1HRHA

Crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
125
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Crystal structure of the ribonuclease H domain of HIV-1 reverse transcriptase.
pubmed rcsb
source organism Human immunodeficiency virus 1
total genus 37
structure length 125
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1991-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hrhA00
3PX6A 4I2QA 4DFKA 3CFRA 1RBUA 4H4OA 3U3YA 3ZSOA 1ITGA 3D45A 3DLGA 3M8PA 4GMJB 4F4KA 1L3TA 1XHZA 3VQ6A 4R5PA 2HHWA 3TR8A 3CM6A 4E7KA 3PY8A 3DLKA 1Q9XA 3VQ4A 2D0BA 1RILA 4CEQA 4FJLA 4FK2A 2F8SA 1VSHA 2RPIA 1VRTA 4CJ3A 4DQQA 2JLEA 4FJNA 3OJUA 4NCBA 4GVMA 3OY9A 3AO3A 3QIPA 2O4IA 3TAGA 4Z4CA 4KHNA 4ICLA 2EX3A 1RTHA 3IRXA 4AHTA 1BCMA 3LP3A 4CJEA 5CYQA 3KJVA 4O55A 3MEGA 4W5NA 1I39A 1VK0A 3MEDA 4CGDA 3EYZA 3DRSA 4HUFA 2KFNA 3MEEA 3K5LA 3AA2A 4AILC 4F2RA 4HCCA 4F8RA 3VQBA 1S9GA 1TAQA 1SL2A 4FZZA 3P83D 3PX0A 2DFFA 4NYFA 1TV6A 3NCIA 4C8LA 4FJGA 2HHQA 4HTUA 3QESA 4FZYA 1TAUA 1X9SA 3V1OA 4CEOA 2Y1IA 1DTTA 3ZSXA 3O4NA 1WSEA 2VG5A 3SYZA 3NF8A 1Q8IA 1WAFA 1RT1A 1WSFA 4CHNA 4HUGA 3AVIA 1FKPA 4O5BA 4RW6A 1VRUA 4CJFA 4CFDA 3DMJA 4CCHA 1HYSA 3ZT0A 2F8TA 4E7JA 3KK1A 4KRFA 1RBVA 3LWLA 4DU4A 3VQ8A 1TKDA 3AVHA 3RTVA 4N5SA 4KB1A 4DTXA 3TAFA 4FJ5A 3SUPA 2HHXA 3CFPA 4KV8A 2OPPA 1YTUA 3EZ5A 4M45A 4CF2A 3O3GA 3O3HA 4DSKA 5KRTA 1VSLA 4OGCA 4CJPA 4FLYA 1C1CA 3QO9A 5C42A 1RTDA 3NGIA 4E1NA 4DQRA 3OYKA 4O44A 2HHTA 3AVMA 4E7LA 3LP2A 1R0AA 1QHTA 3FFIA 3LAMA 3LALA 4DTNA 1BIUA 3V1QA 2KZMA 2FC0A 1DTQA 3V9UA 3KKRA 3K57A 3DOKA 1JL1A 4DFMA 3V4IA 2KFZA 3DRPA 1S5JA 3OYAA 3SPYA 5CYMA 1TKXA 3G10A 4DTOA 2KW4A 3SNNA 2BANA 4H4MA 4BDZA 4FCYA 4Z4IA 1KLNA 3KLGA 1TL3A 4DQIA 1NK7A 1HYZA 4F3OA 1WN7A 2O4GA 4LY7A 4MFBA 1GOCA 2Z1GA 4OLAA 3PV8A 1UA1A 1VSFA 3VQ5A 3RMAA 4PWDA 2WONA 3ZSVA 1J54A 4ELTA 4Q0BA 3AVCA 2P1JA 3SQ0A 3HP9A 4CFAA 1IH7A 4IBNA 3OYFA 1KVBA 4H8KA 4DTJA 1QTMA 2OYQA 2FBTA 4CECA 1BISA 3SQ2A 3K5MA 3S3MA 4ELUA 3NHGA 1NK9A 3KD5E 5D3GA 4CGFA 1JLAA 3SUQA 4Y1CA 3QEXA 3TAMA 1HQEA 4DSJA 4FM1A 4CESA 1IKWA 1BHLA 1C1AA 4N41A 3KKSA 3I0RA 4FM0A 3LDSA 1D8YA 5C24A 4Z4GA 2PYLA 1FK9A 4IDKA 1VSEA 1FXXA 3AVNA 2HMIA 4PUOA 3DLEA 1QSSA 2DFHA 3VN5A 1I3AA 5KGXA 4DTMA 2XY5A 1NK6A 1YTAA 1IKYA 4FJ9A 4OVLA 1ASUA 2FBVA 4B3OA 2W42A 2YNFA 4BDYA 1NOZA 5J2MA 1BI4A 1HNIA 4J2AA 1UWBA 4RG8A 2HNYA 1NK8A 1NKEA 4Z4EA 1LWFA 5J1EA 3NBPA 4CHZA 3AV9A 3C94A 2XRIA 4DTUA 2G8VA 3PO4A 1TGOA 4CJWA 1JXEA 4DFPA 1SKSA 4EZ6A 1QS4A 1NOYA 5SZTA 3MXJA 2VG7A 2LSNA 3OYGA 1RT4A 5HROA 3O3FA 1QSYA 4FJ8A 4FK0A 2ITGA 3VQDA 4OJRA 3V9XA 1QSLA 4DMNA 5KTQA 2HHSA 4DLGA 3F73A 3F9KA 4N47A 1LAWA 3K59A 1L3SA 4KTWA 4DF8A 4QCLA 2HB5A 5EU7A 4DS5A 4IKFA 2HVHA 1SV5A 3DI6A 4IFYA 2Z1JA 3A2FA 4UQGA 3SJJA 3THVA 1B92A 1CZ9A 3K5OA 4OPJA 4CJQA 4AHUA 4DU3A 4CF0A 4CJLA 2PY5A 4E7IA 5J2PA 4CGGA 4W5OA 4CE9A 4RW8A 4CF1A 3V81A 1T03A 4OKEA 4AHVA 4DSEA 2B5JA 3LPUA 4I9QA 3OS0A 1ZBLA 4CJ4A 2YNIA 3TABA 3KK3A 3HPGA 1CLQA 3P1GA 4OLBA 2WOMA 5CZ1A 4FLVA 1UAXA 5CY4A 4L8RB 4QAGA 1ASVA 3ZSWA 4B9TA 4FW2A 3I0SA 1MU2A 3AVFA 1BQNA 1C0TA 4CEEA 1DLOA 2XO7A 3KIOA 4YNQA 1BGXT 4NCAA 3DYAA 3RR7A 1K6YA 1IKVA 2Q3SA 3DOLA 4IG3A 4JRPA 4FLUA 3VA0A 4K8XA 3ZT4A 4CEDA 5HRRA 2QKBA 1RT6A 4HVJA 3OYIA 3IG1A 1TK5A 4W5RA 1UA0A 1D5AA 3M8QA 4KHSA 3NH2A 4C8OA 4Y1DA 3QEPA 4ZHRA 3MXIA 4FK4A 5JS1A 2OZSA 3OYNA 3K5NA 3S3NA 3S3OA 1U48A 3TAPA 1JLGA 2RN2A 2PZSA 3VQQA 5DMRA 4KTZA 3VQAA 3PO5A 2D0CA 4DSIA 3V6DA 2Z1IA 4O0JA 4ZTFA 3I8DA 1S1TA 1HQUA 4E7HA 4KI6A 1U47A 4J2EA 1LV5A 3SI6A 3NFAA 5E41A 3ZSZA 5J2NA 1N5YA 2YV0X 4MQ3A 4DSFA 1A5WA 1WSIA 3M8SA 4ZTJA 4RW4A 4AHRA 1Q9YA 4FJMA 1J5OA 3ISNC 1D9DA 2KQ2A 3C6TA 3QLHA 5HRSA 1S6PA 1B9FA 4K8ZA 1SKWA 2X78A 4B08A 3OYCA 3QIOA 4CGHA 4N56A 1XWLA 4C8NA 1BI4B 5HRNA 2ATQA 4NCGA 5HLFA 3HPOA 1NK4A 4J2DA 4DWIA 2YNHA 3HPHA 3OYJA 4HCBA 4LD0A 1N6QA 3B6PA 3OS1A 4AH9A 3LZJA 3KTQA 2QK9A 1IO2A 1FKOA 4BE1A 3U3GA 3IAYA 3DRRA 4BACA 4DTRA 3KLIA 4BE0A 3MXMA 1RT7A 1LAVA 1RDCA 3T1AA 4JS4A 2OA8A 2ZQBA 2D5RA 4LSLA 2XHBA 3WNGA 3KK2A 3L2WA 4DQPA 1RT2A 3AVGA 2DTUA 5T7BA 1HJRA 1LWEA 4CGJA 2A1RA 4CF9A 3CM5A 2KZZA 3ZT1A 4AHSA 4JRQA 3V9WA 1Z25A 5HBMA 4FJHA 1NK0A 2A1SA 1SUQA 3LZIA 3AA4A 3VQ9A 1WNSA 2YNGA 3LP0A 4O0IA 3D0PA 1NJYA 3ZT3A 4CHYA 4DLEA 1JL2A 1EP4A 3L2UA 2HVIA 1TL1A 3K58A 4YFUA 3ASMA 1T7PA 2HNZA 3OYEA 1LWCA 2IAJA 3HXMA 3OYHA 1BCOA 3RMDA 3HT3A 1L3UA 2KTQA 1T8EA 4AHCA 3SUNA 3LPTA 4OKJA 4CK1A 2ETJA 3NF9A 1KCFA 1YT3A 4CJ5A 4B9UA 4DSLA 3OYDA 2DY4A 1W0HA 1RT5A 3PX4A 1S1WA 4CGIA 3SPZA 1BQMA 1RBSA 1O1WA 1RDDA 4BE2A 1D9FA 3TWHA 3RRHA 2DFEA 3CFOA 1HRHA 4M3UA 3EY1A 1F21A 3SV4A 3HJFA 2I5JA 4KHUA 4FJJA 1WSGA 2QXFA 4ID1A 3AVKA 1U4BA 1U49A 3NGYA 1KSPA 4BWMA 3NH1A 4FXDA 2HW3A 1KFSA 2OZMA 4M3ZA 4CFCA 3SV3A 1S6QA 4Q5VA 1T05A 1RT3A 1NJWA 3VQCA 4ELVA 4OKKA 1VSMA 4C8KA 1C0MA 1RDBA 4FJKA 4E89A 2RF2A 3AVAA 3PUFA 3QINA 4LH5A 4M3XA 1L3VA 3K2PA 3ZSQA 4G1QA 2ZD1A 3LP1A 4FVMA 1KVAA 1EXQA 2E6MA 2PYJA 3VA3A 3JSMA 5J2QA 4KKOA 2XY6A 3BDPA 4KHQA 1JKHA 2Z1HA 3T19A 4E1MA 4B9SA 5I42A 4KHWA 1TKZA 3DM2A 4EP5A 4FYDA 4CEAA 3QNNA 4M3YA 2Y1JA 4I9LA 3SQ1A 4KREA 3AA5X 3H08A 4Z4FA 3C95A 3G0ZA 5JS2A 2E4LA 3QEIA 1TVRA 3HM9A 1KRPA 1KVCA 4CERA 4HHTA 1VSJA 3IS9A 4JS5A 3TARA 1Z26A 4CJKA 1GOBA 3UIQA 3KLEA 4PY5A 4IFVA 3HP6A 4DU1A 1W9HA 4CEBA 3MAQA 2XY7A 4FJIA 1LW2A 2ZE2A 5CZ2A 3ALYA 3L2VA 1SL1A 4M42A 4M41A 1Y97A 5SWMA 4B9NA 3NF7A 3RWUA 3AO1A 4XIUA 1C1BA 4ID5A 1RBTA 5KI6A 4CIEA 3JYTA 3HK2A 3L3UA 1S1UA 4CEZA 1A5XA 3DLRA 4KO0A 4C8MA 4F2SA 1G15A 1RDAA 1C6VA 3SZ2A 1BL3A 1JLFA 4N76A 3OS2A 1QE1A 3ULDA 4B9MA 4CJVA 1KTQA 1JLEA 3QERA 2YHAA 3AVLA 3L2RA 4RW7A 3M8RA 4M3WA 2VWJA 1CXQA 3ZT2A 3CYMA 1WSHA 4HUEA 3AA3A 4JLHA 3OYMA 1BIZA 2G8UA 4KTQA 3AVJA 1REVA 1KLMA 3NGZA 2G8HA 1U45A 2D0AA 2G8WA 3O4QA 2FBYA 4OGEA 4FW1A 3RMCA 4NYNA 3HSTB 3QEWA 2QKKA 1VSKA 3NF6A 3TANA 4CK3A 3CG7A 2G8FA 4I2PA 4CHOA 4E3SA 1XC9A 4FLWA 4KB0A 1J53A 1B9DA 3AO2A 1RNHA 4GW6A 1XI1A 2OPSA 1NK5A 3RMBA 4FZXC 2XY8A 5C25A 3LANA 1EX4A 1IKXA 2IS3A 2HHUA 4M3RA 4DQSA 1GOAA 4FLXA 3SUOA 2X6SA 3AO4A 3L3VA 4CEFA 1JLBA 1CZBA 5FROA 1WAJA 3P5JA 4CF8A 1NJZA 1QQCA 4B9LA 1WSJA 2E6LA 3WNHA 3HYFA 4B8AB 3L2QA 2P5OA 4DS4A 2IDOA 4IG0A 2JGUA 2VG6A 4CIGA 1ZYQA 2X6NA 3C6UA 4FM2A 3RRGA 3L8BA 4CJUA 3BGRA 2BDPA 4KAZA 1ZBIA 1UOCA 4CHPA 2OPRA 2GUIA 4DG1A 4BDPA 1EETA 4E0DA 4KFBA 4B8CA 4CHQA 4LH4A 4DFJA 2YKNA 3TI0A 2G8KA 2VWKA 1S1VA 3HVTA 3V1RA 3LWMA 1RTJA 3NDKA 3CQ8A 3HO1A 3ZSYA 4O4GA 4PQUA 1WLJA 4CJTA 3V9ZA 4CK2A 5HP1A 1CXUA 4E19A 1TKTA 1C0UA 1EKEA 1TK0A 1KFDA 1X9MA 1LW0A 3TAQA 5FDLA 2IOCA 5KGWA 3DLHA 4WE1A 4LSNA 3LAKA 4KI4A 2YHBA 3OJSA 2BE2A 1ZBHA 4CIFA 3QETA 1SL0A 4FJXA 1NKBA 4Z0UA 3VQPA 4FLTA 3QNOA 3T3FA 4DTSA 4KHYA 2YKMA 1NKCA 4QOZB 3WNFA 3E01A 3AO5A 3U6FA 1SKRA 1S9EA 1VSDA 4TSXA 2P5GA 1ZBUA 3KLFA 2F96A 1HNVA 2RKIA 4J2BA 3NH0A 4DF4A 4EZ9A 3TAEA 1TK8A 1RCHA 3ZSRA 2FBXA 1YVUA 4CJSA 2X74A 3KD1E 3OVNA 1IG9A 1JLCA 3ITHA 4I7FA 3SQ4A 2GV9A 1J9AA 4FLZA 3MECA 1NJXA 3VQ7A 2IC3A 5DK5A 4Z4HA 1RTIA 3S9HA 3OYLA 1VSIA 4FJ7A 1ASWA 4CFBA 1A5VA 2HNDA 2OPQA 2GBZA 4PA1A 3KLHA 3WNEA 5FRNA 1HPZA 1U04A 3AVBA 5HRPA 4W5TA 4EP4A 1JLQA 3DLBA 3ZCMA 2HHVA 2R7YA 5K14A 5FRMA 5KRSA 1ZBFA 3HL8A 3V9SA 5I3UA 4OPKA 3NE6A 3SCXA 2G8IA 3VQEA 3B6OA 1JXBA 3HVRA 4KPYA 2AJQA 4F3TA 4RW9A 4BWJA 2BGGA 4CJRA 2B6AA 1HYVA 2IGIA 1X9WA 4DTPA 4B9VA 1L5UA 1RBRA 2P51A 4M3TA 1X1PA 3OYBA 1S1XA 3QEVA 3RR8A 3NAEA 2EHGA 1HMVA 2B4JA 1XHXA 2NUBA 4W5QA
chains in the Genus database with same CATH superfamily
3PX6A 4B3SK 3D45A 4FL9A 5EXWA 2HHWA 3VERA 3VQ6A 4E7KA 1Q9XA 4CEQA 1VSHA 2JLEA 3F9MA 4NCBA 3G71N 4DR1K 3D2FB 3AO3A 3QIPA 4C23A 4ICLA 2OANA 5CHIA 1BCMA 4CJEA 3KJVA 3MEGA 4H5VA 3MEEA 5BPLA 4AILC 4F2RA 3IKMA 4F8RA 4BRIA 5BR8K 4CW7B 1SL2A 4BR7A 2DFFA 4ISGA 1TV6A 1HUXA 4C8LA 2GWJA 4FZYA 3O4WA 1X9SA 3FFKB 2Y1IA 4DR4K 1DTTA 2I7NA 3CPEA 3SYZA 3JAMO 1Q8IA 5GADP 5AJ3K 3AVIA 1FKPA 5AQGA 1Q82O 1VRUA 4CCHA 4JK9A 3ZT0A 4E7JA 3KK1A 2O8EA 4YOXA 2O8BB 3AVHA 4N5SA 4DTXA 3TAFA 2E8AA 4KV8A 4DSKA 4JKFA 3O3GA 4FWNA 1DEJA 4OGCA 1C1CA 5CE3A 4PHTX 4E1NA 4DQRA 1X9JA 3FFIA 3LAMA 4DTNA 3V1QA 1DTQA 4XH5A 5AQHA 3V4IA 2KFZA 1HKGA 3DRPA 3UE5A 1S5JA 3SNNA 1NNEA 1JCEA 4BDZA 4FCYA 4Z4IA 3KLGA 1TUYA 3C6AA 1QVFM 4F3OA 1WN7A 3M6GA 4MFBA 2Z1GA 5EVZA 3RMAA 3WQTA 3EKSA 3CCSN 1HX1A 1YVNA 3HP9A 3OYFA 4O8UA 4CECA 3KD5E 2DPNA 5D3GA 4A59A 3SUQA 4Y1CA 3QEXA 4IWVA 2UXDK 5EX5A 3U9ZA 1C1AA 3CCEN 2ZGZA 3O6WA 3LDSA 2CH6A 2HMIA 3AVNA 3J7AP 2P9NA 1QSSA 3VN5A 2O8DA 1IKYA 3LDPA 4DR6K 2FBVA 2Q2RA 2W42A 1T3VA 1G99A 5J2MA 1KD1O 3P38A 2GELA 2HNYA 4GVEA 4YOYA 1NKEA 4Z4EA 3O08A 1P90A 4CJWA 5EY4A 2QW9A 1SKSA 4BR2A 1XQSC 2P9UA 2VG7A 3OYGA 2E2PA 4CZIA 4YOUA 3BP8A 4RWTA 4FK0A 4FJ8A 4L3QA 5FPMA 4DMNA 2W6LA 1ATNA 3F9KA 1GLFO 2WFBA 4DF8A 5BRHA 5EU7A 4DS5A 3A5MC 2Z1JA 4UQGA 1ATSA 4JYAK 4DU3A 4CF0A 4H0TB 4E7IA 1VQMN 1CZAN 3GE1A 3V81A 3WEEB 1YJNN 1RDWX 4EFHA 2YNIA 3I8BA 2WOMA 4FLVA 5AZIA 1UAXA 4B9TA 1MU2A 3G25A 4CEEA 1DLOA 4B1XB 3THYA 3KIOA 4YNQA 4FWRA 3J81O 4XH1A 2Q3SA 4JRPA 1YIJN 3ZT4A 4DB3A 2QKBA 3OYIA 3M8QA 4U67L 1M90O 2UUCK 5DMRA 2Z1IA 1S1TA 4H0OA 4E7HA 3NFAA 5J2NA 3ULEA 2YV0X 1BA1A 1WSIA 3M8SA 4ZTJA 3U4LA 1J5OA 1D9DA 3C6TA 3QLHA 4JHDB 1OH6A 1B9FA 1VQKN 1SKWA 5BRFA 4YORA 4C8NA 3HPOA 4BRDA 3HPHA 3A0IX 4LD0A 3LZJA 2QK9A 2O8CA 1FKOA 3U3GA 3CC7N 4BY9C 4DV1K 1K8KB 3KLIA 2YHXA 1LAVA 4LF5K 5M1NA 2VCPA 4BRPA 2ZQBA 3L2WA 4DQPA 4CF9A 3NVKA 3EEQA 4O5FA 2A1SA 3AA4A 3QFPA 1WNSA 2YNGA 3LP0A 1Q86O 1EQYA 2OTLN 2KHOA 1TL1A 1OH8A 4LF7K 3HXMA 3OYHA 3HM8A 2KTQA 2E2NA 5AQQA 3SUNA 2PFUA 1YT3A 2DY4A 3EO3A 4KH5A 3PX4A 1S1WA 1EO1A 2D4WA 4CZJA 4LFCK 4BE2A 3CXCM 3HJFA 3RVCA 4FJJA 4FXDA 3NGYA 5BPMA 3GOIA 2OZMA 4M3ZA 3SV3A 3ENOA 4ELVA 4BR5A 1C0MA 2HHHK 1EWQA 3QINA 3ZSQA 4GKJK 3VA3A 5J2QA 3U8XA 4KHQA 1XNQK 3BEXA 5I42A 1TKZA 3DM2A 4KREA 3AA5X 3TU5A 4R79A 4JS5A 4CJKA 1GOBA 2HBLA 3KLEA 3JXUA 3HP6A 2BUPA 4EHUA 1LW2A 4QS7A 2VGNA 4M41A 5SWMA 4DV2K 1M1KO 2P9LA 5KI6A 3UKUB 3HK2A 4F2SA 1A5XA 4C8MA 3TTFA 1XUPO 3QICA 4B9MA 4CD3A 5HOOA 4M3WA 3M8RA 4IJAA 1NWKA 3OYMA 4H0VB 1REVA 4PL7A 2E88A 1DKGD 1KXPA 3O4QA 4FW1A 4CBXA 2W6KA 1VSKA 1VHXA 4E3SA 3CJ9A 1XI1A 1NK5A 1NGGA 3NVMA 2HHUA 5JVHL 2QM1A 1BDGA 3SJHA 2CGKA 5FROA 1WAJA 3P5JA 1NG9A 4B1VA 4JI4K 1WSJA 4NB4A 2O8FB 4EIAA 3W0LA 4DR3K 4DS4A 1QZ5A 4IG0A 3D7EO 2X6NA 4FM2A 3BGRA 1ZBIA 3P31A 2HMPA 3LDQA 1TYQA 3UKRB 1S1VA 3V1RA 3CQ8A 5TKYA 3ZSYA 4PQUA 3V9ZA 2QEXN 4CK2A 2NLXA 1CXUA 3FGUA 5HP1A 3VMFB 4ILGB 1X9MA 5FDLA 4AF1A 5KGWA 3DLHA 1HLUA 1KAXA 4BRQA 1U2VB 3OJSA 1SL0A 4BRAA 3THWB 5C2DA 4Z0UA 5GIOA 1VQ5N 3WNFA 3E01A 4BRHA 1S9EA 3KLFA 2RKIA 3NH0A 5AR0A 3TSPA 1XMOK 2FBXA 1YVUA 1IG9A 4CZKA 2GV9A 3VTHA 1J9AA 1V4TA 4FWQA 3QB0A 3O80A 2IC3A 4Z4HA 1VQPN 2V7YA 1RDUA 1VSIA 4DQ8A 4YOWA 1ASWA 4O8KA 5KQDA 2GBZA 3AVBA 4HWIA 1JLQA 3DLBA 2Q1NA 4FPAA 3ZX0A 5M1OA 3V9SA 3AAPA 2GEMA 4WQ4C 1QHAA 4CJRA 4A5BA 2B6AA 4DUYK 1RBRA 3OYBA 4LFBK 3M1FA 3SLCA 2CGJA 5KPTA 3NAEA 3A5OC 3O1WA 2NUBA 1RBUA 4H4OA 1ITGA 4FJ7A 3DLGA 3FZFA 4NLBA 4F4KA 1L3TA 1XHZA 3PY8A 4FK2A 1NU0A 4FJNA 3OJUA 3HTVA 1WUAA 3OY9A 2O4IA 3TAGA 2ZJRL 4Z4CA 4KHNA 5EOYA 1RTHA 4JKDA 3O5BA 4BC5A 4AHTA 3LP3A 3MX2A 2NNWA 2UXCK 1I39A 3I33A 4FWSA 4HUFA 2KFNA 3AA2A 4HCCA 4FVUA 4FJGA 4CZEA 3VGMA 4CEOA 4J8FA 2GTDA 3E9PA 3ZYYX 1WSEA 1WAFA 1RT1A 3WXIA 4HUGA 4RW6A 4CJFA 4CFDA 1HYSA 2F8TA 4KRFA 3SAHA 4DU4A 4FWMA 4FJ5A 3CJ7A 3SUPA 3ZX3A 3EKUA 2OPPA 5KRTA 3WT0A 4CJPA 2P9IA 2F9TA 4I6MB 5TKWA 4Z94A 4FWPA 2GX9A 4MDAA 4O44A 3AVMA 3LP2A 4CZFA 3LALA 2FC0A 4AQYK 1JL1A 4DV5K 3G10A 3CCVN 2KW4A 5FPNA 4IOXA 2BANA 4DKWA 4LF4K 1KLNA 1TL3A 3EN9A 2O4GA 4LY7A 4DR2K 3PV8A 4JKHA 4WF9L 5KPZA 5M1PA 1QQOA 3QMLA 1MDUB 3AVCA 4BREA 4H8KA 1IBLK 2FBTA 3SQ2A 1BISA 1W97L 3NHGA 2WTUA 1NK9A 4UY8O 1JLAA 3O9QA 2PBDA 3G4SN 1NGIA 2QI2A 4B1ZA 4YHHK 1IKWA 1BHLA 1HPMA 4N41A 3KKSA 4KH6A 3I0RA 4FM0A 4Z4GA 3KHYA 1FK9A 1SS6A 3DLEA 3CCUN 5BPNA 2XY5A 3PSFA 1YTAA 1YJWN 5M1QA 4B3OA 1BI4A 3DWLA 1LWFA 3VPZA 3CC4N 4JI0K 3WXJA 1ZXOA 3C94A 4DTUA 2NZTA 4IEIA 5AQZA 1JXEA 4BRLA 2IIRA 4DFPA 4B1YB 1QS4A 1NOYA 1ILYA 4BRNA 4FWLA 2LSNA 5HROA 1RT4A 5LL6Z 3O3FA 3VQDA 4OJRA 3V9XA 4N47A 3A5LC 1L3SA 4KTWA 3P4IA 3GG4A 4X64K 3A2FA 4ILJA 3SJJA 1CZ9A 3K5OA 4OPJA 3C65A 4CD1A 4CJQA 4AHUA 2PY5A 4B9QA 4CGGA 5AQLA 4JI2K 2UUAK 1E4FT 2VWBA 3C0BA 3PIPL 3LM9A 3TABA 4BRGA 2BTFA 3P1GA 4YOTA 1ASVA 3ZSWA 3I0SA 1C0TA 4H0YB 3R3LA 5AQMA 1BGXT 4NCAA 1DT9A 3CMAN 4FLUA 5HRRA 3VGKA 1YJ9N 3NH2A 4C8OA 4FK4A 2OZSA 1N34K 1U48A 2PZSA 2RN2A 3PO5A 4KTZA 4MLHA 4DSIA 3V6DA 4O0JA 4CBWA 4J2EA 1EWRA 4CVNE 4AM7A 3DXMB 4AHRA 2NRXA 1K9MO 2NRHA 3J80O 3ISNC 4YDUC 5HRSA 1S6PA 4DV0K 2V7ZA 4K8ZA 1HNWK 1KAZA 2X78A 4B08A 3DAWA 4CGHA 1XWLA 2RHKA 2P9SA 4C1NK 2YNHA 4DWIA 3C7NA 4B3TK 2YX6A 3IAYA 3TTDA 1VQ8N 1RT7A 2YHWA 4LSLA 2D5RA 2UU9K 1RT2A 1WB9A 2DTUA 5T7BA 1HJRA 2Q36A 2HF4A 2KZZA 3ZT1A 4KH4A 4AHSA 3V9WA 5HBMA 4FJHA 1NK0A 1MA9B 2D1KA 3H1VX 3D0PA 5E84A 3T1YK 3ZT3A 3AGKA 5AFUA 3ASMA 2HNZA 2IAJA 3VF4A 5AFUH 5DM7L 2ASMA 5F0XA 1L3UA 4PKHA 1T8EA 4AM6A 3HZ6A 4AHCA 3S41A 1GLDG 3EZWA 3OYDA 4MLEA 4K41A 1RDDA 2WC9A 1KQSM 1HRHA 2JWLA 3VGLA 3EY1A 1IG8A 2I5JA 2QXFA 1KSPA 3THXA 3GL1A 1LCUA 4CFCA 1S6QA 4BRFA 1VSMA 4FO0A 2YHYA 4LH5A 4K43A 3VENA 1L3VA 3HI0A 1RFQA 3LP1A 2NRZA 3ENHA 4OPAA 4CZGA 4E1JA 1HNXK 4FVMA 1KVAA 1EXQA 5AZJA 4FSVA 2Z1HA 3L4QA 4EP5A 1QQMA 3ZEUB 4CEAA 4KHPK 3CERA 4CZHA 1S3XA 3M3ZA 4WQ4A 1OKJA 1KRPA 4CERA 4HHTA 1VSJA 2IVOA 1Z26A 2OCEA 4RTFD 3RSEA 4PY5A 4DU1A 5AQFA 3WXLA 5H1SQ 2A40A 4FWOA 5CZ2A 2ZE2A 4IO9L 4JKBA 3TTCA 2IVPA 3ZETA 4WYBA 1C1BA 4CBUA 1S1UA 3MWPA 1S22A 2RE2A 2Q97A 1G15A 1C6VA 1BL3A 1QE1A 5AQTA 4CJVA 1KTQA 1JLEA 5AQIA 4DV6K 1CXQA 3ZT2A 3CCJN 4HUEA 1BIZA 4KTQA 3AVJA 1KLMA 2G8HA 2D0AA 4OGEA 4NYNA 3HSTB 3QEWA 2QKKA 1GLAG 2G8FA 3D2EB 4I2PA 5GINA 4KB0A 1J53A 2OPSA 3ZLJA 4FZXC 5C25A 2P9KB 3LANA 2F4VK 1NGFA 1GOAA 4B3RK 3CIPA 3SUOA 3AO4A 1BWFO 2P9PB 1JLBA 4JD2A 1MWMA 4FOEA 4CF8A 4PL8A 3L2QA 3OBWA 2IDOA 5C10A 3PIOL 3CD6N 3MN5A 3C6UA 3CQYA 3L8BA 3D2FA 1OH7A 4CHPA 1EETA 2ZJQL 4E0DA 4B8CA 3TI0A 2NRTA 4JNEA 3NDKA 3HVTA 5C12A 3E9OA 4CJTA 1E3MA 5C0YA 5F1XA 2QWQA 1LW0A 1NGDA 4BR0A 4GY2B 4KI4A 2YHBA 2J4RA 2BE2A 5BR9A 1ZBHA 4CIFA 4JI6K 3QNOA 4DTSA 4KHYA 1VQ9N 2O8BA 3AO5A 5FLXO 1HJOA 2F96A 1X3MA 4GKKK 1RCHA 2QWRA 4CJSA 1NGEA 2X74A 3OVNA 1JLCA 3ITHA 2E2QA 1BOTO 4JI1K 1RTIA 4X62K 2QWLA 3KLHA 2WBNA 3OBYA 1DGKN 4KBOA 5FRMA 5KRSA 1O13A 3NE6A 3OHRA 3I56N 3AARA 3VEZA 1VQ7N 1VQNN 1NMDA 1NGAA 2P51A 4M3TA 4IXCA 3DXKA 4H0PA 3CCLN 2EHGA 3A8YA 3H46O 2B4JA 4B3MK 4W5QA 4DFKA 3U3YA 1HKBA 2Q0UA 3ZSOA 3M8PA 3CJ1A 5B8HA 2NRWA 4R5PA 3DLKA 4FJLA 3VQ4A 2F8SA 1VRTA 1R59O 3BF1A 1NGCA 3J7YP 2EX3A 3IRXA 5AQYA 4H03B 4O55A 1Z05A 3MEDA 3EYZA 4F9OA 3DRSA 3IDHA 3K5LA 3VQBA 3MMVA 1OVQA 4CZLA 4DHYA 2HHQA 3NCIA 1J5EK 3QESA 1TAUA 3V1OA 2BH1A 3ZSXA 2VG5A 3NF8A 1WSFA 3DMJA 1RBVA 4ILHA 1TKDA 3RTVA 4KB1A 2HHXA 3CFPA 3T1HK 3KZBA 4M45A 4CF2A 4IEEA 3O3HA 4FLYA 5C42A 3R1XA 3NGIA 5IT9O 4H0XB 1BUPA 3WEEA 3MDQA 1QHTA 1BIUA 3V9UA 4YDUA 3K57A 3DOKA 5CYMA 3TPQA 1TKXA 1Q18A 3J8AA 1ATRA 5ELZA 4DCHA 2ZM6K 1NM1A 1NK7A 1IBMK 4JEPA 1GOCA 4OLAA 3HBTA 4FWKA 1BA0A 5AQUA 2ZWHA 3ZSVA 3MCAB 3K0SA 1J54A 3A5NC 4IBNA 1KVBA 3N4PA 3E66A 4ELUA 3S3MA 4JKGB 3CPWM 1ZBSA 1C0GA 4FM1A 5MLCQ 4CESA 4K0KK 4JK8A 4K25A 2QA4N 3FR0A 4JI3K 1D8YA 3OW2M 4H5RA 2PYLA 4IDKA 1VSEA 1FXXA 2Q0RA 4H5NA 4PUOA 4DTMA 1NK6A 4JHDA 3QDKA 4OVLA 2YNFA 4BDYA 1NOZA 1HNIA 4J2AA 1UWBA 1YXQA 1NK8A 3IUCA 2QWNA 3NBPA 4CHZA 3AV9A 2XRIA 3PO4A 1XNRK 3EE9A 1BG3A 4NXMK 5SZTA 1E4GT 4H5WA 1K8KA 4BRKA 4WFBL 2A42A 1QSYA 2A3ZA 2ITGA 5C15A 2CGLA 2HHSA 4DLGA 2O8EB 3K59A 4QCLA 4IKFA 3MK6A 2HVHA 1SV5A 3DI6A 1B92A 4BR9A 1OH5A 4CJLA 3GDQA 5J2PA 4W5OA 1ZC6A 4RW8A 4OKEA 4AHVA 4DSEA 3KK3A 3HPGA 5BN8A 1CLQA 3BZCA 4OLBA 2HSTA 5CY4A 4L8RB 5CR4A 2ZGYA 3SK3A 3AVFA 1BQNA 3RR7A 4IG3A 2QWOA 4YY3K 4K8XA 4CEDA 2HF3A 5E26A 3IG1A 1TK5A 3E1YA 3AY9A 4KHSA 5JS1A 3IMXA 3QEPA 4K42A 3B8AX 4ZHRA 3MXIA 3HRGA 3U9DA 3OYNA 3K5NA 3S3NA 3TAPA 1JLGA 2W41A 3VQAA 1SAZA 2FF6A 4PKGA 4ZTFA 4WQ5C 1HQUA 3CHWA 4JKAA 1LV5A 5E41A 3ZSZA 1N5YA 4A57A 4DSFA 1OVYA 3KWIA 4RW4A 4A2BA 1T6DA 2P9NB 3ID8A 4DR5K 2O8DB 4BVOA 1HR0K 5AQSA 3OYCA 1GLLO 4H5TA 5HRNA 1T6CA 1NK4A 4J2DA 3OYJA 1SZ2A 1N6QA 3B6PA 3KTQA 4AH9A 3VEOA 5AQXA 1IO2A 4DV4K 2EWSA 3MXMA 3UKUA 2P9UB 1RDCA 3T1AA 4BC4A 2XHBA 2HBKA 3WNGA 3KK2A 1NLVA 3AVGA 1LWEA 2A1RA 1N33K 3KWGA 1Z25A 4XEIA 4G9ZA 1SUQA 3LZIA 3VQ9A 1NJYA 5AZJB 4CHYA 1EP4A 3WQUA 4A61A 3K58A 4C1NI 4YFUA 3OYEA 1LWCA 1BCOA 4LF9K 3HT3A 1WBDA 1YAGA 4B9UA 1W0HA 1RT5A 5AZIB 5M1KA 2E5LK 2ITMA 1BQMA 1O1WA 4MO4A 2KKZA 3THYB 1D9FA 3TWHA 2DFEA 4M3UA 4IOCL 1F21A 2O8FA 4KHUA 1WSGA 1U4BA 3AVKA 2HW3A 1KFSA 2W40A 1NGJA 3F5TA 3BY5A 4Q5VA 1T05A 1RT3A 4FPBA 1NJWA 1KC8O 3VQCA 4BRMA 1RDBA 4FJKA 4E89A 3AVAA 4M3XA 4YOVA 5JICA 2E6MA 3ULEB 2XY6A 3JSMA 4JAXA 1JKHA 3T19A 4E1MA 4KHWA 4FYDA 2E1ZA 3CCQN 2Y1JA 1JCFA 4I9LA 3SQ1A 3H08A 1NGBA 3G0ZA 2E4LA 3QEIA 1U2VA 3O1BA 1TVRA 3HM9A 1KVCA 3TARA 1XMQK 1QZ6A 3THWA 2IVNA 3Q7CA 1W9HA 3MAQA 2GUPA 1K8AO 2O8CB 4BGBA 1SL1A 1Y97A 3MX5A 5I9EB 3VF2A 2VQEK 3AO1A 5LMNK 3JYTA 3H6EA 2ASPA 3E9LA 3L3UA 4U7BA 3DLRA 1RDAA 3SZ2A 4MO5A 3ULDA 3W3DA 3WUHA 3DLLL 2YHAA 3AVLA 3L2RA 2VGMA 4RW7A 5HL7L 2VWJA 5FPDA 1WSHA 4JLHA 5AQKA 3UB5A 3NGZA 2G8WA 2FBYA 3RMCA 3CG7A 4CHOA 5GAHP 1XC9A 4MDBA 3AO2A 2D0OA 1N8RO 1EX4A 4OPHA 2IS3A 3T69A 2E20A 3F2KA 4M3RA 4FLXA 3OA9A 1QQCA 3WNHA 4B8AB 3LL3A 2JGUA 4IDHA 4CJUA 4JKCA 3D6RA 2GUIA 4BDPA 3ENBA 4IFEA 4X65K 4A62A 4KFBA 3O9RA 4CHQA 4IOAL 4LH4A 2YKNA 2VWKA 3FE1A 2YJFA 3LWMA 3HO1A 4O4GA 4E19A 1TKTA 3PSIA 1C0UA 1EKEA 1TK0A 5AQWA 1QVGM 2OTJN 2YI1A 4LSNA 3M5RA 4LF6K 3QETA 1NKBA 3DXKB 4RCHA 3VQPA 3T3FA 4QOZB 3U6FA 2FSKA 1VSDA 5JLHA 2P5GA 1ZBUA 1HNVA 4DF4A 2QXLA 3TAEA 2P9LB 4I6MA 4I7FA 5BN9A 3SQ4A 3MECA 1NJXA 3VQ7A 1WOQA 5DK5A 3VEYA 3OYLA 4DV3K 4CFBA 2HNDA 2OPQA 4PA1A 3WNEA 5FRNA 3SMPA 4W5TA 4EP4A 2HHVA 2R7YA 5K14A 1ZBFA 5I3UA 4OPKA 3SCXA 3B6OA 1JXBA 4KPYA 4JKEA 2AJQA 4RW9A 2BGGA 3H3NO 1RGIA 2IGIA 1X9WA 4DTPA 4JI8K 3ATVA 1YITN 1X1PA 3QEVA 1S1XA 3RR8A 3VOVA 4M63C 3R9PA 3CJAA 5DM6L 5GAEP 1HMVA 5LY3A 4I2QA 3CFRA 4GMJB 2ASOA 3FZMA 3SBGA 3TR8A 3CM6A 2D0BA 1RILA 2RPIA 4CJ3A 4DQQA 2UUBK 1W2BM 4GVMA 5KQ8A 3TSUA 5CYQA 3ATUA 4W5NA 1TYQB 1VK0A 2A41A 4CGDA 2D0PA 2FF3B 3DJCA 3QBWA 4X66K 4WFAL 2HBMA 2H3GX 1S9GA 1TAQA 3O8MA 4FZZA 3P83D 3PX0A 3H3OB 4NYFA 4HTUA 4WCEL 3O4NA 5JLFA 1LOTB 4BQZA 4CHNA 4O5BA 1P8ZA 4BVPA 3LWLA 3VQ8A 3H1QA 4B1WB 1YTUA 1T44A 4WQ5A 3EZ5A 3K9KA 1VSLA 3MCPA 5GAGP 3QO9A 1RTDA 3CJCA 3OYKA 3PLAA 2PAVA 2HHTA 5KPRA 4E7LA 1R0AA 1K73O 2KZMA 4BG9A 3KKRA 4DFMA 3OYAA 3SPYA 2KLAA 2E2OA 4DTOA 4H4MA 4DQIA 1HYZA 4A5AA 5AQPA 1UA1A 1VSFA 3VQ5A 3VF6A 3CI5A 3CETA 4PWDA 2WONA 1YHQN 2QWPA 3FZLA 4ELTA 4Q0BA 2P1JA 3WXMB 2Q31A 3SQ0A 4CFAA 1IH7A 1QTMA 4DTJA 2OYQA 4IJNA 4DV7K 3K5MA 4JI7K 4CGFA 1HKCA 1BU6O 1Z6RA 3TAMA 1HQEA 4DSJA 1S72N 1NMNA 3DXMA 5C24A 3NMUA 1J6ZA 3ZX2A 1D4XA 2DFHA 1I3AA 5KGXA 4FJ9A 1ASUA 3ID6A 3K9JA 2VYPA 4HTLA 4RG8A 5J1EA 2G8VA 3QBXA 3L0QA 1TGOA 1FW6A 4EZ6A 1TUUA 3MXJA 1IJJA 3Q7BA 3SAFA 1QSLA 3FZHA 1MWKA 5KTQA 3C6HA 3F73A 1HNZK 1LAWA 5AQRA 4BGAA 3MWTA 1NGHA 2HB5A 3AAQA 3OTOK 1VAZA 4BQLA 1YI2N 4IFYA 1FJGK 3THVA 4CZMA 3CJBA 2P9IB 4CE9A 1YUWA 4CF1A 1T03A 2B5JA 3LPUA 4I9QA 4LFAK 3OS0A 1ZBLA 4CJ4A 5AQNA 5CZ1A 4JK7A 4NLCA 4QAGA 4ISEA 4FW2A 3CCRN 1GLEG 1IBKK 2XO7A 3DYAA 1K6YA 1IKVA 3DOLA 3VA0A 2JWKA 2FXUA 1RT6A 4HVJA 1GLJO 4W5RA 1UA0A 1D5AA 3J7ZO 2FSJA 1WBBA 4Y1DA 3LDOA 5BRDA 1H1VA 4LF8K 3S3OA 1BO5O 3VQQA 5ADXA 2D0CA 3TSQA 5ADXH 3I8DA 5F2RA 4KI6A 1U47A 3SI6A 4V19S 4MQ3A 1A5WA 1GLBG 1Q9YA 3ZEUA 1ESVA 4FJMA 2F9WA 4A2AA 3VEXA 5C2FA 1XC3A 3G6EN 2KQ2A 3MN6A 1VQ4N 3EL2A 3CMEN 2V52B 5AQVA 3QIOA 4N56A 4OO1J 1BI4B 2ATQA 4NCGA 5HLFA 4HCBA 2FSNA 3OS1A 1V4SA 3GBTA 3FZKA 5LJWA 4BE1A 3DRRA 4BACA 4DTRA 3MN7A 3WXKA 3R8EA 4DUZK 4BE0A 4QS9A 4JS4A 2QWMA 2OA8A 1I94K 3R6MA 1VQ6N 1VQLN 4CGJA 2UYTA 3CM5A 3O9TA 4JRQA 2YCHA 2E1YA 1YF5L 4O0IA 1JJ2M 2FLOA 2QTDA 3VTIA 4DLEA 4EAHD 1JL2A 3L2UA 2HVIA 3VEVA 1T7PA 2VQFK 1X3NA 3RMDA 3VETA 3D2EA 3LPTA 4OKJA 4CK1A 2ETJA 1N36K 3NF9A 1KCFA 4CJ5A 5A2QO 3SMSA 5JVGL 4DSLA 3KVGA 2P9KA 4CGIA 3SPZA 3CC2N 1RBSA 4XH4A 3QFUA 3N4QA 2YJEA 1KAYA 2P9PA 3RRHA 3CFOA 3BUZB 2V51B 2ZJPL 3SV4A 4ID1A 1U49A 4BWMA 3NH1A 1U6ZA 4JN4A 2WUSA 3LDLA 4OKKA 4C8KA 2RF2A 3PUFA 3K2PA 4CJ7A 1Y64A 4G1QA 2ZD1A 1IV0A 1C0FA 2PYJA 2HBJA 4KKOA 3BDPA 5LJVA 4B9SA 3L4IA 4LC9B 3QNNA 4M3YA 4Z4FA 3C95A 5JS2A 2ZF5O 4GNIA 3BZKA 1NBWA 3IS9A 4ISFA 2HOEA 1SQKA 3UIQA 4IFVA 4B1UB 2P9SB 5LMUK 4QS8A 4CEBA 3C7NB 2XY7A 4FJIA 3BF3A 3ALYA 3L2VA 3LM2A 4EHTA 4M42A 4PKIA 3FLCO 4B9NA 3NF7A 3RWUA 4XIUA 3CCMN 4ID5A 1RBTA 4CIEA 3SBTA 1QQNA 5GIPA 4CEZA 4KO0A 1JLFA 4N76A 2A5XA 3OS2A 3VESA 3QERA 3CYMA 3AA3A 3CQXA 4BR4A 2AA4A 2G8UA 4GV9A 1U45A 3KK7A 5AQOA 3NF6A 3TANA 4CK3A 1JCGA 4OX9K 4BC2A 4FLWA 1B9DA 1RNHA 4GW6A 3RMBA 2XY8A 3O9SA 1IKXA 5BREA 4DQSA 2X6SA 3L3VA 4CEFA 1CZBA 1NJZA 4B9LA 4NO7A 2E6LA 5JMVA 3HYFA 2P5OA 3THXB 3SAGA 5AQJA 4CIGA 2VG6A 3T7ZA 1ZYQA 2UXBK 4CI6A 3RRGA 4BROA 2NRRA 4M7XA 3LDNA 2I7PA 2BDPA 4KAZA 1UOCA 2OPRA 4DG1A 3CF5L 4DR7K 4DFJA 5IWAK 2G8KA 1RTJA 4JV5K 2AP1A 3AGRA 1WLJA 1KFDA 2F7TA 3HSCA 4BG8A 1W7AA 3TAQA 2IOCA 3I55N 4FOIA 4WE1A 3MN9A 1Q81O 2A6AA 3LAKA 3RSEB 4FJXA 2CH5A 4FLTA 3O9UA 2YKMA 1NKCA 4BRCA 1SKRA 3IFRA 2GWKA 4TSXA 4WFNL 4J2BA 3JS6A 4EZ9A 1TK8A 3ZETB 3ZSRA 1N32K 3KD1E 3EE8A 3HOTA 3VEWA 4FLZA 3P39A 4IZ9A 5M1FA 3S9HA 1Q7YO 4IO8A 4M7YA 1A5VA 4Y0WA 1HPZA 3H45C 3UKRA 1U04A 5HRPA 3ZCMA 4BC3A 3HL8A 4JI5K 3L6QA 2G8IA 2NRVA 3VQEA 3HVRA 4F3TA 4BWJA 5FPEA 1HYVA 3HOSA 1VQON 4B9VA 1L5UA 1NJIO 4GV6A 1GLCG 4NXNK 4GV3A 1XHXA 4JKGA 4JD2B
chains in the Genus database with same CATH topology
3PX6A 4I2QA 4DFKA 3CFRA 1RBUA 4H4OA 3U3YA 3ZSOA 1ITGA 3D45A 3DLGA 3M8PA 4GMJB 4F4KA 1L3TA 1XHZA 3VQ6A 4R5PA 2HHWA 3TR8A 3CM6A 4E7KA 3PY8A 3DLKA 1Q9XA 3VQ4A 2D0BA 1RILA 4CEQA 4FJLA 4FK2A 2F8SA 1VSHA 2RPIA 1VRTA 4CJ3A 4DQQA 2JLEA 4FJNA 3OJUA 4NCBA 4GVMA 3OY9A 3AO3A 3QIPA 2O4IA 3TAGA 4Z4CA 4KHNA 4ICLA 2EX3A 1RTHA 3IRXA 4AHTA 1BCMA 3LP3A 4CJEA 5CYQA 3KJVA 4O55A 3MEGA 4W5NA 1I39A 1VK0A 3MEDA 4CGDA 3EYZA 3DRSA 4HUFA 2KFNA 3MEEA 3K5LA 3AA2A 4AILC 4F2RA 4HCCA 4F8RA 3VQBA 1S9GA 1TAQA 1SL2A 4FZZA 3P83D 3PX0A 2DFFA 4NYFA 1TV6A 3NCIA 4C8LA 4FJGA 2HHQA 4HTUA 3QESA 4FZYA 1TAUA 1X9SA 3V1OA 4CEOA 2Y1IA 1DTTA 3ZSXA 3O4NA 1WSEA 2VG5A 3SYZA 3NF8A 1Q8IA 1WAFA 1RT1A 1WSFA 4CHNA 4HUGA 3AVIA 1FKPA 4O5BA 4RW6A 1VRUA 4CJFA 4CFDA 3DMJA 4CCHA 1HYSA 3ZT0A 2F8TA 4E7JA 3KK1A 4KRFA 1RBVA 3LWLA 4DU4A 3VQ8A 1TKDA 3AVHA 3RTVA 4N5SA 4KB1A 4DTXA 3TAFA 4FJ5A 3SUPA 2HHXA 3CFPA 4KV8A 2OPPA 1YTUA 3EZ5A 4M45A 4CF2A 3O3GA 3O3HA 4DSKA 5KRTA 1VSLA 4OGCA 4CJPA 4FLYA 1C1CA 3QO9A 5C42A 1RTDA 3NGIA 4E1NA 4DQRA 3OYKA 4O44A 2HHTA 3AVMA 4E7LA 3LP2A 1R0AA 1QHTA 3FFIA 3LAMA 3LALA 4DTNA 1BIUA 3V1QA 2KZMA 2FC0A 1DTQA 3V9UA 3KKRA 3K57A 3DOKA 1JL1A 4DFMA 3V4IA 2KFZA 3DRPA 1S5JA 3OYAA 3SPYA 5CYMA 1TKXA 3G10A 4DTOA 2KW4A 3SNNA 2BANA 4H4MA 4BDZA 4FCYA 4Z4IA 1KLNA 3KLGA 1TL3A 4DQIA 1NK7A 1HYZA 4F3OA 1WN7A 2O4GA 4LY7A 4MFBA 1GOCA 2Z1GA 4OLAA 3PV8A 1UA1A 1VSFA 3VQ5A 3RMAA 4PWDA 2WONA 3ZSVA 1J54A 4ELTA 4Q0BA 3AVCA 2P1JA 3SQ0A 3HP9A 4CFAA 1IH7A 4IBNA 3OYFA 1KVBA 4H8KA 4DTJA 1QTMA 2OYQA 2FBTA 4CECA 1BISA 3SQ2A 3K5MA 3S3MA 4ELUA 3NHGA 1NK9A 3KD5E 5D3GA 4CGFA 1JLAA 3SUQA 4Y1CA 3QEXA 3TAMA 1HQEA 4DSJA 4FM1A 4CESA 1IKWA 1BHLA 1C1AA 4N41A 3KKSA 3I0RA 4FM0A 3LDSA 1D8YA 5C24A 4Z4GA 2PYLA 1FK9A 4IDKA 1VSEA 1FXXA 3AVNA 2HMIA 4PUOA 3DLEA 1QSSA 2DFHA 3VN5A 1I3AA 5KGXA 4DTMA 2XY5A 1NK6A 1YTAA 1IKYA 4FJ9A 4OVLA 1ASUA 2FBVA 4B3OA 2W42A 2YNFA 4BDYA 1NOZA 5J2MA 1BI4A 1HNIA 4J2AA 1UWBA 4RG8A 2HNYA 1NK8A 1NKEA 4Z4EA 1LWFA 5J1EA 3NBPA 4CHZA 3AV9A 3C94A 2XRIA 4DTUA 2G8VA 3PO4A 1TGOA 4CJWA 1JXEA 4DFPA 1SKSA 4EZ6A 1QS4A 1NOYA 5SZTA 3MXJA 2VG7A 2LSNA 3OYGA 1RT4A 5HROA 3O3FA 1QSYA 4FJ8A 4FK0A 2ITGA 3VQDA 4OJRA 3V9XA 1QSLA 4DMNA 5KTQA 2HHSA 4DLGA 3F73A 3F9KA 4N47A 1LAWA 3K59A 1L3SA 4KTWA 4DF8A 4QCLA 2HB5A 5EU7A 4DS5A 4IKFA 2HVHA 1SV5A 3DI6A 4IFYA 2Z1JA 3A2FA 4UQGA 3SJJA 3THVA 1B92A 1CZ9A 3K5OA 4OPJA 4CJQA 4AHUA 4DU3A 4CF0A 4CJLA 2PY5A 4E7IA 5J2PA 4CGGA 4W5OA 4CE9A 4RW8A 4CF1A 3V81A 1T03A 4OKEA 4AHVA 4DSEA 2B5JA 3LPUA 4I9QA 3OS0A 1ZBLA 4CJ4A 2YNIA 3TABA 3KK3A 3HPGA 1CLQA 3P1GA 4OLBA 2WOMA 5CZ1A 4FLVA 1UAXA 5CY4A 4L8RB 4QAGA 1ASVA 3ZSWA 4B9TA 4FW2A 3I0SA 1MU2A 3AVFA 1BQNA 1C0TA 4CEEA 1DLOA 2XO7A 3KIOA 4YNQA 1BGXT 4NCAA 3DYAA 3RR7A 1K6YA 1IKVA 2Q3SA 3DOLA 4IG3A 4JRPA 4FLUA 3VA0A 4K8XA 3ZT4A 4CEDA 5HRRA 2QKBA 1RT6A 4HVJA 3OYIA 3IG1A 1TK5A 4W5RA 1UA0A 1D5AA 3M8QA 4KHSA 3NH2A 4C8OA 4Y1DA 3QEPA 4ZHRA 3MXIA 4FK4A 5JS1A 2OZSA 3OYNA 3K5NA 3S3NA 3S3OA 1U48A 3TAPA 1JLGA 2RN2A 2PZSA 3VQQA 5DMRA 4KTZA 3VQAA 3PO5A 2D0CA 4DSIA 3V6DA 2Z1IA 4O0JA 4ZTFA 3I8DA 1S1TA 1HQUA 4E7HA 4KI6A 1U47A 4J2EA 1LV5A 3SI6A 3NFAA 5E41A 3ZSZA 5J2NA 1N5YA 2YV0X 4MQ3A 4DSFA 1A5WA 1WSIA 3M8SA 4ZTJA 4RW4A 4AHRA 1Q9YA 4FJMA 1J5OA 3ISNC 1D9DA 2KQ2A 3C6TA 3QLHA 5HRSA 1S6PA 1B9FA 4K8ZA 1SKWA 2X78A 4B08A 3OYCA 3QIOA 4CGHA 4N56A 1XWLA 4C8NA 1BI4B 5HRNA 2ATQA 4NCGA 5HLFA 3HPOA 1NK4A 4J2DA 4DWIA 2YNHA 3HPHA 3OYJA 4HCBA 4LD0A 1N6QA 3B6PA 3OS1A 4AH9A 3LZJA 3KTQA 2QK9A 1IO2A 1FKOA 4BE1A 3U3GA 3IAYA 3DRRA 4BACA 4DTRA 3KLIA 4BE0A 3MXMA 1RT7A 1LAVA 1RDCA 3T1AA 4JS4A 2OA8A 2ZQBA 2D5RA 4LSLA 2XHBA 3WNGA 3KK2A 3L2WA 4DQPA 1RT2A 3AVGA 2DTUA 5T7BA 1HJRA 1LWEA 4CGJA 2A1RA 4CF9A 3CM5A 2KZZA 3ZT1A 4AHSA 4JRQA 3V9WA 1Z25A 5HBMA 4FJHA 1NK0A 2A1SA 1SUQA 3LZIA 3AA4A 3VQ9A 1WNSA 2YNGA 3LP0A 4O0IA 3D0PA 1NJYA 3ZT3A 4CHYA 4DLEA 1JL2A 1EP4A 3L2UA 2HVIA 1TL1A 3K58A 4YFUA 3ASMA 1T7PA 2HNZA 3OYEA 1LWCA 2IAJA 3HXMA 3OYHA 1BCOA 3RMDA 3HT3A 1L3UA 2KTQA 1T8EA 4AHCA 3SUNA 3LPTA 4OKJA 4CK1A 2ETJA 3NF9A 1KCFA 1YT3A 4CJ5A 4B9UA 4DSLA 3OYDA 2DY4A 1W0HA 1RT5A 3PX4A 1S1WA 4CGIA 3SPZA 1BQMA 1RBSA 1O1WA 1RDDA 4BE2A 1D9FA 3TWHA 3RRHA 2DFEA 3CFOA 1HRHA 4M3UA 3EY1A 1F21A 3SV4A 3HJFA 2I5JA 4KHUA 4FJJA 1WSGA 2QXFA 4ID1A 3AVKA 1U4BA 1U49A 3NGYA 1KSPA 4BWMA 3NH1A 4FXDA 2HW3A 1KFSA 2OZMA 4M3ZA 4CFCA 3SV3A 1S6QA 4Q5VA 1T05A 1RT3A 1NJWA 3VQCA 4ELVA 4OKKA 1VSMA 4C8KA 1C0MA 1RDBA 4FJKA 4E89A 2RF2A 3AVAA 3PUFA 3QINA 4LH5A 4M3XA 1L3VA 3K2PA 3ZSQA 4G1QA 2ZD1A 3LP1A 4FVMA 1KVAA 1EXQA 2E6MA 2PYJA 3VA3A 3JSMA 5J2QA 4KKOA 2XY6A 3BDPA 4KHQA 1JKHA 2Z1HA 3T19A 4E1MA 4B9SA 5I42A 4KHWA 1TKZA 3DM2A 4EP5A 4FYDA 4CEAA 3QNNA 4M3YA 2Y1JA 4I9LA 3SQ1A 4KREA 3AA5X 3H08A 4Z4FA 3C95A 3G0ZA 5JS2A 2E4LA 3QEIA 1TVRA 3HM9A 1KRPA 1KVCA 4CERA 4HHTA 1VSJA 3IS9A 4JS5A 3TARA 1Z26A 4CJKA 1GOBA 3UIQA 3KLEA 4PY5A 4IFVA 3HP6A 4DU1A 1W9HA 4CEBA 3MAQA 2XY7A 4FJIA 1LW2A 2ZE2A 5CZ2A 3ALYA 3L2VA 1SL1A 4M42A 4M41A 1Y97A 5SWMA 4B9NA 3NF7A 3RWUA 3AO1A 4XIUA 1C1BA 4ID5A 1RBTA 5KI6A 4CIEA 3JYTA 3HK2A 3L3UA 1S1UA 4CEZA 1A5XA 3DLRA 4KO0A 4C8MA 4F2SA 1G15A 1RDAA 1C6VA 3SZ2A 1BL3A 1JLFA 4N76A 3OS2A 1QE1A 3ULDA 4B9MA 4CJVA 1KTQA 1JLEA 3QERA 2YHAA 3AVLA 3L2RA 4RW7A 3M8RA 4M3WA 2VWJA 1CXQA 3ZT2A 3CYMA 1WSHA 4HUEA 3AA3A 4JLHA 3OYMA 1BIZA 2G8UA 4KTQA 3AVJA 1REVA 1KLMA 3NGZA 2G8HA 1U45A 2D0AA 2G8WA 3O4QA 2FBYA 4OGEA 4FW1A 3RMCA 4NYNA 3HSTB 3QEWA 2QKKA 1VSKA 3NF6A 3TANA 4CK3A 3CG7A 2G8FA 4I2PA 4CHOA 4E3SA 1XC9A 4FLWA 4KB0A 1J53A 1B9DA 3AO2A 1RNHA 4GW6A 1XI1A 2OPSA 1NK5A 3RMBA 4FZXC 2XY8A 5C25A 3LANA 1EX4A 1IKXA 2IS3A 2HHUA 4M3RA 4DQSA 1GOAA 4FLXA 3SUOA 2X6SA 3AO4A 3L3VA 4CEFA 1JLBA 1CZBA 5FROA 1WAJA 3P5JA 4CF8A 1NJZA 1QQCA 4B9LA 1WSJA 2E6LA 3WNHA 3HYFA 4B8AB 3L2QA 2P5OA 4DS4A 2IDOA 4IG0A 2JGUA 2VG6A 4CIGA 1ZYQA 2X6NA 3C6UA 4FM2A 3RRGA 3L8BA 4CJUA 3BGRA 2BDPA 4KAZA 1ZBIA 1UOCA 4CHPA 2OPRA 2GUIA 4DG1A 4BDPA 1EETA 4E0DA 4KFBA 4B8CA 4CHQA 4LH4A 4DFJA 2YKNA 3TI0A 2G8KA 2VWKA 1S1VA 3HVTA 3V1RA 3LWMA 1RTJA 3NDKA 3CQ8A 3HO1A 3ZSYA 4O4GA 4PQUA 1WLJA 4CJTA 3V9ZA 4CK2A 5HP1A 1CXUA 4E19A 1TKTA 1C0UA 1EKEA 1TK0A 1KFDA 1X9MA 1LW0A 3TAQA 5FDLA 2IOCA 5KGWA 3DLHA 4WE1A 4LSNA 3LAKA 4KI4A 2YHBA 3OJSA 2BE2A 1ZBHA 4CIFA 3QETA 1SL0A 4FJXA 1NKBA 4Z0UA 3VQPA 4FLTA 3QNOA 3T3FA 4DTSA 4KHYA 2YKMA 1NKCA 4QOZB 3WNFA 3E01A 3AO5A 3U6FA 1SKRA 1S9EA 1VSDA 4TSXA 2P5GA 1ZBUA 3KLFA 2F96A 1HNVA 2RKIA 4J2BA 3NH0A 4DF4A 4EZ9A 3TAEA 1TK8A 1RCHA 3ZSRA 2FBXA 1YVUA 4CJSA 2X74A 3KD1E 3OVNA 1IG9A 1JLCA 3ITHA 4I7FA 3SQ4A 2GV9A 1J9AA 4FLZA 3MECA 1NJXA 3VQ7A 2IC3A 5DK5A 4Z4HA 1RTIA 3S9HA 3OYLA 1VSIA 4FJ7A 1ASWA 4CFBA 1A5VA 2HNDA 2OPQA 2GBZA 4PA1A 3KLHA 3WNEA 5FRNA 1HPZA 1U04A 3AVBA 5HRPA 4W5TA 4EP4A 1JLQA 3DLBA 3ZCMA 2HHVA 2R7YA 5K14A 5FRMA 5KRSA 1ZBFA 3HL8A 3V9SA 5I3UA 4OPKA 3NE6A 3SCXA 2G8IA 3VQEA 3B6OA 1JXBA 3HVRA 4KPYA 2AJQA 4F3TA 4RW9A 4BWJA 2BGGA 4CJRA 2B6AA 1HYVA 2IGIA 1X9WA 4DTPA 4B9VA 1L5UA 1RBRA 2P51A 4M3TA 1X1PA 3OYBA 1S1XA 3QEVA 3RR8A 3NAEA 2EHGA 1HMVA 2B4JA 1XHXA 2NUBA 4W5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PX6 A;  4I2Q A;  4DFK A;  3CFR A;  1RBU A;  4H4O A;  3U3Y A;  3ZSO A;  1ITG A;  3D45 A;  3DLG A;  3M8P A;  4GMJ B;  4F4K A;  1L3T A;  1XHZ A;  3VQ6 A;  4R5P A;  2HHW A;  3TR8 A;  3CM6 A;  4E7K A;  3PY8 A;  3DLK A;  1Q9X A;  3VQ4 A;  2D0B A;  1RIL A;  4CEQ A;  4FJL A;  4FK2 A;  2F8S A;  1VSH A;  2RPI A;  1VRT A;  4CJ3 A;  4DQQ A;  2JLE A;  4FJN A;  3OJU A;  4NCB A;  4GVM A;  3OY9 A;  3AO3 A;  3QIP A;  2O4I A;  3TAG A;  4Z4C A;  4KHN A;  4ICL A;  2EX3 A;  1RTH A;  3IRX A;  4AHT A;  1BCM A;  3LP3 A;  4CJE A;  5CYQ A;  3KJV A;  4O55 A;  3MEG A;  4W5N A;  1I39 A;  1VK0 A;  3MED A;  4CGD A;  3EYZ A;  3DRS A;  4HUF A;  2KFN A;  3MEE A;  3K5L A;  3AA2 A;  4AIL C;  4F2R A;  4HCC A;  4F8R A;  3VQB A;  1S9G A;  1TAQ A;  1SL2 A;  4FZZ A;  3P83 D;  3PX0 A;  2DFF A;  4NYF A;  1TV6 A;  3NCI A;  4C8L A;  4FJG A;  2HHQ A;  4HTU A;  3QES A;  4FZY A;  1TAU A;  1X9S A;  3V1O A;  4CEO A;  2Y1I A;  1DTT A;  3ZSX A;  3O4N A;  1WSE A;  2VG5 A;  3SYZ A;  3NF8 A;  1Q8I A;  1WAF A;  1RT1 A;  1WSF A;  4CHN A;  4HUG A;  3AVI A;  1FKP A;  4O5B A;  4RW6 A;  1VRU A;  4CJF A;  4CFD A;  3DMJ A;  4CCH A;  1HYS A;  3ZT0 A;  2F8T A;  4E7J A;  3KK1 A;  4KRF A;  1RBV A;  3LWL A;  4DU4 A;  3VQ8 A;  1TKD A;  3AVH A;  3RTV A;  4N5S A;  4KB1 A;  4DTX A;  3TAF A;  4FJ5 A;  3SUP A;  2HHX A;  3CFP A;  4KV8 A;  2OPP A;  1YTU A;  3EZ5 A;  4M45 A;  4CF2 A;  3O3G A;  3O3H A;  4DSK A;  5KRT A;  1VSL A;  4OGC A;  4CJP A;  4FLY A;  1C1C A;  3QO9 A;  5C42 A;  1RTD A;  3NGI A;  4E1N A;  4DQR A;  3OYK A;  4O44 A;  2HHT A;  3AVM A;  4E7L A;  3LP2 A;  1R0A A;  1QHT A;  3FFI A;  3LAM A;  3LAL A;  4DTN A;  1BIU A;  3V1Q A;  2KZM A;  2FC0 A;  1DTQ A;  3V9U A;  3KKR A;  3K57 A;  3DOK A;  1JL1 A;  4DFM A;  3V4I A;  2KFZ A;  3DRP A;  1S5J A;  3OYA A;  3SPY A;  5CYM A;  1TKX A;  3G10 A;  4DTO A;  2KW4 A;  3SNN A;  2BAN A;  4H4M A;  4BDZ A;  4FCY A;  4Z4I A;  1KLN A;  3KLG A;  1TL3 A;  4DQI A;  1NK7 A;  1HYZ A;  4F3O A;  1WN7 A;  2O4G A;  4LY7 A;  4MFB A;  1GOC A;  2Z1G A;  4OLA A;  3PV8 A;  1UA1 A;  1VSF A;  3VQ5 A;  3RMA A;  4PWD A;  2WON A;  3ZSV A;  1J54 A;  4ELT A;  4Q0B A;  3AVC A;  2P1J A;  3SQ0 A;  3HP9 A;  4CFA A;  1IH7 A;  4IBN A;  3OYF A;  1KVB A;  4H8K A;  4DTJ A;  1QTM A;  2OYQ A;  2FBT A;  4CEC A;  1BIS A;  3SQ2 A;  3K5M A;  3S3M A;  4ELU A;  3NHG A;  1NK9 A;  3KD5 E;  5D3G A;  4CGF A;  1JLA A;  3SUQ A;  4Y1C A;  3QEX A;  3TAM A;  1HQE A;  4DSJ A;  4FM1 A;  4CES A;  1IKW A;  1BHL A;  1C1A A;  4N41 A;  3KKS A;  3I0R A;  4FM0 A;  3LDS A;  1D8Y A;  5C24 A;  4Z4G A;  2PYL A;  1FK9 A;  4IDK A;  1VSE A;  1FXX A;  3AVN A;  2HMI A;  4PUO A;  3DLE A;  1QSS A;  2DFH A;  3VN5 A;  1I3A A;  5KGX A;  4DTM A;  2XY5 A;  1NK6 A;  1YTA A;  1IKY A;  4FJ9 A;  4OVL A;  1ASU A;  2FBV A;  4B3O A;  2W42 A;  2YNF A;  4BDY A;  1NOZ A;  5J2M A;  1BI4 A;  1HNI A;  4J2A A;  1UWB A;  4RG8 A;  2HNY A;  1NK8 A;  1NKE A;  4Z4E A;  1LWF A;  5J1E A;  3NBP A;  4CHZ A;  3AV9 A;  3C94 A;  2XRI A;  4DTU A;  2G8V A;  3PO4 A;  1TGO A;  4CJW A;  1JXE A;  4DFP A;  1SKS A;  4EZ6 A;  1QS4 A;  1NOY A;  5SZT A;  3MXJ A;  2VG7 A;  2LSN A;  3OYG A;  1RT4 A;  5HRO A;  3O3F A;  1QSY A;  4FJ8 A;  4FK0 A;  2ITG A;  3VQD A;  4OJR A;  3V9X A;  1QSL A;  4DMN A;  5KTQ A;  2HHS A;  4DLG A;  3F73 A;  3F9K A;  4N47 A;  1LAW A;  3K59 A;  1L3S A;  4KTW A;  4DF8 A;  4QCL A;  2HB5 A;  5EU7 A;  4DS5 A;  4IKF A;  2HVH A;  1SV5 A;  3DI6 A;  4IFY A;  2Z1J A;  3A2F A;  4UQG A;  3SJJ A;  3THV A;  1B92 A;  1CZ9 A;  3K5O A;  4OPJ A;  4CJQ A;  4AHU A;  4DU3 A;  4CF0 A;  4CJL A;  2PY5 A;  4E7I A;  5J2P A;  4CGG A;  4W5O A;  4CE9 A;  4RW8 A;  4CF1 A;  3V81 A;  1T03 A;  4OKE A;  4AHV A;  4DSE A;  2B5J A;  3LPU A;  4I9Q A;  3OS0 A;  1ZBL A;  4CJ4 A;  2YNI A;  3TAB A;  3KK3 A;  3HPG A;  1CLQ A;  3P1G A;  4OLB A;  2WOM A;  5CZ1 A;  4FLV A;  1UAX A;  5CY4 A;  4L8R B;  4QAG A;  1ASV A;  3ZSW A;  4B9T A;  4FW2 A;  3I0S A;  1MU2 A;  3AVF A;  1BQN A;  1C0T A;  4CEE A;  1DLO A;  2XO7 A;  3KIO A;  4YNQ A;  1BGX T;  4NCA A;  3DYA A;  3RR7 A;  1K6Y A;  1IKV A;  2Q3S A;  3DOL A;  4IG3 A;  4JRP A;  4FLU A;  3VA0 A;  4K8X A;  3ZT4 A;  4CED A;  5HRR A;  2QKB A;  1RT6 A;  4HVJ A;  3OYI A;  3IG1 A;  1TK5 A;  4W5R A;  1UA0 A;  1D5A A;  3M8Q A;  4KHS A;  3NH2 A;  4C8O A;  4Y1D A;  3QEP A;  4ZHR A;  3MXI A;  4FK4 A;  5JS1 A;  2OZS A;  3OYN A;  3K5N A;  3S3N A;  3S3O A;  1U48 A;  3TAP A;  1JLG A;  2RN2 A;  2PZS A;  3VQQ A;  5DMR A;  4KTZ A;  3VQA A;  3PO5 A;  2D0C A;  4DSI A;  3V6D A;  2Z1I A;  4O0J A;  4ZTF A;  3I8D A;  1S1T A;  1HQU A;  4E7H A;  4KI6 A;  1U47 A;  4J2E A;  1LV5 A;  3SI6 A;  3NFA A;  5E41 A;  3ZSZ A;  5J2N A;  1N5Y A;  2YV0 X;  4MQ3 A;  4DSF A;  1A5W A;  1WSI A;  3M8S A;  4ZTJ A;  4RW4 A;  4AHR A;  1Q9Y A;  4FJM A;  1J5O A;  3ISN C;  1D9D A;  2KQ2 A;  3C6T A;  3QLH A;  5HRS A;  1S6P A;  1B9F A;  4K8Z A;  1SKW A;  2X78 A;  4B08 A;  3OYC A;  3QIO A;  4CGH A;  4N56 A;  1XWL A;  4C8N A;  1BI4 B;  5HRN A;  2ATQ A;  4NCG A;  5HLF A;  3HPO A;  1NK4 A;  4J2D A;  4DWI A;  2YNH A;  3HPH A;  3OYJ A;  4HCB A;  4LD0 A;  1N6Q A;  3B6P A;  3OS1 A;  4AH9 A;  3LZJ A;  3KTQ A;  2QK9 A;  1IO2 A;  1FKO A;  4BE1 A;  3U3G A;  3IAY A;  3DRR A;  4BAC A;  4DTR A;  3KLI A;  4BE0 A;  3MXM A;  1RT7 A;  1LAV A;  1RDC A;  3T1A A;  4JS4 A;  2OA8 A;  2ZQB A;  2D5R A;  4LSL A;  2XHB A;  3WNG A;  3KK2 A;  3L2W A;  4DQP A;  1RT2 A;  3AVG A;  2DTU A;  5T7B A;  1HJR A;  1LWE A;  4CGJ A;  2A1R A;  4CF9 A;  3CM5 A;  2KZZ A;  3ZT1 A;  4AHS A;  4JRQ A;  3V9W A;  1Z25 A;  5HBM A;  4FJH A;  1NK0 A;  2A1S A;  1SUQ A;  3LZI A;  3AA4 A;  3VQ9 A;  1WNS A;  2YNG A;  3LP0 A;  4O0I A;  3D0P A;  1NJY A;  3ZT3 A;  4CHY A;  4DLE A;  1JL2 A;  1EP4 A;  3L2U A;  2HVI A;  1TL1 A;  3K58 A;  4YFU A;  3ASM A;  1T7P A;  2HNZ A;  3OYE A;  1LWC A;  2IAJ A;  3HXM A;  3OYH A;  1BCO A;  3RMD A;  3HT3 A;  1L3U A;  2KTQ A;  1T8E A;  4AHC A;  3SUN A;  3LPT A;  4OKJ A;  4CK1 A;  2ETJ A;  3NF9 A;  1KCF A;  1YT3 A;  4CJ5 A;  4B9U A;  4DSL A;  3OYD A;  2DY4 A;  1W0H A;  1RT5 A;  3PX4 A;  1S1W A;  4CGI A;  3SPZ A;  1BQM A;  1RBS A;  1O1W A;  1RDD A;  4BE2 A;  1D9F A;  3TWH A;  3RRH A;  2DFE A;  3CFO A;  1HRH A;  4M3U A;  3EY1 A;  1F21 A;  3SV4 A;  3HJF A;  2I5J A;  4KHU A;  4FJJ A;  1WSG A;  2QXF A;  4ID1 A;  3AVK A;  1U4B A;  1U49 A;  3NGY A;  1KSP A;  4BWM A;  3NH1 A;  4FXD A;  2HW3 A;  1KFS A;  2OZM A;  4M3Z A;  4CFC A;  3SV3 A;  1S6Q A;  4Q5V A;  1T05 A;  1RT3 A;  1NJW A;  3VQC A;  4ELV A;  4OKK A;  1VSM A;  4C8K A;  1C0M A;  1RDB A;  4FJK A;  4E89 A;  2RF2 A;  3AVA A;  3PUF A;  3QIN A;  4LH5 A;  4M3X A;  1L3V A;  3K2P A;  3ZSQ A;  4G1Q A;  2ZD1 A;  3LP1 A;  4FVM A;  1KVA A;  1EXQ A;  2E6M A;  2PYJ A;  3VA3 A;  3JSM A;  5J2Q A;  4KKO A;  2XY6 A;  3BDP A;  4KHQ A;  1JKH A;  2Z1H A;  3T19 A;  4E1M A;  4B9S A;  5I42 A;  4KHW A;  1TKZ A;  3DM2 A;  4EP5 A;  4FYD A;  4CEA A;  3QNN A;  4M3Y A;  2Y1J A;  4I9L A;  3SQ1 A;  4KRE A;  3AA5 X;  3H08 A;  4Z4F A;  3C95 A;  3G0Z A;  5JS2 A;  2E4L A;  3QEI A;  1TVR A;  3HM9 A;  1KRP A;  1KVC A;  4CER A;  4HHT A;  1VSJ A;  3IS9 A;  4JS5 A;  3TAR A;  1Z26 A;  4CJK A;  1GOB A;  3UIQ A;  3KLE A;  4PY5 A;  4IFV A;  3HP6 A;  4DU1 A;  1W9H A;  4CEB A;  3MAQ A;  2XY7 A;  4FJI A;  1LW2 A;  2ZE2 A;  5CZ2 A;  3ALY A;  3L2V A;  1SL1 A;  4M42 A;  4M41 A;  1Y97 A;  5SWM A;  4B9N A;  3NF7 A;  3RWU A;  3AO1 A;  4XIU A;  1C1B A;  4ID5 A;  1RBT A;  5KI6 A;  4CIE A;  3JYT A;  3HK2 A;  3L3U A;  1S1U A;  4CEZ A;  1A5X A;  3DLR A;  4KO0 A;  4C8M A;  4F2S A;  1G15 A;  1RDA A;  1C6V A;  3SZ2 A;  1BL3 A;  1JLF A;  4N76 A;  3OS2 A;  1QE1 A;  3ULD A;  4B9M A;  4CJV A;  1KTQ A;  1JLE A;  3QER A;  2YHA A;  3AVL A;  3L2R A;  4RW7 A;  3M8R A;  4M3W A;  2VWJ A;  1CXQ A;  3ZT2 A;  3CYM A;  1WSH A;  4HUE A;  3AA3 A;  4JLH A;  3OYM A;  1BIZ A;  2G8U A;  4KTQ A;  3AVJ A;  1REV A;  1KLM A;  3NGZ A;  2G8H A;  1U45 A;  2D0A A;  2G8W A;  3O4Q A;  2FBY A;  4OGE A;  4FW1 A;  3RMC A;  4NYN A;  3HST B;  3QEW A;  2QKK A;  1VSK A;  3NF6 A;  3TAN A;  4CK3 A;  3CG7 A;  2G8F A;  4I2P A;  4CHO A;  4E3S A;  1XC9 A;  4FLW A;  4KB0 A;  1J53 A;  1B9D A;  3AO2 A;  1RNH A;  4GW6 A;  1XI1 A;  2OPS A;  1NK5 A;  3RMB A;  4FZX C;  2XY8 A;  5C25 A;  3LAN A;  1EX4 A;  1IKX A;  2IS3 A;  2HHU A;  4M3R A;  4DQS A;  1GOA A;  4FLX A;  3SUO A;  2X6S A;  3AO4 A;  3L3V A;  4CEF A;  1JLB A;  1CZB A;  5FRO A;  1WAJ A;  3P5J A;  4CF8 A;  1NJZ A;  1QQC A;  4B9L A;  1WSJ A;  2E6L A;  3WNH A;  3HYF A;  4B8A B;  3L2Q A;  2P5O A;  4DS4 A;  2IDO A;  4IG0 A;  2JGU A;  2VG6 A;  4CIG A;  1ZYQ A;  2X6N A;  3C6U A;  4FM2 A;  3RRG A;  3L8B A;  4CJU A;  3BGR A;  2BDP A;  4KAZ A;  1ZBI A;  1UOC A;  4CHP A;  2OPR A;  2GUI A;  4DG1 A;  4BDP A;  1EET A;  4E0D A;  4KFB A;  4B8C A;  4CHQ A;  4LH4 A;  4DFJ A;  2YKN A;  3TI0 A;  2G8K A;  2VWK A;  1S1V A;  3HVT A;  3V1R A;  3LWM A;  1RTJ A;  3NDK A;  3CQ8 A;  3HO1 A;  3ZSY A;  4O4G A;  4PQU A;  1WLJ A;  4CJT A;  3V9Z A;  4CK2 A;  5HP1 A;  1CXU A;  4E19 A;  1TKT A;  1C0U A;  1EKE A;  1TK0 A;  1KFD A;  1X9M A;  1LW0 A;  3TAQ A;  5FDL A;  2IOC A;  5KGW A;  3DLH A;  4WE1 A;  4LSN A;  3LAK A;  4KI4 A;  2YHB A;  3OJS A;  2BE2 A;  1ZBH A;  4CIF A;  3QET A;  1SL0 A;  4FJX A;  1NKB A;  4Z0U A;  3VQP A;  4FLT A;  3QNO A;  3T3F A;  4DTS A;  4KHY A;  2YKM A;  1NKC A;  4QOZ B;  3WNF A;  3E01 A;  3AO5 A;  3U6F A;  1SKR A;  1S9E A;  1VSD A;  4TSX A;  2P5G A;  1ZBU A;  3KLF A;  2F96 A;  1HNV A;  2RKI A;  4J2B A;  3NH0 A;  4DF4 A;  4EZ9 A;  3TAE A;  1TK8 A;  1RCH A;  3ZSR A;  2FBX A;  1YVU A;  4CJS A;  2X74 A;  3KD1 E;  3OVN A;  1IG9 A;  1JLC A;  3ITH A;  4I7F A;  3SQ4 A;  2GV9 A;  1J9A A;  4FLZ A;  3MEC A;  1NJX A;  3VQ7 A;  2IC3 A;  5DK5 A;  4Z4H A;  1RTI A;  3S9H A;  3OYL A;  1VSI A;  4FJ7 A;  1ASW A;  4CFB A;  1A5V A;  2HND A;  2OPQ A;  2GBZ A;  4PA1 A;  3KLH A;  3WNE A;  5FRN A;  1HPZ A;  1U04 A;  3AVB A;  5HRP A;  4W5T A;  4EP4 A;  1JLQ A;  3DLB A;  3ZCM A;  2HHV A;  2R7Y A;  5K14 A;  5FRM A;  5KRS A;  1ZBF A;  3HL8 A;  3V9S A;  5I3U A;  4OPK A;  3NE6 A;  3SCX A;  2G8I A;  3VQE A;  3B6O A;  1JXB A;  3HVR A;  4KPY A;  2AJQ A;  4F3T A;  4RW9 A;  4BWJ A;  2BGG A;  4CJR A;  2B6A A;  1HYV A;  2IGI A;  1X9W A;  4DTP A;  4B9V A;  1L5U A;  1RBR A;  2P51 A;  4M3T A;  1X1P A;  3OYB A;  1S1X A;  3QEV A;  3RR8 A;  3NAE A;  2EHG A;  1HMV A;  2B4J A;  1XHX A;  2NUB A;  4W5Q A; 
#chains in the Genus database with same CATH topology
 3PX6 A;  4B3S K;  3D45 A;  4FL9 A;  5EXW A;  2HHW A;  3VER A;  3VQ6 A;  4E7K A;  1Q9X A;  4CEQ A;  1VSH A;  2JLE A;  3F9M A;  4NCB A;  3G71 N;  4DR1 K;  3D2F B;  3AO3 A;  3QIP A;  4C23 A;  4ICL A;  2OAN A;  5CHI A;  1BCM A;  4CJE A;  3KJV A;  3MEG A;  4H5V A;  3MEE A;  5BPL A;  4AIL C;  4F2R A;  3IKM A;  4F8R A;  4BRI A;  5BR8 K;  4CW7 B;  1SL2 A;  4BR7 A;  2DFF A;  4ISG A;  1TV6 A;  1HUX A;  4C8L A;  2GWJ A;  4FZY A;  3O4W A;  1X9S A;  3FFK B;  2Y1I A;  4DR4 K;  1DTT A;  2I7N A;  3CPE A;  3SYZ A;  3JAM O;  1Q8I A;  5GAD P;  5AJ3 K;  3AVI A;  1FKP A;  5AQG A;  1Q82 O;  1VRU A;  4CCH A;  4JK9 A;  3ZT0 A;  4E7J A;  3KK1 A;  2O8E A;  4YOX A;  2O8B B;  3AVH A;  4N5S A;  4DTX A;  3TAF A;  2E8A A;  4KV8 A;  4DSK A;  4JKF A;  3O3G A;  4FWN A;  1DEJ A;  4OGC A;  1C1C A;  5CE3 A;  4PHT X;  4E1N A;  4DQR A;  1X9J A;  3FFI A;  3LAM A;  4DTN A;  3V1Q A;  1DTQ A;  4XH5 A;  5AQH A;  3V4I A;  2KFZ A;  1HKG A;  3DRP A;  3UE5 A;  1S5J A;  3SNN A;  1NNE A;  1JCE A;  4BDZ A;  4FCY A;  4Z4I A;  3KLG A;  1TUY A;  3C6A A;  1QVF M;  4F3O A;  1WN7 A;  3M6G A;  4MFB A;  2Z1G A;  5EVZ A;  3RMA A;  3WQT A;  3EKS A;  3CCS N;  1HX1 A;  1YVN A;  3HP9 A;  3OYF A;  4O8U A;  4CEC A;  3KD5 E;  2DPN A;  5D3G A;  4A59 A;  3SUQ A;  4Y1C A;  3QEX A;  4IWV A;  2UXD K;  5EX5 A;  3U9Z A;  1C1A A;  3CCE N;  2ZGZ A;  3O6W A;  3LDS A;  2CH6 A;  2HMI A;  3AVN A;  3J7A P;  2P9N A;  1QSS A;  3VN5 A;  2O8D A;  1IKY A;  3LDP A;  4DR6 K;  2FBV A;  2Q2R A;  2W42 A;  1T3V A;  1G99 A;  5J2M A;  1KD1 O;  3P38 A;  2GEL A;  2HNY A;  4GVE A;  4YOY A;  1NKE A;  4Z4E A;  3O08 A;  1P90 A;  4CJW A;  5EY4 A;  2QW9 A;  1SKS A;  4BR2 A;  1XQS C;  2P9U A;  2VG7 A;  3OYG A;  2E2P A;  4CZI A;  4YOU A;  3BP8 A;  4RWT A;  4FK0 A;  4FJ8 A;  4L3Q A;  5FPM A;  4DMN A;  2W6L A;  1ATN A;  3F9K A;  1GLF O;  2WFB A;  4DF8 A;  5BRH A;  5EU7 A;  4DS5 A;  3A5M C;  2Z1J A;  4UQG A;  1ATS A;  4JYA K;  4DU3 A;  4CF0 A;  4H0T B;  4E7I A;  1VQM N;  1CZA N;  3GE1 A;  3V81 A;  3WEE B;  1YJN N;  1RDW X;  4EFH A;  2YNI A;  3I8B A;  2WOM A;  4FLV A;  5AZI A;  1UAX A;  4B9T A;  1MU2 A;  3G25 A;  4CEE A;  1DLO A;  4B1X B;  3THY A;  3KIO A;  4YNQ A;  4FWR A;  3J81 O;  4XH1 A;  2Q3S A;  4JRP A;  1YIJ N;  3ZT4 A;  4DB3 A;  2QKB A;  3OYI A;  3M8Q A;  4U67 L;  1M90 O;  2UUC K;  5DMR A;  2Z1I A;  1S1T A;  4H0O A;  4E7H A;  3NFA A;  5J2N A;  3ULE A;  2YV0 X;  1BA1 A;  1WSI A;  3M8S A;  4ZTJ A;  3U4L A;  1J5O A;  1D9D A;  3C6T A;  3QLH A;  4JHD B;  1OH6 A;  1B9F A;  1VQK N;  1SKW A;  5BRF A;  4YOR A;  4C8N A;  3HPO A;  4BRD A;  3HPH A;  3A0I X;  4LD0 A;  3LZJ A;  2QK9 A;  2O8C A;  1FKO A;  3U3G A;  3CC7 N;  4BY9 C;  4DV1 K;  1K8K B;  3KLI A;  2YHX A;  1LAV A;  4LF5 K;  5M1N A;  2VCP A;  4BRP A;  2ZQB A;  3L2W A;  4DQP A;  4CF9 A;  3NVK A;  3EEQ A;  4O5F A;  2A1S A;  3AA4 A;  3QFP A;  1WNS A;  2YNG A;  3LP0 A;  1Q86 O;  1EQY A;  2OTL N;  2KHO A;  1TL1 A;  1OH8 A;  4LF7 K;  3HXM A;  3OYH A;  3HM8 A;  2KTQ A;  2E2N A;  5AQQ A;  3SUN A;  2PFU A;  1YT3 A;  2DY4 A;  3EO3 A;  4KH5 A;  3PX4 A;  1S1W A;  1EO1 A;  2D4W A;  4CZJ A;  4LFC K;  4BE2 A;  3CXC M;  3HJF A;  3RVC A;  4FJJ A;  4FXD A;  3NGY A;  5BPM A;  3GOI A;  2OZM A;  4M3Z A;  3SV3 A;  3ENO A;  4ELV A;  4BR5 A;  1C0M A;  2HHH K;  1EWQ A;  3QIN A;  3ZSQ A;  4GKJ K;  3VA3 A;  5J2Q A;  3U8X A;  4KHQ A;  1XNQ K;  3BEX A;  5I42 A;  1TKZ A;  3DM2 A;  4KRE A;  3AA5 X;  3TU5 A;  4R79 A;  4JS5 A;  4CJK A;  1GOB A;  2HBL A;  3KLE A;  3JXU A;  3HP6 A;  2BUP A;  4EHU A;  1LW2 A;  4QS7 A;  2VGN A;  4M41 A;  5SWM A;  4DV2 K;  1M1K O;  2P9L A;  5KI6 A;  3UKU B;  3HK2 A;  4F2S A;  1A5X A;  4C8M A;  3TTF A;  1XUP O;  3QIC A;  4B9M A;  4CD3 A;  5HOO A;  4M3W A;  3M8R A;  4IJA A;  1NWK A;  3OYM A;  4H0V B;  1REV A;  4PL7 A;  2E88 A;  1DKG D;  1KXP A;  3O4Q A;  4FW1 A;  4CBX A;  2W6K A;  1VSK A;  1VHX A;  4E3S A;  3CJ9 A;  1XI1 A;  1NK5 A;  1NGG A;  3NVM A;  2HHU A;  5JVH L;  2QM1 A;  1BDG A;  3SJH A;  2CGK A;  5FRO A;  1WAJ A;  3P5J A;  1NG9 A;  4B1V A;  4JI4 K;  1WSJ A;  4NB4 A;  2O8F B;  4EIA A;  3W0L A;  4DR3 K;  4DS4 A;  1QZ5 A;  4IG0 A;  3D7E O;  2X6N A;  4FM2 A;  3BGR A;  1ZBI A;  3P31 A;  2HMP A;  3LDQ A;  1TYQ A;  3UKR B;  1S1V A;  3V1R A;  3CQ8 A;  5TKY A;  3ZSY A;  4PQU A;  3V9Z A;  2QEX N;  4CK2 A;  2NLX A;  1CXU A;  3FGU A;  5HP1 A;  3VMF B;  4ILG B;  1X9M A;  5FDL A;  4AF1 A;  5KGW A;  3DLH A;  1HLU A;  1KAX A;  4BRQ A;  1U2V B;  3OJS A;  1SL0 A;  4BRA A;  3THW B;  5C2D A;  4Z0U A;  5GIO A;  1VQ5 N;  3WNF A;  3E01 A;  4BRH A;  1S9E A;  3KLF A;  2RKI A;  3NH0 A;  5AR0 A;  3TSP A;  1XMO K;  2FBX A;  1YVU A;  1IG9 A;  4CZK A;  2GV9 A;  3VTH A;  1J9A A;  1V4T A;  4FWQ A;  3QB0 A;  3O80 A;  2IC3 A;  4Z4H A;  1VQP N;  2V7Y A;  1RDU A;  1VSI A;  4DQ8 A;  4YOW A;  1ASW A;  4O8K A;  5KQD A;  2GBZ A;  3AVB A;  4HWI A;  1JLQ A;  3DLB A;  2Q1N A;  4FPA A;  3ZX0 A;  5M1O A;  3V9S A;  3AAP A;  2GEM A;  4WQ4 C;  1QHA A;  4CJR A;  4A5B A;  2B6A A;  4DUY K;  1RBR A;  3OYB A;  4LFB K;  3M1F A;  3SLC A;  2CGJ A;  5KPT A;  3NAE A;  3A5O C;  3O1W A;  2NUB A;  1RBU A;  4H4O A;  1ITG A;  4FJ7 A;  3DLG A;  3FZF A;  4NLB A;  4F4K A;  1L3T A;  1XHZ A;  3PY8 A;  4FK2 A;  1NU0 A;  4FJN A;  3OJU A;  3HTV A;  1WUA A;  3OY9 A;  2O4I A;  3TAG A;  2ZJR L;  4Z4C A;  4KHN A;  5EOY A;  1RTH A;  4JKD A;  3O5B A;  4BC5 A;  4AHT A;  3LP3 A;  3MX2 A;  2NNW A;  2UXC K;  1I39 A;  3I33 A;  4FWS A;  4HUF A;  2KFN A;  3AA2 A;  4HCC A;  4FVU A;  4FJG A;  4CZE A;  3VGM A;  4CEO A;  4J8F A;  2GTD A;  3E9P A;  3ZYY X;  1WSE A;  1WAF A;  1RT1 A;  3WXI A;  4HUG A;  4RW6 A;  4CJF A;  4CFD A;  1HYS A;  2F8T A;  4KRF A;  3SAH A;  4DU4 A;  4FWM A;  4FJ5 A;  3CJ7 A;  3SUP A;  3ZX3 A;  3EKU A;  2OPP A;  5KRT A;  3WT0 A;  4CJP A;  2P9I A;  2F9T A;  4I6M B;  5TKW A;  4Z94 A;  4FWP A;  2GX9 A;  4MDA A;  4O44 A;  3AVM A;  3LP2 A;  4CZF A;  3LAL A;  2FC0 A;  4AQY K;  1JL1 A;  4DV5 K;  3G10 A;  3CCV N;  2KW4 A;  5FPN A;  4IOX A;  2BAN A;  4DKW A;  4LF4 K;  1KLN A;  1TL3 A;  3EN9 A;  2O4G A;  4LY7 A;  4DR2 K;  3PV8 A;  4JKH A;  4WF9 L;  5KPZ A;  5M1P A;  1QQO A;  3QML A;  1MDU B;  3AVC A;  4BRE A;  4H8K A;  1IBL K;  2FBT A;  3SQ2 A;  1BIS A;  1W97 L;  3NHG A;  2WTU A;  1NK9 A;  4UY8 O;  1JLA A;  3O9Q A;  2PBD A;  3G4S N;  1NGI A;  2QI2 A;  4B1Z A;  4YHH K;  1IKW A;  1BHL A;  1HPM A;  4N41 A;  3KKS A;  4KH6 A;  3I0R A;  4FM0 A;  4Z4G A;  3KHY A;  1FK9 A;  1SS6 A;  3DLE A;  3CCU N;  5BPN A;  2XY5 A;  3PSF A;  1YTA A;  1YJW N;  5M1Q A;  4B3O A;  1BI4 A;  3DWL A;  1LWF A;  3VPZ A;  3CC4 N;  4JI0 K;  3WXJ A;  1ZXO A;  3C94 A;  4DTU A;  2NZT A;  4IEI A;  5AQZ A;  1JXE A;  4BRL A;  2IIR A;  4DFP A;  4B1Y B;  1QS4 A;  1NOY A;  1ILY A;  4BRN A;  4FWL A;  2LSN A;  5HRO A;  1RT4 A;  5LL6 Z;  3O3F A;  3VQD A;  4OJR A;  3V9X A;  4N47 A;  3A5L C;  1L3S A;  4KTW A;  3P4I A;  3GG4 A;  4X64 K;  3A2F A;  4ILJ A;  3SJJ A;  1CZ9 A;  3K5O A;  4OPJ A;  3C65 A;  4CD1 A;  4CJQ A;  4AHU A;  2PY5 A;  4B9Q A;  4CGG A;  5AQL A;  4JI2 K;  2UUA K;  1E4F T;  2VWB A;  3C0B A;  3PIP L;  3LM9 A;  3TAB A;  4BRG A;  2BTF A;  3P1G A;  4YOT A;  1ASV A;  3ZSW A;  3I0S A;  1C0T A;  4H0Y B;  3R3L A;  5AQM A;  1BGX T;  4NCA A;  1DT9 A;  3CMA N;  4FLU A;  5HRR A;  3VGK A;  1YJ9 N;  3NH2 A;  4C8O A;  4FK4 A;  2OZS A;  1N34 K;  1U48 A;  2PZS A;  2RN2 A;  3PO5 A;  4KTZ A;  4MLH A;  4DSI A;  3V6D A;  4O0J A;  4CBW A;  4J2E A;  1EWR A;  4CVN E;  4AM7 A;  3DXM B;  4AHR A;  2NRX A;  1K9M O;  2NRH A;  3J80 O;  3ISN C;  4YDU C;  5HRS A;  1S6P A;  4DV0 K;  2V7Z A;  4K8Z A;  1HNW K;  1KAZ A;  2X78 A;  4B08 A;  3DAW A;  4CGH A;  1XWL A;  2RHK A;  2P9S A;  4C1N K;  2YNH A;  4DWI A;  3C7N A;  4B3T K;  2YX6 A;  3IAY A;  3TTD A;  1VQ8 N;  1RT7 A;  2YHW A;  4LSL A;  2D5R A;  2UU9 K;  1RT2 A;  1WB9 A;  2DTU A;  5T7B A;  1HJR A;  2Q36 A;  2HF4 A;  2KZZ A;  3ZT1 A;  4KH4 A;  4AHS A;  3V9W A;  5HBM A;  4FJH A;  1NK0 A;  1MA9 B;  2D1K A;  3H1V X;  3D0P A;  5E84 A;  3T1Y K;  3ZT3 A;  3AGK A;  5AFU A;  3ASM A;  2HNZ A;  2IAJ A;  3VF4 A;  5AFU H;  5DM7 L;  2ASM A;  5F0X A;  1L3U A;  4PKH A;  1T8E A;  4AM6 A;  3HZ6 A;  4AHC A;  3S41 A;  1GLD G;  3EZW A;  3OYD A;  4MLE A;  4K41 A;  1RDD A;  2WC9 A;  1KQS M;  1HRH A;  2JWL A;  3VGL A;  3EY1 A;  1IG8 A;  2I5J A;  2QXF A;  1KSP A;  3THX A;  3GL1 A;  1LCU A;  4CFC A;  1S6Q A;  4BRF A;  1VSM A;  4FO0 A;  2YHY A;  4LH5 A;  4K43 A;  3VEN A;  1L3V A;  3HI0 A;  1RFQ A;  3LP1 A;  2NRZ A;  3ENH A;  4OPA A;  4CZG A;  4E1J A;  1HNX K;  4FVM A;  1KVA A;  1EXQ A;  5AZJ A;  4FSV A;  2Z1H A;  3L4Q A;  4EP5 A;  1QQM A;  3ZEU B;  4CEA A;  4KHP K;  3CER A;  4CZH A;  1S3X A;  3M3Z A;  4WQ4 A;  1OKJ A;  1KRP A;  4CER A;  4HHT A;  1VSJ A;  2IVO A;  1Z26 A;  2OCE A;  4RTF D;  3RSE A;  4PY5 A;  4DU1 A;  5AQF A;  3WXL A;  5H1S Q;  2A40 A;  4FWO A;  5CZ2 A;  2ZE2 A;  4IO9 L;  4JKB A;  3TTC A;  2IVP A;  3ZET A;  4WYB A;  1C1B A;  4CBU A;  1S1U A;  3MWP A;  1S22 A;  2RE2 A;  2Q97 A;  1G15 A;  1C6V A;  1BL3 A;  1QE1 A;  5AQT A;  4CJV A;  1KTQ A;  1JLE A;  5AQI A;  4DV6 K;  1CXQ A;  3ZT2 A;  3CCJ N;  4HUE A;  1BIZ A;  4KTQ A;  3AVJ A;  1KLM A;  2G8H A;  2D0A A;  4OGE A;  4NYN A;  3HST B;  3QEW A;  2QKK A;  1GLA G;  2G8F A;  3D2E B;  4I2P A;  5GIN A;  4KB0 A;  1J53 A;  2OPS A;  3ZLJ A;  4FZX C;  5C25 A;  2P9K B;  3LAN A;  2F4V K;  1NGF A;  1GOA A;  4B3R K;  3CIP A;  3SUO A;  3AO4 A;  1BWF O;  2P9P B;  1JLB A;  4JD2 A;  1MWM A;  4FOE A;  4CF8 A;  4PL8 A;  3L2Q A;  3OBW A;  2IDO A;  5C10 A;  3PIO L;  3CD6 N;  3MN5 A;  3C6U A;  3CQY A;  3L8B A;  3D2F A;  1OH7 A;  4CHP A;  1EET A;  2ZJQ L;  4E0D A;  4B8C A;  3TI0 A;  2NRT A;  4JNE A;  3NDK A;  3HVT A;  5C12 A;  3E9O A;  4CJT A;  1E3M A;  5C0Y A;  5F1X A;  2QWQ A;  1LW0 A;  1NGD A;  4BR0 A;  4GY2 B;  4KI4 A;  2YHB A;  2J4R A;  2BE2 A;  5BR9 A;  1ZBH A;  4CIF A;  4JI6 K;  3QNO A;  4DTS A;  4KHY A;  1VQ9 N;  2O8B A;  3AO5 A;  5FLX O;  1HJO A;  2F96 A;  1X3M A;  4GKK K;  1RCH A;  2QWR A;  4CJS A;  1NGE A;  2X74 A;  3OVN A;  1JLC A;  3ITH A;  2E2Q A;  1BOT O;  4JI1 K;  1RTI A;  4X62 K;  2QWL A;  3KLH A;  2WBN A;  3OBY A;  1DGK N;  4KBO A;  5FRM A;  5KRS A;  1O13 A;  3NE6 A;  3OHR A;  3I56 N;  3AAR A;  3VEZ A;  1VQ7 N;  1VQN N;  1NMD A;  1NGA A;  2P51 A;  4M3T A;  4IXC A;  3DXK A;  4H0P A;  3CCL N;  2EHG A;  3A8Y A;  3H46 O;  2B4J A;  4B3M K;  4W5Q A;  4DFK A;  3U3Y A;  1HKB A;  2Q0U A;  3ZSO A;  3M8P A;  3CJ1 A;  5B8H A;  2NRW A;  4R5P A;  3DLK A;  4FJL A;  3VQ4 A;  2F8S A;  1VRT A;  1R59 O;  3BF1 A;  1NGC A;  3J7Y P;  2EX3 A;  3IRX A;  5AQY A;  4H03 B;  4O55 A;  1Z05 A;  3MED A;  3EYZ A;  4F9O A;  3DRS A;  3IDH A;  3K5L A;  3VQB A;  3MMV A;  1OVQ A;  4CZL A;  4DHY A;  2HHQ A;  3NCI A;  1J5E K;  3QES A;  1TAU A;  3V1O A;  2BH1 A;  3ZSX A;  2VG5 A;  3NF8 A;  1WSF A;  3DMJ A;  1RBV A;  4ILH A;  1TKD A;  3RTV A;  4KB1 A;  2HHX A;  3CFP A;  3T1H K;  3KZB A;  4M45 A;  4CF2 A;  4IEE A;  3O3H A;  4FLY A;  5C42 A;  3R1X A;  3NGI A;  5IT9 O;  4H0X B;  1BUP A;  3WEE A;  3MDQ A;  1QHT A;  1BIU A;  3V9U A;  4YDU A;  3K57 A;  3DOK A;  5CYM A;  3TPQ A;  1TKX A;  1Q18 A;  3J8A A;  1ATR A;  5ELZ A;  4DCH A;  2ZM6 K;  1NM1 A;  1NK7 A;  1IBM K;  4JEP A;  1GOC A;  4OLA A;  3HBT A;  4FWK A;  1BA0 A;  5AQU A;  2ZWH A;  3ZSV A;  3MCA B;  3K0S A;  1J54 A;  3A5N C;  4IBN A;  1KVB A;  3N4P A;  3E66 A;  4ELU A;  3S3M A;  4JKG B;  3CPW M;  1ZBS A;  1C0G A;  4FM1 A;  5MLC Q;  4CES A;  4K0K K;  4JK8 A;  4K25 A;  2QA4 N;  3FR0 A;  4JI3 K;  1D8Y A;  3OW2 M;  4H5R A;  2PYL A;  4IDK A;  1VSE A;  1FXX A;  2Q0R A;  4H5N A;  4PUO A;  4DTM A;  1NK6 A;  4JHD A;  3QDK A;  4OVL A;  2YNF A;  4BDY A;  1NOZ A;  1HNI A;  4J2A A;  1UWB A;  1YXQ A;  1NK8 A;  3IUC A;  2QWN A;  3NBP A;  4CHZ A;  3AV9 A;  2XRI A;  3PO4 A;  1XNR K;  3EE9 A;  1BG3 A;  4NXM K;  5SZT A;  1E4G T;  4H5W A;  1K8K A;  4BRK A;  4WFB L;  2A42 A;  1QSY A;  2A3Z A;  2ITG A;  5C15 A;  2CGL A;  2HHS A;  4DLG A;  2O8E B;  3K59 A;  4QCL A;  4IKF A;  3MK6 A;  2HVH A;  1SV5 A;  3DI6 A;  1B92 A;  4BR9 A;  1OH5 A;  4CJL A;  3GDQ A;  5J2P A;  4W5O A;  1ZC6 A;  4RW8 A;  4OKE A;  4AHV A;  4DSE A;  3KK3 A;  3HPG A;  5BN8 A;  1CLQ A;  3BZC A;  4OLB A;  2HST A;  5CY4 A;  4L8R B;  5CR4 A;  2ZGY A;  3SK3 A;  3AVF A;  1BQN A;  3RR7 A;  4IG3 A;  2QWO A;  4YY3 K;  4K8X A;  4CED A;  2HF3 A;  5E26 A;  3IG1 A;  1TK5 A;  3E1Y A;  3AY9 A;  4KHS A;  5JS1 A;  3IMX A;  3QEP A;  4K42 A;  3B8A X;  4ZHR A;  3MXI A;  3HRG A;  3U9D A;  3OYN A;  3K5N A;  3S3N A;  3TAP A;  1JLG A;  2W41 A;  3VQA A;  1SAZ A;  2FF6 A;  4PKG A;  4ZTF A;  4WQ5 C;  1HQU A;  3CHW A;  4JKA A;  1LV5 A;  5E41 A;  3ZSZ A;  1N5Y A;  4A57 A;  4DSF A;  1OVY A;  3KWI A;  4RW4 A;  4A2B A;  1T6D A;  2P9N B;  3ID8 A;  4DR5 K;  2O8D B;  4BVO A;  1HR0 K;  5AQS A;  3OYC A;  1GLL O;  4H5T A;  5HRN A;  1T6C A;  1NK4 A;  4J2D A;  3OYJ A;  1SZ2 A;  1N6Q A;  3B6P A;  3KTQ A;  4AH9 A;  3VEO A;  5AQX A;  1IO2 A;  4DV4 K;  2EWS A;  3MXM A;  3UKU A;  2P9U B;  1RDC A;  3T1A A;  4BC4 A;  2XHB A;  2HBK A;  3WNG A;  3KK2 A;  1NLV A;  3AVG A;  1LWE A;  2A1R A;  1N33 K;  3KWG A;  1Z25 A;  4XEI A;  4G9Z A;  1SUQ A;  3LZI A;  3VQ9 A;  1NJY A;  5AZJ B;  4CHY A;  1EP4 A;  3WQU A;  4A61 A;  3K58 A;  4C1N I;  4YFU A;  3OYE A;  1LWC A;  1BCO A;  4LF9 K;  3HT3 A;  1WBD A;  1YAG A;  4B9U A;  1W0H A;  1RT5 A;  5AZI B;  5M1K A;  2E5L K;  2ITM A;  1BQM A;  1O1W A;  4MO4 A;  2KKZ A;  3THY B;  1D9F A;  3TWH A;  2DFE A;  4M3U A;  4IOC L;  1F21 A;  2O8F A;  4KHU A;  1WSG A;  1U4B A;  3AVK A;  2HW3 A;  1KFS A;  2W40 A;  1NGJ A;  3F5T A;  3BY5 A;  4Q5V A;  1T05 A;  1RT3 A;  4FPB A;  1NJW A;  1KC8 O;  3VQC A;  4BRM A;  1RDB A;  4FJK A;  4E89 A;  3AVA A;  4M3X A;  4YOV A;  5JIC A;  2E6M A;  3ULE B;  2XY6 A;  3JSM A;  4JAX A;  1JKH A;  3T19 A;  4E1M A;  4KHW A;  4FYD A;  2E1Z A;  3CCQ N;  2Y1J A;  1JCF A;  4I9L A;  3SQ1 A;  3H08 A;  1NGB A;  3G0Z A;  2E4L A;  3QEI A;  1U2V A;  3O1B A;  1TVR A;  3HM9 A;  1KVC A;  3TAR A;  1XMQ K;  1QZ6 A;  3THW A;  2IVN A;  3Q7C A;  1W9H A;  3MAQ A;  2GUP A;  1K8A O;  2O8C B;  4BGB A;  1SL1 A;  1Y97 A;  3MX5 A;  5I9E B;  3VF2 A;  2VQE K;  3AO1 A;  5LMN K;  3JYT A;  3H6E A;  2ASP A;  3E9L A;  3L3U A;  4U7B A;  3DLR A;  1RDA A;  3SZ2 A;  4MO5 A;  3ULD A;  3W3D A;  3WUH A;  3DLL L;  2YHA A;  3AVL A;  3L2R A;  2VGM A;  4RW7 A;  5HL7 L;  2VWJ A;  5FPD A;  1WSH A;  4JLH A;  5AQK A;  3UB5 A;  3NGZ A;  2G8W A;  2FBY A;  3RMC A;  3CG7 A;  4CHO A;  5GAH P;  1XC9 A;  4MDB A;  3AO2 A;  2D0O A;  1N8R O;  1EX4 A;  4OPH A;  2IS3 A;  3T69 A;  2E20 A;  3F2K A;  4M3R A;  4FLX A;  3OA9 A;  1QQC A;  3WNH A;  4B8A B;  3LL3 A;  2JGU A;  4IDH A;  4CJU A;  4JKC A;  3D6R A;  2GUI A;  4BDP A;  3ENB A;  4IFE A;  4X65 K;  4A62 A;  4KFB A;  3O9R A;  4CHQ A;  4IOA L;  4LH4 A;  2YKN A;  2VWK A;  3FE1 A;  2YJF A;  3LWM A;  3HO1 A;  4O4G A;  4E19 A;  1TKT A;  3PSI A;  1C0U A;  1EKE A;  1TK0 A;  5AQW A;  1QVG M;  2OTJ N;  2YI1 A;  4LSN A;  3M5R A;  4LF6 K;  3QET A;  1NKB A;  3DXK B;  4RCH A;  3VQP A;  3T3F A;  4QOZ B;  3U6F A;  2FSK A;  1VSD A;  5JLH A;  2P5G A;  1ZBU A;  1HNV A;  4DF4 A;  2QXL A;  3TAE A;  2P9L B;  4I6M A;  4I7F A;  5BN9 A;  3SQ4 A;  3MEC A;  1NJX A;  3VQ7 A;  1WOQ A;  5DK5 A;  3VEY A;  3OYL A;  4DV3 K;  4CFB A;  2HND A;  2OPQ A;  4PA1 A;  3WNE A;  5FRN A;  3SMP A;  4W5T A;  4EP4 A;  2HHV A;  2R7Y A;  5K14 A;  1ZBF A;  5I3U A;  4OPK A;  3SCX A;  3B6O A;  1JXB A;  4KPY A;  4JKE A;  2AJQ A;  4RW9 A;  2BGG A;  3H3N O;  1RGI A;  2IGI A;  1X9W A;  4DTP A;  4JI8 K;  3ATV A;  1YIT N;  1X1P A;  3QEV A;  1S1X A;  3RR8 A;  3VOV A;  4M63 C;  3R9P A;  3CJA A;  5DM6 L;  5GAE P;  1HMV A;  5LY3 A;  4I2Q A;  3CFR A;  4GMJ B;  2ASO A;  3FZM A;  3SBG A;  3TR8 A;  3CM6 A;  2D0B A;  1RIL A;  2RPI A;  4CJ3 A;  4DQQ A;  2UUB K;  1W2B M;  4GVM A;  5KQ8 A;  3TSU A;  5CYQ A;  3ATU A;  4W5N A;  1TYQ B;  1VK0 A;  2A41 A;  4CGD A;  2D0P A;  2FF3 B;  3DJC A;  3QBW A;  4X66 K;  4WFA L;  2HBM A;  2H3G X;  1S9G A;  1TAQ A;  3O8M A;  4FZZ A;  3P83 D;  3PX0 A;  3H3O B;  4NYF A;  4HTU A;  4WCE L;  3O4N A;  5JLF A;  1LOT B;  4BQZ A;  4CHN A;  4O5B A;  1P8Z A;  4BVP A;  3LWL A;  3VQ8 A;  3H1Q A;  4B1W B;  1YTU A;  1T44 A;  4WQ5 A;  3EZ5 A;  3K9K A;  1VSL A;  3MCP A;  5GAG P;  3QO9 A;  1RTD A;  3CJC A;  3OYK A;  3PLA A;  2PAV A;  2HHT A;  5KPR A;  4E7L A;  1R0A A;  1K73 O;  2KZM A;  4BG9 A;  3KKR A;  4DFM A;  3OYA A;  3SPY A;  2KLA A;  2E2O A;  4DTO A;  4H4M A;  4DQI A;  1HYZ A;  4A5A A;  5AQP A;  1UA1 A;  1VSF A;  3VQ5 A;  3VF6 A;  3CI5 A;  3CET A;  4PWD A;  2WON A;  1YHQ N;  2QWP A;  3FZL A;  4ELT A;  4Q0B A;  2P1J A;  3WXM B;  2Q31 A;  3SQ0 A;  4CFA A;  1IH7 A;  1QTM A;  4DTJ A;  2OYQ A;  4IJN A;  4DV7 K;  3K5M A;  4JI7 K;  4CGF A;  1HKC A;  1BU6 O;  1Z6R A;  3TAM A;  1HQE A;  4DSJ A;  1S72 N;  1NMN A;  3DXM A;  5C24 A;  3NMU A;  1J6Z A;  3ZX2 A;  1D4X A;  2DFH A;  1I3A A;  5KGX A;  4FJ9 A;  1ASU A;  3ID6 A;  3K9J A;  2VYP A;  4HTL A;  4RG8 A;  5J1E A;  2G8V A;  3QBX A;  3L0Q A;  1TGO A;  1FW6 A;  4EZ6 A;  1TUU A;  3MXJ A;  1IJJ A;  3Q7B A;  3SAF A;  1QSL A;  3FZH A;  1MWK A;  5KTQ A;  3C6H A;  3F73 A;  1HNZ K;  1LAW A;  5AQR A;  4BGA A;  3MWT A;  1NGH A;  2HB5 A;  3AAQ A;  3OTO K;  1VAZ A;  4BQL A;  1YI2 N;  4IFY A;  1FJG K;  3THV A;  4CZM A;  3CJB A;  2P9I B;  4CE9 A;  1YUW A;  4CF1 A;  1T03 A;  2B5J A;  3LPU A;  4I9Q A;  4LFA K;  3OS0 A;  1ZBL A;  4CJ4 A;  5AQN A;  5CZ1 A;  4JK7 A;  4NLC A;  4QAG A;  4ISE A;  4FW2 A;  3CCR N;  1GLE G;  1IBK K;  2XO7 A;  3DYA A;  1K6Y A;  1IKV A;  3DOL A;  3VA0 A;  2JWK A;  2FXU A;  1RT6 A;  4HVJ A;  1GLJ O;  4W5R A;  1UA0 A;  1D5A A;  3J7Z O;  2FSJ A;  1WBB A;  4Y1D A;  3LDO A;  5BRD A;  1H1V A;  4LF8 K;  3S3O A;  1BO5 O;  3VQQ A;  5ADX A;  2D0C A;  3TSQ A;  5ADX H;  3I8D A;  5F2R A;  4KI6 A;  1U47 A;  3SI6 A;  4V19 S;  4MQ3 A;  1A5W A;  1GLB G;  1Q9Y A;  3ZEU A;  1ESV A;  4FJM A;  2F9W A;  4A2A A;  3VEX A;  5C2F A;  1XC3 A;  3G6E N;  2KQ2 A;  3MN6 A;  1VQ4 N;  3EL2 A;  3CME N;  2V52 B;  5AQV A;  3QIO A;  4N56 A;  4OO1 J;  1BI4 B;  2ATQ A;  4NCG A;  5HLF A;  4HCB A;  2FSN A;  3OS1 A;  1V4S A;  3GBT A;  3FZK A;  5LJW A;  4BE1 A;  3DRR A;  4BAC A;  4DTR A;  3MN7 A;  3WXK A;  3R8E A;  4DUZ K;  4BE0 A;  4QS9 A;  4JS4 A;  2QWM A;  2OA8 A;  1I94 K;  3R6M A;  1VQ6 N;  1VQL N;  4CGJ A;  2UYT A;  3CM5 A;  3O9T A;  4JRQ A;  2YCH A;  2E1Y A;  1YF5 L;  4O0I A;  1JJ2 M;  2FLO A;  2QTD A;  3VTI A;  4DLE A;  4EAH D;  1JL2 A;  3L2U A;  2HVI A;  3VEV A;  1T7P A;  2VQF K;  1X3N A;  3RMD A;  3VET A;  3D2E A;  3LPT A;  4OKJ A;  4CK1 A;  2ETJ A;  1N36 K;  3NF9 A;  1KCF A;  4CJ5 A;  5A2Q O;  3SMS A;  5JVG L;  4DSL A;  3KVG A;  2P9K A;  4CGI A;  3SPZ A;  3CC2 N;  1RBS A;  4XH4 A;  3QFU A;  3N4Q A;  2YJE A;  1KAY A;  2P9P A;  3RRH A;  3CFO A;  3BUZ B;  2V51 B;  2ZJP L;  3SV4 A;  4ID1 A;  1U49 A;  4BWM A;  3NH1 A;  1U6Z A;  4JN4 A;  2WUS A;  3LDL A;  4OKK A;  4C8K A;  2RF2 A;  3PUF A;  3K2P A;  4CJ7 A;  1Y64 A;  4G1Q A;  2ZD1 A;  1IV0 A;  1C0F A;  2PYJ A;  2HBJ A;  4KKO A;  3BDP A;  5LJV A;  4B9S A;  3L4I A;  4LC9 B;  3QNN A;  4M3Y A;  4Z4F A;  3C95 A;  5JS2 A;  2ZF5 O;  4GNI A;  3BZK A;  1NBW A;  3IS9 A;  4ISF A;  2HOE A;  1SQK A;  3UIQ A;  4IFV A;  4B1U B;  2P9S B;  5LMU K;  4QS8 A;  4CEB A;  3C7N B;  2XY7 A;  4FJI A;  3BF3 A;  3ALY A;  3L2V A;  3LM2 A;  4EHT A;  4M42 A;  4PKI A;  3FLC O;  4B9N A;  3NF7 A;  3RWU A;  4XIU A;  3CCM N;  4ID5 A;  1RBT A;  4CIE A;  3SBT A;  1QQN A;  5GIP A;  4CEZ A;  4KO0 A;  1JLF A;  4N76 A;  2A5X A;  3OS2 A;  3VES A;  3QER A;  3CYM A;  3AA3 A;  3CQX A;  4BR4 A;  2AA4 A;  2G8U A;  4GV9 A;  1U45 A;  3KK7 A;  5AQO A;  3NF6 A;  3TAN A;  4CK3 A;  1JCG A;  4OX9 K;  4BC2 A;  4FLW A;  1B9D A;  1RNH A;  4GW6 A;  3RMB A;  2XY8 A;  3O9S A;  1IKX A;  5BRE A;  4DQS A;  2X6S A;  3L3V A;  4CEF A;  1CZB A;  1NJZ A;  4B9L A;  4NO7 A;  2E6L A;  5JMV A;  3HYF A;  2P5O A;  3THX B;  3SAG A;  5AQJ A;  4CIG A;  2VG6 A;  3T7Z A;  1ZYQ A;  2UXB K;  4CI6 A;  3RRG A;  4BRO A;  2NRR A;  4M7X A;  3LDN A;  2I7P A;  2BDP A;  4KAZ A;  1UOC A;  2OPR A;  4DG1 A;  3CF5 L;  4DR7 K;  4DFJ A;  5IWA K;  2G8K A;  1RTJ A;  4JV5 K;  2AP1 A;  3AGR A;  1WLJ A;  1KFD A;  2F7T A;  3HSC A;  4BG8 A;  1W7A A;  3TAQ A;  2IOC A;  3I55 N;  4FOI A;  4WE1 A;  3MN9 A;  1Q81 O;  2A6A A;  3LAK A;  3RSE B;  4FJX A;  2CH5 A;  4FLT A;  3O9U A;  2YKM A;  1NKC A;  4BRC A;  1SKR A;  3IFR A;  2GWK A;  4TSX A;  4WFN L;  4J2B A;  3JS6 A;  4EZ9 A;  1TK8 A;  3ZET B;  3ZSR A;  1N32 K;  3KD1 E;  3EE8 A;  3HOT A;  3VEW A;  4FLZ A;  3P39 A;  4IZ9 A;  5M1F A;  3S9H A;  1Q7Y O;  4IO8 A;  4M7Y A;  1A5V A;  4Y0W A;  1HPZ A;  3H45 C;  3UKR A;  1U04 A;  5HRP A;  3ZCM A;  4BC3 A;  3HL8 A;  4JI5 K;  3L6Q A;  2G8I A;  2NRV A;  3VQE A;  3HVR A;  4F3T A;  4BWJ A;  5FPE A;  1HYV A;  3HOS A;  1VQO N;  4B9V A;  1L5U A;  1NJI O;  4GV6 A;  1GLC G;  4NXN K;  4GV3 A;  1XHX A;  4JKG A;  4JD2 B; 
#chains in the Genus database with same CATH homology
 3PX6 A;  4I2Q A;  4DFK A;  3CFR A;  1RBU A;  4H4O A;  3U3Y A;  3ZSO A;  1ITG A;  3D45 A;  3DLG A;  3M8P A;  4GMJ B;  4F4K A;  1L3T A;  1XHZ A;  3VQ6 A;  4R5P A;  2HHW A;  3TR8 A;  3CM6 A;  4E7K A;  3PY8 A;  3DLK A;  1Q9X A;  3VQ4 A;  2D0B A;  1RIL A;  4CEQ A;  4FJL A;  4FK2 A;  2F8S A;  1VSH A;  2RPI A;  1VRT A;  4CJ3 A;  4DQQ A;  2JLE A;  4FJN A;  3OJU A;  4NCB A;  4GVM A;  3OY9 A;  3AO3 A;  3QIP A;  2O4I A;  3TAG A;  4Z4C A;  4KHN A;  4ICL A;  2EX3 A;  1RTH A;  3IRX A;  4AHT A;  1BCM A;  3LP3 A;  4CJE A;  5CYQ A;  3KJV A;  4O55 A;  3MEG A;  4W5N A;  1I39 A;  1VK0 A;  3MED A;  4CGD A;  3EYZ A;  3DRS A;  4HUF A;  2KFN A;  3MEE A;  3K5L A;  3AA2 A;  4AIL C;  4F2R A;  4HCC A;  4F8R A;  3VQB A;  1S9G A;  1TAQ A;  1SL2 A;  4FZZ A;  3P83 D;  3PX0 A;  2DFF A;  4NYF A;  1TV6 A;  3NCI A;  4C8L A;  4FJG A;  2HHQ A;  4HTU A;  3QES A;  4FZY A;  1TAU A;  1X9S A;  3V1O A;  4CEO A;  2Y1I A;  1DTT A;  3ZSX A;  3O4N A;  1WSE A;  2VG5 A;  3SYZ A;  3NF8 A;  1Q8I A;  1WAF A;  1RT1 A;  1WSF A;  4CHN A;  4HUG A;  3AVI A;  1FKP A;  4O5B A;  4RW6 A;  1VRU A;  4CJF A;  4CFD A;  3DMJ A;  4CCH A;  1HYS A;  3ZT0 A;  2F8T A;  4E7J A;  3KK1 A;  4KRF A;  1RBV A;  3LWL A;  4DU4 A;  3VQ8 A;  1TKD A;  3AVH A;  3RTV A;  4N5S A;  4KB1 A;  4DTX A;  3TAF A;  4FJ5 A;  3SUP A;  2HHX A;  3CFP A;  4KV8 A;  2OPP A;  1YTU A;  3EZ5 A;  4M45 A;  4CF2 A;  3O3G A;  3O3H A;  4DSK A;  5KRT A;  1VSL A;  4OGC A;  4CJP A;  4FLY A;  1C1C A;  3QO9 A;  5C42 A;  1RTD A;  3NGI A;  4E1N A;  4DQR A;  3OYK A;  4O44 A;  2HHT A;  3AVM A;  4E7L A;  3LP2 A;  1R0A A;  1QHT A;  3FFI A;  3LAM A;  3LAL A;  4DTN A;  1BIU A;  3V1Q A;  2KZM A;  2FC0 A;  1DTQ A;  3V9U A;  3KKR A;  3K57 A;  3DOK A;  1JL1 A;  4DFM A;  3V4I A;  2KFZ A;  3DRP A;  1S5J A;  3OYA A;  3SPY A;  5CYM A;  1TKX A;  3G10 A;  4DTO A;  2KW4 A;  3SNN A;  2BAN A;  4H4M A;  4BDZ A;  4FCY A;  4Z4I A;  1KLN A;  3KLG A;  1TL3 A;  4DQI A;  1NK7 A;  1HYZ A;  4F3O A;  1WN7 A;  2O4G A;  4LY7 A;  4MFB A;  1GOC A;  2Z1G A;  4OLA A;  3PV8 A;  1UA1 A;  1VSF A;  3VQ5 A;  3RMA A;  4PWD A;  2WON A;  3ZSV A;  1J54 A;  4ELT A;  4Q0B A;  3AVC A;  2P1J A;  3SQ0 A;  3HP9 A;  4CFA A;  1IH7 A;  4IBN A;  3OYF A;  1KVB A;  4H8K A;  4DTJ A;  1QTM A;  2OYQ A;  2FBT A;  4CEC A;  1BIS A;  3SQ2 A;  3K5M A;  3S3M A;  4ELU A;  3NHG A;  1NK9 A;  3KD5 E;  5D3G A;  4CGF A;  1JLA A;  3SUQ A;  4Y1C A;  3QEX A;  3TAM A;  1HQE A;  4DSJ A;  4FM1 A;  4CES A;  1IKW A;  1BHL A;  1C1A A;  4N41 A;  3KKS A;  3I0R A;  4FM0 A;  3LDS A;  1D8Y A;  5C24 A;  4Z4G A;  2PYL A;  1FK9 A;  4IDK A;  1VSE A;  1FXX A;  3AVN A;  2HMI A;  4PUO A;  3DLE A;  1QSS A;  2DFH A;  3VN5 A;  1I3A A;  5KGX A;  4DTM A;  2XY5 A;  1NK6 A;  1YTA A;  1IKY A;  4FJ9 A;  4OVL A;  1ASU A;  2FBV A;  4B3O A;  2W42 A;  2YNF A;  4BDY A;  1NOZ A;  5J2M A;  1BI4 A;  1HNI A;  4J2A A;  1UWB A;  4RG8 A;  2HNY A;  1NK8 A;  1NKE A;  4Z4E A;  1LWF A;  5J1E A;  3NBP A;  4CHZ A;  3AV9 A;  3C94 A;  2XRI A;  4DTU A;  2G8V A;  3PO4 A;  1TGO A;  4CJW A;  1JXE A;  4DFP A;  1SKS A;  4EZ6 A;  1QS4 A;  1NOY A;  5SZT A;  3MXJ A;  2VG7 A;  2LSN A;  3OYG A;  1RT4 A;  5HRO A;  3O3F A;  1QSY A;  4FJ8 A;  4FK0 A;  2ITG A;  3VQD A;  4OJR A;  3V9X A;  1QSL A;  4DMN A;  5KTQ A;  2HHS A;  4DLG A;  3F73 A;  3F9K A;  4N47 A;  1LAW A;  3K59 A;  1L3S A;  4KTW A;  4DF8 A;  4QCL A;  2HB5 A;  5EU7 A;  4DS5 A;  4IKF A;  2HVH A;  1SV5 A;  3DI6 A;  4IFY A;  2Z1J A;  3A2F A;  4UQG A;  3SJJ A;  3THV A;  1B92 A;  1CZ9 A;  3K5O A;  4OPJ A;  4CJQ A;  4AHU A;  4DU3 A;  4CF0 A;  4CJL A;  2PY5 A;  4E7I A;  5J2P A;  4CGG A;  4W5O A;  4CE9 A;  4RW8 A;  4CF1 A;  3V81 A;  1T03 A;  4OKE A;  4AHV A;  4DSE A;  2B5J A;  3LPU A;  4I9Q A;  3OS0 A;  1ZBL A;  4CJ4 A;  2YNI A;  3TAB A;  3KK3 A;  3HPG A;  1CLQ A;  3P1G A;  4OLB A;  2WOM A;  5CZ1 A;  4FLV A;  1UAX A;  5CY4 A;  4L8R B;  4QAG A;  1ASV A;  3ZSW A;  4B9T A;  4FW2 A;  3I0S A;  1MU2 A;  3AVF A;  1BQN A;  1C0T A;  4CEE A;  1DLO A;  2XO7 A;  3KIO A;  4YNQ A;  1BGX T;  4NCA A;  3DYA A;  3RR7 A;  1K6Y A;  1IKV A;  2Q3S A;  3DOL A;  4IG3 A;  4JRP A;  4FLU A;  3VA0 A;  4K8X A;  3ZT4 A;  4CED A;  5HRR A;  2QKB A;  1RT6 A;  4HVJ A;  3OYI A;  3IG1 A;  1TK5 A;  4W5R A;  1UA0 A;  1D5A A;  3M8Q A;  4KHS A;  3NH2 A;  4C8O A;  4Y1D A;  3QEP A;  4ZHR A;  3MXI A;  4FK4 A;  5JS1 A;  2OZS A;  3OYN A;  3K5N A;  3S3N A;  3S3O A;  1U48 A;  3TAP A;  1JLG A;  2RN2 A;  2PZS A;  3VQQ A;  5DMR A;  4KTZ A;  3VQA A;  3PO5 A;  2D0C A;  4DSI A;  3V6D A;  2Z1I A;  4O0J A;  4ZTF A;  3I8D A;  1S1T A;  1HQU A;  4E7H A;  4KI6 A;  1U47 A;  4J2E A;  1LV5 A;  3SI6 A;  3NFA A;  5E41 A;  3ZSZ A;  5J2N A;  1N5Y A;  2YV0 X;  4MQ3 A;  4DSF A;  1A5W A;  1WSI A;  3M8S A;  4ZTJ A;  4RW4 A;  4AHR A;  1Q9Y A;  4FJM A;  1J5O A;  3ISN C;  1D9D A;  2KQ2 A;  3C6T A;  3QLH A;  5HRS A;  1S6P A;  1B9F A;  4K8Z A;  1SKW A;  2X78 A;  4B08 A;  3OYC A;  3QIO A;  4CGH A;  4N56 A;  1XWL A;  4C8N A;  1BI4 B;  5HRN A;  2ATQ A;  4NCG A;  5HLF A;  3HPO A;  1NK4 A;  4J2D A;  4DWI A;  2YNH A;  3HPH A;  3OYJ A;  4HCB A;  4LD0 A;  1N6Q A;  3B6P A;  3OS1 A;  4AH9 A;  3LZJ A;  3KTQ A;  2QK9 A;  1IO2 A;  1FKO A;  4BE1 A;  3U3G A;  3IAY A;  3DRR A;  4BAC A;  4DTR A;  3KLI A;  4BE0 A;  3MXM A;  1RT7 A;  1LAV A;  1RDC A;  3T1A A;  4JS4 A;  2OA8 A;  2ZQB A;  2D5R A;  4LSL A;  2XHB A;  3WNG A;  3KK2 A;  3L2W A;  4DQP A;  1RT2 A;  3AVG A;  2DTU A;  5T7B A;  1HJR A;  1LWE A;  4CGJ A;  2A1R A;  4CF9 A;  3CM5 A;  2KZZ A;  3ZT1 A;  4AHS A;  4JRQ A;  3V9W A;  1Z25 A;  5HBM A;  4FJH A;  1NK0 A;  2A1S A;  1SUQ A;  3LZI A;  3AA4 A;  3VQ9 A;  1WNS A;  2YNG A;  3LP0 A;  4O0I A;  3D0P A;  1NJY A;  3ZT3 A;  4CHY A;  4DLE A;  1JL2 A;  1EP4 A;  3L2U A;  2HVI A;  1TL1 A;  3K58 A;  4YFU A;  3ASM A;  1T7P A;  2HNZ A;  3OYE A;  1LWC A;  2IAJ A;  3HXM A;  3OYH A;  1BCO A;  3RMD A;  3HT3 A;  1L3U A;  2KTQ A;  1T8E A;  4AHC A;  3SUN A;  3LPT A;  4OKJ A;  4CK1 A;  2ETJ A;  3NF9 A;  1KCF A;  1YT3 A;  4CJ5 A;  4B9U A;  4DSL A;  3OYD A;  2DY4 A;  1W0H A;  1RT5 A;  3PX4 A;  1S1W A;  4CGI A;  3SPZ A;  1BQM A;  1RBS A;  1O1W A;  1RDD A;  4BE2 A;  1D9F A;  3TWH A;  3RRH A;  2DFE A;  3CFO A;  1HRH A;  4M3U A;  3EY1 A;  1F21 A;  3SV4 A;  3HJF A;  2I5J A;  4KHU A;  4FJJ A;  1WSG A;  2QXF A;  4ID1 A;  3AVK A;  1U4B A;  1U49 A;  3NGY A;  1KSP A;  4BWM A;  3NH1 A;  4FXD A;  2HW3 A;  1KFS A;  2OZM A;  4M3Z A;  4CFC A;  3SV3 A;  1S6Q A;  4Q5V A;  1T05 A;  1RT3 A;  1NJW A;  3VQC A;  4ELV A;  4OKK A;  1VSM A;  4C8K A;  1C0M A;  1RDB A;  4FJK A;  4E89 A;  2RF2 A;  3AVA A;  3PUF A;  3QIN A;  4LH5 A;  4M3X A;  1L3V A;  3K2P A;  3ZSQ A;  4G1Q A;  2ZD1 A;  3LP1 A;  4FVM A;  1KVA A;  1EXQ A;  2E6M A;  2PYJ A;  3VA3 A;  3JSM A;  5J2Q A;  4KKO A;  2XY6 A;  3BDP A;  4KHQ A;  1JKH A;  2Z1H A;  3T19 A;  4E1M A;  4B9S A;  5I42 A;  4KHW A;  1TKZ A;  3DM2 A;  4EP5 A;  4FYD A;  4CEA A;  3QNN A;  4M3Y A;  2Y1J A;  4I9L A;  3SQ1 A;  4KRE A;  3AA5 X;  3H08 A;  4Z4F A;  3C95 A;  3G0Z A;  5JS2 A;  2E4L A;  3QEI A;  1TVR A;  3HM9 A;  1KRP A;  1KVC A;  4CER A;  4HHT A;  1VSJ A;  3IS9 A;  4JS5 A;  3TAR A;  1Z26 A;  4CJK A;  1GOB A;  3UIQ A;  3KLE A;  4PY5 A;  4IFV A;  3HP6 A;  4DU1 A;  1W9H A;  4CEB A;  3MAQ A;  2XY7 A;  4FJI A;  1LW2 A;  2ZE2 A;  5CZ2 A;  3ALY A;  3L2V A;  1SL1 A;  4M42 A;  4M41 A;  1Y97 A;  5SWM A;  4B9N A;  3NF7 A;  3RWU A;  3AO1 A;  4XIU A;  1C1B A;  4ID5 A;  1RBT A;  5KI6 A;  4CIE A;  3JYT A;  3HK2 A;  3L3U A;  1S1U A;  4CEZ A;  1A5X A;  3DLR A;  4KO0 A;  4C8M A;  4F2S A;  1G15 A;  1RDA A;  1C6V A;  3SZ2 A;  1BL3 A;  1JLF A;  4N76 A;  3OS2 A;  1QE1 A;  3ULD A;  4B9M A;  4CJV A;  1KTQ A;  1JLE A;  3QER A;  2YHA A;  3AVL A;  3L2R A;  4RW7 A;  3M8R A;  4M3W A;  2VWJ A;  1CXQ A;  3ZT2 A;  3CYM A;  1WSH A;  4HUE A;  3AA3 A;  4JLH A;  3OYM A;  1BIZ A;  2G8U A;  4KTQ A;  3AVJ A;  1REV A;  1KLM A;  3NGZ A;  2G8H A;  1U45 A;  2D0A A;  2G8W A;  3O4Q A;  2FBY A;  4OGE A;  4FW1 A;  3RMC A;  4NYN A;  3HST B;  3QEW A;  2QKK A;  1VSK A;  3NF6 A;  3TAN A;  4CK3 A;  3CG7 A;  2G8F A;  4I2P A;  4CHO A;  4E3S A;  1XC9 A;  4FLW A;  4KB0 A;  1J53 A;  1B9D A;  3AO2 A;  1RNH A;  4GW6 A;  1XI1 A;  2OPS A;  1NK5 A;  3RMB A;  4FZX C;  2XY8 A;  5C25 A;  3LAN A;  1EX4 A;  1IKX A;  2IS3 A;  2HHU A;  4M3R A;  4DQS A;  1GOA A;  4FLX A;  3SUO A;  2X6S A;  3AO4 A;  3L3V A;  4CEF A;  1JLB A;  1CZB A;  5FRO A;  1WAJ A;  3P5J A;  4CF8 A;  1NJZ A;  1QQC A;  4B9L A;  1WSJ A;  2E6L A;  3WNH A;  3HYF A;  4B8A B;  3L2Q A;  2P5O A;  4DS4 A;  2IDO A;  4IG0 A;  2JGU A;  2VG6 A;  4CIG A;  1ZYQ A;  2X6N A;  3C6U A;  4FM2 A;  3RRG A;  3L8B A;  4CJU A;  3BGR A;  2BDP A;  4KAZ A;  1ZBI A;  1UOC A;  4CHP A;  2OPR A;  2GUI A;  4DG1 A;  4BDP A;  1EET A;  4E0D A;  4KFB A;  4B8C A;  4CHQ A;  4LH4 A;  4DFJ A;  2YKN A;  3TI0 A;  2G8K A;  2VWK A;  1S1V A;  3HVT A;  3V1R A;  3LWM A;  1RTJ A;  3NDK A;  3CQ8 A;  3HO1 A;  3ZSY A;  4O4G A;  4PQU A;  1WLJ A;  4CJT A;  3V9Z A;  4CK2 A;  5HP1 A;  1CXU A;  4E19 A;  1TKT A;  1C0U A;  1EKE A;  1TK0 A;  1KFD A;  1X9M A;  1LW0 A;  3TAQ A;  5FDL A;  2IOC A;  5KGW A;  3DLH A;  4WE1 A;  4LSN A;  3LAK A;  4KI4 A;  2YHB A;  3OJS A;  2BE2 A;  1ZBH A;  4CIF A;  3QET A;  1SL0 A;  4FJX A;  1NKB A;  4Z0U A;  3VQP A;  4FLT A;  3QNO A;  3T3F A;  4DTS A;  4KHY A;  2YKM A;  1NKC A;  4QOZ B;  3WNF A;  3E01 A;  3AO5 A;  3U6F A;  1SKR A;  1S9E A;  1VSD A;  4TSX A;  2P5G A;  1ZBU A;  3KLF A;  2F96 A;  1HNV A;  2RKI A;  4J2B A;  3NH0 A;  4DF4 A;  4EZ9 A;  3TAE A;  1TK8 A;  1RCH A;  3ZSR A;  2FBX A;  1YVU A;  4CJS A;  2X74 A;  3KD1 E;  3OVN A;  1IG9 A;  1JLC A;  3ITH A;  4I7F A;  3SQ4 A;  2GV9 A;  1J9A A;  4FLZ A;  3MEC A;  1NJX A;  3VQ7 A;  2IC3 A;  5DK5 A;  4Z4H A;  1RTI A;  3S9H A;  3OYL A;  1VSI A;  4FJ7 A;  1ASW A;  4CFB A;  1A5V A;  2HND A;  2OPQ A;  2GBZ A;  4PA1 A;  3KLH A;  3WNE A;  5FRN A;  1HPZ A;  1U04 A;  3AVB A;  5HRP A;  4W5T A;  4EP4 A;  1JLQ A;  3DLB A;  3ZCM A;  2HHV A;  2R7Y A;  5K14 A;  5FRM A;  5KRS A;  1ZBF A;  3HL8 A;  3V9S A;  5I3U A;  4OPK A;  3NE6 A;  3SCX A;  2G8I A;  3VQE A;  3B6O A;  1JXB A;  3HVR A;  4KPY A;  2AJQ A;  4F3T A;  4RW9 A;  4BWJ A;  2BGG A;  4CJR A;  2B6A A;  1HYV A;  2IGI A;  1X9W A;  4DTP A;  4B9V A;  1L5U A;  1RBR A;  2P51 A;  4M3T A;  1X1P A;  3OYB A;  1S1X A;  3QEV A;  3RR8 A;  3NAE A;  2EHG A;  1HMV A;  2B4J A;  1XHX A;  2NUB A;  4W5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...