3ULDA

High resolution structure of dna/rna hybrid in complex with rnase h catalytic domain d132n mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords Ribonuclease H
publication title RNA/DNA hybrid in complex with RNase H catalytic domain mutant D132N
rcsb
source organism Bacillus halodurans
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2011-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3uldA00
4Q5VA 3O3HA 1HRHA 4IBNA 4N76A 2A1SA 3KKSA 2ATQA 5CYMA 4DQSA 3OYMA 2D0BA 2VG7A 3SUQA 3AO4A 3IAYA 4CJEA 1HMVA 1Y97A 4N41A 4LY7A 4LH4A 4OGCA 3ZSYA 5I3UA 1ASUA 5J2MA 4CEZA 3V6DA 4CHZA 1MU2A 4DFJA 1QSSA 4DQPA 3QEWA 2Z1GA 3VQCA 4CJVA 1LWFA 1BL3A 2B4JA 4KHUA 2NUBA 2OPPA 2P51A 3RMBA 2PYLA 1WSFA 1ZBUA 3ZT1A 3KD1E 3NGZA 4DLGA 1B92A 1Z25A 2FBYA 2QXFA 3AVFA 1JLQA 3LPUA 4CF1A 1GOCA 1NJWA 4J2AA 4BWMA 4DTJA 2DFFA 1IKYA 2X6SA 5KRTA 3RRHA 1KTQA 1TV6A 4DSKA 4DMNA 1R0AA 1HYZA 3VQ4A 5C42A 1LAVA 4CIFA 4E7IA 3UIQA 4KTZA 4J2DA 3S3NA 2KTQA 1SKRA 4H4OA 1QSLA 3AVNA 2XO7A 3LZJA 3TWHA 1JKHA 1HNVA 4KI4A 4MQ3A 2HHWA 5KRSA 1NOZA 4FLVA 4ELVA 2IDOA 1UA0A 4IKFA 1CLQA 1U45A 3DLEA 3OS1A 4M3WA 4BE2A 1NK6A 4DQIA 4FK4A 3HL8A 4FJMA 4CFBA 1C6VA 4KHNA 3ZSWA 3OY9A 3OYDA 2AJQA 4FZXC 3ZSXA 4EP5A 3KKRA 4E7LA 4F2RA 2ZQBA 1TKZA 4DU1A 4HUEA 3CFPA 4E7HA 3KLIA 1TK8A 3DLHA 1RT4A 4O0IA 4KTWA 4PWDA 2FBXA 2GBZA 2HVHA 3VQ9A 4ZHRA 1S6QA 1BI4B 4CJ3A 3OYIA 1A5XA 1RDAA 1ZBLA 3PO4A 3AVLA 4CEFA 5C25A 4CHQA 2DFEA 3AV9A 3V1QA 4HVJA 2F8SA 4W5OA 4HTUA 1U04A 4BE0A 4RG8A 1JLFA 1S1UA 1KVCA 4IFVA 1BISA 1VSHA 5CZ2A 3V1RA 4W5TA 4Z4GA 3NAEA 1C1CA 4F2SA 3V9UA 4G1QA 4DTXA 2RN2A 4HHTA 3VQ5A 1JLBA 1B9DA 1VSFA 1N5YA 3MEDA 1NK8A 4CEOA 2YNIA 1T03A 3LALA 2OYQA 1CXUA 1QHTA 2KW4A 2BDPA 4Z4EA 2KFNA 4OPKA 3VQPA 5FRMA 1RTJA 3V9WA 3TAPA 4DSJA 3VN5A 3CYMA 1RDDA 2RPIA 1NK7A 3I0SA 4HUGA 3HPGA 3LZIA 4HCBA 4KAZA 4N47A 3CM5A 3NF6A 4CEEA 4AHUA 3NDKA 3HM9A 3B6PA 1UOCA 3L3VA 1NJXA 4HCCA 4IG3A 1ZYQA 1KLMA 5SZTA 1VSLA 3VQ6A 3OYHA 5K14A 5J2PA 1BQMA 4N56A 3NH2A 3TR8A 4DSFA 4CGGA 3NHGA 1KLNA 1SV5A 4B08A 3OYBA 1L3UA 4M3UA 1U48A 1WSJA 3E01A 1YVUA 2G8FA 2JGUA 1SUQA 4OLBA 2X74A 2G8WA 3LP3A 3OYLA 1HNIA 5CZ1A 4J2EA 2ETJA 3P5JA 4IG0A 3D0PA 2FBTA 2IAJA 3KLHA 3IG1A 4CGFA 4Z4IA 3AA2A 4FM1A 1KVBA 4H4MA 3RRGA 3PUFA 4O0JA 4CJRA 3OYEA 4FLXA 1JL2A 2Y1IA 3AVJA 4QOZB 3VQAA 4DTMA 1D9FA 4Q0BA 1LWEA 4I7FA 4CJLA 4F4KA 3WNEA 3SI6A 3HXMA 4B9UA 4J2BA 4FYDA 3LAMA 1LW2A 2O4GA 3P83D 5DMRA 4KREA 3K58A 3S3MA 4E7JA 3SZ2A 1VSEA 1CZBA 5HRNA 4K8XA 3U3YA 3L8BA 1A5WA 1RNHA 3NE6A 3DM2A 2YKMA 1TL1A 3QINA 2O4IA 4CJQA 2RF2A 3DRPA 1X9WA 3RR7A 4M42A 4I2PA 3TABA 1EKEA 3O4QA 2G8VA 3U3GA 4B9NA 2KFZA 1SL1A 3T19A 3LP0A 3OYFA 4R5PA 1QS4A 1T05A 4W5RA 4FK0A 2QK9A 3FFIA 1NK4A 4JS4A 3SUOA 4CF2A 1U49A 1NK9A 3PX0A 1QE1A 4BDZA 2WONA 4CF9A 4CCHA 1WLJA 3AA3A 2XY5A 2GUIA 4JS5A 1TAQA 4E89A 4Z4CA 4RW6A 4Z4HA 2LSNA 1WSHA 2BE2A 3DYAA 3DOLA 4DF8A 1JLGA 1VSKA 4DSEA 1X1PA 4DLEA 4EZ9A 3HT3A 3QERA 4M3TA 1J54A 4CERA 2IC3A 1RTDA 3AA5X 4AHRA 2HW3A 4E1NA 3NBPA 3QEIA 4KHYA 2DTUA 4NYFA 3VQBA 2QKBA 3RMAA 3SJJA 2E4LA 3OYJA 4N5SA 4ELTA 3QNNA 3VQQA 1BCOA 4IDKA 1CXQA 3VQEA 4QCLA 1TL3A 4FM2A 3SQ0A 1GOAA 4DWIA 3SV3A 1BQNA 1YT3A 2XHBA 2BGGA 3TARA 4PA1A 1FK9A 2IGIA 1KVAA 3ZT2A 4CJPA 4E19A 1S5JA 1NOYA 1BCMA 1WAFA 3RTVA 4ZTJA 1T7PA 4B9MA 2OZMA 2YHBA 2KZZA 1TKDA 3I0RA 3SCXA 4IFYA 4AHSA 2P1JA 1KSPA 1WN7A 4CK3A 4FJHA 3QO9A 3L3UA 2Y1JA 3ZSQA 3V9SA 5J2NA 3MEEA 4W5NA 4E1MA 4BWJA 4PUOA 4CJTA 3RMDA 3AVAA 1NK5A 3HPHA 1Z26A 2JLEA 4M3YA 3M8PA 4KHSA 1K6YA 1LW0A 5CY4A 1TVRA 1XHZA 1W9HA 4ID1A 4ZTFA 1IKVA 4DFKA 3KTQA 3S3OA 4RW8A 3PV8A 1JLAA 1I39A 2YKNA 4K8ZA 4GMJB 1XWLA 3LP1A 3QETA 3QEPA 5T7BA 1UAXA 2ZE2A 4KHQA 3SPZA 3K2PA 1VRUA 4OKJA 1X9SA 4L8RB 4LSLA 4C8MA 3NH0A 1IKWA 1RBUA 3LWLA 2HMIA 3L2RA 3SPYA 1BI4A 3KD5E 2D0AA 4DU3A 4KFBA 3DI6A 4CIGA 1RTIA 4KKOA 4RW7A 4WE1A 3SQ1A 1KRPA 3O3FA 1F21A 4DS5A 1SKSA 4CEDA 2PZSA 1IKXA 1DTQA 5J2QA 4OLAA 2X6NA 1ZBFA 4I2QA 4QAGA 1VSIA 4B8CA 1BHLA 4CFCA 1T8EA 3OS0A 1C0MA 4PY5A 2XY8A 1UWBA 1DLOA 1RBSA 2P5GA 1FKPA 4FLUA 4F3TA 2HNYA 2Q3SA 3ZSVA 4CHNA 3NH1A 5CYQA 4FJ9A 4ELUA 1IG9A 3ZCMA 3ITHA 2B5JA 3C6TA 4CE9A 1JXEA 1TKTA 1X9MA 3ASMA 1B9FA 4FLTA 1HQUA 4DSLA 3EZ5A 5I42A 3OJSA 1VRTA 1A5VA 2ITGA 1JL1A 2HNZA 1WSGA 1VSMA 4Z0UA 1C1BA 5KGWA 2Z1IA 3WNGA 1ASVA 1TK5A 4CFDA 1QSYA 4DF4A 3KK1A 3IRXA 4DU4A 4CIEA 2G8IA 2QKKA 1J53A 3OJUA 3TAFA 5J1EA 1L3VA 4CHOA 1S1TA 4FJ7A 4OJRA 3K59A 1HYSA 3PY8A 4FW2A 2E6MA 3V9XA 1ITGA 4O44A 3M8RA 2WOMA 2G8HA 3OYCA 1D9DA 2X78A 3NGYA 3V1OA 1HQEA 3OS2A 4AILC 1L5UA 2DY4A 3RR8A 3RWUA 4DTUA 3LWMA 1RT6A 3P1GA 4YNQA 4JRQA 1UA1A 1GOBA 3D45A 2PYJA 4DFPA 1QQCA 1LV5A 1J5OA 4BACA 4AHVA 3NF8A 1RILA 2I5JA 1RBVA 2YNFA 3HO1A 4NCAA 1BIUA 4DQQA 4FZYA 4KI6A 4W5QA 2HHSA 4MFBA 1IO2A 3HVTA 4FZZA 4F3OA 1WNSA 3V9ZA 3MEGA 3AA4A 3IS9A 4RW4A 1SL0A 3TAQA 1ZBHA 1XC9A 1WSIA 4CFAA 4B3OA 1DTTA 4YFUA 3AO5A 2BANA 3JSMA 4HUFA 1JLEA 4BDYA 4BE1A 4C8LA 2KZMA 4OKEA 2EX3A 2HB5A 4NCGA 4B9TA 3K5OA 3PX6A 3O3GA 2A1RA 1XHXA 1NJYA 3B6OA 4FJJA 1QTMA 5C24A 3JYTA 2G8KA 4CF0A 2Z1HA 1YTUA 1KFDA 3LPTA 3KLGA 4LD0A 4CECA 4EP4A 3ZSRA 1N6QA 3DLGA 1C1AA 1RCHA 2HNDA 1IH7A 4B9VA 3SNNA 4KV8A 3RMCA 3CFOA 4CGIA 1NKBA 4FJXA 2HVIA 4AH9A 4LH5A 3QEXA 3WNFA 1RBTA 1SL2A 3CQ8A 4FLZA 3DRRA 5HRRA 2W42A 1HYVA 3PO5A 4BDPA 1RT5A 3O4NA 4JRPA 3H08A 4Y1DA 1RT2A 3TAMA 1D5AA 4AHCA 4CF8A 3K5MA 3QLHA 2OZSA 1RBRA 3HP9A 2VG5A 3MECA 4E0DA 4FJNA 4I9LA 3CFRA 5JS1A 1REVA 3QEVA 3I8DA 2R7YA 3NCIA 4FJ8A 3TANA 4KPYA 3T1AA 3OVNA 3SQ4A 2HHUA 3AVKA 1KCFA 3OYKA 3HVRA 2IOCA 4FVMA 4ID5A 2OPSA 5JS2A 1VSDA 4CEBA 3SQ2A 3THVA 3BGRA 3DLRA 1JXBA 4FJLA 4CESA 5HRPA 2IS3A 3ZT4A 2GV9A 4FM0A 4DTNA 2OA8A 4PQUA 3K5NA 1NJZA 2P5OA 2D0CA 4GVMA 3K57A 3U6FA 4KHWA 3VA3A 4ICLA 4NCBA 3MXMA 4C8KA 3KIOA 4CEAA 3HYFA 3AVBA 3K5LA 3OYGA 3CG7A 4CGHA 1BGXT 2Z1JA 3A2FA 4E7KA 3C95A 4OGEA 3AVIA 4CK2A 3SV4A 4KO0A 1YTAA 3LAKA 3QNOA 3DLBA 3WNHA 4B9LA 1O1WA 1W0HA 2D5RA 1S1VA 4CEQA 4CJ5A 4FCYA 3DOKA 2FC0A 5HP1A 2HHXA 4E3SA 1TKXA 2XY6A 1JLCA 1VK0A 5HBMA 4CHPA 4FLYA 2F8TA 2FBVA 4M41A 4CJUA 4B9SA 2VG6A 3AO1A 1LWCA 4RW9A 1KFSA 4LSNA 1EXQA 1HJRA 2E6LA 4OVLA 4FW1A 4F8RA 2OPQA 3VQDA 4FLWA 2ZD1A 3F9KA 4JLHA 3SUNA 1SKWA 4FJIA 3HK2A 1HPZA 1C0UA 3AVGA 5KTQA 2PY5A 5EU7A 3DLKA 4DSIA 3LP2A 4O5BA 4DTSA 3L2QA 3NFAA 4DS4A 3TAGA 1BIZA 4CGJA 5E41A 3ULDA 1TAUA 2EHGA 1S9GA 3ZT3A 4M3XA 3AVCA 3ZT0A 1VSJA 4CJKA 1EX4A 2VWJA 3DMJA 3S9HA 3VA0A 3HSTB 3ZSZA 4DG1A 3M8QA 2HHQA 1I3AA 1RTHA 4Z4FA 4CGDA 1C0TA 5FROA 5HLFA 3TAEA 4TSXA 5DK5A 3QESA 2VWKA 3DRSA 1NKEA 5KGXA 4C8OA 4DQRA 3LANA 4DTRA 2HHVA 1RDBA 3KLFA 3EYZA 3MXIA 3ZSOA 2YNGA 3C94A 3T3FA 1RT1A 3KLEA 3EY1A 3V4IA 3PX4A 1ZBIA 1RT3A 3MAQA 3L2VA 4DTPA 4B8AB 3KK3A 4KRFA 3M8SA 4GW6A 1WSEA 3QIPA 3CM6A 3G10A 4UQGA 4M45A 4Y1CA 3VQ7A 4KTQA 1WAJA 1NK0A 2RKIA 3ISNC 3VQ8A 5FRNA 3QIOA 4FXDA 2YNHA 3V81A 3AO3A 3MXJA 3HPOA 3AVHA 2DFHA 5HROA 4CJ4A 1XI1A 1U4BA 2G8UA 1S1XA 4I9QA 5HRSA 1RDCA 4CJWA 4CJFA 1TK0A 3HJFA 4O55A 4FJGA 4M3ZA 1EP4A 3OYAA 3BDPA 1TGOA 2YHAA 4FJKA 1EETA 2F96A 2XRIA 3G0ZA 3NF7A 4DFMA 1Q9XA 1ASWA 2YV0X 3AO2A 3LDSA 4FJ5A 3ALYA 3NF9A 1Q9YA 1Q8IA 1RT7A 1S6PA 1U47A 2KQ2A 4EZ6A 4M3RA 2OPRA 5SWMA 3SUPA 4CHYA 3KJVA 1LAWA 3OYNA 1S1WA 3F73A 3NGIA 3SYZA 5FDLA 4DTOA 3TI0A 4KB1A 5D3GA 1FXXA 3L2UA 1G15A 1J9AA 4OPJA 1L3TA 1FKOA 4OKKA 4O4GA 3KK2A 4NYNA 4C8NA 4AHTA 3L2WA 1L3SA 1CZ9A 4H8KA 1NKCA 2XY7A 4CJSA 4KB0A 1D8YA 4FK2A 2B6AA 4CK1A 3HP6A 1S9EA 3AVMA 2HHTA 5KI6A 3C6UA 4XIUA
chains in the Genus database with same CATH superfamily
4BGAA 2ZWHA 5CYMA 1ATSA 3OYMA 3D2EB 3VGKA 4NB4A 3IAYA 4CJEA 1HMVA 3ZSYA 1Q81O 2V7ZA 4CHZA 4DQPA 2Z1GA 1BL3A 2NUBA 2P51A 3RMBA 1WSFA 1ZBUA 4GV6A 4PKIA 3NGZA 2ZGZA 4WFAL 1Z25A 1GOCA 5MLCQ 3D2FA 3BZKA 4DSKA 1WOQA 4DMNA 3UKRA 1R0AA 2VGNA 4CIFA 4E7IA 4X65K 2A6AA 4FPAA 2ZJRL 3AVNA 4WQ5C 1XMOK 3LM9A 1NG9A 2UU9K 5AQWA 2WBNA 5KRSA 1CLQA 3O9QA 3BZCA 3JS6A 3OS1A 4IOCL 4M3WA 1NK6A 2W41A 3HL8A 1WUAA 1C6VA 3ZSWA 3OY9A 1JJ2M 4UY8O 4PKHA 4HUEA 3A5NC 4ZHRA 1NGCA 3QICA 4CJ3A 3R3LA 1RDAA 3AVLA 5C25A 3I55N 4HVJA 4BC4A 3FZKA 4IFVA 4BR2A 1BISA 5EY4A 1XNRK 4G1QA 1JLBA 1B9DA 1VSFA 3MEDA 2OYQA 3ENBA 2BDPA 2KFNA 3A5OC 4ISEA 3TAPA 3SJHA 3ZEUA 4DSJA 4ILHA 4HUGA 3CM5A 4CEEA 5FPNA 3HM9A 2HBJA 2EWSA 4H5NA 1VSLA 3LDLA 1VHXA 3NH2A 3TR8A 4DSFA 4JI0K 3OBWA 3NHGA 1KLNA 1L3UA 3CJ7A 4LF8K 3OYLA 1HNXK 3P5JA 2FBTA 1KVBA 5LMUK 2F9TA 4FLXA 1JL2A 2Y1IA 4L3QA 2NRXA 3K0SA 3VQAA 4Q0BA 1Y64A 4WQ4C 1S72N 2ZGYA 4B1XB 3SI6A 4EHUA 4CZJA 4JI5K 2O4GA 5DMRA 4E7JA 3SZ2A 2Q31A 3W3DA 1CZBA 4FWLA 3DM2A 2RF2A 4M42A 1EKEA 2G8VA 3MCPA 4JK8A 4R5PA 3U4LA 4W5RA 2PFUA 4J8FA 2GWKA 3FFIA 1NK4A 4DCHA 5GAHP 1U49A 1NK9A 2QXLA 4BDZA 4CZEA 1YJNN 3N4QA 2XY5A 3EKSA 2GUIA 3QETA 1HYSA 2LSNA 2BE2A 3DOLA 4EFHA 3AA5X 4AHRA 2P9KA 3CJAA 4A2AA 3VQBA 3K9KA 3RMAA 1J6ZA 3KVGA 3OYJA 4ILJA 3QNNA 3VQQA 2WFBA 3VQEA 3FZLA 4NLCA 4BR9A 1TL3A 4FM2A 3RSEB 1BQNA 1NOYA 4CJPA 3ID6A 2YHBA 1GLCG 2FLOA 5C15A 1Q7YO 2P1JA 5GIPA 3JAMO 3L3UA 2JWKA 2Q2RA 2P9PB 4BROA 4H0OA 3RMDA 3AVAA 3DXKA 3M8PA 4KHSA 4KHPK 4CBWA 3SK3A 1I39A 4CZKA 4FL9A 1D4XA 2ZE2A 1X9SA 4LSLA 4C8MA 1N8RO 2HMIA 3L2RA 3CC7N 3KHYA 5AR0A 3KD5E 4DU3A 4CIGA 1RTIA 2ASOA 3B8AX 3J7ZO 3THWB 1SKSA 1IKXA 4JI3K 3K9JA 3H6EA 2X6NA 4B8CA 1T8EA 3OS0A 4PY5A 4U67L 1J5EK 1DLOA 4F3TA 2HNYA 4CHNA 5LJWA 3VMFB 1IG9A 3GE1A 1X9MA 1XMQK 3WT0A 3R1XA 5I42A 4IOAL 1WBDA 4ISFA 2HNZA 3THXA 5KGWA 4CFDA 1QSYA 2NZTA 3IRXA 3G71N 4DU4A 2WUSA 1J53A 1Q18A 3TAFA 3BY5A 4CHOA 1S1TA 3DLLL 3PY8A 4EAHD 3V9XA 4QS7A 2WOMA 5BN9A 4AILC 2QWQA 1S22A 4B1YB 4CD1A 2O8DA 3P1GA 4YNQA 2VQEK 2I7NA 3PIPL 5AFUA 1QQCA 3O8MA 1QZ6A 1RILA 3DAWA 4FWKA 4H03B 1RBVA 1WB9A 1HKCA 1HKGA 4KI6A 3HVTA 4JKGB 3V9ZA 2GUPA 4RW4A 3TAQA 1ZBHA 1XC9A 4DV4K 4B3OA 4BE1A 4U7BA 1JLEA 4BDYA 2EX3A 3D2EA 3O3GA 1NJYA 4FJJA 1VQNN 4CF0A 2Z1HA 3E1YA 2VWBA 2A42A 2F4VK 1OH7A 3ZSRA 3DLGA 1BWFO 1RCHA 3I56N 3U9ZA 3QEXA 1SL2A 4LF6K 4FLZA 5EXWA 4FK2A 4CZMA 1HYVA 3L4QA 4AHCA 3VPZA 1D5AA 5AQOA 1RBRA 1VQMN 4E0DA 2ZJPL 1GLEG 4I9LA 3CFRA 3CMAN 4XH1A 4A59A 3T1AA 3CCUN 3U8XA 3BGRA 3DLRA 5BRHA 4B1ZA 3L4IA 5KPZA 3K5NA 2P5OA 3U6FA 3SBTA 5GAGP 3K57A 4YOWA 1C0GA 4KH6A 3KIOA 2QI2A 3QNOA 3C95A 4HCCA 3CJCA 4KO0A 3DLBA 4B9LA 1W0HA 5HP1A 4DV3K 1TKXA 1JLCA 5HBMA 4FLYA 2CH5A 4H0VB 4CJUA 4B9SA 4DR2K 2VG6A 4OVLA 4FLWA 3HK2A 1C0UA 5EU7A 3HM8A 3DLKA 3LP2A 4O5BA 4BR0A 5E41A 4CJ7A 3AVCA 2VWJA 1EX4A 3S9HA 3ZSZA 4Z4FA 3P38A 4O8KA 5AQSA 3QESA 3VGLA 2VWKA 1NKEA 2E1ZA 3LANA 4DTRA 5F1XA 3KLFA 1NMDA 3EO3A 3LDNA 5BPMA 2NRVA 3O6WA 3L2VA 1W2BM 4O8UA 4FOEA 1OKJA 1YXQA 4B8AB 1ZC6A 4FOIA 1YF5L 3VQ7A 5FRNA 2NRWA 4FXDA 2YNHA 3ZX0A 5C12A 4BR5A 3P39A 3QFPA 3FR0A 4H5TA 3VEZA 4I9QA 4M63C 4CJFA 5F0XA 4FJGA 2ASPA 4BC2A 2YHAA 4FJKA 4B3RK 3AO2A 5FPEA 4JI6K 1MDUB 3ENHA 1S6PA 2OPRA 3KJVA 1E3MA 2E1YA 1S1WA 3SYZA 3WXJA 4DTOA 3F9MA 3L2UA 4DR4K 1RGIA 4O4GA 4AHTA 3L2WA 5BREA 3H1VX 2XY7A 4KB0A 4CK1A 4PA1A 1SL0A 2ZM6K 4MLHA 1HRHA 4N76A 2A1SA 2ATQA 3EZWA 4H5WA 4B1VA 1ZXOA 3AO4A 2P9KB 3TTFA 1Y97A 4LY7A 1ASUA 3V6DA 1KC8O 2FSJA 1QHAA 4LFCK 3CCEN 2B4JA 3PSIA 4B1WB 2OPPA 4YHHK 2PYLA 3ZT1A 3O9SA 3RSEA 4QS9A 3MMVA 3CCRN 1VQ9N 1JLQA 2Q0UA 4CF1A 4J2AA 3O9UA 1IKYA 2X6SA 3Q7BA 5KRTA 3RRHA 1KTQA 1TV6A 1K8KA 1JCFA 3VQ4A 5C42A 5E84A 1SKRA 1QSLA 3UB5A 1OVQA 3DXKB 3QFUA 4MQ3A 3HOTA 3MN6A 2HHWA 4ELVA 4IKFA 4DR7K 1U45A 3DLEA 4DQIA 1HUXA 2NLXA 4CFBA 3FZHA 3VF2A 3I8BA 3VOVA 3WXKA 3OYDA 4JD2A 3ZSXA 4MDAA 3EN9A 4DU1A 1TKZA 4BRPA 1TK8A 4BR4A 3DLHA 4O0IA 4C23A 4CEFA 4CHQA 2DFEA 3V1QA 3L6QA 3THWA 4RG8A 1S1UA 3EKUA 1VSHA 4Z4GA 3C6AA 2KHOA 4HHTA 3VQ5A 5F2RA 3ZETB 1NK8A 2YNIA 3LALA 1CXUA 5FRMA 3VQPA 3ZLJA 3G25A 1YHQN 3CYMA 3T1YK 3I0SA 3HPGA 2OANA 3G6EN 3O80A 3NF6A 3NDKA 3L3VA 1FW6A 1NJXA 2D1KA 1ZYQA 1KLMA 3QB0A 3THXB 5JLFA 3AGRA 4CGGA 3HRGA 3OYBA 1U48A 1WSJA 1YVUA 2JGUA 2X74A 1ATRA 1TYQB 1T6DA 3J7YP 1HNIA 2ETJA 3D0PA 3LL3A 4IG0A 5AQGA 2IAJA 3CERA 3IG1A 4CGFA 4A57A 3RRGA 4O0JA 3AVJA 1D9FA 4DKWA 4B9UA 4J2BA 4FYDA 1LW2A 3P83D 1VSEA 1A5WA 5IT9O 3DRPA 4A61A 3O4QA 5AQMA 3T19A 3GOIA 3LP0A 3VERA 3OYFA 3DJCA 2UUBK 4FK0A 3NVMA 3SUOA 3LM2A 1QE1A 4CCHA 1WLJA 1DT9A 3MDQA 5BN8A 4JS5A 4OO1J 4DQ8A 1UA1A 4WCEL 4DF8A 3CIPA 4DLEA 2IC3A 1M1KO 1YAGA 3QEIA 2QKBA 5BRFA 3A5LC 2E4LA 4IEEA 4IDKA 1CXQA 1X3MA 3SQ0A 1GOAA 4DWIA 5M1PA 3MWPA 3SV3A 3ZT2A 3ZYYX 4E19A 1S5JA 2OZMA 1WAFA 4ZTJA 4LFAK 4FWSA 3I0RA 4AHSA 4HTLA 5LY3A 1KSPA 3IKMA 5KQ8A 3VESA 4W5NA 5J2NA 3MEEA 4BWJA 2E2QA 4DV6K 3HPHA 3A0IX 3MWTA 1NGAA 1TVRA 3O08A 4ID1A 1IKVA 3Q7CA 3S3OA 4RWTA 4CW7B 3PV8A 1JLAA 3LP1A 1YUWA 5C10A 1N32K 4PL7A 4KHQA 3K2PA 1VRUA 4KBOA 3NH0A 4PKGA 3SPYA 1BI4A 1NLVA 3DI6A 3F5TA 4DS5A 4CEDA 4YOTA 1ZBSA 4CFCA 4CZHA 1C0MA 1X9JA 1UWBA 2P5GA 3VF6A 4FLUA 4K25A 3ZSVA 5CYQA 4ELUA 3ZCMA 2B5JA 3OTOK 4GV3A 1JCEA 1TKTA 3WEEB 3DXMA 4FLTA 1HQUA 5H1SQ 1VRTA 2Q97A 3CJBA 2ITGA 4Z0UA 5AQHA 4FWQA 1ASVA 4LF5K 2A41A 2JWLA 4JAXA 4CIEA 1GLFO 5J1EA 3PIOL 2IIRA 1GLBG 1V4TA 3KWGA 2D0PA 4K41A 3GDQA 5EOYA 4O44A 2G8HA 1D9DA 3VEWA 2X78A 1HQEA 3OS2A 1L5UA 3RR8A 3TTDA 4RCHA 4H0YB 4M7YA 3VTIA 3H3NO 3D45A 3QDKA 4DFPA 1J5OA 3S41A 5JVHL 3HO1A 1BIUA 4FZYA 4W5QA 2V7YA 2HHSA 4MFBA 1IO2A 4FZZA 2F7TA 1WNSA 3LDPA 4FO0A 4CFAA 1DTTA 5AQYA 2BANA 3L0QA 4JKCA 4C8LA 4OKEA 1KQSM 4YORA 4DUZK 3PX6A 3EEQA 2G8KA 3M6GA 3LPTA 2QEXN 2HNDA 4KV8A 1NKBA 2HVIA 4LH5A 4PHTX 5AQIA 3PO5A 4BDPA 4KTQA 1K8KB 4B3TK 4GY2B 3HP9A 3MECA 1QQMA 1P90A 3SQ4A 3OYKA 1KCFA 4ID5A 1ILYA 1VSDA 4BRCA 3WUHA 4K0KK 1JXBA 2NNWA 4FJLA 2E20A 2YI1A 4FM0A 4JD2B 5FLXO 3M3ZA 4KHWA 3VA3A 1VQ5N 3MXMA 3ZX3A 3OYGA 1DEJA 4B9QA 3CPEA 4CGHA 5M1FA 4CK2A 2GTDA 3LAKA 4CEQA 1S1VA 2HHXA 4CJ5A 4FCYA 2HBLA 4CHPA 3CCSN 3QMLA 4QS8A 1IBMK 3AO1A 1HJRA 3BP8A 1DGKN 2OPQA 3VQDA 3SUNA 2QWRA 1VAZA 1SKWA 3AVGA 3ZETA 5KTQA 2PY5A 4OX9K 4DTSA 2VYPA 3AARA 4DS4A 1TAUA 3ZT0A 5C2DA 3DMJA 4DG1A 1H1VA 1C0TA 2HHVA 3DRSA 5KPTA 5KGXA 4DQRA 1RDBA 3BF3A 3MCAB 4JK7A 2IVPA 3C94A 3PX4A 3T3FA 4MO5A 3ATVA 1NJIO 1TYQA 3HSCA 3M8SA 4B1UB 3O1WA 3QIPA 1NGHA 1WAJA 3TSUA 2VCPA 2ITMA 5AQRA 5AQTA 4BRHA 1YI2N 3V81A 2DFHA 1XI1A 1S1XA 5HRSA 4CJWA 2W6LA 5DM6L 1NU0A 4M3ZA 3BDPA 1GLDG 3G0ZA 1ASWA 4FJ5A 1Q8IA 2QA4N 4GV9A 4EZ6A 4CZFA 1YITN 2V51B 4LF4K 1LAWA 3NGIA 3H46O 4OPJA 1VQ4N 2AP1A 1FKOA 5LJVA 2YX6A 4H8KA 3CC2N 2HSTA 5AQKA 4DB3A 5AQLA 4YOUA 4YOVA 3CPWM 3HP6A 1QVFM 3AVMA 4BRIA 4XIUA 3O3HA 4IBNA 4CZIA 4DQSA 2D0BA 4AF1A 3SUQA 1LOTB 5ADXA 5J2MA 1MU2A 3OW2M 1VQ8N 1CZAN 3QEWA 3VQCA 4CJVA 1LWFA 4LF7K 3EE9A 1T3VA 2OTLN 3QBWA 2WC9A 4BRGA 1I94K 1B92A 3LPUA 2FBYA 2QXFA 3AVFA 3IDHA 4DTJA 3M1FA 4DV0K 3UIQA 4Z94A 2HOEA 5JICA 2XO7A 3LZJA 3CCLN 4A2BA 3P4IA 1JKHA 4KI4A 2GEMA 3SMPA 1NOZA 1BO5O 4LFBK 4BE2A 4IXCA 1W7AA 4FJMA 4KHNA 3C7NA 4FZXC 4EP5A 4CBXA 1BG3A 2ZQBA 4BRQA 3KLIA 5KQDA 4A5AA 1RT4A 4DR1K 2FBXA 2GBZA 3VQ9A 1S6QA 1BI4B 3OYIA 4W5OA 4EIAA 3G4SN 4FWNA 1KVCA 3V1RA 5CZ2A 2UUCK 2UXCK 3NAEA 3V9UA 1MWMA 4NXNK 2O8EB 4CEOA 1TUUA 1NGDA 2ASMA 4BQLA 4Z4EA 2OTJN 1QQOA 3A8YA 1NGGA 4FSVA 1RTJA 1RDDA 1NK7A 1V4SA 3DXMB 3UE5A 3WEEA 4N47A 5GADP 3HOSA 5C0YA 4IG3A 5SZTA 3OYHA 5K14A 3P31A 3EE8A 4N56A 1IG8A 3TPQA 1VQON 1SV5A 4B08A 2HBMA 4M3UA 3E01A 2G8FA 2YJFA 2GX9A 2G8WA 5M1NA 5CZ1A 1M90O 3KLHA 4ISGA 3AAQA 3THYB 3AA2A 5B8HA 4FM1A 3H1QA 1YIJN 4JYAK 4H4MA 3PUFA 4CJRA 3OYEA 2UXBK 1U6ZA 4QOZB 1IBKK 1LWEA 4CJLA 4KREA 3S3MA 1NBWA 5M1KA 3U3YA 1VQ6N 3WXLA 3CQXA 4IOXA 3L8BA 4BC5A 3N4PA 2VQFK 2BTFA 3QINA 1X9WA 3C0BA 4BY9C 2KFZA 1SL1A 5AQXA 5M1OA 4JS4A 3KK7A 4CF2A 3PX0A 2P9UA 2WONA 2HMPA 2A40A 4E89A 4Z4CA 4RW6A 1WSHA 3DYAA 2HBKA 1JLGA 1J54A 2HW3A 4E1NA 1ATNA 3R8EA 4KHYA 2UYTA 2W6KA 4Y0WA 2P9SA 1R59O 5E26A 4QCLA 5JMVA 2YHYA 2BGGA 3TARA 1FK9A 2IGIA 1VQ7N 2KZZA 4FWMA 1BA1A 1TKDA 3T69A 4IFYA 1WN7A 4CK3A 4FJHA 3QO9A 4CZGA 2Y1JA 4DV5K 3NMUA 3E9LA 4H5RA 4PUOA 4CJTA 2CGLA 1NK5A 1HJOA 1Z26A 1FJGK 1K6YA 1LW0A 2W40A 3DWLA 1XHZA 3KTQA 4K8ZA 1U2VA 4GMJB 4JI1K 1XWLA 5A2QO 4BG9A 3PLAA 3TSPA 5T7BA 1UAXA 5IWAK 3SPZA 4NO7A 4L8RB 1IKWA 1RBUA 2D0OA 3SQ1A 4RW7A 1KRPA 1F21A 3WQUA 3O4WA 4OLAA 2NRHA 1ZBFA 3PSFA 2F9WA 4QAGA 3VGMA 1N33K 2XY8A 4BVPA 2Q3SA 3NH1A 5AQNA 2QTDA 4M7XA 2E2NA 4CE9A 1JXEA 3MX2A 2E2PA 3VEOA 4JHDA 2QWLA 5EX5A 3J81O 3ZX2A 4DSLA 3JXUA 3EZ5A 4X66K 1A5VA 4YDUA 3CQYA 3VEVA 2P9NB 1C1BA 2Z1IA 3WNGA 1NMNA 3MN9A 3KK1A 2QKKA 2O8BB 4AM7A 3K59A 3CXCM 4DV1K 4JKBA 3A5MC 1ITGA 2YHXA 4CZLA 3M8RA 3OA9A 3CETA 3V1OA 3NGYA 4JN4A 4BR7A 1YJ9N 4DTUA 5AQQA 4BC3A 1RT6A 3AGKA 3CCMN 1RDWX 2AA4A 4BACA 4AHVA 2I5JA 4B3MK 2YNFA 4X62K 1SS6A 1LCUA 3CJ1A 4YOYA 3BF1A 4F3OA 3AA4A 3IS9A 4RTFD 4XEIA 3GG4A 3SMSA 5CR4A 2DPNA 4HUFA 2GELA 4NCGA 2HB5A 4JKAA 4B9TA 4CBUA 2A1RA 3B6OA 1QTMA 1Z6RA 5C24A 3JYTA 1NGEA 1YTUA 2E88A 4CECA 4E1JA 5AFUH 1VQPN 1N6QA 5HOOA 1IH7A 4B9VA 4A5BA 5JLHA 3RMCA 1GLJO 4CGIA 1EWRA 4OPAA 1RBTA 3WNFA 3CQ8A 3VEXA 3DRRA 4G9ZA 4JRPA 3QEPA 3H08A 4Y1DA 1RT2A 4CF8A 3K5MA 2OZSA 4JI4K 2PBDA 2VG5A 3H45C 5JS1A 3I8DA 2R7YA 4CVNE 3CD6N 4YOXA 2HHUA 3AVKA 3HVRA 5GIOA 2O8FA 2IOCA 4FVMA 2OPSA 4CEBA 3ZT4A 3MN7A 5I9EB 2OA8A 3U9DA 3C7NB 3UKUB 2YCHA 1NJZA 2D0CA 4GVMA 1BOTO 5ADXH 4AQYK 4CEAA 1SZ2A 3HYFA 3K5LA 3CG7A 1BGXT 3A2FA 1N34K 2HF3A 3AVIA 4EHTA 1KD1O 5BPNA 1O1WA 1QZ5A 3DOKA 2XY6A 1VK0A 4XH5A 2NRRA 2NRTA 1LWCA 4RW9A 4LSNA 1EXQA 1W97L 2E6LA 4FW1A 4IO8A 2ZD1A 4LF9K 4HWIA 2O8EA 4DSIA 2CGJA 1Q82O 4BRAA 3WXMB 3L2QA 3NFAA 3ULEB 1BIZA 3ULDA 4A62A 2EHGA 1S9GA 3ZT3A 2ZJQL 1VSJA 5BPLA 5AQZA 3VA0A 3HSTB 3M8QA 2HHQA 1I3AA 1RTHA 3J8AA 1NNEA 4B3SK 5HLFA 3LDOA 4WQ5A 3TAEA 4TSXA 3GL1A 5DK5A 2UUAK 3EYZA 3HBTA 4WFBL 1Q86O 1ZBIA 1RT1A 3KLEA 3EY1A 3MAQA 3E9PA 4DTPA 3KK3A 1ESVA 2P9LA 4GW6A 3D6RA 5TKWA 4UQGA 1YJWN 2P9IA 3THYA 5BR9A 3O9RA 1NK0A 2RKIA 4MO4A 3H3OB 2PAVA 2J4RA 3MXJA 3HPOA 3AVHA 5HROA 1RFQA 2IVNA 4WYBA 2G8UA 1C0FA 4KH4A 4FWPA 3OYAA 1TGOA 2XRIA 3NF7A 4DFMA 2FF3B 3BEXA 2YV0X 5GINA 3ALYA 1Q9YA 3R9PA 4M3RA 5SWMA 1HPMA 4CHYA 3HTVA 4X64K 1QVGM 3OYNA 4FVUA 3GBTA 3F73A 3TI0A 5FDLA 1Z05A 1FXXA 1IJJA 1HR0K 1G15A 1RDUA 3SLCA 4JV5K 1L3SA 2BUPA 2P9UB 2RHKA 3FGUA 3WXIA 3J7AP 1D8YA 3F2KA 2B6AA 5JVGL 4Q5VA 3KKSA 2O8CB 5ELZA 2E8AA 3QBXA 4F9OA 2VG7A 4BVOA 1XNQK 4N41A 4I6MB 3TSQA 4LH4A 4OGCA 5I3UA 4CEZA 4MDBA 4DFJA 3HZ6A 1QSSA 4WFNL 2P9SB 5AQUA 4KHUA 2D4WA 3OBYA 3KD1E 4DR6K 4DLGA 4WQ4A 4JK9A 3KWIA 1NJWA 1T44A 4BWMA 2DFFA 3C6HA 1IV0A 2YHWA 1K9MO 4JI7K 4H0PA 3VENA 1HYZA 4J2DA 3AY9A 1LAVA 2WTUA 2FF6A 4KTZA 3S3NA 1KXPA 4BRKA 2KTQA 4H4OA 3T1HK 3TWHA 1HNVA 5BR8K 4FLVA 2IDOA 1UA0A 1N36K 2Q1NA 3VEYA 3SAHA 4FK4A 1U2VB 2AJQA 1YVNA 3KKRA 4E7LA 4K43A 4F2RA 1SQKA 3CFPA 4CI6A 4E7HA 1G99A 4KTWA 3WQTA 4PWDA 2HVHA 4H0XB 5AZIB 1VQKN 1A5XA 3CF5L 1ZBLA 3PO4A 2ZF5O 3AV9A 2F8SA 4HTUA 5AQVA 1U04A 4BE0A 1JLFA 4W5TA 1C1CA 4F2SA 2UXDK 4DTXA 2RN2A 4JKFA 1N5YA 1S3XA 2Q0RA 4R79A 3RVCA 1T03A 4MLEA 1O13A 1QHTA 2KW4A 4OPKA 3EL2A 3V9WA 3ID8A 4KH5A 1TUYA 3VN5A 3CJ9A 2RPIA 4JHDB 3LZIA 4HCBA 4O5FA 1BU6O 4GVEA 4KAZA 4AHUA 2FSNA 3B6PA 1UOCA 4FPBA 4BRLA 3VQ6A 5J2PA 1BQMA 2P9NA 1HLUA 1GLLO 5DM7L 1SUQA 4OLBA 3LP3A 2O8BA 4CD3A 4J2EA 3IMXA 4Z4IA 2E5LK 4K42A 3OHRA 1X3NA 5AZJB 4DTMA 4I7FA 2A3ZA 4DHYA 4F4KA 3WNEA 2CH6A 3HXMA 3LAMA 1NGFA 3K58A 5HRNA 4K8XA 4H0TB 4DV2K 1RNHA 2QWNA 3NE6A 2YKMA 1TL1A 2O4IA 4CJQA 1KAXA 3RR7A 3O1BA 4I2PA 3TABA 3U3GA 4B9NA 3FZMA 4IZ9A 1QS4A 1XUPO 1T05A 1VQLN 2QK9A 1MWKA 1EQYA 4DR3K 3MN5A 2OCEA 1HX1A 4CF9A 5KPRA 3AA3A 3CCVN 1TAQA 4Z4HA 4EZ9A 1VSKA 4DSEA 1X1PA 4DUYK 1WBBA 3HT3A 3QERA 4M3TA 4CERA 1RTDA 3SAFA 3NBPA 2DTUA 4NYFA 5FPDA 3SJJA 4N5SA 4ELTA 1BCOA 4DR5K 2XHBA 1YT3A 3KZBA 3CHWA 1KVAA 4B9MA 1BCMA 3RTVA 1T7PA 1DKGD 3E66A 3SCXA 3D2FB 2O8FB 4H5VA 3UKRB 3ZSQA 2VGMA 3V9SA 5AQFA 4E1MA 1HNWK 4IJNA 5FPMA 2JLEA 4M3YA 4BREA 2H3GX 3UKUA 5CY4A 2IVOA 4GNIA 1W9HA 4ZTFA 4DFKA 4RW8A 2YKNA 2QW9A 4IEIA 4BGBA 5CHIA 1HNZK 4OKJA 4GKKK 1NGIA 5TKYA 3J80O 3LWLA 3AAPA 3MX5A 2D0AA 4KFBA 4OPHA 4WE1A 4KKOA 4C1NK 3O3FA 3ULEA 2PZSA 4JI8K 1DTQA 3IUCA 5EVZA 5J2QA 4I2QA 1VSIA 1BHLA 3T7ZA 2FXUA 3HI0A 1RBSA 1FKPA 3MK6A 3TTCA 3ATUA 2E2OA 4FJ9A 3ZEUB 4LC9B 3CCQN 3ITHA 3C6TA 4BRFA 4GKJK 2A5XA 1B9FA 3ASMA 3OJSA 5CE3A 4JEPA 1JL1A 2P9LB 1WSGA 1NGBA 1VSMA 2P9IB 3VTHA 1OH5A 1TK5A 4DF4A 1P8ZA 2G8IA 3E9OA 5HL7L 1JCGA 3OJUA 1L3VA 3FLCO 4BRDA 4FJ7A 1OH8A 4OJRA 1E4FT 4FW2A 2E6MA 3ENOA 3OYCA 1T6CA 2DY4A 4JNEA 5BRDA 5AQPA 4WF9L 1KAYA 3RWUA 4PL8A 3LWMA 4IWVA 4JRQA 1GOBA 2PYJA 1LV5A 3NF8A 1K8AO 1XC3A 3VETA 1BUPA 4NCAA 4DQQA 1OVYA 3MEGA 1WSIA 4YFUA 3AO5A 3JSMA 2KZMA 1HKBA 1QQNA 2O8CA 3K5OA 1XHXA 4I6MA 4JKDA 1KFDA 4FWRA 3KLGA 4LD0A 4EP4A 1C1AA 2QM1A 1EWQA 3SNNA 3CFOA 4FJXA 4AH9A 1E4GT 3C65A 5HRRA 2W42A 3FFKB 1RT5A 3O4NA 5M1QA 3TAMA 3QLHA 4FJNA 4JI2K 1REVA 3QEVA 2QWOA 3NCIA 4FJ8A 3TANA 4KPYA 2BH1A 3OVNA 4NXMK 2YJEA 3VF4A 3THVA 1EO1A 4IJAA 5JS2A 1MA9B 3SQ2A 2RE2A 4BRMA 4CESA 1NGJA 2IS3A 4AM6A 2GV9A 2V52B 2P9PA 3FZFA 5HRPA 4DTNA 4PQUA 4YDUC 3FE1A 2KKZA 4ILGB 1NWKA 4ICLA 4NCBA 4C8KA 1XQSC 3AVBA 3CC4N 2Z1JA 4E7KA 4OGEA 4IO9L 3SV4A 1YTAA 5AZIA 5AJ3K 3WNHA 2D5RA 2FC0A 4E3SA 4IDHA 5C2FA 1IBLK 2F8TA 3CCJN 4JKEA 2FBVA 4M41A 4FWOA 3TU5A 1BA0A 1KFSA 4F8RA 1KAZA 3F9KA 4JLHA 4FJIA 1SAZA 1OH6A 2GWJA 1HPZA 2Q36A 5LMNK 4XH4A 3SAGA 3TAGA 4CGJA 4M3XA 4CJKA 3O9TA 3SBGA 2I7PA 4CGDA 5FROA 4DV7K 4BQZA 5GAEP 4C8OA 3BUZB 3MXIA 3ZSOA 2YNGA 3V4IA 1RT3A 4BG8A 4V19S 3IFRA 4KRFA 1WSEA 1K73O 2NRZA 3CM6A 3G10A 4M45A 4Y1CA 3VQ8A 3ISNC 2HHHK 5AZJA 3QIOA 2KLAA 3AO3A 4CJ4A 4NLBA 3I33A 1U4BA 2FSKA 3LDQA 1RDCA 4BRNA 1TK0A 4JKHA 3HJFA 4O55A 1EP4A 3R6MA 1EETA 2F96A 2CGKA 1Q9XA 3NVKA 4C1NI 3LDSA 5LL6Z 3NF9A 1RT7A 2O8DB 2QWMA 1BDGA 1U47A 2KQ2A 3CMEN 3SUPA 2HF4A 5D3GA 1NM1A 4KB1A 5AQJA 1J9AA 1L3TA 4OKKA 3O5BA 3KK2A 4NYNA 4C8NA 4IFEA 4YY3K 1GLAG 4JKGA 1CZ9A 1NKCA 3W0LA 3D7EO 4CJSA 3M5RA 2QWPA 1S9EA 3CI5A 2HHTA 5KI6A 3C6UA
chains in the Genus database with same CATH topology
4Q5VA 3O3HA 1HRHA 4IBNA 4N76A 2A1SA 3KKSA 2ATQA 5CYMA 4DQSA 3OYMA 2D0BA 2VG7A 3SUQA 3AO4A 3IAYA 4CJEA 1HMVA 1Y97A 4N41A 4LY7A 4LH4A 4OGCA 3ZSYA 5I3UA 1ASUA 5J2MA 4CEZA 3V6DA 4CHZA 1MU2A 4DFJA 1QSSA 4DQPA 3QEWA 2Z1GA 3VQCA 4CJVA 1LWFA 1BL3A 2B4JA 4KHUA 2NUBA 2OPPA 2P51A 3RMBA 2PYLA 1WSFA 1ZBUA 3ZT1A 3KD1E 3NGZA 4DLGA 1B92A 1Z25A 2FBYA 2QXFA 3AVFA 1JLQA 3LPUA 4CF1A 1GOCA 1NJWA 4J2AA 4BWMA 4DTJA 2DFFA 1IKYA 2X6SA 5KRTA 3RRHA 1KTQA 1TV6A 4DSKA 4DMNA 1R0AA 1HYZA 3VQ4A 5C42A 1LAVA 4CIFA 4E7IA 3UIQA 4KTZA 4J2DA 3S3NA 2KTQA 1SKRA 4H4OA 1QSLA 3AVNA 2XO7A 3LZJA 3TWHA 1JKHA 1HNVA 4KI4A 4MQ3A 2HHWA 5KRSA 1NOZA 4FLVA 4ELVA 2IDOA 1UA0A 4IKFA 1CLQA 1U45A 3DLEA 3OS1A 4M3WA 4BE2A 1NK6A 4DQIA 4FK4A 3HL8A 4FJMA 4CFBA 1C6VA 4KHNA 3ZSWA 3OY9A 3OYDA 2AJQA 4FZXC 3ZSXA 4EP5A 3KKRA 4E7LA 4F2RA 2ZQBA 1TKZA 4DU1A 4HUEA 3CFPA 4E7HA 3KLIA 1TK8A 3DLHA 1RT4A 4O0IA 4KTWA 4PWDA 2FBXA 2GBZA 2HVHA 3VQ9A 4ZHRA 1S6QA 1BI4B 4CJ3A 3OYIA 1A5XA 1RDAA 1ZBLA 3PO4A 3AVLA 4CEFA 5C25A 4CHQA 2DFEA 3AV9A 3V1QA 4HVJA 2F8SA 4W5OA 4HTUA 1U04A 4BE0A 4RG8A 1JLFA 1S1UA 1KVCA 4IFVA 1BISA 1VSHA 5CZ2A 3V1RA 4W5TA 4Z4GA 3NAEA 1C1CA 4F2SA 3V9UA 4G1QA 4DTXA 2RN2A 4HHTA 3VQ5A 1JLBA 1B9DA 1VSFA 1N5YA 3MEDA 1NK8A 4CEOA 2YNIA 1T03A 3LALA 2OYQA 1CXUA 1QHTA 2KW4A 2BDPA 4Z4EA 2KFNA 4OPKA 3VQPA 5FRMA 1RTJA 3V9WA 3TAPA 4DSJA 3VN5A 3CYMA 1RDDA 2RPIA 1NK7A 3I0SA 4HUGA 3HPGA 3LZIA 4HCBA 4KAZA 4N47A 3CM5A 3NF6A 4CEEA 4AHUA 3NDKA 3HM9A 3B6PA 1UOCA 3L3VA 1NJXA 4HCCA 4IG3A 1ZYQA 1KLMA 5SZTA 1VSLA 3VQ6A 3OYHA 5K14A 5J2PA 1BQMA 4N56A 3NH2A 3TR8A 4DSFA 4CGGA 3NHGA 1KLNA 1SV5A 4B08A 3OYBA 1L3UA 4M3UA 1U48A 1WSJA 3E01A 1YVUA 2G8FA 2JGUA 1SUQA 4OLBA 2X74A 2G8WA 3LP3A 3OYLA 1HNIA 5CZ1A 4J2EA 2ETJA 3P5JA 4IG0A 3D0PA 2FBTA 2IAJA 3KLHA 3IG1A 4CGFA 4Z4IA 3AA2A 4FM1A 1KVBA 4H4MA 3RRGA 3PUFA 4O0JA 4CJRA 3OYEA 4FLXA 1JL2A 2Y1IA 3AVJA 4QOZB 3VQAA 4DTMA 1D9FA 4Q0BA 1LWEA 4I7FA 4CJLA 4F4KA 3WNEA 3SI6A 3HXMA 4B9UA 4J2BA 4FYDA 3LAMA 1LW2A 2O4GA 3P83D 5DMRA 4KREA 3K58A 3S3MA 4E7JA 3SZ2A 1VSEA 1CZBA 5HRNA 4K8XA 3U3YA 3L8BA 1A5WA 1RNHA 3NE6A 3DM2A 2YKMA 1TL1A 3QINA 2O4IA 4CJQA 2RF2A 3DRPA 1X9WA 3RR7A 4M42A 4I2PA 3TABA 1EKEA 3O4QA 2G8VA 3U3GA 4B9NA 2KFZA 1SL1A 3T19A 3LP0A 3OYFA 4R5PA 1QS4A 1T05A 4W5RA 4FK0A 2QK9A 3FFIA 1NK4A 4JS4A 3SUOA 4CF2A 1U49A 1NK9A 3PX0A 1QE1A 4BDZA 2WONA 4CF9A 4CCHA 1WLJA 3AA3A 2XY5A 2GUIA 4JS5A 1TAQA 4E89A 4Z4CA 4RW6A 4Z4HA 2LSNA 1WSHA 2BE2A 3DYAA 3DOLA 4DF8A 1JLGA 1VSKA 4DSEA 1X1PA 4DLEA 4EZ9A 3HT3A 3QERA 4M3TA 1J54A 4CERA 2IC3A 1RTDA 3AA5X 4AHRA 2HW3A 4E1NA 3NBPA 3QEIA 4KHYA 2DTUA 4NYFA 3VQBA 2QKBA 3RMAA 3SJJA 2E4LA 3OYJA 4N5SA 4ELTA 3QNNA 3VQQA 1BCOA 4IDKA 1CXQA 3VQEA 4QCLA 1TL3A 4FM2A 3SQ0A 1GOAA 4DWIA 3SV3A 1BQNA 1YT3A 2XHBA 2BGGA 3TARA 4PA1A 1FK9A 2IGIA 1KVAA 3ZT2A 4CJPA 4E19A 1S5JA 1NOYA 1BCMA 1WAFA 3RTVA 4ZTJA 1T7PA 4B9MA 2OZMA 2YHBA 2KZZA 1TKDA 3I0RA 3SCXA 4IFYA 4AHSA 2P1JA 1KSPA 1WN7A 4CK3A 4FJHA 3QO9A 3L3UA 2Y1JA 3ZSQA 3V9SA 5J2NA 3MEEA 4W5NA 4E1MA 4BWJA 4PUOA 4CJTA 3RMDA 3AVAA 1NK5A 3HPHA 1Z26A 2JLEA 4M3YA 3M8PA 4KHSA 1K6YA 1LW0A 5CY4A 1TVRA 1XHZA 1W9HA 4ID1A 4ZTFA 1IKVA 4DFKA 3KTQA 3S3OA 4RW8A 3PV8A 1JLAA 1I39A 2YKNA 4K8ZA 4GMJB 1XWLA 3LP1A 3QETA 3QEPA 5T7BA 1UAXA 2ZE2A 4KHQA 3SPZA 3K2PA 1VRUA 4OKJA 1X9SA 4L8RB 4LSLA 4C8MA 3NH0A 1IKWA 1RBUA 3LWLA 2HMIA 3L2RA 3SPYA 1BI4A 3KD5E 2D0AA 4DU3A 4KFBA 3DI6A 4CIGA 1RTIA 4KKOA 4RW7A 4WE1A 3SQ1A 1KRPA 3O3FA 1F21A 4DS5A 1SKSA 4CEDA 2PZSA 1IKXA 1DTQA 5J2QA 4OLAA 2X6NA 1ZBFA 4I2QA 4QAGA 1VSIA 4B8CA 1BHLA 4CFCA 1T8EA 3OS0A 1C0MA 4PY5A 2XY8A 1UWBA 1DLOA 1RBSA 2P5GA 1FKPA 4FLUA 4F3TA 2HNYA 2Q3SA 3ZSVA 4CHNA 3NH1A 5CYQA 4FJ9A 4ELUA 1IG9A 3ZCMA 3ITHA 2B5JA 3C6TA 4CE9A 1JXEA 1TKTA 1X9MA 3ASMA 1B9FA 4FLTA 1HQUA 4DSLA 3EZ5A 5I42A 3OJSA 1VRTA 1A5VA 2ITGA 1JL1A 2HNZA 1WSGA 1VSMA 4Z0UA 1C1BA 5KGWA 2Z1IA 3WNGA 1ASVA 1TK5A 4CFDA 1QSYA 4DF4A 3KK1A 3IRXA 4DU4A 4CIEA 2G8IA 2QKKA 1J53A 3OJUA 3TAFA 5J1EA 1L3VA 4CHOA 1S1TA 4FJ7A 4OJRA 3K59A 1HYSA 3PY8A 4FW2A 2E6MA 3V9XA 1ITGA 4O44A 3M8RA 2WOMA 2G8HA 3OYCA 1D9DA 2X78A 3NGYA 3V1OA 1HQEA 3OS2A 4AILC 1L5UA 2DY4A 3RR8A 3RWUA 4DTUA 3LWMA 1RT6A 3P1GA 4YNQA 4JRQA 1UA1A 1GOBA 3D45A 2PYJA 4DFPA 1QQCA 1LV5A 1J5OA 4BACA 4AHVA 3NF8A 1RILA 2I5JA 1RBVA 2YNFA 3HO1A 4NCAA 1BIUA 4DQQA 4FZYA 4KI6A 4W5QA 2HHSA 4MFBA 1IO2A 3HVTA 4FZZA 4F3OA 1WNSA 3V9ZA 3MEGA 3AA4A 3IS9A 4RW4A 1SL0A 3TAQA 1ZBHA 1XC9A 1WSIA 4CFAA 4B3OA 1DTTA 4YFUA 3AO5A 2BANA 3JSMA 4HUFA 1JLEA 4BDYA 4BE1A 4C8LA 2KZMA 4OKEA 2EX3A 2HB5A 4NCGA 4B9TA 3K5OA 3PX6A 3O3GA 2A1RA 1XHXA 1NJYA 3B6OA 4FJJA 1QTMA 5C24A 3JYTA 2G8KA 4CF0A 2Z1HA 1YTUA 1KFDA 3LPTA 3KLGA 4LD0A 4CECA 4EP4A 3ZSRA 1N6QA 3DLGA 1C1AA 1RCHA 2HNDA 1IH7A 4B9VA 3SNNA 4KV8A 3RMCA 3CFOA 4CGIA 1NKBA 4FJXA 2HVIA 4AH9A 4LH5A 3QEXA 3WNFA 1RBTA 1SL2A 3CQ8A 4FLZA 3DRRA 5HRRA 2W42A 1HYVA 3PO5A 4BDPA 1RT5A 3O4NA 4JRPA 3H08A 4Y1DA 1RT2A 3TAMA 1D5AA 4AHCA 4CF8A 3K5MA 3QLHA 2OZSA 1RBRA 3HP9A 2VG5A 3MECA 4E0DA 4FJNA 4I9LA 3CFRA 5JS1A 1REVA 3QEVA 3I8DA 2R7YA 3NCIA 4FJ8A 3TANA 4KPYA 3T1AA 3OVNA 3SQ4A 2HHUA 3AVKA 1KCFA 3OYKA 3HVRA 2IOCA 4FVMA 4ID5A 2OPSA 5JS2A 1VSDA 4CEBA 3SQ2A 3THVA 3BGRA 3DLRA 1JXBA 4FJLA 4CESA 5HRPA 2IS3A 3ZT4A 2GV9A 4FM0A 4DTNA 2OA8A 4PQUA 3K5NA 1NJZA 2P5OA 2D0CA 4GVMA 3K57A 3U6FA 4KHWA 3VA3A 4ICLA 4NCBA 3MXMA 4C8KA 3KIOA 4CEAA 3HYFA 3AVBA 3K5LA 3OYGA 3CG7A 4CGHA 1BGXT 2Z1JA 3A2FA 4E7KA 3C95A 4OGEA 3AVIA 4CK2A 3SV4A 4KO0A 1YTAA 3LAKA 3QNOA 3DLBA 3WNHA 4B9LA 1O1WA 1W0HA 2D5RA 1S1VA 4CEQA 4CJ5A 4FCYA 3DOKA 2FC0A 5HP1A 2HHXA 4E3SA 1TKXA 2XY6A 1JLCA 1VK0A 5HBMA 4CHPA 4FLYA 2F8TA 2FBVA 4M41A 4CJUA 4B9SA 2VG6A 3AO1A 1LWCA 4RW9A 1KFSA 4LSNA 1EXQA 1HJRA 2E6LA 4OVLA 4FW1A 4F8RA 2OPQA 3VQDA 4FLWA 2ZD1A 3F9KA 4JLHA 3SUNA 1SKWA 4FJIA 3HK2A 1HPZA 1C0UA 3AVGA 5KTQA 2PY5A 5EU7A 3DLKA 4DSIA 3LP2A 4O5BA 4DTSA 3L2QA 3NFAA 4DS4A 3TAGA 1BIZA 4CGJA 5E41A 3ULDA 1TAUA 2EHGA 1S9GA 3ZT3A 4M3XA 3AVCA 3ZT0A 1VSJA 4CJKA 1EX4A 2VWJA 3DMJA 3S9HA 3VA0A 3HSTB 3ZSZA 4DG1A 3M8QA 2HHQA 1I3AA 1RTHA 4Z4FA 4CGDA 1C0TA 5FROA 5HLFA 3TAEA 4TSXA 5DK5A 3QESA 2VWKA 3DRSA 1NKEA 5KGXA 4C8OA 4DQRA 3LANA 4DTRA 2HHVA 1RDBA 3KLFA 3EYZA 3MXIA 3ZSOA 2YNGA 3C94A 3T3FA 1RT1A 3KLEA 3EY1A 3V4IA 3PX4A 1ZBIA 1RT3A 3MAQA 3L2VA 4DTPA 4B8AB 3KK3A 4KRFA 3M8SA 4GW6A 1WSEA 3QIPA 3CM6A 3G10A 4UQGA 4M45A 4Y1CA 3VQ7A 4KTQA 1WAJA 1NK0A 2RKIA 3ISNC 3VQ8A 5FRNA 3QIOA 4FXDA 2YNHA 3V81A 3AO3A 3MXJA 3HPOA 3AVHA 2DFHA 5HROA 4CJ4A 1XI1A 1U4BA 2G8UA 1S1XA 4I9QA 5HRSA 1RDCA 4CJWA 4CJFA 1TK0A 3HJFA 4O55A 4FJGA 4M3ZA 1EP4A 3OYAA 3BDPA 1TGOA 2YHAA 4FJKA 1EETA 2F96A 2XRIA 3G0ZA 3NF7A 4DFMA 1Q9XA 1ASWA 2YV0X 3AO2A 3LDSA 4FJ5A 3ALYA 3NF9A 1Q9YA 1Q8IA 1RT7A 1S6PA 1U47A 2KQ2A 4EZ6A 4M3RA 2OPRA 5SWMA 3SUPA 4CHYA 3KJVA 1LAWA 3OYNA 1S1WA 3F73A 3NGIA 3SYZA 5FDLA 4DTOA 3TI0A 4KB1A 5D3GA 1FXXA 3L2UA 1G15A 1J9AA 4OPJA 1L3TA 1FKOA 4OKKA 4O4GA 3KK2A 4NYNA 4C8NA 4AHTA 3L2WA 1L3SA 1CZ9A 4H8KA 1NKCA 2XY7A 4CJSA 4KB0A 1D8YA 4FK2A 2B6AA 4CK1A 3HP6A 1S9EA 3AVMA 2HHTA 5KI6A 3C6UA 4XIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5V A;  3O3H A;  1HRH A;  4IBN A;  4N76 A;  2A1S A;  3KKS A;  2ATQ A;  5CYM A;  4DQS A;  3OYM A;  2D0B A;  2VG7 A;  3SUQ A;  3AO4 A;  3IAY A;  4CJE A;  1HMV A;  1Y97 A;  4N41 A;  4LY7 A;  4LH4 A;  4OGC A;  3ZSY A;  5I3U A;  1ASU A;  5J2M A;  4CEZ A;  3V6D A;  4CHZ A;  1MU2 A;  4DFJ A;  1QSS A;  4DQP A;  3QEW A;  2Z1G A;  3VQC A;  4CJV A;  1LWF A;  1BL3 A;  2B4J A;  4KHU A;  2NUB A;  2OPP A;  2P51 A;  3RMB A;  2PYL A;  1WSF A;  1ZBU A;  3ZT1 A;  3KD1 E;  3NGZ A;  4DLG A;  1B92 A;  1Z25 A;  2FBY A;  2QXF A;  3AVF A;  1JLQ A;  3LPU A;  4CF1 A;  1GOC A;  1NJW A;  4J2A A;  4BWM A;  4DTJ A;  2DFF A;  1IKY A;  2X6S A;  5KRT A;  3RRH A;  1KTQ A;  1TV6 A;  4DSK A;  4DMN A;  1R0A A;  1HYZ A;  3VQ4 A;  5C42 A;  1LAV A;  4CIF A;  4E7I A;  3UIQ A;  4KTZ A;  4J2D A;  3S3N A;  2KTQ A;  1SKR A;  4H4O A;  1QSL A;  3AVN A;  2XO7 A;  3LZJ A;  3TWH A;  1JKH A;  1HNV A;  4KI4 A;  4MQ3 A;  2HHW A;  5KRS A;  1NOZ A;  4FLV A;  4ELV A;  2IDO A;  1UA0 A;  4IKF A;  1CLQ A;  1U45 A;  3DLE A;  3OS1 A;  4M3W A;  4BE2 A;  1NK6 A;  4DQI A;  4FK4 A;  3HL8 A;  4FJM A;  4CFB A;  1C6V A;  4KHN A;  3ZSW A;  3OY9 A;  3OYD A;  2AJQ A;  4FZX C;  3ZSX A;  4EP5 A;  3KKR A;  4E7L A;  4F2R A;  2ZQB A;  1TKZ A;  4DU1 A;  4HUE A;  3CFP A;  4E7H A;  3KLI A;  1TK8 A;  3DLH A;  1RT4 A;  4O0I A;  4KTW A;  4PWD A;  2FBX A;  2GBZ A;  2HVH A;  3VQ9 A;  4ZHR A;  1S6Q A;  1BI4 B;  4CJ3 A;  3OYI A;  1A5X A;  1RDA A;  1ZBL A;  3PO4 A;  3AVL A;  4CEF A;  5C25 A;  4CHQ A;  2DFE A;  3AV9 A;  3V1Q A;  4HVJ A;  2F8S A;  4W5O A;  4HTU A;  1U04 A;  4BE0 A;  4RG8 A;  1JLF A;  1S1U A;  1KVC A;  4IFV A;  1BIS A;  1VSH A;  5CZ2 A;  3V1R A;  4W5T A;  4Z4G A;  3NAE A;  1C1C A;  4F2S A;  3V9U A;  4G1Q A;  4DTX A;  2RN2 A;  4HHT A;  3VQ5 A;  1JLB A;  1B9D A;  1VSF A;  1N5Y A;  3MED A;  1NK8 A;  4CEO A;  2YNI A;  1T03 A;  3LAL A;  2OYQ A;  1CXU A;  1QHT A;  2KW4 A;  2BDP A;  4Z4E A;  2KFN A;  4OPK A;  3VQP A;  5FRM A;  1RTJ A;  3V9W A;  3TAP A;  4DSJ A;  3VN5 A;  3CYM A;  1RDD A;  2RPI A;  1NK7 A;  3I0S A;  4HUG A;  3HPG A;  3LZI A;  4HCB A;  4KAZ A;  4N47 A;  3CM5 A;  3NF6 A;  4CEE A;  4AHU A;  3NDK A;  3HM9 A;  3B6P A;  1UOC A;  3L3V A;  1NJX A;  4HCC A;  4IG3 A;  1ZYQ A;  1KLM A;  5SZT A;  1VSL A;  3VQ6 A;  3OYH A;  5K14 A;  5J2P A;  1BQM A;  4N56 A;  3NH2 A;  3TR8 A;  4DSF A;  4CGG A;  3NHG A;  1KLN A;  1SV5 A;  4B08 A;  3OYB A;  1L3U A;  4M3U A;  1U48 A;  1WSJ A;  3E01 A;  1YVU A;  2G8F A;  2JGU A;  1SUQ A;  4OLB A;  2X74 A;  2G8W A;  3LP3 A;  3OYL A;  1HNI A;  5CZ1 A;  4J2E A;  2ETJ A;  3P5J A;  4IG0 A;  3D0P A;  2FBT A;  2IAJ A;  3KLH A;  3IG1 A;  4CGF A;  4Z4I A;  3AA2 A;  4FM1 A;  1KVB A;  4H4M A;  3RRG A;  3PUF A;  4O0J A;  4CJR A;  3OYE A;  4FLX A;  1JL2 A;  2Y1I A;  3AVJ A;  4QOZ B;  3VQA A;  4DTM A;  1D9F A;  4Q0B A;  1LWE A;  4I7F A;  4CJL A;  4F4K A;  3WNE A;  3SI6 A;  3HXM A;  4B9U A;  4J2B A;  4FYD A;  3LAM A;  1LW2 A;  2O4G A;  3P83 D;  5DMR A;  4KRE A;  3K58 A;  3S3M A;  4E7J A;  3SZ2 A;  1VSE A;  1CZB A;  5HRN A;  4K8X A;  3U3Y A;  3L8B A;  1A5W A;  1RNH A;  3NE6 A;  3DM2 A;  2YKM A;  1TL1 A;  3QIN A;  2O4I A;  4CJQ A;  2RF2 A;  3DRP A;  1X9W A;  3RR7 A;  4M42 A;  4I2P A;  3TAB A;  1EKE A;  3O4Q A;  2G8V A;  3U3G A;  4B9N A;  2KFZ A;  1SL1 A;  3T19 A;  3LP0 A;  3OYF A;  4R5P A;  1QS4 A;  1T05 A;  4W5R A;  4FK0 A;  2QK9 A;  3FFI A;  1NK4 A;  4JS4 A;  3SUO A;  4CF2 A;  1U49 A;  1NK9 A;  3PX0 A;  1QE1 A;  4BDZ A;  2WON A;  4CF9 A;  4CCH A;  1WLJ A;  3AA3 A;  2XY5 A;  2GUI A;  4JS5 A;  1TAQ A;  4E89 A;  4Z4C A;  4RW6 A;  4Z4H A;  2LSN A;  1WSH A;  2BE2 A;  3DYA A;  3DOL A;  4DF8 A;  1JLG A;  1VSK A;  4DSE A;  1X1P A;  4DLE A;  4EZ9 A;  3HT3 A;  3QER A;  4M3T A;  1J54 A;  4CER A;  2IC3 A;  1RTD A;  3AA5 X;  4AHR A;  2HW3 A;  4E1N A;  3NBP A;  3QEI A;  4KHY A;  2DTU A;  4NYF A;  3VQB A;  2QKB A;  3RMA A;  3SJJ A;  2E4L A;  3OYJ A;  4N5S A;  4ELT A;  3QNN A;  3VQQ A;  1BCO A;  4IDK A;  1CXQ A;  3VQE A;  4QCL A;  1TL3 A;  4FM2 A;  3SQ0 A;  1GOA A;  4DWI A;  3SV3 A;  1BQN A;  1YT3 A;  2XHB A;  2BGG A;  3TAR A;  4PA1 A;  1FK9 A;  2IGI A;  1KVA A;  3ZT2 A;  4CJP A;  4E19 A;  1S5J A;  1NOY A;  1BCM A;  1WAF A;  3RTV A;  4ZTJ A;  1T7P A;  4B9M A;  2OZM A;  2YHB A;  2KZZ A;  1TKD A;  3I0R A;  3SCX A;  4IFY A;  4AHS A;  2P1J A;  1KSP A;  1WN7 A;  4CK3 A;  4FJH A;  3QO9 A;  3L3U A;  2Y1J A;  3ZSQ A;  3V9S A;  5J2N A;  3MEE A;  4W5N A;  4E1M A;  4BWJ A;  4PUO A;  4CJT A;  3RMD A;  3AVA A;  1NK5 A;  3HPH A;  1Z26 A;  2JLE A;  4M3Y A;  3M8P A;  4KHS A;  1K6Y A;  1LW0 A;  5CY4 A;  1TVR A;  1XHZ A;  1W9H A;  4ID1 A;  4ZTF A;  1IKV A;  4DFK A;  3KTQ A;  3S3O A;  4RW8 A;  3PV8 A;  1JLA A;  1I39 A;  2YKN A;  4K8Z A;  4GMJ B;  1XWL A;  3LP1 A;  3QET A;  3QEP A;  5T7B A;  1UAX A;  2ZE2 A;  4KHQ A;  3SPZ A;  3K2P A;  1VRU A;  4OKJ A;  1X9S A;  4L8R B;  4LSL A;  4C8M A;  3NH0 A;  1IKW A;  1RBU A;  3LWL A;  2HMI A;  3L2R A;  3SPY A;  1BI4 A;  3KD5 E;  2D0A A;  4DU3 A;  4KFB A;  3DI6 A;  4CIG A;  1RTI A;  4KKO A;  4RW7 A;  4WE1 A;  3SQ1 A;  1KRP A;  3O3F A;  1F21 A;  4DS5 A;  1SKS A;  4CED A;  2PZS A;  1IKX A;  1DTQ A;  5J2Q A;  4OLA A;  2X6N A;  1ZBF A;  4I2Q A;  4QAG A;  1VSI A;  4B8C A;  1BHL A;  4CFC A;  1T8E A;  3OS0 A;  1C0M A;  4PY5 A;  2XY8 A;  1UWB A;  1DLO A;  1RBS A;  2P5G A;  1FKP A;  4FLU A;  4F3T A;  2HNY A;  2Q3S A;  3ZSV A;  4CHN A;  3NH1 A;  5CYQ A;  4FJ9 A;  4ELU A;  1IG9 A;  3ZCM A;  3ITH A;  2B5J A;  3C6T A;  4CE9 A;  1JXE A;  1TKT A;  1X9M A;  3ASM A;  1B9F A;  4FLT A;  1HQU A;  4DSL A;  3EZ5 A;  5I42 A;  3OJS A;  1VRT A;  1A5V A;  2ITG A;  1JL1 A;  2HNZ A;  1WSG A;  1VSM A;  4Z0U A;  1C1B A;  5KGW A;  2Z1I A;  3WNG A;  1ASV A;  1TK5 A;  4CFD A;  1QSY A;  4DF4 A;  3KK1 A;  3IRX A;  4DU4 A;  4CIE A;  2G8I A;  2QKK A;  1J53 A;  3OJU A;  3TAF A;  5J1E A;  1L3V A;  4CHO A;  1S1T A;  4FJ7 A;  4OJR A;  3K59 A;  1HYS A;  3PY8 A;  4FW2 A;  2E6M A;  3V9X A;  1ITG A;  4O44 A;  3M8R A;  2WOM A;  2G8H A;  3OYC A;  1D9D A;  2X78 A;  3NGY A;  3V1O A;  1HQE A;  3OS2 A;  4AIL C;  1L5U A;  2DY4 A;  3RR8 A;  3RWU A;  4DTU A;  3LWM A;  1RT6 A;  3P1G A;  4YNQ A;  4JRQ A;  1UA1 A;  1GOB A;  3D45 A;  2PYJ A;  4DFP A;  1QQC A;  1LV5 A;  1J5O A;  4BAC A;  4AHV A;  3NF8 A;  1RIL A;  2I5J A;  1RBV A;  2YNF A;  3HO1 A;  4NCA A;  1BIU A;  4DQQ A;  4FZY A;  4KI6 A;  4W5Q A;  2HHS A;  4MFB A;  1IO2 A;  3HVT A;  4FZZ A;  4F3O A;  1WNS A;  3V9Z A;  3MEG A;  3AA4 A;  3IS9 A;  4RW4 A;  1SL0 A;  3TAQ A;  1ZBH A;  1XC9 A;  1WSI A;  4CFA A;  4B3O A;  1DTT A;  4YFU A;  3AO5 A;  2BAN A;  3JSM A;  4HUF A;  1JLE A;  4BDY A;  4BE1 A;  4C8L A;  2KZM A;  4OKE A;  2EX3 A;  2HB5 A;  4NCG A;  4B9T A;  3K5O A;  3PX6 A;  3O3G A;  2A1R A;  1XHX A;  1NJY A;  3B6O A;  4FJJ A;  1QTM A;  5C24 A;  3JYT A;  2G8K A;  4CF0 A;  2Z1H A;  1YTU A;  1KFD A;  3LPT A;  3KLG A;  4LD0 A;  4CEC A;  4EP4 A;  3ZSR A;  1N6Q A;  3DLG A;  1C1A A;  1RCH A;  2HND A;  1IH7 A;  4B9V A;  3SNN A;  4KV8 A;  3RMC A;  3CFO A;  4CGI A;  1NKB A;  4FJX A;  2HVI A;  4AH9 A;  4LH5 A;  3QEX A;  3WNF A;  1RBT A;  1SL2 A;  3CQ8 A;  4FLZ A;  3DRR A;  5HRR A;  2W42 A;  1HYV A;  3PO5 A;  4BDP A;  1RT5 A;  3O4N A;  4JRP A;  3H08 A;  4Y1D A;  1RT2 A;  3TAM A;  1D5A A;  4AHC A;  4CF8 A;  3K5M A;  3QLH A;  2OZS A;  1RBR A;  3HP9 A;  2VG5 A;  3MEC A;  4E0D A;  4FJN A;  4I9L A;  3CFR A;  5JS1 A;  1REV A;  3QEV A;  3I8D A;  2R7Y A;  3NCI A;  4FJ8 A;  3TAN A;  4KPY A;  3T1A A;  3OVN A;  3SQ4 A;  2HHU A;  3AVK A;  1KCF A;  3OYK A;  3HVR A;  2IOC A;  4FVM A;  4ID5 A;  2OPS A;  5JS2 A;  1VSD A;  4CEB A;  3SQ2 A;  3THV A;  3BGR A;  3DLR A;  1JXB A;  4FJL A;  4CES A;  5HRP A;  2IS3 A;  3ZT4 A;  2GV9 A;  4FM0 A;  4DTN A;  2OA8 A;  4PQU A;  3K5N A;  1NJZ A;  2P5O A;  2D0C A;  4GVM A;  3K57 A;  3U6F A;  4KHW A;  3VA3 A;  4ICL A;  4NCB A;  3MXM A;  4C8K A;  3KIO A;  4CEA A;  3HYF A;  3AVB A;  3K5L A;  3OYG A;  3CG7 A;  4CGH A;  1BGX T;  2Z1J A;  3A2F A;  4E7K A;  3C95 A;  4OGE A;  3AVI A;  4CK2 A;  3SV4 A;  4KO0 A;  1YTA A;  3LAK A;  3QNO A;  3DLB A;  3WNH A;  4B9L A;  1O1W A;  1W0H A;  2D5R A;  1S1V A;  4CEQ A;  4CJ5 A;  4FCY A;  3DOK A;  2FC0 A;  5HP1 A;  2HHX A;  4E3S A;  1TKX A;  2XY6 A;  1JLC A;  1VK0 A;  5HBM A;  4CHP A;  4FLY A;  2F8T A;  2FBV A;  4M41 A;  4CJU A;  4B9S A;  2VG6 A;  3AO1 A;  1LWC A;  4RW9 A;  1KFS A;  4LSN A;  1EXQ A;  1HJR A;  2E6L A;  4OVL A;  4FW1 A;  4F8R A;  2OPQ A;  3VQD A;  4FLW A;  2ZD1 A;  3F9K A;  4JLH A;  3SUN A;  1SKW A;  4FJI A;  3HK2 A;  1HPZ A;  1C0U A;  3AVG A;  5KTQ A;  2PY5 A;  5EU7 A;  3DLK A;  4DSI A;  3LP2 A;  4O5B A;  4DTS A;  3L2Q A;  3NFA A;  4DS4 A;  3TAG A;  1BIZ A;  4CGJ A;  5E41 A;  3ULD A;  1TAU A;  2EHG A;  1S9G A;  3ZT3 A;  4M3X A;  3AVC A;  3ZT0 A;  1VSJ A;  4CJK A;  1EX4 A;  2VWJ A;  3DMJ A;  3S9H A;  3VA0 A;  3HST B;  3ZSZ A;  4DG1 A;  3M8Q A;  2HHQ A;  1I3A A;  1RTH A;  4Z4F A;  4CGD A;  1C0T A;  5FRO A;  5HLF A;  3TAE A;  4TSX A;  5DK5 A;  3QES A;  2VWK A;  3DRS A;  1NKE A;  5KGX A;  4C8O A;  4DQR A;  3LAN A;  4DTR A;  2HHV A;  1RDB A;  3KLF A;  3EYZ A;  3MXI A;  3ZSO A;  2YNG A;  3C94 A;  3T3F A;  1RT1 A;  3KLE A;  3EY1 A;  3V4I A;  3PX4 A;  1ZBI A;  1RT3 A;  3MAQ A;  3L2V A;  4DTP A;  4B8A B;  3KK3 A;  4KRF A;  3M8S A;  4GW6 A;  1WSE A;  3QIP A;  3CM6 A;  3G10 A;  4UQG A;  4M45 A;  4Y1C A;  3VQ7 A;  4KTQ A;  1WAJ A;  1NK0 A;  2RKI A;  3ISN C;  3VQ8 A;  5FRN A;  3QIO A;  4FXD A;  2YNH A;  3V81 A;  3AO3 A;  3MXJ A;  3HPO A;  3AVH A;  2DFH A;  5HRO A;  4CJ4 A;  1XI1 A;  1U4B A;  2G8U A;  1S1X A;  4I9Q A;  5HRS A;  1RDC A;  4CJW A;  4CJF A;  1TK0 A;  3HJF A;  4O55 A;  4FJG A;  4M3Z A;  1EP4 A;  3OYA A;  3BDP A;  1TGO A;  2YHA A;  4FJK A;  1EET A;  2F96 A;  2XRI A;  3G0Z A;  3NF7 A;  4DFM A;  1Q9X A;  1ASW A;  2YV0 X;  3AO2 A;  3LDS A;  4FJ5 A;  3ALY A;  3NF9 A;  1Q9Y A;  1Q8I A;  1RT7 A;  1S6P A;  1U47 A;  2KQ2 A;  4EZ6 A;  4M3R A;  2OPR A;  5SWM A;  3SUP A;  4CHY A;  3KJV A;  1LAW A;  3OYN A;  1S1W A;  3F73 A;  3NGI A;  3SYZ A;  5FDL A;  4DTO A;  3TI0 A;  4KB1 A;  5D3G A;  1FXX A;  3L2U A;  1G15 A;  1J9A A;  4OPJ A;  1L3T A;  1FKO A;  4OKK A;  4O4G A;  3KK2 A;  4NYN A;  4C8N A;  4AHT A;  3L2W A;  1L3S A;  1CZ9 A;  4H8K A;  1NKC A;  2XY7 A;  4CJS A;  4KB0 A;  1D8Y A;  4FK2 A;  2B6A A;  4CK1 A;  3HP6 A;  1S9E A;  3AVM A;  2HHT A;  5KI6 A;  3C6U A;  4XIU A; 
#chains in the Genus database with same CATH topology
 4BGA A;  2ZWH A;  5CYM A;  1ATS A;  3OYM A;  3D2E B;  3VGK A;  4NB4 A;  3IAY A;  4CJE A;  1HMV A;  3ZSY A;  1Q81 O;  2V7Z A;  4CHZ A;  4DQP A;  2Z1G A;  1BL3 A;  2NUB A;  2P51 A;  3RMB A;  1WSF A;  1ZBU A;  4GV6 A;  4PKI A;  3NGZ A;  2ZGZ A;  4WFA L;  1Z25 A;  1GOC A;  5MLC Q;  3D2F A;  3BZK A;  4DSK A;  1WOQ A;  4DMN A;  3UKR A;  1R0A A;  2VGN A;  4CIF A;  4E7I A;  4X65 K;  2A6A A;  4FPA A;  2ZJR L;  3AVN A;  4WQ5 C;  1XMO K;  3LM9 A;  1NG9 A;  2UU9 K;  5AQW A;  2WBN A;  5KRS A;  1CLQ A;  3O9Q A;  3BZC A;  3JS6 A;  3OS1 A;  4IOC L;  4M3W A;  1NK6 A;  2W41 A;  3HL8 A;  1WUA A;  1C6V A;  3ZSW A;  3OY9 A;  1JJ2 M;  4UY8 O;  4PKH A;  4HUE A;  3A5N C;  4ZHR A;  1NGC A;  3QIC A;  4CJ3 A;  3R3L A;  1RDA A;  3AVL A;  5C25 A;  3I55 N;  4HVJ A;  4BC4 A;  3FZK A;  4IFV A;  4BR2 A;  1BIS A;  5EY4 A;  1XNR K;  4G1Q A;  1JLB A;  1B9D A;  1VSF A;  3MED A;  2OYQ A;  3ENB A;  2BDP A;  2KFN A;  3A5O C;  4ISE A;  3TAP A;  3SJH A;  3ZEU A;  4DSJ A;  4ILH A;  4HUG A;  3CM5 A;  4CEE A;  5FPN A;  3HM9 A;  2HBJ A;  2EWS A;  4H5N A;  1VSL A;  3LDL A;  1VHX A;  3NH2 A;  3TR8 A;  4DSF A;  4JI0 K;  3OBW A;  3NHG A;  1KLN A;  1L3U A;  3CJ7 A;  4LF8 K;  3OYL A;  1HNX K;  3P5J A;  2FBT A;  1KVB A;  5LMU K;  2F9T A;  4FLX A;  1JL2 A;  2Y1I A;  4L3Q A;  2NRX A;  3K0S A;  3VQA A;  4Q0B A;  1Y64 A;  4WQ4 C;  1S72 N;  2ZGY A;  4B1X B;  3SI6 A;  4EHU A;  4CZJ A;  4JI5 K;  2O4G A;  5DMR A;  4E7J A;  3SZ2 A;  2Q31 A;  3W3D A;  1CZB A;  4FWL A;  3DM2 A;  2RF2 A;  4M42 A;  1EKE A;  2G8V A;  3MCP A;  4JK8 A;  4R5P A;  3U4L A;  4W5R A;  2PFU A;  4J8F A;  2GWK A;  3FFI A;  1NK4 A;  4DCH A;  5GAH P;  1U49 A;  1NK9 A;  2QXL A;  4BDZ A;  4CZE A;  1YJN N;  3N4Q A;  2XY5 A;  3EKS A;  2GUI A;  3QET A;  1HYS A;  2LSN A;  2BE2 A;  3DOL A;  4EFH A;  3AA5 X;  4AHR A;  2P9K A;  3CJA A;  4A2A A;  3VQB A;  3K9K A;  3RMA A;  1J6Z A;  3KVG A;  3OYJ A;  4ILJ A;  3QNN A;  3VQQ A;  2WFB A;  3VQE A;  3FZL A;  4NLC A;  4BR9 A;  1TL3 A;  4FM2 A;  3RSE B;  1BQN A;  1NOY A;  4CJP A;  3ID6 A;  2YHB A;  1GLC G;  2FLO A;  5C15 A;  1Q7Y O;  2P1J A;  5GIP A;  3JAM O;  3L3U A;  2JWK A;  2Q2R A;  2P9P B;  4BRO A;  4H0O A;  3RMD A;  3AVA A;  3DXK A;  3M8P A;  4KHS A;  4KHP K;  4CBW A;  3SK3 A;  1I39 A;  4CZK A;  4FL9 A;  1D4X A;  2ZE2 A;  1X9S A;  4LSL A;  4C8M A;  1N8R O;  2HMI A;  3L2R A;  3CC7 N;  3KHY A;  5AR0 A;  3KD5 E;  4DU3 A;  4CIG A;  1RTI A;  2ASO A;  3B8A X;  3J7Z O;  3THW B;  1SKS A;  1IKX A;  4JI3 K;  3K9J A;  3H6E A;  2X6N A;  4B8C A;  1T8E A;  3OS0 A;  4PY5 A;  4U67 L;  1J5E K;  1DLO A;  4F3T A;  2HNY A;  4CHN A;  5LJW A;  3VMF B;  1IG9 A;  3GE1 A;  1X9M A;  1XMQ K;  3WT0 A;  3R1X A;  5I42 A;  4IOA L;  1WBD A;  4ISF A;  2HNZ A;  3THX A;  5KGW A;  4CFD A;  1QSY A;  2NZT A;  3IRX A;  3G71 N;  4DU4 A;  2WUS A;  1J53 A;  1Q18 A;  3TAF A;  3BY5 A;  4CHO A;  1S1T A;  3DLL L;  3PY8 A;  4EAH D;  3V9X A;  4QS7 A;  2WOM A;  5BN9 A;  4AIL C;  2QWQ A;  1S22 A;  4B1Y B;  4CD1 A;  2O8D A;  3P1G A;  4YNQ A;  2VQE K;  2I7N A;  3PIP L;  5AFU A;  1QQC A;  3O8M A;  1QZ6 A;  1RIL A;  3DAW A;  4FWK A;  4H03 B;  1RBV A;  1WB9 A;  1HKC A;  1HKG A;  4KI6 A;  3HVT A;  4JKG B;  3V9Z A;  2GUP A;  4RW4 A;  3TAQ A;  1ZBH A;  1XC9 A;  4DV4 K;  4B3O A;  4BE1 A;  4U7B A;  1JLE A;  4BDY A;  2EX3 A;  3D2E A;  3O3G A;  1NJY A;  4FJJ A;  1VQN N;  4CF0 A;  2Z1H A;  3E1Y A;  2VWB A;  2A42 A;  2F4V K;  1OH7 A;  3ZSR A;  3DLG A;  1BWF O;  1RCH A;  3I56 N;  3U9Z A;  3QEX A;  1SL2 A;  4LF6 K;  4FLZ A;  5EXW A;  4FK2 A;  4CZM A;  1HYV A;  3L4Q A;  4AHC A;  3VPZ A;  1D5A A;  5AQO A;  1RBR A;  1VQM N;  4E0D A;  2ZJP L;  1GLE G;  4I9L A;  3CFR A;  3CMA N;  4XH1 A;  4A59 A;  3T1A A;  3CCU N;  3U8X A;  3BGR A;  3DLR A;  5BRH A;  4B1Z A;  3L4I A;  5KPZ A;  3K5N A;  2P5O A;  3U6F A;  3SBT A;  5GAG P;  3K57 A;  4YOW A;  1C0G A;  4KH6 A;  3KIO A;  2QI2 A;  3QNO A;  3C95 A;  4HCC A;  3CJC A;  4KO0 A;  3DLB A;  4B9L A;  1W0H A;  5HP1 A;  4DV3 K;  1TKX A;  1JLC A;  5HBM A;  4FLY A;  2CH5 A;  4H0V B;  4CJU A;  4B9S A;  4DR2 K;  2VG6 A;  4OVL A;  4FLW A;  3HK2 A;  1C0U A;  5EU7 A;  3HM8 A;  3DLK A;  3LP2 A;  4O5B A;  4BR0 A;  5E41 A;  4CJ7 A;  3AVC A;  2VWJ A;  1EX4 A;  3S9H A;  3ZSZ A;  4Z4F A;  3P38 A;  4O8K A;  5AQS A;  3QES A;  3VGL A;  2VWK A;  1NKE A;  2E1Z A;  3LAN A;  4DTR A;  5F1X A;  3KLF A;  1NMD A;  3EO3 A;  3LDN A;  5BPM A;  2NRV A;  3O6W A;  3L2V A;  1W2B M;  4O8U A;  4FOE A;  1OKJ A;  1YXQ A;  4B8A B;  1ZC6 A;  4FOI A;  1YF5 L;  3VQ7 A;  5FRN A;  2NRW A;  4FXD A;  2YNH A;  3ZX0 A;  5C12 A;  4BR5 A;  3P39 A;  3QFP A;  3FR0 A;  4H5T A;  3VEZ A;  4I9Q A;  4M63 C;  4CJF A;  5F0X A;  4FJG A;  2ASP A;  4BC2 A;  2YHA A;  4FJK A;  4B3R K;  3AO2 A;  5FPE A;  4JI6 K;  1MDU B;  3ENH A;  1S6P A;  2OPR A;  3KJV A;  1E3M A;  2E1Y A;  1S1W A;  3SYZ A;  3WXJ A;  4DTO A;  3F9M A;  3L2U A;  4DR4 K;  1RGI A;  4O4G A;  4AHT A;  3L2W A;  5BRE A;  3H1V X;  2XY7 A;  4KB0 A;  4CK1 A;  4PA1 A;  1SL0 A;  2ZM6 K;  4MLH A;  1HRH A;  4N76 A;  2A1S A;  2ATQ A;  3EZW A;  4H5W A;  4B1V A;  1ZXO A;  3AO4 A;  2P9K B;  3TTF A;  1Y97 A;  4LY7 A;  1ASU A;  3V6D A;  1KC8 O;  2FSJ A;  1QHA A;  4LFC K;  3CCE N;  2B4J A;  3PSI A;  4B1W B;  2OPP A;  4YHH K;  2PYL A;  3ZT1 A;  3O9S A;  3RSE A;  4QS9 A;  3MMV A;  3CCR N;  1VQ9 N;  1JLQ A;  2Q0U A;  4CF1 A;  4J2A A;  3O9U A;  1IKY A;  2X6S A;  3Q7B A;  5KRT A;  3RRH A;  1KTQ A;  1TV6 A;  1K8K A;  1JCF A;  3VQ4 A;  5C42 A;  5E84 A;  1SKR A;  1QSL A;  3UB5 A;  1OVQ A;  3DXK B;  3QFU A;  4MQ3 A;  3HOT A;  3MN6 A;  2HHW A;  4ELV A;  4IKF A;  4DR7 K;  1U45 A;  3DLE A;  4DQI A;  1HUX A;  2NLX A;  4CFB A;  3FZH A;  3VF2 A;  3I8B A;  3VOV A;  3WXK A;  3OYD A;  4JD2 A;  3ZSX A;  4MDA A;  3EN9 A;  4DU1 A;  1TKZ A;  4BRP A;  1TK8 A;  4BR4 A;  3DLH A;  4O0I A;  4C23 A;  4CEF A;  4CHQ A;  2DFE A;  3V1Q A;  3L6Q A;  3THW A;  4RG8 A;  1S1U A;  3EKU A;  1VSH A;  4Z4G A;  3C6A A;  2KHO A;  4HHT A;  3VQ5 A;  5F2R A;  3ZET B;  1NK8 A;  2YNI A;  3LAL A;  1CXU A;  5FRM A;  3VQP A;  3ZLJ A;  3G25 A;  1YHQ N;  3CYM A;  3T1Y K;  3I0S A;  3HPG A;  2OAN A;  3G6E N;  3O80 A;  3NF6 A;  3NDK A;  3L3V A;  1FW6 A;  1NJX A;  2D1K A;  1ZYQ A;  1KLM A;  3QB0 A;  3THX B;  5JLF A;  3AGR A;  4CGG A;  3HRG A;  3OYB A;  1U48 A;  1WSJ A;  1YVU A;  2JGU A;  2X74 A;  1ATR A;  1TYQ B;  1T6D A;  3J7Y P;  1HNI A;  2ETJ A;  3D0P A;  3LL3 A;  4IG0 A;  5AQG A;  2IAJ A;  3CER A;  3IG1 A;  4CGF A;  4A57 A;  3RRG A;  4O0J A;  3AVJ A;  1D9F A;  4DKW A;  4B9U A;  4J2B A;  4FYD A;  1LW2 A;  3P83 D;  1VSE A;  1A5W A;  5IT9 O;  3DRP A;  4A61 A;  3O4Q A;  5AQM A;  3T19 A;  3GOI A;  3LP0 A;  3VER A;  3OYF A;  3DJC A;  2UUB K;  4FK0 A;  3NVM A;  3SUO A;  3LM2 A;  1QE1 A;  4CCH A;  1WLJ A;  1DT9 A;  3MDQ A;  5BN8 A;  4JS5 A;  4OO1 J;  4DQ8 A;  1UA1 A;  4WCE L;  4DF8 A;  3CIP A;  4DLE A;  2IC3 A;  1M1K O;  1YAG A;  3QEI A;  2QKB A;  5BRF A;  3A5L C;  2E4L A;  4IEE A;  4IDK A;  1CXQ A;  1X3M A;  3SQ0 A;  1GOA A;  4DWI A;  5M1P A;  3MWP A;  3SV3 A;  3ZT2 A;  3ZYY X;  4E19 A;  1S5J A;  2OZM A;  1WAF A;  4ZTJ A;  4LFA K;  4FWS A;  3I0R A;  4AHS A;  4HTL A;  5LY3 A;  1KSP A;  3IKM A;  5KQ8 A;  3VES A;  4W5N A;  5J2N A;  3MEE A;  4BWJ A;  2E2Q A;  4DV6 K;  3HPH A;  3A0I X;  3MWT A;  1NGA A;  1TVR A;  3O08 A;  4ID1 A;  1IKV A;  3Q7C A;  3S3O A;  4RWT A;  4CW7 B;  3PV8 A;  1JLA A;  3LP1 A;  1YUW A;  5C10 A;  1N32 K;  4PL7 A;  4KHQ A;  3K2P A;  1VRU A;  4KBO A;  3NH0 A;  4PKG A;  3SPY A;  1BI4 A;  1NLV A;  3DI6 A;  3F5T A;  4DS5 A;  4CED A;  4YOT A;  1ZBS A;  4CFC A;  4CZH A;  1C0M A;  1X9J A;  1UWB A;  2P5G A;  3VF6 A;  4FLU A;  4K25 A;  3ZSV A;  5CYQ A;  4ELU A;  3ZCM A;  2B5J A;  3OTO K;  4GV3 A;  1JCE A;  1TKT A;  3WEE B;  3DXM A;  4FLT A;  1HQU A;  5H1S Q;  1VRT A;  2Q97 A;  3CJB A;  2ITG A;  4Z0U A;  5AQH A;  4FWQ A;  1ASV A;  4LF5 K;  2A41 A;  2JWL A;  4JAX A;  4CIE A;  1GLF O;  5J1E A;  3PIO L;  2IIR A;  1GLB G;  1V4T A;  3KWG A;  2D0P A;  4K41 A;  3GDQ A;  5EOY A;  4O44 A;  2G8H A;  1D9D A;  3VEW A;  2X78 A;  1HQE A;  3OS2 A;  1L5U A;  3RR8 A;  3TTD A;  4RCH A;  4H0Y B;  4M7Y A;  3VTI A;  3H3N O;  3D45 A;  3QDK A;  4DFP A;  1J5O A;  3S41 A;  5JVH L;  3HO1 A;  1BIU A;  4FZY A;  4W5Q A;  2V7Y A;  2HHS A;  4MFB A;  1IO2 A;  4FZZ A;  2F7T A;  1WNS A;  3LDP A;  4FO0 A;  4CFA A;  1DTT A;  5AQY A;  2BAN A;  3L0Q A;  4JKC A;  4C8L A;  4OKE A;  1KQS M;  4YOR A;  4DUZ K;  3PX6 A;  3EEQ A;  2G8K A;  3M6G A;  3LPT A;  2QEX N;  2HND A;  4KV8 A;  1NKB A;  2HVI A;  4LH5 A;  4PHT X;  5AQI A;  3PO5 A;  4BDP A;  4KTQ A;  1K8K B;  4B3T K;  4GY2 B;  3HP9 A;  3MEC A;  1QQM A;  1P90 A;  3SQ4 A;  3OYK A;  1KCF A;  4ID5 A;  1ILY A;  1VSD A;  4BRC A;  3WUH A;  4K0K K;  1JXB A;  2NNW A;  4FJL A;  2E20 A;  2YI1 A;  4FM0 A;  4JD2 B;  5FLX O;  3M3Z A;  4KHW A;  3VA3 A;  1VQ5 N;  3MXM A;  3ZX3 A;  3OYG A;  1DEJ A;  4B9Q A;  3CPE A;  4CGH A;  5M1F A;  4CK2 A;  2GTD A;  3LAK A;  4CEQ A;  1S1V A;  2HHX A;  4CJ5 A;  4FCY A;  2HBL A;  4CHP A;  3CCS N;  3QML A;  4QS8 A;  1IBM K;  3AO1 A;  1HJR A;  3BP8 A;  1DGK N;  2OPQ A;  3VQD A;  3SUN A;  2QWR A;  1VAZ A;  1SKW A;  3AVG A;  3ZET A;  5KTQ A;  2PY5 A;  4OX9 K;  4DTS A;  2VYP A;  3AAR A;  4DS4 A;  1TAU A;  3ZT0 A;  5C2D A;  3DMJ A;  4DG1 A;  1H1V A;  1C0T A;  2HHV A;  3DRS A;  5KPT A;  5KGX A;  4DQR A;  1RDB A;  3BF3 A;  3MCA B;  4JK7 A;  2IVP A;  3C94 A;  3PX4 A;  3T3F A;  4MO5 A;  3ATV A;  1NJI O;  1TYQ A;  3HSC A;  3M8S A;  4B1U B;  3O1W A;  3QIP A;  1NGH A;  1WAJ A;  3TSU A;  2VCP A;  2ITM A;  5AQR A;  5AQT A;  4BRH A;  1YI2 N;  3V81 A;  2DFH A;  1XI1 A;  1S1X A;  5HRS A;  4CJW A;  2W6L A;  5DM6 L;  1NU0 A;  4M3Z A;  3BDP A;  1GLD G;  3G0Z A;  1ASW A;  4FJ5 A;  1Q8I A;  2QA4 N;  4GV9 A;  4EZ6 A;  4CZF A;  1YIT N;  2V51 B;  4LF4 K;  1LAW A;  3NGI A;  3H46 O;  4OPJ A;  1VQ4 N;  2AP1 A;  1FKO A;  5LJV A;  2YX6 A;  4H8K A;  3CC2 N;  2HST A;  5AQK A;  4DB3 A;  5AQL A;  4YOU A;  4YOV A;  3CPW M;  3HP6 A;  1QVF M;  3AVM A;  4BRI A;  4XIU A;  3O3H A;  4IBN A;  4CZI A;  4DQS A;  2D0B A;  4AF1 A;  3SUQ A;  1LOT B;  5ADX A;  5J2M A;  1MU2 A;  3OW2 M;  1VQ8 N;  1CZA N;  3QEW A;  3VQC A;  4CJV A;  1LWF A;  4LF7 K;  3EE9 A;  1T3V A;  2OTL N;  3QBW A;  2WC9 A;  4BRG A;  1I94 K;  1B92 A;  3LPU A;  2FBY A;  2QXF A;  3AVF A;  3IDH A;  4DTJ A;  3M1F A;  4DV0 K;  3UIQ A;  4Z94 A;  2HOE A;  5JIC A;  2XO7 A;  3LZJ A;  3CCL N;  4A2B A;  3P4I A;  1JKH A;  4KI4 A;  2GEM A;  3SMP A;  1NOZ A;  1BO5 O;  4LFB K;  4BE2 A;  4IXC A;  1W7A A;  4FJM A;  4KHN A;  3C7N A;  4FZX C;  4EP5 A;  4CBX A;  1BG3 A;  2ZQB A;  4BRQ A;  3KLI A;  5KQD A;  4A5A A;  1RT4 A;  4DR1 K;  2FBX A;  2GBZ A;  3VQ9 A;  1S6Q A;  1BI4 B;  3OYI A;  4W5O A;  4EIA A;  3G4S N;  4FWN A;  1KVC A;  3V1R A;  5CZ2 A;  2UUC K;  2UXC K;  3NAE A;  3V9U A;  1MWM A;  4NXN K;  2O8E B;  4CEO A;  1TUU A;  1NGD A;  2ASM A;  4BQL A;  4Z4E A;  2OTJ N;  1QQO A;  3A8Y A;  1NGG A;  4FSV A;  1RTJ A;  1RDD A;  1NK7 A;  1V4S A;  3DXM B;  3UE5 A;  3WEE A;  4N47 A;  5GAD P;  3HOS A;  5C0Y A;  4IG3 A;  5SZT A;  3OYH A;  5K14 A;  3P31 A;  3EE8 A;  4N56 A;  1IG8 A;  3TPQ A;  1VQO N;  1SV5 A;  4B08 A;  2HBM A;  4M3U A;  3E01 A;  2G8F A;  2YJF A;  2GX9 A;  2G8W A;  5M1N A;  5CZ1 A;  1M90 O;  3KLH A;  4ISG A;  3AAQ A;  3THY B;  3AA2 A;  5B8H A;  4FM1 A;  3H1Q A;  1YIJ N;  4JYA K;  4H4M A;  3PUF A;  4CJR A;  3OYE A;  2UXB K;  1U6Z A;  4QOZ B;  1IBK K;  1LWE A;  4CJL A;  4KRE A;  3S3M A;  1NBW A;  5M1K A;  3U3Y A;  1VQ6 N;  3WXL A;  3CQX A;  4IOX A;  3L8B A;  4BC5 A;  3N4P A;  2VQF K;  2BTF A;  3QIN A;  1X9W A;  3C0B A;  4BY9 C;  2KFZ A;  1SL1 A;  5AQX A;  5M1O A;  4JS4 A;  3KK7 A;  4CF2 A;  3PX0 A;  2P9U A;  2WON A;  2HMP A;  2A40 A;  4E89 A;  4Z4C A;  4RW6 A;  1WSH A;  3DYA A;  2HBK A;  1JLG A;  1J54 A;  2HW3 A;  4E1N A;  1ATN A;  3R8E A;  4KHY A;  2UYT A;  2W6K A;  4Y0W A;  2P9S A;  1R59 O;  5E26 A;  4QCL A;  5JMV A;  2YHY A;  2BGG A;  3TAR A;  1FK9 A;  2IGI A;  1VQ7 N;  2KZZ A;  4FWM A;  1BA1 A;  1TKD A;  3T69 A;  4IFY A;  1WN7 A;  4CK3 A;  4FJH A;  3QO9 A;  4CZG A;  2Y1J A;  4DV5 K;  3NMU A;  3E9L A;  4H5R A;  4PUO A;  4CJT A;  2CGL A;  1NK5 A;  1HJO A;  1Z26 A;  1FJG K;  1K6Y A;  1LW0 A;  2W40 A;  3DWL A;  1XHZ A;  3KTQ A;  4K8Z A;  1U2V A;  4GMJ B;  4JI1 K;  1XWL A;  5A2Q O;  4BG9 A;  3PLA A;  3TSP A;  5T7B A;  1UAX A;  5IWA K;  3SPZ A;  4NO7 A;  4L8R B;  1IKW A;  1RBU A;  2D0O A;  3SQ1 A;  4RW7 A;  1KRP A;  1F21 A;  3WQU A;  3O4W A;  4OLA A;  2NRH A;  1ZBF A;  3PSF A;  2F9W A;  4QAG A;  3VGM A;  1N33 K;  2XY8 A;  4BVP A;  2Q3S A;  3NH1 A;  5AQN A;  2QTD A;  4M7X A;  2E2N A;  4CE9 A;  1JXE A;  3MX2 A;  2E2P A;  3VEO A;  4JHD A;  2QWL A;  5EX5 A;  3J81 O;  3ZX2 A;  4DSL A;  3JXU A;  3EZ5 A;  4X66 K;  1A5V A;  4YDU A;  3CQY A;  3VEV A;  2P9N B;  1C1B A;  2Z1I A;  3WNG A;  1NMN A;  3MN9 A;  3KK1 A;  2QKK A;  2O8B B;  4AM7 A;  3K59 A;  3CXC M;  4DV1 K;  4JKB A;  3A5M C;  1ITG A;  2YHX A;  4CZL A;  3M8R A;  3OA9 A;  3CET A;  3V1O A;  3NGY A;  4JN4 A;  4BR7 A;  1YJ9 N;  4DTU A;  5AQQ A;  4BC3 A;  1RT6 A;  3AGK A;  3CCM N;  1RDW X;  2AA4 A;  4BAC A;  4AHV A;  2I5J A;  4B3M K;  2YNF A;  4X62 K;  1SS6 A;  1LCU A;  3CJ1 A;  4YOY A;  3BF1 A;  4F3O A;  3AA4 A;  3IS9 A;  4RTF D;  4XEI A;  3GG4 A;  3SMS A;  5CR4 A;  2DPN A;  4HUF A;  2GEL A;  4NCG A;  2HB5 A;  4JKA A;  4B9T A;  4CBU A;  2A1R A;  3B6O A;  1QTM A;  1Z6R A;  5C24 A;  3JYT A;  1NGE A;  1YTU A;  2E88 A;  4CEC A;  4E1J A;  5AFU H;  1VQP N;  1N6Q A;  5HOO A;  1IH7 A;  4B9V A;  4A5B A;  5JLH A;  3RMC A;  1GLJ O;  4CGI A;  1EWR A;  4OPA A;  1RBT A;  3WNF A;  3CQ8 A;  3VEX A;  3DRR A;  4G9Z A;  4JRP A;  3QEP A;  3H08 A;  4Y1D A;  1RT2 A;  4CF8 A;  3K5M A;  2OZS A;  4JI4 K;  2PBD A;  2VG5 A;  3H45 C;  5JS1 A;  3I8D A;  2R7Y A;  4CVN E;  3CD6 N;  4YOX A;  2HHU A;  3AVK A;  3HVR A;  5GIO A;  2O8F A;  2IOC A;  4FVM A;  2OPS A;  4CEB A;  3ZT4 A;  3MN7 A;  5I9E B;  2OA8 A;  3U9D A;  3C7N B;  3UKU B;  2YCH A;  1NJZ A;  2D0C A;  4GVM A;  1BOT O;  5ADX H;  4AQY K;  4CEA A;  1SZ2 A;  3HYF A;  3K5L A;  3CG7 A;  1BGX T;  3A2F A;  1N34 K;  2HF3 A;  3AVI A;  4EHT A;  1KD1 O;  5BPN A;  1O1W A;  1QZ5 A;  3DOK A;  2XY6 A;  1VK0 A;  4XH5 A;  2NRR A;  2NRT A;  1LWC A;  4RW9 A;  4LSN A;  1EXQ A;  1W97 L;  2E6L A;  4FW1 A;  4IO8 A;  2ZD1 A;  4LF9 K;  4HWI A;  2O8E A;  4DSI A;  2CGJ A;  1Q82 O;  4BRA A;  3WXM B;  3L2Q A;  3NFA A;  3ULE B;  1BIZ A;  3ULD A;  4A62 A;  2EHG A;  1S9G A;  3ZT3 A;  2ZJQ L;  1VSJ A;  5BPL A;  5AQZ A;  3VA0 A;  3HST B;  3M8Q A;  2HHQ A;  1I3A A;  1RTH A;  3J8A A;  1NNE A;  4B3S K;  5HLF A;  3LDO A;  4WQ5 A;  3TAE A;  4TSX A;  3GL1 A;  5DK5 A;  2UUA K;  3EYZ A;  3HBT A;  4WFB L;  1Q86 O;  1ZBI A;  1RT1 A;  3KLE A;  3EY1 A;  3MAQ A;  3E9P A;  4DTP A;  3KK3 A;  1ESV A;  2P9L A;  4GW6 A;  3D6R A;  5TKW A;  4UQG A;  1YJW N;  2P9I A;  3THY A;  5BR9 A;  3O9R A;  1NK0 A;  2RKI A;  4MO4 A;  3H3O B;  2PAV A;  2J4R A;  3MXJ A;  3HPO A;  3AVH A;  5HRO A;  1RFQ A;  2IVN A;  4WYB A;  2G8U A;  1C0F A;  4KH4 A;  4FWP A;  3OYA A;  1TGO A;  2XRI A;  3NF7 A;  4DFM A;  2FF3 B;  3BEX A;  2YV0 X;  5GIN A;  3ALY A;  1Q9Y A;  3R9P A;  4M3R A;  5SWM A;  1HPM A;  4CHY A;  3HTV A;  4X64 K;  1QVG M;  3OYN A;  4FVU A;  3GBT A;  3F73 A;  3TI0 A;  5FDL A;  1Z05 A;  1FXX A;  1IJJ A;  1HR0 K;  1G15 A;  1RDU A;  3SLC A;  4JV5 K;  1L3S A;  2BUP A;  2P9U B;  2RHK A;  3FGU A;  3WXI A;  3J7A P;  1D8Y A;  3F2K A;  2B6A A;  5JVG L;  4Q5V A;  3KKS A;  2O8C B;  5ELZ A;  2E8A A;  3QBX A;  4F9O A;  2VG7 A;  4BVO A;  1XNQ K;  4N41 A;  4I6M B;  3TSQ A;  4LH4 A;  4OGC A;  5I3U A;  4CEZ A;  4MDB A;  4DFJ A;  3HZ6 A;  1QSS A;  4WFN L;  2P9S B;  5AQU A;  4KHU A;  2D4W A;  3OBY A;  3KD1 E;  4DR6 K;  4DLG A;  4WQ4 A;  4JK9 A;  3KWI A;  1NJW A;  1T44 A;  4BWM A;  2DFF A;  3C6H A;  1IV0 A;  2YHW A;  1K9M O;  4JI7 K;  4H0P A;  3VEN A;  1HYZ A;  4J2D A;  3AY9 A;  1LAV A;  2WTU A;  2FF6 A;  4KTZ A;  3S3N A;  1KXP A;  4BRK A;  2KTQ A;  4H4O A;  3T1H K;  3TWH A;  1HNV A;  5BR8 K;  4FLV A;  2IDO A;  1UA0 A;  1N36 K;  2Q1N A;  3VEY A;  3SAH A;  4FK4 A;  1U2V B;  2AJQ A;  1YVN A;  3KKR A;  4E7L A;  4K43 A;  4F2R A;  1SQK A;  3CFP A;  4CI6 A;  4E7H A;  1G99 A;  4KTW A;  3WQT A;  4PWD A;  2HVH A;  4H0X B;  5AZI B;  1VQK N;  1A5X A;  3CF5 L;  1ZBL A;  3PO4 A;  2ZF5 O;  3AV9 A;  2F8S A;  4HTU A;  5AQV A;  1U04 A;  4BE0 A;  1JLF A;  4W5T A;  1C1C A;  4F2S A;  2UXD K;  4DTX A;  2RN2 A;  4JKF A;  1N5Y A;  1S3X A;  2Q0R A;  4R79 A;  3RVC A;  1T03 A;  4MLE A;  1O13 A;  1QHT A;  2KW4 A;  4OPK A;  3EL2 A;  3V9W A;  3ID8 A;  4KH5 A;  1TUY A;  3VN5 A;  3CJ9 A;  2RPI A;  4JHD B;  3LZI A;  4HCB A;  4O5F A;  1BU6 O;  4GVE A;  4KAZ A;  4AHU A;  2FSN A;  3B6P A;  1UOC A;  4FPB A;  4BRL A;  3VQ6 A;  5J2P A;  1BQM A;  2P9N A;  1HLU A;  1GLL O;  5DM7 L;  1SUQ A;  4OLB A;  3LP3 A;  2O8B A;  4CD3 A;  4J2E A;  3IMX A;  4Z4I A;  2E5L K;  4K42 A;  3OHR A;  1X3N A;  5AZJ B;  4DTM A;  4I7F A;  2A3Z A;  4DHY A;  4F4K A;  3WNE A;  2CH6 A;  3HXM A;  3LAM A;  1NGF A;  3K58 A;  5HRN A;  4K8X A;  4H0T B;  4DV2 K;  1RNH A;  2QWN A;  3NE6 A;  2YKM A;  1TL1 A;  2O4I A;  4CJQ A;  1KAX A;  3RR7 A;  3O1B A;  4I2P A;  3TAB A;  3U3G A;  4B9N A;  3FZM A;  4IZ9 A;  1QS4 A;  1XUP O;  1T05 A;  1VQL N;  2QK9 A;  1MWK A;  1EQY A;  4DR3 K;  3MN5 A;  2OCE A;  1HX1 A;  4CF9 A;  5KPR A;  3AA3 A;  3CCV N;  1TAQ A;  4Z4H A;  4EZ9 A;  1VSK A;  4DSE A;  1X1P A;  4DUY K;  1WBB A;  3HT3 A;  3QER A;  4M3T A;  4CER A;  1RTD A;  3SAF A;  3NBP A;  2DTU A;  4NYF A;  5FPD A;  3SJJ A;  4N5S A;  4ELT A;  1BCO A;  4DR5 K;  2XHB A;  1YT3 A;  3KZB A;  3CHW A;  1KVA A;  4B9M A;  1BCM A;  3RTV A;  1T7P A;  1DKG D;  3E66 A;  3SCX A;  3D2F B;  2O8F B;  4H5V A;  3UKR B;  3ZSQ A;  2VGM A;  3V9S A;  5AQF A;  4E1M A;  1HNW K;  4IJN A;  5FPM A;  2JLE A;  4M3Y A;  4BRE A;  2H3G X;  3UKU A;  5CY4 A;  2IVO A;  4GNI A;  1W9H A;  4ZTF A;  4DFK A;  4RW8 A;  2YKN A;  2QW9 A;  4IEI A;  4BGB A;  5CHI A;  1HNZ K;  4OKJ A;  4GKK K;  1NGI A;  5TKY A;  3J80 O;  3LWL A;  3AAP A;  3MX5 A;  2D0A A;  4KFB A;  4OPH A;  4WE1 A;  4KKO A;  4C1N K;  3O3F A;  3ULE A;  2PZS A;  4JI8 K;  1DTQ A;  3IUC A;  5EVZ A;  5J2Q A;  4I2Q A;  1VSI A;  1BHL A;  3T7Z A;  2FXU A;  3HI0 A;  1RBS A;  1FKP A;  3MK6 A;  3TTC A;  3ATU A;  2E2O A;  4FJ9 A;  3ZEU B;  4LC9 B;  3CCQ N;  3ITH A;  3C6T A;  4BRF A;  4GKJ K;  2A5X A;  1B9F A;  3ASM A;  3OJS A;  5CE3 A;  4JEP A;  1JL1 A;  2P9L B;  1WSG A;  1NGB A;  1VSM A;  2P9I B;  3VTH A;  1OH5 A;  1TK5 A;  4DF4 A;  1P8Z A;  2G8I A;  3E9O A;  5HL7 L;  1JCG A;  3OJU A;  1L3V A;  3FLC O;  4BRD A;  4FJ7 A;  1OH8 A;  4OJR A;  1E4F T;  4FW2 A;  2E6M A;  3ENO A;  3OYC A;  1T6C A;  2DY4 A;  4JNE A;  5BRD A;  5AQP A;  4WF9 L;  1KAY A;  3RWU A;  4PL8 A;  3LWM A;  4IWV A;  4JRQ A;  1GOB A;  2PYJ A;  1LV5 A;  3NF8 A;  1K8A O;  1XC3 A;  3VET A;  1BUP A;  4NCA A;  4DQQ A;  1OVY A;  3MEG A;  1WSI A;  4YFU A;  3AO5 A;  3JSM A;  2KZM A;  1HKB A;  1QQN A;  2O8C A;  3K5O A;  1XHX A;  4I6M A;  4JKD A;  1KFD A;  4FWR A;  3KLG A;  4LD0 A;  4EP4 A;  1C1A A;  2QM1 A;  1EWQ A;  3SNN A;  3CFO A;  4FJX A;  4AH9 A;  1E4G T;  3C65 A;  5HRR A;  2W42 A;  3FFK B;  1RT5 A;  3O4N A;  5M1Q A;  3TAM A;  3QLH A;  4FJN A;  4JI2 K;  1REV A;  3QEV A;  2QWO A;  3NCI A;  4FJ8 A;  3TAN A;  4KPY A;  2BH1 A;  3OVN A;  4NXM K;  2YJE A;  3VF4 A;  3THV A;  1EO1 A;  4IJA A;  5JS2 A;  1MA9 B;  3SQ2 A;  2RE2 A;  4BRM A;  4CES A;  1NGJ A;  2IS3 A;  4AM6 A;  2GV9 A;  2V52 B;  2P9P A;  3FZF A;  5HRP A;  4DTN A;  4PQU A;  4YDU C;  3FE1 A;  2KKZ A;  4ILG B;  1NWK A;  4ICL A;  4NCB A;  4C8K A;  1XQS C;  3AVB A;  3CC4 N;  2Z1J A;  4E7K A;  4OGE A;  4IO9 L;  3SV4 A;  1YTA A;  5AZI A;  5AJ3 K;  3WNH A;  2D5R A;  2FC0 A;  4E3S A;  4IDH A;  5C2F A;  1IBL K;  2F8T A;  3CCJ N;  4JKE A;  2FBV A;  4M41 A;  4FWO A;  3TU5 A;  1BA0 A;  1KFS A;  4F8R A;  1KAZ A;  3F9K A;  4JLH A;  4FJI A;  1SAZ A;  1OH6 A;  2GWJ A;  1HPZ A;  2Q36 A;  5LMN K;  4XH4 A;  3SAG A;  3TAG A;  4CGJ A;  4M3X A;  4CJK A;  3O9T A;  3SBG A;  2I7P A;  4CGD A;  5FRO A;  4DV7 K;  4BQZ A;  5GAE P;  4C8O A;  3BUZ B;  3MXI A;  3ZSO A;  2YNG A;  3V4I A;  1RT3 A;  4BG8 A;  4V19 S;  3IFR A;  4KRF A;  1WSE A;  1K73 O;  2NRZ A;  3CM6 A;  3G10 A;  4M45 A;  4Y1C A;  3VQ8 A;  3ISN C;  2HHH K;  5AZJ A;  3QIO A;  2KLA A;  3AO3 A;  4CJ4 A;  4NLB A;  3I33 A;  1U4B A;  2FSK A;  3LDQ A;  1RDC A;  4BRN A;  1TK0 A;  4JKH A;  3HJF A;  4O55 A;  1EP4 A;  3R6M A;  1EET A;  2F96 A;  2CGK A;  1Q9X A;  3NVK A;  4C1N I;  3LDS A;  5LL6 Z;  3NF9 A;  1RT7 A;  2O8D B;  2QWM A;  1BDG A;  1U47 A;  2KQ2 A;  3CME N;  3SUP A;  2HF4 A;  5D3G A;  1NM1 A;  4KB1 A;  5AQJ A;  1J9A A;  1L3T A;  4OKK A;  3O5B A;  3KK2 A;  4NYN A;  4C8N A;  4IFE A;  4YY3 K;  1GLA G;  4JKG A;  1CZ9 A;  1NKC A;  3W0L A;  3D7E O;  4CJS A;  3M5R A;  2QWP A;  1S9E A;  3CI5 A;  2HHT A;  5KI6 A;  3C6U A; 
#chains in the Genus database with same CATH homology
 4Q5V A;  3O3H A;  1HRH A;  4IBN A;  4N76 A;  2A1S A;  3KKS A;  2ATQ A;  5CYM A;  4DQS A;  3OYM A;  2D0B A;  2VG7 A;  3SUQ A;  3AO4 A;  3IAY A;  4CJE A;  1HMV A;  1Y97 A;  4N41 A;  4LY7 A;  4LH4 A;  4OGC A;  3ZSY A;  5I3U A;  1ASU A;  5J2M A;  4CEZ A;  3V6D A;  4CHZ A;  1MU2 A;  4DFJ A;  1QSS A;  4DQP A;  3QEW A;  2Z1G A;  3VQC A;  4CJV A;  1LWF A;  1BL3 A;  2B4J A;  4KHU A;  2NUB A;  2OPP A;  2P51 A;  3RMB A;  2PYL A;  1WSF A;  1ZBU A;  3ZT1 A;  3KD1 E;  3NGZ A;  4DLG A;  1B92 A;  1Z25 A;  2FBY A;  2QXF A;  3AVF A;  1JLQ A;  3LPU A;  4CF1 A;  1GOC A;  1NJW A;  4J2A A;  4BWM A;  4DTJ A;  2DFF A;  1IKY A;  2X6S A;  5KRT A;  3RRH A;  1KTQ A;  1TV6 A;  4DSK A;  4DMN A;  1R0A A;  1HYZ A;  3VQ4 A;  5C42 A;  1LAV A;  4CIF A;  4E7I A;  3UIQ A;  4KTZ A;  4J2D A;  3S3N A;  2KTQ A;  1SKR A;  4H4O A;  1QSL A;  3AVN A;  2XO7 A;  3LZJ A;  3TWH A;  1JKH A;  1HNV A;  4KI4 A;  4MQ3 A;  2HHW A;  5KRS A;  1NOZ A;  4FLV A;  4ELV A;  2IDO A;  1UA0 A;  4IKF A;  1CLQ A;  1U45 A;  3DLE A;  3OS1 A;  4M3W A;  4BE2 A;  1NK6 A;  4DQI A;  4FK4 A;  3HL8 A;  4FJM A;  4CFB A;  1C6V A;  4KHN A;  3ZSW A;  3OY9 A;  3OYD A;  2AJQ A;  4FZX C;  3ZSX A;  4EP5 A;  3KKR A;  4E7L A;  4F2R A;  2ZQB A;  1TKZ A;  4DU1 A;  4HUE A;  3CFP A;  4E7H A;  3KLI A;  1TK8 A;  3DLH A;  1RT4 A;  4O0I A;  4KTW A;  4PWD A;  2FBX A;  2GBZ A;  2HVH A;  3VQ9 A;  4ZHR A;  1S6Q A;  1BI4 B;  4CJ3 A;  3OYI A;  1A5X A;  1RDA A;  1ZBL A;  3PO4 A;  3AVL A;  4CEF A;  5C25 A;  4CHQ A;  2DFE A;  3AV9 A;  3V1Q A;  4HVJ A;  2F8S A;  4W5O A;  4HTU A;  1U04 A;  4BE0 A;  4RG8 A;  1JLF A;  1S1U A;  1KVC A;  4IFV A;  1BIS A;  1VSH A;  5CZ2 A;  3V1R A;  4W5T A;  4Z4G A;  3NAE A;  1C1C A;  4F2S A;  3V9U A;  4G1Q A;  4DTX A;  2RN2 A;  4HHT A;  3VQ5 A;  1JLB A;  1B9D A;  1VSF A;  1N5Y A;  3MED A;  1NK8 A;  4CEO A;  2YNI A;  1T03 A;  3LAL A;  2OYQ A;  1CXU A;  1QHT A;  2KW4 A;  2BDP A;  4Z4E A;  2KFN A;  4OPK A;  3VQP A;  5FRM A;  1RTJ A;  3V9W A;  3TAP A;  4DSJ A;  3VN5 A;  3CYM A;  1RDD A;  2RPI A;  1NK7 A;  3I0S A;  4HUG A;  3HPG A;  3LZI A;  4HCB A;  4KAZ A;  4N47 A;  3CM5 A;  3NF6 A;  4CEE A;  4AHU A;  3NDK A;  3HM9 A;  3B6P A;  1UOC A;  3L3V A;  1NJX A;  4HCC A;  4IG3 A;  1ZYQ A;  1KLM A;  5SZT A;  1VSL A;  3VQ6 A;  3OYH A;  5K14 A;  5J2P A;  1BQM A;  4N56 A;  3NH2 A;  3TR8 A;  4DSF A;  4CGG A;  3NHG A;  1KLN A;  1SV5 A;  4B08 A;  3OYB A;  1L3U A;  4M3U A;  1U48 A;  1WSJ A;  3E01 A;  1YVU A;  2G8F A;  2JGU A;  1SUQ A;  4OLB A;  2X74 A;  2G8W A;  3LP3 A;  3OYL A;  1HNI A;  5CZ1 A;  4J2E A;  2ETJ A;  3P5J A;  4IG0 A;  3D0P A;  2FBT A;  2IAJ A;  3KLH A;  3IG1 A;  4CGF A;  4Z4I A;  3AA2 A;  4FM1 A;  1KVB A;  4H4M A;  3RRG A;  3PUF A;  4O0J A;  4CJR A;  3OYE A;  4FLX A;  1JL2 A;  2Y1I A;  3AVJ A;  4QOZ B;  3VQA A;  4DTM A;  1D9F A;  4Q0B A;  1LWE A;  4I7F A;  4CJL A;  4F4K A;  3WNE A;  3SI6 A;  3HXM A;  4B9U A;  4J2B A;  4FYD A;  3LAM A;  1LW2 A;  2O4G A;  3P83 D;  5DMR A;  4KRE A;  3K58 A;  3S3M A;  4E7J A;  3SZ2 A;  1VSE A;  1CZB A;  5HRN A;  4K8X A;  3U3Y A;  3L8B A;  1A5W A;  1RNH A;  3NE6 A;  3DM2 A;  2YKM A;  1TL1 A;  3QIN A;  2O4I A;  4CJQ A;  2RF2 A;  3DRP A;  1X9W A;  3RR7 A;  4M42 A;  4I2P A;  3TAB A;  1EKE A;  3O4Q A;  2G8V A;  3U3G A;  4B9N A;  2KFZ A;  1SL1 A;  3T19 A;  3LP0 A;  3OYF A;  4R5P A;  1QS4 A;  1T05 A;  4W5R A;  4FK0 A;  2QK9 A;  3FFI A;  1NK4 A;  4JS4 A;  3SUO A;  4CF2 A;  1U49 A;  1NK9 A;  3PX0 A;  1QE1 A;  4BDZ A;  2WON A;  4CF9 A;  4CCH A;  1WLJ A;  3AA3 A;  2XY5 A;  2GUI A;  4JS5 A;  1TAQ A;  4E89 A;  4Z4C A;  4RW6 A;  4Z4H A;  2LSN A;  1WSH A;  2BE2 A;  3DYA A;  3DOL A;  4DF8 A;  1JLG A;  1VSK A;  4DSE A;  1X1P A;  4DLE A;  4EZ9 A;  3HT3 A;  3QER A;  4M3T A;  1J54 A;  4CER A;  2IC3 A;  1RTD A;  3AA5 X;  4AHR A;  2HW3 A;  4E1N A;  3NBP A;  3QEI A;  4KHY A;  2DTU A;  4NYF A;  3VQB A;  2QKB A;  3RMA A;  3SJJ A;  2E4L A;  3OYJ A;  4N5S A;  4ELT A;  3QNN A;  3VQQ A;  1BCO A;  4IDK A;  1CXQ A;  3VQE A;  4QCL A;  1TL3 A;  4FM2 A;  3SQ0 A;  1GOA A;  4DWI A;  3SV3 A;  1BQN A;  1YT3 A;  2XHB A;  2BGG A;  3TAR A;  4PA1 A;  1FK9 A;  2IGI A;  1KVA A;  3ZT2 A;  4CJP A;  4E19 A;  1S5J A;  1NOY A;  1BCM A;  1WAF A;  3RTV A;  4ZTJ A;  1T7P A;  4B9M A;  2OZM A;  2YHB A;  2KZZ A;  1TKD A;  3I0R A;  3SCX A;  4IFY A;  4AHS A;  2P1J A;  1KSP A;  1WN7 A;  4CK3 A;  4FJH A;  3QO9 A;  3L3U A;  2Y1J A;  3ZSQ A;  3V9S A;  5J2N A;  3MEE A;  4W5N A;  4E1M A;  4BWJ A;  4PUO A;  4CJT A;  3RMD A;  3AVA A;  1NK5 A;  3HPH A;  1Z26 A;  2JLE A;  4M3Y A;  3M8P A;  4KHS A;  1K6Y A;  1LW0 A;  5CY4 A;  1TVR A;  1XHZ A;  1W9H A;  4ID1 A;  4ZTF A;  1IKV A;  4DFK A;  3KTQ A;  3S3O A;  4RW8 A;  3PV8 A;  1JLA A;  1I39 A;  2YKN A;  4K8Z A;  4GMJ B;  1XWL A;  3LP1 A;  3QET A;  3QEP A;  5T7B A;  1UAX A;  2ZE2 A;  4KHQ A;  3SPZ A;  3K2P A;  1VRU A;  4OKJ A;  1X9S A;  4L8R B;  4LSL A;  4C8M A;  3NH0 A;  1IKW A;  1RBU A;  3LWL A;  2HMI A;  3L2R A;  3SPY A;  1BI4 A;  3KD5 E;  2D0A A;  4DU3 A;  4KFB A;  3DI6 A;  4CIG A;  1RTI A;  4KKO A;  4RW7 A;  4WE1 A;  3SQ1 A;  1KRP A;  3O3F A;  1F21 A;  4DS5 A;  1SKS A;  4CED A;  2PZS A;  1IKX A;  1DTQ A;  5J2Q A;  4OLA A;  2X6N A;  1ZBF A;  4I2Q A;  4QAG A;  1VSI A;  4B8C A;  1BHL A;  4CFC A;  1T8E A;  3OS0 A;  1C0M A;  4PY5 A;  2XY8 A;  1UWB A;  1DLO A;  1RBS A;  2P5G A;  1FKP A;  4FLU A;  4F3T A;  2HNY A;  2Q3S A;  3ZSV A;  4CHN A;  3NH1 A;  5CYQ A;  4FJ9 A;  4ELU A;  1IG9 A;  3ZCM A;  3ITH A;  2B5J A;  3C6T A;  4CE9 A;  1JXE A;  1TKT A;  1X9M A;  3ASM A;  1B9F A;  4FLT A;  1HQU A;  4DSL A;  3EZ5 A;  5I42 A;  3OJS A;  1VRT A;  1A5V A;  2ITG A;  1JL1 A;  2HNZ A;  1WSG A;  1VSM A;  4Z0U A;  1C1B A;  5KGW A;  2Z1I A;  3WNG A;  1ASV A;  1TK5 A;  4CFD A;  1QSY A;  4DF4 A;  3KK1 A;  3IRX A;  4DU4 A;  4CIE A;  2G8I A;  2QKK A;  1J53 A;  3OJU A;  3TAF A;  5J1E A;  1L3V A;  4CHO A;  1S1T A;  4FJ7 A;  4OJR A;  3K59 A;  1HYS A;  3PY8 A;  4FW2 A;  2E6M A;  3V9X A;  1ITG A;  4O44 A;  3M8R A;  2WOM A;  2G8H A;  3OYC A;  1D9D A;  2X78 A;  3NGY A;  3V1O A;  1HQE A;  3OS2 A;  4AIL C;  1L5U A;  2DY4 A;  3RR8 A;  3RWU A;  4DTU A;  3LWM A;  1RT6 A;  3P1G A;  4YNQ A;  4JRQ A;  1UA1 A;  1GOB A;  3D45 A;  2PYJ A;  4DFP A;  1QQC A;  1LV5 A;  1J5O A;  4BAC A;  4AHV A;  3NF8 A;  1RIL A;  2I5J A;  1RBV A;  2YNF A;  3HO1 A;  4NCA A;  1BIU A;  4DQQ A;  4FZY A;  4KI6 A;  4W5Q A;  2HHS A;  4MFB A;  1IO2 A;  3HVT A;  4FZZ A;  4F3O A;  1WNS A;  3V9Z A;  3MEG A;  3AA4 A;  3IS9 A;  4RW4 A;  1SL0 A;  3TAQ A;  1ZBH A;  1XC9 A;  1WSI A;  4CFA A;  4B3O A;  1DTT A;  4YFU A;  3AO5 A;  2BAN A;  3JSM A;  4HUF A;  1JLE A;  4BDY A;  4BE1 A;  4C8L A;  2KZM A;  4OKE A;  2EX3 A;  2HB5 A;  4NCG A;  4B9T A;  3K5O A;  3PX6 A;  3O3G A;  2A1R A;  1XHX A;  1NJY A;  3B6O A;  4FJJ A;  1QTM A;  5C24 A;  3JYT A;  2G8K A;  4CF0 A;  2Z1H A;  1YTU A;  1KFD A;  3LPT A;  3KLG A;  4LD0 A;  4CEC A;  4EP4 A;  3ZSR A;  1N6Q A;  3DLG A;  1C1A A;  1RCH A;  2HND A;  1IH7 A;  4B9V A;  3SNN A;  4KV8 A;  3RMC A;  3CFO A;  4CGI A;  1NKB A;  4FJX A;  2HVI A;  4AH9 A;  4LH5 A;  3QEX A;  3WNF A;  1RBT A;  1SL2 A;  3CQ8 A;  4FLZ A;  3DRR A;  5HRR A;  2W42 A;  1HYV A;  3PO5 A;  4BDP A;  1RT5 A;  3O4N A;  4JRP A;  3H08 A;  4Y1D A;  1RT2 A;  3TAM A;  1D5A A;  4AHC A;  4CF8 A;  3K5M A;  3QLH A;  2OZS A;  1RBR A;  3HP9 A;  2VG5 A;  3MEC A;  4E0D A;  4FJN A;  4I9L A;  3CFR A;  5JS1 A;  1REV A;  3QEV A;  3I8D A;  2R7Y A;  3NCI A;  4FJ8 A;  3TAN A;  4KPY A;  3T1A A;  3OVN A;  3SQ4 A;  2HHU A;  3AVK A;  1KCF A;  3OYK A;  3HVR A;  2IOC A;  4FVM A;  4ID5 A;  2OPS A;  5JS2 A;  1VSD A;  4CEB A;  3SQ2 A;  3THV A;  3BGR A;  3DLR A;  1JXB A;  4FJL A;  4CES A;  5HRP A;  2IS3 A;  3ZT4 A;  2GV9 A;  4FM0 A;  4DTN A;  2OA8 A;  4PQU A;  3K5N A;  1NJZ A;  2P5O A;  2D0C A;  4GVM A;  3K57 A;  3U6F A;  4KHW A;  3VA3 A;  4ICL A;  4NCB A;  3MXM A;  4C8K A;  3KIO A;  4CEA A;  3HYF A;  3AVB A;  3K5L A;  3OYG A;  3CG7 A;  4CGH A;  1BGX T;  2Z1J A;  3A2F A;  4E7K A;  3C95 A;  4OGE A;  3AVI A;  4CK2 A;  3SV4 A;  4KO0 A;  1YTA A;  3LAK A;  3QNO A;  3DLB A;  3WNH A;  4B9L A;  1O1W A;  1W0H A;  2D5R A;  1S1V A;  4CEQ A;  4CJ5 A;  4FCY A;  3DOK A;  2FC0 A;  5HP1 A;  2HHX A;  4E3S A;  1TKX A;  2XY6 A;  1JLC A;  1VK0 A;  5HBM A;  4CHP A;  4FLY A;  2F8T A;  2FBV A;  4M41 A;  4CJU A;  4B9S A;  2VG6 A;  3AO1 A;  1LWC A;  4RW9 A;  1KFS A;  4LSN A;  1EXQ A;  1HJR A;  2E6L A;  4OVL A;  4FW1 A;  4F8R A;  2OPQ A;  3VQD A;  4FLW A;  2ZD1 A;  3F9K A;  4JLH A;  3SUN A;  1SKW A;  4FJI A;  3HK2 A;  1HPZ A;  1C0U A;  3AVG A;  5KTQ A;  2PY5 A;  5EU7 A;  3DLK A;  4DSI A;  3LP2 A;  4O5B A;  4DTS A;  3L2Q A;  3NFA A;  4DS4 A;  3TAG A;  1BIZ A;  4CGJ A;  5E41 A;  3ULD A;  1TAU A;  2EHG A;  1S9G A;  3ZT3 A;  4M3X A;  3AVC A;  3ZT0 A;  1VSJ A;  4CJK A;  1EX4 A;  2VWJ A;  3DMJ A;  3S9H A;  3VA0 A;  3HST B;  3ZSZ A;  4DG1 A;  3M8Q A;  2HHQ A;  1I3A A;  1RTH A;  4Z4F A;  4CGD A;  1C0T A;  5FRO A;  5HLF A;  3TAE A;  4TSX A;  5DK5 A;  3QES A;  2VWK A;  3DRS A;  1NKE A;  5KGX A;  4C8O A;  4DQR A;  3LAN A;  4DTR A;  2HHV A;  1RDB A;  3KLF A;  3EYZ A;  3MXI A;  3ZSO A;  2YNG A;  3C94 A;  3T3F A;  1RT1 A;  3KLE A;  3EY1 A;  3V4I A;  3PX4 A;  1ZBI A;  1RT3 A;  3MAQ A;  3L2V A;  4DTP A;  4B8A B;  3KK3 A;  4KRF A;  3M8S A;  4GW6 A;  1WSE A;  3QIP A;  3CM6 A;  3G10 A;  4UQG A;  4M45 A;  4Y1C A;  3VQ7 A;  4KTQ A;  1WAJ A;  1NK0 A;  2RKI A;  3ISN C;  3VQ8 A;  5FRN A;  3QIO A;  4FXD A;  2YNH A;  3V81 A;  3AO3 A;  3MXJ A;  3HPO A;  3AVH A;  2DFH A;  5HRO A;  4CJ4 A;  1XI1 A;  1U4B A;  2G8U A;  1S1X A;  4I9Q A;  5HRS A;  1RDC A;  4CJW A;  4CJF A;  1TK0 A;  3HJF A;  4O55 A;  4FJG A;  4M3Z A;  1EP4 A;  3OYA A;  3BDP A;  1TGO A;  2YHA A;  4FJK A;  1EET A;  2F96 A;  2XRI A;  3G0Z A;  3NF7 A;  4DFM A;  1Q9X A;  1ASW A;  2YV0 X;  3AO2 A;  3LDS A;  4FJ5 A;  3ALY A;  3NF9 A;  1Q9Y A;  1Q8I A;  1RT7 A;  1S6P A;  1U47 A;  2KQ2 A;  4EZ6 A;  4M3R A;  2OPR A;  5SWM A;  3SUP A;  4CHY A;  3KJV A;  1LAW A;  3OYN A;  1S1W A;  3F73 A;  3NGI A;  3SYZ A;  5FDL A;  4DTO A;  3TI0 A;  4KB1 A;  5D3G A;  1FXX A;  3L2U A;  1G15 A;  1J9A A;  4OPJ A;  1L3T A;  1FKO A;  4OKK A;  4O4G A;  3KK2 A;  4NYN A;  4C8N A;  4AHT A;  3L2W A;  1L3S A;  1CZ9 A;  4H8K A;  1NKC A;  2XY7 A;  4CJS A;  4KB0 A;  1D8Y A;  4FK2 A;  2B6A A;  4CK1 A;  3HP6 A;  1S9E A;  3AVM A;  2HHT A;  5KI6 A;  3C6U A;  4XIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...