1HRHA

Crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
125
Chain Sequence
b'YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBONUCLEASE H
publication title Crystal structure of the ribonuclease H domain of HIV-1 reverse transcriptase.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase(endoribonuclease)
total genus 37
structure length 125
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1991-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hrhA00
1HMVA 4FM0A 4Y1CA 1CZBA 4E19A 4KHNA 2Y1IA 4M41A 4YNQA 3KLEA 3AO3A 2KFNA 1TKXA 3CYMA 3V1OA 4N5SA 3NFAA 1QE1A 1XWLA 4B8CA 4IKFA 4BE2A 5I3UA 3RRHA 4L8RB 1KCFA 4CK2A 1S9EA 2BE2A 3AVKA 1X9SA 4CHQA 4FK2A 3AVCA 4DLGA 3LAMA 1MU2A 1REVA 3AA4A 3DLRA 3OJUA 4BWJA 4CGGA 5KRTA 3KK2A 4BE1A 1VRTA 3TAPA 4FJLA 2Y1JA 2IS3A 2VG5A 4FXDA 2IOCA 4CGJA 4AHUA 5E41A 1X9WA 4IG0A 3K2PA 4FLXA 3ISNC 3T3FA 4JRPA 3U6FA 4CJ4A 1UA1A 1TK8A 1WSGA 2ZQBA 1KFSA 5FROA 1KRPA 4CJVA 4DS5A 2F8SA 3AVIA 3S3MA 1NK0A 2OA8A 4W5TA 3VQ4A 2HHSA 2XRIA 4FVMA 4KAZA 1BIUA 2HHUA 1RDAA 1S1XA 4CGHA 3LZIA 5HLFA 1LWEA 5JS1A 2KZZA 3NE6A 3OYCA 1LW2A 1YTAA 2HHTA 4CEZA 4FJ8A 1A5VA 1VSEA 1RCHA 3V1QA 3OYGA 5DMRA 3I0SA 3HXMA 1RTHA 1F21A 4H4OA 1KSPA 4FM2A 4O44A 2HW3A 1RT2A 1Q9XA 3QEIA 4DQQA 3AO2A 4EZ6A 4J2DA 1RTJA 1J53A 1HNVA 4CF8A 1RBTA 2PY5A 1IG9A 3KLHA 3C6UA 1BL3A 5I42A 1ZBLA 1JLGA 4RW6A 5HRNA 4DFMA 3DRPA 3AA2A 3VQ5A 3ZSVA 4B9SA 5C24A 4KTQA 3AVLA 1JLQA 1S6PA 1VSDA 3V4IA 1RT7A 3V9WA 1TK5A 4FJGA 4K8ZA 4QAGA 3ZSZA 4FLWA 1EX4A 4KTWA 3KD5E 4KHSA 4DFJA 4RW7A 3SYZA 4F8RA 1YT3A 3S3OA 3TABA 4BWMA 4CIGA 3AVBA 1HYSA 1U04A 3NHGA 4FYDA 4FJKA 4CEOA 4BDYA 4K8XA 1SV5A 3DMJA 5FDLA 4ZTJA 2GV9A 3SQ0A 3MXJA 4ZHRA 1EETA 4M42A 4E1NA 1C1AA 5K14A 3TWHA 3S9HA 2HVIA 1I3AA 2E4LA 3M8QA 3ZCMA 5J2MA 4DTUA 4HUEA 3WNFA 4OJRA 1NK5A 3NF6A 2HB5A 3I8DA 4CIFA 3K5MA 4KI6A 2Z1HA 4Z4IA 2DTUA 2RF2A 4CJSA 4CJTA 5CY4A 1U4BA 4NCGA 4C8NA 2HHQA 3ZT1A 4KREA 3QNOA 3LP2A 1KTQA 1GOBA 1WAFA 2D0AA 4N56A 1L3SA 3VQEA 3L2UA 2HNDA 4HVJA 4W5RA 3SZ2A 4DTPA 4DTNA 1JLFA 3TR8A 3KJVA 4FM1A 5J2NA 1UWBA 1LW0A 1WN7A 4O55A 4CHOA 3QESA 3V81A 4FJNA 1BHLA 1D9DA 3O3HA 4Z4HA 3OYLA 1C0TA 4CJ5A 4DF8A 3TANA 4DSKA 2YKMA 4CEBA 1L3VA 3CQ8A 1VSLA 2ITGA 2RKIA 1A5XA 3KKRA 4EP5A 3KK3A 2ZE2A 4HUFA 4OKEA 3HPOA 2HMIA 4IBNA 1XI1A 4GMJB 4O4GA 1B92A 1TKTA 3TAFA 4DQIA 4DU4A 2XY5A 4JS5A 4DG1A 4OGCA 4OPJA 4BDPA 4CHZA 4H4MA 3TI0A 4EP4A 4NYNA 4DWIA 1C1CA 1SKRA 1ZBIA 1B9FA 1IO2A 1NKCA 4E7IA 4OLBA 1S1UA 3F9KA 4M3ZA 1ASVA 2GBZA 1JL1A 3QO9A 5KI6A 3PY8A 4LSNA 3V6DA 4DTRA 3QEXA 1WNSA 5HRSA 1ZBUA 4CFBA 4FK0A 4M3XA 1ZYQA 2EX3A 2FBVA 4DSIA 2G8FA 3HVRA 2XHBA 3AVJA 3PX6A 4KFBA 1RT6A 4HUGA 1ZBFA 2F96A 4R5PA 4AHCA 1WSIA 1J54A 3B6PA 4HCBA 4FW1A 1IKWA 1L3UA 1KVAA 4ELVA 2LSNA 4FJMA 4KHQA 3PO4A 2QK9A 3NGZA 3KLIA 1XHXA 4B3OA 1FKPA 3NDKA 2KQ2A 1BI4B 3K5OA 1SL0A 1NK8A 1CZ9A 1RBSA 4F4KA 3THVA 3OYEA 4FW2A 4HHTA 4F2RA 4PWDA 4Q5VA 4O5BA 1LAVA 4DTXA 1QSYA 4CJQA 1FXXA 1FK9A 1BISA 1Z25A 2YKNA 4CIEA 3KLGA 4CF2A 3PO5A 1HQEA 2YNFA 4LD0A 1N6QA 5T7BA 1JXEA 4KHUA 2QKBA 2KZMA 1NKEA 4KHWA 1HPZA 1IH7A 3KLFA 3ALYA 1EP4A 4B9LA 1TGOA 1NK9A 4FJXA 5C42A 1JLBA 3RRGA 4CJKA 3G0ZA 2O4GA 1Q9YA 3DOLA 2G8KA 1T7PA 3AVMA 5SZTA 1J9AA 4I2QA 2AJQA 1LAWA 3VQAA 1IKYA 3JYTA 3P5JA 3U3GA 3K58A 1S1TA 2OZSA 4ELUA 1RNHA 1GOAA 4DTJA 3V9XA 3SUPA 2VWJA 3IS9A 1KFDA 1XHZA 1BQNA 5FRMA 3VQBA 2P5GA 3HP9A 3LANA 1T8EA 5SWMA 1LWCA 2WOMA 2GUIA 4BE0A 3ZSQA 4Z4FA 1Q8IA 3SQ4A 1CLQA 1JL2A 1IKXA 5CYMA 3EZ5A 2X78A 1RT3A 4FJHA 3B6OA 4NCAA 3OYKA 3VQPA 3DLHA 3QIOA 4PY5A 1C0UA 1RDBA 4E3SA 1EXQA 3LP1A 3NF9A 2Z1GA 4BDZA 2A1RA 5FRNA 4I7FA 4RG8A 4KKOA 3SQ1A 5HP1A 3QETA 4W5OA 2YHBA 3O4NA 1TAUA 3AA5X 1VSJA 1X1PA 2Q3SA 3SV4A 1DTQA 1HYZA 3KTQA 4N41A 1Z26A 2E6LA 1C6VA 1LV5A 1A5WA 3MEGA 3NF7A 2XY6A 3DRRA 3NH2A 2IC3A 3M8SA 4DQRA 4J2AA 3HL8A 1J5OA 1SL1A 2QKKA 3MEDA 4CJEA 4FLYA 4DTMA 4AHSA 3TAEA 3OS0A 2NUBA 1ZBHA 3SUNA 3CM5A 3NH1A 3L2RA 5HROA 3DLBA 5CZ1A 4CGFA 2B5JA 1JLEA 3LZJA 1VSKA 2IAJA 1S1VA 4B08A 3OJSA 3LPTA 1QHTA 5CYQA 1N5YA 3V1RA 3ZSWA 4CEEA 1WSHA 1KVBA 3DRSA 1VSFA 1W9HA 5J2QA 4CESA 3HO1A 3QNNA 4ID5A 1RBUA 3AV9A 4HCCA 1HYVA 1JXBA 4H8KA 1UAXA 1RILA 2HNYA 3IRXA 3O4QA 4RW8A 4E7KA 3TAQA 3RTVA 4CFAA 2Z1JA 2XY8A 4O0JA 3MECA 4FLZA 4FLVA 1TL1A 4DLEA 3TAGA 2DY4A 3MXIA 2F8TA 1C1BA 4NYFA 1NKBA 3LALA 3V9UA 4KB1A 4XIUA 3NAEA 2P5OA 4KHYA 3ZT0A 3DLKA 3L2WA 1QQCA 3K5NA 2Z1IA 5D3GA 3KD1E 1TKZA 5C25A 3CM6A 4Q0BA 3ZSYA 4CHPA 4Z4EA 4M3YA 2VG6A 3AO1A 2X74A 3P1GA 4ID1A 1WSFA 3KK1A 4GW6A 2JLEA 3HPGA 1HQUA 3VQ8A 3NBPA 4FLUA 2I5JA 4OPKA 3O3GA 3RMDA 4LH4A 4CJFA 4JS4A 1SL2A 2YNIA 4F3OA 3LP3A 2KW4A 4LH5A 4FK4A 3WNHA 4KB0A 1VSIA 4N76A 4CF0A 4CFDA 1HNIA 4GVMA 4CJ3A 2OPRA 1WSJA 3MAQA 3NGIA 4DTSA 1TL3A 4ZTFA 5KRSA 1ITGA 3AA3A 4OKKA 2IGIA 3K57A 4F3TA 3WNEA 3LWMA 4FLTA 2RN2A 4ICLA 4WE1A 5CZ2A 1O1WA 2ETJA 4CGIA 2E6MA 3AO4A 4DQSA 1TAQA 4FJ5A 4AHTA 3ULDA 5KGWA 2YV0X 4IG3A 4CJPA 1CXQA 2OPPA 3TAMA 4DFPA 3OYJA 2G8VA 4AHRA 3ZSOA 4F2SA 4DU3A 2DFEA 3SV3A 2PZSA 1X9MA 3LP0A 4OVLA 4E7LA 1TKDA 4KPYA 3CFOA 3SJJA 5EU7A 5KTQA 3DI6A 4AHVA 3EYZA 2XY7A 2DFFA 4CFCA 2D5RA 4OKJA 3CFPA 3RMAA 3L2QA 3OYNA 4FJ7A 4FJ9A 2BANA 3OYFA 5J2PA 3HJFA 3OS2A 3OYHA 1NOYA 4DSEA 4G1QA 1QSLA 1SKWA 1U47A 4E89A 3BDPA 4RW4A 4N47A 2B4JA 2FBTA 3HPHA 1WSEA 4AH9A 3CFRA 3AVHA 3OYMA 3DM2A 3AVNA 4FCYA 1Y97A 3SUQA 3RR8A 3WNGA 1L5UA 1RBVA 4PA1A 5HRPA 3QLHA 4CEFA 1WAJA 5J1EA 2XO7A 2G8WA 3ZT2A 3HM9A 2P51A 3C94A 3T19A 1RTDA 2A1SA 4CJRA 2ATQA 4OGEA 1KLNA 4J2BA 3LDSA 2HHXA 3VA0A 1RDDA 4KI4A 4B9TA 3A2FA 3PV8A 3DOKA 3M8PA 3ASMA 4TSXA 3MXMA 3PX4A 1UA0A 3HK2A 2VWKA 5JS2A 4Z4CA 1SUQA 4AILC 3O3FA 2BDPA 3DLEA 4NCBA 3FFIA 3ZT4A 3L2VA 4Z4GA 3H08A 1CXUA 4CECA 1U45A 2OYQA 2OPSA 3QINA 2HHWA 3LAKA 4C8OA 3ZSRA 3RWUA 4CE9A 1ASWA 4YFUA 4HTUA 3RR7A 4B9MA 1YVUA 1VRUA 5HRRA 3S3NA 2B6AA 2QXFA 4DU1A 3RMCA 2OZMA 4B8AB 3E01A 4O0IA 4PQUA 3D45A 3NH0A 3QIPA 1DTTA 4Y1DA 3D0PA 2YNGA 2KTQA 3C6TA 3KIOA 4MQ3A 4B9NA 2R7YA 3BGRA 4CEAA 1BCMA 1NJWA 3NGYA 1BIZA 1HJRA 2ZD1A 3OYAA 3QERA 3K59A 2G8IA 4W5NA 5KGXA 3F73A 1WLJA 3SQ2A 1BQMA 3HT3A 3LPUA 4FZZA 2W42A 3AVGA 1S9GA 3PUFA 3OVNA 1VSMA 4KV8A 4I9LA 5HBMA 4DFKA 1NK6A 4B9UA 1DLOA 4LSLA 3VQ7A 2D0CA 3C95A 3SPZA 1K6YA 3VQDA 4CF1A 3SI6A 3ZSXA 3L8BA 2X6NA 3HYFA 4CEQA 1TV6A 1UOCA 4CK1A 1T05A 2HVHA 3ZT3A 4I9QA 2HNZA 3ITHA 1RT4A 1VSHA 4CJUA 3JSMA 3EY1A 3QEVA 4CF9A 1NK4A 4M45A 1IKVA 4CJWA 1NK7A 1T03A 1RBRA 3OYBA 1C0MA 1JLAA 2FBXA 2IDOA 3DYAA 3OYDA 4IFVA 4CERA 3L3UA 2VG7A 3IAYA 3VQ9A 1ASUA 3VQ6A 2FBYA 1YTUA 1RT1A 4I2PA 1L3TA 4EZ9A 4DQPA 2PYJA 1TVRA 1BI4A 4DSFA 4LY7A 4E7HA 1I39A 1KVCA 3V9SA 4IFYA 4JLHA 1LWFA 4BACA 2YNHA 4UQGA 4DF4A 3I0RA 1R0AA 4KRFA 1RDCA 3P83D 4E1MA 1HRHA 4M3RA 1QS4A 3SPYA 3AO5A 1KLMA 2DFHA 4KO0A 3RMBA 1QTMA 2KFZA 2P1JA 4CHNA 1S5JA 2D0BA 3AVAA 4MFBA 4FZXC 4M3TA 4OLAA 3CG7A 4DS4A 4DSLA 1W0HA 4E7JA 4DTOA 3L3VA 1VK0A 2HHVA 2FC0A 1D8YA 1NOZA 3T1AA 3PX0A 1S1WA 1G15A 1GOCA 4CGDA 3KKSA 4E0DA 3VN5A 3U3YA 1FKOA 1NJXA 2X6SA 4CCHA 2EHGA 4CHYA 2PYLA 4FZYA 3QEWA 3VQCA 2WONA 3SNNA 1D9FA 3HSTB 1SKSA 4J2EA 4M3WA 1EKEA 2OPQA 3OS1A 3SCXA 4B9VA 1D5AA 1BCOA 3HP6A 3IG1A 4JRQA 3NCIA 4PUOA 1RT5A 4RW9A 4QCLA 3DLGA 3HVTA 1QSSA 4FJJA 4CJLA 3OYIA 3M8RA 3TARA 1U49A 1U48A 4QOZB 4CK3A 3LWLA 4Z0UA 1JKHA 3MEEA 4CEDA 4DMNA 1XC9A 4KTZA 1NJYA 5DK5A 1RTIA 1NJZA 2JGUA 4ELTA 4W5QA 4FJIA 2G8UA 3G10A 3V9ZA 3VQQA 3K5LA 1BGXT 4C8MA 3QEPA 4C8LA 3NF8A 4C8KA 3UIQA 2G8HA 2BGGA 3AVFA 1S6QA 1B9DA 1JLCA 4M3UA 4IDKA 3OY9A 3VA3A 4DSJA 3SUOA 2YHAA 2O4IA 1TK0A 2RPIA
chains in the Genus database with same CATH superfamily
1HMVA 5AQXA 3F5TA 5H1SQ 4DHYA 1ESVA 4N5SA 1QE1A 4BE2A 3RRHA 1D4XA 2P9NA 3CCVN 5JLFA 1C0FA 3CCQN 2V51B 5FPMA 2PAVA 3LAMA 3DLRA 3TAPA 3NVKA 4BWJA 4CGGA 4R79A 3CCMN 1VRTA 4BRKA 5ADXH 4AHUA 4IG0A 1VQMN 4CJ4A 1WSGA 5FROA 1YI2N 3CCLN 2ITMA 4C23A 2IVNA 3VQ4A 4BQZA 4W5TA 2HHSA 4YY3K 5HLFA 5JS1A 4BRQA 3ZETA 1YTAA 3E9LA 3VEXA 1XUPO 4B3SK 3OYGA 3HXMA 1RTHA 2W41A 3QEIA 5C15A 4EZ6A 1RTJA 1J53A 1HNVA 1JLGA 4RW6A 5HRNA 5EX5A 3DRPA 4H0XB 3J7YP 4DR3K 4KTQA 3V9WA 2O8DA 3ZEUB 4QAGA 4K8ZA 3VEZA 1YF5L 1EX4A 3KD5E 3GE1A 2OTLN 3EL2A 3L0QA 3ULEA 1M1KO 4F8RA 3NHGA 4FYDA 3DLLL 4BVOA 3DMJA 2GV9A 2NNWA 3LDOA 5GIOA 4NB4A 4IOXA 4M42A 4CZEA 3TWHA 2HVIA 1I3AA 3F2KA 3ZCMA 1NWKA 1VHXA 3LDPA 3DXKB 1NK5A 4CIFA 4JI7K 4Z4IA 3IMXA 3VEWA 4CJSA 4CJTA 4YHHK 2A40A 4C8NA 3SMPA 1GOBA 3RSEA 1BO5O 4DV6K 3A5NC 5J2NA 1UWBA 4H5VA 4O55A 4BROA 3CCUN 3KWGA 3QESA 4OPAA 3V81A 3LM2A 2HBLA 4Z4HA 1HPMA 2YKMA 4CEBA 5LJWA 3CQ8A 2RKIA 2HMIA 2HSTA 1HNZK 1XI1A 4GMJB 2A6AA 1Q81O 4DU4A 2XY5A 4OGCA 3GBTA 1Q7YO 1IO2A 1YJWN 1GLJO 4OLBA 1ASVA 5KI6A 3M6GA 3FZHA 4BR9A 1ZBUA 4CFBA 2P9LA 2EX3A 2FBVA 4KFBA 2UU9K 2F9WA 1WSIA 4FW1A 1KVAA 1W7AA 2BH1A 4C1NI 4FJMA 2QK9A 3PO4A 1KAXA 2KQ2A 3GG4A 5HOOA 1CZ9A 3OYEA 1QSYA 4FWMA 3EN9A 1FXXA 4KHPK 5IT9O 2YKNA 4ILGB 1VQPN 2QKBA 3VEOA 1NKEA 2YI1A 4B9LA 1NK9A 4FJXA 1JLBA 1Q9YA 2YJFA 1QVFM 4I2QA 3VQAA 1IKYA 3JYTA 4BRHA 3U3GA 4DTJA 3V9XA 2I7NA 3IS9A 5BPNA 5SWMA 1SS6A 2O8CB 1LWCA 4BE0A 3ZSQA 4Z4FA 1CLQA 3EZ5A 2X78A 1RT3A 4FJHA 3VQPA 3E66A 3UKUB 4PY5A 2A1RA 4KKOA 3ZX2A 2ZF5O 4W5OA 2KLAA 5BR9A 3C6HA 3SV4A 1V4TA 3KTQA 3ATUA 1TUUA 3MEGA 4MO5A 3TTFA 3OW2M 1VQ8N 2O8EB 3VMFB 1SL1A 4K25A 3TAEA 1QZ5A 2ASPA 1ZBHA 1X3MA 3R6MA 5CZ1A 4CGFA 3LZJA 1VSKA 2IAJA 1S1VA 2W40A 1MA9B 3LPTA 5CYQA 1X9JA 1WSHA 4CEEA 4CZGA 1N8RO 3OBWA 3DRSA 4JI2K 1FW6A 4CESA 2H3GX 1HYVA 4H8KA 1RILA 1VQKN 4RW8A 3RTVA 5B8HA 4X66K 3MECA 4FLVA 1TL1A 1Q18A 4NYFA 1NKBA 4XIUA 3ZT0A 4BGAA 1QQCA 2Z1IA 2NLXA 4ILHA 2HHHK 2GWKA 4A59A 2X74A 5AQRA 2JLEA 1HQUA 4JEPA 4BRPA 4BRDA 3AGRA 1YVNA 2OTJN 4LH4A 1XQSC 4JS4A 1T3VA 4DR6K 1NM1A 3MX5A 1SL2A 4F3OA 1E3MA 4WCEL 4LH5A 1OKJA 4JYAK 1BOTO 1OVQA 4GVMA 2JWKA 4PL8A 3NGIA 3AA3A 3K57A 3WNEA 2VGMA 5FPEA 1LOTB 5CZ2A 1K8AO 3AO4A 4FJ5A 3ULDA 4CJPA 3H6EA 1BWFO 1CXQA 3HRGA 3BP8A 4A2BA 4GKKK 4F2SA 1T6CA 3UKRB 3HOSA 2DFEA 2HBJA 3LP0A 1TKDA 1OH6A 3CFOA 2IIRA 5BR8K 3DI6A 4AHVA 1VQNN 2D5RA 3CFPA 2BANA 5BRHA 3OYHA 1QSLA 3P38A 5AZIA 1QQMA 1WSEA 3DM2A 3FR0A 4FCYA 1Y97A 3RR8A 1L5UA 4JD2B 4PA1A 2VQFK 1WAJA 4UY8O 1Q82O 2YCHA 3T19A 1DEJA 3ZYYX 4J2BA 4RTFD 3IDHA 2UYTA 2Q0UA 5ADXA 2ZM6K 3PX4A 3VF6A 5JS2A 4NCBA 3L2VA 3TSPA 4K0KK 4CECA 1U45A 2OPSA 3LAKA 4C8OA 3ZSRA 1ASWA 4HTUA 2Q97A 4JKFA 3RR7A 4WQ5C 3LDLA 4DU1A 4EFHA 3D45A 3CJBA 3D0PA 2KTQA 1K8KA 4MQ3A 3JS6A 2E2QA 3BGRA 1BIZA 2ZD1A 2GX9A 1R59O 1HX1A 1BQMA 4O8KA 5KPTA 1VSMA 4I9LA 3A5LC 4B9UA 1DLOA 4LSLA 3SPZA 3THYB 2ZJQL 3ZSXA 4CK1A 1RT4A 3EY1A 3QEVA 4LF5K 2VCPA 1NK7A 4JKHA 3CC2N 1C0MA 2F7TA 2FBXA 3D7EO 4IFVA 4CERA 4DR2K 2P9UB 4EZ9A 4DQPA 2PYJA 4E7HA 4LF4K 4JLHA 2YNHA 4UQGA 4DF4A 1RDCA 3SPYA 3AO5A 4FOIA 1RFQA 4FZXC 1W0HA 3WT0A 3IFRA 5JMVA 3MMVA 3WXMB 2P9IB 5C2FA 4DV2K 4CCHA 4H0OA 3QEWA 3VQCA 3HSTB 1SKSA 3OS1A 4CW7B 3HP6A 4GVEA 3CHWA 3DLGA 3HVTA 4QOZB 3T1HK 3LWLA 3MEEA 4KTZA 3SAFA 2G8UA 3VQQA 3K5LA 2CH5A 3R9PA 1B9DA 2E2NA 2GTDA 4YOTA 2O4IA 1QS4A 4DSLA 4FM0A 4Y1CA 1CZBA 4E19A 4M41A 1NBWA 1TKXA 4BRAA 3V1OA 4FWQA 3NFAA 4BR7A 1XWLA 4B8CA 5GAGP 5I3UA 1X9SA 2UUCK 2ASOA 3GL1A 4IEIA 2OCEA 1REVA 1KXPA 2QWOA 3KK2A 4BE1A 2EWSA 5KRTA 4FJLA 2QTDA 4DR7K 3VESA 2IS3A 2VG5A 4FXDA 2IOCA 2V7YA 4FLXA 3ISNC 1W97L 1TK8A 4FPBA 3WXKA 2YJEA 1QQOA 4CJVA 4A62A 1JCGA 3BZCA 2OA8A 1NK0A 2CGJA 2XRIA 3OBYA 4FVMA 4FVUA 4CGHA 3LZIA 5LMNK 4FJ8A 3HOTA 4FWKA 4JI1K 2VYPA 3MN6A 3C7NB 4H4OA 5AQOA 4FM2A 4O44A 3SBGA 2HW3A 3JXUA 4JKGA 1RBTA 4B1VA 1U2VA 1NGFA 3AA2A 1OH8A 1DKGD 4HTLA 3AVLA 3K9KA 1NJIO 1IJJA 2Q36A 1IG8A 2E8AA 2QW9A 2A42A 3AAPA 4H0TB 4BC5A 5AQHA 1HNWK 4KHSA 3J7ZO 4DB3A 4DFJA 3O9RA 3THXB 4BRGA 1YT3A 3S3OA 3AVBA 3J80O 1P90A 4BDYA 1RDUA 1SQKA 3EKSA 5EVZA 4E1NA 3S9HA 2E2PA 2E4LA 3M8QA 1NMDA 3J8AA 4DV5K 2QEXN 4NXMK 4KI6A 5GAHP 3K5MA 2DTUA 2RF2A 4I6MB 4CJ7A 2HHQA 1KTQA 2FSNA 2W6LA 1WAFA 2D0AA 4BRFA 4IO8A 4N56A 4W5RA 3KJVA 5LL6Z 1WN7A 4FJNA 4CZKA 2JWLA 4CJ5A 3TANA 1VSLA 2ITGA 5AQLA 3HTVA 4EP5A 5CE3A 3O08A 4OKEA 4HUFA 5A2QO 4JS5A 4CHZA 3TI0A 1N36K 1C1CA 1SKRA 4OX9K 1NKCA 4CZJA 2QWPA 4GV9A 5C12A 1S1UA 4CBXA 4DCHA 3QO9A 3PY8A 1P8ZA 3V6DA 4DTRA 1HKCA 5HRSA 4M3XA 1ZYQA 5AQUA 1RDWX 4BVPA 3HVRA 1VQLN 3AVJA 4A2AA 3PX6A 1RT6A 3CMEN 1ZBFA 5AQKA 1J54A 2KKZA 5KPZA 4HCBA 2F4VK 4WQ4C 3NGZA 4B3OA 3NDKA 3THWA 4C1NK 3L6QA 1SL0A 1NK8A 4F4KA 3F9MA 4FW2A 4BREA 5FPNA 4CJQA 3D2EB 3PO5A 2YNFA 1N32K 4KHWA 1HPZA 1IH7A 2D0PA 4H5TA 3WXJA 3H46O 4QS7A 3RRGA 3G0ZA 3DOLA 4B1ZA 4JK9A 2QM1A 1NGDA 3S41A 2AJQA 5AFUH 1LAWA 1RNHA 3J7AP 3SUPA 4J8FA 4CD3A 4B3TK 1BQNA 3J81O 5FRMA 4G9ZA 1Z05A 2Q31A 2WOMA 3PSFA 4EIAA 2I7PA 1YXQA 1JL2A 5BPLA 4JI3K 3DLHA 1JCFA 2E5LK 1RDBA 4E3SA 1EXQA 3NF9A 5AQJA 2QWMA 4RG8A 3R3LA 4JKDA 2YHBA 4WFNL 2UXCK 3EE8A 4B1UB 2Q3SA 3ENOA 1EWRA 4YOUA 2E6LA 1C6VA 5BN8A 1A5WA 2XY6A 2HF3A 2WTUA 3M8SA 2QI2A 4JHDA 5AQGA 2QKKA 4JI4K 1GLLO 4DTMA 4FLYA 1TUYA 4L3QA 3OS0A 2NUBA 2HHTA 2P9NB 3CM5A 4CZLA 3NH1A 5JVGL 3BY5A 2B5JA 3VGKA 4JKEA 3OJSA 3CETA 4XH4A 4DV3K 1VSFA 3FLCO 5J2QA 4HCCA 3FZMA 1UAXA 3P4IA 3O4QA 4E7KA 1NG9A 2XY8A 4O0JA 4FLZA 3MXIA 5AQVA 2F8TA 3O8MA 4KHYA 3CI5A 3VEYA 1ATRA 5D3GA 3ZETB 4B1WB 4CHPA 4Z4EA 4MLEA 4FWRA 3AO1A 3HPGA 1WOQA 1Z6RA 3CJ1A 3DJCA 4LC9B 1M90O 4CFDA 1HNIA 2OPRA 4DV1K 1X3NA 3MCAB 1TL3A 1ITGA 5AQIA 2O8DB 1JJ2M 2RN2A 4ICLA 2ETJA 4LF9K 3ULEB 3EEQA 2O8BA 2YV0X 4IG3A 2OPPA 4A5AA 1KD1O 3OYJA 2G8VA 4CD1A 3ZSOA 1VQ4N 3SV3A 1NGGA 1X9MA 4OVLA 4E7LA 4WF9L 2QWNA 3EYZA 4DV4K 3WQUA 5EOYA 1XC3A 4FJ7A 3OYFA 5J2PA 4JV5K 1U47A 3BDPA 1ZXOA 2B4JA 2NRWA 3OYMA 3QLHA 3RSEB 5J1EA 1YJ9N 3VF4A 3C94A 2A1SA 1KLNA 2ATQA 2HHXA 4YOWA 4KI4A 1WB9A 3PV8A 3DOKA 2WFBA 1J6ZA 3I33A 1SUQA 3CIPA 3O3FA 2BDPA 3DLEA 3FFIA 1NLVA 4QS9A 2HHWA 2NZTA 2Q2RA 1OVYA 4WFBL 3RMCA 3FZLA 3E01A 3D2FA 1DTTA 4Y1DA 1XMQK 3C6TA 4B9NA 5GAEP 2WBNA 2R7YA 3A0IX 1NJWA 1KQSM 5BREA 3CF5L 3OYAA 2P9LB 4K43A 3K59A 3QERA 2G8IA 3L4IA 4W5NA 3A8YA 4FWLA 3LPUA 4FZZA 2W42A 4DFKA 5HBMA 1S9GA 4EAHD 4FJGA 4KV8A 3P31A 1V4SA 5EY4A 3VQ7A 2YHYA 1K6YA 4CF1A 3L8BA 2X6NA 3HYFA 1TV6A 4MO4A 3ITHA 3C6AA 1IKVA 4PHTX 4QS8A 2HF4A 1DGKN 5AQWA 4XH1A 3VQ9A 4LF8K 4F9OA 3VQ6A 3VF2A 4JI0K 1NGHA 2VGNA 4YOYA 4I2PA 1K73O 1L3TA 2NRZA 2ZJPL 3H3NO 1BI4A 3CPEA 5BRDA 4LY7A 1I39A 2ZGZA 4E1MA 1HRHA 2ASMA 4M3RA 5AJ3K 1QTMA 4KO0A 3LDNA 2KFZA 4CHNA 3AVAA 5F1XA 3CG7A 4CI6A 1NGEA 3WUHA 1E4FT 3DWLA 3PX0A 1SZ2A 4E1JA 1NJXA 1N34K 3CJCA 2NRVA 4CHYA 4B1XB 1TYQA 4DKWA 5TKYA 4B9VA 1D5AA 2WC9A 3N4QA 3IG1A 4QCLA 3NCIA 4RW9A 5M1OA 4CZFA 3FZKA 2YHWA 3P39A 4CZHA 3OYIA 1U48A 3TARA 4DMNA 4M7YA 3RVCA 5GIPA 5DK5A 1RTIA 1IBLK 3AAQA 2PBDA 3G10A 3CERA 4X62K 2NRRA 3FE1A 1IV0A 2IVPA 3AVFA 1JLCA 2P9SA 4ILJA 1SAZA 3SUOA 3TTDA 2DY4A 2RPIA 5M1NA 3IUCA 4KHNA 4CZMA 4H5NA 4YNQA 3KLEA 3AO3A 4IKFA 1S9EA 3AVKA 3WQTA 4FK2A 4B3RK 3AVCA 1MU2A 3OJUA 4OO1J 1BA1A 1NGAA 2Y1JA 1X9WA 3ID6A 2ZJRL 3K2PA 5M1QA 3CD6N 4JRPA 1UA1A 3E9PA 1KFSA 4DS5A 4NO7A 3PLAA 3AVIA 3S3MA 4MDAA 4KAZA 5E84A 1RDAA 1S1XA 5BN9A 1LWEA 3CJ7A 2KZZA 3H1QA 3OYCA 4RCHA 4LF6K 3SLCA 2GELA 5AFUA 5DMRA 1OH7A 4LFCK 1RT2A 1BU6O 3FZFA 3JAMO 3AO2A 5F2RA 4DQQA 1NGIA 2PY5A 1IG9A 3C6UA 1YJNN 4DFMA 3VQ5A 3M3ZA 4B9SA 4NLCA 3MX2A 3B8AX 1JLQA 1S6PA 1VSDA 1RT7A 1NNEA 3LM9A 3ZSZA 4FLWA 4KTWA 3HM8A 3CPWM 1KAYA 3SYZA 4A57A 4BWMA 1U04A 4FJKA 4CEOA 1SV5A 5FDLA 4ZHRA 5AZIB 4JN4A 4BR4A 1C1AA 5K14A 2E20A 3QICA 2HMPA 2V52B 4DTUA 4HUEA 2D1KA 3WNFA 4WFAL 3C65A 3I8DA 2HB5A 3EKUA 4JK7A 1BDGA 5CY4A 4NCGA 3LP2A 2FSJA 3AY9A 2UXDK 4H03B 3VQEA 2HNDA 5LJVA 2QWRA 3SZ2A 3TR8A 4K42A 4CVNE 1U6ZA 4MDBA 1BHLA 1D9DA 4IXCA 4DF8A 3E1YA 4DSKA 4EHUA 3Q7BA 2ZE2A 4XEIA 3U9DA 4IBNA 3ZX0A 3I8BA 1K8KB 4O4GA 1B92A 4DQIA 4IOCL 4H4MA 3T69A 4EP4A 4DWIA 1J5EK 3OTOK 4B1YB 4M3ZA 1XMOK 2GBZA 4FWNA 3HSCA 4LSNA 3QEXA 1WNSA 2GUPA 4DUYK 1GLEG 4DSIA 3PIOL 2G8FA 4HUGA 2F96A 4R5PA 1W2BM 3B6PA 3HZ6A 4A5BA 3O5BA 4KHQA 1QVGM 2QXLA 3CQXA 3O9SA 2KHOA 3AARA 4H0VB 1RBSA 4HHTA 4PWDA 4Q5VA 3KLGA 1HR0K 4LD0A 5T7BA 4KHUA 2KZMA 4PKGA 3KLFA 1EP4A 1TGOA 3WEEA 2O4GA 4DV7K 2P9PA 3AVMA 5SZTA 1J9AA 3FFKB 1T44A 4JI6K 1EQYA 3P5JA 5TKWA 1S1TA 4H0YB 2OZSA 2O8FA 3CJ9A 2VWJA 3VERA 1XHZA 3HP9A 4ISGA 1T8EA 2E1YA 2UXBK 4AM7A 2GUIA 1Q8IA 3SQ4A 3CCEN 1IKXA 5DM6L 4NCAA 3QIOA 1C0UA 3MWPA 5FRNA 3LP1A 2Z1GA 4I7FA 5BRFA 1G99A 3DXMA 5AZJA 4XH5A 4IO9L 2A3ZA 1DTQA 2P9KA 4N41A 3ENBA 1NGJA 3NH2A 2IC3A 1MWMA 2Q1NA 3MEDA 3CJAA 4IJAA 3ATVA 3E9OA 3SUNA 3DLBA 3A5OC 4DQ8A 1JLEA 3EO3A 3IKMA 1N5YA 2Q0RA 3W0LA 1W9HA 3HO1A 4ID5A 3AV9A 1JXBA 2HNYA 3TSQA 2Z1JA 4WYBA 3TAGA 5C0YA 3NVMA 2NRTA 4B3MK 3LALA 3D6RA 4PKIA 3NAEA 1QQNA 1KC8O 3DLKA 3TPQA 3KD1E 1TKZA 5C25A 4Q0BA 2BTFA 2WUSA 3SAGA 2ZGYA 4DR5K 4M3YA 4M63C 4ISEA 5CHIA 3KK1A 3DAWA 3VQ8A 4GKJK 5AR0A 4JKGB 1U2VB 3KHYA 2YNIA 3LP3A 1ILYA 4FK4A 4KB0A 3OHRA 1VSIA 4CF0A 3CC7N 4CJ3A 1WSJA 3MAQA 2IGIA 1EO1A 4FLTA 3SMSA 4WE1A 1O1WA 4DQSA 4AHTA 2FSKA 4AHRA 3ZEUA 4KPYA 3SJJA 5GADP 5KTQA 4OKJA 3L2QA 2QWLA 4FJ9A 3R8EA 3HJFA 2IVOA 4BRCA 4IFEA 4E89A 4RW4A 4N47A 2DPNA 3HPHA 3RMDA 1GLBG 1YITN 2UUBK 3SK3A 3WNGA 1VQ6N 1HKGA 2G8WA 3ZT2A 3O9TA 2P51A 3DXKA 5C10A 4OGEA 4CJRA 4JI8K 5I9EB 3VA0A 4B9TA 3CCJN 3BZKA 3M8PA 4TSXA 3MXMA 1IBKK 1UA0A 3GDQA 2VWKA 4Z4CA 3H1VX 1YUWA 4AILC 1E4GT 3ZT4A 1CXUA 2OYQA 1YHQN 4H5RA 4YFUA 1YVUA 4BC2A 3S3NA 2QXFA 2OZMA 4B8AB 5AQSA 4O0IA 3NH0A 3QIPA 1C0GA 4BQLA 3O9QA 2YNGA 4CBWA 3KIOA 3BF1A 1CZAN 4CEAA 1BCMA 4IJNA 3MN7A 3NGYA 4KH4A 5KGXA 3VTHA 3F73A 3SQ2A 4Z94A 3W3DA 3AVGA 3H3OB 3OVNA 1N33K 2D4WA 2D0CA 3C95A 3SI6A 4CEQA 2HVHA 4I9QA 3JSMA 1VSHA 4U67L 3THWB 1NK4A 4CF9A 4CJWA 3OYBA 3OYDA 3MWTA 3L3UA 2VG7A 4EHTA 5FPDA 3NMUA 2FBYA 4FWOA 3CQYA 1YTUA 4LF7K 1HJOA 3QBWA 1TVRA 1FJGK 1OH5A 4FL9A 4BR5A 4IFYA 1LWFA 1NGCA 2J4RA 4IZ9A 1KLMA 2DFHA 4JNEA 2P1JA 4MFBA 4OLAA 4DTOA 2HHVA 3MN9A 1D8YA 3KZBA 1NU0A 4CGDA 4E0DA 1HLUA 1ATNA 3EZWA 3U3YA 4GV6A 3BEXA 2WONA 4J2EA 1KAZA 3SCXA 1NGBA 4JKCA 4AQYK 4PUOA 1RT5A 1QSSA 4FJJA 4CJLA 4CK3A 3BUZB 4Z0UA 4CEDA 2O8CA 4IOAL 1XC9A 1VQ5N 4JKBA 4ELTA 4W5QA 4IEEA 3UKUA 1BGXT 3QEPA 4C8LA 4HWIA 3QB0A 2G8HA 5JICA 1GLAG 2BGGA 4JHDB 2OANA 5F0XA 1I94K 4JK8A 4JKAA 4IDKA 4M3UA 3VA3A 1EWQA 1TK0A 2QWQA 2Y1IA 2KFNA 2O8EA 3CYMA 3WXLA 4L8RB 3Q7CA 1KCFA 5EXWA 4CK2A 2BE2A 4GY2B 4CHQA 3QFPA 4DLGA 3AA4A 1QHAA 3SAHA 3ZX3A 4BC4A 4CGJA 5E41A 4FWSA 3T3FA 3U6FA 2ZQBA 1KRPA 2F8SA 4X64K 1BIUA 4B9QA 5KQ8A 2HHUA 3TU5A 2VQEK 3NE6A 1LW2A 4CEZA 1A5VA 1VSEA 3QBXA 1RCHA 3AGKA 3V1QA 3I0SA 3MN5A 1KSPA 1F21A 1MWKA 1HKBA 1Q9XA 4FO0A 3SBTA 3VENA 4J2DA 3HBTA 4YDUA 4CF8A 3CCSN 3KLHA 1LCUA 1BL3A 3O80A 5I42A 1ZBLA 3ZSVA 5C24A 4PKHA 1T6DA 2O8BB 3V4IA 3VOVA 1TK5A 2FF3B 4RW7A 3TABA 1ZC6A 4CIGA 1HYSA 3CXCM 5HL7L 4K8XA 4ZTJA 3UKRA 3SQ0A 4DUZK 3MXJA 1EETA 3I55N 1WUAA 5CR4A 1VQ7N 5J2MA 4NXNK 1XNQK 2D0OA 4OJRA 3NF6A 3O1BA 4RWTA 2Z1HA 4MLHA 1U4BA 3ZT1A 4KREA 3QNOA 2RHKA 3EE9A 4JD2A 5AQZA 2HOEA 1L3SA 3L2UA 4DR4K 4HVJA 4DTPA 4DTNA 2E1ZA 4BY9C 1JLFA 4FM1A 1LW0A 4CHOA 5AQMA 5AQPA 3BF3A 3O3HA 3U4LA 4X65K 3OYLA 1C0TA 5AQQA 1L3VA 4YOXA 1A5XA 5C2DA 3KKRA 3KK3A 3D2FB 1H1VA 3HPOA 3M5RA 1TKTA 1O13A 3TAFA 4DG1A 4OPJA 4YDUC 4BDPA 4JI5K 1BA0A 2A41A 4NYNA 1ZBIA 3WXIA 1B9FA 4WQ5A 4E7IA 2VWBA 4IWVA 5BPMA 3F9KA 3ZLJA 1JL1A 3LDQA 2ZWHA 4FK0A 2BUPA 2XHBA 3QMLA 2NRXA 4BRNA 3VETA 4PL7A 4AHCA 4IDHA 4ELVA 1IKWA 1L3UA 4V19S 2LSNA 3THYA 4GNIA 4BC3A 4BGBA 3KLIA 2AP1A 1XHXA 1FKPA 1BI4B 3K5OA 3CC4N 4DR1K 1YAGA 2FF6A 3O9UA 3THVA 4F2RA 4O5BA 1LAVA 4DTXA 1FK9A 1BISA 1Z25A 4CIEA 5JLHA 4CF2A 1HQEA 1N6QA 2P9UA 1JXEA 4U7BA 4BRMA 5LMUK 1YIJN 3ALYA 3FGUA 4H0PA 2F9TA 5C42A 4CJKA 3KVGA 2G8KA 1T7PA 1WBBA 3OA9A 1TYQB 3K58A 3CCRN 3G71N 1IBMK 3QDKA 4ELUA 1GOAA 2CGLA 3GOIA 1ATSA 3TTCA 1KFDA 2P9IA 3VQBA 3O1WA 2P5GA 3LANA 4JAXA 4FWPA 3A5MC 5CYMA 4OPHA 3B6OA 3OYKA 4BDZA 3SQ1A 2V7ZA 4FSVA 3QETA 5HP1A 3G25A 2P9SB 3O4NA 1TAUA 3AA5X 1VSJA 1X1PA 4M7XA 2PFUA 5KQDA 1HYZA 1ZBSA 1Z26A 3ENHA 1LV5A 3NF7A 3DRRA 1MDUB 4DQRA 3U9ZA 4J2AA 4BR0A 3HL8A 4O5FA 1J5OA 2W6KA 3T7ZA 4CJEA 4A61A 4AHSA 1Q86O 3L2RA 5LY3A 2NRHA 5HROA 4NLBA 5JVHL 1HNXK 4B08A 3VTIA 1QHTA 3V1RA 3ZSWA 1WBDA 1KVBA 4YOVA 3QNNA 1RBUA 3IRXA 3TAQA 5FLXO 4CFAA 5E26A 3G6EN 1QZ6A 4DLEA 3R1XA 1C1BA 3V9UA 4KB1A 2HBMA 2P5OA 4FPAA 3L2WA 3K5NA 5M1FA 3CM6A 3ZSYA 4H5WA 2VG6A 2CH6A 4LFBK 1HUXA 3C0BA 3P1GA 4ID1A 1WSFA 4GW6A 3NBPA 4FLUA 2AA4A 2I5JA 4OPKA 3O3GA 3O6WA 4CJFA 3ID8A 3C7NA 2KW4A 3WNHA 1RGIA 3N4PA 4N76A 2YX6A 4DTSA 4ZTFA 5KRSA 2UUAK 4OKKA 4F3TA 3LWMA 2FLOA 1S22A 4CGIA 2E6MA 1TAQA 5KGWA 3UB5A 4AF1A 5AQTA 3TAMA 4DFPA 2GWJA 4O8UA 3VGMA 4DU3A 2PZSA 3MDQA 1VAZA 5EU7A 3VEVA 2XY7A 2DFFA 4CFCA 3THXA 1BG3A 3RMAA 3OYNA 3G4SN 3OS2A 1NOYA 2E2OA 1NMNA 4YORA 3SJHA 4DSEA 4G1QA 1SKWA 4ISFA 2FBTA 2YHXA 4AH9A 3CFRA 3AVHA 3AVNA 5DM7L 3SUQA 1RBVA 5HRPA 4CEFA 2FXUA 2XO7A 5KPRA 3HM9A 1RTDA 4BRLA 3L4QA 5AQNA 3LDSA 3KK7A 4I6MA 1RDDA 3A2FA 3H45C 4DV0K 3ASMA 2A5XA 3HK2A 3M1FA 4Z4GA 1VQ9N 3H08A 1GLCG 3QINA 3RWUA 4CE9A 3PSIA 3PIPL 1S3XA 4B9MA 3LL3A 1VRUA 5HRRA 2B6AA 4PQUA 4AM6A 3HI0A 4KH6A 3O4WA 1JCEA 1HJRA 1WLJA 3QFUA 3HT3A 5M1PA 5ELZA 3PUFA 2HBKA 1NK6A 2CGKA 1GLFO 1GLDG 3VQDA 1Y64A 1VQON 1T05A 1UOCA 4KBOA 3ZT3A 2HNZA 4CJUA 4M45A 2QA4N 1T03A 1RBRA 1JLAA 2IDOA 3DYAA 2GEMA 3IAYA 1DT9A 4LFAK 1ASUA 1RT1A 4WQ4A 1K9MO 4DSFA 4FOEA 5MLCQ 1KVCA 3K9JA 3TSUA 3WEEB 4BACA 3V9SA 1BUPA 3I0RA 1R0AA 4KRFA 2P9PB 3D2EA 2E88A 3P83D 3U8XA 3I56N 3RMBA 1S5JA 2D0BA 4M3TA 2RE2A 4DS4A 2O8FB 3K0SA 4E7JA 5AQYA 3L3VA 1VK0A 2FC0A 1NOZA 3T1AA 3UE5A 4CZIA 1S1WA 4Y0WA 1S72N 1G15A 1GOCA 3KKSA 4GV3A 3VN5A 4BG8A 1FKOA 4K41A 5GINA 5M1KA 2X6SA 2EHGA 2PYLA 4FZYA 1D9FA 3SNNA 4M3WA 1XNRK 1EKEA 2OPQA 4KH5A 1BCOA 4JRQA 4BRIA 3MK6A 3M8RA 1U49A 3DXMB 1NJYA 1JKHA 5AZJB 3T1YK 1NJZA 2JGUA 5IWAK 4FJIA 4BG9A 3KWIA 3V9ZA 2P9KB 4C8MA 3NF8A 5AQFA 4C8KA 3UIQA 4CBUA 3VPZA 1S6QA 4BR2A 3VGLA 3CMAN 3OY9A 4DSJA 2YHAA 3MCPA
chains in the Genus database with same CATH topology
1HMVA 4FM0A 4Y1CA 1CZBA 4E19A 4KHNA 2Y1IA 4M41A 4YNQA 3KLEA 3AO3A 2KFNA 1TKXA 3CYMA 3V1OA 4N5SA 3NFAA 1QE1A 1XWLA 4B8CA 4IKFA 4BE2A 5I3UA 3RRHA 4L8RB 1KCFA 4CK2A 1S9EA 2BE2A 3AVKA 1X9SA 4CHQA 4FK2A 3AVCA 4DLGA 3LAMA 1MU2A 1REVA 3AA4A 3DLRA 3OJUA 4BWJA 4CGGA 5KRTA 3KK2A 4BE1A 1VRTA 3TAPA 4FJLA 2Y1JA 2IS3A 2VG5A 4FXDA 2IOCA 4CGJA 4AHUA 5E41A 1X9WA 4IG0A 3K2PA 4FLXA 3ISNC 3T3FA 4JRPA 3U6FA 4CJ4A 1UA1A 1TK8A 1WSGA 2ZQBA 1KFSA 5FROA 1KRPA 4CJVA 4DS5A 2F8SA 3AVIA 3S3MA 1NK0A 2OA8A 4W5TA 3VQ4A 2HHSA 2XRIA 4FVMA 4KAZA 1BIUA 2HHUA 1RDAA 1S1XA 4CGHA 3LZIA 5HLFA 1LWEA 5JS1A 2KZZA 3NE6A 3OYCA 1LW2A 1YTAA 2HHTA 4CEZA 4FJ8A 1A5VA 1VSEA 1RCHA 3V1QA 3OYGA 5DMRA 3I0SA 3HXMA 1RTHA 1F21A 4H4OA 1KSPA 4FM2A 4O44A 2HW3A 1RT2A 1Q9XA 3QEIA 4DQQA 3AO2A 4EZ6A 4J2DA 1RTJA 1J53A 1HNVA 4CF8A 1RBTA 2PY5A 1IG9A 3KLHA 3C6UA 1BL3A 5I42A 1ZBLA 1JLGA 4RW6A 5HRNA 4DFMA 3DRPA 3AA2A 3VQ5A 3ZSVA 4B9SA 5C24A 4KTQA 3AVLA 1JLQA 1S6PA 1VSDA 3V4IA 1RT7A 3V9WA 1TK5A 4FJGA 4K8ZA 4QAGA 3ZSZA 4FLWA 1EX4A 4KTWA 3KD5E 4KHSA 4DFJA 4RW7A 3SYZA 4F8RA 1YT3A 3S3OA 3TABA 4BWMA 4CIGA 3AVBA 1HYSA 1U04A 3NHGA 4FYDA 4FJKA 4CEOA 4BDYA 4K8XA 1SV5A 3DMJA 5FDLA 4ZTJA 2GV9A 3SQ0A 3MXJA 4ZHRA 1EETA 4M42A 4E1NA 1C1AA 5K14A 3TWHA 3S9HA 2HVIA 1I3AA 2E4LA 3M8QA 3ZCMA 5J2MA 4DTUA 4HUEA 3WNFA 4OJRA 1NK5A 3NF6A 2HB5A 3I8DA 4CIFA 3K5MA 4KI6A 2Z1HA 4Z4IA 2DTUA 2RF2A 4CJSA 4CJTA 5CY4A 1U4BA 4NCGA 4C8NA 2HHQA 3ZT1A 4KREA 3QNOA 3LP2A 1KTQA 1GOBA 1WAFA 2D0AA 4N56A 1L3SA 3VQEA 3L2UA 2HNDA 4HVJA 4W5RA 3SZ2A 4DTPA 4DTNA 1JLFA 3TR8A 3KJVA 4FM1A 5J2NA 1UWBA 1LW0A 1WN7A 4O55A 4CHOA 3QESA 3V81A 4FJNA 1BHLA 1D9DA 3O3HA 4Z4HA 3OYLA 1C0TA 4CJ5A 4DF8A 3TANA 4DSKA 2YKMA 4CEBA 1L3VA 3CQ8A 1VSLA 2ITGA 2RKIA 1A5XA 3KKRA 4EP5A 3KK3A 2ZE2A 4HUFA 4OKEA 3HPOA 2HMIA 4IBNA 1XI1A 4GMJB 4O4GA 1B92A 1TKTA 3TAFA 4DQIA 4DU4A 2XY5A 4JS5A 4DG1A 4OGCA 4OPJA 4BDPA 4CHZA 4H4MA 3TI0A 4EP4A 4NYNA 4DWIA 1C1CA 1SKRA 1ZBIA 1B9FA 1IO2A 1NKCA 4E7IA 4OLBA 1S1UA 3F9KA 4M3ZA 1ASVA 2GBZA 1JL1A 3QO9A 5KI6A 3PY8A 4LSNA 3V6DA 4DTRA 3QEXA 1WNSA 5HRSA 1ZBUA 4CFBA 4FK0A 4M3XA 1ZYQA 2EX3A 2FBVA 4DSIA 2G8FA 3HVRA 2XHBA 3AVJA 3PX6A 4KFBA 1RT6A 4HUGA 1ZBFA 2F96A 4R5PA 4AHCA 1WSIA 1J54A 3B6PA 4HCBA 4FW1A 1IKWA 1L3UA 1KVAA 4ELVA 2LSNA 4FJMA 4KHQA 3PO4A 2QK9A 3NGZA 3KLIA 1XHXA 4B3OA 1FKPA 3NDKA 2KQ2A 1BI4B 3K5OA 1SL0A 1NK8A 1CZ9A 1RBSA 4F4KA 3THVA 3OYEA 4FW2A 4HHTA 4F2RA 4PWDA 4Q5VA 4O5BA 1LAVA 4DTXA 1QSYA 4CJQA 1FXXA 1FK9A 1BISA 1Z25A 2YKNA 4CIEA 3KLGA 4CF2A 3PO5A 1HQEA 2YNFA 4LD0A 1N6QA 5T7BA 1JXEA 4KHUA 2QKBA 2KZMA 1NKEA 4KHWA 1HPZA 1IH7A 3KLFA 3ALYA 1EP4A 4B9LA 1TGOA 1NK9A 4FJXA 5C42A 1JLBA 3RRGA 4CJKA 3G0ZA 2O4GA 1Q9YA 3DOLA 2G8KA 1T7PA 3AVMA 5SZTA 1J9AA 4I2QA 2AJQA 1LAWA 3VQAA 1IKYA 3JYTA 3P5JA 3U3GA 3K58A 1S1TA 2OZSA 4ELUA 1RNHA 1GOAA 4DTJA 3V9XA 3SUPA 2VWJA 3IS9A 1KFDA 1XHZA 1BQNA 5FRMA 3VQBA 2P5GA 3HP9A 3LANA 1T8EA 5SWMA 1LWCA 2WOMA 2GUIA 4BE0A 3ZSQA 4Z4FA 1Q8IA 3SQ4A 1CLQA 1JL2A 1IKXA 5CYMA 3EZ5A 2X78A 1RT3A 4FJHA 3B6OA 4NCAA 3OYKA 3VQPA 3DLHA 3QIOA 4PY5A 1C0UA 1RDBA 4E3SA 1EXQA 3LP1A 3NF9A 2Z1GA 4BDZA 2A1RA 5FRNA 4I7FA 4RG8A 4KKOA 3SQ1A 5HP1A 3QETA 4W5OA 2YHBA 3O4NA 1TAUA 3AA5X 1VSJA 1X1PA 2Q3SA 3SV4A 1DTQA 1HYZA 3KTQA 4N41A 1Z26A 2E6LA 1C6VA 1LV5A 1A5WA 3MEGA 3NF7A 2XY6A 3DRRA 3NH2A 2IC3A 3M8SA 4DQRA 4J2AA 3HL8A 1J5OA 1SL1A 2QKKA 3MEDA 4CJEA 4FLYA 4DTMA 4AHSA 3TAEA 3OS0A 2NUBA 1ZBHA 3SUNA 3CM5A 3NH1A 3L2RA 5HROA 3DLBA 5CZ1A 4CGFA 2B5JA 1JLEA 3LZJA 1VSKA 2IAJA 1S1VA 4B08A 3OJSA 3LPTA 1QHTA 5CYQA 1N5YA 3V1RA 3ZSWA 4CEEA 1WSHA 1KVBA 3DRSA 1VSFA 1W9HA 5J2QA 4CESA 3HO1A 3QNNA 4ID5A 1RBUA 3AV9A 4HCCA 1HYVA 1JXBA 4H8KA 1UAXA 1RILA 2HNYA 3IRXA 3O4QA 4RW8A 4E7KA 3TAQA 3RTVA 4CFAA 2Z1JA 2XY8A 4O0JA 3MECA 4FLZA 4FLVA 1TL1A 4DLEA 3TAGA 2DY4A 3MXIA 2F8TA 1C1BA 4NYFA 1NKBA 3LALA 3V9UA 4KB1A 4XIUA 3NAEA 2P5OA 4KHYA 3ZT0A 3DLKA 3L2WA 1QQCA 3K5NA 2Z1IA 5D3GA 3KD1E 1TKZA 5C25A 3CM6A 4Q0BA 3ZSYA 4CHPA 4Z4EA 4M3YA 2VG6A 3AO1A 2X74A 3P1GA 4ID1A 1WSFA 3KK1A 4GW6A 2JLEA 3HPGA 1HQUA 3VQ8A 3NBPA 4FLUA 2I5JA 4OPKA 3O3GA 3RMDA 4LH4A 4CJFA 4JS4A 1SL2A 2YNIA 4F3OA 3LP3A 2KW4A 4LH5A 4FK4A 3WNHA 4KB0A 1VSIA 4N76A 4CF0A 4CFDA 1HNIA 4GVMA 4CJ3A 2OPRA 1WSJA 3MAQA 3NGIA 4DTSA 1TL3A 4ZTFA 5KRSA 1ITGA 3AA3A 4OKKA 2IGIA 3K57A 4F3TA 3WNEA 3LWMA 4FLTA 2RN2A 4ICLA 4WE1A 5CZ2A 1O1WA 2ETJA 4CGIA 2E6MA 3AO4A 4DQSA 1TAQA 4FJ5A 4AHTA 3ULDA 5KGWA 2YV0X 4IG3A 4CJPA 1CXQA 2OPPA 3TAMA 4DFPA 3OYJA 2G8VA 4AHRA 3ZSOA 4F2SA 4DU3A 2DFEA 3SV3A 2PZSA 1X9MA 3LP0A 4OVLA 4E7LA 1TKDA 4KPYA 3CFOA 3SJJA 5EU7A 5KTQA 3DI6A 4AHVA 3EYZA 2XY7A 2DFFA 4CFCA 2D5RA 4OKJA 3CFPA 3RMAA 3L2QA 3OYNA 4FJ7A 4FJ9A 2BANA 3OYFA 5J2PA 3HJFA 3OS2A 3OYHA 1NOYA 4DSEA 4G1QA 1QSLA 1SKWA 1U47A 4E89A 3BDPA 4RW4A 4N47A 2B4JA 2FBTA 3HPHA 1WSEA 4AH9A 3CFRA 3AVHA 3OYMA 3DM2A 3AVNA 4FCYA 1Y97A 3SUQA 3RR8A 3WNGA 1L5UA 1RBVA 4PA1A 5HRPA 3QLHA 4CEFA 1WAJA 5J1EA 2XO7A 2G8WA 3ZT2A 3HM9A 2P51A 3C94A 3T19A 1RTDA 2A1SA 4CJRA 2ATQA 4OGEA 1KLNA 4J2BA 3LDSA 2HHXA 3VA0A 1RDDA 4KI4A 4B9TA 3A2FA 3PV8A 3DOKA 3M8PA 3ASMA 4TSXA 3MXMA 3PX4A 1UA0A 3HK2A 2VWKA 5JS2A 4Z4CA 1SUQA 4AILC 3O3FA 2BDPA 3DLEA 4NCBA 3FFIA 3ZT4A 3L2VA 4Z4GA 3H08A 1CXUA 4CECA 1U45A 2OYQA 2OPSA 3QINA 2HHWA 3LAKA 4C8OA 3ZSRA 3RWUA 4CE9A 1ASWA 4YFUA 4HTUA 3RR7A 4B9MA 1YVUA 1VRUA 5HRRA 3S3NA 2B6AA 2QXFA 4DU1A 3RMCA 2OZMA 4B8AB 3E01A 4O0IA 4PQUA 3D45A 3NH0A 3QIPA 1DTTA 4Y1DA 3D0PA 2YNGA 2KTQA 3C6TA 3KIOA 4MQ3A 4B9NA 2R7YA 3BGRA 4CEAA 1BCMA 1NJWA 3NGYA 1BIZA 1HJRA 2ZD1A 3OYAA 3QERA 3K59A 2G8IA 4W5NA 5KGXA 3F73A 1WLJA 3SQ2A 1BQMA 3HT3A 3LPUA 4FZZA 2W42A 3AVGA 1S9GA 3PUFA 3OVNA 1VSMA 4KV8A 4I9LA 5HBMA 4DFKA 1NK6A 4B9UA 1DLOA 4LSLA 3VQ7A 2D0CA 3C95A 3SPZA 1K6YA 3VQDA 4CF1A 3SI6A 3ZSXA 3L8BA 2X6NA 3HYFA 4CEQA 1TV6A 1UOCA 4CK1A 1T05A 2HVHA 3ZT3A 4I9QA 2HNZA 3ITHA 1RT4A 1VSHA 4CJUA 3JSMA 3EY1A 3QEVA 4CF9A 1NK4A 4M45A 1IKVA 4CJWA 1NK7A 1T03A 1RBRA 3OYBA 1C0MA 1JLAA 2FBXA 2IDOA 3DYAA 3OYDA 4IFVA 4CERA 3L3UA 2VG7A 3IAYA 3VQ9A 1ASUA 3VQ6A 2FBYA 1YTUA 1RT1A 4I2PA 1L3TA 4EZ9A 4DQPA 2PYJA 1TVRA 1BI4A 4DSFA 4LY7A 4E7HA 1I39A 1KVCA 3V9SA 4IFYA 4JLHA 1LWFA 4BACA 2YNHA 4UQGA 4DF4A 3I0RA 1R0AA 4KRFA 1RDCA 3P83D 4E1MA 1HRHA 4M3RA 1QS4A 3SPYA 3AO5A 1KLMA 2DFHA 4KO0A 3RMBA 1QTMA 2KFZA 2P1JA 4CHNA 1S5JA 2D0BA 3AVAA 4MFBA 4FZXC 4M3TA 4OLAA 3CG7A 4DS4A 4DSLA 1W0HA 4E7JA 4DTOA 3L3VA 1VK0A 2HHVA 2FC0A 1D8YA 1NOZA 3T1AA 3PX0A 1S1WA 1G15A 1GOCA 4CGDA 3KKSA 4E0DA 3VN5A 3U3YA 1FKOA 1NJXA 2X6SA 4CCHA 2EHGA 4CHYA 2PYLA 4FZYA 3QEWA 3VQCA 2WONA 3SNNA 1D9FA 3HSTB 1SKSA 4J2EA 4M3WA 1EKEA 2OPQA 3OS1A 3SCXA 4B9VA 1D5AA 1BCOA 3HP6A 3IG1A 4JRQA 3NCIA 4PUOA 1RT5A 4RW9A 4QCLA 3DLGA 3HVTA 1QSSA 4FJJA 4CJLA 3OYIA 3M8RA 3TARA 1U49A 1U48A 4QOZB 4CK3A 3LWLA 4Z0UA 1JKHA 3MEEA 4CEDA 4DMNA 1XC9A 4KTZA 1NJYA 5DK5A 1RTIA 1NJZA 2JGUA 4ELTA 4W5QA 4FJIA 2G8UA 3G10A 3V9ZA 3VQQA 3K5LA 1BGXT 4C8MA 3QEPA 4C8LA 3NF8A 4C8KA 3UIQA 2G8HA 2BGGA 3AVFA 1S6QA 1B9DA 1JLCA 4M3UA 4IDKA 3OY9A 3VA3A 4DSJA 3SUOA 2YHAA 2O4IA 1TK0A 2RPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMV A;  4FM0 A;  4Y1C A;  1CZB A;  4E19 A;  4KHN A;  2Y1I A;  4M41 A;  4YNQ A;  3KLE A;  3AO3 A;  2KFN A;  1TKX A;  3CYM A;  3V1O A;  4N5S A;  3NFA A;  1QE1 A;  1XWL A;  4B8C A;  4IKF A;  4BE2 A;  5I3U A;  3RRH A;  4L8R B;  1KCF A;  4CK2 A;  1S9E A;  2BE2 A;  3AVK A;  1X9S A;  4CHQ A;  4FK2 A;  3AVC A;  4DLG A;  3LAM A;  1MU2 A;  1REV A;  3AA4 A;  3DLR A;  3OJU A;  4BWJ A;  4CGG A;  5KRT A;  3KK2 A;  4BE1 A;  1VRT A;  3TAP A;  4FJL A;  2Y1J A;  2IS3 A;  2VG5 A;  4FXD A;  2IOC A;  4CGJ A;  4AHU A;  5E41 A;  1X9W A;  4IG0 A;  3K2P A;  4FLX A;  3ISN C;  3T3F A;  4JRP A;  3U6F A;  4CJ4 A;  1UA1 A;  1TK8 A;  1WSG A;  2ZQB A;  1KFS A;  5FRO A;  1KRP A;  4CJV A;  4DS5 A;  2F8S A;  3AVI A;  3S3M A;  1NK0 A;  2OA8 A;  4W5T A;  3VQ4 A;  2HHS A;  2XRI A;  4FVM A;  4KAZ A;  1BIU A;  2HHU A;  1RDA A;  1S1X A;  4CGH A;  3LZI A;  5HLF A;  1LWE A;  5JS1 A;  2KZZ A;  3NE6 A;  3OYC A;  1LW2 A;  1YTA A;  2HHT A;  4CEZ A;  4FJ8 A;  1A5V A;  1VSE A;  1RCH A;  3V1Q A;  3OYG A;  5DMR A;  3I0S A;  3HXM A;  1RTH A;  1F21 A;  4H4O A;  1KSP A;  4FM2 A;  4O44 A;  2HW3 A;  1RT2 A;  1Q9X A;  3QEI A;  4DQQ A;  3AO2 A;  4EZ6 A;  4J2D A;  1RTJ A;  1J53 A;  1HNV A;  4CF8 A;  1RBT A;  2PY5 A;  1IG9 A;  3KLH A;  3C6U A;  1BL3 A;  5I42 A;  1ZBL A;  1JLG A;  4RW6 A;  5HRN A;  4DFM A;  3DRP A;  3AA2 A;  3VQ5 A;  3ZSV A;  4B9S A;  5C24 A;  4KTQ A;  3AVL A;  1JLQ A;  1S6P A;  1VSD A;  3V4I A;  1RT7 A;  3V9W A;  1TK5 A;  4FJG A;  4K8Z A;  4QAG A;  3ZSZ A;  4FLW A;  1EX4 A;  4KTW A;  3KD5 E;  4KHS A;  4DFJ A;  4RW7 A;  3SYZ A;  4F8R A;  1YT3 A;  3S3O A;  3TAB A;  4BWM A;  4CIG A;  3AVB A;  1HYS A;  1U04 A;  3NHG A;  4FYD A;  4FJK A;  4CEO A;  4BDY A;  4K8X A;  1SV5 A;  3DMJ A;  5FDL A;  4ZTJ A;  2GV9 A;  3SQ0 A;  3MXJ A;  4ZHR A;  1EET A;  4M42 A;  4E1N A;  1C1A A;  5K14 A;  3TWH A;  3S9H A;  2HVI A;  1I3A A;  2E4L A;  3M8Q A;  3ZCM A;  5J2M A;  4DTU A;  4HUE A;  3WNF A;  4OJR A;  1NK5 A;  3NF6 A;  2HB5 A;  3I8D A;  4CIF A;  3K5M A;  4KI6 A;  2Z1H A;  4Z4I A;  2DTU A;  2RF2 A;  4CJS A;  4CJT A;  5CY4 A;  1U4B A;  4NCG A;  4C8N A;  2HHQ A;  3ZT1 A;  4KRE A;  3QNO A;  3LP2 A;  1KTQ A;  1GOB A;  1WAF A;  2D0A A;  4N56 A;  1L3S A;  3VQE A;  3L2U A;  2HND A;  4HVJ A;  4W5R A;  3SZ2 A;  4DTP A;  4DTN A;  1JLF A;  3TR8 A;  3KJV A;  4FM1 A;  5J2N A;  1UWB A;  1LW0 A;  1WN7 A;  4O55 A;  4CHO A;  3QES A;  3V81 A;  4FJN A;  1BHL A;  1D9D A;  3O3H A;  4Z4H A;  3OYL A;  1C0T A;  4CJ5 A;  4DF8 A;  3TAN A;  4DSK A;  2YKM A;  4CEB A;  1L3V A;  3CQ8 A;  1VSL A;  2ITG A;  2RKI A;  1A5X A;  3KKR A;  4EP5 A;  3KK3 A;  2ZE2 A;  4HUF A;  4OKE A;  3HPO A;  2HMI A;  4IBN A;  1XI1 A;  4GMJ B;  4O4G A;  1B92 A;  1TKT A;  3TAF A;  4DQI A;  4DU4 A;  2XY5 A;  4JS5 A;  4DG1 A;  4OGC A;  4OPJ A;  4BDP A;  4CHZ A;  4H4M A;  3TI0 A;  4EP4 A;  4NYN A;  4DWI A;  1C1C A;  1SKR A;  1ZBI A;  1B9F A;  1IO2 A;  1NKC A;  4E7I A;  4OLB A;  1S1U A;  3F9K A;  4M3Z A;  1ASV A;  2GBZ A;  1JL1 A;  3QO9 A;  5KI6 A;  3PY8 A;  4LSN A;  3V6D A;  4DTR A;  3QEX A;  1WNS A;  5HRS A;  1ZBU A;  4CFB A;  4FK0 A;  4M3X A;  1ZYQ A;  2EX3 A;  2FBV A;  4DSI A;  2G8F A;  3HVR A;  2XHB A;  3AVJ A;  3PX6 A;  4KFB A;  1RT6 A;  4HUG A;  1ZBF A;  2F96 A;  4R5P A;  4AHC A;  1WSI A;  1J54 A;  3B6P A;  4HCB A;  4FW1 A;  1IKW A;  1L3U A;  1KVA A;  4ELV A;  2LSN A;  4FJM A;  4KHQ A;  3PO4 A;  2QK9 A;  3NGZ A;  3KLI A;  1XHX A;  4B3O A;  1FKP A;  3NDK A;  2KQ2 A;  1BI4 B;  3K5O A;  1SL0 A;  1NK8 A;  1CZ9 A;  1RBS A;  4F4K A;  3THV A;  3OYE A;  4FW2 A;  4HHT A;  4F2R A;  4PWD A;  4Q5V A;  4O5B A;  1LAV A;  4DTX A;  1QSY A;  4CJQ A;  1FXX A;  1FK9 A;  1BIS A;  1Z25 A;  2YKN A;  4CIE A;  3KLG A;  4CF2 A;  3PO5 A;  1HQE A;  2YNF A;  4LD0 A;  1N6Q A;  5T7B A;  1JXE A;  4KHU A;  2QKB A;  2KZM A;  1NKE A;  4KHW A;  1HPZ A;  1IH7 A;  3KLF A;  3ALY A;  1EP4 A;  4B9L A;  1TGO A;  1NK9 A;  4FJX A;  5C42 A;  1JLB A;  3RRG A;  4CJK A;  3G0Z A;  2O4G A;  1Q9Y A;  3DOL A;  2G8K A;  1T7P A;  3AVM A;  5SZT A;  1J9A A;  4I2Q A;  2AJQ A;  1LAW A;  3VQA A;  1IKY A;  3JYT A;  3P5J A;  3U3G A;  3K58 A;  1S1T A;  2OZS A;  4ELU A;  1RNH A;  1GOA A;  4DTJ A;  3V9X A;  3SUP A;  2VWJ A;  3IS9 A;  1KFD A;  1XHZ A;  1BQN A;  5FRM A;  3VQB A;  2P5G A;  3HP9 A;  3LAN A;  1T8E A;  5SWM A;  1LWC A;  2WOM A;  2GUI A;  4BE0 A;  3ZSQ A;  4Z4F A;  1Q8I A;  3SQ4 A;  1CLQ A;  1JL2 A;  1IKX A;  5CYM A;  3EZ5 A;  2X78 A;  1RT3 A;  4FJH A;  3B6O A;  4NCA A;  3OYK A;  3VQP A;  3DLH A;  3QIO A;  4PY5 A;  1C0U A;  1RDB A;  4E3S A;  1EXQ A;  3LP1 A;  3NF9 A;  2Z1G A;  4BDZ A;  2A1R A;  5FRN A;  4I7F A;  4RG8 A;  4KKO A;  3SQ1 A;  5HP1 A;  3QET A;  4W5O A;  2YHB A;  3O4N A;  1TAU A;  3AA5 X;  1VSJ A;  1X1P A;  2Q3S A;  3SV4 A;  1DTQ A;  1HYZ A;  3KTQ A;  4N41 A;  1Z26 A;  2E6L A;  1C6V A;  1LV5 A;  1A5W A;  3MEG A;  3NF7 A;  2XY6 A;  3DRR A;  3NH2 A;  2IC3 A;  3M8S A;  4DQR A;  4J2A A;  3HL8 A;  1J5O A;  1SL1 A;  2QKK A;  3MED A;  4CJE A;  4FLY A;  4DTM A;  4AHS A;  3TAE A;  3OS0 A;  2NUB A;  1ZBH A;  3SUN A;  3CM5 A;  3NH1 A;  3L2R A;  5HRO A;  3DLB A;  5CZ1 A;  4CGF A;  2B5J A;  1JLE A;  3LZJ A;  1VSK A;  2IAJ A;  1S1V A;  4B08 A;  3OJS A;  3LPT A;  1QHT A;  5CYQ A;  1N5Y A;  3V1R A;  3ZSW A;  4CEE A;  1WSH A;  1KVB A;  3DRS A;  1VSF A;  1W9H A;  5J2Q A;  4CES A;  3HO1 A;  3QNN A;  4ID5 A;  1RBU A;  3AV9 A;  4HCC A;  1HYV A;  1JXB A;  4H8K A;  1UAX A;  1RIL A;  2HNY A;  3IRX A;  3O4Q A;  4RW8 A;  4E7K A;  3TAQ A;  3RTV A;  4CFA A;  2Z1J A;  2XY8 A;  4O0J A;  3MEC A;  4FLZ A;  4FLV A;  1TL1 A;  4DLE A;  3TAG A;  2DY4 A;  3MXI A;  2F8T A;  1C1B A;  4NYF A;  1NKB A;  3LAL A;  3V9U A;  4KB1 A;  4XIU A;  3NAE A;  2P5O A;  4KHY A;  3ZT0 A;  3DLK A;  3L2W A;  1QQC A;  3K5N A;  2Z1I A;  5D3G A;  3KD1 E;  1TKZ A;  5C25 A;  3CM6 A;  4Q0B A;  3ZSY A;  4CHP A;  4Z4E A;  4M3Y A;  2VG6 A;  3AO1 A;  2X74 A;  3P1G A;  4ID1 A;  1WSF A;  3KK1 A;  4GW6 A;  2JLE A;  3HPG A;  1HQU A;  3VQ8 A;  3NBP A;  4FLU A;  2I5J A;  4OPK A;  3O3G A;  3RMD A;  4LH4 A;  4CJF A;  4JS4 A;  1SL2 A;  2YNI A;  4F3O A;  3LP3 A;  2KW4 A;  4LH5 A;  4FK4 A;  3WNH A;  4KB0 A;  1VSI A;  4N76 A;  4CF0 A;  4CFD A;  1HNI A;  4GVM A;  4CJ3 A;  2OPR A;  1WSJ A;  3MAQ A;  3NGI A;  4DTS A;  1TL3 A;  4ZTF A;  5KRS A;  1ITG A;  3AA3 A;  4OKK A;  2IGI A;  3K57 A;  4F3T A;  3WNE A;  3LWM A;  4FLT A;  2RN2 A;  4ICL A;  4WE1 A;  5CZ2 A;  1O1W A;  2ETJ A;  4CGI A;  2E6M A;  3AO4 A;  4DQS A;  1TAQ A;  4FJ5 A;  4AHT A;  3ULD A;  5KGW A;  2YV0 X;  4IG3 A;  4CJP A;  1CXQ A;  2OPP A;  3TAM A;  4DFP A;  3OYJ A;  2G8V A;  4AHR A;  3ZSO A;  4F2S A;  4DU3 A;  2DFE A;  3SV3 A;  2PZS A;  1X9M A;  3LP0 A;  4OVL A;  4E7L A;  1TKD A;  4KPY A;  3CFO A;  3SJJ A;  5EU7 A;  5KTQ A;  3DI6 A;  4AHV A;  3EYZ A;  2XY7 A;  2DFF A;  4CFC A;  2D5R A;  4OKJ A;  3CFP A;  3RMA A;  3L2Q A;  3OYN A;  4FJ7 A;  4FJ9 A;  2BAN A;  3OYF A;  5J2P A;  3HJF A;  3OS2 A;  3OYH A;  1NOY A;  4DSE A;  4G1Q A;  1QSL A;  1SKW A;  1U47 A;  4E89 A;  3BDP A;  4RW4 A;  4N47 A;  2B4J A;  2FBT A;  3HPH A;  1WSE A;  4AH9 A;  3CFR A;  3AVH A;  3OYM A;  3DM2 A;  3AVN A;  4FCY A;  1Y97 A;  3SUQ A;  3RR8 A;  3WNG A;  1L5U A;  1RBV A;  4PA1 A;  5HRP A;  3QLH A;  4CEF A;  1WAJ A;  5J1E A;  2XO7 A;  2G8W A;  3ZT2 A;  3HM9 A;  2P51 A;  3C94 A;  3T19 A;  1RTD A;  2A1S A;  4CJR A;  2ATQ A;  4OGE A;  1KLN A;  4J2B A;  3LDS A;  2HHX A;  3VA0 A;  1RDD A;  4KI4 A;  4B9T A;  3A2F A;  3PV8 A;  3DOK A;  3M8P A;  3ASM A;  4TSX A;  3MXM A;  3PX4 A;  1UA0 A;  3HK2 A;  2VWK A;  5JS2 A;  4Z4C A;  1SUQ A;  4AIL C;  3O3F A;  2BDP A;  3DLE A;  4NCB A;  3FFI A;  3ZT4 A;  3L2V A;  4Z4G A;  3H08 A;  1CXU A;  4CEC A;  1U45 A;  2OYQ A;  2OPS A;  3QIN A;  2HHW A;  3LAK A;  4C8O A;  3ZSR A;  3RWU A;  4CE9 A;  1ASW A;  4YFU A;  4HTU A;  3RR7 A;  4B9M A;  1YVU A;  1VRU A;  5HRR A;  3S3N A;  2B6A A;  2QXF A;  4DU1 A;  3RMC A;  2OZM A;  4B8A B;  3E01 A;  4O0I A;  4PQU A;  3D45 A;  3NH0 A;  3QIP A;  1DTT A;  4Y1D A;  3D0P A;  2YNG A;  2KTQ A;  3C6T A;  3KIO A;  4MQ3 A;  4B9N A;  2R7Y A;  3BGR A;  4CEA A;  1BCM A;  1NJW A;  3NGY A;  1BIZ A;  1HJR A;  2ZD1 A;  3OYA A;  3QER A;  3K59 A;  2G8I A;  4W5N A;  5KGX A;  3F73 A;  1WLJ A;  3SQ2 A;  1BQM A;  3HT3 A;  3LPU A;  4FZZ A;  2W42 A;  3AVG A;  1S9G A;  3PUF A;  3OVN A;  1VSM A;  4KV8 A;  4I9L A;  5HBM A;  4DFK A;  1NK6 A;  4B9U A;  1DLO A;  4LSL A;  3VQ7 A;  2D0C A;  3C95 A;  3SPZ A;  1K6Y A;  3VQD A;  4CF1 A;  3SI6 A;  3ZSX A;  3L8B A;  2X6N A;  3HYF A;  4CEQ A;  1TV6 A;  1UOC A;  4CK1 A;  1T05 A;  2HVH A;  3ZT3 A;  4I9Q A;  2HNZ A;  3ITH A;  1RT4 A;  1VSH A;  4CJU A;  3JSM A;  3EY1 A;  3QEV A;  4CF9 A;  1NK4 A;  4M45 A;  1IKV A;  4CJW A;  1NK7 A;  1T03 A;  1RBR A;  3OYB A;  1C0M A;  1JLA A;  2FBX A;  2IDO A;  3DYA A;  3OYD A;  4IFV A;  4CER A;  3L3U A;  2VG7 A;  3IAY A;  3VQ9 A;  1ASU A;  3VQ6 A;  2FBY A;  1YTU A;  1RT1 A;  4I2P A;  1L3T A;  4EZ9 A;  4DQP A;  2PYJ A;  1TVR A;  1BI4 A;  4DSF A;  4LY7 A;  4E7H A;  1I39 A;  1KVC A;  3V9S A;  4IFY A;  4JLH A;  1LWF A;  4BAC A;  2YNH A;  4UQG A;  4DF4 A;  3I0R A;  1R0A A;  4KRF A;  1RDC A;  3P83 D;  4E1M A;  1HRH A;  4M3R A;  1QS4 A;  3SPY A;  3AO5 A;  1KLM A;  2DFH A;  4KO0 A;  3RMB A;  1QTM A;  2KFZ A;  2P1J A;  4CHN A;  1S5J A;  2D0B A;  3AVA A;  4MFB A;  4FZX C;  4M3T A;  4OLA A;  3CG7 A;  4DS4 A;  4DSL A;  1W0H A;  4E7J A;  4DTO A;  3L3V A;  1VK0 A;  2HHV A;  2FC0 A;  1D8Y A;  1NOZ A;  3T1A A;  3PX0 A;  1S1W A;  1G15 A;  1GOC A;  4CGD A;  3KKS A;  4E0D A;  3VN5 A;  3U3Y A;  1FKO A;  1NJX A;  2X6S A;  4CCH A;  2EHG A;  4CHY A;  2PYL A;  4FZY A;  3QEW A;  3VQC A;  2WON A;  3SNN A;  1D9F A;  3HST B;  1SKS A;  4J2E A;  4M3W A;  1EKE A;  2OPQ A;  3OS1 A;  3SCX A;  4B9V A;  1D5A A;  1BCO A;  3HP6 A;  3IG1 A;  4JRQ A;  3NCI A;  4PUO A;  1RT5 A;  4RW9 A;  4QCL A;  3DLG A;  3HVT A;  1QSS A;  4FJJ A;  4CJL A;  3OYI A;  3M8R A;  3TAR A;  1U49 A;  1U48 A;  4QOZ B;  4CK3 A;  3LWL A;  4Z0U A;  1JKH A;  3MEE A;  4CED A;  4DMN A;  1XC9 A;  4KTZ A;  1NJY A;  5DK5 A;  1RTI A;  1NJZ A;  2JGU A;  4ELT A;  4W5Q A;  4FJI A;  2G8U A;  3G10 A;  3V9Z A;  3VQQ A;  3K5L A;  1BGX T;  4C8M A;  3QEP A;  4C8L A;  3NF8 A;  4C8K A;  3UIQ A;  2G8H A;  2BGG A;  3AVF A;  1S6Q A;  1B9D A;  1JLC A;  4M3U A;  4IDK A;  3OY9 A;  3VA3 A;  4DSJ A;  3SUO A;  2YHA A;  2O4I A;  1TK0 A;  2RPI A; 
#chains in the Genus database with same CATH topology
 1HMV A;  5AQX A;  3F5T A;  5H1S Q;  4DHY A;  1ESV A;  4N5S A;  1QE1 A;  4BE2 A;  3RRH A;  1D4X A;  2P9N A;  3CCV N;  5JLF A;  1C0F A;  3CCQ N;  2V51 B;  5FPM A;  2PAV A;  3LAM A;  3DLR A;  3TAP A;  3NVK A;  4BWJ A;  4CGG A;  4R79 A;  3CCM N;  1VRT A;  4BRK A;  5ADX H;  4AHU A;  4IG0 A;  1VQM N;  4CJ4 A;  1WSG A;  5FRO A;  1YI2 N;  3CCL N;  2ITM A;  4C23 A;  2IVN A;  3VQ4 A;  4BQZ A;  4W5T A;  2HHS A;  4YY3 K;  5HLF A;  5JS1 A;  4BRQ A;  3ZET A;  1YTA A;  3E9L A;  3VEX A;  1XUP O;  4B3S K;  3OYG A;  3HXM A;  1RTH A;  2W41 A;  3QEI A;  5C15 A;  4EZ6 A;  1RTJ A;  1J53 A;  1HNV A;  1JLG A;  4RW6 A;  5HRN A;  5EX5 A;  3DRP A;  4H0X B;  3J7Y P;  4DR3 K;  4KTQ A;  3V9W A;  2O8D A;  3ZEU B;  4QAG A;  4K8Z A;  3VEZ A;  1YF5 L;  1EX4 A;  3KD5 E;  3GE1 A;  2OTL N;  3EL2 A;  3L0Q A;  3ULE A;  1M1K O;  4F8R A;  3NHG A;  4FYD A;  3DLL L;  4BVO A;  3DMJ A;  2GV9 A;  2NNW A;  3LDO A;  5GIO A;  4NB4 A;  4IOX A;  4M42 A;  4CZE A;  3TWH A;  2HVI A;  1I3A A;  3F2K A;  3ZCM A;  1NWK A;  1VHX A;  3LDP A;  3DXK B;  1NK5 A;  4CIF A;  4JI7 K;  4Z4I A;  3IMX A;  3VEW A;  4CJS A;  4CJT A;  4YHH K;  2A40 A;  4C8N A;  3SMP A;  1GOB A;  3RSE A;  1BO5 O;  4DV6 K;  3A5N C;  5J2N A;  1UWB A;  4H5V A;  4O55 A;  4BRO A;  3CCU N;  3KWG A;  3QES A;  4OPA A;  3V81 A;  3LM2 A;  2HBL A;  4Z4H A;  1HPM A;  2YKM A;  4CEB A;  5LJW A;  3CQ8 A;  2RKI A;  2HMI A;  2HST A;  1HNZ K;  1XI1 A;  4GMJ B;  2A6A A;  1Q81 O;  4DU4 A;  2XY5 A;  4OGC A;  3GBT A;  1Q7Y O;  1IO2 A;  1YJW N;  1GLJ O;  4OLB A;  1ASV A;  5KI6 A;  3M6G A;  3FZH A;  4BR9 A;  1ZBU A;  4CFB A;  2P9L A;  2EX3 A;  2FBV A;  4KFB A;  2UU9 K;  2F9W A;  1WSI A;  4FW1 A;  1KVA A;  1W7A A;  2BH1 A;  4C1N I;  4FJM A;  2QK9 A;  3PO4 A;  1KAX A;  2KQ2 A;  3GG4 A;  5HOO A;  1CZ9 A;  3OYE A;  1QSY A;  4FWM A;  3EN9 A;  1FXX A;  4KHP K;  5IT9 O;  2YKN A;  4ILG B;  1VQP N;  2QKB A;  3VEO A;  1NKE A;  2YI1 A;  4B9L A;  1NK9 A;  4FJX A;  1JLB A;  1Q9Y A;  2YJF A;  1QVF M;  4I2Q A;  3VQA A;  1IKY A;  3JYT A;  4BRH A;  3U3G A;  4DTJ A;  3V9X A;  2I7N A;  3IS9 A;  5BPN A;  5SWM A;  1SS6 A;  2O8C B;  1LWC A;  4BE0 A;  3ZSQ A;  4Z4F A;  1CLQ A;  3EZ5 A;  2X78 A;  1RT3 A;  4FJH A;  3VQP A;  3E66 A;  3UKU B;  4PY5 A;  2A1R A;  4KKO A;  3ZX2 A;  2ZF5 O;  4W5O A;  2KLA A;  5BR9 A;  3C6H A;  3SV4 A;  1V4T A;  3KTQ A;  3ATU A;  1TUU A;  3MEG A;  4MO5 A;  3TTF A;  3OW2 M;  1VQ8 N;  2O8E B;  3VMF B;  1SL1 A;  4K25 A;  3TAE A;  1QZ5 A;  2ASP A;  1ZBH A;  1X3M A;  3R6M A;  5CZ1 A;  4CGF A;  3LZJ A;  1VSK A;  2IAJ A;  1S1V A;  2W40 A;  1MA9 B;  3LPT A;  5CYQ A;  1X9J A;  1WSH A;  4CEE A;  4CZG A;  1N8R O;  3OBW A;  3DRS A;  4JI2 K;  1FW6 A;  4CES A;  2H3G X;  1HYV A;  4H8K A;  1RIL A;  1VQK N;  4RW8 A;  3RTV A;  5B8H A;  4X66 K;  3MEC A;  4FLV A;  1TL1 A;  1Q18 A;  4NYF A;  1NKB A;  4XIU A;  3ZT0 A;  4BGA A;  1QQC A;  2Z1I A;  2NLX A;  4ILH A;  2HHH K;  2GWK A;  4A59 A;  2X74 A;  5AQR A;  2JLE A;  1HQU A;  4JEP A;  4BRP A;  4BRD A;  3AGR A;  1YVN A;  2OTJ N;  4LH4 A;  1XQS C;  4JS4 A;  1T3V A;  4DR6 K;  1NM1 A;  3MX5 A;  1SL2 A;  4F3O A;  1E3M A;  4WCE L;  4LH5 A;  1OKJ A;  4JYA K;  1BOT O;  1OVQ A;  4GVM A;  2JWK A;  4PL8 A;  3NGI A;  3AA3 A;  3K57 A;  3WNE A;  2VGM A;  5FPE A;  1LOT B;  5CZ2 A;  1K8A O;  3AO4 A;  4FJ5 A;  3ULD A;  4CJP A;  3H6E A;  1BWF O;  1CXQ A;  3HRG A;  3BP8 A;  4A2B A;  4GKK K;  4F2S A;  1T6C A;  3UKR B;  3HOS A;  2DFE A;  2HBJ A;  3LP0 A;  1TKD A;  1OH6 A;  3CFO A;  2IIR A;  5BR8 K;  3DI6 A;  4AHV A;  1VQN N;  2D5R A;  3CFP A;  2BAN A;  5BRH A;  3OYH A;  1QSL A;  3P38 A;  5AZI A;  1QQM A;  1WSE A;  3DM2 A;  3FR0 A;  4FCY A;  1Y97 A;  3RR8 A;  1L5U A;  4JD2 B;  4PA1 A;  2VQF K;  1WAJ A;  4UY8 O;  1Q82 O;  2YCH A;  3T19 A;  1DEJ A;  3ZYY X;  4J2B A;  4RTF D;  3IDH A;  2UYT A;  2Q0U A;  5ADX A;  2ZM6 K;  3PX4 A;  3VF6 A;  5JS2 A;  4NCB A;  3L2V A;  3TSP A;  4K0K K;  4CEC A;  1U45 A;  2OPS A;  3LAK A;  4C8O A;  3ZSR A;  1ASW A;  4HTU A;  2Q97 A;  4JKF A;  3RR7 A;  4WQ5 C;  3LDL A;  4DU1 A;  4EFH A;  3D45 A;  3CJB A;  3D0P A;  2KTQ A;  1K8K A;  4MQ3 A;  3JS6 A;  2E2Q A;  3BGR A;  1BIZ A;  2ZD1 A;  2GX9 A;  1R59 O;  1HX1 A;  1BQM A;  4O8K A;  5KPT A;  1VSM A;  4I9L A;  3A5L C;  4B9U A;  1DLO A;  4LSL A;  3SPZ A;  3THY B;  2ZJQ L;  3ZSX A;  4CK1 A;  1RT4 A;  3EY1 A;  3QEV A;  4LF5 K;  2VCP A;  1NK7 A;  4JKH A;  3CC2 N;  1C0M A;  2F7T A;  2FBX A;  3D7E O;  4IFV A;  4CER A;  4DR2 K;  2P9U B;  4EZ9 A;  4DQP A;  2PYJ A;  4E7H A;  4LF4 K;  4JLH A;  2YNH A;  4UQG A;  4DF4 A;  1RDC A;  3SPY A;  3AO5 A;  4FOI A;  1RFQ A;  4FZX C;  1W0H A;  3WT0 A;  3IFR A;  5JMV A;  3MMV A;  3WXM B;  2P9I B;  5C2F A;  4DV2 K;  4CCH A;  4H0O A;  3QEW A;  3VQC A;  3HST B;  1SKS A;  3OS1 A;  4CW7 B;  3HP6 A;  4GVE A;  3CHW A;  3DLG A;  3HVT A;  4QOZ B;  3T1H K;  3LWL A;  3MEE A;  4KTZ A;  3SAF A;  2G8U A;  3VQQ A;  3K5L A;  2CH5 A;  3R9P A;  1B9D A;  2E2N A;  2GTD A;  4YOT A;  2O4I A;  1QS4 A;  4DSL A;  4FM0 A;  4Y1C A;  1CZB A;  4E19 A;  4M41 A;  1NBW A;  1TKX A;  4BRA A;  3V1O A;  4FWQ A;  3NFA A;  4BR7 A;  1XWL A;  4B8C A;  5GAG P;  5I3U A;  1X9S A;  2UUC K;  2ASO A;  3GL1 A;  4IEI A;  2OCE A;  1REV A;  1KXP A;  2QWO A;  3KK2 A;  4BE1 A;  2EWS A;  5KRT A;  4FJL A;  2QTD A;  4DR7 K;  3VES A;  2IS3 A;  2VG5 A;  4FXD A;  2IOC A;  2V7Y A;  4FLX A;  3ISN C;  1W97 L;  1TK8 A;  4FPB A;  3WXK A;  2YJE A;  1QQO A;  4CJV A;  4A62 A;  1JCG A;  3BZC A;  2OA8 A;  1NK0 A;  2CGJ A;  2XRI A;  3OBY A;  4FVM A;  4FVU A;  4CGH A;  3LZI A;  5LMN K;  4FJ8 A;  3HOT A;  4FWK A;  4JI1 K;  2VYP A;  3MN6 A;  3C7N B;  4H4O A;  5AQO A;  4FM2 A;  4O44 A;  3SBG A;  2HW3 A;  3JXU A;  4JKG A;  1RBT A;  4B1V A;  1U2V A;  1NGF A;  3AA2 A;  1OH8 A;  1DKG D;  4HTL A;  3AVL A;  3K9K A;  1NJI O;  1IJJ A;  2Q36 A;  1IG8 A;  2E8A A;  2QW9 A;  2A42 A;  3AAP A;  4H0T B;  4BC5 A;  5AQH A;  1HNW K;  4KHS A;  3J7Z O;  4DB3 A;  4DFJ A;  3O9R A;  3THX B;  4BRG A;  1YT3 A;  3S3O A;  3AVB A;  3J80 O;  1P90 A;  4BDY A;  1RDU A;  1SQK A;  3EKS A;  5EVZ A;  4E1N A;  3S9H A;  2E2P A;  2E4L A;  3M8Q A;  1NMD A;  3J8A A;  4DV5 K;  2QEX N;  4NXM K;  4KI6 A;  5GAH P;  3K5M A;  2DTU A;  2RF2 A;  4I6M B;  4CJ7 A;  2HHQ A;  1KTQ A;  2FSN A;  2W6L A;  1WAF A;  2D0A A;  4BRF A;  4IO8 A;  4N56 A;  4W5R A;  3KJV A;  5LL6 Z;  1WN7 A;  4FJN A;  4CZK A;  2JWL A;  4CJ5 A;  3TAN A;  1VSL A;  2ITG A;  5AQL A;  3HTV A;  4EP5 A;  5CE3 A;  3O08 A;  4OKE A;  4HUF A;  5A2Q O;  4JS5 A;  4CHZ A;  3TI0 A;  1N36 K;  1C1C A;  1SKR A;  4OX9 K;  1NKC A;  4CZJ A;  2QWP A;  4GV9 A;  5C12 A;  1S1U A;  4CBX A;  4DCH A;  3QO9 A;  3PY8 A;  1P8Z A;  3V6D A;  4DTR A;  1HKC A;  5HRS A;  4M3X A;  1ZYQ A;  5AQU A;  1RDW X;  4BVP A;  3HVR A;  1VQL N;  3AVJ A;  4A2A A;  3PX6 A;  1RT6 A;  3CME N;  1ZBF A;  5AQK A;  1J54 A;  2KKZ A;  5KPZ A;  4HCB A;  2F4V K;  4WQ4 C;  3NGZ A;  4B3O A;  3NDK A;  3THW A;  4C1N K;  3L6Q A;  1SL0 A;  1NK8 A;  4F4K A;  3F9M A;  4FW2 A;  4BRE A;  5FPN A;  4CJQ A;  3D2E B;  3PO5 A;  2YNF A;  1N32 K;  4KHW A;  1HPZ A;  1IH7 A;  2D0P A;  4H5T A;  3WXJ A;  3H46 O;  4QS7 A;  3RRG A;  3G0Z A;  3DOL A;  4B1Z A;  4JK9 A;  2QM1 A;  1NGD A;  3S41 A;  2AJQ A;  5AFU H;  1LAW A;  1RNH A;  3J7A P;  3SUP A;  4J8F A;  4CD3 A;  4B3T K;  1BQN A;  3J81 O;  5FRM A;  4G9Z A;  1Z05 A;  2Q31 A;  2WOM A;  3PSF A;  4EIA A;  2I7P A;  1YXQ A;  1JL2 A;  5BPL A;  4JI3 K;  3DLH A;  1JCF A;  2E5L K;  1RDB A;  4E3S A;  1EXQ A;  3NF9 A;  5AQJ A;  2QWM A;  4RG8 A;  3R3L A;  4JKD A;  2YHB A;  4WFN L;  2UXC K;  3EE8 A;  4B1U B;  2Q3S A;  3ENO A;  1EWR A;  4YOU A;  2E6L A;  1C6V A;  5BN8 A;  1A5W A;  2XY6 A;  2HF3 A;  2WTU A;  3M8S A;  2QI2 A;  4JHD A;  5AQG A;  2QKK A;  4JI4 K;  1GLL O;  4DTM A;  4FLY A;  1TUY A;  4L3Q A;  3OS0 A;  2NUB A;  2HHT A;  2P9N B;  3CM5 A;  4CZL A;  3NH1 A;  5JVG L;  3BY5 A;  2B5J A;  3VGK A;  4JKE A;  3OJS A;  3CET A;  4XH4 A;  4DV3 K;  1VSF A;  3FLC O;  5J2Q A;  4HCC A;  3FZM A;  1UAX A;  3P4I A;  3O4Q A;  4E7K A;  1NG9 A;  2XY8 A;  4O0J A;  4FLZ A;  3MXI A;  5AQV A;  2F8T A;  3O8M A;  4KHY A;  3CI5 A;  3VEY A;  1ATR A;  5D3G A;  3ZET B;  4B1W B;  4CHP A;  4Z4E A;  4MLE A;  4FWR A;  3AO1 A;  3HPG A;  1WOQ A;  1Z6R A;  3CJ1 A;  3DJC A;  4LC9 B;  1M90 O;  4CFD A;  1HNI A;  2OPR A;  4DV1 K;  1X3N A;  3MCA B;  1TL3 A;  1ITG A;  5AQI A;  2O8D B;  1JJ2 M;  2RN2 A;  4ICL A;  2ETJ A;  4LF9 K;  3ULE B;  3EEQ A;  2O8B A;  2YV0 X;  4IG3 A;  2OPP A;  4A5A A;  1KD1 O;  3OYJ A;  2G8V A;  4CD1 A;  3ZSO A;  1VQ4 N;  3SV3 A;  1NGG A;  1X9M A;  4OVL A;  4E7L A;  4WF9 L;  2QWN A;  3EYZ A;  4DV4 K;  3WQU A;  5EOY A;  1XC3 A;  4FJ7 A;  3OYF A;  5J2P A;  4JV5 K;  1U47 A;  3BDP A;  1ZXO A;  2B4J A;  2NRW A;  3OYM A;  3QLH A;  3RSE B;  5J1E A;  1YJ9 N;  3VF4 A;  3C94 A;  2A1S A;  1KLN A;  2ATQ A;  2HHX A;  4YOW A;  4KI4 A;  1WB9 A;  3PV8 A;  3DOK A;  2WFB A;  1J6Z A;  3I33 A;  1SUQ A;  3CIP A;  3O3F A;  2BDP A;  3DLE A;  3FFI A;  1NLV A;  4QS9 A;  2HHW A;  2NZT A;  2Q2R A;  1OVY A;  4WFB L;  3RMC A;  3FZL A;  3E01 A;  3D2F A;  1DTT A;  4Y1D A;  1XMQ K;  3C6T A;  4B9N A;  5GAE P;  2WBN A;  2R7Y A;  3A0I X;  1NJW A;  1KQS M;  5BRE A;  3CF5 L;  3OYA A;  2P9L B;  4K43 A;  3K59 A;  3QER A;  2G8I A;  3L4I A;  4W5N A;  3A8Y A;  4FWL A;  3LPU A;  4FZZ A;  2W42 A;  4DFK A;  5HBM A;  1S9G A;  4EAH D;  4FJG A;  4KV8 A;  3P31 A;  1V4S A;  5EY4 A;  3VQ7 A;  2YHY A;  1K6Y A;  4CF1 A;  3L8B A;  2X6N A;  3HYF A;  1TV6 A;  4MO4 A;  3ITH A;  3C6A A;  1IKV A;  4PHT X;  4QS8 A;  2HF4 A;  1DGK N;  5AQW A;  4XH1 A;  3VQ9 A;  4LF8 K;  4F9O A;  3VQ6 A;  3VF2 A;  4JI0 K;  1NGH A;  2VGN A;  4YOY A;  4I2P A;  1K73 O;  1L3T A;  2NRZ A;  2ZJP L;  3H3N O;  1BI4 A;  3CPE A;  5BRD A;  4LY7 A;  1I39 A;  2ZGZ A;  4E1M A;  1HRH A;  2ASM A;  4M3R A;  5AJ3 K;  1QTM A;  4KO0 A;  3LDN A;  2KFZ A;  4CHN A;  3AVA A;  5F1X A;  3CG7 A;  4CI6 A;  1NGE A;  3WUH A;  1E4F T;  3DWL A;  3PX0 A;  1SZ2 A;  4E1J A;  1NJX A;  1N34 K;  3CJC A;  2NRV A;  4CHY A;  4B1X B;  1TYQ A;  4DKW A;  5TKY A;  4B9V A;  1D5A A;  2WC9 A;  3N4Q A;  3IG1 A;  4QCL A;  3NCI A;  4RW9 A;  5M1O A;  4CZF A;  3FZK A;  2YHW A;  3P39 A;  4CZH A;  3OYI A;  1U48 A;  3TAR A;  4DMN A;  4M7Y A;  3RVC A;  5GIP A;  5DK5 A;  1RTI A;  1IBL K;  3AAQ A;  2PBD A;  3G10 A;  3CER A;  4X62 K;  2NRR A;  3FE1 A;  1IV0 A;  2IVP A;  3AVF A;  1JLC A;  2P9S A;  4ILJ A;  1SAZ A;  3SUO A;  3TTD A;  2DY4 A;  2RPI A;  5M1N A;  3IUC A;  4KHN A;  4CZM A;  4H5N A;  4YNQ A;  3KLE A;  3AO3 A;  4IKF A;  1S9E A;  3AVK A;  3WQT A;  4FK2 A;  4B3R K;  3AVC A;  1MU2 A;  3OJU A;  4OO1 J;  1BA1 A;  1NGA A;  2Y1J A;  1X9W A;  3ID6 A;  2ZJR L;  3K2P A;  5M1Q A;  3CD6 N;  4JRP A;  1UA1 A;  3E9P A;  1KFS A;  4DS5 A;  4NO7 A;  3PLA A;  3AVI A;  3S3M A;  4MDA A;  4KAZ A;  5E84 A;  1RDA A;  1S1X A;  5BN9 A;  1LWE A;  3CJ7 A;  2KZZ A;  3H1Q A;  3OYC A;  4RCH A;  4LF6 K;  3SLC A;  2GEL A;  5AFU A;  5DMR A;  1OH7 A;  4LFC K;  1RT2 A;  1BU6 O;  3FZF A;  3JAM O;  3AO2 A;  5F2R A;  4DQQ A;  1NGI A;  2PY5 A;  1IG9 A;  3C6U A;  1YJN N;  4DFM A;  3VQ5 A;  3M3Z A;  4B9S A;  4NLC A;  3MX2 A;  3B8A X;  1JLQ A;  1S6P A;  1VSD A;  1RT7 A;  1NNE A;  3LM9 A;  3ZSZ A;  4FLW A;  4KTW A;  3HM8 A;  3CPW M;  1KAY A;  3SYZ A;  4A57 A;  4BWM A;  1U04 A;  4FJK A;  4CEO A;  1SV5 A;  5FDL A;  4ZHR A;  5AZI B;  4JN4 A;  4BR4 A;  1C1A A;  5K14 A;  2E20 A;  3QIC A;  2HMP A;  2V52 B;  4DTU A;  4HUE A;  2D1K A;  3WNF A;  4WFA L;  3C65 A;  3I8D A;  2HB5 A;  3EKU A;  4JK7 A;  1BDG A;  5CY4 A;  4NCG A;  3LP2 A;  2FSJ A;  3AY9 A;  2UXD K;  4H03 B;  3VQE A;  2HND A;  5LJV A;  2QWR A;  3SZ2 A;  3TR8 A;  4K42 A;  4CVN E;  1U6Z A;  4MDB A;  1BHL A;  1D9D A;  4IXC A;  4DF8 A;  3E1Y A;  4DSK A;  4EHU A;  3Q7B A;  2ZE2 A;  4XEI A;  3U9D A;  4IBN A;  3ZX0 A;  3I8B A;  1K8K B;  4O4G A;  1B92 A;  4DQI A;  4IOC L;  4H4M A;  3T69 A;  4EP4 A;  4DWI A;  1J5E K;  3OTO K;  4B1Y B;  4M3Z A;  1XMO K;  2GBZ A;  4FWN A;  3HSC A;  4LSN A;  3QEX A;  1WNS A;  2GUP A;  4DUY K;  1GLE G;  4DSI A;  3PIO L;  2G8F A;  4HUG A;  2F96 A;  4R5P A;  1W2B M;  3B6P A;  3HZ6 A;  4A5B A;  3O5B A;  4KHQ A;  1QVG M;  2QXL A;  3CQX A;  3O9S A;  2KHO A;  3AAR A;  4H0V B;  1RBS A;  4HHT A;  4PWD A;  4Q5V A;  3KLG A;  1HR0 K;  4LD0 A;  5T7B A;  4KHU A;  2KZM A;  4PKG A;  3KLF A;  1EP4 A;  1TGO A;  3WEE A;  2O4G A;  4DV7 K;  2P9P A;  3AVM A;  5SZT A;  1J9A A;  3FFK B;  1T44 A;  4JI6 K;  1EQY A;  3P5J A;  5TKW A;  1S1T A;  4H0Y B;  2OZS A;  2O8F A;  3CJ9 A;  2VWJ A;  3VER A;  1XHZ A;  3HP9 A;  4ISG A;  1T8E A;  2E1Y A;  2UXB K;  4AM7 A;  2GUI A;  1Q8I A;  3SQ4 A;  3CCE N;  1IKX A;  5DM6 L;  4NCA A;  3QIO A;  1C0U A;  3MWP A;  5FRN A;  3LP1 A;  2Z1G A;  4I7F A;  5BRF A;  1G99 A;  3DXM A;  5AZJ A;  4XH5 A;  4IO9 L;  2A3Z A;  1DTQ A;  2P9K A;  4N41 A;  3ENB A;  1NGJ A;  3NH2 A;  2IC3 A;  1MWM A;  2Q1N A;  3MED A;  3CJA A;  4IJA A;  3ATV A;  3E9O A;  3SUN A;  3DLB A;  3A5O C;  4DQ8 A;  1JLE A;  3EO3 A;  3IKM A;  1N5Y A;  2Q0R A;  3W0L A;  1W9H A;  3HO1 A;  4ID5 A;  3AV9 A;  1JXB A;  2HNY A;  3TSQ A;  2Z1J A;  4WYB A;  3TAG A;  5C0Y A;  3NVM A;  2NRT A;  4B3M K;  3LAL A;  3D6R A;  4PKI A;  3NAE A;  1QQN A;  1KC8 O;  3DLK A;  3TPQ A;  3KD1 E;  1TKZ A;  5C25 A;  4Q0B A;  2BTF A;  2WUS A;  3SAG A;  2ZGY A;  4DR5 K;  4M3Y A;  4M63 C;  4ISE A;  5CHI A;  3KK1 A;  3DAW A;  3VQ8 A;  4GKJ K;  5AR0 A;  4JKG B;  1U2V B;  3KHY A;  2YNI A;  3LP3 A;  1ILY A;  4FK4 A;  4KB0 A;  3OHR A;  1VSI A;  4CF0 A;  3CC7 N;  4CJ3 A;  1WSJ A;  3MAQ A;  2IGI A;  1EO1 A;  4FLT A;  3SMS A;  4WE1 A;  1O1W A;  4DQS A;  4AHT A;  2FSK A;  4AHR A;  3ZEU A;  4KPY A;  3SJJ A;  5GAD P;  5KTQ A;  4OKJ A;  3L2Q A;  2QWL A;  4FJ9 A;  3R8E A;  3HJF A;  2IVO A;  4BRC A;  4IFE A;  4E89 A;  4RW4 A;  4N47 A;  2DPN A;  3HPH A;  3RMD A;  1GLB G;  1YIT N;  2UUB K;  3SK3 A;  3WNG A;  1VQ6 N;  1HKG A;  2G8W A;  3ZT2 A;  3O9T A;  2P51 A;  3DXK A;  5C10 A;  4OGE A;  4CJR A;  4JI8 K;  5I9E B;  3VA0 A;  4B9T A;  3CCJ N;  3BZK A;  3M8P A;  4TSX A;  3MXM A;  1IBK K;  1UA0 A;  3GDQ A;  2VWK A;  4Z4C A;  3H1V X;  1YUW A;  4AIL C;  1E4G T;  3ZT4 A;  1CXU A;  2OYQ A;  1YHQ N;  4H5R A;  4YFU A;  1YVU A;  4BC2 A;  3S3N A;  2QXF A;  2OZM A;  4B8A B;  5AQS A;  4O0I A;  3NH0 A;  3QIP A;  1C0G A;  4BQL A;  3O9Q A;  2YNG A;  4CBW A;  3KIO A;  3BF1 A;  1CZA N;  4CEA A;  1BCM A;  4IJN A;  3MN7 A;  3NGY A;  4KH4 A;  5KGX A;  3VTH A;  3F73 A;  3SQ2 A;  4Z94 A;  3W3D A;  3AVG A;  3H3O B;  3OVN A;  1N33 K;  2D4W A;  2D0C A;  3C95 A;  3SI6 A;  4CEQ A;  2HVH A;  4I9Q A;  3JSM A;  1VSH A;  4U67 L;  3THW B;  1NK4 A;  4CF9 A;  4CJW A;  3OYB A;  3OYD A;  3MWT A;  3L3U A;  2VG7 A;  4EHT A;  5FPD A;  3NMU A;  2FBY A;  4FWO A;  3CQY A;  1YTU A;  4LF7 K;  1HJO A;  3QBW A;  1TVR A;  1FJG K;  1OH5 A;  4FL9 A;  4BR5 A;  4IFY A;  1LWF A;  1NGC A;  2J4R A;  4IZ9 A;  1KLM A;  2DFH A;  4JNE A;  2P1J A;  4MFB A;  4OLA A;  4DTO A;  2HHV A;  3MN9 A;  1D8Y A;  3KZB A;  1NU0 A;  4CGD A;  4E0D A;  1HLU A;  1ATN A;  3EZW A;  3U3Y A;  4GV6 A;  3BEX A;  2WON A;  4J2E A;  1KAZ A;  3SCX A;  1NGB A;  4JKC A;  4AQY K;  4PUO A;  1RT5 A;  1QSS A;  4FJJ A;  4CJL A;  4CK3 A;  3BUZ B;  4Z0U A;  4CED A;  2O8C A;  4IOA L;  1XC9 A;  1VQ5 N;  4JKB A;  4ELT A;  4W5Q A;  4IEE A;  3UKU A;  1BGX T;  3QEP A;  4C8L A;  4HWI A;  3QB0 A;  2G8H A;  5JIC A;  1GLA G;  2BGG A;  4JHD B;  2OAN A;  5F0X A;  1I94 K;  4JK8 A;  4JKA A;  4IDK A;  4M3U A;  3VA3 A;  1EWQ A;  1TK0 A;  2QWQ A;  2Y1I A;  2KFN A;  2O8E A;  3CYM A;  3WXL A;  4L8R B;  3Q7C A;  1KCF A;  5EXW A;  4CK2 A;  2BE2 A;  4GY2 B;  4CHQ A;  3QFP A;  4DLG A;  3AA4 A;  1QHA A;  3SAH A;  3ZX3 A;  4BC4 A;  4CGJ A;  5E41 A;  4FWS A;  3T3F A;  3U6F A;  2ZQB A;  1KRP A;  2F8S A;  4X64 K;  1BIU A;  4B9Q A;  5KQ8 A;  2HHU A;  3TU5 A;  2VQE K;  3NE6 A;  1LW2 A;  4CEZ A;  1A5V A;  1VSE A;  3QBX A;  1RCH A;  3AGK A;  3V1Q A;  3I0S A;  3MN5 A;  1KSP A;  1F21 A;  1MWK A;  1HKB A;  1Q9X A;  4FO0 A;  3SBT A;  3VEN A;  4J2D A;  3HBT A;  4YDU A;  4CF8 A;  3CCS N;  3KLH A;  1LCU A;  1BL3 A;  3O80 A;  5I42 A;  1ZBL A;  3ZSV A;  5C24 A;  4PKH A;  1T6D A;  2O8B B;  3V4I A;  3VOV A;  1TK5 A;  2FF3 B;  4RW7 A;  3TAB A;  1ZC6 A;  4CIG A;  1HYS A;  3CXC M;  5HL7 L;  4K8X A;  4ZTJ A;  3UKR A;  3SQ0 A;  4DUZ K;  3MXJ A;  1EET A;  3I55 N;  1WUA A;  5CR4 A;  1VQ7 N;  5J2M A;  4NXN K;  1XNQ K;  2D0O A;  4OJR A;  3NF6 A;  3O1B A;  4RWT A;  2Z1H A;  4MLH A;  1U4B A;  3ZT1 A;  4KRE A;  3QNO A;  2RHK A;  3EE9 A;  4JD2 A;  5AQZ A;  2HOE A;  1L3S A;  3L2U A;  4DR4 K;  4HVJ A;  4DTP A;  4DTN A;  2E1Z A;  4BY9 C;  1JLF A;  4FM1 A;  1LW0 A;  4CHO A;  5AQM A;  5AQP A;  3BF3 A;  3O3H A;  3U4L A;  4X65 K;  3OYL A;  1C0T A;  5AQQ A;  1L3V A;  4YOX A;  1A5X A;  5C2D A;  3KKR A;  3KK3 A;  3D2F B;  1H1V A;  3HPO A;  3M5R A;  1TKT A;  1O13 A;  3TAF A;  4DG1 A;  4OPJ A;  4YDU C;  4BDP A;  4JI5 K;  1BA0 A;  2A41 A;  4NYN A;  1ZBI A;  3WXI A;  1B9F A;  4WQ5 A;  4E7I A;  2VWB A;  4IWV A;  5BPM A;  3F9K A;  3ZLJ A;  1JL1 A;  3LDQ A;  2ZWH A;  4FK0 A;  2BUP A;  2XHB A;  3QML A;  2NRX A;  4BRN A;  3VET A;  4PL7 A;  4AHC A;  4IDH A;  4ELV A;  1IKW A;  1L3U A;  4V19 S;  2LSN A;  3THY A;  4GNI A;  4BC3 A;  4BGB A;  3KLI A;  2AP1 A;  1XHX A;  1FKP A;  1BI4 B;  3K5O A;  3CC4 N;  4DR1 K;  1YAG A;  2FF6 A;  3O9U A;  3THV A;  4F2R A;  4O5B A;  1LAV A;  4DTX A;  1FK9 A;  1BIS A;  1Z25 A;  4CIE A;  5JLH A;  4CF2 A;  1HQE A;  1N6Q A;  2P9U A;  1JXE A;  4U7B A;  4BRM A;  5LMU K;  1YIJ N;  3ALY A;  3FGU A;  4H0P A;  2F9T A;  5C42 A;  4CJK A;  3KVG A;  2G8K A;  1T7P A;  1WBB A;  3OA9 A;  1TYQ B;  3K58 A;  3CCR N;  3G71 N;  1IBM K;  3QDK A;  4ELU A;  1GOA A;  2CGL A;  3GOI A;  1ATS A;  3TTC A;  1KFD A;  2P9I A;  3VQB A;  3O1W A;  2P5G A;  3LAN A;  4JAX A;  4FWP A;  3A5M C;  5CYM A;  4OPH A;  3B6O A;  3OYK A;  4BDZ A;  3SQ1 A;  2V7Z A;  4FSV A;  3QET A;  5HP1 A;  3G25 A;  2P9S B;  3O4N A;  1TAU A;  3AA5 X;  1VSJ A;  1X1P A;  4M7X A;  2PFU A;  5KQD A;  1HYZ A;  1ZBS A;  1Z26 A;  3ENH A;  1LV5 A;  3NF7 A;  3DRR A;  1MDU B;  4DQR A;  3U9Z A;  4J2A A;  4BR0 A;  3HL8 A;  4O5F A;  1J5O A;  2W6K A;  3T7Z A;  4CJE A;  4A61 A;  4AHS A;  1Q86 O;  3L2R A;  5LY3 A;  2NRH A;  5HRO A;  4NLB A;  5JVH L;  1HNX K;  4B08 A;  3VTI A;  1QHT A;  3V1R A;  3ZSW A;  1WBD A;  1KVB A;  4YOV A;  3QNN A;  1RBU A;  3IRX A;  3TAQ A;  5FLX O;  4CFA A;  5E26 A;  3G6E N;  1QZ6 A;  4DLE A;  3R1X A;  1C1B A;  3V9U A;  4KB1 A;  2HBM A;  2P5O A;  4FPA A;  3L2W A;  3K5N A;  5M1F A;  3CM6 A;  3ZSY A;  4H5W A;  2VG6 A;  2CH6 A;  4LFB K;  1HUX A;  3C0B A;  3P1G A;  4ID1 A;  1WSF A;  4GW6 A;  3NBP A;  4FLU A;  2AA4 A;  2I5J A;  4OPK A;  3O3G A;  3O6W A;  4CJF A;  3ID8 A;  3C7N A;  2KW4 A;  3WNH A;  1RGI A;  3N4P A;  4N76 A;  2YX6 A;  4DTS A;  4ZTF A;  5KRS A;  2UUA K;  4OKK A;  4F3T A;  3LWM A;  2FLO A;  1S22 A;  4CGI A;  2E6M A;  1TAQ A;  5KGW A;  3UB5 A;  4AF1 A;  5AQT A;  3TAM A;  4DFP A;  2GWJ A;  4O8U A;  3VGM A;  4DU3 A;  2PZS A;  3MDQ A;  1VAZ A;  5EU7 A;  3VEV A;  2XY7 A;  2DFF A;  4CFC A;  3THX A;  1BG3 A;  3RMA A;  3OYN A;  3G4S N;  3OS2 A;  1NOY A;  2E2O A;  1NMN A;  4YOR A;  3SJH A;  4DSE A;  4G1Q A;  1SKW A;  4ISF A;  2FBT A;  2YHX A;  4AH9 A;  3CFR A;  3AVH A;  3AVN A;  5DM7 L;  3SUQ A;  1RBV A;  5HRP A;  4CEF A;  2FXU A;  2XO7 A;  5KPR A;  3HM9 A;  1RTD A;  4BRL A;  3L4Q A;  5AQN A;  3LDS A;  3KK7 A;  4I6M A;  1RDD A;  3A2F A;  3H45 C;  4DV0 K;  3ASM A;  2A5X A;  3HK2 A;  3M1F A;  4Z4G A;  1VQ9 N;  3H08 A;  1GLC G;  3QIN A;  3RWU A;  4CE9 A;  3PSI A;  3PIP L;  1S3X A;  4B9M A;  3LL3 A;  1VRU A;  5HRR A;  2B6A A;  4PQU A;  4AM6 A;  3HI0 A;  4KH6 A;  3O4W A;  1JCE A;  1HJR A;  1WLJ A;  3QFU A;  3HT3 A;  5M1P A;  5ELZ A;  3PUF A;  2HBK A;  1NK6 A;  2CGK A;  1GLF O;  1GLD G;  3VQD A;  1Y64 A;  1VQO N;  1T05 A;  1UOC A;  4KBO A;  3ZT3 A;  2HNZ A;  4CJU A;  4M45 A;  2QA4 N;  1T03 A;  1RBR A;  1JLA A;  2IDO A;  3DYA A;  2GEM A;  3IAY A;  1DT9 A;  4LFA K;  1ASU A;  1RT1 A;  4WQ4 A;  1K9M O;  4DSF A;  4FOE A;  5MLC Q;  1KVC A;  3K9J A;  3TSU A;  3WEE B;  4BAC A;  3V9S A;  1BUP A;  3I0R A;  1R0A A;  4KRF A;  2P9P B;  3D2E A;  2E88 A;  3P83 D;  3U8X A;  3I56 N;  3RMB A;  1S5J A;  2D0B A;  4M3T A;  2RE2 A;  4DS4 A;  2O8F B;  3K0S A;  4E7J A;  5AQY A;  3L3V A;  1VK0 A;  2FC0 A;  1NOZ A;  3T1A A;  3UE5 A;  4CZI A;  1S1W A;  4Y0W A;  1S72 N;  1G15 A;  1GOC A;  3KKS A;  4GV3 A;  3VN5 A;  4BG8 A;  1FKO A;  4K41 A;  5GIN A;  5M1K A;  2X6S A;  2EHG A;  2PYL A;  4FZY A;  1D9F A;  3SNN A;  4M3W A;  1XNR K;  1EKE A;  2OPQ A;  4KH5 A;  1BCO A;  4JRQ A;  4BRI A;  3MK6 A;  3M8R A;  1U49 A;  3DXM B;  1NJY A;  1JKH A;  5AZJ B;  3T1Y K;  1NJZ A;  2JGU A;  5IWA K;  4FJI A;  4BG9 A;  3KWI A;  3V9Z A;  2P9K B;  4C8M A;  3NF8 A;  5AQF A;  4C8K A;  3UIQ A;  4CBU A;  3VPZ A;  1S6Q A;  4BR2 A;  3VGL A;  3CMA N;  3OY9 A;  4DSJ A;  2YHA A;  3MCP A; 
#chains in the Genus database with same CATH homology
 1HMV A;  4FM0 A;  4Y1C A;  1CZB A;  4E19 A;  4KHN A;  2Y1I A;  4M41 A;  4YNQ A;  3KLE A;  3AO3 A;  2KFN A;  1TKX A;  3CYM A;  3V1O A;  4N5S A;  3NFA A;  1QE1 A;  1XWL A;  4B8C A;  4IKF A;  4BE2 A;  5I3U A;  3RRH A;  4L8R B;  1KCF A;  4CK2 A;  1S9E A;  2BE2 A;  3AVK A;  1X9S A;  4CHQ A;  4FK2 A;  3AVC A;  4DLG A;  3LAM A;  1MU2 A;  1REV A;  3AA4 A;  3DLR A;  3OJU A;  4BWJ A;  4CGG A;  5KRT A;  3KK2 A;  4BE1 A;  1VRT A;  3TAP A;  4FJL A;  2Y1J A;  2IS3 A;  2VG5 A;  4FXD A;  2IOC A;  4CGJ A;  4AHU A;  5E41 A;  1X9W A;  4IG0 A;  3K2P A;  4FLX A;  3ISN C;  3T3F A;  4JRP A;  3U6F A;  4CJ4 A;  1UA1 A;  1TK8 A;  1WSG A;  2ZQB A;  1KFS A;  5FRO A;  1KRP A;  4CJV A;  4DS5 A;  2F8S A;  3AVI A;  3S3M A;  1NK0 A;  2OA8 A;  4W5T A;  3VQ4 A;  2HHS A;  2XRI A;  4FVM A;  4KAZ A;  1BIU A;  2HHU A;  1RDA A;  1S1X A;  4CGH A;  3LZI A;  5HLF A;  1LWE A;  5JS1 A;  2KZZ A;  3NE6 A;  3OYC A;  1LW2 A;  1YTA A;  2HHT A;  4CEZ A;  4FJ8 A;  1A5V A;  1VSE A;  1RCH A;  3V1Q A;  3OYG A;  5DMR A;  3I0S A;  3HXM A;  1RTH A;  1F21 A;  4H4O A;  1KSP A;  4FM2 A;  4O44 A;  2HW3 A;  1RT2 A;  1Q9X A;  3QEI A;  4DQQ A;  3AO2 A;  4EZ6 A;  4J2D A;  1RTJ A;  1J53 A;  1HNV A;  4CF8 A;  1RBT A;  2PY5 A;  1IG9 A;  3KLH A;  3C6U A;  1BL3 A;  5I42 A;  1ZBL A;  1JLG A;  4RW6 A;  5HRN A;  4DFM A;  3DRP A;  3AA2 A;  3VQ5 A;  3ZSV A;  4B9S A;  5C24 A;  4KTQ A;  3AVL A;  1JLQ A;  1S6P A;  1VSD A;  3V4I A;  1RT7 A;  3V9W A;  1TK5 A;  4FJG A;  4K8Z A;  4QAG A;  3ZSZ A;  4FLW A;  1EX4 A;  4KTW A;  3KD5 E;  4KHS A;  4DFJ A;  4RW7 A;  3SYZ A;  4F8R A;  1YT3 A;  3S3O A;  3TAB A;  4BWM A;  4CIG A;  3AVB A;  1HYS A;  1U04 A;  3NHG A;  4FYD A;  4FJK A;  4CEO A;  4BDY A;  4K8X A;  1SV5 A;  3DMJ A;  5FDL A;  4ZTJ A;  2GV9 A;  3SQ0 A;  3MXJ A;  4ZHR A;  1EET A;  4M42 A;  4E1N A;  1C1A A;  5K14 A;  3TWH A;  3S9H A;  2HVI A;  1I3A A;  2E4L A;  3M8Q A;  3ZCM A;  5J2M A;  4DTU A;  4HUE A;  3WNF A;  4OJR A;  1NK5 A;  3NF6 A;  2HB5 A;  3I8D A;  4CIF A;  3K5M A;  4KI6 A;  2Z1H A;  4Z4I A;  2DTU A;  2RF2 A;  4CJS A;  4CJT A;  5CY4 A;  1U4B A;  4NCG A;  4C8N A;  2HHQ A;  3ZT1 A;  4KRE A;  3QNO A;  3LP2 A;  1KTQ A;  1GOB A;  1WAF A;  2D0A A;  4N56 A;  1L3S A;  3VQE A;  3L2U A;  2HND A;  4HVJ A;  4W5R A;  3SZ2 A;  4DTP A;  4DTN A;  1JLF A;  3TR8 A;  3KJV A;  4FM1 A;  5J2N A;  1UWB A;  1LW0 A;  1WN7 A;  4O55 A;  4CHO A;  3QES A;  3V81 A;  4FJN A;  1BHL A;  1D9D A;  3O3H A;  4Z4H A;  3OYL A;  1C0T A;  4CJ5 A;  4DF8 A;  3TAN A;  4DSK A;  2YKM A;  4CEB A;  1L3V A;  3CQ8 A;  1VSL A;  2ITG A;  2RKI A;  1A5X A;  3KKR A;  4EP5 A;  3KK3 A;  2ZE2 A;  4HUF A;  4OKE A;  3HPO A;  2HMI A;  4IBN A;  1XI1 A;  4GMJ B;  4O4G A;  1B92 A;  1TKT A;  3TAF A;  4DQI A;  4DU4 A;  2XY5 A;  4JS5 A;  4DG1 A;  4OGC A;  4OPJ A;  4BDP A;  4CHZ A;  4H4M A;  3TI0 A;  4EP4 A;  4NYN A;  4DWI A;  1C1C A;  1SKR A;  1ZBI A;  1B9F A;  1IO2 A;  1NKC A;  4E7I A;  4OLB A;  1S1U A;  3F9K A;  4M3Z A;  1ASV A;  2GBZ A;  1JL1 A;  3QO9 A;  5KI6 A;  3PY8 A;  4LSN A;  3V6D A;  4DTR A;  3QEX A;  1WNS A;  5HRS A;  1ZBU A;  4CFB A;  4FK0 A;  4M3X A;  1ZYQ A;  2EX3 A;  2FBV A;  4DSI A;  2G8F A;  3HVR A;  2XHB A;  3AVJ A;  3PX6 A;  4KFB A;  1RT6 A;  4HUG A;  1ZBF A;  2F96 A;  4R5P A;  4AHC A;  1WSI A;  1J54 A;  3B6P A;  4HCB A;  4FW1 A;  1IKW A;  1L3U A;  1KVA A;  4ELV A;  2LSN A;  4FJM A;  4KHQ A;  3PO4 A;  2QK9 A;  3NGZ A;  3KLI A;  1XHX A;  4B3O A;  1FKP A;  3NDK A;  2KQ2 A;  1BI4 B;  3K5O A;  1SL0 A;  1NK8 A;  1CZ9 A;  1RBS A;  4F4K A;  3THV A;  3OYE A;  4FW2 A;  4HHT A;  4F2R A;  4PWD A;  4Q5V A;  4O5B A;  1LAV A;  4DTX A;  1QSY A;  4CJQ A;  1FXX A;  1FK9 A;  1BIS A;  1Z25 A;  2YKN A;  4CIE A;  3KLG A;  4CF2 A;  3PO5 A;  1HQE A;  2YNF A;  4LD0 A;  1N6Q A;  5T7B A;  1JXE A;  4KHU A;  2QKB A;  2KZM A;  1NKE A;  4KHW A;  1HPZ A;  1IH7 A;  3KLF A;  3ALY A;  1EP4 A;  4B9L A;  1TGO A;  1NK9 A;  4FJX A;  5C42 A;  1JLB A;  3RRG A;  4CJK A;  3G0Z A;  2O4G A;  1Q9Y A;  3DOL A;  2G8K A;  1T7P A;  3AVM A;  5SZT A;  1J9A A;  4I2Q A;  2AJQ A;  1LAW A;  3VQA A;  1IKY A;  3JYT A;  3P5J A;  3U3G A;  3K58 A;  1S1T A;  2OZS A;  4ELU A;  1RNH A;  1GOA A;  4DTJ A;  3V9X A;  3SUP A;  2VWJ A;  3IS9 A;  1KFD A;  1XHZ A;  1BQN A;  5FRM A;  3VQB A;  2P5G A;  3HP9 A;  3LAN A;  1T8E A;  5SWM A;  1LWC A;  2WOM A;  2GUI A;  4BE0 A;  3ZSQ A;  4Z4F A;  1Q8I A;  3SQ4 A;  1CLQ A;  1JL2 A;  1IKX A;  5CYM A;  3EZ5 A;  2X78 A;  1RT3 A;  4FJH A;  3B6O A;  4NCA A;  3OYK A;  3VQP A;  3DLH A;  3QIO A;  4PY5 A;  1C0U A;  1RDB A;  4E3S A;  1EXQ A;  3LP1 A;  3NF9 A;  2Z1G A;  4BDZ A;  2A1R A;  5FRN A;  4I7F A;  4RG8 A;  4KKO A;  3SQ1 A;  5HP1 A;  3QET A;  4W5O A;  2YHB A;  3O4N A;  1TAU A;  3AA5 X;  1VSJ A;  1X1P A;  2Q3S A;  3SV4 A;  1DTQ A;  1HYZ A;  3KTQ A;  4N41 A;  1Z26 A;  2E6L A;  1C6V A;  1LV5 A;  1A5W A;  3MEG A;  3NF7 A;  2XY6 A;  3DRR A;  3NH2 A;  2IC3 A;  3M8S A;  4DQR A;  4J2A A;  3HL8 A;  1J5O A;  1SL1 A;  2QKK A;  3MED A;  4CJE A;  4FLY A;  4DTM A;  4AHS A;  3TAE A;  3OS0 A;  2NUB A;  1ZBH A;  3SUN A;  3CM5 A;  3NH1 A;  3L2R A;  5HRO A;  3DLB A;  5CZ1 A;  4CGF A;  2B5J A;  1JLE A;  3LZJ A;  1VSK A;  2IAJ A;  1S1V A;  4B08 A;  3OJS A;  3LPT A;  1QHT A;  5CYQ A;  1N5Y A;  3V1R A;  3ZSW A;  4CEE A;  1WSH A;  1KVB A;  3DRS A;  1VSF A;  1W9H A;  5J2Q A;  4CES A;  3HO1 A;  3QNN A;  4ID5 A;  1RBU A;  3AV9 A;  4HCC A;  1HYV A;  1JXB A;  4H8K A;  1UAX A;  1RIL A;  2HNY A;  3IRX A;  3O4Q A;  4RW8 A;  4E7K A;  3TAQ A;  3RTV A;  4CFA A;  2Z1J A;  2XY8 A;  4O0J A;  3MEC A;  4FLZ A;  4FLV A;  1TL1 A;  4DLE A;  3TAG A;  2DY4 A;  3MXI A;  2F8T A;  1C1B A;  4NYF A;  1NKB A;  3LAL A;  3V9U A;  4KB1 A;  4XIU A;  3NAE A;  2P5O A;  4KHY A;  3ZT0 A;  3DLK A;  3L2W A;  1QQC A;  3K5N A;  2Z1I A;  5D3G A;  3KD1 E;  1TKZ A;  5C25 A;  3CM6 A;  4Q0B A;  3ZSY A;  4CHP A;  4Z4E A;  4M3Y A;  2VG6 A;  3AO1 A;  2X74 A;  3P1G A;  4ID1 A;  1WSF A;  3KK1 A;  4GW6 A;  2JLE A;  3HPG A;  1HQU A;  3VQ8 A;  3NBP A;  4FLU A;  2I5J A;  4OPK A;  3O3G A;  3RMD A;  4LH4 A;  4CJF A;  4JS4 A;  1SL2 A;  2YNI A;  4F3O A;  3LP3 A;  2KW4 A;  4LH5 A;  4FK4 A;  3WNH A;  4KB0 A;  1VSI A;  4N76 A;  4CF0 A;  4CFD A;  1HNI A;  4GVM A;  4CJ3 A;  2OPR A;  1WSJ A;  3MAQ A;  3NGI A;  4DTS A;  1TL3 A;  4ZTF A;  5KRS A;  1ITG A;  3AA3 A;  4OKK A;  2IGI A;  3K57 A;  4F3T A;  3WNE A;  3LWM A;  4FLT A;  2RN2 A;  4ICL A;  4WE1 A;  5CZ2 A;  1O1W A;  2ETJ A;  4CGI A;  2E6M A;  3AO4 A;  4DQS A;  1TAQ A;  4FJ5 A;  4AHT A;  3ULD A;  5KGW A;  2YV0 X;  4IG3 A;  4CJP A;  1CXQ A;  2OPP A;  3TAM A;  4DFP A;  3OYJ A;  2G8V A;  4AHR A;  3ZSO A;  4F2S A;  4DU3 A;  2DFE A;  3SV3 A;  2PZS A;  1X9M A;  3LP0 A;  4OVL A;  4E7L A;  1TKD A;  4KPY A;  3CFO A;  3SJJ A;  5EU7 A;  5KTQ A;  3DI6 A;  4AHV A;  3EYZ A;  2XY7 A;  2DFF A;  4CFC A;  2D5R A;  4OKJ A;  3CFP A;  3RMA A;  3L2Q A;  3OYN A;  4FJ7 A;  4FJ9 A;  2BAN A;  3OYF A;  5J2P A;  3HJF A;  3OS2 A;  3OYH A;  1NOY A;  4DSE A;  4G1Q A;  1QSL A;  1SKW A;  1U47 A;  4E89 A;  3BDP A;  4RW4 A;  4N47 A;  2B4J A;  2FBT A;  3HPH A;  1WSE A;  4AH9 A;  3CFR A;  3AVH A;  3OYM A;  3DM2 A;  3AVN A;  4FCY A;  1Y97 A;  3SUQ A;  3RR8 A;  3WNG A;  1L5U A;  1RBV A;  4PA1 A;  5HRP A;  3QLH A;  4CEF A;  1WAJ A;  5J1E A;  2XO7 A;  2G8W A;  3ZT2 A;  3HM9 A;  2P51 A;  3C94 A;  3T19 A;  1RTD A;  2A1S A;  4CJR A;  2ATQ A;  4OGE A;  1KLN A;  4J2B A;  3LDS A;  2HHX A;  3VA0 A;  1RDD A;  4KI4 A;  4B9T A;  3A2F A;  3PV8 A;  3DOK A;  3M8P A;  3ASM A;  4TSX A;  3MXM A;  3PX4 A;  1UA0 A;  3HK2 A;  2VWK A;  5JS2 A;  4Z4C A;  1SUQ A;  4AIL C;  3O3F A;  2BDP A;  3DLE A;  4NCB A;  3FFI A;  3ZT4 A;  3L2V A;  4Z4G A;  3H08 A;  1CXU A;  4CEC A;  1U45 A;  2OYQ A;  2OPS A;  3QIN A;  2HHW A;  3LAK A;  4C8O A;  3ZSR A;  3RWU A;  4CE9 A;  1ASW A;  4YFU A;  4HTU A;  3RR7 A;  4B9M A;  1YVU A;  1VRU A;  5HRR A;  3S3N A;  2B6A A;  2QXF A;  4DU1 A;  3RMC A;  2OZM A;  4B8A B;  3E01 A;  4O0I A;  4PQU A;  3D45 A;  3NH0 A;  3QIP A;  1DTT A;  4Y1D A;  3D0P A;  2YNG A;  2KTQ A;  3C6T A;  3KIO A;  4MQ3 A;  4B9N A;  2R7Y A;  3BGR A;  4CEA A;  1BCM A;  1NJW A;  3NGY A;  1BIZ A;  1HJR A;  2ZD1 A;  3OYA A;  3QER A;  3K59 A;  2G8I A;  4W5N A;  5KGX A;  3F73 A;  1WLJ A;  3SQ2 A;  1BQM A;  3HT3 A;  3LPU A;  4FZZ A;  2W42 A;  3AVG A;  1S9G A;  3PUF A;  3OVN A;  1VSM A;  4KV8 A;  4I9L A;  5HBM A;  4DFK A;  1NK6 A;  4B9U A;  1DLO A;  4LSL A;  3VQ7 A;  2D0C A;  3C95 A;  3SPZ A;  1K6Y A;  3VQD A;  4CF1 A;  3SI6 A;  3ZSX A;  3L8B A;  2X6N A;  3HYF A;  4CEQ A;  1TV6 A;  1UOC A;  4CK1 A;  1T05 A;  2HVH A;  3ZT3 A;  4I9Q A;  2HNZ A;  3ITH A;  1RT4 A;  1VSH A;  4CJU A;  3JSM A;  3EY1 A;  3QEV A;  4CF9 A;  1NK4 A;  4M45 A;  1IKV A;  4CJW A;  1NK7 A;  1T03 A;  1RBR A;  3OYB A;  1C0M A;  1JLA A;  2FBX A;  2IDO A;  3DYA A;  3OYD A;  4IFV A;  4CER A;  3L3U A;  2VG7 A;  3IAY A;  3VQ9 A;  1ASU A;  3VQ6 A;  2FBY A;  1YTU A;  1RT1 A;  4I2P A;  1L3T A;  4EZ9 A;  4DQP A;  2PYJ A;  1TVR A;  1BI4 A;  4DSF A;  4LY7 A;  4E7H A;  1I39 A;  1KVC A;  3V9S A;  4IFY A;  4JLH A;  1LWF A;  4BAC A;  2YNH A;  4UQG A;  4DF4 A;  3I0R A;  1R0A A;  4KRF A;  1RDC A;  3P83 D;  4E1M A;  1HRH A;  4M3R A;  1QS4 A;  3SPY A;  3AO5 A;  1KLM A;  2DFH A;  4KO0 A;  3RMB A;  1QTM A;  2KFZ A;  2P1J A;  4CHN A;  1S5J A;  2D0B A;  3AVA A;  4MFB A;  4FZX C;  4M3T A;  4OLA A;  3CG7 A;  4DS4 A;  4DSL A;  1W0H A;  4E7J A;  4DTO A;  3L3V A;  1VK0 A;  2HHV A;  2FC0 A;  1D8Y A;  1NOZ A;  3T1A A;  3PX0 A;  1S1W A;  1G15 A;  1GOC A;  4CGD A;  3KKS A;  4E0D A;  3VN5 A;  3U3Y A;  1FKO A;  1NJX A;  2X6S A;  4CCH A;  2EHG A;  4CHY A;  2PYL A;  4FZY A;  3QEW A;  3VQC A;  2WON A;  3SNN A;  1D9F A;  3HST B;  1SKS A;  4J2E A;  4M3W A;  1EKE A;  2OPQ A;  3OS1 A;  3SCX A;  4B9V A;  1D5A A;  1BCO A;  3HP6 A;  3IG1 A;  4JRQ A;  3NCI A;  4PUO A;  1RT5 A;  4RW9 A;  4QCL A;  3DLG A;  3HVT A;  1QSS A;  4FJJ A;  4CJL A;  3OYI A;  3M8R A;  3TAR A;  1U49 A;  1U48 A;  4QOZ B;  4CK3 A;  3LWL A;  4Z0U A;  1JKH A;  3MEE A;  4CED A;  4DMN A;  1XC9 A;  4KTZ A;  1NJY A;  5DK5 A;  1RTI A;  1NJZ A;  2JGU A;  4ELT A;  4W5Q A;  4FJI A;  2G8U A;  3G10 A;  3V9Z A;  3VQQ A;  3K5L A;  1BGX T;  4C8M A;  3QEP A;  4C8L A;  3NF8 A;  4C8K A;  3UIQ A;  2G8H A;  2BGG A;  3AVF A;  1S6Q A;  1B9D A;  1JLC A;  4M3U A;  4IDK A;  3OY9 A;  3VA3 A;  4DSJ A;  3SUO A;  2YHA A;  2O4I A;  1TK0 A;  2RPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...