1HRHA

Crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
125
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBONUCLEASE H
publication title Crystal structure of the ribonuclease H domain of HIV-1 reverse transcriptase.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase(endoribonuclease)
total genus 37
structure length 125
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1991-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hrhA00
4OJRA 1SL1A 4F2RA 1BQMA 2FBXA 3LZIA 2KFZA 5JS2A 4TSXA 1CLQA 3HJFA 3LP0A 1TAQA 4FJKA 5HRNA 1Z26A 1XHZA 3PY8A 3NGZA 4ICLA 3SJJA 4Y1DA 4KV8A 2E6LA 3VQAA 3T3FA 2P51A 4E0DA 4O0JA 1N6QA 3CM5A 3K5LA 1VRUA 4K8ZA 1B9DA 3TAFA 2FC0A 3QEWA 4CJSA 1NKBA 4FJ8A 1BIUA 2A1SA 4E7KA 1WN7A 1X1PA 4CJTA 3V6DA 1KLMA 2HB5A 4CJVA 3LWLA 1YTUA 3OYMA 1JLFA 5K14A 1LW2A 2ZQBA 4AILC 4B9NA 1WLJA 1LW0A 4KKOA 3NCIA 4DQQA 2P5OA 4ZTJA 1FKPA 4J2BA 4E7IA 4BWMA 1W9HA 1S1UA 4C8MA 1U49A 2RF2A 4Z4GA 2KFNA 4BE0A 4G1QA 3K2PA 4CIFA 2HHWA 4E7HA 3ZSWA 1QS4A 1IKYA 1U48A 3OS1A 1NK7A 4L8RB 3DOKA 1SKSA 1KVBA 3PO5A 4DLEA 1TAUA 3THVA 4J2AA 3ISNC 2I5JA 2VWKA 4FXDA 4FYDA 4Z4HA 4DTXA 3U3YA 3BGRA 4DSFA 4O4GA 4EP5A 3OYBA 4Z4EA 2ITGA 4FJ9A 2Z1GA 4M45A 4CEAA 1KCFA 1N5YA 4W5NA 3D0PA 2OPPA 4PA1A 1L3UA 4DFPA 4DLGA 2DTUA 3LP2A 4CK2A 1RBRA 4DS4A 2HVHA 1D8YA 3HT3A 4F8RA 4CF8A 1HYVA 1NJZA 1WSGA 4N5SA 2IC3A 1WAFA 1S9EA 4FLYA 2HNYA 1IKWA 1JLEA 2HHXA 1VSIA 1HPZA 3CG7A 4DTRA 1NJXA 4FK4A 1JXEA 3DLEA 4OLBA 1SV5A 3S3OA 1NK4A 4FM0A 4C8OA 5C24A 3ZT0A 4DU1A 4ELTA 1C1BA 2XY7A 4AHVA 4E89A 4BACA 1TV6A 4HCBA 4YFUA 3OYAA 4KO0A 3AVAA 3KLEA 4FLUA 3SUNA 3MEGA 3TANA 1RT3A 1ITGA 2X6NA 3DRRA 3SUOA 3WNEA 1BISA 3QIOA 3K59A 3SNNA 3AVIA 1ASWA 2PZSA 4CGGA 3RMAA 4OKKA 5KGWA 3ZT4A 1TKTA 3O3FA 3OYCA 3DLRA 3DYAA 3SV3A 3V81A 1QSSA 2OYQA 3C6UA 3M8SA 5D3GA 1WAJA 1B92A 3MXJA 4I2PA 4JRQA 1S9GA 1YTAA 4M3RA 3ULDA 3QETA 3SUQA 4KREA 3VA0A 4MFBA 2KW4A 1HNVA 3SZ2A 4B9LA 3O3GA 4KPYA 3JSMA 1WSHA 3HP9A 2XRIA 4KHYA 4FJIA 2EHGA 3OYDA 2HW3A 1C6VA 2YV0X 3L8BA 1FKOA 4Z4FA 3SPYA 4PY5A 3NF8A 3S3MA 3T19A 4DTNA 1Z25A 1ASUA 3KIOA 1L3SA 1YVUA 4CEFA 4CJ3A 4CFCA 1FXXA 4E7LA 1BI4B 1SUQA 5HLFA 4CEOA 1QE1A 3B6OA 2E6MA 5CY4A 4FJGA 2HHSA 4R5PA 1JLCA 3V1QA 1VK0A 1T03A 3KD1E 3EY1A 1JKHA 2EX3A 1TVRA 3ALYA 4IG3A 3OJUA 1DLOA 3HO1A 4FM2A 4B08A 3FFIA 1ASVA 1EETA 3LANA 1ZBIA 1XHXA 3AA5X 3G0ZA 3NH1A 3RRGA 4KB0A 2RPIA 3DLGA 4WE1A 1KRPA 1RTIA 5CYMA 2O4GA 5KGXA 4O5BA 3SQ2A 2P5GA 3ZCMA 4FLVA 3QEVA 3DLHA 5CYQA 2Z1IA 4Y1CA 3K5OA 1S1TA 2B6AA 3CFPA 1WSFA 1EXQA 2KQ2A 1CZBA 3SI6A 4LSLA 3AO5A 4IG0A 4OPKA 1VSEA 4CFAA 3OJSA 3QERA 1IKVA 1JL1A 2G8KA 3MECA 4CEEA 4N47A 2O4IA 4DS5A 1HMVA 1X9MA 3KTQA 3ITHA 3M8QA 3IG1A 4FW2A 5DMRA 2QXFA 3NF6A 3QINA 1S6PA 3VN5A 4DFKA 4CJ5A 3KLGA 3AVJA 4B8AB 3K5MA 4DU4A 2YHAA 2RKIA 1NK8A 3ASMA 3CM6A 3ZSRA 1J54A 3L2QA 3QEPA 1RILA 3HK2A 3AV9A 4CJQA 4FJHA 2QKBA 1GOCA 4ZHRA 1C1CA 3VQ9A 4JS5A 4AHCA 4NCBA 2FBTA 3L2UA 1ZBUA 2KZMA 2OPSA 2G8WA 3DI6A 3SQ4A 3VQ8A 4FM1A 3OVNA 3MXIA 1L3TA 4W5QA 4E3SA 1KTQA 1QHTA 1JLBA 1JLGA 3AA2A 3DMJA 3O4QA 3M8RA 3TI0A 3C6TA 4B9MA 4QOZB 4KHNA 1LAWA 1Q9YA 4FZYA 3TAGA 3VQ6A 4FJNA 3AVNA 1RT2A 3NF7A 4RW4A 2HNZA 4QAGA 4Z0UA 3PX4A 1HJRA 4IFYA 4I9LA 3ZSOA 5KRTA 3L2RA 3LDSA 3NH2A 3TABA 3S9HA 1X9WA 4KB1A 1L3VA 4M3TA 1JLQA 3KK3A 3HVTA 4B8CA 4H4OA 4CGIA 3AVFA 4CHOA 5I42A 4FVMA 3NF9A 3AO4A 1EKEA 4CF0A 3TAEA 2OZMA 1S1XA 2HNDA 3ZSVA 1MU2A 1A5XA 3AA3A 3HVRA 3V9ZA 1KLNA 4M3ZA 3KKRA 4CEQA 4CEZA 4ZTFA 3DLKA 3ZSYA 5KRSA 3KJVA 4CJKA 3F73A 3OYKA 2JLEA 3AVGA 3RWUA 1T05A 1ZBLA 4FJJA 3RR8A 1G15A 1GOBA 3TARA 3VQ5A 1UOCA 4CF9A 4XIUA 3K57A 2QK9A 1HYZA 4O0IA 3V9WA 2A1RA 3M8PA 4J2DA 4CIGA 2JGUA 3ZT2A 4O55A 4C8KA 4DFMA 4M3WA 2B4JA 5C42A 1A5WA 2HVIA 3CFOA 2DFFA 4O44A 4OKJA 1IH7A 4DQSA 4KAZA 1NK0A 3VQBA 4AHTA 3G10A 1KVAA 3OYLA 1HRHA 3LPUA 2Y1JA 2X6SA 3RR7A 4FJ7A 3VQQA 1Q8IA 1BGXT 4OGCA 4CECA 1RTDA 1TKXA 1VSMA 4N56A 4AH9A 5J2QA 4ELVA 1NJYA 1J53A 3SQ1A 3TAQA 1U04A 3L3UA 1NK9A 1RTJA 4N76A 3NBPA 4DSEA 2XO7A 3ZT1A 2YNFA 4CERA 3ZSQA 3HPHA 1BCMA 5HRPA 1UA1A 2ZE2A 3IRXA 1SL0A 4KFBA 3SQ0A 2ZD1A 1U4BA 4FJMA 5SWMA 4CJEA 2KTQA 3F9KA 3H08A 3I0SA 4I2QA 4CGFA 3NDKA 2BDPA 5HRSA 1T8EA 4BDYA 4ID1A 2PY5A 4C8LA 3TAMA 3TR8A 1K6YA 2VG7A 3K58A 3VQ7A 1C0TA 3C94A 3SV4A 4DTOA 2IAJA 1RT7A 3HPOA 2F8SA 4CIEA 4HTUA 1ZBFA 1R0AA 1WSEA 4E1NA 5C25A 4GW6A 1RBTA 4B9UA 1NK5A 3OS2A 2XY5A 1QQCA 3VA3A 1KFDA 3AO2A 4LD0A 3V1RA 4CJ4A 2XY6A 2HMIA 4RW8A 3IS9A 2HHTA 2HHQA 3LP3A 4KRFA 3MAQA 4W5OA 4UQGA 3SPZA 4JRPA 1RDDA 3WNHA 1NKEA 1I39A 3LAKA 1KVCA 3OYFA 4CJWA 1TK8A 1S5JA 2WONA 3HSTB 2IOCA 3OYJA 2G8FA 4FLZA 4FZZA 5J1EA 4FZXC 2ATQA 2Y1IA 3HXMA 3EYZA 4BE2A 3CFRA 3VQDA 2OZSA 3HM9A 1RDCA 1BCOA 2E4LA 1J9AA 3KK1A 4KTWA 3VQCA 2IS3A 4NYNA 4CK1A 3RRHA 1DTTA 1S6QA 3P5JA 2VWJA 1HYSA 2R7YA 4CFBA 1RDAA 4KI4A 4OKEA 1RT4A 1VSFA 3CYMA 3DLBA 1NJWA 3OYNA 4RW9A 4CGDA 1U47A 5FROA 4IFVA 3QESA 3D45A 4OPJA 2RN2A 3WNGA 1DTQA 3KK2A 5HROA 3NH0A 1VSLA 4DG1A 3V9UA 4J2EA 4C8NA 1IO2A 1W0HA 3DM2A 4DFJA 1UAXA 3K5NA 2IDOA 1BI4A 4CHYA 1LAVA 3KLHA 3CQ8A 3U6FA 1RT5A 4NCGA 2BGGA 3OY9A 4I7FA 2OPRA 3ZSZA 1TK5A 1D9DA 1WSIA 4DQPA 4FLWA 4HHTA 1RNHA 1HQUA 2FBYA 4OLAA 3MEEA 5CZ1A 4FJXA 4DMNA 3E01A 1RT1A 3QNNA 4DSKA 3AVBA 3A2FA 5HP1A 1O1WA 3PUFA 4DTMA 4RG8A 4DTPA 4IBNA 1CZ9A 5KI6A 5KTQA 1ZYQA 3V9XA 4E19A 1REVA 4CFDA 3L2VA 3ZSXA 4DSJA 1JLAA 2D5RA 4EZ6A 4B3OA 3BDPA 2YNIA 4GVMA 3I8DA 3QEIA 2VG6A 2W42A 4KHSA 4CK3A 1I3AA 1RDBA 4DU3A 1TL1A 1C0UA 4CEDA 4Q0BA 1VSHA 3SUPA 3HYFA 2BE2A 4BDZA 4Z4IA 2YNGA 3HL8A 4AHRA 1WSJA 4NYFA 2Q3SA 1T7PA 2KZZA 4CHNA 4FJ5A 4HUFA 3WNFA 3PX6A 2XHBA 1KFSA 4OGEA 3AO3A 2DFHA 4FW1A 4H4MA 3V4IA 1SKWA 3B6PA 1RTHA 3PX0A 3C95A 3U3GA 1NKCA 4B9TA 1ZBHA 1HQEA 4DQIA 1IKXA 5T7BA 4FLXA 2YKMA 4H8KA 3NE6A 5J2MA 1NOZA 5HRRA 3QLHA 3OYEA 3LZJA 4FK0A 3DRSA 3NHGA 4CF2A 3NAEA 2D0AA 2QKKA 2PYJA 4LSNA 4RW7A 4DTUA 4DTSA 3PO4A 3L3VA 3MXMA 2NUBA 3HP6A 3L2WA 4DTJA 4AHUA 5SZTA 3ZT3A 1L5UA 4DSLA 4FLTA 3RMCA 4DSIA 2DY4A 3HPGA 1RBVA 4CESA 4B9VA 4DQRA 4I9QA 4FK2A 4CGJA 1Q9XA 1WNSA 4MQ3A 5FDLA 3T1AA 4YNQA 4KHWA 5J2NA 4QCLA 1C0MA 4DF8A 1UA0A 4GMJB 4HUEA 4KTQA 1A5VA 4B9SA 1F21A 2Z1HA 1BIZA 4Z4CA 1LV5A 1LWCA 4CJPA 1QTMA 2YKNA 1KSPA 2VG5A 3AO1A 3DOLA 4EZ9A 4KHUA 3NGYA 2FBVA 3DRPA 1TKZA 1LWFA 1CXUA 5EU7A 2F96A 4CJFA 4DF4A 1D5AA 4DWIA 1EX4A 3RTVA 2OPQA 3KKSA 4CE9A 3AVHA 1TK0A 4EP4A 4N41A 5DK5A 1BQNA 2Z1JA 3AA4A 1VSDA 1NOYA 1CXQA 2GUIA 5JS1A 3OS0A 4NCAA 1LWEA 1GOAA 2LSNA 2ETJA 4KTZA 1VRTA 3LAMA 3NGIA 2G8UA 5CZ2A 4BE1A 2X74A 4LH4A 1J5OA 3AVLA 3TWHA 1SKRA 3QO9A 4FCYA 1JXBA 2XY8A 3I0RA 3VQEA 1X9SA 1RT6A 1TL3A 1IG9A 2AJQA 1S1WA 3V9SA 1RBSA 4M41A 3QEXA 3TAPA 2X78A 3VQ4A 2G8HA 3O4NA 4F3OA 4CF1A 4FJLA 4KHQA 4LH5A 1QSYA 4LY7A 3QIPA 2IGIA 1VSJA 1XC9A 3S3NA 2GBZA 1S1VA 2F8TA 3KLIA 3JYTA 3LP1A 1U45A 4CCHA 4ELUA 1BHLA 1RBUA 3SCXA 1SL2A 4M42A 4IDKA 4CHPA 5I3UA 1YT3A 3RMBA 1XWLA 4KI6A 1D9FA 4F2SA 4RW6A 4PQUA 4PUOA 3KD5E 3KLFA 4F3TA 2G8VA 3V1OA 4Q5VA 4HVJA 5FRNA 4HUGA 2P1JA 1FK9A 1BL3A 3P1GA 3MEDA 1RCHA 1XI1A 3QNOA 1EP4A 3SYZA 1B9FA 4CJLA 1VSKA 4CGHA 3AVCA 2D0BA 1UWBA 2BANA 4BWJA 2PYLA 3O3HA 4HCCA 4JLHA 4IKFA 4E7JA 3OYHA 2HHVA 2B5JA 4F4KA 4PWDA 3VQPA 4W5TA 3LWMA 1HNIA 3AVKA 3NFAA 3PV8A 3LALA 2HHUA 3OYIA 4CJRA 2WOMA 5J2PA 2YNHA 4ID5A 4CJUA 4AHSA 1QSLA 5FRMA 4CHZA 1JL2A 3EZ5A 1TGOA 4OVLA 4JS4A 4BDPA 5E41A 3IAYA 4M3XA 4CEBA 1Y97A 1NK6A 4K8XA 4M3YA 2GV9A 4CHQA 4E1MA 4M3UA 1C1AA 2DFEA 3UIQA 2YHBA 3LPTA 1TKDA 4W5RA 2D0CA 3OYGA 3RMDA 3P83D 3AVMA 2OA8A 5HBMA 2G8IA
chains in the Genus database with same CATH superfamily
4F2RA 1BQMA 3H3NO 4Y0WA 4ICLA 4JI8K 4KV8A 2UXBK 4O0JA 3UKUA 2FF3B 1B9DA 3T69A 1BIUA 2RHKA 2BUPA 3CCUN 4NO7A 3LWLA 4BRDA 1YTUA 3OYMA 2V7ZA 5K14A 2GELA 2ZQBA 1LW0A 3NCIA 4J2BA 1U49A 1W9HA 3K2PA 5GIOA 4H0PA 3R3LA 4DCHA 1U48A 4L8RB 3AY9A 3ISNC 4FWOA 3U3YA 4O8KA 4CI6A 1XNQK 4H0TB 4DR2K 3VERA 4YHHK 1NGBA 5JVGL 4DLGA 1Q82O 1D8YA 1HYVA 3C7NB 5KQ8A 4N5SA 2IC3A 3AGKA 4JKBA 1JLEA 2HHXA 3AAQA 1VSIA 4FK4A 3T1YK 1TYQB 1SV5A 3BF1A 4BG8A 3S3OA 4CBXA 4C8OA 3ZT0A 1VQ6N 3DXKA 4CZFA 2XY7A 1ATSA 4MO4A 3OYAA 4KO0A 3BF3A 3ZETB 1K8KB 3SUNA 4IJNA 3TANA 3SUOA 2X6NA 1KXPA 3SBTA 4OKKA 4O5FA 3C6UA 3FGUA 1B92A 1K8AO 3H46O 3S41A 4MFBA 2KW4A 3THXB 2OANA 3DWLA 3O3GA 3JSMA 1WSHA 3HP9A 2EHGA 2HW3A 1C6VA 3K0SA 4H0VB 5AZJA 4DR7K 3MWTA 3S3MA 4DV7K 5FPNA 1WBBA 4CJ3A 1SUQA 4CEOA 3B6OA 4FJGA 4R5PA 2VQFK 3KD1E 1VQLN 2QWNA 1NNEA 1JKHA 1NM1A 5AQPA 2P9IA 3M6GA 5LJWA 3MN7A 5JVHL 1O13A 2A42A 3AA5X 3G0ZA 3RRGA 3ULEA 3DLGA 1KRPA 5CYMA 3SQ2A 2P9NA 4O5BA 5BN8A 3ZCMA 4FLVA 2Z1IA 2B6AA 3CFPA 4IZ9A 2KQ2A 3H1VX 2G8KA 1VSEA 2NRHA 3A5LC 3EE9A 3MDQA 2O4IA 3DAWA 4DS5A 3M8QA 4GNIA 3IG1A 4PKGA 5BR9A 4JKDA 3VTHA 4DFKA 4CJ5A 4GKJK 2FSNA 3K5MA 2YHAA 2RKIA 3CJCA 3ZSRA 3L2QA 4CZKA 3HK2A 5M1QA 1GOCA 4ZHRA 3JAMO 3L6QA 3SAFA 5H1SQ 4PL8A 2VGNA 3OBWA 2G8WA 4DB3A 3SQ4A 1JLGA 3M8RA 4B9MA 1LAWA 1Q9YA 3VEOA 3VQ6A 3O8MA 1BDGA 1RT2A 1VQ8N 4JI4K 4I9LA 3L2RA 3VOVA 2OTLN 5BRFA 1WB9A 3KK3A 3LM2A 4CGIA 1KD1O 1WOQA 3HVRA 3V9ZA 4B1YB 3A0IX 3O08A 3DLKA 4CJKA 2DPNA 1T05A 2KHOA 3CPWM 4CF9A 4O0IA 2A1RA 4J2DA 4DV0K 3KWGA 1E4FT 4C8KA 3DLLL 3DXKB 5JLFA 1P90A 4O44A 3CJAA 2IVPA 4AHTA 3G10A 3OYLA 1Q81O 3RR7A 1Q8IA 5LMNK 4N56A 4YOUA 1U04A 1RTJA 3NBPA 1X9JA 3ZT1A 1BCMA 2ZE2A 3LDQA 3SQ0A 2KLAA 3FZFA 4CJEA 3BEXA 3O9TA 4I2QA 4CGFA 4ID1A 3H6EA 2VG7A 3Q7CA 3VQ7A 2IAJA 4WQ5C 1WSEA 5C25A 1S22A 3QFPA 4PKHA 3OS2A 1QQCA 3VA3A 3AO2A 3V1RA 1NU0A 2HHTA 3IS9A 2HHQA 4CZEA 4JKCA 1RDDA 3LAKA 4CJWA 1S5JA 2WONA 2IOCA 4XH1A 5J1EA 3EN9A 2OZSA 4L3QA 1HLUA 1BCOA 3VF6A 4CK1A 4GVEA 1HYSA 4MDAA 1RDAA 4FWQA 4FWLA 4OKEA 1NJWA 3B8AX 4RW9A 4CGDA 1U47A 1IJJA 2E1ZA 4OPJA 2D1KA 4MLEA 3TTDA 2ZJQL 3DJCA 1G99A 3NH0A 1VSLA 2AA4A 4BRAA 1W0HA 4BQLA 4DFJA 3BZCA 4H03B 2IDOA 4X66K 4CHYA 3K5NA 3KLHA 3OW2M 3MMVA 1QVFM 4NCGA 5JICA 2BGGA 3KVGA 2NRTA 1TK5A 1D9DA 3VPZA 1HQUA 3CXCM 1WBDA 1WUAA 3D2FB 3QNNA 4DSKA 4CBWA 5HP1A 4RG8A 2ZGZA 2YX6A 3HO1A 4IOXA 4GVMA 1VHXA 4DU3A 4LF6K 1TL1A 1C0UA 3CERA 4CEDA 1V4SA 4BDZA 1JCFA 2YNGA 2Q3SA 1T7PA 4R79A 3WNFA 1X3MA 1J6ZA 4FW1A 3B6PA 4BR2A 1YJ9N 1ZBHA 3O80A 4DQIA 4B3MK 2W40A 4YDUA 4JK9A 5AQLA 4H8KA 1NOZA 3OYEA 4JKFA 2CGLA 3TU5A 4B9QA 4FK0A 2QKKA 2PYJA 4RW7A 3PO4A 3G6EN 4M7XA 4DKWA 2VGMA 3AARA 4DSIA 2DY4A 3HPGA 3T7ZA 4CGJA 1Q9XA 1WNSA 4MQ3A 2O8FB 4KHWA 4KTQA 4GMJB 3I56N 3F9MA 1Q7YO 3H3OB 4Z4CA 1LV5A 4BREA 1BUPA 2YKNA 3OTOK 1T3VA 3DOLA 4YOXA 3WQTA 1MDUB 4KHUA 2FBVA 5C15A 5EU7A 5AQTA 2F96A 3C0BA 2OPQA 4B1UB 5AQSA 5AQWA 2NLXA 4EP4A 1VSDA 3HOTA 1CXQA 3VETA 4CVNE 1IBLK 1LWEA 2ETJA 1VRTA 2X74A 4YOWA 4NLCA 3TWHA 1VQMN 1TL3A 2AJQA 1RBSA 4M41A 2X78A 3AAPA 1QSYA 1NGJA 2GWKA 1BWFO 3JYTA 1S72N 3LP1A 1RBUA 4M42A 4BC3A 1RDUA 5I3UA 3RMBA 1XWLA 3FLCO 4B1WB 4F2SA 2HF3A 2G8VA 3V1OA 4EIAA 1BL3A 1NGAA 3MEDA 3P1GA 4NXNK 3TPQA 4CGHA 3AVCA 2D0BA 2BANA 4K0KK 4HCCA 4JLHA 4IKFA 4H5NA 2P9LB 2RE2A 3THWB 4ISEA 1VQKN 3OBYA 5AJ3K 3PV8A 4ILGB 2HHUA 2WOMA 5AQFA 1IBKK 1TGOA 5GAGP 3WUHA 4K8XA 4E1MA 1C1AA 2DFEA 3KK7A 3UIQA 4BRFA 1TKDA 5ADXA 1VQPN 4B3TK 5HBMA 3SCXA 1SL1A 3ZX3A 1M90O 4GV9A 2FBXA 3LZIA 2WFBA 5HRNA 1BOTO 4CZGA 3SJJA 3AGRA 3VQAA 3A5MC 2P51A 1N6QA 3CM5A 2CGJA 4K8ZA 3TAFA 5GAEP 2FC0A 4M7YA 3WXIA 4CJSA 1NKBA 5E26A 1YHQN 4JKHA 3V6DA 4OPAA 3O9SA 4IEEA 2P5OA 3WT0A 1EQYA 2ZJPL 1S1UA 3CETA 4C8MA 4Z4GA 2P9UA 3CC7N 2FF6A 4E7HA 2HHWA 3ZSWA 1IKYA 3PO5A 1XUPO 2P9PA 4IJAA 4ILHA 4J2AA 4DTXA 3UB5A 4IOAL 5C2FA 1GLDG 2PBDA 3HTVA 2YJFA 3WXLA 2Z1GA 4M45A 1N5YA 1K9MO 3D0PA 2OPPA 4DFPA 2DTUA 2HVHA 4DQ8A 2YHWA 4F8RA 1OH8A 4BRGA 1NJZA 3CD6N 1WAFA 1S9EA 4FPBA 4BRHA 3TSUA 3IFRA 1HPZA 4DTRA 1NJXA 1JXEA 1NK4A 4A61A 1T6CA 4DU1A 3CMAN 4E89A 4BACA 2ASPA 3KWIA 4JKGA 5F1XA 4X65K 4FLUA 3MEGA 1RT3A 1ITGA 3VEXA 3WNEA 1NMDA 3QIOA 1KAZA 3SNNA 3AVIA 5AQJA 1YAGA 3J81O 3OA9A 3VEYA 1GLCG 4CGGA 5KGWA 3O3FA 1TKTA 3DYAA 1T44A 4K42A 4E1JA 1WAJA 4I2PA 3QETA 1YTAA 5FPDA 4F9OA 5MLCQ 1HKCA 1HNVA 3ATUA 5TKWA 2XRIA 4KHYA 4BR7A 4FJIA 3VF2A 4JD2A 4Z4FA 4PY5A 5CE3A 3J7AP 4DTNA 1XMOK 1ASUA 2PFUA 1FXXA 1BI4B 5AQUA 2FLOA 3HRGA 5CY4A 3V1QA 3QFUA 3EY1A 2EX3A 3ALYA 1GLEG 5AQNA 3OJUA 4CZMA 1DLOA 3LANA 4KB0A 4WE1A 3M1FA 5KGXA 2Q31A 4BRIA 5CYQA 4Y1CA 1YJNN 1U2VB 3NVMA 3OJSA 4CFAA 1ILYA 2OTJN 1IKVA 1JL1A 3MECA 1HMVA 1X9MA 3O4WA 1T6DA 3ITHA 4FW2A 2QXFA 5FPEA 3KLGA 4DU4A 1BA1A 1VQNN 1J54A 5BRHA 4B1XB 4I6MA 2Q0UA 4CD1A 4MO5A 4CJQA 1GLFO 4FSVA 2V52B 1C1CA 4JS5A 2FBTA 3L2UA 1ZBUA 3GBTA 3ZX0A 3DI6A 3VQ8A 3OVNA 4KH6A 3AA2A 2P9UB 3C6TA 3MN6A 3DXMA 4FJNA 4QAGA 4BRKA 5KPZA 3ZSOA 3LDSA 2WC9A 2HBJA 1X9WA 3MCAB 3HVTA 4B8CA 5I42A 2QM1A 1KAYA 4CZIA 5AQZA 2OZMA 1MU2A 4EHUA 3VMFB 4ZTFA 2D0OA 2HHHK 1M1KO 3OYKA 2JLEA 1KAXA 5C0YA 3RR8A 1G15A 3CC2N 3K57A 2P9KB 2WUSA 4Z94A 4IXCA 4K25A 4M3WA 3CC4N 2B4JA 3THYA 1A5WA 4OKJA 1NK0A 4EAHD 1N32K 1HUXA 2Y1JA 3LPUA 3ID8A 4IOCL 4CECA 4DR1K 1TKXA 1N36K 5BREA 3SQ1A 4QS8A 2YNFA 4BVOA 3ZSQA 3D2EA 5HRPA 1R59O 4KFBA 4BR4A 2W6KA 1U4BA 4FJMA 3MX2A 4NLBA 1LOTB 2JWKA 4DV3K 5C12A 1T8EA 5B8HA 4BDYA 3G4SN 2VCPA 2PY5A 4OO1J 5FLXO 3TR8A 2YJEA 4GKKK 3WQUA 3ZEUB 4CIEA 4HTUA 1SZ2A 1W97L 4E1NA 5AZIB 4GW6A 1NGDA 3WXMB 1NK5A 2XY5A 1KFDA 4A2BA 4LD0A 5F2RA 2O8DA 3LP3A 4W5OA 3U4LA 3OHRA 4JRPA 2FSJA 3OYFA 1KVCA 3HSTB 4WQ5A 3VESA 2GWJA 4BE2A 3VQDA 4A57A 2E4LA 5EXWA 4CD3A 2PAVA 3DLBA 3K9JA 3OYNA 1NG9A 5BPMA 1JCEA 3FZHA 1OH5A 1MA9B 1DTQA 3JXUA 3KK2A 4DG1A 5KPRA 4CW7B 5IT9O 3JS6A 1XQSC 5BN9A 1LAVA 3UKUB 1NJIO 4FWRA 3OY9A 4BR5A 2OPRA 4DQPA 3N4PA 4HHTA 2FBYA 4OLAA 5CZ1A 3BY5A 5DM6L 3R6MA 1RT1A 1KC8O 3AVBA 3A2FA 2NZTA 4BRCA 4DTPA 4E19A 5F0XA 3L2VA 1I94K 4DSJA 2D5RA 3BDPA 3I8DA 3QEIA 2VG6A 2W42A 2O8CA 4CK3A 1RDBA 3RSEA 4Q0BA 3QMLA 3SUPA 3CCLN 2BE2A 3HL8A 1WSJA 4CZHA 4NYFA 2KZZA 2IIRA 4AM6A 5AFUH 3PX6A 1SKWA 3PX0A 1NGFA 2Q2RA 2QWLA 3U3GA 1NKCA 4H0XB 1IKXA 5T7BA 2CGKA 5J2MA 5HRRA 1Q86O 3FZMA 3DRSA 4LSNA 4DTUA 4U7BA 3MXMA 4H5TA 4C1NI 4IEIA 1L5UA 4DSLA 2NRZA 4G9ZA 4B9VA 4I9QA 4DQRA 4FK2A 1CZAN 4KH5A 5FDLA 4YNQA 1YVNA 1C0MA 1UA0A 5EOYA 3IMXA 4B9SA 4LFBK 4EZ9A 3NGYA 4NXMK 2P9SA 2E1YA 1D5AA 3P4IA 3SAGA 1KQSM 2VQEK 1N8RO 3SK3A 4BGAA 1NOYA 5AZJB 2GUIA 5AQMA 3NGIA 2HMPA 2F7TA 5CZ2A 4BE1A 3ATVA 1JXBA 3I0RA 3UE5A 1S1WA 3TAPA 3VQ4A 1P8ZA 2G8HA 4JYAK 4CF1A 2P9IB 1E3MA 4LH5A 4LY7A 2HSTA 2Q36A 3ULEB 1XC9A 2HOEA 2GBZA 2F8TA 3KLIA 2P9NB 4CCHA 2OCEA 3BZKA 5C2DA 3A5OC 4IDKA 1FW6A 1YT3A 3CJBA 4FL9A 3J7YP 3HOSA 3KD5E 5FPMA 1FK9A 2Q1NA 4UY8O 4C1NK 1NBWA 2QW9A 4EFHA 1EP4A 1B9FA 4CJLA 3SLCA 4BWJA 2PYLA 3UKRA 1NGCA 4W5TA 3LWMA 4KBOA 3EE8A 3AVKA 3NFAA 4IO8A 3SMSA 3OYIA 5J2PA 4RCHA 4ISGA 4CJUA 4AHSA 1QSLA 4JS4A 3IAYA 4M3XA 3CCMN 4JI1K 4CEBA 4M3YA 3L0QA 2O8CB 4CHQA 1E4GT 4M3UA 3RSEB 1YIJN 4W5RA 4X64K 3RMDA 3AVMA 2I7PA 2G8IA 2Q0RA 4H5RA 4AF1A 4TSXA 1TAQA 1OH6A 1XHZA 3NGZA 4BY9C 4Y1DA 3CIPA 3VGLA 4O8UA 1VRUA 2QWOA 3F5TA 1OVYA 5HOOA 4FJ8A 4KH4A 1WN7A 1X1PA 4E7KA 3VF4A 1JLFA 3U8XA 1BO5O 1LW2A 4B9NA 1WLJA 4DQQA 4KKOA 2BTFA 2UU9K 4BE0A 4G1QA 1RGIA 2GTDA 4GV6A 3MCPA 1QS4A 1NK7A 3DOKA 1KVBA 3GE1A 4DLEA 3C65A 5DM7L 4Z4HA 4O4GA 5AQOA 4EP5A 4Z4EA 4FJ9A 4W5NA 1KCFA 4BC2A 4A62A 2IVOA 1L3UA 1EWQA 4GY2B 4PHTX 1DKGD 4DS4A 3HT3A 1WSGA 3W0LA 3CG7A 2O8EA 3CHWA 4YOYA 4FM0A 3WXJA 4JI0K 1TV6A 3EKSA 1NGGA 3I55N 4LF5K 1X3NA 4YY3K 1ASWA 2PZSA 3RMAA 1JCGA 2QWMA 3OYCA 2A40A 3SV3A 1Q18A 3DLRA 3V81A 1RFQA 4JHDA 2OYQA 3M8SA 3PSFA 4DR3K 1W2BM 4NCBA 5D3GA 4M3RA 3ULDA 2V51B 3SUQA 3GOIA 3SZ2A 4B9LA 2Q97A 5EY4A 3OYDA 4DV1K 2CH5A 3SPYA 5A2QO 3NF8A 2VYPA 1Z25A 2HF4A 3KIOA 1L3SA 1YVUA 4CEFA 4E7LA 2E2PA 1VQ4N 3ZYYX 1QE1A 3CCJN 2E6MA 5EVZA 4LC9B 2HHSA 1JLCA 1T03A 1VK0A 4CZLA 4IG3A 1NLVA 4FM2A 3FFIA 1ASVA 1ZBIA 1XHXA 3NH1A 1SAZA 4PL7A 1RTIA 3TTCA 2P5GA 4WFNL 3DLHA 3WEEA 1ESVA 1S1TA 1WSFA 1EXQA 3SI6A 1CZBA 4LSLA 3AO5A 4MLHA 3CI5A 2GX9A 4H5WA 4N47A 4GV3A 2D0PA 4MDBA 5JLHA 3KTQA 3VEZA 3G25A 1J5EK 3QINA 4IWVA 1S6PA 3VGKA 5M1NA 1TAUA 1GLLO 3SAHA 3ASMA 3CM6A 4B3RK 3AV9A 2QKBA 2QWPA 4AHCA 5AQQA 4QS7A 2OPSA 2E2NA 4JI7K 3MXIA 4W5QA 1KTQA 1JLBA 3DMJA 5KPTA 4KHNA 4FZYA 3TAGA 3AVNA 4RW4A 5AQYA 4B1ZA 2HNZA 1NKEA 1HJRA 4IFYA 4YDUC 4ISFA 3NH2A 3TABA 1L3VA 4HWIA 1NWKA 4X62K 4H4OA 4FVMA 3NF9A 3AO4A 3IDHA 1EKEA 4CF0A 3TAEA 3CCQN 1S1XA 2HNDA 1KLNA 3AA3A 1HR0K 4M3ZA 1YUWA 4CEZA 3QDKA 2E8AA 4H0YB 1QVGM 3F73A 3SMPA 1TUYA 3CCEN 5AQGA 4FPAA 4FOIA 3TARA 1UOCA 2QK9A 3V9WA 3M8PA 3ZT2A 4IO9L 1EWRA 4DHYA 3H1QA 5GIPA 4DFMA 5C42A 3VEVA 2HVIA 3O5BA 1XMQK 4DV2K 3VQBA 1IV0A 3VEWA 2FXUA 1YI2N 1YITN 4FJ7A 1JJ2M 5AQXA 1IBMK 1RTDA 1VSMA 3FR0A 2YHXA 3R1XA 1NJYA 1MWKA 1NK9A 3L3UA 3E9PA 4M63C 4N76A 2UUBK 3O6WA 4DSEA 2XO7A 4CERA 1K73O 3P39A 2QA4N 4JK7A 5SWMA 2QXLA 3F9KA 3H08A 3I0SA 3NDKA 2BDPA 3MK6A 1V4TA 3TAMA 1C0TA 3C94A 1RT7A 3P38A 1ZBFA 5JMVA 1K8KA 2NNWA 4CJ4A 2XY6A 4FWPA 4RW8A 4UQGA 4DR6K 3WNHA 1I39A 2ITMA 3OYJA 4FLZA 3WEEB 4FZXC 2Y1IA 3HXMA 3EYZA 1RDCA 1J9AA 4A59A 3VQCA 4NYNA 2ZJRL 1DTTA 1S6QA 2R7YA 2HBLA 4A5AA 4KHPK 5FROA 3QESA 3E9LA 3D45A 2UYTA 3WNGA 3E9OA 5AQRA 3V9UA 4WQ4C 4C8NA 4J2EA 1IO2A 3MWPA 1RT5A 3L4QA 2QI2A 3O1BA 2V7YA 3ZSZA 2E2OA 3M5RA 2F4VK 2W41A 2ZF5O 4H5VA 1LCUA 4DTMA 1QZ6A 3D6RA 4IBNA 1CZ9A 1ZYQA 1REVA 4CFDA 3ZSXA 2A5XA 2YNIA 4BROA 3HYFA 2I7NA 2P9PB 3F2KA 4AHRA 2WBNA 2XHBA 1KFSA 3Q7BA 4OGEA 1GLAG 3V4IA 2YCHA 1RTHA 4B9TA 2D4WA 4FLXA 4JNEA 3A8YA 2YKMA 3NE6A 3LZJA 5E84A 3NHGA 2D0AA 4JI5K 2NRXA 3HP6A 4DTJA 4AHUA 5SZTA 4FLTA 4BR0A 3KHYA 3RMCA 1DEJA 4CESA 2BH1A 5BRDA 4BRNA 2O8BA 3SJHA 4WFBL 3W3DA 4DF8A 4HUEA 4JKGB 1A5VA 3GL1A 1F21A 1BIZA 4CJPA 1QTMA 4K41A 3AO1A 2UUCK 2E5LK 3TSQA 4DV4K 3E66A 1VQ5N 3MN9A 1EX4A 4N41A 5DK5A 1BQNA 4FWSA 1W7AA 4JD2B 4WYBA 4LF8K 3OS0A 4NCAA 3AVLA 3QO9A 2ASOA 4FCYA 3VQEA 1X9SA 1RT6A 2A3ZA 1IG9A 4H0OA 3V9SA 3QEXA 3MN5A 1Y64A 4F3OA 4YORA 4FJLA 3QIPA 2IGIA 3S3NA 1S1VA 4ELUA 3O9RA 1BHLA 1BU6O 1SL2A 4CHPA 3CCVN 4KI6A 3QB0A 1D9FA 3KLFA 4Q5VA 4HVJA 2P1JA 1XI1A 1RCHA 3SYZA 4LF4K 2UUAK 3LDLA 3GDQA 3O3HA 3EL2A 4E7JA 3OYHA 4I6MB 4A2AA 4BR9A 2B5JA 4F4KA 4PWDA 5IWAK 4BG9A 4A5BA 4CJRA 2YNHA 4BGBA 5FRMA 4CHZA 1JL2A 3EZ5A 1YJWN 1HPMA 1DGKN 3DXMB 1NK6A 1D4XA 3LPTA 1Z6RA 1C0FA 2D0CA 3VTIA 4OPHA 1HNIA 2OA8A 4OJRA 3HBTA 5JS2A 2KFZA 1CLQA 1VQ7N 3HJFA 3LP0A 4FJKA 1Z26A 3PY8A 1HNXK 2E6LA 3T3FA 1NMNA 4E0DA 1QHAA 4JK8A 3K5LA 5AFUA 3QEWA 3NMUA 2A1SA 4CJTA 1FJGK 1KLMA 2HB5A 4CJVA 3R8EA 2E20A 4FVUA 3D2FA 4AILC 3T1HK 1FKPA 4ZTJA 3THYB 4E7IA 4BWMA 2KFNA 2RF2A 2O8BB 2QWQA 1QQNA 4WCEL 4CIFA 3OS1A 4K43A 1SKSA 3THVA 3I8BA 2I5JA 2VWKA 4FXDA 4FYDA 3BGRA 4DSFA 1IG8A 3OYBA 2ITGA 3M3ZA 4CEAA 3D2EB 4PA1A 1HKBA 3C6AA 3LP2A 4CK2A 4JEPA 1RBRA 3E1YA 1OVQA 4CF8A 4DUZK 4V19S 3ZLJA 3CJ9A 4FLYA 2HNYA 1IKWA 3DLEA 1YF5L 4OLBA 1VQON 5C24A 3EZWA 4DV6K 4ELTA 1C1BA 3O9UA 4JKEA 1BG3A 4AHVA 2O8FA 4HCBA 4YFUA 1SS6A 3AVAA 1HNWK 3KLEA 2UXCK 3DRRA 3L4IA 2O8DB 1BISA 3K59A 4AM7A 4XH4A 4EHTA 4BC4A 3J8AA 3VGMA 3ZT4A 1QSSA 3ID6A 3H45C 4JN4A 3MXJA 4JRQA 1S9GA 3O9QA 4KREA 3RVCA 3VA0A 1YXQA 4KPYA 2YV0X 3L8BA 1FKOA 5LMUK 1HX1A 3T19A 3ENBA 4DV5K 1QZ5A 4CFCA 3CJ1A 4C23A 5HLFA 1XC3A 4BRMA 1TVRA 2E88A 3PIPL 4B08A 1MWMA 1EETA 3G71N 5BR8K 2RPIA 2QTDA 2O4GA 3TSPA 3QEVA 2ZM6K 1VQ9N 2YI1A 3TTFA 3K5OA 4YOTA 2YHYA 4IG0A 4OPKA 3QERA 3KZBA 1VAZA 1ZXOA 4CEEA 4WF9L 2WTUA 1ZBSA 3CMEN 5DMRA 3NF6A 3VN5A 4DR5K 4XH5A 3AVJA 4B8AB 5M1OA 5CR4A 1NK8A 1HJOA 3QEPA 1RILA 3ENHA 3IUCA 4ILJA 4FJHA 2P9LA 3THWA 2HBKA 3VQ9A 1ATRA 3LDNA 2ASMA 2KZMA 4FM1A 1L3TA 4E3SA 4JV5K 1QHTA 3O4QA 3TI0A 4QOZB 1OKJA 3NF7A 3PX4A 4Z0UA 5KRTA 3PSIA 3S9HA 4KB1A 4M3TA 5EX5A 1JLQA 3BUZB 4CHOA 3AVFA 4XEIA 1HKGA 3ZSVA 1A5XA 3KKRA 4BVPA 4CEQA 1TUUA 1H1VA 1SQKA 3ZSYA 3U9DA 5KRSA 3KJVA 5CHIA 2P9SB 1QQOA 3AVGA 3RWUA 3LDOA 1ZBLA 1S3XA 4FJJA 1GOBA 3VQ5A 4XIUA 4LFAK 1HYZA 4CIGA 2JGUA 3LDPA 1QQMA 4O55A 3WXKA 4BRPA 2J4RA 5AQKA 3CFOA 2DFFA 1IH7A 4DQSA 3K9KA 4KAZA 3EKUA 2JWLA 3D7EO 1KVAA 3I33A 1EO1A 1HRHA 2X6SA 3VQQA 4OGCA 1BGXT 3CQYA 5J2QA 4ELVA 4AH9A 1J53A 2FSKA 3FZKA 3TAQA 1Z05A 3LM9A 3HPHA 1UA1A 3IRXA 3A5NC 5I9EB 1SL0A 1XNRK 2ZD1A 4CBUA 4B3SK 4RTFD 4FWKA 1NGHA 2KTQA 3MX5A 5HRSA 4C8LA 2IVNA 1K6YA 3K58A 3R9PA 3CF5L 1DT9A 4FWNA 3SV4A 4DTOA 3HPOA 2F8SA 3UKRB 1R0AA 4BQZA 1RBTA 4B9UA 2HMIA 4KRFA 3MAQA 3SPZA 4BRLA 4DR4K 2G8FA 1TK8A 4FZZA 2QWRA 4BC5A 2ATQA 3CFRA 4FOEA 3HM9A 3KK1A 1U6ZA 4KTWA 2IS3A 4CZJA 3RRHA 4JKAA 3P5JA 2VWJA 4CFBA 4KI4A 1RT4A 1VSFA 3CYMA 4FWMA 4IFVA 2RN2A 4PKIA 3CPEA 5HROA 3DM2A 1UAXA 5KQDA 1BI4A 3CCRN 3CQ8A 3U6FA 3VENA 4I7FA 1WSIA 1GLBG 3NVKA 3FE1A 4FLWA 1RNHA 5ELZA 3HZ6A 3CQXA 3MEEA 4WQ4A 4FJXA 2AP1A 4DMNA 3E01A 3PLAA 5ADXH 1O1WA 3PUFA 5KTQA 2H3GX 5KI6A 2UXDK 3V9XA 4B3OA 1JLAA 4EZ6A 5M1KA 2A41A 1U2VA 4LFCK 4KHSA 4BRQA 4YOVA 1I3AA 5M1PA 4NB4A 1VSHA 4CJ7A 1ZC6A 4Z4IA 4WFAL 5C10A 4QS9A 3J7ZO 4CHNA 4FJ5A 3C6HA 4HUFA 4IFEA 3AO3A 5LY3A 2DFHA 4H4MA 3CCSN 3C95A 1HQEA 2EWSA 3QLHA 4CF2A 5GADP 3NAEA 2F9TA 4FO0A 4DTSA 3L3VA 3LL3A 4B1VA 2NUBA 3L2WA 3ZT3A 2O8EB 5BPLA 4OX9K 2GEMA 1RBVA 3T1AA 2KKZA 5J2NA 2CH6A 1OH7A 4QCLA 1ATNA 2GUPA 5LJVA 3ZX2A 2Z1HA 3EO3A 1LWCA 1NGIA 2A6AA 4J8FA 4LF7K 3PIOL 2QEXN 1KSPA 4RWTA 2VG5A 1GLJO 2HBMA 3DRPA 1TKZA 1LWFA 1CXUA 4JHDB 2NRVA 4CJFA 4DF4A 3HI0A 4DWIA 3HM8A 3QBWA 3RTVA 5HL7L 2P9KA 3KKSA 4CE9A 1N33K 3AVHA 1TK0A 3J80O 5GAHP 3IKMA 2Z1JA 3AA4A 1NGEA 3C7NA 3P31A 5JS1A 3ENOA 5AQVA 2LSNA 1GOAA 4KTZA 3LAMA 2G8UA 1TYQA 4LH4A 1J5OA 1BA0A 3CJ7A 1SKRA 2XY8A 4AQYK 5AQIA 2W6LA 1N34K 5GINA 3O4NA 3ZETA 3FZLA 1HNZK 4KHQA 4LF9K 1VSJA 4JI2K 1U45A 4HTLA 4JI6K 2NRRA 3EEQA 5AR0A 1C0GA 4RW6A 3FFKB 4U67L 5M1FA 4PUOA 4PQUA 4F3TA 2VWBA 5FRNA 3N4QA 4HUGA 3THXA 3U9ZA 2NRWA 3QNOA 2E2QA 1VSKA 3ZEUA 4IDHA 1UWBA 5BPNA 2ZWHA 5AZIA 2HHVA 4DUYK 4JAXA 3VQPA 3LALA 5LL6Z 3QBXA 3GG4A 1RDWX 4ID5A 2ZGYA 3O1WA 5TKYA 3BP8A 4OVLA 4BDPA 5E41A 4JI3K 1Y97A 2GV9A 3SBGA 2YHBA 2F9WA 3QICA 5AQHA 3HSCA 3OYGA 3P83D
chains in the Genus database with same CATH topology
4OJRA 1SL1A 4F2RA 1BQMA 2FBXA 3LZIA 2KFZA 5JS2A 4TSXA 1CLQA 3HJFA 3LP0A 1TAQA 4FJKA 5HRNA 1Z26A 1XHZA 3PY8A 3NGZA 4ICLA 3SJJA 4Y1DA 4KV8A 2E6LA 3VQAA 3T3FA 2P51A 4E0DA 4O0JA 1N6QA 3CM5A 3K5LA 1VRUA 4K8ZA 1B9DA 3TAFA 2FC0A 3QEWA 4CJSA 1NKBA 4FJ8A 1BIUA 2A1SA 4E7KA 1WN7A 1X1PA 4CJTA 3V6DA 1KLMA 2HB5A 4CJVA 3LWLA 1YTUA 3OYMA 1JLFA 5K14A 1LW2A 2ZQBA 4AILC 4B9NA 1WLJA 1LW0A 4KKOA 3NCIA 4DQQA 2P5OA 4ZTJA 1FKPA 4J2BA 4E7IA 4BWMA 1W9HA 1S1UA 4C8MA 1U49A 2RF2A 4Z4GA 2KFNA 4BE0A 4G1QA 3K2PA 4CIFA 2HHWA 4E7HA 3ZSWA 1QS4A 1IKYA 1U48A 3OS1A 1NK7A 4L8RB 3DOKA 1SKSA 1KVBA 3PO5A 4DLEA 1TAUA 3THVA 4J2AA 3ISNC 2I5JA 2VWKA 4FXDA 4FYDA 4Z4HA 4DTXA 3U3YA 3BGRA 4DSFA 4O4GA 4EP5A 3OYBA 4Z4EA 2ITGA 4FJ9A 2Z1GA 4M45A 4CEAA 1KCFA 1N5YA 4W5NA 3D0PA 2OPPA 4PA1A 1L3UA 4DFPA 4DLGA 2DTUA 3LP2A 4CK2A 1RBRA 4DS4A 2HVHA 1D8YA 3HT3A 4F8RA 4CF8A 1HYVA 1NJZA 1WSGA 4N5SA 2IC3A 1WAFA 1S9EA 4FLYA 2HNYA 1IKWA 1JLEA 2HHXA 1VSIA 1HPZA 3CG7A 4DTRA 1NJXA 4FK4A 1JXEA 3DLEA 4OLBA 1SV5A 3S3OA 1NK4A 4FM0A 4C8OA 5C24A 3ZT0A 4DU1A 4ELTA 1C1BA 2XY7A 4AHVA 4E89A 4BACA 1TV6A 4HCBA 4YFUA 3OYAA 4KO0A 3AVAA 3KLEA 4FLUA 3SUNA 3MEGA 3TANA 1RT3A 1ITGA 2X6NA 3DRRA 3SUOA 3WNEA 1BISA 3QIOA 3K59A 3SNNA 3AVIA 1ASWA 2PZSA 4CGGA 3RMAA 4OKKA 5KGWA 3ZT4A 1TKTA 3O3FA 3OYCA 3DLRA 3DYAA 3SV3A 3V81A 1QSSA 2OYQA 3C6UA 3M8SA 5D3GA 1WAJA 1B92A 3MXJA 4I2PA 4JRQA 1S9GA 1YTAA 4M3RA 3ULDA 3QETA 3SUQA 4KREA 3VA0A 4MFBA 2KW4A 1HNVA 3SZ2A 4B9LA 3O3GA 4KPYA 3JSMA 1WSHA 3HP9A 2XRIA 4KHYA 4FJIA 2EHGA 3OYDA 2HW3A 1C6VA 2YV0X 3L8BA 1FKOA 4Z4FA 3SPYA 4PY5A 3NF8A 3S3MA 3T19A 4DTNA 1Z25A 1ASUA 3KIOA 1L3SA 1YVUA 4CEFA 4CJ3A 4CFCA 1FXXA 4E7LA 1BI4B 1SUQA 5HLFA 4CEOA 1QE1A 3B6OA 2E6MA 5CY4A 4FJGA 2HHSA 4R5PA 1JLCA 3V1QA 1VK0A 1T03A 3KD1E 3EY1A 1JKHA 2EX3A 1TVRA 3ALYA 4IG3A 3OJUA 1DLOA 3HO1A 4FM2A 4B08A 3FFIA 1ASVA 1EETA 3LANA 1ZBIA 1XHXA 3AA5X 3G0ZA 3NH1A 3RRGA 4KB0A 2RPIA 3DLGA 4WE1A 1KRPA 1RTIA 5CYMA 2O4GA 5KGXA 4O5BA 3SQ2A 2P5GA 3ZCMA 4FLVA 3QEVA 3DLHA 5CYQA 2Z1IA 4Y1CA 3K5OA 1S1TA 2B6AA 3CFPA 1WSFA 1EXQA 2KQ2A 1CZBA 3SI6A 4LSLA 3AO5A 4IG0A 4OPKA 1VSEA 4CFAA 3OJSA 3QERA 1IKVA 1JL1A 2G8KA 3MECA 4CEEA 4N47A 2O4IA 4DS5A 1HMVA 1X9MA 3KTQA 3ITHA 3M8QA 3IG1A 4FW2A 5DMRA 2QXFA 3NF6A 3QINA 1S6PA 3VN5A 4DFKA 4CJ5A 3KLGA 3AVJA 4B8AB 3K5MA 4DU4A 2YHAA 2RKIA 1NK8A 3ASMA 3CM6A 3ZSRA 1J54A 3L2QA 3QEPA 1RILA 3HK2A 3AV9A 4CJQA 4FJHA 2QKBA 1GOCA 4ZHRA 1C1CA 3VQ9A 4JS5A 4AHCA 4NCBA 2FBTA 3L2UA 1ZBUA 2KZMA 2OPSA 2G8WA 3DI6A 3SQ4A 3VQ8A 4FM1A 3OVNA 3MXIA 1L3TA 4W5QA 4E3SA 1KTQA 1QHTA 1JLBA 1JLGA 3AA2A 3DMJA 3O4QA 3M8RA 3TI0A 3C6TA 4B9MA 4QOZB 4KHNA 1LAWA 1Q9YA 4FZYA 3TAGA 3VQ6A 4FJNA 3AVNA 1RT2A 3NF7A 4RW4A 2HNZA 4QAGA 4Z0UA 3PX4A 1HJRA 4IFYA 4I9LA 3ZSOA 5KRTA 3L2RA 3LDSA 3NH2A 3TABA 3S9HA 1X9WA 4KB1A 1L3VA 4M3TA 1JLQA 3KK3A 3HVTA 4B8CA 4H4OA 4CGIA 3AVFA 4CHOA 5I42A 4FVMA 3NF9A 3AO4A 1EKEA 4CF0A 3TAEA 2OZMA 1S1XA 2HNDA 3ZSVA 1MU2A 1A5XA 3AA3A 3HVRA 3V9ZA 1KLNA 4M3ZA 3KKRA 4CEQA 4CEZA 4ZTFA 3DLKA 3ZSYA 5KRSA 3KJVA 4CJKA 3F73A 3OYKA 2JLEA 3AVGA 3RWUA 1T05A 1ZBLA 4FJJA 3RR8A 1G15A 1GOBA 3TARA 3VQ5A 1UOCA 4CF9A 4XIUA 3K57A 2QK9A 1HYZA 4O0IA 3V9WA 2A1RA 3M8PA 4J2DA 4CIGA 2JGUA 3ZT2A 4O55A 4C8KA 4DFMA 4M3WA 2B4JA 5C42A 1A5WA 2HVIA 3CFOA 2DFFA 4O44A 4OKJA 1IH7A 4DQSA 4KAZA 1NK0A 3VQBA 4AHTA 3G10A 1KVAA 3OYLA 1HRHA 3LPUA 2Y1JA 2X6SA 3RR7A 4FJ7A 3VQQA 1Q8IA 1BGXT 4OGCA 4CECA 1RTDA 1TKXA 1VSMA 4N56A 4AH9A 5J2QA 4ELVA 1NJYA 1J53A 3SQ1A 3TAQA 1U04A 3L3UA 1NK9A 1RTJA 4N76A 3NBPA 4DSEA 2XO7A 3ZT1A 2YNFA 4CERA 3ZSQA 3HPHA 1BCMA 5HRPA 1UA1A 2ZE2A 3IRXA 1SL0A 4KFBA 3SQ0A 2ZD1A 1U4BA 4FJMA 5SWMA 4CJEA 2KTQA 3F9KA 3H08A 3I0SA 4I2QA 4CGFA 3NDKA 2BDPA 5HRSA 1T8EA 4BDYA 4ID1A 2PY5A 4C8LA 3TAMA 3TR8A 1K6YA 2VG7A 3K58A 3VQ7A 1C0TA 3C94A 3SV4A 4DTOA 2IAJA 1RT7A 3HPOA 2F8SA 4CIEA 4HTUA 1ZBFA 1R0AA 1WSEA 4E1NA 5C25A 4GW6A 1RBTA 4B9UA 1NK5A 3OS2A 2XY5A 1QQCA 3VA3A 1KFDA 3AO2A 4LD0A 3V1RA 4CJ4A 2XY6A 2HMIA 4RW8A 3IS9A 2HHTA 2HHQA 3LP3A 4KRFA 3MAQA 4W5OA 4UQGA 3SPZA 4JRPA 1RDDA 3WNHA 1NKEA 1I39A 3LAKA 1KVCA 3OYFA 4CJWA 1TK8A 1S5JA 2WONA 3HSTB 2IOCA 3OYJA 2G8FA 4FLZA 4FZZA 5J1EA 4FZXC 2ATQA 2Y1IA 3HXMA 3EYZA 4BE2A 3CFRA 3VQDA 2OZSA 3HM9A 1RDCA 1BCOA 2E4LA 1J9AA 3KK1A 4KTWA 3VQCA 2IS3A 4NYNA 4CK1A 3RRHA 1DTTA 1S6QA 3P5JA 2VWJA 1HYSA 2R7YA 4CFBA 1RDAA 4KI4A 4OKEA 1RT4A 1VSFA 3CYMA 3DLBA 1NJWA 3OYNA 4RW9A 4CGDA 1U47A 5FROA 4IFVA 3QESA 3D45A 4OPJA 2RN2A 3WNGA 1DTQA 3KK2A 5HROA 3NH0A 1VSLA 4DG1A 3V9UA 4J2EA 4C8NA 1IO2A 1W0HA 3DM2A 4DFJA 1UAXA 3K5NA 2IDOA 1BI4A 4CHYA 1LAVA 3KLHA 3CQ8A 3U6FA 1RT5A 4NCGA 2BGGA 3OY9A 4I7FA 2OPRA 3ZSZA 1TK5A 1D9DA 1WSIA 4DQPA 4FLWA 4HHTA 1RNHA 1HQUA 2FBYA 4OLAA 3MEEA 5CZ1A 4FJXA 4DMNA 3E01A 1RT1A 3QNNA 4DSKA 3AVBA 3A2FA 5HP1A 1O1WA 3PUFA 4DTMA 4RG8A 4DTPA 4IBNA 1CZ9A 5KI6A 5KTQA 1ZYQA 3V9XA 4E19A 1REVA 4CFDA 3L2VA 3ZSXA 4DSJA 1JLAA 2D5RA 4EZ6A 4B3OA 3BDPA 2YNIA 4GVMA 3I8DA 3QEIA 2VG6A 2W42A 4KHSA 4CK3A 1I3AA 1RDBA 4DU3A 1TL1A 1C0UA 4CEDA 4Q0BA 1VSHA 3SUPA 3HYFA 2BE2A 4BDZA 4Z4IA 2YNGA 3HL8A 4AHRA 1WSJA 4NYFA 2Q3SA 1T7PA 2KZZA 4CHNA 4FJ5A 4HUFA 3WNFA 3PX6A 2XHBA 1KFSA 4OGEA 3AO3A 2DFHA 4FW1A 4H4MA 3V4IA 1SKWA 3B6PA 1RTHA 3PX0A 3C95A 3U3GA 1NKCA 4B9TA 1ZBHA 1HQEA 4DQIA 1IKXA 5T7BA 4FLXA 2YKMA 4H8KA 3NE6A 5J2MA 1NOZA 5HRRA 3QLHA 3OYEA 3LZJA 4FK0A 3DRSA 3NHGA 4CF2A 3NAEA 2D0AA 2QKKA 2PYJA 4LSNA 4RW7A 4DTUA 4DTSA 3PO4A 3L3VA 3MXMA 2NUBA 3HP6A 3L2WA 4DTJA 4AHUA 5SZTA 3ZT3A 1L5UA 4DSLA 4FLTA 3RMCA 4DSIA 2DY4A 3HPGA 1RBVA 4CESA 4B9VA 4DQRA 4I9QA 4FK2A 4CGJA 1Q9XA 1WNSA 4MQ3A 5FDLA 3T1AA 4YNQA 4KHWA 5J2NA 4QCLA 1C0MA 4DF8A 1UA0A 4GMJB 4HUEA 4KTQA 1A5VA 4B9SA 1F21A 2Z1HA 1BIZA 4Z4CA 1LV5A 1LWCA 4CJPA 1QTMA 2YKNA 1KSPA 2VG5A 3AO1A 3DOLA 4EZ9A 4KHUA 3NGYA 2FBVA 3DRPA 1TKZA 1LWFA 1CXUA 5EU7A 2F96A 4CJFA 4DF4A 1D5AA 4DWIA 1EX4A 3RTVA 2OPQA 3KKSA 4CE9A 3AVHA 1TK0A 4EP4A 4N41A 5DK5A 1BQNA 2Z1JA 3AA4A 1VSDA 1NOYA 1CXQA 2GUIA 5JS1A 3OS0A 4NCAA 1LWEA 1GOAA 2LSNA 2ETJA 4KTZA 1VRTA 3LAMA 3NGIA 2G8UA 5CZ2A 4BE1A 2X74A 4LH4A 1J5OA 3AVLA 3TWHA 1SKRA 3QO9A 4FCYA 1JXBA 2XY8A 3I0RA 3VQEA 1X9SA 1RT6A 1TL3A 1IG9A 2AJQA 1S1WA 3V9SA 1RBSA 4M41A 3QEXA 3TAPA 2X78A 3VQ4A 2G8HA 3O4NA 4F3OA 4CF1A 4FJLA 4KHQA 4LH5A 1QSYA 4LY7A 3QIPA 2IGIA 1VSJA 1XC9A 3S3NA 2GBZA 1S1VA 2F8TA 3KLIA 3JYTA 3LP1A 1U45A 4CCHA 4ELUA 1BHLA 1RBUA 3SCXA 1SL2A 4M42A 4IDKA 4CHPA 5I3UA 1YT3A 3RMBA 1XWLA 4KI6A 1D9FA 4F2SA 4RW6A 4PQUA 4PUOA 3KD5E 3KLFA 4F3TA 2G8VA 3V1OA 4Q5VA 4HVJA 5FRNA 4HUGA 2P1JA 1FK9A 1BL3A 3P1GA 3MEDA 1RCHA 1XI1A 3QNOA 1EP4A 3SYZA 1B9FA 4CJLA 1VSKA 4CGHA 3AVCA 2D0BA 1UWBA 2BANA 4BWJA 2PYLA 3O3HA 4HCCA 4JLHA 4IKFA 4E7JA 3OYHA 2HHVA 2B5JA 4F4KA 4PWDA 3VQPA 4W5TA 3LWMA 1HNIA 3AVKA 3NFAA 3PV8A 3LALA 2HHUA 3OYIA 4CJRA 2WOMA 5J2PA 2YNHA 4ID5A 4CJUA 4AHSA 1QSLA 5FRMA 4CHZA 1JL2A 3EZ5A 1TGOA 4OVLA 4JS4A 4BDPA 5E41A 3IAYA 4M3XA 4CEBA 1Y97A 1NK6A 4K8XA 4M3YA 2GV9A 4CHQA 4E1MA 4M3UA 1C1AA 2DFEA 3UIQA 2YHBA 3LPTA 1TKDA 4W5RA 2D0CA 3OYGA 3RMDA 3P83D 3AVMA 2OA8A 5HBMA 2G8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJR A;  1SL1 A;  4F2R A;  1BQM A;  2FBX A;  3LZI A;  2KFZ A;  5JS2 A;  4TSX A;  1CLQ A;  3HJF A;  3LP0 A;  1TAQ A;  4FJK A;  5HRN A;  1Z26 A;  1XHZ A;  3PY8 A;  3NGZ A;  4ICL A;  3SJJ A;  4Y1D A;  4KV8 A;  2E6L A;  3VQA A;  3T3F A;  2P51 A;  4E0D A;  4O0J A;  1N6Q A;  3CM5 A;  3K5L A;  1VRU A;  4K8Z A;  1B9D A;  3TAF A;  2FC0 A;  3QEW A;  4CJS A;  1NKB A;  4FJ8 A;  1BIU A;  2A1S A;  4E7K A;  1WN7 A;  1X1P A;  4CJT A;  3V6D A;  1KLM A;  2HB5 A;  4CJV A;  3LWL A;  1YTU A;  3OYM A;  1JLF A;  5K14 A;  1LW2 A;  2ZQB A;  4AIL C;  4B9N A;  1WLJ A;  1LW0 A;  4KKO A;  3NCI A;  4DQQ A;  2P5O A;  4ZTJ A;  1FKP A;  4J2B A;  4E7I A;  4BWM A;  1W9H A;  1S1U A;  4C8M A;  1U49 A;  2RF2 A;  4Z4G A;  2KFN A;  4BE0 A;  4G1Q A;  3K2P A;  4CIF A;  2HHW A;  4E7H A;  3ZSW A;  1QS4 A;  1IKY A;  1U48 A;  3OS1 A;  1NK7 A;  4L8R B;  3DOK A;  1SKS A;  1KVB A;  3PO5 A;  4DLE A;  1TAU A;  3THV A;  4J2A A;  3ISN C;  2I5J A;  2VWK A;  4FXD A;  4FYD A;  4Z4H A;  4DTX A;  3U3Y A;  3BGR A;  4DSF A;  4O4G A;  4EP5 A;  3OYB A;  4Z4E A;  2ITG A;  4FJ9 A;  2Z1G A;  4M45 A;  4CEA A;  1KCF A;  1N5Y A;  4W5N A;  3D0P A;  2OPP A;  4PA1 A;  1L3U A;  4DFP A;  4DLG A;  2DTU A;  3LP2 A;  4CK2 A;  1RBR A;  4DS4 A;  2HVH A;  1D8Y A;  3HT3 A;  4F8R A;  4CF8 A;  1HYV A;  1NJZ A;  1WSG A;  4N5S A;  2IC3 A;  1WAF A;  1S9E A;  4FLY A;  2HNY A;  1IKW A;  1JLE A;  2HHX A;  1VSI A;  1HPZ A;  3CG7 A;  4DTR A;  1NJX A;  4FK4 A;  1JXE A;  3DLE A;  4OLB A;  1SV5 A;  3S3O A;  1NK4 A;  4FM0 A;  4C8O A;  5C24 A;  3ZT0 A;  4DU1 A;  4ELT A;  1C1B A;  2XY7 A;  4AHV A;  4E89 A;  4BAC A;  1TV6 A;  4HCB A;  4YFU A;  3OYA A;  4KO0 A;  3AVA A;  3KLE A;  4FLU A;  3SUN A;  3MEG A;  3TAN A;  1RT3 A;  1ITG A;  2X6N A;  3DRR A;  3SUO A;  3WNE A;  1BIS A;  3QIO A;  3K59 A;  3SNN A;  3AVI A;  1ASW A;  2PZS A;  4CGG A;  3RMA A;  4OKK A;  5KGW A;  3ZT4 A;  1TKT A;  3O3F A;  3OYC A;  3DLR A;  3DYA A;  3SV3 A;  3V81 A;  1QSS A;  2OYQ A;  3C6U A;  3M8S A;  5D3G A;  1WAJ A;  1B92 A;  3MXJ A;  4I2P A;  4JRQ A;  1S9G A;  1YTA A;  4M3R A;  3ULD A;  3QET A;  3SUQ A;  4KRE A;  3VA0 A;  4MFB A;  2KW4 A;  1HNV A;  3SZ2 A;  4B9L A;  3O3G A;  4KPY A;  3JSM A;  1WSH A;  3HP9 A;  2XRI A;  4KHY A;  4FJI A;  2EHG A;  3OYD A;  2HW3 A;  1C6V A;  2YV0 X;  3L8B A;  1FKO A;  4Z4F A;  3SPY A;  4PY5 A;  3NF8 A;  3S3M A;  3T19 A;  4DTN A;  1Z25 A;  1ASU A;  3KIO A;  1L3S A;  1YVU A;  4CEF A;  4CJ3 A;  4CFC A;  1FXX A;  4E7L A;  1BI4 B;  1SUQ A;  5HLF A;  4CEO A;  1QE1 A;  3B6O A;  2E6M A;  5CY4 A;  4FJG A;  2HHS A;  4R5P A;  1JLC A;  3V1Q A;  1VK0 A;  1T03 A;  3KD1 E;  3EY1 A;  1JKH A;  2EX3 A;  1TVR A;  3ALY A;  4IG3 A;  3OJU A;  1DLO A;  3HO1 A;  4FM2 A;  4B08 A;  3FFI A;  1ASV A;  1EET A;  3LAN A;  1ZBI A;  1XHX A;  3AA5 X;  3G0Z A;  3NH1 A;  3RRG A;  4KB0 A;  2RPI A;  3DLG A;  4WE1 A;  1KRP A;  1RTI A;  5CYM A;  2O4G A;  5KGX A;  4O5B A;  3SQ2 A;  2P5G A;  3ZCM A;  4FLV A;  3QEV A;  3DLH A;  5CYQ A;  2Z1I A;  4Y1C A;  3K5O A;  1S1T A;  2B6A A;  3CFP A;  1WSF A;  1EXQ A;  2KQ2 A;  1CZB A;  3SI6 A;  4LSL A;  3AO5 A;  4IG0 A;  4OPK A;  1VSE A;  4CFA A;  3OJS A;  3QER A;  1IKV A;  1JL1 A;  2G8K A;  3MEC A;  4CEE A;  4N47 A;  2O4I A;  4DS5 A;  1HMV A;  1X9M A;  3KTQ A;  3ITH A;  3M8Q A;  3IG1 A;  4FW2 A;  5DMR A;  2QXF A;  3NF6 A;  3QIN A;  1S6P A;  3VN5 A;  4DFK A;  4CJ5 A;  3KLG A;  3AVJ A;  4B8A B;  3K5M A;  4DU4 A;  2YHA A;  2RKI A;  1NK8 A;  3ASM A;  3CM6 A;  3ZSR A;  1J54 A;  3L2Q A;  3QEP A;  1RIL A;  3HK2 A;  3AV9 A;  4CJQ A;  4FJH A;  2QKB A;  1GOC A;  4ZHR A;  1C1C A;  3VQ9 A;  4JS5 A;  4AHC A;  4NCB A;  2FBT A;  3L2U A;  1ZBU A;  2KZM A;  2OPS A;  2G8W A;  3DI6 A;  3SQ4 A;  3VQ8 A;  4FM1 A;  3OVN A;  3MXI A;  1L3T A;  4W5Q A;  4E3S A;  1KTQ A;  1QHT A;  1JLB A;  1JLG A;  3AA2 A;  3DMJ A;  3O4Q A;  3M8R A;  3TI0 A;  3C6T A;  4B9M A;  4QOZ B;  4KHN A;  1LAW A;  1Q9Y A;  4FZY A;  3TAG A;  3VQ6 A;  4FJN A;  3AVN A;  1RT2 A;  3NF7 A;  4RW4 A;  2HNZ A;  4QAG A;  4Z0U A;  3PX4 A;  1HJR A;  4IFY A;  4I9L A;  3ZSO A;  5KRT A;  3L2R A;  3LDS A;  3NH2 A;  3TAB A;  3S9H A;  1X9W A;  4KB1 A;  1L3V A;  4M3T A;  1JLQ A;  3KK3 A;  3HVT A;  4B8C A;  4H4O A;  4CGI A;  3AVF A;  4CHO A;  5I42 A;  4FVM A;  3NF9 A;  3AO4 A;  1EKE A;  4CF0 A;  3TAE A;  2OZM A;  1S1X A;  2HND A;  3ZSV A;  1MU2 A;  1A5X A;  3AA3 A;  3HVR A;  3V9Z A;  1KLN A;  4M3Z A;  3KKR A;  4CEQ A;  4CEZ A;  4ZTF A;  3DLK A;  3ZSY A;  5KRS A;  3KJV A;  4CJK A;  3F73 A;  3OYK A;  2JLE A;  3AVG A;  3RWU A;  1T05 A;  1ZBL A;  4FJJ A;  3RR8 A;  1G15 A;  1GOB A;  3TAR A;  3VQ5 A;  1UOC A;  4CF9 A;  4XIU A;  3K57 A;  2QK9 A;  1HYZ A;  4O0I A;  3V9W A;  2A1R A;  3M8P A;  4J2D A;  4CIG A;  2JGU A;  3ZT2 A;  4O55 A;  4C8K A;  4DFM A;  4M3W A;  2B4J A;  5C42 A;  1A5W A;  2HVI A;  3CFO A;  2DFF A;  4O44 A;  4OKJ A;  1IH7 A;  4DQS A;  4KAZ A;  1NK0 A;  3VQB A;  4AHT A;  3G10 A;  1KVA A;  3OYL A;  1HRH A;  3LPU A;  2Y1J A;  2X6S A;  3RR7 A;  4FJ7 A;  3VQQ A;  1Q8I A;  1BGX T;  4OGC A;  4CEC A;  1RTD A;  1TKX A;  1VSM A;  4N56 A;  4AH9 A;  5J2Q A;  4ELV A;  1NJY A;  1J53 A;  3SQ1 A;  3TAQ A;  1U04 A;  3L3U A;  1NK9 A;  1RTJ A;  4N76 A;  3NBP A;  4DSE A;  2XO7 A;  3ZT1 A;  2YNF A;  4CER A;  3ZSQ A;  3HPH A;  1BCM A;  5HRP A;  1UA1 A;  2ZE2 A;  3IRX A;  1SL0 A;  4KFB A;  3SQ0 A;  2ZD1 A;  1U4B A;  4FJM A;  5SWM A;  4CJE A;  2KTQ A;  3F9K A;  3H08 A;  3I0S A;  4I2Q A;  4CGF A;  3NDK A;  2BDP A;  5HRS A;  1T8E A;  4BDY A;  4ID1 A;  2PY5 A;  4C8L A;  3TAM A;  3TR8 A;  1K6Y A;  2VG7 A;  3K58 A;  3VQ7 A;  1C0T A;  3C94 A;  3SV4 A;  4DTO A;  2IAJ A;  1RT7 A;  3HPO A;  2F8S A;  4CIE A;  4HTU A;  1ZBF A;  1R0A A;  1WSE A;  4E1N A;  5C25 A;  4GW6 A;  1RBT A;  4B9U A;  1NK5 A;  3OS2 A;  2XY5 A;  1QQC A;  3VA3 A;  1KFD A;  3AO2 A;  4LD0 A;  3V1R A;  4CJ4 A;  2XY6 A;  2HMI A;  4RW8 A;  3IS9 A;  2HHT A;  2HHQ A;  3LP3 A;  4KRF A;  3MAQ A;  4W5O A;  4UQG A;  3SPZ A;  4JRP A;  1RDD A;  3WNH A;  1NKE A;  1I39 A;  3LAK A;  1KVC A;  3OYF A;  4CJW A;  1TK8 A;  1S5J A;  2WON A;  3HST B;  2IOC A;  3OYJ A;  2G8F A;  4FLZ A;  4FZZ A;  5J1E A;  4FZX C;  2ATQ A;  2Y1I A;  3HXM A;  3EYZ A;  4BE2 A;  3CFR A;  3VQD A;  2OZS A;  3HM9 A;  1RDC A;  1BCO A;  2E4L A;  1J9A A;  3KK1 A;  4KTW A;  3VQC A;  2IS3 A;  4NYN A;  4CK1 A;  3RRH A;  1DTT A;  1S6Q A;  3P5J A;  2VWJ A;  1HYS A;  2R7Y A;  4CFB A;  1RDA A;  4KI4 A;  4OKE A;  1RT4 A;  1VSF A;  3CYM A;  3DLB A;  1NJW A;  3OYN A;  4RW9 A;  4CGD A;  1U47 A;  5FRO A;  4IFV A;  3QES A;  3D45 A;  4OPJ A;  2RN2 A;  3WNG A;  1DTQ A;  3KK2 A;  5HRO A;  3NH0 A;  1VSL A;  4DG1 A;  3V9U A;  4J2E A;  4C8N A;  1IO2 A;  1W0H A;  3DM2 A;  4DFJ A;  1UAX A;  3K5N A;  2IDO A;  1BI4 A;  4CHY A;  1LAV A;  3KLH A;  3CQ8 A;  3U6F A;  1RT5 A;  4NCG A;  2BGG A;  3OY9 A;  4I7F A;  2OPR A;  3ZSZ A;  1TK5 A;  1D9D A;  1WSI A;  4DQP A;  4FLW A;  4HHT A;  1RNH A;  1HQU A;  2FBY A;  4OLA A;  3MEE A;  5CZ1 A;  4FJX A;  4DMN A;  3E01 A;  1RT1 A;  3QNN A;  4DSK A;  3AVB A;  3A2F A;  5HP1 A;  1O1W A;  3PUF A;  4DTM A;  4RG8 A;  4DTP A;  4IBN A;  1CZ9 A;  5KI6 A;  5KTQ A;  1ZYQ A;  3V9X A;  4E19 A;  1REV A;  4CFD A;  3L2V A;  3ZSX A;  4DSJ A;  1JLA A;  2D5R A;  4EZ6 A;  4B3O A;  3BDP A;  2YNI A;  4GVM A;  3I8D A;  3QEI A;  2VG6 A;  2W42 A;  4KHS A;  4CK3 A;  1I3A A;  1RDB A;  4DU3 A;  1TL1 A;  1C0U A;  4CED A;  4Q0B A;  1VSH A;  3SUP A;  3HYF A;  2BE2 A;  4BDZ A;  4Z4I A;  2YNG A;  3HL8 A;  4AHR A;  1WSJ A;  4NYF A;  2Q3S A;  1T7P A;  2KZZ A;  4CHN A;  4FJ5 A;  4HUF A;  3WNF A;  3PX6 A;  2XHB A;  1KFS A;  4OGE A;  3AO3 A;  2DFH A;  4FW1 A;  4H4M A;  3V4I A;  1SKW A;  3B6P A;  1RTH A;  3PX0 A;  3C95 A;  3U3G A;  1NKC A;  4B9T A;  1ZBH A;  1HQE A;  4DQI A;  1IKX A;  5T7B A;  4FLX A;  2YKM A;  4H8K A;  3NE6 A;  5J2M A;  1NOZ A;  5HRR A;  3QLH A;  3OYE A;  3LZJ A;  4FK0 A;  3DRS A;  3NHG A;  4CF2 A;  3NAE A;  2D0A A;  2QKK A;  2PYJ A;  4LSN A;  4RW7 A;  4DTU A;  4DTS A;  3PO4 A;  3L3V A;  3MXM A;  2NUB A;  3HP6 A;  3L2W A;  4DTJ A;  4AHU A;  5SZT A;  3ZT3 A;  1L5U A;  4DSL A;  4FLT A;  3RMC A;  4DSI A;  2DY4 A;  3HPG A;  1RBV A;  4CES A;  4B9V A;  4DQR A;  4I9Q A;  4FK2 A;  4CGJ A;  1Q9X A;  1WNS A;  4MQ3 A;  5FDL A;  3T1A A;  4YNQ A;  4KHW A;  5J2N A;  4QCL A;  1C0M A;  4DF8 A;  1UA0 A;  4GMJ B;  4HUE A;  4KTQ A;  1A5V A;  4B9S A;  1F21 A;  2Z1H A;  1BIZ A;  4Z4C A;  1LV5 A;  1LWC A;  4CJP A;  1QTM A;  2YKN A;  1KSP A;  2VG5 A;  3AO1 A;  3DOL A;  4EZ9 A;  4KHU A;  3NGY A;  2FBV A;  3DRP A;  1TKZ A;  1LWF A;  1CXU A;  5EU7 A;  2F96 A;  4CJF A;  4DF4 A;  1D5A A;  4DWI A;  1EX4 A;  3RTV A;  2OPQ A;  3KKS A;  4CE9 A;  3AVH A;  1TK0 A;  4EP4 A;  4N41 A;  5DK5 A;  1BQN A;  2Z1J A;  3AA4 A;  1VSD A;  1NOY A;  1CXQ A;  2GUI A;  5JS1 A;  3OS0 A;  4NCA A;  1LWE A;  1GOA A;  2LSN A;  2ETJ A;  4KTZ A;  1VRT A;  3LAM A;  3NGI A;  2G8U A;  5CZ2 A;  4BE1 A;  2X74 A;  4LH4 A;  1J5O A;  3AVL A;  3TWH A;  1SKR A;  3QO9 A;  4FCY A;  1JXB A;  2XY8 A;  3I0R A;  3VQE A;  1X9S A;  1RT6 A;  1TL3 A;  1IG9 A;  2AJQ A;  1S1W A;  3V9S A;  1RBS A;  4M41 A;  3QEX A;  3TAP A;  2X78 A;  3VQ4 A;  2G8H A;  3O4N A;  4F3O A;  4CF1 A;  4FJL A;  4KHQ A;  4LH5 A;  1QSY A;  4LY7 A;  3QIP A;  2IGI A;  1VSJ A;  1XC9 A;  3S3N A;  2GBZ A;  1S1V A;  2F8T A;  3KLI A;  3JYT A;  3LP1 A;  1U45 A;  4CCH A;  4ELU A;  1BHL A;  1RBU A;  3SCX A;  1SL2 A;  4M42 A;  4IDK A;  4CHP A;  5I3U A;  1YT3 A;  3RMB A;  1XWL A;  4KI6 A;  1D9F A;  4F2S A;  4RW6 A;  4PQU A;  4PUO A;  3KD5 E;  3KLF A;  4F3T A;  2G8V A;  3V1O A;  4Q5V A;  4HVJ A;  5FRN A;  4HUG A;  2P1J A;  1FK9 A;  1BL3 A;  3P1G A;  3MED A;  1RCH A;  1XI1 A;  3QNO A;  1EP4 A;  3SYZ A;  1B9F A;  4CJL A;  1VSK A;  4CGH A;  3AVC A;  2D0B A;  1UWB A;  2BAN A;  4BWJ A;  2PYL A;  3O3H A;  4HCC A;  4JLH A;  4IKF A;  4E7J A;  3OYH A;  2HHV A;  2B5J A;  4F4K A;  4PWD A;  3VQP A;  4W5T A;  3LWM A;  1HNI A;  3AVK A;  3NFA A;  3PV8 A;  3LAL A;  2HHU A;  3OYI A;  4CJR A;  2WOM A;  5J2P A;  2YNH A;  4ID5 A;  4CJU A;  4AHS A;  1QSL A;  5FRM A;  4CHZ A;  1JL2 A;  3EZ5 A;  1TGO A;  4OVL A;  4JS4 A;  4BDP A;  5E41 A;  3IAY A;  4M3X A;  4CEB A;  1Y97 A;  1NK6 A;  4K8X A;  4M3Y A;  2GV9 A;  4CHQ A;  4E1M A;  4M3U A;  1C1A A;  2DFE A;  3UIQ A;  2YHB A;  3LPT A;  1TKD A;  4W5R A;  2D0C A;  3OYG A;  3RMD A;  3P83 D;  3AVM A;  2OA8 A;  5HBM A;  2G8I A; 
#chains in the Genus database with same CATH topology
 4F2R A;  1BQM A;  3H3N O;  4Y0W A;  4ICL A;  4JI8 K;  4KV8 A;  2UXB K;  4O0J A;  3UKU A;  2FF3 B;  1B9D A;  3T69 A;  1BIU A;  2RHK A;  2BUP A;  3CCU N;  4NO7 A;  3LWL A;  4BRD A;  1YTU A;  3OYM A;  2V7Z A;  5K14 A;  2GEL A;  2ZQB A;  1LW0 A;  3NCI A;  4J2B A;  1U49 A;  1W9H A;  3K2P A;  5GIO A;  4H0P A;  3R3L A;  4DCH A;  1U48 A;  4L8R B;  3AY9 A;  3ISN C;  4FWO A;  3U3Y A;  4O8K A;  4CI6 A;  1XNQ K;  4H0T B;  4DR2 K;  3VER A;  4YHH K;  1NGB A;  5JVG L;  4DLG A;  1Q82 O;  1D8Y A;  1HYV A;  3C7N B;  5KQ8 A;  4N5S A;  2IC3 A;  3AGK A;  4JKB A;  1JLE A;  2HHX A;  3AAQ A;  1VSI A;  4FK4 A;  3T1Y K;  1TYQ B;  1SV5 A;  3BF1 A;  4BG8 A;  3S3O A;  4CBX A;  4C8O A;  3ZT0 A;  1VQ6 N;  3DXK A;  4CZF A;  2XY7 A;  1ATS A;  4MO4 A;  3OYA A;  4KO0 A;  3BF3 A;  3ZET B;  1K8K B;  3SUN A;  4IJN A;  3TAN A;  3SUO A;  2X6N A;  1KXP A;  3SBT A;  4OKK A;  4O5F A;  3C6U A;  3FGU A;  1B92 A;  1K8A O;  3H46 O;  3S41 A;  4MFB A;  2KW4 A;  3THX B;  2OAN A;  3DWL A;  3O3G A;  3JSM A;  1WSH A;  3HP9 A;  2EHG A;  2HW3 A;  1C6V A;  3K0S A;  4H0V B;  5AZJ A;  4DR7 K;  3MWT A;  3S3M A;  4DV7 K;  5FPN A;  1WBB A;  4CJ3 A;  1SUQ A;  4CEO A;  3B6O A;  4FJG A;  4R5P A;  2VQF K;  3KD1 E;  1VQL N;  2QWN A;  1NNE A;  1JKH A;  1NM1 A;  5AQP A;  2P9I A;  3M6G A;  5LJW A;  3MN7 A;  5JVH L;  1O13 A;  2A42 A;  3AA5 X;  3G0Z A;  3RRG A;  3ULE A;  3DLG A;  1KRP A;  5CYM A;  3SQ2 A;  2P9N A;  4O5B A;  5BN8 A;  3ZCM A;  4FLV A;  2Z1I A;  2B6A A;  3CFP A;  4IZ9 A;  2KQ2 A;  3H1V X;  2G8K A;  1VSE A;  2NRH A;  3A5L C;  3EE9 A;  3MDQ A;  2O4I A;  3DAW A;  4DS5 A;  3M8Q A;  4GNI A;  3IG1 A;  4PKG A;  5BR9 A;  4JKD A;  3VTH A;  4DFK A;  4CJ5 A;  4GKJ K;  2FSN A;  3K5M A;  2YHA A;  2RKI A;  3CJC A;  3ZSR A;  3L2Q A;  4CZK A;  3HK2 A;  5M1Q A;  1GOC A;  4ZHR A;  3JAM O;  3L6Q A;  3SAF A;  5H1S Q;  4PL8 A;  2VGN A;  3OBW A;  2G8W A;  4DB3 A;  3SQ4 A;  1JLG A;  3M8R A;  4B9M A;  1LAW A;  1Q9Y A;  3VEO A;  3VQ6 A;  3O8M A;  1BDG A;  1RT2 A;  1VQ8 N;  4JI4 K;  4I9L A;  3L2R A;  3VOV A;  2OTL N;  5BRF A;  1WB9 A;  3KK3 A;  3LM2 A;  4CGI A;  1KD1 O;  1WOQ A;  3HVR A;  3V9Z A;  4B1Y B;  3A0I X;  3O08 A;  3DLK A;  4CJK A;  2DPN A;  1T05 A;  2KHO A;  3CPW M;  4CF9 A;  4O0I A;  2A1R A;  4J2D A;  4DV0 K;  3KWG A;  1E4F T;  4C8K A;  3DLL L;  3DXK B;  5JLF A;  1P90 A;  4O44 A;  3CJA A;  2IVP A;  4AHT A;  3G10 A;  3OYL A;  1Q81 O;  3RR7 A;  1Q8I A;  5LMN K;  4N56 A;  4YOU A;  1U04 A;  1RTJ A;  3NBP A;  1X9J A;  3ZT1 A;  1BCM A;  2ZE2 A;  3LDQ A;  3SQ0 A;  2KLA A;  3FZF A;  4CJE A;  3BEX A;  3O9T A;  4I2Q A;  4CGF A;  4ID1 A;  3H6E A;  2VG7 A;  3Q7C A;  3VQ7 A;  2IAJ A;  4WQ5 C;  1WSE A;  5C25 A;  1S22 A;  3QFP A;  4PKH A;  3OS2 A;  1QQC A;  3VA3 A;  3AO2 A;  3V1R A;  1NU0 A;  2HHT A;  3IS9 A;  2HHQ A;  4CZE A;  4JKC A;  1RDD A;  3LAK A;  4CJW A;  1S5J A;  2WON A;  2IOC A;  4XH1 A;  5J1E A;  3EN9 A;  2OZS A;  4L3Q A;  1HLU A;  1BCO A;  3VF6 A;  4CK1 A;  4GVE A;  1HYS A;  4MDA A;  1RDA A;  4FWQ A;  4FWL A;  4OKE A;  1NJW A;  3B8A X;  4RW9 A;  4CGD A;  1U47 A;  1IJJ A;  2E1Z A;  4OPJ A;  2D1K A;  4MLE A;  3TTD A;  2ZJQ L;  3DJC A;  1G99 A;  3NH0 A;  1VSL A;  2AA4 A;  4BRA A;  1W0H A;  4BQL A;  4DFJ A;  3BZC A;  4H03 B;  2IDO A;  4X66 K;  4CHY A;  3K5N A;  3KLH A;  3OW2 M;  3MMV A;  1QVF M;  4NCG A;  5JIC A;  2BGG A;  3KVG A;  2NRT A;  1TK5 A;  1D9D A;  3VPZ A;  1HQU A;  3CXC M;  1WBD A;  1WUA A;  3D2F B;  3QNN A;  4DSK A;  4CBW A;  5HP1 A;  4RG8 A;  2ZGZ A;  2YX6 A;  3HO1 A;  4IOX A;  4GVM A;  1VHX A;  4DU3 A;  4LF6 K;  1TL1 A;  1C0U A;  3CER A;  4CED A;  1V4S A;  4BDZ A;  1JCF A;  2YNG A;  2Q3S A;  1T7P A;  4R79 A;  3WNF A;  1X3M A;  1J6Z A;  4FW1 A;  3B6P A;  4BR2 A;  1YJ9 N;  1ZBH A;  3O80 A;  4DQI A;  4B3M K;  2W40 A;  4YDU A;  4JK9 A;  5AQL A;  4H8K A;  1NOZ A;  3OYE A;  4JKF A;  2CGL A;  3TU5 A;  4B9Q A;  4FK0 A;  2QKK A;  2PYJ A;  4RW7 A;  3PO4 A;  3G6E N;  4M7X A;  4DKW A;  2VGM A;  3AAR A;  4DSI A;  2DY4 A;  3HPG A;  3T7Z A;  4CGJ A;  1Q9X A;  1WNS A;  4MQ3 A;  2O8F B;  4KHW A;  4KTQ A;  4GMJ B;  3I56 N;  3F9M A;  1Q7Y O;  3H3O B;  4Z4C A;  1LV5 A;  4BRE A;  1BUP A;  2YKN A;  3OTO K;  1T3V A;  3DOL A;  4YOX A;  3WQT A;  1MDU B;  4KHU A;  2FBV A;  5C15 A;  5EU7 A;  5AQT A;  2F96 A;  3C0B A;  2OPQ A;  4B1U B;  5AQS A;  5AQW A;  2NLX A;  4EP4 A;  1VSD A;  3HOT A;  1CXQ A;  3VET A;  4CVN E;  1IBL K;  1LWE A;  2ETJ A;  1VRT A;  2X74 A;  4YOW A;  4NLC A;  3TWH A;  1VQM N;  1TL3 A;  2AJQ A;  1RBS A;  4M41 A;  2X78 A;  3AAP A;  1QSY A;  1NGJ A;  2GWK A;  1BWF O;  3JYT A;  1S72 N;  3LP1 A;  1RBU A;  4M42 A;  4BC3 A;  1RDU A;  5I3U A;  3RMB A;  1XWL A;  3FLC O;  4B1W B;  4F2S A;  2HF3 A;  2G8V A;  3V1O A;  4EIA A;  1BL3 A;  1NGA A;  3MED A;  3P1G A;  4NXN K;  3TPQ A;  4CGH A;  3AVC A;  2D0B A;  2BAN A;  4K0K K;  4HCC A;  4JLH A;  4IKF A;  4H5N A;  2P9L B;  2RE2 A;  3THW B;  4ISE A;  1VQK N;  3OBY A;  5AJ3 K;  3PV8 A;  4ILG B;  2HHU A;  2WOM A;  5AQF A;  1IBK K;  1TGO A;  5GAG P;  3WUH A;  4K8X A;  4E1M A;  1C1A A;  2DFE A;  3KK7 A;  3UIQ A;  4BRF A;  1TKD A;  5ADX A;  1VQP N;  4B3T K;  5HBM A;  3SCX A;  1SL1 A;  3ZX3 A;  1M90 O;  4GV9 A;  2FBX A;  3LZI A;  2WFB A;  5HRN A;  1BOT O;  4CZG A;  3SJJ A;  3AGR A;  3VQA A;  3A5M C;  2P51 A;  1N6Q A;  3CM5 A;  2CGJ A;  4K8Z A;  3TAF A;  5GAE P;  2FC0 A;  4M7Y A;  3WXI A;  4CJS A;  1NKB A;  5E26 A;  1YHQ N;  4JKH A;  3V6D A;  4OPA A;  3O9S A;  4IEE A;  2P5O A;  3WT0 A;  1EQY A;  2ZJP L;  1S1U A;  3CET A;  4C8M A;  4Z4G A;  2P9U A;  3CC7 N;  2FF6 A;  4E7H A;  2HHW A;  3ZSW A;  1IKY A;  3PO5 A;  1XUP O;  2P9P A;  4IJA A;  4ILH A;  4J2A A;  4DTX A;  3UB5 A;  4IOA L;  5C2F A;  1GLD G;  2PBD A;  3HTV A;  2YJF A;  3WXL A;  2Z1G A;  4M45 A;  1N5Y A;  1K9M O;  3D0P A;  2OPP A;  4DFP A;  2DTU A;  2HVH A;  4DQ8 A;  2YHW A;  4F8R A;  1OH8 A;  4BRG A;  1NJZ A;  3CD6 N;  1WAF A;  1S9E A;  4FPB A;  4BRH A;  3TSU A;  3IFR A;  1HPZ A;  4DTR A;  1NJX A;  1JXE A;  1NK4 A;  4A61 A;  1T6C A;  4DU1 A;  3CMA N;  4E89 A;  4BAC A;  2ASP A;  3KWI A;  4JKG A;  5F1X A;  4X65 K;  4FLU A;  3MEG A;  1RT3 A;  1ITG A;  3VEX A;  3WNE A;  1NMD A;  3QIO A;  1KAZ A;  3SNN A;  3AVI A;  5AQJ A;  1YAG A;  3J81 O;  3OA9 A;  3VEY A;  1GLC G;  4CGG A;  5KGW A;  3O3F A;  1TKT A;  3DYA A;  1T44 A;  4K42 A;  4E1J A;  1WAJ A;  4I2P A;  3QET A;  1YTA A;  5FPD A;  4F9O A;  5MLC Q;  1HKC A;  1HNV A;  3ATU A;  5TKW A;  2XRI A;  4KHY A;  4BR7 A;  4FJI A;  3VF2 A;  4JD2 A;  4Z4F A;  4PY5 A;  5CE3 A;  3J7A P;  4DTN A;  1XMO K;  1ASU A;  2PFU A;  1FXX A;  1BI4 B;  5AQU A;  2FLO A;  3HRG A;  5CY4 A;  3V1Q A;  3QFU A;  3EY1 A;  2EX3 A;  3ALY A;  1GLE G;  5AQN A;  3OJU A;  4CZM A;  1DLO A;  3LAN A;  4KB0 A;  4WE1 A;  3M1F A;  5KGX A;  2Q31 A;  4BRI A;  5CYQ A;  4Y1C A;  1YJN N;  1U2V B;  3NVM A;  3OJS A;  4CFA A;  1ILY A;  2OTJ N;  1IKV A;  1JL1 A;  3MEC A;  1HMV A;  1X9M A;  3O4W A;  1T6D A;  3ITH A;  4FW2 A;  2QXF A;  5FPE A;  3KLG A;  4DU4 A;  1BA1 A;  1VQN N;  1J54 A;  5BRH A;  4B1X B;  4I6M A;  2Q0U A;  4CD1 A;  4MO5 A;  4CJQ A;  1GLF O;  4FSV A;  2V52 B;  1C1C A;  4JS5 A;  2FBT A;  3L2U A;  1ZBU A;  3GBT A;  3ZX0 A;  3DI6 A;  3VQ8 A;  3OVN A;  4KH6 A;  3AA2 A;  2P9U B;  3C6T A;  3MN6 A;  3DXM A;  4FJN A;  4QAG A;  4BRK A;  5KPZ A;  3ZSO A;  3LDS A;  2WC9 A;  2HBJ A;  1X9W A;  3MCA B;  3HVT A;  4B8C A;  5I42 A;  2QM1 A;  1KAY A;  4CZI A;  5AQZ A;  2OZM A;  1MU2 A;  4EHU A;  3VMF B;  4ZTF A;  2D0O A;  2HHH K;  1M1K O;  3OYK A;  2JLE A;  1KAX A;  5C0Y A;  3RR8 A;  1G15 A;  3CC2 N;  3K57 A;  2P9K B;  2WUS A;  4Z94 A;  4IXC A;  4K25 A;  4M3W A;  3CC4 N;  2B4J A;  3THY A;  1A5W A;  4OKJ A;  1NK0 A;  4EAH D;  1N32 K;  1HUX A;  2Y1J A;  3LPU A;  3ID8 A;  4IOC L;  4CEC A;  4DR1 K;  1TKX A;  1N36 K;  5BRE A;  3SQ1 A;  4QS8 A;  2YNF A;  4BVO A;  3ZSQ A;  3D2E A;  5HRP A;  1R59 O;  4KFB A;  4BR4 A;  2W6K A;  1U4B A;  4FJM A;  3MX2 A;  4NLB A;  1LOT B;  2JWK A;  4DV3 K;  5C12 A;  1T8E A;  5B8H A;  4BDY A;  3G4S N;  2VCP A;  2PY5 A;  4OO1 J;  5FLX O;  3TR8 A;  2YJE A;  4GKK K;  3WQU A;  3ZEU B;  4CIE A;  4HTU A;  1SZ2 A;  1W97 L;  4E1N A;  5AZI B;  4GW6 A;  1NGD A;  3WXM B;  1NK5 A;  2XY5 A;  1KFD A;  4A2B A;  4LD0 A;  5F2R A;  2O8D A;  3LP3 A;  4W5O A;  3U4L A;  3OHR A;  4JRP A;  2FSJ A;  3OYF A;  1KVC A;  3HST B;  4WQ5 A;  3VES A;  2GWJ A;  4BE2 A;  3VQD A;  4A57 A;  2E4L A;  5EXW A;  4CD3 A;  2PAV A;  3DLB A;  3K9J A;  3OYN A;  1NG9 A;  5BPM A;  1JCE A;  3FZH A;  1OH5 A;  1MA9 B;  1DTQ A;  3JXU A;  3KK2 A;  4DG1 A;  5KPR A;  4CW7 B;  5IT9 O;  3JS6 A;  1XQS C;  5BN9 A;  1LAV A;  3UKU B;  1NJI O;  4FWR A;  3OY9 A;  4BR5 A;  2OPR A;  4DQP A;  3N4P A;  4HHT A;  2FBY A;  4OLA A;  5CZ1 A;  3BY5 A;  5DM6 L;  3R6M A;  1RT1 A;  1KC8 O;  3AVB A;  3A2F A;  2NZT A;  4BRC A;  4DTP A;  4E19 A;  5F0X A;  3L2V A;  1I94 K;  4DSJ A;  2D5R A;  3BDP A;  3I8D A;  3QEI A;  2VG6 A;  2W42 A;  2O8C A;  4CK3 A;  1RDB A;  3RSE A;  4Q0B A;  3QML A;  3SUP A;  3CCL N;  2BE2 A;  3HL8 A;  1WSJ A;  4CZH A;  4NYF A;  2KZZ A;  2IIR A;  4AM6 A;  5AFU H;  3PX6 A;  1SKW A;  3PX0 A;  1NGF A;  2Q2R A;  2QWL A;  3U3G A;  1NKC A;  4H0X B;  1IKX A;  5T7B A;  2CGK A;  5J2M A;  5HRR A;  1Q86 O;  3FZM A;  3DRS A;  4LSN A;  4DTU A;  4U7B A;  3MXM A;  4H5T A;  4C1N I;  4IEI A;  1L5U A;  4DSL A;  2NRZ A;  4G9Z A;  4B9V A;  4I9Q A;  4DQR A;  4FK2 A;  1CZA N;  4KH5 A;  5FDL A;  4YNQ A;  1YVN A;  1C0M A;  1UA0 A;  5EOY A;  3IMX A;  4B9S A;  4LFB K;  4EZ9 A;  3NGY A;  4NXM K;  2P9S A;  2E1Y A;  1D5A A;  3P4I A;  3SAG A;  1KQS M;  2VQE K;  1N8R O;  3SK3 A;  4BGA A;  1NOY A;  5AZJ B;  2GUI A;  5AQM A;  3NGI A;  2HMP A;  2F7T A;  5CZ2 A;  4BE1 A;  3ATV A;  1JXB A;  3I0R A;  3UE5 A;  1S1W A;  3TAP A;  3VQ4 A;  1P8Z A;  2G8H A;  4JYA K;  4CF1 A;  2P9I B;  1E3M A;  4LH5 A;  4LY7 A;  2HST A;  2Q36 A;  3ULE B;  1XC9 A;  2HOE A;  2GBZ A;  2F8T A;  3KLI A;  2P9N B;  4CCH A;  2OCE A;  3BZK A;  5C2D A;  3A5O C;  4IDK A;  1FW6 A;  1YT3 A;  3CJB A;  4FL9 A;  3J7Y P;  3HOS A;  3KD5 E;  5FPM A;  1FK9 A;  2Q1N A;  4UY8 O;  4C1N K;  1NBW A;  2QW9 A;  4EFH A;  1EP4 A;  1B9F A;  4CJL A;  3SLC A;  4BWJ A;  2PYL A;  3UKR A;  1NGC A;  4W5T A;  3LWM A;  4KBO A;  3EE8 A;  3AVK A;  3NFA A;  4IO8 A;  3SMS A;  3OYI A;  5J2P A;  4RCH A;  4ISG A;  4CJU A;  4AHS A;  1QSL A;  4JS4 A;  3IAY A;  4M3X A;  3CCM N;  4JI1 K;  4CEB A;  4M3Y A;  3L0Q A;  2O8C B;  4CHQ A;  1E4G T;  4M3U A;  3RSE B;  1YIJ N;  4W5R A;  4X64 K;  3RMD A;  3AVM A;  2I7P A;  2G8I A;  2Q0R A;  4H5R A;  4AF1 A;  4TSX A;  1TAQ A;  1OH6 A;  1XHZ A;  3NGZ A;  4BY9 C;  4Y1D A;  3CIP A;  3VGL A;  4O8U A;  1VRU A;  2QWO A;  3F5T A;  1OVY A;  5HOO A;  4FJ8 A;  4KH4 A;  1WN7 A;  1X1P A;  4E7K A;  3VF4 A;  1JLF A;  3U8X A;  1BO5 O;  1LW2 A;  4B9N A;  1WLJ A;  4DQQ A;  4KKO A;  2BTF A;  2UU9 K;  4BE0 A;  4G1Q A;  1RGI A;  2GTD A;  4GV6 A;  3MCP A;  1QS4 A;  1NK7 A;  3DOK A;  1KVB A;  3GE1 A;  4DLE A;  3C65 A;  5DM7 L;  4Z4H A;  4O4G A;  5AQO A;  4EP5 A;  4Z4E A;  4FJ9 A;  4W5N A;  1KCF A;  4BC2 A;  4A62 A;  2IVO A;  1L3U A;  1EWQ A;  4GY2 B;  4PHT X;  1DKG D;  4DS4 A;  3HT3 A;  1WSG A;  3W0L A;  3CG7 A;  2O8E A;  3CHW A;  4YOY A;  4FM0 A;  3WXJ A;  4JI0 K;  1TV6 A;  3EKS A;  1NGG A;  3I55 N;  4LF5 K;  1X3N A;  4YY3 K;  1ASW A;  2PZS A;  3RMA A;  1JCG A;  2QWM A;  3OYC A;  2A40 A;  3SV3 A;  1Q18 A;  3DLR A;  3V81 A;  1RFQ A;  4JHD A;  2OYQ A;  3M8S A;  3PSF A;  4DR3 K;  1W2B M;  4NCB A;  5D3G A;  4M3R A;  3ULD A;  2V51 B;  3SUQ A;  3GOI A;  3SZ2 A;  4B9L A;  2Q97 A;  5EY4 A;  3OYD A;  4DV1 K;  2CH5 A;  3SPY A;  5A2Q O;  3NF8 A;  2VYP A;  1Z25 A;  2HF4 A;  3KIO A;  1L3S A;  1YVU A;  4CEF A;  4E7L A;  2E2P A;  1VQ4 N;  3ZYY X;  1QE1 A;  3CCJ N;  2E6M A;  5EVZ A;  4LC9 B;  2HHS A;  1JLC A;  1T03 A;  1VK0 A;  4CZL A;  4IG3 A;  1NLV A;  4FM2 A;  3FFI A;  1ASV A;  1ZBI A;  1XHX A;  3NH1 A;  1SAZ A;  4PL7 A;  1RTI A;  3TTC A;  2P5G A;  4WFN L;  3DLH A;  3WEE A;  1ESV A;  1S1T A;  1WSF A;  1EXQ A;  3SI6 A;  1CZB A;  4LSL A;  3AO5 A;  4MLH A;  3CI5 A;  2GX9 A;  4H5W A;  4N47 A;  4GV3 A;  2D0P A;  4MDB A;  5JLH A;  3KTQ A;  3VEZ A;  3G25 A;  1J5E K;  3QIN A;  4IWV A;  1S6P A;  3VGK A;  5M1N A;  1TAU A;  1GLL O;  3SAH A;  3ASM A;  3CM6 A;  4B3R K;  3AV9 A;  2QKB A;  2QWP A;  4AHC A;  5AQQ A;  4QS7 A;  2OPS A;  2E2N A;  4JI7 K;  3MXI A;  4W5Q A;  1KTQ A;  1JLB A;  3DMJ A;  5KPT A;  4KHN A;  4FZY A;  3TAG A;  3AVN A;  4RW4 A;  5AQY A;  4B1Z A;  2HNZ A;  1NKE A;  1HJR A;  4IFY A;  4YDU C;  4ISF A;  3NH2 A;  3TAB A;  1L3V A;  4HWI A;  1NWK A;  4X62 K;  4H4O A;  4FVM A;  3NF9 A;  3AO4 A;  3IDH A;  1EKE A;  4CF0 A;  3TAE A;  3CCQ N;  1S1X A;  2HND A;  1KLN A;  3AA3 A;  1HR0 K;  4M3Z A;  1YUW A;  4CEZ A;  3QDK A;  2E8A A;  4H0Y B;  1QVG M;  3F73 A;  3SMP A;  1TUY A;  3CCE N;  5AQG A;  4FPA A;  4FOI A;  3TAR A;  1UOC A;  2QK9 A;  3V9W A;  3M8P A;  3ZT2 A;  4IO9 L;  1EWR A;  4DHY A;  3H1Q A;  5GIP A;  4DFM A;  5C42 A;  3VEV A;  2HVI A;  3O5B A;  1XMQ K;  4DV2 K;  3VQB A;  1IV0 A;  3VEW A;  2FXU A;  1YI2 N;  1YIT N;  4FJ7 A;  1JJ2 M;  5AQX A;  1IBM K;  1RTD A;  1VSM A;  3FR0 A;  2YHX A;  3R1X A;  1NJY A;  1MWK A;  1NK9 A;  3L3U A;  3E9P A;  4M63 C;  4N76 A;  2UUB K;  3O6W A;  4DSE A;  2XO7 A;  4CER A;  1K73 O;  3P39 A;  2QA4 N;  4JK7 A;  5SWM A;  2QXL A;  3F9K A;  3H08 A;  3I0S A;  3NDK A;  2BDP A;  3MK6 A;  1V4T A;  3TAM A;  1C0T A;  3C94 A;  1RT7 A;  3P38 A;  1ZBF A;  5JMV A;  1K8K A;  2NNW A;  4CJ4 A;  2XY6 A;  4FWP A;  4RW8 A;  4UQG A;  4DR6 K;  3WNH A;  1I39 A;  2ITM A;  3OYJ A;  4FLZ A;  3WEE B;  4FZX C;  2Y1I A;  3HXM A;  3EYZ A;  1RDC A;  1J9A A;  4A59 A;  3VQC A;  4NYN A;  2ZJR L;  1DTT A;  1S6Q A;  2R7Y A;  2HBL A;  4A5A A;  4KHP K;  5FRO A;  3QES A;  3E9L A;  3D45 A;  2UYT A;  3WNG A;  3E9O A;  5AQR A;  3V9U A;  4WQ4 C;  4C8N A;  4J2E A;  1IO2 A;  3MWP A;  1RT5 A;  3L4Q A;  2QI2 A;  3O1B A;  2V7Y A;  3ZSZ A;  2E2O A;  3M5R A;  2F4V K;  2W41 A;  2ZF5 O;  4H5V A;  1LCU A;  4DTM A;  1QZ6 A;  3D6R A;  4IBN A;  1CZ9 A;  1ZYQ A;  1REV A;  4CFD A;  3ZSX A;  2A5X A;  2YNI A;  4BRO A;  3HYF A;  2I7N A;  2P9P B;  3F2K A;  4AHR A;  2WBN A;  2XHB A;  1KFS A;  3Q7B A;  4OGE A;  1GLA G;  3V4I A;  2YCH A;  1RTH A;  4B9T A;  2D4W A;  4FLX A;  4JNE A;  3A8Y A;  2YKM A;  3NE6 A;  3LZJ A;  5E84 A;  3NHG A;  2D0A A;  4JI5 K;  2NRX A;  3HP6 A;  4DTJ A;  4AHU A;  5SZT A;  4FLT A;  4BR0 A;  3KHY A;  3RMC A;  1DEJ A;  4CES A;  2BH1 A;  5BRD A;  4BRN A;  2O8B A;  3SJH A;  4WFB L;  3W3D A;  4DF8 A;  4HUE A;  4JKG B;  1A5V A;  3GL1 A;  1F21 A;  1BIZ A;  4CJP A;  1QTM A;  4K41 A;  3AO1 A;  2UUC K;  2E5L K;  3TSQ A;  4DV4 K;  3E66 A;  1VQ5 N;  3MN9 A;  1EX4 A;  4N41 A;  5DK5 A;  1BQN A;  4FWS A;  1W7A A;  4JD2 B;  4WYB A;  4LF8 K;  3OS0 A;  4NCA A;  3AVL A;  3QO9 A;  2ASO A;  4FCY A;  3VQE A;  1X9S A;  1RT6 A;  2A3Z A;  1IG9 A;  4H0O A;  3V9S A;  3QEX A;  3MN5 A;  1Y64 A;  4F3O A;  4YOR A;  4FJL A;  3QIP A;  2IGI A;  3S3N A;  1S1V A;  4ELU A;  3O9R A;  1BHL A;  1BU6 O;  1SL2 A;  4CHP A;  3CCV N;  4KI6 A;  3QB0 A;  1D9F A;  3KLF A;  4Q5V A;  4HVJ A;  2P1J A;  1XI1 A;  1RCH A;  3SYZ A;  4LF4 K;  2UUA K;  3LDL A;  3GDQ A;  3O3H A;  3EL2 A;  4E7J A;  3OYH A;  4I6M B;  4A2A A;  4BR9 A;  2B5J A;  4F4K A;  4PWD A;  5IWA K;  4BG9 A;  4A5B A;  4CJR A;  2YNH A;  4BGB A;  5FRM A;  4CHZ A;  1JL2 A;  3EZ5 A;  1YJW N;  1HPM A;  1DGK N;  3DXM B;  1NK6 A;  1D4X A;  3LPT A;  1Z6R A;  1C0F A;  2D0C A;  3VTI A;  4OPH A;  1HNI A;  2OA8 A;  4OJR A;  3HBT A;  5JS2 A;  2KFZ A;  1CLQ A;  1VQ7 N;  3HJF A;  3LP0 A;  4FJK A;  1Z26 A;  3PY8 A;  1HNX K;  2E6L A;  3T3F A;  1NMN A;  4E0D A;  1QHA A;  4JK8 A;  3K5L A;  5AFU A;  3QEW A;  3NMU A;  2A1S A;  4CJT A;  1FJG K;  1KLM A;  2HB5 A;  4CJV A;  3R8E A;  2E20 A;  4FVU A;  3D2F A;  4AIL C;  3T1H K;  1FKP A;  4ZTJ A;  3THY B;  4E7I A;  4BWM A;  2KFN A;  2RF2 A;  2O8B B;  2QWQ A;  1QQN A;  4WCE L;  4CIF A;  3OS1 A;  4K43 A;  1SKS A;  3THV A;  3I8B A;  2I5J A;  2VWK A;  4FXD A;  4FYD A;  3BGR A;  4DSF A;  1IG8 A;  3OYB A;  2ITG A;  3M3Z A;  4CEA A;  3D2E B;  4PA1 A;  1HKB A;  3C6A A;  3LP2 A;  4CK2 A;  4JEP A;  1RBR A;  3E1Y A;  1OVQ A;  4CF8 A;  4DUZ K;  4V19 S;  3ZLJ A;  3CJ9 A;  4FLY A;  2HNY A;  1IKW A;  3DLE A;  1YF5 L;  4OLB A;  1VQO N;  5C24 A;  3EZW A;  4DV6 K;  4ELT A;  1C1B A;  3O9U A;  4JKE A;  1BG3 A;  4AHV A;  2O8F A;  4HCB A;  4YFU A;  1SS6 A;  3AVA A;  1HNW K;  3KLE A;  2UXC K;  3DRR A;  3L4I A;  2O8D B;  1BIS A;  3K59 A;  4AM7 A;  4XH4 A;  4EHT A;  4BC4 A;  3J8A A;  3VGM A;  3ZT4 A;  1QSS A;  3ID6 A;  3H45 C;  4JN4 A;  3MXJ A;  4JRQ A;  1S9G A;  3O9Q A;  4KRE A;  3RVC A;  3VA0 A;  1YXQ A;  4KPY A;  2YV0 X;  3L8B A;  1FKO A;  5LMU K;  1HX1 A;  3T19 A;  3ENB A;  4DV5 K;  1QZ5 A;  4CFC A;  3CJ1 A;  4C23 A;  5HLF A;  1XC3 A;  4BRM A;  1TVR A;  2E88 A;  3PIP L;  4B08 A;  1MWM A;  1EET A;  3G71 N;  5BR8 K;  2RPI A;  2QTD A;  2O4G A;  3TSP A;  3QEV A;  2ZM6 K;  1VQ9 N;  2YI1 A;  3TTF A;  3K5O A;  4YOT A;  2YHY A;  4IG0 A;  4OPK A;  3QER A;  3KZB A;  1VAZ A;  1ZXO A;  4CEE A;  4WF9 L;  2WTU A;  1ZBS A;  3CME N;  5DMR A;  3NF6 A;  3VN5 A;  4DR5 K;  4XH5 A;  3AVJ A;  4B8A B;  5M1O A;  5CR4 A;  1NK8 A;  1HJO A;  3QEP A;  1RIL A;  3ENH A;  3IUC A;  4ILJ A;  4FJH A;  2P9L A;  3THW A;  2HBK A;  3VQ9 A;  1ATR A;  3LDN A;  2ASM A;  2KZM A;  4FM1 A;  1L3T A;  4E3S A;  4JV5 K;  1QHT A;  3O4Q A;  3TI0 A;  4QOZ B;  1OKJ A;  3NF7 A;  3PX4 A;  4Z0U A;  5KRT A;  3PSI A;  3S9H A;  4KB1 A;  4M3T A;  5EX5 A;  1JLQ A;  3BUZ B;  4CHO A;  3AVF A;  4XEI A;  1HKG A;  3ZSV A;  1A5X A;  3KKR A;  4BVP A;  4CEQ A;  1TUU A;  1H1V A;  1SQK A;  3ZSY A;  3U9D A;  5KRS A;  3KJV A;  5CHI A;  2P9S B;  1QQO A;  3AVG A;  3RWU A;  3LDO A;  1ZBL A;  1S3X A;  4FJJ A;  1GOB A;  3VQ5 A;  4XIU A;  4LFA K;  1HYZ A;  4CIG A;  2JGU A;  3LDP A;  1QQM A;  4O55 A;  3WXK A;  4BRP A;  2J4R A;  5AQK A;  3CFO A;  2DFF A;  1IH7 A;  4DQS A;  3K9K A;  4KAZ A;  3EKU A;  2JWL A;  3D7E O;  1KVA A;  3I33 A;  1EO1 A;  1HRH A;  2X6S A;  3VQQ A;  4OGC A;  1BGX T;  3CQY A;  5J2Q A;  4ELV A;  4AH9 A;  1J53 A;  2FSK A;  3FZK A;  3TAQ A;  1Z05 A;  3LM9 A;  3HPH A;  1UA1 A;  3IRX A;  3A5N C;  5I9E B;  1SL0 A;  1XNR K;  2ZD1 A;  4CBU A;  4B3S K;  4RTF D;  4FWK A;  1NGH A;  2KTQ A;  3MX5 A;  5HRS A;  4C8L A;  2IVN A;  1K6Y A;  3K58 A;  3R9P A;  3CF5 L;  1DT9 A;  4FWN A;  3SV4 A;  4DTO A;  3HPO A;  2F8S A;  3UKR B;  1R0A A;  4BQZ A;  1RBT A;  4B9U A;  2HMI A;  4KRF A;  3MAQ A;  3SPZ A;  4BRL A;  4DR4 K;  2G8F A;  1TK8 A;  4FZZ A;  2QWR A;  4BC5 A;  2ATQ A;  3CFR A;  4FOE A;  3HM9 A;  3KK1 A;  1U6Z A;  4KTW A;  2IS3 A;  4CZJ A;  3RRH A;  4JKA A;  3P5J A;  2VWJ A;  4CFB A;  4KI4 A;  1RT4 A;  1VSF A;  3CYM A;  4FWM A;  4IFV A;  2RN2 A;  4PKI A;  3CPE A;  5HRO A;  3DM2 A;  1UAX A;  5KQD A;  1BI4 A;  3CCR N;  3CQ8 A;  3U6F A;  3VEN A;  4I7F A;  1WSI A;  1GLB G;  3NVK A;  3FE1 A;  4FLW A;  1RNH A;  5ELZ A;  3HZ6 A;  3CQX A;  3MEE A;  4WQ4 A;  4FJX A;  2AP1 A;  4DMN A;  3E01 A;  3PLA A;  5ADX H;  1O1W A;  3PUF A;  5KTQ A;  2H3G X;  5KI6 A;  2UXD K;  3V9X A;  4B3O A;  1JLA A;  4EZ6 A;  5M1K A;  2A41 A;  1U2V A;  4LFC K;  4KHS A;  4BRQ A;  4YOV A;  1I3A A;  5M1P A;  4NB4 A;  1VSH A;  4CJ7 A;  1ZC6 A;  4Z4I A;  4WFA L;  5C10 A;  4QS9 A;  3J7Z O;  4CHN A;  4FJ5 A;  3C6H A;  4HUF A;  4IFE A;  3AO3 A;  5LY3 A;  2DFH A;  4H4M A;  3CCS N;  3C95 A;  1HQE A;  2EWS A;  3QLH A;  4CF2 A;  5GAD P;  3NAE A;  2F9T A;  4FO0 A;  4DTS A;  3L3V A;  3LL3 A;  4B1V A;  2NUB A;  3L2W A;  3ZT3 A;  2O8E B;  5BPL A;  4OX9 K;  2GEM A;  1RBV A;  3T1A A;  2KKZ A;  5J2N A;  2CH6 A;  1OH7 A;  4QCL A;  1ATN A;  2GUP A;  5LJV A;  3ZX2 A;  2Z1H A;  3EO3 A;  1LWC A;  1NGI A;  2A6A A;  4J8F A;  4LF7 K;  3PIO L;  2QEX N;  1KSP A;  4RWT A;  2VG5 A;  1GLJ O;  2HBM A;  3DRP A;  1TKZ A;  1LWF A;  1CXU A;  4JHD B;  2NRV A;  4CJF A;  4DF4 A;  3HI0 A;  4DWI A;  3HM8 A;  3QBW A;  3RTV A;  5HL7 L;  2P9K A;  3KKS A;  4CE9 A;  1N33 K;  3AVH A;  1TK0 A;  3J80 O;  5GAH P;  3IKM A;  2Z1J A;  3AA4 A;  1NGE A;  3C7N A;  3P31 A;  5JS1 A;  3ENO A;  5AQV A;  2LSN A;  1GOA A;  4KTZ A;  3LAM A;  2G8U A;  1TYQ A;  4LH4 A;  1J5O A;  1BA0 A;  3CJ7 A;  1SKR A;  2XY8 A;  4AQY K;  5AQI A;  2W6L A;  1N34 K;  5GIN A;  3O4N A;  3ZET A;  3FZL A;  1HNZ K;  4KHQ A;  4LF9 K;  1VSJ A;  4JI2 K;  1U45 A;  4HTL A;  4JI6 K;  2NRR A;  3EEQ A;  5AR0 A;  1C0G A;  4RW6 A;  3FFK B;  4U67 L;  5M1F A;  4PUO A;  4PQU A;  4F3T A;  2VWB A;  5FRN A;  3N4Q A;  4HUG A;  3THX A;  3U9Z A;  2NRW A;  3QNO A;  2E2Q A;  1VSK A;  3ZEU A;  4IDH A;  1UWB A;  5BPN A;  2ZWH A;  5AZI A;  2HHV A;  4DUY K;  4JAX A;  3VQP A;  3LAL A;  5LL6 Z;  3QBX A;  3GG4 A;  1RDW X;  4ID5 A;  2ZGY A;  3O1W A;  5TKY A;  3BP8 A;  4OVL A;  4BDP A;  5E41 A;  4JI3 K;  1Y97 A;  2GV9 A;  3SBG A;  2YHB A;  2F9W A;  3QIC A;  5AQH A;  3HSC A;  3OYG A;  3P83 D; 
#chains in the Genus database with same CATH homology
 4OJR A;  1SL1 A;  4F2R A;  1BQM A;  2FBX A;  3LZI A;  2KFZ A;  5JS2 A;  4TSX A;  1CLQ A;  3HJF A;  3LP0 A;  1TAQ A;  4FJK A;  5HRN A;  1Z26 A;  1XHZ A;  3PY8 A;  3NGZ A;  4ICL A;  3SJJ A;  4Y1D A;  4KV8 A;  2E6L A;  3VQA A;  3T3F A;  2P51 A;  4E0D A;  4O0J A;  1N6Q A;  3CM5 A;  3K5L A;  1VRU A;  4K8Z A;  1B9D A;  3TAF A;  2FC0 A;  3QEW A;  4CJS A;  1NKB A;  4FJ8 A;  1BIU A;  2A1S A;  4E7K A;  1WN7 A;  1X1P A;  4CJT A;  3V6D A;  1KLM A;  2HB5 A;  4CJV A;  3LWL A;  1YTU A;  3OYM A;  1JLF A;  5K14 A;  1LW2 A;  2ZQB A;  4AIL C;  4B9N A;  1WLJ A;  1LW0 A;  4KKO A;  3NCI A;  4DQQ A;  2P5O A;  4ZTJ A;  1FKP A;  4J2B A;  4E7I A;  4BWM A;  1W9H A;  1S1U A;  4C8M A;  1U49 A;  2RF2 A;  4Z4G A;  2KFN A;  4BE0 A;  4G1Q A;  3K2P A;  4CIF A;  2HHW A;  4E7H A;  3ZSW A;  1QS4 A;  1IKY A;  1U48 A;  3OS1 A;  1NK7 A;  4L8R B;  3DOK A;  1SKS A;  1KVB A;  3PO5 A;  4DLE A;  1TAU A;  3THV A;  4J2A A;  3ISN C;  2I5J A;  2VWK A;  4FXD A;  4FYD A;  4Z4H A;  4DTX A;  3U3Y A;  3BGR A;  4DSF A;  4O4G A;  4EP5 A;  3OYB A;  4Z4E A;  2ITG A;  4FJ9 A;  2Z1G A;  4M45 A;  4CEA A;  1KCF A;  1N5Y A;  4W5N A;  3D0P A;  2OPP A;  4PA1 A;  1L3U A;  4DFP A;  4DLG A;  2DTU A;  3LP2 A;  4CK2 A;  1RBR A;  4DS4 A;  2HVH A;  1D8Y A;  3HT3 A;  4F8R A;  4CF8 A;  1HYV A;  1NJZ A;  1WSG A;  4N5S A;  2IC3 A;  1WAF A;  1S9E A;  4FLY A;  2HNY A;  1IKW A;  1JLE A;  2HHX A;  1VSI A;  1HPZ A;  3CG7 A;  4DTR A;  1NJX A;  4FK4 A;  1JXE A;  3DLE A;  4OLB A;  1SV5 A;  3S3O A;  1NK4 A;  4FM0 A;  4C8O A;  5C24 A;  3ZT0 A;  4DU1 A;  4ELT A;  1C1B A;  2XY7 A;  4AHV A;  4E89 A;  4BAC A;  1TV6 A;  4HCB A;  4YFU A;  3OYA A;  4KO0 A;  3AVA A;  3KLE A;  4FLU A;  3SUN A;  3MEG A;  3TAN A;  1RT3 A;  1ITG A;  2X6N A;  3DRR A;  3SUO A;  3WNE A;  1BIS A;  3QIO A;  3K59 A;  3SNN A;  3AVI A;  1ASW A;  2PZS A;  4CGG A;  3RMA A;  4OKK A;  5KGW A;  3ZT4 A;  1TKT A;  3O3F A;  3OYC A;  3DLR A;  3DYA A;  3SV3 A;  3V81 A;  1QSS A;  2OYQ A;  3C6U A;  3M8S A;  5D3G A;  1WAJ A;  1B92 A;  3MXJ A;  4I2P A;  4JRQ A;  1S9G A;  1YTA A;  4M3R A;  3ULD A;  3QET A;  3SUQ A;  4KRE A;  3VA0 A;  4MFB A;  2KW4 A;  1HNV A;  3SZ2 A;  4B9L A;  3O3G A;  4KPY A;  3JSM A;  1WSH A;  3HP9 A;  2XRI A;  4KHY A;  4FJI A;  2EHG A;  3OYD A;  2HW3 A;  1C6V A;  2YV0 X;  3L8B A;  1FKO A;  4Z4F A;  3SPY A;  4PY5 A;  3NF8 A;  3S3M A;  3T19 A;  4DTN A;  1Z25 A;  1ASU A;  3KIO A;  1L3S A;  1YVU A;  4CEF A;  4CJ3 A;  4CFC A;  1FXX A;  4E7L A;  1BI4 B;  1SUQ A;  5HLF A;  4CEO A;  1QE1 A;  3B6O A;  2E6M A;  5CY4 A;  4FJG A;  2HHS A;  4R5P A;  1JLC A;  3V1Q A;  1VK0 A;  1T03 A;  3KD1 E;  3EY1 A;  1JKH A;  2EX3 A;  1TVR A;  3ALY A;  4IG3 A;  3OJU A;  1DLO A;  3HO1 A;  4FM2 A;  4B08 A;  3FFI A;  1ASV A;  1EET A;  3LAN A;  1ZBI A;  1XHX A;  3AA5 X;  3G0Z A;  3NH1 A;  3RRG A;  4KB0 A;  2RPI A;  3DLG A;  4WE1 A;  1KRP A;  1RTI A;  5CYM A;  2O4G A;  5KGX A;  4O5B A;  3SQ2 A;  2P5G A;  3ZCM A;  4FLV A;  3QEV A;  3DLH A;  5CYQ A;  2Z1I A;  4Y1C A;  3K5O A;  1S1T A;  2B6A A;  3CFP A;  1WSF A;  1EXQ A;  2KQ2 A;  1CZB A;  3SI6 A;  4LSL A;  3AO5 A;  4IG0 A;  4OPK A;  1VSE A;  4CFA A;  3OJS A;  3QER A;  1IKV A;  1JL1 A;  2G8K A;  3MEC A;  4CEE A;  4N47 A;  2O4I A;  4DS5 A;  1HMV A;  1X9M A;  3KTQ A;  3ITH A;  3M8Q A;  3IG1 A;  4FW2 A;  5DMR A;  2QXF A;  3NF6 A;  3QIN A;  1S6P A;  3VN5 A;  4DFK A;  4CJ5 A;  3KLG A;  3AVJ A;  4B8A B;  3K5M A;  4DU4 A;  2YHA A;  2RKI A;  1NK8 A;  3ASM A;  3CM6 A;  3ZSR A;  1J54 A;  3L2Q A;  3QEP A;  1RIL A;  3HK2 A;  3AV9 A;  4CJQ A;  4FJH A;  2QKB A;  1GOC A;  4ZHR A;  1C1C A;  3VQ9 A;  4JS5 A;  4AHC A;  4NCB A;  2FBT A;  3L2U A;  1ZBU A;  2KZM A;  2OPS A;  2G8W A;  3DI6 A;  3SQ4 A;  3VQ8 A;  4FM1 A;  3OVN A;  3MXI A;  1L3T A;  4W5Q A;  4E3S A;  1KTQ A;  1QHT A;  1JLB A;  1JLG A;  3AA2 A;  3DMJ A;  3O4Q A;  3M8R A;  3TI0 A;  3C6T A;  4B9M A;  4QOZ B;  4KHN A;  1LAW A;  1Q9Y A;  4FZY A;  3TAG A;  3VQ6 A;  4FJN A;  3AVN A;  1RT2 A;  3NF7 A;  4RW4 A;  2HNZ A;  4QAG A;  4Z0U A;  3PX4 A;  1HJR A;  4IFY A;  4I9L A;  3ZSO A;  5KRT A;  3L2R A;  3LDS A;  3NH2 A;  3TAB A;  3S9H A;  1X9W A;  4KB1 A;  1L3V A;  4M3T A;  1JLQ A;  3KK3 A;  3HVT A;  4B8C A;  4H4O A;  4CGI A;  3AVF A;  4CHO A;  5I42 A;  4FVM A;  3NF9 A;  3AO4 A;  1EKE A;  4CF0 A;  3TAE A;  2OZM A;  1S1X A;  2HND A;  3ZSV A;  1MU2 A;  1A5X A;  3AA3 A;  3HVR A;  3V9Z A;  1KLN A;  4M3Z A;  3KKR A;  4CEQ A;  4CEZ A;  4ZTF A;  3DLK A;  3ZSY A;  5KRS A;  3KJV A;  4CJK A;  3F73 A;  3OYK A;  2JLE A;  3AVG A;  3RWU A;  1T05 A;  1ZBL A;  4FJJ A;  3RR8 A;  1G15 A;  1GOB A;  3TAR A;  3VQ5 A;  1UOC A;  4CF9 A;  4XIU A;  3K57 A;  2QK9 A;  1HYZ A;  4O0I A;  3V9W A;  2A1R A;  3M8P A;  4J2D A;  4CIG A;  2JGU A;  3ZT2 A;  4O55 A;  4C8K A;  4DFM A;  4M3W A;  2B4J A;  5C42 A;  1A5W A;  2HVI A;  3CFO A;  2DFF A;  4O44 A;  4OKJ A;  1IH7 A;  4DQS A;  4KAZ A;  1NK0 A;  3VQB A;  4AHT A;  3G10 A;  1KVA A;  3OYL A;  1HRH A;  3LPU A;  2Y1J A;  2X6S A;  3RR7 A;  4FJ7 A;  3VQQ A;  1Q8I A;  1BGX T;  4OGC A;  4CEC A;  1RTD A;  1TKX A;  1VSM A;  4N56 A;  4AH9 A;  5J2Q A;  4ELV A;  1NJY A;  1J53 A;  3SQ1 A;  3TAQ A;  1U04 A;  3L3U A;  1NK9 A;  1RTJ A;  4N76 A;  3NBP A;  4DSE A;  2XO7 A;  3ZT1 A;  2YNF A;  4CER A;  3ZSQ A;  3HPH A;  1BCM A;  5HRP A;  1UA1 A;  2ZE2 A;  3IRX A;  1SL0 A;  4KFB A;  3SQ0 A;  2ZD1 A;  1U4B A;  4FJM A;  5SWM A;  4CJE A;  2KTQ A;  3F9K A;  3H08 A;  3I0S A;  4I2Q A;  4CGF A;  3NDK A;  2BDP A;  5HRS A;  1T8E A;  4BDY A;  4ID1 A;  2PY5 A;  4C8L A;  3TAM A;  3TR8 A;  1K6Y A;  2VG7 A;  3K58 A;  3VQ7 A;  1C0T A;  3C94 A;  3SV4 A;  4DTO A;  2IAJ A;  1RT7 A;  3HPO A;  2F8S A;  4CIE A;  4HTU A;  1ZBF A;  1R0A A;  1WSE A;  4E1N A;  5C25 A;  4GW6 A;  1RBT A;  4B9U A;  1NK5 A;  3OS2 A;  2XY5 A;  1QQC A;  3VA3 A;  1KFD A;  3AO2 A;  4LD0 A;  3V1R A;  4CJ4 A;  2XY6 A;  2HMI A;  4RW8 A;  3IS9 A;  2HHT A;  2HHQ A;  3LP3 A;  4KRF A;  3MAQ A;  4W5O A;  4UQG A;  3SPZ A;  4JRP A;  1RDD A;  3WNH A;  1NKE A;  1I39 A;  3LAK A;  1KVC A;  3OYF A;  4CJW A;  1TK8 A;  1S5J A;  2WON A;  3HST B;  2IOC A;  3OYJ A;  2G8F A;  4FLZ A;  4FZZ A;  5J1E A;  4FZX C;  2ATQ A;  2Y1I A;  3HXM A;  3EYZ A;  4BE2 A;  3CFR A;  3VQD A;  2OZS A;  3HM9 A;  1RDC A;  1BCO A;  2E4L A;  1J9A A;  3KK1 A;  4KTW A;  3VQC A;  2IS3 A;  4NYN A;  4CK1 A;  3RRH A;  1DTT A;  1S6Q A;  3P5J A;  2VWJ A;  1HYS A;  2R7Y A;  4CFB A;  1RDA A;  4KI4 A;  4OKE A;  1RT4 A;  1VSF A;  3CYM A;  3DLB A;  1NJW A;  3OYN A;  4RW9 A;  4CGD A;  1U47 A;  5FRO A;  4IFV A;  3QES A;  3D45 A;  4OPJ A;  2RN2 A;  3WNG A;  1DTQ A;  3KK2 A;  5HRO A;  3NH0 A;  1VSL A;  4DG1 A;  3V9U A;  4J2E A;  4C8N A;  1IO2 A;  1W0H A;  3DM2 A;  4DFJ A;  1UAX A;  3K5N A;  2IDO A;  1BI4 A;  4CHY A;  1LAV A;  3KLH A;  3CQ8 A;  3U6F A;  1RT5 A;  4NCG A;  2BGG A;  3OY9 A;  4I7F A;  2OPR A;  3ZSZ A;  1TK5 A;  1D9D A;  1WSI A;  4DQP A;  4FLW A;  4HHT A;  1RNH A;  1HQU A;  2FBY A;  4OLA A;  3MEE A;  5CZ1 A;  4FJX A;  4DMN A;  3E01 A;  1RT1 A;  3QNN A;  4DSK A;  3AVB A;  3A2F A;  5HP1 A;  1O1W A;  3PUF A;  4DTM A;  4RG8 A;  4DTP A;  4IBN A;  1CZ9 A;  5KI6 A;  5KTQ A;  1ZYQ A;  3V9X A;  4E19 A;  1REV A;  4CFD A;  3L2V A;  3ZSX A;  4DSJ A;  1JLA A;  2D5R A;  4EZ6 A;  4B3O A;  3BDP A;  2YNI A;  4GVM A;  3I8D A;  3QEI A;  2VG6 A;  2W42 A;  4KHS A;  4CK3 A;  1I3A A;  1RDB A;  4DU3 A;  1TL1 A;  1C0U A;  4CED A;  4Q0B A;  1VSH A;  3SUP A;  3HYF A;  2BE2 A;  4BDZ A;  4Z4I A;  2YNG A;  3HL8 A;  4AHR A;  1WSJ A;  4NYF A;  2Q3S A;  1T7P A;  2KZZ A;  4CHN A;  4FJ5 A;  4HUF A;  3WNF A;  3PX6 A;  2XHB A;  1KFS A;  4OGE A;  3AO3 A;  2DFH A;  4FW1 A;  4H4M A;  3V4I A;  1SKW A;  3B6P A;  1RTH A;  3PX0 A;  3C95 A;  3U3G A;  1NKC A;  4B9T A;  1ZBH A;  1HQE A;  4DQI A;  1IKX A;  5T7B A;  4FLX A;  2YKM A;  4H8K A;  3NE6 A;  5J2M A;  1NOZ A;  5HRR A;  3QLH A;  3OYE A;  3LZJ A;  4FK0 A;  3DRS A;  3NHG A;  4CF2 A;  3NAE A;  2D0A A;  2QKK A;  2PYJ A;  4LSN A;  4RW7 A;  4DTU A;  4DTS A;  3PO4 A;  3L3V A;  3MXM A;  2NUB A;  3HP6 A;  3L2W A;  4DTJ A;  4AHU A;  5SZT A;  3ZT3 A;  1L5U A;  4DSL A;  4FLT A;  3RMC A;  4DSI A;  2DY4 A;  3HPG A;  1RBV A;  4CES A;  4B9V A;  4DQR A;  4I9Q A;  4FK2 A;  4CGJ A;  1Q9X A;  1WNS A;  4MQ3 A;  5FDL A;  3T1A A;  4YNQ A;  4KHW A;  5J2N A;  4QCL A;  1C0M A;  4DF8 A;  1UA0 A;  4GMJ B;  4HUE A;  4KTQ A;  1A5V A;  4B9S A;  1F21 A;  2Z1H A;  1BIZ A;  4Z4C A;  1LV5 A;  1LWC A;  4CJP A;  1QTM A;  2YKN A;  1KSP A;  2VG5 A;  3AO1 A;  3DOL A;  4EZ9 A;  4KHU A;  3NGY A;  2FBV A;  3DRP A;  1TKZ A;  1LWF A;  1CXU A;  5EU7 A;  2F96 A;  4CJF A;  4DF4 A;  1D5A A;  4DWI A;  1EX4 A;  3RTV A;  2OPQ A;  3KKS A;  4CE9 A;  3AVH A;  1TK0 A;  4EP4 A;  4N41 A;  5DK5 A;  1BQN A;  2Z1J A;  3AA4 A;  1VSD A;  1NOY A;  1CXQ A;  2GUI A;  5JS1 A;  3OS0 A;  4NCA A;  1LWE A;  1GOA A;  2LSN A;  2ETJ A;  4KTZ A;  1VRT A;  3LAM A;  3NGI A;  2G8U A;  5CZ2 A;  4BE1 A;  2X74 A;  4LH4 A;  1J5O A;  3AVL A;  3TWH A;  1SKR A;  3QO9 A;  4FCY A;  1JXB A;  2XY8 A;  3I0R A;  3VQE A;  1X9S A;  1RT6 A;  1TL3 A;  1IG9 A;  2AJQ A;  1S1W A;  3V9S A;  1RBS A;  4M41 A;  3QEX A;  3TAP A;  2X78 A;  3VQ4 A;  2G8H A;  3O4N A;  4F3O A;  4CF1 A;  4FJL A;  4KHQ A;  4LH5 A;  1QSY A;  4LY7 A;  3QIP A;  2IGI A;  1VSJ A;  1XC9 A;  3S3N A;  2GBZ A;  1S1V A;  2F8T A;  3KLI A;  3JYT A;  3LP1 A;  1U45 A;  4CCH A;  4ELU A;  1BHL A;  1RBU A;  3SCX A;  1SL2 A;  4M42 A;  4IDK A;  4CHP A;  5I3U A;  1YT3 A;  3RMB A;  1XWL A;  4KI6 A;  1D9F A;  4F2S A;  4RW6 A;  4PQU A;  4PUO A;  3KD5 E;  3KLF A;  4F3T A;  2G8V A;  3V1O A;  4Q5V A;  4HVJ A;  5FRN A;  4HUG A;  2P1J A;  1FK9 A;  1BL3 A;  3P1G A;  3MED A;  1RCH A;  1XI1 A;  3QNO A;  1EP4 A;  3SYZ A;  1B9F A;  4CJL A;  1VSK A;  4CGH A;  3AVC A;  2D0B A;  1UWB A;  2BAN A;  4BWJ A;  2PYL A;  3O3H A;  4HCC A;  4JLH A;  4IKF A;  4E7J A;  3OYH A;  2HHV A;  2B5J A;  4F4K A;  4PWD A;  3VQP A;  4W5T A;  3LWM A;  1HNI A;  3AVK A;  3NFA A;  3PV8 A;  3LAL A;  2HHU A;  3OYI A;  4CJR A;  2WOM A;  5J2P A;  2YNH A;  4ID5 A;  4CJU A;  4AHS A;  1QSL A;  5FRM A;  4CHZ A;  1JL2 A;  3EZ5 A;  1TGO A;  4OVL A;  4JS4 A;  4BDP A;  5E41 A;  3IAY A;  4M3X A;  4CEB A;  1Y97 A;  1NK6 A;  4K8X A;  4M3Y A;  2GV9 A;  4CHQ A;  4E1M A;  4M3U A;  1C1A A;  2DFE A;  3UIQ A;  2YHB A;  3LPT A;  1TKD A;  4W5R A;  2D0C A;  3OYG A;  3RMD A;  3P83 D;  3AVM A;  2OA8 A;  5HBM A;  2G8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...