5I42A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer, azttp, and ca(2+) ion
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
total genus 141
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i42A05
1QSYA 4ZPBA 4FXDA 1RTHB 1K1SA 3QZ7A 2LSNA 3CQ8A 2JLEA 4FJ5A 4ED8A 2CKWA 1HMVA 2IC3A 3SQ2A 4M3ZA 3GILA 4M45A 3GV7B 4PUOA 3PW4A 4MK9A 2X74A 3V9UA 3IS9B 3OYNA 4FJMA 4BE1A 1QSSA 4ELTA 3TABA 4Q5VA 4LQ9A 3VQAA 4B9NA 4FJIA 1WAFA 2XY5A 4I7FA 5KFWA 4CGIA 4MKAA 4CJKA 3LANA 1LW0B 4RW6B 2G8WA 3LP0A 2FJVA 1WLJA 5KFZA 5DQGA 3MAQA 3PX4A 1S4FA 4Z4FA 3QEXA 4ZP6A 4KTWA 1RTDB 3PR5B 2BQRA 1N5YB 2D7SA 1VSLA 2AQ4A 2VG6B 4IH6A 4OKEA 3DRSA 3RMAA 1RILA 3SI8A 2IBKA 3HKWA 3KHRA 4ZHRA 4MH8A 1U4BA 1EXQA 5KFMA 4K4ZA 1S97A 4F3OA 4RW7B 5J2PB 4I2QA 4CGDA 5KG4A 4KHSA 3KLIA 4DSEA 3L8BA 3RAQA 4KI6A 1RT6A 3WNEA 1IKWB 1BCMA 4RW9B 2OPRA 2YNFB 3ASMA 1RT4B 4DTXA 4EP4A 4DWIA 4CJRA 1DLOB 4B3OB 4PWDB 2WONB 2HWIA 2CJQA 5CYMA 3LZJA 3N6LA 1S6QA 4FM1A 4CK3A 4F4YA 4QWAA 4ZVGA 1JLBA 5J2MA 1VSIA 3CFRA 4Z4IA 1RT7B 3OYEA 1N6QB 1X9MA 5F8MA 1TKDA 3O3HA 1TAQA 1EKEA 1LAVA 4DS4A 4CF1A 3ZSXA 4JLHA 2XGQA 4WYWA 4Q44A 1S1UA 1NHUA 3H5XA 4LD0A 2UUWA 5F9NA 4FJXA 1N48A 5KG5A 4ELUA 4H4MB 1D0EA 3FQLA 2JEGA 4CJEA 2P1JA 3EY1A 1QS4A 3NFAA 2Z1HA 3H40A 2ATQA 2PYJA 3MTKA 4WXOA 3HVWA 4EO8A 2BR0A 3AVNA 2ZE2A 4ECUA 1CZBA 1R0AA 1RDBA 2YNGA 1HNIB 1S9EB 2YKMA 1LWCA 3QIDA 1RT2B 2BDPA 3MFIA 5KFPA 1Y97A 3TQ1A 4NRUA 2ZKUA 4DG1B 4FJJA 2F8EX 4DSLA 4NYZA 4O3NA 4ED3A 5KGXA 4ICLA 4GC6A 1NK4A 3PR4A 2W8LA 3QETA 3QESA 1RT5B 3QNOA 4FCYA 1KCFA 2BANA 3T19A 4E1MA 2D3UA 3RBEA 4WE1B 3AA4A 4CF8A 2HNZA 4E1NA 2D0AA 3DLEB 2VWKA 5KFUA 3RMCA 3SV3A 3SYZA 3FFIA 3PUFA 3PO4A 1DTQA 4RZRA 3DOKA 4IG3A 2KZMA 1C0UA 3L3UA 3RR7A 3H98A 4F4WA 3JSMA 3IN5A 3QO9B 1T05A 5L1KA 1W0HA 4URGA 3SFUA 5L9XA 4CHZA 4GMJB 3KLFA 3SPYA 1KLNA 4TY9A 5HLFB 3V6HA 2OH2A 1S5JA 4E89A 2B6AA 2R2TA 3OYMA 4C8LA 4Q43A 4E0DA 1QQCA 3SCXA 3K5OA 3NMAA 4J2DA 3O3FA 5C25B 3LAKA 5KT2A 3OHBA 4C8NA 4MK8A 1RTJB 2XHBA 1SL1A 3G10A 1QAJA 2C28A 2BQ3A 4IQXA 3O4NA 1A5VA 4JRPA 5J2QB 3PHEA 2UVRA 4HVJA 3KK2A 5KFYA 4HHTA 2R7YA 2XY7A 3SQ0A 3HK2A 5KG6A 4Z4HA 3AVLA 4KHUA 1ASUA 3G0ZA 4KHRA 4DU1A 1TKZB 4FBTA 4DFKA 5DQHA 1JLFB 4J9KA 3GV8B 1UOCA 3LWLA 3FSIA 1TK5A 4YMEA 4F4ZA 4IKFA 3M8PB 3CJ0A 2UVWA 1OS5A 4IRKA 1S6PB 3O3GA 4CJWA 4NLTA 1LWFA 4DLGA 2IDOA 4CHOA 1SKRA 3V9WA 1HARA 2RF2A 5HBMA 4H4OB 4Y34A 4J9OA 2IA6A 5DMRA 3KHHA 4RW6A 4OL8A 5I3UB 3N6MA 3KIOA 5KG0A 3NBPA 4OVLA 3NF9A 5HROA 5KFVA 1NKEA 3UIQA 2AGPA 5KFXA 2Y1JA 1Q9YA 4Q0BB 4WZMA 2HNDB 5DGBA 4NLYA 4OKJA 3WNFA 3K57A 2HMIA 4CESA 1IG9A 2QV6A 1XWLA 1BHLA 1KLMA 2O4IA 4IBNA 4B9MA 3PV8A 4O44B 2ZD1A 4MK7A 3VQSA 3EZ5A 4KV8B 2DFHA 5HRPA 4K4TA 3A2FA 1RT1B 4ZPCA 4DTRA 3EZUA 4URQU 1BIZA 2A1RA 4EBEA 1LWEB 5EU7A 2HHXA 3M8RA 3OSPA 4JV2A 3KJVA 4KKOA 4QOZB 4DL5A 1BGXT 2FBYA 1TV6A 4RW9A 2NUBA 3OYIA 3CDWA 4FW2A 2E4LA 3DRRB 3DYAA 3V9ZA 2Z1JA 2OPSA 5DK5A 4J9QA 3VQCA 3KK3B 4PQUB 4TLRA 4CFDA 3BQ1A 2HVIA 3G6XA 4CE9A 1YTUA 1BIUA 4KB1A 2IM0A 3M9OB 3RWUA 3SNNA 4TN2A 3GIJA 4NLRA 2FBTA 1TQLA 4N41A 4M94A 4JS4A 3LP2A 4IR9A 3VQPA 3QYYA 3HVRA 1NK8A 1J53A 4E7IA 2WB4A 1JKHA 2QKBA 1RCHA 1QE1A 1ITGA 4XPCA 4BDYA 3NKYA 4CHPA 4DSJA 3L2UA 1NNDA 4N5SA 4TYBA 4QW8A 3TAMB 3L2VA 1JXBA 4WYLA 5F8LA 5I42A 4FBUA 3IAYA 3BSNA 5HRSA 2J6SA 4XIUA 3KLHB 3HSTB 4DS5A 2VA2A 1RAJA 4GC7A 3CM5A 1HNIA 1S9EA 1TVRB 2EC0A 4KSEB 4BWMA 2I5JA 4H8KA 5DLGA 4LSNB 5T7BA 4ELVA 1EETB 1XHXA 4FK4A 4ECVA 4CJQA 5K14A 1GOBA 3VN5A 2PZSA 2W9CB 4U7CA 3HPHA 3QNNA 3PW2A 3ITHA 4FJ7A 2OYQA 4CEAA 2IM3A 3DLEA 4B8CA 4RNHA 1JLAA 4M3RA 4DF8A 3EYZA 4DTSA 3KD5E 4QPXA 5L1JA 4CJSA 4RW8A 3NGDA 2BGGA 3KHGA 3ZT3A 2F8SA 2FBVA 4HCBA 2ALZA 1IKXB 4M3WA 4CHQA 3OSNA 4C8OA 2AGQA 1HYVA 2V4QA 4G1QB 4BDZA 4KREA 3SQ4A 3SI6A 4CJTA 2XI2A 3OHAA 4CFAA 3SZ2A 1JL1A 3THVA 2W9BB 4DSIA 2VG5A 4R5PB 2ILZA 3H5SA 4B08A 4UQGA 4B9SA 3H5UA 3AVHA 5C42B 1IKVA 5HP1B 2ETJA 3TVKA 3M9MB 1C2PA 1CXQA 1JLEB 2X78A 3GYNA 5C25A 4ZMMA 4NCGA 1T94A 1BI4A 1RTJA 2OPPB 1WSJA 4JRQA 2JEFA 2UVVA 1VRTA 4CJ5A 2XC9A 4J9SA 3ZT1A 4I2PB 3V6JA 1KRPA 1C1BB 3VQ8A 3DOLB 1TKZA 3QGHA 3PJWA 4CHYA 3QERA 3T5HA 4FLVA 3VQ4A 3V6KA 4RNFA 4KI4A 4AHTA 2UUTA 5FRMA 4CJVA 2RKIB 3U3GA 2XWYA 3OVNA 2E9TA 4N56A 3DMJB 1EP4A 1S6PA 3UDLA 4AHCA 2IOCA 4ED0A 1J5OA 2F8TA 4KHNA 1D9DA 2KQ2A 2B43A 3CYMA 5J1EB 2AWZA 2E9ZA 3E01A 4DL6A 3UR0A 4FJHA 3V6DB 3QLHB 4B9UA 3OYKA 4CECA 3L2WA 4WZQA 2YHBA 3GIKA 1TKXB 1RBVA 4M3XA 4Q0BA 5J2NA 5KFAA 3MR3A 4CGFA 1SV5B 3G6VA 2PYLA 1NHVA 4E7JA 4DL3A 4IH5A 3AVGA 1S1WB 2R2SA 3OYGA 3DM2B 4O44A 4DFMA 3M8QA 1JLGA 3AO1A 3I0SB 2I1RA 1RT1A 1D1UA 5F8NA 1SH0A 4DTMA 4DQPA 5DG8A 2B5JB 1SUQB 1HNVA 1JIHA 2YKNB 1S49A 4DFJA 4PY5A 3B6OA 2P5OA 3SQ1A 2C22A 5KT5A 3TANA 1L3VA 3RRGA 1IKYA 4MFBB 4JUZA 3L2QA 3C6UA 1N56A 1HQUB 4R8UB 3KLEB 3H08A 5FDLA 3FQKA 1VRUB 1VSKA 4EO6A 2BE2A 4YR3A 4HUFA 1WSGA 3QIOA 3VA0A 2C2DA 3ICLA 4ZVHA 4RW4A 4DL7A 3LP1A 3S3OA 5SZTA 2IAJA 2IM1A 2UVUA 1X1PA 3T5KA 4ECRA 3K5MA 5HRRA 1RTIA 3UQSA 4KFBB 3OYDA 1C6VA 3CDUA 2VG7B 5HRNA 3MEEB 4BE0A 4KB0A 1WAJA 4KHMA 3MF5A 4FZZA 1FKPB 3JYTA 2JC1A 4MQ3A 2D41A 4C8MA 2A1SA 3C6TA 4CFCA 3HVTB 3IGNA 4J9NA 1Z4UA 1MU2A 2FLNA 3PO5A 3MXIA 1SH2A 3M9NB 2W42A 4C8KA 3FDSA 1BQNA 3T1AA 1IM4A 3KLHA 1VSEA 3TAFA 1S1XA 4CJLA 4YNQA 3BGRA 2X6NA 1HYSA 5KGWA 4DQQA 4CGJA 4B8AB 1JLCB 1LW2B 2XRIA 3DI6B 4LSNA 1S1VB 3BDPA 1EETA 2AGOA 1SKWA 4HYKA 3NHGA 1C1CA 3S3NA 3QIPA 3RR8A 3NGYA 1XC9A 1RYSA 4H54A 4PA1A 2W7PA 4JS5A 4KRFA 3MECB 1FKOA 2XCAA 4Y2CA 4FLXA 4LH5A 1TL1B 1IH7A 1NOYA 4CIFA 2OPQA 3RMBA 1XR7A 4CHNA 1RA6A 3VQ5A 3DRPA 4KTQA 1W9HA 1JLQA 3MR5A 4ED7A 4FJKA 1REVB 1MMLA 3CJ4A 4J9LA 4CJPA 5KFRA 1TL3A 4O4GA 3P5JA 2YNIB 5C24B 5KFDA 4NLSA 1C0TB 1ZTWA 5F8HA 3CJ2A 1RDDA 4F2RA 1KHWA 3F73A 1FXXA 4RG8A 1UWBA 2FLLA 3ISND 4G1QA 5D3GB 4ED2A 3IRXB 4QWDA 4YFUA 3NAEA 1JX4A 1HJRA 3OYLA 1TKTB 1S48A 1HPZA 3HPGA 4XO0A 2W9AA 3V4IB 1L3SA 4QWBA 3DLGB 2WOMB 3LDSA 2HNYB 5KG1A 4Z4CA 5C42A 1TGOA 2RDIA 4LSLB 2HB5A 5SWMA 4NLPA 2DFFA 4URSA 4ID1A 2XY6A 3LALA 3D0PA 4G3IA 4IFVB 4CJFA 3HO1A 4ECQA 1HQEA 5JS2A 4OJRA 5EWGA 4I2PA 3QZ8A 5CZ2A 3OYHA 4HTUA 2YV0X 3H4DA 4IG0A 5CYQB 4RNMA 1NK6A 4YQWA 3DOLA 1ZBIA 1RT3B 3OYFA 1NJZA 3KLVA 3S9HA 4QWCA 4KO0B 1N4LA 1DTTB 3QEWA 3HHKA 1U45A 1WSFA 3PX0A 4ECSA 1S0NA 3OL9A 2DPJA 1GX5A 3V9SA 3KNAA 1RTHA 4YP3A 3OS2A 2FVSA 4ZVEA 1TAUA 1FK9B 3BR9A 4Q45A 4Y3CA 4ED6A 1NK7A 4CEEA 3IS9A 3SUOA 4DU4A 4XPEA 4NYNA 1ZETA 3QGGA 4FVMA 3MEGB 3D5MA 5KFNA 2R8HA 3AVAA 3BQ2A 4ID5B 4KHYA 3MFHA 4FLZA 1C0MA 4CF9A 2E6MA 1LW0A 3CIZA 1TK0A 3NGZA 3RMDA 1T7PA 1UA0A 3P83D 2YNHB 1QAIA 3KLGB 4DFPA 2HHSA 2FJWA 2IJNA 1RTDA 3I5AA 2XY8A 2KFNA 3OJUA 1N5YA 2ATLA 2XI3A 3TAPA 2VG6A 4FJLA 1HMVB 2IC3B 3Q8SB 5DLFA 3TAEA 4FYDA 3NH1A 2HWHA 3OYJA 4RW7A 5J2PA 1A5XA 1Q8IA 4CEQA 5FROA 3KOAA 1XR6A 1G15A 4AILC 3ZSRA 2HHUA 4LQ3A 2Q3SA 1L3UA 1IKWA 5KG2A 3AVBA 3ZCMA 4E7HA 4FJ9A 3BSCA 1D5AA 2YNFA 4NCAA 4KFBA 3ZT4A 1RT4A 4YR2A 3HPOA 3LP0B 1DLOA 2VG7A 4B3OA 4DL2A 4PWDA 4O3PA 2WONA 2WK4A 1TP7A 3OY9A 4FLYA 3MR6A 2X6SA 4ZVFA 3G86A 3Q8PB 3RAXA 3CFOA 3TR8A 4TYAA 2WHOA 4FW1A 1CSJA 1JL2A 3KKSA 1RT7A 3BJYA 1VSMA 1N6QA 3M8SA 1VSFA 1S0OA 3DRSB 3BREA 2HHVA 4CJ3A 3RB3A 4IR1A 3I8DA 3TI0A 2QKKA 3V1RA 5KFSA 4I2QB 4O4RA 1ZBLA 3KLIB 1QSLA 4R0EA 5EDWA 3DI6A 4H4MA 1RT6B 1J54A 4CK1A 1WN7A 4O5BA 2OPRB 2AX1A 1NK5A 4WFXA 2R8JA 3OLBA 2WCXA 1K6YA 4TSXA 5CYMB 1RBRA 3K2PA 1ASVA 2KFZA 4X2BA 4AHUA 3NCIA 4CK2A 2R2UA 4RUAA 1JLBB 3B6PA 4F3TA 2ASJA 1RT2A 4ZP8A 3BSOA 4O3SA 4QCLA 1X9WA 1W25A 3D45A 5KT6A 3WNGA 3VQ9A 4E7LA 4DG1A 3KHLA 2VWJA 4CJ4A 3SUQA 3HT3A 5KTQA 1S1UB 3DDKA 4M95A 4EBDA 4CIGA 1NK0A 1RT5A 4IDKB 5KG3A 4CGGA 4WE1A 1TKTA 1UAXA 4N47A 3AA5X 5KRTA 4NLUA 1I6JA 4Q8FA 5JXSA 2W8KA 1EX4A 4B9VA 2R2RA 2FVQA 1NK9A 4NLOA 4J2EA 1NOZA 4ECZA 4CEZA 2ZE2B 4NLQA 2YNGB 4IFVA 1VSHA 1NKBA 4M42A 3QO9A 4K4SA 3GQCA 3EPIA 3MR2A 2WRMA 5F8IA 1U47A 4FS2A 3H59A 3RB4A 1KFSA 2JGUA 3H5YA 3AVKA 1T8EA 3HP9A 1RT3A 5HLFA 2F96A 4ICLB 4K4YA 3CO9A 3PW0A 1S0MA 3GIIA 2QK9A 4KO0A 3TAGA 3F9KA 4KTZA 2G8FA 2BANB 1SKSA 3DLKB 1RA7A 3K58A 2HNZB 3AO4A 1I3AA 1L5UA 3GV5B 1CLQA 4LH4A 5J2QA 1RNHA 3FFIB 5KFLA 5KT4A 1DTQB 3DOKB 4IG3B 4IKAA 4OLBA 1C0UB 1JLFA 2FLPA 4RU9A 4DTPA 3PW7A 1HYZA 3RTVA 4RUCA 1D9FA 3AVFA 3JSMB 4O3OA 3M8PA 1T05B 4W5QA 4DQSA 4OPKA 3SV4A 4NRTA 4EYIB 3QINA 2HHQA 3KLFB 2RPIA 3K59A 5F8JA 3D28A 2QXFA 4H4OA 5DQIA 4ID5A 3LP3A 5JS1A 4DTOA 5I3UA 3OYAA 4NLGA 1CZ9A 2OZMA 1B9DA 1KHVA 4KB7A 3H4BA 3PZPA 3ZSYA 3PW5A 1KSPA 2J6TA 3NF8A 2HNDA 3KLGA 4HUEA 1U04A 1UA1A 4O0JA 3HYFA 3SPZA 4ECYA 2IMWP 3KK2B 1IO2A 3CDEA 1VSJA 3E51A 4TQRA 4FM0A 3DLRA 3ULDA 4KV8A 5KFGA 2G8UA 2GV9A 3AV9A 4FK0A 1S1TB 1LWEA 1T03B 4NLXA 1LWFB 1ZBUA 5KT7A 5EWEA 1QUVA 4FZXC 4RNNA 1YVUA 2RF2B 5HBMB 1KVCA 4AHRA 2ZQBA 5DG7A 4L8RB 3DRRA 4Y2AA 1LAWA 3L3VA 4EP5A 4NYFA 3NBPB 5F9LA 3KK3A 5HROB 4PQUA 4U6PA 1RBUA 3AA2A 3KMSA 3AVCA 2P51A 4AH9A 3V9XA 3MEDB 4HKQA 5CZ1A 1Z25A 2HMIB 3CVKA 5KFBA 1BQMB 2V4RA 1KLMB 4J9PA 4DTNA 4K8ZA 1U48A 2HHWA 2ZD1B 4Z4EA 4OGEA 2DTUA 3KTQA 2ITGA 4EEYA 5KI6A 3P1GA 2Z1GA 4ZTFA 4BWJA 1S9FA 2HW3A 4CEOA 3K5NA 3KJVB 4KKOB 2JC0A 4ECWA 3KK1B 4O3RA 1CXUA 1TV6B 1ZYQA 3TAMA 1KTQA 3ZT0A 4FLWA 2V9WA 4W5NA 3DLHA 4TQSA 3DYAB 1RDCA 4KAZA 4M3TA 2OPSB 2IJFA 1NJWA 1S10A 5KFJA 3OYBA 3QEVA 3CFPA 3FRZA 1O1WA 3VQ6A 4JV1A 2RDJA 4KBIA 4GVMA 3IG1B 1TVRA 3K5LA 4GW6A 4EZ6A 4QWEA 4WFYA 3LP2B 3VQBA 4TY8B 3VQDA 1VSDA 4HUGA 1QHTA 1JKHB 4EYHB 2FJXA 4ZTJA 3VQ7A 2W9CA 1QE1B 3PX6A 4F8RA 4M3YA 4IDKA 4CGHA 4J9RA 4K4XA 2AJQA 4Y1DA 3V1QA 2ASDA 2OZSA 2KTQA 2C2RA 3LAMA 2GUIA 4KHWA 4MIBA 5I42B 3NGIA 3OL7A 5F8GA 4J2BA 3I0RB 4CF0A 5FRNA 1IKXA 4F2SA 2GBZA 4ZP7A 4W5OA 2D0CA 1YVFA 2R8GA 3HJFA 2I5JB 2EX3A 4CIEA 1S9GB 3HM9A 3HVAA 1RDAA 4W5TA 4QW9A 4K4UA 4N76A 2W9BA 2R8KA 1SH3A 5KFFA 4R5PA 4K4WA 2C2EA 1U49A 1NJXA 5K14B 4B9LA 1D8YA 2BRLA 4JV0A 4O0IA 5HP1A 2HAIA 3AVJA 3ITHB 1C1AA 4Z0UA 4AHSA 1JLEA 1WNEA 3T3FA 4E19A 1KFDA 3NH2A 3DLKA 4K50A 3DLBA 3Q8RB 2OPPA 1BISA 4BE2A 1JLAB 5KFKA 2R8IA 2QE5A 3AO2A 2DPIA 1YT3A 4RW8B 3KD1E 5KFTA 1C1BA 2W7OA 4CEBA 2DFEA 1XR5A 2XGPA 3TWHA 3V81B 2JEIA 2E6LA 3OS0A 2RKIA 4O55A 1VK0A 2XO7A 3S3MA 3KMQA 3DMJA 3OYCA 3MXJA 2Y1IA 4I9QA 2IS3A 3T5JA 1KVAA 2VG5B 2ILYA 5J1EA 4FLTA 5L1LA 1HRHA 4IFYB 3ZSOA 3LZIA 2PY5A 1IKVB 3V6DA 3QLHA 3AO3A 1TKXA 2ASLA 3NL0A 4DU3A 4NCGB 1BI4B 4NLWA 1SV5A 4M41A 4LY7A 1XI1A 1VRTB 3CJ3A 2G8KA 3H2LA 3U6FA 2XCPA 2GIQA 4IRCA 4CCHA 3KKRA 1NJYA 4MIAA 1S1WA 4FM2A 3MXMA 3DM2A 3VQQA 2FC0A 2BQUA 2DY4A 1QTMA 3I0SA 3OLAA 1BL3A 4FZYA 2B5JA 1SUQA 1ZBHA 1S1TA 1EP4B 1T03A 2YKNA 1J5OB 3AO5A 4FJGA 5EUHA 4DF4A 2HHTA 3OL8A 3E01B 4Y1CA 4MFBA 5KFCA 3ZSWA 3ISNC 1RBTA 1HQUA 4R8UA 2BRKA 2G8IA 5KRSA 3KLEA 2Z1IA 5J2NB 4IRDA 1I39A 2D0BA 1VRUA 3QGIA 4TXSA 4PUOB 4BDPA 2O5DA 5EWFA 3MEDA 1RDRA 5KT3A 5T14A 1Q9XA 1J9AA 3ALYA 4ED1A 1BQMA 2IGIA 4KE5A 4I7FB 5KFOA 3M8QB 1JLGB 1K1QA 3IGVA 4NLDA 4DTJA 4ECTA 4FJ8A 1YTAA 1ASWA 1LV5A 4DTUA 4NCBA 4NLVA 3V1OA 1HNVB 4Q8EA 3MEEA 4ZPAA 1BCOA 4BACA 4DEZA 4OKKA 1FKPA 2WTFA 3EPGA 3KK1A 1IKYB 3AA3A 4KHQA 4FK2A 3L2RA 3HVTA 3NF7A 3C6UB 4O3QA 4OPJA 3RB0A 3LPUA 4DLEA 4HCCA 3AVMA 4W5RA 5KFQA 2KW4A 2P5GA 5FDLB 2GC8A 1WSEA 4ZHRB 1KVBA 2BE2B 3IG1A 1SL0A 1X9SA 4DMNA 1L3TA 1B9FA 1JLCA 1LW2A 4RW4B 2EHGA 3LP1B 1S1VA 3RBDA 2IAJB 1GOAA 2HVHA 2B4JA 3I5CA 2D3ZA 4TY8A 4DQIA 4CJUA 4EZ9A 3OL6A 1RTIB 3MECA 1JXEA 3N6NA 3CJ5A 1TL1A 3SUNA 1GX6A 3OJSA 4Z4GA 1U09A 1S6QB 3SFGA 1A5WA 3LWMA 3AVIA 3JYTB 4EBCA 3C6TB 5J2MB 5E41A 1REVA 3CWJA 1XHZA 4KPYA 2YHAA 4KAIA 3VA3A 1ZBFA 2GIRA 3PVXA 3QEIA 1MU2B 5KG7A 2YNIA 3QEPA 3NH0A 3I0RA 3OS1A 3C95A 5C24A 2G8HA 3HP6A 1BQNB 1C0TA 2E9RX 4RNOA 1S1XB 4ECXA 3BGRB 1HYSB 2IM2A 4CEDA 3CM6A 5D3GA 1S9GA 1Z26A 3NAIA 2VA3A 3C94A 3IRXA 4K8XA 4OGCA 4E7KA 3NF6A 4B9TA 1C1CB 3Q8QB 3QIPB 4F50A 3ZSQA 3WNHA 3O4QA 3V4IA 3DLGA 1FKOB 2WOMA 2HNYA 2OPQB 2RN2A 3HL8A 2V0NA 2O4GA 1TK8A 3DRPB 2JEJA 4LSLA 3ZT2A 4FJNA 4FLUA 1JLQB 1R0AB 3BQ0A 3NE6A 4CEFA 2YKMB 1LWCB 4YR0A 4J9MA 1WNSA 3UPFA 4DQRA 1TL3B 3HXMA 5DG9A 4O4GB 3NDKA 5CYQA 3TAQA 4NZ0A 4AHVA 1WSIA 3RB6A 3SUPA 3V81A 3SJJA 4DSKA 5L1IA 3PJXA 5CY4A 1UWBB 1DTTA 3NAHA 2FBXA 3GIMA 4IOBA 4K4VA 3BSAA 3TARA 1NKCA 1ZTTA 1HPZB 1RBSA 4CERA 4DSFA 4WFZA 3T5LA 2G8VA 4WXWA 1JXLA 4IFYA 1SL2A 2D5RA 5JUMA 2FVCA 1FK9A 4CF2A 2AX0A 4IH7A 4ZP9A 1RYRA 2FVRA 1HQEB 3PY8A 3CG7A 5KFHA 2J6UA 3ZSZA 3G6YA 4FS1A 2KZZA 4CFBA 4IG0B 3I5BA 4J2AA 4M3UA 3VQEA 3MEGA 3ZSVA 5DGAA 4E3SA 2FVPA 2B6AB 2OA8A 4DL4A 1GOCA 1F21A 5KFEA 4F4XA 4OLAA 4F4KA 3RRHA 1T3NA 4ZPDA 5KFIA 1WSHA 4MKBA 2YNHA 1B92A 3LPTA 4I9LA 4QAGA 2AU0A 5C5JA 3U3YA
chains in the Genus database with same CATH superfamily
3MMVA 1K1SA 2LSNA 3CQ8A 1NGIA 2CKWA 4JI4K 3EE3A 4DQ8A 3BZQA 1NGCA 3C6AA 3MM9A 1FNOA 4PUOA 1KVIA 4JHDA 4MK9A 3QWPA 2C2ZB 4ZCLA 4A48A 1H0HB 4WFNL 4ELTA 3TABA 4CBWA 4J9VA 2XY5A 4I7FA 5KFWA 1Q81T 1VLYA 3N01A 3LP0A 1YRXA 4OYBA 1VQ4N 5KFZA 3A4TA 1Z6RA 1SVDA 4CT9A 1S4FA 4Z4FA 3QEXA 5CD4H 5A8WA 1SQEA 1VDHA 3PR5B 1JNRB 1VSLA 4OKEA 2I6WA 4ZN1A 1CG2A 2IBKA 1MG7A 2ZGZA 4ZHRA 1C0FA 4KH6A 5KFMA 4K4ZA 1HPMA 5CQGA 1S97A 4RW7B 5J2PB 4DV4F 1NZ8A 2YKQA 2VONA 1IVZA 3RSEB 5JVGQ 2UU9J 5B0FA 4ANDA 1RT6A 5DDQC 2WBMA 3WNEA 2YNFB 2ZKTA 2QLFB 4B1UB 4NA2A 1DLOB 4PWDB 4PG6A 2C3UA 3US5A 1WKLA 2HHHJ 1U0SA 4FM1A 4HI2A 3QQCD 4F4YA 4ZVGA 3OD2A 1YRTA 4ZJQA 3EX7B 4X4TA 3OYEA 1N6QB 4BC5A 1UVMA 4NXMK 3VZIA 5IT9U 1SIWB 5F8MA 2DKOB 2Q6CA 1FWLA 5JVHQ 1K0TA 4CF1A 2LXUA 4XDDA 3T9ZA 4A8MP 2KL8A 2CH5A 2CVEA 1NHUA 3D6MB 3UN3A 3N5FA 3AGRA 1IV0A 1F5CA 1N48A 1TUGB 2QMUB 3W64A 3NWGA 3O1WA 4ELUA 3FQLA 2JEGA 4KT0C 4X4UA 3MAAA 1AZSA 3MTKA 2CG8A 1FTRA 3BP8A 2BR0A 4RBTA 2ZE2A 4ECUA 1YUWA 1B0TA 1LWCA 2OMLA 1RT2B 5IWAK 2BDPA 2KT5A 3A3PB 4IOXA 5H9EK 3OVSA 4PWUA 2F8EX 3CMES 4DSLA 4NYZA 4ICLA 3PR4A 1QZ5A 4YHHF 3QNOA 2DHAA 2UV8G 1KCFA 4MAKA 3UKRB 3T19A 2D3UA 1KN6A 2CH6A 3QAEA 4WU3A 4ANEA 4C7QA 4DV0J 4DR6K 2VWKA 5IC4B 4YDUA 3RZAA 1XUPO 4RKUC 2X1AA 4DPOA 3C2PA 2DNPA 1DTQA 2GAHC 3ETMA 2KZMA 4CQ1A 2DGOA 4A8XA 5C12A 3FZHA 3JSMA 2QEXS 1XK8A 1ATSA 3R5JB 3CC7S 3KLFA 2KM8C 5GAGI 4AXJA 3HZEA 3A13A 4C8LA 4E89A 2GAGC 3OYMA 1IUJA 2QJ3A 2WVCA 4ZPVR 2VV5A 1UPMB 2JFKA 2Q43A 3OFGA 4NX9A 2XLIA 3T1YF 3LAKA 1BWEA 1LQ9A 1NU0A 1RTJB 3G10A 3TW0A 1PJ7A 2GGPA 2VFTA 4JRPA 3PHEA 2BJ1A 4CM2A 3KK2A 5KFYA 2HQ3A 3CJ1A 2XY7A 5KG6A 1ASUA 3G0ZA 4M5GA 4DU1A 1Q78A 4DFKA 4FBTA 3WT0A 1XMQK 4J9KA 3GV8B 3D6RA 1XNQJ 1TK5A 1J5EF 1V4SA 3CJ0A 2ZH2A 4C0HA 2SXLA 2VOPA 3RUBL 2HQCA 1VQ7S 5AR0A 2G2OA 4OHXA 3P5BP 4Y34A 3FZKA 2IA6A 3CXCM 4RW6A 4OL8A 5I3UB 3Q8YA 2AHOB 1LK5A 3RBXA 5KG0A 3NBPA 4OVLA 2QLXA 1Q95G 1NKEA 3UIQA 1Q9YA 4Q0BB 3UD3P 4WZMA 2HNDB 2O66A 3JTNA 4H5WA 1GLFO 5EY4A 3WNFA 2GEMA 2H9ZA 1FE0A 1XWLA 4ILHA 4IBNA 5U47A 5AXLA 2LEBA 3PV8A 1X9JA 4MK7A 3CF5L 2PMHA 4UOFA 4ZPCA 1YRUA 4DTRA 2FHMA 4URQU 4DV1J 1FRXA 1BIZA 4EBEA 1RAFB 3R6GB 2EPIA 3POTA 4KYZA 2WBRA 4M7XA 1BGXT 3W5XA 1EQYA 4EFAC 4UQTA 2NUBA 4FOIA 3CCQN 3CDWA 4FW2A 2E4LA 3DYAA 3J7YU 2Z1JA 1SI9A 2LMIA 2ZEJA 4CE9A 4KB1A 3B8AX 2IM0A 3LM9A 1YHQN 3RWUA 2O67A 4TN2A 5A8RB 3CUNA 4CZMA 2DHHA 1MROB 3PHTA 4NLRA 1TQLA 4M94A 3M05A 4JS4A 3LP2A 3MCNA 3VQPA 3D67A 3TX8A 3HVRA 1NK8A 4E7IA 2WB4A 1JKHA 1RISA 1VQNS 1T0TV 4NMLA 2DGQA 3NKYA 1G4CA 5DDOC 4QYZJ 1NNDA 2VBWA 4CZCA 2UUAF 2F5GA 2CQCA 4DV4K 4TYBA 3KJNB 2QSWA 4ALZA 2GVDB 5F8LA 5ADZA 3BSNA 3CNQP 3WBZA 4CO4A 5HRSA 4LRDA 2H3GX 4BRCA 1XQIA 1A6LA 5HAOA 4DS5A 1S9EA 2EC0A 4KSEB 5A2QY 2VQFK 1Q0NA 4H8KA 5DLGA 4ELVA 3WX8A 3K89A 3I6PA 4ECVA 5AT1B 3GSDA 4UOHA 3VN5A 3TEGA 2PZSA 2W9CB 3ITHA 4NI2B 4CNYA 3NVKA 2A5XA 2VJVA 5AQVA 2HRYA 3KD5E 2FLOA 5L1JA 4CJSA 1WC4A 3PLAA 3NGDA 1B4SA 2FBVA 1IKXB 2FSNA 1RAGB 3D2EA 4A8KA 4GRSA 1DQAA 2D0PA 2V4QA 3IBFB 3SI6A 4AXIA 3LGMA 2VASA 1I5OB 2O8EA 3K5PA 3M6VA 3THVA 2W9BB 4DSIA 3PXGa 5CYJA 1WEZA 3ZLJA 3AVHA 2HF3A 3TUIC 5C42B 4L3KA 4RUHA 1WELA 2RT3A 2ETJA 3M9MB 1C2PA 1CXQA 3QBWA 1P90A 3GWCA 5C25A 2R42A 2MLYA 1VQYA 3UI3A 3GPAA 1VRTA 4YHHK 2E5GA 2QG9B 3QBCA 2D3OR 2EC2A 2B8QA 1NMNA 4H0VB 3M2UA 3PJWA 3QERA 3T5HA 1YJWS 4FLVA 3V6KA 4RNFA 1CULB 2UUTA 4CJVA 4IZ9A 5LMUF 2RKIB 1F5BA 2XWYA 4X4OA 5LM7E 1MNEA 1GLAG 3JB9k 2AZ1A 2W1BA 2R9LA 2B43A 1EJ7L 3LUYA 5J1EB 2J0XA 2JZ5A 1K73T 1R27B 4CECA 2YHBA 4K7QA 3GIKA 2NRTA 3MR3A 2BW7A 4GV3A 1H1VA 4BGBA 2PYLA 3ENAA 4E7JA 1PSDA 3T1YK 3P3DA 1NBEB 4NZ7A 3THWA 4DOZA 4HDGA 4Q2LA 3H42A 2BOAA 2A40A 2R2SA 4MKVA 4O44A 1C4CA 1AFIA 4DFMA 5AZJA 3I0SB 1RT1A 4RO0A 1SUQB 2ERRA 4C6AA 1CS4B 1FI4A 2RUSA 1S49A 6FDRA 3B6OA 2CIMA 2AEJA 2C22A 5FPMA 2ZWOA 3HHLB 3TANA 1L3VA 4KH5A 1J5EK 4FWOA 1N33K 1UJ6A 2V8DA 1IBKK 4JUZA 3HFKA 3L2QA 1NSKL 3TUJC 5ELZA 3TO8A 3C0BA 2BUNA 1QZ6A 5CZXA 1VRUB 5L46A 2B4UA 3FSYA 4QIFA 1VSKA 1DT9A 4EO6A 1V3SA 5GVQA 1KONA 1WSGA 4P71A 3QIOA 4ZVHA 3PSIA 5DETA 2BJDA 5SZTA 2UVUA 2R7TA 3K5MA 5HRRA 1RTIA 1BWVA 3UQSA 3VAGA 3VAKA 4AM7A 1C6VA 3ET6B 1GTHA 2YHYA 1PC4A 1VIOA 1YZ7A 4E8UA 1PGZA 3BR8A 4KB0A 1WAJA 3L7UA 4F7VA 4FZZA 2Z2LA 1FKPB 2IIHA 2Z57B 3ID6A 3P39A 1SQFA 5IS2A 1UW4A 2D41A 3C6TA 4CFCA 2H4WB 1N5QA 2IHR1 2FLNA 3PO5A 1VAZA 2GQ2A 1U25A 4CZLA 3PACA 3M9NB 3FDSA 3T1AA 3PKYA 1S1XA 4CJLA 1IBLJ 2X6NA 1HYSA 5KGWA 4LIRA 3EICA 4QIGA 3CCTA 5AQUA 1PYTA 3SXLA 4DCJB 2JSXA 1HW8A 1C1CA 1VISA 5E3RA 3S3NA 1HWLA 3AT1B 3RR8A 3FMWA 1F5AA 4AD6A 5BN8A 4RJVA 1CBKA 4FLXA 2IA0A 4ZVRB 1TL1B 2CQHA 1IH7A 5GIPA 1OVQA 1NSAA 4CHNA 2GWJA 1CPZA 1JLQA 3CDAA 1OH7A 4WPAA 4K2XA 3WC2A 1AW0A 1REVB 1MMLA 3CJ4A 3DDNA 1DZ5A 4J9LA 4CJPA 5KFRA 3JQJA 2UUAK 3A0IX 3J81j 3J80O 5JMVA 2CZVC 5KFDA 2BBEA 4NLSA 5F8HA 1ZTWA 1FJCA 4GV6A 2FLLA 4G1QA 5D3GB 4ED2A 3IRXB 4YFUA 4EI2A 1S48A 2KJWA 4JYAF 4ILGB 4KC5A 3V4IB 1HBMB 1VIXA 3DLGB 2WOMB 1X4DA 3JQMA 2OTLN 4Z4CA 3MCAB 4JD2A 3I8BA 4LF5K 2YY3A 4X62J 2JJ4D 3M2VA 2QSFA 4OFZA 5CZ2A 2ZFHA 4BC7A 4IG0A 2OTJS 5CYQB 4ENOA 3W2WB 3OYFA 3I56S 4S0MA 2Z2YB 1GXLA 2YQ1A 1N4LA 2I7NA 1YBAA 3QEWA 3E8OA 2JL9A 4LF4J 1WSFA 3J7A1 3PX0A 2K2PA 1HHTP 3AOAA 1S0NA 1NDKA 5CABA 3OVBA 3V9SA 1JJ2M 3KNAA 4GKKF 1RTHA 1W2BR 2W01A 3NGKA 3OS2A 3VTHA 2FVSA 2X1BA 4WIQA 3BR9A 3CD0A 4G6VB 1FKAF 4Q45A 3MM5A 3BF4A 4DPUA 2I2YA 3IS9A 2QT7A 3VWSA 4DU4A 4NYNA 3JTPA 4ATNA 4CVNE 1ZETA 4JI6J 5KFNA 1BOTO 3ELHA 3HTVA 3MFHA 4FLZA 1FRLA 2FHJD 1NRKA 4YY3K 2ZBQA 1UA0A 2P9UA 4PHTX 1QAIA 1ZA1B 4DFPA 2ZUAA 2BACA 5AQTA 5LMUK 2MQQA 2UYTA 4C2MA 1VQ9S 3OJUA 2F1FA 1N5YA 5CHIA 2XULA 3SAFA 1TFYA 2BTFA 1G3OA 1HMVB 1U6FA 4WTYA 2YWEA 3UB5A 5DLFA 3DXSX 2EFQA 3NH1A 2LFVA 3LDLA 1YI2S 2F9DA 3S1TA 1CJUB 4AILC 2RHSB 2HHUA 2FJBB 3LH2S 3Q23A 1L3UA 3NY0A 4F3MA 4UT4A 3FBBA 3BSCA 3QSIA 4K42A 3TVZA 4OHWA 4NCAA 3MHYA 4KFBA 1M5VC 4YR2A 3HPOA 3JSRA 3DOMB 3FBCA 2PI4A 3NMUA 4O3PA 2WONA 3ZYYX 1OQ6A 1WOSA 4OYPA 3OY9A 5HL7L 4FLYA 2EEYA 4ZVFA 3G86A 2FHOB 4HTLA 4DI6A 2WHOA 4FW1A 2NRWA 5GIOA 3CPWR 3CCUN 3DRSB 2AEFA 3KNGA 4IR1A 5HJXA 2E2QA 1FWPA 3I8DA 1O5JA 3W60A 3T9NA 2F9TA 4I2QB 1ZS6A 3DI6A 1U1OA 3GSIA 3SBMA 4BC4A 4FWMA 2AX1A 1NK5A 2HBKA 1U8WA 4JV5F 5CYMB 1SJFA 4BC3A 5E33A 3ZFVA 2KFZA 1VQ8N 3DGPB 4DPTA 2HIQA 3NCIA 2MKCA 3AJ1A 1JLBB 2HIYA 2WC9A 4F3TA 2DJWA 2IPOB 4CDIA 5B08A 3DXKB 1X9WA 4F36A 1ZBTA 4PG8A 4M5DB 3UNYA 1B3TA 4WJBA 3KHLA 4RBVA 3SUQA 1S1UB 3MEKA 1GNKA 2RH3A 4H03B 1NK0A 2RQCA 1RT5A 4F26A 1Q5VA 2CYYA 4YOTA 5HQ8A 1TKTA 2AZ3A 3R5CA 5BR8F 4YOUA 3K9JA 4K43A 2R2RA 2CJKA 1MN9A 2ZJPL 1VK8A 2F7TA 4OI4A 4CEZA 2DO4A 3L3CA 1GT8A 4IFVA 1R0CB 4K4SA 2CPZA 1ZOTA 4BROA 3MR2A 5F8IA 3H59A 3I4PA 1KNZA 3K0JA 3L7OA 4P7TA 1KFSA 2JGUA 3H5YA 3AVKA 2CRLA 2MZJA 5HLFA 3OUYB 3FE1A 3HDSA 1SCJB 4USIA 3SIPB 5HOOA 5BXIA 2QK9A 3GIIA 5L9NA 2I8EA 3F56A 1X4GA 1EO1A 3F9KA 4USUA 4A61A 4NMXA 1EKSA 3CD7A 1FD2A 3CC2N 3AO4A 1I3AA 3J81O 1PBAA 1RNHA 7AT1B 4JYAK 4IG3B 1X7VA 2ZNZA 4IKAA 1JLFA 1NHKL 2B9XA 3VF2A 4RUCA 2WW8A 1D9FA 2H54B 3WX4A 1HX1A 3M8PA 1T05B 4W5QA 4DQSA 4OPKA 1EQ0A 4NRTA 1EWRA 3QINA 3CJRA 3K59A 5F8JA 3CDBA 4H4OA 4LUBA 2Z0GA 3LP3A 3LGNA 4DTOA 1Q79A 3M2RB 4X65F 1B9DA 4PPDA 4KB7A 3PZPA 2CG4A 3CJCA 2J7WA 1HR0F 3BKUA 4E98A 1CJVB 1UA1A 2AEMA 4GVBB 4O0JA 3OFFA 1YX2A 4ECYA 3QMQA 5CCLA 2E44A 1IO2A 1YJNN 4TQRA 3MM7B 5HVHA 4CLKA 1HKBA 5DZ6A 2PMWA 5KFGA 4JI4J 5A6WA 1RBOB 3MZIA 1AUSL 1LWEA 2DNYA 2H5IB 4V19S 1BD6A 2A6OA 2RF2B 1WF1A 1KVCA 4AHRA 2ZQBA 3DRRA 3VTIA 2RU9A 1RWOB 1WKJA 1UFWA 5HROB 3O9RA 3HSDA 1RBUA 4ZLNA 3AVCA 2VYPA 4AH9A 5C2CA 4DV2J 3D2FB 2HMIB 3ULHA 2UUBF 2V4RA 1WWHA 3JAMO 1FA0A 4J9PA 2KKZA 2APOA 1KQFB 3CJAA 4JN4A 3MMBB 2UXCK 4FWRA 5AQSA 2PMZD 3W1YC 2E1MC 5H1SV 1BU6O 5KI6A 2Z1GA 3CCZA 4BWJA 2V2QA 4UY8O 2MQ8A 5GAGU 4ECWA 3KK1B 5AQPA 1TV6B 4RTFD 3D66A 3GJQB 3LPEA 1G7CB 3TAMA 4BS2A 2V2KA 4KAZA 4M3TA 2OPSB 2QXLA 3CC7N 4BVOA 2N7CA 1S10A 4C3KA 4Z7CA 4YS2A 3CFPA 4GVMA 3IG1B 1TVRA 3C3LA 4DCOB 2VH7A 3SMZA 4P6QA 4WFYA 1R43A 4DCPB 4WCEQ 4ZITA 5AQNA 4DR5F 2KXNB 4ILRA 1VSDA 3SDEA 4HACB 4EYHB 1FX4A 2ASOA 4OI3A 2JLFA 3PX6A 3AD8C 1Z2LA 4B1VA 4CGHA 5AXNA 2V68A 1CC7A 1VQ5S 2KTQA 1YAGA 1FXRA 2EFGA 1T02A 5B0BA 1FJGF 5IFMA 2DNMA 1ZZFA 4G1IA 2YBVA 4J2BA 3I0RB 5HVGA 1BUXA 1FNMA 3OTBA 1YVFA 1WBBA 1VBXA 3HJFA 3A8JA 4JV5K 1HJOA 5HO4A 2EX3A 3ZX2A 4CIEA 3HVAA 4W5TA 2A6AA 4N76A 1U2RA 3VESA 3M6GA 4R5PA 4K4WA 5H9EJ 1D8YA 2BRLA 5DJBA 3D2WA 2E88A 2B4OA 5E3QA 5HP1A 4K5RA 2NR0A 2V94A 2RVJA 1WNEA 1JLEA 3JQKA 3FC9A 4JB8B 2WVDA 4UY85 4F3QA 3ATVA 4K8RA 4OJHA 1V6HA 2EFPA 3D6TB 1JLAB 5KFKA 3AO2A 3OTOF 4JK9A 2DPIA 4JK7A 2V51B 1YT3A 2GCFA 5K8NA 1WC0A 4DR6J 2DHSA 4RW8B 3KD1E 5KFTA 3VEVA 1C1BA 2W7OA 5BR8K 4A8YA 2DPNA 1EQMA 1B7YB 2YJFA 2WZ1A 2DRAA 2ADBA 3GJSB 3OS0A 4K59A 2XO7A 2XLJA 3TSPA 3OYCA 4Z37A 3MXJA 4I9QA 3MPYA 3U1LA 2YPZA 5T7LA 1Y3KA 1V3RA 4IFYB 2Y8WA 4FDFA 3AA8A 3QLHA 2CPJA 5BRHA 1YQHA 1TKXA 3NL0A 4NCGB 4DV5F 4WQ5C 4M41A 3ID8A 1VQMN 1VQNN 2F8MA 2GIQA 3BPSP 2J8AA 4KBOA 3UN2A 1CJKB 1YITN 4PPZA 1S1WA 4ED4A 2NUHA 2FC0A 2DY4A 1QTMA 1XMQJ 5THWA 2IVPA 4FZYA 1ZBHA 1WUUA 4BCAA 1T03A 2YKNA 1J5OB 2ZJRQ 4DV6J 3THTA 5EUHA 4A62A 5AQJA 2B4VA 4DF4A 2HHTA 3E01B 2YPYA 5LXRA 3ZSWA 1UFKA 1N34J 3H6EA 2R7XA 2NRVA 2H3EB 1UEUA 1H38A 4U7BA 1QVGR 4OV6A 4PUOB 4BDPA 5LOQA 5EWFA 1RDRA 2ROPA 4X65K 4RCHA 4O8UA 4CWBA 4ED1A 1HR0K 3AJ2A 4OX7A 4ZS6A 3C7NA 1GAOA 4I7FB 5KFOA 5HSPA 1K1QA 3CCJN 4NLDA 4FZVA 4DTJA 4ECTA 5AFUH 1ASWA 3MMAB 2HQFA 1BWFO 1PJ6A 2MYFA 1VQLS 3MEEA 4FL9A 4BACA 3AB2B 4A46A 4DEZA 4ETXA 3O5BA 1RWMB 1TELA 4C8ZA 2M9KA 2CGJA 2PFUA 1RUSA 1IKYB 2HQGA 3S6EA 1AA1B 3AA3A 5A8WB 1WEXA 4B3TF 3HVTA 1WDTA 3FEZA 3VPZA 4OQJA 1S7IA 4HTJA 1V5IB 4DLEA 2A2CA 2L9WA 2GVZA 5SUHA 2QN6B 5FDLB 4PKHA 4OV1A 3G71S 2GC8A 4ZHRB 1SL0A 4I4BA 1L3TA 3MOJB 1B9FA 3GE1A 1LW2A 4RW4B 2Y1RI 2IAJB 3RU0A 5FLXY 5HI7A 5BRFA 4USTA 5IT9O 4EZ9A 4W98A 3OL6A 4CJUA 2UUBK 4BRIA 3MECA 3I96A 2VBYA 3H0PA 3BDEA 3SUNA 1FFWB 2OEJA 3OJSA 3CERA 3SFGA 3UDEA 4U96A 2FJEB 1RKJA 1A5WA 4QQBA 1K8AO 2N3OA 4JI1J 3GBTA 3W8GA 3LL3A 4B3RJ 2YHAA 4KAIA 2GIRA 1ZBFA 4O0NA 1QVFM 3QEIA 1MU2B 2UXDK 5KG7A 2YNIA 5D77A 3QEPA 2ZH4A 4WIIA 3AHPA 4HDHA 3MDQA 4M7YA 3VGSA 3BGRB 4C3LA 1Q18A 4P73A 3NAIA 2CQ1A 3U1MA 2Z4PA 2VA3A 3O2IA 3VZHA 2YXLA 3NF6A 4F50A 3ZSQA 3MAAB 1QAXA 1T6CA 1R3NA 1R6VA 3C16A 2FGOA 2V0NA 4Z2XA 2O4GA 3MX2A 4DR5K 3OR1A 3A12A 2ZHAA 4CEFA 1LWCB 4X64F 2DR6A 2FC9A 5CE3A 1FXDA 3IR6B 2HQDA 4EIAA 2D4WA 3LDOA 5DM7L 3ZX3A 1VK3A 4LF9J 3VAFA 2X3GA 3TPQA 4AF1A 4CIOA 4ZVTB 4NZ0A 2F4FA 1FJGK 3IBWA 1UWBB 3NAHA 1JMTA 4HR2A 4IOBA 1NKCA 2MKJA 1BUPA 1HPZB 2ZBRA 3TTFA 4YUDA 1SQKA 2V7YA 1HW9A 1LEOA 2D9OA 4FF2A 5A8KB 2BJ3A 2PAVA 1FK9A 5F0XA 4B3MF 4ZP9A 3U8XA 2D0OA 3UKUA 2KU7A 1HQEB 1H7WA 3G6YA 4BR9A 5ITHA 3EVMA 1C4AA 2L9NA 4GKJF 3I5BA 4J2AA 2CZ4A 4YHHJ 2QL5B 3VQEA 2KHDA 5DGAA 1GLEG 3P45B 3HI0A 3TX0A 1HI0P 4CD1A 4OLAA 1S6UA 2HBQB 2DT9A 1BA0A 1WSHA 2YNHA 1M1HA 1B92A 3LPTA 4I9LA 2AU0A 5AJ3F 4FXDA 4ZPBA 2DNLA 2PN6A 4EMDA 4ED8A 1RHKB 2IC3A 1UVJA 3SQ2A 2OEMA 1Y7PA 3R6MA 2DY9A 3HZ6A 4FWLA 2E7VA 4WP9A 3PW4A 4M5HA 1J27A 3VGMA 1YK9A 3V9UA 3OYNA 1QD1A 3GB0A 3CGIA 5CHCB 4BE1A 3T1HF 4Q5VA 2IVYA 4DV5K 1XERA 3UE5A 1WAFA 2RUGA 5E26A 2LQ9A 3R5DA 1LW0B 4RW6B 2G8WA 1P27B 2QA4N 1WLJA 4JKEA 3CMQA 2K7JA 3PX4A 1U6ZA 3VV2B 1RTDB 3CD6N 4DR1F 1MA9B 2D7SA 4NA3A 3MX5A 4BR7A 5LJ5Y 3RMAA 2XHCA 3WC0A 2QLBB 2Q36A 2VIHA 3QFPA 2ROEA 4KHSA 3KLIA 2M8HA 2IYGA 3L8BA 4FVUA 3MXHP 3RAQA 4KI6A 3QT8A 4KH1B 2DR9A 2A3ZA 2OPRA 1RADB 4KRWA 1RT4B 4DTXA 1YJTA 1DJ0A 3H3OB 2HWIA 2CJQA 1CQNA 3C15B 3RYLA 1TL7B 4CK3A 2DB1A 3O1LA 5M1FA 4DPYA 3M1VA 4Z4IA 1RT7B 2QWRA 1TKDA 1CJTA 3O3HA 2DH9A 1TAQA 1HNWF 1LAVA 3D7SB 2QW9A 3SAHA 4B3TK 3QNWB 4JLHA 3E66A 2XGQA 1B0VA 3GDQA 3H5XA 2Y1LB 2P9SA 1WOPA 3MDFA 5F9NA 2D1KA 2ZH7A 4H4MB 3J7AN 2KHOA 1QY7A 4AT1B 2DD8S 2RQ4A 4PG5A 3QJLA 4Y65A 2P9IB 4L3NA 2V8PA 4CD3A 1SB6A 4A47A 3P4IA 5B09A 4A5AA 2PIIA 4BR0A 4DV3F 2P9KA 2DHGA 3MCPA 1CZBA 1R0AA 1NBWA 2YNGA 1Y3JA 1S9EB 2YKMA 5HMYA 3QIDA 2QYCA 3I87A 5M1OA 5KFPA 1Q81O 1HLUA 2CQDA 2UXBF 2ZKUA 4DG1B 3IA0A 4NPOA 2UUAJ 4NA1A 2WB1D 4GC6A 4PEOA 2W8LA 3CO0P 5GAHU 1PAUB 1VFJA 2BANA 3FZBA 3L4BC 2KFYA 4CO0A 2XSJB 1HNZJ 3RBEA 2HNZA 2F8HA 4E1NA 1CQMA 2B3TB 2CNLB 2FJAB 3RMCA 5B0GA 1YI2N 1WSVA 2Z58B 4L3QA 3SYZA 1R8PA 4EFHA 2P9NA 4RZRA 3DOKA 2VPZB 1C0UA 3L3UA 4QIEA 1RWXB 3H98A 1ZM9A 3U27A 2WVBA 5LJ3Y 1FRHA 2GO8A 3EJMA 3HD2A 2VC0A 5L1KA 2BKPA 3F2KA 4CHZA 1YLXA 4GMJB 4B1XB 2R2TA 2C3PA 4MMOA 4KR0B 4YDUC 1LOTB 2CNKB 1YIJN 5C25B 3GMGA 3PYDA 1GLCG 4IEEA 2LU2A 1JQGA 3PRDA 3W66A 5AE1A 2C28A 5A6PA 1NUEA 3O4NA 1N5VA 5J2QB 2UVRA 1RU2A 4B3SF 3HK2A 4HVJA 3SQ0A 2PEHA 4BRMA 3EGZA 4KHRA 2C3YA 1VBYA 2E2NA 5F41A 5IXUA 4YMEA 1XNRF 3BS9A 3BKFA 2GV1A 2ADCA 2W6LA 3O3GA 4CJWA 1S12A 4ZLLA 3M6WA 1M5PC 1D8ZA 1HARA 1IWAA 4DR2F 5CXTA 2GJIA 4LR8A 2CQBA 3H3NO 4JI0K 1IN0A 3FJ2A 4GKJK 3OW2M 2DTJA 5KFVA 4A57A 5BPLA 4ZVUB 3M6XA 3QJPA 5DGBA 3IAM9 4OKJA 1A0OB 5GADU 4WP8A 2BXJA 4FN5A 2Z56B 3THWB 1FFGB 4FNHA 1BHLA 4USWA 2P9LB 2O4IA 2W40A 4O44B 5AJ3K 2ZD1A 3EZ5A 3I33A 1RT1B 2ZM6J 3UE2A 1U0HA 2QL7B 3FKBA 1RWUA 3BN7A 1TZ0A 2Y0BB 1OH5A 3BKTA 3KJVA 3NG8A 2HBJA 3M4XA 3U1NA 2A0FB 1YF5L 1F9HA 3OYIA 3T1HK 5DK5A 3TSQA 3VQCA 4CFDA 3BQ1A 3G6XA 2COLA 5I3QA 4RWTA 3SNNA 3GTYX 3GIJA 2CPFA 2KT2A 2E5LF 4N41A 1N54B 4AQYF 1X31C 3IMQJ 4OZ1A 1XMOF 4DR1K 4OMFG 2MZ1A 1QE1A 2HKEA 1FXLA 1U1QA 4XPCA 2V50A 4DSJA 3ULEB 3W63A 3QATA 5CD4A 4I0WA 3N79A 4QW8A 1X8DA 4QR2A 3L2VA 4FBUA 2H5EA 2J7UA 2VHGA 4DR7J 4XIUA 6AT1B 1OKJA 1OMSA 3IP0A 3WHIA 3Q83A 4USMA 3A5NC 1RAJA 4OZJA 1HNIA 4CP5A 2IMOA 4JKBA 4PXDA 4BWMA 2F4VF 2I5JA 1OPZA 2D3O1 1X5PA 2MZQA 2WFBA 4LC9B 4WBFA 2M70A 4ZIVA 5C10A 4CJQA 4FK4A 1KR4A 3PYGA 1GOBA 3IC1A 1GMWA 3HPHA 2XEXA 1HNWK 2OYQA 2E1CA 2N3LA 4RNHA 2MKYA 5AQXA 4DTSA 1E6YA 4QPXA 1IM6A 4CLWA 1B99A 4J7CA 3P5TL 3OHRA 3O80A 4DL0C 4FVCA 4J90A 4CHQA 3KFWX 2QA2A 1S7HA 3OSNA 3BGUA 2AGQA 3CCQS 4G1QB 3THPA 4R79A 4DV3K 2CQIA 3VEYA 4JI5F 2XI2A 3OHAA 3E9PA 1B70B 1VQKS 1VOMA 3ILJA 4X4SA 2VG5A 3H5SA 4B08A 3H5UA 3ZZPA 1Y64A 2O8BA 1IKVA 1M1GA 3I55N 3MM6A 1AB8A 3M30A 1WTFA 5IM0B 5K8OA 3BGFA 2OPPB 1R8AA 1U6BA 2UVVA 2CPHA 2XC9A 3V4MA 4LF7F 3AJDA 1KRPA 1TKZA 4CHYA 1Q82T 3VQ4A 3BF3A 4JYAJ 1HKCA 3R97A 2PGCA 5FRMA 4BY9C 1PC5A 4CT8A 3OTCA 3B54A 1T95A 4N56A 3DMJB 2XS2A 1EP4A 1S6PA 3A3NB 1WB9A 4CBXA 2F8TA 2V67A 4MO4A 2YKOA 3IM9A 2QRRA 1Q86T 2DIUA 3KUGA 1NGEA 1S4EA 3ZETB 2M5YA 3EGWB 1HL6A 3V6DB 2C1EB 4B9UA 2YHWA 3L2WA 2NREA 2V69A 3TUPA 1RWWB 2HLTA 3VOVA 2HGNA 5KFAA 4F25A 1MN7A 1SV5B 3G6VA 4L74A 4MLEA 1NHVA 3GLJA 3R1HA 1DURA 1X4HA 3CD5A 2ZVSA 4IH5A 4ZVQB 3VR1A 3AVGA 2VCPA 1U1NA 2NSBA 3ZO7A 4A5BA 2LXFA 4HHUA 3OYGA 2U1AA 3M8QA 1JLGA 2I9SA 2VFUA 4B3SK 3R5AA 4DQPA 2B5JB 4GKKJ 4X4VA 1T6DA 1X4FA 3R6LB 2P9UB 4PY5A 2LA6A 3O6WA 3SQ1A 4WKYA 1YGYA 1XNRK 5KT5A 4CO1A 3RRGA 3IWXA 3V2UC 2H4YB 4DV7F 3DN9A 3DAWA 2CJBA 4L73A 3E1YA 1N56A 1HQUB 3I9ZA 1FNXH 1GH8A 3FSXA 1BQXA 4DR2K 4CLFA 3A5LC 1IBMK 3CJKA 2BE2A 2HLUA 4YR3A 4HUFA 2V9KA 2C2DA 3O8WA 4DL7A 3PYFA 3NGTA 3ATUA 4KFBB 2KHCA 5MLCQ 3ZTPA 1G99A 4AM6A 4MKYA 4RX6A 3VGUA 3R9PA 4KHMA 3MF5A 2LU1A 3JYTA 4I56A 2JC1A 4FYYB 2A1SA 4U67L 1Z05A 1XTZA 5AQIA 4J9NA 2EWSA 3FUYA 1E6VB 4RPFA 1NM2A 4OLOA 2C3MA 2YKAA 3R8EA 3CEDA 2QLWA 3VETA 1BQNA 1IM4A 3KLHA 4NYOA 2FY8A 4QS8A 4DQQA 4DUZJ 1KOOA 1FHTA 2RE2A 2CUYA 3DI6B 3HFZB 1S1VB 1I94F 3BDPA 2AGOA 1U24A 3SBGA 1K73O 3GCXP 5EVZA 3WXLA 4H54A 3HI9A 4PA1A 4KRFA 4Y6IA 3OBWA 1XBWA 2VODA 2E5LK 4LF1A 4LH5A 4AQYK 2OPQA 4UUWA 4M5KA 3PIPQ 1APSA 3DRPA 3IWLA 2J5AA 1RU1A 1NM1A 3MR5A 4ED7A 2CPXA 4FJKA 1IQZA 2EG1A 2MHEA 1WC5A 2FC8A 1TL3A 3PIOQ 2FTRA 3CCLN 2AIRB 2R7UA 4DN9A 5C24B 1C0TB 4X66F 1RDDA 3CJ2A 4F2RA 2ASMA 3F73A 1FXXA 1RHJB 3FLCO 2HGLA 4NXNJ 5JICA 3ISND 4OPAA 2DVIA 4PXEA 3NAEA 1JX4A 3MM8A 3CJ7A 1TKTB 1HNXF 3HPGA 1Q8LA 2F4VK 1KAYA 1L3SA 4QWBA 3OA9A 3LDSA 2HNYB 2P5VA 5AQLA 1TGOA 5F0WA 4LSLB 2HB5A 4W4MA 2ZBIA 4URSA 5I4MA 3U4LA 4IFVB 1NAQA 3PYEA 3HHLD 3CCMN 3CIPA 3QZ8A 2YV0X 3BO2A 4YQWA 2NXJA 1ZBIA 3H20A 3KLVA 4QWCA 1OPIA 4Y0WA 5BR8J 3SLCA 1DTTB 3IKMA 5L39A 4NE9C 3QT5A 3HHKA 3VHQA 3DLLL 2DR5A 3BB5A 4WFBQ 4JI5K 2DGXA 3AOCA 1OJ4A 1GLBG 2NYIA 3KK7A 5IV3A 2AJ4A 1DAXA 3TZXA 4C23A 2CQ4A 2BKOA 3IR7B 3SUOA 1K8AT 2VBXA 3QGGA 4L75A 3MEGB 2LP4A 4A8SA 2R8HA 1C0MA 5JLFA 4LF7K 4P7VA 1UCNA 1MMNA 4YOWA 3NGZA 1S59A 3RMDA 3U9DA 3G4SN 1GFWB 2OO4A 1DHMA 2NLXA 1JWWA 2HFNA 3P83D 2GMHA 3OBIA 5FJ4A 1RCXB 2HHSA 3MR7A 2FJWA 2ATLA 1K9MT 4FJLA 1U8SA 1RAOA 2LYVA 4KGZB 3OYJA 3Q8UA 4RW7A 5J2PA 5HMZA 3RSEA 4CEQA 2MQNA 4LMZA 5ETLA 4GO5X 2OTLS 1VR6A 3KOAA 3CJ9A 2EBGA 1F3VA 2Q3SA 1ZA2B 5IT0A 5KQDA 3AVBA 1NZAA 2YNFA 3C6HA 4X4QA 3TYTA 1DLOA 2VG7A 4PWDA 1OSCA 3HM8A 3MD1A 5AXMA 1RXOB 2HS4A 4DHVA 1TYQB 3RAXA 3GYGA 3TR8A 3IXQA 4TYAA 2DY1A 3THXB 2CQ0A 2DNRA 3JAMU 3BJYA 4ZK7M 1VSMA 1N6QA 2XMAA 2KG1A 1VSFA 4A8FA 3RB3A 4JAXA 3MGJA 3H45C 3TI0A 2QKKA 3OTEA 2XS5A 1ZBLA 3M1FA 2C3OA 1J54A 1Q5YA 2DK2A 2DNHA 1RHMB 1WN7A 3OT9A 1S6OA 2ZZNA 2G13A 4WFXA 2R8JA 9RUBA 3C19A 3CQYA 1NGBA 1NU4A 5IWAF 2BX6A 1ASVA 1EKRA 1FDAA 1RT2A 3BSOA 4B02A 1A9NB 2HBMA 3GFXA 1W25A 3D45A 2DGUA 2GNKA 4BRQA 5L8RC 1F60B 3VQ9A 3J8AA 1WF2A 4RU2A 2AYEA 1GLDG 2AJFE 3SDEB 4NB4A 1KD1T 1EIYB 3QWUA 3HULA 2O8DB 5DM6L 4M95A 2ZOGA 2X1GA 1T11A 3UKRA 3A5OC 3M7VA 4IOCQ 1SC3B 4QIWD 5F3TA 4JKHA 5KRTA 4NLUA 1JJCB 4Q8FA 5JXSA 2B7BB 2W8KA 1EX4A 4B9VA 1N0UA 1WBDA 4KGVB 1I94K 1ATRA 4J2EA 1W7WA 2J0WA 4NLQA 1M5OC 3ZZYA 1VSHA 3RRKA 1FJ7A 4J91A 2FPHX 4FS2A 1R6YA 3MD3A 2GUPA 2MZSA 2GHWA 1XNQF 4PL7A 3H25A 1RT3A 3EVOA 3H1VX 4K4YA 5ADXH 2WSFC 3PW0A 2E1ZA 3O8MA 4KO0A 3CETA 2KM8B 3UNGC 1FJGJ 1SKSA 2DXDA 1RZMA 4ZLJA 2Y0SD 1RGIA 2NRZA 1B64A 2BKNA 3TRGA 3TVYA 2M0GB 3SSQA 3FFIB 1TUUA 3AAPA 2XHWA 3Q24A 2CQGA 5D4NA 4RU9A 2CNOB 1HYZA 2CQ3A 3GL1A 1O51A 5IT9Y 2A41A 3BZCA 3SV4A 3U7JA 4E2FB 2HHQA 4L6V3 2QWNA 3D28A 1VQ8S 2QXFA 5DQIA 4ID5A 2HS3A 5JS1A 1SAZA 5I3UA 5BYRA 3OYAA 2MJNA 4NLGA 1CZ9A 3OTOJ 3ILOA 4UW2A 3H4BA 1NJIT 3ZSYA 1H3DA 3NF8A 2HNDA 3KLGA 3M3ZA 3OXGA 2B8PA 2YQ3A 4Z94A 2HBRB 3HYFA 2X3DA 1T44A 2P6SA 3BH7B 3ULDA 2BJ9A 3A8YA 1TR0A 2G8UA 4KGMA 4WKRA 3TJ8A 4LBIA 2EK1A 1M90T 3AV9A 4FK0A 2ZH5A 2LQ5A 3RBZA 1T03B 1LWFB 2AKWB 1ZBUA 1ICEB 3C14B 5EWEA 4FZXC 4EUVA 1YVUA 1W26A 5HBMB 4DV5J 1S72N 4L8RB 4NYFA 1QQOA 1VYAA 2D9PA 2DH7A 2C2KB 3E2EA 3KMSA 3IBCB 3V9XA 5MLCV 4OI2A 4HKQA 5CZ1A 1Z25A 1JNZB 5KFBA 5A8RA 3VENA 2B51A 1MROA 2HPUA 5LT5A 4AL6A 1KLMB 4DTNA 3C7NB 2B9YA 3VALA 4Z4EA 2JX2A 4OGEA 2VBZA 4FWQA 3CC2S 2ITGA 1YG0A 1WJ9A 1WI6A 3TR5A 3P1GA 2R7QA 3DCAA 1SC4B 3J7YP 2HHHK 5IQ6A 4CEOA 3K5NA 5GMEA 1HA1A 4KKOB 5M2UA 2JC0A 4O3RA 5FPDA 2ZC3A 1NLVA 3W9HA 4I6MB 2M2BA 1KTQA 4FLWA 3OV7A 4QU6A 3THYB 4W5NA 3DLHA 2GVDA 4O5FA 4OI1A 1RDCA 3IDHA 2IJFA 2OELA 2VQFF 3EVWA 1B7FA 1O1WA 3PFOA 3LQVA 4N7TA 2B7CB 5D78A 1LWXA 3K8VA 4EZ6A 3NWRA 4CLSA 5M1QA 5IZHA 5IV4A 4ER8A 4LF6F 1YBUA 3EDRB 4HUGA 2W9CA 2VJUA 1T9XA 2OGUA 4NI2A 4IDKA 2RILA 3TEHB 1YJNS 3SK3A 1VQON 2V34A 4Y1DA 2W41A 2MMYA 3V1QA 3U02A 1SS6A 3LAMA 4ZCMA 2GUIA 1IR0A 5I42B 3NGIA 2M52A 3OL7A 2POKA 4CF0A 2QFIA 1X5TA 1IKXA 5ETMA 1KC8T 2ALYB 1TMMA 4Y28C 4W5OA 3VAJA 4ZCKA 1R31A 2XYHB 4FNIA 1H73A 3HM9A 4CI6A 1JCFA 3NS7B 2VC1A 4QW9A 4DV0K 2W9BA 1SH3A 1U49A 5K14B 2ZH6A 3NOCA 2AYMA 2NXCA 4O0IA 4Z0UA 5B0DA 1H7XA 4OJ3A 4DUYJ 3T3FA 3HSGA 2DYAA 2AYGA 1KQSR 4K50A 2KYZA 2J9CA 4PKGA 1WG5A 3MMJA 4NASA 3MWPA 3R2DJ 5H9FJ 5FPNA 1W2IA 1U1RA 5HK4A 4CH1A 2HS0A 3WXMB 2VPYB 1XQSC 5HMWA 2FGCA 2W4PA 1CULA 2ASYA 2JEIA 2E6LA 4LFCJ 1X3MA 2RKIA 1VK0A 3KMQA 6FD1A 1HBNB 1LOUA 5MAOA 2Y1IA 1RB0A 2QA4G 2G1HA 1KVAA 2P9PB 3VGKA 4BRDA 5LSRA 1O13A 5J1EA 1HRHA 3LZIA 1FW6A 4X64J 3VF6A 2KT3A 2YKPA 3JSBA 1XNQK 2CJXB 5BN9A 3AO3A 2ASLA 4WF9L 4DU3A 1NWKA 1BI4B 3G8QA 4NWBA 3U6FA 2PD1A 2XCPA 1RKIA 5IQQA 1UMJA 5AQQA 2EWHA 2WVFA 1PG5B 4ZA1A 4ID8A 2IFXA 4LREA 4ES2A 4LVOP 5A2QO 3I0SA 1N33F 1SUQA 2AF6A 5G0RB 5E2QA 1S1TA 1IBKF 1CS4A 3WIVA 1SPBP 3AO5A 1MWQA 3HHLA 2G0CA 4B3MJ 1FEEA 4HWIA 2MSTA 1JXVA 3HFVA 1IJFB 2G8IA 3FCVA 3IFEA 4GKJJ 1M5HA 4FKYA 4DV1K 3CTRA 2ITMA 5J2NB 3DLLQ 1VRUA 4BG9A 2O5DA 3MEDA 5KT3A 3WEEB 2IRYA 5AE2A 1AROP 2FSKA 3ALYA 3PNIA 3W3DA 1N5TA 1BQMA 4HI1A 3PTWA 2E1AA 4KE5A 2ZJQL 1M5SA 3IGVA 2OAUA 5AJ3J 4DTUA 4CW7B 1HNVB 1I51B 3RW6A 2YH0A 1BCOA 3CXCR 3H90A 1FKPA 2WTFA 1NCLA 3IAS9 3EPGA 2FD2A 5K20B 2W2MP 3CCSS 3KDOA 3C6UB 4OPJA 3TNVA 3RB0A 3HCXA 4HCCA 2PBDA 3BEXA 4W5RA 1VQKN 2KW4A 2P5GA 2GELA 3T1HJ 2NXEA 3VAIA 2MKIA 1KVBA 2FSJA 4DN0A 3ENQA 1R59O 2KVIA 3LP1B 3LOUA 3RBDA 3P6YC 1NGDA 5C7PA 2E2PA 2KYXA 4TY8A 4XDCA 3CCES 1MW7A 4H0YB 1SBRA 2MLZA 3N6NA 1VQMS 1TL1A 3QICA 4DR1J 2IVOA 4DHYA 3GONA 5K5MA 1YITS 1REVA 4J37A 3SCKE 4KPYA 1U02A 5C2FA 3MN5A 1F6TA 2GJ2A 3U9ZA 2ZDPA 3FBEA 1CJTB 3NH0A 2O8FA 2G8HA 4BHQA 3QPIA 4ECXA 3DLJA 4K0KF 1D9AA 4FYVB 2IM2A 4L76A 4BRPA 4CEDA 3CM6A 5D3GA 3WZ0A 3C94A 3IRXA 4K8XA 4OGCA 4E7KA 3QIPB 1EB0A 3WNHA 1JCGA 1KAZA 3VEZA 3SQGB 3V4IA 4P2MA 4LF5F 3DLGA 1FKOB 2WOMA 2RN2A 2Z2ZA 5D4LA 1DEJA 3OR2A 1F9FA 5B7WA 4LF6K 1HWUA 1R0AB 3BQ0A 3NE6A 2YKMB 1HNWJ 4YR0A 2I38A 3AQPA 2LLZA 3CCJS 1TL5A 4MIWA 4C98A 2AMCB 3ZZTA 2BMBA 3HXMA 4O4GB 4LFAF 5CYQA 1HBOB 1YXQA 4C1NI 3LDQA 1WSIA 3SUPA 3VQTA 1K44A 5AQYA 5L1IA 3PJXA 5CY4A 2VUGA 2V2ZA 4IJAA 2FBXA 4TKTA 2M88A 4JI6F 3TARA 1F9EB 2EFOA 4DV3J 2FJDB 3G87A 1F2GA 4CERA 3CJTA 5DM6Q 2VGMA 3T5LA 2G8VA 1JXLA 1SZ2A 3KYLA 5JUMA 3QRPA 2FVCA 3FZFA 2UXBJ 2FVRA 2QMWA 3D1OA 5KFHA 1ZPWX 2MGZA 5K8MA 1HKGA 1P8ZA 4GVEA 2LCWA 3HOSA 2EG2A 4M3UA 4YY3F 3NRBA 4RWXA 4X4NA 1F21A 2O8CB 1TL4A 2HVZA 2ZDOA 2Q1LA 5EOYA 1T3NA 3PJ9A 3I9V9 1NDCA 4ZPDA 5KFIA 1WG4A 5DO2A 4U8YA 5KAKA 2GX9A 1QSYA 1X0PA 2F65A 1WORA 1S77D 2QWOA 4A8OA 1YTYA 4P2FA 4FJ5A 1HMVA 5JVGL 4H4KA 4CTAB 4M3ZA 4K2JA 4F04B 4JI3J 3GILA 3W0LA 3P49B 2Q6BA 4FJMA 1RACB 1CJUA 3UFCX 3VQAA 2YH1A 3FK4A 2AA4A 4FJIA 4CGIA 4MKAA 2DEJA 3LANA 2FJVA 2W4CA 3D6FB 2EXUA 1GXTA 4ZP6A 4YOVA 2YJEA 2BQRA 2CGKA 1TUYA 2VG6B 3DRSA 1LK7A 1RILA 3KHRA 4MH8A 1EXQA 4F3OA 1U0HB 3HHDA 1UVKA 4I2QA 2XMWA 4DSEA 2VDIA 4W90B 1KWMA 3GZ7A 1IKWB 2B9EA 1BCMA 1ACMB 5JMNA 1RQ0A 4Y2KA 3ASMA 2NRRA 3ENOA 4CJRA 4B3OB 4WFNQ 3HF5A 3JXOA 3VGVA 5CYMA 2RB7A 4ZPTR 2IIRA 1S6QA 3DGPA 4QWAA 2K3IA 1JLBA 5J2MA 3OFHA 1VSIA 2X7IA 5H1SQ 2F40A 3DXKA 2ROGA 2A10A 4YOEA 1EKEA 3ZSXA 2C2NA 4HT5A 5AFUA 4WYWA 1S1UA 2RAQA 4LD0A 2UUWA 1G1XA 1D0EA 4CJEA 3BYRA 2P1JA 3EY1A 4CLPA 2KXFA 4V19J 2Z1HA 1UEKA 3H40A 2PYJA 5D4PA 3HVWA 4K5SA 3T69A 2E5LJ 1ATNA 3RGIA 5A0YB 1RDBA 1HNIB 3VAHA 1XMOJ 5AZIB 2B4PA 4F0HA 1E3MA 4USHA 2QA4S 3ZEUB 2JVOA 2HK2A 1XIQA 4NRUA 4DBQA 2ASPA 4FJJA 2QMXA 1BHNA 3OUYA 1M0SA 1NK4A 1P6TA 3CCRN 3CD6S 1RABB 1X3NA 4DPXA 2EKNA 4BRGA 2MLXA 4UZCA 4WE1B 3AA4A 4CF8A 4K0KK 2D0AA 2QYGA 3FNNA 4JP8A 1U26A 3NGSA 3SV3A 2IVMA 2YX4A 3BH6B 3W2VA 3V5RA 2AP6A 3PO4A 3FEXB 4IG3A 1VQ6N 4X4RA 1V4TA 4GNIA 1WHVA 3QO9B 1T05A 3EDQB 2VL1A 1W0HA 1Q7YT 1KLNA 1QM9A 5F0UA 2OH2A 1S5JA 1QUPA 2B6AA 4J8FA 2O8BB 2BEFA 4E0DA 3QRRA 1QQCA 3SCXA 4LRAA 4LFAK 3K5OA 3NMAA 5GAEU 5L38A 3O3FA 2VPXB 3SQOP 1BDGA 3MM6B 3OHBA 1CJVA 4CBUA 2XHBA 7FDRA 2BJEA 3NNCA 4IQXA 1URNA 2CQ2A 1A5VA 4JI6K 2WVEA 4HHTA 2R7YA 4PCQA 4JKGA 4Z4HA 3AVLA 5LMNJ 1OIAA 4QPTA 2B9WA 4O8KA 1TKZB 3MM7A 5DQHA 2VFRA 2UV8A 4DV2F 3LWLA 1UOCA 4IKFA 3EO3A 1XMBA 4IRKA 1S6PB 4NLTA 3E9OA 3FGVA 4HH0A 4DLGA 4QS7A 3GYXB 4ZPWR 5HQMA 1SKRA 3V9WA 2RF2A 4J9OA 4KIAA 2Q31A 5DMRA 3KHHA 2Y3YA 1VC5A 3N6MA 4AE5A 4ILMA 3NF9A 5HROA 1OO0B 2NLWA 2AGPA 2Y1JA 4LT6A 2UP1A 2IRXA 1CC8A 2V52B 1UJ4A 3FCWA 2GFFA 2KDOA 5KOXA 4EWTA 2UXCF 3K57A 1RLDA 3D2FA 2HMIA 1IG9A 2QV6A 1RHQB 4DPWA 1P8GA 1HBUA 4N77A 4FPBA 2ATCB 4WF9Q 4B9MA 2LQBA 3MMBA 1S99A 2DNKA 4YOYA 4KV8B 4K4TA 1FERA 3JXUA 2A1RA 5HATA 5GAHI 1RFQA 5EU7A 3M8RA 1Q1KA 2W7AA 4JV2A 4DL5A 4ZVSB 2BA9A 1TV6A 2RS2A 4OX9J 4RW9A 3F44A 2RDDA 3V9ZA 3DXMB 4CLUA 2OPSA 4J9QA 2HVIA 3KK3B 4PQUB 2ZZTA 3PM9A 3D68A 4TLRA 5LJWA 4G65A 1BIUA 1YTUA 3DHWC 3M9OB 2R7SA 1BA1A 4CLLA 4BR5A 3W8PA 5E0OA 1YIJS 4BRHA 5GAGP 4IR9A 3IMXA 5B8HA 1X4EA 1YDLA 3MCOA 4DV7J 4HACA 1J53A 4PG7A 1ITGA 4BDYA 2ZF5O 4CHPA 3L2UA 2Q0RA 3CF5Q 1VC0A 2VB6A 2IJRA 4M5IA 4WYLA 2OLWA 3IAYA 4IQMA 4C11A 1U2CA 2J6SA 9ATCB 4CJ7A 2B56A 3ZTQA 2OD6A 3KLHB 3HSTB 2VA2A 3L0QA 3G6EN 3CM5A 4DDFA 3UWTA 3VAMA 1OH6A 2QTWA 3O9QA 1U2FA 2CJ9A 3M6UA 5T7BA 2HHPA 1XHXA 3CQXA 1WUAA 1MWYA 1AXQA 2PEBA 4U7CA 3R1XA 4ES3A 4OX6A 2F9WA 4FJ7A 2YWHA 1QLNA 2IM3A 3CC4N 3DLEA 2XMMA 1JLAA 4M3RA 4DF8A 5GADI 1NG9A 1YJVA 1PYSB 4RW8A 1Q7LB 4XH5A 2BGGA 3ZT3A 2F8SA 4M3WA 2RRAA 3MUMP 1V3ZA 4XK8C 5KQ8A 1HYVA 4KREA 2XYPB 1H72C 3MM8B 4G1PA 1JL1A 2YVSA 3R5BA 1VJQA 1RWNB 2IVFB 4UQGA 2VKZG 4F0KA 3ZTRA 2X78A 3AGKA 2GMLA 2F9JA 2RRBA 4ZMMA 4ETZA 2N4DA 4NCGA 1T94A 2IVNA 4JRQA 3IFRA 1TU0B 4X66J 1N34F 5GINA 2JEFA 1X4CA 5LXYA 3LO3A 3VF0B 3AXKA 1DQ9A 2JWLA 3V6JA 1CJKA 1FTCA 3VQ8A 4U8VA 1WHYA 2MSSA 1VHIA 2NZ4A 4KI4A 4OX8A 1HNXJ 4AHTA 4MYTA 3U3GA 4FWKA 3OVNA 2E9TA 3D3BJ 4JI8F 4AHCA 2IOCA 4ED0A 1J5OA 4KHNA 2XSFA 2KQ2A 2NPFA 1RBLA 3CYMA 1WEYA 1F2HA 3E01A 4DL6A 1B0PA 1OY6A 3UR0A 2JWKA 4FJHA 1U2VB 3VCDA 4OJGA 4A8QA 4PXBA 4WZQA 1RBVA 3VMFB 2QO3A 1HKAA 1AFJA 1T9VA 2HAFA 3ETOA 3ZZRA 3JTOA 3BGLA 4QU7A 1NPPA 4DL3A 2PFFB 3P4UB 3DM2B 1RAEB 1UZDA 3NOGA 3AO1A 2I1RA 5F8NA 4DTMA 3MMAA 1WOOA 3O1BA 2R7WA 1NGAA 2HF4A 2PT0A 4DV2K 4YB6A 1XC3A 1IKYA 2ZWPA 1U1LA 2DR8A 4MFBB 1N36F 2XO6A 1RCOB 3CCVN 4R8UB 2KKHA 3KLEB 2L08A 1IJEB 2HZAA 5FDLA 5JLHA 4JI1F 2XBPA 4MTPA 4B3RF 3W65A 2VD3A 3W9IA 3VA0A 4RW4A 2IAJA 2OMOA 3I55S 1X1PA 4QIVA 2ACYA 3OYDA 2VG7B 2E1YA 1UP1A 3MPWA 4YN3B 2UXDF 3HHNB 4MQ3A 4C8MA 2DCLA 3IGNA 3MN7A 2D69A 1OYDA 1Q82O 1Z4UA 1RHUB 5D15A 4XTTA 4LF8F 1MU2A 1KDNA 1ZAWA 3R3LA 4C8KA 2W42A 1X5SA 1WC1A 2BJ7A 3TAFA 4A59A 3BGRA 4B8AB 1JLCB 2I7PA 2XRIA 4P52A 4LF9F 1Q86O 4LSNA 1EETA 1NLKL 2GQCA 4BQLA 3DJCA 3NGYA 1XC9A 1RYSA 1DFDA 4NXMJ 2RJZA 1FWKA 1YJRA 1OQ3A 4ZLPA 3M8WA 4HHJA 2XCAA 2XWXA 1KQSM 4I69A 3RMBA 2QI2A 2JH3A 3R9LA 3KHYA 1RA6A 2DHXA 3GJTB 3S7RA 1HQ2A 3Q0AA 1MWKA 1JJ4A 2OD4A 4HTIA 4C97A 4KHPF 5AQRA 1IBCB 1T3VA 4ANCA 3H8YA 2CVIA 1KHWA 2HFOA 3P38A 3CW2C 3QDKA 4NLCA 1UWBA 1QAYA 2FY1A 1FRIA 3NXZA 1HJRA 5IWAJ 1HPZA 4XO0A 2CJAA 3AOBA 4P9SA 4KH0B 4MDBA 1OWXA 2RDIA 3GU0A 5A8KA 5AQOA 5SWMA 4NLPA 2DFFA 4ID1A 7FD1A 5M1KA 3D0PA 4G3IA 1D4XA 4ECQA 1HQEA 5JS2A 1CLFA 3MMCB 4OJRA 3HLUA 4I2PA 2CDQA 3OYHA 4HTUA 3H4DA 3Q86A 4RNMA 1NK6A 4WFAL 3DOLA 4K25A 1RT3B 1NJZA 3S9HA 3CJQA 2JDJA 3CCSN 2EI5A 1TTHB 2RMLA 2Z30B 4KO0B 1VJWA 3UO0A 5FLXO 3SCIE 4BR4A 4I67A 2FF6A 4ECSA 4R25A 2OUGA 2J7KA 4BRAA 3N0VA 4M63A 1SJ3P 1VQPN 4GY2B 1TAUA 2Y8YA 3DU5A 1UVLA 3ISZA 3CCEN 4CEEA 2GTDA 3UVJB 4DV6K 3G82B 3GJRB 5RUBA 3VGLA 5EGYA 3EGVA 3D5MA 1N34K 2PA8D 4U7UK 3BQ2A 4ID5B 2E6MA 1LW0A 3CIZA 1TK0A 4HL9A 3FZ2A 1AT1B 4HH1A 1BXNA 1ULRA 3CCLS 3KLGB 3DHXA 2F3JA 4J5OA 4C0OC 3O6QA 1RTDA 1ZM2A 3I5AA 4JI8K 1S3XA 1FO1A 2E20A 1VC6A 2XI3A 3TAPA 5LSOA 4ZJOA 3RAMA 4DMZA 3Q8SB 3TAEA 2A2DA 2HWHA 3GG4A 3MM9B 4JHDB 4U9RA 1A5XA 1Q8IA 2V4JA 5FROA 3TTDA 4LQ3A 2XMJA 2KJVA 2BH1A 3ZCMA 2BVZA 1D5AA 4JI7F 2HVDA 4IEIA 1RT4A 3LP0B 3CCMS 4DL2A 3T6JA 2ZWHA 2Q0UA 1NPKA 2E66A 5KPZA 4QJVA 3MR6A 3MN6A 2X6SA 3C15A 3Q8PB 1TL7A 2KLAA 3CFOA 1KAXA 1CSJA 1JL2A 3KKSA 1UAWA 1RT7A 3M8SA 2ZOMA 3O4WA 4A8WA 1S0OA 2HHVA 4CJ3A 5TKYA 2QL9B 2FHJA 4LR7A 5TKWA 1N36K 1TMJA 1YWXA 5KFSA 3V1RA 2FDNA 2AP1A 2Z2MA 1N8RT 4H4MA 4JI1K 1RT6B 3NGUA 1R7IA 1NB7A 2KN4A 4B3RK 3VVTA 2NSCA 2G0JA 2P9CA 3ZXWA 2WCXA 1K6YA 2P9IA 3AY0A 1NPRA 3UDCA 1HNZF 4GV9A 1VCTA 2XNQA 2BW2A 1RBRA 3K2PA 3Q2TC 1WG1A 4AHUA 2OCEA 1GQEA 4CK2A 2R2UA 2EK6A 4TLQA 4YORA 4ZP8A 3A1YG 4MDAA 1PIEA 4DV4J 3G4SS 3MURP 5HL7Q 4DG1A 4L72B 4OYZA 2VWJA 5E3AA 3R2CJ 2DRBA 4CJ4A 1P9YA 1REGX 4EAHD 4EGLA 2I0XA 4HT7A 3DDKA 4LF8K 4EBDA 4IDKB 2XYGB 3CJ8A 2FUG9 3BBCA 2XSJA 3AODA 4LVNP 4CGGA 2VQFJ 2M3DA