1UAXA

Crystal structure of the ribonuclease h2 from pyrococcus horikoshii ot3
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MKVAGVDEAGRGPVIGPLVIGVAVIDEKNIERLRDIGVKDSKQLTPGQREKLFSKLIDILDDYYVLLVTPKEIDERHHSMNELEAEKFVVALNSLRIKPQKIYVDSADVDPKRFASLIKAGLKYEATVIAEHKADAKYEIVSAASIIAKVTRDREIEKLKQKYGEFGSGYPSDPRTKEWLEEYYKQYGDFPPIVRRTWETARKIEERFRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HII
publication title Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1uaxA00
3NGZA 1XC9A 2VG7A 2FC0A 3AVIA 3OYMA 4DQRA 4B9UA 2D5RA 3AVLA 3AO4A 3NAEA 1T03A 1S6PA 3P83D 2HMIA 3WNGA 1JL1A 4AHUA 4CJ5A 4DF4A 3VQQA 4C8LA 3ZSOA 4I2PA 2QKBA 3HPGA 4E19A 1BISA 5SZTA 1G15A 3TAQA 5J2MA 1EX4A 4DTSA 2RPIA 1RT5A 3NFAA 4CK1A 4E0DA 1NJWA 1IKVA 3K2PA 1RBUA 4DMNA 3OS0A 3BGRA 4W5OA 2XY7A 1VSDA 3VQBA 1Q9XA 3OYLA 3DLGA 3KTQA 3AVKA 1TVRA 2BANA 5HLFA 3TAGA 3RRHA 4HCCA 1RT6A 2XHBA 4CJUA 4CIEA 3K5NA 2HHWA 4FJ5A 3LP2A 1L3TA 1D9DA 1B9DA 3CG7A 2B6AA 3SJJA 1CZ9A 3QNOA 4I7FA 2VWKA 3QNNA 1I3AA 2ZE2A 5HRSA 3NCIA 4J2AA 1JKHA 4M42A 2VG5A 2XY8A 3L2UA 1IKYA 1JLAA 3ZSRA 1BL3A 4HTUA 4JS5A 4OVLA 4FLZA 2YV0X 2Z1GA 5FRNA 4O44A 1KTQA 1REVA 3LP0A 3AVHA 4RW9A 1ASUA 3KLGA 4FLTA 3LALA 2XO7A 3TWHA 2X78A 3DRPA 5HRRA 3AA2A 3OYHA 4FM1A 3NF7A 1KLNA 4N76A 3M8PA 4FJKA 3NE6A 4AHRA 1JLGA 3LP3A 3DLHA 3LZJA 1U45A 3TAEA 1S1VA 5CYQA 1D5AA 4OLBA 4FZXC 3DRSA 3RR7A 3HT3A 4KFBA 1NK4A 2RF2A 1LW0A 4E7HA 4OGCA 3DOLA 3U3YA 2FBXA 2WONA 3DRRA 3VQ8A 2YNGA 1SKSA 3PY8A 3ITHA 4KV8A 4XIUA 1QSSA 1WSEA 2G8HA 5KRTA 1T7PA 4I9QA 3M8RA 2DFHA 3B6OA 4BE1A 3WNHA 4DSEA 4BDZA 4UQGA 4FZYA 2F96A 3OYIA 2PYJA 3AA5X 2JGUA 4FJIA 1HPZA 3K57A 4Z4EA 3KK3A 2IAJA 2LSNA 3VQEA 1C1CA 1D8YA 4KTQA 4O5BA 1VK0A 4CK3A 3EYZA 3KKSA 2KFZA 4IKFA 4MFBA 3DMJA 1XWLA 3S3NA 4CJRA 3SUNA 3RMAA 3LPTA 3S9HA 4M3XA 1ZBHA 4CEAA 3CFPA 1Q8IA 1HQEA 4HUGA 1KVCA 1LAWA 2RKIA 4IFYA 4LD0A 3KIOA 2EX3A 3HPHA 1XHXA 2FBYA 4B8AB 4CF0A 2KZMA 3ZSVA 5J2QA 1LWEA 3HVRA 1SV5A 3KLHA 4KPYA 3WNEA 1WN7A 2E6LA 3RTVA 4B9SA 4FYDA 2ZD1A 2X6NA 4DQPA 4B8CA 3HJFA 3RMCA 4HUEA 5D3GA 4M3TA 1U04A 2G8IA 1B9FA 2Z1JA 3DLEA 4LSLA 3ZSZA 4CFDA 3SV3A 4F4KA 1YT3A 3MECA 2XY5A 5DMRA 3NBPA 4JRPA 3DLBA 3LP1A 4W5QA 4KKOA 1C1BA 4DTRA 1KCFA 3I8DA 2DFEA 5KI6A 3SPYA 3V9WA 3PO4A 1X1PA 4KB1A 4KHWA 1K6YA 3IS9A 4DQSA 3QLHA 3G0ZA 3A2FA 4DG1A 5T7BA 1BQNA 1HYVA 4CGHA 3RR8A 3KLEA 5CYMA 1N6QA 4R5PA 4KHQA 3OYFA 3IAYA 4PQUA 1A5WA 1WSJA 4E3SA 4B9LA 3NGYA 1L5UA 1J53A 3AVFA 4CGGA 1LAVA 1UA0A 2HNDA 4CIFA 4PWDA 1YTUA 1S1WA 3DOKA 3RMBA 3PX4A 1TGOA 3KKRA 4DQQA 5I3UA 1S9GA 1W9HA 5EU7A 3V1QA 4CJWA 1JL2A 2HHXA 2P5OA 1QS4A 1EETA 4FM2A 4FJJA 3B6PA 1S5JA 3QO9A 4M45A 4DS4A 4K8ZA 1HYSA 2HHVA 2D0CA 3OYCA 4FW2A 3OYKA 2Y1IA 1QTMA 3BDPA 2KFNA 4PA1A 4BDPA 4OKJA 1NKBA 3AVMA 5C42A 4E7IA 2JLEA 2AJQA 5JS2A 3JSMA 1NJYA 3VQPA 5E41A 3HO1A 2OPSA 2NUBA 4CJ4A 1DLOA 1J9AA 1EKEA 3QIOA 1Z25A 4Z4GA 2OA8A 1RTHA 3LAKA 1T8EA 3KJVA 1BGXT 4OKEA 1S6QA 4DFPA 2IOCA 4CFAA 1TK5A 4OGEA 4CERA 1VSKA 3RWUA 4W5TA 1FKOA 1VSFA 4AH9A 4FK0A 2VWJA 3OYAA 1S1UA 1TK8A 3V1OA 4F2SA 1DTQA 4QOZB 1L3UA 1BQMA 1WAJA 2B5JA 3G10A 3V6DA 4KTWA 3K5OA 1UA1A 1X9SA 2YNHA 1ZYQA 4RW7A 2KTQA 4RW4A 2BGGA 1NK9A 1RILA 5CZ2A 1KFSA 1ASWA 5KRSA 3HXMA 1NKEA 1QE1A 4BE0A 4AHCA 4J2EA 4HVJA 1RBTA 3SV4A 4KAZA 3EY1A 2A1SA 5CY4A 3L3UA 4EZ9A 4ID5A 3FFIA 1RBSA 2X6SA 4DFMA 1TKDA 4JLHA 4CHYA 3NH1A 1X9MA 3VQCA 2OPRA 4O0IA 3AVJA 3K59A 3CM6A 4FXDA 4CHZA 2O4IA 4PUOA 1F21A 4KHSA 4DSLA 3K5MA 1TAUA 4CJPA 3C6TA 3KLIA 1TKTA 3OYJA 4ZTJA 1KRPA 4CIGA 4CF2A 4FJGA 4M3RA 2QXFA 3ZSQA 3ULDA 4Q5VA 2IDOA 2HHUA 1FKPA 3ZSYA 2G8KA 3KLFA 4RW6A 3T19A 1BHLA 3TAPA 4M3ZA 5C24A 2QKKA 3PX6A 3MEEA 3HVTA 3OS1A 3KK2A 2PZSA 4M3WA 4KHYA 4F8RA 4FJ7A 4CHQA 5I42A 3U3GA 4N5SA 3QEPA 1TK0A 5HROA 1CZBA 3H08A 1HMVA 3O4NA 3PUFA 4DTMA 1TKZA 1RDDA 4H4OA 3QEIA 4E7JA 3DLRA 4OPJA 1L3VA 3ASMA 3QESA 1QSLA 2HVHA 4KHUA 4FM0A 1SL2A 2FBTA 3L2WA 3ZSWA 2DY4A 4HCBA 1JXBA 1C0TA 3VQ6A 4CGIA 4ZHRA 3T1AA 1X9WA 4ELTA 1NOYA 1WSIA 2YHBA 1NK5A 4CJQA 3ZT3A 4CJVA 1VSHA 3D0PA 3VQ7A 1CLQA 3ZT2A 2HHTA 2DTUA 3SQ2A 2F8TA 1HNVA 1TAQA 4BDYA 4ZTFA 1VSMA 4O0JA 1ASVA 4YFUA 3QEXA 3HSTB 3V9ZA 3AO2A 5FROA 1YTAA 1RBVA 1GOAA 3K58A 1JLQA 2P5GA 4CEQA 2RN2A 3O3FA 4FK2A 1IO2A 1VRTA 5KTQA 5DK5A 4Q0BA 4I9LA 3LANA 4GW6A 3ZT1A 1N5YA 1RT2A 1LWFA 3V9SA 1BIUA 1FXXA 4LH4A 4C8NA 2HNYA 3LAMA 1C0MA 1S9EA 1NJZA 4ELVA 3MEDA 1Q9YA 3MXMA 4DLEA 3OYNA 3LWLA 1T05A 3VQ4A 3MEGA 1WLJA 2Z1HA 4CEDA 1BI4B 2Y1JA 3V4IA 2YHAA 1FK9A 4FJHA 3NF8A 4NCBA 3DYAA 4Z4FA 2DFFA 4E7LA 4CEFA 1C0UA 4DSJA 1HRHA 4FLVA 1SUQA 3AA3A 3ZSXA 4CFBA 4EZ6A 3OY9A 2G8UA 4B9TA 3OVNA 1RDAA 3CM5A 3WNFA 4AHTA 4W5NA 2BDPA 3SUQA 1ITGA 4N41A 4KI4A 1CXUA 2BE2A 2R7YA 4M41A 3O3HA 1NJXA 4CJKA 4C8KA 1LW2A 4FJXA 1RTJA 4RG8A 4BWJA 1QSYA 2OZSA 2F8SA 2VG6A 1RDBA 2IS3A 4EP5A 3CFRA 4FLXA 2HHSA 2X74A 4OLAA 3NGIA 3NDKA 3ALYA 3L2QA 1HQUA 4KTZA 4HHTA 2D0AA 4DTJA 4NCGA 4CJSA 2KZZA 1KFDA 3ZCMA 4DS5A 1U48A 1RBRA 3L3VA 3VN5A 5KGXA 3LZIA 1RT1A 5C25A 3OYDA 1WNSA 4Z4CA 1IKWA 3HL8A 3MAQA 1CXQA 1RNHA 4CEZA 4E89A 3CQ8A 3V9XA 4CEBA 1SL0A 4DTOA 1UOCA 3TR8A 3VA0A 4CEEA 1KVBA 4CHOA 4JS4A 4FW1A 4CF9A 4W5RA 3OS2A 3HM9A 1NK0A 1BCMA 3NHGA 4H8KA 1KVAA 1XHZA 2KQ2A 3SPZA 1WSHA 4O55A 1R0AA 1JLCA 1HJRA 3AV9A 2OYQA 4DSKA 4F2RA 4FCYA 3SZ2A 1IG9A 1A5VA 4DWIA 4Z4IA 4Y1DA 4OJRA 4WE1A 5K14A 1BCOA 2Q3SA 4E7KA 4IG3A 3TARA 3THVA 1NK7A 4YNQA 4TSXA 3KD1E 3OYEA 4LH5A 4DTNA 4CCHA 3AVGA 3AO3A 3EZ5A 4DU4A 2P51A 1NOZA 1RT4A 1B92A 2PY5A 3TAFA 4DFJA 4DF8A 4IBNA 2HB5A 3P1GA 1RT3A 4CJLA 3F73A 1RCHA 2HVIA 5KGWA 4FK4A 3RMDA 4GMJB 4NYFA 3SCXA 3TABA 4KB0A 2GV9A 2EHGA 4CE9A 4CJTA 4AILC 3AVCA 3AO1A 4CJFA 4F3OA 4DLGA 1ZBLA 4E1MA 4N56A 4AHSA 3V9UA 1ZBFA 4DTPA 3DLKA 3VQ9A 4DSFA 1S1TA 1L3SA 3K5LA 3VQAA 3PV8A 4CHPA 3KK1A 3LWMA 2O4GA 3HP6A 3CYMA 1VRUA 4G1QA 4DQIA 5J2NA 4ICLA 4EP4A 4Z4HA 4PY5A 4FJ9A 1YVUA 3F9KA 4CGJA 3PO5A 1DTTA 3ZT4A 4DU1A 4CGDA 2WOMA 3QETA 2IC3A 4K8XA 3HK2A 4CFCA 4KREA 4KRFA 2YNFA 1XI1A 4CF8A 3C94A 5HRNA 1NKCA 3M8SA 1SL1A 2ZQBA 3OJSA 1A5XA 3CFOA 1U47A 3PX0A 4B9NA 3SQ1A 2D0BA 2YKNA 3S3OA 1C1AA 1VSIA 2GUIA 3AO5A 4FLUA 1KLMA 4KHNA 3E01A 4FJNA 4CJ3A 2YKMA 3AVAA 3P5JA 1BIZA 2W42A 1GOCA 1GOBA 5J1EA 4DU3A 3QIPA 4CECA 4L8RB 1RDCA 1WAFA 4B08A 3TANA 1D9FA 2G8FA 1RTDA 1WSGA 1BI4A 4OKKA 1S1XA 5SWMA 3OJUA 2OPQA 2IGIA 2E4LA 3NH0A 1U4BA 1MU2A 4JRQA 3KD5E 2E6MA 4J2BA 4FVMA 4DTXA 4RW8A 3VQDA 2PYLA 3TI0A 3MXJA 3L2VA 5HBMA 4IFVA 5JS1A 3DI6A 4FLWA 4M3YA 2ATQA 4GVMA 3SQ4A 1NK6A 1ZBUA 4LSNA 4CJEA 4FLYA 1KSPA 3VA3A 5FRMA 4F3TA 3O4QA 4FJMA 4J2DA 3SUPA 2I5JA 1EXQA 1TL3A 4LY7A 4E1NA 1SKWA 1J5OA 2Z1IA 3U6FA 4C8OA 2HW3A 3I0RA 4QAGA 4FJ8A 1J54A 5FDLA 3DM2A 1C6VA 3L2RA 3AVBA 2XY6A 3JYTA 1W0HA 1UWBA 4NYNA 1SKRA 4B3OA 3C6UA 5HRPA 3ISNC 2G8VA 4CESA 4CGFA 3NH2A 4HUFA 1JXEA 3AA4A 4BACA 4KI6A 3IRXA 4BWMA 1NK8A 1HYZA 1IKXA 1TKXA 4N47A 3SQ0A 1IH7A 4DTUA 5HP1A 1QHTA 1VSJA 4IG0A 4C8MA 4CEOA 4OPKA 4FZZA 3OYBA 2HHQA 1VSLA 3LPUA 3NF9A 3ZT0A 1VSEA 3SUOA 1ZBIA 2QK9A 4DFKA 1QQCA 2OPPA 3SI6A 1O1WA 4O4GA 4CF1A 1U49A 2P1JA 3QEVA 1EP4A 4AHVA 1HNIA 3S3MA 2ITGA 4QCLA 4IDKA 1TL1A 1JLFA 2YNIA 1Y97A 3M8QA 3OYGA 3I0SA 2XRIA 3HPOA 3T3FA 3QEWA 4Z0UA 3HYFA 1LV5A 2KW4A 3NF6A 5CZ1A 2FBVA 2GBZA 2G8WA 3L8BA 3MXIA 4ELUA 1RT7A 1TV6A 4DSIA 1UAXA 2HNZA 4KO0A 4BE2A 3HP9A 1I39A 1JLEA 1RTIA 2ETJA 1LWCA 3IG1A 3SYZA 3C95A 3TAMA 4ID1A 4CK2A 3QERA 2OZMA 1JLBA 1WSFA 4H4MA 4M3UA 4FJLA 3LDSA 3AVNA 3QINA 4B9MA 3UIQA 4NCAA 5J2PA 2A1RA 2B4JA 4I2QA 4MQ3A 3D45A 3RRGA 1Z26A 3V1RA 3V81A 3VQ5A 3SNNA 4B9VA 3O3GA 4CHNA 4Y1CA
chains in the Genus database with same CATH superfamily
3U9ZA 3VGKA 2VG7A 1VQ6N 1QHAA 4JI6K 4B9UA 3CC2N 1XQSC 1S6PA 3WNGA 4DF4A 1RGIA 4CJ5A 3C6AA 3ZSOA 2KLAA 4O5FA 1BISA 1EX4A 2RPIA 1OH8A 3N4QA 4E0DA 1NJWA 1IKVA 5B8HA 2QWOA 3CCQN 1VSDA 2D0PA 3CCVN 3KTQA 2P9PA 4HCCA 3TTCA 5GINA 3CJ9A 3ULEA 3UKUA 1L3TA 2ZM6K 4I7FA 3QNNA 4OO1J 1I3AA 2ZE2A 4IZ9A 4J2AA 3B8AX 1JKHA 4KBOA 4M42A 2VG5A 1IV0A 2XY8A 1JLAA 2NRXA 3ZSRA 3MDQA 2YV0X 3AARA 1CZAN 3LP0A 3D2FB 2NRTA 4B3SK 3U8XA 3AA2A 2IVOA 5BR9A 5IWAK 2O8BA 3DRSA 2WC9A 3LL3A 4KFBA 3NVKA 3OHRA 1NGCA 3U3YA 2FBXA 4FWRA 3DRRA 1E4FT 4KV8A 3D2EB 1Y64A 3ZEUA 3B6OA 3WNHA 4FZYA 1HPZA 2LSNA 4BRIA 1JCFA 3VEOA 4BC5A 4KTQA 4O5BA 3KKSA 2KFZA 2F7TA 1XWLA 2P9UB 2OCEA 3P39A 4JHDB 3LPTA 4M3XA 5BREA 3CFPA 2O8FA 1S3XA 1KVCA 4BRLA 2EX3A 2ZGYA 4CF0A 3ZSVA 2QI2A 1LWEA 1SV5A 2KKZA 3KLHA 3WXKA 1WN7A 1HPMA 4XH1A 4GV3A 2ZD1A 3H6EA 4B8CA 1HJOA 2G8IA 4LSLA 3CQYA 3ZSZA 2IIRA 2OTJN 3MECA 4W5QA 4KKOA 1C1BA 3BF1A 3VEYA 1X1PA 1K6YA 4JKGA 4DG1A 5AFUA 4CGHA 3A5NC 4FWNA 1A5WA 1WSJA 4B9LA 1XC3A 4CZMA 3LDPA 4CIFA 1YTUA 3DOKA 5AQFA 5I3UA 1MDUB 2HHTA 2NRHA 1EETA 1S5JA 4K8ZA 2HHVA 1T6CA 4DS4A 2KFNA 2PBDA 1Z05A 4BDPA 5C42A 1GLEG 2JLEA 5JS2A 3JSMA 1NJYA 5E41A 2NUBA 4Z4GA 1Z25A 1WBDA 1T8EA 4OKEA 1S6QA 4DV3K 2QWMA 5DM6L 2IOCA 3O9SA 4CFAA 1TK5A 4OGEA 4CERA 3RWUA 1VSFA 1S1UA 4FWLA 4F2SA 4FOIA 3GBTA 4QOZB 3H46O 4DQ8A 2B5JA 1N34K 3FR0A 4K0KK 2YNHA 3O80A 3HOSA 3O1WA 2BGGA 4PL8A 1NKEA 5ADXH 1KQSM 4HVJA 1RBTA 5JLHA 3SV4A 2A1SA 3GOIA 5CY4A 5M1FA 4DFMA 2W6KA 4JNEA 4CI6A 3G4SN 1BA1A 3I55N 4KHSA 4DSLA 1TAUA 3C6TA 3KLIA 2ASMA 4CF2A 5AQGA 3VF4A 3ATUA 4Q5VA 4LFBK 3KLFA 3MCPA 1HNXK 3RSEA 4C1NI 3TU5A 3PX6A 3MEEA 3KK2A 3OS1A 4F8RA 3TSUA 1T3VA 4FO0A 5AQPA 1KD1O 1HMVA 4DTMA 3CI5A 1TKZA 4H4OA 4CZFA 4EHTA 4E7JA 1K73O 3J7AP 3QESA 2NRRA 3HSCA 3ZSWA 2Q0UA 4ZHRA 2UXBK 3C7NB 4ELTA 5AQVA 1WSIA 4CJQA 1WOQA 3RSEB 3D0PA 1S72N 2DTUA 3SQ2A 3QEXA 1ASVA 2O8EB 3HSTB 4PKHA 5AQJA 2E88A 5LMNK 3GG4A 3AGKA 5KTQA 2WTUA 4Q0BA 1EQYA 4EHUA 3LANA 4GW6A 4X64K 1RT2A 4JKAA 4YDUA 1FXXA 3R8EA 4C8NA 5BRFA 1E3MA 1C0MA 1NJZA 3OYNA 4DV1K 3MEGA 4BC4A 3BY5A 4CEDA 3V4IA 3THWB 3HM8A 3NF8A 4MDBA 4Z4FA 1HR0K 2QA4N 1C0UA 4DSJA 2GWKA 1SUQA 4EZ6A 5AZJA 5IT9O 4B9TA 1RDAA 4BROA 1QVGM 3HBTA 3THXB 4N41A 4H0YB 2R7YA 4M41A 3GL1A 1VHXA 4CJKA 1LW2A 2P9NA 4FJXA 2V7ZA 4RG8A 1QSYA 4YOYA 2HHSA 2X74A 4OLAA 4BRQA 3L2QA 4KTZA 4HHTA 1GLDG 3VF2A 2KZZA 3ZCMA 1IBLK 1RBRA 3VN5A 3MX5A 3OYDA 4Z4CA 3ZLJA 4E89A 3V9XA 4CEBA 2FF3B 2E8AA 4DTOA 4WQ4C 3VA0A 4JS4A 4CF9A 4E1JA 3HM9A 1JCEA 2UXDK 1VQMN 1VQLN 1GLJO 1XHZA 2UXCK 3SZ2A 1W7AA 1IG9A 2H3GX 4JK9A 1BCOA 2Q3SA 2NZTA 4IG3A 3TARA 3THVA 4R79A 2P9SB 4CCHA 3AVGA 4DU4A 2NNWA 3OBWA 3EZ5A 5LL6Z 2NRWA 3TAFA 4BG9A 4IBNA 5C2DA 4FWPA 4LF9K 1RCHA 5KGWA 3RMDA 5KQ8A 3DXKA 5BRDA 3SCXA 2GV9A 3AVCA 1ZBLA 3DLKA 3EKUA 3U4LA 1L3SA 4CHPA 4MO4A 2O4GA 3CYMA 3MN7A 5J2NA 4Z4HA 5M1OA 1YVUA 3F9KA 4K8XA 3HK2A 1P8ZA 5HRNA 3C94A 1NKCA 1V4TA 1NM1A 3PX0A 1NJIO 4BRCA 3S3OA 1N8RO 4KHNA 3E01A 5AR0A 4CJ3A 1WAFA 2Q36A 3QMLA 1RTDA 3FZMA 1BI4A 2OPQA 4JRQA 4DHYA 4J2BA 5C12A 4FVMA 4A61A 1Q81O 3MXJA 4JV5K 1QQNA 4BY9C 4YOVA 1VQPN 2ATQA 4GVMA 4FLYA 2A5XA 1W2BM 1EXQA 4CBWA 1SKWA 3QICA 3U6FA 3NVMA 2A41A 3UKRB 5FDLA 3OBYA 5GADP 3AVBA 1W0HA 4FSVA 1D4XA 1HYZA 5ELZA 3A0IX 3SQ0A 4F2RA 4DTUA 4JI0K 1OVQA 1VSJA 1SAZA 2HHQA 3LPUA 1DEJA 1IJJA 2ZJRL 4K41A 2QK9A 4DFKA 3CPEA 4QS7A 3CHWA 4CZGA 4O4GA 4AHVA 3FZHA 2ITGA 3WQTA 4I6MA 3ZETB 1TL1A 4HTLA 3HPOA 5MLCQ 2XRIA 4DR6K 3HYFA 4LF8K 3E66A 2FBVA 2GBZA 3L8BA 3T1YK 1RT7A 4DSIA 2HNZA 1NGIA 3AGRA 1YJ9N 4BE2A 1I39A 1RTIA 3IG1A 3C95A 1V4SA 1BU6O 2OZMA 1WSFA 1SZ2A 2O8DA 5C2FA 3UIQA 4A5AA 4NCAA 4DKWA 2A1RA 4I2QA 1KC8O 4X66K 3WQUA 3VQ5A 3O3GA 4Y1CA 3PSIA 3NGZA 3O5BA 3OYMA 1SS6A 5LY3A 3AVLA 3AO4A 3P83D 4H0XB 4IWVA 4BQZA 3PIOL 4C8LA 1Z6RA 3HPGA 3EEQA 4BRMA 4DTSA 3QB0A 3NFAA 3K2PA 1YIJN 4DMNA 3BGRA 4W5OA 2XY7A 3VQBA 1Q9XA 5C15A 4CBXA 1KAYA 3IUCA 4JD2B 2XHBA 1YHQN 5JVGL 4CJUA 4CIEA 4FJ5A 1K8KA 2GELA 1EO1A 1B9DA 1IBMK 1FJGK 1CZ9A 4DR4K 1DKGD 3NCIA 1BL3A 1WUAA 2YJFA 1C0GA 2Z1GA 5FRNA 4O44A 1REVA 1ASUA 4FLTA 5CHIA 4XH4A 5HRRA 4N76A 3M8PA 1JLGA 1TUUA 3TSQA 3LZJA 3TAEA 1S1VA 3U9DA 4OGCA 3HTVA 1XUPO 1OKJA 3DOLA 3VEZA 2WONA 1SKSA 2F9TA 1T6DA 1WSEA 2VYPA 3M8RA 2DFHA 5AQMA 4DSEA 4UQGA 2GUPA 2F96A 4FJIA 4Z4EA 5CE3A 3ENBA 5H1SQ 2GWJA 4BRGA 3EYZA 4PL7A 4WYBA 4IOAL 3S9HA 4CEAA 3MK6A 2RKIA 4B8AB 3O1BA 4PKGA 4IOXA 4B9SA 4H0PA 4FYDA 3HJFA 3C0BA 4HUEA 1M1KO 4U67L 1U04A 4LC9B 2Z1JA 3CCSN 1MWMA 3I8DA 2DFEA 5KI6A 1YI2N 3L4QA 5FPEA 3IS9A 1ZBSA 1ZXOA 3A2FA 5T7BA 4G9ZA 3VEWA 3RR8A 4YDUC 4R5PA 3AAQA 2QWLA 1L5UA 1J53A 1LAVA 4PWDA 2A3ZA 3KKRA 4DQQA 1W9HA 2BUPA 4BQLA 3V1QA 4CJWA 1JL2A 1QQMA 3O9QA 4FM2A 5AQKA 3B6PA 1HYSA 1HKGA 2FXUA 3OYKA 3BDPA 4FWQA 1QZ6A 3AVMA 3TSPA 2QXLA 1O13A 2P9IB 3VQPA 5AQUA 3WXLA 5E84A 1BGXT 4EIAA 1RFQA 2W6LA 3JAMO 3THYB 3H3NO 4AH9A 4FK0A 2VWJA 3OYAA 2HSTA 4OPAA 3V1OA 1TK8A 4GNIA 1L3UA 5LJWA 4ILHA 4NLBA 4KTWA 1X9SA 3D2FA 1ZYQA 4RW4A 1RILA 2HMPA 1KFSA 5KRSA 3HXMA 1QE1A 4J2EA 4BRKA 1U2VB 3EY1A 3L3UA 4EZ9A 4OX9K 3I33A 1RBSA 5AJ3K 1TKDA 3D2EA 4CHYA 4JI4K 5AQZA 2OPRA 4O0IA 3AVJA 3K59A 2AA4A 5EVZA 2O4IA 3SAHA 1F21A 3KVGA 1VAZA 2E20A 2A40A 1KRPA 4CIGA 1GLFO 2Q2RA 4B1ZA 2IDOA 3ZSYA 2P9UA 3R1XA 4JHDA 3T19A 4M3ZA 3J8AA 4ISFA 4C23A 3HVTA 1Q82O 2GX9A 4FJ7A 5I42A 3U3GA 4N5SA 1CZBA 3H08A 3O4NA 1VQKN 2V52B 1YAGA 3SMSA 1QSLA 5AQNA 1SQKA 5AQSA 3L2WA 4JEPA 4JKCA 4IOCL 1NGDA 3T1AA 1OVYA 2CH5A 1NK5A 3LM9A 1CLQA 3ZT2A 5A2QO 5JLFA 1JCGA 1HNVA 1BO5O 1TAQA 4B1UB 3QBXA 3V9ZA 4BGAA 3MX2A 4JI8K 3K58A 3CCEN 1JLQA 4FK2A 1IO2A 1VRTA 5FPMA 1N5YA 1HKCA 4ELVA 4H5VA 3UB5A 3MEDA 4PHTX 4DLEA 4H0VB 1TYQB 3IKMA 3VQ4A 5KPRA 2YHAA 1VQ8N 1FK9A 3DYAA 3WXMB 4JI7K 1MA9B 3LDNA 1RDWX 2G8UA 4AHTA 3BUZB 3F5TA 3SUQA 3BF3A 2UUAK 1CXUA 1W97L 4C8KA 2FSKA 3O9UA 1RTJA 2VG6A 1RDBA 4EP5A 3CFRA 3SBTA 4CW7B 5FLXO 2D0AA 4NCGA 3LZIA 1N32K 1RT1A 5C25A 3HL8A 2O8CB 1RNHA 3HI0A 4CEZA 1SL0A 4DV4K 4W5RA 3OS2A 2A42A 4FPBA 3VTIA 4H8KA 1KVAA 5AQOA 1WSHA 3W3DA 3PIPL 5BPNA 2VQFK 3M3ZA 4DWIA 4Z4IA 4WE1A 4BR7A 4E7KA 1WB9A 1Q18A 1GLLO 3KD1E 2HBLA 3AO3A 1RT4A 2PY5A 1B92A 4DFJA 3F73A 2HVIA 4IXCA 4NYFA 5AQQA 2V51B 4BRDA 4AILC 4DLGA 1EWQA 2E1ZA 3C7NA 4DTPA 4ISEA 3VQ9A 2GTDA 3VOVA 4B1XB 3VQAA 3PV8A 3KK1A 3HP6A 2O8EA 4ICLA 1NGEA 2VWBA 4CGJA 3ZT4A 4KREA 4KRFA 1SL1A 2QWNA 4V19S 4B9NA 2D0BA 1C1AA 1VSIA 1KLMA 4FJNA 3LM2A 2YKMA 1BIZA 2W42A 4KHPK 4DU3A 3A8YA 3QIPA 4B08A 4WQ5C 1S1XA 3IDHA 3KD5E 2E4LA 3NH0A 1BA0A 3THWA 2E6MA 2UUBK 2GEMA 3L4IA 4M3YA 4FLWA 4YORA 1X9JA 1ZBUA 3F2KA 4GY2B 5FRMA 3FGUA 3THXA 4FJMA 3SUPA 4LY7A 4E1NA 1J5OA 3CD6N 4EFHA 4FJ8A 1C6VA 3L2RA 3C6UA 2JWKA 4KI6A 4BACA 2I7NA 4BWMA 3CJ1A 1QHTA 4NB4A 4CEOA 1XNQK 3ZT0A 3SUOA 3MN9A 1O1WA 1HX1A 1HNIA 3S3MA 4QCLA 4IDKA 4JKFA 1Y97A 3I0SA 2KW4A 4L3QA 3CMAN 2G8WA 4KO0A 4U7BA 1JLEA 3SYZA 1LWCA 2P9SA 3TAMA 2KHOA 4H4MA 5JICA 4FJLA 3LDSA 2D0OA 3KK7A 2B4JA 3V1RA 3SNNA 4BGBA 4CD1A 3NAEA 1T03A 4H03B 2HMIA 4JAXA 3VQQA 3KZBA 4I2PA 4E19A 2NRVA 2ASPA 3ID8A 5SZTA 3A5LC 5J2MA 1RT5A 2ASOA 4BREA 4CK1A 2YHYA 3CCJN 4DV5K 3OS0A 3OYLA 3DLGA 3AVKA 1TVRA 2BANA 5HLFA 3TAGA 1RT6A 2HHWA 3LP2A 3CG7A 3HRGA 3CETA 2E2QA 2VWKA 4WFBL 4LFAK 5M1PA 3FZFA 4EAHD 5HRSA 1YUWA 5AZIB 3L2UA 1M90O 4HTUA 4OVLA 5AQRA 4MLHA 3BZCA 2VGMA 3AVHA 3KLGA 3LALA 2XO7A 3TWHA 2X78A 1HNWK 2P9KB 3VETA 4FM1A 3NF7A 3QDKA 3O6WA 4FJKA 3NE6A 4AHRA 3K0SA 1I94K 3DLHA 1U45A 1D5AA 5BN8A 4WFNL 4FZXC 3HT3A 1NK4A 3UKRA 2RF2A 1LW0A 1VQ4N 3VQ8A 2YNGA 3PY8A 5C10A 2E2NA 1QSSA 4I9QA 1T7PA 1WBBA 4BE1A 4BDZA 4A5BA 4JK7A 3OYIA 2PYJA 3AA5X 2JGUA 1S22A 3KK3A 2IAJA 3VQEA 1C1CA 1D8YA 3FFKB 4CK3A 4WCEL 5JMVA 4MFBA 3I8BA 3DJCA 1BUPA 3S3NA 3RMAA 3H45C 3VTHA 1Q8IA 1HQEA 3ZETA 3ATVA 4LD0A 3HPHA 2KZMA 5ADXA 4KPYA 5CR4A 4ILGB 3WNEA 2E6LA 3GDQA 2X6NA 4DQPA 3SK3A 4YOUA 4K43A 4CFDA 3DLEA 4BRHA 1YT3A 2XY5A 4CZHA 4AM6A 3L0QA 3QFUA 5DMRA 4JRPA 4DTRA 3WEEB 3SPYA 4KHWA 4KB1A 4DQSA 4MLEA 3QLHA 3SLCA 2D4WA 1BQNA 1HYVA 3KLEA 4LFCK 1N6QA 4KHQA 3OYFA 3AVFA 4CGGA 2HNDA 1NNEA 1S1WA 4AF1A 3RMBA 1DT9A 5GIOA 5EU7A 2HHXA 1QS4A 4FWOA 3QO9A 4M45A 4FVUA 1QTMA 4FW2A 2Y1IA 4LF6K 4PA1A 4BR9A 1NKBA 3D6RA 2OPSA 4JD2A 4CJ4A 1DLOA 1J9AA 1EKEA 3QIOA 1RTHA 1K9MO 3LAKA 4IO8A 4B3TK 3VEXA 2YHXA 3KJVA 4QS8A 1BDGA 2PAVA 2ZGZA 3VMFB 1VSKA 1FKOA 2HBJA 4A59A 1DTQA 1BQMA 3G10A 3V6DA 3K5OA 4DR7K 4RW7A 1RDUA 2KTQA 4CZKA 1ATNA 4AHCA 3KWIA 1H1VA 3JXUA 5EXWA 2WFBA 4YY3K 4C1NK 4DUYK 4AM7A 4JLHA 5I9EB 3NH1A 1X9MA 4FWMA 3CM6A 4B1VA 4CHZA 3ENOA 1J6ZA 4CJPA 1NGAA 3OYJA 2E5LK 4BR4A 4WQ5A 5HOOA 3ZSQA 5AFUH 3BEXA 2HHUA 2G8KA 2FSJA 4RW6A 2WUSA 1HLUA 2QKKA 3JS6A 4A2BA 1TK0A 1EWRA 3P31A 3PUFA 5AQLA 3VGLA 3QEIA 3DLRA 4CVNE 1IBKK 4OPJA 3NMUA 1L3VA 2UUCK 3DXMB 1SL2A 3AY9A 2DY4A 4HCBA 1JXBA 3VQ6A 4CGIA 2YHBA 2DPNA 3ZT3A 3Q7CA 4KH6A 3VQ7A 1NGJA 2F8TA 3K9JA 4ZTFA 4YFUA 3GE1A 1GOAA 4FWSA 2VCPA 4CEQA 2RN2A 3T7ZA 4H5TA 3H3OB 3ZT1A 1LWFA 1BIUA 4LH4A 3LAMA 4DV6K 1KAZA 1Q9YA 4B9QA 3EE9A 2Y1JA 4JKBA 2P9IA 5KPZA 3CF5L 4FJHA 4NCBA 2DFFA 4E7LA 4CEFA 1HRHA 1NGGA 3AA3A 3ZSXA 4FOEA 3OY9A 3EKSA 3OVNA 1N36K 4BVOA 4IJAA 3THYA 2HOEA 2I7PA 2BDPA 4KI4A 1NU0A 3O3HA 5AQIA 5M1KA 2QWPA 3VESA 2F9WA 2IS3A 3O9RA 4FLXA 1G99A 3ALYA 3EL2A 4DTJA 1BWFO 3L3VA 5KGXA 1U2VA 1YJNN 3SJHA 1WNSA 3MAQA 3Q7BA 2FLOA 3P38A 3TR8A 1KVBA 4CHOA 4H5WA 4MDAA 1NGFA 5LMUK 1ATRA 2YX6A 3C65A 1HUXA 2KQ2A 3BP8A 3J7ZO 1R0AA 1JLCA 2P9LB 4M63C 4CZLA 4DSKA 1A5VA 1VQON 4Y1DA 3VF6A 4OJRA 5K14A 1QVFM 5AQHA 4TSXA 1ESVA 1VQ5N 4LF5K 4JI1K 4DF8A 2HB5A 3P1GA 4X62K 3O08A 4FK4A 2E1YA 4GMJB 3CQXA 3E9LA 3FLCO 4H0TB 5EOYA 4DV2K 4JI5K 4F3OA 3AO1A 4AHSA 1S1TA 3MN6A 4IDHA 3LWMA 4BR2A 1VRUA 2CGJA 4PY5A 4FJ9A 3N4PA 1N33K 1DTTA 4M7XA 3QETA 2WOMA 4CFCA 1NMDA 2YNFA 3M6GA 3J81O 1XI1A 4CF8A 2P9PB 4GKKK 3M8SA 3L6QA 1QQOA 1A5XA 3CFOA 3OJSA 3SQ1A 2YKNA 3ULEB 1HNZK 2GUIA 1TUYA 3AO5A 3EN9A 3UKUB 4FLUA 3AVAA 3P5JA 1VQ9N 3TTFA 1GOCA 1GOBA 5J1EA 1TYQA 2JWLA 1RDCA 1D9FA 2G8FA 1WSGA 3J7YP 1QZ5A 2IGIA 1U4BA 1MU2A 4FWKA 5BRHA 5DM7L 3VQDA 2PYLA 2Q31A 4IFVA 4CJ7A 4KH5A 4F3TA 2HF4A 3MMVA 3O4QA 3VPZA 4J2DA 2I5JA 1TL3A 4M7YA 2EWSA 2O8BB 4C8OA 3I0RA 4K42A 3DM2A 4DV7K 2XY6A 4GKJK 3O8MA 1SKRA 3W0LA 2VGNA 3ISNC 4CESA 3F9MA 4CGFA 3ZEUB 1JXEA 3NH2A 3OTOK 1C0FA 1IKXA 4N47A 1IH7A 5HP1A 4C8MA 4DUZK 5AQYA 4FZZA 3NF9A 2O8CA 1VSEA 4BR5A 2QWQA 1MWKA 1ZBIA 2A6AA 4JI3K 3LDQA 1IG8A 2OPPA 3SI6A 4CF1A 1U49A 3QEVA 5BR8K 2O8FB 3OYGA 3QEWA 3O4WA 2OTLN 5M1NA 3WXIA 2ZJQL 3WT0A 5CZ1A 2W41A 3MXIA 4BG8A 4ELUA 1TV6A 4XEIA 3LDOA 4ID1A 3AVNA 4B9MA 5BN9A 4MQ3A 3D45A 1Z26A 3CERA 4JKGB 1XC9A 3AVIA 2FC0A 3TTDA 4DQRA 3QBWA 2D5RA 3DLLL 4J8FA 3H1QA 1JL1A 4AHUA 4CZIA 2QKBA 3TPQA 1R59O 2FSNA 5LJVA 1G15A 3ZX0A 3TAQA 5BPLA 4ILJA 3E9PA 1OH5A 1RBUA 5JVHL 3RRHA 3LDLA 3K5NA 1D9DA 4YOXA 2B6AA 3SJJA 3QNOA 3IMXA 3KWGA 1VQ7N 3SBGA 2BTFA 1NLVA 4JI2K 3HOTA 3DWLA 1IKYA 4IEEA 1NG9A 4JS5A 3SMPA 3A5MC 4FLZA 4Y0WA 1KTQA 4RW9A 4YHHK 1KAXA 3M1FA 3DRPA 4CBUA 3OYHA 1ZC6A 1KLNA 3MCAB 3AAPA 4PKIA 4CZJA 3LP3A 5KQDA 2YI1A 5CYQA 1J5EK 4OLBA 3RR7A 4GV9A 4A57A 4E7HA 1Q7YO 3ITHA 4LF7K 1T44A 4XIUA 2G8HA 5KRTA 4B3RK 1XMQK 3K57A 3I56N 1GLCG 1VK0A 3G6EN 2F4VK 4IKFA 3DMJA 2IVNA 4CJRA 3SUNA 4FPAA 1BOTO 1ZBHA 4HUGA 3CPWM 3VENA 1LAWA 4IFYA 3KIOA 1XHXA 2FBYA 4JKEA 5J2QA 3HVRA 3M5RA 1GLBG 3RTVA 3RMCA 5D3GA 4M3TA 2HBMA 1B9FA 4F4KA 3SV3A 4MO5A 3ENHA 3RVCA 3NBPA 1OH7A 3DLBA 3LP1A 1ILYA 1KCFA 2QW9A 3V9WA 3CCUN 3PO4A 2VQEK 1X3MA 3G0ZA 5F0XA 3CJCA 3FZKA 3P4IA 5CYMA 4DCHA 3IAYA 4PQUA 4E3SA 4DR2K 4BRNA 3NGYA 3A5OC 3ZYYX 4JYAK 1UA0A 4JKDA 3CJBA 5EX5A 3PX4A 1TGOA 4BVPA 1S9GA 3CCRN 2P5OA 1LCUA 4FJJA 2D0CA 3O9TA 3OYCA 2YHWA 3CC4N 4OKJA 4E7IA 2AJQA 3FZLA 3K9KA 3HO1A 2HF3A 2ZWHA 2OA8A 4NXNK 2E2PA 4FL9A 3VGMA 5AZJB 5KPTA 3EO3A 1NGBA 4DFPA 4WFAL 5AZIA 4W5TA 1KXPA 2P9NB 4UY8O 3DAWA 3C6HA 1WAJA 1UA1A 4DV0K 2P9KA 3IFRA 4AQYK 1NK9A 5CZ2A 1ASWA 2YCHA 4BE0A 4BC3A 2NRZA 1VQNN 2RHKA 4KAZA 3CCMN 4X65K 4ID5A 3FFIA 2X6SA 4HWIA 4XH5A 5EY4A 1NBWA 4RCHA 3VQCA 3R3LA 2IVPA 4FXDA 4ISGA 4PUOA 3K5MA 4FJGA 1TKTA 4H0OA 4ZTJA 4IEIA 4M3RA 2QXFA 4GVEA 3ULDA 1FKPA 1JJ2M 3CIPA 1BHLA 3TAPA 5C24A 1YITN 2OANA 2PZSA 4M3WA 4KHYA 3QFPA 4CHQA 3QEPA 4DB3A 4RWTA 5HROA 4RTFD 3CC7N 1RDDA 3DXKB 5TKWA 3ASMA 4DR1K 2HVHA 5BPMA 4KHUA 3WXJA 4FM0A 4IO9L 2FBTA 3EE8A 4O8UA 4JK8A 1C0TA 1X9WA 1NWKA 3H1VX 1NOYA 2V7YA 3WEEA 4QS9A 4CJVA 1VSHA 3SAGA 4A2AA 5GAHP 2QM1A 2ZF5O 4BDYA 1OH6A 1VSMA 4O0JA 2WBNA 4BR0A 4CD3A 3AO2A 5FROA 1YTAA 1RBVA 2P5GA 3O3FA 3MWTA 5DK5A 5AQXA 4I9LA 2J4RA 2D1KA 3T1HK 3V9SA 2HNYA 1S9EA 3VEVA 3WUHA 3MXMA 3LWLA 1T05A 2AP1A 1WLJA 2Z1HA 1BI4B 3BZKA 5E26A 4FLVA 1E4GT 1ATSA 3EZWA 4CFBA 1Q86O 2Q97A 3CM5A 3WNFA 4W5NA 1NGHA 3CMEN 1ITGA 2BE2A 1NJXA 1FW6A 3G71N 4BWJA 2OZSA 2F8SA 5M1QA 2CGLA 3CXCM 3NGIA 4F9OA 3NDKA 2ZJPL 1HQUA 3SAFA 4B3MK 4CJSA 4Z94A 1KFDA 4DS5A 1U48A 4NLCA 1NMNA 2UYTA 3D7EO 2FF6A 1IKWA 1CXQA 3CQ8A 1UOCA 4WF9L 1YXQA 4CEEA 4FW1A 4B1WB 1NK0A 1BCMA 3G25A 4BRPA 3NHGA 4I6MB 3OA9A 3SPZA 4JN4A 4O55A 3CJ7A 1HJRA 3AV9A 1YJWN 2OYQA 3S41A 4FCYA 5GAGP 4YOWA 3MWPA 4OPHA 3OW2M 1NK7A 4YNQA 5HL7L 1YVNA 3OYEA 4LH5A 4IJNA 4DTNA 3J80O 2P51A 1NOZA 4JKHA 2O8DB 1GLAG 3R9PA 2YJEA 2NLXA 3VERA 4CJLA 1RT3A 4YOTA 3CCLN 3TABA 4KB0A 3DXMA 2EHGA 4CE9A 4CJTA 4CJFA 4NXMK 4E1MA 4N56A 3V9UA 1ZBFA 2Q0RA 2HBKA 1HKBA 4DSFA 1LOTB 2BH1A 3K5LA 2Q1NA 3KHYA 1XNRK 3HZ6A 4G1QA 4DQIA 2CGKA 4A62A 4EP4A 3FE1A 1U6ZA 1YF5L 3PO5A 4DU1A 4CGDA 2E2OA 2IC3A 4K25A 2ZQBA 1U47A 1K8KB 3T69A 4GV6A 4O8KA 3PLAA 4LF4K 5FPDA 1BG3A 4H5NA 3CJAA 4H5RA 4CECA 4L8RB 3TANA 2QEXN 3ID6A 5SWMA 4OKKA 3OJUA 5FPNA 4IFEA 1K8AO 4DTXA 2PFUA 4RW8A 3E1YA 3TI0A 3L2VA 1XMOK 5HBMA 4BRFA 4DR5K 5JS1A 5C0YA 3DI6A 4BRAA 3SQ4A 4LSNA 3ZX3A 5TKYA 4CJEA 1NK6A 3VA3A 1KSPA 1DGKN 5GIPA 2UU9K 2Z1IA 2HW3A 4QAGA 1J54A 3R6MA 4DR3K 3JYTA 1UWBA 4NYNA 2RE2A 4B3OA 5HRPA 2G8VA 4HUFA 3AA4A 3IRXA 1NK8A 1TKXA 1X3NA 4IG0A 1P90A 5AQTA 2CH6A 4OPKA 3OYBA 1VSLA 2HHHK 1QQCA 2W40A 3PSFA 4B1YB 4KH4A 5GAEP 2P1JA 1EP4A 3ZX2A 1JLFA 2YNIA 3M8QA 3E9OA 3UE5A 3T3FA 1LV5A 4Z0UA 2P9LA 3NF6A 4WQ4A 5F2RA 2QWRA 2QTDA 4CZEA 1UAXA 3MN5A 4BC2A 4NO7A 3HP9A 2ETJA 4CK2A 3QERA 1JLBA 3QINA 2ITMA 5J2PA 3RRGA 4B9VA 3V81A 5AQWA 4M3UA 4CHNA 5F1XA
chains in the Genus database with same CATH topology
3NGZA 1XC9A 2VG7A 2FC0A 3AVIA 3OYMA 4DQRA 4B9UA 2D5RA 3AVLA 3AO4A 3NAEA 1T03A 1S6PA 3P83D 2HMIA 3WNGA 1JL1A 4AHUA 4CJ5A 4DF4A 3VQQA 4C8LA 3ZSOA 4I2PA 2QKBA 3HPGA 4E19A 1BISA 5SZTA 1G15A 3TAQA 5J2MA 1EX4A 4DTSA 2RPIA 1RT5A 3NFAA 4CK1A 4E0DA 1NJWA 1IKVA 3K2PA 1RBUA 4DMNA 3OS0A 3BGRA 4W5OA 2XY7A 1VSDA 3VQBA 1Q9XA 3OYLA 3DLGA 3KTQA 3AVKA 1TVRA 2BANA 5HLFA 3TAGA 3RRHA 4HCCA 1RT6A 2XHBA 4CJUA 4CIEA 3K5NA 2HHWA 4FJ5A 3LP2A 1L3TA 1D9DA 1B9DA 3CG7A 2B6AA 3SJJA 1CZ9A 3QNOA 4I7FA 2VWKA 3QNNA 1I3AA 2ZE2A 5HRSA 3NCIA 4J2AA 1JKHA 4M42A 2VG5A 2XY8A 3L2UA 1IKYA 1JLAA 3ZSRA 1BL3A 4HTUA 4JS5A 4OVLA 4FLZA 2YV0X 2Z1GA 5FRNA 4O44A 1KTQA 1REVA 3LP0A 3AVHA 4RW9A 1ASUA 3KLGA 4FLTA 3LALA 2XO7A 3TWHA 2X78A 3DRPA 5HRRA 3AA2A 3OYHA 4FM1A 3NF7A 1KLNA 4N76A 3M8PA 4FJKA 3NE6A 4AHRA 1JLGA 3LP3A 3DLHA 3LZJA 1U45A 3TAEA 1S1VA 5CYQA 1D5AA 4OLBA 4FZXC 3DRSA 3RR7A 3HT3A 4KFBA 1NK4A 2RF2A 1LW0A 4E7HA 4OGCA 3DOLA 3U3YA 2FBXA 2WONA 3DRRA 3VQ8A 2YNGA 1SKSA 3PY8A 3ITHA 4KV8A 4XIUA 1QSSA 1WSEA 2G8HA 5KRTA 1T7PA 4I9QA 3M8RA 2DFHA 3B6OA 4BE1A 3WNHA 4DSEA 4BDZA 4UQGA 4FZYA 2F96A 3OYIA 2PYJA 3AA5X 2JGUA 4FJIA 1HPZA 3K57A 4Z4EA 3KK3A 2IAJA 2LSNA 3VQEA 1C1CA 1D8YA 4KTQA 4O5BA 1VK0A 4CK3A 3EYZA 3KKSA 2KFZA 4IKFA 4MFBA 3DMJA 1XWLA 3S3NA 4CJRA 3SUNA 3RMAA 3LPTA 3S9HA 4M3XA 1ZBHA 4CEAA 3CFPA 1Q8IA 1HQEA 4HUGA 1KVCA 1LAWA 2RKIA 4IFYA 4LD0A 3KIOA 2EX3A 3HPHA 1XHXA 2FBYA 4B8AB 4CF0A 2KZMA 3ZSVA 5J2QA 1LWEA 3HVRA 1SV5A 3KLHA 4KPYA 3WNEA 1WN7A 2E6LA 3RTVA 4B9SA 4FYDA 2ZD1A 2X6NA 4DQPA 4B8CA 3HJFA 3RMCA 4HUEA 5D3GA 4M3TA 1U04A 2G8IA 1B9FA 2Z1JA 3DLEA 4LSLA 3ZSZA 4CFDA 3SV3A 4F4KA 1YT3A 3MECA 2XY5A 5DMRA 3NBPA 4JRPA 3DLBA 3LP1A 4W5QA 4KKOA 1C1BA 4DTRA 1KCFA 3I8DA 2DFEA 5KI6A 3SPYA 3V9WA 3PO4A 1X1PA 4KB1A 4KHWA 1K6YA 3IS9A 4DQSA 3QLHA 3G0ZA 3A2FA 4DG1A 5T7BA 1BQNA 1HYVA 4CGHA 3RR8A 3KLEA 5CYMA 1N6QA 4R5PA 4KHQA 3OYFA 3IAYA 4PQUA 1A5WA 1WSJA 4E3SA 4B9LA 3NGYA 1L5UA 1J53A 3AVFA 4CGGA 1LAVA 1UA0A 2HNDA 4CIFA 4PWDA 1YTUA 1S1WA 3DOKA 3RMBA 3PX4A 1TGOA 3KKRA 4DQQA 5I3UA 1S9GA 1W9HA 5EU7A 3V1QA 4CJWA 1JL2A 2HHXA 2P5OA 1QS4A 1EETA 4FM2A 4FJJA 3B6PA 1S5JA 3QO9A 4M45A 4DS4A 4K8ZA 1HYSA 2HHVA 2D0CA 3OYCA 4FW2A 3OYKA 2Y1IA 1QTMA 3BDPA 2KFNA 4PA1A 4BDPA 4OKJA 1NKBA 3AVMA 5C42A 4E7IA 2JLEA 2AJQA 5JS2A 3JSMA 1NJYA 3VQPA 5E41A 3HO1A 2OPSA 2NUBA 4CJ4A 1DLOA 1J9AA 1EKEA 3QIOA 1Z25A 4Z4GA 2OA8A 1RTHA 3LAKA 1T8EA 3KJVA 1BGXT 4OKEA 1S6QA 4DFPA 2IOCA 4CFAA 1TK5A 4OGEA 4CERA 1VSKA 3RWUA 4W5TA 1FKOA 1VSFA 4AH9A 4FK0A 2VWJA 3OYAA 1S1UA 1TK8A 3V1OA 4F2SA 1DTQA 4QOZB 1L3UA 1BQMA 1WAJA 2B5JA 3G10A 3V6DA 4KTWA 3K5OA 1UA1A 1X9SA 2YNHA 1ZYQA 4RW7A 2KTQA 4RW4A 2BGGA 1NK9A 1RILA 5CZ2A 1KFSA 1ASWA 5KRSA 3HXMA 1NKEA 1QE1A 4BE0A 4AHCA 4J2EA 4HVJA 1RBTA 3SV4A 4KAZA 3EY1A 2A1SA 5CY4A 3L3UA 4EZ9A 4ID5A 3FFIA 1RBSA 2X6SA 4DFMA 1TKDA 4JLHA 4CHYA 3NH1A 1X9MA 3VQCA 2OPRA 4O0IA 3AVJA 3K59A 3CM6A 4FXDA 4CHZA 2O4IA 4PUOA 1F21A 4KHSA 4DSLA 3K5MA 1TAUA 4CJPA 3C6TA 3KLIA 1TKTA 3OYJA 4ZTJA 1KRPA 4CIGA 4CF2A 4FJGA 4M3RA 2QXFA 3ZSQA 3ULDA 4Q5VA 2IDOA 2HHUA 1FKPA 3ZSYA 2G8KA 3KLFA 4RW6A 3T19A 1BHLA 3TAPA 4M3ZA 5C24A 2QKKA 3PX6A 3MEEA 3HVTA 3OS1A 3KK2A 2PZSA 4M3WA 4KHYA 4F8RA 4FJ7A 4CHQA 5I42A 3U3GA 4N5SA 3QEPA 1TK0A 5HROA 1CZBA 3H08A 1HMVA 3O4NA 3PUFA 4DTMA 1TKZA 1RDDA 4H4OA 3QEIA 4E7JA 3DLRA 4OPJA 1L3VA 3ASMA 3QESA 1QSLA 2HVHA 4KHUA 4FM0A 1SL2A 2FBTA 3L2WA 3ZSWA 2DY4A 4HCBA 1JXBA 1C0TA 3VQ6A 4CGIA 4ZHRA 3T1AA 1X9WA 4ELTA 1NOYA 1WSIA 2YHBA 1NK5A 4CJQA 3ZT3A 4CJVA 1VSHA 3D0PA 3VQ7A 1CLQA 3ZT2A 2HHTA 2DTUA 3SQ2A 2F8TA 1HNVA 1TAQA 4BDYA 4ZTFA 1VSMA 4O0JA 1ASVA 4YFUA 3QEXA 3HSTB 3V9ZA 3AO2A 5FROA 1YTAA 1RBVA 1GOAA 3K58A 1JLQA 2P5GA 4CEQA 2RN2A 3O3FA 4FK2A 1IO2A 1VRTA 5KTQA 5DK5A 4Q0BA 4I9LA 3LANA 4GW6A 3ZT1A 1N5YA 1RT2A 1LWFA 3V9SA 1BIUA 1FXXA 4LH4A 4C8NA 2HNYA 3LAMA 1C0MA 1S9EA 1NJZA 4ELVA 3MEDA 1Q9YA 3MXMA 4DLEA 3OYNA 3LWLA 1T05A 3VQ4A 3MEGA 1WLJA 2Z1HA 4CEDA 1BI4B 2Y1JA 3V4IA 2YHAA 1FK9A 4FJHA 3NF8A 4NCBA 3DYAA 4Z4FA 2DFFA 4E7LA 4CEFA 1C0UA 4DSJA 1HRHA 4FLVA 1SUQA 3AA3A 3ZSXA 4CFBA 4EZ6A 3OY9A 2G8UA 4B9TA 3OVNA 1RDAA 3CM5A 3WNFA 4AHTA 4W5NA 2BDPA 3SUQA 1ITGA 4N41A 4KI4A 1CXUA 2BE2A 2R7YA 4M41A 3O3HA 1NJXA 4CJKA 4C8KA 1LW2A 4FJXA 1RTJA 4RG8A 4BWJA 1QSYA 2OZSA 2F8SA 2VG6A 1RDBA 2IS3A 4EP5A 3CFRA 4FLXA 2HHSA 2X74A 4OLAA 3NGIA 3NDKA 3ALYA 3L2QA 1HQUA 4KTZA 4HHTA 2D0AA 4DTJA 4NCGA 4CJSA 2KZZA 1KFDA 3ZCMA 4DS5A 1U48A 1RBRA 3L3VA 3VN5A 5KGXA 3LZIA 1RT1A 5C25A 3OYDA 1WNSA 4Z4CA 1IKWA 3HL8A 3MAQA 1CXQA 1RNHA 4CEZA 4E89A 3CQ8A 3V9XA 4CEBA 1SL0A 4DTOA 1UOCA 3TR8A 3VA0A 4CEEA 1KVBA 4CHOA 4JS4A 4FW1A 4CF9A 4W5RA 3OS2A 3HM9A 1NK0A 1BCMA 3NHGA 4H8KA 1KVAA 1XHZA 2KQ2A 3SPZA 1WSHA 4O55A 1R0AA 1JLCA 1HJRA 3AV9A 2OYQA 4DSKA 4F2RA 4FCYA 3SZ2A 1IG9A 1A5VA 4DWIA 4Z4IA 4Y1DA 4OJRA 4WE1A 5K14A 1BCOA 2Q3SA 4E7KA 4IG3A 3TARA 3THVA 1NK7A 4YNQA 4TSXA 3KD1E 3OYEA 4LH5A 4DTNA 4CCHA 3AVGA 3AO3A 3EZ5A 4DU4A 2P51A 1NOZA 1RT4A 1B92A 2PY5A 3TAFA 4DFJA 4DF8A 4IBNA 2HB5A 3P1GA 1RT3A 4CJLA 3F73A 1RCHA 2HVIA 5KGWA 4FK4A 3RMDA 4GMJB 4NYFA 3SCXA 3TABA 4KB0A 2GV9A 2EHGA 4CE9A 4CJTA 4AILC 3AVCA 3AO1A 4CJFA 4F3OA 4DLGA 1ZBLA 4E1MA 4N56A 4AHSA 3V9UA 1ZBFA 4DTPA 3DLKA 3VQ9A 4DSFA 1S1TA 1L3SA 3K5LA 3VQAA 3PV8A 4CHPA 3KK1A 3LWMA 2O4GA 3HP6A 3CYMA 1VRUA 4G1QA 4DQIA 5J2NA 4ICLA 4EP4A 4Z4HA 4PY5A 4FJ9A 1YVUA 3F9KA 4CGJA 3PO5A 1DTTA 3ZT4A 4DU1A 4CGDA 2WOMA 3QETA 2IC3A 4K8XA 3HK2A 4CFCA 4KREA 4KRFA 2YNFA 1XI1A 4CF8A 3C94A 5HRNA 1NKCA 3M8SA 1SL1A 2ZQBA 3OJSA 1A5XA 3CFOA 1U47A 3PX0A 4B9NA 3SQ1A 2D0BA 2YKNA 3S3OA 1C1AA 1VSIA 2GUIA 3AO5A 4FLUA 1KLMA 4KHNA 3E01A 4FJNA 4CJ3A 2YKMA 3AVAA 3P5JA 1BIZA 2W42A 1GOCA 1GOBA 5J1EA 4DU3A 3QIPA 4CECA 4L8RB 1RDCA 1WAFA 4B08A 3TANA 1D9FA 2G8FA 1RTDA 1WSGA 1BI4A 4OKKA 1S1XA 5SWMA 3OJUA 2OPQA 2IGIA 2E4LA 3NH0A 1U4BA 1MU2A 4JRQA 3KD5E 2E6MA 4J2BA 4FVMA 4DTXA 4RW8A 3VQDA 2PYLA 3TI0A 3MXJA 3L2VA 5HBMA 4IFVA 5JS1A 3DI6A 4FLWA 4M3YA 2ATQA 4GVMA 3SQ4A 1NK6A 1ZBUA 4LSNA 4CJEA 4FLYA 1KSPA 3VA3A 5FRMA 4F3TA 3O4QA 4FJMA 4J2DA 3SUPA 2I5JA 1EXQA 1TL3A 4LY7A 4E1NA 1SKWA 1J5OA 2Z1IA 3U6FA 4C8OA 2HW3A 3I0RA 4QAGA 4FJ8A 1J54A 5FDLA 3DM2A 1C6VA 3L2RA 3AVBA 2XY6A 3JYTA 1W0HA 1UWBA 4NYNA 1SKRA 4B3OA 3C6UA 5HRPA 3ISNC 2G8VA 4CESA 4CGFA 3NH2A 4HUFA 1JXEA 3AA4A 4BACA 4KI6A 3IRXA 4BWMA 1NK8A 1HYZA 1IKXA 1TKXA 4N47A 3SQ0A 1IH7A 4DTUA 5HP1A 1QHTA 1VSJA 4IG0A 4C8MA 4CEOA 4OPKA 4FZZA 3OYBA 2HHQA 1VSLA 3LPUA 3NF9A 3ZT0A 1VSEA 3SUOA 1ZBIA 2QK9A 4DFKA 1QQCA 2OPPA 3SI6A 1O1WA 4O4GA 4CF1A 1U49A 2P1JA 3QEVA 1EP4A 4AHVA 1HNIA 3S3MA 2ITGA 4QCLA 4IDKA 1TL1A 1JLFA 2YNIA 1Y97A 3M8QA 3OYGA 3I0SA 2XRIA 3HPOA 3T3FA 3QEWA 4Z0UA 3HYFA 1LV5A 2KW4A 3NF6A 5CZ1A 2FBVA 2GBZA 2G8WA 3L8BA 3MXIA 4ELUA 1RT7A 1TV6A 4DSIA 1UAXA 2HNZA 4KO0A 4BE2A 3HP9A 1I39A 1JLEA 1RTIA 2ETJA 1LWCA 3IG1A 3SYZA 3C95A 3TAMA 4ID1A 4CK2A 3QERA 2OZMA 1JLBA 1WSFA 4H4MA 4M3UA 4FJLA 3LDSA 3AVNA 3QINA 4B9MA 3UIQA 4NCAA 5J2PA 2A1RA 2B4JA 4I2QA 4MQ3A 3D45A 3RRGA 1Z26A 3V1RA 3V81A 3VQ5A 3SNNA 4B9VA 3O3GA 4CHNA 4Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGZ A;  1XC9 A;  2VG7 A;  2FC0 A;  3AVI A;  3OYM A;  4DQR A;  4B9U A;  2D5R A;  3AVL A;  3AO4 A;  3NAE A;  1T03 A;  1S6P A;  3P83 D;  2HMI A;  3WNG A;  1JL1 A;  4AHU A;  4CJ5 A;  4DF4 A;  3VQQ A;  4C8L A;  3ZSO A;  4I2P A;  2QKB A;  3HPG A;  4E19 A;  1BIS A;  5SZT A;  1G15 A;  3TAQ A;  5J2M A;  1EX4 A;  4DTS A;  2RPI A;  1RT5 A;  3NFA A;  4CK1 A;  4E0D A;  1NJW A;  1IKV A;  3K2P A;  1RBU A;  4DMN A;  3OS0 A;  3BGR A;  4W5O A;  2XY7 A;  1VSD A;  3VQB A;  1Q9X A;  3OYL A;  3DLG A;  3KTQ A;  3AVK A;  1TVR A;  2BAN A;  5HLF A;  3TAG A;  3RRH A;  4HCC A;  1RT6 A;  2XHB A;  4CJU A;  4CIE A;  3K5N A;  2HHW A;  4FJ5 A;  3LP2 A;  1L3T A;  1D9D A;  1B9D A;  3CG7 A;  2B6A A;  3SJJ A;  1CZ9 A;  3QNO A;  4I7F A;  2VWK A;  3QNN A;  1I3A A;  2ZE2 A;  5HRS A;  3NCI A;  4J2A A;  1JKH A;  4M42 A;  2VG5 A;  2XY8 A;  3L2U A;  1IKY A;  1JLA A;  3ZSR A;  1BL3 A;  4HTU A;  4JS5 A;  4OVL A;  4FLZ A;  2YV0 X;  2Z1G A;  5FRN A;  4O44 A;  1KTQ A;  1REV A;  3LP0 A;  3AVH A;  4RW9 A;  1ASU A;  3KLG A;  4FLT A;  3LAL A;  2XO7 A;  3TWH A;  2X78 A;  3DRP A;  5HRR A;  3AA2 A;  3OYH A;  4FM1 A;  3NF7 A;  1KLN A;  4N76 A;  3M8P A;  4FJK A;  3NE6 A;  4AHR A;  1JLG A;  3LP3 A;  3DLH A;  3LZJ A;  1U45 A;  3TAE A;  1S1V A;  5CYQ A;  1D5A A;  4OLB A;  4FZX C;  3DRS A;  3RR7 A;  3HT3 A;  4KFB A;  1NK4 A;  2RF2 A;  1LW0 A;  4E7H A;  4OGC A;  3DOL A;  3U3Y A;  2FBX A;  2WON A;  3DRR A;  3VQ8 A;  2YNG A;  1SKS A;  3PY8 A;  3ITH A;  4KV8 A;  4XIU A;  1QSS A;  1WSE A;  2G8H A;  5KRT A;  1T7P A;  4I9Q A;  3M8R A;  2DFH A;  3B6O A;  4BE1 A;  3WNH A;  4DSE A;  4BDZ A;  4UQG A;  4FZY A;  2F96 A;  3OYI A;  2PYJ A;  3AA5 X;  2JGU A;  4FJI A;  1HPZ A;  3K57 A;  4Z4E A;  3KK3 A;  2IAJ A;  2LSN A;  3VQE A;  1C1C A;  1D8Y A;  4KTQ A;  4O5B A;  1VK0 A;  4CK3 A;  3EYZ A;  3KKS A;  2KFZ A;  4IKF A;  4MFB A;  3DMJ A;  1XWL A;  3S3N A;  4CJR A;  3SUN A;  3RMA A;  3LPT A;  3S9H A;  4M3X A;  1ZBH A;  4CEA A;  3CFP A;  1Q8I A;  1HQE A;  4HUG A;  1KVC A;  1LAW A;  2RKI A;  4IFY A;  4LD0 A;  3KIO A;  2EX3 A;  3HPH A;  1XHX A;  2FBY A;  4B8A B;  4CF0 A;  2KZM A;  3ZSV A;  5J2Q A;  1LWE A;  3HVR A;  1SV5 A;  3KLH A;  4KPY A;  3WNE A;  1WN7 A;  2E6L A;  3RTV A;  4B9S A;  4FYD A;  2ZD1 A;  2X6N A;  4DQP A;  4B8C A;  3HJF A;  3RMC A;  4HUE A;  5D3G A;  4M3T A;  1U04 A;  2G8I A;  1B9F A;  2Z1J A;  3DLE A;  4LSL A;  3ZSZ A;  4CFD A;  3SV3 A;  4F4K A;  1YT3 A;  3MEC A;  2XY5 A;  5DMR A;  3NBP A;  4JRP A;  3DLB A;  3LP1 A;  4W5Q A;  4KKO A;  1C1B A;  4DTR A;  1KCF A;  3I8D A;  2DFE A;  5KI6 A;  3SPY A;  3V9W A;  3PO4 A;  1X1P A;  4KB1 A;  4KHW A;  1K6Y A;  3IS9 A;  4DQS A;  3QLH A;  3G0Z A;  3A2F A;  4DG1 A;  5T7B A;  1BQN A;  1HYV A;  4CGH A;  3RR8 A;  3KLE A;  5CYM A;  1N6Q A;  4R5P A;  4KHQ A;  3OYF A;  3IAY A;  4PQU A;  1A5W A;  1WSJ A;  4E3S A;  4B9L A;  3NGY A;  1L5U A;  1J53 A;  3AVF A;  4CGG A;  1LAV A;  1UA0 A;  2HND A;  4CIF A;  4PWD A;  1YTU A;  1S1W A;  3DOK A;  3RMB A;  3PX4 A;  1TGO A;  3KKR A;  4DQQ A;  5I3U A;  1S9G A;  1W9H A;  5EU7 A;  3V1Q A;  4CJW A;  1JL2 A;  2HHX A;  2P5O A;  1QS4 A;  1EET A;  4FM2 A;  4FJJ A;  3B6P A;  1S5J A;  3QO9 A;  4M45 A;  4DS4 A;  4K8Z A;  1HYS A;  2HHV A;  2D0C A;  3OYC A;  4FW2 A;  3OYK A;  2Y1I A;  1QTM A;  3BDP A;  2KFN A;  4PA1 A;  4BDP A;  4OKJ A;  1NKB A;  3AVM A;  5C42 A;  4E7I A;  2JLE A;  2AJQ A;  5JS2 A;  3JSM A;  1NJY A;  3VQP A;  5E41 A;  3HO1 A;  2OPS A;  2NUB A;  4CJ4 A;  1DLO A;  1J9A A;  1EKE A;  3QIO A;  1Z25 A;  4Z4G A;  2OA8 A;  1RTH A;  3LAK A;  1T8E A;  3KJV A;  1BGX T;  4OKE A;  1S6Q A;  4DFP A;  2IOC A;  4CFA A;  1TK5 A;  4OGE A;  4CER A;  1VSK A;  3RWU A;  4W5T A;  1FKO A;  1VSF A;  4AH9 A;  4FK0 A;  2VWJ A;  3OYA A;  1S1U A;  1TK8 A;  3V1O A;  4F2S A;  1DTQ A;  4QOZ B;  1L3U A;  1BQM A;  1WAJ A;  2B5J A;  3G10 A;  3V6D A;  4KTW A;  3K5O A;  1UA1 A;  1X9S A;  2YNH A;  1ZYQ A;  4RW7 A;  2KTQ A;  4RW4 A;  2BGG A;  1NK9 A;  1RIL A;  5CZ2 A;  1KFS A;  1ASW A;  5KRS A;  3HXM A;  1NKE A;  1QE1 A;  4BE0 A;  4AHC A;  4J2E A;  4HVJ A;  1RBT A;  3SV4 A;  4KAZ A;  3EY1 A;  2A1S A;  5CY4 A;  3L3U A;  4EZ9 A;  4ID5 A;  3FFI A;  1RBS A;  2X6S A;  4DFM A;  1TKD A;  4JLH A;  4CHY A;  3NH1 A;  1X9M A;  3VQC A;  2OPR A;  4O0I A;  3AVJ A;  3K59 A;  3CM6 A;  4FXD A;  4CHZ A;  2O4I A;  4PUO A;  1F21 A;  4KHS A;  4DSL A;  3K5M A;  1TAU A;  4CJP A;  3C6T A;  3KLI A;  1TKT A;  3OYJ A;  4ZTJ A;  1KRP A;  4CIG A;  4CF2 A;  4FJG A;  4M3R A;  2QXF A;  3ZSQ A;  3ULD A;  4Q5V A;  2IDO A;  2HHU A;  1FKP A;  3ZSY A;  2G8K A;  3KLF A;  4RW6 A;  3T19 A;  1BHL A;  3TAP A;  4M3Z A;  5C24 A;  2QKK A;  3PX6 A;  3MEE A;  3HVT A;  3OS1 A;  3KK2 A;  2PZS A;  4M3W A;  4KHY A;  4F8R A;  4FJ7 A;  4CHQ A;  5I42 A;  3U3G A;  4N5S A;  3QEP A;  1TK0 A;  5HRO A;  1CZB A;  3H08 A;  1HMV A;  3O4N A;  3PUF A;  4DTM A;  1TKZ A;  1RDD A;  4H4O A;  3QEI A;  4E7J A;  3DLR A;  4OPJ A;  1L3V A;  3ASM A;  3QES A;  1QSL A;  2HVH A;  4KHU A;  4FM0 A;  1SL2 A;  2FBT A;  3L2W A;  3ZSW A;  2DY4 A;  4HCB A;  1JXB A;  1C0T A;  3VQ6 A;  4CGI A;  4ZHR A;  3T1A A;  1X9W A;  4ELT A;  1NOY A;  1WSI A;  2YHB A;  1NK5 A;  4CJQ A;  3ZT3 A;  4CJV A;  1VSH A;  3D0P A;  3VQ7 A;  1CLQ A;  3ZT2 A;  2HHT A;  2DTU A;  3SQ2 A;  2F8T A;  1HNV A;  1TAQ A;  4BDY A;  4ZTF A;  1VSM A;  4O0J A;  1ASV A;  4YFU A;  3QEX A;  3HST B;  3V9Z A;  3AO2 A;  5FRO A;  1YTA A;  1RBV A;  1GOA A;  3K58 A;  1JLQ A;  2P5G A;  4CEQ A;  2RN2 A;  3O3F A;  4FK2 A;  1IO2 A;  1VRT A;  5KTQ A;  5DK5 A;  4Q0B A;  4I9L A;  3LAN A;  4GW6 A;  3ZT1 A;  1N5Y A;  1RT2 A;  1LWF A;  3V9S A;  1BIU A;  1FXX A;  4LH4 A;  4C8N A;  2HNY A;  3LAM A;  1C0M A;  1S9E A;  1NJZ A;  4ELV A;  3MED A;  1Q9Y A;  3MXM A;  4DLE A;  3OYN A;  3LWL A;  1T05 A;  3VQ4 A;  3MEG A;  1WLJ A;  2Z1H A;  4CED A;  1BI4 B;  2Y1J A;  3V4I A;  2YHA A;  1FK9 A;  4FJH A;  3NF8 A;  4NCB A;  3DYA A;  4Z4F A;  2DFF A;  4E7L A;  4CEF A;  1C0U A;  4DSJ A;  1HRH A;  4FLV A;  1SUQ A;  3AA3 A;  3ZSX A;  4CFB A;  4EZ6 A;  3OY9 A;  2G8U A;  4B9T A;  3OVN A;  1RDA A;  3CM5 A;  3WNF A;  4AHT A;  4W5N A;  2BDP A;  3SUQ A;  1ITG A;  4N41 A;  4KI4 A;  1CXU A;  2BE2 A;  2R7Y A;  4M41 A;  3O3H A;  1NJX A;  4CJK A;  4C8K A;  1LW2 A;  4FJX A;  1RTJ A;  4RG8 A;  4BWJ A;  1QSY A;  2OZS A;  2F8S A;  2VG6 A;  1RDB A;  2IS3 A;  4EP5 A;  3CFR A;  4FLX A;  2HHS A;  2X74 A;  4OLA A;  3NGI A;  3NDK A;  3ALY A;  3L2Q A;  1HQU A;  4KTZ A;  4HHT A;  2D0A A;  4DTJ A;  4NCG A;  4CJS A;  2KZZ A;  1KFD A;  3ZCM A;  4DS5 A;  1U48 A;  1RBR A;  3L3V A;  3VN5 A;  5KGX A;  3LZI A;  1RT1 A;  5C25 A;  3OYD A;  1WNS A;  4Z4C A;  1IKW A;  3HL8 A;  3MAQ A;  1CXQ A;  1RNH A;  4CEZ A;  4E89 A;  3CQ8 A;  3V9X A;  4CEB A;  1SL0 A;  4DTO A;  1UOC A;  3TR8 A;  3VA0 A;  4CEE A;  1KVB A;  4CHO A;  4JS4 A;  4FW1 A;  4CF9 A;  4W5R A;  3OS2 A;  3HM9 A;  1NK0 A;  1BCM A;  3NHG A;  4H8K A;  1KVA A;  1XHZ A;  2KQ2 A;  3SPZ A;  1WSH A;  4O55 A;  1R0A A;  1JLC A;  1HJR A;  3AV9 A;  2OYQ A;  4DSK A;  4F2R A;  4FCY A;  3SZ2 A;  1IG9 A;  1A5V A;  4DWI A;  4Z4I A;  4Y1D A;  4OJR A;  4WE1 A;  5K14 A;  1BCO A;  2Q3S A;  4E7K A;  4IG3 A;  3TAR A;  3THV A;  1NK7 A;  4YNQ A;  4TSX A;  3KD1 E;  3OYE A;  4LH5 A;  4DTN A;  4CCH A;  3AVG A;  3AO3 A;  3EZ5 A;  4DU4 A;  2P51 A;  1NOZ A;  1RT4 A;  1B92 A;  2PY5 A;  3TAF A;  4DFJ A;  4DF8 A;  4IBN A;  2HB5 A;  3P1G A;  1RT3 A;  4CJL A;  3F73 A;  1RCH A;  2HVI A;  5KGW A;  4FK4 A;  3RMD A;  4GMJ B;  4NYF A;  3SCX A;  3TAB A;  4KB0 A;  2GV9 A;  2EHG A;  4CE9 A;  4CJT A;  4AIL C;  3AVC A;  3AO1 A;  4CJF A;  4F3O A;  4DLG A;  1ZBL A;  4E1M A;  4N56 A;  4AHS A;  3V9U A;  1ZBF A;  4DTP A;  3DLK A;  3VQ9 A;  4DSF A;  1S1T A;  1L3S A;  3K5L A;  3VQA A;  3PV8 A;  4CHP A;  3KK1 A;  3LWM A;  2O4G A;  3HP6 A;  3CYM A;  1VRU A;  4G1Q A;  4DQI A;  5J2N A;  4ICL A;  4EP4 A;  4Z4H A;  4PY5 A;  4FJ9 A;  1YVU A;  3F9K A;  4CGJ A;  3PO5 A;  1DTT A;  3ZT4 A;  4DU1 A;  4CGD A;  2WOM A;  3QET A;  2IC3 A;  4K8X A;  3HK2 A;  4CFC A;  4KRE A;  4KRF A;  2YNF A;  1XI1 A;  4CF8 A;  3C94 A;  5HRN A;  1NKC A;  3M8S A;  1SL1 A;  2ZQB A;  3OJS A;  1A5X A;  3CFO A;  1U47 A;  3PX0 A;  4B9N A;  3SQ1 A;  2D0B A;  2YKN A;  3S3O A;  1C1A A;  1VSI A;  2GUI A;  3AO5 A;  4FLU A;  1KLM A;  4KHN A;  3E01 A;  4FJN A;  4CJ3 A;  2YKM A;  3AVA A;  3P5J A;  1BIZ A;  2W42 A;  1GOC A;  1GOB A;  5J1E A;  4DU3 A;  3QIP A;  4CEC A;  4L8R B;  1RDC A;  1WAF A;  4B08 A;  3TAN A;  1D9F A;  2G8F A;  1RTD A;  1WSG A;  1BI4 A;  4OKK A;  1S1X A;  5SWM A;  3OJU A;  2OPQ A;  2IGI A;  2E4L A;  3NH0 A;  1U4B A;  1MU2 A;  4JRQ A;  3KD5 E;  2E6M A;  4J2B A;  4FVM A;  4DTX A;  4RW8 A;  3VQD A;  2PYL A;  3TI0 A;  3MXJ A;  3L2V A;  5HBM A;  4IFV A;  5JS1 A;  3DI6 A;  4FLW A;  4M3Y A;  2ATQ A;  4GVM A;  3SQ4 A;  1NK6 A;  1ZBU A;  4LSN A;  4CJE A;  4FLY A;  1KSP A;  3VA3 A;  5FRM A;  4F3T A;  3O4Q A;  4FJM A;  4J2D A;  3SUP A;  2I5J A;  1EXQ A;  1TL3 A;  4LY7 A;  4E1N A;  1SKW A;  1J5O A;  2Z1I A;  3U6F A;  4C8O A;  2HW3 A;  3I0R A;  4QAG A;  4FJ8 A;  1J54 A;  5FDL A;  3DM2 A;  1C6V A;  3L2R A;  3AVB A;  2XY6 A;  3JYT A;  1W0H A;  1UWB A;  4NYN A;  1SKR A;  4B3O A;  3C6U A;  5HRP A;  3ISN C;  2G8V A;  4CES A;  4CGF A;  3NH2 A;  4HUF A;  1JXE A;  3AA4 A;  4BAC A;  4KI6 A;  3IRX A;  4BWM A;  1NK8 A;  1HYZ A;  1IKX A;  1TKX A;  4N47 A;  3SQ0 A;  1IH7 A;  4DTU A;  5HP1 A;  1QHT A;  1VSJ A;  4IG0 A;  4C8M A;  4CEO A;  4OPK A;  4FZZ A;  3OYB A;  2HHQ A;  1VSL A;  3LPU A;  3NF9 A;  3ZT0 A;  1VSE A;  3SUO A;  1ZBI A;  2QK9 A;  4DFK A;  1QQC A;  2OPP A;  3SI6 A;  1O1W A;  4O4G A;  4CF1 A;  1U49 A;  2P1J A;  3QEV A;  1EP4 A;  4AHV A;  1HNI A;  3S3M A;  2ITG A;  4QCL A;  4IDK A;  1TL1 A;  1JLF A;  2YNI A;  1Y97 A;  3M8Q A;  3OYG A;  3I0S A;  2XRI A;  3HPO A;  3T3F A;  3QEW A;  4Z0U A;  3HYF A;  1LV5 A;  2KW4 A;  3NF6 A;  5CZ1 A;  2FBV A;  2GBZ A;  2G8W A;  3L8B A;  3MXI A;  4ELU A;  1RT7 A;  1TV6 A;  4DSI A;  1UAX A;  2HNZ A;  4KO0 A;  4BE2 A;  3HP9 A;  1I39 A;  1JLE A;  1RTI A;  2ETJ A;  1LWC A;  3IG1 A;  3SYZ A;  3C95 A;  3TAM A;  4ID1 A;  4CK2 A;  3QER A;  2OZM A;  1JLB A;  1WSF A;  4H4M A;  4M3U A;  4FJL A;  3LDS A;  3AVN A;  3QIN A;  4B9M A;  3UIQ A;  4NCA A;  5J2P A;  2A1R A;  2B4J A;  4I2Q A;  4MQ3 A;  3D45 A;  3RRG A;  1Z26 A;  3V1R A;  3V81 A;  3VQ5 A;  3SNN A;  4B9V A;  3O3G A;  4CHN A;  4Y1C A; 
#chains in the Genus database with same CATH topology
 3U9Z A;  3VGK A;  2VG7 A;  1VQ6 N;  1QHA A;  4JI6 K;  4B9U A;  3CC2 N;  1XQS C;  1S6P A;  3WNG A;  4DF4 A;  1RGI A;  4CJ5 A;  3C6A A;  3ZSO A;  2KLA A;  4O5F A;  1BIS A;  1EX4 A;  2RPI A;  1OH8 A;  3N4Q A;  4E0D A;  1NJW A;  1IKV A;  5B8H A;  2QWO A;  3CCQ N;  1VSD A;  2D0P A;  3CCV N;  3KTQ A;  2P9P A;  4HCC A;  3TTC A;  5GIN A;  3CJ9 A;  3ULE A;  3UKU A;  1L3T A;  2ZM6 K;  4I7F A;  3QNN A;  4OO1 J;  1I3A A;  2ZE2 A;  4IZ9 A;  4J2A A;  3B8A X;  1JKH A;  4KBO A;  4M42 A;  2VG5 A;  1IV0 A;  2XY8 A;  1JLA A;  2NRX A;  3ZSR A;  3MDQ A;  2YV0 X;  3AAR A;  1CZA N;  3LP0 A;  3D2F B;  2NRT A;  4B3S K;  3U8X A;  3AA2 A;  2IVO A;  5BR9 A;  5IWA K;  2O8B A;  3DRS A;  2WC9 A;  3LL3 A;  4KFB A;  3NVK A;  3OHR A;  1NGC A;  3U3Y A;  2FBX A;  4FWR A;  3DRR A;  1E4F T;  4KV8 A;  3D2E B;  1Y64 A;  3ZEU A;  3B6O A;  3WNH A;  4FZY A;  1HPZ A;  2LSN A;  4BRI A;  1JCF A;  3VEO A;  4BC5 A;  4KTQ A;  4O5B A;  3KKS A;  2KFZ A;  2F7T A;  1XWL A;  2P9U B;  2OCE A;  3P39 A;  4JHD B;  3LPT A;  4M3X A;  5BRE A;  3CFP A;  2O8F A;  1S3X A;  1KVC A;  4BRL A;  2EX3 A;  2ZGY A;  4CF0 A;  3ZSV A;  2QI2 A;  1LWE A;  1SV5 A;  2KKZ A;  3KLH A;  3WXK A;  1WN7 A;  1HPM A;  4XH1 A;  4GV3 A;  2ZD1 A;  3H6E A;  4B8C A;  1HJO A;  2G8I A;  4LSL A;  3CQY A;  3ZSZ A;  2IIR A;  2OTJ N;  3MEC A;  4W5Q A;  4KKO A;  1C1B A;  3BF1 A;  3VEY A;  1X1P A;  1K6Y A;  4JKG A;  4DG1 A;  5AFU A;  4CGH A;  3A5N C;  4FWN A;  1A5W A;  1WSJ A;  4B9L A;  1XC3 A;  4CZM A;  3LDP A;  4CIF A;  1YTU A;  3DOK A;  5AQF A;  5I3U A;  1MDU B;  2HHT A;  2NRH A;  1EET A;  1S5J A;  4K8Z A;  2HHV A;  1T6C A;  4DS4 A;  2KFN A;  2PBD A;  1Z05 A;  4BDP A;  5C42 A;  1GLE G;  2JLE A;  5JS2 A;  3JSM A;  1NJY A;  5E41 A;  2NUB A;  4Z4G A;  1Z25 A;  1WBD A;  1T8E A;  4OKE A;  1S6Q A;  4DV3 K;  2QWM A;  5DM6 L;  2IOC A;  3O9S A;  4CFA A;  1TK5 A;  4OGE A;  4CER A;  3RWU A;  1VSF A;  1S1U A;  4FWL A;  4F2S A;  4FOI A;  3GBT A;  4QOZ B;  3H46 O;  4DQ8 A;  2B5J A;  1N34 K;  3FR0 A;  4K0K K;  2YNH A;  3O80 A;  3HOS A;  3O1W A;  2BGG A;  4PL8 A;  1NKE A;  5ADX H;  1KQS M;  4HVJ A;  1RBT A;  5JLH A;  3SV4 A;  2A1S A;  3GOI A;  5CY4 A;  5M1F A;  4DFM A;  2W6K A;  4JNE A;  4CI6 A;  3G4S N;  1BA1 A;  3I55 N;  4KHS A;  4DSL A;  1TAU A;  3C6T A;  3KLI A;  2ASM A;  4CF2 A;  5AQG A;  3VF4 A;  3ATU A;  4Q5V A;  4LFB K;  3KLF A;  3MCP A;  1HNX K;  3RSE A;  4C1N I;  3TU5 A;  3PX6 A;  3MEE A;  3KK2 A;  3OS1 A;  4F8R A;  3TSU A;  1T3V A;  4FO0 A;  5AQP A;  1KD1 O;  1HMV A;  4DTM A;  3CI5 A;  1TKZ A;  4H4O A;  4CZF A;  4EHT A;  4E7J A;  1K73 O;  3J7A P;  3QES A;  2NRR A;  3HSC A;  3ZSW A;  2Q0U A;  4ZHR A;  2UXB K;  3C7N B;  4ELT A;  5AQV A;  1WSI A;  4CJQ A;  1WOQ A;  3RSE B;  3D0P A;  1S72 N;  2DTU A;  3SQ2 A;  3QEX A;  1ASV A;  2O8E B;  3HST B;  4PKH A;  5AQJ A;  2E88 A;  5LMN K;  3GG4 A;  3AGK A;  5KTQ A;  2WTU A;  4Q0B A;  1EQY A;  4EHU A;  3LAN A;  4GW6 A;  4X64 K;  1RT2 A;  4JKA A;  4YDU A;  1FXX A;  3R8E A;  4C8N A;  5BRF A;  1E3M A;  1C0M A;  1NJZ A;  3OYN A;  4DV1 K;  3MEG A;  4BC4 A;  3BY5 A;  4CED A;  3V4I A;  3THW B;  3HM8 A;  3NF8 A;  4MDB A;  4Z4F A;  1HR0 K;  2QA4 N;  1C0U A;  4DSJ A;  2GWK A;  1SUQ A;  4EZ6 A;  5AZJ A;  5IT9 O;  4B9T A;  1RDA A;  4BRO A;  1QVG M;  3HBT A;  3THX B;  4N41 A;  4H0Y B;  2R7Y A;  4M41 A;  3GL1 A;  1VHX A;  4CJK A;  1LW2 A;  2P9N A;  4FJX A;  2V7Z A;  4RG8 A;  1QSY A;  4YOY A;  2HHS A;  2X74 A;  4OLA A;  4BRQ A;  3L2Q A;  4KTZ A;  4HHT A;  1GLD G;  3VF2 A;  2KZZ A;  3ZCM A;  1IBL K;  1RBR A;  3VN5 A;  3MX5 A;  3OYD A;  4Z4C A;  3ZLJ A;  4E89 A;  3V9X A;  4CEB A;  2FF3 B;  2E8A A;  4DTO A;  4WQ4 C;  3VA0 A;  4JS4 A;  4CF9 A;  4E1J A;  3HM9 A;  1JCE A;  2UXD K;  1VQM N;  1VQL N;  1GLJ O;  1XHZ A;  2UXC K;  3SZ2 A;  1W7A A;  1IG9 A;  2H3G X;  4JK9 A;  1BCO A;  2Q3S A;  2NZT A;  4IG3 A;  3TAR A;  3THV A;  4R79 A;  2P9S B;  4CCH A;  3AVG A;  4DU4 A;  2NNW A;  3OBW A;  3EZ5 A;  5LL6 Z;  2NRW A;  3TAF A;  4BG9 A;  4IBN A;  5C2D A;  4FWP A;  4LF9 K;  1RCH A;  5KGW A;  3RMD A;  5KQ8 A;  3DXK A;  5BRD A;  3SCX A;  2GV9 A;  3AVC A;  1ZBL A;  3DLK A;  3EKU A;  3U4L A;  1L3S A;  4CHP A;  4MO4 A;  2O4G A;  3CYM A;  3MN7 A;  5J2N A;  4Z4H A;  5M1O A;  1YVU A;  3F9K A;  4K8X A;  3HK2 A;  1P8Z A;  5HRN A;  3C94 A;  1NKC A;  1V4T A;  1NM1 A;  3PX0 A;  1NJI O;  4BRC A;  3S3O A;  1N8R O;  4KHN A;  3E01 A;  5AR0 A;  4CJ3 A;  1WAF A;  2Q36 A;  3QML A;  1RTD A;  3FZM A;  1BI4 A;  2OPQ A;  4JRQ A;  4DHY A;  4J2B A;  5C12 A;  4FVM A;  4A61 A;  1Q81 O;  3MXJ A;  4JV5 K;  1QQN A;  4BY9 C;  4YOV A;  1VQP N;  2ATQ A;  4GVM A;  4FLY A;  2A5X A;  1W2B M;  1EXQ A;  4CBW A;  1SKW A;  3QIC A;  3U6F A;  3NVM A;  2A41 A;  3UKR B;  5FDL A;  3OBY A;  5GAD P;  3AVB A;  1W0H A;  4FSV A;  1D4X A;  1HYZ A;  5ELZ A;  3A0I X;  3SQ0 A;  4F2R A;  4DTU A;  4JI0 K;  1OVQ A;  1VSJ A;  1SAZ A;  2HHQ A;  3LPU A;  1DEJ A;  1IJJ A;  2ZJR L;  4K41 A;  2QK9 A;  4DFK A;  3CPE A;  4QS7 A;  3CHW A;  4CZG A;  4O4G A;  4AHV A;  3FZH A;  2ITG A;  3WQT A;  4I6M A;  3ZET B;  1TL1 A;  4HTL A;  3HPO A;  5MLC Q;  2XRI A;  4DR6 K;  3HYF A;  4LF8 K;  3E66 A;  2FBV A;  2GBZ A;  3L8B A;  3T1Y K;  1RT7 A;  4DSI A;  2HNZ A;  1NGI A;  3AGR A;  1YJ9 N;  4BE2 A;  1I39 A;  1RTI A;  3IG1 A;  3C95 A;  1V4S A;  1BU6 O;  2OZM A;  1WSF A;  1SZ2 A;  2O8D A;  5C2F A;  3UIQ A;  4A5A A;  4NCA A;  4DKW A;  2A1R A;  4I2Q A;  1KC8 O;  4X66 K;  3WQU A;  3VQ5 A;  3O3G A;  4Y1C A;  3PSI A;  3NGZ A;  3O5B A;  3OYM A;  1SS6 A;  5LY3 A;  3AVL A;  3AO4 A;  3P83 D;  4H0X B;  4IWV A;  4BQZ A;  3PIO L;  4C8L A;  1Z6R A;  3HPG A;  3EEQ A;  4BRM A;  4DTS A;  3QB0 A;  3NFA A;  3K2P A;  1YIJ N;  4DMN A;  3BGR A;  4W5O A;  2XY7 A;  3VQB A;  1Q9X A;  5C15 A;  4CBX A;  1KAY A;  3IUC A;  4JD2 B;  2XHB A;  1YHQ N;  5JVG L;  4CJU A;  4CIE A;  4FJ5 A;  1K8K A;  2GEL A;  1EO1 A;  1B9D A;  1IBM K;  1FJG K;  1CZ9 A;  4DR4 K;  1DKG D;  3NCI A;  1BL3 A;  1WUA A;  2YJF A;  1C0G A;  2Z1G A;  5FRN A;  4O44 A;  1REV A;  1ASU A;  4FLT A;  5CHI A;  4XH4 A;  5HRR A;  4N76 A;  3M8P A;  1JLG A;  1TUU A;  3TSQ A;  3LZJ A;  3TAE A;  1S1V A;  3U9D A;  4OGC A;  3HTV A;  1XUP O;  1OKJ A;  3DOL A;  3VEZ A;  2WON A;  1SKS A;  2F9T A;  1T6D A;  1WSE A;  2VYP A;  3M8R A;  2DFH A;  5AQM A;  4DSE A;  4UQG A;  2GUP A;  2F96 A;  4FJI A;  4Z4E A;  5CE3 A;  3ENB A;  5H1S Q;  2GWJ A;  4BRG A;  3EYZ A;  4PL7 A;  4WYB A;  4IOA L;  3S9H A;  4CEA A;  3MK6 A;  2RKI A;  4B8A B;  3O1B A;  4PKG A;  4IOX A;  4B9S A;  4H0P A;  4FYD A;  3HJF A;  3C0B A;  4HUE A;  1M1K O;  4U67 L;  1U04 A;  4LC9 B;  2Z1J A;  3CCS N;  1MWM A;  3I8D A;  2DFE A;  5KI6 A;  1YI2 N;  3L4Q A;  5FPE A;  3IS9 A;  1ZBS A;  1ZXO A;  3A2F A;  5T7B A;  4G9Z A;  3VEW A;  3RR8 A;  4YDU C;  4R5P A;  3AAQ A;  2QWL A;  1L5U A;  1J53 A;  1LAV A;  4PWD A;  2A3Z A;  3KKR A;  4DQQ A;  1W9H A;  2BUP A;  4BQL A;  3V1Q A;  4CJW A;  1JL2 A;  1QQM A;  3O9Q A;  4FM2 A;  5AQK A;  3B6P A;  1HYS A;  1HKG A;  2FXU A;  3OYK A;  3BDP A;  4FWQ A;  1QZ6 A;  3AVM A;  3TSP A;  2QXL A;  1O13 A;  2P9I B;  3VQP A;  5AQU A;  3WXL A;  5E84 A;  1BGX T;  4EIA A;  1RFQ A;  2W6L A;  3JAM O;  3THY B;  3H3N O;  4AH9 A;  4FK0 A;  2VWJ A;  3OYA A;  2HST A;  4OPA A;  3V1O A;  1TK8 A;  4GNI A;  1L3U A;  5LJW A;  4ILH A;  4NLB A;  4KTW A;  1X9S A;  3D2F A;  1ZYQ A;  4RW4 A;  1RIL A;  2HMP A;  1KFS A;  5KRS A;  3HXM A;  1QE1 A;  4J2E A;  4BRK A;  1U2V B;  3EY1 A;  3L3U A;  4EZ9 A;  4OX9 K;  3I33 A;  1RBS A;  5AJ3 K;  1TKD A;  3D2E A;  4CHY A;  4JI4 K;  5AQZ A;  2OPR A;  4O0I A;  3AVJ A;  3K59 A;  2AA4 A;  5EVZ A;  2O4I A;  3SAH A;  1F21 A;  3KVG A;  1VAZ A;  2E20 A;  2A40 A;  1KRP A;  4CIG A;  1GLF O;  2Q2R A;  4B1Z A;  2IDO A;  3ZSY A;  2P9U A;  3R1X A;  4JHD A;  3T19 A;  4M3Z A;  3J8A A;  4ISF A;  4C23 A;  3HVT A;  1Q82 O;  2GX9 A;  4FJ7 A;  5I42 A;  3U3G A;  4N5S A;  1CZB A;  3H08 A;  3O4N A;  1VQK N;  2V52 B;  1YAG A;  3SMS A;  1QSL A;  5AQN A;  1SQK A;  5AQS A;  3L2W A;  4JEP A;  4JKC A;  4IOC L;  1NGD A;  3T1A A;  1OVY A;  2CH5 A;  1NK5 A;  3LM9 A;  1CLQ A;  3ZT2 A;  5A2Q O;  5JLF A;  1JCG A;  1HNV A;  1BO5 O;  1TAQ A;  4B1U B;  3QBX A;  3V9Z A;  4BGA A;  3MX2 A;  4JI8 K;  3K58 A;  3CCE N;  1JLQ A;  4FK2 A;  1IO2 A;  1VRT A;  5FPM A;  1N5Y A;  1HKC A;  4ELV A;  4H5V A;  3UB5 A;  3MED A;  4PHT X;  4DLE A;  4H0V B;  1TYQ B;  3IKM A;  3VQ4 A;  5KPR A;  2YHA A;  1VQ8 N;  1FK9 A;  3DYA A;  3WXM B;  4JI7 K;  1MA9 B;  3LDN A;  1RDW X;  2G8U A;  4AHT A;  3BUZ B;  3F5T A;  3SUQ A;  3BF3 A;  2UUA K;  1CXU A;  1W97 L;  4C8K A;  2FSK A;  3O9U A;  1RTJ A;  2VG6 A;  1RDB A;  4EP5 A;  3CFR A;  3SBT A;  4CW7 B;  5FLX O;  2D0A A;  4NCG A;  3LZI A;  1N32 K;  1RT1 A;  5C25 A;  3HL8 A;  2O8C B;  1RNH A;  3HI0 A;  4CEZ A;  1SL0 A;  4DV4 K;  4W5R A;  3OS2 A;  2A42 A;  4FPB A;  3VTI A;  4H8K A;  1KVA A;  5AQO A;  1WSH A;  3W3D A;  3PIP L;  5BPN A;  2VQF K;  3M3Z A;  4DWI A;  4Z4I A;  4WE1 A;  4BR7 A;  4E7K A;  1WB9 A;  1Q18 A;  1GLL O;  3KD1 E;  2HBL A;  3AO3 A;  1RT4 A;  2PY5 A;  1B92 A;  4DFJ A;  3F73 A;  2HVI A;  4IXC A;  4NYF A;  5AQQ A;  2V51 B;  4BRD A;  4AIL C;  4DLG A;  1EWQ A;  2E1Z A;  3C7N A;  4DTP A;  4ISE A;  3VQ9 A;  2GTD A;  3VOV A;  4B1X B;  3VQA A;  3PV8 A;  3KK1 A;  3HP6 A;  2O8E A;  4ICL A;  1NGE A;  2VWB A;  4CGJ A;  3ZT4 A;  4KRE A;  4KRF A;  1SL1 A;  2QWN A;  4V19 S;  4B9N A;  2D0B A;  1C1A A;  1VSI A;  1KLM A;  4FJN A;  3LM2 A;  2YKM A;  1BIZ A;  2W42 A;  4KHP K;  4DU3 A;  3A8Y A;  3QIP A;  4B08 A;  4WQ5 C;  1S1X A;  3IDH A;  3KD5 E;  2E4L A;  3NH0 A;  1BA0 A;  3THW A;  2E6M A;  2UUB K;  2GEM A;  3L4I A;  4M3Y A;  4FLW A;  4YOR A;  1X9J A;  1ZBU A;  3F2K A;  4GY2 B;  5FRM A;  3FGU A;  3THX A;  4FJM A;  3SUP A;  4LY7 A;  4E1N A;  1J5O A;  3CD6 N;  4EFH A;  4FJ8 A;  1C6V A;  3L2R A;  3C6U A;  2JWK A;  4KI6 A;  4BAC A;  2I7N A;  4BWM A;  3CJ1 A;  1QHT A;  4NB4 A;  4CEO A;  1XNQ K;  3ZT0 A;  3SUO A;  3MN9 A;  1O1W A;  1HX1 A;  1HNI A;  3S3M A;  4QCL A;  4IDK A;  4JKF A;  1Y97 A;  3I0S A;  2KW4 A;  4L3Q A;  3CMA N;  2G8W A;  4KO0 A;  4U7B A;  1JLE A;  3SYZ A;  1LWC A;  2P9S A;  3TAM A;  2KHO A;  4H4M A;  5JIC A;  4FJL A;  3LDS A;  2D0O A;  3KK7 A;  2B4J A;  3V1R A;  3SNN A;  4BGB A;  4CD1 A;  3NAE A;  1T03 A;  4H03 B;  2HMI A;  4JAX A;  3VQQ A;  3KZB A;  4I2P A;  4E19 A;  2NRV A;  2ASP A;  3ID8 A;  5SZT A;  3A5L C;  5J2M A;  1RT5 A;  2ASO A;  4BRE A;  4CK1 A;  2YHY A;  3CCJ N;  4DV5 K;  3OS0 A;  3OYL A;  3DLG A;  3AVK A;  1TVR A;  2BAN A;  5HLF A;  3TAG A;  1RT6 A;  2HHW A;  3LP2 A;  3CG7 A;  3HRG A;  3CET A;  2E2Q A;  2VWK A;  4WFB L;  4LFA K;  5M1P A;  3FZF A;  4EAH D;  5HRS A;  1YUW A;  5AZI B;  3L2U A;  1M90 O;  4HTU A;  4OVL A;  5AQR A;  4MLH A;  3BZC A;  2VGM A;  3AVH A;  3KLG A;  3LAL A;  2XO7 A;  3TWH A;  2X78 A;  1HNW K;  2P9K B;  3VET A;  4FM1 A;  3NF7 A;  3QDK A;  3O6W A;  4FJK A;  3NE6 A;  4AHR A;  3K0S A;  1I94 K;  3DLH A;  1U45 A;  1D5A A;  5BN8 A;  4WFN L;  4FZX C;  3HT3 A;  1NK4 A;  3UKR A;  2RF2 A;  1LW0 A;  1VQ4 N;  3VQ8 A;  2YNG A;  3PY8 A;  5C10 A;  2E2N A;  1QSS A;  4I9Q A;  1T7P A;  1WBB A;  4BE1 A;  4BDZ A;  4A5B A;  4JK7 A;  3OYI A;  2PYJ A;  3AA5 X;  2JGU A;  1S22 A;  3KK3 A;  2IAJ A;  3VQE A;  1C1C A;  1D8Y A;  3FFK B;  4CK3 A;  4WCE L;  5JMV A;  4MFB A;  3I8B A;  3DJC A;  1BUP A;  3S3N A;  3RMA A;  3H45 C;  3VTH A;  1Q8I A;  1HQE A;  3ZET A;  3ATV A;  4LD0 A;  3HPH A;  2KZM A;  5ADX A;  4KPY A;  5CR4 A;  4ILG B;  3WNE A;  2E6L A;  3GDQ A;  2X6N A;  4DQP A;  3SK3 A;  4YOU A;  4K43 A;  4CFD A;  3DLE A;  4BRH A;  1YT3 A;  2XY5 A;  4CZH A;  4AM6 A;  3L0Q A;  3QFU A;  5DMR A;  4JRP A;  4DTR A;  3WEE B;  3SPY A;  4KHW A;  4KB1 A;  4DQS A;  4MLE A;  3QLH A;  3SLC A;  2D4W A;  1BQN A;  1HYV A;  3KLE A;  4LFC K;  1N6Q A;  4KHQ A;  3OYF A;  3AVF A;  4CGG A;  2HND A;  1NNE A;  1S1W A;  4AF1 A;  3RMB A;  1DT9 A;  5GIO A;  5EU7 A;  2HHX A;  1QS4 A;  4FWO A;  3QO9 A;  4M45 A;  4FVU A;  1QTM A;  4FW2 A;  2Y1I A;  4LF6 K;  4PA1 A;  4BR9 A;  1NKB A;  3D6R A;  2OPS A;  4JD2 A;  4CJ4 A;  1DLO A;  1J9A A;  1EKE A;  3QIO A;  1RTH A;  1K9M O;  3LAK A;  4IO8 A;  4B3T K;  3VEX A;  2YHX A;  3KJV A;  4QS8 A;  1BDG A;  2PAV A;  2ZGZ A;  3VMF B;  1VSK A;  1FKO A;  2HBJ A;  4A59 A;  1DTQ A;  1BQM A;  3G10 A;  3V6D A;  3K5O A;  4DR7 K;  4RW7 A;  1RDU A;  2KTQ A;  4CZK A;  1ATN A;  4AHC A;  3KWI A;  1H1V A;  3JXU A;  5EXW A;  2WFB A;  4YY3 K;  4C1N K;  4DUY K;  4AM7 A;  4JLH A;  5I9E B;  3NH1 A;  1X9M A;  4FWM A;  3CM6 A;  4B1V A;  4CHZ A;  3ENO A;  1J6Z A;  4CJP A;  1NGA A;  3OYJ A;  2E5L K;  4BR4 A;  4WQ5 A;  5HOO A;  3ZSQ A;  5AFU H;  3BEX A;  2HHU A;  2G8K A;  2FSJ A;  4RW6 A;  2WUS A;  1HLU A;  2QKK A;  3JS6 A;  4A2B A;  1TK0 A;  1EWR A;  3P31 A;  3PUF A;  5AQL A;  3VGL A;  3QEI A;  3DLR A;  4CVN E;  1IBK K;  4OPJ A;  3NMU A;  1L3V A;  2UUC K;  3DXM B;  1SL2 A;  3AY9 A;  2DY4 A;  4HCB A;  1JXB A;  3VQ6 A;  4CGI A;  2YHB A;  2DPN A;  3ZT3 A;  3Q7C A;  4KH6 A;  3VQ7 A;  1NGJ A;  2F8T A;  3K9J A;  4ZTF A;  4YFU A;  3GE1 A;  1GOA A;  4FWS A;  2VCP A;  4CEQ A;  2RN2 A;  3T7Z A;  4H5T A;  3H3O B;  3ZT1 A;  1LWF A;  1BIU A;  4LH4 A;  3LAM A;  4DV6 K;  1KAZ A;  1Q9Y A;  4B9Q A;  3EE9 A;  2Y1J A;  4JKB A;  2P9I A;  5KPZ A;  3CF5 L;  4FJH A;  4NCB A;  2DFF A;  4E7L A;  4CEF A;  1HRH A;  1NGG A;  3AA3 A;  3ZSX A;  4FOE A;  3OY9 A;  3EKS A;  3OVN A;  1N36 K;  4BVO A;  4IJA A;  3THY A;  2HOE A;  2I7P A;  2BDP A;  4KI4 A;  1NU0 A;  3O3H A;  5AQI A;  5M1K A;  2QWP A;  3VES A;  2F9W A;  2IS3 A;  3O9R A;  4FLX A;  1G99 A;  3ALY A;  3EL2 A;  4DTJ A;  1BWF O;  3L3V A;  5KGX A;  1U2V A;  1YJN N;  3SJH A;  1WNS A;  3MAQ A;  3Q7B A;  2FLO A;  3P38 A;  3TR8 A;  1KVB A;  4CHO A;  4H5W A;  4MDA A;  1NGF A;  5LMU K;  1ATR A;  2YX6 A;  3C65 A;  1HUX A;  2KQ2 A;  3BP8 A;  3J7Z O;  1R0A A;  1JLC A;  2P9L B;  4M63 C;  4CZL A;  4DSK A;  1A5V A;  1VQO N;  4Y1D A;  3VF6 A;  4OJR A;  5K14 A;  1QVF M;  5AQH A;  4TSX A;  1ESV A;  1VQ5 N;  4LF5 K;  4JI1 K;  4DF8 A;  2HB5 A;  3P1G A;  4X62 K;  3O08 A;  4FK4 A;  2E1Y A;  4GMJ B;  3CQX A;  3E9L A;  3FLC O;  4H0T B;  5EOY A;  4DV2 K;  4JI5 K;  4F3O A;  3AO1 A;  4AHS A;  1S1T A;  3MN6 A;  4IDH A;  3LWM A;  4BR2 A;  1VRU A;  2CGJ A;  4PY5 A;  4FJ9 A;  3N4P A;  1N33 K;  1DTT A;  4M7X A;  3QET A;  2WOM A;  4CFC A;  1NMD A;  2YNF A;  3M6G A;  3J81 O;  1XI1 A;  4CF8 A;  2P9P B;  4GKK K;  3M8S A;  3L6Q A;  1QQO A;  1A5X A;  3CFO A;  3OJS A;  3SQ1 A;  2YKN A;  3ULE B;  1HNZ K;  2GUI A;  1TUY A;  3AO5 A;  3EN9 A;  3UKU B;  4FLU A;  3AVA A;  3P5J A;  1VQ9 N;  3TTF A;  1GOC A;  1GOB A;  5J1E A;  1TYQ A;  2JWL A;  1RDC A;  1D9F A;  2G8F A;  1WSG A;  3J7Y P;  1QZ5 A;  2IGI A;  1U4B A;  1MU2 A;  4FWK A;  5BRH A;  5DM7 L;  3VQD A;  2PYL A;  2Q31 A;  4IFV A;  4CJ7 A;  4KH5 A;  4F3T A;  2HF4 A;  3MMV A;  3O4Q A;  3VPZ A;  4J2D A;  2I5J A;  1TL3 A;  4M7Y A;  2EWS A;  2O8B B;  4C8O A;  3I0R A;  4K42 A;  3DM2 A;  4DV7 K;  2XY6 A;  4GKJ K;  3O8M A;  1SKR A;  3W0L A;  2VGN A;  3ISN C;  4CES A;  3F9M A;  4CGF A;  3ZEU B;  1JXE A;  3NH2 A;  3OTO K;  1C0F A;  1IKX A;  4N47 A;  1IH7 A;  5HP1 A;  4C8M A;  4DUZ K;  5AQY A;  4FZZ A;  3NF9 A;  2O8C A;  1VSE A;  4BR5 A;  2QWQ A;  1MWK A;  1ZBI A;  2A6A A;  4JI3 K;  3LDQ A;  1IG8 A;  2OPP A;  3SI6 A;  4CF1 A;  1U49 A;  3QEV A;  5BR8 K;  2O8F B;  3OYG A;  3QEW A;  3O4W A;  2OTL N;  5M1N A;  3WXI A;  2ZJQ L;  3WT0 A;  5CZ1 A;  2W41 A;  3MXI A;  4BG8 A;  4ELU A;  1TV6 A;  4XEI A;  3LDO A;  4ID1 A;  3AVN A;  4B9M A;  5BN9 A;  4MQ3 A;  3D45 A;  1Z26 A;  3CER A;  4JKG B;  1XC9 A;  3AVI A;  2FC0 A;  3TTD A;  4DQR A;  3QBW A;  2D5R A;  3DLL L;  4J8F A;  3H1Q A;  1JL1 A;  4AHU A;  4CZI A;  2QKB A;  3TPQ A;  1R59 O;  2FSN A;  5LJV A;  1G15 A;  3ZX0 A;  3TAQ A;  5BPL A;  4ILJ A;  3E9P A;  1OH5 A;  1RBU A;  5JVH L;  3RRH A;  3LDL A;  3K5N A;  1D9D A;  4YOX A;  2B6A A;  3SJJ A;  3QNO A;  3IMX A;  3KWG A;  1VQ7 N;  3SBG A;  2BTF A;  1NLV A;  4JI2 K;  3HOT A;  3DWL A;  1IKY A;  4IEE A;  1NG9 A;  4JS5 A;  3SMP A;  3A5M C;  4FLZ A;  4Y0W A;  1KTQ A;  4RW9 A;  4YHH K;  1KAX A;  3M1F A;  3DRP A;  4CBU A;  3OYH A;  1ZC6 A;  1KLN A;  3MCA B;  3AAP A;  4PKI A;  4CZJ A;  3LP3 A;  5KQD A;  2YI1 A;  5CYQ A;  1J5E K;  4OLB A;  3RR7 A;  4GV9 A;  4A57 A;  4E7H A;  1Q7Y O;  3ITH A;  4LF7 K;  1T44 A;  4XIU A;  2G8H A;  5KRT A;  4B3R K;  1XMQ K;  3K57 A;  3I56 N;  1GLC G;  1VK0 A;  3G6E N;  2F4V K;  4IKF A;  3DMJ A;  2IVN A;  4CJR A;  3SUN A;  4FPA A;  1BOT O;  1ZBH A;  4HUG A;  3CPW M;  3VEN A;  1LAW A;  4IFY A;  3KIO A;  1XHX A;  2FBY A;  4JKE A;  5J2Q A;  3HVR A;  3M5R A;  1GLB G;  3RTV A;  3RMC A;  5D3G A;  4M3T A;  2HBM A;  1B9F A;  4F4K A;  3SV3 A;  4MO5 A;  3ENH A;  3RVC A;  3NBP A;  1OH7 A;  3DLB A;  3LP1 A;  1ILY A;  1KCF A;  2QW9 A;  3V9W A;  3CCU N;  3PO4 A;  2VQE K;  1X3M A;  3G0Z A;  5F0X A;  3CJC A;  3FZK A;  3P4I A;  5CYM A;  4DCH A;  3IAY A;  4PQU A;  4E3S A;  4DR2 K;  4BRN A;  3NGY A;  3A5O C;  3ZYY X;  4JYA K;  1UA0 A;  4JKD A;  3CJB A;  5EX5 A;  3PX4 A;  1TGO A;  4BVP A;  1S9G A;  3CCR N;  2P5O A;  1LCU A;  4FJJ A;  2D0C A;  3O9T A;  3OYC A;  2YHW A;  3CC4 N;  4OKJ A;  4E7I A;  2AJQ A;  3FZL A;  3K9K A;  3HO1 A;  2HF3 A;  2ZWH A;  2OA8 A;  4NXN K;  2E2P A;  4FL9 A;  3VGM A;  5AZJ B;  5KPT A;  3EO3 A;  1NGB A;  4DFP A;  4WFA L;  5AZI A;  4W5T A;  1KXP A;  2P9N B;  4UY8 O;  3DAW A;  3C6H A;  1WAJ A;  1UA1 A;  4DV0 K;  2P9K A;  3IFR A;  4AQY K;  1NK9 A;  5CZ2 A;  1ASW A;  2YCH A;  4BE0 A;  4BC3 A;  2NRZ A;  1VQN N;  2RHK A;  4KAZ A;  3CCM N;  4X65 K;  4ID5 A;  3FFI A;  2X6S A;  4HWI A;  4XH5 A;  5EY4 A;  1NBW A;  4RCH A;  3VQC A;  3R3L A;  2IVP A;  4FXD A;  4ISG A;  4PUO A;  3K5M A;  4FJG A;  1TKT A;  4H0O A;  4ZTJ A;  4IEI A;  4M3R A;  2QXF A;  4GVE A;  3ULD A;  1FKP A;  1JJ2 M;  3CIP A;  1BHL A;  3TAP A;  5C24 A;  1YIT N;  2OAN A;  2PZS A;  4M3W A;  4KHY A;  3QFP A;  4CHQ A;  3QEP A;  4DB3 A;  4RWT A;  5HRO A;  4RTF D;  3CC7 N;  1RDD A;  3DXK B;  5TKW A;  3ASM A;  4DR1 K;  2HVH A;  5BPM A;  4KHU A;  3WXJ A;  4FM0 A;  4IO9 L;  2FBT A;  3EE8 A;  4O8U A;  4JK8 A;  1C0T A;  1X9W A;  1NWK A;  3H1V X;  1NOY A;  2V7Y A;  3WEE A;  4QS9 A;  4CJV A;  1VSH A;  3SAG A;  4A2A A;  5GAH P;  2QM1 A;  2ZF5 O;  4BDY A;  1OH6 A;  1VSM A;  4O0J A;  2WBN A;  4BR0 A;  4CD3 A;  3AO2 A;  5FRO A;  1YTA A;  1RBV A;  2P5G A;  3O3F A;  3MWT A;  5DK5 A;  5AQX A;  4I9L A;  2J4R A;  2D1K A;  3T1H K;  3V9S A;  2HNY A;  1S9E A;  3VEV A;  3WUH A;  3MXM A;  3LWL A;  1T05 A;  2AP1 A;  1WLJ A;  2Z1H A;  1BI4 B;  3BZK A;  5E26 A;  4FLV A;  1E4G T;  1ATS A;  3EZW A;  4CFB A;  1Q86 O;  2Q97 A;  3CM5 A;  3WNF A;  4W5N A;  1NGH A;  3CME N;  1ITG A;  2BE2 A;  1NJX A;  1FW6 A;  3G71 N;  4BWJ A;  2OZS A;  2F8S A;  5M1Q A;  2CGL A;  3CXC M;  3NGI A;  4F9O A;  3NDK A;  2ZJP L;  1HQU A;  3SAF A;  4B3M K;  4CJS A;  4Z94 A;  1KFD A;  4DS5 A;  1U48 A;  4NLC A;  1NMN A;  2UYT A;  3D7E O;  2FF6 A;  1IKW A;  1CXQ A;  3CQ8 A;  1UOC A;  4WF9 L;  1YXQ A;  4CEE A;  4FW1 A;  4B1W B;  1NK0 A;  1BCM A;  3G25 A;  4BRP A;  3NHG A;  4I6M B;  3OA9 A;  3SPZ A;  4JN4 A;  4O55 A;  3CJ7 A;  1HJR A;  3AV9 A;  1YJW N;  2OYQ A;  3S41 A;  4FCY A;  5GAG P;  4YOW A;  3MWP A;  4OPH A;  3OW2 M;  1NK7 A;  4YNQ A;  5HL7 L;  1YVN A;  3OYE A;  4LH5 A;  4IJN A;  4DTN A;  3J80 O;  2P51 A;  1NOZ A;  4JKH A;  2O8D B;  1GLA G;  3R9P A;  2YJE A;  2NLX A;  3VER A;  4CJL A;  1RT3 A;  4YOT A;  3CCL N;  3TAB A;  4KB0 A;  3DXM A;  2EHG A;  4CE9 A;  4CJT A;  4CJF A;  4NXM K;  4E1M A;  4N56 A;  3V9U A;  1ZBF A;  2Q0R A;  2HBK A;  1HKB A;  4DSF A;  1LOT B;  2BH1 A;  3K5L A;  2Q1N A;  3KHY A;  1XNR K;  3HZ6 A;  4G1Q A;  4DQI A;  2CGK A;  4A62 A;  4EP4 A;  3FE1 A;  1U6Z A;  1YF5 L;  3PO5 A;  4DU1 A;  4CGD A;  2E2O A;  2IC3 A;  4K25 A;  2ZQB A;  1U47 A;  1K8K B;  3T69 A;  4GV6 A;  4O8K A;  3PLA A;  4LF4 K;  5FPD A;  1BG3 A;  4H5N A;  3CJA A;  4H5R A;  4CEC A;  4L8R B;  3TAN A;  2QEX N;  3ID6 A;  5SWM A;  4OKK A;  3OJU A;  5FPN A;  4IFE A;  1K8A O;  4DTX A;  2PFU A;  4RW8 A;  3E1Y A;  3TI0 A;  3L2V A;  1XMO K;  5HBM A;  4BRF A;  4DR5 K;  5JS1 A;  5C0Y A;  3DI6 A;  4BRA A;  3SQ4 A;  4LSN A;  3ZX3 A;  5TKY A;  4CJE A;  1NK6 A;  3VA3 A;  1KSP A;  1DGK N;  5GIP A;  2UU9 K;  2Z1I A;  2HW3 A;  4QAG A;  1J54 A;  3R6M A;  4DR3 K;  3JYT A;  1UWB A;  4NYN A;  2RE2 A;  4B3O A;  5HRP A;  2G8V A;  4HUF A;  3AA4 A;  3IRX A;  1NK8 A;  1TKX A;  1X3N A;  4IG0 A;  1P90 A;  5AQT A;  2CH6 A;  4OPK A;  3OYB A;  1VSL A;  2HHH K;  1QQC A;  2W40 A;  3PSF A;  4B1Y B;  4KH4 A;  5GAE P;  2P1J A;  1EP4 A;  3ZX2 A;  1JLF A;  2YNI A;  3M8Q A;  3E9O A;  3UE5 A;  3T3F A;  1LV5 A;  4Z0U A;  2P9L A;  3NF6 A;  4WQ4 A;  5F2R A;  2QWR A;  2QTD A;  4CZE A;  1UAX A;  3MN5 A;  4BC2 A;  4NO7 A;  3HP9 A;  2ETJ A;  4CK2 A;  3QER A;  1JLB A;  3QIN A;  2ITM A;  5J2P A;  3RRG A;  4B9V A;  3V81 A;  5AQW A;  4M3U A;  4CHN A;  5F1X A; 
#chains in the Genus database with same CATH homology
 3NGZ A;  1XC9 A;  2VG7 A;  2FC0 A;  3AVI A;  3OYM A;  4DQR A;  4B9U A;  2D5R A;  3AVL A;  3AO4 A;  3NAE A;  1T03 A;  1S6P A;  3P83 D;  2HMI A;  3WNG A;  1JL1 A;  4AHU A;  4CJ5 A;  4DF4 A;  3VQQ A;  4C8L A;  3ZSO A;  4I2P A;  2QKB A;  3HPG A;  4E19 A;  1BIS A;  5SZT A;  1G15 A;  3TAQ A;  5J2M A;  1EX4 A;  4DTS A;  2RPI A;  1RT5 A;  3NFA A;  4CK1 A;  4E0D A;  1NJW A;  1IKV A;  3K2P A;  1RBU A;  4DMN A;  3OS0 A;  3BGR A;  4W5O A;  2XY7 A;  1VSD A;  3VQB A;  1Q9X A;  3OYL A;  3DLG A;  3KTQ A;  3AVK A;  1TVR A;  2BAN A;  5HLF A;  3TAG A;  3RRH A;  4HCC A;  1RT6 A;  2XHB A;  4CJU A;  4CIE A;  3K5N A;  2HHW A;  4FJ5 A;  3LP2 A;  1L3T A;  1D9D A;  1B9D A;  3CG7 A;  2B6A A;  3SJJ A;  1CZ9 A;  3QNO A;  4I7F A;  2VWK A;  3QNN A;  1I3A A;  2ZE2 A;  5HRS A;  3NCI A;  4J2A A;  1JKH A;  4M42 A;  2VG5 A;  2XY8 A;  3L2U A;  1IKY A;  1JLA A;  3ZSR A;  1BL3 A;  4HTU A;  4JS5 A;  4OVL A;  4FLZ A;  2YV0 X;  2Z1G A;  5FRN A;  4O44 A;  1KTQ A;  1REV A;  3LP0 A;  3AVH A;  4RW9 A;  1ASU A;  3KLG A;  4FLT A;  3LAL A;  2XO7 A;  3TWH A;  2X78 A;  3DRP A;  5HRR A;  3AA2 A;  3OYH A;  4FM1 A;  3NF7 A;  1KLN A;  4N76 A;  3M8P A;  4FJK A;  3NE6 A;  4AHR A;  1JLG A;  3LP3 A;  3DLH A;  3LZJ A;  1U45 A;  3TAE A;  1S1V A;  5CYQ A;  1D5A A;  4OLB A;  4FZX C;  3DRS A;  3RR7 A;  3HT3 A;  4KFB A;  1NK4 A;  2RF2 A;  1LW0 A;  4E7H A;  4OGC A;  3DOL A;  3U3Y A;  2FBX A;  2WON A;  3DRR A;  3VQ8 A;  2YNG A;  1SKS A;  3PY8 A;  3ITH A;  4KV8 A;  4XIU A;  1QSS A;  1WSE A;  2G8H A;  5KRT A;  1T7P A;  4I9Q A;  3M8R A;  2DFH A;  3B6O A;  4BE1 A;  3WNH A;  4DSE A;  4BDZ A;  4UQG A;  4FZY A;  2F96 A;  3OYI A;  2PYJ A;  3AA5 X;  2JGU A;  4FJI A;  1HPZ A;  3K57 A;  4Z4E A;  3KK3 A;  2IAJ A;  2LSN A;  3VQE A;  1C1C A;  1D8Y A;  4KTQ A;  4O5B A;  1VK0 A;  4CK3 A;  3EYZ A;  3KKS A;  2KFZ A;  4IKF A;  4MFB A;  3DMJ A;  1XWL A;  3S3N A;  4CJR A;  3SUN A;  3RMA A;  3LPT A;  3S9H A;  4M3X A;  1ZBH A;  4CEA A;  3CFP A;  1Q8I A;  1HQE A;  4HUG A;  1KVC A;  1LAW A;  2RKI A;  4IFY A;  4LD0 A;  3KIO A;  2EX3 A;  3HPH A;  1XHX A;  2FBY A;  4B8A B;  4CF0 A;  2KZM A;  3ZSV A;  5J2Q A;  1LWE A;  3HVR A;  1SV5 A;  3KLH A;  4KPY A;  3WNE A;  1WN7 A;  2E6L A;  3RTV A;  4B9S A;  4FYD A;  2ZD1 A;  2X6N A;  4DQP A;  4B8C A;  3HJF A;  3RMC A;  4HUE A;  5D3G A;  4M3T A;  1U04 A;  2G8I A;  1B9F A;  2Z1J A;  3DLE A;  4LSL A;  3ZSZ A;  4CFD A;  3SV3 A;  4F4K A;  1YT3 A;  3MEC A;  2XY5 A;  5DMR A;  3NBP A;  4JRP A;  3DLB A;  3LP1 A;  4W5Q A;  4KKO A;  1C1B A;  4DTR A;  1KCF A;  3I8D A;  2DFE A;  5KI6 A;  3SPY A;  3V9W A;  3PO4 A;  1X1P A;  4KB1 A;  4KHW A;  1K6Y A;  3IS9 A;  4DQS A;  3QLH A;  3G0Z A;  3A2F A;  4DG1 A;  5T7B A;  1BQN A;  1HYV A;  4CGH A;  3RR8 A;  3KLE A;  5CYM A;  1N6Q A;  4R5P A;  4KHQ A;  3OYF A;  3IAY A;  4PQU A;  1A5W A;  1WSJ A;  4E3S A;  4B9L A;  3NGY A;  1L5U A;  1J53 A;  3AVF A;  4CGG A;  1LAV A;  1UA0 A;  2HND A;  4CIF A;  4PWD A;  1YTU A;  1S1W A;  3DOK A;  3RMB A;  3PX4 A;  1TGO A;  3KKR A;  4DQQ A;  5I3U A;  1S9G A;  1W9H A;  5EU7 A;  3V1Q A;  4CJW A;  1JL2 A;  2HHX A;  2P5O A;  1QS4 A;  1EET A;  4FM2 A;  4FJJ A;  3B6P A;  1S5J A;  3QO9 A;  4M45 A;  4DS4 A;  4K8Z A;  1HYS A;  2HHV A;  2D0C A;  3OYC A;  4FW2 A;  3OYK A;  2Y1I A;  1QTM A;  3BDP A;  2KFN A;  4PA1 A;  4BDP A;  4OKJ A;  1NKB A;  3AVM A;  5C42 A;  4E7I A;  2JLE A;  2AJQ A;  5JS2 A;  3JSM A;  1NJY A;  3VQP A;  5E41 A;  3HO1 A;  2OPS A;  2NUB A;  4CJ4 A;  1DLO A;  1J9A A;  1EKE A;  3QIO A;  1Z25 A;  4Z4G A;  2OA8 A;  1RTH A;  3LAK A;  1T8E A;  3KJV A;  1BGX T;  4OKE A;  1S6Q A;  4DFP A;  2IOC A;  4CFA A;  1TK5 A;  4OGE A;  4CER A;  1VSK A;  3RWU A;  4W5T A;  1FKO A;  1VSF A;  4AH9 A;  4FK0 A;  2VWJ A;  3OYA A;  1S1U A;  1TK8 A;  3V1O A;  4F2S A;  1DTQ A;  4QOZ B;  1L3U A;  1BQM A;  1WAJ A;  2B5J A;  3G10 A;  3V6D A;  4KTW A;  3K5O A;  1UA1 A;  1X9S A;  2YNH A;  1ZYQ A;  4RW7 A;  2KTQ A;  4RW4 A;  2BGG A;  1NK9 A;  1RIL A;  5CZ2 A;  1KFS A;  1ASW A;  5KRS A;  3HXM A;  1NKE A;  1QE1 A;  4BE0 A;  4AHC A;  4J2E A;  4HVJ A;  1RBT A;  3SV4 A;  4KAZ A;  3EY1 A;  2A1S A;  5CY4 A;  3L3U A;  4EZ9 A;  4ID5 A;  3FFI A;  1RBS A;  2X6S A;  4DFM A;  1TKD A;  4JLH A;  4CHY A;  3NH1 A;  1X9M A;  3VQC A;  2OPR A;  4O0I A;  3AVJ A;  3K59 A;  3CM6 A;  4FXD A;  4CHZ A;  2O4I A;  4PUO A;  1F21 A;  4KHS A;  4DSL A;  3K5M A;  1TAU A;  4CJP A;  3C6T A;  3KLI A;  1TKT A;  3OYJ A;  4ZTJ A;  1KRP A;  4CIG A;  4CF2 A;  4FJG A;  4M3R A;  2QXF A;  3ZSQ A;  3ULD A;  4Q5V A;  2IDO A;  2HHU A;  1FKP A;  3ZSY A;  2G8K A;  3KLF A;  4RW6 A;  3T19 A;  1BHL A;  3TAP A;  4M3Z A;  5C24 A;  2QKK A;  3PX6 A;  3MEE A;  3HVT A;  3OS1 A;  3KK2 A;  2PZS A;  4M3W A;  4KHY A;  4F8R A;  4FJ7 A;  4CHQ A;  5I42 A;  3U3G A;  4N5S A;  3QEP A;  1TK0 A;  5HRO A;  1CZB A;  3H08 A;  1HMV A;  3O4N A;  3PUF A;  4DTM A;  1TKZ A;  1RDD A;  4H4O A;  3QEI A;  4E7J A;  3DLR A;  4OPJ A;  1L3V A;  3ASM A;  3QES A;  1QSL A;  2HVH A;  4KHU A;  4FM0 A;  1SL2 A;  2FBT A;  3L2W A;  3ZSW A;  2DY4 A;  4HCB A;  1JXB A;  1C0T A;  3VQ6 A;  4CGI A;  4ZHR A;  3T1A A;  1X9W A;  4ELT A;  1NOY A;  1WSI A;  2YHB A;  1NK5 A;  4CJQ A;  3ZT3 A;  4CJV A;  1VSH A;  3D0P A;  3VQ7 A;  1CLQ A;  3ZT2 A;  2HHT A;  2DTU A;  3SQ2 A;  2F8T A;  1HNV A;  1TAQ A;  4BDY A;  4ZTF A;  1VSM A;  4O0J A;  1ASV A;  4YFU A;  3QEX A;  3HST B;  3V9Z A;  3AO2 A;  5FRO A;  1YTA A;  1RBV A;  1GOA A;  3K58 A;  1JLQ A;  2P5G A;  4CEQ A;  2RN2 A;  3O3F A;  4FK2 A;  1IO2 A;  1VRT A;  5KTQ A;  5DK5 A;  4Q0B A;  4I9L A;  3LAN A;  4GW6 A;  3ZT1 A;  1N5Y A;  1RT2 A;  1LWF A;  3V9S A;  1BIU A;  1FXX A;  4LH4 A;  4C8N A;  2HNY A;  3LAM A;  1C0M A;  1S9E A;  1NJZ A;  4ELV A;  3MED A;  1Q9Y A;  3MXM A;  4DLE A;  3OYN A;  3LWL A;  1T05 A;  3VQ4 A;  3MEG A;  1WLJ A;  2Z1H A;  4CED A;  1BI4 B;  2Y1J A;  3V4I A;  2YHA A;  1FK9 A;  4FJH A;  3NF8 A;  4NCB A;  3DYA A;  4Z4F A;  2DFF A;  4E7L A;  4CEF A;  1C0U A;  4DSJ A;  1HRH A;  4FLV A;  1SUQ A;  3AA3 A;  3ZSX A;  4CFB A;  4EZ6 A;  3OY9 A;  2G8U A;  4B9T A;  3OVN A;  1RDA A;  3CM5 A;  3WNF A;  4AHT A;  4W5N A;  2BDP A;  3SUQ A;  1ITG A;  4N41 A;  4KI4 A;  1CXU A;  2BE2 A;  2R7Y A;  4M41 A;  3O3H A;  1NJX A;  4CJK A;  4C8K A;  1LW2 A;  4FJX A;  1RTJ A;  4RG8 A;  4BWJ A;  1QSY A;  2OZS A;  2F8S A;  2VG6 A;  1RDB A;  2IS3 A;  4EP5 A;  3CFR A;  4FLX A;  2HHS A;  2X74 A;  4OLA A;  3NGI A;  3NDK A;  3ALY A;  3L2Q A;  1HQU A;  4KTZ A;  4HHT A;  2D0A A;  4DTJ A;  4NCG A;  4CJS A;  2KZZ A;  1KFD A;  3ZCM A;  4DS5 A;  1U48 A;  1RBR A;  3L3V A;  3VN5 A;  5KGX A;  3LZI A;  1RT1 A;  5C25 A;  3OYD A;  1WNS A;  4Z4C A;  1IKW A;  3HL8 A;  3MAQ A;  1CXQ A;  1RNH A;  4CEZ A;  4E89 A;  3CQ8 A;  3V9X A;  4CEB A;  1SL0 A;  4DTO A;  1UOC A;  3TR8 A;  3VA0 A;  4CEE A;  1KVB A;  4CHO A;  4JS4 A;  4FW1 A;  4CF9 A;  4W5R A;  3OS2 A;  3HM9 A;  1NK0 A;  1BCM A;  3NHG A;  4H8K A;  1KVA A;  1XHZ A;  2KQ2 A;  3SPZ A;  1WSH A;  4O55 A;  1R0A A;  1JLC A;  1HJR A;  3AV9 A;  2OYQ A;  4DSK A;  4F2R A;  4FCY A;  3SZ2 A;  1IG9 A;  1A5V A;  4DWI A;  4Z4I A;  4Y1D A;  4OJR A;  4WE1 A;  5K14 A;  1BCO A;  2Q3S A;  4E7K A;  4IG3 A;  3TAR A;  3THV A;  1NK7 A;  4YNQ A;  4TSX A;  3KD1 E;  3OYE A;  4LH5 A;  4DTN A;  4CCH A;  3AVG A;  3AO3 A;  3EZ5 A;  4DU4 A;  2P51 A;  1NOZ A;  1RT4 A;  1B92 A;  2PY5 A;  3TAF A;  4DFJ A;  4DF8 A;  4IBN A;  2HB5 A;  3P1G A;  1RT3 A;  4CJL A;  3F73 A;  1RCH A;  2HVI A;  5KGW A;  4FK4 A;  3RMD A;  4GMJ B;  4NYF A;  3SCX A;  3TAB A;  4KB0 A;  2GV9 A;  2EHG A;  4CE9 A;  4CJT A;  4AIL C;  3AVC A;  3AO1 A;  4CJF A;  4F3O A;  4DLG A;  1ZBL A;  4E1M A;  4N56 A;  4AHS A;  3V9U A;  1ZBF A;  4DTP A;  3DLK A;  3VQ9 A;  4DSF A;  1S1T A;  1L3S A;  3K5L A;  3VQA A;  3PV8 A;  4CHP A;  3KK1 A;  3LWM A;  2O4G A;  3HP6 A;  3CYM A;  1VRU A;  4G1Q A;  4DQI A;  5J2N A;  4ICL A;  4EP4 A;  4Z4H A;  4PY5 A;  4FJ9 A;  1YVU A;  3F9K A;  4CGJ A;  3PO5 A;  1DTT A;  3ZT4 A;  4DU1 A;  4CGD A;  2WOM A;  3QET A;  2IC3 A;  4K8X A;  3HK2 A;  4CFC A;  4KRE A;  4KRF A;  2YNF A;  1XI1 A;  4CF8 A;  3C94 A;  5HRN A;  1NKC A;  3M8S A;  1SL1 A;  2ZQB A;  3OJS A;  1A5X A;  3CFO A;  1U47 A;  3PX0 A;  4B9N A;  3SQ1 A;  2D0B A;  2YKN A;  3S3O A;  1C1A A;  1VSI A;  2GUI A;  3AO5 A;  4FLU A;  1KLM A;  4KHN A;  3E01 A;  4FJN A;  4CJ3 A;  2YKM A;  3AVA A;  3P5J A;  1BIZ A;  2W42 A;  1GOC A;  1GOB A;  5J1E A;  4DU3 A;  3QIP A;  4CEC A;  4L8R B;  1RDC A;  1WAF A;  4B08 A;  3TAN A;  1D9F A;  2G8F A;  1RTD A;  1WSG A;  1BI4 A;  4OKK A;  1S1X A;  5SWM A;  3OJU A;  2OPQ A;  2IGI A;  2E4L A;  3NH0 A;  1U4B A;  1MU2 A;  4JRQ A;  3KD5 E;  2E6M A;  4J2B A;  4FVM A;  4DTX A;  4RW8 A;  3VQD A;  2PYL A;  3TI0 A;  3MXJ A;  3L2V A;  5HBM A;  4IFV A;  5JS1 A;  3DI6 A;  4FLW A;  4M3Y A;  2ATQ A;  4GVM A;  3SQ4 A;  1NK6 A;  1ZBU A;  4LSN A;  4CJE A;  4FLY A;  1KSP A;  3VA3 A;  5FRM A;  4F3T A;  3O4Q A;  4FJM A;  4J2D A;  3SUP A;  2I5J A;  1EXQ A;  1TL3 A;  4LY7 A;  4E1N A;  1SKW A;  1J5O A;  2Z1I A;  3U6F A;  4C8O A;  2HW3 A;  3I0R A;  4QAG A;  4FJ8 A;  1J54 A;  5FDL A;  3DM2 A;  1C6V A;  3L2R A;  3AVB A;  2XY6 A;  3JYT A;  1W0H A;  1UWB A;  4NYN A;  1SKR A;  4B3O A;  3C6U A;  5HRP A;  3ISN C;  2G8V A;  4CES A;  4CGF A;  3NH2 A;  4HUF A;  1JXE A;  3AA4 A;  4BAC A;  4KI6 A;  3IRX A;  4BWM A;  1NK8 A;  1HYZ A;  1IKX A;  1TKX A;  4N47 A;  3SQ0 A;  1IH7 A;  4DTU A;  5HP1 A;  1QHT A;  1VSJ A;  4IG0 A;  4C8M A;  4CEO A;  4OPK A;  4FZZ A;  3OYB A;  2HHQ A;  1VSL A;  3LPU A;  3NF9 A;  3ZT0 A;  1VSE A;  3SUO A;  1ZBI A;  2QK9 A;  4DFK A;  1QQC A;  2OPP A;  3SI6 A;  1O1W A;  4O4G A;  4CF1 A;  1U49 A;  2P1J A;  3QEV A;  1EP4 A;  4AHV A;  1HNI A;  3S3M A;  2ITG A;  4QCL A;  4IDK A;  1TL1 A;  1JLF A;  2YNI A;  1Y97 A;  3M8Q A;  3OYG A;  3I0S A;  2XRI A;  3HPO A;  3T3F A;  3QEW A;  4Z0U A;  3HYF A;  1LV5 A;  2KW4 A;  3NF6 A;  5CZ1 A;  2FBV A;  2GBZ A;  2G8W A;  3L8B A;  3MXI A;  4ELU A;  1RT7 A;  1TV6 A;  4DSI A;  1UAX A;  2HNZ A;  4KO0 A;  4BE2 A;  3HP9 A;  1I39 A;  1JLE A;  1RTI A;  2ETJ A;  1LWC A;  3IG1 A;  3SYZ A;  3C95 A;  3TAM A;  4ID1 A;  4CK2 A;  3QER A;  2OZM A;  1JLB A;  1WSF A;  4H4M A;  4M3U A;  4FJL A;  3LDS A;  3AVN A;  3QIN A;  4B9M A;  3UIQ A;  4NCA A;  5J2P A;  2A1R A;  2B4J A;  4I2Q A;  4MQ3 A;  3D45 A;  3RRG A;  1Z26 A;  3V1R A;  3V81 A;  3VQ5 A;  3SNN A;  4B9V A;  3O3G A;  4CHN A;  4Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...