3JSMA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
total genus 144
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jsmA05
4FM1A 3HP9A 3PJWA 1KFDA 3M8QA 4KB0A 2W7PA 2VG5B 1S6PB 4CK3A 3OHBA 5DLGA 1QSYA 1Y97A 1JLCB 4IH6A 2W42A 3GQCA 4FJGA 2ZD1A 4Z4IA 4M3RA 4Z4EA 1DTQA 4ZPAA 3KIOA 1T05A 3DYAB 4CJFA 3RMBA 1HQUA 1WAFA 2IJFA 2F96A 1S1VB 4CEBA 3LZJA 3THVA 4CJKA 4DQRA 3K5MA 3AVGA 4M3XA 3QNNA 4UQGA 3EZ5A 2BR0A 3HVRA 3H5YA 3QYYA 1W25A 3PR4A 4CGGA 4IRDA 4EP5A 1DTTA 2NUBA 2R8GA 4ID1A 4DSIA 3IRXA 4Y1CA 3OYKA 3MEDA 4H54A 5KFBA 1XR6A 4AHCA 4DL3A 2HHWA 4O5BA 1TGOA 1VSFA 1RAJA 3O4QA 3ISND 4OKEA 4CF0A 1T94A 4QW8A 4E89A 2C28A 4OGEA 1YVFA 3BQ0A 4RNFA 3CDWA 3BSOA 1VSLA 4RZRA 2XY8A 4M3WA 3CFRA 4R5PA 1NHUA 4ID5A 5DQHA 4LH4A 3L2QA 4EBEA 4K4TA 1SH0A 3TAMA 4ZPBA 4CJLA 2G8IA 4DQIA 1RTJB 2QE5A 4DFMA 2IM0A 3GV7B 2AX0A 4NLSA 4QWEA 4OVLA 4KSEB 4O3QA 1FKPB 1EP4B 4Z4GA 1LWCA 3JSMA 1D9FA 2FBTA 4DU3A 4RNHA 4O0IA 2DFFA 3KNAA 4EP4A 3OS0A 3FDSA 3TWHA 3KLGB 5HRSA 1WN7A 3V6DB 1J9AA 1C1BB 3VQ9A 1YT3A 5HLFA 1SH3A 1BQNB 4CJ3A 2EC0A 4E19A 3I0RA 3AVMA 4IG3B 3I5CA 1RT3A 1KLMA 3VQPA 1Z4UA 4E1NA 2ILZA 1S48A 4IKAA 1TKXB 3CJ3A 4OPJA 1Z25A 1QSSA 3H5UA 2IOCA 2G8WA 4BDYA 5KFEA 5KT5A 3IN5A 3FSIA 5KG2A 3HPGA 3OYJA 4DQSA 2RKIA 3KLHA 4Y2CA 2FC0A 4O44A 1I6JA 3NDKA 4KHSA 2FJWA 3P83D 1LW2A 2JEIA 1ZTWA 1VSEA 2YKNA 1NNDA 3DOKA 1HYZA 1NKEA 3RRGA 4KTQA 4QAGA 4DTXA 1B92A 2HVHA 3OYFA 4Y1DA 3QLHA 3RMDA 1HPZA 4FBUA 3OYMA 3ULDA 4KHMA 1S1UA 2FJVA 1IKXA 3V6HA 2DPJA 1MMLA 3AVLA 3MEGA 3CYMA 4B9NA 2ZQBA 3AO1A 4E7HA 3PO4A 4CHNA 4ECSA 3QZ7A 4E7IA 2W8LA 3MECB 2DFHA 4XIUA 3AVBA 3OYAA 4FS2A 4MFBA 3MEEB 1SKRA 4KHUA 3SFUA 1S1TA 3JYTB 3OYEA 1CZ9A 3PW2A 5HRNA 4DTUA 4FJNA 3KK2B 2JGUA 4EZ9A 4JUZA 4DL7A 2E6LA 4Z4FA 2J6TA 1JLEB 4YP3A 4E7JA 3I0SB 1KSPA 2W9BB 3DRRB 1ASVA 2VG7B 4KE5A 1IKVA 3I5AA 3PZPA 3B6OA 4OL8A 3BQ2A 1HQEA 3I0SA 1KHVA 3MR2A 1LV5A 3PW7A 3DI6B 2VG6A 3V81B 4KHQA 4KTZA 4ZVHA 4E7KA 4F2SA 4IQXA 2YKMA 4K4SA 1IKWB 5CYMA 3NGIA 1RTDA 2CJQA 2YNGA 4NLVA 3MEGB 1KTQA 3WNGA 4LQ9A 2D3ZA 4CEOA 1N48A 4CJ4A 4BE0A 3NAEA 1RT1A 5KGXA 1RTIA 2I5JB 5EU7A 1QE1A 3AVNA 1S49A 4KB7A 4HTUA 4ELUA 3CWJA 4RW6A 5C25A 3DLKA 1Z26A 4PUOB 2PY5A 1TKDA 4GC7A 4RG8A 5KFJA 1JIHA 3OYGA 4KHNA 4N41A 4IFYA 2E9TA 2GUIA 4RW6B 2OPRB 1SL0A 4MQ3A 1C0TB 3CG7A 3IGVA 1REVA 4KB1A 3N6MA 4B9LA 2FBVA 3KLIA 3T5HA 2HNYA 3DLHA 1JLCA 3RBEA 4GC6A 3WNFA 4CJUA 1SKSA 5J2PA 3RAQA 5SZTA 3GIIA 1U47A 4IRCA 5J1EB 4DTJA 3PW0A 2R2RA 3VQDA 3QETA 4FJXA 3VQEA 4TXSA 4I7FA 1C1CB 4H4MA 1EKEA 3E51A 2YHAA 3N6NA 1VK0A 2D41A 3MR6A 5KI6A 5CY4A 2AQ4A 1L3UA 4B3OA 1N5YB 1WNSA 4NYZA 5CZ1A 1FKOA 2VA3A 3C94A 2JC1A 4ZPDA 3N6LA 3H59A 3RRHA 4FJLA 3FFIB 1CSJA 1C1AA 1S9GA 3V9UA 4BE1A 3U3GA 3SV4A 3AVAA 5J2QB 4DSKA 1FKOB 4K4WA 4NCBA 4DU4A 4KKOB 3QIPA 2XCAA 4JS5A 4RW9B 1VSIA 1UWBA 1RBSA 3PX0A 2WOMB 3Q8QB 3BDPA 1SL1A 1L3SA 2IS3A 5L1IA 3NFAA 4B08A 4DLGA 3BSCA 3MFHA 4O4GB 4FJJA 4ED0A 3ZCMA 3AVHA 3NH2A 4R5PB 3RMAA 3ZT4A 1CZBA 4YR3A 4TQRA 3ISNC 3UQSA 3MTKA 3IG1B 4TSXA 3NF8A 3RB0A 3P1GA 4J2AA 3AO4A 2IJNA 4DTSA 1ZTTA 4ED7A 4ECWA 4PQUB 3ZT3A 5KFHA 1KVCA 4AHVA 2AJQA 1BCOA 2ALZA 3QERA 1HARA 2HHXA 1S1XB 2W9CA 1C0MA 5KT2A 3ZT2A 2BRLA 4CJRA 4ECRA 1JL1A 3QEPA 1K1QA 4FLTA 4URGA 3RTVA 2FLLA 1JLQA 1NHVA 1IM4A 4CGFA 5FDLB 3VQSA 3L8BA 1IO2A 4DL5A 3HP6A 3SPYA 1EETA 4IG0A 1JLAB 5KRSA 3HYFA 4O3RA 4ID5B 5KFVA 5CZ2A 4F2RA 3QGHA 2P5GA 1QE1B 1HYVA 2RDIA 3VQ5A 2VWJA 5CYQB 4K4ZA 3IG1A 3ITHA 1GX5A 1VSKA 4KFBB 1BI4A 4ED1A 4ECVA 4M3YA 2FVCA 3FRZA 3S3NA 3LPUA 2Y1IA 4CE9A 2XHBA 3KHRA 4KFBA 4NYFA 4M45A 3ZSYA 1RT2A 2F8EX 5JS2A 5J2MA 4E0DA 3D5MA 3KLEB 3T1AA 5KFWA 1IKYA 2XI2A 2D5RA 1GOAA 3HPHA 3OJSA 1NK0A 3VA3A 4FLYA 2DFEA 3V4IB 4RW4B 2XY5A 1NJXA 1KVAA 2HMIB 2KFZA 5F8JA 1IH7A 3I0RB 1TKZA 4E7LA 2FVPA 3ZT0A 2XCPA 3GILA 4Z4HA 4IR9A 2DY4A 2KFNA 1QUVA 4CEAA 1TAQA 4OLAA 1JLEA 1S1XA 2W9CB 2E4LA 2IC3B 4I9LA 4MFBB 3HVWA 4G1QB 5KFNA 4FLVA 4DSFA 3KOAA 2E6MA 1S1UB 3QO9A 3KK1B 1RA6A 2Q3SA 3SI6A 3NBPA 1TV6B 4ICLB 4NRTA 3GIKA 1LW0B 4CF8A 3QLHB 4WXOA 2P1JA 4TYAA 3TAGA 1X9MA 2OPSA 2B5JB 4NCGA 4J9QA 4BACA 3T5KA 3TQ1A 4U6PA 2XGPA 3DRSA 4Q5VA 2O5DA 4K4XA 1NOZA 1S0MA 2E9RX 1D1UA 4HUFA 2XC9A 5T7BA 3WNHA 1U48A 1W0HA 4DTPA 4ECTA 3BSNA 4M3TA 1EETB 4IG0B 1RYRA 3AO2A 4DFKA 4O4GA 1A5XA 2KZMA 3V1RA 3K5NA 2YKMB 2ASDA 3CQ8A 2BQRA 1VRTA 3HSTB 2UVRA 4NLXA 3S9HA 2HNDB 4TN2A 2A1SA 1B9FA 4J2BA 3KD1E 2YNIB 5HP1A 1HQEB 4ZHRA 1SV5A 1WNEA 4OGCA 4KAIA 4E1MA 3L2WA 5KGWA 1RT4B 3VQ6A 2C2EA 4H4OB 1WSGA 1SV5B 2XGQA 4ELVA 4KPYA 3OL7A 5KFZA 3K5LA 1T05B 1WSFA 3IRXB 4N76A 4I2PB 4IKFA 4RNNA 1QSLA 4J2EA 3G10A 2OH2A 3VQCA 3SQ0A 4ED8A 3PO5A 3NKYA 1NJWA 4K4UA 4FJ7A 5HBMB 1RBVA 5C24A 5KT4A 4NLQA 4KRFA 1TKXA 3C95A 2JC0A 3TAMB 4AHUA 4F3TA 1N5YA 1X1PA 1LWFB 3NF7A 2B4JA 3DLGA 3IGNA 2X6SA 3RWUA 2J6SA 2OPQA 1ASWA 3DMJA 2GIRA 3QGIA 4NYNA 4DSLA 4Q0BA 1HMVB 3U6FA 2ZE2B 4YR2A 4IOBA 4CF9A 3AVFA 3ZSRA 1RT5B 3K58A 4O44B 1CXQA 3OYDA 1S4FA 4O4RA 2FBXA 3DRSB 1N4LA 4CHOA 5DQGA 1QS4A 3NH1A 3O3GA 3LP2A 4L8RB 1DLOB 5KFFA 1RT4A 3SYZA 5EDWA 3VN5A 2IM1A 4FZYA 2HHQA 4H4OA 3OJUA 4J9SA 4Z0UA 2R8HA 4IG3A 4ED6A 3NBPB 5L1LA 1R0AB 4CGJA 2YNHA 4ECYA 3V9SA 3ZT1A 4JRQA 4W5RA 2HNDA 1N6QB 3LZIA 1C0UB 3OYNA 4KAZA 4B8AB 2UVWA 3AO3A 5DGAA 3EPGA 1JX4A 4CIFA 5KFRA 3KMSA 4B8CA 3OL9A 1JLQB 1CLQA 4BE2A 1BGXT 1T7PA 4DF4A 3JSMB 2BRKA 3PHEA 4CJQA 1RTJA 4FLXA 1SH2A 1SUQB 5KG5A 2ASLA 3WNEA 5KFCA 3M9NB 1VRUA 4IFVB 5F9NA 4CHQA 4J2DA 1J5OB 3Q8PB 3TAFA 2JEGA 3QO9B 4MIAA 3VQBA 3GIMA 4FVMA 1FK9B 1GOBA 5KG1A 1HMVA 1HNVA 2WTFA 1GX6A 2E9ZA 1BL3A 4QCLA 3RB6A 4JRPA 4B9VA 1BISA 3ITHB 1HYSB 4J9RA 2W7OA 4ZP9A 5HLFB 4TY8A 3I8DA 1RT1B 2WONA 1TK8A 3V6DA 4PY5A 3G6XA 1XR5A 3AV9A 3DLGB 4WFYA 4LSNA 1ZBFA 1RILA 4FYDA 4E3SA 4QWDA 3NGZA 3M8QB 2BQ3A 3I5BA 3S3MA 1S6PA 4EEYA 3SV3A 2IC3A 3AVKA 4F4XA 4ECZA 5KFDA 2BE2A 1TL3B 5KG7A 4KREA 3DRPB 2HNYB 4RW9A 5KFLA 2Z1JA 1L3VA 3B6PA 1B9DA 4CFCA 3MEEA 3QNOA 1RT6B 3SJJA 5E41A 3CDEA 4NCAA 2XI3A 4EBCA 3PV8A 1JXEA 2IM3A 4LSLB 3C6UA 1N56A 4C8LA 4DL2A 3QEIA 4G1QA 4CGHA 3OYLA 4WZMA 3L2VA 1LW0A 5KFUA 3AA2A 3BR9A 3KLGA 4FCYA 1U4BA 5F9LA 4KHYA 3SQ1A 1BQMA 3HPOA 1S0OA 1HJRA 1XHXA 5F8LA 2V9WA 4CECA 2R2SA 4O3OA 1HNVB 4NLRA 1RT5A 1SKWA 3QINA 4CJEA 5CYMB 4TLRA 4F50A 5L9XA 2V0NA 1NK9A 2G8FA 3OY9A 4ZVEA 1TL3A 3HM9A 3C6TB 3U3YA 1RDCA 3PY8A 4DFJA 1XC9A 4CESA 2DTUA 4NLOA 2D3UA 3OYBA 4EYIB 4O0JA 4NLWA 3DMJB 3AVIA 4B9SA 3DLEB 5KT7A 4FJ5A 4PUOA 2UUWA 4C8NA 1Q9YA 4WFXA 3VQAA 3KKSA 2WB4A 3OSPA 3RBDA 4CGDA 2HHTA 3AO5A 4K50A 1QHTA 4DQPA 5KFPA 2OPPB 4QWBA 4PQUA 4Q45A 4CJ5A 4JS4A 3ZSXA 2R2UA 1IG9A 2YNGB 1K1SA 2OPQB 4ZMMA 3UPFA 4EO6A 4NLUA 2YV0X 3NCIA 4FJKA 1SUQA 1RBTA 3D0PA 1O1WA 2WCXA 4M3UA 1T3NA 3PR5B 3SNNA 4CGIA 4IFYB 4FK4A 2VG5A 2VG6B 4DG1B 1TK0A 3CIZA 2IDOA 2XWYA 5KFOA 1NK4A 4CFDA 2GIQA 3C6TA 5I42A 3V1QA 1F21A 2FLPA 3LP0A 2VA2A 2HHUA 4O55A 2BE2B 1N6QA 3VQQA 1S1TB 3HK2A 2GV9A 4DLEA 4URSA 4AILC 3SUOA 4EYHB 1VRTB 1EP4A 1C0TA 3HT3A 2JEFA 4HHTA 4NRUA 5KFQA 1RBUA 1RDDA 3KLFB 1WLJA 5D3GA 3OLBA 4C8MA 1BQMB 5J2PB 1MU2B 5C25B 1HQUB 2W9AA 1VSMA 1NK6A 3MEDB 5I3UA 3V81A 4LY7A 4IRKA 1NKBA 2AGOA 2WK4A 4K8ZA 4QWCA 4QW9A 4H4MB 5I3UB 2YHBA 1LWFA 3SPZA 3PW4A 1RDAA 4RW4A 4DG1A 2HMIA 4ED3A 2JLEA 3E01B 5HRRA 4CF1A 3TI0A 3LP2B 2FBYA 1KVBA 1NJZA 1YTAA 3T19A 4FZXC 4Q8EA 3ASMA 2GBZA 3DI6A 2RKIB 3KLHB 3PW5A 4CJTA 5F8MA 3NF6A 2IMWP 3CDUA 4B9TA 3HHKA 1ZYQA 2ITGA 3DRRA 3ZSWA 1TP7A 2G8VA 3BREA 4CK2A 4NLDA 2PYLA 2F8SA 1RDBA 1TV6A 4Q0BB 4BWJA 3NGYA 3K59A 2IGIA 4CHZA 3MR3A 4KTWA 1ZBIA 2I1RA 3OVNA 3MXMA 1U45A 3NH0A 2HWIA 1T03B 3SI8A 3S3OA 3BQ1A 2ATLA 3NF9A 2B6AB 5L1JA 2QKBA 1JLAA 2I5JA 5KG0A 3D45A 3V9WA 4DSJA 1WSEA 4DS4A 2BANA 2VWKA 4CCHA 4QPXA 3LAKA 5J2NB 4R8UB 4K8XA 4URQU 4IFVA 2RN2A 1S9FA 4RU9A 1NK8A 3SFGA 3TAPA 3E01A 3M8PB 1TAUA 2G8UA 4OLBA 1TKTB 4PWDA 5DK5A 1EXQA 3TARA 4K4YA 4TYBA 4W5NA 3M8PA 4YQWA 3V6KA 3TVKA 2AU0A 3OL8A 1JXBA 1EX4A 3Q8SB 1WSIA 3CJ0A 4F4YA 1ZBUA 1BIZA 5HRPA 2HNZA 1U04A 4BDPA 1KFSA 4DMNA 3AVCA 3ZSZA 2QXFA 1XR7A 4ZHRB 1RCHA 3CO9A 4TY8B 5C5JA 4H8KA 1D8YA 2V4QA 5DQIA 3DOKB 3DLRA 1BI4B 2J6UA 4LH5A 3EYZA 1KLNA 5FDLA 2UVVA 2BGGA 3LWMA 3SQ2A 4M95A 3MF5A 2Z1GA 2XY7A 2OPPA 3M8SA 4KKOA 4CIGA 5DG7A 3OSNA 4YFUA 2P51A 1S5JA 4KO0A 3FFIA 1QQCA 4MK8A 3NAIA 4QOZB 4WFZA 4HYKA 3O4NA 4EO8A 3RMCA 4EBDA 1LAVA 2ZKUA 4OKKA 2KW4A 3FQKA 5C42B 1LAWA 4YR0A 5DLFA 4WZQA 3DLKB 4JV0A 4B9MA 2FVQA 3T3FA 4AHTA 3G6YA 4N56A 1YTUA 1DTQB 5C24B 5K14A 4KI4A 2R7YA 3H2LA 1KRPA 2HVIA 4ZP6A 4FW2A 3TR8A 4CHPA 1S6QA 3DDKA 3KD5E 4MKBA 4GMJB 1J5OA 1TQLA 1TL1B 1IKWA 3TANA 4CK1A 4F4WA 3F9KA 3PVXA 4ZP7A 3BGRA 4FK2A 2HHVA 4ECQA 1FKPA 1QTMA 3M9MB 4AHSA 1S1WB 2ATQA 4DQQA 5KT3A 4F8RA 3LP1B 3KLEA 3CFPA 1WSHA 2D0BA 2BDPA 4ELTA 4EZ6A 2UVUA 4NZ0A 4FXDA 2Z1IA 1JL2A 2JEJA 1LW2B 3T5JA 4WYLA 4CJPA 1JKHA 4CEZA 1BQNA 1NK7A 2C2DA 3HO1A 3NHGA 4FJMA 1JLFA 1ZBHA 2UUTA 5K14B 3DRPA 3SZ2A 2B43A 3UDLA 4WE1A 1I39A 3LPTA 1IKXB 3KLIB 3DOLA 2RDJA 5FRMA 1JLFB 1KHWA 2D7SA 4ZTFA 4W5TA 5KTQA 1ZETA 2YNFB 4FLWA 1J53A 2EX3A 3K5OA 2XY6A 4XO0A 2KTQA 3OLAA 3GV8B 3LANA 4CJVA 3PX6A 3NL0A 1RYSA 4FBTA 3TAEA 3AA4A 5JXSA 3O3HA 2YNIA 5HP1B 1S1WA 2R2TA 2YKNB 1U49A 1RNHA 3LP1A 3UR0A 2R8IA 1A5WA 2KZZA 4CEEA 1X9SA 1JLBA 4RW8A 3T5LA 1VSHA 2D0CA 1W9HA 4Y3CA 1ASUA 3ALYA 4Y34A 4ZPCA 4CF2A 3QZ8A 1VSJA 3QIDA 3CJ5A 4CFBA 4XPEA 2AX1A 2GC8A 4NLPA 5F8IA 3HXMA 4DF8A 4LSNB 4N5SA 4C8OA 1I3AA 3A2FA 5KG6A 3EPIA 2FVSA 4I2QB 3CFOA 1XI1A 3LDSA 3MECA 2FLNA 3GV5B 1NK5A 2IAJB 3HL8A 4X2BA 3MXIA 3DYAA 4CFAA 2WONB 5T14A 1G15A 3BJYA 2X78A 5KFGA 5KFYA 5KFKA 4O3PA 2OZSA 5KFTA 4I9QA 4RW7A 1OS5A 4IH5A 3LP0B 2DPIA 3SUNA 4I2PA 1K6YA 5DG9A 3QEWA 4TY9A 2YNFA 4FS1A 4LSLA 3KJVB 4M42A 4HKQA 2WHOA 3SUQA 4DEZA 4JV1A 4Y2AA 3BGRB 4NLYA 3L3VA 2PZSA 4FLZA 2G8HA 3VQ4A 1S9EB 2OA8A 3KKRA 2O4IA 3SQ4A 5KFXA 4BWMA 1T03A 4ZTJA 2IBKA 4PA1A 3H4DA 3MXJA 5SWMA 1SL2A 2YNHB 1TKTA 3RR8A 5I42B 1ITGA 5C42A 1QAIA 3JYTA 4ED2A 4WXWA 3KHLA 2PYJA 4F3OA 2HB5A 4RUCA 3H5XA 1UAXA 1TKZB 4RW7B 2HNZB 5F8HA 4HCBA 4J9OA 2WOMA 3G86A 1IKVB 3Q8RB 4ECUA 2Z1HA 4IBNA 3G0ZA 4FM0A 4GW6A 1LWCB 2AWZA 2ASJA 3KK1A 3D28A 4C8KA 1Q8IA 3OHAA 5J2NA 1L3TA 1ZBLA 2C22A 2OYQA 4FLUA 4DFPA 3EZUA 4FJIA 4M41A 1DTTB 3GIJA 4MK9A 1D0EA 1D9DA 1XWLA 1RT2B 3OL6A 4RNMA 5FROA 4HUGA 4IR1A 5JS1A 1UOCA 1HRHA 4CEFA 4J9MA 1C1CA 4M3ZA 3L2RA 2IAJA 1HYSA 4DU1A 3LAMA 4LQ3A 3RB3A 4W5OA 5DMRA 4KI6A 4I2QA 2AGPA 4HCCA 1UWBB 4YNQA 5HBMA 1A5VA 1NOYA 4PWDB 4CIEA 1JKHB 5JUMA 1VRUB 2ETJA 2IA6A 3TAQA 3DM2A 4KV8A 1RA7A 3MR5A 4JV2A 4CJSA 3V4IA 3GYNA 3QGGA 2V4RA 5HROA 5KG3A 1VSDA 3DM2B 4KV8B 3KHHA 1CXUA 3DOLB 1TVRA 4DTOA 4FJHA 3KLFA 1C2PA 1C0UA 4B3OB 4FZZA 4CEQA 2B6AA 3LP3A 2X74A 1LWEA 5KG4A 2R8JA 3L2UA 3UIQA 3CVKA 3HVTA 5KFAA 4QWAA 2ILYA 2IM2A 3IS9A 3K57A 4MKAA 1JXLA 3RR7A 3AA3A 4HUEA 1KCFA 4KO0B 3KLVA 2RPIA 2XRIA 3NAHA 1NKCA 3OYIA 5J1EA 3ZSOA 4J9PA 3K2PA 2QK9A 4IH7A 1DLOA 4O3NA 1JLGB 4CEDA 4F4KA 1BIUA 3M9OB 2D0AA 5FRNA 4NLGA 4ZVGA 2EHGA 1REVB 5KFIA 1TK5A 1RT3B 2RF2A 4TQSA 5J2QA 3KMQA 4F4ZA 5EWGA 3V9ZA 2HW3A 1JLGA 1RTHB 2OPSB 4XPCA 3ZSVA 3QIPB 1D5AA 1TL1A 4HVJA 1RT7B 2X6NA 1TVRB 4Q44A 2OPRA 2G8KA 4YMEA 4DL6A 2ZE2A 3H98A 3AVJA 2ZD1B 3LWLA 1NJYA 4KHRA 4J9NA 3HVTB 4DTMA 4B9UA 3HKWA 4Q43A 4W5QA 4MH8A 4NLTA 1S97A 3EY1A 4Q8FA 4DWIA 3ZSQA 3HJFA 4DSEA 2LSNA 4AH9A 3VA0A 4O3SA 3H4BA 2C2RA 3RB4A 3CM5A 1KLMB 1RTDB 5F8NA 4LD0A 3PX4A 2HAIA 2FJXA 3L3UA 4DTNA 3DLBA 2RF2B 3O3FA 2OZMA 2AGQA 3SUPA 5F8GA 3NGDA 1RBRA 5EUHA 1S9GB 2A1RA 3DLEA 3H40A 4IDKA 1UA1A 3MFIA 3RAXA 1RDRA 2R8KA 2W9BA 2KQ2A 4KBIA 2WRMA 1RT7A 3QESA 4FJ8A 2BQUA 1BCMA 4OJRA 3CJ2A 5J2MB 3V9XA 5HROB 4OPKA 3PJXA 3QIOA 3KK3B 2W8KA 4WE1B 3IS9B 5DG8A 3H5SA 4K4VA 3VQ8A 4Z4CA 2BANB 5KFSA 1MU2A 1C6VA 3V1OA 3M8RA 1L5UA 3OS2A 1Q9XA 3OYCA 4KHWA 1HNIA 5EWFA 1X9WA 4ECXA 1S0NA 1HPZB 4G3IA 3C6UB 3PUFA 3NE6A 3KHGA 2HWHA 1UA0A 3HVAA 2FVRA 3KTQA 1FK9A 3H08A 5EWEA 3FQLA 1U09A 3OYHA 4I7FB 1J54A 3AA5X 4WYWA 3IAYA 4RUAA 1LWEB 3TABA 3ICLA 4IDKB 3QEXA 1R0AA 1QAJA 5KRTA 3NMAA 2B5JA 4NCGB 1IKYB 2VG7A 1S1VA 1RTHA 4DTRA 4FK0A 5D3GB 4M94A 4DS5A 4J9KA 4ZP8A 2CKWA 3KJVA 4MK7A 4R0EA 3OS1A 3P5JA 1RTIB 4CHYA 2QKKA 4CJWA 3KK3A 1YVUA 4FW1A 1S6QB 4DL4A 2Y1JA 4FJ9A 1XHZA 4J9LA 1C1BA 1T8EA 3LALA 2F8TA 2HHSA 1FXXA 1WSJA 1S10A 1HNIB 4AHRA 5CYQA 3CM6A 4CERA 3QEVA 1JLBB 4RW8B 4FM2A 3V6JA 2P5OA 1BHLA 3CJ4A 1RT6A 4RNOA 1GOCA 4U7CA 4MIBA 4R8UA 3MAQA 5KT6A 3BSAA 1WAJA 4N47A 3F73A 3VQ7A 2XO7A 4BDZA 5DGBA 4JLHA 1S9EA 4ZVFA 2O4GA 5L1KA 5KFMA 4OKJA 4ICLA 2QV6A 4GVMA 3SCXA 3G6VA 3KK2A
chains in the Genus database with same CATH superfamily
1RE1B 3CD6S 3PJWA 3PKMA 3M8QA 2D3O1 4H0YB 3VENA 2CG8A 1CG2A 4X64K 4C1NK 2B4PA 2W7PA 2VIHA 1RBLA 3UVJA 2GX8A 2HFVA 3OVBA 4HVZA 4FJGA 1NSKL 5AE1A 1T05A 1KONA 4F9OA 1EX8A 2IJFA 2F96A 3CMQA 4NXNK 3NGKA 4NL5A 4B9QA 4CJKA 4BR7A 4ES3A 1F9HA 1CVJA 4M3XA 3HD1A 3W3DA 3QYYA 4ZA1A 4KPCA 5M1NA 1SQKA 4CGGA 4IRDA 4JP8A 2ZVSA 3SEOA 2R8GA 2VDHA 3F56A 4PZVA 2JWNA 4PPDA 1SBRA 3OYKA 3MEDA 5IT0A 1XR6A 1SVDA 1SC4B 1TGOA 5AXKA 1W2BR 1VSFA 3O4QA 2I7NA 4OKEA 2Z58B 4RZRA 1IJEB 2F63A 3QSIA 1WTBA 1U8WA 4LH4A 5JICA 3L2QA 3EE3A 3SBGA 5GAGP 3P49B 3PG9A 1G1XA 4C11A 2YX6A 4ZLNA 1V3ZA 1RTJB 2IM0A 3GV7B 3W64A 2AX0A 1RAIB 1RGVA 1FKPB 4QBUA 3DC2A 2CADA 2KO1A 1VQLN 1VLYA 4DU3A 4O0IA 2CPDA 5AJ3J 2XWXA 1F0XA 3OS0A 3FDSA 3HRGA 3TWHA 4BRKA 3SQGB 1VQKS 5HRSA 1U6BA 1WN7A 1J9AA 1PO6A 3JS6A 1YLXA 3VQ9A 1Y7PA 3VAKA 4B3TF 5LMNF 3AVMA 4IG3B 1WHYA 1U2VB 4LVOP 2P9LA 5D4OA 2IOCA 1FDBA 5KT5A 1UAWA 5KG2A 2NLXA 2GVDA 3KLHA 4O44A 5AXNA 4DR4J 2H3EB 4IWVA 3D6HB 2DISA 2DD8S 4BC9A 1LW2A 2JEIA 2FXUA 2YKNA 4X65F 1NNDA 3J7ZT 3U1MA 3R6LB 3ILIA 5D8HB 1HBMB 1T9VA 4DTXA 2HVHA 5ETKA 4Y1DA 3IC1A 1HPZA 1GLCG 3GG0A 4OV1A 4KHPK 4FBUA 1NSQA 3ULDA 4KHMA 1VLOA 1FW6A 1IKXA 2Y1LB 1MMLA 3MEGA 3CYMA 5AQXA 3ZFVA 1T02A 2ZQBA 3PO4A 2H51B 5JMNA 2O8DB 3MCMA 3QZ7A 2MGZA 3KUEA 3SMSA 4IXCA 5FLXO 1I94J 1B0PA 4EWTA 2J0XA 2H4YB 3ZZRA 3HSZA 3CQYA 1OIAA 3CJ8A 3HM8A 4KHUA 4P71A 1S1TA 2J5AA 4CLFA 3PW2A 2K7KA 1SJRA 2OELA 3WUHA 4WF9L 3HSGA 4OQJA 5MLCQ 4Z4FA 2RQMA 4FZVA 4KE5A 3D1HA 3BQ2A 3ADAC 5GADP 4QOTA 2BUPA 3DXMB 4ZVHA 3M1VA 4B1UB 2ZC4A 3JSYA 3DXSX 1PG5B 3CF5Q 4PKDB 4HLBA 4H0OA 1KTQA 1KAZA 1B99A 4DPTA 4CEOA 4CJ4A 1A9NB 2AT1B 3HF5A 1AW0A 1OH5A 2HFOA 1X60A 2YJEA 3KDOA 4KB7A 4ELUA 4HTUA 2J9EA 3T6BA 1VQKN 5E33A 1VIXA 3RSEA 5KFJA 1JIHA 1XNQK 2OPRB 3QPIA 1SL0A 1C0TB 4P75A 1REVA 1IR0A 4USWA 2VCPA 1S6OA 1FJGK 2GVZA 1CQMA 1HA1A 3KLIA 4X4VA 5J2PA 5HVHA 5IWAK 1N32J 2NZ4A 3UDEA 1OVQA 4IRCA 1YZ7A 1BMQB 2PI4A 4CO4A 4Y28C 1HNZK 5LY3A 1HHSA 3CCMS 3QETA 3OTEA 1C1CB 1PKUA 1X4HA 4H4MA 3ZZZA 5HMYA 2ZHBA 2AA4A 2YHAA 3F41A 3N6NA 4NXNF 2QA4S 2FZGB 4CD1A 3UE5A 3DOMA 4ZVTB 1WNSA 4NYZA 2BJEA 2MQ8A 1YBAA 2VA3A 3C94A 2JC1A 2W24A 3N6LA 3RRHA 1NMNA 2E7WA 3D6MB 1C1AA 1S9GA 3HBTA 4WF9Q 1OKJA 4XAKA 4YEAA 2GO8A 5KOWA 4DSKA 3U3GA 1VCTA 4K4WA 4OX9J 4OX9F 3N5BA 3QIPA 4JS5A 4RW9B 2CZ9A 1T95A 2L3MA 4IEEA 3VGMA 5A8KA 4XK8C 3Q8QB 3BDPA 3G96A 1L3SA 5L1IA 2G2YA 3NFAA 4F04B 3MFHA 4JD2A 4ED0A 2UU9F 1I51B 3FUYA 4BC3A 1APSA 4C3MA 4R5PB 3RMAA 5FPEA 4YR3A 1LQ9A 1T3OA 1RAFB 1HNWJ 1M0SA 3IG1B 4RX6A 1NBWA 3P1GA 1QVGR 1ZTTA 4PQUB 2GV1A 1DFDA 1O0PA 5KFHA 2FIUA 2YWHA 3WQPA 1J5EF 3IBWA 1KVJA 1HARA 1NJIO 3D2WA 5KT2A 3M6GA 4CJRA 2FYXA 3D0GE 4FLTA 1N32K 4JI2F 4URGA 2FLLA 2G1HA 1NHVA 1IM4A 3W5YA 5D0RA 1NSPA 5BYRA 3IKMA 5AT1B 1EETA 5KRSA 1Q1KA 2MKJA 1PC5A 4ID5B 3P96A 1KVKA 1O8BA 4GMKA 5C7PA 1QE1B 5CABA 5IQ6A 2YPZA 1YG0A 3VALA 1TU0B 4XH1A 4K4ZA 3RBZA 4ES2A 3BN4A 4R25A 4KH0B 3S3NA 2CPEA 4JB8B 2XHBA 3QBCA 3TJAA 3MCSA 2CPIA 3TUIC 1RT2A 2HQDA 5JS2A 5J2MA 2UUCF 3ZSYA 1H73A 3AB4B 5KFWA 2NRTA 2XO6A 2D5RA 1GOAA 2QWMA 2CJXB 2YX4A 4O0NA 3VA3A 4OX9K 3IUCA 2Q6CA 2JNJA 2PEBA 2EFNA 4E2FB 4BS2A 3FSXA 2VQEK 2DNYA 2HMIB 1JCEA 2D3OR 2R7RA 5GIOA 1TKZA 3R7NB 3UD3P 2FVPA 3TJ9A 2M88A 2OSRA 4CJ7A 2E5IA 3ENHA 3TX8A 2Y3YA 1VQLS 1Q81O 2A10A 5F41A 2W9CB 1UW9A 1KC8T 2Q1NA 4DR3F 1XMBA 3U02A 1NDCA 4FLVA 1KQSM 2CFXA 2EFVA 4LFAK 2WBMA 1ROFA 1UZDA 2ASPA 2HBJA 4GVBA 1QZ6A 3ZEUB 4B3MF 3HULA 1H6KX 4ICLB 4NRTA 3GIKA 4DJBA 3RJMB 3R5JB 3IR5B 4CF8A 3C19A 4WXOA 2VQFF 4TU8A 2CPJA 3ENWA 2VBYA 3TAGA 3O9SA 4KRWA 3VF2A 3T5KA 3TQ1A 4DR1K 3IAS9 2R42A 4ITSA 1RQ0A 2ROGA 1H0HB 4K4XA 4NWBA 5E84A 1TL7A 5T7BA 3MMBB 2HURA 3BSNA 1F2GA 1FHTA 2VV5A 3AO2A 1MNEA 2KZMA 1FRLA 3K5NA 1QQMA 2Z2YB 2YKMB 1U1PA 1U1RA 5B0BA 2BQRA 3SMPA 1RWOB 4OZ3A 2MY7A 2HNDB 4UOFA 2A1SA 4J2BA 4MYUA 3GSDA 3KD1E 5DJBA 4CVNE 1HI1A 4CZFA 2ZVIA 2AF6A 1V6HA 3NY0A 3UKUB 1RT4B 4K0KK 3TUPA 4H4OB 1WSGA 2G0JA 2QRRA 3JSRA 3IRXB 4KYZA 3UKUA 1T9TA 1R8BA 4C2MA 4N76A 4IKFA 4RNNA 1QSLA 4BRGA 3X1LB 2JHEA 3EVOA 2OH2A 3G10A 4P2SA 1NJWA 2QMUB 2JLFA 4FJ7A 2P9CA 2Q31A 4NLQA 2DXEA 5AQVA 1TKXA 2B7BB 4C9DA 2CG4A 2ZM6F 1YITS 2KL8A 4F3TA 4B3SJ 3VETA 2X3GA 1LWFB 4EUVA 3C16B 2HBYB 4YHHF 3E9LA 3DLGA 1KWMA 2EWHA 2KHDA 4USIA 1HMVB 2F8MA 3IMXA 4LFAF 5TKWA 1HNXK 2E88A 3AVFA 4ZLJA 5MAOA 3K58A 3HOSA 3U8XA 5E3PA 3OYDA 1Z2ZA 5KPRA 3FNNA 3NH1A 2EK6A 3O3GA 3MM5A 4B3MJ 4L8RB 3PACA 3EKUA 2HHQA 2IM1A 3VN5A 4FZYA 2E66A 4ZPTR 5B0CA 4Y65A 4J9SA 3FBEA 2C2OB 3CD6N 4IG3A 3NBPB 5B7WA 1HBUB 1GTHA 1RBOB 4XH5A 3ZT1A 3FC9A 2B56A 1C0UB 4KAZA 3W9IA 1YIJN 2VUGA 2ZJPL 1S72N 4ZOSA 3BP8A 1JX4A 1SI9A 3KMSA 1JLQB 4AFFA 4BE2A 1QM9A 4U7UK 3EXCX 5ADXH 1R3NA 2MZTA 3PHEA 2D1CA 4IOXA 3CJSA 2ASLA 4IFVB 1MN9A 1J5OB 4A47A 2IJRA 4MIAA 2NUHA 2P6TA 5EHHA 5KG1A 3RB6A 4B9VA 3KWIA 4TNOA 3VAGA 5DZ6A 4J9RA 2Z2MA 2D0OA 3A8IA 4ZPWR 3CCEN 2KM8C 2H5EA 5B0DA 3ELHA 2WONA 2BJ1A 1TK8A 4ZITA 3GIRA 4P73A 2R9LA 2CNNB 3VMFB 1ZBFA 4E3SA 2DY1A 1Q53A 3EVMA 3PYDA 1J2VA 2KI2A 3TX0A 2XHCA 3D67A 3ZETB 1OPZA 4ECZA 2DGQA 3AHPA 3W7BA 2C3PA 1HPMA 1GLFO 4KREA 3DRPB 2HNYB 3OT9A 1DQ8A 2Z1JA 3KJQB 1GK8A 4AL7A 1DQAA 3TO8A 5E41A 1X0FA 1BWFO 1Y0HA 3CF5L 1N56A 3OYLA 1LW0A 3DOMB 3FZLA 3FCVA 4H0TB 2Z8QA 4FCYA 2E1RA 1NRKA 3GE9A 1BQMA 3HPOA 1ESVA 4NLCA 5F8LA 2R2SA 4O3OA 1SKWA 1N36J 4OHZA 2ADCA 4CJEA 4TLRA 1F3VA 4F50A 2B9XA 5L9XA 1TUGB 2G8FA 1P9YA 3OY9A 3MDQA 3KK7A 3O9TA 4QS9A 5M1QA 3PY8A 3C6TB 2GEMA 1WF0A 3U9ZA 4JI0J 3TNVA 3M2VB 3OYBA 2FTRA 1VJWA 1WF2A 4NLWA 2AJ1A 4B9SA 3CCSS 3VQAA 3KKSA 1HW9A 1FVQA 2CWKA 3CCTA 3RBDA 3BGUA 2HHTA 3AO5A 4IOCL 3M2UB 4JS4A 5IT9O 2CQDA 3ZSXA 2QM1A 3CPWM 4NO7A 2MQMA 1TYQB 4JN4A 4ZMMA 1FA0A 4NLUA 2YV0X 5ADXA 1SUQA 1RBTA 3D0PA 4BROA 1GXTA 3PR5B 4CGIA 2CQPA 1S6UA 2ZNZA 4F26A 1RADB 1H3DA 2UU9J 5KFOA 3WC0A 4LF9K 5I42A 4AM7A 1F21A 3C15B 5LMNJ 2VA2A 3LL3A 1MWQA 3GB0A 5I4MA 1N34F 3HK2A 2GV9A 4URSA 3SUOA 1C0FA 1C0TA 4DCOB 3HT3A 4HHTA 1CBKA 2K1RB 4C11B 5KFQA 1VQNN 3K89A 1WLJA 4MDAA 1MU2B 1HQUB 3MEDB 4X62K 4B3RK 4LY7A 4BRMA 3IMQJ 1XQSC 1R6VA 3UCGA 2W2OP 4XEIA 2A5XA 1KS2A 4K8ZA 4QPTA 4QWCA 4QW9A 3VAMA 4CLTA 5I3UB 2YHBA 4IOAQ 4RW4A 2LQ8A 1QUPA 3IM8A 4DG1A 2M3DA 2V34A 4DZ6A 1IG8A 2NRXA 3UDVA 4M5IA 5E5NA 2W01A 2BJ7A 4OJHA 5HRRA 1ZZFA 3MM5B 2DNQA 1HUXA 2MZRA 1S59A 2YQ0A 3ASMA 2GBZA 4K25A 3DI6A 2FQQB 1VBYA 1NB7A 2UUAJ 2YBVA 1C0GA 5LSRA 2E2OA 3A1YG 3BREA 1WTFA 3CT9A 2BJ9A 1UW4A 4ZLLA 3NGYA 3K59A 2C2MB 2IGIA 2AZ3A 3MR3A 3MCAB 1ZA1B 3OVNA 3R5BA 3NH0A 1T03B 3SI8A 2ATLA 5L1JA 1JLAA 2VPYB 1ZM4A 2BANA 4JI7F 2VWKA 3M2RB 3TUZC 1IJFB 3LAKA 1F9EB 3PRBA 3UCZP 1ZS6A 1RU2A 4RU9A 3FBCA 4CZHA 4LR8A 1TAUA 3VVTA 4OLBA 4ZK7M 4PWDA 1EXQA 3TARA 1V4TA 3BGFA 2L48A 4TYBA 4F7VA 2MKHA 2XZWA 3EDQB 5E3CA 4PG8A 4HDHA 5H9FJ 2L41A 4HH0A 4DR4F 1ZBSA 4F4YA 5HRPA 1GTEA 2ZH3A 4BDPA 1N34K 1RWPB 2ZBRA 3M3ZA 2QXFA 2FDNA 5BRFA 4YB7A 3O1BA 2DR5A 2HZAA 4EFHA 1D8YA 5DQIA 3DLRA 1FERA 4P9SA 4ZN3A 4MTPA 4LH5A 3WX4A 4FNHA 4OIXA 3OR2B 1KLNA 1RSCA 4DR5K 1K9MO 2BGGA 3LWMA 3SQ2A 3AB2B 2BXJA 1KD1O 4DN0A 2AYMA 4MDBA 2A6AA 4CIGA 5L9NA 4FYXB 1Y64A 2CH6A 4CH7A 4GO5X 3FFIA 2DGWA 2LDIA 2DRBA 4WFZA 4HYKA 3R5CA 3O4NA 2LA4A 4YDXA 3RMCA 1LEOA 1VC0A 3WIVA 2D69A 4ZN1A 1LAWA 3PDNA 4YR0A 3VGTA 4LF9J 3OA9A 4WFBL 1DTQB 5C24B 4KI4A 4JKBA 3H2LA 1KRPA 2HVIA 4FWMA 1F1BB 4L75A 2HHPA 4CHPA 3EVWA 4C48A 3DDKA 3U7JA 1VI7A 4UF4A 4DR7F 1M1HA 4KH6A 1TR0A 1BD6A 2MJNA 1R8CA 3D7SB 5T7LB 4GKJJ 2ZJRQ 4QIEA 2HHVA 4ECQA 1RACB 4AYBD 3N01A 4DQQA 3CSKA 3TEHB 3WC2A 4F8RA 3OXFA 2UXBK 2E8AA 4OHXA 3CFPA 1QLNA 1WSHA 4A59A 4EHUA 1UWAA 3EL2A 1XMQK 1XC3A 4NZ0A 2JEJA 1LW2B 3T5JA 1U2VA 5DDQC 1FDDA 1E6VB 3N5FA 2MLYA 4ER8A 3VEOA 2HGMA 2YPYA 4ETXA 1CC8A 3HO1A 2VONA 1SC6A 4FJMA 3ULEB 5K14B 3KXDA 3DRPA 2FSNA 3H3OB 1I39A 1NGDA 1IKXB 3KLIB 4LIRA 2FZKB 2GO9A 1KHWA 1VOMA 2IIRA 1M5HA 2RVJA 4LF5F 2NNWA 4F02A 1MA9B 3VEYA 3DLLL 1K73O 1FNMA 2QYCA 4CZGA 3BF3A 2EX3A 2M4MA 5LJ3Y 3OLAA 5IT9Y 4HTIA 3LANA 3PX6A 1RYSA 5K8OA 3MUMP 3O3HA 3GCWP 1S1WA 1KAXA 4PHTX 5K8MA 1U49A 5GADI 4PPZA 3LP1A 3TR5A 3UR0A 2JL9A 4RW8A 1VSHA 1SJ1A 4K41A 2FY1A 1N5SA 4Y3CA 1VBXA 3UN3A 1HHTP 3FK4A 4ZPCA 5L8RC 4XPEA 4FPIA 4M5NA 4E8UA 2X51A 2MMYA 4C8OA 2FVSA 3EPIA 2HHHF 3TZWA 3CFOA 1U1KA 4JI3K 3GV5B 2BJ8A 3Q2SC 4DKWA 2I6WA 4X2BA 1DEJA 2G2OA 3GJTB 3NCQA 5KFTA 3NNCA 1BWEA 3LP0B 3PXGa 1UFLA 4I2PA 4L3KA 1VC5A 5DG9A 1UVLA 4ZCIA 2ZH1A 4LSLA 4MJKA 1PAEX 2YY3A 1MLAA 4HKQA 2XS7A 4JV1A 4RKUC 2CDQA 4BRAA 1RAHB 2J7UA 1WB9A 3CMAS 2Y0SD 3SAHA 1JJ2R 2OA8A 2QGFB 2E2NA 4BRDA 2O4IA 4GKJF 1T03A 4OYBA 1NJIT 1HBUA 3M6WA 2KVIA 1SL2A 3RR8A 2UU9K 3G71N 4ED2A 4H4KA 3E3XA 1R0BG 5B0GA 4FWSA 1UAXA 1TKZB 4OYPA 2HNZB 4HCBA 4J9OA 5A8KB 4FYVB 3G86A 2GQCA 3A3NB 1YIJS 3G0ZA 2F4VF 4C8KA 3OHAA 5J2NA 2C22A 2IRYA 4I68A 3NGRA 1YK9A 2W4DA 1U6ZA 1D9DA 4AXJA 2BTFA 1MDUB 1YI2N 1H2VZ 1JQGA 4HUGA 3E66A 1W2BM 4LVNP 5EVZA 2DNNA 3BO3A 5FJ4A 4J8FA 4ZJOA 1OQ3A 1U1LA 4LQ3A 3RB3A 3CQXA 5B8HA 2DJWA 3CCRN 1FNOA 2LQJA 2RE1A 1UWBB 4YNQA 1A5VA 4CM0A 4PWDB 1P1TA 2IA6A 3DM2A 1RA7A 4CBXA 2VQEJ 4CJSA 1S7IA 3QRRA 2ZGYA 2HHHJ 4K59A 3CC7N 2PE8A 3S41A 2PD1A 2VBZA 4I56A 1CXUA 3GFZA 3DOLB 1TVRA 4WU3A 4FJHA 3L7OA 1C2PA 1C0UA 4WPAA 1DY3A 5CCLA 1VQ9S 4QJVA 4Q2MA 3L2UA 1UETA 2IM2A 4I64A 2AKWB 1T9UA 3P4UB 4MKAA 3QMQA 3AA3A 2E20A 3BZKA 1KCFA 2HYIB 4KO0B 1NM1A 1WOOA 3KLVA 3ZTOA 2EC2A 3NAHA 4BC2A 2XQCA 2HQ3A 1NKCA 2F7TA 5J1EA 1M90O 4J9PA 4IH7A 1DLOA 4OJ1A 4O3NA 1NDPA 2GZOA 2V52B 4A61A 4OI6A 3VGSA 1BIUA 3CCRS 1VQ4S 3ENVA 5ELZA 1FX2A 2RF2A 4TQSA 2PO4A 3V9ZA 4BRLA 1UMJA 3UW1A 2Y9HA 1RTHB 4XPCA 4B3RJ 3AFGA 1D5AA 4HVJA 3GZ7A 3LDLA 4EIAA 1RT7B 3CJAA 4JI6J 5E0OA 1X3MA 2ZD1B 1RWXB 1NJYA 1XMQJ 4DV0J 4KHRA 3HVTB 4WYBA 2QLWA 4RO0A 4DHYA 3HKWA 4Q43A 4W5QA 4JOUA 5GMDA 4MH8A 1NGBA 3L7UA 3R3TA 3FJ2A 3OTCA 3BBFA 3N79A 2RS2A 3SJHA 4NLBA 2EW9A 3KKFA 2VFVA 2J0QD 3VA0A 2KT3A 1Q16B 3QRPA 1RTDB 1ZC6A 3N0VA 1RABB 2ZM6J 4OJGA 2G0CA 3MHYA 5AQOA 2QA2A 5F8GA 4BRIA 5EUHA 3OFFA 4HI2A 3H40A 3E1YA 5A8RA 3RAXA 3VAJA 3ZZYA 1YJ9S 1NLKL 2BQUA 1MSWD 2KM8B 1WKJA 4YOVA 2W8KA 5BRHA 1FJGJ 4FKXA 2V2VA 3H5SA 2DT9A 1U0SA 5GADU 2OMLA 5KFSA 4MO5A 3I9ZA 1L5UA 3A8YA 3OUYA 3K2YA 1X9WA 3TQEA 3NCRA 4NEZA 2F4VK 2HWHA 4C8ZA 2FVRA 1OYDA 3H08A 3DDIA 1EZZB 3AA5X 1KOOA 2V7ZA 2VL1A 1LWEB 1CQNA 4IDKB 3A5NC 1QAJA 4BC5A 4LRAA 3NMAA 1Y9OA 2W2MP 1IKYB 3K5PA 4CZCA 1KBRA 2VG7A 3N28A 4V19X 3AODA 2COLA 2VICA 4DTRA 3THWB 1VQSA 4DS5A 4J9KA 3KUGA 4ZP8A 4RU2A 2CKWA 3KJVA 4NPOA 1RTIB 4YOEA 1FNXH 1X5PA 4DV4J 4CJWA 4HDGA 3AOBA 2JFDA 1WUUA 3GONA 4USHA 1YRUA 4FW1A 2A2CA 4DL4A 3HCXA 4FJ9A 4OPHA 1F2HA 2CJAA 1C1BA 4A48A 1T8EA 1DARA 1Q5VA 2EKYA 3THXA 2J76E 2GGPB 4UY8O 2CNOB 1T11A 4RNOA 3MAQA 4MIBA 1R59O 3BSAA 2HBQB 3F73A 3VQ7A 4BDZA 5DGBA 1SJ3P 1S9EA 2O4GA 3TW0A 1Y4ZB 3W2WA 1WKLA 4DV5J 1X4CA 3THPA 1GLDG 2KLAA 2V2QA 2WW8A 3N4QA 4FM1A 1KFDA 4KB0A 1QAYA 5BPLA 3ZETA 1FFSB 1S6PB 4CK3A 5DLGA 1JLCB 2XMMA 4IH6A 3O1LA 1AA1B 1P27B 4JI5F 4M3RA 3DYAB 4K2JA 4CJFA 1O6XA 1NH7A 1WAFA 5A76A 1S1VB 2VGNA 3QB0A 3QRQA 3THVA 1UZHA 3AVGA 2LFVA 5AQWA 1EWRA 2V94A 2QMXA 2ASYA 3L6QA 4EP5A 2QMWA 2BBEA 2NUBA 3MUTP 4FVUA 1QJHA 3MAAB 1YHQS 1NGCA 4DL3A 2N4CA 4ZCKA 3ULEA 3M2UA 3WQUA 1IBMF 1RAJA 3U9DA 3B8AX 1N5QA 2ZZTA 4ZVUB 2QL9B 2ZH2A 4FF4A 1T94A 4FWKA 1YVFA 3BF4A 4CO1A 4EHTA 2BYCA 1M1GA 2PA3A 1XNQJ 3R2CJ 3J7ZO 5MLCV 1SH0A 4ED4A 3NG8A 3BGOP 1N0VC 3VGLA 2P5VA 3BGLA 3G8TA 4OVLA 1R8PA 3Q8YA 5LMNK 3D54A 4OI3A 2CQ1A 1TFYA 4Z4GA 2VFSA 4ILHA 3LDQA 4OYMA 3JSMA 1D9FA 4BR5A 4EI2A 4RNHA 4YB5A 1RDWX 3HZEA 4RLEA 3KNAA 4EP4A 4QQBA 1FXLA 3AT1B 4Z37A 4B3SF 3RBXA 3M6VA 2QZ8A 6FD1A 5K9FA 1YT3A 5D4LA 4BRHA 1VAZA 1BQNB 3B4MA 2EC0A 4E19A 3I0RA 2EG1A 2CPYA 3T1HK 2BM1A 3I5CA 1BG3A 1KLMA 1N34J 1ICEB 3HI0A 4LF4F 1DQ9A 4E1NA 1S48A 2UXBF 3DRXA 4N7TA 3CJ3A 1X4BA 2VD3A 2XB2D 1Z25A 2MPUA 2NPIA 3E9OA 3TTFA 2G8WA 1IBLJ 5HMXA 3LPEA 3IN5A 3OYJA 1U2FA 1EJ7L 4Y2CA 2NXUA 4W92B 2BE7D 2ZM6K 4ID8A 3BM7A 4MAKA 1JB0C 3CPEA 1X0PA 1Q95G 3ZC4A 2UUAK 1NKEA 4PXDA 1PIEA 1Q86O 3QLHA 3OYMA 2X1GA 1CC7A 2A41A 3CDBA 5IT9U 3V6HA 2DPJA 2F3JA 3AO1A 4M5DB 5GINA 4ECSA 2FGOA 3G4SN 4XIUA 4H0VB 4RWTA 3LPYA 4L3NA 4GV6A 1BUXA 3P45B 2QI2A 4OZNA 3NRBA 5HRNA 1CPZA 4DTUA 3KK2B 2JGUA 4EZ9A 5HQLA 4JKGB 2J6TA 2R7TA 2DY9A 4YP3A 4E7JA 2Z2ZA 3TZXA 2M5YA 1Y3JA 4WU2A 1HQEA 1LV5A 1Q7YT 1QTNB 2ZITA 3DFEA 2VG6A 2KH9A 2XMTA 2JJ4D 4YORA 2QFIA 1QDUB 4OFZA 1RTDA 1M5SA 5GAHU 3J80U 3WNGA 3SAGA 1SJ4P 5A0YB 3BYPA 1N48A 4BE0A 2KN4A 3NAEA 2O8DA 5F0XA 4DR1F 3PYEA 1RTIA 2MXYA 2ZEJA 1S49A 5LSLA 4OLPA 3SCJE 1BOTO 4RW6A 3DLKA 1E6VA 1Z26A 1RHQB 4WK3A 1TKDA 3R5AA 4GC7A 5GAHI 3X3UA 2HRTA 3OYGA 2E9TA 2GUIA 4RW6B 2XYGB 4DR6K 1OSCA 2KG1A 4PL8A 3CG7A 2NXJA 1JK9B 3N6MA 1EO1A 3TU5A 2HNYA 3DLHA 3UVJB 4GC6A 3WNFA 3QFWA 2O8BA 5SZTA 1PYTA 4DR2K 3GIIA 5C2CA 2ACYA 5J1EB 3H42A 3PW0A 4AXIA 4O23A 4GRSA 2GWKA 2VYPA 1XMOF 2DCUB 4TXSA 1MG7A 1Q82T 1G99A 5AJ3K 1EKEA 1VK0A 2D41A 3SDEA 3QQCD 2V6AA 2AQ4A 1L3UA 2RE2A 1N5YB 3VF0B 2E1ZA 5CZ1A 1FKOA 4ZPDA 2OI2A 4MO4A 4B1XB 2VPZB 3V9UA 3SV4A 1FKOB 2HVDA 1UEUA 1VQ7N 2HGNA 3SCIE 2DIVA 1VQ6S 1SC3B 1UWBA 1V5VA 1RBSA 1QVGM 3PX0A 4TU9A 1EQYA 1TL4A 4B08A 3BSCA 1WEXA 3BZQA 3H2UB 3I56S 1KOHA 2E1AA 4LF6J 3F0NA 4OO1J 3OW2R 3Q23A 1HNWF 3UQSA 3Q22A 3NF8A 1RUSA 2N82B 2AJ4A 4DV7K 4B3TK 4J2AA 4DTSA 2LKZA 4ED7A 4ECWA 1R31A 4DBQA 2DR8A 3OXGA 4OJ3A 2NRWA 4ZIVA 1ATNA 1YBUA 3BUZB 4DR6F 4Y0WA 4X65K 1WEYA 1K1QA 4MT1A 5H9FK 3OTOJ 2PMZD 4ZJLA 5FDLB 3T9NA 4X62J 3VQSA 4ANDA 1VQ4N 2VJUA 3L8BA 1IO2A 1AZSB 3GYGA 4DL5A 3HP6A 3SPYA 2DHGA 4IG0A 3O8WA 4IZ9A 1P9QC 5KFVA 4F2RA 1U25A 2P5GA 3A8EA 1UJ4A 3MN5A 3THYB 2QWNA 2PAVA 3L95X 3MMCB 1IN0A 4X4OA 3O9UA 1GX5A 1RXOB 1BI4A 1LXJA 1UVMA 2ZJPQ 1YUWA 3FRZA 5CD4H 3LPUA 1VQ5S 1B4SA 4P2FA 2Y1IA 1NLVA 2P9SA 2DVIA 3C8YA 2F4VJ 3JTNA 1G6BA 3L4QA 1IKYA 1JNZB 2XI2A 3KWMA 1K8AT 1BA1A 1NK0A 6AT1B 2DPNA 3V4IB 1PAUB 1CLFA 4RW4B 1AFIA 2CGLA 5KAKA 1VS3A 1NJXA 1K0TA 3FCWA 5F8JA 4LRBA 2FC8A 2VH7A 1SZ2A 2P9EA 3PNIA 4IR9A 2KFNA 2Y1RI 5AQZA 3L4IA 1JLEA 1S1XA 1XNRF 2IC3B 4I9LA 1XNRJ 2BABA 2V68A 4C6AA 4NMLA 2DB1A 2QA4G 1V3RA 4DSFA 3JAMU 2AD9A 5GMEA 1CJUA 4NA1A 2ZH8A 3DHXA 1OH6A 2YKAA 3UFCX 2AMCB 3M1VB 3CMES 1VQ5N 4JHDB 5D15A 1AXQA 1RA6A 3SI6A 3OTOK 5AQSA 5AQUA 3G82A 3CCJS 3DXKB 2XM3A 4FYWB 2ZHAA 4NEYA 1KDNA 3A5OC 2AEJA 2RUGA 4TYAA 3MPVA 3AQPA 2N4DA 1I1GA 2OPSA 3M30B 1UKUA 4DZDA 3Q7CA 2ABYA 2KKZA 3DRSA 4U7UD 3ATVA 3RYLA 3F2KA 1PGZA 1NOZA 5BYSA 4HUFA 1U48A 3WEEB 1HKGA 1H98A 4DFKA 1A5XA 2RRBA 3W1YC 3AD7C 3R1HA 3CQ8A 1VRTA 4HTJA 5AXLA 2HIQA 3THTA 1FXRA 3P3DA 5EX5A 2G13A 4CZJA 1NDKA 1YF5L 1B9FA 2YNIB 3IFRA 3G4SS 3L2WA 3VQ6A 2IYIA 5D0HA 2XS5A 3OBYA 4AQYK 4ELVA 3LF0A 5KFZA 3K5LA 1T05B 3A5LC 5AQTA 4NYOA 2U1AA 1IBKJ 5ETRA 1FDAA 4I2PB 2LU1A 3MTJA 5JLHA 2HWTA 5J1NA 1IWAA 1NZAA 2Q97A 4CNYA 3WXIA 3PO5A 3VQCA 4ED8A 3SQ0A 1EARA 2JVRA 1WBDA 2DH9A 5HBMB 2APOA 1RBVA 1FCAA 2R7WA 4KRFA 3C95A 2JC0A 1N36K 4PQAA 1MROA 3THXB 1ZAXA 1AYEA 2ZKTA 4USMA 3RWUA 4XDDA 4BBYA 3CTRA 4WCEL 1B0VA 2GIRA 3QGIA 2Y8YA 3D2FB 4NYNA 2BA9A 1OH8A 4PYAA 2J0WA 1FWPA 3Q2TC 2I7PA 3R9LA 3DXBA 4YR2A 4CF9A 3BN7A 1O5JA 2RJZA 3GP9A 2YCHA 1RT5B 5CQGA 4UOHA 1F9FA 1UJ5A 1S4FA 4O4RA 2FBXA 1GEHA 1N4LA 2ZOGA 3FGUA 5AQGA 4AQYJ 3GPAA 2X7IA 3AY9A 5KFFA 2Q6BA 2M8HA 5HSPA 5EDWA 1SQFA 3G6ES 2HQCA 2F7VA 2FPHX 1PCAA 3OJUA 4Z0UA 1FD8A 3GCXP 4I6MB 2VU5A 3CJ7A 2R8HA 2AZ1A 3KZBA 2J9DA 4RBUA 4ED6A 3FZMA 3VAHA 3TP2A 4DMZA 1R0AB 4CGJA 5IC6B 1SPBP 1XMQF 3LZIA 2RHQB 3OYNA 3OR1A 5C15A 3CI5A 1IBLK 3QWPA 2ZUGA 1P8GA 3AO3A 3EPGA 1KAYA 1Q4RA 3OL9A 3P5TL 1BDGA 4DF4A 3EUNA 2QEXN 3MN7A 3ZEUA 3JSMB 4CJQA 5A8WB 4FLXA 5THWA 5AFUA 1HR0J 4NI2A 1HNZJ 1VRUA 3DLJA 4ES1A 4J2DA 3FLCO 3TAFA 2CQ2A 2JEGA 2P9KA 4PKIA 2D0PA 4HR2A 4FVMA 3GIMA 1URRA 4DV5K 1X7VA 1EHWA 1EKRA 4DDFA 1BL3A 2E9ZA 1IV0A 1HYSB 1OY8A 4LMZA 4ZP9A 1HWLA 4DU7A 2P9NA 2RD5C 2LXIA 4H5NA 8ATCB 5GAEP 4PY5A 2B9YA 4OHWA 4LSNA 1ZZNA 3NGZA 3M8QB 3N4WA 2BQ3A 3I5BA 2ZDPA 4EEYA 3C3LA 3D1QA 1M1KO 3SV3A 1WJ9A 3AY0A 3BDEA 4OHVA 3AH6A 4CLWA 2BE2A 4B3MK 3U1NA 5KFLA 4U67L 1TUUA 2EWSA 3H0PA 3T6JA 2BKOA 3S8SA 2ASMA 1JXEA 2IM3A 1MMNA 3HI9A 3HT0A 4OX6A 4DL2A 3QEIA 1KP6A 5AQKA 4CGHA 1ZM2A 3T69A 3J7YP 4WZMA 2HS0A 4KIAA 3AA2A 3BR9A 2HVEA 2WBRA 4LF4K 3SQ1A 2R7VA 3K8WA 4ED5A 1S0OA 3L09A 2DHSA 1HJRA 1NXIA 4M7YA 3R2DJ 3O44A 1N88A 3KWGA 1HNVB 2ZNYA 4NLRA 1SJFA 1KN6A 2ADBA 3MD1A 2EFQA 2NS1B 2V0NA 3H7HB 4ZVEA 1TL3A 3SSQA 5IC4B 4Y2IA 3AOAA 4DFJA 1XC9A 4CESA 5AR0A 2RNEA 3AD9C 4RCHA 1LOUA 3O5TB 3DMJB 2I38A 1WI8A 4FJ5A 4C8NA 4WFXA 2WVCA 2WB4A 1ZM9A 1RAGB 4CO3A 3J81j 4DV5F 4K50A 3UCUP 5KFPA 2G2ZA 2DNPA 4JD2B 3AAQA 3WXMB 1IXKA 2BW7A 3ZNUA 3O6QA 3TA0A 2F65A 1KEKA 2SXLA 4ETZA 2VKZG 3FRYA 2GUPA 3O3LA 4EO6A 2A40A 1ZA2B 1GH8A 2IVNA 1O1WA 2WCXA 1T3NA 4NYPA 3SNNA 2YH1A 3ZTPA 5HQ8A 4FK4A 2BE9B 2VG5A 4U8YA 2VG6B 4DG1B 2QIFA 3CIZA 2IDOA 1ZXOA 4CFDA 4YS2A 3C6TA 2FB0A 3V1QA 1YJTA 4NXMJ 4JKCA 1WG1A 2C3UA 3LGHA 2IRXA 4JYAJ 1N6QA 2A3ZA 3PEJA 1RB0A 4EYHB 1EP4A 4X4UA 2KHCA 1TFWA 4NRUA 4OYZA 3DGVA 4OI2A 2G1DA 3KLFB 4C8MA 1TELA 1FWKA 1FRMA 2UXDK 4YDUC 2EK1A 2QA4N 4ISGA 1NK6A 3HHLB 2F9JA 5I3UA 2YWGA 3IRWP 5A0YA 3AJ1A 5CAAA 3A12A 3H20A 2YI1A 1LWFA 2HBRB 3PSFA 3SPZA 3ZXWA 1RDAA 4FN5A 2LYVA 4C1NI 3J7AP 3O08A 3THWA 5HVGA 4ED3A 2JLEA 2AP1A 5BYQA 4MKYA 1KVBA 2E44A 2VC0A 3T19A 1NJZA 1BWVA 2RKIB 3C65A 2EG2A 4PEOA 5ETQA 3PW5A 3VQTA 3O4WA 1U24A 2FSJA 5HJYA 2UUBF 1HBNA 5H9EK 2LVWA 3TOQA 1S57A 1H74A 1SB6A 3MZIA 1X5OA 4LF8F 3ZSWA 1TP7A 3AAWB 3B54A 4NLDA 3TJ8A 2F8SA 3EO3A 2PBDA 4PWWA 3I8BA 2DR9A 3MXMA 5AZIB 3MAHA 2B6AB 4CLLA 3NNHA 3VCDA 2GTDA 3BF1A 3D45A 3V9WA 1WSEA 2CJYB 4CCHA 1VR6A 4QPXA 3UWTA 1NWKA 4ISFA 4R8UB 4URQU 4A62A 4IFVA 2RN2A 4NASA 2O8FA 1H7XA 4P2XA 3GDQA 3E01A 1QHAA 1PJ5A 1U1OA 4DPOA 3DU6A 3RRKA 3Q24A 2P9UA 4YQWA 3NOGA 1VQ7S 1ELOA 3V6KA 3HOTA 2GHPA 1JXBA 1EX4A 3M4XA 5BXIA 4ZVPB 3Q8SB 5F0UA 1ZBUA 1U04A 2NYIA 1KFSA 4DMNA 3AVCA 1XR7A 2OIHA 4HT7A 4DQ8A 4M1KA 5C5JA 1QVFM 2V4QA 1V9OA 2CDRB 2YWWA 3SIPB 2Q2RA 4A57A 1OJ4A 1BI4B 2YKQA 1FFGB 3ZLJA 2YKPA 5FDLA 3MF5A 2Z1GA 2OPPA 2WC9A 1YXQA 1LK5A 4CRJA 4FL9A 2IMOA 2RU9A 3OSNA 3HSJA 2P51A 1S5JA 1QQCA 4MK8A 1KQSR 3NAIA 4QOZB 4EO8A 1LAVA 2ZKUA 5FD1A 2PI5A 1R89A 4OKKA 3FQKA 5C42B 3BPSP 4JV0A 2UP1A 2FVQA 3T3FA 4AHTA 3G6YA 1YTUA 3HHLC 2ERRA 4CZMA 2B8QA 3TR8A 3KD5E 1CJUB 4A8KA 4MKBA 1KNZA 5JVHL 1TQLA 5BR9A 4WP8A 4RPFA 1VMBA 3BB5A 2DXDA 1H1VA 5EOYA 4FK2A 4NA2A 3BEGB 3M9MB 2ATQA 2XMAA 1WOSA 3BKTA 1KKHA 4ALZA 5KT3A 4OZ2A 4PXEA 4Y2MA 4I6YA 4EZ6A 2UVUA 2BEFA 3GSIA 4LF5K 2D9OA 1JL2A 5LJVA 5IQQA 1Q7LB 4WYLA 4HHUA 1VQYA 1JKHA 2HVZA 1NK7A 4BCAA 5DETA 5GAGU 3VEVA 2XNQA 3CCUN 3LPTA 4UZCA 3L0QA 2D7SA 3OTOF 4ZTFA 2NRHA 3TSPA 4TLQA 3M5RA 3VOVA 1RP5A 3MMVA 2V8HA 3U4LA 2FHJA 1RK8A 2Q66A 2YNFB 1UTAA 1J53A 1Q79A 2KTQA 2VFUA 4LJMA 3FMWA 4ZVQB 4UZBA 4FBTA 1VDHA 2V4JA 4BC4A 2YNIA 3IDHA 2AJFE 1OPIA 1RNHA 4CEEA 3T5LA 1R27B 1W9HA 5CHIA 5FPNA 1ASUA 5D77A 3ALYA 2HAFA 3W66A 1IUJA 4CF2A 4KHPF 5B09A 4CFBA 3J81O 3AQOA 4AUKA 2AX1A 4JAXA 3GG1A 1ACMB 5F8IA 2BOPA 2NLWA 5HMWA 4LSNB 1I3AA 4CNZA 1VBZA 2AJ0A 3LDSA 1NK5A 3HL8A 4FWQA 2NYHA 2GWJA 1GT8A 1G15A 4CZIA 3BJYA 3IP0A 2DGOA 4RW7A 4FXVA 2CGKA 3TTCA 4C0HA 1YTYA 1LFPA 2DPIA 1Q8LA 5GAGI 1K6YA 3QEWA 2YNFA 2M9KA 2GHWA 4PKHA 2WHOA 3SUQA 4WWSA 3I32A 3IWNC 1QZ5A 1URNA 4HHJA 4Y2AA 3BGRB 3HTVA 1CJVA 2PZSA 4F25A 2ZHOA 2PN6A 4JKHA 3DKDA 3VQ4A 1WSRA 3W61A 1HWJA 3FR0A 3OR2A 4L73A 2AW0A 5KFXA 4BWMA 4F3MA 4ZTJA 2KFYA 3CCWA 4BQLA 3MPWA 3H4DA 3C2PA 1NNEA 3P5BP 3MXJA 2F9DA 4Y00A 1NEEA 3N9UC 3MOZA 1S99A 4RUBA 1QAIA 3JYTA 4WXWA 1WACA 2EPIA 1WD6A 2WVEA 4DPXA 5M2UA 3E8OA 5IV4A 4X65J 1F5BA 4RW7B 5F8HA 1XNRK 2CH5A 1IKVB 3Q8RB 2XLIA 2GAGC 2V69A 4PG6A 1W97L 4NA3A 1RISA 3KFWX 4GW6A 1Y11A 2BACA 3KK1A 4WTOB 4DUZK 3D28A 1T44A 1U0HA 3MPUB 3D3CJ 3TRGA 4OYOA 1YI2S 1L3TA 2C42A 4UY8T 2OYQA 3QFUA 3EZUA 3NP5A 2JH3A 4M41A 2FHMA 2MKIA 4MK9A 4QIGA 1O51A 3TYTA 4IR1A 3PSIA 2BW2A 1NGEA 5JS1A 1CULB 2MQQA 3GFYA 4RUHA 4HT5A 4CEFA 4FOIA 4J9MA 3RG6A 2HLTA 3L2RA 2IAJA 1PJ7A 1HYSA 4F0HA 4W5OA 4ILMA 1Y5IB 5DMRA 3D4JA 1R8HA 4DV0K 1EQMA 4I2QA 1ZOTA 2AGPA 2MKYA 5M1FA 4HCCA 3NMUA 4G6VB 3FBBA 4ZVSB 5HBMA 4C4WA 1NOYA 5HAOA 2O8EB 4DU8A 1VRUB 2ETJA 4XH4A 3TAQA 3MR5A 4JV2A 5FLXY 3C6AA 1GXLA 1YDLA 5KG3A 1UPMB 3IR6B 2N7YA 4KH4A 4LF7J 3KHHA 4U96A 4FZZA 4IDHA 4OX8A 1HBMA 2B6AA 1LWEA 3PCOB 2VB6A 5KG4A 2FJAB 4B1ZA 2P9IB 4QS7A 4B3TJ 3PLAA 4GKKK 3UIQA 5KFAA 1LNQA 2A6OA 5G0RB 1X4AA 2XZDB 2RPIA 3DJCA 1R43A 1Y5NB 3OUYB 3ZSOA 2VPWB 3K2PA 4M63A 4JNEA 5AZJB 1EB0A 1JLGB 3RAMA 2PFFB 3M9OB 1U6FA 4BRPA 1OY9A 2EHGA 1REVB 5KFIA 3ZZPA 4BVOA 2K7JA 2GVZB 5J2QA 2HW3A 3G71S 3W8GA 1JLGA 3D9BA 2OPSB 4DL0C 4B3RF 4WP9A 2M0GB 2X6NA 4JI6F 3V5RA 1CJKA 2GX9A 2ZE2A 4AE5A 3IO1A 3G82B 3M8ZA 4DTMA 4JV5F 4K5SA 3P39A 4NLTA 1S97A 2P9PB 5DZ7A 1IBKF 4Q8FA 3SXLA 4BR0A 4YY3J 2LSNA 2GA7A 4AH9A 3G2XA 3CJRA 1FF2A 5F8NA 3WXKA 3PFOA 3JXOA 5EN1A 4DR7J 4R0JA 3DLBA 3L3UA 4M5MA 4G9ZA 3SUPA 1VBKA 4B02A 3NGDA 4ILJA 3M2RA 1FE0A 4A8OA 4K7QA 1UA1A 2XZTB 4OHYA 2KQ2A 1BC6A 1NCLA 2QSWA 3R97A 2L9NA 1HQ2A 1RT7A 2ZWHA 1LK7A 2ZBQA 5HROB 2DEJA 4OPKA 3PJXA 3QIOA 1NAQA 3KK3B 4GKKF 3IS9B 5DG8A 2Q36A 1LKZA 2A0FB 2DNHA 3GLJA 2BANB 2P6SA 1MU2A 2RILA 3J7A1 1C6VA 3JB9k 2Q3PA 4DX8H 3OS2A 1H38A 1Q9XA 3OYCA 5EWFA 1I5OB 1DGKN 1S7HA 2ZDOA 3D68A 3T7ZA 1HPZB 4A5AA 3JAMY 4G3IA 4ANEA 3PRDA 4CDIA 4AD6A 3MXHP 2LQ9A 4X64F 5EWEA 3AJ2A 4Q2LA 3GFHA 4M5HA 3IAYA 3QBXA 4RUAA 3POTA 2HS3A 3TABA 3QEXA 1R0AA 2B5JA 4NCGB 2F9TA 1GXUA 1ZBTA 1S1VA 3ZX2A 3MPYA 4FK0A 5D3GB 3EXYA 2MQOA 4MK7A 4R0EA 5C2DA 2NXCA 3P5JA 5HVFA 3SSSA 3T1HJ 1FRHA 5KOXA 2W41A 5AQNA 5H1SQ 2V2KA 4FVCA 4UUXA 3CC2S 4B1VA 3LALA 2HHSA 4CTAA 1S10A 4AHRA 2HLUA 3CM6A 1BHLA 2V8VA 4P52A 2O8CB 5KT6A 4W90B 2NXEA 1WAJA 3K0SA 4N47A 1B70B 3D66A 2CJBA 4BQZA 2G0IA 1IR2A 5KFMA 1NHKL 4OKJA 2UZAA 2MQNA 3CJTA 4OYAA 3BZCA 2BJDA 2QT7A 2EBEA 4XDCA 3OHBA 2J9DE 2ITMA 4HEA9 3M8YA 1VQPS 2UUCK 2CQ0A 3L7PA 1I3OB 2ZD1A 3QT6A 1G3OA 3LM2A 1DTQA 4OMFG 1X4DA 3KIOA 2BKNA 1FWLA 1FRJA 3HD2A 4CEBA 3SCKE 5SUHA 4A8WA 1FXDA 3MPDA 4DQRA 3K5MA 1CULA 4PXBA 2QTWA 4ATNA 4UQGA 3NVKA 3H5YA 2V4JB 1W25A 2ZWPA 1DTTA 4JI2J 1NSAA 4ID1A 3CETA 4DSIA 2CNLB 3E9PA 1K73T 2OTLS 2XNRA 4Y1CA 4A46A 1Z2LA 4H54A 4DR3K 2Z56B 2HHWA 3P6YC 4O5BA 5K20B 2J0SD 1WDDA 3UNGC 3ENQA 2ZH5A 3ISND 2BVZA 4F4AA 3GOIA 2QJ3A 5C0YA 5AQMA 4QW8A 2MQLA 2RAQA 2C28A 4OGEA 5IOLA 1E4FT 1EAYC 6FDRA 4E1JA 2P9PA 3BSOA 1VSLA 2NRVA 2XY8A 3T1YK 3CCUS 4JI8K 4M3WA 1NHUA 1MMDA 3IM9A 4ID5A 3CC4N 2J9CA 3B6BA 3TAMA 4ZPBA 2G8IA 3W62A 4DQIA 4DFMA 1OO0B 4PWUA 4O3QA 2DGTA 3WBZA 2CUYA 4A8XA 1VC6A 1LWCA 2HGLA 1F5CA 2FBTA 3OQ2A 3VAIA 3BR8A 3W2VA 1KR4A 4H4KC 5IWAF 4FPBA 3V6DB 3PIOL 3UN2A 4DR3J 4CJ3A 1SH3A 2AYEA 2PIIA 4GO7X 3Q8VA 1RT3A 4CLZA 3D3BJ 2ZJQL 2EFOA 2UXBJ 2XBPA 3QNWB 2NR0A 3HLUA 2FJEB 3MWPA 3HPGA 4MYTA 3A5MC 4CYUB 1GMWA 4PXCA 4PG7A 1I6JA 3EDRB 3NS6A 3RVCA 1N36F 3NDKA 4KHSA 2FJWA 4KGXB 2MTLA 1ZTWA 3FE1A 3WXLA 3HZ6A 2E5LK 2MB0B 3DOKA 1HYZA 1VQ6N 4KTQA 4QAGA 1U2RA 2LEAA 4HL9A 1B92A 3RMDA 2L08A 5HATA 4YHHK 4P7TA 3DWLA 1S1UA 4LBHA 1RJJA 4UTGA 4KHPJ 1MWMA 4B3SK 2RS8A 5I3QA 4UOGA 3W3SA 4DB3A 4E7HA 4CHNA 4E7IA 2W8LA 4LF5J 2DFHA 3PKYA 4JI8F 3BBCA 4DV1J 1BUPA 3MEEB 1SKRA 2LQBA 3SFUA 3M6XA 1CZ9A 5DS7A 4FJNA 3HHDA 5CE3A 4JUZA 4DL7A 1E6YA 2E6LA 1JMTA 1HNZF 1KSPA 3DRRB 1ASVA 2VG7B 4KT0C 4A2AA 3GJSB 1IKVA 5ETNA 3O8MA 4X4TA 1T0TV 3I0SA 4X84A 3PW7A 2Y0BB 2OEJA 2FHOB 3DI6B 3LGNA 3W0LA 3MEKA 1YJNS 4KTZA 4FWNA 2PFDA 4E7KA 4F2SA 3Q89A 5D78A 3GWCA 3H46O 4IQXA 4HI1A 3R1LA 4K4SA 1IKWB 1NPKA 3PHTA 1S76D 4HHHA 5CYMA 1PBAA 3NGIA 3QJLA 2DNKA 3HFZB 3KVGA 2YNGA 1VQ8S 3T9ZA 1NGIA 2O8FB 2NZCA 1D3WA 4NLVA 1RU1A 3JTPA 3PRVA 4OV6A 1HD1A 1RI7A 4LQ9A 3MCPA 4DR7K 2D3ZA 2X1FA 1N54B 2NSBA 5DDRC 5HL7L 5KGXA 2O8CA 4IOCQ 1QE1A 2JFKA 2V50A 2QWPA 3CCQS 2KU7A 3IWXA 3CWJA 3I9V9 5C25A 4LFAJ 3VGVA 5E7OB 3DAWA 4NXMK 4KHNA 4WBFA 1FTCA 4DXLA 2QN6B 2YX1A 3R27A 4KB1A 2WSCC 5FIIA 5HO4A 4PG5A 1UP1A 2WZ1A 2GHVC 4C98A 3T5HA 1JLCA 1VGYA 1SKSA 4LRFA 3QICA 5JVGL 4LFCJ 3GR1A 1U47A 2NZTA 4DTJA 4HACA 2VZ9A 2ZH9A 2GAHC 2B0GA 5IS2A 4FJXA 3GFXA 4FNIA 4WFAL 5B0AA 3E51A 1EKSA 3MR6A 5KI6A 4P74A 3ULHA 3BH6B 5B0FA 1VQNS 2KG0A 1AZSA 3H59A 4FJLA 2OD6A 4M63C 1VHIA 2CQHA 3TA1A 4IO9L 3A8JA 3BO2A 3OW2M 2LU2A 3ZNJ1 7FD1A 2CZVC 1BY9A 2GVDB 5BN9A 2O8EA 1RWVB 2IS3A 3K7RA 4O4GB 4FP9A 1AROP 4LF6F 3ZCMA 1HWKA 4D3GA 1LFWA 3ZT4A 4TQRA 3ISNC 3MK6A 4YOWA 1YAGA 1FESA 5DRKA 4BGBA 5IT4A 2IJNA 4FDFA 2ZZNA 1CJKB 3V4MA 3ZT3A 4AHVA 2XSFA 2ALZA 5CD4A 3TEGA 4QYZK 2HHXA 2W9CA 4JYAF 1C0MA 2VJVA 4ECRA 1JL1A 3QEPA 2XTJP 3RTVA 3KUHA 2IVOA 4CGFA 2DGVA 1M1KT 2V8DA 3G6EN 1YGYA 1FI4A 3HYFA 2V8PA 4O3RA 4JKGA 1JJCB 3C16A 5JVGQ 4UUWA 3CD0A 2BM0A 2MZQA 1HYVA 4WQ5A 2RDIA 3VQ5A 2VWJA 2IDLA 3IG1A 2E5JA 3D6RA 3ITHA 1ATRA 1GMUA 4M3YA 5LL6Z 1WKKA 3QAEA 2FVCA 8AT1B 4WFAQ 5D6GA 4ISEA 3KHRA 2R7QA 5CH7B 4CO5A 2F8EX 2V67A 4PKGA 3KLEB 3W2WB 3T1AA 9ATCB 4DHVA 1Q81T 1Q8BA 3BKFA 1TL7B 3CJKB 2MJUA 4X4PA 2W2QP 4IYQA 3UD4P 3VZHA 1QAXA 1KVAA 4FF2A 4JI4J 3I0RB 5BR8K 4E7LA 3ZT0A 3AA8A 4I4BA 3P8BB 5IM0B 2XCPA 3GILA 3GJQB 3TTDA 4JV5K 2WVBA 3VEWA 1QUVA 3R9PA 2ZC3A 2DRAA 1K8AO 1RAAB 4RR5A 4Z7CA 3ONQA 5DM7Q 4G1QB 3VZIA 2RQKA 2HEKA 5LXRA 4A8FA 4TKTA 1YBTA 3R5GA 1S1UB 3QO9A 3FSYA 1VHFA 4DUZF 3FKBA 4DV3J 2XMVA 2KT2A 4LF7F 3KK1B 2Q3SA 3NBPA 3P38A 4PYDA 4KC5A 1LW0B 1WHVA 3QAUA 3ILJA 1X9MA 2C2ZB 4J9QA 4JI5J 1M5PC 3JTOA 2IRUA 3CC4S 4YOYA 2O5DA 1ZAVA 3M8WA 4KY3A 1S0MA 3CB4A 1HNXJ 1HNXF 2UV8G 3WNHA 3BKUA 1W0HA 4DTPA 2HMPA 2XULA 2BKPA 2MY8A 4DV4F 1EETB 1RYRA 1N33F 3V1RA 2ASDA 3PEHA 4IO1A 3HSTB 5CZXA 4CLPA 4LR7A 5TKYA 3CIMA 3S9HA 1RGIA 2LMIA 4WFNL 5HP1A 1HQEB 2MZ1A 2FC9A 5KGWA 1F3FA 4P7VA 3FEZA 5AQIA 5GAEI 2XGQA 3D0IE 2L9WA 3OL7A 4LFCK 5RUBA 2OHDA 2DHHA 3V2UC 2WFBA 3G9CA 5CHCB 4J2EA 1TYQA 5E2QA 3NKYA 1WG4A 5U47A 4K4UA 3D6TB 4YOTA 2QLXA 1XBWA 1HNWK 2B51A 3GJRB 2GW8A 2HQGA 3TWZA 4FYYB 5KT4A 3LGMA 1HKCA 4QS8A 4DV7J 3TAMB 3JAMO 4AHUA 5GVQA 1N5YA 4RTFD 5AE2A 1TUVA 5AQHA 3PYGA 2VQFK 2MLZA 4JK9A 3VV2B 3K9KA 3NF7A 2B4JA 3D2FA 2X1AA 2X6SA 2G9OA 1ASWA 1PBUA 1B7FA 5E3AA 1YKWA 3MM8B 2A42A 3NVMA 4Q0BA 1Q78A 5KPZA 5HANA 3K9JA 3U6FA 3LQVA 1QVFR 2QLFB 2RUSA 1U1MA 2WBNA 3H8YA 3A4TA 4KJIA 1YJWS 4IOBA 2HPUA 1BE4A 4LF7K 3H25A 1T9YA 1YJUA 4DX5A 4O44B 1CXQA 4NI2B 2CVIA 5LJ5Y 5DQGA 2P9SB 4N8OA 5E3RA 4BR4A 3EWGA 2ZH6A 1RWNB 2MSTA 1DLOB 3SYZA 4A5BA 2YHWA 2GJFA 4WKRA 1T9XA 2RHSB 4FXWA 5DDOC 1RWWB 1Y10A 2B8PA 4DOZA 5L1LA 4A8SA 4DUYJ 2YNHA 4DUYF 4M5KA 2CWXA 4ECYA 3V9SA 3NWGA 4W5RA 4WKYA 2DKOB 5DGAA 2DNOA 4CIFA 2ZZMA 1KXPA 5BPNA 4USKA 3BEXA 4KH5A 5T41A 1BGXT 3CCZA 3ENBA 1T7PA 2IDEA 4JHDA 3MWTA 1VK8A 1XJWB 1GLJO 1TUWA 1SH2A 1SUQB 3WNEA 5KFCA 3M9NB 4CHQA 3Q8PB 4JI8J 1GOBA 1NU0A 1HMVA 2RRAA 1HNVA 4JRPA 2GFFA 1BISA 3ITHB 2MSSA 2FGCA 1ATSA 2KRRA 2ZOMA 2Y8WA 4IQMA 4JI6K 3IR7B 3V6DA 2W7AA 2NQPA 3G6XA 3EKSA 3ZX3A 1XR5A 5ETLA 4C3KA 3AV9A 4WFYA 4R79A 4I0WA 4QWDA 3POTB 4OI1A 1X8DA 2HFNA 3FZBA 1S6PA 3BBBA 5CZVA 3OPKA 2IC3A 3AVKA 3TZZA 2W6LA 4ZJQA 5KG7A 5AXMA 1UFWA 3VGKA 2RU3A 4RW9A 2YQ1A 4EGLA 5A8RB 3B78A 3CCVS 1B9DA 1SAZA 3FGVA 3MEEA 3H1VX 4BRNA 3QNOA 1RT6B 2YJFA 3MR7A 2HHHK 5BRDA 3HZGA 3MURP 2UUBK 4G1QA 1UVJA 4O5FA 1NGFA 4G1IA 2GIFA 1KD1T 1YHQN 4H0PA 5F0WA 3KLGA 1U4BA 5F9LA 4KHYA 2KYXA 5IM0A 4DV0F 3K17A 4WTYA 2VBXA 2QL7B 3QJJA 3FBFA 2V9WA 4CECA 4BRFA 3AA9A 3QINA 4C7QA 1KQKA 1NK9A 1ZAWA 2I2YA 2XLJA 1IR1A 1QD1A 2HBKA 2B9WA 1RDCA 2WW4A 3NGSA 4LFBF 1IJJA 4KBOA 4NLOA 2DTUA 4EYIB 3RW7A 4JI1K 3J8AA 2F8HA 3AVIA 3A0IX 2HF3A 3J80Y 1Q9YA 3WZ0A 3CMAN 3OSPA 3UKRB 4CD3A 4HACB 4CO0A 3UD5A 4CGDA 3HSCA 4O8UA 1QHTA 5JLFA 2GS8A 4Q45A 2UYTA 2ZWOA 2R2UA 5CCMA 1IG9A 2KKHA 1Q0NA 2YNGB 1OVYA 2OUGA 1VQ8N 4X66F 3UPFA 4ERDA 4JK7A 1PYSB 2QWOA 1P8ZA 4WQ5C 4M3UA 1S5ZA 3P4IA 4USVA 1TK0A 4A2BA 2GIQA 3TVZA 3UB5A 2N7CA 2FLPA 5AQYA 1HIYA 2E7XA 1LOTB 2QYGA 4JKEA