3JSMA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
total genus 144
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jsmA05
2VG7A 2R2UA 2ZE2B 1S6PA 4RW4A 4DTJA 2BRLA 3PUFA 1ZBFA 4EYIB 3T5HA 1HARA 1I39A 4N5SA 3Q8QB 2HVHA 3DRPA 5J2MB 2OPQB 3C6UA 4WFYA 3NDKA 4EEYA 1RILA 1C0UA 2HB5A 4EBDA 1ASVA 5HBMB 2RKIA 3MR6A 2FLLA 1SL2A 1SKWA 4LH4A 4FJNA 4AHTA 3PZPA 4M3TA 1TKXB 1JLEA 3KK3A 3RMAA 4GVMA 4YFUA 3RB0A 1J54A 1J5OA 2B43A 1NK5A 5JS2A 3HSTB 3TAMA 3OJSA 1HYSB 3MAQA 3DOKB 4CJEA 1GX6A 1RBRA 1TV6B 1WLJA 1QSLA 4N47A 3B6OA 2GIRA 3VQ8A 5C42B 5F9NA 3RBDA 5CY4A 1UWBB 3V6DA 5KFAA 1T94A 1LWFA 4TQRA 2ZKUA 3NBPA 2VA2A 3OYCA 1RTHA 1T05A 2IC3B 5KG7A 2W7PA 4NLPA 3M8RA 4M95A 3OJUA 1RA7A 1S97A 4QPXA 3KLGB 2UVUA 3BGRA 2OPPB 4FJKA 2R8GA 3MR3A 4HCCA 3ZT3A 2B5JA 4KB1A 2OYQA 1YVFA 2YNFA 3H98A 1ZYQA 5KFLA 4Y1DA 2YKNA 4FK0A 4DSKA 3VN5A 4DQSA 3D5MA 5KT2A 4B9SA 2CKWA 3QZ7A 4WFZA 3CO9A 3UIQA 3MXMA 4CEFA 1Q9YA 2HWHA 4HUFA 4KV8A 2FLPA 4CGFA 2Z1GA 3I0SB 2QV6A 1WSHA 4DSFA 4KTQA 3RMDA 4EBEA 3NL0A 5T14A 4CEEA 2EC0A 3HP9A 2HNDA 3ULDA 2ASDA 4YNQA 4CHZA 1NHVA 4R5PA 3FSIA 4MK7A 4DFKA 1TVRA 2W9CA 1QE1B 3QINA 3K5LA 3QIDA 3TR8A 3RRHA 1LW2B 5K14A 2Z1IA 4W5RA 4WE1A 4B9VA 2YKMB 4CJWA 1KVBA 2OZSA 1JLCB 3ZSVA 3VQPA 4RG8A 3OLAA 4I2PB 5SZTA 5KFDA 2OA8A 1U04A 3AVFA 4CESA 4DG1A 3ZT0A 3NGZA 3VQ6A 4GC7A 5HRNA 1I3AA 2HHWA 1DLOA 1T8EA 4ECRA 3OYGA 4O55A 3E01A 4CJLA 4IRKA 1SV5B 2YV0X 2W8LA 1RAJA 2Q3SA 3AVBA 3ISNC 3UDLA 1ZBIA 3JSMA 3S9HA 2AQ4A 4ECVA 4G1QB 5E41A 2R8JA 1SH2A 4IOBA 5CYQB 4K4WA 4QWAA 5KG3A 1CLQA 4KHQA 2HWIA 4DWIA 4FW1A 5L9XA 1S6PB 4RW4B 4N76A 1JLAA 1MMLA 3K58A 1J53A 1KSPA 3QLHA 5FDLB 3KHHA 2R2TA 4M3WA 1XR7A 1FK9A 4EO6A 2P1JA 2A1RA 4E89A 1U47A 3LDSA 3DRPB 5KFGA 3C6UB 3LANA 1C0UB 4Q44A 4FJHA 3V6JA 4WFXA 2RKIB 1BIZA 5F8IA 4CK2A 4DSJA 1ZTWA 3EZUA 4Q8EA 1QAJA 2G8FA 4CCHA 4FZXC 4FLUA 3TARA 2FBVA 4ZVEA 1Q9XA 3EPIA 4NLVA 5JS1A 1J5OB 3AO3A 5KTQA 4IH6A 4GC6A 3MEEA 3QO9A 4RW7A 2XCAA 1S10A 1X9SA 3QYYA 3VQ7A 4ZPAA 2D3ZA 2HVIA 4KTWA 1HNIA 1IG9A 3V81A 2FVSA 1S49A 4WYWA 3L3VA 1C0TA 3BQ0A 5F8NA 3V6DB 5KFCA 1KTQA 4FK2A 3HVWA 1LWFB 3MR2A 3HPGA 4JS4A 5EU7A 4K4VA 3NBPB 2HAIA 4ED3A 3D0PA 1T05B 1RDRA 1RDDA 1I6JA 3EYZA 4ECYA 1HJRA 4TSXA 2FLNA 2HHUA 3H4BA 5KG6A 2QKKA 3CFRA 3NGIA 4NLUA 1VRUA 4M3UA 4WXWA 4ELVA 2YHBA 3BGRB 4DS5A 4CJQA 5HRPA 3KHLA 2YNHA 3CG7A 1FXXA 2BANA 3V9XA 4PA1A 4FYDA 5KFBA 2B5JB 1HYZA 1HNVA 1B92A 1RBSA 4C8KA 3QIOA 3OYHA 3V9SA 2YNFB 4ECZA 1G15A 4FZYA 3SCXA 2ATLA 4OLBA 2YKNB 2JLEA 3RWUA 4ECSA 3LP0A 1S9EA 2AX1A 3ICLA 1UOCA 2D0CA 3L2WA 1D9FA 4CHYA 3L2RA 5KG1A 2HHQA 3LP1A 3AA5X 2VA3A 4DU3A 4XPCA 4XO0A 3OL6A 4BDZA 2ZE2A 1HPZB 1ASWA 1EXQA 3VQSA 4ED1A 3CQ8A 3FDSA 1T7PA 2JEFA 2F96A 4MH8A 4E7JA 3OSNA 1GOAA 1TAUA 4E1NA 1UA0A 4HYKA 2XI2A 1UA1A 4JUZA 4R5PB 3CM6A 1TKDA 4O4GA 3PW0A 3IAYA 3H2LA 4QCLA 2IS3A 1D5AA 1TVRB 2ETJA 1DTTB 3CFOA 2W9CB 4ZMMA 2R8HA 4J9NA 2DFFA 3PHEA 4CIFA 3JYTA 3T5LA 1C1CA 4DL7A 4NLDA 1F21A 3KHGA 4MK8A 4EP4A 1RT5A 2P5GA 4M94A 1HMVB 2DPJA 1TK8A 4TYBA 4RNNA 4M41A 4DG1B 2J6TA 3OLBA 4W5QA 2XY5A 2E4LA 2NUBA 1OS5A 3GILA 3ZSXA 1DLOB 3T3FA 1SH3A 4FJ9A 1QQCA 3E01B 1TKZA 4E7LA 4FJLA 2XGPA 4F2RA 3QGGA 1NJWA 2WCXA 4RUAA 1JLQA 4E7IA 1NK0A 4B8CA 3H4DA 1A5VA 5KG4A 5KT7A 3GIIA 5DLFA 3NH1A 1XHZA 1SL1A 4CJTA 3DI6A 1L5UA 5FRNA 3MEGA 4OKKA 3DRRA 3SZ2A 4DTPA 3QLHB 2UUWA 4CHNA 3PX6A 5KI6A 1LW0B 4OGCA 3M9NB 1FK9B 3NAEA 3SQ1A 1IM4A 4IBNA 5SWMA 5DGAA 3BSCA 4ED7A 4BE2A 4HCBA 1JLGA 5JUMA 3KKRA 4FJIA 1NK8A 3DOLB 3HXMA 1LWEA 3M8SA 1RTDA 3MFIA 2IJNA 3MFHA 2W42A 3DLGA 4ID1A 5FRMA 3TAPA 3KJVB 1NOYA 4URGA 2I5JA 4O44A 4OPKA 3MEEB 3ZSZA 1NHUA 3EZ5A 3QO9B 4QWCA 4RW7B 4CF8A 1VSLA 2ITGA 3HPOA 3ITHA 4O3QA 4NLQA 1HNIB 4ID5A 3RR7A 3V81B 1WNSA 3PV8A 4ICLA 4Z4CA 5KRSA 4ZTJA 4PUOA 1C0TB 1LW2A 4IKFA 1KHVA 3M9OB 2IGIA 4AILC 4OLAA 1IKVA 3SFUA 3VA0A 2UVVA 2R2RA 4KKOA 4J9QA 3G6XA 5KFSA 4F4YA 1RT4A 2C28A 3LZJA 3ASMA 2Y1JA 1NJXA 2RF2A 3AO1A 1S5JA 5KFPA 4NLRA 2UUTA 3OYNA 4CFBA 4KHWA 1VRUB 4FM1A 4QW8A 2KFNA 1S0MA 5KFVA 3PX4A 4AHRA 2R2SA 3S3OA 3M8QA 3G10A 2BANB 3TAFA 4NRTA 1HNVB 4Q0BA 4DFPA 1S9FA 1C1BB 4MKAA 2C2EA 3FQLA 4F50A 5T7BA 4ECWA 3LP0B 1S9EB 2JC1A 3AVGA 4G1QA 2ZQBA 3SQ0A 2B4JA 4MK9A 5CYQA 4MIAA 2VWJA 4DMNA 2FVPA 4DQRA 4B9MA 3F9KA 2XI3A 5DGBA 3SI6A 4B9NA 2ZD1A 5EWEA 1BI4A 5FDLA 1RT1A 4RNFA 4CK1A 3AA4A 4J2AA 4Y2CA 2FJVA 3NF8A 5EWFA 3GIMA 4FLXA 3OYEA 2G8WA 3GIKA 5DG9A 4DS4A 5KFXA 5KFYA 1QTMA 1S48A 4O4GB 2BGGA 1S1UA 4ZTFA 2IMWP 1L3SA 4AHVA 4K4TA 2XY6A 3RR8A 1SKRA 3KK2A 5J2NB 1N48A 3HK2A 1D8YA 3JYTB 1RYRA 1RYSA 4W5NA 1C1CB 4CGIA 5HROB 1RT5B 4X2BA 4CEOA 3HHKA 4FLZA 5F8MA 4NLOA 4H54A 4J9MA 3QEIA 3DLKA 4B8AB 2AGOA 2R7YA 4CGGA 4CK3A 3LPUA 1RT2A 3CM5A 4JV0A 1N4LA 4Q45A 3EY1A 3KK1B 3LALA 1B9FA 3FQKA 1EETA 3AO5A 1TKZB 4NYZA 3QGIA 5HRSA 4K8XA 4RUCA 2FJXA 4MFBA 3KLIA 1VSKA 2O4IA 3NCIA 5D3GA 4Z4EA 3KMSA 1O1WA 1DTQB 3CJ5A 1JLQB 4ZVFA 4TYAA 3U3GA 2IDOA 5KFUA 4QW9A 5F8LA 4QWDA 1J9AA 1U45A 4JRPA 1TK0A 3PR4A 1NK9A 1RCHA 2HHSA 3DLBA 3DI6B 1S9GA 3M9MB 3MEGB 4FS2A 3DRRB 5C25A 4NLWA 3M8PA 3VQEA 1N56A 3LP2B 1NKBA 1WNEA 1KCFA 1X1PA 2FC0A 3BQ1A 2JEIA 2P51A 1K6YA 4HVJA 1HQEB 2P5OA 4CE9A 4IR9A 5KFIA 3L2QA 1RDCA 3SV3A 1JLGB 1K1QA 1HQUA 1JLFA 1C6VA 4CEDA 3IG1A 1HPZA 4Y34A 2HHVA 3KLEA 1LWEB 1RTDB 2JEGA 3NH0A 2Y1IA 1NKCA 4O0JA 3DLGB 4FJXA 4GMJB 2F8TA 3HVRA 3T19A 3ZSYA 4DSIA 4ZP8A 2I5JB 3PY8A 2A1SA 4O44B 2X6NA 4FM2A 4M42A 4ZPDA 4FXDA 3ITHB 4Q5VA 3IRXB 3UR0A 4ID5B 1DTTA 1RT7A 1GX5A 3V1OA 4ICLB 4PUOB 4FJGA 1W9HA 4DTNA 3NKYA 1IKVB 5KFFA 2RDJA 4IDKB 2AWZA 3AVAA 5I42A 4KKOB 1HMVA 4F2SA 3K2PA 2OH2A 1RT4B 3TVKA 4CIEA 2RF2B 4Y3CA 1QAIA 2D3UA 2ATQA 4OKJA 1IKYB 3AVCA 3NF9A 2FVQA 4E19A 3AVKA 3NAIA 3G0ZA 3M8QB 4FJJA 4IFVA 4NLSA 2E9ZA 1JXEA 3OVNA 3H40A 4OKEA 3CYMA 4KTZA 4B3OA 1TGOA 1S0OA 4KO0A 4CEAA 2ASLA 4G3IA 4HKQA 4LQ9A 4Q0BB 4J2BA 4I9LA 1BISA 4U7CA 1NKEA 2BQ3A 1YT3A 4CEQA 4PQUA 5KFWA 3QEPA 1JX4A 1KVAA 2X6SA 1VSIA 4URQU 2E6MA 4K8ZA 2KZZA 4M3ZA 2IA6A 4K4UA 2BR0A 4CF9A 1BI4B 2ZD1B 3L2UA 1RT1B 3HVAA 4WYLA 3L8BA 3OS0A 3V9UA 1BQNB 1LW0A 1A5WA 5L1KA 4CF0A 3PW2A 3SPZA 3K57A 3V6KA 1ASUA 4RW6A 4CEBA 3NE6A 4B08A 1S1UB 2KW4A 1KLMA 4H4MA 4BE1A 3BJYA 4DSEA 5KFKA 4CHQA 4CJ4A 3C94A 3ISND 3KK2B 2WOMA 2QE5A 3DOLA 3VQ5A 1SH0A 1NOZA 4FM0A 2AU0A 2VG5A 2YNIB 1B9DA 3C6TB 3GIJA 3KJVA 5KFTA 3THVA 3SI8A 2KTQA 4Q43A 2J6SA 4CJFA 3DLKB 1KFDA 3U3YA 1GOBA 5HLFA 1RT2B 1VSFA 1XR6A 4CJ3A 5KFNA 5KG2A 2BDPA 2FJWA 1S1TA 3O4NA 1WSIA 2IBKA 4CJSA 3CDEA 1EETB 4NLTA 3FRZA 4IH7A 3PW7A 2R8KA 3V4IB 3AVJA 1U4BA 4FJ8A 4CFDA 4MFBB 3KLIB 1A5XA 5D3GB 3T5KA 3S3MA 4CF2A 2V9WA 5KT5A 4J9RA 4OJRA 2E9TA 1LV5A 4O3PA 5KFZA 2G8IA 4EO8A 3DLRA 1ZBLA 5KGWA 1KLNA 2JC0A 1S9GB 2EX3A 1BCOA 4KBIA 4NLXA 1U49A 5C25B 1TL3B 4E7HA 2IJFA 1C1BA 3M8PB 3KNAA 1BQMA 5L1JA 1NNDA 5EUHA 4KHUA 5KG5A 3ZSWA 4E3SA 3KIOA 4J9LA 1JXBA 4U6PA 1ITGA 4DL2A 1LWCB 2C2DA 4Z4IA 1HQUB 1JLFB 3IG1B 4BWMA 4KAZA 3KLEB 1VSJA 1NJYA 4DTMA 1EX4A 4IH5A 3Q8RB 3I8DA 2G8VA 1RBVA 4KHNA 3IGVA 3CJ3A 3ZSOA 2PZSA 2CJQA 1VSHA 2DPIA 3OYLA 4IFYB 1VK0A 4TY8A 4KRFA 4CJVA 3P83D 4ZHRB 3HYFA 1RT7B 5KFMA 3OYKA 5J2NA 2DFEA 2D0AA 4Y2AA 1CZ9A 4KAIA 4KSEB 1VRTA 5I42B 5HROA 3N6NA 4TLRA 3T5JA 1CXUA 3NGDA 4M45A 2FVRA 2RDIA 2VG6A 1QUVA 3KKSA 2FBXA 3I5CA 4HHTA 4CJRA 1SKSA 2E6LA 2KFZA 3MF5A 3LZIA 4IRCA 3K59A 3KK1A 3SUPA 2GUIA 3KTQA 4CGJA 4CIGA 4IFVB 1FKOB 4B3OB 2BQRA 5J2PB 5KG0A 4KO0B 4O3SA 4DTOA 1JL1A 2AX0A 4AHCA 4M3XA 4H4OA 3MXIA 3QEWA 3HL8A 3IN5A 3LWMA 4KPYA 4Z4HA 3RTVA 4I7FB 4PQUB 1DTQA 3AA3A 4E1MA 4CECA 1TP7A 4RU9A 4Y1CA 4IG3B 3DDKA 2Z1JA 3AO4A 4IG0A 4FBUA 1BIUA 4K4YA 2RN2A 3MTKA 4Q8FA 3VQAA 3VQQA 4NRUA 4CFAA 3QNNA 3LP2A 4WXOA 4K4SA 4IRDA 1WSJA 3GQCA 2PY5A 4AHUA 3DYAA 3D28A 1HYVA 3HO1A 3IGNA 2HNYA 4RW6B 4CGDA 2V0NA 4MKBA 1HQEA 4ECXA 3KLVA 3BREA 1YVUA 5KFHA 1KLMB 4H4MB 1TL1A 4RW9A 1EP4B 3GV8B 3PO4A 3VQ4A 4WZQA 5KFOA 3N6LA 4FLTA 1JLBA 4KB0A 2WOMB 4KFBA 2VG5B 4FVMA 1VSEA 4J9KA 3VQCA 4EBCA 1WSEA 1NK4A 4FJ5A 2GC8A 4TQSA 4LY7A 3OL8A 5HLFB 4ELTA 5KGXA 3AO2A 2XY8A 3Q8PB 4DQIA 2XGQA 1KFSA 1RTJA 3IRXA 1BCMA 1S1TB 3PW4A 3BSNA 5KRTA 3RRGA 2JEJA 4RNMA 3V9WA 5CZ1A 4EP5A 4TY9A 1RA6A 1JKHA 4IDKA 2G8HA 3N6MA 2KQ2A 2GBZA 4FCYA 4YQWA 1QSSA 4DL5A 3AVNA 4ZVGA 4C8NA 1IO2A 4C8OA 1N6QA 4DQPA 4FLVA 1IKYA 3DRSB 4RW8B 4AH9A 3A2FA 4Z0UA 3L2VA 4BE0A 4LSNA 3V6HA 1KVCA 2IAJA 4RNOA 3IS9A 2JGUA 1D0EA 4LH5A 4QAGA 4F4ZA 2G8UA 3AV9A 4JRQA 3DM2A 1BQMB 4TXSA 4DL4A 1ZETA 4R8UA 4NCBA 1U09A 4DFMA 2C2RA 3TAEA 3OSPA 3NH2A 4EZ9A 4ELUA 3AVHA 3DMJA 4W5OA 4HUEA 2WONA 3QZ8A 1FKPA 3O3FA 3SQ2A 1RT6B 3P5JA 1MU2A 5DMRA 3RAXA 4FS1A 4DSLA 3RMBA 1REVA 4YR2A 1JL2A 3TABA 1BQNA 2AJQA 2HNZA 1TK5A 4FLWA 4CERA 4CF1A 3TAQA 1T03A 3B6PA 1Z4UA 4TY8B 3VQBA 4FJMA 1RNHA 3PW5A 5EWGA 3QETA 4DF8A 3G6VA 3NMAA 2D41A 3OS1A 5KT4A 4F4KA 5L1IA 1Z26A 2YNIA 3G86A 1VRTB 3C6TA 2O4GA 2VG6B 4DTSA 5JXSA 1EKEA 4ZPCA 4J9OA 4E7KA 1CXQA 5DQHA 3V9ZA 3OL9A 4JLHA 2RPIA 3OY9A 3SUQA 3NAHA 5KT3A 3BQ2A 2ILZA 4NCAA 3ZCMA 4F4XA 1JIHA 3V4IA 3SYZA 4H4OB 1S4FA 4F3OA 5KFEA 4LSLA 2HHXA 3SUNA 2IM1A 3BDPA 2QK9A 2FBTA 1TKTA 1BGXT 5KT6A 5C5JA 3KLFA 2UVRA 4YP3A 3I5AA 3E51A 4URSA 4MIBA 4DL3A 2AGPA 3WNGA 4ECQA 4IG0B 4NYNA 4PY5A 3DLEA 3S3NA 4YR0A 4JS5A 5HP1A 1TL3A 4R0EA 4Z4GA 1TQLA 4M3RA 4AHSA 3HVTA 3MEDA 4Z4FA 4CEZA 3DYAB 3SQ4A 2V4QA 1S0NA 1S1VA 2HNYB 4H8KA 2FVCA 2WHOA 2YNGA 2HW3A 1VSMA 4NZ0A 4F3TA 2B6AA 1IKXB 3KD1E 1TL1B 4RW9B 1LWCA 2W9BB 1L3UA 2QKBA 2EHGA 3F73A 3OYIA 4DTXA 3SJJA 1JLBB 5C24A 4KFBB 3LWLA 5CYMA 1KRPA 3TQ1A 3G6YA 3H5YA 1CSJA 5DQIA 2XWYA 3C95A 4IQXA 4KHSA 1S1XA 4J9SA 4K4ZA 4IFYA 4BDPA 1S1WA 2F8EX 2ALZA 1NK6A 3SFGA 3OYJA 1RTJB 4ZHRA 4FJ7A 3NGYA 4ED6A 1RTIA 1XI1A 4O4RA 3SUOA 4LQ3A 1X9MA 3I0RB 3PO5A 5F8GA 4KI6A 1JKHB 2IM2A 3KMQA 3CJ4A 2UVWA 2O5DA 4DEZA 2GV9A 4EZ6A 1RT3A 1N6QB 2C22A 4UQGA 4FBTA 4KB7A 4I2QA 3SNNA 4F4WA 1C0MA 4LSNB 3HPHA 1LAWA 3RB4A 5DK5A 5I3UA 2IAJB 3IS9B 1FKOA 1JXLA 4HUGA 1LAVA 5J2PA 3WNEA 3BR9A 2WTFA 4NYFA 3ZT4A 3OYDA 5DG7A 3HJFA 4B9UA 5J1EA 3DM2B 3RBEA 1RDAA 4K4XA 4R8UB 5F8JA 4ED0A 4I7FA 5J2QB 2VWKA 5DQGA 1N5YA 1YTAA 4ZP6A 4C8LA 4GW6A 3DMJB 3PJXA 2WONB 4IG3A 5CZ2A 4OPJA 1FKPB 2OPSA 1WSGA 1ZBUA 1R0AA 4KHRA 5F9LA 1MU2B 4F8RA 2V4RA 1W0HA 2QXFA 1Q8IA 2D5RA 2R8IA 1XR5A 2D7SA 3SV4A 1NJZA 4PWDA 1REVB 2DY4A 2PYJA 2HNZB 4NLYA 3O3HA 4DTUA 2DTUA 3HM9A 4ED8A 4O5BA 3V1QA 1T03B 2VG7B 1EP4A 4ZPBA 1SUQA 3TAGA 2W8KA 4XIUA 1WN7A 3GYNA 4CJPA 4DTRA 1SL0A 3MXJA 1KHWA 3FFIA 3HT3A 4NCGA 3OYMA 2ASJA 4CJKA 4FZZA 4WZMA 3WNFA 2BE2A 2OPRA 3LAMA 3D45A 4QWEA 4FW2A 2OZMA 4CJ5A 4YMEA 3PVXA 2Z1HA 4KHYA 3AVIA 1XWLA 3QIPA 3SPYA 1L3VA 4K50A 3CWJA 2W9AA 2DFHA 1JLEB 3LP3A 3KK3B 4KE5A 3K5MA 2XY7A 1WAJA 3TAMB 5DG8A 1C2PA 3KD5E 4W5TA 1Y97A 3CFPA 4O3RA 3NFAA 4LSLB 5KFRA 3DLHA 3KLHA 3KHRA 1QS4A 4DLGA 4XPEA 3DRSA 4RW8A 1HRHA 4LD0A 1S6QA 1D1UA 1TKTB 4DQQA 5HRRA 3KLFB 3T1AA 4CHPA 3PR5B 3DLEB 1RTHB 3HP6A 2IM3A 5HP1B 4RNHA 1WSFA 3VA3A 3AVLA 4BDYA 3OHAA 1IKWA 1BHLA 3HVTB 3EPGA 3MEDB 1ZTTA 4CJUA 4HTUA 1WAFA 4BWJA 2YHAA 1S1VB 4DU4A 4ZP7A 2YNGB 3AA2A 2B6AB 3ZT2A 1TAQA 4FK4A 1RT6A 2WRMA 4C8MA 1X9WA 3ALYA 2XCPA 3MECA 3PX0A 3H5XA 5C24B 3OYFA 3H08A 5CYMB 2ILYA 1ZBHA 2XRIA 4OL8A 2X78A 1U48A 3QEXA 3GV7B 1S1XB 3HKWA 2HMIA 1S1WB 1RDBA 4KV8B 5L1LA 1CZBA 3OS2A 3I5BA 3KOAA 1RTIB 2LSNA 4O3OA 2IM0A 1YTUA 1BL3A 4J9PA 4FLYA 3L3UA 2HNDB 3TWHA 3PJWA 2GIQA 5J2MA 2OPQA 4I9QA 3H59A 4RZRA 5EDWA 4YR3A 1RT3B 3GV5B 5HBMA 3QNOA 2I1RA 4I2QB 5K14B 4WE1B 4KREA 1TKXA 2XHBA 5I3UB 4KHMA 3MR5A 1W25A 3RB3A 4ECUA 4JV1A 1HYSA 3CVKA 3DOKA 4ECTA 4J2DA 4IR1A 2BQUA 5J1EB 4OVLA 2XO7A 1D9DA 1TV6A 2D0BA 3BSAA 1QHTA 1IH7A 5C42A 1N5YB 1UWBA 3UQSA 2G8KA 3U6FA 2OPSB 1Z25A 1R0AB 3Q8SB 2IC3A 4DL6A 3JSMB 3RAQA 3K5NA 3CDUA 3UPFA 2WK4A 4PWDB 3CDWA 3CJ0A 3KLGA 2E9RX 4ED2A 2OPPA 3OYBA 1K1SA 4B9LA 3P1GA 1XC9A 4ZP9A 3TANA 3QEVA 4CGHA 4KI4A 2KZMA 1IKXA 4DFJA 4L8RB 1JLAB 2W9BA 1SUQB 5KFJA 4BACA 2FBYA 3FFIB 4N41A 4CHOA 4NCGB 3CJ2A 3H5SA 2HHTA 3LPTA 4TN2A 2BE2B 2OPRB 4JV2A 1NK7A 4B9TA 3RMCA 3ZT1A 3OHBA 4M3YA 2W7OA 5DLGA 4QWBA 4O3NA 3I0SA 3K5OA 3QIPB 1QSYA 3RB6A 3I0RA 3VQDA 3AVMA 3O4QA 3ZSRA 3NF6A 4O0IA 1QE1A 3KLHB 5F8HA 4DLEA 3QESA 3WNHA 1RBUA 2PYLA 2WB4A 4DF4A 1XHXA 3TI0A 1L3TA 1S6QB 1GOCA 2YKMA 1JLCA 4MQ3A 4QOZB 3CIZA 1RBTA 4I2PA 3LAKA 4EYHB 3V1RA 4ZVHA 4E0DA 4OGEA 1IKWB 5J2QA 5KFQA 3VQ9A 1UAXA 5FROA 2XC9A 4DU1A 3OYAA 2YNHB 4CFCA 1VSDA 3OL7A 1SV5A 1C1AA 2AGQA 3ZSQA 3MECB 2J6UA 2BRKA 3QERA 3BSOA 3NHGA 4IKAA 4J2EA 3LP1B 2X74A 4NLGA 3NF7A 3H5UA 1T3NA 3O3GA 2F8SA 2HMIB 2IOCA 4N56A 3QGHA
chains in the Genus database with same CATH superfamily
2R2UA 2QYCA 2ZHBA 3K2YA 2ZH1A 5LMNF 2CQ4A 1BWFO 2KT2A 1HARA 2UXBJ 3ILOA 4UOHA 4G6VB 4BGAA 2I2YA 4C0HA 4A47A 1FCAA 4OX8A 3C6UA 4WFYA 4EEYA 3FBBA 4X66F 3MM6A 1WF0A 3VHQA 1NGDA 2FLLA 3CCVN 5ETNA 2E1CA 1XUPO 5GMEA 4KHPK 3PZPA 1SJFA 1TKXB 2A41A 4RJVA 4GVMA 1J54A 2B43A 3MAHA 5JS2A 3MAQA 3KHYA 1KC8T 1FRIA 1WLJA 1DQ9A 1UJ4A 5F9NA 5CY4A 2ZWHA 2ZVIA 1CJUB 3TW0A 4TQRA 4DR6K 2ZKUA 3BZCA 1HWKA 2VA2A 1RTHA 1Q82T 1M1KT 2LXFA 3KXDA 4NLPA 3OJUA 4NI2B 5E84A 1CS4B 1PBAA 4QOTA 2OPPB 4U96A 3C2PA 2DNMA 2R8GA 1YJUA 2FB0A 2C2NA 1A7GE 1TFWA 1IWGA 4LVOP 3D4JA 4F02A 3I8BA 3VN5A 4TLQA 3TZXA 4CO0A 5IQ6A 4LR9A 3LGMA 4WFZA 2HBJA 4CEFA 2CQ3A 1UL3A 3QGPA 2QO3A 4HUFA 3FJ2A 1JNZB 3I0SB 1U1QA 2UU9F 4OHVA 5T14A 3DDIA 2XWXA 3PTWA 3TP2A 1NHVA 4JK7A 2BKNA 2GJ2A 2CQCA 2RUGA 2VB6A 3R6GB 2XMTA 4ZDNA 4IUFA 3QINA 3K5LA 4UF4A 4KPCA 3LDPA 3TR8A 5HAOA 5CD4H 2Z1IA 3T69A 4CJWA 1KVBA 2OZSA 5L8RC 2KT5A 2RVJA 4PKHA 3ZSVA 1OPIA 1Q16B 5SZTA 2JOQA 1SQEA 1U04A 3AXKA 1YITS 4OYOA 2XZWA 4ECRA 4LFAF 4OPAA 2KM8C 4CJLA 2KXFA 1X5PA 2YV0X 1C4AA 4FWOA 3T1YK 2MB0B 4JI2J 5M1FA 1B3TA 3JSMA 4LRBA 1V9OA 3V4MA 3M2UB 4PHTX 5ADXH 3UDEA 4HTIA 1SH2A 4IOBA 5CYQB 1V5VA 4KHQA 1P27B 4FW1A 1S6PB 4RW4B 1JLAA 1MMLA 5HQMA 3QATA 2R2TA 2HFNA 1FNXH 4M3WA 2CQ1A 3C6AA 1RWUA 4U7BA 1UMJA 2P1JA 4Z94A 1UETA 2OJ3A 3JS6A 4YORA 3P45B 2H5IB 3U1MA 3NCQA 4Q44A 1VISA 2H48B 1BIZA 1ZTWA 4Q8EA 1S4EA 3PEHA 4FLUA 5IM0A 4WF9L 4AE5A 4IJNA 5KTQA 4IH6A 4GC6A 2ZKTA 3GFHA 5AQRA 5BRHA 4U8YA 3QO9A 2XCAA 3UE5A 1X9SA 4JV5J 4CI6A 3R5BA 5KAKA 2UXDF 1M0SA 1FJ7A 3V81A 4WIQA 2V69A 2YHXA 4ILHA 4DV3F 1UJ6A 3BQ0A 4DR2J 4HHJA 3HCXA 2AYBA 1KTQA 3HVWA 3GG1A 4K4VA 1NDCA 3NBPB 5H1SQ 2QWNA 1KQKA 4WFNQ 3D0PA 3A5NC 1RDRA 1I6JA 3EYZA 3O1LA 5KG6A 4LBPA 2YHBA 3BGRB 1HLUA 1WTBA 4FF1A 1YKWA 2A3JA 3CCUS 5DJBA 2MSTA 3D1QA 1B92A 3RGIA 4C8KA 3OFGA 5IT9U 2YNFB 1R8CA 3Q8UA 3QT5A 1PYSB 3SCXA 1N8RO 4OLBA 2XQCA 3WXJA 2JLEA 4ECSA 1UOCA 3EVOA 2GWJA 1Y7PA 2O66A 3AA5X 2VA3A 4DU3A 1VHXA 2DR6A 1T9UA 1YK9A 1HPZB 5ETTA 3CQ8A 3A8EA 2ROPA 4E7JA 4I56A 1GOAA 4E1NA 3RW7A 5GVQA 1UA1A 4R5PB 2JFDA 2OTJS 1TKDA 4O4GA 2LQ5A 3H2LA 1R0BG 1D5AA 1TVRB 2ETJA 2XMJA 4ZMMA 3S7RA 2BE9B 1TELA 2HS3A 1VQPS 3CJTA 1N34K 3J7AP 1TK8A 2MZTA 4B1ZA 4TYBA 4RNNA 5HSPA 2J6TA 4W5QA 1RTZA 2NUBA 3GILA 4IFEA 1DLOB 3T6JA 3CERA 1CJUA 5D15A 4X4VA 2M4MA 2RAQA 2AD9A 4F2RA 3QGGA 1O51A 2W41A 2LYVA 4IOXA 2RHQB 1RACB 1NJWA 4RUAA 3W60A 5C2DA 2KVIA 1CC7A 4E7IA 1NK0A 4KJIA 4B8CA 5DLFA 3W8GA 5LMNJ 3OBYA 2OD4A 1R3NA 3C6HA 3HHLC 4OX9K 1GH8A 3VEVA 2KT3A 3IO1A 4OKKA 2FJDB 4RO0A 4FNIA 1NGGA 3G82A 4UOGA 3D0IE 2ZH8A 5KI6A 2QLXA 4X66J 2FF6A 4GO5X 2RQCA 3UD3P 4Z2XA 2J0SD 4DR1F 1FJEB 3GL1A 5DGAA 4AXIA 4BE2A 5E3RA 5JUMA 2QT7A 2HK2A 3A3OB 2DD8S 4GO7X 2LP4A 3KG0A 4JI7F 1NOYA 4BC5A 2ZJPQ 4IO9L 4JI3K 3ZSZA 4B3TJ 3O4WA 4Y65A 4ES2A 3HPOA 3EX7B 3ITHA 2ITGA 4OZ5A 1XNRJ 1HNIB 3RR7A 1WNSA 3O9UA 1VIXA 4Z4CA 1SJRA 4YEAA 3WXLA 1KHVA 2IGIA 4OHXA 4RTFD 1IKVA 5LT5A 3GMGA 4J9QA 4DUYK 5KFSA 2Y1JA 2UUCJ 1RWOB 1SIWB 3VV2B 4RL1A 1ZAVA 2DB1A 1S5JA 4PYAA 1UVJA 2QTDA 2XZTB 3OYNA 4KHWA 4FM1A 4QW8A 5HI7A 2RQMA 4ILRA 3PX4A 4AHRA 4JP8A 5LJVA 2BANB 3TAFA 2MY7A 4Q0BA 1S9FA 2O1PA 1C1BB 2VGMA 1HNWK 3H90A 4F50A 4DHYA 2E88A 4LF9K 1T02A 2ATCB 4Y2KA 1XMQK 2MGZB 3M2UA 2BJ3A 2ZQBA 3SQ0A 2WBNA 5CYQA 4R0JA 1GNKA 3KYLA 3UD4P 2GGPB 2XI3A 4OI6A 2PEHA 1VRQC 4B9NA 4CK1A 2P9NB 2JFKA 4KT0C 3NF8A 5EWFA 3GIMA 5HMXA 2Q1NA 1SQKA 1FTCA 5IZHA 2IA0A 4B3MF 5AFUH 2BGGA 3EMTA 4C8YA 4NMLA 2BV3A 4K4TA 4P72A 1SKRA 4ZPWR 1N48A 2WFBA 1WKJA 4NX9A 4CEOA 3HHKA 2V63A 5F8MA 4B8AB 2AGOA 5GIPA 3LPUA 1RT2A 4LFAJ 4ANEA 5AQQA 3CCQS 2RQ4A 2N4CA 2VOPA 2GA7A 1EETA 1JNRB 3AO5A 2QI2A 1TKZB 2GMJA 2RD5C 3QGIA 5HRSA 4JI6K 4K8XA 1JCGA 3CQXA 2A2DA 4RUCA 2FJXA 4MFBA 1YWXA 1B0VA 1IVZA 3LOUA 4MT1A 2DR5A 1O1WA 4ISFA 1JLQB 1YG0A 2IDOA 5KFUA 3MM7B 1REGX 3CMES 2YJFA 1T9TA 1NK9A 3DI6B 1T3OA 3M9MB 1U2VB 4FS2A 3DRRB 1SS6A 5AQSA 1NMDA 1N56A 1VQ4S 2F7VA 1U1KA 2QG9B 1WNEA 1VC0A 3MK6A 1HKAA 1X1PA 1VQMN 4LBHA 3AD9C 4WIIA 1K6YA 1HQEB 4NXNK 3CGIA 3SV3A 1JLGB 2M8DB 5FLXO 1NBEB 1YJNS 3IG1A 1HPZA 4Y34A 2HHVA 1RISA 1Q86O 1EB0A 2JEGA 4FJXA 3HVRA 2UP1A 3TVYA 4R79A 4DSIA 1HI1A 2UXDJ 3PY8A 1HUXA 2A1SA 2EK6A 4MJKA 3JQJA 4OHYA 2CGJA 1H2TZ 4YDUA 2PI5A 4ZPDA 4DV3J 4B3RF 2F1FA 3RSEB 3IRXB 3UR0A 4ID5B 4C6AA 4M5GA 2HBRB 4PUOB 4FJGA 3F0NA 1IBCB 4JI0K 4DTNA 3C66A 5KFFA 1GMWD 2NZCA 1CBKA 1X0PA 3MUMP 2FTRA 3K2PA 4I6AA 2EFPA 2RF2B 4P2SA 2ATQA 4OKJA 1T9XA 2H3GX 3AVCA 3IXQA 1ZM2A 5B08A 2FVQA 4HHUA 2BOPA 4ALZA 4E8UA 4CH7A 3HJVA 4WF9Q 2GTDA 4NLSA 3CD6N 1JXEA 4L6V3 3OVNA 5CAAA 4OKEA 2OLWA 4CEAA 3TTFA 1Y4ZB 2XHWA 2NQPA 4I9LA 1O6XA 3M1VB 3JTNA 2BQ3A 2MZ1A 2MKCA 4CEQA 4HI2A 1H1VA 5KOXA 3UE2A 5LXYA 1KVAA 4CO2A 2E6MA 3GE9A 3MOJB 4NA2A 4K4UA 3RUBL 3I4HX 1SAZA 2MKHA 5JMVA 2ZD1B 2C2KB 4CLLA 1VBZA 3L2UA 3HVAA 1BMQB 2QLJB 3IWLA 3BZQA 2D1KA 3PW2A 1AROP 5FLXY 1ASUA 1X4AA 2AP1A 1QDUB 3NE6A 2K1RB 4DUZF 4OZ0A 4OX6A 2QE5A 2DY9A 4BC3A 3OPKA 5LJ5Y 1YRTA 4LF2A 1IUJA 3ETOA 1U1LA 5BXIA 3I55N 2V68A 2YQ0A 4WQ5A 2IRXA 1XEZA 3OVAA 2L9NA 1PAEX 3PW7A 4A8FA 2VONA 2R7SA 3V4IB 2MLZA 4ILJA 1U4BA 3QWUA 3KLIB 4ZVUB 1A5XA 4F9OA 1MW7A 2V9WA 2YJEA 2L9WA 2FJBB 4J9RA 2E9TA 2A18A 2FXUA 1NAQA 1LV5A 4C3MA 1N36K 4G1PA 4CLUA 4O3PA 5KFZA 3DLRA 2UUBF 1XERA 2A2CA 3WIUA 2EX3A 3I4PA 1BCOA 4KBIA 4L76A 4NLXA 4I64A 1MLAA 1VQ6S 4YB5A 1C1BA 3M8PB 1B99A 4DR1J 2MQLA 3R3TA 4HHHA 2MGZA 1UPPA 2MQOA 1NB2A 3IBCB 4UT4A 1GMUA 4Z4IA 4U9RA 2PDAA 4JI7J 4KAZA 3ET6B 3PFEA 2HIQA 1Q79A 2AMCB 4OJGA 2G8VA 4JN4A 3VAFA 1RHQB 3IGVA 3ZSOA 3I87A 2NRHA 1HBUB 4IEIA 3OYLA 1X4BA 4PR6A 5HMZA 3DFEA 5B0DA 3ZEUB 3HYFA 2E5LF 1AW0A 1RT7B 2MKJA 2V8HA 2DFEA 3CC7N 2CDQA 2D0AA 3F5TA 1CZ9A 1RZMA 1SQFA 5I42B 2PMHA 3JTPA 1S12A 4QIEA 3UD5A 4FP9A 2FBXA 5DDQC 4K2XA 3QJPA 3CB4A 1LNQA 3J80U 4CWBA 2KFZA 4PRFA 3LZIA 3SUPA 3TA2A 1IBLK 4CGJA 1U2CA 2HKEA 4IFVB 4GRSA 2QA4S 1RHRB 3SJHA 4B3OB 4IYQA 5J2PB 3M8YA 4Z7YA 4KO0B 4FOEA 4IO9Q 3MXIA 3QEWA 5AT1B 5EX3A 3HL8A 3DLJA 3LWMA 3RTVA 4Z4HA 3OTBA 4DCHA 1HNXJ 4I69A 4CECA 1TP7A 3MM7A 4RU9A 2DIVA 3DDKA 2Z1JA 3FMWA 3GCWP 2ZEJA 5EY4A 2PGCA 1U2VA 5BN8A 1BIUA 4K4YA 2RN2A 1LXNA 1HKGA 3KNGA 2RB7A 4CFAA 3QNNA 4B3MJ 4IRDA 1FDBA 1WSJA 1D9AA 4G1IA 3GQCA 4BRGA 4AHUA 1HYVA 1ZA1B 2BMBA 4E2FB 2V0NA 1HQEA 4RUHA 2L41A 4H4MB 2M7SA 3PO4A 2QMXA 5FPEA 1JLBA 3CJ8A 1QD1A 3JQMA 5B0AA 4LF6F 2VG5B 4FVMA 3G6ES 3BYPA 3VQCA 2K7KA 2CJKA 3DHWC 4FJ5A 4TQSA 3AXMA 2LU1A 3UWTA 5KGXA 3Q8PB 4CH0S 2XGQA 1VC6A 3C16A 3IRXA 5CQGA 1NH7A 1K8AT 5KRTA 1CULB 1U2FA 1OO0B 3EE8A 1VDHA 5M1PA 4EP5A 2G8HA 2KQ2A 3QNWB 3IUCA 3CCLN 4NO7A 4FCYA 1QVGR 4DL5A 3AVNA 4ZVGA 2HHPA 4C8NA 1IO2A 2D69A 3CIPA 1ZAWA 1FD2A 1BY9A 3TPQA 1KD1T 5BPLA 3A2FA 2B8PA 4Z0UA 3CJBA 1JJHA 3O3LA 2W2PP 4BE0A 2IAJA 1HW8A 1D0EA 2OFGX 4LH5A 5AE2A 4LF8K 3KG1A 1KR4A 4JRQA 5MAOA 3R9PA 4DFMA 2J4RA 3SBTA 4JI5K 5MLCV 3TAEA 3OV7A 5B7WA 2QWOA 3AVHA 2FJAB 3K7RA 1RB0A 4HUEA 1K73O 1RT6B 4USTA 3P5JA 1YXQA 3ZETB 3UN2A 3BZKA 4MYTA 5I3QA 1TUWA 4H5TA 1REVA 3TABA 2DXEA 1T3VA 2RDDA 2HNZA 4FLWA 1VIOA 1MWQA 4DX7A 2KM8B 2GVDA 4TY8B 4FJMA 3FZMA 1Q53A 3S41A 2MKIA 2O8DB 4L3NA 5EWGA 1FWKA 5AR0A 1R6YA 3CCZA 3D2FB 4UQTA 1Z26A 1BO5O 2D74B 5JXSA 2H51B 1RBOB 4ZPCA 4J9OA 4E7KA 3D66A 2D3O1 5HQLA 3DC2A 3C3LA 4JLHA 4LC9B 5D4NA 2ZNZA 4QIVA 2FQQB 3NCRA 2IVPA 1FRXA 3IBFB 4NCAA 2VKRA 4F4XA 5D77A 3NEKA 3VPZA 2UXCJ 3V4IA 4QYRA 3AODA 2GQQA 2NS1B 4C4WA 4BQZA 2DH7A 1M5OC 2NXEA 4C3KA 1RHJB 3MGJA 3C19A 3L7OA 4DV2J 3BDEA 4JB8B 1X5OA 2UVRA 2P9IA 1HX1A 4MIBA 1VQ9N 3WNGA 5IFMA 2Q66A 4ZVSB 3ZZPA 5CCMA 4KGZB 2D9PA 4M3RA 4F26A 3MEDA 4PG7A 3DYAB 3I56N 3SQ4A 1NM1A 2V4QA 4H8KA 5AQYA 1FX4A 4WFAL 2WHOA 2YNGA 1UKUA 3HDSA 2B8QA 4HWIA 1VBKA 3S01A 3CE8A 2KKZA 3Q8VA 4M5KA 1FJGK 3ET6A 2IYIA 3PYGA 5F0XA 1KRPA 4GKKF 1RCOB 3H5YA 3D2EB 1CSJA 2O8FA 2LQJA 4OPHA 2V67A 1HBUA 4K4ZA 3FVYA 4BDPA 2ALZA 2M5YA 3N4QA 2HWTA 3SFGA 3ZEUA 3MM5B 4IJAA 4K0KK 2ROEA 2DKOB 4USIA 3I31A 5EVZA 1JKHB 3KMQA 5H9FK 2FUG9 2W2NP 3VEXA 4B1XB 1WG5A 2OP5A 2GFFA 3UI3A 1UZHA 1N6QB 2R7OA 2UZAA 4NA3A 4UQGA 2B51A 4F0HA 2P6SA 4KB7A 1XNQJ 1NMEB 2AJ1A 2UUBJ 1GMVA 3SNNA 1GXLA 2NXJA 4LSNB 3HPHA 5DK5A 5I3UA 4X64J 4ITSA 1JXLA 3W0LA 5J2PA 1X5TA 3BR9A 2WTFA 4NYFA 3ZT4A 1D4XA 3R7NB 5DG7A 4BRCA 5J1EA 3DM2B 3RBXA 4K4XA 1XMOF 5F8JA 2O8CA 2KN4A 3I82A 5HATA 1K9MT 1YTAA 4M63C 1YJTA 4CRJA 2WONB 4OZJA 5CZ2A 3W2WB 2OPSA 3U7JA 4X4TA 2QXFA 1IBMK 2D5RA 3KUGA 1PSDA 3SV4A 4ZJQA 1URRA 1WHVA 2Z2LA 1QVGM 1AZSA 3LH2S 2VQFJ 3V1QA 2VG7B 1FXDA 3NRBA 2DTJA 4XIUA 4Q2MA 1MWKA 2CZ9A 3GYNA 4O23A 3LF0A 4DV4F 3CCES 3FGUA 2MTLA 3IFEA 4CZJA 5L38A 4FZVA 4CJKA 1SZ2A 1N0UA 5IWAK 1HI0P 3D45A 1HIYA 2DR9A 1E4GT 4DBQA 2OZMA 2JWKA 3HHLB 2Q79A 3B78A 1XIQA 2YWKA 2L9DA 1KKHA 2WVEA 3NVMA 4K50A 2P9UB 3CC2S 1Q1KA 3JAMO 2PMWA 1KVJA 1WAJA 3TAMB 1X5SA 1Y97A 3CFPA 1F0XA 2G2OA 2BOAA 2JWNA 4O3RA 3NFAA 2P9EA 4HI1A 5I4MA 3KDNA 4OYBA 1Q8LA 2HURA 3O5TB 1S6QA 1TKTB 4KHPJ 4DPOA 1X4HA 1ESVA 2PEBA 4PWUA 1WSVA 1AFIA 5CZXA 4Y2IA 5E2QA 2J76E 3PR5B 4F3MA 5A2QU 3HP6A 1WSFA 1ZC6A 1RP5A 3CD5A 1EAYC 3BPSP 1HQ2A 1WAFA 1S1VB 2XLKA 6FDRA 2VKZG 4LF6J 4H0VB 1RT6A 1GTEA 4JI4F 2Z2MA 2ZM6K 4DR6J 2HGLA 3ZETA 4OYAA 5C24B 2EFGA 5CYMB 1ZBHA 4F3QA 2XRIA 2AA4A 4OL8A 2COLA 4RUBA 5EXWA 1MROA 1NG9A 4EAHD 3J81O 3HKWA 4YB6A 1J5EK 2F9TA 3R1XA 2G1HA 1CZBA 3MEKA 1U7LA 2RT3A 3DXMB 2LSNA 2OSRA 3O9SA 3LA0A 2QC3A 1RKIA 5G4DA 4J9PA 4B1UB 2HNDB 4B3SK 1ZBSA 1BWEA 5J2MA 2OPQA 2W7AA 4I9QA 2NXUA 5M2PA 4ZJLA 1IG8A 1RT3B 5IT4A 5HBMA 5IT9Y 4BG9A 2I1RA 3OR1A 4F0MA 4H5VA 4WE1B 2IVYA 5DS7A 1AYEA 3BYRA 3MR5A 1XN9A 2FF3B 4ZA1A 3QAEA 1ZH5A 4OX7A 5M2UA 3PSFA 1U1RA 4AXJA 4L73A 1TV6A 4IO1A 5IC4B 2V2KA 3MAAB 4DR4F 1IH7A 5C42A 2OTLN 3ZX0A 1UVIA 2FIUA 3ULHA 4NB4A 5T41A 5T7LB 3Q8SB 2HBKA 1PYTA 3H20A 4C11B 2N3LA 3IWNC 1H7XA 3RAQA 3K5NA 1IWAA 1NGBA 2E5HA 4MTPA 4ZCMA 3CDWA 4M5DA 4ED2A 1K1SA 4HDGA 3TANA 3FZ2A 1VI7A 2KZMA 2XNQA 4C2MA 3T1YJ 1F5CA 1SUQB 1FA0A 3P5BP 5KFJA 4NE9C 2ZH5A 4CHOA 3CJ2A 3VAJA 3LPTA 5AE1A 4PXCA 2BE2B 3GWCA 2MZJA 3PM9A 3ZT1A 1HHQA 3GLJA 4UOFA 3RG6A 3RB6A 4OI4A 3M5RA 4DV1F 2HK3A 4C1NK 1HD1A 2C2OB 2D0OA 4YUDA 2QW9A 3FZKA 1WC5A 3ZSRA 1FW6A 5LXRA 5LJWA 3AQOA 3KLHB 5THWA 5BR9A 2DVIA 4DF4A 3NP5A 3M2RA 4CP5A 2YH0A 1M1GA 2G2ZA 2W4DA 4QOZB 3CIZA 1N33K 4BRHA 4CZEA 4CNZA 2CJAA 1IKWB 4EUVA 1B64A 1C4CA 1IXKA 2W25A 2KH9A 1UAXA 5FROA 2DGSA 2P9PB 2AW0A 1KVIA 4EHUA 3TUPA 2IFXA 3OL7A 4O0NA 4K5SA 3CJ1A 3R5JB 4DX8H 2Z4PA 3ZSQA 2YHWA 4AL6A 4JAXA 1Y3JA 3B4MA 2CIMA 2JH3A 3Q24A 2BRKA 2CZ4A 2CFXA 3GDQA 2HFZA 5HJXA 5LOQA 3POTB 1WUAA 1GLFO 1EHWA 2W4CA 2GHWA 3NF7A 3QGHA 3B8AX 2VG7A 2ZJRL 4K2JA 1HNZK 3CT9A 3QT8A 1Q8BA 1SQGA 4N5SA 2ZC3A 3J7A1 2HVHA 3VERA 3H1VX 5BREA 3DRPA 2P9SA 4WFAQ 3NDKA 1RILA 1NJIT 1C0UA 3PSIA 1ASVA 4K42A 2RKIA 3NMRA 1SL2A 4DR7K 2NLXA 3BB5A 4FJNA 2NREA 3G96A 2P9UA 1VCTA 3RMAA 2MQQA 4YFUA 2CNOB 2YXLA 3RB0A 3M32A 1NK5A 3TAMA 3OJSA 1YJ9S 4A5AA 1HYSB 3DOKB 1GX6A 3T9NA 4GKJK 1H2VZ 1X60A 4AL7A 4RCHA 1WHWA 5J1NA 3P4UB 1VQNN 1UWBB 3V6DA 2DNLA 3US5A 2ZC4A 1T94A 3ATUA 4X65F 4DCPB 1N34J 1G4CA 2F4VF 3H1QA 8RUCA 3C15A 4LFBF 3SMPA 2IC3B 2W7PA 3ZZYA 4YOTA 3M8RA 5F1XA 4M95A 1S97A 4IDHA 1RAEB 4WPAA 3KLGB 1DKGD 2ZUAA 5AQMA 2Z0GA 3DOMB 1TMJA 3M05A 2H1YA 2DHAA 2B5JA 4KB1A 1VQ7S 3H46O 1S7HA 4JNEA 3H98A 1HR0K 5KFLA 3MPVA 5HJYA 1X8DA 1MMNA 4DSKA 1QM9A 3W3DA 3K0JA 1BE4A 3TSUA 3EEQA 4EK2A 4HACB 3QZ7A 5LJ3Y 3R5CA 2JX2A 3UIQA 2KRBA 3BN7A 2BKOA 2C2ZB 5D78A 3ZTSA 2VIHA 4I6MA 2HWHA 1DT9A 4A61A 3PRBA 3OTOF 4OX9J 4CGFA 2Z1GA 1LOTB 1WBBA 2P5VA 3AHPA 1WSHA 3NNAA 1OVQA 4CEEA 2EC0A 3HP9A 2HNDA 4CHZA 1EQMA 4UUWA 2W9CA 2NYIA 1N5SA 3QIDA 3RBZA 3RRHA 1YHQS 4LF5K 4DUTA 4W5RA 1BXNA 4WE1A 4ZVPB 1NHKL 1U1OA 1SJ4P 4JHDA 3VQPA 4I2PB 3ZNJ1 4FWQA 4JI3J 3AVFA 4DG1A 4GC7A 5D4LA 1OVYA 3M2VA 5HRNA 3TEGA 5AQWA 4P52A 1NDLA 3O5BA 1T8EA 4JI4J 4A4JA 4YY3K 3G71N 3AOBA 3E01A 3FEZA 5GAHU 1FNMA 3SCLE 1RAJA 5T7LA 2Q3SA 4DUYJ 3C14B 2PMZD 2R7RA 1NB7A 3UDLA 1ZBIA 2XMVA 2YX6A 3BO3A 3OFHA 4C0BA 2AQ4A 5DZ6A 2YWEA 4ECVA 2DK2A 1R31A 2VFRA 2EW9A 3FEXB 1YRXA 2GNKA 5KG3A 3LO3A 1GEHA 3VVTA 3NGRA 4N76A 3W62A 1KSPA 3QLHA 1XTZA 1YVNA 2QL7B 1FK9A 2Y1RI 4EO6A 4LF9J 2Y9HA 5FPMA 3FR0A 3CXCR 1XMQJ 1U47A 5JLHA 3W5XA 5KFGA 5M1QA 2W40A 4ETXA 1KQFB 4JYAF 1VLYA 3PHTA 1YJWS 3V6JA 4WFXA 2QIFA 1A9NB 2BBEA 1W7WA 3LPEA 2EFQA 3U9ZA 2XSJB 2ZF5O 4ZVEA 2EKYA 3EPIA 1Q9XA 4DZDA 2RJZA 1J5OB 2QMUB 2HRTA 3MEEA 4DDFA 4ZITA 5AZJB 1RU1A 2YX1A 5JLFA 3HX9A 3VQ7A 3Q86A 1Z05A 3UN5A 2HBMA 1IG9A 2B3TB 3IRWP 5A0YB 5GADU 4WYWA 5K5MA 1C0TA 5F8NA 1V3RA 2MZRA 1LKZA 1U8WA 1LWFB 4USKA 3BBBA 5HMYA 1T05B 2QA4G 1HJRA 2DH8A 4TSXA 4CZIA 3ILIA 3O1WA 2QKKA 3CFRA 5ETKA 1GLDG 2CPYA 2F9DA 4WXWA 4ELVA 2Q31A 2CPJA 3PKYA 3E1YA 4DS5A 3KHLA 3MMCB 2FSJA 1FXXA 3V9XA 2KRRA 1TUVA 1HNVA 4JI6J 3EZWA 4FVCA 2DISA 1AFJA 4YS2A 2ATLA 2A10A 4J5OA 2YKNB 2GS8A 3LP0A 1F1BB 2E5GA 4O8UA 4UW2A 4WQ4C 4BRKA 1VBYA 3FLCO 1VMBA 1M5SA 3W61A 1HWIA 3KUEA 4XO0A 3DU5A 2MEWA 3NGTA 3O1BA 4BDZA 5A8KB 3ENBA 1ASWA 2Q6BA 4WWSA 5C0YA 3FDSA 2C3PA 5B0GA 2F96A 1S99A 2G13A 2NRRA 1NEEA 3OSNA 4IEEA 4CO5A 1Q81T 1UA0A 2QEXS 5LM7E 4HYKA 1Q7LB 4GV6A 2DNPA 2HAFA 2XYHB 1MNEA 3C0BA 1DTTB 5DDOC 4J9NA 3WDOA 3PHEA 4CIFA 5LSRA 4NLDA 4EP4A 5EOYA 2BYCA 3EZOA 3H7HB 1VGYA 3B6BA 4M41A 3OXFA 4C97A 4DN0A 3KJNB 3ID6A 1OS5A 3T3FA 4JI0J 5GIOA 4YB7A 2RNEA 3DAWA 1NGEA 4FOIA 4BRNA 3CCSS 1B70B 2WCXA 2CVIA 2WW4A 4LMZA 4ILLA 1UVMA 4QIFA 1G7CB 1R43A 2BZ2A 1ITPA 3MEGA 4DTPA 4YOVA 3MCNA 3PX6A 2HHHK 4OGCA 3H0PA 3J80Y 3SQ1A 1IM4A 3E66A 2MHEA 4X4RA 2R9LA 5SWMA 1W26A 1X3NA 3CMQA 4HCBA 3BGFA 3PG9A 1HBMB 3KKRA 4BR4A 1LWEA 2LKZA 3MFIA 3MFHA 3DLGA 2FZKB 3EE3A 3DXKA 4A46A 3AARA 2I5JA 8AT1B 4OPKA 1N32F 1WEYA 1MA9B 3ELHA 5HN0A 4OYIA 1NMNA 3FNNA 4QQBA 4RW7B 1CEZA 4CF8A 1VSLA 2ZJRQ 5AQVA 4O3QA 2HFUA 4NLQA 2NNWA 2FHJD 4ZTJA 3NY0A 1LWXA 3M9OB 2E1MC 5FPDA 2WVCA 2CJBA 2DGVA 2UVVA 2OFHX 4DXLA 4WU3A 1MDUB 1HD0A 4NLRA 2E2NA 3CXCM 3D7SB 1VRUB 2ASYA 2YWHA 1WOSA 1Q7YO 4HL9A 3M8QA 2FPHX 2OANA 3G10A 2DHSA 3CNQP 4O5FA 5AZIB 2O8BA 4DFPA 4LF4F 4EWTA 5JJBA 2FSNA 4MKAA 3VEYA 2Q1LA 5T7BA 1VQKN 4ECWA 4XH1A 1FT8A 2RIJA 1S9EB 4UTGA 4A2AA 2E5JA 1U8SA 1N36J 1KNZA 4DMNA 4DQRA 3L0QA 3SXLA 4B9MA 2V34A 2IDEA 4CLZA 5DGBA 3G4SS 1GTHA 3SI6A 1BI4A 1RT1A 4NYOA 4CO3A 3MI7X 3ETMA 2XHCA 2EKNA 3OYEA 3HMJG 3GIKA 3FBCA 5DG9A 4P7TA 2DPNA 4B9QA 3D68A 1KN6A 5KFYA 1S48A 3QMLA 1S1UA 3QBWA 4AHVA 2PAVA 2M0GB 3ZZ0A 4WK1A 1Y3KA 3KK2A 2DCLA 5J2NB 3JYTB 4W5NA 1C1CB 4ES1A 3VALA 4CGIA 1ATSA 1RT5B 2ADBA 4FLZA 3DLKA 3WUHA 2AKWB 5AZJA 2O8EA 1NZ8A 3A1YG 1N4LA 3DRXA 1CPZA 2E1RA 1G2EA 3MURP 4J8FA 1NZAA 3FC9A 4JKEA 1OH6A 4Y00A 1YI2S 1VSKA 2O4IA 5D3GA 1DAXA 1KQSR 2QTWA 1U0HB 4CO1A 2CAJA 4AQYF 3VF6A 2HIYA 3CJ5A 1ZM3A 2J7WA 1KONA 4TU7A 4QWDA 3ZTPA 5ETOA 1U45A 4JRPA 2HHSA 2XMWA 3MMCA 3MCAB 1TUYA 3HHEA 3E9LA 2Z30B 5H9EK 4ZLPA 3J7YU 2E1PA 2FZGB 4IOCL 1S0VA 3HLUA 2O3DA 4CYUA 2WVDA 2P51A 4HVJA 1X4DA 1K8KA 5FIIA 2HQCA 3ZC4A 1K1QA 5EX5A 2VJUA 3L4QA 1JLFA 4CEDA 3UNGC 3KLEA 4NASA 1RTDB 5F3TA 4XEIA 5AXLA 3GIRA 2YY3A 1X31C 4O44B 4FM2A 2M88A 4LRAA 4FXDA 4EHTA 1R6VA 4Q5VA 2Q36A 1VQ5S 1DTTA 1U02A 4ER8A 3V1OA 4ICLB 3EO3A 1RWVB 3CCJN 2VODA 4H4KA 3PJ9A 1SJ3P 2AWZA 2EFVA 4KKOB 4JI1K 2UXBF 4F2SA 2OH2A 1RT4B 2X3DA 1OYDA 4FXWA 2E1ZA 2XEXA 3TVKA 1EKRA 4Y3CA 3WQUA 2VV5A 4U7UD 3NF9A 1QVFR 1SPBP 4PZVA 4BROA 4ILGB 4AUKA 1Y9OA 2ZJQL 3G0ZA 3BUZB 2E9ZA 3QRPA 3U9DA 2J8AA 4DR5K 4LQ9A 2MLXA 2Q3PA 2VYPA 4U7CA 4K5RA 5AQHA 5GADP 1YT3A 3GG0A 5KFWA 3KVGA 3MN9A 3QEPA 1JX4A 1OPZA 1VSIA 4URQU 4LRDA 2W2OP 3KWIA 2CA9A 5L46A 4E1JA 4JK9A 2RUSA 2BR0A 3N4PA 1H98A 3BPDA 1NGCA 2D3OR 2YH1A 3VGMA 2A42A 1KOOA 3A4TA 4X62K 3L8BA 1BA0A 4JI5J 4PQAA 2YKQA 3K57A 3V6KA 2Q2RA 1GLEG 4RW6A 3CCMN 3J81j 4NMXA 4DSEA 1HBMA 5KFKA 4CHQA 1DHMA 3C94A 2HLUA 2WOMA 3BEXA 2OHDA 5LSLA 4M5HA 1Q5YA 4X4QA 3HRGA 1B9DA 3C6TB 5BR8K 3ZTRA 3L3CA 4DV7K 2KTQA 2J6SA 4CJFA 1WOPA 1KFDA 1GOBA 4PWWA 3MMBB 2BVZA 2DNHA 1VSFA 1AXQA 4CJ3A 5KFNA 2DNYA 2BDPA 4OI3A 3O4NA 2IBKA 2RHSB 4Z37A 1RAFB 3GZ7A 2CPDA 4NLTA 1GMWA 1RHMB 3FSYA 5E5NA 1R7IA 1AUDA 3AVJA 1M90O 1RU2A 2V8PA 4FJ8A 3S3MA 2NPIA 5KT5A 3HD2A 4OJRA 1FI4A 4H0XB 3CMAS 5AQOA 2G8IA 4FWPA 4EO8A 5KGWA 3MUVP 1S9GB 2M70A 3EDRB 1UPMB 1PJ6A 5C25B 1TL3B 4E7HA 4L3QA 2JVRA 4CZCA 4RKUC 5L1JA 1NNDA 5BJRA 3RW6A 4V19S 1GAOA 3HOTA 3I33A 3ZSWA 3GP9A 3KIOA 2KB2A 4KQZA 2NUHA 4J9LA 1RK8A 4U6PA 1ITGA 2B56A 2MQMA 4A2BA 4DL2A 3U8XA 3DGPB 2C2DA 3MM8A 2RS8A 1HQUB 1VSJA 4K41A 4FYVB 3Q8RB 3I8DA 3LPYA 1WF2A 1N33F 4JI2F 1I1GA 1NM2A 3CJ3A 3N9UC 2NRZA 1HBOB 1MN7A 1HL6A 1DBDA 3CEDA 1DZ5A 4NPOA 1KQSM 4CJVA 5A2QY 3ENAA 2NLWA 1CJVA 2CJYB 3R1LA 4CZGA 4CZFA 1OYEA 5J2NA 1HKCA 4DV5K 5KQ8A 2DHXA 2ZGYA 2D1CA 5E3QA 4KSEB 3KJQB 4DKWA 4MMOA 3UDVA 3NGDA 4M45A 3R7SB 2JNJA 2VG6A 1B4SA 1QUVA 4FYWB 2CH6A 3HBTA 3BO2A 2B9WA 1P8ZA 5K8NA 6AT1B 2E6LA 5GMKa 3VGUA 4OI1A 1I94K 1NSQA 2GUIA 5MLCQ 4LF4J 2Y0BB 3A8KA 2AZ3A 2FLOA 1KC8O 2BQRA 4KIAA 4C48A 3Q83A 5KG0A 2ZOFA 4FPAA 2EEYA 3CJKB 1JL1A 5H9FJ 2VWBA 4AHCA 3ZZTA 2F3JA 5SUHA 2E29A 2PFFB 1U0HA 2PI4A 1FRKA 4PQUB 3H3OB 2EG2A 2A6MA 3I32A 4BRDA 3QSIA 2I8EA 4JV5F 3FFKB 4CJ7A 3C65A 3R1HA 1Q82O 1M1KO 3IR5B 3AO4A 1T6CA 4IG0A 4FBUA 1VAZA 4DV6K 3VQQA 4K4SA 1WOOA 3D28A 3HO1A 1YBUA 3R2DJ 4CGDA 2U2FA 4ECXA 5D6GA 4H0PA 1KLMB 1IQZA 1TL1A 5EN1A 3ULEB 1QVFM 3ILLA 1UZDA 1U26A 3A13A 3L09A 1I3OB 5F41A 2GO8A 5AJ3K 4EBCA 1WSEA 3P6YC 2IPOB 3EVWA 3OL8A 1XQIA 2DNZA 5HLFB 4ELTA 3CJCA 3HHLD 4DQIA 1KFSA 1BCMA 1S1TB 2Y3YA 1P8GA 3BSNA 3CC4N 2JEJA 3IMXA 4RNMA 3T1HK 5LSOA 5DDRC 5CZ1A 2Y1LB 4TY9A 1RA6A 3AFGA 1HR0F 2GBZA 3G71S 1QSSA 2OEKA 4NOHA 3Q89A 4B02A 3HHDA 1VQSA 3WHIA 4FLVA 2FZCB 5JVGL 2IHR1 4AH9A 3R6MA 3PIPL 2DR7A 3V6HA 3IS9A 2YI1A 4B1YB 4RR5A 4QAGA 2G8UA 3KFWX 4OI0A 4DR3K 1S72S 1BQMB 4TXSA 2BUPA 5L39A 1ZETA 4R8UA 2E2QA 1IQTA 5A8RB 4ELUA 3CDBA 3DMJA 1EJ7L 3QZ8A 3WQTA 2Q0UA 4X4SA 3R3LA 1MU2A 3A5LC 3RAXA 4PABA 2HZCA 4FS1A 1TL7B 4DSLA 3QMQA 1HPMA 1UWAA 3QDKA 1JL2A 1EARA 5U47A 3SCKE 1TK5A 3TUJC 2ZWOA 4XH5A 1T03A 3B6PA 1Z4UA 1E4FT 1RNHA 1V5IB 2VU5A 3PW5A 2ZM6J 2UUAK 3C46A 3KDOA 3FCHA 2HBYB 1IN0A 5KT4A 1FRLA 4IOCQ 3MN5A 3G86A 3L4IA 1VRTB 3C6TA 2YX7A 3VESA 1EKEA 1J5EJ 3MMBA 5E0OA 3AJDA 3V9ZA 2OMLA 3OL9A 4A48A 2MDAA 3D1HA 2XLJA 1X0FA 2R7VA 1RUSA 4YHHK 3OR2B 3SUQA 2ZDOA 1CJKB 4B3SJ 2IJRA 3SYZA 4H4OB 1VJWA 2DGXA 4A8XA 4F3OA 5KFEA 4LSLA 1FXRA 3RU0A 4B3TF 1XNRF 2ITMA 3KLFA 4YP3A 3I5AA 3E51A 3FEYB 3CIMA 4N8NA 4NYNA 3DLEA 4YR0A 1P1TA 5HP1A 1TL3A 1JCFA 3MD1A 1T9WA 1TQLA 4F04B 4PL8A 3HVTA 1JJ2M 2UUCF 4CLPA 2HNYB 2R42A 2L08A 2ZJQQ 5F3ZA 3ZYYX 3EUNA 1H72C 4LVNP 3OVSA 1VSMA 2B6AA 4D3HA 3KD1E 4RW9B 2W9BB 2QKBA 4G9ZA 3F73A 2EHGA 3OYIA 4KFBB 2QN6B 3LWLA 2P9KB 4P9SA 3D0HE 2BX6A 1YX2A 4J9SA 5E3PA 1A0OB 4IO8A 2MKSA 1VQ8S 1HWJA 3OYJA 1RTJB 3NGYA 1GK8A 1X9MA 4M5IA 1OQ3A 5F8GA 1NU4A 4KI6A 3R9LA 2UVWA 1E6VB 4P73A 1BOTO 3SCIE 4JD2B 3LTOA 1TUGB 2HQIA 4FF2A 4UZBA 4I2QA 1C0MA 5LMNK 5CCLA 3QICA 3WNEA 3CJKA 4Z7CA 2MZQA 2F63A 2WUSA 3R97A 3RBEA 2LA6A 2ZVSA 4WP3A 3TOQA 2CG8A 4X66K 3NGSA 2P6TA 5DQGA 1N5YA 4ZP6A 2WVBA 4D3GA 3MWTA 3F44A 3PJXA 1G1XA 3EE9A 1FKPB 2X1GA 1DFDA 5F9LA 4RWWA 3Q22A 1N33J 2VC1A 4PKIA 3AQPA 1Q8IA 4LBIA 1XR5A 1NSAA 1VLOA 1WEXA 4PWDA 2LMIA 3JSYA 2DHGA 3KWGA 4DU7A 2X1BA 4PKGA 1T44A 4X4OA 1YIJN 3B8HA 2M9KA 2CQ2A 1FNOA 3EN9A 4OYMA 3O80A 4KYZA 1UVNA 3GOIA 4JKHA 4ZPBA 3GFXA 1F6TA 3TAGA 3MXJA 2IIRA 3FFIA 3VAMA 1VQLS 4NCGA 3SQGA 3OYMA 1VQON 4QYZK 2PSZA 4RU2A 1JJ4A 4WZMA 2OPRA 3MWBA 4C98A 4DV0F 3SSQA 4JKFA 4USVA 1X7VA 1EX8A 4YMEA 3EICA 1FF2A 1HNZJ 3OUYB 2HGMA 1L3VA 3S1TA 3TQEA 2DFHA 4BR2A 1FRJA 5M2RA 2RMLA 3K5MA 2XY7A 5ETQA 2QXLA 1VOMA 4TU8A 2OKQA 1F9EB 2MLYA 3ZTQA 2CQGA 4DLGA 4XPEA 4DR7J 3DJCA 1HRHA 5TKYA 3G8TA 2HVZA 1T9YA 2UYTA 1W2IA 2UU9K 4CHPA 4S0MA 3VF0B 4BCAA 5HVFA 5GAGU 2G2YA 3OHAA 4PXDA 4GKJJ 2HSTA 2V7YA 3THYB 5FD1A 4HTUA 1H3DA 2CNLB 2JZ5A 3ENVA 4QBUA 1U0SA 3SK3A 1F2HA 4ZP7A 3W3SA 3CDAA 3AA2A 3PLAA 3ZT2A 1TAQA 2XYPB 4C8MA 3I9V9 4DHVA 3H5XA 3OYFA 2VICA 4PYDA 3UO0A 4IZ9A 1MG7A 5ETMA 1RABB 2X78A 5CR4A 2A5XA 3GV7B 1S1XB 3VTHA 1MWZA 3FRYA 2HMIA 1S1WB 4LFAK 5L1LA 3U1LA 3I5BA 5DM6L 2ZZNA 1RTIB 4O3OA 2ZHAA 2GELA 1YTUA 1HR0J 1BL3A 2QMWA 1H74A 3HSGA 5A8WB 4WP9A 3TWHA 1TL4A 2BEFA 1AA1B 2F65A 4OZ3A 5KOWA 3D67A 3GJTB 3BH6B 1TKXA 2XHBA 1KEKA 2DH9A 4KHMA 4LF7F 3U02A 3F41A 1ZM4A 4ECUA 1NU0A 1X4CA 2RS2A 4IQMA 4ED4A 2XNRA 3CVKA 4J2DA 4ECTA 1K0VA 4CW7B 3KJFB 2QSFA 5E7OB 2E2OA 3CCRS 4CM0A 1D9DA 5ETLA 3BY5A 3BSAA 2PBDA 3AOCA 2NUUG 2I7NA 3CJAA 2F40A 3MPYA 2VUGA 5CD4A 1Z25A 1R0AB 4ZCKA 3UCZP 2HS4A 1YITN 3JXOA 1SJQA 5CA5A 2N3OA 4NI2A 5JVGQ 1TMMA 1CS4A 3PIPQ 2OPPA 5JICA 2UXDK 3GYXB 3LUYA 1JK9B 1HLWA 1LK5A 4ZP9A 5G0RB 2XM3A 4KI4A 2YCHA 2W9BA 3AY0A 2CGLA 4UZCA 2ZH7A 4N41A 3H5SA 2FY1A 3GPAA 3M6XA 1NWKA 2Y0SD 1WG1A 2J5AA 1YQHA 4JV2A 1SB6A 4W98A 3I9ZA 3W1YC 5ADXA 2XMUA 2PN6A 5D0HA 3U1NA 2VPYB 4FSVA 2NYHA 3VGSA 4WCEL 3I0SA 3QIPB 2FJEB 2WZ1A 4QU7A 2VJVA 2DNRA 2CNNB 5I3PA 3D1OA 4ES3A 2KVQE 2KJWA 1S79A 3OBIA 2FGOA 3J7ZT 2QFIA 4UY8T 4O0IA 3IKMA 3MR7A 3WNHA 2PYLA 3GE1A 3QFUA 1L3TA 2Z57B 2WSFC 1F5BA 2VOOA 5L9NA 1RBTA 1AB8A 2K8GA 3LAKA 4WFBL 3V1RA 3MXHP 1VS3A 2P9CA 2CQPA 4M1KA 1CQNA 1UW9A 2AEMA 1KP6A 2HVEA 2YNHB 4CFCA 2CPXA 4YDUC 1VSDA 2F9JA 4F36A 1C1AA 3WEEB 1NPRA 3MECB 3DRYA 2J6UA 4GMKA 2FHMA 3BSOA 4FKYA 3NHGA 3CCUN 3LP1B 2X74A 2NRTA 3H5UA 1T3NA 3O3GA 3MHYA 2QRRA 1HNXF 2BE7D 4FF4A 3WZ0A 1S6PA 2Q6CA 4RW4A 5GAEU 4DTJA 2BRLA 2FD2A 4LFCF 3QJJA 1HKBA 3SAHA 3QRQA 1I39A 3SBGA 4FPIA 5D0EA 2ASPA 2HB5A 4EBDA 1QTNB 3MR6A 3MM9B 4LH4A 4CNYA 3OUYA 4AHTA 1IJJA 2HLTA 2OTJN 1YF5L 1FERA 3OTCA 1YJVA 3OHRA 2B4PA 2A40A 1RKJA 1NSKL 5F2RA 1RBRA 4DR1K 1QSLA 4N47A 3AB4B 2GIRA 4JBCA 3VQ8A 1VQPN 4FL9A 2LQBA 4C9DA 3MDQA 3OFEA 5BYSA 3CJQA 2VZ9A 3NBPA 2R3VA 5KG7A 1LCUA 3V5RA 1NUEA 1RA7A 4HR2A 2DHHA 1SJ1A 3K9JA 4CZMA 3BGRA 3TJ9A 3MR3A 1XC3A 3IR7B 4AF1A 3ZT3A 4YOEA 1E6YB 2OYQA 1YVFA 2YNFA 1RGIA 3ZZRA 2J0QD 1ZBTA 1ZYQA 4WQ5C 1Q5VA 2HBLA 4FK0A 1RWMB 2V7ZA 3D5MA 4DV0J 5C10A 2MMYA 2CKWA 1BA1A 4OJ3A 2E7WA 3CO9A 4J9VA 2HRUA 4HT5A 3TA0A 2LU2A 2FLPA 2ZBCA 4PG6A 2KXNB 4EBEA 4ZVRB 2HHHJ 5A8WA 2X1FA 4YNQA 4R5PA 2DNQA 3HOSA 3RAMA 2APOA 2WB1D 4MK7A 1TVRA 2ZBIA 3R7BB 1QE1B 2OEJA 4C8ZA 2QWLA 2YKMB 5FLXU 1JLCB 1P6TA 4BR9A 3OLAA 5B0CA 4OJ1A 2OA8A 2DJWA 2MSSA 4CESA 3ZT0A 1J27A 4EFAC 3NGZA 4B3MK 3VQ6A 1FDDA 2KDOA 1I3AA 1DLOA 3KKFA 3OYGA 2DGQA 1SV5B 2A1BA 2LQ8A 3TTCA 2W8LA 3ISNC 5C2CA 2VCPA 5AXKA 1H0HB 2UXCF 3LDQA 1SBRA 4G1QB 5E41A 2R8JA 3UW1A 4K4WA 1CLQA 2HWIA 4DV2F 2X51A 4P6QA 5M1KA 4FWRA 2PO4A 3UFCX 5FDLB 1RHKB 3KHHA 1TZ0A 4L74A 2Y8WA 5HANA 2A1RA 4JEPA 4E89A 3C6UB 3LANA 4WTYA 1ZS6A 1UCNA 3NNHA 1EIYB 3K0SA 2QLBB 4LF7J 1X4GA 1PJ7A 1QAJA 3OTEA 3ZO7A 2G8FA 4FZXC 3TARA 5JS1A 3NS6A 4JI8F 3AO3A 5DETA 2VGNA 3NMUA 4NEZA 3FMBA 4BRLA 3MN6A 3LDOA 1K8AO 3QYYA 2PT0A 2SXLA 1WC3A 4ZPAA 2HVIA 1HNIA 5DM6Q 5HL7L 1S49A 5AFUA 4P74A 3L3VA 1Y5NB 5KFCA 4LRCA 3D6TB 3GR0A 3MPDA 3MR2A 3HPGA 2MXYA 4JS4A 1R27B 3S6EA 1UFLA 1KD1O 2ZNYA 4ED3A 2W2QP 3BF3A 1RDDA 4ECYA 3CCQN 1YJ7A 3H4BA 4OV1A 4DX6A 3NGIA 4NLUA 4B3RK 1F9FA 4FWKA 1XNQF 5HRPA 2YNHA 1RE1B 2BANA 1FD8A 4FYDA 3GFZA 1RBSA 3WEEA 3W64A 3QIOA 1EQYA 1DRZA 3V9SA 4X64F 1G15A 1M5KC 4FZYA 2HF4A 3MX2A 2L3MA 3CMEN 5A6WA 1GXTA 2NRXA 2HVDA 1D9FA 2D0CA 3L2WA 1RWPB 3L2RA 4RX6A 5KG1A 3LP1A 3ZZZA 2EXUA 1MWMA 4XPCA 2GGPA 3OL6A 1OY8A 1VQ4N 2GJFA 3EL2A 3A3NB 3VQSA 1EXQA 5H9EJ 2P9NA 4MH8A 3TZZA 3CCVS 4Y0FA 1D3WA 2JJ4D 2XI2A 2R7XA 2RILA 4DB3A 1YJNN 3IAYA 3NS7B 4TKTA 2CGKA 2K3IA 2E7XA 2R7QA 3DHXA 2R8HA 2FDNA 3J8AA 2VQFF 2YQ1A 2QX0A 3MM9A 2DFFA 3AA8A 3T5LA 1QQMA 1F21A 3KHGA 1GQEA 4MK8A 2Q43A 2PC6A 3B82A 1HMVB 4FDFA 2G4BA 1W7AA 1MN9A 3OLBA 3P39A 4QS9A 4WCEQ 4KH6A 4KY3A 4DUZK 1SH3A 4FJ9A 3N0VA 5AQTA 2W01A 1TKZA 5IS2A 3SQOP 4E7LA 3FSXA 2CQHA 4JI1J 1RI7A 2XGPA 2QZ8A 3BO4A 1T0TV 4MKYA 1JLQA 3TRGA 1BU6O 1A6LA 2HMPA 1NCLA 3H4DA 1MWYA 4NLBA 1A5VA 5KG4A 5KT7A 4LR7A 3GIIA 3NH1A 1NXIA 3MN7A 4LFCJ 1SL1A 3QFWA 3DI6A 5FRNA 1E6YA 2KYXA 5M1OA 4KHPF 3DRRA 4WFBQ 4DR5J 3EGVA 1VHIA 4CHNA 2PFDA 4KGMA 3MPWA 1LW0B 4Q2LA 1KTVA 3NAEA 2HS0A 1PBUA 4XTTA 1T11A 4W4MA 3BKFA 1JLGA 4MLHA 4WU2A 1NK8A 2UUBK 4YN3B 3DOLB 1Q0NA 3P4IA 3HXMA 2IJNA 2W42A 3L4BC 4DR6F 5IM0B 4X62J 2E1AA 4CLSA 5KPTA 1V3ZA 5GINA 5GAEP 1X4FA 3QO9B 4PPDA 3RSEA 2MJUA 4ID5A 2NZTA 3V81B 4M5LA 3PV8A 2OELA 2IVOA 3T41A 4PUOA 3F56A 4IKFA 4AILC 2KLAA 3D6RA 4OLAA 3D3CJ 3VA0A 4R25A 5AQLA 2MKYA 2R2RA 4EIAA 4NXMK 3PRDA 4PEOA 4F4YA 2C28A 4DV7J 3LZJA 1NJXA 1FFSB 2RF2A 3AO1A 1R8HA 3NWRA 5KFPA 1FX2A 2POKA 3CF5L 1DARA 2HPUA 2VBYA 2BJ9A 2YPZA 3NGKA 2KFNA 1OH8A 1YDLA 2AF6A 5KFVA 3GG4A 2E5LK 4NRTA 3M1VA 4OHZA 1K9MO 1QAXA 2XULA 3FQLA 2HQDA 3MCPA 7FDRA 3WXKA 3HSJA 2JC1A 3AVGA 4G1QA 4PPZA 2B4JA 4MK9A 4RWTA 3FGVA 4MIAA 1SC6A 2FVPA 1H6KX 1VQ6N 2MQPA 4HDHA 3F9KA 3TYTA 3D2WA 2FYXA 3BV8A 2WSEC 4I6WA 1DGKN 3G87A 2ZD1A 5EWEA 5FDLA 5C15A 4Y2CA 2O67A 4FLXA 3GTYX 3GJRB 2G8WA 1DQ8A 3W9JA 5KFXA 2K1RA 1QTMA 4O4GB 3W5YA 1L3SA 2IMWP 2CPHA 1FO1A 1QQNA 3CTRA 3RR8A 3PIOL 2W1BA 1KAYA 4N77A 5EGYA 1RYRA 1RYSA 3T1YF 2Q97A 1XJWB 5LL6d 3NG8A 4X2BA 4PG8A 4OZLA 2B0GA 2L48A 4NLOA 2I0XA 4H54A 3BEGB 1GLLO 5CHCB 4J9MA 2VPXB 3QPIA 3HTVA 4PL7A 1OSCA 1U6FA 4CK3A 3CM5A 4JV0A 3HFKA 2XG8A 3P5TL 4Q45A 3SMSA 3VF2A 4B1VA 2FHJA 3M6GA 4OZ2A 2HRYA 4DV5J 1LEOA 2GO9A 2J7KA 4NYZA 4LF6K 4RBVA 3FBFA 3VR1A 3KLIA 4NA1A 3NCIA 2YWGA 5BPMA 3A8IA 5K20B 3KMSA 1Q95G 3U3GA 2QA4N 4QW9A 1KBRA 3FCVA 1TK0A 1I94J 3LL3A 3DLBA 3D6FB 4FF3A 2D0PA 2GEMA 4BC4A 3BM7A 3ENQA 4NLWA 1WDTA 2EFOA 3M8PA 4DI6A 3G82B 4DL0C 2HOEA 2MYFA 3G25A 1KCFA 2FC0A 2DO4A 3AJ1A 2P5OA 4CE9A 4IR9A 5KFIA 3L2QA 1RDCA 5D8HB 3ZTOA 3ADAC 4ZKAA 4JKGB 2RH3A 4DV6J 4LREA 1C6VA 2XO6A 4JI8J 3N79A 3NH0A 2QL9B 4FKXA 4GMJB 4GY2B 3GONA 2F8TA 3E2EA 2RE2A 1M5PC 3O44A 4ZP8A 2VQEK 3PRVA 5B8HA 4M42A 3QBXA 1EWQA 1Y10A 3ITHB 1FDAA 3IA0A 1RT7A 1GLCG 1GX5A 2X3GA 5K8OA 3G6EN 1T95A 2YPYA 1W9HA 4PG4A 3R6LB 2GMHA 3NKYA 1IKVB 2RDJA 3JSRA 4IDKB 5I42A 1JJCB 5AJ3J 3EKUA 4Y0WA 7AT1B 1HMVA 4CIEA 2D3UA 4O8KA 1IKYB 2BW2A 2QA1A 1UJ5A 1BLUA 2IRUA 4E19A 3AVKA 2E66A 4QJVA 3T1HJ 4FJJA 4IFVA 3IMQJ 2BJ1A 3H40A 2ASMA 4B3OA 1S0OA 4KO0A 2ASLA 4G3IA 4Q0BB 4J2BA 2RU9A 1BISA 3TZWA 3Q7BA 3O9RA 2MHNA 5HL7Q 4N7TA 4P2MA 1U1MA 2KZZA 1BC6A 4WKRA 4M3ZA 4C23A 4ENOA 4CF9A 1HWLA 3HI0A 2JLFA 3QJLA 4IOAL 2NPFA 4DR3J 1N34F 4WYLA 3OS0A 1QY7A 1BQNB 1LW0A 1A5WA 4USJC 4CF0A 1Y5IB 3SPZA 4MDBA 3Q2SC 5F0WA 4CEBA 4UUXA 4B08A 1VQYA 2KW4A 4H4MA 3BJYA 1WD6A 4V1Ak 2G1DA 3DOLA 3VQ5A 1NOZA 4FM0A 2VG5A 2B9YA 3CPWR 2YNIB 4HEA9 2MQ8A 5E3CA 5KFTA 4GVLA 3THVA 2XMAA 3JS9A 4Q43A 1CQMA 3U3YA 2KO1A 1RT2B 1XR6A 1FDNA 2VL1A 5KG2A 1R59O 3G8QA 3WBZA 2UUAJ 1WSIA 1CULA 1BWVA 4OX9F 5IT9O 4CJSA 3CDEA 3VCDA 1EETB 1R0CB 3GSIA 4IH7A 2XLIA 4GKKK 1SIZA 2V94A 1NGIA 4MFBB 3OT9A 4CZLA 4CF2A 5IOLA 1VBXA 4USMA 1NGHA 1OH7A 4FWLA 2B7BB 4FYXB 2B9XA 4YHHJ 3FK4A 3TSPA 2KYZA 1FEHA 4FWMA 2IJFA 3CCWA 3JAMU 4LIWA 3F9MA 2KU7A 5D4OA 4KHUA 5KG5A 4JI3F 1PKUA 2ERRA 2QM1A 1FHTA 1UEKA 1RWKB 3CJSA 4F67A 3MUTP 3K9KA 1FWPA 4GVBB 2H54B 3IG1B 4DTMA 4MO5A 2ZOMA 1EX4A 4DUYF 1NRKA 1RBVA 2QSWA 1D09B 1CC8A 1XMOK 3N5BA 1VSHA 2DPIA 3F2KA 2YWFA 1WKKA 2BTFA 3FKBA 4IFYB 2ACMA 1VK0A 4TY8A 3P3DA 4RWXA 4KRFA 2O8DA 4ZHRB 1RADB 2HQ3A 2BW7A 5KFMA 3VGVA 2YKPA 2OUGA 3D2FA 2K3KA 1WWHA 4KAIA 4MIWA 4WK3A 1NJIO 3N6NA 4TLRA 3T5JA 1HNWF 4X4PA 4QR0A 4LF9F 2FVRA 4YB1P 3O08A 1XMQF 3KKSA 2YKOA 3UVJB 1HA1A 4HHTA 2I38A 2QYGA 3IAM9 1SKSA 3J81U 3UCUP 4IRCA 4TVAB 3KTQA 3OXLA 5CH7B 3TTDA 2J9EA 2BH1A 4CIGA 2U1AA 2WC9A 2H5EA 3UNYA 4DV4K 4O3SA 4DTOA 2AX0A 5K8PA 2BACA 3IN5A 4KPYA 1Q78A 4F0KA 1WEZA 3AA3A 2CG4A 1B7YB 4OMFG 4OYWA 2RHKA 4Y1CA 2CPIA 1VQMS 3VAIA 3CQYA 2BJ7A 2I9SA 3MTKA 3W9HA 2OGUA 2Z2ZA 3CF5Q 2PY5A 3DYAA 1TYQB 2OMOA 3IGNA 4KH4A 2V5HG 3MMAB 4MKBA 3AGRA 2GIFA 3KLVA 3BREA 5KFHA 2JRSA 1JMTA 2BJDA 4MKVA 1EP4B 3GV8B 2JSXA 3AOAA 3WXMB