3LP0A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
558
structure length
555
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 152
structure length 555
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp0A05
4M95A 3ZSYA 2A1SA 3ZT4A 5F8GA 4GMJB 2VWKA 4NLQA 1ASVA 4ZHRB 4DSIA 4NLRA 4DSJA 3TABA 2BE2B 3OLBA 2XO7A 4MQ3A 2GUIA 2RKIB 1BQNA 3QO9A 2GBZA 3NGIA 3TAGA 4DTOA 2KFZA 1S9GB 4HUGA 2ILYA 1RT3A 1TKXB 1T05A 1XI1A 2HNDB 2W8KA 3V6DB 5KI6A 3KK1A 3RAQA 4ECXA 3MEEB 3NF6A 1TV6B 1KVCA 3HJFA 1CSJA 3FSIA 2WOMA 4FYDA 4EYIB 1ZBLA 1RDRA 3KMQA 4QAGA 3CJ5A 5CZ1A 2FJXA 2AGQA 3M8QB 1WNEA 1HNIA 2WONA 4FLXA 3G6VA 4IH7A 1N6QA 3MFIA 3D28A 1NK8A 4G3IA 3AA5X 3M9OB 2XY7A 2WOMB 3QEIA 2OH2A 2RDJA 3LP0A 2W8LA 5DQHA 4QW8A 4EP5A 4Y2AA 5KFCA 4IRDA 2HNDA 3KOAA 5KFJA 3OSNA 3KJVA 2ZD1B 4CEDA 4FZYA 1XR5A 3PJXA 3BSAA 3U6FA 1QE1B 2F96A 4DU3A 3MR5A 1S9EB 1O1WA 5K14A 2F8EX 3O3FA 3TARA 3AVMA 3SV4A 4CJLA 3I0RA 4B9MA 4IFVB 1KLMA 3HL8A 4YNQA 4Q0BB 4O4GA 3ASMA 3RAXA 2IOCA 3K5OA 4R8UB 3VQ5A 2D7SA 4FK4A 4NZ0A 1MU2A 1RBRA 5KFGA 5HRPA 1B92A 4DLGA 2JEFA 2FVPA 1RT5A 3G6YA 3SQ4A 3CIZA 3VQ6A 4CJFA 2AU0A 4WYWA 2O4IA 3SQ1A 2XCAA 3BJYA 5DQGA 4Y34A 3CJ2A 1VRTA 2KZMA 1HMVA 1N4LA 3RRGA 4MH8A 4G1QB 3QETA 2BRLA 2Y1IA 1NK0A 1S1UA 4KFBB 2ASJA 4TXSA 5KT5A 1OS5A 5DGAA 4F4ZA 3TI0A 2YKMB 5L1JA 2B4JA 2DFEA 4CJ5A 3QEWA 2HAIA 3V1OA 3U3YA 4CK3A 1RTJB 2C2DA 4ICLA 4E19A 2ZE2A 4CJUA 3DYAA 2RF2B 1BCMA 1QS4A 2ETJA 1TV6A 2R2SA 3TAMB 3KHRA 2D3ZA 3B6PA 4RW6A 1VSMA 3NF7A 1WN7A 2FBYA 3VQ7A 4HUEA 5HP1B 2FLNA 4J2AA 1X9SA 3EZ5A 2UUWA 4NLVA 5KFOA 1I3AA 3PX4A 3CJ4A 4LSNA 1HPZB 4KKOA 3NGYA 2VWJA 3C6TB 5I42B 5KFIA 1N48A 2FVCA 4PY5A 2HHXA 1LWFA 1BL3A 1W0HA 3CYMA 5SZTA 5FDLA 4ZVEA 1SL1A 2HMIB 3S3NA 1LWEA 1TKTB 2R8KA 3GQCA 3VQSA 4O0JA 4IG3B 2KFNA 2OPRA 3F73A 2HMIA 4Q0BA 2IA6A 1LWFB 4E7LA 3I0RB 4LQ9A 4I9LA 3L2QA 1KFSA 1C1CA 1HQUA 4O44A 3GYNA 1NK6A 3PW4A 1L3VA 3KNAA 5K14B 3A2FA 4FK2A 4E1NA 4OKJA 4E89A 4DEZA 4FJ8A 4BACA 1WSJA 4J2BA 1C2PA 2FBXA 4TY8B 4CJEA 1D1UA 2HVHA 4F50A 1SUQB 3V1QA 1IO2A 2IM1A 4CHPA 3AVHA 3S9HA 3VQDA 3VQ8A 4J9MA 1HJRA 5CYQA 1S1TA 3L8BA 4PWDB 4Q44A 3GIMA 3EPGA 4OJRA 4N47A 2QKBA 5KG3A 3MFHA 3HYFA 2UUTA 4DF8A 2BANA 3BGRB 1IM4A 4DU4A 5F8MA 4F4YA 1RTIB 2VA2A 4CESA 3ZSWA 3T1AA 1SKSA 3FQKA 4IDKB 4RU9A 2VG7B 4KV8A 3BQ1A 1QSLA 2BDPA 3HT3A 3O3GA 5KFLA 4KI4A 4MK7A 4FJ9A 3DLEB 3K2PA 4QWEA 3M9NB 3DRPB 2HHTA 3V9ZA 3OYCA 4XO0A 3PX6A 1EP4B 1TQLA 3IN5A 1JLQB 3H2LA 5D3GA 4K8ZA 3Q8PB 4DFPA 2VG5B 3DLBA 2F8TA 3UR0A 2YKNA 3JYTA 4EBEA 4F8RA 4J9OA 1Z26A 1VRUA 3NH0A 3AVBA 2VG5A 4O4GB 1KLNA 2B5JA 2BE2A 4HYKA 1FK9B 3LDSA 3HO1A 3OL9A 5KT6A 4FLVA 3V1RA 4DL5A 4R5PA 4DTMA 3QNOA 1BQMA 1Z25A 1S49A 2V4RA 1HARA 2P51A 1S6QA 2AJQA 4QW9A 2R8HA 2X74A 1SH3A 2Z1GA 3AV9A 5C25B 2OZMA 4MIBA 1XR7A 3VA0A 2AX0A 3O4NA 4M3RA 4XPEA 4ZP9A 1TL3A 4KTZA 4O5BA 4M42A 4RW4B 3DOLA 2X6SA 1U04A 3WNFA 1RBUA 2XY5A 4IKFA 4CK2A 4I2PA 4CIFA 4W5QA 4N76A 1VK0A 3ZSZA 3MXIA 2HWHA 4KB1A 2WHOA 1WSIA 4EBDA 2G8WA 5DLGA 1S1WA 3BSCA 1TKZA 3KHGA 3I8DA 3ITHB 3RMBA 4HHTA 4KV8B 4IFYA 4CGGA 4B3OA 1RT3B 1ITGA 1SUQA 1QTMA 4WFXA 4DTNA 4BDZA 4B9NA 4FK0A 4Z4HA 3AVGA 3NL0A 4K4SA 1D8YA 1JX4A 4DTXA 3TAPA 1EXQA 4CJ4A 5J2MB 3OJSA 2W9BB 4ID5B 4K4YA 4IR9A 3KLFB 4PWDA 3QZ7A 1VSEA 5DMRA 3LALA 4DWIA 3ZT2A 3AA4A 2DPIA 3KLFA 1LW2A 4LSNB 1LWEB 2G8HA 4CJKA 3NKYA 3H59A 1CXUA 3CG7A 4KRFA 1ASWA 1NK5A 4M3ZA 1NOYA 3K5LA 1DTTB 5KRSA 3OYFA 3H08A 4DTSA 1LV5A 2JEJA 3HVTA 4LSLB 3JSMA 3ZSVA 3MEDB 4DTUA 4NLXA 1ZBUA 1ZTWA 4I2QB 2XY6A 2E4LA 5J2QA 4FJGA 4HCCA 3GV8B 4F4WA 2BQUA 3K5MA 1J5OB 1FKPB 3FRZA 1U49A 4CFAA 3DLHA 3ZSOA 1TKTA 3SPZA 2YKMA 3QINA 3KKRA 2R8GA 2IBKA 2R2UA 4KHWA 4RW9B 1S1VB 4RUCA 5EU7A 4WXOA 4ED3A 1KTQA 1JLEB 4XPCA 1HPZA 4KKOB 4OL8A 1NKBA 3IS9A 3LP3A 2Q3SA 4MKBA 4ZP7A 3LP1A 3K58A 3AO5A 4QWBA 2VA3A 4E7JA 2LSNA 1HRHA 5HP1A 3PUFA 3QEVA 1FKOB 4CHQA 2IDOA 4I7FA 1ZETA 1RT6B 5F8LA 1S1XB 1KRPA 4GC7A 1QQCA 4EYHB 1KVBA 4KHRA 4M3XA 3BR9A 4KHNA 3KD5E 4KO0B 4X2BA 4ZTFA 1RTHA 1C0UB 3DM2B 4NLGA 4YQWA 1IG9A 3DLRA 5J2PB 5FRMA 2R2RA 4HKQA 4DMNA 3BREA 2FBTA 4FS1A 5C5JA 3NF8A 1HYSB 2HHQA 4ED8A 1JLCA 3KLGB 1RDCA 2B5JB 2JLEA 2YNIB 3AO4A 4E7IA 4DTJA 3SPYA 1CLQA 3AVKA 4KO0A 4NLSA 3KLIA 2V4QA 4W5OA 3V4IB 1CZBA 2IGIA 2QK9A 4CFDA 3HPGA 3PW0A 5HRNA 5EDWA 4J9PA 3LZJA 2YHAA 4CJSA 4IG0B 3RMAA 4CGHA 3KHLA 3NAIA 3PW2A 2C22A 1UWBA 1FKOA 3L2VA 4URSA 3EYZA 3PW7A 3I5CA 3OL6A 1SKWA 4OGEA 3H5YA 5C42A 1WSHA 4M94A 4FJIA 1JLGA 2Z1IA 4PQUB 3OYHA 2GV9A 4W5RA 3NFAA 4ZTJA 4K50A 1IKXB 2WONB 1RT7A 1RILA 1XHXA 2R8IA 4FJLA 4FLZA 3GIJA 3N6NA 4IH5A 1X9WA 1NJXA 4EO8A 4CJWA 2C2EA 4I7FB 2CJQA 4K4WA 3VQCA 2XRIA 4KB0A 4Q8EA 1C0MA 4BE1A 5KFYA 4FJXA 5KG1A 3GV7B 3RBEA 1VSKA 4CIEA 3V4IA 1SV5B 3E01B 3H5UA 4AHVA 3ALYA 1R0AB 1TK8A 2BR0A 2IMWP 4URGA 4MFBB 4KB7A 4KREA 1SKRA 1C1CB 1C0UA 4EO6A 5KT4A 4ZVHA 3QNNA 3ZT3A 4QWAA 3V9WA 5KFPA 4E1MA 4TSXA 1RDAA 4RG8A 1BI4B 1RT6A 3NGDA 4R0EA 4DSKA 2IS3A 1JLFB 3H98A 2HHVA 1S9GA 3SZ2A 3MECB 4ED2A 1SL0A 1DTTA 1JLBB 1TP7A 4JRQA 3LANA 3QO9B 2C2RA 5EUHA 3OYGA 4O3QA 1JXBA 2FLPA 4ZPCA 5DK5A 3OYLA 3V81A 4J9NA 1WAFA 3V6JA 2FJVA 3MR6A 5J2PA 4Q43A 3MAQA 3DI6B 1JKHB 2ASLA 4N41A 3DOLB 2IAJA 3QGIA 4CJ3A 1A5WA 4ID5A 1WSEA 1EX4A 1VSIA 2CKWA 3RRHA 1XHZA 3HXMA 2PYLA 3HHKA 1TL3B 1RTJA 3OS2A 1IKVA 3MR3A 3C6UA 3BQ2A 2J6TA 1F21A 1S1XA 3ZSRA 2IM2A 3NMAA 3V9XA 4RNOA 4IRCA 5HBMA 3Q8SB 4KSEB 3HPOA 3BSOA 4ZP6A 2D0AA 1RTDB 4OVLA 4KTWA 1RBTA 3NDKA 3FDSA 3OYDA 1NKCA 4QCLA 1QSSA 3BSNA 4CF8A 4ZP8A 1VRTB 1D9FA 1BIZA 4Q8FA 1JLEA 1NJYA 4DFKA 3M8SA 4OGCA 3V6HA 1WSFA 2KW4A 4FXDA 5KFFA 4J9LA 2QXFA 2P5OA 4J9QA 4CK1A 2W9BA 1Z4UA 4KBIA 2KTQA 2AGPA 1D5AA 4RW4A 2ZKUA 3RMDA 3VQ4A 2ALZA 4CJRA 5C24B 1RA7A 4R8UA 3G10A 4BDYA 5JUMA 3KK3B 4CHOA 4GC6A 2I5JB 3RTVA 4OPKA 2FBVA 4NCGB 1GOBA 4K4XA 4IFYB 1BGXT 1RT4B 3SFGA 3L2WA 1QE1A 3H4BA 4ECQA 3OYKA 1S1WB 1JIHA 4CEBA 4DS5A 1U4BA 3PX0A 1LW2B 2UVWA 4DQIA 2OPSA 3CJ0A 3ZSXA 3QGGA 2W42A 4FM2A 4E3SA 3I0SA 2NUBA 3OYIA 4IDKA 3TWHA 3THVA 4WE1B 3NH1A 2V0NA 1TVRA 3IRXA 2XWYA 1KFDA 4M45A 4B9VA 1RT1B 2YNGA 2IC3B 3NH2A 4MK9A 1EETA 5KFKA 1SV5A 4CGFA 4FW1A 4K4TA 2JGUA 2ATLA 1HNIB 3Q8RB 2HVIA 1JLQA 3DMJB 3LAKA 4RNMA 3AVFA 3M8PA 1K1SA 1MMLA 4FBUA 3Q8QB 4H4OB 4AILC 2VG6A 4J2DA 3DMJA 5DQIA 3N6LA 4KHMA 5KTQA 2VG6B 4H4OA 2B6AA 3SQ0A 2VG7A 3CDEA 3OYEA 3EZUA 4K8XA 4PQUA 1QHTA 1DLOA 1JLGB 4C8LA 3FFIB 3CFRA 4CEEA 4DL6A 3KIOA 4IG3A 1S0MA 2PYJA 2YKNB 3JYTB 3GIIA 2RKIA 3B6OA 3QZ8A 4M3YA 3U3GA 3VA3A 4C8KA 3UIQA 1RAJA 3S3MA 4ZPAA 2WCXA 1HQEA 5DG9A 3VQPA 2EX3A 1S4FA 2OPPA 4PUOA 1K1QA 2XGPA 4F2RA 3OHAA 4DTPA 4O0IA 4BE0A 2G8VA 4MIAA 4YR2A 2DTUA 1REVB 4TY8A 1U48A 3KLIB 3T5KA 2HW3A 3PVXA 5KFTA 3T5HA 1BISA 3OYBA 3H5SA 3KK3A 3OYNA 1C1BA 4FZXC 3ZCMA 1HNVB 5JS1A 3KTQA 1RBSA 3V9SA 1DTQB 1FK9A 3CDWA 2I5JA 3EPIA 4QPXA 2KZZA 1N5YA 4DQSA 5HROB 3PY8A 4DTRA 1ZTTA 3QERA 2FVRA 4YP3A 4M41A 3D45A 2HNYA 2DPJA 4EZ6A 3QIPB 3K5NA 4ECTA 5KFRA 4F4XA 2A1RA 1S1UB 4KFBA 5KFEA 1NOZA 3KD1E 1RYSA 2AWZA 3DRSB 4CERA 3O3HA 1IKWB 4AHRA 4AHUA 1S1VA 4IH6A 4Q5VA 1RTIA 3CDUA 3OY9A 3CQ8A 5EWGA 2DFFA 4EBCA 1UOCA 1IKYA 1G15A 2OPRB 4Z4CA 1FKPA 4ICLB 4KI6A 4E7KA 2UVRA 2E6MA 2IM0A 4B8AB 5DGBA 2GIQA 2C28A 1JLBA 1RDDA 5I42A 3HVAA 4JV1A 4O3NA 1C0TA 3PHEA 4WFZA 1C1BB 2ASDA 4ECZA 2WK4A 4U6PA 4FCYA 1D0EA 4EEYA 2RDIA 5KT2A 2R2TA 3NGZA 2G8UA 1K6YA 2ZQBA 1HQUB 4O44B 2X6NA 4O3SA 4KE5A 1RYRA 4ED6A 1X1PA 1KSPA 4H4MA 3C94A 1MU2B 2IJNA 4BWMA 4F2SA 5F8HA 1X9MA 3M8QA 1L5UA 2G8KA 5JXSA 2YHBA 4ELTA 3QEPA 4AHSA 1Y97A 3VQAA 1R0AA 4HUFA 3HVRA 4H54A 1RNHA 1TK0A 4RNHA 3EY1A 5T7BA 2QV6A 4Z4EA 1YVFA 2D5RA 1Q9YA 1UWBB 1J9AA 2YNFA 1UA0A 1SH2A 1CXQA 4RW7B 4CJPA 4ZVGA 5J1EA 4B9UA 1BCOA 3HK2A 4Z4GA 2P5GA 2YNHB 4B8CA 1TGOA 4DU1A 3KHHA 1HYVA 1TL1A 2QE5A 1U47A 4IFVA 1EETB 3NAHA 3MXJA 3G6XA 4JLHA 4U7CA 5KFNA 3IRXB 5F8IA 1VSFA 2I1RA 2G8IA 4B9TA 2Z1JA 3ZSQA 4LQ3A 4FJKA 3GILA 4G1QA 1T7PA 3SUQA 1HMVB 1J54A 4CFBA 1BIUA 3SCXA 3DRRA 5CYMB 4JS4A 1VSJA 3P5JA 3DOKB 5CYMA 2HNZA 1JL2A 3AVLA 3LAMA 4ZVFA 1J53A 2FVSA 2DY4A 1TAUA 3AA2A 1ZYQA 4IBNA 3LZIA 4CF1A 4M3TA 3LP1B 4TYAA 4FJNA 4O4RA 5C24A 3OLAA 3RR7A 1WSGA 2PY5A 1BQNB 4B9SA 4Z4FA 1RTHB 5DG8A 3BDPA 1KLMB 1RDBA 5D3GB 3KLGA 3RMCA 1NNDA 1RCHA 4CHNA 3QEXA 2JC1A 1WLJA 1S9EA 1XWLA 2XY8A 3PO5A 3OYMA 4CEAA 4Y1CA 4KTQA 3OSPA 4RW8B 4KHSA 1J5OA 2XGQA 4KHUA 3H4DA 3N6MA 4OLBA 3M8PB 4Q45A 4I2QA 4FJHA 4F3OA 4LSLA 5SWMA 4YMEA 5HLFA 4ECSA 5HBMB 4KPYA 5I3UB 3K57A 3RR8A 5KRTA 5KG0A 3RB6A 3G86A 4URQU 4O3RA 3ZT0A 4ED7A 3M8RA 3KK2A 4ELVA 3O4QA 3L3VA 1LW0A 3IS9B 4NRTA 4LH5A 3QLHA 1RT1A 2YNGB 4Y3CA 1BHLA 2Z1HA 3DLKA 1RT2A 1JKHA 2V9WA 4WYLA 4GW6A 2O5DA 5L1IA 1ZBHA 3PR5B 3SUNA 1JL1A 3T19A 3LPUA 4E0DA 4IQXA 1HYZA 3AA3A 3SUPA 3HM9A 4FLTA 3S3OA 3TANA 3V6DA 4NLYA 2X78A 3VQEA 4M3WA 1ASUA 3NBPB 4NCGA 3MEDA 2BQ3A 3KMSA 1JLFA 4GVMA 4OPJA 5KFHA 1SH0A 2JEIA 4FJJA 3CFOA 4HTUA 4K4UA 1BI4A 3ITHA 4NYZA 3DLKB 1I6JA 3QESA 4MK8A 4ELUA 3OS0A 2WRMA 1T94A 3CVKA 2D0BA 4TQRA 3KLHA 3UPFA 2W9CA 4F3TA 1NK9A 2EC0A 4MFBA 3MR2A 2F8SA 3PJWA 1NKEA 1ZBFA 1N56A 3ZT1A 4NCBA 4K4VA 3OHBA 1DLOB 3QIDA 5KFMA 3E01A 5F8NA 3BQ0A 2B43A 4YR0A 5C25A 5KFQA 5I3UA 4RUAA 1WNSA 3DRSA 4BE2A 1LAWA 4WFYA 4CEZA 1TKDA 4YFUA 4J9SA 4HCBA 3MTKA 3HPHA 4PA1A 4I2PB 4FS2A 4DFJA 4J9KA 3LP2A 3DDKA 2HNYB 1BQMB 4XIUA 4W5TA 4FJMA 3KK2B 3IGVA 3FQLA 3V81B 2BQRA 2RN2A 3NAEA 1TAQA 4FVMA 4I9QA 1YVUA 2HB5A 2IC3A 5KFUA 4OLAA 3MEGB 3SI6A 2QKKA 5HLFB 1W9HA 3NF9A 4WE1A 1VRUB 3SFUA 3AVIA 3LWMA 3I0SB 1NJWA 4RNNA 3RWUA 4TYBA 1GOCA 3MXMA 1XC9A 4TQSA 3HVWA 4QWDA 1S6QB 3WNHA 1NHVA 4TN2A 1EP4A 4BDPA 1RT5B 2GC8A 3AVAA 3IG1A 1S9FA 3V9UA 2UVUA 3DOKA 4N56A 4EZ9A 3DLEA 4AH9A 3DRRB 2FVQA 4MKAA 2E9RX 3QIOA 1S10A 4WZQA 3HSTB 1W25A 2WTFA 2AX1A 2YNIA 3T5JA 4LD0A 4R5PB 4IKAA 1LWCA 1NJZA 2YNHA 5T14A 2EHGA 1JXLA 3HP9A 3CFPA 3MEGA 4KAZA 4RW7A 1RBVA 4JV2A 1TL1B 3ISNC 1S0OA 2ZD1A 3H5XA 4K4ZA 1IH7A 3SJJA 3D0PA 1NK7A 4JS5A 3F9KA 2FLLA 2W7OA 4CGDA 5J1EB 3L2UA 1S1TB 5J2NB 3LP0B 4J9RA 5KGWA 4DSFA 4O3OA 1JXEA 4F4KA 2UVVA 3HKWA 3KLVA 2ITGA 2OYQA 1VSLA 4EP4A 4FJ5A 3MF5A 1RT7B 3L2RA 5KFBA 1T03B 1C6VA 4TLRA 3C6UB 4RW9A 4Z0UA 2R7YA 3SQ2A 2OPQB 3DLGB 4C8MA 1JLAA 4C8OA 3GIKA 2HWIA 3WNGA 4B08A 3BGRA 4ECWA 3VQ9A 2YNFB 3MEEA 4WXWA 3RB0A 3KK1B 4FLWA 5KG5A 2W9CB 1GOAA 4DQQA 5KFWA 3TAFA 5KFSA 4N5SA 2FC0A 1A5VA 3OL8A 4IG0A 4ED0A 4FW2A 1B9FA 2Y1JA 1ZBIA 3ISND 3CM6A 1KVAA 4CJTA 3OS1A 3OL7A 4IRKA 4ECUA 4CHZA 4IR1A 3P83D 3IAYA 3UDLA 4CF9A 1A5XA 2YV0X 3PZPA 1NHUA 4RW6B 1C1AA 3TQ1A 4CHYA 4FBTA 3TAMA 3SI8A 1UA1A 2IJFA 3OYAA 4FM1A 3T3FA 1KHWA 2W7PA 2RF2A 1NK4A 4LY7A 5CZ2A 5J2MA 2DFHA 2OPQA 3KLEB 1RT2B 1S6PB 2P1JA 1YT3A 4CEQA 1T03A 1T8EA 1U09A 1GX5A 1S48A 3QLHB 4Y1DA 5CY4A 4HVJA 4RZRA 2AGOA 4CJQA 4DG1B 3P1GA 4OKKA 3CWJA 1L3UA 1S0NA 2D41A 1KCFA 4M3UA 3CJ3A 2BGGA 4AHTA 5FRNA 1L3SA 5KFAA 5FROA 3QGHA 3VN5A 4NYNA 3L3UA 3M9MB 5KFVA 1QUVA 4J2EA 3D5MA 3VQQA 3ULDA 4FLYA 2GIRA 5KFZA 4NYFA 2FJWA 4RW8A 2IAJB 1I39A 3CO9A 1GX6A 3LWLA 2HHWA 2HHUA 1IKYB 1FXXA 3NE6A 5KG2A 1HNVA 3AO1A 4NLUA 2E6LA 4IOBA 4NLDA 5J2QB 4ZMMA 4YR3A 2PZSA 4KHYA 4BWJA 1N5YB 4JRPA 4DQPA 3HVTB 3JSMB 5C42B 1REVA 1DTQA 1Q8IA 2JC0A 3WNEA 2OPPB 4PUOB 4DG1A 2IM3A 3NHGA 5J2NA 4CECA 4FJ7A 1RA6A 1CZ9A 4QOZB 2J6UA 3HP6A 1U45A 2XI3A 5HROA 4DSEA 1JLCB 1JLAB 1HYSA 4QWCA 3DLGA 3TR8A 1SL2A 4FM0A 2WB4A 3OJUA 3SUOA 2OA8A 5L1KA 3FFIA 4ID1A 2D0CA 3LP2B 3KJVB 4DL3A 3SNNA 1TK5A 4DQRA 4UQGA 4B3OB 4JV0A 4JUZA 4RNFA 4DL4A 3DRPA 5DLFA 4TY9A 5L1LA 4C8NA 1TKZB 1L3TA 1HQEB 4NLTA 3C95A 4FZZA 1S5JA 3V6KA 5EWEA 4CEOA 5DG7A 1UAXA 4NLPA 1S97A 3E51A 1IKXA 4H8KA 4CE9A 2XI2A 2ATQA 2BANB 4ZPDA 3AVCA 3IGNA 1N6QB 4KHQA 3TAQA 3CM5A 3KLHB 2B6AB 4CF0A 4O3PA 2E9ZA 2XHBA 4DSLA 3LPTA 4DS4A 4ZPBA 5EWFA 3SYZA 4H4MB 2KQ2A 5KT3A 4FLUA 4CF2A 4O55A 2OPSB 4L8RB 5JS2A 5HRRA 2ILZA 3K59A 3PV8A 4CGIA 4CIGA 2XC9A 1RT4A 4NLOA 1QAJA 4NCAA 1VSDA 3PW5A 1TKXA 1T05B 4AHCA 1XR6A 3T5LA 4ECVA 3RB3A 4CFCA 1KHVA 1EKEA 1TVRB 2XCPA 4ZHRA 3AVNA 2O4GA 1C0TB 4NRUA 1LWCB 2G8FA 3G0ZA 4ED1A 2OZSA 5KFDA 3DM2A 3PO4A 5KFXA 2JEGA 3SV3A 1LW0B 5E41A 5FDLB 3I5AA 2J6SA 3TVKA 4CGJA 4E7HA 3IG1B 3C6TA 1RTDA 3UQSA 4W5NA 4DL2A 3RB4A 2RPIA 3OVNA 4CCHA 5F9LA 1YTAA 3AO2A 1LAVA 4NLWA 1T3NA 4B9LA 4DF4A 4KAIA 4OKEA 3KKSA 3AO3A 1QAIA 3NBPA 1IKVB 2R8JA 4DLEA 1WAJA 1IKWA 1Q9XA 4WZMA 5KG4A 1B9DA 1D9DA 4Z4IA 4DFMA 3DYAB 4DL7A 1YTUA 2BRKA 2E9TA 2ZE2B 3H40A 3VQBA 5KG6A 3OYJA 3QIPA 5HRSA 1QSYA 4CJVA 4LH4A 5CYQB 2D3UA 3QYYA 3DI6A 1VSHA 3MECA 3PR4A 5KT7A 4ECYA 4Y2CA 5KG7A 3ICLA 3RBDA 4ECRA 4CEFA 5L9XA 2W9AA 5F8JA 3NCIA 3I5BA 2HNZB 3AVJA 1S6PA 3KLEA 3GV5B 5F9NA 3TAEA 2AQ4A 5KGXA 2HHSA
chains in the Genus database with same CATH superfamily
3NGSA 4FOEA 2F5GA 3OTOK 4JKDA 4WKRA 4NLQA 1NJIO 2VL1A 4AL7A 4ZHRB 2DCUB 2V8HA 4DSIA 4NLRA 3OLBA 2KHOA 4MQ3A 4LF4J 2ZF5O 1SIZA 3G6ES 2GCFA 2RKIB 3JXUA 5AJ3J 1CJVB 3GU0A 1NGIA 2HBJA 1RBLA 2DO0A 3M3ZA 1VQKS 2VHGA 2Z2MA 1RT3A 1T05A 2FC9A 3R7BB 4A61A 4OI0A 3V6DB 3LDLA 1HL6A 3RAQA 1CSJA 2WOMA 3KWGA 4FSVA 4TU8A 4FYDA 1ZBLA 3MN9A 3OXGA 4DX7A 5K20B 3KXDA 1RDRA 4PAAA 3R5JB 1XMQK 2FJXA 2B3TB 4M7YA 4LBPA 2KT2A 3G6VA 2DJWA 3WQTA 2HFVA 3UWTA 2O66A 3U9DA 2NXNA 3AA5X 4TVAB 1HUXA 2VQEK 3LP0A 3Q7BA 4KGXB 1OY6A 4IXCA 3J80Y 1B4SA 4EP5A 1NGFA 5KFJA 2ZD1B 4GKKJ 2MGZB 2ASOA 4CRJA 4DU3A 2XS5A 3FZ2A 2V5HG 4JI6K 1KOOA 5K14A 1I1GA 2F8EX 1Q81T 3UVJA 4JV5F 4CJLA 4B1VA 4YY3K 4O4GA 1UFLA 3RAXA 2HBKA 3VQ5A 4FK4A 1MU2A 3LUYA 2HVDA 4WJBA 5HK4A 4OHYA 5HRPA 4LFAJ 2JEFA 2UUAF 4PABA 2QIFA 2QYCA 2FDNA 1HMVA 4G65A 4CLPA 4KY3A 1GTHA 3QETA 2AP6A 3CJTA 2K7JA 1WUAA 3CI5A 1MG7A 1OH7A 1VQMN 4L76A 4ILHA 4YORA 4GRSA 4X65J 1JXVA 4F4ZA 1FRXA 1YF5L 1RTJB 3GCWP 2C2DA 4E19A 5CHIA 2QWLA 1GK8A 4JAXA 2V7YA 1GLCG 2R2SA 3TAMB 3KHRA 1RU2A 4DUZF 2E7VA 5F0WA 5HP1B 3CJAA 3UN2A 3AT1B 4J2AA 2OLWA 1LXJA 2CQ1A 5KFOA 2HWTA 4LSNA 1CBKA 2QX0A 3TOQA 2VWJA 1HD1A 5K8PA 1AXQA 4NI2A 2HHXA 4CBUA 1LWFA 1W0HA 5FDLA 1F0XA 4NYPA 1LWEA 1BU6O 3GQCA 1WJ9A 1TUYA 3UKRA 2KFNA 3F73A 5FLXY 3QWPA 3MMCA 4OO1J 3GFZA 4LQ9A 1U2RA 3S1TA 1NHKL 3A2FA 1KQSM 1BE4A 3LL3A 2P9PB 4A8FA 3S7RA 2ZNZA 1GLFO 2W2MP 2FBXA 3MI7X 3V1QA 3NGRA 3IBFB 3BM7A 3AVHA 1XNQF 2CQDA 2DIUA 4J9MA 1CZAN 3SSQA 1YJWS 4WP9A 2AW0A 3EPGA 1W7WA 4LFCK 4N7TA 2YH0A 3HYFA 2UUTA 2E1RA 1HLWA 2KKHA 5LT5A 1NM2A 2P9LB 4F4YA 4CESA 4DR2J 4A8SA 2VG7B 2KT5A 3BQ1A 5G0RA 5AQZA 4MK7A 4FJ9A 1HWUA 2YKQA 3DLEB 3MCAB 3M9NB 3D2EB 2F4VJ 4NXNJ 3G82B 3KUGA 2DGOA 1ICEB 3OV7A 2RE1A 1TQLA 1Z6RA 1WC3A 3IN5A 4RLEA 4DFPA 2VG5B 4EBEA 2YKNA 1AROP 3KJFB 3QSIA 2GEMA 4GKJK 3TUZC 2RU3A 4HYKA 4BR0A 3LDSA 1BO5O 3HO1A 4BRKA 4WFBL 2ASYA 1IBKK 4FLVA 4DV5J 2DR8A 1P6TA 2CG8A 3CDAA 4DL5A 1Y0HA 2P2CB 1KQSR 4R5PA 2DHGA 4DTMA 2V4RA 1HARA 4BLGA 3QGPA 1DURA 2P9IB 4CYUB 2CWXA 4CLUA 4WIIA 2NQPA 4HLBA 4N8OA 2UXDK 2FPHX 2Z1GA 2CQ3A 3HHNB 3EVMA 1U0SA 3ZLJA 2CDQA 2OZMA 3Q8VA 2AX0A 4OYPA 3O4NA 4M3RA 2OSRA 1TL3A 1VQ4S 3A8YA 4M42A 3MX2A 1S72S 1RACB 2X6SA 3PACA 1U04A 3D68A 2XY5A 4I2PA 4N76A 2UUCF 4E1JA 1PYSB 4KB1A 3K9JA 5E33A 3GOIA 4UZCA 3I56N 1SC1B 3I55N 2W1BA 4FVUA 3KHGA 4V19S 3MN6A 4IFYA 1RGVA 4B3OA 1SUQA 2FHJA 1QTMA 3OD2A 4WFXA 1RB0A 4BDZA 2VGNA 4FK0A 4Z4HA 4X62J 3AVGA 4K4SA 1PAEX 5B0CA 3VWSA 5IM0B 4F7VA 3GJQB 4ID5B 2NCKL 4IR9A 2KLAA 5AJ3F 2G2ZA 2P9GA 3U4LA 3ZT2A 2BOPA 2WVBA 1SVDA 3IP0A 4LSNB 1MROB 2Z30B 1VHFA 4DV7J 3W0LA 4KRFA 2J0SD 1NK5A 3TUPA 3QMQA 2OIHA 3UN3A 4DTSA 2F4FA 2JEJA 4LSLB 1LKZA 1RQ0A 2AKWB 2Z56B 1ZBUA 3ZZRA 1UVMA 1ZTWA 5A0YA 3R97A 4F4WA 5BREA 2Q43A 5AQUA 3C15B 2PI4A 3M7VA 1FKPB 2RQMA 3POTA 3OUYB 2QLBB 3SPZA 1YZ6A 4X4NA 2R8GA 4RBTA 1Q8LA 1I3OB 1S1VB 2UXBF 1HWJA 1JLEB 1X7VA 4XPCA 3M2UB 3OTDA 4DPTA 2CPEA 1IR0A 3I96A 2Q3SA 1EWRA 4MKBA 2GUPA 1YAGA 3LP1A 4NEYA 3DWLA 1RBOB 1FKOB 4KJIA 4DPUA 4WQ4C 1KRPA 1QQCA 4GC7A 2OTLS 5IS2A 4KHRA 2CZVC 1XMOK 2IHR1 2P9IA 4Z94A 3GJRB 3DHXA 3TTCA 5GINA 3QRRA 2D9OA 5E5NA 3BP8A 3CJ7A 3TTDA 4YOTA 5AXMA 2FBTA 5DM6Q 2PEBA 1I94K 2GVDA 1RDCA 3KLGB 1UZHA 2CQ4A 2Q97A 1CLQA 2YNIB 3AO4A 4O23A 1WF1A 1HNZJ 3KLIA 4W5OA 3V4IB 3EVOA 1XIQA 3M8YA 3PW0A 5HRNA 1GQEA 2RS8A 3KK7A 2BW7A 2ZVSA 5HQ8A 3KHLA 3NAIA 3WC0A 2NSBA 3OL6A 1SKWA 1IM6A 1DKGD 3Q0AA 1FEEA 2J0WA 4M94A 1JLGA 1PCAA 2GVDB 4PQUB 1FRLA 3OYHA 4CZFA 3KUEA 4ZTJA 1ZM3A 2ZM6K 2XSJB 1RT7A 3A8IA 5GADU 2R8IA 1GNKA 2KRRA 1ZM4A 1WF0A 3AA9A 2JSXA 2C2EA 2EXUA 1YITN 4I7FB 4KB0A 1ZAVA 2CH5A 2DHXA 3IR7B 4JI1F 5KG1A 3ZZOA 1HW9A 4CIEA 3V4IA 3MR7A 2WTUA 3M1VB 2LKZA 2R7SA 3H5UA 1Q5YA 2PA3A 3CJ1A 3ALYA 4BR7A 1DQAA 4WU3A 1C0UA 3NGTA 4EO6A 3JS9A 4K59A 4U7UK 4ILGB 2C42A 3CCMN 2QFIA 1RT6A 1F5AA 3NGDA 1JLFB 2QO3A 3H98A 2QA2A 4J37A 1S9GA 5I9EB 4ZVQB 3SZ2A 2CQ0A 4ED2A 1SL0A 3GJTB 3QO9B 3HD2A 1RSCA 4G1PA 2MZSA 5AQNA 3MD1A 1JXBA 4CO1A 1J5EJ 1XNQK 2ROGA 1WOPA 2L9WA 3W9HA 4B3SK 1ZM9A 2XLIA 1WAFA 3U8XA 5J2PA 2OKQA 1O8BA 4DB3A 1PJ5A 2ASLA 3DOLB 2EG1A 3QGIA 4CJ3A 1VSIA 1EX4A 5LJVA 4FWKA 3BQ2A 2DRBA 1KXPA 1S1XA 2CGLA 3ZSRA 1SJQA 3V9XA 5DZ6A 3AAWB 2CPXA 1UVNA 1I94J 4HTIA 5BPLA 3NDKA 2J9DA 1NKCA 3EZWA 4QCLA 4X4QA 3BSNA 1BMQB 1KAZA 1FTRA 4ZITA 2QA4G 4Q8FA 4DFKA 3M8SA 1WSFA 5ETSA 3D3CJ 4J9LA 3U02A 2LU1A 4BY9C 5HSPA 1S99A 4DHYA 3HM8A 4CK1A 1R89A 4KBIA 2JWNA 1D5AA 4K8RA 3RAMA 4CJRA 2NYHA 3G10A 4NXMK 4CHOA 2I5JB 1H2UX 1QY7A 4MJKA 3NWGA 3J7ZO 1GOBA 1G99A 1RT4B 3SFGA 3H4BA 4UZBA 4ECQA 4U8YA 1JIHA 1U4BA 3E9LA 3FZBA 2OPSA 3ZSXA 1ATRA 3I0SA 1BA1A 3TWHA 1SBRA 5D0HA 1FNXH 2V94A 2DNOA 3R2DJ 1R3NA 4DR3J 1T02A 2CADA 2XWYA 1KFDA 2W2QP 4B9VA 2O8FB 3CC4S 2VPXB 3FZKA 2BJDA 5KFKA 4FXWA 4CGFA 2OO4A 3DCAA 4OQJA 6FDRA 2JGUA 1H7WA 4DCOB 2HVIA 3W5YA 3ENOA 4GV6A 1X4DA 1NGHA 3AVFA 1K1SA 3EKUA 3NVKA 2YI1A 4AILC 2B9WA 1NGCA 5DQIA 4Y0FA 4KHMA 3W2VB 4ZLNA 3O9UA 2VG6B 4H4OA 4C0OC 2HQFA 4BC3A 3OYEA 4QYZK 1X5PA 1HNXK 4K8XA 4PQUA 1QHTA 3FCHA 5THWA 1JLGB 2V7ZA 3CFRA 1S3XA 4OYZA 3HFZB 4MT1A 3GIIA 2RKIA 3IR6B 3OXFA 3QZ8A 3B6OA 3U3GA 4JI7J 3VA3A 2G2OA 3UIQA 4TU7A 3P3DA 3S3MA 3CJQA 3I55S 2EX3A 3K89A 3OHAA 1N34K 4BE0A 2CGKA 4DV7K 2WBRA 3QT5A 4JP8A 3KLIB 2HW3A 5KFTA 1E4GT 2ADCA 2Y3YA 1U2CA 1FF2A 1HNVB 2ZJPQ 3KTQA 2W6LA 1ATNA 1FK9A 3CDWA 3CC7S 4QPXA 2KZZA 5HROB 4I4BA 1EQ0A 2V52B 2E88A 5TKWA 1NAQA 3NVMA 2F9WA 3CC4N 4YOEA 3QFHA 4KH0B 3IRWP 4NI2B 1S1UB 4KFBA 2G2YA 4QIEA 1TL7A 2F9DA 5ETQA 3BBFA 4BRMA 2UUBJ 3CCZA 2ZH3A 1IKWB 2BM1A 3ENVA 4IH6A 3UW1A 4HL9A 1RTIA 3CDUA 3OY9A 5EWGA 2QN6B 4EBCA 2FJAB 2VZ9A 1N8RO 1R6VA 4UTGA 4B3TJ 4JKGA 2XNRA 3CCLN 5DETA 4P71A 1FKPA 4IUFA 4Y6IA 4KI6A 4HH0A 5DGBA 3W8PA 1FJGJ 4C3KA 4K0KF 1TR0A 3JXOA 5LL6Z 1VJQA 4O3NA 3VHQA 3W3DA 2WK4A 4RR5A 4DPXA 1QQNA 1D0EA 2M88A 2J7WA 4GKKF 3G8SA 2R2TA 2CVEA 1T6CA 5CA5A 2ZQBA 4OHZA 1R8PA 1VR6A 5CD4H 2B8PA 4ED6A 1TYQB 4RO0A 1MU2B 2V8GA 4BWMA 5LMNJ 2NR0A 3JTPA 3QEPA 4FKYA 3F41A 4YOWA 1Y97A 4GVBB 4HUFA 3HVRA 4JKAA 3BN4A 1NNEA 3EY1A 5T7BA 2HHPA 4ALZA 2QV6A 2RJZA 1BQXA 2G4BA 1M90O 2RRBA 4U7UD 2D5RA 4NL5A 1SJ1A 2YNFA 1CXQA 3QJJA 4ZVGA 2KG0A 3HK2A 2V67A 2YNHB 2GELA 5IWAJ 4LF4K 3G4SS 3QWUA 3MUTP 2QE5A 1U47A 4IFVA 3NAHA 3CJCA 4JLHA 1P1LA 3S8SA 4U7CA 4DV0K 5F8IA 5FPNA 3IMXA 5IT9U 5H9EK 4B1WB 3QJLA 2CUYA 2Z1JA 2M2BA 4P7TA 3GILA 4C97A 3T6JA 5GAHI 3HSDA 1J54A 4CFBA 1BIUA 4JS4A 2FHMA 4PR6A 2VQFF 3QBWA 5B0DA 1E6YB 1VC5A 1ZAXA 4CLWA 2FJDB 2LQ8A 5BYSA 2DY4A 1ZS6A 1TAUA 1WI8A 2BJ3A 4FPRA 4M3TA 3OLAA 2EFQA 2V2VA 4DR1K 3BDPA 2BKOA 1GAOA 2X51A 1NNDA 1NLVA 5AQFA 4JKHA 2GX9A 2B7CB 1RCHA 2FZKB 4OV6A 4DOZA 1T11A 4X4OA 4CEAA 1W2IA 2BE7D 3OSPA 5DM7Q 2W2NP 4KHUA 5C7PA 5JLFA 5IC6B 1IXKA 2HEKA 5HLFA 4JI5J 3C66A 5KRTA 5KG0A 3RB6A 3G86A 3NG8A 4KH1B 4PG6A 4ZVPB 1U2FA 1YBAA 1QTNB 8RUCA 4LH5A 4I68A 2HFUA 3C14B 2KKZA 3PIPL 2HK2A 1T6DA 3SUNA 1W7AA 4L73A 3C7NB 3T19A 1H0HB 4IO8A 5B8HA 1HYZA 1FX2A 3SUPA 2DGVA 1EQYA 3C16B 3POTB 3MN7A 3TANA 4M3WA 1KOHA 3OBIA 1ASUA 2IDLA 2AJ2A 3I33A 3KMSA 3H8YA 1N52B 4GVMA 5KFHA 1SH0A 4FJJA 1XMQF 2NRTA 2PBDA 1RE1B 5LL6d 2HQ3A 4H4KC 3H90A 2WRMA 2Y8WA 3ZFVA 4CBWA 3UPFA 3AD9C 3IBWA 3H25A 4E8UA 4YOYA 3G96A 2RHQB 3B4DA 3PDNA 4BC7A 1A0OB 1GTEA 5I3UA 2PT0A 2MZ1A 4AF1A 3GIRA 2QEXS 2GFFA 2YCHA 4J9SA 3H45C 3MTKA 4PA1A 2DHAA 3J7ZT 2VFUA 3LP2A 1UWAA 1BQMB 3BYRA 5HANA 2RN2A 1TAQA 1VLOA 1MA9B 1YVUA 3AQPA 1M5HA 2E5LF 3H6EA 5EVZA 5KFUA 3SI6A 2QKKA 1W9HA 1U0HA 3SCKE 2R7UA 1NJWA 4RNNA 4DZ6A 4HDHA 2J7KA 1XC9A 4TQSA 2DYAA 4BS2A 3WNHA 3O9RA 3DAWA 1EP4A 5IZHA 2DRAA 1Q7YT 4O0NA 4BDPA 1RT5B 1N32K 4HTJA 1S4EA 2VU5A 3HFKA 1S9FA 4AH9A 2PE8A 1YUWA 3A13A 1FD8A 5AXKA 3ZZUA 4NE9C 5FPMA 2R7RA 4LD0A 4FF1A 4IKAA 5L39A 4OI1A 1LWCA 3IFEA 3I56S 1L3KA 3EWGA 1NJZA 1WI6A 5L8RC 4CQ1A 1JXLA 3CFPA 4RW7A 1NMEB 2MGZA 4JV2A 2ZD1A 1GH8A 3U1MA 2RDDA 3OR2B 2W7OA 1REGX 4XK8C 4CGDA 3BF3A 5J1EB 5J2NB 3LP0B 1U02A 4J9RA 4O3OA 3IM9A 3M1FA 4F4KA 3DXMB 1WHVA 4O8UA 4OZJA 3HKWA 2HG4A 3G87A 4DI6A 5LMNK 1WC5A 3MUMP 5BRFA 3C3LA 4JHDB 4EP4A 4FJ5A 3MF5A 1RT7B 5KFBA 1UAWA 3UCUP 2R7YA 2A10A 4C23A 1HA1A 1JLAA 2YHYA 8ATCB 3LA0A 3KUHA 3ZNJ1 2YNFB 3MEEA 1X4CA 4LRCA 1JJ2R 1Q0NA 4FLWA 3OW2M 1GT8A 1VQ7S 4DV5F 5KFSA 2OTLN 3QDKA 4N5SA 2ACMA 1A5VA 3OL8A 4FW2A 1K44A 2BBEA 3OBWA 4P52A 1KEKA 3VALA 1RAFB 4IRKA 1S6UA 4J7CA 4H5TA 3BO3A 1H2TZ 4IR1A 2CAJA 3W3SA 1HNXF 2RQCA 2XMTA 3FKBA 1N0UA 1IBKF 3UDLA 2JVOA 4IYQA 1R6YA 3F2KA 4JN4A 5KPZA 4EI2A 4RW6B 3TQ1A 2LQBA 3MUVP 3OYAA 1YJVA 4FM1A 4Z37A 1KHWA 3DDIA 2RF2A 1NK4A 4LY7A 2PMZD 3AXKA 4CM0A 2WAQD 4R0JA 2J9DE 3OBYA 4DR6J 3OT9A 1TU0B 2HGNA 2EEYA 5HVFA 1X5TA 2J0QD 1E4FT 5ETPA 1S48A 1H73A 2BE9B 2YXLA 3Q8YA 4CJQA 1RTZA 2YPYA 3P1GA 3O9SA 2GQ2A 2V51B 5K8NA 1RAHB 3LM9A 5ADXA 1L3SA 4F0MA 3N9UC 4NYNA 3EMTA 3M9MB 1QUVA 2VIHA 2CIMA 3ENWA 3ULDA 4USHA 5KFZA 4NYFA 2FJWA 2V9KA 2MB0B 2IAJB 4ILJA 4GKKK 3CO9A 1GX6A 4X65F 1UW4A 1X8DA 3V2UC 1FXXA 2B51A 4NLUA 2MDAA 2E6LA 2NRXA 4Q2MA 2HHHF 4YR3A 4JRPA 3GBTA 2VDHA 5AZIB 2DNRA 5FLXU 1REVA 5ELZA 4A8WA 1DTQA 4RL1A 1Q8IA 2AJ1A 2JC0A 1T3OA 4RX6A 3M8WA 2OPPB 4PUOB 4C98A 1R8CA 2A3ZA 2YKPA 1AUDA 4DG1A 5E84A 4FJ7A 1RA6A 1S57A 4J91A 3LDPA 5HMXA 1CZ9A 1XMOF 4QOZB 5HMWA 1C4AA 4KH6A 2WW4A 4LMZA 1JLCB 1HYSA 4ITSA 2HBRB 5GADP 4P2XA 1VQ9N 1BLUA 3FFIA 1TL4A 1NDKA 2BJEA 4LF8J 1CS4B 1BG3A 4B3OB 3DC2A 4DL4A 3DRPA 5DO2A 3H3OB 5L1LA 4AQYJ 2AIRB 5A76A 4NLTA 5LSLA 5EWEA 2XO6A 4X62F 3J80O 5DG7A 1UAXA 1HBOA 5IT4A 5E7OB 3D6FB 5AE2A 4JB8B 2X1AA 3DLLL 3JS6A 2XI2A 4ZPDA 3BB5A 3Q83A 3CXCR 3AVCA 4KHQA 3TAQA 4W92B 3CF5Q 4CF0A 4DSLA 2XHBA 4DS4A 1Q81O 1J27A 2E5JA 3MMAB 3SAGA 2KFYA 4FLUA 5E3RA 1OKJA 3Q86A 2N4DA 3ISZA 3QSYB 4DN0A 5JS2A 2QSFA 3EKSA 4M5DB 1GLAG 5IT9O 4USIA 2L41A 1VQMS 4CIGA 3W9IA 2W6KA 1QAJA 4NCAA 1X0PA 3PW5A 2OP5A 1LOTB 2YQ1A 1KHVA 1I5OB 2XCPA 1EKEA 4ZHRA 2O4GA 1C0TB 1AZSB 4FWOA 4M5LA 1LWCB 2L9DA 2Q79A 2JEGA 1F2HA 4LSZB 2HLUA 1EQMA 2B9EA 1SB6A 1S12A 2M3DA 3C6TA 3AHPA 2DHSA 3UQSA 3JB9k 2VQFK 4W5NA 2RPIA 1QLNA 3FBEA 5F9LA 3CB4A 3AO2A 5RUBA 1LOUA 1LAVA 4C1NK 4OKEA 2EFPA 3MGJA 1H72C 3NBPA 3AGKA 3P4UB 1WAJA 1M1HA 1Q9XA 4X4SA 5GAGU 1B9DA 1D9DA 2V34A 3DYAB 4DL7A 2GO8A 3CCRS 3OXLA 3QIPA 2P9KB 5HRSA 1NRKA 4CJVA 3DI6A 1VSHA 3MECA 1G1XA 5A0YB 3SIPB 5A2QO 4Y2CA 5KG7A 2E5HA 3EGWB 3OTCA 1M1KT 3D7SB 3NCIA 3D0IE 3KLEA 3GV5B 2PIIA 3NEKA 1S59A 1KKHA 5KGXA 3D1QA 1UFWA 1X3MA 2HHSA 4M95A 4P6QA 5F8GA 4GMJB 1K8KB 3PEHA 5JLHA 4C3MA 3W63A 4IJAA 1YHQS 2GMLA 4CZMA 2HGLA 4DSJA 2XO7A 2GUIA 2R7TA 1Q95G 5IM0A 1QJHA 4K7QA 3VZIA 2GVZA 4DR1J 3QICA 1ZOTA 4DTOA 2CPZA 4HUGA 1IBLF 1FRHA 3VESA 3OR1B 1XI1A 4H0VB 3KK1A 4ECXA 2Y9HA 1TV6B 1KVCA 3E3XA 2A6OA 4A5AA 5DDRC 3VF2A 5IV4A 2AGQA 3M8QB 1FRJA 4U67L 4FLXA 5ETNA 1FKAF 1YBUA 2NRWA 5AR0A 1DQ9A 3D28A 3ZTPA 4G3IA 2GWKA 2IJRA 3M9OB 2OH2A 2RDJA 2ZC4A 3F5TA 2W8LA 1W97L 2MEWA 1AT1B 2M70A 1YSJA 4CYUA 2HNDA 3HSJA 3OVAA 3KJVA 5H9EJ 1XR5A 4M63C 3U6FA 1QE1B 2XSJA 4QOTA 4KGMA 1O1WA 2YQ3A 3CCQS 1NO8A 2GVZB 4M8LA 3G71N 3TARA 4A8XA 3MAAB 3SV4A 4P74A 2BVZA 3HL8A 1M90T 2E5LK 3RJMB 3W2WA 1VHIA 3K5OA 4R8UB 5BXIA 2D7SA 4M63A 1WG1A 1RBRA 3GP9A 5KFGA 2CQHA 4CLKA 1B92A 3IAS9 3OPKA 4CJ7A 3SQ4A 1JCGA 3VQ6A 2AU0A 4HHHA 2CNOB 3AODA 2DVIA 3EUNA 3SXLA 5DQGA 3CJ2A 4JI3K 4MH8A 3HF5A 5D4OA 4C4WA 4DR4F 1HPMA 3O9QA 3EVWA 5HATA 3HHDA 1NK0A 3H42A 1S1UA 4KFBB 2IA0A 5KT5A 2P9LA 3TZXA 1OS5A 1SC3B 5L1JA 4X4PA 2B4JA 2DBBA 4CJ5A 3QEWA 3V1OA 3N79A 3U3YA 2F8HA 4XDCA 4ICLA 5CYJA 3PEJA 5F3ZA 3DYAA 3ET6A 2ETJA 1BUXA 2D3ZA 3B6PA 2F9JA 1VSMA 3NF7A 3DLJA 1FRMA 4HUEA 5BRHA 4JI8J 2VONA 4DUYJ 1SIWB 3PX4A 3IDHA 4MMOA 2RU9A 5HQLA 1HI1A 1HPZB 1IG8A 4J8FA 2GTDA 2H54B 3CMES 4CZCA 5I42B 1FRKA 1KWMA 2Z8QA 2BJ8A 4PPZA 3M6UA 3CCES 3GFHA 1BL3A 5SZTA 3CYMA 1P9YA 2HMIB 1V4TA 1VBYA 3D4JA 1TKTB 3R5DA 3VQSA 4O0JA 4WP8A 2OPRA 2DRDA 2F3JA 4Q0BA 2RB7A 2RUGA 1LWFB 4Y28C 4I9LA 1JQGA 1KFSA 1C1CA 3ZTOA 5B0EA 3PW4A 3KNAA 4CLLA 4FK2A 4OKJA 2Y1LB 4OJHA 3NLCA 5D4LA 1WSJA 4J2BA 3X1LB 4TY8B 2ZBIA 4DV6J 2IM1A 2K06A 2XNQA 3ELHA 3R5BA 3TJAA 5L38A 1YX2A 2M9KA 2ROPA 5GVQA 4A59A 2N3LA 1S1TA 3GWCA 1F1BB 4LRAA 4Q44A 4OJRA 1FJCA 3VGUA 2J5AA 5KG3A 1P90A 4QPTA 1LEOA 4HH1A 3VAIA 4LUBA 4DU4A 1YWXA 5AFUH 2VA2A 3CJKB 2CYYA 1SKSA 4H0PA 2BDPA 5IV3A 3HT3A 2J9EA 1CJKA 3HKZD 4PWUA 4CDIA 1ZM2A 3K2PA 4BGBA 1WKKA 1RADB 2XMVA 3M2RA 3DRPB 3T1YJ 3V9ZA 3OYCA 4XO0A 1EP4B 1HQ2A 2Q0UA 4C9DA 4RWWA 4EWTA 4J9OA 3NH0A 2F65A 3AVBA 3EZOA 2DH9A 1Z2LA 2DGWA 2YJFA 2PC6A 3TJ8A 3OL9A 1TTHB 3US5A 1JJCB 5KT6A 4EAHD 3V1RA 1BQMA 2XULA 1Z25A 2G0CA 1S49A 2CFXA 1EKSA 2DH8A 1S6QA 1QZ6A 2X1BA 2AJQA 4DUYK 5D0RA 2E5GA 2X74A 5U47A 1SH3A 4F9OA 4DBQA 2MQPA 4CZIA 4IEEA 5FIIA 2D0PA 3VA0A 1XMOJ 1RXOB 1QM9A 3B78A 2XQCA 3X3UA 2OELA 4PKHA 4JI1K 4F67A 4ETXA 3CJ9A 3WNFA 4CK2A 2WBMA 1VK0A 1XK8A 3L3CA 5CD4A 1WSIA 2E1PA 5B0AA 3THWB 2ZGZA 3SSSA 5DLGA 1S1WA 3BSCA 2H9ZA 2IYIA 4CLTA 2NPIA 4B02A 1VBKA 2O8CA 3T1HF 3D6MB 1KR4A 4OZ3A 4DUTA 3NS7B 1N36J 2MSTA 2A6AA 2ZVIA 4JI0K 3TAPA 5LJ5Y 1F3FA 5HOOA 5FPEA 4DR5F 3CNQP 3OJSA 3VAKA 1R31A 3KLFB 3QZ7A 5JICA 2NS1B 2QG9B 5DMRA 4HVZA 2KM8B 3LGHA 4FPIA 2NYIA 2XM3A 4LF1A 2A42A 4CTAA 1D9AA 4M3ZA 1DTTB 3OYFA 3HVTA 3JSMA 4M5DA 4DTUA 4NLXA 3THTA 4I2QB 5J2QA 3K5MA 1J5OB 3UDCA 2JZ5A 3FRZA 3GL1A 1U49A 4CFAA 4IO9L 3UD5A 3QINA 4OYIA 3CUNA 3T1HK 3VTHA 5DRKA 1KBRA 4HI1A 1HI0P 4WXOA 1KTQA 3IM8A 4OL8A 1IWAA 3IS9A 2P9SB 3LP3A 5M1KA 3THYB 2BJ9A 2CPDA 3K58A 2VA3A 1QDUB 2LSNA 5HP1A 3AY0A 3GB0A 3QEVA 3D67A 4ZPTR 2IVMA 4B1ZA 4PQAA 2DXEA 4EYHB 3KG1A 2KXNB 1B3TA 1P27B 2GZOA 1DJ0A 1HLUA 1VIXA 3SCLE 2ZH6A 1RTHA 3UKUA 1HKGA 3VZHA 2HS4A 5FRMA 4JI6J 4LFCF 1OY8A 4P7VA 4FS1A 1HYSB 1JLCA 2E29A 2GO9A 3AVKA 2QK9A 1VHXA 4JI7K 4CM2A 2I2YA 4CFDA 3HPGA 3GG1A 1IV0A 4J9PA 4U96A 5IC4B 4A2BA 3WQPA 4CJSA 4JV5J 4U67Q 1VQKN 3RMAA 1MMNA 3CMAN 1FKOA 3L2VA 3PW7A 1UEVA 2O8EB 2M5YA 1IBKJ 3RSEA 3C65A 4OGEA 3W9JA 3QMLA 1LK7A 3SBMA 2IBOA 4LFBF 3D9BA 1WSHA 4W4MA 3QATA 1YTYA 5AZJA 3L09A 2QWRA 2Q36A 4NXNK 2V8VA 4LF7K 2GV9A 4OFZA 5IFMA 1IKXB 2WONB 5LM7E 3D6TB 1VQ8N 1YJ9S 2CQBA 1RILA 3WX4A 4FJLA 3CCVS 2BYCA 4FZVA 1X9WA 3ZNUA 1TYQA 4X64K 4CJWA 1YVNA 3AXMA 1SC4B 4K4WA 2XRIA 4MYUA 2Q6BA 3ENAA 1EARA 4Q8EA 4BE1A 4FJXA 3GV7B 3H7HB 5BN8A 2J9CA 4HACA 1SV5B 3OFFA 2H5IB 3ADAC 3QT6A 3HZGA 2VYPA 1R0AB 1BUPA 3CCSN 2DK2A 4KREA 1YBTA 3TA0A 3OA9A 2XMMA 4ZKAA 3EGVA 5GMEA 5FJ4A 1O51A 5DDOC 4KT0C 5AQLA 1RHQB 5CABA 4DSKA 9ATCB 2E1MC 3D1HA 4DMZA 1DTTA 1U26A 4NXMF 3LANA 2C2RA 1FJGF 4P9SA 2J8SA 1CEZA 4NMLA 2FLPA 4PL7A 4F0KA 1HBNA 3V6JA 2FJVA 3NNHA 3MR6A 4Q43A 3DI6B 1JKHB 4F0HA 3GSDA 2E2QA 5A6WA 5B7WA 1WSEA 3R9PA 2H65B 1HBMA 2IFXA 3RRHA 1QQMA 2DO4A 4C11A 3C6UA 2C3PA 1XNQJ 3TRGA 4UOHA 1VAZA 1RHRB 5E3PA 1UKUA 3M2VA 3S6EA 3U1NA 3BSOA 2CH6A 3BR8A 1RTDB 1DT9A 3R8EA 3MM6B 2MSSA 1VISA 1RBTA 3FDSA 1U1LA 3OYDA 4CTAB 3E8OA 4TLQA 4CF8A 4H5NA 2MKCA 1K9MO 4ZP8A 1VRTB 3NCQA 3FMWA 3N28A 1NJYA 1HNZF 4ZLJA 1VQ7N 4OGCA 4BREA 4FXDA 2AV5A 4H4KA 4A62A 1VIOA 3ID8A 5KPTA 4PKDB 5A8RB 4X65K 2KTQA 2AGPA 2FF6A 3W1YC 1VDHA 3VF4A 4YDDB 2KYXA 1HKCA 3VQ4A 1YJRA 1BY9A 2VGMA 1VQ5N 4R8UA 4F3QA 4JI4J 4BDYA 5JUMA 3KK3B 4CZEA 3OTBA 4CI0B 4OPKA 2A5XA 1X60A 4K4XA 4K2JA 2RAQA 1CQMA 4OMFG 3CPEA 4ILRA 2HKEA 1YLXA 1QE1A 2YKOA 1S1WB 4CEBA 2DNMA 3NY0A 1ROFA 4A48A 3WC2A 1LW2B 4DQIA 4YUDA 3JSRA 2P9CA 3TQEA 4E3SA 3SK3A 3OYIA 4IDKA 3THVA 2HIQA 2NLXA 2V0NA 4M45A 1KQFB 2FY8A 4MK9A 4GNIA 3NH2A 1EETA 4QQBA 4UQTA 1SV5A 3TEGA 1KS2A 4NZ6A 1ELOA 4LJMA 2DNZA 1JLQA 3DMJB 4BRCA 3LAKA 2ZM6J 3K0SA 3M8PA 5CH7B 4DV0F 2D9PA 4J2DA 3EM1A 5KTQA 2EFNA 2P9NB 2B6AA 1KAXA 2D74B 1HIYA 2D4WA 3CHWA 3CDEA 2LP4A 3EZUA 1Q82O 2WC9A 4CO4A 5J1NA 4DV3J 2XLKA 4DJBA 3PIOL 4IG3A 3OW2R 4DR2K 4Z2XA 1S0MA 2VV5A 3JYTB 3RSEB 3A5LC 2ZNYA 4JKBA 4M5GA 1IVZA 3J7YU 4ZPAA 4ES3A 5DG9A 2WBNA 1D09B 4X4RA 4DTPA 3T41A 2V2QA 2QEXN 4MIAA 3KJQB 5ETLA 1REVB 3TO8A 5B0FA 2LXFA 2PMWA 3PVXA 2PGCA 3GR0A 4ZCLA 3OYNA 1V4SA 4ATNA 4DN9A 3O1LA 1Y7PA 2VC0A 4FYYB 1QUPA 3ZCMA 2KT3A 3J7YI 1RBSA 3ONQA 2XB2D 2DGTA 1DBDA 2NPFA 3HHLA 1DARA 1ZTTA 3GDQA 4YP3A 3BEGB 4JI0F 4KGZB 1A7GE 3CIMA 1NGGA 3QIPB 3K5NA 1FTCA 3M05A 3DHWC 4BR9A 2A1BA 4DR5K 3O4WA 2K3IA 3AD7C 4ZJOA 2DISA 3M2VB 5BYRA 3MM7A 3J8AA 3VMFB 4BR5A 4AHRA 1RK8A 4BVPA 1RCOB 4B9QA 4AHUA 4J9UE 3VEOA 3A8EA 3G71S 3ZYYX 2EKYA 3CQ8A 4G6VB 2LMIA 1NU4A 1UOCA 4PKIA 3V5RA 1G15A 2OPRB 4Z4CA 5DS7A 3WHIA 3BKFA 1WSRA 2QYGA 3PNIA 4E7KA 2UVRA 2IM0A 4B8AB 2ZEJA 3FRYA 3OVSA 4F4AA 3FEZA 3UVJB 2C28A 1RDDA 4FF4A 5I42A 3HVAA 1EZZB 4JV1A 1OPZA 3PHEA 4WFZA 1C1BB 2JFKA 1VC6A 3BUZB 4JNEA 4X62K 3ZX2A 2QRRA 4U6PA 2QI2A 3CCVN 3J7AP 3L7PA 2NUUG 2RDIA 5KT2A 1EX8A 4FYXB 2EK1A 4DR7F 3ETOA 1SQGA 1YJWN 4KE5A 3MMCB 2QLFB 1PG5B 2IIRA 2ZM6F 1GXLA 4H4MA 3C94A 3VCDA 3Q2SC 5F8HA 1X9MA 4ID8A 1L5UA 4LFAK 2G8KA 4JYAJ 3VF6A 5E3QA 2YHBA 5CCLA 4AHSA 4PPDA 1RZMA 1B0VA 1KVIA 3VQAA 1R0AA 1XJWB 1N33K 4H54A 1RNHA 5HI7A 2J8AA 1JMTA 3WT0A 1X4GA 1X4HA 2D69A 3ILOA 3R8YA 3CD6N 4GV3A 1Q9YA 4JI7F 1J9AA 1UA0A 1SH2A 3MMJA 2O3DA 4RW7B 4FWLA 2XZWA 1Q86O 3LF0A 1BCOA 2IRYA 2P5GA 3P6YC 3WQUA 1Q7YO 4B8CA 1CJVA 1MMDA 2F63A 2U2FA 1HYVA 3G6XA 1DFDA 1IJEB 1VSFA 1NWKA 1B70B 2I1RA 4U9RA 1O0PA 3S01A 4B9TA 3ZSQA 4LQ3A 3L4BC 4G1QA 4RWTA 4LF9F 5LSOA 2R9LA 3ID6A 2O8DB 2HQIA 2B56A 5CYMB 4PG7A 4FWNA 3P31A 1GFWB 1Z05A 4BC5A 3CDBA 2L08A 3R5CA 3R6GB 1SKUB 1IN0A 3AVLA 1WBDA 3RU0A 4ZVFA 4WWSA 2EFOA 3TSQA 3AA2A 4OZ5A 3R3TA 4KH5A 2GAHC 4OZNA 3LZIA 4CF1A 2W2OP 3LP1B 4TYAA 4FJNA 1WD6A 1K73O 5C24A 3RR7A 5M1FA 2UUAK 1BQNB 2A2CA 4UF4A 1RTHB 5DG8A 1KLMB 2L3MA 4UW2A 4ZCIA 1FX4A 2V4JA 2R42A 4CHNA 3QEXA 1WLJA 5A2QY 1RWPB 4Y1CA 1RAGB 2FJBB 1MLAA 4KTQA 3LM2A 1CJKB 1OH8A 1WF2A 1EHWA 2XGQA 3N6MA 1YRXA 3M8PB 4OYMA 4Q45A 4EHUA 4LF6F 4F3OA 4LSLA 5SWMA 3K57A 3BV8A 3RR8A 4JD2A 3CGIA 1TL7B 4O3RA 2PA8D 4ED7A 4WTOB 3M8RA 4ELVA 3L3VA 4NRTA 1RT1A 2YNGB 4E98A 1YITS 1BHLA 4C0HA 2Z1HA 2Z0GA 2P9UB 1RT2A 4NASA 2V9WA 1JNZB 1WG5A 4ZLLA 2O5DA 3F0NA 1ZBHA 1V3RA 3VVTA 1JL1A 2CJ9A 2VBWA 4E0DA 3ZETA 4DV2J 4JOUA 4IQXA 1H38A 4FLTA 3S3OA 3V6DA 4H5WA 3RBZA 3NBPB 2DEIA 3W62A 4L3QA 2HZAA 2QZ8A 2YQ0A 3CCJN 1JLFA 2DNKA 4HTUA 2R7VA 3P39A 2JRSA 3RYLA 1BI4A 1S72N 3W64A 2EC2A 3QESA 4ELUA 3PM9A 4TQRA 4I6MA 3MCOA 1VFJA 1U8SA 3MR2A 1IBMF 4KC5A 1ZBFA 1N56A 2AF6A 4NCBA 1DLOB 4OYAA 3K9KA 5KFMA 4X64J 5AXNA 1TFYA 4BRLA 2I38A 2W4CA 4JI8F 4FWQA 3BQ0A 2B43A 3RW7A 1FJGK 2CPHA 1UW9A 2FC8A 3THWA 1TKDA 4CEZA 4YFUA 3MWPA 4HCBA 4BRGA 3HPHA 3W60A 4FS2A 2FF3B 4QU7A 1VK8A 2VFSA 1VQOS 4DV3K 4FJMA 1HI8A 2BKPA 3FQLA 3TEHB 4I9QA 2BTFA 3ZXWA 4E2FB 2HB5A 4OLAA 3MEGB 2CPFA 2FD2A 2E1CA 1VBXA 1VRUB 1LWXA 4F04B 3SFUA 4OHWA 2F7TA 4TYBA 1SZ2A 4QWDA 3WBZA 1NHVA 3ZX0A 3Q89A 3AVAA 3IG1A 4EU0A 3CD5A 2JJ4D 4N56A 4Y0WA 4MKAA 1S79A 1S10A 1R7IA 2UU9K 3HSTB 1W25A 3J7AN 2WTFA 2YNIA 4M5IA 3A1YG 3BZCA 2RHKA 4BRNA 5AFUA 5T14A 1HWIA 3FSXA 2A3JA 3HP9A 4LF6J 2CPJA 4KAZA 2ITMA 1RBVA 5EX0A 1F60B 3H5XA 3SJJA 2W7AA 3DDNA 1Q4RA 1Q82T 4NOHA 3D0PA 1NK7A 3BY5A 3F9KA 3FCWA 3VEWA 3TTFA 4USMA 3IXQA 4DUYF 4P10A 2F9TA 5BR8F 4DSFA 1JXEA 1NB7A 3Q23A 4ZIVA 3JSYA 3TA1A 2ALYB 3L2RA 2UUCK 5IT9Y 4TLRA 3SLCA 4DU8A 2VH7A 4C8MA 3CCEN 1YGYA 1WBBA 3WNGA 1S77D 4B08A 4DCPB 2V2ZA 3VQ9A 1VQON 1HBUA 3KK1B 3CCUS 2P6TA 5HVGA 4KYZA 4RBUA 3TZYA 4LRBA 2RRAA 3A8JA 3BEXA 3BGFA 3OS1A 5GMDA 1VQ4N 1J6ZA 4P72A 3OL7A 5IWAK 2OANA 1UJ6A 3BO4A 2XMJA 1F5CA 1PGZA 4CF9A 1TUWA 2YV0X 1A5XA 4ZVRB 1FE0A 4WK3A 4I6WA 3VPZA 1C1AA 4IOCL 3TAMA 3SI8A 1UA1A 3PYEA 1ZZFA 3T3FA 3A0IX 2O8BA 4F26A 2LYVA 4OZ2A 3KFWX 2OPQA 2HVZA 3CCRN 1VQ6N 1R43A 2EI5A 4UUXA 1FVSA 1ESVA 1YT3A 4CEQA 1T8EA 3IR5B 3BPSP 3QLHB 5CY4A 2EWHA 2MQ8A 1HR0F 4MLEA 2KU7A 1YKWA 2D41A 1KCFA 1RWWB 4M3UA 3IC1A 3CJ3A 4ZK7M 6AT1B 4AHTA 1H74A 5FRNA 2GV1A 4AD6A 4JI1J 5FROA 3ET6B 5KFVA 3D5MA 4LVOP 1ULRA 1YZ7A 2GIRA 4DV2F 4L6V3 1HBMB 3H3NO 1I39A 3LWLA 2QC3A 2MPUA 1IKYB 1HNVA 3AO1A 3Q22A 1WACA 4BBYA 2VODA 3Q7CA 1YDLA 4HT7A 2AMCB 5MLCV 4DQPA 3AAQA 4JHDA 2FGCA 2Q1LA 2G1HA 3MMBB 3E66A 3N5BA 2W2PP 2QL9B 2ACYA 2IM3A 5EN1A 5J2NA 5GAEU 2AEJA 4EMDA 4NXMJ 1BDGA 2G13A 2VOOA 1J5EK 4DR6K 1AFJA 1UETA 1Y5LB 2K2PA 1JLAB 2CQ2A 4BRHA 5B0BA 3TR8A 2RT3A 3BN7A 3K17A 1SL2A 2NLWA 4AQYF 3IWNC 3EE9A 3SUOA 2FXUA 5L1KA 4ID1A 3MM9B 3KJVB 4Y00A 4DL3A 3A5NC 4YY3J 1OSDA 4UQGA 2O8CB 5BPNA 3CTRA 2BW2A 2XHWA 5DLFA 2XMWA 5HMYA 1TKZB 1L3TA 3DKDA 5LXRA 3C95A 1IR1A 2M8DB 2HBMA 2ZFHA 1S97A 1G2EA 3E51A 3FZLA 4LFBK 1TUVA 2GJFA 2HFNA 2NZCA 1VQ9S 2OTJS 2BANB 4YHHF 4DPOA 4NXNF 1N6QB 1F6TA 2HQGA 2MKHA 4O3PA 4X4TA 5EY4A 3SCJE 3LPTA 4CLZA 1BWVA 4JI4K 2IRUA 1N5TA 3OUYA 2KQ2A 2K1RB 4AXIA 3CXCM 2OPSB 4NA3A 2H5JB 2ILZA 2FZGB 1V5VA 3PV8A 4MLHA 4NLOA 3WZ0A 2JX2A 4QYZJ 4G1IA 1TKXA 4L72B 2OFGX 4AHCA 1PYTA 2R4FA 3U9ZA 4B3TF 1FRIA 1KC8T 1WKJA 2E7XA 3R7SB 4DR4K 4Y2IA 1LW0B 5E41A 5H1SQ 1NDLA 2C3UA 2ZJPL 2J76E 2J6SA 4KIAA 4UOFA 3HX9A 3IG1B 2GNKA 3QRQA 3OVNA 4CCHA 1YTAA 3HLUA 5AZIA 1R8HA 4KAIA 3QJPA 1G4CA 3AO3A 1IKVB 2R8JA 3GONA 4AL6A 4DL0C 1NG9A 2WSFC 1WWHA 1KD1T 2H5EA 2VFTA 3QAEA 4WZMA 3C19A 4Z4IA 4MKYA 4ZS6A 4DFMA 3VAHA 4M1KA 2C2OB 2E9TA 3VQBA 3H40A 2OJ3A 5LMNF 4DV3F 4QJVA 1N36K 5CYQB 4A5BA 2P9KA 3QYYA 9RUBA 3HDSA 2OAUA 5G4DA 3PR4A 5KT7A 4ECYA 3ICLA 5C0YA 4B17A 3FVYA 3SMSA 3K8WA 2W9AA 3I5BA 3MCPA 2HNZB 5F9NA 2AQ4A 5AQRA 4RPFA 3KWMA 1BC6A 3ZSYA 2A1SA 2R7XA 3ZZZA 2PSZA 2VWKA 2VUGA 3M8ZA 4I0WA 3CPWM 1ASVA 1UVIA 2I7PA 3BF4A 2Q0RA 4C48A 3CC2S 3M1VA 4KPCA 2ZH9A 2GBZA 3NGIA 2LXIA 2DNLA 3K8VA 5C15A 1NMNA 2D0OA 3TZZA 2MZQA 4N77A 4DPWA 5EOYA 2KHCA 5FPDA 2QL5B 3ZZ0A 2HBQB 2W8KA 5KI6A 1U24A 3MEEB 1H3DA 4FOIA 3NF6A 3MD3A 4ANCA 3L6QA 3VV2B 4B3MK 1IBLJ 3RG6A 3VEXA 2LECA 2IPOB 3OQ2A 2BMBA 1IBMK 1N88A 1T9XA 3DU6A 2KRBA 3HZEA 5BR8J 1HBOB 1CJTA 1NB2A 3MFIA 2DCLA 4I6YA 1NK8A 1RDUA 2MY8A 2XY7A 5AQSA 2WOMB 1FDBA 3ULEA 2VKRA 2YWGA 3W66A 3SBGA 2RD5C 4QW8A 1V5IB 3SSRA 4UOGA 4Y2AA 3KOAA 3LDOA 4CEDA 4FZYA 3PJXA 4PXDA 2AEMA 2F96A 3SJHA 2P9PA 4RCHA 3VEZA 3FSYA 1ZXOA 2QLJB 1WDTA 5T41A 3O3FA 3DGPB 3EICA 3AVMA 3O9TA 2UV8G 1YJNN 4B9MA 4IFVB 1KLMA 4YNQA 3IA0A 1KVJA 5EXWA 1UCNA 2JLFA 4F02A 1Y5NB 3T1HJ 4NZ0A 2WFBA 3GYXB 2FVPA 1Z2ZA 1RT5A 4A2AA 3QPIA 3CIZA 1ZC6A 3CW2C 1HD0A 1Y00A 2O4IA 3SQ1A 2LA6A 2XCAA 3BJYA 4YHHJ 1UJ4A 4LIRA 2MQQA 1XUPO 2KZMA 4TU9A 1MDUB 2GWJA 3NNCA 3WX8A 3RRGA 4G1QB 2DY1A 3WDOA 2BRLA 2Y1IA 3LGNA 2ASJA 4TXSA 3AGRA 1QQOA 2PD1A 5DGAA 3DXKB 2DFEA 5IWAF 1NDPA 2HAIA 4BR2A 2GGPA 1JK9B 1YIJN 4QU6A 1CJUB 1S7HA 4CJUA 1BCMA 3FLCO 1TV6A 2HURA 2CJYB 2QMUB 2L48A 3PYGA 4DHVA 3VQ7A 3DJCA 5EHHA 4DU7A 2YH1A 4NA2A 1AFIA 3AFGA 3EZ5A 3CCUN 4NLVA 5DM6L 1I3AA 3FBFA 1FXRA 3CJ4A 2QFJA 4KKOA 3HI9A 3NGYA 5KFIA 2R7QA 3H20A 4PY5A 5C10A 2D1KA 1SL1A 2HRUA 3MPYA 4LVNP 3S3NA 4J9VA 2R8KA 4BROA 4P2MA 1IQTA 3T6BA 4M5KA 2N3OA 4IG3B 3W5XA 2G0IA 2HMIA 1S22A 3M6WA 3D6HB 3PFOA 4E7LA 3L2QA 4ZOSA 2V6AA 3GYNA 4LF9J 1L3VA 3WXKA 2EFVA 5K14B 2Z2YB 4E1NA 3QT8A 5CAAA 4JK7A 4C1NI 4FJ8A 4BACA 4DR3K 2MQLA 4NEZA 1FXDA 4OJ3A 2HVHA 3HHLD 2OMOA 4IOCQ 1SUQB 5AQYA 3CSKA 3VQDA 4DR7K 3LTOA 2EK6A 1HJRA 3FFKB 3ZEUB 3ULEB 4PWDB 3BH7B 2M7SA 3GIMA 4LIWA 3OFGA 2J0XA 2QKBA 5SUHA 1WHYA 3TVZA 2ZJQL 1TUGB 2BANA 4KGVB 5F8MA 4DR6F 2J4RA 5CQGA 1D3WA 3ZSWA 3T1AA 2UP1A 4IDKB 4LRFA 3RGIA 1YJ7A 2WVFA 3AJ2A 3N4WA 5DZ7A 1QZ5A 2DGSA 3O3GA 1N33F 4KI4A 4OJGA 3W2VA 1WTBA 1KN6A 1OQ3A 2F40A 2HK3A 3OR2A 2HHTA 2I8EA 2X1GA 3PX6A 1GXTA 4ER8A 1UVLA 1Z1ZA 4K8ZA 4OX9J 3TR5A 4BC4A 3B6BA 3DLBA 2CQIA 4F8RA 5FD1A 1VRUA 2VG5A 3BKUA 1KLNA 2B5JA 4ZCMA 3UE5A 2X1FA 1XNRF 2YBVA 1Q16B 3MX5A 3MM8A 3QFPA 3QNOA 3LGMA 3HMJG 2P51A 3DGVA 4QW9A 4AE5A 2R8HA 4JI6F 3AQOA 3R6LB 3QFWA 1FHTA 1RAIB 1GLJO 2Q2RA 1XNRJ 3PKYA 3E1YA 1XR7A 2E20A 2R3VA 1MW7A 4DUZJ 4ZP9A 4KTZA 1F5BA 4O5BA 5BRDA 4MO4A 4RW4B 1MWMA 4WU2A 1FWLA 1IBMJ 1RBUA 1FVQA 3VAMA 2E2PA 3ZSZA 3MXIA 2WHOA 3GFXA 5K5MA 3O5BA 5GMKa 1N36F 3PIPQ 1BHNA 2FSKA 3I8DA 4FPAA 3ITHB 2VC1A 3W65A 2DEJA 4CH7A 3H2UB 4KV8B 1NZ8A 1ITGA 3O1WA 2E1AA 5AQJA 4HHJA 3VETA 4P2FA 3P4IA 2RQ4A 4B9NA 4CO5A 3OHRA 3NL0A 4J5OA 2OFHX 1JX4A 1Q5VA 4DTXA 1NPKA 3QB0A 1RKIA 1PIEA 3TA2A 5BR9A 1HFEL 3MDQA 2MKYA 3EO3A 1VSEA 1S5ZA 3MMVA 3CCLS 2VPZB 2QT7A 4WYBA 1HWKA 3KDOA 1YJTA 3ZZPA 1VI7A 1ZZNA 1LW2A 1LWEB 3BYPA 3O5TB 5EGYA 2OD4A 3QAUA 4U7BA 3K5LA 2JWKA 3H08A 1LV5A 4JI0J 2VOPA 2LFVA 3MEDB 5CCMA 3ZO7A 4WPAA 4PXEA 4FJGA 4HCCA 2BQUA 4DV7F 3FNNA 5HO4A 2U1AA 3DLHA 3MZIA 1TKTA 3EXYA 3C7NA 3KKRA 2VQEF 4JKFA 1T9UA 2IBKA 4BG8A 4PG8A 3DU5A 4FWMA 4KHWA 1B7YB 3V4MA 5HVHA 1HPZA 2V50A 1NKBA 2ZITA 2D3O1 1JJ2M 4P75A 3B4MA 2DR9A 2VFVA 4XTTA 3VAGA 2JFDA 2VD3A 2W25A 3AO5A 1HRHA 4LF7F 1Q86T 1AB8A 4YOVA 4BCAA 2VB6A 1RBAA 2GMHA 4CHQA 2IDOA 4I7FA 1BXNA 2YHWA 1RT6B 5F8LA 3SDEB 4QS8A 2K3KA 4OX8A 3HSGA 3TP2A 4KHNA 1PKUA 1FFSB 2BACA 2QA4S 2IYGA 1VRQC 4KO0B 4X2BA 4ZTFA 3FZFA 1C0UB 3DM2B 1U1OA 4NLGA 7AT1B 4JEPA 1IG9A 2R2RA 4HKQA 4DMNA 3GE9A 5C5JA 2HHQA 2B5JB 4DTJA 4ANDA 4XH5A 2HIYA 4NLSA 2LEPA 1CZBA 2C2ZB 1B64A 2YHAA 1T9YA 4WIQA 1RJJA 4RWXA 4CGHA 3PW2A 1VGYA 1E6YA 3HD1A 3EYZA 2A0FB 2VBYA 3B82A 3H5YA 2DD8S 2LDIA 2AJ4A 3DXSX 1FNOA 4FJIA 2CA9A 3MURP 5AXLA 2OCEA 4W5RA 1UTAA 1RLDA 1V3SA 4F25A 4YOXA 4LFBJ 4FLZA 3K2YA 3N6NA 4IH5A 4DV1F 5E2QA 4EO8A 1YJNS 1TUUA 4WFNL 2MJUA 3VQCA 4YB5A 3B54A 1APSA 4FYVB 1U1RA 1C0MA 5KFYA 5KPRA 2DNNA 1CS4A 3RBEA 1VSKA 2WB1D 5LY3A 3UB5A 3E01B 3NXZA 2NNWA 1UVJA 4AHVA 5AQOA 2BR0A 1Q8KA 4DV5K 4CD3A 3ZTQA 1SKRA 3MCSA 3G8TA 4DQ8A 3JQJA 4ZVHA 3ZT3A 5KFPA 4NMXA 2BEFA 4TSXA 1RU1A 1RDAA 1ACMB 1BI4B 3D2FB 3VGTA 4UT4A 1NDCA 3R1XA 1TMMA 5J1PA 4LBHA 2DB1A 4JI2K 2ZH2A 2HHVA 1F9FA 3P45B 4CH1A 2VDIA 4JRQA 4X66J 3H2VE 4DKWA 1LCUA 1VK3A 3OYGA 3NS5A 4NZ7A 5D15A 5D77A 3OFHA 1N0VC 2VJUA 2FHKA 5C2CA 3SBTA 5DK5A 5JVHL 4OX7A 1GLLO 3MAQA 3I32A 4OI6A 3IO1A 4X4UA 3J81Y 2F1FA 2IAJA 4ID5A 4QIWD 2JL9A 2CKWA 3L0QA 4EFAC 2DNQA 3HXMA 3HHKA 2PYLA 2JVRA 1RTJA 7FD1A 1IKVA 4KRWA 4DCJB 4DR1F 1FJ7A 1S6OA 4OYXA 1NSQA 3DXKA 4RNOA 3EE8A 5HBMA 4KSEB 4ZP6A 3LO3A 1KTVA 2D0AA 3E9PA 4OVLA 2Y0SD 2DIVA 3JAMO 3KKFA 1RWNB 1D9FA 1R59O 3PRVA 2YX6A 1WUUA 2DH7A 5CZVA 2DTJA 4DV4J 3V6HA 2VFRA 1QAXA 1U2VA 3MPUB 5KFFA 1RAEB 4EUVA 2NRRA 2QXFA 4J9QA 3CCQN 5CR4A 2BX6A 5BN9A 1GMVA 1Z4UA 2JDJA 2BV3A 4RW4A 2HVEA 2ZKUA 5C12A 3N01A 3RMDA 5C24B 4ZPVR 2KJWA 1NCLA 1R27B 4DV4F 4V1Ak 4GC6A 2UYTA 1M5PC 4IFYB 3L2WA 3OYKA 3C16A 2Q66A 2QLXA 4PEOA 4DS5A 1TMJA 5CXTA 3JSBA 3PX0A 2UVWA 4IO1A 3SQGA 4Z7CA 5BPMA 3CJ0A 2AJFE 1RKJA 1WC6A 2NUBA 2HAFA 4OZ0A 2RSQA 1P1TA 1HR0K 3NH1A 1TVRA 3CCMS 2ABYA 1P9QC 4FW1A 4K4TA 2HOEA 1RHUB 5CHCB 3Q8RB 2DXDA 4YS2A 2Y1RI 1CG2A 1K0TA 2GW8A 4H0XB 4DR3F 3QBCA 4RNMA 3DXMA 3O3LA 3ZX3A 1ZAWA 4CNYA 2L9NA 1MMLA 5AT1B 2UXCF 3Q8QB 4H4OB 2VG6A 1HWLA 3CMAS 3N6LA 4LF5J 1N5VA 1FW6A 1NSAA 3SQ0A 4DV4K 2VG7A 3B8HA 3UN5A 1JCEA 3UFCX 2NXEA 2FGOA 4C3LA 3E9OA 1DLOA 5EX3A 3F44A 4CEEA 2GHWA 1A9NB 2KVIA 5JMVA 2PYJA 3QBXA 2YKNB 4M3YA 1LNQA 4LF2A 4C8KA 2O8FA 2WCXA 4JV5K 2ZH5A 3ZEUA 4QR1A 4YY3F 1WB9A 2XGPA 1J5EF 4A8YA 3EX7B 4WBFA 3D2EA 4O0IA 2APOA 1RGIA 5GIPA 3H5SA 2UU9J 3R5GA 2RRNA 1C1BA 4FZXC 3IWXA 3FEXB 3V9SA 1Y4ZB 4B1UB 2I5JA 1MN7A 2VQEJ 2XYGB 1RCXB 4Z7YA 1N54B 4A57A 4DTRA 3ENBA 3QERA 1XNRK 4KH4A 2FVRA 4U95A 1WSVA 1X4AA 3R2CJ 3FGUA 4WK1A 4JI2J 1M5KC 5F3TA 4EZ6A 4ECTA 2ADBA 5IQQA 5KFRA 1HBNB 5T7LA 2A1RA 2ZBQA 4A8QA 3KD1E 2CQCA 2AWZA 2IMOA 4IO9Q 1YRUA 1TFWA 3O3HA 4C0BA 2NZTA 3O8MA 1BOTO 1S1VA 5AE3A 1D4XA 4Q5VA 1FWPA 3CETA 3THXB 2BKNA 4OX9K 1UJ5A 5IT0A 4RJVA 3ZZTA 3NMRA 1MSWD 2CXEA 2E6MA 1ZH5A 1UPMB 3HHLB 2O8BB 3MDFA 2CZ4A 2GIQA 2JWLA 2RIJA 2V69A 1NBEB 2CGJA 1GXUA 2ASDA 1H7XA 4IOXA 1WC0A 4DX8H 1FEHA 1MROA 1MWYA 4EEYA 1SQFA 4FF2A 3NGZA 1K6YA 1VQPS 5E0OA 1HQUB 4O44B 4O5FA 3BS9A 1HNXJ 3VGKA 4WQ5A 1RYRA 1NGAA 4DR5J 1KSPA 4WFAQ 2GGPB 1CQNA 5M1QA 4F2SA 2O01C 1HBUB 2I0XA 5AQTA 3M8QA 2VJVA 4KHPF 5IXUA 1CPZA 1RHJB 5JXSA 2AJ0A 3LDNA 4ELTA 4NPOA 1OYDA 4A4JA 1G6BA 1N5SA 5HL7Q 3A5OC 1FCAA 2IRXA 5A8KB 1TK0A 1HR0J 2AT1B 1JCFA 4CH0S 3JTNA 3OTOJ 1YVFA 2GHVC 1UWBB 2C3YA 2VASA 3ENQA 2XMUA 2G9OA 3RBXA 3FC9A 3HCXA