5I42A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer, azttp, and ca(2+) ion
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 141
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i42A05
3OYEA 2R8KA 4DU1A 1TK0A 2C2RA 4G1QB 3ZT3A 5I3UB 1CZBA 4NLTA 4KAIA 4FS1A 4KKOA 3TAMA 4LQ3A 3HPGA 3QGIA 4NLSA 4Q8FA 4Y1CA 3AVMA 4DU4A 3NF9A 4IH5A 4C8LA 3TR8A 4FS2A 3L2RA 2QK9A 2D3UA 4Z4CA 4B9NA 3AA4A 1F21A 4KI4A 2IAJB 4F4ZA 3SI8A 1Q9YA 1GX6A 4IKFA 1NK5A 3PR5B 3KLEB 4H4MB 1TP7A 1D5AA 4IG0B 1ZETA 2GIQA 4CJLA 4ECXA 3C6UB 3CDEA 1MU2A 1JLBA 1S0NA 3ZSWA 4FW1A 4B9MA 4DFKA 3C95A 3I0RB 2AQ4A 4M41A 4CHPA 3TABA 3NCIA 3PY8A 1FKOB 4FK0A 5KFWA 5J2MB 5D3GA 4FJGA 1EXQA 3OYGA 3E01B 1RBVA 3N6MA 5DQIA 4CF1A 2O4IA 3M8RA 4K4WA 2FVQA 2GV9A 1LW2A 4K4UA 1S4FA 2ASDA 1LWFB 2E6LA 4ED6A 2YV0X 4E3SA 4RU9A 2VA3A 1NK8A 1MMLA 4ECVA 1TL3B 2IC3B 4HHTA 3SNNA 1CSJA 4YR0A 2FLLA 3DM2A 1G15A 1S6QB 3NGYA 1JLGA 3QINA 3K5OA 4IFVA 1C0TB 3H5UA 3OSPA 1KLNA 4I2QA 3NKYA 1D9FA 2XY6A 4E7HA 4TQSA 1N56A 3OS1A 2PYJA 5KFCA 4Q45A 4DL2A 1WLJA 2R2SA 1QUVA 5J1EB 3M8QA 3EY1A 4KO0A 5KT5A 3KLGB 2UVVA 3SQ0A 3V1OA 4CJEA 1HQEA 1VSJA 4KPYA 1BIUA 4F4YA 2UUTA 4KRFA 4N41A 1S48A 1TVRA 4Z4EA 3CWJA 1NOZA 2IJNA 4YR2A 3S3MA 1L3UA 4BDZA 5KG7A 2EHGA 4Q5VA 3V6DA 2D3ZA 1RT5B 3FFIA 5T14A 4J2AA 3Q8QB 4HCBA 3PW0A 1WSJA 4KV8A 3PV8A 4CGHA 4JV0A 3BDPA 1B9FA 5F8GA 4K8ZA 4YNQA 3KK1B 2ZD1A 3KLFA 2AU0A 1S9GB 2XC9A 3IS9B 4W5RA 4OJRA 3KLHA 4WXWA 3FSIA 1X9WA 1HNVB 2D0BA 1TGOA 3RMAA 1K6YA 5CZ1A 3PW2A 4FVMA 4RUCA 1J54A 3BGRA 3RMBA 3L2UA 2HB5A 4ZP6A 2RDJA 3LZIA 1RBSA 1UA1A 3H2LA 3T19A 3M9NB 2QKKA 4FJJA 2HW3A 3KIOA 4FLXA 4CJRA 2F96A 2W8KA 5DG9A 4OLBA 4NLXA 4JRQA 2E6MA 5JS1A 1S0OA 3F73A 3ASMA 2G8HA 1YT3A 4EP5A 5KRSA 4M3XA 4IQXA 1T05A 4IRKA 3PW5A 2JC0A 1C6VA 4CFBA 1RDDA 4I2PA 4DSIA 1JXLA 3KK3A 5HRRA 3EPGA 1L3SA 4FYDA 4Q0BA 4EBDA 4UQGA 5EU7A 4NYNA 4RW8B 4K8XA 1XHXA 3THVA 4E0DA 2WTFA 2IGIA 4IOBA 2XY8A 2I5JB 1JLFA 1RT2B 3DDKA 4CESA 4QPXA 4DFPA 4DSEA 4GVMA 1JX4A 1X1PA 5L1KA 5K14B 3KJVB 3LP1A 4WFXA 2OPPA 4URSA 4C8MA 3MECA 3PZPA 4K50A 4IBNA 3HPHA 3SV4A 1SKSA 3KTQA 1K1QA 1KFDA 1BL3A 3AV9A 4DFMA 4CEEA 5KFYA 1HNIA 4GMJB 1Q8IA 3VQDA 3CDUA 4C8KA 3ZT2A 4KTQA 4QW9A 1RTJB 4DL6A 3QERA 4DQRA 1W9HA 3QIOA 3T5JA 4CIEA 4ELTA 2DTUA 4LSLB 3V9SA 4RNMA 3ULDA 3IRXA 3SQ4A 4E7IA 3BQ1A 3NH0A 4M45A 4Y34A 2F8SA 4FLTA 1ASUA 1N5YA 3JYTA 3OYFA 3K59A 1NKEA 3DLEA 2HNDA 2ZE2A 4CECA 4QWAA 1RYRA 2OPSA 4DG1B 3H08A 3GYNA 1Q9XA 1CZ9A 1ASWA 4MK8A 3QIPB 1T94A 5L9XA 4FLYA 4CJ3A 3KNAA 3I0SA 4Z4FA 3QEIA 4EP4A 2WONA 4DTSA 4RW9B 1HYZA 3LPTA 4FK4A 4NZ0A 1JLQA 3NAHA 2B5JA 1O1WA 1VRUB 3AVLA 4CEAA 5JS2A 1A5WA 2BDPA 4KHSA 2VA2A 3NF6A 3VQEA 3UQSA 3HVAA 4YQWA 4O3NA 4K4TA 2B6AB 2GIRA 2RF2A 1RT6A 1KHWA 1KLMB 3GIIA 4DL3A 5KRTA 1S6PB 1RTIA 3ITHB 1JLCB 4Q8EA 2KTQA 1GOCA 5HROB 4EYHB 2QE5A 3V81B 4HUFA 1TL1A 4O0JA 4ELVA 4ID1A 2W9AA 4ICLB 4MFBB 3ZSQA 1UWBA 3TQ1A 2YKMA 2KFZA 1X9SA 5FDLA 3BREA 5KT3A 1WNSA 5J2PB 3OYJA 3C6TA 3V9ZA 1S1XA 3TAEA 4EYIB 3LPUA 3KD1E 4ZTFA 1BI4B 4HTUA 3QEVA 4NLYA 2YNGB 3DLGA 3DYAB 3QNNA 2FJWA 1RBTA 5I42A 2HMIA 5FRNA 4ZVFA 3HVWA 4XPCA 2BANB 2OYQA 3LZJA 4DLEA 1S1UA 4C8NA 5HLFA 1KVAA 4PY5A 3DRPA 4CHNA 4FLZA 1S1TA 1RILA 4TYBA 3PX0A 3BSOA 2JLEA 3DLRA 3VQBA 1C1AA 3SQ1A 4HUEA 3NGZA 4GC7A 3QYYA 4J9LA 3ZSOA 4B3OA 4IR1A 1TAQA 4O5BA 4AHVA 1T3NA 1KCFA 4NLVA 2YNHB 3LAKA 4Y1DA 3MXMA 4ECUA 5HBMA 1A5XA 5DLGA 2HNYA 3O3GA 4EZ6A 1FK9B 2IM0A 5L1JA 4LD0A 4O3PA 3A2FA 2D41A 2OA8A 3PO5A 2FVCA 1GOBA 1REVB 3OYDA 4IRDA 3QZ7A 4CFCA 1SH0A 3RAQA 2J6UA 5C25A 1J5OB 3CJ5A 1ZBIA 4ECZA 5DGAA 3V9XA 4DL5A 3MR3A 3CM6A 1QHTA 2YNFB 1RT4B 4O4GB 3RB4A 3OS0A 1LAVA 4CHOA 2RDIA 3BQ0A 5KT4A 2OZSA 4FJ7A 4ECTA 3DLKB 3FDSA 5KG0A 2HHUA 5KFAA 1KRPA 4B9VA 2JC1A 3CQ8A 4WFZA 5EDWA 4DSFA 1EX4A 2WOMA 1QE1A 4KTZA 4DTJA 3H5XA 4RUAA 4IKAA 1B92A 3LP3A 4CEBA 4CEOA 2BRKA 4GW6A 2E9ZA 3DOKB 3KHLA 4KKOB 3NL0A 3BR9A 4OKEA 2W42A 3TAMB 5DLFA 2G8FA 5HRSA 2Z1JA 1QAIA 2V0NA 4FCYA 5EWGA 3VN5A 4CJTA 1HARA 3OYIA 3KKRA 3HVTA 3AA3A 3P83D 2OPRA 4IDKA 2X6NA 4RW6A 3S3NA 1BQMA 4J9SA 4ID5A 2C2DA 3ISNC 1MU2B 1JLBB 3D45A 1U4BA 2FBVA 5KGWA 2ASLA 5KGXA 4JS5A 4IG3A 3RTVA 1RA6A 4ED3A 1NK0A 2IBKA 1VSHA 3O4QA 4QWCA 1VSMA 2XHBA 3OLBA 5D3GB 4NLQA 2FBYA 5KFTA 4FJ5A 1WSEA 4NLUA 3AO2A 4EZ9A 1SH2A 4KHRA 3SFUA 5KFMA 4AILC 4ED2A 4KBIA 5HP1A 2HHQA 1LW2B 3IN5A 4O3RA 1L5UA 4FJLA 3UPFA 3HJFA 4E89A 3ZCMA 5C42A 4DTOA 4DWIA 4CJKA 4KHUA 2J6SA 5SWMA 4EO8A 2NUBA 4XPEA 4OKJA 1JXBA 3S3OA 3SJJA 4RW4A 2E9RX 1NNDA 5DQHA 1BCMA 1FXXA 4ECWA 2XY7A 3IG1A 4ZHRA 1ZBHA 3HP9A 3DM2B 1JLGB 1RT3A 4NYFA 2DY4A 4IFVB 4I2QB 1QQCA 5KI6A 4LSNA 3EPIA 4JUZA 2F8TA 3L2VA 2IS3A 4AHSA 2VWKA 4OGEA 3ZSRA 2ZQBA 1QSYA 4OLAA 4DL4A 4PWDA 3PW4A 1JL2A 5KFPA 2BQRA 3M8QB 4O44A 4KO0B 4ZPBA 1IKWA 4CF2A 3ZT0A 1HQEB 4FJXA 1JIHA 4DTNA 1TVRB 1VSIA 3QEPA 4CCHA 1HYVA 3V6DB 4Y2CA 4KB1A 2AWZA 3FFIB 5KFHA 3QGHA 5EUHA 4PA1A 4NCGA 3RWUA 3DMJA 4KV8B 2CKWA 2BGGA 3SI6A 3ALYA 3MF5A 2ILYA 3ISND 4N56A 4RZRA 2J6TA 1BCOA 2VG5A 1JLEA 4LH4A 5KFQA 2YHAA 3IGNA 3SCXA 5KTQA 2ZD1B 3KLFB 4CIGA 3KHHA 1S5JA 2KQ2A 3KOAA 1YTAA 2BE2A 1NJXA 5L1LA 4QW8A 3E51A 4M3YA 4TSXA 2QKBA 3KLHB 5DMRA 3VQ5A 4AH9A 1XR5A 1XWLA 2V4QA 2PY5A 4U6PA 4XIUA 3BGRB 3K5NA 3VA3A 4FLUA 2RKIA 3GQCA 5C5JA 4RNFA 2DPIA 4R8UA 3WNHA 2IJFA 3UDLA 1SV5A 4DS5A 2XI3A 2W9BA 3MR5A 4DQPA 4TXSA 1NK4A 2D5RA 3K58A 1LWCA 4WE1A 3L8BA 1SKRA 4B9TA 4CGDA 2I1RA 1T05B 3VQPA 4M3ZA 1JKHA 1JXEA 4CJ5A 4I2PB 1RDAA 2WHOA 1S1VA 4HUGA 3KK3B 1WNEA 3G6YA 3K5MA 3KD5E 4F3TA 2IA6A 2GBZA 2E9TA 4Q0BB 3KHGA 3O4NA 1RDBA 2PYLA 3BSAA 1TK8A 3RBDA 4CGJA 5J2QA 4CHQA 4RNHA 4M3WA 1JLFB 2FJXA 2HWIA 3V6HA 5E41A 4E7JA 3H40A 2HHXA 3I5CA 3LP1B 2AGOA 1RTDA 3OYCA 4CGGA 1SH3A 4QOZB 2HNZA 3NDKA 4CE9A 3MEGA 4HYKA 3OYHA 3MECB 3NFAA 3V9UA 1LWEA 1N48A 3QESA 4YP3A 3H98A 5CYQA 3OYMA 3OYLA 4BE2A 2HWHA 4FJ9A 5KT6A 1J53A 1HNIB 2DFFA 2WRMA 1LW0A 4ZVHA 1XC9A 1Y97A 1KVBA 2D0AA 3WNEA 2R8IA 2XWYA 5JUMA 1C0MA 3OSNA 3AVAA 1TK5A 4FJIA 3AVNA 4KREA 4U7CA 3KK2B 5KFXA 3IRXB 5KFUA 4M3TA 1RDCA 4W5TA 4NLRA 2XGQA 1WAFA 1DTQA 4KTWA 2OPQA 4QWDA 1N5YB 5F8JA 3JYTB 1QSLA 3DLEB 4AHUA 2HNDB 1LV5A 2ZE2B 2OPSB 3D5MA 3QZ8A 1HYSA 1IKYA 3HL8A 4N5SA 3NF8A 3BSNA 4R0EA 3I0SB 4DQQA 2WONB 3IAYA 5KFEA 4ZP9A 3RB3A 4B9UA 3KMSA 4CF0A 4DS4A 3AVGA 1Z4UA 1JLQB 1RT1A 3QEXA 2B5JB 1SKWA 3AVHA 3QIDA 1C1BA 2FLNA 4RW7A 3OS2A 1SL2A 1BIZA 3SQ2A 3N6NA 4YMEA 4ECSA 4CGFA 1VRTA 1SL0A 3AVCA 3SZ2A 2RF2B 1RT6B 3HM9A 2XI2A 1RTIB 1DLOA 4XO0A 3ICLA 1NJWA 4L8RB 4URQU 3SUQA 3HVRA 4YR3A 1TL1B 4NLGA 4MK7A 3DI6A 1N4LA 1UWBB 2YKMB 5FDLB 3AVKA 1S9FA 4CEDA 3C6TB 5FROA 1S1XB 5F8HA 1S10A 4DFJA 3CO9A 3EZ5A 4KAZA 2LSNA 3RAXA 3AA2A 1U48A 3DLGB 5I42B 2VG6A 2HMIB 4HVJA 4J2BA 4R5PB 3GIMA 3KLIA 1KHVA 1RTHA 4ZP8A 1S1UB 2IOCA 5KFSA 5HLFB 1C1CA 3DRPB 1RAJA 3QGGA 1S1TB 3OJSA 3LWMA 1YVFA 1WN7A 3HPOA 3DLHA 3M9MB 5T7BA 1ZYQA 2W7PA 3KHRA 4DMNA 4DTRA 3TAGA 2W9CA 2R8JA 1QTMA 4F3OA 4MH8A 1RT7A 2FJVA 3T5KA 1C0UA 1IO2A 5KFVA 5KG2A 4B3OB 1U09A 3VQQA 4IFYA 4KSEB 1JL1A 4I7FA 4CIFA 3NAIA 2QV6A 3PJWA 4MIAA 3T5HA 3QETA 1WSFA 4DQSA 3OHBA 3KLVA 1R0AA 1XI1A 1QAJA 3Q8PB 1T03A 2P5OA 2IM2A 4MQ3A 5HBMB 3CFPA 2HNYB 4FJMA 5CZ2A 4HCCA 2FBXA 1EP4A 3V6KA 3VQAA 5DGBA 4J9OA 2DFEA 3MR2A 2XO7A 1ZBLA 4GC6A 4Y2AA 5C25B 1KSPA 4H8KA 3OYKA 3G6VA 4CERA 3SV3A 4J9PA 3OL9A 1HQUA 1S1WA 1D1UA 4Q43A 3ZSYA 3NHGA 3DRRA 2Y1JA 1IKVA 1TKXA 4DEZA 3LP2A 1N6QA 4PQUA 4RG8A 3Q8SB 1ZBFA 1TKDA 3AA5X 4ELUA 1UOCA 1NOYA 2WOMB 3ZT4A 4FK2A 2HHSA 1QE1B 5KFRA 4F8RA 3LDSA 4NCBA 4KFBA 5DQGA 5F8MA 3CIZA 2KZMA 4BWJA 2F8EX 2ZKUA 4E1NA 4MIBA 4ECRA 1S49A 5KFNA 2HHTA 3H4DA 4NYZA 5F9NA 5DG8A 4K4XA 1X9MA 3VQCA 1HRHA 3G10A 4W5OA 1A5VA 1YTUA 3HVTB 1Z25A 1HMVA 3TWHA 2OPRB 4IDKB 3GV8B 4BWMA 1FKPA 2G8UA 4RW6B 3CJ4A 4KHMA 1BQMB 3GIKA 4KHNA 2C28A 2O4GA 3NBPA 5CYMA 2R8GA 4ID5B 1S9EA 1OS5A 4OL8A 3CFOA 3AVJA 3OL8A 3QO9A 4IG3B 3H4BA 4JS4A 4CEFA 4Z0UA 3CYMA 2AX0A 5KFGA 3V4IA 3HK2A 2VG7A 4M94A 3TI0A 4IRCA 2XRIA 3SUOA 1DTTA 1IKXA 2YHBA 1VSDA 3VA0A 2ETJA 4O3SA 5J2NA 1NKBA 3MEEA 4URGA 3QEWA 3LALA 1BQNA 3OL7A 5C24A 4O4RA 2Z1GA 2G8IA 1TV6A 3MEDA 5HP1B 3RBEA 4ECYA 3DRSA 4E1MA 3N6LA 4J9RA 4CJ4A 2WK4A 4TLRA 5C42B 1NHUA 2YNIA 2WCXA 2FBTA 3T3FA 4DF4A 4RW4B 4E7LA 4TY8A 4J9QA 3WNFA 1BGXT 3IG1B 4ZHRB 4IH6A 4KHQA 3NAEA 1REVA 1XR7A 1RT3B 1CXUA 2JEFA 2D7SA 1XR6A 4LSNB 5DK5A 1EETA 1TKZA 2ATQA 4FM2A 3K2PA 3HXMA 4CF9A 3RMDA 3OHAA 3PR4A 2G8VA 3H5SA 3QLHA 3BJYA 3PX4A 4PWDB 4DSJA 4FZZA 4O44B 3L3UA 5F9LA 4KI6A 1NJYA 1IKWB 1TKTA 3PX6A 4H4OA 4O3OA 4EBEA 3HO1A 4G3IA 4QWEA 4PUOA 1CXQA 5KT7A 1U49A 3H5YA 2B4JA 2X6SA 4ED8A 3BQ2A 4ED0A 3DOLA 4MKAA 3MXJA 4NCGB 3T1AA 3BSCA 3DOKA 3DMJB 2G8KA 1WAJA 4OPKA 2VG5B 1JLEB 3RB6A 2XGPA 3OYAA 2XCPA 4B9LA 2BE2B 1TAUA 4JV2A 2IDOA 4KB0A 1VSLA 1KVCA 1UA0A 4J9MA 1JLAA 2HAIA 3LP0A 3EZUA 3P1GA 1EKEA 3OLAA 3F9KA 4ZVGA 2EX3A 5HRNA 4WZMA 3V1RA 3SUNA 3GILA 4FJHA 3VQ9A 5HRPA 3KMQA 2W8LA 2RKIB 2P5GA 3JSMA 3I5BA 3LAMA 2YKNA 3C94A 3M8PA 1SUQA 4R8UB 4EBCA 1SV5B 1HPZA 2UVUA 2W9BB 1CLQA 1LWCB 4WE1B 1WSIA 3PW7A 4CGIA 3VQ8A 4MKBA 3SUPA 1D9DA 4G1QA 2O5DA 5I3UA 3VQSA 4OGCA 4CK2A 1IM4A 3HYFA 2OH2A 1JKHB 5KG6A 4B9SA 4I9LA 2JEGA 4F2SA 1S1VB 3IGVA 5KFLA 3RR8A 4AHTA 4FW2A 1BISA 4ED7A 4NLOA 2GUIA 3RRHA 3S9HA 2IAJA 5J2QB 3TANA 3KLEA 4H4MA 2EC0A 2FVSA 5KFFA 1RCHA 3V6JA 1IH7A 5L1IA 4IG0A 1VSKA 2DFHA 3G0ZA 3C6UA 1RTDB 2HNZB 3MEGB 2FC0A 2BQUA 3AO3A 4BE0A 2G8WA 3TAQA 2HVHA 1K1SA 3I0RA 1LWEB 1I3AA 3OYBA 3PO4A 5KFJA 4CFAA 1FKOA 5CYQB 5KFZA 4BACA 5J2MA 1U47A 3LWLA 3NE6A 1LW0B 4DSLA 4K4YA 4ED1A 4FM0A 4DF8A 3VQ4A 3E01A 3CM5A 4KHYA 1KTQA 3L2WA 4BE1A 3TAPA 3Q8RB 4NRTA 1VSFA 4Y3CA 4DU3A 1LWFA 1D8YA 3OJUA 2D0CA 3MFIA 4Z4GA 1L3TA 3M8SA 2HHVA 1DTQB 4NLWA 2OPQB 4EEYA 4OVLA 1TL3A 2IC3A 4OKKA 2R2UA 2ITGA 4FJNA 1S6QA 4M3RA 2OPPB 1UAXA 2R2TA 3L3VA 4WYLA 3CDWA 1HYSB 1IKYB 1C0TA 5CY4A 1SL1A 2X74A 4X2BA 2WB4A 4MK9A 4QAGA 2OZMA 4F50A 4O3QA 5J1EA 3NGDA 1RT1B 3KLGA 4WZQA 1C1BB 5F8IA 2Z1HA 5KFBA 3CFRA 3DLBA 4KE5A 4RW7B 4EO6A 3K5LA 2FVRA 3K57A 4AHCA 4N47A 1NJZA 4DTPA 1VRTB 2V9WA 4Z4HA 2QXFA 5KT2A 1TQLA 1RT5A 1DLOB 3HT3A 4CJQA 3UIQA 4NCAA 1XHZA 4W5NA 3OYNA 4E7KA 3DI6B 4E19A 4CHYA 2ASJA 4CFDA 3KK1A 2B43A 4M3UA 4WXOA 1S9GA 2W7OA 3IS9A 4M95A 2V4RA 3U3GA 4J9KA 4YFUA 1HNVA 4ZPDA 5JXSA 3QNOA 3AVIA 1L3VA 3V9WA 2VG6B 3U3YA 3KLIB 1RTHB 5KFDA 1C2PA 3V1QA 4W5QA 3FRZA 4F2RA 3PJXA 3NMAA 1C1CB 5SZTA 1ZTWA 3NF7A 3HSTB 3MTKA 2HVIA 3HKWA 2W9CB 2AJQA 1RT7B 4DQIA 4N76A 4FJ8A 1C0UB 4QCLA 3KK2A 3M9OB 4IFYB 3O3HA 3CJ3A 4I7FB 4J2EA 1ZBUA 4IH7A 1VK0A 4RW8A 4LH5A 1S97A 1R0AB 3GV7B 3CVKA 3KKSA 4F4XA 1T03B 2XY5A 1LAWA 2FVPA 2I5JA 5EWFA 1RT2A 2IM1A 2UVWA 4Z4IA 4J9NA 3HHKA 5K14A 1EP4B 3KJVA 4TYAA 3MR6A 3OL6A 3NGIA 2E4LA 2AGQA 4JV1A 4ECQA 1HQUB 1S1WB 4TQRA 4FZXC 4K4SA 4B8CA 4DTUA 1T8EA 4K4VA 3DRRB 5KG3A 2AGPA 3CJ0A 3GV5B 1IKVB 1TKXB 5F8LA 1RBUA 3T5LA 3LP2B 1N6QB 3O3FA 4DSKA 2Q3SA 4BDPA 2Z1IA 4PQUB 5KG5A 3WNGA 4NLPA 1RTJA 3SPYA 3SYZA 3ZSZA 4LSLA 2RPIA 1RNHA 4I9QA 4CEQA 1Z26A 2KZZA 4KFBB 4K4ZA 1NHVA 4DLGA 1IG9A 3RMCA 4C8OA 2BRLA 3MFHA 3I8DA 4CK1A 5FRMA 3B6PA 2XCAA 1I39A 4DG1A 2A1SA 1QSSA 4J2DA 4ZP7A 4FBTA 3L2QA 3QIPA 1HMVB 3AVBA 2VWJA 2CJQA 1QS4A 1FKPB 2P1JA 4RW9A 4AHRA 5KG4A 3AO5A 1D0EA 4O0IA 3NBPB 3AO4A 5CYMB 3GIJA 2ALZA 1S9EB 4ZVEA 3FQLA 1I6JA 3CG7A 4RNOA 3G6XA 4R5PA 3RB0A 3QO9B 1VRUA 5KG1A 4QWBA 4CHZA 4OPJA 4FLVA 1RA7A 1GX5A 3OY9A 3G86A 3V4IB 2GC8A 2VG7B 4FBUA 4CEZA 4ZPCA 4FXDA 1DTTB 2B6AA 1IKXB 2HHWA 3ZSXA 3TARA 1KLMA 3AVFA 1S6PA 4IR9A 3ITHA 5J2NB 1JLCA 1NK6A 3MEEB 1W25A 1BQNB 5KFKA 2UUWA 3SPZA 1VSEA 5C24B 5HROA 3OVNA 4DTMA 4WFYA 1TV6B 3MEDB 3RRGA 3V81A 4ZPAA 4RNNA 2FLPA 3SFGA 4FM1A 3PUFA 3DRSB 4FJKA 4ICLA 4HKQA 4MFBA 4CJSA 4TN2A 2YNIB 2R7YA 2R8HA 5J2PA 1WSHA 3B6OA 4TY8B 4JRPA 1BI4A 3H59A 1YVUA 2YNGA 3DYAA 2KW4A 2AX1A 2P51A 2BANA 2IM3A 2JGUA 1U45A 1EETB 4F4WA 1TKZB 2C22A 4BDYA 1GOAA 1T7PA 3TAFA 4Q44A 4KB7A 3MXIA 1NKCA 3QLHB 3FQKA 2X78A 5DG7A 3PHEA 3PVXA 3EYZA 1TKTB 1RYSA 3UR0A 2IMWP 3MAQA 4CJPA 4ZTJA 3D0PA 4H4OB 1NK9A 4F4KA 4DL7A 4NRUA 4KHWA 4PUOB 3TVKA 2ILZA 2Y1IA 4B08A 4FZYA 1KFSA 2UVRA 2BQ3A 3AO1A 2YNHA 2BR0A 2JEIA 3DOLB 1B9DA 1BHLA 4LY7A 4CJUA 4CJFA 3LANA 4JLHA 4H54A 3NH1A 2A1RA 3I5AA 1FK9A 3U6FA 3VQ6A 1ASVA 1ITGA 1NK7A 3NH2A 1HJRA 4ZMMA 4CK3A 1J5OA 4TY9A 1RBRA 2KFNA 4M42A 2YNFA 1RT4A 5EWEA 2PZSA 4O4GA 1JLAB 1WSGA 3ZT1A 3D28A 3LP0B 1W0HA 4O55A 4B8AB 4CJVA 1J9AA 1RDRA 4DTXA 4LQ9A 4FLWA 3DLKA 3CJ2A 4WYWA 3HP6A 2JEJA 2ATLA 5F8NA 3RR7A 2R2RA 3JSMB 2YKNB 1S0MA 2C2EA 3M8PB 1SUQB 2DPJA 3VQ7A 5KFOA 2RN2A 1HPZB 4CJWA 3P5JA 1U04A 4NLDA 3ZSVA 4CF8A 5KFIA 1ZTTA
chains in the Genus database with same CATH superfamily
2LQ9A 3P4IA 1VIXA 4G1QB 2QN6B 5I3UB 1Q86O 2ZJRQ 2Q31A 1IBMF 1U2VA 4C8LA 3NF9A 3TR8A 3ZEUB 3L2RA 4WJBA 2QK9A 2D3UA 4Z4CA 1CJTB 3RW7A 5HL7Q 1RCXB 4F4ZA 1GX6A 3IKMA 2EFPA 2YH1A 3PR5B 3EGWB 3Q83A 2O8EA 4DPWA 1QLNA 4OX7A 1YIJS 3O6WA 4IG0B 3JTNA 4F04B 4PHTX 3K89A 2DH8A 1YHQS 1JLBA 4B9MA 3C95A 3VVUA 4B1VA 3AD7C 3TABA 1FKOB 4NYPA 5D3GA 4FJGA 1DFDA 1NSPA 2MKHA 5AFUA 4CF1A 3WIVA 2QG9B 4K4WA 4NPOA 2GV9A 1CQMA 1FJGJ 4DV7F 5LJVA 1VQ5S 3HHLD 3UB5A 3NGSA 3THWA 2YV0X 4E3SA 2M0GB 3MCSA 2OD4A 4RU9A 2MQQA 2VA3A 4IYQA 1UZHA 3GG1A 2IC3B 3R7NB 4G65A 2FLLA 2E5LK 3QINA 2B9WA 3H5UA 1KLNA 1D9AA 3MCOA 4TQSA 1N56A 1PYTA 3RBZA 1ROFA 3MMJA 4J9UE 4I6WA 2AV5A 5KFCA 4Q45A 4DL2A 4G1IA 2R2SA 4X64J 1QUVA 2IIHA 3CNQP 5J1EB 2OTLS 2GQCA 2I38A 5AXMA 1VSJA 1HL6A 1ICEB 4KRFA 4O23A 2IFXA 2PEHA 3S3MA 3NGRA 3C6AA 1NPPA 5T14A 3PSFA 2HFNA 4GKKK 3LOUA 2EC2A 1Q8LA 3PW0A 1G3OA 2B3TB 2YKOA 3PV8A 1H7XA 1TR0A 5ELZA 2KHDA 4CBXA 5F8GA 5LMNJ 1U1MA 1FDDA 4QR0A 3KLFA 3T1HJ 1S9GB 2XC9A 3IS9B 4QS8A 2GEMA 1EWQA 4DB3A 2JDJA 2VUGA 5CCMA 1HNVB 3G71N 5GINA 1TGOA 1K6YA 4USVA 5CZ1A 3EDRB 4FVMA 2YPZA 2YWFA 2HB5A 2WUSA 3CMAN 4RCHA 2FC8A 3T19A 2PIIA 3M9NB 4FJJA 3MGJA 4OHXA 1I1GA 4FLXA 2F96A 2W8KA 5G0RB 5DG9A 2EEYA 3MMCA 3DNCA 5B0GA 3K8WA 3O9SA 5IQ6A 3OTDA 4EP5A 3PW5A 2D3O1 4CFBA 4LFAJ 4X4NA 3ZZZA 4I2PA 4F4AA 3NWRA 1JXLA 2EFNA 1XK8A 3MMAB 5AZIA 1XUPO 2IJRA 4EBDA 4NYNA 4JP8A 5M2UA 2MSSA 4K8XA 3R1LA 1XHXA 2FB0A 1NSQA 3THVA 4E0DA 2WTFA 2Z0GA 3HJVA 4X64F 1JLFA 2HS4A 3IM8A 1RT2B 4DFPA 4GVMA 1JX4A 3KJVB 3P5TL 2IA0A 1U7LA 3KTQA 3PZPA 4P71A 1WBDA 2DJWA 2G1HA 3HFZB 4NXNJ 2M88A 2Q79A 1IJJA 5B0AA 2PDAA 3CDUA 2UYTA 4DU8A 4QW9A 1NZ8A 3JSYA 3QIOA 5LMNF 2E7XA 4CIEA 3T1HF 1T6CA 3TZXA 3ULDA 1N5TA 3BQ1A 3NH0A 4GV3A 3KWGA 4WU2A 4F7VA 1ASUA 3JYTA 3BP8A 1NKEA 3R7SB 4X4PA 1YWXA 2VPWB 4QWAA 3H08A 2NRTA 3H2VE 4FO0A 1ASWA 3NS5A 3QIPB 1T94A 5IC6B 4X4OA 3KNAA 3I0SA 4EP4A 1WC1A 3T9NA 1HYZA 4M5IA 1NDKA 2JNJA 2J9CA 3LPTA 4LFAF 4ZVSB 1FFGB 5GMEA 3CCTA 1NGJA 1HKCA 3AVLA 2WB1D 4K2JA 2QL9B 1ITPA 3VQEA 3UQSA 3M2RB 5C0YA 4K4TA 4BLGA 2OELA 4DCPB 5GAHP 2B6AB 2GIRA 3PYEA 4FXVA 2W6KA 3GIIA 4BREA 1QUPA 1S6PB 3U9ZA 3KJQB 1OY6A 5T41A 3CTRA 4EYHB 4C6AA 3CJ8A 4DZDA 5B0BA 4ELVA 2HS3A 3AQPA 1V3ZA 4PAAA 2AP6A 1O13A 3TQ1A 2KFZA 4NXNF 5FDLA 4ISEA 5E84A 5G4DA 3V9ZA 4A8SA 2Y0BB 2DCUB 3LPUA 1E4FT 3KD1E 2HQIA 2ZHAA 4NLYA 2ZZTA 3LDLA 2YX6A 4ZVFA 1UL3A 2EW9A 4BY9C 3W64A 3UFCX 2NXUA 2KO1A 3QT5A 2Z30B 3DHXA 4YOYA 3UKRA 3VQBA 3NGZA 3R9LA 4CI6A 3ZSOA 3QATA 1VQNS 4LR7A 3ENAA 2F7TA 3EE8A 1S6UA 2B9XA 4IR1A 2X1GA 3N4WA 3OV7A 4A57A 1WEYA 4GV9A 4MYUA 1KCFA 2E2QA 4LBHA 2O8DA 5ETLA 5AT1B 4M8LA 2DXDA 1YDLA 2O67A 3LGMA 2O8FB 5AQXA 2Q2RA 4F02A 1GOBA 1REVB 2RAQA 3HULA 3IA0A 2IHR1 3QZ7A 1Q7YT 1QTNB 1ZBIA 4ECZA 2E5HA 3D1QA 3HZGA 3P31A 2MTLA 1RT4B 3BDEA 5KPTA 1PILA 1EIYB 3NWGA 2KG1A 3RB4A 2NRHA 1FVQA 1CEZA 4PABA 1LAVA 3OUYA 5AQKA 3Q24A 3KWMA 2WSFC 4F67A 4FJ7A 1VJQA 3EGZA 3FDSA 2YQ1A 3IO1A 3C3LA 1KRPA 4B9VA 3R1HA 2V94A 2VDHA 1ZPVA 2XWXA 3NP5A 4DTJA 2XMVA 1H2VZ 3DHWC 4B3TJ 2WSCC 4CDIA 1ZM9A 4HWIA 1UMJA 2GHWA 4U8YA 2BRKA 2E9ZA 3MM5B 1A9NB 4ILJA 4CH1A 2GWJA 2W42A 4AXJA 2M8DB 1W26A 1RLDA 2Z1JA 1QAIA 2ZH6A 4YDUC 3VN5A 4CJTA 1HARA 2G4BA 3OYIA 4GVBA 5C10A 1FRHA 3P83D 4X4TA 1WI6A 4KH0B 3T41A 3WXKA 1BQMA 2ZBQA 1MU2B 1IG8A 2EG2A 2WBMA 5KGXA 2ASLA 2MY7A 3SMPA 3H0PA 2QWQA 2F7VA 2NYHA 4QWCA 4PEOA 3T6BA 4CO2A 4NLQA 2FBYA 4FJ5A 2PFUA 4NLUA 4EZ9A 4KHRA 2QA4N 2QFJA 3A4TA 3Q22A 2FSJA 4I67A 3OFEA 2HHQA 3WQPA 4LUBA 4E89A 5LOQA 3ZCMA 5C42A 5CXTA 2DR6A 4DUZJ 4CJKA 4YORA 3IC1A 4WFAQ 1AB8A 1BCMA 1CC8A 2C42A 2IDEA 1OY9A 3G9CA 4YOEA 3DM2B 1U0HB 1RT3A 4NYFA 5BYQA 2CVEA 3PJ9A 3DOMA 2R4FA 1QY7A 2ROPA 4B3TF 5JJBA 5A6PA 3AB2B 2RILA 2CZ4A 3QFHA 2ZQBA 1QSYA 2XYPB 1PYSB 2HZVA 1A7GE 5KFPA 4CF2A 1BA0A 2NSCA 4FKXA 3FE1A 1WOSA 4FJXA 2K7KA 5CHCB 3NGUA 1U6FA 3V6DB 4AM7A 3FFIB 1Y7PA 4A5BA 4NCGA 1Q1KA 2BGGA 1M5VC 4DPOA 1BCOA 3CCVN 3BEXA 2YHAA 3UVJB 3IGNA 4ILRA 3HDSA 1PJ6A 5KTQA 2ZD1B 3KHHA 4IOAQ 3KLHB 3H90A 3ZLJA 1X3MA 1RZMA 1XR5A 1UVJA 2HPUA 5D6GA 2V4QA 3RSEA 2PY5A 2OUGA 1VQMS 2D9OA 2VBWA 3CSKA 3HHLA 3OVAA 4A48A 2RKIA 2RB7A 4B3MK 3LO3A 4RNFA 4R8UA 4DUZF 2IJFA 3UDLA 3BR8A 2UXCJ 3HD2A 4WF9L 2D5RA 1C4CA 4WE1A 4OI0A 4WQ5A 3L8BA 1SKRA 2V8HA 2I1RA 2EKNA 2XNQA 1DQAA 1GLAG 1JXEA 3J7ZT 3ZZUA 3DN9A 2DTJA 3G6YA 1S79A 2W2OP 3KD5E 4F3TA 4WFBQ 1SJ3P 2ZH9A 4P6QA 1RDBA 2B51A 2I9SA 1AYEA 1RHRB 3VWSA 3RGIA 4DXLA 1MWKA 1T44A 3V6HA 4Z94A 1RUSA 2XMAA 4CGGA 4QOZB 3NDKA 4JYAJ 3CGIA 4HYKA 3P38A 2OTJN 3OYHA 1QDUB 2AJ0A 3CHWA 2UU9K 5JVHQ 5IWAJ 3OYMA 4P52A 1YRXA 5KT6A 1S7HA 4CO3A 3LQVA 3IBFB 2XS7A 1Q7YO 3C66A 2OO4A 4DJBA 3ISZA 1CS4A 4BR7A 2BV3A 1C0MA 4FJIA 3UN3A 5LT5A 1VQ9N 2V5HG 1RDCA 1BXNA 1QM9A 2UUAJ 2B8PA 4DV1K 5BR8K 4JI1J 4OQJA 3M30A 3DFEA 1KDNA 1H7WA 1VQ6N 4EFAC 2HF3A 2RRBA 2HNDB 3C15A 3CCLN 4ILGB 3CJBA 3D5MA 4HHHA 2QWNA 3B6BA 2UXCF 2LYVA 4BRNA 3Q2SC 3PHTA 1VI7A 4GV6A 1Q79A 3S8SA 3IAYA 2XEXA 1WG1A 4NI2A 4B9UA 2LP4A 5DRKA 4OI2A 3MXHP 2OCEA 1Z4UA 2BJ1A 2B5JB 2I0XA 1C1BA 3E9LA 1VAZA 4H4KC 3EXCX 3OA9A 4GO5X 2GO8A 3N6NA 4RLEA 1H2UX 1VLOA 5G0RA 4CGFA 4GRSA 3AVCA 2DXEA 1RT6B 4H5TA 4EU0A 1RTIB 2LXUA 1OPZA 4URQU 3QB0A 4JYAF 2MQ8A 4M5DA 4YR3A 1TL1B 2YQ0A 4MK7A 1KQGB 1N4LA 3QRRA 1UWBB 1VGYA 2LEBA 5IWAF 3DGPA 3AVKA 3NNCA 1S9FA 4CEDA 4I1TA 2O8BB 3U7JA 3BF1A 4KAZA 2J4RA 3AA2A 3H20A 2UXBK 4QS9A 2J9EA 2IVFB 4MYTA 4J2BA 3J7YI 3GIMA 2MHEA 1I94K 3MX5A 1RTHA 2K8GA 5LSLA 4ZP8A 4C1NK 2JLFA 2UUAF 3D1HA 1NLVA 1C1CA 2CIMA 4JI1F 1ZAVA 4C23A 2LMIA 3FJ2A 2W7PA 3KHRA 3TAGA 2GWKA 1V9OA 4HT5A 3O9RA 5M1QA 2W9CA 4IOCL 2J8AA 4F3OA 4MH8A 1RT7A 5KOWA 3T5KA 2Q6BA 3G6EN 1IO2A 5A8RB 4IFYA 4KSEB 2F40A 3VAHA 3NAIA 2QV6A 1H0HB 3PJWA 4MIAA 2RDDA 4HTLA 1XI1A 1I3OB 3PKMA 1IR2A 2IM2A 4MQ3A 5HBMB 2GVZB 2MQMA 5JMVA 4XEIA 5AQPA 5EX0A 1RQ0A 4K5SA 1RADB 4HCCA 4H0YB 2DXFA 1WTFA 1EP4A 3LM9A 5DGBA 2DFEA 1ZBLA 3EKUA 2V4JA 4GC6A 2CG4A 4H8KA 4BHQA 2P9UA 4JI3K 2W01A 3AXKA 1SJ1A 3NHGA 1FI4A 2CZVC 1IKVA 1RLCL 4DEZA 1YBTA 4DCOB 4P2FA 1OMSA 4PQUA 3NXZA 1ZBFA 3T69A 4C98A 5B7WA 3NMRA 1TKDA 1NOYA 4FK2A 5MAOA 3C14B 2VQFK 3CCMN 2M5YA 5KFRA 3LDSA 1BU6O 2VIHA 2ITMA 2ZBRA 2KZMA 3NLCA 1ZM2A 1WF1A 4RL1A 2ZKUA 5CE3A 1OY8A 2DBBA 3M6GA 4Y6IA 1HRHA 4IJAA 4CNZA 3G10A 3US5A 1EX8A 3FEXB 1YTUA 2KVIA 4DOZA 1HMVA 5IT0A 1PSDA 3ENVA 3J7ZO 3I32A 1NB7A 2ZF5O 3QFPA 2GMHA 3GIKA 3K2YA 2G2OA 1RXOB 1FRIA 4ID5B 1S9EA 3O9TA 1YJWS 4DCJB 3CFOA 3AARA 3QO9A 2YHXA 1FXLA 3H4BA 1D8ZA 4Z0UA 2AX0A 3ZC4A 1UP1A 4IRCA 3SUOA 3FMWA 2ETJA 4O3SA 2V52B 4LVNP 4HI2A 3LALA 1D3WA 3FEYB 1TV6A 2RUSA 3QT8A 1X4DA 4Z7CA 5J1PA 4OYBA 4ECYA 2GCFA 1XMQJ 4KGKA 3TTFA 1NHUA 4C3KA 1HBNB 1TTHB 3FGUA 2YKPA 2DR5A 1CJKA 4J9QA 3WNFA 1U24A 2Y0SD 5FPNA 3C46A 1REVA 2J5AA 1XR7A 6FDRA 4ETZA 2JEFA 1MWQA 4DPUA 4CTAB 1XR6A 1Q53A 3DDIA 5DK5A 4CF9A 2PEBA 3OHAA 1R8BA 1X4CA 3H5SA 4Z2XA 3TZZA 3KUEA 4KY3A 1RU1A 4DV3K 2GUPA 3MDFA 2XB2D 2ZM6K 1KD1O 3PX6A 4O3OA 4EBEA 1VISA 5IQQA 1M5PC 1O0PA 2BBEA 5ETMA 4H5RA 3O1LA 3GTYX 4NASA 2WVFA 2ZH5A 1H72C 2X6SA 3M6XA 1YJ9S 2VGNA 3MXJA 5L8RC 3MK6A 5CR4A 4M1KA 1S72S 1HBMB 3MM9A 3IAM9 2H54B 1WAJA 4ZITA 1JLEB 3H7HB 2XGPA 3OYAA 4DR4K 2W25A 2BE2B 2MKYA 2GX8A 4UUXA 3BV8A 4UF4A 2QLXA 1VQ4N 1UA0A 2P8IA 5B0DA 1QJHA 4MLEA 4ISGA 5AQRA 4A62A 3SUNA 3E2EA 3CJKA 3GOIA 2HG4A 1XMQF 3JSMA 3I5BA 2CJXB 2YKNA 1HJOA 4Y0FA 3M8PA 5ITHA 4EBCA 2GAGC 3Q0AA 1HPZA 3UD3P 2W9BB 4ANEA 2BUPA 1WSIA 3PW7A 1YUWA 3VQ8A 2O01C 2ZOGA 1D9DA 2J0SD 2CH5A 2XZTB 1IM4A 2P9EA 1GLEG 4BG9A 2B4PA 5KG6A 3E9PA 2CQ0A 2CPDA 2L9NA 3IGVA 5AZJA 4I6MA 3CC2N 2HFUA 1AZSB 4AHTA 4FW2A 2HZAA 4NLOA 1QZ5A 3S9HA 2GA7A 1VQPN 3KLEA 4DBQA 2HQDA 4TU8A 1IH7A 1VQON 5DETA 2DFHA 3R6LB 2V7ZA 4YDUA 3AO3A 2HVHA 3T1YK 1K1SA 3VF0B 2DGWA 2K7JA 5KFJA 5T7LA 5CYQB 1WF0A 2Z4PA 3CCRS 1U47A 4BR4A 4L3KA 3LWLA 4HDHA 4HACA 1E6VA 2GMJA 4H0TB 5IV4A 3R3LA 3VQ4A 2E5IA 1WC4A 3CM5A 1KTQA 4LREA 2RHQB 4PL8A 5I3PA 1IM6A 1EQMA 4DU3A 1LWFA 4Z4GA 3TVZA 1L3TA 1RJJA 4NLWA 1JMTA 1XERA 1XQIA 2DNHA 1Y5IB 4H5WA 1DHMA 3W3SA 2XBPA 2R2UA 3K8VA 2ITGA 5CQGA 3FZ2A 4FJNA 5DJBA 2RNEA 4M3RA 3OQ2A 2OPPB 2CAJA 2ZH2A 1UAXA 4WYLA 1JCFA 3QRQA 5CY4A 1SL1A 3NCPA 3PACA 2X74A 2F9WA 2GVDA 1WSRA 3NVKA 2DGUA 1WUUA 2FZCB 1SVDA 1NPKA 1V4TA 3CCUN 3VVTA 4F50A 3VV2B 5E5NA 2PO4A 3IWNC 4OMFG 2QMWA 1O6XA 2EK1A 4RW7B 5HJXA 3ZZTA 5EX3A 5ETVA 2LDYA 3K5LA 5GAEI 2DRAA 3ENQA 3EGNA 4Z4HA 1YJ7A 3MWTA 3FC9A 1X5SA 5KT2A 1TQLA 5AJ3J 1RT5A 2F5GA 1H73A 4K41A 1PGZA 4CJQA 1A0OB 4CT8A 2LKZA 3P49B 2DHGA 3OR2A 3OYNA 1RISA 1GMWD 2VPYB 4ETXA 2B43A 3A8KA 2R7WA 3CCWA 4ZPVR 4M95A 2V4RA 7FDRA 4DV4J 4MO4A 1Q8BA 3IAS9 5JXSA 1N32K 4CM2A 1CBKA 2MLXA 3X3UA 1ZOTA 1NGFA 2XQCA 5U47A 1GMUA 3EE9A 3U3YA 3KLIB 4WQ4A 2C2MB 4JV5K 5IM0A 3NMAA 3PJXA 1FRLA 1NBEB 1RKIA 3OTCA 3G4SN 4JKAA 1ZTWA 3HMJG 3VAMA 1HNWJ 2ZKTA 1BQXA 1HNZK 3WIUA 4FJ8A 2Q0UA 2F8HA 5E0OA 1ZBSA 5RUBA 1GXUA 3CJSA 3ZNUA 3B82A 1R0AB 3CVKA 5E33A 3KKSA 4F4XA 4LBIA 1T6DA 2I5JA 3UDEA 3K5PA 4Z4IA 1W2BR 3D66A 4TYAA 1FVSA 3OFHA 1F3FA 2FGOA 3NGIA 4QIWD 5L38A 2AGQA 2H51B 3ULHA 2NZTA 4RBUA 1HBUA 5AJ3F 4PWUA 1XNQJ 1OH6A 3DRRB 5F8LA 3WQUA 1CLFA 3SXLA 1W2IA 3NY0A 4BDPA 1VHIA 1YJNN 5KG5A 4YOXA 1SPBP 4LSLA 2RPIA 3GR0A 4FOEA 5AQHA 4CLFA 1AUSL 2L41A 2KZZA 4DV4F 3ATUA 3FFKB 4KFBB 1ZZFA 3O08A 3CCEN 5EGYA 4ZN1A 1F5BA 3MFHA 1F6TA 2BUNA 2QXLA 2ZHBA 2Q0RA 4C2MA 2GHVC 1LFPA 3D68A 2KRBA 4E8UA 2A1SA 4ZOSA 3SLCA 2R7XA 3K9JA 4OPHA 2GFFA 3ZZOA 1FKPB 1MWMA 4RW9A 1IR1A 2L48A 4AHRA 1ZXOA 1HNWF 4DR5K 4O0IA 3NBPB 2ZNZA 2LA4A 3AO4A 3SSRA 4ZVEA 2HGNA 3RB0A 3AAPA 1WHYA 2KXFA 3EM1A 1Y10A 1CULA 4H5NA 5FPEA 2LQ8A 2VG7B 4AL5A 4ALZA 2K06A 2ZH8A 4CEZA 4BC2A 4OJ1A 1U0SA 3ITHA 5J2NB 1JLCA 1DY3A 4H4KA 1VQLS 1W25A 2UUWA 3A5NC 3HRGA 5HROA 3OVNA 2VBZA 4DTMA 2CA9A 3V81A 2FLPA 1ULRA 2YWGA 3ELHA 2JWKA 3MWBA 1DZ5A 3K17A 4ICLA 2GJ2A 2VV5A 4QYZK 4OYAA 2K3KA 2X1AA 1XNQF 3R5JB 4CZJA 3ILLA 1WJ9A 5AE3A 2FHOB 1M5SA 3E3XA 4C9DA 4OYWA 1ATSA 3LUYA 1YVUA 3MM6A 4GKJK 2YNGA 5E2QA 4FWMA 3DRYA 2NRWA 5CZVA 2AX1A 1B0VA 2BKOA 1TKZB 4EGLA 2PI4A 4BDYA 2IPOB 4O8UA 4TU9A 4Q44A 2MHNA 4MTPA 1VQSA 4B1ZA 1NKCA 4PL7A 3QLHB 5D4OA 3OVBA 1HW8A 5DG7A 1Q8KA 3EXYA 2FF6A 1TKTB 3UR0A 4X4SA 1N36F 4ED5A 3D0PA 2QWPA 4DL7A 3UKUB 3J80O 4NO7A 4FYYB 4KHWA 2I7PA 1MNEA 2E1PA 3D9BA 3OXFA 4B08A 2Y1IA 1H6KX 3W8GA 1JWWA 1HNXK 2YNHA 1VC5A 5HVHA 4OZ5A 3CI5A 2V8DA 4CJUA 4JLHA 4H54A 3MTJA 1B70B 2BA9A 1ASVA 2JRSA 4CLSA 2HBLA 4KR0B 1URNA 4TY9A 3UCUP 2D1KA 5HMZA 5EN1A 1HUXA 4O4GA 1PC5A 1WSGA 4CZKA 1W0HA 4O55A 1TZ0A 4B8AB 4JNEA 2C3PA 2FIUA 3E66A 1IQZA 2DISA 2C2EA 3GU0A 3D6RA 1SUQB 5AQVA 3VQ7A 2RN2A 2LFVA 2YHWA 1GEHA 4NLDA 4CF8A 1IXKA 2ASOA 2YHYA 4A59A 2VU5A 1N34K 2C2RA 3W0LA 2J0WA 4CLUA 1RAAB 3ZT3A 2VFSA 5ETPA 4KAIA 4QU7A 4CZCA 4DHYA 4YHHJ 1X4AA 2Y9HA 3GJTB 3AVMA 1KXPA 4DU4A 4IH5A 4FS2A 5D4PA 2PMHA 2XZDB 3W2WB 3MM7A 3AA4A 4DV2J 1F21A 1HNXJ 2B7BB 2IAJB 1Q9YA 4IKFA 4FDFA 2PA3A 3WXJA 3G87A 3HSDA 1D5AA 4CJLA 1AROP 3CDEA 2FC9A 4FW1A 5MLCQ 3W63A 4DFKA 3IP0A 4H5VA 2A3JA 3I0RB 1V3SA 2YX1A 3R5BA 2AQ4A 4M41A 3NCQA 3PY8A 4FK0A 5KFWA 5J2MB 2JL9A 1HA1A 4JI4J 1PJ7A 4ZVRB 3AD9C 1T3OA 4TVAB 4DR7K 1T9VA 3N6MA 1LWXA 1DURA 2O4IA 1SXLA 1XNRK 4OYMA 1S4FA 3PRBA 2AD9A 2E6LA 1ILYA 4C3LA 1GXTA 2R7QA 4PCQA 4IDHA 1T11A 1MMLA 3W65A 1NAQA 4ECVA 1HBMA 2ZH4A 3SNNA 1YITN 4ZPTR 4YY3J 3RAMA 1S6QB 3TSUA 5M1NA 4H0XB 1JLGA 2EG1A 1BWVA 2AJ4A 4KYZA 4I2QA 1HWLA 1D9FA 3C16A 2Z2MA 3JSBA 5ETOA 3ILOA 3OS1A 4JD2A 3L9ZA 3NEKA 3BM7A 4DQ8A 5AQLA 1WLJA 2LDIA 1GNKA 3EY1A 4KO0A 4YHHF 4CD1A 3KLGB 4CJEA 2GS8A 2EFVA 4ED4A 4A8MP 1HQEA 1SC3B 4F4YA 1HFEL 3VGKA 4N41A 1TVRA 3H3NO 4DV2F 4YR2A 3CJAA 5GADU 1MLAA 4BDZA 2EHGA 2ACMA 4M7YA 3MPUB 3E1YA 1WSJA 1BE4A 2L9DA 4JKHA 4CGHA 1M5HA 2J9DA 4LF5K 5IT9U 3ULEB 3SBGA 1B9FA 3QWUA 1IBLJ 3KK1B 3I55S 1IUJA 1F9HA 3VAGA 2AT1B 4CIOA 4RPFA 3A13A 4JI4F 2HMPA 2YI1A 2YVSA 4OJRA 4WXWA 1X9WA 3PYGA 2O66A 3UN2A 2PFDA 4JI2J 1FDNA 2QC3A 5B0FA 1RWWB 3LZIA 4CBUA 2MB0B 3DXBA 4UT4A 3QBXA 2LECA 2QKKA 1ZAXA 4M5LA 1YIJN 4H0PA 2XSJB 4LF7K 4OLBA 3LTOA 1SQKA 4JRQA 5JS1A 3PEJA 2OLWA 3F73A 1WOQA 4FOIA 4YY3F 1Q16B 5JVGQ 1CZAN 3MAAB 2C3UA 2H3GX 2OP5A 1L3SA 1C4AA 4FYDA 4Q0BA 1FHTA 5EU7A 1MWYA 4OHWA 4USWA 3BUZB 2HQ3A 2IGIA 4IO9L 5L1KA 3LP1A 1V5VA 4RU2A 1DJ0A 4WFXA 4LF5J 1FNXH 2OPPA 3Q8YA 4O8KA 2W41A 1DBDA 3MECA 1SKSA 4JHDB 1HHSA 5B0EA 1K1QA 3MMBB 1BL3A 4KQZA 3IR5B 3ZTOA 2P9LA 4DFMA 1W7AA 1IBKJ 2R9LA 4CEEA 2Q36A 4P10A 5KFYA 1GMWA 1HNIA 4P2SA 1Q8IA 3VQDA 3OW2M 3ZX2A 1RTJB 4DL6A 4DQRA 1W9HA 2DNOA 2V7YA 1IBLF 3T5JA 3C65A 4ZIWA 2DTUA 1Y64A 3SQ4A 4E7IA 4X65K 5HSPA 3MCAB 2A0FB 4NXMK 3RUBL 4FLTA 3ZO7A 4JI2F 3UNGC 1YJUA 2H5JB 3OYFA 4WKYA 1TMJA 5MLCV 1MMNA 1UVKA 1X4HA 3GYNA 3M6VA 1H3DA 2W2MP 5L9XA 2P2CB 1QHAA 4DTSA 3W9HA 5HL7L 3D67A 3B8HA 2FLOA 4FK4A 2QEXS 4NZ0A 3ZZ0A 4KH6A 1JLQA 1R3NA 1O1WA 4BRGA 5JS2A 3O9QA 4KHSA 1EJ7L 2X51A 2GELA 4FZVA 4OX9K 2RF2A 3QJJA 1KLMB 3K0SA 4DL3A 3G8SA 3AJ1A 2C3OA 5HMWA 4DR3J 4JI6J 1HBOA 1P6TA 3C8YA 4LF5F 2KTQA 4K43A 1RB0A 3CF5L 1TUVA 3KVGA 4O0JA 4ID1A 2W9AA 5LMUJ 4MFBB 4OV6A 2MGZB 1NWKA 2V2VA 1X9SA 1IBKF 5D0GA 2OGUA 4FP9A 1WNSA 4Y28C 2G2ZA 1U1KA 1S1XA 4HTUA 3POTB 4OZ2A 3DLGA 4QIGA 1WDTA 1RBTA 5I42A 2ZWOA 2HMIA 5FRNA 3ZTSA 3D2EA 3BH7B 4F3MA 4NEZA 2P5VA 2YBVA 1S1UA 4C8NA 2E20A 2CNLB 3DLLL 1AA1B 3VAJA 4CHNA 1S1TA 4X66J 1RILA 1XQSC 4TYBA 2YCHA 3PX0A 4BRQA 4DX8H 3R2CJ 2JLEA 5D0EA 3O2IA 1C1AA 2I2YA 3PCOB 2KHCA 4CQ1A 4B3OA 1JJHA 1TAQA 4RBVA 4LF4K 2EWHA 3NNHA 1T3NA 1TUUA 2R7UA 4PPZA 2KHOA 5DDPC 4K0KK 4OX9J 3P8BB 2YWKA 3CJRA 3LAKA 3MXMA 2HBJA 5SUHA 4ZVOB 1A5XA 5DLGA 2HNYA 1JJ2M 3O3GA 4FN5A 2FJDB 2NXJA 3TZYA 2HWTA 4IEIA 4RUBA 5D15A 4CFCA 2J6UA 5C25A 3EVWA 5E26A 5DGAA 2WFBA 3OTOJ 4N8NA 3C7NA 5TKYA 1XMOK 1NM1A 4DR3F 4JI6F 4CH7A 3THYA 3BQ0A 5KT4A 1BO5O 3EICA 3O4WA 4ECTA 3DLKB 2CGJA 5LMUF 5KFAA 2JC1A 3DKDA 3WBZA 1N0VC 1W7WA 4LVOP 4TKTA 1CJUA 5HJYA 4BC5A 5GIOA 3A5OC 2KB2A 5BREA 2PT0A 2K2PA 3LP3A 3LDNA 1KAZA 2C2OB 2CQGA 3CJTA 2DGOA 3KHLA 1NDLA 3NL0A 1U2VB 5DLFA 3IRWP 1FE4A 4LSZB 3VOVA 2V6AA 2DHAA 5EWGA 4RBTA 4X66F 3HVTA 2ZDPA 4IDKA 2X6NA 2O8EB 3ENOA 4HHUA 4RW6A 3S3NA 3AQOA 3QJLA 1H74A 4ES3A 2WC9A 1JLBB 3D45A 2G0CA 5KGWA 3JS6A 3RTVA 2BJ8A 5IV3A 1RAHB 4DV0F 2AEFA 4ED3A 2NUHA 2QMXA 1OVYA 3AXMA 4OX9F 2HSEB 1FFSB 3SQGA 1NRKA 5D3GB 2ROGA 1MN9A 2ACYA 4ZCIA 3TSQA 4G6VB 2IYIA 3GMGA 5KFTA 5C2GA 3GFHA 1FTCA 3FZFA 1SH2A 5A76A 4U7BA 4AILC 3D6TB 4ED2A 4OYOA 3IN5A 1JQGA 3UPFA 4M5JA 1SIWB 3OTOF 3ZYYX 2ZBPA 4QS7A 5BPMA 2NYIA 4DWIA 2J6SA 3THWB 4FNHA 3VETA 3M8WA 5A2QO 4XPEA 3PYFA 4OKJA 4JI8K 1X4BA 3S3OA 4BC7A 4CZHA 1VQNN 1NNDA 4PG8A 3P6YC 2P9PA 3IFRA 3IG1A 4ZHRA 5LXYA 2W6LA 1MDUB 3LW5C 3R8YA 1RFQA 3NRBA 5AE1A 1RK8A 1QQCA 1TL4A 4LSNA 2RS2A 4YDDB 1WB9A 4AHSA 1J5EJ 4OGEA 4OLAA 4DL4A 3PW4A 2GGPA 2D0PA 5GAGI 4MMOA 8AT1B 1IKWA 3VAIA 1TUYA 2DNLA 2G0IA 3SIPB 5AXLA 2CQDA 3O3LA 1JIHA 2VDIA 3P39A 4DTNA 2XSFA 2CUYA 3LA0A 3QEPA 2P9IA 3EGVA 1Z2ZA 2CQBA 3VTIA 4JAXA 2N3LA 3QGHA 3NS7B 1RI7A 1KONA 4CD3A 3RWUA 3EMTA 1X0PA 3M05A 3ALYA 3MF5A 2VG5A 3S1TA 1RTZA 4ZVTB 2QLJB 3W9JA 3KLFB 2KQ2A 3KOAA 3TVYA 5L1LA 3GG0A 2QM1A 2VICA 1UVMA 2Y3YA 1GXLA 4M3YA 3SDEA 3J7YP 4I4BA 1VK8A 3VQ5A 4C97A 1O5JA 4L75A 3D3BJ 2QI2A 3RVCA 1NGBA 1SQGA 4JBCA 4DX6A 1YGYA 3QWPA 1TL5A 5EHHA 2NUUG 1PCAA 1SV5A 3BYRA 2W24A 3MMCB 4UOCA 3C0BA 1WI8A 4TXSA 2UV8A 3K58A 4A8XA 1LWCA 5IZHA 1NH8A 1W97L 4F25A 3Q89A 3VQPA 1VK3A 3FZKA 1JKHA 4I2PB 4HUGA 1KAYA 2MQPA 5AZIB 2EFOA 5THWA 3KHGA 4LF6K 1J5EF 3NS6A 4XH5A 1GAOA 4FXWA 4CGJA 1HIYA 3VGMA 4L72B 3L4QA 2M3DA 1BG3A 1JLFB 2FJXA 2HWIA 2EPIA 3H40A 4NEYA 1FJEB 2NNWA 3OYCA 1SH3A 2HNZA 3MEGA 2FF3B 2E1MC 3AOBA 3NFAA 2RE1A 3LM2A 2UV8G 1ZBTA 2BJ3A 2P9KA 3H98A 3OYLA 4BE2A 1CJVA 3DAWA 4X62K 4QOTA 3NG8A 1Y97A 2D0AA 2AEMA 3UR3C 2R8IA 5JUMA 4X4UA 1Y11A 3M1VA 4BRIA 2BXJA 4I0WA 2PSZA 3CCJN 1DTQA 3AHPA 2A42A 3JYTB 3H3OB 5K5MA 3IUCA 4AHUA 4CRJA 1LV5A 4E98A 3MD3A 2KVQE 4NA1A 1HYSA 1IKYA 3KUHA 2FQQB 4N5SA 4LF6J 3NF8A 2KN4A 3I0SB 1KN6A 3PFOA 1VJWA 3ONQA 4ZP9A 4PYAA 4DS4A 3CE8A 2BH1A 1RT1A 2LQJA 1SKWA 2HQGA 2OSRA 4N77A 1RWXB 4YMEA 4ECSA 2DNQA 1VRTA 2HLTA 3GB0A 2D1CA 3FUYA 3SZ2A 3W60A 4EK2A 4HI1A 3D54A 1VQMN 1DLOA 1HWIA 2W4PA 3PYDA 3TSPA 2Z57B 2BM0A 4CYUA 4YS2A 5FDLB 1HKBA 3H46O 1FWPA 5D4NA 1Q5VA 5F8HA 4A2AA 4DFJA 1S10A 3J7AN 4GMKA 4V19S 1WELA 2LSNA 1SQFA 1U48A 4WFAL 2C2ZB 3D4JA 2F65A 4BRAA 1FXRA 1KHVA 2IOCA 5KFSA 1Q81O 3AODA 1VBYA 3QGGA 3OJSA 4Y2IA 2QX0A 3I56S 1HD1A 4DMNA 4DTRA 4MKVA 3UKRB 2R7OA 4HEA9 3LGHA 3FKBA 2UUCJ 1C0UA 2POKA 1U09A 3CD7A 3Q8VA 3J80U 3WXLA 2FJBB 2HRYA 4CIFA 4BBYA 2XTJP 3PRDA 1B7FA 1Y3KA 1QAJA 3Q8PB 2O8DB 2QMUB 1DKGD 5CZ2A 2DNPA 3V6KA 1K0TA 4J9OA 4DUTA 3JXOA 4WF9Q 4CERA 2UXDK 3OL9A 1S1WA 1D1UA 3TA1A 1MSWD 5LL6Z 4DR2J 4Y2KA 4EI2A 3ZSYA 2B4VA 2WW4A 3OUYB 2Y1JA 1TKXA 4LRAA 4IOAL 3D7EO 4OIXA 2MKCA 3PDNA 4RG8A 1HWUA 1WHVA 4U96A 4WIIA 1VBXA 3R5DA 4PRFA 1UOCA 2G0JA 4DHVA 3ZT4A 4P7VA 3JB9k 3SEOA 4NCBA 1NXIA 2ASMA 3CIZA 3OD2A 2ZJPL 2Z8QA 1S0VA 4E1NA 3AAQA 4MIBA 4ECRA 1S49A 2HHTA 3H4DA 2XULA 4NYZA 1UW4A 3F5TA 5F9NA 4DUYJ 4WWSA 3SSSA 4K4XA 1FE0A 5AQWA 3TZWA 4CLWA 3CC4S 4GVBB 1A5VA 5LJ5Y 5ADXH 3TWHA 4M63C 2RUGA 2G8UA 4ZVQB 2LXFA 2RT3A 1BQMB 2KT3A 1DQ9A 2UUCF 1XBWA 2DY9A 1FNMA 3AVJA 6AT1B 3OFGA 4JS4A 4ERDA 4CEFA 3VTHA 3CYMA 4WFNL 5KFGA 1S59A 4LF9J 4M94A 3CCVS 2XRIA 2V2ZA 4JI5K 2V9KA 5JVHL 2IVNA 4FNIA 1P8ZA 1BWFO 1NKBA 3IWXA 4J91A 2RHKA 4BRMA 3MEEA 1VQYA 3G2XA 5C24A 2QSWA 1YZ7A 2Z1GA 3EUNA 2AMCB 3TNVA 1JXVA 3DRSA 4E1MA 1VBKA 1FO1A 3AOAA 5C42B 2YNIA 5ETQA 1OH5A 4DR2F 2VFUA 5CD4A 1F5CA 4MKYA 4TY8A 4YB5A 3RRKA 3P4UB 4KHQA 3NAEA 3M1FA 1RT3B 2V50A 3DOMB 3IBWA 1OIAA 1EETA 2E66A 3MPDA 2QWRA 3J7YU 4TNOA 4QIFA 3TWZA 3BJYA 4K42A 1H38A 5GAEP 4NZ7A 2DNGA 1EARA 3RW6A 4DUYF 5DM6Q 3U9DA 3GFXA 5GAHI 9RUBA 1SAZA 3QAUA 1B4SA 1CXQA 5KT7A 1BWEA 4OZ3A 2OEKA 3H5YA 4KC5A 2B4JA 4KH1B 2KT5A 4Z7YA 3LPEA 4CT9A 1HI1A 3O5BA 1N8RO 4NCGB 1PBUA 1H1VA 2EFQA 5JLHA 1HR0K 3JQKA 5AQFA 4LFBJ 3RB6A 5C15A 2E5JA 2XCPA 5K8PA 4LF9F 4B9LA 3CQXA 3CC7N 2IDOA 2J7UA 1KVCA 3LPYA 2FHJD 1JLAA 2HAIA 2R3VA 3LP0A 1VQ9S 3THXA 3LF0A 1G1XA 1YRUA 4IOCQ 2EX3A 3RSEB 4WZMA 4FJHA 5A6WA 3VQ9A 3HHLB 4WCEQ 1BD6A 2RKIB 3LAMA 2H65B 1FFWB 2DO4A 4R8UB 3EN9A 2HBRB 1JNRB 4NLCA 2RQ4A 2UVUA 1ZC6A 4CO0A 1CLQA 3FSXA 1AFIA 3TYTA 5BJRA 4WE1B 3ETOA 5E3QA 1YJWN 2ZH3A 4CGIA 4MKBA 1KTVA 3VQSA 2GNKA 4B9SA 4F2SA 4I9LA 2PGCA 3M2VA 4B3RJ 1SJQA 3CCSS 1BISA 2ZH1A 1UTAA 4HH1A 3W66A 5DDRC 3HOSA 2L9WA 2Q6CA 3TANA 4H4MA 1TELA 5KFFA 1RCHA 2MQOA 3BN7A 1GLBG 5ADXA 1VSKA 2RH3A 3C6UA 5IOLA 1HR0J 8ATCB 5L39A 1WC6A 3BF3A 2VWBA 4BE0A 2G8WA 2A3ZA 3FZLA 4P73A 2LVWA 1Z2LA 4A8FA 4USKA 3UWTA 5A8WA 5A8KA 2W1BA 2AKWB 1UKUA 4DSLA 3SJHA 4K4YA 1CS4B 1X4EA 4F9OA 4LFBF 3E01A 4KPCA 4AM6A 1UEUA 1WEXA 2J7KA 4PXDA 1FTRA 2CNKB 2PAVA 3VAKA 3GG4A 1TMMA 3MFIA 3I9ZA 2HSTA 3M8SA 2HHVA 3JAMU 3M30B 4EEYA 2RVJA 1TL3A 3C15B 2DHSA 1RCOB 3W7BA 4H0OA 3W9IA 2SXLA 2CJKA 1SC6A 3CMQA 3L3VA 3MM8A 3MAHA 3J81j 4CZGA 3CJ9A 3MN5A 1C0TA 4CW7B 1YJ9N 1NGCA 1VC0A 2GQQA 2ZWPA 4QYRA 2MPUA 3WUHA 2IIRA 2WB4A 4NI2B 2LU2A 4E1JA 2OZMA 3UNYA 3M8YA 3IBCB 4I6AA 3JSRA 1QD1A 2E5LJ 1C1BB 3CFRA 4EMDA 1FJGF 4B3RF 1RAIB 4ZVUB 3C2PA 1JCGA 3LDOA 2FVRA 2A5XA 4DTPA 2FTRA 2V9WA 3SCIE 2MQNA 3H2UB 4J9VA 3DXMA 3L4IA 5LY3A 1X5TA 1V6HA 4FF1A 1HR0F 1KAXA 3E8OA 4Q2MA 4USMA 4M5DB 4OI3A 1QQNA 1UCNA 4E19A 4DV5K 1RWVB 1URRA 5D77A 3DGPB 4JKEA 3BGUA 2MY8A 2WBNA 4J9KA 2IMOA 3N9UC 4ZPDA 4GKKJ 4CWBA 4FF2A 3CCMS 2B7CB 3BF4A 3V9WA 1W2BM 3NMUA 2HZCA 5KOXA 2N7CA 2AZ3A 1RTHB 1NH7A 2CG8A 5FIIA 2H5IB 1C1CB 2W40A 3NF7A 2KKZA 4HHJA 1K73T 2KFYA 3HKWA 2N4DA 4Y0WA 2W9CB 1OSDA 1BDGA 1E6YA 1HQ2A 1RT7B 1FEEA 2ZBIA 4DMZA 4B1WB 3M9OB 3CCRN 4IFYB 4L73A 1VR6A 2HF4A 2DRDA 4J2EA 1ZBUA 4IH7A 4RW8A 1RBAA 2CQ2A 1S97A 2WSEC 2AJ2A 4OI4A 2XY5A 1LAWA 2DR9A 2UVWA 2E5LF 4HR2A 1P9QC 4AYBD 1NGHA 3N28A 5K14A 1EP4B 2C1EB 4JK9A 2VC1A 2V4JB 1RAOA 1UZDA 3MR6A 3T7ZA 3QNWB 2E4LA 4ZDNA 4ZLLA 4ECQA 4DR1K 5ETKA 2P9UB 5F2RA 3CETA 4FZXC 4K4SA 3FMBA 4DTUA 1NU4A 2CJBA 1KOHA 2HBQB 3GV5B 1KVJA 1IKVB 3T5LA 1Q82T 3OW2R 2HGMA 4DSKA 4HL9A 2Z1IA 4PQUB 1AT1B 1UVLA 3OTBA 3SYZA 5HQ8A 1FX2A 1F0XA 3HSGA 3MX2A 4CEQA 1Q0NA 1Z26A 4OFZA 1MROA 3UD4P 4GKKF 2VHGA 1S4EA 1NHVA 1WC0A 1SC4B 5FRMA 3JQJA 2XCAA 1I39A 3R5AA 3W1YC 4DG1A 1F5AA 2E88A 3EL2A 2RSQA 4FBTA 3W8PA 3L2QA 1VQ7S 1REGX 1R7IA 1BY9A 2DGVA 1HMVB 2CJQA 3RBXA 1QS4A 5EVZA 1SJFA 2ALZA 1S9EB 3A1YG 4LRDA 1RHJB 3CG7A 4CZIA 4RNOA 3QO9B 2F4FA 1VRUA 3AJ2A 4IZ9A 4CHZA 4FLVA 3QMQA 4CO1A 3F56A 4DR1J 3U1NA 1DAXA 4PKDB 3DRXA 4BGAA 4FBUA 5BYRA 4ZPCA 2WVBA 3ZSXA 2X3GA 2AYGA 5GAEU 3ID8A 1NK6A 1VSEA 2OI2A 4WFYA 2H1YA 1TV6B 4ZPAA 4RNNA 2H4WB 2BYCA 2QFIA 4HLBA 1QVFM 4HKQA 3KDNA 2B9EA 2R7YA 1UFWA 4FWSA 5J2PA 1FDAA 2QL7B 2ABYA 1CJKB 2Y8YA 3IMQJ 5JICA 5A2QU 5HI7A 4JRPA 5GMKa 1BI4A 3H59A 1YAGA 4NB4A 4BROA 2DEJA 3DYAA 2KW4A 3D2FA 2BANA 2IM3A 2JGUA 1IJEB 1U45A 3VEZA 3O5TB 4F4WA 2O8CA 1OQ6A 1GOAA 4KB7A 1U26A 5ETRA 2MZTA 3FQKA 3AD8C 2X78A 4JB8B 4RWTA 3PHEA 1CG2A 2P9GA 3MUMP 3EYZA 4DR6K 3IFEA 4ES1A 2IMWP 4CJPA 2JOQA 1FRXA 1NK9A 2ZUGA 3GL1A 3PIOL 3TVKA 2E1YA 1XIQA 1KFSA 3JS9A 2DGXA 3OTEA 3AO1A 1TL7A 2BR0A 3ZZRA 1B9DA 1JJ2R 4JEPA 4LY7A 3NH1A 1NU0A 1FK9A 3MM9B 3U6FA 1ITGA 3GWCA 1HJRA 4IEEA 3GJQB 4ZMMA 3BKUA 3TQEA 4L6V3 1J5OA 1NEEA 2HKEA 2PFFB 2YNFA 1IR0A 3J7A1 3CXCM 4P9SA 3D28A 3QAEA 3AFGA 1J9AA 1RDRA 3CJKB 3CJ2A 3I9V9 3PTWA 3RR7A 3H25A 3NGTA 3JSMB 2YKNB 3M8PB 2DPJA 5KFOA 1J27A 1HPZB 3R6GB 4L74A 4ENOA 3TEHB 3GCXP 2KT2A 2G1DA 5AQOA 4NLTA 4KKOA 3TAMA 2XMWA 4LQ3A 5AZJB 4NLSA 4Q8FA 4I6MB 4Y1CA 2H48B 4Q2LA 2VZ9A 4NWBA 3VF2A 1DGKN 3EO3A 1K73O 3R5CA 4KI4A 1VQLN 3SI8A 1NK5A 4HTJA 3KLEB 3BZCA 4IWVA 3TJAA 4AL6A 3M3ZA 1K9MT 4WP3A 1ZETA 2MKJA 1GH8A 1S0NA 4IXCA 2VKZG 1N33K 2OHDA 4W90B 1Y00A 4CHPA 2OFGX 5T7LB 3BO4A 4RR5A 5CAAA 2KU7A 3G8TA 4HACB 1E6VB 2RRNA 1RACB 3OYGA 5HOOA 2CQCA 4FVUA 1RBVA 1OO0B 5DQIA 2KM8C 2VQEK 3BPSP 4CLZA 2FHJA 2ZWHA 1LW2A 1GTHA 4AXIA 1LWFB 3A5LC 4ED6A 2FUG9 4LFCK 2CPFA 3HF5A 3UI3A 3O1BA 2QLBB 4P2MA 2CFXA 3ID6A 3DCAA 1G15A 3BGOP 4IFVA 2NLWA 3OSPA 2E2NA 1YZ6A 3HKZD 4YN3B 2Z56B 3NKYA 2GVDB 3I33A 4EWTA 1HHQA 2XY6A 2X1FA 1HX1A 4E7HA 4X84A 4PG7A 2KKHA 2PYJA 3AJDA 2ZJQL 2F63A 1TYQA 4U67L 3M8QA 3CIMA 2UVVA 3HM8A 3V1OA 2FHKA 3SQ0A 2VJUA 4KPYA 4K5RA 3S41A 1A6LA 1BIUA 4GY2B 2UUTA 4Z4EA 1WF2A 1NOZA 2IJNA 2JZ5A 4CM0A 1PG5B 4ZCMA 1L3UA 2ATCB 5KG7A 4Q5VA 1ZZNA 4A5AA 2OMOA 2D3ZA 1RT5B 4V19J 1R8AA 2NREA 4LR9A 1HKGA 2ZVSA 4KV8A 1U1RA 3OHRA 1FJ7A 3OR2B 2HAFA 3PIPL 1F1BB 3BDPA 1DT9A 4K8ZA 4YNQA 2AU0A 1WEZA 1HHTP 4W5RA 5M1OA 1HI0P 5I9EB 1U2FA 2RQMA 2D0BA 5JMNA 2OAUA 3RMAA 4M7XA 4LT6A 4RUCA 1XMBA 3BGRA 2MEWA 4M5MA 3L2UA 4ZP6A 1UEKA 2MZQA 3CCES 4DCHA 1RBSA 1UA1A 3H2LA 3CCQS 3JQMA 1UJ6A 3KIOA 2W4DA 5IM0B 2UUBK 3QJPA 4LR8A 4AUKA 3GONA 1V5IB 3ASMA 2WW8A 1YT3A 5KRSA 1G99A 2CNOB 1UFLA 1T05A 4IRKA 1C6VA 2JC0A 4JN4A 2Q66A 3G82A 3EWGA 1RDDA 4B3MJ 4V19X 3KK3A 3ETMA 5DM7L 4N8OA 2CJAA 4UQGA 1X9JA 3VF4A 2E1ZA 4JKFA 2XY8A 2I5JB 2A2DA 2H9ZA 4CESA 5A0YA 4QPXA 4B3SK 2NS1B 1JCEA 3ZETA 1X1PA 2NR0A 1YJRA 5IS2A 4URSA 1VC6A 3SV4A 3HPHA 1V4SA 2VYPA 3TOQA 3AV9A 1HBUB 3A8IA 3S01A 2KG0A 4IFEA 2XNRA 4GMJB 2EBGA 4AFFA 1SCJB 4C8KA 3AOCA 1VRQC 4OYZA 4NMXA 3D2WA 4KGXB 1YI2N 4ELTA 4LSLB 4RNMA 3IRXA 2HURA 2UU9J 2LLZA 2J76E 1RHUB 4FWQA 3CUNA 3IDHA 1B0PA 5C2FA 3SAFA 3L3CA 2B8QA 1N5YA 4BR9A 5IT9O 1EWRA 3K59A 2MZRA 3DLEA 1JK9B 2CVIA 3M6UA 2ZE2A 2HFOA 2OPSA 1N54B 4P74A 2YX7A 3W2VA 1CZ9A 2X1BA 2DNYA 5KPZA 4CJ3A 4DV1J 4W92B 5BR8J 4PG5A 3W5XA 1K8KA 3QEIA 2WONA 4RW9B 1M90T 3MCPA 4USIA 2A18A 3I55N 4B3MF 3NAHA 1NM2A 3F44A 2V51B 2A10A 2BDPA 1UJ4A 4JI0K 3NF6A 1CULB 3MR7A 2OEMA 4YQWA 1K9MO 2HIQA 2O1PA 1KHWA 3PRVA 3ITHB 4K8RA 1JLCB 2D9PA 2LCWA 5HROB 3H42A 5AXNA 4HUFA 3V81B 4UTGA 1KVIA 4ICLB 3WDOA 3ZSQA 2DGQA 3H1VX 3N0VA 2YKMA 1IBMK 4OZ0A 2OANA 2DHHA 2IRXA 3BREA 5KT3A 2XYGB 3C6TA 3TAEA 4EYIB 3OR1A 2ERRA 3MPYA 3QEVA 3MM6B 2YNGB 5CABA 3M7VA 2ALYB 2P9SA 5HMYA 4KH4A 2UU9F 2OYQA 2HVDA 4DLEA 2Q97A 4C8ZA 5HLFA 2DB1A 1OYDA 4PY5A 1DRZA 3OVSA 3DRPA 1BC6A 5BR9A 4FLZA 2MLZA 3J7AP 4ZLPA 2WTUA 2NQPA 2P9CA 3UW1A 5AFUH 2FJAB 3BSOA 1GMVA 2V8PA 2UXBJ 3DLRA 5ADZA 3QBWA 4HUEA 4GC7A 4J9LA 2FSKA 1I94J 4PXEA 4JI0J 4O5BA 1S57A 4AHVA 4DV1F 5BR8F 1VHFA 2BMBA 3FBBA 2YNHB 4DV7K 2GJIA 2HLUA 3ILJA 3BBBA 2N3OA 3MN9A 4EZ6A 2IM0A 5LSRA 5L1JA 4LD0A 4O3PA 1RWKB 3A2FA 2D41A 3PO5A 2FVCA 3OYDA 4IRDA 4AQYK 1TU0B 1SH0A 3RAQA 3CJ5A 1X60A 4LF8K 3V9XA 3FBFA 1FWKA 3DC2A 1ZPWX 3MR3A 5ETNA 3R8EA 1RWPB 4O4GB 4X4QA 1NMNA 3OS0A 4FWPA 2ZZMA 2V2KA 2RDIA 3LH2S 2YKAA 3MOZA 1U1QA 3I96A 4WFZA 5EDWA 4DSFA 1EX4A 3BZKA 2WOMA 1HPMA 3B4MA 4JI3J 3VERA 1QE1A 1YITS 4RUAA 4R25A 1PJ5A 4IO9Q 3BBFA 1B92A 2NSBA 1SKUB 4CEBA 2BE9B 2CRLA 4JKGA 3DOKB 4OKEA 2NRXA 4A46A 1KR4A 2G8FA 4X4VA 2CGLA 2C3MA 2VQFJ 3VMFB 4FCYA 3MM7B 1U8WA 3KKRA 1WHWA 2OJ3A 3AA3A 4DV7J 5E7OB 1VOMA 2OPRA 1RHQB 1RAFB 4BR5A 1WWHA 3C6HA 2M2BA 3MUTP 2UXBF 1LXJA 1AW0A 1I5OB 2GV1A 3P45B 4ZCLA 1HWKA 2F4VK 2C2DA 3WQTA 4BC3A 3ISNC 1I94F 2KYXA 5L9NA 4AQYJ 2PN6A 4PKIA 4JI0F 4IG3A 4UUWA 1B3TA 4LF8J 3OT9A 1NK0A 1VSHA 3O4QA 3OLBA 2ZITA 3HHDA 1VHXA 3BBCA 1KP6A 3PNIA 1NZAA 1VQKN 2XMMA 5HP1A 1NMEB 4O3RA 1L5UA 1BUPA 5BXIA 2NCKL 4KHUA 3O8MA 1P1TA 3J81U 5DS7A 1JXBA 4RW4A 2E9RX 1CQNA 4ECWA 2XY7A 4X64K 3U8XA 1ZBHA 3HP9A 4C3MA 1JLGB 2DY4A 5BN8A 4I2QB 4JI3F 4ZLJA 3C16B 3MOJB 3CMES 3V5RA 4JUZA 1APSA 2KDOA 4JD2B 5FLXU 5F1XA 2BX6A 2KJWA 5DO2A 2QTDA 2VWKA 2VASA 3ZSRA 1FF2A 3ET6A 4PWDA 4CVNE 2ZDOA 2F4VJ 4O44A 4KO0B 3CF5Q 3ZT0A 1HQEB 4F0KA 2VQFF 2V63A 2QLFB 5M1PA 1TVRB 5LMNK 4BS2A 1VSIA 1M90O 1FXDA 3T1HK 4CCHA 4JK8A 2N4CA 1HYVA 2XLJA 1YG0A 1GLFO 4DV3J 1HLWA 5KFHA 4PA1A 2ZM6J 3DMJA 2CKWA 4AQYF 5H9FK 1BUXA 3SI6A 2W7AA 2ILYA 3ISND 4N56A 4RZRA 2J6TA 4LF8F 4EHTA 5KFQA 4OYXA 3SCXA 1K8AT 3DLLQ 1S5JA 4A2BA 4QW8A 4LBPA 4ZKAA 2QKBA 4IUFA 2HK2A 2X3DA 2K1RA 1NSAA 4AH9A 3AT1B 1H2TZ 4XIUA 3K5NA 4MO5A 4FLUA 3Q2TC 3KJNB 4LFAK 5B8HA 4DR4J 1EO1A 1SI9A 2E1AA 3MPVA 1KOOA 2DPIA 3WNHA 1UFKA 3ZTPA 3KYLA 2XI3A 4DQPA 1D09B 2YH0A 1FRJA 3MR5A 2YJEA 2YKQA 4B9TA 4CGDA 2Y1RI 4CLYA 4M3ZA 3UCZP 4EIAA 5DDOC 4CJ5A 3VQTA 1RDAA 1S1VA 1LNQA 1FWLA 3K5MA 4Q0BB 1LCUA 4RX6A 2PYLA 3BSAA 1TK8A 5ETTA 3RBDA 1MWZA 3EKSA 5J2QA 4NXNK 4CHQA 3CB4A 4RNHA 3TW0A 4M3WA 2VFVA 5E41A 2F4VF 4KIAA 5H9FJ 3IWLA 2K3IA 3LP1B 2AGOA 1RTDA 1F3VA 4CE9A 3MECB 2JFKA 2E1CA 1LWEA 4NA2A 2P9LB 3UN5A 1M0SA 2ZOFA 4YP3A 2GAHC 4DV3F 3R3TA 2HWHA 1HNIB 2ZM6F 4OJGA 2DFFA 1LW0A 2D74B 1XC9A 3T1YJ 3MDQA 2MMYA 1RHMB 2CPJA 3OSNA 1TK5A 5KAKA 3AVNA 1JJCB 1FW6A 2IVMA 4W5TA 4NLRA 3GYGA 4BRLA 2XGQA 3CDBA 2OPQA 3F2KA 2U1AA 3QT7A 4ILHA 1RU2A 1QSLA 4JI7K 2Y1LB 5HQLA 4DR4F 4G9ZA 1P9YA 4MAKA 1R8CA 3HX9A 1NB2A 3QZ8A 4IQMA 9ATCB 3EVMA 2XLKA 1YKWA 4ER8A 3QFWA 1O51A 5KFEA 1X8DA 3RB3A 3KMSA 2BE7D 2JWNA 3AVGA 2QWOA 3VAFA 1BA1A 1JLQB 1GFWB 3CD6S 3AVHA 3QIDA 2O3DA 3OS2A 5GAGU 1SL2A 5GIPA 2KXHA 1BIZA 3CCZA 2IVOA 5GADP 4FSVA 4PYDA 2RF2B 3TJ8A 3HM9A 4BCAA 1O8BA 4XO0A 3ICLA 2P9NA 1HBOB 4DZ6A 5M2PA 2G13A 5AQJA 5H1SQ 3HVRA 5IT9Y 4B9QA 4OV1A 4NLGA 3DI6A 3WC0A 1UJ5A 4ZCKA 1KQKA 3WEEA 4AE5A 4CLLA 3IMXA 2W4CA 4DN9A 5F0XA 3HBTA 5FROA 5B08A 5BPNA 1S1XB 2XM3A 5AQGA 5AQSA 4Q7AA 3EZ5A 4JI7J 3RAXA 3DLGB 1FKAF 3T1YF 4XDCA 1HWJA 2Q1NA 2NXEA 5I42B 2VG6A 2HMIB 2QGFB 2ZGYA 3D2EB 4BGBA 4HVJA 1HLUA 4R5PB 2QSFA 1H98A 2RS8A 4ZS6A 1KNZA 3GSDA 1S1UB 1VQ8S 4HT7A 3MURP 4QU6A 2ZUAA 2RHSB 1S1TB 1RAGB 3LWMA 1YVFA 1WN7A 1N32J 3HPOA 5T7BA 1ZYQA 2OMLA 2HBZB 2BABA 2DIUA 2CPIA 3N79A 3D0IE 1QTMA 2FJVA 5KG2A 4B3OB 3DXKA 2RD5C 4JV5J 1JL1A 2AA4A 4I7FA 5GMDA 2X7IA 3QETA 4DQSA 3OHBA 4PQAA 2Z2LA 2DNZA 4OYIA 1T03A 4YB6A 2P5OA 2AEJA 3M2UA 2HNYB 2PA8D 1HNZJ 2FBXA 3VQAA 3MR2A 2XO7A 3CPWR 3CULA 5C25B 1KSPA 3G6VA 2GQ2A 1HQUA 3C7NB 3TEGA 4Q43A 3TP2A 3HSCA 2XZWA 3M32A 4R0JA 2F9TA 4USUA 2PD1A 4B3TK 5F0WA 3THYB 3LP2A 1N6QA 4QJVA 1K8AO 5FD1A