3LP0A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
558
structure length
555
Chain Sequence
b'SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
total genus 152
structure length 555
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp0A05
2ILZA 2VG6A 1KHWA 3PX0A 4DTPA 5T14A 4DL7A 5EWEA 1RBRA 1IKWA 1RT5B 3OL7A 1LW0B 4YNQA 1UA1A 2R8GA 4CIGA 4DSEA 4RW9A 1Z26A 2D0BA 4DSJA 3F73A 3CG7A 4CERA 4TN2A 3U3GA 1EP4B 3T5JA 1NK8A 2YNFB 3HPGA 3HM9A 3UIQA 4NLVA 4DL2A 2IDOA 4CIEA 1T8EA 3CO9A 3T5KA 4RUAA 1WLJA 1S1VA 4CGFA 4F4XA 2OPSB 2FBXA 4DTMA 1U09A 5KGXA 3TAQA 1HMVB 1MU2B 3NKYA 2I5JA 4CESA 3V9UA 1S9GB 3PJWA 3MECA 5KG3A 1KCFA 1NJZA 3O3FA 3G6YA 4FJLA 5KRSA 1LW2B 4QWEA 4KV8A 3ZSWA 5KT5A 2KZZA 3CDWA 5FRMA 5KT2A 1IKYB 4RNNA 4FLTA 4ECQA 2E9ZA 1RTDB 3T1AA 4ZPCA 4E7IA 1S1UB 5KT3A 3AVBA 3IN5A 3KNAA 1RT2A 1NJYA 4KHNA 5DQGA 3N6NA 5HRRA 3QZ8A 5CY4A 4KE5A 2DFHA 4MK7A 1JXLA 1CZ9A 1S9FA 1LWFA 4LQ9A 3OL6A 3Q8SB 4JRQA 4DTRA 1WSEA 5FRNA 1SH0A 4M42A 3K59A 3AVGA 4Q0BA 1U04A 2DTUA 3OYGA 3T3FA 1IKXA 2HHUA 1SH2A 4C8KA 4B08A 4DQIA 4LSNB 3GV7B 2G8WA 4FJIA 3HT3A 1C0UB 4E7JA 3AVJA 2HNYB 3KJVA 3CDEA 4CJ4A 5EU7A 1D9FA 4I2QB 2IJNA 2VWJA 3RRGA 4NLQA 3VQBA 2CJQA 1U48A 2HHWA 4F4ZA 4RW8B 4LH4A 1GOBA 4FJ8A 2HAIA 5J1EA 1A5WA 3QEIA 4MIBA 3LP1B 4FLYA 3SNNA 4F4WA 5T7BA 4N56A 3LPUA 4CK1A 4DFPA 3U6FA 3V4IA 2OZMA 4J2BA 1LWCA 3CWJA 3ZSRA 4J9SA 4L8RB 1BCOA 1WSHA 4RNMA 4DEZA 4DU4A 3O4NA 4F8RA 5KFXA 4AHCA 4ELVA 5C24A 4OKKA 4Q8FA 4CEOA 3LZIA 4DSFA 4K8ZA 2W9CA 2A1SA 4FJHA 1N5YA 4QAGA 3KK2B 2Z1JA 1TKTA 1T05B 2W8LA 3KHRA 4CHZA 1F21A 1XWLA 4LSLA 2JEGA 4IKFA 3MF5A 4NCGB 2IAJB 4WE1A 3V6KA 4FJGA 2OPRB 3QEPA 4FM2A 4E7KA 5L1IA 2W7PA 1TVRA 3MEDA 3H08A 3RB3A 2QV6A 2XGQA 4FCYA 4DG1B 5HROB 4EBCA 1N48A 5EWFA 1SUQA 3JYTA 4KAIA 4KKOB 3TAMB 5KFDA 1JKHA 2G8HA 4J9QA 4J2EA 1QAJA 4CJUA 1HYSA 5KFLA 2GV9A 3JSMB 1TAQA 2P1JA 2ALZA 3K5OA 4EP5A 4TQRA 2GUIA 4UQGA 5HLFB 2HVIA 3DLHA 3OL9A 5KG6A 1RTJB 4NLTA 4KO0A 4FYDA 1IH7A 3MEGA 4TXSA 4OKEA 4CK2A 1U4BA 4FS2A 3S9HA 3NH1A 2AU0A 5KFYA 4F4KA 1REVA 4ZPDA 3OYHA 4KFBB 1KVBA 3HJFA 3TQ1A 5DG9A 4BE2A 5JUMA 3UPFA 4ZTFA 1KHVA 2G8VA 1S1TA 3OVNA 2AWZA 1SL0A 4ICLB 2PZSA 3OS1A 1TL1B 4O4GB 2OH2A 3ZT3A 3CJ3A 3BSOA 2AJQA 2V4RA 4OGCA 1J54A 1QAIA 1BQNB 3KK1B 3L3UA 4CIFA 3KHGA 3KLFB 2R8JA 4U6PA 4H4OA 5KT6A 1J5OB 4NYNA 5HBMB 4O3RA 4KB0A 4ZPAA 2FLNA 5KFZA 4FJMA 5E41A 3QEWA 3H2LA 1HPZA 2IS3A 1S1XB 1WNEA 1ZBHA 4HYKA 4KSEB 5L1JA 1TL3A 1ZBFA 2XRIA 3SYZA 1C1BA 5KFGA 3RMAA 3O3HA 2JLEA 3E01A 3DM2B 3H4BA 3PHEA 3BQ0A 2Q3SA 4BDYA 4OGEA 3AVMA 5DLGA 1J53A 4DU1A 4FW1A 4IBNA 1RNHA 4DL5A 5KG1A 3BSNA 1X1PA 4KI6A 4R8UB 1TKZB 2XC9A 4B9TA 4MKAA 3V81B 3LANA 1DLOB 3GIKA 5L9XA 3M9MB 2D7SA 5KGWA 3LAKA 1JLCA 3DLGB 3DRPB 3VQDA 4IH7A 5KFOA 3I0RB 2X78A 1JX4A 3OSPA 1TAUA 3SQ0A 3B6OA 2IC3A 1GX6A 1ITGA 3QERA 5CYQB 1HYZA 2G8UA 3TARA 4CJLA 3IGNA 3RB4A 3MFHA 3OYBA 3FQLA 3IAYA 5KG7A 4K4VA 4YFUA 3DOKA 2YNGA 3PW2A 3WNGA 1VK0A 1SKSA 3TAGA 3PW5A 1C0TA 4Z0UA 1ZYQA 3QESA 4IRDA 2E6LA 1BI4A 3CQ8A 4IG0A 3OHAA 4PQUB 4HCBA 5J2MB 1ZTWA 4KHYA 4DTUA 3NH2A 4B8CA 1T03B 2OPQB 1U49A 4WFYA 2XWYA 3PUFA 1TKXA 2VA2A 4WYLA 2JEJA 3P5JA 5F8MA 1FKPB 4YR0A 3AV9A 5KI6A 2HHSA 3NL0A 3QIDA 4RW4B 2HHTA 4W5QA 1U45A 1LW0A 4EYIB 2P5GA 2WOMA 5F8LA 4ECUA 2AQ4A 4KAZA 4AHSA 1KLMA 4FBUA 1RDRA 4YQWA 4Y1CA 1SV5A 2X6NA 2I1RA 4M3WA 1QTMA 1QS4A 1NKBA 4J9NA 2EX3A 1T3NA 3ZCMA 1X9WA 3V6HA 4HHTA 3ZT4A 2ZKUA 4H4MA 2WONB 3AVCA 4H54A 4J9LA 1S6PB 5K14B 2ETJA 3NGZA 2R2RA 3OYDA 3GIMA 5JXSA 3NDKA 3PR4A 4URQU 3QNNA 3TANA 4IFVA 4I2PA 3ZSVA 3DLEB 4G3IA 3DRSB 2BQRA 3DYAA 3SFGA 1YTAA 2XCPA 4DF8A 4FLVA 4M3ZA 4CCHA 1RBVA 4PWDB 2JC0A 1FKOA 4EEYA 2ATQA 4O3PA 3G86A 5I42B 1S9EB 4F2RA 3G6VA 4AHUA 1FK9B 3QEVA 2Y1IA 1I39A 2BR0A 4K4ZA 2XY6A 3ZT2A 2XY7A 3I0SA 1LWEB 4FLWA 2QKKA 4WFZA 3QLHA 4ED8A 4HVJA 3IRXB 2YKMA 4CFBA 4C8LA 3KTQA 5KT4A 3OYIA 1RTIB 1KSPA 4ED6A 4M3UA 4DQPA 3RR8A 4BWJA 1FXXA 4H8KA 1QE1A 3ULDA 4FJJA 2KTQA 3DDKA 1TK8A 2YKNA 2J6TA 1HARA 3ITHB 1RT6A 4R5PB 3VQ8A 3CDUA 1KVCA 5DQIA 1VRUA 1EETA 4KB7A 3MR2A 1ASWA 3LAMA 4CHYA 4Q5VA 3B6PA 4CJVA 1TP7A 2OZSA 3HVTA 4RW7B 2WB4A 4RZRA 2RF2A 4GC7A 2ITGA 2BRKA 2W9BA 2YHAA 3KLHB 2BANA 1S6QB 3H5XA 3SI6A 2AX1A 2HWHA 2VG7A 2IMWP 1JIHA 1C0MA 3UDLA 3I8DA 4IR1A 2BE2A 2KFZA 3WNEA 2W42A 4CJTA 3WNFA 4PUOB 4OL8A 3O4QA 3V6DA 2HNZA 4KRFA 2V4QA 1JLFB 3VQAA 3QIPA 2G8FA 3QGHA 3NF7A 1RT1A 4E7HA 3QNOA 1BISA 2O4IA 4M95A 2D41A 2R2TA 3DLKA 4DTNA 4ZP7A 4TY9A 4NLYA 3K5MA 4CEBA 4FJKA 1TV6B 1RTHB 3SQ4A 1BQMB 3HP9A 4CHOA 3V1QA 2XCAA 4FM0A 5F9LA 2IAJA 3I5CA 1BIUA 4F4YA 3DI6A 2ZD1B 4E1MA 4WFXA 5CYMB 3NF6A 5C42B 4CJ3A 1KFSA 1RA7A 3M9OB 1NHVA 3PJXA 5KFCA 5FDLB 3NGYA 3T5HA 4KB1A 3L2RA 1TKDA 3D5MA 4U7CA 4Y3CA 2RKIA 4ZP9A 5J2QA 3RAXA 4RUCA 1VSDA 3DMJB 3NH0A 3JSMA 1S1WB 3ZT0A 1JLBA 1L3SA 4AHVA 4K50A 4MK8A 4Y2AA 1NK4A 4GW6A 3IG1B 4TY8A 4I9LA 4G1QB 1X9SA 4QW9A 1VSFA 3MXMA 3LP0B 3P83D 2PYJA 4ELUA 1I3AA 2RN2A 2ASJA 2F8EX 3HVWA 1DTQB 4IH5A 4FS1A 1S5JA 1JLAA 2KQ2A 1I6JA 3T19A 4CHNA 4ZMMA 1HQUA 2VA3A 1LAWA 1N4LA 4QPXA 2DFEA 3KLGB 2VG5B 2ILYA 4IDKB 1SKWA 3CFPA 3VA0A 1IM4A 1N6QB 4O4GA 1C1CB 3L8BA 3OYLA 4CJQA 3FFIA 1JXEA 3IS9B 4E1NA 1BQNA 3H98A 4NYFA 4CJFA 3KLFA 2HNDA 4MQ3A 5HBMA 1B9DA 3VN5A 3CJ5A 3PY8A 2FBTA 4W5OA 4OKJA 2XHBA 3DOLB 1RT4B 4NLGA 1RT3B 3M8PA 3GIIA 4IKAA 2OYQA 2C2DA 1S49A 4F2SA 3UQSA 3M8QA 4CFDA 2GIRA 2IGIA 1HQEA 4AHTA 1Y97A 4DLEA 4O44B 2J6SA 3NCIA 5KFIA 4EO6A 4ECXA 3OYMA 5KFRA 1B92A 1YTUA 3VQ9A 3DLRA 3V1OA 2YNHB 1ZETA 2FBVA 1WAJA 3MEEA 3OLBA 3ALYA 2V0NA 4IG3B 4XPCA 4ZHRA 1R0AB 3LALA 1TQLA 2ZE2A 2ATLA 3HK2A 5KFVA 4MFBB 3C6UB 1RAJA 3BDPA 1JLEB 2GC8A 4TQSA 2ZQBA 4LH5A 5KFFA 2VG6B 4KHWA 1RDDA 1VRTA 3ZSXA 4KBIA 1ZBIA 4CEZA 3KHHA 3D28A 4J9RA 5KFUA 1TK0A 4NLSA 3L2QA 4FJXA 3HKWA 2C2RA 4NYZA 1WSGA 3KLIA 5J2NA 3NF9A 4WZQA 1S0OA 3KK3B 3M8SA 4DTOA 3K5NA 1S1VB 1HNVB 4DTXA 2IM1A 3M9NB 3OYKA 4HTUA 1HYVA 1UAXA 5HP1A 2HMIB 2IOCA 3C94A 4YR2A 4OLAA 1D0EA 4RU9A 1JLGA 1T94A 3QO9A 3MFIA 2I5JB 3H5YA 4O4RA 4TYBA 2FVPA 3MECB 1S97A 3VQ7A 1T7PA 3QETA 3GV5B 1LAVA 2G8IA 1A5VA 4CHQA 4B3OB 4KTQA 3GIJA 2FVQA 5D3GA 4RNFA 3OHBA 4F50A 4HKQA 3KLVA 3T5LA 2UVWA 5F8NA 5KFBA 2FJWA 3SQ2A 1BL3A 2LSNA 2WCXA 4ED1A 3NF8A 1L3TA 1C6VA 3RMDA 4J2DA 1K1QA 5I3UA 1RT2B 3EZUA 2RPIA 1ASVA 1UWBA 5HRSA 3S3MA 3FSIA 1Z4UA 3AVFA 1NK0A 1QSYA 3Q8PB 1EKEA 5J2PB 1LWFB 3S3NA 4J9PA 4B9VA 1YVFA 3AO2A 4CF9A 4Q0BB 3DRSA 2OPPA 4W5RA 1NKEA 2W7OA 3PVXA 2ASLA 1IKXB 4YR3A 4HUFA 2BGGA 1IO2A 1QUVA 4DS4A 4N5SA 3CM5A 2WRMA 3LPTA 4KTZA 1NNDA 3KJVB 2DFFA 3BGRA 3BSCA 4IRKA 2HWIA 4XO0A 3AO5A 4CF8A 2FLPA 3I5AA 2B6AA 1G15A 4M45A 4ZVEA 5KTQA 5J1EB 2UUWA 4FK0A 4OPJA 2AX0A 1RTIA 1XR6A 4I7FB 3RMCA 4M3XA 5L1KA 4M41A 4F3OA 4LD0A 2GBZA 1VSEA 4KI4A 4QCLA 3S3OA 4DF4A 3E51A 1LWCB 4N41A 1WAFA 4NZ0A 3PX6A 1RT7A 1WNSA 4PA1A 3NGIA 3EYZA 4DWIA 3LP2B 5C24B 4XIUA 3SUNA 3HVRA 2YNIA 2R8HA 3SPYA 2W9CB 3L3VA 2O5DA 1D8YA 5HRNA 1RBUA 1IKVA 4LSLB 4O0IA 3VA3A 4DFMA 4WE1B 5C25A 4EO8A 3KD1E 1NK7A 3F9KA 2W8KA 3TVKA 1JLQA 2FJVA 3MEDB 4CJPA 4PUOA 2D3ZA 3KKRA 1SUQB 3JYTB 3ZSOA 2BRLA 1JL2A 4GVMA 1SH3A 2Z1HA 1VSLA 3DRRA 3QYYA 2UVRA 1JKHB 3N6MA 4NLRA 4LY7A 3VQ6A 4Z4HA 2B43A 2KW4A 3VQ4A 2GIQA 3ASMA 1RT5A 1HYSB 1TV6A 4XPEA 4BE1A 4PY5A 1ZTTA 3ZSZA 1QSLA 3KOAA 5F8JA 3MR5A 3PO5A 3CYMA 1EP4A 3H5UA 1W25A 2YNFA 3PW0A 3OS0A 2PYLA 4Y1DA 5KFJA 4KO0B 4DSLA 4EBDA 3MEGB 2XY8A 3CJ2A 4DTSA 3RBDA 2OPSA 4CGGA 2D3UA 4RNHA 1REVB 5FDLA 4ECYA 1IG9A 4N76A 4JV0A 1HMVA 1MU2A 1S9GA 2V9WA 3ZSQA 4R0EA 2XI2A 3KHLA 1LW2A 2QKBA 4C8OA 3LWLA 1IKYA 4RW6B 4GC6A 3OJSA 4FLXA 3I5BA 1RYRA 1RTDA 1XHXA 5KFQA 4FZZA 1HRHA 1BHLA 4FK4A 1S1UA 2XGPA 4NLXA 4YMEA 4DL4A 1B9FA 1N56A 1SKRA 2BQUA 4CF2A 3PO4A 1VSJA 3L2WA 3ZT1A 3VQEA 1HPZB 4IOBA 4FVMA 1CSJA 4JRPA 1DTTB 1TL3B 1NK6A 4TLRA 1C1BB 1X9MA 3NMAA 3NAHA 4CF0A 1L5UA 1YT3A 3VQ5A 1Q8IA 3V9XA 3E01B 5DLFA 4O0JA 3AVLA 1N6QA 4B9UA 2HW3A 3EZ5A 2HB5A 4KHRA 3AVIA 3TI0A 2CKWA 4LSNA 3FQKA 1BIZA 1C0UA 3CFOA 3P1GA 2HNYA 4NCBA 4ED2A 4I2QA 2NUBA 3TAEA 1W9HA 3GQCA 3PW7A 1NKCA 1RT3A 4RW8A 3SV4A 1JLCB 3V6JA 4O5BA 3CM6A 1HNIB 3AVKA 4CEQA 4Z4FA 3LP1A 3MAQA 1GOAA 2IC3B 4CEEA 3AO3A 4DQRA 4CJ5A 1QSSA 2FVCA 4AH9A 4O44A 4QW8A 5DK5A 3GYNA 2W9AA 3PZPA 3SUOA 1GOCA 3SFUA 1Z25A 3DOKB 3OYEA 2YNGB 4K4WA 1RBTA 2P51A 4E89A 1C0TB 5KFAA 1S0MA 3HHKA 2X6SA 1BI4B 4OJRA 4IG0B 4Z4GA 4K4SA 4IFYB 3KK2A 1T05A 1YVUA 3C6UA 2G8KA 2IM2A 1TKXB 4NCGA 4J2AA 1EXQA 2OPRA 4E19A 4JUZA 4CJEA 4KPYA 4DG1A 5HROA 3ISNC 2XO7A 4ED3A 4ID5B 4DFKA 2WOMB 1KLMB 4KKOA 3RTVA 1NJWA 3AVAA 2R8KA 3TAMA 4URGA 4Q43A 3QIOA 1SV5B 3KLEB 4WZMA 3LP3A 2J6UA 4OVLA 2EHGA 1KLNA 1Q9XA 3KK3A 2D0CA 2F8SA 2E4LA 4ZPBA 4O3NA 3UR0A 1HNVA 4CFCA 4H4MB 4FM1A 1SL2A 2DPJA 5KFMA 2IM3A 5HLFA 3OYCA 2HMIA 4QWDA 4O55A 4Z4CA 4CJWA 1RTJA 5DG8A 3BR9A 2HHVA 2Y1JA 2FC0A 4DTJA 3C6TB 4I2PB 4IFVB 2D0AA 2B5JB 3KIOA 4B3OA 3HYFA 3K2PA 2HVHA 3DYAB 4KFBA 3OSNA 1VSKA 1FKOB 3OYNA 4CJSA 1MMLA 5JS2A 3KMSA 2IJFA 2WHOA 3RR7A 4MKBA 4CJKA 4ICLA 2UUTA 2PY5A 4ED7A 2P5OA 1TL1A 4FJNA 4CGHA 3I0SB 4URSA 4FZYA 2RDJA 5KFKA 4KREA 3V9SA 3QLHB 2QK9A 3G6XA 1A5XA 5J2PA 2YKMB 3ISND 3SUPA 3KK1A 5JS1A 1J5OA 3VQSA 5C5JA 1WN7A 3THVA 3QGIA 3NBPB 3G0ZA 4Z4IA 2XY5A 1QE1B 1S1XA 2IA6A 4C8NA 2FLLA 1VSMA 3V9ZA 2YKNB 1RT6B 3KKSA 4MH8A 1S10A 2C22A 3N6LA 4CEAA 3HSTB 3DM2A 3OYAA 4KHQA 1VRUB 1EETB 4Q45A 4JLHA 3OYJA 3HVTB 2OA8A 4M3YA 3WNHA 4QWBA 4E7LA 4KHMA 4EYHB 2BQ3A 2RF2B 4EZ6A 2E9RX 1UA0A 3SQ1A 2W9BB 1RDAA 3KMQA 2BANB 3SZ2A 3K58A 1BGXT 1S4FA 4I7FA 4R8UA 1TKZA 1J9AA 5CZ2A 2VG7B 5F8IA 3CFRA 4IRCA 4CEDA 1UOCA 1NOZA 3L2UA 1RDBA 4W5TA 3QGGA 1L3VA 3CVKA 2BE2B 3V81A 1DLOA 1ZBUA 1D9DA 3BJYA 4DS5A 4CE9A 2F8TA 3NE6A 1CZBA 3V6DB 2HNZB 3DLGA 3DRPA 4FJ9A 3MXIA 4FLZA 2C2EA 3I0RA 5KFEA 3QIPB 3C95A 2FBYA 1RT1B 5KFPA 5EDWA 3NFAA 1EX4A 1RCHA 3DLBA 3LP2A 3DLKB 1RA6A 5CYQA 3HVAA 4OPKA 3OY9A 1IKWB 4Y34A 4DSKA 4EBEA 4IR9A 4RG8A 4CGDA 3NHGA 4RW9B 4CF1A 1S0NA 3BQ1A 5KFHA 1HJRA 4O3OA 2EC0A 1D5AA 4JS4A 4ZVFA 3HPHA 4K4YA 3DI6B 4PQUA 5J2MA 1XHZA 4NLPA 1VSIA 4FJ7A 5DGAA 4NLUA 3CJ4A 1T03A 2OPQA 3LZJA 1FKPA 3EY1A 3PX4A 2E9TA 4RW4A 4X2BA 4CJRA 4KTWA 2RKIB 4FJ5A 1C1AA 5J2QB 1NJXA 3G10A 4DFJA 3KD5E 4CECA 4KV8B 1JLBB 3OS2A 3AVHA 1KVAA 5KG4A 4TY8B 4Q44A 3NAEA 3V1RA 3D0PA 3SUQA 2AGQA 4MK9A 3PW4A 4M3TA 5FROA 2WONA 3AO4A 4K4XA 1S6PA 5K14A 3QINA 4CK3A 2FJXA 4BDZA 1JLAB 4NLDA 4TYAA 2BDPA 3RAQA 4GMJB 4KHUA 1CLQA 3RB6A 3MXJA 4ZP8A 3HXMA 1HQUB 5L1LA 5DGBA 2QXFA 4MIAA 4FK2A 3RWUA 3DLEA 3TABA 3EPIA 1L3UA 2DPIA 2IM0A 1K6YA 4RW6A 4K4UA 4ED0A 2A1RA 3FFIB 4E0DA 4PWDA 4WXWA 3GILA 4OLBA 3FDSA 5I42A 1S9EA 2HNDB 3V9WA 1FK9A 4E3SA 4K8XA 3QZ7A 5F8HA 2R7YA 5F8GA 1S48A 3CJ0A 1SL1A 3K57A 2QE5A 1LWEA 4ELTA 5F9NA 3M8PB 1TK5A 1DTTA 4NRTA 3IRXA 1KRPA 4JV2A 3H40A 5CZ1A 4FXDA 3RRHA 5KRTA 2UVVA 4IQXA 1WSFA 3M8QB 5EWGA 4Q8EA 5EUHA 1HQEB 2UVUA 1Q9YA 5KFTA 2X74A 3V4IB 4AILC 3ITHA 3OL8A 4R5PA 3MTKA 4ECSA 3AVNA 1D1UA 4FBTA 4FLUA 3Q8RB 1KTQA 4BE0A 3VQCA 3MEEB 4M3RA 2HHQA 2B4JA 2WK4A 3ICLA 4ZVHA 4RW7A 4ZHRB 4Z4EA 1KFDA 2DY4A 2ZE2B 1XI1A 1N5YB 3MR6A 4B9LA 1TKTB 4RNOA 3K5LA 3KLHA 4HUEA 1S6QA 1HNIA 4FW2A 4CGIA 1RYSA 3HL8A 4BWMA 3BREA 3VQPA 3HPOA 4BACA 1K1SA 3Q8QB 4F3TA 1ZBLA 1TVRB 1VRTB 3O3GA 5KT7A 4AHRA 1JLFA 3OJUA 4K4TA 5KFNA 4J9OA 5DQHA 2F96A 2AGOA 4ECZA 4JS5A 3AA2A 1LV5A 3TAPA 3KLIB 1CXUA 5J2NB 3LDSA 5DMRA 1WSIA 3TR8A 1RILA 1RTHA 4JV1A 4IFYA 2FVRA 3CIZA 1BQMA 1CXQA 1JXBA 2YV0X 4NLOA 5HP1B 4IH6A 2JC1A 2JEIA 3MR3A 4DQQA 1JLGB 3H59A 3L2VA 2IBKA 3QO9B 2O4GA 1QHTA 4DU3A 2ZD1A 4ID5A 5CYMA 5C42A 5D3GB 4CGJA 2VWKA 1NK5A 3LWMA 2Z1GA 4WXOA 5DG7A 3KLEA 3TWHA 2R8IA 5I3UB 3AA3A 4DSIA 4CFAA 4B8AB 1S1TB 2Z1IA 3DMJA 4LQ3A 1S1WA 1UWBB 3VQQA 5HRPA 4YP3A 3IGVA 3SCXA 1O1WA 4DMNA 4B9MA 2XI3A 3RMBA 4HCCA 3IG1A 4BDPA 1NOYA 3H4DA 2ASDA 3M8RA 2R2UA 4G1QA 4M94A 2C28A 1NHUA 4H4OB 4EZ9A 5SZTA 4J9KA 3LP0A 2D5RA 4O3SA 3C6TA 3QEXA 2B5JA 3GV8B 1TGOA 2OPPB 3BSAA 4HUGA 1DTQA 4DL6A 3EPGA 5KG5A 1W0HA 1XR7A 1VSHA 2WTFA 3A2FA 3TAFA 4ECVA 2KZMA 3PV8A 3SPZA 5KFSA 1JL1A 4QOZB 4KHSA 4ECTA 3KLGA 3PR5B 2VG5A 3AA4A 4IDKA 3H5SA 4QWCA 3BGRB 1RDCA 1C1CA 4B9SA 4C8MA 2B6AB 4CHPA 4N47A 3HO1A 3RB0A 3SJJA 3IS9A 3BQ2A 3AO1A 1XR5A 3NAIA 4FZXC 4ZTJA 1C2PA 3U3YA 4NRUA 3AA5X 4EP4A 3NBPA 5SWMA 3DOLA 1RT4A 4DL3A 5KG0A 2JGUA 2R2SA 3HP6A 3NGDA 3D45A 1RT7B 1WSJA 4B9NA 2E6MA 5KFWA 2JEFA 1OS5A 1QQCA 4ECWA 4ZVGA 4NCAA 2YNIB 1GX5A 3SI8A 3OLAA 1U47A 3OYFA 4ECRA 3ZSYA 4Y2CA 2KFNA 4W5NA 1NK9A 1IKVB 5KG2A 2YNHA 4DQSA 4WYWA 2YHBA 1RBSA 5C25B 4J9MA 3SV3A 3RBEA 4IG3A 4O3QA 1JLQB 2HHXA 1R0AA 3FRZA 1ASUA 2RDIA 4ID1A 2AGPA 4I9QA 4ZP6A 4MFBA 4DLGA 1JLEA 1XC9A 4CEFA 1BCMA 4NLWA 4QWAA 2FVSA 3DRRB 4TSXA
chains in the Genus database with same CATH superfamily
2VG6A 2OTJS 4TVAB 3DXKB 3MCOA 3UCGA 4FSVA 3CEDA 3OL7A 2DNGA 3WEEB 4DR5K 3CC7N 3OW2R 2LEAA 2QMXA 3F73A 4X4SA 1UVJA 1OY8A 1EP4B 2NXJA 1RCXB 2YNFB 3IC1A 5D77A 3P8BB 3VHQA 2DHSA 4NLVA 2QL7B 2EXUA 3M8ZA 2AJ4A 4WBFA 1HNWJ 4DR3J 4FYWB 3VGSA 7FDRA 3W2WA 1J5EF 1D09B 1HMVB 3HDSA 3FZ2A 1NJZA 2ZNYA 3G6YA 3LQVA 1LW2B 5KRSA 2X7IA 1DEJA 4OJ3A 3BGOP 1R8BA 3EKUA 2DHXA 3M8WA 2E9ZA 1RTDB 5F0UA 5GAEU 2HQFA 1S1UB 1BUXA 2VIHA 3AVBA 4F0MA 3IN5A 4ZPWR 3ILLA 2DTJA 2QO3A 2MGZB 3O1BA 2Q0UA 6FDRA 2Z8QA 1JXLA 3BGLA 1UPPA 4LQ9A 2ZOFA 3OTBA 4NE9C 3D2EB 1WSEA 3TWZA 3AVGA 2CZ4A 4Q0BA 4RBUA 3OYGA 4C8KA 2QA4S 2OO4A 3GV7B 2CQ3A 2CDRB 4OLPA 3HT3A 1C0UB 3MMBB 4R0JA 3KJVA 3N01A 2IDLA 3VQBA 4CZCA 3DKDA 2EC2A 3MM7B 3MHYA 1GLDG 1MROB 5J1EA 4F9OA 4FLYA 1IBLJ 1EQ0A 1NXIA 4DR4K 1OSCA 5E33A 4QZVB 4N56A 4CK1A 4A2AA 3H42A 3H90A 5HJXA 3CWJA 1T9VA 3ZSRA 2HYIB 2ZKTA 4L8RB 1Y4ZB 2M5YA 4RNMA 2FJAB 4WJBA 2Z30B 4F8RA 5KFXA 1M1KT 3LZIA 4FKXA 4JNEA 1SIWB 4K8ZA 2A1SA 2VDHA 1T05B 2W8LA 4CHZA 2NQPA 2JEGA 2Q97A 1YBTA 4MDAA 1RLCL 3V6KA 2H4YB 3QEPA 4FM2A 4E7KA 2UUBJ 5L1IA 2Q1LA 3SBTA 2QYGA 2OMLA 3RB3A 5D15A 2HZAA 4DG1B 2AJFE 2OEMA 1N48A 1SUQA 4KAIA 2HURA 2L9DA 4WP9A 2A0FB 4YDUC 5RUBA 4JK9A 3SQGB 1UEVA 1QAJA 1IJFB 4LVNP 1HA1A 4CJUA 4EAHD 2UXBJ 5KFLA 5AJ3K 4OQJA 2DNOA 1ZS6A 4HH1A 3EVWA 2KN4A 3MM8B 3DLHA 2DY9A 4OI1A 3L4BC 4B1ZA 2QLWA 5KG6A 3CDAA 3HBTA 2QWMA 5CQGA 4NLTA 4LF7K 2GWKA 2G13A 3C8YA 3RBXA 3MEGA 1X3MA 2X1AA 1K8KA 1UW4A 3O8MA 4X65K 5A0YA 3G96A 4BR4A 1HR0J 2DRBA 4FWOA 3S9HA 3O1WA 1EQYA 2AU0A 3IBFB 4DHVA 4P2SA 5FIIA 4JI5F 4BE2A 1U2RA 2W4PA 1KHVA 4ICLB 2JX2A 2PIIA 3W0LA 4PG6A 3CJ3A 3BSOA 4LRDA 4L76A 1J54A 4ZVSB 4KHPF 1BQNB 3L3UA 4CIFA 3KLFB 3A3NB 4QS7A 5HBMB 4O3RA 4KB0A 4YB5A 4WQ5A 3M2VB 5KFZA 4X4OA 4M63A 2MDAA 1T9WA 2JDJA 1WNEA 3WXMB 2QWLA 2H3GX 3SYZA 2RHSB 3QBWA 1IBMF 4N8OA 4GV6A 5LMNF 3E01A 3DM2B 1HWKA 4ER8A 2Q3SA 1A7GE 5DLGA 1WC5A 1WF0A 5GADP 1RNHA 4OZ2A 3ZX2A 3VF2A 5KG1A 4QR2A 2ZJRL 1TKZB 1E4FT 4LFBF 3QJJA 2RJZA 1RWUA 2F65A 4USUA 2D7SA 3HFVA 3LAKA 5AFUA 3DRPB 4IH7A 3EGVA 3I0RB 2X78A 4LR8A 2E1RA 3DJCA 3OXFA 3I32A 2CZ9A 5HO4A 4KPCA 2FJBB 5L39A 2CH5A 3SQ0A 4JV5J 2A6AA 1GX6A 1ITGA 5DM6Q 1HYZA 4XDCA 4CJLA 3OUYB 1Q79A 1RUSA 4KH6A 1W7WA 1E6YB 3RB4A 3EXYA 3LGNA 2FD2A 2X3GA 4WP8A 5KG7A 1EZZB 4K4VA 1S5ZA 1N5QA 2K8GA 4UW2A 3GYXB 3TAGA 3PW5A 2YWHA 1ZYQA 5ETOA 2KKZA 3OHAA 3H25A 4HCBA 2QGFB 4KHYA 3NS7B 4YHHJ 3CUNA 3NH2A 1QAXA 1YF5L 4JK8A 2ZHBA 2DXDA 2XWYA 2JH3A 1R27B 5EVZA 3P5JA 3CCMN 4UOHA 5KI6A 3NL0A 1VIOA 4RW4B 4G65A 2HHTA 1KOHA 3HM8A 1LW0A 3HZEA 5F8LA 4Y1CA 4EFHA 3G82B 3CD6N 2P6SA 1NB2A 2I1RA 3K8WA 3GFZA 4BG8A 1NKBA 4U9RA 4DKWA 4X64K 4B3TF 1X9WA 2BABA 4LF4J 1REGX 1FESA 2M0GB 4J9LA 5K14B 1VQNN 3MM9A 2Q43A 3NGZA 2R2RA 1CULB 2F7VA 1X4FA 3DHWC 1TUYA 1FVQA 3OYDA 1EJ7L 2CQIA 1JJHA 3PR4A 4IFVA 5IM0A 3GG4A 4BRCA 3D3BJ 2OTJN 2XCPA 1HNWF 4DR3F 3O5BA 4JD2B 4FLVA 5IWAK 4CCHA 2CNOB 4PWDB 1X5TA 1YSJA 2JC0A 4HR2A 4EEYA 4CO1A 3T69A 1HNZJ 4KH1B 4DV0J 5C7PA 2CPZA 4CH1A 3PXGa 3W66A 1RGVA 2QL5B 3ZTSA 2DNQA 3G8SA 3D1OA 2XY7A 1VLYA 3QLHA 1XQSC 4DL0C 4C8LA 5BR8K 5HL7Q 1Y5NB 4KGVB 3E8OA 3OYIA 1RTIB 1KSPA 4M3UA 3IAS9 3RR8A 3QWPA 2I7PA 3H1VX 1M1KO 2AZ1A 4QOTA 1RT6A 1NU0A 1SJ1A 2F5GA 2MTLA 3CDUA 3ZZUA 2HF4A 4KB7A 3MR2A 1WC6A 1ASWA 4CJVA 2OZSA 5GAHI 3MDQA 1T0TV 2PE8A 1FXRA 3D7SB 4RZRA 2GJIA 1EHWA 5GAGI 2BANA 2HWHA 4P9SA 4DUYJ 2CPXA 2V6AA 4GVBB 3SJHA 1BG3A 4RJVA 3OBWA 3WNFA 2YWWA 3L3CA 3V6DA 2ZWOA 1JNRB 1H74A 1V5IB 4WTOB 1Q86O 2Q6CA 3UDCA 3NF7A 1RT1A 2QA4N 2YPYA 1BISA 2O4IA 4M95A 1EWQA 2R2TA 1IBLF 4ZP7A 1R6YA 2DH8A 1UKUA 3K5MA 2OFHX 2OMOA 1FEHA 2P9UB 3BZCA 4MKYA 3D0IE 4C23A 1Y11A 1WBBA 2XYPB 3QQCD 4K5SA 2GJ2A 4P2FA 5M2RA 4FM0A 4ZVPB 5ETVA 1BIUA 4F4YA 2P8IA 4FPRA 1ZBSA 2RQMA 4JOUA 4TNOA 3FUYA 4QU6A 2OGUA 1YG0A 5CYMB 3R5CA 3NF6A 5D4LA 4AM7A 1RA7A 2HMPA 1P6TA 4ZJQA 2ZJPL 2BE9B 2CQGA 2VB6A 3T5HA 4FOEA 3IRWP 3QJPA 3L2RA 2UUBF 2RKIA 4ZP9A 3RAXA 2OCEA 4K41A 1WBDA 3NH0A 2QA2A 4A8KA 3M3ZA 3QNWB 1O8BA 5F3TA 2DNKA 5C2FA 3IKMA 4QW9A 3T7ZA 3MXMA 3LP0B 3D7EO 3MWBA 3KVGA 1VK8A 2UXBF 3A8KA 2F8EX 3VF6A 1DTQB 1NBEB 2P9IB 4FS1A 5GAEP 3LW5C 1I6JA 3T19A 4PEOA 3NVKA 1I94K 2VA3A 5AQRA 4CTAA 4IDKB 3C16B 3CCRN 4QIVA 3VA0A 1SB6A 3A8EA 4O4GA 3TA0A 4WTYA 3FFIA 1FDAA 3MM5A 1HR0F 3O4WA 4RL1A 3IS9B 3J7ZT 4NYFA 4CJFA 5CYJA 5A2QU 2ZBRA 3ENAA 4F36A 3CGIA 3VN5A 2Y9HA 4QR0A 2ZH3A 3G71S 3GIIA 1SI9A 2QRRA 2VPZB 2DHGA 1R8PA 2C2DA 4F2SA 3UQSA 1JQGA 3IWNC 1WHWA 5AQSA 4PG8A 4JI0J 2VQFK 2GVZA 4QR1A 2R7UA 1HQEA 1YWXA 1WSRA 2N4DA 1Y97A 4DLEA 4O44B 4PPDA 3UVJA 1FFGB 3OYMA 1JXVA 2XTJP 1YTUA 3VQ9A 2EI5A 2Z2YB 1U1MA 2YNHB 2DIVA 2XLKA 2FBVA 3OLBA 2ZITA 2V0NA 3OV7A 4USTA 4H03B 4NYOA 2DO0A 3R9PA 4ZHRA 1FO1A 5HQMA 1TQLA 2X1FA 2ATLA 5K8PA 5KFVA 3U9DA 3FVYA 4B1WB 3C6UB 1CJKB 1RAJA 2HRUA 4ZDNA 3MZIA 2HHHK 4LH5A 2MB0B 2VG6B 4KHWA 2QTWA 3K2YA 2CPFA 2L9NA 3TPQA 1VAZA 4CEZA 3KHHA 4WK3A 1VQ9S 3X3UA 2APOA 2RQ4A 2ADCA 1XERA 3ENVA 3HKWA 4DV1J 1HKBA 1B70B 1S7HA 5MLCV 3JXOA 3NG8A 4JV5F 1S0OA 3KK3B 2KRBA 3C15A 1IXKA 3EUNA 1WG5A 4MDBA 1HYVA 3W2WB 2HMIB 2IOCA 5B0AA 3C65A 4OLAA 4RU9A 2ZVSA 4BR2A 1Q78A 4XK8C 2LYVA 3MFIA 1MA9B 2ABYA 4TYBA 3EGWB 1X0PA 4KIAA 3GIJA 5D3GA 3SK3A 1YJWS 3SQOP 4IWVA 2Q31A 4YHHF 4HKQA 2E29A 4I0WA 1L3TA 4BLGA 1Z1ZA 2XZWA 2Z57B 1IBKJ 3RMDA 4UUXA 1TMMA 1RFQA 2DIUA 1S79A 2MZQA 1Z4UA 1NK0A 3Q8PB 4LF6K 3FZFA 4YOWA 2HGLA 3VMFB 3T1HJ 4IEIA 1ULRA 5AQTA 3Q2TC 4Q0BB 5HI7A 3DRSA 2W7OA 5H1SV 4LF4F 2VICA 3LPTA 5MAOA 1NNDA 5JVHL 3OVAA 3KJVB 5HSPA 1N32J 4IRKA 4H0XB 3AO5A 3MURP 3H6EA 3CCES 4ZVEA 5KTQA 5J1EB 2UUWA 4W98A 3RMCA 4M3XA 2BOPA 1HNZF 4DV0F 1KBRA 2V67A 4N77A 2MYFA 4QCLA 5F0WA 3V4MA 1VQSA 2OFGX 1KAZA 2I8EA 4NZ0A 1RT7A 2HQDA 5T7LA 2O8CA 4QYZK 1WNSA 1ZM9A 1V9OA 1F0XA 2MJUA 4P2MA 3NGIA 2HBKA 5M2UA 4XIUA 4NLBA 5G0RA 4RR5A 3SPYA 1R8AA 4OV1A 2RAQA 2V8GA 1IKVA 2QYCA 3VA3A 1XC3A 4EO8A 3KD1E 3TVKA 3R3LA 1IVZA 3QRQA 2D3ZA 3CJKA 1SUQB 4LFCF 1P8ZA 4GVMA 2UVRA 2BTFA 3N6MA 2F8HA 2HQGA 1VHXA 3BF3A 4LY7A 3FEYB 4DUYF 4Z4HA 2B43A 3R5BA 2CPDA 3ASMA 1VBKA 1RT5A 2AJ0A 1TV6A 1HWIA 5FLXU 2N82B 3QT7A 1U2VA 3TEGA 2OLWA 2QJ3A 1QSLA 3KOAA 1MWMA 3MR5A 3H5UA 4Y65A 1GMUA 3OS0A 1S0VA 3A8IA 5JVGQ 1XNRK 2DEJA 3MEGB 2QG9B 2XY8A 1K8KB 1G7CB 2VJUA 3KK7A 5A0YB 5FD1A 2ZVIA 2QW9A 1MNEA 1OWXA 1YJTA 3M6VA 4NMLA 5FDLA 1IG9A 2DR6A 3QBCA 1NDCA 5GVQA 1VBYA 3J7ZO 4JKGA 2IY5B 3EXCX 4ILHA 4JI8K 3KHLA 3ZZOA 2EFGA 4C8OA 3LWLA 3FMBA 3VZHA 1IKYA 4RW6B 4C48A 1RYRA 1XHXA 5KFQA 5JICA 1BHLA 4FK4A 4OHYA 1ZH5A 1BWEA 1AB8A 1TFYA 2VH7A 4KQZA 1N56A 5A8RA 1SKRA 4CF2A 3PO4A 3O9SA 2WSFC 2Z4PA 1NK6A 3NAHA 4CF0A 1N0UA 2QN6B 2ZUGA 1YT3A 1Q8IA 3E01B 5DLFA 4YUDA 5KQDA 1VQYA 3B54A 4O0JA 3AVLA 1N6QA 4ZIWA 3Q22A 2FJEB 4BRGA 5D8HB 1TELA 3AJ2A 4LSNA 3VZIA 1HD0A 2CWXA 1W7AA 1RP5A 1Q95G 1X31C 2O8BA 2MZRA 3HKZD 1UCNA 4I2QA 3GQCA 3PW7A 1R7IA 1MN9A 4RW8A 3ETMA 1WI6A 4OYBA 4HVZA 2BJDA 4CEQA 4Z4FA 3LP1A 2RRNA 1N34K 3GCXP 2ZH6A 3CF5L 1HL6A 2DO4A 1GOAA 2W2PP 5FLXY 4CJ5A 2E5LJ 5DM7L 1RZMA 3BKTA 3EM1A 1YZ7A 2XYHB 2MPUA 4AQYJ 2ZH9A 4K4WA 1BD6A 1S0MA 1FX4A 2E1ZA 3O9UA 3O44A 2DNPA 1YVUA 3N4QA 3D6FB 2CRLA 1SBRA 3AB4B 3FZBA 4CBUA 3O6WA 4NCGA 5LY3A 2PA8D 2G9OA 4WCEQ 2WAQD 2O1PA 4CYUA 2LDYA 1TTHB 1QQNA 3ZTPA 5HROA 3PIOL 4DZDA 2AMCB 1H6KX 3FEXB 1G2EA 3RTVA 2BYCA 1BA0A 4HTLA 3KLEB 4WZMA 4OVLA 2MY7A 4A8XA 2F8SA 2XWXA 2NPIA 3DDNA 1HNVA 2H65B 1FNOA 1HKGA 5CCMA 2FDNA 4EWTA 4Z4CA 2I38A 4DV1F 2FC0A 4DTJA 1XMQJ 7FD1A 4IFVB 5IM0B 2BW7A 3HYFA 3PKMA 3PTWA 4LRFA 3BS9A 4BGAA 3J7A1 1VQ9N 4HACA 4DPYA 1MMLA 3N9UC 3KMSA 2IJFA 2WHOA 4CJKA 4ED7A 1AA1B 3MN7A 3BEXA 4FWRA 4EHTA 2KDOA 1RDUA 3QLHB 3O08A 3TOQA 1A5XA 1RWXB 1TUWA 4F02A 3SUPA 4YB1P 1OQ6A 1M90O 1TYQA 2H5JB 5AXKA 5C5JA 2ZHAA 3THVA 1WN7A 2VKZG 2I7NA 4CZIA 2KYZA 4U8VA 4IZ9A 2ATCB 5TKWA 3V9ZA 1SJ3P 2EG1A 4A47A 1RT6B 3OBIA 2NYHA 1H7WA 4M5LA 1YJWN 3AHPA 3T1HF 4QS9A 3HSTB 3OYAA 3FZKA 1F3FA 4Q45A 1N0VC 2W1BA 1WI8A 3WNHA 1LFPA 4M3YA 1R6VA 1TMJA 1U2FA 2PMHA 1UA0A 1GFWB 3RUBL 2BANB 5AQWA 1TR0A 5F8IA 1GTEA 3KXDA 5HATA 3US5A 2UXDJ 2QI2A 4B3RJ 2CG4A 1YLXA 1Q0NA 1RDBA 3SAFA 4W5TA 3QGGA 3D2FB 1L3VA 3CVKA 2LCWA 4NEYA 3R1XA 3A8YA 1D9DA 4P71A 4H0OA 2FQQB 1CZBA 3V6DB 3DLGA 3MXIA 4OYIA 4FLZA 3F0NA 3MUTP 5KFEA 3HD1A 1XNQJ 1RT1B 5KFPA 4DR7K 5EDWA 3NFAA 1VQKS 4I67A 4WFBL 3DLBA 3HVAA 3OY9A 5ADZA 4UZCA 1IKWB 2CNNB 4Y34A 2CIMA 4LFAJ 2QIFA 1XUPO 4GO5X 4EBEA 5E3AA 1K0VA 4ITSA 3BPSP 2FHMA 4RW9B 4CF1A 3BQ1A 1B4SA 5KFHA 4OYZA 4BREA 3CCEN 2IFXA 4ZVFA 3LM2A 4K4YA 4PQUA 1XHZA 2JRSA 5DGAA 3CJ4A 4BRFA 1PYOB 2EWSA 1T03A 2Z2LA 1FDBA 3BB5A 1ATNA 3HHLB 1MMNA 1FKPA 1FERA 4YORA 2E9TA 4X2BA 4CJRA 4WU3A 2RKIB 4J8FA 2YX1A 4KV8B 3OS2A 3AVHA 3EMTA 3D6TB 5C10A 1LOUA 1KVAA 3BF1A 2XB2D 5KOWA 4JYAK 1NDPA 2JLFA 3V1RA 3WZ0A 3M8YA 3EN9A 3N4PA 2YJFA 2DCUB 3QINA 1F5CA 2KHCA 2AIRB 2KI2A 3TUPA 4GMJB 2V63A 3P31A 1Y3JA 1P1LA 1X60A 1SJFA 4CTAB 5CXTA 3VEZA 1GXTA 3EKSA 2IM0A 3MMJA 2D9PA 4K4UA 3FFIB 2RRAA 4E0DA 3G8QA 3MM5B 4EFAC 2FYXA 3H1QA 4OLBA 4K2XA 2BJEA 1BWVA 1Y64A 2AT1B 3H46O 4YDUA 2CAJA 1NSAA 4H4KC 4LF9K 2ITMA 1NDKA 3W5ZA 3DLLQ 1S48A 2MQMA 3M6WA 1Y3KA 1VI7A 2QE5A 3FBEA 2AKWB 2B4PA 1VQ8N 1ILYA 1MN7A 4NRTA 3IRXA 1KRPA 4DR2K 3U8XA 4LIRA 1M1HA 1UAWA 1VHFA 4AE5A 2GVZB 4Q8EA 2M8HA 3R27A 2I9SA 1HQEB 2NZCA 1DQAA 3AA8A 2CPIA 5KFTA 4JI2K 2FTRA 3UVJB 5ETRA 3OL8A 1PJ6A 2GFFA 1GLJO 4R5PA 2CUYA 3AVNA 2PI4A 4DV6K 1EO1A 3H45C 2P9LA 4M3RA 1H0HB 2DNMA 4LC9B 2H51B 2UV8A 4DV2K 4ZHRB 4WFNL 2DY4A 4CLLA 1N5YB 4F25A 4X62J 4WK1A 2EBGA 1S6QA 3K17A 1HNIA 4FW2A 1RYSA 2XG8A 1RHUB 4ES1A 3DOMB 4Y0WA 1TVRB 4G6VB 3T41A 2O66A 1AROP 3I55S 2YHXA 4M5JA 3L6QA 5KFNA 4FPBA 3BKUA 3G2XA 2QA1A 1CXUA 3LDSA 2WUSA 5DMRA 5LL6d 4JB8B 1WSIA 1CJTA 2E5LF 3UDEA 1RILA 4JV1A 2FVRA 3C15B 1BQMA 1CXQA 1P9QC 4I64A 1CJUA 4NLOA 1U8WA 2IJRA 2IYGA 4DQQA 2ZM6K 1Q82O 3GONA 1YJVA 4AQYF 2W4DA 2O4GA 3QB0A 3J81Y 1N8RO 4DU3A 2ZD1A 2J76E 4AF1A 4J37A 5D3GB 3DN9A 3TUJC 5DG7A 2YJEA 4LREA 2A18A 1JB0C 2R8IA 2ZH1A 2Z1IA 1QVGM 3DMJA 4OYXA 1AUDA 3VQQA 3RMBA 3C6HA 2HVEA 3IG1A 4BDPA 3QDKA 3TNVA 3R3TA 2OD4A 1ELOA 3PIPQ 1XBWA 1B64A 3THPA 1NG9A 3C6TA 2B5JA 1F9EB 2V8VA 4YN3B 1P90A 1RJJA 3PSIA 4DL6A 1VSHA 1HNXK 4YY3J 2FSKA 2DH9A 5KFSA 3NEKA 3DRXA 3M30A 2EK6A 4V19X 4IYQA 3PR5B 2WB1D 4H5NA 2VG5A 2D4WA 3AA4A 3KHYA 3HD2A 1XMQF 3BBFA 1RDCA 4B9SA 3PYFA 4N47A 1WJ9A 5LSRA 4JI6J 3AO1A 1S12A 3CJBA 4DPUA 2LXIA 1ZPVA 4M7YA 4I4BA 4ZLPA 4ZTJA 4Y2IA 3ETOA 3NBPA 4L3QA 3J7Z5 2Z56B 3RYLA 2OAUA 5IQQA 3HP6A 2K06A 3TX8A 1RT7B 5T7LB 3N28A 2O8CB 2ZFHA 2E6MA 5KFWA 2BBEA 2P9KA 2RUGA 2RHKA 3ZX0A 1QQCA 4C11A 1W2IA 4KH0B 4BC9A 4ZVGA 4NCAA 4OHWA 1HD1A 2KHDA 2KJWA 1GQEA 3OYFA 3G25A 1YBAA 4ILGB 2G4BA 4W5NA 1IKVB 1BWFO 4U7UK 4Z37A 1QTNB 1YZ6A 4IG3A 4CZFA 1IN0A 1ASUA 4B3SJ 4OHVA 3CJKB 1VQ7S 3KDNA 4A61A 2GQCA 4ZP6A 4FVCA 1NZAA 5L38A 1XC9A 4CEFA 4HWIA 4NLWA 2G2ZA 2RS8A 3PX0A 4WKYA 3UKUA 4B3RF 3D68A 1RT5B 3BGUA 2R8GA 1U2VB 1KVJA 1Z26A 1SKUB 3CG7A 3OFFA 3K9JA 2BH1A 2FPHX 1NK8A 1ZAWA 2MKYA 1XNQF 3ENBA 1MWQA 2M4MA 3HPGA 3UIQA 2A5XA 3Q7BA 4O5FA 4CIEA 1T8EA 1RWWB 2HZVA 4LFAF 1UP1A 2B4OA 1G1XA 4CGFA 1ZZNA 2FBXA 4DTMA 1NGIA 2AW0A 3T9NA 4A8OA 3DDIA 3EJMA 3NKYA 4QIEA 3L7PA 4YDDB 4XH1A 4CESA 4JKGB 3PJWA 3MECA 4DX6A 4ED4A 2I0XA 1VQKN 3A4TA 4QWEA 4FXVA 2F9DA 3CJTA 5KT5A 3CDWA 3VVTA 2KZZA 4I6MB 2RB7A 1IKYB 5KT2A 1KXPA 2QZ8A 5CZXA 4ZPCA 4JKDA 4CZHA 2CQDA 1LCUA 5LM7E 5IC4B 3NGRA 4KHNA 5DQGA 1SPBP 3VAMA 2QL9B 1KVKA 1KVIA 3UE5A 5CY4A 3L7OA 3A3OB 5G4DA 4NXMK 1LK5A 1VQPS 1A9NB 4BRLA 4M42A 5GMDA 1U04A 3R6LB 2DTUA 1IKXA 1HI8A 4B08A 5E0OA 4DQIA 4PXCA 5JMNA 4LSNB 2G8WA 4M5HA 4E7JA 3AVJA 2O8BB 2GHPA 4CJ4A 2F4VK 5E5NA 2MKHA 4I2QB 2GO9A 2Y1RI 1D9FA 1SS6A 4NLQA 1T3VA 2CJQA 2DR8A 4LH4A 4RW8B 1GOBA 3QWUA 1WTFA 1NGGA 2HAIA 4H5RA 3ELHA 5HQLA 1A5WA 5D0EA 3LP1B 2EG2A 4ED5A 5EX3A 1HBNA 4F4WA 5T7BA 4N7TA 3LPUA 3V4IA 4J2BA 5BPMA 1NGDA 5AQYA 2V2KA 1N33J 4DEZA 4DU4A 3OFHA 4OKKA 4YOXA 4CEOA 4DSFA 1CLFA 4QAGA 2O3DA 1W97L 1TKTA 2Y8WA 5IZHA 1GEHA 4BC7A 2XS2A 2D3O1 4IKFA 4ISEA 4NCGB 2IAJB 3BGFA 4X4RA 1UWAA 4LF7J 3M6GA 2W7PA 4CYUB 3MEDA 3H08A 4FYYB 1I3OB 4FCYA 3DGPA 3WC2A 5HROB 5K20B 3JYTA 3L9ZA 4HDGA 3SDEA 4X62F 3KJNB 3V5RA 3M5RA 4CNYA 4ZIVA 5BJRA 2G8HA 3CHWA 1YIJS 4J9QA 4J2EA 4ZN3A 1U0HA 3EZWA 4MLEA 2GTDA 3NS5A 3TVYA 2G1DA 4UQGA 1X4HA 1X5PA 2JZ5A 1YRUA 3HHDA 3OL9A 4PAAA 3B8AX 4KO0A 3QSIA 1CC7A 3PACA 4PCQA 1GNKA 4TXSA 1BA1A 3W65A 2P9CA 2VFTA 1J6ZA 1PGZA 1K0TA 4X4UA 1KVBA 4M5MA 4HACB 3HJFA 2G0IA 3TQ1A 3I55N 4RU2A 1SQGA 2FSNA 3OS1A 4LF8J 3TA2A 2DR7A 1NPPA 2LXFA 3R6MA 4CJ7A 1OMSA 2U1AA 3KHGA 4FF2A 1QHAA 5KT6A 1M0SA 4NYNA 4GNIA 1TYQB 1IQTA 2FLNA 3GIRA 1N54B 5E41A 3H2LA 2O67A 3CQYA 4IEEA 2OI2A 1ZBHA 4HYKA 2KT5A 3BH6B 4AXIA 2MZJA 4UY8T 1OH6A 3FBBA 1C1BA 4YB6A 4H5TA 3RMAA 3O3HA 4L6V3 4ZCMA 1RCOB 5B0DA 2EFPA 4WU2A 1X4BA 1WOOA 5CABA 3AVMA 2OEJA 4FWPA 4DU1A 4L75A 4FW1A 4YY3F 4IBNA 3J7YP 5M1PA 4DCJB 2UUCK 3UCZP 4KI6A 4K5RA 3ILJA 3GJQB 3F5TA 4OX8A 2DISA 2IIRA 3EZOA 3GIKA 5L9XA 3M9MB 5KGWA 3KYLA 3DLGB 3VQDA 4N8NA 4MIWA 1NPRA 5D4OA 1MDUB 4JI6F 1TAUA 2MEWA 3AA9A 1ZZFA 2G8UA 2F3JA 3IGNA 3WIUA 2XNQA 2UXCJ 2HLUA 3OYBA 2QFIA 3IAYA 1PAEX 5E26A 3K9KA 1S3XA 3DOKA 1U2CA 2YNGA 1F1BB 1N36F 3PW2A 4MO5A 1X9JA 3HSZA 5DDOC 3A5NC 4BRAA 3CPEA 1C0TA 4Z0UA 4IRDA 1BI4A 1F2HA 1Q8KA 3WXLA 4PQUB 2VGNA 4DR5F 2ZZMA 1T03B 1IV0A 5DETA 4WYLA 1HQ2A 1WSVA 1FKPB 3CW2C 2VWBA 2MQNA 4ILLA 3O2IA 1YKWA 3QIDA 3GJRB 1X4GA 5B7WA 2FF6A 4EYIB 5JMVA 4ECUA 4KAZA 2R3VA 3BPDA 3GZ7A 5IWAJ 1KLMA 1YRTA 3E9PA 4I69A 1RDRA 4G1PA 4CH0S 1E4GT 2NUUG 1SV5A 1QTMA 4OI4A 3EE9A 2W6LA 4PPZA 4C0OC 2JL9A 2B8QA 3CE8A 1J27A 3DXBA 3DXMA 4H4MA 2ETJA 3OFEA 3JXUA 1WC3A 5IOLA 1VQ7N 2PDAA 1WUAA 3GIMA 3MMCA 2RE2A 5JXSA 1J2VA 3NDKA 5KOXA 1FXDA 3QNNA 3TANA 4I2PA 3FGVA 4G3IA 3CJ9A 1YTAA 1FDNA 4M3ZA 1S57A 2PA3A 2XEXA 4LR7A 2M70A 4O3PA 1FNMA 2XZTB 3I9ZA 4F2RA 3A8JA 4AHUA 1LOTB 2DPNA 5BXIA 3QEVA 2BR0A 1IR2A 3ZT2A 1VISA 3I0SA 2DNLA 2R7QA 3I8BA 1URRA 3LA0A 3IRXB 4V19J 2CQBA 2OHDA 3KTQA 2J0SD 2A1BA 6AT1B 5LSLA 4ED6A 5BYRA 2DRDA 2EFOA 4HH0A 1CS4A 5LMNK 4DQPA 4BWJA 3X1LB 3C6AA 1U1PA 4J90A 3ULDA 1FJ7A 2RIJA 4FJJA 1YJRA 3DDKA 2KTQA 1HWJA 1HARA 1RAHB 3NGTA 4R5PB 1RBAA 2P9LB 2DHAA 4LFBK 3IAM9 1VRUA 1Y7PA 3LAMA 4Q5VA 1U1OA 2DK2A 2VODA 2ZJQL 5AQZA 2RF2A 1IR0A 3MM7A 4GC7A 2ITGA 2BRKA 3N5BA 5H9EK 2YHAA 1S6QB 3SI6A 4OZJA 1JIHA 1C0MA 3UDLA 4B3MK 4IR1A 4IO9Q 1HHQA 2KLAA 4M5DA 2VCPA 1HFEL 3WNEA 1VQPN 3CSKA 2V7ZA 4DR6J 4CJTA 3D3CJ 3I87A 3TO8A 3VERA 5HMYA 4QIWD 5E84A 5ETMA 3KG0A 3A13A 4DV7J 4DUZK 3GJSB 4TY9A 3TW0A 4BRHA 4NLYA 1CJTB 3FZMA 4FJKA 4KYZA 1BQMB 4L73A 4CHOA 2F9JA 2Q1NA 1CJUB 2RU9A 3GDQA 3JS9A 1KKHA 1VCTA 1N33F 3Q8YA 2AYBA 5LJ5Y 4BC3A 3DI6A 1QVGR 4M8LA 4USVA 2ZD1B 4WFXA 2MQQA 4PG7A 1UVKA 1YTYA 2QLXA 1SAZA 3M9OB 3LTOA 1NHVA 3SCKE 5B8HA 3B6BA 3PJXA 3PRBA 3NGYA 1VQ4S 2GX9A 2KT2A 4KB1A 1FXLA 2PC6A 4LF7F 1TKDA 4U7CA 1V6HA 4Y3CA 5J2QA 2EFNA 3DMJB 4FWNA 3ZT0A 4X84A 4MK8A 2PGCA 4XEIA 3IG1B 3OR2A 5ELZA 2MKJA 5HMZA 4I9LA 4LBHA 4UY8O 2NRRA 2B4VA 4PYDA 3P83D 4ELUA 4CRJA 3ZNJ1 4RO0A 1I3AA 2ASJA 2ZOMA 2CYYA 1HNWK 4IOAL 3GSDA 4IH5A 1JLAA 4CHNA 4Z7CA 3M30B 1FRLA 3THWA 3JQKA 2BJ1A 2DFEA 4K42A 2VG5B 2EWHA 1SKWA 1BC6A 1YIJN 4HHUA 1K47A 2FHOB 5LXYA 2QX0A 4PHTX 1WDTA 4Y2KA 1JXEA 3UW1A 3R7BB 4E1NA 1BQNA 3AD9C 4JKFA 3B4DA 1T9XA 5AE1A 3KLFA 4CT8A 4MQ3A 5HBMA 1WACA 2XS5A 1B9DA 2FBTA 4W5OA 2KJVA 4OKJA 2XHBA 5IQ6A 2L41A 3H2UB 1RAFB 3LF0A 2GGPA 2HIQA 4NLGA 1RT3B 3M8PA 3MI7X 2JWNA 4IDHA 2N7CA 3R1LA 1PBAA 2KRRA 3PFEA 4OV6A 2QWRA 2CQ0A 2GIRA 2NZTA 3H20A 2J6SA 3NCIA 5KFIA 4EO6A 3JAMU 2J9EA 5KFRA 2WSCC 2LEPA 2VFSA 1SQFA 4CO4A 4IG3B 1NMDA 4XPCA 3GOIA 1QLNA 3Q8VA 1HX1A 1G99A 1HLWA 9ATCB 2BACA 3S6EA 3ENOA 3MX5A 4C0HA 3MK6A 5KFFA 1RDDA 1X4CA 2OEKA 4KBIA 1ZBIA 3G6EN 1QUPA 1URNA 1F3VA 4BRDA 4NLSA 4FJXA 2W25A 3CJCA 2C2RA 5E3QA 5AQKA 4NYZA 3SCIE 2QMWA 1WSGA 3KLIA 4KY3A 3BKFA 4WZQA 3IDHA 3M8SA 3FE1A 1CG2A 2K3IA 2BV3A 4CM0A 5FLXO 5H9FK 1NRKA 3C94A 4BRMA 4YR2A 1D0EA 3P4UB 3MUMP 3QO9A 2W01A 3OTOJ 3H5YA 2FVPA 3MECB 1S97A 5AQNA 3QETA 1LAVA 2G8IA 1A5VA 4HLBA 2VOPA 4B3OB 3HULA 2HRYA 4X66J 4F50A 1IQZA 1X5SA 2LSNA 1F6TA 2WCXA 4CNZA 4ED1A 5JVHQ 1WD6A 1K1QA 5I3UA 2DJWA 2RPIA 2UXBK 4UF4A 3F44A 4DPOA 2M88A 4ILJA 2HFZA 2NRXA 5IWAF 2FSJA 2A3JA 1QSYA 1EKEA 3CI5A 5J2PB 1FE4A 3HT0A 1QQMA 3S3NA 3ONQA 1HLUA 2A3ZA 4ID8A 4YOVA 3J80Y 4PABA 3JAMY 4W5RA 2OPPA 1NKEA 1ZAVA 4OHZA 3PVXA 2ASLA 1IKXB 2BKPA 4YR3A 2BGGA 2CVIA 2OUGA 4QYZJ 3OA9A 5A76A 3EL2A 2BJ7A 2DFFA 2BW2A 1NPKA 3BGRA 4LBIA 4F4AA 3IXQA 4CF8A 5B0EA 5LOQA 2FLPA 3I5AA 1WELA 1S77D 3UCUP 4ERDA 4OI6A 5C2DA 3KJFB 4OIXA 3UNYA 4FK0A 1AUSL 1RTIA 2AX0A 2IMOA 1XR6A 1WC4A 1K8AT 5EXWA 5L1KA 3AT1B 4M41A 4BRIA 2C2ZB 1HBNB 1VSEA 2ZGZA 1Z6RA 3E51A 1KQKA 1SJQA 1KONA 2HSEB 4N41A 8ATCB 1WAFA 3PX6A 1GLCG 4C8YA 3EYZA 2ZOGA 2K7KA 2DGOA 4HT5A 2G0JA 3SUNA 2YNIA 4WF9L 1H1VA 5ADXA 2O5DA 5HRNA 4KR0B 2ACYA 4O0IA 4HT7A 3MOZA 1P27B 2AJ2A 3F9KA 2R7SA 2OELA 3MEDB 4KGKA 4CJPA 2BXJA 3DGPB 1OY6A 4H4KA 1HWLA 3JYTB 3ZSOA 3ISZA 4WIIA 4CVNE 5L9NA 1SH3A 1VSLA 3GFYA 5I3PA 4F67A 2OP5A 3R6GB 4QJVA 2K1RA 5DM6L 2A41A 1U0HB 1PYSB 4XPEA 3KNGA 4PY5A 4H5WA 3D9BA 5DZ6A 2GX8A 1S6UA 4JI5J 1W25A 4PXBA 3PW0A 4DV7F 3BH7B 4Y1DA 4KO0B 3ID6A 2HGMA 3NOGA 2AF6A 1P1TA 4YHHK 1R89A 2D3UA 2OSQA 4RNHA 4NB4A 1U1LA 2WVCA 1NGCA 1MU2A 1MG7A 2HBZB 4MKVA 3Q24A 3QFUA 1S9GA 2BZ2A 2O8FB 1ZM2A 1G6BA 3I31A 4G1IA 1MW7A 2OKQA 3F41A 1S76D 3A1YG 4R79A 3OJSA 4GC6A 1DURA 3I5BA 1S7IA 2UU9K 4FZZA 1I94F 1HRHA 2ZH8A 1U1KA 5TKYA 1KC8T 2DRAA 1OVYA 1X3NA 4NLXA 2YHWA 2IVMA 2BQUA 1ZM4A 5EGYA 3ZT1A 3VQEA 3OFGA 2H1YA 4LF4K 4FVMA 1CSJA 2PO4A 1DTTB 2CPHA 4IFEA 1C1BB 1F5AA 5FPEA 1L5UA 3U27A 3TSQA 3G4SS 2ZEJA 1VQ4N 3QMLA 2LQJA 2HB5A 4KHRA 3TI0A 8AT1B 2CKWA 2HNYA 4NCBA 2R9LA 1GT8A 4DV0K 4ED2A 3TZWA 2AYEA 2NUBA 3S01A 2J8AA 3EGZA 2VUGA 3CXCM 1NKCA 4ZPVR 2QLJB 4O5BA 1K73T 2ERRA 3GE9A 3CM6A 1BOTO 3E9LA 1WUUA 1CBKA 2MQLA 1U25A 1CEZA 3AO3A 2GAHC 2MLYA 1QSSA 2E7VA 3FZHA 2FVCA 4AH9A 4O44A 4UUWA 1Q81T 3LM9A 4QW8A 3GYNA 2W9AA 5K5MA 1GOCA 3SFUA 2MKKA 3SXLA 3GWCA 2CJXB 3BUZB 4C4WA 4BR9A 3TJ8A 3DOKB 2YNGB 1DQ9A 2DGQA 2VBYA 4E89A 1C0TB 3AQOA 1BI4B 4OJRA 4Z4GA 4HTIA 4IFYB 3S8SA 3Q23A 1S99A 2E7WA 3VESA 2NYIA 2B9YA 4JHDB 4JI4J 3C6UA 1CJKA 3I33A 3A3PB 2FGOA 2E2OA 1GAOA 3CCSS 4J2AA 2NLWA 2OPRA 2J7WA 4E19A 4JUZA 2IYIA 3PJ9A 3ZTQA 4B3TJ 3D1QA 3TQEA 3ISNC 2XO7A 4ID5B 5M1FA 1L3KA 4KH5A 4BVPA 4GKJJ 1KLMB 2R8KA 3TAMA 4URGA 4ANEA 2SXLA 4Q43A 2ASMA 1SV5B 2LQ8A 2Y3YA 3CMQA 3HHLD 2J6UA 4LT6A 1JJ2R 3KK3A 2D0CA 1PCAA 3I56S 2IVOA 3UR0A 2PT0A 3DXMB 4H4MB 2HAFA 2KVQE 2DPJA 5KFMA 2IM3A 2NXCA 3WXKA 2HMIA 1S59A 3A5OC 2BKNA 4QWDA 4O55A 2ZC3A 4LR9A 4D3HA 4NX9A 3MMCB 3BR9A 3N79A 4I2PB 3NCPA 3THYA 1FJGJ 1GK8A 2EK1A 4CBXA 2NUHA 5ETNA 4LF6F 2LU1A 2H5EA 1VSKA 3OYNA 4XH5A 5BYSA 2J9CA 3OTOF 4X4PA 1TL1A 4CGHA 3I0SB 4GMKA 2RDJA 4KREA 1I51B 2QK9A 1NZ8A 3G6XA 4X66F 4YOTA 3J81O 2HS4A 1J5OA 1CS4B 4USMA 2LU2A 3QGIA 2VHGA 3PYDA 2XY5A 1NLVA 2IA6A 4C8NA 1WHVA 2Q6BA 4ZLJA 2FLLA 1RABB 4PKGA 3CJAA 1PJ5A 3KKSA 4DX7A 4CD3A 4MH8A 2C22A 3N6LA 4GKKJ 5EOYA 1VRUB 3Q8UA 2YWEA 2D1CA 4UY85 2MKSA 2OA8A 2E8AA 4QWBA 3W5YA 4E7LA 4KHMA 2RF2B 4OJHA 2WVEA 2XMKA 3PLAA 4EZ6A 2E9RX 4RUHA 3SQ1A 4Y0FA 2EPIA 4OYAA 1QZ5A 3K58A 1S4FA 4R8UA 1J9AA 1T6CA 1N5VA 2JHEA 1VQOS 1EIYB 2FGCA 3B4MA 3L2UA 4DV5J 3V81A 4M5DB 1B0VA 1ZBUA 3BJYA 4DS5A 3MPWA 4CE9A 2F8TA 4L74A 2J0WA 2PI5A 2J0QD 1HI1A 2O8EA 1PO6A 4OPAA 1EX4A 1RCHA 4JI0K 4CLKA 4OPKA 3KZBA 1TU0B 2JSXA 4DX8H 3ULHA 3NHGA 1NUEA 4B9QA 2RNEA 1U6FA 2AHOB 3W9JA 4AL7A 4O3OA 3VAHA 2EC0A 3WQTA 1Y5LB 3HPHA 3DI6B 3MPDA 2H54B 1U1RA 4CD1A 2E5JA 2AP6A 5DDRC 2DNZA 3PEJA 3FRYA 3DRYA 1XNRF 4FJ5A 3QBXA 3N5FA 5J2QB 4CECA 2DGVA 3R5JB 1KQGB 1H2TZ 2VONA 4JN4A 1H38A 2RQKA 5KG4A 3OR2B 2HFNA 5AQJA 4DV1K 3R7NB 3NAEA 2HF3A 3PW4A 1FFSB 3ENHA 2CQHA 3QFPA 5GIPA 4U8YA 2WONA 3OPKA 1S6PA 2KHOA 2NRHA 2H3EB 1P8GA 4DR2J 2GA7A 1JLAB 4CZGA 3T6BA 3ZZ0A 3MXJA 4FZVA 4A5BA 1VR6A 3THWB 3VENA 2MMYA 2QXFA 4GVLA 1T9UA 4L72B 2LFVA 3RWUA 4MLHA 3EPIA 3EX7B 2HFVA 3VTIA 3CMES 4HDHA 1K6YA 4RW6A 4ILMA 4ED0A 1KDNA 1ZC6A 1VQ5S 4DV6J 1SZ2A 5THWA 3GFHA 2QC3A 2VC0A 4JI1K 1IBKK 1FCAA 3IFEA 3RRKA 4C3LA 3CJ8A 3CJ0A 3ZYYX 1SL1A 2YX7A 3K57A 4BR0A 2GGPB 1T95A 4FO0A 4PWUA 3M8PB 3ATVA 2N4CA 3VGUA 1WHYA 4JV2A 2UVVA 3HJVA 1VJQA 3T1HK 5EWGA 1PG5B 1D3WA 2XULA 2YKQA 2DR5A 1Q9YA 3P4IA 2X74A 3OVSA 3MN5A 4AILC 1OPZA 3CPWM 4OYPA 2YKOA 1KTQA 3Q8RB 4JKEA 4BE0A 4K25A 1B7YB 1N32K 4CO0A 3GLJA 4ZVHA 1HHTP 4RW7A 1IUJA 2P9PA 2V69A 1WB9A 4B9LA 3K5LA 1E6VB 4DHYA 4CGIA 2QMUB 2RD5C 3HPOA 3D66A 4UQTA 4F3TA 1IR1A 4PXDA 4TLQA 3O3GA 3CCQS 3MAHA 4MYTA 2X3DA 3G4SN 1JLFA 5AZJA 4K4TA 4DCHA 4ECZA 4Y28C 1PJ7A 3KLIB 3TJ9A 9RUBA 2JWLA 1RTHA 3CIZA 2MQOA 3CMAS 2E66A 3BN7A 4HTJA 3QATA 5IV3A 2IBKA 3IFRA 3QO9B 1QHTA 2Z0GA 2KXNB 2GEMA 1NHKL 3VAGA 2E5IA 3LH2S 4IO1A 4JI4F 2BM1A 3TR5A 3KLEA 3BO2A 1UFWA 1XMOJ 1V3ZA 5I3UB 1KP6A 2MJNA 3UE2A 1S1TB 4WKRA 2C2KB 4LQ3A 4IO8A 5HRPA 3SCXA 2XI3A 3QAEA 4GKJF 2VDIA 1TL5A 1YITS 1YRXA 2JOQA 3H4DA 2ASDA 2FF3B 3QRRA 4G1QA 2HHPA 2C28A 1NHUA 4H4OB 4EZ9A 5KPTA 2D5RA 5JVGL 4O3SA 2DNYA 3CCSN 1C0GA 2OPPB 3ZZYA 3MX2A 1FHTA 1NGHA 1W0HA 3EDQB 2WTFA 4ECVA 2KZMA 3PV8A 4QOZB 2JVOA 3GE1A 2OTLS 3H5SA 4QWCA 3BGRB 3SSSA 4JEPA 5CA5A 5AQGA 4NA2A 1C1CA 1FJGF 4CHPA 3HO1A 3I56N 4NXNK 1XR5A 3KUGA 3U3YA 4O8KA 1KD1T 3M1FA 5C2GA 4WP3A 5KG0A 1UVIA 1FE0A 5C15A 1WSJA 5JLHA 5AZIA 1FRMA 3VWSA 2KT3A 4V19S 4ECWA 2YKAA 1X7VA 2YNIB 2HPUA 2CZVC 2WBNA 3O6QA 4LFCJ 1U47A 1T9YA 3U1LA 3P45B 5ETKA 2QTDA 1SC6A 4M5GA 3VGMA 4DQSA 4GVEA 4WYWA 5D0RA 2QWOA 1U6ZA 3SEOA 3TZZA 2R7TA 4DR7F 4RX6A 4GKKF 3D2FA 2V2VA 1PKUA 1R0AA 3FRZA 1PSDA 2GMHA 3D54A 2AGPA 4I9QA 2DEIA 2VPXB 1YDLA 4MFBA 4NYPA 4DLGA 4ZVUB 1JLEA 2Q66A 1NWKA 4QWAA 3CC2S 2LXUA 4TSXA 4PG4A 3CIMA 1KHWA 5T14A 1IKWA 3BO3A 2K1RB 3UB5A 4DV5F 4YNQA 1XEZA 1UA1A 4FWKA 1RWOB 4DSEA 4RW9A 2BUNA 3THXA 2WSEC 2D0BA 3FBFA 1VIXA 4CERA 3U3GA 3T5JA 4BY9C 1RWPB 2RS2A 4IOCQ 2VV5A 3HM9A 2RT3A 1VBXA 1VQLS 4DDFA 4YEAA 1VQON 4RUAA 2GAGC 5A8KA 4F4XA 3M2UB 5KGXA 3HHLA 1BO5O 3TAQA 3NMUA 1MU2B 4WCEL 3C2PA 4GV9A 4OZ5A 3MDFA 1S9GB 5KG3A 3TZXA 4FJLA 3ET6B 4KV8A 3ZSWA 1WEZA 3TP2A 5FRMA 4RNNA 2BMBA 3TTCA 3T1AA 2XHWA 4FNHA 4YS2A 2E2NA 3UO0A 3Q86A 2F4VJ 3CCUS 1OY9A 1M1GA 1WKLA 1NJYA 3FKBA 3WX4A 2NPFA 3N6NA 5HRRA 2W24A 4JP8A 4KE5A 2DFHA 4OHXA 3Q0AA 3UD4P 3LOUA 1S9FA 2DYAA 3OL6A 3Q8SB 1RKIA 2GCFA 1SQEA 4DTRA 5FRNA 1SH0A 3CD7A 3K59A 1FKAF 3CXCR 3T3FA 2EEYA 4KJIA 1YVNA 2YPZA 2ZF5O 3WXIA 5HN0A 1S22A 3ZX3A 3GG0A 4DR2F 1AFJA 2HNYB 3CDEA 1WDDA 1UVMA 2VWJA 2KKHA 2QLBB 4J91A 3AY9A 2HHWA 4F4ZA 2HEKA 4FF4A 3NNCA 4FJ8A 1ZAXA 4DV6F 4ZVOB 4MIBA 4ZITA 3FEZA 3MMAA 4DFPA 2D0PA 4H5VA 1LWCA 5D4NA 1RAGB 3T1YK 2HSTA 3IM9A 1BCOA 4DV4J 1WSHA 3DU6A 4CO3A 2LEBA 1VQ5N 3S1TA 4CZKA 4CLPA 4AHCA 5BR9A 2V8DA 2W9CA 2XZDB 1N5YA 3K0JA 2Z1JA 4NI2A 1U7LA 1F21A 4LSLA 3MF5A 2WW4A 2HS0A 5CD4H 4ILRA 2OPRB 3DOMA 4A8QA 2UXDK 1TVRA 4B3RK 2AJ1A 1RXOB 4KRWA 2YX4A 1UVLA 1DQ8A 5E3PA 4LF5J 3HSJA 4EBCA 5EWFA 2VPYB 4QYRA 3OT9A 1XMBA 1R3NA 1Q7YT 3TAMB 4OI3A 2R7OA 1JKHA 5AR0A 1WWHA 4USKA 2AEFA 3TX0A 4MO4A 1XNQK 1OO0B 2ZM6F 3QRPA 2EW9A 4BQZA 4RKUC 2DHHA 3VVUA 3R5AA 2DNRA 3JQMA 3TUZC 1Q5YA 4LFAK 3AD7C 3JSMB 1TAQA 2P1JA 4EP5A 4TQRA 2CPYA 2HGNA 2WTUA 1RAEB 1KQSM 2HVIA 4OI0A 3HZGA 4DU8A 3ZC4A 4C7QA 2FC9A 1NSQA 4FYDA 3MUVP 3CDBA 3THYB 4OKEA 1EX8A 2CWKA 2HFSA 4RLEA 4WFAQ 2ZWHA 2CQPA 3ZFVA 4F4KA 5A2QY 3CCQN 4ZPDA 3OYHA 4FXWA 3CNQP 5DG9A 5JUMA 3UPFA 4ZTFA 4HI2A 4C3KA 3OVNA 2AWZA 1SL0A 3MGJA 5E3RA 2G0CA 1TL1B 2XLJA 2OH2A 3ZT3A 4QU7A 1CZAN 2AJQA 2V4RA 4OGCA 4XDDA 3D6HB 3KKFA 4U6PA 1J5OB 4P73A 1RHQB 2ZBPA 4LF1A 1XMOF 4ZPAA 2DXEA 2P9NA 3QEWA 1NO8A 4C8ZA 1HPZA 2C3PA 3RAMA 3RU0A 2M2BA 4KSEB 2B56A 5L1JA 4EMDA 4LRBA 3I4HX 5ETTA 4JBCA 3I82A 3U4LA 2JLEA 2J0XA 4A8MP 3VTHA 3H4BA 1NM1A 1OKJA 2VPWB 5F3ZA 1NEEA 4OGEA 2C1EB 1MSWD 2FIUA 3P6YC 3GFXA 1RDWX 2D1KA 3BSNA 2R4FA 3O5TB 3OTDA 4R8UB 3O80A 1KAXA 3L95X 4B9TA 1YITN 5DRKA 2HVZA 1HJOA 5D0HA 4MKAA 3V81B 3LANA 3DLLL 2LQ5A 1N52B 2CJAA 3ZEUA 5KFOA 3JSRA 4DN0A 2O8EB 1U26A 1JX4A 2KM8C 3PRDA 3B6OA 4CI6A 1XIQA 3TARA 4U67Q 2ACMA 2OTLN 2BJ9A 2UP1A 3MFHA 3BDEA 4OZLA 4ZPTR 3W3DA 4ES3A 4D3GA 4YFUA 1ZA2B 3WNGA 3MPVA 3HFZB 3NGUA 3QESA 2NXEA 2BE7D 3CQ8A 4IG0A 3KWGA 4MJKA 2DGTA 1ZTWA 5LMUK 3GYGA 2A2CA 5ADXH 2WVBA 1U49A 1VQ6S 2COLA 2JEJA 1Z2ZA 4DR1J 4FF1A 2HHSA 4F0KA 2J9DE 3KG4A 2UV8G 3SMPA 1U45A 2P5GA 4AHSA 1HBMB 4YQWA 3BZKA 1VQMS 4ALZA 4M3WA 5E2QA 1QS4A 2P2CB 4J9NA 1T3NA 3UD5A 3ZCMA 5IT4A 2AYGA 3ZT4A 2WONB 3AVCA 1S6PB 3R8EA 4AL6A 4RUBA 4EK2A 4RBVA 2GZOA 5C2CA 4OJ1A 2F9TA 3CC2N 1VK3A 1XK8A 3ZSVA 5JJBA 1EKSA 2G2YA 4LSZB 4DPXA 3ULEA 4I6MA 3J81j 5LJ3Y 2L48A 2F4FA 4W4MA 4E2FB 1PYTA 2ATQA 2N7YA 4H0VB 3G86A 3GBTA 1YK9A 3J8AA 2Y1IA 1I39A 4K4ZA 2OD6A 7AT1B 4BRKA 2ZJQQ 1UJ6A 2QKKA 4WFZA 1VQLN 3IP0A 3QMQA 3CPWR 4F3MA 4HVJA 1XTZA 2YKMA 4CFBA 2GS8A 5BPLA 3TTFA 3LDOA 2R42A 5KT4A 3VALA 3DXSX 1UZHA 3PNIA 2F4VF 1KR4A 4UOGA 1FXXA 3CJSA 5F41A 1QE1A 3M1VB 1CQNA 1TK8A 2YKNA 2YHYA 4YY3K 3MN9A 3VQ8A 2EFQA 2VU5A 4FPIA 4DUZJ 3QFWA 3CJQA 1EETA 1V5VA 2C2MB 3B6PA 4PKIA 1TP7A 3ZTOA 3HF5A 2HBRB 4RW7B 3CCUN 2P9PB 5CE3A 4MMOA 3IUCA 2GNKA 3J80O 1Q7YO 1H73A 3JAMO 2AX1A 4JI6K 2VG7A 2IMWP 3T9ZA 3EE3A 4CIOA 3I8DA 3L7UA 4NA1A 1OVQA 2KFZA 4PUOB 4OL8A 2HNZA 4KRFA 2V4QA 1JLFB 4FPAA 3I96A 5AZJB 4PRFA 2L3MA 3QGHA 5AQVA 2ZBQA 3QJLA 5HVGA 2V9KA 4E7HA 3QNOA 2XSFA 2D41A 3AH6A 4FNIA 4ZVRB 4DTNA 3DAWA 3KUEA 2I2YA 3PRVA 4Q2MA 1RTHB 3SQ4A 3HP9A 1YX2A 4KGMA 3G71N 1KQFB 5HQ8A 3V1QA 1X8DA 3MTJA 2XCAA 2BM0A 2IAJA 3DC2A 1YJNS 4DV4F 3B8HA 3CERA 3C14A 1Y9OA 1Q4RA 3CULA 3MXHP 4E1MA 2CXEA 4IOAQ 5AQMA 4B3SK 3BP8A 5EY4A 3IR5B 4CT9A 3M7VA 3D5MA 2ZDPA 1H2UX 1VSDA 4LF5F 1JLBA 2C3MA 1VBZA 1L3SA 3WT0A 4K50A 2Z58B 1NK4A 2ZH4A 3VQTA 4GW6A 3FJ2A 4G1QB 3SCJE 1X9SA 1VSFA 2JLGA 4NEZA 3CO0P 3FMWA 1NH7A 4NZ6A 2DT9A 3CB4A 3ENWA 4ZMMA 1EWRA 2P9SA 5HVHA 1M5HA 1LAWA 1N4LA 5GIOA 1U1NA 1N5TA 2RH3A 1IM4A 1VJWA 1C1CB 1VC0A 1RWKB 3L8BA 3OYLA 1NAQA 4CJQA 4PXEA 2ZH7A 1DZ5A 1JNZB 3H98A 2HNDA 2PAVA 3CJ5A 4FN5A 3IM8A 1TUGB 3GR1A 3FZLA 1JK9B 4ZVTB 4IKAA 2VBZA 4BRQA 1S49A 2P9EA 2UUCF 3TYTA 1XJWB 5AZIB 1QJHA 3UN2A 4CFDA 2IGIA 2V7YA 4OO1J 4AHTA 1RWVB 3IWLA 3IBWA 3MAAB 2GVDA 2MLZA 1WKKA 4ECXA 5HAOA 2QM1A 2B8PA 4DB3A 2HBJA 1NMNA 4YOUA 2Y8YA 3V1OA 3DU5A 5LL6Z 4JI7J 4OZ3A 2F9WA 3ALYA 5M1KA 3KDOA 2J7UA 1R0AB 1EB0A 3LALA 2MKIA 2ZE2A 3HK2A 2YY3A 5IT9O 3LUYA 4MFBB 5H9FJ 1JLEB 4DV3K 3RVCA 3J7AP 3VEVA 2GC8A 3O3LA 4K0KK 4TQSA 4U96A 2MLXA 4DX5A 4NZ7A 1JJCB 2HIYA 3HMJG 2BKOA 3I6PA 3THXB 4BRPA 1TK0A 4OX9K 3CCRS 2CVEA 4PL8A 1N33K 3OR1A 5KQ8A 1YJUA 1FJEB 1Q86T 5CHCB 5A8KB 2IM1A 3M9NB 2DR9A 3UNGC 5K8OA 4BG9A 3OYKA 4HTUA 4DTXA 1UAXA 1A0OB 4E1JA 1UVNA 4JKAA 2E7XA 2KXFA 2GW8A 2VZ9A 3O9TA 5AT1B 3O1LA 1LQ9A 3BM7A 1T7PA 4FYXB 5LXRA 2FVQA 4M1KA 4A2BA 2W4CA 3OHBA 2RILA 2YX6A 3WX8A 1GXUA 3AQPA 4DI6A 5KFBA 3SQ2A 3C19A 1UEKA 3NF8A 2DB1A 2UUAK 3HRGA 1C6VA 3ZZPA 4DR1F 2K2PA 4J2DA 3DFEA 2B9XA 3EZUA 2E5HA 4I68A 1UWBA 1KS2A 2POKA 5HRSA 3D2WA 3FSIA 2E2PA 3AVFA 4YDXA 3FC9A 1T11A 2MSSA 3D0HE 1VQ6N 4B1XB 1YVFA 4PWWA 1QDUB 1QUVA 2C3OA 2IIHA 2A2DA 4N5SA 1VC6A 2HQ3A 1I1GA 4KTZA 1NSKL 2CJ9A 4CI0B 1VQMN 3CD5A 5IXUA 4XO0A 8RUCA 5CCLA 4WF9Q 4LF8K 2YI1A 1SJ4P 4PR6A 4M45A 1UMJA 2D74B 3ADAC 3SMZA 3UDVA 3J7YU 4I7FB 1HW8A 4I6WA 1WF2A 3HFKA 4LD0A 4KI4A 3MMAB 3L0QA 4DPWA 1RE1B 2IPOB 1RAIB 1LWCB 1FWKA 2HWTA 3PDNA 3S41A 1GTHA 2RQCA 4B3MF 2GQ2A 3LP2B 2ZWPA 2EKNA 1NGFA 5GADI 3HVRA 3W62A 1VRQC 2W9CB 1D8YA 1ZPWX 4NI2B 4LSLB 2CPJA 2F40A 4DFMA 4DUZF 4OX7A 1NK7A 5AQIA 5A6WA 4RBTA 1JLQA 4NWBA 3IMXA 4FOIA 2KL8A 3QPIA 1OIAA 1G4CA 1RAOA 3KKRA 3A0IX 3LO3A 4W92B 1KQSR 2ADBA 3NWGA 1X4EA 1EAYC 2Z1HA 4ISFA 4QBUA 1JKHB 4NLRA 3VQ6A 2CG8A 2KW4A 3VQ4A 2GIQA 2LA4A 4RCHA 1FJCA 2HBYB 2VYPA 4FWLA 1ZTTA 4CH7A 3CCJS 2UXCK 3LPYA 1D8ZA 3FSXA 1HKAA 2UU9J 5F8JA 1GMWD 3PO5A 3CYMA 1C4CA 2PYLA 4CLFA 4DSLA 4I56A 4EBDA 2W40A