3JSMA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with tenofovir-diphosphate as the incoming nucleotide substrate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna complex
molecule keywords DNA (5'-D(*A*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 144
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jsmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jsmA05
3NMAA 4CHPA 3SJJA 4ECQA 1K1SA 3WNFA 5KFIA 4F4XA 2EX3A 1WLJA 1TKTB 3T5HA 1IKVB 4FLXA 2PZSA 1GX5A 5EWFA 4KTWA 3ZSYA 1VRUB 3VQQA 5KFZA 3NBPB 4CK3A 4RNNA 1NK0A 2O4IA 3MXMA 4N76A 1KVBA 3AA2A 2VA2A 4RNFA 4R0EA 2HNZB 4Y2AA 5I42B 4OKEA 2HVIA 4ZPBA 4IRCA 4FLZA 3RMAA 5KFKA 4EYIB 3AVAA 1RT5B 4CJ4A 1UOCA 4KPYA 4O44B 3UR0A 4NRTA 1KCFA 4MFBA 3LZIA 5HRPA 1J5OA 4CJKA 5KGWA 4WFYA 4DFKA 5C24B 3OYLA 3CM5A 3OL8A 2KW4A 2FVCA 4IG0A 3V6HA 1HYVA 3LP0A 3O4NA 1KFSA 3KLIB 3S3NA 1RTIA 1RAJA 3PX4A 2RPIA 2WTFA 3HVTB 3BREA 1ITGA 4DTNA 3DRSA 1ZBFA 4FK0A 4EBEA 1S0OA 4J2DA 1MMLA 4O4GA 4CECA 3B6PA 2WOMA 2C22A 2IM3A 1NK8A 2BQUA 4PQUA 3ZSRA 1RT3A 1LW2B 1HARA 5FDLB 4IKAA 2B43A 2IDOA 3KLFA 3AO5A 3ITHA 4EP4A 4IG3A 1HNIB 4E7LA 4CJQA 2C2DA 3DM2B 4RW6A 2WONA 4J9LA 3KOAA 4H8KA 1Q9XA 3HPOA 5L1JA 3AVNA 1QE1B 2XY6A 2ILZA 3LWLA 2P5GA 1S0MA 3U3YA 2AJQA 3UPFA 4O3RA 1VSIA 1S1WA 2OYQA 3LP1B 1WSFA 2W9BA 4KKOA 4E19A 4C8KA 3K57A 1DTTA 4ID1A 2YKMA 1C0MA 1S1VB 2GIQA 3BSCA 4F4ZA 1FKOB 1HPZB 3U6FA 3DOLB 3KK3A 4BWMA 1LAWA 3EPIA 5HBMB 4IRKA 5KFYA 1S6QA 1CZ9A 5DK5A 3BSOA 3TAPA 1D5AA 1HQEB 2O5DA 3V9SA 3NH0A 4ECVA 1S49A 1BQNB 1TV6A 4E89A 3U3GA 2OPSA 1RBRA 2OPRB 2YKNA 3E01A 1NJYA 3ZT1A 3BSNA 1YTAA 2P5OA 3JYTB 4URGA 4PUOB 1RBSA 4Z4IA 3PJXA 1QTMA 1JLFB 4CK1A 4TYBA 1T05A 1RTJB 4KFBA 5C25A 3SV3A 3QLHA 1KHWA 1RT6B 4BWJA 2XRIA 4KHQA 1W25A 4I9QA 2HHUA 1WSJA 3GQCA 3BQ2A 4FJJA 1C1BB 2V4RA 3PR4A 5T7BA 3OHBA 2XY7A 3CFPA 4NCBA 4MKBA 3WNGA 4JV2A 4C8NA 2V4QA 2E4LA 4Y3CA 2D0CA 3QEWA 4I2QB 5KFAA 5DLGA 4FW1A 1C2PA 1QQCA 2W7OA 2W8KA 4M3YA 4N41A 3RB6A 5K14A 1HJRA 1FK9B 4DL2A 4ECSA 5KG4A 1KRPA 4K4TA 1RT2A 1LWEB 4O3NA 1RILA 4FS1A 1U4BA 3V4IB 4HVJA 3MEDA 1S1TA 4JV1A 3OYGA 1NK6A 2HNYA 3CWJA 1N56A 3DLHA 1JLGB 4QWDA 1JLQA 3NCIA 3VA0A 5KFQA 2FC0A 3Q8SB 2W7PA 2B5JB 5KG0A 2D7SA 1RT1B 3G6XA 4CJVA 3ISND 4Q5VA 4O5BA 3QGHA 5L1LA 5I3UB 4QW9A 1NJWA 4NCGB 4WXOA 1JX4A 3V81A 1WAFA 4J9NA 1SL0A 4FYDA 1SUQA 1ZETA 3FFIB 5C42B 2E6LA 1NKCA 1RTHB 1S9EB 4TY8B 3ZSVA 4M94A 1Z4UA 1UWBB 2D0BA 3QIOA 2AX0A 4EO8A 1DLOB 3V1OA 3TAMB 1NK9A 4FLUA 3KK1B 3DYAB 1EX4A 3L2QA 3I0RB 3V9XA 4FZYA 5KFRA 2YNGB 3I5CA 1WSIA 4DSIA 4M95A 2J6TA 5EU7A 3THVA 2R2SA 1C1CA 2R2TA 4Y1CA 1TK5A 2HNDA 3K58A 3IRXB 1K1QA 3SFUA 4NLUA 3I8DA 1U48A 3TQ1A 4FZZA 1TKXA 4Z4CA 4FJ5A 2FJWA 3SPZA 2DPJA 4ED8A 1BQMA 4BDZA 5FRMA 3AVIA 3I5AA 1JLCA 5KT2A 3V6DB 1SL1A 3VQEA 2IA6A 3VQ7A 4CF9A 3CJ2A 3HT3A 4HHTA 1C0TB 3MTKA 3DOKB 1VSFA 2KQ2A 1XI1A 4DG1A 3NGIA 1HMVB 2R8JA 1CSJA 4B9NA 1Q8IA 4N47A 3M9OB 2VG7B 2G8HA 2VG6A 4RNMA 3ZSWA 4Q45A 4ID5B 3OYDA 3QGIA 3RB3A 5KFNA 1HQUB 2HMIB 4ED2A 4RW4B 4KB0A 2XGPA 3MXIA 1QAJA 3DLEB 3T3FA 3D5MA 2XI2A 5E41A 4QW8A 1VRTA 4E1NA 4J2AA 2FLPA 4M3TA 4OLAA 4DS5A 5F8HA 1EP4A 1B9DA 2QK9A 2W42A 4CF2A 4ECYA 2A1RA 5KG7A 3BJYA 4E7IA 4PWDA 3C94A 4J9SA 2D0AA 4NCAA 3G86A 2FLNA 1A5VA 4CF1A 1RT4A 3M8PB 4LH4A 4IKFA 4O3SA 3NGDA 3KLHA 1XR5A 4FLVA 2IAJA 4CEFA 4N5SA 2W9AA 3DLGB 4FLTA 4FJIA 4QWBA 3AA5X 2ITGA 2NUBA 2IGIA 4TY9A 3OS2A 2KTQA 2KZMA 1WAJA 5KG3A 4F2RA 2E6MA 3QIPB 4GC7A 1IKXB 4F3OA 3NGYA 4ZP8A 4KREA 4KV8B 2XCAA 2ZD1B 5L1KA 4QCLA 4KO0B 4QWEA 2F8SA 2P51A 3QEXA 3NFAA 2BDPA 3H5UA 1TKZB 3SQ2A 2VG5B 1SV5A 1U09A 4K4YA 3S3OA 1LV5A 1LWCB 4LSNA 4QOZB 3SUQA 2AU0A 4YR0A 1C0UB 3AO3A 3MEGB 3SV4A 2FBYA 1J53A 5KT3A 4EZ6A 4ECXA 2Y1JA 3OVNA 1RDAA 4KHUA 3NHGA 1QS4A 3JSMA 4B8CA 3IN5A 5F9LA 2F8EX 4AHRA 4CEAA 1RTDB 3OSPA 3OHAA 1D8YA 2OZSA 3DDKA 4KRFA 3PX6A 4CHNA 4QWAA 1TVRB 5FROA 3SUOA 3AVKA 4F4YA 4CFDA 3V9ZA 4Q8FA 2ZE2B 2D5RA 3SQ1A 5KFOA 3F9KA 4CJUA 1CLQA 3CDUA 4RU9A 4IH5A 4M3ZA 1KLNA 2WB4A 4ZPCA 3LP2A 2IOCA 3EZ5A 4NLDA 3AVGA 1HNVA 3OY9A 2Z1JA 3AVLA 5DG8A 1T03A 5J1EA 3H59A 4KHSA 4CF8A 3MECB 1ZTWA 4W5OA 1A5XA 1R0AB 4CJFA 1S1XA 3IG1A 1BGXT 4J2EA 3C6UA 3I0SB 5KT7A 5J2MB 5HRSA 1QE1A 2IBKA 3TAEA 4J9OA 1LW0A 3MR2A 3M8QA 3NDKA 2B6AB 4H4MB 1REVB 4Y2CA 3OYJA 2AWZA 3KMQA 3H4BA 1XWLA 3QETA 2GIRA 4CJ3A 4LSLB 3L2WA 4FLYA 3KLEA 3RR7A 4K4UA 5L1IA 5L9XA 4B08A 2HHQA 2BANA 3SUPA 4ZVEA 4DSEA 2FVPA 3T5LA 5DGAA 4ICLB 2OPPB 4TQRA 4QWCA 2RF2A 1I39A 1JLBA 1IM4A 4Q8EA 3H08A 4CJWA 3ZSZA 3B6OA 4NRUA 4GVMA 3K59A 4DTMA 1ZBIA 1FKPB 3GIMA 3LDSA 3ISNC 2QXFA 4DTOA 5JXSA 4AHCA 3RMDA 1MU2B 4WXWA 4U7CA 4IFVB 4HCCA 1VSKA 1RT7B 1GOBA 1I6JA 1B9FA 3CJ0A 3H40A 3L3UA 3CVKA 4F4KA 5DQIA 3ZT4A 1OS5A 3VQBA 3V9UA 1N6QA 3DLBA 1NKBA 4ECWA 1WSGA 4KI6A 1NK4A 3ICLA 3ZSQA 1RYRA 4CIFA 4FW2A 2Z1HA 4B8AB 3CDWA 2UVUA 3CJ5A 3AVHA 1JLEA 1BISA 3OYAA 4URQU 3G10A 2UUTA 3MFIA 4DL4A 3OYHA 3KHLA 1BHLA 2R8IA 4ZHRA 2YNIB 3BQ0A 3SCXA 2VWKA 1NHVA 2ALZA 2W9CA 3KK2A 3KJVB 2XWYA 2I5JB 1WN7A 5CYQB 4KI4A 2DTUA 4FM0A 4L8RB 4KHWA 1JXBA 3LAKA 2ATLA 1KFDA 1U47A 2PYJA 4R8UB 4LQ9A 3HL8A 2HHSA 4TLRA 1JLGA 3OYBA 3HVWA 1SH0A 4DS4A 4OPJA 2GBZA 4IDKB 5HLFA 3CDEA 2B5JA 3RAQA 1RT1A 4TXSA 3VN5A 2E9RX 1HYSB 2RKIA 2YNFB 4HUEA 1T7PA 4I2PB 2X78A 3QYYA 1NHUA 1RBUA 4U6PA 4R5PA 4G3IA 5HROB 4ZMMA 1JL1A 1BIZA 3FSIA 4HTUA 1WNEA 1JKHA 3RR8A 2WK4A 2J6UA 1VK0A 3TAGA 5KGXA 4C8LA 4FBUA 3L8BA 2YNHB 1ASVA 1TL1B 5F8GA 5DG9A 3VQ9A 1SKSA 3BGRA 4YR3A 4NYNA 3K5NA 4E0DA 4IH6A 3DI6A 1IG9A 3HKWA 4YFUA 2IMWP 4DEZA 2C2RA 3NKYA 1S4FA 1ZTTA 3D0PA 4E7HA 2G8IA 4DWIA 3O4QA 5KRSA 1Z26A 3OJSA 1KHVA 4NYZA 2BQ3A 5CYMA 3GIJA 3OYKA 4NZ0A 4MH8A 3NGZA 5F8NA 2R2RA 3SYZA 4CGFA 2V9WA 3E51A 3H5XA 4NLSA 4FVMA 4M3RA 4CEDA 5J2NA 5DQGA 4B9TA 4EO6A 3L2RA 3OL7A 4CHQA 4CJSA 4MFBB 1J5OB 3PJWA 2IC3A 2WHOA 1S97A 3VQAA 5DG7A 1TK8A 4OGEA 2G8VA 1S6PB 2G8KA 4CJEA 3QO9A 4RW7A 4M3WA 4IG0B 4X2BA 3MFHA 3LP0B 1BI4B 5F8JA 2FLLA 3DMJA 4Q43A 3Q8RB 5JUMA 1BCOA 1RTIB 1X1PA 3O3HA 1S9GA 3PY8A 3DRSB 2PY5A 3VQPA 1GOCA 4O4GB 2WOMB 1RBTA 3LP3A 4LD0A 4PQUB 1RT3B 2X6SA 4RG8A 3NH1A 4KHMA 1SKWA 2JEFA 5HP1A 3K5MA 4CEQA 3KLFB 2CJQA 4H4OA 3ITHB 4I7FA 3SZ2A 5HRNA 3DLKA 4IG3B 2C2EA 4DSJA 4RW6B 2WONB 3RAXA 4IFYA 1IO2A 4ED3A 4CEBA 2HWIA 3OS0A 3DRRA 4NLYA 3V1QA 2DFFA 2KFZA 2YHBA 1S1WB 4NLRA 1F21A 1IKWA 5KI6A 2W9BB 4KKOB 4ZP9A 1S9FA 1DTTB 4CGHA 2YKMB 3QGGA 1IKYA 4M41A 1IKXA 3KK3B 5KG6A 4KTZA 1KLMA 1X9MA 1VSJA 4CEZA 4KO0A 1S6QB 3WNEA 3L2UA 3C95A 4FK4A 4ELVA 1TP7A 3TARA 3S3MA 3AO1A 2VWJA 3P5JA 4JRPA 3CJ3A 3MEEA 1XHZA 4O3QA 4F2SA 1TV6B 3OYFA 1U45A 2OPQA 2YKNB 4FK2A 3CJ4A 4NLWA 2AX1A 4J9KA 1D0EA 1GX6A 5KFEA 4CJLA 4DU4A 2KZZA 3SNNA 4CCHA 4G1QA 2O4GA 1Q9YA 1T05B 4KFBB 3AO4A 4KHRA 5C25B 4FBTA 3QLHB 5J2QA 3OYMA 3DRPA 3I5BA 1CXUA 4B9MA 2JC1A 3QEIA 4B3OA 4DTSA 2QV6A 2HVHA 1A5WA 4XPCA 4FS2A 4DQSA 4OKJA 3M8RA 1T3NA 1TL3A 3ASMA 1S1UA 4YNQA 3VQDA 4FJXA 5KFDA 4ED6A 1LWFA 2G8WA 4CHYA 1L3UA 3AVMA 3AO2A 3QERA 2D3ZA 1N5YA 4MIAA 3H5SA 1YVUA 1XC9A 5K14B 3OL9A 3VQSA 3Q8PB 3BQ1A 1BCMA 1RT2B 1YTUA 4HUFA 1DTQA 5JS2A 4RW9A 4CGJA 1JXEA 4E1MA 3MEDB 1XHXA 1RDDA 1UA0A 3NAIA 3CIZA 3DLRA 3MECA 2HNYB 4KE5A 5KFBA 5J2PA 1KTQA 5DQHA 3PR5B 3TI0A 1R0AA 3IS9A 2IJFA 3KMSA 3ZT3A 4DL6A 3PVXA 2ASDA 4WYLA 4J9RA 4FJ8A 2FVRA 1GOAA 4FJHA 1C6VA 3P83D 4Q0BA 3QEPA 3MR6A 4RW8B 2AQ4A 2B6AA 2XO7A 4J9QA 4CGGA 1REVA 3V81B 1SUQB 2BE2A 4YMEA 2PYLA 1QSSA 4DL5A 2DY4A 2FVQA 4HYKA 1CXQA 3OJUA 1TK0A 4K8ZA 5KFWA 1J9AA 5KFGA 3ZT2A 1TKTA 4WE1B 1IKVA 3HO1A 2OPPA 3QNNA 4N56A 4DTJA 4O3OA 2FBTA 2GV9A 1VRUA 1JL2A 5KT6A 3CYMA 1ZBLA 4W5TA 2FJVA 5KFLA 3NBPA 1X9SA 3N6MA 4AHVA 2UUWA 4DMNA 1Z25A 3KLGB 2ATQA 3NF7A 1QSLA 5KFHA 3RTVA 2JC0A 2HNZA 1CZBA 4MQ3A 5I42A 2C28A 3A2FA 1C1CB 1RA7A 2EC0A 4Z4HA 1LAVA 2YV0X 1JLAB 2HNDB 4CFCA 5EUHA 5SWMA 5DLFA 1J54A 5KFXA 1RT5A 4DLGA 3ZT0A 5FRNA 4O44A 3UQSA 1TKXB 3OLAA 4DTXA 5C24A 3P1GA 4KTQA 4FJ9A 2Z1IA 2QE5A 2R8HA 5EWEA 5KFPA 3KKRA 4BE0A 4F8RA 3HSTB 3KLIA 2X74A 3M9MB 3KKSA 1QHTA 4F3TA 2AGQA 3HVTA 5KG5A 4RNOA 3AVCA 3EPGA 2GUIA 4O55A 2GC8A 3V6KA 4XO0A 3PW5A 3IAYA 4IQXA 1WSHA 5CZ2A 4Z4EA 1LW2A 3H2LA 1X9WA 2VG6B 5FDLA 4ZPDA 1YVFA 3H98A 2BQRA 4LH5A 3C6TB 4CK2A 3GYNA 1RBVA 5KG1A 3NE6A 1HNIA 4KB7A 4KAZA 2E9TA 1KVAA 3DM2A 3HJFA 3ZSOA 1VRTB 2BR0A 4EEYA 3AVBA 1EP4B 3BSAA 4NLTA 2IS3A 4K4ZA 4NLOA 3GV8B 1HYSA 4RNHA 2R8KA 4H54A 4PWDB 3LP1A 4CERA 3TAQA 1RT4B 1NJXA 3RBEA 3CO9A 3MF5A 1S1VA 3KLHB 2IAJB 1JXLA 5KFUA 1FKOA 1HPZA 3DOLA 4J2BA 1TKDA 3QIDA 3NF8A 5HBMA 1ZYQA 4I9LA 4IBNA 1HQEA 2VA3A 4FLWA 3V9WA 3FQLA 4CEOA 1BQNA 3VQ5A 2B4JA 4DQIA 1RDRA 1W0HA 3RRHA 4CE9A 4M3XA 2OPRA 4CESA 4Z4GA 4ECRA 4BE1A 4EBDA 3JYTA 5F9NA 4K4WA 2ETJA 5F8LA 1N48A 4PUOA 1D9FA 1JLFA 1NNDA 1SV5B 1RTJA 1VSDA 3ULDA 2P1JA 4TSXA 4LSNB 4CJTA 1RDBA 1RT6A 4PA1A 4DSLA 5C5JA 3FQKA 1EXQA 3M8SA 1C1BA 3IGVA 3QNOA 4BACA 1D9DA 2BRKA 5KG2A 3EZUA 5EDWA 2HHWA 1S0NA 3JSMB 1T8EA 2QKKA 1JIHA 2ILYA 4I2QA 3BR9A 2Z1GA 4BDPA 4NLVA 1S6PA 4CGIA 2UVVA 3OYCA 2ZQBA 3ZSXA 1BI4A 4W5QA 5D3GB 3HYFA 1FK9A 4QPXA 1RYSA 4C8OA 3PZPA 4KBIA 1LWEA 4DL7A 4IR1A 4LY7A 2W8LA 3V4IA 4AH9A 4RZRA 4WFZA 4MIBA 2A1SA 4M45A 5KFVA 3LP2B 2HHVA 4OPKA 2DFEA 3KHGA 4AHTA 4ZVHA 2D3UA 3N6NA 4ZTFA 2IM0A 4FJNA 1HNVB 2KFNA 2JEIA 4CHZA 3KTQA 1T03B 3MR5A 5J1EB 1EETB 4IR9A 4DQQA 2RN2A 3K5OA 3OYEA 1ASUA 4FJMA 4MKAA 3HHKA 4M42A 2QKBA 3EYZA 3G0ZA 1TGOA 2WRMA 2XY8A 3ALYA 1S1XB 3IG1B 4ZTJA 3PV8A 4NLXA 3C6UB 5JS1A 4F50A 4BDYA 3RMBA 4MK9A 4FJGA 5I3UA 3T5KA 4NCGA 3AVJA 3SUNA 3M9NB 1LW0B 3FFIA 5C42A 3M8QB 2BRLA 4EYHB 4GC6A 3O3FA 3LPTA 3RB4A 1RTHA 1S9EA 1L5UA 4TY8A 1UWBA 3UDLA 2EHGA 1DLOA 4DFJA 3TAMA 2IM1A 1RNHA 4DTUA 3PHEA 3N6LA 2OH2A 3KLEB 3KK1A 4JS5A 4B9VA 5CY4A 2G8UA 3DYAA 3NH2A 3I0RA 2BANB 4FZXC 4CIGA 3EY1A 4CJRA 2HAIA 4JUZA 2FBXA 2YNGA 3TANA 2RF2B 4ED1A 2XHBA 4DSFA 1JLBB 2HB5A 1BL3A 1I3AA 3IRXA 5KFJA 3VQ8A 3TWHA 4FJLA 4YR2A 2ZKUA 4DSKA 4RUAA 3HPHA 3AV9A 4ECZA 3V6DA 4DLEA 3QEVA 3D45A 3LAMA 1N6QB 3QINA 4Z0UA 4TQSA 4JLHA 4JRQA 1C0TA 3DOKA 3BDPA 5KT4A 3FRZA 3CFOA 1HMVA 4DL3A 2JGUA 4FCYA 4XIUA 1IH7A 1JLEB 1XR7A 2VG7A 2R7YA 3PW4A 5KFMA 4PY5A 3AVFA 4ZP7A 4ID5A 2LSNA 3PX0A 2G8FA 1UAXA 1HQUA 4RUCA 3IGNA 4ZHRB 2HMIA 1RCHA 4RW4A 1QUVA 4CJPA 3QESA 5EWGA 4CFBA 2R2UA 2W9CB 5KTQA 4ELUA 3KK2B 4KSEB 3DLEA 4LQ3A 4BE2A 5KT5A 1NOYA 4WYWA 3NF6A 2UVWA 1S48A 2X6NA 4KB1A 4B9LA 1O1WA 4B9UA 4DF8A 2JLEA 3AA3A 2UVRA 5HLFB 4NLGA 1SL2A 5KFTA 3M8PA 4FXDA 4GW6A 2JEJA 2RKIB 4JS4A 2XY5A 4W5RA 1SH3A 1G15A 1U04A 3DLGA 4R5PB 3CQ8A 4RW8A 4CFAA 3TABA 1JKHB 4CHOA 4OVLA 3QIPA 3NF9A 1VSHA 3L2VA 3F73A 2J6SA 3K5LA 3KD5E 4WZMA 4KV8A 3GV5B 2ZD1A 4DFMA 3BGRB 3KIOA 4Z4FA 3DI6B 4WE1A 3VQ6A 3PO4A 4AHUA 1TKZA 4M3UA 3LZJA 3KD1E 1ZBHA 2VG5A 4MK7A 2OPSB 3E01B 1LWCA 4ZP6A 5KFSA 3KLGA 3T5JA 2YHAA 3SFGA 3OL6A 1C0UA 3CFRA 4CEEA 3MEGA 5CYMB 4F4WA 4JV0A 3VQ4A 1WNSA 1TQLA 3LPUA 1UA1A 1JLAA 4KAIA 4Q44A 3SI8A 4J9MA 4FJKA 4NLQA 1RTDA 3SPYA 5F8MA 3H5YA 4FM2A 5J2NB 1TVRA 2XC9A 4ZVGA 4ED0A 2FBVA 2JEGA 2HHXA 4CGDA 3TR8A 2ZE2A 4HUGA 1FXXA 4URSA 4E3SA 2IC3B 2RDJA 1WSEA 3QO9B 4RW7B 3HVRA 4AHSA 3SI6A 1L3SA 2IM2A 3GV7B 1HRHA 3SQ0A 3T1AA 4OLBA 4NYFA 2IJNA 3HXMA 3DMJB 5SZTA 3O3GA 4GMJB 3PUFA 3KHRA 1ZBUA 1S9GB 5DGBA 3UIQA 1S1TB 3RRGA 3CG7A 1NOZA 3H4DA 3C6TA 1L3VA 3OSNA 3PW2A 4NLPA 3S9HA 3V6JA 1QAIA 4O3PA 4O4RA 3LALA 1RA6A 3G6VA 3RWUA 1JLQB 2HW3A 3KNAA 4CJ5A 3I0SA 3OLBA 2HWHA 3VQCA 4EP5A 5J2MA 5HP1B 5CZ1A 4ELTA 4DFPA 4H4OB 4DTRA 4I7FB 3NAEA 3DLKB 3SQ4A 4Y34A 4ZVFA 3HP9A 4K8XA 1S10A 3PW0A 4H4MA 4IFYB 1TAUA 3HP6A 1YT3A 2DPIA 4WFXA 4LSLA 4CF0A 1RDCA 3DRRB 2OZMA 4HKQA 1VSMA 4DQPA 3NL0A 2RDIA 2F8TA 2FVSA 1TAQA 4MK8A 1U49A 3HPGA 1IKWB 4Y1DA 4OL8A 4OJRA 3ZCMA 4ICLA 4HCBA 4FM1A 2XCPA 1HYZA 1N4LA 1SKRA 4IRDA 3T19A 1IKYB 3LANA 1ASWA 3Q8QB 5HRRA 2V0NA 4J9PA 3TVKA 1KLMB 1FKPA 4EBCA 1Y97A 2F96A 4QAGA 3MR3A 4E7JA 1MU2A 4TYAA 3QZ7A 4ED7A 5KRTA 3RMCA 3HVAA 4IFVA 1RT7A 3MEEB 1T94A 3L3VA 3AA4A 3GILA 2OPQB 1K6YA 1D1UA 4DF4A 4OKKA 5KFFA 2D41A 2R8GA 4E7KA 3MAQA 3KHHA 2HHTA 1BQMB 3PO5A 3OS1A 4YQWA 1W9HA 4G1QB 4TN2A 1JLCB 4ECUA 3RBDA 2BGGA 4UQGA 3NAHA 5J2QB 2OA8A 3DRPB 5T14A 1C1AA 2Y1IA 2I1RA 4IH7A 4B3OB 3LWMA 4FJ7A 1VSEA 3HK2A 1B92A 4EZ9A 3OYIA 4ECTA 4DG1B 1TL3B 5F8IA 1EKEA 4XPEA 2YNIA 4OGCA 4O0JA 1S1UB 1BIUA 4CIEA 5D3GA 3CM6A 3KJVA 4WZQA 3QZ8A 2I5JA 2XGQA 1LWFB 3GIIA 2WCXA 4K4SA 4B9SA 5CYQA 2ASLA 3WNHA 4AILC 4KHYA 4IOBA 1S5JA 1N5YB 4ZPAA 3MXJA 2AGOA 1NKEA 2AGPA 3KLVA 4R8UA 4K4XA 4KHNA 3OYNA 3VA3A 2ASJA 2XI3A 4K50A 1DTQB 4RW9B 4IDKA 1EETA 3RB0A 3G6YA 2FJXA 3K2PA 4DTPA 2DFHA 5J2PB 2YNFA 2CKWA 4I2PA 4DU3A 3GIKA 3IS9B 4DQRA 1NK5A 1L3TA 5HROA 3TAFA 2E9ZA 3V1RA 1KVCA 1NJZA 1SH2A 3D28A 2YNHA 1KSPA 3HM9A 4W5NA 5KFCA 1NK7A 4Q0BB 3PW7A 1TL1A 2Q3SA 4C8MA 5DMRA 4DU1A 1VSLA 4YP3A 4O0IA 4K4VA 2BE2B 1XR6A 1QSYA 3FDSA
chains in the Genus database with same CATH superfamily
2LEBA 3CJ1A 3BR8A 3NMAA 5DDRC 2MKYA 1WHYA 4J7CA 1PYTA 2GMHA 5KFIA 2IVYA 3UDCA 1WLJA 1TKTB 2O8CB 4FLXA 1SIWB 4F3QA 1U02A 1WHVA 5A8WB 3UKUA 3CIMA 2ZH3A 1VRUB 1IWAA 3DRYA 5KFZA 5F3ZA 2G4BA 2QWQA 4RNNA 3BEGB 3SCJE 1KVBA 3DXMA 2J8AA 4HHHA 2ZZNA 3ZETA 4A8SA 2VA2A 4KQZA 4FYXB 3THYA 4IRCA 4MT1A 3CW2C 3PRDA 4JHDA 3AVAA 3UR0A 1R0CB 3D0IE 4MFBA 4ZS6A 1EJ7L 3C6AA 4CJKA 4DFKA 3OYLA 2L9NA 2MHEA 3MWBA 3OL8A 4TU9A 1XMOK 3CE8A 5AQPA 3DDIA 5LMNK 4B02A 3S3NA 3VZIA 1RTIA 3PX4A 1AB8A 2GA7A 1KP6A 3CCRS 4DZ6A 3R7SB 3D67A 1F3FA 3WC0A 5SUHA 1ZBFA 2WOMA 5FPDA 2IM3A 4FPAA 1NMDA 5AQYA 2PFDA 2WW8A 1RT3A 1K8AT 2CUYA 1V6HA 2YPYA 3TVZA 3ENBA 3KJQB 4EP4A 4IG3A 1Q79A 4E7LA 4CJQA 2NCKL 2QMUB 2WONA 1AFJA 2ZH7A 3HPOA 1OYDA 3W2WB 2XY6A 1U0SA 1YJ7A 2ILZA 2P5GA 1YITN 1F0XA 3UPFA 2WBMA 3SAHA 4EAHD 1R8HA 1B70B 4CLSA 1RADB 4KKOA 1BQXA 4C8KA 3UD3P 2NXUA 2JRSA 3PDNA 3VCDA 5DDQC 4QIEA 3WEEA 3U6FA 3EPIA 2JWNA 1CZ9A 3SAGA 5LY3A 2O8BA 3BSOA 4ZVTB 2O67A 3TAPA 1T3VA 4YDXA 3V9SA 3NH0A 2W41A 2NZ4A 1S49A 4K0KJ 2E5IA 2CQ1A 1RBRA 3E01A 1AROP 1MWQA 3BSNA 1YTAA 2P5OA 1WKLA 3SQOP 3BKFA 2DGXA 1ZBTA 1VK8A 4URGA 2OGUA 3CD5A 1QTMA 2RE2A 4CK1A 1FJGK 4KFBA 3FUYA 3TA0A 2R42A 3SV3A 1RT6B 2DXEA 4CO1A 2XRIA 4TNOA 4HVZA 4J9VA 3JTNA 3MN7A 3D6TB 4CYUB 4JV5F 3LO3A 3BO3A 4MKBA 2O66A 4UUWA 4C8NA 2OTJN 4Y3CA 3QEWA 3I55N 1LFWA 2NYIA 5KFAA 2IVPA 2GQQA 3MMCA 4JI8J 4FW1A 1C2PA 3KXDA 4CZMA 1QQCA 4N41A 2VBWA 3RB6A 3R8EA 1FK9B 4ECSA 3M5RA 5KG4A 4K4TA 3IR5B 2PI5A 2A6AA 3MEDA 1S1TA 1AYEA 4PG8A 4KR0B 5GADI 2NSBA 4CBWA 3CCLN 3QJLA 3UVJB 1O5JA 3FZMA 4ZJQA 2RDDA 1GK8A 5C10A 4QQBA 2Z2LA 5KPZA 2MQLA 1RT1B 4LFAF 4O0NA 3ISND 2Q43A 2HKEA 1M5PC 4CT8A 3QGHA 4QW9A 2BW7A 4BRPA 3MM8B 1WAFA 1HLUA 4JI1F 5C42B 2C3PA 2E6LA 2HFSA 1NG9A 1S9EB 4UF4A 4M94A 1UWBB 4USTA 4UUXA 4CO4A 1RAHB 3V1OA 1IJJA 3TAMB 2VFRA 1XNRF 1SC1B 2Z57B 5LJ3Y 4FLUA 5IQQA 3P8BB 5CH7B 3EGNA 4Z7YA 3MM9A 2Z4PA 5A2QY 5EU7A 1SS6A 4PXDA 2NRRA 2EG2A 4QBUA 2GX9A 1TK5A 2G2YA 3HLUA 3SFUA 3I8DA 2XMUA 3EGVA 2Q66A 3BYRA 1CG2A 5KT2A 4CF9A 1SI9A 1YJWS 3W2VA 1H72C 2QYGA 5HMZA 4DUYK 3NGIA 1HMVB 1WI8A 4B9NA 3OBIA 2WTUA 2FUG9 3MMVA 1QVFR 4JKDA 4ID5B 2V8PA 3QGIA 1HQUB 2BJ8A 4DV3J 2VONA 4ED2A 2H5EA 2ERRA 1ZM9A 4QW8A 4LRFA 3NS7B 4OLAA 4NXMF 2GEMA 4BRNA 2E2PA 5KG7A 4FWRA 1ZM3A 1EQMA 5TKYA 2D0AA 3G86A 4MKVA 2D1KA 5IT9Y 1RT4A 2VFUA 1NO8A 4JYAK 3NGDA 3KLHA 1XR5A 4FLVA 4ZIWA 4CEFA 4UTGA 4N5SA 4WK1A 1M1GA 4NO7A 2ITGA 2IGIA 4JKBA 3OS2A 2KZMA 1E6YB 2C2KB 1G2EA 4F2RA 1HKCA 4WYBA 3G6ES 4X4TA 4YS2A 4KV8B 2XCAA 5L1KA 3J7ZT 1XIQA 1NJIT 3QEXA 2IBOA 1URNA 3L95X 4LF1A 1VJWA 5DM7Q 1MMNA 3FCWA 2LVWA 2QGFB 2YKAA 4MO4A 3RSEA 3I9ZA 1SV5A 1U09A 4Q2LA 4QOZB 1S0VA 2ABYA 3CTRA 2AU0A 2BJEA 3AO3A 2I9SA 2FBYA 5ETQA 2HZAA 1RDAA 5ETPA 2J0WA 2CPJA 1VQMS 3NHGA 4C48A 3JTPA 3A8JA 4B8CA 1BG3A 4DR3K 4AHRA 1GLJO 4D3HA 5AXKA 3OSPA 1GLDG 3DDKA 4QWAA 1U2VB 1TVRB 5FROA 4ILMA 9RUBA 4BC5A 3AVKA 2HRUA 4F4AA 3CQYA 1E4GT 5HL7L 3CDUA 2Q0RA 4WBFA 2E20A 5H9FK 3G8SA 4GNIA 2XS7A 1NB2A 2E5HA 3NMRA 3LP2A 2YH1A 3M3ZA 4C97A 3O6QA 3ZZYA 2LQ9A 4RKUC 4BG9A 3G82A 3RVCA 3FLCO 4DCHA 1ZTWA 1Q95G 1R0AB 1S1XA 3IG1A 1BGXT 4GKKF 1RWVB 2CQPA 4ITSA 3JAMU 2X1FA 1S99A 2ZFHA 4HTLA 5LL6Z 1FFSB 4ZVPB 3SSQA 4ETXA 1VQ7N 1M1HA 1HHTP 2B6AB 2B9YA 2PGCA 4Y2CA 2AWZA 2R7TA 3EDQB 4CJ3A 1UVLA 2MQ8A 5AQRA 3KLEA 3RR7A 4K4UA 5L1IA 4PG6A 1F9HA 3NMUA 1DKGD 3FE1A 2XHCA 2VQFK 4DR4K 1NM2A 4N8NA 2VL1A 4PWUA 1M0SA 4CJWA 4H0OA 2AYMA 1ZBIA 1FKPB 2F4VF 1HNZK 2QXFA 3CCUN 2E5LF 1MU2B 4WXWA 4HI1A 4NPOA 4UY85 1V5VA 3BKUA 3UO0A 3CJ0A 3BZCA 3L3UA 5A8RA 3EVMA 2F4FA 4JV5J 1FRIA 2FGCA 1OS5A 2Z58B 3VQBA 3UNYA 5IT4A 2BEFA 2NYHA 1NK4A 3CC2S 5GVQA 3CJSA 4UOGA 4LSZB 4CQ1A 3PNIA 1BISA 4BR9A 3FZLA 2UUTA 4M7YA 3H42A 3OYHA 2R8IA 2YNIB 1B4SA 5ETLA 2RHQB 1NHVA 3KJVB 2NZCA 1IR0A 3VQTA 4OZ0A 5BR8J 4U96A 3M8YA 3SK3A 2O01C 2P9UA 3PHTA 4Y00A 4A8FA 3TO8A 4LFAJ 2ZNZA 3BM7A 4JI5F 1JLGA 1FJ7A 1K9MO 4OIXA 3GE1A 4ZKAA 2WVEA 2GBZA 2M7SA 5HLFA 2B5JA 3T1HF 3RAQA 4I67A 4JI1J 4QIVA 2YNFB 4M8LA 2RQCA 2RH3A 4I2PB 4C3MA 3Q7CA 1VQYA 1QVGR 1JKHA 3KJNB 3RR8A 3B8AX 4FBUA 1XNRJ 3VVUA 2YNHB 2VGMA 5I3PA 3FBBA 2ZOFA 1F5AA 1AZSB 3VQ9A 3BGRA 3TP2A 2NSCA 4YR3A 2FSJA 2MQNA 2FY1A 2CPYA 3DI6A 1RU1A 2HG4A 2Q1LA 4DV5K 1WKJA 2XB2D 2AEFA 4YFUA 2K06A 4C0HA 3NKYA 2LEPA 1CJVA 5HMWA 4N7TA 4E7HA 1AFIA 5KRSA 2M9KA 2RU9A 3VERA 4ZVQB 3OYKA 3TZXA 2ZJRQ 4MDAA 5A76A 3JQJA 2ZJPQ 4WQ4A 2R2RA 2XMMA 3OUYA 4X65F 3W60A 4A8WA 3E51A 3FR0A 4OI0A 2DTJA 5JVGL 4NLSA 4FVMA 1U2FA 5HSPA 4M3RA 2CQGA 3NCRA 2IIHA 1S79A 3ENAA 1MWZA 3GG0A 4B9TA 5AR0A 3L2RA 2DHXA 1JJCB 5M2RA 1J5OB 1LXNA 4DJBA 2L08A 4M5IA 3VQAA 4YOTA 4RW7A 3LP0B 4F26A 2FLLA 4PG4A 3E8OA 3GCXP 5JUMA 3HFVA 2DH8A 2W25A 3L7PA 2YHWA 2DPNA 1S9GA 5HATA 2YI1A 4X66F 2YBVA 2Y3YA 4KH1B 5DZ7A 1GOCA 4O4GB 2CGJA 2QWNA 3TTFA 4NXMJ 3HI9A 4J91A 4PQUB 2CDQA 3G8QA 4KHMA 2M70A 4YHHK 3L7UA 1FVQA 3AD7C 2EKNA 2MGZB 5BR9A 1RWWB 3ITHB 1DARA 2E5GA 5HRNA 1OPIA 3LM9A 3TJ9A 4RW6B 4NI2A 1YDLA 3MM6A 3DOMB 4HEA9 2P9SB 2F9JA 1YJTA 4EI2A 3RGIA 3J80U 2GVDB 4XH1A 2W6KA 1DQ9A 5GADU 1OY8A 3RU0A 2CZ9A 2VPXB 2D69A 1S9FA 1YG0A 4OYIA 1IKYA 2DEIA 4C2MA 2CWKA 2GNKA 4DV2F 2ZBPA 4B3RK 2ZH2A 1X9MA 4G1IA 4KO0A 2OCEA 2W4DA 4WF9Q 4GVEA 2OMLA 3WXIA 4FWOA 3S3MA 1VQPS 2DNOA 1TU0B 4FF1A 4G65A 4DV1K 1M90O 4LRCA 2W01A 4UW2A 1YRXA 2OPQA 3CJ4A 3JQMA 1GX6A 4CJLA 1KKHA 4B3TF 3VV2B 1MA9B 2KZZA 4CCHA 4G1QA 4JK8A 2QTWA 2O4GA 1GLEG 4CH7A 3AO4A 2DGUA 2P9CA 1RGVA 4Q7AA 3NP5A 3M30B 3N4WA 3UE5A 4B9MA 4B3OA 4DTSA 4ES3A 5C15A 1B0VA 4WK3A 2AP6A 3N4QA 3GDQA 4LJMA 4H03B 3IO1A 1SQFA 4U9RA 1FX2A 3VAMA 3U9DA 3VQDA 3TA2A 2C2NA 2R7OA 2ZGYA 1FE4A 4K8RA 1TYQA 1H6KX 3GR0A 1SXLA 1Q86O 2LEAA 4KH0B 4EIAA 3VQSA 5HAOA 3ZXWA 1RT2B 2N4CA 2EG1A 5JS2A 4RW9A 2FHJA 4CGJA 4A8KA 4GKKJ 1XHXA 1ZA2B 5HN0A 3K9KA 3DLRA 3KWIA 2HNYB 4KE5A 4BR4A 1XMOF 1HWUA 1KTQA 3PR5B 2FJDB 3TI0A 4JKGA 2OHDA 1BC6A 2PI4A 2VGNA 5LMNF 1URRA 3MZIA 2ASDA 1RHUB 4J9RA 2DNZA 1GOAA 1VQKS 5HK4A 1U7LA 5CZVA 2H65B 1N36K 3POTB 3EGZA 4RW8B 1Q7YO 1FEHA 1UAWA 4BQLA 1TL7B 1SUQB 2BE2A 1MWMA 3CD7A 2FVQA 3P4IA 1TK0A 3OW2R 1Z2LA 3GFHA 3ZT2A 2W1BA 3FEZA 5AE1A 1TKTA 2O8CA 4WE1B 1B3TA 2QSWA 5A8WA 1P8ZA 2I8EA 3CXCR 2F4VJ 4V19X 5HQMA 2FBTA 1VRUA 2E5LJ 3AD9C 1JL2A 4JKCA 2J0XA 4OYOA 4A61A 4ZITA 4OX8A 2ATQA 4DB3A 5LOQA 3KG1A 1MMDA 3RTVA 4KRWA 1YUWA 1NGCA 1GFWB 2EFNA 1WEXA 4CO2A 5DDPC 4LFBK 2MZTA 3Q89A 3TW0A 1IVZA 3D6RA 4DLGA 1TKXB 4LC9B 3PJ9A 3I56S 4DTXA 1U26A 3R27A 2BW2A 3MDQA 1TFWA 2K7JA 3F2KA 2XNQA 3AY0A 1FHTA 3KKRA 4F8RA 1QZ5A 1IBKK 2QO3A 3NS5A 2AGQA 3IBWA 3N01A 5KG5A 1R7IA 2G0CA 3EPGA 1YBUA 2BKOA 3CCRN 1C4AA 1FJGF 2QN6B 1J27A 1QQMA 3H2LA 1X9WA 2VG6B 2KU7A 4C8ZA 1CPZA 1YVFA 4LH5A 4JI5J 4H0YB 2QL7B 3H0PA 1WSRA 3NE6A 1OJ4A 2BX6A 1QM9A 3T1HJ 3S01A 1G4CA 4EEYA 3CCSS 2RB7A 3OFGA 4NLTA 5FPMA 1P1TA 3V2UC 2BMBA 3GV8B 3PKYA 2K1RB 4RO0A 5HVGA 3ZX0A 3TAQA 1SQGA 4WU3A 4FP9A 4QPTA 3IBCB 2WUSA 1K9MT 3MF5A 1WDDA 4NZ7A 2IAJB 3A3NB 3QIDA 4ES1A 3NF8A 3J7AN 1Q5YA 4J90A 3V9WA 1W7WA 4O5FA 3LA0A 1RDRA 3RRHA 1W0HA 4CE9A 4M3XA 3HSGA 4BE1A 4EBDA 2EWSA 4X65J 3QJJA 3GJRB 3AFGA 1D9FA 2QSFA 1OO0B 2G9OA 1VSDA 1RT6A 3AQPA 5C5JA 2P9GA 3IGVA 5ITHA 2DK2A 3UCGA 4CYUA 2KG1A 2B4UA 1EQ0A 1NWKA 3MTJA 3EZUA 5EDWA 1YJVA 2ZHOA 1T8EA 3GE9A 3LL3A 3MUTP 3BR9A 2CH6A 1XMBA 4FOEA 3SCLE 4NLVA 4X66J 2O1PA 2UUAK 1I3OB 5D3GB 1MW7A 1FK9A 2LA6A 2DXDA 2GIFA 4C8OA 1ACMB 2V6AA 8ATCB 2W8LA 3O9QA 4AH9A 5BJRA 2A1SA 5KFVA 4OPKA 2AEMA 2DFEA 3KHGA 2HYIB 1P9YA 3RW6A 4AHTA 4EFHA 3UVJA 2V7YA 4ZTFA 3RBZA 4DV6F 1YGYA 2E44A 5D4OA 3GL1A 1BY9A 4M5JA 2VB6A 1HWJA 4CLKA 1FRLA 3ZEUB 2YVSA 3D6MB 1WOPA 2YX1A 3IC1A 2WRMA 2XY8A 3ALYA 4KGZB 4DUYF 4X4PA 4NLXA 3C6UB 5JS1A 2ZF5O 4BDYA 2KVIA 1ZAWA 1IR2A 1P90A 3T5KA 3MM8A 3AVJA 4ZJLA 5C42A 4EYHB 3M8QB 1WC1A 1LFPA 3J80O 1S9EA 4GMKA 1RSCA 1UWBA 4DFJA 2DGOA 3FGUA 1S4EA 4DV2J 3TAMA 4BC3A 2MZRA 1X31C 6FDRA 4IEEA 2AD9A 3X3UA 4JS5A 2JDJA 5CY4A 3FVYA 2N82B 2HRYA 1WSVA 2VKZG 1E4FT 1RTZA 4JUZA 4DSFA 4R0JA 1WUAA 2MKIA 4HDHA 1RAAB 4A62A 4B3TJ 3JXUA 2CJKA 3I87A 2E5JA 3WUHA 2HFVA 5KFJA 1VMBA 2MJUA 4GO7X 4OJGA 2W7AA 1XQIA 4YR2A 2ZKUA 3HD2A 5KQ8A 5BRFA 1EX8A 2ZM6K 4RUAA 1XC3A 4WTYA 1BU6O 1O13A 3O08A 3D45A 1M90T 3M2RB 4P2SA 1JMTA 2YTCA 3H1QA 4JRQA 4NOHA 2QA1A 1YJWN 1HMVA 4DL3A 5IC6B 2V50A 1IH7A 5D4PA 3S6EA 4WFAQ 3OV7A 1RWOB 4NMLA 2CJYB 7AT1B 4ID5A 2G8FA 1UAXA 1HQUA 3EZOA 4RUCA 2Q31A 4ZHRB 4CJPA 5A8KB 2R2UA 3KK2B 1XMOJ 2XMKA 5KT5A 2RSQA 4WYWA 4DR3F 3E9PA 3WXLA 3NGSA 5LMNJ 2E8AA 2LQJA 2X6NA 2UXCF 4PKHA 3CCMS 2HOEA 3UCUP 1BE4A 3ADAC 3TTDA 1Q82T 4A59A 3T6JA 4DBQA 2UVRA 4BRGA 1Q86T 2F3JA 1SL2A 5KFTA 1V4TA 4GV6A 4JI7K 3HTVA 3GG1A 2JEJA 2RKIB 1LK7A 4H0VB 1KWMA 3C7NB 3VENA 5IXUA 4R5PB 3J7YI 1VDHA 4A2BA 4P10A 1HI0P 4KJIA 4CHOA 2V63A 1E6YA 3NF9A 2J6SA 3KD5E 1YK9A 4KV8A 3PLAA 2RS8A 3MM7B 3CJQA 3GZ7A 3CJKB 3KIOA 3G6EN 1VBKA 3HD1A 1NDCA 1YJRA 1Q7YT 2IVNA 4IO9Q 2QLWA 2DR6A 3KD1E 2V52B 1PO6A 4AL6A 3M1VB 1M5SA 5IZHA 4OYZA 4ZP6A 3QDKA 5A6WA 4OYPA 3SFGA 4DX5A 3VPZA 4CEEA 4F4WA 5CYMB 4RCHA 2GO9A 3H2VE 2O8FB 3AJDA 2DR7A 1HD1A 4FWLA 4Y0WA 2VQFF 4DR4F 4NLQA 1VQMN 4J9UE 3H5YA 1U2VA 1TVRA 4M5DB 4ED0A 2ZH8A 4CBUA 3BBCA 3BKTA 1RXOB 4JD2B 2PC6A 4AL5A 2GTDA 1HNZF 4ES2A 1FXXA 1Y0HA 4URSA 4CP5A 2IC3B 2RDJA 1FJGJ 3ENVA 1N32K 1FTCA 1WSEA 4JI3K 3QO9B 1X7VA 3Q23A 5D78A 1NGBA 3MWPA 1LK5A 3W0LA 2BTFA 3SQ0A 3T1AA 4OLBA 2IJNA 3HXMA 3K9JA 2ALYB 4YEAA 1PAEX 4ZJOA 3UIQA 3CG7A 3C6TA 1ZM2A 4NLPA 4U67Q 3AHPA 4O3PA 2BOPA 3TRGA 2M8HA 3RW7A 2IRYA 3SCIE 2HWHA 5ETVA 3NNAA 5CZ1A 4NX9A 4ZA1A 4PR6A 1UZDA 4TKTA 3SQ4A 5DM7L 1BDGA 4NWBA 5GAEP 3DRXA 1WTFA 2LXUA 1YT3A 1NSQA 1H1VA 3VF2A 2KXFA 4YB5A 1GXTA 1U49A 1A9NB 4Y2IA 1YJ9S 4F36A 4Y1DA 2HPUA 2XCPA 2CH5A 3VAKA 4I6AA 1RJJA 1T3OA 4V19J 5HRRA 1FKPA 1Y97A 3AGKA 3MR3A 1MU2A 5DM6L 4YUDA 4TYAA 2E29A 3HVAA 2VPYB 2XMWA 4JKHA 4GKJJ 1D1UA 2KYZA 2HHTA 4DV5F 2QMXA 1TMJA 3OR2B 3NAHA 3CC2N 2VDHA 2OA8A 5T14A 2YX6A 4DV7K 4Y28C 4DPTA 2V69A 2NZTA 2I1RA 2NRVA 2AYBA 1OSDA 3HK2A 1B92A 4EZ9A 1B99A 3OYIA 4DG1B 1TL3B 2YNIA 3O9TA 1S1UB 5M1FA 1BIUA 4CIEA 4U95A 3KJVA 3DU6A 4WZQA 4M5HA 1RHQB 1LWFB 4DV6J 4OZNA 3WT0A 4ZPAA 3MXJA 3ATUA 1SQEA 4DU8A 3HM8A 4K42A 4KHNA 2IA0A 3OYNA 3AD8C 2P9IA 2ASJA 4DUYJ 5IS2A 1EETA 1RBLA 1NEEA 3G6YA 3OXLA 2PEBA 2FJXA 5DJBA 1NMEB 4PG5A 2YNFA 1SC6A 3SBMA 1MN7A 3VAIA 4I2PA 4WQ4C 1WHXA 3GIKA 2H1YA 1SJ1A 4J8FA 1NJZA 5FD1A 2CQ3A 3PACA 2XLIA 1GQEA 2YNHA 1KSPA 5H9EJ 5KFCA 4HL9A 4X4OA 3LUYA 3THXB 3F9MA 3THWB 1FFWB 1VSLA 1DEJA 4O8KA 4K4VA 1XR6A 5I9EB 3IAM9 4YHHF 4GY2B 1PC4A 3JQKA 3WNFA 4F4XA 2K7KA 2ZH9A 1HBMB 5K8OA 1IKVB 3FKBA 2PZSA 3ZSYA 4NASA 6AT1B 3VQQA 4GVLA 3R6GB 2WB1D 2HVZA 1TELA 2X1GA 3MXMA 4N76A 3M1FA 3BZKA 4LF4K 1NB7A 1UJ4A 1MSWD 4R0EA 4Y2AA 4LMZA 2VFTA 2PA3A 4FLZA 1ULRA 4V19S 1HHSA 1Q81O 1Q16B 4O44B 2NPIA 4B3RF 4NRTA 3LZIA 3BPDA 5HRPA 1J5OA 1DY3A 3EE3A 5KGWA 5C24B 4UOFA 1Y4ZB 2OJ3A 2YJFA 2WSEC 4NA2A 2FVCA 3V6HA 3NVKA 3LP0A 4DV1F 2DH9A 2OLWA 1FCAA 3HVTB 1ITGA 4FXVA 4OJHA 5IC4B 3KJFB 4DR3J 4J2DA 1MMLA 4O4GA 4CECA 2ZZMA 2C22A 4H5VA 1NK8A 2BQUA 2FIUA 2C3YA 4PQUA 2UXCJ 1T11A 4IKAA 1CJUB 4IJNA 2XSJB 1ITPA 2B43A 2IDOA 2MGZA 1E3MA 3ITHA 1JWWA 2V67A 5BPMA 2DRBA 2JLGA 1RAOA 4MDBA 4HDGA 4RW6A 2C2DA 4J9LA 5H9FJ 3BO4A 4CZCA 4H8KA 3DOMA 2AP1A 4DQ8A 2BXJA 5L1JA 2P9SA 2FTRA 1XK8A 4BLGA 3LWLA 3U3YA 4EMDA 3O9UA 2A41A 1VSIA 2OYQA 4DN0A 5KOXA 2GVDA 2R7RA 1WSFA 3O9RA 3MPUB 3IBFB 2IHR1 2PAVA 1SJFA 3P6YC 4I1TA 1HPZB 4YY3F 2PA8D 1KN6A 3JB9k 4IRKA 5KFYA 5GAHI 4X62K 2HLTA 3BV8A 3AXKA 3NWRA 5MLCV 4QJVA 4ECVA 3G4SS 5CD4A 3M2VA 1VQPN 4W90B 3MAAB 4E89A 2OPSA 1N36F 2OPRB 2QJ3A 4JKFA 1YX2A 3KHYA 1XEZA 5E3CA 5B0BA 2VQFJ 4DR4J 3WIVA 4Z4IA 3ZTOA 1PIEA 4NYPA 1RBOB 5IT9U 3DXSX 3D6FB 2NREA 4MAKA 3DCAA 1W25A 3M30A 1N0UA 2V4RA 4PL8A 5T7BA 4NZ6A 4ZVUB 3CFPA 4NCBA 3WNGA 2K2PA 3GSIA 2JL9A 3JAMY 5EHHA 2D0CA 1HHQA 3DGVA 2OFHX 2B9WA 1WD6A 4MYTA 4I4BA 1VHIA 2W7OA 5AZIA 3RAMA 4M3YA 4LFBF 3CJCA 3KG0A 1KRPA 1RT2A 1RILA 2EC2A 4FS1A 1W7AA 1U4BA 3V4IB 2OI2A 1PILA 3QBWA 3G9CA 3PIOL 2AJ4A 1NK6A 2HNYA 2C3UA 2FB0A 1EKSA 4RU2A 3DLHA 4QWDA 1JLQA 3VA0A 5GIPA 2FC0A 2PE8A 1NGEA 3FBCA 2W7PA 3R1LA 4BC2A 3J81j 3VGKA 4CJVA 3DDNA 1YKWA 2SXLA 1HNWK 3KFWX 3NOCA 3POTA 1VQKN 5IWAK 4OHYA 3W8GA 3UN2A 5LSRA 1GLFO 3K89A 2UXDK 1TL7A 1SUQA 4Q2MA 3X1LB 3FFIB 5DZ6A 1NZ8A 3HZ6A 2YH0A 3OFHA 3HSDA 3SCKE 4BQZA 1F3VA 3QIOA 2CPFA 3QWUA 1OH6A 1FNMA 4FVUA 1T9VA 2H3EB 4PXEA 3CEDA 5FJ4A 4LBHA 1S7HA 4CZLA 3DYAB 1EX4A 1RHMB 2H5JB 2DNGA 5L46A 3V9XA 5LSLA 3Q22A 2J5AA 2YNGB 4RBVA 4DSIA 2J6TA 3EE8A 2CPZA 2R2SA 3VGLA 1RWKB 3J7YU 4X4VA 2IRUA 4DV5J 4A57A 1EARA 5IFMA 1K1QA 3TZYA 3DHWC 4P2XA 1TKXA 4FJ5A 1N52B 2NRWA 4ED8A 1X4EA 4BDZA 3I56N 5FRMA 5BYRA 3AVIA 3I5AA 1JLCA 2W4CA 3IR6B 2HBJA 3V6DB 4BRAA 2IA6A 1Q7LB 3AJ2A 3BGOP 2J7KA 3HT3A 3ZZUA 1APSA 4HHTA 2EPIA 3RJMB 2Y1RI 3CIPA 1XI1A 4O23A 2FPHX 1CSJA 4JK9A 2Q3PA 3M9OB 2VG7B 1UWAA 2G8HA 2VG6A 1GLAG 3ZSWA 2UUBK 4Q45A 3MN5A 3QFHA 5KFNA 2HMIB 4RW4B 2PMZD 1H2UX 3H2UB 3LDQA 3MXIA 3A13A 2VPZB 4J2AA 2FLPA 5GINA 3BDEA 1GLBG 1B9DA 4HH0A 3OTCA 4QS8A 3CCSN 1MROA 2K1RA 4ECYA 3BJYA 2GV1A 1YWXA 1MWYA 4BR7A 2UUAF 4NCAA 3OVAA 2Z0GA 4KHPK 1YRUA 3VVTA 4FF3A 2XQCA 4YHHJ 2IAJA 1EO1A 1Q18A 3NY0A 4FLTA 3AA5X 3M8WA 2NUBA 4TY9A 2KTQA 3EM1A 5ETOA 1WAJA 5KG3A 2F9TA 2E6MA 3QIPB 4QR1A 1RWXB 1IKXB 3NGYA 3D9BA 4KREA 2BE9B 1H3DA 1VQ9S 3ISZA 2WC9A 2F8SA 2P51A 4LRDA 4ID8A 3UDEA 2YCHA 1TKZB 5KPTA 2DGVA 1PG5B 4DV0K 1K47A 3S3OA 1T95A 1L3KA 3MMAB 5A0YB 2L41A 3SUQA 3U1LA 2RUSA 4YR0A 4B3RJ 3MEGB 2VODA 4ECXA 3D4JA 1EKRA 2Y9HA 1Q5VA 2NUHA 3AXMA 4DV1J 5F9LA 4OI2A 3AB4B 3OHAA 3O1LA 4GV9A 4LF8K 3PX6A 2RAQA 3RZAA 2ZITA 1UVMA 4P7VA 1F60B 4CIOA 3BBFA 5K8PA 3ID6A 4JI0K 3ZNUA 3G2XA 3EVOA 1Q81T 2HS4A 1UW9A 1K44A 5T7LB 3DKDA 1KLNA 2WB4A 2CNNB 2ZM6F 5A2QO 2OANA 4OHWA 2IOCA 1HFEL 4NLDA 2DJWA 2YWFA 2GO8A 2Z1JA 4C1NK 2QA2A 1EHWA 1RI7A 2JOQA 3GONA 2KJVA 2Q6CA 2DCLA 3ZEUA 3MECB 1OSCA 2B51A 1A5XA 3R1XA 3OTEA 3C6UA 5GADP 1QE1A 2DNHA 3M8QA 2QXLA 3VOVA 1H7XA 4WFBQ 3W3DA 4F0MA 1REVB 3OYJA 2PDAA 4LR8A 4YY3J 3ZZZA 1XWLA 4ZPVR 2CQDA 4LSLB 3E1YA 4FLYA 1OY6A 2XZWA 5L9XA 4B08A 2HHQA 1OH8A 4ZVEA 3K0JA 4CT9A 1OMSA 4KH4A 2OPPB 1HPMA 2ZNYA 4B1XB 3FRYA 2MKHA 3HOTA 2XO6A 3H08A 4JI7F 4NRUA 4DR2K 3K59A 2ROGA 5B0CA 3BYPA 3LDSA 5LJ5Y 3ISNC 4DTOA 3HFKA 2XLJA 2IDLA 4IFVB 1NLVA 2KXHA 2VHGA 5IT9O 3CVKA 2FGOA 2ZKTA 2QLXA 2GX8A 3M2RA 3BN4A 4FWKA 1OQ6A 4ECWA 1WSGA 4FYYB 5LMUK 4PHTX 2DHGA 1RYRA 2DHSA 3CDAA 2VU5A 1HA1A 1EQYA 4JB8B 4PPDA 2UVUA 3QICA 3AVHA 1WI6A 4LFBJ 3PEJA 3IDHA 5FLXY 4I6YA 1U0HB 4ZHRA 2HK2A 3SCXA 3CJ7A 2VWKA 5A8KA 4MLEA 4OI3A 2ALZA 3KK2A 3EMTA 2KRRA 2MLZA 2BE7D 1R43A 2P2CB 4FM0A 4L8RB 4KHWA 2R4FA 5B09A 1UEVA 2RQMA 4WCEQ 3R1HA 2K3IA 2Q97A 3UB5A 4LQ9A 1ZA1B 2U1AA 2FSNA 2DISA 1OY9A 2RIJA 3OYBA 3CCMN 4RWXA 1N5SA 1HKBA 1N32F 4USHA 3OTOK 4OLPA 4JI3F 1HYSB 2RKIA 3NLCA 1RE1B 5FPEA 3QYYA 3C7NA 1RBUA 4R5PA 1RHRB 1UPMB 5HROB 1JXVA 5M1KA 4ZMMA 1SJQA 2DD8S 4PKGA 5KGXA 3L8BA 2W2MP 2Q36A 5F8GA 1UFLA 2DNKA 3MM7A 1CS4B 3CJKA 4RBUA 4E0DA 2RHSB 2IFXA 1WORA 3O4WA 1IG9A 1YBAA 3C0BA 1RCXB 1FX4A 2C2RA 3CC7S 4OPHA 5CCLA 1Y3JA 2GJFA 5F0XA 3M1VA 1GXUA 4WFAL 3OJSA 1KHVA 3JSBA 2BQ3A 5CYMA 1TUGB 2NUUG 3GIJA 4K59A 4MH8A 2GUPA 2KT5A 3GIRA 3NGZA 4JI2K 3WZ0A 5EGYA 2O8FA 4YOVA 3SYZA 2WFBA 2IVOA 2IYGA 4C11B 2DO4A 5E0OA 4AF1A 2DCUB 1RABB 1QTNB 5DQGA 1SIZA 4M5DA 5F2RA 1VQ8S 3QSYB 3C66A 4ZOSA 4CHQA 4JD2A 3NGRA 2MQPA 1VOMA 2IC3A 1VI7A 2WHOA 2KT3A 5E3QA 3QGPA 3J81Y 3LDNA 3C16B 4OYWA 2G8VA 3GYGA 4CJEA 3QO9A 4IG0B 3I33A 4X2BA 3MFHA 4W92B 3B82A 4A8QA 1QUPA 3C15B 1V5IB 5ETSA 3VEXA 1BCOA 3O3HA 1FO1A 2G1DA 3DRSB 2KJWA 2ZH1A 2GGPB 3VQPA 3PYEA 1C0FA 1RBTA 5HANA 3QAUA 4CWBA 4LD0A 5JVGQ 4RG8A 3NH1A 4DV7F 2GJ2A 2UUAJ 3VESA 2FZCB 2A10A 3E9LA 4AXIA 4DSJA 4WFNL 1SB6A 2NRZA 2ZH5A 2BZ2A 1Y11A 2LQ8A 3VEZA 3HSJA 2E7WA 4NLYA 5E33A 2YHBA 4NLRA 1F21A 4FYWB 3BO2A 3QAEA 2F7TA 1YJ9N 1VJQA 4CGHA 1NLKL 3R97A 2MSTA 1OPZA 1GT8A 4L74A 3BBBA 4KTZA 1J5EK 4CEZA 4OYXA 2CXEA 1S6QB 1TP7A 3AO1A 2VWJA 3CJ3A 1XHZA 4OYBA 4F2SA 1TV6B 1VGYA 3M2UB 1U45A 2J8SA 5H1SV 4DR5J 4FK2A 2AX1A 2KH9A 2D4WA 3U4LA 1VLYA 2W2QP 2GZOA 4DU4A 4ANDA 3SNNA 2DEJA 1JB0C 3PFOA 1Q9YA 5C25B 1LOUA 3LPEA 1R0BG 3OR2A 3QLHB 2B9EA 1X4HA 2BJ7A 4U67L 5G4DA 3FBFA 1CXUA 3QEIA 3OHRA 4BR2A 1I94K 1IBCB 4DQSA 2MXYA 1T3NA 1TL3A 5BYSA 2BOAA 3NGUA 4F7VA 3ASMA 1S1UA 3EWGA 2ZM6J 4P72A 2X51A 4LF4F 2IVFB 1LWFA 1L3UA 1BA1A 5ETRA 1LCUA 3AO2A 3QERA 2D3ZA 1H98A 2IJRA 3H5SA 3O80A 5K14B 1FVSA 2HBQB 4HWIA 2AF6A 3U7JA 3HF5A 3CD6S 1YTUA 4O8UA 1OQ3A 3ONQA 1FD2A 1JXEA 4BCAA 3NAIA 5KFBA 2JFKA 1RAIB 5AE2A 1WC5A 5DQHA 1BA0A 1FTRA 4JOUA 3KMSA 4DL6A 3PVXA 1J6ZA 4FJ8A 3W5YA 3MWTA 4CTAB 1C6VA 2DKOB 2EK1A 1WELA 9ATCB 1OKJA 2ZBQA 3THXA 3MR6A 5MAOA 3THWA 3A8IA 2XO7A 3V81B 2FHJD 3L6QA 2PYLA 1QSSA 2HVDA 3CCWA 4DL5A 2CQ4A 2VIHA 2DXFA 4HYKA 3OJUA 5GAGP 1ESVA 5KFWA 1J9AA 3A4TA 4JI7J 1HBMA 3O44A 3HO1A 1IKVA 3QNNA 4N56A 1U2RA 4DTJA 1PJ5A 4LVOP 5KT6A 1SKUB 1S76D 1X9SA 4DR6K 3N6MA 4PAAA 1Z2ZA 3NF7A 2YX4A 2JC0A 4NE9C 4MQ3A 1RZMA 1C1CB 2ZHBA 3VEYA 5EUHA 3PSFA 5DLFA 3D2WA 4O44A 2FDNA 3SMSA 2WSFC 1GH8A 2DGTA 2BYCA 3OLAA 1X5TA 5C24A 2GHWA 3P1GA 4X62F 2KO1A 2Z1IA 2QE5A 1AXQA 3HSTB 4FPBA 2X74A 3M9MB 3R5DA 4F3TA 3HVTA 2MZSA 3AVCA 3SDEB 3B6BA 3BB5A 2A42A 3WXJA 2GUIA 5HOOA 4UQTA 1ATNA 2ZOGA 2GC8A 2X3DA 3V6KA 3RG6A 3JS6A 3CCVS 1WSHA 5CZ2A 4PKDB 1U1KA 3R7BB 1CJUA 5CA5A 3W9IA 1KXPA 2A3ZA 2XSJA 3MCSA 5BN8A 1EB0A 4CK2A 1RBVA 4QS7A 1N32J 1KD1O 2E9TA 4JI3J 3SLCA 3ZSOA 4FSVA 4IO1A 4DCJB 2IS3A 5BXIA 4QYZK 1XMQK 4K4ZA 4RNHA 3DLJA 4ZCLA 4H54A 4ZLNA 4PWDB 1ILYA 4F04B 4CLFA 4K0KK 3GYXB 1WEYA 3A5LC 1X4FA 3R7NB 1NDKA 5U47A 1X4AA 3RBEA 2YWGA 4C0OC 3S7RA 2A5XA 2AJ1A 4DDFA 1HPZA 2MSSA 1TKDA 5BRHA 3HRGA 4CVNE 2IVMA 2D9PA 1R8PA 3Q8YA 4CZFA 5AQMA 4U8YA 4OZ2A 3VQ5A 3MAAA 3PYFA 1HNWF 3G4SN 2OPRA 5AJ3K 5IWAF 4ECRA 3NG8A 2ASOA 1T0TV 1U1NA 1GEHA 2PFFB 3AODA 4DN9A 7FDRA 4CZHA 2IDEA 4F3MA 3W9HA 1KOOA 2CADA 1S3XA 2A2DA 5K5MA 3ZZRA 2J9DE 3MUVP 4TSXA 4JI8K 3MR7A 2XMVA 3M8SA 3MPVA 1IBMK 4BACA 5CCMA 3MK6A 2R7QA 1UL3A 2BRKA 2ROEA 2XZTB 1ZAVA 1S0NA 3JSMB 3DU5A 2DGSA 2ILYA 4MJKA 1O51A 2YPZA 4DCPB 1FF2A 3QRQA 1VK3A 2R7SA 1S6PA 1T02A 4CGIA 3Q2TC 2UVVA 3ZSXA 1BI4A 2QW9A 1M5KC 2ZC4A 2NXJA 1B0TA 4KT0C 4OX6A 4QR0A 4KBIA 4DL7A 4LY7A 3OBYA 3V4IA 1YAGA 3W5XA 4WFZA 4DV7J 1W2BM 4CLUA 1JJ2M 1H7WA 5D77A 5DO2A 2FZKB 2E1MC 2M88A 2D3UA 2CQHA 1ZH5A 5LXRA 1HNVB 3O6WA 2PMWA 3HULA 1Z05A 2JEIA 4CHZA 1T03B 4DUZJ 3OYEA 2FHMA 2G2ZA 2IMOA 4LT6A 3HHKA 3D1HA 2HSEB 1TGOA 5I4MA 1Y3KA 1Y00A 2PO4A 3PV8A 4F50A 2KHOA 4YOWA 4MK9A 3OBWA 1PJ6A 4N77A 2CQ2A 3QBCA 4M7XA 2P6SA 3BGFA 3FZ2A 3SUNA 3SIPB 4CLWA 1LW0B 3FFIA 2BRLA 2UUBF 4GC6A 3RB4A 3WQTA 1JQGA 1RNHA 1QDUB 1RUSA 1HL6A 4DTUA 4JP8A 2HBZB 4EHTA 2OH2A 1S57A 1WUUA 3DYAA 3MCNA 1MDUB 4YORA 4FZXC 1WHWA 4WU2A 3UI3A 4CJRA 4BRCA 2YNGA 4FZVA 2RF2B 4U8VA 4ED1A 1E6VB 1JLBB 3M6UA 4KHPF 2B4VA 3HZGA 2HB5A 4Y0FA 5ADZA 1Q78A 1SVDA 3K2YA 2V51B 4XEIA 3A1YG 1BL3A 5B0FA 3SAFA 4BGBA 2DH7A 2V5HG 1IJFB 3TR5A 5IT0A 3M6VA 3CI5A 3PIPL 3V6DA 3FEXB 1NGGA 5BPLA 4DV3K 1FJCA 1SC3B 1HW8A 2ZBRA 3LGNA 2CYYA 4BR5A 3M7VA 2MQQA 1IG8A 4P7TA 4DV0F 3DFEA 1VHXA 4ISFA 2VG7A 3PM9A 4OHXA 4PY5A 3KK7A 2UV8A 5E3AA 4ZP7A 5AQGA 2DITA 2D3OR 2VD3A 3IGNA 2HMIA 2RE1A 4RW4A 1QY7A 1YSJA 2Y8WA 2YY3A 4TVAB 4LIRA 4IOAL 5KTQA 2W9CB 4KSEB 4LQ3A 4BE2A 3KWGA 8AT1B 2J76E 3PRBA 3PTWA 2UVWA 1S48A 5IM0B 3W65A 4B9LA 1VS3A 2HFZA 1W97L 4B9UA 4OMFG 4JI0F 2JLEA 1UEUA 3AA3A 2A3JA 1YZ7A 2QLFB 1YRTA 4DZDA 2VV5A 1YF5L 4GW6A 1FT8A 2F9DA 2HVEA 2M52A 1SH3A 1KQKA 1PJ7A 1G15A 1X3MA 2JZ5A 2DYAA 4ILJA 1LKZA 3QIPA 5IOLA 2AHOB 3GV5B 3QQCD 3DAWA 4A5AA 3E9OA 4X4UA 1UVIA 3VQ6A 1VQ9N 3NCQA 1KAXA 1TKZA 4Y2KA 2KKHA 4M3UA 3LZJA 2RVJA 3KNGA 3E01B 3MMAA 5A0YA 4AXJA 5KFSA 4NB4A 4BREA 3KLGA 2QWPA 3SQGB 2HBYB 2PSZA 1RISA 3MEGA 2FF6A 3HJVA 2QC3A 2HGMA 1WNSA 1TQLA 4NEZA 1JLAA 4Q44A 2O8DA 4J9MA 3GFXA 2J7WA 4RWWA 1KVIA 2QYCA 2RU3A 4DR2F 3TR8A 3VGVA 2HHHK 3P38A 1GMUA 4E3SA 2J7UA 1L3SA 1UFKA 1HRHA 2FJBB 4ED4A 2AJ2A 1S1TB 4MTPA 1GTEA 3QMQA 5LMUF 2LECA 3V6JA 4O4RA 1RA6A 4YDDB 2GHVC 2GQ2A 1O6XA 3D0HE 5BPNA 5D4LA 3KNAA 1TUYA 3OLBA 3VQCA 4BS2A 5HP1B 4ELTA 4EU0A 1RWPB 4DFPA 1F1BB 4DTRA 4I7FB 3DLKB 1IR1A 3HP9A 2EXUA 3GWCA 4JI4J 2EW9A 4K8XA 3EO3A 1GXLA 3FZBA 4IFYB 1SAZA 1TAUA 1FDBA 1KD1T 1Q53A 3IP0A 4LSLA 4PG7A 4BRHA 3NL0A 2KL8A 1UP1A 2F8TA 4MK8A 4PKIA 1XNQK 4M5GA 1JJHA 1IKWB 4C0BA 4FWNA 4FM1A 2HRTA 3A5NC 2YXLA 1HNWJ 4BRKA 2JX2A 1ZPVA 3ZC4A 4IRDA 3T19A 4CZIA 4GRSA 3LANA 4X84A 3OTOF 5B0DA 2KLAA 1KLMB 2B7BB 3MPWA 1RK8A 4EBCA 3I82A 5AZJA 4QAGA 2IIRA 2UZAA 3QZ7A 4ED7A 2P9PA 3RMCA 4IFVA 3MEEB 2YWHA 1U1RA 2V8DA 2Z2YB 3ZFVA 1K6YA 4JKEA 1DQAA 3HT0A 1VQ5S 2XMTA 2QI2A 2D41A 3CPWM 2DNRA 4AL7A 1U6BA 4L3NA 3HOSA 4YQWA 1W9HA 4TN2A 1CQNA 3ULHA 2QA4S 3A12A 5BR8K 2MTLA 3Q8VA 2QLBB 2Y1IA 4IH7A 3LWMA 4B1UB 1U0HA 4CH1A 3TPQA 4QIWD 5F8IA 1EKEA 4OGCA 4O0JA 1JK9B 3KUGA 2F65A 4WFBL 3QZ8A 5DM6Q 1D9AA 2XG8A 1FRMA 1EWQA 4DMZA 1RCOB 1TR0A 2ASLA 3WNHA 3PKMA 4IOBA 1S5JA 1Y9OA 3PYGA 2AGPA 3KLVA 3D54A 3ZTPA 3CNQP 3VA3A 1DTQB 1DFDA 3GB0A 4F0KA 3MCOA 3K2PA 3D2EB 2CZ4A 5KQDA 3AAQA 1A7GE 2MKCA 1WBBA 2CKWA 2UUBJ 4DU3A 3IS9B 1CZAN 3EGWB 2NPFA 3P3DA 5HROA 3TAFA 4BC7A 3G96A 2BH1A 3V1RA 3MMJA 4W5NA 4Q0BB 3QRPA 3R8YA 2Q3SA 4C8MA 1CS4A 8RUCA 5DMRA 4O0IA 2CJ9A 4NEYA 3P96A 1V3ZA 1WG4A 3SJJA 3G8TA 4ZIVA 1K1SA 4ECQA 4KHPJ 2KT2A 3B78A 2EX3A 2RT3A 2COLA 2MLYA 1NUEA 3CC7N 1LOTB 1XQSC 1GX5A 5EWFA 4H5WA 2APOA 1H2TZ 3K8VA 3J8AA 4DUTA 1VC0A 2V68A 1OH5A 3CJAA 5D0EA 1NK0A 3HHLD 4ANCA 3HKZD 3AA2A 2GS8A 3H45C 3TSUA 4C11A 2HNZB 2PD1A 5I42B 1U8WA 2M3DA 2EVZA 1WEZA 1UPPA 4RWTA 2YJEA 4EYIB 1HWIA 4WCEL 1CC7A 3IWXA 2N3LA 4CJ4A 4KPYA 4DU7A 4ALZA 1J5EF 1KCFA 1VQ8N 4DV0J 3C16A 3KWMA 2KFYA 2KW4A 3WXKA 3WHIA 2DNLA 4IG0A 4MMOA 4WP8A 3O4NA 3C15A 1KFSA 3KLIB 4HI2A 1V3RA 2E66A 3BREA 4DTNA 5EN1A 3DRSA 3RBXA 4FK0A 1S0OA 3CERA 3B6PA 3VGSA 4YB6A 3ATVA 1T6CA 1HARA 5FDLB 1YXQA 2R7WA 1SZ2A 4JI0J 1UZHA 3AO5A 1I94F 5GAEI 2FHKA 3GLJA 1HNIB 1IM6A 4G9ZA 1Q9XA 4E2FB 1WC3A 3AVNA 5JMVA 1TFYA 4X4SA 2U2FA 4RR5A 4LVNP 3HMJG 2AJQA 3Q8UA 3H46O 1U25A 2NR0A 5D6GA 1X5OA 3QFUA 3LP1B 1SBRA 2W2OP 2XYHB 4ZCMA 4DV4K 4YOXA 4RLEA 4F4ZA 1FKOB 1F6TA 3T7ZA 3HHLB 4FNIA 3BS9A 4BWMA 5HBMB 1PSDA 1S6QA 2HS3A 1EWRA 4BVPA 3E66A 3EXCX 3K5PA 1RAEB 2O5DA 2ZVIA 3IKMA 1TV6A 4Y6IA 4BHQA 3JTOA 5EXWA 3M2UA 3ZT1A 2ASPA 3JYTB 4LREA 3ELHA 1I5OB 4XAKA 3D0GE 1JLFB 5HI7A 1RTJB 4A8OA 5C25A 3QLHA 4BWJA 4KHQA 4R79A 2HHUA 2ZJQL 1Q8KA 4FJJA 1C1BB 4DR2J 4DX7A 4OYMA 1KQFB 3OHBA 3O8MA 2NNWA 2XM3A 1H74A 1QAXA 1BWEA 2V4QA 1HBUB 1RWUA 4DR6F 4B3SK 4LF5K 3O3LA 4A8YA 3CT9A 3N28A 4OV1A 5DLGA 3E3XA 3VF6A 4ENOA 3BY5A 5K14A 1HJRA 5LMUJ 2DR9A 2WVBA 5GIOA 2F9WA 3CD6N 1WG5A 4L3KA 5ETMA 1LNQA 1JLGB 5JLFA 5KFQA 4M63A 2Q1NA 5ETKA 2B5JB 2YX7A 2BV3A 3IFEA 2D7SA 4C98A 1G3OA 1WF1A 3G6XA 1YIJS 4CTAA 1IUJA 4Q5VA 3QSIA 4O5BA 5AQTA 5G0RB 3FC9A 1NJWA 1TUUA 4WXOA 1JX4A 3V81A 3J7A1 4J9NA 4FYDA 2UP1A 2E1CA 3J7Z5 5CXTA 5FPNA 4C3KA 2Q6BA 4TY8B 3ZSVA 2G0JA 2AX0A 4L72B 3OTOJ 1DLOB 1WF2A 2C42A 3PIOQ 3B4MA 2CQBA 3DXKB 3L2QA 3H25A 3GOIA 1XMQF 2NQPA 4FWSA 4AM7A 2GMJA 2H5IB 4AFFA 4FZYA 3A8EA 3HBTA 3I5CA 2HLUA 5LT5A 4B1VA 4K0KF 4U7BA 4UY8O 4OJ1A 4CDIA 4WQ5A 1C1CA 2R2TA 4MO5A 1RGIA 4Y1CA 2FC8A 1X0PA 1T9UA 2F8MA 4L73A 1RBAA 3IRXB 2V4JB 1U48A 5IV4A 4FZZA 4QU6A 2X1BA 3HHDA 2FJWA 3ILJA 3GFYA 2DPJA 1BQMA 2DY1A 1TL5A 3PG9A 3D6HB 1SL1A 3H3NO 3I8BA 3VQ7A 3CJ2A 1IBLK 2RQ4A 5AJ3F 4Z2XA 3SDEA 1FERA 3DN9A 2HS0A 3F0NA 4BC4A 4N47A 1U6ZA 4UZBA 3VAHA 2DGQA 4E1JA 2J9CA 3CCVN 1Q82O 3RB3A 1IBMF 3P49B 1OWXA 2H4YB 4CLPA 2BUNA 1UJ5A 2AJ0A 1QAJA 3DLEB 3EDRB 2XI2A 5E41A 5HO4A 2MKJA 1M1KO 4E1NA 1CQMA 4DS5A 3T69A 1WOSA 5D0RA 2W42A 2A1RA 2DT9A 2GFFA 4E7IA 3MM6B 4PWDA 3C94A 4J9SA 1S12A 5AQOA 2FLNA 1A5VA 5LJVA 4CF1A 4LF2A 1BO5O 3JAMO 4IKFA 4AT1B 3O9SA 2CNLB 4LRAA 2PEHA 2CJXB 4NYOA 5FLXU 5C0YA 3R5GA 3ZO7A 4QWBA 5JJBA 5B0EA 3VGUA 4CW7B 4GC7A 4ZP8A 4KO0B 2VBZA 5JVHL 3AQOA 2ZBIA 3NFAA 2GCFA 1N5TA 3H5UA 3SQ2A 3GTYX 5GAHP 1S6UA 2VG5B 4K4YA 1LV5A 1IWGA 3QBXA 1R27B 4X66K 2XEXA 3ZX2A 2CPIA 1J5EJ 3SV4A 2PFUA 1J53A 4EZ6A 1D4XA 3OVNA 5F1XA 4OZ1A 1QS4A 3JSMA 3IN5A 1D8YA 2OZSA 4PCQA 5BRDA 1HUXA 2XS2A 1HX1A 4K2XA 3V9ZA 1K8KB 2ZE2B 4NA3A 3SQ1A 5KFOA 1CLQA 4RU9A 4IH5A 4M3ZA 3HI0A 1VISA 1HBNB 3TWZA 3EZ5A 3AVGA 1HNVA 1VCTA 3SBTA 3CPEA 5DG8A 1T03A 3H59A 3GBTA 2VASA 3R2DJ 4KHSA 3L3CA 4W5OA 1R89A 3S1TA 2J4RA 1FESA 2HQGA 4J2EA 1RP5A 3I0SB 5KT7A 1YI2S 3CC4S 3W2WA 2IBKA 3P31A 4J9OA 1LW0A 3MR2A 3RUBL 3NDKA 1X9JA 3BGUA 4H4MB 3J81U 2ACYA 3H4BA 2GIRA 2W2PP 1U1QA 2XLKA 3L2WA 1FI4A 5AQNA 2A1BA 1XERA 4DSEA 1ZOTA 1X3NA 2W4PA 2CQIA 2KHDA 2RF2A 1PBAA 1I39A 1KQSM 1E6VA 3UW1A 3D3BJ 1JLBA 1IM4A 3LM2A 3B6OA 2DIVA 3CJTA 2V2VA 2R7UA 1N33K 3GIMA 3OTDA 3EZWA 2QEXS 3BF1A 4AHCA 3WDOA 1IQTA 2H9ZA 2OKQA 1RT7B 2CVIA 5LM7E 1N5VA 2UUCK 1I6JA 1SJ3P 1AUDA 1B9FA 4BVOA 3HZEA 3H40A 4USVA 4F4KA 3CMQA 3Q7BA 3V9UA 3DLBA 2RRNA 1YJNS 1NKBA 2Z2MA 3VZHA 4DR6J 1DBDA 1R31A 5DDOC 4KI6A 3IA0A 3ICLA 3ZSQA 4CIFA 4FW2A 1UEKA 3GSDA 4B8AB 3CDWA 1JCGA 3CJ5A 2BJ9A 4I6WA 3G10A 2H4WB 5HMXA 3NCPA 2V8HA 2P6TA 4DHYA 3L4IA 2CVEA 5HQ8A 1VQLS 2Q79A 2N7YA 4BROA 1AT1B 3I96A 3EICA 4OX9K 1CULB 2EI5A 2W9CA 2Z8QA 2I5JB 1WN7A 3CHWA 2GAGC 4K7QA 5CYQB 4KI4A 2KG0A 2ZEJA 1JXBA 1KFDA 5IM0A 3TSQA 3A5OC 1DRZA 3HL8A 2HHSA 4TLRA 2XZDB 1U1LA 1SH0A 3R9PA 4OPJA 2HHHF 2P9KB 1CJKB 3CDEA 5D8HB 1FXDA 2HQDA 4BR0A 1RT1A 1FEEA 4TXSA 3VN5A 2LCWA 1T7PA 4HUEA 3MN9A 3MM5B 1NHUA 4U6PA 1FW6A 4G3IA 4CM0A 4GO5X 1JL1A 1BIZA 1X60A 2BKNA 1WNEA 3TAGA 3JSRA 3MUMP 3ZZOA 1ZBSA 1ASVA 1BOTO 4WPAA 2BJ3A 5B7WA 3LPYA 5DG9A 2BM1A 1CEZA 4NYNA 2RILA 4QYZJ 1XMQJ 5GAEU 4LF9K 2R9LA 4AM6A 3HKWA 2IMWP 1K0TA 3ZTQA 1S4FA 1ZTTA 2QWRA 3D0PA 5BREA 2G8IA 4KH6A 1GMWD 3NGKA 3QT6A 4P9SA 3O4QA 1KTVA 3SQGA 2PT0A 2YKPA 1G99A 1KOHA 4IUFA 4JYAF 3IMQJ 1XNQF 2X7IA 1S5ZA 4CGFA 3TOQA 2V9WA 3TUJC 3H5XA 5D4NA 1VC5A 4AE5A 4C7QA 3CGIA 5AJ3J 3BH7B 1FXRA 4EO6A 2QZ8A 1UVNA 4UY8T 2FXUA 2D74B 3OL7A 4WIIA 4CJSA 3QT8A 3CO0P 3ZLJA 1RHKB 5DG7A 1RKIA 2G8KA 3AOCA 4M3WA 1OIAA 3M8ZA 1IBMJ 5F8JA 3VEWA 4Q43A 1NPKA 3UWTA 3WBZA 1BXNA 3AH6A 5D0HA 3R3TA 2I2YA 5M1OA 2PY5A 3OVSA 1U1MA 3GG4A 4OLOA 1YTYA 3EE9A 5BR8F 2AEJA 1SKWA 2JEFA 5HP1A 3K5MA 5AQIA 4B17A 3KLFB 3TNVA 4I7FA 3DLKA 2JJ4D 2C2EA 2RRBA 5B08A 1RQ0A 1F5BA 4L3QA 4IFYA 1IO2A 3DLLL 2HWIA 2JSXA 3THTA 3KUHA 3V1QA 1Y5NB 1M1KT 1CJTB 3R6MA 5FLXO 3H7HB 1S1WB 2ZHAA 2RRAA 5KPRA 1IKWA 2W9BB 2HGNA 3D3CJ 4GKJK 1SCJB 3G71S 1DTTB 2YKMB 2CPDA 4M41A 2QIFA 3TU5A 3KK3B 1KLMA 2CG4A 2HFUA 1ELOA 2HURA 4H0PA 2DNPA 3WNEA 4IFEA 4ELVA 3TARA 4FK4A 5E3RA 3MEEA 4O3QA 4WFNQ 5M1PA 2ZVSA 4DR1K 2YKNB 3H3OB 2FSKA 1QZ6A 3N0VA 1NNEA 3S8SA 1WJ9A 3R9LA 3IM8A 1VQ5N 2GMLA 1T05B 1F9FA 4DV6K 3LH2S 2ADBA 3I5BA 2MJNA 1TL4A 2QA4N 2ADCA 2HVHA 4XPCA 4FS2A 4H5RA 3KDNA 4OKJA 5DRKA 2KVQE 4QIGA 1NXIA 2OFGX 1NSPA 2LFVA 1T9YA 4FJXA 2IRXA 4KH5A 2G8WA 4CHYA 1R3NA 2HMPA 4OZLA 4F25A 2OMOA 4RTFD 3IXQA 1C4CA 1CBKA 2KM8C 1YVUA 4PYAA 3BQ1A 1UVJA 5H9EK 5E26A 5AXLA 1DTQA 4ERDA 4E1MA 3BF4A 2C2OB 1RDDA 2XYGB 3D2EA 3MOZA 5HVFA 1R0AA 4FPIA 3FEYB 3IS9A 1X0FA 2IJFA 4WYLA 3MGJA 2XS5A 4FJHA 1P1LA 4FO0A 3K7RA 1QVFM 4Q0BA 2XMAA 4F67A 3J81O 3HSZA 4A5BA 2B6AA 2W2NP 1LQ9A 4J9QA 4HLBA 2LXFA 3CF5L 4ZPTR 5AQKA 3MDFA 2DY4A 1VR6A 1CXQA 2P9NB 2V2ZA 1NRKA 3M6GA 4OQJA 4YB1P 2JVOA 2OP5A 4B1YB 3TZWA 3CCES 4O3OA 2EFQA 3CYMA 3IRWP 1ZBLA 5KFLA 4AHVA 2UUWA 4DMNA 3L09A 4Z37A 2VICA 1XBWA 2HNZA 5I42A 2C28A 2P8IA 2EC0A 3U9ZA 4DV4F 3UN5A 3D68A 2HNDB 1J54A 5KFXA 1FNXH 1TUWA 5FRNA 3OXFA 4RL1A 3BN7A 2UXCK 4KTQA 4LBPA 5C2FA 4FJ9A 5EWEA 4E98A 4P75A 5KFPA 5HQLA 3KLIA 2V2KA 3AOAA 3KKSA 3LW5C 1QHTA 2G1HA 2B7CB 1UW4A 1WWHA 4PZVA 2VKRA 1X5SA 4RNOA 1PYSB 3VALA 4EK2A 2M0GB 2P9LB 4O55A 3ZNJ1 3ILLA 4XO0A 1IQZA 4IQXA 3M32B 5FDLA 4ZPDA 3H98A 2BQRA 2FQQB 4NLBA 3C6TB