5I42A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer, azttp, and ca(2+) ion
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
total genus 141
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i42A05
2OYQA 1KVBA 1SH2A 3KLEB 2DY4A 4I9QA 3G0ZA 3ZSXA 5KFHA 2Z1JA 1T3NA 3DRRB 4F4YA 4NYFA 1D0EA 2OPRB 1I3AA 1LV5A 3QIPA 4O3OA 4CF9A 4Z4CA 3IGVA 3E51A 2Z1HA 3NF6A 2D0CA 4EZ6A 1S1WA 4HUEA 2E9RX 5KG1A 2XO7A 1L3UA 2HWHA 4H54A 3M8SA 4MKAA 1HMVB 1KVCA 1T05A 4DLEA 4CK2A 2GC8A 2ITGA 4YR2A 2VG6B 3IG1A 3SFGA 4ED0A 4ZPCA 3VQAA 3ZSVA 3TAQA 4HVJA 2ATLA 1KTQA 3MXMA 2V4RA 3VQPA 4B9TA 4J2AA 3TAMB 1JLQA 3KHHA 3IAYA 3OLAA 4R8UB 2IAJA 1VSMA 3ULDA 3CJ2A 4QPXA 4KHYA 4I2QA 1KHWA 3QINA 2RKIA 5DQIA 1RT6B 2HAIA 2V0NA 2XY8A 3THVA 3RB4A 5KGXA 3H40A 3VQ9A 5KTQA 3NGYA 1S1TA 1RT3A 4YQWA 2BANA 3MAQA 5HRSA 3MFHA 3NBPB 3Q8PB 3DOLA 5JS1A 1VSIA 1TKTA 4DL4A 5HRPA 1C0TA 4K4YA 4K4SA 3NGDA 4DTPA 2KTQA 3SQ2A 4RNOA 2HNZB 1VSFA 2C2RA 4IRCA 3O3HA 2J6SA 4FLYA 3H5YA 4CJLA 4BDYA 4FJJA 4KFBB 2B4JA 2W7OA 3NF7A 5FRNA 3DMJB 4KPYA 2YNFB 1EP4A 3GILA 5EDWA 5JXSA 1RT4A 3L2RA 3DDKA 2O5DA 4B3OA 3OYAA 1S6PA 4KKOA 4XPCA 4GMJB 5HROB 1RBSA 1K1SA 4DU4A 4ID5A 3D0PA 5J2NB 4CFAA 4CJSA 2NUBA 1UA0A 4FJ5A 3SNNA 1DLOA 4RW8A 3OYNA 4ECVA 4CHPA 4HCCA 4EYHB 4FLWA 3S3NA 1DTTB 3PUFA 4CJRA 4ED7A 4JV1A 4FBUA 4Y3CA 4ECZA 1NK7A 3QLHA 1J5OB 3KKRA 1B9FA 3KK2B 3O4NA 1CSJA 4IH5A 1WSEA 4CHZA 3AVNA 3DLEA 1SKRA 3CM5A 5I42B 5CZ1A 4JLHA 2I5JA 5CY4A 2XRIA 5DQGA 2E6MA 4NLPA 2A1SA 4EBDA 4DL3A 3OYDA 1TKXA 2OZMA 1XHXA 3DI6B 4ECWA 1Z4UA 4CF0A 3KK1A 4ID1A 1S1XB 3ZCMA 1HNVB 3GYNA 3Q8SB 4CJTA 1SL1A 3QZ7A 3MR6A 3OS1A 3HXMA 3EPIA 4CGDA 4DSIA 4E7LA 3DYAB 3O4QA 3VQSA 3AO2A 2OPPB 2DFHA 3NL0A 2ZE2A 3QIPB 2KQ2A 4E7IA 1BCOA 4BACA 1LAVA 3OYEA 1O1WA 1RYSA 4EP5A 5HP1A 3S9HA 1NK6A 5J2MA 1ZBLA 2IOCA 3OHBA 3L8BA 3MEDB 1BQNB 4F50A 4MIBA 4JV2A 1QSYA 3KJVA 1TAQA 3SV4A 1T05B 4WZMA 4KB0A 2XCAA 3TQ1A 4CGJA 2YKNB 2QXFA 5J2PA 1HYZA 4AHVA 1KLNA 4DTXA 3PX6A 3V6DB 2UVRA 5KG6A 1X9MA 1D8YA 3QNNA 3KKSA 1VRUA 1ZYQA 1CZ9A 2BRKA 2DFEA 4HCBA 3ITHB 3C95A 4X2BA 1JLEA 5L1IA 4K4TA 2HVIA 2G8KA 3ASMA 3LZIA 4OLAA 2WHOA 1R0AB 3SQ1A 2QV6A 4EO8A 4LD0A 4ZP8A 4M45A 2B6AA 1NJYA 3RB3A 5C25B 3B6OA 4GC7A 1S1TB 4TXSA 2R2UA 2YHBA 3CJ0A 4IR9A 3BDPA 4ZVHA 5HRNA 4O3SA 1SH3A 1REVA 3DOLB 3C6UB 1HPZA 3CDEA 1S1UB 1TKTB 3Q8QB 2O4GA 3DLGA 1JLCA 5KFYA 4FBTA 2P51A 2YNIA 4FS1A 4NLYA 4FS2A 1A5VA 2OPQA 3ZSRA 4RNFA 3ZT3A 3OSNA 4PUOA 3FRZA 2F8SA 4NLVA 3MEEB 5KFIA 5KFSA 5KFQA 4MK7A 3OS0A 4M3UA 4Z4IA 1B92A 1RBTA 1RT4B 4WYWA 1WAFA 4CHOA 4K4ZA 4CIEA 3BSAA 1WLJA 2PYLA 3NAEA 3QERA 4DFMA 3U6FA 4EEYA 1DTQA 5KFRA 1DLOB 3RR8A 4RW8B 1RTHA 1RILA 1LWEA 1RT2B 1MMLA 2EX3A 4IG0A 5C24A 4DTMA 1FK9A 3VQBA 2IC3A 1BI4A 4KB7A 3QLHB 1ASUA 2W8KA 2ZKUA 2HNDA 4J9LA 3RAQA 1RAJA 1NHUA 2HHWA 2KZZA 2XY7A 4CJPA 3DLEB 4K50A 2G8IA 1K6YA 2AGOA 4E19A 3MR2A 1WAJA 4LQ9A 1FKOA 2I5JB 5KFXA 1GOAA 4M42A 4H4MA 3HKWA 2O4IA 4DSLA 3KD5E 5DQHA 3KLHA 4CF1A 1HQEA 4NYNA 3T1AA 4IH6A 3KK1B 4MK8A 4MFBB 4IFYA 4B8CA 4O3QA 4OJRA 4FJNA 1UWBB 3PZPA 4DTOA 1JIHA 3CM6A 3QO9A 1HQUB 4LQ3A 3V9XA 2X74A 4OL8A 2ZE2B 4DWIA 4M3XA 4OKEA 2WONB 1RDDA 3L3UA 1SV5B 4O3PA 3PW2A 3LPTA 3QEIA 2JEJA 5KT6A 5E41A 2WB4A 3QZ8A 3BQ1A 3RMBA 5KFKA 1G15A 1L3TA 4FJ9A 4MH8A 4HKQA 2WCXA 1T7PA 3OHAA 3TARA 1S1VA 2YKMB 1TVRB 3RBEA 3DLHA 5KG2A 2P5OA 5DG9A 1QSSA 2WTFA 1VSLA 3U3YA 4FJMA 1U09A 2E9ZA 1IH7A 5SZTA 4ECSA 4ZPBA 4TLRA 1VRUB 3MF5A 5FDLA 3IGNA 4CECA 3BGRB 4BWMA 1S6QA 1JLEB 4KI4A 3LWLA 3CFPA 2AJQA 5F8JA 3KK3B 1S48A 4DMNA 5KFUA 5F8HA 5I3UA 3D28A 2B6AB 2C2DA 1HARA 5KFJA 1N4LA 2ASJA 4R5PA 3SJJA 2Y1JA 3LP3A 3AA3A 4M3ZA 4CEBA 1Y97A 3BR9A 3D45A 1C0UA 5J2QB 3G6VA 4OGEA 1REVB 1HPZB 2AX1A 2P1JA 1D9FA 3VQ7A 1HYSB 4CIGA 3MECB 1N56A 2YNIB 4J2BA 4Q0BA 3CDWA 1J9AA 1ZBUA 3HP6A 3HVRA 2OPQB 2WK4A 3SZ2A 1KSPA 4F2RA 4PUOB 2HWIA 4FLUA 3ZT1A 4B9UA 4TQSA 1QUVA 5KFEA 4F4XA 4DLGA 1C1BB 1W25A 4F4ZA 4IR1A 4DS5A 3AVBA 4XPEA 1YVUA 4Z4FA 3DRPA 4CF8A 4C8MA 3RMCA 3TANA 1QSLA 4O55A 5KT4A 3IN5A 3JSMA 1BGXT 3H4BA 3UQSA 2R2SA 2ZD1A 4FVMA 3CO9A 3RRHA 1S10A 4DF8A 3OYHA 1DTQB 4H4OA 1A5WA 4N5SA 1RTHB 4GVMA 4YFUA 1LWEB 4IG0B 3G86A 1D1UA 1ZETA 4FJIA 2IC3B 3OY9A 2BQRA 1T94A 1WNEA 3PW7A 1U4BA 3LP0A 1RCHA 1NKEA 1SUQA 3C94A 4QAGA 2HW3A 1FKOB 1RT5B 1RDRA 4CJFA 4H4MB 3OJSA 4RW4A 5EWFA 3T5KA 4ELUA 3VQ6A 2OPSA 4WFXA 3CFRA 1NNDA 3RMAA 4JRPA 5KFCA 4ZP7A 3BREA 5K14B 4QWDA 3OYMA 1CXQA 4FK4A 4NLSA 4U6PA 4CHNA 3LAKA 1BHLA 3HSTB 3QO9B 3DRSB 2V4QA 1XHZA 4C8LA 3C6TB 3ZT4A 3K5NA 4ED8A 2HNYA 2VWJA 1RTIA 2BDPA 3M9NB 1NJZA 5HBMA 4FZYA 4KAZA 4FK2A 1RBUA 5EWGA 4CGIA 4IG3B 3QYYA 5KFPA 3CJ3A 3VQCA 1TP7A 3UDLA 1KFSA 1IKYA 4PA1A 4IRDA 5KT5A 4ED2A 2IMWP 3NE6A 1N6QB 1RT1A 4LSNA 2FLLA 4N41A 2IM0A 3I5BA 3HP9A 1S1VB 1QHTA 2XGQA 4KV8A 3DLBA 3BJYA 3TR8A 3CJ4A 1C2PA 2BE2B 4LH4A 3LP2B 1ZTWA 2QE5A 1TAUA 4Y1DA 4C8NA 4O44B 5L9XA 3AVIA 3OS2A 5FDLB 1JKHA 4ZTFA 4E1NA 4DFKA 4M3RA 1S0OA 2R8HA 1RTJA 3SI6A 4NCGB 3U3GA 1XR7A 1IO2A 3LAMA 1U45A 5DMRA 2GUIA 3ZT2A 3GQCA 4IFVB 4KO0B 3AO3A 4R5PB 2W7PA 4OPKA 4CHYA 1U04A 3V9ZA 5JS2A 4E0DA 1C0UB 4HUGA 5KFBA 4OKKA 2R8JA 2KZMA 1RDCA 1KRPA 3OYCA 1UOCA 4NCAA 1QE1A 2UUWA 4WE1A 3EYZA 4Q0BB 3OL7A 1RT7B 4IDKA 1MU2A 1JXLA 4DSJA 5HLFB 4CJEA 2C22A 1ASVA 3SPYA 4B9MA 5KT2A 2E6LA 3IS9A 3VA3A 3GIMA 3DOKA 3E01B 3HPGA 4FJGA 3EZUA 4PWDA 3JSMB 4O4GA 4TY8B 4ECRA 3AVJA 4B9SA 4FM1A 5CYQA 4QW8A 2R8IA 3H08A 3M8QA 2E9TA 4H4OB 2HHQA 4O5BA 3OJUA 3AVFA 3MXJA 3K5MA 2AX0A 4BE1A 2GBZA 2UVUA 4O0IA 4RUCA 1FKPA 3QGIA 4NLXA 3NF8A 4CJQA 4ED1A 3OYKA 4ECYA 4MIAA 3LP0B 3V1OA 4E1MA 2JC1A 4DQRA 2V9WA 4FM0A 3SYZA 1NKCA 3N6LA 5KFOA 2FLNA 4RW4B 4YMEA 4K4UA 4CGHA 4CJVA 1VSKA 1JLGB 1LWCB 1TKZB 4ECQA 3K5OA 2XY6A 3WNFA 4W5OA 1TL3A 3LDSA 3TAGA 2JC0A 2VG5A 3DM2B 5F8IA 1W0HA 3T5HA 1NOZA 3OL9A 3NFAA 5CYMA 3AO4A 2HNYB 4FM2A 2ZQBA 2R2RA 2ASDA 4IH7A 3DLRA 4ELTA 4I7FA 4E7KA 5KI6A 3I0RA 2J6TA 5F8NA 3AA5X 1S4FA 1S1WB 4O3NA 4DL6A 4W5RA 2YNGA 3TAFA 2QKBA 4Q8FA 4WXOA 2UVWA 4KV8B 3V9UA 3PHEA 2Y1IA 2OZSA 4DSEA 5EUHA 1ZBFA 3IG1B 3HYFA 2IA6A 5KFTA 4HHTA 2G8UA 4ECTA 4KHQA 1TL1A 5DLGA 2VG7A 4Y1CA 3Q8RB 3TI0A 2JEGA 4NZ0A 4DSKA 4EYIB 1JLQB 2FLPA 4KI6A 4DQSA 4WFYA 4QWAA 4WZQA 3T3FA 2IAJB 4CEQA 4LSLA 2G8VA 3GIKA 4M95A 1S9EA 2DPJA 1BIUA 4CEAA 4I2QB 1I6JA 4KHMA 2RKIB 5FROA 3HVTA 2W9BA 3MEGA 2RF2A 4TSXA 3NGZA 1EETA 3K5LA 5KFVA 2XY5A 1NK5A 4CEFA 3LP1A 4DFJA 3ISND 5KT3A 1RT3B 2BANB 4CFDA 2FJVA 5KFLA 1RDBA 2P5GA 2DFFA 3JYTA 1JLFA 3PR4A 1C0TB 2ATQA 4B9LA 1MU2B 4KTZA 3V6HA 3T5JA 2D7SA 4B8AB 3CQ8A 1CLQA 1KHVA 3VQQA 3VQ4A 1L3VA 1EP4B 4OPJA 1TK5A 4O4GB 4ICLA 3IRXA 2W9AA 5CYQB 4B3OB 4Q45A 1S6PB 4KKOB 2IBKA 3CDUA 3M8QB 3B6PA 4ID5B 1ZTTA 1S5JA 5KG3A 2QKKA 3CJ5A 4F3TA 4W5QA 3BSNA 2HMIA 3T19A 2FBTA 4B9VA 1FKPB 2VWKA 3F73A 2ILZA 3ALYA 3QNOA 1HNIA 4FJHA 4K4VA 2GIRA 2YNHA 1YTUA 3UPFA 1T03A 3SUOA 1EX4A 3I5CA 4RW9A 1IKXA 3BSOA 4CK1A 1LW2A 3AVKA 4YP3A 4J9PA 3HPOA 2FVRA 4DQIA 4CGFA 3I0SA 4MQ3A 4FZZA 4TYAA 1S9GA 4O0JA 3BQ2A 1GOBA 2BQUA 1IKWA 3L2QA 4F4WA 4CEZA 3KLIA 4CJ5A 1TL3B 1TKXB 4TQRA 4FLXA 3EY1A 2VG5B 1XR5A 4CIFA 5KG0A 4AHSA 4FYDA 1VRTA 2GIQA 3TVKA 3QESA 2FVQA 4ZHRA 1NHVA 4PQUA 2B43A 2IM3A 5CZ2A 4FCYA 4EO6A 4I7FB 4FXDA 1VK0A 4B08A 4FJ8A 3QEPA 3I0RB 4FJLA 3V9WA 1X9WA 5HP1B 5KFFA 5J2MB 3PVXA 3OYLA 3KLEA 3CIZA 4KHRA 4BDPA 5KFWA 3KJVB 1RTDA 1WSGA 3NGIA 3NAIA 2X6SA 1HYVA 2G8FA 3SQ0A 3DRRA 4UQGA 5J2PB 2OPRA 4WXWA 3NCIA 4M3YA 2HHTA 4N56A 4QWCA 2VG7B 2R7YA 1NJWA 2YV0X 2RPIA 2FJXA 3G6XA 4J2DA 1J53A 2LSNA 3M8PA 2YHAA 1HMVA 3HVAA 2D0BA 3RAXA 3FDSA 1TQLA 4Q44A 3GV5B 1BCMA 2W9BB 2FVPA 1EKEA 2RF2B 4DQPA 5KFGA 4KHWA 2AQ4A 2HVHA 2D0AA 2EC0A 2JLEA 3BQ0A 3P1GA 3LP1B 5KRSA 3KNAA 4CJ4A 3SUQA 4R8UA 1NJXA 4URSA 2KFZA 2AGQA 3OSPA 4K4XA 3VQ8A 3JYTB 4J9SA 2BGGA 3FSIA 1LWFA 1RT6A 1JLCB 3DLGB 4C8KA 2J6UA 2VA2A 1BIZA 2QK9A 3HVWA 4ED3A 3PY8A 2IM1A 4TN2A 1U48A 1NK8A 3N6MA 4CEDA 4CE9A 2XI3A 3PV8A 1NKBA 1IM4A 3NBPA 5KG5A 3M9OB 4J9MA 1C1AA 2BQ3A 4DFPA 2F96A 4KE5A 4RNMA 4CJ3A 3K58A 2HNZA 4RNNA 4G3IA 5DK5A 3PX0A 3DMJA 2YNFA 2C2EA 3MR5A 5C24B 2YNHB 1FK9B 2I1RA 4K4WA 4RW9B 1RA7A 2F8TA 1IKXB 1BI4B 4KRFA 3UR0A 5HROA 3LANA 2ASLA 2HNDB 1JLBA 4DEZA 5J2NA 4J2EA 2CJQA 4KHUA 1WSHA 4E7JA 1C0MA 2W8LA 4L8RB 3GV7B 1FXXA 2PYJA 4FW1A 4QCLA 3FQKA 4IOBA 2JEIA 2W9CA 3AVMA 3SQ4A 3KLHB 3NHGA 4M94A 4J9NA 1HQEB 4Q5VA 1J5OA 4NLGA 3AVGA 3NKYA 3OVNA 4TYBA 3K59A 3KK2A 4IFYB 2XCPA 3AV9A 1ZBIA 3RTVA 4ELVA 3NAHA 4ECXA 3AVLA 3L2VA 5I42A 1GOCA 4DTUA 4PQUB 5KRTA 4Y34A 1VSHA 3D5MA 2JEFA 2FJWA 2G8HA 5HRRA 4JRQA 3AA2A 3SUNA 1IKVA 4DG1A 2UVVA 2BR0A 1JL2A 3DI6A 3V4IA 2CKWA 1S1XA 4QW9A 1NK0A 1HNVA 4DTSA 5KGWA 4QOZB 2FVSA 5F9NA 4WYLA 4CCHA 2WRMA 1RTDB 3M9MB 2G8WA 1WSJA 3OYFA 4CF2A 3DYAA 4NYZA 1U47A 2OPPA 4AHUA 5DGBA 1KCFA 3O3FA 3VQ5A 4LY7A 5C42A 3HM9A 3LALA 4JS5A 3WNGA 1TK8A 3H5XA 4RW6A 3VQDA 4N47A 1YTAA 3MEDA 1BQNA 3M8PB 3V6JA 1ZBHA 4W5NA 1VSEA 3OYJA 1S6QB 2YKNA 3PX4A 3QEXA 3CFOA 4RUAA 3GV8B 4IKAA 3V6DA 4FJKA 3AA4A 4FJXA 5FRMA 3HPHA 3H98A 3QGHA 5I3UB 1XR6A 1KFDA 1Q8IA 1QAJA 4IQXA 1UA1A 2D3UA 1D9DA 4IKFA 3S3OA 2EHGA 3ITHA 4H8KA 5C5JA 5EU7A 1X1PA 1L3SA 1LWFB 5DG8A 3PW4A 4Z4EA 1R0AA 3SCXA 1XWLA 5F8LA 4RU9A 3H59A 5KG4A 1GX5A 2HHXA 5C25A 1XI1A 3KD1E 4NLRA 4FK0A 4YR3A 4HYKA 3DRPB 1YT3A 4KBIA 3C6UA 3RBDA 3PJWA 1S1UA 4ZVGA 3PW0A 2WOMA 4QWBA 4G1QA 2ZD1B 2W42A 1S49A 4KTWA 4CHQA 1KVAA 4FJ7A 4BWJA 4KTQA 5JUMA 4DSFA 4DL5A 4CJUA 1NOYA 3MEEA 2Q3SA 3VQEA 1NK9A 4E89A 2RN2A 2RDIA 4ZVFA 4KHNA 4JS4A 3N6NA 1YVFA 4GW6A 1T8EA 4GC6A 3T5LA 1BQMA 2Z1GA 2GV9A 3ZSYA 1JLBB 2IS3A 1SUQB 4CFCA 3PJXA 1KLMA 3QEVA 4CEEA 3PR5B 3CG7A 2VA3A 2IJFA 3BSCA 3AVCA 3I8DA 4DL2A 1RT2A 2W9CB 3SUPA 3CWJA 2OPSB 2XWYA 4OKJA 4I2PA 2X78A 4Z4HA 3L2WA 1I39A 4NLOA 2KW4A 4B9NA 3AVHA 3RWUA 4LH5A 1K1QA 1XC9A 3HT3A 4BDZA 3H5UA 3F9KA 1S0NA 4J9OA 3KLFA 4KHSA 4I9LA 1RTIB 1QS4A 1IKVB 2B5JA 5HBMB 4DG1B 2IGIA 2AWZA 1BISA 3V4IB 2ETJA 4MFBA 1UAXA 4RNHA 4DQQA 4DU3A 3KMSA 1IKYB 4RG8A 1UWBA 1CXUA 1RT1B 4LSNB 1N48A 4F2SA 5D3GA 3M8RA 1SL0A 1HQUA 3HK2A 3TABA 3NH2A 4R0EA 2IJNA 2ILYA 5C42B 1SL2A 5EWEA 2WONA 4NLQA 1WNSA 1SV5A 4CERA 2X6NA 3KLGA 4RW6B 3RRGA 1JX4A 5KFAA 2UUTA 1JKHB 3LZJA 2YKMA 1TVRA 3EPGA 2E4LA 5KG7A 1RTJB 4EBEA 1LAWA 1OS5A 2HHUA 4AHRA 3GIJA 4C8OA 4Z4GA 4U7CA 1RNHA 5T14A 5L1LA 1D5AA 3V81A 3QGGA 3V1RA 3FFIA 3KMQA 3P5JA 4HTUA 5DLFA 2HB5A 4CGGA 3RB0A 2ALZA 3ISNC 1Q9XA 4F3OA 3BGRA 1SH0A 4KB1A 4URGA 3HJFA 4XO0A 3TAEA 1W9HA 4NLUA 1Q9YA 1WSIA 1QE1B 2DTUA 4WE1B 5F9LA 4ZPDA 4IDKB 3KK3A 3HO1A 5L1KA 4CJWA 3PO5A 3IS9B 5J2QA 5F8GA 3DOKB 3KTQA 4PWDB 1TV6A 4AH9A 2WOMB 3MXIA 3AO1A 1HYSA 4G1QB 2Z1IA 3MECA 3RMDA 4DF4A 3NDKA 3OYBA 3SFUA 3K57A 5KFNA 3PO4A 1N5YA 4O3RA 1JLAA 1Z26A 2D5RA 4NLTA 1C1BA 4IRKA 2F8EX 4RW7A 5L1JA 4CJKA 4O4RA 1C1CA 3KHRA 4FLTA 2FVCA 2XC9A 5T7BA 3KHGA 1BQMB 1HRHA 3KHLA 3NMAA 3NH1A 4FZXC 1RBVA 4QWEA 4CFBA 4DTJA 3SV3A 1KLMB 1J54A 3K2PA 4WFZA 3O3GA 4F4KA 4M41A 1LW0A 1QAIA 2C28A 4PY5A 3MTKA 4ED6A 4ZP6A 4Z0UA 4I2PB 4MKBA 1SKWA 4M3WA 4DS4A 4W5TA 1RDAA 1IG9A 3EZ5A 4J9RA 2AU0A 1L5UA 5KT7A 3SI8A 1TGOA 5J1EA 1F21A 1RT5A 3P83D 2A1RA 2OH2A 3KLFB 4DTRA 5CYMB 1EXQA 3MR3A 1CZBA 1SKSA 3OYGA 3QEWA 4KSEB 2B5JB 4CK3A 4OVLA 4XIUA 3DLKA 4K8XA 2AGPA 4OLBA 4J9QA 5K14A 2OA8A 3QETA 5DG7A 3TWHA 1B9DA 2YNGB 3V1QA 3DRSA 5D3GB 4ZTJA 3C6TA 4FLZA 3OL8A 1HJRA 3VN5A 4DU1A 4JV0A 2R2TA 3CVKA 3G6YA 1RYRA 2D41A 2RDJA 4CEOA 3AO5A 4IG3A 3RR7A 1TL1B 4NCBA 3KLGB 3H5SA 3KIOA 4DTNA 4JUZA 3LPUA 1C6VA 1N6QA 2PZSA 3LWMA 1GX6A 4NLDA 1BL3A 1JXEA 4LSLB 1S0MA 3NF9A 3ZSWA 1S9EB 2VG6A 2BE2A 3TAPA 3LP2A 3HVTB 1WN7A 3MEGB 3V81B 4CESA 4YNQA 3G10A 4O44A 4FW2A 1EETB 3FFIB 1QQCA 4F8RA 4ZP9A 3TAMA 4J9KA 4IBNA 2R8KA 3S3MA 4ZMMA 2PY5A 1S97A 3OYIA 1JL1A 3UIQA 3ICLA 4NCGA 1RBRA 4Q8EA 2JGUA 1JLFB 4N76A 2D3ZA 4IFVA 4KREA 3PW5A 4KO0A 3MFIA 4BE0A 3ZSZA 1TK0A 4M3TA 5KFDA 4YR0A 3HHKA 5KFMA 2R8GA 4NRTA 4FLVA 3GIIA 4AHTA 4EZ9A 4Y2AA 3CYMA 1TKDA 5KFZA 1Z25A 2XHBA 1TV6B 5DGAA 4ICLB 3WNEA 4EBCA 3IRXB 1ITGA 3H4DA 1RT7A 3ZSOA 4K8ZA 2DPIA 4OGCA 1U49A 3SPZA 1N5YB 1A5XA 5HLFA 3OL6A 1JLAB 1NK4A 2HMIB 1ASWA 3VA0A 4ECUA 4KFBA 4RW7B 3I5AA 4ZPAA 1C1CB 4RZRA 3E01A 1HNIB 4MK9A 2HHVA 4TY8A 1T03B 4AILC 3QIOA 2HHSA 1LW2B 4TY9A 3A2FA 3L3VA 1X9SA 3RB6A 2IDOA 5F8MA 4BE2A 4AHCA 3I0SB 1RA6A 3QIDA 1JXBA 2IM2A 4E3SA 1LW0B 1S9GB 3WNHA 3AVAA 3V9SA 1QTMA 1DTTA 3HL8A 2FBVA 1IKWB 4Y2CA 2BRLA 2KFNA 3KLVA 3NH0A 3KLIB 3ZT0A 2FC0A 3H2LA 4EP4A 3OLBA 5J1EB 1VSJA 2XGPA 5SWMA 1VRTB 4ZVEA 4ZHRB 4URQU 4E7HA 2FBXA 4DL7A 1JLGA 3L2UA 1WSFA 1LWCA 1TKZA 4KAIA 3ZSQA 3KOAA 3DLKB 4NRUA 4HUFA 4Q43A 3FQLA 4NLWA 2XI2A 2FBYA 1S9FA 3V6KA 3DM2A 1VSDA
chains in the Genus database with same CATH superfamily
1R7IA 3CJ9A 3EDQB 1SH2A 4I9QA 3UKRA 3G0ZA 3D6TB 1CVJA 4ENOA 1REGX 2DEJA 3SIPB 1T3NA 3DRRB 2DRBA 4UUXA 3A3NB 3FMWA 1HBMA 4Z4CA 3FCHA 3E51A 2D0CA 2HVDA 3BN4A 4HUEA 4IJAA 2E9RX 3H90A 3OTDA 4KRWA 2PFFB 3ZX2A 2Q1NA 1KVCA 4FF4A 4CK2A 4CZHA 4NPOA 3IG1A 4ED0A 3CCEN 2ZBPA 5BR8J 3IR5B 4ALZA 2UXBF 2EEYA 3D0HE 5CCLA 2ZM6J 5B7WA 3M2RB 2IAJA 2BABA 5K9FA 4KHYA 1BO5O 1QAXA 1KHWA 1T9UA 3OUYB 1RT6B 1PAEX 2LXFA 4J91A 4AM7A 1XMOK 2D1KA 2V0NA 3AJDA 4PWWA 5B0DA 3VAKA 2H48B 3RB4A 5KGXA 3BGLA 3NGYA 3CJ7A 1NDKA 1RT3A 3DXKA 2QGFB 2L9WA 3VENA 3MGJA 4DL4A 4OZNA 5HRPA 5BRHA 2N82B 3E9OA 3NGDA 4NXMK 4ZPTR 2ATCB 5FPDA 4DTPA 3IWNC 3PKMA 2LEAA 2HNZB 1SQGA 3QBCA 4IRCA 4FLYA 1VQON 3PIOQ 1OO0B 3D3BJ 2G4BA 3DMJB 3N01A 4E8UA 3GILA 1FCAA 1N36F 3DDKA 4LF2A 3KG1A 3OYAA 1S6PA 1K8AO 4CO0A 4CLFA 2W2NP 4DU4A 5IT9O 3NCPA 2QTDA 4WFAQ 4JI4K 1EO1A 3MMVA 3U1MA 3BN7A 4RW8A 4FLWA 2ZKTA 2M5YA 1X0FA 1VQ7N 2DHAA 4CJRA 2YHWA 2NRZA 4JV5K 2IIRA 3JB9k 4ECZA 3UD3P 1J5OB 3J7ZO 3KK2B 3W9IA 4UY8T 1CSJA 1WSEA 5IC4B 3AVNA 3DLEA 1DURA 1SKRA 3WZ0A 1FVSA 5GAEU 5I42B 2P9LB 4A2AA 1V9OA 5CY4A 2IDEA 1K73T 2XRIA 2DCUB 1PYTA 1FI4A 2OO4A 2OD6A 2Z4PA 3OXGA 2IFXA 2LXUA 3JSRA 2P9EA 3HD2A 5CYJA 3JTNA 2MLYA 2QMXA 2PO4A 1UWAA 1TL7B 1YRUA 2H4WB 2A1BA 1UMJA 3HI0A 2RHKA 2CXEA 2DFHA 3BPDA 2KQ2A 3QIPB 1U25A 2ZGZA 2O8DB 3FNNA 2F8MA 4LF4F 2B9YA 5HP1A 5LJ3Y 5J2MA 2IOCA 3L8BA 1D9AA 3VZIA 2DHXA 4ERDA 4MIBA 3KJVA 3S01A 2DYAA 3TQ1A 2L48A 3AXKA 4G1IA 2YKNB 2V2ZA 1HI8A 2QXFA 5J2PA 5HL7Q 1G4CA 4DZ6A 2VYPA 4LF7J 3AJ2A 3VAFA 2UVRA 2QFIA 5BRDA 1IBKK 1Y7PA 2EKYA 1ZYQA 4JD2B 3I4PA 1CZ9A 2BRKA 3P5BP 4NXNF 2DFEA 3G8QA 1P90A 3CDBA 2UV8G 3SCKE 2V8HA 4X2BA 2P9UA 1JLEA 4ZLJA 6FDRA 2G8KA 1AT1B 2ZHBA 4O5FA 3R2DJ 3SQ1A 2APOA 2QV6A 2KYXA 3OW2R 2WW8A 3PRDA 4M45A 2B6AA 3C66A 3RB3A 2F4VF 5AQSA 4TXSA 1SCJB 4LIRA 3BDPA 4ZVHA 1UKUA 2CQHA 2BOAA 4JKHA 1HPZA 3CJQA 5KFYA 2P51A 2YNIA 3IA0A 1A5VA 4LR8A 4BREA 3ZT3A 4RNFA 4PUOA 2F8SA 1NGBA 4B3MK 4MK7A 2DK2A 3H25A 2ROGA 2YX1A 1B0PA 2RH3A 1WB9A 1B92A 1IXKA 3NCQA 2GELA 2UP1A 3PNIA 2VL1A 2W6LA 3U02A 3M6GA 4K5RA 3VGMA 4A8KA 4YHHJ 3CJCA 3QERA 5E7OB 1DTQA 2IYGA 3N0VA 4NLCA 2DR6A 4X64K 3EGNA 3RUBL 3CCES 1NEEA 2H9ZA 4BRQA 2MEWA 1GMVA 4KB7A 5E3CA 2DNZA 4XAKA 5HJXA 4P52A 3RAQA 1RAJA 2A6AA 2KZZA 2DTJA 1I94K 3CDAA 1OY8A 3VQTA 1U6FA 1BY9A 1XNRJ 4LQ9A 3LH2S 4LRCA 1GOAA 4H4MA 3HKWA 2JLGA 3I9V9 1N52B 2VOPA 1WF1A 2ZUAA 3KLHA 4EHTA 2GQ2A 4IH6A 3KK1B 4LR9A 1NSQA 4B8CA 1ZOTA 4YY3J 4OJRA 1UWBB 2ZBCA 1QD1A 3KG4A 4DUZJ 4L72B 3MOZA 5DM7L 2HBQB 1UEUA 1IBMK 1JIHA 1YAGA 1YSJA 1HQUB 2UXCJ 2E5JA 3CCLN 2HWTA 1R6YA 2DGOA 4M5HA 3HOSA 4OKEA 3W7BA 5IV3A 3MMAA 5KT6A 3MDFA 3QZ8A 5HVHA 1KEKA 3RMBA 3NVMA 1KQGB 1SC3B 3TR5A 3FR0A 3RBEA 3BB5A 3ZZYA 3DLLL 5KG2A 2NXEA 3C7NA 2K06A 1LK7A 1QSSA 1U09A 2YWEA 3IAM9 2DNHA 4ZPBA 1WG4A 1IBCB 2ADBA 4ZVUB 1VQ7S 2F65A 4CECA 4EK2A 3CXCM 3BGRB 4KI4A 3TOQA 2HBLA 2XSJA 2XMKA 3Q8VA 2JRSA 2JLFA 2XB2D 3CD0A 5GAGP 2XMUA 5U47A 4JI5F 1N4LA 3AA3A 1Y97A 4PKIA 3BR9A 2EFPA 4Z37A 1HNZJ 4WK3A 1REVB 2X1AA 2AX1A 5ETKA 1HNWF 5TKYA 2P1JA 2XO6A 1GLCG 5BRFA 4CIGA 1RKJA 1N56A 1WHVA 3R3LA 1XMQK 4EFHA 2MXYA 1ZBUA 3HP6A 3HVRA 2Q66A 2WK4A 2BKPA 3ZT1A 2HOEA 4TQSA 4GO5X 3K2YA 4DLGA 4F4ZA 3CD6N 1YVUA 3DRPA 3TANA 4KC5A 1IM6A 3H4BA 1P1TA 3UQSA 4J5OA 2ZD1A 3CO9A 5IT9U 4USKA 1S10A 2RUSA 4X4UA 4ZOSA 1IG8A 2XMVA 2X51A 3PLAA 1LWEB 5A8WB 4IG0B 2RILA 3G86A 1VDHA 1V3RA 5GADP 3OY9A 2BQRA 3BGFA 1WC3A 4W4MA 3PW7A 4MTPA 1U4BA 5FJ4A 1NKEA 3WIUA 4OPHA 1RLDA 4DV4K 2RDDA 3TTDA 2XMAA 1R8HA 4FYXB 1NGDA 2EC2A 3TNVA 2OPSA 3J80Y 3RMAA 2CPZA 1SKUB 3EDRB 3OR1A 4HH0A 3BREA 1Y0HA 4QS7A 5ADXH 4CLPA 4NLSA 4X84A 4GKJK 4XH5A 3LAKA 4NX9A 3HSTB 3QO9B 3DRSB 2I8EA 1XHZA 2FTRA 4C8LA 3ZT4A 2CQ0A 2VWJA 2V7ZA 1RTIA 2YBVA 4OZ5A 4FK2A 3MPYA 1Q4RA 3R9LA 2DCLA 3SBGA 1SZ2A 2E1MC 1V4SA 4ED2A 3HD1A 3LDOA 1HPMA 3NE6A 1RT1A 4DL0C 3WDOA 1YXQA 1NJIO 1QHTA 3AGKA 3DLBA 3FLCO 4DOZA 2DIUA 3IBCB 4GMKA 5C2CA 1RWXB 3GONA 4Y1DA 4UOGA 4FWRA 5L46A 2W25A 3QATA 3IR7B 1N36K 4F3QA 2HBKA 1HKCA 3GR0A 4E1NA 2X7IA 1S0OA 1KC8T 2H4YB 3L9ZA 3NMUA 2HSTA 4B17A 1RWUA 1RCXB 4IFVB 1Q7YT 2J7UA 2OSQA 3WXKA 4JB8B 2CNKB 5M2PA 4R5PB 4CHYA 2J0XA 2A5XA 5E3RA 1M5PC 1F6TA 4LJMA 1KRPA 4CH7A 4KH0B 4X4TA 1NGAA 1QE1A 2UUWA 2AYBA 1NGCA 1EARA 1RT7B 1EHWA 2E1ZA 2RB7A 4DCJB 4ZCIA 1G2EA 4J37A 1XMOJ 2J9DE 3JS9A 5HLFB 5AZJA 1ASVA 3CCLS 3R5BA 1PBAA 2E6LA 1G6BA 3DOKA 3H46O 4MDAA 3JSMB 1V5IB 4A8YA 4ECRA 2XS5A 3WEEB 2E5HA 3BZCA 4FM1A 4H0TB 3CMAN 4X66J 2R8IA 3M8QA 3OA9A 4KH6A 2KH9A 3EKUA 1HKAA 1GTHA 2HQFA 3O44A 4RWTA 4NXMJ 3AVFA 3RG6A 3MXJA 3TJ9A 3K5MA 3LDNA 2HFVA 2GBZA 3WXIA 2W4CA 1MN7A 4NLXA 4FWLA 4CJQA 4LF4K 3HSDA 2DBBA 4YUDA 4KH4A 3LP0B 2DT9A 4DI6A 4CZLA 4H4KC 3UD5A 3LTOA 4DR5F 4WU3A 1FD8A 5KFOA 2A18A 4RW4B 4K4UA 4JI4J 2VBXA 3N79A 4OYMA 1LFWA 2XY6A 4Y2IA 5E0OA 3R7NB 4GVBA 4CM2A 4JV5J 1NG9A 4NXNK 4B9QA 3NVKA 5AQFA 1XNQF 1W0HA 3T5HA 4WWSA 3NFAA 2HNYB 3VEVA 1W7AA 2ZQBA 2R2RA 2D0PA 3K9KA 1Y3JA 1PJ5A 4I7FA 1HBMB 2F4VK 5F8NA 3CD6S 4OYAA 4Y6IA 3VGVA 3EXCX 1D4XA 3PKYA 2NXNA 4Q8FA 4WXOA 5CA5A 2UVWA 1S79A 3V9UA 1ZBFA 3IG1B 3GR1A 2Z30B 2IA6A 2M52A 1AUSL 3M5RA 4ECTA 4KHQA 3K8VA 4F0KA 3OFFA 1MWQA 1WC6A 5GAEI 3TYTA 3TI0A 4OZ2A 1QTNB 4DUYF 3CC4N 4Q7AA 4WFYA 4QWAA 4WZQA 2WBNA 3T3FA 2NPIA 2PT0A 2IAJB 2JSXA 1S99A 2G8VA 4M95A 1PKUA 5GAHU 1I6JA 5BN9A 3JQKA 2YH1A 3UE5A 1NDLA 3K5LA 3PSIA 3ISND 1RT3B 1IBKJ 1TUYA 3DXKB 3B54A 4CFDA 1BXNA 3D1QA 3CD5A 3GE9A 3GOIA 1RDBA 2DFFA 1P9YA 2ATQA 3A8KA 1MU2B 3FE1A 4DJBA 3T5JA 3D9BA 3UVJB 1K8KA 4FYWB 4OPJA 4ICLA 1BQXA 5CYQB 1S6PB 1YF5L 1FJCA 2GGPA 1WC5A 2BBEA 2UUAJ 1RTZA 3VGUA 2ILZA 5JVGQ 4B3MJ 5D4OA 2V8DA 3GG1A 3I5CA 2MZRA 5IXUA 3O4WA 3W61A 1IKXA 1XC3A 4GV3A 1LW2A 2AJ4A 1NH8A 3TJ8A 2R4FA 4CGFA 3I0SA 2ABYA 4O0JA 1NH7A 3GLJA 5HQLA 5HQMA 1QDUB 3SAFA 4X64J 4LFCF 3L2QA 1KD1O 3IKMA 2ZH4A 2MKCA 5C7PA 2ZH6A 1S5ZA 1M5OC 1XR5A 2Z2LA 4CIFA 4ID8A 4OI0A 5KG0A 3DXMA 4ILLA 3QESA 1I94J 4HL9A 2W41A 2FHJA 2D0OA 1T0TV 3L4QA 3BBFA 2I0XA 4WP8A 4D3HA 5AQLA 1NMNA 1P6TA 4BRLA 5DETA 1X9WA 5HP1B 4NEYA 4DR6F 2XQCA 5J2MB 2RT3A 3KLEA 4ZK7M 1HNWK 2LKZA 2G13A 1FRLA 1Z2LA 5KFWA 3KJVB 3CMAS 1IBMJ 4JYAK 5AQYA 2ROEA 5J2PB 3M3ZA 4M3YA 2RIJA 2NZ4A 2VG7B 3CPWM 2RPIA 1B7YB 5HMZA 2NLWA 3TVYA 2YHAA 3D67A 1HMVA 3FDSA 4Q44A 2ZJPL 2P9UB 1HR0K 4M1KA 2FVPA 3R6GB 1RAOA 2HVHA 3KWGA 3HF5A 3P1GA 5H9EK 3ZZRA 2KFZA 3ZFVA 3OSPA 2P8IA 1FWLA 1GLFO 2J6UA 2VA2A 4MKVA 1P1LA 3PY8A 2IM1A 2HQGA 3W8GA 2QLFB 5HQ8A 3AA8A 1M5SA 5GMDA 3NBPA 5KG5A 1M90O 3QBWA 4CLWA 4GRSA 3K58A 1OH6A 1HD0A 2SXLA 5KQDA 1BC6A 4EI2A 4CW7B 2F9DA 4DCHA 3R27A 1NGEA 2IVPA 2C2EA 1H73A 3MR5A 1R8CA 3CCSN 2YNHB 2KG0A 2I1RA 2RUGA 2BACA 2YKAA 4RW9B 5E2QA 3UR0A 2VWBA 2ASLA 3CC4S 3M8WA 4DEZA 1FJGJ 2HHHK 4KHUA 5ETVA 4E7JA 4NMXA 1HJOA 2IIHA 5M1KA 1TYQA 2Q0RA 5ETTA 4CLKA 4IOBA 4JI3F 2JEIA 1KS2A 1M5HA 3G6EN 1MMNA 3KLHB 3W0LA 4NLGA 3NKYA 4RR5A 4TYBA 5F0UA 2F9WA 1ZBIA 4ELVA 3CTRA 2NSCA 2FSJA 3L2VA 3BH6B 1TL5A 3UKUA 1GOCA 1JK9B 4PQUB 1PJ6A 3SAHA 4OZJA 4DV4J 5AE1A 2FJWA 1RISA 5HRRA 1EJ7L 3AA2A 2UVVA 1R59O 1JL2A 4JI2K 2Z2ZA 3MMAB 3L09A 4X65J 4BRIA 2FVSA 3RRKA 4WYLA 1OSDA 2L3MA 4K2JA 1PIEA 1RTDB 2EFOA 3VAJA 2G8WA 3I6PA 4GKJJ 1WSJA 2GUPA 5EHHA 4AHUA 1URRA 1FX2A 1PSDA 3CULA 1X5SA 2HBRB 2QXLA 2HQIA 3CETA 4QIGA 2C42A 3H5XA 4RW6A 4C11A 3CI5A 4OI2A 4IJNA 1O0PA 4OJGA 1VSEA 1M5KC 4BRPA 4CTAA 1BHNA 4RUAA 2PGCA 3DOMA 1VQ4N 3MEKA 3GV8B 5A6PA 4FJKA 5A76A 4FJXA 1Q82T 3HPHA 3H98A 3QGHA 4FPRA 5CD4A 1YDLA 2BZ2A 1KFDA 2NXCA 1ZA2B 1UA1A 4USWA 4IQXA 3VEXA 4AUKA 3J7YP 2IBOA 2D3UA 1P27B 1VQMN 3MX2A 3S3OA 4RKUC 4H0PA 4DR5K 4LR7A 3SBMA 1Q81O 5DG8A 2MB0B 1X0PA 3PW4A 4LF6K 4F04B 2R7VA 5LMUF 3SCXA 2FJDB 3UDVA 3B78A 4RU9A 2KU7A 2HHXA 1U8SA 4H03B 2PMHA 1OQ3A 3TX0A 1YJUA 4C3KA 3B4DA 4HYKA 3DRPB 3UCGA 2PI4A 3MM9A 3HKZD 4ZVGA 4DR3J 2WOMA 4QWBA 4G1QA 2ZD1B 1XNQK 1S49A 4KTWA 3Q2TC 5AQWA 4M5MA 4CHQA 1KAZA 1KVAA 2J9DA 2CA9A 3VQEA 2RN2A 4CD1A 3ADAC 4JI0J 4KHNA 2D74B 2AJ1A 4GW6A 4OHVA 3RSEA 1MWKA 1RBOB 1T9VA 1JLBB 2B51A 1VQYA 3PR5B 4O8UA 4DL2A 4ILRA 1KQSM 4A47A 2DISA 2C3PA 2K8GA 2OPSB 1H0HB 1TUGB 3DNCA 2B4OA 4OFZA 2C1EB 3TU5A 2CNNB 4DUYK 2CDQA 1ZA1B 4USIA 4BQLA 1S0NA 2RU9A 4OYZA 3F2KA 2YKOA 1RTIB 3OD2A 1QS4A 1RAHB 2KFYA 3CXCR 3ILOA 2B5JA 2MLZA 2QWMA 3LDQA 2ZITA 3KMSA 1E4GT 2M3DA 3EZOA 2DR9A 1RT1B 3PM9A 4KY3A 2V94A 3GU0A 4NXNJ 1T95A 4PR6A 4A8SA 3NLCA 1W7WA 2RE1A 2QWOA 4DR1J 1IVZA 4FL9A 2ILYA 4FO0A 2NNWA 1SL2A 5T7LA 4LF1A 1SV5A 2OEJA 3HHLC 1ATSA 4BRCA 1IBLF 2F4VJ 1YJ9N 3R3TA 3GP9A 5E3PA 2RVJA 3CCSS 2B9XA 2BVZA 1XBWA 3LZJA 3EGZA 2E4LA 4AQYF 4EBEA 2ZVIA 1LAWA 2VASA 1OS5A 3GIJA 4ANCA 4U7CA 5AQRA 3WIVA 4ZLLA 2B7BB 4CYUA 1X4DA 2VKZG 3JSBA 3RB0A 2ALZA 3G6ES 4F3OA 1SH0A 1A0OB 4XO0A 3R6MA 1N0UA 2OLWA 4NLUA 1CZAN 1Q9YA 2P9SA 3O5BA 1QE1B 4NL5A 1VR6A 3ET6A 4PL7A 3HO1A 5L1KA 4JKFA 4RBUA 1GH8A 5AZJB 4CJWA 2B4UA 2UXDJ 4LFCK 1HI0P 3DOKB 3KTQA 4A8MP 2V4JA 5B0GA 4AH9A 2A2DA 3MXIA 3AO1A 1HYSA 2PIIA 1QQMA 4ZS6A 3OYBA 1HL6A 3SFUA 5A6WA 1N5YA 1JLAA 4IRKA 4RW7A 1EAYC 3FKBA 4O4RA 3ATVA 3UCZP 2A42A 2ASMA 4OMFG 5GAHI 1C1CA 4DX8H 1GEHA 3VTHA 4Y2KA 1HRHA 4U67Q 1RBVA 2JH3A 2Y9HA 2DR8A 3QMQA 1KLMB 3BBBA 3TZWA 4ZJQA 4KHPF 2HKEA 3P6YC 2A41A 5FPNA 2DNRA 4NYPA 2RE2A 4HTJA 1CULA 1UZHA 2N4DA 4Z0UA 2GQQA 3CJKA 4AL6A 3R5AA 5IV4A 2BJ1A 3CJ1A 4GVBB 3EZ5A 4JI7F 1MNEA 2ZH2A 5KT7A 3SI8A 2ZZTA 1VQMS 3P83D 2A1RA 3GBTA 1V6HA 3THYA 4DTRA 3MR3A 3MUVP 1SKSA 5LSOA 3FC9A 2DH9A 4K8XA 3VGSA 2I9SA 2W24A 5K14A 3CO0P 4DV5F 1GQEA 3V2UC 2OELA 3V1QA 4ZKAA 2DGVA 5CQGA 5CE3A 1JWWA 3OL8A 1HJRA 3VN5A 2BW7A 4DU1A 2CJ9A 2CQ3A 1RU1A 3CVKA 4LF5K 3PTWA 4PCQA 2RDJA 4BRFA 1Z05A 1S72N 5GIPA 2AEFA 1R31A 5AR0A 4ZVOB 3KIOA 2CYYA 2WVFA 4NLDA 3M7VA 1VYAA 4IDHA 3R1LA 2OSRA 3I32A 1KAXA 2BE2A 2XLKA 4ED5A 2BXJA 1PYSB 4JYAJ 2B56A 3G10A 2YH0A 5LOQA 2D4WA 1SC6A 3TAMA 2NREA 2R8KA 1S4EA 1VC0A 5JVHL 3LO3A 3MMCA 3PRVA 2DR5A 4Q8EA 3AGRA 1JJ4A 4H0OA 1HHTP 1HR0J 4KO0A 5F3ZA 4HDGA 3MFIA 4JI3K 1KQKA 5KFDA 3HHKA 5KFMA 4FLVA 2U1AA 1OH5A 2EXUA 3GIIA 4EZ9A 1O5JA 3AAPA 1Z25A 3H3NO 3WXLA 1TV6B 4CT8A 5H9EJ 4ICLB 3WNEA 3VF4A 2FGCA 4CLSA 3ZSOA 4DUTA 4OGCA 3R5DA 3GWCA 4YDUC 1U24A 1NK4A 3VA0A 4KFBA 2ZBRA 3KJFB 2GHVC 4ZCMA 3E01A 3RBXA 4H5RA 4BRHA 4C6AA 1YJ9S 3TO8A 2XSFA 1LW2B 3A2FA 3L3VA 4CBWA 3ZC4A 4BE2A 5F8MA 4BCAA 4AHCA 3OVAA 3I0SB 2VFUA 2XYHB 1MA9B 2ITMA 3SCLE 5K8OA 3FVYA 4E3SA 1LW0B 2K1RA 1HBNA 3TEHB 2HQ3A 3ZTOA 3V9SA 1E6VA 1DTTA 1FD2A 4Y2CA 2VKRA 2HIYA 2HYIB 3KLVA 5EX3A 1WI8A 2N3OA 2WVCA 2ZFHA 3JAMO 2FC0A 3H2LA 1FFGB 1RWKB 4DV2F 5SUHA 1VSJA 4NOHA 4CLTA 2HHHJ 3WT0A 1R8BA 4RX6A 1U1RA 3HULA 4DL7A 1JLGA 4UUWA 1WSFA 4A48A 2UUCK 1HKBA 4IO9L 1U6BA 3EE9A 4Q43A 3FQLA 1YWXA 3HPOA 3DM2A 3K17A 4FXWA 1KVBA 3KLEB 4A4JA 4LFBK 4I0WA 3GSIA 5JJBA 3A5OC 2IMOA 4NYFA 1I3AA 3IGVA 3QJJA 4JI2J 4J8FA 1VQ8S 5KG1A 3M8SA 3DDIA 4MKAA 2PA3A 1HMVB 3BKUA 2HQCA 2MY8A 4MLEA 4DLEA 1AXQA 1T3OA 2VG6B 4BGAA 4ZPCA 4DV1F 3MK6A 3VQAA 4B1UB 4HVJA 1EKSA 1YRTA 4F26A 2V4RA 3VQPA 4J2AA 4NASA 2QA1A 1JLQA 2J9CA 3DN9A 1S57A 2BYCA 2MZTA 3O9TA 3CJ2A 3TVZA 4PXEA 2MMYA 4NI2A 2HAIA 3CSKA 4RLEA 3A0IX 1RHKB 2KT2A 5IM0B 3M30B 4NEZA 1S12A 3ETMA 3MAQA 3NBPB 3DOLA 2KT3A 4JI6K 3VV2B 2GVDA 2M4MA 4DR5J 5BR8F 3F0NA 1U2CA 4KT0C 4LF6J 4I68A 1VSFA 2AW0A 5FIIA 4BDYA 2HGLA 2QJ3A 3W9HA 2B4JA 4WQ5C 1UVMA 1VMBA 2ZM6F 2YXLA 5FRNA 1OIAA 2CPYA 1EP4A 2G9OA 1S72S 4B3OA 3VETA 4XPCA 1QVGM 5M1PA 3VALA 1H3DA 2NUBA 5MLCQ 3D2EA 1WOOA 1U1KA 1TYQB 4FOIA 1WKJA 1HA1A 3S3NA 3T6BA 4TU8A 3PUFA 2ASYA 1FERA 2BJ8A 4Y3CA 1IBLK 3QLHA 4X4SA 3Q24A 3KKRA 3ZZTA 1UPMB 4CM0A 3CPWR 4AQYK 3QPIA 3SMPA 2FHMA 1OJ4A 2XYPB 2RQMA 3LGHA 5IT4A 3MM5A 2MZQA 1YIJN 5LT5A 5E5NA 4M5KA 4EBDA 4DL3A 4ETZA 4DV3K 3EO3A 3C65A 4DUYJ 4CJTA 2FJEB 3UW1A 4O8KA 1KBRA 3NXZA 2RD5C 1RWMB 1EIYB 3QZ7A 3OS1A 4DSIA 4E7LA 4WP9A 3LPYA 3AO2A 3IMXA 2P5VA 1S77D 3NL0A 4L6V3 3A8EA 1LAVA 3R1XA 4EP5A 1NK6A 5AQZA 1ZBLA 4C11B 3VEWA 4X4PA 1FEHA 1VLYA 1T05B 3TA2A 2NSBA 4KBOA 4CGJA 4BR0A 4AHVA 3DOMB 4QBUA 3ENWA 1FXLA 3PX6A 4EGLA 2QT7A 2C2KB 3R9PA 5KG6A 1X9MA 5J1PA 2AP6A 1XERA 1CG2A 5ADZA 3NNAA 3TQEA 2VBZA 2HGNA 3C95A 5E3QA 3EN9A 2AHOB 1QJHA 4V19X 3PACA 4OLAA 3JS6A 1KR4A 3T6JA 5CHCB 4EO8A 1N33J 3F41A 2J76E 4YB7A 3QNWB 5BN8A 1WOPA 1M1KO 3VAGA 1G99A 2OMOA 4GC7A 2ZJRL 1S1TB 2R2UA 2YHBA 1YJWN 2EWHA 1OY9A 4Y2MA 1AB8A 5HRNA 1SH3A 4JI7K 1TKTB 2O4GA 1DT9A 3PFOA 2X1BA 4NLYA 4HACB 4LF7F 4DX6A 3OSNA 3I9ZA 5KFSA 2CG8A 5KFQA 1NDCA 1BUXA 3OS0A 2XS2A 1RBTA 1T44A 1RT4B 2FF3B 2DNNA 4C0OC 3RSEB 1WAFA 4CIEA 3BSAA 5M1QA 1B7FA 3U6FA 5KFRA 1DLOB 3RR8A 1RTHA 4IXCA 3D2FA 2D9OA 2EX3A 4FKXA 5BPLA 1FK9A 3VQBA 4TU9A 4B3RF 2MQMA 5D4PA 4JI1J 3CC2N 1FRIA 2BJEA 2Q43A 4CNYA 5FPEA 2HHWA 2XY7A 1TELA 3FEYB 2IVFB 1XK8A 1K6YA 2AGOA 4CH1A 3MR2A 1WAJA 1FKOA 2I5JB 4M42A 4CBXA 5J1NA 3KJQB 4QU6A 1APSA 2LDYA 3HHEA 3ID6A 5GAEP 1YVNA 3NGUA 5DQHA 3EKSA 4CF1A 1T9XA 2KKHA 2GQCA 3T1AA 4IFYA 4O3QA 1NHKL 1KVJA 2CQDA 4OI4A 5AFUH 3MM6B 5I3PA 2V34A 2V7YA 1RAIB 2ZE2B 1NUEA 1PC5A 3IM8A 3M6UA 5T7LB 4DWIA 3HLUA 3L3UA 1SV5B 4A57A 4Q2LA 4RUBA 3PW2A 4JKAA 2LCWA 2AF6A 5D0RA 1G15A 4FJ9A 4HKQA 2XM3A 1T7PA 1XNRF 3ZZOA 5AJ3K 3OBWA 3DLHA 4BLGA 2DXDA 3K0JA 4KGMA 2P5OA 5DG9A 1VSLA 1VHIA 2E9ZA 4LF5J 4IOAL 4C0HA 4YY3F 3ENBA 2YHYA 4B1YB 4TLRA 4DUZF 1VRUB 3MF5A 5FDLA 3NOGA 3EUNA 2UXCF 4BWMA 1ROFA 1S6QA 3UDCA 2YJFA 4JN4A 2C2NA 3CFPA 2P9SB 5G0RA 1S48A 3J7YU 5F8HA 3OV7A 4WU2A 5KFJA 1RCOB 1YIJS 4PQAA 3D45A 1KQSR 4OGEA 2V4JB 3H42A 4IO8A 4B3TK 4FWQA 1HYSB 2FSKA 4DV2K 3CJ8A 4Q0BA 1IR1A 3X3UA 3LDPA 1J9AA 2OPQB 3SZ2A 1HIYA 5FLXO 1KSPA 5L38A 2HWIA 2QWPA 4FLUA 3PRBA 2EK6A 4ZN1A 4K5SA 4NYOA 1H2UX 4WTOB 3AVBA 4RBTA 5M2UA 2ZEJA 4ZPWR 4C8MA 4PHTX 3IN5A 1BGXT 2Q2RA 2JVRA 2R2SA 4FVMA 2DNYA 3GMGA 2MTLA 1VQ6N 1HBOA 3CCJN 4DF8A 3OYHA 4H4OA 3AH6A 3B82A 3N4PA 3IMQJ 2J0SD 4GVMA 1VRQC 2I7NA 5C2DA 1HNZF 1CULB 2IC3B 3CJKB 1WNEA 5IQQA 3HHLB 4F25A 3BF1A 5MAOA 2XZWA 3ENVA 2CJXB 3M32A 3SCIE 1RDRA 1JCGA 3THYB 2V51B 4WFXA 3CFRA 2RQKA 1FDNA 5IZHA 4ZJOA 1QVFR 1NMEB 4USJC 3T1HJ 5K14B 2AZ1A 1YJWS 3DGPA 2ADCA 1QHAA 1CXQA 1UEVA 1CJUA 2OUGA 4DZDA 1BHLA 3GJSB 3W2WA 2BE9B 2ZWPA 4ED8A 3KKFA 4NA2A 2BDPA 3M9NB 1NJZA 5HBMA 1X4CA 4FZYA 1RBUA 1U1PA 2FY8A 4CGIA 1S7IA 2UUCJ 3QYYA 3CJ3A 4PA1A 4IRDA 1J5EJ 2CAJA 2GHPA 3D7EO 5ETOA 2IM0A 1VI7A 2GJ2A 2W2MP 3VAHA 3HP9A 2ZHOA 1S1VB 4KV8A 1D09B 2B4VA 1EWQA 2OCEA 4LFBJ 3TR8A 3CJ4A 4NA1A 1VQPN 1UAWA 3Q0AA 1H38A 2BE2B 2BUPA 3FZHA 1Q18A 1TTHB 4CO4A 3OBIA 5K8PA 4C8NA 2CQCA 3BGOP 2VPXB 1U1NA 4DFKA 4M3RA 1RK8A 2R8HA 3CC2S 2GX8A 1N34F 2QA4N 2KG1A 3R7SB 3MPVA 2V6AA 5CR4A 4LVOP 1U45A 5DMRA 3ZT2A 2RAQA 3GQCA 4KO0B 2PI5A 2YHXA 2FDNA 1SVDA 3HDSA 1W2BM 2W7PA 1OQ6A 4M5DA 2KDOA 4QIEA 3E9PA 1C0UB 4HUGA 3A3PB 4USVA 2I7PA 2ZF5O 4ZCKA 4OKKA 2CVIA 1RDCA 5LXRA 4WE1A 3EYZA 4Y65A 3OL7A 4IDKA 1JXLA 3VZHA 4ILGB 2QG9B 4QQBA 2IVOA 1T9TA 4WBFA 4B9MA 1JCFA 2V8PA 1SQEA 3E01B 3HPGA 4FJGA 8AT1B 4O4GA 3AVJA 4B9SA 4CZMA 2K2PA 1YI2N 4QW8A 4JI6J 3H08A 2CZVC 2E9TA 2EVZA 3OT9A 4DPYA 1W2IA 4WF9Q 2AX0A 2VICA 3BUZB 2K1RB 4EFAC 4RUCA 1XQSC 1FKPA 3QGIA 4ZA1A 4FKYA 3OYKA 1JXVA 5EGYA 3H0PA 4FDFA 4MIAA 4C23A 2GEMA 3M1VA 4E1MA 4DQRA 1VJWA 3CW2C 1NKCA 4P75A 3O3LA 7AT1B 3PYEA 4I6WA 4CGHA 2VGMA 1ZAXA 1JLGB 2CQBA 2W1BA 3UCUP 3WNFA 2CJBA 1FX4A 4X66F 3W3DA 4USTA 3LDSA 1IBLJ 4Y0FA 1UVKA 3DM2B 1XTZA 4NXMF 1VS3A 1PJ7A 5CYMA 3CCQS 4AQYJ 3OPKA 5IQ6A 2VQFK 1LFPA 1SB6A 4L3KA 4FM2A 4DV0J 3I55N 2R7WA 5BPMA 3O9SA 2XNRA 5BXIA 1F3VA 4AF1A 2WC9A 3AA5X 1S4FA 1WEXA 4DV3J 1KOHA 4O3NA 4DL6A 1H1VA 1KTVA 1PCAA 3RU0A 3TAFA 2QKBA 4JI4F 1PO6A 3CIMA 3KZBA 1WSVA 2OZSA 1VQ6S 2DKOB 4LF7K 4TLQA 2G8UA 4JV5F 2RHSB 4Y1CA 3EVOA 4DSKA 1JLQB 2EG1A 4DQSA 2NR0A 2QO3A 1YG0A 4LSLA 3Q8YA 4K2XA 4KYZA 1VQKN 3GIKA 1S9EA 1ZM2A 3HZ6A 2P9KA 5FPMA 2HBMA 3AFGA 1R27B 2RF2A 4TSXA 4F02A 3CNQP 3OTCA 3CGIA 4A8QA 4B3RK 3LP1A 5KT3A 1LQ9A 2FJVA 3QWPA 1UCNA 3CUNA 3JYTA 5LL6d 1RWOB 2EK1A 1IJEB 5FLXU 4KTZA 3KHYA 5MLCV 5M1OA 4L76A 3VQQA 1JJ2M 3PYDA 1EP4B 1NZAA 1TK5A 3H1QA 4MO5A 2W9AA 2E2NA 1NMDA 4B3OB 4JI7J 3AQOA 2HG4A 3BF3A 1S5JA 5KG3A 1AA1B 4ANDA 3CJ5A 4PXCA 3PEJA 4W5QA 3P38A 1I51B 3BSNA 2LYVA 3D2EB 1VQPS 4B9VA 3TRGA 3VR1A 1IBKF 3QNOA 1HNIA 2CZ9A 3MWTA 4FJHA 4K4VA 4H5WA 2MZ1A 1PAUB 2VJUA 5AQMA 2BM1A 1I3OB 3SAGA 4H5NA 2C2MB 1EQYA 3N4WA 4RJVA 2VH7A 2KN4A 4TYAA 4ILMA 1RB0A 1S9GA 2QA4S 3BQ2A 4CI6A 3P39A 1FJEB 2MQOA 1Y3KA 3MM5B 2BQUA 1NPRA 2EBEA 3MOJB 2CFXA 1TL3B 2QWQA 3LOUA 4BVPA 1KNZA 2VG5B 2UUAF 2YX6A 1B0VA 1X8DA 3HSZA 4AHSA 4FYDA 1VRTA 2FVQA 4ZHRA 1Q5VA 2QIFA 4UY8O 3TTCA 2B43A 2IM3A 1HFEL 2FIUA 2HRYA 2W2OP 5AXNA 1D8ZA 3GFZA 2VGNA 2EW9A 4EO6A 1K73O 4FXDA 4IFEA 3I0RB 4FJLA 1NU0A 1VQ5N 4UOFA 5KFFA 2VUGA 2BW2A 3QFHA 3PVXA 4BDPA 5JLFA 2JZ5A 2HZVA 5CHIA 3ELHA 1J27A 1WSGA 2YX7A 3THTA 3NAIA 5AQTA 3SQ0A 4UQGA 4X64F 2OPRA 3NCIA 1IJJA 2NRRA 3ENHA 1NJWA 2R7YA 2YV0X 2NLXA 5CXTA 2FJXA 4J2DA 1RHUB 1QQNA 3HFKA 2LSNA 1Z2ZA 3RAXA 4DU8A 5ETMA 2HEKA 5AJ3J 3HSGA 1WG5A 2W9BB 1EKEA 3EL2A 4GKKK 4DQPA 4F4AA 2RRNA 4QOTA 5KFGA 1QVGR 5GAHP 2QLJB 4KHWA 1RUSA 5L39A 2D0AA 4FF3A 5C2FA 1HNZK 1RZMA 3G82A 3ZTSA 2VCPA 5KRSA 1DRZA 4CJ4A 2CPXA 4R8UA 1NJXA 3SUQA 4URSA 4AFFA 2AGQA 1IBMF 4K8RA 3VQ8A 2BGGA 4XH4A 1VAZA 1FHTA 3NGSA 4C8KA 2QK9A 1SJ4P 4R25A 5E33A 5IWAF 2FPHX 1NK8A 4KR0B 3NY0A 4CE9A 3LL3A 1GLJO 3I55S 2UYTA 2NRTA 4M7XA 2J9EA 4J9MA 2BQ3A 4OI1A 4HDHA 2V5HG 2BJ3A 4B3TJ 3MHYA 2GIFA 4WIQA 1UJ5A 3KUEA 2IDLA 2HAFA 3TW0A 4JKBA 9ATCB 3VEOA 1M1GA 3EZWA 5DK5A 4A2BA 3D2FB 2Q6CA 2YNFA 1TFWA 4P73A 4IOCL 4CNZA 1FK9B 2QL9B 1AZSA 4AL7A 2F8TA 3J7YI 4OV6A 1UFWA 1QZ5A 1VC5A 1ATNA 1VQKS 4FW1A 3FBFA 4BS2A 3VOVA 4S0MA 3FQKA 3D0IE 2V9KA 2W9CA 4L3QA 4LFAK 3TUJC 2VC0A 3AVMA 3KK7A 4AXIA 4G9ZA 3P4IA 5IT0A 3OVNA 3LM2A 4IFYB 2MKSA 3RTVA 3NAHA 3PG9A 3LW5C 4ZIWA 4ECXA 4N7TA 1VHXA 1N34K 1BU6O 2KYZA 4F0HA 4Y34A 4ZITA 2F9TA 1VSHA 2QSFA 1YBTA 2EFVA 4JRQA 4F3MA 1IKVA 1OVQA 2IY5B 3DI6A 3V4IA 3P49B 3IO1A 1S1XA 1FJGF 4KGVB 3LPEA 1NK0A 1HNVA 4DTSA 3SDEA 2XZDB 5KGWA 4XK8C 4CH0S 2HS4A 2WRMA 3CJRA 1FRJA 1QM9A 3KWMA 2O8EA 2NRXA 2OPPA 1B3TA 4BR5A 1MROA 4LY7A 2PAVA 4BG9A 3LALA 2FHKA 5IFMA 3MN7A 4IEIA 2E7XA 3MEDA 3M8PB 1ZBHA 1RI7A 2N3LA 4DV4F 3W65A 2XEXA 1S6QB 3QEXA 1DJ0A 1VK3A 3EWGA 4C9DA 3O8MA 4NZ7A 4U7UD 3V6DA 5G0RB 4UT4A 3VHQA 4DDFA 4X65F 1Q8IA 2ZGYA 3Q23A 4FWMA 3GYXB 4GKJF 5DJBA 1V4TA 1X1PA 1LWFB 1TUVA 3A8YA 3R1HA 1JNZB 1XWLA 3BEXA 3W63A 5KG4A 3BZQA 4DCPB 5C25A 2PC6A 4C8ZA 5E84A 2ROPA 3MWBA 3RJMB 4X66K 1YT3A 1KDNA 4ZDNA 3RBDA 3PJWA 3LF0A 1VQ5S 3S6EA 1AYEA 2W01A 1HBOB 4FJ7A 4KTQA 5JUMA 2F4FA 4DSFA 4P74A 4Y00A 4CJUA 1VIXA 4E89A 1WTBA 2QA2A 3MCSA 3UE2A 2DHSA 2LP4A 4JS4A 1PILA 1JNRB 3KNGA 2QMUB 1YVFA 3EE8A 4E2FB 3ISZA 4GC6A 4K42A 3T5LA 1VQLN 2GV9A 2Q79A 2IS3A 2WSCC 3PJXA 3QEVA 3CG7A 2VA3A 3AVCA 4MYTA 1HKGA 3M32B 2FB0A 4CZIA 4OV1A 3SSSA 1IN0A 1YJRA 3D6RA 1OY6A 3MTJA 3SUPA 4Z94A 1C4CA 3ATUA 4DR3F 3MCNA 3AARA 1JCEA 3MWPA 1ZM4A 2AKWB 4NLOA 2R7OA 1SAZA 2PFUA 3DGPB 1XC9A 3W8PA 4BDZA 3A3OB 2GMHA 3US5A 3W2WB 4JI0F 4FWPA 2NXUA 4EHUA 4OI6A 3PIPQ 3F5TA 2FXUA 5HBMB 4DG1B 3D6FB 2AWZA 1UAXA 4DU3A 3G96A 3CJTA 4LRFA 3SQGB 4F2SA 5D3GA 4IYQA 3VERA 1C4AA 3TABA 5DO2A 2MKHA 1K9MT 5C42B 2VQFJ 2WONA 3FEZA 1WNSA 1Q1KA 4CERA 2QX0A 2H3EB 2W7AA 3E66A 2MY7A 2XMMA 2V2VA 2UUTA 4UTGA 2YKMA 1TVRA 3FZKA 3A5NC 3ZX0A 2HLUA 2HHUA 1WOSA 1SQFA 4C8OA 4RO0A 1RNHA 5T14A 1QUPA 3PYFA 9RUBA 1HWIA 3V1RA 1ZAWA 3FFIA 1YJNN 4PABA 3EMTA 5DLFA 1SPBP 2NCKL 3ISNC 4G6VB 4KB1A 4DR1F 4KGXB 1W9HA 3UR3C 1WSIA 4WE1B 5F9LA 2JVOA 4IDKB 1KC8O 3KK3A 1RSCA 3DHXA 4I67A 3PFEA 3PO5A 2JFDA 5F8GA 1Q7YO 3KDNA 2NXJA 2BKNA 4B3RJ 4DMZA 1IUJA 1ESVA 2UUAK 2XTJP 5KFNA 4F9OA 4O3RA 4WPAA 1C1BA 1NGFA 2E1YA 4A62A 4N77A 4CJKA 4M63A 3KHRA 2OP5A 3DRYA 2PBDA 2DO4A 3KHGA 1BQMB 3NH1A 3KHLA 4FZXC 3WQUA 4OYWA 1Q8BA 3M1VB 5GVQA 4CFBA 1UFLA 4DTJA 2XBPA 2EBGA 5B08A 4QYRA 5A0YB 1S7HA 5CZVA 4PKGA 3AD7C 1UFKA 2UXDF 5EY4A 4M41A 3FRYA 4PY5A 1YBAA 3OFGA 3U27A 4BY9C 4ED6A 3O1BA 1GNKA 4YB6A 4ZP6A 3TSPA 4I2PB 3M2UA 1RDAA 2X1FA 2AZ3A 2G2ZA 2KRBA 1YJ7A 1TGOA 5J1EA 1F21A 1RT5A 3ULEA 3IM9A 1KONA 3AQPA 5AFUA 1EZZB 2J4RA 1RHJB 3KLFB 1RLCL 5CYMB 4K59A 5EXWA 1SI9A 4W90B 4KSEB 4XIUA 4OVLA 1T6CA 3S1TA 4J9QA 2CH6A 2P9PB 2OA8A 3QETA 2MKJA 3MN5A 4M5JA 2Q31A 5DG7A 3TWHA 2QSWA 1UPPA 1B9DA 1W2BR 4ZTJA 3C6TA 3G8TA 5GMEA 4JP8A 5IWAK 1U0HA 4TKTA 1CC7A 1IV0A 3G6YA 1RYRA 1OYDA 2D41A 1HNXF 3RR7A 1VQOS 2OFHX 3ZZPA 1MWZA 3NNCA 3OTOK 3KLGB 5D15A 2DGWA 5ELZA 1N6QA 2FHOB 3U7JA 2PZSA 3J7Z5 4DPTA 2IHR1 3GFXA 3JTPA 3PYGA 3ZTQA 1VQLS 4LSLB 2MGZA 1HW8A 1S9EB 4ATNA 2P9KB 1WN7A 3V81B 4YNQA 4O44A 5DM6L 2F7TA 4UZBA 4ZP9A 3IBWA 4BVOA 4O0NA 4IBNA 4ZMMA 2QLWA 1S97A 2FC9A 4OYIA 1JJHA 4IO1A 3UIQA 3ICLA 3JAMY 5HATA 3F9MA 1Z1ZA 1U2FA 4BC9A 3C0BA 2JGUA 3C6HA 5D4LA 3HOTA 3NRBA 5ETPA 1ZZNA 5BJRA 3PW5A 4FPBA 3ZSZA 1TK0A 3SSQA 4M3TA 4GKKJ 4NRTA 4AXJA 2DXFA 1NB7A 3DCAA 4AHTA 3MMBA 3CYMA 3EGWB 2XHBA 3CF5L 2BJ9A 4YOWA 1ITGA 4JYAF 5C15A 1U49A 1RU2A 2KVQE 1X5PA 4ZLPA 8RUCA 4ECUA 4USMA 1TR0A 4WCEQ 3U9DA 4ZPAA 2UV8A 1HNIB 4MK9A 5JLHA 4R0JA 4OJHA 3GYGA 3AY0A 1NBWA 4TY8A 2EWSA 1LCUA 1FJGK 2YQ0A 2CGJA 1HR0F 3OW2M 3B8HA 1TFYA 2IDOA 3G2XA 3A4TA 1RA6A 3QIDA 1JXBA 3GE1A 4KIAA 3ZO7A 1VC6A 2DY1A 1DGKN 4ZJLA 1S9GB 4BR7A 2E1AA 4GO7X 3M6VA 4YDXA 3AVAA 3HL8A 1OH7A 1YJVA 2WW4A 2ZNYA 1ZS6A 5AE2A 1YJNS 3GFYA 3S7RA 3OLBA 2WVEA 5SWMA 2NYIA 1VRTB 2P9LA 4ZHRB 2DB1A 3DHWC 4URQU 5BREA 2X3DA 1LWCA 1TKZA 4KAIA 3I4HX 2YI1A 3ZSQA 3RVCA 4BC7A 3DLKB 5IS2A 4FWOA 4X65K 4CWBA 3R5GA 4LFAJ 4Z7CA 2CJKA 3O08A 4ZVPB 1S9FA 4OZLA 4U7UK 1TL7A 3IP0A 5M2RA 5LJWA 5M1NA 2Z1JA 1N34J 4F4YA 2OPRB 1P8GA 3QIPA 4CF9A 4CZKA 3KVGA 2Q1LA 2Z1HA 1KN6A 1S1WA 1L3UA 5H9FJ 4H54A 4FNIA 2HHHF 1RGVA 2MYFA 1UVIA 1JJ2R 1A7GE 4EU0A 1GLLO 2GC8A 4YR2A 2DNQA 4ETXA 3GJQB 2VDHA 3MAAB 2PMZD 1UETA 2B8QA 3TAQA 1KTQA 3V4MA 2W2QP 3OXLA 4B9TA 3G82B 2HK2A 3KHHA 1HWLA 1H74A 4JD2A 2NUUG 4CO1A 4QS8A 3OLAA 4R8UB 4JK8A 4OZ0A 1VSMA 4FWKA 4QPXA 1FNOA 1NB2A 4RL1A 4I2QA 3QINA 4YS2A 2RKIA 5DQIA 1N5TA 2HIQA 3THVA 1FTCA 3DU5A 4JI2F 3H40A 3VQ9A 5KTQA 4YOUA 1DY3A 4DR3K 4UW2A 1JMTA 2BANA 5HRSA 3Q8PB 2CGKA 1EWRA 2HFSA 4U95A 4K4SA 2E2PA 2KXFA 4JI0K 2KTQA 2CWXA 3G71N 1SJ3P 2XMWA 3S8SA 3H5YA 4CJLA 1U6ZA 2R42A 4OX6A 1KQFB 2I6WA 4NWBA 3NF7A 4DKWA 4FVCA 3E3XA 4KPYA 2YNFB 2WSEC 2CQIA 4LUBA 1A9NB 3MD3A 1RABB 3T9ZA 2KLAA 3L2RA 1AZSB 2O5DA 5LJ5Y 4DR7K 2EI5A 1RAGB 5A2QO 3UWTA 3E2EA 4CFAA 1XIQA 1UA0A 4WFNQ 4FJ5A 2GMJA 3SNNA 1LXJA 4HCCA 4PG6A 4EYHB 2RSQA 4DX5A 5B0EA 1HQ2A 3LGNA 4JV1A 4C2MA 5AXLA 2LVWA 1B9FA 7FD1A 4BC5A 4LF6F 1H72C 3BEGB 1F1BB 4BR2A 2HZAA 4JLHA 1RHMB 3PIOL 4OYOA 4BC2A 2IA0A 2CNLB 2A1SA 1RDUA 2WAQD 3OYDA 3FK4A 4DPWA 2OZMA 3DI6B 3KK1A 1WDDA 1S1XB 2NZCA 5AQPA 1HNVB 3Q8SB 2O8BA 3SDEB 4DR1K 2BJ7A 3UKRB 2YKPA 4WFAL 3HXMA 2LU2A 2PDAA 4OPAA 2DGQA 1FE0A 3ENQA 1WACA 3VEZA 3T1YK 2OPPB 1MROB 1U26A 4E7IA 4BACA 1X3MA 1O1WA 1RYSA 1U1LA 1A6LA 3OHBA 3D1HA 3MEDB 2OFGX 2AP1A 1QSYA 3SV4A 1DQ8A 3AB4B 2V63A 4OHWA 1HYZA 4F0MA 1KLNA 3V6DB 2DH7A 4CO2A 2NRHA 3QNNA 3KKSA 5TKWA 2MSTA 2LQ9A 3P8BB 1KVIA 5AXKA 2VDIA 1KWMA 1S3XA 4HCBA 1FDDA 2E2OA 2KJVA 4CO5A 1OH8A 2WHOA 3QDKA 2C3YA 2UXDK 5HO4A 4FVUA 2GTDA 3MM7A 4QPTA 4M7YA 3IRWP 1NJYA 5C25B 4OQJA 3AHPA 1BUPA 4LVNP 3P3DA 4FYYB 1Q82O 1OVYA 4Z7YA 1F2HA 1REVA 3L95X 2J7WA 3Q8QB 2R7RA 4CBUA 3DLGA 2GVZA 3TUZC 2KHCA 1YZ7A 1X3NA 5HL7L 1WORA 4FS2A 2I2YA 2BMBA 4NLVA 2MSSA 5KFIA 5H1SQ 3MCMA 7FDRA 4ER8A 4M3UA 1N8RT 4LF9K 4Z4IA 4WYWA 3MCOA 4QU7A 4ANEA 5HOOA 4K4ZA 5DM7Q 2IRXA 3DC2A 3NAEA 5B0AA 1N33F 3BV8A 1T6DA 4QYZK 4DFMA 4LMZA 1ITPA 5CCMA 4RW8B 3JXOA 1LWEA 5A8WA 5EN1A 2WZ1A 4IG0A 5C24A 1HNXK 4P2MA 3TZYA 2RU3A 2FJBB 2DPNA 1BI4A 3MPDA 2W8KA 2VODA 1ASUA 2HNDA 4J9LA 3G9CA 4P6QA 2O66A 3D7SB 3DLEB 3KXDA 2LECA 2QMWA 1VOMA 3D1OA 5HMXA 4K50A 3IWLA 3DRXA 5KFXA 3DLLQ 4DCOB 4JKGA 1SIZA 1Q86T 2HBZB 1Q8LA 1HQEA 4NYNA 4MK8A 4PL8A 4OX9K 4FJNA 3HCXA 3PZPA 4DTOA 1GMWD 3CM6A 3QO9A 2E29A 3M8YA 3W2VA 3R97A 3V9XA 5FLXY 3MR7A 2HFNA 1UW9A 2HMPA 3G71S 2GO9A 2YWWA 4M3XA 2WONB 5CZXA 1RDDA 4JI1F 3QEIA 2JEJA 3NGRA 3BQ1A 3CT9A 1L3TA 1OKJA 2WCXA 2OTLN 4JI8K 1V5VA 2YKMB 1TVRB 4QZVB 5A8KA 4WFBQ 4FXVA 5G4DA 3MN9A 5AE3A 1SC4B 5IWAJ 3OVSA 2W2PP 4K7QA 2VFRA 5SZTA 3JQMA 4ECSA 4C97A 3T7ZA 3OTOJ 1E4FT 2DD8S 3IGNA 4IZ9A 3HSCA 3BF4A 3B8AX 1JLEB 3LWLA 3TZXA 1FDAA 1JQGA 1VLOA 1HWUA 2Y8WA 2AJQA 3UDEA 3KK3B 2XHCA 4DMNA 5KFUA 5LY3A 5I3UA 2B6AB 4R5PA 3SJJA 2Y1JA 3OVBA 1BOTO 3LP3A 4CEBA 2RQCA 1X5TA 3NS6A 3VPZA 2LFVA 1HPZB 3MCAB 4A8OA 4YB1P 1D9FA 4LBHA 3BM7A 1NWKA 2YNIB 1B4SA 2E44A 2ZOMA 2P6SA 4LF5F 1K47A 4PUOB 4B9UA 1QUVA 4A8XA 1C1BB 1N88A 2F3JA 4AD6A 4K41A 1W25A 5D78A 4IR1A 4DS5A 1X31C 4Z4FA 3HM8A 4CF8A 3RMCA 3JSMA 2ZH7A 1X4FA 2A40A 5A2QU 3EGVA 4HLBA 2R7QA 1DTQB 2CJAA 4N5SA 1N32J 2NZTA 2P9IA 2H5JB 4YFUA 3U1NA 1SJRA 4P72A 3C14A 5DDPC 1D1UA 4U7BA 3U1LA 4JKCA 4FJIA 3M2UB 2ASPA 3KG0A 3LP0A 1RCHA 3UI3A 2VONA 1SUQA 2GX9A 3UD4P 4QAGA 1DHMA 2B9EA 3DU6A 2HW3A 4YDDB 3M2VA 1RT5B 4CJFA 4H4MB 3OJSA 2Q36A 4RW4A 5EWFA 2ZNZA 5CABA 2Z57B 5B0BA 4X4QA 3MUMP 3GIRA 3G87A 2ZDPA 1D3WA 4ZP7A 4J9UE 4QWDA 3A1YG 4EIAA 4FK4A 4NA3A 4CHNA 4QR1A 2V4QA 4B1VA 3C6TB 3K5NA 2HNYA 4CLUA 5D0GA 1U0HB 4AYBD 5EWGA 2GMLA 5KFPA 3VQCA 3H2VE 3UDLA 2GNKA 5JICA 2IMWP 1N6QB 2FLLA 2VJVA 3I5BA 4QJVA 2VQEK 1Q78A 4ISEA 2YWGA 3O8WA 2GV1A 2KXHA 3BJYA 3J7AN 3AA9A 2MGZB 3C7NB 4FP9A 1C2PA 2RMLA 2AYMA 2LEPA 2M88A 3OFEA 1ZTWA 3T1HF 2QE5A 3VTIA 3DXSX 3N5FA 4O44B 3AVIA 2FC8A 1RWPB 5LSRA 4ZIVA 2NRWA 1UTAA 4ZTFA 1U2RA 2DNLA 2E8AA 2PFDA 4A8WA 3SI6A 2P9CA 2XSJB 3MN6A 3MAHA 1XR7A 1OYEA 3LAMA 2GUIA 1LKZA 3NGKA 2UUCF 1J5EF 5CD4H 4L75A 2AIRB 4X62K 1U04A 5JS2A 4FN5A 3DAWA 4E0DA 1HBUA 1YJTA 2VPZB 3MMBB 1X9JA 1B99A 2KZMA 2VD3A 3OYCA 4LFBF 4RTFD 4NCAA 2DRAA 3OXFA 1DFDA 3D68A 1ZAVA 2JOQA 1MU2A 3QSIA 4ILHA 1IQZA 3TUPA 2UU9K 4RU2A 2C22A 3UVJA 5JMVA 3SPYA 4DV6J 3VA3A 3GIMA 4DPOA 4FF1A 4PWDA 1WSRA 4TY8B 1KXPA 1QZ6A 5CYQA 5AT1B 2JFKA 3NMRA 1UP1A 2OTLS 3VAMA 2WBRA 5D77A 2CADA 2L9NA 1XN9A 3OJUA 3H45C 3ILJA 4M8LA 3R8EA 1EB0A 3HHNB 4E1JA 4BE1A 5F3TA 1YK9A 4O0IA 2E5LJ 2P2CB 2WVDA 4DV7K 4ED1A 2OIHA 2QEXN 2HGMA 1KOOA 2ZWOA 3TJAA 3L0QA 2JC1A 2U2FA 4DR7J 1FJ7A 4OZ1A 2V9WA 3H8YA 3SYZA 2XNQA 5CAAA 2O1PA 2FLNA 2AD9A 3G4SN 4LRAA 4YMEA 2DXEA 3WXJA 2BM0A 1LWCB 1TKZB 1F9FA 3K5OA 5ETQA 3OR1B 4WQ4C 4JI6F 1IWGA 2MLXA 2RJZA 1T9YA 1BE4A 1FO1A 3OL9A 1VBKA 3ZEUA 4WFNL 3N4QA 1DQAA 1YLXA 2HZCA 5K8NA 3DLRA 3CHWA 5KI6A 4PPDA 2C2OB 2J6TA 2N7YA 1Q7LB 1S1WB 4K25A 4W5RA 1Q5YA 2YNGA 2YX4A 4PPZA 1GFWB 3SMSA 5K8MA 2CUYA 3KJNB 3QT8A 1WUUA 4BRGA 2YPYA 3PHEA 2Y1IA 3BYRA 4ITSA 4C1NK 5KFTA 1RDWX 1M0SA 4YOTA 5DLGA 3GDQA 3HT0A 3H7HB 2VG7A 3T1YJ 2DNMA 4USUA 2QC3A 3Q8RB 4NZ0A 1J2VA 4LBPA 3CB4A 2FLPA 5HMYA 3EEQA 4KI6A 5BPNA 5D4NA 3GCXP 1YBUA 1GLAG 4CEQA 3HFVA 2OEKA 3F56A 2DPJA 1BIUA 1N33K 4I2QB 2VBYA 4DV0F 1RJJA 3MPWA 2RKIB 3WC2A 1H2TZ 3TWZA 3MEGA 3JSYA 2ZH5A 2BX6A 3TZZA 4DV3F 1WDTA 3TSUA 5KFVA 2XY5A 1NK5A 2DITA 4OIXA 4DFJA 1CQMA 2BANB 2DNKA 2LU1A 3SLCA 5CH7B 1RACB 2DNPA 3EE3A 1U1QA 4A59A 1JLFA 3PR4A 3NS7B 4B9LA 4GVEA 3V6HA 4I6MA 2D7SA 4B8AB 3CQ8A 2P9NA 1KHVA 3VQ4A 2H5IB 2XYGB 2Y1LB 3MD1A 1L3VA 2CPFA 3SK3A 3CERA 2R7SA 4K0KF 2X3GA 4P2SA 3QAEA 4Q45A 4UOHA 4WQ4A 5B09A 2K3KA 2IBKA 3D6HB 3CDUA 3M8QB 3B6PA 3QFWA 4I56A 1ZTTA 4F3TA 2HMIA 5D0HA 2RS2A 2PEHA 2ZZMA 1YQHA 3T19A 3J81Y 1QAYA 2VWKA 3F73A 4JI1K 2YNHA 3UPFA 1T03A 3D3CJ 2E5IA 1EX4A 4RW9A 4LF9J 2QA4G 4R79A 3BSOA 4CK1A 1RKIA 3AVKA 4J9PA 4FZVA 2XS7A 4MQ3A 1SBRA 1TUWA 3QJPA 4QYZJ 4TNOA 1U1MA 2KO1A 4PG8A 1VQ4S 2DGUA 2OKQA 4B3SK 1PBUA 1OWXA 3M1FA 2M2BA 3CIPA 1IKWA 3HZEA 3ZX3A 4CEZA 1HNXJ 2E7WA 2V67A 1CEZA 1RXOB 1I5OB 1F2GA 2O8BB 3JXUA 2J0WA 2GIQA 3TVKA 2MQNA 1NHVA 2ZJPQ 4PQUA 4DR2F 5CZ2A 3O1WA 5AQJA 2Q3PA 4FCYA 4I7FB 3I82A 4UF4A 5JVGL 1VK0A 2L41A 1FESA 3QEPA 1RE1B 2OHDA 2FGOA 4ZLNA 2Y3YA 2ZH9A 2FQQB 3PSFA 3CIZA 4OX9J 2V52B 3EICA 1RTDA 3NGIA 2V2KA 4HHJA 3BP8A