1HRHA

Crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
125
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ribonuclease H domain of HIV-1 reverse transcriptase.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 37
structure length 125
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1991-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hrhA00
4B9SA 2B5JA 4CIFA 3V9ZA 4CERA 3U3YA 3KK2A 3HVRA 2BDPA 4HUFA 3ALYA 3HK2A 4E19A 4BWMA 1REVA 2YKMA 4CFCA 2KZZA 3NAEA 3LP0A 4Z4IA 2EX3A 1ZBIA 4CJ5A 1D9FA 4FJMA 5FDLA 1WSIA 2G8FA 5FRMA 3V1QA 3V9UA 3SQ2A 4F8RA 2OZSA 4DG1A 3B6OA 1RTJA 4FW2A 1T8EA 2ZD1A 4HHTA 4K8ZA 2KFNA 4CHZA 3NGZA 4B9NA 2XY8A 3K5OA 4FJ9A 4CJWA 3VQBA 2X6SA 2A1RA 1HNIA 4DFPA 4FJGA 4DS5A 4M3XA 2E6LA 3HPGA 1ASVA 3KLIA 4OJRA 4KFBA 2PZSA 4J2EA 2F96A 2X74A 1WNSA 2FBVA 2YHBA 4H4MA 1N5YA 3EY1A 1RDBA 1RCHA 3V9XA 3DLGA 1NK9A 4CJEA 2G8IA 1CZBA 4KHQA 4B9LA 4N5SA 3HSTB 3PY8A 2P5OA 1W9HA 3OJUA 3E01A 3VA3A 4N76A 2YNHA 1BIUA 5I42A 4DSIA 4W5QA 1FXXA 3O4QA 3NH2A 1Q8IA 4KHYA 3KJVA 3L2QA 3K58A 3AVJA 2F8SA 2D5RA 1JLQA 4IFYA 3HO1A 2OZMA 2HHVA 3AVKA 4OGCA 4E7IA 4TSXA 4FZZA 4DTUA 2D0AA 3VQCA 4F4KA 1D8YA 1L3UA 4Z4EA 3IG1A 4M3WA 1WSFA 1C1CA 1TK5A 4B08A 4H4OA 3SJJA 1RT1A 1QSSA 4CF1A 4CECA 1U47A 4DTXA 1JLEA 1C1BA 2KZMA 1KFDA 4Z4CA 1Z25A 4LSLA 4DTMA 1KLNA 3ZCMA 4AHSA 1WAFA 4MFBA 4G1QA 3KLGA 5J2QA 2FBTA 1TK8A 4GMJB 4CEBA 4B9MA 2DFEA 3DLRA 4CF8A 3CG7A 3DOKA 4ID1A 3QLHA 4LSNA 4LH5A 4L8RB 3MEGA 3MAQA 4OLAA 3NF6A 2JGUA 1ZBFA 3IS9A 1BIZA 4OPKA 3NGIA 3V4IA 3O3HA 4UQGA 4F3OA 1HYSA 1ASUA 2ITGA 3AO5A 4KB1A 1TL1A 3OYCA 4KAZA 3MXJA 3RRHA 4ELVA 4KI6A 4DQPA 4PUOA 1CXQA 3QEXA 3C6UA 2EHGA 1O1WA 3C95A 4WE1A 2BANA 2R7YA 3QETA 3TAGA 3L2VA 2FBYA 3SI6A 5I3UA 4OLBA 1SKSA 2HB5A 3NFAA 1KVAA 1S6PA 2VWJA 1SKWA 4C8LA 3KD5E 1L5UA 1IO2A 5JS1A 2P51A 5DK5A 4QOZB 4PWDA 3C94A 1SL1A 4B9TA 5KTQA 3CYMA 3PX4A 2Y1JA 2G8WA 4DFMA 1RT6A 1RDCA 3ZT0A 2HMIA 4GW6A 2KFZA 4KREA 3NF9A 1HPZA 4QAGA 1DTTA 4DQIA 1JLFA 1CXUA 1BQNA 1C1AA 1NK6A 2O4IA 1U49A 4E3SA 1RT5A 4FJJA 4O0IA 3NF7A 1ZBLA 4FLYA 3ZSXA 3NCIA 3QO9A 2FC0A 3OYNA 3SV3A 3SYZA 1ITGA 4Z0UA 1DLOA 1EP4A 4GVMA 4CJFA 1NKBA 1TAUA 2IOCA 4CK1A 3TAEA 1X9SA 4W5TA 2G8KA 2PY5A 3PX6A 3S3OA 1QQCA 5J2PA 5SZTA 1WLJA 5KGWA 2OPSA 3PV8A 4AH9A 1TVRA 1IG9A 4H8KA 3HJFA 3AVFA 4CJ3A 4FJHA 1VSJA 3RRGA 4Z4GA 4CIGA 4KTZA 4N47A 4DU1A 3SPZA 4AHCA 1A5XA 4M3UA 2KQ2A 4CGFA 3AVNA 1W0HA 4DTOA 5HLFA 3HXMA 3K5MA 1YTUA 1TK0A 4CHOA 3OYBA 3SCXA 1YTAA 2BE2A 4ZHRA 1RT4A 1BI4B 3MEEA 4CGJA 3SNNA 2VG6A 4CK2A 3SUNA 4DU3A 1VSMA 3I8DA 1HRHA 3HT3A 3QEPA 1S9EA 1YVUA 3TAMA 1HQUA 3DRSA 1KSPA 4Z4FA 3LPUA 3OYDA 3DM2A 4IBNA 3VQPA 4CGIA 4IG3A 1EX4A 1YT3A 3ZT1A 3LDSA 3DLKA 3PO4A 1XWLA 3RR8A 3VA0A 4I2QA 3VQ6A 1NJZA 4B9VA 4OKEA 4DF4A 3WNEA 3LP2A 5HRPA 1B9DA 1XHXA 3P83D 4EZ6A 2WONA 1BHLA 3M8SA 1X1PA 2ZQBA 2KTQA 3AO1A 3NBPA 4FZXC 3NH1A 4DFKA 3WNGA 4KHWA 4CHQA 3I0SA 5JS2A 3QERA 1RBVA 1RBSA 2YHAA 3SQ4A 3CFOA 1VSKA 3LWLA 1RBRA 3NGYA 4DFJA 4FJKA 3NH0A 1Q9XA 1TKXA 1Q9YA 1RTIA 2Z1HA 3LPTA 4MQ3A 4FLWA 1DTQA 1QS4A 1KVBA 4CEEA 3C6TA 1QSLA 1S5JA 1NK4A 4DQQA 3VQ8A 3MXMA 4KPYA 4F2RA 1NOZA 3LAMA 1T7PA 3OJSA 1IKXA 1BQMA 3LALA 4E7LA 4BDZA 3NDKA 4EP5A 3DLHA 1QSYA 2XY5A 2Z1IA 3FFIA 1HYZA 2B4JA 3VQ4A 3LWMA 3L2RA 1KRPA 1JLGA 1J53A 4DU4A 3ZT3A 3DOLA 3OYMA 3DYAA 3AVCA 3HM9A 4BE2A 4DWIA 3VQAA 1KCFA 2ZE2A 3HL8A 3TARA 1S1TA 1NJXA 2YNFA 3L2UA 1Y97A 1ASWA 3OS2A 3HPOA 3KK1A 3HYFA 1GOBA 1RDAA 1WSGA 2YNIA 3NHGA 4DTJA 2HHTA 1WN7A 3U6FA 2Z1JA 4BE1A 4ELUA 2ATQA 1A5VA 3O3FA 1L3TA 1TAQA 1S1VA 1G15A 3NF8A 4IG0A 3OS0A 3SUOA 4KI4A 2HHXA 4J2AA 4NCAA 4NYFA 4CF0A 3THVA 4O44A 2VWKA 2F8TA 4FLTA 2GUIA 4M42A 1TKZA 1QTMA 4HUGA 4FK4A 2OPQA 3OYGA 3O4NA 5C24A 4FM0A 4IDKA 4Q5VA 4E7HA 3S3MA 2AJQA 1C0MA 2YV0X 4CEQA 1HYVA 2Z1GA 2E4LA 4HUEA 4M3ZA 3AV9A 4CFAA 3LP3A 4M41A 1U04A 3OYHA 1T03A 4KHUA 2YNGA 4DSFA 4AHRA 4J2BA 4KV8A 4E7KA 1UWBA 4M3RA 4PQUA 4DSKA 5E41A 4DSLA 3F73A 5J2NA 4EP4A 4W5RA 1BI4A 1VSEA 2OPPA 4RW4A 4I9LA 3LZIA 4DQRA 4DF8A 1NK8A 4CEOA 2G8HA 4CEAA 1LW0A 3VQ5A 3ZSRA 3H08A 1SL2A 1LW2A 3OYAA 3OYFA 3ASMA 1JLCA 1IKVA 1VSFA 4CJQA 3SQ0A 4DTPA 4FJ8A 1FKOA 3T1AA 2LSNA 4J2DA 2HNDA 4CJPA 4PA1A 4OPJA 4YFUA 4FLXA 3RR7A 4CE9A 1TV6A 3S3NA 3LANA 3OVNA 1WAJA 3QESA 1XI1A 1U48A 4DLGA 4FYDA 5KI6A 2PYJA 4HCCA 3AA5X 1TGOA 2P1JA 3AVMA 1JLBA 4RG8A 5KRSA 4ZTJA 1RBTA 1T05A 1NK0A 1UAXA 2GV9A 4FVMA 1UA1A 1JXBA 2Y1IA 5K14A 2HNZA 2DFFA 3ZSYA 3CQ8A 3SZ2A 3AA3A 4Y1DA 1EETA 2X78A 4FCYA 1S1XA 2XHBA 2GBZA 3RTVA 1BL3A 1S6QA 1GOCA 4HVJA 5D3GA 4FJ7A 1J54A 1JL2A 1S1WA 4RW6A 5CY4A 4R5PA 4FM1A 4CHNA 4AILC 4XIUA 1C6VA 5J1EA 5J2MA 1KTQA 2PYLA 2IC3A 2RF2A 3ULDA 1SKRA 1A5WA 4FZYA 3MEDA 3QEIA 4O5BA 1ZYQA 4JLHA 1NK5A 3KKSA 1HMVA 2DFHA 4I2PA 1VRUA 1WSJA 1FK9A 1L3SA 1BCOA 2VG5A 2E6MA 2WOMA 3VQQA 3RWUA 2Q3SA 4CJUA 3AVBA 4FM2A 4DSJA 3EZ5A 3AVIA 3K5LA 3K2PA 4DLEA 2OYQA 3IAYA 4NCBA 4I7FA 4K8XA 4CJSA 1J5OA 3L3UA 2DTUA 3AO3A 1RDDA 3ZSWA 1RTDA 3L2WA 1S1UA 3ISNC 1F21A 4YNQA 4JRQA 3QNOA 2X6NA 4E1MA 4FLUA 3TANA 1XHZA 1BISA 3V1RA 4O0JA 2HVIA 4OKJA 3KKRA 3M8RA 1Z26A 3O3GA 3M8QA 4AHTA 3SUQA 4DSEA 5HRNA 4ID5A 3QNNA 1NK7A 1VSHA 4OGEA 2W42A 3SQ1A 4IKFA 1WSEA 2I5JA 4N41A 4M3YA 2BGGA 2P5GA 1K6YA 3DI6A 3WNHA 3T3FA 4OVLA 3VQDA 4JS5A 4CK3A 3KLHA 1RT3A 3QINA 3TAPA 1B92A 3AVGA 4CGDA 4IFVA 3D45A 2B6AA 3M8PA 3QIOA 5HBMA 4E1NA 4CJRA 4FXDA 4CIEA 1TKDA 4CESA 3QEVA 4B9UA 3AO2A 1VK0A 1NJWA 3CM5A 1NOYA 3WNFA 1KVCA 1HQEA 4C8NA 4N56A 3KK3A 3G0ZA 4JS4A 1U4BA 5FRNA 2OPRA 3VQ9A 1LAWA 3V81A 3OYKA 4E89A 2XY6A 2OA8A 4PY5A 3LZJA 5HP1A 5CYQA 1IKYA 3ZT2A 5KRTA 1S9GA 3ITHA 5HRRA 3VQEA 3K59A 1CLQA 2HNYA 4BWJA 2IAJA 3A2FA 4FK2A 4LH4A 4Q0BA 1JXEA 3UIQA 3HPHA 1LWEA 4BDYA 4F3TA 3TI0A 4B8AB 3B6PA 3HP9A 2HVHA 3VN5A 5SWMA 4CFBA 1HNVA 3AVAA 5FROA 1VSLA 3ZSQA 4CJLA 3CM6A 1RILA 1TL3A 4CFDA 5KGXA 3OYIA 3KLEA 3V9WA 4NYNA 4KHSA 1SV5A 3OYLA 3I0RA 4LY7A 2XRIA 2RPIA 3V9SA 1JLAA 3MECA 3CFRA 4KO0A 1LWCA 2A1SA 1L3VA 3DMJA 3DLBA 2XY7A 4BACA 4FJIA 2RKIA 3KD1E 4M3TA 4FK0A 3K57A 1WSHA 4RW8A 3ZT4A 4FLVA 3DRRA 4CHPA 2KW4A 4JRPA 1JL1A 1IH7A 2D0BA 4O4GA 3OYEA 3PX0A 3SUPA 1I39A 2XO7A 3IRXA 3QEWA 3D0PA 1VSIA 2NUBA 3LAKA 2VG7A 2QKBA 4CGHA 3P5JA 4ELTA 4ICLA 1TKTA 4DQSA 3TAQA 4BE0A 4O55A 4C8MA 4KRFA 3RMDA 4CGGA 1J9AA 2QXFA 4EZ9A 3JYTA 4W5OA 1ZBHA 2O4GA 2IGIA 4KKOA 5C25A 1BCMA 1RT2A 1ZBUA 5EU7A 3HP6A 1SL0A 4F2SA 1JKHA 3KIOA 4CEFA 1I3AA 3RMBA 3F9KA 1VSDA 5CZ2A 1U45A 1RT7A 5HROA 5CZ1A 1X9MA 1N6QA 3BDPA 4CCHA 3LP1A 3KLFA 1QE1A 2HW3A 3AA2A 4RW9A 1D5AA 1UA0A 3ZSZA 3MXIA 4CJ4A 1LAVA 1D9DA 4KTQA 2QK9A 4B3OA 4AHUA 4CEZA 4B8CA 1C0UA 1VRTA 1XC9A 3BGRA 2ETJA 4W5NA 1NJYA 3SPYA 1UOCA 3AO4A 1CZ9A 3JSMA 1B9FA 2FBXA 1MU2A 1RNHA 4AHVA 3TABA 3U3GA 1RBUA 1NKEA 3AA4A 4CHYA 1LV5A 3DLEA 1SUQA 4QCLA 5T7BA 1KFSA 1EXQA 4DTNA 5C42A 3DRPA 4DS4A 3NE6A 1X9WA 3OS1A 4FJ5A 4FJNA 2HHSA 3SV4A 2RN2A 4FW1A 3PO5A 4HCBA 4RW7A 3QIPA 3OYJA 4CF2A 5DMRA 4E7JA 1BGXT 4NCGA 4CJVA 2HHUA 4CJTA 2DY4A 3AVHA 3ZSOA 3V6DA 2G8UA 2QKKA 4FJLA 1IKWA 4CJKA 1R0AA 3S9HA 2YKNA 4C8KA 4KHNA 4CEDA 4ZTFA 4FJXA 3L8BA 3P1GA 3KTQA 2D0CA 3G10A 5CYMA 3V1OA 3EYZA 3OY9A 3T19A 4FLZA 3RMCA 4E0DA 4DTRA 2HHWA 4C8OA 5HRSA 4OKKA 4Z4HA 1NKCA 2JLEA 3PUFA 4CF9A 4DTSA 4KTWA 3VQ7A 4DMNA 1C0TA 4M45A 3K5NA 1QHTA 2IDOA 1GOAA 3L3VA 1RTHA 3CFPA 1EKEA 3ZSVA 4HTUA 3RMAA 2HHQA 4Y1CA 4LD0A 3HVTA 1HJRA 1FKPA 3TAFA 1KLMA 1LWFA 2G8VA 3TWHA 3TR8A 4BDPA 4I9QA 2IS3A 4KB0A 3AVLA
chains in the Genus database with same CATH superfamily
4CIFA 3M1FA 1V4SA 4BWMA 2KZZA 4Z4IA 4BREA 2KHOA 1D9FA 4FJMA 1WSIA 3WXKA 2G8FA 3V1QA 3SQ2A 4DV1K 2OZSA 4IJAA 4KBOA 2OTJN 1RTJA 4FW2A 5FPMA 4K8ZA 3HSCA 3NGZA 2XY8A 1HKGA 4M63C 3VQBA 5DM6L 2GELA 4DFPA 4FJGA 2V52B 1ASVA 4OJRA 5CHIA 4PKGA 4JI1K 2W41A 2F96A 3AAQA 1NGJA 1NGHA 5E84A 3G6EN 4H4MA 2ASMA 4BRNA 3FZHA 2G8IA 3P31A 2NRVA 3VPZA 4DSIA 1FXXA 3L2QA 3R9PA 5BN8A 4DR5K 4IFYA 4BQZA 2YHXA 3IG1A 1WSFA 1C1CA 1U47A 1W97L 4YDUC 1ZC6A 1C1BA 1KFDA 1Z25A 4AHSA 4LF4K 5BPNA 4G1QA 1BDGA 4GMJB 1BWFO 5M1OA 1P8ZA 4CEBA 3DLRA 4CF8A 3CG7A 2EWSA 3QLHA 4LH5A 4H5TA 3IS9A 4OPKA 3J7YP 3NGIA 4WQ5A 3EEQA 4Z94A 5AQHA 4KI6A 1JJ2M 3H46O 5KQDA 4YY3K 1W7AA 1BA1A 3C95A 4WE1A 3QETA 5I3UA 4OLBA 2P9NA 1S6PA 1SKWA 4DKWA 1IO2A 4K43A 4PWDA 3OW2M 4BRAA 2G8WA 3O4WA 2KFZA 2A5XA 3JAMO 4KREA 1C1AA 4BR9A 4MLHA 1U49A 4E3SA 4O0IA 3CJBA 1XUPO 3HZ6A 1ITGA 1EP4A 4GVMA 4DV2K 2UUCK 2IOCA 1X9SA 3TAEA 4WCEL 2PY5A 4FPAA 5J2PA 3PV8A 4AH9A 4H8KA 4A61A 4BROA 1OH5A 4CIGA 4BRDA 3SAFA 3AVNA 3ZETB 1VQPN 3OYBA 4A59A 3I33A 5TKWA 3E1YA 2VG6A 2RHKA 3LM2A 3MN5A 4IOCL 4DR6K 1S9EA 2HF3A 3G71N 3LPUA 3MWPA 2YJEA 3DM2A 3VEOA 3VQPA 4CGIA 3E9OA 4IG3A 1EX4A 1YT3A 3ZT1A 4YHHK 3DLKA 3VEYA 4XH4A 3RR8A 4B9VA 4I2QA 1NJZA 2D0PA 5F1XA 4EZ6A 3N4PA 4IOXA 2WONA 2E1YA 1X1PA 3C0BA 2HSTA 2P9KA 3NBPA 4DFKA 1OH8A 3IFRA 4CZMA 1VSKA 3FZKA 4YOYA 4FWQA 3LPTA 2NRHA 3FLCO 5C10A 4BRGA 5AQTA 1NK4A 4F2RA 3CCSN 1T7PA 3J7AP 3SLCA 4E7LA 4EP5A 3CCVN 4BGAA 2F4VK 2OCEA 3VQ4A 4GNIA 1JLGA 3ZX2A 2P9UB 3DYAA 2JWKA 3HL8A 2YNFA 3L2UA 1FW6A 2VQEK 3HPOA 3K0SA 3KK1A 1IJJA 1YVNA 3U6FA 3KHYA 1TAQA 4ILHA 3SUOA 5IT9O 4KI4A 1ILYA 3VGKA 2GUIA 1TKZA 5LJWA 5C24A 3S3MA 2YV0X 2YHYA 4DV6K 2E4LA 5AQUA 4HUEA 3LP3A 4M41A 1T03A 3CCLN 4DSFA 4KV8A 4DR1K 4DQ8A 5E41A 3F73A 1BI4A 3LZIA 4DF8A 2VWBA 4B1XB 1WBBA 2G8HA 2GX9A 1LW2A 3NMUA 2A6AA 1NM1A 3OYFA 3ASMA 1VSFA 1FKOA 4NLCA 4CJPA 4ISFA 4FLXA 4FO0A 1OKJA 1TV6A 3LANA 4DLGA 4RG8A 1H1VA 3D7EO 1RBTA 4H5NA 5AQOA 5AJ3K 1T05A 1Q82O 4LF6K 1UA1A 1E4GT 2E20A 3ZSYA 4RCHA 3OBWA 2YX6A 3MCPA 1GOCA 4HVJA 5D3GA 4JK7A 3FZFA 4FJ7A 4R5PA 2QWNA 4CHNA 3D2FB 1SKRA 3QEIA 1ZYQA 4B3RK 1HMVA 5KQ8A 2DFHA 3CPWM 3H3NO 2YJFA 3FFKB 1U6ZA 3VQQA 4CJUA 4FM2A 4XH1A 4DLEA 3IAYA 2J4RA 4ILJA 4DV4K 5BREA 3ZSWA 3ISNC 3QNOA 1XHZA 4C23A 1BISA 4H0PA 4O0JA 3M8RA 3KKRA 2ZWHA 4K41A 3SUQA 4DV0K 3LDPA 1NK7A 4OGEA 4H5VA 5KPRA 1WSEA 3SAGA 4IKFA 4N41A 3DI6A 3ZYYX 1VQ5N 3VQDA 4CK3A 4H5WA 1RT3A 3QINA 3TAPA 4QS9A 4IFVA 4FXDA 3QIOA 3VEVA 2HBJA 3AO2A 5GAEP 3DLLL 1E3MA 3WNFA 4C8NA 3MMVA 4IXCA 3VQ9A 3V81A 1IKYA 5KRTA 3ITHA 5HRRA 1JCEA 2AP1A 3UIQA 4JD2B 4YOTA 3B6PA 2HVHA 5SWMA 4CFBA 3V6DA 5KGXA 1VSLA 4CFDA 3KLEA 4KHSA 3CCMN 1SV5A 1GLLO 3OYLA 3V9SA 2GTDA 3MECA 4KO0A 3ZEUA 4M7YA 3PLAA 3DMJA 4FJIA 4BACA 4M3TA 4FK0A 3K57A 4RW8A 3DRRA 4IEEA 2UU9K 1SS6A 3EE8A 3PX0A 1I39A 3QEWA 1IBMK 1VSIA 2NUBA 3LAKA 2VG7A 3BZCA 4IDHA 4CGHA 5AFUH 5CR4A 4ELTA 4BE0A 4WQ4C 2ZF5O 3FGUA 2QA4N 3RMDA 4EZ9A 3KWGA 3JYTA 1ZBHA 2YCHA 4IO9L 4U7BA 4Y0WA 1SL0A 5CZ2A 1RT7A 1X9MA 2E88A 2NRXA 3LP1A 1IG8A 4JKHA 3AA2A 3ZSZA 3MXIA 2QK9A 4BVPA 2UXBK 4BY9C 1NJYA 3O1BA 1CZ9A 4BC2A 2HF4A 4KH4A 4AHVA 3PIOL 3TABA 3E66A 4WF9L 3LDOA 4DS4A 3NE6A 1X9WA 2HHSA 3QB0A 3PO5A 3QBWA 2FSNA 4NCGA 2W40A 4BG8A 5I9EB 4CJVA 4GVEA 2HHUA 2DY4A 3ZSOA 3ULEB 2G8UA 4FJLA 2YKNA 3CC4N 4C8KA 4ZTFA 3L8BA 3J80O 3G10A 5CYMA 3EYZA 1BU6O 4FWRA 3WEEA 4C8OA 1NKCA 2JLEA 3PUFA 1N33K 5C15A 4KTWA 3VQ7A 3K5NA 4M45A 1TUUA 3L3VA 3RMAA 5AQJA 5C2FA 1GLBG 1LWFA 3L6QA 4BDPA 2D1KA 2V51B 3V9ZA 2RE2A 3HVRA 4HUFA 4BR4A 3HK2A 3E9LA 3O9SA 2YKMA 3GL1A 2PAVA 1Q86O 2EX3A 5AQWA 1ZBIA 3CC2N 4CJ5A 4CZKA 4FWNA 4KH6A 3UKRB 4I6MB 4JI2K 3B6OA 3PSFA 3W0LA 3F9MA 2HBLA 4B9NA 4FJ9A 1GLAG 1C0FA 5KPTA 1HNIA 4DS5A 3H1QA 3HPGA 3OBYA 4KFBA 2PZSA 4J2EA 2FBVA 1N5YA 4A2BA 1RCHA 3DLGA 2CGJA 3O1WA 1YXQA 1SQKA 3O9TA 4B1VA 2YNHA 1BIUA 1NWKA 4CW7B 4W5QA 3AVJA 5AQNA 5AQYA 4PL7A 2D5RA 1KXPA 2OZMA 3L0QA 4OGCA 4LF9K 4DTUA 3VQCA 4F4KA 3GE1A 1D8YA 1KAZA 1QSSA 4B08A 3CD6N 1RT1A 4B1YB 2KZMA 3MN6A 4PKHA 1KLNA 4DTMA 3ZCMA 3KLGA 5J2QA 4B1UB 2E2OA 3J8AA 4K0KK 2UYTA 4NLBA 3M6GA 2D4WA 3D6RA 3MEGA 3MAQA 3NF6A 1ZBFA 1HYSA 3O3HA 4F3OA 3M3ZA 1ASUA 2ITGA 5C12A 1TL1A 3BF3A 3MXJA 2HOEA 3CQXA 4DQPA 4H0XB 3QEXA 4LFBK 4JKGB 2R7YA 3HM8A 1SKSA 2HB5A 3NFAA 4B3TK 2VWJA 1L5UA 1XNQK 4A2AA 4QOZB 3HTVA 2UXCK 1Q7YO 1SL1A 4B9TA 5KTQA 3QDKA 3OA9A 3VERA 3NF9A 1HPZA 1DTTA 1XQSC 2QTDA 3AAPA 3UE5A 1NK6A 2O4IA 5EOYA 5LMNK 1HLUA 1ZBLA 3NCIA 3OYNA 2FC0A 5AQVA 3AY9A 1VAZA 4W5TA 3PX6A 1WLJA 4DR4K 1VSJA 4Z4GA 2O8BA 4KTZA 4FVUA 1W0HA 5HLFA 1KD1O 1TK0A 3SCXA 1YJWN 4BRLA 3CJAA 2KLAA 3D2EB 3MEEA 3F2KA 4OPAA 4X64K 1QZ6A 1HRHA 3QEPA 3TAMA 1KSPA 5AQLA 5EX5A 3RSEA 4G9ZA 2ZJPL 3PO4A 3VA0A 3EKUA 3WNEA 5HRPA 1B9DA 3CHWA 1ZXOA 4JKCA 5TKYA 2E2QA 5M1KA 1VQKN 5BRDA 5GIPA 3WNGA 2QM1A 4OPHA 4CZEA 2E1ZA 1RBRA 3NGYA 3P38A 1Q9XA 2Z1HA 1WB9A 1DTQA 1QS4A 1HPMA 5MLCQ 4CEEA 1DEJA 3VQ8A 4KPYA 2VGNA 5ADXA 4MLEA 4MDAA 3J7ZO 1BQMA 1TYQA 3NDKA 4BDZA 2XY5A 2B4JA 2HBMA 5AQSA 4ILGB 1J53A 1RGIA 3AVCA 4BE2A 4WFNL 3TTCA 1KCFA 1FJGK 5CE3A 2I7NA 4BR7A 3HYFA 1YIJN 2Z1JA 4BE1A 2ATQA 3OS0A 4IG0A 2HHXA 3G4SN 4J2AA 3ID8A 4NCAA 3EE9A 3KWIA 4O44A 1QTMA 2OPQA 3OYGA 4BR5A 4DUYK 4X65K 3PSIA 3VTIA 1U04A 4KHUA 4M3RA 3CF5L 3CERA 4EP4A 1JCFA 4W5RA 3THXB 3VF4A 3S41A 1NK8A 4EHTA 1VQLN 4FWPA 4JI7K 3VQ5A 3ZSRA 1HNZK 3H08A 4CBXA 4DTPA 1Q81O 2LSNA 3TTDA 2HNDA 1MA9B 2KKZA 4PA1A 4YFUA 4J2DA 4GV9A 1U48A 3OVNA 1WAJA 3QESA 4CD1A 2PYJA 1Y64A 3ZLJA 4HCCA 3AVMA 5KRSA 3J81O 4BC3A 1JXBA 2CGKA 2DFFA 2GEMA 3CQ8A 4DHYA 1EETA 3C7NA 3GOIA 4JKAA 4B1WB 2O8FA 4BRKA 3H1VX 1S1WA 4RW6A 4FM1A 4LFCK 5A2QO 5J2MA 3BZKA 2ZM6K 3ULDA 4FZYA 3MEDA 1X3NA 3KKSA 2A41A 4FWSA 1VRUA 4I2PA 1FK9A 4YORA 1BCOA 1LOTB 2VG5A 4H0YB 4JKFA 3AVBA 4DSJA 3EZ5A 2O8EA 2P9LB 3EN9A 4LC9B 1K73O 2V7YA 4GV3A 2DTUA 1RTDA 1RDUA 2HW3A 5LJVA 4FOEA 4OKJA 5AFUA 3T1HK 1X9JA 3SMPA 4AHTA 5HRNA 3QNNA 3C7NB 1VSHA 3DXMB 3Q7BA 1NLVA 3AVGA 2QWOA 3ATVA 1VQ4N 5ADXH 2B6AA 3M8PA 2O8DB 3VMFB 4CIEA 3QEVA 4B9UA 2QW9A 1S72N 1C0GA 3IKMA 1NJWA 1NOYA 3HOTA 4JS4A 4N56A 5GADP 2OPRA 2OA8A 2WUSA 3OYKA 3DJCA 4KHPK 4LF5K 5CYQA 3K59A 2O8EB 3VQEA 4BWJA 2IAJA 4BDYA 1JCGA 3HP9A 3UB5A 4WQ5C 3AVAA 5FROA 4CJLA 5AQZA 3OYIA 2XY6A 1RILA 1TL3A 1YUWA 4NYNA 2XRIA 2RPIA 3CFRA 1LWCA 2A1SA 5GINA 3HI0A 5AZJB 4FSVA 1WSHA 3A5NC 3THXA 1YHQN 1VQNN 5KPZA 1HKBA 1IH7A 2D0BA 3SUPA 2XO7A 1EO1A 3MK6A 2QKBA 2CH5A 3P5JA 3R3LA 4YOWA 3TAQA 4DQSA 3IUCA 1NU0A 2NNWA 4FWOA 2QXFA 2O4GA 5C25A 4BRMA 1BCMA 1M1KO 4K42A 5EU7A 4JI6K 4CEFA 1I3AA 3MN7A 3RMBA 1N6QA 3QMLA 4H0VB 4IO8A 1K8AO 1WOQA 1D5AA 3LDQA 5ELZA 3T69A 4CEZA 4W5NA 4EHUA 2ETJA 4R79A 2A42A 3L4QA 3ENHA 5JLHA 1G99A 5M1PA 1QVGM 3AA4A 4CHYA 1LV5A 3H45C 1NGBA 3DLEA 1SUQA 4EIAA 4FJ5A 1OVYA 1QQNA 3OS1A 3SV4A 4JKGA 4AQYK 2Q0RA 5EY4A 3SMSA 2UUAK 1QQOA 3QIPA 2NRWA 3MN9A 1IBLK 3QICA 1HR0K 3AVHA 2QKKA 5LMUK 3I56N 1R0AA 1NGFA 1NGDA 4CEDA 4BGBA 2D0CA 3V1OA 4JD2A 3CI5A 4EFHA 4E0DA 5DM7L 3T7ZA 3O6WA 4MDBA 4CF9A 3DXMA 2IDOA 4DR7K 1EKEA 3HVTA 3TAFA 2G8VA 4JKDA 3TR8A 4I9QA 3O9RA 4L3QA 2O8CB 3AVLA 4B9SA 2B5JA 3KK2A 1EWQA 2BDPA 2NZTA 3ALYA 1VQMN 4E19A 4CFCA 3D2EA 3NAEA 3LP0A 2BTFA 3VTHA 5FDLA 3EKSA 4F8RA 3CCUN 4DG1A 3MCAB 2QXLA 3A5OC 2Q31A 4NB4A 4CHZA 4CZGA 4NXMK 4CJWA 2X6SA 2A1RA 2NRRA 2F9WA 4JKBA 1DKGD 2P9SB 3KLIA 2X74A 3ZETA 1WNSA 4DV5K 2YHBA 3EY1A 1RDBA 1CZBA 4N5SA 3HSTB 3PY8A 2P5OA 3OJUA 3E01A 3VA3A 2AA4A 5I42A 1I94K 4C1NI 5BPLA 3O4QA 4KHYA 3KJVA 3K58A 4JK9A 1JLQA 4AM6A 4E7IA 4TSXA 2D0AA 4A5AA 4Z4EA 4I6MA 1TK5A 1BA0A 1IBKK 4CF1A 4CECA 4CD3A 1JLEA 3CMEN 4Z4CA 4AF1A 2P9KB 5FPDA 4MFBA 4DV7K 1VQON 1TK8A 4B9MA 4JHDA 4ID1A 2A40A 2W6KA 4L8RB 4OLAA 3EZWA 4DB3A 1T6DA 2JGUA 4X66K 3CCQN 3QFPA 1NGGA 3ZX0A 4UQGA 4KB1A 4ELVA 3RRHA 4PUOA 2QI2A 1CXQA 3C6UA 4K25A 3HOSA 3SAHA 1CZAN 3TU5A 2BANA 3VGMA 3SI6A 1KQSM 4C8LA 3KD5E 5JS1A 2P51A 5DK5A 5AQXA 3CYMA 2Y1JA 1RT6A 2P9PB 3ZT0A 1EQYA 4QAGA 1CXUA 1BQNA 3TTFA 3A5MC 4FL9A 4DCHA 4FJJA 3NF7A 1NNEA 3QO9A 3SV3A 1DLOA 4CJFA 1NKBA 5LL6Z 1TAUA 5JMVA 3DWLA 3UKUA 4PHTX 5SZTA 5KGWA 2OPSA 1IG9A 3HJFA 3AVFA 4CJ3A 4EAHD 4FJHA 2Q1NA 4DU1A 4AHCA 3VEZA 1U2VA 3FR0A 1P90A 2KQ2A 1QHAA 4CGFA 1T3VA 4IFEA 3CCJN 4DTOA 1KC8O 2P9IA 4HTLA 1YTAA 2BE2A 4ZHRA 1RT4A 1BI4B 3SUNA 2O8FB 3EO3A 1O13A 3DRSA 3OYDA 4IBNA 1ATRA 3LDSA 3THWB 1XWLA 3CETA 4DF4A 3LP2A 4B3MK 1XHXA 5LY3A 2P9SA 2CGLA 1BHLA 4BRPA 3M8SA 2ZQBA 3AO1A 4FWLA 3NH1A 4KHWA 4A57A 4CHQA 4JNEA 2QEXN 1RBVA 1RBSA 2YHAA 1S3XA 4C1NK 3K9JA 1U2VB 4DFJA 1TKXA 4NO7A 1Q9YA 5BN9A 1N36K 4MQ3A 3MX5A 3VGLA 3C6TA 1QSLA 3MXMA 1NOZA 3OJSA 1IKXA 3T1YK 3LALA 4CJ7A 2E5LK 3DLHA 2Z1IA 4IEIA 4XH5A 1HYZA 3LWMA 3L2RA 2QWLA 1KRPA 4JEPA 4DU4A 3DOLA 5B8HA 3HM9A 3VQAA 1ASWA 3OS2A 3U9ZA 3CPEA 1RDAA 1WSGA 3NHGA 2HHTA 4ELUA 2VQFK 1A5VA 3O5BA 3O3FA 1L3TA 1G15A 4CF0A 1YJ9N 2F8TA 4FLTA 4CVNE 4HUGA 2V7ZA 4FM0A 4IDKA 4E7HA 4OO1J 5AQPA 4CEQA 1HYVA 4M3ZA 3AV9A 3U4LA 1KAXA 3C65A 4M7XA 3OYHA 5AZJA 3C6AA 4J2BA 4PQUA 1UWBA 4DSKA 2HHHK 1BO5O 5FPNA 4CEAA 1LW0A 3FZLA 3LM9A 1JLCA 1IKVA 1QQMA 4CJQA 3RR7A 3WEEB 3S3NA 1XI1A 2H3GX 5KI6A 1NGIA 1QZ5A 2Q36A 2YI1A 2GV9A 4FVMA 5K14A 2HNZA 3AA3A 1ATSA 4Y1DA 1E4FT 2X78A 4LFAK 5BR9A 2XHBA 3R6MA 3SBGA 1JL2A 5CY4A 1NBWA 3QBXA 4AILC 4XIUA 3GG4A 5J1EA 3ATUA 2ASOA 3LDLA 5EVZA 1A5WA 1YAGA 4O5BA 3BF1A 2CH6A 1L3SA 1GLJO 3VETA 4ISEA 2Q3SA 4CI6A 2ITMA 3AVIA 3K2PA 1HJOA 4CJSA 1J5OA 3L3UA 1RDDA 1Z6RA 3L2WA 1F21A 2X6NA 3U9DA 3V1RA 1Z26A 3O3GA 1W2BM 3PIPL 3M8QA 4B3SK 4ID5A 1EWRA 3KK7A 2I5JA 4M3YA 2BGGA 3WQTA 3I8BA 2P5GA 1K6YA 3T3FA 3I55N 4JS5A 1HNXK 1B92A 1VHXA 3O9UA 3D45A 5HBMA 4E1NA 4CJRA 2VYPA 1TKDA 4CESA 3O08A 1VK0A 4KH5A 2QWMA 3KK3A 1U4BA 3G0ZA 5FRNA 4E89A 2VGMA 3VF6A 3DXKB 5HP1A 3L4IA 1ZBSA 2P9LA 4LH4A 4Q0BA 1JXEA 3HPHA 1LWEA 4F3TA 4RTFD 1HNVA 2IIRA 3SYZA 3CXCM 3V9WA 5AZIA 2QWRA 1JLAA 1L3VA 3DLBA 2XY7A 2RKIA 1XMOK 3ZT4A 4JI5K 2QWPA 4CHPA 4BQLA 4JRPA 3EL2A 2UUBK 4O4GA 3IRXA 3D0PA 1NGEA 1TYQB 1NMNA 4O55A 4C8MA 3THYA 4CGGA 1J9AA 3VF2A 4W5OA 2IGIA 4BG9A 1VQ9N 4MO5A 4F2SA 1DGKN 3KIOA 4YOVA 1VSDA 1MWKA 1U45A 5HROA 4CCHA 5CZ1A 1QE1A 1J6ZA 3TSUA 1HUXA 4RW9A 1NJIO 4CBUA 3LDNA 4CJ4A 1LAVA 1D9DA 4AHUA 4B8CA 1C0UA 1YI2N 3SPYA 1UOCA 4GKJK 3JSMA 1B9FA 2FBXA 2E2PA 1RNHA 2YHWA 5F0XA 1RBUA 1NKEA 1ESVA 3WXLA 4JI0K 2HBKA 4FOIA 1EXQA 5C42A 3K9KA 2RN2A 4F9OA 1YJNN 4RW7A 3TSPA 3OYJA 4MO4A 5DMRA 4CZHA 1WBDA 1N32K 5HL7L 1WUAA 2IVOA 4J8FA 1OVQA 1XC3A 1IKWA 2E2NA 4CZIA 2E8AA 3S9HA 4FJXA 3KTQA 3P1GA 3GDQA 5JLFA 2GUPA 3OY9A 4FLZA 5HRSA 4OKKA 4JKEA 1GOAA 1RTHA 3CFPA 2HHQA 4LD0A 1FKPA 1HJRA 1OH7A 1KLMA 3TWHA 3ZEUB 2IS3A 3U3YA 4CERA 5JICA 3WXIA 2GWKA 3CIPA 4X62K 1REVA 1T44A 3CJ7A 2WC9A 3VESA 3VEXA 5FPEA 2HMPA 5FRMA 3V9UA 5C0YA 3KZBA 4CZLA 1T8EA 3B8AX 2ZD1A 4HHTA 4JV5K 3KVGA 2KFNA 1SZ2A 1RFQA 4BVOA 3OHRA 3K5OA 4U67L 1YITN 3F5TA 4M3XA 2E6LA 1K8KA 2O8BB 3WUHA 5C2DA 1T6CA 3MDQA 3HBTA 3V9XA 1NK9A 4CJEA 4KHQA 4B9LA 1W9HA 4N76A 1J5EK 3VENA 4H03B 3NH2A 1NMDA 1Q8IA 2F8SA 2HHVA 3HO1A 3AVKA 4LF7K 4FZZA 2P9NB 4QS7A 1L3UA 2BUPA 2A3ZA 4H4OA 3SJJA 2UXDK 1IV0A 4DTXA 5GAHP 4LSLA 5GIOA 1WAFA 4YOUA 3R8EA 2FBTA 2ZGYA 4B1ZA 2DFEA 3ULEA 4IZ9A 3DOKA 4WQ4A 4LSNA 2ZJRL 5JVHL 2PFUA 1BIZA 3V4IA 3AO5A 3SJHA 3OYCA 3O8MA 4KAZA 3ID6A 1M90O 1MWMA 2EHGA 4O8UA 1O1WA 3TAGA 4BRCA 3L2VA 2FBYA 1V4TA 3ENBA 1KVAA 5AQGA 5HOOA 2P9UA 1QVFM 3C94A 4BRHA 2HMIA 3PX4A 4DFMA 1RDCA 4DUZK 3HRGA 4GW6A 3CJCA 4XEIA 4DQIA 1JLFA 1GLDG 2F9TA 1D4XA 3WXMB 1RT5A 3P39A 3AARA 4FLYA 3ZSXA 2W6LA 3WT0A 4Z0UA 2Q0UA 3IDHA 4FWMA 4CK1A 1YF5L 2G8KA 3S3OA 1QQCA 1N34K 2Q2RA 4JN4A 1TVRA 2GWJA 3RRGA 5BPMA 4GY2B 4N47A 3SPZA 1A5XA 4M3UA 3HXMA 3K5MA 1YTUA 4CHOA 4CGJA 3VOVA 3SNNA 4WFBL 4H5RA 4LF8K 4CK2A 4GV6A 4DU3A 3JS6A 3CQYA 1VSMA 3I8DA 3HT3A 1YVUA 5AQKA 1HQUA 4Z4FA 2IVPA 3U8XA 3W3DA 3VQ6A 4OKEA 4JI8K 1K9MO 4E1JA 3P83D 1SAZA 3JXUA 2KTQA 4FZXC 3I0SA 5JS2A 3QERA 3SQ4A 3CFOA 3LWLA 4O8KA 4FJKA 3NH0A 2QWQA 1RTIA 2P9IB 4FLWA 5FLXO 2OTLN 1HX1A 1KVBA 1S5JA 4DQQA 3LAMA 3VEWA 2FLOA 2O8CA 1QSYA 3FFIA 3NVMA 5AQIA 3ZT3A 3OYMA 4DWIA 4FWKA 2ZE2A 3C6HA 3TARA 4JI3K 1S1TA 1NJXA 4A62A 1Y97A 4CZJA 2FF3B 1GOBA 2YNIA 4BRQA 4DTJA 3N4QA 1WN7A 3WXJA 5GAGP 2I7PA 4YDUA 2WFBA 1S1VA 3NF8A 1GLFO 4NYFA 3THVA 2VWKA 4M42A 3E9PA 4CZFA 4FK4A 3O4NA 3UKUB 3M5RA 4Q5VA 5AZIB 1N8RO 2AJQA 5AQMA 1C0MA 3IMXA 4WYBA 1X3MA 4IWVA 3RVCA 2Z1GA 4BRIA 4CFAA 3BY5A 2YNGA 4AM7A 4AHRA 4HWIA 4E7KA 4DSLA 5J2NA 3R1XA 3SK3A 1VSEA 2OPPA 4RW4A 4I9LA 4DQRA 1NGCA 1GLCG 4GKKK 4CEOA 2F7TA 1MDUB 1SL2A 3NVKA 3OYAA 3SQ0A 4FJ8A 4BC4A 3T1AA 3THYB 1NG9A 4OPJA 4CE9A 4BRFA 1LCUA 4JAXA 4FYDA 3AA5X 4RWTA 1TGOA 2P1JA 1JLBA 4ZTJA 5BR8K 1NK0A 1UAXA 4BC5A 2Y1IA 3SZ2A 2FSKA 1BUPA 3DAWA 4FCYA 1S1XA 2GBZA 3RTVA 1BL3A 1S6QA 1J54A 4ISGA 1C6VA 1KTQA 1RDWX 3ENOA 2IC3A 3QFUA 2RF2A 3CJ9A 2PYLA 3O80A 2VCPA 4JLHA 2JWLA 1NK5A 3CCRN 1WSJA 2P9PA 2E6MA 2WOMA 3RWUA 5M1NA 4NCBA 3K5LA 2OYQA 1Q18A 1BG3A 4I7FA 4K8XA 3AO3A 1S1UA 3A8YA 2IVNA 4YNQA 4JRQA 2NRTA 3TANA 4E1MA 4FLUA 2HVIA 2ASPA 1R59O 4JYAK 4DSEA 2PBDA 1GLEG 3CMAN 2W42A 3SQ1A 2ZJQL 4OX9K 3WNHA 4DR3K 4OVLA 1DT9A 5AR0A 4UY8O 3KLHA 3AGRA 4CGDA 1TUYA 3BP8A 2D0OA 3CM5A 4PKIA 5AQRA 1KVCA 1HQEA 1XNRK 2BH1A 1LAWA 4PY5A 4IJNA 3LZJA 3BUZB 3ZT2A 4PL8A 1S9GA 1VQ6N 1CLQA 4IOAL 2FF6A 2HNYA 3THWA 3A2FA 4FK2A 3H3OB 5F2RA 5AQQA 5EXWA 2WBNA 3LL3A 3MX2A 3TI0A 4B8AB 3G25A 2OANA 3O9QA 3VN5A 3BEXA 1VQ8N 4QCLA 3ZSQA 3CM6A 2Q97A 1NGAA 5AQFA 3I0RA 4LY7A 2FSJA 3CCEN 4FPBA 1K8KB 3KD1E 3FE1A 5M1QA 5BRFA 1HNWK 4FLVA 3SBTA 2DPNA 2KW4A 3AGKA 3P4IA 1JL1A 1OH6A 3OYEA 3UKRA 2NLXA 4BR2A 3H6EA 4ICLA 1TKTA 3Q7CA 3A0IX 5IWAK 4DV3K 4KRFA 4KKOA 1RT2A 1ZBUA 3HP6A 4FJNA 1JKHA 4WFAL 3F9KA 2WTUA 4M3WA 3BDPA 3KLFA 1UA0A 1XMQK 3ZX3A 4KTQA 4B3OA 1VRTA 5E26A 3BGRA 1XC9A 3TSQA 5H1SQ 4B9QA 3AO4A 4BR0A 1MU2A 1Z05A 1S22A 3WQUA 1KAYA 3OTOK 4NXNK 3U3GA 1VQ7N 4QS8A 4H0OA 3D2FA 1BOTO 2ZGZA 5T7BA 4DTNA 1KFSA 3DRPA 5BRHA 2FXUA 4FW1A 4DR2K 3RSEB 3CC7N 5JVGL 4HCBA 4CF2A 4E7JA 1BGXT 3MWTA 4A5BA 2O8DA 4H0TB 4CJTA 4JHDB 4CJKA 3DXKA 4KHNA 4V19S 3FZMA 4JK8A 1HKCA 3T19A 3RMCA 4YOXA 4CBWA 4DTRA 2HHWA 3TPQA 3GBTA 4Z4HA 5M1FA 4DTSA 2NRZA 4DMNA 1C0TA 4O5FA 1QHTA 4HTUA 3ZSVA 4Y1CA 3A5LC 3CJ1A 4KB0A 4JI4K 1ATNA
chains in the Genus database with same CATH topology
4B9SA 2B5JA 4CIFA 3V9ZA 4CERA 3U3YA 3KK2A 3HVRA 2BDPA 4HUFA 3ALYA 3HK2A 4E19A 4BWMA 1REVA 2YKMA 4CFCA 2KZZA 3NAEA 3LP0A 4Z4IA 2EX3A 1ZBIA 4CJ5A 1D9FA 4FJMA 5FDLA 1WSIA 2G8FA 5FRMA 3V1QA 3V9UA 3SQ2A 4F8RA 2OZSA 4DG1A 3B6OA 1RTJA 4FW2A 1T8EA 2ZD1A 4HHTA 4K8ZA 2KFNA 4CHZA 3NGZA 4B9NA 2XY8A 3K5OA 4FJ9A 4CJWA 3VQBA 2X6SA 2A1RA 1HNIA 4DFPA 4FJGA 4DS5A 4M3XA 2E6LA 3HPGA 1ASVA 3KLIA 4OJRA 4KFBA 2PZSA 4J2EA 2F96A 2X74A 1WNSA 2FBVA 2YHBA 4H4MA 1N5YA 3EY1A 1RDBA 1RCHA 3V9XA 3DLGA 1NK9A 4CJEA 2G8IA 1CZBA 4KHQA 4B9LA 4N5SA 3HSTB 3PY8A 2P5OA 1W9HA 3OJUA 3E01A 3VA3A 4N76A 2YNHA 1BIUA 5I42A 4DSIA 4W5QA 1FXXA 3O4QA 3NH2A 1Q8IA 4KHYA 3KJVA 3L2QA 3K58A 3AVJA 2F8SA 2D5RA 1JLQA 4IFYA 3HO1A 2OZMA 2HHVA 3AVKA 4OGCA 4E7IA 4TSXA 4FZZA 4DTUA 2D0AA 3VQCA 4F4KA 1D8YA 1L3UA 4Z4EA 3IG1A 4M3WA 1WSFA 1C1CA 1TK5A 4B08A 4H4OA 3SJJA 1RT1A 1QSSA 4CF1A 4CECA 1U47A 4DTXA 1JLEA 1C1BA 2KZMA 1KFDA 4Z4CA 1Z25A 4LSLA 4DTMA 1KLNA 3ZCMA 4AHSA 1WAFA 4MFBA 4G1QA 3KLGA 5J2QA 2FBTA 1TK8A 4GMJB 4CEBA 4B9MA 2DFEA 3DLRA 4CF8A 3CG7A 3DOKA 4ID1A 3QLHA 4LSNA 4LH5A 4L8RB 3MEGA 3MAQA 4OLAA 3NF6A 2JGUA 1ZBFA 3IS9A 1BIZA 4OPKA 3NGIA 3V4IA 3O3HA 4UQGA 4F3OA 1HYSA 1ASUA 2ITGA 3AO5A 4KB1A 1TL1A 3OYCA 4KAZA 3MXJA 3RRHA 4ELVA 4KI6A 4DQPA 4PUOA 1CXQA 3QEXA 3C6UA 2EHGA 1O1WA 3C95A 4WE1A 2BANA 2R7YA 3QETA 3TAGA 3L2VA 2FBYA 3SI6A 5I3UA 4OLBA 1SKSA 2HB5A 3NFAA 1KVAA 1S6PA 2VWJA 1SKWA 4C8LA 3KD5E 1L5UA 1IO2A 5JS1A 2P51A 5DK5A 4QOZB 4PWDA 3C94A 1SL1A 4B9TA 5KTQA 3CYMA 3PX4A 2Y1JA 2G8WA 4DFMA 1RT6A 1RDCA 3ZT0A 2HMIA 4GW6A 2KFZA 4KREA 3NF9A 1HPZA 4QAGA 1DTTA 4DQIA 1JLFA 1CXUA 1BQNA 1C1AA 1NK6A 2O4IA 1U49A 4E3SA 1RT5A 4FJJA 4O0IA 3NF7A 1ZBLA 4FLYA 3ZSXA 3NCIA 3QO9A 2FC0A 3OYNA 3SV3A 3SYZA 1ITGA 4Z0UA 1DLOA 1EP4A 4GVMA 4CJFA 1NKBA 1TAUA 2IOCA 4CK1A 3TAEA 1X9SA 4W5TA 2G8KA 2PY5A 3PX6A 3S3OA 1QQCA 5J2PA 5SZTA 1WLJA 5KGWA 2OPSA 3PV8A 4AH9A 1TVRA 1IG9A 4H8KA 3HJFA 3AVFA 4CJ3A 4FJHA 1VSJA 3RRGA 4Z4GA 4CIGA 4KTZA 4N47A 4DU1A 3SPZA 4AHCA 1A5XA 4M3UA 2KQ2A 4CGFA 3AVNA 1W0HA 4DTOA 5HLFA 3HXMA 3K5MA 1YTUA 1TK0A 4CHOA 3OYBA 3SCXA 1YTAA 2BE2A 4ZHRA 1RT4A 1BI4B 3MEEA 4CGJA 3SNNA 2VG6A 4CK2A 3SUNA 4DU3A 1VSMA 3I8DA 1HRHA 3HT3A 3QEPA 1S9EA 1YVUA 3TAMA 1HQUA 3DRSA 1KSPA 4Z4FA 3LPUA 3OYDA 3DM2A 4IBNA 3VQPA 4CGIA 4IG3A 1EX4A 1YT3A 3ZT1A 3LDSA 3DLKA 3PO4A 1XWLA 3RR8A 3VA0A 4I2QA 3VQ6A 1NJZA 4B9VA 4OKEA 4DF4A 3WNEA 3LP2A 5HRPA 1B9DA 1XHXA 3P83D 4EZ6A 2WONA 1BHLA 3M8SA 1X1PA 2ZQBA 2KTQA 3AO1A 3NBPA 4FZXC 3NH1A 4DFKA 3WNGA 4KHWA 4CHQA 3I0SA 5JS2A 3QERA 1RBVA 1RBSA 2YHAA 3SQ4A 3CFOA 1VSKA 3LWLA 1RBRA 3NGYA 4DFJA 4FJKA 3NH0A 1Q9XA 1TKXA 1Q9YA 1RTIA 2Z1HA 3LPTA 4MQ3A 4FLWA 1DTQA 1QS4A 1KVBA 4CEEA 3C6TA 1QSLA 1S5JA 1NK4A 4DQQA 3VQ8A 3MXMA 4KPYA 4F2RA 1NOZA 3LAMA 1T7PA 3OJSA 1IKXA 1BQMA 3LALA 4E7LA 4BDZA 3NDKA 4EP5A 3DLHA 1QSYA 2XY5A 2Z1IA 3FFIA 1HYZA 2B4JA 3VQ4A 3LWMA 3L2RA 1KRPA 1JLGA 1J53A 4DU4A 3ZT3A 3DOLA 3OYMA 3DYAA 3AVCA 3HM9A 4BE2A 4DWIA 3VQAA 1KCFA 2ZE2A 3HL8A 3TARA 1S1TA 1NJXA 2YNFA 3L2UA 1Y97A 1ASWA 3OS2A 3HPOA 3KK1A 3HYFA 1GOBA 1RDAA 1WSGA 2YNIA 3NHGA 4DTJA 2HHTA 1WN7A 3U6FA 2Z1JA 4BE1A 4ELUA 2ATQA 1A5VA 3O3FA 1L3TA 1TAQA 1S1VA 1G15A 3NF8A 4IG0A 3OS0A 3SUOA 4KI4A 2HHXA 4J2AA 4NCAA 4NYFA 4CF0A 3THVA 4O44A 2VWKA 2F8TA 4FLTA 2GUIA 4M42A 1TKZA 1QTMA 4HUGA 4FK4A 2OPQA 3OYGA 3O4NA 5C24A 4FM0A 4IDKA 4Q5VA 4E7HA 3S3MA 2AJQA 1C0MA 2YV0X 4CEQA 1HYVA 2Z1GA 2E4LA 4HUEA 4M3ZA 3AV9A 4CFAA 3LP3A 4M41A 1U04A 3OYHA 1T03A 4KHUA 2YNGA 4DSFA 4AHRA 4J2BA 4KV8A 4E7KA 1UWBA 4M3RA 4PQUA 4DSKA 5E41A 4DSLA 3F73A 5J2NA 4EP4A 4W5RA 1BI4A 1VSEA 2OPPA 4RW4A 4I9LA 3LZIA 4DQRA 4DF8A 1NK8A 4CEOA 2G8HA 4CEAA 1LW0A 3VQ5A 3ZSRA 3H08A 1SL2A 1LW2A 3OYAA 3OYFA 3ASMA 1JLCA 1IKVA 1VSFA 4CJQA 3SQ0A 4DTPA 4FJ8A 1FKOA 3T1AA 2LSNA 4J2DA 2HNDA 4CJPA 4PA1A 4OPJA 4YFUA 4FLXA 3RR7A 4CE9A 1TV6A 3S3NA 3LANA 3OVNA 1WAJA 3QESA 1XI1A 1U48A 4DLGA 4FYDA 5KI6A 2PYJA 4HCCA 3AA5X 1TGOA 2P1JA 3AVMA 1JLBA 4RG8A 5KRSA 4ZTJA 1RBTA 1T05A 1NK0A 1UAXA 2GV9A 4FVMA 1UA1A 1JXBA 2Y1IA 5K14A 2HNZA 2DFFA 3ZSYA 3CQ8A 3SZ2A 3AA3A 4Y1DA 1EETA 2X78A 4FCYA 1S1XA 2XHBA 2GBZA 3RTVA 1BL3A 1S6QA 1GOCA 4HVJA 5D3GA 4FJ7A 1J54A 1JL2A 1S1WA 4RW6A 5CY4A 4R5PA 4FM1A 4CHNA 4AILC 4XIUA 1C6VA 5J1EA 5J2MA 1KTQA 2PYLA 2IC3A 2RF2A 3ULDA 1SKRA 1A5WA 4FZYA 3MEDA 3QEIA 4O5BA 1ZYQA 4JLHA 1NK5A 3KKSA 1HMVA 2DFHA 4I2PA 1VRUA 1WSJA 1FK9A 1L3SA 1BCOA 2VG5A 2E6MA 2WOMA 3VQQA 3RWUA 2Q3SA 4CJUA 3AVBA 4FM2A 4DSJA 3EZ5A 3AVIA 3K5LA 3K2PA 4DLEA 2OYQA 3IAYA 4NCBA 4I7FA 4K8XA 4CJSA 1J5OA 3L3UA 2DTUA 3AO3A 1RDDA 3ZSWA 1RTDA 3L2WA 1S1UA 3ISNC 1F21A 4YNQA 4JRQA 3QNOA 2X6NA 4E1MA 4FLUA 3TANA 1XHZA 1BISA 3V1RA 4O0JA 2HVIA 4OKJA 3KKRA 3M8RA 1Z26A 3O3GA 3M8QA 4AHTA 3SUQA 4DSEA 5HRNA 4ID5A 3QNNA 1NK7A 1VSHA 4OGEA 2W42A 3SQ1A 4IKFA 1WSEA 2I5JA 4N41A 4M3YA 2BGGA 2P5GA 1K6YA 3DI6A 3WNHA 3T3FA 4OVLA 3VQDA 4JS5A 4CK3A 3KLHA 1RT3A 3QINA 3TAPA 1B92A 3AVGA 4CGDA 4IFVA 3D45A 2B6AA 3M8PA 3QIOA 5HBMA 4E1NA 4CJRA 4FXDA 4CIEA 1TKDA 4CESA 3QEVA 4B9UA 3AO2A 1VK0A 1NJWA 3CM5A 1NOYA 3WNFA 1KVCA 1HQEA 4C8NA 4N56A 3KK3A 3G0ZA 4JS4A 1U4BA 5FRNA 2OPRA 3VQ9A 1LAWA 3V81A 3OYKA 4E89A 2XY6A 2OA8A 4PY5A 3LZJA 5HP1A 5CYQA 1IKYA 3ZT2A 5KRTA 1S9GA 3ITHA 5HRRA 3VQEA 3K59A 1CLQA 2HNYA 4BWJA 2IAJA 3A2FA 4FK2A 4LH4A 4Q0BA 1JXEA 3UIQA 3HPHA 1LWEA 4BDYA 4F3TA 3TI0A 4B8AB 3B6PA 3HP9A 2HVHA 3VN5A 5SWMA 4CFBA 1HNVA 3AVAA 5FROA 1VSLA 3ZSQA 4CJLA 3CM6A 1RILA 1TL3A 4CFDA 5KGXA 3OYIA 3KLEA 3V9WA 4NYNA 4KHSA 1SV5A 3OYLA 3I0RA 4LY7A 2XRIA 2RPIA 3V9SA 1JLAA 3MECA 3CFRA 4KO0A 1LWCA 2A1SA 1L3VA 3DMJA 3DLBA 2XY7A 4BACA 4FJIA 2RKIA 3KD1E 4M3TA 4FK0A 3K57A 1WSHA 4RW8A 3ZT4A 4FLVA 3DRRA 4CHPA 2KW4A 4JRPA 1JL1A 1IH7A 2D0BA 4O4GA 3OYEA 3PX0A 3SUPA 1I39A 2XO7A 3IRXA 3QEWA 3D0PA 1VSIA 2NUBA 3LAKA 2VG7A 2QKBA 4CGHA 3P5JA 4ELTA 4ICLA 1TKTA 4DQSA 3TAQA 4BE0A 4O55A 4C8MA 4KRFA 3RMDA 4CGGA 1J9AA 2QXFA 4EZ9A 3JYTA 4W5OA 1ZBHA 2O4GA 2IGIA 4KKOA 5C25A 1BCMA 1RT2A 1ZBUA 5EU7A 3HP6A 1SL0A 4F2SA 1JKHA 3KIOA 4CEFA 1I3AA 3RMBA 3F9KA 1VSDA 5CZ2A 1U45A 1RT7A 5HROA 5CZ1A 1X9MA 1N6QA 3BDPA 4CCHA 3LP1A 3KLFA 1QE1A 2HW3A 3AA2A 4RW9A 1D5AA 1UA0A 3ZSZA 3MXIA 4CJ4A 1LAVA 1D9DA 4KTQA 2QK9A 4B3OA 4AHUA 4CEZA 4B8CA 1C0UA 1VRTA 1XC9A 3BGRA 2ETJA 4W5NA 1NJYA 3SPYA 1UOCA 3AO4A 1CZ9A 3JSMA 1B9FA 2FBXA 1MU2A 1RNHA 4AHVA 3TABA 3U3GA 1RBUA 1NKEA 3AA4A 4CHYA 1LV5A 3DLEA 1SUQA 4QCLA 5T7BA 1KFSA 1EXQA 4DTNA 5C42A 3DRPA 4DS4A 3NE6A 1X9WA 3OS1A 4FJ5A 4FJNA 2HHSA 3SV4A 2RN2A 4FW1A 3PO5A 4HCBA 4RW7A 3QIPA 3OYJA 4CF2A 5DMRA 4E7JA 1BGXT 4NCGA 4CJVA 2HHUA 4CJTA 2DY4A 3AVHA 3ZSOA 3V6DA 2G8UA 2QKKA 4FJLA 1IKWA 4CJKA 1R0AA 3S9HA 2YKNA 4C8KA 4KHNA 4CEDA 4ZTFA 4FJXA 3L8BA 3P1GA 3KTQA 2D0CA 3G10A 5CYMA 3V1OA 3EYZA 3OY9A 3T19A 4FLZA 3RMCA 4E0DA 4DTRA 2HHWA 4C8OA 5HRSA 4OKKA 4Z4HA 1NKCA 2JLEA 3PUFA 4CF9A 4DTSA 4KTWA 3VQ7A 4DMNA 1C0TA 4M45A 3K5NA 1QHTA 2IDOA 1GOAA 3L3VA 1RTHA 3CFPA 1EKEA 3ZSVA 4HTUA 3RMAA 2HHQA 4Y1CA 4LD0A 3HVTA 1HJRA 1FKPA 3TAFA 1KLMA 1LWFA 2G8VA 3TWHA 3TR8A 4BDPA 4I9QA 2IS3A 4KB0A 3AVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9S A;  2B5J A;  4CIF A;  3V9Z A;  4CER A;  3U3Y A;  3KK2 A;  3HVR A;  2BDP A;  4HUF A;  3ALY A;  3HK2 A;  4E19 A;  4BWM A;  1REV A;  2YKM A;  4CFC A;  2KZZ A;  3NAE A;  3LP0 A;  4Z4I A;  2EX3 A;  1ZBI A;  4CJ5 A;  1D9F A;  4FJM A;  5FDL A;  1WSI A;  2G8F A;  5FRM A;  3V1Q A;  3V9U A;  3SQ2 A;  4F8R A;  2OZS A;  4DG1 A;  3B6O A;  1RTJ A;  4FW2 A;  1T8E A;  2ZD1 A;  4HHT A;  4K8Z A;  2KFN A;  4CHZ A;  3NGZ A;  4B9N A;  2XY8 A;  3K5O A;  4FJ9 A;  4CJW A;  3VQB A;  2X6S A;  2A1R A;  1HNI A;  4DFP A;  4FJG A;  4DS5 A;  4M3X A;  2E6L A;  3HPG A;  1ASV A;  3KLI A;  4OJR A;  4KFB A;  2PZS A;  4J2E A;  2F96 A;  2X74 A;  1WNS A;  2FBV A;  2YHB A;  4H4M A;  1N5Y A;  3EY1 A;  1RDB A;  1RCH A;  3V9X A;  3DLG A;  1NK9 A;  4CJE A;  2G8I A;  1CZB A;  4KHQ A;  4B9L A;  4N5S A;  3HST B;  3PY8 A;  2P5O A;  1W9H A;  3OJU A;  3E01 A;  3VA3 A;  4N76 A;  2YNH A;  1BIU A;  5I42 A;  4DSI A;  4W5Q A;  1FXX A;  3O4Q A;  3NH2 A;  1Q8I A;  4KHY A;  3KJV A;  3L2Q A;  3K58 A;  3AVJ A;  2F8S A;  2D5R A;  1JLQ A;  4IFY A;  3HO1 A;  2OZM A;  2HHV A;  3AVK A;  4OGC A;  4E7I A;  4TSX A;  4FZZ A;  4DTU A;  2D0A A;  3VQC A;  4F4K A;  1D8Y A;  1L3U A;  4Z4E A;  3IG1 A;  4M3W A;  1WSF A;  1C1C A;  1TK5 A;  4B08 A;  4H4O A;  3SJJ A;  1RT1 A;  1QSS A;  4CF1 A;  4CEC A;  1U47 A;  4DTX A;  1JLE A;  1C1B A;  2KZM A;  1KFD A;  4Z4C A;  1Z25 A;  4LSL A;  4DTM A;  1KLN A;  3ZCM A;  4AHS A;  1WAF A;  4MFB A;  4G1Q A;  3KLG A;  5J2Q A;  2FBT A;  1TK8 A;  4GMJ B;  4CEB A;  4B9M A;  2DFE A;  3DLR A;  4CF8 A;  3CG7 A;  3DOK A;  4ID1 A;  3QLH A;  4LSN A;  4LH5 A;  4L8R B;  3MEG A;  3MAQ A;  4OLA A;  3NF6 A;  2JGU A;  1ZBF A;  3IS9 A;  1BIZ A;  4OPK A;  3NGI A;  3V4I A;  3O3H A;  4UQG A;  4F3O A;  1HYS A;  1ASU A;  2ITG A;  3AO5 A;  4KB1 A;  1TL1 A;  3OYC A;  4KAZ A;  3MXJ A;  3RRH A;  4ELV A;  4KI6 A;  4DQP A;  4PUO A;  1CXQ A;  3QEX A;  3C6U A;  2EHG A;  1O1W A;  3C95 A;  4WE1 A;  2BAN A;  2R7Y A;  3QET A;  3TAG A;  3L2V A;  2FBY A;  3SI6 A;  5I3U A;  4OLB A;  1SKS A;  2HB5 A;  3NFA A;  1KVA A;  1S6P A;  2VWJ A;  1SKW A;  4C8L A;  3KD5 E;  1L5U A;  1IO2 A;  5JS1 A;  2P51 A;  5DK5 A;  4QOZ B;  4PWD A;  3C94 A;  1SL1 A;  4B9T A;  5KTQ A;  3CYM A;  3PX4 A;  2Y1J A;  2G8W A;  4DFM A;  1RT6 A;  1RDC A;  3ZT0 A;  2HMI A;  4GW6 A;  2KFZ A;  4KRE A;  3NF9 A;  1HPZ A;  4QAG A;  1DTT A;  4DQI A;  1JLF A;  1CXU A;  1BQN A;  1C1A A;  1NK6 A;  2O4I A;  1U49 A;  4E3S A;  1RT5 A;  4FJJ A;  4O0I A;  3NF7 A;  1ZBL A;  4FLY A;  3ZSX A;  3NCI A;  3QO9 A;  2FC0 A;  3OYN A;  3SV3 A;  3SYZ A;  1ITG A;  4Z0U A;  1DLO A;  1EP4 A;  4GVM A;  4CJF A;  1NKB A;  1TAU A;  2IOC A;  4CK1 A;  3TAE A;  1X9S A;  4W5T A;  2G8K A;  2PY5 A;  3PX6 A;  3S3O A;  1QQC A;  5J2P A;  5SZT A;  1WLJ A;  5KGW A;  2OPS A;  3PV8 A;  4AH9 A;  1TVR A;  1IG9 A;  4H8K A;  3HJF A;  3AVF A;  4CJ3 A;  4FJH A;  1VSJ A;  3RRG A;  4Z4G A;  4CIG A;  4KTZ A;  4N47 A;  4DU1 A;  3SPZ A;  4AHC A;  1A5X A;  4M3U A;  2KQ2 A;  4CGF A;  3AVN A;  1W0H A;  4DTO A;  5HLF A;  3HXM A;  3K5M A;  1YTU A;  1TK0 A;  4CHO A;  3OYB A;  3SCX A;  1YTA A;  2BE2 A;  4ZHR A;  1RT4 A;  1BI4 B;  3MEE A;  4CGJ A;  3SNN A;  2VG6 A;  4CK2 A;  3SUN A;  4DU3 A;  1VSM A;  3I8D A;  1HRH A;  3HT3 A;  3QEP A;  1S9E A;  1YVU A;  3TAM A;  1HQU A;  3DRS A;  1KSP A;  4Z4F A;  3LPU A;  3OYD A;  3DM2 A;  4IBN A;  3VQP A;  4CGI A;  4IG3 A;  1EX4 A;  1YT3 A;  3ZT1 A;  3LDS A;  3DLK A;  3PO4 A;  1XWL A;  3RR8 A;  3VA0 A;  4I2Q A;  3VQ6 A;  1NJZ A;  4B9V A;  4OKE A;  4DF4 A;  3WNE A;  3LP2 A;  5HRP A;  1B9D A;  1XHX A;  3P83 D;  4EZ6 A;  2WON A;  1BHL A;  3M8S A;  1X1P A;  2ZQB A;  2KTQ A;  3AO1 A;  3NBP A;  4FZX C;  3NH1 A;  4DFK A;  3WNG A;  4KHW A;  4CHQ A;  3I0S A;  5JS2 A;  3QER A;  1RBV A;  1RBS A;  2YHA A;  3SQ4 A;  3CFO A;  1VSK A;  3LWL A;  1RBR A;  3NGY A;  4DFJ A;  4FJK A;  3NH0 A;  1Q9X A;  1TKX A;  1Q9Y A;  1RTI A;  2Z1H A;  3LPT A;  4MQ3 A;  4FLW A;  1DTQ A;  1QS4 A;  1KVB A;  4CEE A;  3C6T A;  1QSL A;  1S5J A;  1NK4 A;  4DQQ A;  3VQ8 A;  3MXM A;  4KPY A;  4F2R A;  1NOZ A;  3LAM A;  1T7P A;  3OJS A;  1IKX A;  1BQM A;  3LAL A;  4E7L A;  4BDZ A;  3NDK A;  4EP5 A;  3DLH A;  1QSY A;  2XY5 A;  2Z1I A;  3FFI A;  1HYZ A;  2B4J A;  3VQ4 A;  3LWM A;  3L2R A;  1KRP A;  1JLG A;  1J53 A;  4DU4 A;  3ZT3 A;  3DOL A;  3OYM A;  3DYA A;  3AVC A;  3HM9 A;  4BE2 A;  4DWI A;  3VQA A;  1KCF A;  2ZE2 A;  3HL8 A;  3TAR A;  1S1T A;  1NJX A;  2YNF A;  3L2U A;  1Y97 A;  1ASW A;  3OS2 A;  3HPO A;  3KK1 A;  3HYF A;  1GOB A;  1RDA A;  1WSG A;  2YNI A;  3NHG A;  4DTJ A;  2HHT A;  1WN7 A;  3U6F A;  2Z1J A;  4BE1 A;  4ELU A;  2ATQ A;  1A5V A;  3O3F A;  1L3T A;  1TAQ A;  1S1V A;  1G15 A;  3NF8 A;  4IG0 A;  3OS0 A;  3SUO A;  4KI4 A;  2HHX A;  4J2A A;  4NCA A;  4NYF A;  4CF0 A;  3THV A;  4O44 A;  2VWK A;  2F8T A;  4FLT A;  2GUI A;  4M42 A;  1TKZ A;  1QTM A;  4HUG A;  4FK4 A;  2OPQ A;  3OYG A;  3O4N A;  5C24 A;  4FM0 A;  4IDK A;  4Q5V A;  4E7H A;  3S3M A;  2AJQ A;  1C0M A;  2YV0 X;  4CEQ A;  1HYV A;  2Z1G A;  2E4L A;  4HUE A;  4M3Z A;  3AV9 A;  4CFA A;  3LP3 A;  4M41 A;  1U04 A;  3OYH A;  1T03 A;  4KHU A;  2YNG A;  4DSF A;  4AHR A;  4J2B A;  4KV8 A;  4E7K A;  1UWB A;  4M3R A;  4PQU A;  4DSK A;  5E41 A;  4DSL A;  3F73 A;  5J2N A;  4EP4 A;  4W5R A;  1BI4 A;  1VSE A;  2OPP A;  4RW4 A;  4I9L A;  3LZI A;  4DQR A;  4DF8 A;  1NK8 A;  4CEO A;  2G8H A;  4CEA A;  1LW0 A;  3VQ5 A;  3ZSR A;  3H08 A;  1SL2 A;  1LW2 A;  3OYA A;  3OYF A;  3ASM A;  1JLC A;  1IKV A;  1VSF A;  4CJQ A;  3SQ0 A;  4DTP A;  4FJ8 A;  1FKO A;  3T1A A;  2LSN A;  4J2D A;  2HND A;  4CJP A;  4PA1 A;  4OPJ A;  4YFU A;  4FLX A;  3RR7 A;  4CE9 A;  1TV6 A;  3S3N A;  3LAN A;  3OVN A;  1WAJ A;  3QES A;  1XI1 A;  1U48 A;  4DLG A;  4FYD A;  5KI6 A;  2PYJ A;  4HCC A;  3AA5 X;  1TGO A;  2P1J A;  3AVM A;  1JLB A;  4RG8 A;  5KRS A;  4ZTJ A;  1RBT A;  1T05 A;  1NK0 A;  1UAX A;  2GV9 A;  4FVM A;  1UA1 A;  1JXB A;  2Y1I A;  5K14 A;  2HNZ A;  2DFF A;  3ZSY A;  3CQ8 A;  3SZ2 A;  3AA3 A;  4Y1D A;  1EET A;  2X78 A;  4FCY A;  1S1X A;  2XHB A;  2GBZ A;  3RTV A;  1BL3 A;  1S6Q A;  1GOC A;  4HVJ A;  5D3G A;  4FJ7 A;  1J54 A;  1JL2 A;  1S1W A;  4RW6 A;  5CY4 A;  4R5P A;  4FM1 A;  4CHN A;  4AIL C;  4XIU A;  1C6V A;  5J1E A;  5J2M A;  1KTQ A;  2PYL A;  2IC3 A;  2RF2 A;  3ULD A;  1SKR A;  1A5W A;  4FZY A;  3MED A;  3QEI A;  4O5B A;  1ZYQ A;  4JLH A;  1NK5 A;  3KKS A;  1HMV A;  2DFH A;  4I2P A;  1VRU A;  1WSJ A;  1FK9 A;  1L3S A;  1BCO A;  2VG5 A;  2E6M A;  2WOM A;  3VQQ A;  3RWU A;  2Q3S A;  4CJU A;  3AVB A;  4FM2 A;  4DSJ A;  3EZ5 A;  3AVI A;  3K5L A;  3K2P A;  4DLE A;  2OYQ A;  3IAY A;  4NCB A;  4I7F A;  4K8X A;  4CJS A;  1J5O A;  3L3U A;  2DTU A;  3AO3 A;  1RDD A;  3ZSW A;  1RTD A;  3L2W A;  1S1U A;  3ISN C;  1F21 A;  4YNQ A;  4JRQ A;  3QNO A;  2X6N A;  4E1M A;  4FLU A;  3TAN A;  1XHZ A;  1BIS A;  3V1R A;  4O0J A;  2HVI A;  4OKJ A;  3KKR A;  3M8R A;  1Z26 A;  3O3G A;  3M8Q A;  4AHT A;  3SUQ A;  4DSE A;  5HRN A;  4ID5 A;  3QNN A;  1NK7 A;  1VSH A;  4OGE A;  2W42 A;  3SQ1 A;  4IKF A;  1WSE A;  2I5J A;  4N41 A;  4M3Y A;  2BGG A;  2P5G A;  1K6Y A;  3DI6 A;  3WNH A;  3T3F A;  4OVL A;  3VQD A;  4JS5 A;  4CK3 A;  3KLH A;  1RT3 A;  3QIN A;  3TAP A;  1B92 A;  3AVG A;  4CGD A;  4IFV A;  3D45 A;  2B6A A;  3M8P A;  3QIO A;  5HBM A;  4E1N A;  4CJR A;  4FXD A;  4CIE A;  1TKD A;  4CES A;  3QEV A;  4B9U A;  3AO2 A;  1VK0 A;  1NJW A;  3CM5 A;  1NOY A;  3WNF A;  1KVC A;  1HQE A;  4C8N A;  4N56 A;  3KK3 A;  3G0Z A;  4JS4 A;  1U4B A;  5FRN A;  2OPR A;  3VQ9 A;  1LAW A;  3V81 A;  3OYK A;  4E89 A;  2XY6 A;  2OA8 A;  4PY5 A;  3LZJ A;  5HP1 A;  5CYQ A;  1IKY A;  3ZT2 A;  5KRT A;  1S9G A;  3ITH A;  5HRR A;  3VQE A;  3K59 A;  1CLQ A;  2HNY A;  4BWJ A;  2IAJ A;  3A2F A;  4FK2 A;  4LH4 A;  4Q0B A;  1JXE A;  3UIQ A;  3HPH A;  1LWE A;  4BDY A;  4F3T A;  3TI0 A;  4B8A B;  3B6P A;  3HP9 A;  2HVH A;  3VN5 A;  5SWM A;  4CFB A;  1HNV A;  3AVA A;  5FRO A;  1VSL A;  3ZSQ A;  4CJL A;  3CM6 A;  1RIL A;  1TL3 A;  4CFD A;  5KGX A;  3OYI A;  3KLE A;  3V9W A;  4NYN A;  4KHS A;  1SV5 A;  3OYL A;  3I0R A;  4LY7 A;  2XRI A;  2RPI A;  3V9S A;  1JLA A;  3MEC A;  3CFR A;  4KO0 A;  1LWC A;  2A1S A;  1L3V A;  3DMJ A;  3DLB A;  2XY7 A;  4BAC A;  4FJI A;  2RKI A;  3KD1 E;  4M3T A;  4FK0 A;  3K57 A;  1WSH A;  4RW8 A;  3ZT4 A;  4FLV A;  3DRR A;  4CHP A;  2KW4 A;  4JRP A;  1JL1 A;  1IH7 A;  2D0B A;  4O4G A;  3OYE A;  3PX0 A;  3SUP A;  1I39 A;  2XO7 A;  3IRX A;  3QEW A;  3D0P A;  1VSI A;  2NUB A;  3LAK A;  2VG7 A;  2QKB A;  4CGH A;  3P5J A;  4ELT A;  4ICL A;  1TKT A;  4DQS A;  3TAQ A;  4BE0 A;  4O55 A;  4C8M A;  4KRF A;  3RMD A;  4CGG A;  1J9A A;  2QXF A;  4EZ9 A;  3JYT A;  4W5O A;  1ZBH A;  2O4G A;  2IGI A;  4KKO A;  5C25 A;  1BCM A;  1RT2 A;  1ZBU A;  5EU7 A;  3HP6 A;  1SL0 A;  4F2S A;  1JKH A;  3KIO A;  4CEF A;  1I3A A;  3RMB A;  3F9K A;  1VSD A;  5CZ2 A;  1U45 A;  1RT7 A;  5HRO A;  5CZ1 A;  1X9M A;  1N6Q A;  3BDP A;  4CCH A;  3LP1 A;  3KLF A;  1QE1 A;  2HW3 A;  3AA2 A;  4RW9 A;  1D5A A;  1UA0 A;  3ZSZ A;  3MXI A;  4CJ4 A;  1LAV A;  1D9D A;  4KTQ A;  2QK9 A;  4B3O A;  4AHU A;  4CEZ A;  4B8C A;  1C0U A;  1VRT A;  1XC9 A;  3BGR A;  2ETJ A;  4W5N A;  1NJY A;  3SPY A;  1UOC A;  3AO4 A;  1CZ9 A;  3JSM A;  1B9F A;  2FBX A;  1MU2 A;  1RNH A;  4AHV A;  3TAB A;  3U3G A;  1RBU A;  1NKE A;  3AA4 A;  4CHY A;  1LV5 A;  3DLE A;  1SUQ A;  4QCL A;  5T7B A;  1KFS A;  1EXQ A;  4DTN A;  5C42 A;  3DRP A;  4DS4 A;  3NE6 A;  1X9W A;  3OS1 A;  4FJ5 A;  4FJN A;  2HHS A;  3SV4 A;  2RN2 A;  4FW1 A;  3PO5 A;  4HCB A;  4RW7 A;  3QIP A;  3OYJ A;  4CF2 A;  5DMR A;  4E7J A;  1BGX T;  4NCG A;  4CJV A;  2HHU A;  4CJT A;  2DY4 A;  3AVH A;  3ZSO A;  3V6D A;  2G8U A;  2QKK A;  4FJL A;  1IKW A;  4CJK A;  1R0A A;  3S9H A;  2YKN A;  4C8K A;  4KHN A;  4CED A;  4ZTF A;  4FJX A;  3L8B A;  3P1G A;  3KTQ A;  2D0C A;  3G10 A;  5CYM A;  3V1O A;  3EYZ A;  3OY9 A;  3T19 A;  4FLZ A;  3RMC A;  4E0D A;  4DTR A;  2HHW A;  4C8O A;  5HRS A;  4OKK A;  4Z4H A;  1NKC A;  2JLE A;  3PUF A;  4CF9 A;  4DTS A;  4KTW A;  3VQ7 A;  4DMN A;  1C0T A;  4M45 A;  3K5N A;  1QHT A;  2IDO A;  1GOA A;  3L3V A;  1RTH A;  3CFP A;  1EKE A;  3ZSV A;  4HTU A;  3RMA A;  2HHQ A;  4Y1C A;  4LD0 A;  3HVT A;  1HJR A;  1FKP A;  3TAF A;  1KLM A;  1LWF A;  2G8V A;  3TWH A;  3TR8 A;  4BDP A;  4I9Q A;  2IS3 A;  4KB0 A;  3AVL A; 
#chains in the Genus database with same CATH topology
 4CIF A;  3M1F A;  1V4S A;  4BWM A;  2KZZ A;  4Z4I A;  4BRE A;  2KHO A;  1D9F A;  4FJM A;  1WSI A;  3WXK A;  2G8F A;  3V1Q A;  3SQ2 A;  4DV1 K;  2OZS A;  4IJA A;  4KBO A;  2OTJ N;  1RTJ A;  4FW2 A;  5FPM A;  4K8Z A;  3HSC A;  3NGZ A;  2XY8 A;  1HKG A;  4M63 C;  3VQB A;  5DM6 L;  2GEL A;  4DFP A;  4FJG A;  2V52 B;  1ASV A;  4OJR A;  5CHI A;  4PKG A;  4JI1 K;  2W41 A;  2F96 A;  3AAQ A;  1NGJ A;  1NGH A;  5E84 A;  3G6E N;  4H4M A;  2ASM A;  4BRN A;  3FZH A;  2G8I A;  3P31 A;  2NRV A;  3VPZ A;  4DSI A;  1FXX A;  3L2Q A;  3R9P A;  5BN8 A;  4DR5 K;  4IFY A;  4BQZ A;  2YHX A;  3IG1 A;  1WSF A;  1C1C A;  1U47 A;  1W97 L;  4YDU C;  1ZC6 A;  1C1B A;  1KFD A;  1Z25 A;  4AHS A;  4LF4 K;  5BPN A;  4G1Q A;  1BDG A;  4GMJ B;  1BWF O;  5M1O A;  1P8Z A;  4CEB A;  3DLR A;  4CF8 A;  3CG7 A;  2EWS A;  3QLH A;  4LH5 A;  4H5T A;  3IS9 A;  4OPK A;  3J7Y P;  3NGI A;  4WQ5 A;  3EEQ A;  4Z94 A;  5AQH A;  4KI6 A;  1JJ2 M;  3H46 O;  5KQD A;  4YY3 K;  1W7A A;  1BA1 A;  3C95 A;  4WE1 A;  3QET A;  5I3U A;  4OLB A;  2P9N A;  1S6P A;  1SKW A;  4DKW A;  1IO2 A;  4K43 A;  4PWD A;  3OW2 M;  4BRA A;  2G8W A;  3O4W A;  2KFZ A;  2A5X A;  3JAM O;  4KRE A;  1C1A A;  4BR9 A;  4MLH A;  1U49 A;  4E3S A;  4O0I A;  3CJB A;  1XUP O;  3HZ6 A;  1ITG A;  1EP4 A;  4GVM A;  4DV2 K;  2UUC K;  2IOC A;  1X9S A;  3TAE A;  4WCE L;  2PY5 A;  4FPA A;  5J2P A;  3PV8 A;  4AH9 A;  4H8K A;  4A61 A;  4BRO A;  1OH5 A;  4CIG A;  4BRD A;  3SAF A;  3AVN A;  3ZET B;  1VQP N;  3OYB A;  4A59 A;  3I33 A;  5TKW A;  3E1Y A;  2VG6 A;  2RHK A;  3LM2 A;  3MN5 A;  4IOC L;  4DR6 K;  1S9E A;  2HF3 A;  3G71 N;  3LPU A;  3MWP A;  2YJE A;  3DM2 A;  3VEO A;  3VQP A;  4CGI A;  3E9O A;  4IG3 A;  1EX4 A;  1YT3 A;  3ZT1 A;  4YHH K;  3DLK A;  3VEY A;  4XH4 A;  3RR8 A;  4B9V A;  4I2Q A;  1NJZ A;  2D0P A;  5F1X A;  4EZ6 A;  3N4P A;  4IOX A;  2WON A;  2E1Y A;  1X1P A;  3C0B A;  2HST A;  2P9K A;  3NBP A;  4DFK A;  1OH8 A;  3IFR A;  4CZM A;  1VSK A;  3FZK A;  4YOY A;  4FWQ A;  3LPT A;  2NRH A;  3FLC O;  5C10 A;  4BRG A;  5AQT A;  1NK4 A;  4F2R A;  3CCS N;  1T7P A;  3J7A P;  3SLC A;  4E7L A;  4EP5 A;  3CCV N;  4BGA A;  2F4V K;  2OCE A;  3VQ4 A;  4GNI A;  1JLG A;  3ZX2 A;  2P9U B;  3DYA A;  2JWK A;  3HL8 A;  2YNF A;  3L2U A;  1FW6 A;  2VQE K;  3HPO A;  3K0S A;  3KK1 A;  1IJJ A;  1YVN A;  3U6F A;  3KHY A;  1TAQ A;  4ILH A;  3SUO A;  5IT9 O;  4KI4 A;  1ILY A;  3VGK A;  2GUI A;  1TKZ A;  5LJW A;  5C24 A;  3S3M A;  2YV0 X;  2YHY A;  4DV6 K;  2E4L A;  5AQU A;  4HUE A;  3LP3 A;  4M41 A;  1T03 A;  3CCL N;  4DSF A;  4KV8 A;  4DR1 K;  4DQ8 A;  5E41 A;  3F73 A;  1BI4 A;  3LZI A;  4DF8 A;  2VWB A;  4B1X B;  1WBB A;  2G8H A;  2GX9 A;  1LW2 A;  3NMU A;  2A6A A;  1NM1 A;  3OYF A;  3ASM A;  1VSF A;  1FKO A;  4NLC A;  4CJP A;  4ISF A;  4FLX A;  4FO0 A;  1OKJ A;  1TV6 A;  3LAN A;  4DLG A;  4RG8 A;  1H1V A;  3D7E O;  1RBT A;  4H5N A;  5AQO A;  5AJ3 K;  1T05 A;  1Q82 O;  4LF6 K;  1UA1 A;  1E4G T;  2E20 A;  3ZSY A;  4RCH A;  3OBW A;  2YX6 A;  3MCP A;  1GOC A;  4HVJ A;  5D3G A;  4JK7 A;  3FZF A;  4FJ7 A;  4R5P A;  2QWN A;  4CHN A;  3D2F B;  1SKR A;  3QEI A;  1ZYQ A;  4B3R K;  1HMV A;  5KQ8 A;  2DFH A;  3CPW M;  3H3N O;  2YJF A;  3FFK B;  1U6Z A;  3VQQ A;  4CJU A;  4FM2 A;  4XH1 A;  4DLE A;  3IAY A;  2J4R A;  4ILJ A;  4DV4 K;  5BRE A;  3ZSW A;  3ISN C;  3QNO A;  1XHZ A;  4C23 A;  1BIS A;  4H0P A;  4O0J A;  3M8R A;  3KKR A;  2ZWH A;  4K41 A;  3SUQ A;  4DV0 K;  3LDP A;  1NK7 A;  4OGE A;  4H5V A;  5KPR A;  1WSE A;  3SAG A;  4IKF A;  4N41 A;  3DI6 A;  3ZYY X;  1VQ5 N;  3VQD A;  4CK3 A;  4H5W A;  1RT3 A;  3QIN A;  3TAP A;  4QS9 A;  4IFV A;  4FXD A;  3QIO A;  3VEV A;  2HBJ A;  3AO2 A;  5GAE P;  3DLL L;  1E3M A;  3WNF A;  4C8N A;  3MMV A;  4IXC A;  3VQ9 A;  3V81 A;  1IKY A;  5KRT A;  3ITH A;  5HRR A;  1JCE A;  2AP1 A;  3UIQ A;  4JD2 B;  4YOT A;  3B6P A;  2HVH A;  5SWM A;  4CFB A;  3V6D A;  5KGX A;  1VSL A;  4CFD A;  3KLE A;  4KHS A;  3CCM N;  1SV5 A;  1GLL O;  3OYL A;  3V9S A;  2GTD A;  3MEC A;  4KO0 A;  3ZEU A;  4M7Y A;  3PLA A;  3DMJ A;  4FJI A;  4BAC A;  4M3T A;  4FK0 A;  3K57 A;  4RW8 A;  3DRR A;  4IEE A;  2UU9 K;  1SS6 A;  3EE8 A;  3PX0 A;  1I39 A;  3QEW A;  1IBM K;  1VSI A;  2NUB A;  3LAK A;  2VG7 A;  3BZC A;  4IDH A;  4CGH A;  5AFU H;  5CR4 A;  4ELT A;  4BE0 A;  4WQ4 C;  2ZF5 O;  3FGU A;  2QA4 N;  3RMD A;  4EZ9 A;  3KWG A;  3JYT A;  1ZBH A;  2YCH A;  4IO9 L;  4U7B A;  4Y0W A;  1SL0 A;  5CZ2 A;  1RT7 A;  1X9M A;  2E88 A;  2NRX A;  3LP1 A;  1IG8 A;  4JKH A;  3AA2 A;  3ZSZ A;  3MXI A;  2QK9 A;  4BVP A;  2UXB K;  4BY9 C;  1NJY A;  3O1B A;  1CZ9 A;  4BC2 A;  2HF4 A;  4KH4 A;  4AHV A;  3PIO L;  3TAB A;  3E66 A;  4WF9 L;  3LDO A;  4DS4 A;  3NE6 A;  1X9W A;  2HHS A;  3QB0 A;  3PO5 A;  3QBW A;  2FSN A;  4NCG A;  2W40 A;  4BG8 A;  5I9E B;  4CJV A;  4GVE A;  2HHU A;  2DY4 A;  3ZSO A;  3ULE B;  2G8U A;  4FJL A;  2YKN A;  3CC4 N;  4C8K A;  4ZTF A;  3L8B A;  3J80 O;  3G10 A;  5CYM A;  3EYZ A;  1BU6 O;  4FWR A;  3WEE A;  4C8O A;  1NKC A;  2JLE A;  3PUF A;  1N33 K;  5C15 A;  4KTW A;  3VQ7 A;  3K5N A;  4M45 A;  1TUU A;  3L3V A;  3RMA A;  5AQJ A;  5C2F A;  1GLB G;  1LWF A;  3L6Q A;  4BDP A;  2D1K A;  2V51 B;  3V9Z A;  2RE2 A;  3HVR A;  4HUF A;  4BR4 A;  3HK2 A;  3E9L A;  3O9S A;  2YKM A;  3GL1 A;  2PAV A;  1Q86 O;  2EX3 A;  5AQW A;  1ZBI A;  3CC2 N;  4CJ5 A;  4CZK A;  4FWN A;  4KH6 A;  3UKR B;  4I6M B;  4JI2 K;  3B6O A;  3PSF A;  3W0L A;  3F9M A;  2HBL A;  4B9N A;  4FJ9 A;  1GLA G;  1C0F A;  5KPT A;  1HNI A;  4DS5 A;  3H1Q A;  3HPG A;  3OBY A;  4KFB A;  2PZS A;  4J2E A;  2FBV A;  1N5Y A;  4A2B A;  1RCH A;  3DLG A;  2CGJ A;  3O1W A;  1YXQ A;  1SQK A;  3O9T A;  4B1V A;  2YNH A;  1BIU A;  1NWK A;  4CW7 B;  4W5Q A;  3AVJ A;  5AQN A;  5AQY A;  4PL7 A;  2D5R A;  1KXP A;  2OZM A;  3L0Q A;  4OGC A;  4LF9 K;  4DTU A;  3VQC A;  4F4K A;  3GE1 A;  1D8Y A;  1KAZ A;  1QSS A;  4B08 A;  3CD6 N;  1RT1 A;  4B1Y B;  2KZM A;  3MN6 A;  4PKH A;  1KLN A;  4DTM A;  3ZCM A;  3KLG A;  5J2Q A;  4B1U B;  2E2O A;  3J8A A;  4K0K K;  2UYT A;  4NLB A;  3M6G A;  2D4W A;  3D6R A;  3MEG A;  3MAQ A;  3NF6 A;  1ZBF A;  1HYS A;  3O3H A;  4F3O A;  3M3Z A;  1ASU A;  2ITG A;  5C12 A;  1TL1 A;  3BF3 A;  3MXJ A;  2HOE A;  3CQX A;  4DQP A;  4H0X B;  3QEX A;  4LFB K;  4JKG B;  2R7Y A;  3HM8 A;  1SKS A;  2HB5 A;  3NFA A;  4B3T K;  2VWJ A;  1L5U A;  1XNQ K;  4A2A A;  4QOZ B;  3HTV A;  2UXC K;  1Q7Y O;  1SL1 A;  4B9T A;  5KTQ A;  3QDK A;  3OA9 A;  3VER A;  3NF9 A;  1HPZ A;  1DTT A;  1XQS C;  2QTD A;  3AAP A;  3UE5 A;  1NK6 A;  2O4I A;  5EOY A;  5LMN K;  1HLU A;  1ZBL A;  3NCI A;  3OYN A;  2FC0 A;  5AQV A;  3AY9 A;  1VAZ A;  4W5T A;  3PX6 A;  1WLJ A;  4DR4 K;  1VSJ A;  4Z4G A;  2O8B A;  4KTZ A;  4FVU A;  1W0H A;  5HLF A;  1KD1 O;  1TK0 A;  3SCX A;  1YJW N;  4BRL A;  3CJA A;  2KLA A;  3D2E B;  3MEE A;  3F2K A;  4OPA A;  4X64 K;  1QZ6 A;  1HRH A;  3QEP A;  3TAM A;  1KSP A;  5AQL A;  5EX5 A;  3RSE A;  4G9Z A;  2ZJP L;  3PO4 A;  3VA0 A;  3EKU A;  3WNE A;  5HRP A;  1B9D A;  3CHW A;  1ZXO A;  4JKC A;  5TKY A;  2E2Q A;  5M1K A;  1VQK N;  5BRD A;  5GIP A;  3WNG A;  2QM1 A;  4OPH A;  4CZE A;  2E1Z A;  1RBR A;  3NGY A;  3P38 A;  1Q9X A;  2Z1H A;  1WB9 A;  1DTQ A;  1QS4 A;  1HPM A;  5MLC Q;  4CEE A;  1DEJ A;  3VQ8 A;  4KPY A;  2VGN A;  5ADX A;  4MLE A;  4MDA A;  3J7Z O;  1BQM A;  1TYQ A;  3NDK A;  4BDZ A;  2XY5 A;  2B4J A;  2HBM A;  5AQS A;  4ILG B;  1J53 A;  1RGI A;  3AVC A;  4BE2 A;  4WFN L;  3TTC A;  1KCF A;  1FJG K;  5CE3 A;  2I7N A;  4BR7 A;  3HYF A;  1YIJ N;  2Z1J A;  4BE1 A;  2ATQ A;  3OS0 A;  4IG0 A;  2HHX A;  3G4S N;  4J2A A;  3ID8 A;  4NCA A;  3EE9 A;  3KWI A;  4O44 A;  1QTM A;  2OPQ A;  3OYG A;  4BR5 A;  4DUY K;  4X65 K;  3PSI A;  3VTI A;  1U04 A;  4KHU A;  4M3R A;  3CF5 L;  3CER A;  4EP4 A;  1JCF A;  4W5R A;  3THX B;  3VF4 A;  3S41 A;  1NK8 A;  4EHT A;  1VQL N;  4FWP A;  4JI7 K;  3VQ5 A;  3ZSR A;  1HNZ K;  3H08 A;  4CBX A;  4DTP A;  1Q81 O;  2LSN A;  3TTD A;  2HND A;  1MA9 B;  2KKZ A;  4PA1 A;  4YFU A;  4J2D A;  4GV9 A;  1U48 A;  3OVN A;  1WAJ A;  3QES A;  4CD1 A;  2PYJ A;  1Y64 A;  3ZLJ A;  4HCC A;  3AVM A;  5KRS A;  3J81 O;  4BC3 A;  1JXB A;  2CGK A;  2DFF A;  2GEM A;  3CQ8 A;  4DHY A;  1EET A;  3C7N A;  3GOI A;  4JKA A;  4B1W B;  2O8F A;  4BRK A;  3H1V X;  1S1W A;  4RW6 A;  4FM1 A;  4LFC K;  5A2Q O;  5J2M A;  3BZK A;  2ZM6 K;  3ULD A;  4FZY A;  3MED A;  1X3N A;  3KKS A;  2A41 A;  4FWS A;  1VRU A;  4I2P A;  1FK9 A;  4YOR A;  1BCO A;  1LOT B;  2VG5 A;  4H0Y B;  4JKF A;  3AVB A;  4DSJ A;  3EZ5 A;  2O8E A;  2P9L B;  3EN9 A;  4LC9 B;  1K73 O;  2V7Y A;  4GV3 A;  2DTU A;  1RTD A;  1RDU A;  2HW3 A;  5LJV A;  4FOE A;  4OKJ A;  5AFU A;  3T1H K;  1X9J A;  3SMP A;  4AHT A;  5HRN A;  3QNN A;  3C7N B;  1VSH A;  3DXM B;  3Q7B A;  1NLV A;  3AVG A;  2QWO A;  3ATV A;  1VQ4 N;  5ADX H;  2B6A A;  3M8P A;  2O8D B;  3VMF B;  4CIE A;  3QEV A;  4B9U A;  2QW9 A;  1S72 N;  1C0G A;  3IKM A;  1NJW A;  1NOY A;  3HOT A;  4JS4 A;  4N56 A;  5GAD P;  2OPR A;  2OA8 A;  2WUS A;  3OYK A;  3DJC A;  4KHP K;  4LF5 K;  5CYQ A;  3K59 A;  2O8E B;  3VQE A;  4BWJ A;  2IAJ A;  4BDY A;  1JCG A;  3HP9 A;  3UB5 A;  4WQ5 C;  3AVA A;  5FRO A;  4CJL A;  5AQZ A;  3OYI A;  2XY6 A;  1RIL A;  1TL3 A;  1YUW A;  4NYN A;  2XRI A;  2RPI A;  3CFR A;  1LWC A;  2A1S A;  5GIN A;  3HI0 A;  5AZJ B;  4FSV A;  1WSH A;  3A5N C;  3THX A;  1YHQ N;  1VQN N;  5KPZ A;  1HKB A;  1IH7 A;  2D0B A;  3SUP A;  2XO7 A;  1EO1 A;  3MK6 A;  2QKB A;  2CH5 A;  3P5J A;  3R3L A;  4YOW A;  3TAQ A;  4DQS A;  3IUC A;  1NU0 A;  2NNW A;  4FWO A;  2QXF A;  2O4G A;  5C25 A;  4BRM A;  1BCM A;  1M1K O;  4K42 A;  5EU7 A;  4JI6 K;  4CEF A;  1I3A A;  3MN7 A;  3RMB A;  1N6Q A;  3QML A;  4H0V B;  4IO8 A;  1K8A O;  1WOQ A;  1D5A A;  3LDQ A;  5ELZ A;  3T69 A;  4CEZ A;  4W5N A;  4EHU A;  2ETJ A;  4R79 A;  2A42 A;  3L4Q A;  3ENH A;  5JLH A;  1G99 A;  5M1P A;  1QVG M;  3AA4 A;  4CHY A;  1LV5 A;  3H45 C;  1NGB A;  3DLE A;  1SUQ A;  4EIA A;  4FJ5 A;  1OVY A;  1QQN A;  3OS1 A;  3SV4 A;  4JKG A;  4AQY K;  2Q0R A;  5EY4 A;  3SMS A;  2UUA K;  1QQO A;  3QIP A;  2NRW A;  3MN9 A;  1IBL K;  3QIC A;  1HR0 K;  3AVH A;  2QKK A;  5LMU K;  3I56 N;  1R0A A;  1NGF A;  1NGD A;  4CED A;  4BGB A;  2D0C A;  3V1O A;  4JD2 A;  3CI5 A;  4EFH A;  4E0D A;  5DM7 L;  3T7Z A;  3O6W A;  4MDB A;  4CF9 A;  3DXM A;  2IDO A;  4DR7 K;  1EKE A;  3HVT A;  3TAF A;  2G8V A;  4JKD A;  3TR8 A;  4I9Q A;  3O9R A;  4L3Q A;  2O8C B;  3AVL A;  4B9S A;  2B5J A;  3KK2 A;  1EWQ A;  2BDP A;  2NZT A;  3ALY A;  1VQM N;  4E19 A;  4CFC A;  3D2E A;  3NAE A;  3LP0 A;  2BTF A;  3VTH A;  5FDL A;  3EKS A;  4F8R A;  3CCU N;  4DG1 A;  3MCA B;  2QXL A;  3A5O C;  2Q31 A;  4NB4 A;  4CHZ A;  4CZG A;  4NXM K;  4CJW A;  2X6S A;  2A1R A;  2NRR A;  2F9W A;  4JKB A;  1DKG D;  2P9S B;  3KLI A;  2X74 A;  3ZET A;  1WNS A;  4DV5 K;  2YHB A;  3EY1 A;  1RDB A;  1CZB A;  4N5S A;  3HST B;  3PY8 A;  2P5O A;  3OJU A;  3E01 A;  3VA3 A;  2AA4 A;  5I42 A;  1I94 K;  4C1N I;  5BPL A;  3O4Q A;  4KHY A;  3KJV A;  3K58 A;  4JK9 A;  1JLQ A;  4AM6 A;  4E7I A;  4TSX A;  2D0A A;  4A5A A;  4Z4E A;  4I6M A;  1TK5 A;  1BA0 A;  1IBK K;  4CF1 A;  4CEC A;  4CD3 A;  1JLE A;  3CME N;  4Z4C A;  4AF1 A;  2P9K B;  5FPD A;  4MFB A;  4DV7 K;  1VQO N;  1TK8 A;  4B9M A;  4JHD A;  4ID1 A;  2A40 A;  2W6K A;  4L8R B;  4OLA A;  3EZW A;  4DB3 A;  1T6D A;  2JGU A;  4X66 K;  3CCQ N;  3QFP A;  1NGG A;  3ZX0 A;  4UQG A;  4KB1 A;  4ELV A;  3RRH A;  4PUO A;  2QI2 A;  1CXQ A;  3C6U A;  4K25 A;  3HOS A;  3SAH A;  1CZA N;  3TU5 A;  2BAN A;  3VGM A;  3SI6 A;  1KQS M;  4C8L A;  3KD5 E;  5JS1 A;  2P51 A;  5DK5 A;  5AQX A;  3CYM A;  2Y1J A;  1RT6 A;  2P9P B;  3ZT0 A;  1EQY A;  4QAG A;  1CXU A;  1BQN A;  3TTF A;  3A5M C;  4FL9 A;  4DCH A;  4FJJ A;  3NF7 A;  1NNE A;  3QO9 A;  3SV3 A;  1DLO A;  4CJF A;  1NKB A;  5LL6 Z;  1TAU A;  5JMV A;  3DWL A;  3UKU A;  4PHT X;  5SZT A;  5KGW A;  2OPS A;  1IG9 A;  3HJF A;  3AVF A;  4CJ3 A;  4EAH D;  4FJH A;  2Q1N A;  4DU1 A;  4AHC A;  3VEZ A;  1U2V A;  3FR0 A;  1P90 A;  2KQ2 A;  1QHA A;  4CGF A;  1T3V A;  4IFE A;  3CCJ N;  4DTO A;  1KC8 O;  2P9I A;  4HTL A;  1YTA A;  2BE2 A;  4ZHR A;  1RT4 A;  1BI4 B;  3SUN A;  2O8F B;  3EO3 A;  1O13 A;  3DRS A;  3OYD A;  4IBN A;  1ATR A;  3LDS A;  3THW B;  1XWL A;  3CET A;  4DF4 A;  3LP2 A;  4B3M K;  1XHX A;  5LY3 A;  2P9S A;  2CGL A;  1BHL A;  4BRP A;  3M8S A;  2ZQB A;  3AO1 A;  4FWL A;  3NH1 A;  4KHW A;  4A57 A;  4CHQ A;  4JNE A;  2QEX N;  1RBV A;  1RBS A;  2YHA A;  1S3X A;  4C1N K;  3K9J A;  1U2V B;  4DFJ A;  1TKX A;  4NO7 A;  1Q9Y A;  5BN9 A;  1N36 K;  4MQ3 A;  3MX5 A;  3VGL A;  3C6T A;  1QSL A;  3MXM A;  1NOZ A;  3OJS A;  1IKX A;  3T1Y K;  3LAL A;  4CJ7 A;  2E5L K;  3DLH A;  2Z1I A;  4IEI A;  4XH5 A;  1HYZ A;  3LWM A;  3L2R A;  2QWL A;  1KRP A;  4JEP A;  4DU4 A;  3DOL A;  5B8H A;  3HM9 A;  3VQA A;  1ASW A;  3OS2 A;  3U9Z A;  3CPE A;  1RDA A;  1WSG A;  3NHG A;  2HHT A;  4ELU A;  2VQF K;  1A5V A;  3O5B A;  3O3F A;  1L3T A;  1G15 A;  4CF0 A;  1YJ9 N;  2F8T A;  4FLT A;  4CVN E;  4HUG A;  2V7Z A;  4FM0 A;  4IDK A;  4E7H A;  4OO1 J;  5AQP A;  4CEQ A;  1HYV A;  4M3Z A;  3AV9 A;  3U4L A;  1KAX A;  3C65 A;  4M7X A;  3OYH A;  5AZJ A;  3C6A A;  4J2B A;  4PQU A;  1UWB A;  4DSK A;  2HHH K;  1BO5 O;  5FPN A;  4CEA A;  1LW0 A;  3FZL A;  3LM9 A;  1JLC A;  1IKV A;  1QQM A;  4CJQ A;  3RR7 A;  3WEE B;  3S3N A;  1XI1 A;  2H3G X;  5KI6 A;  1NGI A;  1QZ5 A;  2Q36 A;  2YI1 A;  2GV9 A;  4FVM A;  5K14 A;  2HNZ A;  3AA3 A;  1ATS A;  4Y1D A;  1E4F T;  2X78 A;  4LFA K;  5BR9 A;  2XHB A;  3R6M A;  3SBG A;  1JL2 A;  5CY4 A;  1NBW A;  3QBX A;  4AIL C;  4XIU A;  3GG4 A;  5J1E A;  3ATU A;  2ASO A;  3LDL A;  5EVZ A;  1A5W A;  1YAG A;  4O5B A;  3BF1 A;  2CH6 A;  1L3S A;  1GLJ O;  3VET A;  4ISE A;  2Q3S A;  4CI6 A;  2ITM A;  3AVI A;  3K2P A;  1HJO A;  4CJS A;  1J5O A;  3L3U A;  1RDD A;  1Z6R A;  3L2W A;  1F21 A;  2X6N A;  3U9D A;  3V1R A;  1Z26 A;  3O3G A;  1W2B M;  3PIP L;  3M8Q A;  4B3S K;  4ID5 A;  1EWR A;  3KK7 A;  2I5J A;  4M3Y A;  2BGG A;  3WQT A;  3I8B A;  2P5G A;  1K6Y A;  3T3F A;  3I55 N;  4JS5 A;  1HNX K;  1B92 A;  1VHX A;  3O9U A;  3D45 A;  5HBM A;  4E1N A;  4CJR A;  2VYP A;  1TKD A;  4CES A;  3O08 A;  1VK0 A;  4KH5 A;  2QWM A;  3KK3 A;  1U4B A;  3G0Z A;  5FRN A;  4E89 A;  2VGM A;  3VF6 A;  3DXK B;  5HP1 A;  3L4I A;  1ZBS A;  2P9L A;  4LH4 A;  4Q0B A;  1JXE A;  3HPH A;  1LWE A;  4F3T A;  4RTF D;  1HNV A;  2IIR A;  3SYZ A;  3CXC M;  3V9W A;  5AZI A;  2QWR A;  1JLA A;  1L3V A;  3DLB A;  2XY7 A;  2RKI A;  1XMO K;  3ZT4 A;  4JI5 K;  2QWP A;  4CHP A;  4BQL A;  4JRP A;  3EL2 A;  2UUB K;  4O4G A;  3IRX A;  3D0P A;  1NGE A;  1TYQ B;  1NMN A;  4O55 A;  4C8M A;  3THY A;  4CGG A;  1J9A A;  3VF2 A;  4W5O A;  2IGI A;  4BG9 A;  1VQ9 N;  4MO5 A;  4F2S A;  1DGK N;  3KIO A;  4YOV A;  1VSD A;  1MWK A;  1U45 A;  5HRO A;  4CCH A;  5CZ1 A;  1QE1 A;  1J6Z A;  3TSU A;  1HUX A;  4RW9 A;  1NJI O;  4CBU A;  3LDN A;  4CJ4 A;  1LAV A;  1D9D A;  4AHU A;  4B8C A;  1C0U A;  1YI2 N;  3SPY A;  1UOC A;  4GKJ K;  3JSM A;  1B9F A;  2FBX A;  2E2P A;  1RNH A;  2YHW A;  5F0X A;  1RBU A;  1NKE A;  1ESV A;  3WXL A;  4JI0 K;  2HBK A;  4FOI A;  1EXQ A;  5C42 A;  3K9K A;  2RN2 A;  4F9O A;  1YJN N;  4RW7 A;  3TSP A;  3OYJ A;  4MO4 A;  5DMR A;  4CZH A;  1WBD A;  1N32 K;  5HL7 L;  1WUA A;  2IVO A;  4J8F A;  1OVQ A;  1XC3 A;  1IKW A;  2E2N A;  4CZI A;  2E8A A;  3S9H A;  4FJX A;  3KTQ A;  3P1G A;  3GDQ A;  5JLF A;  2GUP A;  3OY9 A;  4FLZ A;  5HRS A;  4OKK A;  4JKE A;  1GOA A;  1RTH A;  3CFP A;  2HHQ A;  4LD0 A;  1FKP A;  1HJR A;  1OH7 A;  1KLM A;  3TWH A;  3ZEU B;  2IS3 A;  3U3Y A;  4CER A;  5JIC A;  3WXI A;  2GWK A;  3CIP A;  4X62 K;  1REV A;  1T44 A;  3CJ7 A;  2WC9 A;  3VES A;  3VEX A;  5FPE A;  2HMP A;  5FRM A;  3V9U A;  5C0Y A;  3KZB A;  4CZL A;  1T8E A;  3B8A X;  2ZD1 A;  4HHT A;  4JV5 K;  3KVG A;  2KFN A;  1SZ2 A;  1RFQ A;  4BVO A;  3OHR A;  3K5O A;  4U67 L;  1YIT N;  3F5T A;  4M3X A;  2E6L A;  1K8K A;  2O8B B;  3WUH A;  5C2D A;  1T6C A;  3MDQ A;  3HBT A;  3V9X A;  1NK9 A;  4CJE A;  4KHQ A;  4B9L A;  1W9H A;  4N76 A;  1J5E K;  3VEN A;  4H03 B;  3NH2 A;  1NMD A;  1Q8I A;  2F8S A;  2HHV A;  3HO1 A;  3AVK A;  4LF7 K;  4FZZ A;  2P9N B;  4QS7 A;  1L3U A;  2BUP A;  2A3Z A;  4H4O A;  3SJJ A;  2UXD K;  1IV0 A;  4DTX A;  5GAH P;  4LSL A;  5GIO A;  1WAF A;  4YOU A;  3R8E A;  2FBT A;  2ZGY A;  4B1Z A;  2DFE A;  3ULE A;  4IZ9 A;  3DOK A;  4WQ4 A;  4LSN A;  2ZJR L;  5JVH L;  2PFU A;  1BIZ A;  3V4I A;  3AO5 A;  3SJH A;  3OYC A;  3O8M A;  4KAZ A;  3ID6 A;  1M90 O;  1MWM A;  2EHG A;  4O8U A;  1O1W A;  3TAG A;  4BRC A;  3L2V A;  2FBY A;  1V4T A;  3ENB A;  1KVA A;  5AQG A;  5HOO A;  2P9U A;  1QVF M;  3C94 A;  4BRH A;  2HMI A;  3PX4 A;  4DFM A;  1RDC A;  4DUZ K;  3HRG A;  4GW6 A;  3CJC A;  4XEI A;  4DQI A;  1JLF A;  1GLD G;  2F9T A;  1D4X A;  3WXM B;  1RT5 A;  3P39 A;  3AAR A;  4FLY A;  3ZSX A;  2W6L A;  3WT0 A;  4Z0U A;  2Q0U A;  3IDH A;  4FWM A;  4CK1 A;  1YF5 L;  2G8K A;  3S3O A;  1QQC A;  1N34 K;  2Q2R A;  4JN4 A;  1TVR A;  2GWJ A;  3RRG A;  5BPM A;  4GY2 B;  4N47 A;  3SPZ A;  1A5X A;  4M3U A;  3HXM A;  3K5M A;  1YTU A;  4CHO A;  4CGJ A;  3VOV A;  3SNN A;  4WFB L;  4H5R A;  4LF8 K;  4CK2 A;  4GV6 A;  4DU3 A;  3JS6 A;  3CQY A;  1VSM A;  3I8D A;  3HT3 A;  1YVU A;  5AQK A;  1HQU A;  4Z4F A;  2IVP A;  3U8X A;  3W3D A;  3VQ6 A;  4OKE A;  4JI8 K;  1K9M O;  4E1J A;  3P83 D;  1SAZ A;  3JXU A;  2KTQ A;  4FZX C;  3I0S A;  5JS2 A;  3QER A;  3SQ4 A;  3CFO A;  3LWL A;  4O8K A;  4FJK A;  3NH0 A;  2QWQ A;  1RTI A;  2P9I B;  4FLW A;  5FLX O;  2OTL N;  1HX1 A;  1KVB A;  1S5J A;  4DQQ A;  3LAM A;  3VEW A;  2FLO A;  2O8C A;  1QSY A;  3FFI A;  3NVM A;  5AQI A;  3ZT3 A;  3OYM A;  4DWI A;  4FWK A;  2ZE2 A;  3C6H A;  3TAR A;  4JI3 K;  1S1T A;  1NJX A;  4A62 A;  1Y97 A;  4CZJ A;  2FF3 B;  1GOB A;  2YNI A;  4BRQ A;  4DTJ A;  3N4Q A;  1WN7 A;  3WXJ A;  5GAG P;  2I7P A;  4YDU A;  2WFB A;  1S1V A;  3NF8 A;  1GLF O;  4NYF A;  3THV A;  2VWK A;  4M42 A;  3E9P A;  4CZF A;  4FK4 A;  3O4N A;  3UKU B;  3M5R A;  4Q5V A;  5AZI B;  1N8R O;  2AJQ A;  5AQM A;  1C0M A;  3IMX A;  4WYB A;  1X3M A;  4IWV A;  3RVC A;  2Z1G A;  4BRI A;  4CFA A;  3BY5 A;  2YNG A;  4AM7 A;  4AHR A;  4HWI A;  4E7K A;  4DSL A;  5J2N A;  3R1X A;  3SK3 A;  1VSE A;  2OPP A;  4RW4 A;  4I9L A;  4DQR A;  1NGC A;  1GLC G;  4GKK K;  4CEO A;  2F7T A;  1MDU B;  1SL2 A;  3NVK A;  3OYA A;  3SQ0 A;  4FJ8 A;  4BC4 A;  3T1A A;  3THY B;  1NG9 A;  4OPJ A;  4CE9 A;  4BRF A;  1LCU A;  4JAX A;  4FYD A;  3AA5 X;  4RWT A;  1TGO A;  2P1J A;  1JLB A;  4ZTJ A;  5BR8 K;  1NK0 A;  1UAX A;  4BC5 A;  2Y1I A;  3SZ2 A;  2FSK A;  1BUP A;  3DAW A;  4FCY A;  1S1X A;  2GBZ A;  3RTV A;  1BL3 A;  1S6Q A;  1J54 A;  4ISG A;  1C6V A;  1KTQ A;  1RDW X;  3ENO A;  2IC3 A;  3QFU A;  2RF2 A;  3CJ9 A;  2PYL A;  3O80 A;  2VCP A;  4JLH A;  2JWL A;  1NK5 A;  3CCR N;  1WSJ A;  2P9P A;  2E6M A;  2WOM A;  3RWU A;  5M1N A;  4NCB A;  3K5L A;  2OYQ A;  1Q18 A;  1BG3 A;  4I7F A;  4K8X A;  3AO3 A;  1S1U A;  3A8Y A;  2IVN A;  4YNQ A;  4JRQ A;  2NRT A;  3TAN A;  4E1M A;  4FLU A;  2HVI A;  2ASP A;  1R59 O;  4JYA K;  4DSE A;  2PBD A;  1GLE G;  3CMA N;  2W42 A;  3SQ1 A;  2ZJQ L;  4OX9 K;  3WNH A;  4DR3 K;  4OVL A;  1DT9 A;  5AR0 A;  4UY8 O;  3KLH A;  3AGR A;  4CGD A;  1TUY A;  3BP8 A;  2D0O A;  3CM5 A;  4PKI A;  5AQR A;  1KVC A;  1HQE A;  1XNR K;  2BH1 A;  1LAW A;  4PY5 A;  4IJN A;  3LZJ A;  3BUZ B;  3ZT2 A;  4PL8 A;  1S9G A;  1VQ6 N;  1CLQ A;  4IOA L;  2FF6 A;  2HNY A;  3THW A;  3A2F A;  4FK2 A;  3H3O B;  5F2R A;  5AQQ A;  5EXW A;  2WBN A;  3LL3 A;  3MX2 A;  3TI0 A;  4B8A B;  3G25 A;  2OAN A;  3O9Q A;  3VN5 A;  3BEX A;  1VQ8 N;  4QCL A;  3ZSQ A;  3CM6 A;  2Q97 A;  1NGA A;  5AQF A;  3I0R A;  4LY7 A;  2FSJ A;  3CCE N;  4FPB A;  1K8K B;  3KD1 E;  3FE1 A;  5M1Q A;  5BRF A;  1HNW K;  4FLV A;  3SBT A;  2DPN A;  2KW4 A;  3AGK A;  3P4I A;  1JL1 A;  1OH6 A;  3OYE A;  3UKR A;  2NLX A;  4BR2 A;  3H6E A;  4ICL A;  1TKT A;  3Q7C A;  3A0I X;  5IWA K;  4DV3 K;  4KRF A;  4KKO A;  1RT2 A;  1ZBU A;  3HP6 A;  4FJN A;  1JKH A;  4WFA L;  3F9K A;  2WTU A;  4M3W A;  3BDP A;  3KLF A;  1UA0 A;  1XMQ K;  3ZX3 A;  4KTQ A;  4B3O A;  1VRT A;  5E26 A;  3BGR A;  1XC9 A;  3TSQ A;  5H1S Q;  4B9Q A;  3AO4 A;  4BR0 A;  1MU2 A;  1Z05 A;  1S22 A;  3WQU A;  1KAY A;  3OTO K;  4NXN K;  3U3G A;  1VQ7 N;  4QS8 A;  4H0O A;  3D2F A;  1BOT O;  2ZGZ A;  5T7B A;  4DTN A;  1KFS A;  3DRP A;  5BRH A;  2FXU A;  4FW1 A;  4DR2 K;  3RSE B;  3CC7 N;  5JVG L;  4HCB A;  4CF2 A;  4E7J A;  1BGX T;  3MWT A;  4A5B A;  2O8D A;  4H0T B;  4CJT A;  4JHD B;  4CJK A;  3DXK A;  4KHN A;  4V19 S;  3FZM A;  4JK8 A;  1HKC A;  3T19 A;  3RMC A;  4YOX A;  4CBW A;  4DTR A;  2HHW A;  3TPQ A;  3GBT A;  4Z4H A;  5M1F A;  4DTS A;  2NRZ A;  4DMN A;  1C0T A;  4O5F A;  1QHT A;  4HTU A;  3ZSV A;  4Y1C A;  3A5L C;  3CJ1 A;  4KB0 A;  4JI4 K;  1ATN A; 
#chains in the Genus database with same CATH homology
 4B9S A;  2B5J A;  4CIF A;  3V9Z A;  4CER A;  3U3Y A;  3KK2 A;  3HVR A;  2BDP A;  4HUF A;  3ALY A;  3HK2 A;  4E19 A;  4BWM A;  1REV A;  2YKM A;  4CFC A;  2KZZ A;  3NAE A;  3LP0 A;  4Z4I A;  2EX3 A;  1ZBI A;  4CJ5 A;  1D9F A;  4FJM A;  5FDL A;  1WSI A;  2G8F A;  5FRM A;  3V1Q A;  3V9U A;  3SQ2 A;  4F8R A;  2OZS A;  4DG1 A;  3B6O A;  1RTJ A;  4FW2 A;  1T8E A;  2ZD1 A;  4HHT A;  4K8Z A;  2KFN A;  4CHZ A;  3NGZ A;  4B9N A;  2XY8 A;  3K5O A;  4FJ9 A;  4CJW A;  3VQB A;  2X6S A;  2A1R A;  1HNI A;  4DFP A;  4FJG A;  4DS5 A;  4M3X A;  2E6L A;  3HPG A;  1ASV A;  3KLI A;  4OJR A;  4KFB A;  2PZS A;  4J2E A;  2F96 A;  2X74 A;  1WNS A;  2FBV A;  2YHB A;  4H4M A;  1N5Y A;  3EY1 A;  1RDB A;  1RCH A;  3V9X A;  3DLG A;  1NK9 A;  4CJE A;  2G8I A;  1CZB A;  4KHQ A;  4B9L A;  4N5S A;  3HST B;  3PY8 A;  2P5O A;  1W9H A;  3OJU A;  3E01 A;  3VA3 A;  4N76 A;  2YNH A;  1BIU A;  5I42 A;  4DSI A;  4W5Q A;  1FXX A;  3O4Q A;  3NH2 A;  1Q8I A;  4KHY A;  3KJV A;  3L2Q A;  3K58 A;  3AVJ A;  2F8S A;  2D5R A;  1JLQ A;  4IFY A;  3HO1 A;  2OZM A;  2HHV A;  3AVK A;  4OGC A;  4E7I A;  4TSX A;  4FZZ A;  4DTU A;  2D0A A;  3VQC A;  4F4K A;  1D8Y A;  1L3U A;  4Z4E A;  3IG1 A;  4M3W A;  1WSF A;  1C1C A;  1TK5 A;  4B08 A;  4H4O A;  3SJJ A;  1RT1 A;  1QSS A;  4CF1 A;  4CEC A;  1U47 A;  4DTX A;  1JLE A;  1C1B A;  2KZM A;  1KFD A;  4Z4C A;  1Z25 A;  4LSL A;  4DTM A;  1KLN A;  3ZCM A;  4AHS A;  1WAF A;  4MFB A;  4G1Q A;  3KLG A;  5J2Q A;  2FBT A;  1TK8 A;  4GMJ B;  4CEB A;  4B9M A;  2DFE A;  3DLR A;  4CF8 A;  3CG7 A;  3DOK A;  4ID1 A;  3QLH A;  4LSN A;  4LH5 A;  4L8R B;  3MEG A;  3MAQ A;  4OLA A;  3NF6 A;  2JGU A;  1ZBF A;  3IS9 A;  1BIZ A;  4OPK A;  3NGI A;  3V4I A;  3O3H A;  4UQG A;  4F3O A;  1HYS A;  1ASU A;  2ITG A;  3AO5 A;  4KB1 A;  1TL1 A;  3OYC A;  4KAZ A;  3MXJ A;  3RRH A;  4ELV A;  4KI6 A;  4DQP A;  4PUO A;  1CXQ A;  3QEX A;  3C6U A;  2EHG A;  1O1W A;  3C95 A;  4WE1 A;  2BAN A;  2R7Y A;  3QET A;  3TAG A;  3L2V A;  2FBY A;  3SI6 A;  5I3U A;  4OLB A;  1SKS A;  2HB5 A;  3NFA A;  1KVA A;  1S6P A;  2VWJ A;  1SKW A;  4C8L A;  3KD5 E;  1L5U A;  1IO2 A;  5JS1 A;  2P51 A;  5DK5 A;  4QOZ B;  4PWD A;  3C94 A;  1SL1 A;  4B9T A;  5KTQ A;  3CYM A;  3PX4 A;  2Y1J A;  2G8W A;  4DFM A;  1RT6 A;  1RDC A;  3ZT0 A;  2HMI A;  4GW6 A;  2KFZ A;  4KRE A;  3NF9 A;  1HPZ A;  4QAG A;  1DTT A;  4DQI A;  1JLF A;  1CXU A;  1BQN A;  1C1A A;  1NK6 A;  2O4I A;  1U49 A;  4E3S A;  1RT5 A;  4FJJ A;  4O0I A;  3NF7 A;  1ZBL A;  4FLY A;  3ZSX A;  3NCI A;  3QO9 A;  2FC0 A;  3OYN A;  3SV3 A;  3SYZ A;  1ITG A;  4Z0U A;  1DLO A;  1EP4 A;  4GVM A;  4CJF A;  1NKB A;  1TAU A;  2IOC A;  4CK1 A;  3TAE A;  1X9S A;  4W5T A;  2G8K A;  2PY5 A;  3PX6 A;  3S3O A;  1QQC A;  5J2P A;  5SZT A;  1WLJ A;  5KGW A;  2OPS A;  3PV8 A;  4AH9 A;  1TVR A;  1IG9 A;  4H8K A;  3HJF A;  3AVF A;  4CJ3 A;  4FJH A;  1VSJ A;  3RRG A;  4Z4G A;  4CIG A;  4KTZ A;  4N47 A;  4DU1 A;  3SPZ A;  4AHC A;  1A5X A;  4M3U A;  2KQ2 A;  4CGF A;  3AVN A;  1W0H A;  4DTO A;  5HLF A;  3HXM A;  3K5M A;  1YTU A;  1TK0 A;  4CHO A;  3OYB A;  3SCX A;  1YTA A;  2BE2 A;  4ZHR A;  1RT4 A;  1BI4 B;  3MEE A;  4CGJ A;  3SNN A;  2VG6 A;  4CK2 A;  3SUN A;  4DU3 A;  1VSM A;  3I8D A;  1HRH A;  3HT3 A;  3QEP A;  1S9E A;  1YVU A;  3TAM A;  1HQU A;  3DRS A;  1KSP A;  4Z4F A;  3LPU A;  3OYD A;  3DM2 A;  4IBN A;  3VQP A;  4CGI A;  4IG3 A;  1EX4 A;  1YT3 A;  3ZT1 A;  3LDS A;  3DLK A;  3PO4 A;  1XWL A;  3RR8 A;  3VA0 A;  4I2Q A;  3VQ6 A;  1NJZ A;  4B9V A;  4OKE A;  4DF4 A;  3WNE A;  3LP2 A;  5HRP A;  1B9D A;  1XHX A;  3P83 D;  4EZ6 A;  2WON A;  1BHL A;  3M8S A;  1X1P A;  2ZQB A;  2KTQ A;  3AO1 A;  3NBP A;  4FZX C;  3NH1 A;  4DFK A;  3WNG A;  4KHW A;  4CHQ A;  3I0S A;  5JS2 A;  3QER A;  1RBV A;  1RBS A;  2YHA A;  3SQ4 A;  3CFO A;  1VSK A;  3LWL A;  1RBR A;  3NGY A;  4DFJ A;  4FJK A;  3NH0 A;  1Q9X A;  1TKX A;  1Q9Y A;  1RTI A;  2Z1H A;  3LPT A;  4MQ3 A;  4FLW A;  1DTQ A;  1QS4 A;  1KVB A;  4CEE A;  3C6T A;  1QSL A;  1S5J A;  1NK4 A;  4DQQ A;  3VQ8 A;  3MXM A;  4KPY A;  4F2R A;  1NOZ A;  3LAM A;  1T7P A;  3OJS A;  1IKX A;  1BQM A;  3LAL A;  4E7L A;  4BDZ A;  3NDK A;  4EP5 A;  3DLH A;  1QSY A;  2XY5 A;  2Z1I A;  3FFI A;  1HYZ A;  2B4J A;  3VQ4 A;  3LWM A;  3L2R A;  1KRP A;  1JLG A;  1J53 A;  4DU4 A;  3ZT3 A;  3DOL A;  3OYM A;  3DYA A;  3AVC A;  3HM9 A;  4BE2 A;  4DWI A;  3VQA A;  1KCF A;  2ZE2 A;  3HL8 A;  3TAR A;  1S1T A;  1NJX A;  2YNF A;  3L2U A;  1Y97 A;  1ASW A;  3OS2 A;  3HPO A;  3KK1 A;  3HYF A;  1GOB A;  1RDA A;  1WSG A;  2YNI A;  3NHG A;  4DTJ A;  2HHT A;  1WN7 A;  3U6F A;  2Z1J A;  4BE1 A;  4ELU A;  2ATQ A;  1A5V A;  3O3F A;  1L3T A;  1TAQ A;  1S1V A;  1G15 A;  3NF8 A;  4IG0 A;  3OS0 A;  3SUO A;  4KI4 A;  2HHX A;  4J2A A;  4NCA A;  4NYF A;  4CF0 A;  3THV A;  4O44 A;  2VWK A;  2F8T A;  4FLT A;  2GUI A;  4M42 A;  1TKZ A;  1QTM A;  4HUG A;  4FK4 A;  2OPQ A;  3OYG A;  3O4N A;  5C24 A;  4FM0 A;  4IDK A;  4Q5V A;  4E7H A;  3S3M A;  2AJQ A;  1C0M A;  2YV0 X;  4CEQ A;  1HYV A;  2Z1G A;  2E4L A;  4HUE A;  4M3Z A;  3AV9 A;  4CFA A;  3LP3 A;  4M41 A;  1U04 A;  3OYH A;  1T03 A;  4KHU A;  2YNG A;  4DSF A;  4AHR A;  4J2B A;  4KV8 A;  4E7K A;  1UWB A;  4M3R A;  4PQU A;  4DSK A;  5E41 A;  4DSL A;  3F73 A;  5J2N A;  4EP4 A;  4W5R A;  1BI4 A;  1VSE A;  2OPP A;  4RW4 A;  4I9L A;  3LZI A;  4DQR A;  4DF8 A;  1NK8 A;  4CEO A;  2G8H A;  4CEA A;  1LW0 A;  3VQ5 A;  3ZSR A;  3H08 A;  1SL2 A;  1LW2 A;  3OYA A;  3OYF A;  3ASM A;  1JLC A;  1IKV A;  1VSF A;  4CJQ A;  3SQ0 A;  4DTP A;  4FJ8 A;  1FKO A;  3T1A A;  2LSN A;  4J2D A;  2HND A;  4CJP A;  4PA1 A;  4OPJ A;  4YFU A;  4FLX A;  3RR7 A;  4CE9 A;  1TV6 A;  3S3N A;  3LAN A;  3OVN A;  1WAJ A;  3QES A;  1XI1 A;  1U48 A;  4DLG A;  4FYD A;  5KI6 A;  2PYJ A;  4HCC A;  3AA5 X;  1TGO A;  2P1J A;  3AVM A;  1JLB A;  4RG8 A;  5KRS A;  4ZTJ A;  1RBT A;  1T05 A;  1NK0 A;  1UAX A;  2GV9 A;  4FVM A;  1UA1 A;  1JXB A;  2Y1I A;  5K14 A;  2HNZ A;  2DFF A;  3ZSY A;  3CQ8 A;  3SZ2 A;  3AA3 A;  4Y1D A;  1EET A;  2X78 A;  4FCY A;  1S1X A;  2XHB A;  2GBZ A;  3RTV A;  1BL3 A;  1S6Q A;  1GOC A;  4HVJ A;  5D3G A;  4FJ7 A;  1J54 A;  1JL2 A;  1S1W A;  4RW6 A;  5CY4 A;  4R5P A;  4FM1 A;  4CHN A;  4AIL C;  4XIU A;  1C6V A;  5J1E A;  5J2M A;  1KTQ A;  2PYL A;  2IC3 A;  2RF2 A;  3ULD A;  1SKR A;  1A5W A;  4FZY A;  3MED A;  3QEI A;  4O5B A;  1ZYQ A;  4JLH A;  1NK5 A;  3KKS A;  1HMV A;  2DFH A;  4I2P A;  1VRU A;  1WSJ A;  1FK9 A;  1L3S A;  1BCO A;  2VG5 A;  2E6M A;  2WOM A;  3VQQ A;  3RWU A;  2Q3S A;  4CJU A;  3AVB A;  4FM2 A;  4DSJ A;  3EZ5 A;  3AVI A;  3K5L A;  3K2P A;  4DLE A;  2OYQ A;  3IAY A;  4NCB A;  4I7F A;  4K8X A;  4CJS A;  1J5O A;  3L3U A;  2DTU A;  3AO3 A;  1RDD A;  3ZSW A;  1RTD A;  3L2W A;  1S1U A;  3ISN C;  1F21 A;  4YNQ A;  4JRQ A;  3QNO A;  2X6N A;  4E1M A;  4FLU A;  3TAN A;  1XHZ A;  1BIS A;  3V1R A;  4O0J A;  2HVI A;  4OKJ A;  3KKR A;  3M8R A;  1Z26 A;  3O3G A;  3M8Q A;  4AHT A;  3SUQ A;  4DSE A;  5HRN A;  4ID5 A;  3QNN A;  1NK7 A;  1VSH A;  4OGE A;  2W42 A;  3SQ1 A;  4IKF A;  1WSE A;  2I5J A;  4N41 A;  4M3Y A;  2BGG A;  2P5G A;  1K6Y A;  3DI6 A;  3WNH A;  3T3F A;  4OVL A;  3VQD A;  4JS5 A;  4CK3 A;  3KLH A;  1RT3 A;  3QIN A;  3TAP A;  1B92 A;  3AVG A;  4CGD A;  4IFV A;  3D45 A;  2B6A A;  3M8P A;  3QIO A;  5HBM A;  4E1N A;  4CJR A;  4FXD A;  4CIE A;  1TKD A;  4CES A;  3QEV A;  4B9U A;  3AO2 A;  1VK0 A;  1NJW A;  3CM5 A;  1NOY A;  3WNF A;  1KVC A;  1HQE A;  4C8N A;  4N56 A;  3KK3 A;  3G0Z A;  4JS4 A;  1U4B A;  5FRN A;  2OPR A;  3VQ9 A;  1LAW A;  3V81 A;  3OYK A;  4E89 A;  2XY6 A;  2OA8 A;  4PY5 A;  3LZJ A;  5HP1 A;  5CYQ A;  1IKY A;  3ZT2 A;  5KRT A;  1S9G A;  3ITH A;  5HRR A;  3VQE A;  3K59 A;  1CLQ A;  2HNY A;  4BWJ A;  2IAJ A;  3A2F A;  4FK2 A;  4LH4 A;  4Q0B A;  1JXE A;  3UIQ A;  3HPH A;  1LWE A;  4BDY A;  4F3T A;  3TI0 A;  4B8A B;  3B6P A;  3HP9 A;  2HVH A;  3VN5 A;  5SWM A;  4CFB A;  1HNV A;  3AVA A;  5FRO A;  1VSL A;  3ZSQ A;  4CJL A;  3CM6 A;  1RIL A;  1TL3 A;  4CFD A;  5KGX A;  3OYI A;  3KLE A;  3V9W A;  4NYN A;  4KHS A;  1SV5 A;  3OYL A;  3I0R A;  4LY7 A;  2XRI A;  2RPI A;  3V9S A;  1JLA A;  3MEC A;  3CFR A;  4KO0 A;  1LWC A;  2A1S A;  1L3V A;  3DMJ A;  3DLB A;  2XY7 A;  4BAC A;  4FJI A;  2RKI A;  3KD1 E;  4M3T A;  4FK0 A;  3K57 A;  1WSH A;  4RW8 A;  3ZT4 A;  4FLV A;  3DRR A;  4CHP A;  2KW4 A;  4JRP A;  1JL1 A;  1IH7 A;  2D0B A;  4O4G A;  3OYE A;  3PX0 A;  3SUP A;  1I39 A;  2XO7 A;  3IRX A;  3QEW A;  3D0P A;  1VSI A;  2NUB A;  3LAK A;  2VG7 A;  2QKB A;  4CGH A;  3P5J A;  4ELT A;  4ICL A;  1TKT A;  4DQS A;  3TAQ A;  4BE0 A;  4O55 A;  4C8M A;  4KRF A;  3RMD A;  4CGG A;  1J9A A;  2QXF A;  4EZ9 A;  3JYT A;  4W5O A;  1ZBH A;  2O4G A;  2IGI A;  4KKO A;  5C25 A;  1BCM A;  1RT2 A;  1ZBU A;  5EU7 A;  3HP6 A;  1SL0 A;  4F2S A;  1JKH A;  3KIO A;  4CEF A;  1I3A A;  3RMB A;  3F9K A;  1VSD A;  5CZ2 A;  1U45 A;  1RT7 A;  5HRO A;  5CZ1 A;  1X9M A;  1N6Q A;  3BDP A;  4CCH A;  3LP1 A;  3KLF A;  1QE1 A;  2HW3 A;  3AA2 A;  4RW9 A;  1D5A A;  1UA0 A;  3ZSZ A;  3MXI A;  4CJ4 A;  1LAV A;  1D9D A;  4KTQ A;  2QK9 A;  4B3O A;  4AHU A;  4CEZ A;  4B8C A;  1C0U A;  1VRT A;  1XC9 A;  3BGR A;  2ETJ A;  4W5N A;  1NJY A;  3SPY A;  1UOC A;  3AO4 A;  1CZ9 A;  3JSM A;  1B9F A;  2FBX A;  1MU2 A;  1RNH A;  4AHV A;  3TAB A;  3U3G A;  1RBU A;  1NKE A;  3AA4 A;  4CHY A;  1LV5 A;  3DLE A;  1SUQ A;  4QCL A;  5T7B A;  1KFS A;  1EXQ A;  4DTN A;  5C42 A;  3DRP A;  4DS4 A;  3NE6 A;  1X9W A;  3OS1 A;  4FJ5 A;  4FJN A;  2HHS A;  3SV4 A;  2RN2 A;  4FW1 A;  3PO5 A;  4HCB A;  4RW7 A;  3QIP A;  3OYJ A;  4CF2 A;  5DMR A;  4E7J A;  1BGX T;  4NCG A;  4CJV A;  2HHU A;  4CJT A;  2DY4 A;  3AVH A;  3ZSO A;  3V6D A;  2G8U A;  2QKK A;  4FJL A;  1IKW A;  4CJK A;  1R0A A;  3S9H A;  2YKN A;  4C8K A;  4KHN A;  4CED A;  4ZTF A;  4FJX A;  3L8B A;  3P1G A;  3KTQ A;  2D0C A;  3G10 A;  5CYM A;  3V1O A;  3EYZ A;  3OY9 A;  3T19 A;  4FLZ A;  3RMC A;  4E0D A;  4DTR A;  2HHW A;  4C8O A;  5HRS A;  4OKK A;  4Z4H A;  1NKC A;  2JLE A;  3PUF A;  4CF9 A;  4DTS A;  4KTW A;  3VQ7 A;  4DMN A;  1C0T A;  4M45 A;  3K5N A;  1QHT A;  2IDO A;  1GOA A;  3L3V A;  1RTH A;  3CFP A;  1EKE A;  3ZSV A;  4HTU A;  3RMA A;  2HHQ A;  4Y1C A;  4LD0 A;  3HVT A;  1HJR A;  1FKP A;  3TAF A;  1KLM A;  1LWF A;  2G8V A;  3TWH A;  3TR8 A;  4BDP A;  4I9Q A;  2IS3 A;  4KB0 A;  3AVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...