5I42A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer, azttp, and ca(2+) ion
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 141
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i42A05
1A5VA 4NLPA 4EBEA 3HPGA 4Q8EA 4AHTA 1X9MA 3Q8SB 1HYSA 3NBPB 3DLGA 1NJWA 3I8DA 3OYHA 4KHUA 1DTQB 4M3TA 5KGWA 4R0EA 3KK3A 5C24A 4K4ZA 4LD0A 1WNSA 3AO3A 1TV6B 3GQCA 3AV9A 3AA5X 2R8IA 5KG0A 3MEEB 4M3YA 1RCHA 3PW7A 3KOAA 1S49A 4DTPA 3IGVA 2ZE2A 2YNGB 2WB4A 2HVHA 3RMCA 2DFHA 1WSHA 4DQPA 3IAYA 5HBMA 4JRQA 3H5UA 5KFIA 2QK9A 3PX6A 4ED3A 3PR5B 4N41A 4PUOA 2FLLA 3WNHA 1KCFA 3KK1B 5HRRA 1KLMB 2O4GA 3CQ8A 1WN7A 3VQQA 2FBXA 2D41A 1C0UB 4WYWA 5C5JA 5EWEA 3RAQA 1HYVA 4FM1A 4ZPBA 1SV5B 1RTJB 2I5JA 1D5AA 2IAJB 4ECQA 1LW2B 3K5MA 3OYAA 1RTHB 1GOBA 1ZBIA 3FRZA 4CHOA 3SFGA 3OHBA 2W9CA 4CJ4A 4EYIB 1KRPA 3QESA 1ZTWA 3HVRA 2UUTA 4M3XA 1R0AA 1C1BA 2EC0A 5DG9A 3EPGA 4OKJA 1QSYA 3PY8A 4DFJA 3CFPA 4XO0A 3NGIA 3OYEA 1JLEA 4W5OA 5JXSA 2W9AA 4IDKB 4CEEA 2UUWA 1J5OB 4NLDA 3B6OA 3TANA 1T05A 2ASDA 4MFBA 4Z0UA 3RRGA 2HWHA 3V81A 4X2BA 2YNIA 3AVIA 5C25B 4MIAA 1C0UA 3U3GA 3OYLA 1KLMA 4ECUA 3LP2B 5HP1A 3UIQA 5K14A 3RR7A 3H5SA 3D0PA 1FKOA 4FLXA 1BI4B 4J9OA 1QAJA 4DG1A 3H59A 2QV6A 4CGDA 1X9WA 3DM2A 5D3GA 3GIJA 3VQEA 5DMRA 3QGIA 3KLHA 3DOKA 1VRUA 4FBTA 2FJVA 3CVKA 5I3UA 1X1PA 1QSSA 3RB6A 1L3UA 4CEBA 5J2NB 4FK0A 5CYMA 3M8QA 3KD1E 3VQ9A 3NMAA 1UA0A 3SUPA 4DTRA 1CZ9A 4DS5A 4KV8A 3DMJA 4FVMA 4IG0B 4O3NA 1FXXA 1JXLA 3HP6A 4MIBA 4BDYA 1TGOA 1S6PA 3VQDA 2WCXA 4F4YA 3DLHA 4FJ5A 1SL0A 3RB4A 4Z4IA 1BQMB 2JLEA 5CYQA 1NJZA 1IKYA 4C8LA 2HWIA 2D0BA 4JS4A 3KLIA 4CJWA 2BRLA 4RW8B 1VSDA 3HVWA 1RT3B 4DTOA 1SH0A 4TY8B 3VQ7A 4CGFA 2XY5A 4CEOA 3KKRA 3LWLA 5F8MA 2HHVA 4BWMA 4DTNA 3MEGA 3FQLA 4FLYA 4EBCA 4Y3CA 4CF1A 2KFZA 5HROB 4DF4A 4AH9A 1S6QA 1N6QB 3OYJA 4ZPCA 3OHAA 3ISNC 3D28A 4DL4A 1G15A 2ZQBA 5KFMA 4OGCA 2XO7A 5KFJA 1RYSA 4JV0A 3UR0A 5KFGA 2Z1JA 4WFXA 4M94A 4PA1A 4ZPDA 1MMLA 1TKXA 4ICLA 1LWCB 2BANB 2WRMA 1HPZA 1TP7A 5KG1A 1WSGA 4DSJA 4FLWA 3QETA 1ITGA 3KLVA 4FS2A 4CIEA 5K14B 5HP1B 3ZT1A 3DLKA 2AJQA 4FJMA 3QEXA 4ZVEA 5C25A 2UVVA 2O5DA 3TQ1A 1YT3A 1KFSA 3V81B 3L3UA 4ZVFA 4B9NA 4OLBA 4NLUA 1S9GB 1VSIA 1L3TA 2XCPA 1OS5A 2X6SA 4U6PA 3V6DB 4FJ8A 1TVRB 2G8IA 2P51A 3SQ4A 3AA2A 1XR5A 1U09A 5KFAA 1RT5A 1UA1A 3S3OA 2IJFA 1LWFA 2G8KA 5HLFB 4CJQA 4O5BA 2KW4A 4Y2AA 4KE5A 4KHWA 3NAEA 3QEWA 3DRSB 3IN5A 4DLEA 4FK2A 3CDWA 3AVAA 4ZVHA 5F8GA 3ZSQA 3DYAA 3FFIA 4ZMMA 3T3FA 4CJSA 3I5AA 2R8GA 2GBZA 1S1TA 2HHWA 2HHSA 4OL8A 4KAIA 3KHGA 5J1EB 3LZJA 4IRDA 3QGHA 4F3TA 1BISA 4DFPA 1IH7A 3L8BA 2JEGA 4ZP6A 4WE1B 4NRUA 4IG3A 1F21A 3NH1A 4FLVA 3KK1A 3TABA 3TAQA 4CJLA 3IG1B 3MXMA 5KG2A 1RT6B 4KTQA 3GV8B 1JLFA 4J9RA 4Y1DA 5L1JA 3IS9A 4YNQA 3L2RA 4BDPA 4XIUA 3DRSA 3G86A 3DI6B 2B5JA 3CDEA 4DL5A 1QS4A 5DQIA 4CF0A 2ZE2B 3HM9A 3K5LA 1ZYQA 1IKWA 4OKEA 3RBEA 3MF5A 3GYNA 2KQ2A 1VSFA 1VRTB 4ELVA 2OPSB 1S10A 4K4UA 2OPPA 4AHCA 4TQSA 3V6DA 3LDSA 4C8MA 3TAPA 4CCHA 3DLGB 1IKXB 4K4WA 3JYTB 4ZP8A 4RW7A 4F4KA 1JLGA 4DU3A 2XY7A 3CO9A 4O3QA 1KLNA 4RUCA 1EX4A 3VA3A 1CSJA 4OJRA 2D0AA 4GMJB 2G8VA 4CE9A 2B6AB 1SKWA 1NK6A 1HNIB 4FJJA 3V9ZA 4DLGA 4C8KA 1TL1B 1JL2A 4W5RA 1Y97A 3T5HA 4QWCA 1I39A 1HARA 4E7HA 1IKVB 1FKPB 1KVCA 3V6JA 1SKRA 3OL7A 2BDPA 4CGGA 4CEZA 4E19A 2ALZA 1WSEA 4DL2A 3OS2A 4HUGA 4LY7A 4B9TA 1ZBHA 3TR8A 4WXOA 3P1GA 4BACA 3CFOA 3L2VA 5FRNA 4ED8A 2FBTA 2YNHB 1RT1A 4DQSA 3ZSYA 4RNOA 2QXFA 1NKBA 1QTMA 4TYAA 4PWDA 4ECZA 3CIZA 4R8UB 4CJFA 3RMAA 2OH2A 2R2RA 1J53A 2D0CA 3LP0B 2UVRA 2IDOA 1NKEA 3VQ4A 4N76A 4I7FB 1S1VB 3M8RA 2WONA 4FYDA 4O3SA 1EETA 1RT2B 4OGEA 2E9TA 5KFPA 3QNNA 2FJWA 5KFOA 2RPIA 1S1VA 3TVKA 3LP0A 4CGIA 1BQMA 4CERA 5F8NA 1RTIA 3AO4A 4FJKA 1RDBA 1RDAA 2OZMA 1RBUA 3ZSOA 2YNFB 2OZSA 4KV8B 1C0TB 1YVFA 5DGBA 4F2RA 4IFYA 1RBVA 1XR7A 1VRUB 4KSEB 2DPJA 4R5PB 4O4RA 4TYBA 1QUVA 2VG7A 4QW9A 1JLBB 4DEZA 4I2QA 5KG5A 3H08A 4CJ5A 3DLRA 3H5XA 1IKVA 3PW4A 4EEYA 2ASJA 2E9RX 3N6LA 1X9SA 4DU4A 4XPEA 4N56A 3QZ7A 3BSNA 2HNDA 3V6KA 3BR9A 4W5NA 3M9OB 4KKOB 2E6LA 3LPUA 4J9SA 4YR3A 2LSNA 2ATQA 1WLJA 3ZSVA 1IKXA 5KT7A 1FK9A 4CESA 2RDJA 5KI6A 4IDKA 5KFWA 2XC9A 3V1QA 1NJYA 1B9DA 3AVNA 4DL3A 1VRTA 1CXQA 3DRRA 4KFBB 1R0AB 3UQSA 3AVLA 5KFNA 2IM2A 4EP4A 1LAWA 1JKHB 2YKNA 2XCAA 5KFDA 3O4NA 4ZHRA 1RT7A 4NLTA 2R2SA 4NYZA 1JLFB 3N6NA 3IG1A 2BE2B 2ATLA 3KK2B 1O1WA 1RDCA 1UAXA 4MK7A 4PQUB 3ASMA 5KRTA 5JS1A 3AO5A 3M8PA 2XRIA 3EY1A 4K4XA 1N48A 2HHXA 3QIPA 1VSKA 4ELTA 3MEDA 2G8UA 4B8CA 1DLOB 3DLEB 2C2RA 3MECA 3NHGA 1XC9A 5KFQA 3B6PA 4KHYA 4FJLA 3DOLA 4IKFA 2YKMB 4K4YA 3FFIB 3NF6A 1HQUA 1UWBA 4DQRA 5J2QA 4DMNA 2VG7B 4J2BA 1Q8IA 2WK4A 4KHRA 3C6UA 3VQCA 3NH0A 4Y1CA 4URQU 4QWDA 3UPFA 1SH2A 3GIIA 1S4FA 4IRKA 3K5OA 3KK3B 1C0TA 3GIKA 5J2MB 1RT4B 3QEVA 1WSJA 4CJRA 4AHSA 3OVNA 2YNFA 3K2PA 3AVMA 4CEAA 2R8HA 2HMIA 2XY8A 1T8EA 3KLGB 4J9PA 1BL3A 2QKKA 4KRFA 1XR6A 4NLRA 5EUHA 3KD5E 4Q0BB 4IH5A 3LWMA 3H98A 1L3VA 3PW2A 3V1OA 2PZSA 4W5QA 3PW5A 2RKIB 1RT2A 3PV8A 3HYFA 4HCBA 2OPQA 4QOZB 4I7FA 4J9LA 5KFZA 4J2AA 1L5UA 4FJNA 3KKSA 4B9SA 4NLOA 4CJKA 1LWEB 3T1AA 2F8EX 1RILA 2QKBA 4JUZA 4B08A 4N47A 3ZT0A 3ICLA 1SL1A 4R8UA 4WZMA 4PWDB 4TQRA 4GC6A 1XI1A 2XWYA 3S9HA 4DSEA 3SCXA 1XHZA 5HRPA 3IRXB 4ZP9A 3Q8QB 4FM0A 3BDPA 5I42B 4IRCA 1N6QA 1TQLA 3G6XA 4KB0A 4WYLA 3NAIA 3RR8A 3QIOA 3S3MA 4QWBA 4HKQA 4M3RA 4O3RA 1RDDA 1VSLA 4G3IA 4O44A 5FDLB 3NKYA 1RT3A 2R2TA 3ISND 1TKDA 1S9EB 1U48A 3OYBA 2RDIA 3CM5A 3LZIA 3RTVA 3SQ0A 4NCAA 4M95A 1QE1A 4RZRA 4IR9A 4ED2A 1WAJA 3OYDA 4RW7B 3Q8RB 1ASVA 3V4IB 3I5BA 3SUQA 1KHWA 4ECTA 1TKTB 2HHTA 3SUNA 2BRKA 2AGQA 5J2MA 2YNHA 2VA3A 2OPPB 4K4VA 3AVCA 3HSTB 3KTQA 4Z4EA 1ASWA 5CYMB 1TL3B 5EWFA 2IC3A 2P5GA 3SI8A 5I3UB 2FLPA 3PJXA 2FVSA 2F96A 2NUBA 3DI6A 2V4QA 5J2QB 2VG5A 3IS9B 1HQUB 2DPIA 4KHSA 3PW0A 3QGGA 4FW2A 1TL1A 2FLNA 4Z4CA 4B9MA 3QLHA 4CJUA 1HYZA 3LP2A 4URSA 2UVWA 3ZT4A 3LANA 2XGQA 3TWHA 4JS5A 3IGNA 3BGRB 4G1QA 3HO1A 1QSLA 3QIPB 4HHTA 3KLFB 2AU0A 3T5JA 5DLFA 2VA2A 2XHBA 3SFUA 4PQUA 4CK2A 4RNHA 3RBDA 4IR1A 2KZZA 2C2DA 3VQAA 4HVJA 5KFUA 1WAFA 4CIGA 3OYIA 4OPJA 3SPYA 4JLHA 1Q9YA 4W5TA 4NLWA 3NL0A 1C1CA 1YVUA 3N6MA 2OPSA 4Z4FA 4LH5A 2KTQA 3SQ2A 4HYKA 3ZT3A 1JKHA 4M3ZA 1S1UA 1JL1A 3L2UA 3V9XA 2DFFA 1SH3A 2BQRA 1RT5B 4M45A 3NE6A 4KBIA 4YFUA 3LPTA 4CEQA 4ECSA 4FW1A 2KFNA 1SUQA 3HJFA 2C22A 1Z25A 5DG7A 2CKWA 4H54A 4J9MA 1BIZA 1XHXA 3CWJA 4XPCA 4DSFA 3KIOA 4NYNA 3TAMB 3DDKA 4CJTA 3KLFA 1T3NA 5CZ2A 1D0EA 4F3OA 4WE1A 1U04A 5DGAA 4F8RA 2RF2B 5J2PA 3OY9A 4PUOB 2IGIA 1JXBA 3OJSA 4JV1A 2HAIA 3OLBA 1TAQA 1RA6A 3ZSWA 3BSAA 1S48A 3U6FA 1C1AA 4F50A 1K1QA 1EKEA 4M41A 4CK1A 4CFBA 4AILC 3THVA 4H4MA 3E01A 2YNGA 1GOAA 4CECA 3EZUA 1HRHA 4FS1A 5HRSA 1TL3A 3U3YA 4KHNA 4DSLA 3BSOA 1TK5A 5KFVA 3MAQA 1T7PA 4EO6A 3VQPA 4QAGA 4IH6A 5C24B 4Z4HA 2C2EA 3CYMA 4H4OA 1DTQA 3O3HA 3K5NA 4E1NA 1HQEA 3NBPA 3HVAA 4KAZA 3G10A 2XY6A 3K57A 1HNVB 2YHBA 4EBDA 4FJHA 4RW8A 4Q44A 1IKYB 1S9FA 2WONB 4E7JA 4YMEA 3ULDA 5CYQB 3M8SA 4RU9A 2HNZA 4YQWA 4H8KA 2DTUA 2EHGA 4KTWA 3OYMA 2OA8A 4O4GB 1D9FA 1HPZB 5E41A 4IG0A 4ICLB 1NKCA 3DMJB 5KFTA 1RT1B 2I1RA 5L1IA 4ED1A 3D5MA 1BGXT 3NDKA 5DQGA 4CJPA 1S1XA 4E3SA 2VG6A 5DG8A 3M8QB 1LAVA 2JGUA 1VSEA 1JLAA 1ZTTA 4RNNA 1LV5A 3KLHB 1RBSA 5D3GB 3RB0A 3OLAA 2B43A 3MXJA 1D9DA 3EPIA 3KLEA 2OPRA 3MEGB 1QQCA 2WOMA 1FKOB 2OPQB 1WNEA 1T03B 4QWAA 2Y1IA 2XI2A 4FZXC 3KJVA 4URGA 1HNVA 4DS4A 5KFRA 3BQ2A 4KHMA 1S6PB 1U4BA 1T05B 4ECXA 4MK8A 1NK5A 1GX6A 1RT4A 4MK9A 2V0NA 2FVPA 1CLQA 3UDLA 2GUIA 3PJWA 4DTMA 3ZSXA 4NCGB 1ZBFA 5KRSA 2JEFA 4YR0A 2W7PA 2YHAA 4F4XA 3OYFA 4AHUA 5F8HA 3V9WA 1IKWB 4QCLA 3DOKB 3E51A 2FBVA 2FJXA 2JC1A 2B5JB 3PO4A 4FJIA 3HT3A 1UWBB 2YKMA 4DG1B 5CY4A 3LP3A 1BI4A 1LW2A 4GVMA 3QO9B 3CJ3A 4FJ9A 1DTTA 3SI6A 4DFMA 1DLOA 3MEDB 4EP5A 4YP3A 4CJVA 3ZT2A 3AVFA 1DTTB 4B9UA 3SYZA 2P5OA 3KK2A 3HL8A 2BE2A 4TSXA 2FBYA 3TAFA 3SJJA 4RNFA 4OVLA 4MQ3A 1B9FA 1JLEB 4ZHRB 3GIMA 4ED7A 4KI4A 5KFXA 1I6JA 5HLFA 4KFBA 3EZ5A 4ID5B 2KZMA 4LSNB 3QEPA 2HHQA 4CHNA 1C1CB 2R8KA 1W9HA 4BDZA 4QPXA 1C0MA 3KHRA 4DF8A 1XWLA 1KHVA 4ZTJA 4Y34A 3LALA 3ITHB 3MFHA 2HB5A 1FK9B 4CFDA 1HYSB 3QZ8A 2VWJA 3CJ0A 1S9GA 2IAJA 4NLXA 3VN5A 2I5JB 4I9LA 1SV5A 1S0MA 3KJVB 4C8NA 1J54A 4BE2A 1GX5A 3HPOA 1BIUA 5CZ1A 3OSPA 3EYZA 1T03A 3WNEA 4DSKA 3PVXA 4CF9A 3K59A 2WOMB 4Q43A 4LQ3A 2W9BB 4ZTFA 1TK0A 1ZETA 2OYQA 1W0HA 2IS3A 2CJQA 2GIQA 3RB3A 3RMDA 5KFFA 2XI3A 4YR2A 4R5PA 2F8TA 1ASUA 5KFSA 4HUFA 4K8ZA 3JSMB 2VG6B 4I2PB 5DQHA 3G6VA 4IFYB 2VWKA 3NF8A 2G8HA 3QNOA 4MH8A 4M3WA 5KFLA 3RRHA 4O4GA 5HROA 2GIRA 1RTIB 4FZZA 1CXUA 2HNYA 4Q8FA 2HNZB 4I9QA 1QE1B 2D7SA 3LP1B 5KG4A 3SQ1A 4NLQA 4DL6A 4WXWA 2WHOA 4IKAA 4BE1A 4O44B 5FDLA 3I0SA 4MKAA 4E0DA 4F2SA 5C42A 2W7OA 2IA6A 3K58A 4QW8A 1YTAA 4ID1A 3VQBA 1NOYA 2HNYB 3V9UA 2UVUA 4CGHA 4KREA 2IJNA 5KT5A 3AA3A 2JC0A 3AVBA 2X6NA 4E89A 5KFKA 3LAMA 3KNAA 1HQEB 3DRPB 4MKBA 3GILA 4IBNA 4Y2CA 5EU7A 4IOBA 5KT4A 1BQNA 2W8LA 1TAUA 4IH7A 1WSIA 3O3FA 2GC8A 4I2PA 1RBRA 5L9XA 5KFEA 1BCMA 3H4BA 2AX0A 1S1WB 1A5XA 3O4QA 4K50A 4H4MB 2PYJA 1HMVA 3M9MB 1T94A 4AHVA 3H40A 3L2WA 3RWUA 1FKPA 3SZ2A 4FLZA 2E6MA 2W9BA 5J2PB 4CFAA 1JLQB 2G8FA 5KFYA 1HNIA 5F8IA 2FVQA 1EXQA 3NF7A 5T7BA 2ETJA 1RTDA 3OYKA 3HKWA 3TAMA 3AVHA 4Q0BA 1TKZB 3BSCA 4ZVGA 4CJEA 2X78A 3JYTA 3CG7A 1VSHA 1B92A 4KB7A 4U7CA 1W25A 2HMIB 3ITHA 3HPHA 3MR2A 3OSNA 1NK0A 1N56A 4Z4GA 4KPYA 3C95A 4LSLB 3C6UB 4ID5A 2E4LA 4FM2A 4FJ7A 4KO0B 3HHKA 1NJXA 4ZP7A 1I3AA 4CGJA 3C6TA 3NFAA 2W9CB 4Q45A 5SWMA 3SNNA 2V4RA 3O3GA 5JUMA 3SPZA 3PZPA 2EX3A 4B3OA 4N5SA 1J9AA 4TY9A 3TAEA 4NLYA 3DLEA 1D8YA 3M9NB 3GV5B 1S5JA 1RTJA 1JLCB 3CJ2A 1RYRA 1N5YA 2QE5A 3AA4A 3QO9A 1NK7A 4B3OB 3QLHB 3AVKA 4O3PA 3CFRA 4FCYA 1S1TB 3OS1A 1HJRA 1RBTA 3MR5A 1RT7B 3C6TB 3PHEA 2VG5B 4ECRA 2J6SA 3OL9A 1A5WA 3MTKA 3L2QA 2IC3B 2ITGA 3DRRB 1NOZA 3I0RA 3BQ1A 5JS2A 4NCGA 4M3UA 1TV6A 4EO8A 2BR0A 3T19A 3KMQA 4BWJA 4ED0A 4RW4A 4E1MA 3NGZA 2BGGA 4TXSA 4PY5A 4FJGA 5KTQA 4EYHB 3FSIA 3MR6A 4NCBA 1BCOA 4HUEA 3OL6A 3A2FA 1EP4B 1NHVA 2RN2A 2BQ3A 4FXDA 3V4IA 4K4TA 1REVB 4ED6A 4CHZA 5KG7A 4OLAA 5KT2A 1U49A 2Z1GA 4J2DA 4IFVB 1S9EA 3Q8PB 4ECYA 4FLTA 4B9LA 3QEIA 2HNDB 4E7KA 3KHHA 4J9NA 1NHUA 2V9WA 3I5CA 3SV3A 3PR4A 2AGPA 3KLEB 4M42A 2HVIA 4I2QB 4DWIA 1HMVB 1SL2A 3BREA 4CEFA 3VQ6A 4HTUA 1JLAB 4FJXA 4NLGA 3IRXA 3MFIA 4DTJA 2IM0A 2XGPA 3NGDA 2Y1JA 4B9VA 3HVTA 4LQ9A 1C2PA 3AVJA 3LAKA 1K1SA 3CJ4A 4RW9B 4WFYA 3PX0A 1S6QB 3G0ZA 4L8RB 2B4JA 4UQGA 2Z1IA 3L3VA 2FVCA 2A1SA 3P5JA 3ZCMA 1Z26A 1N4LA 1Z4UA 3QIDA 4J9KA 4NYFA 4RW6B 3I0SB 4F4ZA 4ECVA 5DLGA 4CHQA 4CIFA 1EETB 1ZBUA 4FK4A 1U45A 3LP1A 4OPKA 2IM3A 2AWZA 4BE0A 2D3UA 4RUAA 1VSMA 2D5RA 1KVBA 3PUFA 3KLGA 1EP4A 4RNMA 1VK0A 3P83D 4RW9A 1CZBA 3SUOA 4H4OB 2J6UA 4DFKA 4CJ3A 1L3SA 2JEJA 4Q5VA 2C28A 4NRTA 1RA7A 3HVTB 2ZKUA 4EZ9A 2F8SA 4CHYA 4HCCA 4C8OA 5KGXA 4J2EA 1VSJA 3I0RB 3JSMA 5KG3A 5J2NA 2HHUA 5SZTA 5EWGA 2IOCA 4DTXA 1YTUA 3TI0A 1C6VA 5FROA 3E01B 4CF2A 4CEDA 3DM2B 3G6YA 1NNDA 4DQQA 4GW6A 1RAJA 1SKSA 3DOLB 3F73A 3WNFA 3WNGA 4GC7A 4JRPA 2Q3SA 2O4IA 2RF2A 3MECB 2B6AA 1RDRA 4ECWA 4JV2A 2YNIB 3VA0A 4TN2A 2ZD1B 3RMBA 1S0OA 2IMWP 1JLGB 3M8PB 3ZSZA 2AQ4A 1REVA 4FBUA 4MFBB 3T5KA 3QINA 2W8KA 1J5OA 4O0JA 3V6HA 1SUQB 3TAGA 3V9SA 4RW4B 1MU2B 4DSIA 3AVGA 4KI6A 1UOCA 1JXEA 2HW3A 2YKNB 3OYGA 2X74A 4LSNA 1C1BB 1S1UB 3H5YA 4LSLA 2R7YA 3NCIA 4O0IA 5F8JA 2DFEA 5FRMA 1NK8A 2A1RA 1MU2A 4O3OA 5KT6A 4KTZA 4CFCA 4WFZA 2Z1HA 3OYCA 1RNHA 1RT6A 4DTSA 1NK4A 1RTHA 4FZYA 5KT3A 3OL8A 4F4WA 3QERA 4NLVA 5KFCA 5KG6A 1QAIA 4KB1A 1KSPA 3OYNA 1TKZA 3S3NA 2ZD1A 3TARA 1N5YB 4KKOA 4IG3B 1RTDB 4WZQA 1JLCA 4K8XA 3BGRA 4G1QB 3OJUA 3NH2A 5DK5A 4AHRA 3VQ5A 2AGOA 2ILZA 4E7IA 1JLQA 3C94A 5J1EA 3NF9A 3FDSA 1JX4A 4CF8A 3HXMA 2PYLA 4O55A 4LH4A 3NGYA 2DY4A 5HBMB 2W42A 1KVAA 3NAHA 3DYAB 1ZBLA 2D3ZA 2R2UA 1JLBA 3MXIA 1WSFA 1BHLA 3VQ8A 1U47A 4KO0A 1KFDA 4NLSA 4QWEA 2PY5A 1LWFB 3PX4A 5KFBA 3MEEA 3MR3A 3ZSRA 3ALYA 4IQXA 4OKKA 3CJ5A 3BQ0A 1S0NA 1TVRA 3HP9A 3DRPA 2J6TA 2ASLA 1TKTA 4EZ6A 4ELUA 1JIHA 2R8JA 2BQUA 1S97A 4E7LA 1K6YA 3GV7B 2WTFA 3CM6A 2E9ZA 5HRNA 3F9KA 1LW0A 4TLRA 4DU1A 4NZ0A 4RW6A 3DLKB 2YV0X 1NK9A 3H2LA 2IBKA 4FLUA 4CHPA 5EDWA 2JEIA 2OPRB 3BJYA 5L1KA 3T5LA 4RG8A 1IG9A 4J9QA 3KHLA 5F9LA 2P1JA 1LWCA 2BANA 5I42A 1S1WA 1TKXB 3D45A 5T14A 3KMSA 1Q9XA 3CDUA 2FVRA 4ZPAA 1S1XB 3VQSA 2GV9A 1TK8A 2FC0A 1GOCA 5L1LA 1BQNB 2G8WA 2ILYA 4K4SA 1KTQA 3QYYA 1IO2A 1D1UA 2AX1A 5F8LA 3AO1A 3AO2A 4DTUA 3PO5A 4KHQA 1LWEA 3V1RA 5KFHA 3SV4A 3DLBA 4B8AB 3FQKA 4CK3A 3OS0A 5F9NA 4DL7A 5C42B 1QHTA 2RKIA 4TY8A 3HK2A 4DQIA 3KLIB 1IM4A 2IM1A 4IFVA 1LW0B 3RAXA 3H4DA
chains in the Genus database with same CATH superfamily
4EBEA 4HDGA 1UP1A 3PNIA 2QWQA 4CTAB 1NJWA 4DV3F 3I8DA 1VHXA 2DEIA 1DTQB 5D15A 5KGWA 3NS7B 4MMOA 5FPMA 4NZ6A 3GG1A 1WNSA 3KHYA 3AA5X 5KG0A 4M3YA 1RCHA 3PW7A 1Q7YO 1S49A 3GFYA 2UUBJ 3P96A 4OZ3A 3WHIA 2ZE2A 3DHWC 5F41A 3ZTSA 2YNGB 2WB4A 1YTYA 1FWLA 4M7XA 3N9UC 4DQPA 2W2MP 3MURP 3EZWA 3H5UA 3CMES 2NPFA 2FLLA 1GNKA 3WNHA 5AT1B 3EZOA 5HRRA 2O4GA 2FY8A 1WN7A 3CC4N 1C0UB 5C5JA 2QWPA 1NG9A 1OMSA 4FM1A 4ZPBA 2XSFA 4CLTA 1J27A 1Q86T 2FGOA 3S41A 2GELA 3PXGa 2VHGA 1GXLA 1LW2B 3MMAA 3HHLA 2UXBF 1ZBIA 5LL6Z 2PD1A 3OHBA 2UUBK 1WHYA 3QESA 4ZJQA 2FPHX 2FQQB 4F3QA 2UUTA 4M3XA 4X65K 5AJ3J 2P9LB 4OKJA 2VFTA 1QSYA 2Q1LA 3CFPA 4K5SA 4IYQA 3OYEA 3ZNJ1 5BR9A 2N7YA 2W9AA 1MROA 1K9MO 1YZ6A 2Z57B 3O9RA 4CEEA 4MJKA 2ASDA 4FPRA 4MFBA 4O23A 1F5AA 5D77A 2OIHA 4X2BA 2DY9A 3CMAS 3AVIA 4FF1A 5C25B 1HPMA 1SQEA 3OYLA 1DAXA 3IP0A 5HMYA 3LP2B 5K14A 4ILJA 4B3MK 1FKOA 4FLXA 3QGPA 5B0DA 5DETA 1VQ5S 2QV6A 4CGDA 1GQEA 2AJ4A 2CVEA 3VQEA 1N33F 1G4CA 3DOKA 4DX7A 4XTTA 3Q0AA 2FJVA 5IM0B 3RB6A 1AA1B 4CZMA 3Q7CA 2EFNA 2FXUA 1UA0A 1WG1A 4KH6A 3FK4A 2X7IA 2M8DB 3DMJA 3JTOA 5HVFA 2YXLA 2AYBA 1KS2A 1JXLA 5ETPA 4X62F 4ZOSA 1KVIA 3VQDA 4C8ZA 4MDBA 3CCUN 2JLEA 5A2QU 1CJKB 4RBVA 3KLIA 4CJWA 2BRLA 4DTOA 1RT3B 4TY8B 3NLCA 2ZM6F 3MEGA 5KPZA 1M90T 4Y3CA 3FBFA 1PJ5A 2F8HA 1SZ2A 4B17A 5CXTA 3C15B 1KOHA 4DF4A 4Y2MA 2ZH5A 1UVJA 2FHJA 5A6PA 3ISNC 4G9ZA 3D28A 4DL4A 1N88A 2CUYA 4MYUA 4H0OA 2W41A 4JV0A 3UR0A 4ANCA 2DH9A 3CPWM 4ZPDA 1TKXA 1MG7A 1HPZA 3THPA 4BQZA 2RD5C 4CBXA 5KG1A 2KXNB 3BH6B 4DSJA 3DLLQ 4FLWA 2BZ2A 1ITGA 4DV4K 3KLVA 3NNAA 4CIEA 2QSFA 3FZMA 3CJAA 1Q1KA 1F2HA 2UV8A 3DLKA 3EGVA 4X84A 3J7ZO 2ROEA 5KOWA 4DZDA 2DNOA 3MM9A 3ZEUB 2LXFA 3TVYA 1S76D 4B9NA 4OLBA 3HHDA 3THWB 2YJEA 2VUGA 2X6SA 3QFUA 4M5KA 2ZH9A 2ZF5O 1M1GA 1YK9A 4FJ8A 4QJVA 3U02A 4DX8H 1TVRB 1RWOB 3BGFA 5AR0A 1ATRA 3M05A 1WUAA 2WSFC 4B1VA 3DCAA 2RH3A 1U09A 1UA1A 2PFDA 3WXIA 2IJFA 3W9JA 1NB7A 4P2FA 2LP4A 2NYHA 4CJQA 5AE1A 4JV5K 1Z2LA 3QEWA 1HNZJ 4DLEA 3BGUA 4E98A 3AVAA 3ZSQA 2MTLA 4PQAA 4QYZK 4UOGA 4KR0B 4CJSA 3J81U 3OTOF 2NNWA 4KAIA 1GH8A 1GLFO 4IRDA 4WU3A 2L9DA 4QU6A 1MMDA 2HBLA 4ZP6A 2KT3A 4LREA 4FWSA 4EU0A 4IG3A 1UL3A 3CNQP 2NREA 2VU5A 3NWGA 1XK8A 4FLVA 5AE3A 2W01A 2W7AA 1YGYA 2HOEA 3MM6A 3IG1B 1RZMA 4KTQA 4J9VA 4J9RA 4Y1DA 1WKKA 3AFGA 2I2YA 1P1LA 4H0PA 2IBOA 1RHUB 3L2RA 3A0IX 2B0GA 2R7OA 3NRBA 2QWOA 5LJ3Y 2ZITA 3MF5A 2KQ2A 2I6WA 4Y2IA 2V2KA 3ENWA 2HVEA 3R8EA 4TQSA 3V6DA 2HHHF 3TAPA 2DNYA 2O67A 5J1PA 2DYAA 1JLGA 5KPRA 1E6VB 2XY7A 4O3QA 1EX4A 1CSJA 2CG4A 2BBEA 4GMJB 4CE9A 2B6AB 5A8KB 4FJJA 4DLGA 1JL2A 4W5RA 1HARA 1NGBA 2DPNA 1IKVB 2BM0A 2C3UA 2M70A 1FKPB 4OZ1A 2W2NP 4DV6F 2ALZA 5KPTA 4AM7A 2BJ9A 3DWLA 2MPUA 1T95A 3M1FA 4P73A 3MMBA 3V4MA 5A8WB 4DR3K 2M9KA 4OHVA 3P1GA 1YJ9N 3CFOA 3MM5B 3THYB 3L2VA 2RHSB 2YJFA 5IWAK 2FBTA 4DQSA 1VQ8S 2YCHA 1RB0A 4RNOA 1QTMA 2QXFA 2NR0A 1AW0A 3ZETA 4TYAA 3D2EB 4PWDA 1RADB 4R8UB 3RMAA 4X64F 2HZVA 1J53A 1G3OA 4Q2MA 4JI1F 2D0CA 4DUZJ 1FDDA 1HLWA 1IBCB 3LP0B 2UVRA 2IDOA 3GPAA 4N76A 2YWKA 2GX9A 4O3SA 2XZWA 4ES1A 3G25A 2O8DA 3NGUA 2E9TA 1NM1A 1NH8A 2PMHA 2O8DB 2RPIA 4ZIWA 1TMJA 2IMOA 3VPZA 1I1GA 3LP0A 4CGIA 1BQMA 1RTIA 1SIZA 2AEMA 2Z2LA 1RDBA 1GAOA 5GAEP 2OZMA 2OZSA 3MDQA 4OV6A 4KV8B 1YVFA 4YDXA 2MQ8A 2VQFF 3HZ6A 3TEGA 4NMLA 3VZHA 1RBVA 1HNZF 1FF2A 4DU7A 5HQ8A 1I94F 1XR7A 2KM8C 1FX4A 3IXQA 2XNQA 4QW9A 4B3MF 5GADP 3FCHA 5KG5A 3P45B 1FNOA 1IKVA 3PW4A 1RU1A 4EEYA 2ASJA 4IO8A 4H0VB 1Z2ZA 4N56A 3BSNA 3V6KA 2B8QA 4YN3B 3BR9A 4K0KJ 4F9OA 3JS9A 1ZM2A 3ZZPA 2UP1A 3TA0A 4P72A 4YR3A 4JAXA 1M5KC 4F0HA 2ATQA 1WLJA 1B0TA 1FK9A 3D0IE 2RS2A 4LF6K 5H9FK 3MPYA 5KFWA 1SJQA 3QQCD 1NJYA 3T6JA 3CMEN 1XMOK 3AVNA 1OPIA 5BPMA 4Y2KA 4XEIA 3PACA 1WD6A 1UMJA 3AVLA 2IM2A 1LAWA 1AUDA 5KFDA 1UPPA 4A46A 3MWPA 2JJ4D 2R2SA 2JX2A 4S0MA 5CCMA 3OR2A 4LRCA 1IVZA 4BRPA 4AF1A 3IG1A 2BE2B 3AB2B 3KK2B 3ENQA 3PYDA 1A0OB 1UAXA 4MK7A 3ASMA 1ZPVA 3M8PA 4F7VA 5AZJB 4K4XA 1N48A 2HHXA 3QJPA 3QIPA 3HI9A 3MEDA 4ISFA 4B9QA 1DLOB 2QA4N 1OH8A 1BOTO 2VC0A 4DCOB 3C0BA 5KFQA 3TR5A 5GAHU 1JQGA 1XNRJ 3CEDA 2AYEA 1HQUA 2ZUGA 3T69A 1PAUB 4WP3A 2MKKA 1X4BA 2HIYA 5LMUF 2PEBA 5CZXA 2A3JA 5BPLA 2ZH1A 3NH0A 4Y1CA 4URQU 4JI3F 1J5EK 1S4FA 3HF5A 3KK3B 5T7LA 2Z4PA 4PWUA 3QEVA 4AHSA 3OVNA 2YNFA 3K2PA 4CEAA 2XTJP 3E3XA 1XR6A 3B4MA 2BH1A 4DV7J 1FJGF 3H98A 3ZTPA 3CJQA 4GKKK 3MM9B 4EI2A 2FDNA 4LC9B 2J0XA 2PZSA 5BYSA 4UUWA 3R8YA 3D67A 4J2AA 1HWKA 3IAM9 3T1AA 3ICLA 3UKUB 1HHSA 4GC6A 2XWYA 3MDFA 2EG2A 1WSVA 4LBHA 2J0SD 2HBKA 3M32B 3IMXA 3EMTA 4DSEA 1RACB 3IRXB 2LYVA 3Q8QB 3VAIA 1NBWA 2QM1A 3I55N 2XMMA 4IRCA 4JI2J 3CE8A 4WYLA 3L4QA 3NAIA 2GA7A 1IBKK 3S3MA 1WJ9A 3JS6A 4ILRA 1RDDA 2XULA 3WBZA 4O44A 1RT3A 3I4HX 1S9EB 4Y0WA 2RDIA 5TKYA 1FDBA 1HNXJ 1JB0C 2GCFA 1WAJA 3TJ8A 1ASVA 3U9DA 2ZHBA 4OJ3A 3IM9A 1OYEA 1VQLN 1TKTB 2E1RA 2YNHA 4K4VA 1RCXB 2P9KB 3A3PB 1TL3B 3C6AA 4JI6J 2FVSA 4CO1A 1YRUA 2ZH6A 2NUBA 2CZVC 5H1SV 4FVCA 1P27B 2CQ0A 4C0BA 1YJWN 3TPQA 1DFDA 2AP1A 3IBCB 2IFXA 3RVCA 5LXRA 4CJUA 3LP2A 3WC0A 1WOOA 2KXFA 3LANA 1JJ2R 3TWHA 4NXNK 2IVNA 4G1QA 4LF5K 2AU0A 3T5JA 3M30A 3CJ1A 1ZM4A 3HZEA 2ZVIA 3RBDA 3CCEN 2CDRB 1EKSA 2C2DA 2VPZB 3JTNA 3AGKA 3VZIA 1MROB 3E9LA 2EFQA 4CYUB 1NAQA 1YVUA 2KM8B 2EFVA 2KTQA 3ZT3A 5FPNA 2P9LA 2B4UA 4G1IA 4DUTA 3CJ7A 4CZKA 3L2UA 4G6VB 3MM8A 3GMGA 2YHYA 2GJFA 4KBIA 3UVJA 1UW9A 2GQCA 2H3EB 4CEQA 3HJFA 2C22A 2EEYA 1MDUB 2CKWA 1U6ZA 3W2VA 1S77D 2Z0GA 2FHJD 2Z2YB 4LF2A 1BIZA 3CWJA 3KIOA 4ER8A 5H9EK 1TUYA 5AQOA 3CB4A 1DT9A 1HNZK 4A8WA 1L3KA 3KDOA 2YTCA 9ATCB 2Z56B 3NY0A 3L6QA 1XIQA 3TUJC 4DCPB 5DS7A 4IFEA 3H46O 3OJSA 5FD1A 3OLBA 6FDRA 4H0XB 4YOYA 5B09A 2CH5A 1U8WA 3R6GB 1RA6A 3BSAA 4LSZB 2QA1A 2YNGA 3EZUA 4C1NK 3G9CA 4FS1A 5HRSA 1CQMA 3U3YA 1T44A 2G1HA 1AB8A 5KFVA 3MAQA 4EO6A 2VBYA 1S12A 4ZVSB 4A8QA 1DTQA 1HQEA 5MLCV 4W92B 3K7RA 2DR7A 1HA1A 3HVAA 3ZXWA 3SQGB 5M1QA 3H7HB 1X5TA 2A6OA 1OVYA 3ZFVA 4IO9L 1Y10A 1IBLJ 1G6BA 5DDOC 1IJEB 4WCEL 4FL9A 1S9FA 3BGOP 1S4EA 1H74A 2BABA 3FMBA 4PG5A 2OA8A 4CLFA 2MB0B 3DDIA 3BYRA 5CHIA 4IG0A 1FNXH 3OXGA 2LLZA 1B7FA 5AFUA 1WC0A 1YIJN 3D5MA 1B64A 1WDDA 3VAGA 2XQCA 4CJPA 2U2FA 2KI2A 1KEKA 3S1TA 2QYGA 1LAVA 2P9SB 3PRDA 1RBSA 4HHHA 1HW8A 1OKJA 4DR1F 5TKWA 5D4OA 3BKFA 2ZGYA 3IKMA 1P8ZA 1T03B 4QWAA 4LRDA 3DXKB 4KH5A 3D7EO 4CZHA 4ETXA 1NB2A 4LFCF 3GG0A 3O9QA 5KFRA 2MGZA 3BQ2A 5DJBA 4USTA 1T05B 2CPJA 4JKFA 4M5DA 2DGQA 2OTJN 1GX6A 3J81j 1KAZA 2GUIA 4X4UA 1X3NA 4DTMA 2KYZA 3ZSXA 3Q8VA 2F63A 4AHUA 3FZLA 2KJVA 1XC3A 3PO4A 2A6AA 4GVBA 1UWBB 1YJ9S 2JFDA 5CY4A 4FP9A 4LF6J 1N32K 3HX9A 3QO9B 3CJ3A 1DTTA 3R6MA 4C3LA 1T9UA 1FJ7A 4EP5A 4YP3A 4CJVA 3E8OA 1FFGB 5M1FA 3ULHA 3I6PA 1T9TA 2CQCA 4B9UA 1N34F 2P5OA 1U2VB 1LFPA 1HBOA 4JK8A 2FJEB 2FBYA 1W97L 2ASYA 2RU9A 5GMEA 4JYAJ 1JLEB 4YEAA 3UVJB 4NMXA 4K7QA 2E2OA 3BPSP 3RU0A 5KFXA 4DV7F 2B51A 3MCPA 2NSCA 4A47A 4CYUA 1VQKS 4CHNA 3CUNA 2AYMA 1ZOTA 1W9HA 3NVMA 2VJUA 3QRQA 3KHRA 2EK6A 4DF8A 1XWLA 1KHVA 4GV6A 3LALA 3ITHB 3MFHA 1QLNA 2VWJA 1HYSB 2IYGA 1I94J 2IHR1 4I9LA 3P38A 3KJVB 1QAXA 2O8FA 3QATA 3O44A 2CQDA 4BE2A 1HLUA 1GX5A 2DGXA 5CZ1A 3WNEA 2CPDA 3K59A 4ZTFA 4U7UK 2AMCB 2OYQA 2UZAA 2IS3A 3UDVA 1UETA 5KOXA 4WQ5C 4JHDB 1WB9A 2Y9HA 1CPZA 5KFFA 4AL6A 2UU9F 1NGCA 4RX6A 4R5PA 1ASUA 4LF9F 5GAEU 1F3VA 1BY9A 3CCSS 4IFYB 3NF8A 2G8HA 3W1YC 3QNOA 4YHHJ 4O4GA 2VICA 4HHJA 2QWMA 1CXUA 3BYPA 2HNZB 2IJRA 4QR2A 3OBIA 1NEEA 1Y11A 1FXLA 4DL6A 2WHOA 4BE1A 4O44B 4E0DA 4MKAA 2YHXA 1AZSA 4AFFA 2J76E 1YTAA 2P9NB 3K0SA 2H48B 4C9DA 4JI3J 4H5RA 1U26A 3JTPA 3AVBA 4E89A 5KFKA 2Z2MA 3GILA 3M2VB 4IBNA 3BBBA 4C4WA 1F2GA 3W64A 1TAUA 1WSIA 3D0HE 5L9XA 1V4SA 4CZCA 5FLXY 5AQRA 4IOCL 1ZA2B 4ZPWR 4NEZA 3H4BA 3JXOA 1S1WB 4I6WA 4LF9J 1T6CA 1G7CB 1RWUA 3QNWB 4NI2A 4P6QA 5JLHA 5HI7A 2R7XA 3L2WA 3MPUB 1JXVA 4P10A 5B0BA 4P2MA 4FLZA 2E6MA 4IDHA 2W9BA 4CFAA 2MQOA 1N32F 5AQZA 1HNIA 2V5HG 2FVQA 4X66J 5F8IA 1VQ4N 1EX8A 3CJSA 5D0HA 4RTFD 3UNGC 2QMXA 4Z37A 1PKUA 2N7CA 4ZVGA 1Y4ZB 4DPYA 3MM7A 3JYTA 3TVZA 2FUG9 4U7CA 1W25A 3D1QA 3CCES 4JI5J 2VV5A 1GXTA 2EK1A 2E29A 4A8KA 1KAXA 4WIQA 2N82B 4WFNL 5MLCQ 4LSLB 5C7PA 1D9AA 1X3MA 4ID5A 1V3RA 3R3LA 1VDHA 3CC4S 2IA0A 3OR1B 1NJXA 2VBXA 2UUAK 1WTBA 3MD3A 3MPDA 2W9CB 5SWMA 1W7AA 2V4RA 2XSJB 2H3GX 4A8YA 4B3OA 3FEXB 3IBFB 4OI6A 4NLYA 1F6TA 1RTJA 3V2UC 4USKA 3CJ2A 4YB1P 2DXEA 2IRUA 3AA4A 1NK7A 3QLHB 3MAAB 3AVKA 3CTRA 4O3PA 3CFRA 5C0YA 4FCYA 1IQTA 3OS1A 3MR5A 3PHEA 4FWOA 4ECRA 1HBMB 3OL9A 2KT2A 1BXNA 1KDNA 4JKGB 3L2QA 2IDEA 2AEJA 2BX6A 3QT8A 3BQ1A 2VQEJ 3A8YA 4EO8A 5B7WA 3NGZA 2VFUA 4FJGA 4NCBA 5ETLA 2CQBA 3OL6A 1BCOA 4H0TB 2BQ3A 4FXDA 1RFQA 1VYAA 5KT2A 1U49A 4K43A 4LMZA 4IFVB 3M1VA 2AP6A 3Q8PB 4ECYA 1IBMJ 4B9LA 2ZBPA 1GLAG 2HBJA 3BN4A 4KRWA 4LF5J 3PFEA 4OFZA 1YZ7A 2V9WA 4BROA 5JMVA 4DZ6A 3UO0A 4ZKAA 1S5ZA 2AJ1A 4ES2A 3AOAA 4ED4A 4YB5A 3BREA 2HHHJ 3QRRA 4CO4A 3C2PA 3H8YA 1JLAB 1YSJA 2IM0A 3BO2A 1MN9A 1OY9A 4CM2A 5AFUH 3W63A 1C2PA 1WF2A 2QTDA 1NGFA 3B54A 3IFRA 1K47A 3LAKA 3CJ4A 1GTHA 4WFYA 1S6QB 3SIPB 2WW8A 4BRLA 2OLWA 3MN5A 2FVCA 2A1SA 3P5JA 3QIDA 4J9KA 2E7XA 4NYFA 4CI6A 3BF3A 5DLGA 4CHQA 1VQ8N 3CIPA 4CIFA 1ZBUA 1U45A 4OPKA 1CJVA 2DRBA 1HFEL 2D3UA 3PIPQ 2D5RA 3LOUA 2DTJA 2E8AA 1REGX 3QMLA 4FF3A 4CH7A 1CZBA 4DFKA 4CJ3A 4Q5VA 3K17A 2C28A 4EZ9A 3HSZA 3ELHA 2F8SA 4CHYA 3HMJG 4IJAA 3BY5A 4ZITA 4QU7A 1QVFM 1KWMA 5EWGA 2V9KA 2AYGA 3EXCX 4U67Q 4XDCA 1C6VA 4JKGA 3MCAB 2QFJA 3E01B 4FWKA 1O6XA 2RHQB 2QL9B 1NNDA 4JEPA 1H72C 2Q3PA 2OEKA 4YOEA 2MKJA 3F73A 8AT1B 4GVEA 4JRPA 1VQON 5DDQC 1BA0A 2B6AA 4ISEA 1YJNN 3M1VB 3RSEB 1VOMA 1RDRA 2ZBQA 4ECWA 3VA0A 2ZD1B 5GAGP 3RMBA 2I9SA 2IMWP 1JLGB 1SC3B 3T5KA 3POTA 5IZHA 1SUQB 3ZLJA 1RU2A 5DZ6A 2KHCA 1UOCA 1JXEA 2HW3A 3OR1A 4DDFA 2B4PA 2X74A 4LSNA 2FF3B 1C1BB 4DI6A 2RUGA 1S1UB 5IC4B 3PRBA 2WVFA 2FSKA 5HANA 4LSLA 2R7YA 4AQYF 1TU0B 1WEXA 1U1QA 1MU2A 4WTOB 1GK8A 2Z1HA 4DV5K 1JK9B 1RNHA 3QAEA 2HRUA 1JCGA 1QUPA 3GJTB 4DV2K 1FRJA 5ETSA 5KFCA 4FWLA 3MM7B 4JI1J 1KSPA 2FD2A 3DJCA 4F25A 3S3NA 1JJCB 4NZ7A 4IG3B 1FVQA 2A0FB 2ZVSA 3GYXB 4WQ5A 2H5IB 2DHSA 4AHRA 2AGOA 4LIRA 1OH5A 2DRDA 2H5EA 3FDSA 4CF8A 2PA3A 3CCZA 4C0OC 4DV1F 5LJWA 1N36J 3W9IA 2Y0BB 5HVGA 2LEAA 2RQKA 2WAQD 2PY5A 2HBZB 3MEEA 2LEPA 4WKYA 3Q2TC 2B4VA 3MR3A 3GFXA 4K0KK 3BUZB 4IQXA 2JFKA 1TVRA 1G1XA 3HP9A 4UOCA 1FCAA 1BUPA 4EZ6A 1FTRA 4ELUA 1JIHA 3HSCA 3KKFA 3L3CA 2DR6A 4M5NA 3SK3A 3PM9A 5GAHI 4J8FA 4TLRA 3WIVA 2POKA 3OTEA 2K1RB 3ZZ0A 3M3ZA 4NZ0A 3DLKB 2EBEA 2ZH8A 4CVNE 2IBKA 3ZTQA 3EGNA 3CCRS 2MSTA 1OH6A 5F3TA 1VQ6S 3KDNA 3MN9A 3LA0A 3NCRA 3KHLA 3O5TB 3MTJA 1S1WA 1TKXB 1URNA 2ZNYA 1HNWF 3CDUA 2FVRA 1J5EJ 4DJBA 2GV9A 1TK8A 2F5GA 1X4GA 5F0WA 2FC0A 2QZ8A 1KTQA 3QYYA 4NE9C 2MKHA 4QYRA 4KHQA 2WVCA 1LWEA 4B1UB 2BOPA 4DUYK 1MW7A 3K8VA 3Q7BA 4B8AB 3THXB 4CK3A 1YITS 3Q24A 3AT1B 2RKIA 4TY8A 1FVSA 3PEJA 3KLIB 2IM1A 1OSCA 2EKYA 1QTNB 1A5VA 1PBUA 3HPGA 3TA1A 1MWZA 4CH1A 3CJ9A 4Q8EA 4AHTA 1HYSA 3NBPB 1M90O 3DLGA 1WC6A 4JI4K 3OYHA 1YITN 1GMWA 4M3TA 4LD0A 4MLHA 4CQ1A 2HSEB 1TV6B 1F9FA 3UCGA 4DUYF 1U25A 1T3VA 3KOAA 1R3NA 4OYMA 2LU1A 4LBIA 2LFVA 3IGVA 4X4PA 4CW7B 3IWLA 5AXKA 3O4WA 4PXDA 1WSHA 5HBMA 3RW6A 1U1MA 2QK9A 4N41A 2YVSA 4O8KA 2C2MB 1N54B 2MQNA 1DBDA 1MWMA 3KK1B 2YHWA 3RZAA 2D41A 4I68A 4WYWA 4CWBA 4PCQA 3RAQA 2O8FB 1CS4A 1QZ5A 3AAPA 4LF4J 3TP2A 2JVRA 3GR0A 3VAHA 4ECQA 3K5MA 4LFCK 1RTHB 2XG8A 2OAUA 5AXMA 4DR4J 1SB6A 2OTLN 1BQXA 1SCJB 5LL6d 1KRPA 2FSJA 5L46A 1KTVA 2UXCF 3WQUA 1OJ4A 1ZTWA 2Q43A 3HVRA 5DG9A 2XMAA 1GTEA 1RBAA 4KH4A 2E5LF 3NGIA 1JLEA 4USIA 3NMRA 3ZZRA 3EVWA 4IDKB 3OVSA 2HHPA 2UUWA 1RGIA 3TANA 1T05A 3UCUP 2F9DA 1KQKA 1RJJA 3M8WA 4M63C 1U2VA 4LVOP 2OI2A 6FD1A 2HMPA 3SMSA 1U1RA 2NXJA 2M52A 1C0UA 4DV4J 1TUUA 2OHDA 2VQEK 3RR7A 3H5SA 3D0PA 3R1HA 4B3SK 3ZYYX 3H59A 3N4QA 1X5PA 3RGIA 4GVBB 3W2WA 3DM2A 3GIJA 1O8BA 5DMRA 3OTCA 4KHPF 1VRUA 3P5TL 3CVKA 4FBTA 1X1PA 4DR7J 1I3OB 2L9WA 2P9IA 3TTCA 2QTWA 3W7BA 3SUPA 4DTRA 4MKVA 2DITA 4FYYB 4W4MA 3D6TB 4IG0B 1F3FA 5IV4A 2MHEA 2XO6A 3I33A 2WCXA 3RAMA 5AQYA 4FJ5A 2VODA 3RB4A 2GGPB 4JI0J 3DAWA 1TL5A 5IT9U 1UPMB 4C8LA 3T1YJ 1DQ9A 1Q16B 3R5BA 1FDNA 4FKXA 4Y6IA 1VSDA 5HO4A 1HBNA 2BV3A 3VQ7A 2AEFA 3KUHA 2OP5A 2DNNA 3WXKA 4FLYA 3FZBA 1YJVA 2ZGZA 3D3BJ 4CF1A 3SQGA 1MMNA 2KFZA 5HROB 3PYEA 3FCWA 1BU6O 3OHAA 3EO3A 1NCLA 1G15A 2P9SA 3B4DA 4ZCLA 4ILLA 4ALZA 4DX6A 4OGCA 3R6LB 4GO5X 4A8XA 2Z1JA 4OMFG 1U1LA 4OI2A 2NZCA 1I5OB 1OY6A 1LWCB 2ZH2A 4FPAA 2EI5A 3G71S 2ZJQQ 3W2WB 1TR0A 3QETA 1OIAA 4HEA9 3HI0A 2W1BA 4FS2A 4E2FB 3QBCA 3SEOA 3MGJA 2ZH4A 3X1LB 3ZT1A 3UD4P 5AXNA 4HDHA 4BC5A 1H7XA 4BQLA 3TQ1A 1KFSA 3R9PA 5D78A 3L3UA 2XCPA 3TSQA 4U6PA 2R9LA 1NJIO 1BWEA 2WB1D 2P51A 1RKJA 1XR5A 1DHMA 5HLFB 2EFPA 4Y2AA 3H45C 5KQ8A 1IBLK 2DISA 3CDWA 4GRSA 1IBLF 3DYAA 4CRJA 3X3UA 3T3FA 1OVQA 4LUBA 2YWHA 3I5AA 1S1TA 1U2CA 2B7CB 3M6UA 3VF4A 3W9HA 2CA9A 3LZJA 1N33K 4FXWA 1CLFA 2JEGA 3ZZZA 2ZNZA 1VQPN 3EDQB 1UJ5A 1VMBA 3OBYA 3KK1A 2PMWA 2BUNA 3MXMA 5KG2A 4RKUC 3GV8B 1VBKA 1MNEA 5AQFA 2CPFA 3DRSA 3G86A 2B5JA 4CF0A 1QS4A 5DQIA 4OKEA 1A9NB 1IUJA 4YOXA 2QEXN 4F3MA 3GYNA 4ELVA 1VRTB 1S6UA 4B3SF 1S10A 4K4UA 4BGAA 2ZC3A 2FZCB 3DLGB 1BWFO 1IKXB 2BXJA 1Q78A 4K4WA 1XMQF 1CULA 4ZP8A 4F4KA 4DU3A 3CO9A 1PILA 4CJ7A 2ZJRL 3BKUA 4A61A 3VA3A 4OJRA 4DV2J 4V19X 4OIXA 1N8RT 1MWKA 2VGMA 4JI7K 1Y97A 2ZOMA 3T5HA 4CD1A 2YKOA 2K8GA 2QX0A 3OL7A 4CGGA 2ZBIA 4YY3F 2F4VJ 3OS2A 3SSQA 4DHVA 5HSPA 4LY7A 1Q5YA 3KG4A 3LW5C 3BEGB 5FPDA 4H4KC 5GIPA 2YNHB 1M5OC 3FJ2A 3CIZA 4Y28C 4AQYJ 1NPPA 3H2UB 4L3QA 3U1NA 2XM3A 2A2CA 4AD6A 3SAFA 2YX4A 1XEZA 3MAHA 4FYDA 4LJMA 2OEJA 2QGFB 4DMZA 3UCZP 3CMQA 3QNNA 2DHHA 3TVKA 1D8ZA 2RVJA 3NWRA 1A7GE 3EL2A 2CQGA 4CERA 4AM6A 5EN1A 4FJKA 2A40A 4BC2A 1M5PC 2YNFB 1NO8A 2YY3A 1YDLA 5T7LB 1RGVA 5DGBA 2NXEA 3GG4A 4CZLA 2GEMA 5ITHA 3EE3A 2ZHAA 2JWKA 4TYBA 1QUVA 5H1SQ 1YVNA 1IBKF 4HI1A 5ETKA 5C15A 3J7AN 3JSYA 2E9RX 4XPEA 5T41A 3QZ7A 4C0HA 4DV3J 1OQ3A 1RWVB 4ITSA 2RJZA 2E6LA 3LPUA 4J9SA 4LIWA 4X64J 4LR8A 3RBZA 1TUGB 2RDJA 3I8BA 2EG1A 2O8BB 1Y3JA 4WQ4A 4KBOA 3QT5A 3BEXA 1S7HA 3R1XA 2NXUA 2ZZTA 5GVQA 1CXQA 1GLBG 3SCJE 1YBAA 4LF9K 1R0AB 3RJMB 4DHYA 4G65A 3SMPA 4NLTA 2AJ0A 2UU9J 3TTDA 2QYCA 1JLFB 4QR0A 3POTB 3N6NA 5D0GA 2DXFA 4P74A 4DPUA 4HR2A 2F9TA 3G4SS 4JI3K 2XRIA 5DRKA 3EY1A 1NH7A 4B3RF 2QN6B 4XDDA 3B78A 3P49B 4USMA 1XC9A 5IT9O 2QLXA 2D74B 4CLYA 2YX1A 4UUXA 3T1HF 4RJVA 3P6YC 4LF6F 3ILJA 1PBAA 4DQRA 4JI5K 4LF4K 2XMTA 4JKAA 5J2QA 1YUWA 4J2BA 4C97A 1RHQB 4KHRA 3C6UA 2RILA 1S7IA 4QWDA 3UPFA 3EVOA 2M8HA 3GIIA 3D6MB 4IRKA 3K5OA 3EEQA 4DV1K 2HMIA 2DHAA 4HTLA 1WSRA 4O5FA 3GWCA 1WBDA 2QKKA 4KRFA 2AW0A 5EUHA 3EJMA 3ETMA 3ZO7A 1N5VA 1L3VA 4FYVB 1NRKA 3J7YU 3CJKA 2MLXA 4HCBA 2OPQA 5KFZA 4FJNA 4QS7A 3KKSA 4CJKA 4J90A 4B08A 1NXIA 4N47A 1SL1A 4R8UA 3VV2B 4PWDB 2OFHX 4TQRA 4WZMA 4UY8O 3CCLN 2ZUAA 4ZVUB 2GHWA 4DPTA 1T9WA 3H6EA 2F7TA 3D0GE 2A5XA 5AQJA 4TU9A 4KJIA 5A8WA 4Y0FA 1VQ4S 2NRVA 2A6MA 3BDPA 1FEEA 5I42B 2YQ0A 1N6QA 1HI1A 2JHEA 4ZLLA 4QZVB 4KB0A 2RIJA 3J7ZT 2Y8YA 3BR8A 3NCPA 4TLQA 4QWBA 4HKQA 2QMWA 4M3RA 1K8KB 2YKPA 6AT1B 3C16B 1Q8BA 2Y1RI 4G3IA 5FDLB 3NKYA 5A8KA 1VRQC 4ZN3A 3ISND 1TKDA 3IR5B 1FFSB 1RQ0A 4NCAA 2HLUA 4IR9A 4U8YA 2ZEJA 3Q8RB 2UYTA 2L48A 2ASPA 3D54A 2HHHK 3LUYA 5D0EA 2HHTA 3A3NB 3D2EA 2BRKA 3QPIA 3VERA 1M5VC 1XMQJ 2LU2A 3A1YG 4WFNQ 5CYMB 5EWFA 1OWXA 1H2UX 2IIRA 3A5MC 1RUSA 5J2QB 4OI0A 3F9MA 1HBMA 4BRCA 2VH7A 1IV0A 2DPIA 3PW0A 4L75A 4U8VA 3CIMA 2XYHB 1UEUA 2FLNA 3QLHA 3MAAA 3NGRA 4DUZF 1HYZA 2UVWA 3BGRB 3RRKA 4X4OA 4HHTA 3KLFB 2GO8A 1E6VA 4QIEA 5DLFA 2VA2A 2XHBA 3SFUA 4YDUC 4IR1A 2KZZA 3R27A 4BLGA 3VQAA 4BRKA 5KFUA 3OYIA 1Q9YA 2RDDA 4U7BA 4NLWA 4C23A 2DNQA 3N6MA 2OO4A 3LM2A 4HYKA 5M2RA 2P9CA 1E3MA 3V9XA 2DFFA 2ZWPA 1VIOA 3BP8A 2N4DA 3QWUA 3ULEA 3NE6A 4YFUA 2KFNA 1Z25A 3CJCA 1HR0F 4H54A 2CIMA 2FC9A 2RNEA 3RYLA 1WKJA 2ROGA 4XPCA 4KC5A 1T3NA 5CZ2A 2E5JA 1D0EA 4F3OA 1NGAA 2YBVA 1PAEX 5IWAF 1TL7B 2HZAA 3ILIA 2IGIA 3CC7S 3FRYA 2ZJPQ 1KVJA 3R2CJ 1TAQA 4C3MA 1E4FT 2J0WA 4EMDA 1C1AA 4JI0F 1K1QA 1XQIA 4DR7F 1EKEA 3M2RA 4DUZK 4NI2B 3KG0A 1GOAA 2JH3A 4YB7A 4BRQA 1SQGA 2MMYA 4KHNA 2CPIA 3KXDA 4DSLA 4IJNA 1BD6A 5BXIA 1H0HB 2OGUA 4GNIA 5HJYA 1FTCA 4IH6A 3CYMA 4H4OA 3PIPL 3ZNUA 3O3HA 1C4AA 2VBZA 1N8RO 3C15A 2G2ZA 5HMZA 2E1PA 3SCLE 4HVZA 1ZH5A 3ZEUA 2DO4A 3A13A 3K57A 2RE1A 1DGKN 2QLFB 2YHBA 4FJHA 3FZ2A 1TL4A 1NGDA 2L3MA 1YJUA 1YJRA 4ANDA 2HWTA 2OJ3A 4YOUA 4E7JA 2WVBA 2HNZA 4YQWA 4YORA 2EHGA 4FSVA 2VFRA 4O4GB 1D9FA 1D3WA 2HQGA 1RLDA 1HPZB 2RB7A 2Z30B 2NSBA 4I6AA 2R7UA 3GE1A 4F36A 3DMJB 1BGXT 3VGSA 5DQGA 3TZZA 2Z58B 5DG8A 4G1PA 3CCVN 2H5JB 1ZTTA 2IVYA 4RNNA 2GS8A 2MLYA 4IWVA 2FC8A 1R6YA 4QS8A 1D9DA 3GTYX 9RUBA 4PKDB 2LCWA 3MEGB 4LF1A 2C2OB 4A2AA 5LJ5Y 1FKOB 2EWHA 3D2FB 5HMXA 3D1HA 2XI2A 3NCQA 5LMNF 1FJGJ 4FZXC 1LNQA 1CJKA 3KJVA 3MCNA 4URGA 4IXCA 3DNCA 2IVMA 4PPDA 1ZC6A 5DDPC 1XNQF 2RQ4A 2DGOA 4CDIA 5A8RA 1WF0A 4MK8A 4H0YB 5CQGA 1RT4A 4MK9A 3JAMY 4WJBA 1HHQA 4NCGB 2LA4A 4F4XA 3M2UA 3DOKB 2FJXA 1ZAVA 2B5JB 1WDTA 4YUDA 2KFYA 4DN9A 4A8OA 5I3QA 3JSBA 2V7YA 2JWLA 1FJEB 2DNHA 1BG3A 3HT3A 3AGRA 1VC6A 2YKMA 3WXMB 5D4NA 2CPXA 2PDAA 4MO4A 3MMAB 3WZ0A 1X5OA 1HBOB 3D3CJ 1YJNS 1HI0P 1LW2A 2EFOA 4GVMA 5E3PA 3SI6A 1EAYC 4C98A 4GKJK 2WVEA 1VIXA 2V4JB 2GQ2A 1DTTB 2QA4G 4LF8F 3F2KA 4TSXA 1OH7A 3TAFA 3SJJA 4OVLA 1B9FA 1CC7A 1U1NA 1X4FA 2XMKA 2R7VA 1HNWJ 5AQWA 1B70B 1HX1A 4ZHRB 3W5ZA 3GIMA 2YWGA 1EO1A 1I6JA 1Q4RA 1NMNA 5HLFA 1NGHA 4KFBA 2HGNA 4WKRA 2KZMA 2G13A 3TRGA 3W0LA 3QEPA 1C1CB 2R8KA 2CQ4A 4K0KF 4BDZA 4QPXA 4NXMK 2QIFA 1VCTA 2E20A 5DZ7A 5LMUK 4CFDA 3HTVA 3CJ0A 2OCEA 2J9EA 2MGZB 3IWXA 1S0MA 1LEOA 1QQMA 1HWJA 1VQKN 3HPOA 1BIUA 3OSPA 3EYZA 1T03A 2M4MA 1V5IB 3HOSA 2VBWA 1T11A 5HATA 4CF9A 2C3OA 2Q2RA 4P7TA 2F4VF 1VHFA 3RB3A 1XMBA 4QIWD 5KFSA 2BMBA 3JSMB 4I2PB 2FZKB 3MWBA 5DQHA 2RT3A 4AXJA 1T0TV 4PZVA 4MH8A 2W24A 4M3WA 5KFLA 1Y7PA 3J80U 5HROA 2GIRA 2DCLA 2HNYA 3QT6A 1QQNA 2DY1A 5BRDA 4I9QA 1XERA 1QE1B 2H51B 3I31A 2D7SA 2D1KA 4BVPA 3LP1B 2HQCA 5KG4A 2KLAA 1GLEG 2ABYA 3I0SA 3U8XA 5EX0A 3IBWA 2BJ1A 1YHQN 1KOOA 2CJBA 3CCWA 4HHUA 3LDLA 5AJ3F 4WK3A 2HNYB 2UVUA 4M7YA 5G4DA 5KT5A 1Q8LA 2IRXA 1Y5NB 1P1TA 1HR0J 4M63A 4CO2A 1HQEB 5HQLA 4X4TA 3MX2A 5EU7A 4IOBA 2COLA 2OTLS 2W8LA 4IH7A 3O3FA 3PTWA 2GC8A 4I2PA 2P9IB 3UE5A 5KFEA 4JKHA 4ZPTR 1BCMA 4USWA 3ZTOA 2D9PA 3E9OA 3O4QA 1HMVA 2EBGA 4AHVA 3J7A1 1SJRA 3NGKA 3JAMO 3SZ2A 3JQMA 3UDEA 1Z1ZA 1UVLA 4U67L 2PC6A 2G8FA 5KFYA 1EWRA 5AQHA 1NMEB 1ACMB 2AZ1A 4X4NA 1RTDA 1R8AA 5BN8A 4MTPA 3CO0P 2OANA 4CJEA 3GU0A 2X78A 1WC4A 2BEFA 1B92A 3BDEA 2MJNA 3W2VB 5BRHA 5EGYA 3EX7B 3SLCA 4GVLA 4K41A 5BYQA 5F0XA 1CEZA 3HPHA 3NVKA 2MLZA 4NL5A 3LDPA 2QA2A 3PJ9A 1N56A 4Z4GA 3QJLA 4FOIA 3C95A 1NDPA 3JQKA 4FM2A 1LCUA 2ZH3A 3ENAA 1HL6A 2R7WA 4CGJA 3C6TA 3MCMA 4BRDA 3A12A 1RABB 1APSA 3SNNA 1RTZA 3PFOA 5CR4A 1N0UA 3PZPA 3MUTP 1YBTA 1XN9A 4CO5A 1NSQA 1J9AA 4WF9Q 2NUHA 3GV5B 1CS4B 1JLCB 4QPTA 3UDCA 2DNZA 3CT9A 1WELA 4BR5A 2H54B 4FKYA 1WEZA 4GV3A 5LJVA 3CGIA 1RAOA 1V9OA 1RBTA 4PG4A 1ITPA 1ZXOA 2BJ8A 2KO1A 1TYQB 2XYGB 1HI8A 4NLCA 2ITGA 2K3KA 2P9KA 4NCGA 3MX5A 1TV6A 2BR0A 3T19A 2E5IA 4PY5A 2HBQB 5HQMA 5KTQA 3FSIA 1DEJA 3A2FA 5CZVA 1EP4B 2RN2A 4Z7YA 2IVPA 4K4TA 2E5HA 1VQPS 3AB4B 5KG7A 4OLAA 2LDIA 4IOXA 2QL5B 1XUPO 3QBWA 3CD6S 1S9EA 4FLTA 1X9JA 2IDLA 4FO0A 2E5LJ 4E7KA 5LY3A 3KHHA 1KQSM 1CQNA 4J9NA 1U1OA 1S6OA 3AH6A 3I5CA 2AGPA 3MEKA 4LF8J 4I2QB 1CBKA 2DGVA 2XMWA 2HK2A 4DXLA 2YI1A 3HFZB 2E1YA 4OPAA 4HTUA 4CLKA 5HL7Q 1YJTA 3T9NA 4RO0A 1JNRB 3O2IA 3IRXA 2UUBF 2A41A 2Y1JA 3HVTA 5AQVA 2QEXS 2CPHA 4LRAA 2B4OA 1K1SA 3AVJA 4RW9B 4OI1A 5AQSA 3IWNC 2V2VA 3PX0A 4CT9A 3W3DA 2AHOB 2M3DA 3J7Z5 3CQXA 1KAYA 1CG2A 3QAUA 2JOQA 2K7JA 4JI8J 2R7QA 5CA5A 1Z26A 2O3DA 2V8GA 2HFUA 3CCQS 1IBMF 5E26A 2K1RA 1EETB 4W98A 1RBLA 2V8HA 2AWZA 3OD2A 2KG0A 2Z2ZA 4RUAA 1VSMA 4X62J 4NX9A 1RHJB 4DBQA 2WBMA 2X1AA 2ASOA 3FEYB 1SC6A 3FEZA 4AUKA 3P83D 4H4OB 2GVDA 4JI6F 2JEJA 1RA7A 4DL0C 3JXUA 1FNMA 2ZBRA 4C8OA 5KGXA 8RUCA 3I0RB 2NRRA 3G87A 5KG3A 5J2NA 5SZTA 4HI2A 3I9V9 1YTUA 3TI0A 4CM0A 4AQYK 3KZBA 4RR5A 1N34K 4H03B 4WFAL 4DQQA 4GW6A 4LFAK 3H1QA 2V68A 2DR9A 4IOAQ 3MUVP 3SAGA 5ETOA 1XTZA 4GC7A 4OYXA 4ZN1A 4WFBQ 3GONA 1IWAA 3NS5A 4EAHD 4LR7A 2YNIB 5E3CA 1U2FA 3HHEA 1S0OA 3M8PB 2UUAF 5FJ4A 2AQ4A 1REVA 3TO8A 4FBUA 2HQFA 3GJRB 1WG5A 2G2OA 4CZEA 1J5OA 2VASA 3E2EA 3V6HA 3BM7A 4GKJF 1MU2B 3SBTA 3KNGA 1E4GT 2ZOFA 3ULEB 2ZKTA 3KFWX 1V3ZA 3NOGA 2Q0UA 2R4FA 1EWQA 2N3LA 5F8JA 3U1MA 3CCLS 5FRMA 4PG6A 1NK8A 2A1RA 4O3OA 5KT6A 3FVYA 3T9ZA 2B9XA 1NK4A 1RT6A 4DTSA 2V8PA 3CI5A 3W3SA 2IY5B 3PSIA 1C4CA 4DR5F 2UU9K 2ZD1A 3TARA 1W2IA 4RWXA 5CHCB 2R7TA 2PEHA 3BGRA 3OJUA 1TTHB 3RSEA 4LFBJ 3CXCM 2ILZA 5B0GA 1X4CA 3P4UB 1JLQA 2QW9A 2WVDA 3NF9A 1DKGD 1JX4A 1NGIA 2HFVA 4K2XA 4UT4A 2PYLA 3G82B 2DY4A 1KVAA 3NAHA 4UQTA 3PHTA 1ZBLA 3I4PA 2R2UA 1PIEA 3MXIA 1KFDA 4NLSA 4NA1A 1X31C 4OO1J 2F9WA 2QA4S 5HAOA 3ZSRA 5D4PA 3ALYA 3CJ5A 3HZGA 3BQ0A 2J6TA 2ASLA 4JKBA 1LK5A 2V51B 1S97A 3GV7B 1KNZA 2E9ZA 3JAMU 1LW0A 3MXHP 4DU1A 3LH2S 2WUSA 4ZJLA 3UNYA 1NK9A 3C16A 1JMTA 4DR2K 5KQDA 1K8KA 1X4DA 2OPRB 3BJYA 5L1KA 3VHQA 3KVGA 2VZ9A 2E7VA 3T5LA 2IVFB 1VHIA 5LT5A 3NMUA 2LQBA 2H65B 5THWA 2BANA 5I42A 2ZDOA 3LL3A 1EZZB 3D45A 3VVUA 3KMSA 1Q9XA 3MM5A 4I1TA 1YKWA 3FBBA 5I4MA 1S1XB 3VQSA 2HSTA 4FYXB 2CWKA 5CD4H 1GOCA 1BQNB 4I6YA 4BR4A 4ZVOB 1RAFB 4FVUA 1IO2A 4CNYA 5F8LA 2AX1A 3MMJA 3MMCB 3VGTA 3JSRA 2I7NA 5KFHA 3G2XA 5CCLA 5AQTA 2CPEA 4UZCA 5A0YA 4DL7A 1QHTA 2NS1B 3CJKB 3NXZA 4DQIA 4IOAL 3LO3A 4M5GA 1IM4A 2GO9A 4IFVA 1LW0B 3RAXA 1AT1B 3H4DA 1SQKA 2K2PA 1IN0A 1R31A 2XWXA 2LMIA 4N77A 5SUHA 2DGWA 5CAAA 4KHUA 3AJ2A 2KVIA 4R0EA 5C24A 2G0CA 5JLFA 4YY3K 3HD1A 3AV9A 4PWWA 2R8IA 5D6GA 3ENOA 1LXNA 4DTPA 2HGLA 1HR0K 4JI7F 1U1PA 3EE8A 4USJC 2HVHA 2DFHA 3IAYA 4JRQA 3S6EA 3PX6A 4ED3A 3PR5B 2A1BA 4PUOA 2NQPA 2AJFE 3W8GA 1FRKA 1KCFA 2FLOA 1R6VA 4WP9A 3CQ8A 3VQQA 2FBXA 2CNKB 1HYVA 1LFWA 1SV5B 1RTJB 4JV5J 2FB0A 3JQJA 1UCNA 4OV1A 4CNZA 2IAJB 2O01C 4LBPA 5DM6Q 4V19J 1R89A 2XSJA 1FKAF 3Q83A 3FRZA 2W9CA 3AD7C 4E8UA 2CQ2A 4EYIB 1XNQK 3NNCA 2O8EB 4QBUA 1VQNS 1ZM3A 2ZWHA 1R0AA 2EC0A 4LVNP 1R8HA 3CMAN 4DFJA 1NLKL 1D09B 4W5OA 3CULA 3L95X 2XHCA 1Q81T 1J5OB 1HBUA 3VVTA 4DN0A 3BZCA 3RRGA 1C0GA 2NLXA 3N01A 2NRZA 2VQFK 2EPIA 3WDOA 2YNIA 4JB8B 4MIAA 4H5VA 4HTJA 1K9MT 1KLMA 4ECUA 3KUEA 1Y64A 2QT7A 1BI4B 4NB4A 4NYOA 3ID6A 1QAJA 4DG1A 4OQJA 3PDNA 4OHWA 3G8SA 1W2BM 1U8SA 1X5SA 2GMHA 3QGIA 3KLHA 3TU5A 5I3UA 1QSSA 4CEBA 5J2NB 5IT4A 1WOSA 3HBTA 3CD7A 1CZAN 3T1HJ 1ZS6A 2PA8D 1FXXA 1VQLS 2G1DA 3HP6A 4MIBA 4LRFA 1S6PA 1WC3A 1Q0NA 2ZBCA 4F4YA 3DLHA 2P9GA 4Z4IA 2BJ7A 1P9QC 4DV5J 2JVOA 2RE2A 5CYQA 4AL5A 1AZSB 2AIRB 5M1NA 1IKYA 2HWIA 2D0BA 1ESVA 2XY5A 3LWLA 3FQLA 2L41A 3M6XA 4EBCA 2GW8A 2R7RA 4DV4F 1KBRA 4AH9A 1FXRA 3H90A 3AOBA 3C3LA 4CO0A 3OYJA 5JVHQ 1TFYA 4CLWA 2CDQA 5U47A 2ZQBA 2DEJA 1EQ0A 3BO3A 1RYSA 4KT0C 4B02A 2HBMA 4WFXA 4M94A 4PA1A 3EGWB 2GUPA 1WEYA 1EQMA 4ICLA 2W2OP 1JCEA 1VLYA 2WRMA 1TP7A 4X62K 4JHDA 1ZM9A 1BLUA 3EWGA 3OFHA 1N5QA 3H3NO 2MKYA 3SBGA 1NHKL 4H5TA 3E66A 3R9LA 1P6TA 5K14B 4K59A 3KJNB 4ILMA 1F1BB 4R25A 3R2DJ 2AJQA 4FJMA 3QEXA 2CRLA 2CPYA 3ZZUA 2I0XA 5C25A 4OYIA 4WWSA 2UVVA 2I7PA 2O5DA 3SSSA 2ATCB 1UAWA 3OVBA 1EARA 3Q89A 4NLUA 1VSIA 1T6DA 2DRAA 1NLVA 4C6AA 2XS2A 2Q6CA 3Q23A 3OFFA 4H4KA 1CJUB 1TMMA 2IPOB 3IRWP 1CJTA 1SJ1A 2HG4A 4CT8A 1QJHA 2M88A 5KFAA 1D4XA 1RT5A 3S3OA 1LWFA 2G8KA 2Q31A 4NOHA 1H2VZ 5K8MA 4KHWA 1LXJA 1U0HB 4Z2XA 3DRSB 4FK2A 3IMQJ 4ZVHA 5F8GA 2K3IA 3FFIA 2GVZB 2KRRA 1YAGA 2GBZA 2HHSA 4ID8A 4C7QA 3HCXA 3B82A 3KHGA 5J1EB 4F3TA 3OV7A 4FWNA 4DFPA 4KGMA 1IH7A 3L8BA 1OO0B 4KH1B 1XNRK 4NRUA 1RI7A 3DC2A 3BZQA 1GFWB 4P75A 1F21A 3NH1A 3TABA 4CJLA 1RAIB 2VDIA 2W25A 4NO7A 1YI2S 4E1JA 1RKIA 1Y00A 2FYXA 5L1JA 4OZ2A 2W2PP 3IFEA 4YNQA 4BDPA 4XIUA 3DI6B 4DL5A 4J91A 3HM9A 2ZE2B 1EHWA 3HT0A 5BJRA 1G99A 3RBEA 4HH0A 1VSFA 1HD0A 2C3MA 4IO9Q 4FNIA 2OPSB 2HRTA 3EDRB 1ATSA 3MN6A 3GE9A 4GMKA 2OPPA 3TYTA 3O1WA 4AHCA 1KXPA 4C8MA 4CCHA 3MK6A 4CTAA 4FZVA 4RW7A 4XH5A 1IJFB 1Q95G 2QC3A 4A59A 1KLNA 2V2QA 4X4RA 2D0AA 2G8VA 2NRXA 1NK6A 3RBXA 3LPEA 4BGBA 3FUYA 4C8KA 4JI4J 3V9ZA 1TL1B 2VGNA 3FGUA 5M1KA 4EFHA 2QWRA 3VETA 1LWXA 1KVCA 1PSDA 4B3MJ 4JI5F 5HL7L 4CEZA 3FZKA 2X1BA 3W65A 3GSIA 3TZWA 1WSEA 4DL2A 4KYZA 4I6MB 4A57A 1ZBHA 3L7PA 3VQTA 2ASMA 3WX8A 4BACA 3J7AP 2HFSA 1SBRA 3ZSYA 4NXMJ 2P8IA 3O9SA 3O9TA 4CJFA 3MMVA 3CJRA 4GKKF 2MQQA 3VQ4A 3O6WA 3OUYA 4I7FB 1S1VB 2OFGX 3DLJA 3M8RA 4M5LA 4F02A 2CNOB 1RT2B 5KFPA 2P9PB 3ILLA 1S1VA 3DN9A 5FPEA 3AA8A 2V8VA 1J5EF 2KXHA 1YWXA 4DV1J 1WKLA 1O13A 1RDAA 1VQMN 4I69A 1UEKA 2FZGB 4JD2B 5IV3A 4F2RA 3NOCA 4D3GA 5C12A 2DXDA 2ZH7A 3QFHA 4CLSA 1VRUB 2X3GA 4KSEB 3VGUA 2WSCC 3R7SB 2DH8A 4O4RA 2VG7A 1VQ9S 1JLBB 1FWKA 1DZ5A 5F1XA 2UUCJ 2CGLA 1UFLA 4OYAA 4ZS6A 2WW4A 3CD6N 1HHTP 4CJ5A 3DLRA 2UUCK 3H5XA 2BE7D 2JNJA 2GMJA 3N6LA 1FDAA 4A4JA 2BACA 1X9SA 1Y0HA 2FHOB 4DU4A 4ATNA 2HNDA 2PI5A 1S0VA 3TA2A 3TUZC 1SKUB 1XNRF 3O8WA 1UVKA 4CP5A 4JN4A 4KKOB 3LDQA 1U6FA 4WU2A 2W4CA 3DU5A 3A8IA 2NYIA 5KT7A 3OPKA 4OX8A 2WFBA 5KI6A 2FJBB 4IDKA 2XC9A 3V1QA 2GQQA 3GOIA 2K7KA 1MLAA 5M2UA 1B9DA 2F65A 4DR7K 3TOQA 2QWNA 3DRRA 2NCKL 3K2YA 4KFBB 3CDBA 2CQHA 3UQSA 1EKRA 4O0NA 1H98A 2XCAA 2FHKA 5GMDA 3O4NA 4ZHRA 4LF7F 3LTOA 5ETNA 1RT7A 4CD3A 4NYZA 2DCUB 1PJ6A 3AQPA 2ATLA 1O1WA 1RDCA 1RSCA 1YHQS 3AO5A 2V4JA 3D6RA 3M30B 1Z6RA 3UN5A 3UN2A 1R8CA 2G8UA 4B8CA 4IEEA 3DLEB 1YG0A 2C2RA 2M2BA 5E7OB 2HAFA 4QQBA 3VAFA 4FPBA 4KHYA 3HKZD 4FJLA 3DOLA 4IKFA 2E66A 3H20A 2YKMB 4DB3A 4K4YA 3FFIB 5BYRA 3NF6A 1GLDG 1WUUA 1XMOF 4DMNA 3CJTA 2GFFA 1RWMB 4YOWA 5B0AA 1Q8IA 2WK4A 3CD5A 3M2UB 3VQCA 2H9ZA 2W6KA 1SH2A 1HWUA 3HHNB 4BVOA 2ZM6K 1XBWA 4HLBA 1C0TA 1RT4B 1WSJA 1QVFR 4CJRA 1DY3A 5K8OA 5A8RB 2XY8A 1T8EA 4Q7AA 5L8RC 4J9PA 1BO5O 4I64A 1T9XA 4LT6A 4H5NA 4NLRA 3KD5E 4Q0BB 1VK3A 2CAJA 3MUMP 2VOPA 4CH0S 1WC1A 3F5TA 2PAVA 3PW5A 2RKIB 3D2FA 4FYWB 3CJ8A 1MWQA 2E44A 4AYBD 1L5UA 4B9SA 1Q79A 2G0IA 4NLOA 1LWEB 3T1HK 2F8EX 2HQDA 1RILA 3VF0B 2JWNA 2VQFJ 2UXCJ 4JUZA 3ZT0A 4NA3A 1KC8T 3J7YP 4P2XA 1JJ4A 2VPWB 2HPUA 1YJ7A 3S9HA 2M0GB 2CZ9A 1JWWA 3WQPA 5HRPA 3GIRA 2CGJA 1A6LA 4KGXB 4L76A 3DGPA 1N52B 1SJ3P 3UKUA 3VGMA 1PO6A 3C14A 3G6XA 2D3O1 4B3TJ 5AE2A 2RU3A 2CNLB 1HJOA 1ZAXA 3RR8A 3R1LA 3QIOA 4R0JA 2YH0A 1B7YB 1VSLA 1XJWB 3CETA 2ZZMA 2OSQA 2L08A 1U48A 3F56A 3OYBA 2C3YA 5AZIA 3LZIA 3SQ0A 4M95A 4RZRA 1DURA 4ED2A 2DNMA 2FGCA 3EXYA 4PL8A 2QFIA 4AT1B 4M5JA 4DR6K 3SUNA 2AGQA 4OZJA 3TWZA 2VA3A 4KIAA 4CLLA 3C7NB 5ADXA 3ZZYA 1FERA 4OX9K 5GAEI 1ASWA 4OYOA 2P5GA 1N33J 3VR1A 4GV9A 3DKDA 1K8AT 5I3UB 4PRFA 4A5BA 3PJXA 1NU4A 1RDWX 2F96A 2V4QA 1QD1A 2UV8G 3M2RB 2VG5A 2YWWA 4JI4F 3IS9B 3GDQA 2CQIA 1HQUB 3PYGA 5E84A 3KYLA 2HVZA 1XMOJ 5B8HA 1MA9B 3RG6A 4JI8K 3QGGA 4Z4CA 1FD2A 1TL7A 1SS6A 3BS9A 4URSA 3AOCA 3SJHA 3FR0A 3ZT4A 1UVMA 2XGQA 2DD8S 3J81Y 5HVHA 4JS5A 4CIOA 3PKYA 2VF3A 3QIPB 2PIIA 1NDCA 4DR6J 3N4PA 4CK2A 3AJ1A 2QSWA 5K20B 2GJIA 3OR2B 1WAFA 1HWLA 4CIGA 2VDHA 3OXLA 4OPJA 4JLHA 2JL9A 3NL0A 1NSAA 2RS8A 3AHPA 3FLCO 4LH5A 3BBCA 3K0JA 3GLJA 1S1UA 3KWGA 1JL1A 2HZCA 1SH3A 1W7WA 3I9ZA 4M45A 2O8EA 3HFKA 3LPTA 4AXIA 2MY8A 1SUQA 2V2ZA 3O08A 4B1WB 2OUGA 2XMJA 3P39A 3MZIA 1XHXA 4M5HA 4BRFA 4DSFA 4NYNA 4D3HA 4CJTA 2E7WA 3KLFA 3T6BA 2LKZA 1QY7A 4ZCKA 3FZFA 4WE1A 2G9OA 4PXCA 3LF0A 4C1NI 2FSNA 3OY9A 4PUOB 3P4IA 1H1VA 1N34J 2UUCF 1M1HA 4JBCA 3ZSWA 3UKRA 3THVA 1VQYA 4M41A 4CFBA 2Q1NA 3E01A 1NZAA 4WYBA 4XK8C 1RCOB 1DQAA 1KR4A 2JRSA 4WQ4C 1T7PA 4WIIA 5C24B 1U1KA 4Z4HA 2C2EA 4PKIA 1HW9A 1RAEB 4FF2A 4JP8A 1DJ0A 2XY6A 3OTDA 4BR2A 4Z94A 1QHAA 3TZYA 1KVKA 1CJVB 1HNVB 4X65J 2E2NA 3ID8A 4EBDA 3IAS9 3TEHB 4DV7K 4RW8A 2XBPA 5LMNJ 5DM7L 1ICEB 4YMEA 4ZLPA 3ULDA 3IR6B 4BRGA 4HACB 4DU8A 4KTWA 4DV0J 1PYOB 5JJBA 2CNNB 2HK3A 5KFTA 5L1IA 3VEYA 2NZ4A 2G2YA 1R0BG 4CLUA 1KQGB 2NXCA 1S1XA 5HMWA 4E3SA 3M8QB