5DM7L

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGKLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5dm7L01
4WF9L 1VQKN 1KQSM 2ZJQL 2OTJN 3CC2N 2QA4N 1QVFM 1YI2N 1YIJN 3CCSN 1Q81O 4IOAL 1YITN 5GAEP 3PIPL 3CCUN 3CCVN 2QEXN 5DM7L 3G71N 4UY8O 3PIOL 3CC4N 1K73O 1W2BM 3CCLN 1M90O 4WFNL 4WCEL 3I56N 1N8RO 3CXCM 3CC7N 3CCQN 2ZJPL 5JVGL 1VQ5N 1YJWN 1Q82O 3CCMN 1VQ7N 3CD6N 3CPWM 5JVHL 4WFBL 5H1SQ 5GAGP 1VQMN 1KC8O 3G4SN 3CCEN 1Q86O 3J7ZO 3DLLL 3CCJN 1K9MO 1VQ4N 4WFAL 1S72N 3CMAN 1OVYA 1KD1O 3CF5L 1NJIO 3G6EN 3I55N 1K8AO 4IOCL 1M1KO 4U67L 5HL7L 3CCRN 1Q7YO 5DM6L 3CMEN 1VQ8N 1ILYA 1VQPN 1VQ9N 5GADP 1VQLN 5MLCQ 5GAHP 3OW2M 2ZJRL 1YHQN 1QVGM 1VQNN 1VQON 1VQ6N 2OTLN 4IO9L 1YJ9N 1JJ2M 1YJNN
chains in the Genus database with same CATH superfamily
3LP2A 2O8CA 4BG8A 3OYBA 3VQ5A 2O4IA 3CM5A 3RTVA 3PSFA 5DK5A 1NLVA 2I5JA 3DI6A 2QEXN 2YNIA 3LDPA 4CVNE 3RSEA 2CH6A 2O8BB 4CZJA 1SZ2A 3CFOA 3AAQA 3WUHA 4KHQA 3HP9A 3SMPA 2O8DA 4O8UA 2W42A 4FWRA 4JLHA 3KK3A 2Z1IA 1N34K 2B5JA 4NLBA 3CJ1A 3J7AP 4JS5A 1BGXT 1YJWN 4C23A 3SQ1A 3C7NA 3NMUA 4GKJK 2VQEK 3OY9A 5A2QO 3PSIA 4EHUA 4F2SA 3KVGA 4DTRA 3SPYA 3CFPA 5C25A 3AA3A 5DMRA 4DSLA 4JI6K 3NVMA 2IAJA 4L3QA 4AHCA 4FJ8A 2ZGZA 4DCHA 1C1CA 4KTWA 5BR8K 2QXLA 3H08A 4JRQA 2AA4A 4CK2A 5BRHA 3W3DA 3VQAA 1C6VA 4NXMK 4MDBA 3CCJN 4MO4A 4WFAL 2G8KA 3AVLA 2PYLA 4KHUA 3MEEA 1VSDA 5EXWA 5J2PA 3U3YA 4E1NA 5JICA 3L0QA 2D0AA 2VGMA 1MWMA 1RT5A 4BC2A 2HHHK 1IH7A 4LSLA 1N5YA 3VOVA 1N33K 1X9MA 5C10A 3QESA 5CHIA 2QXFA 4M3TA 4DLGA 3O4QA 4FJGA 1XC3A 3KIOA 3B6PA 3PUFA 4NCAA 4BRGA 3HPHA 4O4GA 1V4SA 4GW6A 4X65K 4QAGA 3WEEA 1U45A 1RT1A 4BVOA 2WOMA 4FWSA 3CC2N 2KZMA 5BRDA 1T6DA 1HLUA 4ISEA 3CCVN 4A2AA 2YHXA 1BI4A 4RW4A 4B9VA 2HHXA 5AQPA 3EZ5A 2W6KA 3NF8A 4FK4A 2P9LA 3IMXA 4C1NI 5LJVA 4IFEA 2KFNA 4CJ7A 3AAPA 1JCGA 2E2NA 5FPNA 4LF7K 1N8RO 1VSMA 4Z4GA 3AGKA 5AZJB 5J2QA 1KAXA 4K8ZA 2VGNA 1Q82O 4KH6A 4IJAA 3ZT4A 1VQ7N 4RW6A 4KB1A 4AM6A 3AVNA 2FLOA 3VQ8A 1WLJA 4H8KA 2PAVA 4CFBA 3OBWA 1ZBIA 4N76A 1MU2A 2E88A 3BF1A 4CFAA 3S9HA 2IVOA 1L3SA 3ITHA 4JI5K 4O5FA 4LF9K 4XEIA 4H5NA 3NGZA 2Q3SA 3EEQA 1QQOA 3F9KA 5GINA 1DEJA 3CF5L 5HRRA 4AH9A 2O8FA 4O8KA 1P8ZA 3CCRN 4AF1A 1Q8IA 3C95A 4CEAA 4JI0K 4GKKK 4CJSA 1SL2A 3S41A 3MN5A 2ZE2A 5HOOA 3OYCA 2WBNA 3ZEUA 1VSKA 2E4LA 4CEQA 2G8FA 4W5NA 2QWNA 5HROA 1VSLA 3GDQA 2UUBK 4FM2A 3FE1A 1IJJA 3U8XA 1QVGM 3P5JA 1K8KA 1HNXK 1F21A 3VEWA 1RTJA 3PO5A 2AP1A 2B4JA 4FWMA 4LF5K 4YY3K 3BY5A 1FW6A 1WBBA 4LFBK 4E7IA 4OKKA 4GMJB 4F9OA 4CECA 2P9KB 5C2FA 3FGUA 3B6OA 1O1WA 4IOAL 1RDBA 4Y0WA 2IOCA 4EHTA 4B3TK 1KLNA 5AQLA 2HOEA 1WNSA 3HP6A 2ZGYA 4JKCA 3CC4N 4ISFA 4CZGA 3LDLA 4BRNA 2A41A 2FBVA 3D0PA 3V1OA 4CZEA 3MECA 5CZ1A 3BZKA 1JLAA 4MLHA 3VGMA 5KGWA 5HP1A 3HO1A 4RTFD 2WFBA 4FJHA 3QB0A 3EZWA 1ATNA 1NJWA 3OS0A 4UQGA 1HPZA 5C12A 3L2UA 4FWOA 4CF0A 2YNGA 3TTFA 1LW2A 1HNZK 2Q0UA 4FVUA 3S3NA 3VESA 5BR9A 4JK8A 1WAJA 5JVHL 4CZFA 5AQXA 4QS8A 4FLTA 3WNGA 3MK6A 3THWB 4DTSA 3QEPA 4FWKA 1WN7A 4GNIA 1LAVA 2IC3A 4CJWA 4JKAA 5EY4A 3M1FA 3D2FB 1E4GT 4CCHA 3OYHA 3EE8A 3NBPA 3AV9A 2LSNA 1E3MA 3OVNA 2E5LK 4PQUA 1VRTA 2GUPA 2OPRA 3CETA 3OS2A 4Z4IA 2VWBA 3I55N 4B9TA 5AQIA 1M1KO 3MX5A 1LCUA 3CMEN 4B8CA 5GIPA 1DT9A 4HVJA 4X64K 5EVZA 3HL8A 4JEPA 3KLGA 4PL7A 2VWKA 3CQ8A 4B9QA 4LF6K 3VQBA 1QZ5A 4CHPA 3ZETB 1GLBG 3U6FA 4OKEA 1CZAN 1VQNN 1P90A 4PUOA 3NCIA 3FZKA 4NYFA 2BDPA 4FJJA 4C8LA 1IG8A 3CPEA 3DYAA 4IDHA 3W0LA 1KFSA 3ZSYA 4HCCA 4KHYA 1VQKN 3F2KA 2OTJN 4FLXA 3DLGA 4NB4A 2PY5A 4A2BA 1QVFM 1ZBLA 4OLAA 4BQLA 1IBLK 4CF1A 2G8HA 4EZ9A 2NUBA 2OPPA 1TVRA 1NWKA 3C6TA 3VF4A 4HUGA 3MXIA 1FKOA 1XC9A 2P5GA 3WNFA 4JI1K 1KFDA 4XH4A 3HM9A 2DFEA 4KTQA 4CFDA 2YHAA 3KK2A 3MCAB 1WAFA 3BZCA 1SAZA 2ITMA 2OZMA 4OX9K 4FWQA 3SCXA 3O08A 4OPAA 1SL1A 1UOCA 1VSHA 4FJ5A 3CJCA 1RBUA 3CI5A 4LH4A 2O8EB 4CF8A 1BIUA 2QI2A 3D6RA 2XY6A 3SLCA 4X66K 3U9DA 4CEFA 4B9MA 5AQRA 1NM1A 2GBZA 2HVHA 2FSNA 3J7YP 3GE1A 3LDSA 1WSFA 4FLVA 5GIOA 4FJ7A 1Q86O 4WYBA 3SUQA 4H0TB 1NOYA 4DTOA 3TAGA 3LDNA 1VRUA 3ZX3A 3NDKA 2AJQA 3E9LA 3V4IA 1NJIO 3ZT3A 5J2MA 3S3MA 3HT3A 3UE5A 3VEYA 1NJXA 2UUCK 4DU3A 2O8CB 4DB3A 1YF5L 3FZMA 3A5NC 2QWRA 5AFUA 3M8PA 2P5OA 4FW1A 1ILYA 4EIAA 2V7YA 2Q31A 1TAQA 5AQJA 1W97L 4F2RA 4DV4K 1RT2A 2HNDA 2R7YA 2FF3B 2XRIA 3SBGA 4IO9L 2O8DB 4CBUA 1YJ9N 2EX3A 2XY7A 3QINA 2UXBK 1ATSA 1VHXA 4XIUA 1SV5A 3NGIA 3K5NA 2ZJQL 3C7NB 3O9RA 3ULDA 3QLHA 4B9NA 1VSIA 3L2WA 4Y1CA 4BACA 3BP8A 4DF4A 5CZ2A 3QNNA 2UYTA 4Q5VA 3ZT1A 4DMNA 1NNEA 4AM7A 1NJYA 5KPRA 3ASMA 1OH8A 4DQRA 2HNZA 1X9WA 1T8EA 4G1QA 4J2DA 4BRFA 1CXUA 3CC7N 3T1HK 3D2EA 4NCGA 4ILGB 2W41A 3LAMA 1QHTA 1LWCA 4B1XB 3AO2A 3V9SA 4AHVA 3ZSZA 1VSFA 4RWTA 3ZETA 2FBYA 1LWFA 3GG4A 3K59A 1X1PA 1OVQA 3AARA 2ZM6K 3IFRA 1KC8O 2P9PA 4IG0A 4DR1K 1J54A 3MWTA 3J7ZO 2P51A 4I6MA 2GWKA 2D5RA 1VQ4N 4IOXA 4GVEA 4H0XB 4OJRA 4M41A 4CZHA 3CMAN 1QZ6A 4WE1A 4BR0A 4RW7A 3H6EA 5M1NA 5SWMA 5M1QA 3WEEB 1OKJA 4JI7K 1E4FT 3EKSA 4DV5K 4IWVA 3E1YA 4IG3A 1NGJA 3QEXA 3OYNA 1B92A 4CIEA 4ICLA 4FWPA 3NH2A 1QQNA 1RDDA 1Y97A 3PX0A 1TKDA 2E1YA 1BDGA 2UXDK 1BI4B 2QKKA 3SZ2A 4DQQA 5GADP 2YV0X 3MN7A 2KHOA 5MLCQ 1ZC6A 2QW9A 3R6MA 4EP4A 2NRZA 2P9LB 3DRRA 1J9AA 3WNHA 1VQON 3VEZA 5AFUH 1JJ2M 3RRGA 5C15A 4FZYA 3AVAA 4W5TA 1KAZA 4DTJA 3CQXA 1IKWA 1NGAA 4M3ZA 1S5JA 1UA0A 4BC4A 3JS6A 4N56A 3NFAA 1XI1A 1JLGA 3AA4A 1BIZA 4GV3A 1S3XA 3I0SA 3AVFA 3P4IA 2GELA 3WXIA 3IS9A 1HKGA 3M8RA 1JXBA 3NE6A 3VGLA 1WBDA 1HYZA 1K73O 5BREA 1NGGA 3L4IA 1EP4A 4DLEA 5K14A 2E2OA 4MO5A 2FC0A 4LF4K 5AQSA 2D4WA 1NKCA 3L2VA 3H3OB 4JI8K 3K5MA 4KH4A 1EETA 1NKBA 2A1SA 3OYLA 1ZBFA 3CFRA 5AQYA 3CXCM 1V4TA 4FZZA 2WUSA 3SJHA 3G25A 1HYVA 3OJSA 3HVRA 3CCMN 4DUYK 4E7JA 4EP5A 4HTLA 3PLAA 3SUPA 4JKGA 2KTQA 2O8FB 1DTQA 3THYA 3VQDA 3KLHA 4IBNA 1RDWX 1GLLO 1Q9YA 1RT7A 2UU9K 3IG1A 4YOXA 4KHNA 3ZEUB 4MFBA 3N4QA 4M42A 1J6ZA 3P83D 3EY1A 5B8HA 3IKMA 5M1KA 3PO4A 1XQSC 4K43A 4DR3K 4O5BA 2JLEA 1K8KB 4F3TA 3K5OA 4BR2A 3L4QA 1HQUA 2Z1HA 3IDHA 4CJLA 1TYQA 1GLEG 2NNWA 1VAZA 1KVAA 4CW7B 4ELVA 3DLKA 1JCEA 3NH1A 1J5OA 3O9SA 4HTUA 1DGKN 3NAEA 3QFUA 1A5XA 1VSJA 2FSJA 5AQFA 1VQLN 3UKRA 4FSVA 3ID6A 1WSIA 5ADXH 1NK9A 3LZJA 3LPTA 2HSTA 3CJAA 3TPQA 1XHZA 2OTLN 4IEEA 4J2AA 4B1YB 2X74A 4PKGA 3TU5A 4QS9A 4YORA 3AY9A 1FJGK 5E26A 3GL1A 3QEIA 1WB9A 1W9HA 4DTMA 4M3XA 2QA4N 5FRNA 3FZFA 5AQQA 4FM1A 3OYKA 2GTDA 1RTIA 3AVKA 3L6QA 3PIPL 3TSQA 1T03A 3C6AA 2GX9A 1TV6A 1HUXA 1C0TA 1GLJO 2UUAK 4BRPA 1TKXA 1EWRA 5T7BA 1ASWA 1W2BM 1LWEA 4XH5A 2VCPA 1M90O 4G9ZA 3O6WA 3VF6A 2EWSA 1FKPA 2OANA 1KLMA 3I56N 3SAHA 3I8BA 4JAXA 3K57A 1JLQA 1G15A 3M3ZA 3JSMA 4H0VB 2QK9A 4KRFA 2VWJA 3SJJA 4KHSA 4FM0A 4DWIA 3KTQA 5AZIA 4J8FA 2BTFA 4DKWA 3VETA 1JLEA 1ITGA 3SPZA 4BDZA 4IFYA 4DV2K 4C8OA 4CZMA 1RGIA 3WT0A 4O44A 1QHAA 4BR4A 3DLLL 4DTNA 2HF3A 5AQNA 4YNQA 4RW9A 2OPQA 4IZ9A 3DJCA 3C94A 4B8AB 3MAQA 5AQHA 3V9ZA 4FWLA 1OVYA 2OCEA 2CGJA 3DLHA 1K8AO 5CY4A 3P31A 4QCLA 3FFIA 3KK7A 3H46O 4KREA 3MCPA 4AHSA 3TABA 3AO4A 1W0HA 1BA0A 1C0GA 2QWQA 3SQ2A 4CF2A 3A8YA 4DTUA 1RBSA 1ZBSA 2QWLA 4YOWA 4CJRA 3E9OA 3QBWA 3LDOA 3L2RA 4DR5K 4CHZA 2HMPA 3QFPA 3WQTA 4YOYA 2NZTA 3ZT0A 3VN5A 3T1AA 4BE0A 4B3SK 4DHYA 2DY4A 3V1QA 3ZSQA 1YI2N 2BE2A 5AQZA 4CEBA 3SV3A 1YIJN 2NLXA 3TAFA 5CE3A 4YOVA 3ZSWA 5I42A 1JCFA 5DM7L 5AR0A 4B1WB 3L3VA 3PIOL 1TGOA 1RDCA 1YVNA 4CJKA 2F9WA 5KGXA 1RDAA 2FBXA 1XUPO 2XY8A 3KLEA 1REVA 4PA1A 1BCOA 1FK9A 4OGEA 5AQWA 4BRLA 2F9TA 2HHTA 1NK4A 5JVGL 1XMOK 1JLBA 1VQ5N 1J53A 5TKYA 4BRKA 3VQ9A 2HMIA 4M3YA 1NK5A 5F0XA 1U4BA 4ILHA 3CJ7A 3HBTA 1S9EA 3BF3A 4A61A 3FR0A 4R79A 3MN9A 4CK1A 1MDUB 3SMSA 1BCMA 2E1ZA 3KLIA 2BUPA 3K58A 4E7KA 1YT3A 3CHWA 1X3MA 4MDAA 4H0YB 5GAGP 5FDLA 2Y1IA 5D3GA 5FRMA 4TSXA 2P1JA 3JAMO 4BRIA 5BN9A 1WSHA 4LF8K 1RBRA 4FVMA 4B1UB 4CHOA 1WSJA 3E66A 3QDKA 1EX4A 3DXMA 1DTTA 4BDPA 4KB0A 3A5LC 3C0BA 4CJUA 1N36K 2EHGA 1NK8A 1H1VA 4HUEA 1LAWA 3OYMA 4O55A 5CYQA 1S1WA 4GY2B 4H4OA 4JKBA 1SKSA 1U2VB 4DSFA 1J5EK 1I3AA 2YHBA 4MQ3A 2HF4A 4CFCA 3M8SA 5J1EA 1WOQA 4KHWA 3IUCA 3OJUA 3KLFA 4KV8A 3QEWA 4E19A 1TUYA 4DV1K 3VQQA 4FLWA 3D2EB 3OTOK 4CGHA 3QETA 4ZHRA 4LD0A 1R59O 4JS4A 1S1UA 3SUNA 3TAMA 5KRTA 3ZSVA 2RKIA 2IVNA 3HZ6A 4CERA 3T1YK 5KPTA 4BRMA 3C6UA 3SAGA 3LP1A 1HR0K 3ZCMA 3LWLA 3DOKA 4IEIA 1IBKK 4JV5K 2HW3A 2JGUA 2P9PB 3VEVA 1HNIA 1KVBA 4I6MB 5HBMA 3MN6A 4E89A 2WTUA 2KQ2A 3SBTA 4CZLA 3WXJA 2YNHA 3ZYYX 3A0IX 2IGIA 3CPWM 4FJMA 4QOZB 1BL3A 3SQ4A 4H5TA 3OYDA 1RTDA 2P9UB 2YHWA 4A62A 3V9XA 1X9JA 4CJQA 4B9UA 5AJ3K 1CZ9A 4M3UA 4M3RA 2I7NA 1VK0A 3ZX0A 3NF7A 3RMBA 2P9IA 2D0CA 1SQKA 1NG9A 4H4MA 4X62K 1A5VA 4FJXA 3DM2A 3QIOA 5LJWA 2DFFA 5M1PA 4BWJA 2XY5A 3P39A 4NXNK 4KI4A 2CH5A 4EFHA 3ID8A 1U04A 1Q7YO 4BG9A 3KD5E 1L3UA 5FPMA 4CIFA 4LFAK 2E6MA 1VQPN 5AQGA 2QWPA 3G0ZA 1RBVA 2ZJRL 1XWLA 3BEXA 3SNNA 3QMLA 3DRSA 2IDOA 3O3GA 5AQVA 4M7XA 5M1FA 4IJNA 3LWMA 1Z26A 1U49A 2PZSA 4BRDA 1GLDG 3SI6A 2ZF5O 4CJTA 2Y1JA 2VG7A 3RRHA 4E0DA 3DLBA 4YDUA 3KZBA 3TAQA 1ATRA 3VMFB 4JKHA 2E2QA 1W7AA 1C1BA 2YX6A 3I8DA 3CCSN 3H3NO 1NKEA 1YITN 4M45A 1NK6A 2A5XA 1ZBUA 4JKGB 2ATQA 3LANA 4H5RA 1WUAA 5EOYA 3VQCA 3J8AA 3CIPA 3THYB 5HRPA 2YCHA 1BO5O 3K9KA 2WC9A 4PHTX 2YI1A 4A57A 4KHPK 2KZZA 4NYNA 4DS4A 1S22A 2RHKA 3C65A 5ELZA 3U4LA 4KKOA 3QBXA 1WSGA 1YTUA 3MEGA 3DLRA 1YUWA 4KFBA 5M1OA 1HX1A 1JLCA 2KKZA 4JNEA 1KAYA 3RWUA 1TYQB 3PX4A 2HBLA 4FW2A 4LH5A 1U2VA 3BGRA 3R9PA 4B1ZA 3OHRA 1C0FA 4WFBL 3UKUA 2ETJA 3TARA 1NGCA 3R8EA 3UKRB 4DV7K 4FK0A 3D7EO 3I33A 2E2PA 1K9MO 1EO1A 3HOSA 2JWLA 3VA3A 1DLOA 4K0KK 4RW8A 3RMDA 4OLBA 4QS7A 2ZWHA 3L2QA 2OYQA 4BRQA 3SUOA 1SKWA 4I2QA 1NJZA 4JKEA 1ZYQA 1YXQA 1XMQK 2A6AA 3DRPA 2RE2A 2W40A 1GOCA 3N4PA 3VTHA 2KW4A 3VTIA 2FBTA 4CEEA 3AVMA 3DXKB 4FO0A 4CHYA 3JXUA 2HB5A 4CJVA 4IXCA 4BRAA 2HHUA 4CESA 1BHLA 4CEZA 5LY3A 3HK2A 4FJLA 2P9UA 3SV4A 2Q0RA 2XO7A 4BQZA 4DR7K 4PY5A 1SKRA 1KSPA 4JD2A 4ILJA 4GV9A 4BE2A 3T3FA 3CYMA 5AZIB 3LP3A 4C8KA 4GV6A 4W5RA 1N6QA 1RT4A 1BQMA 2GUIA 3QICA 3CCLN 3Q7BA 5LMUK 2V51B 3HSCA 2PBDA 1UA1A 4CK3A 3KD1E 4Y1DA 1XNRK 3ENOA 4Z0UA 4ELTA 2PYJA 1BUPA 3TAPA 5KTQA 5AQTA 4KTZA 4DV0K 2WONA 1RT3A 4JN4A 1KXPA 4A59A 5JS1A 1WSEA 2ITGA 3SK3A 3VPZA 1Q18A 2G8WA 3VEXA 3ZSRA 5FPDA 2X78A 1KRPA 1VQMN 4FLYA 1SS6A 1NK7A 4ID1A 3G4SN 4AQYK 3EKUA 5C24A 4F8RA 1RFQA 5AQUA 4PWDA 1B9DA 4V19S 3WQUA 1S72N 3CJBA 2HBMA 3VGKA 1NGBA 1U47A 4CJ4A 4H5WA 4DFKA 4F4KA 1QE1A 2B6AA 3MDQA 4CBXA 4CGFA 1MA9B 1S1VA 4M63C 4JKFA 4CJFA 3T69A 3O3HA 3THXA 3OYAA 3A5MC 4OKJA 1TK5A 1NK0A 2YHYA 1YHQN 1KCFA 1LV5A 4DQIA 1U6ZA 1VQ6N 3THVA 1CXQA 1L5UA 3AVIA 1NOZA 3I0RA 3CM6A 2BANA 4BWMA 1T05A 1TL3A 5KRSA 4DFPA 4H03B 3O9UA 1HQEA 1GLFO 5GAEP 2YKNA 3KWIA 4M7YA 4A5BA 3QEVA 4KI6A 1OH6A 1HKBA 2GV9A 3GOIA 4B3OA 4JKDA 4WFNL 4NLCA 5SZTA 1NGIA 4ELUA 4DQ8A 2UXCK 3DLEA 5HRSA 2ZQBA 4CI6A 3NF9A 3M8QA 2O4GA 4Z4CA 2A1RA 1IKVA 3D45A 4K8XA 2X6NA 3HTVA 3DXMB 4E1MA 5IWAK 3GBTA 1TKTA 3DXKA 4FJ9A 1BG3A 4DV3K 2BH1A 3UB5A 4Z4FA 3VEOA 2E8AA 4FXDA 1T6CA 3OYEA 1IKXA 3F9MA 4CE9A 4CJ5A 1R0AA 2IIRA 2D0PA 3DOLA 1HNWK 3QNOA 2F96A 4JYAK 4KO0A 2P9SA 2HHWA 4BROA 3LALA 4WQ5C 3VQ7A 4OO1J 3T19A 1KVCA 4PKIA 4YOTA 3J80O 1HKCA 3ZT2A 2HBJA 3P38A 4JI4K 3V9UA 5J2NA 3F5TA 1TUUA 3EL2A 1RNHA 3MEDA 3BDPA 4DV6K 4CGDA 4H0PA 1S6PA 3ENBA 4FLUA 3ULEA 3TI0A 2ZD1A 3OW2M 2DPNA 1EKEA 3OYGA 2KLAA 3VQ4A 2F7TA 4OPHA 3HYFA 1ZXOA 4RCHA 4WQ5A 2QTDA 4E3SA 4WQ4C 2HHVA 4FPAA 1QSSA 4BR7A 1IG9A 1TK8A 3AA2A 3H1VX 1L3TA 2QWMA 4EAHD 4O0IA 5F2RA 3OYFA 4DSKA 3KJVA 4DG1A 4CD3A 5FPEA 3J81O 2CGKA 2F8TA 3TR8A 3PV8A 1C0MA 1NBWA 3O4NA 1S1TA 3F73A 4FOEA 1QSYA 5I3UA 1T7PA 4OPJA 3ISNC 2VG5A 4WQ4A 3FZLA 3L8BA 4DU4A 2X6SA 2ASMA 2P9IB 4J2BA 5C2DA 4FOIA 4LY7A 4MLEA 3RR8A 2HHQA 3TTDA 5HRNA 2FF6A 3HI0A 5CR4A 4JI2K 1SL0A 1NGHA 3WXMB 3TAEA 2P9NB 4IFVA 3SAFA 3ZX2A 2O8BA 3DMJA 3O9QA 4KBOA 1QQMA 3CQYA 2ASPA 1RILA 1Z05A 1DKGD 4U7BA 4OVLA 3KK1A 4K42A 4DSIA 1LOTB 5AQKA 3B8AX 3E9PA 3VQPA 3LPUA 3HVTA 5AQOA 5JS2A 3ZSXA 3C6HA 4R5PA 3VERA 1QSLA 1X3NA 4O0JA 5HLFA 4ZTJA 1KD1O 4IO8A 1TAUA 4B3RK 3CJ9A 3MXMA 3LP0A 1BA1A 1D9DA 4DSJA 5BPNA 4NO7A 3EO3A 4F3OA 1RDUA 2NRHA 3Q7CA 4CHNA 2HHSA 2OA8A 1CZBA 3CG7A 1NGEA 3HXMA 4OGCA 3NH0A 4PL8A 2D1KA 3VQEA 2FSKA 2OZSA 3OBYA 4Z4HA 4WF9L 1OH7A 1YTAA 3R3LA 1BOTO 2V52B 4W5QA 1X9SA 1Q81O 3VQ6A 3KKSA 4K25A 3AGRA 3S3OA 3MXJA 5BPMA 3OA9A 3V1RA 1ASUA 1S1XA 2CGLA 3DWLA 1JXEA 3UKUB 2YJEA 3MX2A 1QQCA 2HNYA 4DFMA 3AVJA 5BPLA 1L3VA 5FLXO 4HHTA 1I39A 4BDYA 1JL1A 2NRTA 5E84A 3CCQN 2ZJPL 3NGYA 5EX5A 3O1WA 3ATUA 3K0SA 1U48A 1IKYA 4C8MA 3LZIA 4FL9A 3CD6N 2VG6A 4CF9A 4A5AA 4Z94A 1TK0A 2Q97A 4CGIA 3AVBA 3OYIA 1JKHA 1Q9XA 4KH5A 2Q2RA 4CBWA 4CGJA 2J4RA 3P1GA 1JLFA 1NGFA 3PY8A 1Z25A 4FJKA 3KWGA 4Q0BA 4BR5A 4LC9B 3RMCA 1YAGA 1ESVA 3AO5A 2Q36A 3HOTA 4CGGA 2RF2A 3HSTB 3NVKA 2NRWA 3WNEA 3H45C 1BQNA 2QM1A 2Q1NA 1B9FA 4H5VA 4GVMA 5AZJA 5JLFA 1EQYA 1IV0A 4FJNA 3TTCA 3U9ZA 4JHDB 3E01A 3LDQA 3QO9A 4CJPA 4IOCL 4Z4EA 3CERA 4HCBA 2BGGA 5DM6L 4JK7A 4BRHA 1I94K 4JRPA 4DFJA 2V7ZA 4CEDA 4DU1A 4J2EA 1HJRA 4BY9C 3AVGA 4DS5A 4BRCA 4JD2B 1HMVA 5C42A 5BRFA 4CJ3A 1GOAA 1VQ9N 1MWKA 4FPBA 3O1BA 4H0OA 1BISA 3HJFA 1ASVA 5FROA 4IKFA 3FFKB 1QS4A 2D0BA 3JYTA 3LL3A 4K41A 4FJIA 2P9NA 4CZKA 3V9WA 1YJNN 4FZXC 1QTMA 4W5OA 1G99A 4YDUC 3EYZA 3AVCA 4AILC 4AHUA 2E20A 4CZIA 4N41A 4JI3K 1SUQA 1CLQA 3V81A 5BN8A 1NGDA 3LAKA 1EXQA 1A5WA 4DF8A 3WXLA 3G71N 4UY8O 2NRRA 1LW0A 4IDKA 3ENHA 4BREA 4L8RB 3RR7A 2A3ZA 4BGAA 2VYPA 3IRXA 4BC5A 2QKBA 2Z1GA 2P9KA 4E1JA 2FXUA 3AO1A 4CD1A 1RCHA 3FZHA 5I9EB 4I9QA 2KFZA 1GOBA 4DQPA 4EZ6A 3TSUA 5KQ8A 1OH5A 1IBMK 3ZLJA 3AA5X 3V6DA 4B08A 1BWFO 4NCBA 3FLCO 3TWHA 4RG8A 3G10A 5H1SQ 4YOUA 1NMDA 1UWBA 3MWPA 3HPGA 2W6LA 3THXB 4LFCK 4C1NK 3RSEB 3CCEN 2A40A 4BGBA 2YNFA 3UIQA 2RN2A 3DAWA 4I7FA 1JL2A 3PX6A 2IVPA 2Z1JA 1RT6A 3M5RA 1RTHA 2E6LA 4I9LA 1D4XA 1HPMA 3G6EN 4KAZA 1Z6RA 2G8UA 4U67L 5HL7L 2G8VA 1XHXA 4FWNA 4DTPA 2VQFK 4B3MK 3O5BA 4DR6K 3THWA 3IAYA 1VQ8N 1S9GA 1XNQK 2DTUA 3D2FA 4CIGA 3A5OC 3OYJA 2OPSA 2YJFA 3TSPA 4DQSA 4CEOA 3ZSOA 2ASOA 3QIPA 4FK2A 4C8NA 5KI6A 3AO3A 1TL1A 2H3GX 2DFHA 1YVUA 2HVIA 2NRVA 3AVHA 1HJOA 1KQSM 4BC3A 1S6QA 3MMVA 1C0UA 3CCUN 5F1XA 4DUZK 4ZTFA 5JMVA 3VA0A 2NRXA 4CJEA 2GEMA 4HWIA 5LL6Z 2GWJA 1TKZA 4XH1A 4YHHK 3TANA 3HM8A 4JHDA 3R1XA 3HPOA 1HYSA 1RBTA 3O4WA 3O80A 3T7ZA 3KKRA 5IT9O 4ID5A 4WCEL 1GLAG 3ATVA 1UAXA 4N5SA 3O9TA 1D8YA 2P9SB 1NMNA 3ALYA 3SQ0A 2QWOA 4DSEA 2HBKA 2RPIA 3EN9A 4JK9A 5E41A 4FCYA 1IO2A 1KTQA 3LM9A 4FYDA 2XHBA 2JWKA 4E7LA 5LMNK 3LM2A 5ADXA 4BE1A 3VF2A 3RVCA 1Y64A 5KQDA 5C0YA 2F8SA 4PKHA 4KPYA 3U3GA 1VSEA 3O3FA 2A42A 5AQMA 2YKMA 1O13A 2PFUA 3BUZB 3ULEB 4AHRA 3KHYA 1D9FA 2F4VK 1K6YA 4I2PA 1N32K 3H1QA 3A2FA 2G8IA 3O8MA 4FLZA 1FXXA 4DR2K 1NU0A 4BR9A 5JLHA 1EWQA 4CHQA 1T3VA 4ISGA 4E7HA 2O8EA 5TKWA 3OS1A 4DR4K 4N47A 1HRHA 1HNVA 5KPZA 3RMAA 3K9JA 5CYMA 4B1VA 1GLCG 3NF6A 3K5LA 2IS3A 3SYZA 3EE9A 2I7PA 4AHTA 3HRGA 5GAHP 5EU7A 3K2PA 3NHGA 1ZBHA 4LSNA 2D0OA 1BU6O 3M6GA 4B9SA 4DTXA 4YFUA 1T44A 4OPKA 3QERA 4B9LA 4M3WA 1D5AA 3WXKA 4HUFA 4BVPA 3VENA 1C1AA 3L3UA
chains in the Genus database with same CATH topology
1TUYA 4BG8A 3D2EB 2ZJQL 3C7NB 3H1VX 3O9RA 2QWMA 4EAHD 5F2RA 1NLVA 1R59O 2QEXN 4CD3A 3LDPA 5FPEA 3RSEA 2CH6A 2CGKA 4CZJA 1SZ2A 3BP8A 2IVNA 3HZ6A 1NBWA 5KPTA 2UYTA 3AAQA 4BRMA 3WUHA 3SAGA 4FOEA 3SMPA 4AM7A 4O8UA 5KPRA 4IEIA 4WQ4A 4FWRA 2P9PB 3VEVA 3FZLA 4NLBA 3CJ1A 2ASMA 2P9IB 4BRFA 3CC7N 4I6MB 3D2EA 5C2DA 4FOIA 4MLEA 3MN6A 1YJWN 4C23A 3TTDA 3C7NA 2FF6A 3HI0A 3NMUA 4ILGB 5CR4A 1NGHA 3WXMB 3SBTA 2W41A 4CZLA 3WXJA 2P9NB 3ZYYX 4B1XB 4EHUA 3SAFA 3A0IX 3ZX2A 3CPWM 3KVGA 3O9QA 4RWTA 4KBOA 3ZETA 1QQMA 3CQYA 4H5TA 2ASPA 1Z05A 2P9UB 3GG4A 1DKGD 4U7BA 2YHWA 3NVMA 3AARA 4L3QA 1X9JA 3IFRA 4K42A 1KC8O 2ZGZA 4DCHA 1LOTB 2I7NA 2QXLA 2P9PA 2AA4A 3ZX0A 5BRHA 3W3DA 3MWTA 5AQKA 3B8AX 3E9PA 3J7ZO 4MDBA 2P9IA 3CCJN 5AQOA 4I6MA 2GWKA 1SQKA 4MO4A 1VQ4N 3C6HA 4WFAL 3VERA 1X3NA 4GVEA 4H0XB 4IOXA 4CZHA 3CMAN 5EXWA 1KD1O 1QZ6A 4BR0A 5M1NA 3H6EA 5LJWA 5M1PA 4IO8A 5M1QA 3WEEB 3P39A 1OKJA 1E4FT 3CJ9A 3EKSA 4IWVA 5JICA 2CH5A 3E1YA 1NGJA 4EFHA 3ID8A 1BA1A 3L0QA 2VGMA 1Q7YO 1MWMA 4BC2A 4FWPA 4BG9A 5BPNA 1QQNA 4NO7A 5FPMA 2E1YA 3EO3A 1BDGA 1RDUA 2NRHA 3Q7CA 3VOVA 5C10A 1VQPN 5GADP 3MN7A 5AQGA 2QWPA 2KHOA 5CHIA 1ZC6A 5MLCQ 2QW9A 1NGEA 3R6MA 2ZJRL 2NRZA 2P9LB 3BEXA 1XC3A 4PL8A 3QMLA 1VQON 3VEZA 2D1KA 5AFUH 5AQVA 4BRGA 4M7XA 5M1FA 1JJ2M 4IJNA 1V4SA 2FSKA 5C15A 4BRDA 1KAZA 3WEEA 1GLDG 2ZF5O 3OBYA 3CQXA 4WF9L 1NGAA 4YDUA 4BVOA 3KZBA 3R3LA 1BOTO 4FWSA 4BC4A 2V52B 3JS6A 3CC2N 1ATRA 3VMFB 5BRDA 1T6DA 4JKHA 4GV3A 2E2QA 1HLUA 1S3XA 2YX6A 4ISEA 3CCSN 3H3NO 1Q81O 3P4IA 1YITN 2GELA 4K25A 3CCVN 3WXIA 3AGRA 1HKGA 2YHXA 4A2AA 3VGLA 2A5XA 4JKGB 5BPMA 3OA9A 1WUAA 4H5RA 5EOYA 5AQPA 3J8AA 3CIPA 1K73O 2YCHA 2CGLA 5BREA 1NGGA 3L4IA 1BO5O 3K9KA 3DWLA 2P9LA 2WC9A 4PHTX 3UKUB 3IMXA 2YJEA 2YI1A 2E2OA 3MX2A 4A57A 4C1NI 5LJVA 4IFEA 4MO5A 1S22A 2RHKA 3C65A 5ELZA 3U4LA 5BPLA 5AQSA 2D4WA 3QBXA 3H3OB 4CJ7A 3AAPA 1JCGA 2E2NA 5FPNA 4KH4A 1YUWA 1N8RO 2NRTA 5AQYA 5M1OA 3CXCM 5E84A 3AGKA 3CCQN 1V4TA 2WUSA 2ZJPL 3SJHA 1HX1A 3G25A 5EX5A 3O1WA 3ATUA 5AZJB 1KAXA 2VGNA 1Q82O 2KKZA 4KH6A 3CCMN 4IJAA 4FL9A 1VQ7N 4JNEA 1KAYA 3CD6N 1TYQB 4HTLA 2HBLA 4A5AA 4Z94A 3PLAA 1U2VA 4JKGA 3R9PA 4B1ZA 3OHRA 1C0FA 2Q97A 4AM6A 2FLOA 4WFBL 2PAVA 4KH5A 2Q2RA 4CBWA 3OBWA 2J4RA 1RDWX 1NGFA 1GLLO 3UKUA 2E88A 3KWGA 3BF1A 4YOXA 4BR5A 4LC9B 2IVOA 1YAGA 3ZEUB 3N4QA 1NGCA 3R8EA 3UKRB 1ESVA 1J6ZA 2Q36A 5B8HA 3IKMA 5M1KA 3HOTA 1XQSC 2NRWA 3D7EO 3I33A 2E2PA 4H5NA 4K43A 4O5FA 1K8KB 4XEIA 3H45C 1K9MO 2QM1A 3HOSA 1EO1A 2Q1NA 2JWLA 4H5VA 5AZJA 5JLFA 1EQYA 1QQOA 3TTCA 3U9ZA 4BR2A 1DEJA 3L4QA 4JHDB 4QS7A 5GINA 3IDHA 3LDQA 3CF5L 1TYQA 1GLEG 2NNWA 1VAZA 2ZWHA 4IOCL 4O8KA 1P8ZA 1JCEA 4BRQA 3CCRN 4AF1A 3CERA 5DM6L 4JKEA 4JK7A 3O9SA 4BRHA 2V7ZA 1YXQA 1DGKN 4BY9C 3QFUA 4BRCA 4JD2B 3S41A 2A6AA 3MN5A 5BRFA 5HOOA 2FSJA 2WBNA 3ZEUA 2RE2A 1MWKA 1VQ9N 4FPBA 5AQFA 3O1BA 4H0OA 3UKRA 4FSVA 2W40A 3ID6A 2QWNA 1VQLN 3GDQA 5ADXH 3N4PA 3VTHA 3VTIA 2HSTA 3FE1A 1IJJA 3CJAA 3U8XA 3TPQA 3NVKA 3FFKB 1QVGM 3DXKB 4FO0A 1K8KA 3LL3A 4K41A 3VEWA 2OTLN 3JXUA 4IEEA 4B1YB 2P9NA 4IXCA 4BRAA 4PKGA 4CZKA 1YJNN 3TU5A 2AP1A 4QS9A 1G99A 4FWMA 4YORA 4YDUC 5LY3A 3AY9A 5E26A 3GL1A 2E20A 2P9UA 4F9OA 2P9KB 2Q0RA 4BQZA 2QA4N 3FZFA 4CZIA 5C2FA 5AQQA 3FGUA 4IOAL 2GTDA 3L6QA 4JD2A 5BN8A 1NGDA 4ILJA 4Y0WA 3TSQA 4EHTA 3PIPL 4GV9A 3C6AA 5AQLA 2GX9A 2HOEA 1HUXA 3WXLA 3G71N 4UY8O 5AZIB 1GLJO 2ZGYA 4JKCA 3CC4N 2NRRA 4ISFA 4BRPA 4CZGA 4GV6A 3LDLA 4BRNA 2A41A 3ENHA 4BREA 4CZEA 3QICA 1W2BM 3CCLN 3Q7BA 4XH5A 4G9ZA 2A3ZA 2V51B 2VCPA 3HSCA 3O6WA 3VF6A 1M90O 2PBDA 4MLHA 3VGMA 2EWSA 4BGAA 4RTFD 2WFBA 2VYPA 3ENOA 2OANA 3I56N 3QB0A 3EZWA 4BC5A 1ATNA 3SAHA 3I8BA 4JAXA 1BUPA 3M3ZA 5C12A 2P9KA 4FWOA 5AQTA 4E1JA 2FXUA 4CD1A 4H0VB 3FZHA 3TTFA 5I9EB 2Q0UA 4FVUA 4JN4A 3TSUA 5KQ8A 3VESA 5BR9A 1KXPA 4JK8A 5JVHL 5AZIA 4A59A 5AQXA 4CZFA 1BWFO 4J8FA 3FLCO 2BTFA 3SK3A 4QS8A 3VPZA 1Q18A 4DKWA 5H1SQ 3MK6A 4YOUA 3VETA 1NMDA 3VEXA 5FPDA 4FWKA 3MWPA 1VQMN 1SS6A 4GNIA 4CZMA 1RGIA 3G4SN 4C1NK 4JKAA 5EY4A 3RSEB 3WT0A 3CCEN 3M1FA 3D2FB 1E4GT 1QHAA 2A40A 3EKUA 4BGBA 4BR4A 3DLLL 2HF3A 5AQNA 3DAWA 3EE8A 1RFQA 4IZ9A 5AQUA 3DJCA 2IVPA 3WQUA 1S72N 3CJBA 2HBMA 5AQHA 3VGKA 2GUPA 3M5RA 1NGBA 4FWLA 3CETA 1OVYA 1D4XA 2VWBA 1HPMA 2CGJA 3G6EN 4H5WA 3I55N 1Z6RA 5AQIA 1K8AO 1M1KO 4U67L 3MDQA 5HL7L 4FWNA 3P31A 3MX5A 1LCUA 3CMEN 4CBXA 5GIPA 1MA9B 1DT9A 3O5BA 4M63C 4JKFA 5EVZA 1VQ8N 3KK7A 4JEPA 3H46O 3T69A 3MCPA 4PL7A 1BA0A 1C0GA 4B9QA 3D2FA 3A5MC 2QWQA 1QZ5A 3A5OC 2YJFA 2YHYA 3A8YA 1GLBG 3TSPA 3ZETB 1YHQN 1ZBSA 1U6ZA 2ASOA 1CZAN 1VQNN 1VQ6N 1P90A 2QWLA 4YOWA 3FZKA 3E9OA 3LDOA 3QBWA 1IG8A 2HMPA 3CPEA 2H3GX 3QFPA 4IDHA 3WQTA 2NRVA 3W0LA 4YOYA 2NZTA 1HJOA 1VQKN 1KQSM 4BC3A 3F2KA 2OTJN 4DHYA 4H03B 3O9UA 4NB4A 4A2BA 3MMVA 1QVFM 1YI2N 5AQZA 1YIJN 2NLXA 4BQLA 5CE3A 1GLFO 5GAEP 3CCUN 3KWIA 5F1XA 4M7YA 4A5BA 4YOVA 5JMVA 2NRXA 1JCFA 5DM7L 5AR0A 4B1WB 2GEMA 3PIOL 4HWIA 1NWKA 2GWJA 1HKBA 1YVNA 3VF4A 2F9WA 4XH1A 3HM8A 3GOIA 1XUPO 4JKDA 4JHDA 4XH4A 3R1XA 4WFNL 4NLCA 1NGIA 3O4WA 3O80A 3T7ZA 4DQ8A 5AQWA 3MCAB 4WCEL 1GLAG 3ATVA 4BRLA 1SAZA 2F9TA 2ITMA 3O9TA 2P9SB 4FWQA 5JVGL 1VQ5N 5TKYA 3O08A 2QWOA 4OPAA 4BRKA 4CI6A 2HBKA 5F0XA 3EN9A 4JK9A 4ILHA 3CJCA 3CJ7A 3HBTA 3BF3A 3HTVA 3CI5A 4A61A 3FR0A 4R79A 3DXMB 3LM9A 3MN9A 2JWKA 1MDUB 3SMSA 3GBTA 2E1ZA 2BUPA 2QI2A 3LM2A 3D6RA 3DXKA 5ADXA 3SLCA 1BG3A 3U9DA 2BH1A 3UB5A 3VF2A 3CHWA 1Y64A 1X3MA 3RVCA 4MDAA 4H0YB 5AQRA 1NM1A 5GAGP 5KQDA 5C0YA 3VEOA 4PKHA 2E8AA 2FSNA 1T6CA 3GE1A 3F9MA 2A42A 5AQMA 5BN9A 1O13A 2PFUA 3BUZB 3ULEB 4BRIA 5GIOA 2IIRA 1Q86O 2D0PA 4WYBA 3KHYA 4H0TB 3H1QA 2P9SA 4B1UB 3O8MA 3LDNA 3ZX3A 4BROA 4WQ5C 4BR9A 3E66A 3E9LA 5JLHA 3QDKA 1NJIO 4OO1J 1T3VA 4PKIA 4ISGA 4YOTA 1HKCA 3DXMA 3UE5A 3VEYA 5TKWA 3A5LC 3C0BA 2HBJA 3P38A 4DB3A 5KPZA 1YF5L 3FZMA 3A5NC 2QWRA 5AFUA 3F5TA 1TUUA 1H1VA 3K9JA 3EL2A 1ILYA 4EIAA 4B1VA 1GLCG 2V7YA 2Q31A 3EE9A 4H0PA 3ENBA 4GY2B 5AQJA 1W97L 4JKBA 2I7PA 1U2VB 3ULEA 3HRGA 2DPNA 5GAHP 3OW2M 2FF3B 2KLAA 2D0OA 2HF4A 1BU6O 2F7TA 3M6GA 3SBGA 1T44A 4OPHA 4IO9L 1ZXOA 4RCHA 4CBUA 4WQ5A 1YJ9N 2QTDA 1WOQA 4WQ4C 3WXKA 3IUCA 4BVPA 4FPAA 3VENA 1ATSA 4BR7A 4A62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF9 L;  1VQK N;  1KQS M;  2ZJQ L;  2OTJ N;  3CC2 N;  2QA4 N;  1QVF M;  1YI2 N;  1YIJ N;  3CCS N;  1Q81 O;  4IOA L;  1YIT N;  5GAE P;  3PIP L;  3CCU N;  3CCV N;  2QEX N;  5DM7 L;  3G71 N;  4UY8 O;  3PIO L;  3CC4 N;  1K73 O;  1W2B M;  3CCL N;  1M90 O;  4WFN L;  4WCE L;  3I56 N;  1N8R O;  3CXC M;  3CC7 N;  3CCQ N;  2ZJP L;  5JVG L;  1VQ5 N;  1YJW N;  1Q82 O;  3CCM N;  1VQ7 N;  3CD6 N;  3CPW M;  5JVH L;  4WFB L;  5H1S Q;  5GAG P;  1VQM N;  1KC8 O;  3G4S N;  3CCE N;  1Q86 O;  3J7Z O;  3DLL L;  3CCJ N;  1K9M O;  1VQ4 N;  4WFA L;  1S72 N;  3CMA N;  1OVY A;  1KD1 O;  3CF5 L;  1NJI O;  3G6E N;  3I55 N;  1K8A O;  4IOC L;  1M1K O;  4U67 L;  5HL7 L;  3CCR N;  1Q7Y O;  5DM6 L;  3CME N;  1VQ8 N;  1ILY A;  1VQP N;  1VQ9 N;  5GAD P;  1VQL N;  5MLC Q;  5GAH P;  3OW2 M;  2ZJR L;  1YHQ N;  1QVG M;  1VQN N;  1VQO N;  1VQ6 N;  2OTL N;  4IO9 L;  1YJ9 N;  1JJ2 M;  1YJN N; 
#chains in the Genus database with same CATH topology
 3LP2 A;  2O8C A;  4BG8 A;  3OYB A;  3VQ5 A;  2O4I A;  3CM5 A;  3RTV A;  3PSF A;  5DK5 A;  1NLV A;  2I5J A;  3DI6 A;  2QEX N;  2YNI A;  3LDP A;  4CVN E;  3RSE A;  2CH6 A;  2O8B B;  4CZJ A;  1SZ2 A;  3CFO A;  3AAQ A;  3WUH A;  4KHQ A;  3HP9 A;  3SMP A;  2O8D A;  4O8U A;  2W42 A;  4FWR A;  4JLH A;  3KK3 A;  2Z1I A;  1N34 K;  2B5J A;  4NLB A;  3CJ1 A;  3J7A P;  4JS5 A;  1BGX T;  1YJW N;  4C23 A;  3SQ1 A;  3C7N A;  3NMU A;  4GKJ K;  2VQE K;  3OY9 A;  5A2Q O;  3PSI A;  4EHU A;  4F2S A;  3KVG A;  4DTR A;  3SPY A;  3CFP A;  5C25 A;  3AA3 A;  5DMR A;  4DSL A;  4JI6 K;  3NVM A;  2IAJ A;  4L3Q A;  4AHC A;  4FJ8 A;  2ZGZ A;  4DCH A;  1C1C A;  4KTW A;  5BR8 K;  2QXL A;  3H08 A;  4JRQ A;  2AA4 A;  4CK2 A;  5BRH A;  3W3D A;  3VQA A;  1C6V A;  4NXM K;  4MDB A;  3CCJ N;  4MO4 A;  4WFA L;  2G8K A;  3AVL A;  2PYL A;  4KHU A;  3MEE A;  1VSD A;  5EXW A;  5J2P A;  3U3Y A;  4E1N A;  5JIC A;  3L0Q A;  2D0A A;  2VGM A;  1MWM A;  1RT5 A;  4BC2 A;  2HHH K;  1IH7 A;  4LSL A;  1N5Y A;  3VOV A;  1N33 K;  1X9M A;  5C10 A;  3QES A;  5CHI A;  2QXF A;  4M3T A;  4DLG A;  3O4Q A;  4FJG A;  1XC3 A;  3KIO A;  3B6P A;  3PUF A;  4NCA A;  4BRG A;  3HPH A;  4O4G A;  1V4S A;  4GW6 A;  4X65 K;  4QAG A;  3WEE A;  1U45 A;  1RT1 A;  4BVO A;  2WOM A;  4FWS A;  3CC2 N;  2KZM A;  5BRD A;  1T6D A;  1HLU A;  4ISE A;  3CCV N;  4A2A A;  2YHX A;  1BI4 A;  4RW4 A;  4B9V A;  2HHX A;  5AQP A;  3EZ5 A;  2W6K A;  3NF8 A;  4FK4 A;  2P9L A;  3IMX A;  4C1N I;  5LJV A;  4IFE A;  2KFN A;  4CJ7 A;  3AAP A;  1JCG A;  2E2N A;  5FPN A;  4LF7 K;  1N8R O;  1VSM A;  4Z4G A;  3AGK A;  5AZJ B;  5J2Q A;  1KAX A;  4K8Z A;  2VGN A;  1Q82 O;  4KH6 A;  4IJA A;  3ZT4 A;  1VQ7 N;  4RW6 A;  4KB1 A;  4AM6 A;  3AVN A;  2FLO A;  3VQ8 A;  1WLJ A;  4H8K A;  2PAV A;  4CFB A;  3OBW A;  1ZBI A;  4N76 A;  1MU2 A;  2E88 A;  3BF1 A;  4CFA A;  3S9H A;  2IVO A;  1L3S A;  3ITH A;  4JI5 K;  4O5F A;  4LF9 K;  4XEI A;  4H5N A;  3NGZ A;  2Q3S A;  3EEQ A;  1QQO A;  3F9K A;  5GIN A;  1DEJ A;  3CF5 L;  5HRR A;  4AH9 A;  2O8F A;  4O8K A;  1P8Z A;  3CCR N;  4AF1 A;  1Q8I A;  3C95 A;  4CEA A;  4JI0 K;  4GKK K;  4CJS A;  1SL2 A;  3S41 A;  3MN5 A;  2ZE2 A;  5HOO A;  3OYC A;  2WBN A;  3ZEU A;  1VSK A;  2E4L A;  4CEQ A;  2G8F A;  4W5N A;  2QWN A;  5HRO A;  1VSL A;  3GDQ A;  2UUB K;  4FM2 A;  3FE1 A;  1IJJ A;  3U8X A;  1QVG M;  3P5J A;  1K8K A;  1HNX K;  1F21 A;  3VEW A;  1RTJ A;  3PO5 A;  2AP1 A;  2B4J A;  4FWM A;  4LF5 K;  4YY3 K;  3BY5 A;  1FW6 A;  1WBB A;  4LFB K;  4E7I A;  4OKK A;  4GMJ B;  4F9O A;  4CEC A;  2P9K B;  5C2F A;  3FGU A;  3B6O A;  1O1W A;  4IOA L;  1RDB A;  4Y0W A;  2IOC A;  4EHT A;  4B3T K;  1KLN A;  5AQL A;  2HOE A;  1WNS A;  3HP6 A;  2ZGY A;  4JKC A;  3CC4 N;  4ISF A;  4CZG A;  3LDL A;  4BRN A;  2A41 A;  2FBV A;  3D0P A;  3V1O A;  4CZE A;  3MEC A;  5CZ1 A;  3BZK A;  1JLA A;  4MLH A;  3VGM A;  5KGW A;  5HP1 A;  3HO1 A;  4RTF D;  2WFB A;  4FJH A;  3QB0 A;  3EZW A;  1ATN A;  1NJW A;  3OS0 A;  4UQG A;  1HPZ A;  5C12 A;  3L2U A;  4FWO A;  4CF0 A;  2YNG A;  3TTF A;  1LW2 A;  1HNZ K;  2Q0U A;  4FVU A;  3S3N A;  3VES A;  5BR9 A;  4JK8 A;  1WAJ A;  5JVH L;  4CZF A;  5AQX A;  4QS8 A;  4FLT A;  3WNG A;  3MK6 A;  3THW B;  4DTS A;  3QEP A;  4FWK A;  1WN7 A;  4GNI A;  1LAV A;  2IC3 A;  4CJW A;  4JKA A;  5EY4 A;  3M1F A;  3D2F B;  1E4G T;  4CCH A;  3OYH A;  3EE8 A;  3NBP A;  3AV9 A;  2LSN A;  1E3M A;  3OVN A;  2E5L K;  4PQU A;  1VRT A;  2GUP A;  2OPR A;  3CET A;  3OS2 A;  4Z4I A;  2VWB A;  3I55 N;  4B9T A;  5AQI A;  1M1K O;  3MX5 A;  1LCU A;  3CME N;  4B8C A;  5GIP A;  1DT9 A;  4HVJ A;  4X64 K;  5EVZ A;  3HL8 A;  4JEP A;  3KLG A;  4PL7 A;  2VWK A;  3CQ8 A;  4B9Q A;  4LF6 K;  3VQB A;  1QZ5 A;  4CHP A;  3ZET B;  1GLB G;  3U6F A;  4OKE A;  1CZA N;  1VQN N;  1P90 A;  4PUO A;  3NCI A;  3FZK A;  4NYF A;  2BDP A;  4FJJ A;  4C8L A;  1IG8 A;  3CPE A;  3DYA A;  4IDH A;  3W0L A;  1KFS A;  3ZSY A;  4HCC A;  4KHY A;  1VQK N;  3F2K A;  2OTJ N;  4FLX A;  3DLG A;  4NB4 A;  2PY5 A;  4A2B A;  1QVF M;  1ZBL A;  4OLA A;  4BQL A;  1IBL K;  4CF1 A;  2G8H A;  4EZ9 A;  2NUB A;  2OPP A;  1TVR A;  1NWK A;  3C6T A;  3VF4 A;  4HUG A;  3MXI A;  1FKO A;  1XC9 A;  2P5G A;  3WNF A;  4JI1 K;  1KFD A;  4XH4 A;  3HM9 A;  2DFE A;  4KTQ A;  4CFD A;  2YHA A;  3KK2 A;  3MCA B;  1WAF A;  3BZC A;  1SAZ A;  2ITM A;  2OZM A;  4OX9 K;  4FWQ A;  3SCX A;  3O08 A;  4OPA A;  1SL1 A;  1UOC A;  1VSH A;  4FJ5 A;  3CJC A;  1RBU A;  3CI5 A;  4LH4 A;  2O8E B;  4CF8 A;  1BIU A;  2QI2 A;  3D6R A;  2XY6 A;  3SLC A;  4X66 K;  3U9D A;  4CEF A;  4B9M A;  5AQR A;  1NM1 A;  2GBZ A;  2HVH A;  2FSN A;  3J7Y P;  3GE1 A;  3LDS A;  1WSF A;  4FLV A;  5GIO A;  4FJ7 A;  1Q86 O;  4WYB A;  3SUQ A;  4H0T B;  1NOY A;  4DTO A;  3TAG A;  3LDN A;  1VRU A;  3ZX3 A;  3NDK A;  2AJQ A;  3E9L A;  3V4I A;  1NJI O;  3ZT3 A;  5J2M A;  3S3M A;  3HT3 A;  3UE5 A;  3VEY A;  1NJX A;  2UUC K;  4DU3 A;  2O8C B;  4DB3 A;  1YF5 L;  3FZM A;  3A5N C;  2QWR A;  5AFU A;  3M8P A;  2P5O A;  4FW1 A;  1ILY A;  4EIA A;  2V7Y A;  2Q31 A;  1TAQ A;  5AQJ A;  1W97 L;  4F2R A;  4DV4 K;  1RT2 A;  2HND A;  2R7Y A;  2FF3 B;  2XRI A;  3SBG A;  4IO9 L;  2O8D B;  4CBU A;  1YJ9 N;  2EX3 A;  2XY7 A;  3QIN A;  2UXB K;  1ATS A;  1VHX A;  4XIU A;  1SV5 A;  3NGI A;  3K5N A;  2ZJQ L;  3C7N B;  3O9R A;  3ULD A;  3QLH A;  4B9N A;  1VSI A;  3L2W A;  4Y1C A;  4BAC A;  3BP8 A;  4DF4 A;  5CZ2 A;  3QNN A;  2UYT A;  4Q5V A;  3ZT1 A;  4DMN A;  1NNE A;  4AM7 A;  1NJY A;  5KPR A;  3ASM A;  1OH8 A;  4DQR A;  2HNZ A;  1X9W A;  1T8E A;  4G1Q A;  4J2D A;  4BRF A;  1CXU A;  3CC7 N;  3T1H K;  3D2E A;  4NCG A;  4ILG B;  2W41 A;  3LAM A;  1QHT A;  1LWC A;  4B1X B;  3AO2 A;  3V9S A;  4AHV A;  3ZSZ A;  1VSF A;  4RWT A;  3ZET A;  2FBY A;  1LWF A;  3GG4 A;  3K59 A;  1X1P A;  1OVQ A;  3AAR A;  2ZM6 K;  3IFR A;  1KC8 O;  2P9P A;  4IG0 A;  4DR1 K;  1J54 A;  3MWT A;  3J7Z O;  2P51 A;  4I6M A;  2GWK A;  2D5R A;  1VQ4 N;  4IOX A;  4GVE A;  4H0X B;  4OJR A;  4M41 A;  4CZH A;  3CMA N;  1QZ6 A;  4WE1 A;  4BR0 A;  4RW7 A;  3H6E A;  5M1N A;  5SWM A;  5M1Q A;  3WEE B;  1OKJ A;  4JI7 K;  1E4F T;  3EKS A;  4DV5 K;  4IWV A;  3E1Y A;  4IG3 A;  1NGJ A;  3QEX A;  3OYN A;  1B92 A;  4CIE A;  4ICL A;  4FWP A;  3NH2 A;  1QQN A;  1RDD A;  1Y97 A;  3PX0 A;  1TKD A;  2E1Y A;  1BDG A;  2UXD K;  1BI4 B;  2QKK A;  3SZ2 A;  4DQQ A;  5GAD P;  2YV0 X;  3MN7 A;  2KHO A;  5MLC Q;  1ZC6 A;  2QW9 A;  3R6M A;  4EP4 A;  2NRZ A;  2P9L B;  3DRR A;  1J9A A;  3WNH A;  1VQO N;  3VEZ A;  5AFU H;  1JJ2 M;  3RRG A;  5C15 A;  4FZY A;  3AVA A;  4W5T A;  1KAZ A;  4DTJ A;  3CQX A;  1IKW A;  1NGA A;  4M3Z A;  1S5J A;  1UA0 A;  4BC4 A;  3JS6 A;  4N56 A;  3NFA A;  1XI1 A;  1JLG A;  3AA4 A;  1BIZ A;  4GV3 A;  1S3X A;  3I0S A;  3AVF A;  3P4I A;  2GEL A;  3WXI A;  3IS9 A;  1HKG A;  3M8R A;  1JXB A;  3NE6 A;  3VGL A;  1WBD A;  1HYZ A;  1K73 O;  5BRE A;  1NGG A;  3L4I A;  1EP4 A;  4DLE A;  5K14 A;  2E2O A;  4MO5 A;  2FC0 A;  4LF4 K;  5AQS A;  2D4W A;  1NKC A;  3L2V A;  3H3O B;  4JI8 K;  3K5M A;  4KH4 A;  1EET A;  1NKB A;  2A1S A;  3OYL A;  1ZBF A;  3CFR A;  5AQY A;  3CXC M;  1V4T A;  4FZZ A;  2WUS A;  3SJH A;  3G25 A;  1HYV A;  3OJS A;  3HVR A;  3CCM N;  4DUY K;  4E7J A;  4EP5 A;  4HTL A;  3PLA A;  3SUP A;  4JKG A;  2KTQ A;  2O8F B;  1DTQ A;  3THY A;  3VQD A;  3KLH A;  4IBN A;  1RDW X;  1GLL O;  1Q9Y A;  1RT7 A;  2UU9 K;  3IG1 A;  4YOX A;  4KHN A;  3ZEU B;  4MFB A;  3N4Q A;  4M42 A;  1J6Z A;  3P83 D;  3EY1 A;  5B8H A;  3IKM A;  5M1K A;  3PO4 A;  1XQS C;  4K43 A;  4DR3 K;  4O5B A;  2JLE A;  1K8K B;  4F3T A;  3K5O A;  4BR2 A;  3L4Q A;  1HQU A;  2Z1H A;  3IDH A;  4CJL A;  1TYQ A;  1GLE G;  2NNW A;  1VAZ A;  1KVA A;  4CW7 B;  4ELV A;  3DLK A;  1JCE A;  3NH1 A;  1J5O A;  3O9S A;  4HTU A;  1DGK N;  3NAE A;  3QFU A;  1A5X A;  1VSJ A;  2FSJ A;  5AQF A;  1VQL N;  3UKR A;  4FSV A;  3ID6 A;  1WSI A;  5ADX H;  1NK9 A;  3LZJ A;  3LPT A;  2HST A;  3CJA A;  3TPQ A;  1XHZ A;  2OTL N;  4IEE A;  4J2A A;  4B1Y B;  2X74 A;  4PKG A;  3TU5 A;  4QS9 A;  4YOR A;  3AY9 A;  1FJG K;  5E26 A;  3GL1 A;  3QEI A;  1WB9 A;  1W9H A;  4DTM A;  4M3X A;  2QA4 N;  5FRN A;  3FZF A;  5AQQ A;  4FM1 A;  3OYK A;  2GTD A;  1RTI A;  3AVK A;  3L6Q A;  3PIP L;  3TSQ A;  1T03 A;  3C6A A;  2GX9 A;  1TV6 A;  1HUX A;  1C0T A;  1GLJ O;  2UUA K;  4BRP A;  1TKX A;  1EWR A;  5T7B A;  1ASW A;  1W2B M;  1LWE A;  4XH5 A;  2VCP A;  1M90 O;  4G9Z A;  3O6W A;  3VF6 A;  2EWS A;  1FKP A;  2OAN A;  1KLM A;  3I56 N;  3SAH A;  3I8B A;  4JAX A;  3K57 A;  1JLQ A;  1G15 A;  3M3Z A;  3JSM A;  4H0V B;  2QK9 A;  4KRF A;  2VWJ A;  3SJJ A;  4KHS A;  4FM0 A;  4DWI A;  3KTQ A;  5AZI A;  4J8F A;  2BTF A;  4DKW A;  3VET A;  1JLE A;  1ITG A;  3SPZ A;  4BDZ A;  4IFY A;  4DV2 K;  4C8O A;  4CZM A;  1RGI A;  3WT0 A;  4O44 A;  1QHA A;  4BR4 A;  3DLL L;  4DTN A;  2HF3 A;  5AQN A;  4YNQ A;  4RW9 A;  2OPQ A;  4IZ9 A;  3DJC A;  3C94 A;  4B8A B;  3MAQ A;  5AQH A;  3V9Z A;  4FWL A;  1OVY A;  2OCE A;  2CGJ A;  3DLH A;  1K8A O;  5CY4 A;  3P31 A;  4QCL A;  3FFI A;  3KK7 A;  3H46 O;  4KRE A;  3MCP A;  4AHS A;  3TAB A;  3AO4 A;  1W0H A;  1BA0 A;  1C0G A;  2QWQ A;  3SQ2 A;  4CF2 A;  3A8Y A;  4DTU A;  1RBS A;  1ZBS A;  2QWL A;  4YOW A;  4CJR A;  3E9O A;  3QBW A;  3LDO A;  3L2R A;  4DR5 K;  4CHZ A;  2HMP A;  3QFP A;  3WQT A;  4YOY A;  2NZT A;  3ZT0 A;  3VN5 A;  3T1A A;  4BE0 A;  4B3S K;  4DHY A;  2DY4 A;  3V1Q A;  3ZSQ A;  1YI2 N;  2BE2 A;  5AQZ A;  4CEB A;  3SV3 A;  1YIJ N;  2NLX A;  3TAF A;  5CE3 A;  4YOV A;  3ZSW A;  5I42 A;  1JCF A;  5DM7 L;  5AR0 A;  4B1W B;  3L3V A;  3PIO L;  1TGO A;  1RDC A;  1YVN A;  4CJK A;  2F9W A;  5KGX A;  1RDA A;  2FBX A;  1XUP O;  2XY8 A;  3KLE A;  1REV A;  4PA1 A;  1BCO A;  1FK9 A;  4OGE A;  5AQW A;  4BRL A;  2F9T A;  2HHT A;  1NK4 A;  5JVG L;  1XMO K;  1JLB A;  1VQ5 N;  1J53 A;  5TKY A;  4BRK A;  3VQ9 A;  2HMI A;  4M3Y A;  1NK5 A;  5F0X A;  1U4B A;  4ILH A;  3CJ7 A;  3HBT A;  1S9E A;  3BF3 A;  4A61 A;  3FR0 A;  4R79 A;  3MN9 A;  4CK1 A;  1MDU B;  3SMS A;  1BCM A;  2E1Z A;  3KLI A;  2BUP A;  3K58 A;  4E7K A;  1YT3 A;  3CHW A;  1X3M A;  4MDA A;  4H0Y B;  5GAG P;  5FDL A;  2Y1I A;  5D3G A;  5FRM A;  4TSX A;  2P1J A;  3JAM O;  4BRI A;  5BN9 A;  1WSH A;  4LF8 K;  1RBR A;  4FVM A;  4B1U B;  4CHO A;  1WSJ A;  3E66 A;  3QDK A;  1EX4 A;  3DXM A;  1DTT A;  4BDP A;  4KB0 A;  3A5L C;  3C0B A;  4CJU A;  1N36 K;  2EHG A;  1NK8 A;  1H1V A;  4HUE A;  1LAW A;  3OYM A;  4O55 A;  5CYQ A;  1S1W A;  4GY2 B;  4H4O A;  4JKB A;  1SKS A;  1U2V B;  4DSF A;  1J5E K;  1I3A A;  2YHB A;  4MQ3 A;  2HF4 A;  4CFC A;  3M8S A;  5J1E A;  1WOQ A;  4KHW A;  3IUC A;  3OJU A;  3KLF A;  4KV8 A;  3QEW A;  4E19 A;  1TUY A;  4DV1 K;  3VQQ A;  4FLW A;  3D2E B;  3OTO K;  4CGH A;  3QET A;  4ZHR A;  4LD0 A;  1R59 O;  4JS4 A;  1S1U A;  3SUN A;  3TAM A;  5KRT A;  3ZSV A;  2RKI A;  2IVN A;  3HZ6 A;  4CER A;  3T1Y K;  5KPT A;  4BRM A;  3C6U A;  3SAG A;  3LP1 A;  1HR0 K;  3ZCM A;  3LWL A;  3DOK A;  4IEI A;  1IBK K;  4JV5 K;  2HW3 A;  2JGU A;  2P9P B;  3VEV A;  1HNI A;  1KVB A;  4I6M B;  5HBM A;  3MN6 A;  4E89 A;  2WTU A;  2KQ2 A;  3SBT A;  4CZL A;  3WXJ A;  2YNH A;  3ZYY X;  3A0I X;  2IGI A;  3CPW M;  4FJM A;  4QOZ B;  1BL3 A;  3SQ4 A;  4H5T A;  3OYD A;  1RTD A;  2P9U B;  2YHW A;  4A62 A;  3V9X A;  1X9J A;  4CJQ A;  4B9U A;  5AJ3 K;  1CZ9 A;  4M3U A;  4M3R A;  2I7N A;  1VK0 A;  3ZX0 A;  3NF7 A;  3RMB A;  2P9I A;  2D0C A;  1SQK A;  1NG9 A;  4H4M A;  4X62 K;  1A5V A;  4FJX A;  3DM2 A;  3QIO A;  5LJW A;  2DFF A;  5M1P A;  4BWJ A;  2XY5 A;  3P39 A;  4NXN K;  4KI4 A;  2CH5 A;  4EFH A;  3ID8 A;  1U04 A;  1Q7Y O;  4BG9 A;  3KD5 E;  1L3U A;  5FPM A;  4CIF A;  4LFA K;  2E6M A;  1VQP N;  5AQG A;  2QWP A;  3G0Z A;  1RBV A;  2ZJR L;  1XWL A;  3BEX A;  3SNN A;  3QML A;  3DRS A;  2IDO A;  3O3G A;  5AQV A;  4M7X A;  5M1F A;  4IJN A;  3LWM A;  1Z26 A;  1U49 A;  2PZS A;  4BRD A;  1GLD G;  3SI6 A;  2ZF5 O;  4CJT A;  2Y1J A;  2VG7 A;  3RRH A;  4E0D A;  3DLB A;  4YDU A;  3KZB A;  3TAQ A;  1ATR A;  3VMF B;  4JKH A;  2E2Q A;  1W7A A;  1C1B A;  2YX6 A;  3I8D A;  3CCS N;  3H3N O;  1NKE A;  1YIT N;  4M45 A;  1NK6 A;  2A5X A;  1ZBU A;  4JKG B;  2ATQ A;  3LAN A;  4H5R A;  1WUA A;  5EOY A;  3VQC A;  3J8A A;  3CIP A;  3THY B;  5HRP A;  2YCH A;  1BO5 O;  3K9K A;  2WC9 A;  4PHT X;  2YI1 A;  4A57 A;  4KHP K;  2KZZ A;  4NYN A;  4DS4 A;  1S22 A;  2RHK A;  3C65 A;  5ELZ A;  3U4L A;  4KKO A;  3QBX A;  1WSG A;  1YTU A;  3MEG A;  3DLR A;  1YUW A;  4KFB A;  5M1O A;  1HX1 A;  1JLC A;  2KKZ A;  4JNE A;  1KAY A;  3RWU A;  1TYQ B;  3PX4 A;  2HBL A;  4FW2 A;  4LH5 A;  1U2V A;  3BGR A;  3R9P A;  4B1Z A;  3OHR A;  1C0F A;  4WFB L;  3UKU A;  2ETJ A;  3TAR A;  1NGC A;  3R8E A;  3UKR B;  4DV7 K;  4FK0 A;  3D7E O;  3I33 A;  2E2P A;  1K9M O;  1EO1 A;  3HOS A;  2JWL A;  3VA3 A;  1DLO A;  4K0K K;  4RW8 A;  3RMD A;  4OLB A;  4QS7 A;  2ZWH A;  3L2Q A;  2OYQ A;  4BRQ A;  3SUO A;  1SKW A;  4I2Q A;  1NJZ A;  4JKE A;  1ZYQ A;  1YXQ A;  1XMQ K;  2A6A A;  3DRP A;  2RE2 A;  2W40 A;  1GOC A;  3N4P A;  3VTH A;  2KW4 A;  3VTI A;  2FBT A;  4CEE A;  3AVM A;  3DXK B;  4FO0 A;  4CHY A;  3JXU A;  2HB5 A;  4CJV A;  4IXC A;  4BRA A;  2HHU A;  4CES A;  1BHL A;  4CEZ A;  5LY3 A;  3HK2 A;  4FJL A;  2P9U A;  3SV4 A;  2Q0R A;  2XO7 A;  4BQZ A;  4DR7 K;  4PY5 A;  1SKR A;  1KSP A;  4JD2 A;  4ILJ A;  4GV9 A;  4BE2 A;  3T3F A;  3CYM A;  5AZI B;  3LP3 A;  4C8K A;  4GV6 A;  4W5R A;  1N6Q A;  1RT4 A;  1BQM A;  2GUI A;  3QIC A;  3CCL N;  3Q7B A;  5LMU K;  2V51 B;  3HSC A;  2PBD A;  1UA1 A;  4CK3 A;  3KD1 E;  4Y1D A;  1XNR K;  3ENO A;  4Z0U A;  4ELT A;  2PYJ A;  1BUP A;  3TAP A;  5KTQ A;  5AQT A;  4KTZ A;  4DV0 K;  2WON A;  1RT3 A;  4JN4 A;  1KXP A;  4A59 A;  5JS1 A;  1WSE A;  2ITG A;  3SK3 A;  3VPZ A;  1Q18 A;  2G8W A;  3VEX A;  3ZSR A;  5FPD A;  2X78 A;  1KRP A;  1VQM N;  4FLY A;  1SS6 A;  1NK7 A;  4ID1 A;  3G4S N;  4AQY K;  3EKU A;  5C24 A;  4F8R A;  1RFQ A;  5AQU A;  4PWD A;  1B9D A;  4V19 S;  3WQU A;  1S72 N;  3CJB A;  2HBM A;  3VGK A;  1NGB A;  1U47 A;  4CJ4 A;  4H5W A;  4DFK A;  4F4K A;  1QE1 A;  2B6A A;  3MDQ A;  4CBX A;  4CGF A;  1MA9 B;  1S1V A;  4M63 C;  4JKF A;  4CJF A;  3T69 A;  3O3H A;  3THX A;  3OYA A;  3A5M C;  4OKJ A;  1TK5 A;  1NK0 A;  2YHY A;  1YHQ N;  1KCF A;  1LV5 A;  4DQI A;  1U6Z A;  1VQ6 N;  3THV A;  1CXQ A;  1L5U A;  3AVI A;  1NOZ A;  3I0R A;  3CM6 A;  2BAN A;  4BWM A;  1T05 A;  1TL3 A;  5KRS A;  4DFP A;  4H03 B;  3O9U A;  1HQE A;  1GLF O;  5GAE P;  2YKN A;  3KWI A;  4M7Y A;  4A5B A;  3QEV A;  4KI6 A;  1OH6 A;  1HKB A;  2GV9 A;  3GOI A;  4B3O A;  4JKD A;  4WFN L;  4NLC A;  5SZT A;  1NGI A;  4ELU A;  4DQ8 A;  2UXC K;  3DLE A;  5HRS A;  2ZQB A;  4CI6 A;  3NF9 A;  3M8Q A;  2O4G A;  4Z4C A;  2A1R A;  1IKV A;  3D45 A;  4K8X A;  2X6N A;  3HTV A;  3DXM B;  4E1M A;  5IWA K;  3GBT A;  1TKT A;  3DXK A;  4FJ9 A;  1BG3 A;  4DV3 K;  2BH1 A;  3UB5 A;  4Z4F A;  3VEO A;  2E8A A;  4FXD A;  1T6C A;  3OYE A;  1IKX A;  3F9M A;  4CE9 A;  4CJ5 A;  1R0A A;  2IIR A;  2D0P A;  3DOL A;  1HNW K;  3QNO A;  2F96 A;  4JYA K;  4KO0 A;  2P9S A;  2HHW A;  4BRO A;  3LAL A;  4WQ5 C;  3VQ7 A;  4OO1 J;  3T19 A;  1KVC A;  4PKI A;  4YOT A;  3J80 O;  1HKC A;  3ZT2 A;  2HBJ A;  3P38 A;  4JI4 K;  3V9U A;  5J2N A;  3F5T A;  1TUU A;  3EL2 A;  1RNH A;  3MED A;  3BDP A;  4DV6 K;  4CGD A;  4H0P A;  1S6P A;  3ENB A;  4FLU A;  3ULE A;  3TI0 A;  2ZD1 A;  3OW2 M;  2DPN A;  1EKE A;  3OYG A;  2KLA A;  3VQ4 A;  2F7T A;  4OPH A;  3HYF A;  1ZXO A;  4RCH A;  4WQ5 A;  2QTD A;  4E3S A;  4WQ4 C;  2HHV A;  4FPA A;  1QSS A;  4BR7 A;  1IG9 A;  1TK8 A;  3AA2 A;  3H1V X;  1L3T A;  2QWM A;  4EAH D;  4O0I A;  5F2R A;  3OYF A;  4DSK A;  3KJV A;  4DG1 A;  4CD3 A;  5FPE A;  3J81 O;  2CGK A;  2F8T A;  3TR8 A;  3PV8 A;  1C0M A;  1NBW A;  3O4N A;  1S1T A;  3F73 A;  4FOE A;  1QSY A;  5I3U A;  1T7P A;  4OPJ A;  3ISN C;  2VG5 A;  4WQ4 A;  3FZL A;  3L8B A;  4DU4 A;  2X6S A;  2ASM A;  2P9I B;  4J2B A;  5C2D A;  4FOI A;  4LY7 A;  4MLE A;  3RR8 A;  2HHQ A;  3TTD A;  5HRN A;  2FF6 A;  3HI0 A;  5CR4 A;  4JI2 K;  1SL0 A;  1NGH A;  3WXM B;  3TAE A;  2P9N B;  4IFV A;  3SAF A;  3ZX2 A;  2O8B A;  3DMJ A;  3O9Q A;  4KBO A;  1QQM A;  3CQY A;  2ASP A;  1RIL A;  1Z05 A;  1DKG D;  4U7B A;  4OVL A;  3KK1 A;  4K42 A;  4DSI A;  1LOT B;  5AQK A;  3B8A X;  3E9P A;  3VQP A;  3LPU A;  3HVT A;  5AQO A;  5JS2 A;  3ZSX A;  3C6H A;  4R5P A;  3VER A;  1QSL A;  1X3N A;  4O0J A;  5HLF A;  4ZTJ A;  1KD1 O;  4IO8 A;  1TAU A;  4B3R K;  3CJ9 A;  3MXM A;  3LP0 A;  1BA1 A;  1D9D A;  4DSJ A;  5BPN A;  4NO7 A;  3EO3 A;  4F3O A;  1RDU A;  2NRH A;  3Q7C A;  4CHN A;  2HHS A;  2OA8 A;  1CZB A;  3CG7 A;  1NGE A;  3HXM A;  4OGC A;  3NH0 A;  4PL8 A;  2D1K A;  3VQE A;  2FSK A;  2OZS A;  3OBY A;  4Z4H A;  4WF9 L;  1OH7 A;  1YTA A;  3R3L A;  1BOT O;  2V52 B;  4W5Q A;  1X9S A;  1Q81 O;  3VQ6 A;  3KKS A;  4K25 A;  3AGR A;  3S3O A;  3MXJ A;  5BPM A;  3OA9 A;  3V1R A;  1ASU A;  1S1X A;  2CGL A;  3DWL A;  1JXE A;  3UKU B;  2YJE A;  3MX2 A;  1QQC A;  2HNY A;  4DFM A;  3AVJ A;  5BPL A;  1L3V A;  5FLX O;  4HHT A;  1I39 A;  4BDY A;  1JL1 A;  2NRT A;  5E84 A;  3CCQ N;  2ZJP L;  3NGY A;  5EX5 A;  3O1W A;  3ATU A;  3K0S A;  1U48 A;  1IKY A;  4C8M A;  3LZI A;  4FL9 A;  3CD6 N;  2VG6 A;  4CF9 A;  4A5A A;  4Z94 A;  1TK0 A;  2Q97 A;  4CGI A;  3AVB A;  3OYI A;  1JKH A;  1Q9X A;  4KH5 A;  2Q2R A;  4CBW A;  4CGJ A;  2J4R A;  3P1G A;  1JLF A;  1NGF A;  3PY8 A;  1Z25 A;  4FJK A;  3KWG A;  4Q0B A;  4BR5 A;  4LC9 B;  3RMC A;  1YAG A;  1ESV A;  3AO5 A;  2Q36 A;  3HOT A;  4CGG A;  2RF2 A;  3HST B;  3NVK A;  2NRW A;  3WNE A;  3H45 C;  1BQN A;  2QM1 A;  2Q1N A;  1B9F A;  4H5V A;  4GVM A;  5AZJ A;  5JLF A;  1EQY A;  1IV0 A;  4FJN A;  3TTC A;  3U9Z A;  4JHD B;  3E01 A;  3LDQ A;  3QO9 A;  4CJP A;  4IOC L;  4Z4E A;  3CER A;  4HCB A;  2BGG A;  5DM6 L;  4JK7 A;  4BRH A;  1I94 K;  4JRP A;  4DFJ A;  2V7Z A;  4CED A;  4DU1 A;  4J2E A;  1HJR A;  4BY9 C;  3AVG A;  4DS5 A;  4BRC A;  4JD2 B;  1HMV A;  5C42 A;  5BRF A;  4CJ3 A;  1GOA A;  1VQ9 N;  1MWK A;  4FPB A;  3O1B A;  4H0O A;  1BIS A;  3HJF A;  1ASV A;  5FRO A;  4IKF A;  3FFK B;  1QS4 A;  2D0B A;  3JYT A;  3LL3 A;  4K41 A;  4FJI A;  2P9N A;  4CZK A;  3V9W A;  1YJN N;  4FZX C;  1QTM A;  4W5O A;  1G99 A;  4YDU C;  3EYZ A;  3AVC A;  4AIL C;  4AHU A;  2E20 A;  4CZI A;  4N41 A;  4JI3 K;  1SUQ A;  1CLQ A;  3V81 A;  5BN8 A;  1NGD A;  3LAK A;  1EXQ A;  1A5W A;  4DF8 A;  3WXL A;  3G71 N;  4UY8 O;  2NRR A;  1LW0 A;  4IDK A;  3ENH A;  4BRE A;  4L8R B;  3RR7 A;  2A3Z A;  4BGA A;  2VYP A;  3IRX A;  4BC5 A;  2QKB A;  2Z1G A;  2P9K A;  4E1J A;  2FXU A;  3AO1 A;  4CD1 A;  1RCH A;  3FZH A;  5I9E B;  4I9Q A;  2KFZ A;  1GOB A;  4DQP A;  4EZ6 A;  3TSU A;  5KQ8 A;  1OH5 A;  1IBM K;  3ZLJ A;  3AA5 X;  3V6D A;  4B08 A;  1BWF O;  4NCB A;  3FLC O;  3TWH A;  4RG8 A;  3G10 A;  5H1S Q;  4YOU A;  1NMD A;  1UWB A;  3MWP A;  3HPG A;  2W6L A;  3THX B;  4LFC K;  4C1N K;  3RSE B;  3CCE N;  2A40 A;  4BGB A;  2YNF A;  3UIQ A;  2RN2 A;  3DAW A;  4I7F A;  1JL2 A;  3PX6 A;  2IVP A;  2Z1J A;  1RT6 A;  3M5R A;  1RTH A;  2E6L A;  4I9L A;  1D4X A;  1HPM A;  3G6E N;  4KAZ A;  1Z6R A;  2G8U A;  4U67 L;  5HL7 L;  2G8V A;  1XHX A;  4FWN A;  4DTP A;  2VQF K;  4B3M K;  3O5B A;  4DR6 K;  3THW A;  3IAY A;  1VQ8 N;  1S9G A;  1XNQ K;  2DTU A;  3D2F A;  4CIG A;  3A5O C;  3OYJ A;  2OPS A;  2YJF A;  3TSP A;  4DQS A;  4CEO A;  3ZSO A;  2ASO A;  3QIP A;  4FK2 A;  4C8N A;  5KI6 A;  3AO3 A;  1TL1 A;  2H3G X;  2DFH A;  1YVU A;  2HVI A;  2NRV A;  3AVH A;  1HJO A;  1KQS M;  4BC3 A;  1S6Q A;  3MMV A;  1C0U A;  3CCU N;  5F1X A;  4DUZ K;  4ZTF A;  5JMV A;  3VA0 A;  2NRX A;  4CJE A;  2GEM A;  4HWI A;  5LL6 Z;  2GWJ A;  1TKZ A;  4XH1 A;  4YHH K;  3TAN A;  3HM8 A;  4JHD A;  3R1X A;  3HPO A;  1HYS A;  1RBT A;  3O4W A;  3O80 A;  3T7Z A;  3KKR A;  5IT9 O;  4ID5 A;  4WCE L;  1GLA G;  3ATV A;  1UAX A;  4N5S A;  3O9T A;  1D8Y A;  2P9S B;  1NMN A;  3ALY A;  3SQ0 A;  2QWO A;  4DSE A;  2HBK A;  2RPI A;  3EN9 A;  4JK9 A;  5E41 A;  4FCY A;  1IO2 A;  1KTQ A;  3LM9 A;  4FYD A;  2XHB A;  2JWK A;  4E7L A;  5LMN K;  3LM2 A;  5ADX A;  4BE1 A;  3VF2 A;  3RVC A;  1Y64 A;  5KQD A;  5C0Y A;  2F8S A;  4PKH A;  4KPY A;  3U3G A;  1VSE A;  3O3F A;  2A42 A;  5AQM A;  2YKM A;  1O13 A;  2PFU A;  3BUZ B;  3ULE B;  4AHR A;  3KHY A;  1D9F A;  2F4V K;  1K6Y A;  4I2P A;  1N32 K;  3H1Q A;  3A2F A;  2G8I A;  3O8M A;  4FLZ A;  1FXX A;  4DR2 K;  1NU0 A;  4BR9 A;  5JLH A;  1EWQ A;  4CHQ A;  1T3V A;  4ISG A;  4E7H A;  2O8E A;  5TKW A;  3OS1 A;  4DR4 K;  4N47 A;  1HRH A;  1HNV A;  5KPZ A;  3RMA A;  3K9J A;  5CYM A;  4B1V A;  1GLC G;  3NF6 A;  3K5L A;  2IS3 A;  3SYZ A;  3EE9 A;  2I7P A;  4AHT A;  3HRG A;  5GAH P;  5EU7 A;  3K2P A;  3NHG A;  1ZBH A;  4LSN A;  2D0O A;  1BU6 O;  3M6G A;  4B9S A;  4DTX A;  4YFU A;  1T44 A;  4OPK A;  3QER A;  4B9L A;  4M3W A;  1D5A A;  3WXK A;  4HUF A;  4BVP A;  3VEN A;  1C1A A;  3L3U A; 
#chains in the Genus database with same CATH homology
 1TUY A;  4BG8 A;  3D2E B;  2ZJQ L;  3C7N B;  3H1V X;  3O9R A;  2QWM A;  4EAH D;  5F2R A;  1NLV A;  1R59 O;  2QEX N;  4CD3 A;  3LDP A;  5FPE A;  3RSE A;  2CH6 A;  2CGK A;  4CZJ A;  1SZ2 A;  3BP8 A;  2IVN A;  3HZ6 A;  1NBW A;  5KPT A;  2UYT A;  3AAQ A;  4BRM A;  3WUH A;  3SAG A;  4FOE A;  3SMP A;  4AM7 A;  4O8U A;  5KPR A;  4IEI A;  4WQ4 A;  4FWR A;  2P9P B;  3VEV A;  3FZL A;  4NLB A;  3CJ1 A;  2ASM A;  2P9I B;  4BRF A;  3CC7 N;  4I6M B;  3D2E A;  5C2D A;  4FOI A;  4MLE A;  3MN6 A;  1YJW N;  4C23 A;  3TTD A;  3C7N A;  2FF6 A;  3HI0 A;  3NMU A;  4ILG B;  5CR4 A;  1NGH A;  3WXM B;  3SBT A;  2W41 A;  4CZL A;  3WXJ A;  2P9N B;  3ZYY X;  4B1X B;  4EHU A;  3SAF A;  3A0I X;  3ZX2 A;  3CPW M;  3KVG A;  3O9Q A;  4RWT A;  4KBO A;  3ZET A;  1QQM A;  3CQY A;  4H5T A;  2ASP A;  1Z05 A;  2P9U B;  3GG4 A;  1DKG D;  4U7B A;  2YHW A;  3NVM A;  3AAR A;  4L3Q A;  1X9J A;  3IFR A;  4K42 A;  1KC8 O;  2ZGZ A;  4DCH A;  1LOT B;  2I7N A;  2QXL A;  2P9P A;  2AA4 A;  3ZX0 A;  5BRH A;  3W3D A;  3MWT A;  5AQK A;  3B8A X;  3E9P A;  3J7Z O;  4MDB A;  2P9I A;  3CCJ N;  5AQO A;  4I6M A;  2GWK A;  1SQK A;  4MO4 A;  1VQ4 N;  3C6H A;  4WFA L;  3VER A;  1X3N A;  4GVE A;  4H0X B;  4IOX A;  4CZH A;  3CMA N;  5EXW A;  1KD1 O;  1QZ6 A;  4BR0 A;  5M1N A;  3H6E A;  5LJW A;  5M1P A;  4IO8 A;  5M1Q A;  3WEE B;  3P39 A;  1OKJ A;  1E4F T;  3CJ9 A;  3EKS A;  4IWV A;  5JIC A;  2CH5 A;  3E1Y A;  1NGJ A;  4EFH A;  3ID8 A;  1BA1 A;  3L0Q A;  2VGM A;  1Q7Y O;  1MWM A;  4BC2 A;  4FWP A;  4BG9 A;  5BPN A;  1QQN A;  4NO7 A;  5FPM A;  2E1Y A;  3EO3 A;  1BDG A;  1RDU A;  2NRH A;  3Q7C A;  3VOV A;  5C10 A;  1VQP N;  5GAD P;  3MN7 A;  5AQG A;  2QWP A;  2KHO A;  5CHI A;  1ZC6 A;  5MLC Q;  2QW9 A;  1NGE A;  3R6M A;  2ZJR L;  2NRZ A;  2P9L B;  3BEX A;  1XC3 A;  4PL8 A;  3QML A;  1VQO N;  3VEZ A;  2D1K A;  5AFU H;  5AQV A;  4BRG A;  4M7X A;  5M1F A;  1JJ2 M;  4IJN A;  1V4S A;  2FSK A;  5C15 A;  4BRD A;  1KAZ A;  3WEE A;  1GLD G;  2ZF5 O;  3OBY A;  3CQX A;  4WF9 L;  1NGA A;  4YDU A;  4BVO A;  3KZB A;  3R3L A;  1BOT O;  4FWS A;  4BC4 A;  2V52 B;  3JS6 A;  3CC2 N;  1ATR A;  3VMF B;  5BRD A;  1T6D A;  4JKH A;  4GV3 A;  2E2Q A;  1HLU A;  1S3X A;  2YX6 A;  4ISE A;  3CCS N;  3H3N O;  1Q81 O;  3P4I A;  1YIT N;  2GEL A;  4K25 A;  3CCV N;  3WXI A;  3AGR A;  1HKG A;  2YHX A;  4A2A A;  3VGL A;  2A5X A;  4JKG B;  5BPM A;  3OA9 A;  1WUA A;  4H5R A;  5EOY A;  5AQP A;  3J8A A;  3CIP A;  1K73 O;  2YCH A;  2CGL A;  5BRE A;  1NGG A;  3L4I A;  1BO5 O;  3K9K A;  3DWL A;  2P9L A;  2WC9 A;  4PHT X;  3UKU B;  3IMX A;  2YJE A;  2YI1 A;  2E2O A;  3MX2 A;  4A57 A;  4C1N I;  5LJV A;  4IFE A;  4MO5 A;  1S22 A;  2RHK A;  3C65 A;  5ELZ A;  3U4L A;  5BPL A;  5AQS A;  2D4W A;  3QBX A;  3H3O B;  4CJ7 A;  3AAP A;  1JCG A;  2E2N A;  5FPN A;  4KH4 A;  1YUW A;  1N8R O;  2NRT A;  5AQY A;  5M1O A;  3CXC M;  5E84 A;  3AGK A;  3CCQ N;  1V4T A;  2WUS A;  2ZJP L;  3SJH A;  1HX1 A;  3G25 A;  5EX5 A;  3O1W A;  3ATU A;  5AZJ B;  1KAX A;  2VGN A;  1Q82 O;  2KKZ A;  4KH6 A;  3CCM N;  4IJA A;  4FL9 A;  1VQ7 N;  4JNE A;  1KAY A;  3CD6 N;  1TYQ B;  4HTL A;  2HBL A;  4A5A A;  4Z94 A;  3PLA A;  1U2V A;  4JKG A;  3R9P A;  4B1Z A;  3OHR A;  1C0F A;  2Q97 A;  4AM6 A;  2FLO A;  4WFB L;  2PAV A;  4KH5 A;  2Q2R A;  4CBW A;  3OBW A;  2J4R A;  1RDW X;  1NGF A;  1GLL O;  3UKU A;  2E88 A;  3KWG A;  3BF1 A;  4YOX A;  4BR5 A;  4LC9 B;  2IVO A;  1YAG A;  3ZEU B;  3N4Q A;  1NGC A;  3R8E A;  3UKR B;  1ESV A;  1J6Z A;  2Q36 A;  5B8H A;  3IKM A;  5M1K A;  3HOT A;  1XQS C;  2NRW A;  3D7E O;  3I33 A;  2E2P A;  4H5N A;  4K43 A;  4O5F A;  1K8K B;  4XEI A;  3H45 C;  1K9M O;  2QM1 A;  3HOS A;  1EO1 A;  2Q1N A;  2JWL A;  4H5V A;  5AZJ A;  5JLF A;  1EQY A;  1QQO A;  3TTC A;  3U9Z A;  4BR2 A;  1DEJ A;  3L4Q A;  4JHD B;  4QS7 A;  5GIN A;  3IDH A;  3LDQ A;  3CF5 L;  1TYQ A;  1GLE G;  2NNW A;  1VAZ A;  2ZWH A;  4IOC L;  4O8K A;  1P8Z A;  1JCE A;  4BRQ A;  3CCR N;  4AF1 A;  3CER A;  5DM6 L;  4JKE A;  4JK7 A;  3O9S A;  4BRH A;  2V7Z A;  1YXQ A;  1DGK N;  4BY9 C;  3QFU A;  4BRC A;  4JD2 B;  3S41 A;  2A6A A;  3MN5 A;  5BRF A;  5HOO A;  2FSJ A;  2WBN A;  3ZEU A;  2RE2 A;  1MWK A;  1VQ9 N;  4FPB A;  5AQF A;  3O1B A;  4H0O A;  3UKR A;  4FSV A;  2W40 A;  3ID6 A;  2QWN A;  1VQL N;  3GDQ A;  5ADX H;  3N4P A;  3VTH A;  3VTI A;  2HST A;  3FE1 A;  1IJJ A;  3CJA A;  3U8X A;  3TPQ A;  3NVK A;  3FFK B;  1QVG M;  3DXK B;  4FO0 A;  1K8K A;  3LL3 A;  4K41 A;  3VEW A;  2OTL N;  3JXU A;  4IEE A;  4B1Y B;  2P9N A;  4IXC A;  4BRA A;  4PKG A;  4CZK A;  1YJN N;  3TU5 A;  2AP1 A;  4QS9 A;  1G99 A;  4FWM A;  4YOR A;  4YDU C;  5LY3 A;  3AY9 A;  5E26 A;  3GL1 A;  2E20 A;  2P9U A;  4F9O A;  2P9K B;  2Q0R A;  4BQZ A;  2QA4 N;  3FZF A;  4CZI A;  5C2F A;  5AQQ A;  3FGU A;  4IOA L;  2GTD A;  3L6Q A;  4JD2 A;  5BN8 A;  1NGD A;  4ILJ A;  4Y0W A;  3TSQ A;  4EHT A;  3PIP L;  4GV9 A;  3C6A A;  5AQL A;  2GX9 A;  2HOE A;  1HUX A;  3WXL A;  3G71 N;  4UY8 O;  5AZI B;  1GLJ O;  2ZGY A;  4JKC A;  3CC4 N;  2NRR A;  4ISF A;  4BRP A;  4CZG A;  4GV6 A;  3LDL A;  4BRN A;  2A41 A;  3ENH A;  4BRE A;  4CZE A;  3QIC A;  1W2B M;  3CCL N;  3Q7B A;  4XH5 A;  4G9Z A;  2A3Z A;  2V51 B;  2VCP A;  3HSC A;  3O6W A;  3VF6 A;  1M90 O;  2PBD A;  4MLH A;  3VGM A;  2EWS A;  4BGA A;  4RTF D;  2WFB A;  2VYP A;  3ENO A;  2OAN A;  3I56 N;  3QB0 A;  3EZW A;  4BC5 A;  1ATN A;  3SAH A;  3I8B A;  4JAX A;  1BUP A;  3M3Z A;  5C12 A;  2P9K A;  4FWO A;  5AQT A;  4E1J A;  2FXU A;  4CD1 A;  4H0V B;  3FZH A;  3TTF A;  5I9E B;  2Q0U A;  4FVU A;  4JN4 A;  3TSU A;  5KQ8 A;  3VES A;  5BR9 A;  1KXP A;  4JK8 A;  5JVH L;  5AZI A;  4A59 A;  5AQX A;  4CZF A;  1BWF O;  4J8F A;  3FLC O;  2BTF A;  3SK3 A;  4QS8 A;  3VPZ A;  1Q18 A;  4DKW A;  5H1S Q;  3MK6 A;  4YOU A;  3VET A;  1NMD A;  3VEX A;  5FPD A;  4FWK A;  3MWP A;  1VQM N;  1SS6 A;  4GNI A;  4CZM A;  1RGI A;  3G4S N;  4C1N K;  4JKA A;  5EY4 A;  3RSE B;  3WT0 A;  3CCE N;  3M1F A;  3D2F B;  1E4G T;  1QHA A;  2A40 A;  3EKU A;  4BGB A;  4BR4 A;  3DLL L;  2HF3 A;  5AQN A;  3DAW A;  3EE8 A;  1RFQ A;  4IZ9 A;  5AQU A;  3DJC A;  2IVP A;  3WQU A;  1S72 N;  3CJB A;  2HBM A;  5AQH A;  3VGK A;  2GUP A;  3M5R A;  1NGB A;  4FWL A;  3CET A;  1OVY A;  1D4X A;  2VWB A;  1HPM A;  2CGJ A;  3G6E N;  4H5W A;  3I55 N;  1Z6R A;  5AQI A;  1K8A O;  1M1K O;  4U67 L;  3MDQ A;  5HL7 L;  4FWN A;  3P31 A;  3MX5 A;  1LCU A;  3CME N;  4CBX A;  5GIP A;  1MA9 B;  1DT9 A;  3O5B A;  4M63 C;  4JKF A;  5EVZ A;  1VQ8 N;  3KK7 A;  4JEP A;  3H46 O;  3T69 A;  3MCP A;  4PL7 A;  1BA0 A;  1C0G A;  4B9Q A;  3D2F A;  3A5M C;  2QWQ A;  1QZ5 A;  3A5O C;  2YJF A;  2YHY A;  3A8Y A;  1GLB G;  3TSP A;  3ZET B;  1YHQ N;  1ZBS A;  1U6Z A;  2ASO A;  1CZA N;  1VQN N;  1VQ6 N;  1P90 A;  2QWL A;  4YOW A;  3FZK A;  3E9O A;  3LDO A;  3QBW A;  1IG8 A;  2HMP A;  3CPE A;  2H3G X;  3QFP A;  4IDH A;  3WQT A;  2NRV A;  3W0L A;  4YOY A;  2NZT A;  1HJO A;  1VQK N;  1KQS M;  4BC3 A;  3F2K A;  2OTJ N;  4DHY A;  4H03 B;  3O9U A;  4NB4 A;  4A2B A;  3MMV A;  1QVF M;  1YI2 N;  5AQZ A;  1YIJ N;  2NLX A;  4BQL A;  5CE3 A;  1GLF O;  5GAE P;  3CCU N;  3KWI A;  5F1X A;  4M7Y A;  4A5B A;  4YOV A;  5JMV A;  2NRX A;  1JCF A;  5DM7 L;  5AR0 A;  4B1W B;  2GEM A;  3PIO L;  4HWI A;  1NWK A;  2GWJ A;  1HKB A;  1YVN A;  3VF4 A;  2F9W A;  4XH1 A;  3HM8 A;  3GOI A;  1XUP O;  4JKD A;  4JHD A;  4XH4 A;  3R1X A;  4WFN L;  4NLC A;  1NGI A;  3O4W A;  3O80 A;  3T7Z A;  4DQ8 A;  5AQW A;  3MCA B;  4WCE L;  1GLA G;  3ATV A;  4BRL A;  1SAZ A;  2F9T A;  2ITM A;  3O9T A;  2P9S B;  4FWQ A;  5JVG L;  1VQ5 N;  5TKY A;  3O08 A;  2QWO A;  4OPA A;  4BRK A;  4CI6 A;  2HBK A;  5F0X A;  3EN9 A;  4JK9 A;  4ILH A;  3CJC A;  3CJ7 A;  3HBT A;  3BF3 A;  3HTV A;  3CI5 A;  4A61 A;  3FR0 A;  4R79 A;  3DXM B;  3LM9 A;  3MN9 A;  2JWK A;  1MDU B;  3SMS A;  3GBT A;  2E1Z A;  2BUP A;  2QI2 A;  3LM2 A;  3D6R A;  3DXK A;  5ADX A;  3SLC A;  1BG3 A;  3U9D A;  2BH1 A;  3UB5 A;  3VF2 A;  3CHW A;  1Y64 A;  1X3M A;  3RVC A;  4MDA A;  4H0Y B;  5AQR A;  1NM1 A;  5GAG P;  5KQD A;  5C0Y A;  3VEO A;  4PKH A;  2E8A A;  2FSN A;  1T6C A;  3GE1 A;  3F9M A;  2A42 A;  5AQM A;  5BN9 A;  1O13 A;  2PFU A;  3BUZ B;  3ULE B;  4BRI A;  5GIO A;  2IIR A;  1Q86 O;  2D0P A;  4WYB A;  3KHY A;  4H0T B;  3H1Q A;  2P9S A;  4B1U B;  3O8M A;  3LDN A;  3ZX3 A;  4BRO A;  4WQ5 C;  4BR9 A;  3E66 A;  3E9L A;  5JLH A;  3QDK A;  1NJI O;  4OO1 J;  1T3V A;  4PKI A;  4ISG A;  4YOT A;  1HKC A;  3DXM A;  3UE5 A;  3VEY A;  5TKW A;  3A5L C;  3C0B A;  2HBJ A;  3P38 A;  4DB3 A;  5KPZ A;  1YF5 L;  3FZM A;  3A5N C;  2QWR A;  5AFU A;  3F5T A;  1TUU A;  1H1V A;  3K9J A;  3EL2 A;  1ILY A;  4EIA A;  4B1V A;  1GLC G;  2V7Y A;  2Q31 A;  3EE9 A;  4H0P A;  3ENB A;  4GY2 B;  5AQJ A;  1W97 L;  4JKB A;  2I7P A;  1U2V B;  3ULE A;  3HRG A;  2DPN A;  5GAH P;  3OW2 M;  2FF3 B;  2KLA A;  2D0O A;  2HF4 A;  1BU6 O;  2F7T A;  3M6G A;  3SBG A;  1T44 A;  4OPH A;  4IO9 L;  1ZXO A;  4RCH A;  4CBU A;  4WQ5 A;  1YJ9 N;  2QTD A;  1WOQ A;  4WQ4 C;  3WXK A;  3IUC A;  4BVP A;  4FPA A;  3VEN A;  1ATS A;  4BR7 A;  4A62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...