3JSMA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
total genus 144
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jsmA05
3QEVA 3NGZA 1S6QA 4MFBA 4E0DA 1XR6A 3V9UA 2D0AA 3ITHA 3SYZA 3AA4A 4MKAA 4CJKA 4K4VA 1RDAA 3ZCMA 3RRGA 3TAPA 1TKTB 3G10A 5J1EA 1LWFB 3L2VA 5KFMA 3CJ0A 3N6NA 3MTKA 3QEPA 4QOZB 4ZVEA 1RDDA 2OPSA 5DG9A 4EBEA 1ZBHA 1IKWA 3LAKA 3I0SB 1HYSA 2I5JB 4PUOB 5DMRA 1FKOA 3P5JA 3H98A 2DPJA 4FZYA 2XGPA 3HSTB 4DTPA 4IRDA 3DLKB 2HMIA 4CEOA 3L8BA 4C8LA 1VSIA 2J6UA 4I9QA 2V4QA 1EETB 1T03B 4YNQA 2O4GA 4FZZA 3KK1A 5JS1A 3PJWA 2XCAA 1A5XA 3DLGA 4O3SA 2D5RA 4DL4A 4JV1A 4DSFA 2D41A 2Q3SA 4CHYA 4NYFA 1JLGA 4CJTA 4FJNA 3SUNA 5DGBA 1RT6A 2FVPA 4XO0A 3VQPA 5CZ1A 1VRTA 3MEEB 3ULDA 1TK8A 1DTQA 2PZSA 3AVJA 4B3OA 2D0CA 2RKIB 2JEFA 3VA0A 4M3ZA 1WSGA 2OPQB 2E6LA 2AWZA 2D3UA 3HP6A 3CWJA 1GOBA 3QGIA 3M9NB 2WB4A 3QNOA 1BGXT 2V9WA 4MK8A 3DRPB 2ITGA 2OA8A 1JLFA 4DSJA 4DSKA 2ZQBA 1RTHA 1YTAA 4K4TA 5C42A 3SI6A 1XI1A 4TY8B 4NCBA 1JXLA 1JX4A 5SWMA 4LH5A 3V6DA 4CJVA 4ICLB 2CJQA 5J2QB 5J2NA 2BE2B 5CYQB 4MIAA 4IQXA 5HRPA 2HWIA 3PVXA 3NF9A 3EPIA 4CEZA 3LP2B 3IGNA 4IOBA 4NYZA 5C25A 4HUEA 4KKOA 5KFOA 2F8TA 1FKOB 4MK7A 3LPTA 4DG1A 1CSJA 5D3GB 3DLKA 5C5JA 4RW4B 5F8HA 1ZBFA 5KFTA 4ELVA 4WE1A 2HVHA 4NLGA 4CEAA 1S0MA 1L5UA 3I5BA 1TP7A 2X6NA 1SUQB 1XR7A 3L3VA 1SUQA 3D28A 5FROA 4HCCA 3KMQA 1KLMA 1SKRA 4O3RA 4CHNA 4CGGA 1TK5A 3OY9A 5HLFB 2R8JA 2JC1A 1S9EB 3ZSQA 4C8NA 4O5BA 3U6FA 5F8GA 1Q9XA 3SFUA 1WSFA 5KFZA 3PO4A 4O3QA 1JLCB 4JRPA 5J2MA 2OPQA 1REVB 3K5LA 4J2EA 3H4BA 4FLVA 3EZ5A 2OPSB 1S10A 3O3FA 2W9AA 2AX0A 1IKVA 3H08A 2BDPA 3L2WA 2R2UA 4DTOA 3HO1A 4JUZA 3HVTA 4O4GA 1QQCA 4RU9A 1HQUB 3SCXA 4AHVA 4IH7A 1UAXA 5KG0A 4K4UA 4NLTA 5KG4A 1N4LA 2V4RA 4FS1A 4BDYA 1WNEA 2R8HA 5L1JA 3RAQA 1RDRA 4M45A 1S1UA 1ZBLA 3KHHA 3AVLA 3CG7A 3KLEA 2G8UA 2P5GA 1TL3A 3CFPA 2IA6A 3RMBA 2W9BA 5I42B 4DF4A 3V1QA 1D5AA 4LSNB 3AVFA 2JC0A 4R5PB 4ZTJA 5HRNA 3NAEA 1KCFA 4C8MA 1HPZB 4JS4A 4RW7B 1LWEB 1LWCA 3OYEA 4I2QA 1TQLA 4CJUA 3K2PA 1X9MA 5KFPA 4J9SA 4B9LA 1BQNA 1S9FA 3GIMA 2AGOA 2V0NA 4Z4FA 1UA1A 1TKZA 1BQMB 2B6AB 3DI6A 1S6PA 1RAJA 1TAQA 3C6UA 5I3UA 4CGHA 3V6DB 1KLMB 2HNZB 4ZVHA 3DRSA 4DSIA 4KV8A 3WNHA 5DQGA 3QEWA 4DWIA 5EDWA 3RWUA 3PW7A 4ZP6A 4W5OA 4CIFA 1Q9YA 3RMDA 3KHLA 3HP9A 1ITGA 3AO2A 3FSIA 4B9SA 3B6PA 3QEIA 3KJVA 3K58A 4HTUA 3VQ4A 4DU1A 2XRIA 3V4IA 4O3NA 3OLBA 3RMAA 1GX6A 4FJXA 3CVKA 1WSEA 4F4KA 3DOKB 4EYHB 3KLHB 5CYMB 4PA1A 4KI6A 3V81A 3C94A 3ZT2A 3V1RA 4E1NA 1C1CB 1JXEA 1D0EA 2HWHA 1HMVA 3ZSWA 4ED1A 4M95A 1BL3A 3QZ7A 1RBUA 3AO1A 4B8CA 3KK1B 1W0HA 4BWMA 4FJ5A 3BGRA 4KREA 4N56A 3GYNA 1ASVA 3QIOA 2VWKA 3H2LA 3HVWA 3DLBA 4ZTFA 5FRMA 3SUQA 4CJEA 4LSNA 3OYKA 1S1TB 3EYZA 1RTDA 5L9XA 4E7HA 4F4ZA 3NHGA 4CJWA 4ZVGA 3TANA 4KHYA 4RW9A 1S6QB 4MFBB 3C6UB 5I3UB 3MFHA 2A1RA 3FFIA 3SFGA 4NLXA 3EZUA 4FW1A 2KW4A 2FVSA 1ASUA 1RT5B 3VQEA 4HHTA 3TI0A 4E1MA 3GIIA 3CFRA 3V9ZA 1RCHA 1HYZA 1VSJA 2ZE2B 4I2PB 3E51A 3QERA 2AGPA 1RT3A 4EO8A 2X74A 4QAGA 1CLQA 2BQ3A 3LP0A 5C24A 5KT3A 1LAVA 4NRTA 4CF0A 4FJLA 4J9MA 1K1SA 4XPCA 2IS3A 2G8WA 4GMJB 4YFUA 2VG7A 3NGYA 3M8QB 4GW6A 4OGCA 4CGFA 3OYMA 1RBTA 4DU3A 2GC8A 2PY5A 3BQ1A 4EYIB 1TKZB 3CDUA 4PQUA 3OSNA 1RT4B 2KZZA 4OPJA 4F4XA 4NLYA 2DFEA 4GC7A 1WAJA 4KHWA 1S1VB 3MEDA 1SV5B 4R8UA 4CESA 4WYWA 1JLEB 4MKBA 2B4JA 2QK9A 5FDLB 3M8RA 1QHTA 2XCPA 4CHOA 1NNDA 5DLFA 4ECZA 5KGWA 1WSIA 3ZT3A 5EU7A 2FLNA 4H4MA 1S1TA 3TQ1A 1MU2B 1C6VA 2AU0A 3AO5A 4KBIA 5KG7A 4N41A 3UIQA 2HW3A 3IRXA 3HKWA 2IBKA 3OHAA 2XI3A 5KFWA 4MK9A 2UUTA 4IG3B 2AGQA 4G1QB 1CXQA 1FK9B 3I5CA 4PWDB 3ASMA 1C0UB 4F3OA 4NLRA 3HM9A 4QWDA 2WTFA 3DRRB 4ED2A 2E4LA 1KVCA 1S1XB 1HNVA 1UA0A 5J2NB 1YTUA 1C0TB 4NZ0A 3F73A 3BSAA 4NCAA 4YR0A 5KT4A 4RW4A 3CIZA 2GUIA 5K14B 4TLRA 4Q8FA 4DQRA 1BQMA 2RDIA 1LV5A 2XY7A 4CK3A 3OYCA 1NHUA 2UVUA 1QSSA 2OPPA 3OL9A 1ASWA 4EEYA 1IKWB 2YHBA 3OYJA 4KV8B 4CF8A 4F4WA 4B9NA 3DLHA 4K4YA 4EBDA 2O5DA 3KLIA 4O44A 5KI6A 3RBEA 2RF2B 5F8NA 3SNNA 1Z26A 1GOCA 1R0AA 3DOLA 4DSEA 1JKHA 4GC6A 4FJGA 1RT1A 2HMIB 4TQSA 1D9FA 4H4MB 3NH2A 1S9EA 1HJRA 1MU2A 2VG6B 3ZT0A 4NRUA 4DL2A 2BANA 1U04A 1TKXB 4FCYA 4FJ8A 3K59A 2B5JA 3OS1A 1SV5A 3DOKA 4HUGA 2VWJA 4E19A 3ALYA 4CK1A 1T05B 2WHOA 1S5JA 3RB0A 1RYRA 2ETJA 1KHWA 4CJ3A 1NK7A 4F3TA 3HPHA 3SQ4A 5DGAA 2NUBA 1X1PA 2GIRA 4H8KA 1IM4A 4LSLB 1C1BB 2IM1A 4KHRA 5KFQA 2FC0A 1B92A 4Z4EA 3MEDB 2EX3A 2D7SA 4MIBA 2Z1JA 5CYMA 4FYDA 3G6VA 3D0PA 1UWBA 2DFHA 1VRTB 5KFHA 1XR5A 5KFGA 3PW5A 3D45A 2IC3A 1RTHB 1RDBA 3KLGB 3HHKA 3TARA 1JLBA 4FLWA 5KT2A 3E01A 3MEEA 2VA2A 3H59A 2PYJA 4ZPBA 4CIGA 3MFIA 2W7PA 4B9TA 3BJYA 1EXQA 4KTZA 4Q8EA 4XPEA 3AO4A 5KG5A 1DLOA 3FQKA 1S0OA 4M3RA 4AH9A 4E7LA 4Z0UA 4K4XA 4O55A 4FK0A 3C6TA 4FM0A 4IR1A 2YNHA 4Y34A 1C1AA 4DF8A 4XIUA 3HJFA 3CFOA 1CZBA 3PW4A 4MQ3A 3CDEA 4HUFA 1S49A 3QYYA 4Y1DA 3PO5A 1SKSA 2JEIA 4NLDA 2W42A 4ZPAA 2X78A 3FFIB 3RB3A 4KAZA 3QEXA 4DFJA 1VSMA 3CJ5A 2XY5A 3JYTA 3KIOA 4G3IA 4NLUA 4JV2A 5CY4A 2ZD1A 3CQ8A 4KO0B 2HHWA 3GV7B 3G0ZA 4F2RA 5D3GA 3BQ0A 1LWFA 3V9SA 1RT3B 2R8KA 3NF8A 1Z25A 4YQWA 3MR3A 1VRUB 3VQSA 3H5XA 4FS2A 1QSLA 1RTJB 1TKDA 2FBYA 3QZ8A 1S9GB 4KFBB 2FVQA 2W8KA 2XGQA 4FK4A 3L2RA 4IDKB 3DLEA 3KLFA 5HLFA 2WONB 3E01B 3H4DA 4OL8A 3QESA 5HBMB 1J54A 1L3VA 4IRKA 1IKYB 1D8YA 3DLGB 4U6PA 3VQ8A 3KLVA 4R8UB 3KLEB 5KG3A 4ELUA 3QGHA 5KFSA 2C2RA 3MECA 4Y1CA 4DLGA 3I5AA 4OVLA 3A2FA 4EP5A 3TAMA 3Q8QB 3G6YA 4E3SA 3S3MA 3L3UA 1N5YB 1JL1A 4W5NA 4FM2A 4NLVA 3OYGA 4FLYA 1WAFA 2F8EX 4J2BA 4CECA 3DYAB 4RW7A 3LZJA 2FLPA 5FRNA 1BI4A 3OYBA 3LALA 3U3YA 1IO2A 3SUOA 4IH6A 1NK6A 3M8PA 4HCBA 1TAUA 3MR5A 2W9BB 3KKSA 5KTQA 3WNGA 2FVRA 3JYTB 3UR0A 4WFYA 4DMNA 1RA7A 4WZMA 4FLUA 1B9FA 4ECRA 1ZETA 3O3GA 3FDSA 3CJ4A 2UVWA 4TY8A 2FBXA 4I2PA 3N6MA 5HRSA 1RILA 4F2SA 2YKMA 5DLGA 3SI8A 4YP3A 4Y2CA 1KLNA 1NK9A 3H5SA 1T94A 4DEZA 3CJ2A 5KFUA 1D1UA 4LH4A 4ID5A 2LSNA 3GIJA 4QWCA 4DS5A 1BHLA 4LY7A 3DM2B 4IR9A 3G6XA 4BDPA 4Q0BA 1N6QB 1X9WA 3NCIA 1SH2A 1NJXA 2IOCA 3V9WA 3I0RB 2F8SA 3TAGA 2XY6A 2R8IA 2B43A 3IS9A 3O4NA 4Q43A 3G86A 1IKVB 2HNZA 3PJXA 3WNEA 2HHXA 1N48A 3AVHA 5F8LA 3GV5B 3KD1E 4NLSA 4KHQA 1QE1B 1QAJA 4ZP8A 3LANA 1NKCA 1HMVB 3TAQA 1NJYA 2HVIA 3LP1A 1NK4A 2YV0X 1SL2A 4O0IA 1LW2B 1IKYA 4J9NA 4ZP7A 5EWFA 5F8JA 2GBZA 4CF1A 3ICLA 4CHZA 1JLGB 3RMCA 3KK3A 2I1RA 3HT3A 3KLHA 2FBVA 4IG3A 1X9SA 2ILZA 3KK3B 4E7JA 5KG1A 1L3UA 3PY8A 4YR3A 2KFNA 4K8ZA 3AO3A 4J9LA 1JXBA 4FJKA 4Z4CA 4JS5A 1RTDB 4Z4IA 1SKWA 3DYAA 3DMJA 1L3TA 5F8MA 5KFEA 4OKEA 4RUAA 5HRRA 2HHQA 3K5NA 3AVGA 3OL6A 2E9ZA 4CJQA 1U45A 2KTQA 1KFSA 4ICLA 2HAIA 2VG5A 2BE2A 5CYQA 4NCGA 1TVRB 3M9OB 5HROB 1TVRA 4ZMMA 4FBUA 4QWAA 5JS2A 4IG0B 4HVJA 1XHZA 2ZE2A 1HARA 3RR7A 2P51A 2WOMB 5KT5A 3AVKA 3MEGA 4M3TA 5EUHA 3I0SA 3DRSB 4ED8A 4KHNA 1S97A 1I3AA 4L8RB 5T7BA 4DQQA 3HVRA 1GOAA 1TGOA 3QLHA 4IFYB 4FJ9A 3QLHB 4ELTA 2WK4A 5HP1A 3KKRA 3S9HA 2Y1JA 3KJVB 3MF5A 3OYLA 1J53A 3KD5E 3RBDA 3IG1A 1RBSA 2FJXA 1WSHA 1N56A 4M94A 2QXFA 2BQUA 4W5TA 1JLEA 2R2SA 3HPGA 4ID1A 4N76A 4IDKA 2X6SA 2CKWA 4ZPDA 4M3UA 4IKFA 3QIDA 1NKEA 2IM0A 4RZRA 5KFJA 3MR2A 3UDLA 4URGA 4WFXA 1S0NA 1LW2A 1IKXA 2BRKA 3PR5B 3C95A 4DTMA 4CFDA 4TSXA 3KHGA 4H4OA 4BE0A 2KZMA 4CJPA 1FKPB 5DK5A 5EWGA 3CM5A 3NE6A 5FDLA 2UVVA 5E41A 3CDWA 3KNAA 1NJWA 1KTQA 3S3OA 3LPUA 3S3NA 2HNDB 3PW0A 1A5VA 3L2QA 5C42B 4DL6A 3VN5A 4CJFA 3RR8A 4K8XA 1HYVA 5HBMA 1S1UB 1RBVA 3MXIA 4KB1A 4TXSA 3DMJB 3RRHA 3SJJA 1S1XA 3JSMA 2ASLA 2FJWA 2BQRA 4MH8A 2YNGA 3OYAA 2YNFB 4WXOA 1SL1A 4J9RA 4CERA 4I7FA 2IMWP 1JLAA 2WCXA 2XHBA 1JLAB 3ZSYA 3MXMA 4NLQA 3NBPA 3SPYA 1TKTA 2Z1IA 4OGEA 3BR9A 1LWCB 1LWEA 4FLZA 2IAJB 3MR6A 2WOMA 3AA3A 4W5RA 2IAJA 3T1AA 3MXJA 3NGDA 3AV9A 3F9KA 5J2QA 1NOZA 4TQRA 2ILYA 3AVMA 2Z1HA 4CJ4A 4KTQA 4LQ3A 2W8LA 4B8AB 3V9XA 3LP2A 3H5UA 4NCGB 3P1GA 3GV8B 2KFZA 4N47A 4DFKA 2R7YA 4WE1B 2B6AA 2R2TA 2UVRA 4OLBA 2E6MA 4TY9A 3U3GA 1GX5A 4IFVA 4KTWA 3K5OA 4UQGA 1WN7A 3VQ5A 4IFVB 4QWEA 3IG1B 4U7CA 1YVFA 2RF2A 2J6TA 1VK0A 1JKHB 5KFKA 1T05A 5KFBA 1U09A 3M8QA 3BSCA 3GQCA 3OVNA 1VSDA 4O44B 4OPKA 2AX1A 2EC0A 2QV6A 2W9CA 5KFLA 3H5YA 5KFXA 3OSPA 2W9CB 4EZ6A 3AVCA 4OKJA 5KFRA 4DTXA 4WYLA 4R0EA 1IKXB 3OYNA 3K5MA 1Q8IA 1NK0A 1T7PA 4Z4HA 3VA3A 1ZBUA 3OYFA 4CCHA 1J5OB 1SL0A 1DTTB 4X2BA 1TL1B 3HVTB 5CZ2A 3DRPA 3IN5A 1ZBIA 3D5MA 3SQ2A 1YVUA 4Q45A 1S1WA 3M8SA 2YKNB 5DQHA 1DTQB 4J9KA 2YHAA 3THVA 1S1WB 2RDJA 1RDCA 2HNYA 1HPZA 4BACA 1C1BA 5F9LA 5DG8A 4IBNA 3AA2A 1RT2A 1WLJA 1SH3A 3PX4A 2OZMA 4W5QA 4G1QA 5C25B 3T5LA 3OYHA 1U49A 4JRQA 4CGJA 2RN2A 3KLGA 2IM3A 1UWBB 4DTNA 4J9QA 3HVAA 4FJ7A 3SUPA 4M3WA 2G8IA 4AHTA 3ZSZA 5KFCA 3VQAA 4C8KA 5J2PA 4RG8A 4CK2A 1LW0A 4I2QB 3KHRA 2J6SA 3DRRA 3NH0A 3OHBA 4ECQA 1OS5A 2IJNA 3O3HA 3NMAA 4M3XA 2FVCA 4WFZA 1ZTWA 3JSMB 3MEGB 3ZSVA 3BDPA 3LWLA 4JV0A 4KHUA 3OYIA 4B9MA 1HYSB 3NFAA 4ID5B 2XC9A 4KO0A 5KFYA 4ECUA 5KGXA 4IKAA 5J1EB 4RUCA 1T03A 5KFFA 1RT4A 1I39A 2EHGA 2O4IA 3HPOA 3PZPA 4RNFA 1T3NA 2BANB 2OPPB 2C28A 1U47A 4PQUB 1LAWA 3ZT1A 4CJLA 3LP3A 3NH1A 4CEFA 4TN2A 1Y97A 4DS4A 4GVMA 1TL1A 4KB0A 4OJRA 3DLRA 2GIQA 1RT6B 2ZKUA 1KVBA 4QW8A 2HHVA 4ECVA 4IFYA 1RT1B 4FJMA 5KFAA 3CO9A 4B3OB 1RNHA 4FLTA 2G8FA 4BWJA 4RNHA 3NAHA 3T19A 2HHSA 5J2MB 1IH7A 4AHRA 4FJHA 1BIZA 1XWLA 1TV6A 3PR4A 4CEEA 1TV6B 1TL3B 5KT7A 4PWDA 3MAQA 1C0UA 4KFBA 1S9GA 2C2DA 4DLEA 2WONA 1N5YA 4CFAA 4ED0A 4IH5A 4DQPA 3VQDA 1S48A 1KVAA 1KRPA 3V6KA 1KSPA 2RKIA 4H54A 5EWEA 3V6HA 4AILC 2PYLA 1U4BA 3TAFA 4TYBA 3T3FA 1O1WA 2G8VA 4ZHRB 2UUWA 3T5KA 4RW8B 2AJQA 1EP4A 1BQNB 3QIPA 3KK2B 2YNIA 1I6JA 4CEDA 3FRZA 1VSLA 1JLQB 3KTQA 3CM6A 1U48A 2OZSA 3RB4A 4ED6A 1VSEA 5F8IA 4KI4A 5KFNA 3I8DA 4FLXA 4B9VA 3GILA 4J9PA 1HQEB 4RNMA 1NJZA 4RW9B 3IGVA 1HNVB 1WSJA 1BI4B 4CJSA 2YKMB 1K6YA 1BCMA 2E9RX 1FXXA 4FVMA 3ZSXA 2IDOA 4NYNA 4CFBA 3ITHB 4AHSA 1R0AB 3KLIB 5HP1B 3DM2A 4ECXA 3IAYA 4DFPA 4DSLA 1RBRA 4B08A 3PX0A 3I0RA 2VG6A 2B5JB 1W9HA 3Q8PB 3IS9B 1JL2A 3ZT4A 5KG6A 2FLLA 1NOYA 1UOCA 1C2PA 4CFCA 4YR2A 4ED3A 3DLEB 3SZ2A 4DQIA 3PHEA 3B6OA 4WXWA 3BQ2A 1RTIB 3BSOA 4KPYA 2P5OA 5L1KA 3CYMA 2AQ4A 3OJSA 1VRUA 4H4OB 4YMEA 2IGIA 3IRXB 4NLWA 1B9DA 5KRSA 4TYAA 4ZHRA 5L1LA 4KE5A 5KFVA 4KRFA 1VSKA 4QWBA 3V81B 2HNDA 3Q8SB 1WNSA 4ECSA 3HL8A 2A1SA 2JGUA 4FK2A 2RPIA 4CIEA 1HRHA 1HQEA 3SQ1A 4CGIA 4FJIA 1J9AA 1C0MA 1VSHA 3BGRB 2YNGB 2R2RA 3VQ9A 4URQU 2W7OA 2E9TA 1BISA 4FXDA 3TAEA 3SV3A 3LAMA 1VSFA 4LD0A 4RW6B 3VQQA 4RW8A 1D9DA 3KK2A 3C6TB 3H40A 5L1IA 1Z4UA 3NBPB 1FK9A 2ASJA 1RA6A 1HNIB 4OKKA 1L3SA 4DL3A 5J2PB 4J9OA 1HNIA 3Q8RB 2IJFA 4KSEB 2JLEA 2XI2A 4FW2A 3HXMA 4K4WA 4KHSA 2XWYA 4EBCA 4Q5VA 4CF2A 4EZ9A 2DY4A 3M8PB 3RTVA 1QUVA 4KKOB 4QCLA 1EP4B 3OL8A 5K14A 3QETA 2BR0A 2VG7B 2BRLA 4QW9A 3TWHA 4RNNA 2YNHB 3RB6A 5HROA 2R8GA 2ZD1B 4J2AA 1RTIA 3UQSA 4CE9A 4URSA 4Y3CA 2IM2A 3OS2A 4O4RA 1S6PB 4DTUA 4FJJA 3TABA 3QINA 3VQ7A 2XY8A 3V4IB 2FBTA 1CXUA 4O3PA 1NHVA 4BE2A 3ISND 3LDSA 1JIHA 3AVBA 3DOLB 4K4ZA 4FZXC 3KLFB 2GV9A 4AHCA 4ECWA 4ZP9A 4O0JA 2Z1GA 5DG7A 1XHXA 3LZIA 1CZ9A 1KHVA 1EETA 1REVA 3NL0A 1KFDA 4LSLA 3T5JA 5F9NA 4WZQA 3WNFA 2C22A 1ZTTA 4F4YA 3NGIA 4DFMA 4RW6A 1EX4A 1DTTA 5JXSA 4HYKA 4M42A 1JLFB 3OYDA 4NLPA 4O4GB 1ZYQA 3NAIA 1A5WA 2IC3B 3TAMB 2ALZA 4KHMA 3DDKA 3N6LA 3V6JA 1RT7A 4DTSA 4B9UA 2D3ZA 4CJ5A 3VQ6A 2HHUA 4C8OA 3NKYA 3QGGA 4QPXA 2D0BA 1RT2B 4DL7A 3LWMA 3QIPB 1K1QA 1G15A 3HYFA 4J2DA 3NF6A 3PX6A 3ISNC 4K4SA 5I42A 3M9MB 4CHPA 1LW0B 4ZVFA 3ZSRA 4DQSA 1W25A 1MMLA 4NLOA 3EY1A 5SZTA 2ATQA 4RNOA 4IRCA 4FBTA 4CEBA 3NDKA 4CF9A 4EP4A 4CHQA 1TK0A 4ZPCA 2YNFA 3UPFA 5KFIA 2G8KA 3OL7A 4M3YA 4I7FB 4FM1A 4DTRA 3ZSOA 1F21A 2XO7A 1NK5A 3T5HA 2YNIB 3PW2A 3SPZA 3KOAA 2QE5A 4BE1A 1IG9A 1RT5A 5KRTA 1BCOA 4K50A 4DTJA 3VQCA 2G8HA 4JLHA 1T8EA 3V1OA 3SV4A 3HK2A 3OJUA 3AVNA 3VQBA 3QNNA 2P1JA 2HHTA 3AA5X 4Q0BB 4PY5A 4OLAA 3LP0B 5C24B 4Z4GA 5JUMA 4ECYA 1S1VA 3KMSA 5KT6A 2DFFA 3O4QA 2HB5A 2ATLA 1BIUA 4PUOA 4I9LA 1XC9A 4CEQA 3PUFA 3LP1B 3BSNA 1QS4A 1N6QA 3PV8A 4BDZA 3NF7A 1NKBA 5KG2A 1JLCA 4E7KA 4E89A 2JEGA 4F8RA 4ED7A 1TKXA 1NK8A 2F96A 2VA3A 4EO6A 2OH2A 4Q44A 1RTJA 2DTUA 3L2UA 1RYSA 2Y1IA 4DL5A 2I5JA 1QAIA 1C1CA 2BGGA 2OPRA 1YT3A 1HQUA 3GIKA 5DQIA 2FJVA 3RAXA 4N5SA 1SH0A 2OPRB 1QE1A 3BREA 3SQ0A 4DU4A 4F50A 1QSYA 3OLAA 3P83D 1EKEA 4ECTA 2JEJA 1S4FA 3TVKA 2QKBA 4O3OA 3FQLA 2VG5B 3MECB 4LQ9A 1FKPA 1DLOB 3K57A 1J5OA 4CGDA 1JLQA 3CJ3A 4E7IA 4KB7A 2QKKA 3AVAA 4DG1B 4M41A 3EPGA 2WRMA 4Y2AA 4AHUA 1QTMA 2C2EA 4CJRA 4R5PA 5T14A 2KQ2A 1JLBB 4IG0A 2YKNA 2ASDA 4HKQA 4KAIA 2DPIA 3AVIA 2OYQA 1RT7B 3OS0A 3QO9A 2HNYB 3DI6B 3TR8A 1C0TA 3QO9B 5KFDA
chains in the Genus database with same CATH superfamily
1S6QA 2L41A 1A7GE 5F3TA 1CPZA 1B0TA 3M1FA 2YXLA 2DNMA 4B9QA 1M5PC 1WHVA 1RDAA 1H2UX 4C1NI 1N32K 1TKTB 1LWFB 3L2VA 1YJTA 5KFMA 4JV5K 3CMAS 4V19X 3Q7CA 2KYZA 3AAPA 3E9LA 2OPSA 5FIIA 3AD9C 2XO6A 3T69A 3G8QA 3NNHA 3FFKB 1FJCA 1HYSA 4WQ4C 2VFSA 1N32J 2FDNA 3H98A 2PC6A 4J5OA 3F9MA 4QIWD 2HMIA 1J27A 5DDPC 1F2GA 2P5VA 3L8BA 4C8LA 2J6UA 1M90O 2NQPA 4H4KA 4YNQA 2QN6B 4FZZA 1YLXA 3Q2TC 2QA2A 1IUJA 4LVOP 4F3MA 3VEWA 5HVHA 1RT6A 5RUBA 1VQPN 3IBCB 4A57A 2EVZA 5CZ1A 3MEEB 3J7Z5 3VEZA 2RKIB 1RWOB 3CCUS 1WSGA 3NLCA 2E6LA 4A8XA 2AWZA 1NEEA 2RHQB 3CWJA 3QGIA 3M9NB 2V7ZA 3MWTA 4NXMJ 2QA4N 2CPXA 3CCTA 4NEYA 1CJKA 1W7WA 2ZQBA 2IRXA 4DV5F 5AJ3K 5LSRA 3ATVA 2E7VA 3QDKA 3EMTA 1WF0A 2FQQB 1LQ9A 1JX4A 4KH0B 1H73A 4BC7A 4YOYA 5SWMA 2RQMA 3V6DA 4FSVA 2FSKA 1HNXK 1JJ2M 2NXNA 3LP2B 1APSA 4IOBA 4KKOA 1FKOB 3FBEA 4DG1A 1PAEX 2H65B 4DR3J 5KFTA 4WE1A 4ILHA 4CEAA 1S57A 2ATCB 4JI1K 1DY3A 4PWWA 2X6NA 1LOTB 4FP9A 3N4WA 2VONA 1JJ2R 3SAHA 3NVMA 2E2QA 1YHQN 2NRWA 4CHNA 2AW0A 4PL8A 3A8IA 1RFQA 3ET6A 1WOSA 2JC1A 1S9EB 2X1AA 2XZWA 3B82A 2MLZA 1I94J 1VFJA 4O5BA 3U6FA 1B3TA 4DR1K 1WSFA 5KFZA 3K5LA 1S6UA 3IM9A 3EZ5A 3VAMA 3TVYA 3GJSB 1ELOA 1HIYA 3HFZB 3L2WA 3ENHA 3HO1A 4JUZA 4RU9A 2F9DA 3DGVA 4K4UA 1NZ8A 1NGGA 4NLTA 2V4RA 1X8DA 4GKJF 4M45A 2P9NA 3C15B 1S1UA 3GLJA 2IFXA 2P9UA 3PFOA 1B0PA 2MJUA 5D4NA 3AVLA 3G4SS 3KLEA 3CG7A 2P5GA 3FR0A 3CFPA 4IYQA 3RMBA 5ETTA 1O0PA 2DIVA 2W9BA 4DF4A 3Q8UA 1D5AA 3GMGA 3AVFA 4R5PB 5AQGA 2Z56B 4RPFA 3NAEA 4IZ9A 4JS4A 2GJFA 4OYZA 2XYPB 1JK9B 5FD1A 1TQLA 5A8WA 5JMNA 3H2VE 4J9SA 2GHPA 2UXCF 1BQNA 2CNOB 1S9FA 4ZVRB 2AGOA 2G2OA 5CQGA 3CCLS 1RWMB 2CPHA 2R42A 4M63C 3M2UA 1TKZA 3CQXA 1NM2A 1DURA 2QL7B 2NSCA 1WC1A 2GX9A 1QQOA 3C6UA 2HSEB 4O5FA 1B7YB 3B6BA 4KV8A 3WNHA 3NGTA 1LNQA 2KRRA 4LRDA 3K9JA 3EEQA 1WDDA 2IDLA 2IPOB 4L6V3 2ITMA 5AE3A 5D77A 3MWPA 1RUSA 2H51B 3R3LA 3K58A 4DX8H 3W61A 1QVGR 3SDEA 4DU1A 4DR4K 3O3LA 2YQ3A 3J80Y 3RMAA 2FXUA 4F4KA 2R7OA 2LEAA 4OYPA 3MOZA 3A4TA 1FE0A 5K5MA 2K7JA 2ASOA 1RKJA 5HK4A 1XUPO 1T44A 5IT9O 2MKJA 4KI6A 4DUZJ 4H0YB 4X4QA 4E1NA 3R1XA 3B8HA 1D0EA 2VPYB 3ZSWA 1RHUB 2KI2A 1H3DA 2CQ4A 2IVYA 1RBUA 4DX5A 4BWMA 4KREA 3BGRA 4DV3J 4RL1A 4F02A 3GYNA 2RB7A 4YDXA 3W3SA 3I31A 1VQNN 2KJVA 2CADA 2R7WA 4IEEA 3TJAA 3OYKA 2LU2A 1S1TB 3PSIA 4PHTX 3AT1B 1RTDA 2A6AA 3NHGA 3CCVN 4ZVGA 2VCPA 3QBCA 2D4WA 3N28A 4OI3A 1NJIT 4OJGA 4P9SA 5AQJA 4NLXA 3EZUA 2DNQA 1G6BA 3MN5A 1IBKK 2KW4A 4NMLA 1S22A 1RT5B 2H1YA 3V9ZA 3BYPA 3CE8A 2LEBA 1HYZA 2ZE2B 2J0QD 3X1LB 4DV5J 4HLBA 2W24A 4EO8A 1U02A 4P75A 1UETA 5C24A 2A10A 2CPFA 3EWGA 2KXFA 1VQKS 2ZH7A 4ZDNA 4BR2A 1OIAA 3CGIA 4OYXA 1FVQA 1HNWF 2HFSA 4YFUA 1ATNA 4GW6A 2MHEA 2A18A 1RBTA 4OLOA 2PY5A 4GRSA 3K2YA 2DEIA 4JB8B 4ANEA 4B3RJ 3CDUA 2WW8A 1RT4B 5FPNA 2KZZA 4D3GA 1SZ2A 1XMOF 4OPJA 2HHHK 4NLYA 2PFFB 1SV5B 2PGCA 4R8UA 4QR2A 1JLEB 1OY8A 2GTDA 2UXCJ 2F8HA 4P7VA 2OELA 3M8RA 3V2UC 1QHTA 4BRIA 2G13A 1VQ7N 4GMKA 4HT5A 2NUHA 3I4PA 1S1TA 2E1AA 4BRNA 3T1YK 3CC2S 2AU0A 3UNGC 2M3DA 2IBKA 4OPAA 2MLYA 2XI3A 4X4TA 4ITSA 3HI0A 2QA4G 1YJ9N 1CXQA 2Q0RA 2BTFA 1IJFB 1FK9B 5C2DA 3AB2B 3DOMA 3OHRA 2BJ7A 4NB4A 4M5HA 2XS7A 4ED5A 2YI1A 4ED2A 1VK8A 3V5RA 2HQGA 1YTUA 1H98A 1REGX 3ZNUA 2ZH8A 4CNZA 2W4CA 1LKZA 2ZBQA 3MM8B 3GG4A 3CJTA 4BRDA 1GNKA 1BLUA 4NYPA 3A5NC 5AQMA 5KT4A 2LDIA 3Q0AA 5K14B 3OXLA 1V9OA 4TLRA 1BQMA 1S7IA 1BO5O 3K0SA 4CK3A 3VWSA 1QSSA 1U6FA 1XNRF 3J7YP 1SCJB 4AXIA 5C2CA 2YHBA 3ENVA 4F4WA 3DLHA 3RYLA 3HULA 3FZBA 4HDHA 3SNNA 3L4IA 1GOCA 1R0AA 4GC6A 2LEPA 2EPIA 2LDYA 3B4DA 2CH5A 4H4MB 4OZ1A 3VAHA 3W0LA 3NH2A 2MKHA 4FWKA 4DL2A 1RDUA 1U04A 2QLXA 1TKXB 4FCYA 1KOOA 1QD1A 2K1RA 2KHCA 3BGLA 2DNKA 3OS1A 1SV5A 3BH7B 2P9IA 3J81j 1UPPA 4E19A 1T05B 1AW0A 1RYRA 5IV3A 3J81U 1KHWA 4CJ3A 4FYVB 1VQLS 1NK7A 1HBNB 2AZ3A 5GAHI 3SQ4A 2NUBA 1X1PA 2WSCC 3OTCA 1IM4A 2V2ZA 2EWHA 2GUPA 3CQYA 2FC0A 3EUNA 1B92A 4CLTA 2JWNA 3SLCA 3MEDB 1R8HA 3U1MA 4FYDA 2GO8A 2XMWA 4PQAA 1HWLA 5G4DA 3D0PA 1UWBA 2DFHA 3A8YA 2GEMA 3PW5A 3D45A 2IC3A 2EFPA 2W01A 4TVAB 1RDBA 1F9HA 4FLWA 5GAEP 3E01A 2NXCA 3MEEA 1KQFB 2PYJA 2DNGA 4DR5F 4ZPBA 1K9MT 4OHXA 5AJ3F 4XPEA 2MQPA 1S0OA 4AH9A 1OH7A 1TUYA 4K4XA 2J9CA 4PG8A 4O55A 1AFJA 5M2UA 3C6TA 1WI6A 2IVOA 4FM0A 2ZH5A 1C1AA 1H6KX 4ZKAA 4DF8A 2NLWA 1QVFM 3TOQA 2ZM6F 3IFEA 3RUBL 4MQ3A 3CXCR 4DR4J 4DOZA 5BR9A 3QYYA 4ZPAA 4KAZA 5HO4A 2XY5A 5ETOA 1H72C 2GFFA 4OJHA 1NGFA 4NLUA 4P2SA 1U0SA 3BGUA 5CY4A 2ZJPL 4KO0B 3GV7B 2CFXA 3BQ0A 1LWFA 1TR0A 5HL7L 2XWXA 1UJ4A 4OIXA 1HHTP 5B0AA 1R59O 1SPBP 4I6MB 3CC7N 1QSLA 2B7BB 3H46O 1Y10A 2BXJA 2BJ1A 1S9GB 2FVQA 1KR4A 2XGQA 2BW7A 3IKMA 3DLEA 1GMVA 3KLFA 1NGEA 4OX7A 1R0CB 3E01B 2J8AA 4OL8A 2FHOB 5HBMB 2OAUA 4QU7A 1IKYB 3VAFA 1SVDA 4ILLA 4U6PA 7FDRA 3C2PA 3C14A 2FB0A 4H0OA 3WXJA 3NGRA 4OVLA 5CR4A 3A2FA 2UU9F 3TAMA 1MWZA 4G9ZA 2MZTA 3CJKB 3OYGA 4DMZA 2C3UA 4OLPA 1WAFA 4DUTA 1YRUA 4RW7A 2FLPA 5FRNA 1O13A 3U3YA 3R1LA 1TYQB 2V2VA 1TAUA 2W9BB 5KTQA 1ATSA 4CM0A 4CO1A 3L3CA 1IWGA 1HWUA 1B0VA 4ALZA 2XS2A 3ZFVA 2DCLA 2UVWA 3KNGA 5IQ6A 2DISA 4BR4A 5HRSA 1RILA 2QMWA 4EI2A 1FEEA 3HJVA 3AH6A 5H9EK 4Y2CA 4RWTA 1WG5A 5KFUA 4A8KA 4WF9L 3EE3A 3G71N 2OP5A 3GIJA 4X4PA 3MTJA 4NEZA 1E6YA 3K89A 4LFCK 3NOGA 4IR9A 1Q95G 2Z2LA 1UVLA 4Q0BA 2XYGB 3CCRS 1NJXA 3PFEA 4ZCLA 1NMEB 2PIIA 1WG1A 2E5LJ 1YG0A 4FPBA 4EFHA 3IS9A 3FK4A 4Q43A 3G86A 1VIOA 4C11A 1JXVA 1V5VA 4DPXA 2VODA 3T6BA 3WNEA 1Y4ZB 2F63A 4LMZA 3LANA 1URRA 1NKCA 5AE1A 1WDTA 4IQMA 2XNQA 1SL2A 2ZM6J 2C2KB 1MWKA 1IKYA 3QQCD 4ZP7A 5EWFA 5F8JA 4CF1A 3ICLA 2DT9A 1UCNA 2ZNYA 4A46A 3KK3A 2I1RA 3KLHA 4IG3A 3KK3B 4OYWA 5KG1A 1L3UA 3PY8A 2RHKA 3WUHA 3RGIA 1WKJA 1RGVA 1NHKL 3C0BA 4K8ZA 3AO3A 2OTJS 1LCUA 2XHCA 5A8RB 2N3LA 3IBWA 4CYUA 5F8MA 1EKSA 2W4PA 2KTQA 4CJQA 1CULB 2DGUA 1KFSA 5CYQA 3KHYA 2UXBJ 1R8PA 1TVRA 5JS2A 1BDGA 8ATCB 2A6MA 4JI8K 3JTNA 3WT0A 2YWFA 3UDEA 4BCAA 1UTAA 1J5EJ 1UAWA 3J7ZT 4FWMA 4CBWA 1VC0A 3O44A 3TTCA 3MD1A 5D0RA 1WKKA 2XM3A 5EUHA 5ITHA 4KHNA 1I3AA 2HGMA 4FZVA 1TGOA 3QLHA 4ZN1A 2PO4A 3QLHB 4F7VA 4Y0FA 2Y1JA 5GADP 3OTBA 1SAZA 3ZX2A 3RBDA 3IG1A 2WVEA 3JTPA 2R7TA 4DR4F 2V34A 2N7CA 4MAKA 2WZ1A 2R2SA 4DR6K 3OUYA 2J0SD 3MMJA 4EHTA 4IKFA 3QIDA 1NKEA 4IDHA 4RZRA 2RIJA 1TUUA 2BOAA 2QFIA 1RHKB 3D4JA 2HBMA 1GTHA 2ZDPA 3PR5B 1X4CA 4CFDA 1Q5VA 1T3OA 1IVZA 4MDBA 3CM5A 4PG5A 1DEJA 1YVNA 3KNAA 1VQKN 2OTLS 4WK1A 3PEJA 3WZ0A 2O1PA 1Q86O 4CJFA 2XTJP 3RR8A 4DR3K 2A2CA 4JKEA 4KB1A 2XLIA 2NXJA 2BQRA 4MH8A 1HR0J 1AYEA 5CCMA 1ZBSA 2VPXB 2WCXA 3TUPA 4CO3A 2E2PA 3SPYA 3ZX0A 2Y0SD 5HJYA 2UU9J 1XMQJ 2Z1IA 1RAGB 5GAGI 2J7KA 4YB1P 1K9MO 1LWCB 2EFGA 1EAYC 2FGCA 3MR6A 2Q3PA 1OKJA 4W5RA 3G6ES 2ROEA 3EGVA 3FGUA 3MXJA 2AIRB 4DV6J 3NGDA 1XJWB 4M5DA 5J2QA 2ILYA 3US5A 3RSEA 4KTQA 4LQ3A 3CCES 4BGBA 3H5UA 4FVUA 1G2EA 4NCGB 3CUNA 3P1GA 4DV2K 4IOCQ 3H3NO 4N47A 4DFKA 3FEZA 3A8EA 2E6MA 4TY9A 3U3GA 2IIHA 4JI8F 3IG1B 1QY7A 4PWUA 3THTA 2CVIA 1YVFA 4E2FB 5D4OA 5IT4A 3M8QA 3GQCA 4X65K 5GADU 4OPKA 4XTTA 1Y3KA 2VBZA 2RDDA 2DHSA 3A8KA 2M0GB 3FBBA 4WYLA 4B1UB 2KG0A 2LXFA 4R0EA 3K5MA 3OYNA 1Q8IA 3NGSA 3VA3A 1WEYA 2AEFA 4WFBQ 3OYFA 1HBMB 1TL1B 3HVTB 1TUVA 3VESA 1HLUA 2OHDA 1Q7LB 3THXA 3HHEA 3IWNC 1WBDA 3Q83A 2VASA 3SQ2A 4Q45A 4KHPK 3GIRA 2YKNB 4R79A 2N82B 2RDJA 3MM9B 3CPWR 5ADZA 1VQ7S 4IBNA 2E7XA 2CQ0A 2ZHBA 4CBUA 3OYHA 2W1BA 2YWEA 3CC4S 2RU3A 3THWB 1GXUA 4FJ7A 4M3WA 2G8IA 1GLCG 1LW0A 4LFAF 2J6SA 1NGBA 3BO4A 3OHBA 3MEGB 5JLHA 4G65A 1KEKA 1KOHA 3LWLA 2KFYA 3QWPA 3CJQA 4WYBA 3ZZYA 3UN3A 2XC9A 3PIPL 4ECUA 2N3OA 3UW1A 2EXUA 2GVZB 4I69A 3UDVA 2FJDB 1I39A 2ZF5O 4RCHA 3L7UA 3VF0B 3M30A 1T3NA 3Q7BA 1LAWA 1W2BR 3M32B 4OJRA 1KVBA 4QW8A 4K42A 2HHVA 2X1BA 4LT6A 1X5SA 4ECVA 1S5ZA 1BWEA 4FJMA 1F9EB 4B3OB 1FRKA 4X4OA 1XMQF 4BHQA 2PBDA 1PJ5A 5H9FK 1P6TA 2V68A 2ERRA 4AHRA 1BIZA 2EG1A 3HHDA 4M5LA 1V3SA 4KH5A 1TV6B 1UP1A 4KFBA 2C2DA 4JI2F 2PFDA 1N5YA 1P9QC 3W7BA 4CFAA 1KVAA 1KRPA 3CMES 2RKIA 4OI0A 4C2MA 4H54A 3AGRA 2U2FA 3V6HA 2PYLA 2B4OA 4NXNF 3TAFA 3T3FA 3QJJA 2G8VA 2ZBCA 2UUWA 3D2FA 4NXNK 2QTDA 3FGVA 1WC3A 3GP9A 3POTB 1ZXOA 4ED6A 1VSEA 3PACA 5KFNA 3I8DA 4H0PA 3GILA 1UVJA 5A2QY 4RUBA 4A8FA 4LF8K 1Z1ZA 1PYSB 1U2VB 1NJZA 4B3TF 3IGVA 4KHPF 1HNVB 3AXMA 3M6GA 2EBGA 1X4HA 4WPAA 2JZ5A 2CA9A 1BCMA 2E9RX 1N33K 1SJFA 4LBHA 2FJAB 3MMAB 5GAHP 3QATA 3PKYA 2WSEC 2GV1A 3QGPA 3DM2A 2MZSA 4DFPA 1GLFO 2IY5B 3RRKA 4ZCKA 2DGWA 1Q8BA 3TX0A 3I0RA 4UY85 1NH8A 2B5JB 4CRJA 2DGVA 1K0TA 5AXKA 2CAJA 1NOYA 1LK5A 2NRXA 1VQYA 4L3NA 2RE1A 1T9UA 4ANDA 4YR2A 4KT0C 2M4MA 2IYIA 4WXWA 5BR8K 3BZKA 1MROB 3CCEN 5GAHU 4FPAA 5IS2A 4I6YA 4DV1F 2HQ3A 3OJSA 1FXDA 4H4OB 5EOYA 2VICA 5LMUF 2ZZNA 2IGIA 4NLWA 1U1PA 1SJ1A 2D74B 2QGFB 2YH1A 1O51A 5E84A 4KE5A 5KFVA 4G6VB 2ZUGA 1WNSA 2L08A 5E2QA 4FK2A 2RPIA 1NGCA 2WFBA 2R7XA 2P9NB 3GR1A 1HQEA 3UKRB 4FJIA 2YNGB 3G6EN 2E9TA 2GX8A 4FXDA 2YQ0A 3TAEA 2BW2A 1GFWB 3BYRA 3LAMA 3SV3A 4H0TB 2EK6A 4RW6B 3KK2A 4BBYA 4BROA 3NBPB 1JNZB 5M1QA 3DCAA 4U9RA 1H7WA 1WOOA 1T3VA 3R6GB 1L3SA 1OWXA 2XI2A 4UF4A 3UVJB 4K4WA 1BU6O 2ZEJA 4CF2A 4EZ9A 1F0XA 3J8AA 3M8PB 2AHOB 2KT3A 4RTFD 2MGZB 1K73T 1CC8A 4RNNA 2YNHB 5HROA 4J2AA 1RTIA 3UQSA 2B4VA 1MROA 2QYGA 4B3TK 5M1FA 4GO5X 4DL0C 1JIHA 1CZAN 4F9OA 3AVBA 3MK6A 3DOLB 2DR7A 4PKIA 1J5EK 4OZ0A 2GV9A 3CIPA 1HBNA 2BX6A 4LF5F 3BV8A 4O0JA 2Z1GA 2KL8A 1NU4A 4FOIA 1CZ9A 4YUDA 3NL0A 3W63A 3T5JA 2NRZA 1K73O 3OXFA 3AQOA 4RW6A 4A62A 2GELA 4X62F 4M42A 1JLFB 2Q0UA 3MR7A 2YJFA 2IC3B 4KHMA 5CD4H 2K8GA 4CQ1A 3ENOA 3UNYA 4HTLA 3UKRA 1YITS 1UVNA 1U2RA 1HPMA 4JK9A 4XAKA 3NKYA 1JB0C 1U1QA 1AXQA 1K1QA 1G15A 2GNKA 4A8QA 2ZJRL 2CQGA 1CJKB 5I42A 1XBWA 1N54B 1PAUB 5SZTA 2CQ1A 2XS5A 2CWKA 4JNEA 3PHTA 1RAIB 4CF9A 4DV1J 4CHQA 4ZPCA 3AA8A 4LVNP 4ZLPA 2K06A 3OBYA 4M3YA 5BPMA 3LDQA 2XO7A 2YNIB 1HI0P 3PW2A 3VEYA 3KOAA 2QE5A 4DTJA 4K50A 3P38A 4H5TA 4WTYA 1QUPA 1DBDA 3AVNA 3VQBA 3EE9A 2P1JA 3WIVA 2FC8A 2JWLA 2HHTA 1BQXA 4QYZK 1FRMA 3W1YC 5C24B 1DKGD 4ECYA 4QR1A 3SSQA 4RWWA 3O4QA 3HHLA 2HB5A 4BLGA 3UO0A 3UD4P 1BIUA 3KDNA 2A3JA 3ET6B 1VQPS 5F0XA 4Y2MA 2GHWA 5C12A 1JLCA 2JEGA 4EIAA 2F96A 1RTJA 5L38A 5H1SQ 1RYSA 3O9SA 4AT1B 2OCEA 2HRTA 1QAIA 1NBWA 2OPRA 4ZITA 4V19J 2BACA 3BREA 1HHSA 3G82B 2JLGA 1QSYA 4CVNE 1KWMA 2B8QA 3I55N 2MSSA 3ZETA 4ECTA 1S4FA 1BA0A 3TVKA 3SXLA 3FQLA 4ISEA 1ZAVA 3RW7A 2DO4A 2MYFA 4KB7A 3EE8A 3LPEA 3EPGA 1WHWA 3CI5A 2CQBA 4CJRA 1W2IA 3KJQB 4BRGA 4IG0A 2YKNA 2DR5A 4HKQA 1X4GA 3EDRB 2VH7A 2HNYB 3DI6B 1C0TA 4J91A 5AQRA 3QEVA 3MM7A 3M6VA 4CZGA 3MMCB 4K59A 2D0AA 3CJBA 3ITHA 3SYZA 4ZVQB 3AA4A 3O08A 4CJKA 4K4VA 3DNCA 4QQBA 5IT9Y 3C7NB 2GW8A 3S41A 2YVSA 3O8WA 4ZVEA 1RDDA 1WG4A 2B4UA 1IKWA 3H45C 3LAKA 1X4EA 2OD4A 1WUUA 4XEIA 2D69A 3ULHA 2LYVA 3UR3C 4PYAA 5DMRA 3P5JA 1Q7YT 1QTNB 3HSTB 4DTPA 4IRDA 3AARA 3BO3A 1VSIA 2M5YA 3R5CA 4A47A 1BUPA 1EETB 3CETA 5JMVA 1KN6A 3B4MA 2V8GA 5CHCB 3NP5A 3PJWA 2XCAA 2DGSA 3QFUA 1T95A 4WIQA 3DLGA 1EKRA 4NYFA 1JLGA 1GQEA 4FWNA 4FJNA 1FXLA 3A8JA 4MLEA 1G4CA 1NPRA 4XO0A 1VRTA 1WC4A 3MX2A 2Z30B 1TK8A 2ZOMA 1HWIA 4IOAL 3M4XA 2CPYA 3CCWA 4M3ZA 4P72A 2HLTA 2R7QA 3FCHA 3UI3A 2E44A 2D3UA 8RUCA 2WB4A 4FWOA 1UW9A 1QLNA 5E3CA 3NOCA 4C8ZA 3O8MA 2ITGA 1NDCA 2YY3A 1XK8A 1YTAA 4K4TA 1LXNA 5EX3A 5C42A 2YKQA 3G2XA 4TY8B 1CLFA 1JXLA 2YWHA 3FZMA 3I32A 4ILMA 4Q7AA 4CJVA 3AAQA 4ICLB 4HT7A 3RBZA 5J2QB 1KTVA 2BE2B 3UCUP 4MIAA 4IQXA 3SMSA 3PVXA 3NF9A 3IGNA 5KFOA 2F8TA 3D2WA 5D3GB 2PT0A 1NLVA 3DLKA 3QMQA 5C5JA 3SCIE 1ZBFA 1MNEA 2QX0A 2HVHA 1S0MA 2OANA 1SUQB 3TUIC 1U2VA 1SUQA 2YWGA 3D68A 3D28A 4AL6A 1TL4A 2BJEA 4CH0S 1KLMA 5THWA 4AL5A 4FNIA 1Z2ZA 4YDUC 4FXVA 5BPNA 2XLKA 1IG8A 2HIQA 4ZIVA 3NWRA 2IVFB 2BA9A 1YUWA 4CZHA 2VU5A 2R8JA 5J1PA 1NGDA 5LSLA 3ZSQA 3R5BA 2DNLA 2ZH4A 2JL9A 5DDOC 4FWPA 1NJIO 4JRPA 4J2EA 2V9KA 1S10A 2W9AA 1IKVA 3H08A 2R2UA 2QLFB 3HVTA 3IAS9 1NGJA 4RKUC 1FRLA 5KG0A 5B0FA 3ONQA 1N4LA 1WNEA 2R8HA 3OFFA 2BE9B 5L1JA 2GMJA 1JQGA 2CGJA 4DB3A 1P8GA 4DI6A 1ZBLA 3KHHA 1DFDA 2CJ9A 2IA6A 4AFFA 1OYEA 2HBYB 4USWA 3SEOA 3MI7X 1ZAWA 1YK9A 4ZTJA 2I6WA 3TZWA 4EWTA 1OY9A 1KCFA 1HPZB 4BRAA 1LWCA 4JKDA 2X1FA 4DUYK 3NMUA 3ZZTA 4USMA 3M7VA 2V63A 3BBBA 3C8YA 2GZOA 3K2PA 4KBOA 2M8DB 5KFPA 1TMJA 1NDLA 1RKIA 2NLXA 3F56A 4NL5A 3GIMA 1VOMA 4Z4FA 3POTA 4PXBA 4ZLLA 2HSTA 1UA1A 5JICA 4USKA 1BQMB 6FDRA 4X66J 4J7CA 3UVJA 4B3SF 1GMWD 3G25A 3DRSA 4DSIA 2R3VA 4DWIA 1JJHA 4ZP6A 2MMYA 1YDLA 1WC0A 2NPFA 1Q9YA 4CIOA 3KHLA 2X3DA 2W7AA 1H1VA 3B6PA 4UTGA 4OV1A 4HTUA 3PYGA 2XBPA 4QBUA 5K20B 4LFBJ 1ACMB 3E8OA 3OLBA 2FD2A 2CWXA 3TVZA 1GX6A 4CW7B 3CVKA 1WSEA 4JKAA 3KG4A 2IBOA 2LP4A 3DOKB 3D7EO 3KZBA 1ESVA 3UWTA 1MN7A 5M2PA 4PABA 4H5RA 3VQTA 2HAFA 2LFVA 2BUPA 4O8UA 3RG6A 3PCOB 4B8CA 1TMMA 4N56A 2RRAA 3I4HX 2HIYA 2FY1A 1ASVA 3JAMY 5B0DA 4TU7A 5F0UA 3MWBA 4ZPVR 3W8GA 1RWXB 4ZTFA 5FRMA 3VTIA 1XNRK 5L9XA 4E7HA 5LMNJ 1NSKL 4OZJA 1Q81O 2E7WA 3TANA 5LJ5Y 4RW9A 1S6QB 3KJFB 3SSRA 4PG7A 3FFIA 4DR7J 4GV6A 2BUNA 3SQOP 2LQJA 6FD1A 2QM1A 2FVSA 1KAYA 1OH6A 2HZAA 2P9PB 5AQKA 3TI0A 1UVKA 1FJGF 3CFRA 3ZTOA 1RCHA 3TZYA 3J80O 1DQAA 1Y00A 4I2PB 5AQPA 5HMWA 3QERA 1RT3A 2X74A 3SCJE 1OVQA 2O8CA 1PSDA 5KT3A 3WQTA 4NRTA 4CI6A 3E1YA 3AJ1A 3VEOA 5C0YA 1P27B 2RUGA 1Y7PA 5ETPA 4J9MA 4HHJA 4A8OA 4GMJB 4OGCA 3T1HF 3BF3A 4L3KA 1P90A 2CRLA 3R5DA 2LKZA 1ZZNA 4OPHA 4PQUA 3OSNA 5FJ4A 1V5IB 1FVSA 4RBUA 4PG4A 2DFEA 4GC7A 1WAJA 1S1VB 1MMNA 4CZMA 4WYWA 1FW6A 1HLWA 4MLHA 4CHOA 1NNDA 5DLFA 3W5XA 2AP1A 2Y3YA 1HBUB 4PZVA 5AFUA 2V51B 2FLNA 3CJKA 1MU2B 1RWNB 3AO5A 2H3EB 4B3RF 3UIQA 2HW3A 3IRXA 3HKWA 4ZIWA 2WUSA 1RAAB 4MDAA 2AGQA 4BY9C 4G1QB 1HKAA 3SMZA 3QAEA 3I5CA 2Q36A 2B3TB 5ETLA 4JI4K 3ASMA 4X4NA 3HHLC 5GIOA 7FD1A 3DRRB 3I9V9 1IBCB 1KVCA 1HNVA 1UA0A 2DR6A 1F3VA 3OTDA 2H5EA 1OJ4A 3VALA 5CD4A 2IYGA 4Y2KA 4YR0A 3UCGA 4KGXB 4YY3F 4RW4A 2GUIA 3QNWB 2RQ4A 2B56A 4C48A 4OHVA 2PDAA 4LREA 3OYCA 2G2YA 4CM2A 1PCAA 1YRTA 3MM7B 2WBMA 3CEDA 1ASWA 1HA1A 3OYJA 4KV8B 2ADCA 1TUGB 1OQ6A 4K4YA 3QJPA 4JV5F 3KLIA 1Q8KA 3RBEA 5KI6A 2RF2B 4DSEA 2DH7A 3W9HA 1RT1A 4YHHJ 3DAWA 5DO2A 3N5BA 1FKAF 4CI0B 3ISZA 4GKKF 4O8KA 3PIPQ 3R7NB 2QA1A 1S9EA 4YEAA 1MU2A 1FJGK 2VG6B 4ZK7M 4NRUA 2BANA 4RO0A 1RWPB 1M1KT 4HUGA 1VQ8N 1FTRA 2CQCA 3GZ7A 1YGYA 2NS1B 3ALYA 3JXOA 2CJKA 1AT1B 3RB0A 3LDNA 4ISGA 2Z2YB 1OMSA 3O4WA 1S3XA 3HPHA 1CQMA 5GMDA 2RHSB 5AXLA 5AQWA 2V67A 1ROFA 4KHRA 5IM0A 3LOUA 4CZIA 4PYDA 4LFBF 4Z4EA 4LRCA 4MIBA 2Z1JA 2OTJN 5CYMA 3QFHA 2YWWA 3VETA 1VBKA 2MTLA 3QSYB 5KFGA 1Q53A 2OEMA 2N4DA 3KLGB 2VFRA 3FC9A 1T9YA 4CIGA 2W7PA 1I94F 4B9TA 4CYUB 1SKUB 3CSKA 4Q8EA 1M5HA 3MXHP 1YJUA 1DLOA 3TTFA 4M3RA 4E7LA 1OSCA 1Q16B 1RABB 2O3DA 3MCSA 4Z0UA 4FK0A 4CT8A 1N88A 3L09A 1N5VA 2KXNB 2BVZA 2YNHA 1FCAA 2KRBA 1KAXA 2I2YA 3HJFA 1NCLA 4LBPA 3W8PA 4JP8A 1GLDG 2X78A 3RB3A 4J9VA 3QEXA 3CCRN 3CJ5A 2EEYA 1F1BB 3JYTA 4G3IA 2RS8A 4JD2A 1N52B 2QYCA 3UD3P 4JV2A 4OX8A 2ZNZA 2IVPA 4BQLA 3MR3A 3M30B 1VRUB 2ZFHA 1VQ9N 3H5XA 4NASA 2ASYA 4IJAA 3R6MA 3W66A 1RTJB 3QZ8A 2NZTA 4NXMK 3L2RA 3R5JB 4IDKB 3VV2B 4F3QA 5BYSA 3HD1A 3BKUA 5HLFA 3KWGA 1B4SA 3H4DA 1VBYA 1X5OA 4IRKA 3OT9A 4JI2K 3MX5A 4X64F 3DLGB 2E29A 4LF7K 3HKZD 3KLVA 4JI7K 5EHHA 4R8UB 3KLEB 4C3MA 4ELUA 3QGHA 4GKJK 3MECA 4Y1CA 2P9IB 1I5OB 3JB9k 3UKUA 2J4RA 1R27B 1Z2LA 3U1LA 3T1HK 3Q8QB 2W6KA 3G6YA 4E3SA 3S3MA 3L3UA 3M6UA 2YHWA 1N5YB 5GMEA 4YHHF 1KVJA 3C19A 2DYAA 2Q6BA 1DQ9A 2P9SB 2F8EX 1VQ6S 3DYAB 1XMQK 3GU0A 2EKNA 4LRBA 5E0OA 1IO2A 3GYXB 5D0HA 1NK6A 4CO0A 4HCBA 3MR5A 2KKHA 5LJ3Y 3HFVA 2LA4A 2FVRA 3AD8C 4WFYA 1KNZA 4U7UK 4DMNA 4FLUA 2ZOGA 3K8WA 4YOTA 3FKBA 1TU0B 3I9ZA 4TY8A 3ENWA 2NRHA 4JAXA 4LIRA 4M5MA 3N6MA 5D0GA 5FLXY 3BR8A 4F2SA 3SI8A 2MEWA 3C6HA 1KLNA 3WXKA 1X60A 4B02A 4DEZA 2W2OP 4LH4A 2C2ZB 2LSNA 3F2KA 1SJ3P 3FCVA 1HKCA 2XMUA 4DS5A 1BHLA 2ZZMA 4ATNA 4DV7F 4AE5A 1R8CA 4BDPA 2BZ2A 1BA1A 4MO4A 2PAVA 4QS8A 4DQ8A 2QWLA 3CC7S 3I0RB 2F8SA 2DGXA 3TAGA 2EFNA 3CDBA 2CJYB 2JHEA 2B43A 3O9TA 1CJTA 1IKVB 1EIYB 4NYOA 1RBAA 2HNZA 3WX4A 5B0EA 2HHXA 3GYGA 3KD1E 3TNVA 4RLEA 4KHQA 2UUCK 4B1WB 1IBLF 4DZDA 1QAJA 3P96A 4ZP8A 1NJYA 4B3TJ 1NBEB 1FRHA 3PRDA 2YV0X 5HVGA 2QWPA 4B3MF 2QFJA 4CHZA 5M1OA 3K7RA 3HT3A 4MYTA 1SS6A 1UZDA 3G8TA 2HBQB 2P9EA 4J9LA 1JXBA 3BGFA 4Z4CA 1F5AA 1RTDB 4ZPTR 1SKWA 2VWBA 3DYAA 2F9TA 3DMJA 3BKTA 3U4LA 2HHQA 3OL6A 5M1NA 3MCPA 4OMFG 2VG5A 2BE2A 4GO7X 4NCGA 3MAAB 1ZM4A 3M9OB 3NNCA 3BS9A 3DKDA 3MAAA 4FBUA 3G9CA 1NB7A 1HX1A 2I8EA 4A8WA 2WOMB 5KT5A 4MJKA 4A8SA 2FZKB 1IBMJ 2MB0B 1V4SA 1RWKB 3E2EA 3MEGA 4M3TA 1X5PA 4ED8A 5SUHA 4DQQA 3GOIA 1GOAA 2ZBRA 3I56N 2WK4A 3S9HA 1XNQK 5CAAA 5L46A 3KD5E 1W97L 3GJRB 2YCHA 1WSHA 1Z6RA 4M94A 2QXFA 1SQKA 1CC7A 2E5HA 4MKVA 1V3ZA 4ZPWR 3T1YJ 4W5TA 1JLEA 3HPGA 1U2FA 1FDDA 4U8VA 4N76A 1EQMA 3CB4A 3J7AN 2UUAK 3R27A 5KFJA 3UDLA 2HRUA 3KJNB 4PL7A 4KGZB 4URGA 4WFXA 4DTMA 3C95A 2JFKA 1DJ0A 2ZHOA 4H4OA 4BE0A 2KZMA 4CJPA 1FKPB 4LF6F 1JCEA 2FIUA 3THWA 2UUAJ 4FKXA 3NRBA 4OO1J 4UW2A 4A2AA 1A5VA 2QEXS 2KLAA 2K7KA 2BM1A 3VN5A 4U8YA 4EAHD 3ZZPA 2IDEA 1S1UB 3VZIA 1JCFA 3CCMS 4TXSA 2KHOA 3DMJB 1LEOA 1OO0B 3O6WA 3PYEA 4WP3A 2ASLA 4CBXA 3CJ8A 4ZLNA 2FJWA 1BMQB 2E8AA 4PPDA 4I7FA 3BEGB 5AQFA 4DV6K 2UXDJ 1JLAA 4F26A 5T41A 3VAJA 1JLAB 2F4FA 4DPYA 3ZYYX 3NBPA 1NGAA 2H4WB 3BR9A 4PEOA 3L7PA 2WOMA 4X4VA 4DN0A 3DFEA 3ELHA 4JI7F 3T1AA 4DPOA 1GMUA 4Z7CA 4KPCA 3AV9A 1PG5B 3F9KA 3MUTP 3AVMA 1GH8A 4CJ4A 2W8LA 2XNRA 5EX5A 2Z2MA 4CLUA 3SQGA 1FNMA 3HM8A 3LDOA 1HD1A 4WE1B 2B6AA 2R2TA 2WVCA 1YWXA 2UVRA 3H25A 3K8VA 4IFVA 4KTWA 2E5JA 3W5YA 2QG9B 2HFNA 5A0YB 4QWEA 5KPTA 4NZ7A 1FD2A 2CGKA 2RF2A 2P9KB 4DPUA 1JKHB 2R7RA 4LBIA 5KFKA 3UE5A 4FF4A 5KFBA 2IJRA 5EN1A 2NYHA 2P9LA 3H5YA 1VQ8S 3LTOA 2DH8A 5HQ8A 2YKAA 3Q86A 1IKXB 1T7PA 4Z4HA 4W98A 3DN9A 4IXCA 4ZS6A 1IBMF 1OSDA 2X51A 1J5OB 1SL0A 4I1TA 4ED4A 4X2BA 2HKEA 3IUCA 3IN5A 1YVUA 1NNEA 3M8SA 1S1WA 2BMBA 5DQHA 1ZAXA 2ZITA 1Q8LA 1X4BA 5CZVA 3QBWA 4FOEA 3OVBA 2VGMA 1SH3A 3HI9A 5BRHA 4C4WA 5EXWA 4W5QA 4G1QA 4B3MJ 3W62A 1U49A 2RN2A 3JS6A 1Y3JA 3R3TA 3AQPA 3HVAA 3ADAC 3ZSZA 4C8KA 3T7ZA 3VQAA 4RG8A 4CK2A 3KHRA 3CJ7A 2VDIA 2IJNA 3O3HA 2KXHA 1AUDA 2P6SA 2FVCA 5A0YA 3HHNB 1KKHA 2HHPA 1VHXA 2EG2A 5AE2A 2PSZA 2DRBA 3VCDA 3OYIA 2MDAA 1HYSB 3NFAA 2DNZA 4LF9F 4RBTA 4KYZA 5KFYA 2IHR1 3TSPA 2IRYA 2DHAA 2EHGA 1SBRA 3HPOA 3PZPA 4I64A 5JVHL 1RK8A 2GJIA 2ZH3A 2BANB 3FBCA 2HK3A 2POKA 3CJCA 3ZTSA 1YIJS 4DS4A 1Y97A 1RT6B 2GHVC 2Q1LA 3J7YI 5HQMA 1VGYA 4IFYA 1LFWA 1LK7A 3R8EA 5HSPA 3VGTA 1T02A 4BWJA 4RNHA 3T19A 4CO4A 1Y0HA 3F5TA 4ISFA 3HOTA 5J2MB 2EWSA 3TYTA 3LQVA 2AJ2A 2APOA 1FRXA 2O66A 4CEEA 4USIA 1SXLA 2VFVA 3TO8A 2E2NA 1TL3B 3CO0P 2L48A 4PWDA 3MAQA 3TA0A 2LXUA 1IQZA 3EKSA 2O8FB 4M7XA 2AYGA 1F5BA 1PJ7A 4F4AA 4ED0A 4LF7F 4IH5A 3VQDA 1S48A 3VOVA 1KSPA 3I96A 1KS2A 3PSFA 3QBXA 5MAOA 3HDSA 8AT1B 2V8HA 2XSJB 4AILC 5GAGP 1IBMK 1ZBTA 2GQ2A 2YX4A 4JK8A 4TYBA 2I7PA 1O1WA 2AJQA 1S4EA 5JVGL 2QMXA 1I6JA 4WQ4A 1FDNA 3KTQA 2OZSA 4FLXA 2C2NA 2UUAF 1FRIA 3JQKA 4J9PA 1EQ0A 1Q82O 5EX0A 4RNMA 1FX2A 2HQCA 2ROGA 1VQON 2ZZTA 1M5VC 3U9DA 5FLXU 5A8WB 4CJSA 1KC8O 2YKMB 1FXXA 1J6ZA 4FVMA 4DR1J 3ZSXA 1HI1A 3ETMA 2Y1LB 1XEZA 1U1RA 3HLUA 5CA5A 2DNNA 1RE1B 3GCWP 2QTWA 4M7YA 2ZDOA 2UV8A 2HZCA 1NWKA 5BJRA 1FO1A 4NZ6A 1YX2A 2OTLN 2VG6A 2RU9A 1W9HA 3Q8PB 1SI9A 1UFLA 4JI7J 1N0UA 2CZ4A 1U25A 3CJRA 5CABA 2B8PA 2VDHA 3QAUA 3PHEA 2VOOA 3B6OA 4KPYA 1R43A 4S0MA 2VL1A 5L1KA 3FRYA 3CYMA 1N5QA 1T6CA 1VRUA 1CJTB 3CERA 1WSRA 5LJVA 5IM0B 3EVMA 4YMEA 3QRPA 3IRXB 5KRSA 2ADBA 4TYAA 2ZC4A 3R2CJ 2HRYA 4MMOA 2K3IA 3C65A 5HATA 5ADXH 2VQEF 4QWBA 2HNDA 2XZDB 3Q8SB 2PD1A 4ECSA 3CJ1A 1U1NA 4PPZA 4BC9A 1T0TV 1HRHA 3UFCX 3E3XA 4WK3A 2N4CA 4B1VA 3VQ9A 4K7QA 3J7AP 4URQU 3CIMA 3CCUN 1D9DA 4YY3K 4X66K 1NO8A 4DUZK 4EK2A 2B51A 4U96A 1Z4UA 5AQTA 3NVKA 1FK9A 2A2DA 4HVZA 1N36K 3VGMA 2LA6A 3M2RA 1HNIB 4NI2B 4OKKA 2FLOA 4FO0A 1HNIA 4NI2A 3Q8RB 3ZZOA 1ZC6A 4FW2A 3C66A 2XWYA 4CWBA 1IJEB 3IMQJ 4Q5VA 4C23A 5M1KA 4K43A 3T41A 3I82A 1QUVA 2KKZA 3VF4A 3QETA 2QEXN 2BR0A 2VG7B 2BRLA 4QW9A 3TWHA 4JK7A 2ZD1B 3GFHA 4URSA 2IM2A 2HS0A 3KKFA 4QPTA 1S6PB 4DTUA 4YB5A 3QINA 2XMTA 2QA4S 1CXUA 4O3PA 2P8IA 2J5AA 3P31A 3LDSA 4FWRA 3I56S 5F2RA 3CPEA 1Y5IB 1VQ9S 3JS9A 4WP9A 5K8MA 1XHXA 3LZIA 2PEHA 1REVA 4CO2A 1KFDA 4BR5A 3D6TB 3ZC4A 4LSLA 2GVDA 3CCLN 4LSZB 5F9NA 4ER8A 2ZH6A 2C22A 2XHWA 5D78A 4F4YA 5LMNK 4UY8O 1EX4A 2MZRA 1DTTA 3A5OC 1IJJA 4HYKA 3OYDA 4NLPA 3CW2C 2DR8A 1Q18A 4DTSA 2F8MA 2D3ZA 2W6LA 4CJ5A 2DBBA 2ZUAA 2HHUA 2DEJA 2YWKA 1R7IA 1GEHA 3ZZUA 1O6XA 4DL7A 3LWMA 5DDRC 1KQSM 4LFAK 3NF6A 1GLEG 3PX6A 2I9SA 3PIOQ 4JKGB 1IXKA 3IRWP 4E98A 2H4YB 1LW0B 3UE2A 4ZVFA 4PR6A 2M52A 4NLOA 5AQOA 3X3UA 4IRCA 3OW2M 4CEBA 3GE9A 3NDKA 1TK0A 2YHXA 2RS2A 3HRGA 3OR1B 3OPKA 4I7FB 3D2FB 3T9ZA 1F21A 1U0HA 4AQYJ 3M8WA 4YN3B 4BC4A 1EARA 4BE1A 2P9PA 1BCOA 1T8EA 3SCLE 4JLHA 3G8SA 3SV4A 3LDPA 3OJUA 2V2KA 3FEYB 1MLAA 4P52A 1S99A 2HURA 4L74A 4OLAA 1R31A 4WU2A 3LP0B 2DR9A 5AQSA 3EZOA 2F65A 4WF9Q 1AB8A 1MW7A 4NXMF 5E3QA 4PUOA 2DY1A 2MGZA 1DZ5A 3N01A 2DHGA 1PYOB 2XYHB 3BSNA 2B4PA 1UVIA 1FE4A 2Q2RA 1ZZFA 1QVFR 3NF7A 5ETRA 1FRJA 1KVIA 4CDIA 5KG2A 3CXCM 4ED7A 1TKXA 1F9FA 4EO6A 2OH2A 1N33F 3L2UA 1WELA 3BB5A 2Y1IA 4KC5A 1HKBA 5LXRA 2D1CA 3TSQA 1QZ5A 2BGGA 1YBUA 1HQUA 2V5HG 4YHHK 4N5SA 2QC3A 1SH0A 3GWCA 2CNNB 3I55S 3ZEUA 2J0WA 1M1GA 4F50A 1OH5A 2HG4A 5KOWA 2IVMA 5DZ7A 4FL9A 5GVQA 4ZJQA 2JVRA 2H9ZA 2JEJA 5CH7B 3HX9A 1WEXA 1RAEB 1NGHA 3OTOK 2VG5B 2KO1A 1DQ8A 1T6DA 1JLQA 4P74A 4HEA9 2ZBIA 4E7IA 4QJVA 2QKKA 2ROPA 4M41A 2WRMA 4AHUA 1QTMA 3PRVA 3ZZRA 2ZM6K 5L8RC 2VQEJ 3TTDA 2WC9A 1JLBB 2KQ2A 2NRRA 2IRUA 2BM0A 4M5JA 2ASDA 4KAIA 1WB9A 3AVIA 1RT7B 3QT7A 2FF3B 3P5BP 3NGZA 4MFBA 1UZHA 4DX7A 3CCQS 3V9UA 3ZCMA 4IFEA 3B54A 1G1XA 3TAPA 5J1EA 3CJ0A 3MTKA 1KC8T 1VAZA 1HL6A 3DC2A 5DG9A 3RJMB 2FTRA 3I0SB 3ILIA 3P4UB 4PUOB 2XMJA 1FKOA 2QSFA 3IM8A 2DPJA 2NUUG 2HFZA 2XGPA 3FBFA 4CEOA 3GCXP 2VJUA 4KH4A 4I9QA 5KPRA 2FPHX 3KWIA 2MQQA 5JS1A 1VQLN 2A1BA 1A5XA 3LM9A 1J2VA 5KAKA 4O3SA 2VKZG 4DL4A 3FSXA 4JV1A 4DSFA 3DXBA 4CHYA 2AJ4A 4YY3J 4CJTA 4AQYF 3SUNA 5DGBA 4USJC 1CS4B 4NLCA 4FPRA 3VQPA 2MZ1A 2D0OA 1YITN 3ULDA 2PZSA 1H0HB 3D3BJ 2ZH2A 2OPQB 1WTFA 3NMRA 3HP6A 3CDAA 1BGXT 4YOVA 2H48B 1MMDA 4BRFA 4MK8A 3OVSA 1KQGB 5B0GA 1QQMA 3DRPB 3DXMA 1JLFA 3VGKA 2DGQA 4DSKA 1RTHA 3IO1A 3SI6A 5LY3A 4OYBA 5IOLA 1LFPA 1FNXH 2DGOA 3DHXA 1K44A 1VLYA 5I3PA 2CJQA 2WBNA 5CYQB 3EPIA 1U6ZA 3HMJG 2C3MA 4MTPA 5C25A 2ZWPA 2UUBK 3F0NA 2KT2A 3KK7A 4IOAQ 1P8ZA 4WIIA 1FWKA 4RW4B 2RUSA 5F8HA 3MCMA 5ELZA 4LF9K 3TPQA 1L5UA 2ZGYA 1R6YA 1XR7A 2V6AA 4EFAC 4JOUA 4FKYA 5HQLA 1IBKJ 1I94K 1Y11A 5FROA 4HCCA 3KMQA 5D4LA 4BG8A 3ENAA 3QSIA 1SKRA 1VJWA 1XC3A 1T11A 1HNZF 4O3RA 1S76D 2PN6A 4Z7YA 4BRKA 2ASMA 3OY9A 2WTUA 3AAWB 1Q81T 2V8VA 4NE9C 1TZ0A 4C8NA 4DV0J 1RBOB 1VQ4S 5F8GA 3ULEB 3SFUA 3CD6S 1FFSB 3BUZB 2QWMA 1JLCB 5J2MA 2OPQA 3D2EA 4YORA 4LF6K 3H4BA 5HI7A 4FLVA 2Z58B 4LF2A 3O3FA 2UV8G 4BG9A 2VBWA 2HMPA 4JI0K 4OX9J 3C14B 4O4GA 2CIMA 2VGNA 4AHVA 4IH7A 2OFHX 2FF6A 4FS1A 3P49B 1WSVA 1RDRA 3VGSA 2KVQE 3S7RA 1HW9A 2AJ0A 3RBXA 4QIFA 2Z57B 3BO2A 1NMNA 1GT8A 2JVOA 3VAIA 2G8UA 1TL3A 3HSZA 4FVCA 3THXB 1HQ2A 3VAKA 5I42B 4F0MA 1VMBA 4UOCA 2JC0A 3FMBA 4X65F 1RI7A 5HRNA 4W92B 3LPYA 2JH3A 4HR2A 5AZIB 4X66F 3EN9A 5A8RA 4LR9A 3RZAA 3OYEA 3ZETB 4I2QA 1KBRA 3LW5C 1VS3A 4B1YB 1YJRA 5AR0A 3CCJN 1X9MA 1CULA 3IA0A 4B9LA 4PXCA 5IWAJ 1Q0NA 5AFUH 4HI2A 2JWKA 4QIGA 2V0NA 2H3GX 2LECA 2JLFA 2F7TA 5LJWA 4K0KK 4Y6IA 2B6AB 4X64J 1EHWA 1PC5A 5F1XA 3DI6A 1RAJA 1TAQA 2HYIB 4TU9A 1QVGM 3D2EB 2G1DA 2E1PA 4ZVHA 2Q97A 5DQGA 2B9EA 3D0IE 5EDWA 4B3SK 4LIWA 4DXLA 4I67A 3FNNA 4DCPB 4CIFA 2ZH1A 5A8KB 5AQXA 1ITGA 3FSIA 5MLCV 4B9SA 4OZ3A 5A8KA 5EGYA 3KJVA 1QDUB 3VQ4A 4GV9A 3WXIA 5BR8F 1WACA 5IT0A 4LRAA 1SB6A 2HPUA 2WVBA 1VQ5S 5CYJA 5HL7Q 4B3SJ 1KONA 4ID8A 1HBOA 3KLHB 1YJNN 5CE3A 5CYMB 5KQ8A 4K2JA 3V81A 3ZT2A 3V1RA 1JXEA 2HWHA 2VQEK 1HMVA 3Q22A 5J1NA 4ED1A 1BL3A 3PYFA 5LMNF 3MDFA 4USTA 2L9DA 2OEKA 1H74A 3AO1A 3MEKA 2HLUA 3KK1B 1W0HA 2FHJD 1CJUB 1XNRJ 1ZA2B 1S72N 1U1KA 3BKFA 2FJEB 1MSWD 3QIOA 2V8DA 3H2LA 3HVWA 3DLBA 2CJXB 1NSAA 4DR2F 2P9SA 2VV5A 4QU6A 3GONA 2MQNA 3EYZA 1JNRB 4JI5K 3JQJA 4TKTA 1MA9B 3C6UB 4J37A 5T7LA 3ENQA 1RGIA 3MUMP 3L0QA 1QHAA 3SFGA 2HF4A 3OD2A 4GKKK 3CCJS 1GTEA 2FHKA 2HVZA 3VQEA 4HHTA 4E1MA 1VSJA 4A5AA 1RISA 3E51A 4DR6J 2AGPA 3HBTA 2BQ3A 5IZHA 3M3ZA 2DNYA 2GAHC 1K1SA 4U67Q 4EGLA 4XPCA 3CMEN 5LM7E 4C0BA 2G8WA 3M2VA 2J76E 2I38A 1DHMA 2VG7A 3M8QB 2E1RA 1PJ6A 4DU3A 3BQ1A 4ETXA 2K3KA 3O1BA 1NMDA 1QJHA 2DVIA 4IUFA 2VF3A 1WEZA 3TUJC 4F4XA 4KHWA 2BEFA 4G1IA 2SXLA 4C8YA 4CESA 4FNHA 1UFKA 2E1MC 4MKBA 2B4JA 5FDLB 3CULA 3GJTB 2XCPA 4ECZA 4BRPA 3KUGA 3T1HJ 3ZT3A 4M8LA 4H4MA 3J81O 4HACA 2MQLA 3TQ1A 4UOHA 1C6VA 4CTAB 5DM6Q 4KBIA 5KG7A 3OW2R 1WF1A 2GS8A 2RRNA 1PBAA 1NM1A 2XMMA 4MK9A 2UUTA 3PIOL 4DUYJ 3D7SB 2OI2A 2LVWA 1C0UB 2RD5C 4NLRA 2A5XA 3W64A 3TEHB 4QWDA 1U1OA 1X3MA 1SQFA 3MM9A 1FESA 1S1XB 5J2NB 4JI6J 3L4QA 1C0TB 3T1YF 2HFOA 2CDQA 4MT1A 3BPDA 3F73A 4PCQA 2ZWOA 3BSAA 2FSJA 4UT4A 2F40A 3CIZA 4DBQA 2KH9A 5B7WA 4Q8FA 2ASPA 1U24A 2XY7A 5IV4A 4X65J 5AQYA 2UVUA 4CZLA 4QYRA 2OPPA 1ZPWX 3S01A 4EEYA 1IKWB 1SC4B 4JI5F 3EZWA 3CMAN 2UU9K 1PO6A 1M1KO 4O44A 1OPIA 5BXIA 2FSNA 2Y8YA 4FJGA 3D1HA 4TQSA 4TU8A 4R0JA 4BQZA 3IC1A 1HJRA 5IXUA 2O67A 2PMWA 3ZT0A 2LCWA 4P10A 2PMHA 4MIWA 4DV2J 5ETVA 4QS7A 4FJ8A 3WXLA 1SIZA 1FERA 2B5JA 3PJ9A 3DOKA 4LFCJ 2EFVA 3AA9A 1NH7A 3AHPA 4C97A 2QWOA 1WJ9A 1HKGA 4D3HA 4CK1A 4JV5J 3PTWA 4A8MP 4CZEA 2CNKB 4BRCA 4O0NA 4OHWA 4F3TA 4X4SA 2CZ9A 4NX9A 3LGNA 2GIRA 4H8KA 4EHUA 2OO4A 4DR6F 4C3KA 1C1BB 2BJ3A 2IM1A 5KFQA 2MLXA 3IAM9 3ZLJA 4JKFA 2EX3A 3A1YG 3GSIA 3G4SN 3AGKA 2V4JB 2WB1D 2DNOA 1HNWK 1VJQA 1J5EF 3HHKA 3TARA 4HH1A 1RHRB 1JLBA 2IMOA 4JYAK 3OFGA 5KT2A 2Y1RI 2YX7A 1VHFA 4FYXB 3H59A 5BN8A 3MFIA 4KTZA 1X0PA 4DV5K 2KHDA 4OYIA 5KG5A 2RRBA 3THPA 2IVNA 3SBGA 4M5GA 3MMAA 4IR1A 2EI5A 2M8HA 1YXQA 2C1EB 2VPWB 4XIUA 5I9EB 1NG9A 5IC6B 3CDEA 3U7JA 1S49A 4HUFA 1RACB 5E3PA 4Y1DA 4IWVA 3BM7A 3FFIB 1BD6A 4ZLJA 5HAOA 1WUAA 1VSMA 3D67A 5JVHQ 1VISA 1MWMA 3KIOA 3DDIA 3IP0A 4NLBA 2JX2A 2LQ5A 2HHWA 1MDUB 3G0ZA 2MZQA 2Z0GA 4PXDA 3ID6A 4C9DA 1RT3B 1GXTA 2R8KA 2Q66A 2NXEA 1Z25A 4YQWA 2F9WA 1FX4A 4ZA1A 4FS2A 2A0FB 2WBRA 2HQFA 3BY5A 1TKDA 4FF3A 2FBYA 3L9ZA 4KFBB 4BREA 3ZTRA 3PXGa 3D6MB 3HT0A 3D6FB 1FDAA 2WONB 1YBTA 1RSCA 1C0GA 1J54A 3MAHA 3M1VB 3PDNA 1S0VA 3MN9A 1D8YA 3FZ2A 1G3OA 5E3AA 2HGLA 5KG3A 5KFSA 4RU2A 1N36F 2F4VK 5GAEU 3MCNA 5A6WA 1JL1A 3G82A 4NLVA 1NDPA 4FLYA 1WKLA 3NCQA 4J2BA 3LZJA 1T9WA 2G4BA 3OYBA 2XSJA 3LALA 3SK3A 3P5TL 3SUOA 3BBFA 2RQKA 4IH6A 4NMXA 3JAMU 3LDLA 3M8PA 4PKHA 4LFCF 1X5TA 4Y65A 2HF3A 2XEXA 5IFMA 4ILRA 3DHWC 1RA7A 4WZMA 4P2MA 1B9FA 3SQGB 4BS2A 5FPMA 2Z2ZA 4ECRA 3FDSA 3CJ4A 2PA3A 4OYOA 1C0FA 1KD1T 2O8CB 2G9OA 4WCEL 4I2PA 1D4XA 4K8RA 4YB6A 3SAFA 2VPZB 1U6BA 4ES1A 2YKMA 3IWXA 5DLGA 4L75A 4H03B 3H5SA 1T94A 2E20A 4WKYA 3CJ2A 4HHUA 2P6TA 3CD5A 3ENBA 2NCKL 3DRXA 4LY7A 2QZ8A 1NUEA 3G6XA 5GADI 1N6QB 3SSSA 3NCIA 2YKOA 5HMXA 3IR7B 2BKPA 1U26A 2XY6A 1RCXB 2G0CA 3KXDA 2JSXA 3QMLA 4J8FA 4MO5A 2Q43A 1N48A 3AVHA 5F8LA 4NLSA 4Y2IA 3G87A 3CPWM 2NRVA 2WSFC 1YJWS 3DWLA 3TAQA 3GSDA 2HVDA 2JNJA 2UUCF 3C15A 2YTCA 4O0IA 4ZN3A 1LW2B 2HEKA 1BOTO 3DLLQ 4J9NA 1CVJA 6AT1B 4DR1F 4JI6K 1E3MA 4DV6F 2GBZA 5B08A 3QFPA 2LU1A 2FY8A 3WC2A 1KXPA 4XDDA 4DV2F 3QRQA 2R7SA 1JLGB 4LF1A 2L3MA 4H5NA 3IR6B 2FBVA 1X9SA 4QS9A 4B3MK 5B8HA 3H6EA 2QMUB 3JXUA 4YR3A 3PNIA 5AQQA 4JS5A 2F7VA 4YOXA 3C16A 4RUAA 3CJAA 2DHHA 3AVGA 1RU1A 4Q2LA 1OVYA 3DXSX 2E9ZA 1U45A 3KFWX 3BZCA 1TVRB 4HL9A 4K41A 1K8AT 1RQ0A 5HROB 4ZMMA 4QWAA 4IG0B 4C0HA 3MPWA 4HVJA 1HARA 3PG9A 2P51A 1BUXA 2V52B 3OQ2A 1GAOA 3BGOP 4DR5J 2CH6A 2O8DB 3I0SA 3VEXA 3H2UB 5AJ3J 3LF0A 2CXEA 1R6VA 4IO1A 4IFYB 4I6AA 1VK3A 2YQ1A 4ELTA 3KKRA 1EWRA 3FJ2A 1RHJB 3KJVB 1MWQA 3MF5A 3OYLA 4ZVOB 1X4FA 4XK8C 2B9YA 3QPIA 2UUBJ 1N56A 3WBZA 2E1CA 2D0PA 1GLLO 2OUGA 4WBFA 4IO9L 4JD2B 4IDKA 4A5BA 2CKWA 4M3UA 4JKBA