1UAXA

Crystal structure of the ribonuclease h2 from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MKVAGVDEAGRGPVIGPLVIGVAVIDEKNIERLRDIGVKDSKQLTPGQREKLFSKLIDILDDYYVLLVTPKEIDERHHSMNELEAEKFVVALNSLRIKPQKIYVDSADVDPKRFASLIKAGLKYEATVIAEHKADAKYEIVSAASIIAKVTRDREIEKLKQKYGEFGSGYPSDPRTKEWLEEYYKQYGDFPPIVRRTWETARKIEERFRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uaxA00
2EX3A 1TKZA 1JLFA 3AO3A 3VQAA 4YFUA 1NJXA 2YNHA 5FRMA 3WNFA 1EP4A 5SWMA 1NOZA 1IKVA 3HPOA 4DLGA 4KREA 1RBRA 1ZBIA 4DF4A 1B9FA 4I9LA 3LP2A 4DQRA 4KFBA 3AVCA 2YHBA 1O1WA 1J5OA 2ZQBA 1DLOA 1IKWA 1C1AA 2FBYA 3WNEA 4CGDA 1ZYQA 3QIOA 4E1MA 1SKWA 3L2WA 4BDYA 2YV0X 2G8VA 1WLJA 1VSLA 4CJVA 3ITHA 4DSEA 1XI1A 3F73A 4EZ9A 3ZSZA 4L8RB 4Y1CA 3HSTB 4GMJB 3P83D 1S1XA 3DRRA 4EP5A 3HVTA 2KW4A 3DMJA 3I0SA 4FJIA 2YKMA 1FKPA 3VQ5A 4CCHA 2KFZA 4RW4A 2EHGA 3VQQA 3TAQA 1JL2A 2IAJA 1UA0A 1NK6A 4W5RA 4B8AB 4ID1A 2HB5A 1Q9YA 1TK5A 1DTTA 4LSLA 3ZT4A 2RF2A 1L3SA 2HHXA 4CEOA 3TWHA 4QCLA 1BHLA 1VSJA 2KZMA 1K6YA 3P1GA 2QXFA 4GVMA 3S3OA 4Z4FA 1HQEA 1VSKA 4DTXA 4CK1A 5C25A 4DG1A 1VK0A 3PX6A 3AO1A 3K5OA 4PA1A 4CEEA 5E41A 3RMCA 3NFAA 4E19A 3TAFA 1U4BA 1RBSA 3S9HA 4F2RA 2F96A 1JXEA 1T7PA 4DQIA 1EX4A 3LPTA 3TABA 1S1UA 4O0JA 3K59A 4FJ8A 1QE1A 4OGCA 3S3NA 4B9TA 5D3GA 2IGIA 4E7KA 4IFVA 3HP9A 5CY4A 3KD5E 3L2QA 4AILC 3DLBA 3DOLA 3MXIA 3ZT3A 5CYQA 1EETA 2OPQA 1JKHA 1WSEA 3U3YA 2D5RA 1YTUA 3ZSWA 2A1RA 5HROA 2IC3A 4CFDA 4FM1A 5J2NA 3CM5A 2P5GA 4KTZA 3DRSA 4DSLA 4KHUA 1CXUA 4K8ZA 2B6AA 3CG7A 4FJXA 1J9AA 1HQUA 1J53A 2IOCA 3PO4A 3VQBA 4M41A 1UAXA 4CHZA 3OYLA 4B9VA 3D0PA 3AA3A 4Q5VA 4E7LA 2FBVA 4BWJA 1TV6A 4BWMA 2HHQA 3OYHA 3M8QA 1WAJA 3JYTA 1TVRA 3SV3A 2Y1JA 3LWLA 1Y97A 4M42A 3OVNA 3K5LA 1JLCA 4KKOA 4RW7A 3L3UA 4CERA 4RG8A 3SI6A 4ZTJA 3HK2A 3TANA 3DLGA 4FXDA 1BQMA 4AHCA 4I2PA 4HUFA 1X1PA 4DF8A 1IO2A 3SQ4A 4CF1A 3L2RA 1F21A 4CJWA 3OYJA 1S1TA 2PZSA 4OLBA 4NCGA 3PV8A 1U48A 3OYMA 2Y1IA 4CGHA 3TAPA 4MQ3A 1R0AA 3AVIA 4RW6A 2X6SA 1GOCA 1U04A 4H4MA 4FLTA 1XWLA 4DFMA 3RRGA 4KPYA 4CJ5A 5I42A 1EXQA 4C8NA 3MEGA 1JLEA 5CZ1A 1BCMA 3QO9A 3DYAA 1JLBA 4MFBA 2RN2A 3V6DA 4DWIA 1LAVA 1FXXA 4J2DA 4CJFA 1IG9A 4CK2A 4GW6A 2YKNA 4FM0A 3OJSA 4ZTFA 2QKKA 2F8SA 2QK9A 3NH1A 1RT3A 4DLEA 3OYKA 3O3FA 5J2PA 5KGXA 3DI6A 3T1AA 1Q8IA 1ZBFA 3DRPA 4OGEA 1NOYA 1D9FA 3PY8A 2KZZA 3KTQA 4NCAA 1BI4A 3JSMA 1S6PA 1J54A 4J2EA 3RMAA 3MAQA 4KHSA 3THVA 4DTUA 4OKKA 1KTQA 1Z26A 3OYAA 3VQ9A 3OS1A 3DLRA 2X78A 3CYMA 5CZ2A 3SUPA 3B6PA 3QEPA 4FJHA 5FRNA 4W5NA 4E0DA 4CEBA 1IKXA 4WE1A 3O4QA 3TARA 3ZSRA 4CJRA 3C6TA 4QAGA 1BL3A 3NGYA 3ZT0A 4CF9A 3KLEA 4E89A 2BANA 1LW2A 1RCHA 5KRSA 1B92A 2YNGA 1ASVA 1VSMA 3DOKA 4CEQA 4N41A 3KKRA 4FW1A 4CJ4A 1TKDA 3PX0A 4B9LA 3CM6A 2XY5A 2IDOA 4LH5A 3SJJA 1KVAA 3LP0A 1LW0A 5HBMA 3NF7A 2BGGA 1RBVA 3MXJA 1T8EA 3KIOA 3ZCMA 4AH9A 2PYJA 4HCBA 4CJKA 3QEVA 4BE1A 4DS5A 4YNQA 4M3ZA 5HRPA 1QSLA 2LSNA 3BGRA 1QQCA 4CHNA 2OPRA 4BDPA 4IDKA 3PO5A 3HM9A 1C0UA 4KAZA 4JS4A 1C0TA 2YNFA 1RTJA 4TSXA 3V9ZA 1X9WA 4FJGA 4Z4GA 4CHOA 2Z1HA 4Z4IA 4PQUA 4C8MA 3VQDA 4CFBA 2OZMA 2DTUA 4DU4A 3QEXA 4DSIA 4FK0A 4DTSA 2I5JA 5DMRA 1ZBLA 1WSGA 4KI6A 3ZSQA 3LZIA 3QETA 2BDPA 4CHYA 4DU1A 1RT7A 1UOCA 4PWDA 2G8FA 1REVA 4E7HA 1WSJA 1W0HA 1N6QA 4I9QA 1S6QA 3AVFA 3KK1A 3QESA 4KTWA 1ZBUA 2HNDA 4N47A 3SQ0A 1I3AA 1NJYA 1RDAA 2OYQA 4M3TA 3AA2A 3OYFA 4HVJA 1TK0A 3VN5A 4OKEA 2HHTA 3CFPA 3SPYA 2G8HA 2W42A 1TK8A 1HNIA 1YVUA 1VSFA 3AVBA 3QIPA 4ID5A 4AHSA 2RPIA 4Y1DA 2YNIA 3NGZA 3EY1A 2R7YA 4OKJA 1I39A 3K2PA 1QTMA 5JS2A 1KFDA 2G8IA 3SCXA 4CGGA 5K14A 4FLUA 3RTVA 4LH4A 4FM2A 4CJUA 4CIGA 3NGIA 3AVHA 3VQ6A 3OYNA 1XHXA 1S1VA 4CF2A 3IAYA 1RT4A 3ZSYA 5CYMA 4W5OA 4M3RA 3I0RA 1X9MA 2HHWA 3HT3A 5KRTA 2XY6A 2HNZA 4O5BA 3AVGA 1TKTA 4FLZA 3ALYA 3SZ2A 3ISNC 1GOBA 3EZ5A 5I3UA 4O0IA 1NKCA 3LDSA 4W5TA 3OY9A 1VRTA 1IKYA 4J2AA 3ZSVA 1WAFA 1SV5A 3VQ8A 3O3GA 3K58A 3OJUA 1SL2A 3SNNA 3QINA 4H8KA 3SUQA 1T05A 1SL0A 3O4NA 1KCFA 3D45A 5FROA 4K8XA 1S9EA 3AVLA 3EYZA 3HPHA 3NBPA 1U47A 3AVAA 2PYLA 2XY8A 4FVMA 4LSNA 3KK3A 4I2QA 1YTAA 1EKEA 3VQ4A 4EP4A 4KHYA 4JLHA 3TAEA 1C1CA 4DTPA 4KHQA 4DQSA 3SUOA 1D8YA 4KRFA 1XHZA 3DLEA 1NK0A 1VSHA 4B08A 3K5NA 2ETJA 4HHTA 1HPZA 3M8SA 3V9XA 3DLHA 3KKSA 4IG0A 4PY5A 3L3VA 1NK4A 3QLHA 4FW2A 3OYGA 5J2QA 3KLIA 4AHUA 2F8TA 1NK9A 1RT1A 4N76A 5HRSA 4HTUA 1TGOA 3TAGA 5HP1A 1D5AA 2OZSA 4HUGA 4E3SA 2G8KA 3LAKA 2DFHA 4DTOA 2BE2A 3QNNA 2XRIA 1A5VA 4OLAA 5J1EA 1BIZA 4EZ6A 3QEIA 4ELUA 4CEAA 3L8BA 3VQPA 3ULDA 3F9KA 1SL1A 4IG3A 2HNYA 3LANA 2D0CA 2KQ2A 1B9DA 3RMDA 5T7BA 1L3TA 2DY4A 1T03A 3A2FA 5HRRA 3WNGA 1QHTA 3DLKA 2XO7A 3RR8A 4HCCA 1ZBHA 2X74A 4DFPA 4NYNA 4KTQA 2GV9A 1L5UA 4JS5A 4M3UA 1KLNA 3NH2A 3M8RA 2WONA 1NKBA 3K57A 1VRUA 4ELTA 4O55A 3PX4A 4OVLA 1WSIA 4FJMA 2VG7A 4CJTA 1SKSA 3SQ2A 4FJ7A 1KRPA 4DTRA 1RBTA 3MEEA 4FYDA 4FZZA 2VG6A 3VQEA 1W9HA 3LZJA 1KFSA 3RWUA 4ICLA 3TR8A 4FK4A 3MECA 3RMBA 4DTNA 1NK7A 3AA5X 4F4KA 2ITGA 4KI4A 1NKEA 4B3OA 3U6FA 1VSEA 2ATQA 4FLWA 3VA0A 4FLYA 1ASUA 4DQPA 1HYSA 4G1QA 1S5JA 3G0ZA 3VQ7A 4CGFA 3E01A 3NDKA 4CEZA 1RTHA 4FJNA 3HP6A 1BCOA 5KTQA 3HXMA 1HYZA 2Z1IA 4Z0UA 4M45A 3AVKA 3LPUA 3V4IA 4JRQA 3KLFA 1BI4B 4CFAA 3NHGA 2HW3A 4ELVA 4M3XA 2VWJA 4IKFA 5C42A 3V1QA 4CHPA 4BDZA 2PY5A 5JS1A 4XIUA 1TKXA 1TL1A 1FK9A 1KVBA 1WN7A 4R5PA 4KB1A 4DTJA 1SKRA 3IRXA 4DFKA 4CEDA 1C1BA 4CHQA 4Z4CA 3T3FA 2WOMA 1Z25A 3FFIA 4CIEA 3AVJA 2XHBA 4JRPA 4DTMA 3S3MA 5C24A 3VA3A 3OYBA 2HMIA 3V9WA 1U49A 1C6VA 2NUBA 1LAWA 4AHVA 3WNHA 4OPJA 3AV9A 3M8PA 5SZTA 5J2MA 2QKBA 3TAMA 4FLVA 5DK5A 5KI6A 2DFFA 3NAEA 4FLXA 3V9SA 3SPZA 3PUFA 3OYCA 1JLGA 4FJJA 4F3OA 4FJLA 1DTQA 2B5JA 1NJWA 4CJLA 1HMVA 1S9GA 4O44A 3NF9A 3U3GA 4DSFA 3OYDA 3CQ8A 3B6OA 3NF6A 4DU3A 2HVHA 2HVIA 4KV8A 2RKIA 4AHRA 4C8OA 4CEFA 4OPKA 1S1WA 1ITGA 5FDLA 4DMNA 1LV5A 1QSSA 4DQQA 4KO0A 2OPPA 3ZSXA 3LALA 3OYIA 1JXBA 1KSPA 4I7FA 4M3WA 1VSIA 2D0AA 4FJ5A 1VSDA 4C8LA 1CZBA 1QSYA 4KB0A 1NK5A 2FBXA 2VG5A 1A5XA 3T19A 4IFYA 4DFJA 1WSFA 3C94A 2XY7A 3IS9A 3V9UA 3AA4A 1FKOA 1G15A 2E4LA 2GBZA 4CGIA 2A1SA 4BACA 3ZSOA 2P51A 4FK2A 2IS3A 2P1JA 4B9UA 1LWFA 2DFEA 1BGXT 2X6NA 4CECA 3K5MA 4CJSA 3UIQA 2O4IA 3VQCA 3KJVA 4E1NA 3RRHA 3MEDA 3RR7A 4H4OA 3AO5A 3C6UA 3LP1A 3SQ1A 4CJ3A 4F2SA 3HVRA 4FJ9A 3NCIA 1ASWA 4AHTA 1WSHA 4RW9A 5KGWA 2G8UA 4CESA 3BDPA 4C8KA 1NK8A 3AO4A 2Z1GA 3LWMA 1X9SA 4N5SA 3V1OA 2OA8A 2HHSA 1HYVA 1RDCA 3P5JA 1N5YA 1RDBA 4E7IA 3HJFA 1UA1A 3SV4A 3KK2A 4NYFA 2FC0A 2ZE2A 3AVMA 4J2BA 4CJPA 4PUOA 4CF0A 4LY7A 1RTIA 1JLAA 3LAMA 4IBNA 4UQGA 2YHAA 4E7JA 4F3TA 1KVCA 1RILA 4B9MA 1CZ9A 2E6LA 4CGJA 4N56A 1LWCA 2AJQA 1NJZA 1A5WA 4FZYA 1RNHA 2O4GA 3AVNA 3NE6A 1L3VA 5HLFA 3L2UA 3HYFA 3DM2A 3OS0A 1HJRA 1U45A 4B9SA 3HO1A 3AO2A 2GUIA 3H08A 3ASMA 4FCYA 1L3UA 4CJQA 2ZD1A 3HPGA 4W5QA 4ZHRA 4BE0A 4F8RA 2G8WA 1WNSA 3C95A 2D0BA 1LWEA 1SUQA 3CFRA 2JLEA 3QEWA 1Q9XA 1YT3A 2P5OA 4DSKA 1RTDA 1JLQA 4LD0A 2Q3SA 4HUEA 4RW8A 1IH7A 1D9DA 1CLQA 4B9NA 4Z4HA 3HL8A 2VWKA 1JL1A 2B4JA 2KTQA 3ZT2A 1RT6A 1CXQA 4O4GA 3NH0A 4M3YA 4QOZB 4OJRA 1QS4A 1UWBA 3SUNA 3ZT1A 2E6MA 5EU7A 4FJKA 1BQNA 3IG1A 4BE2A 3V81A 4DSJA 1XC9A 3OS2A 4KHWA 1RBUA 4CE9A 1C0MA 3V1RA 2FBTA 2Z1JA 3KLGA 1MU2A 2JGUA 4FZXC 2KFNA 3O3HA 1GOAA 1BISA 3G10A 4KHNA 1RDDA 3QNOA 4Z4EA 4CF8A 3MXMA 4B8CA 4Q0BA 1TAQA 1HRHA 3LP3A 1BIUA 1RT2A 5HRNA 3KD1E 3L2VA 4NCBA 3NF8A 4CFCA 1TAUA 1KLMA 3QERA 3SYZA 1HNVA 3KLHA 4DS4A 2OPSA 3TI0A 3OYEA 3CFOA 1RT5A 1TL3A 4CJEA 4CK3A 4CIFA 2HHUA 3I8DA 2HHVA
chains in the Genus database with same CATH superfamily
1TKZA 4YFUA 3CIPA 2YNHA 3L0QA 5SWMA 1NOZA 1IKVA 4KREA 4DF4A 1B9FA 3U8XA 2O8EB 4KH5A 2ZQBA 5CHIA 4KH4A 2UYTA 4GKKK 5CE3A 2FXUA 1BOTO 3AAQA 3THYB 4JKHA 4CJVA 3F73A 4EZ9A 1BA0A 5M1FA 5ADXH 3DRRA 2V7YA 4EAHD 3E66A 4FJIA 1FKPA 1QZ5A 2KFZA 4RW4A 1D4XA 4W5RA 4FL9A 1NU0A 2NRWA 3CQYA 3VTIA 3OBWA 2KLAA 1K6YA 2P9NA 3WEEA 4CK1A 2QM1A 3F9MA 4DG1A 3PX6A 4PA1A 3CPWM 1U4BA 3NFAA 2OTJN 5E26A 2D0PA 2P9UA 3ZX2A 2VWBA 4DQIA 1EX4A 4FJ8A 4OGCA 5D3GA 2IGIA 1YUWA 4FWMA 2OPQA 1JKHA 4KBOA 2D5RA 4JI1K 2A1RA 2IC3A 5J2NA 2E2QA 1HNWK 3DRSA 4K8ZA 3PLAA 1J9AA 3EKUA 3LM2A 1HQUA 4NXMK 2PAVA 4F9OA 1WB9A 4LF4K 3OYLA 5BPNA 3AA3A 4Q5VA 3KK7A 4BWJA 2HHQA 1IBMK 5AQLA 3VOVA 5BN9A 2NNWA 3OYHA 1TVRA 4WQ5C 5EOYA 2YX6A 3OVNA 3K5LA 4KKOA 3CHWA 4FPAA 3L3UA 3SI6A 5DM6L 4JKEA 2FSNA 4FXDA 4BY9C 2O8FA 4I2PA 3C65A 4XH5A 3L2RA 1KQSM 2PZSA 1U48A 4DR1K 3AVIA 4H0XB 1S22A 5BR8K 4H4MA 4BRHA 3RRGA 4KPYA 3L4IA 3QO9A 1N34K 4QS9A 3H6EA 1DGKN 1IG9A 5FPEA 3DWLA 2F8SA 4DLEA 4H0OA 1D9FA 1ZBFA 3DRPA 4JYAK 4ILGB 2VQEK 4BQLA 2KZZA 4NO7A 2HF4A 1KTQA 2X78A 3SUPA 1YXQA 4E0DA 4LF6K 1IKXA 1ZBSA 4WE1A 1NMNA 1NLVA 3SLCA 3ZSRA 3TARA 2VGMA 3ZT0A 5BPLA 5F2RA 3THWA 3PX0A 4LH5A 3ZEUB 3LP0A 4B1ZA 4HTLA 3KIOA 3ZCMA 1S3XA 3IKMA 4GV3A 2GEMA 4CZMA 2Q1NA 5LY3A 5AQYA 3HM9A 1JCGA 3V9ZA 1X9WA 3K0SA 3VQDA 3J8AA 1NGBA 4BRIA 4X64K 4JV5K 3ZSQA 1UOCA 3ZETA 3WXKA 1RFQA 3ZYYX 1GLLO 4O8KA 1M90O 4HVJA 4G9ZA 3VN5A 2GTDA 3CFPA 2PYLA 2W42A 4FWKA 1BWFO 1HNIA 3AVBA 3QIPA 4Y1DA 1GLCG 2YNIA 4EHTA 2HOEA 2R7YA 1I39A 1NGFA 1GLBG 2F7TA 1KFDA 4CGGA 4GV6A 5K14A 2CGKA 2W40A 4FM2A 5GIOA 2GUPA 1XHXA 4CF2A 2P9PA 1X9MA 3TSPA 1IV0A 4JKAA 2HNZA 4LFBK 4MDAA 3O9QA 4OX9K 1XNRK 3ISNC 1GOBA 4O0IA 3ZSVA 1SL0A 2GELA 3O4NA 3A5OC 2BH1A 3NBPA 4LSNA 2GWJA 3KK3A 1Q7YO 4OPAA 1E4FT 4B9QA 3TAEA 1C1CA 4DR2K 3DLEA 4MLEA 3K5NA 3FR0A 2ETJA 5C2FA 4HHTA 3HSCA 1N32K 3DLHA 3BF3A 3HM8A 1EQYA 4PY5A 1C0FA 4DR6K 2F8TA 2RHKA 3EE8A 3CCQN 3LAKA 2UXCK 2W6KA 3ZX3A 5J1EA 1SL1A 4IG3A 3LANA 2KQ2A 1L3TA 5T7BA 3HOSA 3CETA 2ASMA 3ID6A 4NYNA 3M8RA 3GL1A 4O55A 5C12A 4CJTA 3CCUN 4FJ7A 1KRPA 4DTRA 4Z94A 2VG6A 4FOEA 1W9HA 3LZJA 2FLOA 4FK4A 4DTNA 4FPBA 1S72N 2UUBK 4KI4A 1VSEA 3VA0A 1ASUA 1HYSA 1XUPO 2HSTA 5JVHL 1S5JA 1RTHA 4FJNA 1BCOA 3SBTA 1HYZA 2Z1IA 3C6HA 1H1VA 3V4IA 3NHGA 4R79A 2HW3A 4IKFA 5C42A 3V1QA 5FLXO 5JS1A 5C15A 5LL6Z 1OH6A 3LDQA 4DFKA 5M1KA 3T3FA 1K73O 2WOMA 1Z25A 2YJFA 4CIEA 2XHBA 5AZJB 3LDLA 3VA3A 2HMIA 1C6VA 1YI2N 3F5TA 4IZ9A 3WNHA 4C1NK 3VEXA 3DXKA 4FWPA 3P39A 5DK5A 3NAEA 1U2VB 3SPZA 4CZGA 2B5JA 5GINA 4O44A 3SMPA 3OYDA 1S1WA 1ITGA 2QWPA 5FDLA 1MWMA 2ITMA 4YY3K 3HRGA 1E3MA 4MDBA 4PL7A 4C8LA 1CZBA 2FBXA 5HOOA 3C94A 4FWSA 1FKOA 2GBZA 5GAGP 4BACA 4C23A 3MWPA 2GWKA 4WFBL 4LF8K 4B9UA 3K5MA 1G99A 3RRHA 3MEDA 3RR7A 2QI2A 3C6UA 2O8DB 5IT9O 1CZAN 4CJ3A 4U7BA 4DR5K 5ADXA 4DV2K 1SQKA 3EL2A 1NK8A 3AO4A 3LWMA 4QS8A 3TTDA 3V1OA 5MLCQ 1RDCA 3P5JA 1N5YA 3VEWA 4FOIA 1MWKA 3CF5L 3KK2A 4NYFA 2FC0A 2ZE2A 4DR7K 4CF0A 2E1YA 4LY7A 1U6ZA 3EN9A 3O8MA 2O8CB 1EWRA 1RILA 4B9MA 4CGJA 1LWCA 3CC2N 5AQTA 3O6WA 3AVNA 3ENHA 4B1UB 1WBBA 3DM2A 1OH5A 4B9SA 3HO1A 1L3UA 2ZD1A 4DV7K 4F8RA 2YHWA 1WNSA 4FZXC 2D0BA 3GBTA 3QEWA 3CFRA 1JLQA 4LD0A 3FZLA 4LF5K 3UE5A 3N4PA 1J5EK 3ZT2A 4O4GA 2HMPA 3SUNA 3TPQA 3OBYA 4CVNE 4ILHA 1T6CA 3ENOA 5AQGA 3IG1A 3OS2A 1C0MA 1FJGK 3V1RA 2FBTA 1BISA 3QNOA 4CF8A 3MXMA 2Q36A 1YJNN 1XC3A 4Q0BA 2P9SB 3J7YP 4IOCL 4BR2A 4NCBA 3KZBA 1KLMA 4B3TK 4DS4A 2OPSA 1RT5A 1TL3A 4GVEA 3HZ6A 5TKYA 3M1FA 3EE9A 2HHVA 4DV3K 3VQAA 4EIAA 1EP4A 5A2QO 4JK7A 1K9MO 4DLGA 3P38A 1VAZA 1X3MA 4DQRA 1GLAG 2ZJPL 4PHTX 5AQXA 2A40A 2KKZA 2FBYA 3THXA 3QFUA 4JHDA 4Y0WA 4FO0A 5EY4A 4E1MA 4A5AA 1NNEA 1ZC6A 3C7NB 5AR0A 4LFAK 2HHHK 3HSTB 1MA9B 3HVTA 1HKGA 2KW4A 3DMJA 3I0SA 1VQ9N 2EHGA 3RVCA 1UA0A 1NK6A 1DTTA 2OTLN 3A5MC 4QCLA 1BHLA 1VSJA 3TSQA 3P1GA 4BRNA 5JLHA 2QXFA 1HQEA 1VSKA 2A5XA 5C25A 1VK0A 3AARA 4CEEA 5E41A 3TAFA 4DKWA 2P9IA 3WQUA 4CBXA 5JVGL 3LPTA 2E88A 4O0JA 4B9TA 4E7KA 3GE1A 3KD5E 2NRHA 3L2QA 1QQMA 5FPNA 1EETA 1YTUA 1WSEA 1GLDG 2P9LA 4CFDA 2P9NB 3VETA 3CJCA 3CM5A 2P5GA 2ZJRL 4JI7K 3I33A 2QWQA 4FJXA 5AQPA 2IOCA 3QDKA 3PO4A 4M41A 1UAXA 2FBVA 4BWMA 3PSIA 1HX1A 1NGGA 4DV4K 1Y97A 1YAGA 1JLCA 3I56N 4RW7A 2ZF5O 1VQ8N 1T44A 3TANA 4FWOA 4AHCA 1X1PA 4BQZA 3SQ4A 4CF1A 3N4QA 1NBWA 4CJWA 4M7YA 3OYMA 3DJCA 3GOIA 3VEVA 5BREA 1R0AA 4GV9A 1U04A 4DFMA 4FLTA 3NMUA 3ID8A 4YORA 1EXQA 2WUSA 4C8NA 5DM7L 4IOAL 1BCMA 4A62A 1JLBA 2CH5A 5LJWA 4DUZK 1LAVA 4CJFA 4GW6A 3OJSA 2QKKA 2QK9A 1RT3A 3OYKA 3DI6A 3T1AA 4XH1A 1OH8A 1BI4A 1Q18A 1S6PA 3MAQA 3QB0A 3ENBA 3K9JA 1Z26A 3VQ9A 4FJHA 3DLRA 4PKHA 2NRVA 4AF1A 3O4QA 4CJRA 3C6TA 4CF9A 1BL3A 4WCEL 3KLEA 2BANA 1RCHA 1ASVA 4MO5A 2V51B 3KKRA 4FW1A 4CJ4A 5AQOA 3JAMO 4O8UA 3KWIA 1KVAA 4M7XA 1NGJA 5HBMA 3NF7A 4H5TA 3MXJA 4JI5K 2BGGA 4HCBA 4CJKA 4M3ZA 5HRPA 4CHNA 1YIJN 4IDKA 5AQFA 4NLCA 3BEXA 4H5RA 1ESVA 4H5NA 4FJGA 3O9RA 4FSVA 2HBJA 2Z1HA 4Z4IA 4PQUA 4C8MA 4CFBA 4DU4A 3QEXA 5BR9A 1ZBLA 2QXLA 4KI6A 4PWDA 4CHYA 1RT7A 3VF6A 4E7HA 1WSJA 1W0HA 4IOXA 3AVFA 3QESA 4KTWA 1NJYA 3AA2A 2HHTA 3SPYA 4BR5A 1TK8A 4CGDA 4AHSA 1VSFA 2RPIA 3EY1A 1QTMA 2G8IA 3SCXA 2QEXN 1K8KA 1XQSC 3IAYA 1S1VA 3M6GA 3ZETB 4W5OA 4M3RA 2XY6A 3WXJA 3OA9A 4O5BA 1HNZK 5I3UA 3ALYA 3SZ2A 3IMXA 5HL7L 2CGLA 4L3QA 1SV5A 3O3GA 3SNNA 3QINA 4H8KA 4K8XA 1S9EA 3HPHA 4I2QA 4EP4A 4KHYA 3M3ZA 4KHQA 4BR7A 1D8YA 1VQNN 4QS7A 3CCMN 1VSHA 4B08A 3M8SA 5J2QA 4FW2A 2Q2RA 1VQ7N 1NK9A 4IFEA 3O9UA 3D2EB 4N76A 4JKGB 4E3SA 4DTOA 2A41A 2CGJA 3LDPA 4EZ6A 1NMDA 2HNYA 1T6DA 1T03A 1ZBHA 5AQSA 4KTQA 1KLNA 3K57A 3FZHA 3ULEB 3PX4A 1SKSA 3WXIA 1NGHA 2W41A 3NVKA 4FYDA 3MEEA 1YHQN 2QWNA 3C0BA 3VQEA 1KFSA 4JI0K 4ICLA 4BG9A 3MECA 2WC9A 3AA5X 2WBNA 1NKEA 3U6FA 2FF6A 2ATQA 2HBMA 5KPTA 2FSJA 3G4SN 3S41A 3VF4A 3T69A 4G1QA 3NDKA 3E01A 1NM1A 3BF1A 2O8EA 4Z0UA 1TYQA 3AVKA 5JLFA 4YOXA 4A2BA 3QBXA 2JWLA 4M3XA 1DT9A 3H3NO 4BDZA 2UXBK 4JI6K 1YVNA 3O1BA 1TKXA 3VERA 1KVBA 3IRXA 3FFIA 2QWMA 4DTMA 3J81O 2E2PA 3OYBA 3V9WA 2ZWHA 4DV6K 5M1OA 4NXNK 4AHVA 5J2MA 4JI2K 4JI3K 4FLVA 5KI6A 2Q0UA 5CR4A 1Q86O 1VHXA 1DTQA 4DU3A 4K43A 3RMBA 2HVIA 3CQ8A 4C8OA 4CEFA 3CCVN 1NGEA 3ZSXA 4X62K 4K42A 1KSPA 4I7FA 5AQMA 1VSIA 3I55N 1BO5O 3DXKB 1QSYA 4KB0A 1NK5A 1XMQK 3T19A 2A42A 2XY7A 1RGIA 3V9UA 3E9LA 4H0YB 4CGIA 2A1SA 1J6ZA 1VQ5N 2P1JA 2X6NA 1BGXT 2NRXA 4CECA 4FWNA 1KC8O 3KJVA 3D7EO 3LP1A 4F2SA 2HBKA 3NCIA 1ASWA 5KGWA 2ASOA 2Z1GA 3K9KA 4N5SA 3E9OA 5AQZA 3HJFA 5AQHA 4J2BA 3RSEB 2UXDK 1VQLN 1JLAA 3LAMA 4IBNA 4WF9L 4N56A 2VGNA 3P4IA 4FZYA 4BRAA 5AQRA 3CXCM 3OW2M 3UB5A 1IBLK 4NLBA 2GUIA 3H08A 3ASMA 4JKDA 4XH4A 1WOQA 2V7ZA 4W5QA 4ZHRA 2G8WA 3F2KA 2P5OA 1LWEA 2GX9A 3EKSA 2JLEA 4BR9A 1YT3A 1W97L 2Q3SA 4KH6A 5AQUA 1EWQA 2FSKA 1IG8A 1IH7A 3O1WA 4IWVA 4B9NA 5H1SQ 5KQDA 2KTQA 1GLJO 1ZXOA 4M3YA 1QS4A 2HF3A 1ATNA 4DCHA 1NGDA 1RBUA 1N36K 2JGUA 3O3HA 2IVPA 3G10A 4Z4EA 5LMNK 1NGIA 1HRHA 2VYPA 3LP3A 1HUXA 1BIUA 3KD1E 3NF8A 3KLHA 3TI0A 4CK3A 2EX3A 1JLFA 3MDQA 5FRMA 3WNFA 1HR0K 1RBRA 3IUCA 1ZBIA 4I9LA 3LP2A 2QA4N 4KFBA 1O1WA 1J5OA 1DLOA 1BDGA 4HWIA 2VCPA 3PIPL 3WNEA 1ZYQA 3QIOA 4M63C 3L2WA 4I6MA 2YHXA 4GY2B 3LDNA 4MLHA 4YHHK 1WLJA 1VSLA 3ITHA 4YDUC 4DSEA 4L8RB 4GMJB 1S1XA 3FFKB 2YKMA 3VQ5A 4H0PA 4GKJK 2OANA 5AJ3K 3VQQA 1HJOA 2RE2A 1ATSA 1XNQK 1Q9YA 4ID1A 2HB5A 1HNXK 3ZT4A 2RF2A 1L3SA 2HHXA 4CEOA 3TWHA 1GLFO 3MX5A 3OTOK 4Z4FA 5TKWA 4DTXA 3K5OA 3RMCA 2EWSA 2F96A 1T7PA 3TABA 1S1UA 5C10A 2WFBA 4IFVA 5EXWA 4AILC 5AZIB 3DLBA 3U3YA 3ZSWA 5HROA 4FM1A 3MWTA 1R59O 1JCFA 4KTZA 3SMSA 4KHUA 1CXUA 5BN8A 2B6AA 3CG7A 2P9IB 3CCSN 2J4RA 1ILYA 3BUZB 3D2FB 4CHZA 3CCJN 3CQXA 4A59A 3MK6A 4E7LA 5EVZA 4WFAL 2W6LA 3DXMA 1M1KO 1WAJA 3SV3A 4JD2B 3VENA 2Y1JA 4CERA 1GLEG 3HK2A 4CZJA 3IFRA 1IJJA 4A61A 4JEPA 4HUFA 4DF8A 1IO2A 1F21A 4OLBA 4A2AA 3PV8A 4CGHA 2PFUA 5AQVA 2X6SA 1GOCA 5AQNA 1XWLA 1QVGM 2A6AA 3MEGA 4BRPA 3DYAA 4LC9B 4K41A 4MFBA 2RN2A 4DWIA 3LM9A 5AQWA 4CK2A 2YKNA 4FM0A 2HBLA 4B3MK 5F1XA 4WQ4A 5J2PA 1W7AA 1Q8IA 4OGEA 3PY8A 1HKCA 2O8BB 3KTQA 3FZKA 3JSMA 3NVMA 4BC3A 1J54A 4J2EA 4KHSA 3THVA 4DTUA 4OKKA 5FPMA 4B1YB 3OS1A 4W5NA 1N33K 2WTUA 5AZJA 5KRSA 1B92A 2YNGA 4CEQA 4BGAA 1YJ9N 2P9KA 3VPZA 1TKDA 3CCEN 1NJIO 2XY5A 4BRDA 4DB3A 3SJJA 4DV5K 4AH9A 3QEVA 4DS5A 2F9WA 4YNQA 2LSNA 1MDUB 4NB4A 1C0TA 5LJVA 4RWTA 4CD1A 3AY9A 2IVOA 3VEZA 4BRKA 2I5JA 5DMRA 4DR4K 5E84A 1WUAA 2NRZA 4JI8K 3LZIA 2BDPA 2G8FA 1REVA 4BROA 1N6QA 4I9QA 1S6QA 3KK1A 1FW6A 1HLUA 2HNDA 4FWRA 4BRMA 4N47A 4JAXA 3HBTA 1I3AA 4M3TA 3OYFA 1TK0A 3HOTA 1W2BM 4OKEA 1OH7A 2G8HA 1YVUA 1TK5A 3P31A 1RDWX 4JNEA 3R6MA 5JS2A 3MN5A 3E9PA 4FLUA 3RTVA 4LH4A 4CJUA 5GIPA 4E1JA 3VQ6A 4DUYK 3OYNA 4BRGA 2O8DA 1NGCA 2I7NA 3I0RA 2HHWA 3HT3A 1P8ZA 3AVGA 1TKTA 4FLZA 4ISEA 3WEEB 3EZ5A 3LDSA 3WXLA 1VRTA 3OY9A 4H5VA 4J2AA 3OJUA 1SL2A 3SUQA 1T05A 2P9UB 3GDQA 1KCFA 4B3SK 3AVLA 3H46O 1K8KB 3EYZA 1U47A 4FVMA 2CH6A 1EKEA 4BC5A 4JLHA 2O8CA 4DTPA 4DQSA 1XHZA 1NK0A 1HPZA 3V9XA 1Y64A 4IG0A 3L3VA 3QLHA 1BG3A 5HRSA 3TAGA 2OZSA 3EEQA 3ATVA 4HUGA 5ELZA 2G8KA 2BE2A 3QNNA 4PKGA 2XRIA 3C6AA 3O08A 4ELUA 3HTVA 3L8BA 3ULDA 3J7ZO 5KQ8A 2D0CA 1B9DA 2DY4A 2A3ZA 3A2FA 2XO7A 3UKUA 3DLKA 4HCCA 2X74A 4DFPA 4JS5A 3NH2A 2O8FB 4OVLA 1WSIA 1BA1A 4BRLA 4BREA 3SQ2A 2E5LK 4IJAA 1I94K 4FZZA 2P9SA 2FF3B 5AQQA 4DQ8A 1NK7A 1X9JA 2ITGA 1Z6RA 4FLWA 4FLYA 3MCPA 3J80O 3VQ7A 1RDUA 4CEZA 4JKCA 5KTQA 3HXMA 4JI4K 3J7AP 1T3VA 4RCHA 3LPUA 4JRQA 3KLFA 4CFAA 4ELVA 2VWJA 3QFPA 3VGKA 4CHPA 1OVYA 2PY5A 5KPZA 1FK9A 4BRQA 4DTJA 2UUAK 3C7NA 3H1VX 2E20A 1SKRA 4CEDA 1C1BA 4JRPA 3S3MA 3AVJA 5C24A 5FPDA 1U49A 3WUHA 3THWB 1BUPA 3TTFA 2NUBA 1TYQB 2ASPA 1LAWA 3A5NC 2QKBA 3TAMA 4BG8A 1NWKA 3VMFB 3Q7BA 5BRFA 3OYCA 1JLGA 1HMVA 3NF9A 3B6OA 3NF6A 1VQ6N 4KV8A 2RKIA 1P90A 4DV0K 4OPKA 3A5LC 4KO0A 5IWAK 3OYIA 3LALA 3G6EN 3IDHA 1JXBA 3QMLA 5GAHP 3CJ1A 2D0AA 5AQKA 4JK8A 2VG5A 1A5XA 2UU9K 4DFJA 3UKRA 1WSFA 3IS9A 3AA4A 1G15A 2E4LA 2YJEA 3T1YK 2IS3A 1VQKN 4GNIA 1LWFA 2DFEA 4CJSA 3UIQA 2O4IA 1X3NA 2D1KA 2P9PB 2OCEA 2Q97A 3AO5A 3U9ZA 3HVRA 3VGLA 4LF7K 1WSHA 4K0KK 4RW9A 4CESA 4C8KA 5M1NA 1X9SA 2OA8A 5AQJA 3CJ7A 4E7IA 1UA1A 3SV4A 3WT0A 4RTFD 4CJPA 4WQ5A 5I9EB 4UQGA 2YHAA 2D4WA 3WXMB 2E6LA 2E2OA 3O4WA 1NJZA 1A5WA 3MN7A 3CJBA 3E1YA 1BU6O 2O4GA 3NE6A 1L3VA 5HLFA 3L2UA 3HYFA 3OS0A 4BVPA 1HJRA 1U45A 3AO2A 4CI6A 4FCYA 4CJQA 3FLCO 4H03B 1JJ2M 4DSKA 1TUUA 1RTDA 1Z05A 1VQ4N 3FZMA 1D9DA 1CLQA 4Z4HA 5EX5A 3FE1A 3OHRA 2ZJQL 4OJRA 1UWBA 2V52B 5EU7A 3V81A 3AAPA 4DSJA 5AQIA 4KHWA 2JWKA 3MX2A 4KHNA 1RDDA 2NZTA 5LMUK 4IEEA 3VGMA 1DEJA 5HRNA 3LL3A 4CFCA 1TAUA 4LF9K 3SYZA 3OYEA 3CFOA 2ZGZA 5B8HA 3THYA 4CIFA 2HHUA 1SAZA 3I8DA 3AO3A 3VF2A 3R9PA 3G71N 1NJXA 5GAEP 3HPOA 2QWOA 3R1XA 4K25A 3PSFA 2D0OA 3W3DA 3AVCA 2YHYA 2YHBA 3O80A 4J8FA 3HI0A 1IKWA 1C1AA 1SKWA 3U4LA 4BDYA 2YV0X 3CMAN 2G8VA 1XI1A 2QW9A 3ZSZA 5M1QA 4Y1CA 3P83D 3TTCA 4EP5A 4EFHA 4CCHA 3TAQA 1JL2A 2IAJA 3VEOA 4B8AB 4LSLA 3VESA 2KZMA 2DPNA 3S3OA 4GVMA 4I6MB 4IJNA 4AM6A 1TUYA 3AO1A 4E19A 1RBSA 4IXCA 3S9HA 4F2RA 2E2NA 1JXEA 1OVQA 5C0YA 5AFUA 3K59A 4CZIA 1QE1A 3S3NA 3HP9A 5CY4A 3CPEA 3DOLA 3MXIA 3ZT3A 4UY8O 5CYQA 3L6QA 5M1PA 3ZLJA 1HKBA 4CZLA 2Q0RA 3MCAB 2H3GX 4DSLA 3MN6A 4B3RK 1J53A 3D2EA 4BRCA 4JKGA 3VQBA 4BGBA 3VTHA 4B9VA 3D0PA 2YCHA 1TV6A 1SS6A 3M8QA 1QQOA 3JYTA 3LWLA 4O5FA 2KHOA 4M42A 1LOTB 4RG8A 4ZTJA 4BR4A 3DLGA 3KWGA 1BQMA 4IEIA 4CZHA 3ULEA 3OYJA 1S1TA 3LDOA 4NCGA 3CI5A 3DXMB 2Y1IA 3TAPA 4MQ3A 4IO8A 4ISGA 4RW6A 4CJ5A 5I42A 1JLEA 4H5WA 5F0XA 5CZ1A 3B8AX 3V6DA 1FXXA 4YOYA 4J2DA 4DR3K 4ZTFA 1VQPN 3NH1A 3O3FA 5KGXA 1NOYA 3AGKA 1N8RO 3ZEUA 4NCAA 2QTDA 3WQTA 3I8BA 3RMAA 4C1NI 2IIRA 3OYAA 3QEPA 3CYMA 5CZ2A 3B6PA 5FRNA 2ZM6K 3U9DA 4CEBA 3D6RA 4QAGA 3NGYA 3MN9A 4B1XB 4E89A 1LW2A 4AM7A 2VQFK 3DOKA 1VSMA 4N41A 4B9LA 4YOTA 4CBWA 3CM6A 1V4TA 3G25A 3CC4N 2IDOA 1LW0A 2QWRA 3SAGA 1RBVA 1T8EA 2PYJA 4BE1A 3EO3A 1QSLA 2NRTA 3BGRA 1QQCA 2OPRA 4BDPA 3PO5A 4KAZA 1C0UA 4JS4A 1OKJA 2YNFA 1RTJA 4TSXA 4YOWA 4Z4GA 4CHOA 2AP1A 2OZMA 2DTUA 2P9KB 4FK0A 4DSIA 4OO1J 4DTSA 1WSGA 3O5BA 3SK3A 3QETA 2E8AA 4DU1A 4YDUA 3THXB 3FGUA 4JHDB 3CCLN 4V19S 4CZEA 1ZBUA 3SQ0A 1RDAA 4B1VA 4BC4A 2OYQA 4CW7B 2ZGYA 4ID5A 3NGZA 4OKJA 3K2PA 1EO1A 3T1HK 4CIGA 3NGIA 3AVHA 4IO9L 3DLLL 1RT4A 3ZSYA 5CYMA 5KPRA 5KRTA 1Q82O 1NKCA 4JKFA 4W5TA 1SZ2A 2PBDA 1WBDA 1IKYA 4CD3A 1WAFA 3VQ8A 3K58A 4B1WB 3CJAA 4OPHA 4CJ7A 3RSEA 3D45A 1YJWN 5FROA 4MO4A 4CZFA 4KHPK 3AVAA 2XY8A 1YTAA 4JK9A 3VQ4A 4H0VB 1C0GA 2NRRA 3SUOA 4KRFA 2IVNA 1QVFM 3CC7N 2P9LB 2BTFA 3KKSA 4PKIA 4ISFA 1NK4A 3OYGA 3KLIA 4AHUA 1RT1A 2I7PA 4HTUA 1TGOA 5HP1A 1XMOK 1D5AA 1VQMN 2DFHA 1A5VA 3BP8A 3L4QA 4BVOA 4OLAA 1BIZA 1KXPA 4IDHA 3QEIA 1JCEA 5C2DA 4CEAA 1KAXA 3FZFA 3VQPA 3F9KA 3CMEN 3RMDA 3GG4A 5HRRA 3QICA 3WNGA 1QHTA 2NLXA 3RR8A 2GV9A 1L5UA 2F4VK 4M3UA 2WONA 1NKBA 3KVGA 1YITN 1VRUA 4ELTA 4A5BA 4FJMA 2VG7A 3BY5A 3CJ9A 1RBTA 3KHYA 3RWUA 3TR8A 4WQ4C 3TU5A 3PIOL 2YI1A 1NGAA 4F4KA 3UKUB 4B3OA 3H1QA 4DQPA 2F9TA 4X66K 1IBKK 3G0ZA 4CGFA 3HP6A 3BZCA 5BRDA 4LFCK 4M45A 1BI4B 1NG9A 4JN4A 4WYBA 1E4GT 4XIUA 1U2VA 5AFUH 3VEYA 1TL1A 1WN7A 4R5PA 4FWLA 4DV1K 1HPMA 4CHQA 4Z4CA 5BRHA 3BZKA 3DAWA 3Q7CA 4U67L 4OPJA 3CCRN 3AV9A 3M8PA 5SZTA 1KD1O 2DFFA 4FLXA 3V9SA 3PUFA 4FJJA 3CD6N 4F3OA 1KAZA 4FJLA 2Q31A 3QBWA 1NJWA 4CJLA 4DSFA 1S9GA 3U3GA 2HVHA 3TSUA 4AHRA 3JS6A 4DMNA 1LV5A 1QSSA 4DQQA 2OPPA 4A57A 3JXUA 4M3WA 1KAYA 4FJ5A 5AZIA 1VSDA 4BRFA 3SAHA 1LCUA 4IFYA 3O9SA 3H45C 1VQON 3ZSOA 2P51A 4AQYK 4FK2A 1K8AO 5JMVA 3A8YA 1QHAA 3D2FA 3VQCA 4E1NA 5BPMA 4H4OA 1YF5L 1ATRA 4JD2A 3SQ1A 4FJ9A 2BUPA 1Q81O 4JKBA 4AHTA 2G8UA 3UKRB 3ATUA 3BDPA 2HHSA 1HYVA 1QQNA 3SBGA 1RDBA 1DKGD 3T7ZA 4YOVA 4X65K 3AVMA 4PUOA 3ZX0A 4ILJA 3SAFA 1RTIA 4FWQA 3AGRA 4YOUA 4BR0A 4E7JA 4F3TA 1KVCA 1CZ9A 2AJQA 1RNHA 3R8EA 2E1ZA 5JICA 4DHYA 4EHUA 2QWLA 3W0LA 3HPGA 4BE0A 3MMVA 4PL8A 3C95A 3O9TA 4KB1A 1SUQA 1Q9XA 3SJHA 2AA4A 4FVUA 2UUCK 2O8BA 3A0IX 4HUEA 4RW8A 1QZ6A 3HL8A 2VWKA 1JL1A 1O13A 2B4JA 3NH0A 1RT6A 1CXQA 4BC2A 4QOZB 3ZT1A 2E6MA 4CBUA 4FJKA 1BQNA 4BE2A 3H3OB 4WFNL 1XC9A 4CE9A 2Z1JA 3KLGA 1MU2A 2KFNA 1GOAA 4CZKA 3EZWA 3CERA 4XEIA 4B8CA 1TAQA 1V4SA 3M5RA 1RT2A 3L2VA 5GADP 4H0TB 3QERA 1HNVA 3R3LA 4CJEA
chains in the Genus database with same CATH topology
2EX3A 1TKZA 1JLFA 3AO3A 3VQAA 4YFUA 1NJXA 2YNHA 5FRMA 3WNFA 1EP4A 5SWMA 1NOZA 1IKVA 3HPOA 4DLGA 4KREA 1RBRA 1ZBIA 4DF4A 1B9FA 4I9LA 3LP2A 4DQRA 4KFBA 3AVCA 2YHBA 1O1WA 1J5OA 2ZQBA 1DLOA 1IKWA 1C1AA 2FBYA 3WNEA 4CGDA 1ZYQA 3QIOA 4E1MA 1SKWA 3L2WA 4BDYA 2YV0X 2G8VA 1WLJA 1VSLA 4CJVA 3ITHA 4DSEA 1XI1A 3F73A 4EZ9A 3ZSZA 4L8RB 4Y1CA 3HSTB 4GMJB 3P83D 1S1XA 3DRRA 4EP5A 3HVTA 2KW4A 3DMJA 3I0SA 4FJIA 2YKMA 1FKPA 3VQ5A 4CCHA 2KFZA 4RW4A 2EHGA 3VQQA 3TAQA 1JL2A 2IAJA 1UA0A 1NK6A 4W5RA 4B8AB 4ID1A 2HB5A 1Q9YA 1TK5A 1DTTA 4LSLA 3ZT4A 2RF2A 1L3SA 2HHXA 4CEOA 3TWHA 4QCLA 1BHLA 1VSJA 2KZMA 1K6YA 3P1GA 2QXFA 4GVMA 3S3OA 4Z4FA 1HQEA 1VSKA 4DTXA 4CK1A 5C25A 4DG1A 1VK0A 3PX6A 3AO1A 3K5OA 4PA1A 4CEEA 5E41A 3RMCA 3NFAA 4E19A 3TAFA 1U4BA 1RBSA 3S9HA 4F2RA 2F96A 1JXEA 1T7PA 4DQIA 1EX4A 3LPTA 3TABA 1S1UA 4O0JA 3K59A 4FJ8A 1QE1A 4OGCA 3S3NA 4B9TA 5D3GA 2IGIA 4E7KA 4IFVA 3HP9A 5CY4A 3KD5E 3L2QA 4AILC 3DLBA 3DOLA 3MXIA 3ZT3A 5CYQA 1EETA 2OPQA 1JKHA 1WSEA 3U3YA 2D5RA 1YTUA 3ZSWA 2A1RA 5HROA 2IC3A 4CFDA 4FM1A 5J2NA 3CM5A 2P5GA 4KTZA 3DRSA 4DSLA 4KHUA 1CXUA 4K8ZA 2B6AA 3CG7A 4FJXA 1J9AA 1HQUA 1J53A 2IOCA 3PO4A 3VQBA 4M41A 1UAXA 4CHZA 3OYLA 4B9VA 3D0PA 3AA3A 4Q5VA 4E7LA 2FBVA 4BWJA 1TV6A 4BWMA 2HHQA 3OYHA 3M8QA 1WAJA 3JYTA 1TVRA 3SV3A 2Y1JA 3LWLA 1Y97A 4M42A 3OVNA 3K5LA 1JLCA 4KKOA 4RW7A 3L3UA 4CERA 4RG8A 3SI6A 4ZTJA 3HK2A 3TANA 3DLGA 4FXDA 1BQMA 4AHCA 4I2PA 4HUFA 1X1PA 4DF8A 1IO2A 3SQ4A 4CF1A 3L2RA 1F21A 4CJWA 3OYJA 1S1TA 2PZSA 4OLBA 4NCGA 3PV8A 1U48A 3OYMA 2Y1IA 4CGHA 3TAPA 4MQ3A 1R0AA 3AVIA 4RW6A 2X6SA 1GOCA 1U04A 4H4MA 4FLTA 1XWLA 4DFMA 3RRGA 4KPYA 4CJ5A 5I42A 1EXQA 4C8NA 3MEGA 1JLEA 5CZ1A 1BCMA 3QO9A 3DYAA 1JLBA 4MFBA 2RN2A 3V6DA 4DWIA 1LAVA 1FXXA 4J2DA 4CJFA 1IG9A 4CK2A 4GW6A 2YKNA 4FM0A 3OJSA 4ZTFA 2QKKA 2F8SA 2QK9A 3NH1A 1RT3A 4DLEA 3OYKA 3O3FA 5J2PA 5KGXA 3DI6A 3T1AA 1Q8IA 1ZBFA 3DRPA 4OGEA 1NOYA 1D9FA 3PY8A 2KZZA 3KTQA 4NCAA 1BI4A 3JSMA 1S6PA 1J54A 4J2EA 3RMAA 3MAQA 4KHSA 3THVA 4DTUA 4OKKA 1KTQA 1Z26A 3OYAA 3VQ9A 3OS1A 3DLRA 2X78A 3CYMA 5CZ2A 3SUPA 3B6PA 3QEPA 4FJHA 5FRNA 4W5NA 4E0DA 4CEBA 1IKXA 4WE1A 3O4QA 3TARA 3ZSRA 4CJRA 3C6TA 4QAGA 1BL3A 3NGYA 3ZT0A 4CF9A 3KLEA 4E89A 2BANA 1LW2A 1RCHA 5KRSA 1B92A 2YNGA 1ASVA 1VSMA 3DOKA 4CEQA 4N41A 3KKRA 4FW1A 4CJ4A 1TKDA 3PX0A 4B9LA 3CM6A 2XY5A 2IDOA 4LH5A 3SJJA 1KVAA 3LP0A 1LW0A 5HBMA 3NF7A 2BGGA 1RBVA 3MXJA 1T8EA 3KIOA 3ZCMA 4AH9A 2PYJA 4HCBA 4CJKA 3QEVA 4BE1A 4DS5A 4YNQA 4M3ZA 5HRPA 1QSLA 2LSNA 3BGRA 1QQCA 4CHNA 2OPRA 4BDPA 4IDKA 3PO5A 3HM9A 1C0UA 4KAZA 4JS4A 1C0TA 2YNFA 1RTJA 4TSXA 3V9ZA 1X9WA 4FJGA 4Z4GA 4CHOA 2Z1HA 4Z4IA 4PQUA 4C8MA 3VQDA 4CFBA 2OZMA 2DTUA 4DU4A 3QEXA 4DSIA 4FK0A 4DTSA 2I5JA 5DMRA 1ZBLA 1WSGA 4KI6A 3ZSQA 3LZIA 3QETA 2BDPA 4CHYA 4DU1A 1RT7A 1UOCA 4PWDA 2G8FA 1REVA 4E7HA 1WSJA 1W0HA 1N6QA 4I9QA 1S6QA 3AVFA 3KK1A 3QESA 4KTWA 1ZBUA 2HNDA 4N47A 3SQ0A 1I3AA 1NJYA 1RDAA 2OYQA 4M3TA 3AA2A 3OYFA 4HVJA 1TK0A 3VN5A 4OKEA 2HHTA 3CFPA 3SPYA 2G8HA 2W42A 1TK8A 1HNIA 1YVUA 1VSFA 3AVBA 3QIPA 4ID5A 4AHSA 2RPIA 4Y1DA 2YNIA 3NGZA 3EY1A 2R7YA 4OKJA 1I39A 3K2PA 1QTMA 5JS2A 1KFDA 2G8IA 3SCXA 4CGGA 5K14A 4FLUA 3RTVA 4LH4A 4FM2A 4CJUA 4CIGA 3NGIA 3AVHA 3VQ6A 3OYNA 1XHXA 1S1VA 4CF2A 3IAYA 1RT4A 3ZSYA 5CYMA 4W5OA 4M3RA 3I0RA 1X9MA 2HHWA 3HT3A 5KRTA 2XY6A 2HNZA 4O5BA 3AVGA 1TKTA 4FLZA 3ALYA 3SZ2A 3ISNC 1GOBA 3EZ5A 5I3UA 4O0IA 1NKCA 3LDSA 4W5TA 3OY9A 1VRTA 1IKYA 4J2AA 3ZSVA 1WAFA 1SV5A 3VQ8A 3O3GA 3K58A 3OJUA 1SL2A 3SNNA 3QINA 4H8KA 3SUQA 1T05A 1SL0A 3O4NA 1KCFA 3D45A 5FROA 4K8XA 1S9EA 3AVLA 3EYZA 3HPHA 3NBPA 1U47A 3AVAA 2PYLA 2XY8A 4FVMA 4LSNA 3KK3A 4I2QA 1YTAA 1EKEA 3VQ4A 4EP4A 4KHYA 4JLHA 3TAEA 1C1CA 4DTPA 4KHQA 4DQSA 3SUOA 1D8YA 4KRFA 1XHZA 3DLEA 1NK0A 1VSHA 4B08A 3K5NA 2ETJA 4HHTA 1HPZA 3M8SA 3V9XA 3DLHA 3KKSA 4IG0A 4PY5A 3L3VA 1NK4A 3QLHA 4FW2A 3OYGA 5J2QA 3KLIA 4AHUA 2F8TA 1NK9A 1RT1A 4N76A 5HRSA 4HTUA 1TGOA 3TAGA 5HP1A 1D5AA 2OZSA 4HUGA 4E3SA 2G8KA 3LAKA 2DFHA 4DTOA 2BE2A 3QNNA 2XRIA 1A5VA 4OLAA 5J1EA 1BIZA 4EZ6A 3QEIA 4ELUA 4CEAA 3L8BA 3VQPA 3ULDA 3F9KA 1SL1A 4IG3A 2HNYA 3LANA 2D0CA 2KQ2A 1B9DA 3RMDA 5T7BA 1L3TA 2DY4A 1T03A 3A2FA 5HRRA 3WNGA 1QHTA 3DLKA 2XO7A 3RR8A 4HCCA 1ZBHA 2X74A 4DFPA 4NYNA 4KTQA 2GV9A 1L5UA 4JS5A 4M3UA 1KLNA 3NH2A 3M8RA 2WONA 1NKBA 3K57A 1VRUA 4ELTA 4O55A 3PX4A 4OVLA 1WSIA 4FJMA 2VG7A 4CJTA 1SKSA 3SQ2A 4FJ7A 1KRPA 4DTRA 1RBTA 3MEEA 4FYDA 4FZZA 2VG6A 3VQEA 1W9HA 3LZJA 1KFSA 3RWUA 4ICLA 3TR8A 4FK4A 3MECA 3RMBA 4DTNA 1NK7A 3AA5X 4F4KA 2ITGA 4KI4A 1NKEA 4B3OA 3U6FA 1VSEA 2ATQA 4FLWA 3VA0A 4FLYA 1ASUA 4DQPA 1HYSA 4G1QA 1S5JA 3G0ZA 3VQ7A 4CGFA 3E01A 3NDKA 4CEZA 1RTHA 4FJNA 3HP6A 1BCOA 5KTQA 3HXMA 1HYZA 2Z1IA 4Z0UA 4M45A 3AVKA 3LPUA 3V4IA 4JRQA 3KLFA 1BI4B 4CFAA 3NHGA 2HW3A 4ELVA 4M3XA 2VWJA 4IKFA 5C42A 3V1QA 4CHPA 4BDZA 2PY5A 5JS1A 4XIUA 1TKXA 1TL1A 1FK9A 1KVBA 1WN7A 4R5PA 4KB1A 4DTJA 1SKRA 3IRXA 4DFKA 4CEDA 1C1BA 4CHQA 4Z4CA 3T3FA 2WOMA 1Z25A 3FFIA 4CIEA 3AVJA 2XHBA 4JRPA 4DTMA 3S3MA 5C24A 3VA3A 3OYBA 2HMIA 3V9WA 1U49A 1C6VA 2NUBA 1LAWA 4AHVA 3WNHA 4OPJA 3AV9A 3M8PA 5SZTA 5J2MA 2QKBA 3TAMA 4FLVA 5DK5A 5KI6A 2DFFA 3NAEA 4FLXA 3V9SA 3SPZA 3PUFA 3OYCA 1JLGA 4FJJA 4F3OA 4FJLA 1DTQA 2B5JA 1NJWA 4CJLA 1HMVA 1S9GA 4O44A 3NF9A 3U3GA 4DSFA 3OYDA 3CQ8A 3B6OA 3NF6A 4DU3A 2HVHA 2HVIA 4KV8A 2RKIA 4AHRA 4C8OA 4CEFA 4OPKA 1S1WA 1ITGA 5FDLA 4DMNA 1LV5A 1QSSA 4DQQA 4KO0A 2OPPA 3ZSXA 3LALA 3OYIA 1JXBA 1KSPA 4I7FA 4M3WA 1VSIA 2D0AA 4FJ5A 1VSDA 4C8LA 1CZBA 1QSYA 4KB0A 1NK5A 2FBXA 2VG5A 1A5XA 3T19A 4IFYA 4DFJA 1WSFA 3C94A 2XY7A 3IS9A 3V9UA 3AA4A 1FKOA 1G15A 2E4LA 2GBZA 4CGIA 2A1SA 4BACA 3ZSOA 2P51A 4FK2A 2IS3A 2P1JA 4B9UA 1LWFA 2DFEA 1BGXT 2X6NA 4CECA 3K5MA 4CJSA 3UIQA 2O4IA 3VQCA 3KJVA 4E1NA 3RRHA 3MEDA 3RR7A 4H4OA 3AO5A 3C6UA 3LP1A 3SQ1A 4CJ3A 4F2SA 3HVRA 4FJ9A 3NCIA 1ASWA 4AHTA 1WSHA 4RW9A 5KGWA 2G8UA 4CESA 3BDPA 4C8KA 1NK8A 3AO4A 2Z1GA 3LWMA 1X9SA 4N5SA 3V1OA 2OA8A 2HHSA 1HYVA 1RDCA 3P5JA 1N5YA 1RDBA 4E7IA 3HJFA 1UA1A 3SV4A 3KK2A 4NYFA 2FC0A 2ZE2A 3AVMA 4J2BA 4CJPA 4PUOA 4CF0A 4LY7A 1RTIA 1JLAA 3LAMA 4IBNA 4UQGA 2YHAA 4E7JA 4F3TA 1KVCA 1RILA 4B9MA 1CZ9A 2E6LA 4CGJA 4N56A 1LWCA 2AJQA 1NJZA 1A5WA 4FZYA 1RNHA 2O4GA 3AVNA 3NE6A 1L3VA 5HLFA 3L2UA 3HYFA 3DM2A 3OS0A 1HJRA 1U45A 4B9SA 3HO1A 3AO2A 2GUIA 3H08A 3ASMA 4FCYA 1L3UA 4CJQA 2ZD1A 3HPGA 4W5QA 4ZHRA 4BE0A 4F8RA 2G8WA 1WNSA 3C95A 2D0BA 1LWEA 1SUQA 3CFRA 2JLEA 3QEWA 1Q9XA 1YT3A 2P5OA 4DSKA 1RTDA 1JLQA 4LD0A 2Q3SA 4HUEA 4RW8A 1IH7A 1D9DA 1CLQA 4B9NA 4Z4HA 3HL8A 2VWKA 1JL1A 2B4JA 2KTQA 3ZT2A 1RT6A 1CXQA 4O4GA 3NH0A 4M3YA 4QOZB 4OJRA 1QS4A 1UWBA 3SUNA 3ZT1A 2E6MA 5EU7A 4FJKA 1BQNA 3IG1A 4BE2A 3V81A 4DSJA 1XC9A 3OS2A 4KHWA 1RBUA 4CE9A 1C0MA 3V1RA 2FBTA 2Z1JA 3KLGA 1MU2A 2JGUA 4FZXC 2KFNA 3O3HA 1GOAA 1BISA 3G10A 4KHNA 1RDDA 3QNOA 4Z4EA 4CF8A 3MXMA 4B8CA 4Q0BA 1TAQA 1HRHA 3LP3A 1BIUA 1RT2A 5HRNA 3KD1E 3L2VA 4NCBA 3NF8A 4CFCA 1TAUA 1KLMA 3QERA 3SYZA 1HNVA 3KLHA 4DS4A 2OPSA 3TI0A 3OYEA 3CFOA 1RT5A 1TL3A 4CJEA 4CK3A 4CIFA 2HHUA 3I8DA 2HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX3 A;  1TKZ A;  1JLF A;  3AO3 A;  3VQA A;  4YFU A;  1NJX A;  2YNH A;  5FRM A;  3WNF A;  1EP4 A;  5SWM A;  1NOZ A;  1IKV A;  3HPO A;  4DLG A;  4KRE A;  1RBR A;  1ZBI A;  4DF4 A;  1B9F A;  4I9L A;  3LP2 A;  4DQR A;  4KFB A;  3AVC A;  2YHB A;  1O1W A;  1J5O A;  2ZQB A;  1DLO A;  1IKW A;  1C1A A;  2FBY A;  3WNE A;  4CGD A;  1ZYQ A;  3QIO A;  4E1M A;  1SKW A;  3L2W A;  4BDY A;  2YV0 X;  2G8V A;  1WLJ A;  1VSL A;  4CJV A;  3ITH A;  4DSE A;  1XI1 A;  3F73 A;  4EZ9 A;  3ZSZ A;  4L8R B;  4Y1C A;  3HST B;  4GMJ B;  3P83 D;  1S1X A;  3DRR A;  4EP5 A;  3HVT A;  2KW4 A;  3DMJ A;  3I0S A;  4FJI A;  2YKM A;  1FKP A;  3VQ5 A;  4CCH A;  2KFZ A;  4RW4 A;  2EHG A;  3VQQ A;  3TAQ A;  1JL2 A;  2IAJ A;  1UA0 A;  1NK6 A;  4W5R A;  4B8A B;  4ID1 A;  2HB5 A;  1Q9Y A;  1TK5 A;  1DTT A;  4LSL A;  3ZT4 A;  2RF2 A;  1L3S A;  2HHX A;  4CEO A;  3TWH A;  4QCL A;  1BHL A;  1VSJ A;  2KZM A;  1K6Y A;  3P1G A;  2QXF A;  4GVM A;  3S3O A;  4Z4F A;  1HQE A;  1VSK A;  4DTX A;  4CK1 A;  5C25 A;  4DG1 A;  1VK0 A;  3PX6 A;  3AO1 A;  3K5O A;  4PA1 A;  4CEE A;  5E41 A;  3RMC A;  3NFA A;  4E19 A;  3TAF A;  1U4B A;  1RBS A;  3S9H A;  4F2R A;  2F96 A;  1JXE A;  1T7P A;  4DQI A;  1EX4 A;  3LPT A;  3TAB A;  1S1U A;  4O0J A;  3K59 A;  4FJ8 A;  1QE1 A;  4OGC A;  3S3N A;  4B9T A;  5D3G A;  2IGI A;  4E7K A;  4IFV A;  3HP9 A;  5CY4 A;  3KD5 E;  3L2Q A;  4AIL C;  3DLB A;  3DOL A;  3MXI A;  3ZT3 A;  5CYQ A;  1EET A;  2OPQ A;  1JKH A;  1WSE A;  3U3Y A;  2D5R A;  1YTU A;  3ZSW A;  2A1R A;  5HRO A;  2IC3 A;  4CFD A;  4FM1 A;  5J2N A;  3CM5 A;  2P5G A;  4KTZ A;  3DRS A;  4DSL A;  4KHU A;  1CXU A;  4K8Z A;  2B6A A;  3CG7 A;  4FJX A;  1J9A A;  1HQU A;  1J53 A;  2IOC A;  3PO4 A;  3VQB A;  4M41 A;  1UAX A;  4CHZ A;  3OYL A;  4B9V A;  3D0P A;  3AA3 A;  4Q5V A;  4E7L A;  2FBV A;  4BWJ A;  1TV6 A;  4BWM A;  2HHQ A;  3OYH A;  3M8Q A;  1WAJ A;  3JYT A;  1TVR A;  3SV3 A;  2Y1J A;  3LWL A;  1Y97 A;  4M42 A;  3OVN A;  3K5L A;  1JLC A;  4KKO A;  4RW7 A;  3L3U A;  4CER A;  4RG8 A;  3SI6 A;  4ZTJ A;  3HK2 A;  3TAN A;  3DLG A;  4FXD A;  1BQM A;  4AHC A;  4I2P A;  4HUF A;  1X1P A;  4DF8 A;  1IO2 A;  3SQ4 A;  4CF1 A;  3L2R A;  1F21 A;  4CJW A;  3OYJ A;  1S1T A;  2PZS A;  4OLB A;  4NCG A;  3PV8 A;  1U48 A;  3OYM A;  2Y1I A;  4CGH A;  3TAP A;  4MQ3 A;  1R0A A;  3AVI A;  4RW6 A;  2X6S A;  1GOC A;  1U04 A;  4H4M A;  4FLT A;  1XWL A;  4DFM A;  3RRG A;  4KPY A;  4CJ5 A;  5I42 A;  1EXQ A;  4C8N A;  3MEG A;  1JLE A;  5CZ1 A;  1BCM A;  3QO9 A;  3DYA A;  1JLB A;  4MFB A;  2RN2 A;  3V6D A;  4DWI A;  1LAV A;  1FXX A;  4J2D A;  4CJF A;  1IG9 A;  4CK2 A;  4GW6 A;  2YKN A;  4FM0 A;  3OJS A;  4ZTF A;  2QKK A;  2F8S A;  2QK9 A;  3NH1 A;  1RT3 A;  4DLE A;  3OYK A;  3O3F A;  5J2P A;  5KGX A;  3DI6 A;  3T1A A;  1Q8I A;  1ZBF A;  3DRP A;  4OGE A;  1NOY A;  1D9F A;  3PY8 A;  2KZZ A;  3KTQ A;  4NCA A;  1BI4 A;  3JSM A;  1S6P A;  1J54 A;  4J2E A;  3RMA A;  3MAQ A;  4KHS A;  3THV A;  4DTU A;  4OKK A;  1KTQ A;  1Z26 A;  3OYA A;  3VQ9 A;  3OS1 A;  3DLR A;  2X78 A;  3CYM A;  5CZ2 A;  3SUP A;  3B6P A;  3QEP A;  4FJH A;  5FRN A;  4W5N A;  4E0D A;  4CEB A;  1IKX A;  4WE1 A;  3O4Q A;  3TAR A;  3ZSR A;  4CJR A;  3C6T A;  4QAG A;  1BL3 A;  3NGY A;  3ZT0 A;  4CF9 A;  3KLE A;  4E89 A;  2BAN A;  1LW2 A;  1RCH A;  5KRS A;  1B92 A;  2YNG A;  1ASV A;  1VSM A;  3DOK A;  4CEQ A;  4N41 A;  3KKR A;  4FW1 A;  4CJ4 A;  1TKD A;  3PX0 A;  4B9L A;  3CM6 A;  2XY5 A;  2IDO A;  4LH5 A;  3SJJ A;  1KVA A;  3LP0 A;  1LW0 A;  5HBM A;  3NF7 A;  2BGG A;  1RBV A;  3MXJ A;  1T8E A;  3KIO A;  3ZCM A;  4AH9 A;  2PYJ A;  4HCB A;  4CJK A;  3QEV A;  4BE1 A;  4DS5 A;  4YNQ A;  4M3Z A;  5HRP A;  1QSL A;  2LSN A;  3BGR A;  1QQC A;  4CHN A;  2OPR A;  4BDP A;  4IDK A;  3PO5 A;  3HM9 A;  1C0U A;  4KAZ A;  4JS4 A;  1C0T A;  2YNF A;  1RTJ A;  4TSX A;  3V9Z A;  1X9W A;  4FJG A;  4Z4G A;  4CHO A;  2Z1H A;  4Z4I A;  4PQU A;  4C8M A;  3VQD A;  4CFB A;  2OZM A;  2DTU A;  4DU4 A;  3QEX A;  4DSI A;  4FK0 A;  4DTS A;  2I5J A;  5DMR A;  1ZBL A;  1WSG A;  4KI6 A;  3ZSQ A;  3LZI A;  3QET A;  2BDP A;  4CHY A;  4DU1 A;  1RT7 A;  1UOC A;  4PWD A;  2G8F A;  1REV A;  4E7H A;  1WSJ A;  1W0H A;  1N6Q A;  4I9Q A;  1S6Q A;  3AVF A;  3KK1 A;  3QES A;  4KTW A;  1ZBU A;  2HND A;  4N47 A;  3SQ0 A;  1I3A A;  1NJY A;  1RDA A;  2OYQ A;  4M3T A;  3AA2 A;  3OYF A;  4HVJ A;  1TK0 A;  3VN5 A;  4OKE A;  2HHT A;  3CFP A;  3SPY A;  2G8H A;  2W42 A;  1TK8 A;  1HNI A;  1YVU A;  1VSF A;  3AVB A;  3QIP A;  4ID5 A;  4AHS A;  2RPI A;  4Y1D A;  2YNI A;  3NGZ A;  3EY1 A;  2R7Y A;  4OKJ A;  1I39 A;  3K2P A;  1QTM A;  5JS2 A;  1KFD A;  2G8I A;  3SCX A;  4CGG A;  5K14 A;  4FLU A;  3RTV A;  4LH4 A;  4FM2 A;  4CJU A;  4CIG A;  3NGI A;  3AVH A;  3VQ6 A;  3OYN A;  1XHX A;  1S1V A;  4CF2 A;  3IAY A;  1RT4 A;  3ZSY A;  5CYM A;  4W5O A;  4M3R A;  3I0R A;  1X9M A;  2HHW A;  3HT3 A;  5KRT A;  2XY6 A;  2HNZ A;  4O5B A;  3AVG A;  1TKT A;  4FLZ A;  3ALY A;  3SZ2 A;  3ISN C;  1GOB A;  3EZ5 A;  5I3U A;  4O0I A;  1NKC A;  3LDS A;  4W5T A;  3OY9 A;  1VRT A;  1IKY A;  4J2A A;  3ZSV A;  1WAF A;  1SV5 A;  3VQ8 A;  3O3G A;  3K58 A;  3OJU A;  1SL2 A;  3SNN A;  3QIN A;  4H8K A;  3SUQ A;  1T05 A;  1SL0 A;  3O4N A;  1KCF A;  3D45 A;  5FRO A;  4K8X A;  1S9E A;  3AVL A;  3EYZ A;  3HPH A;  3NBP A;  1U47 A;  3AVA A;  2PYL A;  2XY8 A;  4FVM A;  4LSN A;  3KK3 A;  4I2Q A;  1YTA A;  1EKE A;  3VQ4 A;  4EP4 A;  4KHY A;  4JLH A;  3TAE A;  1C1C A;  4DTP A;  4KHQ A;  4DQS A;  3SUO A;  1D8Y A;  4KRF A;  1XHZ A;  3DLE A;  1NK0 A;  1VSH A;  4B08 A;  3K5N A;  2ETJ A;  4HHT A;  1HPZ A;  3M8S A;  3V9X A;  3DLH A;  3KKS A;  4IG0 A;  4PY5 A;  3L3V A;  1NK4 A;  3QLH A;  4FW2 A;  3OYG A;  5J2Q A;  3KLI A;  4AHU A;  2F8T A;  1NK9 A;  1RT1 A;  4N76 A;  5HRS A;  4HTU A;  1TGO A;  3TAG A;  5HP1 A;  1D5A A;  2OZS A;  4HUG A;  4E3S A;  2G8K A;  3LAK A;  2DFH A;  4DTO A;  2BE2 A;  3QNN A;  2XRI A;  1A5V A;  4OLA A;  5J1E A;  1BIZ A;  4EZ6 A;  3QEI A;  4ELU A;  4CEA A;  3L8B A;  3VQP A;  3ULD A;  3F9K A;  1SL1 A;  4IG3 A;  2HNY A;  3LAN A;  2D0C A;  2KQ2 A;  1B9D A;  3RMD A;  5T7B A;  1L3T A;  2DY4 A;  1T03 A;  3A2F A;  5HRR A;  3WNG A;  1QHT A;  3DLK A;  2XO7 A;  3RR8 A;  4HCC A;  1ZBH A;  2X74 A;  4DFP A;  4NYN A;  4KTQ A;  2GV9 A;  1L5U A;  4JS5 A;  4M3U A;  1KLN A;  3NH2 A;  3M8R A;  2WON A;  1NKB A;  3K57 A;  1VRU A;  4ELT A;  4O55 A;  3PX4 A;  4OVL A;  1WSI A;  4FJM A;  2VG7 A;  4CJT A;  1SKS A;  3SQ2 A;  4FJ7 A;  1KRP A;  4DTR A;  1RBT A;  3MEE A;  4FYD A;  4FZZ A;  2VG6 A;  3VQE A;  1W9H A;  3LZJ A;  1KFS A;  3RWU A;  4ICL A;  3TR8 A;  4FK4 A;  3MEC A;  3RMB A;  4DTN A;  1NK7 A;  3AA5 X;  4F4K A;  2ITG A;  4KI4 A;  1NKE A;  4B3O A;  3U6F A;  1VSE A;  2ATQ A;  4FLW A;  3VA0 A;  4FLY A;  1ASU A;  4DQP A;  1HYS A;  4G1Q A;  1S5J A;  3G0Z A;  3VQ7 A;  4CGF A;  3E01 A;  3NDK A;  4CEZ A;  1RTH A;  4FJN A;  3HP6 A;  1BCO A;  5KTQ A;  3HXM A;  1HYZ A;  2Z1I A;  4Z0U A;  4M45 A;  3AVK A;  3LPU A;  3V4I A;  4JRQ A;  3KLF A;  1BI4 B;  4CFA A;  3NHG A;  2HW3 A;  4ELV A;  4M3X A;  2VWJ A;  4IKF A;  5C42 A;  3V1Q A;  4CHP A;  4BDZ A;  2PY5 A;  5JS1 A;  4XIU A;  1TKX A;  1TL1 A;  1FK9 A;  1KVB A;  1WN7 A;  4R5P A;  4KB1 A;  4DTJ A;  1SKR A;  3IRX A;  4DFK A;  4CED A;  1C1B A;  4CHQ A;  4Z4C A;  3T3F A;  2WOM A;  1Z25 A;  3FFI A;  4CIE A;  3AVJ A;  2XHB A;  4JRP A;  4DTM A;  3S3M A;  5C24 A;  3VA3 A;  3OYB A;  2HMI A;  3V9W A;  1U49 A;  1C6V A;  2NUB A;  1LAW A;  4AHV A;  3WNH A;  4OPJ A;  3AV9 A;  3M8P A;  5SZT A;  5J2M A;  2QKB A;  3TAM A;  4FLV A;  5DK5 A;  5KI6 A;  2DFF A;  3NAE A;  4FLX A;  3V9S A;  3SPZ A;  3PUF A;  3OYC A;  1JLG A;  4FJJ A;  4F3O A;  4FJL A;  1DTQ A;  2B5J A;  1NJW A;  4CJL A;  1HMV A;  1S9G A;  4O44 A;  3NF9 A;  3U3G A;  4DSF A;  3OYD A;  3CQ8 A;  3B6O A;  3NF6 A;  4DU3 A;  2HVH A;  2HVI A;  4KV8 A;  2RKI A;  4AHR A;  4C8O A;  4CEF A;  4OPK A;  1S1W A;  1ITG A;  5FDL A;  4DMN A;  1LV5 A;  1QSS A;  4DQQ A;  4KO0 A;  2OPP A;  3ZSX A;  3LAL A;  3OYI A;  1JXB A;  1KSP A;  4I7F A;  4M3W A;  1VSI A;  2D0A A;  4FJ5 A;  1VSD A;  4C8L A;  1CZB A;  1QSY A;  4KB0 A;  1NK5 A;  2FBX A;  2VG5 A;  1A5X A;  3T19 A;  4IFY A;  4DFJ A;  1WSF A;  3C94 A;  2XY7 A;  3IS9 A;  3V9U A;  3AA4 A;  1FKO A;  1G15 A;  2E4L A;  2GBZ A;  4CGI A;  2A1S A;  4BAC A;  3ZSO A;  2P51 A;  4FK2 A;  2IS3 A;  2P1J A;  4B9U A;  1LWF A;  2DFE A;  1BGX T;  2X6N A;  4CEC A;  3K5M A;  4CJS A;  3UIQ A;  2O4I A;  3VQC A;  3KJV A;  4E1N A;  3RRH A;  3MED A;  3RR7 A;  4H4O A;  3AO5 A;  3C6U A;  3LP1 A;  3SQ1 A;  4CJ3 A;  4F2S A;  3HVR A;  4FJ9 A;  3NCI A;  1ASW A;  4AHT A;  1WSH A;  4RW9 A;  5KGW A;  2G8U A;  4CES A;  3BDP A;  4C8K A;  1NK8 A;  3AO4 A;  2Z1G A;  3LWM A;  1X9S A;  4N5S A;  3V1O A;  2OA8 A;  2HHS A;  1HYV A;  1RDC A;  3P5J A;  1N5Y A;  1RDB A;  4E7I A;  3HJF A;  1UA1 A;  3SV4 A;  3KK2 A;  4NYF A;  2FC0 A;  2ZE2 A;  3AVM A;  4J2B A;  4CJP A;  4PUO A;  4CF0 A;  4LY7 A;  1RTI A;  1JLA A;  3LAM A;  4IBN A;  4UQG A;  2YHA A;  4E7J A;  4F3T A;  1KVC A;  1RIL A;  4B9M A;  1CZ9 A;  2E6L A;  4CGJ A;  4N56 A;  1LWC A;  2AJQ A;  1NJZ A;  1A5W A;  4FZY A;  1RNH A;  2O4G A;  3AVN A;  3NE6 A;  1L3V A;  5HLF A;  3L2U A;  3HYF A;  3DM2 A;  3OS0 A;  1HJR A;  1U45 A;  4B9S A;  3HO1 A;  3AO2 A;  2GUI A;  3H08 A;  3ASM A;  4FCY A;  1L3U A;  4CJQ A;  2ZD1 A;  3HPG A;  4W5Q A;  4ZHR A;  4BE0 A;  4F8R A;  2G8W A;  1WNS A;  3C95 A;  2D0B A;  1LWE A;  1SUQ A;  3CFR A;  2JLE A;  3QEW A;  1Q9X A;  1YT3 A;  2P5O A;  4DSK A;  1RTD A;  1JLQ A;  4LD0 A;  2Q3S A;  4HUE A;  4RW8 A;  1IH7 A;  1D9D A;  1CLQ A;  4B9N A;  4Z4H A;  3HL8 A;  2VWK A;  1JL1 A;  2B4J A;  2KTQ A;  3ZT2 A;  1RT6 A;  1CXQ A;  4O4G A;  3NH0 A;  4M3Y A;  4QOZ B;  4OJR A;  1QS4 A;  1UWB A;  3SUN A;  3ZT1 A;  2E6M A;  5EU7 A;  4FJK A;  1BQN A;  3IG1 A;  4BE2 A;  3V81 A;  4DSJ A;  1XC9 A;  3OS2 A;  4KHW A;  1RBU A;  4CE9 A;  1C0M A;  3V1R A;  2FBT A;  2Z1J A;  3KLG A;  1MU2 A;  2JGU A;  4FZX C;  2KFN A;  3O3H A;  1GOA A;  1BIS A;  3G10 A;  4KHN A;  1RDD A;  3QNO A;  4Z4E A;  4CF8 A;  3MXM A;  4B8C A;  4Q0B A;  1TAQ A;  1HRH A;  3LP3 A;  1BIU A;  1RT2 A;  5HRN A;  3KD1 E;  3L2V A;  4NCB A;  3NF8 A;  4CFC A;  1TAU A;  1KLM A;  3QER A;  3SYZ A;  1HNV A;  3KLH A;  4DS4 A;  2OPS A;  3TI0 A;  3OYE A;  3CFO A;  1RT5 A;  1TL3 A;  4CJE A;  4CK3 A;  4CIF A;  2HHU A;  3I8D A;  2HHV A; 
#chains in the Genus database with same CATH topology
 1TKZ A;  4YFU A;  3CIP A;  2YNH A;  3L0Q A;  5SWM A;  1NOZ A;  1IKV A;  4KRE A;  4DF4 A;  1B9F A;  3U8X A;  2O8E B;  4KH5 A;  2ZQB A;  5CHI A;  4KH4 A;  2UYT A;  4GKK K;  5CE3 A;  2FXU A;  1BOT O;  3AAQ A;  3THY B;  4JKH A;  4CJV A;  3F73 A;  4EZ9 A;  1BA0 A;  5M1F A;  5ADX H;  3DRR A;  2V7Y A;  4EAH D;  3E66 A;  4FJI A;  1FKP A;  1QZ5 A;  2KFZ A;  4RW4 A;  1D4X A;  4W5R A;  4FL9 A;  1NU0 A;  2NRW A;  3CQY A;  3VTI A;  3OBW A;  2KLA A;  1K6Y A;  2P9N A;  3WEE A;  4CK1 A;  2QM1 A;  3F9M A;  4DG1 A;  3PX6 A;  4PA1 A;  3CPW M;  1U4B A;  3NFA A;  2OTJ N;  5E26 A;  2D0P A;  2P9U A;  3ZX2 A;  2VWB A;  4DQI A;  1EX4 A;  4FJ8 A;  4OGC A;  5D3G A;  2IGI A;  1YUW A;  4FWM A;  2OPQ A;  1JKH A;  4KBO A;  2D5R A;  4JI1 K;  2A1R A;  2IC3 A;  5J2N A;  2E2Q A;  1HNW K;  3DRS A;  4K8Z A;  3PLA A;  1J9A A;  3EKU A;  3LM2 A;  1HQU A;  4NXM K;  2PAV A;  4F9O A;  1WB9 A;  4LF4 K;  3OYL A;  5BPN A;  3AA3 A;  4Q5V A;  3KK7 A;  4BWJ A;  2HHQ A;  1IBM K;  5AQL A;  3VOV A;  5BN9 A;  2NNW A;  3OYH A;  1TVR A;  4WQ5 C;  5EOY A;  2YX6 A;  3OVN A;  3K5L A;  4KKO A;  3CHW A;  4FPA A;  3L3U A;  3SI6 A;  5DM6 L;  4JKE A;  2FSN A;  4FXD A;  4BY9 C;  2O8F A;  4I2P A;  3C65 A;  4XH5 A;  3L2R A;  1KQS M;  2PZS A;  1U48 A;  4DR1 K;  3AVI A;  4H0X B;  1S22 A;  5BR8 K;  4H4M A;  4BRH A;  3RRG A;  4KPY A;  3L4I A;  3QO9 A;  1N34 K;  4QS9 A;  3H6E A;  1DGK N;  1IG9 A;  5FPE A;  3DWL A;  2F8S A;  4DLE A;  4H0O A;  1D9F A;  1ZBF A;  3DRP A;  4JYA K;  4ILG B;  2VQE K;  4BQL A;  2KZZ A;  4NO7 A;  2HF4 A;  1KTQ A;  2X78 A;  3SUP A;  1YXQ A;  4E0D A;  4LF6 K;  1IKX A;  1ZBS A;  4WE1 A;  1NMN A;  1NLV A;  3SLC A;  3ZSR A;  3TAR A;  2VGM A;  3ZT0 A;  5BPL A;  5F2R A;  3THW A;  3PX0 A;  4LH5 A;  3ZEU B;  3LP0 A;  4B1Z A;  4HTL A;  3KIO A;  3ZCM A;  1S3X A;  3IKM A;  4GV3 A;  2GEM A;  4CZM A;  2Q1N A;  5LY3 A;  5AQY A;  3HM9 A;  1JCG A;  3V9Z A;  1X9W A;  3K0S A;  3VQD A;  3J8A A;  1NGB A;  4BRI A;  4X64 K;  4JV5 K;  3ZSQ A;  1UOC A;  3ZET A;  3WXK A;  1RFQ A;  3ZYY X;  1GLL O;  4O8K A;  1M90 O;  4HVJ A;  4G9Z A;  3VN5 A;  2GTD A;  3CFP A;  2PYL A;  2W42 A;  4FWK A;  1BWF O;  1HNI A;  3AVB A;  3QIP A;  4Y1D A;  1GLC G;  2YNI A;  4EHT A;  2HOE A;  2R7Y A;  1I39 A;  1NGF A;  1GLB G;  2F7T A;  1KFD A;  4CGG A;  4GV6 A;  5K14 A;  2CGK A;  2W40 A;  4FM2 A;  5GIO A;  2GUP A;  1XHX A;  4CF2 A;  2P9P A;  1X9M A;  3TSP A;  1IV0 A;  4JKA A;  2HNZ A;  4LFB K;  4MDA A;  3O9Q A;  4OX9 K;  1XNR K;  3ISN C;  1GOB A;  4O0I A;  3ZSV A;  1SL0 A;  2GEL A;  3O4N A;  3A5O C;  2BH1 A;  3NBP A;  4LSN A;  2GWJ A;  3KK3 A;  1Q7Y O;  4OPA A;  1E4F T;  4B9Q A;  3TAE A;  1C1C A;  4DR2 K;  3DLE A;  4MLE A;  3K5N A;  3FR0 A;  2ETJ A;  5C2F A;  4HHT A;  3HSC A;  1N32 K;  3DLH A;  3BF3 A;  3HM8 A;  1EQY A;  4PY5 A;  1C0F A;  4DR6 K;  2F8T A;  2RHK A;  3EE8 A;  3CCQ N;  3LAK A;  2UXC K;  2W6K A;  3ZX3 A;  5J1E A;  1SL1 A;  4IG3 A;  3LAN A;  2KQ2 A;  1L3T A;  5T7B A;  3HOS A;  3CET A;  2ASM A;  3ID6 A;  4NYN A;  3M8R A;  3GL1 A;  4O55 A;  5C12 A;  4CJT A;  3CCU N;  4FJ7 A;  1KRP A;  4DTR A;  4Z94 A;  2VG6 A;  4FOE A;  1W9H A;  3LZJ A;  2FLO A;  4FK4 A;  4DTN A;  4FPB A;  1S72 N;  2UUB K;  4KI4 A;  1VSE A;  3VA0 A;  1ASU A;  1HYS A;  1XUP O;  2HST A;  5JVH L;  1S5J A;  1RTH A;  4FJN A;  1BCO A;  3SBT A;  1HYZ A;  2Z1I A;  3C6H A;  1H1V A;  3V4I A;  3NHG A;  4R79 A;  2HW3 A;  4IKF A;  5C42 A;  3V1Q A;  5FLX O;  5JS1 A;  5C15 A;  5LL6 Z;  1OH6 A;  3LDQ A;  4DFK A;  5M1K A;  3T3F A;  1K73 O;  2WOM A;  1Z25 A;  2YJF A;  4CIE A;  2XHB A;  5AZJ B;  3LDL A;  3VA3 A;  2HMI A;  1C6V A;  1YI2 N;  3F5T A;  4IZ9 A;  3WNH A;  4C1N K;  3VEX A;  3DXK A;  4FWP A;  3P39 A;  5DK5 A;  3NAE A;  1U2V B;  3SPZ A;  4CZG A;  2B5J A;  5GIN A;  4O44 A;  3SMP A;  3OYD A;  1S1W A;  1ITG A;  2QWP A;  5FDL A;  1MWM A;  2ITM A;  4YY3 K;  3HRG A;  1E3M A;  4MDB A;  4PL7 A;  4C8L A;  1CZB A;  2FBX A;  5HOO A;  3C94 A;  4FWS A;  1FKO A;  2GBZ A;  5GAG P;  4BAC A;  4C23 A;  3MWP A;  2GWK A;  4WFB L;  4LF8 K;  4B9U A;  3K5M A;  1G99 A;  3RRH A;  3MED A;  3RR7 A;  2QI2 A;  3C6U A;  2O8D B;  5IT9 O;  1CZA N;  4CJ3 A;  4U7B A;  4DR5 K;  5ADX A;  4DV2 K;  1SQK A;  3EL2 A;  1NK8 A;  3AO4 A;  3LWM A;  4QS8 A;  3TTD A;  3V1O A;  5MLC Q;  1RDC A;  3P5J A;  1N5Y A;  3VEW A;  4FOI A;  1MWK A;  3CF5 L;  3KK2 A;  4NYF A;  2FC0 A;  2ZE2 A;  4DR7 K;  4CF0 A;  2E1Y A;  4LY7 A;  1U6Z A;  3EN9 A;  3O8M A;  2O8C B;  1EWR A;  1RIL A;  4B9M A;  4CGJ A;  1LWC A;  3CC2 N;  5AQT A;  3O6W A;  3AVN A;  3ENH A;  4B1U B;  1WBB A;  3DM2 A;  1OH5 A;  4B9S A;  3HO1 A;  1L3U A;  2ZD1 A;  4DV7 K;  4F8R A;  2YHW A;  1WNS A;  4FZX C;  2D0B A;  3GBT A;  3QEW A;  3CFR A;  1JLQ A;  4LD0 A;  3FZL A;  4LF5 K;  3UE5 A;  3N4P A;  1J5E K;  3ZT2 A;  4O4G A;  2HMP A;  3SUN A;  3TPQ A;  3OBY A;  4CVN E;  4ILH A;  1T6C A;  3ENO A;  5AQG A;  3IG1 A;  3OS2 A;  1C0M A;  1FJG K;  3V1R A;  2FBT A;  1BIS A;  3QNO A;  4CF8 A;  3MXM A;  2Q36 A;  1YJN N;  1XC3 A;  4Q0B A;  2P9S B;  3J7Y P;  4IOC L;  4BR2 A;  4NCB A;  3KZB A;  1KLM A;  4B3T K;  4DS4 A;  2OPS A;  1RT5 A;  1TL3 A;  4GVE A;  3HZ6 A;  5TKY A;  3M1F A;  3EE9 A;  2HHV A;  4DV3 K;  3VQA A;  4EIA A;  1EP4 A;  5A2Q O;  4JK7 A;  1K9M O;  4DLG A;  3P38 A;  1VAZ A;  1X3M A;  4DQR A;  1GLA G;  2ZJP L;  4PHT X;  5AQX A;  2A40 A;  2KKZ A;  2FBY A;  3THX A;  3QFU A;  4JHD A;  4Y0W A;  4FO0 A;  5EY4 A;  4E1M A;  4A5A A;  1NNE A;  1ZC6 A;  3C7N B;  5AR0 A;  4LFA K;  2HHH K;  3HST B;  1MA9 B;  3HVT A;  1HKG A;  2KW4 A;  3DMJ A;  3I0S A;  1VQ9 N;  2EHG A;  3RVC A;  1UA0 A;  1NK6 A;  1DTT A;  2OTL N;  3A5M C;  4QCL A;  1BHL A;  1VSJ A;  3TSQ A;  3P1G A;  4BRN A;  5JLH A;  2QXF A;  1HQE A;  1VSK A;  2A5X A;  5C25 A;  1VK0 A;  3AAR A;  4CEE A;  5E41 A;  3TAF A;  4DKW A;  2P9I A;  3WQU A;  4CBX A;  5JVG L;  3LPT A;  2E88 A;  4O0J A;  4B9T A;  4E7K A;  3GE1 A;  3KD5 E;  2NRH A;  3L2Q A;  1QQM A;  5FPN A;  1EET A;  1YTU A;  1WSE A;  1GLD G;  2P9L A;  4CFD A;  2P9N B;  3VET A;  3CJC A;  3CM5 A;  2P5G A;  2ZJR L;  4JI7 K;  3I33 A;  2QWQ A;  4FJX A;  5AQP A;  2IOC A;  3QDK A;  3PO4 A;  4M41 A;  1UAX A;  2FBV A;  4BWM A;  3PSI A;  1HX1 A;  1NGG A;  4DV4 K;  1Y97 A;  1YAG A;  1JLC A;  3I56 N;  4RW7 A;  2ZF5 O;  1VQ8 N;  1T44 A;  3TAN A;  4FWO A;  4AHC A;  1X1P A;  4BQZ A;  3SQ4 A;  4CF1 A;  3N4Q A;  1NBW A;  4CJW A;  4M7Y A;  3OYM A;  3DJC A;  3GOI A;  3VEV A;  5BRE A;  1R0A A;  4GV9 A;  1U04 A;  4DFM A;  4FLT A;  3NMU A;  3ID8 A;  4YOR A;  1EXQ A;  2WUS A;  4C8N A;  5DM7 L;  4IOA L;  1BCM A;  4A62 A;  1JLB A;  2CH5 A;  5LJW A;  4DUZ K;  1LAV A;  4CJF A;  4GW6 A;  3OJS A;  2QKK A;  2QK9 A;  1RT3 A;  3OYK A;  3DI6 A;  3T1A A;  4XH1 A;  1OH8 A;  1BI4 A;  1Q18 A;  1S6P A;  3MAQ A;  3QB0 A;  3ENB A;  3K9J A;  1Z26 A;  3VQ9 A;  4FJH A;  3DLR A;  4PKH A;  2NRV A;  4AF1 A;  3O4Q A;  4CJR A;  3C6T A;  4CF9 A;  1BL3 A;  4WCE L;  3KLE A;  2BAN A;  1RCH A;  1ASV A;  4MO5 A;  2V51 B;  3KKR A;  4FW1 A;  4CJ4 A;  5AQO A;  3JAM O;  4O8U A;  3KWI A;  1KVA A;  4M7X A;  1NGJ A;  5HBM A;  3NF7 A;  4H5T A;  3MXJ A;  4JI5 K;  2BGG A;  4HCB A;  4CJK A;  4M3Z A;  5HRP A;  4CHN A;  1YIJ N;  4IDK A;  5AQF A;  4NLC A;  3BEX A;  4H5R A;  1ESV A;  4H5N A;  4FJG A;  3O9R A;  4FSV A;  2HBJ A;  2Z1H A;  4Z4I A;  4PQU A;  4C8M A;  4CFB A;  4DU4 A;  3QEX A;  5BR9 A;  1ZBL A;  2QXL A;  4KI6 A;  4PWD A;  4CHY A;  1RT7 A;  3VF6 A;  4E7H A;  1WSJ A;  1W0H A;  4IOX A;  3AVF A;  3QES A;  4KTW A;  1NJY A;  3AA2 A;  2HHT A;  3SPY A;  4BR5 A;  1TK8 A;  4CGD A;  4AHS A;  1VSF A;  2RPI A;  3EY1 A;  1QTM A;  2G8I A;  3SCX A;  2QEX N;  1K8K A;  1XQS C;  3IAY A;  1S1V A;  3M6G A;  3ZET B;  4W5O A;  4M3R A;  2XY6 A;  3WXJ A;  3OA9 A;  4O5B A;  1HNZ K;  5I3U A;  3ALY A;  3SZ2 A;  3IMX A;  5HL7 L;  2CGL A;  4L3Q A;  1SV5 A;  3O3G A;  3SNN A;  3QIN A;  4H8K A;  4K8X A;  1S9E A;  3HPH A;  4I2Q A;  4EP4 A;  4KHY A;  3M3Z A;  4KHQ A;  4BR7 A;  1D8Y A;  1VQN N;  4QS7 A;  3CCM N;  1VSH A;  4B08 A;  3M8S A;  5J2Q A;  4FW2 A;  2Q2R A;  1VQ7 N;  1NK9 A;  4IFE A;  3O9U A;  3D2E B;  4N76 A;  4JKG B;  4E3S A;  4DTO A;  2A41 A;  2CGJ A;  3LDP A;  4EZ6 A;  1NMD A;  2HNY A;  1T6D A;  1T03 A;  1ZBH A;  5AQS A;  4KTQ A;  1KLN A;  3K57 A;  3FZH A;  3ULE B;  3PX4 A;  1SKS A;  3WXI A;  1NGH A;  2W41 A;  3NVK A;  4FYD A;  3MEE A;  1YHQ N;  2QWN A;  3C0B A;  3VQE A;  1KFS A;  4JI0 K;  4ICL A;  4BG9 A;  3MEC A;  2WC9 A;  3AA5 X;  2WBN A;  1NKE A;  3U6F A;  2FF6 A;  2ATQ A;  2HBM A;  5KPT A;  2FSJ A;  3G4S N;  3S41 A;  3VF4 A;  3T69 A;  4G1Q A;  3NDK A;  3E01 A;  1NM1 A;  3BF1 A;  2O8E A;  4Z0U A;  1TYQ A;  3AVK A;  5JLF A;  4YOX A;  4A2B A;  3QBX A;  2JWL A;  4M3X A;  1DT9 A;  3H3N O;  4BDZ A;  2UXB K;  4JI6 K;  1YVN A;  3O1B A;  1TKX A;  3VER A;  1KVB A;  3IRX A;  3FFI A;  2QWM A;  4DTM A;  3J81 O;  2E2P A;  3OYB A;  3V9W A;  2ZWH A;  4DV6 K;  5M1O A;  4NXN K;  4AHV A;  5J2M A;  4JI2 K;  4JI3 K;  4FLV A;  5KI6 A;  2Q0U A;  5CR4 A;  1Q86 O;  1VHX A;  1DTQ A;  4DU3 A;  4K43 A;  3RMB A;  2HVI A;  3CQ8 A;  4C8O A;  4CEF A;  3CCV N;  1NGE A;  3ZSX A;  4X62 K;  4K42 A;  1KSP A;  4I7F A;  5AQM A;  1VSI A;  3I55 N;  1BO5 O;  3DXK B;  1QSY A;  4KB0 A;  1NK5 A;  1XMQ K;  3T19 A;  2A42 A;  2XY7 A;  1RGI A;  3V9U A;  3E9L A;  4H0Y B;  4CGI A;  2A1S A;  1J6Z A;  1VQ5 N;  2P1J A;  2X6N A;  1BGX T;  2NRX A;  4CEC A;  4FWN A;  1KC8 O;  3KJV A;  3D7E O;  3LP1 A;  4F2S A;  2HBK A;  3NCI A;  1ASW A;  5KGW A;  2ASO A;  2Z1G A;  3K9K A;  4N5S A;  3E9O A;  5AQZ A;  3HJF A;  5AQH A;  4J2B A;  3RSE B;  2UXD K;  1VQL N;  1JLA A;  3LAM A;  4IBN A;  4WF9 L;  4N56 A;  2VGN A;  3P4I A;  4FZY A;  4BRA A;  5AQR A;  3CXC M;  3OW2 M;  3UB5 A;  1IBL K;  4NLB A;  2GUI A;  3H08 A;  3ASM A;  4JKD A;  4XH4 A;  1WOQ A;  2V7Z A;  4W5Q A;  4ZHR A;  2G8W A;  3F2K A;  2P5O A;  1LWE A;  2GX9 A;  3EKS A;  2JLE A;  4BR9 A;  1YT3 A;  1W97 L;  2Q3S A;  4KH6 A;  5AQU A;  1EWQ A;  2FSK A;  1IG8 A;  1IH7 A;  3O1W A;  4IWV A;  4B9N A;  5H1S Q;  5KQD A;  2KTQ A;  1GLJ O;  1ZXO A;  4M3Y A;  1QS4 A;  2HF3 A;  1ATN A;  4DCH A;  1NGD A;  1RBU A;  1N36 K;  2JGU A;  3O3H A;  2IVP A;  3G10 A;  4Z4E A;  5LMN K;  1NGI A;  1HRH A;  2VYP A;  3LP3 A;  1HUX A;  1BIU A;  3KD1 E;  3NF8 A;  3KLH A;  3TI0 A;  4CK3 A;  2EX3 A;  1JLF A;  3MDQ A;  5FRM A;  3WNF A;  1HR0 K;  1RBR A;  3IUC A;  1ZBI A;  4I9L A;  3LP2 A;  2QA4 N;  4KFB A;  1O1W A;  1J5O A;  1DLO A;  1BDG A;  4HWI A;  2VCP A;  3PIP L;  3WNE A;  1ZYQ A;  3QIO A;  4M63 C;  3L2W A;  4I6M A;  2YHX A;  4GY2 B;  3LDN A;  4MLH A;  4YHH K;  1WLJ A;  1VSL A;  3ITH A;  4YDU C;  4DSE A;  4L8R B;  4GMJ B;  1S1X A;  3FFK B;  2YKM A;  3VQ5 A;  4H0P A;  4GKJ K;  2OAN A;  5AJ3 K;  3VQQ A;  1HJO A;  2RE2 A;  1ATS A;  1XNQ K;  1Q9Y A;  4ID1 A;  2HB5 A;  1HNX K;  3ZT4 A;  2RF2 A;  1L3S A;  2HHX A;  4CEO A;  3TWH A;  1GLF O;  3MX5 A;  3OTO K;  4Z4F A;  5TKW A;  4DTX A;  3K5O A;  3RMC A;  2EWS A;  2F96 A;  1T7P A;  3TAB A;  1S1U A;  5C10 A;  2WFB A;  4IFV A;  5EXW A;  4AIL C;  5AZI B;  3DLB A;  3U3Y A;  3ZSW A;  5HRO A;  4FM1 A;  3MWT A;  1R59 O;  1JCF A;  4KTZ A;  3SMS A;  4KHU A;  1CXU A;  5BN8 A;  2B6A A;  3CG7 A;  2P9I B;  3CCS N;  2J4R A;  1ILY A;  3BUZ B;  3D2F B;  4CHZ A;  3CCJ N;  3CQX A;  4A59 A;  3MK6 A;  4E7L A;  5EVZ A;  4WFA L;  2W6L A;  3DXM A;  1M1K O;  1WAJ A;  3SV3 A;  4JD2 B;  3VEN A;  2Y1J A;  4CER A;  1GLE G;  3HK2 A;  4CZJ A;  3IFR A;  1IJJ A;  4A61 A;  4JEP A;  4HUF A;  4DF8 A;  1IO2 A;  1F21 A;  4OLB A;  4A2A A;  3PV8 A;  4CGH A;  2PFU A;  5AQV A;  2X6S A;  1GOC A;  5AQN A;  1XWL A;  1QVG M;  2A6A A;  3MEG A;  4BRP A;  3DYA A;  4LC9 B;  4K41 A;  4MFB A;  2RN2 A;  4DWI A;  3LM9 A;  5AQW A;  4CK2 A;  2YKN A;  4FM0 A;  2HBL A;  4B3M K;  5F1X A;  4WQ4 A;  5J2P A;  1W7A A;  1Q8I A;  4OGE A;  3PY8 A;  1HKC A;  2O8B B;  3KTQ A;  3FZK A;  3JSM A;  3NVM A;  4BC3 A;  1J54 A;  4J2E A;  4KHS A;  3THV A;  4DTU A;  4OKK A;  5FPM A;  4B1Y B;  3OS1 A;  4W5N A;  1N33 K;  2WTU A;  5AZJ A;  5KRS A;  1B92 A;  2YNG A;  4CEQ A;  4BGA A;  1YJ9 N;  2P9K A;  3VPZ A;  1TKD A;  3CCE N;  1NJI O;  2XY5 A;  4BRD A;  4DB3 A;  3SJJ A;  4DV5 K;  4AH9 A;  3QEV A;  4DS5 A;  2F9W A;  4YNQ A;  2LSN A;  1MDU B;  4NB4 A;  1C0T A;  5LJV A;  4RWT A;  4CD1 A;  3AY9 A;  2IVO A;  3VEZ A;  4BRK A;  2I5J A;  5DMR A;  4DR4 K;  5E84 A;  1WUA A;  2NRZ A;  4JI8 K;  3LZI A;  2BDP A;  2G8F A;  1REV A;  4BRO A;  1N6Q A;  4I9Q A;  1S6Q A;  3KK1 A;  1FW6 A;  1HLU A;  2HND A;  4FWR A;  4BRM A;  4N47 A;  4JAX A;  3HBT A;  1I3A A;  4M3T A;  3OYF A;  1TK0 A;  3HOT A;  1W2B M;  4OKE A;  1OH7 A;  2G8H A;  1YVU A;  1TK5 A;  3P31 A;  1RDW X;  4JNE A;  3R6M A;  5JS2 A;  3MN5 A;  3E9P A;  4FLU A;  3RTV A;  4LH4 A;  4CJU A;  5GIP A;  4E1J A;  3VQ6 A;  4DUY K;  3OYN A;  4BRG A;  2O8D A;  1NGC A;  2I7N A;  3I0R A;  2HHW A;  3HT3 A;  1P8Z A;  3AVG A;  1TKT A;  4FLZ A;  4ISE A;  3WEE B;  3EZ5 A;  3LDS A;  3WXL A;  1VRT A;  3OY9 A;  4H5V A;  4J2A A;  3OJU A;  1SL2 A;  3SUQ A;  1T05 A;  2P9U B;  3GDQ A;  1KCF A;  4B3S K;  3AVL A;  3H46 O;  1K8K B;  3EYZ A;  1U47 A;  4FVM A;  2CH6 A;  1EKE A;  4BC5 A;  4JLH A;  2O8C A;  4DTP A;  4DQS A;  1XHZ A;  1NK0 A;  1HPZ A;  3V9X A;  1Y64 A;  4IG0 A;  3L3V A;  3QLH A;  1BG3 A;  5HRS A;  3TAG A;  2OZS A;  3EEQ A;  3ATV A;  4HUG A;  5ELZ A;  2G8K A;  2BE2 A;  3QNN A;  4PKG A;  2XRI A;  3C6A A;  3O08 A;  4ELU A;  3HTV A;  3L8B A;  3ULD A;  3J7Z O;  5KQ8 A;  2D0C A;  1B9D A;  2DY4 A;  2A3Z A;  3A2F A;  2XO7 A;  3UKU A;  3DLK A;  4HCC A;  2X74 A;  4DFP A;  4JS5 A;  3NH2 A;  2O8F B;  4OVL A;  1WSI A;  1BA1 A;  4BRL A;  4BRE A;  3SQ2 A;  2E5L K;  4IJA A;  1I94 K;  4FZZ A;  2P9S A;  2FF3 B;  5AQQ A;  4DQ8 A;  1NK7 A;  1X9J A;  2ITG A;  1Z6R A;  4FLW A;  4FLY A;  3MCP A;  3J80 O;  3VQ7 A;  1RDU A;  4CEZ A;  4JKC A;  5KTQ A;  3HXM A;  4JI4 K;  3J7A P;  1T3V A;  4RCH A;  3LPU A;  4JRQ A;  3KLF A;  4CFA A;  4ELV A;  2VWJ A;  3QFP A;  3VGK A;  4CHP A;  1OVY A;  2PY5 A;  5KPZ A;  1FK9 A;  4BRQ A;  4DTJ A;  2UUA K;  3C7N A;  3H1V X;  2E20 A;  1SKR A;  4CED A;  1C1B A;  4JRP A;  3S3M A;  3AVJ A;  5C24 A;  5FPD A;  1U49 A;  3WUH A;  3THW B;  1BUP A;  3TTF A;  2NUB A;  1TYQ B;  2ASP A;  1LAW A;  3A5N C;  2QKB A;  3TAM A;  4BG8 A;  1NWK A;  3VMF B;  3Q7B A;  5BRF A;  3OYC A;  1JLG A;  1HMV A;  3NF9 A;  3B6O A;  3NF6 A;  1VQ6 N;  4KV8 A;  2RKI A;  1P90 A;  4DV0 K;  4OPK A;  3A5L C;  4KO0 A;  5IWA K;  3OYI A;  3LAL A;  3G6E N;  3IDH A;  1JXB A;  3QML A;  5GAH P;  3CJ1 A;  2D0A A;  5AQK A;  4JK8 A;  2VG5 A;  1A5X A;  2UU9 K;  4DFJ A;  3UKR A;  1WSF A;  3IS9 A;  3AA4 A;  1G15 A;  2E4L A;  2YJE A;  3T1Y K;  2IS3 A;  1VQK N;  4GNI A;  1LWF A;  2DFE A;  4CJS A;  3UIQ A;  2O4I A;  1X3N A;  2D1K A;  2P9P B;  2OCE A;  2Q97 A;  3AO5 A;  3U9Z A;  3HVR A;  3VGL A;  4LF7 K;  1WSH A;  4K0K K;  4RW9 A;  4CES A;  4C8K A;  5M1N A;  1X9S A;  2OA8 A;  5AQJ A;  3CJ7 A;  4E7I A;  1UA1 A;  3SV4 A;  3WT0 A;  4RTF D;  4CJP A;  4WQ5 A;  5I9E B;  4UQG A;  2YHA A;  2D4W A;  3WXM B;  2E6L A;  2E2O A;  3O4W A;  1NJZ A;  1A5W A;  3MN7 A;  3CJB A;  3E1Y A;  1BU6 O;  2O4G A;  3NE6 A;  1L3V A;  5HLF A;  3L2U A;  3HYF A;  3OS0 A;  4BVP A;  1HJR A;  1U45 A;  3AO2 A;  4CI6 A;  4FCY A;  4CJQ A;  3FLC O;  4H03 B;  1JJ2 M;  4DSK A;  1TUU A;  1RTD A;  1Z05 A;  1VQ4 N;  3FZM A;  1D9D A;  1CLQ A;  4Z4H A;  5EX5 A;  3FE1 A;  3OHR A;  2ZJQ L;  4OJR A;  1UWB A;  2V52 B;  5EU7 A;  3V81 A;  3AAP A;  4DSJ A;  5AQI A;  4KHW A;  2JWK A;  3MX2 A;  4KHN A;  1RDD A;  2NZT A;  5LMU K;  4IEE A;  3VGM A;  1DEJ A;  5HRN A;  3LL3 A;  4CFC A;  1TAU A;  4LF9 K;  3SYZ A;  3OYE A;  3CFO A;  2ZGZ A;  5B8H A;  3THY A;  4CIF A;  2HHU A;  1SAZ A;  3I8D A;  3AO3 A;  3VF2 A;  3R9P A;  3G71 N;  1NJX A;  5GAE P;  3HPO A;  2QWO A;  3R1X A;  4K25 A;  3PSF A;  2D0O A;  3W3D A;  3AVC A;  2YHY A;  2YHB A;  3O80 A;  4J8F A;  3HI0 A;  1IKW A;  1C1A A;  1SKW A;  3U4L A;  4BDY A;  2YV0 X;  3CMA N;  2G8V A;  1XI1 A;  2QW9 A;  3ZSZ A;  5M1Q A;  4Y1C A;  3P83 D;  3TTC A;  4EP5 A;  4EFH A;  4CCH A;  3TAQ A;  1JL2 A;  2IAJ A;  3VEO A;  4B8A B;  4LSL A;  3VES A;  2KZM A;  2DPN A;  3S3O A;  4GVM A;  4I6M B;  4IJN A;  4AM6 A;  1TUY A;  3AO1 A;  4E19 A;  1RBS A;  4IXC A;  3S9H A;  4F2R A;  2E2N A;  1JXE A;  1OVQ A;  5C0Y A;  5AFU A;  3K59 A;  4CZI A;  1QE1 A;  3S3N A;  3HP9 A;  5CY4 A;  3CPE A;  3DOL A;  3MXI A;  3ZT3 A;  4UY8 O;  5CYQ A;  3L6Q A;  5M1P A;  3ZLJ A;  1HKB A;  4CZL A;  2Q0R A;  3MCA B;  2H3G X;  4DSL A;  3MN6 A;  4B3R K;  1J53 A;  3D2E A;  4BRC A;  4JKG A;  3VQB A;  4BGB A;  3VTH A;  4B9V A;  3D0P A;  2YCH A;  1TV6 A;  1SS6 A;  3M8Q A;  1QQO A;  3JYT A;  3LWL A;  4O5F A;  2KHO A;  4M42 A;  1LOT B;  4RG8 A;  4ZTJ A;  4BR4 A;  3DLG A;  3KWG A;  1BQM A;  4IEI A;  4CZH A;  3ULE A;  3OYJ A;  1S1T A;  3LDO A;  4NCG A;  3CI5 A;  3DXM B;  2Y1I A;  3TAP A;  4MQ3 A;  4IO8 A;  4ISG A;  4RW6 A;  4CJ5 A;  5I42 A;  1JLE A;  4H5W A;  5F0X A;  5CZ1 A;  3B8A X;  3V6D A;  1FXX A;  4YOY A;  4J2D A;  4DR3 K;  4ZTF A;  1VQP N;  3NH1 A;  3O3F A;  5KGX A;  1NOY A;  3AGK A;  1N8R O;  3ZEU A;  4NCA A;  2QTD A;  3WQT A;  3I8B A;  3RMA A;  4C1N I;  2IIR A;  3OYA A;  3QEP A;  3CYM A;  5CZ2 A;  3B6P A;  5FRN A;  2ZM6 K;  3U9D A;  4CEB A;  3D6R A;  4QAG A;  3NGY A;  3MN9 A;  4B1X B;  4E89 A;  1LW2 A;  4AM7 A;  2VQF K;  3DOK A;  1VSM A;  4N41 A;  4B9L A;  4YOT A;  4CBW A;  3CM6 A;  1V4T A;  3G25 A;  3CC4 N;  2IDO A;  1LW0 A;  2QWR A;  3SAG A;  1RBV A;  1T8E A;  2PYJ A;  4BE1 A;  3EO3 A;  1QSL A;  2NRT A;  3BGR A;  1QQC A;  2OPR A;  4BDP A;  3PO5 A;  4KAZ A;  1C0U A;  4JS4 A;  1OKJ A;  2YNF A;  1RTJ A;  4TSX A;  4YOW A;  4Z4G A;  4CHO A;  2AP1 A;  2OZM A;  2DTU A;  2P9K B;  4FK0 A;  4DSI A;  4OO1 J;  4DTS A;  1WSG A;  3O5B A;  3SK3 A;  3QET A;  2E8A A;  4DU1 A;  4YDU A;  3THX B;  3FGU A;  4JHD B;  3CCL N;  4V19 S;  4CZE A;  1ZBU A;  3SQ0 A;  1RDA A;  4B1V A;  4BC4 A;  2OYQ A;  4CW7 B;  2ZGY A;  4ID5 A;  3NGZ A;  4OKJ A;  3K2P A;  1EO1 A;  3T1H K;  4CIG A;  3NGI A;  3AVH A;  4IO9 L;  3DLL L;  1RT4 A;  3ZSY A;  5CYM A;  5KPR A;  5KRT A;  1Q82 O;  1NKC A;  4JKF A;  4W5T A;  1SZ2 A;  2PBD A;  1WBD A;  1IKY A;  4CD3 A;  1WAF A;  3VQ8 A;  3K58 A;  4B1W B;  3CJA A;  4OPH A;  4CJ7 A;  3RSE A;  3D45 A;  1YJW N;  5FRO A;  4MO4 A;  4CZF A;  4KHP K;  3AVA A;  2XY8 A;  1YTA A;  4JK9 A;  3VQ4 A;  4H0V B;  1C0G A;  2NRR A;  3SUO A;  4KRF A;  2IVN A;  1QVF M;  3CC7 N;  2P9L B;  2BTF A;  3KKS A;  4PKI A;  4ISF A;  1NK4 A;  3OYG A;  3KLI A;  4AHU A;  1RT1 A;  2I7P A;  4HTU A;  1TGO A;  5HP1 A;  1XMO K;  1D5A A;  1VQM N;  2DFH A;  1A5V A;  3BP8 A;  3L4Q A;  4BVO A;  4OLA A;  1BIZ A;  1KXP A;  4IDH A;  3QEI A;  1JCE A;  5C2D A;  4CEA A;  1KAX A;  3FZF A;  3VQP A;  3F9K A;  3CME N;  3RMD A;  3GG4 A;  5HRR A;  3QIC A;  3WNG A;  1QHT A;  2NLX A;  3RR8 A;  2GV9 A;  1L5U A;  2F4V K;  4M3U A;  2WON A;  1NKB A;  3KVG A;  1YIT N;  1VRU A;  4ELT A;  4A5B A;  4FJM A;  2VG7 A;  3BY5 A;  3CJ9 A;  1RBT A;  3KHY A;  3RWU A;  3TR8 A;  4WQ4 C;  3TU5 A;  3PIO L;  2YI1 A;  1NGA A;  4F4K A;  3UKU B;  4B3O A;  3H1Q A;  4DQP A;  2F9T A;  4X66 K;  1IBK K;  3G0Z A;  4CGF A;  3HP6 A;  3BZC A;  5BRD A;  4LFC K;  4M45 A;  1BI4 B;  1NG9 A;  4JN4 A;  4WYB A;  1E4G T;  4XIU A;  1U2V A;  5AFU H;  3VEY A;  1TL1 A;  1WN7 A;  4R5P A;  4FWL A;  4DV1 K;  1HPM A;  4CHQ A;  4Z4C A;  5BRH A;  3BZK A;  3DAW A;  3Q7C A;  4U67 L;  4OPJ A;  3CCR N;  3AV9 A;  3M8P A;  5SZT A;  1KD1 O;  2DFF A;  4FLX A;  3V9S A;  3PUF A;  4FJJ A;  3CD6 N;  4F3O A;  1KAZ A;  4FJL A;  2Q31 A;  3QBW A;  1NJW A;  4CJL A;  4DSF A;  1S9G A;  3U3G A;  2HVH A;  3TSU A;  4AHR A;  3JS6 A;  4DMN A;  1LV5 A;  1QSS A;  4DQQ A;  2OPP A;  4A57 A;  3JXU A;  4M3W A;  1KAY A;  4FJ5 A;  5AZI A;  1VSD A;  4BRF A;  3SAH A;  1LCU A;  4IFY A;  3O9S A;  3H45 C;  1VQO N;  3ZSO A;  2P51 A;  4AQY K;  4FK2 A;  1K8A O;  5JMV A;  3A8Y A;  1QHA A;  3D2F A;  3VQC A;  4E1N A;  5BPM A;  4H4O A;  1YF5 L;  1ATR A;  4JD2 A;  3SQ1 A;  4FJ9 A;  2BUP A;  1Q81 O;  4JKB A;  4AHT A;  2G8U A;  3UKR B;  3ATU A;  3BDP A;  2HHS A;  1HYV A;  1QQN A;  3SBG A;  1RDB A;  1DKG D;  3T7Z A;  4YOV A;  4X65 K;  3AVM A;  4PUO A;  3ZX0 A;  4ILJ A;  3SAF A;  1RTI A;  4FWQ A;  3AGR A;  4YOU A;  4BR0 A;  4E7J A;  4F3T A;  1KVC A;  1CZ9 A;  2AJQ A;  1RNH A;  3R8E A;  2E1Z A;  5JIC A;  4DHY A;  4EHU A;  2QWL A;  3W0L A;  3HPG A;  4BE0 A;  3MMV A;  4PL8 A;  3C95 A;  3O9T A;  4KB1 A;  1SUQ A;  1Q9X A;  3SJH A;  2AA4 A;  4FVU A;  2UUC K;  2O8B A;  3A0I X;  4HUE A;  4RW8 A;  1QZ6 A;  3HL8 A;  2VWK A;  1JL1 A;  1O13 A;  2B4J A;  3NH0 A;  1RT6 A;  1CXQ A;  4BC2 A;  4QOZ B;  3ZT1 A;  2E6M A;  4CBU A;  4FJK A;  1BQN A;  4BE2 A;  3H3O B;  4WFN L;  1XC9 A;  4CE9 A;  2Z1J A;  3KLG A;  1MU2 A;  2KFN A;  1GOA A;  4CZK A;  3EZW A;  3CER A;  4XEI A;  4B8C A;  1TAQ A;  1V4S A;  3M5R A;  1RT2 A;  3L2V A;  5GAD P;  4H0T B;  3QER A;  1HNV A;  3R3L A;  4CJE A; 
#chains in the Genus database with same CATH homology
 2EX3 A;  1TKZ A;  1JLF A;  3AO3 A;  3VQA A;  4YFU A;  1NJX A;  2YNH A;  5FRM A;  3WNF A;  1EP4 A;  5SWM A;  1NOZ A;  1IKV A;  3HPO A;  4DLG A;  4KRE A;  1RBR A;  1ZBI A;  4DF4 A;  1B9F A;  4I9L A;  3LP2 A;  4DQR A;  4KFB A;  3AVC A;  2YHB A;  1O1W A;  1J5O A;  2ZQB A;  1DLO A;  1IKW A;  1C1A A;  2FBY A;  3WNE A;  4CGD A;  1ZYQ A;  3QIO A;  4E1M A;  1SKW A;  3L2W A;  4BDY A;  2YV0 X;  2G8V A;  1WLJ A;  1VSL A;  4CJV A;  3ITH A;  4DSE A;  1XI1 A;  3F73 A;  4EZ9 A;  3ZSZ A;  4L8R B;  4Y1C A;  3HST B;  4GMJ B;  3P83 D;  1S1X A;  3DRR A;  4EP5 A;  3HVT A;  2KW4 A;  3DMJ A;  3I0S A;  4FJI A;  2YKM A;  1FKP A;  3VQ5 A;  4CCH A;  2KFZ A;  4RW4 A;  2EHG A;  3VQQ A;  3TAQ A;  1JL2 A;  2IAJ A;  1UA0 A;  1NK6 A;  4W5R A;  4B8A B;  4ID1 A;  2HB5 A;  1Q9Y A;  1TK5 A;  1DTT A;  4LSL A;  3ZT4 A;  2RF2 A;  1L3S A;  2HHX A;  4CEO A;  3TWH A;  4QCL A;  1BHL A;  1VSJ A;  2KZM A;  1K6Y A;  3P1G A;  2QXF A;  4GVM A;  3S3O A;  4Z4F A;  1HQE A;  1VSK A;  4DTX A;  4CK1 A;  5C25 A;  4DG1 A;  1VK0 A;  3PX6 A;  3AO1 A;  3K5O A;  4PA1 A;  4CEE A;  5E41 A;  3RMC A;  3NFA A;  4E19 A;  3TAF A;  1U4B A;  1RBS A;  3S9H A;  4F2R A;  2F96 A;  1JXE A;  1T7P A;  4DQI A;  1EX4 A;  3LPT A;  3TAB A;  1S1U A;  4O0J A;  3K59 A;  4FJ8 A;  1QE1 A;  4OGC A;  3S3N A;  4B9T A;  5D3G A;  2IGI A;  4E7K A;  4IFV A;  3HP9 A;  5CY4 A;  3KD5 E;  3L2Q A;  4AIL C;  3DLB A;  3DOL A;  3MXI A;  3ZT3 A;  5CYQ A;  1EET A;  2OPQ A;  1JKH A;  1WSE A;  3U3Y A;  2D5R A;  1YTU A;  3ZSW A;  2A1R A;  5HRO A;  2IC3 A;  4CFD A;  4FM1 A;  5J2N A;  3CM5 A;  2P5G A;  4KTZ A;  3DRS A;  4DSL A;  4KHU A;  1CXU A;  4K8Z A;  2B6A A;  3CG7 A;  4FJX A;  1J9A A;  1HQU A;  1J53 A;  2IOC A;  3PO4 A;  3VQB A;  4M41 A;  1UAX A;  4CHZ A;  3OYL A;  4B9V A;  3D0P A;  3AA3 A;  4Q5V A;  4E7L A;  2FBV A;  4BWJ A;  1TV6 A;  4BWM A;  2HHQ A;  3OYH A;  3M8Q A;  1WAJ A;  3JYT A;  1TVR A;  3SV3 A;  2Y1J A;  3LWL A;  1Y97 A;  4M42 A;  3OVN A;  3K5L A;  1JLC A;  4KKO A;  4RW7 A;  3L3U A;  4CER A;  4RG8 A;  3SI6 A;  4ZTJ A;  3HK2 A;  3TAN A;  3DLG A;  4FXD A;  1BQM A;  4AHC A;  4I2P A;  4HUF A;  1X1P A;  4DF8 A;  1IO2 A;  3SQ4 A;  4CF1 A;  3L2R A;  1F21 A;  4CJW A;  3OYJ A;  1S1T A;  2PZS A;  4OLB A;  4NCG A;  3PV8 A;  1U48 A;  3OYM A;  2Y1I A;  4CGH A;  3TAP A;  4MQ3 A;  1R0A A;  3AVI A;  4RW6 A;  2X6S A;  1GOC A;  1U04 A;  4H4M A;  4FLT A;  1XWL A;  4DFM A;  3RRG A;  4KPY A;  4CJ5 A;  5I42 A;  1EXQ A;  4C8N A;  3MEG A;  1JLE A;  5CZ1 A;  1BCM A;  3QO9 A;  3DYA A;  1JLB A;  4MFB A;  2RN2 A;  3V6D A;  4DWI A;  1LAV A;  1FXX A;  4J2D A;  4CJF A;  1IG9 A;  4CK2 A;  4GW6 A;  2YKN A;  4FM0 A;  3OJS A;  4ZTF A;  2QKK A;  2F8S A;  2QK9 A;  3NH1 A;  1RT3 A;  4DLE A;  3OYK A;  3O3F A;  5J2P A;  5KGX A;  3DI6 A;  3T1A A;  1Q8I A;  1ZBF A;  3DRP A;  4OGE A;  1NOY A;  1D9F A;  3PY8 A;  2KZZ A;  3KTQ A;  4NCA A;  1BI4 A;  3JSM A;  1S6P A;  1J54 A;  4J2E A;  3RMA A;  3MAQ A;  4KHS A;  3THV A;  4DTU A;  4OKK A;  1KTQ A;  1Z26 A;  3OYA A;  3VQ9 A;  3OS1 A;  3DLR A;  2X78 A;  3CYM A;  5CZ2 A;  3SUP A;  3B6P A;  3QEP A;  4FJH A;  5FRN A;  4W5N A;  4E0D A;  4CEB A;  1IKX A;  4WE1 A;  3O4Q A;  3TAR A;  3ZSR A;  4CJR A;  3C6T A;  4QAG A;  1BL3 A;  3NGY A;  3ZT0 A;  4CF9 A;  3KLE A;  4E89 A;  2BAN A;  1LW2 A;  1RCH A;  5KRS A;  1B92 A;  2YNG A;  1ASV A;  1VSM A;  3DOK A;  4CEQ A;  4N41 A;  3KKR A;  4FW1 A;  4CJ4 A;  1TKD A;  3PX0 A;  4B9L A;  3CM6 A;  2XY5 A;  2IDO A;  4LH5 A;  3SJJ A;  1KVA A;  3LP0 A;  1LW0 A;  5HBM A;  3NF7 A;  2BGG A;  1RBV A;  3MXJ A;  1T8E A;  3KIO A;  3ZCM A;  4AH9 A;  2PYJ A;  4HCB A;  4CJK A;  3QEV A;  4BE1 A;  4DS5 A;  4YNQ A;  4M3Z A;  5HRP A;  1QSL A;  2LSN A;  3BGR A;  1QQC A;  4CHN A;  2OPR A;  4BDP A;  4IDK A;  3PO5 A;  3HM9 A;  1C0U A;  4KAZ A;  4JS4 A;  1C0T A;  2YNF A;  1RTJ A;  4TSX A;  3V9Z A;  1X9W A;  4FJG A;  4Z4G A;  4CHO A;  2Z1H A;  4Z4I A;  4PQU A;  4C8M A;  3VQD A;  4CFB A;  2OZM A;  2DTU A;  4DU4 A;  3QEX A;  4DSI A;  4FK0 A;  4DTS A;  2I5J A;  5DMR A;  1ZBL A;  1WSG A;  4KI6 A;  3ZSQ A;  3LZI A;  3QET A;  2BDP A;  4CHY A;  4DU1 A;  1RT7 A;  1UOC A;  4PWD A;  2G8F A;  1REV A;  4E7H A;  1WSJ A;  1W0H A;  1N6Q A;  4I9Q A;  1S6Q A;  3AVF A;  3KK1 A;  3QES A;  4KTW A;  1ZBU A;  2HND A;  4N47 A;  3SQ0 A;  1I3A A;  1NJY A;  1RDA A;  2OYQ A;  4M3T A;  3AA2 A;  3OYF A;  4HVJ A;  1TK0 A;  3VN5 A;  4OKE A;  2HHT A;  3CFP A;  3SPY A;  2G8H A;  2W42 A;  1TK8 A;  1HNI A;  1YVU A;  1VSF A;  3AVB A;  3QIP A;  4ID5 A;  4AHS A;  2RPI A;  4Y1D A;  2YNI A;  3NGZ A;  3EY1 A;  2R7Y A;  4OKJ A;  1I39 A;  3K2P A;  1QTM A;  5JS2 A;  1KFD A;  2G8I A;  3SCX A;  4CGG A;  5K14 A;  4FLU A;  3RTV A;  4LH4 A;  4FM2 A;  4CJU A;  4CIG A;  3NGI A;  3AVH A;  3VQ6 A;  3OYN A;  1XHX A;  1S1V A;  4CF2 A;  3IAY A;  1RT4 A;  3ZSY A;  5CYM A;  4W5O A;  4M3R A;  3I0R A;  1X9M A;  2HHW A;  3HT3 A;  5KRT A;  2XY6 A;  2HNZ A;  4O5B A;  3AVG A;  1TKT A;  4FLZ A;  3ALY A;  3SZ2 A;  3ISN C;  1GOB A;  3EZ5 A;  5I3U A;  4O0I A;  1NKC A;  3LDS A;  4W5T A;  3OY9 A;  1VRT A;  1IKY A;  4J2A A;  3ZSV A;  1WAF A;  1SV5 A;  3VQ8 A;  3O3G A;  3K58 A;  3OJU A;  1SL2 A;  3SNN A;  3QIN A;  4H8K A;  3SUQ A;  1T05 A;  1SL0 A;  3O4N A;  1KCF A;  3D45 A;  5FRO A;  4K8X A;  1S9E A;  3AVL A;  3EYZ A;  3HPH A;  3NBP A;  1U47 A;  3AVA A;  2PYL A;  2XY8 A;  4FVM A;  4LSN A;  3KK3 A;  4I2Q A;  1YTA A;  1EKE A;  3VQ4 A;  4EP4 A;  4KHY A;  4JLH A;  3TAE A;  1C1C A;  4DTP A;  4KHQ A;  4DQS A;  3SUO A;  1D8Y A;  4KRF A;  1XHZ A;  3DLE A;  1NK0 A;  1VSH A;  4B08 A;  3K5N A;  2ETJ A;  4HHT A;  1HPZ A;  3M8S A;  3V9X A;  3DLH A;  3KKS A;  4IG0 A;  4PY5 A;  3L3V A;  1NK4 A;  3QLH A;  4FW2 A;  3OYG A;  5J2Q A;  3KLI A;  4AHU A;  2F8T A;  1NK9 A;  1RT1 A;  4N76 A;  5HRS A;  4HTU A;  1TGO A;  3TAG A;  5HP1 A;  1D5A A;  2OZS A;  4HUG A;  4E3S A;  2G8K A;  3LAK A;  2DFH A;  4DTO A;  2BE2 A;  3QNN A;  2XRI A;  1A5V A;  4OLA A;  5J1E A;  1BIZ A;  4EZ6 A;  3QEI A;  4ELU A;  4CEA A;  3L8B A;  3VQP A;  3ULD A;  3F9K A;  1SL1 A;  4IG3 A;  2HNY A;  3LAN A;  2D0C A;  2KQ2 A;  1B9D A;  3RMD A;  5T7B A;  1L3T A;  2DY4 A;  1T03 A;  3A2F A;  5HRR A;  3WNG A;  1QHT A;  3DLK A;  2XO7 A;  3RR8 A;  4HCC A;  1ZBH A;  2X74 A;  4DFP A;  4NYN A;  4KTQ A;  2GV9 A;  1L5U A;  4JS5 A;  4M3U A;  1KLN A;  3NH2 A;  3M8R A;  2WON A;  1NKB A;  3K57 A;  1VRU A;  4ELT A;  4O55 A;  3PX4 A;  4OVL A;  1WSI A;  4FJM A;  2VG7 A;  4CJT A;  1SKS A;  3SQ2 A;  4FJ7 A;  1KRP A;  4DTR A;  1RBT A;  3MEE A;  4FYD A;  4FZZ A;  2VG6 A;  3VQE A;  1W9H A;  3LZJ A;  1KFS A;  3RWU A;  4ICL A;  3TR8 A;  4FK4 A;  3MEC A;  3RMB A;  4DTN A;  1NK7 A;  3AA5 X;  4F4K A;  2ITG A;  4KI4 A;  1NKE A;  4B3O A;  3U6F A;  1VSE A;  2ATQ A;  4FLW A;  3VA0 A;  4FLY A;  1ASU A;  4DQP A;  1HYS A;  4G1Q A;  1S5J A;  3G0Z A;  3VQ7 A;  4CGF A;  3E01 A;  3NDK A;  4CEZ A;  1RTH A;  4FJN A;  3HP6 A;  1BCO A;  5KTQ A;  3HXM A;  1HYZ A;  2Z1I A;  4Z0U A;  4M45 A;  3AVK A;  3LPU A;  3V4I A;  4JRQ A;  3KLF A;  1BI4 B;  4CFA A;  3NHG A;  2HW3 A;  4ELV A;  4M3X A;  2VWJ A;  4IKF A;  5C42 A;  3V1Q A;  4CHP A;  4BDZ A;  2PY5 A;  5JS1 A;  4XIU A;  1TKX A;  1TL1 A;  1FK9 A;  1KVB A;  1WN7 A;  4R5P A;  4KB1 A;  4DTJ A;  1SKR A;  3IRX A;  4DFK A;  4CED A;  1C1B A;  4CHQ A;  4Z4C A;  3T3F A;  2WOM A;  1Z25 A;  3FFI A;  4CIE A;  3AVJ A;  2XHB A;  4JRP A;  4DTM A;  3S3M A;  5C24 A;  3VA3 A;  3OYB A;  2HMI A;  3V9W A;  1U49 A;  1C6V A;  2NUB A;  1LAW A;  4AHV A;  3WNH A;  4OPJ A;  3AV9 A;  3M8P A;  5SZT A;  5J2M A;  2QKB A;  3TAM A;  4FLV A;  5DK5 A;  5KI6 A;  2DFF A;  3NAE A;  4FLX A;  3V9S A;  3SPZ A;  3PUF A;  3OYC A;  1JLG A;  4FJJ A;  4F3O A;  4FJL A;  1DTQ A;  2B5J A;  1NJW A;  4CJL A;  1HMV A;  1S9G A;  4O44 A;  3NF9 A;  3U3G A;  4DSF A;  3OYD A;  3CQ8 A;  3B6O A;  3NF6 A;  4DU3 A;  2HVH A;  2HVI A;  4KV8 A;  2RKI A;  4AHR A;  4C8O A;  4CEF A;  4OPK A;  1S1W A;  1ITG A;  5FDL A;  4DMN A;  1LV5 A;  1QSS A;  4DQQ A;  4KO0 A;  2OPP A;  3ZSX A;  3LAL A;  3OYI A;  1JXB A;  1KSP A;  4I7F A;  4M3W A;  1VSI A;  2D0A A;  4FJ5 A;  1VSD A;  4C8L A;  1CZB A;  1QSY A;  4KB0 A;  1NK5 A;  2FBX A;  2VG5 A;  1A5X A;  3T19 A;  4IFY A;  4DFJ A;  1WSF A;  3C94 A;  2XY7 A;  3IS9 A;  3V9U A;  3AA4 A;  1FKO A;  1G15 A;  2E4L A;  2GBZ A;  4CGI A;  2A1S A;  4BAC A;  3ZSO A;  2P51 A;  4FK2 A;  2IS3 A;  2P1J A;  4B9U A;  1LWF A;  2DFE A;  1BGX T;  2X6N A;  4CEC A;  3K5M A;  4CJS A;  3UIQ A;  2O4I A;  3VQC A;  3KJV A;  4E1N A;  3RRH A;  3MED A;  3RR7 A;  4H4O A;  3AO5 A;  3C6U A;  3LP1 A;  3SQ1 A;  4CJ3 A;  4F2S A;  3HVR A;  4FJ9 A;  3NCI A;  1ASW A;  4AHT A;  1WSH A;  4RW9 A;  5KGW A;  2G8U A;  4CES A;  3BDP A;  4C8K A;  1NK8 A;  3AO4 A;  2Z1G A;  3LWM A;  1X9S A;  4N5S A;  3V1O A;  2OA8 A;  2HHS A;  1HYV A;  1RDC A;  3P5J A;  1N5Y A;  1RDB A;  4E7I A;  3HJF A;  1UA1 A;  3SV4 A;  3KK2 A;  4NYF A;  2FC0 A;  2ZE2 A;  3AVM A;  4J2B A;  4CJP A;  4PUO A;  4CF0 A;  4LY7 A;  1RTI A;  1JLA A;  3LAM A;  4IBN A;  4UQG A;  2YHA A;  4E7J A;  4F3T A;  1KVC A;  1RIL A;  4B9M A;  1CZ9 A;  2E6L A;  4CGJ A;  4N56 A;  1LWC A;  2AJQ A;  1NJZ A;  1A5W A;  4FZY A;  1RNH A;  2O4G A;  3AVN A;  3NE6 A;  1L3V A;  5HLF A;  3L2U A;  3HYF A;  3DM2 A;  3OS0 A;  1HJR A;  1U45 A;  4B9S A;  3HO1 A;  3AO2 A;  2GUI A;  3H08 A;  3ASM A;  4FCY A;  1L3U A;  4CJQ A;  2ZD1 A;  3HPG A;  4W5Q A;  4ZHR A;  4BE0 A;  4F8R A;  2G8W A;  1WNS A;  3C95 A;  2D0B A;  1LWE A;  1SUQ A;  3CFR A;  2JLE A;  3QEW A;  1Q9X A;  1YT3 A;  2P5O A;  4DSK A;  1RTD A;  1JLQ A;  4LD0 A;  2Q3S A;  4HUE A;  4RW8 A;  1IH7 A;  1D9D A;  1CLQ A;  4B9N A;  4Z4H A;  3HL8 A;  2VWK A;  1JL1 A;  2B4J A;  2KTQ A;  3ZT2 A;  1RT6 A;  1CXQ A;  4O4G A;  3NH0 A;  4M3Y A;  4QOZ B;  4OJR A;  1QS4 A;  1UWB A;  3SUN A;  3ZT1 A;  2E6M A;  5EU7 A;  4FJK A;  1BQN A;  3IG1 A;  4BE2 A;  3V81 A;  4DSJ A;  1XC9 A;  3OS2 A;  4KHW A;  1RBU A;  4CE9 A;  1C0M A;  3V1R A;  2FBT A;  2Z1J A;  3KLG A;  1MU2 A;  2JGU A;  4FZX C;  2KFN A;  3O3H A;  1GOA A;  1BIS A;  3G10 A;  4KHN A;  1RDD A;  3QNO A;  4Z4E A;  4CF8 A;  3MXM A;  4B8C A;  4Q0B A;  1TAQ A;  1HRH A;  3LP3 A;  1BIU A;  1RT2 A;  5HRN A;  3KD1 E;  3L2V A;  4NCB A;  3NF8 A;  4CFC A;  1TAU A;  1KLM A;  3QER A;  3SYZ A;  1HNV A;  3KLH A;  4DS4 A;  2OPS A;  3TI0 A;  3OYE A;  3CFO A;  1RT5 A;  1TL3 A;  4CJE A;  4CK3 A;  4CIF A;  2HHU A;  3I8D A;  2HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...