2OPRA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
538
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGNPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 140
structure length 538
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oprA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oprA05
1ZYQA 4AHUA 3IRXB 1S5JA 4Z0UA 1IKWA 4TQRA 2VG5B 3LP0B 1JKHB 4FLYA 2CKWA 4DWIA 1KSPA 4QW8A 4ZPCA 1JKHA 4YFUA 2G8WA 3QO9A 4RW7B 4UQGA 5DK5A 4M3RA 2Z1IA 3MEGB 2IJNA 3C6UA 4CF2A 4ECTA 3FRZA 1TL3A 5JS1A 2QV6A 4IH5A 2G8VA 4W5QA 4NYFA 3Q8RB 4WZQA 5J2PA 3KK2A 4LQ3A 4WE1B 1JLQA 4GMJB 3KK2B 2WCXA 4FVMA 3KMSA 1EETB 4M42A 3V6DB 3TI0A 5HROB 3PO4A 4NRUA 3RBDA 2E9RX 1TKTA 4M41A 3V1OA 1C0UB 4B8AB 3OHBA 2DTUA 1WSEA 3IG1B 4MQ3A 4NRTA 5FRMA 2C2EA 4JS5A 4IR9A 4DFPA 4DFJA 5KFCA 1VRTB 2AWZA 5KFXA 5KGWA 4K4ZA 1KVAA 1L5UA 3DLEA 1BCOA 2FBXA 4O3SA 5KT7A 3ISND 3OS1A 3TVKA 3SQ0A 3L2QA 4IH6A 3HK2A 2OPSB 4N5SA 4NCBA 5CYMA 1VRUB 3K5OA 4WXWA 2HB5A 3ZT2A 1VSKA 1IKXB 1RTHB 3PR4A 1JXBA 4RW8B 3AV9A 2RDJA 1TV6A 2YNHA 1GOAA 4C8MA 3TR8A 1KLNA 2BE2A 1LW0B 5EDWA 1LW2B 5E41A 2HMIB 3TAGA 4FK2A 4F2RA 4DLGA 4DTPA 1TAUA 1EX4A 1G15A 3CIZA 4ICLA 4OGCA 4ELTA 4KKOB 2C22A 4CK2A 5C24B 4EO8A 4E3SA 4E1NA 4IH7A 3KJVB 1RT2A 4B9SA 5D3GB 4DL6A 2JGUA 3NCIA 3RB6A 4CF0A 5KFSA 4DL2A 5D3GA 4K4SA 4J2BA 1VSEA 3QEXA 2WK4A 3RMBA 1C1BB 3CJ4A 2Z1JA 1SH0A 5DQGA 1NJZA 2BQUA 3BSNA 2ZE2A 2XC9A 4EBEA 2GV9A 4ZPAA 4YQWA 3L3VA 3K5LA 2EC0A 3DRRA 4XO0A 3AVHA 3H59A 5JUMA 1K6YA 5KFQA 3Q8SB 1T7PA 3RTVA 3BSCA 2XGPA 4H4MB 1NJYA 1RT7A 5EUHA 2A1RA 1QUVA 4GW6A 2OYQA 1QSSA 4I7FB 4CIGA 5HBMA 4NYNA 2IBKA 1VSMA 1IKVA 5KG3A 3PW2A 1TK0A 3DLGB 5F8LA 3KLIA 1T94A 2IOCA 3DLGA 1TP7A 3DLBA 3M8SA 4FJ8A 5DGBA 1RT5B 3LP1A 4ECZA 2F8SA 1REVB 3NF9A 4HKQA 1JL1A 3ISNC 2HHVA 3RMCA 1C2PA 1KTQA 4OPKA 3C6UB 3MEDB 3HVTA 1C1AA 1NOZA 1S1WB 1D9DA 3IN5A 3NHGA 4O4RA 3HYFA 4FYDA 4NLXA 2WHOA 2OPPA 1YTAA 3RB4A 1C1BA 1I3AA 1LWEA 2FBTA 1O1WA 1FK9B 1WSFA 3WNHA 2AJQA 1SUQB 1N48A 4WFXA 1HNIA 1RCHA 1S9EA 3LZJA 1XR5A 1MU2B 4CJWA 1S0OA 3IGNA 4OJRA 3NF8A 2RF2A 2HNZB 3MFHA 3K58A 2HHTA 4W5NA 1RILA 1LWFB 3CVKA 1SV5A 1TQLA 3KOAA 1IG9A 1S1TA 1QHTA 4H4MA 4O3QA 4FZXC 2G8FA 2XRIA 3LP0A 1TL1A 4N47A 2Y1IA 4B9LA 3PVXA 2LSNA 3AVAA 4DQSA 3LDSA 2V0NA 3SYZA 3BQ0A 1RTDB 2X78A 3CDWA 3GIJA 2DY4A 2JEGA 1RTDA 2HVIA 1QAJA 1B9FA 3RAQA 5KFJA 3L8BA 1RT3B 2E9ZA 3OYGA 4DL4A 3QLHB 1TV6B 4H8KA 4IFVA 3PW4A 3KD5E 3KLHB 3LAMA 4O3RA 5HROA 4CJLA 2HWHA 1KLMA 1Z4UA 4K4XA 4L8RB 4ECVA 1NHVA 2KFNA 3HL8A 3H4BA 2D3UA 1QE1B 4Q0BA 5J2PB 4FLXA 1KRPA 2HHXA 2NUBA 5DGAA 1UAXA 3SUOA 3EY1A 1NKCA 1A5XA 5CY4A 3UIQA 3CJ3A 1CXQA 1NK9A 4CHYA 1S0NA 3V9XA 3DLEB 3M8RA 3OL8A 3PJXA 2HWIA 3DYAB 1ZTWA 4IQXA 3V1QA 4DTMA 4NZ0A 1U49A 4FJNA 2WTFA 3IRXA 3V6DA 3U3GA 2BQ3A 5J2NB 3AO1A 1QS4A 1S1XB 4ZPDA 4DTSA 4B9MA 3QIDA 1RNHA 4W5TA 1YVFA 4N56A 4TSXA 4FCYA 2QKKA 5F8GA 1JXEA 1SL1A 4Y2AA 4IFYA 4DQPA 1CZ9A 1RTJA 1S1UB 4ZMMA 3UQSA 4O3NA 1WSIA 1T05B 3IGVA 2F8TA 1ZBUA 3CFRA 2XI3A 4CF9A 4CK1A 3EPIA 2W42A 1RTHA 4AHCA 1TGOA 2F8EX 4G3IA 1HQEA 1TKZB 3QLHA 3V81B 2ATQA 1SL0A 4RW9B 4TYBA 1RT1A 5SWMA 3T5JA 3S3OA 1XR6A 2VWKA 4QCLA 4O0JA 4MK7A 4B9VA 4LQ9A 4DF8A 1L3TA 4DTJA 1U09A 5KT4A 4DQIA 4J9SA 3OY9A 3OYEA 4HVJA 1KFSA 2HMIA 5KFOA 3AVCA 4I2PA 4Z4IA 5KFIA 3QZ7A 2IM2A 2O4IA 4IG0B 4O55A 1EETA 5KFBA 3VQ5A 4RNMA 1HYSA 4G1QB 2HVHA 3KLFA 3I0SA 3P83D 2AGPA 5J2NA 3FFIB 4BE2A 4RW8A 3NMAA 3PY8A 1R0AB 1X9WA 1LWCB 1BCMA 1S4FA 1S9FA 2EX3A 1WAJA 4Z4GA 3HPOA 3DLKA 1QQCA 1LW2A 3PUFA 4FJ5A 4O44B 1K1QA 3O3HA 4IFYB 4DG1A 1D9FA 3H98A 4DS4A 5KG6A 4I7FA 4DG1B 1JLCB 5KTQA 1VSDA 4ED7A 3T5KA 1YVUA 1QSYA 2PYJA 3KMQA 3PX6A 1TKXA 4E89A 1FKOB 1J5OB 4EYHB 2XCPA 2C2DA 2OPRA 4HCCA 1HQUA 3OL6A 1VSJA 4FW2A 4NLOA 1SKSA 1XHXA 3VQ4A 1NJXA 2ZKUA 1D5AA 1BISA 5KGXA 3KLHA 4ED1A 2UVWA 4ECRA 1TKDA 3AVGA 4DSIA 4FJIA 2FVQA 4KAZA 2V4RA 2YHAA 4M3UA 4R5PA 2UVVA 4OGEA 1KCFA 3OJUA 2FJXA 1RT4B 2HW3A 4FK0A 3OL7A 4FM1A 1S9GB 3PO5A 2ILYA 4EP4A 1JX4A 3BGRB 4URSA 5KFAA 3Q8PB 3GIMA 1D1UA 5KRSA 2JEIA 4IG0A 1S9EB 1XI1A 4NLRA 2W9BB 4J9RA 1A5VA 1NKBA 2XI2A 2WONB 4KAIA 4CE9A 4CJRA 3AO5A 1KHWA 4M3YA 4FZYA 1LWFA 3MR2A 3QNNA 2JEFA 3OJSA 3KLEB 3AA3A 2JC0A 2XY7A 4H54A 2D0BA 3LP3A 3OYCA 3SUQA 1JXLA 2IS3A 5FDLB 1TL1B 3QINA 4K4WA 2KZZA 1UWBB 3AA2A 5I42A 4IFVB 4CEBA 3GQCA 1C1CA 2WOMB 3AVKA 4E7LA 1J53A 3Q8QB 2GIQA 5J2QA 2V9WA 1QSLA 2AU0A 1X9SA 5DMRA 3V4IA 3KK1B 2ETJA 3ULDA 2X6SA 3BDPA 2RKIA 4ZVEA 1HYZA 3GV7B 1RDDA 3V81A 3H5XA 4CHZA 1RT6A 4FJXA 2VA3A 4PY5A 3GILA 4B9NA 2XWYA 3OLBA 3VA3A 4Q44A 1BQMA 1W0HA 1QAIA 4ED3A 1IKWB 4IG3A 4ECUA 5EU7A 3VQPA 1ASUA 3CJ0A 5KFYA 1ASVA 4FS2A 4FBTA 4R0EA 3G6YA 4K50A 2FVCA 4CHPA 3M9NB 4MIAA 1B9DA 4ELVA 2ASDA 3I5AA 3S3NA 4RNNA 5J1EA 3N6MA 3KLGA 4Z4HA 3GIIA 3HVRA 1S1XA 4DTOA 1DTQA 5CYMB 3F9KA 3UR0A 3PX0A 4OL8A 4ECXA 4DS5A 1HQEB 4ZVGA 5KFKA 4Z4CA 2VG6B 3AA5X 5DLGA 3H5UA 4F4YA 4YR2A 4GC7A 1JIHA 5JS2A 4DFMA 1ZBFA 3ITHA 4E19A 5KFEA 3DI6A 3VQEA 4CHOA 4C8OA 4ICLB 4TY8A 2G8KA 1S49A 1TKZA 1Z25A 2V4QA 1U4BA 4RU9A 3V1RA 3PV8A 3KJVA 1FKPB 4XIUA 2IC3A 4F4WA 3A2FA 1FKPA 1ZBLA 4CJQA 3MEGA 1NK6A 2IC3B 2D41A 3BR9A 3NGZA 2HHQA 4FJ9A 4NLQA 4QOZB 3RB0A 1Q9XA 2WB4A 4FJ7A 3LP2A 4DF4A 4Y1CA 3I0RA 3T19A 3I5BA 3RB3A 4ZPBA 2FLLA 5KFVA 3G6VA 4KSEB 4N76A 1ZTTA 1TK8A 3PR5B 4DSJA 5KT6A 3QEPA 1SL2A 2UUTA 2ZD1A 3CG7A 4F50A 2FBVA 1RDRA 4Q45A 1W9HA 2VWJA 2OPQB 1LAVA 3K5MA 4PQUA 1TKTB 4URGA 3DLHA 4DTXA 2J6UA 1IKVB 4K4TA 3G86A 3IG1A 3GYNA 2YKNB 4KV8A 3QIOA 3TAPA 3IS9A 4BACA 4CGGA 4W5OA 1RT5A 2D0AA 2YHBA 4M3WA 4KHMA 3OYHA 3DOKB 2I5JB 5KFLA 5KFRA 4LH5A 2ILZA 1U04A 3SNNA 1TVRA 2FLNA 3QO9B 5KT3A 4DTNA 3UPFA 4KTWA 3LPUA 3SFGA 5F9LA 4HUFA 4DTRA 2AX0A 2Z1HA 3OYLA 1OS5A 2HAIA 2P5GA 3NDKA 2DPIA 2OPPB 4FJGA 4RNOA 4EZ9A 3QERA 3HP6A 3P1GA 1HYSB 3AVBA 5T14A 3I5CA 1S1VB 3OS0A 3CFPA 4Y1DA 5KG0A 1KFDA 4CHNA 4ZHRA 2HNZA 4FJMA 4CJVA 4DFKA 5HLFB 2XO7A 3HVWA 2F96A 2JEJA 3RR8A 4H4OA 3H5SA 1N56A 2FBYA 4CEQA 2WONA 3V6JA 4H4OB 1NOYA 1BI4A 4B8CA 2FJVA 1S97A 4CEFA 1TK5A 1UA0A 1IO2A 3KHHA 4XPCA 1N6QB 2C28A 4EZ6A 4M94A 3AVFA 5L9XA 5KRTA 3L2VA 3KK1A 2E4LA 4KO0B 5F8NA 3M8PB 1RBRA 2R8JA 3PW7A 3QESA 1JLFA 3HO1A 2I5JA 2FVSA 3ZSXA 2B6AA 4BE0A 4WFZA 3U3YA 3LP1B 3HVTB 3V9SA 1L3VA 3T1AA 3BREA 4J2EA 2XCAA 5C24A 5DG8A 2QKBA 3IAYA 4KBIA 2ZQBA 3O4QA 4CJFA 1HQUB 3LAKA 4YR3A 2FVRA 2W9BA 1NK5A 5HRSA 1BGXT 1VSIA 3M8QA 3QGHA 4KHSA 3ZSVA 5SZTA 1JLAB 3MECB 4WYWA 4NLYA 4WZMA 3HM9A 3MECA 3QYYA 3GV5B 1WSJA 2W9CB 1HNIB 1K1SA 5F9NA 4CGDA 5C25B 1VSFA 3DRSB 4EYIB 3OYMA 2VG6A 3BGRA 5J2MB 3QIPB 3KK3A 4QWDA 4LSLB 1S1TB 3VQ9A 4KPYA 3AO3A 3DDKA 4PQUB 2OZMA 3VQ7A 3KHGA 1IKYA 2R2UA 5J1EB 3CJ5A 4R8UA 3KLGB 4X2BA 3L2RA 1IKYB 3KLEA 1GX5A 3TAFA 4MFBB 3V9UA 4JS4A 3V9WA 2A1SA 4KB1A 4TN2A 4LH4A 4KTZA 3BJYA 4MH8A 4RW4A 4LD0A 3TARA 4HCBA 4I2QA 2IMWP 3RR7A 3MFIA 3PW0A 1RYSA 4WE1A 3DOLA 3ZSOA 2R2RA 4KRFA 4KHRA 3MF5A 4NLPA 4FBUA 1RT6B 5KFFA 2W8LA 1WSGA 3ZT1A 5EWGA 4CGJA 3OLAA 5DG9A 3DRPB 1HNVB 4OKEA 4ELUA 2W8KA 3P5JA 1BQMB 3I0SB 4HUGA 3NH0A 4CJPA 1I39A 3SV3A 4B3OA 1S6PB 3C6TA 1U47A 3BSAA 2UUWA 1SV5B 1C6VA 4NLSA 1ZETA 5DLFA 3JYTA 4FLUA 3H2LA 5KFHA 2ASLA 4F4XA 4DU1A 4TY8B 5L1LA 2B4JA 3T5LA 1UA1A 5L1JA 3NAIA 3HHKA 4K4UA 4FLTA 1TVRB 5K14B 1SH2A 2D7SA 4CCHA 5C5JA 4ZP9A 4FM0A 2OPQA 3FDSA 4K4YA 1RBVA 3VQ8A 2O5DA 3LANA 4TXSA 2VA2A 3MXJA 2R2SA 3DLKB 3HP9A 3AA4A 4OKJA 4B9UA 4O4GA 4I2QB 4FLVA 4M3TA 1REVA 3TWHA 2W9AA 4WXOA 2OA8A 4ZP6A 4ZHRB 1DTTA 3VQDA 3SFUA 4PWDA 3SCXA 1DTTB 4DL5A 4IRKA 4CIFA 2BANA 5HRNA 2BGGA 2UVUA 1XHZA 2OZSA 2AGQA 1WSHA 3PZPA 2IJFA 4DSKA 3MAQA 3VQSA 2B5JB 1D8YA 4MK8A 1C0UA 1F21A 1EP4B 1TAQA 3OYJA 3TANA 2UVRA 1BIUA 3GV8B 4N41A 4CJEA 3RAXA 4FM2A 3DM2A 3TABA 2KW4A 5FDLA 5DQHA 3FFIA 4RW6B 4ED0A 3FQKA 4U6PA 1HYVA 4ID5A 1J5OA 1BHLA 4TLRA 4RNFA 3GIKA 5K14A 2DPJA 5KFPA 1L3UA 3QZ8A 2OPSA 3THVA 4B9TA 2G8IA 2ITGA 4IKAA 4GVMA 4NLTA 4I9LA 4U7CA 2YV0X 5CZ2A 5L1IA 4EBCA 1FKOA 3H08A 4B08A 3CJ2A 3AO4A 5FROA 2IM3A 2IM0A 2BRKA 4AHSA 2FC0A 4K4VA 3SUNA 2PY5A 4ECQA 1C0TA 3CO9A 2EHGA 3OYAA 2YKMA 4GC6A 4O0IA 1C1CB 1TKXB 1B92A 5KFNA 1RYRA 3NBPA 3PW5A 1QE1A 4Q0BB 3EZ5A 3SPYA 3MEDA 4NLUA 4AHTA 1JLAA 3ZT3A 4O3PA 1RAJA 4KHUA 1WAFA 3OS2A 3KTQA 4AILC 4EO6A 3KLFB 1A5WA 1JLGB 5CZ1A 3KHLA 1S6PA 5F8HA 1U48A 1SKRA 5KG4A 1X1PA 4F3TA 2WOMA 2RDIA 1UOCA 1NK8A 2DFHA 1S0MA 2WRMA 5KFMA 1WN7A 4ID5B 2FVPA 1XR7A 3MXMA 4M95A 1BQNA 1WNSA 3DRSA 4KFBA 1BI4B 4J9LA 3CQ8A 3EYZA 1HRHA 3S3MA 4LSLA 1CLQA 2GBZA 1XWLA 1DTQB 1HARA 4WYLA 2OH2A 4CGFA 1JL2A 4HHTA 4NCGB 4BWMA 1VK0A 4CECA 1HMVA 4W5RA 4RW7A 1KLMB 3LWMA 4J9KA 3E01B 1EXQA 5EWFA 2YNIB 1DLOB 4R5PB 4C8NA 4BDYA 3V4IB 3C6TB 1D0EA 3DOLB 4IG3B 1VSLA 5KFZA 1KVBA 4KHWA 3RMAA 2JC1A 4IRDA 3JYTB 4I2PB 3NGYA 1HNVA 3ZSZA 3SZ2A 2JLEA 4QWEA 1RBSA 4J9PA 1RDBA 5JXSA 4DMNA 3L2UA 5HP1A 1X9MA 4PUOB 4PA1A 2ZE2B 5KFDA 4E7JA 3TAQA 4CESA 2X74A 2RF2B 3HVAA 4KV8B 4ZVFA 4NLGA 2KFZA 4HTUA 2C2RA 1MMLA 1JLBB 5EWEA 2HNYA 1EKEA 1UWBA 1CSJA 2HNYB 4CJTA 4FLZA 4JUZA 1KVCA 3KK3B 1RTJB 1RA6A 2XY5A 3SPZA 4KKOA 1RTIB 3N6NA 3B6OA 1GOCA 3SV4A 4F8RA 4ZP7A 3CDEA 2W7OA 3NF6A 1RDAA 3SQ2A 2YNHB 5L1KA 4NCGA 3NKYA 2BE2B 2BQRA 4Q43A 1HJRA 4DLEA 4CFDA 2R7YA 4KB7A 3E01A 1IKXA 4B3OB 1RT1B 5DG7A 4DTUA 2D5RA 2B5JA 4M3XA 4RNHA 5DQIA 4KI4A 4ID1A 4CEEA 4TYAA 1LW0A 1LV5A 4CJSA 1IM4A 1FXXA 4KTQA 4DU3A 1RT4A 1L3SA 2XHBA 4CHQA 3H4DA 2QXFA 5KG2A 3VQAA 4Z4EA 2D0CA 2FLPA 1EP4A 2VG7A 2YNFB 2IA6A 1JLQB 2AX1A 3K59A 4FXDA 5KG1A 5HP1B 3DYAA 4HYKA 3PX4A 1LAWA 4IDKA 5HRPA 5KT5A 2GC8A 3LP2B 3HPGA 5F8JA 3S9HA 3QGIA 2Y1JA 2IGIA 4IDKB 3U6FA 4G1QA 1N5YA 1NHUA 3I8DA 2KTQA 5KG5A 3O4NA 4ZTFA 4QPXA 4TY9A 2R2TA 3ZT0A 4E7IA 3CM6A 4E7HA 4CERA 1NJWA 4CJ5A 1WLJA 4EEYA 3VQQA 1JLCA 1J54A 4O44A 2ZD1B 1IH7A 4RW6A 4RG8A 2DFEA 3MXIA 2HNDB 4I9QA 3CYMA 3OYBA 3CDUA 3BQ2A 4DQQA 2DFFA 4DU4A 3F73A 4ZVHA 2XGQA 5CYQA 3O3FA 3WNFA 5CYQB 3M8QB 3KLVA 3VA0A 2YKMB 3NGDA 1HMVB 4IR1A 3KLIB 1BL3A 1SUQA 3SI6A 2ALZA 3KKSA 4YMEA 3FQLA 4XPEA 2YNIA 2W7PA 4YNQA 1ZBIA 4F4ZA 3SUPA 4ED6A 4CGHA 4OLAA 4MKBA 1S9GA 4FJJA 4IRCA 5C42B 4BE1A 4F4KA 4CJ4A 2G8HA 2RN2A 4KHQA 2BANB 3DMJB 3QIPA 2PZSA 4KHYA 3OSNA 3WNEA 4CF1A 4Q8EA 2XY6A 2J6TA 3WNGA 3QEIA 1N5YB 4CEAA 4NLDA 4CEDA 1JLEB 1LWCA 1JLFB 5F8MA 5HLFA 2P51A 1RT3A 4O3OA 2B43A 2RPIA 2KZMA 1BQNB 2R8KA 2VG5A 3QETA 3M8PA 3HKWA 3KHRA 3AVNA 3NF7A 4JLHA 2HNDA 3SQ1A 4CJKA 3MTKA 3JSMA 1T05A 4ED8A 2B6AB 5KFTA 3JSMB 1S1WA 1YTUA 1RTIA 3RWUA 4KB0A 2ASJA 4AH9A 2ATLA 3O3GA 3MR5A 4KO0A 4E0DA 3HSTB 1FK9A 4KI6A 3AO2A 4CIEA 4CEZA 2E9TA 2YNGB 1U45A 3NL0A 4CGIA 4Q5VA 1DLOA 2QE5A 4CEOA 3MR6A 4ECYA 1S1VA 4ECWA 1SKWA 2PYLA 4Y34A 3NAHA 5KI6A 3LPTA 3G0ZA 2XY8A 4OPJA 3FSIA 2BR0A 1SH3A 3K57A 4CJ3A 4FW1A 2AQ4A 4FLWA 1JLBA 1ASWA 1GOBA 4LY7A 1GX6A 3B6PA 3NAEA 3ZSWA 2P1JA 3M9OB 3CFOA 3ASMA 2YNFA 4NLVA 3C95A 3D5MA 3RMDA 3K5NA 2HHSA 4QWAA 4MFBA 1QTMA 3NFAA 3NH2A 3L2WA 3HJFA 2R8HA 3D0PA 3QNOA 3DRPA 1T03A 4CFAA 3K2PA 4J9OA 3OL9A 3ZSYA 1MU2A 4J9MA 4CFBA 4JRPA 5C25A 1T03B 3G6XA 3OYKA 2AGOA 4K8XA 1S1UA 3OSPA 3IS9B 5KG7A 3ITHB 2BRLA 1T8EA 4MIBA 4NLWA 3D45A 4DSLA 4CFCA 4AHRA 4JRQA 1W25A 1RT2B 4M3ZA 3ZSQA 4MK9A 3KD1E 2D3ZA 5HRRA 1Q9YA 3LZIA 3NH1A 3ZT4A 3HXMA 1Y97A 3LWLA 1S48A 3MR3A 1Z26A 3DLRA 3SQ4A 4QAGA 1RA7A 3C94A 3AVMA 3VQCA 3I0RB 3KNAA 2J6SA 2X6NA 3TQ1A 4J9QA 2E6LA 4Y3CA 3VQ6A 3CM5A 2KQ2A 2IDOA 3ZCMA 4FK4A 4FJKA 1TL3B 1BIZA 2GIRA 3QGGA 3AVIA 4IKFA 1ZBHA 3RRGA 3OHAA 3HPHA 1VRTA 2IM1A 5I3UA 3V9ZA 2IAJA 3AVLA 4NCAA 2CJQA 1S6QB 3MEEB 3V6HA 5I3UB 4DEZA 1NK4A 4R8UB 2OPRB 4BDPA 3T5HA 4ZP8A 2YKNA 3TAMB 4M45A 3DM2B 3LALA 3OYIA 1NK0A 4AHVA 1C0TB 3DI6B 3OYNA 3QEWA 3N6LA 4F2SA 4BDZA 4PWDB 4IOBA 4KHNA 1HPZA 3NGIA 4RW4B 3DOKA 3G10A 4C8KA 4DSFA 3SJJA 1HPZB 3EZUA 1RT7B 3AVJA 3UDLA 4JV2A 3KKRA 4URQU 3BQ1A 1NKEA 2Q3SA 2VG7B 3KIOA 3RBEA 3OYFA 1LWEB 2I1RA 4RW9A 1Q8IA 3ICLA 2Z1GA 2O4GA 4EP5A 4FZZA 2P5OA 4ED2A 3OVNA 4O4GB 1NNDA 1YT3A 4E1MA 4BWJA 4CF8A 1J9AA 4J9NA 2R8GA 3OYDA 3V6KA 4RZRA 4RUCA 3NBPB 4WFYA 5I42B 1T3NA 3M9MB 2HHWA 5J2MA 1WNEA 2FJWA 4FJLA 4EBDA 4OLBA 3DMJA 4JV0A 2G8UA 1KHVA 4O5BA 1VRUA 4OVLA 3DRRB 3D28A 3NE6A 3TAMA 4MKAA 5HBMB 4LSNB 1R0AA 4DL3A 3L3UA 4HUEA 4LSNA 2YNGA 4NYZA 4C8LA 3SI8A 2QK9A 5J2QB 4QWBA 1C0MA 1CZBA 5FRNA 4K8ZA 5C42A 2RKIB 3H5YA 2HHUA 3E51A 1I6JA 2BDPA 4Y2CA 4ECSA 1RBUA 5KFWA 1RDCA 3ZSRA 1XC9A 1NK7A 3HT3A 4KE5A 3CWJA 4ZTJA 5KFGA 4JV1A 4CJUA 3H40A 4YR0A 1ITGA 4YP3A 4E7KA 4FJHA 4KREA 4DL7A 4PUOA 1RBTA 4Z4FA 2E6MA 4DQRA 4CK3A 3RRHA 2W9CA 3T3FA 3BSOA 1JLGA 4DSEA 3VQBA 4KFBB 3ALYA 1N4LA 2GUIA 5KFUA 4TQSA 3QEVA 3VN5A 2R8IA 1VSHA 3PHEA 1S10A 4J2AA 5T7BA 1N6QA 2IAJB 4QW9A 4QWCA 1S6QA 3MEEA 1CXUA 3EPGA 5F8IA 4RUAA 4IBNA 4J2DA 4Q8FA 3TAEA 4OKKA 3PJWA 5KT2A 1JLEA 4F3OA 4FS1A
chains in the Genus database with same CATH superfamily
5M1FA 2B4OA 5C10A 4DV1K 3H90A 1IKWA 1LXNA 4XDDA 4DQ8A 1JKHB 4FLYA 4B1VA 2CKWA 1JKHA 3QO9A 2J0QD 3THXA 3F0NA 4M3RA 1XQSC 2GA7A 3MDFA 4CZIA 3MPYA 1Q86T 4TKTA 2G8VA 4W5QA 4NYFA 1RWNB 2HHPA 4LRCA 2NYIA 1QVGR 3LTOA 3KMSA 1EETB 4M42A 3HFZB 4ILRA 1WUUA 1TKTA 1C0UB 3VPZA 3FMWA 4DUYJ 2CQBA 2W2OP 1OYEA 2JWNA 4MQ3A 5FRMA 4RR5A 4JS5A 2HF3A 1HI8A 2KYZA 4AXIA 4IR9A 4LF1A 4DFJA 2HHHJ 3FCVA 2F65A 3SQOP 4K4ZA 1OIAA 1L5UA 2E7VA 5GAEU 2KJWA 5AQGA 1RU1A 5KT7A 3ISND 3BYPA 2FJBB 4WFAQ 3MTJA 3L2QA 4ZN3A 1NZ8A 4IH6A 2PI5A 3QBWA 5AQNA 4NCBA 5T7LB 2ZDOA 3K5OA 1I51B 1M5SA 4H0OA 2FHJD 4MAKA 2XSFA 2R7SA 5AXKA 2VU5A 3BYRA 3FCWA 2JJ4D 1RTHB 1JXBA 2YNHA 5IM0B 3TAGA 4NE9C 2EPIA 3TUZC 2KXHA 4DTPA 4L76A 5CAAA 1EX4A 4RLEA 4ICLA 2HLTA 1YXQA 3NCPA 2C22A 4QIVA 4TNOA 4JKGB 4G1PA 3UI3A 1RT2A 4F67A 3LDOA 3EN9A 5D3GB 2JGUA 3NCIA 4CF0A 1ZAVA 1IM6A 4K4SA 4J2BA 2WK4A 3RMBA 4LF5J 3CJ4A 2XYGB 3Q8UA 2BQUA 1N8RT 2CQ4A 3BSNA 2XC9A 1N36J 2MSTA 4AQYF 5ETLA 2MZSA 4FXWA 3AJ1A 3AVHA 2NZTA 1HNZK 1U1RA 2Q3PA 4A4JA 1RCOB 3Q8SB 3H8YA 1T7PA 3RTVA 4WP8A 2G2OA 1NJYA 5LMUJ 2RIJA 4C6AA 5GIOA 2FB0A 1YJ9S 2VGNA 3DLGB 1MA9B 2OANA 4DV2F 1T94A 3CI5A 3DLGA 4X4NA 3M1FA 3M8SA 5EX3A 3LP1A 3VQTA 4FF3A 3H1VX 2F8SA 4AL6A 2OTJN 5GADU 4BRPA 3P3DA 4IWVA 3RMCA 3OTBA 3VR1A 4ISEA 4YEAA 3OR2B 3MEDB 3HVTA 1NOZA 3TA1A 4JI8J 5CQGA 2FHMA 2DNOA 1Z05A 2KT5A 1C1BA 4IJAA 1O1WA 4MO5A 2AJQA 1UW4A 1SUQB 1HNIA 1HWIA 2HRTA 4CNZA 2ROPA 3J7ZT 3KWGA 3KK7A 2WBRA 1S9EA 3EMTA 1MU2B 2YCHA 1S0OA 5L46A 1MG7A 4XDCA 2BA9A 3K58A 4ATNA 2JH3A 3DU5A 1SIWB 3QRQA 2YQ0A 3MM5B 1LWFB 3CVKA 2Q0UA 3IA0A 2NLXA 5JICA 1R27B 2P9LB 4B9LA 5HSPA 2DNNA 3LGHA 4XH1A 2CPXA 5CD4A 2ZHAA 3THYA 2BM0A 4Q7AA 3CDWA 2DY4A 2HBYB 3QAEA 3KJNB 2FGCA 2HVIA 4JKEA 4RU2A 1B9FA 1XMBA 3L8BA 1WSVA 2E9ZA 5CHIA 3MM8B 1TUGB 2VFTA 1QHAA 3O08A 4H8KA 3KLHB 1BC6A 2CG8A 2CJ9A 2A41A 4CJLA 1KLMA 2O8EB 2M5YA 2DR6A 3JSRA 4ECVA 2XYHB 2KFNA 4HL9A 4Q0BA 1FFWB 3VWSA 1UKUA 1KRPA 5DGAA 2GCFA 1UAXA 2C3OA 4C0BA 4PHTX 5CY4A 3SCLE 1AW0A 1CXQA 3GLJA 1S0NA 2CNOB 5BYQA 1N8RO 4USUA 4KPCA 3NGSA 3DYAB 1N0VC 4IQXA 4W90B 3V1QA 1U49A 4IJNA 2WTFA 1KNZA 2Q79A 3C2PA 3CNQP 1SC3B 1WELA 2EKYA 4LREA 4DTSA 3T1YF 3QIDA 4W5TA 4N56A 2DRAA 1JXEA 3P39A 2VDIA 4M5NA 3BGUA 3VVTA 3IGVA 5CYJA 2ZBQA 4U96A 3EPIA 3CCSS 2DKOB 2KXNB 2W42A 2E5GA 2R3VA 1F5BA 2F8EX 2OHDA 4LIRA 5GIPA 1BXNA 4TYBA 3KDNA 1RT1A 1XR6A 1Q79A 2YWKA 2IA0A 4LQ9A 2ZH4A 1T02A 2KG1A 2NYHA 4DQIA 5KT4A 1IXKA 4J9SA 1RKJA 3OY9A 3OYEA 4HVJA 3A5NC 1KFSA 2HMIA 1F2GA 5ADXH 3RYLA 3GR1A 5KFOA 4ZLLA 4CBXA 1FFSB 3H0PA 1Y9OA 1Y10A 5DETA 4C98A 3D1QA 2HVZA 1FVQA 3UE5A 2MEWA 1F5CA 2HVHA 2NRTA 3I0SA 1RAFB 1BU6O 4BE2A 4RW8A 3WXMB 2VC1A 2HQFA 4NO7A 4Z4GA 1H2VZ 4X65J 3DLKA 4USIA 4FJ5A 4IFYB 3LL3A 4YOWA 3MCMA 1D9FA 2OSRA 3Q7BA 3H98A 4DG1B 1JLCB 1YBUA 2EFOA 3T5KA 2PYJA 3KMQA 1TKXA 2EG2A 2E1RA 2RMLA 2XCPA 1XMQF 1M5VC 3OL6A 1Q81O 4HWIA 3TU5A 1FRIA 4Y2IA 4NLOA 1XHXA 1P27B 5DDPC 1D5AA 1BISA 3L9ZA 3CCLS 1UZHA 5MAOA 2GFFA 4R5PA 1X4FA 3OJUA 2QA1A 5LMUF 1X4CA 2ZH5A 3UD4P 3DOMA 2CAJA 1E6VA 3DLLQ 2ILYA 1NU4A 4URSA 2OTJS 1D1UA 4YB1P 4GVEA 5KRSA 4JI7J 3R9PA 2B9WA 2XI2A 3KWIA 3J7A1 1W2BR 1YJVA 2JEFA 3OJSA 2JC0A 2D0BA 3PSFA 1O6XA 3BR8A 3OYCA 2MHEA 1JXLA 2E5JA 4EIAA 1UWBB 2A1BA 4E7LA 5AQXA 1Z6RA 5CXTA 2V9WA 3CXCM 4FL9A 1JJHA 1OY8A 3U9DA 4B3TF 4NEYA 2OSQA 2X6SA 1BG3A 2J0XA 4ANDA 2KH9A 1PYSB 3GV7B 3VALA 1URRA 1KC8T 4B9QA 2VA3A 3GILA 3HHNB 4B9NA 4DR1J 2FD2A 3OLBA 3VA3A 2NSBA 1RABB 1BQMA 1HWJA 3W3DA 1QAIA 5BPMA 1LK5A 2IFXA 4NXNJ 5EU7A 3TA0A 5E0OA 3O6WA 1OYDA 5AE1A 5KFYA 4FBTA 4A62A 1H73A 1B9DA 5E84A 3HHLB 2EFNA 2UV8A 5AQHA 2R7QA 4RNNA 3OV7A 1VQ4N 4M5GA 5J1EA 5HMYA 3EVMA 3P4IA 3N6MA 3CF5L 5IS2A 3G6EN 2YPYA 3O1BA 4JI1F 3G82B 5IWAK 4OL8A 4X66F 3AFGA 5KFKA 4DI6A 2Y0SD 3CSKA 1H3DA 3AA5X 1IWGA 4XK8C 5DLGA 1K9MO 3H5UA 4YR2A 1JIHA 3DHWC 3JSYA 5GAHU 3ITHA 2CPIA 4ICLB 2ATCB 4W92B 2EBGA 2UUBK 1NBWA 1DRZA 3PV8A 1WG5A 3KJVA 1FKPB 5ADXA 1KVJA 1AROP 4RWXA 2RHQB 2EC2A 4F4WA 1FKPA 4Y0FA 2KDOA 1NK6A 4X64J 2E44A 4IOAL 2GVDA 2RUSA 2OEJA 3PYGA 4CM0A 4EK2A 2VF3A 5A8WA 1SJFA 3RB0A 1Q9XA 2P9GA 4Y1CA 2XMKA 2CJAA 2PA8D 5IWAJ 3CHWA 3A5OC 3PG9A 2FLLA 4KJIA 1HW9A 3G6VA 4KH4A 3Q8YA 4KSEB 4N76A 1KKHA 4NXNF 1DGKN 1Q0NA 4DV7K 2FBVA 2VWJA 2DXEA 4PQUA 2CWKA 3AGKA 4A8FA 1KQKA 5BXIA 3DLHA 4DTXA 4K4TA 1HBUA 2CNLB 3SQGA 2YKNB 4KV8A 4OHVA 1OWXA 4HI1A 2YHBA 2QIFA 4M3WA 3H3OB 1SQKA 2P9SA 3DGVA 3HI9A 5KFLA 5KFRA 2EW9A 1U04A 3QO9B 3TQEA 5IT4A 3LPUA 1WI8A 2LQ5A 2GAGC 3CIMA 5AXNA 3VEYA 2Z1HA 4F0HA 2P5GA 3NDKA 2LEBA 1R43A 4LF5K 2PN6A 2I6WA 3B8AX 2DCUB 3ZTSA 4XH5A 1KBRA 1N34F 2Z2MA 4ZJOA 2IRXA 3I5CA 5KG0A 5MLCV 2ZH8A 5T41A 2BJ7A 4DFKA 3ET6B 4BVOA 3HVWA 4P2XA 1WC3A 2P9LA 2JEJA 3CJ9A 5HAOA 2CPZA 2R42A 2WONA 1BI4A 2FJVA 2O8DA 2XMAA 2B7BB 1S97A 4CEFA 1M90T 1RHMB 1UA0A 3J7Z5 3MX2A 1IO2A 3KHHA 2V6AA 1WC1A 3AVFA 3KK1A 3GFZA 2E4LA 2X3DA 5CHCB 2Q0RA 1LEOA 3M8PB 4DN0A 4DR2K 4S0MA 4P74A 4PYDA 3K9JA 4NA2A 2HGMA 4M63A 3LP1B 5A6PA 5FJ4A 2WBNA 1BOTO 3WXKA 2V4JA 1VOMA 2XCAA 4JKGA 2QKBA 3CCMS 1WKKA 4DUZJ 1VLOA 2UUBF 3I8BA 4CJFA 2WVEA 1SC4B 1HQUB 3GFYA 4YR3A 3C15A 4C0HA 3M8QA 2LYVA 4KQZA 4KHSA 1YI2N 1R7IA 5SZTA 4WYWA 2ZHBA 3LDNA 3HM9A 2EK1A 4PXDA 2W9CB 1ITPA 3UD3P 1ZXOA 1K1SA 2MKIA 1A0OB 1SQFA 1IN0A 1VSFA 3DRSB 3D2EB 1KQGB 5J1PA 1FVSA 3NGTA 3E9OA 3KK3A 4EU0A 4USTA 1S1TB 4L73A 2I8EA 3DDKA 1DURA 4ISGA 5AQQA 3TYTA 2AP1A 1Y0HA 2R2UA 2PC6A 1S72N 2GNKA 3CJ5A 1GLJO 3KLGB 4UW2A 3TSUA 5TKYA 3GJRB 4IOAQ 2D3O1 2E2PA 1KOOA 2XMTA 1BY9A 1Y3JA 2EWHA 3CCRN 3BDEA 3CJSA 3VAKA 4TN2A 3BJYA 4MH8A 3FNNA 5KOXA 3FBEA 1CJVA 1Q1KA 4OYAA 3TARA 3OXGA 3MFIA 2ZWPA 3PW0A 3ILIA 1ZBTA 1P1TA 3ZETA 3PDNA 1BWEA 3GDQA 4WE1A 3ILLA 2ZOFA 4KRFA 4KHRA 3MF5A 4BHQA 2W8LA 2M88A 5EWGA 1T6DA 4K0KJ 5DG9A 4X62J 3MEKA 3PSIA 2W8KA 1S59A 2R7UA 4U95A 1S6PB 4X66J 2DNYA 4NWBA 1R8BA 1U47A 1SXLA 5FPNA 5A0YB 1ZM2A 2J9DA 2XMMA 3LO3A 3A1YG 1ZETA 3T1YK 1AXQA 3LPEA 4UOCA 3BF3A 2QA2A 4TY8B 3TO8A 2B4JA 3T5LA 3MMVA 3UR3C 2FUG9 3HHKA 3L3CA 2ZDPA 3LDPA 4P71A 3V4MA 4LF7J 3NNHA 3B54A 3M6WA 3O4WA 4DV6F 2OPQA 3P8BB 4U7UK 3LANA 4TXSA 3MXJA 2PE8A 4LRFA 1MWMA 2XHCA 2VGMA 4M3TA 4DX8H 3WZ0A 2R4FA 3K9KA 4ZHRB 5I4MA 2VIHA 2FYXA 2ZOMA 3NVKA 5EY4A 4DZ6A 3D3CJ 3FK4A 1Q4RA 4P7TA 1I94J 1TYQA 3O9RA 3VCDA 1UPMB 2H3EB 3PZPA 4DSKA 3AT1B 2X1GA 5EGYA 5LJVA 3VQSA 5HQ8A 3MPWA 4MK8A 3MWPA 4LFAJ 1S72S 1LXJA 5HMZA 3VEZA 3HHLC 1B7YB 3DRYA 3PYFA 1TFWA 1RI7A 3RAXA 1KQFB 1NWKA 2KW4A 4JI8K 1H98A 2E8AA 1HWKA 2N4DA 4U6PA 1Q95G 5HMXA 4ID5A 3UDVA 1J5OA 2DGOA 2VICA 1A9NB 4YB5A 5KFPA 3ATVA 1CQMA 2AYMA 4BROA 2G8IA 2ITGA 4IKAA 5CZXA 4NLTA 4DCPB 1WEYA 4X4PA 4U7CA 1UJ6A 5CZ2A 3MD3A 1R8PA 2YKOA 2IM0A 2BRKA 4CYUA 2PBDA 3SUNA 3VEOA 3POTA 3PM9A 3OYAA 4RUHA 3CCMN 2QJ3A 3LDLA 2O8FB 3AB4B 1NMNA 2VUGA 1RYRA 2OCEA 4WU3A 3NBPA 3PW5A 4K41A 5G4DA 4AF1A 4NLUA 1JLAA 3C3LA 3JTNA 3WEEA 2GS8A 4P2MA 2X7IA 4Y2KA 2J7WA 4QZVB 4CQ1A 3KTQA 4AILC 2M9KA 4EO6A 1JLGB 1VQMN 5ETNA 2KI2A 5F8HA 1U48A 5M2UA 4H5NA 3B78A 2WOMA 2B4UA 1S0MA 4ID5B 2FVPA 4OYMA 1WNSA 2MDAA 3I56S 2J0WA 2HQCA 1HRHA 1MWQA 3VGKA 1WKLA 1ZH5A 4LF8K 3A4TA 4DV3J 3TTDA 3CPWR 2GBZA 4F3MA 3AOAA 1ILYA 1XWLA 2ZWOA 5CZVA 1D8ZA 4DR1K 1JL2A 1O51A 1YF5L 4BS2A 4CECA 1HMVA 4J9KA 3E01B 2LFVA 2AJ4A 3UE2A 3NGKA 4QYZJ 3H1QA 1RXOB 1AB8A 3PRVA 2KRBA 1VSLA 2FIUA 1YSJA 4IRDA 4LF8J 2A2DA 4I2PB 1HNVA 3ZSZA 3AODA 1JK9B 1NMDA 5IZHA 2JLEA 5AJ3J 2VASA 4GKJK 2KO1A 3UKUA 2IVPA 3I87A 3TAQA 4E7JA 4CESA 2UP1A 5BN9A 4KV8B 3AOBA 2KFZA 3I4HX 4HTUA 3NG8A 2P8IA 1FI4A 3G82A 3NGRA 1JLBB 1O8BA 2MKJA 1EKEA 1UWBA 1EWQA 1CSJA 2BEFA 4ZLJA 4OJHA 1P8GA 1F9EB 4JK7A 4FLZA 4JUZA 2VB6A 2VPYB 3SPZA 3TUIC 2GV1A 9ATCB 3ZZOA 3SV4A 4ZVRB 5AE3A 3NF6A 2C42A 1RDAA 2MXYA 3NKYA 1HJRA 5KQ8A 5DDRC 3U4LA 3GJTB 3J7YP 1BWVA 1FERA 4H0PA 4OMFG 2D5RA 5IFMA 2GUPA 2LDIA 3BO3A 4KI4A 4ID1A 3I9ZA 1XQIA 4QBUA 4CJSA 4Z37A 1IM4A 3WC0A 4DU3A 1RT4A 1M1GA 3NRBA 2CQDA 4DV4F 2XLKA 2VWBA 3MUVP 5E3PA 1T95A 1YIJS 4F0KA 2Q66A 3BV8A 1EP4A 2VG7A 4PG8A 4FWSA 2AX1A 3K59A 4C48A 3PKYA 1Q5VA 1NUEA 4X4SA 5KT5A 3LP2B 3SMPA 3S9HA 1N5SA 3FZKA 2V7YA 2AJFE 3T6BA 2DNQA 3CO0P 3KG1A 2M3DA 1VQ4S 2FHOB 3M6VA 2R2TA 4E7IA 3CM6A 3H3NO 4E7HA 2J76E 4MLHA 1FWPA 4DPOA 1WEZA 1XERA 1IH7A 4CI0B 2QEXS 4RG8A 1JCEA 1HUXA 2HNDB 1FRXA 3CYMA 4DV5K 3EVOA 2UXBK 2RQMA 1HA1A 2IDLA 1NGFA 2DFFA 1VQ6N 2DNHA 5HO4A 2EVZA 4ZVHA 2HFSA 2XGQA 1TU0B 2G13A 4CLYA 2CQCA 3Q89A 5CD4H 4JI7K 4UOFA 3M8QB 3KLVA 1KQSM 2YKMB 1XTZA 2M52A 1V5VA 2U2FA 4KGXB 3MMAB 1SUQA 3CJCA 3VAFA 2FZCB 2BX6A 4YMEA 4XPEA 2W7PA 2ZEJA 4F4AA 1XMOF 1XBWA 3QMQA 1FX2A 3A3PB 4NX9A 1S9GA 3TPQA 3WHIA 3D2FB 3ENQA 3MD1A 3QSIA 1IBLJ 3J7AN 2P5VA 1LWXA 2PZSA 3EXCX 2KRRA 3AARA 3F44A 2EBEA 2Z8QA 2GQQA 5FPEA 3C15B 3BM7A 3QEIA 4UT4A 2QA4G 1MWZA 4Z7YA 1JLEB 3UKRB 3OR1A 1BQNB 2FF3B 2VG5A 3QETA 1TFYA 4P2FA 4J5OA 4JLHA 3SQ1A 4CJKA 3MTKA 1T05A 2WC9A 3RWUA 4IDHA 4WTYA 3I33A 1U2VA 3O3GA 3HFVA 1MW7A 5AQJA 3HSTB 3LW5C 4WU2A 3HTVA 4CEZA 5BPLA 3NL0A 4OI3A 1XIQA 2QE5A 4K8RA 1VQ6S 4ECYA 1S1VA 1QJHA 1KN6A 1VIOA 4Y34A 1UVJA 3G0ZA 3BY5A 4OPJA 3FSIA 1SH3A 4CJ3A 4FLWA 1Y5IB 5E26A 2P1JA 3M9OB 3CFOA 4OZ2A 4NLVA 3ASMA 4JV5J 2Y8WA 4KHPF 4TVAB 3RMDA 3HCXA 1PJ7A 2KHCA 3QNOA 1T03A 1RDWX 3OL9A 3BEGB 3AQOA 5C25A 3FKBA 1QAYA 3OFFA 1OKJA 5HQLA 3HULA 2AGOA 3IS9B 1EQMA 2RVJA 3OFHA 2NRVA 2IVOA 5FLXU 3ULEB 3ULEA 4AHRA 5AJ3F 5FD1A 3AD7C 2BJ1A 2P9UB 2AZ3A 3K17A 3CCWA 1Q9YA 4RX6A 1VS3A 1S48A 4L72B 1Z26A 3PYDA 3C14A 3SQ4A 5LSRA 3C94A 3ZTRA 3I0RB 4G9ZA 2X6NA 5D15A 2L3MA 3ZX3A 2B51A 1TUWA 2BACA 4FJKA 2GIRA 2E66A 1AT1B 4TU9A 2QFJA 8RUCA 5E33A 3IBFB 4FXVA 3EX7B 1XNRJ 4F25A 3N4PA 2CJQA 4A5BA 2MQ8A 3V6HA 2VOOA 3O5TB 5I3QA 5LOQA 2OMOA 4X4VA 3TUJC 2P9PB 4OHXA 1EWRA 3TAMB 4KT0C 1D3WA 4UZBA 3OYIA 1NK0A 3UNGC 2MLZA 3OYNA 4GVLA 3R5AA 3QEWA 4IOBA 5C2DA 1HPZA 4RW4B 2BH1A 5FLXY 2DNPA 5C12A 1CC8A 2DO4A 3ULHA 4FPIA 5HMWA 3CCVN 4O5FA 3CCES 1LWEB 1KVKA 2ROEA 3ICLA 3FZBA 5D6GA 3L4IA 4ED2A 1TYQB 3OVNA 1YBAA 3KUHA 4K42A 3J7YI 1NSPA 4MJKA 2BE7D 2RQCA 1JCFA 1RWWB 4CO5A 3CB4A 3OBIA 1WNEA 2FJWA 2DY9A 1NGHA 3G8TA 3DXMB 4OLBA 3DMJA 5ETPA 5AR0A 4JV0A 4PYAA 4CLWA 2ZJQQ 2G8UA 3HSCA 4GO5X 3NE6A 1RBAA 3TAMA 1NSKL 2V63A 4LSNB 2XSJA 4JI6F 4LSNA 2YNGA 4NYZA 5J2QB 1SZ2A 5BYSA 1C0MA 3IDHA 1CZBA 3E66A 4K8ZA 5C42A 4ZIWA 2LQ9A 3RAMA 1K8KA 3OXFA 2RSQA 2PEBA 4Y2CA 5AZIB 2E1MC 4CLZA 4QS8A 4DV1J 4CJUA 3C46A 2YI1A 4DX5A 2ZJPL 2LU2A 2QWLA 4ZPWR 2GVZB 1G6BA 3ALYA 2DH9A 1P90A 2IIRA 2GUIA 3DU6A 2O8DB 3QEVA 1C0FA 5IC6B 2ZH6A 5T7BA 1U1QA 2E1YA 1CXUA 3CPWM 2MGZA 4ZKAA 4IBNA 4J2DA 1WOQA 2DIUA 5GADI 3BKFA 2QA4N 4FS1A 2E7WA 5ETQA 3IRXB 4LF9F 5JVGQ 3CCQN 3AAWB 4TQRA 3D68A 2XTJP 3MMCA 4JI0F 2R7OA 4QW8A 1KXPA 1T9XA 4ZPCA 4FOEA 4YFUA 1QVFM 4CO3A 5HANA 1IBLF 5DK5A 2Z1IA 2L9WA 2IJNA 3T9NA 3UO0A 5JS1A 2QV6A 3GJSB 4IH5A 2V68A 1WF1A 3Q8RB 1ULRA 3KK2A 3SAHA 4LQ3A 4HTLA 1JLQA 4GMJB 4X4UA 3KK2B 3M7VA 2F9DA 2MKSA 4V19S 3PRDA 3V6DB 3PLAA 3WXJA 3AY0A 4QIFA 2YH1A 4H0TB 3V1OA 3OHBA 4B17A 1R0BG 3AAPA 1WSEA 3GFXA 4NRTA 4JKFA 3C65A 3AXKA 4LF6J 1VRTB 1H0HB 1C4CA 5LMNK 2ZFHA 3DXKB 2H65B 5G0RB 1CQNA 1BD6A 2M70A 2VQFJ 1BCOA 2YJEA 3SCJE 3TVKA 3PEJA 3SQ0A 4LF4K 1SJ3P 1G99A 2Z2ZA 1TTHB 4N5SA 4KHPK 3DLLL 1FDNA 2NUUG 1VC0A 3ZT2A 4RW8B 3AV9A 4OV1A 3VGVA 1HWUA 2RT3A 3TJ9A 3EKUA 3TR8A 4C8MA 1GOAA 3R6LB 5E41A 1N36K 2OEMA 3IWNC 4DLGA 4USKA 2R7WA 4FF4A 3CIZA 4KKOB 2V4JB 4EO8A 4E3SA 1XJWB 5HOOA 3KJVB 4DL6A 3NY0A 1R8AA 2L41A 1CULB 4F36A 5KFSA 3J7YU 1RWKB 5K8MA 1FNXH 2UUBJ 1FDAA 1VSEA 3H20A 1G7CB 1C1BB 3BH7B 1NO8A 1N34J 4JKBA 2DBBA 4IOCL 3CJ7A 4O8UA 1NZAA 4YQWA 4KGMA 3L3VA 2KB2A 2EC0A 4DR4K 5JUMA 2ASOA 3OBYA 2BKOA 2P9KB 5KFQA 2XGPA 3SCKE 3RU0A 1RT7A 2A1RA 1RJJA 4ED5A 2QWQA 4OYBA 1QSSA 4CIGA 4B3RK 3M1VB 2DNMA 1VSMA 4GV3A 2NRHA 5KG3A 3JB9k 1YJ9N 2LEAA 3JS6A 2DHXA 2QMXA 3DLBA 2W2NP 5DGBA 1WHXA 2MMYA 1G3OA 4RBTA 3BUZB 2F5GA 3D6MB 3QJJA 3E8OA 3TR5A 3THXB 4OPKA 2DD8S 1C1AA 1S1WB 1UJ5A 4XEIA 4WIQA 4FYDA 2WHOA 3ENAA 2VYPA 1NLVA 1X4GA 1WSFA 3HFKA 3MUTP 4JI2J 1K0TA 2P9NB 2VBXA 3LZJA 2RF2A 2I9SA 2AA4A 4W5NA 3TJ8A 1TQLA 2O1PA 4F26A 5IWAF 1IG9A 4Y00A 4H4MA 3W0LA 4O3QA 2A5XA 2G8FA 3MM6B 4J90A 3LP0A 1TL1A 1WC5A 2LSNA 3AVAA 4DQSA 1OSCA 1YITN 3THWA 3C16A 1V5IB 3SMZA 2ZM6J 1HLUA 1RTDA 1FW6A 3DXBA 3RAQA 3CDBA 2KVQE 4GVBB 1D4XA 4P10A 1GLCG 2W4PA 1TV6B 2YHWA 4HACA 2XHWA 3PW4A 3I55S 4QJVA 2K7KA 5HROA 3A5LC 3BZCA 2HWHA 4L8RB 1N36F 1QE1B 1VK8A 5J2PB 2Z56B 4X65F 2HHXA 4K0KK 2DR9A 1FJGK 3WQPA 3UIQA 3SK3A 1VC5A 3NOGA 3VAJA 4HH0A 4O8KA 3V9XA 3DLEB 4P6QA 4FYXB 4FJNA 1S76D 1KC8O 5K8NA 3VOVA 2AYBA 2CQIA 4BG9A 1QS4A 2V34A 4DUZK 1RNHA 4OZ3A 1FJEB 4CT9A 5F8GA 3PFOA 4DDFA 1XMQJ 3TTFA 4IFYA 4DQPA 3S41A 5KPRA 3UQSA 4C8YA 4O3NA 4JK9A 1T05B 3E1YA 3EGZA 2XI3A 1ELOA 3AA9A 4CF9A 5D77A 1JJ2R 1TGOA 1SIZA 1HQEA 1BE4A 3QLHA 4NI2B 1MN7A 2ATQA 1VQ7N 4RW9B 4RKUC 2P9UA 4OX9F 1RSCA 5SWMA 3T5JA 3T7ZA 2VWKA 3AQPA 4O0JA 3D7SB 1KVIA 4DV6K 3LOUA 4OZNA 2JWLA 4IUFA 4P75A 3I4PA 1MLAA 3U8XA 5LSLA 1VQNS 3CMAS 3AVCA 4I2PA 4Z4IA 2BVZA 2H5EA 2O4IA 3TJAA 3W62A 1JMTA 4OLPA 4DV5J 3MPUB 5KFBA 2H54B 3VQ5A 1GLDG 3O5BA 1N5QA 5HN0A 5LXRA 3PY8A 1X9WA 4LC9B 5A2QU 1HHTP 2EX3A 3HPOA 1QQCA 3PUFA 3O3HA 2ASPA 2C2ZB 1IBMF 2NRRA 3D6RA 4IXCA 4DG1A 4GV6A 4DV0K 1GK8A 2KVIA 3IR7B 1J6ZA 4I7FA 4OZ0A 4DS4A 3JSBA 4ID8A 5KTQA 3NCQA 3EE8A 2A6MA 5LMNF 1YVUA 1Q86O 3PX6A 4GNIA 3VGMA 4E89A 1J5OB 1Y00A 4EYHB 1VQMS 2C2DA 3J7ZO 4G65A 1EKSA 1KONA 4FW2A 3CCQS 2VOPA 5A6WA 2WFBA 2MJNA 2ZVIA 5B0DA 3VQ4A 3WQTA 3LDQA 3O1LA 1VFJA 4BC2A 5HVGA 3KLHA 2UVWA 4FSVA 1TKDA 4NLCA 4FJIA 3P5TL 1FE0A 3CCTA 4OI6A 2YHAA 1X5OA 4OZLA 4CZHA 4C4WA 2HW3A 3D3BJ 4BGAA 3MK6A 1VJQA 3M8YA 5F0XA 4QR1A 1JX4A 3BGRB 3MCOA 2B4VA 3UNYA 3Q8PB 2J5AA 2JEIA 4NZ6A 4CVNE 2LECA 2JRSA 5H9EK 1HBNB 2HS3A 4C0OC 2W9BB 3R5DA 3KFWX 3W5XA 1Z1ZA 1KHWA 4M3YA 4FZYA 1LWFA 2E1AA 3CMAN 2EXUA 5DM6L 3J80Y 3KLEB 2QRRA 3ZTQA 1DQ8A 3A13A 1UTAA 3QINA 4LVNP 4K4WA 2KZZA 3IR5B 5I42A 4IFVB 1U8WA 3HHDA 2WOMB 1WOOA 2NUHA 1J53A 2FLOA 1OQ3A 5J2QA 4ENOA 1XC3A 3QWUA 2JHEA 2RE2A 3KDOA 4ES3A 3BDPA 1HYZA 3G4SS 3MCNA 3V81A 1NU0A 4CHZA 1RT6A 1HBOB 3VF6A 1FDDA 2ROGA 2RRNA 3CJQA 1JXVA 1W0HA 4ED3A 2CQ2A 1PC4A 4OI1A 5LJ3Y 4ECUA 4RBUA 3CCRS 3LPYA 2DO0A 3VQPA 4CZKA 2XS2A 1ASUA 3CJ0A 4JYAJ 3TNVA 2VHGA 1ASVA 2GVZA 5JLFA 3QJLA 2FVCA 5HVFA 4CHPA 4MIAA 5RUBA 4ELVA 2ASDA 4Z4HA 4LRAA 3T69A 3HVRA 1S1XA 5CYMB 4M5LA 4WFNL 4MYUA 4LBIA 2FY1A 4ES1A 4Z4CA 1X7VA 1GLFO 4GC7A 4DFMA 2AD9A 2AT1B 1ZBFA 2MZQA 3ZETB 3VQEA 3PFEA 4CHOA 2ZITA 1TKZA 1U4BA 3V1RA 4A46A 4XIUA 3O1WA 3CD6S 1SJRA 2Z2LA 2IC3A 3A2FA 1ZBLA 3NWGA 4CJQA 2H1YA 3IUCA 3OTCA 1RHKB 2IC3B 1FD8A 1QLNA 2HHQA 1SS6A 5D78A 5ETOA 4FJ9A 3QGPA 5CCLA 4NLQA 4QOZB 2HRUA 4DR7J 3FEZA 4TU8A 3LP2A 4O23A 3I5BA 3M32B 1DT9A 4MKYA 2IYIA 3T6JA 1IBKJ 1X4EA 1GXLA 2DTJA 1WKJA 1P9YA 4EUVA 1EARA 1TK8A 3C0BA 1SL2A 4Y28C 1RU2A 1F9HA 1RDRA 2GHWA 2OPQB 4URGA 2J6UA 2HSTA 1IKVB 3G86A 3IG1A 2PT0A 4I69A 2KJVA 4CLPA 1HKBA 1K73O 2MY8A 3IS9A 4BACA 4W5OA 2D0AA 2MQLA 3PYEA 4DR6F 2MLYA 2I5JB 4LH5A 5JMNA 2M8DB 3SNNA 4LF2A 3HD2A 2RILA 5F9LA 4DTRA 4K2XA 3W2WB 3OYLA 1MNEA 3R6GB 4Y2MA 4IO1A 1S3XA 4FJGA 3I55N 4I4BA 3IMQJ 4EZ9A 2QXLA 3HP6A 3MWBA 4DV5F 1HYSB 3AVBA 3CD7A 5T14A 2IVMA 1S1VB 4PPDA 4PKIA 3OS0A 1KFDA 3IR6B 2HNZA 3P96A 5L8RC 3SDEB 4AT1B 4IO9L 2HS0A 3OTOJ 2V2KA 2CPYA 3RR8A 2ZM6K 1H6KX 1RDUA 2GGPA 3THWB 2CVIA 2LCWA 4OYOA 4PPZA 2HG4A 2LKZA 2C3UA 1WTFA 1SVDA 4KO0B 3TEHB 1HD1A 5A2QO 2R8JA 2NRZA 1I1GA 2WW8A 4OI0A 3FCHA 4ERDA 2I5JA 2B6AA 4IO9Q 3ZZPA 1GXUA 1U02A 3FBFA 2IVFB 3M2RB 2QWRA 3T1AA 2QWMA 1HR0J 2BJ8A 1NRKA 4J2EA 4JN4A 3SBGA 2O66A 3NCRA 1YVNA 3AH6A 3O4QA 2XM3A 4OLOA 1J5EK 4ZVUB 3S7RA 5HRSA 2GWJA 1FRJA 3P45B 2CJYB 3IKMA 3ZSVA 3MECB 3POTB 1RAEB 1GQEA 4DPYA 3MECA 5LSOA 1HNIB 4MO4A 5F9NA 4CGDA 3CC4S 2E5LF 4JI5J 3D7EO 3OYMA 2VG6A 4WTOB 1WF2A 2IPOB 5HL7L 2VQEJ 3SBMA 2PO4A 2N82B 4QWDA 3BO4A 3BKTA 4G1IA 4A8KA 2YWFA 3ADAC 3AO3A 4YOUA 4PQUB 2YX1A 3KHGA 1B0PA 1WC6A 1RHRB 1U6FA 3R1LA 1GX5A 3M3ZA 3TAFA 4MFBB 4CLKA 3V9UA 2YKPA 2HAFA 2W4DA 4N7TA 4JS4A 4JBCA 3VETA 3V9WA 3A8YA 1GLLO 4CM2A 3O8WA 4ZVTB 4AM6A 2ZJRL 4KGZB 1VBYA 4RW4A 2AJ1A 2E29A 2IHR1 3NGUA 3HHLD 4DHVA 4ZVQB 2Q1NA 3MURP 2GVDB 4A5AA 3DOLA 2CPDA 3ZSOA 2R2RA 2ZH1A 2HBQB 2AW0A 4FBUA 2APOA 5KFFA 3ZT1A 4BG8A 3W8PA 2MKHA 5U47A 4OKEA 2YX7A 4JI2K 2RU3A 1BQMB 2X1AA 3NH0A 3C6HA 1R31A 3ISZA 3SV3A 2ZBRA 3KNGA 4OHZA 2RAQA 3CDAA 2PFUA 1N5TA 1YJUA 2B9EA 1YBTA 3M4XA 3R1XA 3HOSA 2COLA 2VD3A 3H2LA 4CH1A 4F4XA 4DU1A 2ZH3A 5L1LA 3UCGA 5ETSA 2GAHC 5L1JA 5IT9O 4D3GA 3TSPA 1FRKA 4FLTA 1SH2A 4CLFA 2UXDF 2BBEA 3NOCA 2AIRB 3WT0A 3FDSA 2H3GX 4K4YA 4OI2A 4V19J 2MQNA 2OFHX 4BRIA 2MQMA 1OPIA 3I82A 3DCAA 3AA4A 4OKJA 4I2QB 1OMSA 4FLVA 1REVA 3CF5Q 3TWHA 2OA8A 2WZ1A 3Q2SC 4E8UA 4CLUA 1E6YA 1DTTA 4DOZA 1NGBA 4PL8A 4DR3J 4KH1B 1DTTB 5IOLA 5ETKA 4C11B 2BANA 1S6OA 5HRNA 2UVUA 3ZEUA 2OZSA 2AGQA 2QYGA 2F3JA 3AD9C 5FPDA 2B5JB 1C0UA 1F21A 1TAQA 1RWPB 2UVRA 1BIUA 2YX6A 1FEHA 3IFRA 3K0SA 7FD1A 3NS7B 4ED0A 4IOXA 4RNFA 3DXSX 2WSCC 3D6FB 1H72C 2XZTB 4I9LA 5AXLA 2IMOA 3JQMA 2CUYA 3FZHA 3GE1A 5L1IA 4N8OA 3H08A 4DR7F 3AO4A 2FC0A 2PY5A 3DNCA 3IC1A 4RWWA 3QAUA 2W25A 4O0IA 1Y7PA 1C1CB 5M2RA 2AMCB 5C2CA 1IR2A 2X1FA 1RK8A 3GFHA 1F60B 1OO0B 3M2UA 2XULA 2RDDA 2BMBA 4YOXA 3MEDA 2W6KA 4A57A 3CCSN 4WQ5C 2FJDB 3QFWA 3CJBA 2ZVSA 4O3PA 1EQ0A 4DR2F 1KAZA 5EVZA 3V5RA 1RISA 1RAJA 4KHUA 1FTCA 3QMLA 1WAFA 3E3XA 3OS2A 4WQ4A 1QAXA 1A5WA 4JKHA 1WHWA 5CZ1A 5HJXA 1SKRA 1X1PA 3Q8VA 3M05A 5D4NA 4QQBA 1RLCL 4OHYA 2WRMA 1UEUA 5KFMA 1BUPA 3G9CA 1KP6A 3ILOA 4HEA9 4JI7F 1CS4B 1NCLA 2E5IA 3ID8A 2UUCF 4AUKA 4GO7X 1X5PA 1XK8A 4WKYA 3TZWA 4AM7A 4B1ZA 1BI4B 4J9LA 3N9UC 1JJ4A 2ZBPA 4ZN1A 3TVYA 2ZBIA 3OT9A 3S3MA 4LSLA 4NMLA 3VEVA 1HARA 1F3VA 4CGFA 2HBLA 5AJ3K 2AYGA 3CCJN 1VK0A 2AJ2A 2P6SA 1WI6A 1WG4A 4W5RA 1X0PA 2YNIB 2ZJRQ 4I64A 4C8NA 4BDYA 3V4IB 4JP8A 4EFAC 3FR0A 4UQTA 1KD1T 2CZ4A 5GADP 5AFUH 5AQKA 3JYTB 3NGYA 3MUMP 2R7XA 1GTHA 3PIOQ 3TW0A 1RBSA 2KM8C 1HKGA 5BPNA 3D54A 4WQ4C 3C14B 4PA1A 2ZE2B 2RF2B 3HVAA 1BWFO 2C2NA 4ZVFA 1B99A 2D69A 5B0FA 4DUYK 2CFXA 1Q82O 3OVSA 1U0HB 3HRGA 3M30B 3SSRA 8ATCB 2NPFA 4WKRA 1NDCA 1RTJB 1WG1A 4I1TA 2XY5A 4KKOA 1M5KC 4JNEA 4HHJA 3B6OA 1GOCA 2KT2A 2DR7A 2W7OA 3SXLA 2UV8G 2BE2B 3ZX0A 2CIMA 1RADB 3Q22A 4CFDA 4LF7F 4KB7A 2FTRA 4B3OB 3CJKA 2YX4A 3MMCB 4RNHA 3QRPA 2Z57B 4M5KA 5DQIA 2GW8A 5ETTA 4WP9A 4A8MP 2YWEA 1LV5A 3SMSA 2CGJA 4CHQA 3M2VA 2QXFA 1YUWA 5KG2A 2V67A 3BKUA 4Z4EA 5F3ZA 5CCMA 2KU7A 3GSDA 4Y0WA 1JLQB 3EWGA 1JB0C 4PG5A 4E98A 3DYAA 3CJRA 3H25A 4DB3A 2YY3A 5F8JA 2Y1JA 2HBMA 2IGIA 5K8PA 3U6FA 3BBCA 3W2VB 1U0SA 1HNZF 2ALYB 3O4NA 4ZTFA 2BABA 4TY9A 4O44A 2CRLA 1ZBSA 2ZD1B 1KEKA 2YHXA 4CZCA 2HURA 5G0RA 4RW6A 3MXIA 2EG1A 4DUZF 2ZNYA 4GKKF 2PDAA 2ZJPQ 2KXFA 3JXUA 4JAXA 2DCLA 2P9IB 2DNKA 4DU4A 4DV2K 3O3FA 3WNFA 1NGIA 1DARA 2MPUA 5CYQB 3MN6A 4HACB 4C3MA 4IZ9A 3BF4A 3KLIB 2ALZA 3ZTOA 1Q5YA 1YLXA 3CMEN 3SUPA 4ED6A 4CGHA 3DWLA 1T9VA 4C7QA 4BE1A 4F4KA 4CJ4A 1X60A 1CBKA 2VQEF 4FWQA 4YS2A 1FWKA 2V52B 2RN2A 2OGUA 1M1HA 3DMJB 2G2YA 2ZHOA 3J81Y 3OSNA 4GY2B 2WVBA 1VAZA 2J6TA 4Z2XA 2BM1A 2VKRA 4IQMA 3VZHA 1N5YB 1Z2ZA 4NLDA 4FPRA 5HLFA 2P51A 2B7CB 3UFCX 4GVBA 1YJNN 2YPZA 2KZMA 4JI2F 2RPIA 4BVPA 1NPPA 2R8KA 4YDDB 3M8PA 3TVZA 3KVGA 3MI7X 3AVNA 3PTWA 1VQYA 1R89A 3ZTPA 3SCIE 5KFTA 1HR0F 2DRDA 1S1WA 3MM6A 1RTIA 5B09A 4B3MJ 1VQSA 4KB0A 2ATLA 4E0DA 1CPZA 5D4PA 3WXLA 4KI6A 1ZA1B 1RCXB 3AO2A 2NPIA 4DCHA 2YNGB 3ZZZA 2YBVA 2DXFA 2ZH2A 4CGIA 1IBMJ 4Q5VA 1DQ9A 2P9NA 4B1UB 3PIPQ 1QQMA 2I7NA 4JV5F 4CEOA 4LF7K 4ECWA 2PYLA 5KI6A 3BEXA 4YHHJ 4A47A 2QWNA 4KY3A 2XY8A 5M1KA 4DV7F 1FNOA 5B0BA 3FEXB 2QC3A 3K57A 4YOYA 4FW1A 2AQ4A 3MMBA 4A2BA 1ASWA 2YWHA 4B3SJ 3EICA 4V1Ak 2HSEB 1UMJA 3NAEA 4CBWA 1WOPA 4X4RA 3ZSWA 4L74A 1VQ9N 3D5MA 1XNQK 4QWAA 4MFBA 1QTMA 3NFAA 3NH2A 3L2WA 3W65A 3E9PA 2IJRA 2JDJA 4JRPA 2FJAB 1AZSA 5KOWA 4K8XA 1S1UA 1R59O 4P2SA 1NMEB 1EX8A 5KG7A 4H0YB 1RQ0A 4USVA 1N33K 4IOCQ 3F2KA 2QFIA 3MM7B 4DSLA 1BHNA 4LF6F 4JRQA 5JLHA 3ZSQA 3DKDA 4MK9A 2QMUB 3WXIA 3KD1E 4MYTA 5HRRA 3LZIA 3NH1A 3ZT4A 3W9HA 3HXMA 3MR3A 2VC0A 4CZFA 3KNAA 5JVHL 2J6SA 1S22A 4DCOB 3D66A 1TL5A 3BPSP 4Y3CA 1HNXJ 3ZCMA 4I6YA 2UUAJ 3GBTA 1ZM9A 5C2GA 4FDFA 3W5ZA 2OLWA 3RRGA 4J9VA 3HPHA 4KRWA 4DX7A 4FZVA 5H9EJ 1TL7A 4WFAL 1UEVA 2QA4S 4NCAA 2QEXN 3MEEB 3EGWB 3C7NB 5A8RA 4R8UB 4BDPA 1M5HA 2QL9B 3EL2A 3L7OA 3B82A 3DM2B 2U1AA 3LALA 2HQ3A 4QU7A 4HR2A 2UXBJ 4P52A 2NREA 4BDZA 3CD6N 4PKGA 2P9SB 3SJJA 5M1NA 1YJNS 5BRHA 3AVJA 2A3ZA 3D4JA 4JV2A 3QT5A 5AFUA 3KKRA 3GG1A 4URQU 1NKEA 1K73T 3KIOA 5AZIA 3OYFA 4ER8A 4RW9A 3MM9A 3OUYA 2O4GA 4EP5A 3K7RA 1B4SA 2XWXA 1K8AT 4X4QA 3Q24A 1NNDA 5BYRA 1YT3A 1NEEA 4FWKA 4BWJA 1FCAA 3R7NB 1EZZB 4CLLA 1J9AA 3UWTA 2L9NA 3VEWA 3V6KA 4RZRA 4RUCA 1S6UA 2VQFF 3G8SA 3KKFA 5I42B 1BLUA 3CCLN 4ZLNA 1T3VA 3HZEA 1R6YA 3M9MB 5J2MA 3SEOA 1MWKA 4DN9A 2RB7A 1KHVA 1VRUA 2GJIA 1RBOB 2HZVA 2J8AA 3VF4A 2Q31A 1R0AA 4DL3A 3L3UA 4HUEA 2KL8A 4ZK7M 1TMJA 3SI8A 3AHPA 2QK9A 2J7KA 3ZFVA 4BR4A 1YJ7A 2O8CA 4H03B 2O8CB 9RUBA 2RKIB 3H42A 4WYBA 3IAM9 2ZNZA 1WEXA 3E51A 4OYWA 3F9MA 3BGLA 2R7TA 1RBUA 5FIIA 3ZSRA 4KE5A 3CWJA 4FKXA 4ZTJA 2EI5A 2FHKA 1PGZA 1ITGA 3ZZ0A 4FJHA 4HHHA 1FF2A 3HKZD 1NG9A 1APSA 4CK3A 3E9LA 3RRHA 1VJWA 3JAMO 2NXJA 1JLGA 4DSEA 2B9YA 2HYIB 4TQSA 4OX7A 3I32A 3SSSA 3VN5A 1MROB 2R8IA 2HGLA 1VSHA 1S10A 1X3NA 4CNYA 5IXUA 2RNEA 4J91A 3UCZP 4NYOA 1S6QA 1GMWA 2BXJA 1O13A 2Q2RA 4Q8FA 4OKKA 5KT2A 1JLEA 4F3OA 3WBZA 2HBRB 4DCJB 1ZYQA 1FEEA 4H0XB 1SB6A 3LP0B 4F0MA 1KSPA 2H48B 4PG7A 4AFFA 3AA8A 3CIPA 3B8HA 2G8WA 5GAGI 3ZNUA 5ETRA 3MEGB 3C6UA 4CF2A 4ECTA 3M2VB 3CMQA 3BS9A 2XMJA 1M5OC 4DV0J 2QTDA 5LY3A 2XLIA 2O8BA 1TUVA 4BRFA 3R5BA 2WCXA 3PO4A 3ZO7A 2RJZA 1J5EF 4B8AB 4U8VA 2OAUA 3IG1B 3ZNJ1 4EGLA 4J9UE 2F9JA 2Q6CA 4CWBA 5KFCA 2M2BA 1OY6A 1TMMA 5KFXA 5KGWA 2ADBA 1VQNN 3N4WA 1H2UX 2ITMA 3R8YA 3CCJS 3OS1A 1IBMK 3DRXA 4RO0A 2E20A 4OI4A 1K8AO 2MJUA 2OPSB 4NB4A 5CYMA 1VSKA 4BR5A 1IKXB 1WC4A 3HSDA 2JZ5A 2DGTA 1DJ0A 3KUGA 2GMJA 1ZOTA 3FJ2A 5EDWA 3M32A 2HMIB 3HD1A 1TAUA 3R9LA 1HX1A 4WFBL 3KG4A 4CZJA 3CCZA 4ELTA 5ITHA 1P8ZA 3H7HB 4CK2A 5C24B 4IH7A 2CZ9A 3O8MA 4B9SA 1SI9A 3RB6A 4DL2A 3DAWA 4L6V3 2QG9B 2Z1JA 4B02A 2FZKB 4XAKA 5DQGA 4A8QA 3G4SN 2ZE2A 5E5NA 4EBEA 2MKYA 4NA3A 4LJMA 2GV9A 4WBFA 2CJXB 3DRRA 3H59A 3OTOF 5BJRA 2UXCJ 5B8HA 1K6YA 2H4WB 4FPAA 4NEZA 1H74A 4H4MB 4CRJA 2FJEB 4A8WA 2I0XA 4QIGA 5EUHA 3MAAB 1WC0A 5HBMA 2IBKA 1QY7A 1IKVA 3PW2A 1TK0A 4BRMA 5F8LA 3KLIA 3KYLA 1S7HA 1NSQA 1WHYA 1RAOA 4FJ8A 4HTJA 4DR4J 1RT5B 2VBYA 2AV5A 5I9EB 4LR9A 4DV1F 1REVB 3SDEA 2V9KA 3GSIA 2HHVA 3ENVA 1E6VB 4ISFA 4PZVA 4H5VA 6FD1A 2LA4A 5AQZA 1FNMA 4C1NI 2JOQA 2JWKA 1D9DA 2PA3A 3IN5A 3NHGA 2P2CB 3ZEUB 3IBCB 2W40A 3JTOA 4JI6K 3VTIA 4E2FB 4JI4K 2FBTA 2JX2A 2DGUA 1VLYA 1N48A 4WFXA 1Y64A 1RCHA 4UF4A 3MGJA 2GIFA 2QWPA 5GVQA 5AZJB 2J9DE 1NSAA 3IGNA 2HNZB 1X4HA 2G2ZA 2DEIA 2HHTA 3NXZA 1X4BA 1S77D 2QT7A 3BZQA 3RW6A 1QHTA 2VH7A 1OVYA 4FZXC 4ED4A 1NM2A 2F9WA 3AGRA 2Y1IA 4N47A 3PVXA 3HT0A 3MM7A 4M8LA 2J9EA 2V0NA 4DX6A 1RTDB 4FF1A 2X78A 4ALZA 4DR1F 3UVJA 5A8KA 4F04B 3BF1A 4CP5A 3PCOB 1QAJA 5KFJA 3Q2TC 3OYGA 1JQGA 2K3KA 3QLHB 4NI2A 4JI8F 4FWPA 2MQQA 4IFVA 2JNJA 3KD5E 2GQ2A 3LAMA 4O3RA 3CUNA 4KH5A 4K4XA 4LFCJ 2VL1A 2GTDA 4YHHF 3H4BA 2HS4A 2D3UA 4OX9K 4FLXA 2NUBA 4CIOA 2UXCF 5AQVA 4USMA 1A5XA 3CJ3A 2IBOA 5EXWA 4CHYA 5IQ6A 4JI4F 4X84A 3DHXA 3M8RA 4R0JA 3W9JA 2XMWA 3DFEA 3OL8A 2D9OA 4M5HA 1NHKL 2HWIA 1ZTWA 5A8WB 4NZ0A 1OH5A 3L4BC 3EGNA 4J37A 4U67Q 1RACB 5E7OB 3U3GA 2BQ3A 1UVLA 4ZPDA 4NPOA 3JAMU 3W61A 3BN7A 4UY8O 4TSXA 4FCYA 1FESA 1IQTA 3HHLA 1CZ9A 1S1UB 4ZMMA 4OPHA 4B3TJ 1WBBA 2B0GA 1WSIA 1LNQA 1KAYA 2VQFK 4DU8A 3CFRA 5M1PA 4H5RA 4BRLA 4CK1A 3M6UA 1RTHA 2MZ1A 1YJTA 3OHRA 2G1DA 1ATNA 4C11A 2FXUA 2YWWA 4ETZA 1SL0A 4BRAA 4K0KF 3JS9A 3D0IE 4B9VA 5FLXO 1Q7YT 2QL7B 2WTUA 4DTJA 1U09A 1FRLA 1S5ZA 4PKDB 1LOUA 2CA9A 2W01A 5E3CA 2LDYA 1CJKB 3KXDA 2UU9K 3QZ7A 1VDHA 2VFSA 2C3MA 2G0IA 4IG0B 5DDQC 3OA9A 1EETA 2BTFA 4G1QB 3P83D 2QLXA 3HM8A 2AGPA 5J2NA 2N3LA 4FO0A 1YZ7A 2YXLA 3L7UA 3NMAA 3HBTA 3HOTA 2PMZD 1R0AB 1S4FA 1S9FA 1LW2A 1NJIO 1Q7YO 3GU0A 4YUDA 5KG6A 1VSDA 4USHA 4ZA1A 2PMWA 4C9DA 1QSYA 1RAIB 3CETA 4L3NA 2LA6A 2J9CA 2OPRA 3MM9B 1HQUA 2B56A 5HL7Q 1VSJA 3HSJA 2OD6A 3H2VE 3I9V9 1VCTA 5ADZA 2CQ1A 4ECRA 3AVGA 4DL0C 3UDCA 4DSIA 3L09A 2VFVA 4RBVA 2V4RA 5ETMA 1KCFA 3TP2A 2FJXA 4BRDA 1RT4B 2VCPA 1WDTA 1HNXK 4FM1A 3PO5A 4P7VA 3BPDA 4U9RA 1RWMB 1TZ0A 3WC2A 3GIMA 3M2UB 4IG0A 1TL4A 1S9EB 1XI1A 4YOEA 4NLRA 4J9RA 3PNIA 3R7BB 1NKBA 1H1VA 1A5VA 2WONB 4A8OA 3C7NA 4CJRA 3AO5A 2GEMA 3QNNA 3AA3A 1TUYA 2FDNA 4H54A 4LBHA 4BCAA 1MSWD 1Q18A 2IS3A 3AD8C 5FDLB 1TL1B 3G71S 5F1XA 4BC7A 3AA2A 3GQCA 1C1CA 3AVKA 5EOYA 5C0YA 2G0JA 3MR7A 1HKAA 1XNQJ 3Q23A 1YRXA 4LFBK 1ZC6A 1RKIA 2KM8B 2AU0A 1X9SA 4LF8F 1VQ5N 3V4IA 3KK1B 3ULDA 1N88A 1ZM4A 3S1TA 2IDEA 3THYB 1RDDA 3H5XA 2V8PA 4FJXA 2QLJB 3U27A 3VHQA 2XWYA 2W4CA 2R9LA 5DDOC 1H2TZ 2GMLA 2HZCA 2E1ZA 2FC9A 3QJPA 1JNRB 3P5BP 3OR2A 1N33J 2FHJA 4R0EA 3G6YA 2GX8A 4K50A 3R3TA 3M9NB 1FKAF 4HVZA 2BJ9A 1H7WA 4M5MA 3M6XA 5HVHA 3KLGA 4USJC 3UW1A 1H7XA 3F9KA 3UR0A 1RWOB 3PX0A 4ECXA 4DS5A 2DT9A 4ZVGA 4KGKA 3MM5A 2MHNA 1RGVA 2VG6B 4KYZA 4OZ1A 3X3UA 3P6YC 3MAHA 1NGGA 2M4MA 2O8EA 5JS2A 2XS7A 4E19A 5KFEA 3DI6A 4C8OA 4NXMF 4TY8A 4K25A 2G8KA 1NGAA 2V4QA 3G87A 2DVIA 3ZZRA 5AQPA 3GR0A 1XEZA 3MEGA 1ATSA 3VGLA 2D41A 3ZZYA 4NYPA 1P1LA 1Y4ZB 4GRSA 1PSDA 3QRRA 2XNQA 3K5PA 2O8BB 2RHSB 1NXIA 4DF4A 3T19A 3RB3A 3S6EA 3G25A 4FWRA 1HHQA 5KFVA 1HLWA 1VBKA 3CW2C 3AAQA 4WIIA 3J81j 4DSJA 2DGQA 5KT6A 2UUTA 3CG7A 3HSZA 1W9HA 2CPHA 5DS7A 4CJ7A 1SQGA 1V9OA 1TKTB 3D0GE 2F4VJ 2YJFA 2LMIA 2BOAA 4P9SA 2CH6A 3QIOA 4EAHD 1HBMA 3TAPA 4DXLA 2PAVA 4CGGA 1RT5A 1YJWS 3HI0A 4KHMA 3GYGA 3DOKB 4ZDNA 2DY1A 3FSYA 3FEYB 2AF6A 2FLNA 4DTNA 3UPFA 4KTWA 1EIYB 3K0JA 1L3KA 3SFGA 4HUFA 1KDNA 1ZS6A 2AX0A 3MN7A 1OS5A 1DQAA 2HAIA 1IBKF 4NA1A 2OPPB 3D2WA 2VJUA 4DR5K 2GHVC 2DR8A 5AE2A 4U7UD 1IBLK 3CFPA 5AQYA 2GHPA 4CHNA 4ZHRA 2VJVA 5IT9Y 4FJMA 4AL7A 5HLFB 5A0YA 2XO7A 2F96A 3UD5A 1AUSL 1QQOA 4OJ3A 3ELHA 1HWLA 1VR6A 3ENHA 3V6JA 4H4OB 2HF4A 3TZZA 1NOYA 3J81O 1TK5A 1W7WA 3ONQA 4XPCA 1N6QB 4DR6K 4M94A 5KRTA 5L9XA 4LF6K 4YOVA 3VAMA 3LF0A 1RBRA 1H38A 2HMPA 4TU7A 2I2YA 2NS1B 1O0PA 2PIIA 4X62F 1O5JA 1HI1A 2CDQA 2P6TA 2QI2A 3U3YA 4FWOA 3V9SA 3X1LB 1L3VA 3BREA 3CC7S 4ZCIA 1CJTA 5C24A 5ELZA 2CG4A 2RQKA 4KBIA 1CJTB 2ZQBA 2LXIA 2BZ2A 1U2CA 3FVYA 1IBKK 3LAKA 2I7PA 2FVRA 1G2EA 4R79A 2AYEA 5E3RA 1VSIA 3QGHA 1UFKA 4GKKK 1JLAB 4X64F 5GAEI 4NLYA 4ZJQA 1N34K 3QYYA 5C7PA 5C25B 2GMHA 2QX0A 3D6HB 4NASA 4LF4F 3BGRA 4HT5A 3DN9A 3QIPB 5AQMA 1FHTA 4P73A 1FRMA 1VISA 3VQ9A 3T1HF 4KPYA 2DR5A 3A0IX 4PXEA 4DPWA 3TWZA 4R8UA 5HATA 4X2BA 4UOGA 2CPFA 3N01A 4OX8A 3VESA 2KFYA 2XZDB 4X4OA 4DR3F 4KB1A 4UUXA 3IMXA 1UVKA 2CGLA 4BRHA 4LH4A 3M30A 4KTZA 4IEIA 4A2AA 4OZJA 4WCEL 2QLFB 4HCBA 4I2QA 1W2BM 1B70B 3RR7A 4KHPJ 2IIHA 1CJUB 3EXYA 4WQ5A 1RYSA 4OYPA 4CLTA 4NLPA 2EKNA 4AQYJ 2RRBA 4CGJA 3OLAA 2GO9A 2D74B 3DRPB 1HNVB 3RRKA 2BOPA 2DNRA 3TTCA 3P5JA 4HUGA 4CJPA 4B3OA 3GWCA 1PKUA 1PYOB 3CJKB 1UZDA 3UN3A 1UVIA 3ETOA 5CH7B 3ZXWA 1SV5B 1C6VA 1KS2A 2UUCJ 4NLSA 4NOHA 1KTVA 2MYFA 3CC2S 3JYTA 4FLUA 5KFHA 3AY9A 4WPAA 2J7UA 3NAIA 4YB7A 3TX0A 1XN9A 1TVRB 4BBYA 3NP5A 1PAEX 3OVAA 1ZZNA 2VPZB 2JLFA 4JEPA 2A3JA 3TZYA 3VQ8A 2O5DA 4R25A 1U0HA 4I56A 1X3MA 1M1KT 1Q8BA 2QL5B 1NB7A 1KR4A 2ZWHA 2R2SA 4UTGA 4B3SK 3KWMA 3IFEA 1UVMA 3HP9A 5AQUA 4B9UA 1B64A 4F9OA 2GWKA 4GKKJ 4M5IA 3VERA 2N4CA 3VQDA 2ZZTA 3SFUA 4A48A 1NGCA 2HIYA 4PWDA 4CIFA 5GAEP 1YQHA 2KHOA 2F7VA 4L3KA 2D1CA 1CULA 3R97A 2YVSA 4BRCA 3G2XA 2BUPA 4OX9J 4X64K 1Q7LB 4RWTA 4WK3A 3ENWA 2F4VF 4QS7A 4J7CA 4FM2A 2DNLA 1JJ2M 3DM2A 1UCNA 1A6LA 4JI5K 1W7AA 1HW8A 5FDLA 4CBUA 2KG0A 2NXNA 2ZKTA 1N0UA 6FDRA 1X0FA 4B3MK 1HYVA 5KPTA 4TLRA 1DZ5A 5K14A 2LQBA 4YHHK 1TL7B 1L3UA 3QZ8A 1OH8A