3ULDA

High resolution structure of dna/rna hybrid in complex with rnase h catalytic domain d132n mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA/DNA hybrid in complex with RNase H catalytic domain mutant D132N
rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords Ribonuclease H
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2011-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3uldA00
4CGFA 2RKIA 5KI6A 3VQAA 2VWKA 4CHNA 1ASVA 1TL1A 3EZ5A 3V81A 1RDAA 4CHZA 2G8UA 1QTMA 4M3YA 1RT4A 1S9EA 2F8SA 4IFVA 1NK4A 1DTTA 1QHTA 3ZT4A 3ZSXA 3M8SA 2G8FA 1GOCA 2B5JA 2QKBA 1BIZA 4GW6A 4C8KA 3AA4A 4RW9A 3UIQA 2KFZA 3SCXA 2DY4A 1TAUA 4AHVA 1RT7A 5E41A 1B9DA 3OYNA 1S1WA 1W0HA 2OPSA 3AVBA 4CK2A 4XIUA 1LV5A 3V9WA 2O4IA 1HYVA 4H8KA 3JYTA 4YNQA 2YKMA 4H4OA 3L3VA 4FW1A 3ZSVA 4FJ8A 4B9TA 1BI4A 4LSNA 3RRGA 4CFCA 3QEIA 2Z1JA 2X6SA 4HCCA 2IS3A 2G8HA 1C0UA 2BANA 4O44A 4I2QA 3ZSOA 1KTQA 4B9NA 4MFBA 2HHSA 3KKSA 1NJYA 1U48A 2BE2A 4DS5A 1QSYA 4M3UA 1SV5A 1NKCA 1CXUA 3QERA 3HPGA 3M8QA 4CJEA 4E7KA 4CFBA 3TAEA 1D9FA 3HPOA 1IKYA 4F3TA 4Z4FA 5J2PA 3CFOA 3V6DA 4DTRA 3NH1A 1HMVA 3AA3A 3CG7A 2XHBA 4FLVA 4CIEA 3OYHA 3OS2A 2HVHA 4CJQA 1NK7A 4B08A 3OYKA 3M8PA 1KVCA 1RT3A 3TAPA 4KREA 3PX0A 3SYZA 3P5JA 3V1OA 3PO4A 2D0CA 3CM5A 4I9QA 4LH5A 3NH2A 3PX6A 1XHXA 4LH4A 1ZBUA 4FLYA 1RDDA 2D0AA 1JLBA 5HLFA 1YVUA 4J2AA 4W5OA 1S1VA 1O1WA 4AHTA 1C6VA 2WONA 4B9MA 4W5NA 1RBUA 3TAQA 3AO3A 5J2NA 1Z25A 1SKWA 3U3GA 3AVAA 4CEZA 3PY8A 4FJIA 3RMAA 3C94A 5HBMA 5J1EA 3AVFA 3AVIA 2OA8A 3DLHA 4ELUA 1QQCA 1WSHA 1KRPA 4KHWA 1WAFA 1LWEA 4OKKA 5CYQA 2G8WA 1BHLA 3WNGA 3OYLA 1NK5A 2PYLA 4E1MA 1KLNA 3S3MA 3ZSYA 3CFRA 4DTXA 4DFJA 3AO5A 4CGIA 2ZQBA 4FJ7A 1DLOA 3HSTB 4FJLA 1HNIA 4CE9A 1IKXA 3SQ1A 3THVA 4KO0A 4CHOA 4AILC 3DLGA 1Y97A 2E6LA 4QAGA 3OS0A 3LP0A 1WAJA 4B9VA 1C1AA 3EYZA 4BE2A 3MXIA 3BDPA 1YT3A 1JXEA 3B6OA 3OYJA 2EX3A 1QSLA 3WNHA 1T7PA 4DF4A 3K2PA 1TL3A 3KLHA 3WNFA 4DQSA 4ID5A 2FBYA 3H08A 4KFBA 5CZ2A 2FBVA 3AVKA 4CEEA 4DQQA 1A5VA 4ZHRA 1RBTA 1FKPA 4HUFA 2HMIA 4DSKA 3VQ7A 4CHPA 4F4KA 3MXJA 5KTQA 5FRNA 2BGGA 4I2PA 3SUOA 3KD5E 4ZTJA 2HHUA 2XY5A 5D3GA 3OYEA 5HROA 1N6QA 3L2RA 4GVMA 1RILA 4FLWA 3LP2A 5C24A 3L2VA 1NOZA 3AO4A 4DSIA 3DM2A 3AVJA 4CJRA 4BWMA 3T19A 4DG1A 1J5OA 4KPYA 4FYDA 1QS4A 3OY9A 3RMBA 1TV6A 1S1XA 3HL8A 4KHUA 4HCBA 2VG7A 3HP6A 3TAFA 1S9GA 3LAMA 1TVRA 3KK3A 1JL1A 4FM0A 4JLHA 3LDSA 4Z4IA 3SI6A 1BQMA 5FDLA 5J2MA 2GBZA 2NUBA 4N47A 5KRTA 5HRRA 3NGYA 1BCMA 3P83D 4B8AB 3HM9A 3CFPA 1SL2A 4M3WA 1RCHA 1ZBHA 3AVNA 4Y1CA 1NK0A 5CY4A 2IC3A 4FZYA 4UQGA 3LP3A 2PYJA 1VSKA 3OYGA 4FJMA 3L2WA 3PO5A 3I8DA 1EXQA 1JL2A 1S6PA 3NBPA 1VSIA 3RTVA 4N76A 4PA1A 4M3RA 4CJUA 4FW2A 4YFUA 1YTAA 4C8OA 2DFHA 3NF8A 2P51A 3AA5X 3V9XA 1KLMA 1REVA 3CQ8A 2HW3A 3C6UA 4ICLA 3NHGA 1X9WA 3NF7A 3K59A 1C0MA 1RTDA 4BWJA 1VK0A 2D0BA 1L3VA 2Y1IA 1BL3A 5I42A 1VSLA 1BIUA 4KKOA 1UWBA 2HHVA 4FM1A 4E7IA 3OVNA 1SKRA 1RT2A 1RTIA 1WSEA 2YNIA 2FBXA 3L2QA 3QEXA 1L3SA 4F2RA 2B6AA 1NKEA 2KQ2A 1BISA 2P1JA 4LD0A 1I3AA 3ZT3A 4CGDA 4FJ5A 4CF8A 3AA2A 5SZTA 1JLEA 3L8BA 4L8RB 2DTUA 3HYFA 3ZSQA 1JLQA 1J53A 2Z1GA 1FK9A 4WE1A 2XRIA 1C1BA 3TAMA 1X9MA 4Q5VA 1HJRA 3RWUA 3ULDA 3CYMA 3S3NA 3E01A 2HNYA 4DWIA 3D45A 4K8ZA 3ZT2A 4OPKA 2HHWA 4CFDA 4DSFA 4JRPA 1NK8A 1KSPA 4NCGA 1LAWA 4J2EA 4AH9A 1EX4A 3QO9A 1X9SA 3O4NA 3IS9A 1N5YA 2GUIA 4CF9A 2YHBA 4CGHA 4CEOA 4NYFA 3B6PA 4QCLA 1WN7A 3AVCA 3HJFA 3LANA 3HXMA 3V9SA 4FJXA 3V1RA 3RMDA 4H4MA 2OPRA 3LWMA 4MQ3A 3U6FA 1D8YA 4DLEA 2OPQA 1QE1A 3K5MA 1TAQA 3DMJA 3V9ZA 3DOLA 3I0RA 3VQDA 4FK2A 4E3SA 3NGIA 3K57A 4DU4A 4E1NA 3OYFA 4CGJA 3OYIA 4OLBA 3DRPA 4IDKA 4DTMA 2X78A 4B3OA 2FBTA 3SPYA 4CJVA 1RT6A 1VRTA 3K5NA 1ZBLA 4F8RA 4PWDA 3NF9A 4FVMA 1WSJA 3VQEA 4O4GA 1VSJA 2IGIA 4F3OA 1C1CA 4B9LA 4FZZA 4O5BA 3KD1E 1U49A 3ITHA 4KB0A 4DSEA 2ZE2A 3VN5A 1Q9YA 2HVIA 3SJJA 4ID1A 1CXQA 5HRPA 3QEPA 4N41A 4CJTA 4KI4A 4JRQA 3SV4A 4CJPA 3LP1A 3LALA 4JS4A 3SQ4A 3S3OA 1SKSA 1HPZA 1R0AA 2F96A 4OGEA 3IAYA 1EP4A 4OVLA 3KKRA 4IG0A 1DTQA 3NF6A 3T1AA 1LWCA 3NDKA 1SL1A 4HTUA 4BE1A 4FXDA 1U04A 1FXXA 1JKHA 3DOKA 2PY5A 1IG9A 2RPIA 1VSEA 2HHQA 4CEBA 4CJLA 1S1UA 3KLEA 1ZYQA 2QK9A 3ZSRA 3TANA 1BGXT 1ASUA 3DLEA 3QIPA 4M41A 3OYMA 1UA0A 3AVGA 1T8EA 3NFAA 3MEEA 3ASMA 4O0JA 3SUNA 3SQ2A 1VSDA 3VQ8A 2ATQA 4DS4A 3HVTA 4AHSA 4M3XA 4RW8A 3AO2A 4FK4A 3M8RA 1UAXA 1T03A 3QINA 4BDPA 1TKZA 4CF2A 1TK0A 3VA3A 4KRFA 4CIFA 2B4JA 2HHXA 1JLFA 3MEDA 2BDPA 4M45A 4CHQA 3HVRA 4ZTFA 1RT1A 4KHQA 4EP5A 1D9DA 3LAKA 3VQ6A 3KLGA 4FJ9A 4E19A 1HRHA 3G10A 1L5UA 5JS1A 4FK0A 4W5RA 3AVLA 4DMNA 2KW4A 3VQ4A 1K6YA 3OYAA 5EU7A 3ZT0A 4J2DA 5HP1A 1XI1A 2YV0X 4BDZA 2VWJA 3OJUA 2ITGA 3K5LA 4B8CA 3V1QA 3SV3A 1RNHA 2D5RA 3KK1A 4C8LA 4CJ5A 3PV8A 4JS5A 3HK2A 4IBNA 4RW4A 1JLCA 3LPTA 4ELVA 4DFKA 4DTUA 1TKXA 2YNGA 4ELTA 4TSXA 2PZSA 2VG5A 4FJNA 3TABA 4CCHA 4M42A 3IG1A 4FCYA 3QLHA 3S9HA 3KTQA 4Z0UA 1A5XA 4E0DA 3ZT1A 4HUGA 4OGCA 1RTHA 2YKNA 1U4BA 1BI4B 2DFFA 4DTOA 3DRRA 4B9SA 5KRSA 3LZJA 4OKEA 1HQEA 4DSJA 3QNNA 3FFIA 3AVHA 3P1GA 1EKEA 3F9KA 3D0PA 3KJVA 3OYDA 4NCAA 2LSNA 1NK9A 4KHYA 4KTWA 4B9UA 4AHUA 3RMCA 2FC0A 3AVMA 1XHZA 1UA1A 4FLUA 1NJWA 4DTSA 1WSFA 1SL0A 3AO1A 3OYBA 3OYCA 2O4GA 3O3GA 3SQ0A 4DTPA 4EZ6A 1C0TA 5SWMA 1JXBA 1VSHA 4E7HA 1JLGA 1MU2A 1HYZA 3NE6A 1S5JA 1BCOA 4CECA 4CJFA 4CJ4A 2X74A 3TWHA 2VG6A 3MAQA 1U47A 3SZ2A 2A1RA 1IO2A 1NJZA 3L2UA 3G0ZA 3LZIA 3MXMA 3OS1A 2XO7A 3KLFA 1NOYA 3KLIA 1D5AA 2E4LA 4Q0BA 1CLQA 4HVJA 4IFYA 4CJSA 2JLEA 3SNNA 1A5WA 1WLJA 1TGOA 2W42A 4Y1DA 2HNZA 4CK1A 1I39A 1RTJA 1S6QA 3QEVA 1RDCA 4CERA 3OJSA 4E7JA 4DSLA 1GOAA 4C8MA 3V9UA 3TAGA 5FRMA 2AJQA 4R5PA 4N5SA 3IRXA 1U45A 3DYAA 2P5OA 3CM6A 2IDOA 2DFEA 1B92A 1RT5A 3DLKA 4I7FA 1RBSA 1TKDA 1HNVA 4PY5A 3NCIA 2JGUA 1XWLA 5DK5A 1XC9A 4DTJA 2G8VA 4KB1A 3ZSWA 4IKFA 3QETA 3LPUA 4M3TA 1L3TA 2KZZA 4FLZA 3WNEA 4CF0A 4DFMA 1IKVA 4DLGA 4HHTA 4RW7A 3RR7A 1Z26A 4CIGA 1LWFA 4IG3A 5KGXA 1NKBA 3PUFA 3NH0A 4G1QA 2XY7A 4FJHA 1FKOA 1ZBFA 5FROA 5HRNA 1ASWA 2QXFA 5JS2A 2HNDA 1TKTA 1KCFA 4J2BA 2I5JA 4EZ9A 5HRSA 3QNOA 2Y1JA 4I9LA 1EETA 1KFSA 3U3YA 3TARA 1J9AA 1IKWA 4KAZA 4AHCA 3JSMA 4F2SA 2QKKA 4FJGA 3VQPA 1RBVA 1CZBA 3HP9A 4O0IA 1QSSA 2IOCA 2OPPA 3DRSA 3RR8A 2Q3SA 4FLTA 1S1TA 2OYQA 4PUOA 3F73A 4QOZB 2E6MA 1VSMA 4O55A 4BDYA 2EHGA 3DI6A 1KVBA 4Z4CA 2OZSA 4AHRA 2ZD1A 4CK3A 3O3HA 3ZCMA 3QESA 3VQ9A 3O4QA 1LW2A 1IH7A 3HT3A 2IAJA 4CJWA 1TK8A 5C42A 2P5GA 3VQCA 2G8IA 2F8TA 3KK2A 1BQNA 3ZSZA 4CEQA 2Z1HA 3BGRA 4KV8A 3VQQA 1KVAA 3MECA 4Z4HA 1SUQA 4CHYA 4CJ3A 2WOMA 3SPZA 1B9FA 3I0SA 3MEGA 4C8NA 4KI6A 1NJXA 1LW0A 4KTQA 3LWLA 1LAVA 4PQUA 3O3FA 3SUQA 2KZMA 1Q9XA 4LY7A 4BE0A 1RBRA 5J2QA 1JLAA 3KIOA 5CZ1A 4CEFA 3VA0A 4OLAA 4K8XA 4DU3A 4FJKA 3A2FA 4CF1A 1TK5A 4M3ZA 5KGWA 1T05A 1HYSA 3VQBA 5DMRA 1F21A 1VSFA 4DTNA 4KHSA 1UOCA 2ETJA 1ZBIA 3K58A 3V4IA 4FJJA 4CESA 4N56A 3TI0A 1VRUA 4W5QA 2X6NA 3AV9A 3VQ5A 1Q8IA 4DFPA 4NYNA 4DU1A 2Z1IA 4OJRA 4DQPA 2A1SA 4FZXC 1NK6A 1X1PA 3QIOA 4RW6A 4LSLA 3NAEA 3L3UA 5I3UA 4FM2A 4Z4EA 4DQRA 3QEWA 1G15A 2XY8A 4KHNA 2YNHA 3C6TA 5C25A 2G8KA 1J54A 4RG8A 4CEAA 5T7BA 3EY1A 4CJKA 3K5OA 4OPJA 2KFNA 3PX4A 3ALYA 5CYMA 1WNSA 3RRHA 3DLRA 3NGZA 2R7YA 2YHAA 1ITGA 2KTQA 1GOBA 4CGGA 2YNFA 4CFAA 4EP4A 1WSIA 2OZMA 4Z4GA 3SUPA 4DQIA 1YTUA 3HO1A 3TR8A 4OKJA 4CEDA 4GMJB 2RN2A 1KFDA 4HUEA 4DF8A 3T3FA 3C95A 5K14A 1CZ9A 3HPHA 4E89A 4BACA 1W9HA 2XY6A 1HQUA 2GV9A 1WSGA 4E7LA 4W5TA 4FLXA 3DLBA 4NCBA 1L3UA 2HHTA 3ISNC 1RDBA 2RF2A 4KTZA 2HB5A
chains in the Genus database with same CATH superfamily
3VQAA 2VWKA 1TL1A 5BRDA 3EZ5A 4CHZA 2G8UA 2F8SA 1QTMA 1S9EA 5M1NA 3ZT4A 4LF7K 4C8KA 1OH7A 4RW9A 1VQ5N 4AHVA 1S1WA 1W0HA 3WQUA 3TU5A 4CK2A 3V9WA 4H8KA 3JYTA 4KH6A 2YKMA 5C15A 4H4OA 3L3VA 5JMVA 4FJ8A 3J7ZO 2Z1JA 2IS3A 4CZFA 1C0UA 2G8HA 2BANA 2E5LK 3KKSA 4FWOA 3T7ZA 1NKCA 3HPGA 4E7KA 4CFBA 4A5AA 3ZX0A 1DKGD 4Z4FA 3V6DA 3NH1A 1HMVA 2PAVA 3CG7A 3CPEA 2XHBA 4CIEA 3OYHA 2HVHA 3SYZA 3P5JA 4I9QA 4H0VB 4A5BA 2FSJA 4LH4A 2E2QA 1RDDA 3CXCM 3LDNA 5HLFA 1O1WA 3I33A 5C2DA 1U6ZA 1MWMA 1Z25A 1HKCA 4H5VA 3O1BA 1U2VA 1SKWA 3PY8A 4FJIA 4OPAA 3C94A 4ILJA 4CZJA 1KRPA 1NK5A 1E4GT 4E1MA 3ZSYA 4DTXA 4DFJA 4CGIA 4FJ7A 5FPNA 1HNIA 3VETA 5BR8K 4O8UA 4CE9A 4IXCA 4BR2A 4CHOA 1NGBA 3DXMA 4QAGA 3CI5A 4DR7K 1YT3A 2NRHA 1Q18A 1QSLA 3GOIA 2Q31A 4DQSA 4J8FA 4G9ZA 2FBVA 3AVKA 4DQQA 1W97L 1A5VA 3VPZA 1FKPA 4PHTX 2HMIA 3VQ7A 4DHYA 1HJOA 4MLHA 3MXJA 3VEXA 3PIOL 4A61A 3KD5E 3FE1A 3OYEA 5C2FA 1NNEA 1RILA 2VGMA 4FLWA 3LP2A 1NOZA 3AO4A 3DM2A 4CJRA 3K9KA 4KPYA 4FYDA 2QWPA 3R8EA 1ATNA 4HCBA 4KHUA 3HP6A 4GKKK 4CZKA 5CE3A 2IVPA 3VGLA 1BQMA 1VQNN 2GBZA 3NGYA 4HWIA 3P83D 5AZIA 1GLJO 3CFPA 2D4WA 3AVNA 1M90O 5B8HA 3L2WA 1XMOK 3IDHA 1MA9B 1TUUA 4YFUA 4B1YB 3O5BA 2DFHA 3UKUB 3NHGA 1OKJA 3EZWA 3GG4A 3NF7A 4B3SK 3ULEB 4BRCA 1L3VA 2Y1IA 3L6QA 1GLBG 3CQYA 1RT2A 3L2QA 3JXUA 1GLEG 3HOTA 1YITN 4CBUA 1I3AA 4CF8A 3MWTA 4NLCA 1JLEA 3L8BA 4L8RB 3HYFA 3ZSQA 1JLQA 2ZM6K 1FK9A 4WQ4A 2XRIA 1X9MA 4Q5VA 1HJRA 3HBTA 3S3NA 4BR7A 5CR4A 3D45A 3ZT2A 4FWSA 4DSFA 1IG8A 2HBLA 3P31A 4JRPA 4LF8K 4AH9A 1DGKN 4EFHA 2YHBA 4CEOA 4K43A 4QCLA 2ASPA 3HXMA 3QICA 2GUPA 3GE1A 2YX6A 4FJXA 2OPRA 5F2RA 3U6FA 1D8YA 3Q7CA 1JCGA 2YJEA 5BRFA 3MDQA 1TAQA 4FK2A 4E3SA 4DU4A 3KHYA 4CGJA 4IDKA 4CJVA 1VRTA 3FR0A 3NF9A 4FVMA 1IV0A 2IGIA 4F3OA 4KB0A 3C65A 4B1VA 4GV3A 2HVIA 5HRPA 4DKWA 3WUHA 4B9QA 4A57A 4JRQA 4KI4A 4MDBA 4BRLA 4JS4A 4LFAK 3IAYA 1R0AA 4OGEA 3S41A 1EP4A 4IG0A 3NDKA 1IBMK 3R1XA 3FFKB 4WCEL 3DOKA 1JKHA 4NLBA 1S1UA 1K9MO 5FPEA 4C1NI 1YJNN 4M41A 4H0XB 4JN4A 3SLCA 4AHSA 4M3XA 5GAGP 3ID8A 1UAXA 1T03A 3QINA 4BDPA 2BH1A 4KRFA 2B4JA 2BDPA 3HVRA 4KHQA 1RT1A 2RHKA 4EP5A 1D9DA 4V19S 3LAKA 1KXPA 5JS1A 1L5UA 1VQMN 3ULEA 4FK0A 1I94K 3OYAA 3VTIA 5EU7A 5AQZA 3UKUA 1J5EK 1V4SA 3OJUA 4JI3K 1RNHA 4ISFA 3D6RA 4CJ5A 3PV8A 3CD6N 1VHXA 4IBNA 4RW4A 3LPTA 4DFKA 4DTUA 2O8FA 2YNGA 4ELTA 2VG5A 3CIPA 4CCHA 4OGCA 3WXIA 4B9SA 2DFFA 5AQTA 3DLLL 2P9IB 1NJIO 4KHYA 3KJVA 2LSNA 4H0TB 4KTWA 5E26A 2FC0A 3CCSN 3THYB 5F1XA 1ATSA 1Q7YO 1KC8O 1JXBA 5BN9A 1MU2A 1HYZA 3NE6A 4CD1A 3TWHA 5EVZA 2UXDK 4BR5A 3CC7N 1NJZA 3MXMA 2XO7A 3QMLA 1XUPO 2QWRA 1CLQA 4IFYA 1WLJA 1TGOA 3MX5A 1RTJA 4E7JA 4DSLA 3LL3A 5FRMA 4N5SA 1U45A 2P5OA 3DYAA 4B1UB 3CJBA 3CM6A 3GL1A 2DFEA 4CD3A 3T69A 1HNVA 3VENA 3M1FA 2JGUA 3CF5L 1XC9A 4IKFA 3QETA 3LPUA 2KZZA 2P9SA 3WNEA 4BVPA 4DLGA 1NGEA 3K9JA 1BUPA 3RR7A 1LWFA 4IG3A 5BRHA 2FSNA 2E2PA 2W6KA 1FKOA 1ZBSA 5HRNA 1ASWA 5GAEP 4J2BA 5ADXH 3ATUA 1EETA 3U3YA 1IKWA 3K0SA 3AGRA 4WYBA 4O0IA 3RR8A 2NLXA 4JKEA 4O55A 1HPMA 2EHGA 4JI0K 2ZD1A 4BRPA 1NMNA 3ZEUA 3O4QA 1TK8A 3VEWA 2IAJA 4CJWA 4CZMA 1OH6A 3H1QA 5AQMA 3VQQA 4CHYA 2O8BA 2P9SB 5AQRA 3MEGA 4C8NA 3W3DA 3KZBA 4A2AA 5HL7L 1Q9XA 2PBDA 4GY2B 4LY7A 4JI8K 1JLAA 4OLAA 4YDUC 3OBYA 3BZKA 4CF1A 1HYSA 1T05A 3VQBA 1UOCA 1ZBIA 3V4IA 3OBWA 4DR2K 3AV9A 1Q8IA 3H3OB 4PL8A 4DQPA 4FZXC 4JKCA 4RTFD 2HOEA 4RW6A 5AZJB 4LSLA 2A6AA 1NU0A 4DQRA 2XY8A 4GKJK 2BTFA 2G8KA 3EY1A 4OPJA 2HBKA 3PIPL 3PX4A 5CYMA 2QW9A 2R7YA 1MDUB 1ITGA 1GOBA 4CGGA 4EP4A 4Z4GA 2OZMA 1YTUA 3HO1A 3P38A 4DF8A 5AQYA 2GV9A 1WSGA 4E7LA 2HHTA 4NCBA 5HOOA 2UXCK 4KTZA 2RKIA 5KI6A 3V81A 4M3YA 1SZ2A 1RT4A 3RSEA 3J81O 4IFVA 1NK4A 1DTTA 4H5WA 1GOCA 3DXKB 2KFZA 2DY4A 4PL7A 1DT9A 3MWPA 3PLAA 3OYNA 1HLUA 1LV5A 3AVBA 2O4IA 1HYVA 3M3ZA 2O8EB 4Z94A 1FW6A 5EX5A 4LSNA 1D4XA 3KK7A 4EHUA 1N33K 4I2QA 3ZSOA 1KTQA 3HOSA 2HHSA 3M5RA 1NJYA 1U48A 4DS5A 4M3UA 1SV5A 3QERA 5M1QA 1TUYA 4DTRA 4F9OA 4FLVA 3OS2A 4CJQA 4B08A 2D0PA 1RT3A 4K25A 2FSKA 2W40A 1NGHA 4LH5A 3NH2A 1XHXA 4FLYA 3NMUA 3DXMB 4M7XA 4YORA 3AO3A 2V51B 5AQVA 4CEZA 5F0XA 5HBMA 5AQWA 3C6AA 4FPAA 3DLHA 4ELUA 1WAFA 1C0GA 1LWEA 1BHLA 3WNGA 4AQYK 2PYLA 4JI5K 1KLNA 4GVEA 3S3MA 4OX9K 2UYTA 4FJLA 4H5NA 5ADXA 3SQ1A 3THVA 4AILC 2I7NA 5AQOA 3DXKA 1Y97A 2E6LA 1WAJA 2WTUA 1C1AA 3EYZA 3MXIA 4OO1J 3BDPA 2EX3A 1T7PA 2QEXN 1GLLO 4DF4A 3K2PA 1TL3A 3WNFA 1XNQK 4KFBA 4YOTA 2OCEA 2QWOA 4DSKA 2WC9A 2CGJA 5KTQA 1RGIA 1YI2N 3SUOA 1NGCA 3EKSA 1VQ6N 4BWMA 3T19A 2CGKA 5GAHP 4YOWA 3IMXA 3SAGA 2O8DB 2ITMA 3ATVA 4JLHA 2YHXA 3A5OC 5HRRA 1BCMA 4B8AB 2A42A 2P9LB 3CCMN 1HKGA 3CETA 3IFRA 3LP3A 1VQ9N 3PO5A 4IJNA 1BU6O 3I8DA 3NBPA 2A40A 4N76A 4M3RA 4CJUA 1YTAA 1IBKK 3IUCA 3E9LA 3AA5X 2E1ZA 1N36K 1KLMA 5KQ8A 4LFCK 3K59A 1RTDA 4BWJA 5BPLA 2D0BA 2J4RA 1OVYA 2P9PB 4E7IA 1WBBA 1RTIA 4F2RA 1L3SA 3ZX3A 2B6AA 1NKEA 2P1JA 4LD0A 3ZT3A 5DM7L 4AF1A 2DTUA 5BN8A 4PKIA 1MWKA 2HSTA 1J53A 2Z1GA 1Y64A 3TAMA 2GWKA 3A5NC 3CYMA 4DR6K 4JYAK 3DWLA 4DWIA 4DR1K 4OPKA 3MN7A 3QDKA 4RCHA 4NCGA 3BF3A 3Q7BA 1LAWA 1EO1A 1EX4A 3QO9A 3O4NA 3MN6A 3UKRA 4BROA 4NYFA 2F4VK 3AVCA 1QQMA 2A41A 3CCUN 3I56N 3FZLA 2P9KB 1QE1A 4JV5K 3V9ZA 3DOLA 3U9ZA 3I0RA 3VQDA 2O8CB 4E1NA 3VGMA 3OYIA 5AQPA 4DTMA 2X78A 5AQSA 3O80A 3SPYA 3ZLJA 3K5NA 4PWDA 2F7TA 4O4GA 1VSJA 1C1CA 2HMPA 4FZZA 4O5BA 3ITHA 3VN5A 3SJJA 4ID1A 4N41A 4CJTA 1SKSA 3LALA 5LY3A 3MMVA 5AQFA 3T1AA 3MK6A 4EAHD 4BE1A 4FXDA 4MO5A 1T6DA 4CEBA 3WXKA 1ZYQA 2Q1NA 5JICA 5AZIB 3TANA 3QIPA 3DLEA 4DR3K 1UA0A 3AVGA 3MEEA 1TYQB 3ASMA 3SAHA 4YOVA 1VSDA 3A0IX 3VQ8A 2ATQA 4DS4A 1NLVA 4FK4A 1O13A 3AO2A 4CF2A 1TK0A 4GV6A 3HM8A 4JI1K 5AFUH 4X66K 3VQ6A 4FJ9A 4E19A 3WXLA 4W5RA 4DMNA 3VQ4A 5EOYA 4JKBA 3TSUA 3F5TA 1XI1A 4LFBK 3CHWA 4AM6A 3K5LA 3SV3A 2PFUA 2D5RA 3G4SN 3E66A 4JS5A 3HK2A 1H1VA 1JLCA 3AGKA 4ELVA 4FJNA 3TABA 4M42A 3L4IA 3IG1A 3J8AA 4FCYA 3QLHA 3S9HA 3AY9A 4Z0UA 3ZT1A 4HUGA 3THYA 1W7AA 1RTHA 2YKNA 1U4BA 1BI4B 4DTOA 4FO0A 1HQEA 3WT0A 3FFIA 3OW2M 3AVHA 1EKEA 2QWLA 1EQYA 3F9KA 3TSQA 3OYDA 3VGKA 4AHUA 1SKRA 4FSVA 1XHZA 1UA1A 4FLUA 1NJWA 3O4WA 3AO1A 4QS8A 3OYCA 2O4GA 1VQ8N 4DTPA 4BC5A 1VSHA 4E7HA 1E4FT 1JLGA 4CECA 2E2OA 5E84A 3MN5A 3D2EB 2HBJA 2X74A 3MAQA 1U47A 3SZ2A 4JHDA 1S22A 3L2UA 3LZIA 2P9NA 4FWPA 3OS1A 1T6CA 4CBXA 3FZFA 1NGDA 2E4LA 3VEOA 3VERA 4Q0BA 3F9MA 3SNNA 1N8RO 2W42A 4Y1DA 1I39A 1S6QA 1KD1O 3QEVA 1RDCA 3OJSA 1GOAA 3TAGA 4I6MA 1RT5A 3DLKA 1OVQA 3TPQA 1TKDA 3NCIA 2O8CA 5DK5A 4A62A 5GINA 2QWQA 3E9OA 4FVUA 1Z26A 3BUZB 1NKBA 3PUFA 4MDAA 3NH0A 5FROA 5M1KA 2NNWA 3LDOA 4EZ9A 5HRSA 3QNOA 1NGFA 1KFSA 3ENBA 4UY8O 4IWVA 1C0FA 5AQHA 3JSMA 2QKKA 4FJGA 1CZBA 2IOCA 3DRSA 1S1TA 3F73A 4GNIA 2E6MA 1VSMA 2Q97A 1KVBA 2OZSA 4WQ4C 3CQXA 3HSCA 4OPHA 3VQCA 1BQNA 3ZSZA 2Z1HA 3BGRA 4DUYK 1KVAA 2ZGYA 4DV1K 3AARA 3LWLA 1LAVA 4NXNK 3O3FA 1OH5A 2NRVA 3C0BA 4BE0A 1RBRA 3G6EN 3KIOA 4CEFA 5J2QA 3G71N 4DU3A 4M3ZA 1VSFA 4KHSA 4FWMA 2ETJA 5IWAK 3K58A 4GV9A 4CESA 3TI0A 3SBGA 3EL2A 3VQ5A 4NYNA 2A1SA 5AZJA 3AAPA 5AQQA 3QBWA 3QB0A 1VQKN 4KHNA 1P90A 1HR0K 2O8DA 2YNHA 3C6TA 5C25A 4RG8A 5T7BA 1EWQA 4IOCL 1SQKA 3K5OA 3ALYA 3ID6A 5AR0A 3NGZA 2RE2A 2KTQA 2YNFA 4CFAA 4JNEA 4IOAL 4JAXA 4CZGA 4H5TA 2YJFA 3T3FA 1E3MA 4BRHA 4E89A 2GWJA 3UB5A 4DUZK 2OYQA 2OTJN 1X3NA 1RDAA 4K41A 2VGNA 2CH5A 3LDLA 1QHTA 3M8SA 2QKBA 2B5JA 2EWSA 2P9UB 4GW6A 3FZMA 3SCXA 1W2BM 5E41A 4FWLA 1B9DA 2OPSA 4JK7A 4BC2A 4YNQA 3T1YK 1QZ6A 3ZSVA 4B9TA 3VESA 4CFCA 3QEIA 3RRGA 3D2FA 4O44A 3ZYYX 4MFBA 5JVHL 5BREA 4ILGB 1D9FA 1CXUA 3ZETA 4CJEA 3TAEA 2QWMA 1IKYA 2O8EA 2KLAA 4F3TA 5J2PA 3CFOA 5CHIA 3AA3A 1TYQA 3QFUA 1NK7A 3E9PA 1S72N 5A2QO 3M8PA 1KVCA 3OYKA 4YY3K 1QVFM 3UE5A 1NGAA 3DJCA 3V1OA 2OANA 3CM5A 4JI2K 1ZBUA 2O8FB 4IO8A 4J2AA 1YVUA 4W5OA 1S1VA 4AHTA 1C6VA 3R6MA 2WONA 4B9MA 5AQJA 1RBUA 3TAQA 4W5NA 5FPMA 3RMAA 1N34K 3CC2N 5J1EA 1HNWK 4DV3K 4KHWA 1QQCA 4WFNL 5CYQA 3BZCA 3CJ1A 2ZJRL 3FGUA 2FF6A 1QZ5A 3OYLA 3THXA 4CVNE 1GLAG 2ZQBA 4BRIA 2BUPA 1VQLN 4WFAL 1GLDG 4DV4K 3OS0A 3LP0A 4BRAA 4BE2A 1JXEA 3B6OA 3OYJA 1DEJA 3WNHA 3R9PA 3MCPA 3ZX2A 5CZ2A 1N32K 4LC9B 3M6GA 4F4KA 3VMFB 5FRNA 2BGGA 1NG9A 4ZTJA 4CBWA 5D3GA 3ZETB 4BRMA 3CJ7A 3U8XA 3L2RA 5C24A 3ENOA 2YHWA 4DSIA 3T1HK 3AVJA 5BPNA 3D2FB 5EXWA 4DG1A 3KVGA 3CJAA 3OY9A 1TV6A 1S1XA 2VG7A 3TAFA 3LDPA 3LAMA 3KK3A 5I9EB 4FM0A 2VQFK 3LDSA 4Z4IA 3H45C 3SI6A 2O8BB 2VWBA 5FDLA 2NRZA 5J2MA 2NUBA 2Q0RA 3EN9A 3HM9A 1RCHA 1ZBHA 3EO3A 4Y1CA 4BC3A 1NK0A 2IC3A 4BRQA 2PYJA 4JEPA 4BG9A 1EXQA 1VSIA 2I7PA 3O9SA 4H5RA 4FW2A 4R79A 2P51A 3V9XA 1BOTO 3BY5A 5C10A 3O9UA 5KPZA 3O1WA 4B3TK 1NGJA 2NRXA 5I42A 1BIUA 1UWBA 2HHVA 4FM1A 1K73O 3OVNA 1WB9A 2YNIA 2YHYA 3QEXA 1T44A 5AQLA 2KQ2A 2AA4A 4FJ5A 3JAMO 2E2NA 3QBXA 1BA1A 4WE1A 3OHRA 1BWFO 4O5FA 3C7NA 2ZJQL 3RWUA 3ULDA 4K8ZA 4CFDA 2ZGZA 4LF6K 1X9SA 5MLCQ 3IS9A 2GUIA 4CGHA 3VEVA 2QA4N 3HJFA 3LANA 1QQNA 5JVGL 4H4MA 2V52B 4MQ3A 2E20A 4BGBA 1S3XA 3TSPA 4NB4A 3E1YA 3NGIA 3OYFA 4OLBA 3DRPA 3HI0A 3P39A 2IVNA 3EE9A 1HUXA 1WSJA 3VQEA 4U67L 5AJ3K 1U49A 4DSEA 1Z05A 2ZE2A 1Q9YA 1CXQA 3QEPA 3H46O 4CJPA 3SQ4A 1HPZA 2F96A 1DTQA 3NF6A 1LWCA 1SL1A 4YOUA 4HTUA 1VSEA 3KLEA 2QK9A 1ASUA 3OYMA 4DQ8A 3NFAA 4O0JA 3SUNA 3SQ2A 3LM2A 4DCHA 3HVTA 4RW8A 5AQIA 2DPNA 3VA3A 4CIFA 2HHXA 3SBTA 3H3NO 3KLGA 1HRHA 4XH1A 3AVLA 1K6YA 2QM1A 3ZT0A 4J2DA 2YV0X 4BDZA 2D0OA 1YVNA 5IT9O 2ZWHA 4BVOA 1GLCG 4TSXA 2PZSA 2ZJPL 3BP8A 2FXUA 1VQON 4JHDB 5DM6L 4M7YA 3D2EA 4LF9K 3LZJA 1NGIA 4OKEA 3OA9A 4DB3A 4B1ZA 4B9UA 3RMCA 3AVMA 1VQ7N 5H1SQ 1SL0A 1WSFA 4A59A 3CMEN 2ASMA 5SWMA 1HKBA 4ISEA 1BCOA 4CJ4A 2A1RA 4PKGA 2WBNA 1IO2A 3UKRB 4JKFA 1NM1A 3KLFA 1NOYA 3KLIA 5M1FA 1D5AA 2JLEA 4U7BA 5FPDA 1YJWN 4CK1A 4CERA 4C23A 2V7ZA 4C8MA 2AJQA 5TKWA 2HBMA 3P4IA 2IDOA 2P9NB 4FWRA 3O8MA 2YCHA 4X65K 2E8AA 4NXMK 2UXBK 4FLZA 3FZHA 4CF0A 4DFMA 4HHTA 4RW7A 3CC4N 5KGXA 3NVKA 4G1QA 4FJHA 4H03B 4O8KA 2GEMA 4EHTA 4ISGA 3U9DA 2I5JA 3A5MC 5KPRA 2Y1JA 3J80O 3CMAN 4KAZA 4AHCA 4BQZA 3CCVN 4F2SA 3VQPA 1QSSA 4PUOA 2GTDA 4IEEA 4BRDA 2Q3SA 4FLTA 3LDQA 4BDYA 3VOVA 1JCFA 4AHRA 4CK3A 3ZCMA 3QFPA 2Q0UA 5LJWA 3VQ9A 1LW2A 5C42A 5GIOA 3KK2A 2OTLN 3I8BA 4KV8A 1K8KB 3MECA 4Z4HA 1SUQA 2WOMA 3PSFA 3SPZA 3L0QA 4BREA 4KI6A 1LW0A 4KTQA 5AQKA 4PQUA 4KBOA 1HNZK 2P9KA 3NVMA 1NBWA 2Q36A 4DV0K 3SUQA 2QWNA 3GDQA 1HNXK 3BF1A 2IIRA 5CZ1A 3VA0A 4K8XA 4JK8A 4IJAA 3HZ6A 3CJ9A 1F21A 4DTNA 3DAWA 1Z6RA 3VTHA 3I55N 4FJJA 4CI6A 1YF5L 4W5QA 4DFPA 3C7NB 2V7YA 4OJRA 5TKYA 3CJCA 3H1VX 1XC3A 1NK6A 5M1OA 1Q82O 5I3UA 4FM2A 5AQNA 4Z4EA 3QEWA 1G15A 2HHHK 4X64K 3FLCO 4BR0A 4CEAA 4BG8A 4IEIA 2KFNA 1T3VA 1KAZA 4DV6K 1WNSA 3CCQN 1YXQA 3DLRA 4IFEA 2FLOA 1WSIA 4HUEA 3C95A 1CZ9A 3HPHA 3HRGA 4BACA 1W9HA 4XEIA 4W5TA 2NRWA 4FLXA 3DLBA 1L3UA 1RDBA 4H0PA 2HB5A 4CGFA 4CHNA 1ASVA 1G99A 1V4TA 1YUWA 4FL9A 4WQ5A 3ZSXA 4EIAA 2G8FA 1BIZA 4MLEA 3AA4A 3RSEB 3UIQA 4KH5A 2CGLA 3SJHA 1TAUA 1RFQA 1RT7A 2ASOA 2HF4A 4Y0WA 5AQGA 4XIUA 2A5XA 1EWRA 1R59O 4FW1A 3JS6A 1BI4A 1BG3A 2X6SA 4HCCA 4JKDA 4BY9C 1YHQN 4B9NA 2BE2A 1QSYA 3U4LA 3CCJN 4YHHK 3M8QA 3HPOA 2NRRA 1ATRA 4BQLA 4X62K 3TAPA 3VEZA 2CH6A 2ZF5O 4KREA 3PX0A 3PO4A 2D0CA 4WF9L 3PX6A 4CW7B 4KHPK 2UUCK 2D0AA 4K42A 1JLBA 5FLXO 2UUAK 3ENHA 1YJ9N 1XQSC 1QVGM 4QS9A 3OTOK 2W6LA 4CZLA 5J2NA 1BO5O 3U3GA 3AVAA 4LF4K 4JKGA 3AVFA 3AVIA 4FWNA 1BDGA 4E1JA 1WSHA 2OA8A 4OKKA 2KHOA 4BRGA 2G8WA 1JJ2M 3CFRA 2H3GX 3AO5A 3W0LA 4FOEA 1DLOA 3HSTB 1IKXA 3TTCA 3THWB 4KO0A 3DLGA 2GX9A 4B9VA 4I6MB 3FZKA 2W41A 2QI2A 1QQOA 3KLHA 4ID5A 2FBYA 3H08A 4B3MK 4YOYA 3EE8A 4BRNA 4CEEA 4ZHRA 1RBTA 4HUFA 1QHAA 4JI4K 3B8AX 4CHPA 1HX1A 5LL6Z 4I2PA 2HHUA 2XY5A 5HROA 1KAYA 1N6QA 4GVMA 1IJJA 3L2VA 4HTLA 4K0KK 1J5OA 5EY4A 1QS4A 3SMPA 3KWGA 3RMBA 3HL8A 3SMSA 1S9GA 1TVRA 5AQXA 4FWQA 1JL1A 3MN9A 4DV5K 4B3RK 4N47A 5KRTA 1M1KO 4CJ7A 1SL2A 4M3WA 2NZTA 4FZYA 5CY4A 4BGAA 4UQGA 1VSKA 4CZEA 5AFUA 3OYGA 4FJMA 1JL2A 3RTVA 1S6PA 4PA1A 4A2BA 4C8OA 3WEEA 3NF8A 2NRTA 4B1WB 1REVA 3CQ8A 1VAZA 2HW3A 1GLFO 3C6UA 4H0OA 4ICLA 1X9WA 1C0MA 4AM7A 1VK0A 1VQPN 3J7AP 1BL3A 2HF3A 1Q86O 5LMUK 4JI7K 1VSLA 4JKGB 4KKOA 5ELZA 1WSEA 2FBXA 4DV2K 1BISA 2WFBA 4CGDA 1K8AO 2P9IA 3AA2A 5SZTA 1K8KA 4L3QA 2YI1A 1C1BA 2P9LA 4NO7A 3E01A 2HNYA 4YOXA 2HHWA 1P8ZA 1NK8A 2VYPA 1KSPA 3D7EO 3TTDA 3WEEB 3THWA 4J2EA 3CERA 1N5YA 3CCRN 5C0YA 4BRFA 4CF9A 3SAFA 3B6PA 1WN7A 3V9SA 2F9WA 4YDUA 3V1RA 3RMDA 3LWMA 4DLEA 2OPQA 3AAQA 4BR4A 3K5MA 3DMJA 4CZHA 1NMDA 3K57A 3LM9A 5JLHA 4IO9L 4B3OA 2FBTA 4FPBA 1RT6A 1ZBLA 4F8RA 4RWTA 4B9LA 3KD1E 2QTDA 4DR4K 1U2VB 3SV4A 3LP1A 3S3OA 2QXLA 3O9QA 4OVLA 3VF6A 3KKRA 3PSIA 1U04A 1FXXA 2PY5A 1VQ4N 1IG9A 2RPIA 2AP1A 2HHQA 4CJLA 3BEXA 3ZSRA 1BGXT 1T8EA 1WBDA 4BRKA 3N4PA 4IOXA 1KQSM 1YAGA 5KPTA 3M8RA 4BR9A 3IKMA 1TKZA 5GADP 1XMQK 1NWKA 2UUBK 2P9PA 1JLFA 3MEDA 4M45A 1CZAN 4CHQA 4ZTFA 3G10A 3ZEUB 1X3MA 2KW4A 5LMNK 1LOTB 3O9TA 5HP1A 1JCEA 2VWJA 2ITGA 4B8CA 3V1QA 3CPWM 2Q2RA 3KK1A 4C8LA 1J6ZA 4WQ5C 4WFBL 1TKXA 1WOQA 5C12A 4JI6K 1YIJN 3KTQA 3O08A 4E0DA 1A5XA 3R3LA 3RVCA 3GBTA 3DRRA 5KRSA 4DSJA 3QNNA 4M63C 1OH8A 3P1GA 2A3ZA 3D0PA 4NCAA 1NK9A 3CCLN 3A5LC 4DTSA 4QS7A 3OYBA 3H6EA 3SQ0A 3O3GA 4EZ6A 1C0TA 1S5JA 4CJFA 4B1XB 1ILYA 2VG6A 4LF5K 3SK3A 2F9TA 3G0ZA 2JWLA 3A8YA 1LCUA 5AQUA 4HVJA 4CJSA 4FOIA 1A5WA 4ILHA 2HNZA 4JD2A 3L4QA 3V9UA 3EKUA 4KH4A 4R5PA 2KKZA 3IRXA 2E1YA 1B92A 4IDHA 4I7FA 3CCEN 1RBSA 4PY5A 2D1KA 1XWLA 2G8VA 4DTJA 4KB1A 3ZSWA 3EEQA 3N4QA 1L3TA 4M3TA 1IKVA 4CIGA 3VEYA 2XY7A 1ZBFA 1FJGK 2QXFA 3O9RA 5KQDA 5JS2A 2HNDA 4XH4A 1NGGA 1TKTA 1KCFA 1RDUA 1WUAA 4I9LA 2VCPA 3TARA 1J9AA 2GELA 2FF3B 1RBVA 3HP9A 3HTVA 4FWKA 3KWIA 2OPPA 4DR5K 4QOZB 3DI6A 4Z4CA 3O3HA 3VF4A 3QESA 2P5GA 1X9JA 1IH7A 3HT3A 2G8IA 2F8TA 4CEQA 3VF2A 2VQEK 4CJ3A 1B9FA 1SAZA 3I0SA 4JK9A 1NJXA 4C1NK 3MCAB 5BPMA 2KZMA 1XNRK 1SS6A 2IVOA 4FJKA 1KAXA 3A2FA 4BC4A 1TK5A 5KGWA 3WXJA 4MO4A 5DMRA 5LJVA 4DV7K 4N56A 1VRUA 2X6NA 4XH5A 4PKHA 2P9UA 3G25A 2Z1IA 4DU1A 2WUSA 3J7YP 1ZC6A 1X1PA 4JKAA 1RDWX 3QIOA 1BA0A 4H0YB 3NAEA 3L3UA 4JD2B 5M1PA 3C6HA 1ESVA 2JWKA 1J54A 1IBLK 4CJKA 3RRHA 3TTFA 2YHAA 5BR9A 3F2KA 3THXB 1ZXOA 3SUPA 5JLFA 4DQIA 3WQTA 3TR8A 4OKJA 4CEDA 4GMJB 2UU9K 2RN2A 1KFDA 4CZIA 1Q81O 5K14A 3O6WA 2XY6A 1HQUA 3WXMB 3MX2A 2E88A 5GIPA 4JKHA 3ISNC 2RF2A 4IZ9A
chains in the Genus database with same CATH topology
4CGFA 2RKIA 5KI6A 3VQAA 2VWKA 4CHNA 1ASVA 1TL1A 3EZ5A 3V81A 1RDAA 4CHZA 2G8UA 1QTMA 4M3YA 1RT4A 1S9EA 2F8SA 4IFVA 1NK4A 1DTTA 1QHTA 3ZT4A 3ZSXA 3M8SA 2G8FA 1GOCA 2B5JA 2QKBA 1BIZA 4GW6A 4C8KA 3AA4A 4RW9A 3UIQA 2KFZA 3SCXA 2DY4A 1TAUA 4AHVA 1RT7A 5E41A 1B9DA 3OYNA 1S1WA 1W0HA 2OPSA 3AVBA 4CK2A 4XIUA 1LV5A 3V9WA 2O4IA 1HYVA 4H8KA 3JYTA 4YNQA 2YKMA 4H4OA 3L3VA 4FW1A 3ZSVA 4FJ8A 4B9TA 1BI4A 4LSNA 3RRGA 4CFCA 3QEIA 2Z1JA 2X6SA 4HCCA 2IS3A 2G8HA 1C0UA 2BANA 4O44A 4I2QA 3ZSOA 1KTQA 4B9NA 4MFBA 2HHSA 3KKSA 1NJYA 1U48A 2BE2A 4DS5A 1QSYA 4M3UA 1SV5A 1NKCA 1CXUA 3QERA 3HPGA 3M8QA 4CJEA 4E7KA 4CFBA 3TAEA 1D9FA 3HPOA 1IKYA 4F3TA 4Z4FA 5J2PA 3CFOA 3V6DA 4DTRA 3NH1A 1HMVA 3AA3A 3CG7A 2XHBA 4FLVA 4CIEA 3OYHA 3OS2A 2HVHA 4CJQA 1NK7A 4B08A 3OYKA 3M8PA 1KVCA 1RT3A 3TAPA 4KREA 3PX0A 3SYZA 3P5JA 3V1OA 3PO4A 2D0CA 3CM5A 4I9QA 4LH5A 3NH2A 3PX6A 1XHXA 4LH4A 1ZBUA 4FLYA 1RDDA 2D0AA 1JLBA 5HLFA 1YVUA 4J2AA 4W5OA 1S1VA 1O1WA 4AHTA 1C6VA 2WONA 4B9MA 4W5NA 1RBUA 3TAQA 3AO3A 5J2NA 1Z25A 1SKWA 3U3GA 3AVAA 4CEZA 3PY8A 4FJIA 3RMAA 3C94A 5HBMA 5J1EA 3AVFA 3AVIA 2OA8A 3DLHA 4ELUA 1QQCA 1WSHA 1KRPA 4KHWA 1WAFA 1LWEA 4OKKA 5CYQA 2G8WA 1BHLA 3WNGA 3OYLA 1NK5A 2PYLA 4E1MA 1KLNA 3S3MA 3ZSYA 3CFRA 4DTXA 4DFJA 3AO5A 4CGIA 2ZQBA 4FJ7A 1DLOA 3HSTB 4FJLA 1HNIA 4CE9A 1IKXA 3SQ1A 3THVA 4KO0A 4CHOA 4AILC 3DLGA 1Y97A 2E6LA 4QAGA 3OS0A 3LP0A 1WAJA 4B9VA 1C1AA 3EYZA 4BE2A 3MXIA 3BDPA 1YT3A 1JXEA 3B6OA 3OYJA 2EX3A 1QSLA 3WNHA 1T7PA 4DF4A 3K2PA 1TL3A 3KLHA 3WNFA 4DQSA 4ID5A 2FBYA 3H08A 4KFBA 5CZ2A 2FBVA 3AVKA 4CEEA 4DQQA 1A5VA 4ZHRA 1RBTA 1FKPA 4HUFA 2HMIA 4DSKA 3VQ7A 4CHPA 4F4KA 3MXJA 5KTQA 5FRNA 2BGGA 4I2PA 3SUOA 3KD5E 4ZTJA 2HHUA 2XY5A 5D3GA 3OYEA 5HROA 1N6QA 3L2RA 4GVMA 1RILA 4FLWA 3LP2A 5C24A 3L2VA 1NOZA 3AO4A 4DSIA 3DM2A 3AVJA 4CJRA 4BWMA 3T19A 4DG1A 1J5OA 4KPYA 4FYDA 1QS4A 3OY9A 3RMBA 1TV6A 1S1XA 3HL8A 4KHUA 4HCBA 2VG7A 3HP6A 3TAFA 1S9GA 3LAMA 1TVRA 3KK3A 1JL1A 4FM0A 4JLHA 3LDSA 4Z4IA 3SI6A 1BQMA 5FDLA 5J2MA 2GBZA 2NUBA 4N47A 5KRTA 5HRRA 3NGYA 1BCMA 3P83D 4B8AB 3HM9A 3CFPA 1SL2A 4M3WA 1RCHA 1ZBHA 3AVNA 4Y1CA 1NK0A 5CY4A 2IC3A 4FZYA 4UQGA 3LP3A 2PYJA 1VSKA 3OYGA 4FJMA 3L2WA 3PO5A 3I8DA 1EXQA 1JL2A 1S6PA 3NBPA 1VSIA 3RTVA 4N76A 4PA1A 4M3RA 4CJUA 4FW2A 4YFUA 1YTAA 4C8OA 2DFHA 3NF8A 2P51A 3AA5X 3V9XA 1KLMA 1REVA 3CQ8A 2HW3A 3C6UA 4ICLA 3NHGA 1X9WA 3NF7A 3K59A 1C0MA 1RTDA 4BWJA 1VK0A 2D0BA 1L3VA 2Y1IA 1BL3A 5I42A 1VSLA 1BIUA 4KKOA 1UWBA 2HHVA 4FM1A 4E7IA 3OVNA 1SKRA 1RT2A 1RTIA 1WSEA 2YNIA 2FBXA 3L2QA 3QEXA 1L3SA 4F2RA 2B6AA 1NKEA 2KQ2A 1BISA 2P1JA 4LD0A 1I3AA 3ZT3A 4CGDA 4FJ5A 4CF8A 3AA2A 5SZTA 1JLEA 3L8BA 4L8RB 2DTUA 3HYFA 3ZSQA 1JLQA 1J53A 2Z1GA 1FK9A 4WE1A 2XRIA 1C1BA 3TAMA 1X9MA 4Q5VA 1HJRA 3RWUA 3ULDA 3CYMA 3S3NA 3E01A 2HNYA 4DWIA 3D45A 4K8ZA 3ZT2A 4OPKA 2HHWA 4CFDA 4DSFA 4JRPA 1NK8A 1KSPA 4NCGA 1LAWA 4J2EA 4AH9A 1EX4A 3QO9A 1X9SA 3O4NA 3IS9A 1N5YA 2GUIA 4CF9A 2YHBA 4CGHA 4CEOA 4NYFA 3B6PA 4QCLA 1WN7A 3AVCA 3HJFA 3LANA 3HXMA 3V9SA 4FJXA 3V1RA 3RMDA 4H4MA 2OPRA 3LWMA 4MQ3A 3U6FA 1D8YA 4DLEA 2OPQA 1QE1A 3K5MA 1TAQA 3DMJA 3V9ZA 3DOLA 3I0RA 3VQDA 4FK2A 4E3SA 3NGIA 3K57A 4DU4A 4E1NA 3OYFA 4CGJA 3OYIA 4OLBA 3DRPA 4IDKA 4DTMA 2X78A 4B3OA 2FBTA 3SPYA 4CJVA 1RT6A 1VRTA 3K5NA 1ZBLA 4F8RA 4PWDA 3NF9A 4FVMA 1WSJA 3VQEA 4O4GA 1VSJA 2IGIA 4F3OA 1C1CA 4B9LA 4FZZA 4O5BA 3KD1E 1U49A 3ITHA 4KB0A 4DSEA 2ZE2A 3VN5A 1Q9YA 2HVIA 3SJJA 4ID1A 1CXQA 5HRPA 3QEPA 4N41A 4CJTA 4KI4A 4JRQA 3SV4A 4CJPA 3LP1A 3LALA 4JS4A 3SQ4A 3S3OA 1SKSA 1HPZA 1R0AA 2F96A 4OGEA 3IAYA 1EP4A 4OVLA 3KKRA 4IG0A 1DTQA 3NF6A 3T1AA 1LWCA 3NDKA 1SL1A 4HTUA 4BE1A 4FXDA 1U04A 1FXXA 1JKHA 3DOKA 2PY5A 1IG9A 2RPIA 1VSEA 2HHQA 4CEBA 4CJLA 1S1UA 3KLEA 1ZYQA 2QK9A 3ZSRA 3TANA 1BGXT 1ASUA 3DLEA 3QIPA 4M41A 3OYMA 1UA0A 3AVGA 1T8EA 3NFAA 3MEEA 3ASMA 4O0JA 3SUNA 3SQ2A 1VSDA 3VQ8A 2ATQA 4DS4A 3HVTA 4AHSA 4M3XA 4RW8A 3AO2A 4FK4A 3M8RA 1UAXA 1T03A 3QINA 4BDPA 1TKZA 4CF2A 1TK0A 3VA3A 4KRFA 4CIFA 2B4JA 2HHXA 1JLFA 3MEDA 2BDPA 4M45A 4CHQA 3HVRA 4ZTFA 1RT1A 4KHQA 4EP5A 1D9DA 3LAKA 3VQ6A 3KLGA 4FJ9A 4E19A 1HRHA 3G10A 1L5UA 5JS1A 4FK0A 4W5RA 3AVLA 4DMNA 2KW4A 3VQ4A 1K6YA 3OYAA 5EU7A 3ZT0A 4J2DA 5HP1A 1XI1A 2YV0X 4BDZA 2VWJA 3OJUA 2ITGA 3K5LA 4B8CA 3V1QA 3SV3A 1RNHA 2D5RA 3KK1A 4C8LA 4CJ5A 3PV8A 4JS5A 3HK2A 4IBNA 4RW4A 1JLCA 3LPTA 4ELVA 4DFKA 4DTUA 1TKXA 2YNGA 4ELTA 4TSXA 2PZSA 2VG5A 4FJNA 3TABA 4CCHA 4M42A 3IG1A 4FCYA 3QLHA 3S9HA 3KTQA 4Z0UA 1A5XA 4E0DA 3ZT1A 4HUGA 4OGCA 1RTHA 2YKNA 1U4BA 1BI4B 2DFFA 4DTOA 3DRRA 4B9SA 5KRSA 3LZJA 4OKEA 1HQEA 4DSJA 3QNNA 3FFIA 3AVHA 3P1GA 1EKEA 3F9KA 3D0PA 3KJVA 3OYDA 4NCAA 2LSNA 1NK9A 4KHYA 4KTWA 4B9UA 4AHUA 3RMCA 2FC0A 3AVMA 1XHZA 1UA1A 4FLUA 1NJWA 4DTSA 1WSFA 1SL0A 3AO1A 3OYBA 3OYCA 2O4GA 3O3GA 3SQ0A 4DTPA 4EZ6A 1C0TA 5SWMA 1JXBA 1VSHA 4E7HA 1JLGA 1MU2A 1HYZA 3NE6A 1S5JA 1BCOA 4CECA 4CJFA 4CJ4A 2X74A 3TWHA 2VG6A 3MAQA 1U47A 3SZ2A 2A1RA 1IO2A 1NJZA 3L2UA 3G0ZA 3LZIA 3MXMA 3OS1A 2XO7A 3KLFA 1NOYA 3KLIA 1D5AA 2E4LA 4Q0BA 1CLQA 4HVJA 4IFYA 4CJSA 2JLEA 3SNNA 1A5WA 1WLJA 1TGOA 2W42A 4Y1DA 2HNZA 4CK1A 1I39A 1RTJA 1S6QA 3QEVA 1RDCA 4CERA 3OJSA 4E7JA 4DSLA 1GOAA 4C8MA 3V9UA 3TAGA 5FRMA 2AJQA 4R5PA 4N5SA 3IRXA 1U45A 3DYAA 2P5OA 3CM6A 2IDOA 2DFEA 1B92A 1RT5A 3DLKA 4I7FA 1RBSA 1TKDA 1HNVA 4PY5A 3NCIA 2JGUA 1XWLA 5DK5A 1XC9A 4DTJA 2G8VA 4KB1A 3ZSWA 4IKFA 3QETA 3LPUA 4M3TA 1L3TA 2KZZA 4FLZA 3WNEA 4CF0A 4DFMA 1IKVA 4DLGA 4HHTA 4RW7A 3RR7A 1Z26A 4CIGA 1LWFA 4IG3A 5KGXA 1NKBA 3PUFA 3NH0A 4G1QA 2XY7A 4FJHA 1FKOA 1ZBFA 5FROA 5HRNA 1ASWA 2QXFA 5JS2A 2HNDA 1TKTA 1KCFA 4J2BA 2I5JA 4EZ9A 5HRSA 3QNOA 2Y1JA 4I9LA 1EETA 1KFSA 3U3YA 3TARA 1J9AA 1IKWA 4KAZA 4AHCA 3JSMA 4F2SA 2QKKA 4FJGA 3VQPA 1RBVA 1CZBA 3HP9A 4O0IA 1QSSA 2IOCA 2OPPA 3DRSA 3RR8A 2Q3SA 4FLTA 1S1TA 2OYQA 4PUOA 3F73A 4QOZB 2E6MA 1VSMA 4O55A 4BDYA 2EHGA 3DI6A 1KVBA 4Z4CA 2OZSA 4AHRA 2ZD1A 4CK3A 3O3HA 3ZCMA 3QESA 3VQ9A 3O4QA 1LW2A 1IH7A 3HT3A 2IAJA 4CJWA 1TK8A 5C42A 2P5GA 3VQCA 2G8IA 2F8TA 3KK2A 1BQNA 3ZSZA 4CEQA 2Z1HA 3BGRA 4KV8A 3VQQA 1KVAA 3MECA 4Z4HA 1SUQA 4CHYA 4CJ3A 2WOMA 3SPZA 1B9FA 3I0SA 3MEGA 4C8NA 4KI6A 1NJXA 1LW0A 4KTQA 3LWLA 1LAVA 4PQUA 3O3FA 3SUQA 2KZMA 1Q9XA 4LY7A 4BE0A 1RBRA 5J2QA 1JLAA 3KIOA 5CZ1A 4CEFA 3VA0A 4OLAA 4K8XA 4DU3A 4FJKA 3A2FA 4CF1A 1TK5A 4M3ZA 5KGWA 1T05A 1HYSA 3VQBA 5DMRA 1F21A 1VSFA 4DTNA 4KHSA 1UOCA 2ETJA 1ZBIA 3K58A 3V4IA 4FJJA 4CESA 4N56A 3TI0A 1VRUA 4W5QA 2X6NA 3AV9A 3VQ5A 1Q8IA 4DFPA 4NYNA 4DU1A 2Z1IA 4OJRA 4DQPA 2A1SA 4FZXC 1NK6A 1X1PA 3QIOA 4RW6A 4LSLA 3NAEA 3L3UA 5I3UA 4FM2A 4Z4EA 4DQRA 3QEWA 1G15A 2XY8A 4KHNA 2YNHA 3C6TA 5C25A 2G8KA 1J54A 4RG8A 4CEAA 5T7BA 3EY1A 4CJKA 3K5OA 4OPJA 2KFNA 3PX4A 3ALYA 5CYMA 1WNSA 3RRHA 3DLRA 3NGZA 2R7YA 2YHAA 1ITGA 2KTQA 1GOBA 4CGGA 2YNFA 4CFAA 4EP4A 1WSIA 2OZMA 4Z4GA 3SUPA 4DQIA 1YTUA 3HO1A 3TR8A 4OKJA 4CEDA 4GMJB 2RN2A 1KFDA 4HUEA 4DF8A 3T3FA 3C95A 5K14A 1CZ9A 3HPHA 4E89A 4BACA 1W9HA 2XY6A 1HQUA 2GV9A 1WSGA 4E7LA 4W5TA 4FLXA 3DLBA 4NCBA 1L3UA 2HHTA 3ISNC 1RDBA 2RF2A 4KTZA 2HB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGF A;  2RKI A;  5KI6 A;  3VQA A;  2VWK A;  4CHN A;  1ASV A;  1TL1 A;  3EZ5 A;  3V81 A;  1RDA A;  4CHZ A;  2G8U A;  1QTM A;  4M3Y A;  1RT4 A;  1S9E A;  2F8S A;  4IFV A;  1NK4 A;  1DTT A;  1QHT A;  3ZT4 A;  3ZSX A;  3M8S A;  2G8F A;  1GOC A;  2B5J A;  2QKB A;  1BIZ A;  4GW6 A;  4C8K A;  3AA4 A;  4RW9 A;  3UIQ A;  2KFZ A;  3SCX A;  2DY4 A;  1TAU A;  4AHV A;  1RT7 A;  5E41 A;  1B9D A;  3OYN A;  1S1W A;  1W0H A;  2OPS A;  3AVB A;  4CK2 A;  4XIU A;  1LV5 A;  3V9W A;  2O4I A;  1HYV A;  4H8K A;  3JYT A;  4YNQ A;  2YKM A;  4H4O A;  3L3V A;  4FW1 A;  3ZSV A;  4FJ8 A;  4B9T A;  1BI4 A;  4LSN A;  3RRG A;  4CFC A;  3QEI A;  2Z1J A;  2X6S A;  4HCC A;  2IS3 A;  2G8H A;  1C0U A;  2BAN A;  4O44 A;  4I2Q A;  3ZSO A;  1KTQ A;  4B9N A;  4MFB A;  2HHS A;  3KKS A;  1NJY A;  1U48 A;  2BE2 A;  4DS5 A;  1QSY A;  4M3U A;  1SV5 A;  1NKC A;  1CXU A;  3QER A;  3HPG A;  3M8Q A;  4CJE A;  4E7K A;  4CFB A;  3TAE A;  1D9F A;  3HPO A;  1IKY A;  4F3T A;  4Z4F A;  5J2P A;  3CFO A;  3V6D A;  4DTR A;  3NH1 A;  1HMV A;  3AA3 A;  3CG7 A;  2XHB A;  4FLV A;  4CIE A;  3OYH A;  3OS2 A;  2HVH A;  4CJQ A;  1NK7 A;  4B08 A;  3OYK A;  3M8P A;  1KVC A;  1RT3 A;  3TAP A;  4KRE A;  3PX0 A;  3SYZ A;  3P5J A;  3V1O A;  3PO4 A;  2D0C A;  3CM5 A;  4I9Q A;  4LH5 A;  3NH2 A;  3PX6 A;  1XHX A;  4LH4 A;  1ZBU A;  4FLY A;  1RDD A;  2D0A A;  1JLB A;  5HLF A;  1YVU A;  4J2A A;  4W5O A;  1S1V A;  1O1W A;  4AHT A;  1C6V A;  2WON A;  4B9M A;  4W5N A;  1RBU A;  3TAQ A;  3AO3 A;  5J2N A;  1Z25 A;  1SKW A;  3U3G A;  3AVA A;  4CEZ A;  3PY8 A;  4FJI A;  3RMA A;  3C94 A;  5HBM A;  5J1E A;  3AVF A;  3AVI A;  2OA8 A;  3DLH A;  4ELU A;  1QQC A;  1WSH A;  1KRP A;  4KHW A;  1WAF A;  1LWE A;  4OKK A;  5CYQ A;  2G8W A;  1BHL A;  3WNG A;  3OYL A;  1NK5 A;  2PYL A;  4E1M A;  1KLN A;  3S3M A;  3ZSY A;  3CFR A;  4DTX A;  4DFJ A;  3AO5 A;  4CGI A;  2ZQB A;  4FJ7 A;  1DLO A;  3HST B;  4FJL A;  1HNI A;  4CE9 A;  1IKX A;  3SQ1 A;  3THV A;  4KO0 A;  4CHO A;  4AIL C;  3DLG A;  1Y97 A;  2E6L A;  4QAG A;  3OS0 A;  3LP0 A;  1WAJ A;  4B9V A;  1C1A A;  3EYZ A;  4BE2 A;  3MXI A;  3BDP A;  1YT3 A;  1JXE A;  3B6O A;  3OYJ A;  2EX3 A;  1QSL A;  3WNH A;  1T7P A;  4DF4 A;  3K2P A;  1TL3 A;  3KLH A;  3WNF A;  4DQS A;  4ID5 A;  2FBY A;  3H08 A;  4KFB A;  5CZ2 A;  2FBV A;  3AVK A;  4CEE A;  4DQQ A;  1A5V A;  4ZHR A;  1RBT A;  1FKP A;  4HUF A;  2HMI A;  4DSK A;  3VQ7 A;  4CHP A;  4F4K A;  3MXJ A;  5KTQ A;  5FRN A;  2BGG A;  4I2P A;  3SUO A;  3KD5 E;  4ZTJ A;  2HHU A;  2XY5 A;  5D3G A;  3OYE A;  5HRO A;  1N6Q A;  3L2R A;  4GVM A;  1RIL A;  4FLW A;  3LP2 A;  5C24 A;  3L2V A;  1NOZ A;  3AO4 A;  4DSI A;  3DM2 A;  3AVJ A;  4CJR A;  4BWM A;  3T19 A;  4DG1 A;  1J5O A;  4KPY A;  4FYD A;  1QS4 A;  3OY9 A;  3RMB A;  1TV6 A;  1S1X A;  3HL8 A;  4KHU A;  4HCB A;  2VG7 A;  3HP6 A;  3TAF A;  1S9G A;  3LAM A;  1TVR A;  3KK3 A;  1JL1 A;  4FM0 A;  4JLH A;  3LDS A;  4Z4I A;  3SI6 A;  1BQM A;  5FDL A;  5J2M A;  2GBZ A;  2NUB A;  4N47 A;  5KRT A;  5HRR A;  3NGY A;  1BCM A;  3P83 D;  4B8A B;  3HM9 A;  3CFP A;  1SL2 A;  4M3W A;  1RCH A;  1ZBH A;  3AVN A;  4Y1C A;  1NK0 A;  5CY4 A;  2IC3 A;  4FZY A;  4UQG A;  3LP3 A;  2PYJ A;  1VSK A;  3OYG A;  4FJM A;  3L2W A;  3PO5 A;  3I8D A;  1EXQ A;  1JL2 A;  1S6P A;  3NBP A;  1VSI A;  3RTV A;  4N76 A;  4PA1 A;  4M3R A;  4CJU A;  4FW2 A;  4YFU A;  1YTA A;  4C8O A;  2DFH A;  3NF8 A;  2P51 A;  3AA5 X;  3V9X A;  1KLM A;  1REV A;  3CQ8 A;  2HW3 A;  3C6U A;  4ICL A;  3NHG A;  1X9W A;  3NF7 A;  3K59 A;  1C0M A;  1RTD A;  4BWJ A;  1VK0 A;  2D0B A;  1L3V A;  2Y1I A;  1BL3 A;  5I42 A;  1VSL A;  1BIU A;  4KKO A;  1UWB A;  2HHV A;  4FM1 A;  4E7I A;  3OVN A;  1SKR A;  1RT2 A;  1RTI A;  1WSE A;  2YNI A;  2FBX A;  3L2Q A;  3QEX A;  1L3S A;  4F2R A;  2B6A A;  1NKE A;  2KQ2 A;  1BIS A;  2P1J A;  4LD0 A;  1I3A A;  3ZT3 A;  4CGD A;  4FJ5 A;  4CF8 A;  3AA2 A;  5SZT A;  1JLE A;  3L8B A;  4L8R B;  2DTU A;  3HYF A;  3ZSQ A;  1JLQ A;  1J53 A;  2Z1G A;  1FK9 A;  4WE1 A;  2XRI A;  1C1B A;  3TAM A;  1X9M A;  4Q5V A;  1HJR A;  3RWU A;  3ULD A;  3CYM A;  3S3N A;  3E01 A;  2HNY A;  4DWI A;  3D45 A;  4K8Z A;  3ZT2 A;  4OPK A;  2HHW A;  4CFD A;  4DSF A;  4JRP A;  1NK8 A;  1KSP A;  4NCG A;  1LAW A;  4J2E A;  4AH9 A;  1EX4 A;  3QO9 A;  1X9S A;  3O4N A;  3IS9 A;  1N5Y A;  2GUI A;  4CF9 A;  2YHB A;  4CGH A;  4CEO A;  4NYF A;  3B6P A;  4QCL A;  1WN7 A;  3AVC A;  3HJF A;  3LAN A;  3HXM A;  3V9S A;  4FJX A;  3V1R A;  3RMD A;  4H4M A;  2OPR A;  3LWM A;  4MQ3 A;  3U6F A;  1D8Y A;  4DLE A;  2OPQ A;  1QE1 A;  3K5M A;  1TAQ A;  3DMJ A;  3V9Z A;  3DOL A;  3I0R A;  3VQD A;  4FK2 A;  4E3S A;  3NGI A;  3K57 A;  4DU4 A;  4E1N A;  3OYF A;  4CGJ A;  3OYI A;  4OLB A;  3DRP A;  4IDK A;  4DTM A;  2X78 A;  4B3O A;  2FBT A;  3SPY A;  4CJV A;  1RT6 A;  1VRT A;  3K5N A;  1ZBL A;  4F8R A;  4PWD A;  3NF9 A;  4FVM A;  1WSJ A;  3VQE A;  4O4G A;  1VSJ A;  2IGI A;  4F3O A;  1C1C A;  4B9L A;  4FZZ A;  4O5B A;  3KD1 E;  1U49 A;  3ITH A;  4KB0 A;  4DSE A;  2ZE2 A;  3VN5 A;  1Q9Y A;  2HVI A;  3SJJ A;  4ID1 A;  1CXQ A;  5HRP A;  3QEP A;  4N41 A;  4CJT A;  4KI4 A;  4JRQ A;  3SV4 A;  4CJP A;  3LP1 A;  3LAL A;  4JS4 A;  3SQ4 A;  3S3O A;  1SKS A;  1HPZ A;  1R0A A;  2F96 A;  4OGE A;  3IAY A;  1EP4 A;  4OVL A;  3KKR A;  4IG0 A;  1DTQ A;  3NF6 A;  3T1A A;  1LWC A;  3NDK A;  1SL1 A;  4HTU A;  4BE1 A;  4FXD A;  1U04 A;  1FXX A;  1JKH A;  3DOK A;  2PY5 A;  1IG9 A;  2RPI A;  1VSE A;  2HHQ A;  4CEB A;  4CJL A;  1S1U A;  3KLE A;  1ZYQ A;  2QK9 A;  3ZSR A;  3TAN A;  1BGX T;  1ASU A;  3DLE A;  3QIP A;  4M41 A;  3OYM A;  1UA0 A;  3AVG A;  1T8E A;  3NFA A;  3MEE A;  3ASM A;  4O0J A;  3SUN A;  3SQ2 A;  1VSD A;  3VQ8 A;  2ATQ A;  4DS4 A;  3HVT A;  4AHS A;  4M3X A;  4RW8 A;  3AO2 A;  4FK4 A;  3M8R A;  1UAX A;  1T03 A;  3QIN A;  4BDP A;  1TKZ A;  4CF2 A;  1TK0 A;  3VA3 A;  4KRF A;  4CIF A;  2B4J A;  2HHX A;  1JLF A;  3MED A;  2BDP A;  4M45 A;  4CHQ A;  3HVR A;  4ZTF A;  1RT1 A;  4KHQ A;  4EP5 A;  1D9D A;  3LAK A;  3VQ6 A;  3KLG A;  4FJ9 A;  4E19 A;  1HRH A;  3G10 A;  1L5U A;  5JS1 A;  4FK0 A;  4W5R A;  3AVL A;  4DMN A;  2KW4 A;  3VQ4 A;  1K6Y A;  3OYA A;  5EU7 A;  3ZT0 A;  4J2D A;  5HP1 A;  1XI1 A;  2YV0 X;  4BDZ A;  2VWJ A;  3OJU A;  2ITG A;  3K5L A;  4B8C A;  3V1Q A;  3SV3 A;  1RNH A;  2D5R A;  3KK1 A;  4C8L A;  4CJ5 A;  3PV8 A;  4JS5 A;  3HK2 A;  4IBN A;  4RW4 A;  1JLC A;  3LPT A;  4ELV A;  4DFK A;  4DTU A;  1TKX A;  2YNG A;  4ELT A;  4TSX A;  2PZS A;  2VG5 A;  4FJN A;  3TAB A;  4CCH A;  4M42 A;  3IG1 A;  4FCY A;  3QLH A;  3S9H A;  3KTQ A;  4Z0U A;  1A5X A;  4E0D A;  3ZT1 A;  4HUG A;  4OGC A;  1RTH A;  2YKN A;  1U4B A;  1BI4 B;  2DFF A;  4DTO A;  3DRR A;  4B9S A;  5KRS A;  3LZJ A;  4OKE A;  1HQE A;  4DSJ A;  3QNN A;  3FFI A;  3AVH A;  3P1G A;  1EKE A;  3F9K A;  3D0P A;  3KJV A;  3OYD A;  4NCA A;  2LSN A;  1NK9 A;  4KHY A;  4KTW A;  4B9U A;  4AHU A;  3RMC A;  2FC0 A;  3AVM A;  1XHZ A;  1UA1 A;  4FLU A;  1NJW A;  4DTS A;  1WSF A;  1SL0 A;  3AO1 A;  3OYB A;  3OYC A;  2O4G A;  3O3G A;  3SQ0 A;  4DTP A;  4EZ6 A;  1C0T A;  5SWM A;  1JXB A;  1VSH A;  4E7H A;  1JLG A;  1MU2 A;  1HYZ A;  3NE6 A;  1S5J A;  1BCO A;  4CEC A;  4CJF A;  4CJ4 A;  2X74 A;  3TWH A;  2VG6 A;  3MAQ A;  1U47 A;  3SZ2 A;  2A1R A;  1IO2 A;  1NJZ A;  3L2U A;  3G0Z A;  3LZI A;  3MXM A;  3OS1 A;  2XO7 A;  3KLF A;  1NOY A;  3KLI A;  1D5A A;  2E4L A;  4Q0B A;  1CLQ A;  4HVJ A;  4IFY A;  4CJS A;  2JLE A;  3SNN A;  1A5W A;  1WLJ A;  1TGO A;  2W42 A;  4Y1D A;  2HNZ A;  4CK1 A;  1I39 A;  1RTJ A;  1S6Q A;  3QEV A;  1RDC A;  4CER A;  3OJS A;  4E7J A;  4DSL A;  1GOA A;  4C8M A;  3V9U A;  3TAG A;  5FRM A;  2AJQ A;  4R5P A;  4N5S A;  3IRX A;  1U45 A;  3DYA A;  2P5O A;  3CM6 A;  2IDO A;  2DFE A;  1B92 A;  1RT5 A;  3DLK A;  4I7F A;  1RBS A;  1TKD A;  1HNV A;  4PY5 A;  3NCI A;  2JGU A;  1XWL A;  5DK5 A;  1XC9 A;  4DTJ A;  2G8V A;  4KB1 A;  3ZSW A;  4IKF A;  3QET A;  3LPU A;  4M3T A;  1L3T A;  2KZZ A;  4FLZ A;  3WNE A;  4CF0 A;  4DFM A;  1IKV A;  4DLG A;  4HHT A;  4RW7 A;  3RR7 A;  1Z26 A;  4CIG A;  1LWF A;  4IG3 A;  5KGX A;  1NKB A;  3PUF A;  3NH0 A;  4G1Q A;  2XY7 A;  4FJH A;  1FKO A;  1ZBF A;  5FRO A;  5HRN A;  1ASW A;  2QXF A;  5JS2 A;  2HND A;  1TKT A;  1KCF A;  4J2B A;  2I5J A;  4EZ9 A;  5HRS A;  3QNO A;  2Y1J A;  4I9L A;  1EET A;  1KFS A;  3U3Y A;  3TAR A;  1J9A A;  1IKW A;  4KAZ A;  4AHC A;  3JSM A;  4F2S A;  2QKK A;  4FJG A;  3VQP A;  1RBV A;  1CZB A;  3HP9 A;  4O0I A;  1QSS A;  2IOC A;  2OPP A;  3DRS A;  3RR8 A;  2Q3S A;  4FLT A;  1S1T A;  2OYQ A;  4PUO A;  3F73 A;  4QOZ B;  2E6M A;  1VSM A;  4O55 A;  4BDY A;  2EHG A;  3DI6 A;  1KVB A;  4Z4C A;  2OZS A;  4AHR A;  2ZD1 A;  4CK3 A;  3O3H A;  3ZCM A;  3QES A;  3VQ9 A;  3O4Q A;  1LW2 A;  1IH7 A;  3HT3 A;  2IAJ A;  4CJW A;  1TK8 A;  5C42 A;  2P5G A;  3VQC A;  2G8I A;  2F8T A;  3KK2 A;  1BQN A;  3ZSZ A;  4CEQ A;  2Z1H A;  3BGR A;  4KV8 A;  3VQQ A;  1KVA A;  3MEC A;  4Z4H A;  1SUQ A;  4CHY A;  4CJ3 A;  2WOM A;  3SPZ A;  1B9F A;  3I0S A;  3MEG A;  4C8N A;  4KI6 A;  1NJX A;  1LW0 A;  4KTQ A;  3LWL A;  1LAV A;  4PQU A;  3O3F A;  3SUQ A;  2KZM A;  1Q9X A;  4LY7 A;  4BE0 A;  1RBR A;  5J2Q A;  1JLA A;  3KIO A;  5CZ1 A;  4CEF A;  3VA0 A;  4OLA A;  4K8X A;  4DU3 A;  4FJK A;  3A2F A;  4CF1 A;  1TK5 A;  4M3Z A;  5KGW A;  1T05 A;  1HYS A;  3VQB A;  5DMR A;  1F21 A;  1VSF A;  4DTN A;  4KHS A;  1UOC A;  2ETJ A;  1ZBI A;  3K58 A;  3V4I A;  4FJJ A;  4CES A;  4N56 A;  3TI0 A;  1VRU A;  4W5Q A;  2X6N A;  3AV9 A;  3VQ5 A;  1Q8I A;  4DFP A;  4NYN A;  4DU1 A;  2Z1I A;  4OJR A;  4DQP A;  2A1S A;  4FZX C;  1NK6 A;  1X1P A;  3QIO A;  4RW6 A;  4LSL A;  3NAE A;  3L3U A;  5I3U A;  4FM2 A;  4Z4E A;  4DQR A;  3QEW A;  1G15 A;  2XY8 A;  4KHN A;  2YNH A;  3C6T A;  5C25 A;  2G8K A;  1J54 A;  4RG8 A;  4CEA A;  5T7B A;  3EY1 A;  4CJK A;  3K5O A;  4OPJ A;  2KFN A;  3PX4 A;  3ALY A;  5CYM A;  1WNS A;  3RRH A;  3DLR A;  3NGZ A;  2R7Y A;  2YHA A;  1ITG A;  2KTQ A;  1GOB A;  4CGG A;  2YNF A;  4CFA A;  4EP4 A;  1WSI A;  2OZM A;  4Z4G A;  3SUP A;  4DQI A;  1YTU A;  3HO1 A;  3TR8 A;  4OKJ A;  4CED A;  4GMJ B;  2RN2 A;  1KFD A;  4HUE A;  4DF8 A;  3T3F A;  3C95 A;  5K14 A;  1CZ9 A;  3HPH A;  4E89 A;  4BAC A;  1W9H A;  2XY6 A;  1HQU A;  2GV9 A;  1WSG A;  4E7L A;  4W5T A;  4FLX A;  3DLB A;  4NCB A;  1L3U A;  2HHT A;  3ISN C;  1RDB A;  2RF2 A;  4KTZ A;  2HB5 A; 
#chains in the Genus database with same CATH topology
 3VQA A;  2VWK A;  1TL1 A;  5BRD A;  3EZ5 A;  4CHZ A;  2G8U A;  2F8S A;  1QTM A;  1S9E A;  5M1N A;  3ZT4 A;  4LF7 K;  4C8K A;  1OH7 A;  4RW9 A;  1VQ5 N;  4AHV A;  1S1W A;  1W0H A;  3WQU A;  3TU5 A;  4CK2 A;  3V9W A;  4H8K A;  3JYT A;  4KH6 A;  2YKM A;  5C15 A;  4H4O A;  3L3V A;  5JMV A;  4FJ8 A;  3J7Z O;  2Z1J A;  2IS3 A;  4CZF A;  1C0U A;  2G8H A;  2BAN A;  2E5L K;  3KKS A;  4FWO A;  3T7Z A;  1NKC A;  3HPG A;  4E7K A;  4CFB A;  4A5A A;  3ZX0 A;  1DKG D;  4Z4F A;  3V6D A;  3NH1 A;  1HMV A;  2PAV A;  3CG7 A;  3CPE A;  2XHB A;  4CIE A;  3OYH A;  2HVH A;  3SYZ A;  3P5J A;  4I9Q A;  4H0V B;  4A5B A;  2FSJ A;  4LH4 A;  2E2Q A;  1RDD A;  3CXC M;  3LDN A;  5HLF A;  1O1W A;  3I33 A;  5C2D A;  1U6Z A;  1MWM A;  1Z25 A;  1HKC A;  4H5V A;  3O1B A;  1U2V A;  1SKW A;  3PY8 A;  4FJI A;  4OPA A;  3C94 A;  4ILJ A;  4CZJ A;  1KRP A;  1NK5 A;  1E4G T;  4E1M A;  3ZSY A;  4DTX A;  4DFJ A;  4CGI A;  4FJ7 A;  5FPN A;  1HNI A;  3VET A;  5BR8 K;  4O8U A;  4CE9 A;  4IXC A;  4BR2 A;  4CHO A;  1NGB A;  3DXM A;  4QAG A;  3CI5 A;  4DR7 K;  1YT3 A;  2NRH A;  1Q18 A;  1QSL A;  3GOI A;  2Q31 A;  4DQS A;  4J8F A;  4G9Z A;  2FBV A;  3AVK A;  4DQQ A;  1W97 L;  1A5V A;  3VPZ A;  1FKP A;  4PHT X;  2HMI A;  3VQ7 A;  4DHY A;  1HJO A;  4MLH A;  3MXJ A;  3VEX A;  3PIO L;  4A61 A;  3KD5 E;  3FE1 A;  3OYE A;  5C2F A;  1NNE A;  1RIL A;  2VGM A;  4FLW A;  3LP2 A;  1NOZ A;  3AO4 A;  3DM2 A;  4CJR A;  3K9K A;  4KPY A;  4FYD A;  2QWP A;  3R8E A;  1ATN A;  4HCB A;  4KHU A;  3HP6 A;  4GKK K;  4CZK A;  5CE3 A;  2IVP A;  3VGL A;  1BQM A;  1VQN N;  2GBZ A;  3NGY A;  4HWI A;  3P83 D;  5AZI A;  1GLJ O;  3CFP A;  2D4W A;  3AVN A;  1M90 O;  5B8H A;  3L2W A;  1XMO K;  3IDH A;  1MA9 B;  1TUU A;  4YFU A;  4B1Y B;  3O5B A;  2DFH A;  3UKU B;  3NHG A;  1OKJ A;  3EZW A;  3GG4 A;  3NF7 A;  4B3S K;  3ULE B;  4BRC A;  1L3V A;  2Y1I A;  3L6Q A;  1GLB G;  3CQY A;  1RT2 A;  3L2Q A;  3JXU A;  1GLE G;  3HOT A;  1YIT N;  4CBU A;  1I3A A;  4CF8 A;  3MWT A;  4NLC A;  1JLE A;  3L8B A;  4L8R B;  3HYF A;  3ZSQ A;  1JLQ A;  2ZM6 K;  1FK9 A;  4WQ4 A;  2XRI A;  1X9M A;  4Q5V A;  1HJR A;  3HBT A;  3S3N A;  4BR7 A;  5CR4 A;  3D45 A;  3ZT2 A;  4FWS A;  4DSF A;  1IG8 A;  2HBL A;  3P31 A;  4JRP A;  4LF8 K;  4AH9 A;  1DGK N;  4EFH A;  2YHB A;  4CEO A;  4K43 A;  4QCL A;  2ASP A;  3HXM A;  3QIC A;  2GUP A;  3GE1 A;  2YX6 A;  4FJX A;  2OPR A;  5F2R A;  3U6F A;  1D8Y A;  3Q7C A;  1JCG A;  2YJE A;  5BRF A;  3MDQ A;  1TAQ A;  4FK2 A;  4E3S A;  4DU4 A;  3KHY A;  4CGJ A;  4IDK A;  4CJV A;  1VRT A;  3FR0 A;  3NF9 A;  4FVM A;  1IV0 A;  2IGI A;  4F3O A;  4KB0 A;  3C65 A;  4B1V A;  4GV3 A;  2HVI A;  5HRP A;  4DKW A;  3WUH A;  4B9Q A;  4A57 A;  4JRQ A;  4KI4 A;  4MDB A;  4BRL A;  4JS4 A;  4LFA K;  3IAY A;  1R0A A;  4OGE A;  3S41 A;  1EP4 A;  4IG0 A;  3NDK A;  1IBM K;  3R1X A;  3FFK B;  4WCE L;  3DOK A;  1JKH A;  4NLB A;  1S1U A;  1K9M O;  5FPE A;  4C1N I;  1YJN N;  4M41 A;  4H0X B;  4JN4 A;  3SLC A;  4AHS A;  4M3X A;  5GAG P;  3ID8 A;  1UAX A;  1T03 A;  3QIN A;  4BDP A;  2BH1 A;  4KRF A;  2B4J A;  2BDP A;  3HVR A;  4KHQ A;  1RT1 A;  2RHK A;  4EP5 A;  1D9D A;  4V19 S;  3LAK A;  1KXP A;  5JS1 A;  1L5U A;  1VQM N;  3ULE A;  4FK0 A;  1I94 K;  3OYA A;  3VTI A;  5EU7 A;  5AQZ A;  3UKU A;  1J5E K;  1V4S A;  3OJU A;  4JI3 K;  1RNH A;  4ISF A;  3D6R A;  4CJ5 A;  3PV8 A;  3CD6 N;  1VHX A;  4IBN A;  4RW4 A;  3LPT A;  4DFK A;  4DTU A;  2O8F A;  2YNG A;  4ELT A;  2VG5 A;  3CIP A;  4CCH A;  4OGC A;  3WXI A;  4B9S A;  2DFF A;  5AQT A;  3DLL L;  2P9I B;  1NJI O;  4KHY A;  3KJV A;  2LSN A;  4H0T B;  4KTW A;  5E26 A;  2FC0 A;  3CCS N;  3THY B;  5F1X A;  1ATS A;  1Q7Y O;  1KC8 O;  1JXB A;  5BN9 A;  1MU2 A;  1HYZ A;  3NE6 A;  4CD1 A;  3TWH A;  5EVZ A;  2UXD K;  4BR5 A;  3CC7 N;  1NJZ A;  3MXM A;  2XO7 A;  3QML A;  1XUP O;  2QWR A;  1CLQ A;  4IFY A;  1WLJ A;  1TGO A;  3MX5 A;  1RTJ A;  4E7J A;  4DSL A;  3LL3 A;  5FRM A;  4N5S A;  1U45 A;  2P5O A;  3DYA A;  4B1U B;  3CJB A;  3CM6 A;  3GL1 A;  2DFE A;  4CD3 A;  3T69 A;  1HNV A;  3VEN A;  3M1F A;  2JGU A;  3CF5 L;  1XC9 A;  4IKF A;  3QET A;  3LPU A;  2KZZ A;  2P9S A;  3WNE A;  4BVP A;  4DLG A;  1NGE A;  3K9J A;  1BUP A;  3RR7 A;  1LWF A;  4IG3 A;  5BRH A;  2FSN A;  2E2P A;  2W6K A;  1FKO A;  1ZBS A;  5HRN A;  1ASW A;  5GAE P;  4J2B A;  5ADX H;  3ATU A;  1EET A;  3U3Y A;  1IKW A;  3K0S A;  3AGR A;  4WYB A;  4O0I A;  3RR8 A;  2NLX A;  4JKE A;  4O55 A;  1HPM A;  2EHG A;  4JI0 K;  2ZD1 A;  4BRP A;  1NMN A;  3ZEU A;  3O4Q A;  1TK8 A;  3VEW A;  2IAJ A;  4CJW A;  4CZM A;  1OH6 A;  3H1Q A;  5AQM A;  3VQQ A;  4CHY A;  2O8B A;  2P9S B;  5AQR A;  3MEG A;  4C8N A;  3W3D A;  3KZB A;  4A2A A;  5HL7 L;  1Q9X A;  2PBD A;  4GY2 B;  4LY7 A;  4JI8 K;  1JLA A;  4OLA A;  4YDU C;  3OBY A;  3BZK A;  4CF1 A;  1HYS A;  1T05 A;  3VQB A;  1UOC A;  1ZBI A;  3V4I A;  3OBW A;  4DR2 K;  3AV9 A;  1Q8I A;  3H3O B;  4PL8 A;  4DQP A;  4FZX C;  4JKC A;  4RTF D;  2HOE A;  4RW6 A;  5AZJ B;  4LSL A;  2A6A A;  1NU0 A;  4DQR A;  2XY8 A;  4GKJ K;  2BTF A;  2G8K A;  3EY1 A;  4OPJ A;  2HBK A;  3PIP L;  3PX4 A;  5CYM A;  2QW9 A;  2R7Y A;  1MDU B;  1ITG A;  1GOB A;  4CGG A;  4EP4 A;  4Z4G A;  2OZM A;  1YTU A;  3HO1 A;  3P38 A;  4DF8 A;  5AQY A;  2GV9 A;  1WSG A;  4E7L A;  2HHT A;  4NCB A;  5HOO A;  2UXC K;  4KTZ A;  2RKI A;  5KI6 A;  3V81 A;  4M3Y A;  1SZ2 A;  1RT4 A;  3RSE A;  3J81 O;  4IFV A;  1NK4 A;  1DTT A;  4H5W A;  1GOC A;  3DXK B;  2KFZ A;  2DY4 A;  4PL7 A;  1DT9 A;  3MWP A;  3PLA A;  3OYN A;  1HLU A;  1LV5 A;  3AVB A;  2O4I A;  1HYV A;  3M3Z A;  2O8E B;  4Z94 A;  1FW6 A;  5EX5 A;  4LSN A;  1D4X A;  3KK7 A;  4EHU A;  1N33 K;  4I2Q A;  3ZSO A;  1KTQ A;  3HOS A;  2HHS A;  3M5R A;  1NJY A;  1U48 A;  4DS5 A;  4M3U A;  1SV5 A;  3QER A;  5M1Q A;  1TUY A;  4DTR A;  4F9O A;  4FLV A;  3OS2 A;  4CJQ A;  4B08 A;  2D0P A;  1RT3 A;  4K25 A;  2FSK A;  2W40 A;  1NGH A;  4LH5 A;  3NH2 A;  1XHX A;  4FLY A;  3NMU A;  3DXM B;  4M7X A;  4YOR A;  3AO3 A;  2V51 B;  5AQV A;  4CEZ A;  5F0X A;  5HBM A;  5AQW A;  3C6A A;  4FPA A;  3DLH A;  4ELU A;  1WAF A;  1C0G A;  1LWE A;  1BHL A;  3WNG A;  4AQY K;  2PYL A;  4JI5 K;  1KLN A;  4GVE A;  3S3M A;  4OX9 K;  2UYT A;  4FJL A;  4H5N A;  5ADX A;  3SQ1 A;  3THV A;  4AIL C;  2I7N A;  5AQO A;  3DXK A;  1Y97 A;  2E6L A;  1WAJ A;  2WTU A;  1C1A A;  3EYZ A;  3MXI A;  4OO1 J;  3BDP A;  2EX3 A;  1T7P A;  2QEX N;  1GLL O;  4DF4 A;  3K2P A;  1TL3 A;  3WNF A;  1XNQ K;  4KFB A;  4YOT A;  2OCE A;  2QWO A;  4DSK A;  2WC9 A;  2CGJ A;  5KTQ A;  1RGI A;  1YI2 N;  3SUO A;  1NGC A;  3EKS A;  1VQ6 N;  4BWM A;  3T19 A;  2CGK A;  5GAH P;  4YOW A;  3IMX A;  3SAG A;  2O8D B;  2ITM A;  3ATV A;  4JLH A;  2YHX A;  3A5O C;  5HRR A;  1BCM A;  4B8A B;  2A42 A;  2P9L B;  3CCM N;  1HKG A;  3CET A;  3IFR A;  3LP3 A;  1VQ9 N;  3PO5 A;  4IJN A;  1BU6 O;  3I8D A;  3NBP A;  2A40 A;  4N76 A;  4M3R A;  4CJU A;  1YTA A;  1IBK K;  3IUC A;  3E9L A;  3AA5 X;  2E1Z A;  1N36 K;  1KLM A;  5KQ8 A;  4LFC K;  3K59 A;  1RTD A;  4BWJ A;  5BPL A;  2D0B A;  2J4R A;  1OVY A;  2P9P B;  4E7I A;  1WBB A;  1RTI A;  4F2R A;  1L3S A;  3ZX3 A;  2B6A A;  1NKE A;  2P1J A;  4LD0 A;  3ZT3 A;  5DM7 L;  4AF1 A;  2DTU A;  5BN8 A;  4PKI A;  1MWK A;  2HST A;  1J53 A;  2Z1G A;  1Y64 A;  3TAM A;  2GWK A;  3A5N C;  3CYM A;  4DR6 K;  4JYA K;  3DWL A;  4DWI A;  4DR1 K;  4OPK A;  3MN7 A;  3QDK A;  4RCH A;  4NCG A;  3BF3 A;  3Q7B A;  1LAW A;  1EO1 A;  1EX4 A;  3QO9 A;  3O4N A;  3MN6 A;  3UKR A;  4BRO A;  4NYF A;  2F4V K;  3AVC A;  1QQM A;  2A41 A;  3CCU N;  3I56 N;  3FZL A;  2P9K B;  1QE1 A;  4JV5 K;  3V9Z A;  3DOL A;  3U9Z A;  3I0R A;  3VQD A;  2O8C B;  4E1N A;  3VGM A;  3OYI A;  5AQP A;  4DTM A;  2X78 A;  5AQS A;  3O80 A;  3SPY A;  3ZLJ A;  3K5N A;  4PWD A;  2F7T A;  4O4G A;  1VSJ A;  1C1C A;  2HMP A;  4FZZ A;  4O5B A;  3ITH A;  3VN5 A;  3SJJ A;  4ID1 A;  4N41 A;  4CJT A;  1SKS A;  3LAL A;  5LY3 A;  3MMV A;  5AQF A;  3T1A A;  3MK6 A;  4EAH D;  4BE1 A;  4FXD A;  4MO5 A;  1T6D A;  4CEB A;  3WXK A;  1ZYQ A;  2Q1N A;  5JIC A;  5AZI B;  3TAN A;  3QIP A;  3DLE A;  4DR3 K;  1UA0 A;  3AVG A;  3MEE A;  1TYQ B;  3ASM A;  3SAH A;  4YOV A;  1VSD A;  3A0I X;  3VQ8 A;  2ATQ A;  4DS4 A;  1NLV A;  4FK4 A;  1O13 A;  3AO2 A;  4CF2 A;  1TK0 A;  4GV6 A;  3HM8 A;  4JI1 K;  5AFU H;  4X66 K;  3VQ6 A;  4FJ9 A;  4E19 A;  3WXL A;  4W5R A;  4DMN A;  3VQ4 A;  5EOY A;  4JKB A;  3TSU A;  3F5T A;  1XI1 A;  4LFB K;  3CHW A;  4AM6 A;  3K5L A;  3SV3 A;  2PFU A;  2D5R A;  3G4S N;  3E66 A;  4JS5 A;  3HK2 A;  1H1V A;  1JLC A;  3AGK A;  4ELV A;  4FJN A;  3TAB A;  4M42 A;  3L4I A;  3IG1 A;  3J8A A;  4FCY A;  3QLH A;  3S9H A;  3AY9 A;  4Z0U A;  3ZT1 A;  4HUG A;  3THY A;  1W7A A;  1RTH A;  2YKN A;  1U4B A;  1BI4 B;  4DTO A;  4FO0 A;  1HQE A;  3WT0 A;  3FFI A;  3OW2 M;  3AVH A;  1EKE A;  2QWL A;  1EQY A;  3F9K A;  3TSQ A;  3OYD A;  3VGK A;  4AHU A;  1SKR A;  4FSV A;  1XHZ A;  1UA1 A;  4FLU A;  1NJW A;  3O4W A;  3AO1 A;  4QS8 A;  3OYC A;  2O4G A;  1VQ8 N;  4DTP A;  4BC5 A;  1VSH A;  4E7H A;  1E4F T;  1JLG A;  4CEC A;  2E2O A;  5E84 A;  3MN5 A;  3D2E B;  2HBJ A;  2X74 A;  3MAQ A;  1U47 A;  3SZ2 A;  4JHD A;  1S22 A;  3L2U A;  3LZI A;  2P9N A;  4FWP A;  3OS1 A;  1T6C A;  4CBX A;  3FZF A;  1NGD A;  2E4L A;  3VEO A;  3VER A;  4Q0B A;  3F9M A;  3SNN A;  1N8R O;  2W42 A;  4Y1D A;  1I39 A;  1S6Q A;  1KD1 O;  3QEV A;  1RDC A;  3OJS A;  1GOA A;  3TAG A;  4I6M A;  1RT5 A;  3DLK A;  1OVQ A;  3TPQ A;  1TKD A;  3NCI A;  2O8C A;  5DK5 A;  4A62 A;  5GIN A;  2QWQ A;  3E9O A;  4FVU A;  1Z26 A;  3BUZ B;  1NKB A;  3PUF A;  4MDA A;  3NH0 A;  5FRO A;  5M1K A;  2NNW A;  3LDO A;  4EZ9 A;  5HRS A;  3QNO A;  1NGF A;  1KFS A;  3ENB A;  4UY8 O;  4IWV A;  1C0F A;  5AQH A;  3JSM A;  2QKK A;  4FJG A;  1CZB A;  2IOC A;  3DRS A;  1S1T A;  3F73 A;  4GNI A;  2E6M A;  1VSM A;  2Q97 A;  1KVB A;  2OZS A;  4WQ4 C;  3CQX A;  3HSC A;  4OPH A;  3VQC A;  1BQN A;  3ZSZ A;  2Z1H A;  3BGR A;  4DUY K;  1KVA A;  2ZGY A;  4DV1 K;  3AAR A;  3LWL A;  1LAV A;  4NXN K;  3O3F A;  1OH5 A;  2NRV A;  3C0B A;  4BE0 A;  1RBR A;  3G6E N;  3KIO A;  4CEF A;  5J2Q A;  3G71 N;  4DU3 A;  4M3Z A;  1VSF A;  4KHS A;  4FWM A;  2ETJ A;  5IWA K;  3K58 A;  4GV9 A;  4CES A;  3TI0 A;  3SBG A;  3EL2 A;  3VQ5 A;  4NYN A;  2A1S A;  5AZJ A;  3AAP A;  5AQQ A;  3QBW A;  3QB0 A;  1VQK N;  4KHN A;  1P90 A;  1HR0 K;  2O8D A;  2YNH A;  3C6T A;  5C25 A;  4RG8 A;  5T7B A;  1EWQ A;  4IOC L;  1SQK A;  3K5O A;  3ALY A;  3ID6 A;  5AR0 A;  3NGZ A;  2RE2 A;  2KTQ A;  2YNF A;  4CFA A;  4JNE A;  4IOA L;  4JAX A;  4CZG A;  4H5T A;  2YJF A;  3T3F A;  1E3M A;  4BRH A;  4E89 A;  2GWJ A;  3UB5 A;  4DUZ K;  2OYQ A;  2OTJ N;  1X3N A;  1RDA A;  4K41 A;  2VGN A;  2CH5 A;  3LDL A;  1QHT A;  3M8S A;  2QKB A;  2B5J A;  2EWS A;  2P9U B;  4GW6 A;  3FZM A;  3SCX A;  1W2B M;  5E41 A;  4FWL A;  1B9D A;  2OPS A;  4JK7 A;  4BC2 A;  4YNQ A;  3T1Y K;  1QZ6 A;  3ZSV A;  4B9T A;  3VES A;  4CFC A;  3QEI A;  3RRG A;  3D2F A;  4O44 A;  3ZYY X;  4MFB A;  5JVH L;  5BRE A;  4ILG B;  1D9F A;  1CXU A;  3ZET A;  4CJE A;  3TAE A;  2QWM A;  1IKY A;  2O8E A;  2KLA A;  4F3T A;  5J2P A;  3CFO A;  5CHI A;  3AA3 A;  1TYQ A;  3QFU A;  1NK7 A;  3E9P A;  1S72 N;  5A2Q O;  3M8P A;  1KVC A;  3OYK A;  4YY3 K;  1QVF M;  3UE5 A;  1NGA A;  3DJC A;  3V1O A;  2OAN A;  3CM5 A;  4JI2 K;  1ZBU A;  2O8F B;  4IO8 A;  4J2A A;  1YVU A;  4W5O A;  1S1V A;  4AHT A;  1C6V A;  3R6M A;  2WON A;  4B9M A;  5AQJ A;  1RBU A;  3TAQ A;  4W5N A;  5FPM A;  3RMA A;  1N34 K;  3CC2 N;  5J1E A;  1HNW K;  4DV3 K;  4KHW A;  1QQC A;  4WFN L;  5CYQ A;  3BZC A;  3CJ1 A;  2ZJR L;  3FGU A;  2FF6 A;  1QZ5 A;  3OYL A;  3THX A;  4CVN E;  1GLA G;  2ZQB A;  4BRI A;  2BUP A;  1VQL N;  4WFA L;  1GLD G;  4DV4 K;  3OS0 A;  3LP0 A;  4BRA A;  4BE2 A;  1JXE A;  3B6O A;  3OYJ A;  1DEJ A;  3WNH A;  3R9P A;  3MCP A;  3ZX2 A;  5CZ2 A;  1N32 K;  4LC9 B;  3M6G A;  4F4K A;  3VMF B;  5FRN A;  2BGG A;  1NG9 A;  4ZTJ A;  4CBW A;  5D3G A;  3ZET B;  4BRM A;  3CJ7 A;  3U8X A;  3L2R A;  5C24 A;  3ENO A;  2YHW A;  4DSI A;  3T1H K;  3AVJ A;  5BPN A;  3D2F B;  5EXW A;  4DG1 A;  3KVG A;  3CJA A;  3OY9 A;  1TV6 A;  1S1X A;  2VG7 A;  3TAF A;  3LDP A;  3LAM A;  3KK3 A;  5I9E B;  4FM0 A;  2VQF K;  3LDS A;  4Z4I A;  3H45 C;  3SI6 A;  2O8B B;  2VWB A;  5FDL A;  2NRZ A;  5J2M A;  2NUB A;  2Q0R A;  3EN9 A;  3HM9 A;  1RCH A;  1ZBH A;  3EO3 A;  4Y1C A;  4BC3 A;  1NK0 A;  2IC3 A;  4BRQ A;  2PYJ A;  4JEP A;  4BG9 A;  1EXQ A;  1VSI A;  2I7P A;  3O9S A;  4H5R A;  4FW2 A;  4R79 A;  2P51 A;  3V9X A;  1BOT O;  3BY5 A;  5C10 A;  3O9U A;  5KPZ A;  3O1W A;  4B3T K;  1NGJ A;  2NRX A;  5I42 A;  1BIU A;  1UWB A;  2HHV A;  4FM1 A;  1K73 O;  3OVN A;  1WB9 A;  2YNI A;  2YHY A;  3QEX A;  1T44 A;  5AQL A;  2KQ2 A;  2AA4 A;  4FJ5 A;  3JAM O;  2E2N A;  3QBX A;  1BA1 A;  4WE1 A;  3OHR A;  1BWF O;  4O5F A;  3C7N A;  2ZJQ L;  3RWU A;  3ULD A;  4K8Z A;  4CFD A;  2ZGZ A;  4LF6 K;  1X9S A;  5MLC Q;  3IS9 A;  2GUI A;  4CGH A;  3VEV A;  2QA4 N;  3HJF A;  3LAN A;  1QQN A;  5JVG L;  4H4M A;  2V52 B;  4MQ3 A;  2E20 A;  4BGB A;  1S3X A;  3TSP A;  4NB4 A;  3E1Y A;  3NGI A;  3OYF A;  4OLB A;  3DRP A;  3HI0 A;  3P39 A;  2IVN A;  3EE9 A;  1HUX A;  1WSJ A;  3VQE A;  4U67 L;  5AJ3 K;  1U49 A;  4DSE A;  1Z05 A;  2ZE2 A;  1Q9Y A;  1CXQ A;  3QEP A;  3H46 O;  4CJP A;  3SQ4 A;  1HPZ A;  2F96 A;  1DTQ A;  3NF6 A;  1LWC A;  1SL1 A;  4YOU A;  4HTU A;  1VSE A;  3KLE A;  2QK9 A;  1ASU A;  3OYM A;  4DQ8 A;  3NFA A;  4O0J A;  3SUN A;  3SQ2 A;  3LM2 A;  4DCH A;  3HVT A;  4RW8 A;  5AQI A;  2DPN A;  3VA3 A;  4CIF A;  2HHX A;  3SBT A;  3H3N O;  3KLG A;  1HRH A;  4XH1 A;  3AVL A;  1K6Y A;  2QM1 A;  3ZT0 A;  4J2D A;  2YV0 X;  4BDZ A;  2D0O A;  1YVN A;  5IT9 O;  2ZWH A;  4BVO A;  1GLC G;  4TSX A;  2PZS A;  2ZJP L;  3BP8 A;  2FXU A;  1VQO N;  4JHD B;  5DM6 L;  4M7Y A;  3D2E A;  4LF9 K;  3LZJ A;  1NGI A;  4OKE A;  3OA9 A;  4DB3 A;  4B1Z A;  4B9U A;  3RMC A;  3AVM A;  1VQ7 N;  5H1S Q;  1SL0 A;  1WSF A;  4A59 A;  3CME N;  2ASM A;  5SWM A;  1HKB A;  4ISE A;  1BCO A;  4CJ4 A;  2A1R A;  4PKG A;  2WBN A;  1IO2 A;  3UKR B;  4JKF A;  1NM1 A;  3KLF A;  1NOY A;  3KLI A;  5M1F A;  1D5A A;  2JLE A;  4U7B A;  5FPD A;  1YJW N;  4CK1 A;  4CER A;  4C23 A;  2V7Z A;  4C8M A;  2AJQ A;  5TKW A;  2HBM A;  3P4I A;  2IDO A;  2P9N B;  4FWR A;  3O8M A;  2YCH A;  4X65 K;  2E8A A;  4NXM K;  2UXB K;  4FLZ A;  3FZH A;  4CF0 A;  4DFM A;  4HHT A;  4RW7 A;  3CC4 N;  5KGX A;  3NVK A;  4G1Q A;  4FJH A;  4H03 B;  4O8K A;  2GEM A;  4EHT A;  4ISG A;  3U9D A;  2I5J A;  3A5M C;  5KPR A;  2Y1J A;  3J80 O;  3CMA N;  4KAZ A;  4AHC A;  4BQZ A;  3CCV N;  4F2S A;  3VQP A;  1QSS A;  4PUO A;  2GTD A;  4IEE A;  4BRD A;  2Q3S A;  4FLT A;  3LDQ A;  4BDY A;  3VOV A;  1JCF A;  4AHR A;  4CK3 A;  3ZCM A;  3QFP A;  2Q0U A;  5LJW A;  3VQ9 A;  1LW2 A;  5C42 A;  5GIO A;  3KK2 A;  2OTL N;  3I8B A;  4KV8 A;  1K8K B;  3MEC A;  4Z4H A;  1SUQ A;  2WOM A;  3PSF A;  3SPZ A;  3L0Q A;  4BRE A;  4KI6 A;  1LW0 A;  4KTQ A;  5AQK A;  4PQU A;  4KBO A;  1HNZ K;  2P9K A;  3NVM A;  1NBW A;  2Q36 A;  4DV0 K;  3SUQ A;  2QWN A;  3GDQ A;  1HNX K;  3BF1 A;  2IIR A;  5CZ1 A;  3VA0 A;  4K8X A;  4JK8 A;  4IJA A;  3HZ6 A;  3CJ9 A;  1F21 A;  4DTN A;  3DAW A;  1Z6R A;  3VTH A;  3I55 N;  4FJJ A;  4CI6 A;  1YF5 L;  4W5Q A;  4DFP A;  3C7N B;  2V7Y A;  4OJR A;  5TKY A;  3CJC A;  3H1V X;  1XC3 A;  1NK6 A;  5M1O A;  1Q82 O;  5I3U A;  4FM2 A;  5AQN A;  4Z4E A;  3QEW A;  1G15 A;  2HHH K;  4X64 K;  3FLC O;  4BR0 A;  4CEA A;  4BG8 A;  4IEI A;  2KFN A;  1T3V A;  1KAZ A;  4DV6 K;  1WNS A;  3CCQ N;  1YXQ A;  3DLR A;  4IFE A;  2FLO A;  1WSI A;  4HUE A;  3C95 A;  1CZ9 A;  3HPH A;  3HRG A;  4BAC A;  1W9H A;  4XEI A;  4W5T A;  2NRW A;  4FLX A;  3DLB A;  1L3U A;  1RDB A;  4H0P A;  2HB5 A;  4CGF A;  4CHN A;  1ASV A;  1G99 A;  1V4T A;  1YUW A;  4FL9 A;  4WQ5 A;  3ZSX A;  4EIA A;  2G8F A;  1BIZ A;  4MLE A;  3AA4 A;  3RSE B;  3UIQ A;  4KH5 A;  2CGL A;  3SJH A;  1TAU A;  1RFQ A;  1RT7 A;  2ASO A;  2HF4 A;  4Y0W A;  5AQG A;  4XIU A;  2A5X A;  1EWR A;  1R59 O;  4FW1 A;  3JS6 A;  1BI4 A;  1BG3 A;  2X6S A;  4HCC A;  4JKD A;  4BY9 C;  1YHQ N;  4B9N A;  2BE2 A;  1QSY A;  3U4L A;  3CCJ N;  4YHH K;  3M8Q A;  3HPO A;  2NRR A;  1ATR A;  4BQL A;  4X62 K;  3TAP A;  3VEZ A;  2CH6 A;  2ZF5 O;  4KRE A;  3PX0 A;  3PO4 A;  2D0C A;  4WF9 L;  3PX6 A;  4CW7 B;  4KHP K;  2UUC K;  2D0A A;  4K42 A;  1JLB A;  5FLX O;  2UUA K;  3ENH A;  1YJ9 N;  1XQS C;  1QVG M;  4QS9 A;  3OTO K;  2W6L A;  4CZL A;  5J2N A;  1BO5 O;  3U3G A;  3AVA A;  4LF4 K;  4JKG A;  3AVF A;  3AVI A;  4FWN A;  1BDG A;  4E1J A;  1WSH A;  2OA8 A;  4OKK A;  2KHO A;  4BRG A;  2G8W A;  1JJ2 M;  3CFR A;  2H3G X;  3AO5 A;  3W0L A;  4FOE A;  1DLO A;  3HST B;  1IKX A;  3TTC A;  3THW B;  4KO0 A;  3DLG A;  2GX9 A;  4B9V A;  4I6M B;  3FZK A;  2W41 A;  2QI2 A;  1QQO A;  3KLH A;  4ID5 A;  2FBY A;  3H08 A;  4B3M K;  4YOY A;  3EE8 A;  4BRN A;  4CEE A;  4ZHR A;  1RBT A;  4HUF A;  1QHA A;  4JI4 K;  3B8A X;  4CHP A;  1HX1 A;  5LL6 Z;  4I2P A;  2HHU A;  2XY5 A;  5HRO A;  1KAY A;  1N6Q A;  4GVM A;  1IJJ A;  3L2V A;  4HTL A;  4K0K K;  1J5O A;  5EY4 A;  1QS4 A;  3SMP A;  3KWG A;  3RMB A;  3HL8 A;  3SMS A;  1S9G A;  1TVR A;  5AQX A;  4FWQ A;  1JL1 A;  3MN9 A;  4DV5 K;  4B3R K;  4N47 A;  5KRT A;  1M1K O;  4CJ7 A;  1SL2 A;  4M3W A;  2NZT A;  4FZY A;  5CY4 A;  4BGA A;  4UQG A;  1VSK A;  4CZE A;  5AFU A;  3OYG A;  4FJM A;  1JL2 A;  3RTV A;  1S6P A;  4PA1 A;  4A2B A;  4C8O A;  3WEE A;  3NF8 A;  2NRT A;  4B1W B;  1REV A;  3CQ8 A;  1VAZ A;  2HW3 A;  1GLF O;  3C6U A;  4H0O A;  4ICL A;  1X9W A;  1C0M A;  4AM7 A;  1VK0 A;  1VQP N;  3J7A P;  1BL3 A;  2HF3 A;  1Q86 O;  5LMU K;  4JI7 K;  1VSL A;  4JKG B;  4KKO A;  5ELZ A;  1WSE A;  2FBX A;  4DV2 K;  1BIS A;  2WFB A;  4CGD A;  1K8A O;  2P9I A;  3AA2 A;  5SZT A;  1K8K A;  4L3Q A;  2YI1 A;  1C1B A;  2P9L A;  4NO7 A;  3E01 A;  2HNY A;  4YOX A;  2HHW A;  1P8Z A;  1NK8 A;  2VYP A;  1KSP A;  3D7E O;  3TTD A;  3WEE B;  3THW A;  4J2E A;  3CER A;  1N5Y A;  3CCR N;  5C0Y A;  4BRF A;  4CF9 A;  3SAF A;  3B6P A;  1WN7 A;  3V9S A;  2F9W A;  4YDU A;  3V1R A;  3RMD A;  3LWM A;  4DLE A;  2OPQ A;  3AAQ A;  4BR4 A;  3K5M A;  3DMJ A;  4CZH A;  1NMD A;  3K57 A;  3LM9 A;  5JLH A;  4IO9 L;  4B3O A;  2FBT A;  4FPB A;  1RT6 A;  1ZBL A;  4F8R A;  4RWT A;  4B9L A;  3KD1 E;  2QTD A;  4DR4 K;  1U2V B;  3SV4 A;  3LP1 A;  3S3O A;  2QXL A;  3O9Q A;  4OVL A;  3VF6 A;  3KKR A;  3PSI A;  1U04 A;  1FXX A;  2PY5 A;  1VQ4 N;  1IG9 A;  2RPI A;  2AP1 A;  2HHQ A;  4CJL A;  3BEX A;  3ZSR A;  1BGX T;  1T8E A;  1WBD A;  4BRK A;  3N4P A;  4IOX A;  1KQS M;  1YAG A;  5KPT A;  3M8R A;  4BR9 A;  3IKM A;  1TKZ A;  5GAD P;  1XMQ K;  1NWK A;  2UUB K;  2P9P A;  1JLF A;  3MED A;  4M45 A;  1CZA N;  4CHQ A;  4ZTF A;  3G10 A;  3ZEU B;  1X3M A;  2KW4 A;  5LMN K;  1LOT B;  3O9T A;  5HP1 A;  1JCE A;  2VWJ A;  2ITG A;  4B8C A;  3V1Q A;  3CPW M;  2Q2R A;  3KK1 A;  4C8L A;  1J6Z A;  4WQ5 C;  4WFB L;  1TKX A;  1WOQ A;  5C12 A;  4JI6 K;  1YIJ N;  3KTQ A;  3O08 A;  4E0D A;  1A5X A;  3R3L A;  3RVC A;  3GBT A;  3DRR A;  5KRS A;  4DSJ A;  3QNN A;  4M63 C;  1OH8 A;  3P1G A;  2A3Z A;  3D0P A;  4NCA A;  1NK9 A;  3CCL N;  3A5L C;  4DTS A;  4QS7 A;  3OYB A;  3H6E A;  3SQ0 A;  3O3G A;  4EZ6 A;  1C0T A;  1S5J A;  4CJF A;  4B1X B;  1ILY A;  2VG6 A;  4LF5 K;  3SK3 A;  2F9T A;  3G0Z A;  2JWL A;  3A8Y A;  1LCU A;  5AQU A;  4HVJ A;  4CJS A;  4FOI A;  1A5W A;  4ILH A;  2HNZ A;  4JD2 A;  3L4Q A;  3V9U A;  3EKU A;  4KH4 A;  4R5P A;  2KKZ A;  3IRX A;  2E1Y A;  1B92 A;  4IDH A;  4I7F A;  3CCE N;  1RBS A;  4PY5 A;  2D1K A;  1XWL A;  2G8V A;  4DTJ A;  4KB1 A;  3ZSW A;  3EEQ A;  3N4Q A;  1L3T A;  4M3T A;  1IKV A;  4CIG A;  3VEY A;  2XY7 A;  1ZBF A;  1FJG K;  2QXF A;  3O9R A;  5KQD A;  5JS2 A;  2HND A;  4XH4 A;  1NGG A;  1TKT A;  1KCF A;  1RDU A;  1WUA A;  4I9L A;  2VCP A;  3TAR A;  1J9A A;  2GEL A;  2FF3 B;  1RBV A;  3HP9 A;  3HTV A;  4FWK A;  3KWI A;  2OPP A;  4DR5 K;  4QOZ B;  3DI6 A;  4Z4C A;  3O3H A;  3VF4 A;  3QES A;  2P5G A;  1X9J A;  1IH7 A;  3HT3 A;  2G8I A;  2F8T A;  4CEQ A;  3VF2 A;  2VQE K;  4CJ3 A;  1B9F A;  1SAZ A;  3I0S A;  4JK9 A;  1NJX A;  4C1N K;  3MCA B;  5BPM A;  2KZM A;  1XNR K;  1SS6 A;  2IVO A;  4FJK A;  1KAX A;  3A2F A;  4BC4 A;  1TK5 A;  5KGW A;  3WXJ A;  4MO4 A;  5DMR A;  5LJV A;  4DV7 K;  4N56 A;  1VRU A;  2X6N A;  4XH5 A;  4PKH A;  2P9U A;  3G25 A;  2Z1I A;  4DU1 A;  2WUS A;  3J7Y P;  1ZC6 A;  1X1P A;  4JKA A;  1RDW X;  3QIO A;  1BA0 A;  4H0Y B;  3NAE A;  3L3U A;  4JD2 B;  5M1P A;  3C6H A;  1ESV A;  2JWK A;  1J54 A;  1IBL K;  4CJK A;  3RRH A;  3TTF A;  2YHA A;  5BR9 A;  3F2K A;  3THX B;  1ZXO A;  3SUP A;  5JLF A;  4DQI A;  3WQT A;  3TR8 A;  4OKJ A;  4CED A;  4GMJ B;  2UU9 K;  2RN2 A;  1KFD A;  4CZI A;  1Q81 O;  5K14 A;  3O6W A;  2XY6 A;  1HQU A;  3WXM B;  3MX2 A;  2E88 A;  5GIP A;  4JKH A;  3ISN C;  2RF2 A;  4IZ9 A; 
#chains in the Genus database with same CATH homology
 4CGF A;  2RKI A;  5KI6 A;  3VQA A;  2VWK A;  4CHN A;  1ASV A;  1TL1 A;  3EZ5 A;  3V81 A;  1RDA A;  4CHZ A;  2G8U A;  1QTM A;  4M3Y A;  1RT4 A;  1S9E A;  2F8S A;  4IFV A;  1NK4 A;  1DTT A;  1QHT A;  3ZT4 A;  3ZSX A;  3M8S A;  2G8F A;  1GOC A;  2B5J A;  2QKB A;  1BIZ A;  4GW6 A;  4C8K A;  3AA4 A;  4RW9 A;  3UIQ A;  2KFZ A;  3SCX A;  2DY4 A;  1TAU A;  4AHV A;  1RT7 A;  5E41 A;  1B9D A;  3OYN A;  1S1W A;  1W0H A;  2OPS A;  3AVB A;  4CK2 A;  4XIU A;  1LV5 A;  3V9W A;  2O4I A;  1HYV A;  4H8K A;  3JYT A;  4YNQ A;  2YKM A;  4H4O A;  3L3V A;  4FW1 A;  3ZSV A;  4FJ8 A;  4B9T A;  1BI4 A;  4LSN A;  3RRG A;  4CFC A;  3QEI A;  2Z1J A;  2X6S A;  4HCC A;  2IS3 A;  2G8H A;  1C0U A;  2BAN A;  4O44 A;  4I2Q A;  3ZSO A;  1KTQ A;  4B9N A;  4MFB A;  2HHS A;  3KKS A;  1NJY A;  1U48 A;  2BE2 A;  4DS5 A;  1QSY A;  4M3U A;  1SV5 A;  1NKC A;  1CXU A;  3QER A;  3HPG A;  3M8Q A;  4CJE A;  4E7K A;  4CFB A;  3TAE A;  1D9F A;  3HPO A;  1IKY A;  4F3T A;  4Z4F A;  5J2P A;  3CFO A;  3V6D A;  4DTR A;  3NH1 A;  1HMV A;  3AA3 A;  3CG7 A;  2XHB A;  4FLV A;  4CIE A;  3OYH A;  3OS2 A;  2HVH A;  4CJQ A;  1NK7 A;  4B08 A;  3OYK A;  3M8P A;  1KVC A;  1RT3 A;  3TAP A;  4KRE A;  3PX0 A;  3SYZ A;  3P5J A;  3V1O A;  3PO4 A;  2D0C A;  3CM5 A;  4I9Q A;  4LH5 A;  3NH2 A;  3PX6 A;  1XHX A;  4LH4 A;  1ZBU A;  4FLY A;  1RDD A;  2D0A A;  1JLB A;  5HLF A;  1YVU A;  4J2A A;  4W5O A;  1S1V A;  1O1W A;  4AHT A;  1C6V A;  2WON A;  4B9M A;  4W5N A;  1RBU A;  3TAQ A;  3AO3 A;  5J2N A;  1Z25 A;  1SKW A;  3U3G A;  3AVA A;  4CEZ A;  3PY8 A;  4FJI A;  3RMA A;  3C94 A;  5HBM A;  5J1E A;  3AVF A;  3AVI A;  2OA8 A;  3DLH A;  4ELU A;  1QQC A;  1WSH A;  1KRP A;  4KHW A;  1WAF A;  1LWE A;  4OKK A;  5CYQ A;  2G8W A;  1BHL A;  3WNG A;  3OYL A;  1NK5 A;  2PYL A;  4E1M A;  1KLN A;  3S3M A;  3ZSY A;  3CFR A;  4DTX A;  4DFJ A;  3AO5 A;  4CGI A;  2ZQB A;  4FJ7 A;  1DLO A;  3HST B;  4FJL A;  1HNI A;  4CE9 A;  1IKX A;  3SQ1 A;  3THV A;  4KO0 A;  4CHO A;  4AIL C;  3DLG A;  1Y97 A;  2E6L A;  4QAG A;  3OS0 A;  3LP0 A;  1WAJ A;  4B9V A;  1C1A A;  3EYZ A;  4BE2 A;  3MXI A;  3BDP A;  1YT3 A;  1JXE A;  3B6O A;  3OYJ A;  2EX3 A;  1QSL A;  3WNH A;  1T7P A;  4DF4 A;  3K2P A;  1TL3 A;  3KLH A;  3WNF A;  4DQS A;  4ID5 A;  2FBY A;  3H08 A;  4KFB A;  5CZ2 A;  2FBV A;  3AVK A;  4CEE A;  4DQQ A;  1A5V A;  4ZHR A;  1RBT A;  1FKP A;  4HUF A;  2HMI A;  4DSK A;  3VQ7 A;  4CHP A;  4F4K A;  3MXJ A;  5KTQ A;  5FRN A;  2BGG A;  4I2P A;  3SUO A;  3KD5 E;  4ZTJ A;  2HHU A;  2XY5 A;  5D3G A;  3OYE A;  5HRO A;  1N6Q A;  3L2R A;  4GVM A;  1RIL A;  4FLW A;  3LP2 A;  5C24 A;  3L2V A;  1NOZ A;  3AO4 A;  4DSI A;  3DM2 A;  3AVJ A;  4CJR A;  4BWM A;  3T19 A;  4DG1 A;  1J5O A;  4KPY A;  4FYD A;  1QS4 A;  3OY9 A;  3RMB A;  1TV6 A;  1S1X A;  3HL8 A;  4KHU A;  4HCB A;  2VG7 A;  3HP6 A;  3TAF A;  1S9G A;  3LAM A;  1TVR A;  3KK3 A;  1JL1 A;  4FM0 A;  4JLH A;  3LDS A;  4Z4I A;  3SI6 A;  1BQM A;  5FDL A;  5J2M A;  2GBZ A;  2NUB A;  4N47 A;  5KRT A;  5HRR A;  3NGY A;  1BCM A;  3P83 D;  4B8A B;  3HM9 A;  3CFP A;  1SL2 A;  4M3W A;  1RCH A;  1ZBH A;  3AVN A;  4Y1C A;  1NK0 A;  5CY4 A;  2IC3 A;  4FZY A;  4UQG A;  3LP3 A;  2PYJ A;  1VSK A;  3OYG A;  4FJM A;  3L2W A;  3PO5 A;  3I8D A;  1EXQ A;  1JL2 A;  1S6P A;  3NBP A;  1VSI A;  3RTV A;  4N76 A;  4PA1 A;  4M3R A;  4CJU A;  4FW2 A;  4YFU A;  1YTA A;  4C8O A;  2DFH A;  3NF8 A;  2P51 A;  3AA5 X;  3V9X A;  1KLM A;  1REV A;  3CQ8 A;  2HW3 A;  3C6U A;  4ICL A;  3NHG A;  1X9W A;  3NF7 A;  3K59 A;  1C0M A;  1RTD A;  4BWJ A;  1VK0 A;  2D0B A;  1L3V A;  2Y1I A;  1BL3 A;  5I42 A;  1VSL A;  1BIU A;  4KKO A;  1UWB A;  2HHV A;  4FM1 A;  4E7I A;  3OVN A;  1SKR A;  1RT2 A;  1RTI A;  1WSE A;  2YNI A;  2FBX A;  3L2Q A;  3QEX A;  1L3S A;  4F2R A;  2B6A A;  1NKE A;  2KQ2 A;  1BIS A;  2P1J A;  4LD0 A;  1I3A A;  3ZT3 A;  4CGD A;  4FJ5 A;  4CF8 A;  3AA2 A;  5SZT A;  1JLE A;  3L8B A;  4L8R B;  2DTU A;  3HYF A;  3ZSQ A;  1JLQ A;  1J53 A;  2Z1G A;  1FK9 A;  4WE1 A;  2XRI A;  1C1B A;  3TAM A;  1X9M A;  4Q5V A;  1HJR A;  3RWU A;  3ULD A;  3CYM A;  3S3N A;  3E01 A;  2HNY A;  4DWI A;  3D45 A;  4K8Z A;  3ZT2 A;  4OPK A;  2HHW A;  4CFD A;  4DSF A;  4JRP A;  1NK8 A;  1KSP A;  4NCG A;  1LAW A;  4J2E A;  4AH9 A;  1EX4 A;  3QO9 A;  1X9S A;  3O4N A;  3IS9 A;  1N5Y A;  2GUI A;  4CF9 A;  2YHB A;  4CGH A;  4CEO A;  4NYF A;  3B6P A;  4QCL A;  1WN7 A;  3AVC A;  3HJF A;  3LAN A;  3HXM A;  3V9S A;  4FJX A;  3V1R A;  3RMD A;  4H4M A;  2OPR A;  3LWM A;  4MQ3 A;  3U6F A;  1D8Y A;  4DLE A;  2OPQ A;  1QE1 A;  3K5M A;  1TAQ A;  3DMJ A;  3V9Z A;  3DOL A;  3I0R A;  3VQD A;  4FK2 A;  4E3S A;  3NGI A;  3K57 A;  4DU4 A;  4E1N A;  3OYF A;  4CGJ A;  3OYI A;  4OLB A;  3DRP A;  4IDK A;  4DTM A;  2X78 A;  4B3O A;  2FBT A;  3SPY A;  4CJV A;  1RT6 A;  1VRT A;  3K5N A;  1ZBL A;  4F8R A;  4PWD A;  3NF9 A;  4FVM A;  1WSJ A;  3VQE A;  4O4G A;  1VSJ A;  2IGI A;  4F3O A;  1C1C A;  4B9L A;  4FZZ A;  4O5B A;  3KD1 E;  1U49 A;  3ITH A;  4KB0 A;  4DSE A;  2ZE2 A;  3VN5 A;  1Q9Y A;  2HVI A;  3SJJ A;  4ID1 A;  1CXQ A;  5HRP A;  3QEP A;  4N41 A;  4CJT A;  4KI4 A;  4JRQ A;  3SV4 A;  4CJP A;  3LP1 A;  3LAL A;  4JS4 A;  3SQ4 A;  3S3O A;  1SKS A;  1HPZ A;  1R0A A;  2F96 A;  4OGE A;  3IAY A;  1EP4 A;  4OVL A;  3KKR A;  4IG0 A;  1DTQ A;  3NF6 A;  3T1A A;  1LWC A;  3NDK A;  1SL1 A;  4HTU A;  4BE1 A;  4FXD A;  1U04 A;  1FXX A;  1JKH A;  3DOK A;  2PY5 A;  1IG9 A;  2RPI A;  1VSE A;  2HHQ A;  4CEB A;  4CJL A;  1S1U A;  3KLE A;  1ZYQ A;  2QK9 A;  3ZSR A;  3TAN A;  1BGX T;  1ASU A;  3DLE A;  3QIP A;  4M41 A;  3OYM A;  1UA0 A;  3AVG A;  1T8E A;  3NFA A;  3MEE A;  3ASM A;  4O0J A;  3SUN A;  3SQ2 A;  1VSD A;  3VQ8 A;  2ATQ A;  4DS4 A;  3HVT A;  4AHS A;  4M3X A;  4RW8 A;  3AO2 A;  4FK4 A;  3M8R A;  1UAX A;  1T03 A;  3QIN A;  4BDP A;  1TKZ A;  4CF2 A;  1TK0 A;  3VA3 A;  4KRF A;  4CIF A;  2B4J A;  2HHX A;  1JLF A;  3MED A;  2BDP A;  4M45 A;  4CHQ A;  3HVR A;  4ZTF A;  1RT1 A;  4KHQ A;  4EP5 A;  1D9D A;  3LAK A;  3VQ6 A;  3KLG A;  4FJ9 A;  4E19 A;  1HRH A;  3G10 A;  1L5U A;  5JS1 A;  4FK0 A;  4W5R A;  3AVL A;  4DMN A;  2KW4 A;  3VQ4 A;  1K6Y A;  3OYA A;  5EU7 A;  3ZT0 A;  4J2D A;  5HP1 A;  1XI1 A;  2YV0 X;  4BDZ A;  2VWJ A;  3OJU A;  2ITG A;  3K5L A;  4B8C A;  3V1Q A;  3SV3 A;  1RNH A;  2D5R A;  3KK1 A;  4C8L A;  4CJ5 A;  3PV8 A;  4JS5 A;  3HK2 A;  4IBN A;  4RW4 A;  1JLC A;  3LPT A;  4ELV A;  4DFK A;  4DTU A;  1TKX A;  2YNG A;  4ELT A;  4TSX A;  2PZS A;  2VG5 A;  4FJN A;  3TAB A;  4CCH A;  4M42 A;  3IG1 A;  4FCY A;  3QLH A;  3S9H A;  3KTQ A;  4Z0U A;  1A5X A;  4E0D A;  3ZT1 A;  4HUG A;  4OGC A;  1RTH A;  2YKN A;  1U4B A;  1BI4 B;  2DFF A;  4DTO A;  3DRR A;  4B9S A;  5KRS A;  3LZJ A;  4OKE A;  1HQE A;  4DSJ A;  3QNN A;  3FFI A;  3AVH A;  3P1G A;  1EKE A;  3F9K A;  3D0P A;  3KJV A;  3OYD A;  4NCA A;  2LSN A;  1NK9 A;  4KHY A;  4KTW A;  4B9U A;  4AHU A;  3RMC A;  2FC0 A;  3AVM A;  1XHZ A;  1UA1 A;  4FLU A;  1NJW A;  4DTS A;  1WSF A;  1SL0 A;  3AO1 A;  3OYB A;  3OYC A;  2O4G A;  3O3G A;  3SQ0 A;  4DTP A;  4EZ6 A;  1C0T A;  5SWM A;  1JXB A;  1VSH A;  4E7H A;  1JLG A;  1MU2 A;  1HYZ A;  3NE6 A;  1S5J A;  1BCO A;  4CEC A;  4CJF A;  4CJ4 A;  2X74 A;  3TWH A;  2VG6 A;  3MAQ A;  1U47 A;  3SZ2 A;  2A1R A;  1IO2 A;  1NJZ A;  3L2U A;  3G0Z A;  3LZI A;  3MXM A;  3OS1 A;  2XO7 A;  3KLF A;  1NOY A;  3KLI A;  1D5A A;  2E4L A;  4Q0B A;  1CLQ A;  4HVJ A;  4IFY A;  4CJS A;  2JLE A;  3SNN A;  1A5W A;  1WLJ A;  1TGO A;  2W42 A;  4Y1D A;  2HNZ A;  4CK1 A;  1I39 A;  1RTJ A;  1S6Q A;  3QEV A;  1RDC A;  4CER A;  3OJS A;  4E7J A;  4DSL A;  1GOA A;  4C8M A;  3V9U A;  3TAG A;  5FRM A;  2AJQ A;  4R5P A;  4N5S A;  3IRX A;  1U45 A;  3DYA A;  2P5O A;  3CM6 A;  2IDO A;  2DFE A;  1B92 A;  1RT5 A;  3DLK A;  4I7F A;  1RBS A;  1TKD A;  1HNV A;  4PY5 A;  3NCI A;  2JGU A;  1XWL A;  5DK5 A;  1XC9 A;  4DTJ A;  2G8V A;  4KB1 A;  3ZSW A;  4IKF A;  3QET A;  3LPU A;  4M3T A;  1L3T A;  2KZZ A;  4FLZ A;  3WNE A;  4CF0 A;  4DFM A;  1IKV A;  4DLG A;  4HHT A;  4RW7 A;  3RR7 A;  1Z26 A;  4CIG A;  1LWF A;  4IG3 A;  5KGX A;  1NKB A;  3PUF A;  3NH0 A;  4G1Q A;  2XY7 A;  4FJH A;  1FKO A;  1ZBF A;  5FRO A;  5HRN A;  1ASW A;  2QXF A;  5JS2 A;  2HND A;  1TKT A;  1KCF A;  4J2B A;  2I5J A;  4EZ9 A;  5HRS A;  3QNO A;  2Y1J A;  4I9L A;  1EET A;  1KFS A;  3U3Y A;  3TAR A;  1J9A A;  1IKW A;  4KAZ A;  4AHC A;  3JSM A;  4F2S A;  2QKK A;  4FJG A;  3VQP A;  1RBV A;  1CZB A;  3HP9 A;  4O0I A;  1QSS A;  2IOC A;  2OPP A;  3DRS A;  3RR8 A;  2Q3S A;  4FLT A;  1S1T A;  2OYQ A;  4PUO A;  3F73 A;  4QOZ B;  2E6M A;  1VSM A;  4O55 A;  4BDY A;  2EHG A;  3DI6 A;  1KVB A;  4Z4C A;  2OZS A;  4AHR A;  2ZD1 A;  4CK3 A;  3O3H A;  3ZCM A;  3QES A;  3VQ9 A;  3O4Q A;  1LW2 A;  1IH7 A;  3HT3 A;  2IAJ A;  4CJW A;  1TK8 A;  5C42 A;  2P5G A;  3VQC A;  2G8I A;  2F8T A;  3KK2 A;  1BQN A;  3ZSZ A;  4CEQ A;  2Z1H A;  3BGR A;  4KV8 A;  3VQQ A;  1KVA A;  3MEC A;  4Z4H A;  1SUQ A;  4CHY A;  4CJ3 A;  2WOM A;  3SPZ A;  1B9F A;  3I0S A;  3MEG A;  4C8N A;  4KI6 A;  1NJX A;  1LW0 A;  4KTQ A;  3LWL A;  1LAV A;  4PQU A;  3O3F A;  3SUQ A;  2KZM A;  1Q9X A;  4LY7 A;  4BE0 A;  1RBR A;  5J2Q A;  1JLA A;  3KIO A;  5CZ1 A;  4CEF A;  3VA0 A;  4OLA A;  4K8X A;  4DU3 A;  4FJK A;  3A2F A;  4CF1 A;  1TK5 A;  4M3Z A;  5KGW A;  1T05 A;  1HYS A;  3VQB A;  5DMR A;  1F21 A;  1VSF A;  4DTN A;  4KHS A;  1UOC A;  2ETJ A;  1ZBI A;  3K58 A;  3V4I A;  4FJJ A;  4CES A;  4N56 A;  3TI0 A;  1VRU A;  4W5Q A;  2X6N A;  3AV9 A;  3VQ5 A;  1Q8I A;  4DFP A;  4NYN A;  4DU1 A;  2Z1I A;  4OJR A;  4DQP A;  2A1S A;  4FZX C;  1NK6 A;  1X1P A;  3QIO A;  4RW6 A;  4LSL A;  3NAE A;  3L3U A;  5I3U A;  4FM2 A;  4Z4E A;  4DQR A;  3QEW A;  1G15 A;  2XY8 A;  4KHN A;  2YNH A;  3C6T A;  5C25 A;  2G8K A;  1J54 A;  4RG8 A;  4CEA A;  5T7B A;  3EY1 A;  4CJK A;  3K5O A;  4OPJ A;  2KFN A;  3PX4 A;  3ALY A;  5CYM A;  1WNS A;  3RRH A;  3DLR A;  3NGZ A;  2R7Y A;  2YHA A;  1ITG A;  2KTQ A;  1GOB A;  4CGG A;  2YNF A;  4CFA A;  4EP4 A;  1WSI A;  2OZM A;  4Z4G A;  3SUP A;  4DQI A;  1YTU A;  3HO1 A;  3TR8 A;  4OKJ A;  4CED A;  4GMJ B;  2RN2 A;  1KFD A;  4HUE A;  4DF8 A;  3T3F A;  3C95 A;  5K14 A;  1CZ9 A;  3HPH A;  4E89 A;  4BAC A;  1W9H A;  2XY6 A;  1HQU A;  2GV9 A;  1WSG A;  4E7L A;  4W5T A;  4FLX A;  3DLB A;  4NCB A;  1L3U A;  2HHT A;  3ISN C;  1RDB A;  2RF2 A;  4KTZ A;  2HB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...