4CF2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf2A00
3TARA 1ITGA 4R5PA 2YNHA 1S9EA 2HHXA 1B92A 3TI0A 4XIUA 1XI1A 4CK3A 1X9WA 3P1GA 4JS4A 3ZT1A 4DTPA 4B9TA 1VSIA 1TKZA 4CJPA 5KRTA 5HP1A 4ZTFA 1LW0A 4HVJA 3D0PA 1RILA 3CG7A 4ELVA 4J2DA 1KLMA 2QK9A 2KFNA 4O5BA 1TK5A 1D5AA 4B9LA 3LAMA 4BDPA 3O4NA 3U6FA 1NKEA 4QAGA 3UIQA 1T05A 1JXEA 1VSHA 1LWCA 4KV8A 1NK7A 4F3TA 3QIPA 3AVFA 4OLBA 1GOAA 2BGGA 2WONA 2ETJA 3NFAA 3L2WA 4PUOA 4M42A 4CECA 4FJ8A 3RMAA 3C95A 4FJIA 3SUQA 2IAJA 4PQUA 1BHLA 2JLEA 1IG9A 4Y1CA 5HRNA 4J2EA 3ZT0A 4OLAA 1FXXA 1SL1A 4DTMA 3KD5E 3OYFA 1RBSA 3SPYA 3HVTA 1L3UA 2YNFA 3A2FA 3O4QA 4KTWA 4CGJA 3HL8A 3VA3A 2O4GA 1B9FA 3DLKA 1JLAA 2HHTA 4CJRA 2RPIA 3DLBA 3DLHA 1JKHA 1S6PA 1WSJA 3KJVA 3I0RA 1QSLA 1EP4A 5DK5A 3MXMA 1ASWA 4N47A 4L8RB 4FW1A 1KVAA 3SQ0A 4NCGA 3OYAA 3S9HA 3ASMA 3HK2A 1LAVA 1SKSA 4CJKA 4HHTA 2KW4A 1FKOA 1HQUA 3IG1A 4NYFA 1S5JA 1RTDA 3IAYA 1FK9A 2VG5A 3SQ2A 4E7KA 4ID1A 3QNOA 1UOCA 5J2PA 4FJGA 1SL0A 2PYJA 1JLCA 3SV4A 1KVCA 3RWUA 3C94A 1JXBA 4RW4A 3OYLA 4FK2A 1LW2A 3CYMA 3NGYA 4CFBA 1C1CA 3OYGA 1ZBFA 1IKVA 3MECA 4FYDA 3AO1A 3HYFA 4JLHA 3VQAA 4C8KA 2ATQA 3AVMA 3HT3A 2PYLA 1QTMA 2LSNA 3NGZA 2HHQA 1BIUA 2DFFA 3ZSVA 4AHSA 2Y1IA 3M8RA 2BDPA 3KLEA 4BE0A 4FCYA 4M3WA 2G8IA 5HRSA 1ASUA 3VQ6A 5CYMA 4DFKA 2FBXA 4RW6A 4KB1A 1HPZA 3OS2A 4KI6A 3NF9A 1TAUA 4F8RA 3LP3A 5E41A 3WNHA 4RW7A 1NKCA 4W5TA 3OYJA 1S9GA 1BCOA 2HNZA 4Q0BA 4JRPA 2QKBA 4HUGA 3L2QA 1L3VA 4CCHA 4OGCA 3ZT2A 1RDDA 5HLFA 3DYAA 2Z1IA 4CJQA 3K57A 2HHUA 4CESA 3DOKA 2E4LA 1U47A 1RBUA 4CEZA 1D8YA 4LD0A 3DM2A 4LH4A 5FRNA 4CK1A 1NK5A 1IKXA 5D3GA 1ZBIA 4N41A 4M3UA 3LDSA 4DSKA 4KHQA 3HJFA 1TGOA 1BIZA 3VQ4A 2AJQA 1YTUA 3QINA 4UQGA 3AVCA 4KHWA 3ZT4A 2DY4A 3LZJA 4CGDA 3VQBA 4DS4A 2F8SA 1C6VA 2VG6A 1DTTA 3ULDA 3E01A 4IG0A 4O0IA 4DFPA 2GBZA 1MU2A 4KTQA 4KHYA 2E6LA 3LPUA 1RBTA 1BISA 3AVNA 1RBVA 4M3ZA 3LP0A 3KK3A 4FJXA 1BQMA 4LSNA 3SNNA 1NJZA 4PY5A 5KGXA 1WSFA 4EP5A 2HB5A 4N56A 2IGIA 4FJ5A 1JLEA 4LH5A 4DQIA 1HYSA 2A1SA 1NK0A 4I9QA 5JS1A 3M8PA 3SPZA 1KFSA 1HYVA 3HM9A 1LV5A 1RT4A 2X74A 3NBPA 4OPKA 1U4BA 2G8UA 2DFEA 3RRHA 4CF8A 4DU4A 3PX6A 4EZ9A 3PUFA 1HYZA 2WOMA 4OVLA 1LWEA 4CERA 3M8QA 1BCMA 1QHTA 3AVLA 3KD1E 1IKYA 3AVAA 3V1OA 4ID5A 4CHZA 4N5SA 1KRPA 3SV3A 3H08A 5SZTA 3F73A 3OJUA 1XWLA 2EHGA 4FVMA 4FW2A 3VN5A 1RNHA 3OYMA 3V81A 3S3NA 2RN2A 1TK0A 1NOYA 2OYQA 4C8OA 1DTQA 1X9SA 2OPSA 3AVKA 2HHSA 3F9KA 4ICLA 3RMDA 3NHGA 1RT1A 4DFMA 2A1RA 4CJWA 2XY6A 3OVNA 1KCFA 1ZBLA 3T3FA 4NYNA 4B9SA 2GUIA 2BANA 1VRUA 4KTZA 4FLWA 2RKIA 3LAKA 4BWJA 4KFBA 1NKBA 1WAJA 5CYQA 3HP6A 4OGEA 3G10A 3TAFA 4Z4IA 4H4OA 4DTXA 2HNDA 4C8NA 3OS0A 3QERA 4CHPA 3QESA 4NCBA 1X1PA 4M45A 4FK0A 3TAQA 2X78A 3NDKA 3DRSA 2FBYA 4DU3A 3QEVA 2X6NA 3AVBA 4GW6A 4B9NA 4KPYA 4HTUA 1QSYA 3VQ7A 3OY9A 3V9ZA 4O44A 4DTOA 1HJRA 4GMJB 5HRRA 3K5NA 4IKFA 4KREA 2P51A 2Y1JA 1QS4A 1VK0A 3ZT3A 3AO4A 1CXQA 1DLOA 4RG8A 1XC9A 2ZD1A 4CEFA 4WE1A 3AVGA 1EXQA 3HPGA 3SQ4A 3PX0A 1A5XA 1NK9A 3VQDA 2OPPA 3TANA 4KB0A 4FLZA 1CZ9A 3RR8A 4DQPA 4E7JA 1TV6A 4CGIA 4ZHRA 3AA4A 1EETA 3C6UA 3ZSQA 4Q5VA 3RR7A 1Q9XA 5CZ1A 3CM5A 4CGHA 4KHNA 3AO2A 3ZSZA 2HMIA 2HVIA 3OYCA 3MEDA 4B08A 4FLVA 3V9WA 4Z4EA 1VSDA 2D5RA 1O1WA 4KO0A 1SL2A 1YVUA 4FZYA 4AHCA 1G15A 2GV9A 4KHUA 4W5QA 4CF9A 1RT5A 3NF6A 1EKEA 3CFOA 4IFVA 4DTJA 1T7PA 1LWFA 4FK4A 3LP2A 3ZSRA 3L2UA 3ALYA 3QETA 4YNQA 3U3GA 3P83D 3ITHA 5FROA 4KRFA 3DOLA 3SUNA 1UWBA 1KLNA 4FJJA 1C1AA 1SV5A 3HPOA 4CF1A 1XHZA 1TL3A 4CF2A 4B3OA 3O3FA 4FM2A 1VSLA 3WNGA 3ZSXA 1TL1A 4CJEA 4IFYA 1WLJA 1T8EA 3JYTA 3V9XA 4C8LA 4Z4FA 3AVIA 3V9SA 2XHBA 1U48A 4AILC 4M3XA 1CZBA 4C8MA 1Z25A 3VQQA 3MXJA 4CHQA 3VQ5A 2Q3SA 3L8BA 1ZBUA 4BDYA 1WSEA 4DF8A 4H8KA 4FZZA 1TKTA 1S1UA 2EX3A 3L3VA 3NF7A 3TAMA 3TAGA 5DMRA 4G1QA 4IDKA 1X9MA 1YT3A 1GOBA 2HW3A 1C0MA 3KTQA 4J2BA 1IO2A 1J54A 5T7BA 3RMBA 3LALA 5HRPA 4E7LA 4DQRA 4N76A 4CJ5A 4CJ3A 3NCIA 3WNFA 3SUOA 1NK6A 4E7IA 1NJYA 2HHWA 2FBVA 3RRGA 2G8VA 1LAWA 1K6YA 1VSKA 3AV9A 3PX4A 4HUFA 2OZSA 5KGWA 1T03A 2YKNA 3KKSA 1C1BA 3U3YA 4F2RA 3KK2A 4DTRA 4HCBA 1QE1A 2ZE2A 2OA8A 2B5JA 4DTNA 1REVA 2QKKA 3EYZA 1RT3A 4DLEA 4DLGA 2O4IA 1HQEA 4BE1A 1WSGA 1CXUA 2XY8A 2B4JA 4I2QA 1JLBA 3KLIA 4CHOA 4B8CA 3SUPA 1NK4A 4CFAA 4Z4CA 3LWMA 3AO5A 3BGRA 2FC0A 2D0CA 5J1EA 1RTHA 2X6SA 3SI6A 1C0UA 3KLGA 4LSLA 4W5NA 4E1MA 3DLGA 2PY5A 4M3YA 2KZMA 4DTSA 3OS1A 4B9MA 4CEAA 3ZSWA 4AHTA 4BACA 2G8WA 4QOZB 2P1JA 4DQSA 1IKWA 4DSFA 4BWMA 3NF8A 2PZSA 1EX4A 1NJXA 3V6DA 1W0HA 3AA2A 4TSXA 4Z0UA 1RDBA 4B8AB 4PA1A 4CE9A 3OYHA 3L2RA 4DF4A 5J2QA 1VSMA 3TWHA 5CY4A 4I2PA 5JS2A 2G8HA 3CFPA 2IC3A 1SKWA 4CJVA 3OYKA 1BQNA 5EU7A 4FLXA 4FJNA 2RF2A 3THVA 1L3TA 1JL2A 1R0AA 4NCAA 4CHNA 1U04A 4CF0A 2FBTA 4OKJA 1JLFA 2B6AA 2DFHA 1L3SA 4E0DA 1ZYQA 3AA3A 4CJUA 1WSHA 4AH9A 3OYIA 3QO9A 4ELUA 2KFZA 1S1WA 1WSIA 3L3UA 4I7FA 4FXDA 3KLHA 1J53A 1RT6A 4E1NA 1Y97A 3T19A 1TK8A 4E89A 4FZXC 4IBNA 1VSJA 2BE2A 3HO1A 1S1VA 2ZQBA 3S3MA 3LP1A 5KRSA 1WNSA 3PV8A 3CFRA 2HNYA 4CJLA 4YFUA 3O3HA 1NOZA 3DMJA 3NH2A 1RBRA 1YTAA 4DSIA 1XHXA 5K14A 2VG7A 2P5GA 2F96A 5KI6A 4CEQA 1N5YA 2P5OA 4FJ9A 1IH7A 1BI4A 3TR8A 3I8DA 4OJRA 4LY7A 1F21A 3ZSOA 4FM0A 4OKEA 1UA0A 5HBMA 3FFIA 3G0ZA 4AHUA 3NH0A 5HROA 2KZZA 4CGGA 1S6QA 2HVHA 3OYDA 5C42A 3V4IA 2OZMA 4FLUA 4K8XA 4DTUA 2IS3A 3B6OA 4CIEA 3MEEA 4CFDA 1HRHA 3VQ9A 4CHYA 4F3OA 1S1TA 1VSEA 4I9LA 1KFDA 4IG3A 4KI4A 2YNIA 4JRQA 1RT2A 4MQ3A 3QEPA 3VA0A 3V9UA 1UA1A 1U49A 4BE2A 2G8FA 2DTUA 3AVJA 4GVMA 4Y1DA 4CIGA 2YV0X 3LPTA 4DWIA 1RDAA 1TVRA 1W9HA 4FM1A 1NK8A 4O4GA 3LZIA 3CQ8A 1HMVA 3EZ5A 1FKPA 1RDCA 5I42A 3VQEA 4FJ7A 3OYNA 2KTQA 3VQPA 3SYZA 3AA5X 3HSTB 2XY7A 4FJHA 3KK1A 3DLRA 3RMCA 4J2AA 1SKRA 3K5MA 1I3AA 1S1XA 4CEEA 3KLFA 1KVBA 1WAFA 1VRTA 1C0TA 3K5LA 4CEDA 3K59A 3VQCA 3QEXA 2I5JA 1CLQA 1BL3A 1RCHA 1UAXA 4CJTA 2YHBA 2XO7A 1TKXA 4F4KA 2YKMA 3KIOA 4CK2A 3DI6A 2F8TA 4Z4HA 4PWDA 1RT7A 4K8ZA 2YNGA 4RW9A 1Q8IA 4M41A 1TKDA 2ITGA 4O55A 4DU1A 4EZ6A 4CJ4A 3V1QA 3D45A 3AO3A 3VQ8A 4CFCA 3OYBA 2VWJA 4CGFA 3IS9A 2D0AA 5C24A 4M3RA 3HP9A 1ZBHA 2Z1GA 1GOCA 3K5OA 2OPQA 3MEGA 3AVHA 3I0SA 4CJSA 3K58A 4DS5A 4E7HA 5J2MA 3TABA 1ASVA 3K2PA 4W5RA 2IOCA 2R7YA 2D0BA 3MXIA 1B9DA 1HNIA 3KKRA 3L2VA 4F2SA 1HNVA 1Z26A 2KQ2A 4CEOA 2G8KA 3ZCMA 4DSEA 4CEBA 5C25A 2XY5A 1JLGA 5I3UA 5SWMA 3RTVA 4ZTJA 3QLHA 3OJSA 3QIOA 1U45A 1D9FA 1J9AA 3HXMA 1BI4B 3B6PA 1L5UA 3JSMA 2W42A 4Z4GA 2XRIA 3ZSYA 3NGIA 4AHVA 4RW8A 3TAPA 4HCCA 1QQCA 3SCXA 3BDPA 3WNEA 3PY8A 5FRMA 3NE6A 3SJJA 1SUQA 5KTQA 1RTIA 3V1RA 4B9UA 3CM6A 3LWLA 1TAQA 1D9DA 4FJLA 4DQQA 2Z1HA 1QSSA 4B9VA 1BGXT 3NAEA 4AHRA 3SZ2A 3ISNC 2JGUA 3QNNA 1NJWA 4W5OA 4OKKA 4CJFA 4DSLA 4FJKA 3NH1A 4E19A 4KKOA 2OPRA 3T1AA 2E6MA 4DG1A 4CIFA 4BDZA 4DFJA 3QEIA 3O3GA 1JL1A 3IRXA 3P5JA 5J2NA 4H4MA 3SQ1A 1VSFA 2VWKA 2IDOA 1J5OA 3HVRA 3M8SA 1N6QA 3DRPA 4FLTA 3PO5A 3PO4A 4KHSA 4HUEA 3QEWA 1A5WA 2QXFA 1WN7A 2YHAA 2Z1JA 3DRRA 3HPHA 4EP4A 3OYEA 4DSJA 4KAZA 4FJMA 4QCLA 5FDLA 4ELTA 5CZ2A 4JS5A 3TAEA 4M3TA 3S3OA 1KSPA 1A5VA 2NUBA 3DLEA 1RTJA 4FLYA 3EY1A 4OPJA 3LANA 4O0JA 4DMNA 3MAQA 2HHVA 4MFBA 3C6TA 1Q9YA 1KTQA 4E3SA 1JLQA 1I39A
chains in the Genus database with same CATH superfamily
3TARA 1S9EA 4BRHA 4JKHA 4WFBL 3CC4N 1XI1A 4IOAL 2FF6A 4PHTX 5M1QA 3ZT1A 4DTPA 4B9TA 4CJPA 5JMVA 4CZKA 1KLMA 1TK5A 1D5AA 2GELA 3LAMA 4BDPA 5ADXA 1YF5L 1T05A 1JXEA 3J8AA 3QIPA 3AVFA 4OLBA 4M42A 1EWRA 2IAJA 4H5TA 1WOQA 1BHLA 4IOCL 5BPLA 1FXXA 4GNIA 4LF4K 4CBUA 1NGDA 4HTLA 3FFKB 4CBXA 3HVTA 4PKHA 3HL8A 2HHTA 3DLKA 3ULEB 4BRGA 4EAHD 2A6AA 2V52B 3OTOK 5GAGP 1ASWA 4FW1A 4WQ5C 5EXWA 3EN9A 3CF5L 3GG4A 3A8YA 4JI8K 1RTDA 1S5JA 1KAZA 4ID1A 2ITMA 2PYJA 2F7TA 3SV4A 3CCRN 4MO5A 5KPTA 3OYGA 1IKVA 3VQAA 2ATQA 2PYLA 4J8FA 3DXMB 4MDBA 3TSPA 1X9JA 2BDPA 3VETA 4FCYA 4M3WA 2ZWHA 1HKCA 4GKKK 2FBXA 1HPZA 3NF9A 1YUWA 3FR0A 4BRKA 2Q2RA 1ZC6A 4NLCA 1L3VA 4OGCA 1RDDA 4MDAA 4XH1A 2HHUA 3D2EB 2O8CA 3DOKA 4CEZA 5AR0A 4MLEA 3G25A 4BRAA 3LDSA 3CCSN 3HJFA 1BIZA 3VQ4A 5A2QO 3AVCA 4LC9B 4CGDA 1HNZK 2F8SA 3JS6A 2E8AA 4DFPA 2GBZA 1MU2A 4DV6K 3LPUA 1OVYA 4NLBA 1YAGA 1QQMA 1BQMA 1NJZA 3CXCM 4U67L 2IGIA 4FJ5A 1NK0A 5JS1A 3M8PA 3SPZA 1HYVA 3HM9A 1MA9B 4CF8A 3I33A 1HYZA 2I7NA 3HBTA 3O8MA 4CHZA 3UB5A 3F73A 3SAHA 4FOEA 3H3OB 4BR5A 4LF9K 3OYMA 1NOYA 1TK0A 2A1RA 4NO7A 4IFEA 3CJAA 4WCEL 3T3FA 4B9SA 4BWJA 1WAJA 3HP6A 4CZJA 3LM9A 5AQYA 4NCBA 3OS0A 4CHPA 3QESA 3ZEUB 4M45A 1KAYA 2PBDA 3PSFA 2FBYA 3QEVA 3CJBA 5GIPA 1GLBG 1NGHA 4DTOA 4GMJB 1YI2N 4Z94A 2KKZA 2D1KA 2P9SA 3M6GA 1VK0A 3ZT3A 1VQMN 2ZD1A 4WE1A 1EXQA 3WQUA 1NK9A 1CZ9A 4M7YA 4E7JA 1WBDA 3AARA 4JI2K 3ZSQA 2Q97A 2UUAK 4AM7A 2Q1NA 1SAZA 3MMVA 2GWKA 2HVIA 3OYCA 3MEDA 4FLVA 3V9WA 1VSDA 2D5RA 1SL2A 4FZYA 3QFUA 4BY9C 4JI6K 4RTFD 3NF6A 4DHYA 2P9KB 4IFVA 4DTJA 5BPNA 4FK4A 3GE1A 4B1XB 4QS8A 4C23A 1QVFM 4WFAL 5C2DA 3J7ZO 1VQ7N 1SV5A 4H0YB 4YDUA 4CF1A 1TL3A 1ILYA 1TL1A 4CJEA 4JNEA 5BREA 2HBMA 5KQ8A 3AVIA 1U48A 4V19S 1ESVA 4M3XA 3CQXA 5M1OA 5CHIA 1Z25A 2Q3SA 2UUCK 1WSEA 1KXPA 3A5LC 3CCMN 3TAMA 3NF7A 5DMRA 3DJCA 4J2BA 3KTQA 1BO5O 1JCGA 3ENBA 1J54A 5T7BA 4N76A 5M1KA 4DQRA 3SUOA 3WNFA 3IFRA 2FBVA 3AAPA 2G8VA 3ZEUA 1VSKA 3AV9A 3F2KA 4DV4K 2OZSA 1T03A 3N4PA 4F2RA 1XQSC 3G6EN 1YJNN 1SQKA 2B5JA 5EOYA 1K9MO 1RT3A 1HQEA 4BE1A 3RR8A 1CXUA 2QW9A 1LV5A 3LWMA 3BGRA 2FC0A 1RTHA 2CGKA 1C0UA 1RGIA 4E1MA 4DTSA 4B9MA 4AHTA 3SMSA 2G8WA 1IBMK 2E1YA 4LF5K 1NJXA 3V6DA 1W2BM 4TSXA 4Z0UA 3L2RA 4DSKA 3AGRA 5CY4A 2WBNA 3GBTA 3CFPA 1SKWA 3OYKA 3O9QA 4DV1K 5EU7A 4FJNA 5C10A 3THVA 2FF3B 1L3TA 1JL2A 1R0AA 4NCAA 4CHNA 2FBTA 1JLFA 4FWMA 2B6AA 1L3SA 4JKEA 1ZYQA 1QZ5A 3AA3A 1NJIO 1WSHA 4PKGA 3OYIA 4I7FA 3P38A 1XUPO 1J53A 1RT6A 4E1NA 1LOTB 4IBNA 2BE2A 2ZQBA 5BRHA 3L4IA 1WNSA 3PV8A 3H1QA 4CZIA 2ZM6K 4YFUA 1NOZA 4DSIA 4FJ9A 2VG7A 1N5YA 2P5OA 1ZXOA 1BI4A 3I8DA 4FL9A 1RDUA 4OJRA 4RCHA 1TYQA 3ZSOA 2A3ZA 1SZ2A 4OKEA 4BR9A 5HBMA 3NH0A 5C12A 4E3SA 4CGGA 2HVHA 3MEEA 4CFDA 3O08A 1KFDA 3QEPA 4MQ3A 4B3MK 4OPHA 3VA0A 2I7PA 4GVMA 3LPTA 4FM1A 1NK8A 4FWRA 3LZIA 4FJ7A 3OYNA 3VQPA 2XY7A 4BC2A 3O9SA 3O1BA 1I94K 3CHWA 3K5MA 1I3AA 1VQPN 2PAVA 3HM8A 1C0TA 3A5NC 2IVNA 4CK2A 2F8TA 1RT7A 2YNGA 4RW9A 1TKDA 4DU1A 3D45A 1YITN 4CFCA 3OYBA 3OW2M 2O8FB 1V4TA 5AQSA 3K5OA 1ATRA 3I0SA 3MEGA 2YJEA 3TSQA 3GOIA 1OH7A 2QWNA 1LCUA 1FW6A 3CPWM 3MXIA 4JKCA 3KKRA 5SWMA 2YHXA 2AA4A 2NRHA 1D9FA 1BI4B 2GEMA 3MDQA 1L5UA 4Z4GA 4XH4A 4FWNA 4H5RA 3TAPA 5AQMA 4HCCA 1QQCA 5FRMA 3V1RA 3NVMA 3LWLA 4KH4A 3H1VX 1QSSA 2ZJQL 3BP8A 4W5OA 3W0LA 4E19A 2OPRA 3T1AA 2E6MA 2CGLA 4DG1A 5J2NA 1DT9A 4ILGB 3SAFA 4YOUA 3HVRA 3M8SA 3DRPA 4FLTA 5LY3A 4HUEA 4FO0A 5AQHA 3E9OA 1WN7A 2Z1JA 3OYEA 2Q0UA 4QCLA 4PL8A 4M3TA 4CD1A 1RTJA 3VGLA 4JI1K 4YOWA 2FSKA 2QEXN 4MFBA 4DV5K 4GV3A 1KC8O 2KLAA 1ITGA 4DR6K 4U7BA 4BROA 3TI0A 2F4VK 1U2VA 1NGAA 4F2SA 4ZTFA 1LW0A 5AZIA 3D0PA 1RILA 5DM7L 4AF1A 2QK9A 2KFNA 1XNQK 2WFBA 1GLLO 4B9LA 3EKSA 3K9JA 4QAGA 3U6FA 1NKEA 1NK7A 3FZFA 3CMEN 3L2WA 2E1ZA 4FJ8A 3C95A 3SUQA 4PQUA 5JLFA 5AQKA 4Y1CA 5HRNA 1SL1A 4DTMA 3OYFA 2O8DB 3VA3A 4CJRA 2RPIA 3BUZB 1WSJA 3LDOA 3KJVA 3CCVN 1EP4A 4KBOA 5DK5A 3MXMA 4L3QA 4BR2A 4NCGA 3OYAA 5DM6L 3ASMA 2BH1A 1LAVA 1XMOK 3VTHA 3CCUN 2VG5A 3QNOA 4FJGA 5KQDA 1NLVA 1JLCA 1KVCA 4BVPA 3O9TA 5JLHA 1C1CA 3CETA 1M90O 4BRPA 3HYFA 4JLHA 1NMNA 3AVMA 3HT3A 3C6HA 4YY3K 2HHQA 4AHSA 2Y1IA 4B3RK 4BGBA 2G8IA 3VQ6A 3EKUA 4EFHA 5CYMA 2V51B 2HOEA 4KB1A 4JD2B 4KI6A 1TAUA 4F8RA 3WNHA 4RW7A 4BRIA 1NKCA 4JI7K 1BCOA 4FWSA 1BA0A 3WXLA 5AQGA 5BRFA 3ZYYX 4JRPA 4KH5A 3BEXA 5AZIB 3QBXA 3EEQA 4CD3A 3LL3A 4CCHA 1NBWA 2Z1IA 3DYAA 1IBKK 1U47A 4LD0A 2VQEK 3OA9A 4CK1A 1NK5A 5D3GA 1WBBA 2YJFA 4N41A 1QQOA 3F9MA 2AJQA 2DY4A 3LZJA 4KTQA 1RBTA 3AVNA 2ASMA 3LP0A 3KK3A 1O13A 4PY5A 4EP5A 4N56A 1JLEA 1T44A 2NZTA 1HYSA 5M1NA 2HHHK 4OPKA 1XC3A 3ZETB 1BUPA 4EZ9A 1LWEA 3FZLA 4CERA 4EIAA 1QHTA 3AVLA 1IV0A 4R79A 3AVAA 2HBKA 5FPMA 5M1PA 3S3NA 1NGJA 2OYQA 3F9KA 1RT1A 4DFMA 3MWPA 3LAKA 4KFBA 3ZX3A 4BREA 5CYQA 5TKYA 3TAFA 3LDNA 2IVOA 1X1PA 4K42A 4ISEA 4B9NA 4JD2A 4DU3A 2X6NA 4KPYA 4GW6A 3TTFA 4HTUA 3QBWA 3VQ7A 4DKWA 3RSEB 4BQLA 3VEWA 4IXCA 1DLOA 4RG8A 4CEFA 5KPRA 3HPGA 3PX0A 3VPZA 1VAZA 1M1KO 2OPPA 4CBWA 4FLZA 5FLXO 1TV6A 3RR7A 1EETA 3C6UA 4Q5VA 1Q9XA 4JHDB 4G9ZA 1HUXA 3AO2A 1TUYA 1NNEA 1NGFA 3BF1A 4K25A 4AHCA 2RHKA 3QFPA 2QWOA 1N33K 5CR4A 5I9EB 3ZSRA 1KD1O 3ENOA 3WEEB 3QETA 1HLUA 2VGNA 4K43A 4FJJA 4C1NK 3HPOA 4DR2K 1XHZA 3ZETA 4CF2A 3O3FA 2P9SB 4IFYA 2EWSA 1WLJA 1YJWN 4XEIA 4A2AA 3JYTA 1NGCA 5GIOA 4IZ9A 3KWGA 3R3LA 4AILC 2YHWA 4C8MA 2HBLA 3MXJA 3WXKA 1E3MA 3L8BA 1ZBUA 4C1NI 4H8KA 4FZZA 3TAGA 2EX3A 4JAXA 1YT3A 1GOBA 2HW3A 3CPEA 3J80O 3E9LA 5GINA 4A61A 4DUZK 3RMBA 3LALA 5HRPA 4CJ5A 3NCIA 3P31A 1NK6A 4E7IA 2HHWA 3UE5A 3D2FA 2O8BA 2P9LA 1K6YA 4FWKA 1ATNA 3PX4A 4LF8K 5KGWA 3MX2A 3U3YA 1C1BA 1SS6A 4E1JA 3KK2A 4FPAA 1HPMA 2NNWA 3EYZA 3MN6A 4DLGA 2P9IA 3DXMA 4F4KA 4I2QA 1JLBA 3KLIA 4CFAA 3AO5A 3HI0A 5J1EA 4W5NA 3KLGA 4LSLA 2PY5A 2KZMA 2A40A 3OS1A 3CCQN 4CEAA 4QOZB 4LFCK 3BZKA 5AQOA 4BWMA 4FWLA 2UXCK 3AA2A 4B8AB 4CE9A 4DF4A 1RDBA 4DWIA 2WUSA 4A5AA 4H0OA 3VF2A 5JS2A 2G8HA 2IC3A 3WEEA 4FLXA 3SBGA 3PSIA 5JICA 2NRZA 3FZMA 5E26A 2NRVA 1U04A 4CF0A 4UY8O 4DV3K 4E0DA 4H5NA 3O6WA 4CJUA 4AM6A 3QO9A 1S1WA 3KLHA 1X3NA 1TK8A 4E89A 1S1VA 1OH8A 3GDQA 3LP1A 5KRSA 3CMAN 4Y0WA 3CCEN 3E9PA 3LDQA 5KI6A 4QS9A 3L6QA 3TR8A 3R6MA 1T6DA 1F21A 3MWTA 3QDKA 2W6KA 4DCHA 3TTCA 1UA0A 3FFIA 3G0ZA 2O8BB 1S6QA 4M63C 5H1SQ 1VQ9N 2OZMA 2OTLN 3DLLL 3B6OA 3CI5A 3KWIA 3ATUA 3J7YP 5AJ3K 4DV0K 1KQSM 4F3OA 1S1TA 4I9LA 4IG3A 3V9UA 1Z6RA 2PFUA 3AVJA 1YVNA 4DR5K 1TVRA 3THXB 1OH6A 3H45C 3VQEA 3D7EO 5FPDA 4FJHA 3AA5X 4KHPK 3VEOA 1SKRA 4CEEA 3KLFA 2P9PA 1WAFA 1VRTA 3VQCA 1CLQA 2I5JA 1BL3A 1RCHA 2YHBA 1TKXA 2YKMA 4GKJK 3DI6A 1VQLN 3FZKA 4K8ZA 2E2PA 3CC2N 2ITGA 4EZ6A 3K0SA 1W7AA 4ISFA 4CGFA 2D0AA 5C24A 3MCPA 1GOCA 3TABA 3K2PA 2IOCA 2D0BA 3HRGA 1HNVA 1Z26A 4CEOA 3ZCMA 1IG8A 5C25A 3VENA 1JLGA 5I3UA 4ZTJA 4JK8A 5LMUK 1J9AA 2ZJRL 3B6PA 3IKMA 1GLAG 2W42A 2XRIA 1X3MA 3NGIA 4AHVA 3BDPA 3VTIA 3WNEA 4B1ZA 1GLCG 1TAQA 5AQPA 2YHYA 4GV9A 1EQYA 4DV7K 1NMDA 3NAEA 4IO8A 4JK7A 4DSLA 4KKOA 3DAWA 3QEIA 4JKFA 4CZGA 2IIRA 1JL1A 3HOSA 1G99A 4DR4K 1N6QA 1A5WA 3O4WA 3DRRA 4DSJA 4IDHA 3DXKA 1EWQA 4JS5A 5AQQA 5TKWA 3S3OA 2NUBA 3KVGA 3LDPA 3U9ZA 4IO9L 3SK3A 4OPJA 4O0JA 3MAQA 5E84A 1Q9YA 4I6MA 1BU6O 1JLQA 3J81O 4R5PA 1EO1A 2YNHA 2JWLA 4XIUA 3P1GA 4JS4A 1VSIA 3I56N 5KRTA 5HP1A 4ELVA 5JVGL 4BRQA 1NGIA 2ZGZA 3O4NA 3UIQA 4KV8A 1VSHA 3Q7CA 2ETJA 3NFAA 4PUOA 1D4XA 4CECA 3RMAA 4FJIA 4IJAA 2JLEA 3A5OC 1P90A 1IG9A 2QWQA 3EL2A 3ZT0A 3M3ZA 1ATSA 2A5XA 4JKAA 3SPYA 4KTWA 2BTFA 4WF9L 4B1VA 2ZJPL 4JYAK 4H03B 1JKHA 5AQVA 1QQNA 4N47A 2RE2A 1KVAA 3SQ0A 3VEZA 3S9HA 3HK2A 5JVHL 4CJKA 4HHTA 2KW4A 3IG1A 4NYFA 4E7KA 5J2PA 1UOCA 3OBWA 1VQON 3RWUA 3A0IX 4RW4A 4FK2A 3NGYA 1N8RO 4CFBA 2ASPA 2FSNA 5AQXA 2LSNA 3NGZA 1BIUA 2DFFA 3ZSVA 3CQYA 3M8RA 3KLEA 4BE0A 3AAQA 5AQLA 5HRSA 1HKBA 1K8KB 4DFKA 3OS2A 5E41A 3WXIA 3KZBA 2HNZA 2A42A 4A5BA 3L2QA 4FWQA 3ZT2A 5HLFA 3K57A 4FWOA 3G4SN 4CESA 2E4LA 4IEIA 1ZBIA 2P9UA 1NM1A 4BRCA 3QICA 1TGOA 4PKIA 3QINA 4UQGA 2GTDA 2QWPA 4KHWA 3ZT4A 3VQBA 3GL1A 2VG6A 3CCLN 4IG0A 4F9OA 4O0IA 3L0QA 2E6LA 4KHYA 4M3ZA 3AGKA 1RBVA 3A5MC 4LSNA 3SNNA 3TPQA 4GVEA 1WSFA 2E20A 2A1SA 4I9QA 1Q18A 1KFSA 1IJJA 1RT4A 2X74A 2DFEA 1J6ZA 3PX6A 1MDUB 3WUHA 4JI5K 4OVLA 3M8QA 1BCMA 2DPNA 3KD1E 1IKYA 4MLHA 3V1OA 1KRPA 3Q7BA 4O5FA 3SV3A 3H08A 1S22A 3OJUA 1XWLA 2EHGA 4FVMA 3C0BA 1RNHA 3V81A 4Q0BA 1DTQA 1X9SA 4CJWA 3OVNA 1KCFA 1J5EK 4NYNA 1T3VA 3VF4A 4BC4A 1VRUA 1NKBA 4OGEA 4CW7B 2QM1A 2HNDA 4C8NA 4FK0A 2X78A 3NDKA 1VQ8N 3G71N 5C15A 3FLCO 3OY9A 3V9ZA 4O44A 1HJRA 5HRRA 5AZJB 2Y1JA 1N34K 1XC9A 4XH5A 1JJ2M 3AVGA 3VQDA 3TANA 4KB0A 4HWIA 4CGIA 4ZHRA 3AA4A 4DB3A 5IT9O 2P9UB 3CM5A 4JKGB 4CGHA 1VQNN 4KO0A 1BG3A 4H0PA 4FPBA 2GV9A 1RT5A 1NU0A 1T7PA 1LWFA 3LP2A 4YOTA 4YNQA 3U3GA 3O80A 4QS7A 3SUNA 1KLNA 4ILHA 4B3OA 4ISGA 1VSLA 3ZSXA 4ILJA 3EZWA 3V9XA 4C8LA 4Z4FA 2XHBA 3CCJN 3EE8A 1CZBA 4CHQA 3VQ5A 4B1WB 4DF8A 1S1UA 3QMLA 4IDKA 4A2BA 1C0MA 4YHHK 4BRLA 5BN9A 2O8EA 3UKRA 4YOVA 5CE3A 4B1UB 4CJ3A 2WC9A 3SBTA 4DR7K 4BRFA 4CZLA 2YKNA 3KKSA 2ZE2A 2OA8A 4DTNA 1REVA 2F9TA 4DLEA 2O4IA 4JKDA 3SUPA 2XY8A 5FRNA 3IUCA 5HL7L 4B8CA 1U6ZA 3N4QA 2D0CA 3SI6A 2GUPA 3O9UA 3DLGA 4M3YA 2VQFK 3ZSWA 1VQ4N 1OKJA 5AQJA 4AQYK 3HOTA 4DSFA 2PZSA 1EX4A 1W0HA 1BDGA 2IVPA 1E4FT 3OYHA 4YORA 1HKGA 1VSMA 3TWHA 2NRWA 4I2PA 3T1YK 3MN5A 4CJVA 5EY4A 3U9DA 4FWPA 3T7ZA 4OKJA 2P9IB 3OBYA 5AQIA 3L4QA 4ELUA 2KFZA 1WSIA 2W40A 4BRMA 3ENHA 3U4LA 1GLEG 3T19A 5AQTA 3ULEA 1VSJA 1K8AO 3S3MA 5AQNA 3CFRA 3DMJA 3NH2A 5K14A 2P5GA 2F96A 4CZMA 5AFUA 1IH7A 1NG9A 2QWLA 4FM0A 2P9NB 3TU5A 4AHUA 1VQKN 2KZZA 1DGKN 4WQ4A 3V4IA 4FLUA 4K8XA 4DTUA 4CIEA 3VQ9A 3NMUA 4CHYA 4JKBA 1VSEA 4KI4A 4BR0A 1RT2A 3HZ6A 3UKUB 2P9KA 4CIGA 4O8KA 2YV0X 3CJCA 1RDAA 1W9HA 4FSVA 4K0KK 1FKPA 5I42A 1NGGA 2KTQA 1WUAA 3HSTB 1QVGM 3KK1A 2QWRA 5F0XA 4DUYK 1KVBA 3K59A 1R59O 4CEDA 1UAXA 4CJTA 3WQTA 3KIOA 5AQWA 4Z4HA 5BN8A 4JEPA 2ASOA 1Q8IA 2V7ZA 4O55A 2VWJA 3LDLA 3HP9A 1ZBHA 3W3DA 1K73O 2OPQA 4DS5A 3AVHA 5ELZA 3K58A 2CH5A 2W6LA 1ASVA 3U8XA 3THXA 5AQZA 3VEYA 5BPMA 4W5RA 2R7YA 3FGUA 4CZEA 5F2RA 1HNIA 4CVNE 3L2VA 4DSEA 4CEBA 2HBJA 2XY5A 3ATVA 1U45A 3FE1A 5IWAK 1Y64A 4BC3A 2P9NA 4YOXA 3ZSYA 1GLFO 3SCXA 4YOYA 4B3SK 5KTQA 4B9UA 2Q0RA 1D9DA 4DQQA 4H0TB 3SZ2A 4AHRA 2UXDK 2JGUA 3FZHA 4FJKA 2VYPA 4BDZA 4H0VB 2QTDA 3CERA 4DFJA 3O3GA 3IRXA 3SQ1A 2VWKA 2IDOA 4KHSA 3NVKA 3QEWA 1H1VA 1IBLK 4YDUC 4EP4A 4NB4A 4KAZA 4FJMA 4ELTA 5CZ2A 5B8HA 1A5VA 2ZF5O 3DLEA 3PIOL 3EY1A 4WYBA 3C65A 4BQZA 4DMNA 1VQ6N 2HHVA 2FSJA 3P4IA 2BUPA 3C6TA 3R8EA 1KTQA 3IMXA 4LF6K 4Z4CA 1I39A 5BR9A 1OVQA 2NRRA 2HHXA 1B92A 1S72N 4CK3A 1X9WA 3ID6A 4IWVA 1TKZA 5BRDA 4HVJA 3CG7A 3CC7N 4BRDA 1Q82O 4J2DA 4JI3K 4O5BA 3WT0A 4MO4A 3VGMA 3CJ1A 1FJGK 2E2QA 4F3TA 1LWCA 3M5RA 1GOAA 2BGGA 2WONA 3CIPA 1VHXA 1BWFO 3E66A 3PLAA 3RSEA 4J2EA 3DWLA 4OLAA 3KD5E 1RBSA 1L3UA 2YNFA 3A2FA 4RWTA 3O4QA 4FVUA 4CGJA 2O4GA 1B9FA 1JLAA 3C7NA 3DLBA 4BR7A 4X64K 1S6PA 1QSLA 3DLHA 3I0RA 5GAEP 2F9WA 4JHDA 1XNRK 4L8RB 1BA1A 3RVCA 1SKSA 3IAYA 1FKOA 1HQUA 3I8BA 1FK9A 3SQ2A 3D2EA 2O8CB 1SL0A 1XMQK 2W41A 3VERA 1BOTO 3C94A 1JXBA 4X62K 3OYLA 1LW2A 3CYMA 2QI2A 4LF7K 1DEJA 1ZBSA 1ZBFA 2HF4A 2O8FA 3MECA 4FYDA 3AO1A 4C8KA 2D0PA 1QTMA 1RDWX 3M1FA 1Z05A 1MWKA 1JCEA 4WQ4C 1ASUA 4RW6A 2JWKA 4DR1K 4A62A 3LP3A 3KHYA 4W5TA 3OYJA 1S9GA 4M7XA 4H5VA 2QKBA 4HUGA 3VOVA 5AQUA 2P9PB 1T6CA 4CJQA 4CJ7A 2E2NA 2H3GX 1V4SA 1RBUA 1D8YA 3BZCA 3DM2A 4H5WA 2P9LB 4LH4A 1MWMA 1IKXA 4M3UA 2Q31A 4KHQA 1GLDG 1WB9A 1YTUA 2VGMA 4DS4A 3VEVA 1C6VA 1GLJO 1DTTA 3ULDA 3E01A 4JK9A 4FOIA 1BISA 4FJXA 3BF3A 1Q86O 5KGXA 4JN4A 2HB5A 3C7NB 3VGKA 4LH5A 4DQIA 2UU9K 3MCAB 3C6AA 3NBPA 1QZ6A 1U4BA 2G8UA 3RRHA 4DU4A 3PUFA 2WOMA 1P8ZA 4N5SA 4ID5A 3R1XA 5SZTA 1NWKA 3THYB 4BVOA 5ADXH 4FW2A 3BY5A 3VN5A 2E5LK 2AP1A 2RN2A 4C8OA 2HHSA 3OHRA 2OPSA 3AVKA 3RMDA 4ICLA 3NHGA 2XY6A 1ZBLA 2GUIA 2BANA 2Q36A 4KTZA 4FLWA 1HJOA 2RKIA 1Q81O 5AQRA 2NRTA 3G10A 4Z4IA 4H4OA 4DTXA 2UUBK 3QERA 2FXUA 4BRNA 3TAQA 5FPEA 3DRSA 2D4WA 3AVBA 1QSYA 4IKFA 3DXKB 3K5NA 4KREA 2P51A 1QS4A 3AO4A 2KHOA 1CXQA 2HSTA 4CI6A 3ID8A 2O8DA 3SQ4A 1A5XA 4I6MB 1N32K 4DQPA 1S3XA 2QA4N 4X66K 5CZ1A 2NLXA 4KHNA 3ZSZA 2HMIA 4GV6A 4B08A 4Z4EA 1O1WA 1YVUA 1G15A 2VWBA 5AQFA 3MN9A 2QXLA 4W5QA 4CF9A 4KHUA 1EKEA 3SJHA 3CFOA 3TTDA 1QHAA 5HOOA 3ALYA 3L2UA 4CZFA 4BC5A 3P83D 4B1YB 3ITHA 1HNXK 5FROA 4EHUA 4KRFA 3DOLA 1UWBA 1C1AA 3H3NO 4FM2A 3CJ7A 3WNGA 1YIJN 4LFAK 1T8EA 2OTJN 2QWMA 2CH6A 5LJVA 3V9SA 5MLCQ 3THYA 3VQQA 4A59A 3VF6A 4BDYA 4KH6A 5FPNA 3VEXA 1TKTA 2YCHA 3L3VA 5EVZA 1JCFA 4G1QA 1X9MA 2UXBK 1IO2A 2FLOA 2OANA 4GY2B 4E7LA 4JI0K 1N36K 4IJNA 1NJYA 1RFQA 3RRGA 3LM2A 1LAWA 1KAXA 4HUFA 4OPAA 4DTRA 4HCBA 1QE1A 2V7YA 2QKKA 4BGAA 3ZX0A 1WSGA 4CHOA 3WXJA 2B4JA 5EX5A 1NK4A 1E4GT 1YXQA 2X6SA 3IDHA 3SMPA 4BACA 2D0OA 2P1JA 3CD6N 4DQSA 1U2VB 1IKWA 3T69A 3NF8A 5F1XA 3HTVA 4DR3K 1YHQN 3UKRB 4PA1A 5J2QA 1TYQB 3AY9A 1BQNA 3MK6A 3THWA 2RF2A 4DV2K 4LFBK 3MN7A 1CZAN 2ZGYA 3E1YA 1OH5A 2DFHA 2A41A 4X65K 4AH9A 2GX9A 3L3UA 4FXDA 3B8AX 3T1HK 1Y97A 4FZXC 2GWJA 2YI1A 3HO1A 4IEEA 1VQ5N 2HNYA 4CJLA 4B9QA 3O1WA 3O3HA 1RBRA 1YTAA 1XHXA 2E2OA 4CEQA 4NXNK 2CGJA 4K41A 5LMNK 2OCEA 4LY7A 2WTUA 5HROA 4CZHA 3OYDA 5C42A 3VESA 2IS3A 1W97L 3O5BA 1HRHA 1C0FA 3JAMO 2YNIA 4JRQA 1UA1A 2G8FA 1U49A 2DTUA 3S41A 4BE2A 5M1FA 4Y1DA 3I55N 1Q7YO 3SLCA 2YX6A 5AFUH 4O4GA 3CQ8A 1HMVA 3EZ5A 1RDCA 5C2FA 4A57A 3SYZA 3J7AP 3DLRA 3RMCA 4J2AA 1S1XA 5AZJA 3K5LA 1TUUA 3TSUA 3QEXA 3VMFB 2XO7A 4B3TK 4JV5K 3D6RA 3JXUA 4PWDA 3ZX2A 4M41A 3THWB 3H6EA 4JKGA 3CJ9A 4CJ4A 4BG8A 3V1QA 3AO3A 3VQ8A 4EHTA 3IS9A 4O8UA 4M3RA 4BG9A 2Z1GA 1NGBA 3UKUA 4CJSA 2HMPA 4PL7A 3SAGA 4E7HA 5J2MA 3D2FB 4JI4K 1HNWK 4DQ8A 4H0XB 1K8KA 4WQ5A 1B9DA 3HSCA 2KQ2A 2G8KA 3ZLJA 2J4RA 4BR4A 5GAHP 3RTVA 3EE9A 3QLHA 3OJSA 2HF3A 3QIOA 5GADP 3HXMA 3EO3A 1DKGD 3JSMA 1NGEA 3R9PA 4RW8A 3PY8A 5KPZA 4WFNL 3NE6A 1SUQA 3SJJA 1RTIA 4OO1J 3CM6A 4FJLA 2Z1HA 4B9VA 1BGXT 3QNNA 3ISNC 1NJWA 4OKKA 4CJFA 3NH1A 2O8EB 5BR8K 4NXMK 4CIFA 1HX1A 3P5JA 4H4MA 1VSFA 5LL6Z 1J5OA 3PO5A 3PO4A 1YJ9N 3QB0A 2VCPA 1C0GA 3F5TA 2QXFA 2YHAA 3HPHA 3KK7A 3MX5A 5LJWA 3K9KA 5FDLA 3TAEA 4IOXA 2E88A 1KSPA 2UYTA 3PIPL 3WXMB 4FLYA 3LANA 5C0YA 1HR0K 3P39A 2NRXA 4OX9K 3O9RA 3H46O
chains in the Genus database with same CATH topology
3TARA 1ITGA 4R5PA 2YNHA 1S9EA 2HHXA 1B92A 3TI0A 4XIUA 1XI1A 4CK3A 1X9WA 3P1GA 4JS4A 3ZT1A 4DTPA 4B9TA 1VSIA 1TKZA 4CJPA 5KRTA 5HP1A 4ZTFA 1LW0A 4HVJA 3D0PA 1RILA 3CG7A 4ELVA 4J2DA 1KLMA 2QK9A 2KFNA 4O5BA 1TK5A 1D5AA 4B9LA 3LAMA 4BDPA 3O4NA 3U6FA 1NKEA 4QAGA 3UIQA 1T05A 1JXEA 1VSHA 1LWCA 4KV8A 1NK7A 4F3TA 3QIPA 3AVFA 4OLBA 1GOAA 2BGGA 2WONA 2ETJA 3NFAA 3L2WA 4PUOA 4M42A 4CECA 4FJ8A 3RMAA 3C95A 4FJIA 3SUQA 2IAJA 4PQUA 1BHLA 2JLEA 1IG9A 4Y1CA 5HRNA 4J2EA 3ZT0A 4OLAA 1FXXA 1SL1A 4DTMA 3KD5E 3OYFA 1RBSA 3SPYA 3HVTA 1L3UA 2YNFA 3A2FA 3O4QA 4KTWA 4CGJA 3HL8A 3VA3A 2O4GA 1B9FA 3DLKA 1JLAA 2HHTA 4CJRA 2RPIA 3DLBA 3DLHA 1JKHA 1S6PA 1WSJA 3KJVA 3I0RA 1QSLA 1EP4A 5DK5A 3MXMA 1ASWA 4N47A 4L8RB 4FW1A 1KVAA 3SQ0A 4NCGA 3OYAA 3S9HA 3ASMA 3HK2A 1LAVA 1SKSA 4CJKA 4HHTA 2KW4A 1FKOA 1HQUA 3IG1A 4NYFA 1S5JA 1RTDA 3IAYA 1FK9A 2VG5A 3SQ2A 4E7KA 4ID1A 3QNOA 1UOCA 5J2PA 4FJGA 1SL0A 2PYJA 1JLCA 3SV4A 1KVCA 3RWUA 3C94A 1JXBA 4RW4A 3OYLA 4FK2A 1LW2A 3CYMA 3NGYA 4CFBA 1C1CA 3OYGA 1ZBFA 1IKVA 3MECA 4FYDA 3AO1A 3HYFA 4JLHA 3VQAA 4C8KA 2ATQA 3AVMA 3HT3A 2PYLA 1QTMA 2LSNA 3NGZA 2HHQA 1BIUA 2DFFA 3ZSVA 4AHSA 2Y1IA 3M8RA 2BDPA 3KLEA 4BE0A 4FCYA 4M3WA 2G8IA 5HRSA 1ASUA 3VQ6A 5CYMA 4DFKA 2FBXA 4RW6A 4KB1A 1HPZA 3OS2A 4KI6A 3NF9A 1TAUA 4F8RA 3LP3A 5E41A 3WNHA 4RW7A 1NKCA 4W5TA 3OYJA 1S9GA 1BCOA 2HNZA 4Q0BA 4JRPA 2QKBA 4HUGA 3L2QA 1L3VA 4CCHA 4OGCA 3ZT2A 1RDDA 5HLFA 3DYAA 2Z1IA 4CJQA 3K57A 2HHUA 4CESA 3DOKA 2E4LA 1U47A 1RBUA 4CEZA 1D8YA 4LD0A 3DM2A 4LH4A 5FRNA 4CK1A 1NK5A 1IKXA 5D3GA 1ZBIA 4N41A 4M3UA 3LDSA 4DSKA 4KHQA 3HJFA 1TGOA 1BIZA 3VQ4A 2AJQA 1YTUA 3QINA 4UQGA 3AVCA 4KHWA 3ZT4A 2DY4A 3LZJA 4CGDA 3VQBA 4DS4A 2F8SA 1C6VA 2VG6A 1DTTA 3ULDA 3E01A 4IG0A 4O0IA 4DFPA 2GBZA 1MU2A 4KTQA 4KHYA 2E6LA 3LPUA 1RBTA 1BISA 3AVNA 1RBVA 4M3ZA 3LP0A 3KK3A 4FJXA 1BQMA 4LSNA 3SNNA 1NJZA 4PY5A 5KGXA 1WSFA 4EP5A 2HB5A 4N56A 2IGIA 4FJ5A 1JLEA 4LH5A 4DQIA 1HYSA 2A1SA 1NK0A 4I9QA 5JS1A 3M8PA 3SPZA 1KFSA 1HYVA 3HM9A 1LV5A 1RT4A 2X74A 3NBPA 4OPKA 1U4BA 2G8UA 2DFEA 3RRHA 4CF8A 4DU4A 3PX6A 4EZ9A 3PUFA 1HYZA 2WOMA 4OVLA 1LWEA 4CERA 3M8QA 1BCMA 1QHTA 3AVLA 3KD1E 1IKYA 3AVAA 3V1OA 4ID5A 4CHZA 4N5SA 1KRPA 3SV3A 3H08A 5SZTA 3F73A 3OJUA 1XWLA 2EHGA 4FVMA 4FW2A 3VN5A 1RNHA 3OYMA 3V81A 3S3NA 2RN2A 1TK0A 1NOYA 2OYQA 4C8OA 1DTQA 1X9SA 2OPSA 3AVKA 2HHSA 3F9KA 4ICLA 3RMDA 3NHGA 1RT1A 4DFMA 2A1RA 4CJWA 2XY6A 3OVNA 1KCFA 1ZBLA 3T3FA 4NYNA 4B9SA 2GUIA 2BANA 1VRUA 4KTZA 4FLWA 2RKIA 3LAKA 4BWJA 4KFBA 1NKBA 1WAJA 5CYQA 3HP6A 4OGEA 3G10A 3TAFA 4Z4IA 4H4OA 4DTXA 2HNDA 4C8NA 3OS0A 3QERA 4CHPA 3QESA 4NCBA 1X1PA 4M45A 4FK0A 3TAQA 2X78A 3NDKA 3DRSA 2FBYA 4DU3A 3QEVA 2X6NA 3AVBA 4GW6A 4B9NA 4KPYA 4HTUA 1QSYA 3VQ7A 3OY9A 3V9ZA 4O44A 4DTOA 1HJRA 4GMJB 5HRRA 3K5NA 4IKFA 4KREA 2P51A 2Y1JA 1QS4A 1VK0A 3ZT3A 3AO4A 1CXQA 1DLOA 4RG8A 1XC9A 2ZD1A 4CEFA 4WE1A 3AVGA 1EXQA 3HPGA 3SQ4A 3PX0A 1A5XA 1NK9A 3VQDA 2OPPA 3TANA 4KB0A 4FLZA 1CZ9A 3RR8A 4DQPA 4E7JA 1TV6A 4CGIA 4ZHRA 3AA4A 1EETA 3C6UA 3ZSQA 4Q5VA 3RR7A 1Q9XA 5CZ1A 3CM5A 4CGHA 4KHNA 3AO2A 3ZSZA 2HMIA 2HVIA 3OYCA 3MEDA 4B08A 4FLVA 3V9WA 4Z4EA 1VSDA 2D5RA 1O1WA 4KO0A 1SL2A 1YVUA 4FZYA 4AHCA 1G15A 2GV9A 4KHUA 4W5QA 4CF9A 1RT5A 3NF6A 1EKEA 3CFOA 4IFVA 4DTJA 1T7PA 1LWFA 4FK4A 3LP2A 3ZSRA 3L2UA 3ALYA 3QETA 4YNQA 3U3GA 3P83D 3ITHA 5FROA 4KRFA 3DOLA 3SUNA 1UWBA 1KLNA 4FJJA 1C1AA 1SV5A 3HPOA 4CF1A 1XHZA 1TL3A 4CF2A 4B3OA 3O3FA 4FM2A 1VSLA 3WNGA 3ZSXA 1TL1A 4CJEA 4IFYA 1WLJA 1T8EA 3JYTA 3V9XA 4C8LA 4Z4FA 3AVIA 3V9SA 2XHBA 1U48A 4AILC 4M3XA 1CZBA 4C8MA 1Z25A 3VQQA 3MXJA 4CHQA 3VQ5A 2Q3SA 3L8BA 1ZBUA 4BDYA 1WSEA 4DF8A 4H8KA 4FZZA 1TKTA 1S1UA 2EX3A 3L3VA 3NF7A 3TAMA 3TAGA 5DMRA 4G1QA 4IDKA 1X9MA 1YT3A 1GOBA 2HW3A 1C0MA 3KTQA 4J2BA 1IO2A 1J54A 5T7BA 3RMBA 3LALA 5HRPA 4E7LA 4DQRA 4N76A 4CJ5A 4CJ3A 3NCIA 3WNFA 3SUOA 1NK6A 4E7IA 1NJYA 2HHWA 2FBVA 3RRGA 2G8VA 1LAWA 1K6YA 1VSKA 3AV9A 3PX4A 4HUFA 2OZSA 5KGWA 1T03A 2YKNA 3KKSA 1C1BA 3U3YA 4F2RA 3KK2A 4DTRA 4HCBA 1QE1A 2ZE2A 2OA8A 2B5JA 4DTNA 1REVA 2QKKA 3EYZA 1RT3A 4DLEA 4DLGA 2O4IA 1HQEA 4BE1A 1WSGA 1CXUA 2XY8A 2B4JA 4I2QA 1JLBA 3KLIA 4CHOA 4B8CA 3SUPA 1NK4A 4CFAA 4Z4CA 3LWMA 3AO5A 3BGRA 2FC0A 2D0CA 5J1EA 1RTHA 2X6SA 3SI6A 1C0UA 3KLGA 4LSLA 4W5NA 4E1MA 3DLGA 2PY5A 4M3YA 2KZMA 4DTSA 3OS1A 4B9MA 4CEAA 3ZSWA 4AHTA 4BACA 2G8WA 4QOZB 2P1JA 4DQSA 1IKWA 4DSFA 4BWMA 3NF8A 2PZSA 1EX4A 1NJXA 3V6DA 1W0HA 3AA2A 4TSXA 4Z0UA 1RDBA 4B8AB 4PA1A 4CE9A 3OYHA 3L2RA 4DF4A 5J2QA 1VSMA 3TWHA 5CY4A 4I2PA 5JS2A 2G8HA 3CFPA 2IC3A 1SKWA 4CJVA 3OYKA 1BQNA 5EU7A 4FLXA 4FJNA 2RF2A 3THVA 1L3TA 1JL2A 1R0AA 4NCAA 4CHNA 1U04A 4CF0A 2FBTA 4OKJA 1JLFA 2B6AA 2DFHA 1L3SA 4E0DA 1ZYQA 3AA3A 4CJUA 1WSHA 4AH9A 3OYIA 3QO9A 4ELUA 2KFZA 1S1WA 1WSIA 3L3UA 4I7FA 4FXDA 3KLHA 1J53A 1RT6A 4E1NA 1Y97A 3T19A 1TK8A 4E89A 4FZXC 4IBNA 1VSJA 2BE2A 3HO1A 1S1VA 2ZQBA 3S3MA 3LP1A 5KRSA 1WNSA 3PV8A 3CFRA 2HNYA 4CJLA 4YFUA 3O3HA 1NOZA 3DMJA 3NH2A 1RBRA 1YTAA 4DSIA 1XHXA 5K14A 2VG7A 2P5GA 2F96A 5KI6A 4CEQA 1N5YA 2P5OA 4FJ9A 1IH7A 1BI4A 3TR8A 3I8DA 4OJRA 4LY7A 1F21A 3ZSOA 4FM0A 4OKEA 1UA0A 5HBMA 3FFIA 3G0ZA 4AHUA 3NH0A 5HROA 2KZZA 4CGGA 1S6QA 2HVHA 3OYDA 5C42A 3V4IA 2OZMA 4FLUA 4K8XA 4DTUA 2IS3A 3B6OA 4CIEA 3MEEA 4CFDA 1HRHA 3VQ9A 4CHYA 4F3OA 1S1TA 1VSEA 4I9LA 1KFDA 4IG3A 4KI4A 2YNIA 4JRQA 1RT2A 4MQ3A 3QEPA 3VA0A 3V9UA 1UA1A 1U49A 4BE2A 2G8FA 2DTUA 3AVJA 4GVMA 4Y1DA 4CIGA 2YV0X 3LPTA 4DWIA 1RDAA 1TVRA 1W9HA 4FM1A 1NK8A 4O4GA 3LZIA 3CQ8A 1HMVA 3EZ5A 1FKPA 1RDCA 5I42A 3VQEA 4FJ7A 3OYNA 2KTQA 3VQPA 3SYZA 3AA5X 3HSTB 2XY7A 4FJHA 3KK1A 3DLRA 3RMCA 4J2AA 1SKRA 3K5MA 1I3AA 1S1XA 4CEEA 3KLFA 1KVBA 1WAFA 1VRTA 1C0TA 3K5LA 4CEDA 3K59A 3VQCA 3QEXA 2I5JA 1CLQA 1BL3A 1RCHA 1UAXA 4CJTA 2YHBA 2XO7A 1TKXA 4F4KA 2YKMA 3KIOA 4CK2A 3DI6A 2F8TA 4Z4HA 4PWDA 1RT7A 4K8ZA 2YNGA 4RW9A 1Q8IA 4M41A 1TKDA 2ITGA 4O55A 4DU1A 4EZ6A 4CJ4A 3V1QA 3D45A 3AO3A 3VQ8A 4CFCA 3OYBA 2VWJA 4CGFA 3IS9A 2D0AA 5C24A 4M3RA 3HP9A 1ZBHA 2Z1GA 1GOCA 3K5OA 2OPQA 3MEGA 3AVHA 3I0SA 4CJSA 3K58A 4DS5A 4E7HA 5J2MA 3TABA 1ASVA 3K2PA 4W5RA 2IOCA 2R7YA 2D0BA 3MXIA 1B9DA 1HNIA 3KKRA 3L2VA 4F2SA 1HNVA 1Z26A 2KQ2A 4CEOA 2G8KA 3ZCMA 4DSEA 4CEBA 5C25A 2XY5A 1JLGA 5I3UA 5SWMA 3RTVA 4ZTJA 3QLHA 3OJSA 3QIOA 1U45A 1D9FA 1J9AA 3HXMA 1BI4B 3B6PA 1L5UA 3JSMA 2W42A 4Z4GA 2XRIA 3ZSYA 3NGIA 4AHVA 4RW8A 3TAPA 4HCCA 1QQCA 3SCXA 3BDPA 3WNEA 3PY8A 5FRMA 3NE6A 3SJJA 1SUQA 5KTQA 1RTIA 3V1RA 4B9UA 3CM6A 3LWLA 1TAQA 1D9DA 4FJLA 4DQQA 2Z1HA 1QSSA 4B9VA 1BGXT 3NAEA 4AHRA 3SZ2A 3ISNC 2JGUA 3QNNA 1NJWA 4W5OA 4OKKA 4CJFA 4DSLA 4FJKA 3NH1A 4E19A 4KKOA 2OPRA 3T1AA 2E6MA 4DG1A 4CIFA 4BDZA 4DFJA 3QEIA 3O3GA 1JL1A 3IRXA 3P5JA 5J2NA 4H4MA 3SQ1A 1VSFA 2VWKA 2IDOA 1J5OA 3HVRA 3M8SA 1N6QA 3DRPA 4FLTA 3PO5A 3PO4A 4KHSA 4HUEA 3QEWA 1A5WA 2QXFA 1WN7A 2YHAA 2Z1JA 3DRRA 3HPHA 4EP4A 3OYEA 4DSJA 4KAZA 4FJMA 4QCLA 5FDLA 4ELTA 5CZ2A 4JS5A 3TAEA 4M3TA 3S3OA 1KSPA 1A5VA 2NUBA 3DLEA 1RTJA 4FLYA 3EY1A 4OPJA 3LANA 4O0JA 4DMNA 3MAQA 2HHVA 4MFBA 3C6TA 1Q9YA 1KTQA 4E3SA 1JLQA 1I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAR A;  1ITG A;  4R5P A;  2YNH A;  1S9E A;  2HHX A;  1B92 A;  3TI0 A;  4XIU A;  1XI1 A;  4CK3 A;  1X9W A;  3P1G A;  4JS4 A;  3ZT1 A;  4DTP A;  4B9T A;  1VSI A;  1TKZ A;  4CJP A;  5KRT A;  5HP1 A;  4ZTF A;  1LW0 A;  4HVJ A;  3D0P A;  1RIL A;  3CG7 A;  4ELV A;  4J2D A;  1KLM A;  2QK9 A;  2KFN A;  4O5B A;  1TK5 A;  1D5A A;  4B9L A;  3LAM A;  4BDP A;  3O4N A;  3U6F A;  1NKE A;  4QAG A;  3UIQ A;  1T05 A;  1JXE A;  1VSH A;  1LWC A;  4KV8 A;  1NK7 A;  4F3T A;  3QIP A;  3AVF A;  4OLB A;  1GOA A;  2BGG A;  2WON A;  2ETJ A;  3NFA A;  3L2W A;  4PUO A;  4M42 A;  4CEC A;  4FJ8 A;  3RMA A;  3C95 A;  4FJI A;  3SUQ A;  2IAJ A;  4PQU A;  1BHL A;  2JLE A;  1IG9 A;  4Y1C A;  5HRN A;  4J2E A;  3ZT0 A;  4OLA A;  1FXX A;  1SL1 A;  4DTM A;  3KD5 E;  3OYF A;  1RBS A;  3SPY A;  3HVT A;  1L3U A;  2YNF A;  3A2F A;  3O4Q A;  4KTW A;  4CGJ A;  3HL8 A;  3VA3 A;  2O4G A;  1B9F A;  3DLK A;  1JLA A;  2HHT A;  4CJR A;  2RPI A;  3DLB A;  3DLH A;  1JKH A;  1S6P A;  1WSJ A;  3KJV A;  3I0R A;  1QSL A;  1EP4 A;  5DK5 A;  3MXM A;  1ASW A;  4N47 A;  4L8R B;  4FW1 A;  1KVA A;  3SQ0 A;  4NCG A;  3OYA A;  3S9H A;  3ASM A;  3HK2 A;  1LAV A;  1SKS A;  4CJK A;  4HHT A;  2KW4 A;  1FKO A;  1HQU A;  3IG1 A;  4NYF A;  1S5J A;  1RTD A;  3IAY A;  1FK9 A;  2VG5 A;  3SQ2 A;  4E7K A;  4ID1 A;  3QNO A;  1UOC A;  5J2P A;  4FJG A;  1SL0 A;  2PYJ A;  1JLC A;  3SV4 A;  1KVC A;  3RWU A;  3C94 A;  1JXB A;  4RW4 A;  3OYL A;  4FK2 A;  1LW2 A;  3CYM A;  3NGY A;  4CFB A;  1C1C A;  3OYG A;  1ZBF A;  1IKV A;  3MEC A;  4FYD A;  3AO1 A;  3HYF A;  4JLH A;  3VQA A;  4C8K A;  2ATQ A;  3AVM A;  3HT3 A;  2PYL A;  1QTM A;  2LSN A;  3NGZ A;  2HHQ A;  1BIU A;  2DFF A;  3ZSV A;  4AHS A;  2Y1I A;  3M8R A;  2BDP A;  3KLE A;  4BE0 A;  4FCY A;  4M3W A;  2G8I A;  5HRS A;  1ASU A;  3VQ6 A;  5CYM A;  4DFK A;  2FBX A;  4RW6 A;  4KB1 A;  1HPZ A;  3OS2 A;  4KI6 A;  3NF9 A;  1TAU A;  4F8R A;  3LP3 A;  5E41 A;  3WNH A;  4RW7 A;  1NKC A;  4W5T A;  3OYJ A;  1S9G A;  1BCO A;  2HNZ A;  4Q0B A;  4JRP A;  2QKB A;  4HUG A;  3L2Q A;  1L3V A;  4CCH A;  4OGC A;  3ZT2 A;  1RDD A;  5HLF A;  3DYA A;  2Z1I A;  4CJQ A;  3K57 A;  2HHU A;  4CES A;  3DOK A;  2E4L A;  1U47 A;  1RBU A;  4CEZ A;  1D8Y A;  4LD0 A;  3DM2 A;  4LH4 A;  5FRN A;  4CK1 A;  1NK5 A;  1IKX A;  5D3G A;  1ZBI A;  4N41 A;  4M3U A;  3LDS A;  4DSK A;  4KHQ A;  3HJF A;  1TGO A;  1BIZ A;  3VQ4 A;  2AJQ A;  1YTU A;  3QIN A;  4UQG A;  3AVC A;  4KHW A;  3ZT4 A;  2DY4 A;  3LZJ A;  4CGD A;  3VQB A;  4DS4 A;  2F8S A;  1C6V A;  2VG6 A;  1DTT A;  3ULD A;  3E01 A;  4IG0 A;  4O0I A;  4DFP A;  2GBZ A;  1MU2 A;  4KTQ A;  4KHY A;  2E6L A;  3LPU A;  1RBT A;  1BIS A;  3AVN A;  1RBV A;  4M3Z A;  3LP0 A;  3KK3 A;  4FJX A;  1BQM A;  4LSN A;  3SNN A;  1NJZ A;  4PY5 A;  5KGX A;  1WSF A;  4EP5 A;  2HB5 A;  4N56 A;  2IGI A;  4FJ5 A;  1JLE A;  4LH5 A;  4DQI A;  1HYS A;  2A1S A;  1NK0 A;  4I9Q A;  5JS1 A;  3M8P A;  3SPZ A;  1KFS A;  1HYV A;  3HM9 A;  1LV5 A;  1RT4 A;  2X74 A;  3NBP A;  4OPK A;  1U4B A;  2G8U A;  2DFE A;  3RRH A;  4CF8 A;  4DU4 A;  3PX6 A;  4EZ9 A;  3PUF A;  1HYZ A;  2WOM A;  4OVL A;  1LWE A;  4CER A;  3M8Q A;  1BCM A;  1QHT A;  3AVL A;  3KD1 E;  1IKY A;  3AVA A;  3V1O A;  4ID5 A;  4CHZ A;  4N5S A;  1KRP A;  3SV3 A;  3H08 A;  5SZT A;  3F73 A;  3OJU A;  1XWL A;  2EHG A;  4FVM A;  4FW2 A;  3VN5 A;  1RNH A;  3OYM A;  3V81 A;  3S3N A;  2RN2 A;  1TK0 A;  1NOY A;  2OYQ A;  4C8O A;  1DTQ A;  1X9S A;  2OPS A;  3AVK A;  2HHS A;  3F9K A;  4ICL A;  3RMD A;  3NHG A;  1RT1 A;  4DFM A;  2A1R A;  4CJW A;  2XY6 A;  3OVN A;  1KCF A;  1ZBL A;  3T3F A;  4NYN A;  4B9S A;  2GUI A;  2BAN A;  1VRU A;  4KTZ A;  4FLW A;  2RKI A;  3LAK A;  4BWJ A;  4KFB A;  1NKB A;  1WAJ A;  5CYQ A;  3HP6 A;  4OGE A;  3G10 A;  3TAF A;  4Z4I A;  4H4O A;  4DTX A;  2HND A;  4C8N A;  3OS0 A;  3QER A;  4CHP A;  3QES A;  4NCB A;  1X1P A;  4M45 A;  4FK0 A;  3TAQ A;  2X78 A;  3NDK A;  3DRS A;  2FBY A;  4DU3 A;  3QEV A;  2X6N A;  3AVB A;  4GW6 A;  4B9N A;  4KPY A;  4HTU A;  1QSY A;  3VQ7 A;  3OY9 A;  3V9Z A;  4O44 A;  4DTO A;  1HJR A;  4GMJ B;  5HRR A;  3K5N A;  4IKF A;  4KRE A;  2P51 A;  2Y1J A;  1QS4 A;  1VK0 A;  3ZT3 A;  3AO4 A;  1CXQ A;  1DLO A;  4RG8 A;  1XC9 A;  2ZD1 A;  4CEF A;  4WE1 A;  3AVG A;  1EXQ A;  3HPG A;  3SQ4 A;  3PX0 A;  1A5X A;  1NK9 A;  3VQD A;  2OPP A;  3TAN A;  4KB0 A;  4FLZ A;  1CZ9 A;  3RR8 A;  4DQP A;  4E7J A;  1TV6 A;  4CGI A;  4ZHR A;  3AA4 A;  1EET A;  3C6U A;  3ZSQ A;  4Q5V A;  3RR7 A;  1Q9X A;  5CZ1 A;  3CM5 A;  4CGH A;  4KHN A;  3AO2 A;  3ZSZ A;  2HMI A;  2HVI A;  3OYC A;  3MED A;  4B08 A;  4FLV A;  3V9W A;  4Z4E A;  1VSD A;  2D5R A;  1O1W A;  4KO0 A;  1SL2 A;  1YVU A;  4FZY A;  4AHC A;  1G15 A;  2GV9 A;  4KHU A;  4W5Q A;  4CF9 A;  1RT5 A;  3NF6 A;  1EKE A;  3CFO A;  4IFV A;  4DTJ A;  1T7P A;  1LWF A;  4FK4 A;  3LP2 A;  3ZSR A;  3L2U A;  3ALY A;  3QET A;  4YNQ A;  3U3G A;  3P83 D;  3ITH A;  5FRO A;  4KRF A;  3DOL A;  3SUN A;  1UWB A;  1KLN A;  4FJJ A;  1C1A A;  1SV5 A;  3HPO A;  4CF1 A;  1XHZ A;  1TL3 A;  4CF2 A;  4B3O A;  3O3F A;  4FM2 A;  1VSL A;  3WNG A;  3ZSX A;  1TL1 A;  4CJE A;  4IFY A;  1WLJ A;  1T8E A;  3JYT A;  3V9X A;  4C8L A;  4Z4F A;  3AVI A;  3V9S A;  2XHB A;  1U48 A;  4AIL C;  4M3X A;  1CZB A;  4C8M A;  1Z25 A;  3VQQ A;  3MXJ A;  4CHQ A;  3VQ5 A;  2Q3S A;  3L8B A;  1ZBU A;  4BDY A;  1WSE A;  4DF8 A;  4H8K A;  4FZZ A;  1TKT A;  1S1U A;  2EX3 A;  3L3V A;  3NF7 A;  3TAM A;  3TAG A;  5DMR A;  4G1Q A;  4IDK A;  1X9M A;  1YT3 A;  1GOB A;  2HW3 A;  1C0M A;  3KTQ A;  4J2B A;  1IO2 A;  1J54 A;  5T7B A;  3RMB A;  3LAL A;  5HRP A;  4E7L A;  4DQR A;  4N76 A;  4CJ5 A;  4CJ3 A;  3NCI A;  3WNF A;  3SUO A;  1NK6 A;  4E7I A;  1NJY A;  2HHW A;  2FBV A;  3RRG A;  2G8V A;  1LAW A;  1K6Y A;  1VSK A;  3AV9 A;  3PX4 A;  4HUF A;  2OZS A;  5KGW A;  1T03 A;  2YKN A;  3KKS A;  1C1B A;  3U3Y A;  4F2R A;  3KK2 A;  4DTR A;  4HCB A;  1QE1 A;  2ZE2 A;  2OA8 A;  2B5J A;  4DTN A;  1REV A;  2QKK A;  3EYZ A;  1RT3 A;  4DLE A;  4DLG A;  2O4I A;  1HQE A;  4BE1 A;  1WSG A;  1CXU A;  2XY8 A;  2B4J A;  4I2Q A;  1JLB A;  3KLI A;  4CHO A;  4B8C A;  3SUP A;  1NK4 A;  4CFA A;  4Z4C A;  3LWM A;  3AO5 A;  3BGR A;  2FC0 A;  2D0C A;  5J1E A;  1RTH A;  2X6S A;  3SI6 A;  1C0U A;  3KLG A;  4LSL A;  4W5N A;  4E1M A;  3DLG A;  2PY5 A;  4M3Y A;  2KZM A;  4DTS A;  3OS1 A;  4B9M A;  4CEA A;  3ZSW A;  4AHT A;  4BAC A;  2G8W A;  4QOZ B;  2P1J A;  4DQS A;  1IKW A;  4DSF A;  4BWM A;  3NF8 A;  2PZS A;  1EX4 A;  1NJX A;  3V6D A;  1W0H A;  3AA2 A;  4TSX A;  4Z0U A;  1RDB A;  4B8A B;  4PA1 A;  4CE9 A;  3OYH A;  3L2R A;  4DF4 A;  5J2Q A;  1VSM A;  3TWH A;  5CY4 A;  4I2P A;  5JS2 A;  2G8H A;  3CFP A;  2IC3 A;  1SKW A;  4CJV A;  3OYK A;  1BQN A;  5EU7 A;  4FLX A;  4FJN A;  2RF2 A;  3THV A;  1L3T A;  1JL2 A;  1R0A A;  4NCA A;  4CHN A;  1U04 A;  4CF0 A;  2FBT A;  4OKJ A;  1JLF A;  2B6A A;  2DFH A;  1L3S A;  4E0D A;  1ZYQ A;  3AA3 A;  4CJU A;  1WSH A;  4AH9 A;  3OYI A;  3QO9 A;  4ELU A;  2KFZ A;  1S1W A;  1WSI A;  3L3U A;  4I7F A;  4FXD A;  3KLH A;  1J53 A;  1RT6 A;  4E1N A;  1Y97 A;  3T19 A;  1TK8 A;  4E89 A;  4FZX C;  4IBN A;  1VSJ A;  2BE2 A;  3HO1 A;  1S1V A;  2ZQB A;  3S3M A;  3LP1 A;  5KRS A;  1WNS A;  3PV8 A;  3CFR A;  2HNY A;  4CJL A;  4YFU A;  3O3H A;  1NOZ A;  3DMJ A;  3NH2 A;  1RBR A;  1YTA A;  4DSI A;  1XHX A;  5K14 A;  2VG7 A;  2P5G A;  2F96 A;  5KI6 A;  4CEQ A;  1N5Y A;  2P5O A;  4FJ9 A;  1IH7 A;  1BI4 A;  3TR8 A;  3I8D A;  4OJR A;  4LY7 A;  1F21 A;  3ZSO A;  4FM0 A;  4OKE A;  1UA0 A;  5HBM A;  3FFI A;  3G0Z A;  4AHU A;  3NH0 A;  5HRO A;  2KZZ A;  4CGG A;  1S6Q A;  2HVH A;  3OYD A;  5C42 A;  3V4I A;  2OZM A;  4FLU A;  4K8X A;  4DTU A;  2IS3 A;  3B6O A;  4CIE A;  3MEE A;  4CFD A;  1HRH A;  3VQ9 A;  4CHY A;  4F3O A;  1S1T A;  1VSE A;  4I9L A;  1KFD A;  4IG3 A;  4KI4 A;  2YNI A;  4JRQ A;  1RT2 A;  4MQ3 A;  3QEP A;  3VA0 A;  3V9U A;  1UA1 A;  1U49 A;  4BE2 A;  2G8F A;  2DTU A;  3AVJ A;  4GVM A;  4Y1D A;  4CIG A;  2YV0 X;  3LPT A;  4DWI A;  1RDA A;  1TVR A;  1W9H A;  4FM1 A;  1NK8 A;  4O4G A;  3LZI A;  3CQ8 A;  1HMV A;  3EZ5 A;  1FKP A;  1RDC A;  5I42 A;  3VQE A;  4FJ7 A;  3OYN A;  2KTQ A;  3VQP A;  3SYZ A;  3AA5 X;  3HST B;  2XY7 A;  4FJH A;  3KK1 A;  3DLR A;  3RMC A;  4J2A A;  1SKR A;  3K5M A;  1I3A A;  1S1X A;  4CEE A;  3KLF A;  1KVB A;  1WAF A;  1VRT A;  1C0T A;  3K5L A;  4CED A;  3K59 A;  3VQC A;  3QEX A;  2I5J A;  1CLQ A;  1BL3 A;  1RCH A;  1UAX A;  4CJT A;  2YHB A;  2XO7 A;  1TKX A;  4F4K A;  2YKM A;  3KIO A;  4CK2 A;  3DI6 A;  2F8T A;  4Z4H A;  4PWD A;  1RT7 A;  4K8Z A;  2YNG A;  4RW9 A;  1Q8I A;  4M41 A;  1TKD A;  2ITG A;  4O55 A;  4DU1 A;  4EZ6 A;  4CJ4 A;  3V1Q A;  3D45 A;  3AO3 A;  3VQ8 A;  4CFC A;  3OYB A;  2VWJ A;  4CGF A;  3IS9 A;  2D0A A;  5C24 A;  4M3R A;  3HP9 A;  1ZBH A;  2Z1G A;  1GOC A;  3K5O A;  2OPQ A;  3MEG A;  3AVH A;  3I0S A;  4CJS A;  3K58 A;  4DS5 A;  4E7H A;  5J2M A;  3TAB A;  1ASV A;  3K2P A;  4W5R A;  2IOC A;  2R7Y A;  2D0B A;  3MXI A;  1B9D A;  1HNI A;  3KKR A;  3L2V A;  4F2S A;  1HNV A;  1Z26 A;  2KQ2 A;  4CEO A;  2G8K A;  3ZCM A;  4DSE A;  4CEB A;  5C25 A;  2XY5 A;  1JLG A;  5I3U A;  5SWM A;  3RTV A;  4ZTJ A;  3QLH A;  3OJS A;  3QIO A;  1U45 A;  1D9F A;  1J9A A;  3HXM A;  1BI4 B;  3B6P A;  1L5U A;  3JSM A;  2W42 A;  4Z4G A;  2XRI A;  3ZSY A;  3NGI A;  4AHV A;  4RW8 A;  3TAP A;  4HCC A;  1QQC A;  3SCX A;  3BDP A;  3WNE A;  3PY8 A;  5FRM A;  3NE6 A;  3SJJ A;  1SUQ A;  5KTQ A;  1RTI A;  3V1R A;  4B9U A;  3CM6 A;  3LWL A;  1TAQ A;  1D9D A;  4FJL A;  4DQQ A;  2Z1H A;  1QSS A;  4B9V A;  1BGX T;  3NAE A;  4AHR A;  3SZ2 A;  3ISN C;  2JGU A;  3QNN A;  1NJW A;  4W5O A;  4OKK A;  4CJF A;  4DSL A;  4FJK A;  3NH1 A;  4E19 A;  4KKO A;  2OPR A;  3T1A A;  2E6M A;  4DG1 A;  4CIF A;  4BDZ A;  4DFJ A;  3QEI A;  3O3G A;  1JL1 A;  3IRX A;  3P5J A;  5J2N A;  4H4M A;  3SQ1 A;  1VSF A;  2VWK A;  2IDO A;  1J5O A;  3HVR A;  3M8S A;  1N6Q A;  3DRP A;  4FLT A;  3PO5 A;  3PO4 A;  4KHS A;  4HUE A;  3QEW A;  1A5W A;  2QXF A;  1WN7 A;  2YHA A;  2Z1J A;  3DRR A;  3HPH A;  4EP4 A;  3OYE A;  4DSJ A;  4KAZ A;  4FJM A;  4QCL A;  5FDL A;  4ELT A;  5CZ2 A;  4JS5 A;  3TAE A;  4M3T A;  3S3O A;  1KSP A;  1A5V A;  2NUB A;  3DLE A;  1RTJ A;  4FLY A;  3EY1 A;  4OPJ A;  3LAN A;  4O0J A;  4DMN A;  3MAQ A;  2HHV A;  4MFB A;  3C6T A;  1Q9Y A;  1KTQ A;  4E3S A;  1JLQ A;  1I39 A; 
#chains in the Genus database with same CATH topology
 3TAR A;  1S9E A;  4BRH A;  4JKH A;  4WFB L;  3CC4 N;  1XI1 A;  4IOA L;  2FF6 A;  4PHT X;  5M1Q A;  3ZT1 A;  4DTP A;  4B9T A;  4CJP A;  5JMV A;  4CZK A;  1KLM A;  1TK5 A;  1D5A A;  2GEL A;  3LAM A;  4BDP A;  5ADX A;  1YF5 L;  1T05 A;  1JXE A;  3J8A A;  3QIP A;  3AVF A;  4OLB A;  4M42 A;  1EWR A;  2IAJ A;  4H5T A;  1WOQ A;  1BHL A;  4IOC L;  5BPL A;  1FXX A;  4GNI A;  4LF4 K;  4CBU A;  1NGD A;  4HTL A;  3FFK B;  4CBX A;  3HVT A;  4PKH A;  3HL8 A;  2HHT A;  3DLK A;  3ULE B;  4BRG A;  4EAH D;  2A6A A;  2V52 B;  3OTO K;  5GAG P;  1ASW A;  4FW1 A;  4WQ5 C;  5EXW A;  3EN9 A;  3CF5 L;  3GG4 A;  3A8Y A;  4JI8 K;  1RTD A;  1S5J A;  1KAZ A;  4ID1 A;  2ITM A;  2PYJ A;  2F7T A;  3SV4 A;  3CCR N;  4MO5 A;  5KPT A;  3OYG A;  1IKV A;  3VQA A;  2ATQ A;  2PYL A;  4J8F A;  3DXM B;  4MDB A;  3TSP A;  1X9J A;  2BDP A;  3VET A;  4FCY A;  4M3W A;  2ZWH A;  1HKC A;  4GKK K;  2FBX A;  1HPZ A;  3NF9 A;  1YUW A;  3FR0 A;  4BRK A;  2Q2R A;  1ZC6 A;  4NLC A;  1L3V A;  4OGC A;  1RDD A;  4MDA A;  4XH1 A;  2HHU A;  3D2E B;  2O8C A;  3DOK A;  4CEZ A;  5AR0 A;  4MLE A;  3G25 A;  4BRA A;  3LDS A;  3CCS N;  3HJF A;  1BIZ A;  3VQ4 A;  5A2Q O;  3AVC A;  4LC9 B;  4CGD A;  1HNZ K;  2F8S A;  3JS6 A;  2E8A A;  4DFP A;  2GBZ A;  1MU2 A;  4DV6 K;  3LPU A;  1OVY A;  4NLB A;  1YAG A;  1QQM A;  1BQM A;  1NJZ A;  3CXC M;  4U67 L;  2IGI A;  4FJ5 A;  1NK0 A;  5JS1 A;  3M8P A;  3SPZ A;  1HYV A;  3HM9 A;  1MA9 B;  4CF8 A;  3I33 A;  1HYZ A;  2I7N A;  3HBT A;  3O8M A;  4CHZ A;  3UB5 A;  3F73 A;  3SAH A;  4FOE A;  3H3O B;  4BR5 A;  4LF9 K;  3OYM A;  1NOY A;  1TK0 A;  2A1R A;  4NO7 A;  4IFE A;  3CJA A;  4WCE L;  3T3F A;  4B9S A;  4BWJ A;  1WAJ A;  3HP6 A;  4CZJ A;  3LM9 A;  5AQY A;  4NCB A;  3OS0 A;  4CHP A;  3QES A;  3ZEU B;  4M45 A;  1KAY A;  2PBD A;  3PSF A;  2FBY A;  3QEV A;  3CJB A;  5GIP A;  1GLB G;  1NGH A;  4DTO A;  4GMJ B;  1YI2 N;  4Z94 A;  2KKZ A;  2D1K A;  2P9S A;  3M6G A;  1VK0 A;  3ZT3 A;  1VQM N;  2ZD1 A;  4WE1 A;  1EXQ A;  3WQU A;  1NK9 A;  1CZ9 A;  4M7Y A;  4E7J A;  1WBD A;  3AAR A;  4JI2 K;  3ZSQ A;  2Q97 A;  2UUA K;  4AM7 A;  2Q1N A;  1SAZ A;  3MMV A;  2GWK A;  2HVI A;  3OYC A;  3MED A;  4FLV A;  3V9W A;  1VSD A;  2D5R A;  1SL2 A;  4FZY A;  3QFU A;  4BY9 C;  4JI6 K;  4RTF D;  3NF6 A;  4DHY A;  2P9K B;  4IFV A;  4DTJ A;  5BPN A;  4FK4 A;  3GE1 A;  4B1X B;  4QS8 A;  4C23 A;  1QVF M;  4WFA L;  5C2D A;  3J7Z O;  1VQ7 N;  1SV5 A;  4H0Y B;  4YDU A;  4CF1 A;  1TL3 A;  1ILY A;  1TL1 A;  4CJE A;  4JNE A;  5BRE A;  2HBM A;  5KQ8 A;  3AVI A;  1U48 A;  4V19 S;  1ESV A;  4M3X A;  3CQX A;  5M1O A;  5CHI A;  1Z25 A;  2Q3S A;  2UUC K;  1WSE A;  1KXP A;  3A5L C;  3CCM N;  3TAM A;  3NF7 A;  5DMR A;  3DJC A;  4J2B A;  3KTQ A;  1BO5 O;  1JCG A;  3ENB A;  1J54 A;  5T7B A;  4N76 A;  5M1K A;  4DQR A;  3SUO A;  3WNF A;  3IFR A;  2FBV A;  3AAP A;  2G8V A;  3ZEU A;  1VSK A;  3AV9 A;  3F2K A;  4DV4 K;  2OZS A;  1T03 A;  3N4P A;  4F2R A;  1XQS C;  3G6E N;  1YJN N;  1SQK A;  2B5J A;  5EOY A;  1K9M O;  1RT3 A;  1HQE A;  4BE1 A;  3RR8 A;  1CXU A;  2QW9 A;  1LV5 A;  3LWM A;  3BGR A;  2FC0 A;  1RTH A;  2CGK A;  1C0U A;  1RGI A;  4E1M A;  4DTS A;  4B9M A;  4AHT A;  3SMS A;  2G8W A;  1IBM K;  2E1Y A;  4LF5 K;  1NJX A;  3V6D A;  1W2B M;  4TSX A;  4Z0U A;  3L2R A;  4DSK A;  3AGR A;  5CY4 A;  2WBN A;  3GBT A;  3CFP A;  1SKW A;  3OYK A;  3O9Q A;  4DV1 K;  5EU7 A;  4FJN A;  5C10 A;  3THV A;  2FF3 B;  1L3T A;  1JL2 A;  1R0A A;  4NCA A;  4CHN A;  2FBT A;  1JLF A;  4FWM A;  2B6A A;  1L3S A;  4JKE A;  1ZYQ A;  1QZ5 A;  3AA3 A;  1NJI O;  1WSH A;  4PKG A;  3OYI A;  4I7F A;  3P38 A;  1XUP O;  1J53 A;  1RT6 A;  4E1N A;  1LOT B;  4IBN A;  2BE2 A;  2ZQB A;  5BRH A;  3L4I A;  1WNS A;  3PV8 A;  3H1Q A;  4CZI A;  2ZM6 K;  4YFU A;  1NOZ A;  4DSI A;  4FJ9 A;  2VG7 A;  1N5Y A;  2P5O A;  1ZXO A;  1BI4 A;  3I8D A;  4FL9 A;  1RDU A;  4OJR A;  4RCH A;  1TYQ A;  3ZSO A;  2A3Z A;  1SZ2 A;  4OKE A;  4BR9 A;  5HBM A;  3NH0 A;  5C12 A;  4E3S A;  4CGG A;  2HVH A;  3MEE A;  4CFD A;  3O08 A;  1KFD A;  3QEP A;  4MQ3 A;  4B3M K;  4OPH A;  3VA0 A;  2I7P A;  4GVM A;  3LPT A;  4FM1 A;  1NK8 A;  4FWR A;  3LZI A;  4FJ7 A;  3OYN A;  3VQP A;  2XY7 A;  4BC2 A;  3O9S A;  3O1B A;  1I94 K;  3CHW A;  3K5M A;  1I3A A;  1VQP N;  2PAV A;  3HM8 A;  1C0T A;  3A5N C;  2IVN A;  4CK2 A;  2F8T A;  1RT7 A;  2YNG A;  4RW9 A;  1TKD A;  4DU1 A;  3D45 A;  1YIT N;  4CFC A;  3OYB A;  3OW2 M;  2O8F B;  1V4T A;  5AQS A;  3K5O A;  1ATR A;  3I0S A;  3MEG A;  2YJE A;  3TSQ A;  3GOI A;  1OH7 A;  2QWN A;  1LCU A;  1FW6 A;  3CPW M;  3MXI A;  4JKC A;  3KKR A;  5SWM A;  2YHX A;  2AA4 A;  2NRH A;  1D9F A;  1BI4 B;  2GEM A;  3MDQ A;  1L5U A;  4Z4G A;  4XH4 A;  4FWN A;  4H5R A;  3TAP A;  5AQM A;  4HCC A;  1QQC A;  5FRM A;  3V1R A;  3NVM A;  3LWL A;  4KH4 A;  3H1V X;  1QSS A;  2ZJQ L;  3BP8 A;  4W5O A;  3W0L A;  4E19 A;  2OPR A;  3T1A A;  2E6M A;  2CGL A;  4DG1 A;  5J2N A;  1DT9 A;  4ILG B;  3SAF A;  4YOU A;  3HVR A;  3M8S A;  3DRP A;  4FLT A;  5LY3 A;  4HUE A;  4FO0 A;  5AQH A;  3E9O A;  1WN7 A;  2Z1J A;  3OYE A;  2Q0U A;  4QCL A;  4PL8 A;  4M3T A;  4CD1 A;  1RTJ A;  3VGL A;  4JI1 K;  4YOW A;  2FSK A;  2QEX N;  4MFB A;  4DV5 K;  4GV3 A;  1KC8 O;  2KLA A;  1ITG A;  4DR6 K;  4U7B A;  4BRO A;  3TI0 A;  2F4V K;  1U2V A;  1NGA A;  4F2S A;  4ZTF A;  1LW0 A;  5AZI A;  3D0P A;  1RIL A;  5DM7 L;  4AF1 A;  2QK9 A;  2KFN A;  1XNQ K;  2WFB A;  1GLL O;  4B9L A;  3EKS A;  3K9J A;  4QAG A;  3U6F A;  1NKE A;  1NK7 A;  3FZF A;  3CME N;  3L2W A;  2E1Z A;  4FJ8 A;  3C95 A;  3SUQ A;  4PQU A;  5JLF A;  5AQK A;  4Y1C A;  5HRN A;  1SL1 A;  4DTM A;  3OYF A;  2O8D B;  3VA3 A;  4CJR A;  2RPI A;  3BUZ B;  1WSJ A;  3LDO A;  3KJV A;  3CCV N;  1EP4 A;  4KBO A;  5DK5 A;  3MXM A;  4L3Q A;  4BR2 A;  4NCG A;  3OYA A;  5DM6 L;  3ASM A;  2BH1 A;  1LAV A;  1XMO K;  3VTH A;  3CCU N;  2VG5 A;  3QNO A;  4FJG A;  5KQD A;  1NLV A;  1JLC A;  1KVC A;  4BVP A;  3O9T A;  5JLH A;  1C1C A;  3CET A;  1M90 O;  4BRP A;  3HYF A;  4JLH A;  1NMN A;  3AVM A;  3HT3 A;  3C6H A;  4YY3 K;  2HHQ A;  4AHS A;  2Y1I A;  4B3R K;  4BGB A;  2G8I A;  3VQ6 A;  3EKU A;  4EFH A;  5CYM A;  2V51 B;  2HOE A;  4KB1 A;  4JD2 B;  4KI6 A;  1TAU A;  4F8R A;  3WNH A;  4RW7 A;  4BRI A;  1NKC A;  4JI7 K;  1BCO A;  4FWS A;  1BA0 A;  3WXL A;  5AQG A;  5BRF A;  3ZYY X;  4JRP A;  4KH5 A;  3BEX A;  5AZI B;  3QBX A;  3EEQ A;  4CD3 A;  3LL3 A;  4CCH A;  1NBW A;  2Z1I A;  3DYA A;  1IBK K;  1U47 A;  4LD0 A;  2VQE K;  3OA9 A;  4CK1 A;  1NK5 A;  5D3G A;  1WBB A;  2YJF A;  4N41 A;  1QQO A;  3F9M A;  2AJQ A;  2DY4 A;  3LZJ A;  4KTQ A;  1RBT A;  3AVN A;  2ASM A;  3LP0 A;  3KK3 A;  1O13 A;  4PY5 A;  4EP5 A;  4N56 A;  1JLE A;  1T44 A;  2NZT A;  1HYS A;  5M1N A;  2HHH K;  4OPK A;  1XC3 A;  3ZET B;  1BUP A;  4EZ9 A;  1LWE A;  3FZL A;  4CER A;  4EIA A;  1QHT A;  3AVL A;  1IV0 A;  4R79 A;  3AVA A;  2HBK A;  5FPM A;  5M1P A;  3S3N A;  1NGJ A;  2OYQ A;  3F9K A;  1RT1 A;  4DFM A;  3MWP A;  3LAK A;  4KFB A;  3ZX3 A;  4BRE A;  5CYQ A;  5TKY A;  3TAF A;  3LDN A;  2IVO A;  1X1P A;  4K42 A;  4ISE A;  4B9N A;  4JD2 A;  4DU3 A;  2X6N A;  4KPY A;  4GW6 A;  3TTF A;  4HTU A;  3QBW A;  3VQ7 A;  4DKW A;  3RSE B;  4BQL A;  3VEW A;  4IXC A;  1DLO A;  4RG8 A;  4CEF A;  5KPR A;  3HPG A;  3PX0 A;  3VPZ A;  1VAZ A;  1M1K O;  2OPP A;  4CBW A;  4FLZ A;  5FLX O;  1TV6 A;  3RR7 A;  1EET A;  3C6U A;  4Q5V A;  1Q9X A;  4JHD B;  4G9Z A;  1HUX A;  3AO2 A;  1TUY A;  1NNE A;  1NGF A;  3BF1 A;  4K25 A;  4AHC A;  2RHK A;  3QFP A;  2QWO A;  1N33 K;  5CR4 A;  5I9E B;  3ZSR A;  1KD1 O;  3ENO A;  3WEE B;  3QET A;  1HLU A;  2VGN A;  4K43 A;  4FJJ A;  4C1N K;  3HPO A;  4DR2 K;  1XHZ A;  3ZET A;  4CF2 A;  3O3F A;  2P9S B;  4IFY A;  2EWS A;  1WLJ A;  1YJW N;  4XEI A;  4A2A A;  3JYT A;  1NGC A;  5GIO A;  4IZ9 A;  3KWG A;  3R3L A;  4AIL C;  2YHW A;  4C8M A;  2HBL A;  3MXJ A;  3WXK A;  1E3M A;  3L8B A;  1ZBU A;  4C1N I;  4H8K A;  4FZZ A;  3TAG A;  2EX3 A;  4JAX A;  1YT3 A;  1GOB A;  2HW3 A;  3CPE A;  3J80 O;  3E9L A;  5GIN A;  4A61 A;  4DUZ K;  3RMB A;  3LAL A;  5HRP A;  4CJ5 A;  3NCI A;  3P31 A;  1NK6 A;  4E7I A;  2HHW A;  3UE5 A;  3D2F A;  2O8B A;  2P9L A;  1K6Y A;  4FWK A;  1ATN A;  3PX4 A;  4LF8 K;  5KGW A;  3MX2 A;  3U3Y A;  1C1B A;  1SS6 A;  4E1J A;  3KK2 A;  4FPA A;  1HPM A;  2NNW A;  3EYZ A;  3MN6 A;  4DLG A;  2P9I A;  3DXM A;  4F4K A;  4I2Q A;  1JLB A;  3KLI A;  4CFA A;  3AO5 A;  3HI0 A;  5J1E A;  4W5N A;  3KLG A;  4LSL A;  2PY5 A;  2KZM A;  2A40 A;  3OS1 A;  3CCQ N;  4CEA A;  4QOZ B;  4LFC K;  3BZK A;  5AQO A;  4BWM A;  4FWL A;  2UXC K;  3AA2 A;  4B8A B;  4CE9 A;  4DF4 A;  1RDB A;  4DWI A;  2WUS A;  4A5A A;  4H0O A;  3VF2 A;  5JS2 A;  2G8H A;  2IC3 A;  3WEE A;  4FLX A;  3SBG A;  3PSI A;  5JIC A;  2NRZ A;  3FZM A;  5E26 A;  2NRV A;  1U04 A;  4CF0 A;  4UY8 O;  4DV3 K;  4E0D A;  4H5N A;  3O6W A;  4CJU A;  4AM6 A;  3QO9 A;  1S1W A;  3KLH A;  1X3N A;  1TK8 A;  4E89 A;  1S1V A;  1OH8 A;  3GDQ A;  3LP1 A;  5KRS A;  3CMA N;  4Y0W A;  3CCE N;  3E9P A;  3LDQ A;  5KI6 A;  4QS9 A;  3L6Q A;  3TR8 A;  3R6M A;  1T6D A;  1F21 A;  3MWT A;  3QDK A;  2W6K A;  4DCH A;  3TTC A;  1UA0 A;  3FFI A;  3G0Z A;  2O8B B;  1S6Q A;  4M63 C;  5H1S Q;  1VQ9 N;  2OZM A;  2OTL N;  3DLL L;  3B6O A;  3CI5 A;  3KWI A;  3ATU A;  3J7Y P;  5AJ3 K;  4DV0 K;  1KQS M;  4F3O A;  1S1T A;  4I9L A;  4IG3 A;  3V9U A;  1Z6R A;  2PFU A;  3AVJ A;  1YVN A;  4DR5 K;  1TVR A;  3THX B;  1OH6 A;  3H45 C;  3VQE A;  3D7E O;  5FPD A;  4FJH A;  3AA5 X;  4KHP K;  3VEO A;  1SKR A;  4CEE A;  3KLF A;  2P9P A;  1WAF A;  1VRT A;  3VQC A;  1CLQ A;  2I5J A;  1BL3 A;  1RCH A;  2YHB A;  1TKX A;  2YKM A;  4GKJ K;  3DI6 A;  1VQL N;  3FZK A;  4K8Z A;  2E2P A;  3CC2 N;  2ITG A;  4EZ6 A;  3K0S A;  1W7A A;  4ISF A;  4CGF A;  2D0A A;  5C24 A;  3MCP A;  1GOC A;  3TAB A;  3K2P A;  2IOC A;  2D0B A;  3HRG A;  1HNV A;  1Z26 A;  4CEO A;  3ZCM A;  1IG8 A;  5C25 A;  3VEN A;  1JLG A;  5I3U A;  4ZTJ A;  4JK8 A;  5LMU K;  1J9A A;  2ZJR L;  3B6P A;  3IKM A;  1GLA G;  2W42 A;  2XRI A;  1X3M A;  3NGI A;  4AHV A;  3BDP A;  3VTI A;  3WNE A;  4B1Z A;  1GLC G;  1TAQ A;  5AQP A;  2YHY A;  4GV9 A;  1EQY A;  4DV7 K;  1NMD A;  3NAE A;  4IO8 A;  4JK7 A;  4DSL A;  4KKO A;  3DAW A;  3QEI A;  4JKF A;  4CZG A;  2IIR A;  1JL1 A;  3HOS A;  1G99 A;  4DR4 K;  1N6Q A;  1A5W A;  3O4W A;  3DRR A;  4DSJ A;  4IDH A;  3DXK A;  1EWQ A;  4JS5 A;  5AQQ A;  5TKW A;  3S3O A;  2NUB A;  3KVG A;  3LDP A;  3U9Z A;  4IO9 L;  3SK3 A;  4OPJ A;  4O0J A;  3MAQ A;  5E84 A;  1Q9Y A;  4I6M A;  1BU6 O;  1JLQ A;  3J81 O;  4R5P A;  1EO1 A;  2YNH A;  2JWL A;  4XIU A;  3P1G A;  4JS4 A;  1VSI A;  3I56 N;  5KRT A;  5HP1 A;  4ELV A;  5JVG L;  4BRQ A;  1NGI A;  2ZGZ A;  3O4N A;  3UIQ A;  4KV8 A;  1VSH A;  3Q7C A;  2ETJ A;  3NFA A;  4PUO A;  1D4X A;  4CEC A;  3RMA A;  4FJI A;  4IJA A;  2JLE A;  3A5O C;  1P90 A;  1IG9 A;  2QWQ A;  3EL2 A;  3ZT0 A;  3M3Z A;  1ATS A;  2A5X A;  4JKA A;  3SPY A;  4KTW A;  2BTF A;  4WF9 L;  4B1V A;  2ZJP L;  4JYA K;  4H03 B;  1JKH A;  5AQV A;  1QQN A;  4N47 A;  2RE2 A;  1KVA A;  3SQ0 A;  3VEZ A;  3S9H A;  3HK2 A;  5JVH L;  4CJK A;  4HHT A;  2KW4 A;  3IG1 A;  4NYF A;  4E7K A;  5J2P A;  1UOC A;  3OBW A;  1VQO N;  3RWU A;  3A0I X;  4RW4 A;  4FK2 A;  3NGY A;  1N8R O;  4CFB A;  2ASP A;  2FSN A;  5AQX A;  2LSN A;  3NGZ A;  1BIU A;  2DFF A;  3ZSV A;  3CQY A;  3M8R A;  3KLE A;  4BE0 A;  3AAQ A;  5AQL A;  5HRS A;  1HKB A;  1K8K B;  4DFK A;  3OS2 A;  5E41 A;  3WXI A;  3KZB A;  2HNZ A;  2A42 A;  4A5B A;  3L2Q A;  4FWQ A;  3ZT2 A;  5HLF A;  3K57 A;  4FWO A;  3G4S N;  4CES A;  2E4L A;  4IEI A;  1ZBI A;  2P9U A;  1NM1 A;  4BRC A;  3QIC A;  1TGO A;  4PKI A;  3QIN A;  4UQG A;  2GTD A;  2QWP A;  4KHW A;  3ZT4 A;  3VQB A;  3GL1 A;  2VG6 A;  3CCL N;  4IG0 A;  4F9O A;  4O0I A;  3L0Q A;  2E6L A;  4KHY A;  4M3Z A;  3AGK A;  1RBV A;  3A5M C;  4LSN A;  3SNN A;  3TPQ A;  4GVE A;  1WSF A;  2E20 A;  2A1S A;  4I9Q A;  1Q18 A;  1KFS A;  1IJJ A;  1RT4 A;  2X74 A;  2DFE A;  1J6Z A;  3PX6 A;  1MDU B;  3WUH A;  4JI5 K;  4OVL A;  3M8Q A;  1BCM A;  2DPN A;  3KD1 E;  1IKY A;  4MLH A;  3V1O A;  1KRP A;  3Q7B A;  4O5F A;  3SV3 A;  3H08 A;  1S22 A;  3OJU A;  1XWL A;  2EHG A;  4FVM A;  3C0B A;  1RNH A;  3V81 A;  4Q0B A;  1DTQ A;  1X9S A;  4CJW A;  3OVN A;  1KCF A;  1J5E K;  4NYN A;  1T3V A;  3VF4 A;  4BC4 A;  1VRU A;  1NKB A;  4OGE A;  4CW7 B;  2QM1 A;  2HND A;  4C8N A;  4FK0 A;  2X78 A;  3NDK A;  1VQ8 N;  3G71 N;  5C15 A;  3FLC O;  3OY9 A;  3V9Z A;  4O44 A;  1HJR A;  5HRR A;  5AZJ B;  2Y1J A;  1N34 K;  1XC9 A;  4XH5 A;  1JJ2 M;  3AVG A;  3VQD A;  3TAN A;  4KB0 A;  4HWI A;  4CGI A;  4ZHR A;  3AA4 A;  4DB3 A;  5IT9 O;  2P9U B;  3CM5 A;  4JKG B;  4CGH A;  1VQN N;  4KO0 A;  1BG3 A;  4H0P A;  4FPB A;  2GV9 A;  1RT5 A;  1NU0 A;  1T7P A;  1LWF A;  3LP2 A;  4YOT A;  4YNQ A;  3U3G A;  3O80 A;  4QS7 A;  3SUN A;  1KLN A;  4ILH A;  4B3O A;  4ISG A;  1VSL A;  3ZSX A;  4ILJ A;  3EZW A;  3V9X A;  4C8L A;  4Z4F A;  2XHB A;  3CCJ N;  3EE8 A;  1CZB A;  4CHQ A;  3VQ5 A;  4B1W B;  4DF8 A;  1S1U A;  3QML A;  4IDK A;  4A2B A;  1C0M A;  4YHH K;  4BRL A;  5BN9 A;  2O8E A;  3UKR A;  4YOV A;  5CE3 A;  4B1U B;  4CJ3 A;  2WC9 A;  3SBT A;  4DR7 K;  4BRF A;  4CZL A;  2YKN A;  3KKS A;  2ZE2 A;  2OA8 A;  4DTN A;  1REV A;  2F9T A;  4DLE A;  2O4I A;  4JKD A;  3SUP A;  2XY8 A;  5FRN A;  3IUC A;  5HL7 L;  4B8C A;  1U6Z A;  3N4Q A;  2D0C A;  3SI6 A;  2GUP A;  3O9U A;  3DLG A;  4M3Y A;  2VQF K;  3ZSW A;  1VQ4 N;  1OKJ A;  5AQJ A;  4AQY K;  3HOT A;  4DSF A;  2PZS A;  1EX4 A;  1W0H A;  1BDG A;  2IVP A;  1E4F T;  3OYH A;  4YOR A;  1HKG A;  1VSM A;  3TWH A;  2NRW A;  4I2P A;  3T1Y K;  3MN5 A;  4CJV A;  5EY4 A;  3U9D A;  4FWP A;  3T7Z A;  4OKJ A;  2P9I B;  3OBY A;  5AQI A;  3L4Q A;  4ELU A;  2KFZ A;  1WSI A;  2W40 A;  4BRM A;  3ENH A;  3U4L A;  1GLE G;  3T19 A;  5AQT A;  3ULE A;  1VSJ A;  1K8A O;  3S3M A;  5AQN A;  3CFR A;  3DMJ A;  3NH2 A;  5K14 A;  2P5G A;  2F96 A;  4CZM A;  5AFU A;  1IH7 A;  1NG9 A;  2QWL A;  4FM0 A;  2P9N B;  3TU5 A;  4AHU A;  1VQK N;  2KZZ A;  1DGK N;  4WQ4 A;  3V4I A;  4FLU A;  4K8X A;  4DTU A;  4CIE A;  3VQ9 A;  3NMU A;  4CHY A;  4JKB A;  1VSE A;  4KI4 A;  4BR0 A;  1RT2 A;  3HZ6 A;  3UKU B;  2P9K A;  4CIG A;  4O8K A;  2YV0 X;  3CJC A;  1RDA A;  1W9H A;  4FSV A;  4K0K K;  1FKP A;  5I42 A;  1NGG A;  2KTQ A;  1WUA A;  3HST B;  1QVG M;  3KK1 A;  2QWR A;  5F0X A;  4DUY K;  1KVB A;  3K59 A;  1R59 O;  4CED A;  1UAX A;  4CJT A;  3WQT A;  3KIO A;  5AQW A;  4Z4H A;  5BN8 A;  4JEP A;  2ASO A;  1Q8I A;  2V7Z A;  4O55 A;  2VWJ A;  3LDL A;  3HP9 A;  1ZBH A;  3W3D A;  1K73 O;  2OPQ A;  4DS5 A;  3AVH A;  5ELZ A;  3K58 A;  2CH5 A;  2W6L A;  1ASV A;  3U8X A;  3THX A;  5AQZ A;  3VEY A;  5BPM A;  4W5R A;  2R7Y A;  3FGU A;  4CZE A;  5F2R A;  1HNI A;  4CVN E;  3L2V A;  4DSE A;  4CEB A;  2HBJ A;  2XY5 A;  3ATV A;  1U45 A;  3FE1 A;  5IWA K;  1Y64 A;  4BC3 A;  2P9N A;  4YOX A;  3ZSY A;  1GLF O;  3SCX A;  4YOY A;  4B3S K;  5KTQ A;  4B9U A;  2Q0R A;  1D9D A;  4DQQ A;  4H0T B;  3SZ2 A;  4AHR A;  2UXD K;  2JGU A;  3FZH A;  4FJK A;  2VYP A;  4BDZ A;  4H0V B;  2QTD A;  3CER A;  4DFJ A;  3O3G A;  3IRX A;  3SQ1 A;  2VWK A;  2IDO A;  4KHS A;  3NVK A;  3QEW A;  1H1V A;  1IBL K;  4YDU C;  4EP4 A;  4NB4 A;  4KAZ A;  4FJM A;  4ELT A;  5CZ2 A;  5B8H A;  1A5V A;  2ZF5 O;  3DLE A;  3PIO L;  3EY1 A;  4WYB A;  3C65 A;  4BQZ A;  4DMN A;  1VQ6 N;  2HHV A;  2FSJ A;  3P4I A;  2BUP A;  3C6T A;  3R8E A;  1KTQ A;  3IMX A;  4LF6 K;  4Z4C A;  1I39 A;  5BR9 A;  1OVQ A;  2NRR A;  2HHX A;  1B92 A;  1S72 N;  4CK3 A;  1X9W A;  3ID6 A;  4IWV A;  1TKZ A;  5BRD A;  4HVJ A;  3CG7 A;  3CC7 N;  4BRD A;  1Q82 O;  4J2D A;  4JI3 K;  4O5B A;  3WT0 A;  4MO4 A;  3VGM A;  3CJ1 A;  1FJG K;  2E2Q A;  4F3T A;  1LWC A;  3M5R A;  1GOA A;  2BGG A;  2WON A;  3CIP A;  1VHX A;  1BWF O;  3E66 A;  3PLA A;  3RSE A;  4J2E A;  3DWL A;  4OLA A;  3KD5 E;  1RBS A;  1L3U A;  2YNF A;  3A2F A;  4RWT A;  3O4Q A;  4FVU A;  4CGJ A;  2O4G A;  1B9F A;  1JLA A;  3C7N A;  3DLB A;  4BR7 A;  4X64 K;  1S6P A;  1QSL A;  3DLH A;  3I0R A;  5GAE P;  2F9W A;  4JHD A;  1XNR K;  4L8R B;  1BA1 A;  3RVC A;  1SKS A;  3IAY A;  1FKO A;  1HQU A;  3I8B A;  1FK9 A;  3SQ2 A;  3D2E A;  2O8C B;  1SL0 A;  1XMQ K;  2W41 A;  3VER A;  1BOT O;  3C94 A;  1JXB A;  4X62 K;  3OYL A;  1LW2 A;  3CYM A;  2QI2 A;  4LF7 K;  1DEJ A;  1ZBS A;  1ZBF A;  2HF4 A;  2O8F A;  3MEC A;  4FYD A;  3AO1 A;  4C8K A;  2D0P A;  1QTM A;  1RDW X;  3M1F A;  1Z05 A;  1MWK A;  1JCE A;  4WQ4 C;  1ASU A;  4RW6 A;  2JWK A;  4DR1 K;  4A62 A;  3LP3 A;  3KHY A;  4W5T A;  3OYJ A;  1S9G A;  4M7X A;  4H5V A;  2QKB A;  4HUG A;  3VOV A;  5AQU A;  2P9P B;  1T6C A;  4CJQ A;  4CJ7 A;  2E2N A;  2H3G X;  1V4S A;  1RBU A;  1D8Y A;  3BZC A;  3DM2 A;  4H5W A;  2P9L B;  4LH4 A;  1MWM A;  1IKX A;  4M3U A;  2Q31 A;  4KHQ A;  1GLD G;  1WB9 A;  1YTU A;  2VGM A;  4DS4 A;  3VEV A;  1C6V A;  1GLJ O;  1DTT A;  3ULD A;  3E01 A;  4JK9 A;  4FOI A;  1BIS A;  4FJX A;  3BF3 A;  1Q86 O;  5KGX A;  4JN4 A;  2HB5 A;  3C7N B;  3VGK A;  4LH5 A;  4DQI A;  2UU9 K;  3MCA B;  3C6A A;  3NBP A;  1QZ6 A;  1U4B A;  2G8U A;  3RRH A;  4DU4 A;  3PUF A;  2WOM A;  1P8Z A;  4N5S A;  4ID5 A;  3R1X A;  5SZT A;  1NWK A;  3THY B;  4BVO A;  5ADX H;  4FW2 A;  3BY5 A;  3VN5 A;  2E5L K;  2AP1 A;  2RN2 A;  4C8O A;  2HHS A;  3OHR A;  2OPS A;  3AVK A;  3RMD A;  4ICL A;  3NHG A;  2XY6 A;  1ZBL A;  2GUI A;  2BAN A;  2Q36 A;  4KTZ A;  4FLW A;  1HJO A;  2RKI A;  1Q81 O;  5AQR A;  2NRT A;  3G10 A;  4Z4I A;  4H4O A;  4DTX A;  2UUB K;  3QER A;  2FXU A;  4BRN A;  3TAQ A;  5FPE A;  3DRS A;  2D4W A;  3AVB A;  1QSY A;  4IKF A;  3DXK B;  3K5N A;  4KRE A;  2P51 A;  1QS4 A;  3AO4 A;  2KHO A;  1CXQ A;  2HST A;  4CI6 A;  3ID8 A;  2O8D A;  3SQ4 A;  1A5X A;  4I6M B;  1N32 K;  4DQP A;  1S3X A;  2QA4 N;  4X66 K;  5CZ1 A;  2NLX A;  4KHN A;  3ZSZ A;  2HMI A;  4GV6 A;  4B08 A;  4Z4E A;  1O1W A;  1YVU A;  1G15 A;  2VWB A;  5AQF A;  3MN9 A;  2QXL A;  4W5Q A;  4CF9 A;  4KHU A;  1EKE A;  3SJH A;  3CFO A;  3TTD A;  1QHA A;  5HOO A;  3ALY A;  3L2U A;  4CZF A;  4BC5 A;  3P83 D;  4B1Y B;  3ITH A;  1HNX K;  5FRO A;  4EHU A;  4KRF A;  3DOL A;  1UWB A;  1C1A A;  3H3N O;  4FM2 A;  3CJ7 A;  3WNG A;  1YIJ N;  4LFA K;  1T8E A;  2OTJ N;  2QWM A;  2CH6 A;  5LJV A;  3V9S A;  5MLC Q;  3THY A;  3VQQ A;  4A59 A;  3VF6 A;  4BDY A;  4KH6 A;  5FPN A;  3VEX A;  1TKT A;  2YCH A;  3L3V A;  5EVZ A;  1JCF A;  4G1Q A;  1X9M A;  2UXB K;  1IO2 A;  2FLO A;  2OAN A;  4GY2 B;  4E7L A;  4JI0 K;  1N36 K;  4IJN A;  1NJY A;  1RFQ A;  3RRG A;  3LM2 A;  1LAW A;  1KAX A;  4HUF A;  4OPA A;  4DTR A;  4HCB A;  1QE1 A;  2V7Y A;  2QKK A;  4BGA A;  3ZX0 A;  1WSG A;  4CHO A;  3WXJ A;  2B4J A;  5EX5 A;  1NK4 A;  1E4G T;  1YXQ A;  2X6S A;  3IDH A;  3SMP A;  4BAC A;  2D0O A;  2P1J A;  3CD6 N;  4DQS A;  1U2V B;  1IKW A;  3T69 A;  3NF8 A;  5F1X A;  3HTV A;  4DR3 K;  1YHQ N;  3UKR B;  4PA1 A;  5J2Q A;  1TYQ B;  3AY9 A;  1BQN A;  3MK6 A;  3THW A;  2RF2 A;  4DV2 K;  4LFB K;  3MN7 A;  1CZA N;  2ZGY A;  3E1Y A;  1OH5 A;  2DFH A;  2A41 A;  4X65 K;  4AH9 A;  2GX9 A;  3L3U A;  4FXD A;  3B8A X;  3T1H K;  1Y97 A;  4FZX C;  2GWJ A;  2YI1 A;  3HO1 A;  4IEE A;  1VQ5 N;  2HNY A;  4CJL A;  4B9Q A;  3O1W A;  3O3H A;  1RBR A;  1YTA A;  1XHX A;  2E2O A;  4CEQ A;  4NXN K;  2CGJ A;  4K41 A;  5LMN K;  2OCE A;  4LY7 A;  2WTU A;  5HRO A;  4CZH A;  3OYD A;  5C42 A;  3VES A;  2IS3 A;  1W97 L;  3O5B A;  1HRH A;  1C0F A;  3JAM O;  2YNI A;  4JRQ A;  1UA1 A;  2G8F A;  1U49 A;  2DTU A;  3S41 A;  4BE2 A;  5M1F A;  4Y1D A;  3I55 N;  1Q7Y O;  3SLC A;  2YX6 A;  5AFU H;  4O4G A;  3CQ8 A;  1HMV A;  3EZ5 A;  1RDC A;  5C2F A;  4A57 A;  3SYZ A;  3J7A P;  3DLR A;  3RMC A;  4J2A A;  1S1X A;  5AZJ A;  3K5L A;  1TUU A;  3TSU A;  3QEX A;  3VMF B;  2XO7 A;  4B3T K;  4JV5 K;  3D6R A;  3JXU A;  4PWD A;  3ZX2 A;  4M41 A;  3THW B;  3H6E A;  4JKG A;  3CJ9 A;  4CJ4 A;  4BG8 A;  3V1Q A;  3AO3 A;  3VQ8 A;  4EHT A;  3IS9 A;  4O8U A;  4M3R A;  4BG9 A;  2Z1G A;  1NGB A;  3UKU A;  4CJS A;  2HMP A;  4PL7 A;  3SAG A;  4E7H A;  5J2M A;  3D2F B;  4JI4 K;  1HNW K;  4DQ8 A;  4H0X B;  1K8K A;  4WQ5 A;  1B9D A;  3HSC A;  2KQ2 A;  2G8K A;  3ZLJ A;  2J4R A;  4BR4 A;  5GAH P;  3RTV A;  3EE9 A;  3QLH A;  3OJS A;  2HF3 A;  3QIO A;  5GAD P;  3HXM A;  3EO3 A;  1DKG D;  3JSM A;  1NGE A;  3R9P A;  4RW8 A;  3PY8 A;  5KPZ A;  4WFN L;  3NE6 A;  1SUQ A;  3SJJ A;  1RTI A;  4OO1 J;  3CM6 A;  4FJL A;  2Z1H A;  4B9V A;  1BGX T;  3QNN A;  3ISN C;  1NJW A;  4OKK A;  4CJF A;  3NH1 A;  2O8E B;  5BR8 K;  4NXM K;  4CIF A;  1HX1 A;  3P5J A;  4H4M A;  1VSF A;  5LL6 Z;  1J5O A;  3PO5 A;  3PO4 A;  1YJ9 N;  3QB0 A;  2VCP A;  1C0G A;  3F5T A;  2QXF A;  2YHA A;  3HPH A;  3KK7 A;  3MX5 A;  5LJW A;  3K9K A;  5FDL A;  3TAE A;  4IOX A;  2E88 A;  1KSP A;  2UYT A;  3PIP L;  3WXM B;  4FLY A;  3LAN A;  5C0Y A;  1HR0 K;  3P39 A;  2NRX A;  4OX9 K;  3O9R A;  3H46 O; 
#chains in the Genus database with same CATH homology
 3TAR A;  1ITG A;  4R5P A;  2YNH A;  1S9E A;  2HHX A;  1B92 A;  3TI0 A;  4XIU A;  1XI1 A;  4CK3 A;  1X9W A;  3P1G A;  4JS4 A;  3ZT1 A;  4DTP A;  4B9T A;  1VSI A;  1TKZ A;  4CJP A;  5KRT A;  5HP1 A;  4ZTF A;  1LW0 A;  4HVJ A;  3D0P A;  1RIL A;  3CG7 A;  4ELV A;  4J2D A;  1KLM A;  2QK9 A;  2KFN A;  4O5B A;  1TK5 A;  1D5A A;  4B9L A;  3LAM A;  4BDP A;  3O4N A;  3U6F A;  1NKE A;  4QAG A;  3UIQ A;  1T05 A;  1JXE A;  1VSH A;  1LWC A;  4KV8 A;  1NK7 A;  4F3T A;  3QIP A;  3AVF A;  4OLB A;  1GOA A;  2BGG A;  2WON A;  2ETJ A;  3NFA A;  3L2W A;  4PUO A;  4M42 A;  4CEC A;  4FJ8 A;  3RMA A;  3C95 A;  4FJI A;  3SUQ A;  2IAJ A;  4PQU A;  1BHL A;  2JLE A;  1IG9 A;  4Y1C A;  5HRN A;  4J2E A;  3ZT0 A;  4OLA A;  1FXX A;  1SL1 A;  4DTM A;  3KD5 E;  3OYF A;  1RBS A;  3SPY A;  3HVT A;  1L3U A;  2YNF A;  3A2F A;  3O4Q A;  4KTW A;  4CGJ A;  3HL8 A;  3VA3 A;  2O4G A;  1B9F A;  3DLK A;  1JLA A;  2HHT A;  4CJR A;  2RPI A;  3DLB A;  3DLH A;  1JKH A;  1S6P A;  1WSJ A;  3KJV A;  3I0R A;  1QSL A;  1EP4 A;  5DK5 A;  3MXM A;  1ASW A;  4N47 A;  4L8R B;  4FW1 A;  1KVA A;  3SQ0 A;  4NCG A;  3OYA A;  3S9H A;  3ASM A;  3HK2 A;  1LAV A;  1SKS A;  4CJK A;  4HHT A;  2KW4 A;  1FKO A;  1HQU A;  3IG1 A;  4NYF A;  1S5J A;  1RTD A;  3IAY A;  1FK9 A;  2VG5 A;  3SQ2 A;  4E7K A;  4ID1 A;  3QNO A;  1UOC A;  5J2P A;  4FJG A;  1SL0 A;  2PYJ A;  1JLC A;  3SV4 A;  1KVC A;  3RWU A;  3C94 A;  1JXB A;  4RW4 A;  3OYL A;  4FK2 A;  1LW2 A;  3CYM A;  3NGY A;  4CFB A;  1C1C A;  3OYG A;  1ZBF A;  1IKV A;  3MEC A;  4FYD A;  3AO1 A;  3HYF A;  4JLH A;  3VQA A;  4C8K A;  2ATQ A;  3AVM A;  3HT3 A;  2PYL A;  1QTM A;  2LSN A;  3NGZ A;  2HHQ A;  1BIU A;  2DFF A;  3ZSV A;  4AHS A;  2Y1I A;  3M8R A;  2BDP A;  3KLE A;  4BE0 A;  4FCY A;  4M3W A;  2G8I A;  5HRS A;  1ASU A;  3VQ6 A;  5CYM A;  4DFK A;  2FBX A;  4RW6 A;  4KB1 A;  1HPZ A;  3OS2 A;  4KI6 A;  3NF9 A;  1TAU A;  4F8R A;  3LP3 A;  5E41 A;  3WNH A;  4RW7 A;  1NKC A;  4W5T A;  3OYJ A;  1S9G A;  1BCO A;  2HNZ A;  4Q0B A;  4JRP A;  2QKB A;  4HUG A;  3L2Q A;  1L3V A;  4CCH A;  4OGC A;  3ZT2 A;  1RDD A;  5HLF A;  3DYA A;  2Z1I A;  4CJQ A;  3K57 A;  2HHU A;  4CES A;  3DOK A;  2E4L A;  1U47 A;  1RBU A;  4CEZ A;  1D8Y A;  4LD0 A;  3DM2 A;  4LH4 A;  5FRN A;  4CK1 A;  1NK5 A;  1IKX A;  5D3G A;  1ZBI A;  4N41 A;  4M3U A;  3LDS A;  4DSK A;  4KHQ A;  3HJF A;  1TGO A;  1BIZ A;  3VQ4 A;  2AJQ A;  1YTU A;  3QIN A;  4UQG A;  3AVC A;  4KHW A;  3ZT4 A;  2DY4 A;  3LZJ A;  4CGD A;  3VQB A;  4DS4 A;  2F8S A;  1C6V A;  2VG6 A;  1DTT A;  3ULD A;  3E01 A;  4IG0 A;  4O0I A;  4DFP A;  2GBZ A;  1MU2 A;  4KTQ A;  4KHY A;  2E6L A;  3LPU A;  1RBT A;  1BIS A;  3AVN A;  1RBV A;  4M3Z A;  3LP0 A;  3KK3 A;  4FJX A;  1BQM A;  4LSN A;  3SNN A;  1NJZ A;  4PY5 A;  5KGX A;  1WSF A;  4EP5 A;  2HB5 A;  4N56 A;  2IGI A;  4FJ5 A;  1JLE A;  4LH5 A;  4DQI A;  1HYS A;  2A1S A;  1NK0 A;  4I9Q A;  5JS1 A;  3M8P A;  3SPZ A;  1KFS A;  1HYV A;  3HM9 A;  1LV5 A;  1RT4 A;  2X74 A;  3NBP A;  4OPK A;  1U4B A;  2G8U A;  2DFE A;  3RRH A;  4CF8 A;  4DU4 A;  3PX6 A;  4EZ9 A;  3PUF A;  1HYZ A;  2WOM A;  4OVL A;  1LWE A;  4CER A;  3M8Q A;  1BCM A;  1QHT A;  3AVL A;  3KD1 E;  1IKY A;  3AVA A;  3V1O A;  4ID5 A;  4CHZ A;  4N5S A;  1KRP A;  3SV3 A;  3H08 A;  5SZT A;  3F73 A;  3OJU A;  1XWL A;  2EHG A;  4FVM A;  4FW2 A;  3VN5 A;  1RNH A;  3OYM A;  3V81 A;  3S3N A;  2RN2 A;  1TK0 A;  1NOY A;  2OYQ A;  4C8O A;  1DTQ A;  1X9S A;  2OPS A;  3AVK A;  2HHS A;  3F9K A;  4ICL A;  3RMD A;  3NHG A;  1RT1 A;  4DFM A;  2A1R A;  4CJW A;  2XY6 A;  3OVN A;  1KCF A;  1ZBL A;  3T3F A;  4NYN A;  4B9S A;  2GUI A;  2BAN A;  1VRU A;  4KTZ A;  4FLW A;  2RKI A;  3LAK A;  4BWJ A;  4KFB A;  1NKB A;  1WAJ A;  5CYQ A;  3HP6 A;  4OGE A;  3G10 A;  3TAF A;  4Z4I A;  4H4O A;  4DTX A;  2HND A;  4C8N A;  3OS0 A;  3QER A;  4CHP A;  3QES A;  4NCB A;  1X1P A;  4M45 A;  4FK0 A;  3TAQ A;  2X78 A;  3NDK A;  3DRS A;  2FBY A;  4DU3 A;  3QEV A;  2X6N A;  3AVB A;  4GW6 A;  4B9N A;  4KPY A;  4HTU A;  1QSY A;  3VQ7 A;  3OY9 A;  3V9Z A;  4O44 A;  4DTO A;  1HJR A;  4GMJ B;  5HRR A;  3K5N A;  4IKF A;  4KRE A;  2P51 A;  2Y1J A;  1QS4 A;  1VK0 A;  3ZT3 A;  3AO4 A;  1CXQ A;  1DLO A;  4RG8 A;  1XC9 A;  2ZD1 A;  4CEF A;  4WE1 A;  3AVG A;  1EXQ A;  3HPG A;  3SQ4 A;  3PX0 A;  1A5X A;  1NK9 A;  3VQD A;  2OPP A;  3TAN A;  4KB0 A;  4FLZ A;  1CZ9 A;  3RR8 A;  4DQP A;  4E7J A;  1TV6 A;  4CGI A;  4ZHR A;  3AA4 A;  1EET A;  3C6U A;  3ZSQ A;  4Q5V A;  3RR7 A;  1Q9X A;  5CZ1 A;  3CM5 A;  4CGH A;  4KHN A;  3AO2 A;  3ZSZ A;  2HMI A;  2HVI A;  3OYC A;  3MED A;  4B08 A;  4FLV A;  3V9W A;  4Z4E A;  1VSD A;  2D5R A;  1O1W A;  4KO0 A;  1SL2 A;  1YVU A;  4FZY A;  4AHC A;  1G15 A;  2GV9 A;  4KHU A;  4W5Q A;  4CF9 A;  1RT5 A;  3NF6 A;  1EKE A;  3CFO A;  4IFV A;  4DTJ A;  1T7P A;  1LWF A;  4FK4 A;  3LP2 A;  3ZSR A;  3L2U A;  3ALY A;  3QET A;  4YNQ A;  3U3G A;  3P83 D;  3ITH A;  5FRO A;  4KRF A;  3DOL A;  3SUN A;  1UWB A;  1KLN A;  4FJJ A;  1C1A A;  1SV5 A;  3HPO A;  4CF1 A;  1XHZ A;  1TL3 A;  4CF2 A;  4B3O A;  3O3F A;  4FM2 A;  1VSL A;  3WNG A;  3ZSX A;  1TL1 A;  4CJE A;  4IFY A;  1WLJ A;  1T8E A;  3JYT A;  3V9X A;  4C8L A;  4Z4F A;  3AVI A;  3V9S A;  2XHB A;  1U48 A;  4AIL C;  4M3X A;  1CZB A;  4C8M A;  1Z25 A;  3VQQ A;  3MXJ A;  4CHQ A;  3VQ5 A;  2Q3S A;  3L8B A;  1ZBU A;  4BDY A;  1WSE A;  4DF8 A;  4H8K A;  4FZZ A;  1TKT A;  1S1U A;  2EX3 A;  3L3V A;  3NF7 A;  3TAM A;  3TAG A;  5DMR A;  4G1Q A;  4IDK A;  1X9M A;  1YT3 A;  1GOB A;  2HW3 A;  1C0M A;  3KTQ A;  4J2B A;  1IO2 A;  1J54 A;  5T7B A;  3RMB A;  3LAL A;  5HRP A;  4E7L A;  4DQR A;  4N76 A;  4CJ5 A;  4CJ3 A;  3NCI A;  3WNF A;  3SUO A;  1NK6 A;  4E7I A;  1NJY A;  2HHW A;  2FBV A;  3RRG A;  2G8V A;  1LAW A;  1K6Y A;  1VSK A;  3AV9 A;  3PX4 A;  4HUF A;  2OZS A;  5KGW A;  1T03 A;  2YKN A;  3KKS A;  1C1B A;  3U3Y A;  4F2R A;  3KK2 A;  4DTR A;  4HCB A;  1QE1 A;  2ZE2 A;  2OA8 A;  2B5J A;  4DTN A;  1REV A;  2QKK A;  3EYZ A;  1RT3 A;  4DLE A;  4DLG A;  2O4I A;  1HQE A;  4BE1 A;  1WSG A;  1CXU A;  2XY8 A;  2B4J A;  4I2Q A;  1JLB A;  3KLI A;  4CHO A;  4B8C A;  3SUP A;  1NK4 A;  4CFA A;  4Z4C A;  3LWM A;  3AO5 A;  3BGR A;  2FC0 A;  2D0C A;  5J1E A;  1RTH A;  2X6S A;  3SI6 A;  1C0U A;  3KLG A;  4LSL A;  4W5N A;  4E1M A;  3DLG A;  2PY5 A;  4M3Y A;  2KZM A;  4DTS A;  3OS1 A;  4B9M A;  4CEA A;  3ZSW A;  4AHT A;  4BAC A;  2G8W A;  4QOZ B;  2P1J A;  4DQS A;  1IKW A;  4DSF A;  4BWM A;  3NF8 A;  2PZS A;  1EX4 A;  1NJX A;  3V6D A;  1W0H A;  3AA2 A;  4TSX A;  4Z0U A;  1RDB A;  4B8A B;  4PA1 A;  4CE9 A;  3OYH A;  3L2R A;  4DF4 A;  5J2Q A;  1VSM A;  3TWH A;  5CY4 A;  4I2P A;  5JS2 A;  2G8H A;  3CFP A;  2IC3 A;  1SKW A;  4CJV A;  3OYK A;  1BQN A;  5EU7 A;  4FLX A;  4FJN A;  2RF2 A;  3THV A;  1L3T A;  1JL2 A;  1R0A A;  4NCA A;  4CHN A;  1U04 A;  4CF0 A;  2FBT A;  4OKJ A;  1JLF A;  2B6A A;  2DFH A;  1L3S A;  4E0D A;  1ZYQ A;  3AA3 A;  4CJU A;  1WSH A;  4AH9 A;  3OYI A;  3QO9 A;  4ELU A;  2KFZ A;  1S1W A;  1WSI A;  3L3U A;  4I7F A;  4FXD A;  3KLH A;  1J53 A;  1RT6 A;  4E1N A;  1Y97 A;  3T19 A;  1TK8 A;  4E89 A;  4FZX C;  4IBN A;  1VSJ A;  2BE2 A;  3HO1 A;  1S1V A;  2ZQB A;  3S3M A;  3LP1 A;  5KRS A;  1WNS A;  3PV8 A;  3CFR A;  2HNY A;  4CJL A;  4YFU A;  3O3H A;  1NOZ A;  3DMJ A;  3NH2 A;  1RBR A;  1YTA A;  4DSI A;  1XHX A;  5K14 A;  2VG7 A;  2P5G A;  2F96 A;  5KI6 A;  4CEQ A;  1N5Y A;  2P5O A;  4FJ9 A;  1IH7 A;  1BI4 A;  3TR8 A;  3I8D A;  4OJR A;  4LY7 A;  1F21 A;  3ZSO A;  4FM0 A;  4OKE A;  1UA0 A;  5HBM A;  3FFI A;  3G0Z A;  4AHU A;  3NH0 A;  5HRO A;  2KZZ A;  4CGG A;  1S6Q A;  2HVH A;  3OYD A;  5C42 A;  3V4I A;  2OZM A;  4FLU A;  4K8X A;  4DTU A;  2IS3 A;  3B6O A;  4CIE A;  3MEE A;  4CFD A;  1HRH A;  3VQ9 A;  4CHY A;  4F3O A;  1S1T A;  1VSE A;  4I9L A;  1KFD A;  4IG3 A;  4KI4 A;  2YNI A;  4JRQ A;  1RT2 A;  4MQ3 A;  3QEP A;  3VA0 A;  3V9U A;  1UA1 A;  1U49 A;  4BE2 A;  2G8F A;  2DTU A;  3AVJ A;  4GVM A;  4Y1D A;  4CIG A;  2YV0 X;  3LPT A;  4DWI A;  1RDA A;  1TVR A;  1W9H A;  4FM1 A;  1NK8 A;  4O4G A;  3LZI A;  3CQ8 A;  1HMV A;  3EZ5 A;  1FKP A;  1RDC A;  5I42 A;  3VQE A;  4FJ7 A;  3OYN A;  2KTQ A;  3VQP A;  3SYZ A;  3AA5 X;  3HST B;  2XY7 A;  4FJH A;  3KK1 A;  3DLR A;  3RMC A;  4J2A A;  1SKR A;  3K5M A;  1I3A A;  1S1X A;  4CEE A;  3KLF A;  1KVB A;  1WAF A;  1VRT A;  1C0T A;  3K5L A;  4CED A;  3K59 A;  3VQC A;  3QEX A;  2I5J A;  1CLQ A;  1BL3 A;  1RCH A;  1UAX A;  4CJT A;  2YHB A;  2XO7 A;  1TKX A;  4F4K A;  2YKM A;  3KIO A;  4CK2 A;  3DI6 A;  2F8T A;  4Z4H A;  4PWD A;  1RT7 A;  4K8Z A;  2YNG A;  4RW9 A;  1Q8I A;  4M41 A;  1TKD A;  2ITG A;  4O55 A;  4DU1 A;  4EZ6 A;  4CJ4 A;  3V1Q A;  3D45 A;  3AO3 A;  3VQ8 A;  4CFC A;  3OYB A;  2VWJ A;  4CGF A;  3IS9 A;  2D0A A;  5C24 A;  4M3R A;  3HP9 A;  1ZBH A;  2Z1G A;  1GOC A;  3K5O A;  2OPQ A;  3MEG A;  3AVH A;  3I0S A;  4CJS A;  3K58 A;  4DS5 A;  4E7H A;  5J2M A;  3TAB A;  1ASV A;  3K2P A;  4W5R A;  2IOC A;  2R7Y A;  2D0B A;  3MXI A;  1B9D A;  1HNI A;  3KKR A;  3L2V A;  4F2S A;  1HNV A;  1Z26 A;  2KQ2 A;  4CEO A;  2G8K A;  3ZCM A;  4DSE A;  4CEB A;  5C25 A;  2XY5 A;  1JLG A;  5I3U A;  5SWM A;  3RTV A;  4ZTJ A;  3QLH A;  3OJS A;  3QIO A;  1U45 A;  1D9F A;  1J9A A;  3HXM A;  1BI4 B;  3B6P A;  1L5U A;  3JSM A;  2W42 A;  4Z4G A;  2XRI A;  3ZSY A;  3NGI A;  4AHV A;  4RW8 A;  3TAP A;  4HCC A;  1QQC A;  3SCX A;  3BDP A;  3WNE A;  3PY8 A;  5FRM A;  3NE6 A;  3SJJ A;  1SUQ A;  5KTQ A;  1RTI A;  3V1R A;  4B9U A;  3CM6 A;  3LWL A;  1TAQ A;  1D9D A;  4FJL A;  4DQQ A;  2Z1H A;  1QSS A;  4B9V A;  1BGX T;  3NAE A;  4AHR A;  3SZ2 A;  3ISN C;  2JGU A;  3QNN A;  1NJW A;  4W5O A;  4OKK A;  4CJF A;  4DSL A;  4FJK A;  3NH1 A;  4E19 A;  4KKO A;  2OPR A;  3T1A A;  2E6M A;  4DG1 A;  4CIF A;  4BDZ A;  4DFJ A;  3QEI A;  3O3G A;  1JL1 A;  3IRX A;  3P5J A;  5J2N A;  4H4M A;  3SQ1 A;  1VSF A;  2VWK A;  2IDO A;  1J5O A;  3HVR A;  3M8S A;  1N6Q A;  3DRP A;  4FLT A;  3PO5 A;  3PO4 A;  4KHS A;  4HUE A;  3QEW A;  1A5W A;  2QXF A;  1WN7 A;  2YHA A;  2Z1J A;  3DRR A;  3HPH A;  4EP4 A;  3OYE A;  4DSJ A;  4KAZ A;  4FJM A;  4QCL A;  5FDL A;  4ELT A;  5CZ2 A;  4JS5 A;  3TAE A;  4M3T A;  3S3O A;  1KSP A;  1A5V A;  2NUB A;  3DLE A;  1RTJ A;  4FLY A;  3EY1 A;  4OPJ A;  3LAN A;  4O0J A;  4DMN A;  3MAQ A;  2HHV A;  4MFB A;  3C6T A;  1Q9Y A;  1KTQ A;  4E3S A;  1JLQ A;  1I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...