5DM7L

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGKLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5dm7L01
5H1SQ 5DM7L 3CD6N 3G4SN 5GAEP 3PIPL 1VQNN 2OTJN 1M90O 1VQ7N 1Q82O 1KD1O 4WFBL 3CCQN 3CCUN 1ILYA 3G71N 1Q86O 1YJNN 3CC4N 1YI2N 1YHQN 3CCMN 3OW2M 5GAHP 3CCRN 5JVGL 3CMAN 3CC2N 5DM6L 3DLLL 1KC8O 2ZJRL 3CC7N 1VQPN 1VQLN 3CCEN 1QVGM 1YIJN 1KQSM 4IOCL 1K73O 2QA4N 3CXCM 1VQ9N 1VQ8N 1N8RO 4IO9L 5MLCQ 2ZJPL 1K9MO 3I56N 4WFNL 4UY8O 5HL7L 1VQKN 1Q81O 3G6EN 3CCSN 4WCEL 4WF9L 5JVHL 1K8AO 5GADP 3J7ZO 1VQMN 1QVFM 1YITN 1VQ6N 3PIOL 3CCJN 3CMEN 1JJ2M 1NJIO 3CCVN 1VQON 1Q7YO 2ZJQL 1M1KO 1YJ9N 1YJWN 1OVYA 3I55N 1W2BM 1S72N 3CF5L 4IOAL 2OTLN 1VQ5N 1VQ4N 2QEXN 4WFAL 3CCLN 4U67L 3CPWM 5GAGP
chains in the Genus database with same CATH superfamily
1C0MA 3SK3A 4EIAA 4GW6A 4PUOA 3I0SA 3OS0A 3UKRA 1E3MA 2BUPA 1KCFA 2YNHA 1HYSA 4AILC 3OA9A 1HR0K 3OJSA 1IV0A 3CQXA 4JKFA 4M45A 4CHYA 3QBWA 4FWKA 4JD2B 2A40A 3WXKA 3V9WA 1BIUA 3OBYA 5C25A 4DTOA 1WNSA 3MN9A 4FJHA 1Q86O 4EZ9A 3A0IX 4CEAA 4DF8A 3FZHA 1VSKA 2QKKA 5M1QA 4CZIA 1NLVA 3GG4A 2ASMA 3EN9A 4CF1A 4FWSA 4GY2B 3CCRN 4F3OA 2W42A 5AQOA 5KGXA 3O9UA 3G25A 1NMNA 2KFNA 3MX2A 5DK5A 4FK4A 4FJGA 1KVAA 4OKJA 4DR5K 3DAWA 4BDPA 3SUQA 1KQSM 4FSVA 2P9LB 3AVHA 3OJUA 4HWIA 3MEEA 4ELUA 3AVKA 4FK0A 1I39A 3QMLA 3SBTA 2YNFA 4E7LA 5AQZA 5CHIA 3VTHA 2E88A 1A5XA 1RT3A 3LP2A 2E2OA 4C1NK 4JKGB 4KH4A 3I56N 2HHWA 3LWLA 3L0QA 1VQKN 5AZIB 4DKWA 2DFEA 5CE3A 1U04A 4Y0WA 4XH1A 4CK2A 2E6MA 4K43A 4JKCA 3AA2A 3R1XA 4IBNA 4DCHA 4M41A 1VQMN 4HHTA 3DMJA 4C23A 4DV4K 3ZSRA 4M3RA 2I7NA 5EXWA 4DR2K 1RBUA 3K2PA 2J4RA 4BR0A 1HKCA 1MDUB 4EFHA 3SAHA 2HB5A 3CFPA 4BDZA 4FOEA 5F0XA 1U4BA 4BRGA 3CJCA 2V7ZA 3O9TA 3SNNA 2V7YA 4JV5K 2GBZA 4BC2A 3S3NA 2YNIA 1L3VA 1JL1A 4MLEA 3J7YP 4M3WA 4CJKA 3M5RA 2ZM6K 4E1NA 2HOEA 3HPOA 4MFBA 3TAFA 4RW7A 1I94K 1DKGD 1JXBA 4B1WB 2OTJN 1M90O 3O4NA 4FJMA 3AY9A 4CJSA 4H5WA 3OBWA 1FJGK 3ID6A 4E19A 2HHXA 5JVGL 3LANA 2O8EA 3KD5E 3CMAN 3CQYA 4FOIA 2G8VA 2HHUA 4OPAA 4TSXA 4YFUA 1EP4A 2DPNA 2RN2A 4WYBA 3EZWA 4BR2A 3SV4A 4B1UB 3LDPA 4CIGA 4IOCL 3L3VA 3LZIA 4CJUA 1VQ9N 3NE6A 4IEIA 1HX1A 1N8RO 1W7AA 2A1RA 5HOOA 1G99A 4DSIA 2R7YA 3QINA 4ID5A 3TSUA 4DTNA 1T05A 4DV0K 4CIFA 3FZLA 4M63C 3R8EA 1SKWA 3PO5A 4KH5A 3DOKA 3L4QA 3WXLA 4LF6K 2O8CA 3THWA 4WF9L 3CQ8A 3S3MA 4CZLA 3P4IA 2Z1HA 1HYVA 1TUYA 4FO0A 1QVFM 3OYNA 1C1BA 3DWLA 5AQSA 5FDLA 3V1QA 4O0JA 3TSPA 5KI6A 5HBMA 4ILGB 3AVNA 1VQON 4CEDA 3LP0A 4B9LA 3VTIA 1L3TA 2F7TA 5IWAK 3FZMA 1L3UA 4IOAL 1J5EK 1VQ4N 3ZEUA 2VQFK 1XC9A 4OPHA 4WQ5C 1NGIA 4A5AA 4CCHA 4JI2K 3V9XA 2P9IB 2PYJA 3OYHA 4CGDA 2VYPA 3CJAA 4OJRA 1NJYA 5BPLA 4DQRA 1KAXA 3HK2A 2HHQA 2EX3A 4H4OA 1KXPA 3P39A 1BDGA 3F9KA 3VGLA 3H6EA 4W5RA 5HRSA 4RTFD 2VWBA 1NK4A 3DLEA 2AA4A 2D5RA 1SQKA 5AQJA 5J2NA 4BRKA 1KFDA 5KRSA 3CHWA 4Z4FA 2KFZA 2FF6A 3P31A 4X64K 4LSNA 4BVPA 4CECA 3VESA 1BA1A 4IZ9A 4A2AA 4N5SA 1D5AA 1VQPN 4JKAA 2Q0RA 3NH2A 2Y1IA 3ZETA 3N4PA 4X66K 3AA5X 4DR6K 4MO5A 1BWFO 3HOSA 2O8BB 5C2FA 2VG6A 4CZJA 1NU0A 1Q9XA 3PX0A 4QAGA 3H3NO 1EX4A 4B1ZA 1S6QA 4DTUA 1RT7A 4CEOA 2ZF5O 4WQ5A 2QWPA 4OLAA 1RBSA 4IKFA 1EETA 1U49A 4FJLA 3ENBA 4E7KA 1U47A 3KWIA 3TAMA 4MO4A 3I33A 3PIOL 3CCJN 3KHYA 2GWJA 1T03A 3TAEA 2F8TA 1BL3A 4CHZA 1ESVA 3GL1A 4KI6A 4B1XB 3RR7A 4KAZA 1IG8A 3GBTA 3HSTB 2OZMA 5C24A 1O1WA 4JNEA 3OYLA 3VGMA 3MWPA 4JKBA 5ADXH 1T3VA 2NRXA 3VOVA 2A42A 3IS9A 1GLLO 3VERA 1XC3A 3WUHA 1S5JA 1XNQK 4FL9A 3NMUA 1QQOA 3A5LC 3D45A 3NH1A 1N6QA 4K42A 1TKXA 1YT3A 3K5LA 1BCMA 1XMQK 4B9QA 3IUCA 3NF6A 1R59O 2I5JA 2G8WA 3KKSA 4O8KA 3TTDA 4KKOA 4JLHA 4BRHA 4DFMA 1NKCA 4DU1A 4PKHA 4YOYA 3O6WA 3KD1E 5E41A 5FROA 3HOTA 4C8LA 2A5XA 2QK9A 4DSKA 1RBVA 4YOXA 3P1GA 4DFPA 3V81A 3QIPA 4CZEA 3CG7A 3VQ4A 1QHAA 3ULEB 1KFSA 4CBXA 3CC7N 1B9DA 2F9TA 3VQ7A 3E9PA 4CZMA 4KREA 3SMPA 4DUYK 1KAYA 3CJ1A 3DI6A 5TKWA 4I9QA 1JXEA 3S3OA 4KHUA 4HTUA 1V4TA 4DSLA 4OKEA 3HTVA 1RFQA 2PAVA 3ZT4A 1NNEA 4LF5K 1EO1A 3H3OB 1S1VA 2YI1A 5M1NA 1HQEA 2OPPA 3B6PA 3MEGA 4BC3A 3J7ZO 3WNGA 4ISGA 1HRHA 4FM1A 1HNWK 4KHNA 2KLAA 4BRIA 5BPNA 1DTQA 4JK7A 3HI0A 1RT1A 3QLHA 4OPJA 4NYFA 4QS8A 3HYFA 2OA8A 3FE1A 2GELA 1ASVA 1ASWA 4WFAL 2AP1A 1NJWA 2O4GA 4LSLA 4PQUA 1IKXA 1RDUA 4H8KA 4CGGA 3QBXA 4AHUA 1WUAA 1IKYA 1TYQB 5JMVA 3CD6N 1MWKA 1LOTB 4K25A 3AVCA 3SQ2A 5LL6Z 4LF8K 4AM6A 1NWKA 4NXMK 4DUZK 1NGAA 4IEEA 2V52B 2UXDK 3SQ1A 3MDQA 1WSHA 1VSLA 2HBMA 3AVMA 4WFBL 4CFCA 4BWJA 4OX9K 3HPHA 2IAJA 3HVRA 1ATRA 4QOZB 3V9SA 1YHQN 1G15A 4Z94A 1QS4A 3BF3A 4FW1A 1WSGA 4H0YB 3S9HA 4K0KK 2O8FB 3IKMA 3V9ZA 3NHGA 4O0IA 3JXUA 4AHVA 3O1BA 3ZSVA 3LDNA 4CJ3A 5I3UA 4CEEA 4E1MA 4Z4HA 3ATVA 3V1RA 2QA4N 5AQXA 4JS5A 4F9OA 1S9GA 3MN6A 3D6RA 3HSCA 4CEBA 2X6SA 2OYQA 4BRCA 4UQGA 5AFUH 3CM5A 1W97L 4M7YA 4FJ9A 4DHYA 2A3ZA 3DXKB 1ASUA 4B1YB 3VEXA 3NDKA 4LF4K 1DGKN 5C0YA 4FVUA 3SPYA 3ID8A 2H3GX 4FJ8A 3AVBA 1NBWA 1GLBG 3KVGA 1QSLA 1IKWA 3RTVA 4M3TA 1HJOA 3SUNA 3RWUA 5ELZA 4XEIA 2HHHK 1FXXA 4BVOA 4BC5A 3L6QA 3IFRA 4QCLA 2E4LA 4DFKA 4H0TB 1V4SA 2NRHA 4BRLA 3FZKA 3QFUA 1EQYA 1NGHA 2P9UA 1IBMK 1P8ZA 2HNYA 3LALA 2RE2A 5AQLA 4LD0A 2ITGA 1T6DA 3UKUA 2ZWHA 2QWMA 4CF2A 3UB5A 2YHXA 4DG1A 1X9SA 4Q5VA 4KHQA 3SUOA 2NNWA 3R3LA 3ZCMA 1ZBFA 2BE2A 3NGIA 3D2EA 1I3AA 3U4LA 5GAEP 5AQNA 1Z6RA 4BRAA 4OLBA 3RVCA 3ZSZA 1BU6O 4BDYA 2B5JA 5AQYA 4CK3A 4CJWA 4HUEA 2WOMA 4GV9A 1NOZA 4M3XA 1FK9A 1WSEA 5BRFA 2OCEA 4B08A 3HL8A 3R6MA 5JLFA 2FBYA 4CHPA 2QI2A 4ILHA 3U9ZA 3THVA 2IIRA 1NGEA 4NLCA 4RW4A 5M1KA 4ID1A 1JLAA 1ZBSA 3TI0A 2VG5A 2YHAA 3TABA 1K73O 3RR8A 1XHXA 2A1SA 2HBKA 4FPAA 5EVZA 2P9KA 3TU5A 3QEWA 1YVNA 3MXJA 1Z26A 3H08A 1SKRA 3LDLA 4LF7K 3SUPA 2O8DB 1WN7A 1GLFO 3PV8A 1K9MO 4BQLA 3VEWA 4H5RA 3OYDA 3C95A 5BR9A 4KFBA 2F8SA 1X9JA 2I7PA 4KHSA 2UU9K 4DTJA 3E9LA 3PO4A 3OYFA 3T3FA 2IOCA 2ZQBA 2Q0UA 3M8PA 5C10A 1WLJA 1IO2A 2KTQA 5JLHA 3AA4A 2G8KA 2HF4A 5C12A 4I7FA 4CEQA 4X62K 3LDSA 1M1KO 2IS3A 4FLYA 1N32K 2DFFA 2G8FA 4LF9K 4B9MA 1ZBHA 1W0HA 1LCUA 4ZTJA 2IVPA 1ZYQA 4NCGA 4I9LA 4AHRA 4YOWA 1J9AA 4BRQA 4ZTFA 1SZ2A 3F73A 4DR7K 4XIUA 3RSEA 2FLOA 3DM2A 4GV3A 4LY7A 1FKOA 1IH7A 2ITMA 5LY3A 3CM6A 3G4SN 2FF3B 4R79A 1U6ZA 4CD1A 3M8RA 4JK8A 3NVKA 3VQPA 4J2BA 4F3TA 2P9NA 3CJ7A 1KD1O 3QERA 3MCAB 4BGBA 3CMEN 4HCCA 4CJTA 4FM0A 2UUAK 5J2PA 3QIOA 4FWQA 3MMVA 4DWIA 5J2QA 4O5BA 2Q31A 3HBTA 3OY9A 2F9WA 3K9KA 3A5NC 4JHDB 1IG9A 4BR5A 4DU4A 1UWBA 1RT5A 1KVBA 3AARA 4AHTA 1BUPA 3PLAA 1EWQA 4B8CA 4M3YA 3ZT0A 4FLTA 4HVJA 3CCEN 1JLCA 1TGOA 1D9DA 1TUUA 1BQNA 4JI1K 2A41A 1TKZA 4DTSA 4DV2K 4B3TK 1HNIA 3VQQA 5AQQA 3AVGA 3M1FA 3KJVA 4FK2A 3PSFA 1S1XA 3P83D 3C94A 4DTXA 2FSNA 3CYMA 1WBBA 1UAXA 3O80A 4IG0A 3PUFA 1VRUA 4JYAK 4FLUA 3G6EN 4BE2A 3O8MA 3CERA 1LAWA 2RHKA 4DLEA 3L2VA 4BGAA 3LZJA 5BN9A 4EHTA 2DY4A 1BO5O 3Q7CA 2ETJA 4KHYA 4DTMA 1NK9A 2P9SB 4JI3K 4M42A 1NOYA 4H0VB 3HO1A 3M3ZA 2QM1A 3R9PA 4DLGA 4O5FA 3TANA 1U45A 4F2SA 3VQBA 4LC9B 2DTUA 1UOCA 3DLHA 2NUBA 3L3UA 3TAPA 4H5VA 4FVMA 3H1VX 3O08A 4CJFA 3CPWM 3J8AA 1QZ5A 3TAGA 3THYA 1K8KB 3LDQA 3T1YK 1DTTA 3DRPA 4XH5A 1RILA 4OGCA 4DV7K 3THXB 2VWJA 3OYAA 3K5OA 1RBRA 5HROA 3IDHA 4Z4GA 5AJ3K 1KSPA 4YY3K 2XO7A 3DXMA 3CJBA 3VQDA 5FPNA 1Q82O 3PSIA 3ZLJA 3CCQN 3DLBA 3K57A 5CR4A 4Y1CA 1IKVA 1OH8A 1WSFA 3O4QA 5KGWA 2HHVA 2O4IA 4N47A 1YUWA 3C7NB 4X65K 5FPMA 3CCMN 4JD2A 5T7BA 2P1JA 1RTHA 3SQ0A 3DLLL 3N4QA 3EO3A 2E2PA 3NFAA 4AHCA 2GX9A 5E84A 3OHRA 4JEPA 4IFVA 1C1CA 4EP5A 4W5QA 3LPTA 5LMUK 4ISEA 2HW3A 1NMDA 3D0PA 1SKSA 1NJXA 4HUGA 3FLCO 3P38A 2QXLA 1BA0A 1RTJA 2P9LA 3K9JA 4BE0A 1XQSC 1JLBA 2Q1NA 3QEVA 5D3GA 1WOQA 3AA3A 4WCEL 3KK1A 4E7JA 3E01A 5JVHL 3CJ9A 4A62A 3I8DA 4DTPA 4JKGA 4BE1A 1HNZK 4JI6K 3DLRA 4BREA 5AZIA 4RCHA 4CVNE 1WAJA 3OYJA 2HVIA 1Z05A 1OKJA 3D2FB 4FLWA 4DQ8A 3SJJA 4G1QA 5M1FA 1ZC6A 3LAMA 5M1PA 1W2BM 2Q97A 3CF5L 5KPRA 3CPEA 4A61A 2QEXN 1NGBA 3O9RA 2BDPA 3RMBA 4PL7A 4CK1A 3EY1A 1BI4B 1JCFA 3MCPA 4B9UA 3ZX0A 4KRFA 4PHTX 5BREA 3WT0A 1E4GT 1RCHA 3ISNC 3I0RA 2VWKA 5GINA 1S1WA 3L2WA 4BR7A 3DOLA 3QETA 4J2AA 1T6CA 2PY5A 3VPZA 1FW6A 3SJHA 1VSJA 3O4WA 4CEFA 4CJRA 4I6MB 1C1AA 3K5NA 4CW7B 4DF4A 3CCUN 4NCBA 2IVOA 2OPQA 4M3ZA 3PX4A 5AQIA 1BHLA 1NK7A 4BWMA 3OYMA 3OW2M 4FJIA 3VQ5A 4CJVA 2D0AA 2YJEA 2FSJA 1RDWX 1RGIA 4O8UA 4ELTA 2YV0X 5DM6L 4DR3K 3WEEB 3DLKA 3VA3A 1IJJA 3WXIA 4FLXA 3SQ4A 1K6YA 4IXCA 2JWLA 2HMIA 3CXCM 4CGIA 5TKYA 4DV5K 4CF9A 2NLXA 4DQSA 4EZ6A 1KLMA 2EHGA 3ENOA 2YKMA 3NF9A 2QWQA 3T69A 3CFOA 1ZBLA 1CZ9A 4JI4K 3PY8A 4FZZA 3QO9A 2WFBA 3HVTA 2QWOA 2UYTA 4BY9C 5EU7A 4DTRA 3ZSWA 4PY5A 3M6GA 1RTDA 4CHQA 3GE1A 2CH5A 4IG3A 3FZFA 4DS4A 4JAXA 3HZ6A 2JGUA 4M3UA 4IJAA 3KIOA 4YOVA 2YHWA 4IDHA 1IBKK 3UKRB 3G10A 5SZTA 3LP3A 2HMPA 3AVIA 4MQ3A 4B3OA 3CCLN 2P51A 3QNOA 1RT2A 5CYMA 3ZYYX 3BY5A 4BQZA 3AO1A 5KRTA 1L3SA 1X3MA 3BZCA 4Z4IA 1RDBA 3OYKA 2P9IA 3ZT2A 4IFYA 4FCYA 2YCHA 3C6TA 5AQVA 3E1YA 4OKKA 2HF3A 3RRHA 4DMNA 4KB1A 4DV3K 5AQHA 2D0OA 3JS6A 3TARA 3OYBA 4FWNA 3O3GA 4CHNA 3OYCA 4A5BA 1CXQA 4FWLA 2X78A 4PL8A 1S9EA 3VQ6A 1NG9A 3ENHA 4CI6A 3SAGA 4J2EA 1XUPO 2HVHA 2RF2A 4DU3A 4E7IA 5KQDA 4CJLA 1XHZA 5CY4A 3LAKA 3UIQA 1ATNA 3T1HK 4F4KA 4ZHRA 3VQ8A 2PZSA 3AO2A 1YTUA 4FWOA 1J6ZA 4YOTA 4OGEA 4CD3A 1HNXK 5BN8A 3CFRA 1YVUA 4FZXC 4YDUC 4B1VA 3HPGA 2KHOA 5HL7L 1NK5A 2O8BA 1SL1A 4BRFA 5A2QO 2E5LK 4EHUA 4A57A 3OYIA 4W5TA 1HQUA 3AV9A 3LDOA 1K8AO 4FJ5A 1YAGA 4FJXA 2F4VK 3QEPA 3TR8A 1Q9YA 3T1AA 1WB9A 4CJ5A 1XWLA 3F2KA 4IJNA 3ITHA 4F8RA 2RKIA 3EE9A 2NRRA 3MAQA 3QEXA 5BRDA 3U6FA 1FKPA 2OANA 5GIOA 2P5OA 3BF1A 2UXBK 3B6OA 5AQWA 4K8XA 4B3SK 3M8SA 5FPEA 5LJWA 1RDDA 1C0UA 5AQPA 5JS1A 5K14A 4FWPA 3RMCA 2QXFA 4NXNK 3SLCA 2JLEA 2E1ZA 3IRXA 4CESA 1TVRA 3JAMO 4KBOA 4FJKA 1HUXA 3KK7A 1O13A 2HNZA 1BOTO 2YJFA 2O8EB 4BR4A 4YDUA 3V1OA 3OS2A 3V9UA 3WEEA 3OVNA 1YI2N 1ZBIA 3MN5A 1UA0A 3SBGA 2FBVA 3CI5A 3F9MA 3T7ZA 1U48A 2WONA 4RW9A 3HM8A 4CJ7A 1VSHA 2Q3SA 3K0SA 1QSYA 4AH9A 2ZE2A 5CZ2A 4CF0A 4K8ZA 3WNHA 2Z1JA 4L8RB 3OTOK 4GVMA 1LW0A 4KO0A 3ULEA 1Y64A 4DQQA 2O8CB 3AVFA 3GDQA 3EZ5A 4E7HA 1C0GA 3THWB 4LFBK 1CLQA 2JWKA 1EKEA 5E26A 1LW2A 2D1KA 2ZD1A 2WC9A 3AAPA 4JRPA 1GLDG 2GEMA 4O4GA 2XY8A 3CCSN 3KTQA 1OH5A 2VCPA 3BEXA 1B9FA 5I9EB 3HP6A 2YX6A 3V6DA 1C6VA 4KHWA 4RW8A 4CERA 5I42A 3MN7A 5CZ1A 5LJVA 1NM1A 5M1OA 3EYZA 1TK8A 4ELVA 1L5UA 4U7BA 1HJRA 3J81O 3L2QA 1NJIO 3CCVN 2YNGA 3ZEUB 1KRPA 3QEIA 5AR0A 3HJFA 1MWMA 4H5TA 3HP9A 2HBLA 2FSKA 1X3NA 4Z4CA 3K5MA 2D0CA 4RG8A 1OH7A 2KKZA 1RTIA 3VEZA 1D8YA 3FFKB 2OPRA 4LH5A 2B4JA 1N34K 4N41A 3O9SA 4CJPA 4JKDA 2UUBK 3H46O 1SUQA 1NGCA 3OS1A 1NKBA 1TK5A 1HKGA 4BRPA 2P5GA 3S41A 5AQKA 3DJCA 1TYQA 5DMRA 4HUFA 1S6PA 2KZZA 1ILYA 5AZJB 3LWMA 1YJNN 3O3HA 5AFUA 3BZKA 3VETA 2PYLA 1VK0A 2FBXA 3VQAA 4IOXA 3AVAA 4JI0K 4WE1A 3ZETB 3GOIA 1C0FA 3AGRA 1LAVA 5BRHA 5J1EA 3P5JA 1KC8O 2ZJRL 1TL3A 4KI4A 4DSEA 1KAZA 4B3MK 1YIJN 2IDOA 3MK6A 1GLCG 1TKTA 1N36K 3L8BA 2NRWA 2GWKA 2O8FA 1HNVA 1T44A 1F21A 2YKNA 3W0LA 3KZBA 1DT9A 3DYAA 4H0XB 4Q0BA 3SCXA 3NGZA 2ZGYA 1BQMA 3EE8A 2VQEK 1T8EA 3E66A 1B92A 1RDAA 3VF6A 3SI6A 3U3YA 3SV3A 2OPSA 4FXDA 4W5NA 4CZFA 4GKKK 5HLFA 3SYZA 1S1UA 3C6UA 4DFJA 3DLGA 4H0OA 4O55A 2Z1IA 3MEDA 1CZBA 3A5MC 4CZKA 4W5OA 4JK9A 2HBJA 1JJ2M 4DR1K 3DXKA 3MECA 4DS5A 4NLBA 4YORA 4CBUA 2XY5A 4JKHA 3AGKA 2IC3A 1XMOK 3ASMA 1YJ9N 2W6KA 2G8UA 4CE9A 5AQRA 1S72N 3B8AX 1HPZA 1QZ6A 1VQ5N 2PFUA 1U2VB 4FJJA 5AQFA 1ZXOA 1X9MA 5EOYA 4C8NA 4CFBA 5C42A 2NZTA 1X9WA 1QQCA 4CJEA 3NGYA 1SL0A 1QQMA 2EWSA 5AQTA 4ISFA 2WTUA 2WUSA 4PWDA 4BG9A 2F96A 1GLJO 1X1PA 4LH4A 1VQNN 3O1WA 3VEYA 1CXUA 4EAHD 3KLEA 4JI8K 1S22A 4AQYK 4JS4A 1S3XA 3CC4N 1VSMA 4JI5K 1WAFA 4G9ZA 1VSEA 2ZGZA 3LM9A 1HPMA 3E9OA 1IBLK 1GOCA 1YF5L 2E8AA 3CC2N 1OH6A 1QE1A 5FRMA 1D4XA 3KLIA 1SAZA 3SZ2A 1RT6A 3C65A 2E6LA 3JYTA 5FRNA 3NF8A 1VQ8N 4J2DA 5C15A 4ICLA 2X6NA 3VGKA 2Q2RA 5CYQA 3LPUA 1TK0A 2BGGA 4KTZA 1QSSA 3U8XA 3C6AA 1WSIA 4DSFA 4E1JA 4GKJK 1NGFA 3VN5A 2A6AA 5BR8K 2O8DA 2QWLA 5GADP 2YHYA 3VMFB 3DRSA 3C0BA 3U3GA 3TAQA 1HLUA 4M7XA 3BUZB 1RDCA 2QKBA 4CJQA 4CZHA 2QTDA 2E1YA 5KTQA 3MX5A 2UUCK 1R0AA 4CFDA 4FW2A 3BDPA 1GLEG 1TAQA 4H4MA 3MWTA 1LWEA 4NB4A 2XY6A 4C8MA 2FXUA 4CIEA 2XRIA 3AO4A 4DSJA 1T7PA 4LFCK 2PBDA 2V51B 3D7EO 4O44A 2GUIA 4F2RA 3I8BA 4EP4A 1ZBUA 2CGKA 4XH4A 1UA1A 2NRZA 2NRTA 1NKEA 3A5OC 1JLEA 2D0PA 3QESA 1NK8A 5H1SQ 5DM7L 4GV6A 1C0TA 3VF4A 3O9QA 3TPQA 5AZJA 1ATSA 2W40A 4CGJA 1VSDA 4AM7A 2HHSA 3PIPL 1REVA 5HP1A 1VQ7N 2G8IA 1SS6A 4YOUA 4OVLA 1A5WA 1YXQA 2BANA 3G71N 3WXJA 3AO3A 3CETA 4PA1A 4JN4A 4FJ7A 4B8AB 3ZX2A 4CEZA 3A2FA 3CIPA 4K41A 3RRGA 4I2QA 4DR4K 2RPIA 4B3RK 3LP1A 2VG7A 2GV9A 3WQTA 3EKUA 3NVMA 3TSQA 1Y97A 2CGLA 1S1TA 2GUPA 3F5TA 4B9TA 3IMXA 2XHBA 4Y1DA 3VQCA 1KVCA 3C6HA 5EY4A 4BACA 4C8KA 4JHDA 3NH0A 3QNNA 4JKEA 3NBPA 3UE5A 4BRMA 4IO8A 4AHSA 4WFNL 1Z25A 1NGJA 3DRRA 3U9DA 3HXMA 3KLHA 1QTMA 3VQEA 4OPKA 3TTFA 4CHOA 5LMNK 3LM2A 4NO7A 4WQ4C 1JKHA 3WXMB 3HRGA 1TL1A 1DEJA 2ASOA 1LWCA 4J8FA 1BIZA 1XNRK 1NK0A 2YHBA 4KH6A 2P9UB 2QWRA 4RWTA 1TKDA 1E4FT 1NJZA 2UXCK 1KTQA 5C2DA 1U2VA 3UKUB 3ULDA 2E20A 1Q7YO 2VGNA 3WQUA 3J7AP 1YJWN 4NCAA 1QQNA 1JCEA 2P9SA 3QDKA 3FFIA 3D2EB 3KLGA 4DV1K 4BC4A 3EEQA 4A59A 2QW9A 2D0BA 4U67L 3ATUA 5GAGP 4RW6A 3RMDA 1GOAA 2VGMA 2Z1GA 1JLQA 2X74A 4QS7A 2KQ2A 1N5YA 1CZAN 3L2RA 5FLXO 4B9SA 3M8QA 3SMSA 2KW4A 2P9PB 1ITGA 3JSMA 1K8KA 5AQGA 2B6AA 1KLNA 1GLAG 1J53A 4QS9A 4CZGA 2D4WA 3EKSA 3FGUA 1JLGA 4H03B 4MDAA 1SL2A 4B9VA 1TAUA 5KPTA 3THXA 4PKGA 2DFHA 5HRPA 3PX6A 1VSIA 4HCBA 1VAZA 4KV8A 3VF2A 4NYNA 4KTQA 5HRRA 3V4IA 5GAHP 4AF1A 4JI7K 4GVEA 4WQ4A 3VENA 4FLZA 4FZYA 1BCOA 5J2MA 2P9KB 4L3QA 5KQ8A 2W41A 4BROA 1J5OA 4MDBA 2IVNA 1VQLN 3C7NA 4IWVA 2ATQA 4GMJB 4YNQA 3NCIA 3K59A 1JL2A 3W3DA 2FC0A 4MLHA 1XI1A 5MLCQ 1SV5A 4E3SA 3KKRA 3BGRA 5HRNA 1VRTA 1JCGA 1J54A 4CJ4A 1Q81O 4C1NI 2E2NA 3KK2A 3ZSYA 4E89A 5B8HA 4GNIA 3TWHA 1EXQA 2FBTA 1HMVA 4FYDA 4PKIA 3L2UA 3KWGA 3ZT3A 5F2RA 5F1XA 5FPDA 4DV6K 1W9HA 4CGHA 4CGFA 3MXIA 4FM2A 3NF7A 3SAFA 4N76A 4BRDA 3O3FA 4C8OA 3RSEB 3Q7BA 3I55N 5ADXA 4IFEA 1EWRA 2G8HA 1WBDA 1HYZA 2XY7A 3D2FA 5AQUA 2KZMA 4JRQA 4A2BA 4H5NA 1GOBA 4OO1J 4DQPA 3IAYA 2IGIA 1LV5A 4IDKA 1RBTA 1TV6A 4CF8A 2GTDA 3AVLA 2OTLN 3LL3A 2P9NB 2BTFA 1LWFA 4HTLA 4CBWA 1HKBA 4N56A 3FR0A 2NRVA 2WBNA 4FWMA 1BI4A 3VEOA 1D9FA 1NGGA 3IG1A 4I2PA 4LFAK 3TTCA 3K58A 1Q18A 4FWRA 2HHTA 3EL2A 3ZT1A 2HNDA 2BH1A 1VSFA 3G0ZA 3ZX3A 5EX5A 2W6LA 1BGXT 3O5BA 3VA0A 4I6MA 1H1VA 1Q8IA 1BISA 2Y1JA 4KB0A 1DLOA 4H0PA 1WSJA 2QWNA 3NAEA 4BG8A 1NGDA 4R5PA 1QHTA 3HM9A 4CFAA 1QVGM 3KK3A 3QFPA 1RT4A 3WNEA 4KPYA 4Z0UA 3KLFA 4IO9L 3RMAA 4DB3A 1OVQA 2ZJPL 3ALYA 1BG3A 3MXMA 2LSNA 4UY8O 3L4IA 5JS2A 5KPZA 3OYGA 5GIPA 3AO5A 2AJQA 5IT9O 1VHXA 4FLVA 4V19S 5AQMA 3SPZA 1A5VA 1MU2A 3HT3A 3AVJA 3H45C 1P90A 2ASPA 3H1QA 4YHHK 1YITN 4ILJA 1VQ6N 1RNHA 1MA9B 4B9NA 4FJNA 3T19A 4KTWA 2OZSA 1N33K 4KHPK 5JICA 3OYEA 4Z4EA 3AAQA 3ZSQA 2CH6A 3J80O 3QICA 4FPBA 2ZJQL 3A8YA 4BR9A 3BP8A 1OVYA 2CGJA 3QB0A 2E2QA 2Q36A 4BRNA 3THYB 2HSTA 1YTAA 5BPMA 3ZSXA 3ZSOA 1NK6A 5SWMA 4E0DA 1JLFA 3WNFA 4DQIA 3VQ9A 3VEVA 2P9PA 3DXMB
chains in the Genus database with same CATH topology
1QQMA 2EWSA 3SK3A 1TYQB 5AQTA 4ISFA 4EIAA 5JMVA 3CD6N 5GINA 1MWKA 2WUSA 1LOTB 3UKRA 4BR7A 2BUPA 4K25A 4BG9A 3OA9A 1GLJO 4AM6A 1NWKA 1T6CA 3VPZA 3SJHA 3CQXA 1VQNN 4JKFA 1NGAA 4IEEA 2V52B 3QBWA 3O1WA 3O4WA 3MDQA 4FWKA 4JD2B 2A40A 3VEYA 4EAHD 2HBMA 4I6MB 3WXKA 4WFBL 1S22A 3OBYA 3CCUN 2IVOA 3MN9A 1Q86O 1S3XA 3A0IX 5AQIA 3FZHA 3CC4N 1ATRA 5M1QA 1YHQN 4CZIA 1NLVA 4Z94A 3OW2M 3GG4A 2ASMA 2YJEA 3EN9A 4G9ZA 2FSJA 1RDWX 2ZGZA 3BF3A 3LM9A 4FWSA 4GY2B 4H0YB 3CCRN 1HPMA 1RGIA 3E9OA 5AQOA 4O8UA 1YF5L 2E8AA 3O9UA 3G25A 3CC2N 5DM6L 3IKMA 3WEEB 3JXUA 3MX2A 1D4XA 1SAZA 3O1BA 1IJJA 3WXIA 3LDNA 3C65A 3DAWA 4IXCA 1KQSM 4FSVA 2P9LB 4HWIA 2JWLA 3ATVA 3CXCM 2QA4N 5TKYA 1VQ8N 5AQXA 3QMLA 2NLXA 3SBTA 4F9OA 5C15A 3VGKA 3MN6A 2Q2RA 3D6RA 3HSCA 5AQZA 5CHIA 3VTHA 2E88A 3ENOA 2QWQA 3T69A 2E2OA 4BRCA 5AFUH 4C1NK 4JKGB 4KH4A 1W97L 3I56N 3L0QA 3C6AA 4M7YA 3U8XA 1VQKN 5AZIB 4DKWA 5CE3A 4E1JA 4Y0WA 4XH1A 1NGFA 2WFBA 4DHYA 2A3ZA 4K43A 4JKCA 2A6AA 3DXKB 2QWLA 4B1YB 5GADP 2QWOA 2UYTA 2YHYA 3VEXA 3R1XA 3VMFB 4DCHA 1DGKN 4BY9C 5C0YA 1VQMN 3M6GA 3C0BA 4FVUA 4C23A 3ID8A 1HLUA 2H3GX 4M7XA 3BUZB 1NBWA 1GLBG 2QTDA 2I7NA 3GE1A 2E1YA 3KVGA 5EXWA 2J4RA 4BR0A 1MDUB 1HKCA 2CH5A 3MX5A 4EFHA 3SAHA 1HJOA 3FZFA 4FOEA 5F0XA 4JAXA 5ELZA 4XEIA 4BRGA 4BVOA 4BC5A 3L6QA 1GLEG 3IFRA 3MWTA 3HZ6A 4H0TB 4NB4A 1V4SA 2NRHA 3CJCA 4BRLA 3FZKA 2FXUA 1EQYA 2V7ZA 3O9TA 3QFUA 4IJAA 1NGHA 2P9UA 2V7YA 4YOVA 1P8ZA 2YHWA 4IDHA 2RE2A 2PBDA 2V51B 3D7EO 5AQLA 4BC2A 1T6DA 3UKRB 3UKUA 2ZWHA 2QWMA 3I8BA 2HMPA 2CGKA 4XH4A 3UB5A 4MLEA 2NRZA 2NRTA 2YHXA 3CCLN 3A5OC 2D0PA 3M5RA 2NNWA 5H1SQ 3R3LA 3ZYYX 5DM7L 4GV6A 2HOEA 4BQZA 3D2EA 3O9QA 3TPQA 1X3MA 3U4LA 3VF4A 5AZJA 1ATSA 2W40A 4AM7A 5GAEP 3PIPL 1DKGD 5AQNA 1Z6RA 4B1WB 4BRAA 2OTJN 2P9IA 3RVCA 1M90O 1SS6A 1VQ7N 4YOUA 1BU6O 3AY9A 5AQYA 1YXQA 2YCHA 4H5WA 5AQVA 3E1YA 2HF3A 3OBWA 3G71N 5BREA 5AQHA 3WXJA 3CETA 3ID6A 4GV9A 2D0OA 4JN4A 3JS6A 5BRFA 4FWNA 3ZX2A 3CIPA 4K41A 4A5BA 3R6MA 4FWLA 5JVGL 5JLFA 3CMAN 4PL8A 3CQYA 4FOIA 2QI2A 4ILHA 3ENHA 4CI6A 3SAGA 1XUPO 3U9ZA 3WQTA 4OPAA 3EKUA 3NVMA 3TSQA 2CGLA 2DPNA 2IIRA 1NGEA 4WYBA 3EZWA 4NLCA 4BR2A 5KQDA 2GUPA 3F5TA 5M1KA 4B1UB 3IMXA 3LDPA 1ZBSA 4IOCL 1ATNA 3C6HA 1K73O 5EY4A 1VQ9N 2HBKA 4FPAA 5EVZA 4JHDA 4IEIA 1HX1A 2P9KA 1N8RO 3TU5A 4FWOA 1J6ZA 1YVNA 4YOTA 4JKEA 3DXMB 4CD3A 5HOOA 5BN8A 1G99A 3LDLA 3UE5A 1GLFO 4BRMA 4IO8A 4YDUC 3TSUA 1K9MO 4B1VA 4BQLA 4WFNL 3VEWA 4H5RA 1NGJA 2KHOA 3FZLA 4M63C 5BR9A 5HL7L 3U9DA 3R8EA 4KH5A 3L4QA 1X9JA 2I7PA 3WXLA 4BRFA 3TTFA 4EHUA 4A57A 3E9LA 4WF9L 3LM2A 3LDOA 4NO7A 1K8AO 1YAGA 4CZLA 4WQ4C 2Q0UA 3WXMB 3P4IA 3HRGA 5C10A 1DEJA 1TUYA 2ASOA 4J8FA 4FO0A 1QVFM 3F2KA 4IJNA 3DWLA 4KH6A 5AQSA 2P9UB 2QWRA 4RWTA 3EE9A 5JLHA 2NRRA 3TSPA 1E4FT 2HF4A 5C12A 4ILGB 5BRDA 1U2VA 3UKUB 5C2DA 2E20A 1VQON 1Q7YO 2OANA 2VGNA 5GIOA 3WQUA 3VTIA 1M1KO 2F7TA 3BF1A 1YJWN 1QQNA 1JCEA 5AQWA 1LCUA 3FZMA 2P9SA 2IVPA 4IOAL 3QDKA 5FPEA 1VQ4N 4YOWA 5LJWA 3D2EB 3ZEUA 4BRQA 1SZ2A 4BC4A 4OPHA 4A59A 4WQ5C 1NGIA 5AQPA 4A5AA 2QW9A 3RSEA 2FLOA 4FWPA 4U67L 2P9IB 4GV3A 3ATUA 5GAGP 2VYPA 3SLCA 2VGMA 3CJAA 2E1ZA 2ITMA 5BPLA 1KAXA 5LY3A 4QS7A 3G4SN 2FF3B 4R79A 1CZAN 4KBOA 1KXPA 1U6ZA 3P39A 1BDGA 4CD1A 1HUXA 3SMSA 3KK7A 4JK8A 3NVKA 1O13A 3VGLA 3H6EA 2P9PB 1BOTO 2P9NA 1K8KA 2YJFA 3CJ7A 5AQGA 1KD1O 4RTFD 1GLAG 2VWBA 4QS9A 4BR4A 2D4WA 3EKSA 3FGUA 3MCAB 4H03B 4MDAA 4YDUA 4BGBA 3CMEN 2AA4A 5KPTA 4PKGA 1VAZA 3VF2A 3WEEA 1SQKA 5AQJA 1YI2N 3MN5A 4FWQA 3SBGA 3CI5A 4BRKA 3MMVA 5GAHP 4AF1A 3CHWA 3F9MA 4GVEA 4WQ4A 3T7ZA 2Q31A 3VENA 2FF6A 3HBTA 3HM8A 3P31A 2F9WA 4CJ7A 3K9KA 3A5NC 4JHDB 4BVPA 2P9KB 4BR5A 4L3QA 5KQ8A 2W41A 1BA1A 3VESA 4BROA 4IZ9A 4A2AA 4MDBA 3AARA 2IVNA 1VQPN 1BUPA 3PLAA 1VQLN 4JKAA 2Q0RA 3C7NA 4IWVA 3CCEN 3ZETA 3N4PA 1TUUA 2A41A 4MO5A 1BWFO 3W3DA 3HOSA 3ULEA 1Y64A 5C2FA 5AQQA 4CZJA 4MLHA 3M1FA 3GDQA 5MLCQ 1C0GA 3H3NO 2JWKA 4B1ZA 4CZHA 2FSNA 5E26A 2D1KA 2WC9A 3AAPA 3O80A 1GLDG 1JCGA 2GEMA 2ZF5O 1Q81O 4WQ5A 4C1NI 3G6EN 2QWPA 3CCSN 3O8MA 2E2NA 3CERA 2VCPA 3BEXA 5B8HA 5I9EB 4GNIA 2YX6A 2RHKA 4BGAA 5BN9A 3ENBA 4EHTA 4PKIA 1BO5O 3MN7A 5LJVA 1NM1A 3Q7CA 3KWGA 3KWIA 5M1OA 4MO4A 3I33A 3PIOL 3CCJN 3KHYA 4U7BA 2GWJA 5F2RA 5F1XA 2P9SB 5FPDA 1NJIO 3CCVN 4H0VB 3M3ZA 3ZEUB 2QM1A 3R9PA 1ESVA 3GL1A 3SAFA 4O5FA 4B1XB 4BRDA 1IG8A 3RSEB 5AR0A 3Q7BA 3I55N 1MWMA 3GBTA 5ADXA 4IFEA 4H5TA 4LC9B 3D2FA 5AQUA 4JNEA 2HBLA 2FSKA 4A2BA 4H5NA 3VGMA 4H5VA 4OO1J 3MWPA 4JKBA 1X3NA 5ADXH 1T3VA 2NRXA 3VOVA 2A42A 1GLLO 3H1VX 3O08A 2KKZA 1XC3A 3VERA 2GTDA 3WUHA 3J8AA 3CPWM 1QZ5A 3LL3A 2OTLN 3NMUA 4FL9A 1QQOA 2P9NB 1K8KB 3VEZA 3FFKB 3LDQA 2BTFA 3A5LC 4XH5A 4HTLA 4CBWA 1HKBA 3O9SA 3FR0A 2NRVA 2WBNA 3H46O 4JKDA 4K42A 1NGCA 4FWMA 3IDHA 1HKGA 3VEOA 4B9QA 4BRPA 1NGGA 3S41A 5AQKA 3IUCA 3TTCA 3DXMA 3CJBA 5FPNA 1Q18A 3DJCA 1TYQA 4FWRA 1Q82O 1R59O 3EL2A 3CCQN 4O8KA 1ILYA 5AZJB 3TTDA 4CZGA 2BH1A 1YJNN 4BRHA 5AFUA 5CR4A 3VETA 4PKHA 4IOXA 3ZX3A 3O6WA 4YOYA 5EX5A 1YUWA 3C7NB 5FPMA 3HOTA 4JD2A 2A5XA 3CCMN 3ZETB 3O5BA 4I6MA 3GOIA 1C0FA 3AGRA 5BRHA 4YOXA 1H1VA 4CZEA 1QHAA 4H0PA 3ULEB 3DLLL 1KC8O 2QWNA 3N4QA 3EO3A 4BG8A 4CBXA 2ZJRL 1NGDA 2F9TA 2E2PA 3CC7N 2GX9A 3E9PA 5E84A 3OHRA 1QVGM 4CZMA 1KAZA 1YIJN 4JEPA 3MK6A 1GLCG 3QFPA 3SMPA 4ISEA 2NRWA 2GWKA 1KAYA 4IO9L 1T44A 3CJ1A 1NMDA 3W0LA 4DB3A 2ZJPL 5TKWA 3KZBA 1DT9A 4H0XB 3FLCO 3P38A 1BG3A 2ZGYA 2QXLA 3EE8A 1BA0A 2P9LA 3K9JA 3E66A 1V4TA 1XQSC 2Q1NA 3VF6A 4UY8O 1WOQA 3HTVA 3L4IA 1RFQA 2PAVA 5KPZA 5GIPA 4CZFA 4WCEL 1EO1A 3H3OB 2YI1A 5AQMA 5M1NA 5JVHL 3CJ9A 3H45C 4H0OA 1P90A 4A62A 4BC3A 3J7ZO 2ASPA 4JKGA 3A5MC 3H1QA 4ISGA 4CZKA 4BREA 5AZIA 1YITN 4RCHA 4ILJA 4JK9A 1Z05A 1VQ6N 1MA9B 1OKJA 2HBJA 2KLAA 4BRIA 3D2FB 5BPNA 5JICA 1JJ2M 4DQ8A 3DXKA 3AAQA 4NLBA 4YORA 4CBUA 5M1FA 2CH6A 4JKHA 3QICA 4JK7A 1ZC6A 3AGKA 3HI0A 4FPBA 2ZJQL 1YJ9N 3A8YA 5M1PA 4BR9A 3BP8A 1OVYA 5AQRA 4QS8A 2CGJA 2Q97A 2E2QA 3QB0A 1W2BM 2Q36A 4BRNA 1S72N 3CF5L 3FE1A 5KPRA 3B8AX 2HSTA 2GELA 1QZ6A 1VQ5N 3CPEA 4A61A 2PFUA 5BPMA 2QEXN 1NGBA 3O9RA 1U2VB 4WFAL 2AP1A 5AQFA 4PL7A 1ZXOA 5EOYA 1JCFA 1RDUA 3MCPA 3ZX0A 3QBXA 2NZTA 3VEVA 4PHTX 3WT0A 2P9PA 1WUAA 1E4GT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1S Q;  5DM7 L;  3CD6 N;  3G4S N;  5GAE P;  3PIP L;  1VQN N;  2OTJ N;  1M90 O;  1VQ7 N;  1Q82 O;  1KD1 O;  4WFB L;  3CCQ N;  3CCU N;  1ILY A;  3G71 N;  1Q86 O;  1YJN N;  3CC4 N;  1YI2 N;  1YHQ N;  3CCM N;  3OW2 M;  5GAH P;  3CCR N;  5JVG L;  3CMA N;  3CC2 N;  5DM6 L;  3DLL L;  1KC8 O;  2ZJR L;  3CC7 N;  1VQP N;  1VQL N;  3CCE N;  1QVG M;  1YIJ N;  1KQS M;  4IOC L;  1K73 O;  2QA4 N;  3CXC M;  1VQ9 N;  1VQ8 N;  1N8R O;  4IO9 L;  5MLC Q;  2ZJP L;  1K9M O;  3I56 N;  4WFN L;  4UY8 O;  5HL7 L;  1VQK N;  1Q81 O;  3G6E N;  3CCS N;  4WCE L;  4WF9 L;  5JVH L;  1K8A O;  5GAD P;  3J7Z O;  1VQM N;  1QVF M;  1YIT N;  1VQ6 N;  3PIO L;  3CCJ N;  3CME N;  1JJ2 M;  1NJI O;  3CCV N;  1VQO N;  1Q7Y O;  2ZJQ L;  1M1K O;  1YJ9 N;  1YJW N;  1OVY A;  3I55 N;  1W2B M;  1S72 N;  3CF5 L;  4IOA L;  2OTL N;  1VQ5 N;  1VQ4 N;  2QEX N;  4WFA L;  3CCL N;  4U67 L;  3CPW M;  5GAG P; 
#chains in the Genus database with same CATH topology
 1C0M A;  3SK3 A;  4EIA A;  4GW6 A;  4PUO A;  3I0S A;  3OS0 A;  3UKR A;  1E3M A;  2BUP A;  1KCF A;  2YNH A;  1HYS A;  4AIL C;  3OA9 A;  1HR0 K;  3OJS A;  1IV0 A;  3CQX A;  4JKF A;  4M45 A;  4CHY A;  3QBW A;  4FWK A;  4JD2 B;  2A40 A;  3WXK A;  3V9W A;  1BIU A;  3OBY A;  5C25 A;  4DTO A;  1WNS A;  3MN9 A;  4FJH A;  1Q86 O;  4EZ9 A;  3A0I X;  4CEA A;  4DF8 A;  3FZH A;  1VSK A;  2QKK A;  5M1Q A;  4CZI A;  1NLV A;  3GG4 A;  2ASM A;  3EN9 A;  4CF1 A;  4FWS A;  4GY2 B;  3CCR N;  4F3O A;  2W42 A;  5AQO A;  5KGX A;  3O9U A;  3G25 A;  1NMN A;  2KFN A;  3MX2 A;  5DK5 A;  4FK4 A;  4FJG A;  1KVA A;  4OKJ A;  4DR5 K;  3DAW A;  4BDP A;  3SUQ A;  1KQS M;  4FSV A;  2P9L B;  3AVH A;  3OJU A;  4HWI A;  3MEE A;  4ELU A;  3AVK A;  4FK0 A;  1I39 A;  3QML A;  3SBT A;  2YNF A;  4E7L A;  5AQZ A;  5CHI A;  3VTH A;  2E88 A;  1A5X A;  1RT3 A;  3LP2 A;  2E2O A;  4C1N K;  4JKG B;  4KH4 A;  3I56 N;  2HHW A;  3LWL A;  3L0Q A;  1VQK N;  5AZI B;  4DKW A;  2DFE A;  5CE3 A;  1U04 A;  4Y0W A;  4XH1 A;  4CK2 A;  2E6M A;  4K43 A;  4JKC A;  3AA2 A;  3R1X A;  4IBN A;  4DCH A;  4M41 A;  1VQM N;  4HHT A;  3DMJ A;  4C23 A;  4DV4 K;  3ZSR A;  4M3R A;  2I7N A;  5EXW A;  4DR2 K;  1RBU A;  3K2P A;  2J4R A;  4BR0 A;  1HKC A;  1MDU B;  4EFH A;  3SAH A;  2HB5 A;  3CFP A;  4BDZ A;  4FOE A;  5F0X A;  1U4B A;  4BRG A;  3CJC A;  2V7Z A;  3O9T A;  3SNN A;  2V7Y A;  4JV5 K;  2GBZ A;  4BC2 A;  3S3N A;  2YNI A;  1L3V A;  1JL1 A;  4MLE A;  3J7Y P;  4M3W A;  4CJK A;  3M5R A;  2ZM6 K;  4E1N A;  2HOE A;  3HPO A;  4MFB A;  3TAF A;  4RW7 A;  1I94 K;  1DKG D;  1JXB A;  4B1W B;  2OTJ N;  1M90 O;  3O4N A;  4FJM A;  3AY9 A;  4CJS A;  4H5W A;  3OBW A;  1FJG K;  3ID6 A;  4E19 A;  2HHX A;  5JVG L;  3LAN A;  2O8E A;  3KD5 E;  3CMA N;  3CQY A;  4FOI A;  2G8V A;  2HHU A;  4OPA A;  4TSX A;  4YFU A;  1EP4 A;  2DPN A;  2RN2 A;  4WYB A;  3EZW A;  4BR2 A;  3SV4 A;  4B1U B;  3LDP A;  4CIG A;  4IOC L;  3L3V A;  3LZI A;  4CJU A;  1VQ9 N;  3NE6 A;  4IEI A;  1HX1 A;  1N8R O;  1W7A A;  2A1R A;  5HOO A;  1G99 A;  4DSI A;  2R7Y A;  3QIN A;  4ID5 A;  3TSU A;  4DTN A;  1T05 A;  4DV0 K;  4CIF A;  3FZL A;  4M63 C;  3R8E A;  1SKW A;  3PO5 A;  4KH5 A;  3DOK A;  3L4Q A;  3WXL A;  4LF6 K;  2O8C A;  3THW A;  4WF9 L;  3CQ8 A;  3S3M A;  4CZL A;  3P4I A;  2Z1H A;  1HYV A;  1TUY A;  4FO0 A;  1QVF M;  3OYN A;  1C1B A;  3DWL A;  5AQS A;  5FDL A;  3V1Q A;  4O0J A;  3TSP A;  5KI6 A;  5HBM A;  4ILG B;  3AVN A;  1VQO N;  4CED A;  3LP0 A;  4B9L A;  3VTI A;  1L3T A;  2F7T A;  5IWA K;  3FZM A;  1L3U A;  4IOA L;  1J5E K;  1VQ4 N;  3ZEU A;  2VQF K;  1XC9 A;  4OPH A;  4WQ5 C;  1NGI A;  4A5A A;  4CCH A;  4JI2 K;  3V9X A;  2P9I B;  2PYJ A;  3OYH A;  4CGD A;  2VYP A;  3CJA A;  4OJR A;  1NJY A;  5BPL A;  4DQR A;  1KAX A;  3HK2 A;  2HHQ A;  2EX3 A;  4H4O A;  1KXP A;  3P39 A;  1BDG A;  3F9K A;  3VGL A;  3H6E A;  4W5R A;  5HRS A;  4RTF D;  2VWB A;  1NK4 A;  3DLE A;  2AA4 A;  2D5R A;  1SQK A;  5AQJ A;  5J2N A;  4BRK A;  1KFD A;  5KRS A;  3CHW A;  4Z4F A;  2KFZ A;  2FF6 A;  3P31 A;  4X64 K;  4LSN A;  4BVP A;  4CEC A;  3VES A;  1BA1 A;  4IZ9 A;  4A2A A;  4N5S A;  1D5A A;  1VQP N;  4JKA A;  2Q0R A;  3NH2 A;  2Y1I A;  3ZET A;  3N4P A;  4X66 K;  3AA5 X;  4DR6 K;  4MO5 A;  1BWF O;  3HOS A;  2O8B B;  5C2F A;  2VG6 A;  4CZJ A;  1NU0 A;  1Q9X A;  3PX0 A;  4QAG A;  3H3N O;  1EX4 A;  4B1Z A;  1S6Q A;  4DTU A;  1RT7 A;  4CEO A;  2ZF5 O;  4WQ5 A;  2QWP A;  4OLA A;  1RBS A;  4IKF A;  1EET A;  1U49 A;  4FJL A;  3ENB A;  4E7K A;  1U47 A;  3KWI A;  3TAM A;  4MO4 A;  3I33 A;  3PIO L;  3CCJ N;  3KHY A;  2GWJ A;  1T03 A;  3TAE A;  2F8T A;  1BL3 A;  4CHZ A;  1ESV A;  3GL1 A;  4KI6 A;  4B1X B;  3RR7 A;  4KAZ A;  1IG8 A;  3GBT A;  3HST B;  2OZM A;  5C24 A;  1O1W A;  4JNE A;  3OYL A;  3VGM A;  3MWP A;  4JKB A;  5ADX H;  1T3V A;  2NRX A;  3VOV A;  2A42 A;  3IS9 A;  1GLL O;  3VER A;  1XC3 A;  3WUH A;  1S5J A;  1XNQ K;  4FL9 A;  3NMU A;  1QQO A;  3A5L C;  3D45 A;  3NH1 A;  1N6Q A;  4K42 A;  1TKX A;  1YT3 A;  3K5L A;  1BCM A;  1XMQ K;  4B9Q A;  3IUC A;  3NF6 A;  1R59 O;  2I5J A;  2G8W A;  3KKS A;  4O8K A;  3TTD A;  4KKO A;  4JLH A;  4BRH A;  4DFM A;  1NKC A;  4DU1 A;  4PKH A;  4YOY A;  3O6W A;  3KD1 E;  5E41 A;  5FRO A;  3HOT A;  4C8L A;  2A5X A;  2QK9 A;  4DSK A;  1RBV A;  4YOX A;  3P1G A;  4DFP A;  3V81 A;  3QIP A;  4CZE A;  3CG7 A;  3VQ4 A;  1QHA A;  3ULE B;  1KFS A;  4CBX A;  3CC7 N;  1B9D A;  2F9T A;  3VQ7 A;  3E9P A;  4CZM A;  4KRE A;  3SMP A;  4DUY K;  1KAY A;  3CJ1 A;  3DI6 A;  5TKW A;  4I9Q A;  1JXE A;  3S3O A;  4KHU A;  4HTU A;  1V4T A;  4DSL A;  4OKE A;  3HTV A;  1RFQ A;  2PAV A;  3ZT4 A;  1NNE A;  4LF5 K;  1EO1 A;  3H3O B;  1S1V A;  2YI1 A;  5M1N A;  1HQE A;  2OPP A;  3B6P A;  3MEG A;  4BC3 A;  3J7Z O;  3WNG A;  4ISG A;  1HRH A;  4FM1 A;  1HNW K;  4KHN A;  2KLA A;  4BRI A;  5BPN A;  1DTQ A;  4JK7 A;  3HI0 A;  1RT1 A;  3QLH A;  4OPJ A;  4NYF A;  4QS8 A;  3HYF A;  2OA8 A;  3FE1 A;  2GEL A;  1ASV A;  1ASW A;  4WFA L;  2AP1 A;  1NJW A;  2O4G A;  4LSL A;  4PQU A;  1IKX A;  1RDU A;  4H8K A;  4CGG A;  3QBX A;  4AHU A;  1WUA A;  1IKY A;  1TYQ B;  5JMV A;  3CD6 N;  1MWK A;  1LOT B;  4K25 A;  3AVC A;  3SQ2 A;  5LL6 Z;  4LF8 K;  4AM6 A;  1NWK A;  4NXM K;  4DUZ K;  1NGA A;  4IEE A;  2V52 B;  2UXD K;  3SQ1 A;  3MDQ A;  1WSH A;  1VSL A;  2HBM A;  3AVM A;  4WFB L;  4CFC A;  4BWJ A;  4OX9 K;  3HPH A;  2IAJ A;  3HVR A;  1ATR A;  4QOZ B;  3V9S A;  1YHQ N;  1G15 A;  4Z94 A;  1QS4 A;  3BF3 A;  4FW1 A;  1WSG A;  4H0Y B;  3S9H A;  4K0K K;  2O8F B;  3IKM A;  3V9Z A;  3NHG A;  4O0I A;  3JXU A;  4AHV A;  3O1B A;  3ZSV A;  3LDN A;  4CJ3 A;  5I3U A;  4CEE A;  4E1M A;  4Z4H A;  3ATV A;  3V1R A;  2QA4 N;  5AQX A;  4JS5 A;  4F9O A;  1S9G A;  3MN6 A;  3D6R A;  3HSC A;  4CEB A;  2X6S A;  2OYQ A;  4BRC A;  4UQG A;  5AFU H;  3CM5 A;  1W97 L;  4M7Y A;  4FJ9 A;  4DHY A;  2A3Z A;  3DXK B;  1ASU A;  4B1Y B;  3VEX A;  3NDK A;  4LF4 K;  1DGK N;  5C0Y A;  4FVU A;  3SPY A;  3ID8 A;  2H3G X;  4FJ8 A;  3AVB A;  1NBW A;  1GLB G;  3KVG A;  1QSL A;  1IKW A;  3RTV A;  4M3T A;  1HJO A;  3SUN A;  3RWU A;  5ELZ A;  4XEI A;  2HHH K;  1FXX A;  4BVO A;  4BC5 A;  3L6Q A;  3IFR A;  4QCL A;  2E4L A;  4DFK A;  4H0T B;  1V4S A;  2NRH A;  4BRL A;  3FZK A;  3QFU A;  1EQY A;  1NGH A;  2P9U A;  1IBM K;  1P8Z A;  2HNY A;  3LAL A;  2RE2 A;  5AQL A;  4LD0 A;  2ITG A;  1T6D A;  3UKU A;  2ZWH A;  2QWM A;  4CF2 A;  3UB5 A;  2YHX A;  4DG1 A;  1X9S A;  4Q5V A;  4KHQ A;  3SUO A;  2NNW A;  3R3L A;  3ZCM A;  1ZBF A;  2BE2 A;  3NGI A;  3D2E A;  1I3A A;  3U4L A;  5GAE P;  5AQN A;  1Z6R A;  4BRA A;  4OLB A;  3RVC A;  3ZSZ A;  1BU6 O;  4BDY A;  2B5J A;  5AQY A;  4CK3 A;  4CJW A;  4HUE A;  2WOM A;  4GV9 A;  1NOZ A;  4M3X A;  1FK9 A;  1WSE A;  5BRF A;  2OCE A;  4B08 A;  3HL8 A;  3R6M A;  5JLF A;  2FBY A;  4CHP A;  2QI2 A;  4ILH A;  3U9Z A;  3THV A;  2IIR A;  1NGE A;  4NLC A;  4RW4 A;  5M1K A;  4ID1 A;  1JLA A;  1ZBS A;  3TI0 A;  2VG5 A;  2YHA A;  3TAB A;  1K73 O;  3RR8 A;  1XHX A;  2A1S A;  2HBK A;  4FPA A;  5EVZ A;  2P9K A;  3TU5 A;  3QEW A;  1YVN A;  3MXJ A;  1Z26 A;  3H08 A;  1SKR A;  3LDL A;  4LF7 K;  3SUP A;  2O8D B;  1WN7 A;  1GLF O;  3PV8 A;  1K9M O;  4BQL A;  3VEW A;  4H5R A;  3OYD A;  3C95 A;  5BR9 A;  4KFB A;  2F8S A;  1X9J A;  2I7P A;  4KHS A;  2UU9 K;  4DTJ A;  3E9L A;  3PO4 A;  3OYF A;  3T3F A;  2IOC A;  2ZQB A;  2Q0U A;  3M8P A;  5C10 A;  1WLJ A;  1IO2 A;  2KTQ A;  5JLH A;  3AA4 A;  2G8K A;  2HF4 A;  5C12 A;  4I7F A;  4CEQ A;  4X62 K;  3LDS A;  1M1K O;  2IS3 A;  4FLY A;  1N32 K;  2DFF A;  2G8F A;  4LF9 K;  4B9M A;  1ZBH A;  1W0H A;  1LCU A;  4ZTJ A;  2IVP A;  1ZYQ A;  4NCG A;  4I9L A;  4AHR A;  4YOW A;  1J9A A;  4BRQ A;  4ZTF A;  1SZ2 A;  3F73 A;  4DR7 K;  4XIU A;  3RSE A;  2FLO A;  3DM2 A;  4GV3 A;  4LY7 A;  1FKO A;  1IH7 A;  2ITM A;  5LY3 A;  3CM6 A;  3G4S N;  2FF3 B;  4R79 A;  1U6Z A;  4CD1 A;  3M8R A;  4JK8 A;  3NVK A;  3VQP A;  4J2B A;  4F3T A;  2P9N A;  3CJ7 A;  1KD1 O;  3QER A;  3MCA B;  4BGB A;  3CME N;  4HCC A;  4CJT A;  4FM0 A;  2UUA K;  5J2P A;  3QIO A;  4FWQ A;  3MMV A;  4DWI A;  5J2Q A;  4O5B A;  2Q31 A;  3HBT A;  3OY9 A;  2F9W A;  3K9K A;  3A5N C;  4JHD B;  1IG9 A;  4BR5 A;  4DU4 A;  1UWB A;  1RT5 A;  1KVB A;  3AAR A;  4AHT A;  1BUP A;  3PLA A;  1EWQ A;  4B8C A;  4M3Y A;  3ZT0 A;  4FLT A;  4HVJ A;  3CCE N;  1JLC A;  1TGO A;  1D9D A;  1TUU A;  1BQN A;  4JI1 K;  2A41 A;  1TKZ A;  4DTS A;  4DV2 K;  4B3T K;  1HNI A;  3VQQ A;  5AQQ A;  3AVG A;  3M1F A;  3KJV A;  4FK2 A;  3PSF A;  1S1X A;  3P83 D;  3C94 A;  4DTX A;  2FSN A;  3CYM A;  1WBB A;  1UAX A;  3O80 A;  4IG0 A;  3PUF A;  1VRU A;  4JYA K;  4FLU A;  3G6E N;  4BE2 A;  3O8M A;  3CER A;  1LAW A;  2RHK A;  4DLE A;  3L2V A;  4BGA A;  3LZJ A;  5BN9 A;  4EHT A;  2DY4 A;  1BO5 O;  3Q7C A;  2ETJ A;  4KHY A;  4DTM A;  1NK9 A;  2P9S B;  4JI3 K;  4M42 A;  1NOY A;  4H0V B;  3HO1 A;  3M3Z A;  2QM1 A;  3R9P A;  4DLG A;  4O5F A;  3TAN A;  1U45 A;  4F2S A;  3VQB A;  4LC9 B;  2DTU A;  1UOC A;  3DLH A;  2NUB A;  3L3U A;  3TAP A;  4H5V A;  4FVM A;  3H1V X;  3O08 A;  4CJF A;  3CPW M;  3J8A A;  1QZ5 A;  3TAG A;  3THY A;  1K8K B;  3LDQ A;  3T1Y K;  1DTT A;  3DRP A;  4XH5 A;  1RIL A;  4OGC A;  4DV7 K;  3THX B;  2VWJ A;  3OYA A;  3K5O A;  1RBR A;  5HRO A;  3IDH A;  4Z4G A;  5AJ3 K;  1KSP A;  4YY3 K;  2XO7 A;  3DXM A;  3CJB A;  3VQD A;  5FPN A;  1Q82 O;  3PSI A;  3ZLJ A;  3CCQ N;  3DLB A;  3K57 A;  5CR4 A;  4Y1C A;  1IKV A;  1OH8 A;  1WSF A;  3O4Q A;  5KGW A;  2HHV A;  2O4I A;  4N47 A;  1YUW A;  3C7N B;  4X65 K;  5FPM A;  3CCM N;  4JD2 A;  5T7B A;  2P1J A;  1RTH A;  3SQ0 A;  3DLL L;  3N4Q A;  3EO3 A;  2E2P A;  3NFA A;  4AHC A;  2GX9 A;  5E84 A;  3OHR A;  4JEP A;  4IFV A;  1C1C A;  4EP5 A;  4W5Q A;  3LPT A;  5LMU K;  4ISE A;  2HW3 A;  1NMD A;  3D0P A;  1SKS A;  1NJX A;  4HUG A;  3FLC O;  3P38 A;  2QXL A;  1BA0 A;  1RTJ A;  2P9L A;  3K9J A;  4BE0 A;  1XQS C;  1JLB A;  2Q1N A;  3QEV A;  5D3G A;  1WOQ A;  3AA3 A;  4WCE L;  3KK1 A;  4E7J A;  3E01 A;  5JVH L;  3CJ9 A;  4A62 A;  3I8D A;  4DTP A;  4JKG A;  4BE1 A;  1HNZ K;  4JI6 K;  3DLR A;  4BRE A;  5AZI A;  4RCH A;  4CVN E;  1WAJ A;  3OYJ A;  2HVI A;  1Z05 A;  1OKJ A;  3D2F B;  4FLW A;  4DQ8 A;  3SJJ A;  4G1Q A;  5M1F A;  1ZC6 A;  3LAM A;  5M1P A;  1W2B M;  2Q97 A;  3CF5 L;  5KPR A;  3CPE A;  4A61 A;  2QEX N;  1NGB A;  3O9R A;  2BDP A;  3RMB A;  4PL7 A;  4CK1 A;  3EY1 A;  1BI4 B;  1JCF A;  3MCP A;  4B9U A;  3ZX0 A;  4KRF A;  4PHT X;  5BRE A;  3WT0 A;  1E4G T;  1RCH A;  3ISN C;  3I0R A;  2VWK A;  5GIN A;  1S1W A;  3L2W A;  4BR7 A;  3DOL A;  3QET A;  4J2A A;  1T6C A;  2PY5 A;  3VPZ A;  1FW6 A;  3SJH A;  1VSJ A;  3O4W A;  4CEF A;  4CJR A;  4I6M B;  1C1A A;  3K5N A;  4CW7 B;  4DF4 A;  3CCU N;  4NCB A;  2IVO A;  2OPQ A;  4M3Z A;  3PX4 A;  5AQI A;  1BHL A;  1NK7 A;  4BWM A;  3OYM A;  3OW2 M;  4FJI A;  3VQ5 A;  4CJV A;  2D0A A;  2YJE A;  2FSJ A;  1RDW X;  1RGI A;  4O8U A;  4ELT A;  2YV0 X;  5DM6 L;  4DR3 K;  3WEE B;  3DLK A;  3VA3 A;  1IJJ A;  3WXI A;  4FLX A;  3SQ4 A;  1K6Y A;  4IXC A;  2JWL A;  2HMI A;  3CXC M;  4CGI A;  5TKY A;  4DV5 K;  4CF9 A;  2NLX A;  4DQS A;  4EZ6 A;  1KLM A;  2EHG A;  3ENO A;  2YKM A;  3NF9 A;  2QWQ A;  3T69 A;  3CFO A;  1ZBL A;  1CZ9 A;  4JI4 K;  3PY8 A;  4FZZ A;  3QO9 A;  2WFB A;  3HVT A;  2QWO A;  2UYT A;  4BY9 C;  5EU7 A;  4DTR A;  3ZSW A;  4PY5 A;  3M6G A;  1RTD A;  4CHQ A;  3GE1 A;  2CH5 A;  4IG3 A;  3FZF A;  4DS4 A;  4JAX A;  3HZ6 A;  2JGU A;  4M3U A;  4IJA A;  3KIO A;  4YOV A;  2YHW A;  4IDH A;  1IBK K;  3UKR B;  3G10 A;  5SZT A;  3LP3 A;  2HMP A;  3AVI A;  4MQ3 A;  4B3O A;  3CCL N;  2P51 A;  3QNO A;  1RT2 A;  5CYM A;  3ZYY X;  3BY5 A;  4BQZ A;  3AO1 A;  5KRT A;  1L3S A;  1X3M A;  3BZC A;  4Z4I A;  1RDB A;  3OYK A;  2P9I A;  3ZT2 A;  4IFY A;  4FCY A;  2YCH A;  3C6T A;  5AQV A;  3E1Y A;  4OKK A;  2HF3 A;  3RRH A;  4DMN A;  4KB1 A;  4DV3 K;  5AQH A;  2D0O A;  3JS6 A;  3TAR A;  3OYB A;  4FWN A;  3O3G A;  4CHN A;  3OYC A;  4A5B A;  1CXQ A;  4FWL A;  2X78 A;  4PL8 A;  1S9E A;  3VQ6 A;  1NG9 A;  3ENH A;  4CI6 A;  3SAG A;  4J2E A;  1XUP O;  2HVH A;  2RF2 A;  4DU3 A;  4E7I A;  5KQD A;  4CJL A;  1XHZ A;  5CY4 A;  3LAK A;  3UIQ A;  1ATN A;  3T1H K;  4F4K A;  4ZHR A;  3VQ8 A;  2PZS A;  3AO2 A;  1YTU A;  4FWO A;  1J6Z A;  4YOT A;  4OGE A;  4CD3 A;  1HNX K;  5BN8 A;  3CFR A;  1YVU A;  4FZX C;  4YDU C;  4B1V A;  3HPG A;  2KHO A;  5HL7 L;  1NK5 A;  2O8B A;  1SL1 A;  4BRF A;  5A2Q O;  2E5L K;  4EHU A;  4A57 A;  3OYI A;  4W5T A;  1HQU A;  3AV9 A;  3LDO A;  1K8A O;  4FJ5 A;  1YAG A;  4FJX A;  2F4V K;  3QEP A;  3TR8 A;  1Q9Y A;  3T1A A;  1WB9 A;  4CJ5 A;  1XWL A;  3F2K A;  4IJN A;  3ITH A;  4F8R A;  2RKI A;  3EE9 A;  2NRR A;  3MAQ A;  3QEX A;  5BRD A;  3U6F A;  1FKP A;  2OAN A;  5GIO A;  2P5O A;  3BF1 A;  2UXB K;  3B6O A;  5AQW A;  4K8X A;  4B3S K;  3M8S A;  5FPE A;  5LJW A;  1RDD A;  1C0U A;  5AQP A;  5JS1 A;  5K14 A;  4FWP A;  3RMC A;  2QXF A;  4NXN K;  3SLC A;  2JLE A;  2E1Z A;  3IRX A;  4CES A;  1TVR A;  3JAM O;  4KBO A;  4FJK A;  1HUX A;  3KK7 A;  1O13 A;  2HNZ A;  1BOT O;  2YJF A;  2O8E B;  4BR4 A;  4YDU A;  3V1O A;  3OS2 A;  3V9U A;  3WEE A;  3OVN A;  1YI2 N;  1ZBI A;  3MN5 A;  1UA0 A;  3SBG A;  2FBV A;  3CI5 A;  3F9M A;  3T7Z A;  1U48 A;  2WON A;  4RW9 A;  3HM8 A;  4CJ7 A;  1VSH A;  2Q3S A;  3K0S A;  1QSY A;  4AH9 A;  2ZE2 A;  5CZ2 A;  4CF0 A;  4K8Z A;  3WNH A;  2Z1J A;  4L8R B;  3OTO K;  4GVM A;  1LW0 A;  4KO0 A;  3ULE A;  1Y64 A;  4DQQ A;  2O8C B;  3AVF A;  3GDQ A;  3EZ5 A;  4E7H A;  1C0G A;  3THW B;  4LFB K;  1CLQ A;  2JWK A;  1EKE A;  5E26 A;  1LW2 A;  2D1K A;  2ZD1 A;  2WC9 A;  3AAP A;  4JRP A;  1GLD G;  2GEM A;  4O4G A;  2XY8 A;  3CCS N;  3KTQ A;  1OH5 A;  2VCP A;  3BEX A;  1B9F A;  5I9E B;  3HP6 A;  2YX6 A;  3V6D A;  1C6V A;  4KHW A;  4RW8 A;  4CER A;  5I42 A;  3MN7 A;  5CZ1 A;  5LJV A;  1NM1 A;  5M1O A;  3EYZ A;  1TK8 A;  4ELV A;  1L5U A;  4U7B A;  1HJR A;  3J81 O;  3L2Q A;  1NJI O;  3CCV N;  2YNG A;  3ZEU B;  1KRP A;  3QEI A;  5AR0 A;  3HJF A;  1MWM A;  4H5T A;  3HP9 A;  2HBL A;  2FSK A;  1X3N A;  4Z4C A;  3K5M A;  2D0C A;  4RG8 A;  1OH7 A;  2KKZ A;  1RTI A;  3VEZ A;  1D8Y A;  3FFK B;  2OPR A;  4LH5 A;  2B4J A;  1N34 K;  4N41 A;  3O9S A;  4CJP A;  4JKD A;  2UUB K;  3H46 O;  1SUQ A;  1NGC A;  3OS1 A;  1NKB A;  1TK5 A;  1HKG A;  4BRP A;  2P5G A;  3S41 A;  5AQK A;  3DJC A;  1TYQ A;  5DMR A;  4HUF A;  1S6P A;  2KZZ A;  1ILY A;  5AZJ B;  3LWM A;  1YJN N;  3O3H A;  5AFU A;  3BZK A;  3VET A;  2PYL A;  1VK0 A;  2FBX A;  3VQA A;  4IOX A;  3AVA A;  4JI0 K;  4WE1 A;  3ZET B;  3GOI A;  1C0F A;  3AGR A;  1LAV A;  5BRH A;  5J1E A;  3P5J A;  1KC8 O;  2ZJR L;  1TL3 A;  4KI4 A;  4DSE A;  1KAZ A;  4B3M K;  1YIJ N;  2IDO A;  3MK6 A;  1GLC G;  1TKT A;  1N36 K;  3L8B A;  2NRW A;  2GWK A;  2O8F A;  1HNV A;  1T44 A;  1F21 A;  2YKN A;  3W0L A;  3KZB A;  1DT9 A;  3DYA A;  4H0X B;  4Q0B A;  3SCX A;  3NGZ A;  2ZGY A;  1BQM A;  3EE8 A;  2VQE K;  1T8E A;  3E66 A;  1B92 A;  1RDA A;  3VF6 A;  3SI6 A;  3U3Y A;  3SV3 A;  2OPS A;  4FXD A;  4W5N A;  4CZF A;  4GKK K;  5HLF A;  3SYZ A;  1S1U A;  3C6U A;  4DFJ A;  3DLG A;  4H0O A;  4O55 A;  2Z1I A;  3MED A;  1CZB A;  3A5M C;  4CZK A;  4W5O A;  4JK9 A;  2HBJ A;  1JJ2 M;  4DR1 K;  3DXK A;  3MEC A;  4DS5 A;  4NLB A;  4YOR A;  4CBU A;  2XY5 A;  4JKH A;  3AGK A;  2IC3 A;  1XMO K;  3ASM A;  1YJ9 N;  2W6K A;  2G8U A;  4CE9 A;  5AQR A;  1S72 N;  3B8A X;  1HPZ A;  1QZ6 A;  1VQ5 N;  2PFU A;  1U2V B;  4FJJ A;  5AQF A;  1ZXO A;  1X9M A;  5EOY A;  4C8N A;  4CFB A;  5C42 A;  2NZT A;  1X9W A;  1QQC A;  4CJE A;  3NGY A;  1SL0 A;  1QQM A;  2EWS A;  5AQT A;  4ISF A;  2WTU A;  2WUS A;  4PWD A;  4BG9 A;  2F96 A;  1GLJ O;  1X1P A;  4LH4 A;  1VQN N;  3O1W A;  3VEY A;  1CXU A;  4EAH D;  3KLE A;  4JI8 K;  1S22 A;  4AQY K;  4JS4 A;  1S3X A;  3CC4 N;  1VSM A;  4JI5 K;  1WAF A;  4G9Z A;  1VSE A;  2ZGZ A;  3LM9 A;  1HPM A;  3E9O A;  1IBL K;  1GOC A;  1YF5 L;  2E8A A;  3CC2 N;  1OH6 A;  1QE1 A;  5FRM A;  1D4X A;  3KLI A;  1SAZ A;  3SZ2 A;  1RT6 A;  3C65 A;  2E6L A;  3JYT A;  5FRN A;  3NF8 A;  1VQ8 N;  4J2D A;  5C15 A;  4ICL A;  2X6N A;  3VGK A;  2Q2R A;  5CYQ A;  3LPU A;  1TK0 A;  2BGG A;  4KTZ A;  1QSS A;  3U8X A;  3C6A A;  1WSI A;  4DSF A;  4E1J A;  4GKJ K;  1NGF A;  3VN5 A;  2A6A A;  5BR8 K;  2O8D A;  2QWL A;  5GAD P;  2YHY A;  3VMF B;  3DRS A;  3C0B A;  3U3G A;  3TAQ A;  1HLU A;  4M7X A;  3BUZ B;  1RDC A;  2QKB A;  4CJQ A;  4CZH A;  2QTD A;  2E1Y A;  5KTQ A;  3MX5 A;  2UUC K;  1R0A A;  4CFD A;  4FW2 A;  3BDP A;  1GLE G;  1TAQ A;  4H4M A;  3MWT A;  1LWE A;  4NB4 A;  2XY6 A;  4C8M A;  2FXU A;  4CIE A;  2XRI A;  3AO4 A;  4DSJ A;  1T7P A;  4LFC K;  2PBD A;  2V51 B;  3D7E O;  4O44 A;  2GUI A;  4F2R A;  3I8B A;  4EP4 A;  1ZBU A;  2CGK A;  4XH4 A;  1UA1 A;  2NRZ A;  2NRT A;  1NKE A;  3A5O C;  1JLE A;  2D0P A;  3QES A;  1NK8 A;  5H1S Q;  5DM7 L;  4GV6 A;  1C0T A;  3VF4 A;  3O9Q A;  3TPQ A;  5AZJ A;  1ATS A;  2W40 A;  4CGJ A;  1VSD A;  4AM7 A;  2HHS A;  3PIP L;  1REV A;  5HP1 A;  1VQ7 N;  2G8I A;  1SS6 A;  4YOU A;  4OVL A;  1A5W A;  1YXQ A;  2BAN A;  3G71 N;  3WXJ A;  3AO3 A;  3CET A;  4PA1 A;  4JN4 A;  4FJ7 A;  4B8A B;  3ZX2 A;  4CEZ A;  3A2F A;  3CIP A;  4K41 A;  3RRG A;  4I2Q A;  4DR4 K;  2RPI A;  4B3R K;  3LP1 A;  2VG7 A;  2GV9 A;  3WQT A;  3EKU A;  3NVM A;  3TSQ A;  1Y97 A;  2CGL A;  1S1T A;  2GUP A;  3F5T A;  4B9T A;  3IMX A;  2XHB A;  4Y1D A;  3VQC A;  1KVC A;  3C6H A;  5EY4 A;  4BAC A;  4C8K A;  4JHD A;  3NH0 A;  3QNN A;  4JKE A;  3NBP A;  3UE5 A;  4BRM A;  4IO8 A;  4AHS A;  4WFN L;  1Z25 A;  1NGJ A;  3DRR A;  3U9D A;  3HXM A;  3KLH A;  1QTM A;  3VQE A;  4OPK A;  3TTF A;  4CHO A;  5LMN K;  3LM2 A;  4NO7 A;  4WQ4 C;  1JKH A;  3WXM B;  3HRG A;  1TL1 A;  1DEJ A;  2ASO A;  1LWC A;  4J8F A;  1BIZ A;  1XNR K;  1NK0 A;  2YHB A;  4KH6 A;  2P9U B;  2QWR A;  4RWT A;  1TKD A;  1E4F T;  1NJZ A;  2UXC K;  1KTQ A;  5C2D A;  1U2V A;  3UKU B;  3ULD A;  2E20 A;  1Q7Y O;  2VGN A;  3WQU A;  3J7A P;  1YJW N;  4NCA A;  1QQN A;  1JCE A;  2P9S A;  3QDK A;  3FFI A;  3D2E B;  3KLG A;  4DV1 K;  4BC4 A;  3EEQ A;  4A59 A;  2QW9 A;  2D0B A;  4U67 L;  3ATU A;  5GAG P;  4RW6 A;  3RMD A;  1GOA A;  2VGM A;  2Z1G A;  1JLQ A;  2X74 A;  4QS7 A;  2KQ2 A;  1N5Y A;  1CZA N;  3L2R A;  5FLX O;  4B9S A;  3M8Q A;  3SMS A;  2KW4 A;  2P9P B;  1ITG A;  3JSM A;  1K8K A;  5AQG A;  2B6A A;  1KLN A;  1GLA G;  1J53 A;  4QS9 A;  4CZG A;  2D4W A;  3EKS A;  3FGU A;  1JLG A;  4H03 B;  4MDA A;  1SL2 A;  4B9V A;  1TAU A;  5KPT A;  3THX A;  4PKG A;  2DFH A;  5HRP A;  3PX6 A;  1VSI A;  4HCB A;  1VAZ A;  4KV8 A;  3VF2 A;  4NYN A;  4KTQ A;  5HRR A;  3V4I A;  5GAH P;  4AF1 A;  4JI7 K;  4GVE A;  4WQ4 A;  3VEN A;  4FLZ A;  4FZY A;  1BCO A;  5J2M A;  2P9K B;  4L3Q A;  5KQ8 A;  2W41 A;  4BRO A;  1J5O A;  4MDB A;  2IVN A;  1VQL N;  3C7N A;  4IWV A;  2ATQ A;  4GMJ B;  4YNQ A;  3NCI A;  3K59 A;  1JL2 A;  3W3D A;  2FC0 A;  4MLH A;  1XI1 A;  5MLC Q;  1SV5 A;  4E3S A;  3KKR A;  3BGR A;  5HRN A;  1VRT A;  1JCG A;  1J54 A;  4CJ4 A;  1Q81 O;  4C1N I;  2E2N A;  3KK2 A;  3ZSY A;  4E89 A;  5B8H A;  4GNI A;  3TWH A;  1EXQ A;  2FBT A;  1HMV A;  4FYD A;  4PKI A;  3L2U A;  3KWG A;  3ZT3 A;  5F2R A;  5F1X A;  5FPD A;  4DV6 K;  1W9H A;  4CGH A;  4CGF A;  3MXI A;  4FM2 A;  3NF7 A;  3SAF A;  4N76 A;  4BRD A;  3O3F A;  4C8O A;  3RSE B;  3Q7B A;  3I55 N;  5ADX A;  4IFE A;  1EWR A;  2G8H A;  1WBD A;  1HYZ A;  2XY7 A;  3D2F A;  5AQU A;  2KZM A;  4JRQ A;  4A2B A;  4H5N A;  1GOB A;  4OO1 J;  4DQP A;  3IAY A;  2IGI A;  1LV5 A;  4IDK A;  1RBT A;  1TV6 A;  4CF8 A;  2GTD A;  3AVL A;  2OTL N;  3LL3 A;  2P9N B;  2BTF A;  1LWF A;  4HTL A;  4CBW A;  1HKB A;  4N56 A;  3FR0 A;  2NRV A;  2WBN A;  4FWM A;  1BI4 A;  3VEO A;  1D9F A;  1NGG A;  3IG1 A;  4I2P A;  4LFA K;  3TTC A;  3K58 A;  1Q18 A;  4FWR A;  2HHT A;  3EL2 A;  3ZT1 A;  2HND A;  2BH1 A;  1VSF A;  3G0Z A;  3ZX3 A;  5EX5 A;  2W6L A;  1BGX T;  3O5B A;  3VA0 A;  4I6M A;  1H1V A;  1Q8I A;  1BIS A;  2Y1J A;  4KB0 A;  1DLO A;  4H0P A;  1WSJ A;  2QWN A;  3NAE A;  4BG8 A;  1NGD A;  4R5P A;  1QHT A;  3HM9 A;  4CFA A;  1QVG M;  3KK3 A;  3QFP A;  1RT4 A;  3WNE A;  4KPY A;  4Z0U A;  3KLF A;  4IO9 L;  3RMA A;  4DB3 A;  1OVQ A;  2ZJP L;  3ALY A;  1BG3 A;  3MXM A;  2LSN A;  4UY8 O;  3L4I A;  5JS2 A;  5KPZ A;  3OYG A;  5GIP A;  3AO5 A;  2AJQ A;  5IT9 O;  1VHX A;  4FLV A;  4V19 S;  5AQM A;  3SPZ A;  1A5V A;  1MU2 A;  3HT3 A;  3AVJ A;  3H45 C;  1P90 A;  2ASP A;  3H1Q A;  4YHH K;  1YIT N;  4ILJ A;  1VQ6 N;  1RNH A;  1MA9 B;  4B9N A;  4FJN A;  3T19 A;  4KTW A;  2OZS A;  1N33 K;  4KHP K;  5JIC A;  3OYE A;  4Z4E A;  3AAQ A;  3ZSQ A;  2CH6 A;  3J80 O;  3QIC A;  4FPB A;  2ZJQ L;  3A8Y A;  4BR9 A;  3BP8 A;  1OVY A;  2CGJ A;  3QB0 A;  2E2Q A;  2Q36 A;  4BRN A;  3THY B;  2HST A;  1YTA A;  5BPM A;  3ZSX A;  3ZSO A;  1NK6 A;  5SWM A;  4E0D A;  1JLF A;  3WNF A;  4DQI A;  3VQ9 A;  3VEV A;  2P9P A;  3DXM B; 
#chains in the Genus database with same CATH homology
 1QQM A;  2EWS A;  3SK3 A;  1TYQ B;  5AQT A;  4ISF A;  4EIA A;  5JMV A;  3CD6 N;  5GIN A;  1MWK A;  2WUS A;  1LOT B;  3UKR A;  4BR7 A;  2BUP A;  4K25 A;  4BG9 A;  3OA9 A;  1GLJ O;  4AM6 A;  1NWK A;  1T6C A;  3VPZ A;  3SJH A;  3CQX A;  1VQN N;  4JKF A;  1NGA A;  4IEE A;  2V52 B;  3QBW A;  3O1W A;  3O4W A;  3MDQ A;  4FWK A;  4JD2 B;  2A40 A;  3VEY A;  4EAH D;  2HBM A;  4I6M B;  3WXK A;  4WFB L;  1S22 A;  3OBY A;  3CCU N;  2IVO A;  3MN9 A;  1Q86 O;  1S3X A;  3A0I X;  5AQI A;  3FZH A;  3CC4 N;  1ATR A;  5M1Q A;  1YHQ N;  4CZI A;  1NLV A;  4Z94 A;  3OW2 M;  3GG4 A;  2ASM A;  2YJE A;  3EN9 A;  4G9Z A;  2FSJ A;  1RDW X;  2ZGZ A;  3BF3 A;  3LM9 A;  4FWS A;  4GY2 B;  4H0Y B;  3CCR N;  1HPM A;  1RGI A;  3E9O A;  5AQO A;  4O8U A;  1YF5 L;  2E8A A;  3O9U A;  3G25 A;  3CC2 N;  5DM6 L;  3IKM A;  3WEE B;  3JXU A;  3MX2 A;  1D4X A;  1SAZ A;  3O1B A;  1IJJ A;  3WXI A;  3LDN A;  3C65 A;  3DAW A;  4IXC A;  1KQS M;  4FSV A;  2P9L B;  4HWI A;  2JWL A;  3ATV A;  3CXC M;  2QA4 N;  5TKY A;  1VQ8 N;  5AQX A;  3QML A;  2NLX A;  3SBT A;  4F9O A;  5C15 A;  3VGK A;  3MN6 A;  2Q2R A;  3D6R A;  3HSC A;  5AQZ A;  5CHI A;  3VTH A;  2E88 A;  3ENO A;  2QWQ A;  3T69 A;  2E2O A;  4BRC A;  5AFU H;  4C1N K;  4JKG B;  4KH4 A;  1W97 L;  3I56 N;  3L0Q A;  3C6A A;  4M7Y A;  3U8X A;  1VQK N;  5AZI B;  4DKW A;  5CE3 A;  4E1J A;  4Y0W A;  4XH1 A;  1NGF A;  2WFB A;  4DHY A;  2A3Z A;  4K43 A;  4JKC A;  2A6A A;  3DXK B;  2QWL A;  4B1Y B;  5GAD P;  2QWO A;  2UYT A;  2YHY A;  3VEX A;  3R1X A;  3VMF B;  4DCH A;  1DGK N;  4BY9 C;  5C0Y A;  1VQM N;  3M6G A;  3C0B A;  4FVU A;  4C23 A;  3ID8 A;  1HLU A;  2H3G X;  4M7X A;  3BUZ B;  1NBW A;  1GLB G;  2QTD A;  2I7N A;  3GE1 A;  2E1Y A;  3KVG A;  5EXW A;  2J4R A;  4BR0 A;  1MDU B;  1HKC A;  2CH5 A;  3MX5 A;  4EFH A;  3SAH A;  1HJO A;  3FZF A;  4FOE A;  5F0X A;  4JAX A;  5ELZ A;  4XEI A;  4BRG A;  4BVO A;  4BC5 A;  3L6Q A;  1GLE G;  3IFR A;  3MWT A;  3HZ6 A;  4H0T B;  4NB4 A;  1V4S A;  2NRH A;  3CJC A;  4BRL A;  3FZK A;  2FXU A;  1EQY A;  2V7Z A;  3O9T A;  3QFU A;  4IJA A;  1NGH A;  2P9U A;  2V7Y A;  4YOV A;  1P8Z A;  2YHW A;  4IDH A;  2RE2 A;  2PBD A;  2V51 B;  3D7E O;  5AQL A;  4BC2 A;  1T6D A;  3UKR B;  3UKU A;  2ZWH A;  2QWM A;  3I8B A;  2HMP A;  2CGK A;  4XH4 A;  3UB5 A;  4MLE A;  2NRZ A;  2NRT A;  2YHX A;  3CCL N;  3A5O C;  2D0P A;  3M5R A;  2NNW A;  5H1S Q;  3R3L A;  3ZYY X;  5DM7 L;  4GV6 A;  2HOE A;  4BQZ A;  3D2E A;  3O9Q A;  3TPQ A;  1X3M A;  3U4L A;  3VF4 A;  5AZJ A;  1ATS A;  2W40 A;  4AM7 A;  5GAE P;  3PIP L;  1DKG D;  5AQN A;  1Z6R A;  4B1W B;  4BRA A;  2OTJ N;  2P9I A;  3RVC A;  1M90 O;  1SS6 A;  1VQ7 N;  4YOU A;  1BU6 O;  3AY9 A;  5AQY A;  1YXQ A;  2YCH A;  4H5W A;  5AQV A;  3E1Y A;  2HF3 A;  3OBW A;  3G71 N;  5BRE A;  5AQH A;  3WXJ A;  3CET A;  3ID6 A;  4GV9 A;  2D0O A;  4JN4 A;  3JS6 A;  5BRF A;  4FWN A;  3ZX2 A;  3CIP A;  4K41 A;  4A5B A;  3R6M A;  4FWL A;  5JVG L;  5JLF A;  3CMA N;  4PL8 A;  3CQY A;  4FOI A;  2QI2 A;  4ILH A;  3ENH A;  4CI6 A;  3SAG A;  1XUP O;  3U9Z A;  3WQT A;  4OPA A;  3EKU A;  3NVM A;  3TSQ A;  2CGL A;  2DPN A;  2IIR A;  1NGE A;  4WYB A;  3EZW A;  4NLC A;  4BR2 A;  5KQD A;  2GUP A;  3F5T A;  5M1K A;  4B1U B;  3IMX A;  3LDP A;  1ZBS A;  4IOC L;  1ATN A;  3C6H A;  1K73 O;  5EY4 A;  1VQ9 N;  2HBK A;  4FPA A;  5EVZ A;  4JHD A;  4IEI A;  1HX1 A;  2P9K A;  1N8R O;  3TU5 A;  4FWO A;  1J6Z A;  1YVN A;  4YOT A;  4JKE A;  3DXM B;  4CD3 A;  5HOO A;  5BN8 A;  1G99 A;  3LDL A;  3UE5 A;  1GLF O;  4BRM A;  4IO8 A;  4YDU C;  3TSU A;  1K9M O;  4B1V A;  4BQL A;  4WFN L;  3VEW A;  4H5R A;  1NGJ A;  2KHO A;  3FZL A;  4M63 C;  5BR9 A;  5HL7 L;  3U9D A;  3R8E A;  4KH5 A;  3L4Q A;  1X9J A;  2I7P A;  3WXL A;  4BRF A;  3TTF A;  4EHU A;  4A57 A;  3E9L A;  4WF9 L;  3LM2 A;  3LDO A;  4NO7 A;  1K8A O;  1YAG A;  4CZL A;  4WQ4 C;  2Q0U A;  3WXM B;  3P4I A;  3HRG A;  5C10 A;  1DEJ A;  1TUY A;  2ASO A;  4J8F A;  4FO0 A;  1QVF M;  3F2K A;  4IJN A;  3DWL A;  4KH6 A;  5AQS A;  2P9U B;  2QWR A;  4RWT A;  3EE9 A;  5JLH A;  2NRR A;  3TSP A;  1E4F T;  2HF4 A;  5C12 A;  4ILG B;  5BRD A;  1U2V A;  3UKU B;  5C2D A;  2E20 A;  1VQO N;  1Q7Y O;  2OAN A;  2VGN A;  5GIO A;  3WQU A;  3VTI A;  1M1K O;  2F7T A;  3BF1 A;  1YJW N;  1QQN A;  1JCE A;  5AQW A;  1LCU A;  3FZM A;  2P9S A;  2IVP A;  4IOA L;  3QDK A;  5FPE A;  1VQ4 N;  4YOW A;  5LJW A;  3D2E B;  3ZEU A;  4BRQ A;  1SZ2 A;  4BC4 A;  4OPH A;  4A59 A;  4WQ5 C;  1NGI A;  5AQP A;  4A5A A;  2QW9 A;  3RSE A;  2FLO A;  4FWP A;  4U67 L;  2P9I B;  4GV3 A;  3ATU A;  5GAG P;  2VYP A;  3SLC A;  2VGM A;  3CJA A;  2E1Z A;  2ITM A;  5BPL A;  1KAX A;  5LY3 A;  4QS7 A;  3G4S N;  2FF3 B;  4R79 A;  1CZA N;  4KBO A;  1KXP A;  1U6Z A;  3P39 A;  1BDG A;  4CD1 A;  1HUX A;  3SMS A;  3KK7 A;  4JK8 A;  3NVK A;  1O13 A;  3VGL A;  3H6E A;  2P9P B;  1BOT O;  2P9N A;  1K8K A;  2YJF A;  3CJ7 A;  5AQG A;  1KD1 O;  4RTF D;  1GLA G;  2VWB A;  4QS9 A;  4BR4 A;  2D4W A;  3EKS A;  3FGU A;  3MCA B;  4H03 B;  4MDA A;  4YDU A;  4BGB A;  3CME N;  2AA4 A;  5KPT A;  4PKG A;  1VAZ A;  3VF2 A;  3WEE A;  1SQK A;  5AQJ A;  1YI2 N;  3MN5 A;  4FWQ A;  3SBG A;  3CI5 A;  4BRK A;  3MMV A;  5GAH P;  4AF1 A;  3CHW A;  3F9M A;  4GVE A;  4WQ4 A;  3T7Z A;  2Q31 A;  3VEN A;  2FF6 A;  3HBT A;  3HM8 A;  3P31 A;  2F9W A;  4CJ7 A;  3K9K A;  3A5N C;  4JHD B;  4BVP A;  2P9K B;  4BR5 A;  4L3Q A;  5KQ8 A;  2W41 A;  1BA1 A;  3VES A;  4BRO A;  4IZ9 A;  4A2A A;  4MDB A;  3AAR A;  2IVN A;  1VQP N;  1BUP A;  3PLA A;  1VQL N;  4JKA A;  2Q0R A;  3C7N A;  4IWV A;  3CCE N;  3ZET A;  3N4P A;  1TUU A;  2A41 A;  4MO5 A;  1BWF O;  3W3D A;  3HOS A;  3ULE A;  1Y64 A;  5C2F A;  5AQQ A;  4CZJ A;  4MLH A;  3M1F A;  3GDQ A;  5MLC Q;  1C0G A;  3H3N O;  2JWK A;  4B1Z A;  4CZH A;  2FSN A;  5E26 A;  2D1K A;  2WC9 A;  3AAP A;  3O80 A;  1GLD G;  1JCG A;  2GEM A;  2ZF5 O;  1Q81 O;  4WQ5 A;  4C1N I;  3G6E N;  2QWP A;  3CCS N;  3O8M A;  2E2N A;  3CER A;  2VCP A;  3BEX A;  5B8H A;  5I9E B;  4GNI A;  2YX6 A;  2RHK A;  4BGA A;  5BN9 A;  3ENB A;  4EHT A;  4PKI A;  1BO5 O;  3MN7 A;  5LJV A;  1NM1 A;  3Q7C A;  3KWG A;  3KWI A;  5M1O A;  4MO4 A;  3I33 A;  3PIO L;  3CCJ N;  3KHY A;  4U7B A;  2GWJ A;  5F2R A;  5F1X A;  2P9S B;  5FPD A;  1NJI O;  3CCV N;  4H0V B;  3M3Z A;  3ZEU B;  2QM1 A;  3R9P A;  1ESV A;  3GL1 A;  3SAF A;  4O5F A;  4B1X B;  4BRD A;  1IG8 A;  3RSE B;  5AR0 A;  3Q7B A;  3I55 N;  1MWM A;  3GBT A;  5ADX A;  4IFE A;  4H5T A;  4LC9 B;  3D2F A;  5AQU A;  4JNE A;  2HBL A;  2FSK A;  4A2B A;  4H5N A;  3VGM A;  4H5V A;  4OO1 J;  3MWP A;  4JKB A;  1X3N A;  5ADX H;  1T3V A;  2NRX A;  3VOV A;  2A42 A;  1GLL O;  3H1V X;  3O08 A;  2KKZ A;  1XC3 A;  3VER A;  2GTD A;  3WUH A;  3J8A A;  3CPW M;  1QZ5 A;  3LL3 A;  2OTL N;  3NMU A;  4FL9 A;  1QQO A;  2P9N B;  1K8K B;  3VEZ A;  3FFK B;  3LDQ A;  2BTF A;  3A5L C;  4XH5 A;  4HTL A;  4CBW A;  1HKB A;  3O9S A;  3FR0 A;  2NRV A;  2WBN A;  3H46 O;  4JKD A;  4K42 A;  1NGC A;  4FWM A;  3IDH A;  1HKG A;  3VEO A;  4B9Q A;  4BRP A;  1NGG A;  3S41 A;  5AQK A;  3IUC A;  3TTC A;  3DXM A;  3CJB A;  5FPN A;  1Q18 A;  3DJC A;  1TYQ A;  4FWR A;  1Q82 O;  1R59 O;  3EL2 A;  3CCQ N;  4O8K A;  1ILY A;  5AZJ B;  3TTD A;  4CZG A;  2BH1 A;  1YJN N;  4BRH A;  5AFU A;  5CR4 A;  3VET A;  4PKH A;  4IOX A;  3ZX3 A;  3O6W A;  4YOY A;  5EX5 A;  1YUW A;  3C7N B;  5FPM A;  3HOT A;  4JD2 A;  2A5X A;  3CCM N;  3ZET B;  3O5B A;  4I6M A;  3GOI A;  1C0F A;  3AGR A;  5BRH A;  4YOX A;  1H1V A;  4CZE A;  1QHA A;  4H0P A;  3ULE B;  3DLL L;  1KC8 O;  2QWN A;  3N4Q A;  3EO3 A;  4BG8 A;  4CBX A;  2ZJR L;  1NGD A;  2F9T A;  2E2P A;  3CC7 N;  2GX9 A;  3E9P A;  5E84 A;  3OHR A;  1QVG M;  4CZM A;  1KAZ A;  1YIJ N;  4JEP A;  3MK6 A;  1GLC G;  3QFP A;  3SMP A;  4ISE A;  2NRW A;  2GWK A;  1KAY A;  4IO9 L;  1T44 A;  3CJ1 A;  1NMD A;  3W0L A;  4DB3 A;  2ZJP L;  5TKW A;  3KZB A;  1DT9 A;  4H0X B;  3FLC O;  3P38 A;  1BG3 A;  2ZGY A;  2QXL A;  3EE8 A;  1BA0 A;  2P9L A;  3K9J A;  3E66 A;  1V4T A;  1XQS C;  2Q1N A;  3VF6 A;  4UY8 O;  1WOQ A;  3HTV A;  3L4I A;  1RFQ A;  2PAV A;  5KPZ A;  5GIP A;  4CZF A;  4WCE L;  1EO1 A;  3H3O B;  2YI1 A;  5AQM A;  5M1N A;  5JVH L;  3CJ9 A;  3H45 C;  4H0O A;  1P90 A;  4A62 A;  4BC3 A;  3J7Z O;  2ASP A;  4JKG A;  3A5M C;  3H1Q A;  4ISG A;  4CZK A;  4BRE A;  5AZI A;  1YIT N;  4RCH A;  4ILJ A;  4JK9 A;  1Z05 A;  1VQ6 N;  1MA9 B;  1OKJ A;  2HBJ A;  2KLA A;  4BRI A;  3D2F B;  5BPN A;  5JIC A;  1JJ2 M;  4DQ8 A;  3DXK A;  3AAQ A;  4NLB A;  4YOR A;  4CBU A;  5M1F A;  2CH6 A;  4JKH A;  3QIC A;  4JK7 A;  1ZC6 A;  3AGK A;  3HI0 A;  4FPB A;  2ZJQ L;  1YJ9 N;  3A8Y A;  5M1P A;  4BR9 A;  3BP8 A;  1OVY A;  5AQR A;  4QS8 A;  2CGJ A;  2Q97 A;  2E2Q A;  3QB0 A;  1W2B M;  2Q36 A;  4BRN A;  1S72 N;  3CF5 L;  3FE1 A;  5KPR A;  3B8A X;  2HST A;  2GEL A;  1QZ6 A;  1VQ5 N;  3CPE A;  4A61 A;  2PFU A;  5BPM A;  2QEX N;  1NGB A;  3O9R A;  1U2V B;  4WFA L;  2AP1 A;  5AQF A;  4PL7 A;  1ZXO A;  5EOY A;  1JCF A;  1RDU A;  3MCP A;  3ZX0 A;  3QBX A;  2NZT A;  3VEV A;  4PHT X;  3WT0 A;  2P9P A;  1WUA A;  1E4G T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...