1UAXA

Crystal structure of the ribonuclease h2 from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
b'MKVAGVDEAGRGPVIGPLVIGVAVIDEKNIERLRDIGVKDSKQLTPGQREKLFSKLIDILDDYYVLLVTPKEIDERHHSMNELEAEKFVVALNSLRIKPQKIYVDSADVDPKRFASLIKAGLKYEATVIAEHKADAKYEIVSAASIIAKVTRDREIEKLKQKYGEFGSGYPSDPRTKEWLEEYYKQYGDFPPIVRRTWETARKIEERFRKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uaxA00
4O5BA 3TI0A 3MXJA 1YT3A 2G8UA 1CXUA 1D5AA 1LAWA 1Z25A 3ULDA 3HSTB 5C24A 2PY5A 1HNVA 1NJWA 5CZ1A 4EP5A 3O3HA 3ZSZA 4HUFA 4LY7A 1T7PA 5J2PA 3V9ZA 1WLJA 1F21A 4KI6A 1U4BA 3VQPA 4FLTA 5J2NA 1TKTA 4E89A 4CGGA 4W5TA 4H4OA 1WAFA 4OGCA 1IO2A 3SV3A 3OYHA 1NOYA 1TKXA 3KD1E 1U04A 4H4MA 4E7IA 4FJNA 4CECA 3AO1A 5KI6A 3DYAA 4G1QA 3NHGA 4RG8A 3VQBA 3OYFA 4DFMA 2RKIA 3AA2A 4CFCA 1QTMA 4FJIA 4IFYA 2PYJA 3L2WA 2RN2A 3NAEA 4DSFA 4ELUA 2OPRA 3IAYA 4DSLA 4QCLA 3SQ2A 3SQ0A 3ZT1A 4CK3A 4DQSA 4NCAA 1A5XA 2HNDA 4FW1A 3OS1A 1NKBA 3RRHA 4OPKA 2HNYA 4CK2A 4PY5A 4N5SA 4DFKA 4CHOA 4B08A 3QO9A 3U3YA 3QIOA 3K59A 1KRPA 3QIPA 3U6FA 4CF1A 3PX6A 4Y1DA 4B9VA 1NK7A 4FJXA 2ZQBA 2P5OA 4E0DA 3QEPA 1BIZA 3VQ4A 3HL8A 4O44A 1BL3A 2E6MA 4N47A 2XY8A 1LW0A 3V1OA 4O0IA 1SL2A 4LH5A 1KFDA 3LDSA 2IGIA 1VSMA 2RPIA 3SNNA 3OYAA 3I0SA 1HRHA 4M3XA 4F3TA 1BCMA 5FRMA 4BE0A 1L3SA 4YNQA 1X9MA 4FJHA 3F9KA 4IG3A 3AVGA 2FBXA 3MEGA 1KFSA 4I2PA 5FROA 4KFBA 4FJ9A 1EKEA 3LWMA 4PWDA 1NK6A 4F2RA 3MEEA 3D45A 4OGEA 1IKVA 3SPZA 1YVUA 2QKBA 4FJ5A 3G10A 1TKZA 3OY9A 3KLIA 4NCBA 4DLEA 3K5LA 4E7KA 4DTRA 5T7BA 1L3VA 2O4IA 1J53A 2RF2A 4CF0A 1GOAA 1W0HA 3LP2A 4ID1A 1ZBIA 5SZTA 4E1MA 2YKNA 4XIUA 2P5GA 1CXQA 2YHAA 3NGYA 1VSFA 4B9TA 3CFRA 2Y1IA 3RR7A 1NK8A 3LP0A 3NBPA 3ZT0A 4AHUA 4CJRA 4UQGA 1NOZA 3TWHA 1NJZA 4E1NA 4F4KA 1BI4A 3TAGA 5KTQA 1VSHA 4CEQA 2G8IA 3LAKA 1WNSA 1KTQA 4AHSA 4CERA 3QNOA 3K5NA 3IS9A 3NH1A 2OA8A 2EHGA 1RDCA 1EX4A 4FZXC 1XWLA 3HVTA 4KO0A 4LSNA 4DTOA 4M3UA 1BHLA 1KVBA 2DTUA 2X78A 3LANA 1Q9XA 3M8SA 3TAQA 3VN5A 3PO4A 4CF2A 4F3OA 3DRSA 3TABA 5HRSA 1ASWA 1S6PA 4FJKA 3C6TA 3L2QA 4DTXA 4AILC 3MXMA 4PA1A 3V81A 4Z4FA 1RTHA 5J2MA 4PUOA 3RMAA 1S9EA 4F8RA 4CJQA 3ALYA 1VRUA 2WOMA 3OYLA 2IOCA 4W5QA 5K14A 1RTJA 4CFAA 1QE1A 1RT4A 4OVLA 4Y1CA 4IKFA 1LV5A 2HHTA 3O3FA 4B3OA 3VQ7A 5JS1A 4J2EA 2X74A 3NGIA 4CJ4A 2I5JA 2OPPA 3AVHA 2X6NA 2B5JA 4GVMA 1N6QA 2PYLA 4DLGA 3T3FA 1JXBA 4FLWA 4GMJB 3ZSYA 1UOCA 4R5PA 5J2QA 2G8FA 2G8KA 4BDPA 2HHSA 2FBYA 2O4GA 3NE6A 1XHZA 2KZZA 4DTPA 2IAJA 3V1QA 3V9UA 2P1JA 2Q3SA 1S1VA 4CJWA 4FJLA 3VQDA 1VRTA 1UAXA 3OYNA 4B8AB 3V9SA 2XHBA 2JGUA 4FJ8A 2ZD1A 4IFVA 3QEWA 3HPOA 3RMCA 1TAQA 3VQ5A 1A5WA 3DM2A 1VSLA 1RBSA 3ZSWA 2A1SA 3PV8A 3SQ1A 4OLBA 3LZIA 3RR8A 2OZSA 1ASVA 3C94A 3AA3A 2YNHA 4CFDA 2XRIA 1KCFA 2WONA 3VQ8A 1TV6A 3AO3A 4CJKA 1VSEA 2FC0A 4CEAA 3OYBA 3C95A 3DLKA 4FVMA 1BIUA 4B8CA 1HNIA 4CJFA 1QQCA 3SJJA 4C8MA 4DTJA 4KHQA 4M3TA 1MU2A 3EZ5A 5C42A 4MQ3A 4CJEA 3CQ8A 1ZBUA 2IDOA 4ZTFA 2KZMA 4OKJA 1I3AA 4CJ3A 3PUFA 4KHSA 2VWJA 4CJVA 4E7LA 2HHWA 4IBNA 2D0AA 4CJTA 3KLFA 3FFIA 4DTNA 1JLQA 4M41A 3NH0A 3MEDA 3MXIA 4Z4GA 3VQQA 3DOKA 4FLYA 3OVNA 3KTQA 1SV5A 3QEXA 1BQMA 2GUIA 4Z0UA 3OYIA 4CEOA 4DFPA 4KHYA 4I2QA 1S5JA 1RBUA 3AVIA 4AHRA 4CEEA 2R7YA 4JS4A 4JS5A 3RTVA 4DTSA 3DLRA 1Z26A 3KK2A 4Z4CA 3V1RA 1VSKA 2XY5A 4KREA 3L8BA 1B92A 1REVA 4AH9A 5E41A 3BDPA 3AVAA 4FZZA 3WNEA 4DQIA 4DSIA 3S3NA 2KFNA 5JS2A 4M42A 2YNIA 4HVJA 2QK9A 1JL1A 3IG1A 3OYJA 3VA3A 2G8WA 3KLHA 1FKOA 2VWKA 2XY6A 4B9MA 4KTQA 2KW4A 4N41A 2HVHA 4B9UA 2ZE2A 3PO5A 4N76A 3AVJA 1X9SA 1X1PA 5KRSA 3C6UA 3KJVA 3KLEA 4CF8A 2Z1GA 1RNHA 3LAMA 4CJ5A 3S9HA 2ETJA 4CEFA 4N56A 1Y97A 3RWUA 4M3YA 1HYZA 1EETA 2G8HA 3VQCA 4BACA 1VSIA 3SUNA 4KB0A 1G15A 5CYMA 4TSXA 4FJJA 3T1AA 3SCXA 4I9QA 1RCHA 3M8QA 1GOBA 2W42A 3L2RA 4AHCA 4L8RB 3KKSA 3ZT2A 5KGWA 4C8OA 4FCYA 2FBVA 4KI4A 4Z4IA 4F2SA 1JKHA 2IC3A 4RW7A 3NCIA 5HRPA 3M8RA 1ASUA 3OYEA 1ITGA 1W9HA 3NF7A 3HP9A 1L3TA 1ZYQA 4NCGA 4CHQA 4DSEA 1QSSA 2XY7A 2LSNA 5I3UA 1O1WA 1WSHA 1X9WA 2QKKA 4FK4A 1HYVA 4M3WA 4DWIA 3QETA 1LWCA 1WSJA 4CEDA 1HYSA 1TL3A 4DMNA 1CZBA 1EXQA 3DOLA 1T05A 1VSJA 3NGZA 1JLFA 2EX3A 3KD5E 3MECA 1IKYA 3AA5X 3D0PA 4DQQA 3HPGA 4DF4A 3KKRA 1LWEA 1C6VA 4W5RA 4OKEA 3IRXA 4FJ7A 2D5RA 4CK1A 3NF8A 1SL1A 4ELVA 3AVKA 1NK4A 4ID5A 1SKWA 2VG7A 1T03A 3QLHA 3TR8A 3LZJA 4FJGA 4NYFA 1BI4B 3MAQA 4EP4A 4DF8A 1QSYA 4M3ZA 3OYGA 1LAVA 3V4IA 4FK2A 1YTAA 1B9FA 1DTQA 4CJLA 1S1TA 4O4GA 3DMJA 4E3SA 2YHBA 4BWMA 1S6QA 2GV9A 4FW2A 5HRNA 1XC9A 1RT7A 2Z1HA 2DY4A 1I39A 3L2UA 1U45A 1BQNA 1DTTA 2D0CA 1BGXT 4RW8A 3DRPA 5KRTA 4CCHA 4KHWA 1QS4A 1VK0A 2Z1JA 3LALA 4OJRA 3K57A 1R0AA 4KB1A 2HHUA 4K8XA 4ZTJA 3THVA 3VQAA 1KSPA 3G0ZA 2PZSA 4FJMA 1WSGA 1J54A 1IH7A 4CJUA 4I9LA 1C0TA 3HVRA 2DFEA 4CHZA 1NJXA 4CESA 4BDZA 3P1GA 5CZ2A 3RMDA 4J2AA 2HVIA 3QNNA 4H8KA 1HJRA 4BWJA 3VQEA 4DTMA 4FZYA 3P5JA 4HCBA 5CY4A 4E19A 3QERA 3KLGA 1K6YA 3L2VA 3KK3A 1UA1A 3L3UA 2BE2A 3AVBA 4FM2A 3I0RA 1BCOA 1KLMA 4E7HA 3L3VA 4JRPA 3SYZA 4DFJA 3TANA 1QSLA 1CZ9A 3LP3A 4AHTA 1TVRA 3OJUA 1HQEA 1KVCA 3WNFA 3PX4A 3SI6A 3A2FA 3AA4A 4KAZA 2BGGA 5I42A 3TARA 5FRNA 4WE1A 4JLHA 3OS2A 1TK0A 4O55A 1D9DA 2F96A 3NH2A 4KHUA 1RT5A 4QOZB 4FXDA 3UIQA 4DU3A 4QAGA 3JSMA 3ZT4A 2KFZA 3OS0A 1RDAA 2HHVA 1S1XA 3WNGA 2G8VA 4B9SA 3ZT3A 3PY8A 3CM6A 4FLZA 1RT2A 1WSEA 2QXFA 3E01A 5HRRA 3CFPA 1TKDA 3ZSXA 1Q9YA 4KTZA 1GOCA 5CYQA 3I8DA 4LH4A 3P83D 3AVNA 1VSDA 4GW6A 3K58A 2VG5A 4IDKA 1NK5A 1KLNA 3RRGA 4EZ6A 2HHQA 4HTUA 2BDPA 1JLCA 3HT3A 3NFAA 4CHYA 4ZHRA 1NK0A 1A5VA 3VQ9A 1QHTA 3QINA 4HHTA 4OKKA 3LPTA 4B9LA 2AJQA 2X6SA 1NJYA 1WSFA 2ITGA 3K5OA 3OYKA 4O0JA 5HLFA 3DLGA 3DLEA 4IG0A 1HQUA 2NUBA 4CGFA 3V9WA 4C8NA 4DTUA 3CG7A 2Z1IA 4C8KA 2F8SA 3CM5A 2YKMA 3SV4A 1TL1A 3V6DA 1D8YA 5FDLA 2D0BA 3ZCMA 1S1UA 4BE2A 2E6LA 1C1CA 3AVMA 4ELTA 4DS5A 1LW2A 4LD0A 1RBRA 2BANA 4DQRA 1DLOA 2HB5A 2OZMA 1RTDA 3NF9A 3LP1A 2HMIA 3KIOA 3EYZA 2IS3A 3NDKA 1L5UA 1SKSA 1JLEA 4CF9A 4HUGA 4CIFA 4HUEA 4C8LA 3K2PA 3O4QA 5DK5A 3SPYA 2KQ2A 4NYNA 1RT6A 4BE1A 3BGRA 3SUQA 1ZBFA 3B6OA 4I7FA 4CIGA 3V9XA 1NKEA 3HJFA 4M3RA 1UA0A 4W5OA 3K5MA 2XO7A 3EY1A 4E7JA 1FK9A 3SZ2A 3HP6A 4BDYA 4KHNA 4Z4EA 5SWMA 1NK9A 5EU7A 4Q0BA 3HM9A 3ISNC 2OPQA 3QEVA 3SUPA 3DRRA 4DG1A 1C1BA 4AHVA 4MFBA 4CJPA 1Q8IA 4FLUA 1FXXA 5C25A 1RBTA 4KV8A 1TAUA 4KTWA 4OLAA 2YV0X 4Q5VA 1J5OA 4FLVA 4CJSA 3AV9A 3O4NA 3ZSRA 1WN7A 2VG6A 3LPUA 5DMRA 3U3GA 5KGXA 3TAPA 1U47A 3HO1A 1B9DA 1RT3A 1C1AA 2YNFA 3ZSQA 4RW9A 2B4JA 4CE9A 2KTQA 3HXMA 4M45A 3OJSA 1C0UA 5HP1A 2A1RA 4CGDA 3ITHA 3SUOA 3DI6A 4FK0A 2P51A 2F8TA 3LWLA 4LSLA 2HNZA 1T8EA 2YNGA 1WAJA 3OYDA 1KVAA 1IG9A 4J2BA 1HPZA 1SL0A 5HROA 3ZSOA 3AO4A 1IKXA 1UWBA 4DS4A 1WSIA 3AVFA 3T19A 3ASMA 3TAFA 1RDDA 1JLAA 3VQ6A 1CLQA 3M8PA 4ICLA 3NF6A 3DLHA 3TAEA 4EZ9A 3SQ4A 3AO5A 4CFBA 2DFFA 4KPYA 4CEZA 1JL2A 3B6PA 1RBVA 3OYCA 4J2DA 4JRQA 3S3OA 4DU4A 3CFOA 3HK2A 2FBTA 4PQUA 4B9NA 1XI1A 3F73A 1JLGA 2DFHA 4KKOA 4CGHA 3RMBA 4W5NA 1L3UA 1C0MA 4FM0A 1BISA 3O3GA 2Y1JA 4CHNA 1SKRA 1IKWA 4DSJA 4DQPA 4CGIA 1FKPA 4DSKA 4OPJA 1YTUA 1ZBHA 3AVCA 3H08A 4DU1A 1EP4A 3PX0A 5D3GA 1TK8A 3ZSVA 3S3MA 4CIEA 4KRFA 1J9AA 1LWFA 1SUQA 2HW3A 5J1EA 1JLBA 2OPSA 1U48A 3QESA 1RTIA 1TK5A 1RILA 3QEIA 3HYFA 4YFUA 4FM1A 4CEBA 4FLXA 4CGJA 3DLBA 2B6AA 3JYTA 1JXEA 4HCCA 1D9FA 4CHPA 3AO2A 2OYQA 2E4LA 3CYMA 3AVLA 4RW6A 1HMVA 1XHXA 4K8ZA 1N5YA 3KK1A 4FYDA 2ATQA 2GBZA 1ZBLA 1U49A 1TGOA 2HHXA 3OYMA 4Z4HA 1NKCA 1RDBA 1S1WA 3HPHA 1RT1A 2JLEA 5HBMA 3TAMA 3WNHA 3VA0A 1S9GA 4RW4A
chains in the Genus database with same CATH superfamily
3TI0A 3H45C 3MXJA 5FPDA 2O8CA 1D5AA 1LAWA 4MDAA 3KVGA 2P9PA 3SAHA 4LFAK 4BROA 3SV3A 1NOYA 3LM9A 4H4MA 4CECA 3VOVA 3DYAA 5C12A 4G1QA 4RG8A 3VQBA 2RKIA 3AA2A 2OCEA 4CFCA 2PYJA 3NAEA 3SBTA 4PL7A 1O13A 2QEXN 4NCAA 4K25A 4FW1A 2HNYA 4N5SA 3L6QA 3O9UA 4WQ5A 3U6FA 2V52B 4CF1A 1NK7A 4FJXA 2ZQBA 2P5OA 3QEPA 3NVMA 4JI7K 3MX5A 4O44A 4N47A 4CZLA 1M90O 3O9SA 3ZEUB 4LH5A 3LDSA 1VSMA 5KPZA 2BTFA 4DCHA 2P9LB 4BE0A 1L3SA 2W41A 1X9MA 4IG3A 3CJBA 2FBXA 3E1YA 4IWVA 4FJ9A 1ZC6A 3LWMA 4F2RA 4OGEA 1IKVA 2IVOA 1MWKA 4IXCA 4DLEA 1L3VA 2O4IA 1J53A 2CGLA 4CZEA 2GTDA 1CXQA 3CFRA 3LP0A 3NBPA 1NOZA 2IVPA 4JEPA 5M1NA 3LAKA 1K8KA 1KTQA 4WCEL 3U8XA 2FSKA 3K5NA 5IT9O 1OVQA 5GAHP 2F9TA 4BREA 5E26A 4B1UB 3OA9A 3PLAA 4F3OA 3DRSA 3DLLL 1ASWA 5AQXA 1HKGA 1OKJA 4DTXA 3FZKA 1VQLN 1RTHA 4JD2B 3ALYA 3OYLA 2IOCA 2AA4A 1RTJA 1HKBA 5EVZA 2FF3B 3VEOA 2I5JA 1VHXA 2FF6A 3QBXA 4IOXA 2B5JA 4QS9A 4R5PA 2O8DA 2G8FA 1MDUB 4BDPA 1XHZA 2KZZA 4B1YB 4DV6K 3HRGA 4CZFA 3VQDA 1YJWN 5AQOA 4CZKA 2JGUA 1YIJN 4OO1J 4CVNE 3DM2A 3SQ1A 3PV8A 3HBTA 3VGLA 1W97L 1ASVA 3NH1A 4CFDA 1TV6A 2FC0A 4CEAA 5LJWA 3C95A 3DLKA 4CJFA 4DR7K 1V4SA 3EE8A 4DTJA 1MU2A 3RVCA 2A40A 5EXWA 1ZBUA 2IDOA 4OPAA 4OKJA 1I3AA 3PUFA 2A5XA 2D0AA 3KLFA 4Z4GA 4M41A 5EX5A 4A2BA 2GUIA 3MN7A 4FWLA 1RBUA 4AHRA 3CQXA 3VEXA 2YJFA 1X3MA 4JKFA 3KK2A 3BEXA 4PKGA 1HLUA 4AH9A 4FZZA 1VQ6N 4BVPA 4DSIA 3WQTA 1JL1A 3OYJA 4BR7A 4RCHA 2QW9A 4KTQA 4Y0WA 4YOVA 2UUCK 4B9UA 4BR0A 5ADXA 3V6DA 2Z1GA 1Y97A 3RWUA 3O6WA 4BRDA 1VSIA 1G15A 4WFNL 5CYMA 4TSXA 3SCXA 4V19S 2ASMA 3NVKA 4AHCA 3MCAB 4L8RB 4GV6A 2O8FB 4LF9K 2BH1A 4FCYA 4CZHA 5M1QA 3M8RA 3F2KA 1ZYQA 4NCGA 4CHQA 2QKKA 2BUPA 1CZBA 1EXQA 3HTVA 3NGZA 3KD5E 2H3GX 2QWLA 3D0PA 1N34K 2D5RA 1SL1A 4ELVA 5CE3A 1NK4A 2VG7A 4K43A 4GV9A 2A42A 1QSYA 3MAQA 3ID6A 4EP4A 4FK2A 1YTAA 4CJLA 4BWMA 2GV9A 5HRNA 1XC9A 1RT7A 2Z1HA 4K41A 4GY2B 3E9LA 1DTTA 5C10A 1XC3A 3FZHA 1XMOK 2Z1JA 3LALA 4FL9A 3UKUA 4K8XA 4ZTJA 2Q97A 3CCQN 3VQAA 3LL3A 4CJUA 3HVRA 2DFEA 4CHZA 4CESA 2E2QA 3P1GA 3QNNA 3VQEA 3LDNA 3P39A 1KAZA 3QERA 3KLGA 3L2VA 1E4GT 5C2DA 3L3VA 4BRHA 3SYZA 4DFJA 1CZ9A 3SI6A 3C6AA 3AA4A 1YXQA 2OANA 3TARA 1XUPO 3MX2A 4WQ5C 3NH2A 4DU3A 4CD1A 1S1XA 3QDKA 4B9SA 1BDGA 3PY8A 1RT2A 5HRRA 2E1ZA 3A0IX 3J7AP 4OPHA 3WXJA 1JLCA 4X66K 1NK0A 1VQ8N 2X6SA 5AZJA 4O0JA 5HLFA 1HQUA 2Z1IA 3CMAN 5C2FA 1D8YA 2ZF5O 4AF1A 3Q7CA 2E6LA 4DV3K 3AVMA 4ELTA 1LW2A 3U9ZA 3H6EA 4IEEA 2OZMA 3O9TA 1L5UA 4BRMA 4CIFA 3K2PA 1NWKA 4BR4A 2KQ2A 4NYNA 3AGKA 3BGRA 3KWIA 5AQPA 1ZBFA 3V9XA 2ZM6K 1CZAN 2XO7A 1WOQA 3D2EA 3SZ2A 3LDLA 3VTHA 2VWBA 3LDOA 1ATNA 1T6CA 1NGFA 4IDHA 3EKUA 4O8UA 4DG1A 3IDHA 4DV1K 1K9MO 3H1QA 1IJJA 1RBTA 1IG8A 2QA4N 3FR0A 2UUAK 3DWLA 4FLVA 4KH5A 5C0YA 1VQON 3U3GA 3AAPA 3WXIA 2YNFA 1NLVA 3HXMA 4M45A 3OJSA 1C0UA 1NGBA 4FK0A 3SUOA 2F8TA 2P51A 1T8EA 3TSUA 2HNZA 2YNGA 5LJVA 1W2BM 3HM8A 5HROA 4B3MK 3ZSOA 3AO4A 1IKXA 3AVFA 3T19A 3TAFA 3WXMB 4ICLA 3NF6A 3TAEA 5GIOA 4CFBA 4M63C 4CEZA 4J2DA 3OYCA 3S3OA 2FBTA 3EL2A 4B9QA 3DXMA 4CGHA 1TYQA 4H5RA 5BN9A 4NXMK 5AQYA 3I8BA 1BISA 1HKCA 5AQWA 4DSJA 1FKPA 3TTDA 1ZBHA 3H08A 3THXB 1J5EK 3C0BA 3ZSVA 4CIEA 1J9AA 3BP8A 1SUQA 1U48A 5KPRA 4FM1A 3CHWA 3BUZB 4HCCA 1D9FA 3AO2A 2OYQA 4RW6A 4FYDA 2VCPA 1ZBLA 3G71N 1TGOA 2NRZA 1S1WA 3WNHA 5JVHL 1CXUA 1TUUA 3T69A 5C24A 1GLEG 3ZETA 5AFUH 5J2PA 3V9ZA 4KI6A 1BWFO 3VQPA 4FLTA 4H4OA 3DXKB 4NLBA 3KD1E 4E7IA 1NGGA 3I33A 4BRAA 5HOOA 3CCEN 1YJNN 2QWPA 1U6ZA 4DKWA 4IFYA 2GUPA 2RN2A 4DSFA 4BVOA 1VQ7N 4IJNA 3SQ2A 3ZT1A 3AARA 4CK3A 3BF3A 3VEZA 3TTFA 3J81O 3RRHA 4BRLA 4DFKA 4YORA 4CHOA 4B08A 3U3YA 3QIPA 2QWQA 4QS8A 3VA0A 4MDBA 2XY8A 2Q31A 1SL2A 4DUZK 4ILJA 4MO5A 3ATUA 1HNZK 1BCMA 4KHPK 1QZ6A 4YNQA 5EY4A 3F9KA 4H5NA 5BPMA 3R3LA 5FROA 4KH6A 4DR1K 4KFBA 4PWDA 3SBGA 3CCJN 3CIPA 3W0LA 4FJ5A 3KLIA 2RF2A 1VQ9N 1W0HA 4ID1A 3K9JA 4E1MA 3O80A 2KKZA 3NGYA 5AQLA 4B3RK 4K42A 5FLXO 4AHUA 1NJZA 1BI4A 1QQNA 1VSHA 4CEQA 4ILHA 1IV0A 5AQJA 4AHSA 1HNXK 1NGAA 1RDCA 4YHHK 1EX4A 1P8ZA 2P9SB 1XWLA 2UYTA 3CJCA 1M1KO 1I94K 4JKGB 4F9OA 2X78A 1Q9XA 3VN5A 3PO4A 5HRSA 1S6PA 4I6MB 3VEVA 5JVGL 4RWTA 4PUOA 4F8RA 3VF6A 4CJQA 1VRUA 3D6RA 4NXNK 2GWKA 4Y1CA 3JAMO 4IKFA 5AQFA 3CQYA 4BRKA 3O3FA 4J2EA 4H03B 3AVHA 2X6NA 1N6QA 5GINA 1JXBA 4GMJB 4JI8K 5J2QA 4EAHD 2O4GA 2IAJA 1NGEA 3V1QA 3EZWA 4FJLA 1NGIA 2P9UA 1T44A 3R9PA 3QEWA 4JHDA 1TAQA 1R59O 3ZSWA 1RBSA 4OLBA 4A5BA 2WTUA 3THYA 3RR8A 4Z4FA 4BG8A 2WONA 4JI5K 1QHAA 1VSEA 4H5VA 2QI2A 4B8CA 1HNIA 3SJJA 5AQNA 2NRWA 4CJ3A 2O8CB 4KHSA 2HHWA 4M7XA 2QWMA 1KXPA 5JLHA 4E7LA 4CJTA 1JLQA 3E9OA 3MEDA 3MXIA 3IKMA 3KTQA 3KZBA 2Q1NA 4DFPA 3OYIA 2P9PB 4B1ZA 3AVIA 3RTVA 5KQ8A 4YDUA 4DTSA 1Z26A 2HBMA 2WFBA 3V1RA 1VSKA 3KHYA 4CZJA 2XY5A 4KREA 3L8BA 3TTCA 3RSEA 1B92A 3VESA 1BOTO 3EN9A 3CJ7A 3WNEA 2QTDA 2YCHA 3BZCA 3CC7N 4NLCA 4HVJA 2QK9A 1HJOA 3VA3A 2G8WA 4DQ8A 4B9MA 4N41A 2KW4A 2HVHA 2OTJN 3PO5A 1X9SA 3SAFA 1X1PA 3KJVA 3AGRA 4JI2K 1RNHA 4O8KA 4CJ5A 2ETJA 4M3YA 1HYZA 1EETA 2G8HA 4BQLA 1E3MA 3TSQA 4I9QA 1RCHA 1GOBA 1HX1A 4HTLA 3L2RA 5FPEA 3FZMA 1JKHA 3NCIA 3OYEA 4WQ4A 1ITGA 4YOXA 3CCVN 3ZLJA 2XY7A 2LSNA 4BR9A 4JKHA 4FK4A 4DR2K 1LWCA 1HYSA 4DMNA 2ASPA 4FVUA 1VSJA 3UKRA 4DQQA 3G25A 1LWEA 2NRHA 5AQSA 1Q18A 4ID5A 1SKWA 1T03A 3QLHA 3TR8A 3LZJA 1VQ5N 4DF8A 1JCFA 4FWOA 1GLDG 2EWSA 3OYGA 3K0SA 3V4IA 1K8KB 4DR4K 1S1TA 4O4GA 4FW2A 1K73O 3PIPL 3GG4A 4B3SK 5BRDA 3OBYA 4RW8A 2D0CA 2JWLA 3DRPA 4BC2A 5KRTA 4CCHA 4KHWA 2V7YA 1R0AA 3THVA 4FJMA 1WSGA 1J54A 1Z05A 1GLFO 3T7ZA 3TSPA 3WEEA 4H5WA 3RMDA 1HJRA 2HBLA 3HI0A 5AQUA 4PHTX 4HCBA 1Q86O 3A5LC 5FPMA 3N4QA 4DUYK 5F1XA 4FM2A 4E7HA 1KLMA 3E66A 2P9KA 1QSLA 4CI6A 1HQEA 1KVCA 5CHIA 2O8DB 3L4IA 4KAZA 5FRNA 1YITN 4KHUA 4QOZB 3UIQA 1Q7YO 3JSMA 4X62K 3OS0A 1RDWX 2G8VA 1T6DA 3QB0A 3O1WA 4BR5A 5F0XA 2QM1A 3E01A 4CJ7A 1TKDA 1Q9YA 1G99A 5AQQA 4JI1K 4KTZA 1GOCA 4GW6A 1NK5A 4A57A 3RRGA 4EZ6A 2F7TA 2BDPA 3QINA 3LPTA 4G9ZA 2AJQA 3OYKA 5AQRA 3M1FA 2CGJA 3SV4A 4NB4A 2D0BA 1VQ4N 1C1CA 4LD0A 4DQRA 3NF9A 2HF3A 3LP1A 4BRIA 4PKIA 4BC3A 2IS3A 4FWKA 1SKSA 1JLEA 4HUGA 2CGKA 4HUEA 3SPYA 1RT6A 2E2OA 3R1XA 4KH4A 5A2QO 2ZWHA 3SUQA 4I7FA 5AQGA 2FXUA 4A61A 4M3RA 1UA0A 4QS7A 4ILGB 4BGBA 1NK9A 1V4TA 2F9WA 3VGKA 3BZKA 4AHVA 4MFBA 1Q8IA 1NGDA 3UE5A 5C25A 3VERA 4KTWA 4OLAA 1J5OA 4CJSA 3AV9A 3SMPA 4H0XB 2YX6A 4JAXA 1U47A 5KGXA 3HO1A 3O8MA 4CE9A 3OW2M 5HP1A 3ITHA 3EEQA 3OYDA 1IG9A 4J2BA 3CPWM 1HPMA 1HPZA 1SL0A 4B1XB 3ASMA 1RDDA 1JLAA 3VQ6A 1SS6A 4A59A 3OBWA 4YOWA 2Q0RA 2VQFK 1YHQN 2D1KA 2WUSA 3C7NA 4BC4A 4JRQA 1C0FA 5TKYA 2ZJPL 5AQVA 4PKHA 3VF2A 2DFHA 4KKOA 4W5NA 1C0MA 1SKRA 3O3GA 2Y1JA 4CHNA 1IKWA 4DQPA 4CGIA 4JN4A 4OPJA 2FSNA 1YTUA 1NG9A 1EP4A 3DJCA 4JKCA 3PX0A 5D3GA 4YOUA 3S3MA 1KD1O 5AZIA 1VQNN 4DR6K 1LWFA 2VYPA 1RILA 3QEIA 1EO1A 4YFUA 1NJIO 3T1HK 2B6AA 3JYTA 1S72N 3UKUB 3CYMA 4YDUC 3MDQA 1FJGK 3U9DA 2ATQA 4JNEA 5AQIA 1IBLK 2UXDK 2GELA 3HPHA 1ZBSA 1N36K 1Z25A 5IWAK 3ULDA 4ISFA 3HSTB 2PY5A 4BRPA 1NJWA 5CZ1A 3ZSZA 3D2FA 1WLJA 1U4BA 4JKEA 1TKTA 4E89A 4CGGA 4W5TA 1WAFA 4OGCA 1IO2A 3H46O 1TKXA 4FPBA 1U04A 4FJNA 3PSIA 3BF1A 2GWJA 3AO1A 5KI6A 4H0OA 3THWA 2W6KA 4U7BA 4ELUA 3LDQA 5KPTA 2CH6A 5BPNA 3GOIA 5AQHA 2A41A 3D2FB 4WQ4C 1OH6A 4JI4K 1A5XA 2HNDA 3FZLA 3OS1A 5LMUK 5DM6L 5AZJB 3JXUA 3QO9A 1XQSC 3QIOA 3K59A 1KRPA 1LCUA 4B9VA 2ZJRL 1BIZA 5BPLA 1BL3A 2E6MA 1X3NA 2NRXA 5LL6Z 2RPIA 3SNNA 1KQSM 3VENA 4F3TA 5FRMA 1BUPA 4FJHA 2IVNA 1N8RO 3CXCM 1NBWA 4R79A 3D2EB 3SPZA 4BY9C 3OY9A 2E1YA 4NCBA 3K5LA 4DTRA 4CF0A 3CETA 1GLAG 3IUCA 1ZBIA 2GEMA 2YKNA 4XIUA 5AFUA 2P5GA 4B9TA 1VSFA 3P31A 4MLHA 4EIAA 3ENOA 3ZT0A 3C65A 3CCMN 4F4KA 3TAGA 1U2VA 5KTQA 2G8IA 3G6EN 3L0QA 2Q36A 3QNOA 3WT0A 1ATSA 4YOYA 2VGMA 3M5RA 3P4IA 3CCRN 2I7NA 4LSNA 4KO0A 4DTOA 1BHLA 1KVBA 2DTUA 3LANA 5E84A 3M8SA 3TAQA 5EOYA 4CF2A 3TU5A 3C6TA 5BRFA 3VF4A 3FE1A 3V81A 1IBMK 1HUXA 4JKDA 3HSCA 5K14A 1RT4A 1RFQA 4OVLA 1LV5A 2HHTA 1HNWK 5JMVA 3DXMB 3VQ7A 2O8EA 1TYQB 4CJ4A 2KHOA 2OPPA 2NLXA 4FLWA 1MWMA 3AY9A 2HHSA 2G8KA 1QQOA 4JK8A 2FBYA 3H3NO 4DTPA 5JICA 5BN8A 2P1JA 2Q3SA 4CJWA 1UAXA 4B8AB 1EWQA 2XHBA 2ZD1A 3H3OB 3RMCA 3MN6A 4X65K 3VQ5A 4LF4K 1A5WA 4ISGA 1VSLA 4FWMA 2A1SA 3LZIA 2OZSA 3EO3A 3C94A 2YNHA 3AA3A 2YHXA 3AO3A 3OYBA 1BIUA 1Z6RA 2E20A 4M3TA 4KHQA 4FOIA 3CJAA 3VEYA 4FOEA 4CJEA 3CQ8A 1WUAA 2NNWA 3ENBA 4CJVA 4DTNA 4DR5K 3ZETB 3VQQA 3DOKA 4FLYA 3OVNA 1SV5A 2JWKA 1BQMA 3ATVA 4CBWA 4Z0UA 4CEOA 4KHYA 4CBXA 4I2QA 4CBUA 1S5JA 5BR8K 2R7YA 4JS4A 4FSVA 4JS5A 5M1OA 3DLRA 3CD6N 3FLCO 3EE9A 4PL8A 3HOSA 1Q82O 4XH1A 2D0PA 5E41A 3BDPA 4H0PA 4DQIA 3S3NA 4M42A 2YNIA 3GL1A 2XY6A 2VQEK 1S22A 5TKWA 2O8BA 3AVJA 5BR9A 3VEWA 3KLEA 4N56A 3VQCA 3SUNA 4KB0A 4CZMA 3BY5A 1WB9A 1ATRA 2QWNA 2W42A 2P9NA 5GADP 4IOCL 3KKSA 5BRHA 3ZT2A 5GAEP 5KGWA 4XH4A 2FBVA 4KI4A 3B8AX 4F2SA 2E8AA 2IC3A 2YHYA 4RW7A 5HRPA 4BRNA 3NF7A 3HZ6A 5LY3A 1QSSA 4GV3A 5I3UA 4YY3K 1HYVA 1P90A 4M3WA 3QETA 4DV0K 3MCPA 1TL3A 1YVNA 3K9KA 3VETA 3DOLA 1T05A 4IOAL 4JYAK 3ULEA 4K0KK 3MK6A 1IKYA 3HPGA 4W5RA 4NO7A 4A5AA 3FGUA 1Q81O 1BI4B 4M3ZA 3GBTA 1LAVA 1DTQA 3DMJA 1S6QA 4LC9B 2DY4A 3R6MA 1I39A 3L2UA 3CCSN 1U45A 4FWNA 4BRQA 4IFEA 3FFKB 1ILYA 1RDUA 1QS4A 1VK0A 4KB1A 4LFBK 2HHUA 1J6ZA 4FWRA 3J8AA 1KSPA 2PZSA 3MWTA 1RGIA 2NRTA 4I9LA 3GDQA 2ZGYA 4B1WB 4BWJA 4DTMA 4FZYA 5CY4A 1VAZA 3MMVA 1UA1A 2RE2A 3KK3A 2BE2A 4L3QA 3I0RA 1BCOA 3IAYA 2YHWA 1IBKK 2GX9A 4MLEA 3WNFA 3I55N 3WUHA 1ESVA 2BGGA 5I42A 4WE1A 1SZ2A 4JLHA 3OS2A 1D9DA 2YJEA 2F96A 4FXDA 3J80O 2P9UB 4DV5K 3WNGA 4BG9A 3ZT3A 4FLZA 4JHDB 4IO8A 5CYQA 3I8DA 4LF7K 1NMDA 3VGMA 4LH4A 3THYB 3P83D 1KLNA 1VSDA 3K58A 2VG5A 4IDKA 1C0GA 5F2RA 1NGJA 1NNEA 4CHYA 4ZHRA 4HHTA 4B9LA 2ITGA 3DLGA 3DLEA 4IG0A 4C8NA 4C8KA 1TL1A 1BA0A 3ZCMA 4BE2A 4DS5A 3ZEUA 1S3XA 2HB5A 1FW6A 4MO4A 1DGKN 3CJ1A 2HMIA 4RTFD 2P9LA 3KIOA 2Q0UA 4CF9A 3O4QA 3RSEB 4BRFA 3B6OA 4CIGA 3HJFA 3A5OC 2HBKA 1VQKN 3EY1A 4E7JA 1DKGD 1N32K 3HP6A 4BDYA 3Q7BA 1KC8O 4KHNA 4Q0BA 3G4SN 3IMXA 3QEVA 3SUPA 3DRRA 4CJPA 4FLUA 2ZGZA 4KV8A 2Q2RA 4BRCA 1WBBA 4Q5VA 3O4NA 3ZSRA 4CZIA 2PBDA 2OTLN 2VG6A 3LPUA 3A8YA 3A5NC 3O08A 4BRGA 3TAPA 1GLJO 1C1AA 3ZSQA 1D4XA 5AQZA 2KTQA 1EQYA 4DV2K 3SAGA 5BREA 4LSLA 1BA1A 1WAJA 3KWGA 1KVAA 4JV5K 1UWBA 4DS4A 1WSIA 2UXBK 5AR0A 1CLQA 3DLHA 3IFRA 4JD2A 3SQ4A 3AO5A 1DT9A 3N4PA 3D7EO 4BC5A 1JL2A 3B6PA 3UKRB 1XI1A 3F73A 1JLGA 3RMBA 5M1PA 1L3UA 5AQKA 4FM0A 3LM2A 4JK9A 4DU1A 4JK7A 3CCLN 3HOTA 2HW3A 5J1EA 1JLBA 1RTIA 1ZXOA 2D4WA 3CF5L 1TK5A 4LF8K 3NMUA 4FLXA 4CGJA 3DLBA 1JXEA 1EWRA 2E4LA 3AVLA 1XHXA 1HMVA 4K8ZA 1N5YA 3KK1A 3EKSA 1HR0K 3W3DA 1NKCA 3M6GA 3WEEB 2JLEA 5CR4A 3CC2N 1S9GA 4O5BA 3SJHA 5ELZA 1YT3A 2I7PA 4ISEA 2G8UA 4JKAA 1HNVA 2P9KB 4EP5A 3O3HA 1VQPN 4HUFA 4LFCK 4LY7A 1T7PA 1F21A 4XH5A 4WFAL 5J2NA 5H1SQ 4IZ9A 4FPAA 3OYHA 2E2PA 1JCGA 3NHGA 3OYFA 4DFMA 1QTMA 3QFPA 4FJIA 3L2WA 2OPRA 3LDPA 4DSLA 4QCLA 3SQ0A 4DQSA 4C1NI 1NKBA 4OPKA 4CK2A 4PY5A 3SK3A 3CC4N 3PX6A 4H0TB 4Y1DA 4E0DA 3VQ4A 3HL8A 2O8FA 4O0IA 1LW0A 3V1OA 4DV7K 4H0YB 4XEIA 1KFDA 2P9IA 5M1KA 2IGIA 3ZX0A 4DHYA 3OYAA 3I0SA 1HRHA 4M3XA 2F4VK 4A62A 2W6LA 3AVGA 1GLCG 3MEGA 3CCUN 1KFSA 1JCEA 4I2PA 4IO9L 1EKEA 1NK6A 3MEEA 3D45A 3VPZA 1YVUA 2QKBA 3G10A 1TKZA 3C6HA 4E7KA 2P9IB 5T7BA 1GOAA 5M1FA 3LP2A 4WF9L 5SZTA 5C15A 2YHAA 2Y1IA 3RR7A 1KAXA 1NK8A 4GVEA 4FO0A 4UQGA 3TWHA 3ZX2A 1TUYA 4CJRA 4OX9K 1XMQK 4E1NA 4H0VB 1WNSA 1NMNA 1Y64A 5AQMA 4CERA 2OA8A 3IS9A 2EHGA 4FZXC 3HVTA 2FLOA 4M3UA 1QZ5A 3DAWA 3TABA 4FJKA 3L2QA 4AILC 3MXMA 3QMLA 3TPQA 4PA1A 1BG3A 5J2MA 3M3ZA 3RMAA 1S9EA 2WOMA 3C7NB 4W5QA 1W7AA 4CFAA 1QE1A 1XNQK 4JI3K 5GAGP 3SMSA 1NU0A 1N33K 2NRVA 4B3OA 4U67L 5JS1A 5ADXH 2RHKA 2X74A 3NGIA 1GLLO 3SLCA 2PYLA 4GVMA 3H1VX 4DLGA 3T3FA 2UUBK 3S41A 1UOCA 3ZSYA 3WQUA 3NE6A 1NM1A 5AZIB 3V9UA 1BO5O 1S1VA 2ASOA 1VRTA 3U4LA 2QXLA 3V9SA 4FJ8A 4IFVA 3HPOA 4B1VA 3JS6A 5MLCQ 2KFZA 3OYNA 2XRIA 1KCFA 3VQ8A 4CJKA 3J7YP 4A2AA 4JI6K 2A3ZA 4FVMA 3MN9A 1QQCA 4C8MA 4GNIA 3O5BA 3EZ5A 5C42A 4MQ3A 4ZTFA 2KZMA 1T3VA 2VWJA 1DEJA 4IBNA 3FFIA 3NH0A 4HWIA 1SQKA 3QEXA 4LF6K 4CEEA 3L4QA 1X9JA 2CH5A 4X64K 4Z4CA 3THWB 1REVA 3AVAA 3I56N 2KFNA 3AAQA 5AJ3K 5JS2A 2E5LK 3IG1A 4H5TA 3KLHA 1FKOA 2VWKA 5HL7L 1NGCA 2ZE2A 4N76A 5KRSA 3C6UA 4CF8A 2HHHK 2QWRA 2FSJA 3LAMA 3S9HA 2E2NA 4CEFA 4BACA 2DPNA 3O4WA 4FJJA 3T1AA 3M8QA 1NGHA 4BQZA 1KAYA 4C8OA 4FWSA 4CZGA 4Z4IA 3A5MC 1ASUA 3PSFA 4WYBA 1W9HA 4BGAA 1VQMN 3OHRA 3HP9A 1L3TA 4FWPA 4DSEA 1WBDA 2PFUA 1X9WA 1O1WA 1WSHA 2VGNA 4DWIA 1WSJA 4CEDA 1GLBG 1QQMA 3F5TA 3VMFB 5KQDA 1JLFA 2EX3A 3MECA 3AA5X 4IJAA 4C23A 3CJ9A 3KKRA 4DF4A 1C6VA 3UB5A 4OKEA 3IRXA 4FJ7A 4CK1A 3NF8A 3AVKA 3ZX3A 3R8EA 3CMEN 4FJGA 4NYFA 4CW7B 2UU9K 1U2VB 3FZFA 3THXA 1B9FA 4Z94A 4AM7A 4E3SA 2YHBA 2D0OA 1YI2N 3OTOK 1XNRK 1BQNA 2E88A 3CERA 4DV4K 2WBNA 1BGXT 3J7ZO 3K57A 4OJRA 4E1JA 1LOTB 3G0ZA 1YJ9N 1IH7A 1C0TA 1NJXA 4BDZA 4IEIA 5CZ2A 2IIRA 4J2AA 2HVIA 5FPNA 4H8KA 3P5JA 2NRRA 4LF5K 3WXKA 4E19A 1K6YA 2O8EB 3L3UA 3KK7A 2J4RA 3AVBA 4JRPA 4KBOA 3TANA 3LP3A 4AHTA 1TVRA 3QICA 3OJUA 3PX4A 3A2FA 5B8HA 1MA9B 2HMPA 3CPEA 1TK0A 4O55A 3DXKA 5LMNK 4J8FA 1RT5A 2YI1A 1SAZA 4QAGA 3ZT4A 2ZJQL 1RDAA 2HHVA 2NZTA 4BR2A 3CM6A 3E9PA 2HSTA 3CFPA 1WSEA 2QXFA 1H1VA 1YAGA 3ZSXA 1JJ2M 3CI5A 3P38A 3AVNA 3ZYYX 2HHQA 3GE1A 4HTUA 3HT3A 3NFAA 1A5VA 3VQ9A 1QHTA 3QBWA 4OKKA 1NJYA 1WSFA 3K5OA 2WC9A 2F8SA 2NUBA 4CGFA 3V9WA 4DTUA 3CG7A 3F9MA 1OVYA 3CM5A 2YKMA 4M7YA 5FDLA 2W40A 1S1UA 1RBRA 2BANA 1DLOA 1RTDA 3O1BA 1E4FT 4FWQA 1OH5A 3EYZA 3NDKA 4UY8O 4C8LA 5DK5A 4BE1A 2V51B 5I9EB 1NKEA 2ITMA 1QVGM 4W5OA 3K5MA 1FK9A 4Z4EA 5SWMA 5EU7A 3HM9A 2O8BB 3ISNC 2OPQA 2AP1A 1C1BA 1YF5L 4EFHA 1FXXA 2KLAA 3MN5A 3O9RA 4JI0K 1TAUA 2YV0X 5DM7L 4DB3A 4JKBA 4YOTA 4C1NK 1WN7A 5DMRA 5GIPA 2P9NB 3WXLA 1B9DA 1RT3A 2HBJA 3QFUA 4RW9A 2B4JA 3VTIA 2A1RA 4CGDA 5AQTA 3DI6A 2P9SA 3LWLA 4JKGA 3ENHA 4I6MA 2HOEA 3M8PA 4EZ9A 2PAVA 3O9QA 2DFFA 4GKJK 4KPYA 4O5FA 4DR3K 1K8AO 3ULEB 1RBVA 4EHUA 4DU4A 3CFOA 3HK2A 4PQUA 4AQYK 4B9NA 1OH8A 3PIOL 4EHTA 4DSKA 3AVCA 4GKKK 2UXCK 1TK8A 4CD3A 4KRFA 2OPSA 2V7ZA 3QESA 4B3TK 2HF4A 3HYFA 1BU6O 4CEBA 5JLFA 3ID8A 4CHPA 3T1YK 1YUWA 1OH7A 2GBZA 1U49A 2HHXA 3OYMA 4Z4HA 1RDBA 2QWOA 1RT1A 4WFBL 1QVFM 5HBMA 3MWPA 3TAMA 4AM6A 2A6AA 4RW4A
chains in the Genus database with same CATH topology
4O5BA 3TI0A 3MXJA 1YT3A 2G8UA 1CXUA 1D5AA 1LAWA 1Z25A 3ULDA 3HSTB 5C24A 2PY5A 1HNVA 1NJWA 5CZ1A 4EP5A 3O3HA 3ZSZA 4HUFA 4LY7A 1T7PA 5J2PA 3V9ZA 1WLJA 1F21A 4KI6A 1U4BA 3VQPA 4FLTA 5J2NA 1TKTA 4E89A 4CGGA 4W5TA 4H4OA 1WAFA 4OGCA 1IO2A 3SV3A 3OYHA 1NOYA 1TKXA 3KD1E 1U04A 4H4MA 4E7IA 4FJNA 4CECA 3AO1A 5KI6A 3DYAA 4G1QA 3NHGA 4RG8A 3VQBA 3OYFA 4DFMA 2RKIA 3AA2A 4CFCA 1QTMA 4FJIA 4IFYA 2PYJA 3L2WA 2RN2A 3NAEA 4DSFA 4ELUA 2OPRA 3IAYA 4DSLA 4QCLA 3SQ2A 3SQ0A 3ZT1A 4CK3A 4DQSA 4NCAA 1A5XA 2HNDA 4FW1A 3OS1A 1NKBA 3RRHA 4OPKA 2HNYA 4CK2A 4PY5A 4N5SA 4DFKA 4CHOA 4B08A 3QO9A 3U3YA 3QIOA 3K59A 1KRPA 3QIPA 3U6FA 4CF1A 3PX6A 4Y1DA 4B9VA 1NK7A 4FJXA 2ZQBA 2P5OA 4E0DA 3QEPA 1BIZA 3VQ4A 3HL8A 4O44A 1BL3A 2E6MA 4N47A 2XY8A 1LW0A 3V1OA 4O0IA 1SL2A 4LH5A 1KFDA 3LDSA 2IGIA 1VSMA 2RPIA 3SNNA 3OYAA 3I0SA 1HRHA 4M3XA 4F3TA 1BCMA 5FRMA 4BE0A 1L3SA 4YNQA 1X9MA 4FJHA 3F9KA 4IG3A 3AVGA 2FBXA 3MEGA 1KFSA 4I2PA 5FROA 4KFBA 4FJ9A 1EKEA 3LWMA 4PWDA 1NK6A 4F2RA 3MEEA 3D45A 4OGEA 1IKVA 3SPZA 1YVUA 2QKBA 4FJ5A 3G10A 1TKZA 3OY9A 3KLIA 4NCBA 4DLEA 3K5LA 4E7KA 4DTRA 5T7BA 1L3VA 2O4IA 1J53A 2RF2A 4CF0A 1GOAA 1W0HA 3LP2A 4ID1A 1ZBIA 5SZTA 4E1MA 2YKNA 4XIUA 2P5GA 1CXQA 2YHAA 3NGYA 1VSFA 4B9TA 3CFRA 2Y1IA 3RR7A 1NK8A 3LP0A 3NBPA 3ZT0A 4AHUA 4CJRA 4UQGA 1NOZA 3TWHA 1NJZA 4E1NA 4F4KA 1BI4A 3TAGA 5KTQA 1VSHA 4CEQA 2G8IA 3LAKA 1WNSA 1KTQA 4AHSA 4CERA 3QNOA 3K5NA 3IS9A 3NH1A 2OA8A 2EHGA 1RDCA 1EX4A 4FZXC 1XWLA 3HVTA 4KO0A 4LSNA 4DTOA 4M3UA 1BHLA 1KVBA 2DTUA 2X78A 3LANA 1Q9XA 3M8SA 3TAQA 3VN5A 3PO4A 4CF2A 4F3OA 3DRSA 3TABA 5HRSA 1ASWA 1S6PA 4FJKA 3C6TA 3L2QA 4DTXA 4AILC 3MXMA 4PA1A 3V81A 4Z4FA 1RTHA 5J2MA 4PUOA 3RMAA 1S9EA 4F8RA 4CJQA 3ALYA 1VRUA 2WOMA 3OYLA 2IOCA 4W5QA 5K14A 1RTJA 4CFAA 1QE1A 1RT4A 4OVLA 4Y1CA 4IKFA 1LV5A 2HHTA 3O3FA 4B3OA 3VQ7A 5JS1A 4J2EA 2X74A 3NGIA 4CJ4A 2I5JA 2OPPA 3AVHA 2X6NA 2B5JA 4GVMA 1N6QA 2PYLA 4DLGA 3T3FA 1JXBA 4FLWA 4GMJB 3ZSYA 1UOCA 4R5PA 5J2QA 2G8FA 2G8KA 4BDPA 2HHSA 2FBYA 2O4GA 3NE6A 1XHZA 2KZZA 4DTPA 2IAJA 3V1QA 3V9UA 2P1JA 2Q3SA 1S1VA 4CJWA 4FJLA 3VQDA 1VRTA 1UAXA 3OYNA 4B8AB 3V9SA 2XHBA 2JGUA 4FJ8A 2ZD1A 4IFVA 3QEWA 3HPOA 3RMCA 1TAQA 3VQ5A 1A5WA 3DM2A 1VSLA 1RBSA 3ZSWA 2A1SA 3PV8A 3SQ1A 4OLBA 3LZIA 3RR8A 2OZSA 1ASVA 3C94A 3AA3A 2YNHA 4CFDA 2XRIA 1KCFA 2WONA 3VQ8A 1TV6A 3AO3A 4CJKA 1VSEA 2FC0A 4CEAA 3OYBA 3C95A 3DLKA 4FVMA 1BIUA 4B8CA 1HNIA 4CJFA 1QQCA 3SJJA 4C8MA 4DTJA 4KHQA 4M3TA 1MU2A 3EZ5A 5C42A 4MQ3A 4CJEA 3CQ8A 1ZBUA 2IDOA 4ZTFA 2KZMA 4OKJA 1I3AA 4CJ3A 3PUFA 4KHSA 2VWJA 4CJVA 4E7LA 2HHWA 4IBNA 2D0AA 4CJTA 3KLFA 3FFIA 4DTNA 1JLQA 4M41A 3NH0A 3MEDA 3MXIA 4Z4GA 3VQQA 3DOKA 4FLYA 3OVNA 3KTQA 1SV5A 3QEXA 1BQMA 2GUIA 4Z0UA 3OYIA 4CEOA 4DFPA 4KHYA 4I2QA 1S5JA 1RBUA 3AVIA 4AHRA 4CEEA 2R7YA 4JS4A 4JS5A 3RTVA 4DTSA 3DLRA 1Z26A 3KK2A 4Z4CA 3V1RA 1VSKA 2XY5A 4KREA 3L8BA 1B92A 1REVA 4AH9A 5E41A 3BDPA 3AVAA 4FZZA 3WNEA 4DQIA 4DSIA 3S3NA 2KFNA 5JS2A 4M42A 2YNIA 4HVJA 2QK9A 1JL1A 3IG1A 3OYJA 3VA3A 2G8WA 3KLHA 1FKOA 2VWKA 2XY6A 4B9MA 4KTQA 2KW4A 4N41A 2HVHA 4B9UA 2ZE2A 3PO5A 4N76A 3AVJA 1X9SA 1X1PA 5KRSA 3C6UA 3KJVA 3KLEA 4CF8A 2Z1GA 1RNHA 3LAMA 4CJ5A 3S9HA 2ETJA 4CEFA 4N56A 1Y97A 3RWUA 4M3YA 1HYZA 1EETA 2G8HA 3VQCA 4BACA 1VSIA 3SUNA 4KB0A 1G15A 5CYMA 4TSXA 4FJJA 3T1AA 3SCXA 4I9QA 1RCHA 3M8QA 1GOBA 2W42A 3L2RA 4AHCA 4L8RB 3KKSA 3ZT2A 5KGWA 4C8OA 4FCYA 2FBVA 4KI4A 4Z4IA 4F2SA 1JKHA 2IC3A 4RW7A 3NCIA 5HRPA 3M8RA 1ASUA 3OYEA 1ITGA 1W9HA 3NF7A 3HP9A 1L3TA 1ZYQA 4NCGA 4CHQA 4DSEA 1QSSA 2XY7A 2LSNA 5I3UA 1O1WA 1WSHA 1X9WA 2QKKA 4FK4A 1HYVA 4M3WA 4DWIA 3QETA 1LWCA 1WSJA 4CEDA 1HYSA 1TL3A 4DMNA 1CZBA 1EXQA 3DOLA 1T05A 1VSJA 3NGZA 1JLFA 2EX3A 3KD5E 3MECA 1IKYA 3AA5X 3D0PA 4DQQA 3HPGA 4DF4A 3KKRA 1LWEA 1C6VA 4W5RA 4OKEA 3IRXA 4FJ7A 2D5RA 4CK1A 3NF8A 1SL1A 4ELVA 3AVKA 1NK4A 4ID5A 1SKWA 2VG7A 1T03A 3QLHA 3TR8A 3LZJA 4FJGA 4NYFA 1BI4B 3MAQA 4EP4A 4DF8A 1QSYA 4M3ZA 3OYGA 1LAVA 3V4IA 4FK2A 1YTAA 1B9FA 1DTQA 4CJLA 1S1TA 4O4GA 3DMJA 4E3SA 2YHBA 4BWMA 1S6QA 2GV9A 4FW2A 5HRNA 1XC9A 1RT7A 2Z1HA 2DY4A 1I39A 3L2UA 1U45A 1BQNA 1DTTA 2D0CA 1BGXT 4RW8A 3DRPA 5KRTA 4CCHA 4KHWA 1QS4A 1VK0A 2Z1JA 3LALA 4OJRA 3K57A 1R0AA 4KB1A 2HHUA 4K8XA 4ZTJA 3THVA 3VQAA 1KSPA 3G0ZA 2PZSA 4FJMA 1WSGA 1J54A 1IH7A 4CJUA 4I9LA 1C0TA 3HVRA 2DFEA 4CHZA 1NJXA 4CESA 4BDZA 3P1GA 5CZ2A 3RMDA 4J2AA 2HVIA 3QNNA 4H8KA 1HJRA 4BWJA 3VQEA 4DTMA 4FZYA 3P5JA 4HCBA 5CY4A 4E19A 3QERA 3KLGA 1K6YA 3L2VA 3KK3A 1UA1A 3L3UA 2BE2A 3AVBA 4FM2A 3I0RA 1BCOA 1KLMA 4E7HA 3L3VA 4JRPA 3SYZA 4DFJA 3TANA 1QSLA 1CZ9A 3LP3A 4AHTA 1TVRA 3OJUA 1HQEA 1KVCA 3WNFA 3PX4A 3SI6A 3A2FA 3AA4A 4KAZA 2BGGA 5I42A 3TARA 5FRNA 4WE1A 4JLHA 3OS2A 1TK0A 4O55A 1D9DA 2F96A 3NH2A 4KHUA 1RT5A 4QOZB 4FXDA 3UIQA 4DU3A 4QAGA 3JSMA 3ZT4A 2KFZA 3OS0A 1RDAA 2HHVA 1S1XA 3WNGA 2G8VA 4B9SA 3ZT3A 3PY8A 3CM6A 4FLZA 1RT2A 1WSEA 2QXFA 3E01A 5HRRA 3CFPA 1TKDA 3ZSXA 1Q9YA 4KTZA 1GOCA 5CYQA 3I8DA 4LH4A 3P83D 3AVNA 1VSDA 4GW6A 3K58A 2VG5A 4IDKA 1NK5A 1KLNA 3RRGA 4EZ6A 2HHQA 4HTUA 2BDPA 1JLCA 3HT3A 3NFAA 4CHYA 4ZHRA 1NK0A 1A5VA 3VQ9A 1QHTA 3QINA 4HHTA 4OKKA 3LPTA 4B9LA 2AJQA 2X6SA 1NJYA 1WSFA 2ITGA 3K5OA 3OYKA 4O0JA 5HLFA 3DLGA 3DLEA 4IG0A 1HQUA 2NUBA 4CGFA 3V9WA 4C8NA 4DTUA 3CG7A 2Z1IA 4C8KA 2F8SA 3CM5A 2YKMA 3SV4A 1TL1A 3V6DA 1D8YA 5FDLA 2D0BA 3ZCMA 1S1UA 4BE2A 2E6LA 1C1CA 3AVMA 4ELTA 4DS5A 1LW2A 4LD0A 1RBRA 2BANA 4DQRA 1DLOA 2HB5A 2OZMA 1RTDA 3NF9A 3LP1A 2HMIA 3KIOA 3EYZA 2IS3A 3NDKA 1L5UA 1SKSA 1JLEA 4CF9A 4HUGA 4CIFA 4HUEA 4C8LA 3K2PA 3O4QA 5DK5A 3SPYA 2KQ2A 4NYNA 1RT6A 4BE1A 3BGRA 3SUQA 1ZBFA 3B6OA 4I7FA 4CIGA 3V9XA 1NKEA 3HJFA 4M3RA 1UA0A 4W5OA 3K5MA 2XO7A 3EY1A 4E7JA 1FK9A 3SZ2A 3HP6A 4BDYA 4KHNA 4Z4EA 5SWMA 1NK9A 5EU7A 4Q0BA 3HM9A 3ISNC 2OPQA 3QEVA 3SUPA 3DRRA 4DG1A 1C1BA 4AHVA 4MFBA 4CJPA 1Q8IA 4FLUA 1FXXA 5C25A 1RBTA 4KV8A 1TAUA 4KTWA 4OLAA 2YV0X 4Q5VA 1J5OA 4FLVA 4CJSA 3AV9A 3O4NA 3ZSRA 1WN7A 2VG6A 3LPUA 5DMRA 3U3GA 5KGXA 3TAPA 1U47A 3HO1A 1B9DA 1RT3A 1C1AA 2YNFA 3ZSQA 4RW9A 2B4JA 4CE9A 2KTQA 3HXMA 4M45A 3OJSA 1C0UA 5HP1A 2A1RA 4CGDA 3ITHA 3SUOA 3DI6A 4FK0A 2P51A 2F8TA 3LWLA 4LSLA 2HNZA 1T8EA 2YNGA 1WAJA 3OYDA 1KVAA 1IG9A 4J2BA 1HPZA 1SL0A 5HROA 3ZSOA 3AO4A 1IKXA 1UWBA 4DS4A 1WSIA 3AVFA 3T19A 3ASMA 3TAFA 1RDDA 1JLAA 3VQ6A 1CLQA 3M8PA 4ICLA 3NF6A 3DLHA 3TAEA 4EZ9A 3SQ4A 3AO5A 4CFBA 2DFFA 4KPYA 4CEZA 1JL2A 3B6PA 1RBVA 3OYCA 4J2DA 4JRQA 3S3OA 4DU4A 3CFOA 3HK2A 2FBTA 4PQUA 4B9NA 1XI1A 3F73A 1JLGA 2DFHA 4KKOA 4CGHA 3RMBA 4W5NA 1L3UA 1C0MA 4FM0A 1BISA 3O3GA 2Y1JA 4CHNA 1SKRA 1IKWA 4DSJA 4DQPA 4CGIA 1FKPA 4DSKA 4OPJA 1YTUA 1ZBHA 3AVCA 3H08A 4DU1A 1EP4A 3PX0A 5D3GA 1TK8A 3ZSVA 3S3MA 4CIEA 4KRFA 1J9AA 1LWFA 1SUQA 2HW3A 5J1EA 1JLBA 2OPSA 1U48A 3QESA 1RTIA 1TK5A 1RILA 3QEIA 3HYFA 4YFUA 4FM1A 4CEBA 4FLXA 4CGJA 3DLBA 2B6AA 3JYTA 1JXEA 4HCCA 1D9FA 4CHPA 3AO2A 2OYQA 2E4LA 3CYMA 3AVLA 4RW6A 1HMVA 1XHXA 4K8ZA 1N5YA 3KK1A 4FYDA 2ATQA 2GBZA 1ZBLA 1U49A 1TGOA 2HHXA 3OYMA 4Z4HA 1NKCA 1RDBA 1S1WA 3HPHA 1RT1A 2JLEA 5HBMA 3TAMA 3WNHA 3VA0A 1S9GA 4RW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5B A;  3TI0 A;  3MXJ A;  1YT3 A;  2G8U A;  1CXU A;  1D5A A;  1LAW A;  1Z25 A;  3ULD A;  3HST B;  5C24 A;  2PY5 A;  1HNV A;  1NJW A;  5CZ1 A;  4EP5 A;  3O3H A;  3ZSZ A;  4HUF A;  4LY7 A;  1T7P A;  5J2P A;  3V9Z A;  1WLJ A;  1F21 A;  4KI6 A;  1U4B A;  3VQP A;  4FLT A;  5J2N A;  1TKT A;  4E89 A;  4CGG A;  4W5T A;  4H4O A;  1WAF A;  4OGC A;  1IO2 A;  3SV3 A;  3OYH A;  1NOY A;  1TKX A;  3KD1 E;  1U04 A;  4H4M A;  4E7I A;  4FJN A;  4CEC A;  3AO1 A;  5KI6 A;  3DYA A;  4G1Q A;  3NHG A;  4RG8 A;  3VQB A;  3OYF A;  4DFM A;  2RKI A;  3AA2 A;  4CFC A;  1QTM A;  4FJI A;  4IFY A;  2PYJ A;  3L2W A;  2RN2 A;  3NAE A;  4DSF A;  4ELU A;  2OPR A;  3IAY A;  4DSL A;  4QCL A;  3SQ2 A;  3SQ0 A;  3ZT1 A;  4CK3 A;  4DQS A;  4NCA A;  1A5X A;  2HND A;  4FW1 A;  3OS1 A;  1NKB A;  3RRH A;  4OPK A;  2HNY A;  4CK2 A;  4PY5 A;  4N5S A;  4DFK A;  4CHO A;  4B08 A;  3QO9 A;  3U3Y A;  3QIO A;  3K59 A;  1KRP A;  3QIP A;  3U6F A;  4CF1 A;  3PX6 A;  4Y1D A;  4B9V A;  1NK7 A;  4FJX A;  2ZQB A;  2P5O A;  4E0D A;  3QEP A;  1BIZ A;  3VQ4 A;  3HL8 A;  4O44 A;  1BL3 A;  2E6M A;  4N47 A;  2XY8 A;  1LW0 A;  3V1O A;  4O0I A;  1SL2 A;  4LH5 A;  1KFD A;  3LDS A;  2IGI A;  1VSM A;  2RPI A;  3SNN A;  3OYA A;  3I0S A;  1HRH A;  4M3X A;  4F3T A;  1BCM A;  5FRM A;  4BE0 A;  1L3S A;  4YNQ A;  1X9M A;  4FJH A;  3F9K A;  4IG3 A;  3AVG A;  2FBX A;  3MEG A;  1KFS A;  4I2P A;  5FRO A;  4KFB A;  4FJ9 A;  1EKE A;  3LWM A;  4PWD A;  1NK6 A;  4F2R A;  3MEE A;  3D45 A;  4OGE A;  1IKV A;  3SPZ A;  1YVU A;  2QKB A;  4FJ5 A;  3G10 A;  1TKZ A;  3OY9 A;  3KLI A;  4NCB A;  4DLE A;  3K5L A;  4E7K A;  4DTR A;  5T7B A;  1L3V A;  2O4I A;  1J53 A;  2RF2 A;  4CF0 A;  1GOA A;  1W0H A;  3LP2 A;  4ID1 A;  1ZBI A;  5SZT A;  4E1M A;  2YKN A;  4XIU A;  2P5G A;  1CXQ A;  2YHA A;  3NGY A;  1VSF A;  4B9T A;  3CFR A;  2Y1I A;  3RR7 A;  1NK8 A;  3LP0 A;  3NBP A;  3ZT0 A;  4AHU A;  4CJR A;  4UQG A;  1NOZ A;  3TWH A;  1NJZ A;  4E1N A;  4F4K A;  1BI4 A;  3TAG A;  5KTQ A;  1VSH A;  4CEQ A;  2G8I A;  3LAK A;  1WNS A;  1KTQ A;  4AHS A;  4CER A;  3QNO A;  3K5N A;  3IS9 A;  3NH1 A;  2OA8 A;  2EHG A;  1RDC A;  1EX4 A;  4FZX C;  1XWL A;  3HVT A;  4KO0 A;  4LSN A;  4DTO A;  4M3U A;  1BHL A;  1KVB A;  2DTU A;  2X78 A;  3LAN A;  1Q9X A;  3M8S A;  3TAQ A;  3VN5 A;  3PO4 A;  4CF2 A;  4F3O A;  3DRS A;  3TAB A;  5HRS A;  1ASW A;  1S6P A;  4FJK A;  3C6T A;  3L2Q A;  4DTX A;  4AIL C;  3MXM A;  4PA1 A;  3V81 A;  4Z4F A;  1RTH A;  5J2M A;  4PUO A;  3RMA A;  1S9E A;  4F8R A;  4CJQ A;  3ALY A;  1VRU A;  2WOM A;  3OYL A;  2IOC A;  4W5Q A;  5K14 A;  1RTJ A;  4CFA A;  1QE1 A;  1RT4 A;  4OVL A;  4Y1C A;  4IKF A;  1LV5 A;  2HHT A;  3O3F A;  4B3O A;  3VQ7 A;  5JS1 A;  4J2E A;  2X74 A;  3NGI A;  4CJ4 A;  2I5J A;  2OPP A;  3AVH A;  2X6N A;  2B5J A;  4GVM A;  1N6Q A;  2PYL A;  4DLG A;  3T3F A;  1JXB A;  4FLW A;  4GMJ B;  3ZSY A;  1UOC A;  4R5P A;  5J2Q A;  2G8F A;  2G8K A;  4BDP A;  2HHS A;  2FBY A;  2O4G A;  3NE6 A;  1XHZ A;  2KZZ A;  4DTP A;  2IAJ A;  3V1Q A;  3V9U A;  2P1J A;  2Q3S A;  1S1V A;  4CJW A;  4FJL A;  3VQD A;  1VRT A;  1UAX A;  3OYN A;  4B8A B;  3V9S A;  2XHB A;  2JGU A;  4FJ8 A;  2ZD1 A;  4IFV A;  3QEW A;  3HPO A;  3RMC A;  1TAQ A;  3VQ5 A;  1A5W A;  3DM2 A;  1VSL A;  1RBS A;  3ZSW A;  2A1S A;  3PV8 A;  3SQ1 A;  4OLB A;  3LZI A;  3RR8 A;  2OZS A;  1ASV A;  3C94 A;  3AA3 A;  2YNH A;  4CFD A;  2XRI A;  1KCF A;  2WON A;  3VQ8 A;  1TV6 A;  3AO3 A;  4CJK A;  1VSE A;  2FC0 A;  4CEA A;  3OYB A;  3C95 A;  3DLK A;  4FVM A;  1BIU A;  4B8C A;  1HNI A;  4CJF A;  1QQC A;  3SJJ A;  4C8M A;  4DTJ A;  4KHQ A;  4M3T A;  1MU2 A;  3EZ5 A;  5C42 A;  4MQ3 A;  4CJE A;  3CQ8 A;  1ZBU A;  2IDO A;  4ZTF A;  2KZM A;  4OKJ A;  1I3A A;  4CJ3 A;  3PUF A;  4KHS A;  2VWJ A;  4CJV A;  4E7L A;  2HHW A;  4IBN A;  2D0A A;  4CJT A;  3KLF A;  3FFI A;  4DTN A;  1JLQ A;  4M41 A;  3NH0 A;  3MED A;  3MXI A;  4Z4G A;  3VQQ A;  3DOK A;  4FLY A;  3OVN A;  3KTQ A;  1SV5 A;  3QEX A;  1BQM A;  2GUI A;  4Z0U A;  3OYI A;  4CEO A;  4DFP A;  4KHY A;  4I2Q A;  1S5J A;  1RBU A;  3AVI A;  4AHR A;  4CEE A;  2R7Y A;  4JS4 A;  4JS5 A;  3RTV A;  4DTS A;  3DLR A;  1Z26 A;  3KK2 A;  4Z4C A;  3V1R A;  1VSK A;  2XY5 A;  4KRE A;  3L8B A;  1B92 A;  1REV A;  4AH9 A;  5E41 A;  3BDP A;  3AVA A;  4FZZ A;  3WNE A;  4DQI A;  4DSI A;  3S3N A;  2KFN A;  5JS2 A;  4M42 A;  2YNI A;  4HVJ A;  2QK9 A;  1JL1 A;  3IG1 A;  3OYJ A;  3VA3 A;  2G8W A;  3KLH A;  1FKO A;  2VWK A;  2XY6 A;  4B9M A;  4KTQ A;  2KW4 A;  4N41 A;  2HVH A;  4B9U A;  2ZE2 A;  3PO5 A;  4N76 A;  3AVJ A;  1X9S A;  1X1P A;  5KRS A;  3C6U A;  3KJV A;  3KLE A;  4CF8 A;  2Z1G A;  1RNH A;  3LAM A;  4CJ5 A;  3S9H A;  2ETJ A;  4CEF A;  4N56 A;  1Y97 A;  3RWU A;  4M3Y A;  1HYZ A;  1EET A;  2G8H A;  3VQC A;  4BAC A;  1VSI A;  3SUN A;  4KB0 A;  1G15 A;  5CYM A;  4TSX A;  4FJJ A;  3T1A A;  3SCX A;  4I9Q A;  1RCH A;  3M8Q A;  1GOB A;  2W42 A;  3L2R A;  4AHC A;  4L8R B;  3KKS A;  3ZT2 A;  5KGW A;  4C8O A;  4FCY A;  2FBV A;  4KI4 A;  4Z4I A;  4F2S A;  1JKH A;  2IC3 A;  4RW7 A;  3NCI A;  5HRP A;  3M8R A;  1ASU A;  3OYE A;  1ITG A;  1W9H A;  3NF7 A;  3HP9 A;  1L3T A;  1ZYQ A;  4NCG A;  4CHQ A;  4DSE A;  1QSS A;  2XY7 A;  2LSN A;  5I3U A;  1O1W A;  1WSH A;  1X9W A;  2QKK A;  4FK4 A;  1HYV A;  4M3W A;  4DWI A;  3QET A;  1LWC A;  1WSJ A;  4CED A;  1HYS A;  1TL3 A;  4DMN A;  1CZB A;  1EXQ A;  3DOL A;  1T05 A;  1VSJ A;  3NGZ A;  1JLF A;  2EX3 A;  3KD5 E;  3MEC A;  1IKY A;  3AA5 X;  3D0P A;  4DQQ A;  3HPG A;  4DF4 A;  3KKR A;  1LWE A;  1C6V A;  4W5R A;  4OKE A;  3IRX A;  4FJ7 A;  2D5R A;  4CK1 A;  3NF8 A;  1SL1 A;  4ELV A;  3AVK A;  1NK4 A;  4ID5 A;  1SKW A;  2VG7 A;  1T03 A;  3QLH A;  3TR8 A;  3LZJ A;  4FJG A;  4NYF A;  1BI4 B;  3MAQ A;  4EP4 A;  4DF8 A;  1QSY A;  4M3Z A;  3OYG A;  1LAV A;  3V4I A;  4FK2 A;  1YTA A;  1B9F A;  1DTQ A;  4CJL A;  1S1T A;  4O4G A;  3DMJ A;  4E3S A;  2YHB A;  4BWM A;  1S6Q A;  2GV9 A;  4FW2 A;  5HRN A;  1XC9 A;  1RT7 A;  2Z1H A;  2DY4 A;  1I39 A;  3L2U A;  1U45 A;  1BQN A;  1DTT A;  2D0C A;  1BGX T;  4RW8 A;  3DRP A;  5KRT A;  4CCH A;  4KHW A;  1QS4 A;  1VK0 A;  2Z1J A;  3LAL A;  4OJR A;  3K57 A;  1R0A A;  4KB1 A;  2HHU A;  4K8X A;  4ZTJ A;  3THV A;  3VQA A;  1KSP A;  3G0Z A;  2PZS A;  4FJM A;  1WSG A;  1J54 A;  1IH7 A;  4CJU A;  4I9L A;  1C0T A;  3HVR A;  2DFE A;  4CHZ A;  1NJX A;  4CES A;  4BDZ A;  3P1G A;  5CZ2 A;  3RMD A;  4J2A A;  2HVI A;  3QNN A;  4H8K A;  1HJR A;  4BWJ A;  3VQE A;  4DTM A;  4FZY A;  3P5J A;  4HCB A;  5CY4 A;  4E19 A;  3QER A;  3KLG A;  1K6Y A;  3L2V A;  3KK3 A;  1UA1 A;  3L3U A;  2BE2 A;  3AVB A;  4FM2 A;  3I0R A;  1BCO A;  1KLM A;  4E7H A;  3L3V A;  4JRP A;  3SYZ A;  4DFJ A;  3TAN A;  1QSL A;  1CZ9 A;  3LP3 A;  4AHT A;  1TVR A;  3OJU A;  1HQE A;  1KVC A;  3WNF A;  3PX4 A;  3SI6 A;  3A2F A;  3AA4 A;  4KAZ A;  2BGG A;  5I42 A;  3TAR A;  5FRN A;  4WE1 A;  4JLH A;  3OS2 A;  1TK0 A;  4O55 A;  1D9D A;  2F96 A;  3NH2 A;  4KHU A;  1RT5 A;  4QOZ B;  4FXD A;  3UIQ A;  4DU3 A;  4QAG A;  3JSM A;  3ZT4 A;  2KFZ A;  3OS0 A;  1RDA A;  2HHV A;  1S1X A;  3WNG A;  2G8V A;  4B9S A;  3ZT3 A;  3PY8 A;  3CM6 A;  4FLZ A;  1RT2 A;  1WSE A;  2QXF A;  3E01 A;  5HRR A;  3CFP A;  1TKD A;  3ZSX A;  1Q9Y A;  4KTZ A;  1GOC A;  5CYQ A;  3I8D A;  4LH4 A;  3P83 D;  3AVN A;  1VSD A;  4GW6 A;  3K58 A;  2VG5 A;  4IDK A;  1NK5 A;  1KLN A;  3RRG A;  4EZ6 A;  2HHQ A;  4HTU A;  2BDP A;  1JLC A;  3HT3 A;  3NFA A;  4CHY A;  4ZHR A;  1NK0 A;  1A5V A;  3VQ9 A;  1QHT A;  3QIN A;  4HHT A;  4OKK A;  3LPT A;  4B9L A;  2AJQ A;  2X6S A;  1NJY A;  1WSF A;  2ITG A;  3K5O A;  3OYK A;  4O0J A;  5HLF A;  3DLG A;  3DLE A;  4IG0 A;  1HQU A;  2NUB A;  4CGF A;  3V9W A;  4C8N A;  4DTU A;  3CG7 A;  2Z1I A;  4C8K A;  2F8S A;  3CM5 A;  2YKM A;  3SV4 A;  1TL1 A;  3V6D A;  1D8Y A;  5FDL A;  2D0B A;  3ZCM A;  1S1U A;  4BE2 A;  2E6L A;  1C1C A;  3AVM A;  4ELT A;  4DS5 A;  1LW2 A;  4LD0 A;  1RBR A;  2BAN A;  4DQR A;  1DLO A;  2HB5 A;  2OZM A;  1RTD A;  3NF9 A;  3LP1 A;  2HMI A;  3KIO A;  3EYZ A;  2IS3 A;  3NDK A;  1L5U A;  1SKS A;  1JLE A;  4CF9 A;  4HUG A;  4CIF A;  4HUE A;  4C8L A;  3K2P A;  3O4Q A;  5DK5 A;  3SPY A;  2KQ2 A;  4NYN A;  1RT6 A;  4BE1 A;  3BGR A;  3SUQ A;  1ZBF A;  3B6O A;  4I7F A;  4CIG A;  3V9X A;  1NKE A;  3HJF A;  4M3R A;  1UA0 A;  4W5O A;  3K5M A;  2XO7 A;  3EY1 A;  4E7J A;  1FK9 A;  3SZ2 A;  3HP6 A;  4BDY A;  4KHN A;  4Z4E A;  5SWM A;  1NK9 A;  5EU7 A;  4Q0B A;  3HM9 A;  3ISN C;  2OPQ A;  3QEV A;  3SUP A;  3DRR A;  4DG1 A;  1C1B A;  4AHV A;  4MFB A;  4CJP A;  1Q8I A;  4FLU A;  1FXX A;  5C25 A;  1RBT A;  4KV8 A;  1TAU A;  4KTW A;  4OLA A;  2YV0 X;  4Q5V A;  1J5O A;  4FLV A;  4CJS A;  3AV9 A;  3O4N A;  3ZSR A;  1WN7 A;  2VG6 A;  3LPU A;  5DMR A;  3U3G A;  5KGX A;  3TAP A;  1U47 A;  3HO1 A;  1B9D A;  1RT3 A;  1C1A A;  2YNF A;  3ZSQ A;  4RW9 A;  2B4J A;  4CE9 A;  2KTQ A;  3HXM A;  4M45 A;  3OJS A;  1C0U A;  5HP1 A;  2A1R A;  4CGD A;  3ITH A;  3SUO A;  3DI6 A;  4FK0 A;  2P51 A;  2F8T A;  3LWL A;  4LSL A;  2HNZ A;  1T8E A;  2YNG A;  1WAJ A;  3OYD A;  1KVA A;  1IG9 A;  4J2B A;  1HPZ A;  1SL0 A;  5HRO A;  3ZSO A;  3AO4 A;  1IKX A;  1UWB A;  4DS4 A;  1WSI A;  3AVF A;  3T19 A;  3ASM A;  3TAF A;  1RDD A;  1JLA A;  3VQ6 A;  1CLQ A;  3M8P A;  4ICL A;  3NF6 A;  3DLH A;  3TAE A;  4EZ9 A;  3SQ4 A;  3AO5 A;  4CFB A;  2DFF A;  4KPY A;  4CEZ A;  1JL2 A;  3B6P A;  1RBV A;  3OYC A;  4J2D A;  4JRQ A;  3S3O A;  4DU4 A;  3CFO A;  3HK2 A;  2FBT A;  4PQU A;  4B9N A;  1XI1 A;  3F73 A;  1JLG A;  2DFH A;  4KKO A;  4CGH A;  3RMB A;  4W5N A;  1L3U A;  1C0M A;  4FM0 A;  1BIS A;  3O3G A;  2Y1J A;  4CHN A;  1SKR A;  1IKW A;  4DSJ A;  4DQP A;  4CGI A;  1FKP A;  4DSK A;  4OPJ A;  1YTU A;  1ZBH A;  3AVC A;  3H08 A;  4DU1 A;  1EP4 A;  3PX0 A;  5D3G A;  1TK8 A;  3ZSV A;  3S3M A;  4CIE A;  4KRF A;  1J9A A;  1LWF A;  1SUQ A;  2HW3 A;  5J1E A;  1JLB A;  2OPS A;  1U48 A;  3QES A;  1RTI A;  1TK5 A;  1RIL A;  3QEI A;  3HYF A;  4YFU A;  4FM1 A;  4CEB A;  4FLX A;  4CGJ A;  3DLB A;  2B6A A;  3JYT A;  1JXE A;  4HCC A;  1D9F A;  4CHP A;  3AO2 A;  2OYQ A;  2E4L A;  3CYM A;  3AVL A;  4RW6 A;  1HMV A;  1XHX A;  4K8Z A;  1N5Y A;  3KK1 A;  4FYD A;  2ATQ A;  2GBZ A;  1ZBL A;  1U49 A;  1TGO A;  2HHX A;  3OYM A;  4Z4H A;  1NKC A;  1RDB A;  1S1W A;  3HPH A;  1RT1 A;  2JLE A;  5HBM A;  3TAM A;  3WNH A;  3VA0 A;  1S9G A;  4RW4 A; 
#chains in the Genus database with same CATH topology
 3TI0 A;  3H45 C;  3MXJ A;  5FPD A;  2O8C A;  1D5A A;  1LAW A;  4MDA A;  3KVG A;  2P9P A;  3SAH A;  4LFA K;  4BRO A;  3SV3 A;  1NOY A;  3LM9 A;  4H4M A;  4CEC A;  3VOV A;  3DYA A;  5C12 A;  4G1Q A;  4RG8 A;  3VQB A;  2RKI A;  3AA2 A;  2OCE A;  4CFC A;  2PYJ A;  3NAE A;  3SBT A;  4PL7 A;  1O13 A;  2QEX N;  4NCA A;  4K25 A;  4FW1 A;  2HNY A;  4N5S A;  3L6Q A;  3O9U A;  4WQ5 A;  3U6F A;  2V52 B;  4CF1 A;  1NK7 A;  4FJX A;  2ZQB A;  2P5O A;  3QEP A;  3NVM A;  4JI7 K;  3MX5 A;  4O44 A;  4N47 A;  4CZL A;  1M90 O;  3O9S A;  3ZEU B;  4LH5 A;  3LDS A;  1VSM A;  5KPZ A;  2BTF A;  4DCH A;  2P9L B;  4BE0 A;  1L3S A;  2W41 A;  1X9M A;  4IG3 A;  3CJB A;  2FBX A;  3E1Y A;  4IWV A;  4FJ9 A;  1ZC6 A;  3LWM A;  4F2R A;  4OGE A;  1IKV A;  2IVO A;  1MWK A;  4IXC A;  4DLE A;  1L3V A;  2O4I A;  1J53 A;  2CGL A;  4CZE A;  2GTD A;  1CXQ A;  3CFR A;  3LP0 A;  3NBP A;  1NOZ A;  2IVP A;  4JEP A;  5M1N A;  3LAK A;  1K8K A;  1KTQ A;  4WCE L;  3U8X A;  2FSK A;  3K5N A;  5IT9 O;  1OVQ A;  5GAH P;  2F9T A;  4BRE A;  5E26 A;  4B1U B;  3OA9 A;  3PLA A;  4F3O A;  3DRS A;  3DLL L;  1ASW A;  5AQX A;  1HKG A;  1OKJ A;  4DTX A;  3FZK A;  1VQL N;  1RTH A;  4JD2 B;  3ALY A;  3OYL A;  2IOC A;  2AA4 A;  1RTJ A;  1HKB A;  5EVZ A;  2FF3 B;  3VEO A;  2I5J A;  1VHX A;  2FF6 A;  3QBX A;  4IOX A;  2B5J A;  4QS9 A;  4R5P A;  2O8D A;  2G8F A;  1MDU B;  4BDP A;  1XHZ A;  2KZZ A;  4B1Y B;  4DV6 K;  3HRG A;  4CZF A;  3VQD A;  1YJW N;  5AQO A;  4CZK A;  2JGU A;  1YIJ N;  4OO1 J;  4CVN E;  3DM2 A;  3SQ1 A;  3PV8 A;  3HBT A;  3VGL A;  1W97 L;  1ASV A;  3NH1 A;  4CFD A;  1TV6 A;  2FC0 A;  4CEA A;  5LJW A;  3C95 A;  3DLK A;  4CJF A;  4DR7 K;  1V4S A;  3EE8 A;  4DTJ A;  1MU2 A;  3RVC A;  2A40 A;  5EXW A;  1ZBU A;  2IDO A;  4OPA A;  4OKJ A;  1I3A A;  3PUF A;  2A5X A;  2D0A A;  3KLF A;  4Z4G A;  4M41 A;  5EX5 A;  4A2B A;  2GUI A;  3MN7 A;  4FWL A;  1RBU A;  4AHR A;  3CQX A;  3VEX A;  2YJF A;  1X3M A;  4JKF A;  3KK2 A;  3BEX A;  4PKG A;  1HLU A;  4AH9 A;  4FZZ A;  1VQ6 N;  4BVP A;  4DSI A;  3WQT A;  1JL1 A;  3OYJ A;  4BR7 A;  4RCH A;  2QW9 A;  4KTQ A;  4Y0W A;  4YOV A;  2UUC K;  4B9U A;  4BR0 A;  5ADX A;  3V6D A;  2Z1G A;  1Y97 A;  3RWU A;  3O6W A;  4BRD A;  1VSI A;  1G15 A;  4WFN L;  5CYM A;  4TSX A;  3SCX A;  4V19 S;  2ASM A;  3NVK A;  4AHC A;  3MCA B;  4L8R B;  4GV6 A;  2O8F B;  4LF9 K;  2BH1 A;  4FCY A;  4CZH A;  5M1Q A;  3M8R A;  3F2K A;  1ZYQ A;  4NCG A;  4CHQ A;  2QKK A;  2BUP A;  1CZB A;  1EXQ A;  3HTV A;  3NGZ A;  3KD5 E;  2H3G X;  2QWL A;  3D0P A;  1N34 K;  2D5R A;  1SL1 A;  4ELV A;  5CE3 A;  1NK4 A;  2VG7 A;  4K43 A;  4GV9 A;  2A42 A;  1QSY A;  3MAQ A;  3ID6 A;  4EP4 A;  4FK2 A;  1YTA A;  4CJL A;  4BWM A;  2GV9 A;  5HRN A;  1XC9 A;  1RT7 A;  2Z1H A;  4K41 A;  4GY2 B;  3E9L A;  1DTT A;  5C10 A;  1XC3 A;  3FZH A;  1XMO K;  2Z1J A;  3LAL A;  4FL9 A;  3UKU A;  4K8X A;  4ZTJ A;  2Q97 A;  3CCQ N;  3VQA A;  3LL3 A;  4CJU A;  3HVR A;  2DFE A;  4CHZ A;  4CES A;  2E2Q A;  3P1G A;  3QNN A;  3VQE A;  3LDN A;  3P39 A;  1KAZ A;  3QER A;  3KLG A;  3L2V A;  1E4G T;  5C2D A;  3L3V A;  4BRH A;  3SYZ A;  4DFJ A;  1CZ9 A;  3SI6 A;  3C6A A;  3AA4 A;  1YXQ A;  2OAN A;  3TAR A;  1XUP O;  3MX2 A;  4WQ5 C;  3NH2 A;  4DU3 A;  4CD1 A;  1S1X A;  3QDK A;  4B9S A;  1BDG A;  3PY8 A;  1RT2 A;  5HRR A;  2E1Z A;  3A0I X;  3J7A P;  4OPH A;  3WXJ A;  1JLC A;  4X66 K;  1NK0 A;  1VQ8 N;  2X6S A;  5AZJ A;  4O0J A;  5HLF A;  1HQU A;  2Z1I A;  3CMA N;  5C2F A;  1D8Y A;  2ZF5 O;  4AF1 A;  3Q7C A;  2E6L A;  4DV3 K;  3AVM A;  4ELT A;  1LW2 A;  3U9Z A;  3H6E A;  4IEE A;  2OZM A;  3O9T A;  1L5U A;  4BRM A;  4CIF A;  3K2P A;  1NWK A;  4BR4 A;  2KQ2 A;  4NYN A;  3AGK A;  3BGR A;  3KWI A;  5AQP A;  1ZBF A;  3V9X A;  2ZM6 K;  1CZA N;  2XO7 A;  1WOQ A;  3D2E A;  3SZ2 A;  3LDL A;  3VTH A;  2VWB A;  3LDO A;  1ATN A;  1T6C A;  1NGF A;  4IDH A;  3EKU A;  4O8U A;  4DG1 A;  3IDH A;  4DV1 K;  1K9M O;  3H1Q A;  1IJJ A;  1RBT A;  1IG8 A;  2QA4 N;  3FR0 A;  2UUA K;  3DWL A;  4FLV A;  4KH5 A;  5C0Y A;  1VQO N;  3U3G A;  3AAP A;  3WXI A;  2YNF A;  1NLV A;  3HXM A;  4M45 A;  3OJS A;  1C0U A;  1NGB A;  4FK0 A;  3SUO A;  2F8T A;  2P51 A;  1T8E A;  3TSU A;  2HNZ A;  2YNG A;  5LJV A;  1W2B M;  3HM8 A;  5HRO A;  4B3M K;  3ZSO A;  3AO4 A;  1IKX A;  3AVF A;  3T19 A;  3TAF A;  3WXM B;  4ICL A;  3NF6 A;  3TAE A;  5GIO A;  4CFB A;  4M63 C;  4CEZ A;  4J2D A;  3OYC A;  3S3O A;  2FBT A;  3EL2 A;  4B9Q A;  3DXM A;  4CGH A;  1TYQ A;  4H5R A;  5BN9 A;  4NXM K;  5AQY A;  3I8B A;  1BIS A;  1HKC A;  5AQW A;  4DSJ A;  1FKP A;  3TTD A;  1ZBH A;  3H08 A;  3THX B;  1J5E K;  3C0B A;  3ZSV A;  4CIE A;  1J9A A;  3BP8 A;  1SUQ A;  1U48 A;  5KPR A;  4FM1 A;  3CHW A;  3BUZ B;  4HCC A;  1D9F A;  3AO2 A;  2OYQ A;  4RW6 A;  4FYD A;  2VCP A;  1ZBL A;  3G71 N;  1TGO A;  2NRZ A;  1S1W A;  3WNH A;  5JVH L;  1CXU A;  1TUU A;  3T69 A;  5C24 A;  1GLE G;  3ZET A;  5AFU H;  5J2P A;  3V9Z A;  4KI6 A;  1BWF O;  3VQP A;  4FLT A;  4H4O A;  3DXK B;  4NLB A;  3KD1 E;  4E7I A;  1NGG A;  3I33 A;  4BRA A;  5HOO A;  3CCE N;  1YJN N;  2QWP A;  1U6Z A;  4DKW A;  4IFY A;  2GUP A;  2RN2 A;  4DSF A;  4BVO A;  1VQ7 N;  4IJN A;  3SQ2 A;  3ZT1 A;  3AAR A;  4CK3 A;  3BF3 A;  3VEZ A;  3TTF A;  3J81 O;  3RRH A;  4BRL A;  4DFK A;  4YOR A;  4CHO A;  4B08 A;  3U3Y A;  3QIP A;  2QWQ A;  4QS8 A;  3VA0 A;  4MDB A;  2XY8 A;  2Q31 A;  1SL2 A;  4DUZ K;  4ILJ A;  4MO5 A;  3ATU A;  1HNZ K;  1BCM A;  4KHP K;  1QZ6 A;  4YNQ A;  5EY4 A;  3F9K A;  4H5N A;  5BPM A;  3R3L A;  5FRO A;  4KH6 A;  4DR1 K;  4KFB A;  4PWD A;  3SBG A;  3CCJ N;  3CIP A;  3W0L A;  4FJ5 A;  3KLI A;  2RF2 A;  1VQ9 N;  1W0H A;  4ID1 A;  3K9J A;  4E1M A;  3O80 A;  2KKZ A;  3NGY A;  5AQL A;  4B3R K;  4K42 A;  5FLX O;  4AHU A;  1NJZ A;  1BI4 A;  1QQN A;  1VSH A;  4CEQ A;  4ILH A;  1IV0 A;  5AQJ A;  4AHS A;  1HNX K;  1NGA A;  1RDC A;  4YHH K;  1EX4 A;  1P8Z A;  2P9S B;  1XWL A;  2UYT A;  3CJC A;  1M1K O;  1I94 K;  4JKG B;  4F9O A;  2X78 A;  1Q9X A;  3VN5 A;  3PO4 A;  5HRS A;  1S6P A;  4I6M B;  3VEV A;  5JVG L;  4RWT A;  4PUO A;  4F8R A;  3VF6 A;  4CJQ A;  1VRU A;  3D6R A;  4NXN K;  2GWK A;  4Y1C A;  3JAM O;  4IKF A;  5AQF A;  3CQY A;  4BRK A;  3O3F A;  4J2E A;  4H03 B;  3AVH A;  2X6N A;  1N6Q A;  5GIN A;  1JXB A;  4GMJ B;  4JI8 K;  5J2Q A;  4EAH D;  2O4G A;  2IAJ A;  1NGE A;  3V1Q A;  3EZW A;  4FJL A;  1NGI A;  2P9U A;  1T44 A;  3R9P A;  3QEW A;  4JHD A;  1TAQ A;  1R59 O;  3ZSW A;  1RBS A;  4OLB A;  4A5B A;  2WTU A;  3THY A;  3RR8 A;  4Z4F A;  4BG8 A;  2WON A;  4JI5 K;  1QHA A;  1VSE A;  4H5V A;  2QI2 A;  4B8C A;  1HNI A;  3SJJ A;  5AQN A;  2NRW A;  4CJ3 A;  2O8C B;  4KHS A;  2HHW A;  4M7X A;  2QWM A;  1KXP A;  5JLH A;  4E7L A;  4CJT A;  1JLQ A;  3E9O A;  3MED A;  3MXI A;  3IKM A;  3KTQ A;  3KZB A;  2Q1N A;  4DFP A;  3OYI A;  2P9P B;  4B1Z A;  3AVI A;  3RTV A;  5KQ8 A;  4YDU A;  4DTS A;  1Z26 A;  2HBM A;  2WFB A;  3V1R A;  1VSK A;  3KHY A;  4CZJ A;  2XY5 A;  4KRE A;  3L8B A;  3TTC A;  3RSE A;  1B92 A;  3VES A;  1BOT O;  3EN9 A;  3CJ7 A;  3WNE A;  2QTD A;  2YCH A;  3BZC A;  3CC7 N;  4NLC A;  4HVJ A;  2QK9 A;  1HJO A;  3VA3 A;  2G8W A;  4DQ8 A;  4B9M A;  4N41 A;  2KW4 A;  2HVH A;  2OTJ N;  3PO5 A;  1X9S A;  3SAF A;  1X1P A;  3KJV A;  3AGR A;  4JI2 K;  1RNH A;  4O8K A;  4CJ5 A;  2ETJ A;  4M3Y A;  1HYZ A;  1EET A;  2G8H A;  4BQL A;  1E3M A;  3TSQ A;  4I9Q A;  1RCH A;  1GOB A;  1HX1 A;  4HTL A;  3L2R A;  5FPE A;  3FZM A;  1JKH A;  3NCI A;  3OYE A;  4WQ4 A;  1ITG A;  4YOX A;  3CCV N;  3ZLJ A;  2XY7 A;  2LSN A;  4BR9 A;  4JKH A;  4FK4 A;  4DR2 K;  1LWC A;  1HYS A;  4DMN A;  2ASP A;  4FVU A;  1VSJ A;  3UKR A;  4DQQ A;  3G25 A;  1LWE A;  2NRH A;  5AQS A;  1Q18 A;  4ID5 A;  1SKW A;  1T03 A;  3QLH A;  3TR8 A;  3LZJ A;  1VQ5 N;  4DF8 A;  1JCF A;  4FWO A;  1GLD G;  2EWS A;  3OYG A;  3K0S A;  3V4I A;  1K8K B;  4DR4 K;  1S1T A;  4O4G A;  4FW2 A;  1K73 O;  3PIP L;  3GG4 A;  4B3S K;  5BRD A;  3OBY A;  4RW8 A;  2D0C A;  2JWL A;  3DRP A;  4BC2 A;  5KRT A;  4CCH A;  4KHW A;  2V7Y A;  1R0A A;  3THV A;  4FJM A;  1WSG A;  1J54 A;  1Z05 A;  1GLF O;  3T7Z A;  3TSP A;  3WEE A;  4H5W A;  3RMD A;  1HJR A;  2HBL A;  3HI0 A;  5AQU A;  4PHT X;  4HCB A;  1Q86 O;  3A5L C;  5FPM A;  3N4Q A;  4DUY K;  5F1X A;  4FM2 A;  4E7H A;  1KLM A;  3E66 A;  2P9K A;  1QSL A;  4CI6 A;  1HQE A;  1KVC A;  5CHI A;  2O8D B;  3L4I A;  4KAZ A;  5FRN A;  1YIT N;  4KHU A;  4QOZ B;  3UIQ A;  1Q7Y O;  3JSM A;  4X62 K;  3OS0 A;  1RDW X;  2G8V A;  1T6D A;  3QB0 A;  3O1W A;  4BR5 A;  5F0X A;  2QM1 A;  3E01 A;  4CJ7 A;  1TKD A;  1Q9Y A;  1G99 A;  5AQQ A;  4JI1 K;  4KTZ A;  1GOC A;  4GW6 A;  1NK5 A;  4A57 A;  3RRG A;  4EZ6 A;  2F7T A;  2BDP A;  3QIN A;  3LPT A;  4G9Z A;  2AJQ A;  3OYK A;  5AQR A;  3M1F A;  2CGJ A;  3SV4 A;  4NB4 A;  2D0B A;  1VQ4 N;  1C1C A;  4LD0 A;  4DQR A;  3NF9 A;  2HF3 A;  3LP1 A;  4BRI A;  4PKI A;  4BC3 A;  2IS3 A;  4FWK A;  1SKS A;  1JLE A;  4HUG A;  2CGK A;  4HUE A;  3SPY A;  1RT6 A;  2E2O A;  3R1X A;  4KH4 A;  5A2Q O;  2ZWH A;  3SUQ A;  4I7F A;  5AQG A;  2FXU A;  4A61 A;  4M3R A;  1UA0 A;  4QS7 A;  4ILG B;  4BGB A;  1NK9 A;  1V4T A;  2F9W A;  3VGK A;  3BZK A;  4AHV A;  4MFB A;  1Q8I A;  1NGD A;  3UE5 A;  5C25 A;  3VER A;  4KTW A;  4OLA A;  1J5O A;  4CJS A;  3AV9 A;  3SMP A;  4H0X B;  2YX6 A;  4JAX A;  1U47 A;  5KGX A;  3HO1 A;  3O8M A;  4CE9 A;  3OW2 M;  5HP1 A;  3ITH A;  3EEQ A;  3OYD A;  1IG9 A;  4J2B A;  3CPW M;  1HPM A;  1HPZ A;  1SL0 A;  4B1X B;  3ASM A;  1RDD A;  1JLA A;  3VQ6 A;  1SS6 A;  4A59 A;  3OBW A;  4YOW A;  2Q0R A;  2VQF K;  1YHQ N;  2D1K A;  2WUS A;  3C7N A;  4BC4 A;  4JRQ A;  1C0F A;  5TKY A;  2ZJP L;  5AQV A;  4PKH A;  3VF2 A;  2DFH A;  4KKO A;  4W5N A;  1C0M A;  1SKR A;  3O3G A;  2Y1J A;  4CHN A;  1IKW A;  4DQP A;  4CGI A;  4JN4 A;  4OPJ A;  2FSN A;  1YTU A;  1NG9 A;  1EP4 A;  3DJC A;  4JKC A;  3PX0 A;  5D3G A;  4YOU A;  3S3M A;  1KD1 O;  5AZI A;  1VQN N;  4DR6 K;  1LWF A;  2VYP A;  1RIL A;  3QEI A;  1EO1 A;  4YFU A;  1NJI O;  3T1H K;  2B6A A;  3JYT A;  1S72 N;  3UKU B;  3CYM A;  4YDU C;  3MDQ A;  1FJG K;  3U9D A;  2ATQ A;  4JNE A;  5AQI A;  1IBL K;  2UXD K;  2GEL A;  3HPH A;  1ZBS A;  1N36 K;  1Z25 A;  5IWA K;  3ULD A;  4ISF A;  3HST B;  2PY5 A;  4BRP A;  1NJW A;  5CZ1 A;  3ZSZ A;  3D2F A;  1WLJ A;  1U4B A;  4JKE A;  1TKT A;  4E89 A;  4CGG A;  4W5T A;  1WAF A;  4OGC A;  1IO2 A;  3H46 O;  1TKX A;  4FPB A;  1U04 A;  4FJN A;  3PSI A;  3BF1 A;  2GWJ A;  3AO1 A;  5KI6 A;  4H0O A;  3THW A;  2W6K A;  4U7B A;  4ELU A;  3LDQ A;  5KPT A;  2CH6 A;  5BPN A;  3GOI A;  5AQH A;  2A41 A;  3D2F B;  4WQ4 C;  1OH6 A;  4JI4 K;  1A5X A;  2HND A;  3FZL A;  3OS1 A;  5LMU K;  5DM6 L;  5AZJ B;  3JXU A;  3QO9 A;  1XQS C;  3QIO A;  3K59 A;  1KRP A;  1LCU A;  4B9V A;  2ZJR L;  1BIZ A;  5BPL A;  1BL3 A;  2E6M A;  1X3N A;  2NRX A;  5LL6 Z;  2RPI A;  3SNN A;  1KQS M;  3VEN A;  4F3T A;  5FRM A;  1BUP A;  4FJH A;  2IVN A;  1N8R O;  3CXC M;  1NBW A;  4R79 A;  3D2E B;  3SPZ A;  4BY9 C;  3OY9 A;  2E1Y A;  4NCB A;  3K5L A;  4DTR A;  4CF0 A;  3CET A;  1GLA G;  3IUC A;  1ZBI A;  2GEM A;  2YKN A;  4XIU A;  5AFU A;  2P5G A;  4B9T A;  1VSF A;  3P31 A;  4MLH A;  4EIA A;  3ENO A;  3ZT0 A;  3C65 A;  3CCM N;  4F4K A;  3TAG A;  1U2V A;  5KTQ A;  2G8I A;  3G6E N;  3L0Q A;  2Q36 A;  3QNO A;  3WT0 A;  1ATS A;  4YOY A;  2VGM A;  3M5R A;  3P4I A;  3CCR N;  2I7N A;  4LSN A;  4KO0 A;  4DTO A;  1BHL A;  1KVB A;  2DTU A;  3LAN A;  5E84 A;  3M8S A;  3TAQ A;  5EOY A;  4CF2 A;  3TU5 A;  3C6T A;  5BRF A;  3VF4 A;  3FE1 A;  3V81 A;  1IBM K;  1HUX A;  4JKD A;  3HSC A;  5K14 A;  1RT4 A;  1RFQ A;  4OVL A;  1LV5 A;  2HHT A;  1HNW K;  5JMV A;  3DXM B;  3VQ7 A;  2O8E A;  1TYQ B;  4CJ4 A;  2KHO A;  2OPP A;  2NLX A;  4FLW A;  1MWM A;  3AY9 A;  2HHS A;  2G8K A;  1QQO A;  4JK8 A;  2FBY A;  3H3N O;  4DTP A;  5JIC A;  5BN8 A;  2P1J A;  2Q3S A;  4CJW A;  1UAX A;  4B8A B;  1EWQ A;  2XHB A;  2ZD1 A;  3H3O B;  3RMC A;  3MN6 A;  4X65 K;  3VQ5 A;  4LF4 K;  1A5W A;  4ISG A;  1VSL A;  4FWM A;  2A1S A;  3LZI A;  2OZS A;  3EO3 A;  3C94 A;  2YNH A;  3AA3 A;  2YHX A;  3AO3 A;  3OYB A;  1BIU A;  1Z6R A;  2E20 A;  4M3T A;  4KHQ A;  4FOI A;  3CJA A;  3VEY A;  4FOE A;  4CJE A;  3CQ8 A;  1WUA A;  2NNW A;  3ENB A;  4CJV A;  4DTN A;  4DR5 K;  3ZET B;  3VQQ A;  3DOK A;  4FLY A;  3OVN A;  1SV5 A;  2JWK A;  1BQM A;  3ATV A;  4CBW A;  4Z0U A;  4CEO A;  4KHY A;  4CBX A;  4I2Q A;  4CBU A;  1S5J A;  5BR8 K;  2R7Y A;  4JS4 A;  4FSV A;  4JS5 A;  5M1O A;  3DLR A;  3CD6 N;  3FLC O;  3EE9 A;  4PL8 A;  3HOS A;  1Q82 O;  4XH1 A;  2D0P A;  5E41 A;  3BDP A;  4H0P A;  4DQI A;  3S3N A;  4M42 A;  2YNI A;  3GL1 A;  2XY6 A;  2VQE K;  1S22 A;  5TKW A;  2O8B A;  3AVJ A;  5BR9 A;  3VEW A;  3KLE A;  4N56 A;  3VQC A;  3SUN A;  4KB0 A;  4CZM A;  3BY5 A;  1WB9 A;  1ATR A;  2QWN A;  2W42 A;  2P9N A;  5GAD P;  4IOC L;  3KKS A;  5BRH A;  3ZT2 A;  5GAE P;  5KGW A;  4XH4 A;  2FBV A;  4KI4 A;  3B8A X;  4F2S A;  2E8A A;  2IC3 A;  2YHY A;  4RW7 A;  5HRP A;  4BRN A;  3NF7 A;  3HZ6 A;  5LY3 A;  1QSS A;  4GV3 A;  5I3U A;  4YY3 K;  1HYV A;  1P90 A;  4M3W A;  3QET A;  4DV0 K;  3MCP A;  1TL3 A;  1YVN A;  3K9K A;  3VET A;  3DOL A;  1T05 A;  4IOA L;  4JYA K;  3ULE A;  4K0K K;  3MK6 A;  1IKY A;  3HPG A;  4W5R A;  4NO7 A;  4A5A A;  3FGU A;  1Q81 O;  1BI4 B;  4M3Z A;  3GBT A;  1LAV A;  1DTQ A;  3DMJ A;  1S6Q A;  4LC9 B;  2DY4 A;  3R6M A;  1I39 A;  3L2U A;  3CCS N;  1U45 A;  4FWN A;  4BRQ A;  4IFE A;  3FFK B;  1ILY A;  1RDU A;  1QS4 A;  1VK0 A;  4KB1 A;  4LFB K;  2HHU A;  1J6Z A;  4FWR A;  3J8A A;  1KSP A;  2PZS A;  3MWT A;  1RGI A;  2NRT A;  4I9L A;  3GDQ A;  2ZGY A;  4B1W B;  4BWJ A;  4DTM A;  4FZY A;  5CY4 A;  1VAZ A;  3MMV A;  1UA1 A;  2RE2 A;  3KK3 A;  2BE2 A;  4L3Q A;  3I0R A;  1BCO A;  3IAY A;  2YHW A;  1IBK K;  2GX9 A;  4MLE A;  3WNF A;  3I55 N;  3WUH A;  1ESV A;  2BGG A;  5I42 A;  4WE1 A;  1SZ2 A;  4JLH A;  3OS2 A;  1D9D A;  2YJE A;  2F96 A;  4FXD A;  3J80 O;  2P9U B;  4DV5 K;  3WNG A;  4BG9 A;  3ZT3 A;  4FLZ A;  4JHD B;  4IO8 A;  5CYQ A;  3I8D A;  4LF7 K;  1NMD A;  3VGM A;  4LH4 A;  3THY B;  3P83 D;  1KLN A;  1VSD A;  3K58 A;  2VG5 A;  4IDK A;  1C0G A;  5F2R A;  1NGJ A;  1NNE A;  4CHY A;  4ZHR A;  4HHT A;  4B9L A;  2ITG A;  3DLG A;  3DLE A;  4IG0 A;  4C8N A;  4C8K A;  1TL1 A;  1BA0 A;  3ZCM A;  4BE2 A;  4DS5 A;  3ZEU A;  1S3X A;  2HB5 A;  1FW6 A;  4MO4 A;  1DGK N;  3CJ1 A;  2HMI A;  4RTF D;  2P9L A;  3KIO A;  2Q0U A;  4CF9 A;  3O4Q A;  3RSE B;  4BRF A;  3B6O A;  4CIG A;  3HJF A;  3A5O C;  2HBK A;  1VQK N;  3EY1 A;  4E7J A;  1DKG D;  1N32 K;  3HP6 A;  4BDY A;  3Q7B A;  1KC8 O;  4KHN A;  4Q0B A;  3G4S N;  3IMX A;  3QEV A;  3SUP A;  3DRR A;  4CJP A;  4FLU A;  2ZGZ A;  4KV8 A;  2Q2R A;  4BRC A;  1WBB A;  4Q5V A;  3O4N A;  3ZSR A;  4CZI A;  2PBD A;  2OTL N;  2VG6 A;  3LPU A;  3A8Y A;  3A5N C;  3O08 A;  4BRG A;  3TAP A;  1GLJ O;  1C1A A;  3ZSQ A;  1D4X A;  5AQZ A;  2KTQ A;  1EQY A;  4DV2 K;  3SAG A;  5BRE A;  4LSL A;  1BA1 A;  1WAJ A;  3KWG A;  1KVA A;  4JV5 K;  1UWB A;  4DS4 A;  1WSI A;  2UXB K;  5AR0 A;  1CLQ A;  3DLH A;  3IFR A;  4JD2 A;  3SQ4 A;  3AO5 A;  1DT9 A;  3N4P A;  3D7E O;  4BC5 A;  1JL2 A;  3B6P A;  3UKR B;  1XI1 A;  3F73 A;  1JLG A;  3RMB A;  5M1P A;  1L3U A;  5AQK A;  4FM0 A;  3LM2 A;  4JK9 A;  4DU1 A;  4JK7 A;  3CCL N;  3HOT A;  2HW3 A;  5J1E A;  1JLB A;  1RTI A;  1ZXO A;  2D4W A;  3CF5 L;  1TK5 A;  4LF8 K;  3NMU A;  4FLX A;  4CGJ A;  3DLB A;  1JXE A;  1EWR A;  2E4L A;  3AVL A;  1XHX A;  1HMV A;  4K8Z A;  1N5Y A;  3KK1 A;  3EKS A;  1HR0 K;  3W3D A;  1NKC A;  3M6G A;  3WEE B;  2JLE A;  5CR4 A;  3CC2 N;  1S9G A;  4O5B A;  3SJH A;  5ELZ A;  1YT3 A;  2I7P A;  4ISE A;  2G8U A;  4JKA A;  1HNV A;  2P9K B;  4EP5 A;  3O3H A;  1VQP N;  4HUF A;  4LFC K;  4LY7 A;  1T7P A;  1F21 A;  4XH5 A;  4WFA L;  5J2N A;  5H1S Q;  4IZ9 A;  4FPA A;  3OYH A;  2E2P A;  1JCG A;  3NHG A;  3OYF A;  4DFM A;  1QTM A;  3QFP A;  4FJI A;  3L2W A;  2OPR A;  3LDP A;  4DSL A;  4QCL A;  3SQ0 A;  4DQS A;  4C1N I;  1NKB A;  4OPK A;  4CK2 A;  4PY5 A;  3SK3 A;  3CC4 N;  3PX6 A;  4H0T B;  4Y1D A;  4E0D A;  3VQ4 A;  3HL8 A;  2O8F A;  4O0I A;  1LW0 A;  3V1O A;  4DV7 K;  4H0Y B;  4XEI A;  1KFD A;  2P9I A;  5M1K A;  2IGI A;  3ZX0 A;  4DHY A;  3OYA A;  3I0S A;  1HRH A;  4M3X A;  2F4V K;  4A62 A;  2W6L A;  3AVG A;  1GLC G;  3MEG A;  3CCU N;  1KFS A;  1JCE A;  4I2P A;  4IO9 L;  1EKE A;  1NK6 A;  3MEE A;  3D45 A;  3VPZ A;  1YVU A;  2QKB A;  3G10 A;  1TKZ A;  3C6H A;  4E7K A;  2P9I B;  5T7B A;  1GOA A;  5M1F A;  3LP2 A;  4WF9 L;  5SZT A;  5C15 A;  2YHA A;  2Y1I A;  3RR7 A;  1KAX A;  1NK8 A;  4GVE A;  4FO0 A;  4UQG A;  3TWH A;  3ZX2 A;  1TUY A;  4CJR A;  4OX9 K;  1XMQ K;  4E1N A;  4H0V B;  1WNS A;  1NMN A;  1Y64 A;  5AQM A;  4CER A;  2OA8 A;  3IS9 A;  2EHG A;  4FZX C;  3HVT A;  2FLO A;  4M3U A;  1QZ5 A;  3DAW A;  3TAB A;  4FJK A;  3L2Q A;  4AIL C;  3MXM A;  3QML A;  3TPQ A;  4PA1 A;  1BG3 A;  5J2M A;  3M3Z A;  3RMA A;  1S9E A;  2WOM A;  3C7N B;  4W5Q A;  1W7A A;  4CFA A;  1QE1 A;  1XNQ K;  4JI3 K;  5GAG P;  3SMS A;  1NU0 A;  1N33 K;  2NRV A;  4B3O A;  4U67 L;  5JS1 A;  5ADX H;  2RHK A;  2X74 A;  3NGI A;  1GLL O;  3SLC A;  2PYL A;  4GVM A;  3H1V X;  4DLG A;  3T3F A;  2UUB K;  3S41 A;  1UOC A;  3ZSY A;  3WQU A;  3NE6 A;  1NM1 A;  5AZI B;  3V9U A;  1BO5 O;  1S1V A;  2ASO A;  1VRT A;  3U4L A;  2QXL A;  3V9S A;  4FJ8 A;  4IFV A;  3HPO A;  4B1V A;  3JS6 A;  5MLC Q;  2KFZ A;  3OYN A;  2XRI A;  1KCF A;  3VQ8 A;  4CJK A;  3J7Y P;  4A2A A;  4JI6 K;  2A3Z A;  4FVM A;  3MN9 A;  1QQC A;  4C8M A;  4GNI A;  3O5B A;  3EZ5 A;  5C42 A;  4MQ3 A;  4ZTF A;  2KZM A;  1T3V A;  2VWJ A;  1DEJ A;  4IBN A;  3FFI A;  3NH0 A;  4HWI A;  1SQK A;  3QEX A;  4LF6 K;  4CEE A;  3L4Q A;  1X9J A;  2CH5 A;  4X64 K;  4Z4C A;  3THW B;  1REV A;  3AVA A;  3I56 N;  2KFN A;  3AAQ A;  5AJ3 K;  5JS2 A;  2E5L K;  3IG1 A;  4H5T A;  3KLH A;  1FKO A;  2VWK A;  5HL7 L;  1NGC A;  2ZE2 A;  4N76 A;  5KRS A;  3C6U A;  4CF8 A;  2HHH K;  2QWR A;  2FSJ A;  3LAM A;  3S9H A;  2E2N A;  4CEF A;  4BAC A;  2DPN A;  3O4W A;  4FJJ A;  3T1A A;  3M8Q A;  1NGH A;  4BQZ A;  1KAY A;  4C8O A;  4FWS A;  4CZG A;  4Z4I A;  3A5M C;  1ASU A;  3PSF A;  4WYB A;  1W9H A;  4BGA A;  1VQM N;  3OHR A;  3HP9 A;  1L3T A;  4FWP A;  4DSE A;  1WBD A;  2PFU A;  1X9W A;  1O1W A;  1WSH A;  2VGN A;  4DWI A;  1WSJ A;  4CED A;  1GLB G;  1QQM A;  3F5T A;  3VMF B;  5KQD A;  1JLF A;  2EX3 A;  3MEC A;  3AA5 X;  4IJA A;  4C23 A;  3CJ9 A;  3KKR A;  4DF4 A;  1C6V A;  3UB5 A;  4OKE A;  3IRX A;  4FJ7 A;  4CK1 A;  3NF8 A;  3AVK A;  3ZX3 A;  3R8E A;  3CME N;  4FJG A;  4NYF A;  4CW7 B;  2UU9 K;  1U2V B;  3FZF A;  3THX A;  1B9F A;  4Z94 A;  4AM7 A;  4E3S A;  2YHB A;  2D0O A;  1YI2 N;  3OTO K;  1XNR K;  1BQN A;  2E88 A;  3CER A;  4DV4 K;  2WBN A;  1BGX T;  3J7Z O;  3K57 A;  4OJR A;  4E1J A;  1LOT B;  3G0Z A;  1YJ9 N;  1IH7 A;  1C0T A;  1NJX A;  4BDZ A;  4IEI A;  5CZ2 A;  2IIR A;  4J2A A;  2HVI A;  5FPN A;  4H8K A;  3P5J A;  2NRR A;  4LF5 K;  3WXK A;  4E19 A;  1K6Y A;  2O8E B;  3L3U A;  3KK7 A;  2J4R A;  3AVB A;  4JRP A;  4KBO A;  3TAN A;  3LP3 A;  4AHT A;  1TVR A;  3QIC A;  3OJU A;  3PX4 A;  3A2F A;  5B8H A;  1MA9 B;  2HMP A;  3CPE A;  1TK0 A;  4O55 A;  3DXK A;  5LMN K;  4J8F A;  1RT5 A;  2YI1 A;  1SAZ A;  4QAG A;  3ZT4 A;  2ZJQ L;  1RDA A;  2HHV A;  2NZT A;  4BR2 A;  3CM6 A;  3E9P A;  2HST A;  3CFP A;  1WSE A;  2QXF A;  1H1V A;  1YAG A;  3ZSX A;  1JJ2 M;  3CI5 A;  3P38 A;  3AVN A;  3ZYY X;  2HHQ A;  3GE1 A;  4HTU A;  3HT3 A;  3NFA A;  1A5V A;  3VQ9 A;  1QHT A;  3QBW A;  4OKK A;  1NJY A;  1WSF A;  3K5O A;  2WC9 A;  2F8S A;  2NUB A;  4CGF A;  3V9W A;  4DTU A;  3CG7 A;  3F9M A;  1OVY A;  3CM5 A;  2YKM A;  4M7Y A;  5FDL A;  2W40 A;  1S1U A;  1RBR A;  2BAN A;  1DLO A;  1RTD A;  3O1B A;  1E4F T;  4FWQ A;  1OH5 A;  3EYZ A;  3NDK A;  4UY8 O;  4C8L A;  5DK5 A;  4BE1 A;  2V51 B;  5I9E B;  1NKE A;  2ITM A;  1QVG M;  4W5O A;  3K5M A;  1FK9 A;  4Z4E A;  5SWM A;  5EU7 A;  3HM9 A;  2O8B B;  3ISN C;  2OPQ A;  2AP1 A;  1C1B A;  1YF5 L;  4EFH A;  1FXX A;  2KLA A;  3MN5 A;  3O9R A;  4JI0 K;  1TAU A;  2YV0 X;  5DM7 L;  4DB3 A;  4JKB A;  4YOT A;  4C1N K;  1WN7 A;  5DMR A;  5GIP A;  2P9N B;  3WXL A;  1B9D A;  1RT3 A;  2HBJ A;  3QFU A;  4RW9 A;  2B4J A;  3VTI A;  2A1R A;  4CGD A;  5AQT A;  3DI6 A;  2P9S A;  3LWL A;  4JKG A;  3ENH A;  4I6M A;  2HOE A;  3M8P A;  4EZ9 A;  2PAV A;  3O9Q A;  2DFF A;  4GKJ K;  4KPY A;  4O5F A;  4DR3 K;  1K8A O;  3ULE B;  1RBV A;  4EHU A;  4DU4 A;  3CFO A;  3HK2 A;  4PQU A;  4AQY K;  4B9N A;  1OH8 A;  3PIO L;  4EHT A;  4DSK A;  3AVC A;  4GKK K;  2UXC K;  1TK8 A;  4CD3 A;  4KRF A;  2OPS A;  2V7Z A;  3QES A;  4B3T K;  2HF4 A;  3HYF A;  1BU6 O;  4CEB A;  5JLF A;  3ID8 A;  4CHP A;  3T1Y K;  1YUW A;  1OH7 A;  2GBZ A;  1U49 A;  2HHX A;  3OYM A;  4Z4H A;  1RDB A;  2QWO A;  1RT1 A;  4WFB L;  1QVF M;  5HBM A;  3MWP A;  3TAM A;  4AM6 A;  2A6A A;  4RW4 A; 
#chains in the Genus database with same CATH homology
 4O5B A;  3TI0 A;  3MXJ A;  1YT3 A;  2G8U A;  1CXU A;  1D5A A;  1LAW A;  1Z25 A;  3ULD A;  3HST B;  5C24 A;  2PY5 A;  1HNV A;  1NJW A;  5CZ1 A;  4EP5 A;  3O3H A;  3ZSZ A;  4HUF A;  4LY7 A;  1T7P A;  5J2P A;  3V9Z A;  1WLJ A;  1F21 A;  4KI6 A;  1U4B A;  3VQP A;  4FLT A;  5J2N A;  1TKT A;  4E89 A;  4CGG A;  4W5T A;  4H4O A;  1WAF A;  4OGC A;  1IO2 A;  3SV3 A;  3OYH A;  1NOY A;  1TKX A;  3KD1 E;  1U04 A;  4H4M A;  4E7I A;  4FJN A;  4CEC A;  3AO1 A;  5KI6 A;  3DYA A;  4G1Q A;  3NHG A;  4RG8 A;  3VQB A;  3OYF A;  4DFM A;  2RKI A;  3AA2 A;  4CFC A;  1QTM A;  4FJI A;  4IFY A;  2PYJ A;  3L2W A;  2RN2 A;  3NAE A;  4DSF A;  4ELU A;  2OPR A;  3IAY A;  4DSL A;  4QCL A;  3SQ2 A;  3SQ0 A;  3ZT1 A;  4CK3 A;  4DQS A;  4NCA A;  1A5X A;  2HND A;  4FW1 A;  3OS1 A;  1NKB A;  3RRH A;  4OPK A;  2HNY A;  4CK2 A;  4PY5 A;  4N5S A;  4DFK A;  4CHO A;  4B08 A;  3QO9 A;  3U3Y A;  3QIO A;  3K59 A;  1KRP A;  3QIP A;  3U6F A;  4CF1 A;  3PX6 A;  4Y1D A;  4B9V A;  1NK7 A;  4FJX A;  2ZQB A;  2P5O A;  4E0D A;  3QEP A;  1BIZ A;  3VQ4 A;  3HL8 A;  4O44 A;  1BL3 A;  2E6M A;  4N47 A;  2XY8 A;  1LW0 A;  3V1O A;  4O0I A;  1SL2 A;  4LH5 A;  1KFD A;  3LDS A;  2IGI A;  1VSM A;  2RPI A;  3SNN A;  3OYA A;  3I0S A;  1HRH A;  4M3X A;  4F3T A;  1BCM A;  5FRM A;  4BE0 A;  1L3S A;  4YNQ A;  1X9M A;  4FJH A;  3F9K A;  4IG3 A;  3AVG A;  2FBX A;  3MEG A;  1KFS A;  4I2P A;  5FRO A;  4KFB A;  4FJ9 A;  1EKE A;  3LWM A;  4PWD A;  1NK6 A;  4F2R A;  3MEE A;  3D45 A;  4OGE A;  1IKV A;  3SPZ A;  1YVU A;  2QKB A;  4FJ5 A;  3G10 A;  1TKZ A;  3OY9 A;  3KLI A;  4NCB A;  4DLE A;  3K5L A;  4E7K A;  4DTR A;  5T7B A;  1L3V A;  2O4I A;  1J53 A;  2RF2 A;  4CF0 A;  1GOA A;  1W0H A;  3LP2 A;  4ID1 A;  1ZBI A;  5SZT A;  4E1M A;  2YKN A;  4XIU A;  2P5G A;  1CXQ A;  2YHA A;  3NGY A;  1VSF A;  4B9T A;  3CFR A;  2Y1I A;  3RR7 A;  1NK8 A;  3LP0 A;  3NBP A;  3ZT0 A;  4AHU A;  4CJR A;  4UQG A;  1NOZ A;  3TWH A;  1NJZ A;  4E1N A;  4F4K A;  1BI4 A;  3TAG A;  5KTQ A;  1VSH A;  4CEQ A;  2G8I A;  3LAK A;  1WNS A;  1KTQ A;  4AHS A;  4CER A;  3QNO A;  3K5N A;  3IS9 A;  3NH1 A;  2OA8 A;  2EHG A;  1RDC A;  1EX4 A;  4FZX C;  1XWL A;  3HVT A;  4KO0 A;  4LSN A;  4DTO A;  4M3U A;  1BHL A;  1KVB A;  2DTU A;  2X78 A;  3LAN A;  1Q9X A;  3M8S A;  3TAQ A;  3VN5 A;  3PO4 A;  4CF2 A;  4F3O A;  3DRS A;  3TAB A;  5HRS A;  1ASW A;  1S6P A;  4FJK A;  3C6T A;  3L2Q A;  4DTX A;  4AIL C;  3MXM A;  4PA1 A;  3V81 A;  4Z4F A;  1RTH A;  5J2M A;  4PUO A;  3RMA A;  1S9E A;  4F8R A;  4CJQ A;  3ALY A;  1VRU A;  2WOM A;  3OYL A;  2IOC A;  4W5Q A;  5K14 A;  1RTJ A;  4CFA A;  1QE1 A;  1RT4 A;  4OVL A;  4Y1C A;  4IKF A;  1LV5 A;  2HHT A;  3O3F A;  4B3O A;  3VQ7 A;  5JS1 A;  4J2E A;  2X74 A;  3NGI A;  4CJ4 A;  2I5J A;  2OPP A;  3AVH A;  2X6N A;  2B5J A;  4GVM A;  1N6Q A;  2PYL A;  4DLG A;  3T3F A;  1JXB A;  4FLW A;  4GMJ B;  3ZSY A;  1UOC A;  4R5P A;  5J2Q A;  2G8F A;  2G8K A;  4BDP A;  2HHS A;  2FBY A;  2O4G A;  3NE6 A;  1XHZ A;  2KZZ A;  4DTP A;  2IAJ A;  3V1Q A;  3V9U A;  2P1J A;  2Q3S A;  1S1V A;  4CJW A;  4FJL A;  3VQD A;  1VRT A;  1UAX A;  3OYN A;  4B8A B;  3V9S A;  2XHB A;  2JGU A;  4FJ8 A;  2ZD1 A;  4IFV A;  3QEW A;  3HPO A;  3RMC A;  1TAQ A;  3VQ5 A;  1A5W A;  3DM2 A;  1VSL A;  1RBS A;  3ZSW A;  2A1S A;  3PV8 A;  3SQ1 A;  4OLB A;  3LZI A;  3RR8 A;  2OZS A;  1ASV A;  3C94 A;  3AA3 A;  2YNH A;  4CFD A;  2XRI A;  1KCF A;  2WON A;  3VQ8 A;  1TV6 A;  3AO3 A;  4CJK A;  1VSE A;  2FC0 A;  4CEA A;  3OYB A;  3C95 A;  3DLK A;  4FVM A;  1BIU A;  4B8C A;  1HNI A;  4CJF A;  1QQC A;  3SJJ A;  4C8M A;  4DTJ A;  4KHQ A;  4M3T A;  1MU2 A;  3EZ5 A;  5C42 A;  4MQ3 A;  4CJE A;  3CQ8 A;  1ZBU A;  2IDO A;  4ZTF A;  2KZM A;  4OKJ A;  1I3A A;  4CJ3 A;  3PUF A;  4KHS A;  2VWJ A;  4CJV A;  4E7L A;  2HHW A;  4IBN A;  2D0A A;  4CJT A;  3KLF A;  3FFI A;  4DTN A;  1JLQ A;  4M41 A;  3NH0 A;  3MED A;  3MXI A;  4Z4G A;  3VQQ A;  3DOK A;  4FLY A;  3OVN A;  3KTQ A;  1SV5 A;  3QEX A;  1BQM A;  2GUI A;  4Z0U A;  3OYI A;  4CEO A;  4DFP A;  4KHY A;  4I2Q A;  1S5J A;  1RBU A;  3AVI A;  4AHR A;  4CEE A;  2R7Y A;  4JS4 A;  4JS5 A;  3RTV A;  4DTS A;  3DLR A;  1Z26 A;  3KK2 A;  4Z4C A;  3V1R A;  1VSK A;  2XY5 A;  4KRE A;  3L8B A;  1B92 A;  1REV A;  4AH9 A;  5E41 A;  3BDP A;  3AVA A;  4FZZ A;  3WNE A;  4DQI A;  4DSI A;  3S3N A;  2KFN A;  5JS2 A;  4M42 A;  2YNI A;  4HVJ A;  2QK9 A;  1JL1 A;  3IG1 A;  3OYJ A;  3VA3 A;  2G8W A;  3KLH A;  1FKO A;  2VWK A;  2XY6 A;  4B9M A;  4KTQ A;  2KW4 A;  4N41 A;  2HVH A;  4B9U A;  2ZE2 A;  3PO5 A;  4N76 A;  3AVJ A;  1X9S A;  1X1P A;  5KRS A;  3C6U A;  3KJV A;  3KLE A;  4CF8 A;  2Z1G A;  1RNH A;  3LAM A;  4CJ5 A;  3S9H A;  2ETJ A;  4CEF A;  4N56 A;  1Y97 A;  3RWU A;  4M3Y A;  1HYZ A;  1EET A;  2G8H A;  3VQC A;  4BAC A;  1VSI A;  3SUN A;  4KB0 A;  1G15 A;  5CYM A;  4TSX A;  4FJJ A;  3T1A A;  3SCX A;  4I9Q A;  1RCH A;  3M8Q A;  1GOB A;  2W42 A;  3L2R A;  4AHC A;  4L8R B;  3KKS A;  3ZT2 A;  5KGW A;  4C8O A;  4FCY A;  2FBV A;  4KI4 A;  4Z4I A;  4F2S A;  1JKH A;  2IC3 A;  4RW7 A;  3NCI A;  5HRP A;  3M8R A;  1ASU A;  3OYE A;  1ITG A;  1W9H A;  3NF7 A;  3HP9 A;  1L3T A;  1ZYQ A;  4NCG A;  4CHQ A;  4DSE A;  1QSS A;  2XY7 A;  2LSN A;  5I3U A;  1O1W A;  1WSH A;  1X9W A;  2QKK A;  4FK4 A;  1HYV A;  4M3W A;  4DWI A;  3QET A;  1LWC A;  1WSJ A;  4CED A;  1HYS A;  1TL3 A;  4DMN A;  1CZB A;  1EXQ A;  3DOL A;  1T05 A;  1VSJ A;  3NGZ A;  1JLF A;  2EX3 A;  3KD5 E;  3MEC A;  1IKY A;  3AA5 X;  3D0P A;  4DQQ A;  3HPG A;  4DF4 A;  3KKR A;  1LWE A;  1C6V A;  4W5R A;  4OKE A;  3IRX A;  4FJ7 A;  2D5R A;  4CK1 A;  3NF8 A;  1SL1 A;  4ELV A;  3AVK A;  1NK4 A;  4ID5 A;  1SKW A;  2VG7 A;  1T03 A;  3QLH A;  3TR8 A;  3LZJ A;  4FJG A;  4NYF A;  1BI4 B;  3MAQ A;  4EP4 A;  4DF8 A;  1QSY A;  4M3Z A;  3OYG A;  1LAV A;  3V4I A;  4FK2 A;  1YTA A;  1B9F A;  1DTQ A;  4CJL A;  1S1T A;  4O4G A;  3DMJ A;  4E3S A;  2YHB A;  4BWM A;  1S6Q A;  2GV9 A;  4FW2 A;  5HRN A;  1XC9 A;  1RT7 A;  2Z1H A;  2DY4 A;  1I39 A;  3L2U A;  1U45 A;  1BQN A;  1DTT A;  2D0C A;  1BGX T;  4RW8 A;  3DRP A;  5KRT A;  4CCH A;  4KHW A;  1QS4 A;  1VK0 A;  2Z1J A;  3LAL A;  4OJR A;  3K57 A;  1R0A A;  4KB1 A;  2HHU A;  4K8X A;  4ZTJ A;  3THV A;  3VQA A;  1KSP A;  3G0Z A;  2PZS A;  4FJM A;  1WSG A;  1J54 A;  1IH7 A;  4CJU A;  4I9L A;  1C0T A;  3HVR A;  2DFE A;  4CHZ A;  1NJX A;  4CES A;  4BDZ A;  3P1G A;  5CZ2 A;  3RMD A;  4J2A A;  2HVI A;  3QNN A;  4H8K A;  1HJR A;  4BWJ A;  3VQE A;  4DTM A;  4FZY A;  3P5J A;  4HCB A;  5CY4 A;  4E19 A;  3QER A;  3KLG A;  1K6Y A;  3L2V A;  3KK3 A;  1UA1 A;  3L3U A;  2BE2 A;  3AVB A;  4FM2 A;  3I0R A;  1BCO A;  1KLM A;  4E7H A;  3L3V A;  4JRP A;  3SYZ A;  4DFJ A;  3TAN A;  1QSL A;  1CZ9 A;  3LP3 A;  4AHT A;  1TVR A;  3OJU A;  1HQE A;  1KVC A;  3WNF A;  3PX4 A;  3SI6 A;  3A2F A;  3AA4 A;  4KAZ A;  2BGG A;  5I42 A;  3TAR A;  5FRN A;  4WE1 A;  4JLH A;  3OS2 A;  1TK0 A;  4O55 A;  1D9D A;  2F96 A;  3NH2 A;  4KHU A;  1RT5 A;  4QOZ B;  4FXD A;  3UIQ A;  4DU3 A;  4QAG A;  3JSM A;  3ZT4 A;  2KFZ A;  3OS0 A;  1RDA A;  2HHV A;  1S1X A;  3WNG A;  2G8V A;  4B9S A;  3ZT3 A;  3PY8 A;  3CM6 A;  4FLZ A;  1RT2 A;  1WSE A;  2QXF A;  3E01 A;  5HRR A;  3CFP A;  1TKD A;  3ZSX A;  1Q9Y A;  4KTZ A;  1GOC A;  5CYQ A;  3I8D A;  4LH4 A;  3P83 D;  3AVN A;  1VSD A;  4GW6 A;  3K58 A;  2VG5 A;  4IDK A;  1NK5 A;  1KLN A;  3RRG A;  4EZ6 A;  2HHQ A;  4HTU A;  2BDP A;  1JLC A;  3HT3 A;  3NFA A;  4CHY A;  4ZHR A;  1NK0 A;  1A5V A;  3VQ9 A;  1QHT A;  3QIN A;  4HHT A;  4OKK A;  3LPT A;  4B9L A;  2AJQ A;  2X6S A;  1NJY A;  1WSF A;  2ITG A;  3K5O A;  3OYK A;  4O0J A;  5HLF A;  3DLG A;  3DLE A;  4IG0 A;  1HQU A;  2NUB A;  4CGF A;  3V9W A;  4C8N A;  4DTU A;  3CG7 A;  2Z1I A;  4C8K A;  2F8S A;  3CM5 A;  2YKM A;  3SV4 A;  1TL1 A;  3V6D A;  1D8Y A;  5FDL A;  2D0B A;  3ZCM A;  1S1U A;  4BE2 A;  2E6L A;  1C1C A;  3AVM A;  4ELT A;  4DS5 A;  1LW2 A;  4LD0 A;  1RBR A;  2BAN A;  4DQR A;  1DLO A;  2HB5 A;  2OZM A;  1RTD A;  3NF9 A;  3LP1 A;  2HMI A;  3KIO A;  3EYZ A;  2IS3 A;  3NDK A;  1L5U A;  1SKS A;  1JLE A;  4CF9 A;  4HUG A;  4CIF A;  4HUE A;  4C8L A;  3K2P A;  3O4Q A;  5DK5 A;  3SPY A;  2KQ2 A;  4NYN A;  1RT6 A;  4BE1 A;  3BGR A;  3SUQ A;  1ZBF A;  3B6O A;  4I7F A;  4CIG A;  3V9X A;  1NKE A;  3HJF A;  4M3R A;  1UA0 A;  4W5O A;  3K5M A;  2XO7 A;  3EY1 A;  4E7J A;  1FK9 A;  3SZ2 A;  3HP6 A;  4BDY A;  4KHN A;  4Z4E A;  5SWM A;  1NK9 A;  5EU7 A;  4Q0B A;  3HM9 A;  3ISN C;  2OPQ A;  3QEV A;  3SUP A;  3DRR A;  4DG1 A;  1C1B A;  4AHV A;  4MFB A;  4CJP A;  1Q8I A;  4FLU A;  1FXX A;  5C25 A;  1RBT A;  4KV8 A;  1TAU A;  4KTW A;  4OLA A;  2YV0 X;  4Q5V A;  1J5O A;  4FLV A;  4CJS A;  3AV9 A;  3O4N A;  3ZSR A;  1WN7 A;  2VG6 A;  3LPU A;  5DMR A;  3U3G A;  5KGX A;  3TAP A;  1U47 A;  3HO1 A;  1B9D A;  1RT3 A;  1C1A A;  2YNF A;  3ZSQ A;  4RW9 A;  2B4J A;  4CE9 A;  2KTQ A;  3HXM A;  4M45 A;  3OJS A;  1C0U A;  5HP1 A;  2A1R A;  4CGD A;  3ITH A;  3SUO A;  3DI6 A;  4FK0 A;  2P51 A;  2F8T A;  3LWL A;  4LSL A;  2HNZ A;  1T8E A;  2YNG A;  1WAJ A;  3OYD A;  1KVA A;  1IG9 A;  4J2B A;  1HPZ A;  1SL0 A;  5HRO A;  3ZSO A;  3AO4 A;  1IKX A;  1UWB A;  4DS4 A;  1WSI A;  3AVF A;  3T19 A;  3ASM A;  3TAF A;  1RDD A;  1JLA A;  3VQ6 A;  1CLQ A;  3M8P A;  4ICL A;  3NF6 A;  3DLH A;  3TAE A;  4EZ9 A;  3SQ4 A;  3AO5 A;  4CFB A;  2DFF A;  4KPY A;  4CEZ A;  1JL2 A;  3B6P A;  1RBV A;  3OYC A;  4J2D A;  4JRQ A;  3S3O A;  4DU4 A;  3CFO A;  3HK2 A;  2FBT A;  4PQU A;  4B9N A;  1XI1 A;  3F73 A;  1JLG A;  2DFH A;  4KKO A;  4CGH A;  3RMB A;  4W5N A;  1L3U A;  1C0M A;  4FM0 A;  1BIS A;  3O3G A;  2Y1J A;  4CHN A;  1SKR A;  1IKW A;  4DSJ A;  4DQP A;  4CGI A;  1FKP A;  4DSK A;  4OPJ A;  1YTU A;  1ZBH A;  3AVC A;  3H08 A;  4DU1 A;  1EP4 A;  3PX0 A;  5D3G A;  1TK8 A;  3ZSV A;  3S3M A;  4CIE A;  4KRF A;  1J9A A;  1LWF A;  1SUQ A;  2HW3 A;  5J1E A;  1JLB A;  2OPS A;  1U48 A;  3QES A;  1RTI A;  1TK5 A;  1RIL A;  3QEI A;  3HYF A;  4YFU A;  4FM1 A;  4CEB A;  4FLX A;  4CGJ A;  3DLB A;  2B6A A;  3JYT A;  1JXE A;  4HCC A;  1D9F A;  4CHP A;  3AO2 A;  2OYQ A;  2E4L A;  3CYM A;  3AVL A;  4RW6 A;  1HMV A;  1XHX A;  4K8Z A;  1N5Y A;  3KK1 A;  4FYD A;  2ATQ A;  2GBZ A;  1ZBL A;  1U49 A;  1TGO A;  2HHX A;  3OYM A;  4Z4H A;  1NKC A;  1RDB A;  1S1W A;  3HPH A;  1RT1 A;  2JLE A;  5HBM A;  3TAM A;  3WNH A;  3VA0 A;  1S9G A;  4RW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...