 4JI5K 5FPNA 3T9NA 3DOLA 2UVWA 3HKWA 1N36F 3BQ2A 3CERA 4WQ5C 3BQ1A 4UY8O 2V50A 4XH5A 3POTB 1R0AB 2UUBK 2CJYB 3CXCR 4CEOA 2Y3YA 2IVYA 3PYFA 4RUAA 2CVEA 3JS9A 4X66J 5LJ3Y 1BY9A 1FRXA 3E9PA 1A9NB 4NMLA 2VG6A 1FRLA 3RUBL 4X65K 3GV5B 1FXRA 4JV1A 1ZPVA 4ANCA 2E2NA 3OBIA 2F9TA 1FKPB 1RGVA 1VGYA 1Q8IA 2V2VA 1AROP 5LOQA 1EP4A 4DQQA 1TKXA 3GIIA 2GAGC 6FDRA 1SAZA 2D41A 4DUZK 3H90A 3ZO7A 3VGSA 3L3CA 4DL7A 5C12A 1XC3A 3JTPA 4YY3J 3PDNA 1YJVA 1VMBA 2GEMA 4GC6A 3LDSA 1MMDA 1LXNA 1PO6A 1EX4A 3T5KA 2ZNZA 3FUYA 1LAVA 1YVNA 1BHLA 4Y28C 5F8JA 4JD2A 1CJKA 2G9OA 3GPAA 3QT6A 3FDSA 2HYIB 1HA1A 1ROFA 3UIQA 3O4WA 2MLYA 3WBZA 4DG1A 3O5BA 2F4FA 2J0WA 4YB6A 1M5PC 3M4XA 2IM0A 2IDOA 2YWFA 3L7PA 3OTBA 4XDDA 1YDLA 3VAJA 1Q81T 3R97A 3TRGA 5IWAJ 1QVFR 4JI3F 4ED0A 3KNGA 3VAMA 4MJKA 2G4BA 2NR0A 4FWPA 4EGLA 4CBXA 1S1XB 3G86A 3CJ2A 1VRUA 5ETVA 1FXXA 1LOUA 4OX7A 5D15A 2Z2ZA 4IG0B 1HPZA 2XHCA 4FOIA 1LWEA 1HR0K 2ZBPA 3V1QA 1WC6A 1G3OA 1N5TA 4HI1A 3KKSA 2IS3A 1Y5LB 5DS7A 4O4GB 4MO5A 4RW8B 3HO1A 1GT8A 3CCSS 2I1RA 5HBMB 4FZYA 4DU3A 1Q86T 1HWUA 5IT9U 2RU9A 2JSXA 1A7GE 1FVSA 2NYIA 1TKTA 1TYQB 5A8RA 4WQ4C 3THXA 5DMRA 5HOOA 3TAFA 3CJKA 4A4JA 2P9SB 4JHDA 1HBUA 3PM9A 2XZDB 3D7EO 3QIDA 3V81B 3HK2A 4L76A 1VYAA 4ZP8A 2HVHA 4KY3A 5AXKA 2X1BA 3QYYA 1W9HA 1OYDA 5AJ3K 3EE3A 5GAHU 1KAXA 4B08A 1SH3A 2AWZA 3G8TA 3ILOA 4CBWA 4F3OA 4PRFA 1VBZA 3CJ9A 4USMA 4DV7J 4WKRA 2RUSA 3BS9A 2FQQB 4UOFA 3C7NB 3CCLS 5LMNF 4A8QA 1TUYA 4O3RA 3FQLA 1HR0J 4YHHJ 2NRTA 4B17A 1KAYA 5J1EA 2VJUA 5TKYA 1NLVA 2OD6A 3KOAA 5KFAA 3T69A 5EX3A 3I5AA 4JI2K 1WG1A 4OPAA 4KRWA 3N4PA 3RB4A 5FDLB 4Z4GA 2FJWA 2CXEA 3F56A 3VAFA 1FEEA 5DDOC 3MM9A 2A3ZA 4FLWA 3FEYB 4LF8K 4BRPA 3AAQA 2DNOA 4A8WA 2G2OA 2CJKA 1RAIB 4CHPA 3QETA 5G0RB 4DU4A 3DLGA 4MTPA 1RT6A 3V81A 2RH3A 2OAUA 1RLDA 4EHUA 1WC1A 3L2WA 3PACA 4LFBK 3R9PA 3OTDA 5DZ7A 2GVDA 3GYGA 4CLFA 3MF5A 4B3RF 2DR5A 3PEHA 1SQFA 3KDOA 3B8HA 2HQFA 4WFAQ 1Q53A 3IAYA 2YQ3A 3SK3A 2XY6A 2QMXA 3MR3A 4H0TB 2ASJA 1CZ9A 5KG1A 1X9SA 4KV8A 1RB0A 1Q8LA 2FHJA 3X1LB 4USHA 1GTHA 5KFYA 5GIOA 5ETNA 1BISA 2QN6B 4C98A 5L39A 1D4XA 2BYCA 1FKAF 3TJ8A 4E2FB 4YHHK 2Y1RI 3E2EA 3OYKA 2JLFA 3J81U 1WHXA 6AT1B 5CH7B 3U9DA 1QSYA 5HANA 1K8AT 1S1XA 3LTOA 2KVIA 2D3OR 4E19A 1C1AA 3IAS9 2ASYA 2G13A 5KFMA 1WEYA 2YWEA 4P6QA 1M5KC 3A5OC 2EVZA 1HNVB 5F9NA 3PKYA 3MCPA 4DCHA 4BLGA 2KVQE 5BR8F 4DR7F 2XM3A 2VU5A 1VQ4N 4LF6F 5KFVA 3SFUA 2DRBA 2IFXA 3T6JA 3QNWB 3K2YA 1IBLJ 5LXRA 4FVMA 1WF0A 1IUJA 3OXGA 1A5VA 2WB1D 2IAJB 3IGVA 5FRNA 5JUMA 2Q6BA 3OYNA 4YFUA 3RAXA 3ZX3A 3KG1A 3SFGA 3ZZTA 1WAFA 4DR6K 4ZOSA 3MMBB 2GV9A 3WDOA 4RPFA 1RDDA 1UJ6A 1ZM4A 2J7WA 5EUHA 1VSHA 1TP7A 5KFZA 4Q0BB 5E41A 1W97L 3ZX2A 3KK7A 3OW2M 3FZ2A 4OLPA 3FCVA 5ADXH 2OKQA 4Y2CA 3PW7A 3U1MA 3PW0A 4OX9F 2ZJRQ 1KKHA 3AXMA 5F9LA 3DGPA 3D0GE 2OPSA 3TWHA 2QWLA 4LFAJ 4DL4A 3OHAA 4NYNA 2E1ZA 4CZEA 1V3ZA 2LU1A 2GV1A 1RT5B 5ADZA 2Y1LB 3NOCA 1ZAWA 4FW2A 4BC4A 1KSPA 2UXDK 1S9GA 2CPEA 1FTCA 1BIUA 1HL6A 4NA3A 2IY5B 2Q2RA 5HN0A 1GLAG 2EHGA 2W4CA 3SSRA 2QWNA 5KGWA 2V6AA 1N32K 1YZ7A 4QWEA 4MKYA 2IRUA 5BYQA 2YKNA 1GOAA 4ZDNA 4B3MJ 3CIPA 3HHLD 3D6MB 4LF4F 3K7RA 4A8OA 1RABB 2YPYA 3VESA 4PG4A 1LW0B 4FYYB 4KH0B 4LR9A 2CUYA 2ZE2A 1EZZB 2ETJA 4TYBA 4DR6J 3UPFA 3TU5A 3PYEA 4GKJF 4JI6K 2X1FA 1N8RO 4AD6A 2B4UA 1JL1A 4BC5A 1FDAA 1S5JA 4DV3K 3H5UA 3DMJB 3TA0A 4ECWA 4R5PB 4BGBA 4OYWA 3VGKA 1C2PA 3VQSA 4NL5A 2IJNA 2RIJA 1WN7A 4X4SA 2QV6A 3FSYA 4C0HA 2DEIA 4URQU 4N47A 5THWA 2HVZA 3CCRS 2XGPA 3AY9A 4OZ0A 5SUHA 1RT2A 4J7CA 3QAEA 3HT3A 4DTNA 1IKYA 3AAWB 1UKUA 2O8BA 4LFAK 1V3RA 1EO1A 1N54B 1TFYA 4RG8A 3BGRA 3QMQA 2F96A 5I42A 2AEMA 4CGIA 4O8KA 2PDAA 5CCLA 1DAXA 2QI2A 4ZPTR 1S5ZA 4Q5VA 4BR9A 2EXUA 4WFZA 2WBMA 3TAMB 4DL5A 4ID5A 1V9OA 3R1XA 2A1BA 3KNAA 4MK8A 1N32J 1TL7A 4LF4J 2ZM6F 3ZTOA 1GEHA 1ZA2B 1YZ6A 4KAZA 1N8RT 5T7LA 2E7WA 1T03A 4LF6K 2FVCA 1G6BA 4ECUA 2ZNYA 4HEA9 3UW1A 4I6AA 3NRBA 3ZTPA 5LY3A 1QUVA 3ZNUA 1QAIA 1ZS6A 4I2PA 1BE4A 1UWBB 1JKHA 4K41A 3W3DA 4NASA 4CJFA 4X64F 1JXLA 3BV8A 2XQCA 3HL8A 1JJ4A 2JRSA 1CSJA 3D2WA 4K4UA 2X78A 4ZLNA 2MQPA 3IR7B 2AYBA 2RS2A 5J2QB 5F8HA 4KAIA 3RSEB 1EAYC 2H48B 2IJFA 4OZ5A 2RRBA 3W62A 5KQ8A 3W5YA 2KH9A 4C4WA 3TR8A 5J2MB 4OYBA 1S6UA 2IVOA 4O5FA 3NXZA 3MD1A 2OGUA 5C2DA 2RB7A 4PWDA 1HWKA 2CPHA 1NB7A 2JEJA 4CEDA 1OO0B 2LQBA 1RISA 1RJJA 1IXKA 4OGCA 4GO5X 1F3VA 4D3GA 4FXVA 4XDCA 1GXTA 4RKUC 2LDYA 4LY7A 3J80Y 1BWVA 5ETSA 1Q7LB 2HIQA 4QJVA 1TL7B 4WTOB 3P5JA 3SV4A 3WX8A 2W01A 4M3ZA 1UVMA 3M8SA 2GVZA 4CZLA 4FJNA 4L75A 2APOA 3HF5A 1RHKB 2J6TA 3T1YJ 3T1HK 4IYQA 1T6DA 3QGIA 1BIZA 4OZ1A 2IC3B 1NKEA 1C0UA 3A5MC 3M3ZA 3O4NA 2HWIA 4LF6J 3QB0A 4YOYA 3QWPA 5KT6A 2K3KA 3OL7A 2PYLA 4ZPCA 4ZS6A 3RG6A 4JRPA 2Y8YA 4FWSA 1D09B 1RAFB 3G71S 3DOLB 4XH1A 3EGNA 1G4CA 1Q82O 5AQNA 3BO3A 3GILA 5L1KA 4PWDB 2WB4A 2FDNA 3L2QA 3K8WA 2E9ZA 4BRCA 3THWA 2PMWA 3KK3A 2OJ3A 3SJHA 3GQCA 4IR1A 4Z7YA 3OYLA 2CGLA 3GIKA 2O8EA 4C1NI 3GOIA 4JI0K 3CWJA 5K8NA 2P9UA 3QEIA 3SBGA 4OZLA 5F0WA 5IT9O 2PA3A 2V4QA 2FIUA 2W9CB 1JLEB 3IMXA 4EYIB 1OVQA 5CXTA 5L38A 4CZMA 4UQGA 1T9YA 3ZC4A 1D3WA 2MKIA 2IVFB 1WORA 1RDCA 1IBKF 1X4EA 4F3QA 2Y1JA 1LV5A 1VSJA 2HBRB 2PMZD 2HQIA 3BQ0A 2B6AA 1ZETA 2BM0A 2P9IA 2RU3A 2E5LF 4LMZA 5F41A 2KG0A 2KHOA 1ZZFA 2B9YA 1FWKA 5D0EA 4FPAA 3CDUA 2HQ3A 3OV7A 3OS1A 2VASA 4KQZA 4C3MA 4DKWA 1DTTA 3J7ZO 3IRWP 2Y9HA 3KLIB 1NU4A 2U1AA 2RDJA 4DTUA 3HLUA 4LRFA 2P9PA 3RBXA 3TNVA 5JVHQ 2HK2A 3SBTA 1Z2LA 5H1SV 1JJ2M 4FWLA 2YNGB 1Q79A 4YOUA 4RW7B 2HHUA 1IKVB 4CEEA 2L3MA 1QHTA 3H3OB 4PAAA 3U9ZA 1HIYA 4A62A 3QGGA 4K4XA 3CJ0A 5I3PA 1UVLA 4FW1A 4TU7A 5KG5A 1NGDA 1C1BA 1FFGB 3D2FA 4JV0A 3UCUP 3U8XA 2HHVA 4YN3B 4JI0J 1KAZA 3NH2A 5I3UA 1U4BA 4JI6F 1TK8A 3HDSA 3ULDA 1WEXA 1FRMA 5FLXU 2WAQD 4DR2F 3WX4A 4OLAA 4U96A 1N48A 1YJUA 3Q8UA 1Z25A 4KKOB 2CA9A 1Z6RA 1JCEA 1TKZA 2CPIA 2GBZA 4B8CA 1UW9A