5DM7L

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGKLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5dm7L01
1NJIO 1VQ9N 1YHQN 1OVYA 3CCVN 3G4SN 5HL7L 1YJNN 1Q86O 5DM7L 4U67L 1KQSM 3CCMN 1Q7YO 2OTLN 3CCJN 3I55N 3CF5L 1VQNN 2ZJRL 1YIJN 3CCQN 3PIOL 1S72N 3CCUN 1VQLN 4WFNL 3G6EN 1M1KO 5GADP 5GAEP 1KD1O 3G71N 2QA4N 1N8RO 1KC8O 3CCLN 1QVGM 1QVFM 5DM6L 4IO9L 2ZJPL 1VQ7N 1K8AO 5JVHL 5GAGP 2OTJN 3J7ZO 5JVGL 1YJ9N 1Q81O 1YITN 3CPWM 4WFAL 1Q82O 1VQPN 5H1SQ 4WF9L 1YI2N 5GAHP 3CC4N 1VQ8N 3OW2M 1W2BM 1VQKN 4UY8O 1YJWN 3CMEN 1VQ6N 1M90O 1JJ2M 4WCEL 4WFBL 3I56N 3CMAN 1VQ5N 3DLLL 3CD6N 3CXCM 2QEXN 1K73O 2ZJQL 3CCSN 1VQMN 1K9MO 1ILYA 3PIPL 3CCRN 4IOAL 3CC7N 1VQON 3CC2N 5MLCQ 1VQ4N 3CCEN 4IOCL
chains in the Genus database with same CATH superfamily
2V7ZA 4BDZA 3O5BA 1W9HA 1IG8A 5LMNK 3QEIA 1CXQA 4BQLA 1L3UA 1YHQN 4O5FA 4IOXA 1C0TA 2A42A 3WXKA 2GBZA 1VSLA 5HRRA 2O8DB 1ZBIA 5AJ3K 3EZWA 4MLEA 2IC3A 2D5RA 1IO2A 2UXDK 3U3GA 5AFUA 3ID6A 1S1VA 3WNGA 1ZBLA 4JI8K 1RT3A 3KLHA 1ZYQA 3PSFA 5F2RA 3PIOL 1NJWA 3LZJA 1FJGK 3CCUN 3RSEB 4CEZA 4FJNA 3F9KA 2G8KA 5HOOA 5FPMA 1M1KO 2PBDA 5KI6A 2HNYA 3S3MA 4QS8A 4JK9A 3C7NB 4U7BA 2NZTA 5EOYA 3RMCA 4H0PA 4KHUA 2F9WA 4Z4IA 3AO3A 4DSIA 1IKWA 1RT7A 5EX5A 3NF6A 5KQ8A 3A8YA 3QESA 1RDCA 1IKYA 3OS0A 3ENHA 2D4WA 3LP1A 3L2WA 5AQYA 1GLBG 3CFOA 2FBVA 1NOZA 2P9LB 4W5NA 2NLXA 4M3WA 4CVNE 3HPOA 1T03A 1QQMA 5J2PA 4L8RB 3VERA 3L2VA 5AR0A 3CJ9A 3HSCA 4LSNA 5TKYA 2NUBA 4LFCK 5FRMA 4H0VB 1RBSA 3M3ZA 4CBXA 3IDHA 3PSIA 3ZT1A 2XHBA 1IKXA 1RDUA 3M8RA 5FRNA 1VSMA 4JEPA 1RBUA 4MO4A 4GV3A 1VQMN 3EO3A 3BZCA 4GNIA 2P51A 3HXMA 2OPSA 1IBMK 2HHTA 1Q8IA 3IMXA 1SZ2A 3A5MC 2HF3A 3QFUA 4CJPA 4LSLA 4CJTA 5BR8K 3CIPA 3C7NA 3VESA 2D0CA 3C6TA 2GV9A 1T05A 1NGAA 4AF1A 1NOYA 3TAEA 1QTMA 1RTJA 3MX2A 1LV5A 1JLFA 1S3XA 3G4SN 3U4LA 1C0FA 3DAWA 3MN9A 3KKRA 5AQMA 3P1GA 2P9IA 4LF5K 4JKGA 2UUBK 4CEDA 3S3NA 3L4IA 4N5SA 4H5NA 4OPJA 5AQLA 3THVA 4FK4A 4FWRA 3DRRA 3D7EO 2YKMA 1R59O 4ZHRA 1TYQB 3SZ2A 1YTAA 4CIGA 5SWMA 5HP1A 5FLXO 5ELZA 1S1TA 1S1XA 3MX5A 3H3NO 3DXKB 2A1SA 4CK1A 3HZ6A 2HSTA 4DTJA 1U2VB 1SL2A 3SYZA 1VSIA 2YHBA 3L2UA 4Z4EA 1Y97A 1C0MA 4BRQA 3J80O 4CHYA 1WLJA 4CJEA 2YHAA 5LMUK 1EX4A 3SQ0A 4H4MA 3SBGA 5CYMA 4OO1J 3HRGA 5BN8A 2WTUA 3T19A 3OHRA 1C0GA 4FWSA 4H03B 3K0SA 2GWKA 4NXNK 3QETA 4F2RA 4CBWA 4GVMA 5C2DA 5C10A 1QSLA 4Y1DA 2ASPA 2HBLA 2OA8A 1KFDA 2IS3A 4DFKA 2QI2A 4DS4A 1VQ6N 4RW9A 3LDOA 3NMUA 2O8CA 3QEWA 4OPKA 3EE8A 4BRDA 2W6LA 3OS1A 4B9LA 1K9MO 2IAJA 1YF5L 3C65A 1KAZA 3MN5A 4CBUA 4JRQA 1KXPA 2RN2A 1W97L 4FCYA 3CM6A 1HJRA 3KLFA 4JV5K 1FKPA 2VWJA 3FLCO 4FM2A 2E2OA 2HB5A 4YOWA 4YOVA 3AO1A 1MA9B 3DXKA 4JI4K 3QB0A 3QFPA 4KKOA 5AQOA 2WC9A 5HL7L 4AHVA 4IO8A 4K41A 4CJVA 4I9QA 1U2VA 5HRSA 3V9WA 4R79A 1EWRA 4CJLA 1I94K 5M1OA 3WNHA 4JRPA 4M7XA 4DLEA 4OX9K 4A59A 2IGIA 5M1PA 3JSMA 5J2MA 3S9HA 2XY5A 1SKRA 3CCQN 3O9QA 1X1PA 2RHKA 2FSKA 4JD2A 4KHWA 4CIFA 1N6QA 2GWJA 3NF7A 4E7JA 3FZLA 4A5BA 4WFNL 1HNXK 4GMJB 4X66K 3QLHA 3V1RA 4I6MB 1JLCA 3AO4A 3CCLN 4DFMA 1UA0A 4KHNA 2DFEA 4FSVA 1T6CA 3EZ5A 4DU4A 1BQMA 2HVHA 4KH4A 4HWIA 5JVGL 1YJ9N 1Q81O 2NRTA 2AP1A 3HBTA 5ADXH 3CPWM 3CQ8A 1ZBFA 3GDQA 4AQYK 2IDOA 5M1FA 1NKEA 4HCCA 4CEEA 1TAUA 3UIQA 4AHSA 3TSUA 1YVUA 4C8LA 2HHHK 3GBTA 1TK5A 2V51B 2HBJA 3AA2A 3P5JA 3JS6A 3WEEB 2D0AA 5CYQA 5K14A 5AZJA 4CW7B 4FWQA 4BRMA 5CZ2A 3G10A 3THWB 4WE1A 4M3TA 3WQUA 3ZYYX 2AA4A 3I8BA 3ISNC 3TABA 2KZMA 3QNOA 3LDLA 5BPMA 4F2SA 4PKHA 4CGJA 1RDDA 1TK8A 3CC7N 4FWLA 2FBXA 4ID1A 1VQ4N 5BREA 4JI5K 2P9UA 5AQHA 2Q1NA 4HUFA 4FM0A 3QERA 4I6MA 1WAFA 3DLEA 1QZ6A 3K2PA 4FOEA 3L8BA 1WB9A 3V1QA 4BGAA 1DEJA 4M41A 3AVGA 3H45C 4O4GA 4JK8A 1D9DA 1RT5A 1QQOA 2F9TA 1BQNA 5J2QA 3A0IX 5C0YA 2YI1A 4DTPA 4JKEA 4H5VA 3SI6A 1FKOA 3KD5E 2NRXA 4CZIA 4FZYA 1RTDA 4O0IA 2IVNA 4IBNA 1KVBA 4DF4A 3QICA 2QWRA 4BC2A 3ZT4A 4N56A 1NGCA 3I8DA 1TKDA 4CJ3A 5HLFA 3H46O 1HUXA 4EP4A 4YOYA 1KD1O 3OY9A 3P39A 3AAQA 2FSJA 3C6AA 5BRDA 5FPEA 1B92A 3U3YA 3WT0A 4MDAA 3FGUA 3OYBA 2O8EB 2BE2A 4IDKA 1VHXA 3PX6A 3U9ZA 3THWA 3H3OB 4A5AA 5C42A 3DLGA 4CESA 2KKZA 3NH1A 3ENBA 2QM1A 3P31A 3F9MA 3ATVA 2KQ2A 4CI6A 1TL3A 3S3OA 5IWAK 1R0AA 3WNFA 1LWFA 1XQSC 3T3FA 3THXB 5I9EB 1N5YA 4C8OA 4B3RK 1VQ8N 1S6PA 3ZSVA 2I7PA 4E7HA 3SMPA 5AQKA 4DV1K 3B8AX 4FPBA 2PYLA 1Z25A 4CJRA 4RG8A 3CJ7A 4BACA 3I56N 3CMAN 3DLLL 4FJKA 2CH5A 4X62K 4GV9A 3CFPA 4B1UB 4HUGA 1RT2A 3OYKA 1EP4A 4FJIA 3AVLA 5C12A 3T1HK 4CFDA 3ZLJA 1S6QA 2H3GX 1N36K 1CZ9A 3VQ9A 3O08A 2UU9K 3RWUA 1ZC6A 2IIRA 2Q2RA 3FZKA 2Z1JA 1NBWA 4J2AA 2DTUA 4OLAA 1S1UA 2RPIA 1YXQA 3JAMO 3BP8A 5GIOA 2VYPA 1YJNN 2JWKA 2O8EA 1C0UA 4M3RA 2OANA 3ZEUB 2W6KA 1E4FT 2E1ZA 2JGUA 4E89A 1GLAG 3HTVA 3VQEA 3CJBA 3M1FA 4ELTA 1C1AA 1HKBA 1ZBUA 5JS2A 4H5WA 3HP9A 2FBYA 1U48A 2E20A 3HOSA 2XY6A 4BRKA 2QKKA 3VMFB 3KIOA 1JCFA 3U9DA 1I3AA 2ZGZA 4IXCA 4DFPA 1XMQK 2F4VK 2F96A 4KB1A 1NGEA 3OYHA 3O3GA 1D8YA 3F73A 4RTFD 2HHUA 5GAEP 2QWMA 3D45A 2O8BB 3O4NA 3MAQA 2WUSA 3LM2A 4CEFA 5DM6L 3DJCA 4M45A 3NH2A 1Z26A 5AQFA 3AARA 4N47A 4IO9L 3BZKA 4RWTA 5AQIA 2IVOA 1DLOA 2VG7A 3O4WA 3TWHA 4KHSA 4I2PA 1WBDA 4NYFA 2KLAA 4KO0A 4O0JA 4FLVA 1UA1A 3R3LA 4YOUA 1YT3A 3AA4A 3DRPA 2G8HA 3A5LC 1X3MA 3AY9A 3WUHA 1SV5A 5BPNA 3E9OA 4A62A 2J4RA 2X74A 1NK0A 3M8SA 1GLLO 4DQRA 1RBTA 2X78A 4IKFA 3ENOA 3IKMA 2KFNA 1HNWK 3FE1A 4CGHA 3RR7A 1XNRK 3ZEUA 3F2KA 2CGKA 3ATUA 4HTUA 1HKCA 5DMRA 3T1AA 5AQPA 2QWLA 3O6WA 4LD0A 4DFJA 2ETJA 4H0XB 2HHWA 4QS7A 3ZX3A 2VQFK 4JI0K 3DI6A 2W42A 4I7FA 3NGZA 3QBWA 4W5QA 3TAGA 2O8BA 5AQTA 3H6EA 3AVBA 3HT3A 4FWOA 2KHOA 4FWMA 5AQWA 1BIZA 1WUAA 4C8MA 1XNQK 1REVA 2Y1IA 1S22A 1HNVA 3KWGA 3CERA 4PHTX 3KK7A 3T69A 1X9MA 5KRSA 2YNIA 4Q5VA 3B6OA 4JI7K 2CH6A 2YV0X 4AM6A 1LWCA 2YHXA 1GLFO 2D1KA 2ZD1A 3RRHA 3NF9A 3OJSA 1T7PA 4BROA 1NGGA 3HVTA 3T7ZA 4H4OA 4Q0BA 5KTQA 2E2NA 5AQJA 2NRVA 1Q9XA 3BEXA 4CGFA 5GINA 3HSTB 5KGXA 4JLHA 4IFEA 3SJHA 3VGMA 4CHPA 3MEGA 4JNEA 3AA5X 3TR8A 3VQCA 4CEBA 3G25A 3J7ZO 5KQDA 3TTFA 2I7NA 1RT1A 2UUCK 1NK9A 3AVNA 1BGXT 1D4XA 1TUYA 1G99A 2NRRA 4RW6A 1Q82O 3ZT2A 3OYFA 3K59A 3V9XA 4BR5A 2EWSA 1WN7A 4HHTA 4B1WB 3OW2M 1A5WA 2ZWHA 3AVAA 4NCGA 3MXIA 4CZMA 2F7TA 1VSHA 4CK3A 4GKJK 3AVCA 2P9IB 1SUQA 4JKGB 1OH6A 2NNWA 4EHUA 2ZQBA 3B6PA 2YJEA 4JI2K 1E3MA 3R6MA 1NU0A 1KAYA 4HCBA 3DLRA 2QEXN 1VAZA 3SBTA 1GLEG 4WQ5A 4DTNA 4FL9A 1MU2A 4CZGA 2QXFA 3IFRA 4HUEA 3PIPL 1GLCG 3NF8A 2VQEK 1S9EA 3O3FA 1NK4A 4K8ZA 3C0BA 5MLCQ 3NFAA 3FZMA 1HX1A 4JI1K 3EN9A 3TANA 2G8FA 4FJLA 3MECA 2HW3A 5AQQA 1NJZA 1ZBSA 3I0RA 2WFBA 4FZZA 1MDUB 4H5TA 4RW8A 1RTHA 4J2EA 3MXJA 5E84A 3H08A 4KHYA 3SAFA 3AVMA 2HMIA 3CQXA 4XH5A 4OGEA 3SPYA 3H1QA 3VOVA 2GUIA 1VQNN 1WAJA 4AHRA 2R7YA 2GUPA 1KAXA 4FJ9A 3ULDA 2E6LA 2OPPA 4YNQA 2QWPA 4M3UA 4CFAA 1NM1A 1TVRA 1SAZA 1JLBA 1GOBA 1ESVA 5CZ1A 3OYCA 3R9PA 1EKEA 4BRCA 3CPEA 3SPZA 4NB4A 1YTUA 2O8FA 3G71N 4IFYA 3C6UA 4DUZK 3VTHA 2O8CB 1Y64A 1EO1A 1JLQA 4B9NA 3O8MA 3GE1A 3FZFA 3ZT0A 3HOTA 4DQ8A 3Q7CA 5B8HA 1BI4B 3WXIA 3SQ1A 2BDPA 1IH7A 3P4IA 4N41A 2HMPA 3KHYA 4CZFA 1ZBHA 5HRNA 1BHLA 1ASUA 1S5JA 1XWLA 4JK7A 2VGMA 2JLEA 3SV3A 3AVFA 1DGKN 4DCHA 4BRIA 4F4KA 1UAXA 4E7IA 4O44A 4B3MK 2Q3SA 3A5NC 1W2BM 1JL1A 1D9FA 4DV6K 2KZZA 2YKNA 2D0OA 3TAFA 1RDBA 1Q9YA 2QWOA 4B1YB 2HHQA 1NK6A 1T6DA 4BR4A 5LY3A 3M8QA 1M90O 1J5EK 3SV4A 4KBOA 4NCBA 3JYTA 1LAVA 4IZ9A 5C2FA 2HBMA 5JS1A 2E2QA 5C15A 3L4QA 4CF0A 4CF2A 2ATQA 3CCSN 3OBWA 2B6AA 4DV2K 4ZTJA 4RCHA 4FWKA 4DR2K 4JD2B 4CIEA 5BRFA 4OVLA 3V9ZA 2IOCA 3A5OC 3BUZB 1WSIA 4JKFA 3NGIA 4OPHA 2UUAK 1JLEA 2HOEA 2W41A 4BVOA 1J6ZA 1VQ9N 4A61A 5LJVA 2OYQA 1YUWA 1E4GT 1VSFA 4B9MA 3OBYA 4ZTFA 5EVZA 1DTTA 3EE9A 4EZ6A 2YX6A 1JCGA 2UXCK 1GLDG 3SMSA 1Q86O 1RDWX 3ZSZA 5A2QO 2G8VA 4KTQA 1Q7YO 4BR9A 1BI4A 4BRFA 4FWNA 4MDBA 1HPZA 4FLWA 2PFUA 1SL1A 4JHDA 3HI0A 4AM7A 4YORA 4DG1A 2OCEA 1U47A 3VENA 3SNNA 3ZSXA 3PLAA 4BRLA 3VEYA 4FVUA 2G8IA 1J53A 4DKWA 1N34K 2UYTA 2V7YA 3QEPA 5AZJB 1NK7A 3VTIA 4TSXA 3LPUA 1ATSA 3KLEA 4CJQA 2BUPA 4C8KA 2XY8A 3MCPA 1WSHA 2CGJA 2Z1HA 3UB5A 1ITGA 1NLVA 3AAPA 3PV8A 4O55A 1BL3A 3M5RA 1MWKA 4KFBA 1Z6RA 2EX3A 4CJFA 1RFQA 3MK6A 1L3VA 4IJNA 4GKKK 1IBLK 2P9UB 1O1WA 1J54A 3N4QA 3O9TA 3IUCA 4B9SA 1QS4A 5HBMA 4NCAA 3D6RA 3LM9A 4BRGA 3OYMA 2FBTA 4HTLA 4CFCA 3PY8A 4FYDA 1QSYA 1KVAA 3SAGA 4B8CA 4OJRA 2WBNA 4DR4K 4DUYK 4KAZA 5ADXA 4EHTA 3HM8A 4H5RA 3MCAB 3RMAA 1NGHA 4W5TA 1UWBA 3EEQA 2QXLA 4CHQA 2HHXA 4A57A 4RW4A 4LH5A 1NKBA 1KRPA 4LFBK 5C24A 4JKAA 3ALYA 4DV7K 4LF9K 3TSQA 2VWKA 1HYSA 3VGKA 4LF4K 3BF3A 3CHWA 2NRHA 4BRNA 3L6QA 4PWDA 4QOZB 4DSJA 3SAHA 4FJJA 3GG4A 5AQUA 4B3OA 2P9PA 1EWQA 2BTFA 4YDUA 1U49A 2O4GA 2VWBA 3DM2A 4NXMK 1TL1A 3NE6A 3D2FA 4AHCA 1TKXA 4CE9A 4CGDA 4IG3A 5AZIA 3OYIA 2FF3B 4CZJA 3NAEA 3ID8A 2YJFA 4IG0A 2X6SA 1K6YA 4YDUC 2PY5A 3IAYA 4IJAA 1K8AO 3TU5A 1H1VA 1SS6A 4AHUA 3C6HA 2HNDA 5GAGP 2RKIA 1HYZA 2D0PA 5AQXA 1XHZA 3VQ6A 5F0XA 4OLBA 5D3GA 4LF8K 2KW4A 4KTZA 1RGIA 5IT9O 5AQNA 3CC4N 1DT9A 4CHZA 1NGDA 5BRHA 2Q31A 4H0TB 4DLGA 1HJOA 2QK9A 3ZCMA 4GVEA 1B9DA 3AGKA 3SQ2A 3CD6N 1HNZK 1NGBA 4O8KA 3QINA 1F21A 4YY3K 1CZAN 1HR0K 2A40A 3C95A 4DV0K 2NRZA 4DR6K 4ISGA 5E26A 3RR8A 3SCXA 1XI1A 1SL0A 2FC0A 1BG3A 4H8KA 1VSDA 3K5LA 3CCMN 4CEOA 1HKGA 4DSFA 4M42A 2Z1GA 2ZJRL 3SLCA 2XO7A 3KK1A 4FJHA 4LF7K 3VF6A 1LCUA 3DWLA 1WNSA 5CHIA 1VK0A 5F1XA 1O13A 1BU6O 4YOTA 1RBVA 4ILGB 4YOXA 3WXJA 3K5OA 1QVFM 4EAHD 3EKUA 4XH4A 3OYNA 2ZJPL 3ZX2A 1RTIA 3THYA 3LWMA 4BC4A 4CJUA 1OKJA 4DQQA 3VEXA 1NJYA 2OTJN 1SKSA 4CF8A 2HF4A 4IEEA 1N33K 4OPAA 4B9QA 5CE3A 1VQPN 4R5PA 4PQUA 4GY2B 3KZBA 2CGLA 2DFFA 3WXLA 2B5JA 4BDYA 4C1NK 4YHHK 4FPAA 4FW1A 3AVIA 1JLGA 1HNIA 3AO5A 4B9TA 1U45A 3RTVA 4MFBA 3SQ4A 1NWKA 2OZSA 4A2AA 2GEMA 2RE2A 2V52B 4KB0A 4I2QA 2YCHA 4CGGA 4B1VA 3O1BA 4XEIA 4CF1A 4IFVA 5JLHA 3TAPA 4F3OA 3QBXA 2PZSA 2P9KA 4O8UA 4BRPA 3L0QA 2QWNA 4N76A 3V6DA 1KVCA 3D2EA 3UKUA 1Z05A 3KJVA 4M3YA 1VSEA 5FROA 3LAMA 4FLUA 4PA1A 4DS5A 1EXQA 1OVYA 1BOTO 2Q0RA 2DY4A 1QQNA 2FSNA 3GL1A 2E88A 3E9PA 4BWJA 1WSGA 4FLZA 3AO2A 5DM7L 2KFZA 1KQSM 4EFHA 2OTLN 1TAQA 3KVGA 3SJJA 1LW2A 3AGRA 1OH7A 5AQVA 4C23A 1KSPA 3DRSA 4K8XA 1RILA 4JS4A 3QIPA 3NBPA 1T8EA 4FW2A 3BGRA 4E1NA 3D0PA 3O80A 1BDGA 4JAXA 4BREA 1B9FA 4Y1CA 4UQGA 3TARA 5GADP 3OYJA 4Z4CA 3MN7A 4H0OA 3LWLA 5TKWA 2HBKA 1KC8O 4KRFA 3GOIA 3KK2A 4FZXC 1L5UA 5I42A 1QHAA 1V4TA 3VQ7A 2YNHA 3M8PA 4CD1A 3K5MA 4DQPA 2A1RA 4JKDA 4FJMA 2VGNA 4E0DA 1I39A 4DHYA 3VA0A 2A3ZA 1QSSA 4B08A 1K8KB 5KRTA 2HNZA 5CR4A 3LDQA 1YI2N 3VPZA 1JXBA 3R1XA 3VGLA 3O1WA 3CETA 2DFHA 5EU7A 4Z0UA 4FJXA 1XMOK 3CMEN 3PX4A 4EZ9A 4B1ZA 3LALA 2ASOA 4CFBA 3P83D 5AFUH 4CHNA 2O4IA 5BR9A 1C6VA 3ZX0A 3PO5A 3L2RA 4FJ5A 4BC5A 4M3XA 4WQ4A 4FXDA 4IOAL 4DV4K 5CY4A 1BCOA 5KPZA 4J8FA 2O8FB 3WXMB 2VCPA 2YHWA 4BGBA 1SQKA 1N32K 3T1YK 3HJFA 2E2PA 1C1CA 3QMLA 3NGYA 3LPTA 2E6MA 4WQ4C 3TTCA 4ILHA 3QDKA 4DQIA 1KTQA 4G1QA 3K58A 1JLAA 4C8NA 2ASMA 3RVCA 1NG9A 2E4LA 1K8KA 3J7AP 2BANA 2LSNA 3MXMA 5FPNA 4FJGA 2Z1IA 4FK0A 4NO7A 3OS2A 3UKRA 3ZSOA 2ZE2A 5KPTA 3ZT3A 1VQLN 4WQ5C 4FJ8A 3J7YP 4DTMA 1YVNA 4ELUA 4FWPA 3WQTA 3JXUA 2QA4N 1DKGD 1RBRA 1OH5A 3ZSWA 4B1XB 2YHYA 2GX9A 5AQSA 3LDPA 2B4JA 2O8DA 3KWIA 1V4SA 5J1EA 4DTXA 2PYJA 4OKEA 4K25A 4LFAK 3L3VA 4F9OA 4CEQA 4DSKA 1HQUA 3K9KA 5H1SQ 4WF9L 4CJ4A 1RT4A 4BRHA 1Q18A 5GAHP 3PUFA 3O4QA 4CGIA 1JKHA 4I9LA 5DK5A 4W5OA 3RSEA 3BDPA 3KLGA 3OTOK 4XH1A 4M7YA 3E1YA 4Y0WA 1A5XA 1YJWN 3CG7A 4CERA 4C1NI 3U6FA 3AVJA 3VEZA 3DMJA 1ATRA 1JJ2M 4WCEL 2F8TA 4DV5K 3LP0A 4BG9A 1LWEA 4W5RA 3TAQA 4DR1K 1K73O 4JHDB 2ZJQL 2OPQA 5M1NA 3VQBA 4JKHA 1C1BA 3CC2N 4RW7A 1NGIA 4IOCL 3DOLA 4Z4HA 1ZXOA 1A5VA 1ASVA 3OYAA 4BR0A 4ICLA 3WNEA 1L3SA 2P9LA 4IWVA 3TI0A 3CFRA 5FPDA 1VRUA 2IVPA 4FM1A 2QWQA 3CI5A 1XC9A 1S1WA 4E1JA 1P8ZA 2P5GA 4V19S 5EXWA 1JXEA 3SUPA 2QKBA 3V9SA 2WONA 3VQPA 2E5LK 4BRAA 5LL6Z 3HK2A 4KI6A 3E01A 1BA0A 2Q36A 3G0ZA 4JYAK 2FF6A 2GTDA 3ULEB 1BO5O 3VEOA 3IS9A 4CJSA 5AQGA 4K42A 4KREA 1IJJA 3MDQA 4O5BA 1IKVA 4CD3A 1TGOA 3QEXA 4PL7A 2P9SB 2RF2A 3RRGA 2F8SA 2YNFA 1VQ7N 4AH9A 2W40A 4FJ7A 1MWMA 4B9UA 1TKZA 2AJQA 1BIUA 4DMNA 1YITN 4DV3K 4CCHA 2Q0UA 4LH4A 2A5XA 1KLNA 1NKCA 1NJXA 2FXUA 3V9UA 2WOMA 1TYQA 3AVKA 4UY8O 4DWIA 3O9UA 3ZETB 3NH0A 3W3DA 3VQQA 4CZHA 3AA3A 1KFSA 4XIUA 3QNNA 3QEVA 1LW0A 1SKWA 4B3TK 1VQ5N 5M1QA 3VQ8A 4M63C 4CJ7A 3DYAA 4G9ZA 3LDSA 4MQ3A 2P9PB 4BWMA 1RCHA 4JKCA 2VG5A 1RDAA 3TSPA 3CCRN 3AVHA 4YFUA 5HROA 3IG1A 3D2FB 1HQEA 3ULEA 4ISFA 3CCEN 2PAVA 4K43A 5AZIB 2P9NB 5FDLA 1KLMA 4FLTA 3DXMB 3E9LA 4FLXA 3ZSYA 1BWFO 4CECA 3C94A 3M6GA 2P9SA 1WBBA 2VG6A 3VQ5A 3BY5A 3SUNA 3CCJN 2OZMA 4L3QA 5GIPA 3MWPA 3NVMA 2OPRA 1BISA 1S72N 4QCLA 1NNEA 2JWLA 4PUOA 3ZSQA 5EY4A 4DR7K 3FFIA 4CZLA 3U8XA 1W7AA 4EIAA 3MEDA 4LF6K 3ZETA 4CJWA 1N8RO 1NK5A 3HYFA 4KV8A 3VF4A 3N4PA 2ZM6K 4JN4A 4DF8A 4BG8A 1QZ5A 4KH6A 3OYDA 3VA3A 3TAMA 5E41A 2A6AA 3FFKB 3UE5A 5C25A 5J2NA 1QE1A 2QTDA 1X9SA 1NK8A 4BQZA 3RMBA 4Z4GA 3LL3A 4NLBA 4WFAL 1LOTB 3HVRA 3QIOA 1NMNA 3AV9A 4BR7A 4E1MA 4JI6K 2P9NA 3EKSA 4OKJA 5I3UA 3DXMA 3DLBA 1OVQA 4ID5A 4DTOA 2G8WA 4KHQA 3OVNA 3ZSRA 4X64K 5AQRA 3BF1A 3LP3A 2EHGA 3MN6A 3O9RA 4FVMA 2UXBK 1FW6A 4WFBL 4PL8A 1BUPA 1GOAA 1X9JA 4K0KK 1W0HA 2P1JA 3V81A 4BY9C 2ITGA 3DLKA 1VSKA 4A2BA 3NDKA 4CHOA 5SZTA 5KGWA 4B9VA 2E8AA 4CK2A 2QW9A 3SUQA 3OYLA 2XY7A 4DR5K 5M1KA 2HVIA 1RNHA 1CXUA 3EYZA 2HHSA 4PKGA 3CJ1A 1T3VA 4ELVA 3J81O 3F5TA 4MLHA 4CF9A 1TUUA 1QHTA 3L2QA 1G15A 1U6ZA 3WEEA 4ILJA 3K57A 4CJ5A 3SK3A 2ITMA 3THYB 4GW6A 4CJKA 3PX0A 5LJWA 3I55N 3TTDA 1OH8A 1L3TA 1GOCA 4CZEA 4GV6A 3HPHA 4BE0A 4DTRA 1NGJA 4DTUA 1EETA 2BH1A 3KKSA 2KTQA 5HRPA 3K5NA 4BE2A 3VETA 3LANA 4KTWA 3HP6A 4M3ZA 3VEVA 1IBKK 1ATNA 3MWTA 5T7BA 4DU3A 5BN9A 4CZKA 5JMVA 1XHXA 4J2DA 4QAGA 2P9KB 5JVHL 3HO1A 5JLFA 4E7LA 1BCMA 3MMVA 3MEEA 4E3SA 3VQAA 1WOQA 3D2EB 1UOCA 1U4BA 3UKUB 4HVJA 3KK3A 4EP5A 3O9SA 1JCEA 3CJAA 1HPMA 3ITHA 1T44A 4DU1A 4DR3K 1FXXA 4E19A 2XRIA 3CJCA 4MO5A 1RT6A 3Q7BA 4DQSA 4DTSA 1VQKN 3E66A 1JL2A 1QQCA 3FZHA 1WSJA 1VSJA 4OGCA 3HL8A 1VRTA 4J2BA 1HMVA 4Z94A 4KI4A 1FK9A 3S41A 4DSEA 4WYBA 1LAWA 3VQDA 1X9WA 4BE1A 3SUOA 4KHPK 3VF2A 3NCIA 3W0LA 4KH5A 4E7KA 1J9AA 4Z4FA 2HHVA 3NVKA 4PY5A 2ZGYA 5AQZA 1BA1A 4FOIA 1NJIO 3THXA 4FK2A 1NGFA 4CEAA 1HLUA 3KTQA 3CCVN 2FLOA 1S9GA 4BR2A 3EL2A 4BC3A 3VN5A 1U04A 4U67L 3H1VX 1XC3A 4FLYA 4B3SK 1WSEA 1J5OA 1ASWA 2E1YA 3TPQA 2DPNA 1NMDA 1GLJO 2D0BA 3CF5L 3LP2A 1IG9A 4QS9A 3CYMA 4F3TA 1YIJN 4AHTA 2NRWA 1HRHA 3ASMA 1TKTA 4NLCA 4LC9B 4LY7A 3G6EN 3KD1E 2ZF5O 3EY1A 3CM5A 1P90A 1X3NA 1IV0A 4PKIA 1QVGM 3V1OA 4BVPA 3A2FA 3VEWA 3P38A 1EQYA 3HPGA 3RMDA 3QO9A 4JKBA 4JI3K 1XUPO 5KPRA 4AILC 4F8RA 3I0SA 3V4IA 3PO4A 3IRXA 3LDNA 4BDPA 4KPYA 1TK0A 3K9JA 1HYVA 2Y1JA 3LAKA 5BPLA 2X6NA 1TV6A 3DOKA 2GELA 4DSLA 4ISEA 1CZBA 3L3UA 2A41A 3VQ4A 1KCFA 3FR0A 1WSFA 4NYNA 4B8AB 2G8UA 1CLQA 4H0YB 3KLIA 3I33A 4IEIA 3DLHA 3CXCM 3OA9A 3OYEA 3OYGA 2I5JA 3CQYA 3NHGA 4IDHA 2P5OA 2BGGA 4OKKA 3J8AA 4DB3A 1DTQA 1D5AA 4X65K 4JS5A 1ILYA 3OJUA 1YAGA 3LZIA 3R8EA 3UKRB 2Q97A 4FO0A 3O3HA 1VQON 5JICA 2YNGA 3HM9A
chains in the Genus database with same CATH topology
2V7ZA 3O5BA 1ZC6A 1ZXOA 2IIRA 2Q2RA 2QXLA 3FZKA 1IG8A 4BR0A 4BQLA 1NBWA 2P9LA 4IWVA 4A57A 1YHQN 4O5FA 4IOXA 5FPDA 2IVPA 2A42A 3WXKA 1YXQA 2QWQA 3CI5A 3BP8A 4JKAA 5GIOA 2VYPA 1YJNN 2JWKA 1P8ZA 4E1JA 3TSQA 2OANA 5EXWA 3ZEUB 1E4FT 2E1ZA 3EZWA 4MLEA 3VGKA 3BF3A 1GLAG 3CHWA 2NRHA 3HTVA 4BRNA 3L6QA 5AFUA 3CJBA 3ID6A 3M1FA 3SAHA 3GG4A 1HKBA 4H5WA 5AQUA 2E20A 2P9PA 2BTFA 4BRKA 3HOSA 4YDUA 5F2RA 4BRAA 3PIOL 3VMFB 1JCFA 3U9DA 2ZGZA 2VWBA 3CCUN 4IXCA 3RSEB 1BA0A 2Q36A 2FF6A 5HOOA 1NGEA 2GTDA 5FPMA 1BO5O 2PBDA 3ULEB 1M1KO 3D2FA 4RTFD 3VEOA 4QS8A 5GAEP 2QWMA 4JK9A 3C7NB 5AQGA 4U7BA 4K42A 1IJJA 3MDQA 5AZIA 2NZTA 4CD3A 2WUSA 3LM2A 5EOYA 2FF3B 4CZJA 4H0PA 4PL7A 5DM6L 2P9SB 3DJCA 3ID8A 5AQFA 3AARA 2F9WA 2YJFA 4IO9L 4YDUC 4RWTA 5AQIA 1VQ7N 4IJAA 1K8AO 2IVOA 3O4WA 2W40A 3TU5A 5EX5A 1H1VA 1SS6A 5KQ8A 3C6HA 5GAGP 2KLAA 1MWMA 3A8YA 2D0PA 5AQXA 1YITN 3R3LA 3ENHA 2D4WA 4YOUA 2Q0UA 5AQYA 5F0XA 2A5XA 1RGIA 1GLBG 3A5LC 1X3MA 3AY9A 5AQNA 3WUHA 1DT9A 2FXUA 3CC4N 2P9LB 1NGDA 1TYQA 2NLXA 5BPNA 5BRHA 2Q31A 4H0TB 3E9OA 4UY8O 1HJOA 4A62A 2J4RA 1GLLO 1QQMA 3O9UA 3VERA 3ZETB 3W3DA 5AR0A 4CZHA 3CJ9A 3HSCA 4GVEA 3AGKA 3ENOA 3IKMA 3FE1A 5TKYA 3ZEUA 4H0VB 3F2KA 1VQ5N 5M1QA 3CD6N 4CBXA 2CGKA 3M3ZA 4M63C 3IDHA 4CJ7A 1NGBA 3ATUA 4O8KA 4G9ZA 1HKCA 1RDUA 4JEPA 5AQPA 2P9PB 2QWLA 4MO4A 4GV3A 1VQMN 3O6WA 3EO3A 4GNIA 4JKCA 4H0XB 4QS7A 3TSPA 3ZX3A 3CCRN 3IMXA 1CZAN 1SZ2A 3A5MC 2A40A 2HF3A 3QFUA 2NRZA 3D2FB 3ULEA 4ISGA 5E26A 4ISFA 3QBWA 3CCEN 2PAVA 3CIPA 4K43A 5AZIB 3C7NA 2P9NB 3VESA 3DXMB 5AQTA 3H6EA 1NGAA 3E9LA 4AF1A 3MX2A 1BWFO 3M6GA 1S3XA 1BG3A 2KHOA 2P9SA 4FWOA 4FWMA 3U4LA 3G4SN 5AQWA 1C0FA 3DAWA 3MN9A 1WUAA 5AQMA 2P9IA 1S22A 4JKGA 3CCMN 3L4IA 3CCJN 1HKGA 4H5NA 3KWGA 3CERA 4L3QA 3KK7A 5AQLA 3T69A 4PHTX 3SLCA 3MWPA 5GIPA 2ZJRL 4FWRA 3VF6A 3D7EO 2CH6A 3NVMA 4AM6A 1LCUA 2YHXA 1GLFO 2D1KA 1S72N 1R59O 3DWLA 5CHIA 2JWLA 1TYQB 5EY4A 4BROA 5F1XA 1O13A 1NGGA 1BU6O 3T7ZA 4CZLA 3U8XA 4YOTA 4EIAA 2E2NA 5ELZA 5AQJA 2NRVA 3MX5A 4ILGB 3ZETA 1N8RO 4YOXA 3H3NO 3WXJA 3BEXA 3DXKB 5GINA 3VF4A 1QVFM 4EAHD 3N4PA 3EKUA 4JN4A 4XH4A 4IFEA 4BG8A 3SJHA 1QZ5A 3HZ6A 4KH6A 2ZJPL 2HSTA 3VGMA 1U2VB 3ZX2A 2A6AA 3FFKB 4JNEA 4BC4A 3UE5A 4BRQA 1OKJA 2QTDA 3G25A 3VEXA 2OTJN 4BQZA 5KQDA 3TTFA 2I7NA 3J7ZO 3LL3A 2HF4A 4IEEA 4NLBA 1D4XA 1TUYA 2NRRA 1G99A 3SBGA 4WFAL 1LOTB 1Q82O 4OO1J 3HRGA 5BN8A 4OPAA 4B9QA 5CE3A 1VQPN 3OHRA 4BR7A 1C0GA 4FWSA 4BR5A 2EWSA 4H03B 2P9NA 3EKSA 4GY2B 3KZBA 3DXMA 4B1WB 2CGLA 2GWKA 3WXLA 3OW2M 2ZWHA 4C1NK 4FPAA 4CBWA 4CZMA 2F7TA 5C2DA 5C10A 2ASPA 2HBLA 5AQRA 2P9IB 3BF1A 4JKGB 3MN6A 2NNWA 3O9RA 2QI2A 1NWKA 4EHUA 1VQ6N 2YJEA 4WFBL 3LDOA 3R6MA 2GEMA 4PL8A 4A2AA 1BUPA 1KAYA 1X9JA 2RE2A 3NMUA 2V52B 2QEXN 1VAZA 3SBTA 4BY9C 1GLEG 4WQ5A 4FL9A 2YCHA 3EE8A 4A2BA 4CZGA 4B1VA 3O1BA 4XEIA 4BRDA 5JLHA 1K9MO 3QBXA 3IFRA 2E8AA 2P9KA 1YF5L 1GLCG 3C65A 4O8UA 4BRPA 1KAZA 3MN5A 3PIPL 4CBUA 3L0QA 2QWNA 2QW9A 1KXPA 1W97L 3C0BA 5MLCQ 3D2EA 3FZMA 1HX1A 3UKUA 3EN9A 1Z05A 5M1KA 3FLCO 4PKGA 5AQQA 3CJ1A 1T3VA 2E2OA 1ZBSA 4YOWA 2WFBA 4YOVA 1MDUB 3F5TA 4MLHA 1OVYA 4H5TA 1BOTO 2Q0RA 1MA9B 3DXKA 1QQNA 2FSNA 3GL1A 3QB0A 3QFPA 5AQOA 1TUUA 2E88A 3E9PA 2WC9A 5E84A 1U6ZA 5HL7L 3WEEA 4ILJA 4IO8A 4K41A 3SAFA 3SK3A 5DM7L 2ITMA 3CQXA 1U2VA 4XH5A 4EFHA 1KQSM 4R79A 5LJWA 2OTLN 3KVGA 5M1OA 3TTDA 3H1QA 3I55N 3AGRA 3VOVA 5AQVA 4M7XA 1VQNN 4C23A 4A59A 4CZEA 5M1PA 2GUPA 1KAXA 4GV6A 3CCQN 3O9QA 2RHKA 1BDGA 2FSKA 3O80A 4JD2A 4JAXA 4BREA 2QWPA 1NGJA 2GWJA 1NM1A 3FZLA 1SAZA 4A5BA 4WFNL 5GADP 2BH1A 1ESVA 3R9PA 3MN7A 3VETA 3CPEA 4BRCA 4NB4A 4H0OA 3G71N 5TKWA 2HBKA 1KC8O 4I6MB 3CCLN 3GOIA 3VEVA 3VTHA 1ATNA 1Y64A 1QHAA 3MWTA 1V4TA 4CD1A 1EO1A 3O8MA 5BN9A 4CZKA 5JMVA 3GE1A 4JKDA 3FZFA 2VGNA 3HOTA 4FSVA 1T6CA 4DQ8A 2P9KB 3Q7CA 3WXIA 5B8HA 5JVHL 5JLFA 3P4IA 4KH4A 3MMVA 2HMPA 2A3ZA 3KHYA 4HWIA 4DHYA 5JVGL 1YJ9N 2NRTA 2AP1A 4CZFA 1Q81O 1K8KB 1WOQA 3HBTA 5ADXH 3CPWM 3D2EB 3GDQA 4JK7A 3UKUB 5M1FA 2VGMA 3O9SA 1JCEA 5CR4A 1DGKN 4DCHA 3CJAA 1HPMA 3LDQA 1YI2N 1T44A 3TSUA 3VPZA 4BRIA 3R1XA 3VGLA 3CJCA 3CETA 3O1WA 3A5NC 3GBTA 4MO5A 3Q7BA 1W2BM 1VQKN 2V51B 2HBJA 3E66A 2D0OA 2QWOA 3JS6A 3WEEB 4B1YB 3FZHA 1T6DA 3CMEN 4BR4A 5LY3A 5AZJA 1M90O 4KBOA 4B1ZA 4FWQA 4IZ9A 5C2FA 2HBMA 4BRMA 2E2QA 4Z94A 2ASOA 5C15A 3S41A 5AFUH 3L4QA 3WQUA 5BR9A 4WYBA 3ZYYX 3CCSN 2AA4A 3I8BA 3OBWA 3ZX0A 4RCHA 4FWKA 4JD2B 5BRFA 3VF2A 3W0LA 4BC5A 4WQ4A 3LDLA 4KH5A 5BPMA 3BUZB 3A5OC 4PKHA 4IOAL 3CC7N 3NVKA 4FWLA 4JKFA 2ZGYA 4OPHA 1VQ4N 5KPZA 5BREA 2HOEA 4J8FA 2W41A 2P9UA 1J6ZA 2Q1NA 5AQHA 5AQZA 1BA1A 4FOIA 4BVOA 1NJIO 1VQ9N 4A61A 1NGFA 5LJVA 1YUWA 3WXMB 1E4GT 2VCPA 1HLUA 2YHWA 4BGBA 3OBYA 4I6MA 1SQKA 5EVZA 3CCVN 2FLOA 3EE9A 4BR2A 2YX6A 1QZ6A 3EL2A 1JCGA 4BC3A 2E2PA 4FOEA 1GLDG 3SMSA 1Q86O 1RDWX 4U67L 4BGAA 3QMLA 3H1VX 1DEJA 1XC3A 3H45C 4WQ4C 3TTCA 4ILHA 3QDKA 1Q7YO 4BR9A 2E1YA 4JK8A 2DPNA 1NMDA 1GLJO 3TPQA 1QQOA 2F9TA 4FWNA 4BRFA 3CF5L 4MDBA 2ASMA 3A0IX 2PFUA 4QS9A 3RVCA 5C0YA 2YI1A 1K8KA 4JHDA 3HI0A 4AM7A 4JKEA 4YORA 1YIJN 4H5VA 5FPNA 2NRXA 2NRWA 4CZIA 3VENA 2IVNA 4NO7A 4BRLA 3PLAA 3UKRA 3VEYA 4NLCA 3QICA 4LC9B 4FVUA 5KPTA 1VQLN 2QWRA 4BC2A 1NGCA 4WQ5C 3G6EN 4DKWA 2ZF5O 1YVNA 3H46O 1HUXA 2UYTA 4FWPA 4YOYA 3WQTA 1P90A 2V7YA 3JXUA 2QA4N 3P39A 1KD1O 1DKGD 5AZJB 1X3NA 3AAQA 4B1XB 2YHYA 4PKIA 2GX9A 3VTIA 2FSJA 3C6AA 1QVGM 1ATSA 5BRDA 5FPEA 5AQSA 3WT0A 2BUPA 3LDPA 4BVPA 4MDAA 3FGUA 3VEWA 3P38A 1EQYA 3MCPA 2CGJA 3UB5A 3U9ZA 4JKBA 3H3OB 1XUPO 5KPRA 1NLVA 3AAPA 4A5AA 3KWIA 1V4SA 2KKZA 3M5RA 1MWKA 3ENBA 2QM1A 3P31A 3F9MA 3ATVA 4K25A 1Z6RA 4CI6A 1RFQA 3LDNA 3MK6A 4IJNA 4F9OA 3K9JA 2P9UB 1XQSC 5BPLA 3K9KA 5I9EB 4WF9L 5H1SQ 3N4QA 4BRHA 1Q18A 5GAHP 3O9TA 1VQ8N 2GELA 2I7PA 3IUCA 3RSEA 4ISEA 3SMPA 5AQKA 2A41A 3B8AX 4XH1A 3D6RA 4M7YA 3LM9A 4FPBA 3FR0A 3E1YA 4Y0WA 4BRGA 1YJWN 4C1NI 3VEZA 3CJ7A 4H0YB 1ATRA 1JJ2M 4WCEL 3I56N 3I33A 3CMAN 4IEIA 4BG9A 4HTLA 3DLLL 3CXCM 2CH5A 3OA9A 3CQYA 1K73O 4JHDB 4IDHA 3SAGA 2ZJQL 4B1UB 4GV9A 3J8AA 4DB3A 5M1NA 1ILYA 2WBNA 1YAGA 3R8EA 3UKRB 4JKHA 2Q97A 5C12A 4FO0A 5ADXA 4EHTA 3HM8A 1VQON 4H5RA 3CC2N 3MCAB 5JICA 2H3GX 1NGIA 1NGHA 3O08A 4IOCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI O;  1VQ9 N;  1YHQ N;  1OVY A;  3CCV N;  3G4S N;  5HL7 L;  1YJN N;  1Q86 O;  5DM7 L;  4U67 L;  1KQS M;  3CCM N;  1Q7Y O;  2OTL N;  3CCJ N;  3I55 N;  3CF5 L;  1VQN N;  2ZJR L;  1YIJ N;  3CCQ N;  3PIO L;  1S72 N;  3CCU N;  1VQL N;  4WFN L;  3G6E N;  1M1K O;  5GAD P;  5GAE P;  1KD1 O;  3G71 N;  2QA4 N;  1N8R O;  1KC8 O;  3CCL N;  1QVG M;  1QVF M;  5DM6 L;  4IO9 L;  2ZJP L;  1VQ7 N;  1K8A O;  5JVH L;  5GAG P;  2OTJ N;  3J7Z O;  5JVG L;  1YJ9 N;  1Q81 O;  1YIT N;  3CPW M;  4WFA L;  1Q82 O;  1VQP N;  5H1S Q;  4WF9 L;  1YI2 N;  5GAH P;  3CC4 N;  1VQ8 N;  3OW2 M;  1W2B M;  1VQK N;  4UY8 O;  1YJW N;  3CME N;  1VQ6 N;  1M90 O;  1JJ2 M;  4WCE L;  4WFB L;  3I56 N;  3CMA N;  1VQ5 N;  3DLL L;  3CD6 N;  3CXC M;  2QEX N;  1K73 O;  2ZJQ L;  3CCS N;  1VQM N;  1K9M O;  1ILY A;  3PIP L;  3CCR N;  4IOA L;  3CC7 N;  1VQO N;  3CC2 N;  5MLC Q;  1VQ4 N;  3CCE N;  4IOC L; 
#chains in the Genus database with same CATH topology
 2V7Z A;  4BDZ A;  3O5B A;  1W9H A;  1IG8 A;  5LMN K;  3QEI A;  1CXQ A;  4BQL A;  1L3U A;  1YHQ N;  4O5F A;  4IOX A;  1C0T A;  2A42 A;  3WXK A;  2GBZ A;  1VSL A;  5HRR A;  2O8D B;  1ZBI A;  5AJ3 K;  3EZW A;  4MLE A;  2IC3 A;  2D5R A;  1IO2 A;  2UXD K;  3U3G A;  5AFU A;  3ID6 A;  1S1V A;  3WNG A;  1ZBL A;  4JI8 K;  1RT3 A;  3KLH A;  1ZYQ A;  3PSF A;  5F2R A;  3PIO L;  1NJW A;  3LZJ A;  1FJG K;  3CCU N;  3RSE B;  4CEZ A;  4FJN A;  3F9K A;  2G8K A;  5HOO A;  5FPM A;  1M1K O;  2PBD A;  5KI6 A;  2HNY A;  3S3M A;  4QS8 A;  4JK9 A;  3C7N B;  4U7B A;  2NZT A;  5EOY A;  3RMC A;  4H0P A;  4KHU A;  2F9W A;  4Z4I A;  3AO3 A;  4DSI A;  1IKW A;  1RT7 A;  5EX5 A;  3NF6 A;  5KQ8 A;  3A8Y A;  3QES A;  1RDC A;  1IKY A;  3OS0 A;  3ENH A;  2D4W A;  3LP1 A;  3L2W A;  5AQY A;  1GLB G;  3CFO A;  2FBV A;  1NOZ A;  2P9L B;  4W5N A;  2NLX A;  4M3W A;  4CVN E;  3HPO A;  1T03 A;  1QQM A;  5J2P A;  4L8R B;  3VER A;  3L2V A;  5AR0 A;  3CJ9 A;  3HSC A;  4LSN A;  5TKY A;  2NUB A;  4LFC K;  5FRM A;  4H0V B;  1RBS A;  3M3Z A;  4CBX A;  3IDH A;  3PSI A;  3ZT1 A;  2XHB A;  1IKX A;  1RDU A;  3M8R A;  5FRN A;  1VSM A;  4JEP A;  1RBU A;  4MO4 A;  4GV3 A;  1VQM N;  3EO3 A;  3BZC A;  4GNI A;  2P51 A;  3HXM A;  2OPS A;  1IBM K;  2HHT A;  1Q8I A;  3IMX A;  1SZ2 A;  3A5M C;  2HF3 A;  3QFU A;  4CJP A;  4LSL A;  4CJT A;  5BR8 K;  3CIP A;  3C7N A;  3VES A;  2D0C A;  3C6T A;  2GV9 A;  1T05 A;  1NGA A;  4AF1 A;  1NOY A;  3TAE A;  1QTM A;  1RTJ A;  3MX2 A;  1LV5 A;  1JLF A;  1S3X A;  3G4S N;  3U4L A;  1C0F A;  3DAW A;  3MN9 A;  3KKR A;  5AQM A;  3P1G A;  2P9I A;  4LF5 K;  4JKG A;  2UUB K;  4CED A;  3S3N A;  3L4I A;  4N5S A;  4H5N A;  4OPJ A;  5AQL A;  3THV A;  4FK4 A;  4FWR A;  3DRR A;  3D7E O;  2YKM A;  1R59 O;  4ZHR A;  1TYQ B;  3SZ2 A;  1YTA A;  4CIG A;  5SWM A;  5HP1 A;  5FLX O;  5ELZ A;  1S1T A;  1S1X A;  3MX5 A;  3H3N O;  3DXK B;  2A1S A;  4CK1 A;  3HZ6 A;  2HST A;  4DTJ A;  1U2V B;  1SL2 A;  3SYZ A;  1VSI A;  2YHB A;  3L2U A;  4Z4E A;  1Y97 A;  1C0M A;  4BRQ A;  3J80 O;  4CHY A;  1WLJ A;  4CJE A;  2YHA A;  5LMU K;  1EX4 A;  3SQ0 A;  4H4M A;  3SBG A;  5CYM A;  4OO1 J;  3HRG A;  5BN8 A;  2WTU A;  3T19 A;  3OHR A;  1C0G A;  4FWS A;  4H03 B;  3K0S A;  2GWK A;  4NXN K;  3QET A;  4F2R A;  4CBW A;  4GVM A;  5C2D A;  5C10 A;  1QSL A;  4Y1D A;  2ASP A;  2HBL A;  2OA8 A;  1KFD A;  2IS3 A;  4DFK A;  2QI2 A;  4DS4 A;  1VQ6 N;  4RW9 A;  3LDO A;  3NMU A;  2O8C A;  3QEW A;  4OPK A;  3EE8 A;  4BRD A;  2W6L A;  3OS1 A;  4B9L A;  1K9M O;  2IAJ A;  1YF5 L;  3C65 A;  1KAZ A;  3MN5 A;  4CBU A;  4JRQ A;  1KXP A;  2RN2 A;  1W97 L;  4FCY A;  3CM6 A;  1HJR A;  3KLF A;  4JV5 K;  1FKP A;  2VWJ A;  3FLC O;  4FM2 A;  2E2O A;  2HB5 A;  4YOW A;  4YOV A;  3AO1 A;  1MA9 B;  3DXK A;  4JI4 K;  3QB0 A;  3QFP A;  4KKO A;  5AQO A;  2WC9 A;  5HL7 L;  4AHV A;  4IO8 A;  4K41 A;  4CJV A;  4I9Q A;  1U2V A;  5HRS A;  3V9W A;  4R79 A;  1EWR A;  4CJL A;  1I94 K;  5M1O A;  3WNH A;  4JRP A;  4M7X A;  4DLE A;  4OX9 K;  4A59 A;  2IGI A;  5M1P A;  3JSM A;  5J2M A;  3S9H A;  2XY5 A;  1SKR A;  3CCQ N;  3O9Q A;  1X1P A;  2RHK A;  2FSK A;  4JD2 A;  4KHW A;  4CIF A;  1N6Q A;  2GWJ A;  3NF7 A;  4E7J A;  3FZL A;  4A5B A;  4WFN L;  1HNX K;  4GMJ B;  4X66 K;  3QLH A;  3V1R A;  4I6M B;  1JLC A;  3AO4 A;  3CCL N;  4DFM A;  1UA0 A;  4KHN A;  2DFE A;  4FSV A;  1T6C A;  3EZ5 A;  4DU4 A;  1BQM A;  2HVH A;  4KH4 A;  4HWI A;  5JVG L;  1YJ9 N;  1Q81 O;  2NRT A;  2AP1 A;  3HBT A;  5ADX H;  3CPW M;  3CQ8 A;  1ZBF A;  3GDQ A;  4AQY K;  2IDO A;  5M1F A;  1NKE A;  4HCC A;  4CEE A;  1TAU A;  3UIQ A;  4AHS A;  3TSU A;  1YVU A;  4C8L A;  2HHH K;  3GBT A;  1TK5 A;  2V51 B;  2HBJ A;  3AA2 A;  3P5J A;  3JS6 A;  3WEE B;  2D0A A;  5CYQ A;  5K14 A;  5AZJ A;  4CW7 B;  4FWQ A;  4BRM A;  5CZ2 A;  3G10 A;  3THW B;  4WE1 A;  4M3T A;  3WQU A;  3ZYY X;  2AA4 A;  3I8B A;  3ISN C;  3TAB A;  2KZM A;  3QNO A;  3LDL A;  5BPM A;  4F2S A;  4PKH A;  4CGJ A;  1RDD A;  1TK8 A;  3CC7 N;  4FWL A;  2FBX A;  4ID1 A;  1VQ4 N;  5BRE A;  4JI5 K;  2P9U A;  5AQH A;  2Q1N A;  4HUF A;  4FM0 A;  3QER A;  4I6M A;  1WAF A;  3DLE A;  1QZ6 A;  3K2P A;  4FOE A;  3L8B A;  1WB9 A;  3V1Q A;  4BGA A;  1DEJ A;  4M41 A;  3AVG A;  3H45 C;  4O4G A;  4JK8 A;  1D9D A;  1RT5 A;  1QQO A;  2F9T A;  1BQN A;  5J2Q A;  3A0I X;  5C0Y A;  2YI1 A;  4DTP A;  4JKE A;  4H5V A;  3SI6 A;  1FKO A;  3KD5 E;  2NRX A;  4CZI A;  4FZY A;  1RTD A;  4O0I A;  2IVN A;  4IBN A;  1KVB A;  4DF4 A;  3QIC A;  2QWR A;  4BC2 A;  3ZT4 A;  4N56 A;  1NGC A;  3I8D A;  1TKD A;  4CJ3 A;  5HLF A;  3H46 O;  1HUX A;  4EP4 A;  4YOY A;  1KD1 O;  3OY9 A;  3P39 A;  3AAQ A;  2FSJ A;  3C6A A;  5BRD A;  5FPE A;  1B92 A;  3U3Y A;  3WT0 A;  4MDA A;  3FGU A;  3OYB A;  2O8E B;  2BE2 A;  4IDK A;  1VHX A;  3PX6 A;  3U9Z A;  3THW A;  3H3O B;  4A5A A;  5C42 A;  3DLG A;  4CES A;  2KKZ A;  3NH1 A;  3ENB A;  2QM1 A;  3P31 A;  3F9M A;  3ATV A;  2KQ2 A;  4CI6 A;  1TL3 A;  3S3O A;  5IWA K;  1R0A A;  3WNF A;  1LWF A;  1XQS C;  3T3F A;  3THX B;  5I9E B;  1N5Y A;  4C8O A;  4B3R K;  1VQ8 N;  1S6P A;  3ZSV A;  2I7P A;  4E7H A;  3SMP A;  5AQK A;  4DV1 K;  3B8A X;  4FPB A;  2PYL A;  1Z25 A;  4CJR A;  4RG8 A;  3CJ7 A;  4BAC A;  3I56 N;  3CMA N;  3DLL L;  4FJK A;  2CH5 A;  4X62 K;  4GV9 A;  3CFP A;  4B1U B;  4HUG A;  1RT2 A;  3OYK A;  1EP4 A;  4FJI A;  3AVL A;  5C12 A;  3T1H K;  4CFD A;  3ZLJ A;  1S6Q A;  2H3G X;  1N36 K;  1CZ9 A;  3VQ9 A;  3O08 A;  2UU9 K;  3RWU A;  1ZC6 A;  2IIR A;  2Q2R A;  3FZK A;  2Z1J A;  1NBW A;  4J2A A;  2DTU A;  4OLA A;  1S1U A;  2RPI A;  1YXQ A;  3JAM O;  3BP8 A;  5GIO A;  2VYP A;  1YJN N;  2JWK A;  2O8E A;  1C0U A;  4M3R A;  2OAN A;  3ZEU B;  2W6K A;  1E4F T;  2E1Z A;  2JGU A;  4E89 A;  1GLA G;  3HTV A;  3VQE A;  3CJB A;  3M1F A;  4ELT A;  1C1A A;  1HKB A;  1ZBU A;  5JS2 A;  4H5W A;  3HP9 A;  2FBY A;  1U48 A;  2E20 A;  3HOS A;  2XY6 A;  4BRK A;  2QKK A;  3VMF B;  3KIO A;  1JCF A;  3U9D A;  1I3A A;  2ZGZ A;  4IXC A;  4DFP A;  1XMQ K;  2F4V K;  2F96 A;  4KB1 A;  1NGE A;  3OYH A;  3O3G A;  1D8Y A;  3F73 A;  4RTF D;  2HHU A;  5GAE P;  2QWM A;  3D45 A;  2O8B B;  3O4N A;  3MAQ A;  2WUS A;  3LM2 A;  4CEF A;  5DM6 L;  3DJC A;  4M45 A;  3NH2 A;  1Z26 A;  5AQF A;  3AAR A;  4N47 A;  4IO9 L;  3BZK A;  4RWT A;  5AQI A;  2IVO A;  1DLO A;  2VG7 A;  3O4W A;  3TWH A;  4KHS A;  4I2P A;  1WBD A;  4NYF A;  2KLA A;  4KO0 A;  4O0J A;  4FLV A;  1UA1 A;  3R3L A;  4YOU A;  1YT3 A;  3AA4 A;  3DRP A;  2G8H A;  3A5L C;  1X3M A;  3AY9 A;  3WUH A;  1SV5 A;  5BPN A;  3E9O A;  4A62 A;  2J4R A;  2X74 A;  1NK0 A;  3M8S A;  1GLL O;  4DQR A;  1RBT A;  2X78 A;  4IKF A;  3ENO A;  3IKM A;  2KFN A;  1HNW K;  3FE1 A;  4CGH A;  3RR7 A;  1XNR K;  3ZEU A;  3F2K A;  2CGK A;  3ATU A;  4HTU A;  1HKC A;  5DMR A;  3T1A A;  5AQP A;  2QWL A;  3O6W A;  4LD0 A;  4DFJ A;  2ETJ A;  4H0X B;  2HHW A;  4QS7 A;  3ZX3 A;  2VQF K;  4JI0 K;  3DI6 A;  2W42 A;  4I7F A;  3NGZ A;  3QBW A;  4W5Q A;  3TAG A;  2O8B A;  5AQT A;  3H6E A;  3AVB A;  3HT3 A;  4FWO A;  2KHO A;  4FWM A;  5AQW A;  1BIZ A;  1WUA A;  4C8M A;  1XNQ K;  1REV A;  2Y1I A;  1S22 A;  1HNV A;  3KWG A;  3CER A;  4PHT X;  3KK7 A;  3T69 A;  1X9M A;  5KRS A;  2YNI A;  4Q5V A;  3B6O A;  4JI7 K;  2CH6 A;  2YV0 X;  4AM6 A;  1LWC A;  2YHX A;  1GLF O;  2D1K A;  2ZD1 A;  3RRH A;  3NF9 A;  3OJS A;  1T7P A;  4BRO A;  1NGG A;  3HVT A;  3T7Z A;  4H4O A;  4Q0B A;  5KTQ A;  2E2N A;  5AQJ A;  2NRV A;  1Q9X A;  3BEX A;  4CGF A;  5GIN A;  3HST B;  5KGX A;  4JLH A;  4IFE A;  3SJH A;  3VGM A;  4CHP A;  3MEG A;  4JNE A;  3AA5 X;  3TR8 A;  3VQC A;  4CEB A;  3G25 A;  3J7Z O;  5KQD A;  3TTF A;  2I7N A;  1RT1 A;  2UUC K;  1NK9 A;  3AVN A;  1BGX T;  1D4X A;  1TUY A;  1G99 A;  2NRR A;  4RW6 A;  1Q82 O;  3ZT2 A;  3OYF A;  3K59 A;  3V9X A;  4BR5 A;  2EWS A;  1WN7 A;  4HHT A;  4B1W B;  3OW2 M;  1A5W A;  2ZWH A;  3AVA A;  4NCG A;  3MXI A;  4CZM A;  2F7T A;  1VSH A;  4CK3 A;  4GKJ K;  3AVC A;  2P9I B;  1SUQ A;  4JKG B;  1OH6 A;  2NNW A;  4EHU A;  2ZQB A;  3B6P A;  2YJE A;  4JI2 K;  1E3M A;  3R6M A;  1NU0 A;  1KAY A;  4HCB A;  3DLR A;  2QEX N;  1VAZ A;  3SBT A;  1GLE G;  4WQ5 A;  4DTN A;  4FL9 A;  1MU2 A;  4CZG A;  2QXF A;  3IFR A;  4HUE A;  3PIP L;  1GLC G;  3NF8 A;  2VQE K;  1S9E A;  3O3F A;  1NK4 A;  4K8Z A;  3C0B A;  5MLC Q;  3NFA A;  3FZM A;  1HX1 A;  4JI1 K;  3EN9 A;  3TAN A;  2G8F A;  4FJL A;  3MEC A;  2HW3 A;  5AQQ A;  1NJZ A;  1ZBS A;  3I0R A;  2WFB A;  4FZZ A;  1MDU B;  4H5T A;  4RW8 A;  1RTH A;  4J2E A;  3MXJ A;  5E84 A;  3H08 A;  4KHY A;  3SAF A;  3AVM A;  2HMI A;  3CQX A;  4XH5 A;  4OGE A;  3SPY A;  3H1Q A;  3VOV A;  2GUI A;  1VQN N;  1WAJ A;  4AHR A;  2R7Y A;  2GUP A;  1KAX A;  4FJ9 A;  3ULD A;  2E6L A;  2OPP A;  4YNQ A;  2QWP A;  4M3U A;  4CFA A;  1NM1 A;  1TVR A;  1SAZ A;  1JLB A;  1GOB A;  1ESV A;  5CZ1 A;  3OYC A;  3R9P A;  1EKE A;  4BRC A;  3CPE A;  3SPZ A;  4NB4 A;  1YTU A;  2O8F A;  3G71 N;  4IFY A;  3C6U A;  4DUZ K;  3VTH A;  2O8C B;  1Y64 A;  1EO1 A;  1JLQ A;  4B9N A;  3O8M A;  3GE1 A;  3FZF A;  3ZT0 A;  3HOT A;  4DQ8 A;  3Q7C A;  5B8H A;  1BI4 B;  3WXI A;  3SQ1 A;  2BDP A;  1IH7 A;  3P4I A;  4N41 A;  2HMP A;  3KHY A;  4CZF A;  1ZBH A;  5HRN A;  1BHL A;  1ASU A;  1S5J A;  1XWL A;  4JK7 A;  2VGM A;  2JLE A;  3SV3 A;  3AVF A;  1DGK N;  4DCH A;  4BRI A;  4F4K A;  1UAX A;  4E7I A;  4O44 A;  4B3M K;  2Q3S A;  3A5N C;  1W2B M;  1JL1 A;  1D9F A;  4DV6 K;  2KZZ A;  2YKN A;  2D0O A;  3TAF A;  1RDB A;  1Q9Y A;  2QWO A;  4B1Y B;  2HHQ A;  1NK6 A;  1T6D A;  4BR4 A;  5LY3 A;  3M8Q A;  1M90 O;  1J5E K;  3SV4 A;  4KBO A;  4NCB A;  3JYT A;  1LAV A;  4IZ9 A;  5C2F A;  2HBM A;  5JS1 A;  2E2Q A;  5C15 A;  3L4Q A;  4CF0 A;  4CF2 A;  2ATQ A;  3CCS N;  3OBW A;  2B6A A;  4DV2 K;  4ZTJ A;  4RCH A;  4FWK A;  4DR2 K;  4JD2 B;  4CIE A;  5BRF A;  4OVL A;  3V9Z A;  2IOC A;  3A5O C;  3BUZ B;  1WSI A;  4JKF A;  3NGI A;  4OPH A;  2UUA K;  1JLE A;  2HOE A;  2W41 A;  4BVO A;  1J6Z A;  1VQ9 N;  4A61 A;  5LJV A;  2OYQ A;  1YUW A;  1E4G T;  1VSF A;  4B9M A;  3OBY A;  4ZTF A;  5EVZ A;  1DTT A;  3EE9 A;  4EZ6 A;  2YX6 A;  1JCG A;  2UXC K;  1GLD G;  3SMS A;  1Q86 O;  1RDW X;  3ZSZ A;  5A2Q O;  2G8V A;  4KTQ A;  1Q7Y O;  4BR9 A;  1BI4 A;  4BRF A;  4FWN A;  4MDB A;  1HPZ A;  4FLW A;  2PFU A;  1SL1 A;  4JHD A;  3HI0 A;  4AM7 A;  4YOR A;  4DG1 A;  2OCE A;  1U47 A;  3VEN A;  3SNN A;  3ZSX A;  3PLA A;  4BRL A;  3VEY A;  4FVU A;  2G8I A;  1J53 A;  4DKW A;  1N34 K;  2UYT A;  2V7Y A;  3QEP A;  5AZJ B;  1NK7 A;  3VTI A;  4TSX A;  3LPU A;  1ATS A;  3KLE A;  4CJQ A;  2BUP A;  4C8K A;  2XY8 A;  3MCP A;  1WSH A;  2CGJ A;  2Z1H A;  3UB5 A;  1ITG A;  1NLV A;  3AAP A;  3PV8 A;  4O55 A;  1BL3 A;  3M5R A;  1MWK A;  4KFB A;  1Z6R A;  2EX3 A;  4CJF A;  1RFQ A;  3MK6 A;  1L3V A;  4IJN A;  4GKK K;  1IBL K;  2P9U B;  1O1W A;  1J54 A;  3N4Q A;  3O9T A;  3IUC A;  4B9S A;  1QS4 A;  5HBM A;  4NCA A;  3D6R A;  3LM9 A;  4BRG A;  3OYM A;  2FBT A;  4HTL A;  4CFC A;  3PY8 A;  4FYD A;  1QSY A;  1KVA A;  3SAG A;  4B8C A;  4OJR A;  2WBN A;  4DR4 K;  4DUY K;  4KAZ A;  5ADX A;  4EHT A;  3HM8 A;  4H5R A;  3MCA B;  3RMA A;  1NGH A;  4W5T A;  1UWB A;  3EEQ A;  2QXL A;  4CHQ A;  2HHX A;  4A57 A;  4RW4 A;  4LH5 A;  1NKB A;  1KRP A;  4LFB K;  5C24 A;  4JKA A;  3ALY A;  4DV7 K;  4LF9 K;  3TSQ A;  2VWK A;  1HYS A;  3VGK A;  4LF4 K;  3BF3 A;  3CHW A;  2NRH A;  4BRN A;  3L6Q A;  4PWD A;  4QOZ B;  4DSJ A;  3SAH A;  4FJJ A;  3GG4 A;  5AQU A;  4B3O A;  2P9P A;  1EWQ A;  2BTF A;  4YDU A;  1U49 A;  2O4G A;  2VWB A;  3DM2 A;  4NXM K;  1TL1 A;  3NE6 A;  3D2F A;  4AHC A;  1TKX A;  4CE9 A;  4CGD A;  4IG3 A;  5AZI A;  3OYI A;  2FF3 B;  4CZJ A;  3NAE A;  3ID8 A;  2YJF A;  4IG0 A;  2X6S A;  1K6Y A;  4YDU C;  2PY5 A;  3IAY A;  4IJA A;  1K8A O;  3TU5 A;  1H1V A;  1SS6 A;  4AHU A;  3C6H A;  2HND A;  5GAG P;  2RKI A;  1HYZ A;  2D0P A;  5AQX A;  1XHZ A;  3VQ6 A;  5F0X A;  4OLB A;  5D3G A;  4LF8 K;  2KW4 A;  4KTZ A;  1RGI A;  5IT9 O;  5AQN A;  3CC4 N;  1DT9 A;  4CHZ A;  1NGD A;  5BRH A;  2Q31 A;  4H0T B;  4DLG A;  1HJO A;  2QK9 A;  3ZCM A;  4GVE A;  1B9D A;  3AGK A;  3SQ2 A;  3CD6 N;  1HNZ K;  1NGB A;  4O8K A;  3QIN A;  1F21 A;  4YY3 K;  1CZA N;  1HR0 K;  2A40 A;  3C95 A;  4DV0 K;  2NRZ A;  4DR6 K;  4ISG A;  5E26 A;  3RR8 A;  3SCX A;  1XI1 A;  1SL0 A;  2FC0 A;  1BG3 A;  4H8K A;  1VSD A;  3K5L A;  3CCM N;  4CEO A;  1HKG A;  4DSF A;  4M42 A;  2Z1G A;  2ZJR L;  3SLC A;  2XO7 A;  3KK1 A;  4FJH A;  4LF7 K;  3VF6 A;  1LCU A;  3DWL A;  1WNS A;  5CHI A;  1VK0 A;  5F1X A;  1O13 A;  1BU6 O;  4YOT A;  1RBV A;  4ILG B;  4YOX A;  3WXJ A;  3K5O A;  1QVF M;  4EAH D;  3EKU A;  4XH4 A;  3OYN A;  2ZJP L;  3ZX2 A;  1RTI A;  3THY A;  3LWM A;  4BC4 A;  4CJU A;  1OKJ A;  4DQQ A;  3VEX A;  1NJY A;  2OTJ N;  1SKS A;  4CF8 A;  2HF4 A;  4IEE A;  1N33 K;  4OPA A;  4B9Q A;  5CE3 A;  1VQP N;  4R5P A;  4PQU A;  4GY2 B;  3KZB A;  2CGL A;  2DFF A;  3WXL A;  2B5J A;  4BDY A;  4C1N K;  4YHH K;  4FPA A;  4FW1 A;  3AVI A;  1JLG A;  1HNI A;  3AO5 A;  4B9T A;  1U45 A;  3RTV A;  4MFB A;  3SQ4 A;  1NWK A;  2OZS A;  4A2A A;  2GEM A;  2RE2 A;  2V52 B;  4KB0 A;  4I2Q A;  2YCH A;  4CGG A;  4B1V A;  3O1B A;  4XEI A;  4CF1 A;  4IFV A;  5JLH A;  3TAP A;  4F3O A;  3QBX A;  2PZS A;  2P9K A;  4O8U A;  4BRP A;  3L0Q A;  2QWN A;  4N76 A;  3V6D A;  1KVC A;  3D2E A;  3UKU A;  1Z05 A;  3KJV A;  4M3Y A;  1VSE A;  5FRO A;  3LAM A;  4FLU A;  4PA1 A;  4DS5 A;  1EXQ A;  1OVY A;  1BOT O;  2Q0R A;  2DY4 A;  1QQN A;  2FSN A;  3GL1 A;  2E88 A;  3E9P A;  4BWJ A;  1WSG A;  4FLZ A;  3AO2 A;  5DM7 L;  2KFZ A;  1KQS M;  4EFH A;  2OTL N;  1TAQ A;  3KVG A;  3SJJ A;  1LW2 A;  3AGR A;  1OH7 A;  5AQV A;  4C23 A;  1KSP A;  3DRS A;  4K8X A;  1RIL A;  4JS4 A;  3QIP A;  3NBP A;  1T8E A;  4FW2 A;  3BGR A;  4E1N A;  3D0P A;  3O80 A;  1BDG A;  4JAX A;  4BRE A;  1B9F A;  4Y1C A;  4UQG A;  3TAR A;  5GAD P;  3OYJ A;  4Z4C A;  3MN7 A;  4H0O A;  3LWL A;  5TKW A;  2HBK A;  1KC8 O;  4KRF A;  3GOI A;  3KK2 A;  4FZX C;  1L5U A;  5I42 A;  1QHA A;  1V4T A;  3VQ7 A;  2YNH A;  3M8P A;  4CD1 A;  3K5M A;  4DQP A;  2A1R A;  4JKD A;  4FJM A;  2VGN A;  4E0D A;  1I39 A;  4DHY A;  3VA0 A;  2A3Z A;  1QSS A;  4B08 A;  1K8K B;  5KRT A;  2HNZ A;  5CR4 A;  3LDQ A;  1YI2 N;  3VPZ A;  1JXB A;  3R1X A;  3VGL A;  3O1W A;  3CET A;  2DFH A;  5EU7 A;  4Z0U A;  4FJX A;  1XMO K;  3CME N;  3PX4 A;  4EZ9 A;  4B1Z A;  3LAL A;  2ASO A;  4CFB A;  3P83 D;  5AFU H;  4CHN A;  2O4I A;  5BR9 A;  1C6V A;  3ZX0 A;  3PO5 A;  3L2R A;  4FJ5 A;  4BC5 A;  4M3X A;  4WQ4 A;  4FXD A;  4IOA L;  4DV4 K;  5CY4 A;  1BCO A;  5KPZ A;  4J8F A;  2O8F B;  3WXM B;  2VCP A;  2YHW A;  4BGB A;  1SQK A;  1N32 K;  3T1Y K;  3HJF A;  2E2P A;  1C1C A;  3QML A;  3NGY A;  3LPT A;  2E6M A;  4WQ4 C;  3TTC A;  4ILH A;  3QDK A;  4DQI A;  1KTQ A;  4G1Q A;  3K58 A;  1JLA A;  4C8N A;  2ASM A;  3RVC A;  1NG9 A;  2E4L A;  1K8K A;  3J7A P;  2BAN A;  2LSN A;  3MXM A;  5FPN A;  4FJG A;  2Z1I A;  4FK0 A;  4NO7 A;  3OS2 A;  3UKR A;  3ZSO A;  2ZE2 A;  5KPT A;  3ZT3 A;  1VQL N;  4WQ5 C;  4FJ8 A;  3J7Y P;  4DTM A;  1YVN A;  4ELU A;  4FWP A;  3WQT A;  3JXU A;  2QA4 N;  1DKG D;  1RBR A;  1OH5 A;  3ZSW A;  4B1X B;  2YHY A;  2GX9 A;  5AQS A;  3LDP A;  2B4J A;  2O8D A;  3KWI A;  1V4S A;  5J1E A;  4DTX A;  2PYJ A;  4OKE A;  4K25 A;  4LFA K;  3L3V A;  4F9O A;  4CEQ A;  4DSK A;  1HQU A;  3K9K A;  5H1S Q;  4WF9 L;  4CJ4 A;  1RT4 A;  4BRH A;  1Q18 A;  5GAH P;  3PUF A;  3O4Q A;  4CGI A;  1JKH A;  4I9L A;  5DK5 A;  4W5O A;  3RSE A;  3BDP A;  3KLG A;  3OTO K;  4XH1 A;  4M7Y A;  3E1Y A;  4Y0W A;  1A5X A;  1YJW N;  3CG7 A;  4CER A;  4C1N I;  3U6F A;  3AVJ A;  3VEZ A;  3DMJ A;  1ATR A;  1JJ2 M;  4WCE L;  2F8T A;  4DV5 K;  3LP0 A;  4BG9 A;  1LWE A;  4W5R A;  3TAQ A;  4DR1 K;  1K73 O;  4JHD B;  2ZJQ L;  2OPQ A;  5M1N A;  3VQB A;  4JKH A;  1C1B A;  3CC2 N;  4RW7 A;  1NGI A;  4IOC L;  3DOL A;  4Z4H A;  1ZXO A;  1A5V A;  1ASV A;  3OYA A;  4BR0 A;  4ICL A;  3WNE A;  1L3S A;  2P9L A;  4IWV A;  3TI0 A;  3CFR A;  5FPD A;  1VRU A;  2IVP A;  4FM1 A;  2QWQ A;  3CI5 A;  1XC9 A;  1S1W A;  4E1J A;  1P8Z A;  2P5G A;  4V19 S;  5EXW A;  1JXE A;  3SUP A;  2QKB A;  3V9S A;  2WON A;  3VQP A;  2E5L K;  4BRA A;  5LL6 Z;  3HK2 A;  4KI6 A;  3E01 A;  1BA0 A;  2Q36 A;  3G0Z A;  4JYA K;  2FF6 A;  2GTD A;  3ULE B;  1BO5 O;  3VEO A;  3IS9 A;  4CJS A;  5AQG A;  4K42 A;  4KRE A;  1IJJ A;  3MDQ A;  4O5B A;  1IKV A;  4CD3 A;  1TGO A;  3QEX A;  4PL7 A;  2P9S B;  2RF2 A;  3RRG A;  2F8S A;  2YNF A;  1VQ7 N;  4AH9 A;  2W40 A;  4FJ7 A;  1MWM A;  4B9U A;  1TKZ A;  2AJQ A;  1BIU A;  4DMN A;  1YIT N;  4DV3 K;  4CCH A;  2Q0U A;  4LH4 A;  2A5X A;  1KLN A;  1NKC A;  1NJX A;  2FXU A;  3V9U A;  2WOM A;  1TYQ A;  3AVK A;  4UY8 O;  4DWI A;  3O9U A;  3ZET B;  3NH0 A;  3W3D A;  3VQQ A;  4CZH A;  3AA3 A;  1KFS A;  4XIU A;  3QNN A;  3QEV A;  1LW0 A;  1SKW A;  4B3T K;  1VQ5 N;  5M1Q A;  3VQ8 A;  4M63 C;  4CJ7 A;  3DYA A;  4G9Z A;  3LDS A;  4MQ3 A;  2P9P B;  4BWM A;  1RCH A;  4JKC A;  2VG5 A;  1RDA A;  3TSP A;  3CCR N;  3AVH A;  4YFU A;  5HRO A;  3IG1 A;  3D2F B;  1HQE A;  3ULE A;  4ISF A;  3CCE N;  2PAV A;  4K43 A;  5AZI B;  2P9N B;  5FDL A;  1KLM A;  4FLT A;  3DXM B;  3E9L A;  4FLX A;  3ZSY A;  1BWF O;  4CEC A;  3C94 A;  3M6G A;  2P9S A;  1WBB A;  2VG6 A;  3VQ5 A;  3BY5 A;  3SUN A;  3CCJ N;  2OZM A;  4L3Q A;  5GIP A;  3MWP A;  3NVM A;  2OPR A;  1BIS A;  1S72 N;  4QCL A;  1NNE A;  2JWL A;  4PUO A;  3ZSQ A;  5EY4 A;  4DR7 K;  3FFI A;  4CZL A;  3U8X A;  1W7A A;  4EIA A;  3MED A;  4LF6 K;  3ZET A;  4CJW A;  1N8R O;  1NK5 A;  3HYF A;  4KV8 A;  3VF4 A;  3N4P A;  2ZM6 K;  4JN4 A;  4DF8 A;  4BG8 A;  1QZ5 A;  4KH6 A;  3OYD A;  3VA3 A;  3TAM A;  5E41 A;  2A6A A;  3FFK B;  3UE5 A;  5C25 A;  5J2N A;  1QE1 A;  2QTD A;  1X9S A;  1NK8 A;  4BQZ A;  3RMB A;  4Z4G A;  3LL3 A;  4NLB A;  4WFA L;  1LOT B;  3HVR A;  3QIO A;  1NMN A;  3AV9 A;  4BR7 A;  4E1M A;  4JI6 K;  2P9N A;  3EKS A;  4OKJ A;  5I3U A;  3DXM A;  3DLB A;  1OVQ A;  4ID5 A;  4DTO A;  2G8W A;  4KHQ A;  3OVN A;  3ZSR A;  4X64 K;  5AQR A;  3BF1 A;  3LP3 A;  2EHG A;  3MN6 A;  3O9R A;  4FVM A;  2UXB K;  1FW6 A;  4WFB L;  4PL8 A;  1BUP A;  1GOA A;  1X9J A;  4K0K K;  1W0H A;  2P1J A;  3V81 A;  4BY9 C;  2ITG A;  3DLK A;  1VSK A;  4A2B A;  3NDK A;  4CHO A;  5SZT A;  5KGW A;  4B9V A;  2E8A A;  4CK2 A;  2QW9 A;  3SUQ A;  3OYL A;  2XY7 A;  4DR5 K;  5M1K A;  2HVI A;  1RNH A;  1CXU A;  3EYZ A;  2HHS A;  4PKG A;  3CJ1 A;  1T3V A;  4ELV A;  3J81 O;  3F5T A;  4MLH A;  4CF9 A;  1TUU A;  1QHT A;  3L2Q A;  1G15 A;  1U6Z A;  3WEE A;  4ILJ A;  3K57 A;  4CJ5 A;  3SK3 A;  2ITM A;  3THY B;  4GW6 A;  4CJK A;  3PX0 A;  5LJW A;  3I55 N;  3TTD A;  1OH8 A;  1L3T A;  1GOC A;  4CZE A;  4GV6 A;  3HPH A;  4BE0 A;  4DTR A;  1NGJ A;  4DTU A;  1EET A;  2BH1 A;  3KKS A;  2KTQ A;  5HRP A;  3K5N A;  4BE2 A;  3VET A;  3LAN A;  4KTW A;  3HP6 A;  4M3Z A;  3VEV A;  1IBK K;  1ATN A;  3MWT A;  5T7B A;  4DU3 A;  5BN9 A;  4CZK A;  5JMV A;  1XHX A;  4J2D A;  4QAG A;  2P9K B;  5JVH L;  3HO1 A;  5JLF A;  4E7L A;  1BCM A;  3MMV A;  3MEE A;  4E3S A;  3VQA A;  1WOQ A;  3D2E B;  1UOC A;  1U4B A;  3UKU B;  4HVJ A;  3KK3 A;  4EP5 A;  3O9S A;  1JCE A;  3CJA A;  1HPM A;  3ITH A;  1T44 A;  4DU1 A;  4DR3 K;  1FXX A;  4E19 A;  2XRI A;  3CJC A;  4MO5 A;  1RT6 A;  3Q7B A;  4DQS A;  4DTS A;  1VQK N;  3E66 A;  1JL2 A;  1QQC A;  3FZH A;  1WSJ A;  1VSJ A;  4OGC A;  3HL8 A;  1VRT A;  4J2B A;  1HMV A;  4Z94 A;  4KI4 A;  1FK9 A;  3S41 A;  4DSE A;  4WYB A;  1LAW A;  3VQD A;  1X9W A;  4BE1 A;  3SUO A;  4KHP K;  3VF2 A;  3NCI A;  3W0L A;  4KH5 A;  4E7K A;  1J9A A;  4Z4F A;  2HHV A;  3NVK A;  4PY5 A;  2ZGY A;  5AQZ A;  1BA1 A;  4FOI A;  1NJI O;  3THX A;  4FK2 A;  1NGF A;  4CEA A;  1HLU A;  3KTQ A;  3CCV N;  2FLO A;  1S9G A;  4BR2 A;  3EL2 A;  4BC3 A;  3VN5 A;  1U04 A;  4U67 L;  3H1V X;  1XC3 A;  4FLY A;  4B3S K;  1WSE A;  1J5O A;  1ASW A;  2E1Y A;  3TPQ A;  2DPN A;  1NMD A;  1GLJ O;  2D0B A;  3CF5 L;  3LP2 A;  1IG9 A;  4QS9 A;  3CYM A;  4F3T A;  1YIJ N;  4AHT A;  2NRW A;  1HRH A;  3ASM A;  1TKT A;  4NLC A;  4LC9 B;  4LY7 A;  3G6E N;  3KD1 E;  2ZF5 O;  3EY1 A;  3CM5 A;  1P90 A;  1X3N A;  1IV0 A;  4PKI A;  1QVG M;  3V1O A;  4BVP A;  3A2F A;  3VEW A;  3P38 A;  1EQY A;  3HPG A;  3RMD A;  3QO9 A;  4JKB A;  4JI3 K;  1XUP O;  5KPR A;  4AIL C;  4F8R A;  3I0S A;  3V4I A;  3PO4 A;  3IRX A;  3LDN A;  4BDP A;  4KPY A;  1TK0 A;  3K9J A;  1HYV A;  2Y1J A;  3LAK A;  5BPL A;  2X6N A;  1TV6 A;  3DOK A;  2GEL A;  4DSL A;  4ISE A;  1CZB A;  3L3U A;  2A41 A;  3VQ4 A;  1KCF A;  3FR0 A;  1WSF A;  4NYN A;  4B8A B;  2G8U A;  1CLQ A;  4H0Y B;  3KLI A;  3I33 A;  4IEI A;  3DLH A;  3CXC M;  3OA9 A;  3OYE A;  3OYG A;  2I5J A;  3CQY A;  3NHG A;  4IDH A;  2P5O A;  2BGG A;  4OKK A;  3J8A A;  4DB3 A;  1DTQ A;  1D5A A;  4X65 K;  4JS5 A;  1ILY A;  3OJU A;  1YAG A;  3LZI A;  3R8E A;  3UKR B;  2Q97 A;  4FO0 A;  3O3H A;  1VQO N;  5JIC A;  2YNG A;  3HM9 A; 
#chains in the Genus database with same CATH homology
 2V7Z A;  3O5B A;  1ZC6 A;  1ZXO A;  2IIR A;  2Q2R A;  2QXL A;  3FZK A;  1IG8 A;  4BR0 A;  4BQL A;  1NBW A;  2P9L A;  4IWV A;  4A57 A;  1YHQ N;  4O5F A;  4IOX A;  5FPD A;  2IVP A;  2A42 A;  3WXK A;  1YXQ A;  2QWQ A;  3CI5 A;  3BP8 A;  4JKA A;  5GIO A;  2VYP A;  1YJN N;  2JWK A;  1P8Z A;  4E1J A;  3TSQ A;  2OAN A;  5EXW A;  3ZEU B;  1E4F T;  2E1Z A;  3EZW A;  4MLE A;  3VGK A;  3BF3 A;  1GLA G;  3CHW A;  2NRH A;  3HTV A;  4BRN A;  3L6Q A;  5AFU A;  3CJB A;  3ID6 A;  3M1F A;  3SAH A;  3GG4 A;  1HKB A;  4H5W A;  5AQU A;  2E20 A;  2P9P A;  2BTF A;  4BRK A;  3HOS A;  4YDU A;  5F2R A;  4BRA A;  3PIO L;  3VMF B;  1JCF A;  3U9D A;  2ZGZ A;  2VWB A;  3CCU N;  4IXC A;  3RSE B;  1BA0 A;  2Q36 A;  2FF6 A;  5HOO A;  1NGE A;  2GTD A;  5FPM A;  1BO5 O;  2PBD A;  3ULE B;  1M1K O;  3D2F A;  4RTF D;  3VEO A;  4QS8 A;  5GAE P;  2QWM A;  4JK9 A;  3C7N B;  5AQG A;  4U7B A;  4K42 A;  1IJJ A;  3MDQ A;  5AZI A;  2NZT A;  4CD3 A;  2WUS A;  3LM2 A;  5EOY A;  2FF3 B;  4CZJ A;  4H0P A;  4PL7 A;  5DM6 L;  2P9S B;  3DJC A;  3ID8 A;  5AQF A;  3AAR A;  2F9W A;  2YJF A;  4IO9 L;  4YDU C;  4RWT A;  5AQI A;  1VQ7 N;  4IJA A;  1K8A O;  2IVO A;  3O4W A;  2W40 A;  3TU5 A;  5EX5 A;  1H1V A;  1SS6 A;  5KQ8 A;  3C6H A;  5GAG P;  2KLA A;  1MWM A;  3A8Y A;  2D0P A;  5AQX A;  1YIT N;  3R3L A;  3ENH A;  2D4W A;  4YOU A;  2Q0U A;  5AQY A;  5F0X A;  2A5X A;  1RGI A;  1GLB G;  3A5L C;  1X3M A;  3AY9 A;  5AQN A;  3WUH A;  1DT9 A;  2FXU A;  3CC4 N;  2P9L B;  1NGD A;  1TYQ A;  2NLX A;  5BPN A;  5BRH A;  2Q31 A;  4H0T B;  3E9O A;  4UY8 O;  1HJO A;  4A62 A;  2J4R A;  1GLL O;  1QQM A;  3O9U A;  3VER A;  3ZET B;  3W3D A;  5AR0 A;  4CZH A;  3CJ9 A;  3HSC A;  4GVE A;  3AGK A;  3ENO A;  3IKM A;  3FE1 A;  5TKY A;  3ZEU A;  4H0V B;  3F2K A;  1VQ5 N;  5M1Q A;  3CD6 N;  4CBX A;  2CGK A;  3M3Z A;  4M63 C;  3IDH A;  4CJ7 A;  1NGB A;  3ATU A;  4O8K A;  4G9Z A;  1HKC A;  1RDU A;  4JEP A;  5AQP A;  2P9P B;  2QWL A;  4MO4 A;  4GV3 A;  1VQM N;  3O6W A;  3EO3 A;  4GNI A;  4JKC A;  4H0X B;  4QS7 A;  3TSP A;  3ZX3 A;  3CCR N;  3IMX A;  1CZA N;  1SZ2 A;  3A5M C;  2A40 A;  2HF3 A;  3QFU A;  2NRZ A;  3D2F B;  3ULE A;  4ISG A;  5E26 A;  4ISF A;  3QBW A;  3CCE N;  2PAV A;  3CIP A;  4K43 A;  5AZI B;  3C7N A;  2P9N B;  3VES A;  3DXM B;  5AQT A;  3H6E A;  1NGA A;  3E9L A;  4AF1 A;  3MX2 A;  1BWF O;  3M6G A;  1S3X A;  1BG3 A;  2KHO A;  2P9S A;  4FWO A;  4FWM A;  3U4L A;  3G4S N;  5AQW A;  1C0F A;  3DAW A;  3MN9 A;  1WUA A;  5AQM A;  2P9I A;  1S22 A;  4JKG A;  3CCM N;  3L4I A;  3CCJ N;  1HKG A;  4H5N A;  3KWG A;  3CER A;  4L3Q A;  3KK7 A;  5AQL A;  3T69 A;  4PHT X;  3SLC A;  3MWP A;  5GIP A;  2ZJR L;  4FWR A;  3VF6 A;  3D7E O;  2CH6 A;  3NVM A;  4AM6 A;  1LCU A;  2YHX A;  1GLF O;  2D1K A;  1S72 N;  1R59 O;  3DWL A;  5CHI A;  2JWL A;  1TYQ B;  5EY4 A;  4BRO A;  5F1X A;  1O13 A;  1NGG A;  1BU6 O;  3T7Z A;  4CZL A;  3U8X A;  4YOT A;  4EIA A;  2E2N A;  5ELZ A;  5AQJ A;  2NRV A;  3MX5 A;  4ILG B;  3ZET A;  1N8R O;  4YOX A;  3H3N O;  3WXJ A;  3BEX A;  3DXK B;  5GIN A;  3VF4 A;  1QVF M;  4EAH D;  3N4P A;  3EKU A;  4JN4 A;  4XH4 A;  4IFE A;  4BG8 A;  3SJH A;  1QZ5 A;  3HZ6 A;  4KH6 A;  2ZJP L;  2HST A;  3VGM A;  1U2V B;  3ZX2 A;  2A6A A;  3FFK B;  4JNE A;  4BC4 A;  3UE5 A;  4BRQ A;  1OKJ A;  2QTD A;  3G25 A;  3VEX A;  2OTJ N;  4BQZ A;  5KQD A;  3TTF A;  2I7N A;  3J7Z O;  3LL3 A;  2HF4 A;  4IEE A;  4NLB A;  1D4X A;  1TUY A;  2NRR A;  1G99 A;  3SBG A;  4WFA L;  1LOT B;  1Q82 O;  4OO1 J;  3HRG A;  5BN8 A;  4OPA A;  4B9Q A;  5CE3 A;  1VQP N;  3OHR A;  4BR7 A;  1C0G A;  4FWS A;  4BR5 A;  2EWS A;  4H03 B;  2P9N A;  3EKS A;  4GY2 B;  3KZB A;  3DXM A;  4B1W B;  2CGL A;  2GWK A;  3WXL A;  3OW2 M;  2ZWH A;  4C1N K;  4FPA A;  4CBW A;  4CZM A;  2F7T A;  5C2D A;  5C10 A;  2ASP A;  2HBL A;  5AQR A;  2P9I B;  3BF1 A;  4JKG B;  3MN6 A;  2NNW A;  3O9R A;  2QI2 A;  1NWK A;  4EHU A;  1VQ6 N;  2YJE A;  4WFB L;  3LDO A;  3R6M A;  2GEM A;  4PL8 A;  4A2A A;  1BUP A;  1KAY A;  1X9J A;  2RE2 A;  3NMU A;  2V52 B;  2QEX N;  1VAZ A;  3SBT A;  4BY9 C;  1GLE G;  4WQ5 A;  4FL9 A;  2YCH A;  3EE8 A;  4A2B A;  4CZG A;  4B1V A;  3O1B A;  4XEI A;  4BRD A;  5JLH A;  1K9M O;  3QBX A;  3IFR A;  2E8A A;  2P9K A;  1YF5 L;  1GLC G;  3C65 A;  4O8U A;  4BRP A;  1KAZ A;  3MN5 A;  3PIP L;  4CBU A;  3L0Q A;  2QWN A;  2QW9 A;  1KXP A;  1W97 L;  3C0B A;  5MLC Q;  3D2E A;  3FZM A;  1HX1 A;  3UKU A;  3EN9 A;  1Z05 A;  5M1K A;  3FLC O;  4PKG A;  5AQQ A;  3CJ1 A;  1T3V A;  2E2O A;  1ZBS A;  4YOW A;  2WFB A;  4YOV A;  1MDU B;  3F5T A;  4MLH A;  1OVY A;  4H5T A;  1BOT O;  2Q0R A;  1MA9 B;  3DXK A;  1QQN A;  2FSN A;  3GL1 A;  3QB0 A;  3QFP A;  5AQO A;  1TUU A;  2E88 A;  3E9P A;  2WC9 A;  5E84 A;  1U6Z A;  5HL7 L;  3WEE A;  4ILJ A;  4IO8 A;  4K41 A;  3SAF A;  3SK3 A;  5DM7 L;  2ITM A;  3CQX A;  1U2V A;  4XH5 A;  4EFH A;  1KQS M;  4R79 A;  5LJW A;  2OTL N;  3KVG A;  5M1O A;  3TTD A;  3H1Q A;  3I55 N;  3AGR A;  3VOV A;  5AQV A;  4M7X A;  1VQN N;  4C23 A;  4A59 A;  4CZE A;  5M1P A;  2GUP A;  1KAX A;  4GV6 A;  3CCQ N;  3O9Q A;  2RHK A;  1BDG A;  2FSK A;  3O80 A;  4JD2 A;  4JAX A;  4BRE A;  2QWP A;  1NGJ A;  2GWJ A;  1NM1 A;  3FZL A;  1SAZ A;  4A5B A;  4WFN L;  5GAD P;  2BH1 A;  1ESV A;  3R9P A;  3MN7 A;  3VET A;  3CPE A;  4BRC A;  4NB4 A;  4H0O A;  3G71 N;  5TKW A;  2HBK A;  1KC8 O;  4I6M B;  3CCL N;  3GOI A;  3VEV A;  3VTH A;  1ATN A;  1Y64 A;  1QHA A;  3MWT A;  1V4T A;  4CD1 A;  1EO1 A;  3O8M A;  5BN9 A;  4CZK A;  5JMV A;  3GE1 A;  4JKD A;  3FZF A;  2VGN A;  3HOT A;  4FSV A;  1T6C A;  4DQ8 A;  2P9K B;  3Q7C A;  3WXI A;  5B8H A;  5JVH L;  5JLF A;  3P4I A;  4KH4 A;  3MMV A;  2HMP A;  2A3Z A;  3KHY A;  4HWI A;  4DHY A;  5JVG L;  1YJ9 N;  2NRT A;  2AP1 A;  4CZF A;  1Q81 O;  1K8K B;  1WOQ A;  3HBT A;  5ADX H;  3CPW M;  3D2E B;  3GDQ A;  4JK7 A;  3UKU B;  5M1F A;  2VGM A;  3O9S A;  1JCE A;  5CR4 A;  1DGK N;  4DCH A;  3CJA A;  1HPM A;  3LDQ A;  1YI2 N;  1T44 A;  3TSU A;  3VPZ A;  4BRI A;  3R1X A;  3VGL A;  3CJC A;  3CET A;  3O1W A;  3A5N C;  3GBT A;  4MO5 A;  3Q7B A;  1W2B M;  1VQK N;  2V51 B;  2HBJ A;  3E66 A;  2D0O A;  2QWO A;  3JS6 A;  3WEE B;  4B1Y B;  3FZH A;  1T6D A;  3CME N;  4BR4 A;  5LY3 A;  5AZJ A;  1M90 O;  4KBO A;  4B1Z A;  4FWQ A;  4IZ9 A;  5C2F A;  2HBM A;  4BRM A;  2E2Q A;  4Z94 A;  2ASO A;  5C15 A;  3S41 A;  5AFU H;  3L4Q A;  3WQU A;  5BR9 A;  4WYB A;  3ZYY X;  3CCS N;  2AA4 A;  3I8B A;  3OBW A;  3ZX0 A;  4RCH A;  4FWK A;  4JD2 B;  5BRF A;  3VF2 A;  3W0L A;  4BC5 A;  4WQ4 A;  3LDL A;  4KH5 A;  5BPM A;  3BUZ B;  3A5O C;  4PKH A;  4IOA L;  3CC7 N;  3NVK A;  4FWL A;  4JKF A;  2ZGY A;  4OPH A;  1VQ4 N;  5KPZ A;  5BRE A;  2HOE A;  4J8F A;  2W41 A;  2P9U A;  1J6Z A;  2Q1N A;  5AQH A;  5AQZ A;  1BA1 A;  4FOI A;  4BVO A;  1NJI O;  1VQ9 N;  4A61 A;  1NGF A;  5LJV A;  1YUW A;  3WXM B;  1E4G T;  2VCP A;  1HLU A;  2YHW A;  4BGB A;  3OBY A;  4I6M A;  1SQK A;  5EVZ A;  3CCV N;  2FLO A;  3EE9 A;  4BR2 A;  2YX6 A;  1QZ6 A;  3EL2 A;  1JCG A;  4BC3 A;  2E2P A;  4FOE A;  1GLD G;  3SMS A;  1Q86 O;  1RDW X;  4U67 L;  4BGA A;  3QML A;  3H1V X;  1DEJ A;  1XC3 A;  3H45 C;  4WQ4 C;  3TTC A;  4ILH A;  3QDK A;  1Q7Y O;  4BR9 A;  2E1Y A;  4JK8 A;  2DPN A;  1NMD A;  1GLJ O;  3TPQ A;  1QQO A;  2F9T A;  4FWN A;  4BRF A;  3CF5 L;  4MDB A;  2ASM A;  3A0I X;  2PFU A;  4QS9 A;  3RVC A;  5C0Y A;  2YI1 A;  1K8K A;  4JHD A;  3HI0 A;  4AM7 A;  4JKE A;  4YOR A;  1YIJ N;  4H5V A;  5FPN A;  2NRX A;  2NRW A;  4CZI A;  3VEN A;  2IVN A;  4NO7 A;  4BRL A;  3PLA A;  3UKR A;  3VEY A;  4NLC A;  3QIC A;  4LC9 B;  4FVU A;  5KPT A;  1VQL N;  2QWR A;  4BC2 A;  1NGC A;  4WQ5 C;  3G6E N;  4DKW A;  2ZF5 O;  1YVN A;  3H46 O;  1HUX A;  2UYT A;  4FWP A;  4YOY A;  3WQT A;  1P90 A;  2V7Y A;  3JXU A;  2QA4 N;  3P39 A;  1KD1 O;  1DKG D;  5AZJ B;  1X3N A;  3AAQ A;  4B1X B;  2YHY A;  4PKI A;  2GX9 A;  3VTI A;  2FSJ A;  3C6A A;  1QVG M;  1ATS A;  5BRD A;  5FPE A;  5AQS A;  3WT0 A;  2BUP A;  3LDP A;  4BVP A;  4MDA A;  3FGU A;  3VEW A;  3P38 A;  1EQY A;  3MCP A;  2CGJ A;  3UB5 A;  3U9Z A;  4JKB A;  3H3O B;  1XUP O;  5KPR A;  1NLV A;  3AAP A;  4A5A A;  3KWI A;  1V4S A;  2KKZ A;  3M5R A;  1MWK A;  3ENB A;  2QM1 A;  3P31 A;  3F9M A;  3ATV A;  4K25 A;  1Z6R A;  4CI6 A;  1RFQ A;  3LDN A;  3MK6 A;  4IJN A;  4F9O A;  3K9J A;  2P9U B;  1XQS C;  5BPL A;  3K9K A;  5I9E B;  4WF9 L;  5H1S Q;  3N4Q A;  4BRH A;  1Q18 A;  5GAH P;  3O9T A;  1VQ8 N;  2GEL A;  2I7P A;  3IUC A;  3RSE A;  4ISE A;  3SMP A;  5AQK A;  2A41 A;  3B8A X;  4XH1 A;  3D6R A;  4M7Y A;  3LM9 A;  4FPB A;  3FR0 A;  3E1Y A;  4Y0W A;  4BRG A;  1YJW N;  4C1N I;  3VEZ A;  3CJ7 A;  4H0Y B;  1ATR A;  1JJ2 M;  4WCE L;  3I56 N;  3I33 A;  3CMA N;  4IEI A;  4BG9 A;  4HTL A;  3DLL L;  3CXC M;  2CH5 A;  3OA9 A;  3CQY A;  1K73 O;  4JHD B;  4IDH A;  3SAG A;  2ZJQ L;  4B1U B;  4GV9 A;  3J8A A;  4DB3 A;  5M1N A;  1ILY A;  2WBN A;  1YAG A;  3R8E A;  3UKR B;  4JKH A;  2Q97 A;  5C12 A;  4FO0 A;  5ADX A;  4EHT A;  3HM8 A;  1VQO N;  4H5R A;  3CC2 N;  3MCA B;  5JIC A;  2H3G X;  1NGI A;  1NGH A;  3O08 A;  4IOC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...