4CF2A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf2A00
2XY5A 5C42A 1SKRA 3VQ5A 3V1RA 4M3XA 2HHSA 3OJSA 4KI4A 3L3UA 4F3OA 3V9UA 3LP3A 4O4GA 3OS2A 1L3VA 4F2SA 2G8KA 5CYQA 3T3FA 1LW2A 3KIOA 3T19A 4GW6A 2X78A 1DLOA 3NAEA 1TL3A 2Q3SA 4OVLA 4RW6A 4DQIA 4DMNA 4KHWA 1D9FA 4K8ZA 4FCYA 1S9GA 3NDKA 3AO1A 2B4JA 4CJQA 3ZSZA 5I42A 1RTJA 3MXJA 4DFJA 1D9DA 3VQPA 4DFKA 3TANA 2P5GA 1WSJA 4FJ7A 2F8SA 1IKVA 3NE6A 1XI1A 3PO4A 3PX4A 2HNZA 4CJTA 2GBZA 1JL1A 3NHGA 1IO2A 1BHLA 1BQMA 4FK4A 4KV8A 2LSNA 4LSLA 3V6DA 3KD5E 5DMRA 3C6UA 4B3OA 4F3TA 2YNIA 3ZSQA 3U3GA 4CEEA 1NJYA 4FLUA 3S3OA 3WNGA 2B6AA 2ITGA 4LH5A 3ALYA 3VQ8A 3RRHA 4EZ6A 1DTQA 1RT6A 4CJUA 4XIUA 2Y1IA 4QCLA 1RDDA 4KRFA 4DLEA 1U48A 2G8UA 4DTSA 2KW4A 4CERA 3HK2A 3NFAA 2RN2A 2PZSA 4CK2A 2OZSA 1NOZA 4TSXA 2GUIA 3KKSA 4HUFA 3BDPA 4W5NA 5J2QA 3U3YA 4CFDA 4FK0A 4I9LA 4DS5A 2IOCA 1VSHA 2EHGA 3UIQA 2RKIA 3S3NA 1T03A 4FW1A 3HP9A 1TGOA 3ZT4A 1EX4A 4E19A 1SL2A 3PX6A 3KK1A 3OYGA 4CHQA 3VQ4A 3ZT0A 4DF8A 3OYBA 3SQ2A 2VWKA 3AVCA 1WSEA 3M8SA 2HHWA 4BWJA 1UOCA 3AO2A 3AVIA 3TAMA 2KZMA 1A5VA 3PUFA 3JSMA 3DLHA 4B9LA 3K2PA 4IFVA 3DRRA 3DLKA 4H4OA 4KO0A 4FW2A 3LWMA 1RBUA 1NJWA 5HRRA 3DOKA 2JLEA 4CK3A 1ZBFA 1RT3A 3AVAA 1SL1A 4O44A 3V9WA 2Z1HA 4N5SA 2DY4A 3OYHA 1NK6A 4I9QA 4AH9A 4OLAA 1XHZA 4O0IA 4Z4IA 3AVJA 1HYZA 4C8KA 3AO4A 5HBMA 1JXEA 2ETJA 4KTWA 3TABA 4CGJA 4E7JA 4KHSA 4FJKA 4B08A 4KPYA 1ZBHA 4CESA 3KKRA 4IG0A 3P5JA 4DTRA 4IFYA 4DTNA 3KLHA 1NK0A 4FJXA 4CF0A 3VQBA 2F96A 1HNIA 3KLIA 4CEDA 4FLVA 3E01A 1D5AA 4CJFA 3CQ8A 5HLFA 1YTUA 3OYEA 3QEPA 1BL3A 2R7YA 1TKXA 1BISA 3IAYA 1C0MA 2RPIA 3SV4A 1X9MA 1HPZA 1Z25A 3ITHA 4C8OA 2D0BA 4RW4A 3OYFA 4E7KA 4FJIA 3V9ZA 4YNQA 4Z4EA 4NYNA 4ID1A 3WNFA 1S1VA 4JRPA 3V4IA 3RR8A 4KHYA 2HVHA 3RMAA 1FKPA 2HHVA 4I2QA 2KFNA 3F73A 3F9KA 4DTMA 4FJGA 4H8KA 1S1XA 4FM0A 2E4LA 1TKZA 4DSKA 4KB1A 1RCHA 1SV5A 4Z4CA 2VWJA 3LZIA 3LP2A 3QEWA 4ZTJA 1J9AA 1X9SA 2YNFA 3L8BA 1KFDA 4DTUA 4WE1A 4CJVA 1RTIA 3VQ6A 4FM1A 3TAPA 1KRPA 4J2DA 4CEZA 4FYDA 4FM2A 4DTPA 3ZSXA 4E7LA 3ZT1A 1A5XA 3DM2A 2IC3A 4DQPA 3ZSWA 3DLRA 3OYIA 4KTQA 4DWIA 4AHRA 1RDAA 1ITGA 4KHQA 3L2QA 3SI6A 2I5JA 3WNEA 4AILC 4CJLA 3PO5A 5JS1A 4MQ3A 2OPSA 4AHSA 3NGYA 5FRMA 4FK2A 1UAXA 4RW8A 1JKHA 1U49A 2AJQA 4EP5A 4HVJA 2PYLA 2IS3A 3CFRA 1CXUA 3HT3A 4J2AA 4CJ5A 4UQGA 4W5QA 3OYMA 4M3RA 5I3UA 4FJJA 1C1CA 1RBTA 4FLZA 1CLQA 5CYMA 4YFUA 5KI6A 4Y1DA 4Q5VA 3NGZA 4RW9A 4J2EA 2QK9A 1JLCA 1BIUA 5SWMA 3C95A 3O3HA 3KK2A 3C94A 2YNGA 3HSTB 4QAGA 5HRSA 3K5MA 3V9SA 1L5UA 2JGUA 1W9HA 4I2PA 1TL1A 1EKEA 3QIPA 1I3AA 1XC9A 2KFZA 1HQEA 3CYMA 4CF1A 3KLGA 2P5OA 3LWLA 1JL2A 1T8EA 1N6QA 3OYLA 4DTOA 4ELUA 3C6TA 3ISNC 3QETA 4PQUA 1IKWA 3RMCA 1EXQA 3NF6A 3H08A 1C0TA 4CJRA 4IBNA 4OJRA 4CEQA 3SCXA 3P83D 4W5OA 3OY9A 4CEAA 2XY7A 3AA4A 1QTMA 3AVFA 4EZ9A 1QSLA 1RDCA 5KRTA 1VRTA 3FFIA 1G15A 3OYCA 4Z4GA 1TVRA 1HNVA 1O1WA 4JRQA 3SNNA 1LV5A 1LAVA 1YT3A 1ZBUA 3MEGA 2PYJA 1SKWA 1X1PA 4DFMA 4CJWA 3KD1E 4O0JA 3O3GA 1S1UA 1S1TA 1YTAA 2ZE2A 3VQDA 3VQAA 1JLGA 2D0CA 3THVA 3HPHA 3QLHA 2GV9A 3NF9A 5J2MA 2QXFA 2FBXA 2O4GA 3DOLA 4KB0A 3SUNA 3ASMA 5CZ1A 5E41A 1HYVA 1S6PA 2KQ2A 4KKOA 3HXMA 4BE2A 3U6FA 3DI6A 4G1QA 3LDSA 3PX0A 1RTDA 4DSJA 1FXXA 2VG5A 4FLXA 1QE1A 1NKCA 4M42A 3AO3A 4KFBA 4L8RB 3V1OA 4HCBA 4PUOA 3BGRA 1HQUA 1RBSA 5HRNA 3MECA 4AHCA 3VA0A 2X74A 4B8CA 1HJRA 2Z1GA 3PV8A 1JLAA 1BCMA 4LH4A 1KVAA 4W5RA 4B9VA 1WN7A 2WONA 4BDZA 3NF8A 1ASUA 3RRGA 1L3TA 4FJNA 4E89A 4GVMA 4CJPA 2IGIA 3L2VA 3JYTA 4AHVA 4BE1A 2HW3A 3IRXA 2B5JA 2E6MA 3I8DA 4NCAA 3QESA 1KLNA 1KFSA 2NUBA 5DK5A 3AVNA 4M45A 3D0PA 4N56A 3LANA 1N5YA 4ELTA 4CFAA 3DLGA 4CF2A 3OS1A 1WSFA 1UA1A 5EU7A 3EY1A 3VA3A 4F8RA 2HMIA 3ZT3A 4N76A 5D3GA 3CM6A 4N47A 1KVBA 4LD0A 5J1EA 3PY8A 3NBPA 2XHBA 2DFFA 4KHUA 1QSSA 4HUGA 1VK0A 3CFOA 1ASVA 2FBVA 1RT7A 3O4NA 2YKMA 3TAEA 1SUQA 1YVUA 1TV6A 1TAQA 4O55A 4FLYA 1S6QA 3IS9A 4QOZB 1UA0A 2E6LA 4IDKA 4O5BA 3NF7A 1RT4A 2G8FA 1IKXA 4N41A 1U4BA 1HRHA 4CGHA 1IKYA 4BWMA 3VQ7A 1RBVA 2IAJA 2RF2A 3AA5X 3OVNA 3ZSVA 1FK9A 3LAKA 1D8YA 2G8HA 3NH1A 4OPJA 4KTZA 2HB5A 3K5OA 1IH7A 3SUOA 3LAMA 1L3SA 4E3SA 3NCIA 4FJ9A 3AA3A 5K14A 4JS4A 4BACA 5T7BA 4BDPA 5FROA 3L2RA 4M3TA 4CEBA 3K5NA 3SJJA 1J5OA 2IDOA 3LP1A 5KGWA 4C8MA 3A2FA 4AHUA 1TKTA 1L3UA 4KI6A 1BCOA 1BI4B 1VSFA 4Y1CA 1W0HA 2KZZA 3TR8A 1WSGA 1TK8A 1UWBA 4CIFA 4ID5A 2DFEA 4DF4A 3HYFA 1Z26A 3AV9A 4AHTA 2BGGA 1WSIA 2ZQBA 1KTQA 1WAFA 3WNHA 1RTHA 3DLEA 1DTTA 4CE9A 3HP6A 3NGIA 3TAGA 1NJXA 3KTQA 2D0AA 5SZTA 3RMBA 4FZYA 1QS4A 4CGFA 3SUPA 4ZTFA 3ZT2A 1ASWA 3L2UA 1U04A 2X6SA 2A1RA 1B92A 3HPOA 4LSNA 4CHOA 2G8WA 3EYZA 1NK4A 3HM9A 3QNOA 4NCGA 1WNSA 3M8RA 3RR7A 4F4KA 1VSLA 2D5RA 1FKOA 3AA2A 3K5LA 1T7PA 1RNHA 1JXBA 1I39A 3AVGA 4K8XA 4CJSA 3SV3A 2DTUA 3O3FA 4FJMA 4E0DA 3DLBA 3KJVA 1TKDA 2F8TA 3QEVA 4M41A 1B9DA 3V1QA 4E7HA 5CZ2A 4M3ZA 2Y1JA 4E7IA 3O4QA 3V9XA 4CJ3A 3HVRA 1NKEA 3QNNA 3RWUA 2P1JA 1BQNA 4KREA 5KTQA 5C25A 3NH2A 1SL0A 4B9SA 3HPGA 3ZSYA 2WOMA 4PWDA 4CFCA 1Q9XA 4FJ5A 4I7FA 3DRSA 3AVHA 3DYAA 3QIOA 3SZ2A 3HL8A 3SPYA 4DQSA 4FJ8A 1C0UA 1LWFA 1MU2A 4JLHA 1RBRA 4Z4HA 4DU4A 3TAFA 3MEEA 1LWCA 5J2NA 2P51A 3K59A 1NK5A 2YV0X 3OYJA 2FC0A 2XY8A 3AO5A 3QINA 4CGGA 4DQQA 4CJ4A 1ZBLA 4CCHA 3I0SA 4RW7A 2A1SA 4CIEA 3K58A 4KAZA 1QHTA 3RTVA 1WAJA 4HCCA 5FDLA 4HTUA 4CJKA 1TAUA 1BGXT 3KLFA 1NKBA 1QQCA 1XWLA 2YNHA 4DU3A 1TK0A 1NOYA 5C24A 4JS5A 3MXIA 2HHUA 4CHPA 1IG9A 4B9UA 4DSEA 1Q9YA 4DSLA 3G0ZA 1BI4A 4OKKA 3DRPA 4BE0A 4F2RA 1ZYQA 3MEDA 3RMDA 1VSDA 3B6PA 3AVLA 1CZ9A 3QEXA 1LWEA 4CGDA 3AVMA 4HHTA 2ZD1A 1KCFA 1VSJA 4CGIA 4M3YA 2HHXA 3M8QA 3V81A 3SPZA 3B6OA 1K6YA 2OZMA 3OYAA 1RDBA 1NJZA 4ELVA 2KTQA 4DFPA 2EX3A 1R0AA 2BE2A 3OYNA 1VRUA 3S9HA 4DSFA 1HYSA 1NK8A 4IKFA 4OPKA 3VQCA 4FLTA 4PA1A 4RG8A 3OYDA 1QSYA 1X9WA 4CIGA 5J2PA 3I0RA 4DSIA 1J53A 3L3VA 4KHNA 3K57A 1JLQA 3IG1A 3OS0A 3CFPA 4DS4A 3SQ1A 4FZZA 2OYQA 4Q0BA 3TAQA 2G8VA 3HJFA 4PY5A 4GMJB 2DFHA 1B9FA 3LP0A 1JLEA 1CXQA 3SQ4A 4FZXC 3HVTA 2ATQA 4NCBA 4FXDA 4CECA 1A5WA 4OGEA 3S3MA 4CEOA 4C8NA 2YHBA 4OGCA 4CHZA 4CK1A 4EP4A 3VQ9A 4M3WA 3HO1A 4B9TA 3SYZA 5CY4A 2XRIA 2X6NA 4OKEA 4E1MA 2XY6A 2Z1JA 1T05A 1S9EA 2VG6A 4DLGA 1RT1A 2HNYA 5FRNA 2HHQA 3L2WA 1GOCA 1Q8IA 1REVA 1VSEA 2FBYA 3AVBA 4CF9A 3KLEA 1LW0A 4FJHA 3TARA 3M8PA 1C6VA 4CFBA 5HROA 4CHYA 4DTJA 3OYKA 2HVIA 3LALA 2G8IA 4CEFA 1VSIA 4CJEA 1TK5A 3T1AA 4Z0UA 3SUQA 4B9NA 2OA8A 1NK9A 3VN5A 3ZCMA 4Z4FA 4IG3A 1WLJA 1C1BA 1F21A 1BIZA 4FJLA 1GOBA 3QO9A 4H4MA 4W5TA 3SQ0A 1JLFA 2VG7A 3MAQA 4OLBA 2FBTA 2QKKA 3MXMA 1U45A 4B8AB 2PY5A 5KRSA 4FVMA 3G10A 4CHNA 1KVCA 3ULDA 3EZ5A 4FLWA 5JS2A 1GOAA 4ZHRA 1RT5A 3LPTA 1XHXA 1U47A 5HRPA 4M3UA 2YKNA 4NYFA 1KSPA 3LPUA 4LY7A 4E1NA 2OPRA 2Z1IA 4MFBA 2YHAA 1Y97A 1C1AA 4DTXA 1EETA 3P1GA 1S5JA 3TWHA 3NH0A 3TI0A 1J54A 2O4IA 4OKJA 4HUEA 1KLMA 1RT2A 1VSMA 3VQQA 2QKBA 3KK3A 3ZSRA 1LAWA 4DG1A 4J2BA 1SKSA 4R5PA 4DU1A 3D45A 2HHTA 1WSHA 1RILA 3OJUA 4C8LA 3AVKA 2OPQA 3ZSOA 2W42A 4BDYA 1NK7A 4B9MA 3QERA 1CZBA 2XO7A 1HMVA 5HP1A 3VQEA 2OPPA 1S1WA 2HNDA 1EP4A 2BANA 3CG7A 4ICLA 4DQRA 3QEIA 5KGXA 1JLBA 3LZJA 2BDPA 1ZBIA 3CM5A 4CF8A 1VSKA 3DMJA
chains in the Genus database with same CATH superfamily
3WEEA 4F3OA 3V9UA 3T3FA 3KIOA 3E9PA 3E9OA 3OW2M 4RW6A 4DMNA 4KHWA 4K8ZA 3AO1A 4CBWA 4CJQA 5GAEP 5I42A 1D9DA 2QWPA 1NWKA 3P39A 3TANA 3NE6A 4LC9B 2IVOA 5AZJB 1JL1A 2WTUA 3NHGA 1IO2A 1SAZA 2NRRA 4BREA 2YNIA 3U3GA 3WNGA 3BZKA 4A57A 3CD6N 1YVNA 3PLAA 4XIUA 2Y1IA 1K8KA 4QCLA 5BR9A 4LFAK 3NFAA 2RN2A 1IV0A 2OZSA 4TSXA 4W5NA 5J2QA 4CFDA 3MK6A 2NRVA 1T03A 4DKWA 1DKGD 4BRIA 1TGOA 1HLUA 1EX4A 3PX6A 3TAMA 2KZMA 1A5VA 3PUFA 3DLHA 4B9LA 1K8AO 5GINA 5M1PA 3G4SN 4FW2A 5HRRA 1RT3A 3TU5A 1SL1A 4O5FA 3UKRB 1VQPN 1VQ8N 3CC4N 1V4TA 4FPBA 1VQ9N 2D0OA 3SAGA 2ITMA 4Z4IA 4C8KA 4JV5K 3AO4A 1KXPA 4KHSA 4B08A 1ZBHA 2CH5A 1DT9A 5AQJA 4CESA 4FSVA 4DTRA 4DTNA 3KLHA 4WYBA 3VQBA 2F96A 3BUZB 4CEDA 3EKSA 1D5AA 1ATNA 5BPLA 1TKXA 3IAYA 3SV4A 5AQRA 3K9JA 1YITN 1Z25A 3ITHA 4E7KA 4Z4EA 2HHVA 2KFNA 1FKPA 4DTMA 5AQFA 2VCPA 1TKZA 5ADXA 4Z4CA 3QEWA 4ZTJA 3C7NB 3CCRN 4BRQA 4FM1A 4ILGB 1WB9A 4DTPA 3ZT1A 3DM2A 3VEOA 3DLRA 3OYIA 2QTDA 3H6EA 3RVCA 3L2QA 3UKUB 4AILC 4AHSA 3U9DA 4EP5A 3CJ7A 2IS3A 3CFRA 4B3TK 3ZYYX 3O9SA 2A5XA 3DWLA 4W5QA 3OYMA 4FJJA 4IFEA 4YFUA 4Q5VA 4Y1DA 5SWMA 3RWUA 1RDUA 2YNGA 3C94A 4QAGA 3DXKA 4RWTA 2JGUA 3Q7BA 4A62A 1NMNA 3CYMA 3O4WA 3H1VX 5BRHA 1JL2A 2P5OA 1N6QA 4DTOA 4ELUA 3PIOL 4CEQA 4W5OA 3TTFA 4CEAA 3JXUA 1RDCA 4XH5A 1G15A 3OYCA 1EO1A 1HNVA 3DLLL 4MDAA 1LAVA 3MEGA 3CJAA 3ENBA 2PYJA 4C1NI 3N4QA 5DM7L 3O3GA 2O8DB 1S1TA 2ZE2A 5JLFA 4KBOA 1JLGA 4JN4A 1N33K 3HPHA 1K73O 3CCVN 2GV9A 4XH4A 3NF9A 5J2MA 3C65A 1G99A 2P9LB 1XC3A 3D2EB 3LDLA 1S6PA 4KKOA 4JKCA 4DV6K 3GDQA 4G1QA 1RTDA 1NKCA 3V1OA 4PUOA 1HPMA 3BGRA 1HQUA 5JICA 2X74A 3J7AP 1HJRA 2Z1GA 3FGUA 4LH4A 4WQ5A 3NF8A 3EO3A 4CJPA 2IGIA 5F1XA 2QEXN 3G6EN 3QESA 2NUBA 5M1FA 3DLGA 4JHDA 3ULEA 4CF2A 4PKHA 3MWTA 4ISEA 1Z6RA 4H0OA 4N47A 4LD0A 5J1EA 3PY8A 4YORA 2XHBA 2DFFA 3CFOA 3CCQN 3E66A 1ASVA 1T6DA 5JLHA 4R79A 1S6QA 1BO5O 1UA0A 4O5BA 5AQPA 4EFHA 1IKXA 2G8FA 4Z94A 1U4BA 2E2OA 4IO8A 1IKYA 4BVOA 2RF2A 3ZSVA 1FK9A 3JAMO 2P9PA 1D8YA 3NH1A 4OPJA 3I55N 4KTZA 2HB5A 3K5OA 5FPNA 3SUOA 5C0YA 2BTFA 4B1XB 1NGEA 5E84A 3K5NA 3VF6A 3LP1A 4AHUA 5IWAK 1ZBSA 4H03B 2F4VK 1BI4B 1VSFA 1W0HA 1SS6A 1UWBA 5AQLA 1OH7A 4H0PA 3HYFA 4JAXA 3AV9A 5AQYA 1WAFA 1DTTA 4CGFA 2F7TA 3SUPA 4H0VB 4LF9K 1U04A 3HM9A 4QS8A 4NCGA 3THXB 3M8RA 2V52B 3RSEA 3AA2A 3K5LA 4OPAA 3AVGA 1I39A 4JK9A 3SV3A 3O3FA 3IMXA 5KPTA 1YHQN 1TKDA 3GL1A 3QEVA 5CZ2A 4QS7A 3HVRA 4KREA 3QNNA 2P1JA 1BQNA 4LFCK 1SL0A 4YOXA 4I7FA 2E8AA 2UUCK 1NBWA 3SPYA 4PHTX 4X62K 3CF5L 3H3NO 4Z4HA 4ISFA 3MEEA 3K59A 4BRMA 1C0GA 3GE1A 4DQQA 4RW7A 1HKBA 1TAUA 4DV7K 1BUPA 3KLFA 1TK0A 5C24A 3MXIA 2QWNA 3AARA 4OKKA 5LMUK 3MEDA 4OX9K 5BN8A 5AQSA 4DR6K 3Q7CA 4JKBA 3A0IX 3V81A 1RDBA 5KPZA 2EX3A 3S9HA 4DSFA 4OPKA 1JCGA 2ZJRL 2PFUA 3CERA 4PA1A 1QSYA 4FVUA 4JKGB 5GIOA 1TYQA 2E5LK 3L3VA 4BRFA 1JLQA 3IG1A 3OS0A 3SQ1A 4A5AA 3HJFA 4JI1K 3THYA 4GMJB 4CZMA 3LP0A 1CXQA 3HM8A 2OCEA 2ATQA 1VQON 1A5WA 3S3MA 3K9KA 4CK1A 3HO1A 4EP4A 4BR0A 2QWMA 2XY6A 4JI6K 2Z1JA 1HNXK 4JI5K 1S9EA 4AQYK 5FPDA 1RT1A 2HNYA 3VEZA 2HHQA 3L2WA 1GOCA 4JKHA 1REVA 3KVGA 3M8PA 4GKJK 3CC7N 3C6AA 3E9LA 2G8IA 4Z0UA 3I8BA 3VN5A 3ZCMA 4AM7A 1Y64A 3T1YK 1BIZA 3QO9A 4W5TA 3SQ0A 3O9RA 3MAQA 1U45A 5KRSA 1BA0A 4FVMA 5KQ8A 4H5WA 2QA4N 4ZHRA 1RT5A 1XHXA 3WXKA 3TSPA 3MX5A 1HR0K 5B8HA 2UXDK 2BH1A 4FWQA 1DGKN 1C1AA 4BRPA 1S5JA 2ZWHA 3QDKA 4IXCA 3NH0A 3TI0A 1VQLN 4CZHA 3P31A 1LAWA 3EN9A 1SKSA 3P4IA 1NG9A 4YOWA 5JMVA 4C8LA 4F9OA 2W42A 4AM6A 1NK7A 2A40A 1MWMA 3B8AX 1CZBA 5HP1A 3DXMB 1ZXOA 3F9MA 3CM5A 3BF3A 4Z4FA 3VF2A 1VSKA 2HBLA 1XUPO 1SKRA 3VQ5A 3L3UA 3CMAN 3LP3A 4RTFD 1L3VA 5CYQA 1LW2A 4GW6A 1TL3A 4DQIA 4DV1K 1S9GA 3MN9A 3AY9A 3MXJA 4DFJA 1QZ5A 3CCEN 2P5GA 4DFKA 3CC2N 3WXJA 2F8SA 3MX2A 4FWOA 3SJHA 4GVEA 3ATVA 4K43A 4F3TA 4BG9A 2ZGZA 4FLUA 3S3OA 2ITGA 1DTQA 1N34K 4OPHA 5M1NA 2YJEA 4DR5K 3HK2A 2PZSA 1VQKN 4DQ8A 2PAVA 4I9LA 4DS5A 2IOCA 2GUPA 2EHGA 1RDWX 2P9IB 4CW7B 3HP9A 1W2BM 1NLVA 4PL8A 4JD2A 3OYGA 4DF8A 5TKWA 3SAHA 3M8SA 1WUAA 4A5BA 1SZ2A 1UOCA 3AO2A 3AVIA 3JSMA 3DRRA 4FPAA 2ZM6K 2JLEA 4CBXA 4CK3A 5LL6Z 3U9ZA 3QMLA 4LF7K 3TABA 3VF4A 2UUAK 4KPYA 2ZF5O 3EEQA 4FYDA 2HF4A 3DJCA 4IG0A 4B1VA 3KLIA 1HNIA 5CR4A 1YTUA 1WBBA 4G9ZA 1YF5L 2D4WA 2QWLA 4BGBA 1HPZA 4C8OA 3OYFA 2HBJA 2V7YA 1O13A 4NYNA 4DUZK 1S1VA 3RR8A 5AQOA 2NNWA 4JI3K 1S1XA 4FM0A 3D2FA 4DSKA 4KB1A 4WQ4A 2VWJA 1J9AA 2YNFA 4BC4A 4WE1A 3VQ6A 1TUUA 4J2DA 1NGBA 2O8BA 2Q1NA 4E7LA 1D4XA 1A5XA 2IC3A 4DQPA 3THWB 4KHQA 1ITGA 3MWPA 2I5JA 4CJLA 1YUWA 2FLOA 5JS1A 4WQ5C 4DCHA 1JKHA 1U49A 3HBTA 1OH5A 4EHUA 1K9MO 3BF1A 4UQGA 4M3RA 4DUYK 5GIPA 2P9UA 4EIAA 5CYMA 1YIJN 1NGHA 2E2QA 3KK2A 2A3ZA 5HRSA 1L5UA 3EE9A 4IJNA 1EKEA 2QI2A 1I3AA 4BVPA 2KFZA 3KLGA 2GX9A 4X66K 1T8EA 4FL9A 3C6TA 3ISNC 4JKAA 3QETA 4PQUA 2FXUA 1EXQA 1QQNA 1KD1O 4JYAK 1C0TA 3P38A 3O8MA 4IBNA 2VGNA 5AQHA 4H0TB 2XY7A 3AA4A 4IJAA 3VEYA 5KRTA 3FZLA 3FFIA 4JRQA 1LV5A 1YT3A 1ZBUA 5ADXH 4DR2K 2O8FA 4DB3A 4CZIA 3R3LA 1EQYA 1QZ6A 1S1UA 4WF9L 3VQAA 2D0CA 2PBDA 3PSFA 3SLCA 2FBXA 2O4GA 3DOLA 1U6ZA 3SUNA 5E41A 1HYVA 5EOYA 3DI6A 3CCSN 1FXXA 4FLXA 3I33A 1N36K 4AHCA 1Q18A 4YHHK 3ENOA 5AFUA 2ASMA 4CJ7A 3O80A 1KAXA 4W5RA 1WN7A 2WONA 1ASUA 3RRGA 4FJNA 3JYTA 4AHVA 4BE1A 1KFSA 4K41A 1N5YA 4ELTA 5M1OA 4DR3K 4DR7K 4CFAA 3ZX2A 1WSFA 1UA1A 3M1FA 4F8RA 4N76A 3LDOA 3O1WA 4JK7A 5D3GA 4BRAA 4BC2A 1T3VA 1QSSA 3BZCA 4NXMK 3EL2A 3O4NA 4DV3K 3S41A 3TAEA 1TAQA 2O8EA 4FLYA 1S3XA 4NLBA 4IDKA 2ZJPL 3TSQA 3E1YA 1HRHA 4EHTA 3LDPA 4BWMA 2IAJA 3OVNA 4GV3A 3LAKA 1Q7YO 1IH7A 3CJ1A 3ATUA 3LAMA 5BRFA 4FJ9A 4BRHA 1IJJA 3R1XA 1J5OA 4DR4K 4KI6A 3WXMB 4I6MB 3R6MA 4ID5A 2DFEA 3CMEN 4AHTA 2BGGA 3HP6A 1KTQA 3WNHA 2UU9K 1NJXA 4WCEL 1ATRA 5SZTA 2P9NB 1VHXA 3RMBA 4O8KA 2P9KB 3ZT2A 2X6SA 3A5OC 4HWIA 3EYZA 2VQFK 1X9JA 3WT0A 3QNOA 3VEXA 1WNSA 5AQKA 3RR7A 4F4KA 4PKIA 1VSLA 1FKOA 1RNHA 3ZEUA 5C10A 4K8XA 4CJSA 2DTUA 3FLCO 4E0DA 4B1UB 3KJVA 5FLXO 4E7HA 5C2FA 2HF3A 3H45C 3V9XA 3ZLJA 4CJ3A 3J7ZO 3NH2A 4B9SA 4PWDA 3T1HK 3HOTA 3QIOA 4JLHA 1RBRA 1WOQA 1QVGM 5J2NA 3OYJA 4IO9L 1NGAA 1NU0A 1BU6O 2WUSA 2XY8A 3AO5A 3QINA 1DEJA 4CIEA 1N8RO 4YY3K 4HCCA 4HTUA 4CJKA 2O8CA 1NKBA 4LFBK 1IBLK 4JS5A 2HHUA 1IG9A 4B9UA 1X3MA 3UB5A 4GV9A 2KHOA 3K0SA 3AVLA 2I7NA 5HOOA 4HHTA 1VSJA 3M8QA 1M1KO 4IWVA 2EWSA 1C0FA 3B6OA 1K6YA 3AGRA 3OYAA 1NJZA 4DFPA 2FF6A 3OYNA 1HKCA 4IKFA 3VQCA 4FLTA 1HNZK 4RG8A 5J2PA 2A42A 3I0RA 1BOTO 2BUPA 4IZ9A 2OYQA 4Q0BA 4PY5A 2J4RA 2HMPA 3HZ6A 4FXDA 4NCBA 4CD3A 4CECA 4B3RK 4KH5A 4C8NA 3VQ9A 4KHPK 3LM2A 1XQSC 2P9SB 4PKGA 2XRIA 5CY4A 2OTJN 4E1MA 3WEEB 5FRNA 2GWKA 3WXLA 1Q8IA 3AVBA 3FZKA 2P9SA 2YJFA 4CFBA 5JVGL 5HROA 4CHYA 3VTIA 2Q31A 4LF6K 1TK5A 5H1SQ 3W3DA 4IG3A 4FJLA 3HRGA 4OLBA 1MA9B 4H4MA 3KWGA 1JLFA 2VG7A 3MXMA 4BRGA 3VGMA 3ULDA 3EZ5A 4BR5A 5JS2A 3VESA 1U47A 3LPTA 2YKNA 4NYFA 3LPUA 2E88A 1GLDG 1E3MA 4K25A 4MFBA 4QS9A 4B3SK 3FR0A 2YHAA 5TKYA 4BROA 3P1GA 3TWHA 3ZETA 1K8KB 3QICA 4HUEA 1KLMA 1KC8O 1XMQK 2A6AA 3VQQA 2QKBA 4JI8K 3ZSRA 2YHXA 1VQ5N 2VGMA 2HHTA 1NGGA 4FWPA 1QQMA 3QBWA 1YXQA 1EWQA 3AVKA 4B9MA 4FWLA 4YDUA 3VQEA 4ICLA 2HNDA 1EP4A 4DQRA 3LZJA 1KAYA 3GG4A 5BR8K 4M3XA 3OJSA 3FFKB 3MN7A 1NGJA 2X78A 3NAEA 4H5RA 4FCYA 5CHIA 4OO1J 3NDKA 4NO7A 5LJVA 3ZSZA 4CZGA 3VQPA 5BREA 1HJOA 1WSJA 2WBNA 4FJ7A 1IKVA 1XI1A 4BC5A 3PX4A 1YJWN 4CJTA 2GBZA 4FK4A 4KV8A 2LSNA 4LSLA 4PL7A 3V6DA 3KD5E 4B3OA 3ZSQA 4BQLA 4CEEA 4WQ4C 4YOUA 1GLBG 3QFPA 4LH5A 3VQ8A 3RRHA 4EZ6A 2QWQA 1ILYA 5EY4A 1RT6A 3ID8A 4B1ZA 4DLEA 2KW4A 4BG8A 4NXNK 1NOZA 3VENA 3KKSA 3PIPL 3NVMA 2I7PA 3UIQA 2RKIA 3S3NA 3QB0A 4CZKA 3ZT4A 5HL7L 1J6ZA 4BRKA 4CHQA 2VWKA 1WSEA 4LF5K 4BWJA 2HHWA 5BPMA 4J2BA 3DLKA 4H4OA 1NJWA 1RBUA 5E26A 1ZBFA 4GV6A 4H5NA 4O44A 3V9WA 2DY4A 2E1YA 4BR4A 1GLAG 1NK6A 3U8XA 1XHZA 3VEWA 1JXEA 2ETJA 3DXKB 4CGJA 4E7JA 4C1NK 3CCMN 3PSIA 3KKRA 4FJXA 3P5JA 4IFYA 4CF0A 3IKMA 3QFUA 4U7BA 4FOEA 4FLVA 3E01A 3CQ8A 1VAZA 3MN6A 5HLFA 2QXLA 1BL3A 5AZJA 2QM1A 3M6GA 1C0MA 1X9MA 1W97L 2D0BA 2JWLA 3G25A 4ID1A 3V4IA 4I2QA 3F9KA 4FJGA 3IUCA 2W6LA 1RCHA 1SV5A 1NGDA 2VYPA 1X9SA 3L8BA 1KRPA 2QWRA 2QW9A 3NMUA 3VMFB 4FWMA 3CI5A 4KTQA 4DWIA 1RDAA 4B3MK 3M3ZA 5AQVA 3J80O 3WNEA 4DV2K 3NGYA 1MDUB 5FRMA 1UAXA 4BR9A 4HVJA 4J2AA 1CXUA 3HT3A 4CJ5A 5I3UA 2V51B 3UKRA 1C1CA 2ZGYA 4FLZA 4BQZA 2QK9A 2W40A 1JLCA 1BIUA 3BDPA 3C95A 3K5MA 5C2DA 3H1QA 4I2PA 3OA9A 1TL1A 4CD1A 5AQGA 4WFBL 3QIPA 3CJBA 4JHDB 3ULEB 1XC9A 1HQEA 4FOIA 4CF1A 1Q86O 3BY5A 1IKWA 1HX1A 2GWJA 3RMCA 5GAHP 3NF6A 4JI4K 5AQIA 4OJRA 3P83D 1FW6A 1QTMA 4XEIA 3SMPA 4DV0K 2CGKA 4CZLA 3OBYA 4DFMA 4CJWA 3KD1E 1BG3A 4O0JA 1U2VA 1YTAA 3VQDA 2P9PB 3C7NA 3THVA 3VOVA 2E2NA 2HHHK 4KB0A 3ASMA 1HNWK 1NGIA 3L4QA 4JEPA 1JJ2M 1CZAN 2WC9A 1JCEA 3GOIA 2VG5A 1IBMK 4M42A 4K0KK 3AO3A 3WQTA 4CBUA 4L8RB 4HCBA 3UKUA 1RBSA 5HRNA 5GAGP 3J8AA 3VA0A 3ZX0A 3PV8A 1JLAA 1BCMA 1KVAA 4B9VA 4BDZA 1P90A 4IOCL 2A41A 3IRXA 2B5JA 4NCAA 5DK5A 4M45A 3D0PA 2H3GX 5EXWA 3SBGA 3RSEB 3OS1A 3L4IA 5EU7A 3EY1A 3VA3A 2HMIA 3ZT3A 1KVBA 1IBKK 3NBPA 4ILHA 4KHUA 3EKUA 3VETA 4HUGA 1RT7A 5AQUA 1SUQA 1NNEA 1N32K 4O55A 3J7YP 4QOZB 2E6LA 3TPQA 1RT4A 1GLLO 5AQXA 2O8DA 5LMNK 3NVKA 4E3SA 3AA3A 5K14A 2P9LA 3D2EA 1S72N 3R8EA 3L2RA 4M3TA 4CEBA 3D6RA 3SJJA 4Y0WA 4C8MA 5KGWA 3F5TA 2FSJA 4GY2B 3A2FA 3LL3A 1TKTA 1L3UA 1BCOA 2V7ZA 4Y1CA 5AFUH 3TR8A 1YJNN 4CIFA 4LF4K 4DF4A 1Z26A 1QQOA 3CJ9A 1W7AA 2ZQBA 5BPNA 1VQ4N 3DLEA 3KTQA 3TAGA 2D0AA 2Q36A 4FZYA 4ZTFA 5BN9A 3VERA 3L2UA 2G8WA 1B92A 4LSNA 1NK4A 2HBMA 2D5RA 2GEMA 5M1QA 1T7PA 3A8YA 1TYQB 2ASOA 1B9DA 3THYB 1RGIA 4A2BA 3O4QA 4E7IA 2NRXA 1ESVA 1Z05A 3CQYA 5KTQA 3FE1A 3ZSYA 2WOMA 5FPMA 3DRSA 1J5EK 3DYAA 4NB4A 3HL8A 4DQSA 4FJ8A 3KWIA 1C0UA 1MU2A 4DU4A 4AF1A 3O6WA 1NK5A 4CJ4A 4O8UA 1ZBLA 4CCHA 2A1SA 3K58A 5AQZA 4JI2K 1BGXT 1QQCA 4WFAL 4DU3A 1YJ9N 4CHPA 1ATSA 1BI4A 3DRPA 4GKKK 1ZYQA 2OTLN 1GLFO 3QEXA 1LWEA 5F2RA 2ZD1A 1KCFA 2HHXA 3SPZA 4CZFA 3FZHA 3CETA 3AAQA 2KTQA 1R0AA 1QVFM 1I94K 3CJCA 1VRUA 1NK8A 3THXA 3OYDA 4CIGA 4B1YB 1J53A 3CFPA 4FZZA 4YDUC 4UY8O 2G8VA 3A5NC 4FWRA 3SQ4A 3HVTA 4OGEA 2NRHA 2YHBA 4M3WA 4B9TA 2X6NA 4OKEA 2VG6A 4DLGA 2YI1A 2YCHA 1VSEA 3KLEA 4FJHA 5IT9O 4DTJA 3OYKA 1V4SA 1R59O 3A5LC 3LALA 4CJEA 3T1AA 5LJWA 1NK9A 2HOEA 4MLEA 2OA8A 1WLJA 4BRDA 1C1BA 1GOBA 2HBKA 2FBTA 2QKKA 4B8AB 1ZC6A 5AQTA 4CHNA 3G10A 4FLWA 1GOAA 4A61A 4JKEA 3C0BA 1KSPA 4BR7A 2OPRA 4FO0A 3OHRA 1Y97A 1EETA 3T7ZA 2W41A 2Q2RA 1U2VB 4JK8A 4OKJA 3M5RA 3KK7A 3KK3A 4JKGA 4DG1A 4BRCA 2GELA 3D45A 4DU1A 1WSHA 5AZIA 1RILA 3C6HA 2VQEK 1NGFA 3ZSOA 4BDYA 2NRWA 3OBWA 1TUYA 4FWNA 4JD2B 2XO7A 2W6KA 2DPNA 2OPPA 2BANA 5KGXA 1JLBA 1ZBIA 4CF8A 2XY5A 3D7EO 5C42A 2HHSA 3V1RA 4YOYA 4KI4A 4O4GA 4CVNE 5KQDA 3OS2A 4F2SA 3L0QA 2G8KA 3T19A 1DLOA 2Q3SA 4OVLA 1D9FA 2B4JA 1VQ7N 1RTJA 1T6CA 3PO4A 2HNZA 3H3OB 1SQKA 4MO5A 4FWSA 5AQQA 1BQMA 1BHLA 4GNIA 5LY3A 3MMVA 5DMRA 3C6UA 5FPEA 3CCJN 1NJYA 3HOSA 5EX5A 2B6AA 3ALYA 4MLHA 1P8ZA 4CJUA 3D2FB 2CGLA 1RDDA 4M7XA 4MO4A 4KRFA 3SBTA 1U48A 2G8UA 4DTSA 4CERA 4CK2A 4C23A 2GUIA 4HUFA 2O8BB 3U3YA 4FK0A 1VSHA 4FW1A 3ENHA 4E19A 4EAHD 1SL2A 1VQNN 2UXBK 3KK1A 3SQ2A 3VQ4A 3ZT0A 3OYBA 3AVCA 3TTCA 3DXMA 3H46O 4XH1A 3K2PA 4IFVA 5AQWA 4KO0A 5AQNA 3LWMA 1HUXA 3DOKA 4B1WB 3AVAA 2P9UB 2IIRA 2Z1HA 4CZEA 4N5SA 3OYHA 4I9QA 4AH9A 4OLAA 4O0IA 3AVJA 1HYZA 4JNEA 5HBMA 3AGKA 4KTWA 3R9PA 2NLXA 4IOXA 4FJKA 2VWBA 3IDHA 1NK0A 4KH6A 3N4PA 2FSNA 4CJFA 2UUBK 4B9QA 3O1BA 3OYEA 3QEPA 2R7YA 1BISA 4NLCA 1XNRK 3HI0A 4CI6A 2RPIA 3VTHA 2Q0UA 1HKGA 2AA4A 4RW4A 4FJIA 3LM9A 3V9ZA 4YNQA 4ISGA 3WNFA 2HVHA 4JRPA 4KHYA 3OTOK 3RMAA 3F73A 4H8KA 2UXCK 3BEXA 2E4LA 2O8FB 2NRZA 3LZIA 3LP2A 2GTDA 5GADP 3CPWM 1KFDA 4DTUA 4CJVA 3TAPA 1RTIA 3IFRA 3MCAB 1GLEG 4CEZA 4FM2A 3ZSXA 3FZMA 2P9IA 3ZSWA 3ZX3A 5JVHL 4AHRA 2JWKA 4RCHA 3SI6A 2NZTA 3VGKA 4BRNA 4L3QA 3PO5A 4MQ3A 2OPSA 4FK2A 4RW8A 2E1ZA 2AJQA 2PYLA 5CE3A 2NRTA 4K42A 1RBTA 1CLQA 3NGZA 5KI6A 4J2EA 4RW9A 3O3HA 3T69A 3HSTB 3V9SA 1W9HA 3A5MC 2Q97A 4MDBA 2FF3B 2OANA 3DAWA 3LWLA 3L6QA 3OYLA 3BP8A 4YOTA 3H08A 4WFNL 4CJRA 2E20A 3SCXA 4JKDA 3OY9A 3AVFA 4EZ9A 1QSLA 2O8EB 1VRTA 4Z4GA 1TVRA 1WBDA 1O1WA 3SNNA 1SKWA 1X1PA 4CZJA 2FSKA 3CIPA 4IEEA 4X65K 3QLHA 4J8FA 2QXFA 1NM1A 5CZ1A 2F9TA 2KQ2A 4BE2A 3PX0A 3U6FA 3HXMA 4DSJA 3LDSA 3WQUA 3THWA 2RHKA 1QE1A 2KLAA 4KFBA 3SAFA 1NMDA 4IDHA 5C12A 4BR2A 3MECA 4E1JA 4B8CA 5AQMA 2YHWA 2F9WA 1L3TA 4E89A 4GVMA 3L2VA 2E6MA 3I8DA 1KLNA 4A59A 3TSUA 3MN5A 3AVNA 4N56A 1OKJA 3LANA 5AZIB 3ZEUB 3CQXA 5C15A 3SMSA 3CM6A 1M90O 1VK0A 4BC3A 2Q0RA 2FBVA 1OH6A 3O08A 2YKMA 4FWKA 1YVUA 1TV6A 1Q81O 3KHYA 3IS9A 3NF7A 4N41A 4JI7K 4CGHA 4DV4K 3VQ7A 1RBVA 5DM6L 3AA5X 5KPRA 2G8HA 2ZJQL 3TTDA 1L3SA 3NCIA 1NJIO 4H5TA 4JS4A 4BACA 5T7BA 4BDPA 3CPEA 2O8CB 4ILJA 5FROA 2IVNA 3G71N 2IDOA 2ASPA 5ELZA 4A2AA 1VQ6N 4M63C 3CCUN 2KZZA 1WSGA 1TK8A 2E2PA 2UYTA 3LDNA 3HSCA 1WSIA 3NGIA 2HW3A 1RTHA 4CE9A 1QS4A 3W0LA 1ASWA 2A1RA 3VPZA 3FZFA 5F0XA 3HPOA 4CHOA 1E4GT 1BA1A 1QHAA 4U67L 5AR0A 1RFQA 1XMOK 1JXBA 4FJMA 3EZWA 3DLBA 2F8TA 4M41A 3V1QA 5MLCQ 4M3ZA 2Y1JA 1JCFA 1NKEA 1BWFO 1BDGA 4DHYA 5C25A 1GLJO 3HPGA 4H0YB 2YHYA 4CFCA 1Q9XA 4FJ5A 4LF8K 3AVHA 3SZ2A 1E4FT 1LWFA 3TAFA 3O9TA 1LWCA 2P51A 2YV0X 3SK3A 2FC0A 4CGGA 1KAZA 3I0SA 3J81O 4KAZA 1QHTA 3RTVA 1WAJA 5FDLA 2D1KA 1FJGK 3WXIA 1XWLA 1NOYA 4JI0K 5AJ3K 4DSEA 1Q9YA 4DSLA 3G0ZA 4BE0A 4F2RA 3RMDA 1VSDA 4JKFA 3B6PA 3GBTA 1Q82O 1CZ9A 3F2KA 4I6MA 4DR1K 4CGDA 3AVMA 2WFBA 3VEVA 4M3YA 4CGIA 2AP1A 4BRLA 4H0XB 2OZMA 2P9NA 3HTVA 4ELVA 2P9KA 3CHWA 3ZETB 2BE2A 3I56N 1HYSA 1XNQK 1X3NA 1YI2N 1X9WA 2D0PA 4DV5K 2CH6A 4DSIA 2CGJA 2KKZA 4KHNA 2RE2A 1NGCA 3MDQA 3K57A 4DS4A 4YOVA 1KQSM 2QWOA 2DFHA 1B9FA 1JLEA 1H1VA 4FZXC 2HSTA 3UE5A 3JS6A 4CEOA 4HTLA 4OGCA 3O9UA 4CHZA 5A2QO 3SYZA 4H5VA 1T05A 3O5BA 2FBYA 4CF9A 1S22A 4KH4A 1LW0A 3TARA 1C6VA 1LOTB 1T44A 2HVIA 4CEFA 1VSIA 4IEIA 1OVQA 4B9NA 3SUQA 3VGLA 1EWRA 3CXCM 3KZBA 1F21A 1OH8A 3QBXA 3WUHA 1YAGA 1LCUA 4BGAA 1VQMN 4BY9C 2PY5A 3EE8A 1KVCA 4M3UA 5HRPA 4M7YA 4LY7A 4E1NA 3LDQA 3U4LA 2Z1IA 2YX6A 4DTXA 5M1KA 5I9EB 4V19S 1J54A 2O4IA 5EVZA 1RT2A 1VSMA 3MCPA 4X64K 4R5PA 1MWKA 5BRDA 3O9QA 3OJUA 2IVPA 1IG8A 1OVYA 2OPQA 1GLCG 3AAPA 3QERA 3ID6A 1HMVA 3CCLN 3CG7A 1S1WA 3TAQA 3QEIA 2BDPA 2YNHA 3DMJA 4IOAL
chains in the Genus database with same CATH topology
2XY5A 5C42A 1SKRA 3VQ5A 3V1RA 4M3XA 2HHSA 3OJSA 4KI4A 3L3UA 4F3OA 3V9UA 3LP3A 4O4GA 3OS2A 1L3VA 4F2SA 2G8KA 5CYQA 3T3FA 1LW2A 3KIOA 3T19A 4GW6A 2X78A 1DLOA 3NAEA 1TL3A 2Q3SA 4OVLA 4RW6A 4DQIA 4DMNA 4KHWA 1D9FA 4K8ZA 4FCYA 1S9GA 3NDKA 3AO1A 2B4JA 4CJQA 3ZSZA 5I42A 1RTJA 3MXJA 4DFJA 1D9DA 3VQPA 4DFKA 3TANA 2P5GA 1WSJA 4FJ7A 2F8SA 1IKVA 3NE6A 1XI1A 3PO4A 3PX4A 2HNZA 4CJTA 2GBZA 1JL1A 3NHGA 1IO2A 1BHLA 1BQMA 4FK4A 4KV8A 2LSNA 4LSLA 3V6DA 3KD5E 5DMRA 3C6UA 4B3OA 4F3TA 2YNIA 3ZSQA 3U3GA 4CEEA 1NJYA 4FLUA 3S3OA 3WNGA 2B6AA 2ITGA 4LH5A 3ALYA 3VQ8A 3RRHA 4EZ6A 1DTQA 1RT6A 4CJUA 4XIUA 2Y1IA 4QCLA 1RDDA 4KRFA 4DLEA 1U48A 2G8UA 4DTSA 2KW4A 4CERA 3HK2A 3NFAA 2RN2A 2PZSA 4CK2A 2OZSA 1NOZA 4TSXA 2GUIA 3KKSA 4HUFA 3BDPA 4W5NA 5J2QA 3U3YA 4CFDA 4FK0A 4I9LA 4DS5A 2IOCA 1VSHA 2EHGA 3UIQA 2RKIA 3S3NA 1T03A 4FW1A 3HP9A 1TGOA 3ZT4A 1EX4A 4E19A 1SL2A 3PX6A 3KK1A 3OYGA 4CHQA 3VQ4A 3ZT0A 4DF8A 3OYBA 3SQ2A 2VWKA 3AVCA 1WSEA 3M8SA 2HHWA 4BWJA 1UOCA 3AO2A 3AVIA 3TAMA 2KZMA 1A5VA 3PUFA 3JSMA 3DLHA 4B9LA 3K2PA 4IFVA 3DRRA 3DLKA 4H4OA 4KO0A 4FW2A 3LWMA 1RBUA 1NJWA 5HRRA 3DOKA 2JLEA 4CK3A 1ZBFA 1RT3A 3AVAA 1SL1A 4O44A 3V9WA 2Z1HA 4N5SA 2DY4A 3OYHA 1NK6A 4I9QA 4AH9A 4OLAA 1XHZA 4O0IA 4Z4IA 3AVJA 1HYZA 4C8KA 3AO4A 5HBMA 1JXEA 2ETJA 4KTWA 3TABA 4CGJA 4E7JA 4KHSA 4FJKA 4B08A 4KPYA 1ZBHA 4CESA 3KKRA 4IG0A 3P5JA 4DTRA 4IFYA 4DTNA 3KLHA 1NK0A 4FJXA 4CF0A 3VQBA 2F96A 1HNIA 3KLIA 4CEDA 4FLVA 3E01A 1D5AA 4CJFA 3CQ8A 5HLFA 1YTUA 3OYEA 3QEPA 1BL3A 2R7YA 1TKXA 1BISA 3IAYA 1C0MA 2RPIA 3SV4A 1X9MA 1HPZA 1Z25A 3ITHA 4C8OA 2D0BA 4RW4A 3OYFA 4E7KA 4FJIA 3V9ZA 4YNQA 4Z4EA 4NYNA 4ID1A 3WNFA 1S1VA 4JRPA 3V4IA 3RR8A 4KHYA 2HVHA 3RMAA 1FKPA 2HHVA 4I2QA 2KFNA 3F73A 3F9KA 4DTMA 4FJGA 4H8KA 1S1XA 4FM0A 2E4LA 1TKZA 4DSKA 4KB1A 1RCHA 1SV5A 4Z4CA 2VWJA 3LZIA 3LP2A 3QEWA 4ZTJA 1J9AA 1X9SA 2YNFA 3L8BA 1KFDA 4DTUA 4WE1A 4CJVA 1RTIA 3VQ6A 4FM1A 3TAPA 1KRPA 4J2DA 4CEZA 4FYDA 4FM2A 4DTPA 3ZSXA 4E7LA 3ZT1A 1A5XA 3DM2A 2IC3A 4DQPA 3ZSWA 3DLRA 3OYIA 4KTQA 4DWIA 4AHRA 1RDAA 1ITGA 4KHQA 3L2QA 3SI6A 2I5JA 3WNEA 4AILC 4CJLA 3PO5A 5JS1A 4MQ3A 2OPSA 4AHSA 3NGYA 5FRMA 4FK2A 1UAXA 4RW8A 1JKHA 1U49A 2AJQA 4EP5A 4HVJA 2PYLA 2IS3A 3CFRA 1CXUA 3HT3A 4J2AA 4CJ5A 4UQGA 4W5QA 3OYMA 4M3RA 5I3UA 4FJJA 1C1CA 1RBTA 4FLZA 1CLQA 5CYMA 4YFUA 5KI6A 4Y1DA 4Q5VA 3NGZA 4RW9A 4J2EA 2QK9A 1JLCA 1BIUA 5SWMA 3C95A 3O3HA 3KK2A 3C94A 2YNGA 3HSTB 4QAGA 5HRSA 3K5MA 3V9SA 1L5UA 2JGUA 1W9HA 4I2PA 1TL1A 1EKEA 3QIPA 1I3AA 1XC9A 2KFZA 1HQEA 3CYMA 4CF1A 3KLGA 2P5OA 3LWLA 1JL2A 1T8EA 1N6QA 3OYLA 4DTOA 4ELUA 3C6TA 3ISNC 3QETA 4PQUA 1IKWA 3RMCA 1EXQA 3NF6A 3H08A 1C0TA 4CJRA 4IBNA 4OJRA 4CEQA 3SCXA 3P83D 4W5OA 3OY9A 4CEAA 2XY7A 3AA4A 1QTMA 3AVFA 4EZ9A 1QSLA 1RDCA 5KRTA 1VRTA 3FFIA 1G15A 3OYCA 4Z4GA 1TVRA 1HNVA 1O1WA 4JRQA 3SNNA 1LV5A 1LAVA 1YT3A 1ZBUA 3MEGA 2PYJA 1SKWA 1X1PA 4DFMA 4CJWA 3KD1E 4O0JA 3O3GA 1S1UA 1S1TA 1YTAA 2ZE2A 3VQDA 3VQAA 1JLGA 2D0CA 3THVA 3HPHA 3QLHA 2GV9A 3NF9A 5J2MA 2QXFA 2FBXA 2O4GA 3DOLA 4KB0A 3SUNA 3ASMA 5CZ1A 5E41A 1HYVA 1S6PA 2KQ2A 4KKOA 3HXMA 4BE2A 3U6FA 3DI6A 4G1QA 3LDSA 3PX0A 1RTDA 4DSJA 1FXXA 2VG5A 4FLXA 1QE1A 1NKCA 4M42A 3AO3A 4KFBA 4L8RB 3V1OA 4HCBA 4PUOA 3BGRA 1HQUA 1RBSA 5HRNA 3MECA 4AHCA 3VA0A 2X74A 4B8CA 1HJRA 2Z1GA 3PV8A 1JLAA 1BCMA 4LH4A 1KVAA 4W5RA 4B9VA 1WN7A 2WONA 4BDZA 3NF8A 1ASUA 3RRGA 1L3TA 4FJNA 4E89A 4GVMA 4CJPA 2IGIA 3L2VA 3JYTA 4AHVA 4BE1A 2HW3A 3IRXA 2B5JA 2E6MA 3I8DA 4NCAA 3QESA 1KLNA 1KFSA 2NUBA 5DK5A 3AVNA 4M45A 3D0PA 4N56A 3LANA 1N5YA 4ELTA 4CFAA 3DLGA 4CF2A 3OS1A 1WSFA 1UA1A 5EU7A 3EY1A 3VA3A 4F8RA 2HMIA 3ZT3A 4N76A 5D3GA 3CM6A 4N47A 1KVBA 4LD0A 5J1EA 3PY8A 3NBPA 2XHBA 2DFFA 4KHUA 1QSSA 4HUGA 1VK0A 3CFOA 1ASVA 2FBVA 1RT7A 3O4NA 2YKMA 3TAEA 1SUQA 1YVUA 1TV6A 1TAQA 4O55A 4FLYA 1S6QA 3IS9A 4QOZB 1UA0A 2E6LA 4IDKA 4O5BA 3NF7A 1RT4A 2G8FA 1IKXA 4N41A 1U4BA 1HRHA 4CGHA 1IKYA 4BWMA 3VQ7A 1RBVA 2IAJA 2RF2A 3AA5X 3OVNA 3ZSVA 1FK9A 3LAKA 1D8YA 2G8HA 3NH1A 4OPJA 4KTZA 2HB5A 3K5OA 1IH7A 3SUOA 3LAMA 1L3SA 4E3SA 3NCIA 4FJ9A 3AA3A 5K14A 4JS4A 4BACA 5T7BA 4BDPA 5FROA 3L2RA 4M3TA 4CEBA 3K5NA 3SJJA 1J5OA 2IDOA 3LP1A 5KGWA 4C8MA 3A2FA 4AHUA 1TKTA 1L3UA 4KI6A 1BCOA 1BI4B 1VSFA 4Y1CA 1W0HA 2KZZA 3TR8A 1WSGA 1TK8A 1UWBA 4CIFA 4ID5A 2DFEA 4DF4A 3HYFA 1Z26A 3AV9A 4AHTA 2BGGA 1WSIA 2ZQBA 1KTQA 1WAFA 3WNHA 1RTHA 3DLEA 1DTTA 4CE9A 3HP6A 3NGIA 3TAGA 1NJXA 3KTQA 2D0AA 5SZTA 3RMBA 4FZYA 1QS4A 4CGFA 3SUPA 4ZTFA 3ZT2A 1ASWA 3L2UA 1U04A 2X6SA 2A1RA 1B92A 3HPOA 4LSNA 4CHOA 2G8WA 3EYZA 1NK4A 3HM9A 3QNOA 4NCGA 1WNSA 3M8RA 3RR7A 4F4KA 1VSLA 2D5RA 1FKOA 3AA2A 3K5LA 1T7PA 1RNHA 1JXBA 1I39A 3AVGA 4K8XA 4CJSA 3SV3A 2DTUA 3O3FA 4FJMA 4E0DA 3DLBA 3KJVA 1TKDA 2F8TA 3QEVA 4M41A 1B9DA 3V1QA 4E7HA 5CZ2A 4M3ZA 2Y1JA 4E7IA 3O4QA 3V9XA 4CJ3A 3HVRA 1NKEA 3QNNA 3RWUA 2P1JA 1BQNA 4KREA 5KTQA 5C25A 3NH2A 1SL0A 4B9SA 3HPGA 3ZSYA 2WOMA 4PWDA 4CFCA 1Q9XA 4FJ5A 4I7FA 3DRSA 3AVHA 3DYAA 3QIOA 3SZ2A 3HL8A 3SPYA 4DQSA 4FJ8A 1C0UA 1LWFA 1MU2A 4JLHA 1RBRA 4Z4HA 4DU4A 3TAFA 3MEEA 1LWCA 5J2NA 2P51A 3K59A 1NK5A 2YV0X 3OYJA 2FC0A 2XY8A 3AO5A 3QINA 4CGGA 4DQQA 4CJ4A 1ZBLA 4CCHA 3I0SA 4RW7A 2A1SA 4CIEA 3K58A 4KAZA 1QHTA 3RTVA 1WAJA 4HCCA 5FDLA 4HTUA 4CJKA 1TAUA 1BGXT 3KLFA 1NKBA 1QQCA 1XWLA 2YNHA 4DU3A 1TK0A 1NOYA 5C24A 4JS5A 3MXIA 2HHUA 4CHPA 1IG9A 4B9UA 4DSEA 1Q9YA 4DSLA 3G0ZA 1BI4A 4OKKA 3DRPA 4BE0A 4F2RA 1ZYQA 3MEDA 3RMDA 1VSDA 3B6PA 3AVLA 1CZ9A 3QEXA 1LWEA 4CGDA 3AVMA 4HHTA 2ZD1A 1KCFA 1VSJA 4CGIA 4M3YA 2HHXA 3M8QA 3V81A 3SPZA 3B6OA 1K6YA 2OZMA 3OYAA 1RDBA 1NJZA 4ELVA 2KTQA 4DFPA 2EX3A 1R0AA 2BE2A 3OYNA 1VRUA 3S9HA 4DSFA 1HYSA 1NK8A 4IKFA 4OPKA 3VQCA 4FLTA 4PA1A 4RG8A 3OYDA 1QSYA 1X9WA 4CIGA 5J2PA 3I0RA 4DSIA 1J53A 3L3VA 4KHNA 3K57A 1JLQA 3IG1A 3OS0A 3CFPA 4DS4A 3SQ1A 4FZZA 2OYQA 4Q0BA 3TAQA 2G8VA 3HJFA 4PY5A 4GMJB 2DFHA 1B9FA 3LP0A 1JLEA 1CXQA 3SQ4A 4FZXC 3HVTA 2ATQA 4NCBA 4FXDA 4CECA 1A5WA 4OGEA 3S3MA 4CEOA 4C8NA 2YHBA 4OGCA 4CHZA 4CK1A 4EP4A 3VQ9A 4M3WA 3HO1A 4B9TA 3SYZA 5CY4A 2XRIA 2X6NA 4OKEA 4E1MA 2XY6A 2Z1JA 1T05A 1S9EA 2VG6A 4DLGA 1RT1A 2HNYA 5FRNA 2HHQA 3L2WA 1GOCA 1Q8IA 1REVA 1VSEA 2FBYA 3AVBA 4CF9A 3KLEA 1LW0A 4FJHA 3TARA 3M8PA 1C6VA 4CFBA 5HROA 4CHYA 4DTJA 3OYKA 2HVIA 3LALA 2G8IA 4CEFA 1VSIA 4CJEA 1TK5A 3T1AA 4Z0UA 3SUQA 4B9NA 2OA8A 1NK9A 3VN5A 3ZCMA 4Z4FA 4IG3A 1WLJA 1C1BA 1F21A 1BIZA 4FJLA 1GOBA 3QO9A 4H4MA 4W5TA 3SQ0A 1JLFA 2VG7A 3MAQA 4OLBA 2FBTA 2QKKA 3MXMA 1U45A 4B8AB 2PY5A 5KRSA 4FVMA 3G10A 4CHNA 1KVCA 3ULDA 3EZ5A 4FLWA 5JS2A 1GOAA 4ZHRA 1RT5A 3LPTA 1XHXA 1U47A 5HRPA 4M3UA 2YKNA 4NYFA 1KSPA 3LPUA 4LY7A 4E1NA 2OPRA 2Z1IA 4MFBA 2YHAA 1Y97A 1C1AA 4DTXA 1EETA 3P1GA 1S5JA 3TWHA 3NH0A 3TI0A 1J54A 2O4IA 4OKJA 4HUEA 1KLMA 1RT2A 1VSMA 3VQQA 2QKBA 3KK3A 3ZSRA 1LAWA 4DG1A 4J2BA 1SKSA 4R5PA 4DU1A 3D45A 2HHTA 1WSHA 1RILA 3OJUA 4C8LA 3AVKA 2OPQA 3ZSOA 2W42A 4BDYA 1NK7A 4B9MA 3QERA 1CZBA 2XO7A 1HMVA 5HP1A 3VQEA 2OPPA 1S1WA 2HNDA 1EP4A 2BANA 3CG7A 4ICLA 4DQRA 3QEIA 5KGXA 1JLBA 3LZJA 2BDPA 1ZBIA 3CM5A 4CF8A 1VSKA 3DMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XY5 A;  5C42 A;  1SKR A;  3VQ5 A;  3V1R A;  4M3X A;  2HHS A;  3OJS A;  4KI4 A;  3L3U A;  4F3O A;  3V9U A;  3LP3 A;  4O4G A;  3OS2 A;  1L3V A;  4F2S A;  2G8K A;  5CYQ A;  3T3F A;  1LW2 A;  3KIO A;  3T19 A;  4GW6 A;  2X78 A;  1DLO A;  3NAE A;  1TL3 A;  2Q3S A;  4OVL A;  4RW6 A;  4DQI A;  4DMN A;  4KHW A;  1D9F A;  4K8Z A;  4FCY A;  1S9G A;  3NDK A;  3AO1 A;  2B4J A;  4CJQ A;  3ZSZ A;  5I42 A;  1RTJ A;  3MXJ A;  4DFJ A;  1D9D A;  3VQP A;  4DFK A;  3TAN A;  2P5G A;  1WSJ A;  4FJ7 A;  2F8S A;  1IKV A;  3NE6 A;  1XI1 A;  3PO4 A;  3PX4 A;  2HNZ A;  4CJT A;  2GBZ A;  1JL1 A;  3NHG A;  1IO2 A;  1BHL A;  1BQM A;  4FK4 A;  4KV8 A;  2LSN A;  4LSL A;  3V6D A;  3KD5 E;  5DMR A;  3C6U A;  4B3O A;  4F3T A;  2YNI A;  3ZSQ A;  3U3G A;  4CEE A;  1NJY A;  4FLU A;  3S3O A;  3WNG A;  2B6A A;  2ITG A;  4LH5 A;  3ALY A;  3VQ8 A;  3RRH A;  4EZ6 A;  1DTQ A;  1RT6 A;  4CJU A;  4XIU A;  2Y1I A;  4QCL A;  1RDD A;  4KRF A;  4DLE A;  1U48 A;  2G8U A;  4DTS A;  2KW4 A;  4CER A;  3HK2 A;  3NFA A;  2RN2 A;  2PZS A;  4CK2 A;  2OZS A;  1NOZ A;  4TSX A;  2GUI A;  3KKS A;  4HUF A;  3BDP A;  4W5N A;  5J2Q A;  3U3Y A;  4CFD A;  4FK0 A;  4I9L A;  4DS5 A;  2IOC A;  1VSH A;  2EHG A;  3UIQ A;  2RKI A;  3S3N A;  1T03 A;  4FW1 A;  3HP9 A;  1TGO A;  3ZT4 A;  1EX4 A;  4E19 A;  1SL2 A;  3PX6 A;  3KK1 A;  3OYG A;  4CHQ A;  3VQ4 A;  3ZT0 A;  4DF8 A;  3OYB A;  3SQ2 A;  2VWK A;  3AVC A;  1WSE A;  3M8S A;  2HHW A;  4BWJ A;  1UOC A;  3AO2 A;  3AVI A;  3TAM A;  2KZM A;  1A5V A;  3PUF A;  3JSM A;  3DLH A;  4B9L A;  3K2P A;  4IFV A;  3DRR A;  3DLK A;  4H4O A;  4KO0 A;  4FW2 A;  3LWM A;  1RBU A;  1NJW A;  5HRR A;  3DOK A;  2JLE A;  4CK3 A;  1ZBF A;  1RT3 A;  3AVA A;  1SL1 A;  4O44 A;  3V9W A;  2Z1H A;  4N5S A;  2DY4 A;  3OYH A;  1NK6 A;  4I9Q A;  4AH9 A;  4OLA A;  1XHZ A;  4O0I A;  4Z4I A;  3AVJ A;  1HYZ A;  4C8K A;  3AO4 A;  5HBM A;  1JXE A;  2ETJ A;  4KTW A;  3TAB A;  4CGJ A;  4E7J A;  4KHS A;  4FJK A;  4B08 A;  4KPY A;  1ZBH A;  4CES A;  3KKR A;  4IG0 A;  3P5J A;  4DTR A;  4IFY A;  4DTN A;  3KLH A;  1NK0 A;  4FJX A;  4CF0 A;  3VQB A;  2F96 A;  1HNI A;  3KLI A;  4CED A;  4FLV A;  3E01 A;  1D5A A;  4CJF A;  3CQ8 A;  5HLF A;  1YTU A;  3OYE A;  3QEP A;  1BL3 A;  2R7Y A;  1TKX A;  1BIS A;  3IAY A;  1C0M A;  2RPI A;  3SV4 A;  1X9M A;  1HPZ A;  1Z25 A;  3ITH A;  4C8O A;  2D0B A;  4RW4 A;  3OYF A;  4E7K A;  4FJI A;  3V9Z A;  4YNQ A;  4Z4E A;  4NYN A;  4ID1 A;  3WNF A;  1S1V A;  4JRP A;  3V4I A;  3RR8 A;  4KHY A;  2HVH A;  3RMA A;  1FKP A;  2HHV A;  4I2Q A;  2KFN A;  3F73 A;  3F9K A;  4DTM A;  4FJG A;  4H8K A;  1S1X A;  4FM0 A;  2E4L A;  1TKZ A;  4DSK A;  4KB1 A;  1RCH A;  1SV5 A;  4Z4C A;  2VWJ A;  3LZI A;  3LP2 A;  3QEW A;  4ZTJ A;  1J9A A;  1X9S A;  2YNF A;  3L8B A;  1KFD A;  4DTU A;  4WE1 A;  4CJV A;  1RTI A;  3VQ6 A;  4FM1 A;  3TAP A;  1KRP A;  4J2D A;  4CEZ A;  4FYD A;  4FM2 A;  4DTP A;  3ZSX A;  4E7L A;  3ZT1 A;  1A5X A;  3DM2 A;  2IC3 A;  4DQP A;  3ZSW A;  3DLR A;  3OYI A;  4KTQ A;  4DWI A;  4AHR A;  1RDA A;  1ITG A;  4KHQ A;  3L2Q A;  3SI6 A;  2I5J A;  3WNE A;  4AIL C;  4CJL A;  3PO5 A;  5JS1 A;  4MQ3 A;  2OPS A;  4AHS A;  3NGY A;  5FRM A;  4FK2 A;  1UAX A;  4RW8 A;  1JKH A;  1U49 A;  2AJQ A;  4EP5 A;  4HVJ A;  2PYL A;  2IS3 A;  3CFR A;  1CXU A;  3HT3 A;  4J2A A;  4CJ5 A;  4UQG A;  4W5Q A;  3OYM A;  4M3R A;  5I3U A;  4FJJ A;  1C1C A;  1RBT A;  4FLZ A;  1CLQ A;  5CYM A;  4YFU A;  5KI6 A;  4Y1D A;  4Q5V A;  3NGZ A;  4RW9 A;  4J2E A;  2QK9 A;  1JLC A;  1BIU A;  5SWM A;  3C95 A;  3O3H A;  3KK2 A;  3C94 A;  2YNG A;  3HST B;  4QAG A;  5HRS A;  3K5M A;  3V9S A;  1L5U A;  2JGU A;  1W9H A;  4I2P A;  1TL1 A;  1EKE A;  3QIP A;  1I3A A;  1XC9 A;  2KFZ A;  1HQE A;  3CYM A;  4CF1 A;  3KLG A;  2P5O A;  3LWL A;  1JL2 A;  1T8E A;  1N6Q A;  3OYL A;  4DTO A;  4ELU A;  3C6T A;  3ISN C;  3QET A;  4PQU A;  1IKW A;  3RMC A;  1EXQ A;  3NF6 A;  3H08 A;  1C0T A;  4CJR A;  4IBN A;  4OJR A;  4CEQ A;  3SCX A;  3P83 D;  4W5O A;  3OY9 A;  4CEA A;  2XY7 A;  3AA4 A;  1QTM A;  3AVF A;  4EZ9 A;  1QSL A;  1RDC A;  5KRT A;  1VRT A;  3FFI A;  1G15 A;  3OYC A;  4Z4G A;  1TVR A;  1HNV A;  1O1W A;  4JRQ A;  3SNN A;  1LV5 A;  1LAV A;  1YT3 A;  1ZBU A;  3MEG A;  2PYJ A;  1SKW A;  1X1P A;  4DFM A;  4CJW A;  3KD1 E;  4O0J A;  3O3G A;  1S1U A;  1S1T A;  1YTA A;  2ZE2 A;  3VQD A;  3VQA A;  1JLG A;  2D0C A;  3THV A;  3HPH A;  3QLH A;  2GV9 A;  3NF9 A;  5J2M A;  2QXF A;  2FBX A;  2O4G A;  3DOL A;  4KB0 A;  3SUN A;  3ASM A;  5CZ1 A;  5E41 A;  1HYV A;  1S6P A;  2KQ2 A;  4KKO A;  3HXM A;  4BE2 A;  3U6F A;  3DI6 A;  4G1Q A;  3LDS A;  3PX0 A;  1RTD A;  4DSJ A;  1FXX A;  2VG5 A;  4FLX A;  1QE1 A;  1NKC A;  4M42 A;  3AO3 A;  4KFB A;  4L8R B;  3V1O A;  4HCB A;  4PUO A;  3BGR A;  1HQU A;  1RBS A;  5HRN A;  3MEC A;  4AHC A;  3VA0 A;  2X74 A;  4B8C A;  1HJR A;  2Z1G A;  3PV8 A;  1JLA A;  1BCM A;  4LH4 A;  1KVA A;  4W5R A;  4B9V A;  1WN7 A;  2WON A;  4BDZ A;  3NF8 A;  1ASU A;  3RRG A;  1L3T A;  4FJN A;  4E89 A;  4GVM A;  4CJP A;  2IGI A;  3L2V A;  3JYT A;  4AHV A;  4BE1 A;  2HW3 A;  3IRX A;  2B5J A;  2E6M A;  3I8D A;  4NCA A;  3QES A;  1KLN A;  1KFS A;  2NUB A;  5DK5 A;  3AVN A;  4M45 A;  3D0P A;  4N56 A;  3LAN A;  1N5Y A;  4ELT A;  4CFA A;  3DLG A;  4CF2 A;  3OS1 A;  1WSF A;  1UA1 A;  5EU7 A;  3EY1 A;  3VA3 A;  4F8R A;  2HMI A;  3ZT3 A;  4N76 A;  5D3G A;  3CM6 A;  4N47 A;  1KVB A;  4LD0 A;  5J1E A;  3PY8 A;  3NBP A;  2XHB A;  2DFF A;  4KHU A;  1QSS A;  4HUG A;  1VK0 A;  3CFO A;  1ASV A;  2FBV A;  1RT7 A;  3O4N A;  2YKM A;  3TAE A;  1SUQ A;  1YVU A;  1TV6 A;  1TAQ A;  4O55 A;  4FLY A;  1S6Q A;  3IS9 A;  4QOZ B;  1UA0 A;  2E6L A;  4IDK A;  4O5B A;  3NF7 A;  1RT4 A;  2G8F A;  1IKX A;  4N41 A;  1U4B A;  1HRH A;  4CGH A;  1IKY A;  4BWM A;  3VQ7 A;  1RBV A;  2IAJ A;  2RF2 A;  3AA5 X;  3OVN A;  3ZSV A;  1FK9 A;  3LAK A;  1D8Y A;  2G8H A;  3NH1 A;  4OPJ A;  4KTZ A;  2HB5 A;  3K5O A;  1IH7 A;  3SUO A;  3LAM A;  1L3S A;  4E3S A;  3NCI A;  4FJ9 A;  3AA3 A;  5K14 A;  4JS4 A;  4BAC A;  5T7B A;  4BDP A;  5FRO A;  3L2R A;  4M3T A;  4CEB A;  3K5N A;  3SJJ A;  1J5O A;  2IDO A;  3LP1 A;  5KGW A;  4C8M A;  3A2F A;  4AHU A;  1TKT A;  1L3U A;  4KI6 A;  1BCO A;  1BI4 B;  1VSF A;  4Y1C A;  1W0H A;  2KZZ A;  3TR8 A;  1WSG A;  1TK8 A;  1UWB A;  4CIF A;  4ID5 A;  2DFE A;  4DF4 A;  3HYF A;  1Z26 A;  3AV9 A;  4AHT A;  2BGG A;  1WSI A;  2ZQB A;  1KTQ A;  1WAF A;  3WNH A;  1RTH A;  3DLE A;  1DTT A;  4CE9 A;  3HP6 A;  3NGI A;  3TAG A;  1NJX A;  3KTQ A;  2D0A A;  5SZT A;  3RMB A;  4FZY A;  1QS4 A;  4CGF A;  3SUP A;  4ZTF A;  3ZT2 A;  1ASW A;  3L2U A;  1U04 A;  2X6S A;  2A1R A;  1B92 A;  3HPO A;  4LSN A;  4CHO A;  2G8W A;  3EYZ A;  1NK4 A;  3HM9 A;  3QNO A;  4NCG A;  1WNS A;  3M8R A;  3RR7 A;  4F4K A;  1VSL A;  2D5R A;  1FKO A;  3AA2 A;  3K5L A;  1T7P A;  1RNH A;  1JXB A;  1I39 A;  3AVG A;  4K8X A;  4CJS A;  3SV3 A;  2DTU A;  3O3F A;  4FJM A;  4E0D A;  3DLB A;  3KJV A;  1TKD A;  2F8T A;  3QEV A;  4M41 A;  1B9D A;  3V1Q A;  4E7H A;  5CZ2 A;  4M3Z A;  2Y1J A;  4E7I A;  3O4Q A;  3V9X A;  4CJ3 A;  3HVR A;  1NKE A;  3QNN A;  3RWU A;  2P1J A;  1BQN A;  4KRE A;  5KTQ A;  5C25 A;  3NH2 A;  1SL0 A;  4B9S A;  3HPG A;  3ZSY A;  2WOM A;  4PWD A;  4CFC A;  1Q9X A;  4FJ5 A;  4I7F A;  3DRS A;  3AVH A;  3DYA A;  3QIO A;  3SZ2 A;  3HL8 A;  3SPY A;  4DQS A;  4FJ8 A;  1C0U A;  1LWF A;  1MU2 A;  4JLH A;  1RBR A;  4Z4H A;  4DU4 A;  3TAF A;  3MEE A;  1LWC A;  5J2N A;  2P51 A;  3K59 A;  1NK5 A;  2YV0 X;  3OYJ A;  2FC0 A;  2XY8 A;  3AO5 A;  3QIN A;  4CGG A;  4DQQ A;  4CJ4 A;  1ZBL A;  4CCH A;  3I0S A;  4RW7 A;  2A1S A;  4CIE A;  3K58 A;  4KAZ A;  1QHT A;  3RTV A;  1WAJ A;  4HCC A;  5FDL A;  4HTU A;  4CJK A;  1TAU A;  1BGX T;  3KLF A;  1NKB A;  1QQC A;  1XWL A;  2YNH A;  4DU3 A;  1TK0 A;  1NOY A;  5C24 A;  4JS5 A;  3MXI A;  2HHU A;  4CHP A;  1IG9 A;  4B9U A;  4DSE A;  1Q9Y A;  4DSL A;  3G0Z A;  1BI4 A;  4OKK A;  3DRP A;  4BE0 A;  4F2R A;  1ZYQ A;  3MED A;  3RMD A;  1VSD A;  3B6P A;  3AVL A;  1CZ9 A;  3QEX A;  1LWE A;  4CGD A;  3AVM A;  4HHT A;  2ZD1 A;  1KCF A;  1VSJ A;  4CGI A;  4M3Y A;  2HHX A;  3M8Q A;  3V81 A;  3SPZ A;  3B6O A;  1K6Y A;  2OZM A;  3OYA A;  1RDB A;  1NJZ A;  4ELV A;  2KTQ A;  4DFP A;  2EX3 A;  1R0A A;  2BE2 A;  3OYN A;  1VRU A;  3S9H A;  4DSF A;  1HYS A;  1NK8 A;  4IKF A;  4OPK A;  3VQC A;  4FLT A;  4PA1 A;  4RG8 A;  3OYD A;  1QSY A;  1X9W A;  4CIG A;  5J2P A;  3I0R A;  4DSI A;  1J53 A;  3L3V A;  4KHN A;  3K57 A;  1JLQ A;  3IG1 A;  3OS0 A;  3CFP A;  4DS4 A;  3SQ1 A;  4FZZ A;  2OYQ A;  4Q0B A;  3TAQ A;  2G8V A;  3HJF A;  4PY5 A;  4GMJ B;  2DFH A;  1B9F A;  3LP0 A;  1JLE A;  1CXQ A;  3SQ4 A;  4FZX C;  3HVT A;  2ATQ A;  4NCB A;  4FXD A;  4CEC A;  1A5W A;  4OGE A;  3S3M A;  4CEO A;  4C8N A;  2YHB A;  4OGC A;  4CHZ A;  4CK1 A;  4EP4 A;  3VQ9 A;  4M3W A;  3HO1 A;  4B9T A;  3SYZ A;  5CY4 A;  2XRI A;  2X6N A;  4OKE A;  4E1M A;  2XY6 A;  2Z1J A;  1T05 A;  1S9E A;  2VG6 A;  4DLG A;  1RT1 A;  2HNY A;  5FRN A;  2HHQ A;  3L2W A;  1GOC A;  1Q8I A;  1REV A;  1VSE A;  2FBY A;  3AVB A;  4CF9 A;  3KLE A;  1LW0 A;  4FJH A;  3TAR A;  3M8P A;  1C6V A;  4CFB A;  5HRO A;  4CHY A;  4DTJ A;  3OYK A;  2HVI A;  3LAL A;  2G8I A;  4CEF A;  1VSI A;  4CJE A;  1TK5 A;  3T1A A;  4Z0U A;  3SUQ A;  4B9N A;  2OA8 A;  1NK9 A;  3VN5 A;  3ZCM A;  4Z4F A;  4IG3 A;  1WLJ A;  1C1B A;  1F21 A;  1BIZ A;  4FJL A;  1GOB A;  3QO9 A;  4H4M A;  4W5T A;  3SQ0 A;  1JLF A;  2VG7 A;  3MAQ A;  4OLB A;  2FBT A;  2QKK A;  3MXM A;  1U45 A;  4B8A B;  2PY5 A;  5KRS A;  4FVM A;  3G10 A;  4CHN A;  1KVC A;  3ULD A;  3EZ5 A;  4FLW A;  5JS2 A;  1GOA A;  4ZHR A;  1RT5 A;  3LPT A;  1XHX A;  1U47 A;  5HRP A;  4M3U A;  2YKN A;  4NYF A;  1KSP A;  3LPU A;  4LY7 A;  4E1N A;  2OPR A;  2Z1I A;  4MFB A;  2YHA A;  1Y97 A;  1C1A A;  4DTX A;  1EET A;  3P1G A;  1S5J A;  3TWH A;  3NH0 A;  3TI0 A;  1J54 A;  2O4I A;  4OKJ A;  4HUE A;  1KLM A;  1RT2 A;  1VSM A;  3VQQ A;  2QKB A;  3KK3 A;  3ZSR A;  1LAW A;  4DG1 A;  4J2B A;  1SKS A;  4R5P A;  4DU1 A;  3D45 A;  2HHT A;  1WSH A;  1RIL A;  3OJU A;  4C8L A;  3AVK A;  2OPQ A;  3ZSO A;  2W42 A;  4BDY A;  1NK7 A;  4B9M A;  3QER A;  1CZB A;  2XO7 A;  1HMV A;  5HP1 A;  3VQE A;  2OPP A;  1S1W A;  2HND A;  1EP4 A;  2BAN A;  3CG7 A;  4ICL A;  4DQR A;  3QEI A;  5KGX A;  1JLB A;  3LZJ A;  2BDP A;  1ZBI A;  3CM5 A;  4CF8 A;  1VSK A;  3DMJ A; 
#chains in the Genus database with same CATH topology
 3WEE A;  4F3O A;  3V9U A;  3T3F A;  3KIO A;  3E9P A;  3E9O A;  3OW2 M;  4RW6 A;  4DMN A;  4KHW A;  4K8Z A;  3AO1 A;  4CBW A;  4CJQ A;  5GAE P;  5I42 A;  1D9D A;  2QWP A;  1NWK A;  3P39 A;  3TAN A;  3NE6 A;  4LC9 B;  2IVO A;  5AZJ B;  1JL1 A;  2WTU A;  3NHG A;  1IO2 A;  1SAZ A;  2NRR A;  4BRE A;  2YNI A;  3U3G A;  3WNG A;  3BZK A;  4A57 A;  3CD6 N;  1YVN A;  3PLA A;  4XIU A;  2Y1I A;  1K8K A;  4QCL A;  5BR9 A;  4LFA K;  3NFA A;  2RN2 A;  1IV0 A;  2OZS A;  4TSX A;  4W5N A;  5J2Q A;  4CFD A;  3MK6 A;  2NRV A;  1T03 A;  4DKW A;  1DKG D;  4BRI A;  1TGO A;  1HLU A;  1EX4 A;  3PX6 A;  3TAM A;  2KZM A;  1A5V A;  3PUF A;  3DLH A;  4B9L A;  1K8A O;  5GIN A;  5M1P A;  3G4S N;  4FW2 A;  5HRR A;  1RT3 A;  3TU5 A;  1SL1 A;  4O5F A;  3UKR B;  1VQP N;  1VQ8 N;  3CC4 N;  1V4T A;  4FPB A;  1VQ9 N;  2D0O A;  3SAG A;  2ITM A;  4Z4I A;  4C8K A;  4JV5 K;  3AO4 A;  1KXP A;  4KHS A;  4B08 A;  1ZBH A;  2CH5 A;  1DT9 A;  5AQJ A;  4CES A;  4FSV A;  4DTR A;  4DTN A;  3KLH A;  4WYB A;  3VQB A;  2F96 A;  3BUZ B;  4CED A;  3EKS A;  1D5A A;  1ATN A;  5BPL A;  1TKX A;  3IAY A;  3SV4 A;  5AQR A;  3K9J A;  1YIT N;  1Z25 A;  3ITH A;  4E7K A;  4Z4E A;  2HHV A;  2KFN A;  1FKP A;  4DTM A;  5AQF A;  2VCP A;  1TKZ A;  5ADX A;  4Z4C A;  3QEW A;  4ZTJ A;  3C7N B;  3CCR N;  4BRQ A;  4FM1 A;  4ILG B;  1WB9 A;  4DTP A;  3ZT1 A;  3DM2 A;  3VEO A;  3DLR A;  3OYI A;  2QTD A;  3H6E A;  3RVC A;  3L2Q A;  3UKU B;  4AIL C;  4AHS A;  3U9D A;  4EP5 A;  3CJ7 A;  2IS3 A;  3CFR A;  4B3T K;  3ZYY X;  3O9S A;  2A5X A;  3DWL A;  4W5Q A;  3OYM A;  4FJJ A;  4IFE A;  4YFU A;  4Q5V A;  4Y1D A;  5SWM A;  3RWU A;  1RDU A;  2YNG A;  3C94 A;  4QAG A;  3DXK A;  4RWT A;  2JGU A;  3Q7B A;  4A62 A;  1NMN A;  3CYM A;  3O4W A;  3H1V X;  5BRH A;  1JL2 A;  2P5O A;  1N6Q A;  4DTO A;  4ELU A;  3PIO L;  4CEQ A;  4W5O A;  3TTF A;  4CEA A;  3JXU A;  1RDC A;  4XH5 A;  1G15 A;  3OYC A;  1EO1 A;  1HNV A;  3DLL L;  4MDA A;  1LAV A;  3MEG A;  3CJA A;  3ENB A;  2PYJ A;  4C1N I;  3N4Q A;  5DM7 L;  3O3G A;  2O8D B;  1S1T A;  2ZE2 A;  5JLF A;  4KBO A;  1JLG A;  4JN4 A;  1N33 K;  3HPH A;  1K73 O;  3CCV N;  2GV9 A;  4XH4 A;  3NF9 A;  5J2M A;  3C65 A;  1G99 A;  2P9L B;  1XC3 A;  3D2E B;  3LDL A;  1S6P A;  4KKO A;  4JKC A;  4DV6 K;  3GDQ A;  4G1Q A;  1RTD A;  1NKC A;  3V1O A;  4PUO A;  1HPM A;  3BGR A;  1HQU A;  5JIC A;  2X74 A;  3J7A P;  1HJR A;  2Z1G A;  3FGU A;  4LH4 A;  4WQ5 A;  3NF8 A;  3EO3 A;  4CJP A;  2IGI A;  5F1X A;  2QEX N;  3G6E N;  3QES A;  2NUB A;  5M1F A;  3DLG A;  4JHD A;  3ULE A;  4CF2 A;  4PKH A;  3MWT A;  4ISE A;  1Z6R A;  4H0O A;  4N47 A;  4LD0 A;  5J1E A;  3PY8 A;  4YOR A;  2XHB A;  2DFF A;  3CFO A;  3CCQ N;  3E66 A;  1ASV A;  1T6D A;  5JLH A;  4R79 A;  1S6Q A;  1BO5 O;  1UA0 A;  4O5B A;  5AQP A;  4EFH A;  1IKX A;  2G8F A;  4Z94 A;  1U4B A;  2E2O A;  4IO8 A;  1IKY A;  4BVO A;  2RF2 A;  3ZSV A;  1FK9 A;  3JAM O;  2P9P A;  1D8Y A;  3NH1 A;  4OPJ A;  3I55 N;  4KTZ A;  2HB5 A;  3K5O A;  5FPN A;  3SUO A;  5C0Y A;  2BTF A;  4B1X B;  1NGE A;  5E84 A;  3K5N A;  3VF6 A;  3LP1 A;  4AHU A;  5IWA K;  1ZBS A;  4H03 B;  2F4V K;  1BI4 B;  1VSF A;  1W0H A;  1SS6 A;  1UWB A;  5AQL A;  1OH7 A;  4H0P A;  3HYF A;  4JAX A;  3AV9 A;  5AQY A;  1WAF A;  1DTT A;  4CGF A;  2F7T A;  3SUP A;  4H0V B;  4LF9 K;  1U04 A;  3HM9 A;  4QS8 A;  4NCG A;  3THX B;  3M8R A;  2V52 B;  3RSE A;  3AA2 A;  3K5L A;  4OPA A;  3AVG A;  1I39 A;  4JK9 A;  3SV3 A;  3O3F A;  3IMX A;  5KPT A;  1YHQ N;  1TKD A;  3GL1 A;  3QEV A;  5CZ2 A;  4QS7 A;  3HVR A;  4KRE A;  3QNN A;  2P1J A;  1BQN A;  4LFC K;  1SL0 A;  4YOX A;  4I7F A;  2E8A A;  2UUC K;  1NBW A;  3SPY A;  4PHT X;  4X62 K;  3CF5 L;  3H3N O;  4Z4H A;  4ISF A;  3MEE A;  3K59 A;  4BRM A;  1C0G A;  3GE1 A;  4DQQ A;  4RW7 A;  1HKB A;  1TAU A;  4DV7 K;  1BUP A;  3KLF A;  1TK0 A;  5C24 A;  3MXI A;  2QWN A;  3AAR A;  4OKK A;  5LMU K;  3MED A;  4OX9 K;  5BN8 A;  5AQS A;  4DR6 K;  3Q7C A;  4JKB A;  3A0I X;  3V81 A;  1RDB A;  5KPZ A;  2EX3 A;  3S9H A;  4DSF A;  4OPK A;  1JCG A;  2ZJR L;  2PFU A;  3CER A;  4PA1 A;  1QSY A;  4FVU A;  4JKG B;  5GIO A;  1TYQ A;  2E5L K;  3L3V A;  4BRF A;  1JLQ A;  3IG1 A;  3OS0 A;  3SQ1 A;  4A5A A;  3HJF A;  4JI1 K;  3THY A;  4GMJ B;  4CZM A;  3LP0 A;  1CXQ A;  3HM8 A;  2OCE A;  2ATQ A;  1VQO N;  1A5W A;  3S3M A;  3K9K A;  4CK1 A;  3HO1 A;  4EP4 A;  4BR0 A;  2QWM A;  2XY6 A;  4JI6 K;  2Z1J A;  1HNX K;  4JI5 K;  1S9E A;  4AQY K;  5FPD A;  1RT1 A;  2HNY A;  3VEZ A;  2HHQ A;  3L2W A;  1GOC A;  4JKH A;  1REV A;  3KVG A;  3M8P A;  4GKJ K;  3CC7 N;  3C6A A;  3E9L A;  2G8I A;  4Z0U A;  3I8B A;  3VN5 A;  3ZCM A;  4AM7 A;  1Y64 A;  3T1Y K;  1BIZ A;  3QO9 A;  4W5T A;  3SQ0 A;  3O9R A;  3MAQ A;  1U45 A;  5KRS A;  1BA0 A;  4FVM A;  5KQ8 A;  4H5W A;  2QA4 N;  4ZHR A;  1RT5 A;  1XHX A;  3WXK A;  3TSP A;  3MX5 A;  1HR0 K;  5B8H A;  2UXD K;  2BH1 A;  4FWQ A;  1DGK N;  1C1A A;  4BRP A;  1S5J A;  2ZWH A;  3QDK A;  4IXC A;  3NH0 A;  3TI0 A;  1VQL N;  4CZH A;  3P31 A;  1LAW A;  3EN9 A;  1SKS A;  3P4I A;  1NG9 A;  4YOW A;  5JMV A;  4C8L A;  4F9O A;  2W42 A;  4AM6 A;  1NK7 A;  2A40 A;  1MWM A;  3B8A X;  1CZB A;  5HP1 A;  3DXM B;  1ZXO A;  3F9M A;  3CM5 A;  3BF3 A;  4Z4F A;  3VF2 A;  1VSK A;  2HBL A;  1XUP O;  1SKR A;  3VQ5 A;  3L3U A;  3CMA N;  3LP3 A;  4RTF D;  1L3V A;  5CYQ A;  1LW2 A;  4GW6 A;  1TL3 A;  4DQI A;  4DV1 K;  1S9G A;  3MN9 A;  3AY9 A;  3MXJ A;  4DFJ A;  1QZ5 A;  3CCE N;  2P5G A;  4DFK A;  3CC2 N;  3WXJ A;  2F8S A;  3MX2 A;  4FWO A;  3SJH A;  4GVE A;  3ATV A;  4K43 A;  4F3T A;  4BG9 A;  2ZGZ A;  4FLU A;  3S3O A;  2ITG A;  1DTQ A;  1N34 K;  4OPH A;  5M1N A;  2YJE A;  4DR5 K;  3HK2 A;  2PZS A;  1VQK N;  4DQ8 A;  2PAV A;  4I9L A;  4DS5 A;  2IOC A;  2GUP A;  2EHG A;  1RDW X;  2P9I B;  4CW7 B;  3HP9 A;  1W2B M;  1NLV A;  4PL8 A;  4JD2 A;  3OYG A;  4DF8 A;  5TKW A;  3SAH A;  3M8S A;  1WUA A;  4A5B A;  1SZ2 A;  1UOC A;  3AO2 A;  3AVI A;  3JSM A;  3DRR A;  4FPA A;  2ZM6 K;  2JLE A;  4CBX A;  4CK3 A;  5LL6 Z;  3U9Z A;  3QML A;  4LF7 K;  3TAB A;  3VF4 A;  2UUA K;  4KPY A;  2ZF5 O;  3EEQ A;  4FYD A;  2HF4 A;  3DJC A;  4IG0 A;  4B1V A;  3KLI A;  1HNI A;  5CR4 A;  1YTU A;  1WBB A;  4G9Z A;  1YF5 L;  2D4W A;  2QWL A;  4BGB A;  1HPZ A;  4C8O A;  3OYF A;  2HBJ A;  2V7Y A;  1O13 A;  4NYN A;  4DUZ K;  1S1V A;  3RR8 A;  5AQO A;  2NNW A;  4JI3 K;  1S1X A;  4FM0 A;  3D2F A;  4DSK A;  4KB1 A;  4WQ4 A;  2VWJ A;  1J9A A;  2YNF A;  4BC4 A;  4WE1 A;  3VQ6 A;  1TUU A;  4J2D A;  1NGB A;  2O8B A;  2Q1N A;  4E7L A;  1D4X A;  1A5X A;  2IC3 A;  4DQP A;  3THW B;  4KHQ A;  1ITG A;  3MWP A;  2I5J A;  4CJL A;  1YUW A;  2FLO A;  5JS1 A;  4WQ5 C;  4DCH A;  1JKH A;  1U49 A;  3HBT A;  1OH5 A;  4EHU A;  1K9M O;  3BF1 A;  4UQG A;  4M3R A;  4DUY K;  5GIP A;  2P9U A;  4EIA A;  5CYM A;  1YIJ N;  1NGH A;  2E2Q A;  3KK2 A;  2A3Z A;  5HRS A;  1L5U A;  3EE9 A;  4IJN A;  1EKE A;  2QI2 A;  1I3A A;  4BVP A;  2KFZ A;  3KLG A;  2GX9 A;  4X66 K;  1T8E A;  4FL9 A;  3C6T A;  3ISN C;  4JKA A;  3QET A;  4PQU A;  2FXU A;  1EXQ A;  1QQN A;  1KD1 O;  4JYA K;  1C0T A;  3P38 A;  3O8M A;  4IBN A;  2VGN A;  5AQH A;  4H0T B;  2XY7 A;  3AA4 A;  4IJA A;  3VEY A;  5KRT A;  3FZL A;  3FFI A;  4JRQ A;  1LV5 A;  1YT3 A;  1ZBU A;  5ADX H;  4DR2 K;  2O8F A;  4DB3 A;  4CZI A;  3R3L A;  1EQY A;  1QZ6 A;  1S1U A;  4WF9 L;  3VQA A;  2D0C A;  2PBD A;  3PSF A;  3SLC A;  2FBX A;  2O4G A;  3DOL A;  1U6Z A;  3SUN A;  5E41 A;  1HYV A;  5EOY A;  3DI6 A;  3CCS N;  1FXX A;  4FLX A;  3I33 A;  1N36 K;  4AHC A;  1Q18 A;  4YHH K;  3ENO A;  5AFU A;  2ASM A;  4CJ7 A;  3O80 A;  1KAX A;  4W5R A;  1WN7 A;  2WON A;  1ASU A;  3RRG A;  4FJN A;  3JYT A;  4AHV A;  4BE1 A;  1KFS A;  4K41 A;  1N5Y A;  4ELT A;  5M1O A;  4DR3 K;  4DR7 K;  4CFA A;  3ZX2 A;  1WSF A;  1UA1 A;  3M1F A;  4F8R A;  4N76 A;  3LDO A;  3O1W A;  4JK7 A;  5D3G A;  4BRA A;  4BC2 A;  1T3V A;  1QSS A;  3BZC A;  4NXM K;  3EL2 A;  3O4N A;  4DV3 K;  3S41 A;  3TAE A;  1TAQ A;  2O8E A;  4FLY A;  1S3X A;  4NLB A;  4IDK A;  2ZJP L;  3TSQ A;  3E1Y A;  1HRH A;  4EHT A;  3LDP A;  4BWM A;  2IAJ A;  3OVN A;  4GV3 A;  3LAK A;  1Q7Y O;  1IH7 A;  3CJ1 A;  3ATU A;  3LAM A;  5BRF A;  4FJ9 A;  4BRH A;  1IJJ A;  3R1X A;  1J5O A;  4DR4 K;  4KI6 A;  3WXM B;  4I6M B;  3R6M A;  4ID5 A;  2DFE A;  3CME N;  4AHT A;  2BGG A;  3HP6 A;  1KTQ A;  3WNH A;  2UU9 K;  1NJX A;  4WCE L;  1ATR A;  5SZT A;  2P9N B;  1VHX A;  3RMB A;  4O8K A;  2P9K B;  3ZT2 A;  2X6S A;  3A5O C;  4HWI A;  3EYZ A;  2VQF K;  1X9J A;  3WT0 A;  3QNO A;  3VEX A;  1WNS A;  5AQK A;  3RR7 A;  4F4K A;  4PKI A;  1VSL A;  1FKO A;  1RNH A;  3ZEU A;  5C10 A;  4K8X A;  4CJS A;  2DTU A;  3FLC O;  4E0D A;  4B1U B;  3KJV A;  5FLX O;  4E7H A;  5C2F A;  2HF3 A;  3H45 C;  3V9X A;  3ZLJ A;  4CJ3 A;  3J7Z O;  3NH2 A;  4B9S A;  4PWD A;  3T1H K;  3HOT A;  3QIO A;  4JLH A;  1RBR A;  1WOQ A;  1QVG M;  5J2N A;  3OYJ A;  4IO9 L;  1NGA A;  1NU0 A;  1BU6 O;  2WUS A;  2XY8 A;  3AO5 A;  3QIN A;  1DEJ A;  4CIE A;  1N8R O;  4YY3 K;  4HCC A;  4HTU A;  4CJK A;  2O8C A;  1NKB A;  4LFB K;  1IBL K;  4JS5 A;  2HHU A;  1IG9 A;  4B9U A;  1X3M A;  3UB5 A;  4GV9 A;  2KHO A;  3K0S A;  3AVL A;  2I7N A;  5HOO A;  4HHT A;  1VSJ A;  3M8Q A;  1M1K O;  4IWV A;  2EWS A;  1C0F A;  3B6O A;  1K6Y A;  3AGR A;  3OYA A;  1NJZ A;  4DFP A;  2FF6 A;  3OYN A;  1HKC A;  4IKF A;  3VQC A;  4FLT A;  1HNZ K;  4RG8 A;  5J2P A;  2A42 A;  3I0R A;  1BOT O;  2BUP A;  4IZ9 A;  2OYQ A;  4Q0B A;  4PY5 A;  2J4R A;  2HMP A;  3HZ6 A;  4FXD A;  4NCB A;  4CD3 A;  4CEC A;  4B3R K;  4KH5 A;  4C8N A;  3VQ9 A;  4KHP K;  3LM2 A;  1XQS C;  2P9S B;  4PKG A;  2XRI A;  5CY4 A;  2OTJ N;  4E1M A;  3WEE B;  5FRN A;  2GWK A;  3WXL A;  1Q8I A;  3AVB A;  3FZK A;  2P9S A;  2YJF A;  4CFB A;  5JVG L;  5HRO A;  4CHY A;  3VTI A;  2Q31 A;  4LF6 K;  1TK5 A;  5H1S Q;  3W3D A;  4IG3 A;  4FJL A;  3HRG A;  4OLB A;  1MA9 B;  4H4M A;  3KWG A;  1JLF A;  2VG7 A;  3MXM A;  4BRG A;  3VGM A;  3ULD A;  3EZ5 A;  4BR5 A;  5JS2 A;  3VES A;  1U47 A;  3LPT A;  2YKN A;  4NYF A;  3LPU A;  2E88 A;  1GLD G;  1E3M A;  4K25 A;  4MFB A;  4QS9 A;  4B3S K;  3FR0 A;  2YHA A;  5TKY A;  4BRO A;  3P1G A;  3TWH A;  3ZET A;  1K8K B;  3QIC A;  4HUE A;  1KLM A;  1KC8 O;  1XMQ K;  2A6A A;  3VQQ A;  2QKB A;  4JI8 K;  3ZSR A;  2YHX A;  1VQ5 N;  2VGM A;  2HHT A;  1NGG A;  4FWP A;  1QQM A;  3QBW A;  1YXQ A;  1EWQ A;  3AVK A;  4B9M A;  4FWL A;  4YDU A;  3VQE A;  4ICL A;  2HND A;  1EP4 A;  4DQR A;  3LZJ A;  1KAY A;  3GG4 A;  5BR8 K;  4M3X A;  3OJS A;  3FFK B;  3MN7 A;  1NGJ A;  2X78 A;  3NAE A;  4H5R A;  4FCY A;  5CHI A;  4OO1 J;  3NDK A;  4NO7 A;  5LJV A;  3ZSZ A;  4CZG A;  3VQP A;  5BRE A;  1HJO A;  1WSJ A;  2WBN A;  4FJ7 A;  1IKV A;  1XI1 A;  4BC5 A;  3PX4 A;  1YJW N;  4CJT A;  2GBZ A;  4FK4 A;  4KV8 A;  2LSN A;  4LSL A;  4PL7 A;  3V6D A;  3KD5 E;  4B3O A;  3ZSQ A;  4BQL A;  4CEE A;  4WQ4 C;  4YOU A;  1GLB G;  3QFP A;  4LH5 A;  3VQ8 A;  3RRH A;  4EZ6 A;  2QWQ A;  1ILY A;  5EY4 A;  1RT6 A;  3ID8 A;  4B1Z A;  4DLE A;  2KW4 A;  4BG8 A;  4NXN K;  1NOZ A;  3VEN A;  3KKS A;  3PIP L;  3NVM A;  2I7P A;  3UIQ A;  2RKI A;  3S3N A;  3QB0 A;  4CZK A;  3ZT4 A;  5HL7 L;  1J6Z A;  4BRK A;  4CHQ A;  2VWK A;  1WSE A;  4LF5 K;  4BWJ A;  2HHW A;  5BPM A;  4J2B A;  3DLK A;  4H4O A;  1NJW A;  1RBU A;  5E26 A;  1ZBF A;  4GV6 A;  4H5N A;  4O44 A;  3V9W A;  2DY4 A;  2E1Y A;  4BR4 A;  1GLA G;  1NK6 A;  3U8X A;  1XHZ A;  3VEW A;  1JXE A;  2ETJ A;  3DXK B;  4CGJ A;  4E7J A;  4C1N K;  3CCM N;  3PSI A;  3KKR A;  4FJX A;  3P5J A;  4IFY A;  4CF0 A;  3IKM A;  3QFU A;  4U7B A;  4FOE A;  4FLV A;  3E01 A;  3CQ8 A;  1VAZ A;  3MN6 A;  5HLF A;  2QXL A;  1BL3 A;  5AZJ A;  2QM1 A;  3M6G A;  1C0M A;  1X9M A;  1W97 L;  2D0B A;  2JWL A;  3G25 A;  4ID1 A;  3V4I A;  4I2Q A;  3F9K A;  4FJG A;  3IUC A;  2W6L A;  1RCH A;  1SV5 A;  1NGD A;  2VYP A;  1X9S A;  3L8B A;  1KRP A;  2QWR A;  2QW9 A;  3NMU A;  3VMF B;  4FWM A;  3CI5 A;  4KTQ A;  4DWI A;  1RDA A;  4B3M K;  3M3Z A;  5AQV A;  3J80 O;  3WNE A;  4DV2 K;  3NGY A;  1MDU B;  5FRM A;  1UAX A;  4BR9 A;  4HVJ A;  4J2A A;  1CXU A;  3HT3 A;  4CJ5 A;  5I3U A;  2V51 B;  3UKR A;  1C1C A;  2ZGY A;  4FLZ A;  4BQZ A;  2QK9 A;  2W40 A;  1JLC A;  1BIU A;  3BDP A;  3C95 A;  3K5M A;  5C2D A;  3H1Q A;  4I2P A;  3OA9 A;  1TL1 A;  4CD1 A;  5AQG A;  4WFB L;  3QIP A;  3CJB A;  4JHD B;  3ULE B;  1XC9 A;  1HQE A;  4FOI A;  4CF1 A;  1Q86 O;  3BY5 A;  1IKW A;  1HX1 A;  2GWJ A;  3RMC A;  5GAH P;  3NF6 A;  4JI4 K;  5AQI A;  4OJR A;  3P83 D;  1FW6 A;  1QTM A;  4XEI A;  3SMP A;  4DV0 K;  2CGK A;  4CZL A;  3OBY A;  4DFM A;  4CJW A;  3KD1 E;  1BG3 A;  4O0J A;  1U2V A;  1YTA A;  3VQD A;  2P9P B;  3C7N A;  3THV A;  3VOV A;  2E2N A;  2HHH K;  4KB0 A;  3ASM A;  1HNW K;  1NGI A;  3L4Q A;  4JEP A;  1JJ2 M;  1CZA N;  2WC9 A;  1JCE A;  3GOI A;  2VG5 A;  1IBM K;  4M42 A;  4K0K K;  3AO3 A;  3WQT A;  4CBU A;  4L8R B;  4HCB A;  3UKU A;  1RBS A;  5HRN A;  5GAG P;  3J8A A;  3VA0 A;  3ZX0 A;  3PV8 A;  1JLA A;  1BCM A;  1KVA A;  4B9V A;  4BDZ A;  1P90 A;  4IOC L;  2A41 A;  3IRX A;  2B5J A;  4NCA A;  5DK5 A;  4M45 A;  3D0P A;  2H3G X;  5EXW A;  3SBG A;  3RSE B;  3OS1 A;  3L4I A;  5EU7 A;  3EY1 A;  3VA3 A;  2HMI A;  3ZT3 A;  1KVB A;  1IBK K;  3NBP A;  4ILH A;  4KHU A;  3EKU A;  3VET A;  4HUG A;  1RT7 A;  5AQU A;  1SUQ A;  1NNE A;  1N32 K;  4O55 A;  3J7Y P;  4QOZ B;  2E6L A;  3TPQ A;  1RT4 A;  1GLL O;  5AQX A;  2O8D A;  5LMN K;  3NVK A;  4E3S A;  3AA3 A;  5K14 A;  2P9L A;  3D2E A;  1S72 N;  3R8E A;  3L2R A;  4M3T A;  4CEB A;  3D6R A;  3SJJ A;  4Y0W A;  4C8M A;  5KGW A;  3F5T A;  2FSJ A;  4GY2 B;  3A2F A;  3LL3 A;  1TKT A;  1L3U A;  1BCO A;  2V7Z A;  4Y1C A;  5AFU H;  3TR8 A;  1YJN N;  4CIF A;  4LF4 K;  4DF4 A;  1Z26 A;  1QQO A;  3CJ9 A;  1W7A A;  2ZQB A;  5BPN A;  1VQ4 N;  3DLE A;  3KTQ A;  3TAG A;  2D0A A;  2Q36 A;  4FZY A;  4ZTF A;  5BN9 A;  3VER A;  3L2U A;  2G8W A;  1B92 A;  4LSN A;  1NK4 A;  2HBM A;  2D5R A;  2GEM A;  5M1Q A;  1T7P A;  3A8Y A;  1TYQ B;  2ASO A;  1B9D A;  3THY B;  1RGI A;  4A2B A;  3O4Q A;  4E7I A;  2NRX A;  1ESV A;  1Z05 A;  3CQY A;  5KTQ A;  3FE1 A;  3ZSY A;  2WOM A;  5FPM A;  3DRS A;  1J5E K;  3DYA A;  4NB4 A;  3HL8 A;  4DQS A;  4FJ8 A;  3KWI A;  1C0U A;  1MU2 A;  4DU4 A;  4AF1 A;  3O6W A;  1NK5 A;  4CJ4 A;  4O8U A;  1ZBL A;  4CCH A;  2A1S A;  3K58 A;  5AQZ A;  4JI2 K;  1BGX T;  1QQC A;  4WFA L;  4DU3 A;  1YJ9 N;  4CHP A;  1ATS A;  1BI4 A;  3DRP A;  4GKK K;  1ZYQ A;  2OTL N;  1GLF O;  3QEX A;  1LWE A;  5F2R A;  2ZD1 A;  1KCF A;  2HHX A;  3SPZ A;  4CZF A;  3FZH A;  3CET A;  3AAQ A;  2KTQ A;  1R0A A;  1QVF M;  1I94 K;  3CJC A;  1VRU A;  1NK8 A;  3THX A;  3OYD A;  4CIG A;  4B1Y B;  1J53 A;  3CFP A;  4FZZ A;  4YDU C;  4UY8 O;  2G8V A;  3A5N C;  4FWR A;  3SQ4 A;  3HVT A;  4OGE A;  2NRH A;  2YHB A;  4M3W A;  4B9T A;  2X6N A;  4OKE A;  2VG6 A;  4DLG A;  2YI1 A;  2YCH A;  1VSE A;  3KLE A;  4FJH A;  5IT9 O;  4DTJ A;  3OYK A;  1V4S A;  1R59 O;  3A5L C;  3LAL A;  4CJE A;  3T1A A;  5LJW A;  1NK9 A;  2HOE A;  4MLE A;  2OA8 A;  1WLJ A;  4BRD A;  1C1B A;  1GOB A;  2HBK A;  2FBT A;  2QKK A;  4B8A B;  1ZC6 A;  5AQT A;  4CHN A;  3G10 A;  4FLW A;  1GOA A;  4A61 A;  4JKE A;  3C0B A;  1KSP A;  4BR7 A;  2OPR A;  4FO0 A;  3OHR A;  1Y97 A;  1EET A;  3T7Z A;  2W41 A;  2Q2R A;  1U2V B;  4JK8 A;  4OKJ A;  3M5R A;  3KK7 A;  3KK3 A;  4JKG A;  4DG1 A;  4BRC A;  2GEL A;  3D45 A;  4DU1 A;  1WSH A;  5AZI A;  1RIL A;  3C6H A;  2VQE K;  1NGF A;  3ZSO A;  4BDY A;  2NRW A;  3OBW A;  1TUY A;  4FWN A;  4JD2 B;  2XO7 A;  2W6K A;  2DPN A;  2OPP A;  2BAN A;  5KGX A;  1JLB A;  1ZBI A;  4CF8 A;  2XY5 A;  3D7E O;  5C42 A;  2HHS A;  3V1R A;  4YOY A;  4KI4 A;  4O4G A;  4CVN E;  5KQD A;  3OS2 A;  4F2S A;  3L0Q A;  2G8K A;  3T19 A;  1DLO A;  2Q3S A;  4OVL A;  1D9F A;  2B4J A;  1VQ7 N;  1RTJ A;  1T6C A;  3PO4 A;  2HNZ A;  3H3O B;  1SQK A;  4MO5 A;  4FWS A;  5AQQ A;  1BQM A;  1BHL A;  4GNI A;  5LY3 A;  3MMV A;  5DMR A;  3C6U A;  5FPE A;  3CCJ N;  1NJY A;  3HOS A;  5EX5 A;  2B6A A;  3ALY A;  4MLH A;  1P8Z A;  4CJU A;  3D2F B;  2CGL A;  1RDD A;  4M7X A;  4MO4 A;  4KRF A;  3SBT A;  1U48 A;  2G8U A;  4DTS A;  4CER A;  4CK2 A;  4C23 A;  2GUI A;  4HUF A;  2O8B B;  3U3Y A;  4FK0 A;  1VSH A;  4FW1 A;  3ENH A;  4E19 A;  4EAH D;  1SL2 A;  1VQN N;  2UXB K;  3KK1 A;  3SQ2 A;  3VQ4 A;  3ZT0 A;  3OYB A;  3AVC A;  3TTC A;  3DXM A;  3H46 O;  4XH1 A;  3K2P A;  4IFV A;  5AQW A;  4KO0 A;  5AQN A;  3LWM A;  1HUX A;  3DOK A;  4B1W B;  3AVA A;  2P9U B;  2IIR A;  2Z1H A;  4CZE A;  4N5S A;  3OYH A;  4I9Q A;  4AH9 A;  4OLA A;  4O0I A;  3AVJ A;  1HYZ A;  4JNE A;  5HBM A;  3AGK A;  4KTW A;  3R9P A;  2NLX A;  4IOX A;  4FJK A;  2VWB A;  3IDH A;  1NK0 A;  4KH6 A;  3N4P A;  2FSN A;  4CJF A;  2UUB K;  4B9Q A;  3O1B A;  3OYE A;  3QEP A;  2R7Y A;  1BIS A;  4NLC A;  1XNR K;  3HI0 A;  4CI6 A;  2RPI A;  3VTH A;  2Q0U A;  1HKG A;  2AA4 A;  4RW4 A;  4FJI A;  3LM9 A;  3V9Z A;  4YNQ A;  4ISG A;  3WNF A;  2HVH A;  4JRP A;  4KHY A;  3OTO K;  3RMA A;  3F73 A;  4H8K A;  2UXC K;  3BEX A;  2E4L A;  2O8F B;  2NRZ A;  3LZI A;  3LP2 A;  2GTD A;  5GAD P;  3CPW M;  1KFD A;  4DTU A;  4CJV A;  3TAP A;  1RTI A;  3IFR A;  3MCA B;  1GLE G;  4CEZ A;  4FM2 A;  3ZSX A;  3FZM A;  2P9I A;  3ZSW A;  3ZX3 A;  5JVH L;  4AHR A;  2JWK A;  4RCH A;  3SI6 A;  2NZT A;  3VGK A;  4BRN A;  4L3Q A;  3PO5 A;  4MQ3 A;  2OPS A;  4FK2 A;  4RW8 A;  2E1Z A;  2AJQ A;  2PYL A;  5CE3 A;  2NRT A;  4K42 A;  1RBT A;  1CLQ A;  3NGZ A;  5KI6 A;  4J2E A;  4RW9 A;  3O3H A;  3T69 A;  3HST B;  3V9S A;  1W9H A;  3A5M C;  2Q97 A;  4MDB A;  2FF3 B;  2OAN A;  3DAW A;  3LWL A;  3L6Q A;  3OYL A;  3BP8 A;  4YOT A;  3H08 A;  4WFN L;  4CJR A;  2E20 A;  3SCX A;  4JKD A;  3OY9 A;  3AVF A;  4EZ9 A;  1QSL A;  2O8E B;  1VRT A;  4Z4G A;  1TVR A;  1WBD A;  1O1W A;  3SNN A;  1SKW A;  1X1P A;  4CZJ A;  2FSK A;  3CIP A;  4IEE A;  4X65 K;  3QLH A;  4J8F A;  2QXF A;  1NM1 A;  5CZ1 A;  2F9T A;  2KQ2 A;  4BE2 A;  3PX0 A;  3U6F A;  3HXM A;  4DSJ A;  3LDS A;  3WQU A;  3THW A;  2RHK A;  1QE1 A;  2KLA A;  4KFB A;  3SAF A;  1NMD A;  4IDH A;  5C12 A;  4BR2 A;  3MEC A;  4E1J A;  4B8C A;  5AQM A;  2YHW A;  2F9W A;  1L3T A;  4E89 A;  4GVM A;  3L2V A;  2E6M A;  3I8D A;  1KLN A;  4A59 A;  3TSU A;  3MN5 A;  3AVN A;  4N56 A;  1OKJ A;  3LAN A;  5AZI B;  3ZEU B;  3CQX A;  5C15 A;  3SMS A;  3CM6 A;  1M90 O;  1VK0 A;  4BC3 A;  2Q0R A;  2FBV A;  1OH6 A;  3O08 A;  2YKM A;  4FWK A;  1YVU A;  1TV6 A;  1Q81 O;  3KHY A;  3IS9 A;  3NF7 A;  4N41 A;  4JI7 K;  4CGH A;  4DV4 K;  3VQ7 A;  1RBV A;  5DM6 L;  3AA5 X;  5KPR A;  2G8H A;  2ZJQ L;  3TTD A;  1L3S A;  3NCI A;  1NJI O;  4H5T A;  4JS4 A;  4BAC A;  5T7B A;  4BDP A;  3CPE A;  2O8C B;  4ILJ A;  5FRO A;  2IVN A;  3G71 N;  2IDO A;  2ASP A;  5ELZ A;  4A2A A;  1VQ6 N;  4M63 C;  3CCU N;  2KZZ A;  1WSG A;  1TK8 A;  2E2P A;  2UYT A;  3LDN A;  3HSC A;  1WSI A;  3NGI A;  2HW3 A;  1RTH A;  4CE9 A;  1QS4 A;  3W0L A;  1ASW A;  2A1R A;  3VPZ A;  3FZF A;  5F0X A;  3HPO A;  4CHO A;  1E4G T;  1BA1 A;  1QHA A;  4U67 L;  5AR0 A;  1RFQ A;  1XMO K;  1JXB A;  4FJM A;  3EZW A;  3DLB A;  2F8T A;  4M41 A;  3V1Q A;  5MLC Q;  4M3Z A;  2Y1J A;  1JCF A;  1NKE A;  1BWF O;  1BDG A;  4DHY A;  5C25 A;  1GLJ O;  3HPG A;  4H0Y B;  2YHY A;  4CFC A;  1Q9X A;  4FJ5 A;  4LF8 K;  3AVH A;  3SZ2 A;  1E4F T;  1LWF A;  3TAF A;  3O9T A;  1LWC A;  2P51 A;  2YV0 X;  3SK3 A;  2FC0 A;  4CGG A;  1KAZ A;  3I0S A;  3J81 O;  4KAZ A;  1QHT A;  3RTV A;  1WAJ A;  5FDL A;  2D1K A;  1FJG K;  3WXI A;  1XWL A;  1NOY A;  4JI0 K;  5AJ3 K;  4DSE A;  1Q9Y A;  4DSL A;  3G0Z A;  4BE0 A;  4F2R A;  3RMD A;  1VSD A;  4JKF A;  3B6P A;  3GBT A;  1Q82 O;  1CZ9 A;  3F2K A;  4I6M A;  4DR1 K;  4CGD A;  3AVM A;  2WFB A;  3VEV A;  4M3Y A;  4CGI A;  2AP1 A;  4BRL A;  4H0X B;  2OZM A;  2P9N A;  3HTV A;  4ELV A;  2P9K A;  3CHW A;  3ZET B;  2BE2 A;  3I56 N;  1HYS A;  1XNQ K;  1X3N A;  1YI2 N;  1X9W A;  2D0P A;  4DV5 K;  2CH6 A;  4DSI A;  2CGJ A;  2KKZ A;  4KHN A;  2RE2 A;  1NGC A;  3MDQ A;  3K57 A;  4DS4 A;  4YOV A;  1KQS M;  2QWO A;  2DFH A;  1B9F A;  1JLE A;  1H1V A;  4FZX C;  2HST A;  3UE5 A;  3JS6 A;  4CEO A;  4HTL A;  4OGC A;  3O9U A;  4CHZ A;  5A2Q O;  3SYZ A;  4H5V A;  1T05 A;  3O5B A;  2FBY A;  4CF9 A;  1S22 A;  4KH4 A;  1LW0 A;  3TAR A;  1C6V A;  1LOT B;  1T44 A;  2HVI A;  4CEF A;  1VSI A;  4IEI A;  1OVQ A;  4B9N A;  3SUQ A;  3VGL A;  1EWR A;  3CXC M;  3KZB A;  1F21 A;  1OH8 A;  3QBX A;  3WUH A;  1YAG A;  1LCU A;  4BGA A;  1VQM N;  4BY9 C;  2PY5 A;  3EE8 A;  1KVC A;  4M3U A;  5HRP A;  4M7Y A;  4LY7 A;  4E1N A;  3LDQ A;  3U4L A;  2Z1I A;  2YX6 A;  4DTX A;  5M1K A;  5I9E B;  4V19 S;  1J54 A;  2O4I A;  5EVZ A;  1RT2 A;  1VSM A;  3MCP A;  4X64 K;  4R5P A;  1MWK A;  5BRD A;  3O9Q A;  3OJU A;  2IVP A;  1IG8 A;  1OVY A;  2OPQ A;  1GLC G;  3AAP A;  3QER A;  3ID6 A;  1HMV A;  3CCL N;  3CG7 A;  1S1W A;  3TAQ A;  3QEI A;  2BDP A;  2YNH A;  3DMJ A;  4IOA L; 
#chains in the Genus database with same CATH homology
 2XY5 A;  5C42 A;  1SKR A;  3VQ5 A;  3V1R A;  4M3X A;  2HHS A;  3OJS A;  4KI4 A;  3L3U A;  4F3O A;  3V9U A;  3LP3 A;  4O4G A;  3OS2 A;  1L3V A;  4F2S A;  2G8K A;  5CYQ A;  3T3F A;  1LW2 A;  3KIO A;  3T19 A;  4GW6 A;  2X78 A;  1DLO A;  3NAE A;  1TL3 A;  2Q3S A;  4OVL A;  4RW6 A;  4DQI A;  4DMN A;  4KHW A;  1D9F A;  4K8Z A;  4FCY A;  1S9G A;  3NDK A;  3AO1 A;  2B4J A;  4CJQ A;  3ZSZ A;  5I42 A;  1RTJ A;  3MXJ A;  4DFJ A;  1D9D A;  3VQP A;  4DFK A;  3TAN A;  2P5G A;  1WSJ A;  4FJ7 A;  2F8S A;  1IKV A;  3NE6 A;  1XI1 A;  3PO4 A;  3PX4 A;  2HNZ A;  4CJT A;  2GBZ A;  1JL1 A;  3NHG A;  1IO2 A;  1BHL A;  1BQM A;  4FK4 A;  4KV8 A;  2LSN A;  4LSL A;  3V6D A;  3KD5 E;  5DMR A;  3C6U A;  4B3O A;  4F3T A;  2YNI A;  3ZSQ A;  3U3G A;  4CEE A;  1NJY A;  4FLU A;  3S3O A;  3WNG A;  2B6A A;  2ITG A;  4LH5 A;  3ALY A;  3VQ8 A;  3RRH A;  4EZ6 A;  1DTQ A;  1RT6 A;  4CJU A;  4XIU A;  2Y1I A;  4QCL A;  1RDD A;  4KRF A;  4DLE A;  1U48 A;  2G8U A;  4DTS A;  2KW4 A;  4CER A;  3HK2 A;  3NFA A;  2RN2 A;  2PZS A;  4CK2 A;  2OZS A;  1NOZ A;  4TSX A;  2GUI A;  3KKS A;  4HUF A;  3BDP A;  4W5N A;  5J2Q A;  3U3Y A;  4CFD A;  4FK0 A;  4I9L A;  4DS5 A;  2IOC A;  1VSH A;  2EHG A;  3UIQ A;  2RKI A;  3S3N A;  1T03 A;  4FW1 A;  3HP9 A;  1TGO A;  3ZT4 A;  1EX4 A;  4E19 A;  1SL2 A;  3PX6 A;  3KK1 A;  3OYG A;  4CHQ A;  3VQ4 A;  3ZT0 A;  4DF8 A;  3OYB A;  3SQ2 A;  2VWK A;  3AVC A;  1WSE A;  3M8S A;  2HHW A;  4BWJ A;  1UOC A;  3AO2 A;  3AVI A;  3TAM A;  2KZM A;  1A5V A;  3PUF A;  3JSM A;  3DLH A;  4B9L A;  3K2P A;  4IFV A;  3DRR A;  3DLK A;  4H4O A;  4KO0 A;  4FW2 A;  3LWM A;  1RBU A;  1NJW A;  5HRR A;  3DOK A;  2JLE A;  4CK3 A;  1ZBF A;  1RT3 A;  3AVA A;  1SL1 A;  4O44 A;  3V9W A;  2Z1H A;  4N5S A;  2DY4 A;  3OYH A;  1NK6 A;  4I9Q A;  4AH9 A;  4OLA A;  1XHZ A;  4O0I A;  4Z4I A;  3AVJ A;  1HYZ A;  4C8K A;  3AO4 A;  5HBM A;  1JXE A;  2ETJ A;  4KTW A;  3TAB A;  4CGJ A;  4E7J A;  4KHS A;  4FJK A;  4B08 A;  4KPY A;  1ZBH A;  4CES A;  3KKR A;  4IG0 A;  3P5J A;  4DTR A;  4IFY A;  4DTN A;  3KLH A;  1NK0 A;  4FJX A;  4CF0 A;  3VQB A;  2F96 A;  1HNI A;  3KLI A;  4CED A;  4FLV A;  3E01 A;  1D5A A;  4CJF A;  3CQ8 A;  5HLF A;  1YTU A;  3OYE A;  3QEP A;  1BL3 A;  2R7Y A;  1TKX A;  1BIS A;  3IAY A;  1C0M A;  2RPI A;  3SV4 A;  1X9M A;  1HPZ A;  1Z25 A;  3ITH A;  4C8O A;  2D0B A;  4RW4 A;  3OYF A;  4E7K A;  4FJI A;  3V9Z A;  4YNQ A;  4Z4E A;  4NYN A;  4ID1 A;  3WNF A;  1S1V A;  4JRP A;  3V4I A;  3RR8 A;  4KHY A;  2HVH A;  3RMA A;  1FKP A;  2HHV A;  4I2Q A;  2KFN A;  3F73 A;  3F9K A;  4DTM A;  4FJG A;  4H8K A;  1S1X A;  4FM0 A;  2E4L A;  1TKZ A;  4DSK A;  4KB1 A;  1RCH A;  1SV5 A;  4Z4C A;  2VWJ A;  3LZI A;  3LP2 A;  3QEW A;  4ZTJ A;  1J9A A;  1X9S A;  2YNF A;  3L8B A;  1KFD A;  4DTU A;  4WE1 A;  4CJV A;  1RTI A;  3VQ6 A;  4FM1 A;  3TAP A;  1KRP A;  4J2D A;  4CEZ A;  4FYD A;  4FM2 A;  4DTP A;  3ZSX A;  4E7L A;  3ZT1 A;  1A5X A;  3DM2 A;  2IC3 A;  4DQP A;  3ZSW A;  3DLR A;  3OYI A;  4KTQ A;  4DWI A;  4AHR A;  1RDA A;  1ITG A;  4KHQ A;  3L2Q A;  3SI6 A;  2I5J A;  3WNE A;  4AIL C;  4CJL A;  3PO5 A;  5JS1 A;  4MQ3 A;  2OPS A;  4AHS A;  3NGY A;  5FRM A;  4FK2 A;  1UAX A;  4RW8 A;  1JKH A;  1U49 A;  2AJQ A;  4EP5 A;  4HVJ A;  2PYL A;  2IS3 A;  3CFR A;  1CXU A;  3HT3 A;  4J2A A;  4CJ5 A;  4UQG A;  4W5Q A;  3OYM A;  4M3R A;  5I3U A;  4FJJ A;  1C1C A;  1RBT A;  4FLZ A;  1CLQ A;  5CYM A;  4YFU A;  5KI6 A;  4Y1D A;  4Q5V A;  3NGZ A;  4RW9 A;  4J2E A;  2QK9 A;  1JLC A;  1BIU A;  5SWM A;  3C95 A;  3O3H A;  3KK2 A;  3C94 A;  2YNG A;  3HST B;  4QAG A;  5HRS A;  3K5M A;  3V9S A;  1L5U A;  2JGU A;  1W9H A;  4I2P A;  1TL1 A;  1EKE A;  3QIP A;  1I3A A;  1XC9 A;  2KFZ A;  1HQE A;  3CYM A;  4CF1 A;  3KLG A;  2P5O A;  3LWL A;  1JL2 A;  1T8E A;  1N6Q A;  3OYL A;  4DTO A;  4ELU A;  3C6T A;  3ISN C;  3QET A;  4PQU A;  1IKW A;  3RMC A;  1EXQ A;  3NF6 A;  3H08 A;  1C0T A;  4CJR A;  4IBN A;  4OJR A;  4CEQ A;  3SCX A;  3P83 D;  4W5O A;  3OY9 A;  4CEA A;  2XY7 A;  3AA4 A;  1QTM A;  3AVF A;  4EZ9 A;  1QSL A;  1RDC A;  5KRT A;  1VRT A;  3FFI A;  1G15 A;  3OYC A;  4Z4G A;  1TVR A;  1HNV A;  1O1W A;  4JRQ A;  3SNN A;  1LV5 A;  1LAV A;  1YT3 A;  1ZBU A;  3MEG A;  2PYJ A;  1SKW A;  1X1P A;  4DFM A;  4CJW A;  3KD1 E;  4O0J A;  3O3G A;  1S1U A;  1S1T A;  1YTA A;  2ZE2 A;  3VQD A;  3VQA A;  1JLG A;  2D0C A;  3THV A;  3HPH A;  3QLH A;  2GV9 A;  3NF9 A;  5J2M A;  2QXF A;  2FBX A;  2O4G A;  3DOL A;  4KB0 A;  3SUN A;  3ASM A;  5CZ1 A;  5E41 A;  1HYV A;  1S6P A;  2KQ2 A;  4KKO A;  3HXM A;  4BE2 A;  3U6F A;  3DI6 A;  4G1Q A;  3LDS A;  3PX0 A;  1RTD A;  4DSJ A;  1FXX A;  2VG5 A;  4FLX A;  1QE1 A;  1NKC A;  4M42 A;  3AO3 A;  4KFB A;  4L8R B;  3V1O A;  4HCB A;  4PUO A;  3BGR A;  1HQU A;  1RBS A;  5HRN A;  3MEC A;  4AHC A;  3VA0 A;  2X74 A;  4B8C A;  1HJR A;  2Z1G A;  3PV8 A;  1JLA A;  1BCM A;  4LH4 A;  1KVA A;  4W5R A;  4B9V A;  1WN7 A;  2WON A;  4BDZ A;  3NF8 A;  1ASU A;  3RRG A;  1L3T A;  4FJN A;  4E89 A;  4GVM A;  4CJP A;  2IGI A;  3L2V A;  3JYT A;  4AHV A;  4BE1 A;  2HW3 A;  3IRX A;  2B5J A;  2E6M A;  3I8D A;  4NCA A;  3QES A;  1KLN A;  1KFS A;  2NUB A;  5DK5 A;  3AVN A;  4M45 A;  3D0P A;  4N56 A;  3LAN A;  1N5Y A;  4ELT A;  4CFA A;  3DLG A;  4CF2 A;  3OS1 A;  1WSF A;  1UA1 A;  5EU7 A;  3EY1 A;  3VA3 A;  4F8R A;  2HMI A;  3ZT3 A;  4N76 A;  5D3G A;  3CM6 A;  4N47 A;  1KVB A;  4LD0 A;  5J1E A;  3PY8 A;  3NBP A;  2XHB A;  2DFF A;  4KHU A;  1QSS A;  4HUG A;  1VK0 A;  3CFO A;  1ASV A;  2FBV A;  1RT7 A;  3O4N A;  2YKM A;  3TAE A;  1SUQ A;  1YVU A;  1TV6 A;  1TAQ A;  4O55 A;  4FLY A;  1S6Q A;  3IS9 A;  4QOZ B;  1UA0 A;  2E6L A;  4IDK A;  4O5B A;  3NF7 A;  1RT4 A;  2G8F A;  1IKX A;  4N41 A;  1U4B A;  1HRH A;  4CGH A;  1IKY A;  4BWM A;  3VQ7 A;  1RBV A;  2IAJ A;  2RF2 A;  3AA5 X;  3OVN A;  3ZSV A;  1FK9 A;  3LAK A;  1D8Y A;  2G8H A;  3NH1 A;  4OPJ A;  4KTZ A;  2HB5 A;  3K5O A;  1IH7 A;  3SUO A;  3LAM A;  1L3S A;  4E3S A;  3NCI A;  4FJ9 A;  3AA3 A;  5K14 A;  4JS4 A;  4BAC A;  5T7B A;  4BDP A;  5FRO A;  3L2R A;  4M3T A;  4CEB A;  3K5N A;  3SJJ A;  1J5O A;  2IDO A;  3LP1 A;  5KGW A;  4C8M A;  3A2F A;  4AHU A;  1TKT A;  1L3U A;  4KI6 A;  1BCO A;  1BI4 B;  1VSF A;  4Y1C A;  1W0H A;  2KZZ A;  3TR8 A;  1WSG A;  1TK8 A;  1UWB A;  4CIF A;  4ID5 A;  2DFE A;  4DF4 A;  3HYF A;  1Z26 A;  3AV9 A;  4AHT A;  2BGG A;  1WSI A;  2ZQB A;  1KTQ A;  1WAF A;  3WNH A;  1RTH A;  3DLE A;  1DTT A;  4CE9 A;  3HP6 A;  3NGI A;  3TAG A;  1NJX A;  3KTQ A;  2D0A A;  5SZT A;  3RMB A;  4FZY A;  1QS4 A;  4CGF A;  3SUP A;  4ZTF A;  3ZT2 A;  1ASW A;  3L2U A;  1U04 A;  2X6S A;  2A1R A;  1B92 A;  3HPO A;  4LSN A;  4CHO A;  2G8W A;  3EYZ A;  1NK4 A;  3HM9 A;  3QNO A;  4NCG A;  1WNS A;  3M8R A;  3RR7 A;  4F4K A;  1VSL A;  2D5R A;  1FKO A;  3AA2 A;  3K5L A;  1T7P A;  1RNH A;  1JXB A;  1I39 A;  3AVG A;  4K8X A;  4CJS A;  3SV3 A;  2DTU A;  3O3F A;  4FJM A;  4E0D A;  3DLB A;  3KJV A;  1TKD A;  2F8T A;  3QEV A;  4M41 A;  1B9D A;  3V1Q A;  4E7H A;  5CZ2 A;  4M3Z A;  2Y1J A;  4E7I A;  3O4Q A;  3V9X A;  4CJ3 A;  3HVR A;  1NKE A;  3QNN A;  3RWU A;  2P1J A;  1BQN A;  4KRE A;  5KTQ A;  5C25 A;  3NH2 A;  1SL0 A;  4B9S A;  3HPG A;  3ZSY A;  2WOM A;  4PWD A;  4CFC A;  1Q9X A;  4FJ5 A;  4I7F A;  3DRS A;  3AVH A;  3DYA A;  3QIO A;  3SZ2 A;  3HL8 A;  3SPY A;  4DQS A;  4FJ8 A;  1C0U A;  1LWF A;  1MU2 A;  4JLH A;  1RBR A;  4Z4H A;  4DU4 A;  3TAF A;  3MEE A;  1LWC A;  5J2N A;  2P51 A;  3K59 A;  1NK5 A;  2YV0 X;  3OYJ A;  2FC0 A;  2XY8 A;  3AO5 A;  3QIN A;  4CGG A;  4DQQ A;  4CJ4 A;  1ZBL A;  4CCH A;  3I0S A;  4RW7 A;  2A1S A;  4CIE A;  3K58 A;  4KAZ A;  1QHT A;  3RTV A;  1WAJ A;  4HCC A;  5FDL A;  4HTU A;  4CJK A;  1TAU A;  1BGX T;  3KLF A;  1NKB A;  1QQC A;  1XWL A;  2YNH A;  4DU3 A;  1TK0 A;  1NOY A;  5C24 A;  4JS5 A;  3MXI A;  2HHU A;  4CHP A;  1IG9 A;  4B9U A;  4DSE A;  1Q9Y A;  4DSL A;  3G0Z A;  1BI4 A;  4OKK A;  3DRP A;  4BE0 A;  4F2R A;  1ZYQ A;  3MED A;  3RMD A;  1VSD A;  3B6P A;  3AVL A;  1CZ9 A;  3QEX A;  1LWE A;  4CGD A;  3AVM A;  4HHT A;  2ZD1 A;  1KCF A;  1VSJ A;  4CGI A;  4M3Y A;  2HHX A;  3M8Q A;  3V81 A;  3SPZ A;  3B6O A;  1K6Y A;  2OZM A;  3OYA A;  1RDB A;  1NJZ A;  4ELV A;  2KTQ A;  4DFP A;  2EX3 A;  1R0A A;  2BE2 A;  3OYN A;  1VRU A;  3S9H A;  4DSF A;  1HYS A;  1NK8 A;  4IKF A;  4OPK A;  3VQC A;  4FLT A;  4PA1 A;  4RG8 A;  3OYD A;  1QSY A;  1X9W A;  4CIG A;  5J2P A;  3I0R A;  4DSI A;  1J53 A;  3L3V A;  4KHN A;  3K57 A;  1JLQ A;  3IG1 A;  3OS0 A;  3CFP A;  4DS4 A;  3SQ1 A;  4FZZ A;  2OYQ A;  4Q0B A;  3TAQ A;  2G8V A;  3HJF A;  4PY5 A;  4GMJ B;  2DFH A;  1B9F A;  3LP0 A;  1JLE A;  1CXQ A;  3SQ4 A;  4FZX C;  3HVT A;  2ATQ A;  4NCB A;  4FXD A;  4CEC A;  1A5W A;  4OGE A;  3S3M A;  4CEO A;  4C8N A;  2YHB A;  4OGC A;  4CHZ A;  4CK1 A;  4EP4 A;  3VQ9 A;  4M3W A;  3HO1 A;  4B9T A;  3SYZ A;  5CY4 A;  2XRI A;  2X6N A;  4OKE A;  4E1M A;  2XY6 A;  2Z1J A;  1T05 A;  1S9E A;  2VG6 A;  4DLG A;  1RT1 A;  2HNY A;  5FRN A;  2HHQ A;  3L2W A;  1GOC A;  1Q8I A;  1REV A;  1VSE A;  2FBY A;  3AVB A;  4CF9 A;  3KLE A;  1LW0 A;  4FJH A;  3TAR A;  3M8P A;  1C6V A;  4CFB A;  5HRO A;  4CHY A;  4DTJ A;  3OYK A;  2HVI A;  3LAL A;  2G8I A;  4CEF A;  1VSI A;  4CJE A;  1TK5 A;  3T1A A;  4Z0U A;  3SUQ A;  4B9N A;  2OA8 A;  1NK9 A;  3VN5 A;  3ZCM A;  4Z4F A;  4IG3 A;  1WLJ A;  1C1B A;  1F21 A;  1BIZ A;  4FJL A;  1GOB A;  3QO9 A;  4H4M A;  4W5T A;  3SQ0 A;  1JLF A;  2VG7 A;  3MAQ A;  4OLB A;  2FBT A;  2QKK A;  3MXM A;  1U45 A;  4B8A B;  2PY5 A;  5KRS A;  4FVM A;  3G10 A;  4CHN A;  1KVC A;  3ULD A;  3EZ5 A;  4FLW A;  5JS2 A;  1GOA A;  4ZHR A;  1RT5 A;  3LPT A;  1XHX A;  1U47 A;  5HRP A;  4M3U A;  2YKN A;  4NYF A;  1KSP A;  3LPU A;  4LY7 A;  4E1N A;  2OPR A;  2Z1I A;  4MFB A;  2YHA A;  1Y97 A;  1C1A A;  4DTX A;  1EET A;  3P1G A;  1S5J A;  3TWH A;  3NH0 A;  3TI0 A;  1J54 A;  2O4I A;  4OKJ A;  4HUE A;  1KLM A;  1RT2 A;  1VSM A;  3VQQ A;  2QKB A;  3KK3 A;  3ZSR A;  1LAW A;  4DG1 A;  4J2B A;  1SKS A;  4R5P A;  4DU1 A;  3D45 A;  2HHT A;  1WSH A;  1RIL A;  3OJU A;  4C8L A;  3AVK A;  2OPQ A;  3ZSO A;  2W42 A;  4BDY A;  1NK7 A;  4B9M A;  3QER A;  1CZB A;  2XO7 A;  1HMV A;  5HP1 A;  3VQE A;  2OPP A;  1S1W A;  2HND A;  1EP4 A;  2BAN A;  3CG7 A;  4ICL A;  4DQR A;  3QEI A;  5KGX A;  1JLB A;  3LZJ A;  2BDP A;  1ZBI A;  3CM5 A;  4CF8 A;  1VSK A;  3DMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...