3JSMA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
total genus 144
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jsmA05
1S1TA 4MFBA 4QAGA 4NLSA 4KHNA 3ZSXA 2FBVA 3C95A 3SUNA 3AVGA 1JLGA 4O4GB 3KLGA 5EWFA 1RT1A 3KTQA 3KK3A 3AA2A 3AVIA 1U48A 4PUOB 4K4UA 1Z25A 3L2UA 3K5MA 4M94A 1EP4A 1HQEB 4I2QA 1S1VA 4XPEA 3PO4A 3L8BA 2WONA 2VG7B 2GV9A 3B6OA 2ZD1A 1S48A 4CF9A 2OH2A 4NCGA 3Q8SB 4BE0A 3OL8A 4IDKB 3BJYA 5KFFA 3BQ1A 1KHVA 3CWJA 3VQ6A 1X9SA 2R8KA 2XY7A 5DK5A 1EX4A 3PJXA 3CQ8A 3EPIA 2KQ2A 4DTJA 3RB4A 4E7KA 5KGWA 4ZVGA 1RBRA 4LSLA 3BSAA 1ZBIA 1X9MA 1S9GA 2DFEA 3AVJA 4M3RA 3BGRB 3NH1A 3LZJA 4NRUA 4CFBA 4J9PA 2DFFA 2ASLA 3LP1B 1CXQA 4LH4A 4M3YA 4HUGA 5F8JA 4F4WA 4TN2A 4E19A 3PHEA 3ZSZA 2O5DA 1MU2B 3MXJA 4QW8A 4FJ9A 1S1WB 1TQLA 1BGXT 4DQRA 1KFSA 5KFSA 4EBCA 3DLKA 3CDWA 1T03A 4MIAA 4EP5A 4CIGA 2HMIA 4B9NA 1LW2A 1C2PA 4CJEA 4ICLA 4ED1A 2PYJA 3PO5A 1UA1A 4DQSA 2FVSA 4DL5A 2YKNA 4IG0B 4FM0A 3V4IB 4NLXA 3I5AA 4NLDA 2IJNA 4N5SA 4K4XA 1S1UA 3UQSA 4URQU 2OPRA 4C8NA 3OYGA 2XCPA 4DL3A 3P83D 4O4GA 1R0AB 2JEFA 2D0AA 3SI6A 4E1NA 2YHAA 3NH2A 4TY9A 4MH8A 3T19A 4RU9A 3H4BA 3P1GA 5HRSA 1N4LA 5KFJA 4IBNA 4JRQA 4URGA 3NF8A 3HVAA 4M3TA 1RYSA 2HHTA 1NK6A 5L1IA 2AGOA 2E9ZA 3L3UA 1RT3A 4ID5B 2C28A 1S0OA 4U6PA 4EP4A 3KJVB 3V6KA 2HWHA 1IG9A 5T14A 4O3RA 1QE1A 4MK7A 5FRMA 5I42A 4ED0A 4ED8A 2IM0A 4ED7A 1N5YB 4XPCA 4NLRA 3MAQA 3MEGB 1ITGA 2RDIA 4CJKA 4GC6A 3WNEA 1L3TA 1TK8A 4B9LA 3AO3A 2PZSA 4DFPA 3GIIA 2XY8A 1RDCA 2W8KA 2X6SA 4DFMA 4TYAA 2A1SA 2FLPA 3NAEA 4MK9A 1HNVA 3IG1B 3QIDA 3UPFA 2E4LA 3MEDA 4KHSA 2HVIA 4TY8A 5CYMB 3E01B 2UVRA 2IGIA 4CF2A 2IDOA 4KHQA 4FLUA 1Q9XA 1N6QB 2C2EA 1TVRA 2HAIA 3NBPA 2YNFB 3IAYA 1QAJA 1Z4UA 1NKBA 1TKXA 4ZMMA 1TL3A 3HHKA 4M41A 5F9NA 4AHSA 1RYRA 3MFHA 5EU7A 5J2MA 5KG4A 3LWMA 4DQIA 3Q8PB 3KK2A 3RAQA 1VSJA 5DQHA 5KG5A 1NOZA 3K57A 1Q8IA 3V1QA 1BQNB 4E7JA 4Q43A 3VQCA 5HP1B 4ED2A 1CZBA 1LWCB 1KSPA 3TWHA 2IS3A 3QGIA 3KLVA 5DLFA 4ECZA 2B6AB 4FK0A 1SV5B 4G3IA 4JV0A 5KT2A 2R8JA 1WAJA 3QINA 4DSJA 3ZSOA 4O44A 1EKEA 4HCCA 2ZKUA 3IN5A 5HROB 4J9QA 3G10A 3KK1A 4DU4A 1HYSA 3CJ5A 1S49A 3M9MB 2AJQA 3DRRB 4NYZA 2KTQA 5SWMA 5KFAA 1QSLA 3NAHA 4AILC 2Z1IA 1J5OB 4C8OA 4KKOA 4MIBA 1I6JA 4ECVA 5KFCA 1C1BA 4RW7A 3IRXA 4BWJA 3QIPB 2HNYA 1KLMB 4DWIA 4KB7A 1U45A 4YR0A 3AA3A 3CVKA 3AO1A 2G8HA 4L8RB 4K4SA 2BANB 1S6QB 4F4ZA 2YKMA 4BDPA 5FDLB 3GILA 4KV8B 1EETA 2FJVA 1RTJB 1RT7A 2IC3B 2XCAA 3OS1A 4KREA 4QOZB 2F8SA 2JLEA 3D5MA 4LH5A 3AO4A 4HVJA 1CXUA 1HMVA 5JXSA 3NGDA 1D8YA 4ZP8A 5F8HA 4CJQA 1RDDA 3PX4A 2W42A 3BREA 5KFTA 4Q8EA 2W7PA 1RILA 2HHQA 3S9HA 5DG8A 2FJWA 1SL0A 3AVKA 4DEZA 4DL4A 4URSA 4N76A 4Y2CA 3PX0A 5HP1A 1U49A 3O4QA 3DM2B 2J6UA 3T5KA 4PQUB 5FRNA 1D1UA 4KHRA 1UAXA 4NLTA 1S9EA 4CGFA 3OYCA 3U3GA 4CGHA 3DOLB 4WE1B 5KFOA 3VQ5A 1REVA 3M9NB 1T7PA 4KB0A 1WSIA 2UUWA 2XI3A 5KFMA 4O3PA 1L3VA 4ELVA 3DRRA 3DDKA 3KD5E 2BRKA 4KTQA 3H08A 4FXDA 4FJJA 4O3OA 2J6SA 2Z1HA 3KKSA 2OA8A 1NKEA 4O0IA 1X1PA 3ZT2A 4DL7A 2ILYA 4IR1A 3DI6A 1RT5A 3DOKA 5JS2A 2FBTA 4KHWA 4CE9A 4GC7A 3GIKA 3ASMA 2HB5A 1I39A 1IKWB 1LWEB 3QEPA 4OLBA 4B3OB 1S6PA 1S1XA 3F9KA 4RW6A 4QWCA 5KRTA 2DFHA 1YTAA 1F21A 4NLYA 3FQLA 4FVMA 3HK2A 3HM9A 2WTFA 3GIMA 5C5JA 1BIUA 4BDYA 3T1AA 3NL0A 5KRSA 3H5UA 4ZTFA 1C1AA 4Y34A 2GUIA 3C6TA 4DL2A 3AVLA 2ETJA 1HNIB 3CDUA 3QNNA 1D5AA 4OGCA 4Y1DA 5J2QB 4RW8A 3HVTA 2IBKA 1SUQB 2IAJB 1RTIA 3CJ0A 1NJWA 4KB1A 2C2RA 2B5JA 1CSJA 4ZVEA 5KT7A 1JLCB 4W5OA 4NYFA 1SL1A 3GQCA 4FLXA 3THVA 5KFNA 3HXMA 4KFBB 4WXOA 3O4NA 1TAUA 4OPKA 3MFIA 3QLHA 3C94A 3LPTA 2VG5A 3DYAB 4PQUA 2IA6A 1XHXA 1VRTB 5KG6A 4ED6A 1W25A 4GW6A 3RBEA 2GC8A 1IKXA 2HNZB 1QUVA 5KFUA 2FLLA 1RA6A 4Q0BB 1ZETA 3VQ8A 1Z26A 3RRHA 5HLFB 1LW0B 4Y1CA 1BCOA 4DSIA 5J2NB 2VA2A 3SFGA 3NCIA 4WZQA 4DTPA 4DLGA 2AGPA 3V6HA 4JS4A 3V6DB 3N6MA 3QEXA 1RT2A 3KLIB 5J1EA 3FDSA 4RNFA 4J2EA 3V9WA 3PVXA 3G6YA 3HPGA 1RT6B 4KTWA 5L9XA 1B9FA 3OLAA 2OPQB 4FK4A 3TAGA 2BQ3A 3CDEA 3ZT3A 4DTXA 2I1RA 1TV6B 4CFCA 5KFVA 1JLAB 4HHTA 3DLEB 4I9QA 5KFXA 1VRUA 4CF8A 2E9RX 2VWJA 3QESA 1JXEA 3NF6A 3RR7A 3DMJA 3TAPA 3CM6A 3NF7A 2P51A 3KLFA 4DS4A 5I3UB 4E7HA 2I5JB 1OS5A 4CGIA 3NGYA 4JUZA 3L2QA 4ZPDA 4DSLA 3V9ZA 2RF2A 1UWBA 3MR2A 4U7CA 4J9OA 3I0RB 4BDZA 4R8UB 1FK9B 3C6UB 4K4VA 3Q8RB 4J2AA 2ALZA 3M8QB 2YNIA 3OSPA 1BCMA 2YNGB 3DLGB 3HP6A 3DLRA 5KG1A 2IJFA 4AHUA 4N56A 3I0SA 3DRSB 1L5UA 3OHAA 4HUEA 4FK2A 5K14A 4J9KA 3MR6A 1TKZB 4K4YA 4CESA 5KFZA 1LW0A 3CG7A 1U04A 5KGXA 4FJLA 3T3FA 2JEGA 1DTQB 1A5VA 4PA1A 2C22A 4WYWA 3MR5A 3V6DA 1JL2A 2G8FA 4ZPBA 4JS5A 1UOCA 3VQEA 1LAVA 3LP0A 3DLHA 2R8IA 2R2UA 1FKPA 3RWUA 4FLTA 2ZQBA 3IS9B 1RAJA 1JXBA 3PZPA 1HPZA 5JS1A 1O1WA 3QEVA 2FJXA 4K4ZA 4ECTA 3TI0A 1WSJA 1VSKA 3DLEA 3KMQA 1WNSA 3GYNA 1NK9A 3RMAA 1SKWA 2B43A 2WB4A 1ZTWA 4CF1A 4EEYA 5HRPA 4RNNA 4CJWA 1JKHB 4IH6A 1N48A 4NYNA 3HVRA 1FKOB 1JX4A 3HPOA 3ZSRA 1ASUA 3ZSVA 1NJXA 4CJLA 1KTQA 3KKRA 3T5LA 4M95A 4CK1A 4IRCA 2OPSA 2EC0A 5KFLA 3VQDA 2YV0X 1IKYB 1BHLA 4C8LA 4M3WA 4R5PB 1VSMA 4F8RA 4CF0A 3H2LA 3LALA 3CO9A 1QAIA 4DTSA 4UQGA 5KFPA 1JLFA 2YHBA 4IG3A 4CEDA 4QWAA 4OGEA 3KLEB 5CYQB 4IRDA 3OYDA 5JUMA 2RKIB 1JLBB 3KLHB 2HNDB 3M8PB 2ZE2B 2AWZA 3QGHA 4I7FB 4N41A 4IOBA 1KRPA 2OZSA 4PUOA 3IGVA 4YNQA 4O3NA 4CEQA 2KFZA 3OYJA 1ZBLA 1HQEA 1RT4B 3GV7B 1NK4A 4LSNB 4FJIA 3QYYA 5L1LA 3SI8A 2VG7A 3OS2A 3MXIA 4FJGA 1C0MA 4G1QB 4XIUA 1W9HA 4N47A 4IDKA 4FBUA 1CLQA 3ITHB 2OZMA 3CFOA 4W5RA 4B08A 2XI2A 1FXXA 1NHUA 5F8LA 4NZ0A 2O4IA 4AHCA 3P5JA 5E41A 2XGPA 5DLGA 3TR8A 3BGRA 3LP1A 4FM1A 4WZMA 2RPIA 1TKTB 4PY5A 4Z4EA 2HHSA 3AO2A 4NLGA 1EXQA 1RDRA 3RTVA 3AVCA 1K1QA 1MU2A 3H40A 4CEBA 4J9RA 3OYNA 3LP2B 1S1WA 2CKWA 4PWDB 5KT3A 2Y1JA 2Q3SA 4M3ZA 2AGQA 4Z4CA 3AVMA 2R8GA 2R2SA 4RW9B 3AA5X 3V1RA 3OYEA 4FM2A 3TAFA 3ZSQA 2G8VA 4LY7A 2BE2B 4BE1A 5DG7A 4DTNA 2G8WA 1BISA 4NLVA 5C42B 2W9CB 1QSYA 4IG0A 3H5SA 3KLEA 3V4IA 3RBDA 1IH7A 2ATQA 3M8PA 4H4OB 1KCFA 1VSHA 4NCBA 3KHLA 4OVLA 3O3HA 3U6FA 1WSHA 3SPYA 1R0AA 4IR9A 1WAFA 1I3AA 4CJVA 4GMJB 4CEOA 2D0BA 3SYZA 3M9OB 1RBTA 1GOCA 4E89A 1NK7A 3Q8QB 4FS2A 1A5XA 4C8KA 1IO2A 1IM4A 1VK0A 3JSMB 3L2RA 4H4MB 1XWLA 4ID5A 4GVMA 2D7SA 3FSIA 3LPUA 4BWMA 1S0MA 4FJXA 3KJVA 2UVUA 3UDLA 4M3UA 1YTUA 3MEEB 4F3TA 4DU1A 2XO7A 3TAMB 3HPHA 2XWYA 3PV8A 2Z1GA 4IKAA 4F4YA 1N5YA 1HRHA 5CY4A 4CHOA 1D9DA 4J9NA 4KBIA 3MEGA 2OYQA 4DG1B 1LAWA 4WXWA 4O4RA 1DTTB 4IFYB 4J9LA 3EZ5A 1C0TB 2XC9A 3VQ7A 3LANA 2F8TA 4DSEA 2IOCA 1ZTTA 3K2PA 4KTZA 3SV4A 4KAZA 4QPXA 1XC9A 3LP2A 3IG1A 2HHWA 1SH0A 2J6TA 4EZ9A 4KO0B 3NE6A 1C1CB 1RTDB 5CYMA 3E01A 4RG8A 5J2PB 4FCYA 2JGUA 3SQ4A 4CCHA 1N6QA 5EDWA 1D0EA 4KHUA 4TXSA 4DTUA 3QO9B 1C0UB 4ZPCA 4DU3A 4FJMA 3AO5A 3FFIB 3DRPB 2YNFA 5L1KA 4FZZA 1VSFA 5KG2A 4ZTJA 4FJHA 4ELTA 4ECYA 3SCXA 4FW2A 1HJRA 3TABA 3OYLA 4RUAA 4HUFA 4CIEA 2X74A 3OSNA 3NKYA 1BQNA 1LWCA 3L2WA 3K58A 1GOBA 3MR3A 3KIOA 2B6AA 1SV5A 4QCLA 4J9MA 2JEJA 1RBVA 3QEWA 2XY6A 5HROA 3OS0A 4ZPAA 4QWBA 5KFQA 3KNAA 4DLEA 4CEAA 2JC1A 1BI4B 3VQBA 4ZHRB 4IFVB 4CJ4A 4CIFA 1JLQB 3RMBA 3OVNA 4DG1A 1J5OA 3GV8B 4FLZA 4NRTA 4DMNA 2IMWP 2QXFA 1BQMB 3RB6A 1C0TA 4WFXA 2FVRA 5C24B 2X78A 2ATLA 1NOYA 5C25B 2BRLA 3QIPA 4JLHA 5HBMB 3NH0A 1KLMA 4CEZA 1TL1B 4YP3A 3PX6A 1T3NA 1SKRA 2GIQA 3BSOA 1RDBA 4TYBA 2BANA 1S6QA 3MECB 3B6PA 4O55A 5FDLA 4KV8A 4EZ6A 3VA3A 4TQRA 4I9LA 1RTJA 2IC3A 3CFRA 4RW4B 1C0UA 4FJ5A 1VSDA 4K4TA 3SQ2A 1NJZA 4ELUA 3AVNA 3VQAA 3OYAA 3OJSA 3TANA 1S4FA 3H4DA 3WNFA 4FLWA 1L3UA 1HQUB 3NFAA 2W9BB 4DTOA 1RDAA 2GBZA 3LAMA 1GX5A 4W5NA 1X9WA 2PYLA 3VQQA 2UUTA 4NLPA 5KFWA 4FJNA 5DQIA 3V81B 1T05B 4O3QA 3GIJA 5EWEA 4CEEA 3DM2A 4B8AB 3EPGA 4ECRA 3NGZA 3O3FA 1U09A 3DOLA 3ULDA 4I2PB 4WE1A 4KI6A 4M45A 4LD0A 4OPJA 1JL1A 4E1MA 3KHHA 4CHNA 3SPZA 4NLWA 2FVPA 3ZSWA 3JYTB 4K8XA 1S1TB 4MFBB 2CJQA 4O3SA 3AA4A 3BSNA 2Z1JA 1JLGB 3NMAA 3KLGB 1RT1B 3KK3B 2VA3A 1ASWA 1YT3A 3PW5A 1U47A 3HYFA 4FJ7A 1EP4B 2Y1IA 3S3OA 1DLOB 4I2QB 1S1VB 5KG0A 2QK9A 1HYVA 1IKWA 1LWEA 4B3OA 4MK8A 2VG6B 2WONB 4M3XA 1CZ9A 4LQ3A 2ZD1B 2YNHB 1VSLA 3HO1A 4NCGB 3D45A 4OLAA 3G0ZA 3OYHA 4ED3A 2W9AA 4AHTA 4C8MA 1Y97A 3I8DA 1LWFB 1HARA 4CHQA 5KG3A 3SJJA 4CHPA 3SV3A 2G8UA 1HNIA 1S9GB 3OYFA 5KG7A 2EHGA 5J2QA 5F8NA 3RMDA 2UVWA 3SFUA 4DTRA 1SUQA 2R8HA 2IAJA 2KZMA 2PY5A 3CJ2A 1JLCA 4CGGA 3CJ4A 3PW2A 2E6LA 4KFBA 4EYHB 4CECA 4FLYA 3DLKB 3DLBA 1T03B 1J54A 3DYAA 3BDPA 3PW7A 1VRTA 2HMIB 5KFGA 4Z0UA 1NHVA 4H8KA 2HNZA 4WYLA 1LW2B 1NNDA 4ICLB 4Q0BA 2BQRA 3TAEA 4Q44A 5HLFA 5EWGA 4E3SA 1SH2A 4EYIB 4EBDA 5J2NA 2BR0A 2HWIA 1QSSA 1NKCA 3LZIA 1S1UB 2OPRB 4IKFA 1S97A 1B9DA 3GV5B 2E9TA 1JIHA 2QKKA 3KLIA 3SUOA 4ECUA 4J9SA 1KHWA 4Z4GA 4WFZA 2WCXA 4CJTA 5KFIA 3H98A 1DLOA 4E0DA 1YVUA 1RT6A 4RNMA 4FBTA 1NK5A 2VG6A 1TP7A 2OPQA 2YNHA 1WN7A 3PR4A 3HKWA 1TV6A 1JLAA 4RUCA 1RT3B 1TK0A 4FZYA 2WOMB 1ZBHA 1LWFA 1QE1B 2O4GA 3QZ7A 3OL6A 3V9UA 1NK0A 4DFKA 5I42B 2KFNA 4JRPA 3MTKA 2V9WA 4RZRA 2DPJA 1VSEA 3OYKA 5I3UA 3IGNA 2I5JA 3S3MA 4CEFA 2V0NA 4Z4FA 4R0EA 4NLUA 4TLRA 4AHRA 2EX3A 3I0RA 4R8UA 1FK9A 1HNVB 3C6UA 1N56A 3H5XA 3MEDB 4TY8B 3M8QA 3L2VA 3K59A 2YNGA 3DLGA 3K5NA 4EBEA 3PUFA 1G15A 3AVBA 5F8GA 3HL8A 4ZP9A 3ICLA 4YFUA 3DRSA 3ZT0A 1MMLA 1KVBA 3ISNC 1KVCA 1IKVB 1TVRB 3NBPB 4J2DA 4QWDA 1TKZA 1Q9YA 4CJRA 3HVWA 2XGQA 3N6LA 2HHUA 4TSXA 5KT4A 2W8LA 4KHYA 1DTQA 3SNNA 3SUQA 2AX0A 1TKXB 3QEIA 3TARA 1TL3B 3NGIA 1JLEB 5J2MB 1RA7A 4CJ3A 3KK2B 4E7LA 3QETA 2XHBA 4ZP7A 2V4QA 3VQ9A 4XO0A 3IS9A 4CHYA 4IH7A 4Q45A 3G6VA 1WNEA 2RDJA 5KI6A 3VQ4A 3RRGA 2P5GA 3I5BA 2FLNA 4KSEB 4O44B 3SQ1A 4DSFA 1LV5A 4FJ8A 2WOMA 3TQ1A 3KK1B 3AV9A 1HYSB 1XHZA 1JKHA 3RAXA 3NF9A 4DQPA 4MQ3A 4HKQA 2B4JA 4FS1A 1FKOA 3U3YA 3N6NA 3H5YA 1K1SA 2FVQA 1NK8A 4J2BA 3LWLA 3SZ2A 2D5RA 1VSIA 4X2BA 4KKOB 4QWEA 3PW4A 1IKYA 2W7OA 1C1BB 5KFRA 4RW7B 4Z4IA 4R5PA 4DFJA 3IRXB 2HNYB 5CZ2A 3BSCA 5KT6A 2WK4A 3WNGA 1TK5A 2D3ZA 4FW1A 4KE5A 5CYQA 5EUHA 2YKMB 2RKIA 1JLBA 3KLHA 2HNDA 4CK3A 4KPYA 3F73A 3QERA 2ZE2A 4E7IA 1S9FA 1EETB 4YR2A 4O5BA 1RT7B 1D9FA 4KAIA 5KFYA 4I7FA 4MKAA 1IKVA 4F4KA 5DGAA 1ZYQA 1SL2A 4FJKA 1J9AA 1HMVB 4B9SA 3BQ2A 3HJFA 2D3UA 2IM1A 1RT4A 1S5JA 5CZ1A 3OYMA 2D41A 4LSNA 1B92A 1GOAA 4CJSA 1JLEA 4G1QA 2QKBA 3ITHA 5T7BA 4HTUA 3QGGA 1ZBFA 3CFPA 5D3GB 2GIRA 3G86A 1S9EB 3HSTB 5HRNA 3T5JA 3O3GA 2KZZA 3RB3A 3OLBA 2LSNA 1RTHB 3V9SA 1A5WA 1YVFA 3AVAA 3V6JA 3QIOA 2HHVA 3MF5A 4IH5A 1REVB 2JC0A 3OYIA 4F2RA 2DY4A 2IM2A 2BGGA 1TKTA 4Z4HA 2RN2A 4CFAA 1J53A 2XY5A 3UR0A 3VQSA 5F8MA 4W5TA 4B9VA 4PWDA 3DI6B 3NHGA 1RT5B 4FLVA 4DTMA 2FC0A 3DOKB 4YMEA 4RW9A 4KI4A 3LAKA 2BE2A 1BL3A 1S6PB 2BDPA 1S1XB 5C42A 2W9CA 4RW6B 4DF4A 4B8CA 5DGBA 2R2RA 3PJWA 1ASVA 3S3NA 2ASDA 3OY9A 4H4OA 4KHMA 5KT5A 3NAIA 2NUBA 4JV1A 2P1JA 4IRKA 2JEIA 3CIZA 4EO8A 3OL7A 4RNOA 3C6TB 1QTMA 2D0CA 3AVHA 3H59A 4ZVHA 1SH3A 4DS5A 3EZUA 3D0PA 4RW8B 4F3OA 3HVTB 4CJUA 2F8EX 1RTIB 5DQGA 3JSMA 2B5JB 4Y2AA 5L1JA 3K5LA 4H4MA 3SUPA 4CFDA 2C2DA 4DSKA 3OHBA 5KFEA 1C6VA 3WNHA 3M8RA 4ID1A 3MEEA 1WLJA 3V1OA 1NJYA 1RBUA 4OKJA 2P5OA 2HW3A 3QLHB 2VG5B 5D3GA 3TAMA 4DQQA 4CGJA 3KD1E 3HT3A 5KFBA 2A1RA 1IKXB 3ZT4A 1RTHA 4W5QA 4JV2A 4NLOA 4FZXC 2R7YA 2HVHA 1DTTA 4IFYA 5DG9A 3VQPA 2AX1A 3BR9A 3K5OA 2VWKA 3T5HA 4NCAA 2QE5A 4ZP6A 5SZTA 1ZBUA 3TAQA 3PW0A 3KOAA 4O0JA 4ECQA 3RR8A 3LP3A 2FBXA 1RT2B 5J1EB 3CM5A 4KO0A 1C1CA 1XR5A 1RTDA 5F9LA 4DF8A 4FYDA 3ZSYA 5J2PA 2AQ4A 3V9XA 1KVAA 1XR6A 4Y3CA 3QO9A 1RCHA 5KTQA 3RB0A 3PR5B 3OJUA 3KHGA 3FFIA 3DRPA 4B9MA 4H54A 4CHZA 3CJ3A 1K6YA 3TVKA 1VRUB 5KFHA 4F4XA 4Q8FA 3G6XA 1KLNA 3VN5A 2X6NA 4B9UA 4Q5VA 3DMJB 5FROA 2V4RA 2KW4A 3BQ0A 3E51A 4K4WA 3KLFB 3FRZA 1TGOA 4OKEA 4AH9A 4OKKA 1T94A 3NDKA 2OPPB 1TKDA 4TQSA 4CJFA 3A2FA 2RF2B 4ZVFA 1L3SA 4BE2A 1UWBB 1U4BA 2BQUA 3KMSA 1WSEA 2G8KA 1SKSA 3RMCA 2ILZA 2YNIB 4LSLB 1BI4A 4ZHRA 3FQKA 4AHVA 4IFVA 4HYKA 2ASJA 1JLQA 3I0SB 3EY1A 4CJPA 5K14B 3LDSA 1BQMA 4F2SA 3QZ8A 5C24A 3OL9A 5C25A 3L3VA 2R2TA 3HP9A 3OYBA 4KRFA 5HBMA 1TAQA 5KFDA 1TL1A 1GX6A 4RNHA 4IQXA 1BIZA 4CK2A 3UIQA 3ISND 3ALYA 1T8EA 3M8SA 3LP0B 4YQWA 4LQ9A 1W0HA 3EYZA 1RNHA 2G8IA 3MECA 1QQCA 4ECWA 1QS4A 1FKPB 3ZT1A 2DPIA 5F8IA 4OL8A 3VA0A 2DTUA 1S0NA 2FVCA 4DL6A 2AU0A 1KFDA 1WSGA 4RW4A 1HPZB 1JXLA 4EO6A 1XR7A 2IM3A 4CERA 4B9TA 4F50A 4NLQA 1HYZA 1XI1A 1WSFA 4M42A 4ECSA 1QHTA 1HQUA 1S10A 2W9BA 4HCBA 5HRRA 3ZCMA 2ITGA 2FBYA 4K8ZA 2E6MA 3V81A 1T05A 4ECXA 2UVVA 4OJRA 2OPSB 4MKBA 4QW9A 3MXMA 4CGDA 2WHOA 2OPPA 3QNOA 4WFYA 2XRIA 3PY8A 5KFKA 2HHXA 3SQ0A 5DMRA 4I2PA 2WRMA 3AVFA 2QV6A 2F96A 4CJ5A 3I5CA 4BACA 1UA0A 1JLFB 4IG3B 2YKNB 3D28A 1RBSA 3CYMA 4K50A 3KHRA 3JYTA 4YR3A
chains in the Genus database with same CATH superfamily
4MFBA 5ETNA 4CBUA 2FBVA 4WFBQ 3SUNA 3AVGA 3E1YA 3KTQA 3AVIA 1U48A 4K4UA 1Z25A 2ZH7A 5AQYA 1DAXA 3NWGA 1YRXA 4B3RK 1RAFB 2WONA 2VFVA 3FZBA 2GV9A 2KXHA 3B6OA 1U1QA 3BBFA 4OZ1A 4CF9A 4FYWB 2OH2A 4P10A 4BE0A 1G99A 1NDPA 1ZPWX 3KJFB 5KFFA 3BQ1A 2HGLA 2VD3A 2FQQB 3H20A 2Z57B 2GUPA 4HEA9 1FFSB 2W01A 3CQ8A 3LF0A 4V1Ak 2H1YA 4DTJA 4ZVGA 1RBRA 1ZBIA 1F9FA 3J7ZT 4CLZA 3NH1A 4CFBA 3LP1B 4FWNA 1CXQA 3TR5A 4LH4A 4M3YA 2W24A 4DR6J 2PFUA 2HFUA 2O5DA 2DNZA 1MU2B 3MXJA 3SAFA 4DPOA 4FJ9A 3FSXA 4DQRA 3CCMS 4EBCA 1DQAA 3CDWA 3TJ9A 4JI7K 3K0JA 3VF4A 4MIAA 4EP5A 3O5BA 1X5SA 4QR2A 3FSYA 3WXKA 1FVQA 1X4GA 3GJQB 4ZLNA 2PYJA 4DV5J 1UA1A 1RAAB 2FVSA 2P9UA 1BWFO 2JJ4D 1VIXA 3V4IB 2GV1A 4USVA 4NLXA 4DUZK 2HBRB 3I5AA 2ZGYA 1WKKA 4J91A 1FDAA 2IJNA 4N5SA 4BRDA 3ZLJA 4JHDA 2YWEA 4YB6A 2KN4A 3P83D 4M7YA 4E1NA 2YHAA 4MH8A 3H4BA 1EQ0A 3P1GA 3CD6N 3GFHA 1N4LA 5KFJA 2VC1A 1UJ6A 4URGA 3NF8A 3HVAA 1WEXA 5L1IA 3L3UA 1RT3A 1Q4RA 5B08A 2GGPA 4U6PA 1S0OA 4YDDB 3V6KA 1F3FA 2HWHA 4MDBA 5T14A 2P9IA 3VPZA 1QE1A 5FRMA 4B3TF 4ED8A 2AA4A 1FJGJ 1V9OA 1GQEA 1Y9OA 3FZFA 2J0WA 3OVAA 2P9PA 2GO8A 3A12A 1FEEA 4FWMA 2QWMA 1VHIA 4FYVB 4B9QA 3CD7A 4GC6A 3SCIE 5EX5A 3Q89A 1O6XA 1MROA 2DHAA 2DR5A 5LL6d 3GIIA 4BREA 3KUEA 1VQPS 4UOGA 4H0YB 1QQOA 1MN7A 4TNOA 2FLPA 3SJHA 3NAEA 3IG1B 2DGSA 3BBBA 3UPFA 4ZPVR 2E4LA 3MEDA 2VKZG 3RUBL 1RKJA 3M1VB 2IGIA 2R4FA 4CF2A 2GQQA 2PSZA 4KHQA 3QRPA 2JFDA 1XMOK 1TVRA 4JKAA 1UVIA 1Z2LA 5ETKA 2KKHA 2V69A 4HH1A 2AJ2A 3KWMA 3IAYA 4U9RA 4CZIA 2LMIA 1OVYA 3U1LA 5DDOC 3MCNA 3QFUA 1TL3A 1RDWX 4K2XA 1OYDA 1Y00A 1AB8A 2AJ1A 3LWMA 5GAGP 2GQCA 1VCTA 3UFCX 3RAQA 1VSJA 1YJWN 3PNIA 1NOZA 3K57A 1CPZA 1C4AA 1Q8IA 4F7VA 2NPIA 3MCAB 3VQCA 4M5JA 1TMMA 4BRLA 2CQHA 2Y8WA 2YKQA 2D9PA 3POTB 4JV0A 5FLXY 1YDLA 4OX7A 3QMQA 2ZKUA 3IN5A 5HROB 4PXEA 3CF5Q 4J9QA 3VEZA 4DU4A 5B7WA 1AW0A 1HYSA 1S7HA 4HDHA 3M9MB 1KD1T 2DCUB 2AJQA 2RHQB 3OTEA 5SWMA 4EHUA 2XG8A 1QSLA 2DIVA 5C7PA 2Z1IA 1VRQC 3CC4N 1ZBSA 2F9DA 4DPUA 3ZZTA 1MMNA 4C8OA 4KKOA 3ULHA 3MDFA 2YJEA 1K8AT 3D6MB 2CPHA 4CDIA 5C12A 4BWJA 4LF7J 4B1VA 5FPNA 2HNYA 1O8BA 4QIGA 3CC7N 3MM6B 4KB7A 1RAEB 2F5GA 3CVKA 3BGFA 3AO1A 4CZGA 4YY3J 2PI5A 2M70A 8AT1B 1PSDA 4BDPA 4BGBA 4KV8B 3B82A 2ZJRQ 2VICA 2IDEA 1HNZK 4KREA 4QOZB 2LLZA 2F8SA 1BWVA 3AO4A 5JXSA 4HDGA 4ZP8A 1SQEA 1UFWA 5F8HA 4CJQA 3BREA 3ID8A 2MJNA 2W7PA 1N33J 2HHQA 5DG8A 3OTOK 2FJWA 4DV4K 3FLCO 4DEZA 1NWKA 1NJIO 1ROFA 3CPWM 3HBTA 2CG4A 3PX0A 1A9NB 4V19X 5FRNA 1M5OC 1UAXA 2PD1A 4FDFA 4CGHA 3POTA 1NGJA 3NRBA 2ZH3A 5KFOA 2HGNA 5AZIB 3M9NB 1FD2A 3O4WA 1T7PA 4B3MF 3KXDA 1Q82O 4O3PA 1L3VA 1G2EA 3KD5E 4ZA1A 3C15B 2E5LF 4WKYA 5CR4A 4OV6A 3KKSA 4LR9A 1X1PA 2YQ3A 3CCWA 4IR1A 1JJCB 5LJVA 1BMQB 3ZZ0A 3DOKA 5E33A 3TTFA 1KAXA 3LH2S 4F02A 4B3OB 5A8WB 3W61A 4YHHF 4RW6A 4QWCA 4OX6A 3HZEA 3I87A 2MHEA 2P6SA 4NWBA 1K0VA 4FVMA 2ASMA 3HM9A 2GWJA 3GIMA 3T1AA 2NS1B 5KRSA 3H5UA 1HHSA 4CI0B 4Y34A 2GUIA 2NXEA 3LOUA 3BH7B 5IM0A 4PKIA 3QNNA 3MCOA 3D0HE 5DM6L 4RW8A 3RW6A 3HVTA 2ZJPQ 2IBKA 4J8FA 2WVFA 2C2RA 3C14A 3MM9A 2Y1RI 4FLXA 3J80Y 4B3TK 4WXOA 3O4NA 1FF2A 3C8YA 2EEYA 2VG5A 3JTOA 1VHXA 2VWBA 5DRKA 4Y65A 3GYXB 1XHXA 1VRTB 1DY3A 4ED6A 1U2FA 2GC8A 1FJEB 3D2FA 2VA2A 3SFGA 1M1GA 2YTCA 4WZQA 2G0CA 4LF4K 2HBZB 2CVIA 3V6HA 3V6DB 3MM8B 4JNEA 4FWRA 2K3IA 1TR0A 4P52A 4J2EA 1FWLA 3SCKE 2V51B 3EDRB 1LOUA 3G6YA 3HPGA 5M1QA 3QAUA 3OLAA 2OPQB 4DV6K 2J9DA 1O13A 2VZ9A 2RE2A 3TAGA 5AE3A 3CDEA 4KPCA 4IZ9A 4I9QA 3VESA 2E9RX 2XLJA 1MWYA 1SVDA 2JL9A 2FF6A 2Y0SD 2IVMA 3CM6A 3LDPA 1F3VA 3NF7A 1VQMS 3GDQA 4E7HA 2IVYA 3NGYA 4JUZA 3L2QA 2FSJA 4KH5A 4JAXA 5HMWA 1UWBA 3ZNUA 2CNLB 5HAOA 3ZEUA 4EGLA 3AQPA 3VEXA 2YPYA 3M8QB 2YNIA 4LT6A 3CCSS 2V7YA 6FDRA 1CJTA 4H5RA 1EZZB 2IJFA 1YBUA 4N56A 3I0SA 3DRSB 1SIWB 2WW8A 3HJVA 3CF5L 2PFFB 1T95A 3OHAA 4FK2A 4K4YA 1FRMA 5AQKA 2YWHA 2NZTA 4FWKA 1U04A 5KGXA 5HJXA 1A5VA 4KJIA 1IUJA 3Q7BA 3SQOP 3V6DA 1VYAA 5I3PA 1JL2A 1YRTA 4ZPBA 1FNXH 3AGKA 1HR0F 1Q81T 5FD1A 3CGIA 3IBFB 2R8IA 2UUBK 3RWUA 3E2EA 3IR6B 5IQQA 3J7Z5 1QM9A 5GMDA 3TI0A 1NK9A 4WFNQ 4CF1A 4EEYA 1RWMB 3OFHA 4CJWA 3N4QA 3HVRA 2XMUA 1J5EK 4CJLA 3OFGA 1RXOB 4KH0B 1KTQA 1IBKK 4EFHA 3ZYYX 4M95A 1CS4A 4KH6A 2EC0A 5KFLA 3VQDA 2YV0X 1IKYB 1BHLA 4GO5X 4CZFA 2G9OA 4R5PB 1VSMA 4CF0A 1EARA 4BG9A 2C42A 3LALA 5AXKA 3CQYA 4DV3J 1NGGA 2YHBA 1TYQA 4IG3A 2A41A 1UEKA 4QWAA 4C2MA 3RW7A 4MMOA 3KG1A 3GL1A 1JLBB 3KLHB 3NCRA 4C11B 4KBOA 1RBLA 1C4CA 1E6YB 2AWZA 3QGHA 4CYUB 4H5NA 1VAZA 2MZJA 4YNQA 4O3NA 4CEQA 3OYJA 1ZBLA 1NSKL 2AV5A 4I6WA 4LF8J 5D4LA 2RRBA 4DV0K 4USJC 4ZPTR 3OS2A 3W0LA 1QY7A 2MLYA 1T9XA 3NMRA 4IDKA 4FBUA 1CLQA 4ZJOA 2R7SA 3PYDA 2HWTA 3CFOA 4DN0A 3CUNA 4FP9A 2XI2A 1NHUA 3HMJG 1JNRB 2O4IA 4AHCA 3QGPA 5E41A 3P5JA 5A2QY 5IT9O 4LFBF 2ZKTA 3GLJA 4AL7A 4KGVB 1UVMA 4K43A 3MWPA 4FM1A 4JP8A 1Y7PA 2DB1A 2PC6A 4WZMA 3JAMO 1TKTB 4PY5A 4Z4EA 2DXFA 4P6QA 3M30B 3MMBA 4NLGA 1OKJA 4C3LA 4RX6A 1NGBA 3B8HA 3RTVA 4J9RA 1S1WA 2CKWA 5EGYA 4EAHD 3D0IE 1AFIA 3QMLA 3K0SA 4B3RJ 3V1RA 4FM2A 3FCVA 3D6RA 4N77A 2P9LB 3NNAA 4DTNA 4NLVA 4JKGA 2W9CB 3JSBA 2P6TA 5AJ3K 1RHKB 3GCWP 2L48A 4KGXB 1IH7A 2ATQA 1KCFA 1VSHA 1OMSA 2N3OA 2KDOA 3HSJA 3THTA 2ZBRA 4P71A 3CQXA 3MTJA 1WSHA 5ETLA 4KGZB 3SIPB 3AXMA 3R7NB 1KAZA 1SPBP 4E89A 2ZWOA 4ETZA 4YB7A 1OQ3A 3UN5A 3MN7A 1U0SA 1IM4A 1OYEA 5I4MA 2HVEA 3JSMB 3ULEA 2RB7A 3CETA 4H4MB 4CNZA 4ID5A 4GVMA 2JRSA 3LPUA 3M8YA 2VOOA 1OQ6A 3BV8A 1URNA 3FUYA 3AAPA 3FNNA 5AFUA 3PRDA 2XWYA 3H1VX 2NNWA 1HBMB 2UXDK 1N5YA 5CY4A 1D9DA 1GTHA 2FLOA 1IJFB 3HSCA 1KEKA 3FEXB 1VQ7N 2WSFC 4CIOA 4O4RA 1DTTB 4IFYB 1I1GA 4DUZJ 1P1TA 4J9LA 1BA1A 2M7SA 1MA9B 2C2OB 1QVGR 1M5VC 3WHIA 2M3DA 2VBZA 1VQ5S 1SKUB 3GSDA 3VGSA 2ZNYA 1SH0A 2H4YB 4EZ9A 4UW2A 3LDNA 1RTDB 1VBXA 2FJBB 2NRXA 3BB5A 2JGUA 1FERA 1N6QA 2QO3A 1QHAA 3CT9A 4TXSA 2OIHA 2LQ9A 1WACA 4JBCA 3AH6A 1XUPO 4DU3A 2DRAA 4FJMA 1IBLF 3AO5A 3DRPB 2LECA 3EICA 2YNFA 5JLHA 2YWKA 4CLLA 1ZXOA 4FZZA 1RK8A 2ADCA 1SJ4P 4ZTJA 1KDNA 2KXNB 4FW2A 4RUAA 1OPIA 3IO1A 4HUFA 5IT4A 1EJ7L 2JDJA 3R5AA 2QI2A 3RU0A 1HKCA 2GVDA 2HQIA 5LOQA 1LWCA 1Y4ZB 1GOBA 1KN6A 2WSEC 2B6AA 4JI0F 4J9MA 2UV8G 3KKFA 1KWMA 1M1KO 2M9KA 4ZPAA 1X8DA 2KYXA 4UQTA 1KONA 4PABA 1RI7A 3J7YI 4FWQA 3HRGA 2MZTA 2UUCK 4IFVB 2ZH4A 2O8EA 4OFZA 3OVNA 3GV8B 4JB8B 4NRTA 4DMNA 2IMWP 2QXFA 1Y3KA 1WSVA 4BR0A 3QIPA 4JLHA 1SB6A 4YP3A 3PX6A 5GAGU 1S72N 1RDBA 4Z7CA 2IBOA 2XSFA 1HA1A 3NS5A 4OLPA 4DR1F 1IG8A 3FBBA 4EZ6A 3AGRA 4GKJK 2NREA 2NZCA 3CFRA 3CIPA 1VSDA 1Q7YO 3Q2SC 3SQ2A 4ELUA 1YITN 3TANA 1Y0HA 2HFOA 4ZVTB 3DAWA 4L74A 3H4DA 3Q24A 1HQUB 4MKYA 3NFAA 1AZSB 1K8KA 4OX9K 4F9OA 2W9BB 3ETOA 4DTOA 3FVYA 1RDAA 2CJYB 1KP6A 4CD1A 4PPZA 3HHLC 3KJNB 1X9WA 1FFGB 1TFYA 1HI1A 1BE4A 3CCRS 5DQIA 1T05B 3AY0A 5CCLA 4NPOA 3DM2A 4UOFA 2EWSA 3MPUB 1AUSL 4UOHA 2BV3A 1RFQA 4B8AB 1NH7A 3NGZA 1EQMA 1U09A 3CB4A 1WB9A 4KI6A 4M45A 4JI5K 3A8IA 4AF1A 3I96A 5KPRA 5D4NA 3QFPA 3OXLA 4DN9A 3OFEA 2FVPA 3E9OA 3ZSWA 4AUKA 3A3OB 1S1TB 1M0SA 3AA4A 3CI5A 4XDDA 3BSNA 5GAGI 2Z1JA 5JJBA 2KKZA 1RT1B 2JH3A 2ZFHA 2UUAF 3UVJA 4B1XB 1FT8A 1BWEA 2HQGA 3HYFA 2BKOA 2Y1IA 3DC2A 2DO4A 1J2VA 2V7ZA 2GCFA 1VQLS 4IYQA 2B4OA 1CZ9A 4LQ3A 1VSLA 3HO1A 1KOOA 3G0ZA 3BO3A 4H5VA 4AHTA 3O2IA 1Y97A 1LWFB 3RYLA 4QR1A 4LMZA 2C2ZB 2RIJA 3SV3A 1RHUB 1S9GB 3S8SA 3OYFA 3ENBA 5F8NA 1NH8A 3SFUA 4DTRA 1SUQA 3QT6A 2IAJA 4NXMK 4AL6A 2HHHK 5HATA 2PY5A 3CJ2A 2DNHA 3H2UB 4PG5A 2QWPA 4M5DA 4CECA 5FLXO 4ZK7M 4RUHA 2IYIA 3I82A 3DLKB 2M0GB 2RVJA 3H7HB 4Z0UA 3CCJN 4DDFA 4DUTA 2HNZA 1LW2B 3UDEA 3H42A 4ANDA 2X7IA 3LTOA 5HLFA 5EWGA 5H9FK 4MYUA 5J2NA 1KKHA 3DXKB 2J0QD 3ETMA 1NKCA 1S1UB 2MSTA 1B9DA 7AT1B 3O5TB 1FVSA 2VKRA 1OPZA 4J9SA 1DGKN 2GHVC 4Z4GA 1HIYA 4I6YA 3H98A 4FBTA 2BACA 1TELA 3LGHA 1TP7A 5F3ZA 4BQZA 3PR4A 3EVMA 5L38A 1TV6A 4B3TJ 2L9WA 4RUCA 1X5TA 4OO1J 4F0MA 2WOMB 1HPMA 2EKNA 1LWFA 3Q0AA 4CH7A 2A40A 3OL6A 2F9JA 2NUHA 1NK0A 4DFKA 5I42B 4RZRA 1VSEA 3THWB 1HWKA 3SCJE 2ROGA 4R25A 4J9VA 1R0BG 5L39A 5I3UA 3SMSA 3CCMN 2ASYA 3UN2A 2MKHA 1WHVA 3A4TA 1TZ0A 4HT7A 2HFSA 4U67L 1GLLO 4F04B 3CMAS 1S3XA 1K73O 2RAQA 1HNVB 1N56A 3C6UA 4KIAA 2HBJA 2OTLN 4L72B 3K59A 3L2VA 3DLGA 1N88A 1G15A 5JVGQ 3ICLA 2DBBA 5M2PA 1MMLA 1KVBA 3PEJA 3ZZPA 1TKZA 4CJRA 4V19J 3HSDA 2WVEA 4TSXA 1CQNA 5KT4A 3DXKA 2AX0A 5D77A 3TARA 1GLCG 2W2MP 1RWVB 1RA7A 2DHSA 4LF2A 4CJ3A 2XHBA 2N7YA 3MMVA 5GAHP 4X62F 1FX2A 4IH7A 2QWNA 5HJYA 2P9KA 2Z4PA 5B0EA 2CNKB 2FLNA 2PT0A 4BRAA 3WQUA 1LV5A 2XULA 4FJ8A 2WOMA 3TQ1A 4YOEA 4OYPA 3AV9A 1XHZA 1HBUA 3CJ9A 3NF9A 1DQ8A 4CO2A 3BGUA 4HKQA 1VQPN 4FSVA 4FS1A 1FKOA 3L95X 3MD3A 2I8EA 4KH4A 2HF3A 4K59A 1OSDA 3D3BJ 4PYDA 3K2YA 3JTNA 2MZSA 4QOTA 3HZ6A 2XSJB 4BC2A 2F8HA 2OAUA 1Q78A 3GJRB 2D3ZA 2GS8A 5EUHA 5CYQA 2HIQA 4DHYA 2YKMB 2RKIA 5K8OA 3F73A 3QERA 1S77D 3TX0A 3FZ2A 4RBTA 4YR2A 4ES1A 4O5BA 4WU2A 2E2QA 5KFYA 4I7FA 4FJKA 4ED4A 2GJFA 2PA3A 4AQYK 2F4FA 4A62A 1JCGA 3L0QA 1H7WA 1S5JA 1UVNA 3MCSA 4LSNA 1B92A 5KPZA 1GOAA 2Q36A 2PMWA 4G1QA 3K8VA 2V8HA 2L3MA 4OZNA 2QKBA 2C2MB 4HTUA 1KXPA 1U1PA 3DDNA 5D4PA 1AT1B 3FE1A 4YOTA 3B54A 3HSTB 3G71S 1OH6A 3H8YA 3T5JA 2AZ1A 3RB3A 4NLCA 3V9SA 1YVFA 2HHVA 2BOAA 1REVB 2JC0A 3OYIA 1T44A 2BGGA 4UY8O 5AQTA 4ES3A 4OZ2A 4MAKA 2R3VA 3PFEA 4CFAA 3EKSA 3NWRA 2RDDA 3VQSA 4PWDA 4K5RA 1NSQA 1RT5B 4FLVA 2BMBA 4YMEA 4YHHJ 1WC3A 2GWKA 2MKYA 4RW9A 2QTDA 2SXLA 3G6ES 5C42A 3THYA 2R2RA 2JOQA 3PJWA 4LF5F 4PYAA 2MKJA 3TZXA 2UXCF 3S3NA 1YBTA 3OY9A 3I4HX 2QA4N 5KT5A 1R31A 4JV1A 4ZIWA 1ZPVA 2P1JA 1VC6A 3C6TB 2YWFA 2HKEA 2P8IA 2ZZTA 3H59A 4NYOA 1BG3A 2KH9A 1PYSB 4F3OA 2F8EX 3C16B 5LSOA 1AXQA 3DNCA 4WF9Q 4QJVA 2B5JB 5L1JA 3D0GE 3MMCB 3AOAA 4CFDA 3SQGA 2A18A 1R8CA 3M8RA 4OKJA 1N32F 1H6KX 4CGJA 5HL7Q 3EXYA 2GHPA 2A1RA 4PXDA 4DR7F 2W41A 3TSUA 4DR3F 5AJ3J 4E1JA 2HPUA 4NLOA 3UE2A 2ZVIA 2R7YA 1RSCA 1YVNA 5DG9A 2L41A 3M6GA 4X64K 1ZM2A 3TRGA 3TZWA 3T5HA 3TAQA 4OI0A 4DCPB 3RR8A 3LP3A 1RZMA 3CJKA 4X66F 3S6EA 1C1CA 1XR5A 3R9LA 2LKZA 3ZSYA 1U2RA 4A48A 4LFAK 4KQZA 1KVAA 3QO9A 5KTQA 4S0MA 3TZYA 4USTA 3PR5B 3OJUA 2HQDA 3KHGA 1T3VA 3SMZA 4LSZB 4GKKK 4IFEA 4B9MA 4O8UA 4HTIA 5TKWA 4HHHA 2O8BA 1K6YA 2XMMA 1VGYA 1SS6A 1VRUB 3D7SB 1WOPA 4NZ6A 2AEFA 3AAWB 4XH5A 1V4SA 4U96A 2UXDJ 4K41A 2OCEA 3DMJB 1EIYB 3GG4A 5FROA 4UUXA 2V4RA 4DHVA 3F41A 1UTAA 4K4WA 4PG6A 4OKEA 4OKKA 3NDKA 3JB9k 3C16A 2OPPB 3OTBA 3BYPA 2BBEA 3UO0A 1VC0A 3ADAC 1F5AA 1S6OA 4DR4K 2BQUA 3CJ7A 2ZH2A 3U27A 3P5BP 2VJVA 4KY3A 4LSLB 4ZHRA 1A7GE 1JLQA 2K06A 3EE9A 5DETA 3VEYA 5K14B 3LDSA 3QZ8A 2AEJA 2QFIA 2O8DB 3CERA 3AQOA 4BRKA 2YWGA 2W7AA 1HR0J 3HP9A 3ZETA 5HBMA 1TL1A 1NZAA 1BIZA 4CLSA 1CULB 1R59O 2EFOA 5E0OA 5AQHA 4YQWA 2MGZA 3EYZA 1RNHA 4OYBA 1FKPB 2DPIA 4HH0A 1RAOA 5LL6Z 2FVCA 2Q1LA 1NU4A 4CO1A 1WSGA 1HPZB 2KHDA 1B0VA 1JB0C 1XR7A 4C97A 4F50A 2O1PA 1VQMN 4ECSA 2VPXB 4HCBA 2LA4A 3O44A 3GTYX 3CTRA 2UUCJ 3MN5A 2QL9B 1X4HA 2UVVA 1FDNA 4OJRA 2RNEA 4K25A 3QJJA 1WUAA 3MM7A 3MXMA 2OPPA 5G0RA 1JQGA 4QYZK 3PY8A 4ZVRB 2DJWA 5A6PA 3CCSN 4I68A 3SQ0A 2WRMA 4OYIA 3BZCA 1U1RA 3HFKA 1UA0A 2CH6A 3K17A 4K50A 2B9EA 2CAJA 1PAEX 3QPIA 3KHRA 4LSLA 3FEZA 4KHNA 3C95A 4O4GB 3KLGA 3KK3A 3AA2A 2HLUA 4PUOB 4BGAA 3OUYA 1HFEL 2BE9B 3AODA 1S1VA 3CJTA 5TKYA 4XPEA 4OX9J 2VG7B 3R5DA 2RRAA 3HF5A 6FD1A 1S48A 5LSRA 1CULA 4NCGA 2NUUG 5AQWA 4BRIA 2PMZD 4EK2A 1QVFR 4LFBJ 1O5JA 4U7UD 1U6FA 2NPFA 2KQ2A 2QGFB 1HL6A 4JI5J 1CJKB 1KVKA 2QEXS 4ES2A 3AVJA 2OFHX 2J8AA 3IM8A 5BR8K 4WP3A 3BGRB 3LZJA 4M8LA 5EN1A 2ASLA 4IOAL 3MUVP 4JI4K 4YDXA 1KQSM 3W8PA 4JD2A 4F4WA 3GONA 2LEBA 1TUGB 2IJRA 4E19A 3PHEA 3C65A 1N32K 3EVOA 4QW8A 2Q3PA 2Z58B 1BGXT 1T03A 1VIOA 4CIGA 2HMIA 4IO8A 2FF3B 2KFYA 2QWLA 1C2PA 4ICLA 3VENA 1W26A 5JLFA 3UNGC 4D3GA 4JKHA 2PDAA 4N8OA 2NRTA 4NLDA 1ESVA 2DPNA 3ZFVA 2GEMA 4C8NA 4BVPA 2ACMA 4WQ4C 4O4GA 1R0AB 3ZTOA 3Q86A 4P73A 3LGMA 1XNRK 1RP5A 2N4DA 2MQPA 2EBGA 3UW1A 3J81Y 3BO2A 4TY9A 3T19A 1HBOB 4RU9A 4NXMJ 2R7XA 3AD9C 2HHHJ 4FYYB 4IBNA 2EI5A 3NCQA 4M3TA 4AD6A 1RYSA 2AGOA 2E9ZA 1U6BA 3KJVB 3HFVA 2VDIA 3LA0A 4JI1K 1IG9A 2B3TB 4OZ5A 4ZDNA 1CLFA 3CPWR 1PIEA 4MK7A 4ILHA 4Y0FA 2VBYA 4ED7A 3MMJA 3MEGB 4UZBA 2RDIA 3G2XA 4B9LA 4C23A 4H5TA 3RAMA 2PZSA 4DFPA 4X4OA 4DCHA 1WC0A 4LF6F 1NPPA 2A1SA 3CEDA 2HVIA 1U0HA 4CTAA 3E01B 1WBBA 3QICA 1IBLJ 4MTPA 4GO7X 5E5NA 3V5RA 2C2EA 5LXRA 2HAIA 3NBPA 2NXCA 1RWWB 3ATVA 3R2DJ 1VQNS 1ILYA 4C7QA 1F60B 1SIZA 3A8JA 2ZJQQ 1SBRA 3SEOA 5F9NA 4AHSA 5B0DA 2ZF5O 1RYRA 1VOMA 3EVWA 5KG4A 2WVDA 4X4VA 1RQ0A 3UKUB 3KK2A 4KHPF 2Y1LB 4RU2A 4E7JA 1BQNB 1GMVA 4Q43A 2EG1A 1AFJA 1ATNA 3NGKA 3E9PA 2IS3A 3QGIA 4I6MA 4ECZA 4FK0A 2CQCA 1WAJA 4DSJA 4O44A 3EUNA 4KRWA 5U47A 1DARA 1NPKA 1WUUA 3TTDA 3ID6A 2ZITA 1S49A 4A8FA 3DRRB 2QL5B 2KTQA 3K9JA 1NNEA 4LJMA 3JSRA 1HI8A 3C66A 3N4WA 5KFAA 3NAHA 4AILC 1Q86O 1VQ5N 3LGNA 1J5OB 3O9QA 4G1IA 5EX3A 4AT1B 2DNNA 4ECVA 1K0TA 4HT5A 5ETRA 3GPAA 5BRDA 2LEPA 3TW0A 4W90B 4DR1J 4DWIA 4YR0A 1DT9A 1OSCA 4L8RB 2BANB 2CG8A 4JOUA 1Z05A 1P6TA 3DJCA 5FDLB 5GAHU 1EETA 3OPKA 1NRKA 1RT7A 2IC3B 2AJ4A 4QS9A 2JLEA 5GIPA 1HMVA 3VHQA 3CE8A 1D8YA 2XHCA 5KAKA 1RDDA 3THPA 5C2CA 1BOTO 2W42A 4X65F 3QJLA 3S9HA 3JSYA 1IBMF 5A0YB 1NMDA 1NPRA 2HRUA 3BN7A 1SL0A 4URSA 2GVZA 1RUSA 3JQJA 5HMZA 2M5YA 2QWRA 5AXLA 2QYCA 2YH1A 3T5KA 4PQUB 2XMWA 1D1UA 3SDEB 1GLBG 4ZVUB 1S9EA 4CGFA 2E1RA 4CH0S 2G1DA 3DOLB 3KK7A 1HNWF 2FGOA 5AZJA 4CLTA 3IR5B 1FD8A 2UUWA 4EWTA 2UUAJ 3DRRA 4FF1A 1HX1A 5ADXH 4KTQA 3H08A 2BXJA 4O3OA 2OA8A 4C0BA 4O0IA 3ZT2A 4DL7A 2E8AA 4PL8A 5LMNK 3NEKA 3CXCM 4BC4A 4AQYJ 3ZZOA 5GAHI 1WHYA 4CE9A 3GIKA 4CZHA 3ASMA 3PIOL 4FVUA 1IKWB 3GE9A 4CQ1A 4OLBA 1VQ8S 1S1XA 2DY1A 2DFHA 3UE5A 4RLEA 5D0GA 4DV2F 3BY5A 1V3ZA 1XMQK 5KOXA 4IUFA 1BDGA 4USIA 1G3OA 3OR2B 2WTFA 2DR8A 1QUPA 4DL2A 3VOVA 3VR1A 2ETJA 3TA0A 2HAFA 1XBWA 5J2QB 5BPMA 1Q95G 1RTIA 2DXDA 3IMXA 4KB1A 1CSJA 4NYFA 3GQCA 1NMEB 5M1FA 3Q22A 5KFNA 3HXMA 4KFBB 2FYXA 1TL5A 4XK8C 5DDRC 3BN4A 3HHNB 2C2KB 3QLHA 2QW9A 3B4DA 1MG7A 4PQUA 1DURA 3CMES 1GLJO 3NS6A 3EE3A 1WF2A 2IDLA 4I6AA 1QUVA 4JI2F 1RA6A 4WIQA 3VQ8A 1VLOA 2OELA 2ATCB 3O3LA 4NMXA 1BCOA 5EXWA 2UU9F 5DJBA 8RUCA 3DN9A 3R2CJ 4DR6K 4DTPA 2AGPA 4JS4A 1VQLN 4HLBA 1RT2A 3MWBA 3V9WA 3PVXA 3ZZRA 3S7RA 2BYCA 1RT6B 1PJ6A 1G1XA 5L9XA 4JI8F 1NU0A 4E2FB 3ZT3A 1YZ7A 4ED5A 3E3XA 5KFVA 1RAHB 5KFXA 4M5HA 2IIRA 3I9V9 2Z8QA 3M3ZA 1JXEA 2LXUA 4WTYA 3UR3C 5CD4H 2ZHAA 1X9JA 3NVMA 1MWQA 3KLFA 1T11A 3D7EO 4X64J 1SJRA 2H51B 3O6QA 4ZPDA 1M5KC 4DSLA 2O8CB 4CM0A 2QLWA 2LQ8A 1E4FT 2V8GA 3FMBA 3UI3A 3O1WA 5C2GA 5FLXU 3I0RB 3J7ZO 4R8UB 1FK9B 4BDZA 2O8FA 1VJQA 4LRDA 5AQXA 4J2AA 1YIJS 2GMLA 4A8WA 1BCMA 2V8VA 3E66A 5DM7Q 3I8BA 5KG1A 4F67A 3ZXWA 1L5UA 3ENAA 1NM2A 1TL7A 2P9NA 5KFZA 5M1KA 5IV4A 5I3QA 5D0RA 4FJLA 2JEGA 4PA1A 3OR1A 3MR5A 3BF4A 2G8FA 1Z2ZA 1C0FA 5ADZA 1W2BM 3VGTA 2J7UA 4A8OA 1WI8A 3W63A 3VQEA 5CHCB 2RE1A 1BXNA 2W2OP 5GAEI 1FXDA 2ZQBA 1VR6A 1RAJA 1F0XA 1XK8A 4YB1P 3PZPA 5JS1A 4DR4J 4K4ZA 3GB0A 3PDNA 4WJBA 3I31A 4WIIA 4J7CA 1IBMK 2Q1NA 3KMQA 2VUGA 2J8SA 3RMAA 1SKWA 2HLTA 2WB4A 3EXCX 1ZTWA 5E84A 4RNNA 3A8KA 1JKHB 4IH6A 1N48A 1T6DA 2HBMA 4NYNA 3NCPA 2F65A 1JX4A 1NJXA 3MOZA 3ZSRA 2EFQA 2E5GA 3B6BA 5AE1A 3CMAN 1R0CB 2OPSA 1FRIA 2NYHA 2ZOMA 2ZC4A 3TOQA 4C8LA 1ULRA 4F8RA 4YOYA 1NBWA 5LMUK 1LCUA 3OD2A 3CO9A 2IHR1 4ISGA 2R7UA 4DTSA 4UQGA 3I4PA 5AQPA 1JLFA 4P75A 4JYAF 2AYMA 1UVKA 4I69A 3CCTA 5AXNA 2ZE2B 3WT0A 5F3TA 3TA2A 4WCEQ 1FE0A 3WEEA 2OZSA 1V5IB 4GRSA 3IGVA 2KFZA 1HQEA 2CADA 1RT4B 1WOSA 5J1PA 3DKDA 4FJIA 3QYYA 1R6VA 3SI8A 1N34F 4LF7K 1TFWA 4C3KA 2K1RB 1C0MA 2ZOFA 4JN4A 4W5RA 2VHGA 4YY3K 1WJ9A 4ATNA 4QYZJ 2CPEA 5F8LA 2KXFA 2ACYA 4FWLA 3G9CA 3W8GA 2ASOA 1WD6A 2J9CA 5DLGA 4GVBB 4MYTA 3R9PA 2B51A 2CJAA 2V2QA 3NGSA 2HHSA 1EXQA 1N36F 1RBAA 4CEBA 2V2KA 4OX8A 3J80U 4M3ZA 2Q3SA 3V2UC 1GMUA 2XLKA 4QBUA 5GADU 4MLHA 2R2SA 3ZSQA 1KD1O 2BE2B 4BE1A 5DG7A 2UXCJ 2EKYA 1L3KA 2HSTA 4IG0A 3N79A 2ZBPA 3KHLA 3U6FA 1K8AO 3DOMB 4ZLLA 2PEHA 2HRTA 3VGLA 3SPYA 4IR9A 1WAFA 3UD4P 4IOCQ 4CJVA 4CEOA 5BR8J 4NE9C 3NMUA 3SYZA 1RBTA 2BJEA 2AP6A 2QIFA 1O0PA 3H25A 3UN3A 3G82B 4M5KA 2AZ3A 4C8KA 2V4JB 1X4AA 5M1NA 2DNOA 3D3CJ 3L2RA 1UP1A 2K2PA 1N32J 2DEIA 4IJAA 3G71N 5E26A 1SXLA 1YTYA 4CI6A 2GX8A 2D7SA 2ZHBA 1P1LA 5BPNA 4FJXA 3UDLA 4O0NA 4M3UA 4DR7J 3MEEB 3D2EA 4DR3J 1T6CA 3PV8A 4BRHA 4F4YA 5D78A 2OTJN 2VCPA 3QFHA 4J9NA 2FJAB 4OZJA 5EX0A 2OYQA 3BDEA 2AMCB 1R43A 3EZ5A 4PPDA 3H3OB 2CGLA 4X66J 1RISA 3SV4A 4NI2B 3RBXA 3G6EN 5DDQC 4FO0A 3MM5B 2J6TA 3IR7B 4QYRA 2GHWA 5CYMA 4YEAA 5J2PB 2L08A 3TVZA 2ZH8A 3SQ4A 5EDWA 3TYTA 4DV1F 1DJ0A 4DTUA 1DHMA 2VL1A 1PAUB 1U1OA 3FFIB 2B7CB 1LFWA 4PHTX 4B02A 5L1KA 5KG2A 1MWKA 2VASA 3TEGA 2DEJA 4FNHA 1WTBA 2A2CA 3KVGA 1SC4B 1HJRA 4OZ0A 3OYLA 3ENVA 3HD1A 4CIEA 1OH8A 2Z2YB 2VF3A 4BVOA 4OHXA 4ANEA 3AXKA 3MR3A 3ZTPA 2E1ZA 1SV5A 3ZC4A 3PIPL 4PAAA 1RCXB 3OS0A 2MLXA 4QWBA 5A8RB 2OMLA 3KNAA 4LF1A 2PA8D 3PFOA 3MGJA 2DGXA 3MURP 4CIFA 3RMBA 2DNMA 2QSWA 4FLZA 3D1HA 1DEJA 2X78A 5IQ6A 2IYGA 1KLMA 4FOEA 2HIYA 4CEZA 2FJEB 3CMQA 1SKRA 2GIQA 4GY2B 3BSOA 5F0UA 1S6QA 2GNKA 1HW8A 3B6PA 3VMFB 4TKTA 3FBFA 1RTJA 2OMOA 2KRRA 4RW4B 1FE4A 3U9ZA 1GLEG 4K4TA 1EAYC 1NJZA 4A4JA 3AVNA 3A5MC 2POKA 1F5BA 4USKA 2FIUA 3B78A 2F9WA 1Z1ZA 2CPZA 2V68A 2VC0A 3LAMA 1GX5A 3NP5A 4W5NA 1OH7A 1U8SA 3VQQA 2VQEF 2UUTA 4NLPA 5KFWA 3H1QA 3V81B 4O3QA 4CEEA 4WYBA 4I67A 4R0JA 3VGVA 2A3ZA 4PXCA 2VPWB 3M2UB 3FRYA 1XC3A 4I2PB 4WE1A 5IWAF 2KL8A 3CPEA 5A2QU 2X1FA 1JL1A 3CJRA 4DUYF 3W3SA 1SJ3P 2E66A 3T9ZA 2L9DA 1O51A 3SPZA 1SC3B 1GH8A 3C7NB 1K9MT 3JYTB 4MFBB 2KT3A 4O3SA 2B9XA 4RPFA 4CO3A 1LWXA 4WPAA 3O8MA 1HWIA 1WEZA 3BGLA 4ZVOB 1JJ4A 3PW5A 3SXLA 1UVLA 1FDBA 5KG0A 3MUMP 1HYVA 2NLWA 3WXIA 1LWEA 1WHXA 4DL0C 2UXBF 4K0KF 4MK8A 2VG6B 2WONB 4M3XA 2LQ5A 2Q66A 3P96A 4DV3K 1QTNB 4ZN3A 1IQTA 1W2IA 3MHYA 3BGOP 2C1EB 5JVHQ 3OYHA 2W9AA 4C8MA 5KQDA 3I8DA 1HARA 3UCZP 4CHQA 3SJJA 2RH3A 1R8BA 4CHPA 2QMXA 4NB4A 1HNIA 2WBMA 1Q81O 1HLUA 2UVWA 4FF2A 3M4XA 3T9NA 2R8HA 2JSXA 3PG9A 2I6WA 2KZMA 1JLCA 4BRFA 1RADB 4CGGA 3CJ4A 1X4DA 3J8AA 2VV5A 5LMNJ 4EYHB 3FBCA 4WP9A 2I7PA 4FLYA 1YXQA 3AOBA 3DLBA 4ZITA 2B0GA 2QC3A 1J54A 3DYAA 2FZCB 1R7IA 1VK3A 5FPEA 5CZVA 4Q0BA 3RSEA 4IEIA 4AFFA 1N8RT 3Q8UA 2P9UB 1XMQJ 4Q7AA 2YBVA 3R27A 1H2UX 3LZIA 2XEXA 4IKFA 4JHDB 1JIHA 4DR2F 3WZ0A 3BKFA 2QXLA 3HOTA 3KLIA 4ECUA 2CQ2A 2HHPA 4WBFA 3EO3A 3VVUA 1YVUA 2BZ2A 1ZAVA 3NOGA 4H0VB 2VG6A 3L7OA 3IFRA 3TSQA 1RHJB 1JLAA 2F7TA 1RT3B 1TK0A 2Q0RA 2GGPB 2QEXN 4FZYA 3VAIA 3CCUS 2P9IB 1QE1B 3M32A 3QZ7A 4G6VB 4F4AA 4QZVB 3DFEA 2UYTA 1LQ9A 3KWIA 2P9PB 2DNPA 4RWTA 1ZM3A 3IGNA 2I5JA 1MROB 2CNOB 3AJ1A 5T41A 4Z4FA 3MAAA 1T3OA 5B8HA 1MNEA 2MZQA 2BOPA 5AQFA 2D74B 3MEDB 1WWHA 3HD2A 2YNGA 5FPDA 3H90A 3MAHA 3K5NA 4EBEA 3DLLL 4CZJA 5K8MA 4NMLA 1KVCA 3O8WA 1IKVB 1TVRB 4RJVA 5KPTA 4J2DA 1Q9YA 2OTLS 2HYIB 5M2RA 5E7OB 2GTDA 2FSKA 3R7SB 2CDQA 3N6LA 3VEOA 4KHYA 2BABA 1DTQA 1APSA 2F8MA 1H72C 3SUQA 3SNNA 4KHPJ 4RL1A 3QEIA 2DNYA 1TL3B 2DRDA 4L75A 4ID8A 2YX7A 1YLXA 4BR7A 1V3RA 1YJ9S 4CLFA 4DX6A 1NBEB 2E1YA 3T1HK 3IS9A 1V3SA 3G6VA 2MHNA 5KI6A 3PSIA 3R1HA 4JI6F 1NMNA 1D3WA 2P5GA 4KSEB 2ZDPA 2DNGA 3AD7C 2P9SA 3SBMA 3X3UA 1HYSB 4MQ3A 2B4JA 4C1NI 3N6NA 2QG9B 2AIRB 3QBCA 4DCJB 3LWLA 1JWWA 4BC9A 2D5RA 5EVZA 4KKOB 1RWKB 5IWAK 2W7OA 5KFRA 4DFJA 4DUYK 4JI3F 2HNYB 3MX5A 1DRZA 1TK5A 4BQLA 3HHEA 1P27B 1EKRA 1Y5IB 4OMFG 2YKPA 5E2QA 1VQNN 2WB1D 2HNDA 4DV5F 3EE8A 4PKHA 3ZZYA 4E7IA 4A5BA 4HVZA 2CPYA 2K7KA 4LIRA 1IKVA 1Q8KA 4NLBA 5DGAA 1ZYQA 1H1VA 4OYMA 5CABA 1IBMJ 2ZZNA 1ATSA 1HQ2A 3HJFA 2IM1A 2ZBQA 5CZ1A 1WSRA 2NQPA 4B3SK 1DKGD 4CJSA 4PEOA 2HZCA 3DHXA 3ITHA 1NGDA 2I7NA 1ZBFA 5AQVA 2U1AA 4GV9A 2YXLA 1WC5A 2O66A 1HKGA 1LK5A 2YVSA 5HRNA 3KNGA 3T1YK 3O3GA 5LMUJ 1OY6A 2HFVA 1RTHB 1F2GA 5BN8A 3QIOA 1FJCA 3V6JA 4PCQA 4Z37A 1X4FA 4IH5A 3HHLD 1WELA 4Y2IA 4F2RA 1FJGF 2DY4A 4Z4HA 1U24A 4AL5A 1M1HA 2B4VA 3UR0A 3F9MA 4P2MA 2VQFK 1XERA 2DGOA 2E5IA 1OWXA 2ABYA 1Q5VA 1ZA2B 4DTMA 3DOKB 1UAWA 1EKSA 2QTWA 4DV2J 1PYOB 2QA1A 4AYBD 1ICEB 3EGNA 2BDPA 4RW6B 1R27B 5DGBA 4H5WA 2MEWA 4OHVA 4P2SA 1X7VA 2ASDA 4H4OA 4KHMA 1WOOA 4WK3A 2A0FB 2XWXA 2NUBA 1S57A 1Y11A 2JEIA 2RQMA 4IRKA 3CIZA 2OD4A 4EO8A 4RNOA 1T0TV 5IM0B 1QTMA 4UY8T 2QA4S 1SH3A 3QRQA 3EZUA 3BZKA 4RW8B 4MJKA 3HVTB 3FBEA 4WFBL 1WC4A 1HNXF 4CO4A 3C14B 3MM9B 5GINA 3QSYB 3K5LA 2HSEB 3KDNA 3RJMB 4RUBA 2GMJA 2C2DA 3TO8A 3W65A 2W2QP 5KFEA 3TU5A 1C6VA 4JI2J 2VJUA 1RBUA 2VG5B 4MLEA 3TAMA 5C2FA 3LM9A 5KFBA 1VQYA 2AP1A 3ZT4A 1RTHA 3GG0A 4CH1A 2UU9J 5C10A 2DNLA 3PTWA 4JKEA 3A1YG 2HVHA 2R9LA 1F1BB 2AX1A 3I56S 5LT5A 3D2FB 3K5OA 2VWKA 3FC9A 1ZBUA 3A5LC 1VQ8N 4M63A 4ANCA 1ZC6A 3SAGA 1JCFA 4KO0A 4JI8J 5B0AA 2YJFA 4FYDA 3P31A 2AQ4A 3IDHA 1NO8A 1YX2A 3OTDA 4Y3CA 1SQKA 3RB0A 3HHLA 4LBHA 1JK9B 2ZM6F 4H54A 3CJ3A 3R5JB 4YOWA 3HI9A 3BF1A 1C0GA 3ZTQA 5KFHA 3R8YA 2MKSA 5HQMA 4B9UA 3Q23A 3F2KA 4D3HA 3RVCA 1N33F 4JEPA 1VQ6S 4BR4A 3AY9A 3DGPB 2KG1A 3ZX3A 1T94A 4NXNF 1PJ5A 3EDQB 2BJ8A 1ITPA 4CJFA 3CMEN 3E8OA 4BE2A 1UWBB 1WSEA 1QVGM 3WIVA 5RUBA 3ZEUB 1SKSA 2V8PA 4A8SA 2N82B 1RWPB 5A76A 2YNIB 1BI4A 1CJTB 1TL4A 4AHVA 4HYKA 3PEHA 3I0SB 2XM3A 4YOVA 4WU3A 1BQMA 5GIOA 4ILJA 4G1PA 5C24A 3UDCA 3OL9A 5JMVA 5C25A 3OYBA 1TAQA 3C19A 4IQXA 4G9ZA 2LYVA 3ALYA 4OI1A 4F26A 1W0HA 2G8IA 3MECA 2GJIA 4ECWA 2G2ZA 3ZT1A 6AT1B 5F8IA 4OL8A 1NDKA 2DTUA 4DL6A 2GX9A 5EY4A 4R79A 1XEZA 1OY9A 2NZ4A 2PBDA 3CIMA 4EO6A 3KG4A 2U2FA 2IM3A 4CERA 2BVZA 4B9TA 5JICA 1ZS6A 3CCQS 1WI6A 4NLQA 1XI1A 1WSFA 5DDPC 2LDYA 2I2YA 3L3CA 4DX8H 1QHTA 2E2PA 5IC4B 2H3EB 3M2RA 3ZCMA 4DV7F 4ECXA 3VQTA 4MKBA 1CS4B 3DGPA 4DZDA 4WFYA 3BO4A 2QLBB 2ZH9A 1YIJN 2HHXA 4CZCA 2MDAA 4JYAJ 1CJUA 3LPEA 4CJ5A 2A6AA 3I5CA 1S76D 1FWKA 4BACA 1OH5A 1TYQB 4IG3B 2CWXA 1OIAA 1RBSA 1NGAA 3SLCA 4QAGA 4NLSA 1IM6A 3ZSXA 3BYRA 1JLGA 2RHKA 3LDQA 1HBNA 2HQ3A 3L2UA 3K5MA 4M94A 1EP4A 1ZBTA 3WXLA 3G96A 4I2QA 2A6OA 1T9TA 1Q79A 1RU1A 2FHJD 3L8BA 3ZZZA 2ZD1A 1I3OB 4L3NA 1WHWA 3VAHA 3Q8SB 1XNQF 4OZ3A 3KZBA 4FVCA 4IDKB 2EFGA 3ENHA 3BJYA 3VZIA 3CWJA 1X9SA 4FZVA 4LUBA 1EX4A 3PJXA 3W9HA 3EPIA 2J9EA 5KGWA 2E1PA 1KQKA 4CNYA 1R6YA 2NXJA 3TUIC 2DFEA 2CIMA 1N36J 4OHYA 4M3RA 4NRUA 2ZJRL 3D66A 3D68A 4HUGA 4U8VA 3MMBB 3L6QA 2MQQA 5F8JA 4DPTA 4FPAA 1ZZNA 4TN2A 4JKFA 3ZSZA 4LFCF 2L9NA 2Q6CA 1VI7A 3O9TA 1N5SA 1S1WB 1TQLA 1KFSA 5KFSA 2APOA 2OANA 3E9LA 3RGIA 3M6VA 2QN6B 3MZIA 1YJNS 3UKRA 4CJEA 1VQSA 4ED1A 4JKGB 4B3MK 2OFGX 3A3PB 2E5LK 4FM0A 3AA8A 3C6HA 4A2BA 3OXGA 1YI2S 3S01A 1X5OA 4WQ5C 2B4UA 2V52B 4K4XA 4URQU 2OPRA 2BM0A 3HX9A 3V4MA 2JEFA 2D0AA 3NGUA 2LA6A 4ZCMA 3BPSP 4YHHK 4GVEA 2QT7A 4F3QA 3VTHA 1X0FA 5A8KA 4JRQA 3ULEB 2ZWHA 2HHTA 1NK6A 3DU6A 3PXGa 2C28A 4ID5B 3Q83A 4FNIA 1UVJA 4O3RA 1ACMB 3WDOA 4LIWA 2OGUA 3AAQA 1N5YB 2HF4A 4XPCA 4NLRA 4A47A 4HACA 1NUEA 1X31C 2NSBA 4CJKA 2FZKB 4A8MP 3WNEA 2IRYA 1TK8A 2FXUA 2E5HA 4UZCA 4M5NA 3AO3A 3D1QA 2IVOA 3D9BA 1RDCA 4NEYA 3SMPA 3ILIA 4DFMA 4TYAA 2G0IA 4Z7YA 3VGMA 4MK9A 2ZJPL 4WTOB 4KHSA 4TY8A 4UUWA 3CXCR 2JLGA 1NGEA 1WTFA 4FLUA 2QRRA 4JK7A 2W4DA 2F4VF 1Q9XA 1N6QB 2DNRA 5HOOA 2IVPA 3CO0P 1NGHA 2YNFB 2CZ9A 1QAJA 1R89A 3R3LA 2D3O1 1RHMB 1Z4UA 1NKBA 3AHPA 1TKXA 4J5OA 2FC9A 3GSIA 2GIFA 5J2MA 2JWNA 4LF8F 3Q8PB 1QQNA 1S6UA 1J6ZA 4IO9Q 3V1QA 2HOEA 1ZM9A 2GVDB 4ED2A 1CZBA 1LWCB 1KSPA 1J27A 1GXLA 2N7CA 1RAGB 5DLFA 1RCOB 2B6AB 2EK6A 4G3IA 3QINA 3RRKA 1YGYA 4CZMA 2V2VA 3G10A 3KK1A 3CJ5A 1M90T 2K3KA 4CLYA 1ELOA 2C3PA 4NYZA 3DGVA 4XAKA 1LXNA 1SZ2A 4A57A 4GV6A 2R7RA 1QAYA 3HKZD 2XLIA 2O8EB 2M8DB 3IWXA 4IO1A 2NSCA 2OEMA 5FPMA 4MIBA 4QU6A 1QDUB 1BC6A 4PZVA 5KFCA 1C1BA 4RW7A 3IRXA 3QIPB 2Q79A 5ETOA 2XMAA 1CQMA 4B3RF 1U2VA 4K4SA 2V8DA 5AQSA 3CJAA 2BUNA 3T1HJ 2AYBA 3TP2A 3GILA 4C98A 2DKOB 3W2WA 3OS1A 2XCAA 5BYQA 4X4TA 4OYXA 2H5EA 1RWNB 4UY85 4HVJA 5B0GA 2BJDA 1H3DA 3PX4A 3DHWC 1BY9A 3X1LB 4Q8EA 1XNQK 1RILA 1HR0K 4FN5A 2VQEJ 2XS2A 1K8KB 3QT5A 3AVKA 1Q53A 3R5BA 5E3RA 3MPWA 4DL4A 2LQJA 4N76A 5K9FA 4Y2CA 2H3GX 3Q7CA 5IWAJ 3DM2B 2LU1A 5DZ6A 2ZNZA 4KHRA 4F25A 3DXMA 4DUYJ 2MTLA 4JI7F 3OQ2A 1SQGA 4EI2A 3BP8A 1WSIA 3N9UC 2XI3A 1U25A 5KFMA 2DR6A 3FJ2A 4ELVA 2BRKA 2HZVA 3GBTA 2J6SA 4H0OA 3CCLS 4YOXA 1W7WA 2VONA 1P9QC 2ILYA 5HANA 3HULA 4WFNL 2UXBJ 3DI6A 3UVJB 4K0KJ 4ZLPA 3GWCA 1PGZA 4DQ8A 2FBTA 4GC7A 2HRYA 2HB5A 4BRCA 2ZC3A 4B3SJ 4HL9A 2MZRA 1S6PA 2GO9A 3VVTA 3F9KA 3LDLA 2G0JA 1HWJA 1W2BR 5BN9A 1URRA 1YTAA 1F21A 2YY3A 4NLYA 4W92B 3M2VA 3FQLA 3I55S 3BM7A 2MSSA 2QX0A 4YDUC 3HK2A 2J7KA 1Y5NB 5C5JA 1BIUA 2A5XA 4BDYA 3L4BC 3NL0A 3T1YJ 4ZTFA 1C1AA 5IT9Y 3AVLA 2V34A 3CDUA 4LVNP 1QAXA 2DK2A 2FGCA 4OGCA 3JAMY 5LSLA 1EWRA 1KC8T 1SUQB 2XYGB 2IAJB 3J81U 3CJ0A 1NJWA 1ZH5A 5KT7A 4W5OA 4U7BA 1SL1A 2BUPA 4PG8A 3H3NO 2VQFJ 4M5DB 3N5BA 1NDLA 4OPKA 3C94A 3LPTA 3KUGA 4LFBK 2H65B 4X4PA 5KG6A 3RBEA 1IKXA 2E29A 2HNZB 2FLLA 3EGWB 5KFUA 3R97A 3CC2S 3PHTA 3RRHA 5HLFB 3ENOA 4Y1CA 1F5CA 1XMOF 2EK1A 4DSIA 4DR2J 5J2NB 2RQ4A 1KTVA 4DLGA 1HLWA 1NGFA 4ER8A 2EW9A 3L4QA 1H38A 1VQKS 2H9ZA 2ALYB 2M52A 3QEXA 5J1EA 3SBGA 4L73A 2RJZA 4BHQA 4HTJA 5AXMA 3THXA 1VISA 2CQPA 5F41A 3R3TA 1GXUA 1B9FA 1CJVA 3G8QA 4FK4A 2R7QA 2BQ3A 4DTXA 4RBVA 2I9SA 1TV6B 2I1RA 4CFCA 3MMAA 4CLPA 5IFMA 2VFRA 4HHTA 3DLEB 2W25A 3W60A 4FWPA 4P7TA 1SI9A 4C0HA 3RR7A 2EVZA 4Y0WA 4V19S 2RMLA 3QATA 1BQXA 3FGUA 2P51A 3BEXA 5LY3A 5I3UB 1OS5A 4ITSA 4CGIA 3OHRA 3U02A 4O23A 3T6BA 2JFKA 3V9ZA 2RF2A 3ILOA 1WORA 2AHOB 3UWTA 4IO9L 2NXNA 4U7CA 2PE8A 4U8YA 4J9OA 1LFPA 3C6UB 3U8XA 4K4VA 3Q8RB 4BR9A 4YORA 3OSPA 3DLGB 3EGZA 3DLRA 3HTVA 4AHUA 3NY0A 1WG4A 1TKZB 1IR1A 3N01A 1YJTA 1HNZF 2H5IB 2MXYA 3T3FA 2VBWA 2NRRA 2CXEA 2HEKA 5D0HA 2C22A 2QM1A 1YWXA 3K5PA 5D0EA 1UEUA 3KWGA 4JS5A 2M8HA 3DDIA 2AW0A 3LP0A 1LAVA 3DLHA 2D0OA 3OTOF 2R2UA 3F44A 4JI6J 4DV4F 2CFXA 1IBLK 3CCUN 2KJVA 4BY9C 5DS7A 1JXBA 4LBIA 2P9KB 4M5MA 1F9HA 4USWA 2GW8A 1SAZA 5F2RA 3QEVA 2FJXA 3OBIA 4ECTA 1WSJA 3DLEA 4LRAA 3GYNA 3AD8C 1YRUA 4HTLA 1RHRB 4MO4A 5HRPA 1HBUB 4TLQA 2LVWA 4I4BA 1FKOB 3ZSVA 1ASUA 1U26A 2V67A 1EHWA 4RR5A 3KKRA 3T5LA 3FZHA 2GJ2A 4CK1A 3ILJA 4JI3J 5L9NA 4EFAC 4JI0K 2RS8A 2Y9HA 3VCDA 3JS9A 1NB2A 4ALZA 3B8AX 2FUG9 2HG4A 4PG7A 3H2LA 4WQ4A 4H4KC 2R7OA 1SJQA 3SBTA 1QAIA 4DOZA 4YN3B 5HO4A 2GA7A 5KFPA 1PC5A 3A8EA 4OGEA 3KLEB 5CYQB 1M5HA 7FD1A 5T7LA 3W2VA 3FR0A 5JUMA 1H2VZ 2RKIB 2IY5B 3JXUA 5DM6Q 3J7YP 3NNCA 3HSZA 5D8HB 4BRQA 4I7FB 1U02A 4IOBA 1UETA 3F56A 1B64A 3CCVS 1FKAF 5HVFA 1YJ9N 1NK4A 2DRBA 2MMYA 4LSNB 1T9YA 5L1LA 2KM8B 2WC9A 3MD1A 3OW2M 4M1KA 5E3QA 4G1QB 4DR1K 4N47A 2OZMA 3OVSA 1AA1B 3TWZA 2E7XA 4X4RA 3F5TA 1FXXA 4X84A 2Z2ZA 3U4LA 4NZ0A 1VQ4S 3PYGA 5G4DA 3O80A 1KVJA 3GE1A 3GFYA 3LP1A 3FZLA 3PRBA 2YPZA 2RPIA 1VJWA 3AO2A 2QWQA 3AVCA 1K1QA 1MU2A 3H40A 3J80O 2G2YA 2J4RA 4DPXA 1FW6A 4LF4F 3IBCB 4PWDB 2FHMA 4FKYA 4F36A 5KT3A 4A46A 4OI6A 3NNHA 4DMZA 1G7CB 2R8GA 1UCNA 4HHUA 4RW9B 3G4SS 3OYEA 2ZEJA 2G8VA 1YKWA 5ITHA 2G8WA 1BISA 5AQOA 3C6AA 5C42B 3PM9A 3THYB 1GK8A 5HQ8A 3H5SA 3KLEA 3V4IA 2DISA 4DV6F 2P5VA 4NCBA 4OVLA 3O3HA 2UUAK 4AE5A 4J37A 3T7ZA 1I3AA 1UFKA 1QVFM 1UPMB 1PO6A 1HNXJ 3M7VA 5SUHA 2D0BA 4NO7A 3W9IA 7FDRA 2V5HG 1NK7A 1B7YB 4FS2A 3VAKA 3AARA 5BRFA 1RWUA 2PO4A 2MQOA 1KR4A 3WC0A 1XWLA 2XO6A 3SQGB 3QDKA 2UVUA 3CULA 3UNYA 2Q2RA 1EO1A 4I1TA 2VYPA 2W2PP 4DU1A 4F3TA 2XO7A 5L46A 2IRXA 2Z1GA 4IKAA 3Q8VA 2B9WA 4EHTA 1X3MA 4B3MJ 1HRHA 4CHOA 3VTIA 3R8EA 2CH5A 2CZ4A 4DG1B 2E5LJ 5AQZA 4WXWA 4USUA 3G25A 1C0TB 2XC9A 2W4CA 2IA0A 2H5JB 3IAM9 5B0FA 1T9WA 4CT9A 2J5AA 4DSEA 1GT8A 1ZTTA 2OTJS 2IFXA 1XC9A 1N0UA 3R1LA 4NL5A 3IG1A 4CJ7A 1WDDA 3M1FA 3CJKB 2HHWA 2DH8A 3NE6A 3ZTRA 1C1CB 3M1VA 2HBYB 2ZM6J 2HURA 2DYAA 4KHUA 3CJ8A 2UUBF 3IXQA 3QO9B 2V94A 1C0UB 2E7VA 4ZPCA 2MPUA 3WX8A 1TTHB 4ILLA 3DXSX 2KT5A 2MLZA 5HMYA 2O8BB 3GMGA 1Q8LA 3BR8A 2CNNB 2DR7A 2HQCA 2JNJA 4ELTA 1FRHA 4ECYA 3TABA 4NXNJ 2D0PA 3I33A 4KC5A 2JVRA 3OSNA 3RG6A 1J5EF 3GOIA 3L2WA 1IBKF 5ETTA 3KIOA 4QCLA 2YHYA 2RHSB 1KOHA 1GAOA 2ZDOA 3A13A 3W5ZA 5HROA 1ZA1B 3D6FB 2ZWPA 5KFQA 4CEAA 3I56N 2OSRA 4M5IA 2Y0BB 4ZHRB 2ITMA