5I42A

Structure of hiv-1 reverse transcriptase in complex with a dna aptamer, azttp, and ca(2+) ion
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 141
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i42A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i42A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i42A05
2HMIA 1JLFA 3PZPA 1SV5A 2XWYA 4I2PB 3VQ4A 3OYGA 4IKAA 4CJ4A 4TQRA 3SFGA 4F2RA 2R8GA 1Q9XA 2Y1IA 4DF8A 4IBNA 3OYCA 2YV0X 2Q3SA 2C28A 3S3OA 3AO4A 1RTIB 3RAQA 3MR2A 4DSEA 2KTQA 4F3TA 1JL2A 4DSIA 2RF2A 4I2QB 3OS0A 3PW0A 4B9NA 4K4SA 2QXFA 3SV3A 1VRTB 1BQNA 2OPSA 1XI1A 1J5OA 5KFPA 3HJFA 4ZPBA 4WFXA 3DLRA 2R2SA 4ZHRB 3SUPA 4Q45A 4DF4A 3CDEA 3OYLA 4M94A 2YHBA 3QNOA 4DWIA 3FQLA 1TK5A 4URGA 3DOKA 4CJLA 1T7PA 1D8YA 2FBXA 2FJVA 3CJ0A 1Q8IA 4RW8A 1RILA 4KHQA 3AA5X 1NK5A 1S1WB 4NZ0A 3M9OB 4I7FB 4FK0A 3I8DA 1RTDA 5KFVA 4KFBB 5KFUA 2XY7A 1LW0A 3CJ4A 2IAJA 4DEZA 3LP1A 2BRLA 4FJJA 4OL8A 4DSJA 4KKOB 3KJVB 3T5JA 1VSEA 3PO4A 4CHNA 3PY8A 1TL3A 4OLAA 3OYMA 3BGRA 4RW9B 1T03A 4YR2A 4CERA 4CEFA 1RBUA 3FSIA 5J2NA 2BQRA 4CCHA 3SQ1A 4LD0A 1T3NA 3NMAA 1RT1A 5DG9A 1RYSA 5J2MA 4BACA 1I3AA 4AH9A 5KRTA 4CJFA 1FK9B 3KKSA 4ELTA 3QYYA 2E6MA 3OYNA 4Q8EA 2FBTA 1BQMA 3DI6B 1D9DA 3QINA 2IM1A 3V9ZA 4NLUA 1RDBA 1Q9YA 4RNOA 5T14A 4ECQA 1ZYQA 3RB0A 1RT5A 1S97A 5DQGA 1X9SA 2B6AB 1T05B 1S4FA 1GOCA 3T5HA 1J53A 2HNZB 1EKEA 2JEIA 4KHSA 1IKYB 1RCHA 2I5JA 3TAQA 1L3TA 1X1PA 4N5SA 3NH2A 4R5PA 1RT6B 2FVQA 1LWCA 5JUMA 4M3UA 4KBIA 2FLNA 3PW2A 2XY8A 3S3NA 3S3MA 4OPKA 1REVB 4O44A 4OVLA 2V9WA 5KFLA 3QIPB 1GOAA 3T1AA 3NDKA 1A5WA 4FZXC 1WSHA 3BGRB 4GC6A 1TP7A 4LSNB 2BANB 3AO1A 3LWLA 1S1VA 1BHLA 1IKWA 3DLEB 4EBDA 2E9RX 4KFBA 1TVRB 2XRIA 3FDSA 1YTUA 1WSGA 4FS2A 4ZP7A 4ZVHA 2HNYA 4LQ9A 2BRKA 1VSMA 3DLGB 5KG2A 3CO9A 3MEEB 2XO7A 1RT4B 3Q8PB 4G1QB 2VG5A 1TAUA 4B3OA 4IDKB 4GMJB 4FM1A 3V6DB 4U6PA 4KKOA 1RBSA 3SZ2A 1QE1B 5KG0A 5HRRA 4MK7A 4K8ZA 3NGDA 4NYNA 3EYZA 2JEFA 1IO2A 4CK3A 3K2PA 4FW1A 3LZIA 4ICLA 4MKBA 1S1VB 1FKOB 2W42A 1TV6A 3MR5A 4ED2A 3VQDA 1WNEA 4J9PA 3MECA 4LSLB 4WFZA 3WNEA 3LP3A 4MKAA 2WRMA 1XC9A 3CIZA 4R8UA 5I3UA 2W9BA 2EHGA 2E4LA 3TQ1A 3ZT3A 1ZBFA 1ZTTA 3SUQA 1C0UA 4DG1A 3KMSA 5FRNA 1T03B 2IDOA 4ZP9A 4R0EA 4IDKA 2CJQA 4C8NA 2IM3A 3HVWA 2DPIA 3L8BA 1HNVA 3LP1B 1T94A 3AA3A 2WONA 1NKEA 3T3FA 4KTWA 1HARA 1K6YA 3RWUA 4XPEA 4KTZA 2I1RA 4EZ9A 4ECWA 2F8TA 5J2PB 1F21A 4DTXA 1RT2B 2WTFA 3LP2B 5KT7A 3GIIA 4FLWA 3RRHA 2VWJA 4QW9A 1I6JA 2G8UA 4NLVA 2O4GA 4NLSA 3I5BA 5L1KA 1C1BB 3ZT4A 1TK0A 5DGBA 3V1QA 3CJ2A 4B9MA 2WK4A 5J2NB 4DS5A 4FBTA 4ECVA 4FLVA 2R2UA 1SH2A 3PJWA 4F4XA 4HKQA 3WNGA 3F73A 4W5RA 3ZSZA 1RTHB 4RNFA 3SPYA 4DFMA 4PWDB 1ITGA 4KRFA 4EEYA 3MF5A 3HK2A 4CHPA 1JXBA 1C6VA 5J2PA 5K14A 4GC7A 4PA1A 2DFHA 2IA6A 3SI8A 4ZMMA 1KCFA 1EXQA 4LSLA 3OYKA 4UQGA 3IGVA 4RW4B 3KD1E 4CEEA 3OYAA 4R8UB 1JXLA 4ZHRA 3EZUA 5CYMA 3QETA 4O3OA 5KT3A 4N56A 2RDIA 1S6QA 3L3UA 4BDZA 3LALA 1LWEA 1S6PA 3SQ4A 4KHNA 5SWMA 1SL2A 4ZP8A 2IC3A 2FC0A 3V1OA 3P1GA 4FCYA 1NNDA 3SI6A 4FLTA 1T8EA 4CF1A 1TAQA 5KT4A 3TAMB 3HVTB 2W9CB 4H54A 3CM5A 3BQ1A 3H2LA 3DRPB 2C2DA 3O3FA 4CFBA 1L3UA 1TKXA 2FJWA 1QAJA 4G1QA 4MIBA 4Q44A 1FKPB 3OL7A 1RDAA 4M42A 1JLGB 3ZCMA 1NHVA 4QWCA 2ZE2A 4ID1A 1RTJB 4CEQA 4Z4CA 3V1RA 2NUBA 1YTAA 1S1WA 4ICLB 4M3ZA 1W9HA 2F8EX 1HQEB 3AVGA 5KFGA 1K1QA 1WSIA 3QLHB 4YMEA 3CG7A 4CFAA 5KI6A 3OYIA 1S1XB 4CJQA 1NOZA 4TYAA 3CFRA 2XCAA 3PW4A 1BI4A 4DFKA 5KG3A 2YNGA 2BR0A 2V4QA 1U48A 4CJEA 4NRTA 4CEBA 1S49A 3MAQA 2YNIA 3ISNC 1DLOA 3JSMB 1IH7A 4DQSA 3QIDA 2A1SA 3L2UA 3V6JA 2D0AA 2YNIB 4CEAA 1KLNA 4B8CA 2P5GA 1NHUA 3ZSRA 2FBYA 3VA0A 1WN7A 4ED7A 3TWHA 3GQCA 3JYTB 1KFSA 1RBTA 3HP6A 5I42B 2XGQA 4ECXA 3V6KA 4CGIA 4CF8A 4O3SA 1EX4A 5F8IA 4E7LA 2DFFA 3KK1A 4NLGA 2XI2A 5DLFA 4M3WA 4KI4A 5KFSA 4M41A 2FLLA 4O55A 1XR6A 4NLQA 4CFCA 3QO9B 5KFNA 3K5LA 4M3TA 4B9TA 4DTUA 1W0HA 4F4KA 4IH5A 3NCIA 3VQPA 4E1MA 5EWEA 4LH5A 4NLYA 2ZQBA 4Y3CA 4FJLA 1X9WA 4CGDA 3DYAB 1CLQA 2R8IA 2F96A 3LAKA 1TKXB 4ELVA 4EP5A 3H5UA 2JC0A 2OYQA 1R0AB 2XY6A 2FLPA 4CJVA 4JRPA 4RUAA 1G15A 4ZP6A 1QSSA 1U45A 2XGPA 2OPQB 2HHUA 3TAFA 4K4YA 3ZSXA 3KLFB 2RKIB 4Y2CA 3V9SA 4JUZA 1TGOA 4IR1A 4M3YA 1WSFA 3RB6A 1JLGA 3T5LA 4RW9A 2P1JA 4DU3A 3IRXA 1XR7A 4PUOA 4J9SA 3QEXA 2D3UA 2IAJB 3MEGB 1N5YA 1S9EB 3OHAA 2R8JA 4FJNA 1KLMB 1SH0A 2G8FA 3DM2A 1QQCA 1NJXA 3P5JA 3FRZA 1YVUA 1TL3B 2YKNA 3G6VA 1RTDB 3BQ2A 1KVBA 2D5RA 3C6UB 3H59A 1UA1A 2KZMA 3N6LA 5FDLA 1NJWA 2HB5A 3H5SA 4TSXA 2JEJA 3NH0A 5C24A 3HVRA 5KFMA 5C42B 1SUQA 1BL3A 4KO0A 2LSNA 4E0DA 4FJ9A 5KFYA 1XHXA 1JLAA 1J54A 4DQIA 3HPOA 3NF7A 1HPZB 1RTJA 4WYWA 4HTUA 4BE2A 4HUGA 2R2TA 2D0BA 4Q43A 5FRMA 4IG3A 4URSA 5HP1B 4AHVA 3BSOA 1S9GA 3QGGA 4Z4GA 2UVUA 2UUWA 4K4VA 4DQQA 3VQBA 3QLHA 4ID5B 1XWLA 3DLGA 4KV8A 5HP1A 1KSPA 4CJTA 1RBRA 2QKBA 1TKZB 1RT2A 2YNGB 3RR7A 4WXWA 3NF8A 3AVHA 5KFKA 3QIPA 3I0RA 1EETA 1KVCA 5J1EB 5F8JA 1XHZA 1D5AA 4HHTA 5C25B 1KTQA 3KK2B 2W7OA 1DTQA 3WNHA 2D41A 2ILYA 3LAMA 2AGQA 4FJ5A 3V9UA 3D0PA 1JLAB 4F3OA 1FXXA 1ASWA 4MK9A 1QSYA 1C0UB 4DG1B 2E6LA 3AVIA 4NYZA 4WFYA 2ZD1B 3LWMA 3CVKA 1S9FA 4ZTFA 2WB4A 1IKXB 4DTRA 1UWBB 3K58A 4AHCA 3SQ2A 4KHWA 1RBVA 2OPPA 1B9DA 3QZ8A 1MMLA 3KKRA 2XCPA 1SKRA 3V9WA 4RUCA 3AVFA 2OZSA 1FKPA 4FLXA 1RAJA 3RMDA 5C42A 3BSAA 3OHBA 4RW7B 1CZ9A 3ZSWA 4W5QA 1N5YB 4DQPA 4CJSA 4DTPA 4XIUA 3TAGA 3KLGA 5DMRA 1SL0A 1RTHA 2FVRA 4DMNA 3ASMA 2VG7A 1GX5A 2OH2A 2KFZA 2AJQA 2BE2B 2W9CA 2ETJA 2AQ4A 1BIUA 1BISA 4B9LA 3KTQA 4RW6B 3EPGA 4ED8A 4IG0A 1EP4A 2DPJA 3IGNA 2JEGA 3NF9A 4GW6A 4JV0A 2X78A 4NCGA 5K14B 1ZBHA 2AU0A 3CWJA 2XI3A 4DL4A 4PQUA 2C2RA 1RT3B 1IKVB 5KFBA 1OS5A 1KFDA 3NE6A 3RR8A 3EY1A 5HBMA 4IQXA 4GVMA 3IAYA 3AVCA 3I5AA 3FQKA 4MQ3A 3OJSA 4IOBA 1RA6A 3M9NB 3OJUA 1IKXA 2BQUA 1A5VA 3DLBA 4CJ3A 4OJRA 3RRGA 3VQ5A 4ZVFA 4FLZA 3MECB 4B08A 5KFWA 5F9NA 4DTSA 3D28A 2QE5A 3CDWA 3T19A 1SUQB 4DU1A 2GIRA 3VQ9A 3D45A 5EU7A 4DTMA 4KHRA 3UPFA 4FJ8A 3RBEA 2E9TA 2OPPB 4O3NA 3KLHB 4RW7A 2E9ZA 3KK3A 1NK9A 1RT7B 1C0TB 4QPXA 5C5JA 4DL2A 4DSKA 3V4IB 4J9QA 2B5JB 3NBPB 2YNHA 2ASJA 5KFAA 3IN5A 4X2BA 2HNYB 3UIQA 4WXOA 4OKEA 3M8SA 3HXMA 3G10A 2ZKUA 4DFJA 4IH6A 3KLFA 2KQ2A 4AHSA 2JC1A 3BSNA 1NK6A 2ZD1A 5KFDA 2F8SA 3DOKB 4YR0A 5KTQA 3OL6A 3OY9A 4MK8A 4HYKA 3ZT0A 4CFDA 3ALYA 3IRXB 3TVKA 1S0OA 3VQ8A 3U6FA 3MEGA 2ILZA 4O0JA 3B6PA 4CIEA 3EZ5A 4IRCA 4FJKA 3NF6A 2OPSB 5KFIA 3MEDA 4O4GA 2HMIB 2RN2A 5CYMB 1SH3A 1HJRA 3OYJA 3RTVA 2Z1GA 4CF9A 3C95A 3ITHB 4M45A 2KZZA 1VSLA 1L3SA 1KHWA 3CFPA 1RT4A 4N41A 1NKBA 4BDYA 3GV5B 1SKSA 3HSTB 2VG7B 4QWBA 3V6DA 4AHUA 4LSNA 4FZZA 4IFVA 2IOCA 4FJGA 1W25A 4PQUB 1S48A 3ZT2A 4HVJA 2G8HA 4J2BA 1VRUA 1TVRA 3HKWA 4MFBB 4ECZA 5KT2A 4CIFA 3DYAA 3CDUA 1RDDA 2IS3A 3RMCA 3MXIA 1VRTA 4YQWA 2B6AA 1T05A 4KHYA 1JKHB 2HWIA 2RF2B 1LWFB 4C8LA 4IFYA 3HPGA 2UVWA 2HNDB 3OL8A 1S0NA 5HRSA 3SQ0A 3KLVA 3H5YA 1O1WA 3PX6A 2BANA 3NFAA 2FBVA 1BIZA 1DLOB 5I42A 4W5TA 2ATQA 1NJZA 4HCCA 1RT3A 2BQ3A 4E7HA 2IM2A 3DLKA 5HLFB 1JLCB 2OA8A 1ZBLA 3KK1B 4ZVGA 1HYSB 3AVJA 5KG4A 3KD5E 2Z1JA 5KRSA 2O5DA 4CJ5A 4K4ZA 4Y1CA 1LW0B 1HNIB 4NCAA 4URQU 4B9VA 2JGUA 1HMVA 3KHHA 4BE0A 3NAHA 3LANA 3EPIA 4CJWA 1EETB 3AVBA 2Z1IA 4NCBA 1BQMB 3DI6A 1UAXA 1JLEA 4O4GB 3MEDB 2P51A 4Z4EA 1S1UB 5J2QA 2PY5A 3BDPA 1C0TA 3QO9A 3NAIA 4CE9A 4DL3A 5EUHA 1VSIA 4IG3B 3ZT1A 3NH1A 1NK8A 3HHKA 4IFVB 5KFZA 3HVAA 4FK2A 3MXJA 1LW2B 4ECYA 4J9NA 3ZSOA 4LQ3A 4IRKA 2AX1A 4MFBA 4DLGA 1RT1B 3DRSB 4K4XA 2D0CA 1FKOA 4IKFA 4F8RA 2QV6A 4ED0A 4H4MB 1TKTA 2HHQA 5F8MA 2B5JA 3NBPA 3V9XA 3I0RB 3TARA 3L2VA 4H4MA 4TXSA 1TKTB 4HUFA 4BWJA 2HHVA 2GBZA 3DMJA 5KFQA 1TV6B 1RNHA 3VQ7A 4E7KA 3OYHA 2Y1JA 1QSLA 5KG7A 3AO2A 3OVNA 3CJ3A 4YNQA 4Z4HA 1X9MA 4K8XA 3Q8QB 4M95A 2CKWA 3TAEA 3C6TB 4KTQA 5KFCA 1WSJA 1WAJA 3QGIA 5FDLB 2GC8A 5DG8A 3RAXA 4N76A 4CHOA 4KAZA 3M8PA 1S6QB 4B3OB 4CEZA 3CYMA 4JV1A 4Y2AA 5CYQA 1SV5B 3AV9A 2IM0A 1NK7A 3O4QA 3H98A 1JLEB 3UDLA 2PZSA 4FXDA 3K5NA 4RU9A 1HMVB 1KHVA 3V6HA 3AO5A 3M8RA 1RTIA 5HROB 3F9KA 4ED3A 3RB4A 4ZTJA 5C25A 3UR0A 2EC0A 5C24B 3PV8A 3GV8B 4R5PB 3L2QA 2UUTA 2PYLA 4O3RA 3DLKB 1JLCA 3C6UA 1S5JA 4FYDA 1S1TB 3PW5A 4OGCA 4NLWA 5KG5A 4Q5VA 1I39A 3VQCA 4FJMA 3L2WA 4Q8FA 5EWGA 4IG0B 3QEWA 3CQ8A 3MFIA 4CK2A 1QS4A 3LP0A 3E51A 1U04A 2HVHA 2HNDA 5J2MB 2G8IA 3ISND 4E3SA 3GIMA 5KGWA 3T5KA 3H4BA 3OLAA 1WSEA 3RBDA 4MIAA 4KAIA 1IKYA 4F4WA 4I9LA 1ZBIA 5DG7A 2HNZA 4BE1A 3PW7A 2KW4A 4AILC 3U3GA 1UOCA 1QHTA 3KNAA 5EDWA 3HL8A 1ZTWA 4H4OA 3M8PB 5KGXA 4OPJA 1N6QB 3DMJB 3KJVA 5DGAA 2X6SA 4WYLA 1VSKA 4CJKA 5F8GA 2FVPA 2W9AA 3SFUA 4OLBA 4JV2A 3DDKA 4YP3A 3HYFA 3GYNA 3WNFA 3JYTA 4Y34A 1SL1A 3OYEA 1SKWA 3TI0A 3NKYA 1UA0A 3THVA 4JRQA 3L2RA 4DL6A 3NGYA 4LY7A 4G3IA 4CJPA 3U3YA 4CF2A 3JSMA 4ED1A 4ZVEA 4FS1A 4FK4A 5CZ2A 2J6TA 2VG6A 3CFOA 3KOAA 5KFXA 4NLDA 4DL7A 3VA3A 1YT3A 3OYBA 4RNHA 4NRUA 1CXUA 2HHSA 3SNNA 3G6YA 1REVA 4O44B 5E41A 2YKMB 4J9RA 3L3VA 3FFIB 3GIJA 3QZ7A 4DTJA 4TY8B 5DQIA 1HPZA 3FFIA 3KHGA 3GILA 1N56A 1Z26A 5KG1A 3O3HA 2JLEA 5KT5A 1S0MA 2RPIA 3IG1B 4H8KA 1WAFA 4TN2A 1NOYA 2Z1HA 4FJIA 3AO3A 4DTOA 2VG5B 1C1CA 2PYJA 4FVMA 4IR9A 2OPRB 2QK9A 3BREA 2WOMB 4F50A 4J2AA 2B4JA 1LAVA 4CHQA 4Z4FA 1CXQA 4HUEA 1HYZA 4PUOB 2GIQA 5J2QB 2DFEA 3E01A 4XO0A 3KK2A 1ASVA 2BDPA 4HCBA 3MR6A 4NCGB 1LWEB 1S6PB 5JS2A 4NLPA 1NJYA 4CGHA 4ED6A 4TQSA 1RDRA 3PR4A 4BWMA 2VA2A 4RZRA 4OGEA 1NK4A 1KVAA 4E19A 4KPYA 3QEVA 3TR8A 3HT3A 1B92A 3KIOA 4CK1A 2ASLA 3O4NA 4J2EA 4NLOA 4NLTA 1J9AA 2ASDA 3GV7B 5L9XA 3SCXA 4ZPDA 3KHRA 2FJXA 4QWEA 1QUVA 1KLMA 1HQUB 4O3QA 1DTTA 2YNFB 4QWDA 2XHBA 1Y97A 4RNMA 2C2EA 4Z4IA 1MU2B 3A2FA 4ECRA 1VK0A 5L1IA 1JXEA 3DOLA 3M8QA 4EBCA 1ASUA 3D5MA 4J9MA 1C1BA 5JS1A 2AX0A 4L8RB 3M8QB 4CIGA 2I5JB 4EYIB 3DLHA 4IFYB 4WZQA 2HHXA 5HLFA 3OYDA 3OS1A 3OSPA 4TLRA 1UWBA 1KRPA 5KFEA 3KLEB 4ELUA 3I0SB 3AVLA 4E89A 4PWDA 1S1TA 3NGZA 3VN5A 1JKHA 1Z4UA 4EO8A 3RB3A 4DFPA 4DU4A 5FROA 4ZPCA 3PR5B 2HWHA 3V81B 3PX0A 5DQHA 3AVAA 2YNFA 1DTTB 2IBKA 5KFRA 4CGGA 3ZSVA 2RDJA 1IM4A 2VA3A 5KG6A 4J9OA 4WZMA 1MU2A 4M3XA 4DS4A 4FJHA 4EP4A 3I5CA 1VSDA 4CECA 3PX4A 1D1UA 3KHLA 2IGIA 3QGHA 4KB7A 4C8MA 4CESA 2FVCA 4DTNA 4EYHB 5I3UB 4CJUA 4QW8A 1BI4B 4ECTA 4DQRA 4I2QA 4C8KA 2OPRA 1ZETA 3TABA 2BGGA 4WE1A 4J2DA 3SYZA 3G0ZA 1JLFB 4QCLA 1N48A 5HRNA 2V0NA 4J9KA 3PHEA 2EX3A 4FM0A 3MTKA 1JLBA 2ITGA 3PVXA 4JS4A 4JS5A 3DRPA 3AVKA 4I7FA 2WOMA 5KFFA 1B9FA 2X74A 3SV4A 4MH8A 3NAEA 4QWAA 2R2RA 3OSNA 5KFTA 4PY5A 2HHTA 2BE2A 2J6UA 3QNNA 1RA7A 3LP2A 5DLGA 3K5MA 4RNNA 1N6QA 4M3RA 5JXSA 2DY4A 4O3PA 3H08A 2AGOA 3ICLA 4I2PA 3MFHA 3TAPA 3O3GA 3C94A 1HQEA 4LH4A 2X6NA 3KLIB 3SPZA 4YR3A 1BGXT 1LW2A 4I9QA 2KFNA 3SJJA 4AHTA 2ZE2B 4F2SA 5SZTA 4KB0A 3I0SA 2UVRA 1N4LA 1U47A 4B9SA 2W8KA 3DM2B 4N47A 2YHAA 4KHUA 1IKWB 5KFHA 3N6MA 1U4BA 4QOZB 3Q8RB 4FJ7A 4KB1A 3VQ6A 1S1UA 5HBMB 2HVIA 1BQNB 4CJRA 4OKKA 2ALZA 3SUNA 4H4OB 1C2PA 1LWCB 1QTMA 1TQLA 1TK8A 2C22A 2V4RA 3DLEA 3V4IA 2R7YA 2RKIA 5F8HA 2WHOA 2WCXA 4W5NA 5CY4A 3VQQA 3MR3A 4J9LA 3H5XA 3KLGB 1VSJA 3QEPA 1HYSA 5HRPA 1GX6A 1TL1A 2G8KA 5T7BA 3H40A 1TKDA 3N6NA 1S1XA 3ZSQA 4E1NA 1JL1A 3IS9A 4ID5A 2HW3A 2W8LA 4DSLA 4YFUA 3RMAA 2FVSA 4O4RA 2AGPA 1RT6A 4EO6A 4DL5A 3K5OA 5D3GA 5KT6A 2B43A 4Y1DA 1BCMA 4W5OA 2HHWA 4CGFA 4KREA 3DRRB 4F4ZA 4IRDA 3V81A 4C8OA 2OPQA 4QAGA 4KO0B 1U09A 4TY8A 3RMBA 1HNVB 1LV5A 3OL9A 3UQSA 1K1SA 3KLIA 5HROA 2XY5A 2G8WA 1JIHA 4CEOA 3HO1A 4FZYA 1Z25A 4KE5A 1NK0A 3S9HA 3LDSA 4EZ6A 2UVVA 5EWFA 1JLQA 4EBEA 5CYQB 1LAWA 4AHRA 1JLBB 3CM6A 1LWFA 3HM9A 4K50A 2G8VA 1QE1A 3AA2A 4F4YA 2YNHB 4KSEB 4CF0A 4FBUA 2W9BB 5CZ1A 3OYFA 3PJXA 3KK3B 1C0MA 3KLHA 2A1RA 4KHMA 3AVNA 4WE1B 3VQSA 2J6SA 2D3ZA 4ECSA 3LPUA 4KI6A 1VSFA 3MEEA 2GV9A 3C6TA 2IJFA 1CSJA 1S9GB 3BSCA 4FLYA 3ITHA 1FK9A 5F8LA 3NGIA 1XR5A 3LPTA 4U7CA 3M9MB 2ATLA 4B8AB 1WNSA 4Q0BA 5D3GB 2DTUA 3AVMA 3SUOA 3ZSYA 1DTQB 4NLXA 5L1JA 4CGJA 1U49A 4RW4A 2YKMA 1D0EA 4TY9A 1RT7A 3CJ5A 3IS9B 2YKNB 1IKVA 3K57A 3NHGA 3ULDA 3QERA 1L3VA 4O5BA 3TAMA 3HVTA 1R0AA 4O0IA 1TL1B 3GIKA 3BR9A 3QIOA 2AWZA 4CEDA 2IJNA 4KV8B 2WONB 3IG1A 5F8NA 2VWKA 3DRRA 4K4WA 3HP9A 1HRHA 1D9FA 4OKJA 1VSHA 4RW6A 3G6XA 3BJYA 1QAIA 1EP4B 1S9EA 1L5UA 3OS2A 4RG8A 4NYFA 2VG6B 1GOBA 3QESA 3DOLB 3NL0A 3LZJA 1RDCA 4JLHA 2P5OA 4K4TA 2OZMA 3LP0B 1RYRA 1RT5B 4NLRA 1JLQB 1C1AA 1VRUB 4CHYA 4FJXA 4DSFA 5KFJA 4K4UA 3K59A 1HNIA 5L1LA 5DK5A 3B6OA 2IC3B 3TANA 1J5OB 5KFOA 4FM2A 1ZBUA 3HPHA 3P83D 4ZPAA 3MXMA 3QEIA 4ECUA 3PUFA 4E7JA 2HAIA 1YVFA 2IMWP 4XPCA 3KLEA 3G86A 4Z0UA 1NKCA 1TKZA 4FLUA 4BDPA 3AA4A 4FW2A 4RW8B 1HYVA 3OLBA 1WLJA 1IG9A 3E01B 2QKKA 1A5XA 2R8KA 4IH7A 4TYBA 3Q8SB 2D7SA 4E7IA 3H4DA 3BQ0A 1JX4A 3KMQA 1S10A 3DRSA 2R8HA 2W7PA 2GUIA 3VQEA 2XC9A 1BCOA 4Q0BB 1C1CB 5J1EA 1HQUA 4CHZA 4DLEA 3PO5A 5F9LA 2O4IA 4B9UA 3VQAA 1CZBA
chains in the Genus database with same CATH superfamily
4EFAC 1HWIA 2KYZA 1PC4A 3PZPA 2DK2A 2LQBA 1SV5A 2R7OA 2ZH8A 3RSEA 3SFGA 4F2RA 2Q6CA 2R8GA 4AM6A 4DF8A 3GONA 3ZTOA 2FSJA 5ETLA 3S3OA 1DKGD 4FO0A 1RTIB 1P90A 2KTQA 4F3TA 1MWYA 1RUSA 4Q2MA 4DR4F 4I2QB 4JI6K 4FWPA 1R8CA 2QXFA 3SV3A 3D0HE 1VRTB 2J4RA 3W7BA 1WI6A 1SS6A 3LO3A 1TFWA 2DGQA 3PHTA 3HJFA 4RWWA 5IOLA 4WK1A 3RYLA 2R2SA 3SUPA 2RQMA 3CDEA 5C2GA 2F65A 3DN9A 3DOKA 2LVWA 1T7PA 2Y8YA 3MUVP 3CJ0A 1RILA 3BO4A 4KHQA 3J7AP 3V5RA 1IJEB 2NRZA 4OYBA 2VQFJ 4GKKF 4ANDA 3I8DA 4ZVTB 1VLYA 2H5EA 2VDIA 4DX8H 3CJKA 3X3UA 2HF4A 1LW0A 3CJ4A 4OHWA 1IQZA 1U8SA 1NPPA 2BRLA 4ZOSA 3AD7C 4KKOB 4RWTA 3O80A 5DDQC 3SCIE 2KI2A 4CHNA 1EKSA 1NLKL 4OLAA 3OYMA 5IWAF 4DB3A 4GO5X 2PGCA 4CERA 1WHWA 4JD2B 2WVFA 3J7A1 3D2EB 1RBUA 1ICEB 1ACMB 3NP5A 3IP0A 2AZ3A 3HHLB 2QWOA 5C2FA 4LD0A 4BGBA 3W63A 3WT0A 1N5VA 3MM6A 1N36J 5KRTA 2OD4A 5AQRA 5GIOA 4PXCA 1E6YB 3HX9A 2NPFA 4CLFA 2EFGA 1D9DA 5GADP 2VPWB 2ZNYA 4M5JA 1RDBA 1Q9YA 3RB0A 1CJUA 1T05B 1RHJB 3R9LA 1GOCA 1J53A 1EKEA 2IY5B 2JEIA 1IKYB 1XNRK 5GINA 1X1PA 1RT6B 1LWCA 3G6EN 1T44A 2FLNA 2XY8A 3S3NA 3T1HF 3S3MA 4OPKA 5KQDA 4CM0A 3SLCA 3HHLC 4O44A 4OVLA 4JOUA 3ZTSA 4WWSA 4FZXC 5B0BA 4DV4K 3ILJA 2HBYB 4A5AA 4WFNL 2J7KA 3LWLA 4CH7A 3QWUA 4NMXA 4EBDA 2MZQA 1TVRB 5M1FA 2OUGA 2LLZA 2XRIA 3FDSA 1YTUA 2H54B 2LKZA 5GAEP 2D1CA 4ZP7A 4OJGA 3U1NA 4WF9L 2PAVA 4JD2A 2ZH7A 5ETRA 2HBRB 4ZLPA 2LDYA 1CS4B 4W4MA 3OUYB 3D6TB 2CQ3A 5THWA 4GMJB 4YN3B 4U6PA 3P49B 1M90O 3W2VA 3SZ2A 1YWXA 3RVCA 4K8ZA 2Z0GA 2ROGA 3EYZA 3DRYA 4UUWA 2KO1A 2JHEA 3O44A 4FW1A 4DR4K 4JI8F 4ICLA 4MKBA 1S22A 4ITSA 2W42A 1X4GA 4LR7A 2E2QA 4J9PA 3SXLA 3GYXB 4A8SA 2CQ2A 4R8UA 5I3UA 4I1TA 4USJC 3THPA 3OTDA 2GJ2A 4CZFA 3M8WA 3SUQA 4C1NI 1C0UA 4Y6IA 1T03B 2IDOA 5JVGL 4ZP9A 1BUPA 2N4CA 4XEIA 1YJ9N 1T9UA 1JNRB 2Z57B 3J7YP 2IM3A 3L8BA 3CGIA 5E5NA 3LP1B 1B7YB 2F8MA 1T94A 2NXUA 1G99A 3AA3A 2ZEJA 3T3FA 2VFTA 1K6YA 4XPEA 2I1RA 2WSFC 2W4CA 1RT2B 1NU0A 2WTFA 3QSYB 2V5HG 1CJUB 3RRHA 3C66A 3QMQA 2BA9A 1YJWN 3BF1A 1H7WA 1C1BB 2KJWA 1AROP 1PJ5A 2RH3A 4DS5A 2Q0UA 1SKUB 2LXIA 4X64F 4FLVA 3TPQA 2R2UA 1SH2A 4F4XA 3ZZZA 4K41A 4M63A 1RTHB 4DFMA 4MMOA 2DR8A 4NA3A 1BMQB 4CHPA 1JXBA 1U6ZA 5DM6Q 5A8KA 1VQNN 1IBLJ 5K14A 3MD3A 4GC7A 1HR0J 1SIZA 2DFHA 1EXQA 4P2FA 4I6YA 4DV3F 2ZJRQ 4CEEA 4JYAK 1JXLA 3EZUA 3QFPA 3TUJC 5KT3A 3HT0A 2YH0A 3L3UA 1HW9A 5DM6L 4ZP8A 4BRLA 2HLTA 1OY6A 1NNDA 2R9LA 3EDQB 4OHYA 2ACYA 4OZNA 3TAMB 5AZIB 4WFNQ 3BQ1A 1KQSR 3DRPB 5IM0A 2C2DA 2B9YA 4AL6A 3Q0AA 4CNYA 2FHMA 2DO4A 3CCMN 4G1QA 5AQZA 3PIPQ 4Q44A 1FKPB 3FC9A 4QWCA 2ZE2A 4UOGA 4CEQA 2BJ3A 3H0PA 2HK2A 2F8EX 5KFGA 1K1QA 3QLHB 4DR6F 1C0GA 4DR3K 6AT1B 5CZVA 2GMHA 4TYAA 4YY3K 4DFKA 1LCUA 5KG3A 4A8XA 2KU7A 2V4QA 1NRKA 4CJEA 4NRTA 3RU0A 3SBGA 3TA1A 4CEBA 1DLOA 3Q8VA 2HZAA 4P71A 3CC2S 3L2UA 2EFQA 2P9KB 2M8HA 4X4QA 4N8NA 4G9ZA 4B8CA 2P5GA 4GKJK 1MLAA 2OANA 5CXTA 3IM8A 3GQCA 3TWHA 3DFEA 1RBTA 4BRAA 1UVKA 4USKA 3I4PA 5F8IA 1MG7A 4EWTA 4LF8K 4NLGA 4EU0A 3Q8YA 3EEQA 1HJOA 5M1KA 4M41A 1XR6A 5E7OB 4CFCA 2M3DA 5KFNA 3K5LA 3D6HB 4JI2K 3SCLE 3J7YU 3FLCO 2CQHA 3A5NC 1AFJA 4B3TJ 4CGDA 3CCSS 2F96A 4OX6A 2MSTA 3KWMA 1JXVA 1YIJN 2OGUA 1RBOB 3AY0A 4GKJJ 2L9WA 5HMWA 2R7VA 4NYOA 5A2QY 1G15A 3HLUA 5GAEI 3CCMS 4L6V3 2OPQB 5LT5A 4WU3A 2HHUA 3TAFA 4K4YA 3KLFB 4Y2CA 3NWRA 4USIA 1EWRA 1JLGA 1YITN 3NY0A 5IT9O 2V69A 5AZJA 5AQWA 1D3WA 1U8WA 4J9SA 3QEXA 2PA8D 1YZ6A 5F3TA 1KLMB 1MROA 3RW6A 3I9V9 1NGDA 3JXUA 3IBFB 4K8RA 1TL3B 4DCHA 1RTDB 3BQ2A 3O9SA 2J7UA 3C6UB 1CJVB 3H59A 5BRHA 3U1LA 2RHSB 2OD6A 5AQJA 2XS2A 1Q5VA 2DNYA 4TSXA 1BA1A 3ZZYA 2J0SD 4MT1A 5D77A 5KFYA 3CCUS 4J8FA 1J54A 3MURP 4X65K 2WSEC 4DQIA 3TRGA 3HPOA 4WIIA 1GK8A 2UUCK 4K5SA 3F9MA 2Z30B 1KDNA 4HUGA 2QWNA 2R2TA 4Q43A 1X4DA 3C19A 3R2CJ 5DO2A 4KV8A 1KSPA 3IR7B 2YNGB 2K1RB 4DV3J 5GAHP 4A8MP 5KFKA 3QIPA 3VEYA 2LA6A 4DV5J 3IBWA 1HR0F 1A6LA 1U2RA 1BUXA 1KTQA 1OYEA 2QMXA 3WNHA 3C15A 2D41A 1PYOB 3KDOA 3RBXA 3NS5A 1HHSA 4MK9A 4HTIA 1C0UB 2E6LA 3AVIA 3BR8A 3PSFA 1X5OA 1FRJA 2UYTA 4I64A 3V2UC 3LWMA 4BR2A 1UWBB 3SQ2A 3WXJA 3FNNA 4JKEA 3KKRA 2X1GA 2QLBB 1FKPA 1RAJA 3D1OA 4JK9A 3DXKA 3BSAA 5DM7L 1WHYA 1U6BA 4DQPA 1PKUA 4DPTA 1MMDA 3QFWA 3OR2B 2ZNZA 2K06A 4TNOA 3GTYX 2VG7A 3IMQJ 2PO4A 5BJRA 1REGX 1RHQB 3AGKA 3ZXWA 1VHFA 4XDDA 3M1VB 1O51A 1EP4A 4AUKA 3ZX2A 2H3EB 1ROFA 2DNGA 3OTOJ 2JEGA 2OFGX 1WUAA 1AA1B 2HQFA 2PMHA 4C8ZA 4NCGA 5K14B 3Q22A 4DV0K 4L76A 4WTOB 2ZOMA 4DL4A 4DR5K 3M4XA 4ZCIA 4WP8A 3RR8A 3EY1A 1K8AO 1TL5A 2QW9A 4GVMA 3ILLA 3I5AA 4MQ3A 3OJSA 3D66A 5EGYA 1RISA 1IKXA 4BQZA 2BQUA 1FXDA 3DLBA 4CJ3A 2VF3A 3D67A 3UCZP 2XMTA 1WUUA 3MECB 2MY7A 5F9NA 4DR7J 2QE5A 4CZMA 4J5OA 5ITHA 1R7IA 2VOPA 1U2CA 4DHVA 2V7YA 3CQXA 2LQ5A 4DTMA 4CO5A 2LCWA 3GJQB 1B3TA 2SXLA 5LXYA 3AH6A 2LA4A 4B3TF 2BJDA 5AXKA 2AYGA 2YWFA 4LF6K 4YUDA 3PEJA 4J9QA 3P3DA 4C0HA 3UB5A 3ZTRA 4JB8B 4X2BA 2MDAA 4CZLA 2CPJA 3UIQA 2EG2A 2V94A 1EB0A 2ZUAA 3HXMA 3CC4S 3G10A 2DRAA 3KLFA 5B0EA 4BRQA 4BRGA 2XG8A 3FBEA 1B7FA 3DOKB 1FTCA 2QTDA 4MK8A 1H7XA 2J7WA 1HHTP 4CFDA 1K73O 2CADA 5C12A 2AD9A 3GOIA 3FBCA 1S0OA 2XEXA 4P75A 3U6FA 1J6ZA 3THXA 2XYHB 5HK4A 4JKGB 2ILZA 1IM6A 5FLXO 3EZ5A 2W6KA 3B6PA 3ZO7A 3NF6A 2VFRA 3D6FB 4BG8A 4H0OA 2HMIB 4TU7A 4PCQA 1HJRA 3G6ES 3GJTB 4CF9A 3VENA 1VGYA 2P9UB 3O5BA 1KHWA 4I6AA 3CFPA 3A8KA 1WKKA 1XNRJ 4DR6J 1CULA 1SKSA 1NNEA 2VG7B 2I9SA 1YRTA 1DT9A 5B7WA 4FJGA 2I8EA 2CGJA 1TUWA 3CPWR 5LMNJ 4UOFA 4HVJA 2G8HA 5HATA 1TVRA 2XLKA 3HKWA 3EX7B 1GTEA 1BWVA 3MXIA 4YQWA 4BRMA 4X66F 1E6YA 1L3KA 2BUNA 4WFBL 8AT1B 1TYQB 3MAAA 4OFZA 3KLVA 2RHQB 2V68A 3GYGA 3RJMB 1U1LA 5KAKA 3BZCA 2BANA 3NFAA 4DV3K 2NLXA 5I42A 5CCMA 2DKOB 2ATQA 4HCCA 2KN4A 2P9LA 4E7HA 2OHDA 2AKWB 1YITS 1NDLA 3D68A 4MDBA 1NXIA 3WUHA 2WBNA 3A5MC 4LF7K 5KG4A 5AQTA 2GHWA 3OVSA 3J7AN 1HNIB 1U02A 4GNIA 1HMVA 3OTCA 4BE0A 3PRDA 3NVKA 3CD6N 1VQ9N 4QIEA 4O4GB 2P51A 3ZNUA 2W2OP 2PY5A 2GWKA 1N32K 3W9JA 1F5AA 1BD6A 3ZT1A 3HHKA 1WOPA 2G0CA 3MXJA 4YB6A 1ZXOA 4ECYA 4NASA 4LQ3A 4ATNA 2AX1A 1HD1A 3D3CJ 5C2DA 2YX7A 3FGVA 1CG2A 3HBTA 2PE8A 1JMTA 2RAQA 3EE9A 3QQCD 4WIQA 2MKYA 2POKA 1FESA 1UVLA 1UW4A 2RSQA 2L41A 3V9XA 1AT1B 4TXSA 4HUFA 3JAMY 3BBBA 2ZKTA 3CMAS 2DGXA 1H1VA 4A47A 2GBZA 3FZHA 1FW6A 3ILOA 4YHHJ 2OSRA 3HHNB 3H46O 3OVNA 2Q31A 3CJ3A 1DY3A 2JRSA 3BF4A 3CQYA 3OFFA 3T6BA 2CKWA 8ATCB 1TL7B 1S77D 4PR6A 5DG8A 2PMZD 1HI8A 1U1NA 1CS4A 3K0JA 4CZGA 3DLJA 4CW7B 2BJEA 2LP4A 3CYMA 4L3QA 4JV1A 4Y2AA 1NSKL 3DU5A 1MNEA 2VHGA 5KPTA 3R5BA 2XBPA 3O4QA 3H98A 1N34J 2VODA 2R7WA 3AOAA 5HVHA 3R5DA 4Y2MA 1YJUA 2GWJA 4A2AA 3OBWA 1HMVB 3SDEA 4ZTJA 1X7VA 3THWB 1SC4B 1WELA 2CVEA 5LOQA 4R5PB 3L2QA 2PYLA 4H0XB 1P27B 1S1TB 2BV3A 3AXKA 4DV2F 3VQCA 1MWZA 3EVOA 3M1VA 3R6GB 1QS4A 1VQMN 4M7YA 2G8IA 4FYXB 1JQGA 3QNWB 2DGWA 1R0BG 3T5KA 2Y0SD 1WG1A 2HFZA 4F4WA 4P52A 3BV8A 1GLAG 5EDWA 1ZTWA 4H4OA 4OPJA 3KJVA 1FF2A 4XH4A 4CO2A 4K25A 4L3KA 3VGVA 4ZVSB 1KEKA 4XH1A 4WJBA 3WNFA 4Y34A 2RT3A 2M4MA 4KR0B 3OYEA 2EFOA 3OXGA 2Q79A 4KH4A 3NGKA 4LY7A 1P1TA 2MZJA 4ED1A 2CQ1A 4ZVEA 4CYUB 3CCLS 2XSJB 2VL1A 5CZ2A 2J6TA 2J9DE 3CFOA 3IWLA 5K9FA 3NVMA 2DCUB 4NRUA 5U47A 2HHSA 1MDUB 2YWWA 5E41A 1OQ6A 2QFJA 4NXMK 1GTHA 3GIJA 1RZMA 1BE4A 2YHWA 4HHJA 3UNYA 4B3SF 4ID8A 3PKMA 2RQKA 5C10A 4H8KA 1WAFA 2UU9J 1C1CA 4IR9A 1NMNA 2OPRB 5A76A 3TTDA 5IS2A 3EICA 2MKKA 4Z4FA 1CXQA 3JAMU 2ZWOA 2BEFA 1FI4A 2KKHA 2DFEA 3E8OA 4HCBA 3MR6A 3W64A 2ZGYA 1LWEB 4V19S 3HF5A 4NLPA 3ZNJ1 1NJYA 4TQSA 3SMPA 2YY3A 4BWMA 5AQQA 4IZ9A 2VA2A 4RZRA 1NK4A 4OGEA 4IO9L 4H03B 3QEVA 1GMVA 3HT3A 5AQMA 1B92A 2QA2A 3KIOA 4CK1A 4J2EA 4NLOA 1J9AA 2ASDA 4ZIWA 1YTYA 3HFZB 5L9XA 3SCXA 4H5NA 4Z7YA 3KHRA 2P8IA 1QUVA 2H51B 4KGKA 5FJ4A 4DPOA 2YNFB 4RX6A 2E1ZA 4ECRA 3MDFA 5L1IA 4GKKJ 1JXEA 1Q8BA 4DV0F 3D2EA 4NZ6A 3M8QA 5IZHA 4JKFA 4EBCA 3D5MA 3EJMA 2OELA 1Q1KA 2AX0A 2GX9A 2I5JB 3R7NB 4AM7A 3Q24A 1LKZA 3OS1A 4TLRA 5AQIA 2PMWA 1KRPA 3CJKB 3CIMA 1VBKA 3ZYYX 2AW0A 1PO6A 5BPNA 4EO8A 4DFPA 3SQGA 3MWTA 5FROA 2QZ8A 1B70B 3R3TA 4IDHA 4JEPA 4CGGA 2UUBF 2KXFA 3ZSVA 4CIOA 2RDJA 3FSXA 4M3XA 1MU2A 2ZM6K 2YX1A 5IC6B 1S72S 1VSDA 3QBWA 2MKIA 5AQHA 1D1UA 4FN5A 2VQFK 4CESA 4CZKA 2G2OA 4JNEA 4DTNA 4XTTA 3FUYA 4DPXA 1BI4B 1YGYA 4ECTA 4I2QA 3I4HX 3RW7A 3OTOK 1ZETA 1QTNB 2GVZB 3G0ZA 2ZVIA 3CMEN 2EX3A 4CQ1A 4DX5A 2NRHA 1JLBA 4NZ7A 2ITGA 5BXIA 3PYFA 1I3OB 2V67A 2XMMA 3VMFB 2HVDA 3OR1A 1B9FA 3FMBA 3G25A 4MH8A 3MTJA 4NI2B 4F4AA 2XS7A 4DN9A 2VQFF 4I6MA 3NNAA 4QU6A 2BOAA 4TU8A 1G2EA 1AW0A 1JCGA 3QT5A 4LH4A 1RWOB 4L72B 4KC5A 3KLIB 3MMAA 3SPZA 4B1VA 3T6JA 2Z56B 1Y4ZB 4ED4A 2NRWA 1OIAA 4IWVA 4DV6J 2KFNA 3AQOA 4AHTA 4NXNF 2CWKA 3NMUA 1ATSA 2YHAA 4H0VB 4IQMA 4AQYF 3OD2A 1UEUA 4F0HA 2MXYA 3VQ6A 1S1UA 5HBMB 3SUNA 1BU6O 1WF2A 4P7TA 1C2PA 3NRBA 4WKRA 3CE8A 3KNGA 4YY3F 1C4AA 1TK8A 2QRRA 2AZ1A 4HH1A 4BRNA 2RKIA 1JNZB 5F8HA 3G71N 3IXQA 3OR2A 3E2EA 3MR3A 1Q8KA 2PFUA 1U1RA 2G8KA 1KD1T 1UPPA 3H40A 1TKDA 2LQJA 2G4BA 4E1NA 4OYPA 2B0GA 3ELHA 2GNKA 5BRDA 3LTOA 3D3BJ 1RT6A 4DL5A 1WC0A 5KT6A 2CZ4A 4LRBA 1FDBA 3WXMB 4IRDA 3V81A 2DHAA 4KO0B 2QGFB 3RMBA 3OL9A 1UW9A 1Y7PA 2OEKA 3EVMA 3BGFA 4ZLLA 2HQ3A 4DUYF 1S72N 3GWCA 2VICA 1HW8A 1MA9B 1RAHB 1CULB 3OXLA 1NDKA 3SSQA 1LAWA 3SMZA 1BA0A 2YPZA 2P9NB 1JLBB 2NYIA 4K50A 4ZVQB 2HAFA 3D6RA 4KSEB 3OR1B 4FBUA 4OV1A 4BC7A 5SUHA 4XAKA 5CZ1A 1UJ6A 3EWGA 1HNXF 3PJXA 3M6UA 2UUAK 4B1WB 3N28A 2BE7D 4KHMA 3CJ1A 2FZKB 2X51A 4CP5A 2WAQD 3CCZA 4WE1B 3C6AA 3VQSA 1Y5IB 3LPUA 1YJRA 3C7NB 2PC6A 3MCNA 1BWFO 2IJFA 2LXFA 4CZJA 2RIJA 3BSCA 5T7LA 7FDRA 4U7CA 1HLWA 2D3O1 3VGUA 4B8AB 3MWBA 1CVJA 1WNSA 4W98A 2DTUA 3AA8A 3BZKA 1S7HA 2HURA 5LMNK 2HQGA 3BUZB 2FHJA 4CGJA 2K3KA 3LPEA 2YQ1A 3TYTA 4WP9A 4M5DA 1NB7A 5D4PA 3M1FA 1IJFB 2I6WA 4B1ZA 4DI6A 2VIHA 4O5BA 3TAMA 1EIYB 1GLFO 2QMUB 5ETQA 3I32A 3GIKA 1E4FT 5B0DA 2AWZA 2Y1RI 5DJBA 1V9OA 4RKUC 1D9FA 4OKJA 3NNCA 3T41A 3G6XA 2EC2A 3BJYA 2BVZA 2Q43A 2FY8A 4KGXB 1YX2A 4G6VB 1GOBA 3QESA 1RACB 3LZJA 3KUHA 1RDCA 3R1XA 2L48A 4BR0A 3NCRA 2BOPA 1KAZA 3MCPA 2ASMA 4DV1K 4FJXA 1NGHA 5KFJA 1OH5A 4K4UA 1XQSC 3K59A 3I31A 4DHYA 3TANA 4DR5J 5KFOA 3Q7BA 3P83D 4HACB 1VQPN 1RTZA 2ZZNA 2ZGZA 3GB0A 4LF5F 2YXLA 4QR0A 2HAIA 2Q36A 2OAUA 1YVFA 3A3PB 4XPCA 1Q7YT 4LF8J 4BDPA 3AA4A 4DCJB 1B4SA 4ES2A 3HI9A 1IR2A 2ATCB 4IEIA 5ADXA 4IH7A 2D7SA 4E7IA 2COLA 4A61A 1JX4A 3G8SA 3CIPA 2YKPA 3WIVA 4FYYB 2W7PA 5HAOA 1LXJA 2MZ1A 4DXLA 4ZPWR 1HBUB 3A8YA 2VC1A 1WTBA 1YI2S 2R4FA 1U24A 3VAKA 3MX5A 5AJ3J 4ZLNA 3OYGA 2XTJP 4TQRA 1D8ZA 3R6MA 2O8BB 3ZETB 1QVGM 1YBUA 2Y1IA 2G2YA 2XNQA 3TQEA 1YDLA 4LF1A 4IBNA 2DNKA 4E2FB 1XUPO 3IR6B 2HQCA 2OLWA 3FRYA 1WEZA 4DSIA 2RF2A 3WC2A 3RG6A 3OS0A 3R5GA 4K4SA 4USUA 2GCFA 4L74A 1Y11A 1S6UA 2OPSA 1N88A 2DT9A 3D0IE 4DL0C 3AQPA 5KFPA 3CI5A 4ZPBA 4ZVPB 4WFXA 4U7UD 4IOAL 3KFWX 1VQ6S 4Q45A 4HT5A 4DF4A 3AJDA 2YHBA 5KPRA 4DWIA 3FQLA 3N5FA 4URGA 1HBNA 4CJLA 2UXDK 1D8YA 5CQGA 3S01A 5HO4A 4RW8A 3AA5X 1NK5A 2XMWA 1S1WB 3MM5A 4ENOA 3D6MB 3M9OB 1FWLA 4P2MA 3M3ZA 4FK0A 1AYEA 1RTDA 2X3GA 4ZVOB 5KFVA 4W92B 1HKBA 2GTDA 4KFBB 4AD6A 5KFUA 4DEZA 1UTAA 4OL8A 3ET6B 3KJVB 2F9DA 3PO4A 1VSEA 4IOCQ 3BGRA 2Q0RA 1JCEA 4YR2A 3IRWP 3O3LA 2N7YA 1VBYA 2OTJN 2F63A 4U67Q 4F3MA 1HNXK 3FSIA 4R25A 5J2NA 4CT8A 4CCHA 5BPMA 4U7BA 1BXNA 1MWMA 3DKDA 1RT1A 1KC8T 3J80U 1I3AA 4AH9A 2RUSA 4LIWA 4UOHA 3T1YK 3KKSA 2DR7A 1KS2A 5D15A 2FBTA 2E66A 4BCAA 1GLLO 1IBKK 2XZTB 5MLCV 4A8FA 2IM1A 2VASA 4NLUA 4RNOA 1ZYQA 1T3VA 2DGOA 1J5EF 4ZVRB 1U1OA 1WEXA 2FZCB 1S97A 3RUBL 4NB4A 4P72A 1X9SA 4ZPVR 5CCLA 5IV3A 2Q1LA 3T5HA 2C2NA 4KHSA 1LK7A 3TAQA 3PTWA 1PJ6A 4N5SA 1C4CA 4R5PA 2N82B 4JI4K 4QYZK 4M3UA 5ETVA 4DV4J 1UPMB 3BGLA 1REVB 2C1EB 5KFLA 2D69A 5EX3A 2ZHAA 3DGPA 3NDKA 4LBHA 4LFCF 5DS7A 2K2PA 1FCAA 3I9ZA 1SXLA 2HFNA 1RAGB 2E1MC 2DGSA 1S1VA 4O8KA 4FF2A 4YB1P 1WOQA 4KFBA 1SIWB 2IVFB 2J0WA 2IBOA 1Q81T 2HIYA 2CQPA 1UEKA 4JI7K 4ZVHA 2HWTA 5KG2A 4OZ0A 3PEHA 3TTCA 2E2PA 3Q8PB 1TAUA 4B3OA 3TUIC 2DHGA 3V6DB 1C0FA 1YLXA 4KKOA 1KAXA 1Y5LB 4YOWA 4FWMA 1TUVA 4DV7K 2DNZA 5AQFA 4FVUA 4ZPTR 1IO2A 1X5SA 2APOA 3DCAA 2QSWA 3C15B 4GVBB 5JVGQ 1YUWA 4CLUA 1WB9A 4Z7CA 1TV6A 3BKFA 3BPSP 1HL6A 3VQDA 3MECA 4MKAA 1XC9A 2B4UA 2CGLA 4K0KK 2W9BA 3KVGA 2EHGA 1HNWK 1ZTTA 3OT9A 5FRNA 1JK9B 1HKGA 4IDKA 2VFVA 2ZC4A 2CJQA 2RRBA 3AJ1A 5IWAJ 2R7TA 2RD5C 4OHZA 3CCJN 3ENBA 3MEKA 1XMQK 1BC6A 3ZTPA 4F0KA 4KTWA 3BGOP 2P9GA 3RWUA 1FVSA 4KTZA 3I82A 3PYEA 4ECWA 1NJIT 1VAZA 2O8DB 1F21A 3BPDA 2EFPA 1R59O 2M2BA 3GE9A 3GIIA 4FLWA 4FF1A 4PAAA 1LQ9A 1VR6A 4RBUA 4QW9A 1I6JA 3D2FB 2G8UA 3TR5A 3DXMB 1GAOA 5L1KA 3W3SA 1RXOB 1K44A 5LMUK 4PL7A 4I56A 5DGBA 3W9IA 4LF8F 4B9MA 2P9IB 4FBTA 4ECVA 2ZDOA 4KH0B 4HKQA 1UJ5A 4W5RA 4RNFA 2RUGA 4JI3K 4EI2A 1ITGA 1B0TA 2E1PA 4MO5A 1C6VA 5J2PA 4BC5A 2HVEA 4PA1A 4AXIA 1TUYA 3WX8A 2KYXA 1KCFA 5D0GA 4BRIA 1MMNA 2IIRA 3OYKA 2H5IB 3IGVA 3D1QA 4R8UB 1WBDA 3PYGA 4O3OA 5E84A 1ZZNA 4N56A 1U1PA 1SQKA 3OV7A 3LALA 5C0YA 1S6PA 3C16B 4KHNA 2CA9A 5B0AA 2IC3A 1W2IA 1Y3JA 3EE8A 4FCYA 3SI6A 2HYIB 1T8EA 3B4DA 4F9OA 4CF1A 3C3LA 5IQ6A 1FJGF 3CM5A 1K9MO 1GH8A 3O3FA 4LUBA 2ZJQL 3QT7A 1L3UA 3NGTA 1U2VA 1Q4RA 1TKXA 2FJWA 4X62K 3D0GE 3MPWA 3H42A 3PYDA 1RDAA 2V2QA 4DQ8A 4OZ3A 1VQ6N 3BZQA 4BG9A 3VZIA 4NL5A 3ZZPA 1NHVA 1RTJB 1RK8A 3MM8A 3CCJS 2UP1A 1YTAA 4ICLB 3PSIA 1HQEB 3AVGA 4YMEA 5KI6A 3OYIA 3BF3A 3CFRA 1M5VC 4RJVA 1BI4A 2BR0A 1U48A 3W60A 4KHPF 1ZS6A 2EEYA 1S49A 3ISNC 3JSMB 4L73A 2KM8B 4DQSA 3N9UC 3QIDA 4BVOA 2D0AA 4CEAA 4LVNP 4C23A 2M52A 3TW0A 2CPZA 2FBYA 2H5JB 4ED7A 3JYTB 5A8RA 4GO7X 1MN9A 2XGQA 3V6KA 4CJ7A 1EX4A 1MWKA 4M5HA 4CO0A 4E7LA 4YB5A 4I6MB 1S99A 3KK1A 2XI2A 1EQYA 4JI3J 4JI2J 4KI4A 2UUCF 2PI4A 1ZPVA 2D3OR 4X66J 1Q78A 3CC7S 3NOGA 2DNQA 2QJ3A 3R7SB 2E2NA 2FZGB 3WDOA 5A8KB 4C3KA 2YWKA 4DTUA 3A1YG 1W0HA 3NCIA 5IWAK 1WWHA 5AQXA 4JHDB 2BM0A 4FJLA 1X9WA 1FE4A 3CNQP 4Z94A 1CLQA 4J90A 1WC5A 3NEKA 1WC6A 1TKXB 2FSKA 2JC0A 1R0AB 1XMOK 1Q79A 4CJVA 4JRPA 2FB0A 4NLCA 1U45A 1O0PA 2J8AA 4YORA 3OFHA 2RKIB 3A0IX 1K47A 3CJTA 5ETPA 3HD2A 2LYVA 4JUZA 4IR1A 3CEDA 5LXRA 3NGRA 4FYWB 3T5LA 6FD1A 4QYRA 4RW9A 3RGIA 2P1JA 3IRXA 3UI3A 1VLOA 4ZS6A 2D3UA 2CNNB 2IAJB 2W2NP 1BWEA 2R8JA 3HOTA 1SH0A 3DM2A 3P5JA 5EY4A 2NRTA 1UA1A 1N8RT 1NJWA 1SB6A 3QSIA 3JQKA 4FP9A 3NH0A 5C24A 5KFMA 5C42B 1SUQA 4KO0A 3UD5A 4A4JA 1XHXA 1JLAA 1E4GT 4DV7J 1PILA 1FFSB 2A40A 3AGRA 3EXYA 1N34K 2QIFA 5D78A 4WYWA 4HTUA 3BKUA 4UY85 2GJFA 3DAWA 5LJ5Y 5FRMA 3G96A 3S6EA 2IYGA 1YSJA 2DISA 2P5VA 2M0GB 2UVUA 1O5JA 3TVYA 4LFBF 3QLHA 3W0LA 3DLGA 2F4VF 3MMVA 5KOWA 1VQ8N 2CQ4A 4RO0A 2UV8G 4CBUA 1TL4A 3RR7A 2XSJA 3NF8A 1N8RO 5J1EB 5F8JA 1QDUB 4QU7A 1XHZA 2ASPA 1D5AA 3KXDA 5C25B 2AYMA 2FQQB 3CCRN 2QX0A 3FZ2A 2E5LF 3KK2B 3S8SA 4USVA 3K9JA 3V9UA 4ILJA 4BR9A 4C8YA 1RP5A 2A6OA 3D0PA 1FXXA 1RFQA 5BRFA 3TZXA 1V4TA 2MQNA 4C6AA 1S9FA 4DTRA 3CJCA 3K58A 4NXMJ 4LFBK 4KHWA 4QYZJ 2OPPA 2ZJPL 3C65A 3MM9B 2IPOB 4BR5A 3V9WA 3IAS9 4RUCA 2A3JA 2OZSA 3LOUA 1FX2A 3US5A 4JKCA 4ZIVA 1CJVA 3UO0A 3OHBA 4GY2B 4RW7B 3D2FA 2HFSA 2DNLA 2YTCA 4J9VA 3B78A 3F41A 3ADAC 2N7CA 4DUTA 1TTHB 4X4VA 1F3VA 3ASMA 2OH2A 1S12A 2FPHX 2KFZA 1URRA 4AFFA 2MQQA 2QFIA 2ZHBA 2GVDA 4B9LA 4PWUA 3UCGA 2DPJA 4PZVA 1P8GA 2ZBIA 4P73A 3ILIA 3WX4A 2V8PA 4JV0A 2X78A 3CWJA 2HQDA 2RVJA 4H0TB 1IKVB 1YJTA 3PKYA 1M5PC 3NE6A 2FGCA 4LF2A 1VQKS 3JQJA 3A8JA 3N01A 4O23A 3FQKA 4IOBA 1RA6A 3HHLD 2W25A 2WW8A 1FJEB 4I69A 2W24A 3CT9A 4OJRA 3CF5Q 4FLZA 1K0TA 5EOYA 3WIUA 2ZDPA 3P38A 5GMDA 4X66K 3D45A 2XZDB 5EU7A 3MMCB 5AQLA 4FJ8A 1NGCA 4CLKA 2BZ2A 5GAGU 3MCOA 3QFUA 5GADU 5AQPA 5AJ3K 2OPPB 1F2HA 2OIHA 2GAHC 1W97L 3MN9A 5ETNA 1NK9A 1C0TB 5G4DA 5C5JA 4NXMF 1LK5A 2YNHA 2CJKA 4CLLA 2LU1A 4CLPA 1IUJA 4OKEA 2Z2ZA 2VKZG 1HI1A 3L0QA 4OZJA 5AXNA 4K0KF 2F8SA 2M9KA 4YR0A 5KTQA 2XMJA 1R6VA 2VJVA 2BJ9A 3M6WA 3ALYA 2G0JA 3IRXB 4ILMA 1YJNS 3VQ8A 1P9QC 3EO3A 5AQGA 2XZWA 4CIEA 4IRCA 2OPSB 5BR8K 4B3MJ 2WSCC 4H5TA 5CYMB 3OYJA 3HKZD 3O6QA 4N7TA 1VSLA 1ZOTA 1L3SA 3MPVA 3OBYA 4BDYA 1PYSB 4OX8A 1LXNA 2GHPA 4DUYK 4HDGA 4LFBJ 1RABB 4IFVA 2IOCA 5D0EA 3LUYA 1W25A 1S48A 2R7SA 4FL9A 2EKYA 2P2CB 4J2BA 1VRUA 3DDNA 2DNMA 2F9JA 3FZBA 2CDQA 5D8HB 4MFBB 5A8WA 3CDUA 2IS3A 3QWPA 2VCPA 1T05A 2PI5A 1G4CA 2GVZA 4KHPK 4DDFA 2UVWA 2HNDB 3OL8A 4IXCA 1GFWB 3SQ0A 1FJGJ 2R7XA 1T9WA 4X4PA 4CTAB 4CLYA 1BIZA 3HSJA 1R8BA 2E5HA 3PM9A 1FX4A 4ZVUB 1NJZA 2ZZMA 4W5TA 3LPYA 4NI2A 2B4VA 5HLFB 3B54A 4DV2J 2CQBA 2F40A 2BW2A 3FEXB 4RU2A 4U7UK 3KD5E 3HSGA 1TMMA 2H65B 1FD2A 3TEHB 1SPBP 2F9WA 3R5CA 4OYZA 3I6PA 5HQMA 1D09B 3KHHA 3EPIA 3AVBA 5A6PA 4ERDA 3T69A 1R0CB 2V34A 1KNZA 5AQSA 1N5TA 4YOYA 1UAXA 1JLEA 1ILYA 1U1KA 5J2QA 5L46A 3BDPA 1C0TA 3QO9A 3IKMA 3VHQA 3NAIA 3VV2B 4IG3B 3CCLN 5IT9Y 3CCQS 5KFZA 3IAM9 1LW2B 1UEVA 2CZ9A 2XHCA 3MM7A 4CZCA 1R8AA 1LOTB 5BYSA 2ADBA 3DRSB 5IM0B 4K4XA 3DHWC 2D0CA 2XM3A 1I94J 2QV6A 2E7WA 4ED0A 3GZ7A 4B9QA 4U67L 1SBRA 4NO7A 3HOSA 5GAGP 4UY8T 3W1YC 2B5JA 3NBPA 3JS6A 2BKNA 1TKTB 1MN7A 2HHVA 4DR1K 5KFQA 1TV6B 2FHOB 5FIIA 4X64K 1VC5A 1YVNA 3AO2A 3IBCB 2B7CB 4YNQA 2GS8A 3M2RA 2E88A 3ULEB 1X9MA 2QA4S 5ADXH 3M6GA 5IT9U 5ETSA 2HGMA 5FDLB 2YX6A 2KB2A 4QR2A 3RAXA 4KAZA 1HNZJ 3MHYA 3M8PA 2JVRA 4B3OB 3VESA 2GEMA 1RHUB 3VZHA 1ZAWA 2MKJA 5CYQA 2IDLA 2Y0BB 2IM0A 4HDHA 3OTOF 1NK7A 1OPZA 4PG4A 2JX2A 4FWOA 1FRXA 1YJ7A 3SSSA 4DR1F 3OFEA 2PZSA 2A10A 2ZOGA 3EN9A 2CPIA 3M8RA 1VFJA 2N3OA 4A59A 4JP8A 4QOTA 4ED3A 5C25A 2EW9A 3UR0A 2IVMA 2JSXA 4C4WA 3PV8A 3GV8B 3QDKA 2UUTA 4LF4K 4NMLA 3NMRA 1F9HA 3O1WA 3VGKA 3MWPA 2AEJA 2FF3B 2FGOA 1N36F 3N4QA 4QZVB 4Q8FA 2K7JA 3NS7B 1NSPA 2QLJB 3TJ8A 3ENAA 3G2XA 2DEJA 5J2MB 4E3SA 3M2UA 1KONA 3GIMA 4RCHA 2CNKB 2E44A 4R79A 3RBDA 2ACMA 4H4KC 2ZM6F 4LF9J 2HS3A 3UR3C 1ZBIA 4CT9A 1HLUA 2DH8A 2KW4A 4AILC 3U3GA 4PG7A 1UOCA 5DDRC 3KNAA 3VGMA 3HL8A 4FPRA 7FD1A 2G13A 4ZKAA 2YI1A 1SC6A 4CJKA 3W3DA 1KWMA 2FVPA 3DDKA 1M5OC 1VQPS 3D54A 3JYTA 5CABA 2AYBA 1X3MA 1SL1A 4OLPA 3J7Z5 1SKWA 3THVA 4JRQA 3TNVA 4G3IA 4CJPA 5CR4A 3CMES 2A41A 4CF2A 2IIHA 4FS1A 3UN3A 1V4SA 2NXNA 1UP1A 2XYPB 5KFXA 3DHXA 4DL7A 3OYBA 2RHKA 2VC0A 3QJJA 2P9SA 1JWWA 3UN5A 2AEFA 3U9ZA 4DPYA 3FFIA 1RHKB 1FFGB 5AE2A 4LF7J 4HI1A 1Z26A 2JLEA 3LM2A 1D4XA 3SCJE 1ZZFA 4KJIA 2KLAA 2DNRA 2Z1HA 4JI5K 4OI0A 3AB2B 2VG5B 2PYJA 2H3GX 4FPAA 3K8WA 3KUEA 3BREA 4F50A 1WG4A 1LAVA 4B3RK 2ZOFA 3FJ2A 2HHHF 4PXBA 3MMBB 3MOJB 3G8QA 5J2QB 2IDEA 4NEZA 1SQFA 4OZ2A 1M1KO 3P96A 3ATUA 5JS2A 3OVAA 1RAOA 2AHOB 3GMGA 2DNHA 4FWRA 1RDRA 1VQYA 5CAAA 1HNZK 3F0NA 3FEZA 1S79A 1X4AA 3TR8A 3ID6A 1Q7YO 1M5KC 1R89A 2KVIA 3GV7B 3G4SN 1IWGA 5BN9A 4ZPDA 3VEWA 4H0YB 2O8BA 1NHKL 3BN7A 5FPNA 4R0JA 4QWEA 5GAHU 1FEHA 3OXFA 1DTTA 3SQOP 4QWDA 2DD8S 4DV1F 2JZ5A 1GLDG 1RAIB 2CJAA 2WB1D 2C2EA 3A4TA 3CHWA 1VK0A 2B4OA 5GAEU 4J9MA 1AB8A 3KG0A 4CIGA 4WZQA 2HHXA 5HLFA 3OYDA 4LVOP 4KQZA 3GE1A 2RU9A 1UWBA 2GHVC 2KJVA 1IR1A 2LQ9A 1FTRA 4PWDA 1S1TA 2VQEF 3NGZA 3UVJB 4BRCA 1JKHA 2F3JA 1Z4UA 3CB4A 3O6WA 1ZM2A 4A8YA 4DU4A 3PFEA 2CQDA 2GV1A 4ZPCA 3PX0A 5KFRA 4DV6K 1YBAA 1IM4A 4WZMA 3T1YJ 3CCTA 4FJHA 4CECA 3MOZA 3CJRA 2QTWA 3H45C 4GV6A 1NBWA 4C8MA 5ETTA 2OFHX 4WYBA 1OO0B 2V4JA 3PG9A 1QQMA 4LRDA 1IXKA 2OPRA 3D2WA 1R43A 2PBDA 3TABA 1GLCG 4J2DA 1QAYA 2VFSA 3C6HA 4ISFA 1AZSB 3QT8A 3L4QA 1HD0A 2YQ0A 1WC4A 4FM0A 3K0SA 1VQ4N 2ZH6A 4IFEA 2ZM6J 3TUZC 2ZFHA 4FOEA 5KFFA 3SV4A 2UXCJ 2X74A 2CUYA 3R6LB 3HHDA 4QWAA 2DB1A 2R2RA 2Q6BA 3OSNA 4CD3A 3KHYA 3JTNA 2GQQA 3LP2A 2NQPA 5DLGA 1H3DA 4LF9K 4RNNA 1A0OB 4M3RA 1SJ3P 4M5KA 2AGOA 3NGSA 2E29A 1XBWA 2HG4A 3T7ZA 1FVQA 3HM8A 2X6NA 2FHKA 4I9QA 1X4HA 4CO1A 4A8KA 3E9PA 1H98A 2QYCA 5SZTA 4NLBA 4KB0A 5DDPC 2ZHOA 2NRVA 2AEMA 4YDUA 4KHUA 3FZKA 4QOZB 4MTPA 4FJ7A 4J9UE 1F5BA 1LWCB 2CWXA 4K59A 1CQNA 2V4RA 2GO8A 5LSRA 3QRPA 2XYGB 2HGNA 1KD1O 2K7KA 4GRSA 1WEYA 1T9VA 1HPMA 4KHPJ 4QQBA 4QPTA 4W5NA 3T1YF 3VQQA 3PLAA 2EPIA 3POTA 4J9LA 3L7PA 4S0MA 1FE0A 5HRPA 3GP9A 4C11B 1TL1A 4H5WA 2I7PA 2YH1A 1VQ9S 5T7BA 1WSRA 1VCTA 1SZ2A 3N6NA 1S1XA 5LJ3Y 4TLQA 2ROEA 3BH7B 1ZA1B 2LDIA 4JN4A 3MR7A 4YFUA 4HH0A 4IOXA 3RMAA 4UZBA 2FXUA 4EO6A 4Y2IA 3K5OA 5D3GA 5D0RA 2ZH5A 2HHWA 4W5OA 4CGFA 4RPFA 3AAPA 4KREA 3DRRB 4F4ZA 4OHXA 4QAGA 4TY8A 4NEYA 3VR1A 1WKJA 3KLIA 5HROA 3FVYA 3HO1A 3B82A 4KE5A 1NK0A 4P74A 3S9HA 2DH7A 2O8DA 5CA5A 3L3CA 4LRCA 4UF4A 2ZJPQ 4AHRA 3AAQA 2BX6A 3HM9A 1NGFA 2P9CA 2HBLA 1P6TA 1WTFA 2B7BB 1HIYA 2V2VA 3DOMA 1K9MT 5A8WB 1FFWB 4GKKK 2N3LA 1IBKF 2HRTA 2OKQA 4BVPA 1I94F 1DQ9A 2A1RA 3ENHA 2MB0B 1YHQS 2D3ZA 4ECSA 2XNRA 1VSFA 2MQPA 3MEEA 3R7BB 2GV9A 5K5MA 1IBCB 3MCMA 3EDRB 1KBRA 4FLYA 4DPUA 3HTVA 1FK9A 3SBMA 2R7RA 4HTJA 1QZ6A 3C0BA 2IFXA 3AVMA 1Y10A 4OZ1A 1T0TV 3CDAA 4F36A 4ZA1A 1DTQB 3VF0B 4M5DB 2YKMA 2MKSA 2HRYA 3AD8C 3NHGA 3ULDA 2MQMA 4O0IA 1CQMA 1HNWF 3BR9A 3DXBA 2VWKA 3DRRA 1S0VA 4K4WA 1VISA 3J80Y 4Y28C 4G65A 2NZCA 3HHEA 5E26A 1QAIA 3W2WB 2YJEA 1S9EA 2VG6B 4WFAQ 3DOLB 3NL0A 4DZDA 2LXUA 2P5OA 4K4TA 4PG5A 4XK8C 2OZMA 3LP0B 1RYRA 4PKIA 1RT5B 3KZBA 1VRUB 4CHYA 1B64A 1HNIA 5M1NA 3B6OA 3O2IA 3DDIA 1J5OB 2VKRA 1ZBUA 3R97A 3J8AA 2EKNA 1RLCL 2CIMA 4CBWA 1PG5B 3EGNA 3MXMA 2WZ1A 5LM7E 4ZJOA 4LF9F 1RWXB 4X62J 4YDUC 1Z2LA 5I4MA 2O67A 4FPBA 1NKCA 4OLOA 1GMWA 2E7XA 3I55N 2NS1B 1CJTB 3E01B 2IMOA 4TYBA 1IQTA 3DXSX 1S10A 4B3MK 4GV9A 3VQEA 2XC9A 3IWNC 1BCOA 2ZWPA 3RRKA 3HRGA 4Z37A 2KXHA 3O08A 1HQUA 2O4IA 4B9UA 4MJKA 2VWJA 4I0WA 3IAYA 2HMIA 2CQIA 1JLFA 4OI1A 4I68A 1M5SA 4I2PB 3K9KA 1OYDA 4ILGB 4IKAA 2H4YB 1Q9XA 5E3RA 5H9FK 2YV0X 2Q3SA 2QMWA 3TZWA 3L4BC 3AO4A 2ALYB 1H6KX 2ZUGA 3RAQA 2W2QP 2P9EA 4DSEA 1QUPA 1FD8A 2DY1A 4FXVA 3ZZUA 3PW0A 3BN4A 3AAWB 4B9NA 2GUPA 4KH1B 5T7LB 5E2QA 4OYAA 1XI1A 3MN7A 4MAKA 3DLRA 3GCWP 4ZCKA 3OQ2A 3CPWM 2KKZA 1TK5A 3WXIA 2BE9B 5EN1A 2FBXA 1Q8IA 3GLJA 3M2RB 3ULEA 1RWWB 3QGPA 4ZDNA 2RNEA 1F2GA 5FPMA 4XDCA 3U1MA 2AMCB 2QWPA 1UKUA 4I7FB 5L9NA 3BO2A 4PEOA 1LNQA 1HWKA 2XY7A 2NSCA 3LP1A 4FJJA 1CJTA 4DSJA 3T5JA 1UFLA 3PY8A 1TL3A 4RW9B 4DJBA 1Y64A 1NGEA 5CE3A 4K2JA 3AARA 1N0VC 1YF5L 3ZFVA 2OMOA 3U9DA 4I4BA 2CXEA 4CBXA 3NMAA 2CPHA 4M5NA 5DG9A 1RYSA 2CAJA 2XO6A 1Q82T 3O9TA 4BACA 2CG4A 4K43A 1FK9B 1P9YA 4QIWD 4ELTA 3QYYA 4WPAA 3OYNA 4Q8EA 1F5CA 4OZ5A 3DI6B 1M5HA 3IWXA 1K0VA 2P9PB 1Y0HA 1S57A 3WEEA 3V4MA 3H1QA 4KH5A 4P10A 2F7TA 4KRWA 5A8RB 2B6AB 1S4FA 3R1LA 3W62A 2PIIA 1RCHA 2I5JA 3THTA 1RAFB 1L3TA 3FKBA 3NH2A 1N0UA 2C2ZB 2X7IA 1PGZA 5JUMA 4KBIA 3I8BA 4MKYA 9RUBA 2MMYA 2NXCA 4LREA 4LRFA 4JI0F 2NUHA 2JDJA 4CH0S 2BM1A 3QIPB 1A5WA 3A12A 3B6BA 3BGRB 1TP7A 1GLJO 3GFHA 2IJRA 1BHLA 1IKWA 5BYQA 2QM1A 4JI0J 1TYQA 4MO4A 4F04B 3RBZA 2O01C 3TA0A 3PACA 1LWXA 3B4MA 2HNYA 1ESVA 1NPKA 2EVZA 2BRKA 3DLGB 2C42A 2B8PA 2D1KA 1Q95G 1EHWA 3MEEB 1RT4B 1NPRA 4JKDA 2O8CA 4PHTX 1XTZA 4WQ4A 2FJDB 2DY9A 4FM1A 1UVNA 1RBSA 5KG0A 4MK7A 3NGDA 1N33F 4CK3A 2BBEA 4DOZA 1GEHA 3SEOA 3LZIA 1QHAA 2QN6B 3KKFA 4K2XA 3BB5A 1FKOB 5M2PA 3RAMA 1Z1ZA 4ED2A 3FBBA 5BR8J 2HS4A 2OTLN 2WVBA 4LSLB 4WFZA 1OVYA 2WRMA 3EGWB 3CIZA 2GA7A 2KFYA 2L9DA 3X1LB 1FJ7A 3CJBA 2E4LA 3TQ1A 4QBUA 1H2TZ 3KMSA 1ZM9A 4M7XA 4UTGA 4R0EA 3W9HA 4C8NA 2DPIA 3TOQA 4AE5A 1EJ7L 2AYEA 3EZWA 2WONA 3U7JA 1HARA 2ZBQA 2OMLA 2OEJA 4EZ9A 1RADB 3SCKE 5H9FJ 2EFVA 4OV6A 2OEMA 5KT7A 2V8GA 4V19X 4UT4A 1GMWD 2F4VJ 4NLVA 2O4GA 3JSBA 4NLSA 1HR0K 3I5BA 3H25A 4X4NA 4FNHA 3AXMA 4HHHA 1YZ7A 4B02A 2HBKA 1TK0A 3ZT4A 4OYWA 3CJ2A 2WK4A 5J2NB 1DFDA 2LEAA 3H90A 1FRKA 1M1KT 3F73A 3H3OB 1DZ5A 4PWDB 4KRFA 4EEYA 3LQVA 2V52B 3KJFB 2MHEA 2J5AA 2DPNA 3UVJA 2PT0A 3P31A 1X0PA 3J80O 3I87A 2IA6A 3SI8A 1ZAVA 2C3PA 4RW4B 3GFZA 3LA0A 4YHHF 3KD1E 4ZHRA 3QETA 4G1PA 2UUAJ 1IBMK 2DXEA 2PD1A 2RDIA 5HQ8A 2DTJA 1LWEA 1XERA 1SL2A 4D3GA 3V1OA 4ISGA 3P1GA 1NO8A 4FLTA 4CD1A 4H54A 3H2LA 3BEXA 4QS8A 2A2DA 4CFBA 1HQ2A 1VOMA 4CLTA 5B09A 1QAJA 3PIPL 3UKRB 4M42A 1FERA 1K8KA 1UL3A 4WCEQ 3ZCMA 2NCKL 2Z2LA 2RE2A 5LJVA 4Z4CA 2YQ3A 2E8AA 2UUCJ 2NUBA 4GVBA 5KQ8A 3E3XA 4M3ZA 1W9HA 5B8HA 1WSIA 3CG7A 1Q0NA 4JI8J 1Q8LA 1S1XB 2AP6A 3PW4A 3CD7A 1KAYA 1SAZA 3M05A 2JJ4D 4PKHA 4OI6A 1OQ3A 1VI7A 1T6DA 1HFEL 3D9BA 1HNXJ 1IH7A 2QL9B 2M88A 2V8DA 1WF0A 2FJEB 2GELA 2YNIB 5BPLA 1KLNA 3JQMA 1FWPA 1H0HB 3JS9A 4CVNE 1Q82O 1WN7A 3U02A 3VCDA 1KFSA 4OIXA 3THYA 5I42B 4ECXA 4CGIA 2QL5B 4DV1J 4O3SA 1Y3KA 4K7QA 3ZX3A 2OCEA 2IVYA 3C8YA 3R5JB 4M3WA 4NLQA 4FDFA 5CYJA 3QO9B 3LDPA 4B9TA 3Q86A 4F4KA 2NRRA 1BQXA 2VFUA 3VQPA 4E1MA 5EWEA 4LH5A 4NLYA 1XQIA 2P6SA 2ZQBA 1Q16B 3DYAB 1GXUA 2MLXA 3LAKA 1R27B 3P5BP 2MGZA 4UZCA 4ELVA 4EP5A 1O6XA 2HEKA 1V5IB 5F0XA 2XY6A 2FLPA 4RUAA 3VAMA 1EX8A 3GG4A 1QSSA 1UVIA 2XGPA 1XMBA 3BY5A 2W4PA 2PSZA 4FVCA 2MY8A 4LRAA 3WBZA 1ZBSA 3V9SA 2C2KB 4CZEA 3ETOA 5AE1A 1URNA 1NGBA 4BREA 3IO1A 1HA1A 4BC2A 1U0HB 1KVKA 2QI2A 4DU3A 1F9EB 1M1HA 1XR7A 2DRBA 4PUOA 4DU8A 4EHUA 1VQ5N 1IN0A 3KWGA 1PBUA 3LW5C 2BJ7A 4HR2A 4TU9A 1N5YA 1S9EB 3OHAA 4KGZB 4ANEA 2G8FA 3K7RA 4JK8A 1E6VB 2HHHK 1PBAA 3FRZA 1JJHA 2YKNA 3G6VA 3SAHA 1NSQA 1OY9A 4C97A 3N6LA 2EK6A 1NU4A 2HB5A 3H5SA 3PDNA 4IJNA 3U4LA 2XMUA 2MKHA 2X3DA 3CPEA 3HVRA 2NLWA 4JKAA 1BL3A 4BLGA 2LSNA 3GJSB 5F0WA 1X4EA 3AODA 5K8PA 1HPZB 1RTJA 4BE2A 3GG1A 2B4PA 4ETXA 4AHVA 3AT1B 2CRLA 3BSOA 4Z4GA 2UUWA 4K4VA 4DQQA 4ID5B 5HP1A 4GMKA 3MPUB 2QXLA 3TSUA 2YVSA 4CJTA 1X5PA 5TKYA 1FKAF 5AQVA 3UFCX 1N5QA 2DYAA 1MROB 3I0RA 2RE1A 2KHOA 3M6XA 1KVCA 1V5VA 3W66A 1Y9OA 4HL9A 4LSZB 2V2ZA 2O8FA 4HHTA 3FCWA 1DTQA 4QS7A 1ATRA 3LAMA 2AGQA 1ITPA 1QQNA 2CPFA 1VQ8S 1RHMB 4QIVA 2UXBF 2R7UA 3QBCA 1ASWA 1N32J 3I55S 1VYAA 2PA3A 1OJ4A 2Q1NA 3R5AA 2XWXA 1SJQA 1NZAA 2UU9F 3W2WA 1UMJA 2VH7A 1MMLA 2XCPA 3OUYA 4MDAA 1SKRA 2IHR1 3AVFA 3UKRA 4LF7F 3B8HA 5C42A 2IRXA 3M2UB 3R9PA 3CC7N 1CZ9A 2VD3A 4W5QA 1N5YB 4DTPA 2ZZTA 1RTHA 2FVRA 3R8YA 1ZM4A 1GX5A 2X1AA 2BE2B 2MQLA 4JI4J 2IYIA 2WC9A 2W9CA 1QQOA 5M1QA 1FXRA 2A6AA 1J27A 2AJ2A 2FF6A 3W5XA 2JWKA 3KTQA 3WQTA 4QJVA 2O3DA 4JI1F 3EPGA 3CJSA 4ED8A 3JB9k 2DEIA 5E3CA 4YOUA 3IGNA 4BC3A 4LFCJ 3NF9A 4GW6A 3KK7A 1ZBHA 1RDUA 1WACA 2XI3A 3HCXA 4O5FA 3P4IA 3ATVA 1ZH5A 4PQUA 2RB7A 3FSYA 1RT3B 2V7ZA 1OS5A 4MIWA 1KFDA 5HBMA 1H2UX 1D9AA 5HI7A 3IA0A 3P6YC 3OJUA 1RDWX 1VQ5S 2E5LK 3M5RA 2NZTA 1EQMA 2ZJQQ 1GMUA 3D28A 2JOQA 1SUQB 1OMSA 2GIRA 1KR4A 3NGUA 1IG8A 2MTLA 4KHRA 5ETKA 2VOOA 4A8WA 4H4KA 3JSYA 1SJ1A 1XJWB 3HZEA 3RBEA 1DQ8A 1T11A 4JV5J 3LF0A 2VU5A 4PKDB 3KLHB 5GVQA 4RW7A 4JKGA 2CDRB 1J5EK 5F3ZA 1DGKN 3VETA 3N5BA 1RT7B 2HFUA 5LSLA 2QLFB 3S1TA 1WHVA 2QSFA 4DL2A 4DSKA 2DR5A 3V4IB 1ZM3A 1WD6A 3VF6A 3TJ9A 2ASJA 5KFAA 3IN5A 2UZAA 2DIUA 4WXOA 2IVOA 1DAXA 4LF6F 2ZKUA 4DFJA 4IH6A 2KQ2A 4EUVA 2JC1A 3BSNA 1NK6A 1PC5A 5KFDA 4JI5F 2WBRA 2XHWA 5DDOC 4ES1A 4L3NA 3OY9A 5M2UA 1NGGA 3AB4B 3HULA 4FOIA 3ZT0A 4KGVB 3PCOB 4B1YB 2X1FA 2KRRA 1LFWA 3NG8A 4FNIA 3OBIA 3THYB 4FJKA 4BROA 2AV5A 1FXLA 3MEDA 1NCLA 4C7QA 1XNQF 2RN2A 2EG1A 3RTVA 3FZLA 2Z1GA 4C3LA 4ZITA 5HVGA 1R8HA 3C95A 3ITHB 5C7PA 1NAQA 3BS9A 4N41A 2E1YA 2JWNA 3KUGA 4QWBA 3V6DA 4AHUA 3SK3A 3CCSN 3MMCA 3ZT2A 1JJCB 5JJBA 2U1AA 2ERRA 5KT2A 4CIFA 1UCNA 3DYAA 3RMCA 1VRTA 2CJ9A 1R8PA 3QRQA 3TTFA 1JKHB 4BRPA 5IC4B 2RF2B 1ATNA 1LWFB 4C8LA 4LF6J 1KP6A 4C1NK 4A57A 1S0NA 1HUXA 5HRSA 3F2KA 2P9PA 1QM9A 2QC3A 2QWQA 4BS2A 1EKRA 3PX6A 3G9CA 2MHNA 2FBVA 1NGJA 5GAHI 1SCJB 5IQQA 2BQ3A 1RU2A 4MKVA 2G9OA 2HVZA 4ZVGA 1IBMF 4FWKA 1VQON 4UUXA 2GFFA 2Z1JA 5T41A 3MPDA 3NXZA 4GKJF 3M30B 3EUNA 3BYRA 2O5DA 1T9YA 4CJ5A 4K4ZA 1LW0B 5ADZA 4B9VA 4DMZA 5AQUA 2V2KA 3NAHA 3LANA 4CLWA 1EETB 2DNOA 2Z1IA 3DI6A 2CQCA 4AQYK 4Z4EA 4ED5A 1S1UB 3WEEB 3MUMP 3VAFA 2YHXA 1VMBA 1Q5YA 4Q2LA 4CE9A 3OTBA 5EUHA 1VSIA 1PCAA 1NK8A 3NH1A 4D3HA 4IFVB 1VQ7S 2BYCA 1S59A 2DR6A 4FK2A 3AOBA 4JI2F 3ZSOA 4U96A 3MM6B 4DZ6A 4MFBA 2VUGA 1TUUA 1IJJA 4IOCL 1RT1B 1CPZA 1QZ5A 1CZAN 5JMNA 5EVZA 5BREA 2WUSA 2NREA 4F8RA 1VS3A 2QWLA 4BR4A 2QA4G 2AF6A 3S7RA 1TKTA 2E1CA 5F8MA 5F2RA 2E20A 3ZZRA 4OYMA 3I0RB 3TARA 4H4MA 1KXPA 4BWJA 3VERA 1NDPA 3DMJA 3M2VB 2VB6A 3MM8B 3VQ7A 4E7KA 3OYHA 1JJ2M 5KG7A 4DX7A 1RWVB 2AA4A 4Z4HA 4K8XA 4M95A 2FYXA 1RBAA 2G1HA 5KFCA 1WSJA 3VPZA 3QGIA 2HOEA 2PN6A 2GC8A 4FWNA 2MSSA 1WOSA 4CHOA 1H2VZ