3LP0A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
558
structure length
555
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 152
structure length 555
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp0A05
4PY5A 5E41A 2IM0A 1VSEA 4LH5A 4OGEA 5FRMA 4Q0BA 1RCHA 2BGGA 3TI0A 2XO7A 3HPOA 2AX0A 4ZP9A 1J53A 5K14B 4IKFA 2F8EX 2JGUA 3ZSOA 5L1LA 4O3QA 5K14A 3MAQA 4FLYA 4Z4EA 1TL3B 1SKWA 2I5JB 4ELUA 3OHAA 5KFAA 3DM2A 4KTZA 1TL3A 2I5JA 5KFLA 4ID5B 1GOBA 2HNZB 4H4OA 1L3TA 2R7YA 4FJ5A 4URGA 2R2RA 3OSNA 4PA1A 3TAQA 3V6DB 2F96A 4J2DA 3AV9A 3ZSVA 3PV8A 4CJTA 1S9GA 2CJQA 4W5RA 3GYNA 1IKYA 4RW4A 3VQPA 3ZCMA 3IG1B 3QGIA 4F50A 3KLIA 3NGZA 4ZVEA 4IG0B 1UAXA 2WCXA 3IGVA 4EO8A 1HPZA 2XRIA 4BDZA 3AVGA 1JLFA 3SFGA 4DSFA 2W9CB 3QIPA 1B9DA 2RKIB 3KMQA 2ILZA 1N5YA 4URSA 2IBKA 3FFIB 2W9CA 3RR8A 1QE1A 2RKIA 3HKWA 4B8AB 4DLGA 3LPUA 3DOKB 3OLBA 3QYYA 4YFUA 5HRNA 3AVHA 3F9KA 2YKMB 2IGIA 3OYJA 3TWHA 3NBPA 3SJJA 1R0AB 4DFPA 3D0PA 4OLBA 4EBCA 4LSNB 4RW9A 2XCAA 1XC9A 4EZ9A 2BANA 3LPTA 3C94A 1FXXA 4CK1A 3M8SA 3V9WA 1WAFA 1N48A 2X6SA 5KG7A 3KTQA 5KG0A 4EBEA 3NKYA 2VG7A 3VQ6A 3I5CA 3HSTB 4WFZA 2FVCA 4J9RA 3L8BA 3CO9A 3FQKA 5FDLB 1RT1B 4WYLA 4JRQA 4O0JA 2WONB 3NH0A 3DI6B 3DRSB 1FK9B 2Y1JA 5FDLA 1K1QA 1HNVB 4E0DA 4W5OA 1TVRB 5HBMB 4K4UA 4NCGA 3VQ5A 3AA2A 4PQUB 1NK0A 3SPZA 1NK8A 2ATLA 2JEIA 4QOZB 1ZTWA 5KFYA 1RT3A 2VA2A 3GV5B 3HPGA 3I0RB 3M9OB 3KJVB 4CIEA 1QHTA 2UVWA 1N4LA 1XR5A 3IAYA 3BJYA 1GX6A 2Y1IA 4YP3A 2P1JA 4FJHA 1IKWA 4ECUA 1BGXT 4ED0A 1UWBA 3V9SA 1NKEA 5HROA 3DLGB 1RTDB 1VRUA 5L1IA 3PW4A 3ASMA 4KTWA 2X74A 5FRNA 2HNDB 3DLGA 5EWEA 3AVAA 5J2PB 1TV6A 5KFCA 1MU2B 2HWHA 3DMJB 3V4IA 2HHVA 2ZD1A 4KV8A 2GUIA 3Q8QB 4CGFA 2FVQA 4MK9A 4JV0A 3M9NB 3CM6A 4J9PA 4IR9A 1HQUA 2KZZA 5T14A 2OPRB 2P5GA 4FBUA 3CYMA 2IS3A 3F73A 4KHYA 5KFDA 3BSAA 2ETJA 1RA6A 1NNDA 3G6YA 2C2DA 1VSJA 1BI4B 3MR2A 1A5WA 1KFSA 4ECZA 1LW0B 3MEGA 1GOCA 4E7JA 3QNOA 1N6QB 1BIZA 2FLNA 3K57A 5I3UA 3PZPA 3PJXA 3NFAA 4KKOB 1N6QA 4ZP8A 4BWMA 4K4SA 3GV8B 1HNIA 1HMVB 4WYWA 3VQBA 4KKOA 3MXIA 4B9MA 5DQIA 2RF2A 1D1UA 3DLKB 1D5AA 2OPSB 4KRFA 2BE2A 1WNEA 4F2RA 4CJEA 2XHBA 3QIOA 1I39A 2XI2A 1QSSA 1U09A 1A5VA 1LWEB 3SQ4A 2WRMA 3OS0A 3TQ1A 3V9XA 3DLBA 2X78A 5J2QA 4R0EA 1JKHA 4G1QA 3CJ0A 3DDKA 3MF5A 4J2EA 1C0UB 1Z25A 3MXMA 3OY9A 3ZT1A 3KD1E 1VSMA 2D3ZA 2BQRA 3IN5A 3V9UA 3TAMB 1QTMA 2B43A 1C0MA 3GIJA 3TAMA 3T5LA 1ZTTA 2HHXA 3CG7A 3KHHA 2R2TA 4OPKA 3AVNA 1DTTA 3MFHA 4E19A 4E7LA 3KLHA 4O4GB 2HAIA 5EDWA 1VSLA 2AGQA 4NLXA 5HP1A 2YNHB 2B5JB 1N56A 4CGIA 3AO2A 1BQNB 2HMIA 1WLJA 3L2UA 2KFZA 4E7KA 4B9LA 4NCBA 2YNHA 2HNYB 3H59A 3LZIA 2JEGA 4RNOA 1S1TA 2W9BB 1VRTB 5KFWA 2HNYA 4YR3A 2BRKA 5KFOA 4X2BA 4KO0A 3T3FA 5EU7A 3MEDB 4XIUA 3LP2B 1ASUA 4CGDA 1MMLA 3C95A 4FYDA 4C8MA 3LP2A 3VQQA 3SUQA 1ZBLA 1RTJA 2VWKA 3BGRA 4C8NA 4C8OA 3N6LA 4GMJB 2YKNA 1RT5B 3OYIA 5CYMA 4CIFA 4J2AA 4I2QA 3PW2A 3GIMA 2WHOA 2BQ3A 4FJJA 4KFBB 2O4GA 1S9FA 3QEVA 3KLVA 1YTAA 2FLPA 4KFBA 4Q8FA 4O4RA 3AVKA 1T8EA 4BACA 1TKZA 5F8HA 3M8RA 3K59A 1S6QB 2BR0A 4GC7A 2XCPA 1Q8IA 3V6JA 4FLWA 3L2WA 3ZSXA 3M8PA 2XWYA 3H40A 4DTXA 3K5MA 3PW0A 3NDKA 4FJLA 4F4XA 4DFMA 5F8JA 3OYGA 2HHSA 3OL9A 4M42A 2W42A 1W9HA 5I42B 3PR4A 1QAJA 1ITGA 5J2NA 3DOLA 1REVB 3VA3A 1IKXB 1RAJA 1JLBA 1C1BA 1LW2A 4CK2A 3SPYA 1X9SA 4WZQA 1REVA 4ZPBA 2ASJA 4IDKA 3M9MB 2YNFA 1HYZA 4OKEA 2D0BA 4DTJA 2G8WA 4ECVA 3VQAA 5F8GA 1JXEA 2KTQA 2DFHA 1T05A 4ED1A 2J6TA 1ZBFA 1RBRA 1JLGB 2R8GA 3V1OA 4KHRA 1C6VA 3LP0B 4CK3A 1Q9XA 4KAZA 4IG3A 1RBVA 4FJ9A 1XR6A 5D3GA 3QNNA 4HCCA 4MK8A 1L5UA 4ED8A 3LZJA 4KSEB 2QKBA 4LQ9A 2R2UA 4EP4A 4J9MA 2R8IA 2DTUA 2VG5B 3GIKA 1EETA 4H8KA 1JLEA 3NAHA 1EKEA 2EHGA 5FROA 3AO4A 2V4RA 3QGHA 5C24B 1SV5B 2CKWA 4K4VA 1XI1A 2IMWP 1RDDA 4KB7A 1W0HA 5DQHA 4OKKA 4I2PA 2W7PA 3UR0A 4DTPA 4O3NA 3MTKA 4AHRA 5DG9A 5F9LA 3PW5A 3PX0A 1NJYA 3DRPA 2A1SA 2RDIA 5KFTA 3OYBA 4Q43A 2E4LA 3I0SA 4CJSA 3ZSQA 3CDWA 4CEZA 1TL1B 3WNGA 2ASLA 3SQ0A 4IBNA 4UQGA 2B6AB 1I6JA 3TANA 3K58A 4OL8A 3OYDA 2B6AA 1OS5A 1VSHA 2PYJA 1RT6B 3MR6A 4FXDA 2GC8A 3UQSA 2XGPA 4DF4A 4RZRA 2IAJA 4ECYA 1TAQA 2GV9A 3BR9A 3KK2A 3DYAA 1ZYQA 5DLFA 4CHQA 5KFFA 4HCBA 5KFQA 2KQ2A 4CJ5A 5CY4A 4IFVA 3QERA 4NYZA 5KFKA 2JEFA 4DU4A 1IKVB 3M8QA 4BE0A 4IH7A 4NLRA 4ED2A 5C25B 4MKBA 4CF9A 2FBYA 3NL0A 1C1AA 1IKVA 1SL0A 1KLNA 4LQ3A 1NJZA 5KG4A 4OLAA 1X9MA 2YHBA 4CJ3A 1U45A 1B92A 1RTHB 4MIBA 4TY8B 4DTUA 4FK2A 3KHLA 4CJRA 3OS2A 4N56A 2G8HA 3KKSA 2F8SA 4DTRA 3RMCA 4TY9A 5EWGA 1S1VB 4ID5A 4O5BA 3KLEB 3ZSYA 2HNZA 4Q8EA 3IGNA 2E6LA 4WXWA 3P5JA 2ZE2B 3KLEA 4OJRA 4H4MB 1RT4B 5J2MB 1G15A 3V6DA 4HTUA 3AVFA 3S3MA 4C8KA 1IG9A 1NOZA 3GIIA 4CJKA 3HPHA 1RBUA 4H4MA 1YVUA 2IJFA 3N6MA 5KFVA 3BSOA 1C2PA 3IG1A 3TARA 4WXOA 2AWZA 4I9QA 3QZ8A 4IG0A 4MQ3A 4DL2A 1RILA 4M95A 4KHMA 3KHRA 5KFZA 2IA6A 3NF8A 4CJPA 3HJFA 4I7FB 5KT5A 4IOBA 3FFIA 4ZPDA 4B9UA 2O5DA 1U48A 3QEPA 1L3VA 3OYAA 3QGGA 5SZTA 3HO1A 3DOKA 3L3VA 4MIAA 5KGWA 3CDEA 4U7CA 2YKMA 3O3GA 3PW7A 1LV5A 3CJ5A 3H5YA 4FJGA 1RDBA 1FKPB 3QLHB 1R0AA 3IRXB 4BWJA 3VQ9A 4LSNA 4YMEA 2W7OA 2UVVA 1GX5A 3IRXA 4ZP7A 1T7PA 2P51A 2R2SA 2G8IA 2W8LA 4RNFA 4FM1A 4ZTFA 3ZSRA 3MXJA 1TK8A 5KG2A 4B8CA 4O55A 2FC0A 3KK1B 4NYNA 1TGOA 4TQRA 3NF6A 4HYKA 4CJFA 1RT1A 4M3WA 2NUBA 1WNSA 2WONA 1KHWA 3G86A 3DI6A 3DRSA 4K4YA 4N47A 3CIZA 1FK9A 1KVAA 4AHUA 1LWFB 1HNVA 1J5OB 4CEBA 1TVRA 2C2RA 5HBMA 3BREA 4O3PA 2AGOA 1YT3A 4QCLA 4PQUA 3FQLA 4DG1B 1VSKA 4HKQA 4J2BA 1S6PB 3LP1B 3EY1A 4K8ZA 4W5NA 2FBXA 1BQMB 1KRPA 1TQLA 4CERA 3I0RA 3QO9B 4O44B 4M3TA 3KJVA 3TR8A 1D9FA 1S5JA 4ICLB 3VQCA 3K5NA 3PX4A 5KRTA 1XHZA 3GILA 2FBVA 4XPEA 3RAXA 4IRCA 2UVUA 4OPJA 1O1WA 2AU0A 5KFHA 4Q44A 1RTDA 5KFGA 3QIDA 4ZHRB 5KG6A 4FJ8A 2HNDA 4W5TA 1KHVA 5J2PA 2OZSA 4CF8A 4PWDB 1MU2A 4BE2A 4F2SA 3DMJA 4AHCA 5KFMA 4Y34A 4DS5A 3ZT0A 1HYSB 3VQSA 2D5RA 2D7SA 3K2PA 4RW7B 1HYSA 1U4BA 2AJQA 2FVRA 2OPRA 4DTOA 3E01B 3PHEA 4U6PA 2FLLA 4ECWA 4RW7A 4NLTA 3C6UB 4MH8A 4CCHA 3IS9B 4JUZA 2DPJA 1CXUA 1VSFA 5KFJA 3V1RA 1NJWA 4J9LA 1BI4A 3RWUA 4ED6A 1LW0A 3S3OA 4J9QA 4DQPA 3QINA 5KG1A 4HUGA 4QWDA 2V4QA 3WNHA 3CJ3A 3OL8A 4KHUA 1HMVA 3LAMA 3FRZA 4KHSA 1SH0A 3DLKA 1J9AA 2OPSA 2Z1HA 4DL4A 3TVKA 3WNFA 2IDOA 3VQ8A 3H2LA 4OGCA 3AVLA 3VQ7A 2HHTA 3UIQA 1HARA 3CM5A 3ISNC 3LANA 1NOYA 4IFYB 1LWEA 4ED3A 5KFUA 5DMRA 3OJSA 5HRRA 2QK9A 3EPIA 3JYTB 1JLCB 5KG5A 1C0UA 3JYTA 3MFIA 3CFRA 1TP7A 4Z4GA 1BCOA 4WE1B 3WNEA 1BISA 1A5XA 3HVTB 5KFXA 3OYEA 3CWJA 1T94A 4KAIA 4DQRA 3OL7A 1HJRA 3CQ8A 2QV6A 4B08A 5CYQB 4O4GA 3RB0A 5SWMA 4F3TA 4R8UB 3AVCA 4F8RA 2B5JA 2IC3B 1QAIA 4NLQA 2QKKA 4Z4IA 1BQNA 4NRTA 4K4WA 4DFJA 2W9AA 4B3OB 3HP6A 1CZBA 3H5UA 1HYVA 4DLEA 4CJUA 2W9BA 5DQGA 1VRTA 4ECTA 4CEFA 4FLXA 4KBIA 4EEYA 3MEDA 3RBEA 2G8VA 2XGQA 3V1QA 1SKSA 3Q8SB 3I5AA 1WSJA 3HHKA 2WTFA 3DLEB 1IM4A 1NK7A 1RNHA 2D0CA 4QWEA 1JX4A 3DLEA 3ALYA 1JIHA 5KT6A 2YNIB 1T03B 3VN5A 1RT5A 1T03A 3SFUA 2G8KA 3AO5A 4O0IA 1S1UB 3B6PA 5HRPA 5KFRA 3AVIA 4TYBA 1IO2A 4JS5A 4WFXA 5C5JA 5DG8A 4NLGA 4F4KA 3QETA 2HB5A 2OYQA 4R5PB 3KIOA 2HVIA 2B4JA 3RB6A 4FK0A 4RNNA 4AILC 1D8YA 1S6QA 1S4FA 1Z26A 4R5PA 3SYZA 1Q9YA 1HQEB 4FJKA 2O4IA 1T3NA 5CZ2A 3SQ1A 3NAIA 3NGDA 3L2QA 4EZ6A 1SUQB 3RR7A 4E7HA 5I42A 4RNMA 2FVPA 3ICLA 5KFEA 3EPGA 1IKXA 2WK4A 2E9TA 2D0AA 1JLQB 2J6UA 3T1AA 3QEXA 4YQWA 5HLFB 5EUHA 5KT7A 1KTQA 2WOMB 1XHXA 1RBTA 2JEJA 1S1XB 3U6FA 2KZMA 3G10A 5HLFA 3KD5E 4URQU 3T5HA 4HUFA 3RRGA 4KREA 2PZSA 1BL3A 1TAUA 1TKTB 2UVRA 3OYKA 3Q8PB 3T5KA 4LSLB 5JUMA 4F4YA 1WSHA 4NLYA 1JLGA 5KFIA 1JL1A 4CE9A 4ZVHA 2GIQA 3LP0A 3SV3A 1U47A 4FLTA 1SKRA 3O3HA 4O3RA 3BQ2A 2Z1IA 4FLUA 3MEEB 3H4BA 1X9WA 4CFCA 5KFBA 3HVAA 2DFEA 3TAEA 3LALA 3JSMB 3MEEA 4KPYA 3H5SA 2VG5A 2GBZA 3UDLA 2W8KA 4DL7A 3OHBA 4M3RA 4CHYA 4NLDA 5C24A 5DG7A 3OYFA 1SV5A 4DSEA 4Q45A 5KRSA 4JV2A 4ECRA 4TQSA 3E51A 1LWCB 5KTQA 4DWIA 1KLMB 1XWLA 2KFNA 1RYSA 1BIUA 3Q8RB 4FLZA 4AHTA 4RW6B 3CDUA 2G8FA 5DGAA 1DTQB 4ZVGA 3T5JA 4ED7A 4FW1A 2OPQB 1TL1A 2OPPB 4CEDA 3LAKA 4DSJA 4DSLA 5KFSA 1RTIB 3RTVA 5F8LA 4NLWA 1S97A 4JV1A 3L2RA 3TAGA 1NK6A 1FKOB 4Y1DA 3KLGB 1RTIA 1S0NA 1RT6A 3V81B 5F8IA 2AQ4A 4FZXC 3SI8A 3RMBA 3DLHA 3KNAA 2X6NA 3HT3A 1TKDA 1ZBIA 2ZKUA 2R8JA 2A1RA 3BDPA 4FM0A 3VQEA 3G6XA 2ITGA 1RT2B 3MECB 4E1MA 2VWJA 1NKBA 4YR2A 4CECA 2IJNA 1CZ9A 4PUOB 4J9SA 2BDPA 4DTSA 5C25A 4DL6A 4Q0BB 3VQDA 4FBTA 2AX1A 2XC9A 4FJNA 4PUOA 1JXBA 3QZ7A 3TABA 3AA5X 1LAWA 2RN2A 3SUOA 1X1PA 1RTHA 1F21A 4TY8A 5F9NA 1QSYA 2ILYA 3TAFA 4E1NA 2XY6A 1ZETA 1L3SA 1NHUA 3P83D 1I3AA 3DM2B 4DQSA 3RMDA 1K6YA 1S1VA 4F3OA 3HXMA 4IRDA 4H4OB 4DSKA 4FLVA 4DS4A 3NCIA 4DMNA 5DGBA 2ZE2A 5L1JA 3ZT2A 4Q5VA 4CGJA 4Z4CA 1RT4A 5J2MA 3SNNA 1NK4A 2HHUA 1KFDA 1HRHA 1S9GB 1SL2A 3V9ZA 4CEAA 1IKYB 4RW4B 4JRPA 3G6VA 4C8LA 3KLIB 4GC6A 1BHLA 3OYMA 1RA7A 4RW8B 1WSIA 1HPZB 4HHTA 2ALZA 4QW9A 1EP4B 3FSIA 4DTMA 4G3IA 1JLFB 1YTUA 2JLEA 4RW8A 4Y2CA 4ECSA 3NH2A 3QIPB 4CJ4A 2HW3A 1EP4A 4RUAA 4KI6A 1N5YB 1S0MA 3CJ4A 4I7FA 1EXQA 3AA4A 2YHAA 1QE1B 4AH9A 4FS2A 3ZSWA 4CEOA 4RG8A 4CJLA 1QS4A 4TYAA 3HVRA 1U49A 4TN2A 1S0OA 2KW4A 5KG3A 3NHGA 3NBPB 1FKPA 3QLHA 3ZSZA 1NHVA 4CFAA 4RW9B 4NRUA 1U04A 1TKXB 3PUFA 2BANB 4M94A 4CJVA 1RDAA 3EYZA 1TKXA 3ULDA 5L9XA 2AGPA 3OSPA 1WSFA 4JLHA 3O4QA 3PO4A 4M3YA 2VG7B 3LWLA 1WSEA 3KK1A 1VK0A 1S48A 4NLUA 4CJWA 3I5BA 4K4TA 2IM3A 1CSJA 1UA0A 3PY8A 4EBDA 1QSLA 1RYRA 3O4NA 4IH5A 1CXQA 4N41A 2DFFA 1LWFA 1J5OA 3SZ2A 4M45A 3VQ4A 4TXSA 4OVLA 1S9EB 4NCGB 2LSNA 4CHOA 3OJUA 4FJXA 4FS1A 2ATQA 3KHGA 1VSIA 3KKRA 4B9SA 2IM2A 1S9EA 4L8RB 1NK9A 3OL6A 4DG1A 4DF8A 4KTQA 1S6PA 3LP1A 5KT2A 1RT3B 4FZZA 1BQMA 4E7IA 4RNHA 3CFOA 3NGIA 3VA0A 2FJWA 3QO9A 4O44A 3BQ0A 2EC0A 3H08A 4ECQA 4ICLA 5DK5A 1TK0A 2FBTA 1IKWB 3EZUA 3KOAA 3NF7A 3RRHA 3SUNA 3PO5A 3BSCA 4J9KA 2R8KA 4OKJA 3PR5B 1UWBB 4CEQA 5HROB 1VRUB 1D9DA 4IQXA 3KMSA 3H5XA 4ZHRA 4HUEA 1K1SA 3T19A 4Y2AA 3HP9A 1TV6B 2UUWA 4PWDA 4ECXA 3V4IB 3ITHB 2ZD1B 4KV8B 4GW6A 2XY5A 1RBSA 1NK5A 3H98A 3ITHA 2P5OA 3L3UA 4KHWA 3NF9A 1HQUB 3BQ1A 2BQUA 3E01A 1SH3A 3L2VA 4MFBB 4JS4A 3BSNA 4KB1A 2HWIA 4K8XA 1UOCA 3C6UA 3K5OA 4AHVA 2G8UA 4MFBA 3IS9A 1KVBA 2ZQBA 1RT7B 2HHQA 3MEGB 3GV7B 1ASWA 4FJIA 4MKAA 2VG6B 2OH2A 2PYLA 1RT7A 5I3UB 4RU9A 4BDPA 3HL8A 1ZBHA 4RUCA 2C2EA 4M3UA 2VG6A 3ZT4A 1HNIB 5KGXA 4EYIB 3U3GA 2JC0A 2RF2B 1IH7A 2BE2B 1KSPA 3HVWA 4Y1CA 3CJ2A 3B6OA 5C42B 3SCXA 3SQ2A 4DTNA 4BDYA 3C6TB 1W25A 4I9LA 3S9HA 5F8NA 4IFYA 3OYCA 5C42A 1KCFA 4KHNA 4FK4A 2V0NA 1Y97A 3C6TA 5J2QB 4ELVA 4QWBA 3SI6A 1JKHB 4G1QB 1JLCA 4M41A 1YVFA 3P1GA 2IOCA 1D0EA 2QE5A 2E9ZA 1JL2A 5DLGA 1S49A 2XI3A 4NYFA 2C22A 5EWFA 2ASDA 4WE1A 3ZT3A 4M3XA 3D5MA 3HVTA 4EYHB 3GQCA 3NGYA 4W5QA 3AVJA 4CGHA 3OYLA 3RAQA 4FJMA 1C0TB 3V6KA 4CHZA 1DTTB 4LH4A 4DFKA 1LAVA 5CYQA 5J1EB 1C0TA 4ELTA 3KLHB 1XR7A 5CZ1A 4B9VA 5HP1B 4R8UA 2IC3A 1SL1A 5J1EA 2HMIB 4B3OA 1SH2A 4DEZA 2BRLA 4Y3CA 3DRRB 1S1TB 4QWAA 2E9RX 3V6HA 4K50A 3UPFA 3DRRA 4KO0B 4QW8A 2V9WA 4CGGA 3I8DA 4NLVA 3QEIA 1NKCA 4B9TA 3RMAA 3FDSA 4AHSA 3AVBA 1RTJB 3BGRB 4ZP6A 4LD0A 4WFYA 4E89A 2YNIA 2YKNB 4KE5A 4GVMA 1DLOB 5JXSA 2EX3A 3D28A 4FM2A 5CYMB 4I2QB 4CHPA 1DLOA 1WSGA 1S1UA 4CFDA 4NLSA 4DU3A 4DU1A 4Z4HA 4IH6A 2HHWA 3ISND 2DPIA 1TKZB 5JS2A 2YNGB 2UUTA 5F8MA 3EZ5A 4M3ZA 3D45A 4ZPCA 3SUPA 3CFPA 4FZYA 1HQEA 2YNGA 4TLRA 4F4WA 3RB4A 3M8PB 2DY4A 3THVA 1TK5A 1WN7A 1RDCA 1C1CB 1BCMA 4ZVFA 1S1WB 1L3UA 4FJ7A 1B9FA 1SUQA 1C1CA 3MR5A 3KK3B 4K4ZA 1S1WA 5J2NB 3DOLB 1JLBB 1QUVA 1C1BB 1LW2B 4F4ZA 1EX4A 2D3UA 4Z0UA 1UA1A 2FJVA 3NMAA 4DL3A 3KK3A 4E3SA 4LY7A 1JLQA 5JS1A 1ZBUA 2GIRA 2QXFA 2Z1GA 4IRKA 4IDKB 2WOMA 2FVSA 3RBDA 2YNFB 1S1XA 4QWCA 3U3YA 2R8HA 4QPXA 2XY7A 4NCAA 4WZMA 4XO0A 4IR1A 1QQCA 1TKTA 4Z4FA 3NH1A 2IM1A 4J9NA 3AA3A 1T05B 3LWMA 4NLPA 2OZMA 4LSLA 3S3NA 3SV4A 2HVHA 3HK2A 4FW2A 3NAEA 3OYNA 2C28A 3DLRA 3PJWA 4IG3B 4N5SA 3G0ZA 5D3GB 2D41A 1VSDA 4FVMA 3OS1A 4EP5A 3PX6A 4CF1A 3JSMA 1J54A 5KI6A 3TAPA 4EO6A 4J9OA 3PVXA 4CESA 1EETB 3KLFB 3HM9A 4KHQA 4CFBA 4ZTJA 4CJQA 4NLOA 4DQIA 1JLEB 5L1KA 2OA8A 3QEWA 2RDJA 3KLFA 4DSIA 2Z1JA 2JC1A 4NZ0A 4CEEA 3AO3A 4H54A 1JXLA 4MK7A 2VA3A 2J6SA 3MR3A 4K4XA 3HYFA 4CF0A 4ZMMA 4O3SA 1LWCA 4I2PB 3OLAA 4ID1A 4QAGA 5KFPA 3H4DA 2F8TA 2I1RA 1KLMA 2Q3SA 1ASVA 1CLQA 3RB3A 1GOAA 2E6MA 1Z4UA 4XPCA 3DRPB 4BE1A 4HVJA 4RW6A 4YNQA 4O3OA 4YR0A 1DTQA 3I0SB 4CHNA 4CIGA 2OPQA 2OPPA 5T7BA 4ZPAA 5KFNA 3OYHA 4IKAA 2FJXA 2WB4A 4KI4A 1FKOA 4N76A 4DQQA 3KLGA 1S10A 5KT4A 3K5LA 3V81A 2XY8A 3CVKA 3A2FA 3OVNA 3AVMA 3AO1A 5KT3A 2IAJB 1JLAB 2RPIA 3LP3A 3KK2B 4KB0A 4DL5A 1WAJA 3DYAB 2YV0X 4TSXA 4FCYA 4CF2A 2PY5A 4B9NA 1JLAA 5HRSA 1RDRA 1RT2A 3MECA 3NE6A 4IFVB 3QESA 3O3FA 3N6NA 1NJXA 3LDSA 3M8QB 1KVCA
chains in the Genus database with same CATH superfamily
5E3AA 2IM0A 3M30A 4Q0BA 5H1SQ 2QA1A 3R2DJ 3TI0A 2DXEA 1MLAA 1NB7A 1EO1A 3HPOA 4LFAK 3N0VA 4L6V3 2W4DA 1YZ6A 5D78A 3ZSOA 1R43A 3MAQA 4C9DA 1FFGB 2AW0A 4LF5F 4Z4EA 2I5JB 4ELUA 1B7YB 4A8MP 3OA9A 5KFAA 1TL3A 1MWKA 2KM8B 2NREA 2PD1A 4ID5B 2YWHA 1GOBA 4H4OA 3C19A 1HNXJ 2FZGB 1AT1B 2MY7A 3OXGA 3CEDA 1U1OA 4URGA 3P38A 1FWPA 1SXLA 4NI2B 1QVFR 4J2DA 4EMDA 1HKBA 3AV9A 3O08A 2GVZB 4B3RK 3ZTQA 1WDDA 3C14A 3IG1B 4OPHA 1UWAA 3KLIA 2AZ1A 3D2FB 1W2IA 4HVZA 3TRGA 1ZM2A 2V8PA 1VQMS 1HNWJ 2YQ1A 4JEPA 5B0BA 1X4AA 2IBKA 4ILRA 4J91A 4X65J 3FBBA 2RKIA 2HS3A 3HKWA 3MHYA 4DLGA 3CERA 4B8AB 4B1YB 1V4SA 4PL8A 5IWAF 5HRNA 3FKBA 2QMXA 2YKMB 4YDUC 3DU6A 3THXB 1P9QC 4K0KF 1NGIA 3GJSB 2U2FA 2XCAA 1S57A 2V2KA 2F63A 3LPTA 3C94A 3O9TA 1QHAA 2Z2ZA 3D3CJ 5KG7A 3HMJG 3A4TA 3CJQA 3VQ6A 4WFZA 2L9NA 3L8BA 2DISA 3FQKA 2YWEA 3JTPA 2CQDA 4LVNP 3H2UB 5FDLA 4NMLA 4E0DA 4W5OA 4P72A 3ONQA 1UJ6A 2LEPA 3AA2A 1IJFB 2E5LJ 1ICEB 1MWYA 1WC1A 1ZTWA 2CPFA 5KFYA 5FPNA 1RT3A 4YOVA 2VA2A 4KC5A 4NXMK 2FPHX 1NO8A 3M9OB 2RE2A 1RU1A 2VPXB 1QHTA 2GHVC 2HFVA 4LFCF 2PEBA 4JI5J 2BKPA 2Y1IA 1T11A 1HIYA 2NR0A 1WTBA 4WU2A 5K8PA 4BQLA 3MUVP 5E3CA 5GIOA 4ECUA 3J81U 5HJYA 3R6LB 4OJ3A 4RUBA 4LF7J 4ED0A 1UWBA 2GMJA 2MPUA 1Q7YT 1VQON 1XQSC 4FWOA 4BR0A 1VQ9S 1XJWB 2X74A 2LCWA 1RWMB 3ZLJA 3QSYB 5KFCA 1VAZA 4U8VA 3V4IA 2HHVA 1AROP 1S99A 2HVZA 2GUIA 2ZWHA 4OX9F 1OY8A 5DJBA 4JV0A 3F41A 2ZM6J 3CM6A 4Q2LA 5A0YA 1RWKB 4IR9A 3E9PA 1F0XA 3BEGB 4P2MA 4YOWA 2RMLA 4OYPA 1WDTA 1IBLF 4UUWA 1KQSR 2ETJA 1RA6A 3A8EA 1NNDA 1TUVA 3G6YA 1QTNB 3M5RA 3MR2A 3A5NC 1KFSA 1LW0B 1GOCA 2Q0UA 2PN6A 3CD5A 1FRLA 4WFBL 3QNOA 1N6QB 2YWWA 2DITA 3PIOQ 2BUPA 4KKOB 4BWMA 4K4SA 3GV8B 1KQKA 1HMVB 3HI9A 2J0SD 2ZUGA 4WYWA 3MXIA 2QA4S 2RF2A 1N5QA 1D5AA 4MDBA 2UXBJ 4HR2A 2G2OA 1FTCA 2CA9A 5GMDA 4DV4J 3QIOA 5HVGA 4DV2K 1G2EA 4C3KA 3ILJA 2QG9B 2J9DA 1TZ0A 3DLBA 5J2QA 1MMDA 2CAJA 4G1QA 1GMWA 3MF5A 3MXMA 4JP8A 3ZT1A 9RUBA 4C4WA 3JS9A 4JI3K 2PBDA 4X4UA 4GKJF 3EXCX 5AQTA 1IWAA 3TTCA 3KHYA 2QFIA 3CG7A 1QAXA 2HLUA 1UCNA 2B7CB 4OPKA 1RADB 2K3KA 4MT1A 4JK7A 2HAIA 3H90A 1GQEA 5C0YA 1N56A 4CGIA 5AJ3K 4JI0F 3AO2A 1LKZA 2G1HA 4Y65A 1X31C 3DCAA 2DEJA 3H59A 1AFJA 4QIWD 4QPTA 3LZIA 1S1TA 4BRAA 2W9BB 1YJWS 4IJAA 2BRKA 3T3FA 2HGNA 1T02A 5EU7A 5LMUJ 2KM8C 4PYAA 3K0JA 2CVEA 3U1LA 3C95A 5TKWA 3CCLS 2JRSA 3BKUA 3WQTA 2VOPA 4C8OA 3L0QA 2R42A 2YKNA 3NVKA 1XMOF 1D9AA 1RT5B 1TL7B 2WHOA 1S9FA 3QEVA 3M2UA 2GCFA 1TKZA 5F8HA 1Q8IA 3IMXA 3E8OA 4E98A 5J1NA 1K47A 1WWHA 3M7VA 4BCAA 4LF2A 4B3MJ 2ZKTA 4FJLA 4F4XA 4QYRA 3OL9A 4AM6A 1N34J 3K2YA 3SCLE 1ITGA 5J2NA 3PNIA 3VA3A 4CK2A 3SPYA 1DJ0A 2WVBA 2Q31A 4WZQA 3D68A 3G2XA 4IDKA 2YNFA 1HYZA 4LF9K 4X66K 3GCWP 3QRQA 1RAIB 3AODA 4LRFA 4LFBK 3BBBA 4UTGA 4I6AA 1X8DA 4YORA 2XLJA 1JXEA 1VFJA 3VEVA 1YJNN 2QW9A 3ATVA 4JD2A 1AUSL 2EK6A 3C6AA 1Q9XA 2EEYA 4JI6F 3UD5A 3LGMA 1Q81T 4KAZA 3HOTA 3X1LB 4FJ9A 4HCCA 3GSDA 4EUVA 2GUPA 5LXYA 2QKBA 2P9NA 1YJTA 4LF1A 4J9MA 2R8IA 2XNRA 2VG5B 2V63A 1JJ2R 5CXTA 2QSWA 2FHJD 3CQYA 3M05A 4KH6A 2V4RA 3L7OA 1SV5B 2CKWA 4HDGA 1XI1A 3BH7B 1RDDA 1VHFA 1X7VA 1APSA 3WXJA 5DQHA 1LNQA 4OYIA 1GH8A 2W7PA 3UR0A 3MMJA 2NUHA 5A8WA 1YX2A 4IFEA 3DRPA 4OV6A 5IC6B 4BHQA 1UPMB 3WNGA 1OVYA 2E2OA 1LFPA 4IBNA 3J7Z5 1F2GA 1RCOB 4OZ3A 3TANA 3K58A 5M1KA 1I1GA 5AQXA 3GP9A 2B6AA 3MR6A 1U6BA 1D4XA 1ZZNA 1UVJA 1O51A 1HL6A 2XGPA 3H6EA 4DUZK 4ECYA 4DN9A 5D4NA 1TAQA 4B17A 1ZYQA 3FZLA 4HCBA 3EICA 3C3LA 3MUTP 1SQKA 3QERA 3J7AP 5KFKA 1EKSA 2BOPA 4J37A 4DU4A 3MCSA 3ULHA 4NLRA 2J8SA 3CC2N 4CF9A 3NL0A 1IKVA 5J1PA 4X4PA 4LRAA 2YWGA 4DI6A 3W2VB 1SQEA 4KGXB 3M2RA 3D6FB 4A8YA 2HQDA 1MROB 3R9LA 2HFNA 4DTUA 2AT1B 1ZA1B 3HM8A 4G65A 3KKSA 2RDDA 2F8SA 3BB5A 4X62J 5EWGA 1U8SA 2V50A 2RAQA 5GIPA 3SSSA 3R8EA 2ZE2B 2VJVA 1UVKA 3OR1B 1BUXA 4H4MB 1G15A 4AFFA 5AZIB 3S3MA 3LL3A 5BJRA 1RBUA 2KRRA 2HQFA 1YVUA 5AQIA 2ASYA 4ZCMA 3BSOA 2C2NA 2OUGA 4Y00A 1AZSA 4EK2A 1PAEX 3VGLA 5H9EK 5IM0A 3NF8A 2CJYB 5AFUA 4CJPA 2MKKA 3HJFA 1P1LA 2UUCK 3K5PA 2O66A 4B3TJ 1NDLA 5KT5A 3D67A 2O5DA 1FERA 3VF0B 3QGGA 2GVDB 4CH1A 2RQKA 3R9PA 4NZ6A 3H0PA 3OTCA 3HO1A 1JJCB 3L9ZA 4JI8J 1HI0P 4MIAA 1FRIA 5KGWA 1LV5A 4FXVA 3CJ5A 3H5YA 4BBYA 3L3CA 3WXIA 5LY3A 4YOUA 3VQ9A 4OO1J 1U24A 3R7SB 4JNEA 1LEOA 1XTZA 3D2EA 3D6RA 4FM1A 1YHQN 4ZTFA 4ES2A 3W8PA 2G0CA 1IBKF 3RSEA 2VFRA 3CD6S 3KG1A 3FVYA 4HYKA 4CJFA 2XQCA 1WNSA 2WONA 2VQFF 3VEYA 1KHWA 3DI6A 1VK8A 3I32A 2LA6A 3W5YA 3NGKA 3CIZA 2DNLA 3QBCA 3HSGA 3S8SA 5HBMA 1LQ9A 3OBIA 1M1KT 5IV3A 1VIOA 3FQLA 4K8ZA 3LP1B 4W5NA 5CCLA 1Y64A 2JLFA 1RWXB 3WXKA 3I0RA 2X1BA 4M3TA 2FIUA 3KJVA 4HHUA 4HACB 5IT9Y 3ILIA 2AIRB 1P8GA 1JNRB 2KYZA 1XHZA 2ZJPL 4IOAQ 4PG5A 3KVGA 4WU3A 3RAXA 1VCTA 2UVUA 4OPJA 1O1WA 2AU0A 2NXCA 4DV1J 2V5HG 3F56A 5KFGA 4WQ4A 1WF1A 4FJ8A 2VH7A 3VGSA 4G6VB 2LA4A 1YRXA 3MDFA 3DMJA 3CW2C 3QRPA 4Y34A 3ZT0A 2YHWA 4HHJA 2X1GA 4CBWA 1H1VA 2D5RA 2M4MA 3K2PA 2OTLN 1X3MA 3PYDA 2FVRA 2MLYA 5JICA 3ENHA 3PHEA 2N4CA 4U6PA 1XNRK 4RW7A 2CADA 4Z94A 4CCHA 2DPJA 1VSFA 5LSRA 1NJWA 3OTDA 3RWUA 4C0BA 2HHPA 2YKQA 3S3OA 2OLWA 2FD2A 2CQBA 3HHDA 4Q2MA 4DQPA 3ILOA 2V2ZA 1UJ4A 2IA0A 2KXFA 2O1PA 1OQ3A 3TZYA 3AOAA 5A2QO 4A8WA 5F41A 1K8KA 1SH0A 2LYVA 2OPSA 3TVKA 4H0VB 5E3PA 3EXYA 3VQ8A 1YHQS 3TA0A 1RWVB 5HMXA 1V3RA 3PYFA 1EWRA 5MLCV 4ED3A 2ROEA 3JB9k 4L75A 5HRRA 3CCJN 3MCPA 4JBCA 5LJ5Y 4E1JA 3UFCX 1NMNA 3JYTA 4ILGB 3GYXB 2IVNA 1TP7A 2MQLA 4LRDA 1A7GE 1MWZA 3QFHA 5FIIA 4RR5A 4RO0A 3HVTB 2XZTB 2OCEA 3DRYA 5I9EB 2KG0A 1PO6A 3E2EA 4X4QA 4X4NA 4B08A 3QRRA 2WSEC 1Q53A 4O4GA 3RB0A 4DR2F 4F3TA 3JTOA 1R3NA 2PMHA 4FNIA 2B5JA 4KH0B 2ZJQQ 2QKKA 1VJQA 4OYZA 4DFJA 1CZBA 4LF5J 3D4JA 2HBRB 1VMBA 4DLEA 4O0NA 2A10A 1KXPA 1VRTA 2ZVSA 5BPMA 1OO0B 1U0HB 2UXCK 3BGLA 2A3JA 4EEYA 3RBEA 2G8VA 2W01A 1SIZA 2IVFB 1YKWA 5LM7E 3CPEA 4Z2XA 2VBWA 3TA2A 5E3RA 2Z4PA 4J9UE 3ZC4A 3HSDA 4QWEA 1JX4A 3MAHA 3D0GE 2HGLA 1JIHA 1Q5YA 2YNIB 3CO0P 1PYOB 1QQMA 2CYYA 1WOPA 4DR3K 2MHEA 1VISA 1X4DA 2G8KA 4E8UA 1N5SA 3KZBA 4JHDB 1XC3A 5KFRA 4BRNA 3I9V9 2X7IA 1HLUA 3JXUA 5C5JA 5DG8A 3QETA 1VQ5S 1IJJA 3KIOA 2CQ1A 2B4JA 2K7KA 1FVSA 3MCMA 2AHOB 4WFNQ 1S4FA 3AGKA 3G96A 4YY3F 5BXIA 4R5PA 1XBWA 5IWAJ 1Y9OA 4FJKA 1NUEA 1Q1KA 1S6OA 3HFVA 3BZKA 2DD8S 3NGDA 4K0KJ 3H3OB 3IM8A 4UF4A 4EZ6A 1SUQB 4RNMA 1IKXA 2XEXA 3HCXA 2D0AA 1REGX 3T1AA 3PEJA 4YQWA 3BGUA 3U6FA 4I4BA 3G10A 1Y3KA 3KD5E 3I4PA 3RRGA 4KREA 2Q66A 2OGUA 3UN5A 4KPCA 3T5KA 1E4FT 4LSLB 4X64K 1AYEA 4F4YA 1N5TA 3SSRA 4A2BA 3GIRA 1JLGA 2K1RB 3LP0A 2JVOA 3MM5B 3O3HA 3JSRA 2AZ3A 4UOFA 3BQ2A 2DHHA 4FLUA 3MEEB 1X9WA 2KT3A 5KFBA 2W1BA 4U7BA 3HVAA 1I51B 1R89A 4LFCJ 3UDLA 1U2CA 1CC8A 3T6BA 3ZTOA 1ACMB 2R7UA 2R7QA 3D54A 3CHWA 3G8QA 4HTJA 2Z2YB 4KH5A 3FZKA 1YBTA 1FRXA 1CJTA 4ECRA 2ZH9A 4DV6F 3MWTA 1LWCB 5KTQA 3ENOA 1WKJA 4QYZJ 1RYSA 1UP1A 3W63A 1H74A 3J7A1 4FLZA 4RW6B 2G8FA 1DTQB 2L3MA 4WF9Q 4ED7A 4I69A 2OPPB 4DSJA 1WG4A 4JI7J 4USHA 3I87A 3SMZA 4IOCQ 1WHVA 2F8HA 2V4JB 3TAGA 3ENAA 3KLGB 2HG4A 1IBLJ 1RGVA 1TFYA 4DV0F 1RT6A 5F8IA 4P2SA 3RG6A 4H03B 5HO4A 4A59A 1S5ZA 2MZ1A 3HT3A 1TKDA 5KQ8A 5ETNA 1RABB 1G3OA 3FBCA 1OPZA 3U9ZA 1NGAA 3VQEA 5B0DA 3A5OC 2ITGA 3RZAA 3PIPL 3DLLQ 2LECA 4YR2A 2XMMA 1MW7A 4PUOB 2BDPA 3M30B 4Q0BB 1UEKA 3VQDA 1CG2A 3NCRA 2XC9A 4FJNA 2CPEA 4WYBA 3QZ7A 3TABA 1LAWA 2HGMA 2RN2A 3SUOA 2DY9A 3N9UC 2ILYA 3VZHA 4OI6A 2CJ9A 2YPZA 1PBAA 3WQPA 2XY6A 1QVGR 3P83D 1U6ZA 1I3AA 4DQSA 2BA9A 3UE5A 4DUYJ 1K6YA 4GKJJ 1S0VA 4C98A 4IRDA 4H4OB 2YHXA 1R6VA 2UV8G 4IQMA 1W26A 5L1JA 3ZT2A 4LR8A 4LR7A 5FPMA 1RT4A 1FJGF 2FGOA 3UVJA 1WOSA 2OSQA 1HRHA 1RJJA 1SL2A 5E3QA 2OD6A 1EKRA 4UOCA 3G6VA 3CD0A 4C8LA 2UU9F 3CPWM 2HFSA 3KLIB 4I67A 4CM0A 2J0XA 5C2CA 4JI0J 1WSIA 5H9FJ 4QW9A 3FSIA 3E3XA 2BACA 4Y2CA 3NH2A 1OSDA 3A13A 2CWXA 4RUAA 4KI6A 2G2ZA 1YI2N 2PMZD 4I7FA 2NUUG 3EVOA 1HKGA 2YHAA 5GINA 4B02A 2CRLA 3CMES 4ZN3A 1QS4A 4Z7CA 4TN2A 3KXDA 2KW4A 4ZVPB 4FYWB 3NHGA 4H0XB 3Q8YA 2KL8A 1BG3A 1UEUA 4LC9B 1NHVA 2OKQA 1XMOJ 1U04A 4G1PA 3A3NB 5GAGI 4M94A 4WQ5C 3EYZA 1TKXA 2RRAA 3ULDA 2AGPA 4LJMA 3AOBA 2DGTA 4M3YA 3O4QA 3R2CJ 5DDOC 5JVHQ 3IC1A 1FX4A 1HI1A 1SBRA 3VAGA 4TU7A 3GMGA 2KB2A 4K4TA 2KHDA 1QSLA 2Y8YA 3O4NA 3FUYA 1UMJA 1LWFA 4OVLA 2KHCA 4CHOA 4DV5K 3OVBA 3KKRA 2IM2A 1M5HA 3TJ8A 4L8RB 1NK9A 4DG1A 1P8ZA 4N7TA 1ZXOA 1YJRA 5FLXY 1RT3B 1BQMA 4RNHA 1Y10A 3D1QA 3NGIA 1TELA 2E2NA 4O44A 3SEOA 4B1WB 4IJNA 4C3LA 3ZX3A 4CO5A 3HSZA 3FRYA 3H08A 4ECQA 2LEBA 1TK0A 3DU5A 3EZUA 3CDAA 5JVGL 3SUNA 4P6QA 3PG9A 4OKJA 4FWMA 3W0LA 4DPTA 1UWBB 5A6PA 3R1LA 1TUYA 3M8YA 2F8MA 3VGMA 4MYTA 1RCXB 1D9DA 2DBBA 4ZHRA 4HUEA 1K1SA 3T19A 1AUDA 5EX3A 2WW4A 1XNQK 4ECXA 1RXOB 3V4IB 2ZWPA 2FSNA 4WFAQ 1OYDA 5EOYA 3TSQA 3BV8A 3I82A 2P5OA 3L3UA 5A0YB 3NF9A 1QY7A 2WBRA 3CNQP 2OMOA 3E01A 1SH3A 5B09A 3MCOA 1YITN 2QO3A 1VQKN 3NS5A 2HF3A 4GKKF 5K8MA 3K5OA 3FC9A 1NH7A 4MFBA 2CWKA 4OPAA 3MR7A 1KVBA 2HHQA 1ASWA 3T1HK 4FJIA 1HWIA 2PYLA 1RT7A 4BRQA 4MO5A 4RUCA 3A3PB 3MI7X 3J81j 5JLFA 1RWPB 1R27B 2DVIA 4ZVOB 2WSFC 2RF2B 5CCMA 1S72N 5AR0A 5ETVA 5BPLA 3B6OA 3PYGA 1S76D 1FTRA 5C42B 1PYTA 3C6TB 4OFZA 4WBFA 3S9HA 1ZC6A 2E1ZA 3OYCA 2RVJA 1MDUB 2IIRA 2H3EB 3P6YC 5J2QB 4DR5F 3ZO7A 2BW2A 3MGJA 4G1QB 4F26A 3CJBA 3I56S 1SQFA 4M41A 3J7AN 3J7ZO 1JJHA 2J0QD 4DV7F 3CJ7A 1WC6A 2YWKA 5C2DA 2XI3A 2C22A 3IAM9 5CD4H 1PJ7A 4WE1A 5HATA 4OLOA 2WVDA 3UD3P 2ZH8A 4GNIA 2PA3A 4CGHA 1HR0K 3RAQA 1Q7YO 3ULEA 1C0TB 2B3TB 4LH4A 3CCTA 1LAVA 4D3HA 5CYQA 4B1ZA 4BC4A 3E1YA 5GAHI 4UZBA 2M8DB 2Y1LB 1OWXA 1SH2A 5BR9A 4C8YA 3DRRB 4LFAF 2MQOA 1S1TB 1LK5A 2E9RX 3BBCA 4PCQA 1KC8T 4CNZA 3O8WA 2R3VA 4QW8A 1R8AA 3G8SA 2E1AA 4F4AA 4P75A 4B9TA 3RMAA 3FDSA 1YXQA 2Z30B 2O8CA 7FDRA 3HOSA 1IQZA 3KJNB 4WFYA 2YKNB 5GAGU 4ERDA 3D28A 3BYRA 3HI0A 2ERRA 2M52A 2JWNA 4B3RF 4NLSA 5ADXA 3LQVA 3HF5A 3MM6A 3M2UB 2FJBB 1TKZB 2Z2MA 5F8MA 1K9MT 4ZPCA 3SUPA 2EVZA 1IN0A 3RB4A 5HVHA 1TK5A 3FCHA 1NGDA 3CQXA 2VFVA 3GFYA 4DR1J 4ZVFA 1S72S 1S1WB 2VQEK 4BC3A 4Y2IA 2ZZTA 3B8HA 3NEKA 3EKUA 5J2NB 4OZ0A 1UA1A 2LVWA 1BLUA 4C1NI 4E3SA 2FUG9 4LY7A 2KT2A 2XSFA 4Y28C 4W98A 2WSCC 2QXFA 2Z1GA 4UQTA 1QJHA 4IDKB 4CD1A 2YNFB 4GVBA 4QWCA 3VZIA 1IBKJ 2GAGC 3ZZRA 3NG8A 4DPXA 2XY7A 5HL7L 1GLJO 4BGAA 3NH1A 2IM1A 3J81Y 3EE3A 3TZWA 3L95X 2W6KA 4JD2B 1RWUA 2ZBIA 1HNZK 3UW1A 2C28A 3B8AX 3DLRA 1QVFM 3LTOA 3DN9A 3VGVA 4N5SA 3FZFA 4FVMA 3GJQB 2B9XA 3MWPA 2GHWA 2XLIA 4NO7A 3I8BA 4EO6A 2V8HA 3KLFB 5T41A 4CFBA 4NLOA 2PA8D 4NXMF 1SKUB 2JC1A 2KU7A 3NY0A 1JXLA 1ZAVA 4MK7A 2VA3A 4O3SA 5L9NA 5ITHA 1T9TA 3H4DA 2F8TA 2XHCA 5D8HB 1KLMA 2F7TA 5A8WB 1N33K 2BKOA 1ASVA 1UZDA 2NZTA 1Y5NB 3DRPB 4BE1A 3AY0A 4EGLA 3N28A 3V2UC 4FF3A 4CHNA 2JVRA 4ZPAA 2KKZA 4O23A 3OYHA 4IKAA 3VMFB 3MWBA 5BYRA 4GO7X 3K89A 2RILA 2V7YA 2VYPA 4A62A 3V81A 3A2FA 1BC6A 1A0OB 3GTYX 3AO1A 5AQPA 2ZDOA 4O8KA 4JI2K 1WAJA 1RUSA 4TSXA 3MAAA 4B9NA 3HHLA 1JLAA 1VQNN 4XEIA 1DBDA 4B1XB 3MECA 3QJLA 3DDIA 3NE6A 2OAUA 4JI4F 4DUTA 4DXLA 3VEOA 5E41A 2LDIA 3TU5A 3MEKA 2LLZA 4DX6A 2ZH3A 3M2RB 3CULA 3BKTA 1GLAG 1VQ8N 1OYEA 1FRJA 3ET6A 3OHAA 3DM2A 1KQGB 2G1DA 2UUBK 2I5JA 1OPIA 2J4RA 3C7NB 1L3TA 2F4VJ 2R7YA 2ZF5O 4NB4A 2NLWA 2R2RA 1PG5B 3OSNA 3PDNA 2H4WB 4JI3F 1QQOA 2APOA 2EFQA 2RU9A 5IT9O 3ZSVA 1S9GA 2XB2D 2CJQA 3QT7A 1GLLO 1IKYA 1NB2A 2J9EA 4P2FA 4B3SF 3VQPA 4F50A 1AZSB 1Y5LB 4DR2J 3VWSA 1UAXA 2Q3PA 2WCXA 3W64A 1TL5A 4YHHK 4ZCIA 2GZOA 2IVPA 3AVGA 4DHYA 1JLFA 2J9CA 2E44A 3QBWA 5JMNA 3KMQA 3MN7A 5AJ3F 4XH1A 3MOJB 3SK3A 4URSA 1RBLA 3CJAA 4RBTA 1QE1A 3LPUA 1EIYB 1F5CA 4JV5F 5DM6L 4YFUA 3AVHA 5L8RC 1U2VA 2NRWA 4UT4A 5AFUH 3TWHA 3SJJA 1T6DA 3D0PA 1SVDA 4RW9A 1YJVA 1XC9A 4IO9Q 2HF4A 2QTWA 3D2EB 4CK1A 3D0HE 1S12A 1N48A 3TSUA 1RI7A 3NKYA 3IM9A 4N8OA 4MKYA 2PFUA 4F3MA 3CO9A 3KG0A 2GJ2A 3E9OA 2WONB 1UKUA 3N5FA 4YY3J 3NH0A 3DI6B 5M1OA 5HBMB 4LMZA 4K4UA 4OHXA 3U27A 3VQ5A 2ZJRQ 4GVEA 4QOZB 3N4WA 1NH8A 4FSVA 2ZGYA 3IMQJ 3I0RB 4FZVA 3KJVB 1E6YA 3NOGA 2UVWA 1RSCA 1N4LA 3PXGa 1GX6A 4LF6K 2J7UA 4YP3A 3CDBA 4YB1P 1IKWA 2DIVA 2C3MA 2F9DA 1WUUA 4M5DA 1BGXT 1V9OA 2GO8A 2B7BB 1U1LA 2W7AA 1YJ9S 4LF9F 4X66F 1X5PA 1NKEA 3V9SA 3PKMA 3DLGB 4LFBF 5L1IA 1EARA 1NM1A 4FYYB 2DNZA 2GIFA 5FRNA 2P9EA 3AVAA 3BF3A 3TO8A 4WP9A 1ATSA 3OW2M 3DMJB 4KGMA 3VF4A 3M1FA 4CGFA 4CDIA 2FVQA 3TEGA 3ZTPA 1K0VA 1KD1O 2DRBA 4J9PA 2ITMA 1HQUA 2KZZA 1DZ5A 5AQLA 3MPYA 5T14A 4FBUA 2CGKA 1VQ7N 3CCWA 2E2QA 4FWPA 5KFDA 3FZ2A 3BSAA 1UPPA 5HSPA 5M2UA 5GAEI 2C2DA 1VSJA 1A5WA 4ECZA 1IUJA 4WKYA 4DV6J 1W2BM 2I9SA 1HA1A 4NZ7A 3NFAA 2VICA 4CLFA 1N6QA 4BRHA 1HNIA 2QA2A 4KKOA 4MKVA 1K8KB 4M7XA 3QATA 2OPSB 4KRFA 4F2RA 4CJEA 1K44A 4MJKA 3TTDA 3T1YK 1QSSA 1U09A 2A18A 1A5VA 4RL1A 1U0SA 4M5IA 3OS0A 3TQ1A 4WWSA 3V9XA 1K8AO 3NVMA 3TVYA 4DV0J 4RKUC 4PXCA 3TX8A 4JK9A 3SCIE 4J2EA 2GS8A 9ATCB 1Z25A 1EJ7L 4PEOA 3OY9A 1NCLA 1QAYA 2D3ZA 2BQRA 1SZ2A 2ZGZA 4JKDA 3NOCA 3TAMB 1BA0A 5CYJA 5AQSA 2C42A 1ZA2B 4DUZF 4CZGA 2KVIA 3GIJA 2FHMA 1ZTTA 2O8DB 2AJ4A 1OMSA 2HHXA 2YKAA 3DNCA 2UZAA 3DFEA 2R2TA 3P96A 3JQKA 3GR1A 1DTTA 1GMUA 3MFHA 2P9SA 4E7LA 1CPZA 2EKNA 4O4GB 5EDWA 5FPEA 2YNHB 3TUPA 2B5JB 1SJFA 1IQTA 2VGMA 4XAKA 3EE9A 3A8KA 2PFFB 1VRTB 1ZBTA 1HNWF 5KFWA 3VR1A 2CZVC 4FWSA 3R5DA 1RWNB 4M5LA 1ASUA 4X65F 3RUBL 4I64A 3ENWA 4C8MA 4JYAF 2NYHA 1WHXA 3VESA 4QBUA 1RTJA 2VWKA 1OIAA 3N6LA 4GMJB 2VPYB 1RHJB 1S22A 2UU9J 3OYIA 1VQ7S 4CIFA 4J2AA 3VAKA 3PEHA 3N4QA 5F3TA 3ZZTA 3MXHP 3VAIA 3ISZA 3HHNB 1YVNA 5GADU 3KLVA 1IBCB 3LOUA 2FLPA 5M1FA 4O4RA 2VFUA 1ZOTA 3LDPA 4L74A 4BS2A 3K59A 1J27A 2BR0A 1MNEA 2B9EA 1GLEG 1JCFA 2UUCF 3I96A 3ZSXA 3M8PA 3DXKA 1CULA 1N0UA 1GLBG 1FW6A 1UAWA 2C2KB 5K20B 1I3OB 2FYXA 1QAJA 2E5LF 3MK6A 1S59A 1IKXB 1C1BA 3J7YU 1LW2A 3MPDA 1FNXH 4PWUA 2E7XA 3M9MB 2XS7A 1WI6A 3MN9A 4AQYK 4OKEA 3PFEA 4J90A 2YX1A 4C1NK 2PI4A 4WFBQ 3VQAA 4DR7K 2KTQA 1NRKA 3MOZA 2GQCA 1JLGB 2Z0GA 3V1OA 4CT8A 5IZHA 3LP0B 2VFSA 1VQLS 3W2WA 2Q0RA 4CK3A 3FNNA 2DRDA 1PJ5A 2RUGA 2HVDA 5CE3A 1DGKN 1RBVA 1L5UA 2F65A 1T44A 2OEMA 2EWSA 1WJ9A 2DTUA 2CDQA 4U8YA 1EETA 3QJPA 4A4JA 1FFWB 1JLEA 4USMA 3R1XA 5AE2A 2H4YB 2DJWA 1UVMA 3PSIA 4ZLLA 2EHGA 1RISA 4A5AA 3QGHA 1FDNA 2Y1RI 3O3LA 1EAYC 4KB7A 3PJ9A 2JSXA 4BR2A 4RWXA 3H42A 4HI2A 4O3NA 3AD7C 3ZZZA 2QT7A 1NEEA 3W5XA 1UFWA 3PW5A 3PX0A 1B4SA 1JWWA 1NJYA 1NJIO 2RDIA 5KFTA 3OYBA 4Q43A 2E4LA 4IOXA 2PEHA 2DGSA 2AJFE 2BABA 4ZIWA 4U67L 1I6JA 2DNGA 1YRTA 3OYDA 4I0WA 1OS5A 4RWWA 1VSHA 2AYBA 2OP5A 2PYJA 4GKKJ 1RT6B 4DL0C 4MIWA 2M8HA 2XULA 1VK3A 1XNRF 2IAJA 1X4CA 3O9SA 2GV9A 4HWIA 3DYAA 4KQZA 4CHQA 4CIOA 4FL9A 1Y0HA 2LEAA 2JZ5A 2CPZA 2LQJA 2QYCA 5KFQA 4ZVRB 2GGPA 3Q86A 4CJ5A 4IFVA 4NYZA 5I3PA 4ZJOA 2Y3YA 1Y00A 1ZS6A 4ED2A 4J8FA 2O3DA 4MKBA 2XZDB 2FBYA 4DR6K 4LQ3A 4PXEA 2C1EB 4AYBD 4OLAA 3U9DA 2BBEA 5LSLA 3HTVA 2FDNA 1X9MA 4CJ3A 4CTAA 1KDNA 4EI2A 4DR5J 3IR5B 1S79A 2BE9B 3KHLA 4DCOB 4CJRA 2G8HA 1H38A 5IQQA 4DV7J 1DT9A 4DTRA 4TY9A 2ASMA 4RU2A 3E66A 4O5BA 3KLEB 1CJVA 2HNZA 5FLXO 3IGNA 2AP6A 3U8XA 4PR6A 2E6LA 4WXWA 4BRIA 4JAXA 4OJRA 1RT4B 3V6DA 3UVJB 5D0RA 4UUXA 4C8KA 3GIIA 3OR1A 4H4MA 3FCVA 5KFVA 1BUPA 1C2PA 4CZFA 4DCPB 1SC6A 2FZKB 4USUA 2XYGB 1LK7A 3MN5A 2B0GA 2BJ7A 3QZ8A 1QDUB 3RW7A 1WC5A 2QEXS 1RILA 2FSKA 2LP4A 2GX8A 4LFAJ 3OHRA 4RBUA 4I7FB 4IOBA 4ZPDA 4CD3A 1L3VA 3QEPA 5SZTA 2H1YA 1NSKL 2VL1A 1YIJS 1WD6A 3L3VA 4U7CA 2GVDA 2UXCF 2EXUA 1PSDA 4DMZA 5A2QU 3IRWP 4B3MF 3IRXB 4FYXB 2W7OA 3CCUS 2UVVA 4LVOP 2QWLA 4ZP7A 1N34F 3K8WA 4NLBA 4B3RJ 4DV1K 3ZSRA 3F2KA 3P31A 3B6BA 4O55A 4B8CA 2H5JB 3MURP 4DR3F 4UY8T 2H51B 4TQRA 3NF6A 3KWIA 3AFGA 5A76A 5GAHP 1RT1A 1N8RO 1X4FA 1V6HA 3DRSA 2VHGA 4K4YA 5BN8A 1LWFB 1F3FA 1FWKA 2C2RA 3NMRA 3BREA 3WZ0A 1YT3A 4YOEA 1KQFB 4DG1B 1VSKA 1BMQB 2B4UA 2FBXA 1BQMB 1KRPA 1TQLA 3TZZA 3O6WA 4O44B 3TUZC 2BM1A 4FDFA 5ELZA 5B0FA 2UYTA 1WKKA 5T7LA 3VQCA 1FVQA 3CJSA 3K5NA 5KRTA 3O5TB 3W66A 1OH6A 1NGCA 2NXNA 3ELHA 1R8PA 5KFHA 1RTDA 2YWFA 4ZHRB 2I38A 5KG6A 1NHKL 2VIHA 1KHVA 2CJKA 2X1AA 1MU2A 4X64F 5KFMA 5C12A 1FO1A 4M8LA 4DS5A 5AQOA 2R7TA 1N36K 1QM9A 5CH7B 2N7CA 3FBFA 2D7SA 2ZEJA 1U4BA 2OPRA 3E01B 1Y3JA 5RUBA 2ZBPA 3CPWR 5H1SV 4NXMJ 3O9RA 1XMQK 4U7UD 3ZZYA 1CXUA 3V1RA 1BI4A 4FPRA 1FT8A 4JKHA 2CG8A 4J9QA 3GJTB 1VQSA 2RHKA 2DGQA 2HQIA 2ZBRA 4RJVA 5AQNA 4BROA 3OL8A 3Q7CA 4KHUA 3ZZPA 4NPOA 5A8RA 1U1PA 3DLKA 1J9AA 1RU2A 4GMKA 4DL4A 2FHKA 1S6UA 2CFXA 4OGCA 3VQ7A 3CM5A 2GQ2A 2N3LA 4WP3A 3LANA 1NOYA 2P9CA 4F04B 1LWEA 2QL9B 3BF1A 1X4EA 3C15A 2DHAA 1M90O 3MFIA 2PI5A 1X0PA 3BN7A 2EG1A 4ZJLA 3NRBA 4Z4GA 1LXJA 1RAFB 4X62F 2FTRA 1BCOA 2GAHC 4WE1B 3WNEA 2RE1A 1A5XA 4JI4J 2LXIA 3OYEA 2HEKA 3M6UA 2GTDA 1FX2A 1RHMB 1HBNA 2CQIA 3ULEB 4DQRA 1URRA 2NXEA 2QV6A 3IFEA 5CYQB 1NDCA 1VQPN 5ETTA 4C48A 4F8RA 4P71A 2CH5A 4CZCA 4Z4IA 3J81O 1BQNA 1X4BA 4K4WA 2MKIA 2VU5A 2W9AA 4DV2J 1YZ7A 3O4WA 4FLXA 2CQGA 4KBIA 3GDQA 2VB6A 3ZZOA 2XGQA 1SKSA 2I7NA 2ASPA 1WSJA 4JI3J 3DLEB 1IM4A 4OHZA 3THWA 4HT7A 2D0CA 2O8CB 2MGZB 4JI8F 4BRKA 1T03B 2UXDK 2FXUA 1RHQB 5HMWA 3VN5A 3C65A 2E2PA 3SFUA 4O0IA 5HRPA 2ZNZA 4QOTA 2WFBA 4TYBA 4WFXA 4FNHA 5D0EA 2V6AA 4NLGA 4OX6A 2BZ2A 2OYQA 4PG8A 5AJ3J 2HVIA 3RB6A 2QWRA 3FSXA 5DZ7A 3OUYA 3QMQA 1RE1B 3HZGA 3ZEUA 3SQ1A 5ADXH 3NAIA 1GFWB 5G4DA 1TMMA 2RRNA 2XMTA 4CZHA 3KDOA 4E7HA 2UP1A 5I42A 3Q8UA 3ICLA 1UETA 4V19J 3GR0A 2E9TA 1PBUA 2J6UA 2X3GA 4K2XA 1T6CA 2YBVA 3QEXA 2PGCA 5HLFB 4CZMA 1CJKB 1XHXA 4J5OA 1RBTA 2JEJA 4GVBB 1OVQA 4ZK7M 2VDIA 2UVRA 4OX9K 5JUMA 1CVJA 1IJEB 4ZIVA 3O1BA 2DR7A 4OZ5A 1J5EK 2C2MB 1U47A 2DGXA 3OXFA 4O3RA 2PFDA 1KC8O 3MM5A 2Z1IA 4CZJA 4DV5F 3MX2A 1VQPS 1FXLA 1TMJA 2DFEA 5AQYA 3LALA 3MEEA 4JKEA 3H5SA 1F5BA 4RUHA 2E88A 4A5BA 2K8GA 4PKHA 6AT1B 4FWQA 4NLDA 4Z37A 1MA9B 3TUJC 1M1HA 4LF9J 4X66J 2AV5A 4LFBJ 3ZXWA 4TQSA 5EX0A 4DR4K 1KLMB 1XWLA 1PKUA 3OVSA 4K2JA 2SXLA 2M70A 3TJAA 4ZVGA 2DY1A 3CMAN 3KKFA 1TL1A 4CEDA 1XNQF 2W2OP 1RTIB 3RTVA 2J7KA 5F8LA 4NLWA 1YG0A 4JV1A 4GV6A 4DX7A 4Y1DA 2RB7A 8ATCB 2V4JA 3V81B 2ZBCA 2UUAK 2CDRB 4ZCKA 1ZBIA 4GO5X 3JTNA 2ZFHA 1WORA 3SMSA 2R8JA 2ZDPA 2YH0A 4FM0A 3HHLB 4QU6A 4QR0A 3MECB 4E1MA 2KXNB 5AXNA 3TQEA 3T1HF 3S6EA 4LBIA 2XS2A 3JQJA 5DS7A 4DTSA 2YXLA 4FBTA 4PUOA 3M1VA 3TWZA 2HOEA 1JXBA 3EWGA 2E29A 4FPIA 1UL3A 2JWLA 1RTHA 2DGWA 4TY8A 3BGOP 3ET6B 1LWXA 1Q86O 1L3SA 3BKFA 3DM2B 2KHOA 3WQUA 3L4BC 4F3OA 2QMUB 4DSKA 2W2MP 4DUZJ 5GAEP 4ED4A 4DMNA 5DGBA 4Y0FA 3J80U 3SCJE 3OBWA 4Z4CA 5BREA 1M5PC 1S9GB 4E2FB 1IKYB 3MM7A 5D6GA 3M8WA 4JRPA 4DDFA 3Q24A 4OZNA 1SJQA 3CJRA 1HR0F 4DPWA 3F9MA 4RW8B 1FNMA 4G3IA 1JLFB 4PL7A 2ZH5A 2M0GB 2HW3A 3VF6A 4NYOA 1S0MA 1EXQA 3AA4A 2NQPA 3EX7B 1QE1B 4AUKA 2GV1A 3Q2SC 3CETA 3ZSWA 1UJ5A 3HBTA 1PJ6A 3FZHA 3VQTA 2VZ9A 1U2VB 4JYAJ 4QR1A 3CMAS 4ANCA 5AXMA 5KG3A 3N4PA 1FKPA 3MM9A 2E5HA 4RW9B 3T41A 4NRUA 2VBXA 4PWWA 3FGUA 3CCQS 2ZJQL 2OO4A 2WC9A 3CJ9A 2Q6CA 3LPEA 4C3MA 4DN0A 4PKDB 3W9HA 4DJBA 1NSQA 4FOIA 2H65B 4JI1K 2KKHA 4JI6K 2L08A 4NE9C 2IM3A 5H9EJ 1UA0A 4EBDA 4GRSA 2E66A 1BE4A 1QUPA 2UUCJ 1J5OA 2E5JA 3SZ2A 4YOYA 1NGGA 2HAFA 4TXSA 4FJXA 2ATQA 2NRTA 2QLXA 4B9SA 3OL6A 1NGFA 3CF5L 4DF8A 3VGUA 4KTQA 2BJ3A 1HD1A 4NA3A 2UV8A 1S6PA 5KQDA 1OY9A 3VGTA 4E7IA 1WEYA 1E6YB 3UDVA 2EC0A 1H2TZ 2NSBA 1BY9A 3GE9A 2IMOA 4ICLA 1NLVA 1NPRA 3PTWA 1IKWB 3PO5A 3NF7A 4M5DB 3BSCA 4J9KA 1NDPA 3VGKA 3PR5B 4CVNE 4OIXA 2BEFA 3PIPQ 2B9YA 2PT0A 5AQWA 2UUWA 4PWDA 3ITHB 2VF3A 3EGWB 2QWMA 2XY5A 3G9CA 1NK5A 3H98A 4JKGA 4BRLA 2QYGA 4ZOSA 4KHWA 3HD2A 5AQRA 1DQ8A 1HQUB 2C2ZB 3BQ1A 3MD1A 2V69A 4JI7F 4JS4A 2NPFA 3BSNA 4KB1A 2B4OA 1T9YA 3S41A 4MYUA 3C6UA 3T9ZA 4AHVA 2G8UA 3IS9A 1U2FA 2ZOGA 4WKRA 1MWQA 2OTJN 2VG6B 2OH2A 4RU9A 3HL8A 3ATUA 4Y2MA 2C2EA 1HNIB 3QFWA 2JC0A 5KPTA 5CR4A 4PPZA 4J7CA 2M2BA 1N33F 4QIVA 2MQNA 3PRVA 2KYXA 1R8BA 3SCXA 3FJ2A 2W41A 4FO0A 5AZJA 3CCVN 3OR2A 5C42A 3BDEA 3C6TA 1AW0A 3CIMA 5CD4A 1IR1A 1XNRJ 3CCZA 1YVFA 4P52A 3H45C 1D0EA 1U02A 1S49A 2WBNA 4NYFA 2A41A 2L9WA 3HHLC 3ZT3A 4DUYF 4JI2F 4EYHB 3GQCA 4W5QA 3IDHA 2ZOMA 2KJWA 4YUDA 2VV5A 3OYLA 1XQIA 5CZXA 1DTTB 4DFKA 2P9SB 3N5BA 5J1EB 3QB0A 1C0TA 1XR7A 2Q2RA 4B9VA 5M1PA 3T69A 4R8UA 2ADBA 1X4GA 5EX5A 3I6PA 4QWAA 2NXJA 3QT6A 3JS6A 3WXLA 3DRRA 1VQOS 3DAWA 4AM7A 4NLVA 1FDBA 2ZH1A 3QEIA 3MPUB 3GFXA 3AAPA 2P2CB 1NKCA 2V52B 2HBYB 2U1AA 4AHSA 2RSQA 1Q8LA 1RTJB 1H98A 1HWUA 1T95A 2AJ2A 3TR5A 3UR3C 1HBMA 3OW2R 4HTIA 1DRZA 2EX3A 3D0IE 2HBJA 2VQFK 1XMBA 3UCGA 1S1UA 4AL7A 1U1MA 4DU3A 3H20A 5JVGQ 5HANA 4Z4HA 4LF4K 2GJIA 1SC1B 2B51A 4FKXA 2YNGB 4YHHF 2UUTA 5DDPC 2BJ1A 3Q2TC 1IBMK 3K0SA 4FZYA 4TLRA 4F4WA 2YTCA 3TX0A 3M8PB 3DXKB 1EHWA 1CULB 1W2BR 2UXCJ 2XO6A 1C1CB 1BCMA 2XMAA 1B9FA 1UFLA 3HJVA 3JAMU 3MR5A 3CCSN 3KK3B 5BRDA 2D9OA 1S1WA 1C1BB 4IO8A 1LW2B 1EX4A 4K43A 2D3UA 4Z0UA 4I56A 2J9DE 2CH6A 2FJVA 1FJCA 4DL3A 2DT9A 4WIIA 1AA1B 1WG5A 2KDOA 1JLQA 4P7VA 2GIRA 3LA0A 4IRKA 2WOMA 2FVSA 4CT9A 4DR3J 3U3YA 5D77A 3WBZA 4WZMA 8RUCA 1TKTA 1J2VA 5FJ4A 3MUMP 3AA3A 4A61A 3X3UA 4NLPA 2OZMA 2F3JA 4IO1A 4EAHD 1KWMA 4FW2A 3NAEA 3W2WB 2W2NP 3PJWA 3GOIA 5MAOA 1HKAA 4ZKAA 1VSDA 1VBZA 2XMVA 4PKGA 3OS1A 2DYAA 4EP5A 2K06A 1KAXA 3W8GA 4CF1A 2JFDA 4AT1B 5KI6A 3JQMA 3MPWA 3PVXA 4K42A 1EETB 4ZTJA 1JLEB 3K7RA 2E1CA 3KLFA 3BO2A 3BY5A 4NZ0A 4H54A 4LF6F 2HBLA 2EW9A 2J6SA 4BGBA 4CF0A 4KHPK 5IS2A 3LO3A 3CJCA 3DXSX 4LIWA 1G4CA 3SMPA 2R4FA 3NNCA 2VOOA 2HSTA 1CLQA 3RB3A 4X64J 1GOAA 4XPCA 3VTHA 4YNQA 3FFKB 4H0YB 4ES1A 2HLTA 3TTFA 2ZITA 2WB4A 2LU1A 1FKOA 4N76A 2NNWA 4AF1A 2XTJP 2P9IA 2A6AA 1VQYA 3SQGA 4PQAA 3CVKA 4QQBA 2BM0A 4H5VA 3AT1B 2QFJA 5KT3A 2IAJB 1FA0A 4KB0A 3BZCA 3DYAB 2YV0X 4FCYA 3EDRB 5HRSA 3BO4A 5EGYA 2NPIA 2GGPB 1HBUB 1WEZA 4IFVB 4DR2K 1YK9A 3O3FA 3CCSS 5IT4A 3B4MA 3CJ8A 3VAMA 4QU7A 4PY5A 1MN7A 3QAUA 1VSEA 2ABYA 4OGEA 5FRMA 2BGGA 4LUBA 4Q7AA 5CABA 1Z6RA 3QSIA 4ZP9A 1J53A 3UKRA 5K14B 4IKFA 2IVOA 4R0JA 4W4MA 4CTAB 2JGUA 2YQ0A 2DKOB 2QRRA 5L1LA 3T1YF 4O3QA 4RCHA 1B70B 1SKWA 1X4HA 5B8HA 1NGBA 3OQ2A 3A0IX 1R0BG 4KTZA 4L72B 2BMBA 5KFLA 1YJNS 1CJVB 2HNZB 2W6LA 1YJ7A 5LL6Z 4FJ5A 4JB8B 2AKWB 3C7NA 4PA1A 1GLCG 3V6DB 1ATRA 2F96A 1EQYA 3PV8A 2FHJA 4CJTA 3TW0A 3A8YA 4W5RA 2DPNA 5LJ3Y 3GYNA 3ZCMA 2CJBA 4PG6A 1VDHA 1VQ6N 3QGIA 4HI1A 2XM3A 3NGZA 1E4GT 4GY2B 4ZVEA 2F4FA 1JCEA 5BR8K 3IGVA 4EO8A 1HPZA 2PC6A 2YKOA 2YCHA 3BYPA 3U4LA 4DSFA 5F0WA 2CXEA 5HL7Q 2W9CB 4YB5A 1B9DA 2ILZA 1N5YA 1SS6A 4EHTA 4CBUA 2QC3A 2LQ8A 4BVPA 3OLBA 2IY5B 3QYYA 1CLFA 4OI3A 2MMYA 3K9JA 4WP8A 5AXLA 3NBPA 3NNAA 5B0AA 5IT0A 4DR1F 2VDHA 4DFPA 4OLBA 4EBCA 4WTOB 4C8ZA 3VEWA 3LF0A 3WHIA 4EZ9A 4RPFA 5AQMA 1FXXA 3V9WA 3AXMA 3DJCA 5CHIA 3KTQA 5KG0A 3M8ZA 1E6VB 3I5CA 2EG2A 4HDHA 2NZCA 4J9RA 3AY9A 1RT1B 2XMJA 2AEJA 3ZNJ1 3DRSB 2EWHA 1K1QA 3WXMB 4A2AA 4PG4A 4NCGA 2JDJA 1BXNA 2MHNA 2ATLA 2MKYA 2GW8A 1T3VA 4JKCA 2VWBA 4IEIA 3CC2S 3CC4N 1H7WA 1KS2A 1ZAWA 2K2PA 1U1QA 1P90A 4ILLA 3VETA 3IAYA 4NWBA 5T7LB 2P1JA 2MKCA 2P9PA 4FJHA 4OJHA 4BY9C 4EFHA 2HBMA 2O8EA 2C3UA 4AQYF 1W7AA 2R9LA 2XMWA 5HROA 1RTDB 2RHQB 4H5TA 3PW4A 2GWJA 3OBYA 3CJTA 3FGVA 2P9KA 3DLGA 5EWEA 4DR7F 1YDLA 1TV6A 2XHWA 1MU2B 4FPAA 3JSBA 1KKHA 4KV8A 3HHEA 4DV5J 1NZ8A 1HKCA 3ZTRA 3M9NB 1X5TA 3QNWB 4M5GA 2B56A 2OPRB 1R59O 2P5GA 1WSRA 1H72C 2IS3A 2AEFA 3VAHA 4NOHA 4MO4A 4USTA 3EGZA 1BI4B 2PAVA 1NGJA 3QMLA 3K57A 2FLNA 3PZPA 3PJXA 2MZQA 4A8FA 4ZP8A 3AAQA 2GJFA 1R6YA 3VQBA 2F5GA 1NBWA 3AJ2A 3K9KA 4B9MA 5A8RB 5DQIA 1FF2A 3DLKB 1XNQJ 2AYEA 4YN3B 4LT6A 4NXNK 2XI2A 3HT0A 3PLAA 5BRFA 3CJ1A 1LWEB 3SQ4A 3AD8C 3I31A 2X78A 1CEZA 3C15B 4WCEL 1JKHA 3CJ0A 2NRHA 2CPJA 4EIAA 1KVKA 4ZVUB 2ZH2A 3MN6A 1FJGK 2KRBA 3A8JA 1BWVA 5C10A 1VSMA 4PABA 3V9UA 4ISGA 1QTMA 2B43A 3OTOK 2HQCA 5IFMA 5DM6Q 5HMZA 5LMNK 3T7ZA 1RWOB 3TAMA 4NMXA 3T5LA 3T1HJ 3MCAB 2QLJB 2F4VF 1RTZA 5L46A 1PILA 1HBNB 2O8DA 1XIQA 1ZPVA 2Z8QA 4BR4A 4E19A 1AXQA 1NMEB 3KLHA 4C7QA 1VSLA 4NLXA 5HP1A 3UNGC 3DGPA 5LT5A 1BQNB 4DR6F 2HMIA 1WLJA 3L2UA 2KFZA 5IXUA 2DH8A 4NCBA 2YNHA 2HNYB 3D9BA 2JEGA 3QDKA 4X2BA 4KO0A 4XIUA 3LP2B 4CGDA 1N88A 1I5OB 4FYDA 1X5OA 3THWB 1KEKA 3VQQA 1B0VA 3BGRA 2IDLA 2YKPA 2LFVA 1WACA 3IBCB 3G82A 4K25A 2KO1A 2OTLS 4I2QA 3PW2A 4W92B 3WIUA 3PRBA 1HR0J 4Y2KA 1YF5L 4FJJA 4KFBB 2O4GA 6FDRA 4F3QA 1O5JA 1YTAA 2EKYA 1I94K 3AAWB 3AVKA 2W4CA 3AQOA 4H0TB 5GVQA 2AA4A 3M8RA 3W3DA 5JJBA 3OUYB 3L2WA 5EHHA 2XWYA 3H40A 2X3DA 3PW0A 3ZEUB 8AT1B 4L3NA 4FF1A 5F8JA 1WEXA 2IVYA 2HHSA 4M42A 1RAEB 2EK1A 2CNKB 2BJDA 4BC7A 1SQGA 5I42B 3PR4A 3CTRA 1REVB 1JLBA 5ETQA 1X9SA 1RB0A 1NLKL 4ZPBA 3CSKA 3M3ZA 3SLCA 4CZKA 5LL6d 2D0BA 1N32K 4OYOA 3R5BA 1DQAA 2A2DA 3CCJS 3LH2S 1NBEB 4CYUA 3BN4A 3NGRA 4OZJA 3SAGA 1WHYA 2Z57B 4BR9A 1SPBP 4OQJA 4KHRA 1C6VA 4IUFA 4IG3A 3PKYA 5DO2A 1XR6A 3QNNA 4P2XA 1WBDA 4ED8A 3LZJA 4KSEB 2HKEA 4LQ9A 4NA1A 2F9WA 3Q8VA 1YTYA 3NNHA 2RH3A 3GIKA 3KUGA 2XS5A 1Y4ZB 1OH7A 3NAHA 1MN9A 2WVFA 5AQFA 4U96A 4PAAA 4BC2A 4K4VA 2IMWP 1P9YA 2KFYA 4OKKA 1PC5A 3SQOP 1SI9A 2BYCA 4OZLA 1B7FA 4DTPA 4ILJA 1U7LA 3MTKA 2FZCB 4PZVA 5DG9A 3IBWA 3LM9A 3F44A 2HRYA 4CZLA 3I0SA 3CDWA 3R5JB 4CEZA 1HNZJ 1TL1B 2ASLA 1K73O 3SQ0A 1Q18A 1FCAA 4OL8A 1N36F 2N82B 1WOQA 4FXDA 2JX2A 2GC8A 2H48B 4RZRA 3MX5A 1U6FA 3BR9A 4CBXA 3CGIA 2H54B 3SCKE 2KQ2A 1RBAA 5CY4A 4H0OA 3M8QA 4FKYA 4BE0A 1FNOA 1DARA 4IH7A 1N33J 2V34A 5CQGA 4OI4A 5I3QA 1KLNA 1NJZA 2HMPA 3M1VB 1T9UA 2B4PA 1OY6A 3RW6A 4QS9A 2YHBA 1U45A 1RTHB 2ZH7A 4TY8B 3F0NA 3FLCO 2KT5A 2O67A 3P5BP 2DNYA 2HHHK 3RMCA 2DIUA 5D4LA 1PGZA 3ZSYA 1VQ9N 4Q8EA 2CQ4A 3P5JA 4JI2J 5CHCB 3KLEA 3AJ1A 4DCJB 1WB9A 4ATNA 3AVFA 1IG9A 1SJ3P 1NOZA 3IAS9 2DB1A 5A8KA 3MM7B 1ULRA 2IJFA 2QLWA 3N6MA 1CQNA 2VC1A 2ACYA 3FEXB 3TARA 4WXOA 2KN4A 1PC4A 4I9QA 5KPZA 4DV3F 4IG0A 4MQ3A 4IDHA 1ZM3A 4P9SA 4M95A 3KHRA 4O8UA 5AXKA 2WB1D 2B9WA 1IR2A 3FFIA 4B9UA 1CBKA 1ILYA 2JOQA 3DOKA 1FDDA 2WW8A 3PW7A 3BBFA 3VVTA 2UUBJ 4FJGA 3RJMB 1RDBA 2A1BA 4XH5A 4PYDA 1FKPB 2QA4N 1R0AA 3MM9B 2Z56B 2JWKA 4F9OA 4LSNA 4YMEA 1GX5A 3IRXA 2BUNA 2BKNA 2MXYA 1RHKB 4X84A 2P51A 2W8LA 4RNFA 1KVJA 3OXLA 2UXDF 3F5TA 1D8ZA 3MXJA 1TK8A 4F36A 2FC0A 3O9UA 3R1HA 2DGUA 1TGOA 1S4EA 3PACA 1WSVA 3W61A 4YHHJ 4QIFA 1FD8A 4M3WA 4A57A 2C3PA 2JHEA 4N47A 1FK9A 4AHUA 1HNVA 1J5OB 4YB7A 4CEBA 1TVRA 2P9LA 1GMWD 5ETOA 4O3PA 1UVLA 4QCLA 5DRKA 4JK8A 4PQUA 4P7TA 3A1YG 3FE1A 4HKQA 4J2BA 3EMTA 1S6PB 3J7ZT 3C0BA 3C8YA 1VJWA 2BJEA 4U67Q 4ZCLA 3Q22A 1VHXA 1D9FA 1ZZFA 2R7XA 2IYGA 3T6JA 1S5JA 4ICLB 3R6GB 2FBVA 4IRCA 1YJWN 3VEXA 2DR9A 4Q44A 4ZLNA 3NGUA 3QIDA 1S77D 3KUHA 3EZWA 2HNDA 3MMVA 1AB8A 1ATNA 3CCLN 3S7RA 5J2PA 2OZSA 4PWDB 1YRUA 4DU8A 1NPKA 1HYSB 1ELOA 3CCEN 1J5EF 3MMAA 4JKGB 1V3ZA 2P6TA 3AA8A 4HT5A 5K8NA 2XBPA 4NLTA 4C23A 4DOZA 1A9NB 3C6UB 2MJUA 4JI4K 3IS9B 5KFJA 4LF6J 4B9QA 1QQNA 3H2VE 1YI2S 2RD5C 3C16A 4EWTA 1WG1A 5KG1A 4HUGA 3FMWA 1M1GA 4YOTA 3W1YC 3ZZUA 3WNHA 5ADZA 2N7YA 3CJ3A 3LAMA 1U1KA 1EQ0A 4HLBA 1X60A 2MZJA 4DR4F 1EZZB 4PKIA 3OFHA 4LR9A 3WNFA 3H2LA 3AVLA 4OYXA 2H3GX 3UIQA 2C3YA 1BWEA 4FVUA 1HARA 1RWWB 3ISNC 3NGSA 5AZJB 3OR2B 3H25A 1AFIA 1R8HA 3PM9A 5KFUA 3OJSA 4NASA 2CIMA 2QK9A 1RHRB 1C0UA 4KJIA 2UUAF 2XG8A 4B3SK 3ZFVA 1F9FA 3BP8A 1BA1A 2L48A 2O8FB 5KFXA 3V5RA 3C46A 3CWJA 3J80Y 4NX9A 4KAIA 3HLUA 4ILHA 3I55N 1HJRA 4HH1A 3DDNA 1G1XA 5SWMA 5ETMA 3KJFB 4R8UB 1URNA 5DM7L 4A8QA 1QAIA 4K5RA 2PO4A 3T1YJ 3HP6A 4JV5K 2OMLA 1M5SA 3H5UA 1HYVA 4CJUA 5CA5A 5DQGA 3WEEB 2F7VA 4CEFA 2NRXA 2CUYA 4DPYA 3MEDA 4DU7A 4OHVA 3V1QA 3P39A 3ZYYX 5B0EA 3PRDA 3IP0A 2WTFA 4AXJA 4ES3A 3CCES 4PPDA 3SSQA 4FF2A 4CI0B 3DLEA 1M0SA 3BUZB 1HBMB 4OMFG 2MGZA 3WC0A 1T03A 2PE8A 3AO5A 1VIXA 1S1UB 2P9UA 1YITS 2YQ3A 1VQKS 4MLEA 4JS5A 2QX0A 4RWTA 4F4KA 2DR6A 2HB5A 1S6QA 1Z26A 2HFOA 4OZ2A 3CIPA 4CLTA 3BS9A 1TYQB 4C2MA 2O4IA 1RKJA 2EPIA 2NZ4A 4LREA 3ENQA 3CJKA 3WX4A 4ALZA 3RR7A 1GXUA 3WDOA 3GZ7A 4CO3A 4B1VA 1JLQB 3OTBA 5EUHA 2WOMB 3I9ZA 3DXMA 2KZMA 4I6MA 5LOQA 1G99A 2AJ1A 3A5LC 1QZ6A 5HLFA 4U95A 1CJKA 1V3SA 4URQU 3T5HA 4HUFA 2HIQA 1TAUA 1BL3A 1TKTB 1L3KA 3LDQA 4V19X 4NEZA 1SIWB 4JI1F 3QQCD 4NLYA 1WSHA 5KFIA 1JL1A 4K41A 4ZVHA 2GIQA 3MDQA 4LF8K 4FLTA 1SKRA 1ROFA 3I55S 1RAHB 2ATCB 4M5MA 1FJ7A 3M6VA 4BR5A 3UB5A 4KBOA 4CFCA 4X4RA 2Q43A 2E5GA 3R5GA 3TAEA 1ZH5A 2MQPA 2GBZA 1GXLA 2W8KA 2OI2A 5AE1A 2OFHX 3NS6A 5C24A