4CF2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf2A00
1JL1A 3ZSVA 3QNNA 3VQ9A 2RPIA 3OYNA 1HRHA 1HPZA 1I3AA 2KZZA 2Z1IA 4OPJA 2QKKA 2D0BA 3K5MA 3DOLA 3NGZA 1FKPA 1QE1A 4LH5A 1RT5A 2YHAA 4G1QA 3CM6A 5HRPA 3OS0A 1CZBA 4O4GA 3MXJA 1NK9A 3LPUA 1JXEA 4LY7A 4FCYA 2FBVA 2OPSA 3L8BA 3QETA 2YV0X 4IDKA 5KGWA 1D9DA 4J2DA 1HNIA 2WONA 4CJRA 3V9ZA 1A5XA 3CFPA 3ZCMA 4EZ6A 1T03A 1ITGA 1QSSA 1CXUA 1B9FA 5FROA 3KKSA 1C0TA 1BCMA 2I5JA 4FLVA 4Z0UA 4CJEA 3I0SA 4CJVA 3B6OA 3ULDA 3O4QA 4B8CA 4M3WA 3OYAA 1QTMA 1NK4A 3SPYA 4B9VA 4UQGA 4KTWA 2XY5A 2G8VA 4FZXC 1WLJA 3V81A 4OKKA 4Z4EA 4DSEA 4DTNA 4M3ZA 2YNHA 3L3VA 3ZT0A 4I7FA 1LAWA 3PX0A 2B6AA 1XI1A 3C95A 3DRSA 5J2MA 1S9EA 2VG7A 4ZTFA 1J5OA 2KFNA 1JLGA 2X74A 4CGJA 4RG8A 1KTQA 4CGHA 1KVAA 1SL0A 4Z4CA 3RR7A 4QAGA 4DSLA 4FJKA 1LW2A 4E7IA 4AILC 2QK9A 3DRPA 4FM0A 1TK8A 4FJ5A 4CEAA 4CIFA 2WOMA 1Q9XA 3JSMA 4KPYA 4IG0A 3VQ4A 3HT3A 4C8MA 3OYDA 4IBNA 2XO7A 3AVHA 3LPTA 3CG7A 4FJXA 1N6QA 3RMAA 4CEZA 4ELTA 3O4NA 5FRMA 1JLBA 4B9NA 4CJPA 2VWKA 4DU4A 3V6DA 4PWDA 4BE1A 3DLRA 3SI6A 3TAQA 1D9FA 2KTQA 3AVGA 4JRPA 5C42A 3KJVA 4CGGA 3M8PA 4Q0BA 4NYNA 1SL2A 3RRGA 1S9GA 4I9LA 3NHGA 3PO4A 1NJZA 1TK0A 3I0RA 4C8LA 5HRSA 5E41A 3TANA 4DWIA 1S1TA 4KHQA 5J1EA 4AHUA 1J54A 1RTJA 4GVMA 4DSJA 4I9QA 3TR8A 3NGIA 1L3UA 4NCAA 1IG9A 3F9KA 4Z4IA 4FW2A 3RR8A 5CYMA 4CGFA 4FLYA 3KLHA 3S3MA 3L2QA 4KV8A 4KO0A 4E7KA 3AV9A 5HRRA 1VSMA 4CF2A 5JS2A 3K59A 1REVA 3HPHA 1YTUA 1X9SA 1SL1A 2D0AA 3ZT4A 4B3OA 4DU1A 4Z4HA 4IFVA 4DFJA 3C6UA 2P5OA 2BE2A 2YNFA 4EZ9A 3LP1A 2IC3A 4CHYA 5I42A 4O0JA 3U3YA 4AHRA 3IG1A 1JKHA 4DG1A 4I2PA 1T05A 1HQEA 4M3YA 4CHPA 1HYVA 1S6QA 3AO4A 3FFIA 1BI4A 3ZT2A 1TAQA 3VQ8A 4ELVA 4CJQA 3NFAA 4BE0A 3DLHA 1WAJA 1NKCA 1EP4A 3AO5A 1KRPA 3AA5X 1TVRA 4DFKA 1RCHA 4HUGA 2W42A 4C8NA 1UOCA 4FLTA 4FK4A 4KHNA 4LSNA 1NOZA 3AVCA 4B9MA 4FJHA 1KFDA 4N41A 1D8YA 4CK2A 2RN2A 4CJWA 4XIUA 3KK2A 4HTUA 1TKTA 4CFDA 2IDOA 1RDDA 4DQQA 1LV5A 5C24A 3HVRA 2G8IA 2YHBA 3LANA 3KLEA 2HHXA 1C0UA 3JYTA 3MEDA 2GUIA 3QNOA 4FK2A 2HHQA 4CF0A 3AA2A 3D0PA 4FM2A 3NE6A 1Y97A 3HL8A 2XHBA 3TI0A 5FDLA 4B8AB 3T1AA 4FVMA 4RW4A 4GMJB 4B9TA 1RILA 3UIQA 4FLXA 4CGIA 3ZSOA 4PQUA 1VSDA 3V1OA 4J2EA 3IS9A 3DLGA 4KKOA 4FLWA 4CEEA 3SUNA 1U45A 1SKSA 2XY7A 1HYSA 3L2WA 2O4IA 1NKBA 1EX4A 1BQNA 4FZYA 4KHSA 4FXDA 2F8SA 4FYDA 1C1AA 2DFFA 3VA0A 3SUQA 4LSLA 4HHTA 1QSYA 2F8TA 2NUBA 4Y1DA 1KCFA 1SKRA 2YKMA 4KFBA 4E1MA 3KLFA 1KFSA 1YTAA 4BACA 3AVJA 2ZQBA 2X6NA 4YNQA 1RDCA 4DTUA 3TARA 3PY8A 3DM2A 1S6PA 4N56A 1J9AA 2HHTA 4Z4FA 1SUQA 5HROA 3QEVA 1RBVA 4E7HA 1RT4A 4E7LA 4DTRA 4FLUA 4CE9A 4WE1A 3OYLA 1RTHA 4DSFA 3QERA 2OZSA 3L2RA 3VQDA 2B5JA 1S1WA 3RRHA 1G15A 2OZMA 3OYJA 1WAFA 2EX3A 4PUOA 3NH2A 3OYBA 3HPGA 3QO9A 3NGYA 3SQ0A 2HHUA 1GOAA 4DSKA 1KVBA 3HP6A 1VSFA 3RTVA 3SNNA 4DLGA 1BCOA 3LZIA 1NK8A 4CJ3A 4O55A 2YNGA 4Y1CA 3OYGA 3NH0A 4HCBA 4R5PA 1LWCA 4DTPA 4CJKA 4KHYA 3DMJA 3VQCA 2YNIA 4AH9A 5SZTA 4W5TA 3CQ8A 1VRTA 4CEQA 3C6TA 5CY4A 3QEIA 1YT3A 1T8EA 1W9HA 2GV9A 3ZSWA 4DTJA 3VQ6A 3TAPA 4RW6A 2OA8A 2BANA 2G8FA 5HLFA 4W5NA 2XY8A 1RT6A 3AA3A 1K6YA 1Q8IA 1WSJA 3CFOA 1IKWA 3DLEA 1L5UA 4E19A 2HHWA 3RMDA 1BGXT 1FKOA 3AO1A 3OS1A 3CM5A 4OLBA 1BI4B 2YKNA 3M8QA 2Y1JA 4F2SA 3ALYA 4CERA 1L3SA 4HCCA 1JLFA 2LSNA 4OJRA 3P5JA 2VWJA 3M8SA 3B6PA 2OPRA 3G0ZA 4FW1A 4NCBA 1Q9YA 3AVBA 2BGGA 1JL2A 2P1JA 1ZBFA 2D5RA 2E6MA 4FJNA 3TWHA 3NF7A 1EETA 3QINA 1VK0A 3PUFA 1RT7A 2JLEA 2FBTA 4PY5A 4C8KA 3P1GA 5JS1A 1ZYQA 2FBXA 4C8OA 4FJJA 4O44A 4AHVA 3OJUA 3NF6A 3HM9A 3V9UA 1KLMA 3NF9A 4CEDA 3V4IA 3SCXA 5J2QA 1HQUA 3KD5E 1JXBA 2FBYA 3P83D 1RDBA 1VSIA 4OKEA 3OYMA 2G8KA 2PYLA 4CECA 3QEWA 5C25A 4FJLA 4ICLA 4I2QA 2HHSA 4M41A 4AHCA 2IOCA 1EXQA 1Z26A 3V1QA 4JRQA 3QEPA 3AO2A 3SYZA 2E4LA 2XY6A 4OKJA 3TAFA 1DTTA 3KIOA 4DQRA 4DQSA 3HJFA 4K8XA 3D45A 4CK3A 5T7BA 2IS3A 3K2PA 4LH4A 4CFBA 3LWLA 3PX6A 3IAYA 1LWEA 2IGIA 2RKIA 3HPOA 4CJFA 1TL1A 4BWJA 4FZZA 3NBPA 5KGXA 3HSTB 1HJRA 4CEOA 1I39A 1WSFA 3AVMA 3OYHA 4FM1A 4DTSA 5J2PA 2B4JA 5J2NA 4L8RB 2E6LA 1NK7A 4KAZA 3CYMA 2RF2A 4J2AA 5FRNA 3MECA 1WSHA 4M3RA 4KTZA 3KK1A 1S5JA 4RW8A 1NJYA 3MEEA 1X1PA 3NH1A 3VQPA 3SZ2A 4IKFA 2HW3A 4IG3A 4E7JA 3VA3A 2G8HA 1XWLA 2HHVA 1IKXA 4CF8A 3O3HA 2G8WA 1C0MA 2D0CA 4Q5VA 4W5QA 5HRNA 3S3OA 5KRSA 4DQPA 4FJ8A 1JLAA 2ITGA 2VG5A 3SJJA 1L3TA 3QLHA 4NYFA 4FJ7A 4CJTA 4EP4A 1U04A 3OYCA 3G10A 1RT2A 3S9HA 2VG6A 3ZT1A 4M42A 2KZMA 1WSGA 3ZT3A 2X78A 3F73A 3AO3A 5CZ2A 3ISNC 2ZD1A 1X9MA 1RBSA 3MEGA 1LAVA 3LP0A 2X6SA 4BWMA 3NDKA 3SQ4A 4CF9A 4HUEA 3ZSRA 1JLQA 4QOZB 4F3OA 1VRUA 3HO1A 1ZBIA 1BIUA 2Z1HA 3LAMA 4N47A 1VSLA 3K5LA 1XHZA 2PZSA 1D5AA 3VQ5A 4AHTA 4BE2A 4F2RA 4KHWA 4YFUA 3WNHA 3ZSYA 4GW6A 4ELUA 3I8DA 3QIPA 4DFPA 4KREA 3RMBA 1WSIA 4OGEA 5CZ1A 3WNEA 4DTXA 1CXQA 1NJXA 1HMVA 2XRIA 3OJSA 1TAUA 1UWBA 3NCIA 4CK1A 1RNHA 2JGUA 3V9XA 4CCHA 3AVNA 3T19A 4CJ5A 3QIOA 1MU2A 1NJWA 4H8KA 3EZ5A 1NK6A 4QCLA 1ZBUA 2O4GA 4H4MA 1U4BA 4DFMA 1RBRA 2G8UA 1KLNA 4FJGA 4CEFA 1QQCA 2KQ2A 3LP3A 3OYFA 3EYZA 4DLEA 2Y1IA 3M8RA 3KLIA 2OPQA 1T7PA 1RBUA 5EU7A 4CFAA 1LWFA 4ID5A 4M45A 1RTIA 3ZSZA 4M3XA 4CJLA 4W5RA 1U48A 3NF8A 2PYJA 2DFEA 2DY4A 1CZ9A 3DRRA 3HYFA 3DI6A 3L3UA 2R7YA 3OYEA 1C1CA 4KTQA 1JLCA 3SUOA 1IKYA 1B9DA 1NK0A 1SV5A 1S1VA 1NK5A 2QKBA 3AVAA 1BHLA 1C1BA 1BISA 2FC0A 4H4OA 1TKDA 4FK0A 3HK2A 3THVA 2F96A 1VSHA 3TAEA 3U3GA 3VQQA 3AVIA 4OGCA 1IKVA 3ZSQA 1UA0A 4KB1A 2DTUA 3VQ7A 5SWMA 1ASUA 1BL3A 1TKZA 4K8ZA 4OVLA 4DU3A 1VSKA 3T3FA 3CFRA 4IFYA 3U6FA 1TV6A 3SQ1A 3LZJA 4LD0A 3PO5A 4DTMA 1KVCA 4HVJA 3OYKA 2KW4A 2HNYA 3S3NA 1VSEA 1QS4A 3KTQA 3LDSA 1IH7A 2PY5A 3QEXA 3TAGA 1R0AA 2ZE2A 4F8RA 3DLBA 4KI4A 4M3TA 1HNVA 3VN5A 4CIEA 2HMIA 4E0DA 4B9UA 4MFBA 4BDZA 3K5OA 1B92A 1TL3A 4FJMA 4KB0A 3H08A 3AVLA 4PA1A 4CGDA 1LW0A 2A1SA 4ID1A 4NCGA 4ZHRA 3EY1A 1RDAA 4DTOA 1UA1A 1TK5A 2Z1JA 5KRTA 4M3UA 3PX4A 1WN7A 4OPKA 5KTQA 3KD1E 3DOKA 2DFHA 2HNZA 4F3TA 4Z4GA 4AHSA 2OPPA 3PV8A 1VSJA 1SKWA 3KLGA 2Q3SA 4B08A 5DK5A 5K14A 4B9LA 4CHQA 3L2UA 4KHUA 3LWMA 1GOCA 4KI6A 4OLAA 5CYQA 1TGOA 3O3FA 1ASVA 1YVUA 4CF1A 2P51A 3IRXA 2IAJA 3MXIA 3QESA 3AVFA 1U47A 3VQAA 3ITHA 1GOBA 1NOYA 1BQMA 2HNDA 3NAEA 5I3UA 4DSIA 4J2BA 1FXXA 4N76A 3DYAA 2GBZA 3LALA 3SV4A 4FJIA 4FJ9A 1S1UA 3V9SA 1X9WA 3A2FA 2AJQA 3OVNA 4N5SA 1L3VA 3K5NA 4KRFA 4CESA 4DS5A 4DS4A 4O0IA 1W0HA 4CJSA 1RBTA 3OYIA 4JS5A 3KK3A 5HP1A 3SPZA 4ZTJA 2HVIA 3TABA 2ETJA 5KI6A 4B9SA 3MXMA 2P5GA 4CIGA 3O3GA 4MQ3A 5DMRA 4CHNA 3HXMA 1N5YA 1WNSA 4CHZA 4F4KA 3K58A 1WSEA 3BGRA 3K57A 3LP2A 4RW9A 2A1RA 3VQEA 4RW7A 1BIZA 1DLOA 3TAMA 1FK9A 4EP5A 4DQIA 4CHOA 4W5OA 4HUFA 3SV3A 3SUPA 1F21A 1XHXA 1JLEA 3V9WA 3RWUA 1EKEA 4E1NA 3LAKA 1TKXA 3E01A 1RTDA 2Z1GA 3C94A 5D3GA 3DLKA 4CJ4A 2OYQA 4CFCA 1QSLA 3ZSXA 1A5WA 3AA4A 3L2VA 4JS4A 1J53A 1UAXA 2EHGA 1ZBLA 1XC9A 3BDPA 2HB5A 4O5BA 2KFZA 2BDPA 3AVKA 1U49A 4CJUA 3OS2A 2ATQA 3OY9A 1A5VA 1RT1A 1NKEA 3VQBA 1C6VA 4E3SA 4DMNA 3KKRA 4DF4A 1HYZA 1Z25A 2QXFA 3HP9A 5HBMA 3SQ2A 1O1WA 3WNGA 1CLQA 1ASWA 1KSPA 4FLZA 1QHTA 4TSXA 3WNFA 3MAQA 3RMCA 1S1XA 4E89A 3V1RA 4BDPA 3HVTA 4CEBA 4BDYA 2HVHA 3ASMA 4DF8A 1IO2A 4JLHA 1DTQA 1RT3A 1ZBHA
chains in the Genus database with same CATH superfamily
3W0LA 3QNNA 2P9SA 3VQ9A 2RPIA 3TTDA 2O8CB 3VETA 4FPAA 2QKKA 2EWSA 2YHAA 5AQXA 1T3VA 3LPUA 4LY7A 4FCYA 2VGMA 4J2DA 2YV0X 5KGWA 1MA9B 1YVNA 1D9DA 1S3XA 4CBXA 3ZCMA 1T03A 1ITGA 1B9FA 1X3MA 4YDUA 3KKSA 1C0TA 1BCMA 2WC9A 4CJEA 4WQ4C 4B8CA 3ID6A 3HRGA 4J8FA 3TTFA 4K25A 2G8VA 3V81A 3F5TA 3W3DA 2PAVA 2YNHA 3L3VA 3LDPA 4I7FA 4EFHA 2B6AA 5J2MA 1S9EA 2VG7A 5BR8K 4ZTFA 4FWLA 4BRKA 1JLGA 3SK3A 2X74A 1KTQA 4DSLA 3WEEA 4EHUA 4FM0A 1WBDA 1TK8A 4FJ5A 4CEAA 1N8RO 3F9MA 2QM1A 3HT3A 3J7ZO 1T6DA 5AQFA 3VGMA 3CG7A 4FJXA 1VQ6N 3O4NA 5FRMA 4B9NA 1FJGK 4CJ7A 3SI6A 1OH5A 3AVGA 1VQPN 3RSEB 1ATRA 4Q0BA 4I9LA 3PO4A 1NJZA 3I0RA 4FSVA 4C23A 4DWIA 4YOVA 3UB5A 4I9QA 3NGIA 1L3UA 2F9TA 1IG9A 3F9KA 4NCAA 3CJ7A 5CYMA 4FLYA 4JHDA 3KLHA 3S3MA 3MN7A 3PIOL 4KO0A 4E7KA 5HRRA 3EEQA 1W2BM 1Q18A 4PL8A 4CF2A 3HPHA 1YTUA 3IMXA 4B3OA 5AQUA 4Z4HA 3C6UA 2BE2A 2YNFA 3L4IA 2P9SB 4CHYA 5I42A 1NJIO 4O0JA 4LC9B 1HLUA 1I94K 4I2PA 1T05A 1HQEA 4M3YA 1HYVA 1S6QA 3AO4A 4FWQA 1BI4A 2H3GX 4ELVA 4IOXA 2YJEA 4BE0A 1WAJA 1TVRA 4FK4A 4KHNA 4B9MA 4N41A 4C1NI 2RN2A 3QICA 1U6ZA 1RDDA 2D4WA 2E8AA 2F9WA 1C0UA 4LF8K 3NVKA 3AA2A 3MWTA 3TI0A 5FPDA 4AQYK 3T1AA 4FVMA 2P9PA 4GMJB 1RILA 4IDHA 4PQUA 3A5NC 1VSDA 3HI0A 3SUNA 1SKSA 4FZYA 4FXDA 1NGHA 4KHSA 4ILGB 2E1ZA 1C1AA 3WEEB 3SUQA 2O8EA 2NUBA 3G25A 1KCFA 4KFBA 1BDGA 4BACA 3PY8A 3AVJA 4YNQA 3DM2A 1S6PA 3FLCO 1J9AA 2HHTA 3H1VX 4Z4FA 4DTRA 2VWBA 3CCMN 4BVPA 3VQDA 2EX3A 2OTLN 3EE8A 2HBJA 4DSKA 1NK8A 1YJNN 4BRAA 4Y1CA 3NH0A 4XH4A 4CZEA 4R5PA 3UE5A 3DMJA 3CERA 4GVEA 4A5AA 2YNIA 4JHDB 4AH9A 2RHKA 3C6TA 3O9QA 4BRLA 1FW6A 1ZXOA 4DTJA 3TAPA 2QWPA 5C15A 1WSJA 4IEEA 1L5UA 3RMDA 1BGXT 3L0QA 4WFNL 1BI4B 2YKNA 5ELZA 3ALYA 1L3SA 4DR3K 4JV5K 1HPMA 1JLFA 4NB4A 4OJRA 3D2FA 3B6PA 4JYAK 2YCHA 1NGFA 1ZBFA 2D5RA 2E6MA 3TWHA 3QFUA 4K41A 1K8KA 3P1GA 4C8OA 3CCQN 1GLBG 3A0IX 3BY5A 1HKCA 3NF6A 4BVOA 3ATUA 3ENHA 1KLMA 5AFUA 4CEDA 3V4IA 5J2QA 2P9PB 4OKEA 2PYLA 3WXJA 2HHSA 1XMOK 1NGBA 3MWPA 1BO5O 4IO9L 5AQGA 3TAFA 2O8EB 2UUCK 4R79A 3D45A 1C0FA 4CK3A 5T7BA 3NMUA 4CFBA 3IAYA 1LWEA 2IGIA 4OPAA 3HPOA 4GKKK 5KGXA 4FM1A 1HJRA 5J2PA 3AVMA 3KVGA 4BR0A 4DTSA 1V4TA 4JEPA 4CZJA 1E4FT 2RF2A 5ADXA 4M3RA 4GV9A 3KK1A 4RW8A 5C0YA 3MEEA 1X1PA 4BY9C 4IKFA 1H1VA 3PSFA 4YORA 2NRZA 3O3HA 1W97L 2G8WA 3Q7BA 4WQ5A 4Q5VA 4W5QA 1T6CA 4E1JA 1JLAA 2V7ZA 4NYFA 4FJ7A 4CJTA 3G10A 3SAFA 4AM7A 3AO3A 2ASMA 5F1XA 3I55N 3ISNC 4GV6A 5KPRA 1X9MA 1RBSA 1VQMN 4DQ8A 1IBLK 4BWMA 3H1QA 1TUUA 4CF9A 1VQNN 2QWMA 1NMNA 5FPNA 3CJBA 4YOUA 3K5LA 5AQIA 3O9RA 4BE2A 2IVOA 2YX6A 1M1KO 3QIPA 2Q97A 3D2FB 3ZLJA 4OGEA 4DTXA 1HMVA 4BRFA 4IXCA 4OO1J 4KBOA 1NJWA 4CJ5A 3J80O 1MU2A 4FOIA 5AQKA 2O4GA 4JK9A 1K8KB 2PBDA 4CZLA 3D7EO 4CEFA 3LP3A 3KWIA 4DLEA 3EKSA 2OPQA 4M3XA 4W5RA 1U48A 1YITN 1VQLN 3CPWM 4PKHA 1M90O 2DY4A 3DRRA 2UUBK 3OYEA 1C1CA 1JLCA 2F7TA 2KHOA 1NK0A 4B3TK 1C1BA 4H4OA 1BISA 1TKDA 4JKCA 3TAEA 2AA4A 3VQQA 1J6ZA 2UXDK 2FSKA 4BRNA 3P38A 1BA1A 1TV6A 5BPLA 3SQ1A 1XNQK 4DTMA 4HVJA 3P4IA 2KW4A 3LDSA 3TAGA 3D2EA 3DLBA 4M3TA 4BDZA 4QS8A 2FF6A 1TL3A 4FJMA 4KB0A 4DTOA 4ID1A 3L6QA 3KHYA 1TK5A 1VQ9N 5KRTA 4B1YB 1JCFA 4OPKA 5KTQA 3KD1E 2HNZA 1Z6RA 1SKWA 3VEXA 5MLCQ 5DK5A 4MDBA 4CHQA 3L2UA 4KHUA 3LWMA 1GOCA 2P9IA 5CYQA 3TSUA 1YJ9N 1YVUA 2O8DA 4CF1A 2P9LA 3IRXA 2IAJA 3MXIA 3VQAA 3CCJN 4H5NA 1NOYA 1BQMA 5AQSA 5AQOA 4J2BA 1DGKN 2HHHK 1BWFO 3V9SA 3A2FA 4PHTX 4N5SA 1L3VA 3K5NA 4JKDA 4KRFA 3QFPA 4DS5A 5HP1A 1W0HA 3P39A 2YHWA 3TABA 1GLDG 3O3GA 3HXMA 4IJNA 5JLHA 4H0YB 4F4KA 2Q0UA 3ZEUA 1WSEA 4DV3K 3HZ6A 2J4RA 1DLOA 2QTDA 3TAMA 5GAGP 4DV7K 3PLAA 3V9WA 1JLEA 2V51B 4A59A 3R3LA 1KAZA 3C94A 2NRXA 2NNWA 3ZSXA 4BRQA 1J53A 1XC9A 3GL1A 2P9UA 5AFUH 4BG8A 4CJUA 3H3NO 4DR4K 1RT1A 4JKAA 1O1WA 3WNGA 4BC4A 2O8FB 1QHTA 3M5RA 3WNFA 4DV6K 1WB9A 1EWQA 4BDYA 2HVHA 3ASMA 2KZZA 1I3AA 2Z1IA 3DOLA 3D2EB 1QE1A 3OS0A 2FBVA 5ADXH 4IDKA 1HNIA 4CJRA 1A5XA 5GADP 1CXUA 5FROA 4B3MK 2A42A 4FLVA 5BRHA 5GIOA 4BGAA 5M1NA 4CJVA 3ULDA 3SBGA 1QTMA 4B1ZA 3SPYA 2P9IB 2ZJPL 1WLJA 4OKKA 2O8DB 4BRHA 4DSEA 4BGBA 2P9LB 3ZT0A 2VCPA 3C0BA 1XI1A 4LF7K 3C95A 3DRSA 4X65K 3C65A 4A5BA 4G9ZA 4O5FA 1BA0A 1KVAA 3RR7A 4Z4CA 1HNXK 4AILC 4QS7A 5GIPA 3U9DA 3LDNA 3ZX3A 4KPYA 3VEZA 3OBWA 2ZJQL 4C8MA 3LPTA 3RMAA 3ZEUB 3ZETA 2ZGZA 3DLRA 5M1KA 3TAQA 2KTQA 4CGGA 3M8PA 3CC2N 4BR7A 1S9GA 4NXMK 5DM7L 2YJFA 5HRSA 1GLJO 4KHQA 1RTJA 4GVMA 3C6HA 3DXKA 1ATNA 1GLAG 4FW2A 3FZKA 3FE1A 3MX5A 3L2QA 1VQ5N 5CR4A 1X9SA 3T69A 3TSQA 4DFJA 4EZ9A 2ZF5O 3FZFA 2F4VK 4AHRA 2E2OA 4CVNE 3IG1A 3CETA 2OCEA 3ZT2A 1TAQA 3NFAA 3DLHA 4JI5K 1EP4A 2W42A 3AVCA 1EQYA 4GNIA 1HKBA 4KH5A 4BR4A 4CK2A 4CJWA 4RCHA 1LV5A 3HVRA 3LANA 3MEDA 4FK2A 4FWOA 1XUPO 3TTCA 3D0PA 1HUXA 3NE6A 4XH1A 2XHBA 4B8AB 3BZKA 2E2NA 3LM9A 3O1WA 1NGJA 2Q2RA 3UIQA 4C1NK 4CGIA 2UXCK 5FRNA 4KKOA 3DLGA 4FLWA 1U45A 4CEEA 3VF4A 1NKBA 2CGJA 3ULEA 1YJWN 2DFFA 1QSYA 1SKRA 1NGIA 2E2QA 2YKMA 4MLEA 4E1MA 3KLFA 1OH6A 5M1OA 1KFSA 1YTAA 1NGAA 2ZQBA 1RDCA 4FL9A 4NXNK 2KKZA 3OTOK 1SUQA 3ZETB 3QEVA 4IEIA 4JKEA 4FLUA 1YAGA 4WE1A 3OYLA 1RTHA 2OZSA 2OZMA 1EO1A 3RRHA 1WAFA 4JI3K 2RE2A 5LJWA 3O9SA 5I9EB 3NGYA 4O8KA 1GOAA 1KVBA 3M3ZA 3HP6A 4JKHA 3VGKA 4DLGA 4FPBA 3ZX2A 4JAXA 4JK8A 3OYGA 3DXKB 4HCBA 5BN8A 2FSJA 3O9UA 4JKGA 1P90A 5SZTA 2Q36A 3LM2A 1VRTA 4CEQA 2E88A 3R1XA 1T8EA 1W9HA 3M6GA 2GV9A 1Q82O 3ZSWA 2OA8A 4WQ4A 2BANA 3AAPA 4IWVA 2G8FA 1KXPA 2XY8A 3CQYA 3AA3A 1K6YA 1Q8IA 3CFOA 1IKWA 1T44A 4E19A 3AO1A 1G99A 3VOVA 2HF4A 4F2SA 2Q31A 4CERA 4HCCA 3G71N 3I56N 3M8SA 4FW1A 3AVBA 2BGGA 1JL2A 3RVCA 2HBMA 4IFEA 4U7BA 4FJNA 1EETA 3QINA 1VK0A 1RT7A 4F9OA 5JS1A 2FBXA 5M1QA 1GLFO 2FF3B 4I6MA 4PKIA 2A6AA 1HQUA 3CCUN 1RDBA 3QEWA 3LDOA 4ICLA 4I2QA 1NG9A 3WQUA 5AQPA 3QEPA 4M63C 3SYZA 4JK7A 3ULEB 4YY3K 3QBWA 4JN4A 1N36K 4DR1K 1DTTA 3L4QA 4DQRA 4DQSA 4K8XA 2IS3A 3K2PA 3PX6A 1VQ4N 3SMPA 2RKIA 3KWGA 4CJFA 1RGIA 1TL1A 4BWJA 3NBPA 4LFBK 4DHYA 1WSFA 4L8RB 2WTUA 1NK7A 4KAZA 4J2AA 4KTZA 1NJYA 1NMDA 3NH1A 2V7YA 3SZ2A 4BROA 2HHVA 3WT0A 3CC4N 2ASPA 1WBBA 5JVGL 1C0MA 5HRNA 3S3OA 5KRSA 4DQPA 4JKGB 4A57A 4WFAL 3SJJA 1L3TA 3OYCA 1RT2A 2X78A 3WXMB 2GTDA 1BU6O 1OH8A 3LP0A 2X6SA 2A3ZA 3H3OB 4HUEA 3O9TA 5BN9A 4QOZB 4BRGA 4F3OA 1VRUA 1BG3A 1ILYA 3HO1A 2QWQA 1ZBIA 2D0OA 2W6LA 1XHZA 3FZHA 4AHTA 4KHWA 4YFUA 3ZSYA 4DFPA 3WUHA 3VEWA 1TAUA 1UWBA 3NCIA 1RNHA 2JGUA 2QW9A 4CCHA 3T19A 2YI1A 4H8KA 4LF4K 1ZBUA 4H4MA 3A5MC 4FJGA 2KQ2A 2Y1IA 4CFAA 4ID5A 4I6MB 4CJLA 1J5EK 4X62K 4YOXA 3DI6A 1IKYA 1B9DA 1SV5A 3S41A 1S1VA 4HWIA 2WFBA 5AQNA 1IG8A 3HK2A 2E1YA 3E66A 2ITMA 3AVIA 2E5LK 4CZGA 2DTUA 2UUAK 5C2DA 4K8ZA 3SBTA 4DU3A 1VSKA 3T3FA 3J7YP 5AJ3K 3G4SN 2HNYA 3S3NA 3QMLA 3EKUA 4M7XA 3QEXA 5EY4A 1R0AA 4KI4A 1YF5L 4B3SK 1HNVA 4CIEA 4WF9L 2HMIA 2GELA 5BRFA 4MFBA 3K5OA 4FWMA 5IT9O 1NGEA 1OKJA 1UA1A 1LW0A 2A1SA 3A5OC 1RDAA 4M3UA 2QWOA 1WN7A 5C2FA 3DOKA 4Z4GA 3K0SA 5K14A 4B9LA 2P9NA 3CCSN 3CCVN 2HF3A 2I7PA 3IFRA 1U47A 5E26A 2HNDA 1SQKA 4FJ9A 2AJQA 3U9ZA 3E9LA 3BF1A 5HL7L 4O0IA 1RBTA 3BF3A 5LMUK 4ZTJA 4JI8K 2HVIA 1N5YA 5DMRA 3HOSA 4L3QA 1YI2N 3K58A 3K57A 4YOWA 4RW7A 1BIZA 3N4PA 2IVPA 5JVHL 4CHOA 4W5OA 4HUFA 3SV3A 3SUPA 1XHXA 3U8XA 4GKJK 1EKEA 3LAKA 1TKXA 5D3GA 3BUZB 3DLKA 4DUYK 2OYQA 4U67L 1ZBLA 5BREA 3E9PA 3OS2A 4AF1A 1NGGA 4BR5A 3OY9A 4E3SA 3CI5A 3AGKA 4DF4A 1Z25A 1XQSC 3HP9A 3VTHA 4FO0A 3SQ2A 4B3RK 1KSPA 3RMCA 3PSIA 1S1XA 4BDPA 2HBLA 3CJCA 3ID8A 1IO2A 1DTQA 4WCEL 1RT3A 4KH4A 1JL1A 3ZSVA 4A2BA 2WBNA 3OYNA 4UY8O 1HRHA 1WUAA 3A5LC 4ISFA 5LL6Z 4OPJA 2O8BA 1QZ6A 3Q7CA 5A2QO 3NGZA 1RT5A 1NLVA 3CM6A 2NLXA 5HRPA 3T1HK 3MXJA 1JXEA 1JCEA 3QETA 2OPSA 4A61A 3V9ZA 4CD1A 4JI1K 3VGLA 2I5JA 5AQMA 3AY9A 4Z0UA 3NVMA 3GE1A 3GOIA 3I0SA 4M3WA 3B6OA 3O4QA 3OYAA 1NK4A 4B9VA 2P9NB 4YOYA 4KTWA 2XY5A 4DR7K 4Z4EA 4M3ZA 1KAYA 1MWKA 1LAWA 2KFNA 4CGJA 3CQXA 4RG8A 1SL0A 4QAGA 1LW2A 2GX9A 2QK9A 4NLCA 5AQYA 5BR9A 1Q9XA 2WOMA 5EXWA 3JSMA 5AQLA 4IG0A 4PKGA 1QQMA 4DKWA 2I7NA 3CXCM 1V4SA 1N6QA 2WUSA 4CEZA 4ELTA 2VWKA 4DU4A 3V6DA 4PWDA 1NGDA 1D9FA 5AZIA 4JRPA 3KJVA 4EAHD 4NYNA 1SAZA 1TK0A 3EN9A 5E41A 3TANA 1SS6A 5J1EA 4AHUA 1J54A 3TR8A 2QWRA 2HBKA 4Z4IA 1YXQA 4CGFA 3CCRN 3AV9A 3AGRA 1VSMA 3CHWA 1GLCG 5M1PA 2OANA 3K59A 3MCPA 4DU1A 3BEXA 5GAHP 2Q0RA 2IC3A 4BREA 3U3YA 1X9JA 3P31A 3FFIA 3VQ8A 5KQDA 1KRPA 3AA5X 4DFKA 4HUGA 2FLOA 4NLBA 4C8NA 4IOAL 1NOZA 2VGNA 4FJHA 1KFDA 4XIUA 3KK2A 4HTUA 4M7YA 2UU9K 4CFDA 4DQQA 5C24A 5TKYA 4LFCK 1QVFM 3KLEA 2GEMA 4BRDA 2GUIA 3QNOA 4DV0K 1QZ5A 1Y97A 2YHYA 3HL8A 2V52B 5FDLA 4JI7K 4LF9K 1E3MA 2VQEK 4A62A 3JAMO 3ZSOA 3V1OA 4KI6A 2NRHA 4ISGA 2XY7A 3I33A 1HYSA 4DUZK 3PIPL 1EX4A 4A2AA 1VQ8N 4LSLA 4HHTA 2F8TA 1HNWK 4Y1DA 1KC8O 2GUPA 4DTUA 1Y64A 2DPNA 3TARA 4H0OA 4RWTA 3LL3A 4E7HA 4CE9A 5AZIB 1O13A 4DSFA 3L2RA 2B5JA 3EO3A 3C7NA 1G15A 3SAHA 3OYBA 1OH7A 3HPGA 3HTVA 2HSTA 3UKUA 3VPZA 3SQ0A 1HX1A 3O4WA 1VSFA 4GV3A 3O6WA 3LZIA 1K73O 4BRCA 1LWCA 3R9PA 4CJKA 4DTPA 4KHYA 3HOTA 3VQCA 4W5TA 3CQ8A 5AQQA 3U4LA 1YT3A 3IDHA 1K9MO 4RW6A 3E9OA 4W5NA 2ZGYA 1RT6A 3HM8A 3DLEA 4KHPK 3DXMA 4B1WB 1Q86O 1WOQA 4BG9A 2LSNA 3P5JA 4DR5K 2OPRA 3G0ZA 2O8CA 3HBTA 4JNEA 4FWPA 3NF7A 3PUFA 3CF5L 2P9UB 3DLLL 1ZYQA 3TU5A 4FJJA 4O44A 1IJJA 2E20A 4AHVA 3OJUA 1K8AO 5BPMA 4LF5K 5KQ8A 4CZIA 1YIJN 1JXBA 3MX2A 1NU0A 2G8KA 3J7AP 3OYMA 4CECA 3MDQA 4FJLA 5FLXO 3C6AA 4AHCA 1YHQN 1EXQA 1Z26A 1NBWA 3AO2A 3J8AA 2XY6A 4OKJA 3KIOA 5JLFA 3HJFA 3LWLA 3MN9A 4LH4A 4RTFD 2NRWA 3HSTB 1I39A 4JKFA 3VESA 1R59O 2B4JA 5J2NA 3KK7A 2E2PA 2YHXA 3CYMA 3C7NB 1WSHA 3EE9A 3K9JA 1S5JA 2W41A 3EL2A 4QS9A 3VQPA 3UKUB 4IG3A 4DCHA 4E7JA 3VA3A 5BRDA 2ITGA 2VG5A 5AQWA 4EP4A 4M42A 3ZX0A 2VG6A 3CD6N 3F73A 2UYTA 4AM6A 5CZ2A 1VHXA 3MEGA 3GG4A 1LAVA 3NDKA 3SQ4A 4LFAK 3ZSRA 1JLQA 3VF6A 3UKRA 4DV4K 1OVYA 4X64K 1BIUA 2Z1HA 3LAMA 1VSLA 2PZSA 4DR2K 1D5AA 3VQ5A 4F2RA 3DXMB 5IWAK 3O8MA 3I8DA 2JWLA 4KREA 4WFBL 4YDUC 5CZ1A 1NJXA 2FXUA 3OJSA 4JI6K 3SLCA 5KPZA 2QA4N 5AR0A 3V9XA 3AVNA 4DFMA 5B8HA 1RBRA 4EIAA 3FFKB 3IUCA 4CZFA 5BPNA 1QQCA 3OYFA 3M8RA 1T7PA 1RTIA 3OW2M 3NF8A 4MO5A 2PYJA 2DFEA 3JXUA 3HYFA 5LMNK 1KQSM 3SUOA 4H0TB 1NK5A 2QKBA 3AVAA 2FC0A 3H45C 5AQZA 1VSHA 4CD3A 2CH5A 1UA0A 1IKVA 4KB1A 4HTLA 1ASUA 1BL3A 1TKZA 4OVLA 4ISEA 5FPEA 3CFRA 2A41A 4IFYA 3U6FA 4CZMA 3EZWA 1VSEA 1IH7A 2PY5A 2ZE2A 3DJCA 4E0DA 2JWKA 4B9UA 1B92A 3ZYYX 3H08A 4CGDA 3EY1A 4NCGA 1Z05A 4ZHRA 3PX4A 2GWJA 4FWSA 4B9QA 4F3TA 4H5VA 4AHSA 3T7ZA 3VENA 4CI6A 4OLAA 3O3FA 1C0GA 5AQRA 3AVFA 1HNZK 3UKRB 4CBWA 3ITHA 1GOBA 4DSIA 4BRMA 1FXXA 4NCBA 3DYAA 3SV4A 4OPHA 1X9WA 3OVNA 4CESA 1N32K 4K0KK 4DS4A 4CJSA 3OYIA 3KK3A 5KI6A 4B9SA 3HSCA 2P5GA 4MQ3A 3H46O 5AZJA 4B1XB 4GY2B 2P9KA 1F21A 3RWUA 4E1NA 2CH6A 2Z1GA 4CJ4A 5GAEP 4MLHA 1QSLA 3L2VA 3B8AX 2BH1A 2KFZA 3BZCA 3AVKA 1U49A 3CC7N 1A5VA 4K43A 3VQBA 5CE3A 1IBMK 4FWRA 2QXFA 5HBMA 3WQTA 4X66K 1ASWA 4LF6K 4TSXA 4Y0WA 3MAQA 4E89A 5EX5A 3HVTA 4CZKA 3MMVA 4DF8A 4OLBA 1ZBHA 4DV1K 1HPZA 4WYBA 5EVZA 2D0BA 3K5MA 2FSNA 1FKPA 4LH5A 3MN6A 4MDAA 4G1QA 1CZBA 4O4GA 1NK9A 3L8BA 2NZTA 3T1YK 1ZC6A 2D1KA 2WONA 4EZ6A 3CFPA 1QSSA 4H03B 4MO4A 3CJ1A 3OBYA 3SJHA 4CZHA 1TYQA 4O8UA 3QBXA 1ESVA 1XMQK 2QWLA 4UQGA 4FZXC 1VQ7N 1QQOA 1DEJA 1ZBSA 4DTNA 1D4XA 3PX0A 1J5OA 3K9KA 4DV2K 4FVUA 3ENBA 4CGHA 4B1VA 3VF2A 4FJKA 1CZAN 5LJVA 4E7IA 1KAXA 3DRPA 3CCLN 1S72N 4CIFA 4OX9K 3VQ4A 3OYDA 4IBNA 2XO7A 3AVHA 3CMAN 3FZLA 5KPTA 1U2VA 5DM6L 1JLBA 5AZJB 4CJPA 5F0XA 4BE1A 4BC3A 5HOOA 5C42A 2P9KB 1MDUB 1SL2A 3RRGA 2NRRA 2ASOA 3NHGA 4C8LA 3ATVA 2BUPA 1S1TA 2A40A 1BOTO 3VEVA 4DSJA 3AAQA 3THWA 2Q1NA 3RR8A 4Z94A 3DAWA 4KV8A 5JS2A 1REVA 1SL1A 2D0AA 3ZT4A 3F2KA 3KZBA 4IFVA 1JCGA 3TPQA 2P5OA 4H0PA 3LP1A 4V19S 3A8YA 4CBUA 1JKHA 4DG1A 2OTJN 4CHPA 4BQZA 2ZJRL 4CJQA 4ILJA 1NKCA 3AO5A 4WQ5C 3R8EA 1RCHA 1UOCA 4FLTA 4LSNA 1D8YA 4BRIA 5AQHA 1TKTA 5AQTA 5TKWA 1TYQB 1N34K 4XEIA 2IDOA 3D6RA 5JICA 2YHBA 2G8IA 2HHXA 1S22A 3JYTA 4DV5K 2PFUA 2HHQA 4CF0A 2ZM6K 4FM2A 4RW4A 3TSPA 4B9TA 3CMEN 4FLXA 4J2EA 3IS9A 1VQON 1RDWX 3L2WA 2O4IA 1RFQA 1BQNA 2F8SA 2KLAA 4FYDA 5CHIA 4FWNA 4H0XB 3VA0A 2HMPA 2X6NA 4N56A 1NNEA 2QEXN 1U2VB 3MN5A 5HROA 1RBVA 4E7LA 1RT4A 3QERA 3FGUA 1LCUA 1S1WA 3OYJA 4PUOA 3NH2A 2QWNA 3QO9A 4BRPA 1IBKK 2HHUA 3RTVA 3SNNA 1BCOA 4CJ3A 4O55A 2YNGA 2BTFA 3H6EA 3VEOA 3THWB 5FPMA 5CY4A 3QEIA 3SAGA 3ENOA 1BUPA 3OHRA 1VQKN 3VQ6A 3SMSA 5HLFA 5EOYA 4JKBA 3CJ9A 1MWMA 1E4GT 4BC5A 2HHWA 3OS1A 1FKOA 3CM5A 2O8FA 1RDUA 3CCEN 3M8QA 2Y1JA 3I8BA 2VWJA 4IJAA 3VEYA 3O5BA 3FR0A 3O80A 3WXIA 1Q9YA 2P1JA 4IOCL 1QHAA 4FOEA 3J81O 2JLEA 4YHHK 2FBTA 4PY5A 4C8KA 2NRTA 1QQNA 1KD1O 3HM9A 1Q7YO 3V9UA 1SZ2A 3NF9A 3SCXA 2IVNA 3KD5E 1JJ2M 3BP8A 4K42A 3WXKA 2FBYA 3P83D 1VSIA 3VTIA 5C25A 4M41A 2IOCA 1NGCA 3R6MA 3V1QA 4JRQA 5JMVA 3JS6A 4XH5A 2E4LA 4JI4K 2HOEA 2O8BB 3CJAA 1ATSA 1X3NA 4BC2A 4BR9A 3GDQA 1HKGA 2QI2A 2A5XA 4FZZA 3E1YA 1DT9A 4CEOA 3OYHA 2E6LA 3CPEA 3MECA 3GBTA 1QVGM 4IZ9A 1XNRK 2HW3A 2G8HA 4JI2K 1XWLA 1IKXA 1XC3A 4CF8A 3THYA 5H1SQ 2D0CA 2W6KA 3QB0A 4FJ8A 3QLHA 1LOTB 1U04A 3S9HA 1EWRA 2KZMA 3O1BA 3ZT1A 1WSGA 3ZT3A 2ZD1A 3AARA 1NWKA 3VERA 3OA9A 4N47A 5LY3A 4KH6A 3WNHA 4ELUA 4GW6A 3N4QA 3RMBA 1WSIA 4ILHA 3WNEA 1CXQA 2XRIA 3QDKA 1TUYA 4CK1A 1W7AA 1IV0A 3QIOA 4QCLA 3EZ5A 1NK6A 1N33K 1U4BA 2G8UA 1KLNA 3EYZA 3KLIA 1NM1A 4H5RA 1RBUA 5EU7A 4CW7B 1LWFA 4M45A 3ZSZA 5E84A 1OVQA 3LDQA 1CZ9A 3L3UA 2R7YA 3FZMA 4KTQA 1BHLA 4FK0A 3MCAB 3THVA 2F96A 3U3GA 5AQVA 4OGCA 3ZSQA 3THXA 2D0PA 4JD2A 3VQ7A 5SWMA 3DWLA 3M1FA 3LZJA 4LD0A 3PO5A 1KVCA 3OYKA 3LDLA 1QS4A 3KTQA 4FWKA 4F8RA 2ZWHA 2UXBK 3VN5A 4NO7A 3VMFB 5C12A 2VYPA 4H5TA 3AVLA 4PA1A 3THYB 2CGLA 2Z1JA 4H0VB 3CIPA 1DKGD 4B1UB 2DFHA 2OPPA 3PV8A 1VSJA 3KLGA 5AQJA 2Q3SA 4B08A 3G6EN 1TGOA 4BR2A 1ASVA 5F2RA 2P51A 5GINA 3QESA 3NAEA 4N76A 5I3UA 4H5WA 1GLEG 3LALA 2GBZA 4FJIA 2AP1A 4DB3A 4JI0K 1S1UA 2CGKA 3SPZA 4JS5A 2ETJA 4DR6K 3MXMA 2IIRA 4CIGA 4CHNA 1WNSA 3O08A 1Q81O 4YOTA 4CHZA 1VAZA 2A1RA 3MK6A 3BGRA 2GWKA 3LP2A 4RW9A 3VQEA 4EHTA 4EP5A 4DQIA 1FK9A 3RSEA 1RTDA 3E01A 4CFCA 1HJOA 1A5WA 3AA4A 4JS4A 1UAXA 2EHGA 3BDPA 2HB5A 4O5BA 2BDPA 2W40A 2ATQA 2VQFK 1NKEA 2NRVA 4BQLA 1C6VA 4DMNA 3KKRA 4IO8A 1HYZA 2QXLA 5M1FA 1CLQA 1YUWA 1P8ZA 3WXLA 4PL7A 4FLZA 3THXB 4JD2B 3V1RA 5C10A 3IKMA 4CEBA 1GLLO 4JLHA 1HR0K
chains in the Genus database with same CATH topology
1JL1A 3ZSVA 3QNNA 3VQ9A 2RPIA 3OYNA 1HRHA 1HPZA 1I3AA 2KZZA 2Z1IA 4OPJA 2QKKA 2D0BA 3K5MA 3DOLA 3NGZA 1FKPA 1QE1A 4LH5A 1RT5A 2YHAA 4G1QA 3CM6A 5HRPA 3OS0A 1CZBA 4O4GA 3MXJA 1NK9A 3LPUA 1JXEA 4LY7A 4FCYA 2FBVA 2OPSA 3L8BA 3QETA 2YV0X 4IDKA 5KGWA 1D9DA 4J2DA 1HNIA 2WONA 4CJRA 3V9ZA 1A5XA 3CFPA 3ZCMA 4EZ6A 1T03A 1ITGA 1QSSA 1CXUA 1B9FA 5FROA 3KKSA 1C0TA 1BCMA 2I5JA 4FLVA 4Z0UA 4CJEA 3I0SA 4CJVA 3B6OA 3ULDA 3O4QA 4B8CA 4M3WA 3OYAA 1QTMA 1NK4A 3SPYA 4B9VA 4UQGA 4KTWA 2XY5A 2G8VA 4FZXC 1WLJA 3V81A 4OKKA 4Z4EA 4DSEA 4DTNA 4M3ZA 2YNHA 3L3VA 3ZT0A 4I7FA 1LAWA 3PX0A 2B6AA 1XI1A 3C95A 3DRSA 5J2MA 1S9EA 2VG7A 4ZTFA 1J5OA 2KFNA 1JLGA 2X74A 4CGJA 4RG8A 1KTQA 4CGHA 1KVAA 1SL0A 4Z4CA 3RR7A 4QAGA 4DSLA 4FJKA 1LW2A 4E7IA 4AILC 2QK9A 3DRPA 4FM0A 1TK8A 4FJ5A 4CEAA 4CIFA 2WOMA 1Q9XA 3JSMA 4KPYA 4IG0A 3VQ4A 3HT3A 4C8MA 3OYDA 4IBNA 2XO7A 3AVHA 3LPTA 3CG7A 4FJXA 1N6QA 3RMAA 4CEZA 4ELTA 3O4NA 5FRMA 1JLBA 4B9NA 4CJPA 2VWKA 4DU4A 3V6DA 4PWDA 4BE1A 3DLRA 3SI6A 3TAQA 1D9FA 2KTQA 3AVGA 4JRPA 5C42A 3KJVA 4CGGA 3M8PA 4Q0BA 4NYNA 1SL2A 3RRGA 1S9GA 4I9LA 3NHGA 3PO4A 1NJZA 1TK0A 3I0RA 4C8LA 5HRSA 5E41A 3TANA 4DWIA 1S1TA 4KHQA 5J1EA 4AHUA 1J54A 1RTJA 4GVMA 4DSJA 4I9QA 3TR8A 3NGIA 1L3UA 4NCAA 1IG9A 3F9KA 4Z4IA 4FW2A 3RR8A 5CYMA 4CGFA 4FLYA 3KLHA 3S3MA 3L2QA 4KV8A 4KO0A 4E7KA 3AV9A 5HRRA 1VSMA 4CF2A 5JS2A 3K59A 1REVA 3HPHA 1YTUA 1X9SA 1SL1A 2D0AA 3ZT4A 4B3OA 4DU1A 4Z4HA 4IFVA 4DFJA 3C6UA 2P5OA 2BE2A 2YNFA 4EZ9A 3LP1A 2IC3A 4CHYA 5I42A 4O0JA 3U3YA 4AHRA 3IG1A 1JKHA 4DG1A 4I2PA 1T05A 1HQEA 4M3YA 4CHPA 1HYVA 1S6QA 3AO4A 3FFIA 1BI4A 3ZT2A 1TAQA 3VQ8A 4ELVA 4CJQA 3NFAA 4BE0A 3DLHA 1WAJA 1NKCA 1EP4A 3AO5A 1KRPA 3AA5X 1TVRA 4DFKA 1RCHA 4HUGA 2W42A 4C8NA 1UOCA 4FLTA 4FK4A 4KHNA 4LSNA 1NOZA 3AVCA 4B9MA 4FJHA 1KFDA 4N41A 1D8YA 4CK2A 2RN2A 4CJWA 4XIUA 3KK2A 4HTUA 1TKTA 4CFDA 2IDOA 1RDDA 4DQQA 1LV5A 5C24A 3HVRA 2G8IA 2YHBA 3LANA 3KLEA 2HHXA 1C0UA 3JYTA 3MEDA 2GUIA 3QNOA 4FK2A 2HHQA 4CF0A 3AA2A 3D0PA 4FM2A 3NE6A 1Y97A 3HL8A 2XHBA 3TI0A 5FDLA 4B8AB 3T1AA 4FVMA 4RW4A 4GMJB 4B9TA 1RILA 3UIQA 4FLXA 4CGIA 3ZSOA 4PQUA 1VSDA 3V1OA 4J2EA 3IS9A 3DLGA 4KKOA 4FLWA 4CEEA 3SUNA 1U45A 1SKSA 2XY7A 1HYSA 3L2WA 2O4IA 1NKBA 1EX4A 1BQNA 4FZYA 4KHSA 4FXDA 2F8SA 4FYDA 1C1AA 2DFFA 3VA0A 3SUQA 4LSLA 4HHTA 1QSYA 2F8TA 2NUBA 4Y1DA 1KCFA 1SKRA 2YKMA 4KFBA 4E1MA 3KLFA 1KFSA 1YTAA 4BACA 3AVJA 2ZQBA 2X6NA 4YNQA 1RDCA 4DTUA 3TARA 3PY8A 3DM2A 1S6PA 4N56A 1J9AA 2HHTA 4Z4FA 1SUQA 5HROA 3QEVA 1RBVA 4E7HA 1RT4A 4E7LA 4DTRA 4FLUA 4CE9A 4WE1A 3OYLA 1RTHA 4DSFA 3QERA 2OZSA 3L2RA 3VQDA 2B5JA 1S1WA 3RRHA 1G15A 2OZMA 3OYJA 1WAFA 2EX3A 4PUOA 3NH2A 3OYBA 3HPGA 3QO9A 3NGYA 3SQ0A 2HHUA 1GOAA 4DSKA 1KVBA 3HP6A 1VSFA 3RTVA 3SNNA 4DLGA 1BCOA 3LZIA 1NK8A 4CJ3A 4O55A 2YNGA 4Y1CA 3OYGA 3NH0A 4HCBA 4R5PA 1LWCA 4DTPA 4CJKA 4KHYA 3DMJA 3VQCA 2YNIA 4AH9A 5SZTA 4W5TA 3CQ8A 1VRTA 4CEQA 3C6TA 5CY4A 3QEIA 1YT3A 1T8EA 1W9HA 2GV9A 3ZSWA 4DTJA 3VQ6A 3TAPA 4RW6A 2OA8A 2BANA 2G8FA 5HLFA 4W5NA 2XY8A 1RT6A 3AA3A 1K6YA 1Q8IA 1WSJA 3CFOA 1IKWA 3DLEA 1L5UA 4E19A 2HHWA 3RMDA 1BGXT 1FKOA 3AO1A 3OS1A 3CM5A 4OLBA 1BI4B 2YKNA 3M8QA 2Y1JA 4F2SA 3ALYA 4CERA 1L3SA 4HCCA 1JLFA 2LSNA 4OJRA 3P5JA 2VWJA 3M8SA 3B6PA 2OPRA 3G0ZA 4FW1A 4NCBA 1Q9YA 3AVBA 2BGGA 1JL2A 2P1JA 1ZBFA 2D5RA 2E6MA 4FJNA 3TWHA 3NF7A 1EETA 3QINA 1VK0A 3PUFA 1RT7A 2JLEA 2FBTA 4PY5A 4C8KA 3P1GA 5JS1A 1ZYQA 2FBXA 4C8OA 4FJJA 4O44A 4AHVA 3OJUA 3NF6A 3HM9A 3V9UA 1KLMA 3NF9A 4CEDA 3V4IA 3SCXA 5J2QA 1HQUA 3KD5E 1JXBA 2FBYA 3P83D 1RDBA 1VSIA 4OKEA 3OYMA 2G8KA 2PYLA 4CECA 3QEWA 5C25A 4FJLA 4ICLA 4I2QA 2HHSA 4M41A 4AHCA 2IOCA 1EXQA 1Z26A 3V1QA 4JRQA 3QEPA 3AO2A 3SYZA 2E4LA 2XY6A 4OKJA 3TAFA 1DTTA 3KIOA 4DQRA 4DQSA 3HJFA 4K8XA 3D45A 4CK3A 5T7BA 2IS3A 3K2PA 4LH4A 4CFBA 3LWLA 3PX6A 3IAYA 1LWEA 2IGIA 2RKIA 3HPOA 4CJFA 1TL1A 4BWJA 4FZZA 3NBPA 5KGXA 3HSTB 1HJRA 4CEOA 1I39A 1WSFA 3AVMA 3OYHA 4FM1A 4DTSA 5J2PA 2B4JA 5J2NA 4L8RB 2E6LA 1NK7A 4KAZA 3CYMA 2RF2A 4J2AA 5FRNA 3MECA 1WSHA 4M3RA 4KTZA 3KK1A 1S5JA 4RW8A 1NJYA 3MEEA 1X1PA 3NH1A 3VQPA 3SZ2A 4IKFA 2HW3A 4IG3A 4E7JA 3VA3A 2G8HA 1XWLA 2HHVA 1IKXA 4CF8A 3O3HA 2G8WA 1C0MA 2D0CA 4Q5VA 4W5QA 5HRNA 3S3OA 5KRSA 4DQPA 4FJ8A 1JLAA 2ITGA 2VG5A 3SJJA 1L3TA 3QLHA 4NYFA 4FJ7A 4CJTA 4EP4A 1U04A 3OYCA 3G10A 1RT2A 3S9HA 2VG6A 3ZT1A 4M42A 2KZMA 1WSGA 3ZT3A 2X78A 3F73A 3AO3A 5CZ2A 3ISNC 2ZD1A 1X9MA 1RBSA 3MEGA 1LAVA 3LP0A 2X6SA 4BWMA 3NDKA 3SQ4A 4CF9A 4HUEA 3ZSRA 1JLQA 4QOZB 4F3OA 1VRUA 3HO1A 1ZBIA 1BIUA 2Z1HA 3LAMA 4N47A 1VSLA 3K5LA 1XHZA 2PZSA 1D5AA 3VQ5A 4AHTA 4BE2A 4F2RA 4KHWA 4YFUA 3WNHA 3ZSYA 4GW6A 4ELUA 3I8DA 3QIPA 4DFPA 4KREA 3RMBA 1WSIA 4OGEA 5CZ1A 3WNEA 4DTXA 1CXQA 1NJXA 1HMVA 2XRIA 3OJSA 1TAUA 1UWBA 3NCIA 4CK1A 1RNHA 2JGUA 3V9XA 4CCHA 3AVNA 3T19A 4CJ5A 3QIOA 1MU2A 1NJWA 4H8KA 3EZ5A 1NK6A 4QCLA 1ZBUA 2O4GA 4H4MA 1U4BA 4DFMA 1RBRA 2G8UA 1KLNA 4FJGA 4CEFA 1QQCA 2KQ2A 3LP3A 3OYFA 3EYZA 4DLEA 2Y1IA 3M8RA 3KLIA 2OPQA 1T7PA 1RBUA 5EU7A 4CFAA 1LWFA 4ID5A 4M45A 1RTIA 3ZSZA 4M3XA 4CJLA 4W5RA 1U48A 3NF8A 2PYJA 2DFEA 2DY4A 1CZ9A 3DRRA 3HYFA 3DI6A 3L3UA 2R7YA 3OYEA 1C1CA 4KTQA 1JLCA 3SUOA 1IKYA 1B9DA 1NK0A 1SV5A 1S1VA 1NK5A 2QKBA 3AVAA 1BHLA 1C1BA 1BISA 2FC0A 4H4OA 1TKDA 4FK0A 3HK2A 3THVA 2F96A 1VSHA 3TAEA 3U3GA 3VQQA 3AVIA 4OGCA 1IKVA 3ZSQA 1UA0A 4KB1A 2DTUA 3VQ7A 5SWMA 1ASUA 1BL3A 1TKZA 4K8ZA 4OVLA 4DU3A 1VSKA 3T3FA 3CFRA 4IFYA 3U6FA 1TV6A 3SQ1A 3LZJA 4LD0A 3PO5A 4DTMA 1KVCA 4HVJA 3OYKA 2KW4A 2HNYA 3S3NA 1VSEA 1QS4A 3KTQA 3LDSA 1IH7A 2PY5A 3QEXA 3TAGA 1R0AA 2ZE2A 4F8RA 3DLBA 4KI4A 4M3TA 1HNVA 3VN5A 4CIEA 2HMIA 4E0DA 4B9UA 4MFBA 4BDZA 3K5OA 1B92A 1TL3A 4FJMA 4KB0A 3H08A 3AVLA 4PA1A 4CGDA 1LW0A 2A1SA 4ID1A 4NCGA 4ZHRA 3EY1A 1RDAA 4DTOA 1UA1A 1TK5A 2Z1JA 5KRTA 4M3UA 3PX4A 1WN7A 4OPKA 5KTQA 3KD1E 3DOKA 2DFHA 2HNZA 4F3TA 4Z4GA 4AHSA 2OPPA 3PV8A 1VSJA 1SKWA 3KLGA 2Q3SA 4B08A 5DK5A 5K14A 4B9LA 4CHQA 3L2UA 4KHUA 3LWMA 1GOCA 4KI6A 4OLAA 5CYQA 1TGOA 3O3FA 1ASVA 1YVUA 4CF1A 2P51A 3IRXA 2IAJA 3MXIA 3QESA 3AVFA 1U47A 3VQAA 3ITHA 1GOBA 1NOYA 1BQMA 2HNDA 3NAEA 5I3UA 4DSIA 4J2BA 1FXXA 4N76A 3DYAA 2GBZA 3LALA 3SV4A 4FJIA 4FJ9A 1S1UA 3V9SA 1X9WA 3A2FA 2AJQA 3OVNA 4N5SA 1L3VA 3K5NA 4KRFA 4CESA 4DS5A 4DS4A 4O0IA 1W0HA 4CJSA 1RBTA 3OYIA 4JS5A 3KK3A 5HP1A 3SPZA 4ZTJA 2HVIA 3TABA 2ETJA 5KI6A 4B9SA 3MXMA 2P5GA 4CIGA 3O3GA 4MQ3A 5DMRA 4CHNA 3HXMA 1N5YA 1WNSA 4CHZA 4F4KA 3K58A 1WSEA 3BGRA 3K57A 3LP2A 4RW9A 2A1RA 3VQEA 4RW7A 1BIZA 1DLOA 3TAMA 1FK9A 4EP5A 4DQIA 4CHOA 4W5OA 4HUFA 3SV3A 3SUPA 1F21A 1XHXA 1JLEA 3V9WA 3RWUA 1EKEA 4E1NA 3LAKA 1TKXA 3E01A 1RTDA 2Z1GA 3C94A 5D3GA 3DLKA 4CJ4A 2OYQA 4CFCA 1QSLA 3ZSXA 1A5WA 3AA4A 3L2VA 4JS4A 1J53A 1UAXA 2EHGA 1ZBLA 1XC9A 3BDPA 2HB5A 4O5BA 2KFZA 2BDPA 3AVKA 1U49A 4CJUA 3OS2A 2ATQA 3OY9A 1A5VA 1RT1A 1NKEA 3VQBA 1C6VA 4E3SA 4DMNA 3KKRA 4DF4A 1HYZA 1Z25A 2QXFA 3HP9A 5HBMA 3SQ2A 1O1WA 3WNGA 1CLQA 1ASWA 1KSPA 4FLZA 1QHTA 4TSXA 3WNFA 3MAQA 3RMCA 1S1XA 4E89A 3V1RA 4BDPA 3HVTA 4CEBA 4BDYA 2HVHA 3ASMA 4DF8A 1IO2A 4JLHA 1DTQA 1RT3A 1ZBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JL1 A;  3ZSV A;  3QNN A;  3VQ9 A;  2RPI A;  3OYN A;  1HRH A;  1HPZ A;  1I3A A;  2KZZ A;  2Z1I A;  4OPJ A;  2QKK A;  2D0B A;  3K5M A;  3DOL A;  3NGZ A;  1FKP A;  1QE1 A;  4LH5 A;  1RT5 A;  2YHA A;  4G1Q A;  3CM6 A;  5HRP A;  3OS0 A;  1CZB A;  4O4G A;  3MXJ A;  1NK9 A;  3LPU A;  1JXE A;  4LY7 A;  4FCY A;  2FBV A;  2OPS A;  3L8B A;  3QET A;  2YV0 X;  4IDK A;  5KGW A;  1D9D A;  4J2D A;  1HNI A;  2WON A;  4CJR A;  3V9Z A;  1A5X A;  3CFP A;  3ZCM A;  4EZ6 A;  1T03 A;  1ITG A;  1QSS A;  1CXU A;  1B9F A;  5FRO A;  3KKS A;  1C0T A;  1BCM A;  2I5J A;  4FLV A;  4Z0U A;  4CJE A;  3I0S A;  4CJV A;  3B6O A;  3ULD A;  3O4Q A;  4B8C A;  4M3W A;  3OYA A;  1QTM A;  1NK4 A;  3SPY A;  4B9V A;  4UQG A;  4KTW A;  2XY5 A;  2G8V A;  4FZX C;  1WLJ A;  3V81 A;  4OKK A;  4Z4E A;  4DSE A;  4DTN A;  4M3Z A;  2YNH A;  3L3V A;  3ZT0 A;  4I7F A;  1LAW A;  3PX0 A;  2B6A A;  1XI1 A;  3C95 A;  3DRS A;  5J2M A;  1S9E A;  2VG7 A;  4ZTF A;  1J5O A;  2KFN A;  1JLG A;  2X74 A;  4CGJ A;  4RG8 A;  1KTQ A;  4CGH A;  1KVA A;  1SL0 A;  4Z4C A;  3RR7 A;  4QAG A;  4DSL A;  4FJK A;  1LW2 A;  4E7I A;  4AIL C;  2QK9 A;  3DRP A;  4FM0 A;  1TK8 A;  4FJ5 A;  4CEA A;  4CIF A;  2WOM A;  1Q9X A;  3JSM A;  4KPY A;  4IG0 A;  3VQ4 A;  3HT3 A;  4C8M A;  3OYD A;  4IBN A;  2XO7 A;  3AVH A;  3LPT A;  3CG7 A;  4FJX A;  1N6Q A;  3RMA A;  4CEZ A;  4ELT A;  3O4N A;  5FRM A;  1JLB A;  4B9N A;  4CJP A;  2VWK A;  4DU4 A;  3V6D A;  4PWD A;  4BE1 A;  3DLR A;  3SI6 A;  3TAQ A;  1D9F A;  2KTQ A;  3AVG A;  4JRP A;  5C42 A;  3KJV A;  4CGG A;  3M8P A;  4Q0B A;  4NYN A;  1SL2 A;  3RRG A;  1S9G A;  4I9L A;  3NHG A;  3PO4 A;  1NJZ A;  1TK0 A;  3I0R A;  4C8L A;  5HRS A;  5E41 A;  3TAN A;  4DWI A;  1S1T A;  4KHQ A;  5J1E A;  4AHU A;  1J54 A;  1RTJ A;  4GVM A;  4DSJ A;  4I9Q A;  3TR8 A;  3NGI A;  1L3U A;  4NCA A;  1IG9 A;  3F9K A;  4Z4I A;  4FW2 A;  3RR8 A;  5CYM A;  4CGF A;  4FLY A;  3KLH A;  3S3M A;  3L2Q A;  4KV8 A;  4KO0 A;  4E7K A;  3AV9 A;  5HRR A;  1VSM A;  4CF2 A;  5JS2 A;  3K59 A;  1REV A;  3HPH A;  1YTU A;  1X9S A;  1SL1 A;  2D0A A;  3ZT4 A;  4B3O A;  4DU1 A;  4Z4H A;  4IFV A;  4DFJ A;  3C6U A;  2P5O A;  2BE2 A;  2YNF A;  4EZ9 A;  3LP1 A;  2IC3 A;  4CHY A;  5I42 A;  4O0J A;  3U3Y A;  4AHR A;  3IG1 A;  1JKH A;  4DG1 A;  4I2P A;  1T05 A;  1HQE A;  4M3Y A;  4CHP A;  1HYV A;  1S6Q A;  3AO4 A;  3FFI A;  1BI4 A;  3ZT2 A;  1TAQ A;  3VQ8 A;  4ELV A;  4CJQ A;  3NFA A;  4BE0 A;  3DLH A;  1WAJ A;  1NKC A;  1EP4 A;  3AO5 A;  1KRP A;  3AA5 X;  1TVR A;  4DFK A;  1RCH A;  4HUG A;  2W42 A;  4C8N A;  1UOC A;  4FLT A;  4FK4 A;  4KHN A;  4LSN A;  1NOZ A;  3AVC A;  4B9M A;  4FJH A;  1KFD A;  4N41 A;  1D8Y A;  4CK2 A;  2RN2 A;  4CJW A;  4XIU A;  3KK2 A;  4HTU A;  1TKT A;  4CFD A;  2IDO A;  1RDD A;  4DQQ A;  1LV5 A;  5C24 A;  3HVR A;  2G8I A;  2YHB A;  3LAN A;  3KLE A;  2HHX A;  1C0U A;  3JYT A;  3MED A;  2GUI A;  3QNO A;  4FK2 A;  2HHQ A;  4CF0 A;  3AA2 A;  3D0P A;  4FM2 A;  3NE6 A;  1Y97 A;  3HL8 A;  2XHB A;  3TI0 A;  5FDL A;  4B8A B;  3T1A A;  4FVM A;  4RW4 A;  4GMJ B;  4B9T A;  1RIL A;  3UIQ A;  4FLX A;  4CGI A;  3ZSO A;  4PQU A;  1VSD A;  3V1O A;  4J2E A;  3IS9 A;  3DLG A;  4KKO A;  4FLW A;  4CEE A;  3SUN A;  1U45 A;  1SKS A;  2XY7 A;  1HYS A;  3L2W A;  2O4I A;  1NKB A;  1EX4 A;  1BQN A;  4FZY A;  4KHS A;  4FXD A;  2F8S A;  4FYD A;  1C1A A;  2DFF A;  3VA0 A;  3SUQ A;  4LSL A;  4HHT A;  1QSY A;  2F8T A;  2NUB A;  4Y1D A;  1KCF A;  1SKR A;  2YKM A;  4KFB A;  4E1M A;  3KLF A;  1KFS A;  1YTA A;  4BAC A;  3AVJ A;  2ZQB A;  2X6N A;  4YNQ A;  1RDC A;  4DTU A;  3TAR A;  3PY8 A;  3DM2 A;  1S6P A;  4N56 A;  1J9A A;  2HHT A;  4Z4F A;  1SUQ A;  5HRO A;  3QEV A;  1RBV A;  4E7H A;  1RT4 A;  4E7L A;  4DTR A;  4FLU A;  4CE9 A;  4WE1 A;  3OYL A;  1RTH A;  4DSF A;  3QER A;  2OZS A;  3L2R A;  3VQD A;  2B5J A;  1S1W A;  3RRH A;  1G15 A;  2OZM A;  3OYJ A;  1WAF A;  2EX3 A;  4PUO A;  3NH2 A;  3OYB A;  3HPG A;  3QO9 A;  3NGY A;  3SQ0 A;  2HHU A;  1GOA A;  4DSK A;  1KVB A;  3HP6 A;  1VSF A;  3RTV A;  3SNN A;  4DLG A;  1BCO A;  3LZI A;  1NK8 A;  4CJ3 A;  4O55 A;  2YNG A;  4Y1C A;  3OYG A;  3NH0 A;  4HCB A;  4R5P A;  1LWC A;  4DTP A;  4CJK A;  4KHY A;  3DMJ A;  3VQC A;  2YNI A;  4AH9 A;  5SZT A;  4W5T A;  3CQ8 A;  1VRT A;  4CEQ A;  3C6T A;  5CY4 A;  3QEI A;  1YT3 A;  1T8E A;  1W9H A;  2GV9 A;  3ZSW A;  4DTJ A;  3VQ6 A;  3TAP A;  4RW6 A;  2OA8 A;  2BAN A;  2G8F A;  5HLF A;  4W5N A;  2XY8 A;  1RT6 A;  3AA3 A;  1K6Y A;  1Q8I A;  1WSJ A;  3CFO A;  1IKW A;  3DLE A;  1L5U A;  4E19 A;  2HHW A;  3RMD A;  1BGX T;  1FKO A;  3AO1 A;  3OS1 A;  3CM5 A;  4OLB A;  1BI4 B;  2YKN A;  3M8Q A;  2Y1J A;  4F2S A;  3ALY A;  4CER A;  1L3S A;  4HCC A;  1JLF A;  2LSN A;  4OJR A;  3P5J A;  2VWJ A;  3M8S A;  3B6P A;  2OPR A;  3G0Z A;  4FW1 A;  4NCB A;  1Q9Y A;  3AVB A;  2BGG A;  1JL2 A;  2P1J A;  1ZBF A;  2D5R A;  2E6M A;  4FJN A;  3TWH A;  3NF7 A;  1EET A;  3QIN A;  1VK0 A;  3PUF A;  1RT7 A;  2JLE A;  2FBT A;  4PY5 A;  4C8K A;  3P1G A;  5JS1 A;  1ZYQ A;  2FBX A;  4C8O A;  4FJJ A;  4O44 A;  4AHV A;  3OJU A;  3NF6 A;  3HM9 A;  3V9U A;  1KLM A;  3NF9 A;  4CED A;  3V4I A;  3SCX A;  5J2Q A;  1HQU A;  3KD5 E;  1JXB A;  2FBY A;  3P83 D;  1RDB A;  1VSI A;  4OKE A;  3OYM A;  2G8K A;  2PYL A;  4CEC A;  3QEW A;  5C25 A;  4FJL A;  4ICL A;  4I2Q A;  2HHS A;  4M41 A;  4AHC A;  2IOC A;  1EXQ A;  1Z26 A;  3V1Q A;  4JRQ A;  3QEP A;  3AO2 A;  3SYZ A;  2E4L A;  2XY6 A;  4OKJ A;  3TAF A;  1DTT A;  3KIO A;  4DQR A;  4DQS A;  3HJF A;  4K8X A;  3D45 A;  4CK3 A;  5T7B A;  2IS3 A;  3K2P A;  4LH4 A;  4CFB A;  3LWL A;  3PX6 A;  3IAY A;  1LWE A;  2IGI A;  2RKI A;  3HPO A;  4CJF A;  1TL1 A;  4BWJ A;  4FZZ A;  3NBP A;  5KGX A;  3HST B;  1HJR A;  4CEO A;  1I39 A;  1WSF A;  3AVM A;  3OYH A;  4FM1 A;  4DTS A;  5J2P A;  2B4J A;  5J2N A;  4L8R B;  2E6L A;  1NK7 A;  4KAZ A;  3CYM A;  2RF2 A;  4J2A A;  5FRN A;  3MEC A;  1WSH A;  4M3R A;  4KTZ A;  3KK1 A;  1S5J A;  4RW8 A;  1NJY A;  3MEE A;  1X1P A;  3NH1 A;  3VQP A;  3SZ2 A;  4IKF A;  2HW3 A;  4IG3 A;  4E7J A;  3VA3 A;  2G8H A;  1XWL A;  2HHV A;  1IKX A;  4CF8 A;  3O3H A;  2G8W A;  1C0M A;  2D0C A;  4Q5V A;  4W5Q A;  5HRN A;  3S3O A;  5KRS A;  4DQP A;  4FJ8 A;  1JLA A;  2ITG A;  2VG5 A;  3SJJ A;  1L3T A;  3QLH A;  4NYF A;  4FJ7 A;  4CJT A;  4EP4 A;  1U04 A;  3OYC A;  3G10 A;  1RT2 A;  3S9H A;  2VG6 A;  3ZT1 A;  4M42 A;  2KZM A;  1WSG A;  3ZT3 A;  2X78 A;  3F73 A;  3AO3 A;  5CZ2 A;  3ISN C;  2ZD1 A;  1X9M A;  1RBS A;  3MEG A;  1LAV A;  3LP0 A;  2X6S A;  4BWM A;  3NDK A;  3SQ4 A;  4CF9 A;  4HUE A;  3ZSR A;  1JLQ A;  4QOZ B;  4F3O A;  1VRU A;  3HO1 A;  1ZBI A;  1BIU A;  2Z1H A;  3LAM A;  4N47 A;  1VSL A;  3K5L A;  1XHZ A;  2PZS A;  1D5A A;  3VQ5 A;  4AHT A;  4BE2 A;  4F2R A;  4KHW A;  4YFU A;  3WNH A;  3ZSY A;  4GW6 A;  4ELU A;  3I8D A;  3QIP A;  4DFP A;  4KRE A;  3RMB A;  1WSI A;  4OGE A;  5CZ1 A;  3WNE A;  4DTX A;  1CXQ A;  1NJX A;  1HMV A;  2XRI A;  3OJS A;  1TAU A;  1UWB A;  3NCI A;  4CK1 A;  1RNH A;  2JGU A;  3V9X A;  4CCH A;  3AVN A;  3T19 A;  4CJ5 A;  3QIO A;  1MU2 A;  1NJW A;  4H8K A;  3EZ5 A;  1NK6 A;  4QCL A;  1ZBU A;  2O4G A;  4H4M A;  1U4B A;  4DFM A;  1RBR A;  2G8U A;  1KLN A;  4FJG A;  4CEF A;  1QQC A;  2KQ2 A;  3LP3 A;  3OYF A;  3EYZ A;  4DLE A;  2Y1I A;  3M8R A;  3KLI A;  2OPQ A;  1T7P A;  1RBU A;  5EU7 A;  4CFA A;  1LWF A;  4ID5 A;  4M45 A;  1RTI A;  3ZSZ A;  4M3X A;  4CJL A;  4W5R A;  1U48 A;  3NF8 A;  2PYJ A;  2DFE A;  2DY4 A;  1CZ9 A;  3DRR A;  3HYF A;  3DI6 A;  3L3U A;  2R7Y A;  3OYE A;  1C1C A;  4KTQ A;  1JLC A;  3SUO A;  1IKY A;  1B9D A;  1NK0 A;  1SV5 A;  1S1V A;  1NK5 A;  2QKB A;  3AVA A;  1BHL A;  1C1B A;  1BIS A;  2FC0 A;  4H4O A;  1TKD A;  4FK0 A;  3HK2 A;  3THV A;  2F96 A;  1VSH A;  3TAE A;  3U3G A;  3VQQ A;  3AVI A;  4OGC A;  1IKV A;  3ZSQ A;  1UA0 A;  4KB1 A;  2DTU A;  3VQ7 A;  5SWM A;  1ASU A;  1BL3 A;  1TKZ A;  4K8Z A;  4OVL A;  4DU3 A;  1VSK A;  3T3F A;  3CFR A;  4IFY A;  3U6F A;  1TV6 A;  3SQ1 A;  3LZJ A;  4LD0 A;  3PO5 A;  4DTM A;  1KVC A;  4HVJ A;  3OYK A;  2KW4 A;  2HNY A;  3S3N A;  1VSE A;  1QS4 A;  3KTQ A;  3LDS A;  1IH7 A;  2PY5 A;  3QEX A;  3TAG A;  1R0A A;  2ZE2 A;  4F8R A;  3DLB A;  4KI4 A;  4M3T A;  1HNV A;  3VN5 A;  4CIE A;  2HMI A;  4E0D A;  4B9U A;  4MFB A;  4BDZ A;  3K5O A;  1B92 A;  1TL3 A;  4FJM A;  4KB0 A;  3H08 A;  3AVL A;  4PA1 A;  4CGD A;  1LW0 A;  2A1S A;  4ID1 A;  4NCG A;  4ZHR A;  3EY1 A;  1RDA A;  4DTO A;  1UA1 A;  1TK5 A;  2Z1J A;  5KRT A;  4M3U A;  3PX4 A;  1WN7 A;  4OPK A;  5KTQ A;  3KD1 E;  3DOK A;  2DFH A;  2HNZ A;  4F3T A;  4Z4G A;  4AHS A;  2OPP A;  3PV8 A;  1VSJ A;  1SKW A;  3KLG A;  2Q3S A;  4B08 A;  5DK5 A;  5K14 A;  4B9L A;  4CHQ A;  3L2U A;  4KHU A;  3LWM A;  1GOC A;  4KI6 A;  4OLA A;  5CYQ A;  1TGO A;  3O3F A;  1ASV A;  1YVU A;  4CF1 A;  2P51 A;  3IRX A;  2IAJ A;  3MXI A;  3QES A;  3AVF A;  1U47 A;  3VQA A;  3ITH A;  1GOB A;  1NOY A;  1BQM A;  2HND A;  3NAE A;  5I3U A;  4DSI A;  4J2B A;  1FXX A;  4N76 A;  3DYA A;  2GBZ A;  3LAL A;  3SV4 A;  4FJI A;  4FJ9 A;  1S1U A;  3V9S A;  1X9W A;  3A2F A;  2AJQ A;  3OVN A;  4N5S A;  1L3V A;  3K5N A;  4KRF A;  4CES A;  4DS5 A;  4DS4 A;  4O0I A;  1W0H A;  4CJS A;  1RBT A;  3OYI A;  4JS5 A;  3KK3 A;  5HP1 A;  3SPZ A;  4ZTJ A;  2HVI A;  3TAB A;  2ETJ A;  5KI6 A;  4B9S A;  3MXM A;  2P5G A;  4CIG A;  3O3G A;  4MQ3 A;  5DMR A;  4CHN A;  3HXM A;  1N5Y A;  1WNS A;  4CHZ A;  4F4K A;  3K58 A;  1WSE A;  3BGR A;  3K57 A;  3LP2 A;  4RW9 A;  2A1R A;  3VQE A;  4RW7 A;  1BIZ A;  1DLO A;  3TAM A;  1FK9 A;  4EP5 A;  4DQI A;  4CHO A;  4W5O A;  4HUF A;  3SV3 A;  3SUP A;  1F21 A;  1XHX A;  1JLE A;  3V9W A;  3RWU A;  1EKE A;  4E1N A;  3LAK A;  1TKX A;  3E01 A;  1RTD A;  2Z1G A;  3C94 A;  5D3G A;  3DLK A;  4CJ4 A;  2OYQ A;  4CFC A;  1QSL A;  3ZSX A;  1A5W A;  3AA4 A;  3L2V A;  4JS4 A;  1J53 A;  1UAX A;  2EHG A;  1ZBL A;  1XC9 A;  3BDP A;  2HB5 A;  4O5B A;  2KFZ A;  2BDP A;  3AVK A;  1U49 A;  4CJU A;  3OS2 A;  2ATQ A;  3OY9 A;  1A5V A;  1RT1 A;  1NKE A;  3VQB A;  1C6V A;  4E3S A;  4DMN A;  3KKR A;  4DF4 A;  1HYZ A;  1Z25 A;  2QXF A;  3HP9 A;  5HBM A;  3SQ2 A;  1O1W A;  3WNG A;  1CLQ A;  1ASW A;  1KSP A;  4FLZ A;  1QHT A;  4TSX A;  3WNF A;  3MAQ A;  3RMC A;  1S1X A;  4E89 A;  3V1R A;  4BDP A;  3HVT A;  4CEB A;  4BDY A;  2HVH A;  3ASM A;  4DF8 A;  1IO2 A;  4JLH A;  1DTQ A;  1RT3 A;  1ZBH A; 
#chains in the Genus database with same CATH topology
 3W0L A;  3QNN A;  2P9S A;  3VQ9 A;  2RPI A;  3TTD A;  2O8C B;  3VET A;  4FPA A;  2QKK A;  2EWS A;  2YHA A;  5AQX A;  1T3V A;  3LPU A;  4LY7 A;  4FCY A;  2VGM A;  4J2D A;  2YV0 X;  5KGW A;  1MA9 B;  1YVN A;  1D9D A;  1S3X A;  4CBX A;  3ZCM A;  1T03 A;  1ITG A;  1B9F A;  1X3M A;  4YDU A;  3KKS A;  1C0T A;  1BCM A;  2WC9 A;  4CJE A;  4WQ4 C;  4B8C A;  3ID6 A;  3HRG A;  4J8F A;  3TTF A;  4K25 A;  2G8V A;  3V81 A;  3F5T A;  3W3D A;  2PAV A;  2YNH A;  3L3V A;  3LDP A;  4I7F A;  4EFH A;  2B6A A;  5J2M A;  1S9E A;  2VG7 A;  5BR8 K;  4ZTF A;  4FWL A;  4BRK A;  1JLG A;  3SK3 A;  2X74 A;  1KTQ A;  4DSL A;  3WEE A;  4EHU A;  4FM0 A;  1WBD A;  1TK8 A;  4FJ5 A;  4CEA A;  1N8R O;  3F9M A;  2QM1 A;  3HT3 A;  3J7Z O;  1T6D A;  5AQF A;  3VGM A;  3CG7 A;  4FJX A;  1VQ6 N;  3O4N A;  5FRM A;  4B9N A;  1FJG K;  4CJ7 A;  3SI6 A;  1OH5 A;  3AVG A;  1VQP N;  3RSE B;  1ATR A;  4Q0B A;  4I9L A;  3PO4 A;  1NJZ A;  3I0R A;  4FSV A;  4C23 A;  4DWI A;  4YOV A;  3UB5 A;  4I9Q A;  3NGI A;  1L3U A;  2F9T A;  1IG9 A;  3F9K A;  4NCA A;  3CJ7 A;  5CYM A;  4FLY A;  4JHD A;  3KLH A;  3S3M A;  3MN7 A;  3PIO L;  4KO0 A;  4E7K A;  5HRR A;  3EEQ A;  1W2B M;  1Q18 A;  4PL8 A;  4CF2 A;  3HPH A;  1YTU A;  3IMX A;  4B3O A;  5AQU A;  4Z4H A;  3C6U A;  2BE2 A;  2YNF A;  3L4I A;  2P9S B;  4CHY A;  5I42 A;  1NJI O;  4O0J A;  4LC9 B;  1HLU A;  1I94 K;  4I2P A;  1T05 A;  1HQE A;  4M3Y A;  1HYV A;  1S6Q A;  3AO4 A;  4FWQ A;  1BI4 A;  2H3G X;  4ELV A;  4IOX A;  2YJE A;  4BE0 A;  1WAJ A;  1TVR A;  4FK4 A;  4KHN A;  4B9M A;  4N41 A;  4C1N I;  2RN2 A;  3QIC A;  1U6Z A;  1RDD A;  2D4W A;  2E8A A;  2F9W A;  1C0U A;  4LF8 K;  3NVK A;  3AA2 A;  3MWT A;  3TI0 A;  5FPD A;  4AQY K;  3T1A A;  4FVM A;  2P9P A;  4GMJ B;  1RIL A;  4IDH A;  4PQU A;  3A5N C;  1VSD A;  3HI0 A;  3SUN A;  1SKS A;  4FZY A;  4FXD A;  1NGH A;  4KHS A;  4ILG B;  2E1Z A;  1C1A A;  3WEE B;  3SUQ A;  2O8E A;  2NUB A;  3G25 A;  1KCF A;  4KFB A;  1BDG A;  4BAC A;  3PY8 A;  3AVJ A;  4YNQ A;  3DM2 A;  1S6P A;  3FLC O;  1J9A A;  2HHT A;  3H1V X;  4Z4F A;  4DTR A;  2VWB A;  3CCM N;  4BVP A;  3VQD A;  2EX3 A;  2OTL N;  3EE8 A;  2HBJ A;  4DSK A;  1NK8 A;  1YJN N;  4BRA A;  4Y1C A;  3NH0 A;  4XH4 A;  4CZE A;  4R5P A;  3UE5 A;  3DMJ A;  3CER A;  4GVE A;  4A5A A;  2YNI A;  4JHD B;  4AH9 A;  2RHK A;  3C6T A;  3O9Q A;  4BRL A;  1FW6 A;  1ZXO A;  4DTJ A;  3TAP A;  2QWP A;  5C15 A;  1WSJ A;  4IEE A;  1L5U A;  3RMD A;  1BGX T;  3L0Q A;  4WFN L;  1BI4 B;  2YKN A;  5ELZ A;  3ALY A;  1L3S A;  4DR3 K;  4JV5 K;  1HPM A;  1JLF A;  4NB4 A;  4OJR A;  3D2F A;  3B6P A;  4JYA K;  2YCH A;  1NGF A;  1ZBF A;  2D5R A;  2E6M A;  3TWH A;  3QFU A;  4K41 A;  1K8K A;  3P1G A;  4C8O A;  3CCQ N;  1GLB G;  3A0I X;  3BY5 A;  1HKC A;  3NF6 A;  4BVO A;  3ATU A;  3ENH A;  1KLM A;  5AFU A;  4CED A;  3V4I A;  5J2Q A;  2P9P B;  4OKE A;  2PYL A;  3WXJ A;  2HHS A;  1XMO K;  1NGB A;  3MWP A;  1BO5 O;  4IO9 L;  5AQG A;  3TAF A;  2O8E B;  2UUC K;  4R79 A;  3D45 A;  1C0F A;  4CK3 A;  5T7B A;  3NMU A;  4CFB A;  3IAY A;  1LWE A;  2IGI A;  4OPA A;  3HPO A;  4GKK K;  5KGX A;  4FM1 A;  1HJR A;  5J2P A;  3AVM A;  3KVG A;  4BR0 A;  4DTS A;  1V4T A;  4JEP A;  4CZJ A;  1E4F T;  2RF2 A;  5ADX A;  4M3R A;  4GV9 A;  3KK1 A;  4RW8 A;  5C0Y A;  3MEE A;  1X1P A;  4BY9 C;  4IKF A;  1H1V A;  3PSF A;  4YOR A;  2NRZ A;  3O3H A;  1W97 L;  2G8W A;  3Q7B A;  4WQ5 A;  4Q5V A;  4W5Q A;  1T6C A;  4E1J A;  1JLA A;  2V7Z A;  4NYF A;  4FJ7 A;  4CJT A;  3G10 A;  3SAF A;  4AM7 A;  3AO3 A;  2ASM A;  5F1X A;  3I55 N;  3ISN C;  4GV6 A;  5KPR A;  1X9M A;  1RBS A;  1VQM N;  4DQ8 A;  1IBL K;  4BWM A;  3H1Q A;  1TUU A;  4CF9 A;  1VQN N;  2QWM A;  1NMN A;  5FPN A;  3CJB A;  4YOU A;  3K5L A;  5AQI A;  3O9R A;  4BE2 A;  2IVO A;  2YX6 A;  1M1K O;  3QIP A;  2Q97 A;  3D2F B;  3ZLJ A;  4OGE A;  4DTX A;  1HMV A;  4BRF A;  4IXC A;  4OO1 J;  4KBO A;  1NJW A;  4CJ5 A;  3J80 O;  1MU2 A;  4FOI A;  5AQK A;  2O4G A;  4JK9 A;  1K8K B;  2PBD A;  4CZL A;  3D7E O;  4CEF A;  3LP3 A;  3KWI A;  4DLE A;  3EKS A;  2OPQ A;  4M3X A;  4W5R A;  1U48 A;  1YIT N;  1VQL N;  3CPW M;  4PKH A;  1M90 O;  2DY4 A;  3DRR A;  2UUB K;  3OYE A;  1C1C A;  1JLC A;  2F7T A;  2KHO A;  1NK0 A;  4B3T K;  1C1B A;  4H4O A;  1BIS A;  1TKD A;  4JKC A;  3TAE A;  2AA4 A;  3VQQ A;  1J6Z A;  2UXD K;  2FSK A;  4BRN A;  3P38 A;  1BA1 A;  1TV6 A;  5BPL A;  3SQ1 A;  1XNQ K;  4DTM A;  4HVJ A;  3P4I A;  2KW4 A;  3LDS A;  3TAG A;  3D2E A;  3DLB A;  4M3T A;  4BDZ A;  4QS8 A;  2FF6 A;  1TL3 A;  4FJM A;  4KB0 A;  4DTO A;  4ID1 A;  3L6Q A;  3KHY A;  1TK5 A;  1VQ9 N;  5KRT A;  4B1Y B;  1JCF A;  4OPK A;  5KTQ A;  3KD1 E;  2HNZ A;  1Z6R A;  1SKW A;  3VEX A;  5MLC Q;  5DK5 A;  4MDB A;  4CHQ A;  3L2U A;  4KHU A;  3LWM A;  1GOC A;  2P9I A;  5CYQ A;  3TSU A;  1YJ9 N;  1YVU A;  2O8D A;  4CF1 A;  2P9L A;  3IRX A;  2IAJ A;  3MXI A;  3VQA A;  3CCJ N;  4H5N A;  1NOY A;  1BQM A;  5AQS A;  5AQO A;  4J2B A;  1DGK N;  2HHH K;  1BWF O;  3V9S A;  3A2F A;  4PHT X;  4N5S A;  1L3V A;  3K5N A;  4JKD A;  4KRF A;  3QFP A;  4DS5 A;  5HP1 A;  1W0H A;  3P39 A;  2YHW A;  3TAB A;  1GLD G;  3O3G A;  3HXM A;  4IJN A;  5JLH A;  4H0Y B;  4F4K A;  2Q0U A;  3ZEU A;  1WSE A;  4DV3 K;  3HZ6 A;  2J4R A;  1DLO A;  2QTD A;  3TAM A;  5GAG P;  4DV7 K;  3PLA A;  3V9W A;  1JLE A;  2V51 B;  4A59 A;  3R3L A;  1KAZ A;  3C94 A;  2NRX A;  2NNW A;  3ZSX A;  4BRQ A;  1J53 A;  1XC9 A;  3GL1 A;  2P9U A;  5AFU H;  4BG8 A;  4CJU A;  3H3N O;  4DR4 K;  1RT1 A;  4JKA A;  1O1W A;  3WNG A;  4BC4 A;  2O8F B;  1QHT A;  3M5R A;  3WNF A;  4DV6 K;  1WB9 A;  1EWQ A;  4BDY A;  2HVH A;  3ASM A;  2KZZ A;  1I3A A;  2Z1I A;  3DOL A;  3D2E B;  1QE1 A;  3OS0 A;  2FBV A;  5ADX H;  4IDK A;  1HNI A;  4CJR A;  1A5X A;  5GAD P;  1CXU A;  5FRO A;  4B3M K;  2A42 A;  4FLV A;  5BRH A;  5GIO A;  4BGA A;  5M1N A;  4CJV A;  3ULD A;  3SBG A;  1QTM A;  4B1Z A;  3SPY A;  2P9I B;  2ZJP L;  1WLJ A;  4OKK A;  2O8D B;  4BRH A;  4DSE A;  4BGB A;  2P9L B;  3ZT0 A;  2VCP A;  3C0B A;  1XI1 A;  4LF7 K;  3C95 A;  3DRS A;  4X65 K;  3C65 A;  4A5B A;  4G9Z A;  4O5F A;  1BA0 A;  1KVA A;  3RR7 A;  4Z4C A;  1HNX K;  4AIL C;  4QS7 A;  5GIP A;  3U9D A;  3LDN A;  3ZX3 A;  4KPY A;  3VEZ A;  3OBW A;  2ZJQ L;  4C8M A;  3LPT A;  3RMA A;  3ZEU B;  3ZET A;  2ZGZ A;  3DLR A;  5M1K A;  3TAQ A;  2KTQ A;  4CGG A;  3M8P A;  3CC2 N;  4BR7 A;  1S9G A;  4NXM K;  5DM7 L;  2YJF A;  5HRS A;  1GLJ O;  4KHQ A;  1RTJ A;  4GVM A;  3C6H A;  3DXK A;  1ATN A;  1GLA G;  4FW2 A;  3FZK A;  3FE1 A;  3MX5 A;  3L2Q A;  1VQ5 N;  5CR4 A;  1X9S A;  3T69 A;  3TSQ A;  4DFJ A;  4EZ9 A;  2ZF5 O;  3FZF A;  2F4V K;  4AHR A;  2E2O A;  4CVN E;  3IG1 A;  3CET A;  2OCE A;  3ZT2 A;  1TAQ A;  3NFA A;  3DLH A;  4JI5 K;  1EP4 A;  2W42 A;  3AVC A;  1EQY A;  4GNI A;  1HKB A;  4KH5 A;  4BR4 A;  4CK2 A;  4CJW A;  4RCH A;  1LV5 A;  3HVR A;  3LAN A;  3MED A;  4FK2 A;  4FWO A;  1XUP O;  3TTC A;  3D0P A;  1HUX A;  3NE6 A;  4XH1 A;  2XHB A;  4B8A B;  3BZK A;  2E2N A;  3LM9 A;  3O1W A;  1NGJ A;  2Q2R A;  3UIQ A;  4C1N K;  4CGI A;  2UXC K;  5FRN A;  4KKO A;  3DLG A;  4FLW A;  1U45 A;  4CEE A;  3VF4 A;  1NKB A;  2CGJ A;  3ULE A;  1YJW N;  2DFF A;  1QSY A;  1SKR A;  1NGI A;  2E2Q A;  2YKM A;  4MLE A;  4E1M A;  3KLF A;  1OH6 A;  5M1O A;  1KFS A;  1YTA A;  1NGA A;  2ZQB A;  1RDC A;  4FL9 A;  4NXN K;  2KKZ A;  3OTO K;  1SUQ A;  3ZET B;  3QEV A;  4IEI A;  4JKE A;  4FLU A;  1YAG A;  4WE1 A;  3OYL A;  1RTH A;  2OZS A;  2OZM A;  1EO1 A;  3RRH A;  1WAF A;  4JI3 K;  2RE2 A;  5LJW A;  3O9S A;  5I9E B;  3NGY A;  4O8K A;  1GOA A;  1KVB A;  3M3Z A;  3HP6 A;  4JKH A;  3VGK A;  4DLG A;  4FPB A;  3ZX2 A;  4JAX A;  4JK8 A;  3OYG A;  3DXK B;  4HCB A;  5BN8 A;  2FSJ A;  3O9U A;  4JKG A;  1P90 A;  5SZT A;  2Q36 A;  3LM2 A;  1VRT A;  4CEQ A;  2E88 A;  3R1X A;  1T8E A;  1W9H A;  3M6G A;  2GV9 A;  1Q82 O;  3ZSW A;  2OA8 A;  4WQ4 A;  2BAN A;  3AAP A;  4IWV A;  2G8F A;  1KXP A;  2XY8 A;  3CQY A;  3AA3 A;  1K6Y A;  1Q8I A;  3CFO A;  1IKW A;  1T44 A;  4E19 A;  3AO1 A;  1G99 A;  3VOV A;  2HF4 A;  4F2S A;  2Q31 A;  4CER A;  4HCC A;  3G71 N;  3I56 N;  3M8S A;  4FW1 A;  3AVB A;  2BGG A;  1JL2 A;  3RVC A;  2HBM A;  4IFE A;  4U7B A;  4FJN A;  1EET A;  3QIN A;  1VK0 A;  1RT7 A;  4F9O A;  5JS1 A;  2FBX A;  5M1Q A;  1GLF O;  2FF3 B;  4I6M A;  4PKI A;  2A6A A;  1HQU A;  3CCU N;  1RDB A;  3QEW A;  3LDO A;  4ICL A;  4I2Q A;  1NG9 A;  3WQU A;  5AQP A;  3QEP A;  4M63 C;  3SYZ A;  4JK7 A;  3ULE B;  4YY3 K;  3QBW A;  4JN4 A;  1N36 K;  4DR1 K;  1DTT A;  3L4Q A;  4DQR A;  4DQS A;  4K8X A;  2IS3 A;  3K2P A;  3PX6 A;  1VQ4 N;  3SMP A;  2RKI A;  3KWG A;  4CJF A;  1RGI A;  1TL1 A;  4BWJ A;  3NBP A;  4LFB K;  4DHY A;  1WSF A;  4L8R B;  2WTU A;  1NK7 A;  4KAZ A;  4J2A A;  4KTZ A;  1NJY A;  1NMD A;  3NH1 A;  2V7Y A;  3SZ2 A;  4BRO A;  2HHV A;  3WT0 A;  3CC4 N;  2ASP A;  1WBB A;  5JVG L;  1C0M A;  5HRN A;  3S3O A;  5KRS A;  4DQP A;  4JKG B;  4A57 A;  4WFA L;  3SJJ A;  1L3T A;  3OYC A;  1RT2 A;  2X78 A;  3WXM B;  2GTD A;  1BU6 O;  1OH8 A;  3LP0 A;  2X6S A;  2A3Z A;  3H3O B;  4HUE A;  3O9T A;  5BN9 A;  4QOZ B;  4BRG A;  4F3O A;  1VRU A;  1BG3 A;  1ILY A;  3HO1 A;  2QWQ A;  1ZBI A;  2D0O A;  2W6L A;  1XHZ A;  3FZH A;  4AHT A;  4KHW A;  4YFU A;  3ZSY A;  4DFP A;  3WUH A;  3VEW A;  1TAU A;  1UWB A;  3NCI A;  1RNH A;  2JGU A;  2QW9 A;  4CCH A;  3T19 A;  2YI1 A;  4H8K A;  4LF4 K;  1ZBU A;  4H4M A;  3A5M C;  4FJG A;  2KQ2 A;  2Y1I A;  4CFA A;  4ID5 A;  4I6M B;  4CJL A;  1J5E K;  4X62 K;  4YOX A;  3DI6 A;  1IKY A;  1B9D A;  1SV5 A;  3S41 A;  1S1V A;  4HWI A;  2WFB A;  5AQN A;  1IG8 A;  3HK2 A;  2E1Y A;  3E66 A;  2ITM A;  3AVI A;  2E5L K;  4CZG A;  2DTU A;  2UUA K;  5C2D A;  4K8Z A;  3SBT A;  4DU3 A;  1VSK A;  3T3F A;  3J7Y P;  5AJ3 K;  3G4S N;  2HNY A;  3S3N A;  3QML A;  3EKU A;  4M7X A;  3QEX A;  5EY4 A;  1R0A A;  4KI4 A;  1YF5 L;  4B3S K;  1HNV A;  4CIE A;  4WF9 L;  2HMI A;  2GEL A;  5BRF A;  4MFB A;  3K5O A;  4FWM A;  5IT9 O;  1NGE A;  1OKJ A;  1UA1 A;  1LW0 A;  2A1S A;  3A5O C;  1RDA A;  4M3U A;  2QWO A;  1WN7 A;  5C2F A;  3DOK A;  4Z4G A;  3K0S A;  5K14 A;  4B9L A;  2P9N A;  3CCS N;  3CCV N;  2HF3 A;  2I7P A;  3IFR A;  1U47 A;  5E26 A;  2HND A;  1SQK A;  4FJ9 A;  2AJQ A;  3U9Z A;  3E9L A;  3BF1 A;  5HL7 L;  4O0I A;  1RBT A;  3BF3 A;  5LMU K;  4ZTJ A;  4JI8 K;  2HVI A;  1N5Y A;  5DMR A;  3HOS A;  4L3Q A;  1YI2 N;  3K58 A;  3K57 A;  4YOW A;  4RW7 A;  1BIZ A;  3N4P A;  2IVP A;  5JVH L;  4CHO A;  4W5O A;  4HUF A;  3SV3 A;  3SUP A;  1XHX A;  3U8X A;  4GKJ K;  1EKE A;  3LAK A;  1TKX A;  5D3G A;  3BUZ B;  3DLK A;  4DUY K;  2OYQ A;  4U67 L;  1ZBL A;  5BRE A;  3E9P A;  3OS2 A;  4AF1 A;  1NGG A;  4BR5 A;  3OY9 A;  4E3S A;  3CI5 A;  3AGK A;  4DF4 A;  1Z25 A;  1XQS C;  3HP9 A;  3VTH A;  4FO0 A;  3SQ2 A;  4B3R K;  1KSP A;  3RMC A;  3PSI A;  1S1X A;  4BDP A;  2HBL A;  3CJC A;  3ID8 A;  1IO2 A;  1DTQ A;  4WCE L;  1RT3 A;  4KH4 A;  1JL1 A;  3ZSV A;  4A2B A;  2WBN A;  3OYN A;  4UY8 O;  1HRH A;  1WUA A;  3A5L C;  4ISF A;  5LL6 Z;  4OPJ A;  2O8B A;  1QZ6 A;  3Q7C A;  5A2Q O;  3NGZ A;  1RT5 A;  1NLV A;  3CM6 A;  2NLX A;  5HRP A;  3T1H K;  3MXJ A;  1JXE A;  1JCE A;  3QET A;  2OPS A;  4A61 A;  3V9Z A;  4CD1 A;  4JI1 K;  3VGL A;  2I5J A;  5AQM A;  3AY9 A;  4Z0U A;  3NVM A;  3GE1 A;  3GOI A;  3I0S A;  4M3W A;  3B6O A;  3O4Q A;  3OYA A;  1NK4 A;  4B9V A;  2P9N B;  4YOY A;  4KTW A;  2XY5 A;  4DR7 K;  4Z4E A;  4M3Z A;  1KAY A;  1MWK A;  1LAW A;  2KFN A;  4CGJ A;  3CQX A;  4RG8 A;  1SL0 A;  4QAG A;  1LW2 A;  2GX9 A;  2QK9 A;  4NLC A;  5AQY A;  5BR9 A;  1Q9X A;  2WOM A;  5EXW A;  3JSM A;  5AQL A;  4IG0 A;  4PKG A;  1QQM A;  4DKW A;  2I7N A;  3CXC M;  1V4S A;  1N6Q A;  2WUS A;  4CEZ A;  4ELT A;  2VWK A;  4DU4 A;  3V6D A;  4PWD A;  1NGD A;  1D9F A;  5AZI A;  4JRP A;  3KJV A;  4EAH D;  4NYN A;  1SAZ A;  1TK0 A;  3EN9 A;  5E41 A;  3TAN A;  1SS6 A;  5J1E A;  4AHU A;  1J54 A;  3TR8 A;  2QWR A;  2HBK A;  4Z4I A;  1YXQ A;  4CGF A;  3CCR N;  3AV9 A;  3AGR A;  1VSM A;  3CHW A;  1GLC G;  5M1P A;  2OAN A;  3K59 A;  3MCP A;  4DU1 A;  3BEX A;  5GAH P;  2Q0R A;  2IC3 A;  4BRE A;  3U3Y A;  1X9J A;  3P31 A;  3FFI A;  3VQ8 A;  5KQD A;  1KRP A;  3AA5 X;  4DFK A;  4HUG A;  2FLO A;  4NLB A;  4C8N A;  4IOA L;  1NOZ A;  2VGN A;  4FJH A;  1KFD A;  4XIU A;  3KK2 A;  4HTU A;  4M7Y A;  2UU9 K;  4CFD A;  4DQQ A;  5C24 A;  5TKY A;  4LFC K;  1QVF M;  3KLE A;  2GEM A;  4BRD A;  2GUI A;  3QNO A;  4DV0 K;  1QZ5 A;  1Y97 A;  2YHY A;  3HL8 A;  2V52 B;  5FDL A;  4JI7 K;  4LF9 K;  1E3M A;  2VQE K;  4A62 A;  3JAM O;  3ZSO A;  3V1O A;  4KI6 A;  2NRH A;  4ISG A;  2XY7 A;  3I33 A;  1HYS A;  4DUZ K;  3PIP L;  1EX4 A;  4A2A A;  1VQ8 N;  4LSL A;  4HHT A;  2F8T A;  1HNW K;  4Y1D A;  1KC8 O;  2GUP A;  4DTU A;  1Y64 A;  2DPN A;  3TAR A;  4H0O A;  4RWT A;  3LL3 A;  4E7H A;  4CE9 A;  5AZI B;  1O13 A;  4DSF A;  3L2R A;  2B5J A;  3EO3 A;  3C7N A;  1G15 A;  3SAH A;  3OYB A;  1OH7 A;  3HPG A;  3HTV A;  2HST A;  3UKU A;  3VPZ A;  3SQ0 A;  1HX1 A;  3O4W A;  1VSF A;  4GV3 A;  3O6W A;  3LZI A;  1K73 O;  4BRC A;  1LWC A;  3R9P A;  4CJK A;  4DTP A;  4KHY A;  3HOT A;  3VQC A;  4W5T A;  3CQ8 A;  5AQQ A;  3U4L A;  1YT3 A;  3IDH A;  1K9M O;  4RW6 A;  3E9O A;  4W5N A;  2ZGY A;  1RT6 A;  3HM8 A;  3DLE A;  4KHP K;  3DXM A;  4B1W B;  1Q86 O;  1WOQ A;  4BG9 A;  2LSN A;  3P5J A;  4DR5 K;  2OPR A;  3G0Z A;  2O8C A;  3HBT A;  4JNE A;  4FWP A;  3NF7 A;  3PUF A;  3CF5 L;  2P9U B;  3DLL L;  1ZYQ A;  3TU5 A;  4FJJ A;  4O44 A;  1IJJ A;  2E20 A;  4AHV A;  3OJU A;  1K8A O;  5BPM A;  4LF5 K;  5KQ8 A;  4CZI A;  1YIJ N;  1JXB A;  3MX2 A;  1NU0 A;  2G8K A;  3J7A P;  3OYM A;  4CEC A;  3MDQ A;  4FJL A;  5FLX O;  3C6A A;  4AHC A;  1YHQ N;  1EXQ A;  1Z26 A;  1NBW A;  3AO2 A;  3J8A A;  2XY6 A;  4OKJ A;  3KIO A;  5JLF A;  3HJF A;  3LWL A;  3MN9 A;  4LH4 A;  4RTF D;  2NRW A;  3HST B;  1I39 A;  4JKF A;  3VES A;  1R59 O;  2B4J A;  5J2N A;  3KK7 A;  2E2P A;  2YHX A;  3CYM A;  3C7N B;  1WSH A;  3EE9 A;  3K9J A;  1S5J A;  2W41 A;  3EL2 A;  4QS9 A;  3VQP A;  3UKU B;  4IG3 A;  4DCH A;  4E7J A;  3VA3 A;  5BRD A;  2ITG A;  2VG5 A;  5AQW A;  4EP4 A;  4M42 A;  3ZX0 A;  2VG6 A;  3CD6 N;  3F73 A;  2UYT A;  4AM6 A;  5CZ2 A;  1VHX A;  3MEG A;  3GG4 A;  1LAV A;  3NDK A;  3SQ4 A;  4LFA K;  3ZSR A;  1JLQ A;  3VF6 A;  3UKR A;  4DV4 K;  1OVY A;  4X64 K;  1BIU A;  2Z1H A;  3LAM A;  1VSL A;  2PZS A;  4DR2 K;  1D5A A;  3VQ5 A;  4F2R A;  3DXM B;  5IWA K;  3O8M A;  3I8D A;  2JWL A;  4KRE A;  4WFB L;  4YDU C;  5CZ1 A;  1NJX A;  2FXU A;  3OJS A;  4JI6 K;  3SLC A;  5KPZ A;  2QA4 N;  5AR0 A;  3V9X A;  3AVN A;  4DFM A;  5B8H A;  1RBR A;  4EIA A;  3FFK B;  3IUC A;  4CZF A;  5BPN A;  1QQC A;  3OYF A;  3M8R A;  1T7P A;  1RTI A;  3OW2 M;  3NF8 A;  4MO5 A;  2PYJ A;  2DFE A;  3JXU A;  3HYF A;  5LMN K;  1KQS M;  3SUO A;  4H0T B;  1NK5 A;  2QKB A;  3AVA A;  2FC0 A;  3H45 C;  5AQZ A;  1VSH A;  4CD3 A;  2CH5 A;  1UA0 A;  1IKV A;  4KB1 A;  4HTL A;  1ASU A;  1BL3 A;  1TKZ A;  4OVL A;  4ISE A;  5FPE A;  3CFR A;  2A41 A;  4IFY A;  3U6F A;  4CZM A;  3EZW A;  1VSE A;  1IH7 A;  2PY5 A;  2ZE2 A;  3DJC A;  4E0D A;  2JWK A;  4B9U A;  1B92 A;  3ZYY X;  3H08 A;  4CGD A;  3EY1 A;  4NCG A;  1Z05 A;  4ZHR A;  3PX4 A;  2GWJ A;  4FWS A;  4B9Q A;  4F3T A;  4H5V A;  4AHS A;  3T7Z A;  3VEN A;  4CI6 A;  4OLA A;  3O3F A;  1C0G A;  5AQR A;  3AVF A;  1HNZ K;  3UKR B;  4CBW A;  3ITH A;  1GOB A;  4DSI A;  4BRM A;  1FXX A;  4NCB A;  3DYA A;  3SV4 A;  4OPH A;  1X9W A;  3OVN A;  4CES A;  1N32 K;  4K0K K;  4DS4 A;  4CJS A;  3OYI A;  3KK3 A;  5KI6 A;  4B9S A;  3HSC A;  2P5G A;  4MQ3 A;  3H46 O;  5AZJ A;  4B1X B;  4GY2 B;  2P9K A;  1F21 A;  3RWU A;  4E1N A;  2CH6 A;  2Z1G A;  4CJ4 A;  5GAE P;  4MLH A;  1QSL A;  3L2V A;  3B8A X;  2BH1 A;  2KFZ A;  3BZC A;  3AVK A;  1U49 A;  3CC7 N;  1A5V A;  4K43 A;  3VQB A;  5CE3 A;  1IBM K;  4FWR A;  2QXF A;  5HBM A;  3WQT A;  4X66 K;  1ASW A;  4LF6 K;  4TSX A;  4Y0W A;  3MAQ A;  4E89 A;  5EX5 A;  3HVT A;  4CZK A;  3MMV A;  4DF8 A;  4OLB A;  1ZBH A;  4DV1 K;  1HPZ A;  4WYB A;  5EVZ A;  2D0B A;  3K5M A;  2FSN A;  1FKP A;  4LH5 A;  3MN6 A;  4MDA A;  4G1Q A;  1CZB A;  4O4G A;  1NK9 A;  3L8B A;  2NZT A;  3T1Y K;  1ZC6 A;  2D1K A;  2WON A;  4EZ6 A;  3CFP A;  1QSS A;  4H03 B;  4MO4 A;  3CJ1 A;  3OBY A;  3SJH A;  4CZH A;  1TYQ A;  4O8U A;  3QBX A;  1ESV A;  1XMQ K;  2QWL A;  4UQG A;  4FZX C;  1VQ7 N;  1QQO A;  1DEJ A;  1ZBS A;  4DTN A;  1D4X A;  3PX0 A;  1J5O A;  3K9K A;  4DV2 K;  4FVU A;  3ENB A;  4CGH A;  4B1V A;  3VF2 A;  4FJK A;  1CZA N;  5LJV A;  4E7I A;  1KAX A;  3DRP A;  3CCL N;  1S72 N;  4CIF A;  4OX9 K;  3VQ4 A;  3OYD A;  4IBN A;  2XO7 A;  3AVH A;  3CMA N;  3FZL A;  5KPT A;  1U2V A;  5DM6 L;  1JLB A;  5AZJ B;  4CJP A;  5F0X A;  4BE1 A;  4BC3 A;  5HOO A;  5C42 A;  2P9K B;  1MDU B;  1SL2 A;  3RRG A;  2NRR A;  2ASO A;  3NHG A;  4C8L A;  3ATV A;  2BUP A;  1S1T A;  2A40 A;  1BOT O;  3VEV A;  4DSJ A;  3AAQ A;  3THW A;  2Q1N A;  3RR8 A;  4Z94 A;  3DAW A;  4KV8 A;  5JS2 A;  1REV A;  1SL1 A;  2D0A A;  3ZT4 A;  3F2K A;  3KZB A;  4IFV A;  1JCG A;  3TPQ A;  2P5O A;  4H0P A;  3LP1 A;  4V19 S;  3A8Y A;  4CBU A;  1JKH A;  4DG1 A;  2OTJ N;  4CHP A;  4BQZ A;  2ZJR L;  4CJQ A;  4ILJ A;  1NKC A;  3AO5 A;  4WQ5 C;  3R8E A;  1RCH A;  1UOC A;  4FLT A;  4LSN A;  1D8Y A;  4BRI A;  5AQH A;  1TKT A;  5AQT A;  5TKW A;  1TYQ B;  1N34 K;  4XEI A;  2IDO A;  3D6R A;  5JIC A;  2YHB A;  2G8I A;  2HHX A;  1S22 A;  3JYT A;  4DV5 K;  2PFU A;  2HHQ A;  4CF0 A;  2ZM6 K;  4FM2 A;  4RW4 A;  3TSP A;  4B9T A;  3CME N;  4FLX A;  4J2E A;  3IS9 A;  1VQO N;  1RDW X;  3L2W A;  2O4I A;  1RFQ A;  1BQN A;  2F8S A;  2KLA A;  4FYD A;  5CHI A;  4FWN A;  4H0X B;  3VA0 A;  2HMP A;  2X6N A;  4N56 A;  1NNE A;  2QEX N;  1U2V B;  3MN5 A;  5HRO A;  1RBV A;  4E7L A;  1RT4 A;  3QER A;  3FGU A;  1LCU A;  1S1W A;  3OYJ A;  4PUO A;  3NH2 A;  2QWN A;  3QO9 A;  4BRP A;  1IBK K;  2HHU A;  3RTV A;  3SNN A;  1BCO A;  4CJ3 A;  4O55 A;  2YNG A;  2BTF A;  3H6E A;  3VEO A;  3THW B;  5FPM A;  5CY4 A;  3QEI A;  3SAG A;  3ENO A;  1BUP A;  3OHR A;  1VQK N;  3VQ6 A;  3SMS A;  5HLF A;  5EOY A;  4JKB A;  3CJ9 A;  1MWM A;  1E4G T;  4BC5 A;  2HHW A;  3OS1 A;  1FKO A;  3CM5 A;  2O8F A;  1RDU A;  3CCE N;  3M8Q A;  2Y1J A;  3I8B A;  2VWJ A;  4IJA A;  3VEY A;  3O5B A;  3FR0 A;  3O80 A;  3WXI A;  1Q9Y A;  2P1J A;  4IOC L;  1QHA A;  4FOE A;  3J81 O;  2JLE A;  4YHH K;  2FBT A;  4PY5 A;  4C8K A;  2NRT A;  1QQN A;  1KD1 O;  3HM9 A;  1Q7Y O;  3V9U A;  1SZ2 A;  3NF9 A;  3SCX A;  2IVN A;  3KD5 E;  1JJ2 M;  3BP8 A;  4K42 A;  3WXK A;  2FBY A;  3P83 D;  1VSI A;  3VTI A;  5C25 A;  4M41 A;  2IOC A;  1NGC A;  3R6M A;  3V1Q A;  4JRQ A;  5JMV A;  3JS6 A;  4XH5 A;  2E4L A;  4JI4 K;  2HOE A;  2O8B B;  3CJA A;  1ATS A;  1X3N A;  4BC2 A;  4BR9 A;  3GDQ A;  1HKG A;  2QI2 A;  2A5X A;  4FZZ A;  3E1Y A;  1DT9 A;  4CEO A;  3OYH A;  2E6L A;  3CPE A;  3MEC A;  3GBT A;  1QVG M;  4IZ9 A;  1XNR K;  2HW3 A;  2G8H A;  4JI2 K;  1XWL A;  1IKX A;  1XC3 A;  4CF8 A;  3THY A;  5H1S Q;  2D0C A;  2W6K A;  3QB0 A;  4FJ8 A;  3QLH A;  1LOT B;  1U04 A;  3S9H A;  1EWR A;  2KZM A;  3O1B A;  3ZT1 A;  1WSG A;  3ZT3 A;  2ZD1 A;  3AAR A;  1NWK A;  3VER A;  3OA9 A;  4N47 A;  5LY3 A;  4KH6 A;  3WNH A;  4ELU A;  4GW6 A;  3N4Q A;  3RMB A;  1WSI A;  4ILH A;  3WNE A;  1CXQ A;  2XRI A;  3QDK A;  1TUY A;  4CK1 A;  1W7A A;  1IV0 A;  3QIO A;  4QCL A;  3EZ5 A;  1NK6 A;  1N33 K;  1U4B A;  2G8U A;  1KLN A;  3EYZ A;  3KLI A;  1NM1 A;  4H5R A;  1RBU A;  5EU7 A;  4CW7 B;  1LWF A;  4M45 A;  3ZSZ A;  5E84 A;  1OVQ A;  3LDQ A;  1CZ9 A;  3L3U A;  2R7Y A;  3FZM A;  4KTQ A;  1BHL A;  4FK0 A;  3MCA B;  3THV A;  2F96 A;  3U3G A;  5AQV A;  4OGC A;  3ZSQ A;  3THX A;  2D0P A;  4JD2 A;  3VQ7 A;  5SWM A;  3DWL A;  3M1F A;  3LZJ A;  4LD0 A;  3PO5 A;  1KVC A;  3OYK A;  3LDL A;  1QS4 A;  3KTQ A;  4FWK A;  4F8R A;  2ZWH A;  2UXB K;  3VN5 A;  4NO7 A;  3VMF B;  5C12 A;  2VYP A;  4H5T A;  3AVL A;  4PA1 A;  3THY B;  2CGL A;  2Z1J A;  4H0V B;  3CIP A;  1DKG D;  4B1U B;  2DFH A;  2OPP A;  3PV8 A;  1VSJ A;  3KLG A;  5AQJ A;  2Q3S A;  4B08 A;  3G6E N;  1TGO A;  4BR2 A;  1ASV A;  5F2R A;  2P51 A;  5GIN A;  3QES A;  3NAE A;  4N76 A;  5I3U A;  4H5W A;  1GLE G;  3LAL A;  2GBZ A;  4FJI A;  2AP1 A;  4DB3 A;  4JI0 K;  1S1U A;  2CGK A;  3SPZ A;  4JS5 A;  2ETJ A;  4DR6 K;  3MXM A;  2IIR A;  4CIG A;  4CHN A;  1WNS A;  3O08 A;  1Q81 O;  4YOT A;  4CHZ A;  1VAZ A;  2A1R A;  3MK6 A;  3BGR A;  2GWK A;  3LP2 A;  4RW9 A;  3VQE A;  4EHT A;  4EP5 A;  4DQI A;  1FK9 A;  3RSE A;  1RTD A;  3E01 A;  4CFC A;  1HJO A;  1A5W A;  3AA4 A;  4JS4 A;  1UAX A;  2EHG A;  3BDP A;  2HB5 A;  4O5B A;  2BDP A;  2W40 A;  2ATQ A;  2VQF K;  1NKE A;  2NRV A;  4BQL A;  1C6V A;  4DMN A;  3KKR A;  4IO8 A;  1HYZ A;  2QXL A;  5M1F A;  1CLQ A;  1YUW A;  1P8Z A;  3WXL A;  4PL7 A;  4FLZ A;  3THX B;  4JD2 B;  3V1R A;  5C10 A;  3IKM A;  4CEB A;  1GLL O;  4JLH A;  1HR0 K; 
#chains in the Genus database with same CATH homology
 1JL1 A;  3ZSV A;  3QNN A;  3VQ9 A;  2RPI A;  3OYN A;  1HRH A;  1HPZ A;  1I3A A;  2KZZ A;  2Z1I A;  4OPJ A;  2QKK A;  2D0B A;  3K5M A;  3DOL A;  3NGZ A;  1FKP A;  1QE1 A;  4LH5 A;  1RT5 A;  2YHA A;  4G1Q A;  3CM6 A;  5HRP A;  3OS0 A;  1CZB A;  4O4G A;  3MXJ A;  1NK9 A;  3LPU A;  1JXE A;  4LY7 A;  4FCY A;  2FBV A;  2OPS A;  3L8B A;  3QET A;  2YV0 X;  4IDK A;  5KGW A;  1D9D A;  4J2D A;  1HNI A;  2WON A;  4CJR A;  3V9Z A;  1A5X A;  3CFP A;  3ZCM A;  4EZ6 A;  1T03 A;  1ITG A;  1QSS A;  1CXU A;  1B9F A;  5FRO A;  3KKS A;  1C0T A;  1BCM A;  2I5J A;  4FLV A;  4Z0U A;  4CJE A;  3I0S A;  4CJV A;  3B6O A;  3ULD A;  3O4Q A;  4B8C A;  4M3W A;  3OYA A;  1QTM A;  1NK4 A;  3SPY A;  4B9V A;  4UQG A;  4KTW A;  2XY5 A;  2G8V A;  4FZX C;  1WLJ A;  3V81 A;  4OKK A;  4Z4E A;  4DSE A;  4DTN A;  4M3Z A;  2YNH A;  3L3V A;  3ZT0 A;  4I7F A;  1LAW A;  3PX0 A;  2B6A A;  1XI1 A;  3C95 A;  3DRS A;  5J2M A;  1S9E A;  2VG7 A;  4ZTF A;  1J5O A;  2KFN A;  1JLG A;  2X74 A;  4CGJ A;  4RG8 A;  1KTQ A;  4CGH A;  1KVA A;  1SL0 A;  4Z4C A;  3RR7 A;  4QAG A;  4DSL A;  4FJK A;  1LW2 A;  4E7I A;  4AIL C;  2QK9 A;  3DRP A;  4FM0 A;  1TK8 A;  4FJ5 A;  4CEA A;  4CIF A;  2WOM A;  1Q9X A;  3JSM A;  4KPY A;  4IG0 A;  3VQ4 A;  3HT3 A;  4C8M A;  3OYD A;  4IBN A;  2XO7 A;  3AVH A;  3LPT A;  3CG7 A;  4FJX A;  1N6Q A;  3RMA A;  4CEZ A;  4ELT A;  3O4N A;  5FRM A;  1JLB A;  4B9N A;  4CJP A;  2VWK A;  4DU4 A;  3V6D A;  4PWD A;  4BE1 A;  3DLR A;  3SI6 A;  3TAQ A;  1D9F A;  2KTQ A;  3AVG A;  4JRP A;  5C42 A;  3KJV A;  4CGG A;  3M8P A;  4Q0B A;  4NYN A;  1SL2 A;  3RRG A;  1S9G A;  4I9L A;  3NHG A;  3PO4 A;  1NJZ A;  1TK0 A;  3I0R A;  4C8L A;  5HRS A;  5E41 A;  3TAN A;  4DWI A;  1S1T A;  4KHQ A;  5J1E A;  4AHU A;  1J54 A;  1RTJ A;  4GVM A;  4DSJ A;  4I9Q A;  3TR8 A;  3NGI A;  1L3U A;  4NCA A;  1IG9 A;  3F9K A;  4Z4I A;  4FW2 A;  3RR8 A;  5CYM A;  4CGF A;  4FLY A;  3KLH A;  3S3M A;  3L2Q A;  4KV8 A;  4KO0 A;  4E7K A;  3AV9 A;  5HRR A;  1VSM A;  4CF2 A;  5JS2 A;  3K59 A;  1REV A;  3HPH A;  1YTU A;  1X9S A;  1SL1 A;  2D0A A;  3ZT4 A;  4B3O A;  4DU1 A;  4Z4H A;  4IFV A;  4DFJ A;  3C6U A;  2P5O A;  2BE2 A;  2YNF A;  4EZ9 A;  3LP1 A;  2IC3 A;  4CHY A;  5I42 A;  4O0J A;  3U3Y A;  4AHR A;  3IG1 A;  1JKH A;  4DG1 A;  4I2P A;  1T05 A;  1HQE A;  4M3Y A;  4CHP A;  1HYV A;  1S6Q A;  3AO4 A;  3FFI A;  1BI4 A;  3ZT2 A;  1TAQ A;  3VQ8 A;  4ELV A;  4CJQ A;  3NFA A;  4BE0 A;  3DLH A;  1WAJ A;  1NKC A;  1EP4 A;  3AO5 A;  1KRP A;  3AA5 X;  1TVR A;  4DFK A;  1RCH A;  4HUG A;  2W42 A;  4C8N A;  1UOC A;  4FLT A;  4FK4 A;  4KHN A;  4LSN A;  1NOZ A;  3AVC A;  4B9M A;  4FJH A;  1KFD A;  4N41 A;  1D8Y A;  4CK2 A;  2RN2 A;  4CJW A;  4XIU A;  3KK2 A;  4HTU A;  1TKT A;  4CFD A;  2IDO A;  1RDD A;  4DQQ A;  1LV5 A;  5C24 A;  3HVR A;  2G8I A;  2YHB A;  3LAN A;  3KLE A;  2HHX A;  1C0U A;  3JYT A;  3MED A;  2GUI A;  3QNO A;  4FK2 A;  2HHQ A;  4CF0 A;  3AA2 A;  3D0P A;  4FM2 A;  3NE6 A;  1Y97 A;  3HL8 A;  2XHB A;  3TI0 A;  5FDL A;  4B8A B;  3T1A A;  4FVM A;  4RW4 A;  4GMJ B;  4B9T A;  1RIL A;  3UIQ A;  4FLX A;  4CGI A;  3ZSO A;  4PQU A;  1VSD A;  3V1O A;  4J2E A;  3IS9 A;  3DLG A;  4KKO A;  4FLW A;  4CEE A;  3SUN A;  1U45 A;  1SKS A;  2XY7 A;  1HYS A;  3L2W A;  2O4I A;  1NKB A;  1EX4 A;  1BQN A;  4FZY A;  4KHS A;  4FXD A;  2F8S A;  4FYD A;  1C1A A;  2DFF A;  3VA0 A;  3SUQ A;  4LSL A;  4HHT A;  1QSY A;  2F8T A;  2NUB A;  4Y1D A;  1KCF A;  1SKR A;  2YKM A;  4KFB A;  4E1M A;  3KLF A;  1KFS A;  1YTA A;  4BAC A;  3AVJ A;  2ZQB A;  2X6N A;  4YNQ A;  1RDC A;  4DTU A;  3TAR A;  3PY8 A;  3DM2 A;  1S6P A;  4N56 A;  1J9A A;  2HHT A;  4Z4F A;  1SUQ A;  5HRO A;  3QEV A;  1RBV A;  4E7H A;  1RT4 A;  4E7L A;  4DTR A;  4FLU A;  4CE9 A;  4WE1 A;  3OYL A;  1RTH A;  4DSF A;  3QER A;  2OZS A;  3L2R A;  3VQD A;  2B5J A;  1S1W A;  3RRH A;  1G15 A;  2OZM A;  3OYJ A;  1WAF A;  2EX3 A;  4PUO A;  3NH2 A;  3OYB A;  3HPG A;  3QO9 A;  3NGY A;  3SQ0 A;  2HHU A;  1GOA A;  4DSK A;  1KVB A;  3HP6 A;  1VSF A;  3RTV A;  3SNN A;  4DLG A;  1BCO A;  3LZI A;  1NK8 A;  4CJ3 A;  4O55 A;  2YNG A;  4Y1C A;  3OYG A;  3NH0 A;  4HCB A;  4R5P A;  1LWC A;  4DTP A;  4CJK A;  4KHY A;  3DMJ A;  3VQC A;  2YNI A;  4AH9 A;  5SZT A;  4W5T A;  3CQ8 A;  1VRT A;  4CEQ A;  3C6T A;  5CY4 A;  3QEI A;  1YT3 A;  1T8E A;  1W9H A;  2GV9 A;  3ZSW A;  4DTJ A;  3VQ6 A;  3TAP A;  4RW6 A;  2OA8 A;  2BAN A;  2G8F A;  5HLF A;  4W5N A;  2XY8 A;  1RT6 A;  3AA3 A;  1K6Y A;  1Q8I A;  1WSJ A;  3CFO A;  1IKW A;  3DLE A;  1L5U A;  4E19 A;  2HHW A;  3RMD A;  1BGX T;  1FKO A;  3AO1 A;  3OS1 A;  3CM5 A;  4OLB A;  1BI4 B;  2YKN A;  3M8Q A;  2Y1J A;  4F2S A;  3ALY A;  4CER A;  1L3S A;  4HCC A;  1JLF A;  2LSN A;  4OJR A;  3P5J A;  2VWJ A;  3M8S A;  3B6P A;  2OPR A;  3G0Z A;  4FW1 A;  4NCB A;  1Q9Y A;  3AVB A;  2BGG A;  1JL2 A;  2P1J A;  1ZBF A;  2D5R A;  2E6M A;  4FJN A;  3TWH A;  3NF7 A;  1EET A;  3QIN A;  1VK0 A;  3PUF A;  1RT7 A;  2JLE A;  2FBT A;  4PY5 A;  4C8K A;  3P1G A;  5JS1 A;  1ZYQ A;  2FBX A;  4C8O A;  4FJJ A;  4O44 A;  4AHV A;  3OJU A;  3NF6 A;  3HM9 A;  3V9U A;  1KLM A;  3NF9 A;  4CED A;  3V4I A;  3SCX A;  5J2Q A;  1HQU A;  3KD5 E;  1JXB A;  2FBY A;  3P83 D;  1RDB A;  1VSI A;  4OKE A;  3OYM A;  2G8K A;  2PYL A;  4CEC A;  3QEW A;  5C25 A;  4FJL A;  4ICL A;  4I2Q A;  2HHS A;  4M41 A;  4AHC A;  2IOC A;  1EXQ A;  1Z26 A;  3V1Q A;  4JRQ A;  3QEP A;  3AO2 A;  3SYZ A;  2E4L A;  2XY6 A;  4OKJ A;  3TAF A;  1DTT A;  3KIO A;  4DQR A;  4DQS A;  3HJF A;  4K8X A;  3D45 A;  4CK3 A;  5T7B A;  2IS3 A;  3K2P A;  4LH4 A;  4CFB A;  3LWL A;  3PX6 A;  3IAY A;  1LWE A;  2IGI A;  2RKI A;  3HPO A;  4CJF A;  1TL1 A;  4BWJ A;  4FZZ A;  3NBP A;  5KGX A;  3HST B;  1HJR A;  4CEO A;  1I39 A;  1WSF A;  3AVM A;  3OYH A;  4FM1 A;  4DTS A;  5J2P A;  2B4J A;  5J2N A;  4L8R B;  2E6L A;  1NK7 A;  4KAZ A;  3CYM A;  2RF2 A;  4J2A A;  5FRN A;  3MEC A;  1WSH A;  4M3R A;  4KTZ A;  3KK1 A;  1S5J A;  4RW8 A;  1NJY A;  3MEE A;  1X1P A;  3NH1 A;  3VQP A;  3SZ2 A;  4IKF A;  2HW3 A;  4IG3 A;  4E7J A;  3VA3 A;  2G8H A;  1XWL A;  2HHV A;  1IKX A;  4CF8 A;  3O3H A;  2G8W A;  1C0M A;  2D0C A;  4Q5V A;  4W5Q A;  5HRN A;  3S3O A;  5KRS A;  4DQP A;  4FJ8 A;  1JLA A;  2ITG A;  2VG5 A;  3SJJ A;  1L3T A;  3QLH A;  4NYF A;  4FJ7 A;  4CJT A;  4EP4 A;  1U04 A;  3OYC A;  3G10 A;  1RT2 A;  3S9H A;  2VG6 A;  3ZT1 A;  4M42 A;  2KZM A;  1WSG A;  3ZT3 A;  2X78 A;  3F73 A;  3AO3 A;  5CZ2 A;  3ISN C;  2ZD1 A;  1X9M A;  1RBS A;  3MEG A;  1LAV A;  3LP0 A;  2X6S A;  4BWM A;  3NDK A;  3SQ4 A;  4CF9 A;  4HUE A;  3ZSR A;  1JLQ A;  4QOZ B;  4F3O A;  1VRU A;  3HO1 A;  1ZBI A;  1BIU A;  2Z1H A;  3LAM A;  4N47 A;  1VSL A;  3K5L A;  1XHZ A;  2PZS A;  1D5A A;  3VQ5 A;  4AHT A;  4BE2 A;  4F2R A;  4KHW A;  4YFU A;  3WNH A;  3ZSY A;  4GW6 A;  4ELU A;  3I8D A;  3QIP A;  4DFP A;  4KRE A;  3RMB A;  1WSI A;  4OGE A;  5CZ1 A;  3WNE A;  4DTX A;  1CXQ A;  1NJX A;  1HMV A;  2XRI A;  3OJS A;  1TAU A;  1UWB A;  3NCI A;  4CK1 A;  1RNH A;  2JGU A;  3V9X A;  4CCH A;  3AVN A;  3T19 A;  4CJ5 A;  3QIO A;  1MU2 A;  1NJW A;  4H8K A;  3EZ5 A;  1NK6 A;  4QCL A;  1ZBU A;  2O4G A;  4H4M A;  1U4B A;  4DFM A;  1RBR A;  2G8U A;  1KLN A;  4FJG A;  4CEF A;  1QQC A;  2KQ2 A;  3LP3 A;  3OYF A;  3EYZ A;  4DLE A;  2Y1I A;  3M8R A;  3KLI A;  2OPQ A;  1T7P A;  1RBU A;  5EU7 A;  4CFA A;  1LWF A;  4ID5 A;  4M45 A;  1RTI A;  3ZSZ A;  4M3X A;  4CJL A;  4W5R A;  1U48 A;  3NF8 A;  2PYJ A;  2DFE A;  2DY4 A;  1CZ9 A;  3DRR A;  3HYF A;  3DI6 A;  3L3U A;  2R7Y A;  3OYE A;  1C1C A;  4KTQ A;  1JLC A;  3SUO A;  1IKY A;  1B9D A;  1NK0 A;  1SV5 A;  1S1V A;  1NK5 A;  2QKB A;  3AVA A;  1BHL A;  1C1B A;  1BIS A;  2FC0 A;  4H4O A;  1TKD A;  4FK0 A;  3HK2 A;  3THV A;  2F96 A;  1VSH A;  3TAE A;  3U3G A;  3VQQ A;  3AVI A;  4OGC A;  1IKV A;  3ZSQ A;  1UA0 A;  4KB1 A;  2DTU A;  3VQ7 A;  5SWM A;  1ASU A;  1BL3 A;  1TKZ A;  4K8Z A;  4OVL A;  4DU3 A;  1VSK A;  3T3F A;  3CFR A;  4IFY A;  3U6F A;  1TV6 A;  3SQ1 A;  3LZJ A;  4LD0 A;  3PO5 A;  4DTM A;  1KVC A;  4HVJ A;  3OYK A;  2KW4 A;  2HNY A;  3S3N A;  1VSE A;  1QS4 A;  3KTQ A;  3LDS A;  1IH7 A;  2PY5 A;  3QEX A;  3TAG A;  1R0A A;  2ZE2 A;  4F8R A;  3DLB A;  4KI4 A;  4M3T A;  1HNV A;  3VN5 A;  4CIE A;  2HMI A;  4E0D A;  4B9U A;  4MFB A;  4BDZ A;  3K5O A;  1B92 A;  1TL3 A;  4FJM A;  4KB0 A;  3H08 A;  3AVL A;  4PA1 A;  4CGD A;  1LW0 A;  2A1S A;  4ID1 A;  4NCG A;  4ZHR A;  3EY1 A;  1RDA A;  4DTO A;  1UA1 A;  1TK5 A;  2Z1J A;  5KRT A;  4M3U A;  3PX4 A;  1WN7 A;  4OPK A;  5KTQ A;  3KD1 E;  3DOK A;  2DFH A;  2HNZ A;  4F3T A;  4Z4G A;  4AHS A;  2OPP A;  3PV8 A;  1VSJ A;  1SKW A;  3KLG A;  2Q3S A;  4B08 A;  5DK5 A;  5K14 A;  4B9L A;  4CHQ A;  3L2U A;  4KHU A;  3LWM A;  1GOC A;  4KI6 A;  4OLA A;  5CYQ A;  1TGO A;  3O3F A;  1ASV A;  1YVU A;  4CF1 A;  2P51 A;  3IRX A;  2IAJ A;  3MXI A;  3QES A;  3AVF A;  1U47 A;  3VQA A;  3ITH A;  1GOB A;  1NOY A;  1BQM A;  2HND A;  3NAE A;  5I3U A;  4DSI A;  4J2B A;  1FXX A;  4N76 A;  3DYA A;  2GBZ A;  3LAL A;  3SV4 A;  4FJI A;  4FJ9 A;  1S1U A;  3V9S A;  1X9W A;  3A2F A;  2AJQ A;  3OVN A;  4N5S A;  1L3V A;  3K5N A;  4KRF A;  4CES A;  4DS5 A;  4DS4 A;  4O0I A;  1W0H A;  4CJS A;  1RBT A;  3OYI A;  4JS5 A;  3KK3 A;  5HP1 A;  3SPZ A;  4ZTJ A;  2HVI A;  3TAB A;  2ETJ A;  5KI6 A;  4B9S A;  3MXM A;  2P5G A;  4CIG A;  3O3G A;  4MQ3 A;  5DMR A;  4CHN A;  3HXM A;  1N5Y A;  1WNS A;  4CHZ A;  4F4K A;  3K58 A;  1WSE A;  3BGR A;  3K57 A;  3LP2 A;  4RW9 A;  2A1R A;  3VQE A;  4RW7 A;  1BIZ A;  1DLO A;  3TAM A;  1FK9 A;  4EP5 A;  4DQI A;  4CHO A;  4W5O A;  4HUF A;  3SV3 A;  3SUP A;  1F21 A;  1XHX A;  1JLE A;  3V9W A;  3RWU A;  1EKE A;  4E1N A;  3LAK A;  1TKX A;  3E01 A;  1RTD A;  2Z1G A;  3C94 A;  5D3G A;  3DLK A;  4CJ4 A;  2OYQ A;  4CFC A;  1QSL A;  3ZSX A;  1A5W A;  3AA4 A;  3L2V A;  4JS4 A;  1J53 A;  1UAX A;  2EHG A;  1ZBL A;  1XC9 A;  3BDP A;  2HB5 A;  4O5B A;  2KFZ A;  2BDP A;  3AVK A;  1U49 A;  4CJU A;  3OS2 A;  2ATQ A;  3OY9 A;  1A5V A;  1RT1 A;  1NKE A;  3VQB A;  1C6V A;  4E3S A;  4DMN A;  3KKR A;  4DF4 A;  1HYZ A;  1Z25 A;  2QXF A;  3HP9 A;  5HBM A;  3SQ2 A;  1O1W A;  3WNG A;  1CLQ A;  1ASW A;  1KSP A;  4FLZ A;  1QHT A;  4TSX A;  3WNF A;  3MAQ A;  3RMC A;  1S1X A;  4E89 A;  3V1R A;  4BDP A;  3HVT A;  4CEB A;  4BDY A;  2HVH A;  3ASM A;  4DF8 A;  1IO2 A;  4JLH A;  1DTQ A;  1RT3 A;  1ZBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...