2OPRA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
538
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGNPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 140
structure length 538
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oprA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oprA05
5KFFA 1C1BB 4ECSA 4B9SA 4WZMA 4Y2CA 3DLRA 5KG3A 3SV3A 1JL1A 4ECYA 3ZSZA 1REVB 3QLHB 2XWYA 1C0UB 1J53A 3L2RA 4Y3CA 4HTUA 4FW2A 4E7HA 4DL4A 4CFDA 2G8HA 4QWCA 4IFYA 3UIQA 4Y2AA 4ECTA 5C24A 4URQU 4DFJA 1RTIA 5KG7A 3VQ5A 1VRTB 4QWDA 3LP2B 4J9QA 5CYQA 5F8LA 3HPOA 5HRNA 4B9LA 4PQUB 3V1QA 1TAQA 1HNIB 4QAGA 4FZYA 4ECWA 5L1KA 3RR7A 5D3GA 4DSIA 1S10A 1HQUA 1ZBUA 1QSYA 1IKYA 1FKPA 4CEZA 1IKXB 2PZSA 4DTMA 4EO6A 3MEDB 2HW3A 4UQGA 2RDIA 4ZMMA 3BSAA 2KW4A 2VWKA 4ZVEA 1RT2A 4C8MA 1JLEB 1JIHA 3WNGA 3OYGA 1JLFB 3H98A 5HRSA 1K1SA 3AVGA 1RDDA 1WSJA 4CGIA 3AO3A 2FJVA 3L2VA 3MR3A 1RYSA 2JEIA 4OKJA 4AHUA 4NCGA 1KVCA 3QERA 4BDYA 2I1RA 1Y97A 3AVFA 4DS5A 2HNYB 3TANA 4N76A 5FRNA 2W9BB 4FJLA 4OLAA 4CHZA 3KLHA 2XY6A 4CF9A 3NAIA 4TY8A 4QCLA 3D45A 5KFIA 3MR6A 4IDKB 4M95A 4HUEA 1SKSA 1N5YB 3QESA 3OLBA 4FM2A 3DI6A 5FDLA 2LSNA 2ZD1B 4CGDA 4YR0A 4M3RA 1SL1A 3CVKA 3I0SA 4FJ8A 4F50A 5L1LA 2B6AA 2WB4A 4O3QA 2PYLA 2O4GA 1NHUA 4J9MA 3IS9B 4IBNA 1UWBA 4URSA 3MR2A 3JYTA 1RBRA 4Y1CA 2IM2A 4QWBA 1LWCA 3AV9A 1JX4A 3DOLB 3L3UA 3O3FA 3FRZA 3OL8A 3Q8RB 1X9SA 3G6VA 4X2BA 2G8KA 1YT3A 4JV1A 3V9UA 3MAQA 3C94A 1NK7A 1TKDA 2HHSA 4FJXA 1HPZA 3ZSYA 3OYBA 4IG0A 1HARA 4HUGA 1QS4A 4CHNA 1T03B 1RTJA 4QW9A 1HJRA 2GIQA 4CHQA 3SPZA 3OYCA 3KLFB 4DG1B 1U09A 5EWGA 2QXFA 3SV4A 4ELVA 1HYSA 3CFRA 2OPRA 2D7SA 1QQCA 3KK1A 1HQUB 5KT5A 1IKYB 3HYFA 3DMJA 1CXQA 4G1QB 3SI6A 4FYDA 1KVAA 1L3TA 4DSJA 4MFBA 4DSLA 4MK9A 3SFGA 1C1AA 3RR8A 1RT2B 4KSEB 2HWIA 4Z4EA 3ZSWA 1S0MA 3M8RA 3FDSA 1WAFA 3AA5X 3CM5A 2YKMA 4NRUA 1TL1A 4PA1A 2EC0A 4CEAA 4FK2A 4BWJA 4DL6A 3I0RA 3QIDA 3DYAB 3KHLA 2IC3A 1VSFA 2HWHA 4K50A 4CJFA 4TY8B 5F9NA 2EX3A 4IR9A 5KFWA 4YR2A 2VG7B 2IMWP 1Q9YA 2IGIA 3T3FA 1JLCB 4IH5A 4ED7A 5KFMA 2BDPA 3TR8A 3S3MA 1S1WB 1S1UA 2GBZA 1S49A 3U3GA 4F4KA 4OGEA 3KKRA 2JLEA 4ZTJA 3I0SB 3B6PA 4FJGA 3OS0A 3RMCA 2XGQA 1RT5B 3CM6A 3CDUA 4LQ3A 2XRIA 4KRFA 1XHZA 3EPGA 3OYIA 1LAVA 3C6TA 2D5RA 2AQ4A 5C5JA 3HP6A 3N6LA 3KJVA 4M3WA 4O3SA 3V6DB 2BGGA 1HPZB 1S6PA 3T19A 3IGVA 3PHEA 3MXIA 5KFKA 4FZZA 3QEPA 1RTJB 2G8FA 2XY7A 4KKOB 4FLWA 3K5OA 1TVRA 1CLQA 3TARA 4KTWA 2Z1GA 2OZMA 4TN2A 1GOBA 4W5OA 3NMAA 3DMJB 4CFAA 1TV6A 3BGRA 1A5WA 3L8BA 2IJNA 4FJJA 4URGA 4FLZA 4Z4FA 2G8VA 4NLDA 3TAPA 3I5AA 3VQ6A 4K4SA 3U6FA 4M3TA 2HHXA 4IQXA 1W0HA 3H5YA 1BQMB 3AA3A 3LP3A 4CJSA 3KK3A 1DLOA 4CHOA 1RA7A 4ZP7A 1LW0A 2AGOA 4DFKA 5KT6A 2YKMB 3N6NA 4Q8EA 4OGCA 4NLOA 1LWFA 1XHXA 3OYMA 2KFNA 3MEGA 4I2PA 4CJTA 3Q8SB 4IRDA 3RB3A 1QE1A 3OVNA 4ZTFA 4ECVA 1S1XB 4K4YA 3D28A 3G86A 5DG8A 3OYLA 2AGPA 4E7JA 2W9AA 4NLWA 1NK5A 4ZVGA 2R2UA 3PW5A 3DRSA 1QUVA 1KTQA 1S1UB 2VG6A 3MF5A 3VA0A 4NRTA 2HHVA 2ZQBA 3VQCA 3F73A 3LZIA 1KLNA 3NAHA 4I9QA 2KFZA 4W5NA 2FLLA 1SH2A 1RTDA 4KB7A 3V4IB 1GOAA 3DOKA 4CGFA 4FBUA 3C6TB 2UUTA 4H4MB 1RT4A 1JXLA 2WRMA 2Q3SA 3ITHA 4JS5A 3K58A 3VQSA 4HYKA 3KLGA 2OA8A 3C6UA 2D0CA 3H5XA 3HPGA 4H54A 2W42A 4C8LA 4FK0A 1RT6B 1HNVB 4RW9B 4PUOA 4DL3A 5C25B 1TVRB 4CF0A 2V0NA 4TYBA 4F3TA 4Y34A 5FRMA 5KFSA 1BL3A 1UA1A 5SWMA 5JS2A 3CYMA 4O4GA 3E51A 3HHKA 5F8JA 2B4JA 4OPJA 4KV8A 3AO5A 4GW6A 3DLKA 1TV6B 3DDKA 1U48A 4KFBA 1QAJA 3IGNA 1EP4A 1IG9A 5KTQA 5HBMA 4KTZA 3KK2B 3ZSQA 3KLEB 1NOZA 2DFEA 4O44A 4DTNA 4E7LA 2OPPB 2BQ3A 4RW6A 1EETA 1CSJA 3FQKA 3I8DA 3FFIA 3HK2A 2VA3A 2RN2A 2IS3A 1LWFB 4MH8A 3I5BA 1EXQA 4F2RA 4R8UA 4FJ5A 1WSFA 2P1JA 1VRUA 3PW7A 3ZSXA 2AGQA 2FC0A 4PWDA 3EZUA 4FW1A 4BE0A 2UUWA 2C2DA 4DTPA 3HVAA 4TXSA 3CJ3A 2CKWA 4DLEA 2V9WA 5I42B 4ZPCA 3ZT0A 4RUCA 3CFPA 3DRSB 2W7PA 2VG6B 4ICLA 2OZSA 4TY9A 1D9DA 3HT3A 1U47A 3KD5E 4HVJA 1ASWA 1RTHB 3ALYA 3MECA 1S9FA 2RF2A 3KOAA 4W5RA 3BDPA 4EYIB 3IAYA 4LSNA 2UVWA 1RTDB 2PYJA 4KHNA 2VG5A 3V9ZA 3DOKB 3OYDA 3SI8A 4KI6A 2WHOA 5L9XA 2R2TA 4KAZA 3SFUA 4CEDA 3CJ4A 3GIJA 2BRKA 4KHRA 1S1VA 2F8EX 1DTTB 3NGDA 5HRRA 3TAFA 1BHLA 3QNNA 4DL2A 4ED0A 5KFVA 1TK0A 4QPXA 5DQGA 2DFHA 3LP0A 3PJWA 3OJSA 1UA0A 2B5JA 4DTJA 5F9LA 4KV8B 1RYRA 3VQ7A 1LW2A 4KFBB 4RW4A 4JLHA 4H4OA 4KB0A 1ZBIA 1ZTWA 3SUPA 4KHSA 2HMIB 2DFFA 1TKZA 2ZE2B 4O44B 3KHRA 1ZBHA 3V1OA 3LAMA 1DTQB 3GIKA 1EETB 3FSIA 4N41A 3OYJA 4FXDA 3M8SA 1S9GA 4BDPA 3BJYA 3PZPA 3AA4A 1TQLA 3M8QA 3KNAA 1FK9B 4YFUA 4B8AB 4RNNA 3QYYA 5CYMA 1JKHA 3EPIA 1RNHA 4CEEA 2OPQB 5EDWA 1NHVA 1QTMA 3RB6A 4RW7A 4CK3A 4WYWA 2YNFB 3OYHA 5KG5A 1TAUA 1HQEB 4EP5A 4DTXA 2RF2B 4ID5A 4CJWA 3QZ7A 4WZQA 5DK5A 2Y1JA 2VG5B 4FLUA 4B9TA 4CF1A 1S6QA 3QIPB 3CJ0A 1CZ9A 3DM2B 4HUFA 3OSPA 3E01B 3HVTA 2FVRA 1A5VA 3CQ8A 1QSLA 3S3OA 4MIBA 3TWHA 3GV7B 2E9TA 4EBDA 2O4IA 2JC0A 4QWEA 5C42B 3OL6A 3SUQA 3L2QA 3JSMB 1JLAB 4KO0A 3SQ4A 3T1AA 1C0MA 3PV8A 4CJUA 4Q5VA 2KTQA 3PR5B 5DQIA 1OS5A 2IM1A 3LP0B 3QO9A 1KFDA 1BIUA 4IRKA 4N56A 4FJIA 1NK6A 2P5GA 4CF2A 1GX6A 3K2PA 1BQNB 1C0TA 4CEFA 5J2NB 3OS1A 3MEEA 4TQRA 4NYZA 2J6SA 3K5LA 2HNZB 1SUQA 3NCIA 3AVKA 3QETA 3Q8PB 3OYKA 3DLGA 2QE5A 1WSEA 4FJKA 4RU9A 3PR4A 3AVHA 3RMBA 4I7FB 4DFPA 2OYQA 4K8ZA 2HVHA 2AX1A 4FCYA 3PO5A 4W5TA 1SKRA 1RT7A 2ILYA 3T5KA 1B9DA 1IM4A 4RW8A 1S9GB 4HKQA 1BI4A 4HHTA 4LSLA 4JUZA 3IN5A 1LV5A 3TAEA 4IFYB 5KFJA 2DPJA 4KBIA 5CYMB 4CCHA 4GC6A 5HLFA 5KRTA 2D3ZA 4YR3A 3G6XA 5C24B 3TAMA 3CO9A 2XCPA 1RTIB 4RW7B 1KHWA 5CYQB 2VA2A 4MK8A 1Q9XA 1RILA 4F2SA 5D3GB 4CESA 4Q8FA 3PJXA 4Z4CA 3TAGA 4U7CA 1FKPB 4J2DA 4DQSA 4M3XA 5KFOA 3OHAA 2J6UA 1S6QB 3KMQA 1TK5A 1NK9A 4CHPA 1Q8IA 4L8RB 3KMSA 3NHGA 4WXOA 4F4XA 3V9WA 4B3OA 2WONA 5CY4A 2GV9A 4E1MA 4O3PA 4FJMA 3HJFA 3TVKA 4GMJB 5DG9A 3AVMA 4BACA 1XR7A 2BR0A 3LPTA 1VSEA 4NCGB 4GC7A 4B9UA 3FQLA 2F8SA 4LY7A 1I39A 5J1EA 1ASUA 4KHWA 3DLBA 4ID1A 2QV6A 3KLHB 4FLXA 4I9LA 1BGXT 3UR0A 3PX4A 4CIFA 4Q0BA 1GX5A 3PX6A 4RG8A 2IAJA 2NUBA 3DI6B 3RRHA 5FDLB 3MR5A 4ED8A 4BWMA 4O0IA 3DRRA 1NNDA 5JXSA 3DLGB 2KZZA 2IOCA 2B6AB 3H4BA 4QOZB 1RBUA 4EYHB 1UWBB 4C8KA 3QGIA 1ZETA 3JYTB 1WNSA 1IKVA 2IM3A 1D9FA 1LWCB 4DTSA 3CIZA 3NFAA 1BIZA 4RW8B 1BI4B 2KZMA 1UAXA 4BE2A 3NDKA 3K57A 5DLGA 2YV0X 3C95A 4WFXA 4IG0B 3QINA 4CHYA 3H4DA 3TAMB 4C8OA 4ECXA 4CJQA 1TKXA 4KI4A 1JLBA 4WE1A 4M94A 3AVNA 5J2MA 1ZBLA 3VQ8A 1C2PA 4TSXA 3VQEA 1Z4UA 1HYSB 3AVLA 2OPRB 4ZHRA 4DL7A 3KK1B 5KFGA 5EWFA 2ASJA 3P83D 4KB1A 4CEQA 2WCXA 4KHYA 3LPUA 1NKCA 1KHVA 2HHTA 4NLRA 4CJKA 2C22A 4R5PA 4MFBB 4K4VA 1C6VA 3S9HA 4IG3A 4FM0A 4J9SA 4F4YA 4NLGA 4RUAA 2FLNA 3DLEA 5F8MA 1SH0A 3L2UA 3IG1A 1WSGA 2C2EA 2XCAA 3IRXA 1CZBA 2W9CA 3AA2A 2XGPA 3ZSVA 1TL1B 4ZPAA 4ECUA 3Q8QB 3D5MA 2OPSA 1NOYA 3I0RB 4Z0UA 1S1TA 1D1UA 4FS2A 3G10A 1C1CA 2IC3B 1NK0A 2AJQA 2R8HA 1S4FA 2E6MA 3ZT2A 3RTVA 4ZP9A 3RAXA 1U45A 2YNGA 4FM1A 1KFSA 3AO1A 2YNIA 2BANA 2XI3A 3BSNA 5KFCA 3O3HA 4BE1A 3VQAA 1ZYQA 5I3UA 4Z4GA 3DRRB 4ZPBA 2IBKA 4F3OA 4ZPDA 4JV0A 1N48A 4O3NA 4AILC 2RPIA 5KFAA 3NF9A 4IFVA 2IM0A 3K5NA 4CEOA 3B6OA 4MIAA 1K6YA 3NGZA 3CJ5A 3OLAA 3OY9A 3I5CA 3SQ0A 3KJVB 4WFYA 4I2QA 4KHUA 1S6PB 3RRGA 4E19A 2Z1JA 1T05A 4B9MA 4J2AA 5KFPA 1TKXB 4CJEA 4CGGA 3EY1A 1L3SA 2XHBA 2WOMA 5J2MB 1B92A 3V1RA 3TAQA 3L3VA 3BSOA 2A1SA 4NYNA 4ZHRB 1TKTA 1XR5A 3V9XA 4GVMA 2AWZA 4LQ9A 2IJFA 4N47A 4B08A 2E6LA 3AO2A 1GOCA 2EHGA 1RT3A 3BGRB 2X6NA 4E7IA 3PX0A 3ICLA 1N6QA 3AO4A 4MKAA 3RBEA 5T14A 4DMNA 5KG2A 3SUOA 3KK3B 3QEWA 3IG1B 1CXUA 1DLOB 3OYEA 2C28A 1LW0B 1S9EA 4DF8A 2DPIA 3T5HA 3VQBA 1VSJA 2VWJA 2OPSB 3MFHA 1QHTA 1QSSA 3MEGB 4DTOA 3NBPA 3LANA 4I2PB 1S1TB 1W9HA 5K14A 1QE1B 5EWEA 4WYLA 3T5LA 2BQUA 4R0EA 4ECRA 1WAJA 3ZT4A 3V9SA 2YNGB 4W5QA 4E7KA 4B8CA 4CERA 4CFCA 2YNIB 3KD1E 1ASVA 1UOCA 5KFEA 1REVA 3QLHA 3CG7A 1C0UA 2HNDA 3M9NB 4B9NA 1S97A 1XWLA 1RT1A 1KSPA 1VSIA 4DU4A 5J2PA 4MK7A 4DQQA 1JXBA 3CDWA 4LD0A 3F9KA 1RDRA 3DLHA 4DQPA 3GILA 3H40A 2G8WA 3PW4A 3WNEA 4IH6A 1BISA 1VRTA 1RT4B 5KFRA 3GIIA 3CFOA 4Z4IA 5HRPA 1IH7A 4OKKA 3ITHB 2D3UA 2DTUA 4PQUA 3TI0A 3AVCA 4J9OA 3KLGB 3C6UB 3SUNA 4NLVA 3OYFA 4EEYA 1ZTTA 3ASMA 3QNOA 3M9OB 1IKXA 3OS2A 5F8HA 4PUOB 3MEDA 5HROA 4NLPA 5KFYA 4E3SA 1RDCA 4CGJA 1U49A 5JS1A 1RA6A 3ISNC 4OKEA 3H5UA 4M42A 4CJ5A 1JLEA 4O3OA 5KT2A 1YTAA 4CK1A 1LAWA 1JLFA 4WXWA 4O4GB 5KFHA 3K5MA 2ILZA 2ATQA 1VSKA 2ALZA 2D0BA 3DLKB 4NLXA 4KAIA 4J2EA 1QAIA 4RNHA 2ATLA 4OVLA 1EP4B 3HKWA 1HYVA 4CEBA 5HBMB 1NKEA 4DQRA 3O4NA 3LAKA 2R2SA 2W9BA 4J9LA 3VQ9A 3NF7A 4EZ9A 5KFUA 1Z26A 5DLFA 4K4ZA 4RW6B 1KCFA 3HPHA 3SYZA 2R8GA 4IDKA 5CZ1A 4IR1A 4FK4A 3FFIB 3VQDA 3EYZA 1N5YA 5KFTA 5KFNA 1JLQA 4R8UB 1VRUB 2ZD1A 3L2WA 2XC9A 3RAQA 4J9NA 4U6PA 4PWDB 1U04A 3UQSA 2PY5A 3HO1A 4K4TA 3IS9A 4IKFA 5EUHA 4E0DA 4DTRA 2W8KA 3SQ1A 4O3RA 3VQPA 2HNDB 3DOLA 4ICLB 1RT1B 2XY8A 3MECB 2ETJA 2KQ2A 5J2PB 4WFZA 4LSNB 4RNFA 4KHMA 1T03A 4CFBA 1T94A 3OL9A 1NKBA 3NKYA 4YMEA 3KLFA 4DG1A 1RBVA 2IA6A 4ZP8A 5F8IA 1S1VB 1WN7A 4FJHA 5DMRA 3QGHA 2RDJA 1D5AA 2J6TA 4ED2A 4N5SA 4YP3A 1NJZA 1T8EA 4G1QA 5HROB 1EX4A 1G15A 5KFBA 1ITGA 4F8RA 3ZSOA 1TP7A 2R8IA 5J2QA 4C8NA 3VQ4A 5EU7A 3GIMA 4O0JA 2OH2A 1JL2A 4Q44A 2B5JB 3THVA 4AHRA 4FJ9A 4NCAA 1S0NA 1NK4A 1LW2B 1WLJA 3CDEA 4RW4B 3WNFA 3MXJA 4H4OB 3U3YA 3M8PA 3PW0A 3PW2A 3ULDA 3KLIA 1T3NA 4KHQA 2AX0A 3AVIA 3QEXA 1S5JA 5HP1A 2YHAA 3BREA 2WK4A 1TKZB 3DYAA 3VQQA 1B9FA 3ISND 4E89A 4TQSA 2ZKUA 3TABA 4XPCA 1W25A 3SQ2A 1TL3A 4RNMA 2VG7A 1A5XA 1JLCA 4YQWA 2UVRA 3WNHA 4DQIA 1HMVA 1JLQB 3H59A 1S1WA 3SPYA 2JEJA 3NF8A 4Z4HA 3M8QB 1RBSA 3T5JA 4Y1DA 3K59A 1JKHB 4DSEA 3BQ0A 4M3YA 4DF4A 2FBYA 3LWLA 1RT5A 4ED1A 3PO4A 3PY8A 4NLSA 3HL8A 2FVCA 1SV5A 2C2RA 1MMLA 4DFMA 3QIOA 4J2BA 2R8KA 3VN5A 4K4XA 2ASLA 3LDSA 4CK2A 4KTQA 3BQ2A 1YVFA 3V6DA 4ID5B 1L3VA 4MQ3A 3V6KA 2YNHA 3A2FA 3P1GA 5KT4A 1LWEA 4ECZA 2XY5A 4QW8A 4KKOA 4IOBA 3LWMA 2V4QA 3HVTB 2E9ZA 3O3GA 5KT7A 4NZ0A 2R2RA 5F8NA 4CJPA 2UVUA 4NYFA 4NLUA 3OHBA 3BQ1A 3H5SA 2V4RA 4KO0B 1BCMA 4JRQA 4RNOA 1J9AA 4CIEA 3P5JA 4FVMA 5J2QB 3LALA 5KFLA 3KIOA 3DRPA 1KVBA 3QO9B 4CJ4A 1BQMA 3KLVA 4EP4A 3NAEA 2BE2A 1D8YA 2HHQA 2FBTA 1ZBFA 4CJ3A 4AH9A 4CF8A 1JLGA 3ZT3A 1C0TB 4MKBA 3M8PB 3KLIB 3MEEB 2R7YA 5HP1B 3V6JA 5DG7A 1N4LA 1L3UA 4ELTA 1SUQB 1XI1A 1JXEA 1VK0A 4ZVFA 1S1XA 5KI6A 2E4LA 1R0AA 4O4RA 1TL3B 4KE5A 1RT7B 1HMVB 4ECQA 2YKNA 4OLBA 2P5OA 4LSLB 2JGUA 4JS4A 3GQCA 4IH7A 5SZTA 2E9RX 4DEZA 5HLFB 2FBXA 3KHHA 2XI2A 4JRPA 1D0EA 4DU3A 3TQ1A 5KGWA 1WSIA 1WSHA 1T7PA 1RDAA 3NGIA 1SV5B 3QGGA 3PVXA 3V4IA 2I5JA 3NH2A 5KRSA 2D41A 2IDOA 4H4MA 1I3AA 2GUIA 4ED6A 3RB4A 5JUMA 3V81A 4XIUA 4FLVA 3RB0A 2RKIA 3SNNA 1KLMA 3PUFA 1SL0A 1TK8A 3EZ5A 2YNHB 1IO2A 3SCXA 1RT6A 2JEFA 4M3ZA 1Z25A 1HNVA 4RW9A 1N56A 1LWEB 2QKBA 5C25A 2X78A 2HHWA 1RCHA 1HRHA 1SH3A 3LP1A 1YVUA 3AVJA 4OL8A 2HVIA 2F8TA 5L1IA 4EZ6A 4FLTA 1MU2A 4B3OB 4CJRA 2WONB 3NH0A 3HVRA 1FKOA 3S3NA 4NCBA 1X9WA 4AHCA 3SJJA 2HB5A 1WNEA 4XO0A 5J1EB 4CJVA 3RBDA 3DRPB 3KK2A 4ZVHA 4TYAA 3KLEA 2BQRA 3V6HA 2BE2B 2OPPA 3O4QA 4DS4A 3ZSRA 1EKEA 1JLGB 2GIRA 3MXMA 4Q0BB 2HAIA 3D0PA 2IAJB 2CJQA 2Z1IA 4EBEA 2AU0A 3G6YA 1XR6A 2FBVA 3ZT1A 3H2LA 2Z1HA 3NH1A 3NE6A 4AHTA 2O5DA 4DWIA 4J9PA 1R0AB 1SL2A 4K8XA 3ZCMA 4FZXC 4M45A 2ASDA 3HSTB 4DTUA 5I42A 1IKVB 1S48A 1SKWA 3NL0A 5KG6A 2YKNB 4F4WA 5KFQA 1NJWA 1RAJA 2FJXA 4LH4A 1RTHA 4Q43A 5KG4A 3G0ZA 5T7BA 2A1RA 3HVWA 1XC9A 3NGYA 4CECA 4F4ZA 1JLBB 4ZP6A 4IRCA 4WE1B 2GC8A 2I5JB 2FJWA 5DQHA 3CWJA 4ED3A 2XO7A 5F8GA 1U4BA 3V81B 4Q45A 1HYZA 4M3UA 2RKIB 1KLMB 4IKAA 4DU1A 1DTTA 3M9MB 4FS1A 4NLQA 1RDBA 1X1PA 2FVSA 1TGOA 4CJLA 4FLYA 4O55A 4R5PB 4FJNA 3AVAA 4IG3B 2W8LA 1X9MA 3LP1B 2UVVA 4TLRA 3DLEB 4DL5A 4NLYA 2JC1A 5DGAA 2X6SA 4NLTA 1MU2B 3BSCA 1VSMA 1FKOB 1S0OA 3MFIA 4RZRA 3IRXB 4QWAA 4B9VA 3UPFA 2QKKA 2W9CB 3MTKA 2JEGA 2HMIA 4OJRA 3H08A 2R8JA 1NK8A 4JV2A 3GV5B 1IKWA 1C1CB 2ZE2A 2WTFA 5KG1A 5KT3A 1DTQA 1BCOA 1J5OA 3RWUA 1C1BA 4KREA 2FLPA 4H8KA 2BANB 4HCCA 3RMAA 4FBTA 5I3UB 4DLGA 4YNQA 4HCBA 1FK9A 5KFDA 3KKSA 4LH5A 2OPQA 3NF6A 4CE9A 3OYAA 4CGHA 4IFVB 1L5UA 3HXMA 5L1JA 4KPYA 3KHGA 3HM9A 4DSKA 2YNFA 5FROA 3LP2A 1I6JA 3UDLA 1VSHA 2Y1IA 3OYNA 1HQEA 3QZ8A 1FXXA 1HNIA 4I2QB 2X74A 4CIGA 3N6MA 5DGBA 1T05B 2FVQA 4PY5A 4E1NA 4G3IA 4K4WA 4EBCA 4ELUA 2WOMB 3QIPA 3DM2A 4AHVA 3E01A 5E41A 2W7OA 4EO8A 2G8UA 1TKTB 4O5BA 2G8IA 2B43A 5CZ2A 2HHUA 4BDZA 3QEVA 2BRLA 5KGXA 1VSDA 4J9KA 3VA3A 1NJYA 5C42A 1NJXA 4AHSA 2F96A 3JSMA 1RT3B 1JLAA 1VSLA 4OPKA 2QK9A 1N6QB 1KRPA 1F21A 3LZJA 2HNYA 3QEIA 4J9RA 1YTUA 4FJ7A 1O1WA 5KG0A 1RBTA 1J54A 5KFZA 1S9EB 2FVPA 1BQNA 2DY4A 2P51A 5J2NA 3OSNA 3AVBA 1K1QA 3GYNA 3SZ2A 4DSFA 4K4UA 2YHBA 1IKWB 5KFXA 3RMDA 3NBPB 3HP9A 5K14B 2HNZA 3CJ2A 4M41A 2D0AA 4XPEA 3KTQA 3BR9A 3OJUA 3GV8B 4I7FA 2ITGA 1J5OB 3OL7A
chains in the Genus database with same CATH superfamily
1GMWA 4ECSA 4IO8A 4B9SA 2XS7A 3DLRA 3JTPA 3ILJA 1AZSA 4ECYA 3ZSZA 1REVB 3QLHB 1C0UB 4FYYB 4OX8A 1J53A 4FW2A 4E7HA 4OX7A 1V3RA 4QWCA 3SMPA 1R6VA 1AXQA 2CQ0A 4IFYA 4PG5A 3UIQA 4NXMJ 5ETOA 4DN9A 3VAMA 5C24A 1LCUA 2MTLA 1RTIA 5KG7A 3ZX0A 1FHTA 3LP2B 2UXDJ 2WAQD 2UUCF 3CDAA 3HPOA 2CWXA 1MMNA 2PE8A 1HQUA 1IKYA 2A41A 1HWUA 3TUPA 1IKXB 4DTMA 4EO6A 1RAGB 2HW3A 2E7WA 2KW4A 2M0GB 4IO9Q 3M3ZA 2L9NA 1Q1KA 4H4KA 3AVGA 1DEJA 1RDDA 3K8WA 2MB0B 1WSJA 2IRYA 3N5FA 4CGIA 1SXLA 3L2VA 1GTHA 3PYDA 4DX7A 1KVCA 1MROB 3QERA 4R0JA 4N76A 3P5BP 4ERDA 3CIMA 4FJLA 3L95X 2XY6A 2AW0A 3NAIA 4QCLA 4DUYJ 3HMJG 3ILOA 1ZS6A 3JXOA 3CCES 4LFAK 1N5YB 1SIZA 4FM2A 1HQ2A 3CCRS 3DI6A 3JSRA 1KAZA 2LSNA 4YR0A 1N8RO 1HBOA 3W9HA 3CCJN 3CCQS 4XDDA 2B6AA 4O3QA 2V4JB 4NXNK 4NASA 4CI0B 2RS8A 3MR2A 1AZSB 1RBRA 2IM2A 2RRNA 2ZFHA 4EI2A 1LWCA 3OTEA 2GEMA 4YHHJ 3Q8RB 3G6VA 2HZAA 1YT3A 1V4TA 4IJAA 3V9UA 2QMXA 5GAGI 1TKDA 5GMKa 4F4AA 3SAFA 5DM6Q 8AT1B 1T03B 3CQYA 1HJRA 2GIQA 4DG1B 3IRWP 5EWGA 1PBUA 3U1MA 4ZVRB 1VFJA 3KK1A 1WF0A 3MUTP 2PFDA 1VS3A 1HQUB 4P7TA 5KT5A 2HFSA 1IKYB 1ILYA 3DMJA 2XM3A 3UCUP 4G1QB 2KH9A 4CO3A 1SKUB 3FEZA 3UFCX 1C1AA 1JJ2R 4LF1A 3RR8A 2BACA 4WQ5C 2ITMA 3VMFB 1VQ9N 2HWIA 5D4LA 2HBMA 3ZSWA 5IXUA 1S0MA 4JP8A 3CM5A 4NRUA 1JCGA 4PA1A 1B3TA 2I9SA 4RX6A 5FPEA 1PYTA 2LMIA 1EJ7L 3M8ZA 2HWHA 4CJFA 4QJVA 2EX3A 2P9SA 2W01A 2QZ8A 5A0YB 3NXZA 2W2NP 4NMLA 3T3FA 2VDHA 4ED7A 2BDPA 5AXMA 4C6AA 4CZGA 1U25A 3JSBA 3S3MA 2Y8YA 4DN0A 2OFHX 3OTOK 2FIUA 2JLEA 2KFYA 2FHKA 2EFVA 3H46O 4FJGA 4N7TA 2XGQA 5BYRA 4C97A 4FL9A 4PKGA 3EPGA 4RJVA 2ZEJA 5AQKA 3M8YA 2MJUA 1VQNS 4BC5A 2B8QA 3IAM9 2D5RA 2IHR1 2OEJA 3HP6A 1OJ4A 2RILA 3N6LA 4LSZB 1WC0A 3PIOQ 2NRVA 2MGZB 4M3WA 2BGGA 3QQCD 1YWXA 2BE9B 2RRAA 4DUZF 3QEPA 3L7PA 3K9JA 3HOTA 2CGKA 3WQPA 4FLWA 3EGZA 2RE1A 1FDNA 4KTWA 2OD4A 2EK1A 3PIPQ 3JQJA 3H8YA 1GOBA 4W5OA 3ULEB 3FBBA 3DGVA 3DMJB 1S72S 1X4GA 2YQ0A 1ZC6A 5HJYA 3HSDA 3U4LA 1MWZA 3NWGA 2HQ3A 4NLDA 3UCGA 4OYXA 4A8QA 4DR1J 2HHXA 2V6AA 2M5YA 3AA3A 3LP3A 3KK3A 1DLOA 4OZNA 3VEXA 1RWPB 1BLUA 4X65K 2AGOA 1VBXA 4DX5A 3N6NA 4K0KJ 4V1Ak 4MKVA 2XYPB 2D1CA 5DZ6A 1TFWA 2FJAB 3HCXA 4ISGA 1IJEB 2OANA 4PXDA 2OTJS 1S0VA 2CPXA 2HQCA 3G86A 3F5TA 2P9SB 2AGPA 4KHPK 1AYEA 4JI4J 2V8HA 2W9AA 2EC2A 4DV1J 2R2UA 3PW5A 1RBOB 3MF5A 1Q7LB 3IDHA 3LZIA 2HK2A 3MN9A 1KLNA 2DXEA 3DN9A 1URNA 1OYDA 5HVHA 2V94A 2WSFC 3CCTA 2MY8A 1XMOK 4KB7A 2HRTA 4X64K 3BEGB 2HHHK 2UUTA 1MN7A 1JXLA 3K58A 3VQSA 2OA8A 1Y00A 2KYXA 2B3TB 2HZVA 3H5XA 1JNRB 2E7VA 1WUAA 2R7VA 4CO4A 5C25B 2HQDA 1XNRJ 4IXCA 2CPFA 4CF0A 1X5OA 5SWMA 3CPEA 1XEZA 3HHKA 2QJ3A 3AO5A 2BABA 3DLKA 2ZH6A 1IG9A 2ZVIA 3D2FB 5HATA 2Z2MA 2YBVA 2ZBIA 4NXNF 4YB5A 1NOZA 2DFEA 3SAGA 4O44A 2DEIA 3VF2A 2OPPB 2HQIA 3FQKA 3D0HE 2O8FA 4CZLA 3I8DA 1R7IA 1TZ0A 2XMVA 3HK2A 1N0UA 2VQEK 2UXBJ 2IS3A 1EXQA 4R8UA 1WSFA 2MKHA 2CQBA 3R5BA 3ZSXA 3BGLA 4PWDA 2QLWA 4BE0A 4FWOA 4I6MB 1U2FA 2K3KA 2V9WA 4BREA 2B4UA 2DH9A 5I42B 4ZPCA 4OI3A 2DNOA 2Z2LA 3ZT0A 1G7CB 2W7PA 2ZJRL 2AJ4A 2ZZMA 2ZJPL 1SZ2A 1QUPA 2KN4A 4Z7CA 1U47A 1ASWA 1RTHB 5HMZA 1S9FA 2B51A 4RUHA 1G99A 2P9NA 2E1YA 1BA1A 1VIOA 4F25A 4WCEL 4FSVA 1W2BR 2PYJA 1BC6A 2VG5A 2DBBA 4P71A 1VBKA 1WD6A 4OI1A 4CEDA 2BRKA 3J7YU 2CZ9A 3NGDA 1Q7YT 3TAFA 1JWWA 3QNNA 3QICA 1HHQA 4GRSA 1RJJA 2AIRB 2CPJA 2CNOB 5AQJA 2A0FB 2DFHA 3LP0A 4PXBA 1X5SA 4CBUA 1HBMA 4Q2MA 2YQ3A 1ZBIA 3SIPB 2VC0A 3HT0A 3K5PA 4KGKA 3CJKA 4JI2K 2ZE2B 4O44B 1ZBHA 3V1OA 3LAMA 1PIEA 3V2UC 4NA2A 2O8FB 4FN5A 3DOMB 4GVEA 4OMFG 1R43A 4BDPA 3AA4A 5C10A 3M8QA 4MJKA 3KYLA 5AFUA 1FK9B 2YWWA 3M6WA 4RNNA 3EPIA 1JKHA 2OPQB 3G6EN 3ZZTA 1QTMA 3ZZUA 3UR3C 1M1KT 2A6AA 2ZH1A 4Y0WA 2MYFA 3HHNB 5AQUA 2QA4G 3HFKA 4CJWA 4Y2IA 2O01C 3DWLA 2C3PA 4LFAJ 3EUNA 2VG5B 4B9TA 2ZWHA 4HTLA 1S6QA 3QIPB 1CZ9A 3DM2B 3I87A 1K73T 2LQ9A 1A5VA 3CQ8A 1FRXA 3O9QA 3MMVA 4GVBB 1HNZF 3TWHA 3GV7B 3GFHA 2DNNA 4X4SA 1YAGA 1JLAB 1F5AA 1RAAB 3MMBA 2NUUG 2CG8A 3SMZA 3D1OA 2KTQA 1GLAG 2BJ3A 2F40A 4JI1K 4IOCQ 4KHPF 3LP0B 1KFDA 2AYMA 4N56A 3UKUA 4FJIA 4CF2A 2IJRA 1HBMB 3TZXA 2QFJA 3SBGA 4CEFA 5J2NB 1M5SA 4CD1A 3OS1A 2E2NA 4PAAA 3GR0A 2ASOA 3AAQA 1SI9A 4NLBA 3CJKB 1P1TA 2O8CB 1X8DA 3OYKA 2M7SA 4X64F 2Q2RA 1X4AA 2HGNA 3EKSA 4I7FB 4DFPA 3DJCA 1HI8A 3R2DJ 2CGJA 2GGPA 3K7RA 1SKRA 2GQQA 3ZO7A 1IM4A 4FOIA 4HHTA 3E66A 3LF0A 4JUZA 4OZ0A 3OFHA 2MZRA 4LVNP 4KBIA 4WBFA 1IM6A 1W97L 4HWIA 2E66A 5HLFA 4QIWD 2K8GA 1R0BG 2G1HA 3P8BB 1K9MT 5JVGL 3O1WA 4C3MA 3R8YA 1RAHB 1RFQA 5CYQB 3PDNA 2VA2A 5B8HA 1P6TA 4F2SA 5D3GB 3PHTA 1SIWB 3TAGA 4DU7A 4U7CA 1N5SA 1T44A 4X62F 4M3XA 1WBBA 1TK5A 2J6UA 1S6QB 7FDRA 3KMQA 4H4KC 4DPXA 4OJ3A 4L8RB 1VQON 2E5JA 3OTOJ 1P9YA 4F4XA 4DPWA 1BE4A 2VQEF 3SCKE 4BRKA 3MTJA 2GV9A 4B17A 4O3PA 3MPDA 3TVKA 3VTHA 3LPTA 1VSEA 5EXWA 4NCGB 1XMQK 2CZ4A 3DXKB 2F8SA 2W4CA 4A8SA 1BWFO 4LY7A 1I39A 5J1EA 4KHWA 1G1XA 1FVQA 4BR4A 1H72C 4FWMA 4I9LA 1NDLA 3BGOP 4B3RK 4LR7A 4Q0BA 2M88A 2IAJA 1PCAA 3RRHA 2WFBA 4ED8A 1NNDA 4CO0A 5HMXA 3NS5A 3PKMA 3AXKA 5LXRA 3NMUA 5B0BA 3CCVS 5BPMA 3M8WA 5BPNA 7FD1A 2GGPB 1WNSA 2IM3A 1NDKA 4TLQA 3NFAA 3C16B 4BE2A 1HBNA 3K57A 1MNEA 4X65J 4ILGB 4WE1A 4IDHA 3AVNA 1OYEA 1ZBLA 2IDLA 2ZWPA 5LM7E 3MM6B 1SAZA 1HYSB 1VC0A 2RD5C 3FC9A 4CEQA 2UU9F 4KHYA 4K42A 4JI2F 1FJGK 2HURA 2C22A 4K4VA 5D0RA 5CH7B 1AW0A 2FLNA 5F8MA 2BMBA 3M2UB 3R8EA 2PMHA 2MEWA 3W63A 2VB6A 2CJXB 2VICA 1QVFM 2XCAA 3IRXA 1IBKK 1XMOJ 2XGPA 4P6QA 4ECUA 4X64J 2BJ7A 2HHHJ 2VQFK 1GEHA 5D0EA 2ZZNA 4FPAA 1NOYA 3I0RB 4Z0UA 4FS2A 1KR4A 2IC3B 5M2PA 2AJQA 2L48A 2RU9A 2OSRA 2R8HA 1WHYA 2E20A 3W9IA 2E6MA 3ZT2A 3C14B 3KJNB 3RAXA 3FVYA 4B1WB 3MM7A 1QVGM 2YNIA 3LO3A 4X4UA 1QAYA 3HFZB 2FHJA 3VALA 3O3HA 3AY9A 2MZQA 1WHWA 1F6TA 2IBKA 4F3OA 4ZPDA 2DNHA 4ZLLA 3CJ1A 3H3OB 3C66A 1IXKA 4IFVA 3QT8A 2L41A 1ZH5A 3GFXA 1U1OA 4MIAA 3NGZA 1QY7A 1RB0A 3I5CA 2M2BA 2H65B 4UQTA 3D3BJ 1S6PB 4E19A 1T05A 4B9MA 2NNWA 3ZTQA 3GE1A 3CC4S 2VQEJ 2WOMA 4ZA1A 1T6DA 3V1RA 3A5OC 3W61A 2X3DA 4S0MA 4BHQA 4JYAF 1XR5A 1YSJA 3V9XA 2NYHA 4HHJA 4GVMA 2AWZA 2NRXA 1HHTP 3AXMA 3FRYA 5CE3A 1O5JA 3R3TA 1ROFA 2X6NA 2DXFA 5AQMA 1N6QA 4ILMA 2H54B 2J7KA 2YPZA 4N8OA 2Z58B 4DMNA 3IBFB 5KG2A 4GVLA 5ADZA 3D67A 1E4GT 3OYEA 2G4BA 2C28A 2KB2A 3EVOA 4XTTA 1BUXA 3GB0A 3T5HA 4OYPA 3VQBA 1QHTA 1VQSA 3UCZP 4WYLA 1PGZA 2BQUA 1OIAA 4OI6A 1YDLA 1WAJA 4B8CA 3MM7B 3W64A 2ACMA 3P4IA 1C4AA 5AZJA 4QQBA 2YNIB 4CFCA 5M1OA 4I1TA 4TKTA 2QEXS 5KFEA 2H5JB 2HNDA 4P2XA 1N54B 3EKUA 1S97A 2BV3A 1TELA 3BBBA 3P49B 1Q0NA 3AY0A 3PNIA 3W9JA 4BRAA 4USMA 2QYCA 1NSQA 4JI2J 3BPSP 1RT4B 3BEXA 1CJTA 4LF8J 5LSRA 1P8ZA 4FDFA 3ITHB 2D3UA 3TI0A 3AVCA 1VDHA 3KLGB 1XMQF 2A2CA 5D0GA 3SUNA 3OYFA 4EEYA 2YJEA 2FSJA 2NRRA 4I69A 1HBUA 5KPTA 4O8UA 4UOFA 4E3SA 1BU6O 4DZ6A 1FW6A 1P1LA 1RA6A 1ZM4A 4M42A 1JLEA 3S1TA 5KT2A 3EVWA 1J5EF 1UTAA 1Q16B 1XJWB 1JLFA 2ILZA 2E5HA 2ALZA 3A3OB 4NOHA 4NLXA 3OTCA 3NNAA 3VAJA 4J2EA 4RNHA 3WZ0A 1HYVA 4CEBA 3PEJA 3ZZPA 4H0PA 2Q6CA 4DQRA 4C0BA 3O4NA 5BYQA 5KFUA 4P73A 3BPDA 4WIQA 3POTA 3AA8A 4RW6B 4LF4J 4A5AA 5AFUH 1BO5O 5CZ1A 2X1FA 4H5WA 3VQDA 1JLQA 1VRUB 1LK7A 2MDAA 2RQCA 4DCHA 4W4MA 4J9NA 5BRFA 2MKJA 3RUBL 2BH1A 1U04A 2GCFA 3MUVP 1PBAA 2VODA 4JI1J 2HNDB 3DOLA 3VQPA 3UDEA 4Y00A 3BUZB 4DV7K 2ZBQA 2MKCA 2XY8A 1RE1B 1MMDA 3A8EA 5MLCQ 3QJJA 2CQ4A 4LSNB 1VJQA 4CO2A 2NXUA 3CCMS 5BR9A 2UUBK 3MCPA 3HHLB 1CJTB 1RBVA 5C0YA 1LQ9A 4P74A 5F8IA 1S1VB 1WN7A 2F9TA 2HEKA 3QGHA 1YHQS 2J6TA 4QU6A 3MXHP 1DT9A 2I38A 4QYZK 3EN9A 1T8EA 4JK7A 4DR3F 3SCJE 3CHWA 4NX9A 4F8RA 2HGLA 2X51A 2QLBB 2C2ZB 4PWUA 4IEEA 3QT5A 4MMOA 3GIMA 2FYXA 2B5JB 2FZCB 1JJ4A 1NK4A 2D0OA 2NYIA 2B9EA 3WNFA 1NMDA 3U3YA 3PW0A 2H4YB 3ULDA 3KLIA 1WHVA 1T3NA 4KHQA 2AX0A 5L9NA 3AVIA 3QEXA 2YHAA 3BREA 3CD6N 2PFUA 4U8YA 1TKZB 3PG9A 3DYAA 2B4OA 3EGVA 3L4QA 2P2CB 3POTB 5GMDA 3QFHA 3CCUN 3TABA 3SQ2A 1TL3A 3OQ2A 2VPWB 2UVRA 3WNHA 4DQIA 1JLQB 1GLBG 2PO4A 2JEJA 2Y3YA 4QS9A 3IXQA 4WIIA 2BE7D 3PLAA 3KUEA 4BRGA 1HNWJ 2V5HG 4M3YA 4DF4A 1RT5A 4ED1A 3DU5A 4EWTA 1XMQJ 4C9DA 2RHQB 1SV5A 1R31A 4DFMA 3DRXA 3D6RA 3ZX3A 4J2BA 2R8KA 3VN5A 2R7UA 5TKYA 1YVFA 1Q81O 2VGNA 3FLCO 3V6DA 2WBMA 4B3RJ 4OPHA 2OP5A 2QX0A 3A4TA 2YY3A 3A2FA 1FEEA 2HHPA 4ZOSA 3RJMB 5KT4A 1LWEA 2CDRB 4HH0A 2E5IA 4IOBA 2V4QA 2VFSA 4PXCA 5AQNA 1FJCA 2R2RA 5F8NA 2BZ2A 5HAOA 2OTLS 2CJYB 3OHBA 3IM9A 3DLLL 3O3LA 4AD6A 4FZVA 4OYIA 3H5SA 3WQUA 2VBZA 1J9AA 4NEZA 4CIEA 3CSKA 4C7QA 3CD5A 1X7VA 2IFXA 4IEIA 4UF4A 3MWPA 5KFLA 1VR6A 4ZCMA 4NA1A 1VHIA 4FPRA 4P2SA 2HHQA 4F3MA 1Q8BA 2XMUA 3D3CJ 1ZBFA 1PC5A 4CJ3A 2YXLA 3CUNA 4DCOB 2FD2A 3KLIB 4C1NI 1CPZA 2R7YA 1L3UA 3NWRA 1WJ9A 3IR5B 4ELTA 2W4DA 1XI1A 1W26A 2FY1A 4C8ZA 2E4LA 1FJGJ 4O4RA 1TL3B 4KE5A 1CVJA 2DGOA 4M5KA 4PKIA 4ECQA 4OLBA 4L75A 2P5OA 4AL5A 3T1YK 2JGUA 4ILLA 3GQCA 2NRWA 5SZTA 1O13A 4ZPVR 3CC2S 1IBKJ 2N3OA 2QL5B 2XI2A 3KHHA 3FR0A 4WFNQ 2VQFJ 1SV5B 3NH2A 1DY3A 3W8GA 1JCEA 3JQKA 1YJ9N 5A8RB 2D41A 2IDOA 4H4MA 1I3AA 1XN9A 5JUMA 4ZJQA 1ZZFA 4XIUA 3RB0A 1GFWB 8RUCA 3RSEB 5LMUK 2DCUB 1TK8A 1MW7A 1RT6A 1Z25A 4RW9A 1LWEB 2PEHA 1RDWX 2X78A 5K9FA 2O8DA 1RCHA 3VCDA 4OZJA 3MMJA 1C0GA 1U2RA 3LP1A 1UKUA 1YVUA 2ZGZA 1CQNA 2XMJA 1KN6A 1MU2A 2YWHA 4B3OB 2WONB 3HVRA 2HFUA 2YX4A 4NCBA 2RH3A 2HB5A 4BR5A 4HT5A 1NSKL 3FCHA 1NJIO 2F8MA 3N28A 3KK2A 4ZVHA 4GY2B 3O4QA 3ZSRA 2CH6A 3MCAB 1KP6A 1FDAA 1W7WA 2BUPA 4DBQA 2UZAA 2Q97A 4K5SA 1G4CA 2UUBF 2FBVA 3ZT1A 2G0JA 1X60A 2Z1HA 1PSDA 5MLCV 4FZXC 4OJGA 1IKVB 2E44A 1TR0A 2KG1A 3VPZA 3A5LC 1RAJA 2ZBPA 2R4FA 4UW2A 4Q43A 1VQ7S 1Q8KA 2O8BB 2EVZA 1RWUA 3V4MA 4BC3A 4CECA 2JFDA 3LDPA 1NWKA 3W5XA 2JVOA 4F04B 4B3MF 5F8GA 4U95A 4IKAA 4AQYK 3FCVA 4NLQA 4QBUA 1N0VC 2DEJA 1V4SA 1RK8A 3IMXA 1E6YA 2O8DB 4FOEA 3AVAA 3WX8A 1WACA 2QMUB 3LP1B 4LBIA 2UVVA 3DLEB 3OFEA 3WEEA 4DL5A 2V63A 1MU2B 2HLTA 3H2UB 2KYZA 3JS9A 1YVNA 2EKYA 2V7ZA 4B9VA 4NI2A 2VH7A 2W9CB 3BO2A 1RBAA 4JK9A 2JEGA 2DHSA 3DGPA 3GV5B 1IKWA 2WTFA 2P9EA 2NPFA 1DTQA 2QLJB 3C65A 3MCNA 2F7TA 3RWUA 5KAKA 4P52A 1O6XA 4L3KA 3C15A 3CJ7A 2BANB 1NDPA 1MA9B 1OQ3A 3MOZA 4HCCA 2O1PA 2GVDA 2F8HA 4DLGA 4YNQA 4QU7A 3UW1A 1H7XA 2DCLA 5E3PA 3NOGA 3NF6A 2AF6A 3FCWA 4CGHA 1AT1B 1X4BA 4FYVB 4A4JA 2Q36A 2LXUA 3GJRB 1IJFB 4KPYA 3KHGA 3HM9A 6FD1A 1YJNN 4ZJLA 4WFBL 3UDLA 4BQLA 3S6EA 1HQEA 2PDAA 1HNIA 2Q1NA 3TA2A 3N6MA 3Q2SC 2FVQA 4E1NA 3GG4A 4EBCA 4ELUA 3TZYA 3E01A 3R2CJ 2Q66A 3H0PA 4EO8A 2OEKA 2QA2A 2G8IA 2B43A 2RVJA 2O3DA 4BDZA 1VSDA 1H74A 3PYEA 4MLHA 2H3EB 2F96A 2GMLA 1RT3B 1E6YB 3VAIA 1RWWB 1VSLA 4OPKA 3QMLA 3PCOB 1QAXA 4ER8A 2QK9A 3ATVA 1KRPA 4DV7J 2HNYA 4ILRA 3WEEB 4JK8A 5CABA 1YTUA 3HD2A 2QL7B 4FJ7A 1OSDA 4LF7K 3AD9C 1CLFA 1J54A 3E9LA 2UUBJ 2P51A 3TQEA 3AVBA 4M7XA 3SZ2A 3TWZA 1OKJA 2QTDA 1IKWB 1VYAA 3HDSA 3VERA 3BR9A 1U1PA 3GV8B 3H90A 4QYZJ 4QIFA 2LEPA 3KWMA 5KFFA 1T9TA 3ZC4A 4IO1A 1QVFR 4CLTA 4WZMA 4Y2CA 2P5VA 5KG3A 1JL1A 5LMUF 3IFRA 2KKZA 3TJ8A 2VFRA 3HKZD 5CHCB 3L2RA 4Y3CA 3VVTA 2YHYA 1HR0F 4KIAA 5GAGP 3ZLJA 3UNYA 4ECTA 2DY1A 5AQHA 4F9OA 3KK7A 4URQU 4RBTA 3BS9A 4LRCA 5GINA 4C98A 2WVCA 1QVGR 3VQ5A 4NZ6A 4IJNA 1FNMA 5HRNA 3CXCM 3BB5A 2XLKA 1HNIB 4FZYA 3PACA 5L1KA 3RR7A 2EEYA 2WSCC 1CJVA 4F0MA 2BM0A 1QSYA 4B1VA 3HZ6A 4UQGA 2JFKA 2E5GA 3O9RA 2RDIA 3MN7A 1RT2A 2DNQA 2HF3A 4C8MA 4HVZA 3ZZ0A 3HRGA 4C0OC 1YBUA 3LGNA 3WNGA 3OYGA 3O1BA 1NPKA 2FJVA 1KVKA 1L3KA 3BKFA 3M6GA 2IRXA 4I6AA 4FO0A 4BDYA 4LRAA 3AVFA 4KR0B 3WXJA 2M3DA 2HNYB 2F5GA 2V68A 1DHMA 2EG1A 4LFBK 5FRNA 2W9BB 1IVZA 3CI5A 3J80U 4CHZA 1RZMA 4LRDA 4CF9A 3GZ7A 4ZIWA 1Q86O 1FXRA 4M95A 4ANEA 1NMNA 4HUEA 2C3OA 3OLBA 3WT0A 2QYGA 4FF2A 5FDLA 2ZD1B 4CGDA 3QAEA 4M3RA 2IPOB 4FJ8A 4B02A 2PYLA 1F2HA 1RWXB 3IS9B 2ZH8A 1UWBA 3QWPA 1NGDA 4URSA 3OFFA 2C2OB 3JYTA 2HIYA 5ADXH 1V6HA 4QWBA 1JX4A 3BH7B 3L3UA 3FRZA 3OL8A 2G8KA 3EO3A 3C94A 4JKFA 5E5NA 2HHSA 3SBTA 4AT1B 4FJXA 1HPZA 3CULA 3OYBA 1HARA 1DKGD 1S5ZA 1QS4A 3VAGA 2DRDA 2E5LK 1RTJA 4CHQA 4O5FA 3OYCA 3KLFB 1SVDA 4IYQA 4A2BA 4ELVA 3THTA 1ZA2B 1FI4A 2OPRA 2D7SA 2P9PA 3KHYA 2DNMA 3H42A 2CJBA 3MAAB 2L08A 1Y5LB 3FZLA 1VQ7N 1L3TA 4QS8A 4DSJA 4MFBA 3HHLD 3QPIA 3TVZA 3P45B 1RT2B 2NSBA 3T1YJ 4DR4F 5C2CA 3OD2A 1NGHA 1RABB 4BG9A 2KKHA 1EAYC 4JKBA 3MDFA 3A8IA 4JD2B 3CCLS 1TL1A 4ES1A 4BWJA 3TRGA 3KVGA 3BR8A 3KHLA 4P2MA 1MWYA 1QTNB 4UOGA 2V8VA 1YJWN 1U8SA 2KI2A 2VG7B 3V5RA 5KFMA 3GBTA 1S1WB 4PKDB 2E1MC 1WB9A 2F4VK 1S49A 1DFDA 4PRFA 4B3SF 2AJFE 2ALYB 2IIHA 3GJSB 1FCAA 2BJ9A 4FWKA 3B6PA 3RMCA 5C2GA 3D1HA 1LK5A 3L7OA 4YB7A 1K47A 3EGNA 1OY6A 1UMJA 2CAJA 4DJBA 1PJ7A 2MXYA 3C6TA 3H7HB 2AQ4A 5C5JA 2ZJPQ 3RBZA 4O3SA 1HPZB 3EE3A 1LXJA 2P9IB 3MHYA 1M5HA 1CULA 1FJ7A 1T9VA 1RTJB 2W2OP 3K5OA 2A42A 2Z1GA 4U7BA 4JAXA 4TN2A 4HI2A 3M2RA 3M1FA 4H5TA 4CLZA 5BN9A 1SQKA 4CFAA 2ZH4A 3L8BA 3KDNA 3TUJC 4FJJA 4UUXA 4FLZA 2LLZA 3LDQA 3I5AA 1ZM9A 4DR5J 3QNWB 2X3GA 4M3TA 2J5AA 4IQXA 3ILIA 1BQMB 2EFPA 3A5MC 3GSIA 2DXDA 1UL3A 2V7YA 1KD1O 2RJZA 5DO2A 2NSCA 2G0IA 4JKDA 4CHOA 1RA7A 4ZP7A 4DFKA 2JWKA 2HMPA 3LUYA 3MMAA 5B09A 3OYMA 2KFNA 3MEGA 4FVUA 2E1AA 3A8KA 1EB0A 4AQYJ 4IRDA 5CQGA 5IZHA 1H2UX 1QE1A 1NGGA 4ECVA 3CIPA 4BRNA 3MOJB 4OI4A 5DG8A 1U6ZA 1SQFA 1VLOA 3HZGA 2FDNA 1NH7A 3WUHA 4PPZA 4E7JA 2AT1B 4NLWA 2CNLB 1KTQA 3ET6A 2BA9A 4DDFA 3VA0A 3UE5A 4NRTA 2ZQBA 3F73A 2BVZA 3AH6A 2GVZB 2D3OR 4W5NA 3LGHA 4H0XB 4M5NA 3GE9A 3V4IB 1RAOA 3DOKA 4FBUA 3C6TB 3EVMA 2WRMA 1XNQK 4CT9A 2VASA 3D6MB 4JS5A 2GUPA 4LMZA 3HPGA 4C8LA 4LFBF 1HNVB 1CULB 3WXMB 4DL3A 2YHWA 2EI5A 2NRHA 4B1XB 4F3TA 4CDIA 1F5BA 1RWMB 5KFSA 1UA1A 2SXLA 1F9FA 1D8ZA 1N5QA 2GNKA 2UUAK 3E51A 3OPKA 3HM8A 2GJIA 3CEDA 3Q83A 4OPJA 4GW6A 4P7VA 3CT9A 4OV6A 1U48A 4KFBA 2QWRA 4CWBA 3UDVA 2K2PA 4XAKA 3W66A 4ISFA 5GAHU 4LFCF 5M1QA 2DRBA 3SEOA 1EETA 3FZHA 4BC9A 3T69A 3ENQA 3L4BC 3FFIA 1NSPA 2L3MA 2BKPA 2VA3A 2RN2A 4MH8A 4OI0A 4FJ5A 2U2FA 2ASPA 5B0AA 4GKKK 2E5LF 4C2MA 3PW7A 2WTUA 1N34K 1WKKA 2FC0A 1FF2A 3EZUA 3NGSA 3J81Y 4AFFA 3K0JA 3HVAA 4TXSA 3CJ3A 1S76D 1VQ5S 4USWA 4RUCA 1SB6A 2OZSA 1KAXA 4FXVA 3L0QA 3O4WA 3KD5E 3FEYB 4LF7J 3ALYA 4OO1J 3MECA 4JI7K 4V19S 4EYIB 5D8HB 1M90T 4OYZA 3SXLA 4C11A 2I7PA 4GV3A 4OHZA 4CRJA 4ZLNA 4KHNA 4A8OA 5GADP 3V9ZA 5LY3A 1X31C 3DOKB 3SDEA 1I1GA 3P38A 1APSA 4KI6A 4ZCIA 2MKKA 5JVGQ 5CD4H 4KAZA 4BRPA 3CJ4A 5ETVA 3A8JA 5H9FJ 2F8EX 1DTTB 2JJ4D 3UO0A 1YI2N 4JBCA 2V2VA 2KVQE 5KFVA 1IV0A 2D9PA 2EBGA 4LF5F 2GW8A 2JSXA 1PJ6A 2G2YA 4I0WA 3RW6A 2MJNA 4DTJA 5F9LA 1K44A 5IWAJ 1LW2A 4KFBB 4RW4A 4JLHA 4BQZA 1I94K 4H4OA 4KB0A 2HMIB 3QBXA 2WBNA 1Z1ZA 3MURP 5IQ6A 2QL9B 4X84A 2C3YA 3EDQB 3A5NC 1KTVA 3ENWA 1KEKA 4M5GA 2MSTA 2BJ1A 4J90A 4I6YA 1EETB 1WEYA 1BHNA 4K7QA 5AQRA 1LFPA 1K0VA 1EQMA 3R6MA 4FXDA 4U7UK 1S9GA 3EE8A 3BJYA 3GJTB 2IVNA 2MQOA 3CCWA 3QYYA 1RNHA 3G82A 2RQ4A 5EDWA 2DK2A 5ETLA 1OH5A 3OVSA 5JLFA 2AP6A 4AUKA 4RW7A 4E8UA 4WYWA 1VC5A 2YNFB 1S7IA 1R8BA 5KG5A 4EP5A 4DTXA 2XWXA 2ADCA 1LXNA 1S3XA 4FLUA 1P8GA 4ISEA 2KHCA 1VMBA 4CF1A 3SDEB 4HUFA 1FRHA 2FVRA 3Q8UA 5DDQC 4X4NA 5EY4A 2W7AA 5EVZA 2E9TA 4QWEA 5C42B 3JSYA 3OL6A 4NWBA 3G8TA 3JSMB 1HKBA 4KO0A 3ISZA 3T1AA 1C0MA 5G4DA 4Q5VA 2J0QD 3PR5B 5LSOA 1EHWA 1ESVA 1OS5A 1VGYA 1SPBP 4IFEA 1QDUB 5JMNA 2MHNA 1NK6A 3OXLA 3T6BA 4GNIA 2E5LJ 1TUGB 2VKRA 4CLWA 4K25A 1BQNB 1C0TA 5L39A 3DXSX 3MEEA 2QA1A 4NYZA 2E1ZA 5IT4A 3VOVA 2GAGC 3R9LA 1FESA 2DPNA 2HNZB 1SUQA 3AVKA 3LTOA 2YWFA 1WSEA 3PR4A 3AVHA 1K0TA 1R59O 2HVHA 4JI6F 4EHUA 1FX2A 1RT7A 3O6WA 3T5KA 5CXTA 1B9DA 3IWLA 2VOOA 3I56S 1OY9A 4WFAL 1EQ0A 4RW8A 1S9GB 4HKQA 1BI4A 2IVPA 3UB5A 4LSLA 2KDOA 4XH4A 2UXCF 2NREA 5KFJA 2AJ0A 2DPJA 4CCHA 3QRQA 4YR3A 5IFMA 2DNGA 3ZEUA 4RW7B 2UUAF 3EICA 3HTVA 3EJMA 4LVOP 1Q9XA 3OTDA 2A10A 4CESA 1ZAVA 1IBLK 4Q8FA 4PZVA 4Z4CA 3OVBA 4DV0F 4YOVA 4OHYA 1FKPB 3A3NB 3O80A 4J2DA 4DQSA 2PA3A 2IVOA 1F60B 5KFOA 3OW2R 4CHPA 2F4VJ 1Q8IA 3S41A 3KMSA 4ZK7M 4WXOA 1D09B 3CMAN 1CJUA 1X4HA 4Z94A 1N36K 1H2TZ 3QATA 1UJ5A 5AE1A 2P9KA 4XDCA 5FIIA 1KQGB 4FJMA 4BACA 1XR7A 2HFNA 1N34F 4XEIA 2WVFA 4B9UA 3FQLA 3NNHA 1FVSA 5A76A 3DLBA 4IWVA 4DV5J 5AQWA 2QV6A 5AR0A 3KLHB 1U6BA 3J7AN 2IBOA 1BGXT 5E2QA 4CIFA 2R7RA 3NGKA 4BRLA 1QZ6A 1YUWA 3BZQA 1QZ5A 4JI7F 5GAEP 4RG8A 2KM8B 4C48A 1B7FA 5I4MA 4RWTA 2X1BA 3DRRA 4GKJF 4B3TF 2OMLA 2IOCA 3GLJA 2DIUA 1NEEA 5I9EB 2KHDA 3QGIA 2LYVA 5FLXU 2FLOA 4YDUA 4A57A 3GP9A 1FEHA 4RW8B 1BI4B 1UAXA 4MDAA 3W3DA 4Z37A 5DLGA 4JI3J 3B4MA 4K2JA 4KH4A 4IG0B 4USHA 3F9MA 3H4DA 4ECXA 4CJQA 1JLBA 2DHXA 4YB6A 3D1QA 4KH1B 3CCZA 2P9CA 4M94A 5J2MA 1OMSA 2O67A 4A8FA 3VQ8A 3JAMO 1C2PA 4TSXA 3CCSN 1YQHA 3AVLA 1I94F 1ZM3A 2VPYB 3MWBA 1U8WA 5KFGA 2ASJA 2I8EA 1V3SA 2WCXA 1VK3A 2CADA 2XMAA 5AQYA 4KYZA 1KHVA 3BN4A 4R5PA 2B0GA 1XMBA 2CG4A 1C6VA 3AAPA 1NLKL 1OSCA 4IG3A 4FM0A 4DCJB 4TU7A 4J9SA 4MTPA 4RUAA 1SJ1A 4IUFA 3OUYA 5D4OA 4UTGA 3S8SA 2QWPA 1CJUB 3CXCR 4YORA 4USKA 3CTRA 2UUCK 3AA2A 3CCJS 3TTCA 1NPPA 2Z2YB 1U1NA 4FPIA 1HL6A 1XNQJ 2VU5A 3UVJB 4TVAB 2VL1A 1C1CA 1H0HB 2HZCA 4RLEA 3DLJA 1TYQA 2R7SA 4FWSA 4CNZA 5HVGA 4PXEA 5KFCA 5ELZA 4BE1A 1G3OA 2R7TA 1ZYQA 5I3UA 3QSYB 3DRRB 5D15A 3FK4A 2KL8A 4OI2A 4JV0A 4NLCA 3DXMB 3MDQA 3T41A 1H2VZ 3MM9A 5KFAA 2XG8A 3MPUB 3EGWB 2IM0A 3K5NA 4WU2A 1WC6A 3OLAA 5ETPA 3KJVB 4I2QA 3OTBA 4KHUA 3QBWA 2Z1JA 4CZEA 2DR6A 2ROGA 2KT5A 4CGGA 2BJDA 4W92B 2E2OA 1VQ9S 5J2MB 2YKQA 4GKKJ 4RKUC 4OFZA 3J80Y 3FSXA 1PYOB 2GWJA 1TKTA 1FD2A 4LQ9A 4N47A 4B08A 4PG4A 3AO2A 1S4EA 2EHGA 3MCOA 3BGRB 3ID6A 3ICLA 3AO4A 2MQNA 2DNYA 1PJ5A 2CVEA 9RUBA 4ZDNA 5CR4A 1LW0B 1Y3KA 5A2QY 1UFWA 2DPIA 4AE5A 1RCXB 2RHKA 2VWJA 3P31A 3NGTA 1UVKA 1I5OB 3NBPA 3LANA 4I2PB 4P75A 5T7LB 3VAFA 5K14A 2DO0A 4OX9F 3TUIC 1T6CA 1VISA 1J6ZA 2JX2A 1VHFA 4I68A 4O23A 4USVA 1RQ0A 4ECRA 4P10A 4NYPA 4W5QA 2PA8D 2NPIA 4YEAA 1UOCA 3KJQB 1REVA 3QLHA 4QZVB 1C0UA 3LDNA 3M9NB 2HBZB 1KSPA 5BJRA 3BH6B 5HSPA 1JXBA 3CDWA 4LD0A 4HEA9 3VVUA 3PRVA 3DLHA 5HO4A 5F0WA 2G8WA 3PW4A 3WNEA 1GNKA 2EFGA 2QWMA 1NDCA 3SBMA 1KAYA 2RRBA 1N88A 3W62A 4CQ1A 1IH7A 4Z4IA 4JI0F 2BUNA 4LBPA 3C6UB 4NLVA 2QWNA 1NG9A 3QNOA 1WDDA 1IKXA 4PUOB 4NLPA 4LRBA 4ZITA 1RDCA 3K2YA 4CGJA 1YJ7A 1U49A 3B6BA 3H5UA 1XC3A 1NNEA 4CJ5A 1LAWA 4OYMA 4O4GB 4Y28C 1VSKA 1VLYA 4KAIA 3CC7N 4LC9B 3GG0A 4YY3F 4OVLA 1MROA 1EP4B 3GFZA 5HBMB 5IQQA 3ENHA 5T41A 2ZH9A 4DUZK 2VC1A 2Y8WA 4A61A 2A5XA 1W2IA 5LMNJ 1WC1A 2Z30B 3K17A 4FKXA 3G8SA 1KCFA 2QA4N 1AUSL 2B9XA 2HRUA 3EYZA 1N5YA 1RHRB 2ZITA 4ZS6A 5E26A 1EWRA 3RAQA 4U6PA 4ZLJA 4F0KA 3G9CA 3AB4B 2KJVA 3UQSA 4K4TA 4C23A 2ZM6J 4E0DA 2HFZA 3SQ1A 2RS2A 3CW2C 4ICLB 3KFWX 3H25A 1Q82O 4HDGA 4WFZA 2YKOA 2ZF5O 3SQGB 3TSQA 1U2VB 3W5YA 1CJKB 1E6VB 4KHMA 1NBEB 1T03A 1NM2A 1NKBA 1KC8O 4DG1A 1BG3A 1RAFB 4IOAL 3LQVA 3KUGA 2KU7A 4FJHA 3QFPA 4A59A 2JH3A 1NLVA 3OFGA 3THYA 4ED2A 4N5SA 4YP3A 1NJZA 3US5A 5KOXA 4G1QA 1TL5A 2V69A 1N32F 1G15A 5KFBA 3IBCB 2MZJA 2QI2A 1TP7A 2R8IA 5J2QA 2FF3B 1Y64A 1SJ3P 5EU7A 2MPUA 5BREA 3Q23A 4WK3A 2XS5A 4X4OA 1UZDA 2A6OA 3E8OA 4FJ9A 2EPIA 1S0NA 1FD8A 5JMVA 1WLJA 3CDEA 1N5VA 4DV3F 1LEOA 3WC2A 1FRJA 2A6MA 3PW2A 1Y10A 2ZNYA 1S5JA 2DB1A 2WK4A 3H3NO 1FJEB 3VQQA 1IBLJ 3T9ZA 1WF2A 2ZKUA 3ULHA 1B0VA 3ZNUA 2EWHA 5A0YA 4RNMA 3U7JA 1FRKA 1HMVA 1Q53A 3EZWA 5K8PA 2K1RA 1FRMA 5IC6B 5K20B 4BLGA 5LT5A 3NF8A 1BOTO 1N36J 4X66F 3ENOA 2HSTA 5AJ3F 3T5JA 4Y1DA 3FGVA 4CLFA 3R7BB 1F3VA 2DNPA 1K8AT 3RYLA 1YBAA 3G2XA 3SLCA 4CK2A 1GXUA 3I33A 2NQPA 1CC7A 1F2GA 2MGZA 1YG0A 4ID5B 2F9JA 3IBWA 4MQ3A 4PL8A 3FNNA 3P1GA 4DPYA 5DETA 5DZ7A 4ECZA 2OIHA 4QW8A 3C3LA 3HVTB 3MCSA 2VCPA 3WXLA 4WP8A 1ZBTA 5KT7A 4NZ0A 3ULEA 4E98A 4NLUA 4I6WA 3CETA 3THYB 3BQ1A 1NZ8A 2V34A 4RNOA 2RMLA 3QJLA 1VBZA 3P5JA 4JKEA 1P90A 1QJHA 5J2QB 1RISA 2VPZB 3DRPA 1KVBA 3QO9B 4RR5A 4EP4A 1FT8A 2CIMA 2LA4A 2DITA 4JI5F 1OH8A 5JICA 4AH9A 1WELA 3THWB 1WWHA 2HBRB 4MKBA 3VGKA 1VOMA 4RBUA 5AQVA 1R6YA 3K89A 3G6ES 1HW9A 1DAXA 2MQLA 2V2KA 1VK0A 4ZVFA 1UW4A 1R0AA 3PFOA 2RDDA 3B82A 2FC8A 1HMVB 2K1RB 2Z8QA 5A6WA 4JS4A 4IH7A 4F7VA 2BW7A 2YH0A 2UUCJ 3NS6A 1X4EA 1WTFA 3W2WB 3NGIA 4EUVA 3I55N 5B7WA 3RB4A 3M5RA 4CO1A 3KWGA 2ZOFA 2RKIA 3SNNA 1KLMA 4WFBQ 1SL0A 5KPRA 2B9YA 1IO2A 2JEFA 1XTZA 3PXGa 2QKBA 2E8AA 5C25A 5LL6Z 1JK9B 4DUTA 1HRHA 1NU4A 1SH3A 4F36A 2NZTA 3ATUA 2IA0A 3VF6A 4EZ6A 3A12A 2YKPA 4G1IA 2ZGYA 3NH0A 1FKOA 3S3NA 2E88A 5A8WB 3R5AA 3MM8A 4F02A 4F26A 2JNJA 2CJAA 1VBYA 1R89A 2C42A 5HN0A 2WW8A 3D2FA 4LF6K 3RBDA 1U2CA 3QT6A 3DRPB 2Q43A 3DDNA 2VBXA 2GS8A 4DL0C 2OPPA 4DS4A 2VF3A 4DHVA 1V9OA 2DGWA 2LEBA 1FA0A 5BR8F 1VC6A 1OVQA 1HNZK 3MXMA 1X0PA 2YI1A 2HAIA 3W2VB 4QR2A 2CJQA 1ZPWX 4I67A 4YDDB 1VQKN 3CJ9A 2AU0A 4KGXB 3F44A 1XR6A 1NGEA 4BG8A 4YDUC 4I6MA 4HH1A 3NH1A 5EX5A 2O5DA 4DWIA 4J9PA 1R0AB 4LR9A 4K8XA 3ZCMA 3O8WA 3UN2A 2ASDA 3FKBA 3R5GA 2BEFA 2CQHA 5I42A 1S48A 3NL0A 1J2VA 1Q95G 3W1YC 2FY8A 5KFQA 1FDBA 5L8RC 3SCIE 4LH4A 1RTHA 2JZ5A 4RTFD 5KG4A 5C15A 4CYUB 2ZDPA 3HVWA 1PYSB 1VQOS 2XNRA 4M63A 1WI6A 4MIWA 3O5BA 2CPIA 2FJWA 3CWJA 3F2KA 3CD7A 2XO7A 4Q45A 2DHAA 2RKIB 3AFGA 4ZLPA 5C7PA 4CZFA 1KLMB 3CF5L 3L7UA 3W7BA 3U27A 4KH6A 4TU9A 4WPAA 1RDBA 1UPPA 1X1PA 1G2EA 3N4WA 5F2RA 3VGLA 5E3AA 3LW5C 4FJNA 3CO0P 4JI8K 1YF5L 4TLRA 4NLYA 4J7CA 3VZIA 2X6SA 3R97A 3BSCA 4LF9F 1FKOB 1S0OA 4RU2A 4QWAA 3MM8B 3UPFA 4M7YA 3MTKA 3JS6A 1YITN 1NB2A 1QQNA 2R8JA 4MYTA 1RLDA 1XIQA 4YB1P 1V5IB 1GTEA 2B7BB 2O8EB 4X62K 2ZE2A 2NRZA 5KG1A 5KT3A 2KXHA 5D6GA 2ASMA 1VQLN 1J5OA 4A8YA 3DOMA 5ETKA 2FLPA 2BBEA 4H8KA 1VQ8N 2I2YA 5IT9Y 3UE2A 5HMWA 4DR6F 2QIFA 1FK9A 5KFDA 3GIRA 1U6FA 2OPQA 4CE9A 1RACB 1UVNA 3D7EO 1TL7B 2NXNA 2MSSA 1F1BB 2PC6A 3HHDA 3DKDA 4CTAB 5FROA 4DUZJ 3J7ZO 1VSHA 1OO0B 3O9UA 2XHWA 1KWMA 3W5ZA 1FXXA 1RBLA 5DGBA 2VV5A 4EK2A 3CB4A 4K41A 1WOPA 4PY5A 4WF9Q 3QIPA 3DM2A 4HI1A 3U9DA 1VAZA 3KJFB 4GVBA 2G8UA 5IV3A 3L09A 4O5BA 2QLFB 3VA3A 4FF1A 1JLAA 4AM6A 3GL1A 3O9TA 1ELOA 3J81j 3TEGA 1WC3A 3QEIA 1X4DA 4ENOA 2MZTA 3MMCA 1RCOB 4F67A 5LJ3Y 4JKAA 2P8IA 2OJ3A 3N4QA 3Q8VA 3P4UB 1S9EB 5FLXY 1OH6A 5J2NA 3R7NB 3OSNA 1E4FT 2UU9K 4ETZA 1RHQB 2CPDA 2B7CB 5KFXA 1KBRA 4DX6A 3G8QA 3HP9A 4L6V3 2MKIA 4PABA 2D0AA 2O8CA 1FE0A 1GLFO 2RUSA 2J76E 4I7FA 1J5OB 2CYYA 3J7YP 1URRA 4H0OA 2FHMA 4FXWA 3BV8A 2VPXB 2OI2A 3AB2B 2XWYA 3NS7B 1O8BA 2CA9A 4C4WA 4FWPA 4B1ZA 2G8HA 2LDYA 4PPDA 1HD1A 3U1NA 4OHXA 4CW7B 2LU1A 1Q82T 1BXNA 2CGLA 3NG8A 1VRTB 4J9QA 5CYQA 2Z4PA 4B9LA 4PQUB 3V1QA 5D3GA 2F1FA 4DSIA 4LF6F 2RHSB 1ZBUA 3D54A 3LPYA 3WBZA 4ZVUB 3OR2B 5U47A 3CJTA 5GADI 4IOXA 3MEDB 3P96A 3VWSA 3AARA 3BSAA 2VWKA 1PILA 3VEVA 3TNVA 3N9UC 1JIHA 5HRSA 1SC4B 4NXNJ 3H6EA 5D78A 1TTHB 3MR3A 3TU5A 4OKJA 2XLJA 4AHUA 4NCGA 2W1BA 2ZOGA 2I1RA 3DXKA 1Y97A 7AT1B 4DS5A 1QM9A 4OLAA 5B0EA 3MMCB 2BKNA 1RKJA 1Q78A 2F9DA 1F9EB 2B8PA 2GAHC 5KFIA 3MR6A 3L9ZA 3IA0A 4IDKB 5IT0A 4JYAK 3GWCA 5G0RB 3DHWC 1SKSA 1KOOA 3QESA 4AXIA 2ZHOA 1BWVA 2PFFB 4BC4A 1IR2A 1Q5YA 3CVKA 3I0SA 4F50A 4PQAA 2O4GA 1FO1A 1NHUA 3G71N 1KKHA 2ZBCA 1N8RT 3WXIA 1TUVA 2C3MA 2Y9HA 3VR1A 4Y1CA 2DRAA 2R7QA 4Y6IA 3ZETB 2HSEB 3TZWA 3T6JA 3ONQA 3C16A 3C7NA 4JV1A 3MAQA 4PYDA 4BC2A 3DDIA 3MPYA 2PEBA 4JI8F 1HI0P 1U0HA 1EIYB 4HUGA 4BRMA 4CHNA 4CIOA 4USUA 4ES3A 2CJKA 2W2MP 4Y0FA 3SPZA 1U09A 2QXFA 3MM6A 4ZPTR 1HYSA 1Y11A 4DQ8A 4N77A 5ETSA 1YZ6A 1GLJO 3FMBA 1CXQA 2KT2A 5E84A 1RTZA 2X1GA 4MK9A 3AJDA 2CFXA 3M6UA 3VENA 3OA9A 1VQ6N 1RWOB 4YHHK 3M2UA 4KSEB 3QT7A 4X4VA 2AYBA 4FKYA 2YX1A 3FDSA 2QO3A 2EC0A 4CEAA 4JEPA 4FK2A 2VFTA 1M1GA 4DL6A 3T7ZA 3I0RA 4J8FA 3QIDA 4OYWA 5FPDA 2IC3A 3TYTA 4ZCLA 3MPWA 3C14A 1VHXA 3O2IA 4IR9A 5KFWA 4YR2A 1J5EK 2ZC3A 3U8XA 1Q9YA 2IGIA 1JLCB 1WI8A 3TR8A 4DPOA 1S1UA 4NPOA 2GBZA 4OGEA 3KKRA 4ZTJA 1NZAA 2G9OA 4BVPA 3I0SB 2XNQA 3OS0A 2ROEA 2XYGB 1UVLA 3CM6A 2XULA 4KPCA 2XRIA 1FXDA 4KRFA 1XHZA 2JWLA 3OYIA 1LAVA 4DV4F 3JQMA 1HLWA 4WTOB 3C7NB 4KGVB 2PI4A 1MSWD 4DR2K 5FPNA 3GFYA 1WG1A 3UD5A 4CO5A 2C2MB 2NUHA 1S6PA 3T19A 1U0HB 2BW2A 1NSAA 2K7JA 1HNZJ 1O0PA 4FZZA 4CZCA 2G8FA 2PBDA 4KKOB 1TVRA 1T9UA 3TARA 2OZMA 3IAS9 1P9QC 3T1HF 1N33F 4KHPJ 1UFKA 3NMAA 4WKRA 1FRLA 3CD6S 4B1UB 4URGA 5L38A 3Q24A 2YQ1A 2A18A 3LL3A 3CCUS 2CZVC 2N7YA 4K4SA 3U6FA 1W0HA 3MEKA 3QFWA 2P9LA 3QAUA 3OR1B 3D9BA 2G1DA 4NLOA 1LWFA 3I96A 3Q2TC 1XHXA 2OO4A 2AJ1A 3AQOA 1V3ZA 2A3JA 1GH8A 3Q8SB 4DR3K 3RB3A 2AV5A 1HWKA 3OVNA 4ZTFA 1KS2A 2POKA 1VCTA 1S1XB 4OYOA 1LFWA 5GAEI 1Q4RA 3TPQA 4ZVGA 4JI8J 1HHSA 3KUHA 2M9KA 1QUVA 1S1UB 2VG6A 2AEJA 2DH7A 1U1KA 2HHVA 3HHEA 2GQ2A 2IMOA 1KONA 4HHUA 3TZZA 1NGAA 4ZVTB 2KFZA 2FLLA 3OXGA 3VF4A 3PRBA 4EHTA 4MKYA 1SH2A 4K0KK 2F7VA 3MM5B 4CGFA 1IUJA 1RT4A 4X62J 4NXMF 3ITHA 3KLGA 2CUYA 1YJVA 1R8CA 2D0CA 2LCWA 4H54A 1EQYA 4FK0A 4HTIA 2PGCA 2UXDF 1JMTA 5HVFA 2XSFA 4JI4K 4RUBA 1EARA 3M7VA 1TVRB 3GDQA 1YGYA 2HBJA 5FRMA 1BL3A 3D6HB 1CQMA 3DXBA 3CYMA 4RO0A 2YHXA 5F8JA 3DDKA 4E2FB 1BQXA 1B4SA 1VI7A 1HUXA 3R7SB 5KTQA 1K8KA 3LGMA 1OPZA 2GX9A 3KLEB 1BD6A 3S7RA 3FZKA 2FJBB 3G25A 3MPVA 2P9LB 4V19X 4RW6A 1CSJA 4C8YA 1LNQA 4KRWA 2J4RA 4U67Q 1LWFB 3I5BA 2F3JA 4QYRA 2LDIA 2P1JA 1VRUA 3PYFA 1JJCB 4DUYF 1GXTA 1FRIA 1YJ9S 3NVKA 2UUWA 4WFNL 3FE1A 1WORA 4FNIA 2WSEC 2P6TA 4J37A 2VG6B 4TY9A 4Q7AA 1MDUB 1HD0A 2R9LA 4M63C 5F1XA 1NGCA 4WFAQ 4HVJA 4FF3A 3KOAA 1HX1A 3AQPA 3G4SN 3J7ZT 1WSRA 5DS7A 4LSNA 4YHHF 3GCXP 2DR5A 2UVWA 4PYAA 2UU9J 5K5MA 4USTA 3OYDA 3SI8A 5HL7L 3HHLA 2J0SD 4L72B 1GMUA 3GIJA 2DR9A 1S1VA 4G65A 4CLPA 1JJHA 2A40A 1U1QA 3NOCA 2E29A 4ZN3A 2KXNB 5GMEA 2U1AA 3D2WA 3WXKA 1U26A 4L3NA 5DM7Q 1RI7A 4QPXA 3Q0AA 5DQGA 2H3GX 2VGMA 3MCMA 3PJWA 3OJSA 2GJ2A 3VEZA 2B5JA 2Q3PA 3FSYA 2I6WA 2QWQA 4CZIA 3THPA 1RU2A 4NYOA 1ZTWA 4K2XA 2DHGA 2KRBA 1K8KB 2DFFA 4H5VA 4L74A 1TKZA 5AQFA 1UCNA 3IP0A 4OZ5A 3G96A 2M52A 4DR2F 3FSIA 1R0CB 4N41A 3A3PB 2EG2A 4UUWA 1I3OB 2VONA 4CT8A 3OYJA 1AROP 3M8SA 2R3VA 3PZPA 3VZHA 2Z2ZA 2ASYA 1M1KO 4B8AB 5CYMA 4UOHA 1NHVA 5CCLA 4CH7A 4CK3A 1T3VA 3L4IA 1SCJB 3OYHA 4RCHA 4ED4A 2MLYA 2QFIA 1KQFB 3E1YA 1K73O 4M5LA 4JYAJ 2Y1JA 3SMSA 3MUMP 3ENAA 3W60A 1QSLA 4EBDA 2O4IA 2JC0A 2UV8A 3J7AP 4QS7A 3L2QA 4AYBD 1MWQA 2C3UA 3PV8A 4CJUA 4U8VA 3FZ2A 1KQSM 5E3CA 5DQIA 4W98A 5AXKA 4JKCA 1YRXA 3ETMA 3ZXWA 4IRKA 2P5GA 1FTCA 4B3MK 3I82A 1HIYA 1M5VC 4DR1F 4GMKA 1KNZA 4TQRA 2J6SA 2DTJA 3MN6A 2BJ8A 2MZ1A 3K5LA 3CMEN 3QETA 3Q8PB 3DLGA 4K0KF 1ATSA 4FJKA 1A0OB 3RMBA 1DQ9A 1YJNS 3LDOA 2KVIA 4K8ZA 2AX1A 3PO5A 2W6LA 4W5TA 5HOOA 1SJ4P 1UEKA 3ID8A 2YTCA 3IN5A 2EBEA 2DNRA 1LV5A 5F41A 2DGTA 3D0IE 4JI4F 2V52B 4IFYB 1K9MO 5CYMB 5H1SQ 4DV1F 2MKYA 2K7KA 3G6XA 5C24B 3CO9A 3VGSA 1JXVA 1TMJA 2RQMA 1RTIB 2HQGA 5A8RA 2A2DA 3HI0A 1RILA 3DFEA 5ADXA 3SSSA 4CNYA 3RSEA 3PJXA 3QSIA 3J81U 1J5EJ 4WU3A 1NRKA 1RWKB 4Z2XA 2N3LA 3NGUA 1XQIA 4C3KA 1YLXA 3DU6A 3V9WA 3TOQA 4B3OA 2WONA 4HTJA 2FGCA 1XNRF 5M1PA 3L6QA 3IR7B 3R1XA 3AVMA 1JNZB 3I6PA 4BR7A 1N5TA 4DR2J 4M1KA 2CQDA 3PSFA 3H20A 2ZVSA 2P6SA 4EFHA 4CM2A 2YH1A 4A2AA 5AZIA 1WKJA 3DI6B 1UPMB 3MR5A 4DU8A 1HBOB 4BWMA 4O0IA 3WDOA 1H1VA 5JXSA 3DLGB 2KZZA 4Y65A 2IVMA 3MD3A 2B6AB 4HDHA 4WJBA 2UXBF 2ZOMA 3D2EA 3OBYA 1RBUA 4M5MA 4C8KA 4ZVPB 4AXJA 1IKVA 3HD1A 1D9FA 1LWCB 1Q18A 1VQMS 5B0GA 5GVQA 3BN7A 2YV0X 3C95A 4WFXA 4CZMA 2ZC4A 2O8BA 3QINA 4CHYA 4UZCA 4C8OA 1FERA 1TKXA 4RBVA 4FWQA 4JB8B 3MGJA 5EX0A 4P2FA 3O1LA 2H48B 1Z4UA 4DR3J 2HOEA 3KK1B 5ETNA 3IC1A 3AAWB 3ZZRA 3LPUA 1NKCA 4OYBA 1HR0K 4CJKA 4WWSA 2LQBA 3S9HA 1YZ7A 2YJFA 4A46A 3DLEA 1SH0A 3L2UA 5DDOC 1T0TV 3IG1A 1WSGA 3N79A 2W9CA 3ZSVA 2YWKA 3BF3A 4ZPAA 2CNNB 1AA1B 3Q8QB 5ETRA 2OPSA 1VQPN 2GQCA 3BYRA 1OH7A 1YJRA 3G10A 1YIJN 1S4FA 3RTVA 2RE2A 1H38A 1D9AA 4ZP9A 1U45A 2YWGA 1KFSA 5AZIB 3AO1A 4WK1A 4NMXA 4DPTA 2BANA 5JVHQ 5E0OA 2ZHBA 3VQAA 3MAHA 4Z4GA 4HL9A 1OY8A 1N48A 5AQTA 4ZVOB 4CBXA 4O3NA 4DV6K 4AILC 3TA0A 2UP1A 2RPIA 3D2EB 3NF9A 2W2PP 1E3MA 2E7XA 3CJ5A 3OY9A 3SQ0A 1EKSA 4H0VB 1Y5NB 5B08A 3BBFA 3O08A 1MG7A 1Z2ZA 3RRGA 5KFPA 4CLSA 1TKXB 2BOAA 4I64A 3EY1A 1L3SA 2XHBA 3PYGA 2EW9A 3NEKA 1B92A 2NLWA 2H51B 3L3VA 3TR5A 3C6HA 5LJ5Y 2A1SA 2MKSA 1NGBA 2QC3A 4LFAF 4IOAQ 2IJFA 3F41A 2Q0UA 2E6LA 1GOCA 1RT3A 1XBWA 5AE2A 3EWGA 4MKAA 1ZXOA 1YJWS 1ZM2A 5T14A 4WP9A 3KK3B 3IG1B 3DNCA 1CXUA 3GYXB 1DLOB 1SS6A 3TX0A 5HMYA <