3LP0A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
558
structure length
555
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
total genus 152
structure length 555
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp0A05
1U48A 3EPGA 4JLHA 1ZYQA 2BGGA 4NYNA 3O3HA 3LAKA 5J2MB 3BJYA 1N48A 3VQ5A 5KFHA 4Q8EA 4PY5A 5T14A 1HPZA 4KHQA 1KVCA 3DRSA 4KHWA 2WK4A 5JXSA 4K4VA 2C2EA 4NYFA 4CJFA 3PR4A 1VK0A 3OS2A 4CCHA 3ZSZA 3K5LA 1S49A 1TVRA 3P83D 3ITHB 1RDCA 1X9SA 2JC1A 4E7IA 3S9HA 1VSIA 4YMEA 3T1AA 4O55A 4CF8A 2HB5A 2F8TA 2BRLA 3IGNA 3M8SA 2XO7A 3KJVA 3DOKA 4B9VA 4CF2A 2DTUA 3KK1B 4CIEA 4EBDA 4I2QB 2WONA 3OS0A 1RA7A 2JEFA 2C2RA 4OKKA 3T5LA 4N5SA 1J5OA 5KFUA 1BL3A 4FBUA 3ISNC 3HM9A 4R5PA 4ECYA 2ATQA 3OSPA 4ZTJA 4IFYB 4CJPA 1TKDA 4DTPA 2G8WA 4ECRA 4FJ7A 4QWAA 3RMAA 3H40A 2O4GA 3AVBA 3VA0A 1RT4B 3DLBA 2YNFB 2HHXA 3S3MA 1JXLA 4EYIB 2ZE2B 3LP2B 4IG3A 3OHBA 3Q8QB 3RMBA 4ED3A 3OYKA 4M95A 1FK9A 3QLHA 4EO8A 4KTZA 3KIOA 2OPSA 1RTIB 3OYJA 4JS5A 2XRIA 4AHVA 5J1EA 3KHLA 5DQIA 3ZSRA 3D45A 3OHAA 4ZHRB 3V9XA 1RBSA 2PYJA 2W42A 4B3OA 4DF8A 1RA6A 2HHSA 3PHEA 2HHTA 3ZT1A 5KGXA 4DTOA 5JUMA 4F4WA 3VQQA 4K4YA 4KHNA 4CJWA 3PJWA 4CK3A 3SPYA 1BQMB 2E4LA 2E6MA 1Z4UA 5K14A 1CZBA 1TGOA 1KVAA 4KHMA 3V1RA 1TKZB 3DM2B 5HP1A 5CYMA 1HNVA 3DLGB 1BI4B 1RDAA 1UAXA 1HQUA 4RW9B 1NK4A 5KG2A 4CEDA 1L5UA 1S6QA 4QAGA 4B08A 4DTUA 2HHQA 5CZ2A 2RDJA 4RUCA 4CEBA 3QZ7A 4ZPDA 2JEIA 3DLEB 3PW5A 4I7FA 3HPGA 3GIJA 5KFBA 1S6PA 1KSPA 1K1QA 4MKBA 1SKRA 3KKSA 4FJHA 1A5WA 3PX4A 3V1OA 3NAIA 4J9KA 2DFHA 4RG8A 3ZSWA 3IS9B 3HPOA 4RW7B 2RPIA 2YNHA 3OL7A 1JLFB 4MQ3A 2XCAA 3ZSOA 5L1JA 2WOMB 1HRHA 4IFVB 3SNNA 1QHTA 1X9MA 5C24A 2R2TA 4FJKA 2HHUA 1A5VA 2G8IA 5D3GA 3H5XA 4BE2A 2HW3A 1RT1A 2HHVA 3UQSA 5KFSA 3LP0B 2RF2A 4OKJA 1S9GA 4FK4A 2DY4A 4DF4A 1UOCA 3G86A 1S10A 5J2MA 4JRPA 4TLRA 1YTUA 4ECUA 4FK0A 5DLFA 4NLOA 4AHTA 3EY1A 2RN2A 4AHUA 2X74A 4FLTA 2AX1A 2EHGA 2FC0A 3ITHA 2C2DA 4ZP9A 2IS3A 1KTQA 1TK5A 1S1UB 4JUZA 4MK9A 2BANB 1S0OA 4KFBB 1NJWA 1JL2A 1VSLA 2ZD1B 3NFAA 1QUVA 1BCOA 2I1RA 3BR9A 2QE5A 4ZVFA 3KK1A 3RB0A 2JEJA 4I2QA 2YNGA 4DTMA 4E7JA 4BDPA 1C0TB 4E7HA 1QS4A 3PR5B 3G6XA 1JLGB 3RAQA 1DTQB 5HRNA 4G1QB 1OS5A 3I0SB 2G8FA 1O1WA 3K59A 3NHGA 3TARA 3K2PA 2GBZA 4O4RA 2GV9A 3RR7A 2Z1JA 3AVNA 4CJ4A 4FLXA 3BGRA 3GV8B 4C8NA 4CK1A 2Z1HA 4WZQA 3KLEB 2IM2A 1RT4A 3PO5A 4B9TA 3G6YA 2YNFA 3CO9A 1T05B 3AO4A 3LP2A 5KI6A 2UUTA 3C94A 3THVA 2ETJA 1RTIA 3KHGA 1BGXT 2F96A 2FBYA 4CEZA 3RB4A 1RBRA 2QKBA 1LAWA 1RDRA 5T7BA 4ZHRA 2W9AA 4IQXA 3OYNA 2XHBA 4K4UA 2I5JB 1S4FA 5J2PB 4CJEA 3OJUA 1G15A 1XC9A 2B43A 2O5DA 1FXXA 5EUHA 4RNNA 4DL5A 2OYQA 3V1QA 3KMQA 1KHVA 1FKPB 1LWFB 4XO0A 1XR7A 1BQMA 4QWCA 3MAQA 3L3VA 3CJ2A 4RW6A 1TKXB 5DK5A 1TKZA 3DM2A 2WONB 1HMVB 1R0AB 2KZZA 3KK3B 4CJRA 3DLGA 1BI4A 4CJQA 4RW9A 5DQHA 1Q9XA 1ZBUA 2XCPA 1I39A 1NK8A 4FJJA 3SUNA 1Q9YA 4IH7A 4YQWA 4FM0A 3QEWA 4QOZB 4AHSA 3NKYA 1C0UB 4FYDA 4FM2A 4HUGA 3ZSXA 3NGYA 1ZBIA 3DLEA 4IR9A 3AO3A 1NK5A 4IG0B 2D0AA 2WTFA 2HAIA 1RTHB 3LP1A 1D8YA 3NDKA 4O3RA 2Y1IA 3OYAA 1TKTB 2IM0A 4CEQA 1J53A 1F21A 4TYBA 3SQ1A 4TN2A 4ZP7A 3IS9A 4RW7A 2YNIB 3S3OA 4KREA 4DSEA 1FK9B 4LY7A 3U6FA 1RT5B 3OYMA 5KFIA 1WNSA 3AA4A 3KTQA 3OYHA 2ASDA 3GILA 2E6LA 5KGWA 1KRPA 3KLIB 1C6VA 2WOMA 4CHQA 1HNIB 4Y3CA 2D41A 4RNOA 4K50A 4HKQA 5KFMA 4OJRA 4IKAA 3C6TB 4OLAA 2G8VA 4IBNA 4ELVA 4K4SA 3LP0A 3NF9A 1L3TA 4WFYA 3IRXA 3ICLA 2XY8A 4LQ9A 1QQCA 4W5QA 4QW9A 1HQUB 3CM6A 3K58A 2ZKUA 4DTXA 2AX0A 3PJXA 3I5BA 4KTWA 3HO1A 4CGIA 4CFBA 1TL1B 4F4ZA 3KKRA 2ILZA 4XPEA 1IKVB 5KG6A 3UPFA 3MECB 5FROA 4NLXA 2VG5B 4MH8A 4E7LA 1S1UA 2BANA 1WSEA 3NF7A 4ZVEA 3ZCMA 2WCXA 3LPTA 4QW8A 2NUBA 4BWJA 4F4KA 4CJTA 3PO4A 4HCCA 3HP6A 2OH2A 5JS1A 3S3NA 3O4NA 1GOCA 4YP3A 4L8RB 3PX6A 3Q8RB 1C0TA 3KK2B 2KZMA 5KFTA 4K8ZA 4IDKB 5HRSA 1JLGA 1N5YB 4WE1B 1DTQA 4NCAA 4G1QA 3I0SA 2X78A 4JRQA 3GV5B 4DS5A 2JLEA 4K4XA 4CJKA 1QE1B 2J6UA 3NH2A 5DGAA 2YHBA 1WSHA 4DMNA 2R2UA 3VN5A 3KLEA 3AVCA 4HTUA 1RDDA 2B4JA 1T05A 4FLWA 4IR1A 2XI2A 1UA1A 1IG9A 4RW4B 4ID1A 5HBMB 3QGGA 5KFWA 2R2SA 1WLJA 1S9GB 4DFKA 4BDZA 1RAJA 3DDKA 4E19A 3JYTB 4QWEA 3RRHA 1GOAA 2IGIA 1SH3A 5KFPA 5EDWA 3V6HA 1ZBFA 2IDOA 2CJQA 1C2PA 4FCYA 3DOLB 2XY6A 1REVB 1YVFA 3QEPA 3D5MA 2I5JA 5J2PA 4CHZA 4OGEA 4ED0A 4HHTA 5F9LA 4ELTA 3QIPB 4ID5B 1D1UA 4F4XA 4NZ0A 1S0NA 2DFFA 4YR0A 4FK2A 4MKAA 4X2BA 3A2FA 1FKPA 1W0HA 1LWFA 4DSLA 1ZTWA 3TAPA 3HVAA 2XGPA 1TKXA 4KHYA 2YNGB 1HMVA 2R7YA 1R0AA 1NJZA 3KK3A 1RBUA 4M3ZA 4K8XA 4FZZA 3BQ2A 2XWYA 2IJNA 1T8EA 3KHRA 2GIRA 5L1KA 1D0EA 5CYQB 4K4WA 4DL4A 3RMDA 4FW1A 4KI6A 1C0UA 4GVMA 4BDYA 1T03B 1D9FA 3H98A 4Q44A 1HARA 3AO2A 4WYLA 3T5HA 1LW2B 4Z4IA 3BGRB 1TK8A 3OYEA 4CGDA 3GIMA 4IG0A 4YR3A 3N6MA 4J9QA 4KBIA 1EKEA 3CFPA 4Z4GA 5KG3A 2OA8A 1RTHA 4FLYA 3CDEA 4J9MA 2JEGA 2DFEA 1RTJB 4KHRA 1W9HA 1TKTA 3WNGA 3UIQA 5J2QB 1TL3A 3M9OB 4DS4A 2YNIA 3EYZA 1NOYA 4EO6A 3NH0A 2D3UA 4NLWA 1RT7B 1S48A 3O3FA 5KFYA 1RT5A 4ICLB 3VQCA 1QSSA 2FBVA 5DGBA 4NLRA 3C6UB 2R2RA 4ZTFA 2OPPB 4IH6A 1VRTB 2LSNA 3V4IB 3KLIA 4ECWA 4TYAA 1HNIA 1N4LA 2A1SA 5KFCA 4RNHA 3T3FA 4LD0A 1IKWB 1S1TB 4DG1B 1LWCA 3SV4A 1TK0A 1K6YA 4DLEA 3NGIA 2FJVA 2VG7B 3C6TA 3SFUA 1K1SA 4Z4HA 2W9BB 2E9RX 4C8MA 3CJ5A 5E41A 4RW6B 4CJ5A 2F8SA 5EWGA 3TABA 1UA0A 1SH0A 4NLQA 5KG1A 1EXQA 2ATLA 4U6PA 3MR3A 4R8UB 4GC6A 1YVUA 2R8IA 5FRMA 4CGFA 4F3TA 4FJMA 4O3PA 3I8DA 3GYNA 4ECQA 1XR6A 1FKOB 3SUOA 1TL1A 3D28A 1KCFA 4DSFA 3PVXA 4RW8A 3RBDA 1IKVA 3MECA 1XHXA 2VG5A 4H4OB 2D5RA 4Q43A 2R8KA 1SUQB 1ZTTA 2HMIA 4PUOB 2IM1A 3LP1B 3L3UA 2IAJB 3OYLA 5SWMA 1JLBB 2W8LA 4HVJA 1QSLA 2AQ4A 3KK2A 3QZ8A 4JV1A 4CIFA 1C1BA 4IDKA 2KW4A 1N5YA 4WE1A 3NGDA 3IN5A 1C0MA 1TV6B 3C95A 4FVMA 3OS1A 3KD1E 1NNDA 4Z0UA 3DLRA 4J9LA 3AVAA 3QEXA 4FLUA 4FJ8A 1QE1A 3RB6A 3SQ2A 2AGQA 3IAYA 1CZ9A 4GW6A 4DTSA 4J2BA 3QYYA 4FBTA 1WSIA 2OZMA 1DLOB 4NCGA 4W5NA 3HVTA 4M3WA 3H5SA 2UVUA 3SUPA 3VQAA 1HJRA 4RW4A 5HBMA 2OPQB 3QNNA 4DWIA 4KE5A 1QAJA 1KLMB 3TAFA 4DSIA 4B9SA 1MU2B 3SYZA 2ITGA 4CHPA 3IRXB 5F9NA 3JYTA 4Y1DA 3T5JA 5DLGA 5C5JA 3QEVA 1WN7A 3Q8PB 3K5NA 4URGA 3DOLA 5KFXA 4O3SA 2UUWA 1REVA 1CLQA 1WSGA 3KOAA 1W25A 3I5CA 4AHCA 4F2RA 4KAIA 1RT3B 5FRNA 5J2NB 3QIPA 4NLDA 4ID5A 3LWMA 3E01B 4DFMA 2B5JB 4CF0A 3HJFA 4FJLA 3V6KA 4B8CA 4ED6A 1EP4A 4DQPA 4OLBA 1VSHA 1RTDB 4ECTA 3TWHA 1KFSA 2OZSA 2KFZA 2V4RA 4FW2A 4FZYA 4DU1A 3V9SA 4R0EA 2XGQA 3ZSQA 4M3UA 1GOBA 4LSLB 5CYQA 2FLNA 3GIKA 3NBPA 3OY9A 4MIAA 2FVRA 3FSIA 2YKNB 1SH2A 4CESA 4ZP8A 1T03A 2BRKA 3N6LA 1NHVA 2ZQBA 1LW2A 4QPXA 3OLAA 3CJ4A 3OLBA 3CG7A 1U45A 4FJGA 1Q8IA 5KG4A 4N41A 4FJXA 1YTAA 2RKIB 4K4ZA 3RAXA 4AILC 1RTJA 1S1WB 2C28A 1JLAB 4NLYA 1J9AA 4B9LA 5J2QA 1JLCB 3TAEA 4FJ5A 4FXDA 2CKWA 2B6AB 3RTVA 3I0RB 4LQ3A 3MTKA 1RT7A 3UDLA 3SZ2A 4ICLA 4N47A 4YNQA 2PYLA 2KFNA 3WNEA 3TVKA 3E51A 3C6UA 1XWLA 4CF9A 3M8QA 2OPPA 1VRTA 3B6PA 3V4IA 4Z4CA 2P5GA 3PZPA 1IKWA 5DQGA 1S1TA 4DG1A 2RDIA 4IOBA 2VG7A 1KVBA 3OYFA 4KI4A 3QESA 2W9BA 2R8HA 2AWZA 1TQLA 4MFBB 2YKMB 1N56A 3K57A 4KKOB 3NF6A 3V9ZA 3MXIA 1EX4A 3MEGA 2P5OA 4TQSA 4N56A 1GX5A 4C8KA 4R8UA 4URQU 3V9UA 4I2PB 1CXUA 1FKOA 3AA3A 3HSTB 3AVMA 5KT7A 3QIOA 4E0DA 3CDWA 4NRUA 2FLLA 1T3NA 4ED2A 2KQ2A 3D0PA 4TY9A 4H4OA 5F8MA 4DLGA 2XY5A 3ZSYA 1JXEA 1SUQA 4RU9A 2J6SA 3MR5A 3KLHB 4Z4EA 3O3GA 2V0NA 1VSKA 4PUOA 2IAJA 1BIUA 4ED7A 4M3RA 4Q0BB 4Q8FA 4CJLA 1JLBA 1JLQA 2GC8A 3TAQA 3NAEA 1TAUA 1S5JA 1QSYA 3SUQA 1RILA 4TY8A 4DU4A 4DEZA 1TL3B 4KAZA 3QEIA 4LH5A 5KT3A 1TV6A 2X6SA 4E1NA 2D0CA 3V9WA 4QCLA 4KHSA 3GV7B 5KT2A 1JLEA 4I9LA 5SZTA 3BQ1A 4F2SA 3IG1B 3OYBA 3L2WA 1LWCB 1DLOA 1U09A 1BQNB 3ULDA 2VG6B 3VQ9A 4DL2A 2AJQA 2OPQA 3BREA 3SQ4A 2P51A 1KLMA 3BQ0A 1VSDA 3DLKB 3QO9B 1MU2A 5F8LA 3OYIA 1LW0B 1XR5A 2G8HA 1U4BA 4Q45A 3AVJA 3CVKA 4EBCA 2XY7A 4O4GA 3CM5A 1D9DA 2J6TA 3SCXA 3CFRA 2E9TA 3PV8A 3PY8A 3O4QA 4DQRA 2IJFA 4O0IA 2UVVA 1RT3A 4RW8B 4RNMA 3MR6A 1RNHA 4CHNA 5KRTA 5J2NA 2G8UA 3FQLA 3E01A 2B5JA 2IM3A 3G6VA 2HMIB 3VA3A 3VQ6A 3L2UA 3TAGA 4NLPA 3L2VA 1RTDA 3OYGA 4YR2A 3AO1A 4O44B 2W7OA 4DL6A 1NK7A 1T94A 4ECXA 1JXBA 4K4TA 1C1BB 3PW7A 3VQ8A 2FJWA 3DYAB 4NLUA 3H4DA 4LSLA 5KFLA 5KT4A 3V81B 3AO5A 1EETA 2YKNA 1RBVA 4URSA 3NF8A 3GIIA 2FVQA 3NCIA 3AA2A 4DQIA 5HROA 1S97A 4B8AB 5FDLA 4NCGB 3HVTB 3FFIB 2RKIA 5KFEA 5C42A 1S1WA 4J9PA 1JLAA 3H5YA 1LWEB 1BISA 1JLCA 2Q3SA 2B6AA 3H2LA 3ZT2A 3I0RA 4M45A 3M9MB 3PW2A 3DMJA 2XC9A 1WSFA 3M8RA 5F8GA 4M3YA 1IO2A 1QTMA 3OL8A 4CERA 1RT2B 3B6OA 1JL1A 4CECA 3ZSVA 4KO0B 3DI6A 3EZUA 4IRKA 3U3YA 3OSNA 2QK9A 4CFCA 3SI8A 4KB7A 2W8KA 3Q8SB 4HUEA 4HUFA 1JX4A 4TXSA 3MFIA 4BACA 1EP4B 1KFDA 4DFJA 4MFBA 2YKMA 2IBKA 1A5XA 4ECVA 4KKOA 4ZVHA 4UQGA 4WFZA 5F8IA 3MEEB 4WXOA 1B9FA 2VA2A 3F73A 4NYZA 5DG7A 4NLVA 1HQEB 2JC0A 3H4BA 4AH9A 4KV8B 3NBPB 5L1LA 1S1VB 4I2PA 4NRTA 3LZJA 4LSNB 1Y97A 4TSXA 1NKCA 2IC3B 3MEDB 3OYCA 3QINA 4DFPA 5KG7A 2HNYB 4MIBA 3MXMA 5EWFA 3EZ5A 3KLHA 4DTRA 3QETA 2AU0A 4W5OA 2HWIA 4Q0BA 5KFNA 4CJUA 3QGHA 3ASMA 3ALYA 4OPJA 1UWBB 3CWJA 5KT6A 1CXQA 1IKXB 4FJ9A 5KTQA 4OKEA 3P1GA 2R8GA 4FLZA 4RUAA 5DMRA 4E7KA 3TQ1A 2FVCA 3EPIA 2BR0A 3AVLA 1HYSB 1SL0A 4ZP6A 3M8QB 4KHUA 3LZIA 4IH5A 2D0BA 2VWJA 2JGUA 3TI0A 1Z26A 4G3IA 2DPJA 3IG1A 4DTJA 4CJVA 1X9WA 1S1XA 3AVKA 5L9XA 3DRRB 4H54A 4Y1CA 1BQNA 5I3UB 2VG6A 2BDPA 4PQUB 5KG5A 1NK0A 2R8JA 3LDSA 3PW0A 1N6QB 2BQUA 3DLKA 3QO9A 2QV6A 5HRRA 4O0JA 3VQEA 3UR0A 2D3ZA 3P5JA 4DQSA 4ED1A 1RT6B 4CGHA 2HNZB 1LW0A 1X1PA 3MEGB 3SQ0A 3T19A 2WRMA 1S9EB 5KFVA 4XPCA 1C1CA 2VA3A 1ZBLA 3HHKA 2GUIA 4ED8A 1WSJA 5C25B 3RRGA 4RZRA 2YHAA 5I42B 5HLFB 4J2EA 3MFHA 1VSMA 4J9RA 3MR2A 1C1AA 3V6JA 4NLGA 3MF5A 3HL8A 5KFRA 2BQ3A 1JLQB 2UVWA 2PY5A 4O44A 4Z4FA 4TY8B 1RDBA 4H4MB 4EYHB 3QNOA 3VQ7A 3DYAA 1ASVA 1L3SA 4NLSA 3CDUA 1B92A 4CGJA 3V81A 5L1IA 3NMAA 3KLFB 1TAQA 4C8LA 2BE2A 3DLHA 3M8PA 3WNFA 3QERA 1JKHB 1I6JA 3HVWA 3I5AA 4U7CA 1JLEB 4CEEA 1U47A 1LV5A 5KFDA 4AHRA 3FFIA 4CK2A 3V6DB 1SKSA 1HYVA 3ZT4A 4ECSA 4KPYA 1DTTB 4J9NA 2FJXA 4ZPCA 4MK8A 3HYFA 1LWEA 1JIHA 1SV5B 3SV3A 4CF1A 1IKYB 3NGZA 5F8NA 3QIDA 4YFUA 2ALZA 4DL7A 1NOZA 3L2RA 5KT5A 4NCBA 2HNDB 4O4GB 2W9CB 3ISND 1RT2A 3SI6A 3M9NB 4CJ3A 1HYZA 3HP9A 5F8HA 4KO0A 1VSJA 4HCBA 3CFOA 4JV0A 1VRUB 4OL8A 4DSJA 3SFGA 4ECZA 2W7PA 3WNHA 3TAMB 2EC0A 2OPRB 2IA6A 3T5KA 3IGVA 2FVSA 3NE6A 2Z1IA 1WAJA 1I3AA 3G0ZA 4ZPBA 3OL6A 4F4YA 4OVLA 2XI3A 4O3QA 4W5RA 3MEEA 2FBTA 3L8BA 3FQKA 1U04A 1SKWA 3KNAA 2KTQA 1HQEA 5DG9A 4CGGA 3RBEA 2DPIA 4B9MA 5KRSA 3OYDA 1KLNA 1NJXA 4KV8A 1S1VA 4E89A 2QKKA 3KLGB 3NAHA 3K5OA 1EETB 4LSNA 4M3XA 1MMLA 3VQBA 2IC3A 5KFKA 5KFOA 3BDPA 3MEDA 4H8KA 4WFXA 4PWDB 2AGOA 2HNYA 3CYMA 4EP5A 4N76A 5HROB 3BSAA 5FDLB 3KD5E 3H59A 4OGCA 4W5TA 3CQ8A 3RMCA 5C42B 3TR8A 3RWUA 2Z1GA 4IFYA 1KHWA 3NL0A 5CZ1A 4OPKA 4F8RA 4NLTA 1UWBA 3L2QA 3DRPB 3PW4A 4JV2A 1IKXA 3H5UA 3PUFA 4FJNA 1S9FA 3LALA 3AVGA 1L3VA 1WNEA 3LP3A 2A1RA 3DMJB 4Y2CA 1J54A 1HYSA 3JSMB 1NKEA 2V4QA 4FS2A 4O5BA 4WYWA 1ZBHA 5KFGA 3FRZA 3OVNA 3VQSA 2ZE2A 3DI6B 4DSKA 1ASUA 1LAVA 2HHWA 1U49A 4QWDA 3DRRA 5I3UA 1D5AA 4F3OA 2ASLA 5EWEA 4Y34A 4PQUA 4CE9A 1HPZB 3DRSB 4GC7A 3HT3A 3QGIA 4DL3A 4J2AA 4IKFA 4RNFA 1N6QA 4IRDA 1RT6A 4EZ9A 1TVRB 2HNZA 4MK7A 4E3SA 1IH7A 1VSFA 4BWMA 1GX6A 3AV9A 2AGPA 3ZT3A 3HK2A 2WHOA 1ZETA 2G8KA 4O3NA 4J9SA 1S9EA 4CEOA 3KJVB 3DOKB 2Y1JA 3BSOA 4Q5VA 2GIQA 3CJ0A 5C25A 1BHLA 2PZSA 5I42A 5HLFA 3BSCA 4ZMMA 1RCHA 3H08A 4IRCA 1J5OB 2FBXA 4KB0A 1SL2A 2FVPA 4BE1A 4EZ6A 3LANA 1NJYA 4R5PB 3KHHA 4WZMA 4B9UA 4B9NA 3U3GA 4H4MA 5F8JA 3RB3A 4CJSA 2C22A 5JS2A 3HXMA 4FJIA 3KLFA 3CIZA 1WAFA 5EU7A 2WB4A 2X6NA 1JKHA 2VWKA 3N6NA 4FLVA 5DG8A 4EP4A 4DQQA 2ILYA 4IG3B 4C8OA 2BQRA 4F50A 3LPUA 4QWBA 3RR8A 3BSNA 2D7SA 3QLHB 1S1XB 5HRPA 4M3TA 3KMSA 2OPSB 1JLFA 1ITGA 3TANA 3V6DA 1BIZA 4LH4A 4BE0A 5J1EB 3F9KA 4ZPAA 1RYRA 4CFAA 1XI1A 3AVHA 3VQ4A 1DTTA 4KRFA 4CEAA 1SV5A 4O3OA 3SJJA 3AVFA 1IKYA 1L3UA 2O4IA 4XIUA 4IFVA 3HPHA 4B3OB 3MXJA 1T7PA 4FZXC 4ZVGA 2HWHA 4DU3A 2HNDA 2W9CA 5KFQA 3G10A 1YT3A 2P1JA 4FS1A 3OJSA 3AVIA 1B9DA 4J2DA 1C1CB 1VRUA 5K14B 3NH1A 4CHYA 4Y2AA 1RBTA 4M41A 3VQDA 4CFDA 3TAMA 5HP1B 4DTNA 2OPRA 5CYMB 1HNVB 3SPZA 4KB1A 4J9OA 4ELUA 4EEYA 4M42A 1S6QB 4TQRA 3GQCA 4I9QA 1NK9A 1VSEA 3PX0A 3OL9A 5KFZA 2IMWP 3HVRA 5KFFA 1NHUA 5KG0A 1CSJA 2YV0X 4KSEB 2QXFA 4I7FB 4KFBA 1S6PB 1ASWA 2ZD1A 2BE2B 1Z25A 4HYKA 3M8PB 3KLGA 4M94A 4WXWA 4GMJB 4FM1A 3K5MA 3AA5X 4PA1A 4PWDA 2F8EX 2YNHB 3VQPA 2FLPA 1BCMA 5CY4A 3FDSA 2EX3A 3HKWA 2HVIA 5KFJA 1S0MA 4EBEA 3DRPA 4CIGA 2E9ZA 3LWLA 5C24B 4JS4A 1SL1A 1NK6A 1NKBA 3CJ3A 5D3GB 3ZT0A 1RYSA 2ASJA 5KFAA 1TP7A 3JSMA 1RT1B 4KTQA 1IM4A 1QAIA 1XHZA 2V9WA 4CHOA 2IOCA 2UVRA 2RF2B 3LAMA 4CEFA 2HVHA 3KLVA 4E1MA
chains in the Genus database with same CATH superfamily
3EPGA 4J37A 3IRWP 2BGGA 1VQ6S 3UN2A 1U8SA 5KFHA 4Q8EA 5T41A 4PY5A 2GGPA 2WBRA 3OT9A 4KHQA 4H0OA 2UXBK 2LLZA 3DRSA 5IQ6A 4YOTA 4K4VA 4YDUA 1I94J 4IO1A 3PR4A 2HEKA 4CCHA 3ZSZA 3OXLA 2MY8A 3G8SA 3TX0A 2RS2A 2JC1A 4E7IA 2CXEA 1VSIA 2HB5A 4JYAJ 1NLVA 4ZIWA 3KK1B 4EBDA 1RA7A 4EU0A 2ZM6K 5B0GA 1X0FA 1N5TA 1Q81O 4FBUA 3ISNC 3HM9A 4R5PA 4DDFA 2DJWA 3HI0A 2FSNA 4DTPA 1RFQA 4BRKA 2DNLA 3H40A 4FN5A 3VA0A 4LJMA 2J0SD 2YNFB 1P1LA 4JHDA 4J7CA 4HL9A 1JXLA 5LJWA 4CLZA 4MLHA 4RUHA 2ZE2B 3LP2B 3KYLA 4IQMA 2R7TA 5E3AA 4ED3A 1P27B 4Y28C 3QLHA 4EO8A 3KIOA 1UJ6A 3SMPA 1TUYA 3OYJA 4JS5A 2QFJA 4AHVA 2MKYA 5J1EA 4QU7A 3OHAA 2BYCA 1E6VA 1S7HA 1BO5O 3UCGA 1RBSA 2MPUA 3LM2A 2PYJA 3H20A 4B3OA 4PG7A 3IO1A 2CJAA 1NRKA 1CULB 4OYMA 1OH8A 5H9FJ 4F4WA 4KHNA 2LCWA 4H4KA 2LVWA 4K0KJ 1AFJA 4IUFA 3CCEN 5FPEA 1RISA 3DM2B 1M5SA 4DUZK 1X3NA 1RDAA 1UAXA 1BUPA 2QA4G 4NXNJ 2I6WA 1QQNA 2ASMA 5GADP 2HHQA 2RDJA 1KWMA 1MROB 4V19J 4RUCA 1HWKA 1Y3JA 1WKKA 2H3EB 3QPIA 4CJ7A 1IBMF 3NXZA 4EAHD 4QBUA 1K1QA 5LM7E 4MKBA 2EFPA 2RQ4A 1O6XA 1A5WA 3MURP 2O8DA 1YRUA 4YHHJ 4J9KA 1CBKA 2RD5C 3CEDA 4FWMA 2KB2A 3HPOA 4M5NA 2ZJRL 2KXHA 4P52A 1FDBA 1VHXA 4PRFA 1PIEA 1JLFB 1FXLA 3LA0A 5HO4A 2QG9B 1DQ9A 3MCSA 1XNRK 3THPA 3ZSOA 5E0OA 4AD6A 1X9MA 3SNNA 2R2TA 1K0TA 1T3VA 3LW5C 4F3MA 3I56S 2VFVA 3U9ZA 3H5XA 2YX1A 3CCRS 4A61A 1RT1A 3S6EA 2HHVA 3PCOB 3CJ7A 2W2OP 1KD1T 4RBUA 2RE1A 5T7LB 1HX1A 3G86A 3EVOA 1CQNA 1NO8A 1YTUA 4ECUA 4NLOA 2RN2A 4ETXA 4X4NA 3AARA 4WQ4C 4FLTA 3GYGA 4DR1F 4I68A 2FC0A 2C2DA 4ZP9A 1N5VA 2IS3A 3VEOA 1P9YA 3C3LA 2RT3A 1WKLA 5E3CA 1TELA 3KJNB 2YHYA 3CC2N 3BKFA 2I1RA 2M8DB 2N4DA 3RB0A 2YNGA 3P45B 4WCEQ 1OSDA 3VGVA 1R6YA 1UKUA 1TR0A 3ZZYA 3U1LA 4MYUA 1SPBP 3TZWA 2G8FA 3AA8A 4U9RA 4LF4K 3K59A 4YORA 3TARA 5LOQA 3GWCA 3VGMA 2ZVSA 2Z1JA 2YWGA 3AVNA 1R8PA 3W66A 2HWTA 1H98A 3BBFA 2IM2A 4OI1A 3PO5A 3OR1A 3WZ0A 3CO9A 4DCHA 3VWSA 3GCXP 2PA8D 2DNPA 4RPFA 4A8KA 4JI7K 2QC3A 3A8JA 5KI6A 1M5HA 3DWLA 3I9V9 1PYTA 3THVA 4U8VA 5AQSA 2CQ4A 1RBRA 1RDRA 2CJKA 4ZHRA 4C3MA 1RWNB 1FE0A 2XHBA 1LK5A 2I5JB 4CJEA 5H9EJ 2W7AA 1XC9A 1G15A 3NGKA 4IXCA 3BKUA 3NS6A 5G0RA 2HSTA 3CCJN 4RNNA 4C8YA 5EN1A 1KHVA 3G2XA 3OXGA 4QWCA 4DV0K 2P9IB 4NZ6A 2B4VA 4CLTA 1TKXB 5DK5A 5DS7A 2ZUGA 2WONB 1U8WA 4I67A 3OVBA 3KK3B 2XS7A 1G2EA 1BI4A 3MWPA 4RW9A 3UE2A 1Q9XA 3VGUA 4A48A 2CQ1A 1Q9YA 4IH7A 4YQWA 4AHSA 1C0UB 4BG8A 1DQAA 1F2HA 5AJ3F 2QWOA 1R8CA 3DLEA 4JI6J 1H0HB 3MM9B 3D2EB 3FZKA 1RTHB 1TU0B 1FFGB 4FWQA 3QB0A 1HBOB 4B1ZA 3U27A 4B3RJ 3WHIA 3AY9A 2HIYA 2IM0A 2UXCF 1FEHA 4TYBA 1FW6A 3AY0A 2LFVA 3EXYA 3HJVA 4RW7A 4X4TA 4A8QA 2ZH4A 4KREA 4GKKK 3ADAC 3HHDA 1RT5B 3OYMA 2ZHAA 1ZAVA 1ICEB 5KFIA 3KTQA 1WNSA 3OYHA 3DGPA 3CCSS 4BC9A 4CHQA 2O67A 3MDFA 1HNIB 4Y3CA 2ZWOA 1FNMA 4IKAA 2K1RB 3MN6A 2CPFA 5HMYA 5AQZA 1H72C 4IBNA 4ELVA 3LP0A 3A1YG 3D66A 1L3TA 2AF6A 2MHNA 2NSBA 2WW8A 1FFWB 3W3SA 5A8RA 4W5QA 4QW9A 4DKWA 3W1YC 3CM6A 4AXIA 3F2KA 1HNZF 1M90T 1YZ7A 3I5BA 2HS3A 4S0MA 2GUPA 3GG4A 4M5KA 5FIIA 4RTFD 1IKVB 3BP8A 1M0SA 2VG5B 4E7LA 3BH6B 1QJHA 4JI4J 1R8HA 4ZVEA 4HCCA 2BJ8A 2E5LF 2AJ2A 3BEXA 2XM3A 3E3XA 4OX8A 1VQON 2UP1A 1SQKA 1U1PA 4DR5F 1XJWB 5KFTA 4K8ZA 3KUHA 1U0HA 4IDKB 5HRSA 1RI7A 2A6MA 1JLGA 2M52A 4WE1B 1DTQA 1Y7PA 4K8RA 4K41A 3I0SA 4B9QA 4DS5A 1LOUA 2R7SA 2Q97A 4K4XA 2GHPA 6AT1B 1YDLA 2Q43A 2AJ1A 3NH2A 5DGAA 1WSHA 5AE2A 2DGUA 3MM6A 1CJTA 4EK2A 4FVUA 3H1QA 1NU4A 2B4JA 1T05A 2EK1A 2A10A 4NA1A 2V6AA 2GS8A 1F0XA 1EO1A 5M2RA 1Q4RA 3U7JA 2D4WA 2OANA 4DFKA 4CO4A 3D6HB 2X7IA 4QWEA 1NB2A 2NXNA 3DXMB 5KFPA 5JVGQ 5EDWA 5B7WA 1SJQA 5DDRC 2NNWA 4FCYA 3H90A 4ZVPB 1HPMA 1REVB 4YB5A 2BABA 3QEPA 5AQLA 5I3QA 3I82A 1XNQK 3AD7C 4F4XA 4OX9F 1S0NA 4FK2A 4MKAA 1VC6A 1VLOA 3A2FA 1FKPA 2FQQB 4DSLA 2YKOA 4FO0A 2DR5A 4KIAA 4KHYA 3CCMS 1NJZA 4H0VB 4DV1K 1RBUA 3SJHA 2GIRA 5L1KA 5CYQB 3T6JA 2XMWA 3W5YA 1Y11A 3M6XA 5GAHU 4WKYA 3RMDA 4GVMA 3VTHA 4EWTA 4Q44A 1N0UA 1HARA 3G71S 3BGRB 4IG0A 4YR3A 1EKEA 1YAGA 4Z94A 2OA8A 2MZRA 2KRBA 1UVNA 4J9MA 4WQ5C 2DFEA 4KHRA 5J2QB 4H5VA 4KC5A 1J5EF 3C0BA 2QLBB 3M9OB 3J80O 2D69A 3B82A 1RHKB 4ICLB 1QSSA 1ZBTA 3C6UB 2R2RA 1V3ZA 3LQVA 3Q24A 4IO9L 4BRCA 1VRTB 2IDLA 2E29A 3NOGA 5HQLA 4RNHA 4ILRA 1DHMA 3CMES 1M5OC 3SV4A 4XH1A 3U02A 4DLEA 3NGIA 3MMAA 4OZJA 2VODA 1K1SA 2P2CB 2E66A 4C8MA 2OMOA 3GLJA 3TABA 3BPSP 1SH0A 1RHJB 2WBNA 1WHWA 3P6YC 2Q31A 4OZ1A 2JWKA 4MAKA 4JKGA 4O3PA 3CC7N 2ZGYA 1FKOB 5DDQC 1N32F 2CQCA 2VPZB 1XHXA 2VUGA 4ZIVA 2QTDA 4WIIA 1UP1A 1WG1A 1X4GA 4PUOB 2IM1A 4M7YA 3OYLA 5SWMA 1TYQA 2ZITA 1YHQS 2KW4A 1NGHA 3KHYA 4JKFA 3TZYA 2VB6A 3KD1E 2VASA 3SQ2A 4HDGA 4ERDA 3OW2M 1N34F 2HS4A 4OI4A 4J2BA 1DGKN 1Q95G 3QYYA 3P31A 1B7FA 1FJGK 3LM9A 2RU3A 3MWTA 3SUPA 4RW4A 3P49B 4DWIA 1QAJA 1KLMB 2NPFA 4B3TK 3MM5B 3HFVA 2WFBA 3CD6S 2ITGA 4FL9A 3IRXB 3H0PA 2RVJA 4GVLA 4Y1DA 3TO8A 2J0WA 1WN7A 5C10A 4URGA 3N4PA 5KFXA 1VQKS 4OYPA 1W25A 2OJ3A 4K5RA 3PDNA 4KAIA 4LUBA 3QT8A 5J2NB 5EX5A 3HM8A 1RWPB 3E01B 4TNOA 4FJLA 1T9UA 4B8CA 4ED6A 4ZVTB 5BYSA 2VHGA 1RTDB 5DM6Q 2KFZA 1VQSA 3CJAA 2V4RA 2K8GA 2A2DA 2HQCA 1RGVA 3Q22A 2DNHA 1YG0A 2E7XA 4R0EA 3UB5A 3N79A 4LSLB 5C15A 3MMCB 1WC4A 2LQBA 3D3BJ 4CLYA 4C1NK 3CCUS 5GMKa 2X1GA 4DR2F 1O51A 5BRHA 5AQVA 4OYIA 1RBOB 2YCHA 1LW2A 4ZLPA 4QPXA 4CI0B 4EMDA 1U45A 3CG7A 1Q8IA 1Y5LB 3RAXA 4AILC 1RTJA 3IR7B 1FRXA 4GV6A 1VMBA 4HHJA 3J7ZO 3O80A 1OIAA 4ZVQB 5DJBA 2HBLA 5B8HA 1RT7A 2E7WA 2GMJA 3UDLA 1NPKA 1KVKA 1K8KA 1XMBA 5M1QA 3LTOA 3TVKA 4H0XB 4CF9A 1SQGA 4CZKA 1W7AA 2DH8A 3W61A 1Q82T 2P5GA 3PZPA 1IKWA 5DQGA 1S1TA 4LF6K 2L9WA 1NGJA 1KNZA 2VG7A 2YHWA 3ENQA 4BR0A 5THWA 3TW0A 2R8HA 1TQLA 1ZM9A 4DV7F 1CS4A 1SKUB 4YY3F 3OR2B 1R3NA 1X3MA 1HNXF 4Y2KA 4TQSA 4N56A 2LQ9A 2P9KB 4JI5J 4URQU 1VC0A 3R6LB 5I9EB 1T0TV 3W2WB 3KUGA 1CXUA 1VJWA 3AA3A 3T6BA 5IWAF 3FZLA 4NRUA 1T3NA 4ED2A 3SBMA 2V7ZA 5ETKA 3GFZA 3M32A 4CZLA 4YDUC 4M3RA 2K2PA 5ETVA 1JLBA 3NAEA 1S5JA 1RILA 4A62A 2ZC3A 3QT5A 4PPZA 2C2NA 1B3TA 3I56N 1V4SA 4QIWD 3CCRN 5KT3A 1TV6A 2X6SA 1BWVA 4QCLA 2PMHA 4HR2A 5KT2A 1JLEA 3R9LA 2YKPA 4I9LA 3DOMB 1UVMA 4A8YA 3OYBA 1DRZA 5A6WA 1LWCB 2OFHX 1DLOA 4R0JA 2CG8A 5IXUA 3SK3A 3CPEA 4FF4A 3N28A 3SQ4A 2NLXA 3DXKA 5FJ4A 1VSDA 3OYIA 4B1XB 2UXBJ 4LRAA 1LW0B 2G8HA 1OJ4A 1Q7LB 4Q45A 3CVKA 2XY7A 4FWKA 4O4GA 5BPNA 1Q0NA 2KO1A 4N8NA 1A0OB 1IJJA 3VAHA 3E8OA 1GLDG 4BC3A 1RT3A 4RNMA 3MR6A 4FOEA 2XBPA 2PMWA 3FQLA 4USKA 4USJC 1U1LA 4XEIA 3G8TA 4R79A 1RAFB 4HEA9 3ZTRA 4B1YB 3L2UA 2L41A 3QMLA 3OYGA 2DNNA 3AO1A 5KQDA 4DV5F 2KHCA 4DL6A 2ZM6J 1T94A 1XMQK 2QIFA 3TTCA 1JXBA 1DARA 4K4TA 2RSQA 3LPEA 2BOAA 1YF5L 3H4DA 1XQSC 4U7UD 2OI2A 3D0IE 4QR1A 4QOTA 4RR5A 4LRCA 4X62J 2PEBA 2I2YA 2PIIA 5D0EA 5FDLA 1MNEA 4PEOA 3F56A 3MN9A 4OI3A 1HKAA 3JB9k 4J9PA 1BISA 4X64F 2Q3SA 1PKUA 4JP8A 3R1XA 2NPIA 3MOZA 3ZT2A 3I0RA 3WC2A 3MMVA 1U26A 4BQLA 3S1TA 1VQMN 3DMJA 4JV5K 5F8GA 4LF1A 4P74A 1QTMA 4KQZA 3OL8A 5GVQA 1KQKA 1JL1A 1QQMA 4RU2A 4CECA 4KO0B 5E84A 1I5OB 3U3YA 1SBRA 1X9JA 3AJ1A 4YDDB 1MMNA 3BBCA 3Q8SB 2XTJP 1HBUB 2MQLA 5IQQA 4HUFA 4AT1B 3GE1A 1HFEL 2D3O1 1QD1A 2VQEK 2HRUA 4MFBA 4DR3K 1YUWA 4I56A 1WORA 3FBCA 1A5XA 4ZVHA 4DUZJ 3T1HF 1OMSA 1YRXA 2E88A 3AJDA 2VA2A 2VOOA 1UW4A 4NYZA 5DG7A 2CPXA 4FZVA 1YSJA 3ZEUB 4KV8B 4U7UK 1PJ6A 1RADB 3CF5L 2CYYA 4NRTA 5E33A 4BC5A 3V4MA 3FBFA 1GTHA 3SBGA 3ZYYX 4LF5F 3MPWA 4B02A 4DUTA 4DFPA 2P5VA 1IR0A 1OVQA 4IWVA 3EZ5A 2RMLA 3M2UA 2Y3YA 3KLHA 4DTRA 5D0GA 2XS2A 4CZMA 3CCSN 4Q0BA 2NZTA 3QGHA 1AYEA 3R8EA 2MQPA 3AB2B 5KT6A 3W63A 2LKZA 3THYB 1O8BA 3OUYA 4FNIA 1IBLF 3P1GA 1XNRJ 1YI2N 4E7KA 1HYSB 2P6TA 2DY9A 3BDEA 1GLLO 5E26A 4KHUA 3FUYA 3TNVA 3PRVA 4G3IA 4DTJA 1X9WA 4ZPTR 1BQNA 4E2FB 2VG6A 2ZUAA 2BDPA 5KG5A 2R8JA 5LL6d 7FDRA 1TMJA 4U7BA 3F5TA 5CD4H 3BGFA 1GLCG 2PC6A 4DQSA 4MKVA 1TTHB 4JK7A 3T19A 3AODA 2ZH8A 3J7ZT 4BR5A 2PFUA 2LQ8A 1QQOA 3HFKA 4E98A 3TRGA 3HRGA 1ZBLA 2DKOB 2CJ9A 2A40A 1WSJA 2GQCA 5IS2A 2YHAA 3P39A 2K3IA 3W2VB 3MFHA 1M5VC 3MPYA 4DV6J 3FJ2A 1JXVA 3HL8A 1JLQB 4M5GA 3THTA 4O44A 2F40A 4OZ0A 2CH6A 1RDBA 3VCDA 3DYAA 1B92A 4CGJA 3V81A 4IJNA 2CWXA 3PNIA 3N4QA 1PJ5A 3M8PA 1HWIA 1WEXA 3HVWA 4CDIA 1VQ9N 2MZQA 1I94F 2I8EA 4P2XA 1LV5A 2DHSA 3O9SA 3TA2A 4AHRA 2FXUA 3FFIA 3V6DB 3ZZTA 1YJRA 1X5PA 4JYAF 3TU5A 4CLWA 4J9NA 4MK8A 3H45C 5AR0A 2AYEA 2ALZA 2MHEA 3ETOA 3L2RA 4H0TB 5KT5A 1JNZB 4ILHA 2MSSA 2H5JB 4P6QA 3ISND 1RT2A 2B7CB 3RSEA 5LMNK 4KHPJ 3SI6A 3M9NB 4CJ3A 1E4FT 3C2PA 4HCBA 1VRUB 1DBDA 2F65A 2UZAA 3IWNC 3CCMN 4ECZA 5GIOA 2DT9A 2W7PA 5CD4A 3K0SA 2EC0A 2DO4A 5ETLA 5CR4A 2D1CA 1MWQA 4DV2K 2H65B 3IGVA 3ULEB 2Z1IA 4BR7A 1FTRA 1I3AA 1WAJA 1RXOB 3G96A 3MX5A 1AFIA 4OVLA 2QRRA 3A0IX 4FYVB 3MEEA 3L8BA 2VBYA 2M0GB 3J7Z5 1AZSB 5DG9A 3FBBA 4CGGA 2CUYA 1HIYA 5KRSA 1RKJA 3UVJA 4H5WA 3PM9A 3CJQA 1XBWA 2XSJB 4LR7A 3AD8C 2VV5A 3VQBA 3VEWA 4CZHA 2U1AA 5KFOA 2O8CA 4WFXA 2AGOA 3VGLA 1YK9A 4CLKA 1QHAA 5HROB 2IVYA 1SAZA 3BSAA 3A5OC 3CQ8A 2BJDA 5A0YB 3RMCA 1RHUB 3LGNA 1JJ4A 4IDHA 2Z1GA 1KHWA 5CZ1A 2Z30B 4GKKJ 4OPKA 2PSZA 4A8FA 1UWBA 2V8DA 3CMEN 1EWRA 4JV2A 4FJNA 1MDUB 3KDNA 2MQOA 2IFXA 1WNEA 3LP3A 4WFAQ 2K06A 2EFGA 1J54A 2H4YB 1W2BM 4FS2A 4O5BA 5CCLA 4Y2MA 3U8XA 2F4VK 3FRZA 1U2VA 3DI6B 1NCLA 1LAVA 3B8AX 3VTIA 1U49A 2GMLA 1NU0A 4HH0A 3DRRA 4PG4A 2FJEB 3CW2C 4ZN1A 5EWEA 4Y34A 2RJZA 4PQUA 1RBLA 4CE9A 3KG4A 2YWHA 2V8VA 4DL3A 1VQNS 1YJ9S 3DGVA 4E3SA 2WHOA 2NUHA 1Q5YA 1S9EA 3GG1A 3ZETB 2EBEA 1JWWA 3KJVB 1ZXOA 2D0PA 4BREA 4Y00A 4OYBA 2ZH9A 2W2NP 2PZSA 2DB1A 1YHQN 4ES3A 2DXFA 3R6MA 3H08A 4Z7CA 3R9PA 2FBXA 1SL2A 2IY5B 1NJYA 3HDSA 3WX4A 4WZMA 5ITHA 2CQPA 4LRFA 2BJ3A 4B9NA 4NI2A 2UUBJ 4CH1A 1FTCA 3GYXB 1S6UA 3HXMA 1NGIA 2VC0A 1SJ1A 4U67L 3QFUA 3KLFA 3Q89A 4UOFA 3D3CJ 2VWKA 2XWXA 1M5PC 1U2CA 5A8KA 4OJGA 3GFYA 1FA0A 3A12A 3CD6N 4IG3B 3NNAA 4F50A 3LPUA 3BSNA 2D7SA 5AQFA 2OD6A 3BO2A 2J8SA 2CDQA 5HRPA 5M2UA 2GMHA 3TANA 2XMJA 4LH4A 3F9KA 2F9DA 2A18A 1WWHA 1VQKN 2KT2A 3AVHA 3U1MA 4DN9A 2GV1A 1RAOA 2MSTA 4O3OA 2OP5A 3AVFA 1IKYA 3L95X 3J7AP 4J91A 2KVIA 4L73A 1NNEA 1U25A 3WDOA 1EARA 4ED5A 3MAAB 5AQYA 3BF3A 4FS1A 3J7YU 1XNQJ 1B9DA 2Q3PA 4NASA 1H38A 4X4SA 4CHYA 4Y2AA 1RBTA 1ZZNA 4CFDA 4Y65A 1G99A 3TJAA 2OPRA 4KBOA 5CYMB 1IM6A 5A2QU 2QYCA 3CCUN 1HKCA 2QXLA 2DYAA 4DV1J 1NK9A 1WSVA 3D6TB 3VALA 3G25A 5GAGU 5KFZA 5A8WA 1U1MA 1NHUA 4FF1A 4LF9F 3FZHA 4J5OA 1DY3A 4JI8K 2QXFA 1U02A 2YWWA 1S6PB 5LJ3Y 3QQCD 1PC4A 1Z25A 3T41A 1C4CA 2AMCB 4GMJB 4FM1A 2EW9A 3C16A 4N77A 5GMEA 3IUCA 4TU9A 2X3GA 2YNHB 3JSYA 1LQ9A 3VQPA 2AJ4A 1NAQA 1C0FA 1HWJA 3FDSA 1BHNA 2IYIA 2V4JB 3W5XA 2FY1A 3BPDA 3G4SS 2LECA 4Q2MA 1VK8A 2QA1A 2NZ4A 3ZTOA 1S0MA 4EBEA 3DRPA 4CIGA 3LWLA 3VEZA 1VQPS 2FHOB 1VQ7S 3CMAS 2KLAA 4H5RA 1NKBA 5D3GB 2Z57B 3D6RA 4BLGA 3FC9A 1N8RT 2XNRA 2UVRA 3J7AN 1ZC6A 2E1PA 2W4PA 4JLHA 4NYNA 3SMSA 3TUIC 5J2MB 1VQ8N 2VYPA 3MUMP 3ID6A 3HHLB 1N52B 4IOAQ 2IRXA 4ZLLA 3SCJE 5JXSA 2OEMA 3PIPL 5BN9A 2HFUA 4NYFA 3VENA 1KQGB 3HTVA 3ITHB 1RDCA 1MA9B 3S9HA 3V5RA 4YMEA 3KWGA 3T1AA 3DAWA 1FDAA 2G13A 2F8TA 1X5SA 2BRLA 2ZBQA 3OVAA 1OH6A 3C66A 3T1YJ 2DTUA 4PL8A 2BUPA 4CIEA 4I2QB 4JKHA 3C7NB 2JEFA 2C2RA 4B1VA 4OKKA 3FNNA 1UFKA 3IAM9 5E3RA 4IFYB 4ZS6A 2OAUA 4C97A 4QWAA 4IZ9A 2BJEA 3RMAA 2R7UA 4FWRA 3AVBA 4F0MA 4FPBA 4F9OA 1DFDA 1S72S 1ZA1B 3FE1A 1FJGJ 4GKJJ 2AP1A 1SXLA 3HSJA 4HHHA 3RMBA 3H2VE 4ZK7M 3OYKA 4M95A 1FK9A 1IBMK 3FCWA 4JI4F 3C14B 4ED4A 3V9XA 3TUZC 3FEZA 2R3VA 4CWBA 5IV3A 1EZZB 4Y0WA 3ZT1A 1OKJA 4CYUB 2V68A 3Q2SC 5I4MA 3VQQA 2GJIA 1SZ2A 4CJWA 1FRKA 4QQBA 4HT5A 1BQMB 4UQTA 1SS6A 5K14A 3IBWA 4KHMA 4I6YA 3JTPA 4LBHA 3HMJG 3R2CJ 1HNVA 1PYOB 4LT6A 4DR6J 1HQUA 2CFXA 1NK4A 2PFDA 1WHYA 5JVHL 3ET6B 1S6QA 5FLXO 4RWTA 1JK9B 4HVZA 3SQGB 5CZ2A 2NRXA 2DNRA 3K9KA 2JEIA 4ILGB 3PW5A 4CQ1A 3GIJA 4NE9C 3BUZB 2VJUA 3BF4A 4DV3J 2C3UA 4JEPA 3WIUA 3KKSA 2C1EB 2DNYA 4K5SA 5LSLA 1GLJO 1CG2A 3V1OA 3NAIA 2NXJA 1O5JA 4DR1K 3IS9B 4B3MJ 2RHKA 3L09A 5GINA 3CUNA 1DEJA 1PC5A 3OL7A 3HD1A 1JB0C 5GAEU 4UOCA 3W7BA 4M8LA 3R97A 3R27A 2MJUA 4MQ3A 4DOZA 4WBFA 2A1BA 2XCAA 2X1AA 2Z2YB 4ZCKA 2WOMB 2KL8A 3M8YA 1HRHA 3TUJC 2DBBA 3LDNA 4G1PA 4IFVB 1VLYA 1QHTA 5C24A 2CWKA 2HHUA 4F25A 1T6CA 4NA2A 3J80Y 2HQGA 2ZKTA 3KUEA 2Q6BA 4DHVA 3JAMO 3MPDA 2RF2A 1D9AA 2F3JA 4FK4A 2DY4A 5A76A 4HLBA 4NXMJ 3ZZOA 4FK0A 5DLFA 4OMFG 2FY8A 3ZTSA 1R6VA 4AHUA 3X3UA 4W4MA 2X74A 2GFFA 2CDRB 5AXLA 1BWEA 2QX0A 3VGTA 3D0GE 4ANCA 3OFFA 1TK5A 3O9UA 4ETZA 4KFBB 3B54A 2ZD1B 3OTCA 2BH1A 5IM0B 4ZVFA 3KK1A 2CPHA 2JEJA 1T6DA 2M9KA 4E7JA 4BDPA 1C0TB 3D9BA 1S3XA 4HI2A 1ATRA 1QS4A 2XHCA 5HRNA 4G1QB 1OS5A 4P2FA 4I4BA 1XMOJ 3BGOP 4TKTA 4CJ4A 1RQ0A 1A6LA 4QPTA 4FLXA 4CK1A 1YJWN 4WZQA 3KLEB 2NS1B 1QZ5A 3MD3A 2YNFA 5FPNA 3W9IA 4K7QA 1BE4A 2PO4A 2EG1A 2WTUA 3LP2A 3C94A 4BRNA 2JDJA 1X4DA 5AJ3K 3S41A 4AF1A 3L4BC 1BGXT 2ZH3A 2D3OR 4OI0A 1T3OA 3GJRB 4MDBA 4ZDNA 1VBXA 1LAWA 4G65A 4QS7A 2W9AA 4GVEA 2IYGA 1Y10A 3OYNA 2ZZMA 1S4FA 2UXCK 1WG5A 5LY3A 3OJUA 2M4MA 1FXXA 1CULA 2G0JA 5EUHA 4DL5A 3AD9C 2OYQA 2P9PB 3V1QA 1O0PA 1QLNA 1LWFB 1XR7A 2AIRB 5K5MA 1XERA 1RTZA 4RW6A 5G4DA 5B08A 1WC3A 1KQSR 3DM2A 2E5IA 1R0AB 2KZZA 2H3GX 4CJRA 4KH1B 2YWKA 2NUUG 2XCPA 4FJJA 2DISA 1XMQJ 1Q7YO 3NKYA 4OLPA 2FGOA 4DPOA 1MROA 1WSRA 4FM2A 3NGYA 3PLAA 4C1NI 3D54A 5GIPA 1N5SA 2HAIA 3P5BP 3FRYA 3LP1A 2AKWB 3KKFA 3W0LA 2FF6A 1UEVA 4X4QA 3NDKA 4O3RA 1HNZK 1TKTB 3TR5A 3SQ1A 3IP0A 2CJXB 4PHTX 3MMBB 3EKSA 3TTFA 2QLWA 4DSEA 4LY7A 4X4OA 3U6FA 3CDBA 3US5A 3N01A 2EEYA 3AA4A 1EAYC 2N82B 2AEMA 2ASDA 5KGWA 3KLIB 1C6VA 2XLJA 2E5LK 4JV5J 2D41A 5AE3A 5ETOA 2HHHJ 5KFMA 3C15B 2DR6A 4DR5K 5KOWA 1N33F 4AFFA 2DH7A 2NREA 4K4SA 4RBTA 5L39A 3VAKA 1QDUB 3VF4A 1NSPA 2DGVA 1RSCA 2ZHOA 5ETMA 4WFYA 2R7QA 5T7LA 2XY8A 2VQEJ 2G4BA 2IVPA 4ENOA 2EVZA 4DR3J 9RUBA 3Q83A 3K58A 1RLDA 2DNQA 2ZKUA 2ACMA 3TYTA 3QSYB 3L4IA 3GJSB 2YPYA 2MXYA 1K0VA 3SSRA 2GO8A 2ZNYA 2ILZA 5KG6A 1HNWF 4J8FA 4NLXA 4LFCF 1WSEA 3NF7A 1S22A 1PYSB 4FOIA 3EKUA 3MD1A 4KY3A 5LMUJ 3HP6A 2OH2A 3S3NA 2ACYA 3TVYA 2XHWA 2ATCB 2FZGB 1X4CA 3KK2B 3HT0A 1F6TA 1N5YB 4OHZA 1WOQA 2ZJPL 4OX9K 2R4FA 2X78A 1T95A 2NR0A 4DL0C 2JLEA 4CJKA 2O8FB 2YHBA 4BVOA 2YWEA 5EX0A 1Y4ZB 3AVCA 4Y6IA 2BUNA 3CETA 1UA1A 2QFIA 1UZDA 1VQNN 1YJ9N 3QRRA 1TL5A 3Q23A 3Q7CA 2FLOA 3IMQJ 4E19A 4M5DA 3GZ7A 2IGIA 1SH3A 5EVZA 3V6HA 2IDOA 5GAEI 2CJQA 2XS5A 2ZJQQ 3DU6A 3NCQA 1UMJA 8AT1B 3D5MA 4ILMA 2I5JA 4ED0A 2CJYB 1J5EK 4C3LA 1V6HA 4GO7X 4BQZA 1NPPA 2E1MC 2BX6A 3SCLE 2M7SA 3BGLA 1YITS 1ZTWA 2P9IA 4P75A 2QA4N 4X66J 1TKXA 2YNGB 4V19X 5D0RA 3KK3A 3MR7A 3BN4A 3BQ2A 3KHRA 1D0EA 3AAPA 4USUA 4UZCA 2KDOA 4FW1A 5B0AA 4KI6A 1C0UA 1HBNB 4BDYA 2ROEA 4WYLA 2AJ0A 1C0GA 1SJ3P 4M63C 5AQUA 1M1GA 5KG3A 3MM9A 3D2EA 1RTHA 2ZGZA 4OHXA 3DU5A 3CDEA 1HBOA 2JEGA 3R6GB 3WNGA 1MSWD 3UIQA 3CC2S 1KDNA 1S12A 2CPZA 2KYXA 3R5GA 5HJXA 1G6BA 1TL3A 1N32K 2BW7A 3AXMA 3IXQA 4NLWA 1RT5A 2BACA 2XG8A 4B17A 2OPPB 4IH6A 3V4IB 1HNIA 5KFCA 4OZNA 3WIVA 2FTRA 3CD5A 3IAS9 1OPZA 2K1RA 1TK0A 4TLQA 2DR9A 3TOQA 4L75A 3JSRA 3SFUA 2W9BB 5E41A 2F8SA 4DV2J 4WFBL 1RE1B 2HAFA 5EWGA 1N34K 4X62F 3H6EA 1NSKL 4NLQA 1EXQA 1R7IA 3MR3A 4R8UB 3M2VB 4AE5A 2R8IA 5FRMA 3THWB 4FJMA 4WTOB 4QS8A 3ZZZA 4MO4A 1H7WA 4RW8A 1IKVA 2VG5A 2YKQA 1RWXB 2DR8A 4PXBA 1QVFR 3EWGA 2FC8A 4HTIA 1SUQB 4YOWA 3CCJS 4UOHA 5HJYA 2J7KA 4DN0A 3QBCA 2KI2A 4OV1A 1VQPN 2ADCA 1VQ7N 3CMAN 4RUBA 4PR6A 5AQXA 4CM0A 3G9CA 1C1BA 4IDKA 3T7ZA 4WE1A 1M1HA 3NGDA 4FVMA 5K9FA 3AVAA 3CXCM 3P96A 5JICA 4LFAJ 3IAYA 2G9OA 2XB2D 2MB0B 1Q7YT 4GW6A 4PWUA 4DTSA 3ONQA 2DEJA 4D3HA 1YJTA 4FBTA 1AT1B 5K8OA 3TWZA 4NCGA 3HVTA 4M3WA 2UVUA 3AOCA 3ENAA 3W3DA 3EMTA 3GJTB 2MJNA 4X4RA 5AQNA 3TAFA 4PPDA 1B70B 4B9SA 1MU2B 1C4AA 4DR2K 1IJEB 4LRBA 2ALYB 3DXMA 5HL7L 3CPWR 3Q8PB 4JI3F 2V8GA 3D7SB 2L48A 1GK8A 3NCRA 1REVA 3S8SA 1CLQA 1WG4A 1WSGA 4F2RA 1Z1ZA 1SJRA 3TPQA 3LWMA 4NX9A 4DFMA 1X31C 3HJFA 2ZBPA 1WF0A 1EP4A 1XNRF 4M5LA 4OLBA 1VSHA 3MZIA 3OBYA 3LF0A 2OZSA 1F9FA 4WQ5A 3MCMA 4CW7B 4FW2A 2KH9A 1WC0A 1NM2A 3ZSQA 4M3UA 1QAXA 4YB6A 1GOBA 5CYQA 1UCNA 1S72N 2FLNA 5RUBA 2FZKB 3CCZA 1B0VA 2B56A 1NH8A 4MIAA 5CZXA 5LJVA 2YKNB 1SH2A 2L08A 2C42A 1WELA 1WC5A 1ZA2B 4I64A 2BRKA 1P9QC 3A8EA 3OFHA 3R2DJ 4DV7K 1KAYA 4CO3A 4YY3K 4GNIA 3F0NA 4JI0F 3OLBA 1HNXK 1CJTB 1VYAA 5DM7Q 1U2FA 5KG4A 4N41A 2B4OA 1YTAA 4O23A 4K4ZA 1UWAA 1S1WB 4JK8A 2DGOA 1JLAB 4NLYA 5J2QA 1JLCB 2XYGB 3TAEA 1F5CA 1WF1A 2NCKL 4F3QA 4UUXA 2CKWA 2B6AB 3RTVA 4LQ3A 5IWAK 4L3NA 2VPYB 3DLLL 2QSWA 5ETQA 4ICLA 4CNYA 4OPHA 2HQ3A 3QAEA 3C6UA 4X4VA 4DV6F 3M8QA 1VRTA 3B6PA 4IOCL 1UETA 2CQ2A 3MXHP 2XEXA 1Y5IB 2MKKA 3VMFB 4IOBA 2VQFK 5ADXH 1B4SA 3QESA 2J9DA 1N56A 2MQMA 2BV3A 3FSXA 3K57A 5HVHA 3NF6A 2ZBCA 3IWXA 4OI2A 3MEGA 3KXDA 3PFEA 3HX9A 4WU3A 3O08A 3O6WA 4I2PB 1BUXA 3IM8A 1FKOA 4JI8J 2CNOB 4LIWA 3TA1A 3CDWA 3EZOA 3MWBA 4DLGA 4DX6A 3ZSYA 4RU9A 2VBXA 2J6SA 4Z4EA 3O3GA 2B51A 4PUOA 4ED7A 5BPMA 3EICA 4CJLA 2EFQA 1HUXA 2PD1A 4DPTA 4KHPF 1QSYA 4TY8A 3HULA 3ILLA 2FHMA 1UL3A 3QBXA 4E1NA 2D0CA 3V9WA 3BGUA 2C3MA 4A8SA 1R27B 3GV7B 1Q86O 3VAIA 4LIRA 1KBRA 2QW9A 5SZTA 4DV5K 2DGSA 3BQ1A 4BRPA 1YQHA 4WFNL 3IG1B 2ZH2A 4DV4J 2G0IA 3ULDA 3MMAB 2NRWA 2RIJA 4YEAA 2UYTA 2AJQA 2F7TA 4R25A 2P51A 1KLMA 3K9JA 2B3TB 3MM5A 3DLKB 3NGUA 3QO9B 3C46A 4PQAA 4F26A 3B4MA 1X4EA 2RAQA 2R7OA 3QFHA 4EBCA 2DHHA 3A3NB 1X4AA 3CM5A 2B4UA 2L3MA 3OTBA 3PIOL 3SCXA 3CFRA 3WXIA 5D77A 5ADXA 3O4QA 5HMXA 4YOXA 3QRPA 2MQQA 1RNHA 1BD6A 5KRTA 5J2NA 4JOUA 3LDLA 4X64K 3HCXA 3E01A 2GW8A 1T02A 2J9EA 3TAGA 4NLPA 4GV3A 3CSKA 1RTDA 4YR2A 2GHWA 4FWSA 2AP6A 2W7OA 2C2ZB 5JJBA 4USWA 3HSGA 4EHTA 2DRAA 4ECXA 5BR8F 3PW7A 3RAMA 2RQKA 4LSLA 3MMCA 3EGWB 2OHDA 4ZCMA 1UFLA 2CZ4A 1RBVA 1UVJA 3IMXA 4URSA 3GIIA 2FVQA 2EK6A 2AV5A 2E2PA 2JVRA 4FYXB 3T1HK 2GX9A 3UKUA 2V94A 4ZJOA 5J1PA 2IHR1 1VQLS 5KFEA 3BEGB 3KG1A 2X3DA 3VESA 3U1NA 2YBVA 4XAKA 5HVGA 3H2LA 4LF5K 5ADZA 5CABA 4BRAA 3OTOJ 3M9MB 1BA1A 5M1FA 1WSFA 1NMNA 4M3YA 2FJDB 3A3OB 4YN3B 4AUKA 2IRYA 1YGYA 5BXIA 1JJCB 2VFUA 1QVFM 4CFCA 2QK9A 1BLUA 2KM8B 3N5FA 2Z4PA 3EJMA 2W8KA 2UUBF 2DXDA 3MM8A 5A2QY 1IN0A 3UDEA 2W4DA 1IBLK 4BACA 2VICA 1KFDA 2IBKA 1OPIA 4UQGA 1VCTA 5F8IA 1WB9A 2XMMA 2CPJA 4C6AA 4LFBF 2P9CA 3GSDA 3SAFA 1FERA 3UO0A 2LXIA 4NLVA 4PKHA 3UNGC 2V34A 2XULA 5L1LA 1HKBA 3W2WA 2PFFB 5CYJA 2IC3B 2KM8C 4OYWA 4PXEA 3QINA 2WW4A 5KG7A 2HNYB 4ZVUB 1OY9A 2WVFA 2MKHA 4C9DA 5EWFA 2E2NA 1UJ4A 2VF3A 3SQOP 3TA0A 2VWBA 2W2MP 2AU0A 4W5OA 4W92B 4DR1J 3M5RA 3GFHA 3ASMA 4EGLA 3SCKE 3A5LC 1D4XA 3BH7B 2AA4A 4WWSA 1VFJA 3CWJA 3J81O 1CXQA 1IKXB 3OFEA 1OSCA 4FJ9A 3GPAA 4OKEA 2P9NB 4FSVA 3BO3A 3ISZA 5IC6B 4FLZA 2FVCA 1ZM2A 1CJVB 1K8KB 3AVLA 4B1WB 1SL0A 4NO7A 1FD2A 3TI0A 2DVIA 4W90B 2VWJA 1ILYA 2DPJA 4M5JA 3J81U 4CJVA 1TUGB 1U6FA 1S1XA 3AVKA 4CT9A 4OJ3A 1JCFA 1SIWB 3LDSA 2MDAA 2BQUA 2QV6A 5HRRA 3P5JA 2G2OA 2HNZB 1Q53A 1LW0A 2HMPA 1I94K 2C2MB 1ZH5A 5SUHA 5KFVA 4ZKAA 4PG8A 2VA3A 1GLEG 3CULA 1UZHA 4JYAK 2Y9HA 2GELA 3RRGA 5I42B 4J2EA 2BKNA 5AQIA 3AOAA 3Q0AA 2B8QA 1VSMA 1GH8A 2RRBA 1TMMA 4XDCA 1WF2A 4WPAA 5DETA 4RL1A 4F67A 2OMLA 5KFRA 1HI8A 3GBTA 4LF8J 2YQ1A 3I4HX 4Z4FA 1Y64A 1URNA 4H4MB 4EYHB 3A8YA 1JMTA 4NLSA 3NMAA 3GR1A 4BY9C 2BE2A 2IIRA 3WUHA 3WNFA 3QERA 1JKHB 1DKGD 3I5AA 1JLEB 4CM2A 2F7VA 2ZZNA 4KH4A 4CO5A 2H1YA 2ERRA 2HBYB 3K5PA 2NXCA 2RQCA 1SKSA 1HYVA 4A2BA 4CK2A 1FXDA 2FJXA 2Q66A 1SV5B 2YJEA 3NGZA 3T1YF 3SIPB 1CJUB 1I3OB 1EKSA 3QIDA 4DL7A 1NOZA 3HHLD 2JWNA 4X65F 4NCBA 4O4GB 2OEKA 1YITN 3R3LA 2Q1LA 2WUSA 3ZZPA 4A46A 4KO0A 3CFOA 4JV0A 4CRJA 4OL8A 5H9FK 2LYVA 5M1PA 3WNHA 1CEZA 5BR9A 3FKBA 3IC1A 3K7RA 3NE6A 4KYZA 3ATVA 5M1NA 4ZPBA 3OL6A 2XI3A 4ER8A 4O3QA 3K17A 1BC6A 3CI5A 2FBTA 2UUCF 4A8OA 2HIQA 4N7TA 2B9WA 4GKJF 3FK4A 1NB7A 4WF9Q 2HFZA 2DPIA 4B9MA 1GT8A 1NJXA 4KV8A 1EQMA 5LXYA 3ZEUA 5LL6Z 5HOOA 5FLXY 3K5OA 3M8ZA 1Z6RA 1MMLA 4OX7A 2XMKA 4MO5A 3QBWA 2LDIA 2E1YA 3BYRA 3RG6A 3JXUA 2VC1A 2CNNB 3MN7A 1CPZA 5FDLB 3LH2S 3R7BB 4W5TA 3NOCA 4PYAA 3OD2A 2DCLA 3VZIA 2AZ3A 2F1FA 3DDIA 4NLTA 2IPOB 5C2CA 3THYA 3SMZA 1IUJA 4IEEA 4LMZA 2A1RA 3DMJB 2MEWA 2YXLA 2E5LJ 2QL7B 4DR6F 1HYSA 3JSMB 5KFGA 3OVNA 1FX2A 3WBZA 1FD8A 3OTEA 3CO0P 1NGGA 2HHWA 1QZ6A 3QJJA 4QWDA 2ASLA 3R5JB 1HPZB 3HHNB 4GC7A 4IKFA 1NZAA 4DV3F 4IRDA 4C11B 3NVMA 1MMDA 2QT7A 4EZ9A 1TVRB 4BWMA 1IH7A 1VSFA 5AQQA 2CRLA 2VGMA 3ZT3A 2V67A 4B3MF 2X51A 3H7HB 4MJKA 1VQMS 4UW2A 3UN5A 3DOKB 1NXIA 3ZZUA 2QWRA 5EX3A 1RHRB 3CJ0A 3CHWA 1H74A 4GO5X 4LVNP 2P9UB 1BHLA 1HI0P 2P9GA 2KXFA 1LFWA 2LP4A 3CJSA 4KGZB 3RZAA 1X8DA 1BOTO 3M2UB 1J5OB 2FVPA 4EZ6A 3O4WA 1N54B 1GMWD 5D6GA 4B9UA 1W26A 4OX9J 3TX8A 4NMLA 4CJSA 2VKRA 3NMUA 4FJIA 4QJVA 5K8PA 3CIZA 4P7VA 4NXMF 3KJFB 4PABA 2KXNB 2CPIA 4DQQA 1K73O 4CLSA 2GVZA 4QWBA 4ZA1A 4M3TA 1TUVA 2OPSB 4LF9K 1U1OA 2PMZD 2NQPA 3V6DA 2HFSA 4CLUA 5HSPA 3R1LA 2BKOA 2O3DA 3VR1A 1Q81T 3LUYA 3SJJA 2O4IA 1Q78A 2P9LB 1U7LA 3ZFVA 3KFWX 3ELHA 4GVBB 3CCVS 1H6KX 2HWHA 3BKTA 4K42A 3G10A 5H9EK 1YI2S 1YT3A 1A9NB 1J5EJ 3UD5A 3OJSA 1TFYA 1VRUA 4IFEA 3M05A 1XMOF 2DRBA 5HP1B 4DTNA 1AB8A 2CGJA 2CIMA 4J9OA 4ELUA 4M42A 3ULEA 4TQRA 2UU9F 3GG0A 1IG8A 4F02A 4P9SA 3PX0A 3OL9A 4U96A 1KQFB 2IMWP 3HVRA 1FWPA 2MZ1A 5KG0A 1CLFA 1AZSA 3BZQA 4C48A 4EIAA 1V5VA 1X4HA 2EG2A 2EKNA 8RUCA 4I7FB 1HBMB 1ASWA 1KXPA 2XSJA 2XZTB 3M8PB 3H2UB 3EGZA 4M94A 3PYEA 4WXWA 2H5IB 1RABB 5GADU 4A59A 4PA1A 3JQMA 5C2GA 2HZVA 3MEKA 4I6WA 1XUPO 1KOOA 3G82B 3PFOA 1BA0A 2BW2A 2ZZTA 2FLPA 1BCMA 2H54B 2HFOA 5A0YA 2HBZB 2HVIA 1N32J 5KFJA 1FDNA 1MWMA 1RCXB 3FZMA 3ZT0A 1RYSA 1KP6A 4O8KA 4KTQA 5JMVA 3N9UC 1ZPWX 2O8EA 4E1MA 3UNYA 1VQ9S 2KG0A 3I8BA 4OHWA 3ILJA 3O3HA 5D78A 4B3SF 3LAKA 2V63A 3BJYA 2OGUA 1KVCA 2WK4A 4OFZA 1N34J 4DPYA 2C2EA 1RWVB 3SCIE 4CJFA 1QVGR 3OS2A 2DK2A 1Q8LA 3CD0A 4JI2J 1X9SA 1S76D 2AD9A 3J81j 4DUYJ 3WQPA 4DR7J 1AUDA 3M8SA 4BHQA 2E7VA 3ZETA 1QAYA 2M88A 2XO7A 3KJVA 1HR0F 1FX4A 1SQEA 4JI4K 2GNKA 1S0VA 3PJ9A 1WKJA 2O8CB 2B7BB 3OS0A 2QN6B 1WOPA 5CCMA 4N5SA 2HHHF 1BL3A 3VAGA 4ANEA 1F5AA 4ECYA 2ATQA 5AQRA 4A4JA 3MCAB 4K43A 1TKDA 3UI3A 5AQMA 2G8WA 2ZJRQ 4BS2A 2I0XA 4P10A 2CGLA 4FJ7A 2YQ3A 1FKAF 1RT4B 2EWHA 3S3MA 1EB0A 2CPDA 3OTDA 4EYIB 2XMUA 1U2VB 4IG3A 2Y8YA 3OHBA 1KN6A 2QWPA 4HTJA 3P8BB 3FVYA 4KTZA 2DEIA 1RTIB 3SDEB 2POKA 2XRIA 5B0BA 2E1RA 4DR2J 3LL3A 3VEYA 3ZNJ1 5DQIA 3ZSRA 1BG3A 3E66A 4CBXA 5LMUF 2W42A 2DPNA 4DF8A 5HAOA 1WJ9A 1RA6A 4PWWA 3PHEA 4P2MA 2HHTA 5KGXA 4NYOA 3J80U 2P8IA 3QJPA 1H1VA 5JUMA 1MN9A 4KGMA 2MLXA 4K4YA 2HHPA 2W01A 3MAAA 1NSAA 4ZITA 1LEOA 3WXJA 2DGQA 2O1PA 3AB4B 2E4LA 2O8BB 1Z4UA 1TGOA 1V9OA 1KVAA 3V1RA 1FE4A 1TKZB 1MLAA 5CYMA 3DLGB 1OO0B 3D1QA 4GV9A 5KG2A 1GLBG 4CEDA 2Q0RA 1CC8A 3NY0A 1WHVA 4QAGA 1AROP 4B08A 3IA0A 3NLCA 3QRQA 3K8VA 3M7VA 4NI2B 3UCZP 1VQLN 5F1XA 3HPGA 5KFBA 1S6PA 1FCAA 3FCVA 3WEEB 3VF0B 4P7TA 4RG8A 1NBWA 1ZAXA 2YNHA 4GRSA 4F04B 4YOEA 5ETNA 1IWAA 4HACB 2QZ8A 2ZOFA 1YBAA 5B09A 2V4JA 5K20B 2JLFA 2WVEA 5IWAJ 4UT4A 4PCQA 4FJKA 4X66F 1LXNA 2F63A 4KH6A 1A5VA 1VIXA 5D3GA 3CJCA 3DXBA 4Q2LA 2Q36A 2HW3A 3MX2A 3UQSA 2VPXB 4ZLJA 3JS6A 1NPRA 2Y0BB 3L7OA 2ZC4A 5IV4A 1S9GA 2VQFJ 4CVNE 4DF4A 1ZZFA 1S10A 1K73T 5J2MA 2XMAA 4TLRA 4JRPA 3EX7B 3OBIA 3FCHA 4JNEA 3HHLA 2RH3A 2OFGX 2RUSA 5CAAA 3P4UB 4NZ7A 2AX1A 2DGWA 2XQCA 2DRDA 5A8WB 5K8MA 3ITHA 1DQ8A 1ZAWA 2CVIA 4ZPWR 3ID8A 4G9ZA 4BR4A 1S1UB 2BANB 2R7RA 1S77D 2HFNA 1S0OA 1NJWA 1JL2A 3OVSA 1VSLA 2HQDA 1BCOA 2UUAJ 2E5JA 3BR9A 4BRIA 2AJFE 3QMQA 2JWLA 4I2QA 5BREA 3ZTPA 3FR0A 2QLXA 4E7HA 3RUBL 3L6QA 4XDDA 1ACMB 5F0XA 2YVSA 3MM7B 3RAQA 1O1WA 4BRLA 3AAWB 2N3OA 3NHGA 1VRQC 4I69A 2GBZA 3K2PA 2GV9A 1EX8A 2IDEA 2RRAA 1HQ2A 2E2QA 5HANA 1NGBA 2HOEA 2QL9B 3G6YA 3AO4A 1NDPA 5D15A 4DV5J 2RS8A 5EGYA 1JNRB 2DO0A 1PAUB 4LSZB 3VAMA 3HZGA 3C14A 4OJ1A 4CEZA 3RB4A 2QKBA 2IJRA 4FXWA 2QWNA 1KR4A 4IQXA 2CNKB 5J2PB 3BZKA 2CADA 2B43A 4PYDA 1UAWA 1GLAG 4XK8C 3GTYX 4CZGA 2N7YA 1RDUA 2FSJA 3JTOA 1PBUA 4X64J 1BQMA 1HWUA 3L3VA 2UXDF 1GMVA 4LFAF 1HMVB 3J8AA 4QYZK 1QTNB 4NEYA 4CJQA 1ZBUA 1VQ8S 3ET6A 4LF7F 3I32A 4USMA 1NK8A 1NGEA 2A41A 3SUNA 2LEBA 1N33K 2VONA 5E3PA 3SQGA 2BKPA 4FYDA 1T11A 2PI5A 3QDKA 3AO3A 1FRMA 4WCEL 2WTFA 2BMBA 4CD1A 3H8YA 4DR4J 3OHRA 1D8YA 3T1HJ 1GMWA 3WX8A 2Y1IA 2DXEA 4DPXA 3OYAA 1N0VC 1BXNA 1F21A 5CE3A 4TN2A 3IS9A 3AQPA 2YNIB 3S3OA 2QSFA 1FK9B 1HNWK 4NYPA 4LFCK 1K44A 1G7CB 2CZ9A 5GAHI 4YS2A 4JKCA 4LF5J 1KRPA 3L4QA 2WOMA 4YB7A 3W62A 2OSRA 2XSFA 4C4WA 4K50A 4RNOA 3CJ8A 4OYZA 3Q2TC 4BRFA 4FYWB 4D3GA 3EVMA 5AQHA 5DRKA 1N36F 3SXLA 3C6TB 2ASOA 2W40A 3B8HA 2DR7A 5E7OB 3DC2A 1PG5B 3ICLA 1LKZA 3BF1A 1QQCA 1HQUB 2W6LA 4DTXA 5EY4A 2AX0A 3HO1A 4CGIA 4CFBA 1HKGA 5F3ZA 1TL1B 2P9SA 1RAIB 4F4ZA 3KKRA 4WK1A 3MECB 3M1VA 2Y0SD 3ZCMA 3M4XA 4QW8A 5ETPA 3PO4A 2MQNA 2HGLA 3R7SB 5IM0A 2CAJA 3SAGA 5JS1A 3O4NA 4YP3A 4L8RB 2BVZA 4QIGA 1C0TA 2KZMA 2GAGC 2KYZA 2OO4A 4NCAA 1F9HA 4G1QA 4JRQA 3GV5B 4AQYF 3MOJB 1U1NA 2WBMA 1QE1B 4CNZA 1VI7A 4JI1F 2CZVC 4DMNA 1WUUA 1HHSA 1DT9A 3KLEA 4HTUA 1RDDA 3OA9A 4FLWA 1NLKL 4IO9Q 4NLBA 4ID1A 5HBMB 2KFYA 1BMQB 1I1GA 2YH1A 2MZJA 2R2SA 4O0NA 3DJCA 1WLJA 4BDZA 3DDKA 3TJ8A 2DITA 1JJ2R 3JYTB 1RU2A 1GOAA 2ZF5O 4YB1P 1ZBFA 1EQYA 2NXUA 1VDHA 1KC8O 1C2PA 3DOLB 1Y3KA 5ETTA 4MT1A 4QU6A 1NJIO 3NGSA 4CHZA 5F9LA 4ELTA 3PSIA 3QIPB 4ID5B 1NMDA 4NZ0A 1OH5A 5CA5A 5JMNA 2DFFA 4YR0A 3R5AA 1X4FA 4X2BA 2P9PA 1LWFA 1MG7A 3TAPA 2Z8QA 3ZC4A 2XGPA 3KG0A 1R0AA 3EDRB 4M3ZA 4K8XA 1VBKA 4RWWA 3CJKB 3LDOA 1T8EA 4ATNA 2IIHA 2DHAA 4X4UA 2GVDA 4DV4F 2YH0A 1UFWA 1FWKA 3A3PB 4K59A 3SSSA 1T03B 3R5BA 1D9FA 3ZNUA 3T5HA 3FZ2A 5L9NA 3GIMA 1UW9A 2XZWA 3N6MA 1XC3A 4X62K 3TZZA 1IQZA 1IBKF 1WTBA 3IR5B 2RUGA 3UR3C 3WXKA 1W9HA 1TKTA 3D1OA 5DO2A 1OQ6A 4CD3A 2GQQA 2XMTA 4DS4A 3MMBA 3CCVN 3PYGA 3DN9A 1NOYA 1M90O 4EO6A 3NH0A 2D3UA 2I7NA 5KFYA 1RAGB 3VQCA 4CLLA 2PN6A 3VAFA 5DGBA 1PGZA 4ZVSB 2QEXS 2LSNA 1Y0HA 3KLIA 4TYAA 4Z7YA 3T3FA 4LD0A 2DHXA 3C15A 3KNGA 4DG1B 1DURA 2ZWPA 1YJWS 2FJVA 1U1RA 5JVGL 5LSRA 2E9RX 3CJ5A 4RW6B 4CJ5A 2JH3A 4N8OA 3KZBA 2EWSA 1FJ7A 2B9YA 3EEQA 3AQOA 5KPTA 4U6PA 5CQGA 4CGFA 1PSDA 4ECQA 2I38A 3SUOA 2WSEC 3QSIA 4P71A 3SEOA 4FF3A 3PVXA 3RBDA 4ZCIA 4ES2A 1YX2A 4PZVA 4H4OB 1FVQA 2D5RA 2GWJA 2PAVA 1ZTTA 2HMIA 2W2PP 3OTOF 3LP1B 3I96A 2IAJB 2CQ3A 4JI3K 3CERA 2W8LA 1Y5NB 3BZCA 4HVJA 4EUVA 1QSLA 3M6GA 2HQIA 1LOTB 4Z37A 5TKWA 3KK2A 3O8MA 3QZ8A 4LF4J 1N5YA 2VKZG 3C95A 3PACA 4CH7A 3C6AA 5BYRA 2Y1RI 1NNDA 5CHCB 3DLRA 4J9LA 4Z0UA 3QEXA 4FJ8A 1KVIA 2MKJA 1M1KO 1SI9A 2O8FA 4ZVRB 3J81Y 2DNOA 1CJKB 4JI7J 2W2QP 2OZMA 1ESVA 1SQFA 2ZOMA 2EFVA 2OPQB 4KE5A 3DRYA 2HRTA 4OO1J 2C3YA 3VHQA 5C2DA 3SYZA 2ZVIA 2ZOGA 2PDAA 5F9NA 3EL2A 1OYEA 3T5JA 1PILA 3QEVA 1VQ5S 4JI0K 4C3KA 3K5NA 5LSOA 2DNZA 4XH4A 2UUWA 2K3KA 4H5NA 3KOAA 1IR2A 1UVIA 4AHCA 3I31A 1JCEA 5FRNA 3CJRA 2B5JB 1EQ0A 2M2BA 4DV0J 4CF0A 4M63A 3DHWC 3V6KA 5GAHP 2CGKA 4DQPA 2BXJA 4ECTA 1KFSA 4DV6K 4DU1A 2Q2RA 1MWKA 2XGQA 2WVCA 3W60A 3GIKA 1BU6O 2ABYA 3NBPA 3OY9A 2FVRA 2NRZA 2CJBA 1ZOTA 1HBNA 2WSCC 3NS5A 4MKYA 4ZP8A 5DZ6A 3PXGa 2RNEA 4W98A 1S4EA 3N6LA 3CDAA 1NHVA 2ZQBA 4A5BA 4FKYA 1IWGA 3OLAA 3I55N 3CJ4A 4BGBA 3L7PA 3TUPA 4RJVA 5L8RC 3O8WA 1RWOB 2RKIB 4JD2B 4J9VA 4B9LA 1J9AA 1V3SA 4C0OC 4LF9J 4FJ5A 4K0KF 4FXDA 2MZSA 1HWLA 2HLTA 1R0BG 3P3DA 2LXUA 1YBTA 3UE5A 2FPHX 2BJ7A 4M5DB 3SBTA 1PO6A 4YNQA 2KFNA 2PYLA 4OZ2A 3WNEA 4NXNF 1MWZA 2OPPA 3V4IA 3NWGA 4KHPK 4LF8F 3OW2R 3TSPA 1DZ5A 4I6MB 2YJFA 3UCUP 5C2FA 4KI4A 2W9BA 2COLA 2BM0A 2YKMB 2R7WA 4QZVB 4KKOB 1T44A 2XZDB 2EPIA 3MXIA 1TZ0A 3NWRA 4YHHF 4C8KA 4R8UA 3M2VA 3THWA 2A6OA 2OTJS 3V9UA 4DPUA 4FVCA 3M30A 3HSTB 3AVMA 5DM6L 1KC8T 2D9OA 1WTFA 4TU8A 2KQ2A 2VGNA 3D0PA 4TY9A 1CC7A 5F8MA 1VIOA 1NJIT 1SUQA 1H73A 1VSKA 1YJ7A 4Q8FA 2JHEA 4OJHA 4FWLA 3TAQA 1TAUA 5IT0A 1JJ2M 2QA4S 1TL3B 3Q8YA 3O1BA 3TSQA 2ZH1A 1SC3B 2BBEA 1UPMB 2ASYA 1F2GA 4F36A 4LH5A 3VVTA 3PHTA 4YOVA 3AA9A 1YJNS 2Z2ZA 4KHSA 4I6AA 3HF5A 2O66A 1GXUA 2VCPA 3W65A 1EKRA 2AYGA 1OH7A 2D1KA 1F3VA 3D68A 3L2WA 1RP5A 4WYBA 2ZBIA 1K8AO 3K8WA 5BR8K 2I9SA 2P9EA 3P4IA 5JLFA 3BREA 2A0FB 1FFSB 3PTWA 1MU2A 2KG1A 5AXMA 3O44A 1XR5A 2EKYA 2FC9A 1U4BA 1VR6A 4YOUA 3M3ZA 3ZTQA 3GCWP 3WXLA 1VC5A 3PY8A 2E9TA 1MWYA 4ZLNA 3K2YA