1HRHA

Crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
125
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBONUCLEASE H
publication title Crystal structure of the ribonuclease H domain of HIV-1 reverse transcriptase.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase(endoribonuclease)
total genus 37
structure length 125
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1991-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hrhA00
5T7BA 4FLWA 3AVMA 2Z1JA 5KTQA 4C8KA 5J2PA 1SL1A 1JLGA 3LALA 1C1AA 3SPZA 3QEWA 1KCFA 2ETJA 3AVJA 3KKSA 1HYZA 4FZYA 1RILA 5E41A 3NH2A 3HPOA 2GBZA 4CFBA 1U48A 2ITGA 1RDBA 3HPHA 4DFKA 3AVGA 1QS4A 1W0HA 2IAJA 4RW9A 2AJQA 1D8YA 3OYLA 3HM9A 1WSFA 4DSFA 1TKDA 2X6SA 4CJVA 3HP9A 1KRPA 4J2AA 1X1PA 5J1EA 1VSLA 1HQUA 4CJ3A 4O4GA 3VA3A 4DS4A 4DU1A 3PX6A 3RTVA 1SKWA 1NKEA 2Q3SA 4IBNA 3C6TA 4O0IA 3QIOA 5KRSA 3EYZA 4FJ9A 4L8RB 4K8ZA 5J2QA 5HBMA 4DFMA 4BDZA 3F73A 3QETA 2PY5A 1C1CA 3LZIA 3NH1A 2HHVA 1HJRA 4G1QA 1HQEA 4FJGA 1VSFA 3AVIA 3ISNC 4FK4A 4FCYA 4AILC 3K5NA 4WE1A 4KRFA 1FXXA 4FW1A 2HNZA 4CJEA 1CZ9A 1I3AA 3SUPA 3AO3A 3LP2A 1K6YA 4OGCA 4XIUA 1QTMA 1Y97A 3AVHA 3I0SA 4DG1A 1TAQA 3AA4A 1UWBA 3WNHA 4CK2A 1ZBIA 3NH0A 3RR8A 3SQ0A 4AHVA 4BE2A 5CYQA 3WNGA 4Z4CA 4FM0A 2YHBA 1TAUA 2YKMA 2WONA 1IKYA 3DI6A 4NCGA 3ZSWA 2BANA 3AVCA 1J54A 1TV6A 4JS4A 2D0AA 3THVA 1JLFA 4KO0A 1R0AA 4DF8A 4W5RA 3HP6A 3QERA 2E6MA 2DFHA 3AA5X 3QIPA 4EZ9A 4CJPA 4OLBA 2OPSA 4FK0A 3OYNA 4FJNA 3TI0A 5K14A 4Y1CA 4M3WA 3L8BA 4KFBA 1QSLA 1VRTA 5FDLA 1NKBA 3TABA 3ZSVA 4JRPA 4ICLA 3VQ8A 3HVTA 4HUGA 3DLBA 4FJ7A 4HCCA 4BACA 4IDKA 2QK9A 3HVRA 1VSKA 1B9FA 4LY7A 3RWUA 4CGJA 4DSEA 3HPGA 1VSDA 3LP3A 4FJ5A 2B4JA 3V9UA 3NBPA 4F2RA 3HYFA 4CEFA 3PO5A 2IS3A 2XHBA 1ZBHA 3KLGA 1UAXA 1XHXA 3T3FA 4M3UA 1RDCA 3SUNA 1T7PA 4B9NA 4NCAA 4HVJA 1A5WA 2YNHA 3AO5A 4JS5A 3V81A 3TANA 1QE1A 4M3XA 1S9EA 4CEAA 4B9UA 4CHYA 2VG7A 4M41A 4ZHRA 4B9VA 4CE9A 3K59A 1KLMA 4CEQA 2D5RA 5CZ2A 3LP0A 4Z0UA 4FYDA 2G8WA 2HVHA 4FLUA 4CIFA 2OZSA 4W5QA 4Z4FA 3RRGA 1FKPA 4HCBA 2DTUA 4IFVA 4CHQA 4CF0A 3QINA 4JLHA 3NF8A 4CF8A 3IG1A 2RN2A 3U3GA 1NK9A 3QO9A 4OJRA 1Z25A 4CCHA 4FLZA 3QEXA 4DLGA 1QSYA 5CZ1A 4AHTA 1N5YA 1LWFA 1ASWA 3SQ1A 2Y1IA 3CFPA 3TAMA 1NJWA 4CJ4A 2Z1HA 1TL1A 3S9HA 3ZSQA 4OGEA 4RW6A 1XHZA 3VQCA 1NK5A 4BDPA 1BISA 5HRPA 1WSGA 2W42A 2F96A 4CGIA 4DFJA 1J53A 1VSIA 1X9SA 3S3MA 3KD1E 2G8KA 3V1QA 1NK0A 1LW0A 4CK1A 3L2RA 1LW2A 2YNFA 3M8PA 4W5TA 4DTXA 1WSHA 5J2MA 3LZJA 2HHWA 3AVFA 4AHCA 1L3TA 1ASUA 2IGIA 5KRTA 1Q9YA 2OZMA 4BE0A 1ASVA 1SUQA 3NF9A 4N47A 4CEDA 2KQ2A 4RW4A 2NUBA 1Q9XA 4CF9A 3UIQA 1HMVA 3QNNA 2FBVA 3LPTA 2FC0A 3OYAA 2BE2A 1RTIA 2O4IA 1EXQA 2XRIA 2HB5A 3DLKA 5DMRA 2OA8A 1C6VA 4CEBA 1D9FA 4GVMA 1ZBLA 1IKXA 4KHWA 5FROA 1S1TA 1WSJA 2I5JA 4FZXC 1NOZA 1ITGA 3AO2A 2G8HA 4LSLA 4FJJA 5C25A 3OJUA 1RDAA 1NK8A 1CXUA 4ELVA 3SUOA 1EX4A 5D3GA 1U49A 4MFBA 4FJ8A 1BQNA 3O3HA 1KLNA 5FRMA 3NAEA 3G10A 3DLRA 1WLJA 4BWJA 4DQRA 2WOMA 4LSNA 4HUFA 1SV5A 3LWMA 3ZSYA 4M45A 1FKOA 1KSPA 3L2WA 4JRQA 4DTRA 1NK6A 4HTUA 3L2QA 5HP1A 4QAGA 4DSJA 3LDSA 4KI4A 2YKNA 2G8FA 3LPUA 2P1JA 2Z1IA 4E1MA 3RMAA 4M42A 4OLAA 2G8IA 4CK3A 4O5BA 4PWDA 4B08A 4W5NA 3K2PA 3O4QA 4CFCA 3TAEA 1RCHA 3O4NA 4NYNA 3OYIA 1VSHA 3SUQA 3VQBA 1VK0A 1S1XA 2P5GA 3AO1A 3FFIA 4CJSA 2X78A 3KJVA 1YTUA 4DFPA 1HRHA 4FM1A 3NDKA 3TAFA 2HVIA 3ALYA 4GW6A 1ZBFA 1RBRA 1RT6A 3ZSXA 3JSMA 1WAFA 4KHYA 2HHTA 4LH5A 1KVAA 3SV3A 3C95A 4DS5A 2IOCA 4ID1A 4CJWA 3G0ZA 3EZ5A 1BCOA 3K5MA 1I39A 1KFDA 1S9GA 3ASMA 3QNOA 4O0JA 4FK2A 3C94A 3B6OA 4DTUA 2ZD1A 3VQ5A 1J9AA 3SCXA 3I8DA 4Z4EA 4PY5A 1RT5A 3AVNA 3OVNA 3BGRA 3H08A 5EU7A 3NF6A 4CJRA 1NJZA 2OPRA 4CJ5A 4AHRA 3PY8A 4Z4IA 3DM2A 1ZYQA 4Z4HA 4KV8A 1T05A 4J2EA 2A1RA 3DLGA 1O1WA 3OJSA 3SQ2A 4N56A 1GOAA 4H4OA 1QHTA 3RMCA 2YNIA 2HHUA 2OPQA 1CXQA 5HRSA 2G8VA 1TKZA 2KZZA 3MAQA 2QXFA 4DTPA 4KPYA 2KFZA 4CF1A 3CFOA 5J2NA 4ZTFA 1BQMA 1FK9A 1RBSA 3MEEA 1Q8IA 1RBVA 1EP4A 5SZTA 4E0DA 3CFRA 1EETA 4PQUA 3SJJA 5KGWA 1L5UA 4RG8A 4M3YA 3PUFA 2HHSA 3E01A 4CFDA 4FJLA 3OYDA 4M3ZA 4FXDA 4OPKA 3VQ4A 3VQ6A 4N76A 3SZ2A 4AH9A 3TR8A 3AV9A 3ZSZA 4CERA 3AO4A 2ZE2A 2XY6A 4DQIA 3KTQA 2P5OA 3VQAA 1RT7A 4I9QA 3KK2A 3VQDA 2X6NA 1QQCA 1WSIA 3ZT1A 4CHPA 1U47A 1L3SA 3HT3A 2ATQA 1LWCA 3IS9A 1EKEA 1J5OA 1RT3A 3ITHA 4CGHA 1D5AA 1T8EA 3WNFA 1RTHA 3SPYA 1JLBA 1C1BA 4OKEA 2F8SA 2B6AA 3NGYA 1JLAA 1A5XA 4CEEA 1F21A 1JXBA 2E6LA 3ULDA 4I7FA 1TK0A 3PV8A 1C0UA 1YVUA 4OVLA 3EY1A 3LAKA 3KLHA 4FLVA 4DTMA 1SL2A 3V1RA 3ZSRA 2FBTA 3CQ8A 2OYQA 4C8LA 1DTTA 4FJXA 3OYCA 3ZSOA 3AVKA 4QCLA 1S1WA 2QKBA 3VQPA 4DMNA 3HO1A 1VSEA 3NGZA 1XI1A 3DLEA 1JLQA 3DLHA 4B9LA 1IH7A 1LV5A 4KTZA 3OY9A 3NHGA 2YHAA 4I2PA 4DTOA 4KHNA 1KVCA 3MXMA 2Y1JA 4DSKA 4DU3A 1S5JA 3QLHA 5SWMA 3OYHA 4E89A 5CY4A 4CJFA 1WNSA 4CIEA 4ELTA 4KTQA 1JXEA 2DY4A 4IKFA 1NK4A 4CFAA 3MEDA 3ZT4A 3IAYA 4GMJB 3V9SA 3RMDA 1NJXA 3OYMA 1LWEA 4PUOA 1C0TA 3OYKA 4O44A 3ZT3A 3DYAA 4BE1A 4E3SA 1U04A 4CJKA 4J2BA 1X9WA 1TKXA 4KREA 5DK5A 4CF2A 1YTAA 4E7IA 4K8XA 4DLEA 2HW3A 2RPIA 4H8KA 1RDDA 4IG3A 5C42A 3KD5E 4B9MA 1IO2A 1IKWA 3IRXA 3OS2A 3V9WA 1BGXT 3NCIA 1BHLA 1RBTA 1VRUA 3VQQA 5I3UA 4FJIA 3HXMA 1RT4A 3SNNA 4B8AB 4FM2A 3MEGA 4KB1A 3KK3A 4YNQA 3ZT0A 4DQSA 3V9ZA 1DLOA 1TL3A 2B5JA 2BDPA 1TK5A 2QKKA 4F3OA 3CM5A 4IG0A 3OS0A 3NFAA 4LH4A 4CHOA 3HSTB 2R7YA 1NJYA 1CLQA 1IG9A 2IDOA 1LAVA 3D45A 2FBYA 2HNYA 3M8RA 2GUIA 2DFFA 1BIZA 4CGDA 3JYTA 4B9SA 4EZ6A 3AA3A 3NE6A 5CYMA 1SKSA 3VN5A 4CJUA 3QESA 1NOYA 4ELUA 3K5LA 4E7HA 4DTNA 2XY7A 4IFYA 4KAZA 4KI6A 4RW7A 1TK8A 2HNDA 3DRSA 2X74A 1TKTA 3WNEA 3U3YA 1N6QA 1XC9A 1C0MA 1JLCA 2VG6A 4CGFA 3AVBA 1IKVA 4FVMA 5KI6A 5KGXA 3KLFA 2YNGA 3NGIA 1L3VA 1YT3A 4AHUA 4DU4A 3SI6A 2PZSA 5HRRA 1JLEA 3AA2A 4F8RA 4KHSA 2HMIA 3KIOA 4DTJA 1RTDA 2KTQA 3RRHA 5HLFA 1S6QA 1SKRA 4DTSA 1JL2A 5HRNA 5I42A 2Z1GA 4CEZA 1UA0A 1X9MA 2DFEA 3V1OA 1UA1A 4FW2A 1G15A 3V9XA 4J2DA 4KHQA 2XO7A 3OS1A 2KW4A 4UQGA 3MXIA 1VSJA 1D9DA 1RT1A 1B92A 3HJFA 3D0PA 3KK1A 1BCMA 1NKCA 3LANA 4CIGA 3OYFA 3P83D 3OYEA 1DTQA 2JGUA 4B3OA 1KTQA 3K57A 1JL1A 2ZQBA 4HHTA 3VA0A 1VSMA 3C6UA 3KKRA 4CGGA 2FBXA 5FRNA 3SQ4A 1S1UA 3HK2A 3SYZA 4NYFA 3DOKA 3SV4A 3ZCMA 3DOLA 1MU2A 3P1GA 3L2UA 4E7KA 4DQPA 4YFUA 4CJLA 2VWKA 4FLYA 1U4BA 4EP5A 1BI4A 2YV0X 3PX4A 3B6PA 3CG7A 1SL0A 4C8MA 4RW8A 1TVRA 3VQ7A 2G8UA 1HYSA 5JS1A 3BDPA 3AVAA 4KHUA 3LAMA 2XY5A 2BGGA 4OKJA 3S3NA 3KLEA 3M8QA 4B8CA 1NK7A 4CEOA 4M3RA 2GV9A 1TGOA 4I9LA 5C24A 3OYGA 1T03A 2OPPA 4KKOA 1WN7A 4LD0A 4TSXA 2HHQA 4M3TA 4Q5VA 4FLXA 3O3GA 3PX0A 3OYBA 3LWLA 3A2FA 2HHXA 2KZMA 1S6PA 3I0RA 2VWJA 4FJHA 3L3UA 2F8TA 3VQ9A 3F9KA 4CECA 4FJKA 2RF2A 1JKHA 4E1NA 4HUEA 4Q0BA 4DWIA 3TAPA 1CZBA 3QEVA 4FJMA 3DMJA 4MQ3A 1W9HA 4H4MA 1LAWA 3T1AA 1L3UA 4EP4A 4CJQA 4F3TA 4ID5A 4W5OA 2XY8A 1A5VA 3RMBA 3CYMA 4OPJA 2PYLA 4PA1A 3L3VA 4F2SA 4E19A 3DRPA 4KB0A 3OYJA 3S3OA 3ZT2A 1HNVA 4N41A 1RT2A 3L2VA 1ZBUA 3P5JA 1GOCA 4Z4GA 1UOCA 2EX3A 5JS2A 3TWHA 4Y1DA 4DF4A 3U6FA 3KLIA 4CHNA 4AHSA 4FLTA 4NCBA 1GOBA 3QEIA 3VQEA 1Z26A 4FZZA 1RNHA 4KTWA 3DRRA 4QOZB 3NF7A 1HPZA 3AVLA 2P51A 1S1VA 1REVA 2D0CA 4R5PA 3T19A 1B9DA 3HL8A 4N5SA 4CJTA 3TAGA 4CESA 3V4IA 4DQQA 2D0BA 2A1SA 4E7JA 2VG5A 3TAQA 2EHGA 3K58A 4OKKA 3QEPA 3MXJA 3PO4A 3TARA 4B9TA 4DSIA 3CM6A 1BIUA 1RBUA 4O55A 4BWMA 2IC3A 2LSNA 4I2QA 4E7LA 1QSSA 2PYJA 4C8NA 1BI4B 3RR7A 2O4GA 4F4KA 3O3FA 4C8OA 1WAJA 3LP1A 3MECA 1WSEA 1XWLA 3V6DA 1KFSA 1RTJA 4DSLA 2JLEA 3K5OA 1BL3A 1HNIA 2E4LA 1KVBA 2KFNA 2RKIA 4CHZA 1U45A 3M8SA 5HROA 1HYVA 4ZTJA 4BDYA
chains in the Genus database with same CATH superfamily
3AVMA 5J2PA 1SL1A 1JLGA 3IKMA 3LALA 3HOTA 1KD1O 1HYZA 4H0OA 2GBZA 4CFBA 2VQEK 1U48A 1RDBA 4DFKA 3Q7BA 3ID8A 3AVGA 5GIPA 4QS7A 3KZBA 5KPZA 1WB9A 1NGEA 2AJQA 3HZ6A 3OYLA 1NMDA 1OH5A 2X6SA 3UE5A 4CJVA 3PX6A 4CJ3A 4JI3K 2VCPA 1SKWA 3VEVA 1NKEA 2D0OA 3F2KA 3QIOA 5ADXH 1V4SA 4K8ZA 3I55N 3THWA 1K8KB 4FJGA 1HQEA 1VSFA 1XMQK 4B9QA 4FCYA 1GLAG 1YXQA 4FW1A 2A3ZA 2HNZA 5AQSA 3AO3A 3M1FA 1W7AA 1UWBA 3WNHA 3NH0A 3RR8A 4CBXA 1TAUA 4X64K 4DV0K 3MN6A 4BVPA 1TYQA 3A5NC 4NCGA 3ZSWA 1U2VB 2D0AA 1RGIA 3THVA 3TSPA 3J81O 4DF8A 3LM9A 3MK6A 4FK0A 3OYNA 3VPZA 3TI0A 4FJNA 5K14A 3L8BA 1NKBA 4QS9A 1HKBA 4X62K 4ICLA 3FR0A 1HKGA 4CZFA 3A5OC 1J5EK 1B9FA 4LY7A 3RWUA 5AQFA 1HKCA 1X9JA 1VSDA 1VQLN 4CEFA 1A5WA 3AO5A 3CJBA 5M1FA 3BF1A 4LF8K 3EEQA 3TPQA 3G6EN 1KLMA 2O8FB 1SAZA 2FLOA 1HX1A 3RRGA 1FKPA 2DTUA 3QINA 4EHTA 3THYB 3IG1A 3U3GA 4V19S 1XC3A 1QSYA 4AHTA 1N5YA 1LWFA 3MMVA 3SQ1A 4CJ4A 2Z1HA 3ZSQA 3GOIA 4RW6A 4JD2B 1XHZA 5LJVA 5HRPA 1CZAN 3S3MA 3L2RA 4DTXA 4B3SK 2BTFA 3SBTA 4M63C 5AQZA 4BRHA 2HHWA 3AVFA 1ASUA 2IGIA 2OZMA 3NF9A 1YI2N 4CEDA 3DXKA 4CF9A 5AQRA 1HMVA 3QNNA 3LPTA 3VEYA 2BE2A 4PKGA 1JCFA 1EXQA 2XRIA 3C7NB 1ZBLA 4B3MK 1KXPA 4FZXC 1S1TA 3R3LA 3CCSN 1ITGA 4FJJA 5C25A 4YHHK 2P9IA 1CXUA 4PHTX 1EX4A 1U49A 3ZEUB 1KLNA 5C12A 3M3ZA 4A5BA 2WOMA 4LSNA 1SV5A 4DTRA 3CF5L 2A5XA 4QAGA 5AQNA 2IIRA 2YKNA 2F9WA 4E1MA 3RMAA 1S22A 4IZ9A 4JHDB 4NXNK 3AO1A 4CJSA 4CJ7A 3UKRB 4WYBA 2P9LA 3NDKA 3CCUN 4GW6A 1RBRA 1RT6A 3ZSXA 3JSMA 5AFUA 4KHYA 4DS5A 3E1YA 4CJWA 3EZ5A 2KZMA 1BCOA 3K5MA 1VHXA 1S9GA 4OPAA 4FK2A 4CD1A 5AZIA 4NLCA 3NF6A 1Y64A 4Z4IA 4Z4HA 2F7TA 5FPEA 2CH6A 1O1WA 4N56A 1QHTA 4MDBA 3RMCA 2YNIA 1CXQA 2G8VA 1C0GA 4DTPA 4FWSA 3AAQA 4ZTFA 3VTIA 1GLDG 4E0DA 2GUPA 2P9NA 1L5UA 2PAVA 1M1KO 4M3ZA 4FXDA 4YOTA 2ZE2A 3VQAA 3ZX0A 4I9QA 5GAEP 2X6NA 1QQCA 4IOXA 2E2OA 1LWCA 3AGKA 5HOOA 4IFEA 4CGHA 1D5AA 5KPRA 3SPYA 3VESA 1C1BA 2BH1A 4OKEA 3WUHA 2B6AA 3NGYA 1A5XA 3CCEN 3BEXA 3U4LA 1TK0A 4OVLA 3EY1A 3LAKA 1O13A 1SL2A 4JI5K 4FJXA 4GV6A 3OYCA 4K0KK 2QWMA 1KAYA 3AVKA 4QCLA 1Q86O 1NNEA 3HO1A 3ATUA 3NGZA 1GLLO 4DHYA 4B9LA 1IH7A 4KTZA 3J8AA 2YHAA 4I2PA 3G4SN 4DV7K 4DSKA 4DU3A 5CY4A 4ELTA 2DY4A 1RFQA 1NK4A 3MEDA 2QWRA 3ZT4A 4WQ4C 1VQ9N 3T1YK 3RMDA 4JK9A 3ZT3A 3DYAA 4E3SA 1T6CA 3L0QA 4CJKA 4J2BA 4KREA 1TKXA 4UY8O 3JXUA 4OPHA 4E7IA 3ZLJA 2NRVA 3THXA 1EWQA 4KH4A 4IG3A 4BGBA 1IO2A 3DXMA 3FGUA 3IRXA 4XEIA 3FZHA 5JLHA 2WFBA 5I3UA 4FPBA 3PLAA 5M1PA 2W40A 4KB1A 4CD3A 4F3OA 1TL3A 3CM5A 4BR2A 3NFAA 5CR4A 4RWTA 3L4IA 3S41A 3HSTB 4O8KA 1CLQA 2IDOA 3D45A 3U8XA 4A59A 1M90O 3JYTA 2ZGYA 3VOVA 3P31A 4ELUA 5DM6L 3K5LA 4KI6A 2FF3B 1Z05A 4RW7A 1TK8A 3DRSA 2IVPA 1T6DA 2VG6A 4DR2K 1P8ZA 4BREA 3NGIA 2PZSA 4DU4A 1Q18A 3SI6A 3KWIA 3TSQA 1DKGD 3KIOA 4FWNA 1S6QA 1SKRA 2P9KA 1JL2A 4BR9A 5I42A 2Z1GA 3J7ZO 2F9TA 3LDNA 4B1UB 3V9XA 4DV5K 3OS1A 4LFAK 5KQDA 3KK1A 5BRHA 5AQKA 2YJFA 5JICA 3OYFA 5AQMA 1JL1A 3KKRA 4WCEL 5FRNA 2YHXA 1J6ZA 4YOVA 3HK2A 3ZCMA 1YVNA 3QFUA 1MDUB 5M1OA 3CD6N 5BN9A 1U4BA 5AFUH 3FFKB 3CG7A 3F9MA 1TVRA 3VQ7A 3AVAA 4B1VA 4KHUA 3LAMA 2BGGA 3KLEA 4B8CA 4CEOA 5C24A 4I9LA 2BUPA 4JKHA 4LD0A 1SS6A 3SMPA 3SMSA 4Q5VA 3PX0A 1S6PA 3I0RA 2F8TA 3HOSA 3GG4A 3CETA 2RF2A 1JKHA 4E1NA 3IDHA 4HUEA 4IJNA 3TAPA 1NG9A 4FJMA 3DMJA 4MQ3A 4RCHA 1L3UA 4EP4A 4F3TA 2XY8A 2PYLA 4F2SA 4E19A 3ZT2A 1HNVA 1RT2A 2WTUA 4Z4GA 3P5JA 2EX3A 3VQEA 5BR9A 1Z26A 3VMFB 1RNHA 4JKCA 2E20A 2QI2A 4QOZB 3NF7A 1HPZA 3VEOA 1K8KA 3HL8A 3TAGA 1E4FT 2A1SA 4E7JA 2QWLA 2E1ZA 3BF3A 4L3QA 4OKKA 3QEPA 3MXJA 4ILJA 1RBUA 4C8NA 1NJIO 1W97L 3MECA 1XWLA 3K5OA 5KPTA 2QWPA 3D2FB 4CHZA 3K9JA 1HYVA 4H0YB 1QZ6A 5AQTA 1ZBSA 4DV1K 3HBTA 3QEWA 2ETJA 3AVJA 3KKSA 1N34K 4PL7A 4DCHA 2ITGA 3HPHA 2IAJA 5GAGP 5JMVA 3FZKA 2EWSA 3HM9A 1TKDA 1Q82O 4K41A 3AARA 4J2AA 2JWKA 1X3MA 4O4GA 1NMNA 5KRSA 1BOTO 5HBMA 4DFMA 2GX9A 4NLBA 3F73A 1HNXK 3NH1A 4LF6K 3ISNC 1VQNN 4B3TK 1OH6A 4CJEA 3SAGA 2O8FA 1ATRA 5JVGL 4OGCA 1QTMA 2YHYA 3I0SA 1JJ2M 1MWKA 1TAQA 3AA4A 3DLLL 5F2RA 3MCAB 1ZBIA 3FE1A 1WUAA 3R9PA 3HI0A 4BE2A 5CYQA 3WNGA 4FM0A 3WXJA 2WONA 4MO5A 1IKYA 3LL3A 3MN5A 2Q31A 2O8DB 4JD2A 4FWRA 3MX5A 2BANA 5KQ8A 1TV6A 4JS4A 1JLFA 3NVKA 1R0AA 3QERA 2PFUA 2YI1A 2DFHA 3MX2A 2OPSA 1K8AO 1VRTA 3OBWA 3TABA 1IBLK 2AA4A 4G9ZA 3HVTA 2QK9A 3HVRA 1VSKA 3U9ZA 4BC2A 3CERA 3NMUA 3HPGA 3LP3A 3ZX3A 3HYFA 4F2RA 4LFCK 1UAXA 1XHXA 3T3FA 1RDCA 3SUNA 1T7PA 2FSKA 4HVJA 2YNHA 2HF4A 4YDUC 4JI0K 4B9VA 3VETA 3ZEUA 2D5RA 5CZ2A 3LP0A 2G8WA 4CIFA 5AZJA 4FOIA 3CQXA 3T69A 4PL8A 2RN2A 4U7BA 3QO9A 4OJRA 3JS6A 4FWMA 4FLZA 3QEXA 4CCHA 5CZ1A 1ASWA 4K42A 2WUSA 3CFPA 3TAMA 2HHHK 3QICA 2QW9A 4OGEA 3VQCA 5LL6Z 3CHWA 4FWKA 4DFJA 1TUUA 1ZC6A 5C2FA 1DEJA 1D4XA 4ISFA 1NK0A 2G8KA 2YNFA 5J2MA 3WEEB 2V7ZA 1Q7YO 4BE0A 1BA0A 4N47A 2NUBA 4JKAA 1Q9XA 3UIQA 3SK3A 3M6GA 1HLUA 3DLKA 2OA8A 4CEBA 3UKUA 4KHWA 5FROA 1WSJA 2I5JA 3TTCA 1YHQN 4M7YA 3O9RA 4I6MB 4WFBL 1FJGK 2HBKA 1RDAA 2CH5A 1NK8A 3ZX2A 4H03B 3ENBA 3NAEA 4JKFA 3G10A 1WLJA 4BRCA 4DQRA 3QFPA 3LWMA 3ZSYA 4M45A 1FKOA 1KSPA 3L2WA 4GKJK 4DV4K 4HTUA 3L2QA 1TUYA 4KI4A 4R79A 2G8FA 4M42A 3ULEA 2P1JA 3O9QA 4BRMA 2E2QA 1XNRK 2ITMA 3GBTA 3CQYA 4B08A 4WFNL 4PWDA 4W5NA 3O4NA 4NYNA 1VSHA 5BPLA 3SUQA 1K73O 5LMUK 3VQBA 3ENOA 5GINA 3KJVA 3TAFA 2HVIA 1EO1A 1ZBFA 3SJHA 1VQON 1WAFA 4LH5A 1KVAA 3O6WA 1I39A 3ASMA 2Q1NA 4O0JA 1NGAA 4DQ8A 2P9UA 2ZD1A 4Z4EA 3SCXA 3I8DA 4PY5A 5EU7A 3OVNA 2GWJA 2O8CA 2OPRA 5CHIA 4AHRA 3L4QA 3PY8A 2Q0UA 1OH7A 1T44A 1T05A 5B8HA 2A1RA 4CBUA 2Q36A 4H4OA 1NGFA 4CZKA 3C0BA 2HHUA 2WBNA 5AQLA 2VGNA 4U67L 4FWOA 1FK9A 4WQ5A 3EE9A 2KLAA 4PQUA 3CCQN 4RG8A 2ZM6K 4H0PA 2HHSA 5EOYA 4N76A 5BPMA 4JI8K 3I8BA 3TR8A 3AO4A 2P5OA 3EKSA 3E9LA 3KK2A 4BRIA 1U47A 4WF9L 3P4IA 3HT3A 3VEXA 1RT3A 3ITHA 1IV0A 3WNFA 3EO3A 2V52B 1JLAA 4CEEA 1F21A 1JXBA 1YJWN 3PV8A 1YVUA 4FLVA 4DTMA 1NWKA 4BR5A 2FBTA 1GLEG 5AQOA 1W2BM 1ESVA 1S1WA 4BVOA 3EN9A 3DLEA 3DLHA 3MCPA 3CCVN 3OY9A 2HBJA 4IOCL 3TU5A 3O9SA 4CJFA 3O4WA 4IKFA 4CFAA 1BUPA 2A6AA 3V9SA 4X66K 3OYMA 1XUPO 4BRLA 3BZKA 3VEZA 4GV9A 3A5MC 3CIPA 3RVCA 2HW3A 2RPIA 5C42A 5BN8A 3KD5E 3CC7N 3OS2A 1WBDA 1BGXT 1BHLA 3ZETB 4FJIA 3HXMA 4BY9C 3KK3A 1OKJA 4AM7A 4AQYK 3HSCA 2D0PA 2HOEA 3NE6A 1BO5O 5CYMA 2UU9K 4CJUA 1LOTB 2HSTA 4JI7K 3WNEA 1N6QA 1BA1A 5KI6A 3KLFA 5KGXA 2FF6A 3N4QA 5HRRA 1QQOA 2KTQA 3RRHA 5GIOA 4DTSA 5HRNA 1N33K 1UA0A 1X9MA 2DFEA 3EE8A 3V1OA 1UA1A 4J2DA 2O8BB 4DKWA 4UQGA 4JK8A 1VSJA 1SZ2A 4FWPA 1B92A 5EX5A 5AQJA 3D0PA 3E9PA 3O8MA 3VEWA 3LANA 4LF4K 4CIGA 2PBDA 2WC9A 2P9PB 2E8AA 1DTQA 1WBBA 2JGUA 3K57A 4C23A 4HHTA 5AQWA 2NRZA 3CJ9A 1C0FA 1S1UA 5E26A 3SYZA 4NYFA 4BRPA 4DQPA 4CJLA 3P39A 4EP5A 2G8UA 3B6PA 1HYSA 1JCEA 2XY5A 1MA9B 1N8RO 3S3NA 4ISEA 4H0TB 3CJ1A 3D2FA 2GV9A 1T03A 1WN7A 4LF7K 2HHQA 4M3TA 2RHKA 3FZLA 5C10A 3L3UA 2A40A 1IG8A 3THWB 3QEVA 4H4MA 1LAWA 1NLVA 4CJQA 3CYMA 3E66A 4KB0A 3FZFA 3S3OA 4MLEA 1ZBUA 1GOCA 1NBWA 1QQMA 3IFRA 3U6FA 4YORA 3KLIA 1S3XA 2OANA 3G25A 4PKIA 4AHSA 1GOBA 4FZZA 1R59O 3DRRA 2UUCK 3AVLA 1S1VA 2D0CA 2P51A 3T19A 1B9DA 2QWNA 4DQQA 4IWVA 2VG5A 3TAQA 1QQNA 5AJ3K 2J4RA 3W0LA 4B9TA 4DSIA 4E7LA 3ID6A 2LSNA 3C6AA 4CZEA 2YX6A 1BI4B 4C8OA 1WSEA 3V6DA 2JLEA 1BL3A 3U9DA 3ZYYX 2KFNA 2RKIA 5F1XA 4K25A 3PIPL 4BDYA 3VTHA 1HR0K 5T7BA 4FLWA 2Z1JA 5KTQA 4C8KA 3SPZA 1XQSC 4WFAL 5E84A 3LDOA 5E41A 3NH2A 3HPOA 4FWQA 3D2EA 3I33A 1W0HA 2E5LK 4RW9A 4GVEA 2NRTA 4EFHA 1D8YA 1NGDA 2A41A 1GLBG 3HP9A 1KRPA 3MWPA 1VSLA 1HQUA 3VA3A 4DU1A 2UXDK 3P38A 3RTVA 2Q3SA 4IBNA 3VGLA 3EYZA 4FJ9A 3OBYA 5J2QA 4BDZA 2PY5A 4JKGA 5LY3A 2H3GX 2HHVA 5C0YA 3AVIA 4FK4A 4AILC 3K5NA 4WE1A 1FXXA 1I3AA 3LP2A 4XIUA 4A5AA 1Y97A 3AVHA 4DG1A 3J80O 3SQ0A 4AHVA 3DXKB 4Z4CA 4NB4A 2YHBA 2E2PA 3DI6A 3H1QA 5IWAK 1K9MO 1J54A 5AQUA 3FLCO 4IJAA 1WOQA 4KO0A 2NNWA 3HP6A 2E6MA 3AA5X 2P9IB 3QIPA 4EZ9A 4OLBA 3H1VX 1HJOA 3WEEA 1HNZK 4Y1CA 5FDLA 3CCJN 3ZSVA 3VQ8A 3DLBA 4FJ7A 5LJWA 4DUYK 1HUXA 3M5RA 4BACA 3EZWA 3V9UA 2IS3A 4YOUA 4M3UA 2QWOA 4JKBA 4JS5A 4DR3K 3FZMA 3SAHA 3V81A 2IVNA 1E3MA 2NRRA 1S9EA 4NXMK 4CEAA 4CHYA 2VG7A 4M41A 4CE9A 3K59A 2P9LB 4CEQA 3O9UA 4DR5K 2HBLA 4DV2K 4FLUA 2OZSA 4Z4FA 3K9KA 4CF0A 4CHQA 4JLHA 4BR0A 3NF8A 1H1VA 1Z25A 3H3NO 2UXCK 5AZIB 2Y1IA 3QDKA 2QWQA 1NK5A 1WSGA 2W42A 4CGIA 2QXLA 1J53A 1VSIA 4YOXA 3KD1E 1LW0A 4CK1A 1LW2A 3M8PA 4W5TA 3VF6A 1XNQK 4H5WA 3O1BA 1ASVA 4IEIA 1GLCG 2FBVA 2FC0A 1RTIA 4GY2B 2P9NB 5DMRA 4GVMA 1IKXA 5C2DA 1U2VA 5DM7L 3AO2A 2G8HA 5EVZA 3OJUA 5TKWA 4ELVA 3MN9A 5D3GA 4MFBA 5FRMA 3DLRA 5JVHL 3BZCA 3HRGA 3B8AX 4JRQA 5BRDA 1NK6A 5HP1A 3LDSA 4H5RA 2OCEA 4OLAA 4KH5A 4CK3A 4JI6K 4K43A 4O5BA 4HTLA 3K2PA 3H45C 3TAEA 1RCHA 2V7YA 3OYIA 1NM1A 1S1XA 1YTUA 2FXUA 3O08A 2X78A 4FM1A 3BY5A 5IT9O 3ALYA 4OX9K 2HHTA 3KHYA 2IOCA 4ID1A 2F8SA 3G0ZA 3THYA 4B1YB 1HNWK 1VQKN 3VGMA 2UUAK 4CBWA 1J9AA 4X65K 4Z94A 3SBGA 3AVNA 3BGRA 1VQ4N 4CJ5A 2KKZA 2OTLN 1ZYQA 2I7PA 1P90A 1QVGM 4J2EA 3DLGA 3OJSA 3SQ2A 4XH4A 4XH5A 1N36K 5HRSA 1VQ8N 1TKZA 3PSIA 2KZZA 2DPNA 3DXMB 2JWLA 1KAZA 4KPYA 3CFOA 5J2NA 2AP1A 3MEEA 1Q8IA 1RBVA 1EP4A 5SZTA 3CFRA 4LF5K 3C7NA 3KWGA 4M3YA 3PUFA 3E01A 4CFDA 3CPEA 3OYDA 4ILHA 4OPKA 3VQ6A 3LDPA 3AAPA 4AH9A 4CERA 2KHOA 3AV9A 3ZSZA 3OHRA 2XY6A 1SQKA 3VQDA 1L3SA 2ATQA 4DR1K 3IS9A 1EKEA 5I9EB 1J5OA 4IO8A 5AQVA 3C65A 4C1NI 5AQIA 1GLJO 3H46O 4A2BA 2E6LA 4JHDA 3ULDA 3KLHA 4JV5K 3V1RA 4JYAK 3UKRA 2P9KB 3ZSOA 2QKBA 3VQPA 1VSEA 1XI1A 4KHNA 1LV5A 3MXMA 3R8EA 3OYHA 4E89A 1YUWA 1WNSA 4CIEA 4KTQA 1JXEA 4BRGA 4J8FA 1KC8O 2RE2A 3IAYA 3KVGA 1NJXA 4AF1A 4PUOA 4GNIA 1C0TA 3OYKA 4O44A 4BE1A 3G71N 2Q0RA 2GELA 1X9WA 3VF2A 1VQ5N 4CF2A 4A62A 4K8XA 4DLEA 4B9MA 4CZLA 3V9WA 1VRUA 5BRFA 3MN7A 1IJJA 3VQQA 4H5VA 1RT4A 4FM2A 3DJCA 3HTVA 2QKKA 3V9ZA 4DV3K 2B5JA 3OS0A 2NLXA 4IG0A 4CHOA 1NU0A 3D6RA 2QM1A 2HNYA 2DFFA 1Q81O 1BIZA 2ZJPL 5H1SQ 3AA3A 4EIAA 4DR7K 3WQTA 3VN5A 1NOYA 4CZJA 2ZJRL 4E7HA 4DTNA 2XY7A 4IFYA 4KAZA 2X74A 1TKTA 3AVBA 4FVMA 1L3VA 1NGCA 1YT3A 4AHUA 4OO1J 1JLEA 3AA2A 3CXCM 3LM2A 2ASMA 3TSUA 4A57A 1RTDA 1YF5L 3KK7A 3RSEB 4CEZA 3CMEN 4KHQA 2XO7A 1ATNA 2KW4A 3MXIA 4JKDA 1RT1A 1GLFO 4BROA 3HJFA 1E4GT 1NKCA 4IXCA 1YIJN 3P83D 3OYEA 4B3OA 1KTQA 2E88A 1VSMA 4CGGA 2VGMA 3VENA 3DOLA 5FLXO 1MU2A 4E7KA 4FLYA 3O9TA 1BI4A 3QBWA 4RW8A 5JS1A 3BDPA 4FL9A 1VQPN 2QA4N 3OYGA 4KKOA 2O8EB 4FLXA 2A42A 3OYBA 4JN4A 1NGIA 2VWJA 4B1XB 4B1ZA 4FJHA 4CECA 4FJKA 4MDAA 4BQZA 2UUBK 4DWIA 4Q0BA 4HWIA 3T1AA 5BREA 4ID5A 4CZMA 3CI5A 1A5VA 4CW7B 5GAHP 3RMBA 1UOCA 3IMXA 4BR7A 4CHNA 4FLTA 4NCBA 2ZGZA 3QEIA 3VGKA 4EAHD 3PIOL 4AM6A 1NGBA 3O80A 4R5PA 4N5SA 4CJTA 4CESA 3V4IA 2D0BA 4WQ5C 3J7AP 2EHGA 3K58A 3TARA 2UXBK 1JCGA 1BIUA 2GWKA 1VQ6N 1QSSA 4LFBK 2PYJA 5AQPA 3TTFA 1ILYA 1VQ7N 4F4KA 4DR6K 1RTJA 4DSLA 2W6KA 3LDLA 1HNIA 1KVBA 4BRDA 3M8SA 2F4VK 1MWMA 1YJ9N 4BRNA 3BUZB 3HM8A 4BQLA 1C1AA 1KCFA 3LDQA 4FZYA 1RILA 2YJEA 2E2NA 4ILGB 2FSNA 3SLCA 1QS4A 3CMAN 5AR0A 2W6LA 1EQYA 3N4PA 4DSFA 1WSFA 5AZJB 1X1PA 5J1EA 4DS4A 3C6TA 3H3OB 4O0IA 2I7NA 4L8RB 4ISGA 1QZ5A 3QETA 1C1CA 3LZIA 1HJRA 4G1QA 3AGRA 4KRFA 3D7EO 3CJAA 1CZ9A 3SUPA 1K6YA 1IBKK 5EY4A 4CK2A 3IUCA 2W41A 4BC5A 3QBXA 2D4WA 1S72N 2YKMA 2P9SB 3PSFA 3AVCA 3CPWM 1N32K 3UKUB 4DUZK 2OTJN 1NGJA 4W5RA 4LC9B 4CJPA 4GKKK 4A61A 4JNEA 4M3WA 4NO7A 1QHAA 4KFBA 1QSLA 4JRPA 4WQ4A 4HUGA 4HCCA 4IDKA 4CZGA 4PKHA 4CGJA 3CC4N 4DSEA 4FJ5A 1OH8A 2B4JA 3NBPA 1ZBHA 2CGKA 3PO5A 2XHBA 5C15A 3ULEB 3KLGA 3WXKA 4NCAA 4B9NA 3E9OA 3TANA 1QE1A 4M3XA 4BRKA 3C6HA 1RDUA 1NGGA 4ZHRA 1ATSA 4Z0UA 4FYDA 4CI6A 3GL1A 2HVHA 4W5QA 3WXLA 3K0SA 4HCBA 3T7ZA 1YITN 4IFVA 1IBMK 4CF8A 5TKYA 1NK9A 1KAXA 5FPDA 3A5LC 4DLGA 1HPMA 4BC4A 2P9UB 4H5NA 1NJWA 3CJ7A 2O8CB 1TL1A 3S9HA 1TYQB 4B3RK 4BDPA 1BISA 3CJCA 5AQQA 2F96A 3MDQA 4FO0A 2E1YA 1X9SA 4FPAA 4IOAL 3V1QA 3NVMA 1WSHA 3LZJA 2QTDA 3VERA 4AHCA 1L3TA 3WT0A 5KRTA 1Q9YA 3L6QA 2Q2RA 1SUQA 2KQ2A 4RW4A 5F0XA 4DV6K 3OYAA 2O4IA 2O8DA 2HB5A 1C6VA 1D9FA 4JEPA 3ATVA 1XMOK 1NOZA 4LSLA 3VF4A 4F9OA 1NGHA 4A2AA 5M1QA 5GADP 2Q97A 2YCHA 3SUOA 4KHPK 2VQFK 4FJ8A 1BQNA 3O3HA 3JAMO 4BWJA 4H0XB 4HUFA 3SAFA 5FPMA 4BR4A 4DSJA 3LPUA 2Z1IA 2G8IA 3R1XA 3O4QA 4CFCA 4JI1K 2NZTA 2YHWA 2P5GA 1VK0A 2GEMA 3CC2N 3FFIA 4DFPA 1HRHA 4BRAA 4H0VB 2IVOA 3SV3A 3C95A 4BRQA 3QNOA 4CZHA 1KFDA 5A2QO 1T3VA 3C94A 3B6OA 2ASPA 4DTUA 4IO9L 3VQ5A 2VWBA 1RT5A 5MLCQ 4CJRA 3H08A 3OA9A 1NJZA 2NRWA 4YOWA 3DM2A 1OVQA 4KV8A 2HF3A 4RTFD 1GOAA 1U6ZA 2OPQA 4FOEA 4BC3A 3MAQA 2QXFA 3A8YA 4FSVA 2KFZA 4CF1A 1QVFM 1BQMA 1RBSA 1EETA 3SJJA 5KGWA 1BG3A 4FJLA 4I6MA 3VQ4A 3SZ2A 3I56N 4MO4A 4IEEA 4DQIA 3WXIA 3KTQA 1VQMN 4Y0WA 1RT7A 1WSIA 3ZT1A 4CHPA 1X3NA 2HMPA 4YY3K 4B1WB 3Q7CA 1T8EA 1RTHA 1JLBA 4E1JA 1BDGA 3TTDA 4I7FA 1C0UA 2OYQA 1EWRA 3ZSRA 3CQ8A 4O5FA 3CCMN 4C8LA 1DTTA 2ZF5O 3R6MA 4YOYA 4DMNA 1OVYA 4XH1A 3EL2A 5HL7L 1JLQA 3MWTA 3NHGA 4DTOA 1KVCA 2Y1JA 4M7XA 1S5JA 3QLHA 5SWMA 2V51B 5JLFA 2NRHA 5ELZA 4GMJB 5AQGA 5ADXA 1LWEA 5FPNA 3RSEA 1DT9A 1U04A 5DK5A 2UYTA 1YTAA 4H8KA 1RDDA 1IKWA 4IDHA 4C1NK 3NCIA 1RBTA 5AQXA 3SNNA 2ZJQL 4B8AB 3MEGA 4LF9K 5M1KA 2CGLA 4YNQA 3ZT0A 4DQSA 2CGJA 1DLOA 2D1KA 2BDPA 1TK5A 4JK7A 4KH6A 4LH4A 3OW2M 1DGKN 4FVUA 2R7YA 4H5TA 4BRFA 1NJYA 1IG9A 1LAVA 2FBYA 3M8RA 2GUIA 3F5TA 4CGDA 4BGAA 4QS8A 4EZ6A 3A0IX 5AQHA 3QESA 1SKSA 2QEXN 4KBOA 3T1HK 2HNDA 2O8EA 3O1WA 3U3YA 5M1NA 1XC9A 4DR4K 4YDUA 1JLCA 1C0MA 4CGFA 1IKVA 2YNGA 1V4TA 4F8RA 4KHSA 2HMIA 4DTJA 2NRXA 5HLFA 4CZIA 1G99A 3H6EA 4JI2K 4FW2A 1G15A 3WQUA 3CCRN 3UB5A 4JKEA 1BU6O 1D9DA 3THXB 4MLHA 1BCMA 1FW6A 4JI4K 3GE1A 2ZQBA 3GDQA 3VA0A 1BWFO 3C6UA 5AQYA 3DAWA 2FBXA 3WXMB 3SQ4A 3BP8A 3DOKA 3SV4A 1RDWX 3P1GA 3L2UA 4YFUA 3D2EB 2VWKA 4O8UA 4EHUA 2YV0X 3QMLA 3PX4A 1SL0A 4C8MA 2ASOA 4JAXA 1KQSM 5BPNA 4OKJA 3M8QA 3ZETA 1NK7A 4M3RA 3AY9A 1TGOA 3DWLA 2OPPA 4CVNE 4TSXA 3O3GA 2HHXA 3LWLA 3A2FA 5EXWA 2VYPA 3VQ9A 3F9KA 4JKGB 1CZBA 1W9HA 2ZWHA 5BR8K 4GV3A 4W5OA 4BG9A 1YJNN 3ENHA 4OPJA 4PA1A 3L3VA 1Z6RA 3DRPA 4DB3A 3OYJA 4N41A 3L2VA 1I94K 2GTDA 5JS2A 5LMNK 3TWHA 4Y1DA 4DF4A 3EKUA 3QB0A 3J7YP 3O5BA 4KTWA 1ZXOA 1REVA 4B9UA 4B9SA 3W3DA 4BG8A 2HBMA 1YAGA 2FSJA 3PO4A 3CM6A 4O55A 4BWMA 2IC3A 4I2QA 1VAZA 2O8BA 3RR7A 2O4GA 3O3FA 1WAJA 3LP1A 3OTOK 1LCUA 1KFSA 5CE3A 3CCLN 2E4LA 1U45A 4FWLA 5HROA 2P9PA 4ZTJA 2P9SA
chains in the Genus database with same CATH topology
5T7BA 4FLWA 3AVMA 2Z1JA 5KTQA 4C8KA 5J2PA 1SL1A 1JLGA 3LALA 1C1AA 3SPZA 3QEWA 1KCFA 2ETJA 3AVJA 3KKSA 1HYZA 4FZYA 1RILA 5E41A 3NH2A 3HPOA 2GBZA 4CFBA 1U48A 2ITGA 1RDBA 3HPHA 4DFKA 3AVGA 1QS4A 1W0HA 2IAJA 4RW9A 2AJQA 1D8YA 3OYLA 3HM9A 1WSFA 4DSFA 1TKDA 2X6SA 4CJVA 3HP9A 1KRPA 4J2AA 1X1PA 5J1EA 1VSLA 1HQUA 4CJ3A 4O4GA 3VA3A 4DS4A 4DU1A 3PX6A 3RTVA 1SKWA 1NKEA 2Q3SA 4IBNA 3C6TA 4O0IA 3QIOA 5KRSA 3EYZA 4FJ9A 4L8RB 4K8ZA 5J2QA 5HBMA 4DFMA 4BDZA 3F73A 3QETA 2PY5A 1C1CA 3LZIA 3NH1A 2HHVA 1HJRA 4G1QA 1HQEA 4FJGA 1VSFA 3AVIA 3ISNC 4FK4A 4FCYA 4AILC 3K5NA 4WE1A 4KRFA 1FXXA 4FW1A 2HNZA 4CJEA 1CZ9A 1I3AA 3SUPA 3AO3A 3LP2A 1K6YA 4OGCA 4XIUA 1QTMA 1Y97A 3AVHA 3I0SA 4DG1A 1TAQA 3AA4A 1UWBA 3WNHA 4CK2A 1ZBIA 3NH0A 3RR8A 3SQ0A 4AHVA 4BE2A 5CYQA 3WNGA 4Z4CA 4FM0A 2YHBA 1TAUA 2YKMA 2WONA 1IKYA 3DI6A 4NCGA 3ZSWA 2BANA 3AVCA 1J54A 1TV6A 4JS4A 2D0AA 3THVA 1JLFA 4KO0A 1R0AA 4DF8A 4W5RA 3HP6A 3QERA 2E6MA 2DFHA 3AA5X 3QIPA 4EZ9A 4CJPA 4OLBA 2OPSA 4FK0A 3OYNA 4FJNA 3TI0A 5K14A 4Y1CA 4M3WA 3L8BA 4KFBA 1QSLA 1VRTA 5FDLA 1NKBA 3TABA 3ZSVA 4JRPA 4ICLA 3VQ8A 3HVTA 4HUGA 3DLBA 4FJ7A 4HCCA 4BACA 4IDKA 2QK9A 3HVRA 1VSKA 1B9FA 4LY7A 3RWUA 4CGJA 4DSEA 3HPGA 1VSDA 3LP3A 4FJ5A 2B4JA 3V9UA 3NBPA 4F2RA 3HYFA 4CEFA 3PO5A 2IS3A 2XHBA 1ZBHA 3KLGA 1UAXA 1XHXA 3T3FA 4M3UA 1RDCA 3SUNA 1T7PA 4B9NA 4NCAA 4HVJA 1A5WA 2YNHA 3AO5A 4JS5A 3V81A 3TANA 1QE1A 4M3XA 1S9EA 4CEAA 4B9UA 4CHYA 2VG7A 4M41A 4ZHRA 4B9VA 4CE9A 3K59A 1KLMA 4CEQA 2D5RA 5CZ2A 3LP0A 4Z0UA 4FYDA 2G8WA 2HVHA 4FLUA 4CIFA 2OZSA 4W5QA 4Z4FA 3RRGA 1FKPA 4HCBA 2DTUA 4IFVA 4CHQA 4CF0A 3QINA 4JLHA 3NF8A 4CF8A 3IG1A 2RN2A 3U3GA 1NK9A 3QO9A 4OJRA 1Z25A 4CCHA 4FLZA 3QEXA 4DLGA 1QSYA 5CZ1A 4AHTA 1N5YA 1LWFA 1ASWA 3SQ1A 2Y1IA 3CFPA 3TAMA 1NJWA 4CJ4A 2Z1HA 1TL1A 3S9HA 3ZSQA 4OGEA 4RW6A 1XHZA 3VQCA 1NK5A 4BDPA 1BISA 5HRPA 1WSGA 2W42A 2F96A 4CGIA 4DFJA 1J53A 1VSIA 1X9SA 3S3MA 3KD1E 2G8KA 3V1QA 1NK0A 1LW0A 4CK1A 3L2RA 1LW2A 2YNFA 3M8PA 4W5TA 4DTXA 1WSHA 5J2MA 3LZJA 2HHWA 3AVFA 4AHCA 1L3TA 1ASUA 2IGIA 5KRTA 1Q9YA 2OZMA 4BE0A 1ASVA 1SUQA 3NF9A 4N47A 4CEDA 2KQ2A 4RW4A 2NUBA 1Q9XA 4CF9A 3UIQA 1HMVA 3QNNA 2FBVA 3LPTA 2FC0A 3OYAA 2BE2A 1RTIA 2O4IA 1EXQA 2XRIA 2HB5A 3DLKA 5DMRA 2OA8A 1C6VA 4CEBA 1D9FA 4GVMA 1ZBLA 1IKXA 4KHWA 5FROA 1S1TA 1WSJA 2I5JA 4FZXC 1NOZA 1ITGA 3AO2A 2G8HA 4LSLA 4FJJA 5C25A 3OJUA 1RDAA 1NK8A 1CXUA 4ELVA 3SUOA 1EX4A 5D3GA 1U49A 4MFBA 4FJ8A 1BQNA 3O3HA 1KLNA 5FRMA 3NAEA 3G10A 3DLRA 1WLJA 4BWJA 4DQRA 2WOMA 4LSNA 4HUFA 1SV5A 3LWMA 3ZSYA 4M45A 1FKOA 1KSPA 3L2WA 4JRQA 4DTRA 1NK6A 4HTUA 3L2QA 5HP1A 4QAGA 4DSJA 3LDSA 4KI4A 2YKNA 2G8FA 3LPUA 2P1JA 2Z1IA 4E1MA 3RMAA 4M42A 4OLAA 2G8IA 4CK3A 4O5BA 4PWDA 4B08A 4W5NA 3K2PA 3O4QA 4CFCA 3TAEA 1RCHA 3O4NA 4NYNA 3OYIA 1VSHA 3SUQA 3VQBA 1VK0A 1S1XA 2P5GA 3AO1A 3FFIA 4CJSA 2X78A 3KJVA 1YTUA 4DFPA 1HRHA 4FM1A 3NDKA 3TAFA 2HVIA 3ALYA 4GW6A 1ZBFA 1RBRA 1RT6A 3ZSXA 3JSMA 1WAFA 4KHYA 2HHTA 4LH5A 1KVAA 3SV3A 3C95A 4DS5A 2IOCA 4ID1A 4CJWA 3G0ZA 3EZ5A 1BCOA 3K5MA 1I39A 1KFDA 1S9GA 3ASMA 3QNOA 4O0JA 4FK2A 3C94A 3B6OA 4DTUA 2ZD1A 3VQ5A 1J9AA 3SCXA 3I8DA 4Z4EA 4PY5A 1RT5A 3AVNA 3OVNA 3BGRA 3H08A 5EU7A 3NF6A 4CJRA 1NJZA 2OPRA 4CJ5A 4AHRA 3PY8A 4Z4IA 3DM2A 1ZYQA 4Z4HA 4KV8A 1T05A 4J2EA 2A1RA 3DLGA 1O1WA 3OJSA 3SQ2A 4N56A 1GOAA 4H4OA 1QHTA 3RMCA 2YNIA 2HHUA 2OPQA 1CXQA 5HRSA 2G8VA 1TKZA 2KZZA 3MAQA 2QXFA 4DTPA 4KPYA 2KFZA 4CF1A 3CFOA 5J2NA 4ZTFA 1BQMA 1FK9A 1RBSA 3MEEA 1Q8IA 1RBVA 1EP4A 5SZTA 4E0DA 3CFRA 1EETA 4PQUA 3SJJA 5KGWA 1L5UA 4RG8A 4M3YA 3PUFA 2HHSA 3E01A 4CFDA 4FJLA 3OYDA 4M3ZA 4FXDA 4OPKA 3VQ4A 3VQ6A 4N76A 3SZ2A 4AH9A 3TR8A 3AV9A 3ZSZA 4CERA 3AO4A 2ZE2A 2XY6A 4DQIA 3KTQA 2P5OA 3VQAA 1RT7A 4I9QA 3KK2A 3VQDA 2X6NA 1QQCA 1WSIA 3ZT1A 4CHPA 1U47A 1L3SA 3HT3A 2ATQA 1LWCA 3IS9A 1EKEA 1J5OA 1RT3A 3ITHA 4CGHA 1D5AA 1T8EA 3WNFA 1RTHA 3SPYA 1JLBA 1C1BA 4OKEA 2F8SA 2B6AA 3NGYA 1JLAA 1A5XA 4CEEA 1F21A 1JXBA 2E6LA 3ULDA 4I7FA 1TK0A 3PV8A 1C0UA 1YVUA 4OVLA 3EY1A 3LAKA 3KLHA 4FLVA 4DTMA 1SL2A 3V1RA 3ZSRA 2FBTA 3CQ8A 2OYQA 4C8LA 1DTTA 4FJXA 3OYCA 3ZSOA 3AVKA 4QCLA 1S1WA 2QKBA 3VQPA 4DMNA 3HO1A 1VSEA 3NGZA 1XI1A 3DLEA 1JLQA 3DLHA 4B9LA 1IH7A 1LV5A 4KTZA 3OY9A 3NHGA 2YHAA 4I2PA 4DTOA 4KHNA 1KVCA 3MXMA 2Y1JA 4DSKA 4DU3A 1S5JA 3QLHA 5SWMA 3OYHA 4E89A 5CY4A 4CJFA 1WNSA 4CIEA 4ELTA 4KTQA 1JXEA 2DY4A 4IKFA 1NK4A 4CFAA 3MEDA 3ZT4A 3IAYA 4GMJB 3V9SA 3RMDA 1NJXA 3OYMA 1LWEA 4PUOA 1C0TA 3OYKA 4O44A 3ZT3A 3DYAA 4BE1A 4E3SA 1U04A 4CJKA 4J2BA 1X9WA 1TKXA 4KREA 5DK5A 4CF2A 1YTAA 4E7IA 4K8XA 4DLEA 2HW3A 2RPIA 4H8KA 1RDDA 4IG3A 5C42A 3KD5E 4B9MA 1IO2A 1IKWA 3IRXA 3OS2A 3V9WA 1BGXT 3NCIA 1BHLA 1RBTA 1VRUA 3VQQA 5I3UA 4FJIA 3HXMA 1RT4A 3SNNA 4B8AB 4FM2A 3MEGA 4KB1A 3KK3A 4YNQA 3ZT0A 4DQSA 3V9ZA 1DLOA 1TL3A 2B5JA 2BDPA 1TK5A 2QKKA 4F3OA 3CM5A 4IG0A 3OS0A 3NFAA 4LH4A 4CHOA 3HSTB 2R7YA 1NJYA 1CLQA 1IG9A 2IDOA 1LAVA 3D45A 2FBYA 2HNYA 3M8RA 2GUIA 2DFFA 1BIZA 4CGDA 3JYTA 4B9SA 4EZ6A 3AA3A 3NE6A 5CYMA 1SKSA 3VN5A 4CJUA 3QESA 1NOYA 4ELUA 3K5LA 4E7HA 4DTNA 2XY7A 4IFYA 4KAZA 4KI6A 4RW7A 1TK8A 2HNDA 3DRSA 2X74A 1TKTA 3WNEA 3U3YA 1N6QA 1XC9A 1C0MA 1JLCA 2VG6A 4CGFA 3AVBA 1IKVA 4FVMA 5KI6A 5KGXA 3KLFA 2YNGA 3NGIA 1L3VA 1YT3A 4AHUA 4DU4A 3SI6A 2PZSA 5HRRA 1JLEA 3AA2A 4F8RA 4KHSA 2HMIA 3KIOA 4DTJA 1RTDA 2KTQA 3RRHA 5HLFA 1S6QA 1SKRA 4DTSA 1JL2A 5HRNA 5I42A 2Z1GA 4CEZA 1UA0A 1X9MA 2DFEA 3V1OA 1UA1A 4FW2A 1G15A 3V9XA 4J2DA 4KHQA 2XO7A 3OS1A 2KW4A 4UQGA 3MXIA 1VSJA 1D9DA 1RT1A 1B92A 3HJFA 3D0PA 3KK1A 1BCMA 1NKCA 3LANA 4CIGA 3OYFA 3P83D 3OYEA 1DTQA 2JGUA 4B3OA 1KTQA 3K57A 1JL1A 2ZQBA 4HHTA 3VA0A 1VSMA 3C6UA 3KKRA 4CGGA 2FBXA 5FRNA 3SQ4A 1S1UA 3HK2A 3SYZA 4NYFA 3DOKA 3SV4A 3ZCMA 3DOLA 1MU2A 3P1GA 3L2UA 4E7KA 4DQPA 4YFUA 4CJLA 2VWKA 4FLYA 1U4BA 4EP5A 1BI4A 2YV0X 3PX4A 3B6PA 3CG7A 1SL0A 4C8MA 4RW8A 1TVRA 3VQ7A 2G8UA 1HYSA 5JS1A 3BDPA 3AVAA 4KHUA 3LAMA 2XY5A 2BGGA 4OKJA 3S3NA 3KLEA 3M8QA 4B8CA 1NK7A 4CEOA 4M3RA 2GV9A 1TGOA 4I9LA 5C24A 3OYGA 1T03A 2OPPA 4KKOA 1WN7A 4LD0A 4TSXA 2HHQA 4M3TA 4Q5VA 4FLXA 3O3GA 3PX0A 3OYBA 3LWLA 3A2FA 2HHXA 2KZMA 1S6PA 3I0RA 2VWJA 4FJHA 3L3UA 2F8TA 3VQ9A 3F9KA 4CECA 4FJKA 2RF2A 1JKHA 4E1NA 4HUEA 4Q0BA 4DWIA 3TAPA 1CZBA 3QEVA 4FJMA 3DMJA 4MQ3A 1W9HA 4H4MA 1LAWA 3T1AA 1L3UA 4EP4A 4CJQA 4F3TA 4ID5A 4W5OA 2XY8A 1A5VA 3RMBA 3CYMA 4OPJA 2PYLA 4PA1A 3L3VA 4F2SA 4E19A 3DRPA 4KB0A 3OYJA 3S3OA 3ZT2A 1HNVA 4N41A 1RT2A 3L2VA 1ZBUA 3P5JA 1GOCA 4Z4GA 1UOCA 2EX3A 5JS2A 3TWHA 4Y1DA 4DF4A 3U6FA 3KLIA 4CHNA 4AHSA 4FLTA 4NCBA 1GOBA 3QEIA 3VQEA 1Z26A 4FZZA 1RNHA 4KTWA 3DRRA 4QOZB 3NF7A 1HPZA 3AVLA 2P51A 1S1VA 1REVA 2D0CA 4R5PA 3T19A 1B9DA 3HL8A 4N5SA 4CJTA 3TAGA 4CESA 3V4IA 4DQQA 2D0BA 2A1SA 4E7JA 2VG5A 3TAQA 2EHGA 3K58A 4OKKA 3QEPA 3MXJA 3PO4A 3TARA 4B9TA 4DSIA 3CM6A 1BIUA 1RBUA 4O55A 4BWMA 2IC3A 2LSNA 4I2QA 4E7LA 1QSSA 2PYJA 4C8NA 1BI4B 3RR7A 2O4GA 4F4KA 3O3FA 4C8OA 1WAJA 3LP1A 3MECA 1WSEA 1XWLA 3V6DA 1KFSA 1RTJA 4DSLA 2JLEA 3K5OA 1BL3A 1HNIA 2E4LA 1KVBA 2KFNA 2RKIA 4CHZA 1U45A 3M8SA 5HROA 1HYVA 4ZTJA 4BDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T7B A;  4FLW A;  3AVM A;  2Z1J A;  5KTQ A;  4C8K A;  5J2P A;  1SL1 A;  1JLG A;  3LAL A;  1C1A A;  3SPZ A;  3QEW A;  1KCF A;  2ETJ A;  3AVJ A;  3KKS A;  1HYZ A;  4FZY A;  1RIL A;  5E41 A;  3NH2 A;  3HPO A;  2GBZ A;  4CFB A;  1U48 A;  2ITG A;  1RDB A;  3HPH A;  4DFK A;  3AVG A;  1QS4 A;  1W0H A;  2IAJ A;  4RW9 A;  2AJQ A;  1D8Y A;  3OYL A;  3HM9 A;  1WSF A;  4DSF A;  1TKD A;  2X6S A;  4CJV A;  3HP9 A;  1KRP A;  4J2A A;  1X1P A;  5J1E A;  1VSL A;  1HQU A;  4CJ3 A;  4O4G A;  3VA3 A;  4DS4 A;  4DU1 A;  3PX6 A;  3RTV A;  1SKW A;  1NKE A;  2Q3S A;  4IBN A;  3C6T A;  4O0I A;  3QIO A;  5KRS A;  3EYZ A;  4FJ9 A;  4L8R B;  4K8Z A;  5J2Q A;  5HBM A;  4DFM A;  4BDZ A;  3F73 A;  3QET A;  2PY5 A;  1C1C A;  3LZI A;  3NH1 A;  2HHV A;  1HJR A;  4G1Q A;  1HQE A;  4FJG A;  1VSF A;  3AVI A;  3ISN C;  4FK4 A;  4FCY A;  4AIL C;  3K5N A;  4WE1 A;  4KRF A;  1FXX A;  4FW1 A;  2HNZ A;  4CJE A;  1CZ9 A;  1I3A A;  3SUP A;  3AO3 A;  3LP2 A;  1K6Y A;  4OGC A;  4XIU A;  1QTM A;  1Y97 A;  3AVH A;  3I0S A;  4DG1 A;  1TAQ A;  3AA4 A;  1UWB A;  3WNH A;  4CK2 A;  1ZBI A;  3NH0 A;  3RR8 A;  3SQ0 A;  4AHV A;  4BE2 A;  5CYQ A;  3WNG A;  4Z4C A;  4FM0 A;  2YHB A;  1TAU A;  2YKM A;  2WON A;  1IKY A;  3DI6 A;  4NCG A;  3ZSW A;  2BAN A;  3AVC A;  1J54 A;  1TV6 A;  4JS4 A;  2D0A A;  3THV A;  1JLF A;  4KO0 A;  1R0A A;  4DF8 A;  4W5R A;  3HP6 A;  3QER A;  2E6M A;  2DFH A;  3AA5 X;  3QIP A;  4EZ9 A;  4CJP A;  4OLB A;  2OPS A;  4FK0 A;  3OYN A;  4FJN A;  3TI0 A;  5K14 A;  4Y1C A;  4M3W A;  3L8B A;  4KFB A;  1QSL A;  1VRT A;  5FDL A;  1NKB A;  3TAB A;  3ZSV A;  4JRP A;  4ICL A;  3VQ8 A;  3HVT A;  4HUG A;  3DLB A;  4FJ7 A;  4HCC A;  4BAC A;  4IDK A;  2QK9 A;  3HVR A;  1VSK A;  1B9F A;  4LY7 A;  3RWU A;  4CGJ A;  4DSE A;  3HPG A;  1VSD A;  3LP3 A;  4FJ5 A;  2B4J A;  3V9U A;  3NBP A;  4F2R A;  3HYF A;  4CEF A;  3PO5 A;  2IS3 A;  2XHB A;  1ZBH A;  3KLG A;  1UAX A;  1XHX A;  3T3F A;  4M3U A;  1RDC A;  3SUN A;  1T7P A;  4B9N A;  4NCA A;  4HVJ A;  1A5W A;  2YNH A;  3AO5 A;  4JS5 A;  3V81 A;  3TAN A;  1QE1 A;  4M3X A;  1S9E A;  4CEA A;  4B9U A;  4CHY A;  2VG7 A;  4M41 A;  4ZHR A;  4B9V A;  4CE9 A;  3K59 A;  1KLM A;  4CEQ A;  2D5R A;  5CZ2 A;  3LP0 A;  4Z0U A;  4FYD A;  2G8W A;  2HVH A;  4FLU A;  4CIF A;  2OZS A;  4W5Q A;  4Z4F A;  3RRG A;  1FKP A;  4HCB A;  2DTU A;  4IFV A;  4CHQ A;  4CF0 A;  3QIN A;  4JLH A;  3NF8 A;  4CF8 A;  3IG1 A;  2RN2 A;  3U3G A;  1NK9 A;  3QO9 A;  4OJR A;  1Z25 A;  4CCH A;  4FLZ A;  3QEX A;  4DLG A;  1QSY A;  5CZ1 A;  4AHT A;  1N5Y A;  1LWF A;  1ASW A;  3SQ1 A;  2Y1I A;  3CFP A;  3TAM A;  1NJW A;  4CJ4 A;  2Z1H A;  1TL1 A;  3S9H A;  3ZSQ A;  4OGE A;  4RW6 A;  1XHZ A;  3VQC A;  1NK5 A;  4BDP A;  1BIS A;  5HRP A;  1WSG A;  2W42 A;  2F96 A;  4CGI A;  4DFJ A;  1J53 A;  1VSI A;  1X9S A;  3S3M A;  3KD1 E;  2G8K A;  3V1Q A;  1NK0 A;  1LW0 A;  4CK1 A;  3L2R A;  1LW2 A;  2YNF A;  3M8P A;  4W5T A;  4DTX A;  1WSH A;  5J2M A;  3LZJ A;  2HHW A;  3AVF A;  4AHC A;  1L3T A;  1ASU A;  2IGI A;  5KRT A;  1Q9Y A;  2OZM A;  4BE0 A;  1ASV A;  1SUQ A;  3NF9 A;  4N47 A;  4CED A;  2KQ2 A;  4RW4 A;  2NUB A;  1Q9X A;  4CF9 A;  3UIQ A;  1HMV A;  3QNN A;  2FBV A;  3LPT A;  2FC0 A;  3OYA A;  2BE2 A;  1RTI A;  2O4I A;  1EXQ A;  2XRI A;  2HB5 A;  3DLK A;  5DMR A;  2OA8 A;  1C6V A;  4CEB A;  1D9F A;  4GVM A;  1ZBL A;  1IKX A;  4KHW A;  5FRO A;  1S1T A;  1WSJ A;  2I5J A;  4FZX C;  1NOZ A;  1ITG A;  3AO2 A;  2G8H A;  4LSL A;  4FJJ A;  5C25 A;  3OJU A;  1RDA A;  1NK8 A;  1CXU A;  4ELV A;  3SUO A;  1EX4 A;  5D3G A;  1U49 A;  4MFB A;  4FJ8 A;  1BQN A;  3O3H A;  1KLN A;  5FRM A;  3NAE A;  3G10 A;  3DLR A;  1WLJ A;  4BWJ A;  4DQR A;  2WOM A;  4LSN A;  4HUF A;  1SV5 A;  3LWM A;  3ZSY A;  4M45 A;  1FKO A;  1KSP A;  3L2W A;  4JRQ A;  4DTR A;  1NK6 A;  4HTU A;  3L2Q A;  5HP1 A;  4QAG A;  4DSJ A;  3LDS A;  4KI4 A;  2YKN A;  2G8F A;  3LPU A;  2P1J A;  2Z1I A;  4E1M A;  3RMA A;  4M42 A;  4OLA A;  2G8I A;  4CK3 A;  4O5B A;  4PWD A;  4B08 A;  4W5N A;  3K2P A;  3O4Q A;  4CFC A;  3TAE A;  1RCH A;  3O4N A;  4NYN A;  3OYI A;  1VSH A;  3SUQ A;  3VQB A;  1VK0 A;  1S1X A;  2P5G A;  3AO1 A;  3FFI A;  4CJS A;  2X78 A;  3KJV A;  1YTU A;  4DFP A;  1HRH A;  4FM1 A;  3NDK A;  3TAF A;  2HVI A;  3ALY A;  4GW6 A;  1ZBF A;  1RBR A;  1RT6 A;  3ZSX A;  3JSM A;  1WAF A;  4KHY A;  2HHT A;  4LH5 A;  1KVA A;  3SV3 A;  3C95 A;  4DS5 A;  2IOC A;  4ID1 A;  4CJW A;  3G0Z A;  3EZ5 A;  1BCO A;  3K5M A;  1I39 A;  1KFD A;  1S9G A;  3ASM A;  3QNO A;  4O0J A;  4FK2 A;  3C94 A;  3B6O A;  4DTU A;  2ZD1 A;  3VQ5 A;  1J9A A;  3SCX A;  3I8D A;  4Z4E A;  4PY5 A;  1RT5 A;  3AVN A;  3OVN A;  3BGR A;  3H08 A;  5EU7 A;  3NF6 A;  4CJR A;  1NJZ A;  2OPR A;  4CJ5 A;  4AHR A;  3PY8 A;  4Z4I A;  3DM2 A;  1ZYQ A;  4Z4H A;  4KV8 A;  1T05 A;  4J2E A;  2A1R A;  3DLG A;  1O1W A;  3OJS A;  3SQ2 A;  4N56 A;  1GOA A;  4H4O A;  1QHT A;  3RMC A;  2YNI A;  2HHU A;  2OPQ A;  1CXQ A;  5HRS A;  2G8V A;  1TKZ A;  2KZZ A;  3MAQ A;  2QXF A;  4DTP A;  4KPY A;  2KFZ A;  4CF1 A;  3CFO A;  5J2N A;  4ZTF A;  1BQM A;  1FK9 A;  1RBS A;  3MEE A;  1Q8I A;  1RBV A;  1EP4 A;  5SZT A;  4E0D A;  3CFR A;  1EET A;  4PQU A;  3SJJ A;  5KGW A;  1L5U A;  4RG8 A;  4M3Y A;  3PUF A;  2HHS A;  3E01 A;  4CFD A;  4FJL A;  3OYD A;  4M3Z A;  4FXD A;  4OPK A;  3VQ4 A;  3VQ6 A;  4N76 A;  3SZ2 A;  4AH9 A;  3TR8 A;  3AV9 A;  3ZSZ A;  4CER A;  3AO4 A;  2ZE2 A;  2XY6 A;  4DQI A;  3KTQ A;  2P5O A;  3VQA A;  1RT7 A;  4I9Q A;  3KK2 A;  3VQD A;  2X6N A;  1QQC A;  1WSI A;  3ZT1 A;  4CHP A;  1U47 A;  1L3S A;  3HT3 A;  2ATQ A;  1LWC A;  3IS9 A;  1EKE A;  1J5O A;  1RT3 A;  3ITH A;  4CGH A;  1D5A A;  1T8E A;  3WNF A;  1RTH A;  3SPY A;  1JLB A;  1C1B A;  4OKE A;  2F8S A;  2B6A A;  3NGY A;  1JLA A;  1A5X A;  4CEE A;  1F21 A;  1JXB A;  2E6L A;  3ULD A;  4I7F A;  1TK0 A;  3PV8 A;  1C0U A;  1YVU A;  4OVL A;  3EY1 A;  3LAK A;  3KLH A;  4FLV A;  4DTM A;  1SL2 A;  3V1R A;  3ZSR A;  2FBT A;  3CQ8 A;  2OYQ A;  4C8L A;  1DTT A;  4FJX A;  3OYC A;  3ZSO A;  3AVK A;  4QCL A;  1S1W A;  2QKB A;  3VQP A;  4DMN A;  3HO1 A;  1VSE A;  3NGZ A;  1XI1 A;  3DLE A;  1JLQ A;  3DLH A;  4B9L A;  1IH7 A;  1LV5 A;  4KTZ A;  3OY9 A;  3NHG A;  2YHA A;  4I2P A;  4DTO A;  4KHN A;  1KVC A;  3MXM A;  2Y1J A;  4DSK A;  4DU3 A;  1S5J A;  3QLH A;  5SWM A;  3OYH A;  4E89 A;  5CY4 A;  4CJF A;  1WNS A;  4CIE A;  4ELT A;  4KTQ A;  1JXE A;  2DY4 A;  4IKF A;  1NK4 A;  4CFA A;  3MED A;  3ZT4 A;  3IAY A;  4GMJ B;  3V9S A;  3RMD A;  1NJX A;  3OYM A;  1LWE A;  4PUO A;  1C0T A;  3OYK A;  4O44 A;  3ZT3 A;  3DYA A;  4BE1 A;  4E3S A;  1U04 A;  4CJK A;  4J2B A;  1X9W A;  1TKX A;  4KRE A;  5DK5 A;  4CF2 A;  1YTA A;  4E7I A;  4K8X A;  4DLE A;  2HW3 A;  2RPI A;  4H8K A;  1RDD A;  4IG3 A;  5C42 A;  3KD5 E;  4B9M A;  1IO2 A;  1IKW A;  3IRX A;  3OS2 A;  3V9W A;  1BGX T;  3NCI A;  1BHL A;  1RBT A;  1VRU A;  3VQQ A;  5I3U A;  4FJI A;  3HXM A;  1RT4 A;  3SNN A;  4B8A B;  4FM2 A;  3MEG A;  4KB1 A;  3KK3 A;  4YNQ A;  3ZT0 A;  4DQS A;  3V9Z A;  1DLO A;  1TL3 A;  2B5J A;  2BDP A;  1TK5 A;  2QKK A;  4F3O A;  3CM5 A;  4IG0 A;  3OS0 A;  3NFA A;  4LH4 A;  4CHO A;  3HST B;  2R7Y A;  1NJY A;  1CLQ A;  1IG9 A;  2IDO A;  1LAV A;  3D45 A;  2FBY A;  2HNY A;  3M8R A;  2GUI A;  2DFF A;  1BIZ A;  4CGD A;  3JYT A;  4B9S A;  4EZ6 A;  3AA3 A;  3NE6 A;  5CYM A;  1SKS A;  3VN5 A;  4CJU A;  3QES A;  1NOY A;  4ELU A;  3K5L A;  4E7H A;  4DTN A;  2XY7 A;  4IFY A;  4KAZ A;  4KI6 A;  4RW7 A;  1TK8 A;  2HND A;  3DRS A;  2X74 A;  1TKT A;  3WNE A;  3U3Y A;  1N6Q A;  1XC9 A;  1C0M A;  1JLC A;  2VG6 A;  4CGF A;  3AVB A;  1IKV A;  4FVM A;  5KI6 A;  5KGX A;  3KLF A;  2YNG A;  3NGI A;  1L3V A;  1YT3 A;  4AHU A;  4DU4 A;  3SI6 A;  2PZS A;  5HRR A;  1JLE A;  3AA2 A;  4F8R A;  4KHS A;  2HMI A;  3KIO A;  4DTJ A;  1RTD A;  2KTQ A;  3RRH A;  5HLF A;  1S6Q A;  1SKR A;  4DTS A;  1JL2 A;  5HRN A;  5I42 A;  2Z1G A;  4CEZ A;  1UA0 A;  1X9M A;  2DFE A;  3V1O A;  1UA1 A;  4FW2 A;  1G15 A;  3V9X A;  4J2D A;  4KHQ A;  2XO7 A;  3OS1 A;  2KW4 A;  4UQG A;  3MXI A;  1VSJ A;  1D9D A;  1RT1 A;  1B92 A;  3HJF A;  3D0P A;  3KK1 A;  1BCM A;  1NKC A;  3LAN A;  4CIG A;  3OYF A;  3P83 D;  3OYE A;  1DTQ A;  2JGU A;  4B3O A;  1KTQ A;  3K57 A;  1JL1 A;  2ZQB A;  4HHT A;  3VA0 A;  1VSM A;  3C6U A;  3KKR A;  4CGG A;  2FBX A;  5FRN A;  3SQ4 A;  1S1U A;  3HK2 A;  3SYZ A;  4NYF A;  3DOK A;  3SV4 A;  3ZCM A;  3DOL A;  1MU2 A;  3P1G A;  3L2U A;  4E7K A;  4DQP A;  4YFU A;  4CJL A;  2VWK A;  4FLY A;  1U4B A;  4EP5 A;  1BI4 A;  2YV0 X;  3PX4 A;  3B6P A;  3CG7 A;  1SL0 A;  4C8M A;  4RW8 A;  1TVR A;  3VQ7 A;  2G8U A;  1HYS A;  5JS1 A;  3BDP A;  3AVA A;  4KHU A;  3LAM A;  2XY5 A;  2BGG A;  4OKJ A;  3S3N A;  3KLE A;  3M8Q A;  4B8C A;  1NK7 A;  4CEO A;  4M3R A;  2GV9 A;  1TGO A;  4I9L A;  5C24 A;  3OYG A;  1T03 A;  2OPP A;  4KKO A;  1WN7 A;  4LD0 A;  4TSX A;  2HHQ A;  4M3T A;  4Q5V A;  4FLX A;  3O3G A;  3PX0 A;  3OYB A;  3LWL A;  3A2F A;  2HHX A;  2KZM A;  1S6P A;  3I0R A;  2VWJ A;  4FJH A;  3L3U A;  2F8T A;  3VQ9 A;  3F9K A;  4CEC A;  4FJK A;  2RF2 A;  1JKH A;  4E1N A;  4HUE A;  4Q0B A;  4DWI A;  3TAP A;  1CZB A;  3QEV A;  4FJM A;  3DMJ A;  4MQ3 A;  1W9H A;  4H4M A;  1LAW A;  3T1A A;  1L3U A;  4EP4 A;  4CJQ A;  4F3T A;  4ID5 A;  4W5O A;  2XY8 A;  1A5V A;  3RMB A;  3CYM A;  4OPJ A;  2PYL A;  4PA1 A;  3L3V A;  4F2S A;  4E19 A;  3DRP A;  4KB0 A;  3OYJ A;  3S3O A;  3ZT2 A;  1HNV A;  4N41 A;  1RT2 A;  3L2V A;  1ZBU A;  3P5J A;  1GOC A;  4Z4G A;  1UOC A;  2EX3 A;  5JS2 A;  3TWH A;  4Y1D A;  4DF4 A;  3U6F A;  3KLI A;  4CHN A;  4AHS A;  4FLT A;  4NCB A;  1GOB A;  3QEI A;  3VQE A;  1Z26 A;  4FZZ A;  1RNH A;  4KTW A;  3DRR A;  4QOZ B;  3NF7 A;  1HPZ A;  3AVL A;  2P51 A;  1S1V A;  1REV A;  2D0C A;  4R5P A;  3T19 A;  1B9D A;  3HL8 A;  4N5S A;  4CJT A;  3TAG A;  4CES A;  3V4I A;  4DQQ A;  2D0B A;  2A1S A;  4E7J A;  2VG5 A;  3TAQ A;  2EHG A;  3K58 A;  4OKK A;  3QEP A;  3MXJ A;  3PO4 A;  3TAR A;  4B9T A;  4DSI A;  3CM6 A;  1BIU A;  1RBU A;  4O55 A;  4BWM A;  2IC3 A;  2LSN A;  4I2Q A;  4E7L A;  1QSS A;  2PYJ A;  4C8N A;  1BI4 B;  3RR7 A;  2O4G A;  4F4K A;  3O3F A;  4C8O A;  1WAJ A;  3LP1 A;  3MEC A;  1WSE A;  1XWL A;  3V6D A;  1KFS A;  1RTJ A;  4DSL A;  2JLE A;  3K5O A;  1BL3 A;  1HNI A;  2E4L A;  1KVB A;  2KFN A;  2RKI A;  4CHZ A;  1U45 A;  3M8S A;  5HRO A;  1HYV A;  4ZTJ A;  4BDY A; 
#chains in the Genus database with same CATH topology
 3AVM A;  5J2P A;  1SL1 A;  1JLG A;  3IKM A;  3LAL A;  3HOT A;  1KD1 O;  1HYZ A;  4H0O A;  2GBZ A;  4CFB A;  2VQE K;  1U48 A;  1RDB A;  4DFK A;  3Q7B A;  3ID8 A;  3AVG A;  5GIP A;  4QS7 A;  3KZB A;  5KPZ A;  1WB9 A;  1NGE A;  2AJQ A;  3HZ6 A;  3OYL A;  1NMD A;  1OH5 A;  2X6S A;  3UE5 A;  4CJV A;  3PX6 A;  4CJ3 A;  4JI3 K;  2VCP A;  1SKW A;  3VEV A;  1NKE A;  2D0O A;  3F2K A;  3QIO A;  5ADX H;  1V4S A;  4K8Z A;  3I55 N;  3THW A;  1K8K B;  4FJG A;  1HQE A;  1VSF A;  1XMQ K;  4B9Q A;  4FCY A;  1GLA G;  1YXQ A;  4FW1 A;  2A3Z A;  2HNZ A;  5AQS A;  3AO3 A;  3M1F A;  1W7A A;  1UWB A;  3WNH A;  3NH0 A;  3RR8 A;  4CBX A;  1TAU A;  4X64 K;  4DV0 K;  3MN6 A;  4BVP A;  1TYQ A;  3A5N C;  4NCG A;  3ZSW A;  1U2V B;  2D0A A;  1RGI A;  3THV A;  3TSP A;  3J81 O;  4DF8 A;  3LM9 A;  3MK6 A;  4FK0 A;  3OYN A;  3VPZ A;  3TI0 A;  4FJN A;  5K14 A;  3L8B A;  1NKB A;  4QS9 A;  1HKB A;  4X62 K;  4ICL A;  3FR0 A;  1HKG A;  4CZF A;  3A5O C;  1J5E K;  1B9F A;  4LY7 A;  3RWU A;  5AQF A;  1HKC A;  1X9J A;  1VSD A;  1VQL N;  4CEF A;  1A5W A;  3AO5 A;  3CJB A;  5M1F A;  3BF1 A;  4LF8 K;  3EEQ A;  3TPQ A;  3G6E N;  1KLM A;  2O8F B;  1SAZ A;  2FLO A;  1HX1 A;  3RRG A;  1FKP A;  2DTU A;  3QIN A;  4EHT A;  3THY B;  3IG1 A;  3U3G A;  4V19 S;  1XC3 A;  1QSY A;  4AHT A;  1N5Y A;  1LWF A;  3MMV A;  3SQ1 A;  4CJ4 A;  2Z1H A;  3ZSQ A;  3GOI A;  4RW6 A;  4JD2 B;  1XHZ A;  5LJV A;  5HRP A;  1CZA N;  3S3M A;  3L2R A;  4DTX A;  4B3S K;  2BTF A;  3SBT A;  4M63 C;  5AQZ A;  4BRH A;  2HHW A;  3AVF A;  1ASU A;  2IGI A;  2OZM A;  3NF9 A;  1YI2 N;  4CED A;  3DXK A;  4CF9 A;  5AQR A;  1HMV A;  3QNN A;  3LPT A;  3VEY A;  2BE2 A;  4PKG A;  1JCF A;  1EXQ A;  2XRI A;  3C7N B;  1ZBL A;  4B3M K;  1KXP A;  4FZX C;  1S1T A;  3R3L A;  3CCS N;  1ITG A;  4FJJ A;  5C25 A;  4YHH K;  2P9I A;  1CXU A;  4PHT X;  1EX4 A;  1U49 A;  3ZEU B;  1KLN A;  5C12 A;  3M3Z A;  4A5B A;  2WOM A;  4LSN A;  1SV5 A;  4DTR A;  3CF5 L;  2A5X A;  4QAG A;  5AQN A;  2IIR A;  2YKN A;  2F9W A;  4E1M A;  3RMA A;  1S22 A;  4IZ9 A;  4JHD B;  4NXN K;  3AO1 A;  4CJS A;  4CJ7 A;  3UKR B;  4WYB A;  2P9L A;  3NDK A;  3CCU N;  4GW6 A;  1RBR A;  1RT6 A;  3ZSX A;  3JSM A;  5AFU A;  4KHY A;  4DS5 A;  3E1Y A;  4CJW A;  3EZ5 A;  2KZM A;  1BCO A;  3K5M A;  1VHX A;  1S9G A;  4OPA A;  4FK2 A;  4CD1 A;  5AZI A;  4NLC A;  3NF6 A;  1Y64 A;  4Z4I A;  4Z4H A;  2F7T A;  5FPE A;  2CH6 A;  1O1W A;  4N56 A;  1QHT A;  4MDB A;  3RMC A;  2YNI A;  1CXQ A;  2G8V A;  1C0G A;  4DTP A;  4FWS A;  3AAQ A;  4ZTF A;  3VTI A;  1GLD G;  4E0D A;  2GUP A;  2P9N A;  1L5U A;  2PAV A;  1M1K O;  4M3Z A;  4FXD A;  4YOT A;  2ZE2 A;  3VQA A;  3ZX0 A;  4I9Q A;  5GAE P;  2X6N A;  1QQC A;  4IOX A;  2E2O A;  1LWC A;  3AGK A;  5HOO A;  4IFE A;  4CGH A;  1D5A A;  5KPR A;  3SPY A;  3VES A;  1C1B A;  2BH1 A;  4OKE A;  3WUH A;  2B6A A;  3NGY A;  1A5X A;  3CCE N;  3BEX A;  3U4L A;  1TK0 A;  4OVL A;  3EY1 A;  3LAK A;  1O13 A;  1SL2 A;  4JI5 K;  4FJX A;  4GV6 A;  3OYC A;  4K0K K;  2QWM A;  1KAY A;  3AVK A;  4QCL A;  1Q86 O;  1NNE A;  3HO1 A;  3ATU A;  3NGZ A;  1GLL O;  4DHY A;  4B9L A;  1IH7 A;  4KTZ A;  3J8A A;  2YHA A;  4I2P A;  3G4S N;  4DV7 K;  4DSK A;  4DU3 A;  5CY4 A;  4ELT A;  2DY4 A;  1RFQ A;  1NK4 A;  3MED A;  2QWR A;  3ZT4 A;  4WQ4 C;  1VQ9 N;  3T1Y K;  3RMD A;  4JK9 A;  3ZT3 A;  3DYA A;  4E3S A;  1T6C A;  3L0Q A;  4CJK A;  4J2B A;  4KRE A;  1TKX A;  4UY8 O;  3JXU A;  4OPH A;  4E7I A;  3ZLJ A;  2NRV A;  3THX A;  1EWQ A;  4KH4 A;  4IG3 A;  4BGB A;  1IO2 A;  3DXM A;  3FGU A;  3IRX A;  4XEI A;  3FZH A;  5JLH A;  2WFB A;  5I3U A;  4FPB A;  3PLA A;  5M1P A;  2W40 A;  4KB1 A;  4CD3 A;  4F3O A;  1TL3 A;  3CM5 A;  4BR2 A;  3NFA A;  5CR4 A;  4RWT A;  3L4I A;  3S41 A;  3HST B;  4O8K A;  1CLQ A;  2IDO A;  3D45 A;  3U8X A;  4A59 A;  1M90 O;  3JYT A;  2ZGY A;  3VOV A;  3P31 A;  4ELU A;  5DM6 L;  3K5L A;  4KI6 A;  2FF3 B;  1Z05 A;  4RW7 A;  1TK8 A;  3DRS A;  2IVP A;  1T6D A;  2VG6 A;  4DR2 K;  1P8Z A;  4BRE A;  3NGI A;  2PZS A;  4DU4 A;  1Q18 A;  3SI6 A;  3KWI A;  3TSQ A;  1DKG D;  3KIO A;  4FWN A;  1S6Q A;  1SKR A;  2P9K A;  1JL2 A;  4BR9 A;  5I42 A;  2Z1G A;  3J7Z O;  2F9T A;  3LDN A;  4B1U B;  3V9X A;  4DV5 K;  3OS1 A;  4LFA K;  5KQD A;  3KK1 A;  5BRH A;  5AQK A;  2YJF A;  5JIC A;  3OYF A;  5AQM A;  1JL1 A;  3KKR A;  4WCE L;  5FRN A;  2YHX A;  1J6Z A;  4YOV A;  3HK2 A;  3ZCM A;  1YVN A;  3QFU A;  1MDU B;  5M1O A;  3CD6 N;  5BN9 A;  1U4B A;  5AFU H;  3FFK B;  3CG7 A;  3F9M A;  1TVR A;  3VQ7 A;  3AVA A;  4B1V A;  4KHU A;  3LAM A;  2BGG A;  3KLE A;  4B8C A;  4CEO A;  5C24 A;  4I9L A;  2BUP A;  4JKH A;  4LD0 A;  1SS6 A;  3SMP A;  3SMS A;  4Q5V A;  3PX0 A;  1S6P A;  3I0R A;  2F8T A;  3HOS A;  3GG4 A;  3CET A;  2RF2 A;  1JKH A;  4E1N A;  3IDH A;  4HUE A;  4IJN A;  3TAP A;  1NG9 A;  4FJM A;  3DMJ A;  4MQ3 A;  4RCH A;  1L3U A;  4EP4 A;  4F3T A;  2XY8 A;  2PYL A;  4F2S A;  4E19 A;  3ZT2 A;  1HNV A;  1RT2 A;  2WTU A;  4Z4G A;  3P5J A;  2EX3 A;  3VQE A;  5BR9 A;  1Z26 A;  3VMF B;  1RNH A;  4JKC A;  2E20 A;  2QI2 A;  4QOZ B;  3NF7 A;  1HPZ A;  3VEO A;  1K8K A;  3HL8 A;  3TAG A;  1E4F T;  2A1S A;  4E7J A;  2QWL A;  2E1Z A;  3BF3 A;  4L3Q A;  4OKK A;  3QEP A;  3MXJ A;  4ILJ A;  1RBU A;  4C8N A;  1NJI O;  1W97 L;  3MEC A;  1XWL A;  3K5O A;  5KPT A;  2QWP A;  3D2F B;  4CHZ A;  3K9J A;  1HYV A;  4H0Y B;  1QZ6 A;  5AQT A;  1ZBS A;  4DV1 K;  3HBT A;  3QEW A;  2ETJ A;  3AVJ A;  3KKS A;  1N34 K;  4PL7 A;  4DCH A;  2ITG A;  3HPH A;  2IAJ A;  5GAG P;  5JMV A;  3FZK A;  2EWS A;  3HM9 A;  1TKD A;  1Q82 O;  4K41 A;  3AAR A;  4J2A A;  2JWK A;  1X3M A;  4O4G A;  1NMN A;  5KRS A;  1BOT O;  5HBM A;  4DFM A;  2GX9 A;  4NLB A;  3F73 A;  1HNX K;  3NH1 A;  4LF6 K;  3ISN C;  1VQN N;  4B3T K;  1OH6 A;  4CJE A;  3SAG A;  2O8F A;  1ATR A;  5JVG L;  4OGC A;  1QTM A;  2YHY A;  3I0S A;  1JJ2 M;  1MWK A;  1TAQ A;  3AA4 A;  3DLL L;  5F2R A;  3MCA B;  1ZBI A;  3FE1 A;  1WUA A;  3R9P A;  3HI0 A;  4BE2 A;  5CYQ A;  3WNG A;  4FM0 A;  3WXJ A;  2WON A;  4MO5 A;  1IKY A;  3LL3 A;  3MN5 A;  2Q31 A;  2O8D B;  4JD2 A;  4FWR A;  3MX5 A;  2BAN A;  5KQ8 A;  1TV6 A;  4JS4 A;  1JLF A;  3NVK A;  1R0A A;  3QER A;  2PFU A;  2YI1 A;  2DFH A;  3MX2 A;  2OPS A;  1K8A O;  1VRT A;  3OBW A;  3TAB A;  1IBL K;  2AA4 A;  4G9Z A;  3HVT A;  2QK9 A;  3HVR A;  1VSK A;  3U9Z A;  4BC2 A;  3CER A;  3NMU A;  3HPG A;  3LP3 A;  3ZX3 A;  3HYF A;  4F2R A;  4LFC K;  1UAX A;  1XHX A;  3T3F A;  1RDC A;  3SUN A;  1T7P A;  2FSK A;  4HVJ A;  2YNH A;  2HF4 A;  4YDU C;  4JI0 K;  4B9V A;  3VET A;  3ZEU A;  2D5R A;  5CZ2 A;  3LP0 A;  2G8W A;  4CIF A;  5AZJ A;  4FOI A;  3CQX A;  3T69 A;  4PL8 A;  2RN2 A;  4U7B A;  3QO9 A;  4OJR A;  3JS6 A;  4FWM A;  4FLZ A;  3QEX A;  4CCH A;  5CZ1 A;  1ASW A;  4K42 A;  2WUS A;  3CFP A;  3TAM A;  2HHH K;  3QIC A;  2QW9 A;  4OGE A;  3VQC A;  5LL6 Z;  3CHW A;  4FWK A;  4DFJ A;  1TUU A;  1ZC6 A;  5C2F A;  1DEJ A;  1D4X A;  4ISF A;  1NK0 A;  2G8K A;  2YNF A;  5J2M A;  3WEE B;  2V7Z A;  1Q7Y O;  4BE0 A;  1BA0 A;  4N47 A;  2NUB A;  4JKA A;  1Q9X A;  3UIQ A;  3SK3 A;  3M6G A;  1HLU A;  3DLK A;  2OA8 A;  4CEB A;  3UKU A;  4KHW A;  5FRO A;  1WSJ A;  2I5J A;  3TTC A;  1YHQ N;  4M7Y A;  3O9R A;  4I6M B;  4WFB L;  1FJG K;  2HBK A;  1RDA A;  2CH5 A;  1NK8 A;  3ZX2 A;  4H03 B;  3ENB A;  3NAE A;  4JKF A;  3G10 A;  1WLJ A;  4BRC A;  4DQR A;  3QFP A;  3LWM A;  3ZSY A;  4M45 A;  1FKO A;  1KSP A;  3L2W A;  4GKJ K;  4DV4 K;  4HTU A;  3L2Q A;  1TUY A;  4KI4 A;  4R79 A;  2G8F A;  4M42 A;  3ULE A;  2P1J A;  3O9Q A;  4BRM A;  2E2Q A;  1XNR K;  2ITM A;  3GBT A;  3CQY A;  4B08 A;  4WFN L;  4PWD A;  4W5N A;  3O4N A;  4NYN A;  1VSH A;  5BPL A;  3SUQ A;  1K73 O;  5LMU K;  3VQB A;  3ENO A;  5GIN A;  3KJV A;  3TAF A;  2HVI A;  1EO1 A;  1ZBF A;  3SJH A;  1VQO N;  1WAF A;  4LH5 A;  1KVA A;  3O6W A;  1I39 A;  3ASM A;  2Q1N A;  4O0J A;  1NGA A;  4DQ8 A;  2P9U A;  2ZD1 A;  4Z4E A;  3SCX A;  3I8D A;  4PY5 A;  5EU7 A;  3OVN A;  2GWJ A;  2O8C A;  2OPR A;  5CHI A;  4AHR A;  3L4Q A;  3PY8 A;  2Q0U A;  1OH7 A;  1T44 A;  1T05 A;  5B8H A;  2A1R A;  4CBU A;  2Q36 A;  4H4O A;  1NGF A;  4CZK A;  3C0B A;  2HHU A;  2WBN A;  5AQL A;  2VGN A;  4U67 L;  4FWO A;  1FK9 A;  4WQ5 A;  3EE9 A;  2KLA A;  4PQU A;  3CCQ N;  4RG8 A;  2ZM6 K;  4H0P A;  2HHS A;  5EOY A;  4N76 A;  5BPM A;  4JI8 K;  3I8B A;  3TR8 A;  3AO4 A;  2P5O A;  3EKS A;  3E9L A;  3KK2 A;  4BRI A;  1U47 A;  4WF9 L;  3P4I A;  3HT3 A;  3VEX A;  1RT3 A;  3ITH A;  1IV0 A;  3WNF A;  3EO3 A;  2V52 B;  1JLA A;  4CEE A;  1F21 A;  1JXB A;  1YJW N;  3PV8 A;  1YVU A;  4FLV A;  4DTM A;  1NWK A;  4BR5 A;  2FBT A;  1GLE G;  5AQO A;  1W2B M;  1ESV A;  1S1W A;  4BVO A;  3EN9 A;  3DLE A;  3DLH A;  3MCP A;  3CCV N;  3OY9 A;  2HBJ A;  4IOC L;  3TU5 A;  3O9S A;  4CJF A;  3O4W A;  4IKF A;  4CFA A;  1BUP A;  2A6A A;  3V9S A;  4X66 K;  3OYM A;  1XUP O;  4BRL A;  3BZK A;  3VEZ A;  4GV9 A;  3A5M C;  3CIP A;  3RVC A;  2HW3 A;  2RPI A;  5C42 A;  5BN8 A;  3KD5 E;  3CC7 N;  3OS2 A;  1WBD A;  1BGX T;  1BHL A;  3ZET B;  4FJI A;  3HXM A;  4BY9 C;  3KK3 A;  1OKJ A;  4AM7 A;  4AQY K;  3HSC A;  2D0P A;  2HOE A;  3NE6 A;  1BO5 O;  5CYM A;  2UU9 K;  4CJU A;  1LOT B;  2HST A;  4JI7 K;  3WNE A;  1N6Q A;  1BA1 A;  5KI6 A;  3KLF A;  5KGX A;  2FF6 A;  3N4Q A;  5HRR A;  1QQO A;  2KTQ A;  3RRH A;  5GIO A;  4DTS A;  5HRN A;  1N33 K;  1UA0 A;  1X9M A;  2DFE A;  3EE8 A;  3V1O A;  1UA1 A;  4J2D A;  2O8B B;  4DKW A;  4UQG A;  4JK8 A;  1VSJ A;  1SZ2 A;  4FWP A;  1B92 A;  5EX5 A;  5AQJ A;  3D0P A;  3E9P A;  3O8M A;  3VEW A;  3LAN A;  4LF4 K;  4CIG A;  2PBD A;  2WC9 A;  2P9P B;  2E8A A;  1DTQ A;  1WBB A;  2JGU A;  3K57 A;  4C23 A;  4HHT A;  5AQW A;  2NRZ A;  3CJ9 A;  1C0F A;  1S1U A;  5E26 A;  3SYZ A;  4NYF A;  4BRP A;  4DQP A;  4CJL A;  3P39 A;  4EP5 A;  2G8U A;  3B6P A;  1HYS A;  1JCE A;  2XY5 A;  1MA9 B;  1N8R O;  3S3N A;  4ISE A;  4H0T B;  3CJ1 A;  3D2F A;  2GV9 A;  1T03 A;  1WN7 A;  4LF7 K;  2HHQ A;  4M3T A;  2RHK A;  3FZL A;  5C10 A;  3L3U A;  2A40 A;  1IG8 A;  3THW B;  3QEV A;  4H4M A;  1LAW A;  1NLV A;  4CJQ A;  3CYM A;  3E66 A;  4KB0 A;  3FZF A;  3S3O A;  4MLE A;  1ZBU A;  1GOC A;  1NBW A;  1QQM A;  3IFR A;  3U6F A;  4YOR A;  3KLI A;  1S3X A;  2OAN A;  3G25 A;  4PKI A;  4AHS A;  1GOB A;  4FZZ A;  1R59 O;  3DRR A;  2UUC K;  3AVL A;  1S1V A;  2D0C A;  2P51 A;  3T19 A;  1B9D A;  2QWN A;  4DQQ A;  4IWV A;  2VG5 A;  3TAQ A;  1QQN A;  5AJ3 K;  2J4R A;  3W0L A;  4B9T A;  4DSI A;  4E7L A;  3ID6 A;  2LSN A;  3C6A A;  4CZE A;  2YX6 A;  1BI4 B;  4C8O A;  1WSE A;  3V6D A;  2JLE A;  1BL3 A;  3U9D A;  3ZYY X;  2KFN A;  2RKI A;  5F1X A;  4K25 A;  3PIP L;  4BDY A;  3VTH A;  1HR0 K;  5T7B A;  4FLW A;  2Z1J A;  5KTQ A;  4C8K A;  3SPZ A;  1XQS C;  4WFA L;  5E84 A;  3LDO A;  5E41 A;  3NH2 A;  3HPO A;  4FWQ A;  3D2E A;  3I33 A;  1W0H A;  2E5L K;  4RW9 A;  4GVE A;  2NRT A;  4EFH A;  1D8Y A;  1NGD A;  2A41 A;  1GLB G;  3HP9 A;  1KRP A;  3MWP A;  1VSL A;  1HQU A;  3VA3 A;  4DU1 A;  2UXD K;  3P38 A;  3RTV A;  2Q3S A;  4IBN A;  3VGL A;  3EYZ A;  4FJ9 A;  3OBY A;  5J2Q A;  4BDZ A;  2PY5 A;  4JKG A;  5LY3 A;  2H3G X;  2HHV A;  5C0Y A;  3AVI A;  4FK4 A;  4AIL C;  3K5N A;  4WE1 A;  1FXX A;  1I3A A;  3LP2 A;  4XIU A;  4A5A A;  1Y97 A;  3AVH A;  4DG1 A;  3J80 O;  3SQ0 A;  4AHV A;  3DXK B;  4Z4C A;  4NB4 A;  2YHB A;  2E2P A;  3DI6 A;  3H1Q A;  5IWA K;  1K9M O;  1J54 A;  5AQU A;  3FLC O;  4IJA A;  1WOQ A;  4KO0 A;  2NNW A;  3HP6 A;  2E6M A;  3AA5 X;  2P9I B;  3QIP A;  4EZ9 A;  4OLB A;  3H1V X;  1HJO A;  3WEE A;  1HNZ K;  4Y1C A;  5FDL A;  3CCJ N;  3ZSV A;  3VQ8 A;  3DLB A;  4FJ7 A;  5LJW A;  4DUY K;  1HUX A;  3M5R A;  4BAC A;  3EZW A;  3V9U A;  2IS3 A;  4YOU A;  4M3U A;  2QWO A;  4JKB A;  4JS5 A;  4DR3 K;  3FZM A;  3SAH A;  3V81 A;  2IVN A;  1E3M A;  2NRR A;  1S9E A;  4NXM K;  4CEA A;  4CHY A;  2VG7 A;  4M41 A;  4CE9 A;  3K59 A;  2P9L B;  4CEQ A;  3O9U A;  4DR5 K;  2HBL A;  4DV2 K;  4FLU A;  2OZS A;  4Z4F A;  3K9K A;  4CF0 A;  4CHQ A;  4JLH A;  4BR0 A;  3NF8 A;  1H1V A;  1Z25 A;  3H3N O;  2UXC K;  5AZI B;  2Y1I A;  3QDK A;  2QWQ A;  1NK5 A;  1WSG A;  2W42 A;  4CGI A;  2QXL A;  1J53 A;  1VSI A;  4YOX A;  3KD1 E;  1LW0 A;  4CK1 A;  1LW2 A;  3M8P A;  4W5T A;  3VF6 A;  1XNQ K;  4H5W A;  3O1B A;  1ASV A;  4IEI A;  1GLC G;  2FBV A;  2FC0 A;  1RTI A;  4GY2 B;  2P9N B;  5DMR A;  4GVM A;  1IKX A;  5C2D A;  1U2V A;  5DM7 L;  3AO2 A;  2G8H A;  5EVZ A;  3OJU A;  5TKW A;  4ELV A;  3MN9 A;  5D3G A;  4MFB A;  5FRM A;  3DLR A;  5JVH L;  3BZC A;  3HRG A;  3B8A X;  4JRQ A;  5BRD A;  1NK6 A;  5HP1 A;  3LDS A;  4H5R A;  2OCE A;  4OLA A;  4KH5 A;  4CK3 A;  4JI6 K;  4K43 A;  4O5B A;  4HTL A;  3K2P A;  3H45 C;  3TAE A;  1RCH A;  2V7Y A;  3OYI A;  1NM1 A;  1S1X A;  1YTU A;  2FXU A;  3O08 A;  2X78 A;  4FM1 A;  3BY5 A;  5IT9 O;  3ALY A;  4OX9 K;  2HHT A;  3KHY A;  2IOC A;  4ID1 A;  2F8S A;  3G0Z A;  3THY A;  4B1Y B;  1HNW K;  1VQK N;  3VGM A;  2UUA K;  4CBW A;  1J9A A;  4X65 K;  4Z94 A;  3SBG A;  3AVN A;  3BGR A;  1VQ4 N;  4CJ5 A;  2KKZ A;  2OTL N;  1ZYQ A;  2I7P A;  1P90 A;  1QVG M;  4J2E A;  3DLG A;  3OJS A;  3SQ2 A;  4XH4 A;  4XH5 A;  1N36 K;  5HRS A;  1VQ8 N;  1TKZ A;  3PSI A;  2KZZ A;  2DPN A;  3DXM B;  2JWL A;  1KAZ A;  4KPY A;  3CFO A;  5J2N A;  2AP1 A;  3MEE A;  1Q8I A;  1RBV A;  1EP4 A;  5SZT A;  3CFR A;  4LF5 K;  3C7N A;  3KWG A;  4M3Y A;  3PUF A;  3E01 A;  4CFD A;  3CPE A;  3OYD A;  4ILH A;  4OPK A;  3VQ6 A;  3LDP A;  3AAP A;  4AH9 A;  4CER A;  2KHO A;  3AV9 A;  3ZSZ A;  3OHR A;  2XY6 A;  1SQK A;  3VQD A;  1L3S A;  2ATQ A;  4DR1 K;  3IS9 A;  1EKE A;  5I9E B;  1J5O A;  4IO8 A;  5AQV A;  3C65 A;  4C1N I;  5AQI A;  1GLJ O;  3H46 O;  4A2B A;  2E6L A;  4JHD A;  3ULD A;  3KLH A;  4JV5 K;  3V1R A;  4JYA K;  3UKR A;  2P9K B;  3ZSO A;  2QKB A;  3VQP A;  1VSE A;  1XI1 A;  4KHN A;  1LV5 A;  3MXM A;  3R8E A;  3OYH A;  4E89 A;  1YUW A;  1WNS A;  4CIE A;  4KTQ A;  1JXE A;  4BRG A;  4J8F A;  1KC8 O;  2RE2 A;  3IAY A;  3KVG A;  1NJX A;  4AF1 A;  4PUO A;  4GNI A;  1C0T A;  3OYK A;  4O44 A;  4BE1 A;  3G71 N;  2Q0R A;  2GEL A;  1X9W A;  3VF2 A;  1VQ5 N;  4CF2 A;  4A62 A;  4K8X A;  4DLE A;  4B9M A;  4CZL A;  3V9W A;  1VRU A;  5BRF A;  3MN7 A;  1IJJ A;  3VQQ A;  4H5V A;  1RT4 A;  4FM2 A;  3DJC A;  3HTV A;  2QKK A;  3V9Z A;  4DV3 K;  2B5J A;  3OS0 A;  2NLX A;  4IG0 A;  4CHO A;  1NU0 A;  3D6R A;  2QM1 A;  2HNY A;  2DFF A;  1Q81 O;  1BIZ A;  2ZJP L;  5H1S Q;  3AA3 A;  4EIA A;  4DR7 K;  3WQT A;  3VN5 A;  1NOY A;  4CZJ A;  2ZJR L;  4E7H A;  4DTN A;  2XY7 A;  4IFY A;  4KAZ A;  2X74 A;  1TKT A;  3AVB A;  4FVM A;  1L3V A;  1NGC A;  1YT3 A;  4AHU A;  4OO1 J;  1JLE A;  3AA2 A;  3CXC M;  3LM2 A;  2ASM A;  3TSU A;  4A57 A;  1RTD A;  1YF5 L;  3KK7 A;  3RSE B;  4CEZ A;  3CME N;  4KHQ A;  2XO7 A;  1ATN A;  2KW4 A;  3MXI A;  4JKD A;  1RT1 A;  1GLF O;  4BRO A;  3HJF A;  1E4G T;  1NKC A;  4IXC A;  1YIJ N;  3P83 D;  3OYE A;  4B3O A;  1KTQ A;  2E88 A;  1VSM A;  4CGG A;  2VGM A;  3VEN A;  3DOL A;  5FLX O;  1MU2 A;  4E7K A;  4FLY A;  3O9T A;  1BI4 A;  3QBW A;  4RW8 A;  5JS1 A;  3BDP A;  4FL9 A;  1VQP N;  2QA4 N;  3OYG A;  4KKO A;  2O8E B;  4FLX A;  2A42 A;  3OYB A;  4JN4 A;  1NGI A;  2VWJ A;  4B1X B;  4B1Z A;  4FJH A;  4CEC A;  4FJK A;  4MDA A;  4BQZ A;  2UUB K;  4DWI A;  4Q0B A;  4HWI A;  3T1A A;  5BRE A;  4ID5 A;  4CZM A;  3CI5 A;  1A5V A;  4CW7 B;  5GAH P;  3RMB A;  1UOC A;  3IMX A;  4BR7 A;  4CHN A;  4FLT A;  4NCB A;  2ZGZ A;  3QEI A;  3VGK A;  4EAH D;  3PIO L;  4AM6 A;  1NGB A;  3O80 A;  4R5P A;  4N5S A;  4CJT A;  4CES A;  3V4I A;  2D0B A;  4WQ5 C;  3J7A P;  2EHG A;  3K58 A;  3TAR A;  2UXB K;  1JCG A;  1BIU A;  2GWK A;  1VQ6 N;  1QSS A;  4LFB K;  2PYJ A;  5AQP A;  3TTF A;  1ILY A;  1VQ7 N;  4F4K A;  4DR6 K;  1RTJ A;  4DSL A;  2W6K A;  3LDL A;  1HNI A;  1KVB A;  4BRD A;  3M8S A;  2F4V K;  1MWM A;  1YJ9 N;  4BRN A;  3BUZ B;  3HM8 A;  4BQL A;  1C1A A;  1KCF A;  3LDQ A;  4FZY A;  1RIL A;  2YJE A;  2E2N A;  4ILG B;  2FSN A;  3SLC A;  1QS4 A;  3CMA N;  5AR0 A;  2W6L A;  1EQY A;  3N4P A;  4DSF A;  1WSF A;  5AZJ B;  1X1P A;  5J1E A;  4DS4 A;  3C6T A;  3H3O B;  4O0I A;  2I7N A;  4L8R B;  4ISG A;  1QZ5 A;  3QET A;  1C1C A;  3LZI A;  1HJR A;  4G1Q A;  3AGR A;  4KRF A;  3D7E O;  3CJA A;  1CZ9 A;  3SUP A;  1K6Y A;  1IBK K;  5EY4 A;  4CK2 A;  3IUC A;  2W41 A;  4BC5 A;  3QBX A;  2D4W A;  1S72 N;  2YKM A;  2P9S B;  3PSF A;  3AVC A;  3CPW M;  1N32 K;  3UKU B;  4DUZ K;  2OTJ N;  1NGJ A;  4W5R A;  4LC9 B;  4CJP A;  4GKK K;  4A61 A;  4JNE A;  4M3W A;  4NO7 A;  1QHA A;  4KFB A;  1QSL A;  4JRP A;  4WQ4 A;  4HUG A;  4HCC A;  4IDK A;  4CZG A;  4PKH A;  4CGJ A;  3CC4 N;  4DSE A;  4FJ5 A;  1OH8 A;  2B4J A;  3NBP A;  1ZBH A;  2CGK A;  3PO5 A;  2XHB A;  5C15 A;  3ULE B;  3KLG A;  3WXK A;  4NCA A;  4B9N A;  3E9O A;  3TAN A;  1QE1 A;  4M3X A;  4BRK A;  3C6H A;  1RDU A;  1NGG A;  4ZHR A;  1ATS A;  4Z0U A;  4FYD A;  4CI6 A;  3GL1 A;  2HVH A;  4W5Q A;  3WXL A;  3K0S A;  4HCB A;  3T7Z A;  1YIT N;  4IFV A;  1IBM K;  4CF8 A;  5TKY A;  1NK9 A;  1KAX A;  5FPD A;  3A5L C;  4DLG A;  1HPM A;  4BC4 A;  2P9U B;  4H5N A;  1NJW A;  3CJ7 A;  2O8C B;  1TL1 A;  3S9H A;  1TYQ B;  4B3R K;  4BDP A;  1BIS A;  3CJC A;  5AQQ A;  2F96 A;  3MDQ A;  4FO0 A;  2E1Y A;  1X9S A;  4FPA A;  4IOA L;  3V1Q A;  3NVM A;  1WSH A;  3LZJ A;  2QTD A;  3VER A;  4AHC A;  1L3T A;  3WT0 A;  5KRT A;  1Q9Y A;  3L6Q A;  2Q2R A;  1SUQ A;  2KQ2 A;  4RW4 A;  5F0X A;  4DV6 K;  3OYA A;  2O4I A;  2O8D A;  2HB5 A;  1C6V A;  1D9F A;  4JEP A;  3ATV A;  1XMO K;  1NOZ A;  4LSL A;  3VF4 A;  4F9O A;  1NGH A;  4A2A A;  5M1Q A;  5GAD P;  2Q97 A;  2YCH A;  3SUO A;  4KHP K;  2VQF K;  4FJ8 A;  1BQN A;  3O3H A;  3JAM O;  4BWJ A;  4H0X B;  4HUF A;  3SAF A;  5FPM A;  4BR4 A;  4DSJ A;  3LPU A;  2Z1I A;  2G8I A;  3R1X A;  3O4Q A;  4CFC A;  4JI1 K;  2NZT A;  2YHW A;  2P5G A;  1VK0 A;  2GEM A;  3CC2 N;  3FFI A;  4DFP A;  1HRH A;  4BRA A;  4H0V B;  2IVO A;  3SV3 A;  3C95 A;  4BRQ A;  3QNO A;  4CZH A;  1KFD A;  5A2Q O;  1T3V A;  3C94 A;  3B6O A;  2ASP A;  4DTU A;  4IO9 L;  3VQ5 A;  2VWB A;  1RT5 A;  5MLC Q;  4CJR A;  3H08 A;  3OA9 A;  1NJZ A;  2NRW A;  4YOW A;  3DM2 A;  1OVQ A;  4KV8 A;  2HF3 A;  4RTF D;  1GOA A;  1U6Z A;  2OPQ A;  4FOE A;  4BC3 A;  3MAQ A;  2QXF A;  3A8Y A;  4FSV A;  2KFZ A;  4CF1 A;  1QVF M;  1BQM A;  1RBS A;  1EET A;  3SJJ A;  5KGW A;  1BG3 A;  4FJL A;  4I6M A;  3VQ4 A;  3SZ2 A;  3I56 N;  4MO4 A;  4IEE A;  4DQI A;  3WXI A;  3KTQ A;  1VQM N;  4Y0W A;  1RT7 A;  1WSI A;  3ZT1 A;  4CHP A;  1X3N A;  2HMP A;  4YY3 K;  4B1W B;  3Q7C A;  1T8E A;  1RTH A;  1JLB A;  4E1J A;  1BDG A;  3TTD A;  4I7F A;  1C0U A;  2OYQ A;  1EWR A;  3ZSR A;  3CQ8 A;  4O5F A;  3CCM N;  4C8L A;  1DTT A;  2ZF5 O;  3R6M A;  4YOY A;  4DMN A;  1OVY A;  4XH1 A;  3EL2 A;  5HL7 L;  1JLQ A;  3MWT A;  3NHG A;  4DTO A;  1KVC A;  2Y1J A;  4M7X A;  1S5J A;  3QLH A;  5SWM A;  2V51 B;  5JLF A;  2NRH A;  5ELZ A;  4GMJ B;  5AQG A;  5ADX A;  1LWE A;  5FPN A;  3RSE A;  1DT9 A;  1U04 A;  5DK5 A;  2UYT A;  1YTA A;  4H8K A;  1RDD A;  1IKW A;  4IDH A;  4C1N K;  3NCI A;  1RBT A;  5AQX A;  3SNN A;  2ZJQ L;  4B8A B;  3MEG A;  4LF9 K;  5M1K A;  2CGL A;  4YNQ A;  3ZT0 A;  4DQS A;  2CGJ A;  1DLO A;  2D1K A;  2BDP A;  1TK5 A;  4JK7 A;  4KH6 A;  4LH4 A;  3OW2 M;  1DGK N;  4FVU A;  2R7Y A;  4H5T A;  4BRF A;  1NJY A;  1IG9 A;  1LAV A;  2FBY A;  3M8R A;  2GUI A;  3F5T A;  4CGD A;  4BGA A;  4QS8 A;  4EZ6 A;  3A0I X;  5AQH A;  3QES A;  1SKS A;  2QEX N;  4KBO A;  3T1H K;  2HND A;  2O8E A;  3O1W A;  3U3Y A;  5M1N A;  1XC9 A;  4DR4 K;  4YDU A;  1JLC A;  1C0M A;  4CGF A;  1IKV A;  2YNG A;  1V4T A;  4F8R A;  4KHS A;  2HMI A;  4DTJ A;  2NRX A;  5HLF A;  4CZI A;  1G99 A;  3H6E A;  4JI2 K;  4FW2 A;  1G15 A;  3WQU A;  3CCR N;  3UB5 A;  4JKE A;  1BU6 O;  1D9D A;  3THX B;  4MLH A;  1BCM A;  1FW6 A;  4JI4 K;  3GE1 A;  2ZQB A;  3GDQ A;  3VA0 A;  1BWF O;  3C6U A;  5AQY A;  3DAW A;  2FBX A;  3WXM B;  3SQ4 A;  3BP8 A;  3DOK A;  3SV4 A;  1RDW X;  3P1G A;  3L2U A;  4YFU A;  3D2E B;  2VWK A;  4O8U A;  4EHU A;  2YV0 X;  3QML A;  3PX4 A;  1SL0 A;  4C8M A;  2ASO A;  4JAX A;  1KQS M;  5BPN A;  4OKJ A;  3M8Q A;  3ZET A;  1NK7 A;  4M3R A;  3AY9 A;  1TGO A;  3DWL A;  2OPP A;  4CVN E;  4TSX A;  3O3G A;  2HHX A;  3LWL A;  3A2F A;  5EXW A;  2VYP A;  3VQ9 A;  3F9K A;  4JKG B;  1CZB A;  1W9H A;  2ZWH A;  5BR8 K;  4GV3 A;  4W5O A;  4BG9 A;  1YJN N;  3ENH A;  4OPJ A;  4PA1 A;  3L3V A;  1Z6R A;  3DRP A;  4DB3 A;  3OYJ A;  4N41 A;  3L2V A;  1I94 K;  2GTD A;  5JS2 A;  5LMN K;  3TWH A;  4Y1D A;  4DF4 A;  3EKU A;  3QB0 A;  3J7Y P;  3O5B A;  4KTW A;  1ZXO A;  1REV A;  4B9U A;  4B9S A;  3W3D A;  4BG8 A;  2HBM A;  1YAG A;  2FSJ A;  3PO4 A;  3CM6 A;  4O55 A;  4BWM A;  2IC3 A;  4I2Q A;  1VAZ A;  2O8B A;  3RR7 A;  2O4G A;  3O3F A;  1WAJ A;  3LP1 A;  3OTO K;  1LCU A;  1KFS A;  5CE3 A;  3CCL N;  2E4L A;  1U45 A;  4FWL A;  5HRO A;  2P9P A;  4ZTJ A;  2P9S A; 
#chains in the Genus database with same CATH homology
 5T7B A;  4FLW A;  3AVM A;  2Z1J A;  5KTQ A;  4C8K A;  5J2P A;  1SL1 A;  1JLG A;  3LAL A;  1C1A A;  3SPZ A;  3QEW A;  1KCF A;  2ETJ A;  3AVJ A;  3KKS A;  1HYZ A;  4FZY A;  1RIL A;  5E41 A;  3NH2 A;  3HPO A;  2GBZ A;  4CFB A;  1U48 A;  2ITG A;  1RDB A;  3HPH A;  4DFK A;  3AVG A;  1QS4 A;  1W0H A;  2IAJ A;  4RW9 A;  2AJQ A;  1D8Y A;  3OYL A;  3HM9 A;  1WSF A;  4DSF A;  1TKD A;  2X6S A;  4CJV A;  3HP9 A;  1KRP A;  4J2A A;  1X1P A;  5J1E A;  1VSL A;  1HQU A;  4CJ3 A;  4O4G A;  3VA3 A;  4DS4 A;  4DU1 A;  3PX6 A;  3RTV A;  1SKW A;  1NKE A;  2Q3S A;  4IBN A;  3C6T A;  4O0I A;  3QIO A;  5KRS A;  3EYZ A;  4FJ9 A;  4L8R B;  4K8Z A;  5J2Q A;  5HBM A;  4DFM A;  4BDZ A;  3F73 A;  3QET A;  2PY5 A;  1C1C A;  3LZI A;  3NH1 A;  2HHV A;  1HJR A;  4G1Q A;  1HQE A;  4FJG A;  1VSF A;  3AVI A;  3ISN C;  4FK4 A;  4FCY A;  4AIL C;  3K5N A;  4WE1 A;  4KRF A;  1FXX A;  4FW1 A;  2HNZ A;  4CJE A;  1CZ9 A;  1I3A A;  3SUP A;  3AO3 A;  3LP2 A;  1K6Y A;  4OGC A;  4XIU A;  1QTM A;  1Y97 A;  3AVH A;  3I0S A;  4DG1 A;  1TAQ A;  3AA4 A;  1UWB A;  3WNH A;  4CK2 A;  1ZBI A;  3NH0 A;  3RR8 A;  3SQ0 A;  4AHV A;  4BE2 A;  5CYQ A;  3WNG A;  4Z4C A;  4FM0 A;  2YHB A;  1TAU A;  2YKM A;  2WON A;  1IKY A;  3DI6 A;  4NCG A;  3ZSW A;  2BAN A;  3AVC A;  1J54 A;  1TV6 A;  4JS4 A;  2D0A A;  3THV A;  1JLF A;  4KO0 A;  1R0A A;  4DF8 A;  4W5R A;  3HP6 A;  3QER A;  2E6M A;  2DFH A;  3AA5 X;  3QIP A;  4EZ9 A;  4CJP A;  4OLB A;  2OPS A;  4FK0 A;  3OYN A;  4FJN A;  3TI0 A;  5K14 A;  4Y1C A;  4M3W A;  3L8B A;  4KFB A;  1QSL A;  1VRT A;  5FDL A;  1NKB A;  3TAB A;  3ZSV A;  4JRP A;  4ICL A;  3VQ8 A;  3HVT A;  4HUG A;  3DLB A;  4FJ7 A;  4HCC A;  4BAC A;  4IDK A;  2QK9 A;  3HVR A;  1VSK A;  1B9F A;  4LY7 A;  3RWU A;  4CGJ A;  4DSE A;  3HPG A;  1VSD A;  3LP3 A;  4FJ5 A;  2B4J A;  3V9U A;  3NBP A;  4F2R A;  3HYF A;  4CEF A;  3PO5 A;  2IS3 A;  2XHB A;  1ZBH A;  3KLG A;  1UAX A;  1XHX A;  3T3F A;  4M3U A;  1RDC A;  3SUN A;  1T7P A;  4B9N A;  4NCA A;  4HVJ A;  1A5W A;  2YNH A;  3AO5 A;  4JS5 A;  3V81 A;  3TAN A;  1QE1 A;  4M3X A;  1S9E A;  4CEA A;  4B9U A;  4CHY A;  2VG7 A;  4M41 A;  4ZHR A;  4B9V A;  4CE9 A;  3K59 A;  1KLM A;  4CEQ A;  2D5R A;  5CZ2 A;  3LP0 A;  4Z0U A;  4FYD A;  2G8W A;  2HVH A;  4FLU A;  4CIF A;  2OZS A;  4W5Q A;  4Z4F A;  3RRG A;  1FKP A;  4HCB A;  2DTU A;  4IFV A;  4CHQ A;  4CF0 A;  3QIN A;  4JLH A;  3NF8 A;  4CF8 A;  3IG1 A;  2RN2 A;  3U3G A;  1NK9 A;  3QO9 A;  4OJR A;  1Z25 A;  4CCH A;  4FLZ A;  3QEX A;  4DLG A;  1QSY A;  5CZ1 A;  4AHT A;  1N5Y A;  1LWF A;  1ASW A;  3SQ1 A;  2Y1I A;  3CFP A;  3TAM A;  1NJW A;  4CJ4 A;  2Z1H A;  1TL1 A;  3S9H A;  3ZSQ A;  4OGE A;  4RW6 A;  1XHZ A;  3VQC A;  1NK5 A;  4BDP A;  1BIS A;  5HRP A;  1WSG A;  2W42 A;  2F96 A;  4CGI A;  4DFJ A;  1J53 A;  1VSI A;  1X9S A;  3S3M A;  3KD1 E;  2G8K A;  3V1Q A;  1NK0 A;  1LW0 A;  4CK1 A;  3L2R A;  1LW2 A;  2YNF A;  3M8P A;  4W5T A;  4DTX A;  1WSH A;  5J2M A;  3LZJ A;  2HHW A;  3AVF A;  4AHC A;  1L3T A;  1ASU A;  2IGI A;  5KRT A;  1Q9Y A;  2OZM A;  4BE0 A;  1ASV A;  1SUQ A;  3NF9 A;  4N47 A;  4CED A;  2KQ2 A;  4RW4 A;  2NUB A;  1Q9X A;  4CF9 A;  3UIQ A;  1HMV A;  3QNN A;  2FBV A;  3LPT A;  2FC0 A;  3OYA A;  2BE2 A;  1RTI A;  2O4I A;  1EXQ A;  2XRI A;  2HB5 A;  3DLK A;  5DMR A;  2OA8 A;  1C6V A;  4CEB A;  1D9F A;  4GVM A;  1ZBL A;  1IKX A;  4KHW A;  5FRO A;  1S1T A;  1WSJ A;  2I5J A;  4FZX C;  1NOZ A;  1ITG A;  3AO2 A;  2G8H A;  4LSL A;  4FJJ A;  5C25 A;  3OJU A;  1RDA A;  1NK8 A;  1CXU A;  4ELV A;  3SUO A;  1EX4 A;  5D3G A;  1U49 A;  4MFB A;  4FJ8 A;  1BQN A;  3O3H A;  1KLN A;  5FRM A;  3NAE A;  3G10 A;  3DLR A;  1WLJ A;  4BWJ A;  4DQR A;  2WOM A;  4LSN A;  4HUF A;  1SV5 A;  3LWM A;  3ZSY A;  4M45 A;  1FKO A;  1KSP A;  3L2W A;  4JRQ A;  4DTR A;  1NK6 A;  4HTU A;  3L2Q A;  5HP1 A;  4QAG A;  4DSJ A;  3LDS A;  4KI4 A;  2YKN A;  2G8F A;  3LPU A;  2P1J A;  2Z1I A;  4E1M A;  3RMA A;  4M42 A;  4OLA A;  2G8I A;  4CK3 A;  4O5B A;  4PWD A;  4B08 A;  4W5N A;  3K2P A;  3O4Q A;  4CFC A;  3TAE A;  1RCH A;  3O4N A;  4NYN A;  3OYI A;  1VSH A;  3SUQ A;  3VQB A;  1VK0 A;  1S1X A;  2P5G A;  3AO1 A;  3FFI A;  4CJS A;  2X78 A;  3KJV A;  1YTU A;  4DFP A;  1HRH A;  4FM1 A;  3NDK A;  3TAF A;  2HVI A;  3ALY A;  4GW6 A;  1ZBF A;  1RBR A;  1RT6 A;  3ZSX A;  3JSM A;  1WAF A;  4KHY A;  2HHT A;  4LH5 A;  1KVA A;  3SV3 A;  3C95 A;  4DS5 A;  2IOC A;  4ID1 A;  4CJW A;  3G0Z A;  3EZ5 A;  1BCO A;  3K5M A;  1I39 A;  1KFD A;  1S9G A;  3ASM A;  3QNO A;  4O0J A;  4FK2 A;  3C94 A;  3B6O A;  4DTU A;  2ZD1 A;  3VQ5 A;  1J9A A;  3SCX A;  3I8D A;  4Z4E A;  4PY5 A;  1RT5 A;  3AVN A;  3OVN A;  3BGR A;  3H08 A;  5EU7 A;  3NF6 A;  4CJR A;  1NJZ A;  2OPR A;  4CJ5 A;  4AHR A;  3PY8 A;  4Z4I A;  3DM2 A;  1ZYQ A;  4Z4H A;  4KV8 A;  1T05 A;  4J2E A;  2A1R A;  3DLG A;  1O1W A;  3OJS A;  3SQ2 A;  4N56 A;  1GOA A;  4H4O A;  1QHT A;  3RMC A;  2YNI A;  2HHU A;  2OPQ A;  1CXQ A;  5HRS A;  2G8V A;  1TKZ A;  2KZZ A;  3MAQ A;  2QXF A;  4DTP A;  4KPY A;  2KFZ A;  4CF1 A;  3CFO A;  5J2N A;  4ZTF A;  1BQM A;  1FK9 A;  1RBS A;  3MEE A;  1Q8I A;  1RBV A;  1EP4 A;  5SZT A;  4E0D A;  3CFR A;  1EET A;  4PQU A;  3SJJ A;  5KGW A;  1L5U A;  4RG8 A;  4M3Y A;  3PUF A;  2HHS A;  3E01 A;  4CFD A;  4FJL A;  3OYD A;  4M3Z A;  4FXD A;  4OPK A;  3VQ4 A;  3VQ6 A;  4N76 A;  3SZ2 A;  4AH9 A;  3TR8 A;  3AV9 A;  3ZSZ A;  4CER A;  3AO4 A;  2ZE2 A;  2XY6 A;  4DQI A;  3KTQ A;  2P5O A;  3VQA A;  1RT7 A;  4I9Q A;  3KK2 A;  3VQD A;  2X6N A;  1QQC A;  1WSI A;  3ZT1 A;  4CHP A;  1U47 A;  1L3S A;  3HT3 A;  2ATQ A;  1LWC A;  3IS9 A;  1EKE A;  1J5O A;  1RT3 A;  3ITH A;  4CGH A;  1D5A A;  1T8E A;  3WNF A;  1RTH A;  3SPY A;  1JLB A;  1C1B A;  4OKE A;  2F8S A;  2B6A A;  3NGY A;  1JLA A;  1A5X A;  4CEE A;  1F21 A;  1JXB A;  2E6L A;  3ULD A;  4I7F A;  1TK0 A;  3PV8 A;  1C0U A;  1YVU A;  4OVL A;  3EY1 A;  3LAK A;  3KLH A;  4FLV A;  4DTM A;  1SL2 A;  3V1R A;  3ZSR A;  2FBT A;  3CQ8 A;  2OYQ A;  4C8L A;  1DTT A;  4FJX A;  3OYC A;  3ZSO A;  3AVK A;  4QCL A;  1S1W A;  2QKB A;  3VQP A;  4DMN A;  3HO1 A;  1VSE A;  3NGZ A;  1XI1 A;  3DLE A;  1JLQ A;  3DLH A;  4B9L A;  1IH7 A;  1LV5 A;  4KTZ A;  3OY9 A;  3NHG A;  2YHA A;  4I2P A;  4DTO A;  4KHN A;  1KVC A;  3MXM A;  2Y1J A;  4DSK A;  4DU3 A;  1S5J A;  3QLH A;  5SWM A;  3OYH A;  4E89 A;  5CY4 A;  4CJF A;  1WNS A;  4CIE A;  4ELT A;  4KTQ A;  1JXE A;  2DY4 A;  4IKF A;  1NK4 A;  4CFA A;  3MED A;  3ZT4 A;  3IAY A;  4GMJ B;  3V9S A;  3RMD A;  1NJX A;  3OYM A;  1LWE A;  4PUO A;  1C0T A;  3OYK A;  4O44 A;  3ZT3 A;  3DYA A;  4BE1 A;  4E3S A;  1U04 A;  4CJK A;  4J2B A;  1X9W A;  1TKX A;  4KRE A;  5DK5 A;  4CF2 A;  1YTA A;  4E7I A;  4K8X A;  4DLE A;  2HW3 A;  2RPI A;  4H8K A;  1RDD A;  4IG3 A;  5C42 A;  3KD5 E;  4B9M A;  1IO2 A;  1IKW A;  3IRX A;  3OS2 A;  3V9W A;  1BGX T;  3NCI A;  1BHL A;  1RBT A;  1VRU A;  3VQQ A;  5I3U A;  4FJI A;  3HXM A;  1RT4 A;  3SNN A;  4B8A B;  4FM2 A;  3MEG A;  4KB1 A;  3KK3 A;  4YNQ A;  3ZT0 A;  4DQS A;  3V9Z A;  1DLO A;  1TL3 A;  2B5J A;  2BDP A;  1TK5 A;  2QKK A;  4F3O A;  3CM5 A;  4IG0 A;  3OS0 A;  3NFA A;  4LH4 A;  4CHO A;  3HST B;  2R7Y A;  1NJY A;  1CLQ A;  1IG9 A;  2IDO A;  1LAV A;  3D45 A;  2FBY A;  2HNY A;  3M8R A;  2GUI A;  2DFF A;  1BIZ A;  4CGD A;  3JYT A;  4B9S A;  4EZ6 A;  3AA3 A;  3NE6 A;  5CYM A;  1SKS A;  3VN5 A;  4CJU A;  3QES A;  1NOY A;  4ELU A;  3K5L A;  4E7H A;  4DTN A;  2XY7 A;  4IFY A;  4KAZ A;  4KI6 A;  4RW7 A;  1TK8 A;  2HND A;  3DRS A;  2X74 A;  1TKT A;  3WNE A;  3U3Y A;  1N6Q A;  1XC9 A;  1C0M A;  1JLC A;  2VG6 A;  4CGF A;  3AVB A;  1IKV A;  4FVM A;  5KI6 A;  5KGX A;  3KLF A;  2YNG A;  3NGI A;  1L3V A;  1YT3 A;  4AHU A;  4DU4 A;  3SI6 A;  2PZS A;  5HRR A;  1JLE A;  3AA2 A;  4F8R A;  4KHS A;  2HMI A;  3KIO A;  4DTJ A;  1RTD A;  2KTQ A;  3RRH A;  5HLF A;  1S6Q A;  1SKR A;  4DTS A;  1JL2 A;  5HRN A;  5I42 A;  2Z1G A;  4CEZ A;  1UA0 A;  1X9M A;  2DFE A;  3V1O A;  1UA1 A;  4FW2 A;  1G15 A;  3V9X A;  4J2D A;  4KHQ A;  2XO7 A;  3OS1 A;  2KW4 A;  4UQG A;  3MXI A;  1VSJ A;  1D9D A;  1RT1 A;  1B92 A;  3HJF A;  3D0P A;  3KK1 A;  1BCM A;  1NKC A;  3LAN A;  4CIG A;  3OYF A;  3P83 D;  3OYE A;  1DTQ A;  2JGU A;  4B3O A;  1KTQ A;  3K57 A;  1JL1 A;  2ZQB A;  4HHT A;  3VA0 A;  1VSM A;  3C6U A;  3KKR A;  4CGG A;  2FBX A;  5FRN A;  3SQ4 A;  1S1U A;  3HK2 A;  3SYZ A;  4NYF A;  3DOK A;  3SV4 A;  3ZCM A;  3DOL A;  1MU2 A;  3P1G A;  3L2U A;  4E7K A;  4DQP A;  4YFU A;  4CJL A;  2VWK A;  4FLY A;  1U4B A;  4EP5 A;  1BI4 A;  2YV0 X;  3PX4 A;  3B6P A;  3CG7 A;  1SL0 A;  4C8M A;  4RW8 A;  1TVR A;  3VQ7 A;  2G8U A;  1HYS A;  5JS1 A;  3BDP A;  3AVA A;  4KHU A;  3LAM A;  2XY5 A;  2BGG A;  4OKJ A;  3S3N A;  3KLE A;  3M8Q A;  4B8C A;  1NK7 A;  4CEO A;  4M3R A;  2GV9 A;  1TGO A;  4I9L A;  5C24 A;  3OYG A;  1T03 A;  2OPP A;  4KKO A;  1WN7 A;  4LD0 A;  4TSX A;  2HHQ A;  4M3T A;  4Q5V A;  4FLX A;  3O3G A;  3PX0 A;  3OYB A;  3LWL A;  3A2F A;  2HHX A;  2KZM A;  1S6P A;  3I0R A;  2VWJ A;  4FJH A;  3L3U A;  2F8T A;  3VQ9 A;  3F9K A;  4CEC A;  4FJK A;  2RF2 A;  1JKH A;  4E1N A;  4HUE A;  4Q0B A;  4DWI A;  3TAP A;  1CZB A;  3QEV A;  4FJM A;  3DMJ A;  4MQ3 A;  1W9H A;  4H4M A;  1LAW A;  3T1A A;  1L3U A;  4EP4 A;  4CJQ A;  4F3T A;  4ID5 A;  4W5O A;  2XY8 A;  1A5V A;  3RMB A;  3CYM A;  4OPJ A;  2PYL A;  4PA1 A;  3L3V A;  4F2S A;  4E19 A;  3DRP A;  4KB0 A;  3OYJ A;  3S3O A;  3ZT2 A;  1HNV A;  4N41 A;  1RT2 A;  3L2V A;  1ZBU A;  3P5J A;  1GOC A;  4Z4G A;  1UOC A;  2EX3 A;  5JS2 A;  3TWH A;  4Y1D A;  4DF4 A;  3U6F A;  3KLI A;  4CHN A;  4AHS A;  4FLT A;  4NCB A;  1GOB A;  3QEI A;  3VQE A;  1Z26 A;  4FZZ A;  1RNH A;  4KTW A;  3DRR A;  4QOZ B;  3NF7 A;  1HPZ A;  3AVL A;  2P51 A;  1S1V A;  1REV A;  2D0C A;  4R5P A;  3T19 A;  1B9D A;  3HL8 A;  4N5S A;  4CJT A;  3TAG A;  4CES A;  3V4I A;  4DQQ A;  2D0B A;  2A1S A;  4E7J A;  2VG5 A;  3TAQ A;  2EHG A;  3K58 A;  4OKK A;  3QEP A;  3MXJ A;  3PO4 A;  3TAR A;  4B9T A;  4DSI A;  3CM6 A;  1BIU A;  1RBU A;  4O55 A;  4BWM A;  2IC3 A;  2LSN A;  4I2Q A;  4E7L A;  1QSS A;  2PYJ A;  4C8N A;  1BI4 B;  3RR7 A;  2O4G A;  4F4K A;  3O3F A;  4C8O A;  1WAJ A;  3LP1 A;  3MEC A;  1WSE A;  1XWL A;  3V6D A;  1KFS A;  1RTJ A;  4DSL A;  2JLE A;  3K5O A;  1BL3 A;  1HNI A;  2E4L A;  1KVB A;  2KFN A;  2RKI A;  4CHZ A;  1U45 A;  3M8S A;  5HRO A;  1HYV A;  4ZTJ A;  4BDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...