5I42A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer, azttp, and ca(2+) ion
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 141
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i42A05
3GV7B 4NCAA 3OYMA 1A5VA 4GVMA 4ID5B 1YT3A 5KT2A 4MKAA 1VSLA 3CQ8A 4K4VA 2G8FA 1TK5A 5HLFB 4ED1A 1ASWA 2LSNA 4JS5A 4FJGA 1NNDA 1RT7B 2OPPB 1JLQB 2KFZA 3LDSA 3QYYA 1TL1A 4OPJA 3OY9A 1KLMB 1EP4A 3ZSRA 4FW1A 1YVUA 3O4QA 2ASDA 2GBZA 3K5LA 3H59A 3SI6A 3GYNA 4NLVA 3G86A 4OKEA 4BWMA 4WZQA 1NJWA 1LAVA 3VQ4A 3OYFA 4O44B 4O3PA 3P1GA 1C0UB 1BISA 1QUVA 4OPKA 3PZPA 1JKHA 4K4YA 3C94A 5KT3A 5L1IA 2D0BA 3PX0A 3HK2A 3DRPA 3PO4A 1VRUA 3EYZA 2BQUA 3MR5A 2X78A 2FLPA 1JLEA 2W9BA 4IFYA 3CO9A 1IKVB 3S3MA 2R8HA 5KG3A 4N47A 1SKRA 2IJNA 1X9WA 1ASUA 3PW5A 4K4UA 4O3NA 1BCOA 1SUQA 2VG7B 3KLIB 3AO2A 5DG7A 3PY8A 4IFYB 1HPZB 1S6PA 2IAJA 4J2AA 4DTXA 4RW9A 4FZXC 3H40A 3KHRA 3K5NA 4B9NA 1FKPB 2XHBA 1I3AA 4FJXA 1CZBA 4FLTA 3I0SB 2D41A 4CESA 4Z4HA 3NH1A 2VG6A 3RMCA 2HNYB 4ELVA 4FJ7A 1ZTTA 4NRTA 5J2PB 2WHOA 3PHEA 2HVHA 1JLFA 3DLGB 1U47A 2D3ZA 1RT5B 5HRPA 5J1EA 1N5YB 1KVCA 3ASMA 3PX4A 3GIMA 3I5AA 5KFMA 3H5YA 2C2EA 2VG5B 3VQBA 1RYSA 1JXLA 3RAXA 1RA6A 4KHSA 4IRKA 2FBTA 3FDSA 3WNHA 4KTWA 4LH5A 3ICLA 4H8KA 3VQSA 3Q8RB 1JL2A 3JSMB 2IGIA 4C8KA 1CSJA 4YR0A 5KT7A 4K4WA 2F8SA 4TYBA 2G8VA 1RAJA 4ZP6A 1Q9YA 1GOCA 2RF2A 3T5JA 3N6MA 1DLOB 1S1TB 2QK9A 3TWHA 3KK3B 3UR0A 1RBVA 2XGPA 4W5TA 5I42B 2R2TA 3G6YA 3HKWA 1VSKA 4FJLA 3ZSWA 4E1NA 5L1KA 4DEZA 4CHPA 4LSLA 3KKRA 3K59A 3RMDA 4OL8A 4MFBB 1LW0B 4IG0B 2UVVA 3C95A 4LQ3A 3AVAA 4MKBA 1ZYQA 1B9FA 4RNNA 5DK5A 1WAFA 4DQSA 3RR8A 1W0HA 1RT5A 1FK9A 4DSLA 4ECZA 1NK9A 3OYAA 1RT3B 4M41A 1ITGA 5KFAA 3FQKA 3BSAA 3V81B 4KTZA 1HYSA 4DG1A 3KLGB 3KLEB 2R2SA 4YQWA 2UUWA 2J6TA 3KNAA 4RNFA 4NLWA 5E41A 3M9NB 1BIUA 1S0MA 4NZ0A 4F50A 3OL9A 4I2PB 5HP1A 4CF2A 3K58A 3KHGA 1RDRA 3ZT0A 3QEWA 1VRUB 3NH2A 4ID5A 3KIOA 5FRNA 3LAKA 2W42A 2FVPA 1UWBB 4NLPA 3UDLA 3PW4A 2P1JA 4IKFA 1J53A 4WYWA 3IRXB 3QNOA 1BCMA 5C5JA 1LWEB 4E89A 3OYHA 4OLBA 1LAWA 3E01A 1SH0A 4NLQA 3M8SA 3QGHA 3ZCMA 3PW2A 4O55A 3LZJA 1J5OB 1T3NA 4IG0A 1HNIA 5D3GB 3V9WA 1KHVA 2ASJA 3I0RB 2BR0A 4EBCA 3LP1B 1S1VB 3K5OA 4OGCA 4KAZA 4CGDA 1D9DA 1L5UA 2OA8A 1ZBIA 3OYNA 2E9TA 2VG6B 4GC7A 3AO5A 4CEBA 3SZ2A 1DTQB 1BI4A 3VQEA 2WOMA 4I2QB 4CK3A 3PO5A 4FVMA 5DG8A 1S10A 4ELUA 4WZMA 4CEDA 3QO9A 4E1MA 4QWAA 3SUNA 3SFGA 1IKVA 1JLGA 4E3SA 4R5PB 1Z26A 3CWJA 2B4JA 3OYDA 3QINA 1NK0A 3NBPA 3KLHB 4BWJA 4H54A 3QO9B 3M8PA 3QIDA 4ZP7A 1HQEB 4DLGA 1UWBA 3AA5X 3FQLA 4G1QA 2D0AA 2V9WA 1BQNA 4TYAA 2O4IA 3SPZA 3JSMA 1VSEA 1S1XB 1C6VA 3OLBA 4MK7A 2YNGB 1XR6A 4Q0BA 5J2MA 1JX4A 2OPRB 4N56A 3RRHA 5D3GA 2P5GA 3PR5B 2YNHB 2E9RX 1S97A 4ECQA 3KD1E 5KFUA 2V4RA 4M42A 1NJXA 1T05A 3SQ0A 3AVIA 1RTJB 3KKSA 5K14B 4F4ZA 2KQ2A 3H4DA 1JLCB 4LSLB 3EZ5A 4CF0A 2F8EX 2VWJA 4IR9A 1HARA 4AH9A 2HNZA 3AVGA 5HROB 3SUQA 4J9RA 3BDPA 3LALA 3AA3A 1HJRA 3HVTB 2QXFA 1C0UA 4F3OA 4CJTA 2HNDA 4O0IA 1REVB 4WE1A 3RWUA 2WCXA 1BQMB 1S1WA 4CJVA 5KG1A 1C1AA 4YMEA 3KLFB 1WSEA 4CJWA 3BGRB 1NHVA 4DS5A 3ZT2A 3MECB 1S9GB 4MIBA 2QV6A 3ULDA 2R2RA 3O3HA 4B9UA 1RBUA 4NCGB 4CCHA 4KFBB 4E7JA 4EBDA 2E4LA 4FW2A 1JXBA 3V6KA 1SKSA 4HKQA 3CJ2A 3CFRA 5J2MB 4DU1A 4KHUA 4FZYA 3H5UA 2YNFA 4NLDA 3DOLA 3L2QA 1HQUA 2XY8A 2D0CA 1HYVA 1TGOA 4UQGA 1KLNA 4KFBA 1NK6A 4J2DA 5KFPA 1X9SA 1JLBA 2I5JB 3HP9A 1KSPA 1LW2A 4FLVA 4DWIA 3Q8SB 3G10A 2XRIA 1K1QA 2YNFB 3V9SA 3I8DA 1X9MA 1VRTA 1QS4A 2X6NA 4R0EA 3ZSXA 4I9QA 1QAJA 3BQ0A 3NF6A 5KG0A 1K1SA 5JXSA 1HNVA 1HMVA 2RKIB 4DTSA 4CEZA 4RNMA 3V6DA 4KO0B 3QIPB 4FLWA 3ZSZA 1XC9A 3UQSA 4ZHRB 4RW4A 4MIAA 3IGNA 3QESA 3HPOA 1D8YA 4Y1CA 5DQIA 3I5BA 1U49A 3AO3A 1TAQA 4CHQA 1XHXA 3S3NA 2W7PA 3IN5A 4JRQA 5DGAA 2QKBA 5HRSA 4IDKB 4YR2A 1NK5A 3LPTA 1C1CB 2G8UA 3DLKB 1LV5A 3C6TB 4RW6B 3NGZA 4C8LA 3AVKA 4YP3A 2CJQA 3LWLA 3THVA 3B6OA 3MF5A 3V81A 4KAIA 1ZETA 1RT2B 1MU2A 1TKTB 1T8EA 3A2FA 2IDOA 1BL3A 3DLKA 2ATLA 5KFBA 4IOBA 3HYFA 3M8QA 3ZSYA 1NJYA 3KMQA 3KK3A 4H4OA 1XI1A 4NCBA 3SQ4A 4RW7A 2WRMA 1TKZA 2GV9A 1NKCA 1SV5B 1EKEA 4DMNA 1WN7A 3KD5E 2HNYA 2XO7A 4MFBA 2FC0A 1RBTA 3PX6A 3TQ1A 2Z1JA 1HPZA 1S6PB 1IO2A 4DQQA 5KT4A 2KW4A 3EPIA 3V6DB 3QEXA 4ED2A 5I3UB 2ASLA 4ZTFA 3PW7A 4E7KA 1T05B 3QEPA 4GW6A 1RT6B 3HVRA 5L1LA 3L2UA 2W8KA 4M45A 3BR9A 4XPCA 4KV8B 2JC0A 2Q3SA 3TVKA 3H2LA 3NL0A 3KK1B 3D5MA 5F9LA 3GIKA 3QETA 2RDJA 3DLGA 1JLEB 5KFYA 3MTKA 4ICLB 1RTDB 1RT2A 4C8NA 4N76A 4IH5A 3SV3A 3ISND 3M8QB 1S9EA 1K6YA 3MECA 1LWFB 4DFMA 3D0PA 1R0AA 3HL8A 1NKEA 3BSNA 3SUPA 4HUFA 2C2RA 2OZMA 1IG9A 3N6LA 4URGA 4MQ3A 4CF1A 5KI6A 2XGQA 4F2SA 2YHAA 5T7BA 3DYAB 4O3RA 1D1UA 5F8IA 4M3RA 4MK8A 2UVRA 2OPPA 2UUTA 4LH4A 4EYIB 4FYDA 4DL6A 4O4GA 1GOAA 2R7YA 4J2BA 3NAEA 4DL2A 1RT4B 3HPGA 1C0MA 1DTQA 5KTQA 1EETA 2OPQA 4F8RA 4FCYA 2A1SA 2VA3A 3KK2B 3L3UA 2Y1JA 1A5XA 2E9ZA 3LP2A 3BGRA 4CECA 4K4SA 4FBTA 5EUHA 5KFCA 3MEEA 1EETB 4TY9A 3ZSQA 3H08A 2KTQA 3OSNA 5J2PA 3P5JA 3L8BA 4B9SA 3DI6B 4ED3A 3MXIA 2ETJA 1TKDA 1JLAB 4TQRA 1NJZA 1IKWA 3HP6A 3LP0B 1RNHA 2J6UA 1ZBHA 1LWFA 4I7FB 4CFDA 3G6VA 1C2PA 4DSIA 4O0JA 5KG4A 1RDDA 4QWDA 4KBIA 4JS4A 4FZZA 4ED7A 3SQ1A 5SWMA 1QHTA 3KJVB 4CJ4A 4FLZA 1TVRA 3C6UA 3GIJA 3OJSA 1SKWA 3V1OA 1I6JA 3TABA 5J2NA 2XI2A 3LPUA 3GILA 3MXMA 3KOAA 3AA2A 1FXXA 3F9KA 3NDKA 5HBMA 4ZPBA 5KG7A 4NYFA 4DTPA 1VSJA 3S3OA 3C6UB 5KFLA 1S6QA 3KK2A 4PA1A 3EZUA 4AILC 3G0ZA 3TAPA 2G8WA 3OL6A 2C28A 2X6SA 1OS5A 4URSA 2YHBA 2BQRA 4ZPCA 2KZZA 2EC0A 2Z1IA 1S1VA 4CK2A 4JRPA 4WXOA 4BE2A 1L3VA 4KREA 3OHAA 3GQCA 4OGEA 3DI6A 3DRPB 4I2PA 4DTOA 5HRRA 4O5BA 4PUOB 1RDCA 4CEQA 3HHKA 3T3FA 3QLHB 5KFVA 4NLUA 4AHUA 3SV4A 2ZKUA 2R2UA 1KVAA 1O1WA 5CYQA 2ZD1B 3ITHB 4ICLA 4CIEA 1NK4A 2XCPA 3LZIA 1T7PA 4KHMA 4ZVEA 4B3OB 2DPIA 4IQXA 4F4YA 5KGWA 3RTVA 1TK8A 1QSSA 3GV8B 4JV2A 3AVLA 4ECXA 2XC9A 3V1QA 3M8PB 4K8ZA 4KHRA 3AO4A 4W5OA 3PW0A 4RUAA 2Z1HA 1QSLA 4CFCA 4KSEB 4B9LA 3OYJA 1VSDA 4LY7A 2GIQA 3E51A 3VA0A 1N6QA 2FJVA 3QEIA 3DOKB 1JLCA 4RNHA 3RB6A 4FBUA 1IKYB 3NKYA 4WFZA 3L3VA 2HB5A 2OPSB 1KLMA 1L3SA 4WYLA 5JUMA 2NUBA 4J9MA 2ZQBA 4C8MA 4KO0A 2YNHA 3MEDB 4C8OA 3TAGA 3WNEA 3CJ3A 4W5RA 4H4MA 4Q45A 1N48A 4EBEA 1HYZA 4B8AB 1J5OA 4URQU 5CZ1A 2V0NA 4WE1B 1LWCB 5FDLB 2BGGA 1RBRA 3VQ5A 4FJHA 3MEDA 1C1BA 1S49A 3KMSA 2CKWA 2VA2A 3CVKA 3DLEA 1RCHA 3LP2B 4CF9A 1B9DA 5FDLA 5HRNA 4MH8A 2XY6A 1TL3B 2ATQA 3MFHA 1SH2A 1WSHA 4ZVFA 4B9VA 3H98A 5FRMA 1S1XA 3TANA 3KK1A 4ED8A 2B6AA 4CIGA 3U6FA 3KLFA 1DLOA 4J9LA 4CF8A 1Z4UA 3RR7A 2FJXA 1MMLA 5HLFA 1WSJA 3BQ1A 3NHGA 4B9TA 4PY5A 1TKZB 1N6QB 4K50A 2YV0X 4CGHA 3QNNA 3DOKA 4EP4A 4DSKA 2WTFA 2GIRA 3SJJA 4O4GB 4NRUA 5K14A 4QW8A 1Y97A 1IKXB 2AWZA 2FLLA 4DL5A 1BQNB 1CZ9A 1TVRB 5KFNA 5C42A 2HAIA 4BE0A 4CFBA 4Y2CA 1NOZA 2AGOA 3AVJA 3DLRA 2Y1IA 1LW2B 1CXUA 2XWYA 4ECYA 4R8UB 1LWCA 1U4BA 5KFKA 1J9AA 4Z0UA 1RTIB 4W5NA 2HNDB 1Q9XA 5C42B 2HVIA 2BANB 1RBSA 4LQ9A 3DLEB 1VSIA 2HWIA 3UIQA 1C1CA 1BIZA 2JEIA 4ZTJA 2DTUA 2W7OA 4IFVB 3T5LA 3V6JA 1EXQA 4FM1A 2XY5A 1NKBA 5C24B 3CIZA 3SYZA 3SFUA 2AQ4A 3OS1A 4CJSA 3RBEA 2R8GA 3K2PA 3H5SA 2O4GA 3EY1A 4FK0A 4KI6A 1L3TA 5DQHA 4DL4A 2ILZA 1ZBUA 4FM2A 1DTTB 4J9PA 3N6NA 2YNIB 3DRRB 2FBXA 3HVAA 2HWHA 1SH3A 4ZP9A 4Q43A 3HO1A 1SV5A 3DRSA 2A1RA 4F4KA 1SUQB 1Z25A 5HP1B 4TY8B 3MEGA 1W9HA 5C25B 1QAIA 1S9GA 1YVFA 5J2QB 1QQCA 4CFAA 1HRHA 3VQPA 2YKMA 4XIUA 4E7IA 3NGDA 4EYHB 4KHQA 2FBYA 3CDEA 3KLGA 3KLEA 4H4OB 3PUFA 3TAEA 4B08A 3DMJA 4ECSA 1WNEA 4ECUA 2RPIA 2D7SA 4CJ3A 1QSYA 4FJ5A 1N5YA 5KFWA 3IS9A 4DF8A 2KZMA 4BDPA 1D5AA 5DQGA 1RDBA 2IOCA 4CERA 2IC3A 3NMAA 4YNQA 1RTDA 1RT6A 3BSOA 2G8KA 4IKAA 1WSIA 2ZE2B 3QIPA 4M3XA 4Q8FA 2JEJA 2R8JA 3LAMA 2GC8A 4ECVA 2F96A 2Z1GA 5L1JA 4PWDB 1QTMA 3I5CA 1VSMA 2QE5A 1J54A 3WNFA 2VG7A 3KLIA 1TL3A 4LSNA 5KT5A 1D9FA 3M9MB 2HHVA 4RW7B 3NF8A 2PYJA 4BE1A 3NCIA 2IM0A 3KHHA 4HHTA 2C2DA 4IG3B 2HMIB 1T94A 3QZ8A 4CGGA 4ZVGA 1S48A 4RW8B 3FRZA 4HUGA 4DTMA 4O4RA 4QWBA 2YKNA 4O3SA 5L9XA 3OYBA 2QKKA 1SL0A 2YNGA 4HVJA 1FKOA 3V9ZA 4OJRA 1TL1B 4CJQA 2J6SA 4CK1A 2D5RA 1NHUA 2R8KA 3VN5A 3O4NA 4HCBA 5EDWA 2BDPA 4FJMA 3DYAA 4FJ8A 3OJUA 3AVBA 1UA1A 1U45A 1HQEA 4ED0A 4NLOA 4EEYA 4AHRA 1S1UA 4ZPDA 3MFIA 1S5JA 3NAHA 2FVQA 2FBVA 2W9CA 1JLAA 4N5SA 4FLYA 3QIOA 1KVBA 2HHTA 5I3UA 1XR7A 5KFXA 1ZTWA 3QLHA 4NLGA 4J9QA 4Y34A 1KHWA 3OVNA 1C0TB 4KV8A 5CYQB 4FS2A 3QEVA 4J9SA 3GV5B 2ITGA 1TKXA 3FFIB 3TAFA 1RTJA 3M9OB 3QERA 4IR1A 1WAJA 3M8RA 4RUCA 3QGIA 4Z4IA 4W5QA 4NYZA 3PJWA 4QWEA 3KHLA 2HNZB 5HROA 2R8IA 2FJWA 4CEEA 5EWFA 3PV8A 3NF9A 4DLEA 4Q5VA 1UOCA 3I0SA 1GX6A 4HYKA 4Z4CA 3VQAA 1XR5A 3PVXA 4CJRA 1RT4A 4E0DA 1HQUB 4M3YA 5F8GA 2HW3A 2JEFA 3SI8A 3VQDA 3OS2A 2OH2A 5J2NB 5CY4A 3Q8QB 3F73A 3DMJB 4DTRA 4K4XA 1S4FA 4FJKA 1RT1B 2W9CB 4EZ9A 4B8CA 4HTUA 2JLEA 1C1BB 4DFKA 4IDKA 3G6XA 4ELTA 2HHWA 1HNVB 1S0NA 2RKIA 2EHGA 4DU3A 3EPGA 3NBPB 4HUEA 4HCCA 5F8JA 1S9FA 4R8UA 2C22A 3B6PA 4NLRA 5I42A 1TQLA 1VK0A 4DQPA 4MK9A 3IG1B 2BQ3A 1U04A 4AHTA 4CHOA 4KB1A 5KFJA 5KRSA 1S9EB 3DOLB 4CGFA 3MEEB 3V4IA 4NLSA 4K8XA 3NGIA 4QPXA 4KHWA 2IMWP 3K5MA 3DLHA 3E01B 1RT3A 4JLHA 5KFEA 4CEFA 1IKWB 2V4QA 2DFHA 1NK8A 4RG8A 3HT3A 2AU0A 2YNIA 3DRRA 1IH7A 2JEGA 5KRTA 3ISNC 3KTQA 3PJXA 5F9NA 4E7LA 3AVHA 5KGXA 4ID1A 2G8IA 3BJYA 4K4ZA 4BDZA 1TP7A 3P83D 2FLNA 1EP4B 3CJ0A 4GMJB 3SQ2A 3CM5A 4EO6A 2ZE2A 1HYSB 3TI0A 4DSFA 4DFPA 2X74A 2WONB 5C24A 1JLGB 3TARA 3SCXA 2XY7A 4R5PA 1REVA 2DPJA 4AHSA 4OKKA 2BRKA 4OLAA 2BRLA 3JYTA 1MU2B 4B3OA 3V6HA 1ASVA 4Y1DA 2P5OA 4CJKA 1WLJA 3RB0A 1GX5A 2OZSA 3RB4A 3DDKA 5KFFA 1TK0A 4WFYA 4RW8A 1JLFB 3K57A 3ZSVA 5C25A 3HJFA 4Y3CA 4CJEA 3HXMA 2IAJB 1D0EA 2YKMB 1TAUA 1VRTB 4NYNA 2OPSA 1LW0A 2WB4A 3MXJA 4PWDA 1YTUA 5DGBA 3AVMA 4DTNA 3VQ8A 4QCLA 3FSIA 1YTAA 3Q8PB 2P51A 4M3UA 4DTUA 4EZ6A 5HBMB 3HSTB 3OL7A 4H4MB 3BREA 4JV0A 4QOZB 4ZHRA 5KFRA 4DF4A 5KG6A 1NK7A 4J9OA 4FJIA 4CHYA 4IRDA 4FJNA 2ILYA 2IM2A 2WOMB 5CYMB 1KFDA 2W9BB 4U6PA 2B43A 5KFOA 2WONA 1UA0A 4ZVHA 4RZRA 1R0AB 4ECTA 1JXEA 2IA6A 2XCAA 3OLAA 4ZPAA 2BE2A 3AV9A 5DG9A 1RTIA 2W8LA 3RMBA 4PUOA 1B92A 5KFHA 1TKTA 4DS4A 1SL1A 1ZBLA 3CJ4A 4XO0A 1RTHB 1TV6B 3NAIA 3ZSOA 4KE5A 3BQ2A 3U3YA 4NLTA 2ZD1A 2AJQA 3OYGA 1CLQA 1FK9B 4CJFA 5J2QA 2RDIA 4IRCA 3KJVA 3SNNA 4Q0BB 1N4LA 1HNIB 4YFUA 3V1RA 1TKXB 2HMIA 4RW9B 4WFXA 4ZP8A 4CIFA 4DU4A 4JUZA 3HVTA 3AVCA 5FROA 3DLBA 2B6AB 3SPYA 4KRFA 4L8RB 3L2VA 3AVNA 5KFSA 4FLXA 4DQRA 4CHZA 5EWGA 2OPQB 4KHYA 1S0OA 2UVWA 4I2QA 2EX3A 1S1UB 5KFQA 4M94A 3H4BA 3S9HA 3AA4A 2I5JA 4RW4B 4EP5A 4CEOA 3LP3A 5JS1A 4ECWA 4IH6A 1JL1A 1T03A 5J1EB 2IM1A 4JV1A 1L3UA 3IRXA 4TLRA 2IS3A 1JKHB 2W9AA 2IBKA 4DQIA 3BSCA 4Z4FA 4E7HA 4FLUA 3OHBA 3V9UA 4AHVA 2B5JB 4FXDA 3V4IB 1JLBB 4NCGA 1XWLA 2PZSA 5F8NA 2BANA 1RT7A 4Q44A 4YR3A 1JLQA 4KHNA 3TAQA 2F8TA 3JYTB 4CJLA 2PY5A 4M95A 1ZBFA 2OPRA 4KB0A 5F8MA 2OYQA 5DLGA 1EX4A 1LWEA 1WSGA 4Y2AA 2AGPA 3KLVA 3ITHA 1F21A 3CFPA 2VWKA 4LSNB 4F4WA 4O44A 4M3WA 3CDUA 2HHSA 4CHNA 2I1RA 5EWEA 3I0RA 4DSJA 3LWMA 2E6LA 4F4XA 3NE6A 3CFOA 3MR3A 3VQ9A 5KG2A 3NF7A 4CJUA 3RRGA 4F2RA 4OKJA 4RW6A 1WNSA 2FVRA 1U48A 3VQ6A 1QE1B 1KTQA 1I39A 2RN2A 4FK2A 2JC1A 3HVWA 5EU7A 4EO8A 1U09A 3T1AA 2IM3A 3O3FA 3L2WA 1BQMA 1S1WB 3NFAA 4QW9A 2DFFA 3OL8A 5CYMA 5KFIA 4IH7A 2D3UA 4O3QA 3IS9B 1VSFA 3O3GA 3IG1A 2BE2B 3GIIA 3RBDA 3OYCA 1RYRA 4FM0A 3KLHA 4F3TA 4DSEA 5F8HA 3L2RA 3QGGA 3LP0A 1VSHA 5F8LA 4CGJA 1RTHA 1TV6A 2RF2B 2HHXA 2DY4A 4IG3A 3V9XA 3VQQA 3MEGB 4ED6A 4KKOB 1SL2A 1Q8IA 2JGUA 2KFNA 4KTQA 2PYLA 3HPHA 5KFTA 1IKYA 1JIHA 4FS1A 2FVCA 1WSFA 4TSXA 3D28A 1IM4A 1GOBA 3AVFA 2VG5A 2FVSA 4B9MA 3NGYA 3T5HA 4ECRA 4CEAA 1XHZA 3LP1A 4AHCA 4TQSA 4I9LA 3D45A 3RB3A 4E19A 1BGXT 5KFZA 1CXQA 1S6QB 3CYMA 4Z4GA 4QWCA 1IKXA 3OYKA 3T19A 3CDWA 3H5XA 4J9KA 3OYLA 3CM6A 1BI4B 5DLFA 3AO1A 3RAQA 3U3GA 4LD0A 2YKNB 1RA7A 4ZMMA 1NOYA 4CJ5A 2IC3B 3NH0A 3HM9A 3QZ7A 5T14A 3C6TA 1S1TA 1W25A 5JS2A 3DM2A 4G3IA 4CJPA 4FJJA 4N41A 1RT1A 1KCFA 3CG7A 4K4TA 3FFIA 1BHLA 5CZ2A 4M3TA 3OYIA 3RMAA 1KRPA 1N56A 2ALZA 1RILA 3UPFA 4KB7A 2O5DA 1X1PA 5KT6A 4O3OA 4DTJA 1FKPA 4Q8EA 4G1QB 4KKOA 2UVUA 1RDAA 3VA3A 4J2EA 4X2BA 2GUIA 3WNGA 4DFJA 2AX0A 4KI4A 1C0TA 5DMRA 3SUOA 3TAMA 2AGQA 4GC6A 4RNOA 1UAXA 3LANA 5KG5A 3VQCA 3IAYA 4TN2A 3MR6A 3T5KA 4RU9A 3OYEA 4M3ZA 4TY8A 1FKOB 5KFGA 4Z4EA 3MR2A 4FJ9A 4CE9A 2HHQA 1T03B 1HMVB 3TAMB 3ZT4A 3OSPA 2IJFA 4OVLA 2G8HA 1DTTA 4PQUA 4WXWA 2DFEA 4I7FA 4U7CA 4BDYA 4NLXA 4QAGA 3TR8A 4IFVA 3DM2B 4BACA 1QE1A 3IGVA 2B5JA 4XPEA 3DRSB 2XI3A 2AX1A 4NLYA 3ZT3A 3PR4A 3ZT1A 3ALYA 4DG1B 4DL7A 4CGIA 4PQUB 2E6MA 1A5WA 4J9NA 4TXSA 4FK4A 4DL3A 3VQ7A 4KPYA 5SZTA 1KFSA 3OS0A 2WK4A 1G15A 3MAQA 2HHUA 5KFDA 4IBNA 3CJ5A
chains in the Genus database with same CATH superfamily
4MYUA 1GLDG 2D69A 3W1YC 2VQEK 1A5VA 1ZPVA 4ID5B 1V3SA 3CI5A 1JB0C 5D78A 3CQ8A 2WC9A 1TK5A 3QSYB 4ED1A 4LF4J 2DH9A 1ASWA 2LSNA 4EK2A 2DYAA 3D6MB 1XK8A 1RT7B 2OPPB 4PR6A 3KUGA 2DR8A 3QYYA 4PWUA 3OY9A 3CCJS 1JNRB 3L7PA 3DXSX 2NREA 3JXOA 3SI6A 2B4UA 2EEYA 4BWMA 4WZQA 4CO0A 2IDLA 1LAVA 1I94F 3AFGA 4ZJLA 4O44B 1YBUA 2VPZB 1M5VC 4IXCA 3AD8C 4JK9A 1RACB 2UZAA 3F44A 5KT3A 5L1IA 2MXYA 3PX0A 4B3MJ 3DRPA 1KS2A 5A6WA 4J91A 4KH6A 3HHEA 3MR5A 2X78A 5GAHU 2FLPA 1JLEA 2W9BA 4IFYA 3CO9A 2DGXA 3FSXA 3RSEB 3J7A1 2M2BA 2PC6A 5KG3A 1FF2A 2IJNA 1ASUA 4N8NA 4K4UA 1FRMA 3KLIB 2DH7A 8AT1B 1FD8A 4OI2A 3LGHA 3JAMY 3WXLA 3O2IA 4J2AA 4JI1F 3UDCA 4DV2F 4X65K 2OFGX 1VQ8S 2YKQA 3MUTP 4B9NA 1T6CA 3I8BA 4YN3B 2NSCA 5AQHA 1YI2N 1VQYA 2OCEA 4CESA 4Z4HA 3PJ9A 1T9WA 4LF5F 3B4DA 1G6BA 4CRJA 3RW6A 5CHIA 3TVYA 4LBPA 4YOTA 1H0HB 2ABYA 3DXKA 3ASMA 2MY7A 1IBMK 3I5AA 5KFMA 1AYEA 3IR6B 3NGRA 3RAXA 1RA6A 4N8OA 4DCPB 3FDSA 4V19X 3ICLA 3JQMA 3K0SA 3Q8RB 3QMLA 4DOZA 5A2QU 1U6FA 1F2HA 2B4OA 2R7QA 2RQKA 4X66J 2H4WB 1X0FA 3SSSA 1IV0A 1MG7A 1EX8A 2G8VA 1T3VA 4ZP6A 2PE8A 2NRRA 3KK3B 3R7NB 4RTFD 5CD4A 5JVHQ 2R2TA 3ZSWA 3GR0A 4DR2F 1VQ6N 4NASA 4OL8A 4KHPK 1EQMA 4HI1A 1K9MT 3I56N 1R31A 4MKBA 3OTEA 3FK4A 2P9NA 3D7EO 1B9FA 4RNNA 5EX3A 1S0VA 1WAFA 5C15A 1FK9A 5IT4A 1Q7YT 1RT3B 5HK4A 2IY5B 2DNKA 2XSFA 2HBMA 1CJUB 5EN1A 2P9NB 5LSLA 4BLGA 4NXMJ 3V81B 2DNQA 3JB9k 1B64A 4DG1A 1KTVA 3IM9A 2P9UB 2UUWA 3KNAA 3CCJN 4RNFA 1BIUA 3UD3P 3P4IA 1S0MA 1F0XA 4F50A 3TUPA 2LXIA 4X64K 3U1MA 1WC5A 4KR0B 2Z4PA 2OTLN 2VC0A 2VFTA 2ZFHA 2FZKB 1FDNA 2NRXA 3NY0A 3QB0A 3WBZA 5HVFA 3OYHA 1H2VZ 1Z6RA 4Y00A 1LAWA 3CT9A 1HBOA 4NLQA 2ZVIA 2JRSA 3ZCMA 2OD6A 4PPDA 1UFKA 2H48B 5LMNF 4BRHA 3QRPA 4RBVA 3V9WA 2DISA 1DZ5A 3SLCA 3I0RB 4OX9K 3LP1B 3OFHA 2O8DB 4KAZA 1X4HA 3VOVA 1L5UA 4D3GA 2NPFA 1V3RA 4GC7A 1WC3A 2AZ3A 2EBEA 3PO5A 5EVZA 1S10A 2PFDA 4CEDA 1HD0A 4QWAA 4RO0A 3VPZA 3N5FA 2AJ4A 3W63A 5EHHA 3CWJA 4OHVA 1BG3A 1VR6A 3K89A 3A5NC 1OY9A 3QO9B 3LGMA 1UWBA 4JV5K 3FQLA 1BQNA 1VQ9N 1HNZK 3G82A 2ZJPL 1SBRA 2HMPA 3OLBA 3OXFA 3EE3A 1Q81O 4N56A 2NZCA 4BY9C 3VAMA 1LOUA 4JI2J 1HL6A 1HFEL 5HJYA 3QMQA 3L4QA 2J8AA 2YNHB 3HCXA 3VR1A 4NZ7A 5I4MA 2N3LA 5K14B 2Y8WA 3GJSB 3H4DA 3FEXB 1JLCB 2LXFA 1CJKA 1I3OB 1VHFA 2VWJA 4IR9A 1OH7A 1HARA 4AH9A 3AVGA 4ANEA 3BKUA 4X4RA 4Z37A 1XMBA 2YQ3A 4ILRA 5ETNA 2QWPA 4F3QA 2HBKA 1VBYA 2KXNB 1GQEA 4F3OA 3EJMA 3FVYA 3N0VA 2BYCA 2D4WA 2HEKA 2GHWA 4WE1A 3FEYB 3VTIA 3RWUA 1X5PA 4DR4F 5KOWA 1S1WA 4M8LA 5KG1A 2E5LF 4MMOA 4LVNP 4CJWA 2N4DA 3ZT2A 4B3SJ 1S9GB 2FZGB 4DX8H 2R2RA 2PMHA 1RBUA 3W2WB 3WX4A 3LO3A 4E7JA 4EBDA 3FFKB 1Q8BA 3E9LA 3CJ2A 3A3PB 2I7PA 4P75A 4EU0A 4FZYA 4LF8K 5A2QY 3K5PA 3OR2B 4FWRA 2P9CA 3I87A 2DNPA 1JLBA 4CZIA 1YHQS 4DWIA 3DRYA 3Q8SB 1PYSB 5DDQC 1K1QA 3I8DA 5L38A 1PIEA 4R0EA 2OAUA 4WPAA 1K1SA 4IOAL 2YX7A 2RKIB 3G6ES 2X1FA 3CMAN 3ZX2A 4KO0B 3QIPB 1Q86O 3IFEA 1HKBA 3GG1A 1WEZA 4PQAA 4PEOA 4O5FA 2CPJA 1F9EB 1D8YA 1FNOA 4CHQA 3BV8A 4C0BA 3IN5A 2ZM6K 5HRSA 4IDKB 1M1KT 4OO1J 4F9OA 3U7JA 2E20A 1VQ6S 3ET6A 1LV5A 3C6TB 4C8YA 3ZTQA 3L7UA 2CJQA 3THVA 3B6OA 4KAIA 1ZETA 2FY1A 3P5BP 3AAWB 1TKTB 4NYOA 3UKUB 1T8EA 3A2FA 3PIPL 1VHXA 3I6PA 2ATLA 3M2RA 1RHQB 4NCBA 2EFGA 2PDAA 4FF1A 3DXMA 4WP9A 2V7YA 4RW7A 4ID8A 2WRMA 2PA3A 1SV5B 4PZVA 4JI0F 2IDEA 2DBBA 4LRAA 2HNYA 2BKOA 2SXLA 2DT9A 1MMNA 1Y7PA 5KT4A 2Q43A 2BX6A 1RAEB 2ASLA 2P9KA 1Y4ZB 4L73A 3PEHA 1IR0A 1FDAA 3MCNA 4GW6A 3HVRA 5L1LA 5KOXA 3BR9A 4U9RA 3CMEN 3TVKA 5L9NA 3ILIA 2XYPB 4I68A 2MKKA 4ITSA 3NL0A 3KK1B 1GTHA 3H8YA 4YB6A 4H0VB 3DLGA 4H5NA 3MN5A 3GBTA 1E6YA 3DHXA 2PA8D 4IO9L 2F3JA 1YJVA 2XULA 1QJHA 1BY9A 2J0QD 4LIWA 2GGPB 5KPRA 3SV3A 4KH5A 1KAZA 1X31C 2FF6A 2QLFB 1Z1ZA 4HUFA 1B3TA 1VIOA 1NEEA 2OZMA 1IG9A 9ATCB 3N6LA 2YPZA 2BABA 4MQ3A 3H3NO 5IFMA 3UNYA 5KI6A 4DR3F 3D66A 1BLUA 3KJNB 1WOPA 4GV6A 5T7BA 3DYAB 4AT1B 3BZKA 1D1UA 5F8IA 4MK8A 3J7YP 2MKJA 4LH4A 2DY1A 4AUKA 3PSFA 4DV0K 4FYDA 1GFWB 1S4EA 3VEVA 4O4GA 3MD3A 4DCHA 3D3CJ 1KBRA 4J2BA 5B0DA 3LDOA 4LRCA 1C0MA 3HI9A 2BW2A 1M90T 3MM9B 3OFFA 4F8RA 4ZOSA 2A1SA 5IOLA 3L3UA 2MKCA 1H98A 2Y1JA 4I6MB 1WD6A 1M1KO 5D8HB 2XMAA 2OKQA 5JVGL 3I31A 3OVBA 2KTQA 4NL5A 5J2PA 3L8BA 3BGUA 2ETJA 1W7WA 1NH7A 3UDEA 5CXTA 3IBFB 1IKWA 1NJZA 2Q1NA 1YITS 2J6UA 1LWFA 4A62A 4CFDA 1C2PA 1UP1A 4FWPA 3D6RA 5KG4A 5C2FA 4ED7A 4KGZB 2F40A 3CF5Q 4FLZA 1TVRA 3W3DA 2ADBA 3CJCA 3OJSA 1SKWA 5MAOA 3V1OA 1G4CA 2O8DA 5J2NA 4FZVA 3A12A 4OX9J 1WELA 5KG7A 4NYFA 2IPOB 4O8KA 4DUZK 1X9JA 4Z2XA 2XO6A 5LMNK 2X1AA 5KFLA 4RPFA 3KK2A 3MPWA 3G0ZA 3TAPA 4P73A 2KM8B 5JLHA 1N54B 2YHBA 2WVCA 4BRNA 2KZZA 2Z1IA 4LF5J 1RAFB 3DI6A 4A8OA 3O9TA 1FVQA 4E98A 4BVOA 2K7KA 5BR9A 2UXDK 3EO3A 4PUOB 5LXYA 3ZTRA 1RDCA 4CEQA 3JAMO 4ZVPB 2J0XA 4NLUA 2OEMA 5L8RC 3MMAB 3VGTA 2R2UA 2F7TA 2HRTA 2HBYB 1O1WA 2ZD1B 3ITHB 3D1HA 2PBDA 1WB9A 2XQCA 3D2WA 2CZ9A 2WSEC 1T7PA 1BQXA 3EXCX 4KHMA 3C65A 1RAGB 4BG8A 3VAIA 2N82B 2QMXA 4K5SA 4ECXA 1LXNA 4K8ZA 4L3NA 4W5OA 5B7WA 3NVKA 4X66F 1QSLA 1HUXA 4B9LA 4AF1A 4DPOA 1OJ4A 1JLCA 1WG4A 3NKYA 4WFZA 3VENA 3ILOA 2QLWA 2M52A 4AFFA 3L3VA 5A8KA 3A3OB 1U2FA 2HZAA 1F3FA 4ENOA 1T44A 2MYFA 5D4OA 3BN7A 1Z2ZA 2A18A 2ZHAA 4OZNA 2P9LB 3WEEA 4H4MA 5BR8J 5C7PA 2ATCB 4Q45A 1YJNS 1WG5A 1HYZA 1NPKA 4JI3J 1EO1A 2B4VA 2RRAA 2QEXS 4FJHA 3CMQA 3MEDA 2H3EB 4XDCA 5IV3A 4R79A 1S49A 2PO4A 2ZOMA 3KMSA 2CKWA 2G2OA 3Q89A 3M6WA 2VA2A 3DLEA 2D0PA 4IJAA 3GL1A 3TP2A 3AOBA 4CZLA 4P7TA 3DXKB 2DCLA 3MFHA 1HNWK 2D1KA 3OW2M 4B9VA 2XMMA 1KOHA 2DEIA 4ED8A 2VPXB 4FN5A 3KLFA 1U1MA 1DLOA 1UTAA 4CF8A 3RR7A 5HLFA 3LF0A 4DB3A 3NHGA 4PY5A 1K73T 1NMEB 4ZK7M 4OV6A 4CGHA 3MN6A 2HRYA 4LFAF 1RBOB 2OFHX 1T95A 1TVRB 3MOJB 1C0GA 1RSCA 4Y2CA 1YIJS 3PKMA 5ETVA 3P49B 2X3DA 1LW2B 4M7XA 4ECYA 3UE5A 1U4BA 1J9AA 4W5NA 1RTIB 3EX7B 4F7VA 4M5DA 2BBEA 2CDQA 5FIIA 5C42B 3PRBA 5GAHP 3DGVA 5IC6B 1Q4RA 3T5LA 1EXQA 2ASYA 4CNZA 1NGEA 4CJSA 3D2EA 4DPWA 4MLEA 1P9QC 2O4GA 4FK0A 4CWBA 4KI6A 3IR5B 4CO2A 4LF4F 4DL4A 5HVHA 1U1NA 4G1PA 2P9UA 5BJRA 5LXRA 1VFJA 4ZP9A 3TSPA 3T41A 3HO1A 1SV5A 1YTYA 4F4KA 5HP1B 1W9HA 2OP5A 5C25B 3WUHA 4E8UA 3SK3A 1SZ2A 3FZFA 1HBUB 1KVIA 3SCKE 5M1PA 4WU3A 2FBYA 4H4OB 3PUFA 3TAEA 2GX9A 2YJFA 4KH0B 4B08A 3W5YA 4OHZA 2PT0A 4UUWA 1N8RT 3AXKA 2EC2A 3A4TA 1RBLA 3W9HA 3RJMB 1N5YA 2LQ9A 4ZKAA 1PO6A 1BWFO 2KZMA 4A46A 5AR0A 2H3GX 1RDBA 1UL3A 4ZCMA 1X4GA 4TKTA 1VDHA 1EKSA 4CERA 3NMAA 2AJ0A 4DN9A 3QIPA 2LECA 2DD8S 3HSCA 3FUYA 1N0UA 2R8JA 3LAMA 3T6BA 3U9DA 4ECVA 2F96A 2VPYB 5GINA 4PWDB 4H4KA 2VG7A 2QLXA 4RW7B 3NF8A 4J8FA 5MLCQ 1IQTA 2GJFA 4GMKA 2OELA 1XNQJ 2NRZA 2EG2A 4HHTA 3QZ8A 2F4VJ 5AZIA 2M4MA 4Y0WA 3MX5A 2LYVA 2GQCA 1F60B 4HVJA 3V9ZA 4OJRA 1NHUA 3M1VB 2LEAA 1VJQA 2B9XA 4JI0J 3VGLA 2GMHA 1S6UA 3IDHA 1N0VC 1FRJA 1N34F 1QVGR 1W26A 2P9EA 4MLHA 3FZMA 2ZGZA 1FFGB 1LFWA 2RS8A 1VQSA 3HJVA 3KG4A 3CDAA 5E3QA 4FWLA 4M5LA 4J9QA 4LF1A 1GLBG 3OVNA 4J90A 3RU0A 4J9SA 3J7ZO 2ITGA 5B0BA 2YH1A 1ESVA 1WF0A 3TAFA 3QERA 1WAJA 3M8RA 3QGIA 4W5QA 4K5RA 6FDRA 3ZZOA 2BW7A 3N9UC 1UVNA 2UXCK 1QD1A 2FSJA 2C1EB 3AOCA 4DPUA 4DLEA 1VQ5N 3QAUA 1YHQN 4HYKA 1NWKA 5HAOA 1UKUA 2WW8A 2K3KA 1M0SA 2POKA 4IOAQ 2JEFA 3SI8A 3VQDA 2M9KA 5LJWA 4JKHA 5CY4A 3F73A 4OYAA 4OZ5A 4K4XA 2ZHBA 5GADI 3VALA 2GZOA 1ATRA 4ZLNA 2RKIA 4WF9Q 2EFVA 2H65B 3NBPB 1FA0A 2E1PA 2C22A 3HX9A 4DV4J 4F67A 1NXIA 2F4VK 4DQPA 4JI5J 3O1BA 2DGOA 1RXOB 4KB1A 1Q5VA 2G13A 1S9EB 1YBAA 4K42A 3D7SB 4CGFA 4NLSA 3T9NA 3H46O 4QPXA 3U02A 4JLHA 5KFEA 1OO0B 2LQ8A 1NK8A 2RJZA 4HT7A 3DRRA 2QLBB 3ISNC 1YK9A 2QXLA 4DR5K 3UKRA 3AVHA 2F5GA 3SEOA 2MZSA 2AF6A 4ID1A 3CB4A 2GHVC 1SAZA 3BJYA 1XN9A 4EFAC 1YRUA 3SCIE 1GT8A 4D3HA 1B70B 2P9SB 1RE1B 2V52B 2J76E 1E4FT 1DGKN 3X1LB 3AOAA 2KYZA 4EO6A 2L48A 2ZE2A 4A59A 4H5RA 1NU4A 1I5OB 4DV3K 2J9EA 2XY7A 3ZLJA 3O6QA 1REVA 2E44A 4OZJA 2XLKA 5CHCB 1N5QA 3A5LC 2VOPA 3ENBA 2BJ8A 4B1VA 2H51B 2XTJP 1MMDA 1SQEA 1PJ7A 5D6GA 1D9AA 5BYRA 2DK2A 4RW8A 2MJNA 4Y3CA 1W97L 2UXBK 3BYRA 4KHPJ 1TAUA 3DOMA 4LRBA 5IWAF 4DI6A 4CLWA 4CNYA 4NXMF 3VQ8A 3QBXA 1R89A 4M3UA 5EX5A 4EZ6A 5HBMB 2J0WA 3CERA 4KRWA 4H4MB 2VL1A 3A3NB 4ZHRA 4DF4A 4ZCIA 2QL7B 4J9OA 3M8YA 1R59O 4FJNA 4DUZJ 3JS6A 4U67Q 2VGMA 2O01C 5CYMB 2J9DA 2W9BB 4FPRA 5KFOA 2WONA 2D9OA 4ZVHA 2Q0RA 4ER8A 2YCHA 5D4NA 3OFGA 2MQ8A 4CYUA 2AA4A 2IA6A 4KT0C 2XCAA 4ZLJA 2XZTB 3AV9A 3OTBA 4JV5J 5KFHA 4DS4A 2BJEA 4WTOB 3AAPA 1S72N 2AEJA 2UUCF 3U3YA 2BV3A 3MUVP 2JJ4D 3T1YF 2FF3B 3SJHA 5ETQA 1CS4A 2ZH2A 2CPIA 1R8HA 2VOOA 3R8EA 2EVZA 3KJVA 5K20B 2Y1RI 2E7XA 1VQKS 2YKPA 2B9WA 4GKKF 3LPEA 1TKXB 1FRLA 1F2GA 2DVIA 2CWKA 3AVCA 4H4KC 3NP5A 4FYWB 2KFYA 3D6FB 4WU2A 5B0FA 4AL5A 2QA2A 5KFSA 3DAWA 4CHZA 4OZLA 1CQNA 5EWGA 4LF5K 2OPQB 2KLAA 2YKAA 1AB8A 4JKBA 2UVWA 4I2QA 1S1UB 3H4BA 2I5JA 4LFAJ 4B17A 4IOCL 4I56A 1SC1B 4IH6A 4C11A 4CLLA 5DZ6A 5J1EB 2IM1A 4JV1A 2IS3A 4CO4A 1JKHB 2V8PA 1KKHA 4DQIA 1HHQA 1PJ6A 3M2UB 4Z4FA 1NH8A 2FDNA 5D0HA 2DR6A 3H7HB 3V9UA 3O1LA 2XMUA 4BBYA 3V4IB 1D09B 1XWLA 3W7BA 4G65A 3I32A 3T7ZA 2PZSA 1T02A 1P9YA 2BANA 1RT7A 2VBYA 4DPXA 1REGX 2DITA 1D3WA 3TAQA 2F8TA 3JYTB 4M95A 1NO8A 1ZBFA 5JICA 3EKSA 3HSGA 2UUCJ 2OYQA 1LWEA 3PIPQ 4X4OA 2Q2RA 2K8GA 4YOEA 3CFPA 1EJ7L 1EARA 1ZZFA 5HL7L 4O44A 3KWGA 3MM7B 1WKKA 3CDUA 2HHSA 2I1RA 4JK8A 1N8RO 3BKTA 5ETMA 4KHPF 4OKJA 1HHSA 2FVRA 4FYXB 3D1OA 1UETA 3IKMA 3HVWA 5EU7A 3MAAA 3O3FA 1I51B 3FR0A 1WACA 3OL8A 1N32K 1S79A 5KFIA 3EE9A 1NSPA 1GLFO 1DQAA 2KHDA 4OMFG 4F04B 3HOTA 2DGSA 4WJBA 4DPTA 3KLHA 4F3TA 5F8HA 4C0OC 4BR7A 2V67A 2WTUA 5F8LA 2YX6A 2RF2B 2HHXA 1KAYA 1M90O 3AARA 2DY4A 1RLDA 4YHHF 4BR0A 1MA9B 2ZM6J 4C7QA 2KFNA 1GMUA 4KTQA 3HPHA 3HZGA 2ZC4A 4AM7A 4IOXA 2AHOB 1WSFA 3IMXA 4M5HA 1WG1A 4X62J 3WXJA 4CJ7A 1GMVA 4LFBK 1JXVA 3D45A 4E19A 1BGXT 5KFZA 1DQ8A 4OIXA 4K7QA 3QJPA 3QT8A 5IQ6A 2MB0B 3CDWA 3OYLA 1BI4B 3PYDA 5DLFA 3JSYA 3U3GA 1C4CA 2DO0A 2XNRA 1NOYA 2IC3B 4JP8A 4AYBD 3I56S 5T14A 2YQ1A 2UP1A 3DM2A 4UF4A 4G3IA 2EW9A 4CJPA 4FJJA 2FUG9 1KCFA 1UVIA 3OYIA 4NA1A 3LM9A 4FVCA 1RILA 1G1XA 4KB7A 2IVNA 2JWNA 3AB2B 1X1PA 2VIHA 4OX6A 4JV5F 1FE0A 1FKPA 1RHRB 4G1QB 2UVUA 3VA3A 1MROA 2ZJPQ 5GAHI 3EVWA 3MD1A 3S7RA 1UWAA 1RHKB 1C0TA 4U7UD 1B7YB 4B1UB 2W01A 4HTLA 1V5VA 3SUOA 4PXCA 3TAMA 2F8MA 5KPTA 4CT8A 3UD5A 1TUWA 1M5KC 4M3ZA 1ZBSA 2C2OB 1FT8A 3MR2A 4FJ9A 5IV4A 1YZ7A 1HMVB 3ZT4A 3OSPA 2IJFA 4OVLA 2G8HA 4DV6F 2CPDA 1X8DA 4YY3F 4ZVRB 1VGYA 5AQLA 4PG8A 1SQKA 5K8MA 4MJKA 2XI3A 3ALYA 2GX8A 5HQLA 2VF3A 4I6AA 1PCAA 4BRGA 3Q8UA 3FBFA 3CD5A 4DL7A 4CGIA 5HQ8A 3RBXA 2PGCA 4TXSA 4FK4A 5GAEP 5B08A 3GB0A 3VQ7A 1KFSA 2GJIA 3C6AA 3IO1A 3OR2A 1G15A 3D6HB 2ZH1A 3A13A 3GV7B 1TR0A 2CH5A 3OYMA 4GVMA 4LF9J 3ZTPA 4MKAA 4OZ3A 3C14A 1DFDA 4DV4F 5ITHA 1R6VA 5HLFB 1ZBTA 5AJ3J 1GNKA 3MCAB 1NNDA 2AIRB 3OHRA 1FW6A 2KFZA 4A5AA 3LDSA 3CCLS 3LPYA 3RAMA 4LBHA 4OPJA 2QSFA 2K1RB 1KQSR 4M5NA 3O4QA 3K5LA 2YKOA 4HDHA 4I67A 1LXJA 4GKKJ 4BR4A 2KJVA 4W90B 4NLVA 4OI1A 3G86A 4OKEA 2NLXA 1NJWA 2OI2A 3GJTB 3OYFA 4QIGA 5E26A 4UOCA 1N33J 1BISA 1QUVA 4OPKA 2PFUA 2D0BA 2DHSA 4KH1B 4DHYA 3M2UA 1VRUA 1J5EF 4JAXA 1IKVB 3S3MA 4OZ1A 2ZGYA 1Y5IB 4USMA 4DR7J 1FJGJ 5BPLA 1JMTA 3CPEA 2CNLB 1BCOA 5AQXA 4JKDA 3IWXA 2CPZA 1LNQA 2MHEA 5DG7A 3PY8A 1S6PA 4ISFA 4IJNA 3DLLL 4GKKK 4DTXA 1UVMA 3H40A 4YDXA 3T6JA 2QC3A 4FLTA 3I0SB 4BGBA 1WF1A 2D41A 2VG6A 5CCLA 1YJ7A 3BF3A 4YHHJ 1HBNB 4ELVA 1NGJA 4FJ7A 4NRTA 1VQNN 4ZVUB 2WHOA 3O9RA 3TZXA 1CZAN 4LFCJ 3Q83A 3QFHA 5HRPA 1FFWB 3OTOF 1FXLA 2DNHA 2CJ9A 3PX4A 4HR2A 3H5YA 2RVJA 3MZIA 3GOIA 4P52A 3VQBA 1PG5B 2HKEA 5HMWA 5LJ5Y 2OIHA 2G1DA 3NEKA 4IRKA 4WQ5A 1YX2A 1O0PA 3VEOA 3WNHA 2V34A 4H8KA 4IDHA 3UB5A 3Q2SC 5M1NA 1JL2A 3BGFA 4C8KA 4H03B 1XMOF 3MMVA 4LREA 2DB1A 5KT7A 2V51B 1RAJA 2XS5A 1S1TB 2GO9A 4KGXB 1WF2A 4CO1A 3UR0A 1RBVA 4H0TB 3G6YA 3HKWA 1VSKA 4E1NA 4FWOA 1Y3JA 3KKRA 2CA9A 4MFBB 4IG0B 5K8OA 2NQPA 3M2VA 3Q7CA 1ZXOA 3J7ZT 5DK5A 3P38A 3RR8A 4DQSA 3ZEUA 1W2IA 5HOOA 1Y5LB 2O8CA 2WSFC 2KXHA 3M1VA 5AT1B 1ITGA 2A3ZA 1JCFA 5HN0A 5KFAA 3TA1A 1HYSA 1HNZF 4CLSA 2ZH7A 3KLGB 3KLEB 2R2SA 4OX7A 3A8JA 2RB7A 2VDIA 2J6TA 5HO4A 3DWLA 2FLOA 3PG9A 4NLWA 1M5PC 4NZ0A 4L3QA 3OL9A 1U2VB 2CQ0A 4I2PB 4JYAF 3PCOB 4CF2A 3ZZYA 3K58A 3Q86A 4FWMA 2HQFA 1VRUB 2W2QP 4A48A 4ID5A 4K0KF 4U8YA 2W42A 2ASOA 3K9JA 2Q3PA 2ZBPA 3PW4A 4IKFA 4WQ5C 1J53A 4WYWA 2UUBJ 1GMWD 1BCMA 2ZKTA 1XMOJ 2HGNA 4WTYA 1RCXB 3SMPA 1FRIA 2CQGA 3M8SA 3QGHA 2QA4S 3VGMA 3LZJA 2EFQA 4DR6F 3ZX3A 3MPVA 2GTDA 1HNIA 2Y0BB 5D3GB 1KHVA 2O66A 4QR2A 4OV1A 2ASJA 2PI4A 1TU0B 1SVDA 2BA9A 1B7FA 3WT0A 5DRKA 3VZIA 1V4TA 4BHQA 1S1VB 4OGCA 1D9DA 2OA8A 3OYNA 2E9TA 2VG6B 4CEBA 1HWJA 3SZ2A 1DTQB 4OJ3A 4K43A 1SQGA 5DM6L 2WOMA 3BY5A 3L7OA 4WZMA 4USKA 3CCWA 2W4DA 3D4JA 3SFGA 1RWKB 1NPPA 1P8GA 4LF8F 3TZZA 4E3SA 3H0PA 1SCJB 2RUGA 1PYOB 2E5IA 3ZYYX 2B4JA 3KLHB 4J5OA 2Y1LB 2FJAB 4BWJA 4K2JA 4H54A 1GTEA 1HQEB 3MUMP 4G1QA 2VHGA 4I6WA 1E6VB 3E2EA 2VFSA 2E5GA 2ZWPA 4OHXA 5DDOC 1C6VA 5DS7A 4WFBL 4J37A 2X51A 4MK7A 3C3LA 5J2MA 3OQ2A 3RRHA 2AJ1A 3RSEA 3PR5B 2QEXN 2E9RX 4ES3A 1S97A 3KD1E 1N36K 2V4RA 1NJXA 1T05A 3SQ0A 3AVIA 3OBYA 1RTJB 1ZM4A 3KKSA 2MJUA 4LC9B 4JI8K 2FC9A 4KIAA 3BPDA 3EZ5A 2F8EX 4NWBA 1YLXA 3SUQA 4Q7AA 3D54A 2ZOFA 4DV5J 5FLXO 5LJVA 5IT9O 3LM2A 4GVBA 1HJRA 3KKFA 1C0UA 3CCRS 2HNDA 1QLNA 3I33A 4USIA 2CQ3A 2VQFF 1YSJA 4ZVTB 1VI7A 4FF3A 2CYYA 1C1AA 1HLWA 1RB0A 2UV8A 1BXNA 1RWWB 3CCQS 4MIBA 3ULDA 4OJGA 3CCUS 2V2VA 4B9UA 1YJWN 4KFBB 1BUXA 2E4LA 4FW2A 3V6KA 4HKQA 4KHUA 4QBUA 3PKYA 1PC4A 1JNZB 1FVSA 2UUAK 3DOLA 2G0IA 3R6GB 4Y2KA 4DDFA 2D0CA 1KLNA 4ATNA 2APOA 3RW7A 4CZMA 1X9SA 1ROFA 5EX0A 2I5JB 1RJJA 5F41A 3RBZA 3HP9A 2LVWA 5AZIB 3GMGA 3TWZA 1X9MA 1G7CB 1TYQA 1VRTA 1QS4A 1YJNN 2A1BA 3ZSXA 1HNVA 1EQYA 1FE4A 4RNMA 3BEGB 5KQDA 1VK8A 1T9XA 3ZSZA 1FWPA 1XC9A 3UQSA 4ZHRB 4MIAA 1Q78A 4Y1CA 2JWLA 2A42A 4YR2A 3W8GA 3LPTA 1C1CB 3DLKB 3W2WA 2Z58B 4RW6B 3CJKA 3NGZA 4C8LA 3NRBA 3LWLA 3EVOA 3MF5A 1RT2B 3ENHA 2XS7A 2FIUA 1MU2A 1JQGA 3ZX0A 5F3ZA 1X60A 3O44A 2OUGA 4NI2B 3JTPA 4IOBA 4P2SA 3HYFA 3A8KA 2F7VA 4H5TA 3ZSYA 3KMQA 5ETRA 5H1SQ 3QGPA 4UOHA 3OUYB 1TUYA 2G0JA 1TKZA 4EMDA 4DBQA 1EKEA 3KD5E 1SIWB 4MFBA 2KT3A 2Z1JA 1HPZA 2CWXA 4DQQA 4ILHA 2OMOA 3W0LA 4ZIVA 3EPIA 1GLAG 3V6DB 3F9MA 3QEXA 1U1RA 2LU1A 2MKSA 3I4HX 2M3DA 3PW7A 3MCMA 4AQYJ 2GW8A 2FGCA 4M45A 2V7ZA 3MPYA 4XPCA 2JSXA 4KV8B 5JMVA 3TYTA 3MK6A 2XG8A 2JC0A 3GFZA 3UE2A 2Q3SA 3HF5A 2CQBA 3TQEA 1UPMB 2PFFB 3H2LA 1P1LA 3THYA 2ROPA 2VYPA 3VMFB 3O8WA 4CO3A 1TUGB 5C2GA 4C8NA 2HS3A 4YDUA 2NRVA 1MWMA 1YIJN 1PBAA 2J7WA 4X64J 2HQIA 1QDUB 2HHPA 3M8QB 1S9EA 3MECA 1LWFB 2E5LJ 4DFMA 1YXQA 1CS4B 1R0AA 3BSNA 2BE7D 4B3SF 2C2RA 1H2UX 4JYAJ 1Q79A 4CF1A 1UAWA 3CCMS 5AQTA 3LA0A 2O3DA 5K8PA 2XGQA 4F2SA 2ZF5O 2YHAA 1HIYA 1AZSB 4O3RA 4PL7A 1WDDA 2RRNA 4M63C 3M05A 1GOAA 1XNRF 1NNEA 1MWZA 2ADCA 3GIRA 2R7YA 3BF4A 3NAEA 1WOOA 4QU6A 1RT4B 5EY4A 2Y3YA 1NDCA 2VA3A 3QQCD 3KK2B 1VCTA 2ZDPA 5I3PA 3GSDA 4YOXA 2CIMA 2W2OP 2C2MB 3DLJA 4AQYF 4CECA 4FBTA 5EUHA 3MEEA 3DXBA 4TY9A 3ZSQA 2MDAA 3P5JA 5A8WA 3DI6B 2IYIA 2R42A 3FCWA 1JLAB 2QT7A 2B9EA 3LP0B 2CFXA 2ASPA 3H1VX 4ZVQB 3G6VA 1GEHA 2IRYA 1KNZA 4O0JA 3GYGA 2W2NP 2FB0A 4ALZA 4QWDA 5BYQA 1O8BA 4FZZA 1IUJA 2DR7A 4JI5K 2GVZB 4CZHA 3SQ1A 4K41A 5SWMA 1WUAA 3C6UA 4PG4A 3GIJA 4DR3K 1NAQA 5BPNA 1HWIA 1QVFM 4DV6J 3GILA 3L0QA 4DR7K 3KOAA 1FXXA 3VAKA 5AQVA 3M5RA 5HBMA 3NDKA 1FRHA 4Y6IA 5BYSA 2RDDA 1VSJA 1R8BA 3CCUN 3S3OA 4BQZA 3R3LA 1RWMB 3CQXA 3GG4A 3WHIA 4AILC 4A8MP 3H20A 4URSA 4PL8A 1FRKA 1B0TA 4CK2A 4NEZA 5AFUA 3ENAA 4L74A 3WQUA 3IFRA 2HZCA 4KREA 4OGEA 4JHDA 2KDOA 3DRPB 4DTOA 2Z57B 2A40A 2UUAJ 3ENVA 3JAMU 3SV4A 2DR9A 1APSA 3HHLA 4WFAL 5CYQA 1JJ4A 1VBZA 2L9DA 2XCPA 3LZIA 2VFVA 1EQ0A 4CO5A 4KPCA 2OEKA 4ZVEA 4B3OB 2C2ZB 5KGWA 4USWA 3GV8B 5K5MA 4I69A 2XC9A 3M8PB 4LFBF 3AO4A 4OPAA 1BE4A 2Z1HA 4CFCA 5AQIA 2CPYA 5HATA 2GIQA 4BRKA 3VA0A 1N6QA 2FJVA 5A8RB 1U1KA 3QEIA 3DOKB 2JFKA 3O08A 1KN6A 2B0GA 5AQFA 2OPSB 2Q79A 1YRXA 1YI2S 5LSOA 2YHYA 4GVBB 1RP5A 3TAGA 3WNEA 4BC2A 1MN9A 1N48A 3G96A 2H9ZA 1LWCB 5FDLB 2BGGA 2GQQA 1FJGF 3MAAB 4BGAA 3CVKA 4B1WB 3LP2B 4CF9A 3UCUP 1U6ZA 2XEXA 1B9DA 2YPYA 2O8BB 5FDLA 3DCAA 1U1QA 2W4CA 1UVKA 1SH2A 4C23A 2LQBA 2P6SA 3KK1A 2B6AA 2FJXA 1BUPA 2MLYA 4RWXA 1YZ6A 3BM7A 3BO4A 1M5OC 3CD7A 1HHTP 1YITN 3VVTA 1FJ7A 1TKZB 3EEQA 4K50A 2WTFA 4O4GB 4NRUA 1A7GE 1X0PA 4C1NI 3CC4S 5EGYA 4FPAA 4DL5A 3W2VB 2GELA 2DNRA 1RHMB 5HVGA 2HAIA 4BE0A 4CFBA 3M8WA 1WOQA 2AGOA 3AVJA 2Y1IA 3UFCX 5FPDA 2HLTA 2RHQB 1SQFA 4Z0UA 3TO8A 3R5CA 2HNDB 1Q9XA 4BVPA 3C16A 1XNRJ 3TR5A 4LQ9A 1VSIA 3UIQA 1BIZA 2DTUA 2KT5A 4EGLA 2GIFA 5C24B 1Q5YA 3CD6S 3OS1A 2E1MC 2R8GA 1HBMA 3H5SA 3MWTA 4XH1A 4ANCA 1HA1A 5DQHA 2ILZA 1ZBUA 4FM2A 1DTTB 2VV5A 2YNIB 2FBXA 3HVAA 3QPIA 2HWHA 2VQFJ 1SH3A 2RH3A 1WC4A 3THXB 3M3ZA 3VCDA 1SUQB 2CGLA 4ZLPA 3POTA 5AZJB 5J2QB 1QQCA 3VQTA 3MHYA 5K8NA 2YKMA 3NGDA 3ZZUA 4EYHB 1O6XA 3CDEA 4CT9A 3KLGA 3KLEA 1SJ1A 4K2XA 3OR1A 3DMJA 1WNEA 2DNNA 2JWKA 1A6LA 4USUA 5KFWA 2EPIA 3NNCA 2BUNA 4DR4K 2EK1A 3CUNA 2EKYA 5ETTA 2GWKA 4A2AA 5AQMA 3JXUA 3NGUA 3FLCO 1S99A 1RTDA 2HQDA 1VQMN 1OH6A 3T9ZA 4N77A 1VHIA 2DNGA 4PYDA 2UXBJ 4YUDA 2G8KA 1RHJB 3PIOQ 2ZE2B 3HD2A 3VEXA 2Z0GA 3FKBA 2A6OA 1NGIA 4M3XA 4IO8A 2JEJA 2HQCA 3DNCA 1VQKN 3I5CA 2MGZA 1TL3A 1R7IA 2CJKA 3N4PA 2PYJA 4HHHA 2ZDOA 3ONQA 2C2DA 3OXGA 5FLXY 4CGGA 3HFZB 3FCHA 4ZVGA 4RW8B 1OSDA 3FRZA 4HUGA 1KQGB 2HIQA 4O3SA 3GFYA 3EZWA 5GAGU 2W7AA 5AQSA 4CK1A 2R8KA 3O9SA 1JJCB 3VN5A 3O4NA 4BR2A 4HCBA 3FMBA 4B1XB 4FJ8A 3R6LB 4FSVA 1U45A 2F4VF 4NLOA 3G4SS 4ZPDA 2O8CB 4DR5J 4PXBA 2FVQA 3A8YA 1UEKA 2NXCA 1JLAA 2HHTA 5I3UA 1XR7A 5LM7E 5KFXA 4MYTA 1J6ZA 4NLGA 2Y8YA 2V9KA 2BJ1A 2D9PA 3QEVA 5CYQB 4FS2A 3FBBA 1TKXA 1FXDA 3FFIB 1N32F 4TVAB 3P8BB 5M1QA 2K06A 2CDRB 4NYPA 2HNZB 2ZH8A 5HROA 2B7BB 1IVZA 3NCPA 4QOTA 2R8IA 2LLZA 2FJWA 4MKVA 3K8VA 3PV8A 3NF9A 4K25A 2EKNA 3I0SA 1TFWA 3VQAA 3PVXA 4E0DA 1RT4A 3FZHA 1FD2A 2CQIA 2PEHA 2XLJA 3ZFVA 1YQHA 5IWAJ 3OS2A 2UYTA 2DHGA 1HR0F 2OH2A 5J2NB 3CMAS 4M7YA 3UN5A 2ZH4A 2UU9K 4GKJF 1S4FA 2DKOB 2NXJA 2W9CB 2MQPA 3QRRA 4L76A 4C97A 3CJAA 4B8CA 4HTUA 1N33K 2B4PA 3B78A 3W64A 1XJWB 1HNVB 4DU3A 3C7NA 3VF4A 2EFPA 1RDWX 4NXNJ 4R8UA 3GU0A 1L3KA 4ZN1A 3ETMA 3PYEA 2CQ2A 4CTAB 3JSBA 3BN4A 3MN7A 1VK0A 1DT9A 3IG1B 2Z2ZA 2G9OA 3JSRA 2DNYA 2RMLA 1XBWA 3MEEB 4A61A 3NGIA 2OO4A 4KHWA 3SXLA 2IMWP 2QRRA 1RGIA 4CLYA 3E01B 4CLPA 1RT3A 2Z8QA 2A6AA 3Q23A 3CJQA 3ULEA 3CXCM 4RG8A 2JEGA 5KRTA 2AJ2A 3KTQA 2DXEA 2C2NA 5F9NA 3EWGA 2VCPA 3K7RA 2W2PP 2ZM6F 2W4PA 2R9LA 4CD1A 3P3DA 5ADXH 1UMJA 1QQOA 1KVKA 5KGXA 1S76D 4BDZA 1BWVA 4K4ZA 1HKGA 2EWHA 2FLNA 1EP4B 1ZAVA 3EL2A 3CJ0A 4QIWD 1RWXB 3SQ2A 3UVJB 3Q24A 3CM5A 4YDDB 2YXLA 3M1FA 4JNEA 5D77A 3EVMA 4DSFA 4DFPA 1RAIB 3OUYA 5C24A 1K73O 3CO0P 1JLGB 3TARA 4R5PA 2YWGA 2R4FA 2O67A 2DPJA 1U2VA 1U8WA 1U0HB 3J81j 1GMWA 4U8VA 2I6WA 4K59A 4WCEL 4JI8J 4OLAA 3BGOP 4YB7A 1IN0A 4H0YB 3CD6N 1WLJA 2YVSA 3ZTOA 1B4SA 1OVYA 2OZSA 2HURA 3ZSVA 4CJEA 4B1YB 2QG9B 2FY8A 2YKMB 1ZZNA 2OPSA 1LW0A 2VQEF 1YTUA 3AVMA 3OBIA 3GR1A 1YTAA 2P51A 2V2QA 1FWLA 4F4AA 1HPMA 1OSCA 2YJEA 4U7UK 4U7BA 1FJCA 5BRDA 4JV0A 4QOZB 4IZ9A 4Y65A 5KG6A 1NK7A 5H9FK 2EG1A 4HHUA 2P8IA 1EIYB 2ILYA 2HGLA 1U02A 4USJC 3KWMA 4U6PA 5AQWA 2MZ1A 2B43A 5IQQA 4Y2MA 2OTJN 4ECTA 1R0AB 1JXEA 3O5TB 1R8PA 2QFIA 3OLAA 4ZPAA 3F41A 5DG9A 2UUBF 1I1GA 5AQPA 3FRYA 4RBTA 2MKIA 1TKTA 1SL1A 4LF7J 1WI6A 3CJ4A 1TV6B 3EM1A 3EUNA 3LDLA 3ZSOA 4C6AA 4KE5A 3BQ2A 4ZS6A 1H1VA 1S6OA 2F4FA 5CABA 2VDHA 5J2QA 4ZDNA 4Q0BB 2AJFE 2V8HA 4RKUC 4BRIA 4RW9B 4WFXA 5A0YB 3F56A 3HVTA 2B6AB 2JLGA 2CH6A 1NRKA 4MDAA 4IUFA 3GG0A 1NBEB 2CUYA 4X4TA 3NOGA 1XTZA 3WZ0A 4DQRA 3WDOA 3NS7B 4DU7A 4M5IA 4J9VA 1WKJA 2GQ2A 2KVQE 1S0OA 1UFWA 3U1NA 4M94A 3AA4A 1LK5A 4CEOA 2M5YA 4ECWA 1PAEX 4BC7A 2R7TA 4B3MK 2GO8A 3E3XA 1T03A 4X62K 2YBVA 1XMOK 3IRXA 2RD5C 5FPEA 2CGJA 3HHDA 2YWFA 3FBCA 5TKWA 1WJ9A 2B8PA 2YY3A 5AXNA 4MIWA 1QVGM 3CC7N 3C14B 4FKXA 3R1LA 2EFOA 3CEDA 1FFSB 4ZA1A 1E4GT 4IFEA 4YR3A 1JLQA 1H3DA 3VERA 4RX6A 1Q82O 3MPUB 4CJLA 1BU6O 2PY5A 1ACMB 4WFBQ 4GV9A 2F9WA 5F8MA 5ADZA 1EX4A 3J80Y 1WSGA 4Y2AA 1FEHA 3B82A 3KLVA 3PACA 1MW7A 3C15A 2KG0A 1K8KA 4DUTA 2VWKA 3TUZC 4F4WA 3BBBA 2RILA 3T1HJ 4BC9A 4IEIA 5EWEA 3I0RA 5BRFA 4CLUA 2ZOGA 3CCZA 3IMQJ 2VICA 1OKJA 1FCAA 3O1WA 3KFWX 1WNSA 2NUHA 4FK2A 2RN2A 3PFOA 4JYAK 4EO8A 1U09A 3T1AA 3DJCA 1NGGA 3L2WA 2V8DA 2BVZA 4ZITA 5C2DA 2DFFA 2XHCA 3PSIA 1Y64A 4IH7A 2D3UA 4O3QA 2VJVA 1VSFA 3Q0AA 2ASMA 2CG8A 3FBEA 4Y28C 3IG1A 4W92B 2HF3A 4FM0A 4DQ8A 3HSZA 3TUJC 1U26A 3QGGA 3LP0A 1VSHA 1CJKB 1YJ9N 3R3TA 5HQMA 1TV6A 4PYAA 4QQBA 2QMUB 3R9LA 2W25A 4LF7F 1WEXA 4KKOB 4FL9A 5KFTA 2A2DA 1JIHA 4M5KA 1VAZA 3MMJA 2HFOA 2I2YA 4JK7A 3D28A 1IM4A 3AVFA 3LL3A 2FVSA 4ECRA 3LP1A 2JHEA 3HRGA 4GRSA 4GKJK 3LTOA 4TQSA 4I9LA 1Q53A 5H9EK 4Z4GA 3OYKA 2O8FA 5E3RA 2QWRA 2HFVA 3TU5A 5C12A 4ZMMA 2N7YA 3HM9A 2VODA 2BXJA 1KR4A 1S1TA 5JS2A 2FD2A 1RT1A 1K9MO 2AZ1A 3CG7A 4K4TA 3FFIA 1BHLA 5CZ2A 3RMAA 5B0AA 3GZ7A 1D8ZA 4O3OA 3WXMB 3LUYA 4Q8EA 3E9OA 1P27B 2NZTA 5ELZA 1BHNA 2LU2A 4FWKA 4X2BA 4L3KA 4JI8F 4UY85 1OYEA 2GUIA 1JJ2M 4J7CA 5EOYA 2BJ3A 4GC6A 1IWAA 4WWSA 4NMXA 5AQKA 1UAXA 1GLEG 4C3MA 3VQCA 4TN2A 2CRLA 2ZH3A 4RU9A 4TY8A 4WIIA 1FKOB 5KFGA 1HJOA 4CE9A 2L3MA 1EHWA 2HHQA 1FHTA 1U1OA 4CLFA 4PQUA 2WFBA 3T1YJ 4IFVA 2DXFA 3WQPA 2XZDB 3O4WA 1QE1A 4A8QA 2B5JA 2VFRA 3AHPA 2AX1A 4NLYA 3ZT3A 3PR4A 3ZT1A 1WDTA 5LL6Z 4LF6K 3OTOJ 1NBWA 2RHSB 3POTB 4PQUB 1A5WA 1Z05A 4KPYA 3OS0A 4KQZA 5AQOA 2WK4A 2HHUA 2DCUB 3BS9A 2LA4A 1QZ6A 3HOSA 4NCAA 2LKZA 3MX2A 1F9FA 4QU7A 4BRCA 5M1KA 4UW2A 4JS5A 2AYMA 3G25A 4FJGA 3LDPA 2DNZA 3MXHP 2E2PA 2OD4A 4OHYA 2WBRA 1HI0P 1TL1A 2ZH6A 3VAJA 1EP4A 1YVUA 4DV1F 4HACA 1PJ5A 2HRUA 1JJHA 2LEPA 2VC1A 2GBZA 2DY9A 5E33A 2VQEJ 3G8TA 1SS6A 3T1HF 3AY0A 3VQ4A 3MMAA 4O3PA 2P6TA 3P1GA 4ISGA 5DM7L 3PZPA 1CJVA 1SJ4P 3JTNA 2QN6B 1LFPA 3EYZA 3IC1A 2M7SA 1N36J 3BEXA 2KRRA 1RWPB 4N47A 3U1LA 2V8GA 2NR0A 2COLA 2LFVA 2V69A 3PW5A 4O3NA 2VG7B 4WKYA 2CNKB 1Y0HA 2KKHA 5I9EB 4IFYB 5A2QO 1HPZB 2NNWA 4DPYA 3OPKA 4ZIWA 5HANA 4RW9A 5A0YA 4FZXC 2J5AA 3KHRA 4QR1A 3K5NA 3F5TA 2XHBA 1I3AA 4FJXA 2IHR1 2ZWOA 4C9DA 4WKRA 2GAHC 3UR3C 3RMCA 3UWTA 2HNYB 4ED4A 1FNMA 1X3NA 1FERA 1ZTTA 2U1AA 4JI0K 5J2PB 1N34J 2QGFB 1IBKK 2HVHA 3IBCB 1R8AA 1U47A 1RT5B 1TFYA 4NX9A 4C1NK 2ZBQA 2YWKA 1RK8A 5AXKA 2C2EA 1ZOTA 1JXLA 3W3SA 9RUBA 4KHSA 2FBTA 4LH5A 1XMQK 3QFWA 3VQSA 4LF6J 3JSMB 2IGIA 3C19A 2JX2A 5H9FJ 1LEOA 4YR0A 1V6HA 4FYYB 4EHUA 4K4WA 2LQ5A 4TYBA 1Q86T 4DJBA 3ZZPA 4YS2A 2MZRA 1XQSC 1Q9YA 4AM6A 3T5JA 1F5CA 2QK9A 3ZZZA 2XGPA 5I42B 3HD1A 4FJLA 3MTJA 3VAFA 2HSEB 4LSLA 1MWKA 2VGNA 1RDUA 2ROEA 1MNEA 2UVVA 4LQ3A 2ZC3A 3EGVA 1ZYQA 2Y0SD 2DRDA 2RS2A 1W0HA 1Q7YO 4DSLA 4JI4K 1NK9A 3OYAA 2E8AA 3PXGa 5KQ8A 2FC8A 5CAAA 3BSAA 1WHYA 4YQWA 1XEZA 3KG1A 3NXZA 1QQNA 3HFVA 3PHTA 5HP1A 1G3OA 1R6YA 1UVLA 1RDRA 3ZT0A 3HZ6A 3KIOA 5F2RA 5FRNA 3LAKA 4WIQA 4DX6A 2NRHA 3SIPB 4DV7J 3UNGC 4NLPA 3UDLA 1RWVB 3IRXB 5IS2A 3QNOA 2BACA 4OLBA 2CQ1A 1UCNA 4B02A 3QBCA 1TL7A 3PW2A 2XYGB 4CZJA 1J5OB 3UD4P 4U96A 4IG0A 4MAKA 3DFEA 2HGMA 1BMQB 3N01A 2P2CB 3CJ1A 4YY3J 3VZHA 4OHWA 3HHLC 4X84A 2J7UA 3IR7B 3K5OA 4CGDA 2FHKA 1ZBIA 1M5HA 5DM7Q 3AO5A 3KNGA 3OTCA 3CCSS 1HD1A 4I2QB 4FPIA 4CK3A 4FVMA 3VAHA 5DG8A 1SJRA 4ELUA 1EWRA 2NCKL 3QO9A 3SUNA 1O51A 1IKVA 4YHHK 2C3UA 3GFHA 4GV3A 1X4BA 4CBWA 1NK0A 5M2RA 2JFDA 4OI6A 2MQMA 1VQ7S 3DN9A 1Q1KA 3M8PA 3QIDA 4DLGA 5E3CA 4USVA 1CJTB 3AA5X 4HDGA 4CI0B 3JSMA 1VSEA 4DCJB 5BPMA 2GJ2A 3L4IA 2YNGB 1XR6A 2HBLA 2C2KB 5IM0B 1NB2A 2QWLA 3O9QA 5D3GA 2GAGC 1LK7A 3D0GE 4ECQA 2V50A 5KFUA 2E7WA 2DRBA 2HAFA 4NB4A 1N33F 1WWHA 2V2ZA 4F4ZA 2GA7A 3F2KA 4LSLB 2HBQB 1H7XA 4CF0A 1KEKA 4UTGA 2XB2D 3CJ7A 3GE1A 3LH2S 2IA0A 4J9RA 1T9YA 3LALA 1HW8A 3TX8A 2ZEJA 3HVTB 4CLKA 2QXFA 1N5SA 2YI1A 4LF9K 4CJTA 1FWKA 1KQKA 2R3VA 1KOOA 1REVB 3OVSA 1EAYC 3HHNB 2WCXA 2ZNYA 2W6KA 4CJVA 4BRPA 3BGRB 1NHVA 3UO0A 5B0GA 5CCMA 3EDRB 2QV6A 3FGUA 3W5ZA 3MMCA 4DV1K 1LWXA 3O3HA 1R43A 3MAHA 1R8CA 3W62A 4B3TK 4HHJA 1JXBA 3Q7BA 2CJBA 3FMWA 3CFRA 5J2MB 4DU1A 3RZAA 1UZHA 2LDIA 3EZOA 4NO7A 3H5UA 2YNFA 4NLDA 4XTTA 3L2QA 1HQUA 1LKZA 3TNVA 4UQGA 4A8FA 1TGOA 4J2DA 5KFPA 3NMRA 3M2VB 4CQ1A 1KSPA 5DETA 4HL9A 2RIJA 3G10A 2XRIA 3TZYA 2YNFB 5HL7Q 4HEA9 5BREA 2E7VA 1YJTA 4I9QA 3BQ0A 4CVNE 5KG0A 5JXSA 1JWWA 3NVMA 4CEZA 3V6DA 3T1HK 2OLWA 3K8WA 4Y2IA 3IGNA 1ATSA 4A4JA 3TEGA 3HPOA 3W9JA 1U49A 3VF0B 3AO3A 1SC4B 3ENOA 4OYIA 4YB1P 4WF9L 4JRQA 5DGAA 3D67A 2QKBA 2PMWA 3ZEUB 3N5BA 5G0RA 4LIRA 2O1PA 4YP3A 2L9WA 1J27A 2GNKA 5HSPA 3VESA 2CPFA 1VYAA 2M8HA 3M30B 2IDOA 1T3OA 2G2YA 5AE1A 1BL3A 5KFBA 3M8QA 1NJYA 1XI1A 3KK3A 3SQ4A 3QICA 2HHHF 2HFSA 1HKAA 1EKRA 4PAAA 2GV9A 1NKCA 4DMNA 1TELA 4UY8O 1WN7A 3SSRA 3N28A 2ZVSA 2FC0A 5IM0A 1RBTA 3PX6A 3TQ1A 1V9OA 1S6PB 3M7VA 1IO2A 3GSIA 3A5OC 1HBUA 4ED2A 1RGVA 4ZTFA 2AEFA 5SUHA 4H0OA 2E2OA 4DR3J 2RU3A 3ID8A 3KHYA 3US5A 2W8KA 3L2UA 2XLIA 2P9PB 3RUBL 1HW9A 4CZEA 1AW0A 1VRQC 1NJIT 5GAEI 2P9KB 1Q82T 4P7VA 1N88A 3D5MA 5F9LA 3GIKA 3QETA 3Q8YA 1XMQF 2FSNA 1JLEB 4CH1A 3KYLA 5KFYA 3LGNA 1RT2A 5CH7B 1NGDA 4P2MA 3CCRN 5A8WB 1AROP 3MR7A 1JCEA 3J80U 3ISND 1K6YA 4C3KA 4YOVA 2BZ2A 3D0PA 4CYUB 1NKEA 3HL8A 5F0XA 3SUPA 1NM1A 4QPTA 1E3MA 1HI8A 1YJWS 4URGA 3I55N 3CF5L 3L9ZA 3OTOK 4HTIA 2O8EA 5LMUK 4M3RA 2KYXA 3HM8A 2UVRA 2DHXA 3BBCA 4DCOB 4DL6A 3A0IX 2V4JB 2GHPA 1Q8KA 5JVGQ 2CPEA 3HKZD 3C6HA 2PI5A 1UVJA 4DL2A 3BO2A 1HWUA 2HVEA 2F8HA 3FSYA 2ZBCA 2E9ZA 2QFJA 4P72A 4B3SK 2A2CA 5BXIA 1VK3A 2DO4A 2HFUA 3J7Z5 2E29A 4K4SA 4DV3J 3C46A 4ZJQA 2CPXA 1TKDA 1N34K 1RNHA 7AT1B 4LSZB 3QT5A 1YGYA 1AUDA 1RDDA 4JS4A 2BM1A 3NOCA 3R7BB 5HJXA 3SSQA 3J7AN 4EAHD 1PSDA 1QHTA 4CJ4A 3ULHA 2A10A 3CJBA 4DV5F 1QY7A 4A8XA 1HNXK 5CZXA 1YWXA 2B7CB 2XI2A 3MXMA 3PYGA 2XHWA 3NNAA 3F9KA 4ZPBA 3RVCA 3A5MC 5KAKA 2C3PA 3CJ8A 3P4UB 1HLUA 3G4SN 4DTPA 2CNNB 3TVZA 2R7XA 4PA1A 3EZUA 2HFNA 3OL6A 2X6SA 2QYGA 1OS5A 3MEKA 4ZPCA 2EC0A 1S1VA 4JRPA 1ZA2B 2CZVC 4BE2A 4ILMA 3GQCA 2QW9A 2VU5A 2HF4A 2XZWA 2YX4A 5HRRA 4O5BA 3ZNJ1 2CQPA 4DR5F 1V4SA 3HHKA 4EHTA 3B6BA 3P5TL 5KFVA 4AHUA 4BCAA 2ZKUA 1KVAA 2G4BA 2JLFA 2QWNA 5HI7A 1VQLS 2CG4A 3MGJA 3BZQA 2VBZA 1WKLA 3VAGA 2DPIA 2X1BA 4F4YA 3RTVA 1TK8A 1QSSA 3CCEN 1GLCG 4JV2A 2BMBA 3AVLA 4LF6F 1NG9A 3V1QA 4AD6A 1O5JA 5M2UA 4RUAA 4KSEB 2HBZB 3KDNA 1HNWF 3W61A 3OYJA 3E51A 4F3MA 4IWVA 4FBUA 3ZC4A 1P8ZA 3OW2R 1VLOA 4KC5A 2HB5A 3I55S 1H2TZ 3BUZB 4HLBA 1KLMA 4LJMA 3CCMN 4J9MA 2QIFA 4R25A 1U2RA 4C8MA 1TUUA 1ICEB 4KO0A 2UXDF 4FNHA 3MEDB 3LDQA 5IXUA 4CBUA 1OYDA 3CJ3A 1VBXA 4EBEA 1J5OA 4URQU 4LFAK 4WE1B 4IEEA 3IRWP 1UEVA 1FESA 2QI2A 3VQ5A 1DARA 1FTCA 1UJ5A 4FWSA 2NUUG 2CZ4A 2EWSA 4I0WA 4DR1J 2LEBA 1NGBA 4LF9F 2Z2LA 4TLQA 3MM8B 4ERDA 5C0YA 4E1JA 1WSHA 4ZVFA 3H98A 5FRMA 2K7JA 1U1PA 4ANDA 1Y5NB 4CIGA 1OIAA 3IUCA 3C8YA 3TA2A 3KG0A 4J9LA 3QJLA 3P96A 1Z4UA 2QL5B 3PTWA 1WSJA 3BQ1A 4X65F 4DV2K 4B9TA 5AQGA 2QTDA 4GO7X 1Q18A 3NS5A 3CD0A 3GPAA 1N6QB 5DO2A 5A8RA 3DOKA 4EP4A 4TU9A 2GIRA 2X1GA 3VF2A 3SJJA 3H3OB 5K14A 3QDKA 1IKXB 3THTA 3E1YA 2FLLA 1BQNB 1CZ9A 4FPBA 2E5LK 2A3JA 1KQSM 5C42A 3PNIA 3HI0A 1WSRA 3O6WA 3L4BC 4UZCA 4OYOA 3Q8VA 1NOZA 1RLCL 2CPHA 3KUHA 2XWYA 4R8UB 1LWCA 5GAGI 1TZ0A 4HACB 2RQMA 2BANB 3QNWB 3TTDA 3NWGA 1F9HA 5JMNA 4X4VA 3NGTA 4CH7A 4IFVB 1OH8A 3V6JA 4FM1A 2OANA 3CIZA 1CJUA 3RBEA 1VOMA 3K2PA 2LMIA 4AQYK 4A8YA 1DHMA 2E1AA 1L3TA 2H4YB 4J9PA 4JKFA 5AQNA 2RAQA 1SC3B 4NXNF 4Q43A 3R5AA 1GK8A 4QIFA 3DRSA 2A1RA 1H74A 3UCZP 1Z25A 1HWKA 4JI6J 2J0SD 7FDRA 1S9GA 2BM0A 4CFAA 1VQLN 2KJWA 4LFCF 3VQPA 2O8EB 4E7IA 3CIPA 4KHQA 4MTPA 1B0VA 3CCES 2HOEA 1XIQA 4X65J 4J9UE 3L6QA 1NSKL 4ECSA 4CJ3A 1QSYA 4X4UA 1SI9A 3GJQB 1KWMA 3H2VE 2BKNA 3G8SA 3MURP 5I3QA 3C16B 2V63A 4DF8A 1YG0A 3QT7A 1HNXJ 4PKDB 4WBFA 4BDPA 1V5IB 3TA0A 5DQGA 2IOCA 1GXTA 1Z2LA 3VGVA 4OI3A 1YVNA 3HULA 4YNQA 1X4CA 1RT6A 4Q2LA 3LW5C 2G1HA 1XNQK 4B1ZA 3UVJA 1HBOB 4NA3A 3EGWB 2HG4A 1WSIA 1CC8A 2NLWA 4JI7K 5CE3A 3SDEB