1UAXA

Crystal structure of the ribonuclease h2 from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MKVAGVDEAGRGPVIGPLVIGVAVIDEKNIERLRDIGVKDSKQLTPGQREKLFSKLIDILDDYYVLLVTPKEIDERHHSMNELEAEKFVVALNSLRIKPQKIYVDSADVDPKRFASLIKAGLKYEATVIAEHKADAKYEIVSAASIIAKVTRDREIEKLKQKYGEFGSGYPSDPRTKEWLEEYYKQYGDFPPIVRRTWETARKIEERFRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uaxA00
3PX0A 3ZSXA 1NK8A 4OKJA 4OLBA 4JRQA 4KREA 4CECA 4HUFA 2YNGA 2I5JA 3HP6A 4Z4IA 2OPRA 4AHCA 4EP5A 4FJJA 4B9MA 2KW4A 4B9VA 4GW6A 5HLFA 4FJ9A 3VQ6A 3AVCA 2DFHA 3VQCA 3HXMA 3QINA 4FJHA 3DYAA 4FM2A 3CFOA 1TK0A 1RBRA 4Z4CA 4CFBA 1RT6A 4FK2A 1ZBFA 3TR8A 3LP3A 2FBTA 3AO1A 2RPIA 1Z26A 5J2NA 3C94A 4M3ZA 3QERA 5E41A 4DQIA 1RBUA 2ETJA 3PX4A 3TANA 1XHZA 4Q5VA 2D5RA 2RKIA 4R5PA 4FK0A 1QSLA 3DLBA 4Z4FA 4QOZB 3VQ4A 4CIGA 4BACA 3LP0A 4Z4EA 2PYLA 4PQUA 1HNIA 1BQNA 2IDOA 1VSJA 3OYIA 1JLFA 1JL1A 3M8RA 3HYFA 2G8FA 2WONA 4KTZA 3QIPA 4FLTA 1VRUA 2VG6A 3PO4A 4LSNA 2Z1HA 1SL0A 4MQ3A 3VQ9A 3QEVA 2OYQA 4FW2A 2A1RA 3MEGA 3RWUA 1JLCA 4M45A 2JLEA 1BI4A 3TI0A 4E89A 3V9SA 3V81A 3B6PA 4E1MA 4BWJA 3S3NA 2XO7A 4CJQA 4PY5A 1ZBIA 1C6VA 3I0RA 3KTQA 2QKKA 3SCXA 1QTMA 1IG9A 3DOKA 4C8LA 3U6FA 4B8AB 1RNHA 4AHSA 3T1AA 2YNFA 3QIOA 4ELUA 1D5AA 2ZQBA 3BGRA 4OVLA 5EU7A 4BE0A 3VA3A 4DTSA 1X9MA 2FBVA 3DM2A 1L3VA 1QSSA 3KKSA 1L3TA 4FJ7A 4E7KA 2IC3A 4B9LA 1C1CA 1NOZA 3NH0A 3OYKA 3T3FA 5KGWA 4CJ4A 1WSIA 5K14A 3KD1E 4EZ6A 4KTQA 3QEIA 4ICLA 3LWMA 1VRTA 2HNYA 3A2FA 3L3VA 1VSIA 1TAQA 2IS3A 4E7HA 3THVA 2NUBA 4Y1CA 3QETA 2GBZA 2Z1GA 4B9NA 2RN2A 1C1BA 1SL1A 2F8TA 4FM0A 4FZZA 5SWMA 1WSHA 3OY9A 4JRPA 2G8UA 4W5TA 3AVLA 4CK3A 4FJLA 1J5OA 5CZ1A 1FK9A 3ZSVA 5HROA 1RT2A 3WNGA 4CE9A 1FXXA 2GV9A 1BI4B 5J2MA 2XY6A 4KKOA 1FKPA 3OVNA 1TKXA 2KZMA 3OYLA 3P1GA 2O4IA 4H8KA 5FROA 4DTPA 4DU4A 3QEXA 3AV9A 3CFPA 4FJ5A 3L2VA 3HM9A 4W5OA 3V4IA 4CEDA 3L3UA 3KJVA 1NKEA 2YHAA 4C8KA 5T7BA 3S9HA 1SV5A 1UWBA 2XY8A 3NF6A 3LP1A 5HRRA 4CGJA 1XHXA 4Z4HA 2BANA 3OYGA 3K5MA 3SV4A 4DS4A 4NCBA 4TSXA 3OYFA 5C24A 4CEFA 4N5SA 4CEBA 3KKRA 1LWCA 1VSKA 1HRHA 4FLWA 1IKXA 5C42A 1WSFA 3NCIA 3RMCA 4DSLA 4H4MA 4E7JA 2BE2A 4DF8A 2D0AA 3AVIA 4AILC 3AVMA 4G1QA 2Z1JA 3TWHA 3KK3A 4DSJA 4CJLA 4JS5A 5FRMA 2LSNA 1RT3A 3TABA 4F8RA 5CYMA 5KGXA 3LWLA 4CJFA 3NH2A 3F9KA 2EX3A 2X74A 2P1JA 3E01A 4FJMA 4W5RA 1Q8IA 5HP1A 3QEPA 3HL8A 1JLAA 4CF8A 4KV8A 4CERA 1WSEA 3PUFA 4UQGA 2OZSA 4KI6A 3LDSA 4E7IA 3M8SA 1NKCA 1SKSA 3ZSRA 3L2RA 3TAPA 1EX4A 1S9GA 2HNZA 4CF0A 3V9XA 1ZBHA 3DLGA 2HHUA 1I39A 1IKWA 4GMJB 1WLJA 3LPTA 4CEEA 3RMAA 2P5GA 4DS5A 4C8NA 4IFYA 2G8IA 4O4GA 3KLIA 4CF1A 3D0PA 3QLHA 1HPZA 4CHOA 1YTAA 4DLGA 3U3YA 3SJJA 2G8VA 2HB5A 4DFMA 2PYJA 3VQ8A 1RT1A 1LAWA 2Y1JA 3L2WA 4GVMA 1CLQA 4DQRA 4CFDA 4KHYA 2FBYA 1C0UA 3WNEA 4DU3A 3OS1A 3IS9A 3SNNA 4I7FA 2ZD1A 4FYDA 4RW9A 1ZBLA 5CY4A 1UOCA 3NH1A 3V1QA 3VQQA 4KHQA 3TARA 4NYFA 4I9LA 3LZIA 2ZE2A 4L8RB 4OGCA 4DTOA 1QHTA 2P51A 4CGFA 1JLQA 4W5QA 4CHNA 4CJ5A 4FZXC 1Z25A 4ELTA 4CK1A 3VQAA 3RTVA 2Q3SA 4AHRA 4XIUA 3KLFA 4IG0A 1VSDA 4LH5A 1NK5A 4F3TA 3V9ZA 3QESA 1NK7A 1RDCA 3ISNC 3QEWA 4W5NA 3V1RA 1REVA 2YNHA 1WN7A 4NCAA 5J1EA 2HW3A 3AVGA 3MEEA 1RDAA 3OYHA 3TAQA 3OYBA 3HVRA 4ID1A 2DFEA 3SQ1A 4DWIA 1X9SA 4M42A 1QQCA 1T05A 3O4NA 3TAFA 2XY7A 4FLXA 4KHNA 3AA2A 1BIUA 1ASWA 3OJSA 3DLKA 3NGYA 1NK6A 4F4KA 4CIEA 1S9EA 3LANA 3HVTA 5DK5A 3WNFA 1HNVA 3NGIA 3AA5X 5J2QA 1U04A 4FJ8A 3K59A 4FLZA 2P5OA 1I3AA 4BDPA 5FDLA 3DOLA 1NK0A 3C95A 4NCGA 1B9FA 2KZZA 1B9DA 1S6PA 1VSLA 3L2UA 4KHSA 3VQ7A 2VWJA 3V6DA 3HSTB 4CCHA 1BQMA 3DLEA 3RMBA 4ZHRA 4YNQA 3AO5A 1LV5A 3IRXA 4HVJA 4DSFA 3HP9A 4QCLA 3AVFA 3VA0A 3NHGA 4Z4GA 3SUOA 4KI4A 4HUEA 2DTUA 2FC0A 1U49A 4CJSA 4J2EA 1GOCA 3OJUA 4OLAA 1NOYA 4CHQA 1ITGA 1XWLA 5SZTA 1RILA 4RW6A 4RW7A 4OKEA 3C6TA 1TKDA 4PA1A 1JKHA 1HQEA 5C25A 1DTTA 2QXFA 3FFIA 2VG5A 2OPSA 3V9WA 2X6SA 1UAXA 5DMRA 1SKRA 2OA8A 1VK0A 1TV6A 1S1UA 3DLRA 3VQPA 2RF2A 3ZT0A 1LW0A 1QS4A 1X1PA 4LSLA 4KB1A 1CXUA 4Y1DA 4YFUA 1NJYA 4DTUA 5JS2A 3K5OA 3RR8A 1NK9A 3DRPA 3SV3A 3RR7A 1WSGA 4OPKA 4ZTJA 1R0AA 4M3TA 3NAEA 3LALA 4K8XA 2Z1IA 2IAJA 3HPHA 3ZT2A 4CJRA 1RT7A 4DSEA 3NE6A 4CGHA 4BE1A 1W0HA 4DLEA 3PX6A 5KI6A 1A5XA 1BIZA 4CFAA 1C1AA 4FLUA 1KSPA 2KQ2A 3ZT1A 3CYMA 2E6LA 4FVMA 1C0MA 4CJTA 4FXDA 4CEOA 1GOBA 2OZMA 2HHQA 4RG8A 4DTMA 1F21A 4O44A 3VQDA 1TVRA 3MXMA 2HHVA 3G10A 3TAMA 3JSMA 1JL2A 2X6NA 3ASMA 4M3XA 4M3RA 4BE2A 1JLBA 3QNOA 1TK5A 1EP4A 3M8QA 5FRNA 3KK2A 4AHVA 3DI6A 4Z0UA 1U45A 1WAFA 1SUQA 1BISA 2D0CA 2R7YA 4CJKA 3K58A 3DLHA 4CHYA 3O3GA 3JYTA 3NBPA 3ZSYA 4M3YA 2HMIA 2F8SA 1HYSA 1BGXT 3KK1A 4DU1A 2QKBA 3PY8A 1VSMA 3KLEA 3MXIA 4FLYA 4E3SA 1UA1A 4F3OA 1J54A 1TKZA 1VSEA 3D45A 3WNHA 2O4GA 4CK2A 1KVCA 3LAMA 1HJRA 2IGIA 1N5YA 1Q9YA 1N6QA 4N47A 2E6MA 4QAGA 2EHGA 1KTQA 1JXBA 1JLGA 1D9FA 2ITGA 2YHBA 4FJNA 4DSIA 1RDBA 1WNSA 1BCMA 4B9SA 1WSJA 4B9UA 4MFBA 3KLHA 1S5JA 2JGUA 3F73A 2PZSA 4IKFA 4M3WA 3SYZA 4KO0A 2B6AA 3AVKA 3DRRA 4I2QA 3LP2A 3TAEA 1T7PA 2G8KA 2D0BA 2WOMA 4OGEA 1CZBA 4OJRA 3SI6A 4M3UA 4C8MA 1B92A 1RT5A 4RW8A 3ZSQA 1LW2A 4OKKA 3ULDA 4DFJA 1TK8A 2Y1IA 1L3SA 3AVBA 3QO9A 4HCBA 3OYNA 3AO4A 4CEAA 5KTQA 4FK4A 1KVBA 3SQ0A 4HTUA 4PWDA 2XRIA 4DFKA 1RTHA 3CM6A 3SQ2A 2E4LA 1FKOA 2IOCA 2G8WA 1CZ9A 3ZT3A 4N76A 3CM5A 3OS2A 4JLHA 4O0IA 3IAYA 4CJPA 1QE1A 1EXQA 3MEDA 1IKYA 4E1NA 3OYMA 3V1OA 4BDYA 1NJWA 4FZYA 3L8BA 1A5VA 1RBVA 3EY1A 5HRNA 1DTQA 3AO2A 1NK4A 1KLMA 4LD0A 3OYCA 3PV8A 4Q0BA 3MXJA 1ZYQA 1W9HA 3TAGA 3P5JA 3K5LA 3OYAA 1UA0A 1MU2A 4B3OA 4CGGA 3OS0A 1K6YA 4ELVA 4EP4A 1S1XA 1L3UA 1RTIA 2YV0X 3AA4A 4LY7A 4J2DA 5HRSA 1NKBA 4FLVA 5D3GA 3NF7A 1RBTA 3H08A 4DTJA 3NF8A 4PUOA 3RRGA 2KFNA 2AJQA 4CJ3A 4WE1A 3ZCMA 3VQBA 5I42A 2DY4A 2VG7A 3KLGA 5HBMA 1KFDA 1RTDA 1QSYA 1NJXA 4EZ9A 1Y97A 3ALYA 4CJEA 3OYEA 5CZ2A 2XHBA 1TL1A 2W42A 1YT3A 4DTRA 4IG3A 3HT3A 4LH4A 1RDDA 2YKMA 4DQQA 3HK2A 1YVUA 4CJWA 1O1WA 1IO2A 1GOAA 3O3HA 1S1WA 5JS1A 3CQ8A 1RCHA 2B5JA 3BDPA 2YNIA 4O5BA 1KFSA 1BHLA 4CHZA 1BL3A 1HMVA 4BWMA 4M41A 4ZTFA 1T03A 4CHPA 3NF9A 3SPZA 4AHTA 1LWFA 3T19A 4CGDA 4CEZA 3K5NA 1KLNA 4N41A 1EETA 1LWEA 1VSFA 2ATQA 3SUPA 1L5UA 1C0TA 4KAZA 3C6UA 4IBNA 4KRFA 3NFAA 3HO1A 4B08A 4KFBA 4FM1A 3NGZA 3ZSWA 1TAUA 1HYVA 4AHUA 3SQ4A 4KPYA 4DTNA 1Q9XA 3VQEA 1KRPA 1U4BA 2F96A 4CJVA 5CYQA 1U47A 2VWKA 3IG1A 1HYZA 4CEQA 3SUNA 3K2PA 4C8OA 3B6OA 4NYNA 1EKEA 3LZJA 4E0DA 3QNNA 3EYZA 1S1VA 1IH7A 1ASUA 3LAKA 4CESA 3SUQA 4KB0A 4F2SA 5I3UA 1LAVA 3MECA 1U48A 2HHTA 4DQSA 4KHWA 3MAQA 2BDPA 3AVJA 5KRSA 3O3FA 3EZ5A 1IKVA 1XC9A 1ASVA 3RRHA 4I2PA 2HNDA 3S3OA 1SL2A 1X9WA 1WAJA 5KRTA 2BGGA 3VN5A 4IFVA 2HHWA 4O0JA 4AH9A 3CG7A 4FJXA 1ZBUA 1KVAA 1A5WA 3S3MA 2HVHA 4CGIA 4JS4A 1KCFA 4FCYA 3I0SA 3ZSOA 2G8HA 2YKNA 3KD5E 1J53A 4DTXA 4DFPA 1D8YA 4I9QA 2HHSA 2XY5A 3ZT4A 4DSKA 3G0ZA 1D9DA 2DFFA 3DRSA 3PO5A 4B8CA 1TGOA 1CXQA 4DF4A 2B4JA 3AO3A 1TKTA 4KHUA 2HHXA 2OPQA 2A1SA 1HQUA 3I8DA 2PY5A 3OYJA 4CJUA 1NJZA 4H4OA 4FJGA 3AVHA 4FW1A 3SZ2A 2KFZA 4HCCA 3O4QA 4DMNA 2X78A 1SKWA 1S1TA 3HPGA 1JLEA 4DQPA 4F2RA 4FJIA 2GUIA 4J2AA 4O55A 3VQ5A 2KTQA 3CFRA 1TL3A 3AVNA 4B9TA 1T8EA 2HVIA 5HRPA 3NDKA 4HHTA 1XI1A 3LPUA 3P83D 4BDZA 1VSHA 4OPJA 1DLOA 4IDKA 1J9AA 3ZSZA 3ITHA 3SPYA 4N56A 1RTJA 4CF9A 3AA3A 1G15A 3AVAA 3L2QA 3V9UA 4J2BA 4FJKA 4E19A 1BCOA 4CF2A 5J2PA 3KIOA 3K57A 3U3GA 4HUGA 1RT4A 4CIFA 4KTWA 3M8PA 1YTUA 3UIQA 1JXEA 4RW4A 4K8ZA 3OYDA 2QK9A 1RBSA 4DG1A 3RMDA 1S6QA 4CFCA 3DMJA 2OPPA 4E7LA 3HJFA 4ID5A 2FBXA 3HPOA
chains in the Genus database with same CATH superfamily
1NK8A 2NRRA 3CETA 1VQ9N 3TTFA 3O08A 4IXCA 4DV6K 3THXB 4AHCA 1JCGA 3ATUA 3AVCA 3AGKA 4LFAK 3L4IA 1RT6A 3J7AP 3TR8A 4MLHA 2QWRA 1TYQB 3QERA 5E41A 2V7ZA 3EL2A 2ETJA 4JI2K 3PX4A 4Q5VA 1NMNA 2RKIA 4R5PA 3FGUA 2UU9K 4KHPK 4PQUA 4Z4EA 1NGGA 2PYLA 1BQNA 1VQPN 3A5OC 4JI0K 1VSJA 4FWQA 3OYIA 1JL1A 3M8RA 3HYFA 2G8FA 4ISGA 1JCEA 5EOYA 3QIPA 3PO4A 4LSNA 2Z1HA 2QWNA 3QEVA 3OHRA 3WXMB 3RWUA 3MEGA 1JLCA 2JLEA 3CJ1A 3TI0A 4E1MA 4JD2B 2HHHK 4PY5A 1C6VA 3N4QA 3GL1A 1C0FA 1YI2N 5AQTA 3M5RA 4B8AB 4DV2K 1D5AA 2ZQBA 3BF3A 1IG8A 2E88A 2UUAK 4U67L 2IC3A 1NOZA 3OYKA 3T3FA 4L3QA 3MN7A 2F7TA 4BGAA 3LWMA 2W40A 2HNYA 1VSIA 2NUBA 3CCVN 3QETA 3AAPA 3F2KA 4FM0A 4B1UB 3VGLA 5GIOA 1OH6A 5CZ1A 2D4WA 2XY6A 2JWLA 3VETA 3CFPA 3KK7A 4W5OA 3V4IA 4BG9A 4K43A 3L3UA 1NKEA 2YHAA 3E9LA 5T7BA 3S9HA 2XY8A 3C7NB 5FPNA 5C24A 4CEBA 5HOOA 2O8FA 1N34K 4FLWA 4PKGA 1HNXK 3RMCA 3AAQA 3VEZA 4H4MA 1S22A 3MDQA 3AVIA 4AILC 1VQ5N 4CZIA 3KK3A 4DSJA 4JS5A 3TABA 3ATVA 5CYMA 3UB5A 3BP8A 4CJFA 2EX3A 2X74A 2P1JA 3VTIA 2E2PA 3R6MA 5M1QA 3IMXA 4UQGA 4CF0A 3G71N 1I39A 4BRIA 2OTJN 1WLJA 5E84A 3CD6N 1LCUA 3RMAA 2P5GA 2UXDK 3HRGA 3KLIA 4CF1A 1XNRK 4I6MB 1YTAA 5EY4A 3J8AA 2HB5A 2O8FB 3VQ8A 3SAHA 3D6RA 3LDQA 4CFDA 2FBYA 4DU3A 4JNEA 5AQXA 3SNNA 2O8DB 1DKGD 4A57A 4FYDA 2AA4A 5CY4A 5CHIA 4YOYA 4MO5A 3NH1A 3QDKA 4I9LA 4OGCA 4DTOA 1ATRA 3U8XA 1Z25A 4H5RA 4ELTA 4AHRA 2RE2A 4XIUA 3DXMA 3QESA 1NK7A 1RDCA 4KH5A 3V1RA 5DM6L 2UUCK 1WN7A 5J1EA 4X62K 4WFNL 3HVRA 4ID1A 1MA9B 2DFEA 4DWIA 1X9SA 4M42A 1QQCA 3O4NA 1YITN 2XY7A 4CZJA 3DLKA 3DXKA 4CIEA 1HJOA 5M1FA 3HVTA 4KBOA 1HNVA 3AA5X 1U04A 2P5OA 4BDPA 2FXUA 1B9FA 2KZZA 1S6PA 1VSLA 3L2UA 5LMNK 4PL7A 3CCSN 4KHSA 4CCHA 1BQMA 4BRQA 3AO5A 4QCLA 3AVFA 4B3SK 3VMFB 2FC0A 3DXMB 1U49A 4OLAA 3HOSA 1ITGA 3O9UA 4RW7A 1JKHA 1DTTA 1SKRA 5AJ3K 3KHYA 1TV6A 3VQPA 2RF2A 1X1PA 3BEXA 5JS2A 3RR8A 1NK9A 4CJRA 4O5FA 3M1FA 4CGHA 2PAVA 3PX6A 4A5AA 1C1AA 3GE1A 4FVMA 4CJTA 4DV1K 1GOBA 3O4WA 1F21A 3VQDA 2WUSA 3MXMA 4Z94A 2X6NA 2QW9A 4M3RA 3MWPA 1EP4A 3PSFA 4AHVA 1U45A 5ADXA 3CIPA 3I55N 5H1SQ 2W6LA 3T69A 2HMIA 2HBKA 2F8SA 1HYSA 4DU1A 2QKBA 2F9TA 3KLEA 1X9JA 4F3OA 4BR0A 4PKIA 4N47A 4QAGA 1KTQA 1JXBA 1D9FA 3JAMO 1LOTB 3FZFA 5AQWA 4LFBK 2JGUA 2B6AA 1S72N 3TAEA 2G8KA 3SK3A 1B92A 3ZSQA 2HOEA 1L3SA 3AVBA 3VGMA 5KQ8A 4FK4A 4HTUA 1FKOA 3K9JA 3TTCA 1GLJO 4B3TK 4N76A 4K0KK 3DJCA 2P9PA 4CJPA 3MEDA 1DEJA 1IKYA 4BDYA 1NJWA 2P9UB 1A5VA 4JKDA 3CXCM 4Q0BA 2W6KA 1W9HA 3TAGA 3ZETA 4RCHA 4JKGA 4J2DA 4JKHA 4CI6A 1IBMK 3C6AA 4FLVA 3NF7A 1GLDG 4JK8A 4B3MK 4DHYA 1BU6O 3ZCMA 3VQBA 2DY4A 2VG7A 3KLGA 1RTDA 3ALYA 3BZCA 3Q7CA 2W42A 1YT3A 4DTRA 4LH4A 1RDDA 2YKMA 4DQQA 4CJWA 1S1WA 3CQ8A 2E2OA 2P9PB 1K9MO 3BDPA 2YNIA 4GY2B 4CEZA 1LWFA 3BZKA 2EWSA 1VSFA 1LWEA 1J5EK 2ATQA 1I94K 2E2QA 1KXPA 1ILYA 3EO3A 1ZC6A 3NFAA 5AQZA 3P39A 3ZETB 3HO1A 1FW6A 3NGZA 4KPYA 4H5NA 4YOUA 3VEWA 2VQEK 1NLVA 3VQEA 1U4BA 2F96A 2VWKA 1YJ9N 3LZJA 3EYZA 1JJ2M 2HHTA 5KRSA 3O3FA 1ASVA 3M3ZA 1YIJN 3S3OA 1HPMA 3CCRN 4AH9A 5M1OA 2HVHA 4JS4A 4H0YB 1KCFA 4FCYA 2YKNA 3TU5A 3S41A 4DFPA 1D8YA 2XY5A 3ZT4A 2WTUA 3G0ZA 3OA9A 3I56N 1EWRA 1D9DA 3DRSA 3PO5A 4B8CA 1TGOA 4DF4A 2B4JA 3AO3A 2OPQA 3AY9A 2GEMA 2KKZA 3HOTA 4JKBA 4CJUA 1NJZA 4CW7B 4H4OA 2QWQA 2ASMA 3AVHA 5GINA 4H5VA 4DMNA 4J2AA 1SKWA 1RFQA 3VQ5A 3W3DA 4B9TA 1NGIA 1YF5L 4GV6A 5HRPA 3NDKA 3LPUA 1BWFO 3P83D 4BDZA 1VQKN 1R59O 4ILJA 3E66A 1J9AA 4N56A 3W0LA 3CC7N 1RTJA 2Q36A 4BQLA 1G15A 3AVAA 4FJKA 4CF2A 3SBTA 4KTWA 2P9NA 1YTUA 3OYDA 3SMSA 5TKYA 2QK9A 1EQYA 3HJFA 2OPPA 5JLFA 2YNGA 2I5JA 5FLXO 4FJJA 4B9VA 2J4RA 4GW6A 5HLFA 4JYAK 1QVGM 3VQ6A 2DFHA 4BRAA 3IFRA 4FJHA 2RHKA 3D2FA 1TK0A 4E1JA 3L0QA 4WQ5A 4MLEA 3LP3A 1Z6RA 3AO1A 4BVPA 1Q7YO 2RPIA 5BRHA 1Z26A 4BRMA 5J2NA 3TANA 1XHZA 4BG8A 4CIGA 4BACA 3MX5A 1HNIA 2GWKA 2A5XA 1JLFA 4A5BA 4JV5K 3WUHA 2ASOA 2Q0RA 4FLTA 1VRUA 2GTDA 2P9IA 2VG6A 3EN9A 3VQ9A 4MO4A 2OYQA 4FW2A 2A1RA 2A3ZA 4ILHA 1BI4A 4RWTA 3V9SA 1ZBIA 3KTQA 5CR4A 2QKKA 2P9SA 1IG9A 2OTLN 4CZFA 1NGBA 1RNHA 3T1AA 4BE0A 4H5WA 3U9ZA 3U4LA 2P9LA 4E7KA 4QS9A 3NH0A 3A5LC 3WQTA 4DV7K 5KGWA 4BRLA 5K14A 3KD1E 4EZ6A 4KTQA 3QEIA 1VRTA 3A2FA 1TAQA 4J8FA 2NRVA 4Y1CA 3THVA 5AQOA 5KPZA 3HI0A 1SL1A 3VF6A 3VERA 5BR8K 2G8UA 4W5TA 1YXQA 4CK3A 3A0IX 1J5OA 3P38A 4B1VA 1BI4B 5J2MA 3CJAA 1WUAA 3OVNA 1TKXA 4ISFA 4H8KA 4DTPA 1C0GA 4DU4A 3AV9A 2P9SB 5AQIA 1VQ6N 5HRRA 1UWBA 3SV4A 4NCBA 3K5MA 2P9LB 4AF1A 4N5SA 1BG3A 3FFKB 4B1WB 1ZBSA 5C42A 2GELA 3L4QA 1HKGA 2BE2A 2I7NA 4H5TA 2V51B 1K73O 3TWHA 2D1KA 4GV9A 5FRMA 2LSNA 4BRFA 4WFAL 4KH6A 2YCHA 3LWLA 1MWMA 4BC3A 3NH2A 3HL8A 1JLAA 4CF8A 4KI6A 4CD3A 4EIAA 4E7IA 3M8SA 1NKCA 4IZ9A 1SKSA 3V9XA 2HNZA 3IDHA 4FL9A 4JI6K 3H1QA 1MWKA 1HPZA 3LM2A 3U3YA 1LAWA 4JD2A 3L2WA 4GVMA 1CLQA 4KHYA 1E3MA 3WNEA 5LY3A 3IS9A 4I7FA 1QVFM 2ZD1A 3T7ZA 4H0OA 5AFUH 4RW9A 1OVQA 1N36K 3NVMA 3VQQA 4KHQA 5GAGP 4NYFA 4L8RB 4CHNA 1VQNN 2E8AA 3VQAA 2QWLA 1KAZA 3FZHA 5BN9A 4OPAA 4F3TA 3V9ZA 3FLCO 3ISNC 4A59A 1REVA 1HNZK 3AVGA 3MEEA 3OYHA 3TAQA 4DUYK 3HTVA 1NGAA 1NGDA 2HBMA 2D0PA 4FLXA 1EWQA 4WF9L 3AA2A 1BIUA 3O9RA 5AQYA 3NGIA 5J2QA 1NU0A 3K59A 1NK0A 3C95A 4NCGA 4BRPA 3MN5A 3VEVA 3C7NA 5FPDA 3VQ7A 2VWJA 3V6DA 3HSTB 2DPNA 4YNQA 3IRXA 4YOWA 3HP9A 3SJHA 4HUEA 2DTUA 2QWMA 1NOYA 1XWLA 4BRNA 5SZTA 1RILA 4JKFA 3CCQN 5LJWA 4IDHA 5BR9A 5C25A 1YUWA 3FFIA 3V9WA 2X6SA 2OA8A 1VK0A 5C2DA 1LW0A 1QS4A 1CXUA 1NJYA 4IO8A 3QFUA 4K25A 3DRPA 4ZTJA 1SS6A 3LALA 4K8XA 2Z1IA 1GLLO 3HPHA 4DSEA 2FSJA 3VEXA 1A5XA 1SAZA 3GG4A 4F9OA 2A41A 2CGKA 1G99A 4CBUA 4B1XB 2HHQA 4RG8A 4I6MA 2HHVA 1HNWK 3KK2A 4CBXA 2O8DA 4JI4K 3CCUN 3MWTA 4CZMA 5BPMA 3JYTA 1VQON 1BGXT 3ID8A 3LM9A 4E3SA 1J54A 1VSEA 3D45A 3ZX0A 2O4GA 4CK2A 4DV0K 3PSIA 2IGIA 1N5YA 1Q9YA 2EHGA 5FPMA 2Q1NA 3LL3A 4B1YB 2D0OA 4MFBA 3KLHA 3F73A 4LF9K 4M3WA 4CJ7A 3RSEA 4OGEA 1CZBA 4OJRA 5TKWA 4OKKA 3SAGA 4NXNK 4H0TB 1QZ6A 4JK9A 4CEAA 5KTQA 2BTFA 2O8CA 1RTHA 3CM6A 2E2NA 2IOCA 4MDAA 3CM5A 3OS2A 4DB3A 4O0IA 1EXQA 3OYMA 4FZYA 3L8BA 3OYCA 4LD0A 3VEYA 3RVCA 5GAEP 4H03B 3M6GA 3K5LA 1KAXA 3OYAA 1UA0A 2YX6A 3H6EA 4GVEA 4EP4A 1S1XA 1RTIA 4WQ5C 4LY7A 1NKBA 3VENA 1W7AA 4DCHA 3NF8A 2AJQA 3RSEB 3PIOL 3HM8A 3R3LA 4WE1A 5HL7L 5DM7L 3D2EA 1KFDA 3WXIA 1QSYA 4EZ9A 1Y97A 5CZ2A 2O8CB 2Q97A 4DR1K 1SQKA 1SZ2A 3D7EO 2B5JA 4PHTX 3G4SN 4BWMA 1VQ8N 4BR2A 1NM1A 4CHPA 4CGDA 3T19A 3VF2A 1HR0K 1EETA 4OX9K 2ZGYA 4IBNA 4FM1A 1TAUA 2IVPA 3SQ4A 1KRPA 4CJVA 4EHUA 5CYQA 1U47A 3THWB 1U2VA 3IG1A 4CEQA 3WXKA 3FZMA 3K2PA 1EKEA 3CQXA 3QNNA 1S1VA 4CESA 3LAKA 3SUQA 4KB0A 3D2EB 2QWOA 3MECA 4DR3K 4DQSA 3MAQA 3AVJA 4C1NK 4AQYK 3EZ5A 1BO5O 3O80A 1XC9A 4DR5K 1X9WA 5KRTA 2HHWA 4FJXA 1ZBUA 2E5LK 1D4XA 2NZTA 3SMPA 3EE8A 4I9QA 5M1NA 1VQ7N 4BR4A 2NRTA 4YDUA 1P8ZA 4DSKA 2DFFA 3OTOK 3PLAA 1TKTA 5IWAK 3I8DA 1U2VB 2P9UA 4JK7A 4H0PA 5JMVA 1S1TA 4DQPA 2GUIA 3G6EN 1TL3A 3I33A 1Q81O 1VSHA 1BUPA 4OPJA 1DLOA 4BR5A 4RTFD 3SPYA 1YAGA 4CF9A 4V19S 3V9UA 4BR7A 3K57A 3U3GA 3SAFA 3ZX3A 3M8PA 2I7PA 4K8ZA 1RBSA 4DG1A 2FBXA 5AQNA 3PX0A 3O1BA 3A5MC 5GAHP 4OKJA 4JRQA 4KREA 4C23A 3HP6A 4Z4IA 1KD1O 4EP5A 4YHHK 4DQ8A 1GLEG 1HLUA 1OKJA 2FLOA 3QINA 3DYAA 4FM2A 3CFOA 1RBRA 4EFHA 4Z4CA 4CFBA 1N33K 4BRHA 2FBTA 4BRDA 4M3ZA 1M90O 2D5RA 3T1HK 4IFEA 1IBLK 4FK0A 1QSLA 3DLBA 5AQJA 3WXLA 1IJJA 2IDOA 1ZXOA 2YHYA 1H1VA 5A2QO 4IOXA 3H3OB 3ZX2A 2YHXA 1SL0A 1QQMA 4LF8K 3V81A 4JKCA 4BWJA 2XO7A 4CJQA 3I0RA 4BGBA 1QTMA 3DOKA 3U6FA 1X3MA 4AHSA 4ELUA 5EU7A 2ZM6K 4OVLA 4DTSA 4DR4K 3TSUA 3DM2A 1L3VA 1QZ5A 1L3TA 1C1CA 4ICLA 3L3VA 2IS3A 4DR6K 3IUCA 3HSCA 2GBZA 2Z1GA 4B9NA 2RN2A 4JKEA 5SWMA 1WSHA 3OY9A 4JRPA 2BUPA 2E1YA 3AVLA 4FJLA 5HROA 3WNGA 1FXXA 2GV9A 2VCPA 2BH1A 4KKOA 1NWKA 3OYLA 2JWKA 2V7YA 4FJ5A 4B9QA 3I8BA 3HM9A 1VQ4N 3HZ6A 3KJVA 2OANA 3NF6A 3LP1A 2FF6A 3OYFA 3KKRA 1K8AO 1LWCA 4EHTA 4NLCA 3NCIA 4ISEA 4DSLA 4E7JA 4NO7A 2D0AA 3AVMA 4G1QA 4CJLA 3NVKA 3FZKA 3QFPA 1Q8IA 1NGJA 3O9QA 4CERA 1WSEA 2HMPA 2OZSA 3LDSA 3L2RA 3TAPA 1S9GA 1ZBHA 4M7YA 2HHUA 3CF5L 1ATSA 4CZEA 3CCJN 4DS5A 4IFYA 3MK6A 3TPQA 3UKRA 4O4GA 3QLHA 3EKUA 3SJJA 2G8VA 2PYJA 4DFMA 4YY3K 3J80O 1GLCG 4DQRA 3QBXA 3DAWA 1ZBLA 1UOCA 4DR2K 3TARA 3LZIA 3P31A 4CGFA 1JLQA 4W5QA 5KPTA 4FWOA 3UKUB 1BDGA 2H3GX 3KLFA 4LH5A 1VSDA 3ULEB 1NK5A 2VQFK 4BC5A 3GOIA 4W5NA 1OH7A 3JS6A 2ZJQL 4NCAA 2HW3A 3OYBA 1HUXA 3UKRB 1KQSM 3SQ1A 3TAFA 4KHNA 3LDOA 3OJSA 1ASWA 5AQVA 3NGYA 1NK6A 2Q31A 2V52B 4F4KA 3LANA 2GUPA 1CZAN 5DK5A 1XNQK 4WFBL 3EZWA 1VAZA 3ZYYX 4B3RK 1NG9A 1B9DA 3B8AX 3VF4A 3DLEA 3RMBA 4ZHRA 1LV5A 4DSFA 1HX1A 1U6ZA 3VA0A 3NHGA 3CCMN 4KI4A 3BY5A 1GOCA 3G25A 3JXUA 4OKEA 1TKDA 1HQEA 2OPSA 5DMRA 3O6WA 1S1UA 3C0BA 4KB1A 3FZLA 3ZT0A 1K8KB 5B8HA 3O9TA 4YFUA 2HBLA 4DTUA 3SV3A 3RR7A 4LF7K 1WSGA 1R0AA 4JI8K 3J7YP 4FOIA 3ZT2A 3EKSA 3NE6A 4BE1A 1BIZA 4CFAA 1XQSC 4BQZA 4FLUA 1KSPA 2KQ2A 3ZT1A 3CYMA 4IOAL 2OZMA 3L6QA 2Q0UA 3A8YA 1JL2A 4X66K 3ASMA 3TSPA 4FPBA 2HF3A 3CJ7A 4BE2A 4M3XA 1JLBA 1TK5A 3CHWA 3M8QA 5FRNA 1DGKN 2QXLA 3DI6A 4Z0UA 4YDUC 4JI1K 2W41A 4DR7K 1SUQA 1BISA 2D0CA 2R7YA 4CJKA 3K58A 4CHYA 3NBPA 4Y0WA 4MDBA 3KK1A 1NJIO 1S3XA 3PY8A 3H1VX 1VSMA 3GDQA 1UA1A 5LL6Z 3GBTA 3K0SA 1HJRA 1TUUA 4FWMA 4JHDA 1JLGA 2ITGA 4FJNA 4DSIA 4DV5K 1RDBA 1WNSA 1BCMA 4B9SA 1WSJA 4XH4A 4IKFA 3WEEA 2PZSA 3SYZA 4KO0A 3AVKA 3VOVA 4I2QA 2VGMA 1T7PA 4M3UA 3SI6A 3BF1A 1TK8A 1RT5A 1LW2A 4HWIA 1NMDA 2Y1IA 3E9OA 1E4FT 3QO9A 2IVOA 3AO4A 3WT0A 3SQ0A 5AQHA 3THYA 3SBGA 4DFKA 4AM6A 5KPRA 5LJVA 5AZIA 2E4LA 3MN9A 3ZT3A 3CQYA 5AR0A 4JLHA 4LF5K 3IAYA 1QE1A 2UYTA 4XH1A 3V1OA 4FVUA 5HRNA 1NK4A 3MXJA 4C1NI 5BPNA 3P5JA 4JHDB 5ADXH 1K6YA 3CC2N 3CMAN 2YV0X 4U7BA 3WEEB 1RBTA 3H08A 4DTJA 4JAXA 4PUOA 1VHXA 5I42A 2QI2A 5HBMA 5AZJA 3MCAB 4CJEA 3IKMA 3OYEA 3THYB 3HT3A 5AZIB 4IO9L 1O1WA 1IO2A 3O3HA 5JS1A 1T03A 4M41A 1BL3A 1HMVA 2WC9A 4ZTFA 2IIRA 3FR0A 3K5NA 4M63C 4IOCL 1N8RO 4KAZA 4B08A 2QWPA 1HYVA 4AHUA 1NNEA 4DTNA 1DT9A 1Q9XA 4BC4A 4BROA 3QB0A 4FWNA 4XH5A 4CVNE 3B6OA 4NYNA 1XC3A 4CD1A 2F4VK 3MMVA 1ASUA 5I3UA 1LAVA 1U48A 1NGHA 5AZJB 5EVZA 1VQMN 5BRFA 1IKVA 4CZKA 4I2PA 1NBWA 5C0YA 1SL2A 4GKJK 3WXJA 2FSNA 2WBNA 3O8MA 4IFVA 3NMUA 3CG7A 1KVAA 1A5WA 3S3MA 3I0SA 3ZSOA 4DTXA 4DV3K 4A62A 5AQSA 4BRCA 1MDUB 3CI5A 4K42A 4PL8A 4KHUA 2HHXA 1NGEA 3CJCA 2A1SA 1HQUA 2CGJA 1NGCA 3OYJA 4FJGA 4HCCA 4DV4K 2KTQA 4F2RA 3R8EA 4O55A 3CFRA 3J81O 2HVIA 2NRWA 3KWIA 2VGNA 4HHTA 2KLAA 3OW2M 2NRZA 3A5NC 3ZSZA 2ZF5O 3ITHA 1HKCA 3L2QA 4J2BA 4E19A 1BCOA 3KIOA 4YOVA 3MCPA 2YHWA 4NXMK 4A61A 4RW4A 2HF4A 4JI7K 3ENBA 5AQLA 4E7LA 4CFCA 3HPOA 2PBDA 3ZSXA 4FWSA 4OLBA 1OH5A 4CECA 4O8UA 4HUFA 2OPRA 3QMLA 1XUPO 5F2RA 2NRHA 4NB4A 2KW4A 4B9MA 1O13A 4FJ9A 2VYPA 3VQCA 3HXMA 4GV3A 4GKKK 4FK2A 1ZBFA 3THWA 3C94A 4CBWA 2NRXA 5BPLA 4DQIA 1RBUA 5GIPA 3KWGA 4Z4FA 4QOZB 3VQ4A 3LP0A 2WONA 4KTZA 3CPWM 2FSKA 4R79A 4MQ3A 2PFUA 1VQLN 1WBBA 4M45A 3E9PA 1V4SA 4E89A 2YI1A 3B6PA 5AQRA 3S3NA 3TSQA 3SCXA 2A42A 4C8LA 1X3NA 1FJGK 2YNFA 3QIOA 3BGRA 1X9MA 3UE5A 3VA3A 3LDPA 3VPZA 2FBVA 1QSSA 3R9PA 3KKSA 4KH4A 4FJ7A 1JCFA 4B9LA 4CZGA 4CJ4A 1WSIA 4FSVA 4WQ4C 4WYBA 4E7HA 3CJ9A 4IEEA 2Q2RA 1C1BA 2F8TA 4O8KA 4FZZA 1RGIA 3VTHA 5BREA 1FK9A 3ZSVA 1QQOA 1RT2A 4CE9A 4BR9A 3DXKB 1T6DA 4WCEL 1FKPA 4M7XA 2KZMA 4FPAA 2O4IA 3P1GA 1RDUA 5FROA 3QEXA 3L2VA 1T44A 4CEDA 1KAYA 5AFUA 2YJFA 4C8KA 1SV5A 4CGJA 4Z4HA 3OYGA 1XHXA 2BANA 4DS4A 4TSXA 4G9ZA 4CEFA 3N4PA 2CH5A 4JKAA 1VSKA 1HRHA 1ESVA 5AQMA 1IKXA 1P90A 3ZEUA 1WSFA 1GLAG 4YOTA 1BA1A 2E20A 2HBJA 4DF8A 5JICA 2GX9A 2F9WA 2Z1JA 5C15A 1WBDA 1RT3A 4F8RA 3CJBA 5KGXA 3F9KA 4FJMA 3E01A 2FF3B 4W5RA 5HP1A 3QEPA 5C2FA 4KV8A 2UUBK 3PUFA 4CZLA 3DLLL 3ZSRA 1EX4A 3DLGA 4IJNA 4GNIA 1IKWA 4OPHA 4GMJB 3LPTA 3PIPL 4CEEA 2G8IA 4C8NA 4YOXA 5EXWA 3CPEA 3D0PA 4CHOA 4LF4K 4DLGA 4YORA 1Z05A 4CZHA 1RT1A 1GLFO 2Y1JA 1W2BM 3ZEUB 3MN6A 3DWLA 1C0UA 3OS1A 4A2AA 3V1QA 4HTLA 1W97L 2QM1A 2ZE2A 1QHTA 2P51A 4JEPA 4CJ5A 4BRGA 4FZXC 1BA0A 4CK1A 3RTVA 2Q3SA 4IG0A 1XMQK 3QEWA 2YNHA 1Y64A 4ILGB 1RDAA 1T05A 3E1YA 2GWJA 3VESA 5JLHA 1S9EA 3WNFA 3KVGA 4FJ8A 1WOQA 4FLZA 4DKWA 1I3AA 3P4IA 4DUZK 5FDLA 3DOLA 5JVGL 2ZJPL 3AGRA 3O9SA 2ZWHA 1YJWN 1Q86O 5I9EB 4HVJA 4NLBA 5F0XA 4LF6K 4X64K 4Z4GA 3SUOA 3T1YK 4J2EA 4CJSA 3OJUA 4CHQA 5GADP 2QA4N 4RW6A 3C6TA 4PA1A 5CE3A 5FPEA 4H0VB 2ZJRL 1E4GT 2QXFA 1YJNN 2VG5A 3EEQA 2A40A 4JKGB 4LC9B 1UAXA 5JVHL 3DLRA 1EO1A 3MX2A 4LSLA 4Y1DA 3CCLN 3K5OA 1WB9A 4IJAA 4M3TA 4OPKA 3NAEA 3H3NO 2IAJA 1RT7A 5BN8A 4DLEA 1W0HA 5KI6A 3TTDA 2P9KA 2ASPA 2E6LA 1C0MA 3CERA 5AQFA 4FXDA 4CEOA 4DTMA 4O44A 1TVRA 3H46O 1YHQN 3G10A 3TAMA 3JSMA 3OBYA 3QNOA 1WAFA 3LDNA 3WQUA 3KZBA 5BRDA 3DLHA 4IWVA 3O3GA 1IV0A 3ZSYA 4M3YA 1ATNA 4BY9C 2NNWA 3C6HA 3MXIA 4FLYA 1TKZA 3UKUA 3WNHA 2O8EA 1KVCA 2VWBA 3LAMA 3ENOA 3ULEA 1N6QA 2E6MA 4A2BA 3C65A 2YHBA 2QEXN 3Q7BA 2P9KB 4B9UA 5C12A 1GLBG 1S5JA 3DRRA 5LMUK 3LP2A 2D0BA 1YVNA 2WOMA 4C8MA 3VEOA 4RW8A 3ULDA 4DFJA 3QBWA 1OH8A 2UXBK 2ZGZA 4HCBA 3OYNA 1KVBA 3OBWA 4PWDA 2XRIA 3BUZB 1QHAA 3SQ2A 1RDWX 2G8WA 1CZ9A 3CMEN 4E1NA 5MLCQ 1RBVA 3EY1A 4JI5K 1DTQA 3AO2A 1KLMA 3PV8A 2O8EB 1ZYQA 1QQNA 4FWKA 4B3OA 3HBTA 1MU2A 3O1WA 4BVOA 1NGFA 4CGGA 3OS0A 4ELVA 2CGLA 1L3UA 2QTDA 3AA4A 2IVNA 5HRSA 5D3GA 2KFNA 3RRGA 1K8KA 4CJ3A 1BOTO 3FE1A 3K9KA 1NJXA 2XHBA 1TL1A 4QS8A 5KQDA 2P9NB 3AARA 4IG3A 3HK2A 3EE9A 1YVUA 1GOAA 4BREA 1RCHA 3O5BA 3F5TA 4O5BA 1KFSA 1BHLA 4CHZA 3ENHA 3ID6A 4EAHD 3NF9A 3SPZA 4AHTA 1KLNA 4N41A 3SUPA 1L5UA 1C0TA 4WQ4A 3C6UA 4KRFA 4KFBA 2OCEA 1Q18A 3F9MA 3ZSWA 1KC8O 3D2FB 5C10A 5AQQA 5AQKA 1OVYA 1HYZA 4X65K 3SUNA 1TUYA 2YJEA 4C8OA 4E0DA 2O8BA 1IH7A 3VGKA 4F2SA 5IT9O 3J7ZO 4KHWA 2A6AA 1M1KO 2BDPA 4FWLA 2HSTA 3RRHA 2HNDA 3CC4N 5ELZA 1WAJA 4JI3K 2BGGA 3VN5A 2UXCK 4K41A 5M1PA 4O0JA 2CH6A 2P9IB 4CGIA 3U9DA 3CCEN 1XMOK 4BRKA 2G8HA 3KD5E 1J53A 4IEIA 4B1ZA 2HHSA 2AP1A 4FWPA 4BC2A 1T6CA 2NLXA 5EX5A 1J6ZA 3QICA 1CXQA 3ZLJA 4H0XB 2WFBA 1V4TA 2PY5A 4XEIA 2E1ZA 3THXA 4FW1A 3SZ2A 2O8BB 4FOEA 1IBKK 2KFZA 3O4QA 2X78A 4FJIA 3HPGA 1JLEA 4PKHA 4AM7A 3R1XA 4FWRA 3LDLA 3AVNA 3SLCA 4UY8O 1T8EA 4FO0A 5AQGA 1XI1A 3H45C 2KHOA 5E26A 4OO1J 1Q82O 4IDKA 1TYQA 4JN4A 4QS7A 1N32K 5AQUA 3AA3A 2ITMA 5J2PA 4HUGA 1RT4A 4CIFA 5M1KA 5F1XA 3UIQA 1JXEA 1HKBA 3RMDA 1T3VA 1S6QA 3DMJA 5AQPA 4ID5A 4LFCK
chains in the Genus database with same CATH topology
3PX0A 3ZSXA 1NK8A 4OKJA 4OLBA 4JRQA 4KREA 4CECA 4HUFA 2YNGA 2I5JA 3HP6A 4Z4IA 2OPRA 4AHCA 4EP5A 4FJJA 4B9MA 2KW4A 4B9VA 4GW6A 5HLFA 4FJ9A 3VQ6A 3AVCA 2DFHA 3VQCA 3HXMA 3QINA 4FJHA 3DYAA 4FM2A 3CFOA 1TK0A 1RBRA 4Z4CA 4CFBA 1RT6A 4FK2A 1ZBFA 3TR8A 3LP3A 2FBTA 3AO1A 2RPIA 1Z26A 5J2NA 3C94A 4M3ZA 3QERA 5E41A 4DQIA 1RBUA 2ETJA 3PX4A 3TANA 1XHZA 4Q5VA 2D5RA 2RKIA 4R5PA 4FK0A 1QSLA 3DLBA 4Z4FA 4QOZB 3VQ4A 4CIGA 4BACA 3LP0A 4Z4EA 2PYLA 4PQUA 1HNIA 1BQNA 2IDOA 1VSJA 3OYIA 1JLFA 1JL1A 3M8RA 3HYFA 2G8FA 2WONA 4KTZA 3QIPA 4FLTA 1VRUA 2VG6A 3PO4A 4LSNA 2Z1HA 1SL0A 4MQ3A 3VQ9A 3QEVA 2OYQA 4FW2A 2A1RA 3MEGA 3RWUA 1JLCA 4M45A 2JLEA 1BI4A 3TI0A 4E89A 3V9SA 3V81A 3B6PA 4E1MA 4BWJA 3S3NA 2XO7A 4CJQA 4PY5A 1ZBIA 1C6VA 3I0RA 3KTQA 2QKKA 3SCXA 1QTMA 1IG9A 3DOKA 4C8LA 3U6FA 4B8AB 1RNHA 4AHSA 3T1AA 2YNFA 3QIOA 4ELUA 1D5AA 2ZQBA 3BGRA 4OVLA 5EU7A 4BE0A 3VA3A 4DTSA 1X9MA 2FBVA 3DM2A 1L3VA 1QSSA 3KKSA 1L3TA 4FJ7A 4E7KA 2IC3A 4B9LA 1C1CA 1NOZA 3NH0A 3OYKA 3T3FA 5KGWA 4CJ4A 1WSIA 5K14A 3KD1E 4EZ6A 4KTQA 3QEIA 4ICLA 3LWMA 1VRTA 2HNYA 3A2FA 3L3VA 1VSIA 1TAQA 2IS3A 4E7HA 3THVA 2NUBA 4Y1CA 3QETA 2GBZA 2Z1GA 4B9NA 2RN2A 1C1BA 1SL1A 2F8TA 4FM0A 4FZZA 5SWMA 1WSHA 3OY9A 4JRPA 2G8UA 4W5TA 3AVLA 4CK3A 4FJLA 1J5OA 5CZ1A 1FK9A 3ZSVA 5HROA 1RT2A 3WNGA 4CE9A 1FXXA 2GV9A 1BI4B 5J2MA 2XY6A 4KKOA 1FKPA 3OVNA 1TKXA 2KZMA 3OYLA 3P1GA 2O4IA 4H8KA 5FROA 4DTPA 4DU4A 3QEXA 3AV9A 3CFPA 4FJ5A 3L2VA 3HM9A 4W5OA 3V4IA 4CEDA 3L3UA 3KJVA 1NKEA 2YHAA 4C8KA 5T7BA 3S9HA 1SV5A 1UWBA 2XY8A 3NF6A 3LP1A 5HRRA 4CGJA 1XHXA 4Z4HA 2BANA 3OYGA 3K5MA 3SV4A 4DS4A 4NCBA 4TSXA 3OYFA 5C24A 4CEFA 4N5SA 4CEBA 3KKRA 1LWCA 1VSKA 1HRHA 4FLWA 1IKXA 5C42A 1WSFA 3NCIA 3RMCA 4DSLA 4H4MA 4E7JA 2BE2A 4DF8A 2D0AA 3AVIA 4AILC 3AVMA 4G1QA 2Z1JA 3TWHA 3KK3A 4DSJA 4CJLA 4JS5A 5FRMA 2LSNA 1RT3A 3TABA 4F8RA 5CYMA 5KGXA 3LWLA 4CJFA 3NH2A 3F9KA 2EX3A 2X74A 2P1JA 3E01A 4FJMA 4W5RA 1Q8IA 5HP1A 3QEPA 3HL8A 1JLAA 4CF8A 4KV8A 4CERA 1WSEA 3PUFA 4UQGA 2OZSA 4KI6A 3LDSA 4E7IA 3M8SA 1NKCA 1SKSA 3ZSRA 3L2RA 3TAPA 1EX4A 1S9GA 2HNZA 4CF0A 3V9XA 1ZBHA 3DLGA 2HHUA 1I39A 1IKWA 4GMJB 1WLJA 3LPTA 4CEEA 3RMAA 2P5GA 4DS5A 4C8NA 4IFYA 2G8IA 4O4GA 3KLIA 4CF1A 3D0PA 3QLHA 1HPZA 4CHOA 1YTAA 4DLGA 3U3YA 3SJJA 2G8VA 2HB5A 4DFMA 2PYJA 3VQ8A 1RT1A 1LAWA 2Y1JA 3L2WA 4GVMA 1CLQA 4DQRA 4CFDA 4KHYA 2FBYA 1C0UA 3WNEA 4DU3A 3OS1A 3IS9A 3SNNA 4I7FA 2ZD1A 4FYDA 4RW9A 1ZBLA 5CY4A 1UOCA 3NH1A 3V1QA 3VQQA 4KHQA 3TARA 4NYFA 4I9LA 3LZIA 2ZE2A 4L8RB 4OGCA 4DTOA 1QHTA 2P51A 4CGFA 1JLQA 4W5QA 4CHNA 4CJ5A 4FZXC 1Z25A 4ELTA 4CK1A 3VQAA 3RTVA 2Q3SA 4AHRA 4XIUA 3KLFA 4IG0A 1VSDA 4LH5A 1NK5A 4F3TA 3V9ZA 3QESA 1NK7A 1RDCA 3ISNC 3QEWA 4W5NA 3V1RA 1REVA 2YNHA 1WN7A 4NCAA 5J1EA 2HW3A 3AVGA 3MEEA 1RDAA 3OYHA 3TAQA 3OYBA 3HVRA 4ID1A 2DFEA 3SQ1A 4DWIA 1X9SA 4M42A 1QQCA 1T05A 3O4NA 3TAFA 2XY7A 4FLXA 4KHNA 3AA2A 1BIUA 1ASWA 3OJSA 3DLKA 3NGYA 1NK6A 4F4KA 4CIEA 1S9EA 3LANA 3HVTA 5DK5A 3WNFA 1HNVA 3NGIA 3AA5X 5J2QA 1U04A 4FJ8A 3K59A 4FLZA 2P5OA 1I3AA 4BDPA 5FDLA 3DOLA 1NK0A 3C95A 4NCGA 1B9FA 2KZZA 1B9DA 1S6PA 1VSLA 3L2UA 4KHSA 3VQ7A 2VWJA 3V6DA 3HSTB 4CCHA 1BQMA 3DLEA 3RMBA 4ZHRA 4YNQA 3AO5A 1LV5A 3IRXA 4HVJA 4DSFA 3HP9A 4QCLA 3AVFA 3VA0A 3NHGA 4Z4GA 3SUOA 4KI4A 4HUEA 2DTUA 2FC0A 1U49A 4CJSA 4J2EA 1GOCA 3OJUA 4OLAA 1NOYA 4CHQA 1ITGA 1XWLA 5SZTA 1RILA 4RW6A 4RW7A 4OKEA 3C6TA 1TKDA 4PA1A 1JKHA 1HQEA 5C25A 1DTTA 2QXFA 3FFIA 2VG5A 2OPSA 3V9WA 2X6SA 1UAXA 5DMRA 1SKRA 2OA8A 1VK0A 1TV6A 1S1UA 3DLRA 3VQPA 2RF2A 3ZT0A 1LW0A 1QS4A 1X1PA 4LSLA 4KB1A 1CXUA 4Y1DA 4YFUA 1NJYA 4DTUA 5JS2A 3K5OA 3RR8A 1NK9A 3DRPA 3SV3A 3RR7A 1WSGA 4OPKA 4ZTJA 1R0AA 4M3TA 3NAEA 3LALA 4K8XA 2Z1IA 2IAJA 3HPHA 3ZT2A 4CJRA 1RT7A 4DSEA 3NE6A 4CGHA 4BE1A 1W0HA 4DLEA 3PX6A 5KI6A 1A5XA 1BIZA 4CFAA 1C1AA 4FLUA 1KSPA 2KQ2A 3ZT1A 3CYMA 2E6LA 4FVMA 1C0MA 4CJTA 4FXDA 4CEOA 1GOBA 2OZMA 2HHQA 4RG8A 4DTMA 1F21A 4O44A 3VQDA 1TVRA 3MXMA 2HHVA 3G10A 3TAMA 3JSMA 1JL2A 2X6NA 3ASMA 4M3XA 4M3RA 4BE2A 1JLBA 3QNOA 1TK5A 1EP4A 3M8QA 5FRNA 3KK2A 4AHVA 3DI6A 4Z0UA 1U45A 1WAFA 1SUQA 1BISA 2D0CA 2R7YA 4CJKA 3K58A 3DLHA 4CHYA 3O3GA 3JYTA 3NBPA 3ZSYA 4M3YA 2HMIA 2F8SA 1HYSA 1BGXT 3KK1A 4DU1A 2QKBA 3PY8A 1VSMA 3KLEA 3MXIA 4FLYA 4E3SA 1UA1A 4F3OA 1J54A 1TKZA 1VSEA 3D45A 3WNHA 2O4GA 4CK2A 1KVCA 3LAMA 1HJRA 2IGIA 1N5YA 1Q9YA 1N6QA 4N47A 2E6MA 4QAGA 2EHGA 1KTQA 1JXBA 1JLGA 1D9FA 2ITGA 2YHBA 4FJNA 4DSIA 1RDBA 1WNSA 1BCMA 4B9SA 1WSJA 4B9UA 4MFBA 3KLHA 1S5JA 2JGUA 3F73A 2PZSA 4IKFA 4M3WA 3SYZA 4KO0A 2B6AA 3AVKA 3DRRA 4I2QA 3LP2A 3TAEA 1T7PA 2G8KA 2D0BA 2WOMA 4OGEA 1CZBA 4OJRA 3SI6A 4M3UA 4C8MA 1B92A 1RT5A 4RW8A 3ZSQA 1LW2A 4OKKA 3ULDA 4DFJA 1TK8A 2Y1IA 1L3SA 3AVBA 3QO9A 4HCBA 3OYNA 3AO4A 4CEAA 5KTQA 4FK4A 1KVBA 3SQ0A 4HTUA 4PWDA 2XRIA 4DFKA 1RTHA 3CM6A 3SQ2A 2E4LA 1FKOA 2IOCA 2G8WA 1CZ9A 3ZT3A 4N76A 3CM5A 3OS2A 4JLHA 4O0IA 3IAYA 4CJPA 1QE1A 1EXQA 3MEDA 1IKYA 4E1NA 3OYMA 3V1OA 4BDYA 1NJWA 4FZYA 3L8BA 1A5VA 1RBVA 3EY1A 5HRNA 1DTQA 3AO2A 1NK4A 1KLMA 4LD0A 3OYCA 3PV8A 4Q0BA 3MXJA 1ZYQA 1W9HA 3TAGA 3P5JA 3K5LA 3OYAA 1UA0A 1MU2A 4B3OA 4CGGA 3OS0A 1K6YA 4ELVA 4EP4A 1S1XA 1L3UA 1RTIA 2YV0X 3AA4A 4LY7A 4J2DA 5HRSA 1NKBA 4FLVA 5D3GA 3NF7A 1RBTA 3H08A 4DTJA 3NF8A 4PUOA 3RRGA 2KFNA 2AJQA 4CJ3A 4WE1A 3ZCMA 3VQBA 5I42A 2DY4A 2VG7A 3KLGA 5HBMA 1KFDA 1RTDA 1QSYA 1NJXA 4EZ9A 1Y97A 3ALYA 4CJEA 3OYEA 5CZ2A 2XHBA 1TL1A 2W42A 1YT3A 4DTRA 4IG3A 3HT3A 4LH4A 1RDDA 2YKMA 4DQQA 3HK2A 1YVUA 4CJWA 1O1WA 1IO2A 1GOAA 3O3HA 1S1WA 5JS1A 3CQ8A 1RCHA 2B5JA 3BDPA 2YNIA 4O5BA 1KFSA 1BHLA 4CHZA 1BL3A 1HMVA 4BWMA 4M41A 4ZTFA 1T03A 4CHPA 3NF9A 3SPZA 4AHTA 1LWFA 3T19A 4CGDA 4CEZA 3K5NA 1KLNA 4N41A 1EETA 1LWEA 1VSFA 2ATQA 3SUPA 1L5UA 1C0TA 4KAZA 3C6UA 4IBNA 4KRFA 3NFAA 3HO1A 4B08A 4KFBA 4FM1A 3NGZA 3ZSWA 1TAUA 1HYVA 4AHUA 3SQ4A 4KPYA 4DTNA 1Q9XA 3VQEA 1KRPA 1U4BA 2F96A 4CJVA 5CYQA 1U47A 2VWKA 3IG1A 1HYZA 4CEQA 3SUNA 3K2PA 4C8OA 3B6OA 4NYNA 1EKEA 3LZJA 4E0DA 3QNNA 3EYZA 1S1VA 1IH7A 1ASUA 3LAKA 4CESA 3SUQA 4KB0A 4F2SA 5I3UA 1LAVA 3MECA 1U48A 2HHTA 4DQSA 4KHWA 3MAQA 2BDPA 3AVJA 5KRSA 3O3FA 3EZ5A 1IKVA 1XC9A 1ASVA 3RRHA 4I2PA 2HNDA 3S3OA 1SL2A 1X9WA 1WAJA 5KRTA 2BGGA 3VN5A 4IFVA 2HHWA 4O0JA 4AH9A 3CG7A 4FJXA 1ZBUA 1KVAA 1A5WA 3S3MA 2HVHA 4CGIA 4JS4A 1KCFA 4FCYA 3I0SA 3ZSOA 2G8HA 2YKNA 3KD5E 1J53A 4DTXA 4DFPA 1D8YA 4I9QA 2HHSA 2XY5A 3ZT4A 4DSKA 3G0ZA 1D9DA 2DFFA 3DRSA 3PO5A 4B8CA 1TGOA 1CXQA 4DF4A 2B4JA 3AO3A 1TKTA 4KHUA 2HHXA 2OPQA 2A1SA 1HQUA 3I8DA 2PY5A 3OYJA 4CJUA 1NJZA 4H4OA 4FJGA 3AVHA 4FW1A 3SZ2A 2KFZA 4HCCA 3O4QA 4DMNA 2X78A 1SKWA 1S1TA 3HPGA 1JLEA 4DQPA 4F2RA 4FJIA 2GUIA 4J2AA 4O55A 3VQ5A 2KTQA 3CFRA 1TL3A 3AVNA 4B9TA 1T8EA 2HVIA 5HRPA 3NDKA 4HHTA 1XI1A 3LPUA 3P83D 4BDZA 1VSHA 4OPJA 1DLOA 4IDKA 1J9AA 3ZSZA 3ITHA 3SPYA 4N56A 1RTJA 4CF9A 3AA3A 1G15A 3AVAA 3L2QA 3V9UA 4J2BA 4FJKA 4E19A 1BCOA 4CF2A 5J2PA 3KIOA 3K57A 3U3GA 4HUGA 1RT4A 4CIFA 4KTWA 3M8PA 1YTUA 3UIQA 1JXEA 4RW4A 4K8ZA 3OYDA 2QK9A 1RBSA 4DG1A 3RMDA 1S6QA 4CFCA 3DMJA 2OPPA 4E7LA 3HJFA 4ID5A 2FBXA 3HPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PX0 A;  3ZSX A;  1NK8 A;  4OKJ A;  4OLB A;  4JRQ A;  4KRE A;  4CEC A;  4HUF A;  2YNG A;  2I5J A;  3HP6 A;  4Z4I A;  2OPR A;  4AHC A;  4EP5 A;  4FJJ A;  4B9M A;  2KW4 A;  4B9V A;  4GW6 A;  5HLF A;  4FJ9 A;  3VQ6 A;  3AVC A;  2DFH A;  3VQC A;  3HXM A;  3QIN A;  4FJH A;  3DYA A;  4FM2 A;  3CFO A;  1TK0 A;  1RBR A;  4Z4C A;  4CFB A;  1RT6 A;  4FK2 A;  1ZBF A;  3TR8 A;  3LP3 A;  2FBT A;  3AO1 A;  2RPI A;  1Z26 A;  5J2N A;  3C94 A;  4M3Z A;  3QER A;  5E41 A;  4DQI A;  1RBU A;  2ETJ A;  3PX4 A;  3TAN A;  1XHZ A;  4Q5V A;  2D5R A;  2RKI A;  4R5P A;  4FK0 A;  1QSL A;  3DLB A;  4Z4F A;  4QOZ B;  3VQ4 A;  4CIG A;  4BAC A;  3LP0 A;  4Z4E A;  2PYL A;  4PQU A;  1HNI A;  1BQN A;  2IDO A;  1VSJ A;  3OYI A;  1JLF A;  1JL1 A;  3M8R A;  3HYF A;  2G8F A;  2WON A;  4KTZ A;  3QIP A;  4FLT A;  1VRU A;  2VG6 A;  3PO4 A;  4LSN A;  2Z1H A;  1SL0 A;  4MQ3 A;  3VQ9 A;  3QEV A;  2OYQ A;  4FW2 A;  2A1R A;  3MEG A;  3RWU A;  1JLC A;  4M45 A;  2JLE A;  1BI4 A;  3TI0 A;  4E89 A;  3V9S A;  3V81 A;  3B6P A;  4E1M A;  4BWJ A;  3S3N A;  2XO7 A;  4CJQ A;  4PY5 A;  1ZBI A;  1C6V A;  3I0R A;  3KTQ A;  2QKK A;  3SCX A;  1QTM A;  1IG9 A;  3DOK A;  4C8L A;  3U6F A;  4B8A B;  1RNH A;  4AHS A;  3T1A A;  2YNF A;  3QIO A;  4ELU A;  1D5A A;  2ZQB A;  3BGR A;  4OVL A;  5EU7 A;  4BE0 A;  3VA3 A;  4DTS A;  1X9M A;  2FBV A;  3DM2 A;  1L3V A;  1QSS A;  3KKS A;  1L3T A;  4FJ7 A;  4E7K A;  2IC3 A;  4B9L A;  1C1C A;  1NOZ A;  3NH0 A;  3OYK A;  3T3F A;  5KGW A;  4CJ4 A;  1WSI A;  5K14 A;  3KD1 E;  4EZ6 A;  4KTQ A;  3QEI A;  4ICL A;  3LWM A;  1VRT A;  2HNY A;  3A2F A;  3L3V A;  1VSI A;  1TAQ A;  2IS3 A;  4E7H A;  3THV A;  2NUB A;  4Y1C A;  3QET A;  2GBZ A;  2Z1G A;  4B9N A;  2RN2 A;  1C1B A;  1SL1 A;  2F8T A;  4FM0 A;  4FZZ A;  5SWM A;  1WSH A;  3OY9 A;  4JRP A;  2G8U A;  4W5T A;  3AVL A;  4CK3 A;  4FJL A;  1J5O A;  5CZ1 A;  1FK9 A;  3ZSV A;  5HRO A;  1RT2 A;  3WNG A;  4CE9 A;  1FXX A;  2GV9 A;  1BI4 B;  5J2M A;  2XY6 A;  4KKO A;  1FKP A;  3OVN A;  1TKX A;  2KZM A;  3OYL A;  3P1G A;  2O4I A;  4H8K A;  5FRO A;  4DTP A;  4DU4 A;  3QEX A;  3AV9 A;  3CFP A;  4FJ5 A;  3L2V A;  3HM9 A;  4W5O A;  3V4I A;  4CED A;  3L3U A;  3KJV A;  1NKE A;  2YHA A;  4C8K A;  5T7B A;  3S9H A;  1SV5 A;  1UWB A;  2XY8 A;  3NF6 A;  3LP1 A;  5HRR A;  4CGJ A;  1XHX A;  4Z4H A;  2BAN A;  3OYG A;  3K5M A;  3SV4 A;  4DS4 A;  4NCB A;  4TSX A;  3OYF A;  5C24 A;  4CEF A;  4N5S A;  4CEB A;  3KKR A;  1LWC A;  1VSK A;  1HRH A;  4FLW A;  1IKX A;  5C42 A;  1WSF A;  3NCI A;  3RMC A;  4DSL A;  4H4M A;  4E7J A;  2BE2 A;  4DF8 A;  2D0A A;  3AVI A;  4AIL C;  3AVM A;  4G1Q A;  2Z1J A;  3TWH A;  3KK3 A;  4DSJ A;  4CJL A;  4JS5 A;  5FRM A;  2LSN A;  1RT3 A;  3TAB A;  4F8R A;  5CYM A;  5KGX A;  3LWL A;  4CJF A;  3NH2 A;  3F9K A;  2EX3 A;  2X74 A;  2P1J A;  3E01 A;  4FJM A;  4W5R A;  1Q8I A;  5HP1 A;  3QEP A;  3HL8 A;  1JLA A;  4CF8 A;  4KV8 A;  4CER A;  1WSE A;  3PUF A;  4UQG A;  2OZS A;  4KI6 A;  3LDS A;  4E7I A;  3M8S A;  1NKC A;  1SKS A;  3ZSR A;  3L2R A;  3TAP A;  1EX4 A;  1S9G A;  2HNZ A;  4CF0 A;  3V9X A;  1ZBH A;  3DLG A;  2HHU A;  1I39 A;  1IKW A;  4GMJ B;  1WLJ A;  3LPT A;  4CEE A;  3RMA A;  2P5G A;  4DS5 A;  4C8N A;  4IFY A;  2G8I A;  4O4G A;  3KLI A;  4CF1 A;  3D0P A;  3QLH A;  1HPZ A;  4CHO A;  1YTA A;  4DLG A;  3U3Y A;  3SJJ A;  2G8V A;  2HB5 A;  4DFM A;  2PYJ A;  3VQ8 A;  1RT1 A;  1LAW A;  2Y1J A;  3L2W A;  4GVM A;  1CLQ A;  4DQR A;  4CFD A;  4KHY A;  2FBY A;  1C0U A;  3WNE A;  4DU3 A;  3OS1 A;  3IS9 A;  3SNN A;  4I7F A;  2ZD1 A;  4FYD A;  4RW9 A;  1ZBL A;  5CY4 A;  1UOC A;  3NH1 A;  3V1Q A;  3VQQ A;  4KHQ A;  3TAR A;  4NYF A;  4I9L A;  3LZI A;  2ZE2 A;  4L8R B;  4OGC A;  4DTO A;  1QHT A;  2P51 A;  4CGF A;  1JLQ A;  4W5Q A;  4CHN A;  4CJ5 A;  4FZX C;  1Z25 A;  4ELT A;  4CK1 A;  3VQA A;  3RTV A;  2Q3S A;  4AHR A;  4XIU A;  3KLF A;  4IG0 A;  1VSD A;  4LH5 A;  1NK5 A;  4F3T A;  3V9Z A;  3QES A;  1NK7 A;  1RDC A;  3ISN C;  3QEW A;  4W5N A;  3V1R A;  1REV A;  2YNH A;  1WN7 A;  4NCA A;  5J1E A;  2HW3 A;  3AVG A;  3MEE A;  1RDA A;  3OYH A;  3TAQ A;  3OYB A;  3HVR A;  4ID1 A;  2DFE A;  3SQ1 A;  4DWI A;  1X9S A;  4M42 A;  1QQC A;  1T05 A;  3O4N A;  3TAF A;  2XY7 A;  4FLX A;  4KHN A;  3AA2 A;  1BIU A;  1ASW A;  3OJS A;  3DLK A;  3NGY A;  1NK6 A;  4F4K A;  4CIE A;  1S9E A;  3LAN A;  3HVT A;  5DK5 A;  3WNF A;  1HNV A;  3NGI A;  3AA5 X;  5J2Q A;  1U04 A;  4FJ8 A;  3K59 A;  4FLZ A;  2P5O A;  1I3A A;  4BDP A;  5FDL A;  3DOL A;  1NK0 A;  3C95 A;  4NCG A;  1B9F A;  2KZZ A;  1B9D A;  1S6P A;  1VSL A;  3L2U A;  4KHS A;  3VQ7 A;  2VWJ A;  3V6D A;  3HST B;  4CCH A;  1BQM A;  3DLE A;  3RMB A;  4ZHR A;  4YNQ A;  3AO5 A;  1LV5 A;  3IRX A;  4HVJ A;  4DSF A;  3HP9 A;  4QCL A;  3AVF A;  3VA0 A;  3NHG A;  4Z4G A;  3SUO A;  4KI4 A;  4HUE A;  2DTU A;  2FC0 A;  1U49 A;  4CJS A;  4J2E A;  1GOC A;  3OJU A;  4OLA A;  1NOY A;  4CHQ A;  1ITG A;  1XWL A;  5SZT A;  1RIL A;  4RW6 A;  4RW7 A;  4OKE A;  3C6T A;  1TKD A;  4PA1 A;  1JKH A;  1HQE A;  5C25 A;  1DTT A;  2QXF A;  3FFI A;  2VG5 A;  2OPS A;  3V9W A;  2X6S A;  1UAX A;  5DMR A;  1SKR A;  2OA8 A;  1VK0 A;  1TV6 A;  1S1U A;  3DLR A;  3VQP A;  2RF2 A;  3ZT0 A;  1LW0 A;  1QS4 A;  1X1P A;  4LSL A;  4KB1 A;  1CXU A;  4Y1D A;  4YFU A;  1NJY A;  4DTU A;  5JS2 A;  3K5O A;  3RR8 A;  1NK9 A;  3DRP A;  3SV3 A;  3RR7 A;  1WSG A;  4OPK A;  4ZTJ A;  1R0A A;  4M3T A;  3NAE A;  3LAL A;  4K8X A;  2Z1I A;  2IAJ A;  3HPH A;  3ZT2 A;  4CJR A;  1RT7 A;  4DSE A;  3NE6 A;  4CGH A;  4BE1 A;  1W0H A;  4DLE A;  3PX6 A;  5KI6 A;  1A5X A;  1BIZ A;  4CFA A;  1C1A A;  4FLU A;  1KSP A;  2KQ2 A;  3ZT1 A;  3CYM A;  2E6L A;  4FVM A;  1C0M A;  4CJT A;  4FXD A;  4CEO A;  1GOB A;  2OZM A;  2HHQ A;  4RG8 A;  4DTM A;  1F21 A;  4O44 A;  3VQD A;  1TVR A;  3MXM A;  2HHV A;  3G10 A;  3TAM A;  3JSM A;  1JL2 A;  2X6N A;  3ASM A;  4M3X A;  4M3R A;  4BE2 A;  1JLB A;  3QNO A;  1TK5 A;  1EP4 A;  3M8Q A;  5FRN A;  3KK2 A;  4AHV A;  3DI6 A;  4Z0U A;  1U45 A;  1WAF A;  1SUQ A;  1BIS A;  2D0C A;  2R7Y A;  4CJK A;  3K58 A;  3DLH A;  4CHY A;  3O3G A;  3JYT A;  3NBP A;  3ZSY A;  4M3Y A;  2HMI A;  2F8S A;  1HYS A;  1BGX T;  3KK1 A;  4DU1 A;  2QKB A;  3PY8 A;  1VSM A;  3KLE A;  3MXI A;  4FLY A;  4E3S A;  1UA1 A;  4F3O A;  1J54 A;  1TKZ A;  1VSE A;  3D45 A;  3WNH A;  2O4G A;  4CK2 A;  1KVC A;  3LAM A;  1HJR A;  2IGI A;  1N5Y A;  1Q9Y A;  1N6Q A;  4N47 A;  2E6M A;  4QAG A;  2EHG A;  1KTQ A;  1JXB A;  1JLG A;  1D9F A;  2ITG A;  2YHB A;  4FJN A;  4DSI A;  1RDB A;  1WNS A;  1BCM A;  4B9S A;  1WSJ A;  4B9U A;  4MFB A;  3KLH A;  1S5J A;  2JGU A;  3F73 A;  2PZS A;  4IKF A;  4M3W A;  3SYZ A;  4KO0 A;  2B6A A;  3AVK A;  3DRR A;  4I2Q A;  3LP2 A;  3TAE A;  1T7P A;  2G8K A;  2D0B A;  2WOM A;  4OGE A;  1CZB A;  4OJR A;  3SI6 A;  4M3U A;  4C8M A;  1B92 A;  1RT5 A;  4RW8 A;  3ZSQ A;  1LW2 A;  4OKK A;  3ULD A;  4DFJ A;  1TK8 A;  2Y1I A;  1L3S A;  3AVB A;  3QO9 A;  4HCB A;  3OYN A;  3AO4 A;  4CEA A;  5KTQ A;  4FK4 A;  1KVB A;  3SQ0 A;  4HTU A;  4PWD A;  2XRI A;  4DFK A;  1RTH A;  3CM6 A;  3SQ2 A;  2E4L A;  1FKO A;  2IOC A;  2G8W A;  1CZ9 A;  3ZT3 A;  4N76 A;  3CM5 A;  3OS2 A;  4JLH A;  4O0I A;  3IAY A;  4CJP A;  1QE1 A;  1EXQ A;  3MED A;  1IKY A;  4E1N A;  3OYM A;  3V1O A;  4BDY A;  1NJW A;  4FZY A;  3L8B A;  1A5V A;  1RBV A;  3EY1 A;  5HRN A;  1DTQ A;  3AO2 A;  1NK4 A;  1KLM A;  4LD0 A;  3OYC A;  3PV8 A;  4Q0B A;  3MXJ A;  1ZYQ A;  1W9H A;  3TAG A;  3P5J A;  3K5L A;  3OYA A;  1UA0 A;  1MU2 A;  4B3O A;  4CGG A;  3OS0 A;  1K6Y A;  4ELV A;  4EP4 A;  1S1X A;  1L3U A;  1RTI A;  2YV0 X;  3AA4 A;  4LY7 A;  4J2D A;  5HRS A;  1NKB A;  4FLV A;  5D3G A;  3NF7 A;  1RBT A;  3H08 A;  4DTJ A;  3NF8 A;  4PUO A;  3RRG A;  2KFN A;  2AJQ A;  4CJ3 A;  4WE1 A;  3ZCM A;  3VQB A;  5I42 A;  2DY4 A;  2VG7 A;  3KLG A;  5HBM A;  1KFD A;  1RTD A;  1QSY A;  1NJX A;  4EZ9 A;  1Y97 A;  3ALY A;  4CJE A;  3OYE A;  5CZ2 A;  2XHB A;  1TL1 A;  2W42 A;  1YT3 A;  4DTR A;  4IG3 A;  3HT3 A;  4LH4 A;  1RDD A;  2YKM A;  4DQQ A;  3HK2 A;  1YVU A;  4CJW A;  1O1W A;  1IO2 A;  1GOA A;  3O3H A;  1S1W A;  5JS1 A;  3CQ8 A;  1RCH A;  2B5J A;  3BDP A;  2YNI A;  4O5B A;  1KFS A;  1BHL A;  4CHZ A;  1BL3 A;  1HMV A;  4BWM A;  4M41 A;  4ZTF A;  1T03 A;  4CHP A;  3NF9 A;  3SPZ A;  4AHT A;  1LWF A;  3T19 A;  4CGD A;  4CEZ A;  3K5N A;  1KLN A;  4N41 A;  1EET A;  1LWE A;  1VSF A;  2ATQ A;  3SUP A;  1L5U A;  1C0T A;  4KAZ A;  3C6U A;  4IBN A;  4KRF A;  3NFA A;  3HO1 A;  4B08 A;  4KFB A;  4FM1 A;  3NGZ A;  3ZSW A;  1TAU A;  1HYV A;  4AHU A;  3SQ4 A;  4KPY A;  4DTN A;  1Q9X A;  3VQE A;  1KRP A;  1U4B A;  2F96 A;  4CJV A;  5CYQ A;  1U47 A;  2VWK A;  3IG1 A;  1HYZ A;  4CEQ A;  3SUN A;  3K2P A;  4C8O A;  3B6O A;  4NYN A;  1EKE A;  3LZJ A;  4E0D A;  3QNN A;  3EYZ A;  1S1V A;  1IH7 A;  1ASU A;  3LAK A;  4CES A;  3SUQ A;  4KB0 A;  4F2S A;  5I3U A;  1LAV A;  3MEC A;  1U48 A;  2HHT A;  4DQS A;  4KHW A;  3MAQ A;  2BDP A;  3AVJ A;  5KRS A;  3O3F A;  3EZ5 A;  1IKV A;  1XC9 A;  1ASV A;  3RRH A;  4I2P A;  2HND A;  3S3O A;  1SL2 A;  1X9W A;  1WAJ A;  5KRT A;  2BGG A;  3VN5 A;  4IFV A;  2HHW A;  4O0J A;  4AH9 A;  3CG7 A;  4FJX A;  1ZBU A;  1KVA A;  1A5W A;  3S3M A;  2HVH A;  4CGI A;  4JS4 A;  1KCF A;  4FCY A;  3I0S A;  3ZSO A;  2G8H A;  2YKN A;  3KD5 E;  1J53 A;  4DTX A;  4DFP A;  1D8Y A;  4I9Q A;  2HHS A;  2XY5 A;  3ZT4 A;  4DSK A;  3G0Z A;  1D9D A;  2DFF A;  3DRS A;  3PO5 A;  4B8C A;  1TGO A;  1CXQ A;  4DF4 A;  2B4J A;  3AO3 A;  1TKT A;  4KHU A;  2HHX A;  2OPQ A;  2A1S A;  1HQU A;  3I8D A;  2PY5 A;  3OYJ A;  4CJU A;  1NJZ A;  4H4O A;  4FJG A;  3AVH A;  4FW1 A;  3SZ2 A;  2KFZ A;  4HCC A;  3O4Q A;  4DMN A;  2X78 A;  1SKW A;  1S1T A;  3HPG A;  1JLE A;  4DQP A;  4F2R A;  4FJI A;  2GUI A;  4J2A A;  4O55 A;  3VQ5 A;  2KTQ A;  3CFR A;  1TL3 A;  3AVN A;  4B9T A;  1T8E A;  2HVI A;  5HRP A;  3NDK A;  4HHT A;  1XI1 A;  3LPU A;  3P83 D;  4BDZ A;  1VSH A;  4OPJ A;  1DLO A;  4IDK A;  1J9A A;  3ZSZ A;  3ITH A;  3SPY A;  4N56 A;  1RTJ A;  4CF9 A;  3AA3 A;  1G15 A;  3AVA A;  3L2Q A;  3V9U A;  4J2B A;  4FJK A;  4E19 A;  1BCO A;  4CF2 A;  5J2P A;  3KIO A;  3K57 A;  3U3G A;  4HUG A;  1RT4 A;  4CIF A;  4KTW A;  3M8P A;  1YTU A;  3UIQ A;  1JXE A;  4RW4 A;  4K8Z A;  3OYD A;  2QK9 A;  1RBS A;  4DG1 A;  3RMD A;  1S6Q A;  4CFC A;  3DMJ A;  2OPP A;  4E7L A;  3HJF A;  4ID5 A;  2FBX A;  3HPO A; 
#chains in the Genus database with same CATH topology
 1NK8 A;  2NRR A;  3CET A;  1VQ9 N;  3TTF A;  3O08 A;  4IXC A;  4DV6 K;  3THX B;  4AHC A;  1JCG A;  3ATU A;  3AVC A;  3AGK A;  4LFA K;  3L4I A;  1RT6 A;  3J7A P;  3TR8 A;  4MLH A;  2QWR A;  1TYQ B;  3QER A;  5E41 A;  2V7Z A;  3EL2 A;  2ETJ A;  4JI2 K;  3PX4 A;  4Q5V A;  1NMN A;  2RKI A;  4R5P A;  3FGU A;  2UU9 K;  4KHP K;  4PQU A;  4Z4E A;  1NGG A;  2PYL A;  1BQN A;  1VQP N;  3A5O C;  4JI0 K;  1VSJ A;  4FWQ A;  3OYI A;  1JL1 A;  3M8R A;  3HYF A;  2G8F A;  4ISG A;  1JCE A;  5EOY A;  3QIP A;  3PO4 A;  4LSN A;  2Z1H A;  2QWN A;  3QEV A;  3OHR A;  3WXM B;  3RWU A;  3MEG A;  1JLC A;  2JLE A;  3CJ1 A;  3TI0 A;  4E1M A;  4JD2 B;  2HHH K;  4PY5 A;  1C6V A;  3N4Q A;  3GL1 A;  1C0F A;  1YI2 N;  5AQT A;  3M5R A;  4B8A B;  4DV2 K;  1D5A A;  2ZQB A;  3BF3 A;  1IG8 A;  2E88 A;  2UUA K;  4U67 L;  2IC3 A;  1NOZ A;  3OYK A;  3T3F A;  4L3Q A;  3MN7 A;  2F7T A;  4BGA A;  3LWM A;  2W40 A;  2HNY A;  1VSI A;  2NUB A;  3CCV N;  3QET A;  3AAP A;  3F2K A;  4FM0 A;  4B1U B;  3VGL A;  5GIO A;  1OH6 A;  5CZ1 A;  2D4W A;  2XY6 A;  2JWL A;  3VET A;  3CFP A;  3KK7 A;  4W5O A;  3V4I A;  4BG9 A;  4K43 A;  3L3U A;  1NKE A;  2YHA A;  3E9L A;  5T7B A;  3S9H A;  2XY8 A;  3C7N B;  5FPN A;  5C24 A;  4CEB A;  5HOO A;  2O8F A;  1N34 K;  4FLW A;  4PKG A;  1HNX K;  3RMC A;  3AAQ A;  3VEZ A;  4H4M A;  1S22 A;  3MDQ A;  3AVI A;  4AIL C;  1VQ5 N;  4CZI A;  3KK3 A;  4DSJ A;  4JS5 A;  3TAB A;  3ATV A;  5CYM A;  3UB5 A;  3BP8 A;  4CJF A;  2EX3 A;  2X74 A;  2P1J A;  3VTI A;  2E2P A;  3R6M A;  5M1Q A;  3IMX A;  4UQG A;  4CF0 A;  3G71 N;  1I39 A;  4BRI A;  2OTJ N;  1WLJ A;  5E84 A;  3CD6 N;  1LCU A;  3RMA A;  2P5G A;  2UXD K;  3HRG A;  3KLI A;  4CF1 A;  1XNR K;  4I6M B;  1YTA A;  5EY4 A;  3J8A A;  2HB5 A;  2O8F B;  3VQ8 A;  3SAH A;  3D6R A;  3LDQ A;  4CFD A;  2FBY A;  4DU3 A;  4JNE A;  5AQX A;  3SNN A;  2O8D B;  1DKG D;  4A57 A;  4FYD A;  2AA4 A;  5CY4 A;  5CHI A;  4YOY A;  4MO5 A;  3NH1 A;  3QDK A;  4I9L A;  4OGC A;  4DTO A;  1ATR A;  3U8X A;  1Z25 A;  4H5R A;  4ELT A;  4AHR A;  2RE2 A;  4XIU A;  3DXM A;  3QES A;  1NK7 A;  1RDC A;  4KH5 A;  3V1R A;  5DM6 L;  2UUC K;  1WN7 A;  5J1E A;  4X62 K;  4WFN L;  3HVR A;  4ID1 A;  1MA9 B;  2DFE A;  4DWI A;  1X9S A;  4M42 A;  1QQC A;  3O4N A;  1YIT N;  2XY7 A;  4CZJ A;  3DLK A;  3DXK A;  4CIE A;  1HJO A;  5M1F A;  3HVT A;  4KBO A;  1HNV A;  3AA5 X;  1U04 A;  2P5O A;  4BDP A;  2FXU A;  1B9F A;  2KZZ A;  1S6P A;  1VSL A;  3L2U A;  5LMN K;  4PL7 A;  3CCS N;  4KHS A;  4CCH A;  1BQM A;  4BRQ A;  3AO5 A;  4QCL A;  3AVF A;  4B3S K;  3VMF B;  2FC0 A;  3DXM B;  1U49 A;  4OLA A;  3HOS A;  1ITG A;  3O9U A;  4RW7 A;  1JKH A;  1DTT A;  1SKR A;  5AJ3 K;  3KHY A;  1TV6 A;  3VQP A;  2RF2 A;  1X1P A;  3BEX A;  5JS2 A;  3RR8 A;  1NK9 A;  4CJR A;  4O5F A;  3M1F A;  4CGH A;  2PAV A;  3PX6 A;  4A5A A;  1C1A A;  3GE1 A;  4FVM A;  4CJT A;  4DV1 K;  1GOB A;  3O4W A;  1F21 A;  3VQD A;  2WUS A;  3MXM A;  4Z94 A;  2X6N A;  2QW9 A;  4M3R A;  3MWP A;  1EP4 A;  3PSF A;  4AHV A;  1U45 A;  5ADX A;  3CIP A;  3I55 N;  5H1S Q;  2W6L A;  3T69 A;  2HMI A;  2HBK A;  2F8S A;  1HYS A;  4DU1 A;  2QKB A;  2F9T A;  3KLE A;  1X9J A;  4F3O A;  4BR0 A;  4PKI A;  4N47 A;  4QAG A;  1KTQ A;  1JXB A;  1D9F A;  3JAM O;  1LOT B;  3FZF A;  5AQW A;  4LFB K;  2JGU A;  2B6A A;  1S72 N;  3TAE A;  2G8K A;  3SK3 A;  1B92 A;  3ZSQ A;  2HOE A;  1L3S A;  3AVB A;  3VGM A;  5KQ8 A;  4FK4 A;  4HTU A;  1FKO A;  3K9J A;  3TTC A;  1GLJ O;  4B3T K;  4N76 A;  4K0K K;  3DJC A;  2P9P A;  4CJP A;  3MED A;  1DEJ A;  1IKY A;  4BDY A;  1NJW A;  2P9U B;  1A5V A;  4JKD A;  3CXC M;  4Q0B A;  2W6K A;  1W9H A;  3TAG A;  3ZET A;  4RCH A;  4JKG A;  4J2D A;  4JKH A;  4CI6 A;  1IBM K;  3C6A A;  4FLV A;  3NF7 A;  1GLD G;  4JK8 A;  4B3M K;  4DHY A;  1BU6 O;  3ZCM A;  3VQB A;  2DY4 A;  2VG7 A;  3KLG A;  1RTD A;  3ALY A;  3BZC A;  3Q7C A;  2W42 A;  1YT3 A;  4DTR A;  4LH4 A;  1RDD A;  2YKM A;  4DQQ A;  4CJW A;  1S1W A;  3CQ8 A;  2E2O A;  2P9P B;  1K9M O;  3BDP A;  2YNI A;  4GY2 B;  4CEZ A;  1LWF A;  3BZK A;  2EWS A;  1VSF A;  1LWE A;  1J5E K;  2ATQ A;  1I94 K;  2E2Q A;  1KXP A;  1ILY A;  3EO3 A;  1ZC6 A;  3NFA A;  5AQZ A;  3P39 A;  3ZET B;  3HO1 A;  1FW6 A;  3NGZ A;  4KPY A;  4H5N A;  4YOU A;  3VEW A;  2VQE K;  1NLV A;  3VQE A;  1U4B A;  2F96 A;  2VWK A;  1YJ9 N;  3LZJ A;  3EYZ A;  1JJ2 M;  2HHT A;  5KRS A;  3O3F A;  1ASV A;  3M3Z A;  1YIJ N;  3S3O A;  1HPM A;  3CCR N;  4AH9 A;  5M1O A;  2HVH A;  4JS4 A;  4H0Y B;  1KCF A;  4FCY A;  2YKN A;  3TU5 A;  3S41 A;  4DFP A;  1D8Y A;  2XY5 A;  3ZT4 A;  2WTU A;  3G0Z A;  3OA9 A;  3I56 N;  1EWR A;  1D9D A;  3DRS A;  3PO5 A;  4B8C A;  1TGO A;  4DF4 A;  2B4J A;  3AO3 A;  2OPQ A;  3AY9 A;  2GEM A;  2KKZ A;  3HOT A;  4JKB A;  4CJU A;  1NJZ A;  4CW7 B;  4H4O A;  2QWQ A;  2ASM A;  3AVH A;  5GIN A;  4H5V A;  4DMN A;  4J2A A;  1SKW A;  1RFQ A;  3VQ5 A;  3W3D A;  4B9T A;  1NGI A;  1YF5 L;  4GV6 A;  5HRP A;  3NDK A;  3LPU A;  1BWF O;  3P83 D;  4BDZ A;  1VQK N;  1R59 O;  4ILJ A;  3E66 A;  1J9A A;  4N56 A;  3W0L A;  3CC7 N;  1RTJ A;  2Q36 A;  4BQL A;  1G15 A;  3AVA A;  4FJK A;  4CF2 A;  3SBT A;  4KTW A;  2P9N A;  1YTU A;  3OYD A;  3SMS A;  5TKY A;  2QK9 A;  1EQY A;  3HJF A;  2OPP A;  5JLF A;  2YNG A;  2I5J A;  5FLX O;  4FJJ A;  4B9V A;  2J4R A;  4GW6 A;  5HLF A;  4JYA K;  1QVG M;  3VQ6 A;  2DFH A;  4BRA A;  3IFR A;  4FJH A;  2RHK A;  3D2F A;  1TK0 A;  4E1J A;  3L0Q A;  4WQ5 A;  4MLE A;  3LP3 A;  1Z6R A;  3AO1 A;  4BVP A;  1Q7Y O;  2RPI A;  5BRH A;  1Z26 A;  4BRM A;  5J2N A;  3TAN A;  1XHZ A;  4BG8 A;  4CIG A;  4BAC A;  3MX5 A;  1HNI A;  2GWK A;  2A5X A;  1JLF A;  4A5B A;  4JV5 K;  3WUH A;  2ASO A;  2Q0R A;  4FLT A;  1VRU A;  2GTD A;  2P9I A;  2VG6 A;  3EN9 A;  3VQ9 A;  4MO4 A;  2OYQ A;  4FW2 A;  2A1R A;  2A3Z A;  4ILH A;  1BI4 A;  4RWT A;  3V9S A;  1ZBI A;  3KTQ A;  5CR4 A;  2QKK A;  2P9S A;  1IG9 A;  2OTL N;  4CZF A;  1NGB A;  1RNH A;  3T1A A;  4BE0 A;  4H5W A;  3U9Z A;  3U4L A;  2P9L A;  4E7K A;  4QS9 A;  3NH0 A;  3A5L C;  3WQT A;  4DV7 K;  5KGW A;  4BRL A;  5K14 A;  3KD1 E;  4EZ6 A;  4KTQ A;  3QEI A;  1VRT A;  3A2F A;  1TAQ A;  4J8F A;  2NRV A;  4Y1C A;  3THV A;  5AQO A;  5KPZ A;  3HI0 A;  1SL1 A;  3VF6 A;  3VER A;  5BR8 K;  2G8U A;  4W5T A;  1YXQ A;  4CK3 A;  3A0I X;  1J5O A;  3P38 A;  4B1V A;  1BI4 B;  5J2M A;  3CJA A;  1WUA A;  3OVN A;  1TKX A;  4ISF A;  4H8K A;  4DTP A;  1C0G A;  4DU4 A;  3AV9 A;  2P9S B;  5AQI A;  1VQ6 N;  5HRR A;  1UWB A;  3SV4 A;  4NCB A;  3K5M A;  2P9L B;  4AF1 A;  4N5S A;  1BG3 A;  3FFK B;  4B1W B;  1ZBS A;  5C42 A;  2GEL A;  3L4Q A;  1HKG A;  2BE2 A;  2I7N A;  4H5T A;  2V51 B;  1K73 O;  3TWH A;  2D1K A;  4GV9 A;  5FRM A;  2LSN A;  4BRF A;  4WFA L;  4KH6 A;  2YCH A;  3LWL A;  1MWM A;  4BC3 A;  3NH2 A;  3HL8 A;  1JLA A;  4CF8 A;  4KI6 A;  4CD3 A;  4EIA A;  4E7I A;  3M8S A;  1NKC A;  4IZ9 A;  1SKS A;  3V9X A;  2HNZ A;  3IDH A;  4FL9 A;  4JI6 K;  3H1Q A;  1MWK A;  1HPZ A;  3LM2 A;  3U3Y A;  1LAW A;  4JD2 A;  3L2W A;  4GVM A;  1CLQ A;  4KHY A;  1E3M A;  3WNE A;  5LY3 A;  3IS9 A;  4I7F A;  1QVF M;  2ZD1 A;  3T7Z A;  4H0O A;  5AFU H;  4RW9 A;  1OVQ A;  1N36 K;  3NVM A;  3VQQ A;  4KHQ A;  5GAG P;  4NYF A;  4L8R B;  4CHN A;  1VQN N;  2E8A A;  3VQA A;  2QWL A;  1KAZ A;  3FZH A;  5BN9 A;  4OPA A;  4F3T A;  3V9Z A;  3FLC O;  3ISN C;  4A59 A;  1REV A;  1HNZ K;  3AVG A;  3MEE A;  3OYH A;  3TAQ A;  4DUY K;  3HTV A;  1NGA A;  1NGD A;  2HBM A;  2D0P A;  4FLX A;  1EWQ A;  4WF9 L;  3AA2 A;  1BIU A;  3O9R A;  5AQY A;  3NGI A;  5J2Q A;  1NU0 A;  3K59 A;  1NK0 A;  3C95 A;  4NCG A;  4BRP A;  3MN5 A;  3VEV A;  3C7N A;  5FPD A;  3VQ7 A;  2VWJ A;  3V6D A;  3HST B;  2DPN A;  4YNQ A;  3IRX A;  4YOW A;  3HP9 A;  3SJH A;  4HUE A;  2DTU A;  2QWM A;  1NOY A;  1XWL A;  4BRN A;  5SZT A;  1RIL A;  4JKF A;  3CCQ N;  5LJW A;  4IDH A;  5BR9 A;  5C25 A;  1YUW A;  3FFI A;  3V9W A;  2X6S A;  2OA8 A;  1VK0 A;  5C2D A;  1LW0 A;  1QS4 A;  1CXU A;  1NJY A;  4IO8 A;  3QFU A;  4K25 A;  3DRP A;  4ZTJ A;  1SS6 A;  3LAL A;  4K8X A;  2Z1I A;  1GLL O;  3HPH A;  4DSE A;  2FSJ A;  3VEX A;  1A5X A;  1SAZ A;  3GG4 A;  4F9O A;  2A41 A;  2CGK A;  1G99 A;  4CBU A;  4B1X B;  2HHQ A;  4RG8 A;  4I6M A;  2HHV A;  1HNW K;  3KK2 A;  4CBX A;  2O8D A;  4JI4 K;  3CCU N;  3MWT A;  4CZM A;  5BPM A;  3JYT A;  1VQO N;  1BGX T;  3ID8 A;  3LM9 A;  4E3S A;  1J54 A;  1VSE A;  3D45 A;  3ZX0 A;  2O4G A;  4CK2 A;  4DV0 K;  3PSI A;  2IGI A;  1N5Y A;  1Q9Y A;  2EHG A;  5FPM A;  2Q1N A;  3LL3 A;  4B1Y B;  2D0O A;  4MFB A;  3KLH A;  3F73 A;  4LF9 K;  4M3W A;  4CJ7 A;  3RSE A;  4OGE A;  1CZB A;  4OJR A;  5TKW A;  4OKK A;  3SAG A;  4NXN K;  4H0T B;  1QZ6 A;  4JK9 A;  4CEA A;  5KTQ A;  2BTF A;  2O8C A;  1RTH A;  3CM6 A;  2E2N A;  2IOC A;  4MDA A;  3CM5 A;  3OS2 A;  4DB3 A;  4O0I A;  1EXQ A;  3OYM A;  4FZY A;  3L8B A;  3OYC A;  4LD0 A;  3VEY A;  3RVC A;  5GAE P;  4H03 B;  3M6G A;  3K5L A;  1KAX A;  3OYA A;  1UA0 A;  2YX6 A;  3H6E A;  4GVE A;  4EP4 A;  1S1X A;  1RTI A;  4WQ5 C;  4LY7 A;  1NKB A;  3VEN A;  1W7A A;  4DCH A;  3NF8 A;  2AJQ A;  3RSE B;  3PIO L;  3HM8 A;  3R3L A;  4WE1 A;  5HL7 L;  5DM7 L;  3D2E A;  1KFD A;  3WXI A;  1QSY A;  4EZ9 A;  1Y97 A;  5CZ2 A;  2O8C B;  2Q97 A;  4DR1 K;  1SQK A;  1SZ2 A;  3D7E O;  2B5J A;  4PHT X;  3G4S N;  4BWM A;  1VQ8 N;  4BR2 A;  1NM1 A;  4CHP A;  4CGD A;  3T19 A;  3VF2 A;  1HR0 K;  1EET A;  4OX9 K;  2ZGY A;  4IBN A;  4FM1 A;  1TAU A;  2IVP A;  3SQ4 A;  1KRP A;  4CJV A;  4EHU A;  5CYQ A;  1U47 A;  3THW B;  1U2V A;  3IG1 A;  4CEQ A;  3WXK A;  3FZM A;  3K2P A;  1EKE A;  3CQX A;  3QNN A;  1S1V A;  4CES A;  3LAK A;  3SUQ A;  4KB0 A;  3D2E B;  2QWO A;  3MEC A;  4DR3 K;  4DQS A;  3MAQ A;  3AVJ A;  4C1N K;  4AQY K;  3EZ5 A;  1BO5 O;  3O80 A;  1XC9 A;  4DR5 K;  1X9W A;  5KRT A;  2HHW A;  4FJX A;  1ZBU A;  2E5L K;  1D4X A;  2NZT A;  3SMP A;  3EE8 A;  4I9Q A;  5M1N A;  1VQ7 N;  4BR4 A;  2NRT A;  4YDU A;  1P8Z A;  4DSK A;  2DFF A;  3OTO K;  3PLA A;  1TKT A;  5IWA K;  3I8D A;  1U2V B;  2P9U A;  4JK7 A;  4H0P A;  5JMV A;  1S1T A;  4DQP A;  2GUI A;  3G6E N;  1TL3 A;  3I33 A;  1Q81 O;  1VSH A;  1BUP A;  4OPJ A;  1DLO A;  4BR5 A;  4RTF D;  3SPY A;  1YAG A;  4CF9 A;  4V19 S;  3V9U A;  4BR7 A;  3K57 A;  3U3G A;  3SAF A;  3ZX3 A;  3M8P A;  2I7P A;  4K8Z A;  1RBS A;  4DG1 A;  2FBX A;  5AQN A;  3PX0 A;  3O1B A;  3A5M C;  5GAH P;  4OKJ A;  4JRQ A;  4KRE A;  4C23 A;  3HP6 A;  4Z4I A;  1KD1 O;  4EP5 A;  4YHH K;  4DQ8 A;  1GLE G;  1HLU A;  1OKJ A;  2FLO A;  3QIN A;  3DYA A;  4FM2 A;  3CFO A;  1RBR A;  4EFH A;  4Z4C A;  4CFB A;  1N33 K;  4BRH A;  2FBT A;  4BRD A;  4M3Z A;  1M90 O;  2D5R A;  3T1H K;  4IFE A;  1IBL K;  4FK0 A;  1QSL A;  3DLB A;  5AQJ A;  3WXL A;  1IJJ A;  2IDO A;  1ZXO A;  2YHY A;  1H1V A;  5A2Q O;  4IOX A;  3H3O B;  3ZX2 A;  2YHX A;  1SL0 A;  1QQM A;  4LF8 K;  3V81 A;  4JKC A;  4BWJ A;  2XO7 A;  4CJQ A;  3I0R A;  4BGB A;  1QTM A;  3DOK A;  3U6F A;  1X3M A;  4AHS A;  4ELU A;  5EU7 A;  2ZM6 K;  4OVL A;  4DTS A;  4DR4 K;  3TSU A;  3DM2 A;  1L3V A;  1QZ5 A;  1L3T A;  1C1C A;  4ICL A;  3L3V A;  2IS3 A;  4DR6 K;  3IUC A;  3HSC A;  2GBZ A;  2Z1G A;  4B9N A;  2RN2 A;  4JKE A;  5SWM A;  1WSH A;  3OY9 A;  4JRP A;  2BUP A;  2E1Y A;  3AVL A;  4FJL A;  5HRO A;  3WNG A;  1FXX A;  2GV9 A;  2VCP A;  2BH1 A;  4KKO A;  1NWK A;  3OYL A;  2JWK A;  2V7Y A;  4FJ5 A;  4B9Q A;  3I8B A;  3HM9 A;  1VQ4 N;  3HZ6 A;  3KJV A;  2OAN A;  3NF6 A;  3LP1 A;  2FF6 A;  3OYF A;  3KKR A;  1K8A O;  1LWC A;  4EHT A;  4NLC A;  3NCI A;  4ISE A;  4DSL A;  4E7J A;  4NO7 A;  2D0A A;  3AVM A;  4G1Q A;  4CJL A;  3NVK A;  3FZK A;  3QFP A;  1Q8I A;  1NGJ A;  3O9Q A;  4CER A;  1WSE A;  2HMP A;  2OZS A;  3LDS A;  3L2R A;  3TAP A;  1S9G A;  1ZBH A;  4M7Y A;  2HHU A;  3CF5 L;  1ATS A;  4CZE A;  3CCJ N;  4DS5 A;  4IFY A;  3MK6 A;  3TPQ A;  3UKR A;  4O4G A;  3QLH A;  3EKU A;  3SJJ A;  2G8V A;  2PYJ A;  4DFM A;  4YY3 K;  3J80 O;  1GLC G;  4DQR A;  3QBX A;  3DAW A;  1ZBL A;  1UOC A;  4DR2 K;  3TAR A;  3LZI A;  3P31 A;  4CGF A;  1JLQ A;  4W5Q A;  5KPT A;  4FWO A;  3UKU B;  1BDG A;  2H3G X;  3KLF A;  4LH5 A;  1VSD A;  3ULE B;  1NK5 A;  2VQF K;  4BC5 A;  3GOI A;  4W5N A;  1OH7 A;  3JS6 A;  2ZJQ L;  4NCA A;  2HW3 A;  3OYB A;  1HUX A;  3UKR B;  1KQS M;  3SQ1 A;  3TAF A;  4KHN A;  3LDO A;  3OJS A;  1ASW A;  5AQV A;  3NGY A;  1NK6 A;  2Q31 A;  2V52 B;  4F4K A;  3LAN A;  2GUP A;  1CZA N;  5DK5 A;  1XNQ K;  4WFB L;  3EZW A;  1VAZ A;  3ZYY X;  4B3R K;  1NG9 A;  1B9D A;  3B8A X;  3VF4 A;  3DLE A;  3RMB A;  4ZHR A;  1LV5 A;  4DSF A;  1HX1 A;  1U6Z A;  3VA0 A;  3NHG A;  3CCM N;  4KI4 A;  3BY5 A;  1GOC A;  3G25 A;  3JXU A;  4OKE A;  1TKD A;  1HQE A;  2OPS A;  5DMR A;  3O6W A;  1S1U A;  3C0B A;  4KB1 A;  3FZL A;  3ZT0 A;  1K8K B;  5B8H A;  3O9T A;  4YFU A;  2HBL A;  4DTU A;  3SV3 A;  3RR7 A;  4LF7 K;  1WSG A;  1R0A A;  4JI8 K;  3J7Y P;  4FOI A;  3ZT2 A;  3EKS A;  3NE6 A;  4BE1 A;  1BIZ A;  4CFA A;  1XQS C;  4BQZ A;  4FLU A;  1KSP A;  2KQ2 A;  3ZT1 A;  3CYM A;  4IOA L;  2OZM A;  3L6Q A;  2Q0U A;  3A8Y A;  1JL2 A;  4X66 K;  3ASM A;  3TSP A;  4FPB A;  2HF3 A;  3CJ7 A;  4BE2 A;  4M3X A;  1JLB A;  1TK5 A;  3CHW A;  3M8Q A;  5FRN A;  1DGK N;  2QXL A;  3DI6 A;  4Z0U A;  4YDU C;  4JI1 K;  2W41 A;  4DR7 K;  1SUQ A;  1BIS A;  2D0C A;  2R7Y A;  4CJK A;  3K58 A;  4CHY A;  3NBP A;  4Y0W A;  4MDB A;  3KK1 A;  1NJI O;  1S3X A;  3PY8 A;  3H1V X;  1VSM A;  3GDQ A;  1UA1 A;  5LL6 Z;  3GBT A;  3K0S A;  1HJR A;  1TUU A;  4FWM A;  4JHD A;  1JLG A;  2ITG A;  4FJN A;  4DSI A;  4DV5 K;  1RDB A;  1WNS A;  1BCM A;  4B9S A;  1WSJ A;  4XH4 A;  4IKF A;  3WEE A;  2PZS A;  3SYZ A;  4KO0 A;  3AVK A;  3VOV A;  4I2Q A;  2VGM A;  1T7P A;  4M3U A;  3SI6 A;  3BF1 A;  1TK8 A;  1RT5 A;  1LW2 A;  4HWI A;  1NMD A;  2Y1I A;  3E9O A;  1E4F T;  3QO9 A;  2IVO A;  3AO4 A;  3WT0 A;  3SQ0 A;  5AQH A;  3THY A;  3SBG A;  4DFK A;  4AM6 A;  5KPR A;  5LJV A;  5AZI A;  2E4L A;  3MN9 A;  3ZT3 A;  3CQY A;  5AR0 A;  4JLH A;  4LF5 K;  3IAY A;  1QE1 A;  2UYT A;  4XH1 A;  3V1O A;  4FVU A;  5HRN A;  1NK4 A;  3MXJ A;  4C1N I;  5BPN A;  3P5J A;  4JHD B;  5ADX H;  1K6Y A;  3CC2 N;  3CMA N;  2YV0 X;  4U7B A;  3WEE B;  1RBT A;  3H08 A;  4DTJ A;  4JAX A;  4PUO A;  1VHX A;  5I42 A;  2QI2 A;  5HBM A;  5AZJ A;  3MCA B;  4CJE A;  3IKM A;  3OYE A;  3THY B;  3HT3 A;  5AZI B;  4IO9 L;  1O1W A;  1IO2 A;  3O3H A;  5JS1 A;  1T03 A;  4M41 A;  1BL3 A;  1HMV A;  2WC9 A;  4ZTF A;  2IIR A;  3FR0 A;  3K5N A;  4M63 C;  4IOC L;  1N8R O;  4KAZ A;  4B08 A;  2QWP A;  1HYV A;  4AHU A;  1NNE A;  4DTN A;  1DT9 A;  1Q9X A;  4BC4 A;  4BRO A;  3QB0 A;  4FWN A;  4XH5 A;  4CVN E;  3B6O A;  4NYN A;  1XC3 A;  4CD1 A;  2F4V K;  3MMV A;  1ASU A;  5I3U A;  1LAV A;  1U48 A;  1NGH A;  5AZJ B;  5EVZ A;  1VQM N;  5BRF A;  1IKV A;  4CZK A;  4I2P A;  1NBW A;  5C0Y A;  1SL2 A;  4GKJ K;  3WXJ A;  2FSN A;  2WBN A;  3O8M A;  4IFV A;  3NMU A;  3CG7 A;  1KVA A;  1A5W A;  3S3M A;  3I0S A;  3ZSO A;  4DTX A;  4DV3 K;  4A62 A;  5AQS A;  4BRC A;  1MDU B;  3CI5 A;  4K42 A;  4PL8 A;  4KHU A;  2HHX A;  1NGE A;  3CJC A;  2A1S A;  1HQU A;  2CGJ A;  1NGC A;  3OYJ A;  4FJG A;  4HCC A;  4DV4 K;  2KTQ A;  4F2R A;  3R8E A;  4O55 A;  3CFR A;  3J81 O;  2HVI A;  2NRW A;  3KWI A;  2VGN A;  4HHT A;  2KLA A;  3OW2 M;  2NRZ A;  3A5N C;  3ZSZ A;  2ZF5 O;  3ITH A;  1HKC A;  3L2Q A;  4J2B A;  4E19 A;  1BCO A;  3KIO A;  4YOV A;  3MCP A;  2YHW A;  4NXM K;  4A61 A;  4RW4 A;  2HF4 A;  4JI7 K;  3ENB A;  5AQL A;  4E7L A;  4CFC A;  3HPO A;  2PBD A;  3ZSX A;  4FWS A;  4OLB A;  1OH5 A;  4CEC A;  4O8U A;  4HUF A;  2OPR A;  3QML A;  1XUP O;  5F2R A;  2NRH A;  4NB4 A;  2KW4 A;  4B9M A;  1O13 A;  4FJ9 A;  2VYP A;  3VQC A;  3HXM A;  4GV3 A;  4GKK K;  4FK2 A;  1ZBF A;  3THW A;  3C94 A;  4CBW A;  2NRX A;  5BPL A;  4DQI A;  1RBU A;  5GIP A;  3KWG A;  4Z4F A;  4QOZ B;  3VQ4 A;  3LP0 A;  2WON A;  4KTZ A;  3CPW M;  2FSK A;  4R79 A;  4MQ3 A;  2PFU A;  1VQL N;  1WBB A;  4M45 A;  3E9P A;  1V4S A;  4E89 A;  2YI1 A;  3B6P A;  5AQR A;  3S3N A;  3TSQ A;  3SCX A;  2A42 A;  4C8L A;  1X3N A;  1FJG K;  2YNF A;  3QIO A;  3BGR A;  1X9M A;  3UE5 A;  3VA3 A;  3LDP A;  3VPZ A;  2FBV A;  1QSS A;  3R9P A;  3KKS A;  4KH4 A;  4FJ7 A;  1JCF A;  4B9L A;  4CZG A;  4CJ4 A;  1WSI A;  4FSV A;  4WQ4 C;  4WYB A;  4E7H A;  3CJ9 A;  4IEE A;  2Q2R A;  1C1B A;  2F8T A;  4O8K A;  4FZZ A;  1RGI A;  3VTH A;  5BRE A;  1FK9 A;  3ZSV A;  1QQO A;  1RT2 A;  4CE9 A;  4BR9 A;  3DXK B;  1T6D A;  4WCE L;  1FKP A;  4M7X A;  2KZM A;  4FPA A;  2O4I A;  3P1G A;  1RDU A;  5FRO A;  3QEX A;  3L2V A;  1T44 A;  4CED A;  1KAY A;  5AFU A;  2YJF A;  4C8K A;  1SV5 A;  4CGJ A;  4Z4H A;  3OYG A;  1XHX A;  2BAN A;  4DS4 A;  4TSX A;  4G9Z A;  4CEF A;  3N4P A;  2CH5 A;  4JKA A;  1VSK A;  1HRH A;  1ESV A;  5AQM A;  1IKX A;  1P90 A;  3ZEU A;  1WSF A;  1GLA G;  4YOT A;  1BA1 A;  2E20 A;  2HBJ A;  4DF8 A;  5JIC A;  2GX9 A;  2F9W A;  2Z1J A;  5C15 A;  1WBD A;  1RT3 A;  4F8R A;  3CJB A;  5KGX A;  3F9K A;  4FJM A;  3E01 A;  2FF3 B;  4W5R A;  5HP1 A;  3QEP A;  5C2F A;  4KV8 A;  2UUB K;  3PUF A;  4CZL A;  3DLL L;  3ZSR A;  1EX4 A;  3DLG A;  4IJN A;  4GNI A;  1IKW A;  4OPH A;  4GMJ B;  3LPT A;  3PIP L;  4CEE A;  2G8I A;  4C8N A;  4YOX A;  5EXW A;  3CPE A;  3D0P A;  4CHO A;  4LF4 K;  4DLG A;  4YOR A;  1Z05 A;  4CZH A;  1RT1 A;  1GLF O;  2Y1J A;  1W2B M;  3ZEU B;  3MN6 A;  3DWL A;  1C0U A;  3OS1 A;  4A2A A;  3V1Q A;  4HTL A;  1W97 L;  2QM1 A;  2ZE2 A;  1QHT A;  2P51 A;  4JEP A;  4CJ5 A;  4BRG A;  4FZX C;  1BA0 A;  4CK1 A;  3RTV A;  2Q3S A;  4IG0 A;  1XMQ K;  3QEW A;  2YNH A;  1Y64 A;  4ILG B;  1RDA A;  1T05 A;  3E1Y A;  2GWJ A;  3VES A;  5JLH A;  1S9E A;  3WNF A;  3KVG A;  4FJ8 A;  1WOQ A;  4FLZ A;  4DKW A;  1I3A A;  3P4I A;  4DUZ K;  5FDL A;  3DOL A;  5JVG L;  2ZJP L;  3AGR A;  3O9S A;  2ZWH A;  1YJW N;  1Q86 O;  5I9E B;  4HVJ A;  4NLB A;  5F0X A;  4LF6 K;  4X64 K;  4Z4G A;  3SUO A;  3T1Y K;  4J2E A;  4CJS A;  3OJU A;  4CHQ A;  5GAD P;  2QA4 N;  4RW6 A;  3C6T A;  4PA1 A;  5CE3 A;  5FPE A;  4H0V B;  2ZJR L;  1E4G T;  2QXF A;  1YJN N;  2VG5 A;  3EEQ A;  2A40 A;  4JKG B;  4LC9 B;  1UAX A;  5JVH L;  3DLR A;  1EO1 A;  3MX2 A;  4LSL A;  4Y1D A;  3CCL N;  3K5O A;  1WB9 A;  4IJA A;  4M3T A;  4OPK A;  3NAE A;  3H3N O;  2IAJ A;  1RT7 A;  5BN8 A;  4DLE A;  1W0H A;  5KI6 A;  3TTD A;  2P9K A;  2ASP A;  2E6L A;  1C0M A;  3CER A;  5AQF A;  4FXD A;  4CEO A;  4DTM A;  4O44 A;  1TVR A;  3H46 O;  1YHQ N;  3G10 A;  3TAM A;  3JSM A;  3OBY A;  3QNO A;  1WAF A;  3LDN A;  3WQU A;  3KZB A;  5BRD A;  3DLH A;  4IWV A;  3O3G A;  1IV0 A;  3ZSY A;  4M3Y A;  1ATN A;  4BY9 C;  2NNW A;  3C6H A;  3MXI A;  4FLY A;  1TKZ A;  3UKU A;  3WNH A;  2O8E A;  1KVC A;  2VWB A;  3LAM A;  3ENO A;  3ULE A;  1N6Q A;  2E6M A;  4A2B A;  3C65 A;  2YHB A;  2QEX N;  3Q7B A;  2P9K B;  4B9U A;  5C12 A;  1GLB G;  1S5J A;  3DRR A;  5LMU K;  3LP2 A;  2D0B A;  1YVN A;  2WOM A;  4C8M A;  3VEO A;  4RW8 A;  3ULD A;  4DFJ A;  3QBW A;  1OH8 A;  2UXB K;  2ZGZ A;  4HCB A;  3OYN A;  1KVB A;  3OBW A;  4PWD A;  2XRI A;  3BUZ B;  1QHA A;  3SQ2 A;  1RDW X;  2G8W A;  1CZ9 A;  3CME N;  4E1N A;  5MLC Q;  1RBV A;  3EY1 A;  4JI5 K;  1DTQ A;  3AO2 A;  1KLM A;  3PV8 A;  2O8E B;  1ZYQ A;  1QQN A;  4FWK A;  4B3O A;  3HBT A;  1MU2 A;  3O1W A;  4BVO A;  1NGF A;  4CGG A;  3OS0 A;  4ELV A;  2CGL A;  1L3U A;  2QTD A;  3AA4 A;  2IVN A;  5HRS A;  5D3G A;  2KFN A;  3RRG A;  1K8K A;  4CJ3 A;  1BOT O;  3FE1 A;  3K9K A;  1NJX A;  2XHB A;  1TL1 A;  4QS8 A;  5KQD A;  2P9N B;  3AAR A;  4IG3 A;  3HK2 A;  3EE9 A;  1YVU A;  1GOA A;  4BRE A;  1RCH A;  3O5B A;  3F5T A;  4O5B A;  1KFS A;  1BHL A;  4CHZ A;  3ENH A;  3ID6 A;  4EAH D;  3NF9 A;  3SPZ A;  4AHT A;  1KLN A;  4N41 A;  3SUP A;  1L5U A;  1C0T A;  4WQ4 A;  3C6U A;  4KRF A;  4KFB A;  2OCE A;  1Q18 A;  3F9M A;  3ZSW A;  1KC8 O;  3D2F B;  5C10 A;  5AQQ A;  5AQK A;  1OVY A;  1HYZ A;  4X65 K;  3SUN A;  1TUY A;  2YJE A;  4C8O A;  4E0D A;  2O8B A;  1IH7 A;  3VGK A;  4F2S A;  5IT9 O;  3J7Z O;  4KHW A;  2A6A A;  1M1K O;  2BDP A;  4FWL A;  2HST A;  3RRH A;  2HND A;  3CC4 N;  5ELZ A;  1WAJ A;  4JI3 K;  2BGG A;  3VN5 A;  2UXC K;  4K41 A;  5M1P A;  4O0J A;  2CH6 A;  2P9I B;  4CGI A;  3U9D A;  3CCE N;  1XMO K;  4BRK A;  2G8H A;  3KD5 E;  1J53 A;  4IEI A;  4B1Z A;  2HHS A;  2AP1 A;  4FWP A;  4BC2 A;  1T6C A;  2NLX A;  5EX5 A;  1J6Z A;  3QIC A;  1CXQ A;  3ZLJ A;  4H0X B;  2WFB A;  1V4T A;  2PY5 A;  4XEI A;  2E1Z A;  3THX A;  4FW1 A;  3SZ2 A;  2O8B B;  4FOE A;  1IBK K;  2KFZ A;  3O4Q A;  2X78 A;  4FJI A;  3HPG A;  1JLE A;  4PKH A;  4AM7 A;  3R1X A;  4FWR A;  3LDL A;  3AVN A;  3SLC A;  4UY8 O;  1T8E A;  4FO0 A;  5AQG A;  1XI1 A;  3H45 C;  2KHO A;  5E26 A;  4OO1 J;  1Q82 O;  4IDK A;  1TYQ A;  4JN4 A;  4QS7 A;  1N32 K;  5AQU A;  3AA3 A;  2ITM A;  5J2P A;  4HUG A;  1RT4 A;  4CIF A;  5M1K A;  5F1X A;  3UIQ A;  1JXE A;  1HKB A;  3RMD A;  1T3V A;  1S6Q A;  3DMJ A;  5AQP A;  4ID5 A;  4LFC K; 
#chains in the Genus database with same CATH homology
 3PX0 A;  3ZSX A;  1NK8 A;  4OKJ A;  4OLB A;  4JRQ A;  4KRE A;  4CEC A;  4HUF A;  2YNG A;  2I5J A;  3HP6 A;  4Z4I A;  2OPR A;  4AHC A;  4EP5 A;  4FJJ A;  4B9M A;  2KW4 A;  4B9V A;  4GW6 A;  5HLF A;  4FJ9 A;  3VQ6 A;  3AVC A;  2DFH A;  3VQC A;  3HXM A;  3QIN A;  4FJH A;  3DYA A;  4FM2 A;  3CFO A;  1TK0 A;  1RBR A;  4Z4C A;  4CFB A;  1RT6 A;  4FK2 A;  1ZBF A;  3TR8 A;  3LP3 A;  2FBT A;  3AO1 A;  2RPI A;  1Z26 A;  5J2N A;  3C94 A;  4M3Z A;  3QER A;  5E41 A;  4DQI A;  1RBU A;  2ETJ A;  3PX4 A;  3TAN A;  1XHZ A;  4Q5V A;  2D5R A;  2RKI A;  4R5P A;  4FK0 A;  1QSL A;  3DLB A;  4Z4F A;  4QOZ B;  3VQ4 A;  4CIG A;  4BAC A;  3LP0 A;  4Z4E A;  2PYL A;  4PQU A;  1HNI A;  1BQN A;  2IDO A;  1VSJ A;  3OYI A;  1JLF A;  1JL1 A;  3M8R A;  3HYF A;  2G8F A;  2WON A;  4KTZ A;  3QIP A;  4FLT A;  1VRU A;  2VG6 A;  3PO4 A;  4LSN A;  2Z1H A;  1SL0 A;  4MQ3 A;  3VQ9 A;  3QEV A;  2OYQ A;  4FW2 A;  2A1R A;  3MEG A;  3RWU A;  1JLC A;  4M45 A;  2JLE A;  1BI4 A;  3TI0 A;  4E89 A;  3V9S A;  3V81 A;  3B6P A;  4E1M A;  4BWJ A;  3S3N A;  2XO7 A;  4CJQ A;  4PY5 A;  1ZBI A;  1C6V A;  3I0R A;  3KTQ A;  2QKK A;  3SCX A;  1QTM A;  1IG9 A;  3DOK A;  4C8L A;  3U6F A;  4B8A B;  1RNH A;  4AHS A;  3T1A A;  2YNF A;  3QIO A;  4ELU A;  1D5A A;  2ZQB A;  3BGR A;  4OVL A;  5EU7 A;  4BE0 A;  3VA3 A;  4DTS A;  1X9M A;  2FBV A;  3DM2 A;  1L3V A;  1QSS A;  3KKS A;  1L3T A;  4FJ7 A;  4E7K A;  2IC3 A;  4B9L A;  1C1C A;  1NOZ A;  3NH0 A;  3OYK A;  3T3F A;  5KGW A;  4CJ4 A;  1WSI A;  5K14 A;  3KD1 E;  4EZ6 A;  4KTQ A;  3QEI A;  4ICL A;  3LWM A;  1VRT A;  2HNY A;  3A2F A;  3L3V A;  1VSI A;  1TAQ A;  2IS3 A;  4E7H A;  3THV A;  2NUB A;  4Y1C A;  3QET A;  2GBZ A;  2Z1G A;  4B9N A;  2RN2 A;  1C1B A;  1SL1 A;  2F8T A;  4FM0 A;  4FZZ A;  5SWM A;  1WSH A;  3OY9 A;  4JRP A;  2G8U A;  4W5T A;  3AVL A;  4CK3 A;  4FJL A;  1J5O A;  5CZ1 A;  1FK9 A;  3ZSV A;  5HRO A;  1RT2 A;  3WNG A;  4CE9 A;  1FXX A;  2GV9 A;  1BI4 B;  5J2M A;  2XY6 A;  4KKO A;  1FKP A;  3OVN A;  1TKX A;  2KZM A;  3OYL A;  3P1G A;  2O4I A;  4H8K A;  5FRO A;  4DTP A;  4DU4 A;  3QEX A;  3AV9 A;  3CFP A;  4FJ5 A;  3L2V A;  3HM9 A;  4W5O A;  3V4I A;  4CED A;  3L3U A;  3KJV A;  1NKE A;  2YHA A;  4C8K A;  5T7B A;  3S9H A;  1SV5 A;  1UWB A;  2XY8 A;  3NF6 A;  3LP1 A;  5HRR A;  4CGJ A;  1XHX A;  4Z4H A;  2BAN A;  3OYG A;  3K5M A;  3SV4 A;  4DS4 A;  4NCB A;  4TSX A;  3OYF A;  5C24 A;  4CEF A;  4N5S A;  4CEB A;  3KKR A;  1LWC A;  1VSK A;  1HRH A;  4FLW A;  1IKX A;  5C42 A;  1WSF A;  3NCI A;  3RMC A;  4DSL A;  4H4M A;  4E7J A;  2BE2 A;  4DF8 A;  2D0A A;  3AVI A;  4AIL C;  3AVM A;  4G1Q A;  2Z1J A;  3TWH A;  3KK3 A;  4DSJ A;  4CJL A;  4JS5 A;  5FRM A;  2LSN A;  1RT3 A;  3TAB A;  4F8R A;  5CYM A;  5KGX A;  3LWL A;  4CJF A;  3NH2 A;  3F9K A;  2EX3 A;  2X74 A;  2P1J A;  3E01 A;  4FJM A;  4W5R A;  1Q8I A;  5HP1 A;  3QEP A;  3HL8 A;  1JLA A;  4CF8 A;  4KV8 A;  4CER A;  1WSE A;  3PUF A;  4UQG A;  2OZS A;  4KI6 A;  3LDS A;  4E7I A;  3M8S A;  1NKC A;  1SKS A;  3ZSR A;  3L2R A;  3TAP A;  1EX4 A;  1S9G A;  2HNZ A;  4CF0 A;  3V9X A;  1ZBH A;  3DLG A;  2HHU A;  1I39 A;  1IKW A;  4GMJ B;  1WLJ A;  3LPT A;  4CEE A;  3RMA A;  2P5G A;  4DS5 A;  4C8N A;  4IFY A;  2G8I A;  4O4G A;  3KLI A;  4CF1 A;  3D0P A;  3QLH A;  1HPZ A;  4CHO A;  1YTA A;  4DLG A;  3U3Y A;  3SJJ A;  2G8V A;  2HB5 A;  4DFM A;  2PYJ A;  3VQ8 A;  1RT1 A;  1LAW A;  2Y1J A;  3L2W A;  4GVM A;  1CLQ A;  4DQR A;  4CFD A;  4KHY A;  2FBY A;  1C0U A;  3WNE A;  4DU3 A;  3OS1 A;  3IS9 A;  3SNN A;  4I7F A;  2ZD1 A;  4FYD A;  4RW9 A;  1ZBL A;  5CY4 A;  1UOC A;  3NH1 A;  3V1Q A;  3VQQ A;  4KHQ A;  3TAR A;  4NYF A;  4I9L A;  3LZI A;  2ZE2 A;  4L8R B;  4OGC A;  4DTO A;  1QHT A;  2P51 A;  4CGF A;  1JLQ A;  4W5Q A;  4CHN A;  4CJ5 A;  4FZX C;  1Z25 A;  4ELT A;  4CK1 A;  3VQA A;  3RTV A;  2Q3S A;  4AHR A;  4XIU A;  3KLF A;  4IG0 A;  1VSD A;  4LH5 A;  1NK5 A;  4F3T A;  3V9Z A;  3QES A;  1NK7 A;  1RDC A;  3ISN C;  3QEW A;  4W5N A;  3V1R A;  1REV A;  2YNH A;  1WN7 A;  4NCA A;  5J1E A;  2HW3 A;  3AVG A;  3MEE A;  1RDA A;  3OYH A;  3TAQ A;  3OYB A;  3HVR A;  4ID1 A;  2DFE A;  3SQ1 A;  4DWI A;  1X9S A;  4M42 A;  1QQC A;  1T05 A;  3O4N A;  3TAF A;  2XY7 A;  4FLX A;  4KHN A;  3AA2 A;  1BIU A;  1ASW A;  3OJS A;  3DLK A;  3NGY A;  1NK6 A;  4F4K A;  4CIE A;  1S9E A;  3LAN A;  3HVT A;  5DK5 A;  3WNF A;  1HNV A;  3NGI A;  3AA5 X;  5J2Q A;  1U04 A;  4FJ8 A;  3K59 A;  4FLZ A;  2P5O A;  1I3A A;  4BDP A;  5FDL A;  3DOL A;  1NK0 A;  3C95 A;  4NCG A;  1B9F A;  2KZZ A;  1B9D A;  1S6P A;  1VSL A;  3L2U A;  4KHS A;  3VQ7 A;  2VWJ A;  3V6D A;  3HST B;  4CCH A;  1BQM A;  3DLE A;  3RMB A;  4ZHR A;  4YNQ A;  3AO5 A;  1LV5 A;  3IRX A;  4HVJ A;  4DSF A;  3HP9 A;  4QCL A;  3AVF A;  3VA0 A;  3NHG A;  4Z4G A;  3SUO A;  4KI4 A;  4HUE A;  2DTU A;  2FC0 A;  1U49 A;  4CJS A;  4J2E A;  1GOC A;  3OJU A;  4OLA A;  1NOY A;  4CHQ A;  1ITG A;  1XWL A;  5SZT A;  1RIL A;  4RW6 A;  4RW7 A;  4OKE A;  3C6T A;  1TKD A;  4PA1 A;  1JKH A;  1HQE A;  5C25 A;  1DTT A;  2QXF A;  3FFI A;  2VG5 A;  2OPS A;  3V9W A;  2X6S A;  1UAX A;  5DMR A;  1SKR A;  2OA8 A;  1VK0 A;  1TV6 A;  1S1U A;  3DLR A;  3VQP A;  2RF2 A;  3ZT0 A;  1LW0 A;  1QS4 A;  1X1P A;  4LSL A;  4KB1 A;  1CXU A;  4Y1D A;  4YFU A;  1NJY A;  4DTU A;  5JS2 A;  3K5O A;  3RR8 A;  1NK9 A;  3DRP A;  3SV3 A;  3RR7 A;  1WSG A;  4OPK A;  4ZTJ A;  1R0A A;  4M3T A;  3NAE A;  3LAL A;  4K8X A;  2Z1I A;  2IAJ A;  3HPH A;  3ZT2 A;  4CJR A;  1RT7 A;  4DSE A;  3NE6 A;  4CGH A;  4BE1 A;  1W0H A;  4DLE A;  3PX6 A;  5KI6 A;  1A5X A;  1BIZ A;  4CFA A;  1C1A A;  4FLU A;  1KSP A;  2KQ2 A;  3ZT1 A;  3CYM A;  2E6L A;  4FVM A;  1C0M A;  4CJT A;  4FXD A;  4CEO A;  1GOB A;  2OZM A;  2HHQ A;  4RG8 A;  4DTM A;  1F21 A;  4O44 A;  3VQD A;  1TVR A;  3MXM A;  2HHV A;  3G10 A;  3TAM A;  3JSM A;  1JL2 A;  2X6N A;  3ASM A;  4M3X A;  4M3R A;  4BE2 A;  1JLB A;  3QNO A;  1TK5 A;  1EP4 A;  3M8Q A;  5FRN A;  3KK2 A;  4AHV A;  3DI6 A;  4Z0U A;  1U45 A;  1WAF A;  1SUQ A;  1BIS A;  2D0C A;  2R7Y A;  4CJK A;  3K58 A;  3DLH A;  4CHY A;  3O3G A;  3JYT A;  3NBP A;  3ZSY A;  4M3Y A;  2HMI A;  2F8S A;  1HYS A;  1BGX T;  3KK1 A;  4DU1 A;  2QKB A;  3PY8 A;  1VSM A;  3KLE A;  3MXI A;  4FLY A;  4E3S A;  1UA1 A;  4F3O A;  1J54 A;  1TKZ A;  1VSE A;  3D45 A;  3WNH A;  2O4G A;  4CK2 A;  1KVC A;  3LAM A;  1HJR A;  2IGI A;  1N5Y A;  1Q9Y A;  1N6Q A;  4N47 A;  2E6M A;  4QAG A;  2EHG A;  1KTQ A;  1JXB A;  1JLG A;  1D9F A;  2ITG A;  2YHB A;  4FJN A;  4DSI A;  1RDB A;  1WNS A;  1BCM A;  4B9S A;  1WSJ A;  4B9U A;  4MFB A;  3KLH A;  1S5J A;  2JGU A;  3F73 A;  2PZS A;  4IKF A;  4M3W A;  3SYZ A;  4KO0 A;  2B6A A;  3AVK A;  3DRR A;  4I2Q A;  3LP2 A;  3TAE A;  1T7P A;  2G8K A;  2D0B A;  2WOM A;  4OGE A;  1CZB A;  4OJR A;  3SI6 A;  4M3U A;  4C8M A;  1B92 A;  1RT5 A;  4RW8 A;  3ZSQ A;  1LW2 A;  4OKK A;  3ULD A;  4DFJ A;  1TK8 A;  2Y1I A;  1L3S A;  3AVB A;  3QO9 A;  4HCB A;  3OYN A;  3AO4 A;  4CEA A;  5KTQ A;  4FK4 A;  1KVB A;  3SQ0 A;  4HTU A;  4PWD A;  2XRI A;  4DFK A;  1RTH A;  3CM6 A;  3SQ2 A;  2E4L A;  1FKO A;  2IOC A;  2G8W A;  1CZ9 A;  3ZT3 A;  4N76 A;  3CM5 A;  3OS2 A;  4JLH A;  4O0I A;  3IAY A;  4CJP A;  1QE1 A;  1EXQ A;  3MED A;  1IKY A;  4E1N A;  3OYM A;  3V1O A;  4BDY A;  1NJW A;  4FZY A;  3L8B A;  1A5V A;  1RBV A;  3EY1 A;  5HRN A;  1DTQ A;  3AO2 A;  1NK4 A;  1KLM A;  4LD0 A;  3OYC A;  3PV8 A;  4Q0B A;  3MXJ A;  1ZYQ A;  1W9H A;  3TAG A;  3P5J A;  3K5L A;  3OYA A;  1UA0 A;  1MU2 A;  4B3O A;  4CGG A;  3OS0 A;  1K6Y A;  4ELV A;  4EP4 A;  1S1X A;  1L3U A;  1RTI A;  2YV0 X;  3AA4 A;  4LY7 A;  4J2D A;  5HRS A;  1NKB A;  4FLV A;  5D3G A;  3NF7 A;  1RBT A;  3H08 A;  4DTJ A;  3NF8 A;  4PUO A;  3RRG A;  2KFN A;  2AJQ A;  4CJ3 A;  4WE1 A;  3ZCM A;  3VQB A;  5I42 A;  2DY4 A;  2VG7 A;  3KLG A;  5HBM A;  1KFD A;  1RTD A;  1QSY A;  1NJX A;  4EZ9 A;  1Y97 A;  3ALY A;  4CJE A;  3OYE A;  5CZ2 A;  2XHB A;  1TL1 A;  2W42 A;  1YT3 A;  4DTR A;  4IG3 A;  3HT3 A;  4LH4 A;  1RDD A;  2YKM A;  4DQQ A;  3HK2 A;  1YVU A;  4CJW A;  1O1W A;  1IO2 A;  1GOA A;  3O3H A;  1S1W A;  5JS1 A;  3CQ8 A;  1RCH A;  2B5J A;  3BDP A;  2YNI A;  4O5B A;  1KFS A;  1BHL A;  4CHZ A;  1BL3 A;  1HMV A;  4BWM A;  4M41 A;  4ZTF A;  1T03 A;  4CHP A;  3NF9 A;  3SPZ A;  4AHT A;  1LWF A;  3T19 A;  4CGD A;  4CEZ A;  3K5N A;  1KLN A;  4N41 A;  1EET A;  1LWE A;  1VSF A;  2ATQ A;  3SUP A;  1L5U A;  1C0T A;  4KAZ A;  3C6U A;  4IBN A;  4KRF A;  3NFA A;  3HO1 A;  4B08 A;  4KFB A;  4FM1 A;  3NGZ A;  3ZSW A;  1TAU A;  1HYV A;  4AHU A;  3SQ4 A;  4KPY A;  4DTN A;  1Q9X A;  3VQE A;  1KRP A;  1U4B A;  2F96 A;  4CJV A;  5CYQ A;  1U47 A;  2VWK A;  3IG1 A;  1HYZ A;  4CEQ A;  3SUN A;  3K2P A;  4C8O A;  3B6O A;  4NYN A;  1EKE A;  3LZJ A;  4E0D A;  3QNN A;  3EYZ A;  1S1V A;  1IH7 A;  1ASU A;  3LAK A;  4CES A;  3SUQ A;  4KB0 A;  4F2S A;  5I3U A;  1LAV A;  3MEC A;  1U48 A;  2HHT A;  4DQS A;  4KHW A;  3MAQ A;  2BDP A;  3AVJ A;  5KRS A;  3O3F A;  3EZ5 A;  1IKV A;  1XC9 A;  1ASV A;  3RRH A;  4I2P A;  2HND A;  3S3O A;  1SL2 A;  1X9W A;  1WAJ A;  5KRT A;  2BGG A;  3VN5 A;  4IFV A;  2HHW A;  4O0J A;  4AH9 A;  3CG7 A;  4FJX A;  1ZBU A;  1KVA A;  1A5W A;  3S3M A;  2HVH A;  4CGI A;  4JS4 A;  1KCF A;  4FCY A;  3I0S A;  3ZSO A;  2G8H A;  2YKN A;  3KD5 E;  1J53 A;  4DTX A;  4DFP A;  1D8Y A;  4I9Q A;  2HHS A;  2XY5 A;  3ZT4 A;  4DSK A;  3G0Z A;  1D9D A;  2DFF A;  3DRS A;  3PO5 A;  4B8C A;  1TGO A;  1CXQ A;  4DF4 A;  2B4J A;  3AO3 A;  1TKT A;  4KHU A;  2HHX A;  2OPQ A;  2A1S A;  1HQU A;  3I8D A;  2PY5 A;  3OYJ A;  4CJU A;  1NJZ A;  4H4O A;  4FJG A;  3AVH A;  4FW1 A;  3SZ2 A;  2KFZ A;  4HCC A;  3O4Q A;  4DMN A;  2X78 A;  1SKW A;  1S1T A;  3HPG A;  1JLE A;  4DQP A;  4F2R A;  4FJI A;  2GUI A;  4J2A A;  4O55 A;  3VQ5 A;  2KTQ A;  3CFR A;  1TL3 A;  3AVN A;  4B9T A;  1T8E A;  2HVI A;  5HRP A;  3NDK A;  4HHT A;  1XI1 A;  3LPU A;  3P83 D;  4BDZ A;  1VSH A;  4OPJ A;  1DLO A;  4IDK A;  1J9A A;  3ZSZ A;  3ITH A;  3SPY A;  4N56 A;  1RTJ A;  4CF9 A;  3AA3 A;  1G15 A;  3AVA A;  3L2Q A;  3V9U A;  4J2B A;  4FJK A;  4E19 A;  1BCO A;  4CF2 A;  5J2P A;  3KIO A;  3K57 A;  3U3G A;  4HUG A;  1RT4 A;  4CIF A;  4KTW A;  3M8P A;  1YTU A;  3UIQ A;  1JXE A;  4RW4 A;  4K8Z A;  3OYD A;  2QK9 A;  1RBS A;  4DG1 A;  3RMD A;  1S6Q A;  4CFC A;  3DMJ A;  2OPP A;  4E7L A;  3HJF A;  4ID5 A;  2FBX A;  3HPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...