2OPRA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
538
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGNPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 140
structure length 538
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oprA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oprA05
1S6QA 4CK3A 5F8LA 3AA3A 2WOMB 1BISA 4CEDA 1XHZA 3CM6A 3HPHA 4HKQA 1S1TB 2A1RA 1NKCA 5J2PA 1L3VA 4B9LA 5CYQA 4IRCA 1RYSA 2WK4A 5KFGA 4KTQA 2KZZA 2VWJA 5I3UA 3HM9A 4IOBA 2FBYA 1HARA 3DLGA 5KFJA 2FLNA 4CHZA 2G8UA 1NJYA 3SCXA 4LSNB 4DTJA 1ZBLA 3LP2B 3ZT0A 2ZD1B 1YTAA 2G8HA 3BREA 3ITHB 4DTUA 5C25B 2FVRA 1UA1A 4RW4B 1T7PA 1N5YB 4ZHRA 4KKOB 5KT3A 2Z1JA 2HHXA 1RBSA 5KG4A 3G10A 1JLGB 2R8KA 3AO2A 1L3TA 1N6QB 4F4ZA 3DRRA 5KFZA 4CEZA 3LDSA 4Q0BA 2XI3A 5HBMB 1IKVA 1TKZA 3CFOA 2XI2A 2A1SA 3G0ZA 1S1VB 2RDJA 3VQAA 3LWMA 1HJRA 3Q8SB 3RMBA 2FJVA 1EX4A 3SZ2A 3OYDA 1ASWA 4DSLA 2R8HA 3QGIA 1C6VA 4R8UA 4NLSA 4QWDA 1WNSA 4I2PB 2OZMA 4GC7A 3LALA 4DQSA 4B9NA 3AVKA 4B9TA 1RTJB 4YFUA 4FBTA 1LW2A 4H54A 3SFGA 3MECB 5KI6A 2WB4A 3VQ5A 4H4MA 3VQDA 5C42A 5F8GA 1S6QB 2XCAA 2FLLA 4JS4A 3T19A 1GX6A 4DG1A 1JXBA 3CIZA 4EYHB 4Z4EA 5J2PB 2BDPA 5CYQB 3OS0A 4CJ3A 2E9ZA 1K1SA 1ZYQA 3KLFB 5I3UB 4MQ3A 3TAFA 2DY4A 1EP4A 4HHTA 1C0UB 4MK8A 4FXDA 3DLGB 4KBIA 1BGXT 5DG9A 3OJUA 1ZBUA 3QIPA 2X6NA 3PX4A 2XY6A 3Q8PB 2OA8A 5L1IA 5KT2A 4ZHRB 2FJXA 4RUAA 2D3UA 4J2AA 5F8MA 4DFJA 4ZVHA 4LQ9A 2FBXA 4O3RA 2HWHA 3LP1A 3NGYA 4KTZA 4B8CA 4Q0BB 2HHWA 3N6LA 1TKZB 2HB5A 3ZT1A 3GV5B 4TLRA 4KHUA 3EPIA 1S9GA 3HL8A 3AVBA 4AHTA 2HVHA 3JYTB 2XY5A 2OPRB 1SKSA 3VQBA 1ZBHA 3HPGA 2BANA 1RT2A 5FDLA 4FS1A 4IFVA 1HNIA 1W9HA 4B9UA 4CGDA 1LW2B 4XO0A 1L3SA 2FVCA 3CDWA 4CGHA 3WNGA 3QLHB 3PO5A 5T7BA 4FW2A 4H4MB 3KTQA 2YNFA 1ZBIA 3S3OA 5KFVA 5F8IA 1TKXB 5EWFA 2QXFA 4DL4A 4ELVA 3TANA 2GIQA 2E6MA 4NLTA 3AVNA 3T5KA 3JSMB 4RW6B 5J1EA 3L2QA 3PZPA 3H5YA 5L1KA 1TKDA 2ASLA 3M9NB 4E7HA 2EX3A 5L1JA 3PJXA 5KFEA 3T3FA 4O5BA 5L1LA 3RBDA 4F4XA 3H98A 1L3UA 1U09A 3OYMA 3OYHA 4KO0A 3QIDA 3QIPB 3TAEA 3HJFA 3DOKA 4EBCA 3OYIA 2OYQA 3RRGA 2RPIA 2R2SA 1NJWA 4ZP8A 2HMIA 1X1PA 3CG7A 3HVRA 1BCOA 3SQ2A 4ZPCA 1HMVA 2JEGA 2YHBA 2JEJA 4F4KA 3V9WA 1J9AA 1ITGA 5EUHA 3EY1A 5F9NA 3TAPA 4M3RA 3NHGA 2QKBA 4OLAA 1I6JA 1TAUA 1I3AA 3M8QB 1S1XA 1TVRA 4IR9A 1IKWA 3ZT4A 4NCGA 3KK2B 4CESA 1NHUA 4FBUA 1YT3A 3DDKA 4CF2A 2OPPA 3DM2B 4ZVEA 1XHXA 3NDKA 2BANB 1RT2B 5FDLB 4Y1CA 4E19A 3KLEA 2FVQA 4IFVB 1HNIB 5KFNA 3QO9B 2AGQA 3QERA 4E1MA 3FQLA 4K4WA 4YR0A 1FXXA 2EHGA 3H5SA 1C0MA 4LSLB 2YNFB 4TQRA 4WE1A 3VQCA 4H8KA 3HP9A 1EETA 2D0AA 5J1EB 4TXSA 1KHVA 3BSNA 2O4GA 2P5OA 3PX6A 1WSIA 2LSNA 1B92A 1MMLA 1BIZA 1EKEA 2F8TA 1QAJA 1UWBA 4NYZA 2DPJA 3MAQA 4RW9A 3PW5A 4KO0B 4F3TA 3DOKB 4J2EA 3VQ8A 3E01B 3HP6A 1NOYA 2RN2A 3NBPB 2HMIB 4CJRA 1JL1A 2ATQA 1HMVB 1J53A 3IRXA 3L2UA 2OZSA 4B9VA 4FLXA 3UQSA 3QINA 4J9RA 1QE1A 1Q9XA 3NL0A 3ZSZA 1TVRB 4CEEA 3OL7A 5KFUA 1S5JA 3OYKA 1IKWB 1LWCA 3ZSWA 4M3WA 4WYWA 1RBVA 4K50A 3NH1A 4DSJA 3H5XA 2IMWP 3G6XA 2OPPB 2BRKA 3EZ5A 4FJGA 4DU4A 4OL8A 1LW0B 4FJMA 2IC3A 4K4SA 3CVKA 4CJ5A 3NF6A 5HP1B 1JXEA 2IM2A 3QZ7A 4FLVA 1NK6A 2RF2A 1XR6A 5L9XA 1NK7A 4LQ3A 1S1UA 1X9SA 1RTIA 2ZQBA 4IH7A 3OYEA 3PR5B 3TWHA 1NK9A 4CJSA 3EYZA 4MK7A 3T5LA 1XI1A 4HUGA 2B43A 5JS1A 1KVAA 4TN2A 1GOCA 4WYLA 3C6TB 1JLFB 4TQSA 1QTMA 4ICLB 2IM1A 1UWBB 1GX5A 4KHMA 2I5JA 5J2NA 4RW9B 4M94A 1TKTA 3PO4A 1SH2A 4W5QA 3VQEA 2FLPA 4CFBA 3L2RA 3RMDA 3V9ZA 2ZKUA 1R0AA 1XC9A 3IRXB 4Y2AA 4ZPAA 2DFHA 5I42A 1VSMA 2KQ2A 4PWDA 1C2PA 3CFPA 5DGAA 1RCHA 1QE1B 3I8DA 3SUNA 4KHWA 2C2EA 3SUPA 4AILC 1JXLA 3SPYA 1LWCB 4YR3A 3CJ4A 4FJHA 5C5JA 5KFBA 5DQIA 4J2BA 1ASUA 3D0PA 2IC3B 3DMJA 5CZ2A 4CECA 3Q8QB 4NRTA 4CHYA 2RF2B 3I5CA 3DRPA 1VSJA 4H4OA 4O4GA 4WFZA 1S1UB 1IKYA 3KMQA 3T1AA 1RTIB 4TYBA 3L3VA 4F2SA 3IGVA 1HRHA 4CEAA 3OYGA 3AV9A 1HPZA 2YKMB 3SJJA 3C6UA 2F96A 4CFDA 1U45A 3AA5X 1SL0A 5KFDA 4ECYA 1VRTA 1VSHA 2XY8A 4ECTA 3OYCA 2P51A 4F2RA 2I5JB 5J2NB 4FJ9A 1TKTB 3HSTB 1RDRA 4CHOA 5EDWA 4JLHA 3TAMA 3DLHA 1FK9B 3AO5A 5EU7A 3TR8A 5HRPA 3P5JA 3P83D 3HT3A 4CJLA 5KFXA 4OKJA 4F4WA 3S3NA 1R0AB 1ZBFA 5I42B 4PWDB 1JLAB 3HVWA 3SQ4A 2RDIA 4YP3A 1VRUA 4OKEA 3OHBA 4N47A 4CJUA 3O3HA 4DU3A 4EBDA 2UVVA 4IBNA 5D3GA 2IS3A 2R8IA 3MXIA 5KGWA 3V1RA 4CIFA 3VQSA 4RZRA 3VQ6A 3V9SA 4GW6A 4DFKA 1QUVA 4URGA 4GVMA 4DWIA 3KHHA 1B9DA 3BGRA 3RWUA 5DMRA 2XRIA 4N41A 2D0CA 2OPQA 3H2LA 4DS5A 3FRZA 1RBRA 3ZSQA 3TVKA 3DRPB 3H08A 2PYJA 4FJ5A 1RNHA 3OS2A 2J6UA 4H4OB 2YKNA 3D28A 3TARA 4O4GB 4ELUA 3AVJA 4M95A 3QEVA 1IKYB 3V81B 3AVFA 4ZTFA 3KLVA 3IG1A 4RUCA 3KHRA 4GMJB 1BI4B 3AVHA 4J9KA 3NGZA 3C6UB 3QEIA 4EP4A 4DTOA 4C8LA 3ZT3A 1KTQA 1T94A 4OVLA 4Z4IA 2B4JA 2JLEA 1VSKA 3LWLA 1N4LA 2O5DA 3M8SA 3HVTA 4LD0A 4XPEA 4HTUA 1RDCA 3TAGA 3TAMB 1FKPA 4E89A 2WTFA 4IFYA 3UIQA 4NLXA 3WNEA 1SL2A 1TK8A 4FLWA 3BQ2A 1RYRA 4JV2A 4DTSA 1JL2A 2JEFA 4FVMA 1A5VA 3MXMA 3S9HA 3LAKA 3DLRA 4CJFA 1UA0A 2YNIA 3G6VA 2CKWA 3DI6A 2AGPA 5EWGA 3KJVA 4AHCA 4HYKA 2W9AA 1DTTA 3EZUA 1B9FA 4KTWA 2C2RA 5D3GB 1WNEA 3RTVA 2G8FA 1C0TA 3H40A 3M9OB 3KD5E 4CFCA 3V9XA 1VSIA 3RB0A 4ED6A 3BGRB 4J9NA 2JEIA 2Y1IA 4DTRA 4HUFA 2AU0A 2OPQB 1WSGA 1KCFA 4EO8A 3F73A 3N6MA 2JC0A 2ZE2A 4BDZA 1U4BA 1HYSA 3KHGA 1TK0A 4BWMA 4CJPA 3PR4A 2YKNB 3ALYA 1RBTA 1J5OA 1TGOA 1W0HA 3K57A 4ED7A 3PW2A 4U7CA 2C22A 4BE0A 4Y3CA 3IG1B 3RMCA 5KFPA 4FLYA 1RT6A 4AHSA 4O3NA 2BGGA 3LANA 4KB7A 3QEXA 2DTUA 3Q8RB 1K1QA 1D0EA 4Q43A 4C8KA 1DLOA 1QSYA 3HVTB 5CYMA 2XO7A 3QNNA 1FKPB 4I7FA 2QKKA 4Z4CA 1TQLA 4IFYB 5F8JA 4J9PA 1CSJA 4JV0A 4CHNA 3DLBA 1JKHA 3HK2A 5HLFA 4MIBA 2YNIB 1KFSA 4ZP9A 3TI0A 2XGPA 3KJVB 4FK2A 4F4YA 5DG8A 3VQ7A 3DRRB 1DTTB 4DLGA 3H5UA 3HO1A 1IKVB 2HHVA 3B6PA 3PY8A 3DLEA 1SH0A 4TSXA 1C0TB 4W5OA 4B9MA 4HCBA 4OKKA 4IR1A 1SV5A 3U3GA 3MFHA 4O3OA 1CXUA 4RU9A 4CF0A 1TL3A 4R8UB 2XWYA 3L3UA 1G15A 3MF5A 1HNVA 4XIUA 2ZE2B 5T14A 1HYSB 5KFHA 1TAQA 3RAQA 1RA7A 4IDKA 1Y97A 4I9QA 1F21A 1T3NA 4ECWA 3CQ8A 4FJJA 1J5OB 1YTUA 4E7IA 5C42B 1J54A 4HUEA 1A5WA 4DG1B 1RT6B 4NLPA 3QZ8A 3L2WA 1S49A 4HCCA 3LPUA 2G8VA 1IG9A 3K58A 2YV0X 1DLOB 4ZP6A 1NKEA 1TV6A 4IQXA 2VWKA 1EP4B 4O0IA 1I39A 1D1UA 4IKAA 2V4RA 4I7FB 1GOBA 3GQCA 4C8NA 4NLYA 3V9UA 2W7OA 2BE2A 4FK0A 2HHTA 2WHOA 5KG7A 1HYVA 1JKHB 4I2QA 3PUFA 4DL2A 3QETA 5HLFB 1KLNA 4EEYA 2C28A 3NAEA 3V6KA 4TY8A 4M45A 1HQUA 4K4ZA 3LP1B 3PVXA 1MU2A 3SI6A 4KE5A 1K6YA 1D9FA 5KRTA 1T03A 3ASMA 3DLEB 4JRPA 4IG3A 1TL1A 3CDEA 4QOZB 1VSFA 1S9GB 4OPKA 3UDLA 3I0RA 1CZ9A 3BR9A 3L8BA 1KHWA 3V6JA 3KLIA 1SV5B 3BQ1A 4O55A 3VA3A 4CJTA 1TL3B 3SUQA 3CYMA 5FRMA 1RT7A 5DK5A 1HNVB 1BCMA 1C1AA 3OYNA 2R8GA 2V4QA 3D45A 2Q3SA 2GIRA 5KT6A 4ED8A 3TQ1A 4B08A 4KV8A 2GBZA 3OJSA 5EWEA 2W8LA 4DQRA 4DSFA 1NJXA 4K8XA 3ISND 2HNZA 4AHVA 1C1CA 2AWZA 4CIGA 3GIJA 1RAJA 1WSFA 1QSLA 2UVUA 4CGGA 3C95A 4NYNA 4CEOA 4O44A 1RDDA 4WFYA 3VQPA 4KHYA 4ZPBA 1YVFA 4FJIA 3AVMA 4Z0UA 3HXMA 3AVLA 4IRDA 1JIHA 2VG7A 4B9SA 2YHAA 2J6SA 1RT5A 4KHNA 2AGOA 3MR2A 1KFDA 4KB1A 2EC0A 4CJWA 3NH2A 1BIUA 1HYZA 5J2QA 1T8EA 1U47A 4NLOA 3CJ5A 5KGXA 4Y2CA 1NK4A 1S10A 1Q8IA 1RT3A 2BE2B 5J2MA 2HNDA 3MR6A 4CGIA 4JV1A 3FSIA 3LZIA 2J6TA 2KFZA 4FYDA 4BE1A 2W8KA 4CGJA 3E51A 5SWMA 1NHVA 5KFMA 2E9RX 4TY8B 3PV8A 2HVIA 4Y1DA 5C24A 4FJNA 1X9MA 2UVRA 2Z1IA 1MU2B 2IJNA 3KNAA 4QWCA 4QWEA 4J9SA 1RT1A 1T03B 1S1XB 3PW4A 4IG3B 1TL1B 3UPFA 4NCGB 3I0RB 3KLHA 2R2TA 4J9LA 4NCBA 2AJQA 3KLIB 3TAQA 1FKOA 1D8YA 4IG0A 5KG2A 4K4YA 1RT7B 3KLEB 2C2DA 2IM3A 4DL3A 3OSPA 3SYZA 4KV8B 4WXWA 2ATLA 2HNZB 1C1CB 4WE1B 3I0SA 2YNHA 3FFIA 4PA1A 4JRQA 4J9QA 1EETB 4O44B 4K8ZA 2RKIA 1RILA 3OYJA 4M3YA 4FZYA 1RT5B 3IGNA 4M3ZA 4QCLA 3MR3A 2W9CA 4ZP7A 3QNOA 2YNGA 3ZSXA 3MEGA 1RT3B 4U6PA 5J2MB 3M9MB 2HNDB 4XPCA 4ZVFA 2HNYA 4PUOA 4FS2A 2X74A 3TABA 1QSSA 2HHUA 3OSNA 4ECUA 1N56A 5C24B 4KSEB 4O4RA 4R5PA 3CDUA 5KG0A 4E0DA 4QW8A 1RT1B 1RTHA 4ED3A 4KHSA 1WLJA 5SZTA 2VG5A 4K4XA 2BQ3A 3GIMA 1YVUA 3H4DA 1WAJA 4EP5A 3K5NA 2OH2A 1T05A 1SL1A 1FKOB 4Q44A 2VG6A 2E9TA 2AX0A 5KFFA 2XGQA 4DMNA 2B6AA 3RB4A 1GOAA 5DG7A 4M3TA 2ILZA 3V4IA 3SV4A 3DOLA 4Z4FA 4CIEA 2PYLA 4CHQA 3G86A 3O3GA 4YMEA 2IA6A 3LPTA 1Q9YA 3O3FA 3I0SB 5KFOA 3V1OA 3SPZA 3NGDA 2YNHB 3PJWA 3FFIB 4DL6A 4O3QA 4FCYA 3MEEA 2QK9A 4DF4A 2RKIB 2HWIA 4MIAA 1RT4A 2W9CB 4DU1A 4EO6A 4RNNA 1NOZA 2E6LA 1S0NA 2UUTA 4FZXC 4DEZA 4MKAA 4C8OA 2R8JA 3SQ1A 2HNYB 4PUOB 5E41A 1QQCA 3MFIA 2V9WA 4MH8A 4ZMMA 5HRNA 3IN5A 3PW7A 3SQ0A 4DS4A 4CK1A 4R5PB 1QHTA 3SV3A 4DTPA 2UVWA 5JXSA 4KFBA 1S4FA 1RTHB 4CHPA 2HW3A 1JLEA 4BWJA 2W7PA 2F8EX 5KFWA 4OPJA 3AO1A 1L5UA 2JC1A 5DGBA 2GUIA 2IBKA 3NCIA 4RW4A 1T05B 1D5AA 2B5JA 4KKOA 2VG6B 4K4TA 3NF7A 4DTXA 1ZETA 1N6QA 4CERA 3DMJB 3QGHA 3K5OA 3CO9A 3IS9A 5HBMA 4FLUA 3DOLB 4KAIA 3D5MA 3NMAA 4CCHA 1SKWA 1WSJA 1QAIA 3MEEB 4ECVA 4CGFA 4CF1A 1OS5A 1TK5A 3NF8A 1Z4UA 1HPZB 4EBEA 4EYIB 3NFAA 3RRHA 4Q8FA 1RTJA 1KVCA 2IAJA 1VRTB 4NLQA 4FLTA 4N56A 1S6PA 5KTQA 3NH0A 3T5JA 1RT4B 1UAXA 3CJ0A 4AH9A 1BHLA 3V1QA 4OGCA 3VQQA 3ZSOA 1LV5A 3QYYA 2FC0A 5KRSA 4QWAA 4Q45A 2W42A 4EZ9A 3KLFA 1U48A 4FJXA 2F8SA 1C0UA 3NKYA 1VRUB 4KFBB 1RA6A 3GYNA 4NLRA 3V6DA 2WRMA 1JLEB 4F8RA 4FM2A 3ZSYA 3QEWA 4DSEA 4O0JA 4M42A 2B5JB 3O4QA 4L8RB 4DF8A 2DFFA 3MTKA 4W5TA 1KVBA 1NNDA 4CFAA 4NYFA 4N76A 3DRSA 3IS9B 4M41A 4ED2A 4LH4A 5KG1A 3CWJA 1S0OA 4FJ7A 1ZTWA 3QESA 3JYTA 2OPRA 1RTDA 4MKBA 5KG3A 3HYFA 2IAJB 4PQUA 1S6PB 3WNFA 3QLHA 4DTNA 4RNMA 1U49A 3N6NA 4G1QA 3OLAA 2KFNA 5HRRA 3S3MA 3OYBA 5KG5A 4X2BA 3K2PA 3PW0A 1TKXA 3RB3A 4RNFA 3JSMA 4RW6A 3RR8A 2E4LA 4CEBA 4Z4GA 1Z26A 3T5HA 4DQIA 1IM4A 3NAHA 4NLDA 4N5SA 1SH3A 3DI6B 4OJRA 4FJ8A 3A2FA 2QE5A 3OLBA 3V6DB 3U6FA 2Z1HA 3M8PA 2BRLA 1C1BA 1BQNA 3EPGA 5F8HA 4YQWA 1LAWA 1XR5A 4K4VA 4WZMA 3AVCA 3QGGA 3RB6A 4E3SA 5DLGA 2I1RA 2G8KA 3DRSB 3KOAA 2GV9A 3M8QA 3KD1E 3KLGA 2VA3A 3KK2A 2FBVA 2PZSA 2VA2A 1VSDA 3K59A 1VSLA 1RTDB 3DM2A 5CZ1A 4CJVA 4W5NA 4ECQA 3OYAA 4B8AB 3QO9A 4PQUB 2ALZA 3KKRA 1NK0A 1A5XA 4BDYA 2HHSA 3SFUA 2FBTA 4G1QB 1DTQA 1S97A 4LSLA 3HVAA 4Z4HA 4KHRA 4FW1A 4B3OA 3AO4A 5DQGA 5CYMB 2QV6A 3G6YA 2HAIA 5KFRA 4AHUA 3NAIA 5KFLA 3BQ0A 4RW7A 1LAVA 3NF9A 4GC6A 1HQEA 2OPSA 4QPXA 4NLVA 1VK0A 5KFYA 4ZTJA 3OL9A 3HPOA 3BDPA 2IOCA 5KG6A 1BL3A 4ECZA 3M8PB 2WONA 4IRKA 1WAFA 4ZVGA 1C1BB 3E01A 5HROA 2BQUA 3LP0A 1BQNB 3NBPA 2IM0A 4ED0A 2P1JA 2R2RA 3RAXA 1RBUA 2D7SA 4ID1A 3OL8A 4F50A 3OY9A 3KMSA 3CJ2A 3GV8B 3KK3A 4RNOA 4QAGA 4RW8A 4IDKB 3BSOA 2HHQA 3KLGB 3I5BA 2FVPA 3HHKA 1S9EA 2GC8A 4IH6A 3C94A 4BE2A 2R2UA 1LW0A 3BSCA 1RDBA 4E7JA 4DTMA 1SKRA 5JS2A 4CE9A 5HP1A 3RR7A 3ICLA 4Y34A 1TV6B 1DTQB 5DQHA 1X9WA 3DYAA 4B3OB 2XY7A 2DFEA 4YR2A 1NK8A 2X6SA 4RW7B 4C8MA 1HQEB 2AQ4A 1BQMA 4I2QB 5F9LA 3C6TA 1JLFA 3MR5A 4Q5VA 2OPSB 2XCPA 3OYLA 4DQQA 3VN5A 2X78A 4ICLA 4EZ6A 4FZZA 4FK4A 1U04A 1HQUB 3I5AA 3ZT2A 1S0MA 2WONB 1XWLA 3H4BA 1D9DA 3GILA 1SUQA 1NK5A 3FDSA 1KLMA 5HROB 3LP0B 4PY5A 2W9BA 3BJYA 1S48A 3QEPA 4ECSA 5JUMA 1LWEA 2FVSA 1TP7A 3AA4A 3OYFA 4IKFA 1CLQA 1JLBA 3AO3A 4DSKA 3CM5A 2IDOA 3H59A 4ECRA 1KRPA 4CJQA 3ULDA 2G8IA 2ILYA 4AHRA 3KK3B 3P1GA 3NE6A 4DLEA 1VSEA 3ZSRA 3K5MA 2KTQA 4RW8B 5F8NA 2IJFA 4BDPA 5KT4A 4E7KA 4F3OA 4NLWA 3QIOA 4ZPDA 1S9EB 3F9KA 4DL7A 1REVA 4LY7A 2D5RA 4DSIA 1W25A 4KREA 2D3ZA 1EXQA 3CFRA 4J9MA 5DLFA 2P5GA 4KHQA 3KKSA 4E1NA 4KAZA 4FM1A 2VG7B 4JS5A 4FJKA 3DYAB 2NUBA 4WFXA 4RG8A 4KPYA 4KB0A 2ITGA 5J2QB 1S1WA 4R0EA 4WXOA 1QS4A 2R7YA 2Y1JA 4CJKA 1JX4A 4J9OA 2YKMA 3DLKA 4G3IA 4KI6A 3AVAA 1N48A 3WNHA 1KSPA 1BQMB 5K14A 2UUWA 3K5LA 4ED1A 3NGIA 4FLZA 4TYAA 3CJ3A 3RBEA 3KIOA 3MEDA 4DQPA 1SUQB 2ETJA 4QW9A 3IAYA 1FK9A 3B6OA 1IKXA 1KLMB 2XHBA 4URSA 4WZQA 2W9BB 4CJEA 3U3YA 3KLHB 1JLQA 1LWEB 4MK9A 3AVGA 5HRSA 1JLBB 2WCXA 4TY9A 4O3SA 1JLAA 4IG0B 4JUZA 3OVNA 3ZSVA 3OS1A 2BQRA 3O4NA 1XR7A 4MFBA 2G8WA 4RNHA 2O4IA 4HVJA 1JLCA 1CXQA 3LZJA 3AA2A 1REVB 3HKWA 1RDAA 1NKBA 4URQU 4FM0A 2DPIA 5FROA 5KFCA 2FJWA 3AVIA 5KFSA 4W5RA 3ISNC 3RMAA 4DFMA 3OHAA 4CEQA 4O3PA 1Z25A 3VQ4A 4CEFA 5KFIA 4BACA 3KK1A 1ASVA 4DL5A 4ID5A 3V81A 1LWFA 1S1WB 3GV7B 2YNGB 3FQKA 4K4UA 2BR0A 4NLGA 4NCAA 3MEGB 1BI4A 4CJ4A 3SUOA 2WOMA 3DLKB 4CF8A 3M8RA 1S1TA 5KFQA 2KZMA 3VA0A 5KT5A 5K14B 3LAMA 3PX0A 4OGEA 4FJLA 2AX1A 3GIKA 4ELTA 4E7LA 4I9LA 5FRNA 2CJQA 3UR0A 4KRFA 4ECXA 3MEDB 3GIIA 4NRUA 1WSHA 3BSAA 4M3UA 4CK2A 4LSNA 1WN7A 3V6HA 2VG5B 5KT7A 4OLBA 3LP2A 1IKXB 2ZD1A 5KFTA 2ASDA 5KFKA 4UQGA 3ITHA 1JLQB 2IGIA 5C25A 4Q8EA 4NLUA 1N5YA 4IH5A 2ASJA 1CZBA 3SNNA 1JLGA 2XC9A 5CY4A 3KHLA 2B6AB 3LP3A 4MFBB 2Z1GA 1NJZA 3V4IB 3PHEA 2PY5A 1JLCB 1S1VA 4M3XA 3L2VA 5KFAA 2D41A 4DFPA 1WSEA 1ZTTA 1IH7A 4YNQA 4I2PA 3MXJA 3SI8A 4KI4A 2D0BA 1UOCA 3VQ9A 2JGUA 4CF9A 3MECA 1IO2A 3KK1B 4NZ0A 4QWBA 1O1WA 2KW4A 1S9FA 4LH5A 4ID5B 4J2DA 3OL6A 3THVA 3ZCMA 1LWFB 2V0NA
chains in the Genus database with same CATH superfamily
4CK3A 5F8LA 3AA3A 3HPHA 4HKQA 3DGVA 5C2GA 4Z37A 4PG5A 2V50A 3K9JA 1L3VA 2P9EA 5KAKA 4DV3F 5KFGA 4DUZK 1IN0A 4L75A 3HM9A 4WFAL 4ID8A 2FLNA 1NJYA 4LSNB 3OVBA 1KKHA 1NSPA 2ZDPA 2ZD1B 4NYPA 4HHUA 3KK7A 4PXCA 4K25A 4W92B 2MJUA 5GAGP 4CZMA 4ZHRA 3TUIC 3G10A 4WPAA 4JI6F 4ILLA 2QMXA 1H3DA 1NB2A 3DRRA 2LKZA 2AIRB 4CEZA 3LDSA 4QYZK 3CFOA 4RWWA 4FOEA 2XI2A 1NMNA 3G0ZA 3SDEB 3LWMA 2RAQA 4N8OA 3ZETB 1HJRA 3RMBA 2FJVA 1EX4A 4HACB 1T6CA 3OYDA 4DSLA 3OTEA 2V51B 3NGTA 1C6VA 3HKZD 4I2PB 4AQYK 2FUG9 4DQSA 4B9TA 1RTJB 3J80Y 2OMLA 4FBTA 2VC1A 4H54A 3W61A 3SFGA 3ZNJ1 3VQ5A 4C8ZA 2W4PA 1A7GE 3AQOA 1XC3A 5F8GA 2O66A 3T19A 1GX6A 4DG1A 1YJWS 1XQSC 2XB2D 4EYHB 1KR4A 2BDPA 4OLOA 4CJ3A 2QEXS 1K1SA 3LGHA 1ZYQA 1UZHA 2FQQB 4FXDA 2MGZA 5DG9A 4BRMA 4CLUA 4LF5K 4H0OA 1ZBUA 3BO2A 4ZIWA 1U25A 2Y9HA 3VAIA 2XY6A 3IXQA 4L74A 5JJBA 2ZVIA 2HYIB 1W97L 5KT2A 4ZHRB 3ENWA 2GCFA 3I56N 2D3UA 4ZVHA 5E3AA 3PRBA 1KAZA 1FESA 2WBRA 3FFKB 1HWIA 1Q79A 2RS2A 2M4MA 3ZT1A 3PLAA 4LF9F 3CMQA 3O6QA 3AVBA 4LVOP 4AFFA 4DHVA 4HHHA 3LPYA 5KOXA 2A42A 2FYXA 3HULA 3DXBA 3E2EA 3HPGA 4JV5K 2BANA 4FS1A 1HNIA 1NGIA 4XO0A 5AXKA 3HHNB 5T7BA 2V9KA 1ZBIA 3S3OA 2J4RA 4LF8J 4X4VA 5F8IA 4W90B 1TKXB 5EWFA 3AVNA 3H2VE 5ETLA 5MLCQ 3PZPA 1TKDA 1UMJA 3M9NB 3PJXA 4O5BA 5L1LA 2DR5A 1DGKN 4F4XA 1U09A 4AE5A 2MGZB 4IO1A 4KO0A 3QIDA 3RVCA 3CC2N 2APOA 3FR0A 4EBCA 3PM9A 1N34F 3RRGA 4YOEA 2FHOB 1WBBA 3UN2A 4X64J 2HMIA 3HVRA 3C7NA 2JEJA 3W66A 1HNXJ 2MQMA 2NRVA 2ZWPA 4ILHA 3HF5A 1IBLF 1S1XA 2KB2A 4CLLA 3NCPA 4FF4A 2N4CA 5GMKa 2MQ8A 1RU1A 3KK2B 1R6VA 4BBYA 4DCJB 3DDKA 2OPPA 3OV7A 3DN9A 1XHXA 3PACA 1ATRA 2BANB 1HNIB 5KFNA 2UZAA 2AGQA 2HZVA 2RRNA 3QERA 4YORA 4B1YB 1N5QA 3SCJE 4LSLB 1CC7A 4P6QA 3OD2A 3VQCA 2P6SA 4KGMA 4U8VA 4H0XB 2UXBJ 3NWGA 3VF2A 2FC8A 3C16A 4DQ8A 1IBCB 2E7VA 3J80O 2LSNA 1B92A 1MMLA 3IDHA 4CW7B 2DPJA 2CJYB 1U2VA 3H6EA 3VHQA 5AQIA 2O8EA 3PW5A 4KO0B 1IBKK 4P2SA 1RHMB 4LT6A 2RN2A 2HMIB 2CPYA 4CJRA 1JL1A 3C7NB 4B3SF 3AJ2A 3IRXA 2VFRA 2RQCA 1M1KT 3DHXA 3UN5A 1FXDA 3TYTA 2QWNA 3L6QA 1Q9XA 4KC5A 2AJ1A 4CEEA 3OL7A 5KFUA 1PILA 1MN7A 2VKZG 3ZSWA 4M3WA 4DV2J 2GHVC 3MCNA 3GP9A 2RE1A 3E3XA 3OBYA 2KRRA 2JRSA 4U9RA 4I6YA 2OPPB 3EZ5A 5IT4A 8RUCA 3CMEN 2Z2ZA 4DR2J 4FJMA 1DY3A 1TR0A 2IC3A 1FJGJ 3MCOA 3NF6A 2HHPA 2IM2A 1NK6A 3CJTA 1B70B 1KTVA 2E5IA 1UW4A 4HH1A 3TVZA 1X9SA 2QLJB 5THWA 4IH7A 4FN5A 2FZCB 2DEJA 1NK9A 1OSDA 4ZN3A 2DGUA 1VBYA 1KD1T 2B43A 1U2RA 4WYLA 4TQSA 1JLFB 1QTMA 2Q1NA 1DARA 4ZVOB 2AHOB 4JI0K 1U2VB 3F44A 3PO4A 1FI4A 3IR7B 2CJKA 2R7WA 4LR8A 1GFWB 2MKKA 3BEGB 2QC3A 3IRXB 1TMJA 4ZPAA 5I42A 4LBIA 1VSMA 3NLCA 1C2PA 3QDKA 4JYAK 1D3WA 4BQLA 4BLGA 1KC8O 4TKTA 3SUNA 3N4WA 1IG8A 3WQPA 2RHKA 3VQTA 2KG1A 1X3NA 2RRBA 5LXRA 5AZIA 3PJ9A 2LQBA 1SZ2A 3ZTOA 5HMXA 1ZAVA 1JNRB 2IC3B 3DMJA 3Q8QB 1XMQF 1VQ4N 3GE1A 4QS8A 3A5MC 2CPZA 1IKYA 2HMPA 2RMLA 1WEXA 4TYBA 1T6DA 4F2SA 3IGVA 3FCWA 3FNNA 1N36J 2QIFA 4CFDA 1U45A 2ASMA 3T1YK 1E4GT 1VSHA 2K1RB 2DCUB 4ECTA 3OYCA 1HNZF 2Q97A 3P3DA 2ZWHA 3D9BA 3HHLA 2JHEA 2RJZA 5LMNJ 2DNOA 3TAMA 3DLHA 4K2XA 4RUHA 5EU7A 3P5JA 4F4WA 3WXMB 3S3NA 3KUGA 1B0TA 2E1YA 1OY9A 2A10A 5I42B 3ZZZA 1NCLA 2RDIA 4OKEA 3OHBA 4PWUA 2ZJRQ 1S59A 4BGAA 1ZM9A 3Q0AA 4IBNA 4LF2A 5D3GA 2IS3A 2R8IA 3MXIA 4A8KA 4RZRA 3HLUA 2QLFB 5AZIB 2OO4A 4DFKA 2G4BA 1U02A 5IWAK 4DWIA 5DMRA 4BCAA 5D15A 3TW0A 3CF5L 1NG9A 5HAOA 4MMOA 5IQ6A 3ZSQA 3OVSA 1NHKL 5AQYA 2OCEA 1VQ7N 3AVJA 4M95A 3QEVA 1IKYB 3C6HA 1EIYB 1XIQA 2Q6BA 3CCZA 4RJVA 1YDLA 2LU2A 4GMJB 4J9KA 5BR8J 3QEIA 4JI5F 3TUZC 4JEPA 3P45B 1V3ZA 3OHRA 1T94A 2KFYA 4FOIA 1VSKA 1N4LA 3ZO7A 3M8SA 2ATCB 3TAMB 1XNQK 1H2TZ 1H98A 3WNEA 1TK8A 5MLCV 3BQ2A 3MDQA 1SC6A 3MXMA 1UA0A 2Z56B 4CD1A 4CZHA 3O1WA 3DLLQ 3DI6A 5EWGA 3D4JA 4HYKA 3EZUA 4YOYA 5D3GB 2CJBA 1E6YB 3AY0A 1W2BR 1QZ5A 4CO5A 4Y65A 2G8FA 1TMMA 2K2PA 4OJHA 3H40A 1QZ6A 4QIWD 3KD5E 4YHHK 3RB0A 4ED6A 2UXBF 3NOCA 4NOHA 4LC9B 3N6MA 2ZE2A 1U1OA 4Q2MA 1HYSA 7FD1A 1NJIO 4BWMA 4DUYJ 2HQIA 2YCHA 2UXCJ 4YDUA 3O8WA 4CO0A 3AD8C 4AHSA 4NMXA 5A8WA 9ATCB 4O3NA 5HANA 2BGGA 5AQZA 1F6TA 4KB7A 2ZM6J 4AXJA 5FJ4A 1DLOA 3VZIA 3TTCA 1IXKA 1XQIA 2DXEA 5KOWA 3GJSB 2XO7A 1VQ8S 4JI2K 4B3TK 4DR3J 5A8KA 2QKKA 4Z4CA 1TQLA 2J7WA 1D9AA 2E5JA 2RT3A 1CSJA 1BA1A 1DAXA 3DLBA 1JKHA 4DV2F 3MR7A 1YJ9S 4H0TB 2UUAJ 1FDBA 4MIBA 2IVPA 4LFBK 4OO1J 1KFSA 2FY1A 3CIMA 2VC0A 1H7XA 2GVZA 3TI0A 3ADAC 1HW9A 2MTLA 5LJVA 1NGJA 2F9TA 1IKVB 2HHVA 3DLEA 1YKWA 1SH0A 4TSXA 3E9LA 4W5OA 4HCBA 2E66A 4OKKA 2U2FA 3MFHA 1REGX 1TL3A 2XWYA 3W3DA 3FSYA 3E66A 3UFCX 3ZX0A 4XIUA 2ZE2B 3Q8UA 5T14A 4JKAA 1HYSB 1LXNA 4PG7A 1ZH5A 4I9QA 2MKHA 4RR5A 1T9YA 4ECWA 1F21A 3GU0A 3CQ8A 1NNEA 1VQNN 4ZCKA 2ZHAA 3HD2A 2MQNA 3EMTA 3F41A 3K8WA 1YTUA 5C42B 2V69A 5IV4A 3N4PA 2VJUA 2ACYA 4ANEA 3C46A 3CJAA 4NLPA 4YDDB 5A8WB 3C14A 1TUUA 1VR6A 3QAEA 2MXYA 4HCCA 4CLZA 2G8VA 1IG9A 3LM2A 4CO1A 1YITN 2YV0X 2K06A 1MMNA 3U1MA 1DLOB 1NM2A 3TWZA 2VWKA 2HFNA 1EP4B 4O0IA 1I39A 1F9HA 1XMOF 2V4RA 3GQCA 2W7OA 2ZITA 3IM8A 1QVGM 4OFZA 1WF1A 3T1HJ 1JKHB 3PUFA 2LQ5A 2HSEB 1VDHA 3MD1A 2C28A 3CCEN 2VFTA 1E3MA 1T95A 4M45A 2FF6A 1D09B 1WHVA 3HT0A 4X62K 3SI6A 1FJCA 2M8HA 4GVBA 2DGSA 1U1LA 3DLEB 3ENOA 5GADP 1TL1A 2G13A 1TZ0A 1WKLA 2XMMA 1VSFA 4OPKA 3UDLA 2I0XA 3KLIA 1G3OA 4CJTA 1TL3B 1FD8A 1N36F 3SUQA 1BCMA 1E6VA 2F4VF 4ZDNA 3OYNA 3TQ1A 3A8YA 4KV8A 2GBZA 1WG1A 4DSFA 4K8XA 3ISND 4AXIA 4CIGA 1RXOB 3GIJA 2C2MB 2GTDA 1WSFA 2UVUA 2ITMA 2MMYA 3NMUA 3EVWA 3OPKA 3FMBA 4IRDA 1JIHA 4B9SA 2AGOA 4C2MA 3RW7A 2W2MP 3CETA 4NLOA 3CJ5A 5ELZA 2A1BA 2OP5A 3DHWC 4CH0S 2DNMA 3ENHA 2UXDK 3MR6A 3WDOA 3LDNA 2W8KA 5SWMA 1ACMB 1NHVA 4LR7A 4Y1DA 3TSUA 1K73O 4KPCA 4BRQA 3ZX2A 3KNAA 4QWEA 4J9SA 4L3QA 1RT1A 1KVKA 4GVBB 3DNCA 3L4IA 4DCPB 1TL1B 4NCGB 3CD6N 5D6GA 3I33A 4AUKA 1I51B 1X60A 4NCBA 3KLIB 3TAQA 3FMWA 4K4YA 3R8YA 1YXQA 2CAJA 4X65K 4FL9A 4DZ6A 4LFAK 1E6VB 5H9EJ 4EGLA 2CQBA 4DPOA 4IJNA 3VF4A 4WU3A 4KV8B 2ATLA 2MKYA 2G0JA 2UUBF 3CEDA 3J7ZT 4J9QA 1CULA 1EETB 3C65A 1U2FA 1RILA 4WTOB 1OH8A 5T7LB 2DGTA 4YB5A 1BA0A 1GQEA 2FJEB 3US5A 3IWLA 4ZP7A 3QNOA 3G6ES 1JNZB 2Z2YB 1RHJB 1TUVA 3MEGA 4KIAA 4U6PA 1PG5B 2XSJA 4WTYA 2HNYA 1S79A 2QW9A 5C12A 1Y9OA 2JLFA 4MIWA 5D77A 2HHUA 2HVZA 3BGFA 4JKHA 4FF3A 4OHWA 5HL7L 3SSQA 3H3NO 3MM9B 1RT1B 4KHSA 4DV6F 3L0QA 2VG5A 1X5TA 1PSDA 2P9NA 3MZIA 4EP5A 1EARA 1WC5A 1J5EF 3HD1A 4ZPWR 5LL6d 3NGRA 2V8DA 3H7HB 1SJQA 5BXIA 4BRDA 2Z57B 1YZ6A 3NNAA 2EWHA 3D2EA 2GHPA 2XGQA 3H1VX 1U0HA 2CH6A 4YOWA 3GLJA 2VB6A 2K3IA 1RI7A 2ILZA 5C2FA 3V4IA 3SV4A 3DOLA 5BR9A 4CHQA 1B99A 5KFOA 3THYA 3NGDA 4RBTA 5LJWA 3NGSA 2LECA 4PZVA 1CULB 3KZBA 4IYQA 1JK9B 4RX6A 2RSQA 4F9OA 2FZKB 1Q81O 2HWIA 3GFXA 4UOCA 3CPWR 4IOCQ 4MIAA 1KAXA 4EO6A 3AA9A 3NGKA 1YIJS 4RNNA 1K8KA 1NOZA 4TVAB 2E6LA 1EQYA 4I1TA 2BJEA 2UUTA 1NDKA 2XSJB 5AJ3J 4C8OA 3UB5A 4KY3A 2HNYB 3GB0A 3VWSA 1CS4B 2D9OA 3M6UA 2CPEA 4ZMMA 5HRNA 3SQ0A 3O44A 4IEEA 3AD9C 2UVWA 5JXSA 1AFJA 2EXUA 5AE2A 2XMKA 2RILA 1TUGB 2HW3A 5D8HB 4BWJA 5KFWA 3R3LA 3OR1B 3AO1A 4NA3A 3NCIA 4RW4A 1D5AA 4ZPTR 1HX1A 1OH7A 3SJHA 3NF7A 1ATSA 1N6QA 2NUUG 5A6PA 3DOLB 1EQMA 2E1CA 4OV1A 1NAQA 1RFQA 3THYB 4CCHA 2PDAA 3EVMA 1QAIA 5GAHI 1VBZA 1FJ7A 1OS5A 1RTZA 1YVNA 4H4KC 3NF8A 2J9DE 4EBEA 2HLUA 4EU0A 4NLQA 4FLTA 3T5JA 4AH9A 2AD9A 1PBAA 1WORA 1K8KB 4J8FA 3ZSOA 3QYYA 2VICA 4K0KJ 4QWAA 4UZCA 4B02A 4EZ9A 2V8VA 3OTDA 4CZIA 4Y6IA 1C0UA 4HL9A 2MPUA 3ZFVA 2WRMA 2W7AA 2MZJA 2WVBA 5DO2A 1WHXA 4O0JA 4NO7A 1X4GA 3H1QA 4OHZA 1S6OA 1Q16B 2DFFA 3BEXA 4W5TA 4NYFA 3AAPA 3W0LA 3NVMA 3CQXA 2XMUA 4BG8A 4U67Q 4WKYA 3VEWA 4A61A 3VAHA 3CWJA 1ZTWA 3QESA 2GJIA 3F56A 3I8BA 4EHUA 4NE9C 2DCLA 2FSNA 2UUCK 2L48A 5ETTA 3QLHA 4RWTA 3N6NA 4G1QA 3RZAA 3AARA 3HFVA 3O9UA 3OLAA 2KFNA 5HRRA 3OYBA 5KG5A 2HSTA 2HS0A 3RBXA 2DRBA 1ITPA 1M5PC 4G1IA 3UD5A 3RR8A 2E4LA 2IRUA 3ZXWA 1Z26A 4CO3A 1JJ2M 3NAHA 1I94K 2JX2A 1U6BA 4NLDA 4AL5A 4N5SA 1SH3A 4F0HA 2LXIA 1HBUA 3MPVA 1WUAA 4NB4A 1VBKA 2WC9A 2Q79A 4Z94A 1C1BA 2A0FB 2MLZA 4ISGA 3CCMN 4ZA1A 3EPGA 4YQWA 1G1XA 3C66A 1LAWA 4K4VA 3CQYA 4LREA 1VLOA 2A5XA 5DLGA 4EUVA 2G8KA 4GV9A 5E2QA 3M8QA 3K7RA 2ZBCA 2GS8A 1SB6A 4GMKA 3MI7X 3QBWA 2OANA 2FBVA 5JVHL 3RSEA 2VA2A 4Z2XA 1VSLA 4OX9F 1RGVA 5CZ1A 1Q0NA 4ECQA 3P5BP 1XNRK 3G9CA 3F5TA 1NK0A 1IUJA 3AT1B 1A5XA 4GKKF 2FBTA 2MHNA 4G1QB 2OSRA 3NP5A 3SBTA 3N28A 2BM1A 4KHRA 3J81Y 2ZH3A 3N01A 5CYMB 1VMBA 2DNLA 2DNQA 1B7YB 1A9NB 3QATA 4B3MF 1UFKA 4RW7A 1LAVA 3QFWA 3NF9A 1HQEA 2HQFA 4YEAA 1RHKB 1UPPA 5BYSA 2CNNB 3J7YP 4IO9L 1HL6A 2DHAA 3FSXA 1HBUB 2ADCA 1BL3A 3ZLJA 1YI2S 4ECZA 4JKEA 1F5BA 3GCXP 3PIOQ 4K43A 1C1BB 2R7TA 2BUNA 1H2VZ 5HROA 3NBPA 2DR9A 4ZCMA 1HBNA 3JXOA 3HX9A 3PHTA 3AH6A 2XMAA 3O9QA 1GK8A 4X4RA 2QA4N 1OY6A 3KMSA 4DMZA 3CJ2A 3GV8B 4QAGA 3BSOA 2C3OA 3I5BA 2KM8C 2GQ2A 3RSEB 1AW0A 2M5YA 3PDNA 3FLCO 2W1BA 1LW0A 4FP9A 1KDNA 1SKRA 1RWMB 5JS2A 4WFBL 2P9UA 1VQLN 1NLVA 4Y34A 5DQHA 2P9KA 3DYAA 1HKGA 4PKIA 2DR8A 4CWBA 4DV7J 3W5ZA 5IT9U 1WC6A 2DYAA 1Q1KA 1N34K 1H1VA 4RW7B 4C8MA 9RUBA 1HQEB 4I2QB 3C6TA 3MR5A 4DQQA 2X78A 3QJLA 4FK4A 1U04A 3SIPB 1HQUB 3RAMA 2HG4A 4JI4K 4KQZA 4Y2KA 2C1EB 1IBLK 1GMUA 3QT8A 1YAGA 2WVEA 3RUBL 5C7PA 1KLMA 1MWZA 5HROB 1TTHB 3IM9A 2W9BA 1S48A 2WB1D 2KJWA 1HBNB 1IR0A 4DSKA 2IDOA 3WX4A 2JSXA 3W7BA 2DNZA 3BBBA 4AHRA 1OY8A 1VSEA 1QJHA 3EE3A 3K5MA 3Q24A 3HOSA 1T3VA 5F8NA 4E2FB 1IWGA 4PXDA 4E7KA 4YY3J 4NLWA 4HTLA 1WDTA 4U7BA 2VIHA 3B54A 4C98A 2FXUA 3PCOB 2KU7A 3J8AA 3MMAA 5L38A 4J9MA 5DLFA 1FRJA 4K0KF 4KAZA 1S99A 3AJDA 3BM7A 1RAFB 3KG0A 2OHDA 2YWFA 2P9KB 3DYAB 1U2CA 2O3DA 1T0TV 3CJ9A 4WFXA 2MZQA 3KNGA 4KPYA 1MN9A 2ITGA 4WXOA 4CJKA 5BJRA 3T69A 1P8GA 4G3IA 2NNWA 3WNHA 4M63A 5K14A 3NGIA 2HBZB 4USIA 4DR1J 3CJ3A 3MEDA 1LEOA 3VAMA 3EE9A 1WC4A 1FK9A 1IVZA 1ZPWX 3U7JA 1KLMB 2W9BB 4CJEA 2LQ8A 1WF2A 3GPAA 2DHHA 2B4OA 3M1FA 4EFHA 5HRSA 3QPIA 4O3SA 2B4VA 1U1RA 3MX5A 3OVNA 4C3KA 3UD3P 2O01C 4X84A 2KXNB 4FO0A 2K7JA 5ETMA 4HDHA 2G8WA 2O4IA 4HDGA 2KKHA 4CZLA 1CJVA 3TJAA 3RG6A 4FPAA 1U1KA 3AA2A 3MN5A 1U1PA 3UKUA 4URQU 3CJSA 5SUHA 2NLXA 3ISNC 4CEQA 3BH7B 1Z25A 2ZJQQ 2RNEA 2H4WB 4CJ7A 2KT5A 2XS2A 1PIEA 3WIVA 4UF4A 2YNGB 4K4UA 2GJ2A 3M8RA 5KT5A 4C0HA 4J37A 5K14B 1N32F 3LAMA 3PX0A 4FJLA 3GIKA 4E7LA 4FYYB 5FRNA 2CJQA 1FKAF 2C3YA 3MEDB 3ZZYA 3EEQA 2CXEA 3BSAA 4M3UA 1UPMB 2QLBB 4F04B 3V6HA 4OLBA 3MPWA 2PEBA 2Y8YA 3L4BC 2DNNA 5CXTA 4UQGA 4CLFA 1F1BB 1YJWN 1DHMA 1N5YA 4IH5A 2VODA 3TA2A 3PIPL 5B0GA 3MX2A 2OTJS 2XC9A 4DL0C 2QEXN 4L6V3 4N7TA 2GUPA 4BY9C 4BG9A 2PY5A 1CJVB 1NUEA 5I3PA 5KFAA 4JI7F 4C9DA 2ZH6A 4UT4A 4DFPA 3G96A 1IH7A 3UKUB 1YJVA 3NY0A 3R5JB 1XEZA 3GE9A 5IZHA 4KI4A 1RCOB 1ZPVA 2JGUA 1U1QA 1DZ5A 5H1SQ 1BLUA 2X1AA 4LF7F 1O1WA 4FVUA 1WSVA 4J2DA 2ZNZA 3EX7B 1T44A 3CCQS 1S6QA 2PI5A 1BISA 1XHZA 3CM6A 4PG8A 1JJ2R 4PYAA 1P1LA 1NKCA 7FDRA 3PG9A 1LK7A 4OZ1A 3RGIA 1AFIA 4ZCIA 2NUHA 4KTQA 4OZNA 2VGNA 5I3UA 4IOBA 3TOQA 3ZZTA 2FBYA 3FUYA 5GAGU 4RO0A 5HATA 2G8UA 4DPYA 3BF1A 1YJNS 4NXMJ 3W9IA 1YTAA 2Y1LB 4F4AA 4D3GA 2G8HA 1T11A 4LF8K 1N5YB 2MKIA 1MA9B 4KKOB 3M3ZA 2Z1JA 4QIFA 1KBRA 2PD1A 2R8KA 1L3TA 3AO2A 1T9XA 4F4ZA 1FW6A 5KFZA 4K2JA 1K8AT 3OFFA 2XI3A 2RRAA 1ZM2A 2R7VA 1UAWA 3Q83A 2RQ4A 2R3VA 3MWBA 2R8HA 3FBEA 4NLSA 2DD8S 3THTA 3LALA 3EUNA 3M4XA 1NGHA 4X64K 2AKWB 1WI8A 2A6MA 1VJQA 1BE4A 3RJMB 1HNXK 1ZM3A 5M1KA 2UU9J 4B3RJ 3NXZA 1S6QB 2FTRA 3H20A 1EB0A 1FRIA 4Q7AA 3CE8A 3POTA 1N5VA 1UVNA 4ITSA 4Z4EA 1KXPA 3OBIA 2HS3A 5I3UB 5HO4A 4HHTA 1YBUA 2WW8A 3UDEA 1BGXT 1X8DA 1FO1A 2NZ4A 2X6NA 3I96A 1AXQA 4X4TA 3TZYA 4YY3F 5L1IA 4RUAA 1S57A 1NPRA 3GL1A 5F8MA 2NRZA 4DFJA 3UO0A 2UXBK 4DR5J 4LQ9A 3LP1A 2IA0A 3ISZA 1UETA 4BR9A 3KG1A 1VAZA 2YX6A 4RTFD 2DR6A 3EPIA 2QA1A 1Y10A 3HL8A 2MJNA 4CVNE 5HSPA 2HVHA 1K47A 5E3PA 2DT9A 2W2QP 1ZBHA 2OPRB 2KT3A 4QIGA 3VALA 1ZZNA 1RT2A 3ILIA 4A5AA 1W9HA 1KWMA 4B9UA 2AV5A 3I4PA 4JI3J 4NMLA 2NYIA 4DR1F 1YBTA 4FW2A 3CHWA 1HBOB 1V5IB 5KFVA 3TSQA 5AXMA 4HLBA 3POTB 3JSMB 4RW6B 5J1EA 3SMPA 3CCRS 2WTUA 4DV2K 2NXJA 2C2OB 1F2HA 2QLXA 5F1XA 5L1KA 4WCEL 2EX3A 3MPDA 2B51A 3H98A 4DR2K 1L3UA 3OYHA 2XMVA 2ZHOA 1GAOA 2V68A 1FJGK 2VPZB 3F0NA 3AQPA 2OYQA 1Z1ZA 2CQ4A 4FWMA 2P9IB 1KEKA 2ZJPL 2RQMA 2R2SA 3UKRA 3OFHA 5C2DA 1ZAWA 3IAS9 3FZLA 3CG7A 2CGKA 1DQAA 2NRWA 3V9WA 1J9AA 4CTAA 1ITGA 2IVYA 3W5YA 2Z0GA 4ZJQA 2CPHA 4M3RA 3NHGA 1V5VA 1TAUA 1TVRA 2IBOA 3LGNA 5AQKA 2YI1A 3ZT4A 1UL3A 2NZCA 3U4LA 4DV0J 4TU7A 3I87A 3FEYB 1BMQB 3WXIA 2XBPA 4C4WA 4CF2A 3DM2B 1DQ8A 3FK4A 1RT2B 3KLEA 2QL9B 3GG0A 5D0GA 3QO9B 4CZFA 5EHHA 4M5LA 4DV4J 2EHGA 2FIUA 2GAHC 1HR0J 4WE1A 1U0SA 2I9SA 2V8GA 2BJDA 2W40A 4H8KA 4FSVA 1VOMA 3TA1A 5J1EB 1CJKA 1KHVA 4TXSA 1RUSA 5ITHA 3D1QA 4BRFA 3MAAA 1BDGA 1BIZA 1EKEA 2F8TA 1QAJA 4I4BA 1UWBA 3ILLA 1LK5A 4F3TA 2VQFJ 4J2EA 4I56A 3WX8A 8AT1B 3VQ8A 3I4HX 1NOYA 5AQSA 5IS2A 4ZVQB 2CZ4A 3H0PA 3MPYA 3D7SB 1MDUB 2OZSA 4CTAB 1N5TA 1SJ1A 3VF0B 2VQEJ 1N36K 4DPWA 4LF6J 3W9JA 2VF3A 3ZSZA 1TVRB 1PYSB 1S5JA 4MKVA 2HVDA 1LWCA 2PI4A 5LMUF 4DB3A 4NI2A 3NH1A 1XK8A 3H5XA 2IMWP 2QN6B 1GLCG 5LMNK 1C4CA 4WQ5A 2BRKA 4P52A 2CH5A 1WC3A 2Z58B 3HSZA 4FJGA 4NYOA 3CCWA 2MKJA 4K4SA 5AZJB 3LDPA 4CJ5A 5HP1B 4DX5A 5L9XA 1NK7A 1IBMJ 5A2QU 4DR6J 2VBYA 3BBFA 2CQ1A 1RJJA 3GZ7A 1GLBG 4P7VA 3HI9A 4BVPA 3PR5B 1CJKB 1T9VA 2YWWA 4KH5A 5HOOA 3G4SS 3EYZA 1C0FA 1Z2ZA 5JS1A 2B9XA 3MAAB 3D66A 3CERA 4KHMA 2IM1A 1UWBB 5H1SV 2I5JA 5F3TA 1R89A 5J2NA 4M94A 1TKTA 1H7WA 4BC2A 1Q5VA 2FLPA 4CFBA 3GWCA 3RMDA 1C4AA 2ZKUA 5BRHA 3Q7CA 4CD3A 2EWSA 1QQOA 2V67A 1R0AA 3IFRA 1ILYA 2DXDA 2N7CA 4A2AA 2IHR1 5DGAA 5BR8K 4H03B 3NG8A 2C2EA 5HQMA 4DR4J 1P90A 4R0JA 1XERA 2I6WA 2XHCA 1LWCB 2CQCA 3L95X 3K5PA 2XZWA 3PTWA 4LFCJ 4RU2A 1RLDA 2VASA 4DXLA 2W01A 1EHWA 3PYDA 3D0PA 3CMAS 4F67A 5CZ2A 4CHYA 4F7VA 1VSJA 1R3NA 3GSIA 2BMBA 5F0XA 3KMQA 1KS2A 3T1AA 5GIPA 2MZ1A 1HRHA 4CEAA 1HPZA 1NGEA 2MEWA 3SJJA 2F96A 1SC1B 5KFDA 4ECYA 1VRTA 2NRXA 2X3GA 4OYMA 1DURA 1X31C 4P71A 5DETA 1X9JA 2CQ2A 2HRYA 2P51A 3BDEA 2LVWA 3CCLS 2I5JB 4DV5F 2XZDB 1OYEA 5J2NB 2QI2A 4FJ9A 1TKTB 1PC5A 3CD6S 3HSTB 1RDRA 2CGLA 4BC4A 3AO5A 5HRPA 3G8TA 3GR1A 4DUYK 4OYIA 5C2CA 1R0AB 2UXCK 1WSRA 2DK2A 3MN7A 1VC0A 2YH1A 1MNEA 1JLAB 3HVWA 5ETNA 2G2YA 4V19X 4WP9A 3P8BB 4EBDA 2ZM6K 1KD1O 2CFXA 2QZ8A 1H2UX 4EI2A 3VQSA 1VQ8N 4IFEA 3CW2C 4MAKA 4KH0B 2FF3B 2FSJA 2B9YA 3W8GA 4URGA 4DR3K 3E1YA 2DIUA 2QT7A 3RWUA 1RABB 2R42A 3TZXA 1YJ9N 3H2LA 1HI0P 1B0VA 5HMWA 3FRZA 3TVKA 2UUAK 3OXGA 3H08A 2HBKA 6AT1B 2X1BA 4ELUA 3V81B 4AL7A 4ZTFA 2NREA 3W2VB 5LT5A 5A0YA 3AVHA 3VERA 3NGZA 3OVAA 4EP4A 4DTOA 4NLCA 4KR0B 5LM7E 3M1VB 3MK6A 4OVLA 4Z4IA 2B4JA 1HKCA 2KM8B 2JLEA 1WKJA 1Z05A 1M1HA 2HBYB 3PNIA 2J8SA 2BV3A 3D54A 4XEIA 1RDCA 2EK6A 3TAGA 2N3OA 4D3HA 2VDHA 4IFYA 3UIQA 4JB8B 2GGPB 1SL2A 2H3EB 4C0OC 1S7IA 1CJUB 4DV0F 4FVMA 3LAKA 1CBKA 1F3FA 3DLRA 4BRIA 1X5SA 5M1OA 3OA9A 2CKWA 1KP6A 1AZSA 3KJVA 2W9AA 1X4AA 1WOPA 3FBCA 1B9FA 4KTWA 2C2RA 4ZKAA 4X4SA 1BWVA 2PSZA 1HR0F 5IQQA 3IR5B 3M9OB 3TEGA 4BC9A 4CFCA 4J9NA 2Y1IA 3KXDA 1KCFA 3T1HK 1VJWA 1GLAG 3F73A 4OYZA 2PFDA 4O8KA 3PR4A 2HZCA 4ANDA 3GMGA 1RBTA 4ED7A 4BE0A 3RMCA 5KFPA 2RH3A 4A47A 5F0WA 4C6AA 5A0YB 4F0KA 2GO8A 1ICEB 2VQFF 4FLYA 2HHHF 2Y0BB 3QEXA 2DTUA 2ZH9A 1K1QA 1D0EA 4C8KA 4WQ4C 5BPNA 4QQBA 4ES3A 2VQEF 4UY8T 4J7CA 4P2FA 4WK3A 2EI5A 4GKJF 1X4CA 3R7BB 4IFYB 2ZBQA 1U8SA 3AXMA 2IMOA 4CHNA 2OEMA 3HK2A 4XH1A 2V2QA 4FXVA 1WACA 4ZLPA 1NU4A 2XGPA 3KJVB 4FF2A 5IT0A 5DG8A 3H5UA 4ETXA 4JP8A 3N79A 5U47A 3PY8A 3CC7S 1IR1A 1URNA 1PYOB 4ZVRB 4DR6F 1NH8A 3J7A1 1Q86T 3U3GA 4DX8H 4O3OA 1Y7PA 1CXUA 2J0SD 4H0VB 4R8UB 3R6MA 1UP1A 2VZ9A 1HNVA 1M5KC 5E33A 1TAQA 2OFHX 4IDKA 3M2VA 1Y97A 2ZGZA 2ZHBA 1T3NA 2J0XA 5EVZA 4OX8A 1TL7A 1J54A 2LMIA 1A5WA 3DLJA 1WOSA 2P8IA 3VPZA 3QMQA 3EZOA 1Q78A 4FVCA 3UE2A 3K58A 2GV1A 4BHQA 1TV6A 3H46O 2Z2LA 4IQXA 4FF1A 2G1HA 2CJ9A 4G6VB 4IKAA 1GH8A 3FCVA 5H9EK 1GOBA 3QBCA 1RB0A 4NLYA 3O5BA 5TKWA 2AEFA 2BE2A 4FK0A 4USMA 2HHTA 2WHOA 2VKRA 1BWFO 2DISA 2XWXA 1KLNA 3AGKA 3NAEA 1KOHA 5GADU 4OZ0A 3D1OA 4NXNJ 4K4ZA 3ZZUA 2JVRA 5GAGI 1G6BA 1K6YA 3MCAB 2KI2A 2UYTA 4IG3A 3CDEA 1TU0B 1Y5NB 4DV3J 4RLEA 1X0PA 3CD0A 3IAM9 3G6EN 1S9GB 1SIWB 2J9DA 4KGZB 3L8BA 1KHWA 2H5JB 1WEZA 5CD4H 2EK1A 4M5HA 1W7AA 3CYMA 2V2VA 3BKFA 1HNVB 2MKSA 1C1AA 1OQ6A 2KG0A 2V4QA 4KHPF 3M2VB 2Q3SA 4ED8A 3HSJA 5F3ZA 5EWEA 1FDNA 4DQRA 1TL7B 3HI0A 3M32A 2AF6A 3D0GE 2BM0A 4JI6J 1QSLA 3C95A 4CEOA 4O44A 1RDDA 3VQPA 1YVFA 2O8CA 3VGKA 3R6GB 1UVLA 2I38A 3S6EA 1QY7A 1RT5A 2F63A 3G25A 2AYGA 4KHNA 3MR2A 5M1NA 3BB5A 1KFDA 4DV1F 3RW6A 1O0PA 4DHYA 4CJWA 3NH2A 1BIUA 1HYZA 1R8HA 5CAAA 1T8EA 1MSWD 1FE4A 3FJ2A 3MCSA 1S10A 1Q8IA 2MZTA 2VH7A 1RT3A 2BE2B 4DX6A 4V1Ak 4BR4A 2FZGB 4DCOB 3KYLA 3FSIA 3H3OB 4E1JA 3LZIA 2J6TA 4BE1A 3CCSS 1Y5LB 5KFMA 2E9RX 3PV8A 3LTOA 4C11A 2CVEA 5DM6Q 2IJNA 2E8AA 2CQ0A 1JJCB 3D2FA 2W4DA 4IG3B 3UPFA 1YIJN 2YX1A 2R2TA 3UCZP 4FWNA 2AJQA 2C3UA 3MMBA 1D8YA 3O3LA 1WBDA 4DOZA 1KAYA 4M5JA 5AJ3K 3SQGB 3OSPA 3QJJA 4WXWA 1R31A 3M6VA 3M32B 3I0SA 1T9TA 3VGUA 3MXHP 3GDQA 4O44B 3V2UC 2DXFA 3EGVA 2O8CB 2CJAA 3OYJA 1YSJA 5GMEA 4M3YA 4FZYA 2AEMA 1RT5B 4CZEA 4LF9J 4M3ZA 5D4PA 3MR3A 2W9CA 3T41A 1ZAXA 5HI7A 5GMDA 5D0RA 3ZSXA 2VONA 4H5TA 1RT3B 6FD1A 4RCHA 4ZVFA 1RHUB 3EWGA 4A8OA 4PUOA 2FSKA 3TABA 3OXLA 3OSNA 4C11B 2POKA 5M2PA 4R5PA 1HBMA 3AOBA 2PGCA 5KG0A 4E0DA 4QW8A 2BJ1A 1RTHA 4JOUA 4P2MA 4K4XA 1VQKS 2VV5A 2GW8A 2F7VA 3K5NA 1VC5A 3JTNA 2OH2A 4G9ZA 1JCFA 3PRVA 1T05A 1SL1A 3MMBB 4ALZA 2E9TA 3EXCX 5KFFA 2L41A 4K0KK 1GOAA 3IO1A 1MLAA 1R8BA 3ZZPA 4YS2A 4NL5A 4CIEA 3G86A 1EKSA 4I69A 4YMEA 2IA6A 1Q9YA 3D6MB 3I0SB 3V1OA 3PJWA 4O3QA 2LCWA 3MEEA 1PCAA 4DF4A 3BZKA 2LQ9A 1JQGA 2P2CB 2GWJA 2KHOA 1OJ4A 4QS7A 1RT4A 3FEXB 2DBBA 2W9CB 5B0DA 2VBXA 4BS2A 4ZVTB 3B8AX 3PKYA 1S0NA 4MKAA 1D4XA 3SQ1A 4PUOB 5AQVA 5BPLA 2ZH4A 1SC3B 1LXJA 2QJ3A 3MFIA 2V9WA 4MH8A 3J7ZO 1FVSA 1WG5A 3CNQP 4DUZF 1GLLO 4R5PB 3SV3A 5D0EA 4CO2A 1QHTA 4PR6A 3EJMA 4DTPA 1S4FA 2HGMA 1RTHB 2LA6A 4CHPA 4X66J 2Q1LA 5AQWA 2W7PA 3FZ2A 2CQPA 3U8XA 1NM1A 3C19A 1L5UA 1S72S 1T05B 3A5NC 1KQSR 4K4TA 4JKFA 1PYTA 4KRWA 3UCGA 4CM2A 1CG2A 3CO9A 1HNWJ 4FLUA 2DIVA 1RWOB 4QR0A 4QU7A 5HN0A 5D78A 4TU9A 4OX7A 2E1RA 4FZVA 4B3SJ 1SKWA 5BPMA 4X4OA 3ZTRA 3MEEB 4ECVA 4CGFA 4DN0A 2F8HA 4L72B 3BKTA 4USKA 3NFAA 2DRAA 4GNIA 5JVGL 1RTJA 4AQYF 3WT0A 1UEUA 3GFZA 5JLHA 1RT4B 2FB0A 4IZ9A 3CDAA 2QWPA 2NXNA 3RU0A 1RAHB 3V1QA 4OGCA 1G7CB 2B4PA 3THXA 1LWXA 3B4MA 2OKQA 2FC0A 2CVIA 5ETRA 5KRSA 4K7QA 2NXUA 4Q45A 2W42A 5M1QA 4FJXA 2F8SA 5LSLA 4O0NA 1VRUB 3P31A 3GYNA 4LBHA 4F8RA 4AF1A 3QEWA 3JAMY 2F4FA 3D6TB 1BY9A 1NBEB 4ZLLA 5BREA 4A2BA 4PL8A 3TJ8A 4DF8A 2PAVA 2QFJA 3EDQB 1FX4A 1KVBA 4CFAA 4N76A 3DRSA 3HHLD 1V4SA 5AQQA 4Y0WA 4LH4A 3FZKA 1YI2N 1FRXA 3X1LB 3FEZA 1UTAA 4MKBA 3Q2TC 3E9PA 4JV5F 3HYFA 1E4FT 2H1YA 1K0VA 3WNFA 2QL7B 1U6ZA 1ZXOA 4RNMA 4NASA 3PW0A 1TKXA 3RB3A 3THXB 3MEKA 1IM6A 4OPHA 3CB4A 2JNJA 2QO3A 1G4CA 2XLIA 1XMQJ 3O2IA 4KJIA 3FRYA 3HZGA 1QHAA 4G65A 1G99A 2DPNA 2QE5A 4DR7J 3M8PA 3DXSX 4YB6A 3IA0A 2DEIA 1RE1B 2HK3A 4NWBA 1R8CA 3I82A 1RBOB 1H73A 1HNZJ 4DV7K 4FKYA 3HOTA 4E3SA 4JI8J 4BRAA 3D3CJ 2BABA 3DRSB 4BR5A 3QJPA 1HHQA 3LDQA 1X4DA 3KLGA 4QU6A 2ZOFA 3KK2A 5FIIA 4EK2A 2D3OR 1VK8A 2YQ0A 4OYWA 2BXJA 5HJXA 1K9MO 3S7RA 4W5NA 3OYAA 4FPIA 1MG7A 2WVFA 4HTIA 2HHSA 3SCLE 1YGYA 3D2WA 1S97A 3MURP 4LSLA 3MM7A 3MMCB 3AO4A 3I6PA 1RWVB 2K7KA 2HAIA 2SXLA 4PYDA 3J7YU 2EKNA 3S01A 1SC4B 2KRBA 1N54B 5KFLA 3BQ0A 4YY3K 2OTLS 2BKOA 4GC6A 1PGZA 2IIRA 1RU2A 1P9QC 4BRGA 2OPSA 1RAIB 5ADXA 4BREA 3OL9A 4WFNQ 2LYVA 4H5RA 3R5GA 3M8PB 3OW2R 3FCHA 4JI5J 1WAFA 4PRFA 2ZC3A 3G8QA 3LP0A 3TNVA 3G87A 4XH5A 1B3TA 4OI6A 1RBUA 1YHQS 2LQJA 1CPZA 2D7SA 4A8QA 1FEHA 1H38A 4ZVUB 4A59A 5EXWA 4DR1K 3KLGB 2BBEA 2FVPA 4RUBA 2OD4A 1ZA1B 3C94A 1NZ8A 1FCAA 3WHIA 3B6BA 4QPTA 2Z2MA 1RDBA 4QOTA 3Q86A 5MAOA 2CG8A 5C10A 4CE9A 3RR7A 1IWAA 2C2NA 2YHWA 3MM7B 1CZAN 2WSEC 2EC2A 2DFEA 4X66F 2GELA 4YR2A 5D0HA 1PC4A 3HDSA 1H72C 2IDEA 2AQ4A 3FZMA 1FERA 1JLFA 2A41A 2OPSB 4F25A 3VN5A 2JWNA 4FZZA 1GXTA 3E9OA 3ZT2A 4BR0A 1XWLA 1HNWF 2EVZA 4OZ3A 5ETPA 4ZOSA 3LP0B 4PY5A 2QLWA 3BJYA 5JUMA 3AA4A 3GBTA 1TP7A 1CLQA 4BRNA 3N5BA 2ZH8A 4USHA 2YX7A 3CM5A 3KUHA 4ECRA 1KRPA 2LXUA 3DXKA 2K3KA 3TZZA 4DLEA 2KTQA 4V19J 3QQCD 2IJFA 2DHXA 5KT4A 1F2GA 3IMQJ 3QIOA 1BD6A 2XHWA 4ES1A 3B82A 4DL7A 2Y3YA 1BUXA 1REVA 5GAHU 4LY7A 2D5RA 3GJTB 3SCKE 4KGKA 1W25A 4KREA 3NWRA 4CLPA 1EXQA 1N0UA 2MSTA 4KHQA 2P5GA 3KKSA 4LRBA 4B1VA 2VG7B 2OTJN 4A8YA 2NUBA 5J2QB 3GR0A 4XK8C 4R0EA 2R7YA 5DDQC 2Y1JA 1EX8A 3MWPA 3NGUA 3T1YF 3LO3A 4ED1A 4FLZA 1S4EA 2K1RA 3FGUA 4NEZA 4TYAA 1SS6A 1QTNB 1N8RT 4IXCA 3TRGA 2GIFA 4A57A 2A18A 1YWXA 3EXYA 3MGJA 3QFUA 2V4JA 2NLWA 1YQHA 4WF9Q 3OT9A 4URSA 3FE1A 4WZQA 3CCQN 4RWXA 3KLHB 1YJTA 4MK9A 4KBOA 2WCXA 5GADI 3A8KA 1N88A 4TY9A 4IG0B 4JUZA 1XMOJ 1FRHA 4FWQA 1T3OA 3BGLA 3DXKB 3Q23A 1KQGB 2RE2A 3VAGA 3O4NA 3MD3A 2JH3A 2VBZA 1ZBSA 2CYYA 3CCTA 1JLCA 3WUHA 1QM9A 4ZPVR 2A2DA 1YJNN 1JB0C 5KPTA 4QJVA 3LZJA 2AMCB 2DNRA 1HQ2A 1REVB 4NXMK 3M2UA 5IWAF 3EN9A 4JKGB 2DPIA 2JVOA 1FXRA 2FJWA 5KFCA 2DHGA 3EICA 4DFMA 4O3PA 3VQ4A 1YUWA 3KHYA 1SXLA 4DL5A 3SBMA 4CH1A 1QAXA 5A6WA 2DO0A 4PKDB 1O6XA 4NCAA 2HBLA 4DR7F 1UJ5A 4HI2A 3K0JA 2E5HA 1S1TA 5KFQA 3ONQA 2F4VJ 3UVJA 3VA0A 1LCUA 4MT1A 3I31A 4OGEA 4GV6A 4M5KA 4DJBA 4F36A 4I9LA 3GTYX 1EO1A 2VWBA 2PFUA 3V5RA 4JI8F 2ZVSA 1GTEA 2V4JB 5KT7A 1XNQF 3FZHA 2VPWB 2ASDA 2CIMA 3TSPA 4CH7A 3ITHA 2UU9K 2IGIA 4Q8EA 3AJ1A 4NLUA 3TO8A 4B3RK 3C6AA 4DN9A 5E84A 2ASJA 2AEJA 2EW9A 3KHLA 4PAAA 2B6AB 1FRKA 5EOYA 3VGLA 3MN9A 5DM7Q 1E6YA 3PHEA 3O9SA 1JLCB 2UV8A 2DTJA 1S1VA 1FWKA 1HWKA 1ZM4A 2DY9A 2GVDA 2D41A 3M2UB 4YHHF 1ZTTA 4YNQA 2B56A 1S12A 3MXJA 2O67A 2ASPA 1UOCA 3VQ9A 2OFGX 2OAUA 3MECA 1UVIA 1S22A 4IOAQ 4NZ0A 4DR5K 3ZCMA 5DDPC 1TFYA 4FWOA 2E7WA 4CEDA 2B8QA 4C7QA 1HIYA 3CXCM 5HVGA 2CPJA 3BGUA 1S1TB 3DWLA 3UVJB 2A1RA 4CNYA 2N4DA 3PKMA 5CYQA 4RPFA 2VDIA 1S3XA 4IRCA 2X3DA 1Q8LA 3EO3A 2QRRA 2UUBJ 4KGVB 2H4YB 1FTRA 1SPBP 1HARA 3DLGA 1I5OB 3ENVA 3SCXA 4B3TF 1ZBLA 3ELHA 4JI3K 4LRFA 5BN8A 3O4WA 3BREA 3ITHB 4PXBA 2D1KA 4LSZB 1T7PA 1UA1A 2F3JA 3M2RA 4KYZA 4USJC 5KT3A 3CCRN 2R7QA 2HHXA 1P27B 2G2ZA 2QWOA 3HJVA 2J8AA 3CCJS 3ID8A 1ELOA 1VQYA 5HBMB 1IKVA 1TKZA 2WAQD 2VFVA 1RADB 1HWUA 4PG4A 1S1VB 4A62A 4JNEA 2D74B 2VPYB 2GVDB 3JSYA 3MM8A 3HFKA 1I3OB 3QGIA 3FKBA 1WNSA 2OZMA 2B7BB 5IT9Y 3AVKA 4DV6J 4YFUA 4USVA 3M6XA 2WUSA 4X4QA 5FPEA 5CR4A 3MECB 4XDCA 2WB4A 4QYRA 3O5TB 4I6MB 1U1MA 1J5EJ 2HF3A 3VQDA 1FF2A 5C42A 2IVFB 2XCAA 3C2PA 4WP3A 1JXBA 1V9OA 3CIZA 3QT6A 4N77A 4BRPA 5CYQB 4DV0K 2XMJA 5ETOA 3KLFB 2OIHA 3VEXA 3TAFA 1EP4A 3BH6B 4CBUA 3DLGB 3AXKA 4RBUA 3OJUA 2NRTA 1EQ0A 3QIPA 1NLKL 4DV4K 1OYDA 5JMNA 1HR0K 4O8UA 2OA8A 4CZKA 1V3RA 4CT8A 3M2RB 5HQ8A 2GO9A 4OYAA 1VQOS 3DRXA 4O3RA 2DH8A 3DRYA 1PJ6A 4B8CA 5AR0A 3R1XA 2HHWA 4X62F 1TKZB 1VQSA 2HB5A 3GV5B 1FFWB 4TLRA 3QSIA 4AM6A 3MM8B 2CRLA 3JYTB 2XY5A 4FYWB 3VQBA 2E88A 2VQFK 4RKUC 5LXYA 2XS7A 5FDLA 2G2OA 5DZ6A 4IFVA 3JB9k 2X1GA 5B0FA 3X3UA 2FVCA 3JSBA 4BR2A 3W9HA 3KTQA 2YNFA 2VQEK 3JTOA 4LF6K 2W2OP 3MUTP 4ELVA 3M30B 5AQGA 3PXGa 1K8AO 3ET6A 3CCVN 4QBUA 2HIQA 3H5YA 4WFAQ 2VHGA 3VOVA 4USTA 5KFEA 3RBDA 1UFWA 5B0BA 4DX7A 4C3MA 4DI6A 3OYMA 1VI7A 3QIPB 3NVKA 1GNKA 3HJFA 3DOKA 1U8WA 2RVJA 2RPIA 1IBMK 2UXDF 3LH2S 4ZP8A 1X1PA 1BCOA 3SQ2A 4ZPCA 1DT9A 4DR6K 2YHBA 2LEBA 1IJFB 2DJWA 2LXFA 3G4SN 2VFSA 4ILJA 2E2PA 5EUHA 4LVNP 2CZ9A 1BXNA 2QKBA 1I6JA 5ETSA 1I3AA 3M8YA 1OMSA 1IQZA 3R6LB 4L3NA 4IR9A 3NNCA 4NCGA 3ZNUA 4CESA 1OPZA 1YT3A 3VZHA 2W2NP 3HHLC 2AYEA 4ZVEA 4CI6A 3SMSA 2IPOB 5FDLB 1FEEA 5HMZA 4Y1CA 2NPFA 2FVQA 4E19A 4IFVB 4X65F 5H9FJ 3JAMU 4E1MA 2XLJA 3FQLA 4K4WA 5B8HA 3EM1A 2QWQA 3AY9A 3H5SA 4B1ZA 4TQRA 2YNFB 2RIJA 1M90T 2E44A 3HP9A 4DR4K 3D67A 1EETA 2D0AA 3R5AA 3ET6B 1BO5O 3AFGA 5T7LA 2P5OA 4B17A 4LFCK 2FDNA 3PX6A 1WSIA 4J9VA 3A1YG 3CMAN 3UN3A 4BC7A 3CPEA 3QWUA 4NYZA 3MAQA 4RW9A 3GFYA 4FWKA 3VTIA 1J6ZA 2KHCA 3DOKB 4HEA9 3E01B 3HP6A 1H0HB 4X4PA 1HD0A 1X7VA 4CI0B 2FJDB 3KG4A 4ZN1A 1JWWA 2Q0RA 3A5LC 4FLXA 1OPIA 4J9RA 2DHSA 3MM9A 3NL0A 3CCLN 4WYWA 1RBVA 2ZJRL 4DSJA 4K41A 1X4FA 2NPIA 4MYUA 5AE3A 4DU4A 3U1LA 4OL8A 2DRDA 4FLVA 2VL1A 1XR6A 1SQEA 4A8SA 2A6OA 2X7IA 4I0WA 4EFAC 1WJ9A 1RTIA 2ZQBA 4M7XA 3OYEA 3U02A 1VQPS 3PFOA 2L9NA 4MK7A 2IIHA 2Y1RI 4ICLB 1FX2A 3L09A 3PSIA 4RW9B 3OQ2A 1SH2A 4OX9J 2FHMA 3L7UA 3J7YI 2D69A 4Q2LA 4H0PA 1CS4A 4GKKJ 3AODA 2FJAB 1YZ7A 2W6LA 2YQ3A 1XC9A 4KH6A 5BN9A 4Y2AA 4OV6A 2DFHA 3NNHA 2LA4A 1RCHA 4KHWA 2EKYA 3SUPA 3HFZB 3DLLL 4B3MJ 3SPYA 2EG2A 4EHTA 3OR1A 5HQLA 4FJHA 5DQIA 4J2BA 2F8MA 2P9SA 1ASUA 4UZBA 1SBRA 1J2VA 4A5BA 1S6UA 3PFEA 3AB2B 5GAEP 4ENOA 4LJMA 5E3QA 1V3SA 3DRPA 3KJNB 2ZH2A 1RTIB 1ZC6A 1MROA 3L3VA 3DOMA 2B4UA 2ACMA 2QYGA 2ROGA 2YKMB 3C6UA 2AW0A 3AA5X 5IM0A 2V7ZA 2U1AA 2BJ9A 3BV8A 1Q82O 3ID6A 2AJFE 4F2RA 2ABYA 1YK9A 2EG1A 3BF4A 4WKRA 5D4LA 5EDWA 1SQGA 5G4DA 4ZVPB 1L3KA 3TR8A 1LOUA 3HT3A 2E7XA 5KFXA 1N5SA 1RP5A 1F9EB 2QYCA 3I32A 1NGDA 5CHIA 3DXMA 5LL6Z 4WP8A 2HURA 4FDFA 3MMVA 1M5HA 4N47A 1DEJA 4CJUA 2HKEA 3O3HA 3U9DA 2BJ7A 2DGVA 2ZDOA 2HQGA 3TQEA 2QX0A 4GW6A 2P9SB 3D0HE 4NZ6A 4QR1A 5C0YA 2AP1A 1QUVA 5CH7B 2IDLA 1KOOA 2MQLA 5IXUA 2XG8A 4GVMA 3R97A 3A8IA 2CDQA 4N41A 2XYPB 3ENQA 2OPQA 1R27B 1O5JA 4DS5A 2J9EA 1RBRA 5AQUA 1VQMS 1MMDA 3DRPB 2PYJA 1X4EA 1RNHA 3OS2A 2YX4A 3TARA 3AVFA 1V4TA 1MROB 1HI8A 3KLVA 3DOMB 3OXFA 3KHRA 1BI4B 3CC7N 3C6UB 4Z7CA 2BW2A 4C8LA 3ZT3A 1KTQA 5IM0B 2UUCF 1W2IA 3K2YA 2V52B 2FHJA 1TL5A 2O5DA 1GXLA 3HVTA 2HFOA 2JFKA 4XPEA 1UJ6A 3EKSA 1SAZA 2A3ZA 4NLXA 2HBJA 3TZWA 2VCPA 1RYRA 2XYGB 4CNZA 4JV2A 1UVJA 3BR8A 2JEFA 3DXMB 2ASOA 3S9HA 2EFOA 3D1HA 1I94F 4CJFA 1Q5YA 5ADXH 3G6VA 2DNHA 4HTJA 1NDCA 1K9MT 3O1BA 5GVQA 2ROPA 2BZ2A 2KYXA 3MCPA 3CT9A 1VC6A 2PBDA 3UE5A 2CPXA 3V9XA 4A8MP 2AYMA 1WC1A 4HUFA 2OPQB 4EO8A 4BDZA 2JC0A 4UUXA 5FLXU 1TK0A 3R7SB 3KHGA 2LEPA 3CJQA 4CJPA 2UP1A 4ZVSB 5HJYA 2PMHA 2M2BA 5CZVA 1W0HA 3K57A 3PW2A 4NXNK 2C22A 4Y3CA 4OZ2A 2EBGA 4U95A 2MY8A 1M5OC 1RT6A 2DNYA 3L7PA 5I9EB 3LANA 1DRZA 1XNRF 4DV3K 2ZUAA 3Q8RB 4LF4J 4Q43A 5T41A 2COLA 1NZAA 1Q7YT 4K5RA 1JCGA 3HVTB 2MLXA 2YTCA 5HK4A 1QVGR 5CYMA 4QS9A 3H42A 4OHXA 3QNNA 4J91A 4I7FA 5DRKA 1M1GA 4JV0A 3E8OA 4FYXB 4P10A 5HLFA 2GX8A 4CZCA 4JI6K 1O13A 2IYGA 4F4YA 3VQ7A 1PAEX 3DRRB 4DLGA 1N33J 4E8UA 5I4MA 4CLKA 1FFSB 4RL1A 1N32J 4PPZA 1WHYA 5K5MA 3W1YC 2GJFA 2QGFB 1W2BM 3CF5Q 2CWKA 4IR1A 1SV5A 4RU9A 5A2QY 3K17A 2JOQA 3T6JA 3MF5A 5CCLA 4MJKA 3CCSN 2CJXB 5KFHA 5J1NA 3RAQA 1RA7A 1LQ9A 4H5VA 4WYBA 2ZKTA 2CNKB 2BTFA 1WKKA 4E7IA 2NQPA 4DG1B 4BR7A 1RT6B 3QZ8A 2O1PA 5ETKA 1S49A 4K5SA 2YKOA 3LPUA 2HRUA 3B4DA 4LR9A 2GNKA 3ETMA 4V19S 3KWIA 4ZP6A 2Q66A 1NDPA 1C0GA 3NS5A 2GZOA 4JI7J 1S5ZA 1X4HA 4I7FB 4PL7A 3S8SA 5KG7A 1HYVA 2D3O1 2WVDA 3VVUA 4OHYA 4I2QA 4DL2A 4LF7J 4CLWA 5HLFB 3HHDA 4EEYA 1KQFB 3BS9A 1YRTA 3V6KA 4TY8A 3D0IE 5LOQA 1HQUA 2CA9A 4U7UK 1MU2A 3T9NA 4KE5A 4JI4F 3ZTPA 2ZH7A 1T03A 4LF9K 4LIWA 2F9JA 3I0RA 1CZ9A 3BR9A 3O9TA 4UY8O 2PFFB 3BQ1A 1SV5B 4CBWA 4O55A 1VHXA 2MDAA 4R25A 3UI3A 3JXUA 5FRMA 1RT7A 5DK5A 3THWA 3NRBA 4DU7A 2JZ5A 5KT6A 2QM1A 3CC4S 3DCAA 1FXLA 3OJSA 2W8LA 4JKBA 2Q6CA 1VQKN 1RACB 4NYNA 4KHYA 4WFYA 4ZPBA 4FJIA 3VF6A 3AVMA 4Z0UA 4MKYA 3HXMA 1KQKA 5ADZA 3AVLA 4ES2A 1NBWA 2J6SA 2WBMA 3NOGA 2J76E 1Q86O 4KB1A 4B1UB 1U47A 2HQCA 4IOCL 1YF5L 5KGXA 5I3QA 3OTOJ 5G0RA 2HNDA 3D6FB 3N5FA 4O23A 2HQ3A 4M5NA 4FYDA 2BOAA 2ZF5O 4CGJA 3E51A 3VEZA 4TY8B 1TL4A 1X9MA 2UVRA 2KKZA 4IWVA 2Z1IA 2CNLB 1MU2B 3Q7BA 2DNPA 2GEMA 1GT8A 1T03B 1S1XB 3CJ8A 2C3PA 3WXJA 3PW4A 2GWKA 2OUGA 3I0RB 3OFGA 5KPRA 1FKOA 1FA0A 4IQMA 5KG2A 2E1PA 1RT7B 3THWB 2YY3A 4ZLNA 3FBFA 2IM3A 3VCDA 3QSYB 4DL3A 2E5LJ 3SYZA 2VPXB 1OKJA 4ZLJA 1BHNA 2YNHA 2CQIA 4X66K 1B0PA 3CJ7A 1OO0B 3VGSA 4M5IA 1QUPA 1S72N 3C16B 4FNHA 2FHKA 5A2QO 3IMXA 4Y28C 1FDAA 3QT7A 4P73A 2G1DA 3BY5A 2HS4A 2YNGA 2O8EB 3AGRA 2GQQA 1HNWK 1RZMA 2HQDA 3M9MB 5G0RB 2HNDB 2XMTA 4FS2A 4B3SK 1GMWD 4YOVA 4ECUA 2A3JA