2OPRA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
538
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGNPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 140
structure length 538
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oprA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oprA05
3M8QB 3DM2A 3ISNC 5HP1A 3ZCMA 3G86A 4R8UB 3AO4A 2P1JA 4M42A 4I2QB 3TANA 2XY5A 5E41A 4N5SA 3L3UA 1REVA 3N6LA 3LP1B 3NAHA 4LSNA 4WE1A 5KFLA 4LH5A 4TQRA 1G15A 1HQEB 3V1RA 4ZPDA 3WNGA 4DU3A 1RBTA 1ZYQA 3HK2A 4OPJA 3HL8A 4YR2A 3RB0A 4KSEB 1EETA 3NGZA 2YHBA 4ZHRA 3SYZA 4NRTA 5EWGA 4NYNA 1QE1A 1SKRA 2RDIA 1U45A 3KK2B 4BDZA 1C0TB 1X9SA 3CIZA 4K4VA 1L3TA 4XPEA 1RT1B 3N6NA 3U3GA 3WNEA 2UVRA 1Z26A 4NYZA 4E3SA 2BANA 1UAXA 2AX1A 4M94A 3CM6A 4ZVGA 2JEIA 3QERA 4C8OA 4RW6B 4Q0BA 2AGQA 3HT3A 3VQ5A 4CEDA 4ED1A 3NL0A 2KTQA 3PV8A 2IM1A 4ZP6A 3NE6A 1CLQA 4IH7A 2FBXA 2OA8A 3E01B 1NKCA 2X6NA 2UVUA 3BDPA 4E0DA 4Y3CA 4ZPBA 3OVNA 3I5CA 4CFAA 2W8KA 4HTUA 2B5JA 4C8KA 2WB4A 4M45A 3ITHA 5DG7A 3QGIA 4CIFA 3NCIA 3F73A 3SQ0A 4QCLA 4EBDA 4CEBA 4FLVA 1NKBA 1LW2B 2E9TA 2FVPA 4FK0A 1R0AB 3QIDA 3QGHA 4AHVA 3DOKB 1L5UA 2YNGB 4YP3A 3NF8A 3VQ6A 4EP5A 1TKZA 5JXSA 3PVXA 4CJEA 2G8KA 3QEPA 1C0UA 2I1RA 1UWBB 4U7CA 5KFGA 3KMSA 1HYZA 1JLEA 2GIRA 4ID5B 3O3FA 3TARA 1NK7A 2KZMA 4TY8A 4F8RA 5C25A 5KFIA 3LZIA 2E9RX 4IRDA 1RT7A 4KI4A 4H4OB 4J2EA 2F96A 3QZ7A 4K4TA 2I5JA 4B9LA 1D1UA 2YKMB 3MECB 4PQUB 3CFRA 4Y1DA 4TXSA 3ZSOA 5F8NA 3ZSRA 4URSA 4L8RB 4Z4GA 3PZPA 3CWJA 2HB5A 3M8SA 5KFCA 1GX5A 2ETJA 2Z1HA 4FCYA 5EU7A 3OS1A 2C28A 1IKYB 1N6QB 3BQ1A 5KI6A 1DTTA 3FQLA 1T03B 3S3MA 4O4GA 2R8JA 3PW0A 3T19A 3LDSA 3IG1B 4KTQA 3PR5B 1NKEA 1TAUA 3NH2A 3AV9A 3CDEA 4MH8A 5CYQA 4FJNA 4CHYA 3AO2A 1IKXB 2IJFA 1JLQB 5KFEA 1DLOA 3BQ0A 4CK3A 5KT5A 3MEDB 2B4JA 1HQUB 1SL2A 3WNHA 1T7PA 3BSOA 1LAVA 3L2RA 1MMLA 3DRRA 3H5XA 2OPRA 4I2PA 3NMAA 4DTJA 3Q8RB 4ZVHA 4CK2A 4C8NA 2P5OA 2R8HA 4K4UA 4RNMA 4NLSA 2YNIB 1RDDA 3HM9A 1VSHA 3G0ZA 5KG1A 3QESA 1RTHB 3RBDA 2B6AA 1LWEA 4Y2AA 2XC9A 1RT2B 4KHMA 1KFSA 3OHAA 4FXDA 2D5RA 2G8IA 1N48A 1JXLA 5DMRA 4RW8A 4KO0A 4CJWA 2G8VA 2GBZA 2YV0X 3OYJA 1TL3A 3AVJA 4ZMMA 5J2QB 4DS4A 2FVRA 4DSJA 3SUPA 3OL9A 4CJQA 2WONA 4M41A 3UDLA 4CHOA 3LALA 2UVVA 1S1VA 4K8ZA 3MFHA 2JLEA 3LWLA 4IFVB 3Q8QB 3TAMB 4CERA 1TK5A 5CYMB 4G3IA 4O3QA 3AVMA 1HNVA 1RYSA 2OPSA 1RDBA 2IAJA 1TL1A 2XY8A 1JLBB 1JKHB 2HNDB 1XHXA 3DI6B 1KTQA 1RILA 2D3UA 3OYHA 3TAFA 1CZ9A 4BWMA 1S9FA 1YVUA 3KHRA 2A1SA 4OLAA 3RAXA 2J6SA 3KLFB 4Q43A 4FZZA 4FJLA 4B8AB 4ED8A 3GV5B 5KFYA 5CZ1A 5J1EA 4EZ9A 1TV6A 1FK9A 3K2PA 3ZT3A 3EY1A 5KFPA 3KHLA 1TVRB 3KLIA 4OKJA 2IC3B 3DDKA 1ZBHA 3KLHA 3CJ5A 3ZT4A 3RWUA 2V4QA 1C1BA 1X9MA 5KGWA 3RMAA 2AJQA 3UIQA 4M3RA 4FK2A 2RKIA 4ZPAA 4FBUA 4ECUA 4FLZA 2E6LA 1ZBFA 3WNFA 3V6DB 4JV0A 4Q44A 2W42A 1D0EA 1HPZA 4LY7A 5HROA 3QIPA 1U09A 2BQRA 3QLHB 4NLTA 4HUFA 3TAQA 1KLNA 2QK9A 1IKWB 4FLWA 3T3FA 1S6PA 3QNNA 3LP2B 4AH9A 1XC9A 2F8TA 4HUEA 3MEEA 3NAIA 4ELTA 3V4IA 3D0PA 3F9KA 3SQ2A 2GUIA 3NBPA 2V4RA 3ZSYA 2WCXA 5I42B 3L3VA 4DL3A 4CHQA 4O55A 3OLBA 3AVKA 1RT4B 4Q8FA 1KFDA 3M8RA 1T05B 1DTQB 4URQU 3M8PA 3HO1A 2EHGA 1LAWA 3P83D 2BRLA 5FDLA 2IGIA 4K4YA 2R2UA 1RA6A 4DL5A 4M3UA 2VG7B 5KFBA 3KNAA 1BCOA 3LWMA 4E1NA 4IKAA 3CFPA 3BREA 2HHTA 5F8GA 2WOMA 2BQUA 3IAYA 4CGJA 4Z0UA 4LD0A 2AX0A 4K4XA 1SV5B 4CJ3A 2GIQA 4I7FB 2ASDA 2X6SA 4G1QB 1S9EB 3O3HA 5EUHA 3VQQA 4RW4A 1KLMA 4IBNA 2O4GA 4O3SA 2W9BA 4DTXA 4DSIA 4B3OA 4DQQA 2XY6A 3HP9A 3OYEA 4OL8A 3CM5A 3M8QA 2YNFB 3CJ0A 4O44B 2HVIA 4R8UA 1NJYA 4XPCA 4KI6A 3IS9B 4I2QA 3RTVA 4FYDA 4F3OA 3DLRA 3LP1A 4R0EA 3FDSA 2ILYA 1HQEA 4CHPA 4NLWA 4NLXA 5KG4A 2DPIA 2O5DA 2HNYB 2XI3A 3SFGA 3HP6A 2R2RA 1N5YB 5DG9A 1W9HA 1CZBA 4MKAA 3CG7A 2HHQA 1RBSA 3KK2A 1HMVB 4FJHA 3SI8A 1RT1A 3NHGA 3PO4A 3LANA 2FBTA 4TSXA 1RT6A 3UR0A 2C22A 4RW6A 3OYAA 4DTOA 5FRNA 1IH7A 3LP3A 4DQPA 1QSYA 2YHAA 1S0OA 4LQ9A 2JEGA 3RRHA 3SPYA 3E01A 5DLFA 2YNHB 1F21A 2XCAA 1VSMA 4MKBA 4GC7A 3OS0A 1JLGB 3IRXB 3VQ9A 4H54A 4QWCA 4FM1A 1RDRA 1HYSA 1TKDA 2JGUA 1HJRA 3O4NA 2R2SA 4FJMA 4GMJB 1LW2A 2RDJA 3TI0A 1TKXB 1S0NA 3DLEB 4CECA 1R0AA 3BGRA 4H4MB 3GV7B 4DSKA 4ECVA 1S1TB 3DOKA 1RTDA 2YNGA 5KT6A 4JLHA 1RTJB 1B92A 3T5JA 4NLGA 3OYBA 1UWBA 3QYYA 2XGQA 2QXFA 4CJLA 4FK4A 1VRTB 4NYFA 3SUQA 3E51A 2W9CB 4ED7A 4ZVEA 4HCCA 3DOLA 5KFWA 3SNNA 3L2UA 4DFMA 4YNQA 4M3WA 1VSDA 5JUMA 2XY7A 3T5HA 3MECA 4ECYA 3FSIA 2R7YA 3H40A 4FS1A 4CHZA 3NF6A 3S9HA 5KG3A 4KHRA 1NJXA 1J53A 4MK8A 2J6TA 1D9FA 4RW9B 5F8HA 3NGDA 2IA6A 4KE5A 4AHRA 1IKYA 3MTKA 1N6QA 1S6QB 2FJWA 3V6JA 1TKTB 4MK9A 1ASWA 3I0SB 2NUBA 3OYFA 3K5MA 3RMBA 4J2AA 3IG1A 3CFOA 4RUCA 3DLKB 2AU0A 4ZP9A 4AHUA 3D5MA 4DL2A 3A2FA 4FJGA 1IKXA 1JLQA 2KFNA 2HNZA 1IM4A 3VQAA 2VG5B 4DEZA 4F3TA 4DU1A 1RTIB 5DK5A 4M3XA 4O4RA 4KB1A 4CJKA 4TQSA 2JC0A 4FM0A 4E7JA 3QETA 5CZ2A 1IO2A 3V9UA 5HLFB 2GC8A 2R8KA 4ID1A 1RBUA 4NRUA 2IS3A 1RTHA 3KLGB 3GV8B 1RT2A 1FXXA 2IM2A 1HNIB 3RMDA 3QEVA 2PYLA 5HRPA 1UOCA 1U49A 4N56A 5C42B 3CJ4A 1QUVA 3DRSA 3GIJA 3V81B 1KVBA 1S1WA 4W5OA 4HHTA 3PX6A 2G8WA 4DL4A 4AHSA 3LAKA 1SL1A 4IQXA 3S3NA 4KTWA 2DFFA 5J2QA 3OYIA 1HRHA 3QZ8A 1I6JA 2IMWP 3VQ4A 4ED6A 1WSIA 4CEFA 1RT5B 5J2MB 3GIIA 3EYZA 3PY8A 4IFVA 3TAMA 3OYMA 2W8LA 3HVTB 3PUFA 4WXWA 4FJ5A 1KHVA 3DM2B 5HP1B 4ED2A 4J9MA 4DTPA 3NH0A 4FLUA 1S1UA 4C8MA 1JKHA 1REVB 1JLAA 3GIMA 1VSEA 2ATQA 5K14B 3OLAA 2XCPA 2Z1JA 4GC6A 3OL7A 3V9WA 3VQ7A 5KT2A 3C94A 4DQSA 4OGEA 3PR4A 4CIEA 3KLFA 3LPUA 1S9GB 2DFHA 4RNFA 4AHCA 3SFUA 5I3UB 5KFTA 4DFJA 3C6UA 4O3RA 2HWIA 1RT3B 3HSTB 3T5KA 3S3OA 5DGAA 4RUAA 2ZE2A 3AO3A 1TVRA 4DMNA 4ELUA 5KFAA 4KHQA 4IG3B 3TQ1A 1JL1A 4FLTA 1IG9A 4NCAA 3K59A 4KB7A 4ECSA 4JS5A 4NCBA 3BJYA 1EP4B 3OY9A 5KFUA 2G8FA 5CY4A 3PJWA 3AVCA 3JYTB 5JS2A 2JEJA 1XR6A 3SQ1A 2YKNB 3H5UA 1VSLA 4FZXC 4F2SA 3QGGA 3MAQA 1JLFB 1LW0A 3C6TA 4QPXA 4DSEA 1WNSA 1SH3A 3QEWA 4F4XA 1LWCB 3AVGA 2IBKA 3OJSA 4MK7A 1B9FA 5D3GB 3AVFA 5HBMB 4CJVA 3QLHA 4IH6A 4DL6A 4QW9A 3V6KA 4JV2A 2RN2A 5F8JA 4XIUA 1IKWA 3JSMB 4KHSA 5KFFA 4FW2A 2FJXA 1GOAA 2ITGA 4H8KA 4KAZA 2W9AA 2XGPA 4DSLA 4N76A 2UUTA 4CESA 3G6YA 3PW7A 5I42A 3H59A 2C2EA 3SQ4A 1WAFA 1RT4A 4IDKB 1J5OB 1K6YA 1T05A 4YQWA 1DTQA 1Q9XA 1BIUA 1Z4UA 1NK8A 2I5JB 4NLPA 3BQ2A 3RAQA 3I8DA 4ZP8A 4FJIA 3KK3B 1QS4A 4EYIB 4F2RA 1SH2A 3MR6A 4Q5VA 3OYDA 4ZTJA 3N6MA 1C1CB 3ZSXA 3DMJB 4HUGA 4FJXA 1WSJA 3BSAA 1K1QA 1W25A 3LP0B 4DL7A 4J9RA 1SV5A 4KHWA 1C2PA 1TGOA 3B6OA 4G1QA 2P5GA 1S1XB 5FROA 1Y97A 3SV3A 4ZPCA 1QSLA 1BQMB 4BWJA 4CGIA 4Y1CA 4CEQA 3SJJA 1T3NA 3VA0A 4K4WA 4DLGA 4DTUA 2ZD1B 4CJFA 2FVCA 2YNFA 1WSEA 4O44A 3V9SA 5DGBA 1U47A 3H08A 2HHSA 3ZT0A 4IFYB 4OKEA 3IS9A 3TAEA 3K58A 3FFIB 5KFOA 2PY5A 3VN5A 4ED0A 2B43A 4B08A 1NHUA 3NF7A 2HNYA 3OL6A 3K57A 3VQSA 1VSKA 1XWLA 1N5YA 4DQRA 1NHVA 3VA3A 5JS1A 2D0AA 4DG1B 2DFEA 1RCHA 1NJWA 4PUOB 1HMVA 4O0JA 4CFDA 3DRPB 1A5VA 3BR9A 2G8UA 5L1LA 3RB6A 5KG7A 3OSPA 4KPYA 3ULDA 4KAIA 3C95A 4BACA 2HAIA 1NK5A 1D9DA 2RF2B 1RYRA 3MEGB 5EDWA 1I39A 3G10A 3V9XA 4J2BA 4CGGA 5C24A 2BE2B 5EWFA 4OJRA 4W5RA 4DTRA 3HPGA 4EO8A 4EO6A 3LAMA 4CGDA 2YNHA 3KJVB 3KK1B 4PWDB 2WONB 2VG6B 5KFHA 1JLGA 3IRXA 2ALZA 4TLRA 2R2TA 4JS4A 4QWBA 3V1OA 4CGFA 4NZ0A 5KG5A 4LSLB 2X74A 4BE0A 4KBIA 1TKXA 3DLEA 2XHBA 4H4MA 4NLYA 1KHWA 1S1TA 3ZSZA 1IKVB 2BRKA 1RTJA 5L1IA 4FS2A 4KFBB 4CF1A 4F4WA 4CGHA 3L8BA 3DYAB 3AVLA 4NCGB 4O3OA 4N47A 1KRPA 4Q8EA 4J9LA 1WSGA 4Z4CA 1NK4A 1VRTA 2W9CA 3I5AA 1EX4A 3V9ZA 4AILC 3TAGA 4FJKA 1XI1A 3LZJA 1T8EA 3PW2A 3PHEA 3VQPA 3PX4A 5L9XA 1FK9B 3ZT2A 4CJSA 1VK0A 1C6VA 2HMIB 3KLIB 3G6VA 1VRUB 4J9KA 3VQCA 3DLBA 1S4FA 3KLHB 4R5PB 1KCFA 3KLEB 4J9QA 3TWHA 3CYMA 4NLQA 1Q9YA 3K5OA 2HW3A 2OPPB 4RW9A 3RRGA 1TKTA 3QNOA 3PO5A 2FBYA 2HVHA 5F9NA 3OYKA 4JRPA 1QAIA 1C0TA 4CIGA 1RDAA 4OLBA 3DLKA 1HPZB 2PYJA 1MU2B 4HVJA 2UVWA 1TP7A 1SKWA 1S49A 5HRRA 3U3YA 1FKPB 1S97A 5F8IA 5KFKA 4ELVA 3I0RB 4TYBA 4PY5A 4CEAA 4B9UA 2DPJA 4KHNA 2VG5A 4CE9A 3NF9A 4CJ5A 2G8HA 3FRZA 2C2DA 2QV6A 4CEEA 4O0IA 2HHUA 3NFAA 1RTIA 4F4KA 3PX0A 1Z25A 4TYAA 4WZMA 4B9SA 1NK9A 5KFJA 1KSPA 4TN2A 2IM3A 4DFPA 2OYQA 3ZSVA 4C8LA 2BQ3A 2KW4A 5HLFA 4KTZA 2HHVA 4WFZA 4F50A 3KLGA 1WN7A 3PW5A 5J2PB 1HNIA 2IM0A 4EP4A 1LV5A 4ID5A 5C42A 4BDYA 2WOMB 4O5BA 1CXUA 4EEYA 3Q8SB 5KFVA 3RR7A 1SUQB 3CQ8A 3GYNA 2W7PA 3AA5X 1NK6A 5F8MA 4DFKA 4H4OA 4KHUA 4X2BA 4KV8B 4IOBA 4MIAA 2YKMA 4RW4B 4PQUA 4OGCA 3IN5A 1RT5A 2XWYA 5J2MA 4LQ3A 4M3TA 1QQCA 4RW7B 3GIKA 3HVTA 5KT7A 2E9ZA 3RB4A 2OZSA 1JLCB 3KMQA 2A1RA 1RA7A 2D0CA 1UA1A 2KZZA 3OS2A 1SH0A 4K4SA 1BI4B 3QO9B 4WYLA 1T03A 2UUWA 5K14A 1S0MA 4F4YA 4ICLB 3SCXA 4IG0B 2V0NA 3H5SA 2WRMA 2D41A 3P1GA 1S9GA 2V9WA 5I3UA 1HYVA 5J2NB 4XO0A 1YTUA 4FLYA 1RT3A 3MR3A 3MEDA 4ECQA 3SPZA 4DWIA 1HQUA 1LWFB 3QEIA 1FKOB 1JXBA 4CFCA 4RNNA 3MXJA 4IG3A 4CEZA 2AWZA 1RT6B 3FQKA 3PW4A 2Y1JA 5SWMA 1EP4A 4EBCA 1BL3A 1L3SA 4Z4FA 4NLDA 1BQNB 4OKKA 4E1MA 3JYTA 2ILZA 5DQGA 3ASMA 2YKNA 1WAJA 1N56A 4CJUA 4RG8A 4N41A 2YNIA 1JLFA 3HPHA 1A5XA 1J9AA 3V6HA 1NNDA 1LWCA 3DLGB 5D3GA 5KFRA 5HBMA 4KKOB 4FJ8A 1BCMA 1HYSB 2WK4A 4Z4HA 3HKWA 2EC0A 2FBVA 1XR7A 2ZQBA 3IGNA 3TABA 4IR1A 3BGRB 3JSMA 2IDOA 1RTDB 1D8YA 3AVAA 2OPQB 4YMEA 3OHBA 3RR8A 3DOLB 5DLGA 1ZBLA 3HPOA 4K4ZA 4MFBB 4FJ7A 5CYMA 4IDKA 1J5OA 2FVSA 3SUOA 5KFZA 1L3VA 4KRFA 1S10A 3HVAA 5KG2A 4PA1A 4M3ZA 4QW8A 4URGA 4I9QA 1JLBA 4E7LA 3KK3A 4HYKA 2HNDA 4DSFA 4LSNB 4WE1B 1J54A 3DI6A 5EWEA 4KREA 2DTUA 2ASJA 2FC0A 3KIOA 4NLOA 1C1CA 3DMJA 2XRIA 4NLUA 3QIOA 1I3AA 3EPGA 2JEFA 1EETB 3LP0A 3VQEA 4ZHRB 4EBEA 4UQGA 4BE1A 1QE1B 3O3GA 3AA3A 4AHTA 1RAJA 1S1XA 2Y1IA 2VA3A 5FRMA 4DLEA 5KRTA 5KT3A 2IC3A 1BQMA 2BANB 2IJNA 1QTMA 3EZ5A 4CFBA 1ZETA 4Q0BB 2ZD1A 3AVNA 3ZT1A 2HNZB 4DTMA 4IFYA 4BDPA 4WXOA 3FFIA 1A5WA 1B9DA 5DG8A 1NOYA 3K5NA 1X9WA 3TR8A 3V6DA 2DY4A 4CJRA 4W5QA 2B5JB 4E7IA 1TK0A 1WSHA 4GVMA 4CK1A 4CF9A 3T5LA 3ITHB 2FLNA 2VWKA 4KHYA 2R8IA 4IKFA 3MXMA 2IOCA 3CVKA 5KGXA 1YTAA 3VQBA 2Z1IA 1T94A 4DG1A 2VWJA 3M9MB 1KVAA 3CO9A 3OYNA 2BR0A 4KB0A 4MIBA 5T7BA 2ZKUA 4PUOA 3LP2A 3OYGA 3CJ3A 4Z4IA 3DRPA 1TKZB 4RU9A 1C0UB 2GV9A 2X78A 4BE2A 1NOZA 1JLEB 4QAGA 4FJ9A 4JRQA 2RF2A 4DTNA 3H2LA 3MEGA 3DRSB 4TY8B 5C25B 3AVIA 1S1WB 3AVHA 3SV4A 2O4IA 1RDCA 4RZRA 2W7OA 5KFXA 3MR2A 1RT7B 4W5TA 2BE2A 1YVFA 1BIZA 1JXEA 3OSNA 1VSIA 4CF2A 2EX3A 1TK8A 2J6UA 3KJVA 5DQIA 3KK1A 4PWDA 1VSFA 3VQDA 3SUNA 2VG6A 4F4ZA 4CJTA 3RMCA 3EZUA 5KFQA 3L2QA 4E7HA 3TVKA 4CJ4A 2VG7A 4JUZA 3KHHA 3NKYA 2HHWA 4LSLA 3K5LA 3THVA 3V1QA 4ECRA 4DF8A 3DLHA 1XR5A 1IKVA 3AO1A 4KFBA 1S1UB 4ED3A 4I7FA 3DYAA 1S48A 4M95A 3M9OB 3QINA 1DTTB 1JLAB 4NCGA 3BSCA 4O4GB 1S9EA 5KFSA 2D3ZA 3CJ2A 1HARA 4B8CA 2FLPA 2OZMA 4DTSA 1CSJA 4Y34A 1QAJA 5CYQB 3RBEA 5SZTA 4DQIA 3G6XA 3D28A 3SI6A 3MF5A 1DLOB 3C6UB 1JL2A 2R8GA 1ASUA 4OPKA 2ZE2B 3DRRB 3ZSWA 2ASLA 2HMIA 2FJVA 2OPRB 1N4LA 3NGIA 4M3YA 1VRUA 3P5JA 4I2PB 2QKBA 1EXQA 3T1AA 1ZBUA 3NGYA 3KHGA 3KD1E 4R5PA 3KLEA 1WLJA 1WNEA 1U4BA 1SKSA 3KLVA 2WHOA 3KOAA 2OPPA 3IGVA 4FBTA 4ZP7A 3HHKA 3OJUA 1LW0B 3NH1A 3C6TB 2XI2A 4ZTFA 3PJXA 4J9OA 2B6AB 1LWEB 5C5JA 2XO7A 1MU2A 4ECZA 4YR3A 3CDUA 2E4LA 3U6FA 3HVWA 3KKRA 2FVQA 4HKQA 4NLVA 4WZQA 4CJPA 1FKPA 1TAQA 4IRKA 4RW8B 3AVBA 4OVLA 1SL0A 4KO0B 4RNHA 1GOBA 2C2RA 2RPIA 3I0RA 1TL3B 1BHLA 4ECXA 4B9TA 2KFZA 3MR5A 1RBRA 1K1SA 5KFNA 4NLRA 4ECWA 2LSNA 4GW6A 5KTQA 1U48A 2F8EX 1S1VB 4O3PA 2D0BA 3NAEA 4K8XA 4HCBA 1HNVB 2VA2A 4E19A 2OPSB 1EKEA 5DQHA 4QWAA 4FLXA 2IAJB 3ALYA 4O3NA 1TL1B 3MFIA 1C1AA 1CXQA 3I5BA 1YT3A 4FJJA 5J2PA 5HRSA 1GX6A 1ASVA 5KT4A 4FZYA 1QHTA 4B9VA 1D5AA 2PZSA 1RNHA 4I9LA 1SUQA 1S5JA 4ECTA 3LPTA 1BISA 4IRCA 5KG0A 4QWDA 1W0HA 3AA2A 5J1EB 4KV8A 1TV6B 3HVRA 4K50A 4Q45A 5L1KA 2HWHA 3TAPA 4ZVFA 3RB3A 2Z1GA 4DF4A 3H5YA 1L3UA 3M9NB 4FVMA 1KVCA 3H4DA 4RW7A 4J2DA 4FW1A 1XHZA 1TQLA 1C1BB 5F9LA 5HRNA 2QE5A 4QWEA 1JLCA 1BGXT 3AA4A 3O4QA 1O1WA 1WSFA 4B9MA 2CJQA 3L2WA 4MQ3A 4QOZB 2RKIB 1BI4A 5F8LA 1S6QA 3QO9A 3H4BA 4E7KA 3I0SA 2HHXA 3QEXA 4WYWA 2OH2A 1JX4A 4ICLA 3H98A 4IG0A 1OS5A 3UPFA 3B6PA 5T14A 4EYHB 5HROB 3QIPB 3SZ2A 2KQ2A 4YFUA 3CDWA 5J2NA 3ICLA 1ZTTA 3KKSA 1S6PB 3EPIA 3ISND 1LWFA 5KFMA 1FKOA 1JIHA 4Y2CA 3MEEB 4CEOA 1Q8IA 1VSJA 1NK0A 3MXIA 3V4IB 4DS5A 3UQSA 3HJFA 4CCHA 3NBPB 2Q3SA 3HYFA 3KD5E 2E6MA 1BQNA 5C24B 3GILA 4IR9A 2WTFA 1UA0A 2BDPA 4CHNA 3Q8PB 1U04A 4DU4A 1RBVA 3M8PB 3OYLA 1NJZA 3VQ8A 2ATLA 4TY9A 4J9SA 1C0MA 4WFYA 5KRSA 1ITGA 3L2VA 4WFXA 5FDLB 4Z4EA 2D7SA 1ZTWA 4IH5A 4EZ6A 3DLGA 1GOCA 4KKOA 4W5NA 4YR0A 4U6PA 2CKWA 3OYCA 2JC1A 3V81A 4CF8A 2BGGA 4J9NA 3D45A 3NDKA 4FM2A 4E89A 2OPQA 3OL8A 5KG6A 2P51A 4J9PA 4LH4A 3ZSQA 2FLLA 3BSNA 3GQCA 1KLMB 5KFDA 2W9BB 2AGPA 3KTQA 4B9NA 4MFBA 4B3OB 5L1JA 1ZBIA 1X1PA 3AO5A 4CF0A 4RNOA 2AGOA 2QKKA 2AQ4A 3HXMA 4JV1A 1QSSA 2F8SA
chains in the Genus database with same CATH superfamily
1NDPA 3ISNC 5HP1A 3G86A 4R8UB 3AAQA 1MLAA 3M5RA 4I2QB 3W2VA 4ZJOA 1QHAA 3L3UA 3N6LA 2EK6A 4LSNA 4WE1A 2L3MA 4ISGA 1S77D 1FE0A 3WNGA 1D3WA 4ES1A 1WHYA 1ZYQA 3C15A 4EFHA 4OZ3A 1EETA 5HAOA 2A5XA 4NRTA 2DHXA 2V7YA 2RS2A 3CCVS 3UD5A 1XMOK 4CW7B 4BDZA 4XPEA 1RT1B 3N6NA 1S72N 2CIMA 1Z26A 2JVOA 1UAXA 3GFXA 1Q8KA 2AX1A 4DR3K 3QERA 2JEIA 4FL9A 2J7KA 2NXUA 4ED1A 3NL0A 1S6UA 4IH7A 1KVJA 3WXMB 4DX7A 2OFHX 4LF9K 3AJDA 3MM9B 3BKTA 2ZM6F 4E0DA 2H5IB 1N34F 3CT9A 2W8KA 4JI0K 4HTUA 1PYSB 2JJ4D 3QICA 2OMLA 4NWBA 4M45A 1PCAA 4CIFA 1Y00A 4MYTA 4CLYA 4FLVA 1NKBA 3EICA 3EVMA 3WBZA 4N8OA 2EFNA 1R0AB 3QIDA 3PDNA 4DR5K 1KAZA 4AHVA 3DOKB 3GTYX 2HS0A 3VQ6A 2FIUA 3D2FB 1UEUA 5LOQA 1C0UA 2D0OA 3RU0A 3KMSA 4WQ5A 3AOCA 4QS9A 4B3TF 2OAUA 3ID6A 2KZMA 2KT5A 3O6WA 3NMRA 4F8RA 4HACB 3SDEA 4AQYJ 3DDNA 3LDPA 2P9UB 3WDOA 3IUCA 4H4OB 4ZCKA 3QZ7A 4B9LA 3MECB 2NSCA 3LDOA 3TEGA 2VWBA 4PKHA 4Y1DA 4DV1K 2OHDA 1AB8A 1Z05A 2FPHX 4URSA 4LFBK 3PZPA 3T6BA 4GKJK 3I4PA 3HOSA 4USKA 3SBTA 5EU7A 3OS1A 2G9OA 1T03B 2NZCA 3M30A 4O4GA 2VHGA 2B9EA 2OCEA 3NH2A 4DV0F 2B56A 4H4KC 4FOEA 4NI2A 2DCLA 5KT5A 3MEDB 1SL2A 3H5XA 2QWLA 5IWAJ 4B1VA 1RHQB 1FXRA 2GVZB 3ULEA 5HANA 2BJ8A 4C8NA 4EHTA 5GAEP 4ETXA 3PEHA 5ETMA 2AP6A 3CCWA 4JI2J 2ZKTA 2M52A 2YNIB 3POTA 3BM7A 5CE3A 1WKKA 1LWEA 3CXCR 2E20A 2HIYA 4CP5A 3HSCA 4ZLJA 4HI2A 3QRPA 2G8IA 4M7XA 5M1NA 1XEZA 2YKPA 1GMWA 4RW8A 3NY0A 4KO0A 2DH7A 4L76A 4A8FA 1DZ5A 4MJKA 2GBZA 2OLWA 2YV0X 3OYJA 4DZ6A 3CCJS 4DCJB 4RR5A 4ZMMA 4CLKA 4LF8J 2G13A 2VASA 5J2QB 3VOVA 2FVRA 3ZZ0A 4DSJA 2MDAA 3QDKA 4AXIA 2XS5A 4M7YA 3CD7A 1S1VA 1NRKA 4K8ZA 3MFHA 2JLEA 3OV7A 4IFVB 3ZTSA 1EJ7L 4FYWB 5CYMB 4G3IA 1N33F 3OR1A 5LJVA 1HNVA 1R0BG 2VONA 2IAJA 3EKSA 1UW4A 1ATRA 4PKDB 3VAMA 3MN9A 4BC9A 1K8KA 2CQ4A 3CGIA 3BDEA 4A59A 2CJBA 2FUG9 4FZZA 1M1KO 2IHR1 4ED8A 5CZ1A 4G1PA 3ENHA 4NA1A 2NZ4A 3K2PA 1V4TA 1HBNB 4BREA 1HLUA 5DETA 4F7VA 1UVIA 5GINA 1WC6A 2IC3B 2MQMA 3TW0A 1MMNA 3KLHA 3ZT4A 3RWUA 3IM8A 1PJ5A 1C1BA 2ITMA 4TNOA 3MM6B 5KGWA 3RMAA 3UIQA 4M3RA 1H74A 1SQKA 4FBUA 1ZBFA 1YJUA 2O8FB 2HFOA 1I3OB 1WF2A 2B4OA 4GV3A 2OIHA 1WBDA 4PEOA 5BR9A 4YB7A 4LY7A 3QIPA 1J5EK 3UI3A 1HNWF 2AJ0A 2QWQA 4FLWA 1S6PA 2ZUAA 4X62J 3LP2B 1BY9A 1IBMJ 4AH9A 1XC9A 1MA9B 1RISA 3F0NA 3V4IA 4AQYK 3D0PA 5D8HB 4Y00A 3BP8A 2GUIA 1HBOA 3ZSYA 2WCXA 2W01A 1RLDA 2ZBIA 4KGXB 4UZCA 3L3VA 3LTOA 4CHQA 3OLBA 5H9FJ 3M8RA 3M32A 3K7RA 2BRLA 4ZDNA 5GIOA 2D4WA 2Q1NA 4K4YA 2R2UA 2EW9A 3EVOA 3GJTB 2V69A 5CAAA 2RU3A 3GE9A 4DCHA 2VG7B 1BCOA 4CH7A 1RDUA 2CA9A 4IKAA 1FJEB 2W4CA 1R8BA 2M88A 2B51A 1IJEB 1GEHA 2AX0A 4I7FB 2EVZA 4A8YA 1N32J 4DBQA 1CEZA 2VC1A 4QIVA 2X6SA 1S9EB 3O3HA 2E1YA 5EUHA 2VL1A 4USVA 2O4GA 2W9BA 3L4QA 4FWLA 3AA8A 4HHJA 3A5LC 1RAIB 1H2VZ 3HP9A 3OYEA 3G6ES 3D2WA 3CM5A 1UW9A 2YNFB 3CJ0A 5IWAK 4O44B 1C4AA 2HVIA 2MQ8A 1NJYA 2GIFA 4XPCA 1Z2ZA 1OH5A 3LP1A 3G82A 3GB0A 5KG4A 2V8GA 4JI2K 2BOPA 3SFGA 4XEIA 2CPHA 1Q8BA 4OJHA 1N5YB 1CZBA 5AXLA 2HHQA 2HLTA 1NM1A 2NXEA 5B08A 2YX1A 2E1ZA 3NHGA 3LANA 5K5MA 2IPOB 1M90O 1RT6A 3D9BA 2HFVA 2C22A 3TR5A 4DTOA 2FHJA 4AM7A 4LF8K 5FRNA 4BRFA 2WUSA 4DQPA 1NH8A 4LIWA 1S0OA 1HL6A 1ESVA 3RRHA 2F5GA 3SPYA 4V19J 3E01A 5DLFA 2J9CA 1HNZJ 1C0GA 2E2OA 4MKBA 3FMWA 1TYQB 4B3SJ 4QWCA 2Q31A 4FM1A 4BR5A 1SJQA 2JGUA 2G2ZA 3O4NA 2BE9B 4L3KA 3TI0A 3D2EB 1TKXB 1S0NA 3GV7B 4DSKA 3VCDA 1RTDA 5KT6A 3IR5B 3WC0A 2XLJA 5GMDA 3OYBA 3H20A 3QYYA 1OY8A 3OHRA 4ED7A 5C2FA 3DOLA 2B9WA 3TUJC 4CLSA 5FD1A 4ZN3A 2E8AA 4DR6K 4ZVTB 2MY7A 3KDNA 1FDDA 2RU9A 1U7LA 1WC0A 4DFMA 2YHYA 4YNQA 5LSLA 1U24A 1T9YA 1JCGA 3QT7A 2XY7A 4DPXA 4QS8A 4ECYA 2WVFA 2R7OA 1YJVA 1VQ5N 4FS1A 3EXCX 5IV3A 2PD1A 4KHRA 2ZWHA 4OYAA 2BUPA 1J53A 2J6TA 5F8HA 2IA6A 4KE5A 2P9SA 3MTKA 1S6QB 2O8BB 1TKTB 2WTUA 5IOLA 3I0SB 2AYMA 2NUBA 2UUCJ 1HBUB 3BYPA 3RMBA 2W2OP 3K89A 2NRWA 2VPYB 2W25A 2NRVA 3W64A 3CJKA 1GXTA 3DOMA 3OW2R 3H8YA 2FZGB 4X62K 1IBMK 1IKXA 3HLUA 1JLQA 1U1PA 2MZRA 3AAWB 1CJVB 4F3TA 2QLJB 3DXMA 1RTIB 3CMAS 1BOTO 3CIPA 5H9FK 1XERA 4O4RA 1HQ2A 2JC0A 2X1BA 3VEZA 2OEKA 2CJ9A 3ZTRA 4FVCA 3V9UA 3ZZOA 2ASOA 1YHQN 1RTHA 3I31A 3QQCD 3GV8B 3RMDA 1SIWB 4YEAA 4JNEA 2CPFA 2VBYA 5HRPA 3HD2A 3VF0B 1NGHA 3T1HJ 3GIJA 3V81B 1N32K 4G6VB 2PIIA 4W5OA 3CJAA 1RWWB 3WT0A 2DGVA 1SL1A 1URNA 4IQXA 3S3NA 1XK8A 1X31C 2XMAA 4K2JA 5CCLA 4WQ5C 1VQMS 3TJAA 5IS2A 1YX2A 2XTJP 4ED6A 1Q78A 1JMTA 4CEFA 5J2MB 2QA4G 3D1OA 1N36J 3TAMA 2KVQE 2MHNA 2AEFA 1SVDA 3HVTB 1RAEB 4WKYA 1RGIA 5HP1B 3M4XA 3VAJA 4I1TA 3AJ2A 4FLUA 3VTIA 2XB2D 4OZLA 1JLAA 3OLAA 4JB8B 3TZWA 1AA1B 2XCPA 1J2VA 2XZWA 3NVMA 4L3QA 1Q81T 4PAAA 4JKCA 5KT2A 4OO1J 1N8RO 2WFBA 3BR8A 4YHHJ 2MY8A 2DFHA 5I3UB 5ETSA 1BLUA 3DLJA 1RT3B 2O1PA 3T5KA 1EWRA 3S3OA 2DPNA 5H9EK 3AO3A 5KFAA 3BO2A 1JL1A 4NCAA 2ZUGA 4KB7A 2Y3YA 4JS5A 3BJYA 4LRAA 1PKUA 3OY9A 2XO6A 2P9GA 2VODA 3PJWA 3LOUA 2VFTA 3SQ1A 2YKNB 1VSLA 4NEZA 2DNYA 3EGNA 1HNZK 4CZIA 2FZCB 4ERDA 2DGQA 2AZ1A 4HH0A 1JLFB 4BRMA 3EEQA 2CQPA 2HF3A 3W9HA 2KRBA 4CZJA 3U7JA 3J81U 3OR2A 4MK7A 4OX6A 1B9FA 3BGOP 3AVFA 2EFOA 4DL6A 4QW9A 4OYBA 3D3CJ 3AHPA 1ZA2B 4RWXA 1Q1KA 2A2CA 4KYZA 1HBMA 1RHUB 1UAWA 1BA1A 1IKWA 3JSMB 2D1CA 5KFFA 1Q86T 5LMUJ 2ZZMA 2ITGA 4HHHA 5DDQC 3C7NB 4H8KA 4KAZA 2QLFB 4YOUA 2W9AA 1MWZA 2XGPA 2D0PA 4X4VA 4N76A 4CESA 3CCRS 1TL7B 5KQDA 2UV8A 3G9CA 5I42A 2C2EA 2LU2A 4YY3J 1W7WA 1RT4A 4IDKB 1J5OB 1K6YA 1P90A 4AM6A 1NJIT 1Z4UA 2MKJA 1NK8A 3K0JA 3BQ2A 3TNVA 1RABB 4FJIA 5IC6B 3Q86A 2O01C 2XYGB 1QS4A 3GBTA 3MR6A 4Q5VA 4LREA 4Y6IA 1QJHA 3N6MA 5BYRA 1EB0A 3HM8A 3ZSXA 4DHVA 1CJUA 3Q23A 2G4BA 3LP0B 2UUCK 4QR1A 3IP0A 4J9RA 3UKUB 4JI8F 4X84A 1C2PA 4G1QA 2QLBB 2P5GA 1S1XB 2RE1A 4LR8A 3ZNJ1 2RHSB 3Q2TC 5FJ4A 3SV3A 4ZPCA 4BWJA 4CGIA 3N9UC 5E3RA 3G4SN 2K1RA 3L4IA 3NEKA 3LQVA 1WSEA 5DGBA 1U47A 3ZT0A 4RUHA 3UDVA 5KFOA 2P9IA 2NRXA 4KR0B 2LEAA 4BR7A 4ED0A 2NR0A 4JAXA 2YI1A 3NF7A 3VWSA 2HVEA 5BR8F 5B0DA 3HT0A 3CC2N 1NBEB 3ENVA 3QFWA 1RCHA 4GNIA 3POTB 4ILGB 1NJWA 1HMVA 3IAS9 1RAFB 2G8UA 1VAZA 3T1HK 3RB6A 1WTBA 2RE2A 1VISA 1Q53A 1UJ4A 1SJ4P 1NK5A 3C95A 2QA2A 2V7ZA 3G10A 3ZTOA 4DTRA 2DKOB 5GAHU 3FBFA 3KK1B 5HMXA 4PWDB 1MW7A 1N36K 4JKEA 5KFHA 2C2NA 4H5TA 1JLGA 3IRXA 1K73O 2M8DB 4JS4A 4QWBA 2F63A 2RQMA 1X4HA 3HSZA 4LSLB 2X74A 4BE0A 2XHBA 4KY3A 5I3PA 2R7SA 3CCVN 2F9JA 4CT8A 2LQ8A 2KM8B 4KFBB 2P9LA 3DYAB 1KQSM 3P4UB 3U27A 1NSQA 4O3OA 4DR1F 1UVMA 4F25A 1U0HB 4YHHK 2A40A 5H1SV 2OMOA 4FJKA 1S59A 3DRXA 1YQHA 4USWA 1Y7PA 3PHEA 5K8OA 2MQOA 3VQPA 3PX4A 5GAGU 3ZT2A 2F1FA 2QW9A 4RPFA 1C6VA 5I4MA 3W2WA 2HMIB 2A2DA 2Y8YA 2ZHOA 1VRUB 4G65A 1TUVA 3DLBA 1S4FA 3KLHB 1VBXA 4J9QA 4Y65A 1HA1A 4RW9A 5B09A 2QWMA 2OELA 1Y5NB 1UZHA 2MGZA 5AQZA 2E44A 2HHHF 1C0TA 4YOWA 5AQKA 3EJMA 1PILA 3HF5A 1WC1A 4PL7A 4JI7F 2UVWA 1S49A 5HRRA 1MNEA 3U3YA 3FZLA 3UFCX 1MWYA 4YORA 2M8HA 1WUAA 5KFKA 3CC7S 4ELVA 4PY5A 4CEAA 4B9UA 3J7YI 5E26A 2A10A 2VG5A 4CE9A 4B3TJ 3CNQP 8ATCB 1UVLA 4TYAA 4WZMA 5GAHI 2GAGC 4USIA 3SSSA 3HMJG 2DXDA 2Z8QA 1FEEA 2IM3A 2VV5A 2DVIA 2JZ5A 2N7CA 5JVGQ 2PFFB 3E3XA 1JK9B 4FXWA 5JICA 3T6JA 5CZVA 2DR5A 4DPTA 1YIJS 3KLGA 4JI3J 1IWGA 2W1BA 3Q8SB 3RR7A 2V2KA 1NCLA 4QR0A 5F8MA 2C42A 4DFKA 4X2BA 1RQ0A 4DV0J 4MTPA 2YKMA 5C2GA 5GAGI 3IN5A 1RT5A 4LQ3A 1DY3A 2QN6B 4A8XA 2EWSA 3JTNA 1QZ6A 3GIKA 5KT7A 2VF3A 3MAHA 1RWXB 3HRGA 2IY5B 3NOGA 5AR0A 2EG2A 1OO0B 2KZZA 3AODA 3PKYA 4CLUA 2K3IA 3QO9B 5GMEA 2UUWA 2ZBPA 3CUNA 2HFUA 2OJ3A 3TA2A 1VQKN 1R59O 2RT3A 3SSQA 3P3DA 2V0NA 3H5SA 3D0GE 2WRMA 3M2RA 2CFXA 3CCJN 4QZVB 4XO0A 3HI9A 1HNXF 4FLYA 2BEFA 1LWFB 4ATNA 4KIAA 1FKOB 2EC2A 4CFCA 5D4PA 3CJQA 1IR0A 3MXJA 5AJ3F 4EHUA 1RT6B 3D6FB 2VUGA 2Y1JA 3B8HA 1VMBA 1EP4A 1LKZA 4NOHA 1BQNB 3BF1A 3VVTA 3JYTA 2ILZA 4AE5A 2HZAA 2CWXA 1KTVA 4UT4A 1WSRA 4DUYK 3V6HA 1HKCA 3CCLS 3DLGB 5KFRA 5HBMA 4KKOB 3AJ1A 2LCWA 3HKWA 1Y5LB 2EC0A 4P7VA 2F4VF 4PRFA 3U02A 3CCSS 3I9V9 1RTDB 1LXJA 1OYEA 1BA0A 2AA4A 1TL5A 2OPQB 3CMQA 2IYIA 4C3KA 2IDLA 2CZ4A 3HKZD 4BG9A 3L4BC 2HHPA 3DOLB 1NZAA 5DLGA 3C16B 3HPOA 4MFBB 4FJ7A 5CHIA 2GZOA 2ALYB 4LF4F 2ZOGA 1L3VA 2ZDPA 1EWQA 2CUYA 5L38A 4U95A 1HPMA 1VC0A 5T41A 5HMWA 4M3ZA 2CPYA 5CA5A 2HNDA 1NPPA 2ZM6K 4NLOA 1C1CA 4DPUA 1N34K 2JX2A 2XRIA 4NLUA 4WWSA 1I3AA 3EPGA 2JEFA 2G2YA 1GMWD 1VBYA 4P73A 3AGKA 2V94A 1WEYA 1RAJA 5B0GA 3D68A 2H4WB 2Y1IA 1HNWJ 4BRAA 5FRMA 1SQFA 3J7AP 1QQOA 4LRBA 1BU6O 3M6UA 1Y10A 4FNIA 3DJCA 4CNZA 3M2UB 4B3TK 2RHKA 2YHWA 3I9ZA 4PYDA 4IFYA 4BDPA 1B9DA 1R0CB 5DG8A 3V6DA 3SCIE 3DXMB 3IKMA 2RS8A 3OTDA 1TK0A 1KNZA 1IR1A 2UYTA 4BQLA 4GVMA 4CK1A 1CS4A 2VWKA 2R8IA 5D4NA 3NVKA 1X0FA 5AXMA 2MZSA 3M9MB 2H51B 4JI3K 4KB0A 5T7BA 4PUOA 1FFSB 2XS2A 5D15A 5F0XA 3LUYA 4RU9A 5JLHA 1WUUA 1XNRJ 5F0WA 4BC7A 4FJ9A 3Q8VA 4JRQA 2ZH8A 4NZ6A 3G6EN 1VQLS 3SV4A 1XQIA 4DX6A 5KFXA 4DV0K 3MR2A 1JXEA 1BIZA 2A41A 4CF2A 4I4BA 3KJVA 1VOMA 5DQIA 3HSJA 2FY8A 4WFAQ 3VQDA 1TTHB 2VG6A 1VK8A 2EFGA 4F4ZA 4CJTA 4HI1A 4DV2F 4PG8A 3L2QA 4E7HA 4F0MA 2V4JA 1VQYA 1VHIA 2FSJA 2OTLS 4QYZJ 4JKAA 1OH6A 1NSPA 3OVSA 5HQ8A 3DLHA 4HTIA 2HMPA 1Y0HA 1V4SA 3QINA 1JLAB 1GLJO 1RCOB 3CJ2A 2RIJA 4HR2A 1HARA 5AZIA 4ZPTR 2CQIA 4Y34A 1X0PA 1VJWA 3CD6S 1MWKA 5SZTA 3FZHA 4GMKA 1NGFA 3HX9A 2CQBA 3MF5A 3DGPB 5CQGA 1MMDA 2JOQA 2A6OA 3R9LA 4OPKA 4ANDA 1U1MA 4NXMF 3A8EA 3DNCA 2W2NP 4LVOP 3W60A 4I2PB 2XMKA 1E6YA 3B6BA 4PABA 4XH5A 3O9QA 3NGYA 1FJ7A 3KD1E 4R5PA 3O4WA 3BUZB 3ZX3A 4P2FA 3KLVA 2WHOA 4YOTA 2OKQA 3CDAA 5HQLA 1N33K 3OJUA 2XI2A 3M8YA 3R27A 3H2VE 1MU2A 4YR3A 4KGVB 4MO4A 3HVWA 2HBRB 3ENQA 4HKQA 4X4NA 4CYUA 1FKPA 2V68A 4KHPF 1GOBA 4QYRA 2RPIA 1RKJA 5JVHL 2UZAA 6AT1B 2EG1A 4B9TA 3VEWA 3T9ZA 2YX6A 3PYGA 3O1LA 3KWGA 4RU2A 1F9EB 1AYEA 2CPIA 1K1SA 2OANA 5KFNA 4UY8O 4JI4F 2V50A 5ADXH 3G8QA 4O3PA 2EKYA 4E1JA 3DU6A 2PMHA 3HCXA 4RWTA 2PEHA 2VA2A 5CD4H 2CNKB 3QFHA 2P9CA 3NXZA 1TL1B 3MFIA 1OWXA 2DGUA 1C1AA 5IT0A 1I51B 5AE2A 2XG8A 5HRSA 1GX6A 2QMXA 5JVGL 3VESA 4B9VA 1D5AA 3T1YF 1CJUB 2Z57B 1RNHA 3S7RA 1V3ZA 5LSOA 2RAQA 1M1GA 1EKRA 4C0BA 1HNWK 3PM9A 2FHJD 3RZAA 4ZLPA 3C46A 2GVDB 3DN9A 5J1EB 4KV8A 2P9PA 4Q45A 2C3YA 2J8SA 3CMAN 3ATVA 3BBBA 1V3SA 2Z1GA 3H5YA 3FFKB 4FVMA 1RUSA 1KVCA 4F9OA 3H4DA 4ILHA 5F1XA 4J2DA 4FW1A 1TQLA 3DHXA 3QRRA 3OBWA 1JLCA 2GQCA 4B9MA 1M5HA 3L2WA 3FZFA 2PFUA 4QOZB 4WKRA 3B4DA 1ZM2A 4E7KA 2ZOMA 2VYPA 2HHXA 3GE1A 2LECA 4BRGA 3H98A 4IG0A 3N4WA 6FD1A 1OS5A 3B6PA 4EYHB 5HROB 4JHDA 5BN8A 3IFRA 1UKUA 9RUBA 1GXUA 1WI8A 2J0XA 4X4TA 5J2NA 2CGKA 1XNRK 3M05A 4BRKA 3EPIA 4PG6A 3NS5A 1B7YB 1IJFB 1VQMN 3MEEB 2GHWA 4CEOA 1VQ9S 1VSJA 1UFWA 2MTLA 1VQPS 2MZTA 3UQSA 2QC3A 2R7WA 1X3NA 3HYFA 1MN7A 2DHSA 3WEEA 3VEOA 1UEVA 2WTFA 4CHNA 2R3VA 2DGSA 2DNQA 4MLEA 4BR9A 3OYLA 1NJZA 4TY9A 5DM6Q 1C0MA 4LIRA 3GJSB 4PKGA 3U4LA 1ITGA 4G9ZA 4QYZK 4Y0WA 5IM0A 1VLYA 1PC4A 2D9OA 5AQVA 4DMZA 2R7QA 4U6PA 1C4CA 2E5IA 2Z4PA 3OTBA 2KI2A 2E5GA 3D45A 4FM2A 5HVGA 4C6AA 4CO3A 3Q8UA 1TMMA 4NXNJ 4LH4A 4ALZA 2FLLA 1KLMB 4UUWA 1SPBP 2C3OA 1BWEA 2DBBA 3KTQA 1OY6A 4B9NA 4CO0A 1ZBIA 1LFWA 2AGOA 2QKKA 2AQ4A 2ZNYA 3IRWP 2F8SA 1MWQA 3ZCMA 2IYGA 3AO4A 1WG1A 4M42A 4ILRA 1N5SA 4R79A 3DAWA 1GLAG 4N5SA 1Y64A 3D7EO 2MQNA 2LMIA 1YBAA 4TQRA 2XYPB 2R9LA 1FFGB 3QMLA 3DU5A 2JFDA 3UKRB 4OPJA 3HL8A 4EIAA 3H1QA 3CPWR 4ZHRA 3SYZA 4KBOA 5EWGA 4A46A 3HSGA 2RDIA 4C98A 3KK2B 5AZJB 1C0TB 4QPTA 2V8PA 3CCRN 2XS7A 2QSFA 5FPNA 4XTTA 1FJCA 1RWNB 4E3SA 4NYZA 2BANA 2DNMA 4C8OA 3CM6A 1WBBA 1VHFA 4Q0BA 4U96A 1CLQA 1OMSA 2FBXA 3RUBL 3M8ZA 1NKCA 2Q1LA 2CQ3A 4ZPBA 2QMWA 1A6LA 2DGXA 5E3QA 4LFBF 2B5JA 1ZM3A 2WB4A 3S01A 5DG7A 1RWOB 3QSYB 3NCIA 3F73A 3SQ0A 4CEBA 1LW2B 2FVPA 2DXEA 2HK3A 3QGHA 3ONQA 2YNGB 4YP3A 3NF8A 2HF4A 4BQZA 1DAXA 2KU7A 3LH2S 4USJC 1UWBB 4U7CA 5KFGA 1JLEA 2GIRA 3O3FA 2AJ4A 2KXHA 3OTOF 2AW0A 5C25A 5KFIA 3OFHA 4OLOA 4IRDA 1RT7A 1A9NB 4KI4A 4OHYA 4P52A 2QFIA 3CXCM 3JSRA 1FEHA 4K4TA 2I5JA 1ZM4A 2Z56B 2YKMB 1WC3A 5L9NA 4TVAB 3DC2A 5IZHA 2AMCB 3Q89A 2U2FA 1H3DA 4YN3B 4X4PA 4AL5A 2DR8A 2RQKA 3ZSRA 2CH5A 4L8RB 3W7BA 4WFAL 1G6BA 2HB5A 3SQGB 4FCYA 2NPIA 2C28A 2R7TA 9ATCB 1DRZA 2E5LF 3EE3A 3T19A 1S76D 4ISFA 1RWMB 5AQWA 4O23A 1RJJA 3AV9A 4X65F 4MH8A 5CYQA 4MKVA 4B3RF 4FJNA 3OUYA 1VLOA 1CPZA 1XTZA 2BACA 5E3AA 2ZC3A 5M1OA 3ZZZA 1R7IA 1DLOA 4WIIA 3GSDA 3NMUA 3BQ0A 3CO0P 3WNHA 3DRRA 4K7QA 4PXBA 2O8CB 3BS9A 4BRNA 1R43A 3J7YP 1RACB 4ZVHA 1FWKA 3SCKE 1YJNS 3H46O 4QIFA 4U8YA 5GAHP 5LMNF 3ILOA 3G0ZA 4A61A 2YCHA 4Y2AA 2XMUA 1S4EA 3NG8A 1KFSA 3OHAA 1PO6A 4FXDA 4BC5A 5G4DA 4C0OC 4Z94A 2MKIA 4NL5A 4DR1J 3EDRB 1TL3A 2AV5A 4OZJA 1FRMA 3WIVA 1Q82T 4CBUA 2FJBB 1S6OA 1FD2A 3C6AA 4CJQA 3UDLA 1UL3A 4K25A 3PSFA 4FKXA 3BGUA 5JLFA 1UETA 4LBHA 4NE9C 3AVMA 3GJRB 5GAGP 2OPSA 4PWUA 3DCAA 5GIPA 2VBWA 2Q0UA 2HQIA 1YUWA 2HNDB 1X4EA 3DXKB 4P2SA 3QPIA 2D3UA 2P9NA 3BYRA 3OYHA 4BWMA 2AHOB 4JYAJ 4GKKF 2CQ1A 3RSEA 3CC7N 2HHHJ 4FJLA 1YI2S 3DKDA 3KZBA 4B8AB 3GV5B 4EZ9A 2E1CA 4JI7J 3ZT3A 4OYWA 4YDDB 2RJZA 2PEBA 3KLIA 3QJLA 1T02A 2XZDB 1SJRA 2NXJA 4KH1B 1LFPA 5L46A 1X9MA 3JXUA 4FK2A 4GVLA 1YIJN 2IRYA 4DOZA 2E6LA 3WNFA 3V6DB 4JV0A 4Q44A 1P9QC 4L72B 5E84A 4FPRA 5ETOA 4FWSA 1CS4B 3NNAA 1HJOA 4F0HA 3QLHB 1LCUA 4USMA 2Q36A 4HUFA 2QK9A 2YY3A 3OBYA 4FXVA 4J7CA 1S7IA 3M1VA 2A1BA 2JDJA 1JB0C 3Q2SC 4HUEA 4JI8K 2W6LA 3NAIA 4ELTA 3ZETB 4RX6A 2CXEA 3SQ2A 2C2MB 3AD8C 4OI2A 2V4RA 1U8WA 1O13A 2AJFE 3AB4B 4DL3A 2JLFA 2AT1B 3AVKA 2W7AA 4Q7AA 4BVOA 1DTQB 4URQU 2KHOA 3HO1A 3EXYA 3P83D 5FDLA 3NNCA 3FRYA 4DL5A 4M3UA 1S22A 3KNAA 1BUXA 5D0EA 4CBXA 2HHTA 2XZTB 3MMVA 5DM6L 4U7UK 4NLBA 4ZVPB 3KUGA 4Z0UA 5BR8K 1DBDA 4MAKA 2ATCB 3OA9A 1SV5B 4CJ3A 2F40A 1QD1A 3W8PA 4LF2A 3VQQA 4FPIA 1FHTA 1NXIA 4F4AA 4B3OA 4DQQA 2XY6A 3W0LA 1FA0A 2KHCA 4M5DB 4BY9C 4PG7A 2LFVA 4PR6A 5D4OA 5LJ5Y 2I9SA 4R8UA 5AJ3J 2Z2ZA 3IS9B 4I2QA 4QU6A 2HPUA 4OIXA 5M1KA 3DLRA 3KVGA 3CCLN 4R0EA 2DPIA 4DV4F 4Y2MA 5AQUA 2H5EA 2K7JA 3HP6A 2QLWA 4OPHA 2IIHA 3CCSN 1X4DA 3QNWB 3CEDA 4M5KA 2HOEA 3PFOA 1RT1A 4B3MJ 4HWIA 2F4VJ 4DR1K 1FDAA 3UR0A 3KJNB 1VC5A 3A8KA 1IH7A 1HW8A 3SCLE 1B70B 3BKUA 1T11A 2Q66A 3OW2M 2QEXN 4ZVUB 4ZVRB 2XCAA 4LF4J 4GC7A 1IBLJ 1KQSR 3OS0A 3K2YA 5HI7A 4H54A 3TZYA 2VKRA 2VIHA 1HYSA 1S5ZA 4LRCA 2RDJA 6FDRA 4CECA 1R0AA 3PTWA 4Z7CA 5ETPA 1Y9OA 3DOKA 3NGTA 4DR4J 4XDCA 4JLHA 1NNEA 1RTJB 2IRXA 4IJNA 3MHYA 3D2FA 3EZWA 3T5JA 4NLGA 4JYAK 1E6VB 2BUNA 4Q2MA 4X62F 2MLYA 3RYLA 4CJLA 2KYZA 1VIOA 3SUQA 3BH6B 3E51A 2HHHK 4EK2A 5D78A 2V52B 5KFWA 2B7BB 4JI7K 3SNNA 2P9UA 1VQ8S 5B0FA 1WACA 1NDCA 3NCPA 4DX5A 3T5HA 3QFPA 3MECA 4YOXA 3N4PA 4UQTA 2DY1A 1Q0NA 3J7Z5 5TKYA 2H5JB 3R6LB 5KG3A 4MT1A 2H3EB 2Q3PA 3I4HX 3Q7CA 3IR6B 1ASWA 2X1AA 3K5MA 4J2AA 2ZZTA 4X64F 3CFOA 3DLKB 2LEBA 4AHUA 1JCFA 3A2FA 4HT7A 4FJGA 2W4PA 4LUBA 1XMQJ 4MKYA 1NB2A 4R25A 2HNZA 3NCQA 4BRDA 1FDNA 5LT5A 2P9KB 4DU1A 1BUPA 1KKHA 1N54B 4CDIA 3B54A 2GVZA 2DYAA 2OTLN 4M3XA 4KB1A 3WEEB 1AUSL 2CG4A 4I69A 4ZPVR 2FSKA 3D7SB 3OVAA 1WOQA 3QETA 2GC8A 4DV2J 1RBUA 4NRUA 3MDFA 3IDHA 3GFZA 5CABA 1RHRB 1OQ3A 4A8WA 2PYLA 3CQYA 1UOCA 1U49A 4N56A 3CJBA 3CJ4A 1QUVA 3O5BA 3CD6N 5AQMA 5M2UA 1S1WA 5AE3A 3P49B 1AW0A 5CD4A 1NM2A 2LLZA 4KTWA 2DFFA 4HLBA 5J2QA 2ZC4A 4CH0S 2IMWP 3OXFA 1JNZB 4C7QA 3QRQA 1WSIA 5LL6Z 2QX0A 3WHIA 4IFVA 3JXOA 1J27A 5AJ3K 2YX7A 4JV5J 4KC5A 4B3SF 1KHVA 4J9MA 4DTPA 3NH0A 3LDLA 1F3FA 4W98A 2E1AA 4C8MA 3GIMA 3EGWB 4CLZA 2H54B 3Q83A 2ATQA 5K14B 5ETTA 2J0QD 4BCAA 1SQGA 2ASMA 2Z1JA 2F8HA 3P39A 2LDYA 2NRZA 3PR4A 4JEPA 3LPUA 4I6YA 2Y0BB 4RNFA 4O3RA 2HWIA 4B3MK 3HZ6A 3FEZA 1FT8A 2F4VK 4CM0A 1IG8A 4XH1A 5A8WB 4H0OA 5DGAA 4RUAA 1HBNA 2PI5A 2R7VA 2ZE2A 3CDBA 4KHQA 4ECSA 3O1BA 1PGZA 3HHLB 2VJVA 3I56S 5KFUA 2VGMA 3W9JA 2G8FA 3MM6A 3AVCA 3H5UA 2XNRA 2GMJA 4LF4K 2PFDA 4BC2A 3VZHA 4JI4J 2O8FA 2VQEJ 4QPXA 3QEWA 2IBKA 3OJSA 4CLWA 5KOXA 5D3GB 4DR4K 4LF5F 2BOAA 2RN2A 3O9RA 2HRYA 1S7HA 1UP1A 1RBAA 4YB6A 3MM7B 3VEYA 1PSDA 1FF2A 1BHNA 3VGTA 3DGVA 3ZX0A 5GADU 3JAMO 2PDAA 3KHYA 4H0XB 1TU0B 4DR2J 1VHXA 2NRRA 1RXOB 1ZOTA 2VB6A 1KVKA 3MD1A 3G6YA 4IO1A 4L74A 5HK4A 3C66A 1BIUA 2W4DA 2I5JB 4NLPA 3RAQA 5J1NA 2NREA 1FTRA 3KK3B 2AYGA 1WJ9A 4IFEA 4HTLA 4F2RA 3GJQB 4LFCF 4C4WA 2HBJA 4YOVA 2CZ9A 2HWTA 1SC1B 1W25A 1H2UX 4KHWA 4N8NA 3B6OA 4M5IA 2NQPA 1FD8A 1TFWA 1VQ9N 3X3UA 1Y97A 1VQPN 1XMQK 2K3KA 1QSLA 3Q22A 3SJJA 4Y1CA 2ZITA 3VA0A 4K4WA 1QVFR 1GQEA 4DTUA 2ZD1B 4CJFA 2YNFA 4O44A 3J80U 3K58A 1EZZB 2C2OB 3VN5A 2C2KB 1HWIA 3FZ2A 1U25A 4B08A 1NAQA 4X4SA 3OL6A 2RSQA 3VQSA 4DV2K 1GK8A 1N5YA 4DQRA 2MQPA 4DG1B 4CJ7A 4ZLNA 1K47A 2CG8A 3VERA 2UXCF 1F2HA 1X4GA 3DRPB 4IOCQ 3EL2A 1WDDA 5KG7A 3OSPA 3KDOA 5GADI 3ULDA 3NGRA 1O0PA 2RF2B 1LNQA 1RYRA 3MEGB 5EDWA 1I39A 3V9XA 3FK4A 4J2BA 2QA4S 4CGGA 2YWKA 3EE9A 1U1QA 3FZKA 2FDNA 4YDUA 4I68A 5ITHA 2DRAA 3LAMA 2XSJB 1HW9A 4FWMA 1WG5A 4JV5K 2ALZA 1TYQA 1RAOA 1NB7A 4CBWA 4NZ0A 2F4FA 1WF0A 2UUBF 1TKXA 1YSJA 3CJSA 3J7ZT 3L8BA 1M5SA 4CO2A 2JHEA 4GRSA 4LSZB 5LMUF 4Q8EA 2VZ9A 1WSGA 2V2QA 2ZNZA 1EX4A 2W41A 1M90T 3TVYA 4AILC 4OZNA 2PN6A 1XI1A 2FJDB 4CLTA 3RSEB 4NLCA 3HZGA 1PC5A 1YTYA 4KHPK 4YY3F 5AQPA 4IZ9A 2VPWB 1LK5A 3DXSX 1B64A 3KLIB 3HULA 5CZXA 3VQCA 2NUHA 3LW5C 3JAMY 2SXLA 3CYMA 4NLQA 1FWPA 4JI4K 1YAGA 4C3MA 2OPPB 1GLFO 1TUYA 2YX4A 2AIRB 4A57A 1RU1A 1TUUA 1PIEA 5F0UA 7FDRA 4FYVB 1TKTA 3PO5A 2HVHA 3H1VX 1N88A 1UCNA 4JRPA 4BGBA 1G7CB 2OO4A 3BPDA 3SAFA 1SC6A 1R3NA 4OLBA 2DR9A 3G71S 2V2ZA 4A5AA 4E2FB 1SKWA 4CVNE 3WX4A 1S97A 1FVQA 3SMSA 3RVCA 5E5NA 1X5TA 4DR2K 5SUHA 2DPJA 1ZZNA 1X5SA 5KQ8A 1CJVA 3U8XA 3NF9A 3OTOJ 2DRBA 2QV6A 4CM2A 1RTIA 4HDHA 1RWPB 4WP8A 1Z25A 2ZHAA 2F9TA 1PJ7A 2DHGA 1NK9A 5KFJA 1KSPA 2OYQA 3AXKA 3DLLQ 1R8CA 5G0RB 3HHEA 2E1RA 2DNOA 1WKJA 2YH0A 4OPAA 3IFEA 5J2PB 5BRHA 4BS2A 2BYCA 3N01A 4TU8A 3CJCA 3THWB 1SUQB 3AY0A 3AA5X 1PAUB 1NK6A 2E5LJ 2R7XA 4ITSA 2O8DB 3UE5A 4X65J 4MIAA 1Q7YT 4B3RJ 2F3JA 4FOIA 1FTCA 3ZZRA 3M7VA 4M5LA 4OGCA 2XWYA 5J2MA 5KOWA 4CZLA 4HTJA 5LL6d 3MWBA 1YJNN 4RW7B 2DEJA 3HVTA 2DK2A 2DXFA 4FWQA 4H0YB 3KMQA 4WF9Q 1RA7A 1UA1A 1SH0A 1BI4B 1CG2A 2LU1A 3R7NB 5HN0A 3X1LB 4F0KA 1TUGB 4CLFA 3H45C 5B7WA 3R1XA 2E7VA 3CCQS 2F7TA 5LMNJ 2X3GA 2C2ZB 2KT3A 4I6WA 5I3UA 1HYVA 5GVQA 3FCHA 1RT3A 4QOTA 4ECQA 1WDTA 2ZGZA 5ETQA 1U1OA 4P72A 3VAGA 1JXBA 1H7WA 1YZ7A 2QMUB 2AWZA 3GR1A 3MUTP 1LK7A 1G1XA 4WU3A 2JH3A 4EBCA 2PMZD 2C1EB 5IQ6A 5DQGA 2YKNA 2NSBA 4JKBA 3L95X 4JP8A 2QSWA 4N41A 1JLFA 2HBZB 5BYSA 1IBCB 1T44A 1HYSB 2WK4A 2FBVA 2ZQBA 1YI2N 2CJAA 3MUMP 4OZ5A 3CCES 3JSMA 3RBZA 1N8RT 2YQ0A 5FPMA 3C7NA 5AT1B 4GKKJ 2IVFB 3MPDA 1VQSA 3JS9A 1TL7A 1OJ4A 4P71A 3GSIA 4U7UD 1CJKB 2VGNA 4IDKA 1J5OA 5KFZA 4DPOA 3UD3P 4DV3F 3HVAA 5AQHA 3GZ7A 3H7HB 4IQMA 4RBTA 4I9QA 4MDAA 4E7LA 1W2IA 4KREA 3DI6A 4X4UA 3RRKA 1UTAA 4ZITA 4EFAC 2CPJA 4NA2A 4JI3F 2Z0GA 4DHYA 3SIPB 2G0IA 4F04B 2R42A 3LP0A 2BX6A 3GCXP 4X66F 3CJ7A 4BE1A 3UKUA 1QE1B 3AA3A 2ZVSA 3D6RA 2W6KA 4AHTA 2I7PA 4H5VA 3I96A 1S1XA 3UWTA 3CMES 1H7XA 4DLEA 2QL5B 4Z7YA 3U1LA 3O8WA 1QTMA 3EZ5A 1VQNS 1XBWA 3U9DA 2WBRA 2W2MP 3OTOK 3ZT1A 2G2OA 2HNZB 4KPCA 3VGVA 1FRHA 1GNKA 3O9SA 1FRXA 2J8AA 1V9OA 3TR8A 4BRLA 2W40A 2DY4A 4CJRA 1RZMA 4E7IA 2RRAA 1VGYA 2CYYA 3M6WA 5E3PA 1U1LA 3T5LA 3ITHB 3MX2A 4KHYA 4IKFA 3MXMA 2IOCA 3UN3A 1RDWX 5KGXA 3VQBA 2Z1IA 3VPZA 2ZH4A 1KVAA 3BGFA 3WC2A 1DJ0A 4PPZA 2BR0A 5IT9U 1FW6A 3AA9A 5CXTA 3OYGA 4ZVOB 2IJRA 1TKZB 2N3OA 1NGGA 1CULA 1SI9A 4BE2A 1NOZA 5EX3A 2E5LK 2JNJA 5KPZA 4TY8B 1S1WB 2DEIA 1RDCA 3W9IA 2ZH9A 4X65K 4W5TA 3HBTA 4B3RK 4IOCL 1VSIA 1GAOA 5EX5A 5EOYA 2J6UA 2YVSA 2LVWA 3KK1A 4PWDA 5ETVA 1NHKL 2HRTA 2QZ8A 3MTJA 3EZUA 1R31A 3MOJB 1XNQJ 2WZ1A 4ZOSA 5M2RA 4OV6A 3AXMA 2V34A 2GWJA 4LSLA 3K5LA 4JI1F 4C2MA 1ELOA 4DF8A 4OZ1A 3PYDA 1XR5A 3EWGA 3AO1A 4KFBA 1MN9A 3DYAA 1DTTB 4DV4J 2DT9A 5LMNK 1BMQB 2AJ2A 2O67A 1U0HA 3M2VB 4B8CA 1SZ2A 4AXJA 4DTSA 5FIIA 1CSJA 2NXNA 4P2XA 3LM9A 5ETNA 3J7AN 4CTAB 2EWHA 2VFVA 3D28A 1TUWA 4A8QA 2R8GA 3O3LA 1F60B 2ZE2B 2CAJA 3ZSWA 2ASLA 2HMIA 2FJVA 2OPRB 1GH8A 1O51A 1VRUA 4U8VA 2QKBA 2DNGA 4ZKAA 1JQGA 4OLPA 4EUVA 3F44A 1K73T 1SKSA 3L7OA 4C3LA 5D4LA 4J8FA 3MM8B 2Q0RA 1XQSC 3US5A 1OQ6A 3HHKA 1ZC6A 1N0VC 4ZTFA 4IUFA 1FXLA 2B6AB 4TU7A 5HSPA 3ETMA 1SJ1A 2Q6BA 2G1HA 2E4LA 4USTA 3U6FA 4D3HA 3KKRA 3GL1A 2GX8A 4WZQA 3MWPA 5THWA 4IDHA 1VQ8N 2C2RA 2MKCA 4GKKK 3OXLA 3K5PA 3R97A 2E2PA 1ACMB 4NLRA 2KYXA 3QB0A 2HS4A 1JWWA 1DHMA 2LSNA 4GW6A 3MPUB 4KH5A 2BABA 4F36A 5J1PA 2D0BA 3HZEA 4K8XA 4YDUC 4E19A 1EKEA 5DQHA 2PBDA 4FLXA 1IR2A 4J9UE 5BXIA 3ALYA 1F6TA 3IBCB 4O3NA 1CXQA 3I5BA 2WVEA 1ASVA 5KT4A 5K8PA 1RHJB 3DLLL 2CNNB 2IA0A 2PZSA 2FJAB 3OFEA 2ACMA 1XNRF 2N4DA 1S5JA 1EQ0A 4EAHD 2JVRA 2FB0A 4ECTA 1CC8A 3LPTA 1U2VB 1BISA 4X64J 3AA2A 5MLCV 2HBLA 4DV5F 1TV6B 3HVRA 1CC7A 3D66A 2J4RA 4WK3A 3RAMA 1WHWA 1L3UA 3M9NB 1ZS6A 7AT1B 5HRNA 2QE5A 4QWEA 3A5OC 1KXPA 3O4QA 3C19A 2CJQA 1EO1A 4CI0B 3S1TA 2RKIB 1TR0A 5F8LA 3QO9A 3H4BA 4CNYA 1EX8A 4ZCMA 4WYWA 2ZHBA 4WF9L 2QWPA 1P9YA 4CO1A 1FI4A 4CZFA 1LEOA 3EZOA 5AQLA 2CWKA 3J7ZO 1Q95G 4RKUC 3ICLA 1ZTTA 2EXUA 1R8PA 1YRXA 4UY85 5JMVA 2I0XA 2OTJS 1IQTA 5K8NA 4K41A 3ISND 1LWFA 1FKOA 4Y2CA 2XMTA 1SJFA 2EFPA 1YITS 3CPWM 4DS5A 3EVWA 3NBPB 1WWHA 2E6MA 4LF7J 2HFSA 1GMUA 1BQNA 4ZCIA 2P6SA 3TZXA 2NLXA 1WG4A 3D3BJ 3M8PB 2ATLA 1XNQK 4FF4A 4BRPA 4J9SA 1NLKL 2V67A 2D7SA 4IH5A 4NO7A 2GA7A 3DLGA 1QDUB 3ZEUA 5F3ZA 1WD6A 4QR2A 4KKOA 4YR0A 2CKWA 3RJMB 2MLXA 3OYCA 2YBVA 3CJ1A 2JC1A 4CF8A 3JB9k 4I0WA 4DV4K 2KJWA 3VENA 4OJGA 3VGSA 3VAHA 2OPQA 4DN0A 5IV4A 3TPQA 3BSNA 3GQCA 3HHDA 3LA0A 1NGCA 3LGNA 3R6MA 2DCUB 3C16A 4MFBA 5L1JA 5BRDA 3I56N 4RNOA 1WSVA 2B4VA 3M8QB 3ZYYX 1OPZA 4NMLA 2XYHB 3CCUS 3OD2A 2DB1A 3MDQA 2CDRB 3IMQJ 2Z2MA 3R5GA 3NAHA 4Q2LA 4NEYA 1HQEB 4YDXA 4ZPDA 4DU3A 1RBTA 5FLXU 4ZVSB 3BV8A 4YR2A 4Y2KA 3RB0A 2MJUA 3NGZA 1EAYC 4NYNA 4C8YA 4LBPA 3M1FA 1U45A 5EHHA 3TVZA 4ID8A 4K4VA 4LF5J 3U3GA 4I67A 3WNEA 2UVRA 4K0KF 1JJ2R 4M94A 3M2UA 4RW6B 3FE1A 2AGQA 4CO4A 2GHPA 2YWGA 4CEDA 5GADP 1Q7YO 2XNQA 2IM1A 3PV8A 3NE6A 1QY7A 4DQ8A 3FMBA 3ID8A 3AARA 1W97L 4Y3CA 1KR4A 2QXLA 4CFAA 3PJ9A 4C8KA 3MCMA 2RRBA 2FYXA 5LXYA 4JN4A 4UZBA 3PACA 4QCLA 2CGJA 2E9TA 4LFCJ 4JKGB 1NU0A 2HZCA 1NGJA 1VCTA 3PVXA 2G8KA 2I1RA 1HYZA 1NPKA 1NK7A 3QGPA 4X64K 1BG3A 2BA9A 3LZIA 2DGOA 4A62A 2XWXA 4J2EA 3F5TA 2F96A 2OEJA 2CJKA 2FD2A 4ZN1A 1D1UA 1U02A 3QSIA 3CFRA 4D3GA 4TXSA 3ZSOA 2BM1A 3M8WA 5F8NA 3J81O 4I6AA 2DIUA 1J6ZA 1RU2A 2VBXA 3CWJA 3MPWA 5M1PA 3H42A 5KFCA 2ETJA 3TZZA 1JNRB 1IKYB 1N6QB 1X4AA 5IXUA 3BQ1A 4E98A 5FLXY 3FQLA 3VVUA 5KI6A 4WPAA 3OQ2A 1F2GA 3PW0A 3A8YA 3IG1B 3PR5B 1NKEA 1TAUA 3OTEA 4W4MA 3CDEA 4NXNF 3OT9A 2WSCC 4CHYA 1R89A 2UXCJ 2HVZA 3VEXA 3GYGA 5KFEA 3DGPA 1OYDA 1F9HA 2ZH1A 3HFZB 3BSOA 3L2RA 1MMLA 5GMKa 1JXVA 4XK8C 4I2PA 2ZDOA 3A5NC 3Q8RB 3CW2C 5AQFA 2MQQA 2P5OA 1S79A 1KBRA 4DCPB 2R8HA 4PG4A 1UJ5A 4GVBB 1RHKB 1KP6A 2P8IA 1VSHA 4B3SK 5KG1A 4CZGA 1XMBA 3QT8A 3RBDA 3P45B 1RT2B 3L09A 3BF3A 2UUBJ 4KHMA 1N48A 3O44A 2MQLA 1HR0F 5DMRA 2Q79A 3IMXA 1FRIA 2G8VA 4ENOA 2NLWA 1U2CA 5B0BA 2VICA 4OX7A 3AVJA 2VFSA 4DS4A 4GO7X 1V3RA 4HDGA 2HGLA 2DH8A 4M41A 4CHOA 2NXCA 2OSRA 2UVVA 4CWBA 5M2PA 3LWLA 4CERA 4OQJA 1TK5A 4O3QA 2JFKA 1RYSA 4BR0A 3SXLA 3SBGA 1RDBA 3B78A 1OPIA 1TL1A 3R5BA 3PXGa 2XY8A 4LFAJ 1JKHB 2CQ2A 3DI6B 1KTQA 2B7CB 3G71N 2CQ0A 4F3MA 3K8WA 4YOEA 2L08A 3H3OB 1S9FA 1YVUA 3KHRA 2A1SA 4OLAA 1X9JA 2XSFA 4BGAA 2J6SA 5A2QU 3KLFB 4Q43A 4JOUA 2KM8C 4LF5K 2GVDA 5KFYA 5J1EA 4IOXA 2CQGA 3Q7BA 5C0YA 3THYB 4OX8A 5KFPA 4A4JA 3KHLA 3KG4A 1TVRB 3DDKA 1ZBHA 3CJ5A 4UY8T 2FC8A 3QAEA 4DB3A 1FX4A 1YBUA 5LJ3Y 1S3XA 3H0PA 4ZPAA 3UCUP 4H5NA 2DGTA 4FLZA 1U6FA 1M5KC 3V5RA 2GELA 2IVNA 2W42A 1D0EA 3R3TA 1HPZA 5AQGA 4JK9A 4U67Q 2YKAA 5HROA 1XMOJ 1IV0A 4LFCK 1REGX 4OV1A 1YRTA 3MMAB 3TAQA 5RUBA 2HBKA 4HEA9 2VQFF 3T3FA 3J81Y 4DR3J 3QNNA 1N0UA 4K42A 4E8UA 2MLZA 2F8TA 3MEEA 1CULB 5AQNA 4LF9J 3J7YU 1RWKB 4WTOB 1RWUA 4JI0J 4O55A 4Q8FA 1T05B 1X60A 1QZ5A 3GIRA 2EHGA 1NSKL 1FRKA 3SCJE 4BRCA 2APOA 1RA6A 3MWTA 2WVCA 3NGUA 3CCQN 2J9DE 2LYVA 3LWMA 4FWNA 3CFPA 3BREA 3UD4P 5F8GA 1SKUB 2BQUA 3IAYA 3TRGA 3PCOB 3ENBA 4K4XA 4IEEA 2GIQA 2ASDA 3IWLA 1SIZA 1YG0A 2MZQA 1GTHA 3OBIA 4Z37A 2P6TA 4RW4A 1KLMA 3O5TB 3MMCB 3MZIA 4O3SA 2UXCK 1K0VA 4DTXA 4KJIA 4DSIA 5CR4A 4OL8A 1KQKA 4KT0C 4DR7J 4MDBA 3K0SA 2B3TB 2CJYB 4GKJJ 2M3DA 2CQDA 2MJNA 4CHPA 1WKLA 2VD3A 4NLXA 4JI6F 1NGEA 4DKWA 3UKRA 2Y0SD 2HNYB 2MHEA 2XI3A 1QAYA 3VMFB 4DU7A 2KXFA 3CCEN 2GJFA 1W9HA 4PXCA 4JYAF 3CG7A 2DGWA 4PCQA 2UUBK 4BROA 1RBSA 1Q7LB 3KK2A 5AZJA 3P96A 1UVKA 3AOBA 2HIQA 3SI8A 5AQTA 2UUAF 2O8EB 2FBTA 3WZ0A 3F41A 3IBFB 4DV7F 1X4BA 5LMUK 4UF4A 3OYAA 1CQMA 1H98A 3LP3A 2E7XA 1GLDG 2DNHA 3TP2A 2YHAA 1E3MA 1NEEA 2B9XA 2YNHB 1YVNA 2X7IA 1U2RA 4NX9A 1F21A 5K20B 4WYBA 3CCZA 4B1WB 4YY3K 1VSMA 1U6BA 4DV3J 3VQ9A 1IXKA 1RDRA 3MPVA 4BG8A 4GMJB 3VF4A 1LW2A 3W5YA 3KYLA 4LFAK 3DLEB 3BGRA 4H4MB 3N4QA 1C0FA 1S1TB 3UW1A 3G25A 1VIXA 2YNGA 2DHHA 3CMEN 1B92A 3WUHA 4CZKA 3MCNA 1UWBA 3JQKA 3QWUA 1A0OB 1MG7A 1VRTB 2IDEA 2W9CB 4IO8A 2QWNA 1VQNN 4X66J 3QFUA 3N0VA 2E1PA 4PKIA 1YRUA 4A48A 5T7LB 3L2UA 3UDEA 4LF6F 2EBGA 1VSDA 3QJJA 5A8RB 1WHXA 1VBKA 3A1YG 1DT9A 3FSIA 3PG9A 2R7YA 2MMYA 1OY9A 1HKAA 2B9YA 3S9HA 3CSKA 4H0PA 3WXJA 1D9FA 3SQGA 3NGDA 1VQ6S 4FPBA 3THXB 1FE4A 3OTCA 3V6JA 4MK9A 1HWLA 2M5YA 3E8OA 3C2PA 1KDNA 3A3PB 3S6EA 2JWKA 3FZMA 3P5BP 4RUCA 4UW2A 4WIQA 4DL2A 1VQOS 1VQ4S 1QLNA 1MSWD 3FJ2A 5FPDA 3TWZA 1T6DA 1IM4A 4DEZA 3R7SB 2DD8S 3EDQB 4P10A 2O8CA 3KFWX 4WJBA 1UZDA 1U6ZA 3HOTA 3EGVA 3CF5Q 1RHMB 5DK5A 2IVOA 2HQ3A 1QVGR 2QTWA 4TQSA 2Q97A 5CZ2A 1IO2A 5HLFB 1J5EJ 4LR7A 1ZAXA 5A8KB 4KGMA 5C7PA 1DFDA 4PHTX 2CGLA 2QGFB 3A3OB 2X1GA 1TELA 1FXXA 1HNIB 2ZFHA 3QEVA 2IVYA 3ZEUB 4JI1J 4ILJA 1RAGB 3GYXB 5C42B 4B3MF 3DRSA 1KVBA 4FYXB 5CH7B 4HHTA 4CD1A 1GXLA 5LJWA 3PX6A 2G8WA 4DL4A 2KO1A 1HWUA 4FF3A 4AHSA 3OYIA 3BZKA 5ETRA 1HRHA 1P1LA 2WSEC 3CQXA 4DR7K 3GIIA 3B8AX 4NPOA 1Q16B 1NGBA 2Y1LB 1S0VA 3OYMA 2W8LA 1IBLF 2QYCA 4ED2A 3TSPA 2A42A 4DCOB 4DR4F 3DFEA 2MKSA 3DXKA 2UXBJ 4IJAA 5AFUA 4MIWA 3UB5A 2WW8A 5AQSA 2CZVC 4OJ3A 4GC6A 3OL7A 2D3O1 3V9WA 3C94A 3OFGA 4WFBQ 1ZPWX 3C14B 1S9GB 3AT1B 4AHCA 1HHQA 5BPLA 5KFTA 3UVJB 3C6UA 2J0WA 1OSDA 3OFFA 2HLUA 5L8RC 4DMNA 1VRQC 4ELUA 4IG3B 2DO4A 1IG9A 1VFJA 1WI6A 3J8AA 4NCBA 4K8RA 3R5JB 3AFGA 3KJFB 5JS2A 1SXLA 4I6MB 3CULA 5ADZA 2YTCA 2VJUA 4A8MP 3QGGA 4DV3K 1LW0A 2XLIA 2ZOFA 1QVFM 1WNSA 2XEXA 1LWCB 2FTRA 3AVGA 1W7AA 3DDIA 3IC1A 2VBZA 2WB1D 3C6HA 2HQFA 1WELA 1VQKS 2DITA 3QLHA 3V6KA 1BWVA 2GCFA 3NWRA 4XIUA 1B0PA 1H38A 1K8AT 4KHSA 1UWAA 1XMQF 4FW2A 4U67L 2FJXA 3MMJA 3FEYB 4X66K 3VAIA 3ZETA 2OP5A 3T41A 2UUTA 4OHZA 1W2BR 2V63A 1YDLA 1GT8A 2BM0A 3I55S 3H90A 3I32A 2HVDA 3H59A 5E7OB 4DV5J 2U1AA 4OYOA 2BKPA 2PA8D 1DTQA 3EKUA 3NLCA 5C2DA 4FO0A 2POKA 1ZPVA 1MROB 4ZP8A 3PEJA 5A0YB 2XHCA 5HO4A 1L3KA 1HI0P 3LM2A 4EYIB 2MYFA 4ZTJA 2LXIA 2ROPA 2P2CB 2E2QA 4WFNQ 1UVJA 3DMJB 2H4YB 4HUGA 4GY2B 4FJXA 4P2MA 1WSJA 3BSAA 1K1QA 4Y0FA 2YWEA 4IOAQ 5EVZA 4C23A 1SV5A 2OTJN 1TGOA 3U9ZA 1TL4A 4DR6J 3LGMA 5FROA 1QM9A 1YITN 1IBKF 2GEMA 2HYIB 2OGUA 1BQMB 3CCTA 5HOOA 3GLJA 2FJEB 4M5DA 1LOTB 2HBMA 3MX5A 2LXUA 1U0SA 3QBCA 4HT5A 4ETZA 3V9SA 3H08A 4JV5F 3IS9A 3TAEA 3FFIB 2PY5A 2YPYA 2HBQB 2WBMA 2B43A 4BVPA 3NGSA 4C11B 3IBWA 1VSKA 1XWLA 2GGPB 3NS7B 2RDDA 2UXDJ 5DM7Q 5JS1A 2M70A 3GR0A 4PQAA 4JI1K 1XC3A 4O0JA 1P1TA 4LF1A 3BR9A 2NZTA 3O80A 1B0TA 4PPDA 4KPYA 1RCXB 4BACA 3AQOA 4ZA1A 1XIQA 1B4SA 5C24A 2BE2B 3J7A1 4C8ZA 4EO8A 3CCUN 4EO6A 5KPTA 4CGDA 3MCPA 3AD9C 2AEMA 5E3CA 5DDPC 1X4FA 3PRDA 4TLRA 2VQEF 2XULA 5EN1A 3V1OA 5KG5A 4KGZB 3Q0AA 4KH6A 1VJQA 3R3LA 5H1SQ 3WQPA 4NLYA 1KHWA 2PO4A 2UXBK 2YWFA 4H03B 1IKVB 5L1IA 1RTJA 4FS2A 4CGHA 4JBCA 2LA6A 3AVLA 4NCGB 4N47A 1E6VA 1KRPA 2RQCA 4J9LA 2LQ9A 1NK4A 2RQ4A 3I5AA 3V9ZA 2KG0A 2FLOA 4DR2F 3LZJA 2Z2LA 3PRVA 4W92B 4K0KJ 4P75A 3R5CA 3FNNA 1VK0A 1VS3A 4B1YB 1KOOA 3G6VA 2BW2A 4DX8H 4X4OA 1I94J 3ZO7A 1OH7A 2HQDA 1KCFA 3KLEB 3TWHA 1Q9YA 2PT0A 2ZF5O 3RRGA 1Y11A 4JKDA 8AT1B 3QNOA 4CZCA 2H9ZA 1DURA 2FBYA 1Q8LA 4AYBD 5F9NA 2MB0B 3OYKA 3PYFA 5AQXA 4FP9A 2XM3A 1QAIA 4CIGA 1JJCB 3DLKA <