1HRHA

Crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
125
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ribonuclease H domain of HIV-1 reverse transcriptase.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 37
structure length 125
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1991-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hrhA00
2Z1IA 3UIQA 5FRMA 3C95A 3LP3A 1BCMA 2RPIA 2DTUA 2JLEA 2HHVA 3V1QA 3K5OA 3V6DA 3TR8A 3I0SA 3QIPA 4CEBA 1JLGA 1VRUA 1QHTA 4I9LA 3T1AA 3SI6A 5T7BA 4DQIA 3CM6A 2X74A 1B92A 1Q9XA 4PUOA 3L8BA 2AJQA 1BCOA 4C8OA 4E7HA 3EZ5A 4QCLA 3P83D 1RTIA 1D9DA 3HO1A 1U04A 4BE2A 1KTQA 3HP9A 4CK3A 4DLEA 4CEFA 4FJHA 2HHQA 4HUEA 1JLFA 1HRHA 3HSTB 3NF6A 4BE1A 3ALYA 4CE9A 3QNOA 1ZBIA 1ASVA 3AO5A 4OGCA 2Q3SA 3VQAA 1G15A 4Y1CA 3ZSRA 4E3SA 3K5LA 3TAMA 4CGJA 1NK0A 4W5RA 4RW8A 3M8RA 1O1WA 4CGFA 4OKKA 3M8SA 3NF9A 3OYJA 3HVRA 2DFEA 3ZSOA 4HUFA 3QESA 4FK2A 4Z4FA 4DFKA 4CF2A 4E7KA 4FLXA 1NOYA 3VQ9A 4N76A 4CFDA 4PY5A 1VRTA 2F8TA 3OYHA 1BHLA 3CM5A 4ELTA 1B9FA 4CFCA 4CK2A 5HRPA 3LZIA 3IG1A 2G8FA 1LWCA 1TAUA 3ISNC 1RNHA 2YNGA 3AO4A 3PUFA 3RMCA 1JLQA 1WNSA 3SNNA 3OYFA 4CHQA 1S6PA 1BI4B 3AO2A 2E4LA 1NK5A 5C24A 4CF0A 5J1EA 3V9XA 2P51A 1SKSA 4OLAA 4H4MA 4O4GA 4CJ4A 4CJKA 1VSDA 2VG7A 1B9DA 4Z4HA 4O44A 4FLUA 4CESA 3KK2A 1Y97A 3S3NA 3DLBA 4DSJA 3AVMA 3WNFA 2KFZA 2YNFA 3SPZA 1EX4A 4BWMA 2G8HA 5HLFA 1T03A 3O4NA 3S9HA 4CEQA 4F2SA 2ZE2A 4CF9A 3K2PA 3NFAA 4I9QA 3QEPA 3TAPA 2GV9A 4CECA 3KLGA 1FKOA 2VG5A 4M42A 2WOMA 3SCXA 3O3HA 3RR8A 4W5NA 1VSKA 3THVA 1TKZA 3LAKA 1RDBA 4PA1A 4DLGA 5FRNA 4CGHA 3SPYA 3VA3A 3AVCA 4R5PA 3MEEA 5EU7A 3VQQA 4BDPA 3AO1A 5HBMA 3DYAA 1LWEA 4I2PA 4DF4A 3DLHA 4FVMA 1BGXT 3KK3A 3ZT0A 4AH9A 1BISA 4Z4EA 4KTWA 3V4IA 1TK8A 3ZT2A 4NYNA 4AHSA 4B9TA 1IKYA 3RRHA 4OLBA 4IG3A 1IKVA 1CXQA 1S1TA 4BWJA 4CERA 1KVCA 4CFAA 4CGGA 2IOCA 4DFJA 3TABA 2BDPA 4IKFA 1WSJA 4JS4A 3IRXA 2JGUA 2ZD1A 4CIEA 3OJUA 4DF8A 1C1BA 2HVHA 1GOAA 3U3YA 3MXIA 1RTJA 3QEWA 2RKIA 2G8UA 1TKXA 4B9MA 2P1JA 4GW6A 5HROA 4FLWA 3ULDA 3HL8A 3OYIA 2XY6A 3PO4A 1W9HA 2KTQA 3VQCA 3P1GA 3C94A 1RT2A 4AHRA 1JXEA 1WSIA 3EYZA 3BDPA 1S9GA 2ITGA 2P5GA 5KGWA 4ID1A 3L2UA 4EZ9A 4LSNA 3DRPA 2XY7A 3SZ2A 2XY8A 4LY7A 4DSLA 5I42A 4ICLA 4CJFA 1VK0A 1HNIA 3HPGA 3ZSQA 1XHXA 3RMAA 3WNEA 3OVNA 1QSSA 4H8KA 1BQMA 2IC3A 3OYGA 4DTNA 2A1RA 1S5JA 2HNYA 3DRSA 3P5JA 2OPRA 4HHTA 1KSPA 1WSFA 3DLGA 4CEAA 4CEEA 4MQ3A 4UQGA 3AVLA 2VWJA 5I3UA 5FDLA 3HJFA 1A5XA 3AV9A 3MAQA 5J2NA 1U47A 1BIZA 1KFDA 3V9WA 1RTDA 3KTQA 3V1OA 1A5VA 3PO5A 4E0DA 4Z4CA 4H4OA 1ZBHA 4B8CA 3NGZA 4FXDA 1BIUA 4FJKA 1WLJA 4FLVA 3NAEA 1KVAA 2D0BA 4CF1A 3O3FA 1Q8IA 2IAJA 3G10A 3MXJA 3V9SA 4LD0A 3QETA 1DTTA 3QEXA 4C8KA 3OYAA 1TL1A 2Z1HA 1EETA 3VQ4A 3KD5E 5CYMA 4GMJB 2FC0A 4FJLA 2F8SA 4E89A 3TI0A 3DM2A 4NCAA 3HP6A 5J2QA 4B3OA 1TVRA 3KKRA 3AA3A 5JS1A 4DQSA 3O3GA 4DTPA 1HNVA 4JRPA 3C6UA 5CY4A 4ZTFA 2OZSA 3HYFA 4B9NA 2DY4A 3QEVA 3NH2A 3IS9A 1K6YA 3OYLA 4FLZA 4BE0A 4B9LA 2W42A 4J2BA 3V1RA 1HYSA 1RT5A 1D5AA 3CFOA 3KIOA 4RG8A 4DSFA 3TAFA 3LALA 4HVJA 4LH5A 1RDCA 1GOCA 2D0CA 3HXMA 2PYJA 4KHQA 3VQ5A 4K8XA 2WONA 4CF8A 4BACA 3FFIA 4BDZA 3QERA 1L3SA 1CXUA 5HP1A 2QKKA 3L2WA 3QINA 4ELUA 4W5TA 2ATQA 2HNDA 2D0AA 1IH7A 3VQ6A 5SWMA 3OY9A 3HPHA 4CJUA 4M3UA 3M8PA 3ZT4A 3F9KA 2Z1JA 4E1MA 3TWHA 3NGIA 1D8YA 1X9WA 4M3TA 1U49A 1SV5A 4E1NA 1HMVA 3WNHA 1SL2A 3U6FA 1REVA 3MEGA 4CJEA 4KFBA 1CZ9A 3V9UA 1T05A 4F8RA 1HYZA 4FW1A 3VQEA 2XRIA 3MECA 3WNGA 5CZ1A 3QO9A 4YNQA 2YHBA 4CJ5A 3NH0A 3K5MA 5D3GA 4KB1A 4JRQA 2E6MA 4AILC 4IDKA 1KFSA 2XHBA 2G8VA 4FJGA 2QKBA 4CEZA 3T3FA 1QTMA 2Y1IA 1L3TA 1LV5A 1WN7A 4L8RB 4AHCA 4FW2A 3OYDA 3JYTA 4DTMA 3AVAA 4DU3A 4FM1A 4FZYA 1L3UA 3TAGA 4CHPA 1YT3A 2B6AA 3NGYA 3LZJA 2NUBA 2PYLA 4FZXC 1JLAA 4KHNA 3CG7A 4DU1A 3AA2A 2GUIA 1JL1A 4IG0A 1NOZA 2OPPA 5CZ2A 1FK9A 1WAJA 1LAWA 3PX6A 1L3VA 2HMIA 1SL0A 4DWIA 1Z26A 1YVUA 4HCBA 3AVKA 4EZ6A 3KKSA 1ZBLA 4OKEA 3G0ZA 2EHGA 3KLHA 1QE1A 3L2RA 1C0TA 1VSEA 1ZBUA 1RT6A 1FXXA 1RCHA 4IFYA 4W5OA 2KZZA 4OPKA 4M3RA 2EX3A 1SUQA 3AVFA 2BE2A 3DLRA 3ZSWA 4AHVA 3KJVA 3TARA 3S3MA 4PWDA 4DFPA 3DLKA 1ZBFA 1KLNA 1RT1A 4HCCA 2ETJA 2OPSA 3BGRA 3QEIA 4XIUA 3RR7A 4KHUA 4CEOA 2IS3A 1XI1A 4FJNA 1IKWA 3M8QA 4ZHRA 3L2VA 4MFBA 3V9ZA 4KO0A 1UA0A 1ITGA 1UAXA 3HT3A 3SYZA 4M3XA 2HB5A 4DG1A 1KCFA 5CYQA 3AVIA 3B6PA 3ASMA 1WSGA 3SV4A 3LWLA 3DRRA 4IFVA 4RW4A 3OS0A 1QQCA 1EP4A 2BANA 5DK5A 3VQPA 2I5JA 3KK1A 3SQ2A 4F3TA 1J53A 5J2MA 4DTSA 3NF7A 1WSHA 3NDKA 4NCBA 4I7FA 3L3UA 2IDOA 4ZTJA 3NF8A 3SJJA 3SQ1A 1X1PA 2OZMA 3LP0A 1LWFA 4IBNA 1NK6A 1WSEA 3SUOA 4CJTA 1RDDA 4CJQA 1TK5A 3DLEA 3ZSXA 2YNHA 1C1AA 1W0HA 1Z25A 3VQDA 4CIGA 3LWMA 3D0PA 2HW3A 2X6SA 4JS5A 1IO2A 1RILA 5KTQA 4DTUA 4CGIA 1WAFA 4O5BA 2HHWA 4OPJA 3NH1A 4F2RA 4FJ5A 4M41A 2HVIA 3O4QA 4NCGA 3K57A 1BL3A 2KQ2A 1NK7A 1BQNA 4OJRA 1JLBA 1UWBA 2GBZA 4CJ3A 4E19A 3HPOA 2B4JA 3SUPA 2HHSA 3ZSVA 3OYNA 1QSYA 1C6VA 4DS4A 4B9UA 4DSIA 4KAZA 5E41A 3VQ7A 4HTUA 2X6NA 5C42A 4M3ZA 1QS4A 3AVHA 3AVBA 4E7LA 1A5WA 3EY1A 1L5UA 4B9VA 4KHSA 4BDYA 1KLMA 1KVBA 4DSKA 2HHUA 2QK9A 4KREA 1U4BA 2RF2A 4FM2A 3SV3A 2KZMA 1JLEA 4WE1A 1TK0A 3AA4A 4N47A 4NYFA 1CZBA 3OS1A 1NJXA 4FYDA 3LANA 2IGIA 1S6QA 3B6OA 4CHZA 4KTQA 1RTHA 4FJ7A 4FJ8A 4Z4IA 3T19A 4CJSA 4C8MA 3U3GA 4DQQA 2XY5A 4QAGA 3HM9A 4FJJA 4DTJA 4FZZA 2X78A 1VSLA 3RRGA 3TAEA 4GVMA 4FK0A 3LAMA 3HK2A 3AVGA 2OPQA 4E7IA 1NKCA 3L2QA 1N5YA 4W5QA 2ZQBA 4CJWA 3KLFA 3PX4A 3DMJA 3KD1E 3AVNA 1S1XA 3ZCMA 4Z4GA 2HHTA 1X9SA 3KLIA 2Z1GA 1NK4A 1TL3A 2D5RA 1SKWA 4B08A 1SL1A 2VWKA 1RBUA 3OYCA 1VSIA 1NKEA 1ASUA 2YNIA 4N56A 4FM0A 4N41A 1T8EA 4KTZA 5J2PA 1VSJA 1J9AA 1TKTA 1HJRA 4O0JA 4N5SA 1ASWA 4DQPA 4J2AA 3SUQA 5KI6A 1RBRA 4OVLA 1TGOA 1RT4A 4FCYA 4OGEA 1R0AA 1C1CA 2QXFA 4RW9A 1YTAA 4DTRA 3ZT3A 5KGXA 1HQEA 4RW6A 1RBVA 2HNZA 4CJRA 3CQ8A 1I3AA 5JS2A 3TAQA 2O4IA 4CJVA 1RBSA 3RTVA 2P5OA 2RN2A 4CK1A 2YKMA 3LDSA 3DOLA 3LP2A 3MXMA 1QSLA 4CFBA 4FJMA 2KFNA 4M3YA 4DTOA 4M3WA 3D45A 2BGGA 4EP4A 3VQ8A 4TSXA 4G1QA 2FBYA 4M45A 4O0IA 4EP5A 1J54A 4FJ9A 3ITHA 3I8DA 3PV8A 3L3VA 1S1UA 1NJWA 1BI4A 2G8KA 1KRPA 4FLTA 2Y1JA 4CHOA 4DSEA 2OYQA 3DI6A 4FJXA 4CGDA 3QNNA 1RT3A 3SUNA 3OYEA 2PY5A 4CCHA 4FJIA 3VQBA 4KI6A 2KW4A 4AHUA 3F73A 3CFPA 4FK4A 5SZTA 3RMBA 4YFUA 3DOKA 2R7YA 1ZYQA 1XWLA 4O55A 4Q5VA 3ZT1A 1UOCA 1MU2A 3QLHA 4OKJA 5C25A 3OJSA 3NE6A 1HQUA 2FBTA 3OS2A 1RBTA 3LPTA 4CHNA 4Y1DA 4B8AB 3NHGA 1N6QA 4Z0UA 4E7JA 4CEDA 2OA8A 4K8ZA 1EKEA 1TAQA 4DQRA 1X9MA 4J2DA 1JL2A 5HRRA 5FROA 2XO7A 3V81A 1F21A 3ZSZA 3PX0A 4C8NA 4JLHA 3IAYA 1NJYA 1TV6A 3CFRA 4C8LA 4I2QA 1S1VA 2A1SA 1HPZA 1NKBA 3OYMA 4CJPA 1JXBA 1LAVA 1JLCA 3ZSYA 4CIFA 3PY8A 4F4KA 1NK8A 3LP1A 1IKXA 2FBXA 4CJLA 3SQ4A 1U48A 3OYKA 1U45A 2PZSA 3K59A 1T7PA 4KPYA 4FLYA 2DFHA 4DU4A 1S1WA 2B5JA 3I0RA 1IG9A 1NJZA 4KB0A 4DFMA 3CYMA 4F3OA 1GOBA 2DFFA 3VA0A 5DMRA 4ID5A 1C0MA 1S9EA 3NCIA 4ELVA 1C0UA 1RT7A 3LPUA 1NK9A 4DMNA 3KLEA 4QOZB 3TANA 1VSFA 1RDAA 3A2FA 1XHZA 5KRTA 3JSMA 3RMDA 3MEDA 4DS5A 3VN5A 3AO3A 5KRSA 5HRNA 1Q9YA 2G8WA 3OYBA 3RWUA 1JKHA 4HUGA 4J2EA 3S3OA 3AA5X 2YKNA 4KV8A 1DLOA 1FKPA 3NBPA 1EXQA 2YV0X 4KHYA 1D9FA 1YTUA 2HHXA 4LSLA 5K14A 4KHWA 4CHYA 3SQ0A 3AVJA 4PQUA 4Q0BA 1HYVA 1LW2A 4RW7A 1UA1A 4KI4A 4DTXA 4KRFA 4KKOA 4LH4A 4B9SA 1VSHA 5HRSA 3K58A 3QIOA 1XC9A 3K5NA 2G8IA 1CLQA 2F96A 3E01A 2E6LA 2YHAA 4AHTA 3C6TA 1J5OA 1TKDA 2VG6A 1I39A 1LW0A 2FBVA 2LSNA 1SKRA 3HVTA 2O4GA 3H08A 1VSMA 1DTQA
chains in the Genus database with same CATH superfamily
5E84A 3UIQA 1QZ6A 4DCHA 4BRAA 3EKSA 3K5OA 3I0SA 3QIPA 2FF6A 4DQIA 3T1AA 5T7BA 4PL7A 1Q9XA 1BOTO 1NGAA 3L8BA 4QCLA 1IJJA 3THWB 4JI7K 4OPAA 4BE2A 3BP8A 4E3SA 3EE8A 3ZSRA 3U4LA 2UYTA 4RW8A 4CBUA 5TKWA 4FK2A 4HUFA 3ZSOA 3QESA 2YI1A 4DFKA 4CF2A 1T6CA 3VQ9A 3KZBA 3GOIA 1VRTA 3CM5A 1B9FA 3JS6A 3G71N 4JD2A 5KPTA 3OTOK 1LWCA 4EHTA 3ISNC 2F9WA 3RMCA 3PUFA 5E26A 4CBXA 1JLQA 3A5LC 3AO2A 1KXPA 2ZJRL 5C24A 3V9XA 3FE1A 5FPNA 4DQ8A 4O4GA 2HSTA 4A59A 5AQPA 4YY3K 1QVGM 3O9QA 2G8HA 2QWQA 3O4NA 3CD6N 1X3MA 3CERA 4PHTX 1VHXA 3PIPL 3TAPA 4M42A 5BR8K 4W5NA 4JI1K 2QEXN 3LAKA 4PA1A 2RHKA 4CGHA 3E9PA 1N32K 3CC2N 1BGXT 3KK3A 4AH9A 4Z4EA 5AQJA 1VQKN 3V4IA 4IG3A 3G4SN 3JXUA 3CC4N 3O1BA 4DFJA 1KVCA 4CGGA 3TABA 4IKFA 3MN9A 3A5NC 1YIJN 4JS4A 3E1YA 3MXIA 1TKXA 2P9KA 5HROA 5AZIB 1V4TA 4PKHA 2GELA 2ZGZA 3PO4A 3IFRA 2QA4N 4JKHA 3EYZA 1S9GA 1RFQA 5KGWA 3L2UA 4DV7K 4LSNA 2XY7A 2XY8A 4LY7A 4QS9A 3OVNA 4CZFA 4DV1K 4DTNA 2HNYA 4HHTA 3VF4A 4RWTA 3U9ZA 5FDLA 1A5XA 4IJAA 3MAQA 1KFDA 1RTDA 3N4PA 3KTQA 2HHSA 3ZX0A 3KWIA 4FXDA 4FJKA 4BR2A 2E5LK 1KVAA 3QETA 4C8KA 1YUWA 2Z1HA 4BR5A 4E89A 5GINA 4BRGA 3HP6A 1OH7A 4B3OA 3KKRA 3AA3A 4M63C 3CHWA 4B9NA 4WQ5A 3IS9A 1Q82O 2YHYA 4BE0A 3KK7A 4B9LA 1D5AA 3AGRA 4LH5A 1RDCA 1GOCA 3HXMA 4MO4A 4CF8A 1L3SA 3L2WA 4ELUA 1K73O 3G25A 4W5TA 1IBLK 3VQ6A 3HPHA 4CJUA 3LDLA 2FLOA 3ZT4A 2Z1JA 4E1MA 1V4SA 3NGIA 1X9WA 2O8CB 2I7PA 1SL2A 3MEGA 1CZ9A 4B3RK 4F8RA 2HHHK 1GLLO 3VQEA 2YHBA 4CD3A 5D3GA 3THYA 4JRQA 4B1UB 3AAQA 1KFSA 2QKBA 2BH1A 3LDNA 3CCUN 1LV5A 1WN7A 2W6KA 4L8RB 4DTMA 2HBMA 3AVAA 4FZYA 4JI2K 3VGLA 2P9IB 1NOZA 5CZ2A 3PX6A 1SL0A 4WQ5C 1Z26A 1EO1A 2O8CA 3QB0A 3KLHA 1S3XA 4GVEA 1K8AO 1VSEA 1FXXA 2P9LB 4JKDA 1RCHA 2KZZA 3K0SA 5LJWA 4M3RA 1SUQA 3AVFA 1KD1O 3FZHA 4DFPA 3DLKA 4HCCA 3QEIA 1QQNA 4FJNA 1UAXA 3HT3A 3SYZA 2HBKA 3B6PA 3QFPA 2HF4A 1WSGA 3KVGA 4NO7A 3LWLA 4PL8A 3HK2A 2YJEA 3KK1A 2BUPA 1WOQA 4F3TA 3D2EB 4IWVA 3CJCA 3NF7A 4I7FA 3L3UA 3WT0A 2QM1A 4ZTJA 2P9KB 1X1PA 1LWFA 4CJTA 1RDDA 3FGUA 4CJQA 1TK5A 1XQSC 3ZSXA 1Z25A 4CIGA 3J81O 4JS5A 2E1ZA 5GAEP 1N34K 4O5BA 3NH1A 4M41A 4JNEA 3O4QA 1W7AA 4NCGA 3FZFA 2KQ2A 1BQNA 4OX9K 1UWBA 4E19A 2B4JA 4B9UA 3PIOL 3ZETB 4JI8K 2O8BA 3AVBA 4B9VA 4K25A 4KHSA 4BDYA 1KLMA 1KVBA 2QK9A 1BU6O 4A57A 3O4WA 3OS1A 4LFAK 4FJ7A 3B6OA 4BY9C 3T19A 2XY5A 4QAGA 4DTJA 3I8BA 2X78A 3RRGA 3LAMA 4MLHA 2E88A 4DR4K 4E7IA 4W5QA 2ZQBA 1KAXA 3KLFA 4CZMA 5H1SQ 1S1XA 1VQ6N 4Z4GA 2NNWA 3CCRN 2Z1GA 2D5RA 4BR4A 1VSIA 3EKUA 4N56A 4JK7A 5AQGA 1YHQN 4JD2B 4WQ4A 3GL1A 1VQON 4O0JA 4N5SA 4BRHA 4DQPA 3TU5A 4J2AA 1NJIO 4IFEA 4EHUA 4FCYA 1C1CA 4RW9A 4DTRA 2DPNA 1HQEA 4RW6A 1RBSA 3RTVA 4CK1A 4JHDA 3LP2A 2KFNA 4BVPA 4M3YA 1P8ZA 2BGGA 3VQ8A 4CZGA 5F0XA 4M45A 4KH4A 4JHDB 4FJ9A 3PV8A 1XMOK 1NJWA 2F9TA 4DSEA 2UXBK 3SMPA 4BGAA 3T1HK 3FZKA 4KI6A 4CCHA 2OCEA 1VQLN 4AHUA 1OH5A 3F73A 4FK4A 2WFBA 1NGFA 3DOKA 2R7YA 5LMUK 1ZYQA 4Q5VA 3TSUA 4A5BA 1VQ5N 1HQUA 4A62A 3LPTA 3TPQA 4WYBA 1DEJA 1EQYA 2HBJA 3NHGA 4LF7K 4LF5K 2NRRA 1EKEA 5FPMA 4CZJA 1SZ2A 5FROA 4UY8O 3UKUA 4FWQA 2NRXA 4JLHA 3CFRA 2O8DB 1S1VA 1JXBA 4OPHA 2CGLA 3C0BA 4GY2B 4JI0K 2E2OA 1DT9A 1E3MA 2GTDA 2D0OA 2NRHA 3ZSYA 4JYAK 4PKIA 4CJLA 4R79A 3E9LA 3OYKA 2JWKA 3AGKA 5KQ8A 1T7PA 2Q0UA 4KB0A 3I0RA 1BA0A 4B3MK 3CYMA 1WBDA 2DFFA 3OA9A 3VA0A 3NVKA 4L3QA 4O8UA 3CJBA 4CD1A 4ELVA 5LMNK 1OKJA 1RT7A 4DMNA 1BDGA 1NGGA 3EZWA 1XHZA 5KRTA 4WQ4C 2V51B 3MEDA 4DS5A 2O8EA 5FPEA 1U2VA 4M7YA 3RWUA 4KH6A 3S3OA 3CCLN 1T3VA 3WXJA 1LCUA 1DLOA 1FKPA 1EXQA 1VQPN 3A5MC 5K14A 4KHWA 5M1KA 4PQUA 1VAZA 1HYVA 1LW2A 1S22A 1UA1A 2HOEA 4FOIA 3GDQA 4KKOA 1VSHA 3D6RA 5HRSA 1XC9A 3WXKA 2CGJA 1G99A 3E01A 3CJ7A 2E6LA 2YHAA 1J5OA 1I39A 1D4XA 3THXA 3H08A 1YJ9N 2DTUA 3LP3A 2JLEA 3VENA 3HZ6A 3TR8A 1JLGA 3CM6A 3VEXA 1BCOA 4E7HA 3CCJN 1YF5L 4IOCL 1KTQA 4CK3A 4DLEA 4FJHA 4CEFA 1JLFA 1ZC6A 3HSTB 4BE1A 4X65K 3ALYA 5HOOA 3DWLA 3MN5A 3SBTA 3VQAA 3TAMA 4W5RA 3WEEB 3M8RA 4CGFA 3OYJA 2DFEA 1SAZA 1IG8A 4BC5A 4CFDA 5ELZA 3OYHA 3TSPA 4CFCA 4CK2A 1KQSM 2VQEK 1XC3A 2Q97A 4YOWA 3RSEA 2YNGA 2AA4A 3SNNA 5M1QA 3OYFA 3TTDA 2P9NB 1S6PA 3ZLJA 5BPLA 2KKZA 1NK5A 5J1EA 4H4MA 4CJ4A 2VG7A 4O44A 3S3NA 5I9EB 4DSJA 3AVMA 2YNFA 4PKGA 5HLFA 2P9PB 3CJ9A 1T03A 4HWIA 4F2SA 4CF9A 4DR3K 4I9QA 1W2BM 3S41A 3C7NB 1FKOA 2VG5A 2WOMA 3SCXA 4FWRA 3MCPA 3ZEUA 3SPYA 3AVCA 3MEEA 4BDPA 1HLUA 5BRFA 2E2QA 3MX2A 4GV3A 3LM9A 5FLXO 1KAZA 4BWJA 4CERA 4ILHA 2IOCA 3FZMA 1WSJA 3IKMA 2JGUA 4NB4A 1C1BA 2HVHA 3ZX2A 2G8UA 2AP1A 4YOTA 3K9JA 3H3OB 4YOUA 3ULDA 3HL8A 3E9OA 1W9HA 3EO3A 2KTQA 3P1GA 1RT2A 2O8BB 3VETA 4ID1A 2D0PA 3CMEN 4H0VB 4DSLA 5I42A 2GUPA 1Z6RA 3TTFA 1VK0A 3L0QA 1HNIA 3HPGA 3ZSQA 4AM7A 1XHXA 4BR0A 1BQMA 3OYGA 1S5JA 3P5JA 5CE3A 2OPRA 1KSPA 1WSFA 5AQLA 4CEAA 4MQ3A 2VWJA 5I3UA 3AV9A 5J2NA 1BIZA 1ZBHA 3DJCA 4H4OA 1BIUA 4FLVA 3VEVA 2HMIA 1Q8IA 3G10A 2VWBA 3V9SA 1TL1A 3VQ4A 4AQYK 3KD5E 3QFUA 2FC0A 5LL6Z 2F8SA 1M90O 4NCAA 5C10A 4B1XB 4BRIA 5A2QO 4GKJK 5JS1A 1HNVA 4JRPA 4NXMK 3HYFA 2DY4A 4BGBA 3VERA 3R9PA 3KIOA 4RG8A 3ZX3A 2OTLN 4KHQA 2GX9A 4BDZA 1YITN 1CXUA 5HP1A 2QKKA 1KC8O 5AFUA 3C6AA 4FWLA 4LFCK 4CJ7A 1X9JA 3OY9A 4M3UA 2ASOA 3EE9A 2ZJQL 4M3TA 4E1NA 1HMVA 4H0TB 3WNHA 3U6FA 1REVA 1HPMA 1T05A 4G9ZA 2FSNA 2QWPA 4FW1A 4O8KA 3M6GA 5CZ1A 4DUZK 3VESA 4YNQA 2FSKA 2E6MA 2XHBA 1VQ9N 2ZM6K 3HBTA 4CEZA 2GWJA 4AHCA 4FW2A 3JYTA 4JKBA 1ILYA 3F5TA 1YT3A 4KHNA 4FZXC 3CG7A 3O8MA 4CZEA 1JL1A 2QWNA 2QWOA 2OPPA 1L3VA 4IEEA 4JKCA 1LAWA 4DWIA 1YVUA 1ZBLA 2EHGA 4BG8A 1QE1A 4WFAL 5BPNA 4IFYA 1MA9B 5BN9A 4Z94A 4BC3A 3F9MA 4DR6K 5GIPA 1YAGA 3S3MA 2CH5A 3R8EA 1GLBG 5ADXH 4ZHRA 4GV9A 4K43A 3L2VA 4MFBA 1UA0A 4M3XA 3J8AA 1KCFA 4H03B 4DG1A 5CYQA 3ENBA 2NRTA 4IOXA 3BY5A 4LF8K 1EP4A 3SQ2A 5DK5A 3VQPA 4DTSA 4NCBA 1IBKK 3NF8A 4E1JA 3SLCA 3SJJA 3LP0A 1HKCA 2A40A 2HMPA 4IBNA 5AQMA 3DLEA 2YNHA 1W0HA 3VQDA 5BRDA 3LWMA 4RCHA 2X6SA 3IUCA 5AQXA 4DTUA 1WAFA 1OH6A 2HHWA 1BL3A 4OJRA 1JLBA 2GBZA 3SK3A 4CJ3A 5AQSA 5AQOA 3HPOA 2UU9K 3OYNA 1QSYA 4DSIA 4KAZA 4CW7B 2P9LA 4M3ZA 3AVHA 4E7LA 1A5WA 3EY1A 1L5UA 3Q7CA 3ZEUB 1U4BA 4FM2A 2KZMA 1TK0A 4N47A 4NYFA 1CZBA 4FYDA 3VMFB 3C7NA 2YHXA 4CHZA 4F9OA 3K9KA 4DUYK 4C8MA 3U3GA 2E1YA 3CMAN 1OH8A 4FZZA 4BRNA 4GVMA 4DV2K 4EIAA 5JLHA 2ITMA 4DHYA 1N5YA 2E8AA 3PX4A 3KD1E 3AVNA 3DAWA 1ATNA 3DXKA 3KLIA 1SL1A 2VWKA 3FFKB 5JMVA 4N41A 4JKGA 1T8EA 4FL9A 4BROA 1NWKA 3RSEB 3HTVA 1TKTA 1Z05A 3AARA 5KI6A 1RBRA 1TGOA 3H3NO 4U7BA 2O4IA 4FSVA 2RN2A 2YKMA 1QSLA 3W0LA 4EP4A 1JCGA 2A6AA 2FBYA 4YDUA 4O0IA 3CF5L 4EP5A 1J54A 5M1PA 5C15A 1S1UA 1VQ4N 2G8KA 1KRPA 2Y1JA 4CHOA 4FJXA 5AFUH 3QNNA 2YX6A 3WUHA 2PY5A 2KW4A 4BREA 3RMBA 1TYQA 4O55A 3E66A 4IZ9A 1MU2A 2F7TA 4OKJA 4EFHA 4B8AB 4X66K 4Z0UA 2OA8A 1JL2A 2XO7A 3ZSZA 3IAYA 2Q1NA 1TV6A 5GAHP 4ILJA 4LFBK 1HPZA 1NNEA 3ID8A 4YOXA 1QQMA 4OO1J 5LJVA 3PY8A 3R3LA 4IO8A 3Q7BA 2A42A 1U45A 2PZSA 3K59A 4FLYA 4DU4A 2B5JA 2P9SA 5EOYA 1NJZA 4X64K 4DV3K 1GOBA 5DMRA 4FWMA 1WB9A 3SJHA 1S9EA 3NCIA 5M1FA 1NU0A 1C0UA 3UKRB 1NK9A 4BRLA 5IT9O 3JSMA 3O9TA 3AO3A 5KRSA 1GLJO 1ESVA 5BN8A 3AA5X 2YKNA 4KV8A 1WBBA 1VQNN 4KHYA 4DR5K 3HRGA 4C1NI 4LSLA 1OVYA 3LDOA 2OANA 3AVJA 4Q0BA 3R6MA 1YJWN 4CZLA 4DTXA 3AY9A 1MWMA 3QIOA 3I56N 5AQZA 1Q86O 3C6TA 1TKDA 4QS8A 3T69A 2NLXA 3UKUB 1LW0A 1SKRA 3HVTA 3A0IX 4CZKA 3M5RA 2NRVA 3VA3A 1DTQA 2Z1IA 3C95A 1NGJA 3EN9A 3V1QA 4CEBA 1QHTA 2NRWA 2X74A 4PUOA 4BQZA 2AJQA 4C8OA 1BUPA 1N33K 4JAXA 5C2FA 1RTIA 5AQHA 1D9DA 3P38A 3HOSA 2VYPA 2VGNA 1ATRA 3HP9A 3SAFA 4HUEA 4JI4K 4OGCA 1FJGK 4Y1CA 1NK0A 3HI0A 4JEPA 3THYB 2EWSA 1O1WA 3M8SA 3NF9A 3KWGA 3HVRA 4Z4FA 4DR1K 4E7KA 4FLXA 2WC9A 3H46O 2VQFK 2F8TA 1BHLA 1I94K 5HRPA 4CI6A 3LZIA 3IG1A 2G8FA 3P31A 1TAUA 3AO4A 1WNSA 4JKGB 1QZ5A 1BI4B 3L6QA 2E4LA 1SKSA 2QWMA 4JK8A 3CCQN 1HUXA 1VSDA 1B9DA 4Z4HA 4BRMA 4FLUA 4CESA 3KK2A 3DLBA 2KFZA 3SPZA 2ZE2A 2GV9A 3MCAB 3RR8A 3O3HA 2V7ZA 1TKZA 1YI2N 1RDBA 2D4WA 4R5PA 5EU7A 3L4QA 4B1WB 3AO1A 4H5TA 4IJNA 3DYAA 1LWEA 4DF4A 2Q31A 4FVMA 1YXQA 1BISA 2HBLA 4NYNA 3ZT2A 4AHSA 4CBWA 3O1WA 3QMLA 2ZF5O 1CXQA 4I6MB 1RDWX 3MN6A 4CFAA 3D2FB 3VF6A 2ZD1A 4CIEA 2RE2A 1GOAA 2H3GX 2RKIA 4X62K 4GW6A 5B8HA 3OYIA 2XY6A 1YJNN 3VQCA 5JLFA 1JXEA 1WSIA 4K41A 2P5GA 2IVPA 4EZ9A 4JK9A 2W6LA 3SZ2A 3QDKA 4ICLA 4AF1A 4C1NK 4CJFA 1WUAA 1QSSA 3OHRA 2PBDA 2QTDA 2O8EB 3DLGA 4CEEA 4UQGA 1XMQK 1LOTB 4DKWA 1GLEG 3HJFA 4IO9L 1U47A 3PO5A 1A5VA 3MMVA 3NGZA 1DKGD 1WLJA 1HNWK 3O3FA 1NGIA 3MXJA 4LD0A 1DTTA 1EETA 2W41A 5CYMA 4GMJB 4IEIA 4FJLA 3TI0A 3DM2A 4H0OA 5J2QA 3U9DA 2E2NA 4DR7K 3C6UA 3MX5A 5CY4A 4ZTFA 3UE5A 4A2AA 3D7EO 4BC2A 4J2BA 2W42A 1RT5A 3CFOA 4DSFA 3MK6A 3MN7A 4HVJA 1QQOA 4QS7A 2WONA 1O13A 4BACA 3J7ZO 3QERA 2ASPA 1Q7YO 1T44A 2HNDA 2D0AA 1IH7A 2UXDK 5SWMA 3P4IA 4JN4A 1HX1A 5JICA 1SV5A 2QWRA 4CJEA 1NGEA 1NMNA 2QI2A 4KFBA 3LDQA 1X3NA 3VPZA 3WNGA 3MECA 3OBYA 5AQNA 3QO9A 3H45C 4A5AA 4CJ5A 3K5MA 3NMUA 4AILC 1M1KO 2G8VA 4FJGA 1L3TA 5JVHL 3OYDA 4DU3A 4BVOA 4FM1A 3TAGA 1NG9A 2A41A 2B6AA 3NGYA 3J7AP 4DU1A 4M7XA 3AA2A 1VQ8N 3VTHA 1FK9A 1WAJA 3VEYA 2ASMA 4HCBA 4OKEA 3G0ZA 2UUAK 2QXLA 3L2RA 3O80A 3LL3A 3CCVN 4W5OA 2GWKA 3ID6A 4OPKA 2EX3A 3BUZB 5AQTA 3ZSWA 5DM7L 1ZBFA 1KLNA 1RT1A 2ETJA 5AQYA 5EVZA 4CEOA 1XI1A 1HNXK 1IKWA 4KO0A 1ITGA 2I7NA 4LF4K 3SAGA 1SS6A 4FWOA 5GAGP 3ASMA 4ISFA 3CCEN 3ULEB 2P9SB 3DRRA 4RW4A 5M1NA 3MXMA 1QQCA 2IVNA 5HL7L 2I5JA 5EY4A 1FW6A 1N8RO 1WSHA 2IDOA 3ULEA 3SQ1A 2A5XA 2OZMA 2FSJA 5AZIA 1NK6A 1C1AA 2VCPA 2HW3A 4CGIA 4IDHA 4OPJA 4H5VA 3K57A 3CCMN 1NK7A 4V19S 1C0GA 3ZSVA 1DGKN 3PSIA 3VQ7A 5C42A 1QS4A 3BF1A 4LF6K 3SMSA 5DM6L 4KREA 2RF2A 4BRDA 1JLEA 2HF3A 1NJXA 4JKFA 3LANA 2IGIA 4FJ8A 4Z4IA 4KTQA 1RTHA 4DQQA 3D2FA 3MWTA 4FJJA 3O5BA 1VSLA 1NGDA 3WQTA 1GLCG 1SQKA 5AJ3K 3DMJA 3ZCMA 1X9SA 3CPEA 2J4RA 1NK4A 1IBMK 1SKWA 3OYCA 1NKEA 4FM0A 3F2KA 1GLDG 1VSJA 1J9AA 4H0PA 1ASWA 5LY3A 2QWLA 4OVLA 2ZJPL 4OGEA 1R0AA 4K0KK 5KGXA 4CJRA 1RBVA 1I3AA 2HHTA 4FJMA 3AAPA 3LDSA 4CFBA 3WEEA 1NGBA 4H5RA 4M3WA 3D45A 4G1QA 1EWRA 1R59O 1BWFO 3ZYYX 4KBOA 1BI4A 1MDUB 3DI6A 3IDHA 3THWA 4Y0WA 4FJIA 2YCHA 5SZTA 3DXMA 3U8XA 5AQUA 2Q0RA 2O8FB 3ZETA 3VGKA 3ZT1A 1UOCA 2FXUA 2UXCK 3HOTA 4H5WA 1RBTA 5CHIA 4CEDA 5MLCQ 2KHOA 4K8ZA 1TAQA 4DQRA 3FLCO 3QBXA 5HRRA 3THXB 2CGKA 4BRPA 3FZLA 1NJYA 4C8LA 5AZJA 1NKBA 3SBGA 3OYMA 4CJPA 1LAVA 4JI5K 1U6ZA 1JLCA 4BC4A 4CIFA 4F4KA 1NK8A 3LP1A 1IKXA 3SQ4A 3CCSN 3VEOA 4KPYA 2DFHA 1S1WA 4DFMA 2CH6A 2E2PA 1T6DA 4C23A 4MO5A 1U2VB 3TSQA 3KLEA 3TANA 1VSFA 3CJ1A 3A2FA 1NBWA 4FWNA 3WQUA 3VN5A 2ZWHA 1Q9YA 3ATVA 1JKHA 4HUGA 1Q81O 5AQFA 1J6ZA 2A3ZA 2F4VK 3NBPA 2YV0X 4BRKA 4B3TK 5C12A 1KAYA 2HHXA 4CHYA 4RW7A 4KI4A 2V7YA 3IMXA 4LH4A 4B9SA 5KPRA 3G6EN 3K58A 3JAMO 2VGMA 3VTIA 3K5NA 2G8IA 1ZBSA 2F96A 3J80O 2PFUA 1HKBA 2WBNA 4FWSA 2FF3B 1RGIA 2Q2RA 3H1QA 1VSMA 1YVNA 5AQVA 5FRMA 3RVCA 1BCMA 2RPIA 2HHVA 1BG3A 3V6DA 1VRUA 4I9LA 3SI6A 4JKAA 1B92A 4EAHD 1BO5O 4FOEA 1J5EK 3EZ5A 1MWKA 1ZXOA 4ISGA 3P83D 5F2RA 1HNZK 1JJ2M 3HO1A 1U04A 3N4QA 2HHQA 1E4FT 1TUYA 1HRHA 5AQWA 3NF6A 4CE9A 3QNOA 1ZBIA 1ASVA 3AO5A 2Q3SA 1G15A 3K5LA 4CGJA 4OKKA 5GIOA 1NOYA 1ATSA 2P9NA 4N76A 4PY5A 4RTFD 4ELTA 5BR9A 4J8FA 5F1XA 1RNHA 4CHQA 4B1ZA 4CF0A 4OLAA 2P51A 4CZIA 3DLLL 3CQYA 3QICA 4CJKA 5AQIA 3T1YK 1Y97A 2D1KA 4NLBA 3WNFA 3CQXA 1EX4A 4BWMA 3BEXA 3S9HA 4FPAA 4CEQA 1E4GT 3K2PA 3NFAA 3QEPA 4CECA 3KLGA 3OW2M 5TKYA 3WXLA 1VSKA 4U67L 3THVA 5FRNA 4DLGA 3L4IA 3VQQA 4DR2K 5HBMA 4I2PA 4BRCA 3DLHA 3HSCA 3GG4A 3ZT0A 1GLFO 4KTWA 1TK8A 4B9TA 1IKYA 3EL2A 3RRHA 4OLBA 5AQRA 2OTJN 1IKVA 1S1TA 2BDPA 3IRXA 4DV6K 4DF8A 3OJUA 1XNQK 4FVUA 1JCFA 3U3YA 1RTJA 3QEWA 4B9MA 2P1JA 3O08A 4ILGB 4FLWA 5BPMA 5KQDA 3C94A 4AHRA 3BDPA 2WTUA 3MWPA 2ITGA 3R1XA 5AR0A 3GBTA 1CZAN 3DRPA 3VOVA 1NLVA 3UB5A 4GNIA 4FPBA 4H0XB 2IIRA 5C0YA 1HR0K 3RMAA 3WNEA 4K42A 4MDBA 4H8KA 2IC3A 2A1RA 3DRSA 3CXCM 3AVLA 4H5NA 2KLAA 2BTFA 3V9WA 4E0DA 3V1OA 4Z4CA 2V52B 4B8CA 4BRFA 3NAEA 3CI5A 4CF1A 2D0BA 3SAHA 2IAJA 3QEXA 3C6HA 2QW9A 3B8AX 3OYAA 3H1VX 3VEZA 1RDUA 1TVRA 4DQSA 3O3GA 3DXMB 4DTPA 2OZSA 5CR4A 5BRHA 3QEVA 3NH2A 1S72N 3PLAA 5BREA 1K6YA 3OYLA 4YHHK 4FLZA 3V1RA 1HYSA 3TAFA 1QHAA 4B3SK 3LALA 1NMDA 4XH5A 2D0CA 1OVQA 2PYJA 3VQ5A 3H6EA 4CZHA 1JCEA 4K8XA 2P9PA 5C2DA 3FFIA 3QBWA 3QINA 2ATQA 3LM2A 4A61A 3ENHA 5AQQA 3M8PA 4XH1A 3F9KA 1P90A 3TWHA 1D8YA 1U49A 2PAVA 3BZCA 3V9UA 1K9MO 2ZGYA 1HYZA 3M3ZA 2XRIA 3CC7N 3KHYA 3DXKB 4DV4K 3GE1A 3NH0A 4KB1A 4XH4A 1W97L 4IDKA 1XUPO 1QTMA 3T3FA 2Y1IA 1K8KB 1HKGA 4WFBL 1BA1A 1L3UA 4CHPA 3LZJA 2PYLA 2NUBA 1JLAA 3O9SA 1C0FA 4BR9A 2GUIA 4IG0A 4IOAL 1XNRK 5EX5A 1Q18A 3AVKA 4EZ6A 3KKSA 2GEMA 4O5FA 4DB3A 3VF2A 4BRQA 2NRZA 1C0TA 1ZBUA 1RT6A 4PWDA 3DLRA 2BE2A 3KJVA 4AHVA 3I33A 3TARA 3CPWM 3OBWA 2OPSA 3BGRA 3LDPA 3VEWA 1NGHA 4XIUA 3RR7A 4KHUA 2IS3A 5M1OA 4GV6A 3M8QA 4AM6A 3J7YP 3WXMB 3V9ZA 2HB5A 1H1VA 2P9UA 3AVIA 4FO0A 3SV4A 4YOYA 3OS0A 4IFVA 2YHWA 2BANA 2WUSA 1J53A 4BR7A 5J2MA 4HTLA 3NDKA 3FR0A 4H0YB 4B1YB 4JI6K 1EWQA 4MLEA 1TUUA 4DV5K 1WSEA 3SUOA 4JKEA 4BQLA 3W3DA 3D0PA 3ENOA 4NXNK 1IO2A 1NGCA 1RILA 3BF3A 3WXIA 4BG9A 5KTQA 4JI3K 4F2RA 3NVMA 4FJ5A 3O9RA 2HVIA 4CVNE 4WCEL 5JVGL 3TTCA 3C65A 3SUPA 1C6VA 4DS4A 2E20A 5E41A 4HTUA 2X6NA 4FWKA 4YOVA 4DSKA 2HHUA 3SV3A 5AZJB 4YORA 4WE1A 3AA4A 1IV0A 1S6QA 3O6WA 2O8DA 4A2BA 4CJSA 3HM9A 3CJAA 4GKKK 4FK0A 3TAEA 5ADXA 4B1VA 3AVGA 2OPQA 1NKCA 3L2QA 4CJWA 1TL3A 4B08A 1RBUA 2O8FA 1ASUA 2YNIA 4KTZA 5J2PA 2YJFA 3P39A 1TYQB 1HJRA 4LC9B 3SUQA 5FPDA 1RT4A 2QXFA 1YTAA 3ZT3A 3TAQA 2HNZA 3CQ8A 5JS2A 4CJVA 2P5OA 3DOLA 3CIPA 4DTOA 4TSXA 4IXCA 1VQMN 3ITHA 3I8DA 3L3VA 1QVFM 3CETA 4FLTA 2OYQA 4CGDA 2JWLA 1RT3A 3SUNA 3OYEA 3VQBA 3CFPA 4YFUA 4MDAA 1XWLA 3EEQA 3QLHA 5C25A 3NE6A 3OJSA 2FBTA 4WF9L 3OS2A 3BZKA 4CHNA 2W40A 4Y1DA 3PSFA 4WFNL 1N6QA 4E7JA 1X9MA 4XEIA 4J2DA 1NM1A 4KH5A 1F21A 3V81A 2UUBK 3PX0A 4C8NA 4I2QA 3I55N 2A1SA 3A8YA 5IWAK 2UUCK 4YDUC 1U48A 2FBXA 2Q36A 4KHPK 2IVOA 5KPZA 4LF9K 1IG9A 4F3OA 4FWPA 4ISEA 2P9UB 4ID5A 1C0MA 3M1FA 3A5OC 1HJOA 3O9UA 1N36K 3LPUA 4QOZB 1RDAA 3RMDA 4I6MA 5HRNA 2NZTA 5GADP 2G8WA 3OYBA 4JV5K 4J2EA 5AQKA 1VQ7N 1D9FA 1YTUA 3SQ0A 4B9QA 3T7ZA 1GLAG 3D2EA 4KRFA 5EXWA 2P9IA 1CLQA 3HM8A 4DV0K 4AHTA 2VG6A 3ATUA 4NLCA 1K8KA 2FBVA 3UKRA 2LSNA 2O4GA 1Y64A 3MDQA 3VGMA
chains in the Genus database with same CATH topology
2Z1IA 3UIQA 5FRMA 3C95A 3LP3A 1BCMA 2RPIA 2DTUA 2JLEA 2HHVA 3V1QA 3K5OA 3V6DA 3TR8A 3I0SA 3QIPA 4CEBA 1JLGA 1VRUA 1QHTA 4I9LA 3T1AA 3SI6A 5T7BA 4DQIA 3CM6A 2X74A 1B92A 1Q9XA 4PUOA 3L8BA 2AJQA 1BCOA 4C8OA 4E7HA 3EZ5A 4QCLA 3P83D 1RTIA 1D9DA 3HO1A 1U04A 4BE2A 1KTQA 3HP9A 4CK3A 4DLEA 4CEFA 4FJHA 2HHQA 4HUEA 1JLFA 1HRHA 3HSTB 3NF6A 4BE1A 3ALYA 4CE9A 3QNOA 1ZBIA 1ASVA 3AO5A 4OGCA 2Q3SA 3VQAA 1G15A 4Y1CA 3ZSRA 4E3SA 3K5LA 3TAMA 4CGJA 1NK0A 4W5RA 4RW8A 3M8RA 1O1WA 4CGFA 4OKKA 3M8SA 3NF9A 3OYJA 3HVRA 2DFEA 3ZSOA 4HUFA 3QESA 4FK2A 4Z4FA 4DFKA 4CF2A 4E7KA 4FLXA 1NOYA 3VQ9A 4N76A 4CFDA 4PY5A 1VRTA 2F8TA 3OYHA 1BHLA 3CM5A 4ELTA 1B9FA 4CFCA 4CK2A 5HRPA 3LZIA 3IG1A 2G8FA 1LWCA 1TAUA 3ISNC 1RNHA 2YNGA 3AO4A 3PUFA 3RMCA 1JLQA 1WNSA 3SNNA 3OYFA 4CHQA 1S6PA 1BI4B 3AO2A 2E4LA 1NK5A 5C24A 4CF0A 5J1EA 3V9XA 2P51A 1SKSA 4OLAA 4H4MA 4O4GA 4CJ4A 4CJKA 1VSDA 2VG7A 1B9DA 4Z4HA 4O44A 4FLUA 4CESA 3KK2A 1Y97A 3S3NA 3DLBA 4DSJA 3AVMA 3WNFA 2KFZA 2YNFA 3SPZA 1EX4A 4BWMA 2G8HA 5HLFA 1T03A 3O4NA 3S9HA 4CEQA 4F2SA 2ZE2A 4CF9A 3K2PA 3NFAA 4I9QA 3QEPA 3TAPA 2GV9A 4CECA 3KLGA 1FKOA 2VG5A 4M42A 2WOMA 3SCXA 3O3HA 3RR8A 4W5NA 1VSKA 3THVA 1TKZA 3LAKA 1RDBA 4PA1A 4DLGA 5FRNA 4CGHA 3SPYA 3VA3A 3AVCA 4R5PA 3MEEA 5EU7A 3VQQA 4BDPA 3AO1A 5HBMA 3DYAA 1LWEA 4I2PA 4DF4A 3DLHA 4FVMA 1BGXT 3KK3A 3ZT0A 4AH9A 1BISA 4Z4EA 4KTWA 3V4IA 1TK8A 3ZT2A 4NYNA 4AHSA 4B9TA 1IKYA 3RRHA 4OLBA 4IG3A 1IKVA 1CXQA 1S1TA 4BWJA 4CERA 1KVCA 4CFAA 4CGGA 2IOCA 4DFJA 3TABA 2BDPA 4IKFA 1WSJA 4JS4A 3IRXA 2JGUA 2ZD1A 4CIEA 3OJUA 4DF8A 1C1BA 2HVHA 1GOAA 3U3YA 3MXIA 1RTJA 3QEWA 2RKIA 2G8UA 1TKXA 4B9MA 2P1JA 4GW6A 5HROA 4FLWA 3ULDA 3HL8A 3OYIA 2XY6A 3PO4A 1W9HA 2KTQA 3VQCA 3P1GA 3C94A 1RT2A 4AHRA 1JXEA 1WSIA 3EYZA 3BDPA 1S9GA 2ITGA 2P5GA 5KGWA 4ID1A 3L2UA 4EZ9A 4LSNA 3DRPA 2XY7A 3SZ2A 2XY8A 4LY7A 4DSLA 5I42A 4ICLA 4CJFA 1VK0A 1HNIA 3HPGA 3ZSQA 1XHXA 3RMAA 3WNEA 3OVNA 1QSSA 4H8KA 1BQMA 2IC3A 3OYGA 4DTNA 2A1RA 1S5JA 2HNYA 3DRSA 3P5JA 2OPRA 4HHTA 1KSPA 1WSFA 3DLGA 4CEAA 4CEEA 4MQ3A 4UQGA 3AVLA 2VWJA 5I3UA 5FDLA 3HJFA 1A5XA 3AV9A 3MAQA 5J2NA 1U47A 1BIZA 1KFDA 3V9WA 1RTDA 3KTQA 3V1OA 1A5VA 3PO5A 4E0DA 4Z4CA 4H4OA 1ZBHA 4B8CA 3NGZA 4FXDA 1BIUA 4FJKA 1WLJA 4FLVA 3NAEA 1KVAA 2D0BA 4CF1A 3O3FA 1Q8IA 2IAJA 3G10A 3MXJA 3V9SA 4LD0A 3QETA 1DTTA 3QEXA 4C8KA 3OYAA 1TL1A 2Z1HA 1EETA 3VQ4A 3KD5E 5CYMA 4GMJB 2FC0A 4FJLA 2F8SA 4E89A 3TI0A 3DM2A 4NCAA 3HP6A 5J2QA 4B3OA 1TVRA 3KKRA 3AA3A 5JS1A 4DQSA 3O3GA 4DTPA 1HNVA 4JRPA 3C6UA 5CY4A 4ZTFA 2OZSA 3HYFA 4B9NA 2DY4A 3QEVA 3NH2A 3IS9A 1K6YA 3OYLA 4FLZA 4BE0A 4B9LA 2W42A 4J2BA 3V1RA 1HYSA 1RT5A 1D5AA 3CFOA 3KIOA 4RG8A 4DSFA 3TAFA 3LALA 4HVJA 4LH5A 1RDCA 1GOCA 2D0CA 3HXMA 2PYJA 4KHQA 3VQ5A 4K8XA 2WONA 4CF8A 4BACA 3FFIA 4BDZA 3QERA 1L3SA 1CXUA 5HP1A 2QKKA 3L2WA 3QINA 4ELUA 4W5TA 2ATQA 2HNDA 2D0AA 1IH7A 3VQ6A 5SWMA 3OY9A 3HPHA 4CJUA 4M3UA 3M8PA 3ZT4A 3F9KA 2Z1JA 4E1MA 3TWHA 3NGIA 1D8YA 1X9WA 4M3TA 1U49A 1SV5A 4E1NA 1HMVA 3WNHA 1SL2A 3U6FA 1REVA 3MEGA 4CJEA 4KFBA 1CZ9A 3V9UA 1T05A 4F8RA 1HYZA 4FW1A 3VQEA 2XRIA 3MECA 3WNGA 5CZ1A 3QO9A 4YNQA 2YHBA 4CJ5A 3NH0A 3K5MA 5D3GA 4KB1A 4JRQA 2E6MA 4AILC 4IDKA 1KFSA 2XHBA 2G8VA 4FJGA 2QKBA 4CEZA 3T3FA 1QTMA 2Y1IA 1L3TA 1LV5A 1WN7A 4L8RB 4AHCA 4FW2A 3OYDA 3JYTA 4DTMA 3AVAA 4DU3A 4FM1A 4FZYA 1L3UA 3TAGA 4CHPA 1YT3A 2B6AA 3NGYA 3LZJA 2NUBA 2PYLA 4FZXC 1JLAA 4KHNA 3CG7A 4DU1A 3AA2A 2GUIA 1JL1A 4IG0A 1NOZA 2OPPA 5CZ2A 1FK9A 1WAJA 1LAWA 3PX6A 1L3VA 2HMIA 1SL0A 4DWIA 1Z26A 1YVUA 4HCBA 3AVKA 4EZ6A 3KKSA 1ZBLA 4OKEA 3G0ZA 2EHGA 3KLHA 1QE1A 3L2RA 1C0TA 1VSEA 1ZBUA 1RT6A 1FXXA 1RCHA 4IFYA 4W5OA 2KZZA 4OPKA 4M3RA 2EX3A 1SUQA 3AVFA 2BE2A 3DLRA 3ZSWA 4AHVA 3KJVA 3TARA 3S3MA 4PWDA 4DFPA 3DLKA 1ZBFA 1KLNA 1RT1A 4HCCA 2ETJA 2OPSA 3BGRA 3QEIA 4XIUA 3RR7A 4KHUA 4CEOA 2IS3A 1XI1A 4FJNA 1IKWA 3M8QA 4ZHRA 3L2VA 4MFBA 3V9ZA 4KO0A 1UA0A 1ITGA 1UAXA 3HT3A 3SYZA 4M3XA 2HB5A 4DG1A 1KCFA 5CYQA 3AVIA 3B6PA 3ASMA 1WSGA 3SV4A 3LWLA 3DRRA 4IFVA 4RW4A 3OS0A 1QQCA 1EP4A 2BANA 5DK5A 3VQPA 2I5JA 3KK1A 3SQ2A 4F3TA 1J53A 5J2MA 4DTSA 3NF7A 1WSHA 3NDKA 4NCBA 4I7FA 3L3UA 2IDOA 4ZTJA 3NF8A 3SJJA 3SQ1A 1X1PA 2OZMA 3LP0A 1LWFA 4IBNA 1NK6A 1WSEA 3SUOA 4CJTA 1RDDA 4CJQA 1TK5A 3DLEA 3ZSXA 2YNHA 1C1AA 1W0HA 1Z25A 3VQDA 4CIGA 3LWMA 3D0PA 2HW3A 2X6SA 4JS5A 1IO2A 1RILA 5KTQA 4DTUA 4CGIA 1WAFA 4O5BA 2HHWA 4OPJA 3NH1A 4F2RA 4FJ5A 4M41A 2HVIA 3O4QA 4NCGA 3K57A 1BL3A 2KQ2A 1NK7A 1BQNA 4OJRA 1JLBA 1UWBA 2GBZA 4CJ3A 4E19A 3HPOA 2B4JA 3SUPA 2HHSA 3ZSVA 3OYNA 1QSYA 1C6VA 4DS4A 4B9UA 4DSIA 4KAZA 5E41A 3VQ7A 4HTUA 2X6NA 5C42A 4M3ZA 1QS4A 3AVHA 3AVBA 4E7LA 1A5WA 3EY1A 1L5UA 4B9VA 4KHSA 4BDYA 1KLMA 1KVBA 4DSKA 2HHUA 2QK9A 4KREA 1U4BA 2RF2A 4FM2A 3SV3A 2KZMA 1JLEA 4WE1A 1TK0A 3AA4A 4N47A 4NYFA 1CZBA 3OS1A 1NJXA 4FYDA 3LANA 2IGIA 1S6QA 3B6OA 4CHZA 4KTQA 1RTHA 4FJ7A 4FJ8A 4Z4IA 3T19A 4CJSA 4C8MA 3U3GA 4DQQA 2XY5A 4QAGA 3HM9A 4FJJA 4DTJA 4FZZA 2X78A 1VSLA 3RRGA 3TAEA 4GVMA 4FK0A 3LAMA 3HK2A 3AVGA 2OPQA 4E7IA 1NKCA 3L2QA 1N5YA 4W5QA 2ZQBA 4CJWA 3KLFA 3PX4A 3DMJA 3KD1E 3AVNA 1S1XA 3ZCMA 4Z4GA 2HHTA 1X9SA 3KLIA 2Z1GA 1NK4A 1TL3A 2D5RA 1SKWA 4B08A 1SL1A 2VWKA 1RBUA 3OYCA 1VSIA 1NKEA 1ASUA 2YNIA 4N56A 4FM0A 4N41A 1T8EA 4KTZA 5J2PA 1VSJA 1J9AA 1TKTA 1HJRA 4O0JA 4N5SA 1ASWA 4DQPA 4J2AA 3SUQA 5KI6A 1RBRA 4OVLA 1TGOA 1RT4A 4FCYA 4OGEA 1R0AA 1C1CA 2QXFA 4RW9A 1YTAA 4DTRA 3ZT3A 5KGXA 1HQEA 4RW6A 1RBVA 2HNZA 4CJRA 3CQ8A 1I3AA 5JS2A 3TAQA 2O4IA 4CJVA 1RBSA 3RTVA 2P5OA 2RN2A 4CK1A 2YKMA 3LDSA 3DOLA 3LP2A 3MXMA 1QSLA 4CFBA 4FJMA 2KFNA 4M3YA 4DTOA 4M3WA 3D45A 2BGGA 4EP4A 3VQ8A 4TSXA 4G1QA 2FBYA 4M45A 4O0IA 4EP5A 1J54A 4FJ9A 3ITHA 3I8DA 3PV8A 3L3VA 1S1UA 1NJWA 1BI4A 2G8KA 1KRPA 4FLTA 2Y1JA 4CHOA 4DSEA 2OYQA 3DI6A 4FJXA 4CGDA 3QNNA 1RT3A 3SUNA 3OYEA 2PY5A 4CCHA 4FJIA 3VQBA 4KI6A 2KW4A 4AHUA 3F73A 3CFPA 4FK4A 5SZTA 3RMBA 4YFUA 3DOKA 2R7YA 1ZYQA 1XWLA 4O55A 4Q5VA 3ZT1A 1UOCA 1MU2A 3QLHA 4OKJA 5C25A 3OJSA 3NE6A 1HQUA 2FBTA 3OS2A 1RBTA 3LPTA 4CHNA 4Y1DA 4B8AB 3NHGA 1N6QA 4Z0UA 4E7JA 4CEDA 2OA8A 4K8ZA 1EKEA 1TAQA 4DQRA 1X9MA 4J2DA 1JL2A 5HRRA 5FROA 2XO7A 3V81A 1F21A 3ZSZA 3PX0A 4C8NA 4JLHA 3IAYA 1NJYA 1TV6A 3CFRA 4C8LA 4I2QA 1S1VA 2A1SA 1HPZA 1NKBA 3OYMA 4CJPA 1JXBA 1LAVA 1JLCA 3ZSYA 4CIFA 3PY8A 4F4KA 1NK8A 3LP1A 1IKXA 2FBXA 4CJLA 3SQ4A 1U48A 3OYKA 1U45A 2PZSA 3K59A 1T7PA 4KPYA 4FLYA 2DFHA 4DU4A 1S1WA 2B5JA 3I0RA 1IG9A 1NJZA 4KB0A 4DFMA 3CYMA 4F3OA 1GOBA 2DFFA 3VA0A 5DMRA 4ID5A 1C0MA 1S9EA 3NCIA 4ELVA 1C0UA 1RT7A 3LPUA 1NK9A 4DMNA 3KLEA 4QOZB 3TANA 1VSFA 1RDAA 3A2FA 1XHZA 5KRTA 3JSMA 3RMDA 3MEDA 4DS5A 3VN5A 3AO3A 5KRSA 5HRNA 1Q9YA 2G8WA 3OYBA 3RWUA 1JKHA 4HUGA 4J2EA 3S3OA 3AA5X 2YKNA 4KV8A 1DLOA 1FKPA 3NBPA 1EXQA 2YV0X 4KHYA 1D9FA 1YTUA 2HHXA 4LSLA 5K14A 4KHWA 4CHYA 3SQ0A 3AVJA 4PQUA 4Q0BA 1HYVA 1LW2A 4RW7A 1UA1A 4KI4A 4DTXA 4KRFA 4KKOA 4LH4A 4B9SA 1VSHA 5HRSA 3K58A 3QIOA 1XC9A 3K5NA 2G8IA 1CLQA 2F96A 3E01A 2E6LA 2YHAA 4AHTA 3C6TA 1J5OA 1TKDA 2VG6A 1I39A 1LW0A 2FBVA 2LSNA 1SKRA 3HVTA 2O4GA 3H08A 1VSMA 1DTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1I A;  3UIQ A;  5FRM A;  3C95 A;  3LP3 A;  1BCM A;  2RPI A;  2DTU A;  2JLE A;  2HHV A;  3V1Q A;  3K5O A;  3V6D A;  3TR8 A;  3I0S A;  3QIP A;  4CEB A;  1JLG A;  1VRU A;  1QHT A;  4I9L A;  3T1A A;  3SI6 A;  5T7B A;  4DQI A;  3CM6 A;  2X74 A;  1B92 A;  1Q9X A;  4PUO A;  3L8B A;  2AJQ A;  1BCO A;  4C8O A;  4E7H A;  3EZ5 A;  4QCL A;  3P83 D;  1RTI A;  1D9D A;  3HO1 A;  1U04 A;  4BE2 A;  1KTQ A;  3HP9 A;  4CK3 A;  4DLE A;  4CEF A;  4FJH A;  2HHQ A;  4HUE A;  1JLF A;  1HRH A;  3HST B;  3NF6 A;  4BE1 A;  3ALY A;  4CE9 A;  3QNO A;  1ZBI A;  1ASV A;  3AO5 A;  4OGC A;  2Q3S A;  3VQA A;  1G15 A;  4Y1C A;  3ZSR A;  4E3S A;  3K5L A;  3TAM A;  4CGJ A;  1NK0 A;  4W5R A;  4RW8 A;  3M8R A;  1O1W A;  4CGF A;  4OKK A;  3M8S A;  3NF9 A;  3OYJ A;  3HVR A;  2DFE A;  3ZSO A;  4HUF A;  3QES A;  4FK2 A;  4Z4F A;  4DFK A;  4CF2 A;  4E7K A;  4FLX A;  1NOY A;  3VQ9 A;  4N76 A;  4CFD A;  4PY5 A;  1VRT A;  2F8T A;  3OYH A;  1BHL A;  3CM5 A;  4ELT A;  1B9F A;  4CFC A;  4CK2 A;  5HRP A;  3LZI A;  3IG1 A;  2G8F A;  1LWC A;  1TAU A;  3ISN C;  1RNH A;  2YNG A;  3AO4 A;  3PUF A;  3RMC A;  1JLQ A;  1WNS A;  3SNN A;  3OYF A;  4CHQ A;  1S6P A;  1BI4 B;  3AO2 A;  2E4L A;  1NK5 A;  5C24 A;  4CF0 A;  5J1E A;  3V9X A;  2P51 A;  1SKS A;  4OLA A;  4H4M A;  4O4G A;  4CJ4 A;  4CJK A;  1VSD A;  2VG7 A;  1B9D A;  4Z4H A;  4O44 A;  4FLU A;  4CES A;  3KK2 A;  1Y97 A;  3S3N A;  3DLB A;  4DSJ A;  3AVM A;  3WNF A;  2KFZ A;  2YNF A;  3SPZ A;  1EX4 A;  4BWM A;  2G8H A;  5HLF A;  1T03 A;  3O4N A;  3S9H A;  4CEQ A;  4F2S A;  2ZE2 A;  4CF9 A;  3K2P A;  3NFA A;  4I9Q A;  3QEP A;  3TAP A;  2GV9 A;  4CEC A;  3KLG A;  1FKO A;  2VG5 A;  4M42 A;  2WOM A;  3SCX A;  3O3H A;  3RR8 A;  4W5N A;  1VSK A;  3THV A;  1TKZ A;  3LAK A;  1RDB A;  4PA1 A;  4DLG A;  5FRN A;  4CGH A;  3SPY A;  3VA3 A;  3AVC A;  4R5P A;  3MEE A;  5EU7 A;  3VQQ A;  4BDP A;  3AO1 A;  5HBM A;  3DYA A;  1LWE A;  4I2P A;  4DF4 A;  3DLH A;  4FVM A;  1BGX T;  3KK3 A;  3ZT0 A;  4AH9 A;  1BIS A;  4Z4E A;  4KTW A;  3V4I A;  1TK8 A;  3ZT2 A;  4NYN A;  4AHS A;  4B9T A;  1IKY A;  3RRH A;  4OLB A;  4IG3 A;  1IKV A;  1CXQ A;  1S1T A;  4BWJ A;  4CER A;  1KVC A;  4CFA A;  4CGG A;  2IOC A;  4DFJ A;  3TAB A;  2BDP A;  4IKF A;  1WSJ A;  4JS4 A;  3IRX A;  2JGU A;  2ZD1 A;  4CIE A;  3OJU A;  4DF8 A;  1C1B A;  2HVH A;  1GOA A;  3U3Y A;  3MXI A;  1RTJ A;  3QEW A;  2RKI A;  2G8U A;  1TKX A;  4B9M A;  2P1J A;  4GW6 A;  5HRO A;  4FLW A;  3ULD A;  3HL8 A;  3OYI A;  2XY6 A;  3PO4 A;  1W9H A;  2KTQ A;  3VQC A;  3P1G A;  3C94 A;  1RT2 A;  4AHR A;  1JXE A;  1WSI A;  3EYZ A;  3BDP A;  1S9G A;  2ITG A;  2P5G A;  5KGW A;  4ID1 A;  3L2U A;  4EZ9 A;  4LSN A;  3DRP A;  2XY7 A;  3SZ2 A;  2XY8 A;  4LY7 A;  4DSL A;  5I42 A;  4ICL A;  4CJF A;  1VK0 A;  1HNI A;  3HPG A;  3ZSQ A;  1XHX A;  3RMA A;  3WNE A;  3OVN A;  1QSS A;  4H8K A;  1BQM A;  2IC3 A;  3OYG A;  4DTN A;  2A1R A;  1S5J A;  2HNY A;  3DRS A;  3P5J A;  2OPR A;  4HHT A;  1KSP A;  1WSF A;  3DLG A;  4CEA A;  4CEE A;  4MQ3 A;  4UQG A;  3AVL A;  2VWJ A;  5I3U A;  5FDL A;  3HJF A;  1A5X A;  3AV9 A;  3MAQ A;  5J2N A;  1U47 A;  1BIZ A;  1KFD A;  3V9W A;  1RTD A;  3KTQ A;  3V1O A;  1A5V A;  3PO5 A;  4E0D A;  4Z4C A;  4H4O A;  1ZBH A;  4B8C A;  3NGZ A;  4FXD A;  1BIU A;  4FJK A;  1WLJ A;  4FLV A;  3NAE A;  1KVA A;  2D0B A;  4CF1 A;  3O3F A;  1Q8I A;  2IAJ A;  3G10 A;  3MXJ A;  3V9S A;  4LD0 A;  3QET A;  1DTT A;  3QEX A;  4C8K A;  3OYA A;  1TL1 A;  2Z1H A;  1EET A;  3VQ4 A;  3KD5 E;  5CYM A;  4GMJ B;  2FC0 A;  4FJL A;  2F8S A;  4E89 A;  3TI0 A;  3DM2 A;  4NCA A;  3HP6 A;  5J2Q A;  4B3O A;  1TVR A;  3KKR A;  3AA3 A;  5JS1 A;  4DQS A;  3O3G A;  4DTP A;  1HNV A;  4JRP A;  3C6U A;  5CY4 A;  4ZTF A;  2OZS A;  3HYF A;  4B9N A;  2DY4 A;  3QEV A;  3NH2 A;  3IS9 A;  1K6Y A;  3OYL A;  4FLZ A;  4BE0 A;  4B9L A;  2W42 A;  4J2B A;  3V1R A;  1HYS A;  1RT5 A;  1D5A A;  3CFO A;  3KIO A;  4RG8 A;  4DSF A;  3TAF A;  3LAL A;  4HVJ A;  4LH5 A;  1RDC A;  1GOC A;  2D0C A;  3HXM A;  2PYJ A;  4KHQ A;  3VQ5 A;  4K8X A;  2WON A;  4CF8 A;  4BAC A;  3FFI A;  4BDZ A;  3QER A;  1L3S A;  1CXU A;  5HP1 A;  2QKK A;  3L2W A;  3QIN A;  4ELU A;  4W5T A;  2ATQ A;  2HND A;  2D0A A;  1IH7 A;  3VQ6 A;  5SWM A;  3OY9 A;  3HPH A;  4CJU A;  4M3U A;  3M8P A;  3ZT4 A;  3F9K A;  2Z1J A;  4E1M A;  3TWH A;  3NGI A;  1D8Y A;  1X9W A;  4M3T A;  1U49 A;  1SV5 A;  4E1N A;  1HMV A;  3WNH A;  1SL2 A;  3U6F A;  1REV A;  3MEG A;  4CJE A;  4KFB A;  1CZ9 A;  3V9U A;  1T05 A;  4F8R A;  1HYZ A;  4FW1 A;  3VQE A;  2XRI A;  3MEC A;  3WNG A;  5CZ1 A;  3QO9 A;  4YNQ A;  2YHB A;  4CJ5 A;  3NH0 A;  3K5M A;  5D3G A;  4KB1 A;  4JRQ A;  2E6M A;  4AIL C;  4IDK A;  1KFS A;  2XHB A;  2G8V A;  4FJG A;  2QKB A;  4CEZ A;  3T3F A;  1QTM A;  2Y1I A;  1L3T A;  1LV5 A;  1WN7 A;  4L8R B;  4AHC A;  4FW2 A;  3OYD A;  3JYT A;  4DTM A;  3AVA A;  4DU3 A;  4FM1 A;  4FZY A;  1L3U A;  3TAG A;  4CHP A;  1YT3 A;  2B6A A;  3NGY A;  3LZJ A;  2NUB A;  2PYL A;  4FZX C;  1JLA A;  4KHN A;  3CG7 A;  4DU1 A;  3AA2 A;  2GUI A;  1JL1 A;  4IG0 A;  1NOZ A;  2OPP A;  5CZ2 A;  1FK9 A;  1WAJ A;  1LAW A;  3PX6 A;  1L3V A;  2HMI A;  1SL0 A;  4DWI A;  1Z26 A;  1YVU A;  4HCB A;  3AVK A;  4EZ6 A;  3KKS A;  1ZBL A;  4OKE A;  3G0Z A;  2EHG A;  3KLH A;  1QE1 A;  3L2R A;  1C0T A;  1VSE A;  1ZBU A;  1RT6 A;  1FXX A;  1RCH A;  4IFY A;  4W5O A;  2KZZ A;  4OPK A;  4M3R A;  2EX3 A;  1SUQ A;  3AVF A;  2BE2 A;  3DLR A;  3ZSW A;  4AHV A;  3KJV A;  3TAR A;  3S3M A;  4PWD A;  4DFP A;  3DLK A;  1ZBF A;  1KLN A;  1RT1 A;  4HCC A;  2ETJ A;  2OPS A;  3BGR A;  3QEI A;  4XIU A;  3RR7 A;  4KHU A;  4CEO A;  2IS3 A;  1XI1 A;  4FJN A;  1IKW A;  3M8Q A;  4ZHR A;  3L2V A;  4MFB A;  3V9Z A;  4KO0 A;  1UA0 A;  1ITG A;  1UAX A;  3HT3 A;  3SYZ A;  4M3X A;  2HB5 A;  4DG1 A;  1KCF A;  5CYQ A;  3AVI A;  3B6P A;  3ASM A;  1WSG A;  3SV4 A;  3LWL A;  3DRR A;  4IFV A;  4RW4 A;  3OS0 A;  1QQC A;  1EP4 A;  2BAN A;  5DK5 A;  3VQP A;  2I5J A;  3KK1 A;  3SQ2 A;  4F3T A;  1J53 A;  5J2M A;  4DTS A;  3NF7 A;  1WSH A;  3NDK A;  4NCB A;  4I7F A;  3L3U A;  2IDO A;  4ZTJ A;  3NF8 A;  3SJJ A;  3SQ1 A;  1X1P A;  2OZM A;  3LP0 A;  1LWF A;  4IBN A;  1NK6 A;  1WSE A;  3SUO A;  4CJT A;  1RDD A;  4CJQ A;  1TK5 A;  3DLE A;  3ZSX A;  2YNH A;  1C1A A;  1W0H A;  1Z25 A;  3VQD A;  4CIG A;  3LWM A;  3D0P A;  2HW3 A;  2X6S A;  4JS5 A;  1IO2 A;  1RIL A;  5KTQ A;  4DTU A;  4CGI A;  1WAF A;  4O5B A;  2HHW A;  4OPJ A;  3NH1 A;  4F2R A;  4FJ5 A;  4M41 A;  2HVI A;  3O4Q A;  4NCG A;  3K57 A;  1BL3 A;  2KQ2 A;  1NK7 A;  1BQN A;  4OJR A;  1JLB A;  1UWB A;  2GBZ A;  4CJ3 A;  4E19 A;  3HPO A;  2B4J A;  3SUP A;  2HHS A;  3ZSV A;  3OYN A;  1QSY A;  1C6V A;  4DS4 A;  4B9U A;  4DSI A;  4KAZ A;  5E41 A;  3VQ7 A;  4HTU A;  2X6N A;  5C42 A;  4M3Z A;  1QS4 A;  3AVH A;  3AVB A;  4E7L A;  1A5W A;  3EY1 A;  1L5U A;  4B9V A;  4KHS A;  4BDY A;  1KLM A;  1KVB A;  4DSK A;  2HHU A;  2QK9 A;  4KRE A;  1U4B A;  2RF2 A;  4FM2 A;  3SV3 A;  2KZM A;  1JLE A;  4WE1 A;  1TK0 A;  3AA4 A;  4N47 A;  4NYF A;  1CZB A;  3OS1 A;  1NJX A;  4FYD A;  3LAN A;  2IGI A;  1S6Q A;  3B6O A;  4CHZ A;  4KTQ A;  1RTH A;  4FJ7 A;  4FJ8 A;  4Z4I A;  3T19 A;  4CJS A;  4C8M A;  3U3G A;  4DQQ A;  2XY5 A;  4QAG A;  3HM9 A;  4FJJ A;  4DTJ A;  4FZZ A;  2X78 A;  1VSL A;  3RRG A;  3TAE A;  4GVM A;  4FK0 A;  3LAM A;  3HK2 A;  3AVG A;  2OPQ A;  4E7I A;  1NKC A;  3L2Q A;  1N5Y A;  4W5Q A;  2ZQB A;  4CJW A;  3KLF A;  3PX4 A;  3DMJ A;  3KD1 E;  3AVN A;  1S1X A;  3ZCM A;  4Z4G A;  2HHT A;  1X9S A;  3KLI A;  2Z1G A;  1NK4 A;  1TL3 A;  2D5R A;  1SKW A;  4B08 A;  1SL1 A;  2VWK A;  1RBU A;  3OYC A;  1VSI A;  1NKE A;  1ASU A;  2YNI A;  4N56 A;  4FM0 A;  4N41 A;  1T8E A;  4KTZ A;  5J2P A;  1VSJ A;  1J9A A;  1TKT A;  1HJR A;  4O0J A;  4N5S A;  1ASW A;  4DQP A;  4J2A A;  3SUQ A;  5KI6 A;  1RBR A;  4OVL A;  1TGO A;  1RT4 A;  4FCY A;  4OGE A;  1R0A A;  1C1C A;  2QXF A;  4RW9 A;  1YTA A;  4DTR A;  3ZT3 A;  5KGX A;  1HQE A;  4RW6 A;  1RBV A;  2HNZ A;  4CJR A;  3CQ8 A;  1I3A A;  5JS2 A;  3TAQ A;  2O4I A;  4CJV A;  1RBS A;  3RTV A;  2P5O A;  2RN2 A;  4CK1 A;  2YKM A;  3LDS A;  3DOL A;  3LP2 A;  3MXM A;  1QSL A;  4CFB A;  4FJM A;  2KFN A;  4M3Y A;  4DTO A;  4M3W A;  3D45 A;  2BGG A;  4EP4 A;  3VQ8 A;  4TSX A;  4G1Q A;  2FBY A;  4M45 A;  4O0I A;  4EP5 A;  1J54 A;  4FJ9 A;  3ITH A;  3I8D A;  3PV8 A;  3L3V A;  1S1U A;  1NJW A;  1BI4 A;  2G8K A;  1KRP A;  4FLT A;  2Y1J A;  4CHO A;  4DSE A;  2OYQ A;  3DI6 A;  4FJX A;  4CGD A;  3QNN A;  1RT3 A;  3SUN A;  3OYE A;  2PY5 A;  4CCH A;  4FJI A;  3VQB A;  4KI6 A;  2KW4 A;  4AHU A;  3F73 A;  3CFP A;  4FK4 A;  5SZT A;  3RMB A;  4YFU A;  3DOK A;  2R7Y A;  1ZYQ A;  1XWL A;  4O55 A;  4Q5V A;  3ZT1 A;  1UOC A;  1MU2 A;  3QLH A;  4OKJ A;  5C25 A;  3OJS A;  3NE6 A;  1HQU A;  2FBT A;  3OS2 A;  1RBT A;  3LPT A;  4CHN A;  4Y1D A;  4B8A B;  3NHG A;  1N6Q A;  4Z0U A;  4E7J A;  4CED A;  2OA8 A;  4K8Z A;  1EKE A;  1TAQ A;  4DQR A;  1X9M A;  4J2D A;  1JL2 A;  5HRR A;  5FRO A;  2XO7 A;  3V81 A;  1F21 A;  3ZSZ A;  3PX0 A;  4C8N A;  4JLH A;  3IAY A;  1NJY A;  1TV6 A;  3CFR A;  4C8L A;  4I2Q A;  1S1V A;  2A1S A;  1HPZ A;  1NKB A;  3OYM A;  4CJP A;  1JXB A;  1LAV A;  1JLC A;  3ZSY A;  4CIF A;  3PY8 A;  4F4K A;  1NK8 A;  3LP1 A;  1IKX A;  2FBX A;  4CJL A;  3SQ4 A;  1U48 A;  3OYK A;  1U45 A;  2PZS A;  3K59 A;  1T7P A;  4KPY A;  4FLY A;  2DFH A;  4DU4 A;  1S1W A;  2B5J A;  3I0R A;  1IG9 A;  1NJZ A;  4KB0 A;  4DFM A;  3CYM A;  4F3O A;  1GOB A;  2DFF A;  3VA0 A;  5DMR A;  4ID5 A;  1C0M A;  1S9E A;  3NCI A;  4ELV A;  1C0U A;  1RT7 A;  3LPU A;  1NK9 A;  4DMN A;  3KLE A;  4QOZ B;  3TAN A;  1VSF A;  1RDA A;  3A2F A;  1XHZ A;  5KRT A;  3JSM A;  3RMD A;  3MED A;  4DS5 A;  3VN5 A;  3AO3 A;  5KRS A;  5HRN A;  1Q9Y A;  2G8W A;  3OYB A;  3RWU A;  1JKH A;  4HUG A;  4J2E A;  3S3O A;  3AA5 X;  2YKN A;  4KV8 A;  1DLO A;  1FKP A;  3NBP A;  1EXQ A;  2YV0 X;  4KHY A;  1D9F A;  1YTU A;  2HHX A;  4LSL A;  5K14 A;  4KHW A;  4CHY A;  3SQ0 A;  3AVJ A;  4PQU A;  4Q0B A;  1HYV A;  1LW2 A;  4RW7 A;  1UA1 A;  4KI4 A;  4DTX A;  4KRF A;  4KKO A;  4LH4 A;  4B9S A;  1VSH A;  5HRS A;  3K58 A;  3QIO A;  1XC9 A;  3K5N A;  2G8I A;  1CLQ A;  2F96 A;  3E01 A;  2E6L A;  2YHA A;  4AHT A;  3C6T A;  1J5O A;  1TKD A;  2VG6 A;  1I39 A;  1LW0 A;  2FBV A;  2LSN A;  1SKR A;  3HVT A;  2O4G A;  3H08 A;  1VSM A;  1DTQ A; 
#chains in the Genus database with same CATH topology
 5E84 A;  3UIQ A;  1QZ6 A;  4DCH A;  4BRA A;  3EKS A;  3K5O A;  3I0S A;  3QIP A;  2FF6 A;  4DQI A;  3T1A A;  5T7B A;  4PL7 A;  1Q9X A;  1BOT O;  1NGA A;  3L8B A;  4QCL A;  1IJJ A;  3THW B;  4JI7 K;  4OPA A;  4BE2 A;  3BP8 A;  4E3S A;  3EE8 A;  3ZSR A;  3U4L A;  2UYT A;  4RW8 A;  4CBU A;  5TKW A;  4FK2 A;  4HUF A;  3ZSO A;  3QES A;  2YI1 A;  4DFK A;  4CF2 A;  1T6C A;  3VQ9 A;  3KZB A;  3GOI A;  1VRT A;  3CM5 A;  1B9F A;  3JS6 A;  3G71 N;  4JD2 A;  5KPT A;  3OTO K;  1LWC A;  4EHT A;  3ISN C;  2F9W A;  3RMC A;  3PUF A;  5E26 A;  4CBX A;  1JLQ A;  3A5L C;  3AO2 A;  1KXP A;  2ZJR L;  5C24 A;  3V9X A;  3FE1 A;  5FPN A;  4DQ8 A;  4O4G A;  2HST A;  4A59 A;  5AQP A;  4YY3 K;  1QVG M;  3O9Q A;  2G8H A;  2QWQ A;  3O4N A;  3CD6 N;  1X3M A;  3CER A;  4PHT X;  1VHX A;  3PIP L;  3TAP A;  4M42 A;  5BR8 K;  4W5N A;  4JI1 K;  2QEX N;  3LAK A;  4PA1 A;  2RHK A;  4CGH A;  3E9P A;  1N32 K;  3CC2 N;  1BGX T;  3KK3 A;  4AH9 A;  4Z4E A;  5AQJ A;  1VQK N;  3V4I A;  4IG3 A;  3G4S N;  3JXU A;  3CC4 N;  3O1B A;  4DFJ A;  1KVC A;  4CGG A;  3TAB A;  4IKF A;  3MN9 A;  3A5N C;  1YIJ N;  4JS4 A;  3E1Y A;  3MXI A;  1TKX A;  2P9K A;  5HRO A;  5AZI B;  1V4T A;  4PKH A;  2GEL A;  2ZGZ A;  3PO4 A;  3IFR A;  2QA4 N;  4JKH A;  3EYZ A;  1S9G A;  1RFQ A;  5KGW A;  3L2U A;  4DV7 K;  4LSN A;  2XY7 A;  2XY8 A;  4LY7 A;  4QS9 A;  3OVN A;  4CZF A;  4DV1 K;  4DTN A;  2HNY A;  4HHT A;  3VF4 A;  4RWT A;  3U9Z A;  5FDL A;  1A5X A;  4IJA A;  3MAQ A;  1KFD A;  1RTD A;  3N4P A;  3KTQ A;  2HHS A;  3ZX0 A;  3KWI A;  4FXD A;  4FJK A;  4BR2 A;  2E5L K;  1KVA A;  3QET A;  4C8K A;  1YUW A;  2Z1H A;  4BR5 A;  4E89 A;  5GIN A;  4BRG A;  3HP6 A;  1OH7 A;  4B3O A;  3KKR A;  3AA3 A;  4M63 C;  3CHW A;  4B9N A;  4WQ5 A;  3IS9 A;  1Q82 O;  2YHY A;  4BE0 A;  3KK7 A;  4B9L A;  1D5A A;  3AGR A;  4LH5 A;  1RDC A;  1GOC A;  3HXM A;  4MO4 A;  4CF8 A;  1L3S A;  3L2W A;  4ELU A;  1K73 O;  3G25 A;  4W5T A;  1IBL K;  3VQ6 A;  3HPH A;  4CJU A;  3LDL A;  2FLO A;  3ZT4 A;  2Z1J A;  4E1M A;  1V4S A;  3NGI A;  1X9W A;  2O8C B;  2I7P A;  1SL2 A;  3MEG A;  1CZ9 A;  4B3R K;  4F8R A;  2HHH K;  1GLL O;  3VQE A;  2YHB A;  4CD3 A;  5D3G A;  3THY A;  4JRQ A;  4B1U B;  3AAQ A;  1KFS A;  2QKB A;  2BH1 A;  3LDN A;  3CCU N;  1LV5 A;  1WN7 A;  2W6K A;  4L8R B;  4DTM A;  2HBM A;  3AVA A;  4FZY A;  4JI2 K;  3VGL A;  2P9I B;  1NOZ A;  5CZ2 A;  3PX6 A;  1SL0 A;  4WQ5 C;  1Z26 A;  1EO1 A;  2O8C A;  3QB0 A;  3KLH A;  1S3X A;  4GVE A;  1K8A O;  1VSE A;  1FXX A;  2P9L B;  4JKD A;  1RCH A;  2KZZ A;  3K0S A;  5LJW A;  4M3R A;  1SUQ A;  3AVF A;  1KD1 O;  3FZH A;  4DFP A;  3DLK A;  4HCC A;  3QEI A;  1QQN A;  4FJN A;  1UAX A;  3HT3 A;  3SYZ A;  2HBK A;  3B6P A;  3QFP A;  2HF4 A;  1WSG A;  3KVG A;  4NO7 A;  3LWL A;  4PL8 A;  3HK2 A;  2YJE A;  3KK1 A;  2BUP A;  1WOQ A;  4F3T A;  3D2E B;  4IWV A;  3CJC A;  3NF7 A;  4I7F A;  3L3U A;  3WT0 A;  2QM1 A;  4ZTJ A;  2P9K B;  1X1P A;  1LWF A;  4CJT A;  1RDD A;  3FGU A;  4CJQ A;  1TK5 A;  1XQS C;  3ZSX A;  1Z25 A;  4CIG A;  3J81 O;  4JS5 A;  2E1Z A;  5GAE P;  1N34 K;  4O5B A;  3NH1 A;  4M41 A;  4JNE A;  3O4Q A;  1W7A A;  4NCG A;  3FZF A;  2KQ2 A;  1BQN A;  4OX9 K;  1UWB A;  4E19 A;  2B4J A;  4B9U A;  3PIO L;  3ZET B;  4JI8 K;  2O8B A;  3AVB A;  4B9V A;  4K25 A;  4KHS A;  4BDY A;  1KLM A;  1KVB A;  2QK9 A;  1BU6 O;  4A57 A;  3O4W A;  3OS1 A;  4LFA K;  4FJ7 A;  3B6O A;  4BY9 C;  3T19 A;  2XY5 A;  4QAG A;  4DTJ A;  3I8B A;  2X78 A;  3RRG A;  3LAM A;  4MLH A;  2E88 A;  4DR4 K;  4E7I A;  4W5Q A;  2ZQB A;  1KAX A;  3KLF A;  4CZM A;  5H1S Q;  1S1X A;  1VQ6 N;  4Z4G A;  2NNW A;  3CCR N;  2Z1G A;  2D5R A;  4BR4 A;  1VSI A;  3EKU A;  4N56 A;  4JK7 A;  5AQG A;  1YHQ N;  4JD2 B;  4WQ4 A;  3GL1 A;  1VQO N;  4O0J A;  4N5S A;  4BRH A;  4DQP A;  3TU5 A;  4J2A A;  1NJI O;  4IFE A;  4EHU A;  4FCY A;  1C1C A;  4RW9 A;  4DTR A;  2DPN A;  1HQE A;  4RW6 A;  1RBS A;  3RTV A;  4CK1 A;  4JHD A;  3LP2 A;  2KFN A;  4BVP A;  4M3Y A;  1P8Z A;  2BGG A;  3VQ8 A;  4CZG A;  5F0X A;  4M45 A;  4KH4 A;  4JHD B;  4FJ9 A;  3PV8 A;  1XMO K;  1NJW A;  2F9T A;  4DSE A;  2UXB K;  3SMP A;  4BGA A;  3T1H K;  3FZK A;  4KI6 A;  4CCH A;  2OCE A;  1VQL N;  4AHU A;  1OH5 A;  3F73 A;  4FK4 A;  2WFB A;  1NGF A;  3DOK A;  2R7Y A;  5LMU K;  1ZYQ A;  4Q5V A;  3TSU A;  4A5B A;  1VQ5 N;  1HQU A;  4A62 A;  3LPT A;  3TPQ A;  4WYB A;  1DEJ A;  1EQY A;  2HBJ A;  3NHG A;  4LF7 K;  4LF5 K;  2NRR A;  1EKE A;  5FPM A;  4CZJ A;  1SZ2 A;  5FRO A;  4UY8 O;  3UKU A;  4FWQ A;  2NRX A;  4JLH A;  3CFR A;  2O8D B;  1S1V A;  1JXB A;  4OPH A;  2CGL A;  3C0B A;  4GY2 B;  4JI0 K;  2E2O A;  1DT9 A;  1E3M A;  2GTD A;  2D0O A;  2NRH A;  3ZSY A;  4JYA K;  4PKI A;  4CJL A;  4R79 A;  3E9L A;  3OYK A;  2JWK A;  3AGK A;  5KQ8 A;  1T7P A;  2Q0U A;  4KB0 A;  3I0R A;  1BA0 A;  4B3M K;  3CYM A;  1WBD A;  2DFF A;  3OA9 A;  3VA0 A;  3NVK A;  4L3Q A;  4O8U A;  3CJB A;  4CD1 A;  4ELV A;  5LMN K;  1OKJ A;  1RT7 A;  4DMN A;  1BDG A;  1NGG A;  3EZW A;  1XHZ A;  5KRT A;  4WQ4 C;  2V51 B;  3MED A;  4DS5 A;  2O8E A;  5FPE A;  1U2V A;  4M7Y A;  3RWU A;  4KH6 A;  3S3O A;  3CCL N;  1T3V A;  3WXJ A;  1LCU A;  1DLO A;  1FKP A;  1EXQ A;  1VQP N;  3A5M C;  5K14 A;  4KHW A;  5M1K A;  4PQU A;  1VAZ A;  1HYV A;  1LW2 A;  1S22 A;  1UA1 A;  2HOE A;  4FOI A;  3GDQ A;  4KKO A;  1VSH A;  3D6R A;  5HRS A;  1XC9 A;  3WXK A;  2CGJ A;  1G99 A;  3E01 A;  3CJ7 A;  2E6L A;  2YHA A;  1J5O A;  1I39 A;  1D4X A;  3THX A;  3H08 A;  1YJ9 N;  2DTU A;  3LP3 A;  2JLE A;  3VEN A;  3HZ6 A;  3TR8 A;  1JLG A;  3CM6 A;  3VEX A;  1BCO A;  4E7H A;  3CCJ N;  1YF5 L;  4IOC L;  1KTQ A;  4CK3 A;  4DLE A;  4FJH A;  4CEF A;  1JLF A;  1ZC6 A;  3HST B;  4BE1 A;  4X65 K;  3ALY A;  5HOO A;  3DWL A;  3MN5 A;  3SBT A;  3VQA A;  3TAM A;  4W5R A;  3WEE B;  3M8R A;  4CGF A;  3OYJ A;  2DFE A;  1SAZ A;  1IG8 A;  4BC5 A;  4CFD A;  5ELZ A;  3OYH A;  3TSP A;  4CFC A;  4CK2 A;  1KQS M;  2VQE K;  1XC3 A;  2Q97 A;  4YOW A;  3RSE A;  2YNG A;  2AA4 A;  3SNN A;  5M1Q A;  3OYF A;  3TTD A;  2P9N B;  1S6P A;  3ZLJ A;  5BPL A;  2KKZ A;  1NK5 A;  5J1E A;  4H4M A;  4CJ4 A;  2VG7 A;  4O44 A;  3S3N A;  5I9E B;  4DSJ A;  3AVM A;  2YNF A;  4PKG A;  5HLF A;  2P9P B;  3CJ9 A;  1T03 A;  4HWI A;  4F2S A;  4CF9 A;  4DR3 K;  4I9Q A;  1W2B M;  3S41 A;  3C7N B;  1FKO A;  2VG5 A;  2WOM A;  3SCX A;  4FWR A;  3MCP A;  3ZEU A;  3SPY A;  3AVC A;  3MEE A;  4BDP A;  1HLU A;  5BRF A;  2E2Q A;  3MX2 A;  4GV3 A;  3LM9 A;  5FLX O;  1KAZ A;  4BWJ A;  4CER A;  4ILH A;  2IOC A;  3FZM A;  1WSJ A;  3IKM A;  2JGU A;  4NB4 A;  1C1B A;  2HVH A;  3ZX2 A;  2G8U A;  2AP1 A;  4YOT A;  3K9J A;  3H3O B;  4YOU A;  3ULD A;  3HL8 A;  3E9O A;  1W9H A;  3EO3 A;  2KTQ A;  3P1G A;  1RT2 A;  2O8B B;  3VET A;  4ID1 A;  2D0P A;  3CME N;  4H0V B;  4DSL A;  5I42 A;  2GUP A;  1Z6R A;  3TTF A;  1VK0 A;  3L0Q A;  1HNI A;  3HPG A;  3ZSQ A;  4AM7 A;  1XHX A;  4BR0 A;  1BQM A;  3OYG A;  1S5J A;  3P5J A;  5CE3 A;  2OPR A;  1KSP A;  1WSF A;  5AQL A;  4CEA A;  4MQ3 A;  2VWJ A;  5I3U A;  3AV9 A;  5J2N A;  1BIZ A;  1ZBH A;  3DJC A;  4H4O A;  1BIU A;  4FLV A;  3VEV A;  2HMI A;  1Q8I A;  3G10 A;  2VWB A;  3V9S A;  1TL1 A;  3VQ4 A;  4AQY K;  3KD5 E;  3QFU A;  2FC0 A;  5LL6 Z;  2F8S A;  1M90 O;  4NCA A;  5C10 A;  4B1X B;  4BRI A;  5A2Q O;  4GKJ K;  5JS1 A;  1HNV A;  4JRP A;  4NXM K;  3HYF A;  2DY4 A;  4BGB A;  3VER A;  3R9P A;  3KIO A;  4RG8 A;  3ZX3 A;  2OTL N;  4KHQ A;  2GX9 A;  4BDZ A;  1YIT N;  1CXU A;  5HP1 A;  2QKK A;  1KC8 O;  5AFU A;  3C6A A;  4FWL A;  4LFC K;  4CJ7 A;  1X9J A;  3OY9 A;  4M3U A;  2ASO A;  3EE9 A;  2ZJQ L;  4M3T A;  4E1N A;  1HMV A;  4H0T B;  3WNH A;  3U6F A;  1REV A;  1HPM A;  1T05 A;  4G9Z A;  2FSN A;  2QWP A;  4FW1 A;  4O8K A;  3M6G A;  5CZ1 A;  4DUZ K;  3VES A;  4YNQ A;  2FSK A;  2E6M A;  2XHB A;  1VQ9 N;  2ZM6 K;  3HBT A;  4CEZ A;  2GWJ A;  4AHC A;  4FW2 A;  3JYT A;  4JKB A;  1ILY A;  3F5T A;  1YT3 A;  4KHN A;  4FZX C;  3CG7 A;  3O8M A;  4CZE A;  1JL1 A;  2QWN A;  2QWO A;  2OPP A;  1L3V A;  4IEE A;  4JKC A;  1LAW A;  4DWI A;  1YVU A;  1ZBL A;  2EHG A;  4BG8 A;  1QE1 A;  4WFA L;  5BPN A;  4IFY A;  1MA9 B;  5BN9 A;  4Z94 A;  4BC3 A;  3F9M A;  4DR6 K;  5GIP A;  1YAG A;  3S3M A;  2CH5 A;  3R8E A;  1GLB G;  5ADX H;  4ZHR A;  4GV9 A;  4K43 A;  3L2V A;  4MFB A;  1UA0 A;  4M3X A;  3J8A A;  1KCF A;  4H03 B;  4DG1 A;  5CYQ A;  3ENB A;  2NRT A;  4IOX A;  3BY5 A;  4LF8 K;  1EP4 A;  3SQ2 A;  5DK5 A;  3VQP A;  4DTS A;  4NCB A;  1IBK K;  3NF8 A;  4E1J A;  3SLC A;  3SJJ A;  3LP0 A;  1HKC A;  2A40 A;  2HMP A;  4IBN A;  5AQM A;  3DLE A;  2YNH A;  1W0H A;  3VQD A;  5BRD A;  3LWM A;  4RCH A;  2X6S A;  3IUC A;  5AQX A;  4DTU A;  1WAF A;  1OH6 A;  2HHW A;  1BL3 A;  4OJR A;  1JLB A;  2GBZ A;  3SK3 A;  4CJ3 A;  5AQS A;  5AQO A;  3HPO A;  2UU9 K;  3OYN A;  1QSY A;  4DSI A;  4KAZ A;  4CW7 B;  2P9L A;  4M3Z A;  3AVH A;  4E7L A;  1A5W A;  3EY1 A;  1L5U A;  3Q7C A;  3ZEU B;  1U4B A;  4FM2 A;  2KZM A;  1TK0 A;  4N47 A;  4NYF A;  1CZB A;  4FYD A;  3VMF B;  3C7N A;  2YHX A;  4CHZ A;  4F9O A;  3K9K A;  4DUY K;  4C8M A;  3U3G A;  2E1Y A;  3CMA N;  1OH8 A;  4FZZ A;  4BRN A;  4GVM A;  4DV2 K;  4EIA A;  5JLH A;  2ITM A;  4DHY A;  1N5Y A;  2E8A A;  3PX4 A;  3KD1 E;  3AVN A;  3DAW A;  1ATN A;  3DXK A;  3KLI A;  1SL1 A;  2VWK A;  3FFK B;  5JMV A;  4N41 A;  4JKG A;  1T8E A;  4FL9 A;  4BRO A;  1NWK A;  3RSE B;  3HTV A;  1TKT A;  1Z05 A;  3AAR A;  5KI6 A;  1RBR A;  1TGO A;  3H3N O;  4U7B A;  2O4I A;  4FSV A;  2RN2 A;  2YKM A;  1QSL A;  3W0L A;  4EP4 A;  1JCG A;  2A6A A;  2FBY A;  4YDU A;  4O0I A;  3CF5 L;  4EP5 A;  1J54 A;  5M1P A;  5C15 A;  1S1U A;  1VQ4 N;  2G8K A;  1KRP A;  2Y1J A;  4CHO A;  4FJX A;  5AFU H;  3QNN A;  2YX6 A;  3WUH A;  2PY5 A;  2KW4 A;  4BRE A;  3RMB A;  1TYQ A;  4O55 A;  3E66 A;  4IZ9 A;  1MU2 A;  2F7T A;  4OKJ A;  4EFH A;  4B8A B;  4X66 K;  4Z0U A;  2OA8 A;  1JL2 A;  2XO7 A;  3ZSZ A;  3IAY A;  2Q1N A;  1TV6 A;  5GAH P;  4ILJ A;  4LFB K;  1HPZ A;  1NNE A;  3ID8 A;  4YOX A;  1QQM A;  4OO1 J;  5LJV A;  3PY8 A;  3R3L A;  4IO8 A;  3Q7B A;  2A42 A;  1U45 A;  2PZS A;  3K59 A;  4FLY A;  4DU4 A;  2B5J A;  2P9S A;  5EOY A;  1NJZ A;  4X64 K;  4DV3 K;  1GOB A;  5DMR A;  4FWM A;  1WB9 A;  3SJH A;  1S9E A;  3NCI A;  5M1F A;  1NU0 A;  1C0U A;  3UKR B;  1NK9 A;  4BRL A;  5IT9 O;  3JSM A;  3O9T A;  3AO3 A;  5KRS A;  1GLJ O;  1ESV A;  5BN8 A;  3AA5 X;  2YKN A;  4KV8 A;  1WBB A;  1VQN N;  4KHY A;  4DR5 K;  3HRG A;  4C1N I;  4LSL A;  1OVY A;  3LDO A;  2OAN A;  3AVJ A;  4Q0B A;  3R6M A;  1YJW N;  4CZL A;  4DTX A;  3AY9 A;  1MWM A;  3QIO A;  3I56 N;  5AQZ A;  1Q86 O;  3C6T A;  1TKD A;  4QS8 A;  3T69 A;  2NLX A;  3UKU B;  1LW0 A;  1SKR A;  3HVT A;  3A0I X;  4CZK A;  3M5R A;  2NRV A;  3VA3 A;  1DTQ A;  2Z1I A;  3C95 A;  1NGJ A;  3EN9 A;  3V1Q A;  4CEB A;  1QHT A;  2NRW A;  2X74 A;  4PUO A;  4BQZ A;  2AJQ A;  4C8O A;  1BUP A;  1N33 K;  4JAX A;  5C2F A;  1RTI A;  5AQH A;  1D9D A;  3P38 A;  3HOS A;  2VYP A;  2VGN A;  1ATR A;  3HP9 A;  3SAF A;  4HUE A;  4JI4 K;  4OGC A;  1FJG K;  4Y1C A;  1NK0 A;  3HI0 A;  4JEP A;  3THY B;  2EWS A;  1O1W A;  3M8S A;  3NF9 A;  3KWG A;  3HVR A;  4Z4F A;  4DR1 K;  4E7K A;  4FLX A;  2WC9 A;  3H46 O;  2VQF K;  2F8T A;  1BHL A;  1I94 K;  5HRP A;  4CI6 A;  3LZI A;  3IG1 A;  2G8F A;  3P31 A;  1TAU A;  3AO4 A;  1WNS A;  4JKG B;  1QZ5 A;  1BI4 B;  3L6Q A;  2E4L A;  1SKS A;  2QWM A;  4JK8 A;  3CCQ N;  1HUX A;  1VSD A;  1B9D A;  4Z4H A;  4BRM A;  4FLU A;  4CES A;  3KK2 A;  3DLB A;  2KFZ A;  3SPZ A;  2ZE2 A;  2GV9 A;  3MCA B;  3RR8 A;  3O3H A;  2V7Z A;  1TKZ A;  1YI2 N;  1RDB A;  2D4W A;  4R5P A;  5EU7 A;  3L4Q A;  4B1W B;  3AO1 A;  4H5T A;  4IJN A;  3DYA A;  1LWE A;  4DF4 A;  2Q31 A;  4FVM A;  1YXQ A;  1BIS A;  2HBL A;  4NYN A;  3ZT2 A;  4AHS A;  4CBW A;  3O1W A;  3QML A;  2ZF5 O;  1CXQ A;  4I6M B;  1RDW X;  3MN6 A;  4CFA A;  3D2F B;  3VF6 A;  2ZD1 A;  4CIE A;  2RE2 A;  1GOA A;  2H3G X;  2RKI A;  4X62 K;  4GW6 A;  5B8H A;  3OYI A;  2XY6 A;  1YJN N;  3VQC A;  5JLF A;  1JXE A;  1WSI A;  4K41 A;  2P5G A;  2IVP A;  4EZ9 A;  4JK9 A;  2W6L A;  3SZ2 A;  3QDK A;  4ICL A;  4AF1 A;  4C1N K;  4CJF A;  1WUA A;  1QSS A;  3OHR A;  2PBD A;  2QTD A;  2O8E B;  3DLG A;  4CEE A;  4UQG A;  1XMQ K;  1LOT B;  4DKW A;  1GLE G;  3HJF A;  4IO9 L;  1U47 A;  3PO5 A;  1A5V A;  3MMV A;  3NGZ A;  1DKG D;  1WLJ A;  1HNW K;  3O3F A;  1NGI A;  3MXJ A;  4LD0 A;  1DTT A;  1EET A;  2W41 A;  5CYM A;  4GMJ B;  4IEI A;  4FJL A;  3TI0 A;  3DM2 A;  4H0O A;  5J2Q A;  3U9D A;  2E2N A;  4DR7 K;  3C6U A;  3MX5 A;  5CY4 A;  4ZTF A;  3UE5 A;  4A2A A;  3D7E O;  4BC2 A;  4J2B A;  2W42 A;  1RT5 A;  3CFO A;  4DSF A;  3MK6 A;  3MN7 A;  4HVJ A;  1QQO A;  4QS7 A;  2WON A;  1O13 A;  4BAC A;  3J7Z O;  3QER A;  2ASP A;  1Q7Y O;  1T44 A;  2HND A;  2D0A A;  1IH7 A;  2UXD K;  5SWM A;  3P4I A;  4JN4 A;  1HX1 A;  5JIC A;  1SV5 A;  2QWR A;  4CJE A;  1NGE A;  1NMN A;  2QI2 A;  4KFB A;  3LDQ A;  1X3N A;  3VPZ A;  3WNG A;  3MEC A;  3OBY A;  5AQN A;  3QO9 A;  3H45 C;  4A5A A;  4CJ5 A;  3K5M A;  3NMU A;  4AIL C;  1M1K O;  2G8V A;  4FJG A;  1L3T A;  5JVH L;  3OYD A;  4DU3 A;  4BVO A;  4FM1 A;  3TAG A;  1NG9 A;  2A41 A;  2B6A A;  3NGY A;  3J7A P;  4DU1 A;  4M7X A;  3AA2 A;  1VQ8 N;  3VTH A;  1FK9 A;  1WAJ A;  3VEY A;  2ASM A;  4HCB A;  4OKE A;  3G0Z A;  2UUA K;  2QXL A;  3L2R A;  3O80 A;  3LL3 A;  3CCV N;  4W5O A;  2GWK A;  3ID6 A;  4OPK A;  2EX3 A;  3BUZ B;  5AQT A;  3ZSW A;  5DM7 L;  1ZBF A;  1KLN A;  1RT1 A;  2ETJ A;  5AQY A;  5EVZ A;  4CEO A;  1XI1 A;  1HNX K;  1IKW A;  4KO0 A;  1ITG A;  2I7N A;  4LF4 K;  3SAG A;  1SS6 A;  4FWO A;  5GAG P;  3ASM A;  4ISF A;  3CCE N;  3ULE B;  2P9S B;  3DRR A;  4RW4 A;  5M1N A;  3MXM A;  1QQC A;  2IVN A;  5HL7 L;  2I5J A;  5EY4 A;  1FW6 A;  1N8R O;  1WSH A;  2IDO A;  3ULE A;  3SQ1 A;  2A5X A;  2OZM A;  2FSJ A;  5AZI A;  1NK6 A;  1C1A A;  2VCP A;  2HW3 A;  4CGI A;  4IDH A;  4OPJ A;  4H5V A;  3K57 A;  3CCM N;  1NK7 A;  4V19 S;  1C0G A;  3ZSV A;  1DGK N;  3PSI A;  3VQ7 A;  5C42 A;  1QS4 A;  3BF1 A;  4LF6 K;  3SMS A;  5DM6 L;  4KRE A;  2RF2 A;  4BRD A;  1JLE A;  2HF3 A;  1NJX A;  4JKF A;  3LAN A;  2IGI A;  4FJ8 A;  4Z4I A;  4KTQ A;  1RTH A;  4DQQ A;  3D2F A;  3MWT A;  4FJJ A;  3O5B A;  1VSL A;  1NGD A;  3WQT A;  1GLC G;  1SQK A;  5AJ3 K;  3DMJ A;  3ZCM A;  1X9S A;  3CPE A;  2J4R A;  1NK4 A;  1IBM K;  1SKW A;  3OYC A;  1NKE A;  4FM0 A;  3F2K A;  1GLD G;  1VSJ A;  1J9A A;  4H0P A;  1ASW A;  5LY3 A;  2QWL A;  4OVL A;  2ZJP L;  4OGE A;  1R0A A;  4K0K K;  5KGX A;  4CJR A;  1RBV A;  1I3A A;  2HHT A;  4FJM A;  3AAP A;  3LDS A;  4CFB A;  3WEE A;  1NGB A;  4H5R A;  4M3W A;  3D45 A;  4G1Q A;  1EWR A;  1R59 O;  1BWF O;  3ZYY X;  4KBO A;  1BI4 A;  1MDU B;  3DI6 A;  3IDH A;  3THW A;  4Y0W A;  4FJI A;  2YCH A;  5SZT A;  3DXM A;  3U8X A;  5AQU A;  2Q0R A;  2O8F B;  3ZET A;  3VGK A;  3ZT1 A;  1UOC A;  2FXU A;  2UXC K;  3HOT A;  4H5W A;  1RBT A;  5CHI A;  4CED A;  5MLC Q;  2KHO A;  4K8Z A;  1TAQ A;  4DQR A;  3FLC O;  3QBX A;  5HRR A;  3THX B;  2CGK A;  4BRP A;  3FZL A;  1NJY A;  4C8L A;  5AZJ A;  1NKB A;  3SBG A;  3OYM A;  4CJP A;  1LAV A;  4JI5 K;  1U6Z A;  1JLC A;  4BC4 A;  4CIF A;  4F4K A;  1NK8 A;  3LP1 A;  1IKX A;  3SQ4 A;  3CCS N;  3VEO A;  4KPY A;  2DFH A;  1S1W A;  4DFM A;  2CH6 A;  2E2P A;  1T6D A;  4C23 A;  4MO5 A;  1U2V B;  3TSQ A;  3KLE A;  3TAN A;  1VSF A;  3CJ1 A;  3A2F A;  1NBW A;  4FWN A;  3WQU A;  3VN5 A;  2ZWH A;  1Q9Y A;  3ATV A;  1JKH A;  4HUG A;  1Q81 O;  5AQF A;  1J6Z A;  2A3Z A;  2F4V K;  3NBP A;  2YV0 X;  4BRK A;  4B3T K;  5C12 A;  1KAY A;  2HHX A;  4CHY A;  4RW7 A;  4KI4 A;  2V7Y A;  3IMX A;  4LH4 A;  4B9S A;  5KPR A;  3G6E N;  3K58 A;  3JAM O;  2VGM A;  3VTI A;  3K5N A;  2G8I A;  1ZBS A;  2F96 A;  3J80 O;  2PFU A;  1HKB A;  2WBN A;  4FWS A;  2FF3 B;  1RGI A;  2Q2R A;  3H1Q A;  1VSM A;  1YVN A;  5AQV A;  5FRM A;  3RVC A;  1BCM A;  2RPI A;  2HHV A;  1BG3 A;  3V6D A;  1VRU A;  4I9L A;  3SI6 A;  4JKA A;  1B92 A;  4EAH D;  1BO5 O;  4FOE A;  1J5E K;  3EZ5 A;  1MWK A;  1ZXO A;  4ISG A;  3P83 D;  5F2R A;  1HNZ K;  1JJ2 M;  3HO1 A;  1U04 A;  3N4Q A;  2HHQ A;  1E4F T;  1TUY A;  1HRH A;  5AQW A;  3NF6 A;  4CE9 A;  3QNO A;  1ZBI A;  1ASV A;  3AO5 A;  2Q3S A;  1G15 A;  3K5L A;  4CGJ A;  4OKK A;  5GIO A;  1NOY A;  1ATS A;  2P9N A;  4N76 A;  4PY5 A;  4RTF D;  4ELT A;  5BR9 A;  4J8F A;  5F1X A;  1RNH A;  4CHQ A;  4B1Z A;  4CF0 A;  4OLA A;  2P51 A;  4CZI A;  3DLL L;  3CQY A;  3QIC A;  4CJK A;  5AQI A;  3T1Y K;  1Y97 A;  2D1K A;  4NLB A;  3WNF A;  3CQX A;  1EX4 A;  4BWM A;  3BEX A;  3S9H A;  4FPA A;  4CEQ A;  1E4G T;  3K2P A;  3NFA A;  3QEP A;  4CEC A;  3KLG A;  3OW2 M;  5TKY A;  3WXL A;  1VSK A;  4U67 L;  3THV A;  5FRN A;  4DLG A;  3L4I A;  3VQQ A;  4DR2 K;  5HBM A;  4I2P A;  4BRC A;  3DLH A;  3HSC A;  3GG4 A;  3ZT0 A;  1GLF O;  4KTW A;  1TK8 A;  4B9T A;  1IKY A;  3EL2 A;  3RRH A;  4OLB A;  5AQR A;  2OTJ N;  1IKV A;  1S1T A;  2BDP A;  3IRX A;  4DV6 K;  4DF8 A;  3OJU A;  1XNQ K;  4FVU A;  1JCF A;  3U3Y A;  1RTJ A;  3QEW A;  4B9M A;  2P1J A;  3O08 A;  4ILG B;  4FLW A;  5BPM A;  5KQD A;  3C94 A;  4AHR A;  3BDP A;  2WTU A;  3MWP A;  2ITG A;  3R1X A;  5AR0 A;  3GBT A;  1CZA N;  3DRP A;  3VOV A;  1NLV A;  3UB5 A;  4GNI A;  4FPB A;  4H0X B;  2IIR A;  5C0Y A;  1HR0 K;  3RMA A;  3WNE A;  4K42 A;  4MDB A;  4H8K A;  2IC3 A;  2A1R A;  3DRS A;  3CXC M;  3AVL A;  4H5N A;  2KLA A;  2BTF A;  3V9W A;  4E0D A;  3V1O A;  4Z4C A;  2V52 B;  4B8C A;  4BRF A;  3NAE A;  3CI5 A;  4CF1 A;  2D0B A;  3SAH A;  2IAJ A;  3QEX A;  3C6H A;  2QW9 A;  3B8A X;  3OYA A;  3H1V X;  3VEZ A;  1RDU A;  1TVR A;  4DQS A;  3O3G A;  3DXM B;  4DTP A;  2OZS A;  5CR4 A;  5BRH A;  3QEV A;  3NH2 A;  1S72 N;  3PLA A;  5BRE A;  1K6Y A;  3OYL A;  4YHH K;  4FLZ A;  3V1R A;  1HYS A;  3TAF A;  1QHA A;  4B3S K;  3LAL A;  1NMD A;  4XH5 A;  2D0C A;  1OVQ A;  2PYJ A;  3VQ5 A;  3H6E A;  4CZH A;  1JCE A;  4K8X A;  2P9P A;  5C2D A;  3FFI A;  3QBW A;  3QIN A;  2ATQ A;  3LM2 A;  4A61 A;  3ENH A;  5AQQ A;  3M8P A;  4XH1 A;  3F9K A;  1P90 A;  3TWH A;  1D8Y A;  1U49 A;  2PAV A;  3BZC A;  3V9U A;  1K9M O;  2ZGY A;  1HYZ A;  3M3Z A;  2XRI A;  3CC7 N;  3KHY A;  3DXK B;  4DV4 K;  3GE1 A;  3NH0 A;  4KB1 A;  4XH4 A;  1W97 L;  4IDK A;  1XUP O;  1QTM A;  3T3F A;  2Y1I A;  1K8K B;  1HKG A;  4WFB L;  1BA1 A;  1L3U A;  4CHP A;  3LZJ A;  2PYL A;  2NUB A;  1JLA A;  3O9S A;  1C0F A;  4BR9 A;  2GUI A;  4IG0 A;  4IOA L;  1XNR K;  5EX5 A;  1Q18 A;  3AVK A;  4EZ6 A;  3KKS A;  2GEM A;  4O5F A;  4DB3 A;  3VF2 A;  4BRQ A;  2NRZ A;  1C0T A;  1ZBU A;  1RT6 A;  4PWD A;  3DLR A;  2BE2 A;  3KJV A;  4AHV A;  3I33 A;  3TAR A;  3CPW M;  3OBW A;  2OPS A;  3BGR A;  3LDP A;  3VEW A;  1NGH A;  4XIU A;  3RR7 A;  4KHU A;  2IS3 A;  5M1O A;  4GV6 A;  3M8Q A;  4AM6 A;  3J7Y P;  3WXM B;  3V9Z A;  2HB5 A;  1H1V A;  2P9U A;  3AVI A;  4FO0 A;  3SV4 A;  4YOY A;  3OS0 A;  4IFV A;  2YHW A;  2BAN A;  2WUS A;  1J53 A;  4BR7 A;  5J2M A;  4HTL A;  3NDK A;  3FR0 A;  4H0Y B;  4B1Y B;  4JI6 K;  1EWQ A;  4MLE A;  1TUU A;  4DV5 K;  1WSE A;  3SUO A;  4JKE A;  4BQL A;  3W3D A;  3D0P A;  3ENO A;  4NXN K;  1IO2 A;  1NGC A;  1RIL A;  3BF3 A;  3WXI A;  4BG9 A;  5KTQ A;  4JI3 K;  4F2R A;  3NVM A;  4FJ5 A;  3O9R A;  2HVI A;  4CVN E;  4WCE L;  5JVG L;  3TTC A;  3C65 A;  3SUP A;  1C6V A;  4DS4 A;  2E20 A;  5E41 A;  4HTU A;  2X6N A;  4FWK A;  4YOV A;  4DSK A;  2HHU A;  3SV3 A;  5AZJ B;  4YOR A;  4WE1 A;  3AA4 A;  1IV0 A;  1S6Q A;  3O6W A;  2O8D A;  4A2B A;  4CJS A;  3HM9 A;  3CJA A;  4GKK K;  4FK0 A;  3TAE A;  5ADX A;  4B1V A;  3AVG A;  2OPQ A;  1NKC A;  3L2Q A;  4CJW A;  1TL3 A;  4B08 A;  1RBU A;  2O8F A;  1ASU A;  2YNI A;  4KTZ A;  5J2P A;  2YJF A;  3P39 A;  1TYQ B;  1HJR A;  4LC9 B;  3SUQ A;  5FPD A;  1RT4 A;  2QXF A;  1YTA A;  3ZT3 A;  3TAQ A;  2HNZ A;  3CQ8 A;  5JS2 A;  4CJV A;  2P5O A;  3DOL A;  3CIP A;  4DTO A;  4TSX A;  4IXC A;  1VQM N;  3ITH A;  3I8D A;  3L3V A;  1QVF M;  3CET A;  4FLT A;  2OYQ A;  4CGD A;  2JWL A;  1RT3 A;  3SUN A;  3OYE A;  3VQB A;  3CFP A;  4YFU A;  4MDA A;  1XWL A;  3EEQ A;  3QLH A;  5C25 A;  3NE6 A;  3OJS A;  2FBT A;  4WF9 L;  3OS2 A;  3BZK A;  4CHN A;  2W40 A;  4Y1D A;  3PSF A;  4WFN L;  1N6Q A;  4E7J A;  1X9M A;  4XEI A;  4J2D A;  1NM1 A;  4KH5 A;  1F21 A;  3V81 A;  2UUB K;  3PX0 A;  4C8N A;  4I2Q A;  3I55 N;  2A1S A;  3A8Y A;  5IWA K;  2UUC K;  4YDU C;  1U48 A;  2FBX A;  2Q36 A;  4KHP K;  2IVO A;  5KPZ A;  4LF9 K;  1IG9 A;  4F3O A;  4FWP A;  4ISE A;  2P9U B;  4ID5 A;  1C0M A;  3M1F A;  3A5O C;  1HJO A;  3O9U A;  1N36 K;  3LPU A;  4QOZ B;  1RDA A;  3RMD A;  4I6M A;  5HRN A;  2NZT A;  5GAD P;  2G8W A;  3OYB A;  4JV5 K;  4J2E A;  5AQK A;  1VQ7 N;  1D9F A;  1YTU A;  3SQ0 A;  4B9Q A;  3T7Z A;  1GLA G;  3D2E A;  4KRF A;  5EXW A;  2P9I A;  1CLQ A;  3HM8 A;  4DV0 K;  4AHT A;  2VG6 A;  3ATU A;  4NLC A;  1K8K A;  2FBV A;  3UKR A;  2LSN A;  2O4G A;  1Y64 A;  3MDQ A;  3VGM A; 
#chains in the Genus database with same CATH homology
 2Z1I A;  3UIQ A;  5FRM A;  3C95 A;  3LP3 A;  1BCM A;  2RPI A;  2DTU A;  2JLE A;  2HHV A;  3V1Q A;  3K5O A;  3V6D A;  3TR8 A;  3I0S A;  3QIP A;  4CEB A;  1JLG A;  1VRU A;  1QHT A;  4I9L A;  3T1A A;  3SI6 A;  5T7B A;  4DQI A;  3CM6 A;  2X74 A;  1B92 A;  1Q9X A;  4PUO A;  3L8B A;  2AJQ A;  1BCO A;  4C8O A;  4E7H A;  3EZ5 A;  4QCL A;  3P83 D;  1RTI A;  1D9D A;  3HO1 A;  1U04 A;  4BE2 A;  1KTQ A;  3HP9 A;  4CK3 A;  4DLE A;  4CEF A;  4FJH A;  2HHQ A;  4HUE A;  1JLF A;  1HRH A;  3HST B;  3NF6 A;  4BE1 A;  3ALY A;  4CE9 A;  3QNO A;  1ZBI A;  1ASV A;  3AO5 A;  4OGC A;  2Q3S A;  3VQA A;  1G15 A;  4Y1C A;  3ZSR A;  4E3S A;  3K5L A;  3TAM A;  4CGJ A;  1NK0 A;  4W5R A;  4RW8 A;  3M8R A;  1O1W A;  4CGF A;  4OKK A;  3M8S A;  3NF9 A;  3OYJ A;  3HVR A;  2DFE A;  3ZSO A;  4HUF A;  3QES A;  4FK2 A;  4Z4F A;  4DFK A;  4CF2 A;  4E7K A;  4FLX A;  1NOY A;  3VQ9 A;  4N76 A;  4CFD A;  4PY5 A;  1VRT A;  2F8T A;  3OYH A;  1BHL A;  3CM5 A;  4ELT A;  1B9F A;  4CFC A;  4CK2 A;  5HRP A;  3LZI A;  3IG1 A;  2G8F A;  1LWC A;  1TAU A;  3ISN C;  1RNH A;  2YNG A;  3AO4 A;  3PUF A;  3RMC A;  1JLQ A;  1WNS A;  3SNN A;  3OYF A;  4CHQ A;  1S6P A;  1BI4 B;  3AO2 A;  2E4L A;  1NK5 A;  5C24 A;  4CF0 A;  5J1E A;  3V9X A;  2P51 A;  1SKS A;  4OLA A;  4H4M A;  4O4G A;  4CJ4 A;  4CJK A;  1VSD A;  2VG7 A;  1B9D A;  4Z4H A;  4O44 A;  4FLU A;  4CES A;  3KK2 A;  1Y97 A;  3S3N A;  3DLB A;  4DSJ A;  3AVM A;  3WNF A;  2KFZ A;  2YNF A;  3SPZ A;  1EX4 A;  4BWM A;  2G8H A;  5HLF A;  1T03 A;  3O4N A;  3S9H A;  4CEQ A;  4F2S A;  2ZE2 A;  4CF9 A;  3K2P A;  3NFA A;  4I9Q A;  3QEP A;  3TAP A;  2GV9 A;  4CEC A;  3KLG A;  1FKO A;  2VG5 A;  4M42 A;  2WOM A;  3SCX A;  3O3H A;  3RR8 A;  4W5N A;  1VSK A;  3THV A;  1TKZ A;  3LAK A;  1RDB A;  4PA1 A;  4DLG A;  5FRN A;  4CGH A;  3SPY A;  3VA3 A;  3AVC A;  4R5P A;  3MEE A;  5EU7 A;  3VQQ A;  4BDP A;  3AO1 A;  5HBM A;  3DYA A;  1LWE A;  4I2P A;  4DF4 A;  3DLH A;  4FVM A;  1BGX T;  3KK3 A;  3ZT0 A;  4AH9 A;  1BIS A;  4Z4E A;  4KTW A;  3V4I A;  1TK8 A;  3ZT2 A;  4NYN A;  4AHS A;  4B9T A;  1IKY A;  3RRH A;  4OLB A;  4IG3 A;  1IKV A;  1CXQ A;  1S1T A;  4BWJ A;  4CER A;  1KVC A;  4CFA A;  4CGG A;  2IOC A;  4DFJ A;  3TAB A;  2BDP A;  4IKF A;  1WSJ A;  4JS4 A;  3IRX A;  2JGU A;  2ZD1 A;  4CIE A;  3OJU A;  4DF8 A;  1C1B A;  2HVH A;  1GOA A;  3U3Y A;  3MXI A;  1RTJ A;  3QEW A;  2RKI A;  2G8U A;  1TKX A;  4B9M A;  2P1J A;  4GW6 A;  5HRO A;  4FLW A;  3ULD A;  3HL8 A;  3OYI A;  2XY6 A;  3PO4 A;  1W9H A;  2KTQ A;  3VQC A;  3P1G A;  3C94 A;  1RT2 A;  4AHR A;  1JXE A;  1WSI A;  3EYZ A;  3BDP A;  1S9G A;  2ITG A;  2P5G A;  5KGW A;  4ID1 A;  3L2U A;  4EZ9 A;  4LSN A;  3DRP A;  2XY7 A;  3SZ2 A;  2XY8 A;  4LY7 A;  4DSL A;  5I42 A;  4ICL A;  4CJF A;  1VK0 A;  1HNI A;  3HPG A;  3ZSQ A;  1XHX A;  3RMA A;  3WNE A;  3OVN A;  1QSS A;  4H8K A;  1BQM A;  2IC3 A;  3OYG A;  4DTN A;  2A1R A;  1S5J A;  2HNY A;  3DRS A;  3P5J A;  2OPR A;  4HHT A;  1KSP A;  1WSF A;  3DLG A;  4CEA A;  4CEE A;  4MQ3 A;  4UQG A;  3AVL A;  2VWJ A;  5I3U A;  5FDL A;  3HJF A;  1A5X A;  3AV9 A;  3MAQ A;  5J2N A;  1U47 A;  1BIZ A;  1KFD A;  3V9W A;  1RTD A;  3KTQ A;  3V1O A;  1A5V A;  3PO5 A;  4E0D A;  4Z4C A;  4H4O A;  1ZBH A;  4B8C A;  3NGZ A;  4FXD A;  1BIU A;  4FJK A;  1WLJ A;  4FLV A;  3NAE A;  1KVA A;  2D0B A;  4CF1 A;  3O3F A;  1Q8I A;  2IAJ A;  3G10 A;  3MXJ A;  3V9S A;  4LD0 A;  3QET A;  1DTT A;  3QEX A;  4C8K A;  3OYA A;  1TL1 A;  2Z1H A;  1EET A;  3VQ4 A;  3KD5 E;  5CYM A;  4GMJ B;  2FC0 A;  4FJL A;  2F8S A;  4E89 A;  3TI0 A;  3DM2 A;  4NCA A;  3HP6 A;  5J2Q A;  4B3O A;  1TVR A;  3KKR A;  3AA3 A;  5JS1 A;  4DQS A;  3O3G A;  4DTP A;  1HNV A;  4JRP A;  3C6U A;  5CY4 A;  4ZTF A;  2OZS A;  3HYF A;  4B9N A;  2DY4 A;  3QEV A;  3NH2 A;  3IS9 A;  1K6Y A;  3OYL A;  4FLZ A;  4BE0 A;  4B9L A;  2W42 A;  4J2B A;  3V1R A;  1HYS A;  1RT5 A;  1D5A A;  3CFO A;  3KIO A;  4RG8 A;  4DSF A;  3TAF A;  3LAL A;  4HVJ A;  4LH5 A;  1RDC A;  1GOC A;  2D0C A;  3HXM A;  2PYJ A;  4KHQ A;  3VQ5 A;  4K8X A;  2WON A;  4CF8 A;  4BAC A;  3FFI A;  4BDZ A;  3QER A;  1L3S A;  1CXU A;  5HP1 A;  2QKK A;  3L2W A;  3QIN A;  4ELU A;  4W5T A;  2ATQ A;  2HND A;  2D0A A;  1IH7 A;  3VQ6 A;  5SWM A;  3OY9 A;  3HPH A;  4CJU A;  4M3U A;  3M8P A;  3ZT4 A;  3F9K A;  2Z1J A;  4E1M A;  3TWH A;  3NGI A;  1D8Y A;  1X9W A;  4M3T A;  1U49 A;  1SV5 A;  4E1N A;  1HMV A;  3WNH A;  1SL2 A;  3U6F A;  1REV A;  3MEG A;  4CJE A;  4KFB A;  1CZ9 A;  3V9U A;  1T05 A;  4F8R A;  1HYZ A;  4FW1 A;  3VQE A;  2XRI A;  3MEC A;  3WNG A;  5CZ1 A;  3QO9 A;  4YNQ A;  2YHB A;  4CJ5 A;  3NH0 A;  3K5M A;  5D3G A;  4KB1 A;  4JRQ A;  2E6M A;  4AIL C;  4IDK A;  1KFS A;  2XHB A;  2G8V A;  4FJG A;  2QKB A;  4CEZ A;  3T3F A;  1QTM A;  2Y1I A;  1L3T A;  1LV5 A;  1WN7 A;  4L8R B;  4AHC A;  4FW2 A;  3OYD A;  3JYT A;  4DTM A;  3AVA A;  4DU3 A;  4FM1 A;  4FZY A;  1L3U A;  3TAG A;  4CHP A;  1YT3 A;  2B6A A;  3NGY A;  3LZJ A;  2NUB A;  2PYL A;  4FZX C;  1JLA A;  4KHN A;  3CG7 A;  4DU1 A;  3AA2 A;  2GUI A;  1JL1 A;  4IG0 A;  1NOZ A;  2OPP A;  5CZ2 A;  1FK9 A;  1WAJ A;  1LAW A;  3PX6 A;  1L3V A;  2HMI A;  1SL0 A;  4DWI A;  1Z26 A;  1YVU A;  4HCB A;  3AVK A;  4EZ6 A;  3KKS A;  1ZBL A;  4OKE A;  3G0Z A;  2EHG A;  3KLH A;  1QE1 A;  3L2R A;  1C0T A;  1VSE A;  1ZBU A;  1RT6 A;  1FXX A;  1RCH A;  4IFY A;  4W5O A;  2KZZ A;  4OPK A;  4M3R A;  2EX3 A;  1SUQ A;  3AVF A;  2BE2 A;  3DLR A;  3ZSW A;  4AHV A;  3KJV A;  3TAR A;  3S3M A;  4PWD A;  4DFP A;  3DLK A;  1ZBF A;  1KLN A;  1RT1 A;  4HCC A;  2ETJ A;  2OPS A;  3BGR A;  3QEI A;  4XIU A;  3RR7 A;  4KHU A;  4CEO A;  2IS3 A;  1XI1 A;  4FJN A;  1IKW A;  3M8Q A;  4ZHR A;  3L2V A;  4MFB A;  3V9Z A;  4KO0 A;  1UA0 A;  1ITG A;  1UAX A;  3HT3 A;  3SYZ A;  4M3X A;  2HB5 A;  4DG1 A;  1KCF A;  5CYQ A;  3AVI A;  3B6P A;  3ASM A;  1WSG A;  3SV4 A;  3LWL A;  3DRR A;  4IFV A;  4RW4 A;  3OS0 A;  1QQC A;  1EP4 A;  2BAN A;  5DK5 A;  3VQP A;  2I5J A;  3KK1 A;  3SQ2 A;  4F3T A;  1J53 A;  5J2M A;  4DTS A;  3NF7 A;  1WSH A;  3NDK A;  4NCB A;  4I7F A;  3L3U A;  2IDO A;  4ZTJ A;  3NF8 A;  3SJJ A;  3SQ1 A;  1X1P A;  2OZM A;  3LP0 A;  1LWF A;  4IBN A;  1NK6 A;  1WSE A;  3SUO A;  4CJT A;  1RDD A;  4CJQ A;  1TK5 A;  3DLE A;  3ZSX A;  2YNH A;  1C1A A;  1W0H A;  1Z25 A;  3VQD A;  4CIG A;  3LWM A;  3D0P A;  2HW3 A;  2X6S A;  4JS5 A;  1IO2 A;  1RIL A;  5KTQ A;  4DTU A;  4CGI A;  1WAF A;  4O5B A;  2HHW A;  4OPJ A;  3NH1 A;  4F2R A;  4FJ5 A;  4M41 A;  2HVI A;  3O4Q A;  4NCG A;  3K57 A;  1BL3 A;  2KQ2 A;  1NK7 A;  1BQN A;  4OJR A;  1JLB A;  1UWB A;  2GBZ A;  4CJ3 A;  4E19 A;  3HPO A;  2B4J A;  3SUP A;  2HHS A;  3ZSV A;  3OYN A;  1QSY A;  1C6V A;  4DS4 A;  4B9U A;  4DSI A;  4KAZ A;  5E41 A;  3VQ7 A;  4HTU A;  2X6N A;  5C42 A;  4M3Z A;  1QS4 A;  3AVH A;  3AVB A;  4E7L A;  1A5W A;  3EY1 A;  1L5U A;  4B9V A;  4KHS A;  4BDY A;  1KLM A;  1KVB A;  4DSK A;  2HHU A;  2QK9 A;  4KRE A;  1U4B A;  2RF2 A;  4FM2 A;  3SV3 A;  2KZM A;  1JLE A;  4WE1 A;  1TK0 A;  3AA4 A;  4N47 A;  4NYF A;  1CZB A;  3OS1 A;  1NJX A;  4FYD A;  3LAN A;  2IGI A;  1S6Q A;  3B6O A;  4CHZ A;  4KTQ A;  1RTH A;  4FJ7 A;  4FJ8 A;  4Z4I A;  3T19 A;  4CJS A;  4C8M A;  3U3G A;  4DQQ A;  2XY5 A;  4QAG A;  3HM9 A;  4FJJ A;  4DTJ A;  4FZZ A;  2X78 A;  1VSL A;  3RRG A;  3TAE A;  4GVM A;  4FK0 A;  3LAM A;  3HK2 A;  3AVG A;  2OPQ A;  4E7I A;  1NKC A;  3L2Q A;  1N5Y A;  4W5Q A;  2ZQB A;  4CJW A;  3KLF A;  3PX4 A;  3DMJ A;  3KD1 E;  3AVN A;  1S1X A;  3ZCM A;  4Z4G A;  2HHT A;  1X9S A;  3KLI A;  2Z1G A;  1NK4 A;  1TL3 A;  2D5R A;  1SKW A;  4B08 A;  1SL1 A;  2VWK A;  1RBU A;  3OYC A;  1VSI A;  1NKE A;  1ASU A;  2YNI A;  4N56 A;  4FM0 A;  4N41 A;  1T8E A;  4KTZ A;  5J2P A;  1VSJ A;  1J9A A;  1TKT A;  1HJR A;  4O0J A;  4N5S A;  1ASW A;  4DQP A;  4J2A A;  3SUQ A;  5KI6 A;  1RBR A;  4OVL A;  1TGO A;  1RT4 A;  4FCY A;  4OGE A;  1R0A A;  1C1C A;  2QXF A;  4RW9 A;  1YTA A;  4DTR A;  3ZT3 A;  5KGX A;  1HQE A;  4RW6 A;  1RBV A;  2HNZ A;  4CJR A;  3CQ8 A;  1I3A A;  5JS2 A;  3TAQ A;  2O4I A;  4CJV A;  1RBS A;  3RTV A;  2P5O A;  2RN2 A;  4CK1 A;  2YKM A;  3LDS A;  3DOL A;  3LP2 A;  3MXM A;  1QSL A;  4CFB A;  4FJM A;  2KFN A;  4M3Y A;  4DTO A;  4M3W A;  3D45 A;  2BGG A;  4EP4 A;  3VQ8 A;  4TSX A;  4G1Q A;  2FBY A;  4M45 A;  4O0I A;  4EP5 A;  1J54 A;  4FJ9 A;  3ITH A;  3I8D A;  3PV8 A;  3L3V A;  1S1U A;  1NJW A;  1BI4 A;  2G8K A;  1KRP A;  4FLT A;  2Y1J A;  4CHO A;  4DSE A;  2OYQ A;  3DI6 A;  4FJX A;  4CGD A;  3QNN A;  1RT3 A;  3SUN A;  3OYE A;  2PY5 A;  4CCH A;  4FJI A;  3VQB A;  4KI6 A;  2KW4 A;  4AHU A;  3F73 A;  3CFP A;  4FK4 A;  5SZT A;  3RMB A;  4YFU A;  3DOK A;  2R7Y A;  1ZYQ A;  1XWL A;  4O55 A;  4Q5V A;  3ZT1 A;  1UOC A;  1MU2 A;  3QLH A;  4OKJ A;  5C25 A;  3OJS A;  3NE6 A;  1HQU A;  2FBT A;  3OS2 A;  1RBT A;  3LPT A;  4CHN A;  4Y1D A;  4B8A B;  3NHG A;  1N6Q A;  4Z0U A;  4E7J A;  4CED A;  2OA8 A;  4K8Z A;  1EKE A;  1TAQ A;  4DQR A;  1X9M A;  4J2D A;  1JL2 A;  5HRR A;  5FRO A;  2XO7 A;  3V81 A;  1F21 A;  3ZSZ A;  3PX0 A;  4C8N A;  4JLH A;  3IAY A;  1NJY A;  1TV6 A;  3CFR A;  4C8L A;  4I2Q A;  1S1V A;  2A1S A;  1HPZ A;  1NKB A;  3OYM A;  4CJP A;  1JXB A;  1LAV A;  1JLC A;  3ZSY A;  4CIF A;  3PY8 A;  4F4K A;  1NK8 A;  3LP1 A;  1IKX A;  2FBX A;  4CJL A;  3SQ4 A;  1U48 A;  3OYK A;  1U45 A;  2PZS A;  3K59 A;  1T7P A;  4KPY A;  4FLY A;  2DFH A;  4DU4 A;  1S1W A;  2B5J A;  3I0R A;  1IG9 A;  1NJZ A;  4KB0 A;  4DFM A;  3CYM A;  4F3O A;  1GOB A;  2DFF A;  3VA0 A;  5DMR A;  4ID5 A;  1C0M A;  1S9E A;  3NCI A;  4ELV A;  1C0U A;  1RT7 A;  3LPU A;  1NK9 A;  4DMN A;  3KLE A;  4QOZ B;  3TAN A;  1VSF A;  1RDA A;  3A2F A;  1XHZ A;  5KRT A;  3JSM A;  3RMD A;  3MED A;  4DS5 A;  3VN5 A;  3AO3 A;  5KRS A;  5HRN A;  1Q9Y A;  2G8W A;  3OYB A;  3RWU A;  1JKH A;  4HUG A;  4J2E A;  3S3O A;  3AA5 X;  2YKN A;  4KV8 A;  1DLO A;  1FKP A;  3NBP A;  1EXQ A;  2YV0 X;  4KHY A;  1D9F A;  1YTU A;  2HHX A;  4LSL A;  5K14 A;  4KHW A;  4CHY A;  3SQ0 A;  3AVJ A;  4PQU A;  4Q0B A;  1HYV A;  1LW2 A;  4RW7 A;  1UA1 A;  4KI4 A;  4DTX A;  4KRF A;  4KKO A;  4LH4 A;  4B9S A;  1VSH A;  5HRS A;  3K58 A;  3QIO A;  1XC9 A;  3K5N A;  2G8I A;  1CLQ A;  2F96 A;  3E01 A;  2E6L A;  2YHA A;  4AHT A;  3C6T A;  1J5O A;  1TKD A;  2VG6 A;  1I39 A;  1LW0 A;  2FBV A;  2LSN A;  1SKR A;  3HVT A;  2O4G A;  3H08 A;  1VSM A;  1DTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...