4MFBA

Crystal structure of hiv-1 reverse transcriptase in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
544
structure length
544
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picomolar Inhibitors of HIV Reverse Transcriptase Featuring Bicyclic Replacement of a Cyanovinylphenyl Group.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 143
structure length 544
sequence length 544
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4mfbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4mfbA05
4H8KA 3HSTB 4JV1A 3KK3B 3L3VA 1I39A 4CEZA 1KSPA 4IG0A 2ZKUA 1JXBA 2IJNA 3CJ4A 4MH8A 3T5JA 1KFSA 1TL1B 4B9NA 5J2MA 3SQ4A 4AILC 5L1JA 1C0TB 3KK1B 3N6NA 2OPQB 5KFHA 4KBIA 4DTJA 2G8HA 5KT2A 1LW2B 4U6PA 2Y1IA 1QSSA 2IJFA 2HHSA 1VSHA 4KB7A 5KFGA 5DGAA 2KFZA 4O44B 2YV0X 3T3FA 4YP3A 2G8FA 4ECVA 4DTSA 1GOAA 4E7HA 3RMDA 1HMVB 3KKRA 3L8BA 1GX5A 3O4NA 3QGHA 3N6MA 4O3NA 2IC3B 3OYCA 2WHOA 3NBPA 1S9EA 3QZ7A 2KTQA 3DLRA 3NF7A 4CJVA 3SUPA 1NJZA 2WOMA 4ECUA 3AA5X 2XY5A 1LW2A 4BE0A 5L9XA 4DSIA 2C2EA 2FVPA 4YR3A 1RA7A 4QW9A 4FS1A 1XI1A 4DS5A 1S9GA 3H5UA 1B9DA 3G10A 3HVRA 4OKEA 5HRSA 4Q43A 4ZPDA 3PVXA 3NHGA 3SV4A 5HP1B 3NAIA 4ID5B 3NH2A 1QS4A 3OYGA 3OL8A 3NAHA 4RNOA 4KFBB 1EETB 5F8IA 3OY9A 1S97A 3CJ0A 4TXSA 3RB4A 5FRMA 1NKEA 1XWLA 5F8GA 2BE2B 1Z25A 4LH5A 3ZCMA 1W9HA 4J9MA 1NK7A 3T1AA 1RTDA 2BE2A 3C6TB 2OYQA 4E7JA 2AX0A 4CEDA 3V81B 3HPGA 1BQNB 2HHVA 4GMJB 4RW7B 3EYZA 5KFMA 4R5PA 4CGGA 5JXSA 3FFIA 3I0SA 2VG6A 4KHRA 1IKYA 2V0NA 1FK9A 3QO9A 1KHVA 1RDDA 4N41A 2OZSA 3DLBA 1S0NA 2XCAA 3EY1A 2VG6B 3V1OA 3QESA 4IKFA 3BJYA 2IA6A 4PA1A 4FM2A 4LSNA 4Q0BA 3TWHA 1QSYA 1UWBB 3SUOA 4TSXA 4HTUA 4DU1A 3SV3A 3H59A 2XCPA 2QV6A 1NK5A 5KFZA 1NOZA 5F8HA 5J1EB 3TR8A 3AO4A 3L2UA 2JGUA 3TI0A 1TKXB 1BI4A 2KQ2A 3N6LA 3KLEB 2OPPA 3LP2A 3LP1A 2J6TA 5KTQA 3OYNA 3PX4A 3ASMA 3GIMA 4NLWA 2AQ4A 3IS9B 4RW6A 3OHAA 1YVUA 1C2PA 4BDZA 4RZRA 3UQSA 1JLQA 2Q3SA 4KFBA 3SJJA 3DYAA 4CJKA 4CK1A 4ZMMA 4O55A 3SUNA 4F4WA 2FBVA 3HXMA 4FW1A 1VSDA 3QEPA 3SNNA 2XI3A 1T05A 3QNNA 3QIPB 3H98A 1U4BA 4WXOA 2I1RA 1LWFB 2OPSB 4CK3A 3OS2A 3DLEB 2FBTA 3MR3A 1X9SA 2FBYA 4CJFA 4FXDA 4K50A 1TKTA 4IH5A 4FZXC 2HWHA 1WSJA 1S48A 4EBCA 3G0ZA 5KG2A 3OYAA 3HVWA 4Q8EA 1BIZA 2JC0A 1MMLA 3V4IA 4IFVB 5I42B 5KG1A 4EEYA 1XR6A 4Y2CA 3KMQA 1S5JA 4FLWA 2W9BB 3KKSA 3AVAA 2IBKA 4QCLA 4FJLA 4J9RA 4DFMA 1RTIB 2D5RA 4KKOA 3GV8B 2YNGB 4CECA 3ZSVA 3CO9A 2GIRA 1LAWA 4DTPA 1RTJB 3RMCA 1CLQA 4NLSA 4DEZA 3H2LA 3PO4A 2OZMA 3PUFA 1JL2A 3GIJA 2RF2A 3S9HA 1JLGB 1DTTA 3CDWA 3BSCA 1KCFA 4KTWA 1NHVA 2JEFA 5EWGA 5F8JA 2YNHB 4KHNA 2BANA 3PZPA 3CJ3A 3AO1A 1KVBA 1WN7A 1QE1A 3AV9A 2YNHA 1NK0A 3TAPA 3HL8A 3SCXA 3PW7A 1C1BA 3E51A 4M3XA 5D3GA 1KLMB 1WSHA 2LSNA 5FRNA 2HVHA 4M3RA 5KFLA 3HT3A 4FK2A 5HP1A 1Z4UA 4F4YA 2R8IA 3SQ2A 1HYSB 3OVNA 4PWDA 1I6JA 2UVVA 4DSEA 1SUQB 4KV8A 4IRCA 2W7PA 1C0TA 3KK1A 1WSFA 1TKZA 1RTHB 4EZ6A 3HYFA 3EPGA 1G15A 1RAJA 3E01A 4F4ZA 1SH3A 4JRQA 1DLOA 4FJXA 3LAMA 1ITGA 4FJ7A 1D1UA 3SI6A 4PWDB 3AVKA 4IG3B 5KFNA 2RDIA 1CXUA 4CK2A 4JRPA 5C24B 3H5YA 3VQPA 1RTHA 4ZP7A 4ECRA 3QIPA 5HROB 3QLHB 1ZBHA 3I5BA 1QAJA 1LW0A 4BDPA 1IKVA 3FDSA 4EP4A 1JL1A 4KRFA 5FROA 3KMSA 3RB3A 1ZTTA 2HVIA 3V9UA 1MU2A 1C0MA 3CIZA 3T5LA 4ZHRA 2I5JB 3PR5B 4FJIA 2B6AA 2BQUA 4HUGA 3V9SA 3ZT4A 2B5JA 4MIAA 1OS5A 3CM6A 5KT7A 3KIOA 3BQ2A 4DL7A 1DLOB 1CXQA 5DG8A 3LAKA 2ASJA 1IKVB 3KJVB 1UA0A 4FS2A 5C42A 2YNFB 4Y34A 1VSFA 5CY4A 4FM1A 2HNZB 1YTAA 3SFUA 4LD0A 3QETA 4FJKA 2IDOA 5KFVA 1JLFA 2YNIB 2AX1A 2JEJA 2XHBA 3NF9A 4CE9A 5DGBA 1LW0B 4HYKA 4NCGB 4WFZA 4NLRA 3U3YA 4E7IA 3DOLA 3KHHA 5HRNA 5J2QA 4YMEA 3D5MA 1HNVA 5KI6A 3I0RB 4FBUA 1ZBIA 5DQGA 5D3GB 4K4ZA 4I9QA 3B6OA 1RBVA 3HPOA 1WSIA 4O3PA 4Z4EA 1C1CA 3VQ9A 1VRTA 3PW2A 4M3ZA 4LY7A 3KTQA 4J2EA 1JIHA 3VN5A 1TP7A 3HKWA 5KFIA 5KFEA 3RWUA 3HK2A 3KD1E 2F96A 3V1QA 1J54A 3OJSA 5L1LA 2OPQA 3BGRB 4NLUA 1NNDA 4RUCA 4RW9A 4CEQA 1HYSA 1QTMA 1IKXB 4IFYA 4NRUA 3IG1A 3TVKA 4K4UA 2FVCA 3K5MA 2ZE2B 4CIGA 2B6AB 2R7YA 1TK8A 4I2PA 3G6XA 5F8NA 4FLZA 4CEFA 3DLHA 5HBMA 2JEIA 3ZSOA 1BIUA 4H4OB 4OLAA 4LQ3A 4E7LA 4NLTA 3Q8SB 1U04A 4EBEA 3C95A 4EP5A 1KVCA 1SV5A 3T5KA 4RW6B 3IS9A 1RT5A 2OH2A 4B8AB 3MECB 2IM0A 3TAGA 2YKNA 2UVWA 1RT6A 3GV7B 2FVSA 3SI8A 4NCGA 5EWFA 1T94A 4H4MB 3VA3A 1VSMA 3FQLA 4KB0A 3OYEA 2HWIA 1X9MA 4NLVA 3CM5A 4Z4FA 1S1WB 4BWJA 5KT5A 2UVUA 4ZVEA 3K5OA 4NYFA 4Q5VA 2RF2B 2CKWA 3WNHA 4HHTA 2P5OA 2R2SA 1HQEA 1X1PA 4PQUA 3TQ1A 3ZSXA 1NJYA 2KZMA 1Z26A 5CZ1A 2GV9A 2FJXA 1TV6A 4GC6A 3VQAA 4M3TA 3S3OA 4C8LA 3SFGA 2AWZA 5FDLB 1KVAA 4ECQA 5KG7A 4XO0A 4ECWA 5J2QB 1HPZA 4MFBB 3MR6A 4FLXA 4C8KA 5JS2A 1RDCA 3H40A 4KTQA 4M45A 4HUFA 2XGPA 1SL1A 1L3TA 4FCYA 1KLNA 3VQ7A 3NGZA 3MEEA 3OYIA 3PX6A 3MFIA 1C1AA 1S1UA 1T7PA 3VQQA 1LAVA 4I7FA 4FK0A 5CYMA 3KK2B 2WONA 4IG0B 3S3MA 4RNFA 4DLGA 1D0EA 1T8EA 5KFSA 3CG7A 1T05B 1JLBB 3RTVA 3S3NA 3O3GA 5F9NA 2DTUA 2R8HA 3DOKA 3OYDA 4Y2AA 2UUWA 1SL0A 3NH0A 3BGRA 2ATQA 1SKWA 1TAUA 4ICLB 2HB5A 3GYNA 5CYMB 3BSAA 2O5DA 2F8TA 1N4LA 3QIDA 4YR0A 4CEOA 4LH4A 3ZT2A 2XY7A 2QXFA 4H4MA 3UDLA 5I3UA 3U6FA 4W5RA 3WNFA 2HMIB 3LALA 2YNFA 3ITHB 2BR0A 4M94A 5CYQB 1R0AB 1S49A 4QWEA 2E4LA 3OL9A 3MEGA 1NK9A 3BDPA 2FVRA 3V6HA 4TQSA 3AA2A 4YR2A 2PYJA 3PHEA 4EYHB 1L5UA 4ED3A 3DOLB 1QAIA 2RPIA 3SUQA 1FK9B 3QO9B 1TL1A 4NLGA 3AVIA 1QUVA 1TK5A 3VQEA 1WNSA 2JEGA 4DQQA 1UAXA 3NH1A 3CFOA 3G6YA 2JC1A 4B8CA 4B9TA 1XC9A 4B9VA 4KPYA 3V9XA 3C6TA 2PYLA 1S0OA 3OYBA 1ZBFA 4DQSA 1D8YA 4FBTA 3PV8A 4OVLA 4QW8A 5T14A 3P5JA 5DK5A 3OYHA 1TV6B 4M95A 4CJRA 1JLCB 4R0EA 1BQMB 4TN2A 3GILA 4CHYA 2KFNA 4CEAA 4AHVA 2ILYA 3RBEA 3MEDB 5T7BA 4AHUA 1RA6A 2EC0A 1S6QB 4F2RA 5J2NB 4ELVA 4NLOA 4IR9A 3HP6A 3K59A 3Q8PB 3LZIA 1TAQA 1S1UB 4BE1A 2YHAA 4CEBA 4KAZA 1LWFA 2OPSA 5DLGA 4BDYA 4DLEA 2VG7B 3O4QA 3LDSA 4HVJA 1XR7A 4MFBA 4O3OA 3CDUA 5C5JA 2V9WA 2BQ3A 1KRPA 3OYLA 4KHMA 2D0BA 1HQUA 4K8ZA 1ZBUA 1HNIA 4MK9A 4K4SA 3OS1A 2ITGA 2CJQA 4N5SA 1BHLA 4F8RA 5DQHA 4ELUA 4FJGA 4DTNA 3PO5A 4DQRA 4OL8A 1B9FA 3VQ6A 4N76A 4IH7A 2ETJA 1JKHA 1EX4A 2D3UA 2X78A 3AO3A 3PJXA 2P5GA 3FRZA 5HLFB 1JLEA 4Z4CA 4MQ3A 3B6PA 4CHPA 1W25A 5KRSA 3RMAA 3BQ0A 1RT7B 3DRSA 3EZ5A 4FJ9A 4E1MA 1U45A 2YKNB 3RB6A 2ILZA 3A2FA 5KG0A 4F3TA 3CQ8A 2R2RA 4O4GB 2VA2A 4O0IA 3H08A 1BQMA 1WLJA 3THVA 2C22A 5KG3A 2I5JA 2W9BA 4ZPBA 3RBDA 3MEEB 1Q9YA 1EXQA 4CF8A 4URQU 1TVRA 1B92A 1C6VA 4QWBA 4I2PB 1TQLA 3D0PA 4K4VA 4CJ3A 4K4XA 2DFEA 2QKKA 2AJQA 3RRGA 2A1SA 3QINA 2ZQBA 2BRLA 4IQXA 3KLFB 4BACA 4OJRA 3AVMA 2X6NA 2C28A 1TL3B 3V81A 1RBTA 1RBRA 3LZJA 4DSLA 3UR0A 1HQEB 4PUOB 3L2QA 3TANA 1K6YA 3AA4A 5KFCA 3JSMB 4EO8A 3M9NB 1RT1B 1RT4B 4KO0A 3DDKA 4URSA 5DG7A 2FLNA 4KHQA 1L3UA 1D9DA 2D3ZA 4WYLA 1KHWA 4F50A 3VQ8A 4CFBA 2WRMA 1J5OA 4E89A 2W7OA 4QAGA 4RU9A 3HVAA 5JS1A 1TKTB 2C2DA 4NLDA 1JLGA 4RW9B 2IGIA 1XHXA 4RG8A 4F4KA 4DQPA 4BE2A 3TAEA 3HPHA 3DLGA 4QPXA 3PY8A 4RW7A 4CERA 3V6DB 3C6UA 3CYMA 2QE5A 2F8EX 1Q9XA 4YFUA 1ZTWA 4CJSA 1N5YB 4DTOA 4IBNA 4M3UA 1YTUA 3AVFA 2OPRA 3MR2A 4LSNB 3NKYA 2WCXA 3NMAA 3IG1B 1N48A 1SH2A 5KGWA 3MAQA 4XIUA 1HQUB 1RDAA 1S6PB 1FKPA 1RT1A 1TKDA 3M9MB 4EYIB 2Y1JA 3GV5B 2FJVA 1RYRA 3OL7A 3ZSQA 3VQDA 3ZT3A 4AHRA 3VQBA 3NGIA 4XPCA 2GIQA 4RW8A 4WYWA 4J9OA 4DFKA 4ED2A 1RT3A 3D45A 1IKWB 4CJUA 1TL3A 2KW4A 4DF4A 5EDWA 2FLPA 1C1CB 2NUBA 1S6QA 4G3IA 1A5WA 4JLHA 1IO2A 1EETA 4DTUA 4DU4A 4Q0BB 4OGCA 1RT7A 3NCIA 4YNQA 3IRXB 4PQUB 3DYAB 4W5NA 4NLQA 3AVCA 4WZMA 4FJ5A 5KG4A 3NL0A 4FYDA 4CF2A 3K5NA 3ZT1A 2EHGA 1UA1A 2XO7A 4B9UA 4J9KA 1TKXA 5KFFA 4NCAA 3ITHA 2ZD1A 1NK4A 3HP9A 1S1XB 1MU2B 4M41A 2YKMB 3NF8A 3NFAA 1DTTB 3P83D 3KHGA 4KV8B 1SUQA 4EO6A 4B3OA 3MR5A 5L1KA 1JLAA 5FDLA 4C8MA 2HHXA 4NYNA 4CESA 2XI2A 5J2PB 3LPTA 4J2AA 5KFOA 4RNHA 2W9AA 1U47A 4CEEA 3LWMA 4ECYA 4JV0A 1K1QA 4LSLB 4NCBA 4KHUA 4K4TA 3DM2A 2GC8A 2VG5B 4C8OA 4CIFA 3SPYA 5I3UB 5J2MB 1T3NA 3AVNA 3VQ4A 2HHUA 2ATLA 1NK8A 4CF9A 3SPZA 1JLQB 3JYTB 4ECZA 1QSLA 4ECXA 3TABA 2E9RX 1RT5B 4TQRA 3NGDA 4CHQA 3OHBA 4DWIA 3IRXA 2W8LA 2VA3A 4AH9A 4ZPCA 5DQIA 3T5HA 1RBSA 2YNGA 5EWEA 3L2WA 3QEWA 4B9LA 1JLBA 1ASVA 4DTXA 3V4IB 4R8UB 3DRPA 2Z1GA 1WAFA 4WE1B 3RMBA 4NYZA 2IM2A 4KB1A 4HCBA 3ISND 1IM4A 2ZD1B 3AA3A 3SYZA 4ED1A 4CFCA 3AO2A 1S1VB 3QEVA 3KD5E 1BQNA 5KFXA 1FKPB 5F9LA 2R8JA 2O4GA 1LWEA 4TY8A 4KHWA 3HJFA 3UIQA 4R5PB 4IOBA 2PY5A 4Z4GA 2BGGA 4ECTA 4Q8FA 4B9MA 1IH7A 1WNEA 3CFPA 3C94A 3V6KA 5SWMA 4HUEA 4WZQA 3OYJA 4FLUA 1EP4A 1A5XA 2IOCA 4RNNA 3IGVA 3CVKA 5KGXA 4LSLA 2VWJA 3SZ2A 5KG6A 1CZ9A 3PW4A 1EKEA 2FC0A 4KTZA 2VG5A 2BDPA 3VQCA 2DFHA 4CGIA 1HNIB 1TK0A 1N6QB 4DTMA 1NOYA 1HARA 3KLEA 2HNYB 4X2BA 2AU0A 5CZ2A 3KLGB 5KFJA 1IKYB 3CJ2A 4K8XA 4JV2A 2E9ZA 1TGOA 4RNMA 3P1GA 1ZYQA 4J2DA 1C0UA 4DSFA 1U09A 3ZSRA 1RTIA 2F8SA 1JX4A 3CWJA 3KLVA 2IMWP 2HNDB 3QIOA 5K14A 3V9WA 3K57A 4DFJA 4E7KA 2B5JB 4KSEB 4AHSA 4IH6A 4M3YA 1JKHB 1HYVA 4L8RB 3LP0A 4W5QA 4CGHA 3NAEA 1YT3A 2XRIA 1ZETA 3CDEA 1N6QA 4O3RA 4W5OA 3JSMA 3AVJA 5K14B 2W42A 3IAYA 3QGGA 4QWDA 1S1TA 4IFVA 5I42A 1BI4B 1VRUB 2G8WA 3TAMB 2OA8A 2IC3A 4DL2A 2FJWA 2GBZA 1T03A 1C0UB 2E6LA 3L2RA 1RTDB 3HHKA 4HCCA 3H5SA 1J5OB 1BCOA 3RRHA 2W8KA 1VK0A 2P1JA 4CHOA 4F2SA 3AVGA 4FJMA 3I5AA 3RR7A 3DMJA 2DPIA 4ID5A 1TVRB 4Z4IA 1KLMA 2C2RA 3MF5A 1NJXA 3DLKB 4NLXA 1Y97A 4OKJA 4MKBA 4NRTA 4I9LA 4DSKA 1S4FA 4ED6A 4ZPAA 4J9QA 1RILA 4CJPA 3G6VA 2DPJA 3OSPA 3GIKA 3AVHA 4CJ4A 1S1WA 3OL6A 3MEDA 4W5TA 3Q8QB 3CFRA 4DG1B 2HNZA 1LWCA 1DTQA 3BR9A 2WONB 3KHLA 5DLFA 3RAQA 4AHTA 4DL3A 1REVA 4KKOB 4XPEA 4DG1A 2OPPB 3LP2B 4Q45A 4ZTJA 3ZSZA 4J9NA 1LV5A 1VSJA 3F73A 3O3HA 2X6SA 4F4XA 4QWAA 3PW5A 4E19A 4CJQA 4NLYA 1RT3B 5KT6A 4FLVA 3UPFA 1SV5B 3RR8A 1D9FA 1ASUA 4I2QB 3MEGB 3CJ5A 4CGJA 2QKBA 4I7FB 3LP3A 5EUHA 2E9TA 3M9OB 5J2PA 3KLHA 4IFYB 4FJJA 2B43A 2E6MA 3PW0A 1VSIA 2EX3A 1SKSA 1FXXA 3DLEA 5JUMA 3HVTA 4IDKB 5L1IA 4ED7A 3QNOA 4Y1DA 4NLPA 3WNGA 4RW8B 3DI6B 3ZSYA 4PUOA 5HLFA 2YKMA 2XY8A 1VSLA 4B3OB 4OLBA 2ASLA 3M8SA 3HM9A 4WFXA 2P51A 3GQCA 2O4IA 5KT4A 1JXLA 3U3GA 4CFAA 3TAQA 1WSGA 1CSJA 4ECSA 3NBPB 1S1TB 1SKRA 3TAFA 4N56A 4F3OA 3AVBA 3NF6A 1ZBLA 2WK4A 4ZVFA 4O3QA 2AGOA 2Z1HA 5KFAA 2XY6A 1RDRA 1VSKA 3OYKA 1HRHA 4E1NA 2V4RA 2VWKA 2R8KA 1S1VA 5F8MA 2DFFA 4CHNA 4IR1A 4CIEA 1RT2B 4DU3A 3V6DA 1REVB 3AO5A 4FJ8A 4MK8A 5HRRA 4DS4A 4OGEA 4R8UA 3PR4A 1U49A 4ZVHA 3OYFA 2QK9A 3AVLA 1BL3A 5KFYA 1HMVA 1NKCA 4ZP9A 5KT3A 3MFHA 3H4DA 3L3UA 2R8GA 4O44A 2XGQA 1S6PA 4ZTFA 2GUIA 3M8PB 1XHZA 5SZTA 3LP0B 4URGA 1N56A 4JS4A 2V4QA 4ZHRB 2G8UA 2ALZA 2W9CB 3KNAA 3KLHB 4EZ9A 2D7SA 3MXMA 1YVFA 1RTJA 1CZBA 3PX0A 2FVQA 1BCMA 4OPJA 4QOZB 1HJRA 1SH0A 2HW3A 4J9LA 3WNEA 4FW2A 5C25B 5C42B 1SL2A 1GX6A 4JUZA 1S1XA 1RT6B 4JS5A 3C6UB 2HNDA 4FLTA 3G86A 4J9SA 3H5XA 2HHTA 1JLCA 4E3SA 4KHSA 3RAXA 3M8QA 1KFDA 2UVRA 3K5LA 4DFPA 3DRRB 2ASDA 1BISA 2OPRB 2G8KA 3IN5A 3VA0A 4O4GA 2IAJA 3FQKA 4DTRA 3OLBA 5KFPA 1KTQA 3DMJB 2BRKA 4B9SA 3KK2A 2IM3A 4RW4A 1BGXT 2J6UA 5CYQA 1R0AA 3OYMA 4FZYA 2AGPA 2PZSA 3BSNA 4FM0A 3FFIB 5EU7A 4KAIA 3DLGB 5HBMB 2UUTA 4QWCA 1S9EB 3SQ0A 1TKZB 4ELTA 1HYZA 3K2PA 4UQGA 4O4RA 3I5CA 2RKIA 3TARA 3KLIB 4IKAA 1FKOA 3OSNA 4YQWA 1JLEB 2RDJA 2RKIB 3QZ8A 4U7CA 3BQ1A 5KFDA 3DOKB 4K4WA 2IM1A 4CHZA 1RYSA 3EPIA 4I2QA 4G1QA 3M8RA 3V1RA 2IS3A 1NK6A 4FJHA 3T19A 1NJWA 5KFRA 5KFKA 4ED8A 4DL4A 1L3SA 3L2VA 5KFBA 4RW4B 1GOCA 1EP4B 4KREA 1QQCA 1A5VA 4KHYA 3HO1A 1HNVB 3I0RA 3QEIA 3IGNA 5C25A 3MTKA 5KG5A 2R2TA 1J9AA 3DI6A 3PJWA 3NGYA 5E41A 2FLLA 2ZE2A 1JLAB 4TYAA 4CJEA 4CGDA 3LP1B 3MECA 1LWEB 2HHQA 3H4BA 1Q8IA 3I8DA 3ZSWA 4FK4A 3TAMA 2HNYA 1VRUA 2AGQA 1JXEA 3OJUA 1VSEA 4J9PA 4CF0A 4PY5A 1U48A 3KJVA 3Q8RB 4GVMA 4CCHA 3OS0A 1I3AA 4TYBA 4E0DA 2A1RA 3M8PA 2D0CA 4TY9A 3V9ZA 1GOBA 4FZZA 4IRKA 3NE6A 4DQIA 3KLGA 4DSJA 1O1WA 1RDBA 4RUAA 3KLFA 1XR5A 4FJNA 3DLKA 5DG9A 3MXJA 5HROA 3K58A 2XWYA 3JYTA 3FSIA 4Z4HA 1D5AA 3KLIA 3RB0A 4B08A 3NDKA 1NHUA 3OLAA 1WAJA 4Y3CA 3V6JA 1QE1B 1IG9A 1S9GB 2D0AA 4AHCA 3GIIA 2WTFA 1RBUA 4G1QB 2RN2A 1VRTB 3DM2B 4CFDA 5J2NA 3QEXA 4GC7A 3DRPB 3F9KA 4ZP6A 4N47A 3ISNC 1S0MA 5C24A 4O5BA 4LQ9A 4Q44A 3DRRA 1W0HA 4CGFA 2IAJB 3E01B 4C8NA 4HKQA 2HAIA 4M42A 2DY4A 4O0JA 4WFYA 1FKOB 4EBDA 3KOAA 5KFTA 2D41A 2B4JA 3O3FA 1T03B 5KFWA 1QHTA 4CJ5A 4GW6A 1LWCB 3QGIA 3ZT0A 4DMNA 3QLHA 4H4OA 4K4YA 4CJLA 4OPKA 3LWLA 3HVTB 4IDKA 1IKWA 4ID1A 4MIBA 2BANB 4FLYA 4TLRA 3LANA 1IKXA 1NKBA 3QYYA 1RNHA 3KK3A 1UWBA 2XC9A 2X74A 1RCHA 3ULDA 4MKAA 2WB4A 1UOCA 1X9WA 2J6SA 2HHWA 1C1BB 4TY8B 4IG3A 5KFQA 4CJWA 1WSEA 4CF1A 3VQSA 4CJTA 3VQ5A 4O3SA 2Z1JA 4M3WA 3EZUA 1HPZB 1RT4A 4KO0B 4IRDA 1S9FA 4DL6A 4FVMA 5DMRA 5KRTA 1L3VA 4KI6A 4OKKA 4MK7A 4ED0A 1S10A 4H54A 2KZZA 5J1EA 2W9CA 3DRSB 3ICLA 2YHBA 1K1SA 3BSOA 2Z1IA 4ZP8A 4ICLA 1DTQB 3QERA 5F8LA 3LPUA 3M8QB 4WXWA 4KE5A 1F21A 3SQ1A 2R2UA 2WOMB 4WE1A 4J2BA 2G8VA 4ZVGA 2FBXA 2HMIA 4NZ0A 1N5YA 3BREA 1JLFB 2YNIA 3MXIA 5HRPA 4BWMA 5KFUA 3I0SB 2G8IA 2BQRA 2JLEA 1RT2A 3KHRA 3ALYA 4Z0UA 4KI4A 4DL5A 4DF8A 3D28A 4Y1CA 1ASWA 1J53A 2VG7A
chains in the Genus database with same CATH superfamily
3CCJS 1E6VB 2O1PA 2FXUA 2Q43A 4CEZA 4YY3K 1KSPA 2V52B 3T5JA 2EKYA 5HJXA 2KHCA 2GHVC 4F0HA 4AILC 3ID6A 3VGTA 1Q95G 3KK1B 1RHUB 2HZVA 2HBMA 4DTJA 5KT2A 3B6BA 3CC4S 4WFAQ 3BEXA 2RS2A 1QSSA 1Q8BA 2B9YA 2AYGA 3MPYA 2A10A 1WC6A 3T3FA 1ESVA 2RSQA 3TNVA 5B08A 1HNXJ 2VFTA 3SMZA 1MN9A 2G8FA 3CD6N 1GOAA 3HZGA 1HMVB 1YZ6A 4C1NK 3L8BA 5ITHA 3O4NA 2X1FA 4PWUA 4Y2IA 1OH5A 2KTQA 2ROGA 3DLRA 4LT6A 4DV7J 5H1SQ 1N8RO 2WOMA 2NR0A 3TX0A 2ZBQA 2XY5A 4A4JA 2ROEA 2C2EA 4FS1A 3GSIA 4DS5A 1CJVB 3H5UA 2DVIA 3HVRA 2E1YA 3G10A 1N0VC 2UXBF 2L9DA 3NHGA 3L7UA 4OYWA 3OL8A 4KFBB 2DR6A 3HMJG 3HX9A 5F8IA 5BR8F 4EIAA 5BRFA 3TU5A 2P9PB 3CQYA 4DR3K 1DHMA 3VGSA 3T1AA 1X4HA 2W6KA 3C6TB 3W5XA 4JI3K 2AX0A 5THWA 2W7AA 3GE9A 4LIWA 4DX5A 2VJVA 4DBQA 3ULHA 3TTCA 1WOPA 1HKBA 2GGPB 3CD6S 3OUYA 2FSKA 3ZEUB 3TUZC 3FFIA 2YXLA 2GAHC 2VHGA 3JTNA 2VGNA 2ZVIA 5MLCV 1NMDA 2VG6B 1KQFB 4BQLA 4IKFA 3O9QA 3BJYA 1RADB 4LSNA 1U6FA 5CCLA 5D15A 1IUJA 5A8KB 4HTUA 3D1QA 3HKZD 2FZCB 2G2ZA 2BH1A 3AA9A 2XCPA 4X65K 2HBRB 2YCHA 1YUWA 3TI0A 1WORA 1T0TV 2ASPA 3KLEB 2OPPA 3LP2A 1B64A 4HHUA 3O6WA 2J6TA 3L6QA 4NASA 3ASMA 1HIYA 2V34A 4NXMJ 2CH6A 1YVUA 1C2PA 2LEPA 3LDOA 2YH1A 3BV8A 2CQCA 4KFBA 3SJJA 2GX8A 4CK1A 4LRDA 3VZIA 3HXMA 4PG7A 1VSDA 3RBXA 4C0OC 1LWFB 1XNRJ 2MKYA 4IO9L 2MKCA 4IOCQ 1X9SA 4CJFA 2FHOB 4FXDA 2F1FA 4TVAB 5C2GA 4IH5A 4FZXC 3M2UB 4EBCA 3TR5A 5HL7Q 2QTDA 5F41A 3OYAA 5I42B 3FVYA 5KG1A 4EEYA 3U9ZA 1CG2A 1XR6A 4KH1B 4CDIA 5AJ3K 3H45C 1RU2A 4QBUA 3R7NB 1RTIB 3GV8B 3ZSVA 5M1FA 3EDQB 5GAGI 3CO9A 2QWRA 3PKYA 3MMCA 2GIRA 4HT5A 4YB7A 2PA3A 1ZZFA 4DTPA 2DH8A 3GOIA 1T02A 3RMCA 1CLQA 1YLXA 2MXYA 4M5DA 3BO4A 2XNQA 2DRBA 4KTWA 3HHNB 2DGVA 5C7PA 2QWNA 2Y0BB 2RQ4A 4V19S 2LA4A 4P2XA 3PZPA 1G3OA 2VL1A 4YOWA 1KVBA 2ZZNA 4WF9L 1ZPVA 3O9UA 4A8QA 1NK0A 4C8ZA 4WCEQ 3G4SN 1Q4RA 4M3XA 1CC8A 5D3GA 2NCKL 1WSHA 3WC0A 5HOOA 1VYAA 2ACMA 1T3OA 3DGPA 4BR5A 2WC9A 4FK2A 1Z4UA 5ETNA 1HYSB 3OVNA 2DXFA 1I6JA 4CZKA 4DSEA 4IRCA 1WSFA 4L3KA 5KQDA 5CE3A 1RHJB 2JOQA 1F0XA 4WKRA 3EPGA 1G15A 2IFXA 2OTJS 4DPTA 2V63A 3E01A 2PMHA 3ATVA 3GJSB 4F4ZA 1SH3A 4FJXA 2LXUA 1ITGA 5HQ8A 3P5TL 2XB2D 3PNIA 2VODA 5ETMA 4FYWB 4CK2A 5C2CA 4QZVB 4WKYA 2RIJA 3H46O 1OH7A 1RTHA 2KH9A 3DRYA 5FJ4A 2HQIA 3QIPA 3QLHB 1URRA 1I94J 1Z05A 3R5JB 3I5BA 1CULB 1QAJA 2AF6A 2N3OA 4C6AA 5D8HB 4M5KA 5KAKA 2YWKA 1JL1A 5C15A 2O8EB 3VVTA 2HVIA 4CLPA 2MQ8A 3HFKA 3Q8UA 3PR5B 5L8RC 4DX7A 3E2EA 4J9VA 3ZT4A 4MIAA 3LGNA 4JKCA 1VQMS 2MLZA 3BQ2A 1DLOB 4OI1A 1CXQA 4NXMK 5C42A 1VSFA 5DO2A 3CD5A 3J7AN 4FM1A 4IO1A 3SFUA 2EG1A 4LSZB 4D3HA 3EKSA 5AQWA 3I55S 2WSFC 2JEJA 4DR4K 2EFGA 1UVKA 4NCGB 3DOLA 2ZBRA 3KHHA 1W97L 5AQJA 3RUBL 1HNVA 1JMTA 5D3GB 3O1WA 1HFEL 1CS4B 5HQLA 1WSIA 5DM7L 4O3PA 2MKIA 1C1CA 4ILMA 4CLYA 5K5MA 1LCUA 2BKOA 3KTQA 3D4JA 2NRWA 2BKPA 2DR7A 1Y64A 4FXVA 2A1BA 3QT8A 3V1QA 2R7VA 4L73A 1M90T 4RUCA 4CEQA 1DQAA 4D3GA 3TSQA 4WF9Q 4DV1J 1RCXB 4DR4J 2DNGA 6FD1A 4IFYA 3AB4B 3CETA 4K4UA 3IG1A 4CIGA 4I2PA 3G6XA 1KEKA 3HHLD 3IR5B 2AHOB 1H6KX 3ZSOA 3M8WA 4HHJA 4BRNA 3U1NA 5M1QA 2OD4A 1ZAVA 2HBQB 4EP5A 3SEOA 4RW6B 3IS9A 1RT5A 2R4FA 3MX2A 2RRBA 4QR1A 2R7QA 3S01A 1R0CB 2OH2A 3D2WA 2WVFA 2IM0A 4UY85 2QMXA 3R97A 3HRGA 3T6BA 2V68A 4X64F 2FVSA 4NCGA 4FVCA 1T94A 2RNEA 3A8IA 4H4MB 4EAHD 1VSMA 3FQLA 1FHTA 4HH1A 3LPYA 3M8YA 5DZ7A 1PG5B 2O3DA 5IT9U 3PSFA 4X4SA 5AJ3F 3K5OA 4JKBA 1IJJA 2LQ5A 3UDVA 2MQLA 3ZSXA 2KZMA 2QI2A 1R7IA 2HQFA 4GC6A 1TV6A 3J7AP 4M3TA 4ECQA 2BA9A 3HD1A 2ABYA 3MR6A 2HG4A 1OY8A 1YK9A 4HT7A 2XZDB 1SL1A 3WXMB 1G1XA 3THPA 2Q79A 3VQ7A 3H42A 2OFGX 3VQQA 1S72N 3G87A 5CYMA 1R8BA 3KKFA 3TX8A 3PXGa 3EM1A 5KFSA 3IAS9 1JLBB 1U2RA 3O3GA 3OR1A 3D0GE 3ZZUA 1REGX 1FDNA 2DTUA 2R8HA 3DOKA 2PEHA 4EHUA 3OYDA 4Y2AA 3HLUA 4U7UK 4PABA 2ATQA 1SKWA 4YR0A 1RWMB 2NUHA 2XY7A 3VALA 3QJJA 3DHWC 3UDLA 4X65F 3U6FA 2P9LB 2CNOB 4W5RA 4JKGA 2OP5A 2N7YA 3WNFA 4YHHK 1EQMA 2HMIB 5D0HA 2YNFA 2E1RA 1KKHA 3CI5A 2E4LA 1UVLA 1D9AA 3V6HA 4HVZA 2OMOA 4I4BA 2PYJA 1BUXA 2DGOA 2QX0A 1QAIA 2AEJA 3LF0A 3WXIA 4ATNA 4NLGA 3UWTA 3AVIA 5LSOA 1TK5A 5K8OA 4JI3F 1WNSA 2E5JA 2ZH7A 2W2NP 1UAXA 3P4IA 1VIXA 5B0CA 2BUPA 1FVQA 1X5TA 1XC9A 4JI2K 4B9VA 4QIWD 4GV6A 4ENOA 3R1XA 3ID8A 1ZBFA 2RHSB 2EVZA 2ZWPA 1D8YA 3JQJA 1SJ3P 4CM2A 4ZLNA 5T14A 3AQPA 3P5JA 4F3MA 4ANDA 3OYHA 3CJKB 1TV6B 3W2VA 3O5TB 4WQ4A 4TN2A 2ZF5O 2KFNA 4CO2A 3RBEA 1YJUA 4YB1P 4LVNP 2CYYA 1MWYA 4FF1A 1NEEA 3HHLC 3HP6A 4P7TA 1NJIT 3G71S 2YHAA 2FPHX 4CH7A 4WQ4C 4U8YA 4BR0A 1CJTB 1VS3A 2F65A 2VQEF 1U1LA 1X9JA 4HVJA 4MFBA 4O3OA 3CDUA 3O1BA 2D0BA 2IDLA 1ZBUA 3NMUA 2WFBA 1NGCA 2MKHA 1B3TA 2F9WA 4K2JA 1VQ9S 1XQIA 4N5SA 2P9CA 1BHLA 2Q2RA 3D2FA 1NSPA 4JI2J 1NH7A 4DR6J 4N76A 4NI2B 2F5GA 5ETOA 4YY3F 2A6OA 2ETJA 1JKHA 1EX4A 2X78A 5LY3A 4FYVB 1YJ7A 4CZFA 4FWMA 4OI2A 3FZHA 2Q6BA 4OHYA 2OGUA 1LNQA 4ZS6A 3RMAA 2ZM6J 3BQ0A 4JBCA 2YKNB 1F9EB 4F3TA 4OIXA 3CQ8A 1B7FA 4KH0B 3DXSX 4O4GB 2XYGB 1WLJA 1MROA 4ERDA 5AQKA 4EWTA 5GIPA 2IIRA 2HK2A 2EG2A 2FC9A 4ZPBA 4FPRA 3MEEB 1HL6A 4A8MP 4U67Q 3HSGA 1N54B 1TVRA 4DKWA 1H74A 2Q66A 1B92A 3E66A 3QT7A 1TQLA 3D0PA 4NLCA 4K4VA 4HTJA 2ZOMA 3PG9A 2ZQBA 1YJNN 5LMUK 3IFRA 4OJRA 4LFCK 1NPKA 2C28A 3V81A 2DIUA 1S79A 4DSLA 1Q18A 1IBCB 4PUOB 3WQTA 2DHSA 3VV2B 2CPIA 5KFCA 3JSMB 1QAXA 3LA0A 4ISFA 1OJ4A 4YUDA 1RT1B 1RT4B 5DG7A 3ADAC 1L3UA 1DKGD 4ZJQA 1KHWA 4F50A 2WRMA 3MMAB 3JS6A 4FL9A 3HVAA 2C2DA 3IKMA 2CJXB 1UCNA 4ILHA 2I0XA 1Y7PA 5M2RA 4CRJA 4B3RF 4X62K 1FRLA 5D0EA 3V6DB 2F8EX 2COLA 3D68A 3U1LA 3HCXA 4DUTA 3OBYA 1URNA 2M70A 3L9ZA 5L38A 4YOXA 1YTUA 3MR2A 2NRZA 3IG1B 5MLCQ 4L76A 1E6YA 1SH2A 3P49B 4XIUA 4QS7A 1OY6A 3DJCA 5GAHU 4EYIB 3GV5B 2VCPA 4XDCA 5JVHQ 1RAHB 3CCMS 2GIFA 4USWA 4IQMA 2MHNA 2RRNA 2J0SD 2OIHA 1EB0A 4LFCJ 2ZWOA 3MMBB 1YTYA 3GJRB 3D45A 2FLPA 4WCEL 2GVDB 1S6QA 2IYGA 3G82B 1IO2A 4CLWA 2HOEA 2HFZA 3JQKA 1BWVA 4YNQA 3IRXB 2X1GA 3CJAA 4NLQA 5IT9O 1IWGA 4CF2A 1KQGB 4DV1K 4UOHA 5T7LB 2EHGA 2WUSA 3QJPA 2DNMA 5IQ6A 4J9KA 1TKXA 4NCAA 3BF3A 3HP9A 1AZSA 3KUEA 3P83D 2H65B 5ETTA 3CMEN 4Q2MA 4Y0WA 3FZBA 4B3OA 1JLAA 2YHXA 2YX7A 1ATSA 3OD2A 2QGFB 2P9IB 3ZX2A 1NNEA 5BN8A 3HDSA 3MR7A 3IMXA 2MYFA 4ECYA 2OANA 2IIHA 3I9V9 3LM2A 1FW6A 3CCJN 4PYAA 4GKKF 2LDIA 3UDCA 2VG5B 3POTB 2IHR1 3DCAA 4C8OA 2FB0A 4BC2A 3L4QA 1EZZB 5J2MB 3DXKA 2HHUA 1WKLA 1NK8A 5EN1A 1SQKA 3TABA 5LM7E 2KO1A 4RCHA 3DU5A 1BA1A 1WBDA 3C6AA 4JI7K 4DWIA 3IRXA 2RQMA 2DISA 2CQBA 3D0IE 2VA3A 4DV7F 4F0MA 2KB2A 4GKJF 4YORA 1JCEA 1WAFA 4KB1A 2DB1A 4K59A 2ZD1B 4OZ5A 3CJTA 5EGYA 1Q8LA 1KP6A 5F9LA 1ZOTA 1I94K 1LWEA 4KJIA 1N8RT 2XHCA 4B3RJ 3OUYB 2HRUA 4Z4GA 2DCUB 4HI2A 2VUGA 4DDFA 2ZH2A 1IH7A 4WZQA 3OYJA 4G1PA 1A5XA 2ZZTA 2VFUA 3KG1A 3NGUA 2NRHA 1CS4A 3GMGA 2P5VA 4JI0J 4GV3A 1SCJB 3NCPA 4M63A 4DV0F 2XS2A 1U02A 1O6XA 4KTZA 5A6WA 4YB5A 3TSPA 2HKEA 4LFBF 2JHEA 1YHQN 1N6QB 1ZM3A 2OKQA 1GLBG 4DTMA 1HARA 3KLEA 2HNYB 4DUYK 1TR0A 5CZ2A 2YVSA 1IKYB 3CJ2A 4CZCA 2E9ZA 1TGOA 1RWOB 1ZYQA 4LR7A 4JNEA 2RUGA 4MIWA 3P5BP 2G1HA 2M9KA 1I5OB 4IEIA 1IBLF 4DMZA 3O8MA 3KLVA 4L75A 2ZJQL 2X7IA 3LGMA 4JI6K 3V9WA 1T6CA 4DFJA 2GCFA 2B5JB 1P6TA 5BJRA 3PIOQ 4IH6A 4YDXA 1JKHB 3LP0A 3E8OA 3FGUA 4RO0A 3G96A 3CDEA 2I2YA 2DNRA 1M1KT 3AVJA 3QGGA 1S1TA 4IFVA 1BI4B 1NGAA 1VRUB 2EFVA 5TKYA 2C3YA 1T03A 3AH6A 2E6LA 4UOCA 2O8FA 3L2RA 1RTDB 3HHKA 3PTWA 4OYXA 4FZVA 1IBKJ 4U7BA 1K9MT 2W8KA 1VK0A 3LGHA 4CHOA 2YH0A 3BGFA 3RR7A 4BRKA 2DPIA 1TVRB 2ZVSA 2UU9K 2R9LA 1Y97A 2V2ZA 4BRFA 3NG8A 4I9LA 4NRTA 1U1NA 4GV9A 4N8OA 3RAMA 4J9QA 4M5DB 1RILA 2DPJA 2GV1A 4F25A 2GQ2A 2L9NA 2PO4A 1BU6O 2FJAB 4QR0A 4LFBJ 4W5TA 2HS3A 2O8DB 3CFRA 2I7NA 1RJJA 1LWCA 4B3TF 2WBNA 3BR9A 2FZKB 1N33K 4DL3A 1NLKL 5HI7A 4ZTJA 1NUEA 4DCHA 3ZSZA 4JI1F 3WBZA 3SMPA 1UPMB 3LH2S 2NRVA 1LV5A 4B3SF 1VSJA 2FC8A 4OI6A 3I9ZA 3R6GB 1LK7A 4QWAA 4ISEA 4E19A 4WBFA 4NLYA 2MQOA 3M4XA 1S22A 3QSYB 4DZDA 4F02A 4FLVA 1SV5B 1P9YA 2G1DA 3LP3A 1VCTA 1WKKA 3HHLB 4ES1A 4JKHA 2EX3A 5CZXA 1SKSA 4X84A 2XQCA 1QVFR 1UTAA 4IDKB 5L1IA 5IT9Y 3QT5A 3WNGA 2UZAA 3CJBA 1OY9A 4P10A 5HLFA 3GSDA 3MCNA 5BYQA 4FWNA 3O9SA 3HM9A 4WFXA 2P51A 3GQCA 3M2VA 3HOSA 2MTLA 1ATNA 1S77D 1CSJA 1S1TB 3TAFA 3R6LB 4B1UB 5G0RA 3KJNB 4JI3J 3AVBA 3NY0A 2VDHA 1ZBLA 4BBYA 5M1KA 1RDRA 3WZ0A 1SZ2A 2V4RA 2VWKA 1S1VA 3ZZOA 3CEDA 3G82A 2DFFA 3VEWA 4CHNA 3CNQP 2JRSA 4CIEA 1RT2B 2DPNA 4ZVOB 4DU3A 5GMEA 4GVEA 3MM8A 2GVZA 5KFYA 4DHVA 3E9LA 5BRDA 2FJBB 5KT3A 2R8GA 4CO0A 4O44A 3GJTB 4ZTFA 2GUIA 3M8PB 1XHZA 2E5HA 2ZH4A 5D6GA 2D0OA 2G8UA 4IOAL 3QDKA 3KLHB 4O8KA 1Y0HA 1CJTA 2D7SA 1YVFA 1RGIA 4P72A 2QWQA 1FA0A 3VR1A 3PRVA 1Q8KA 2ALYB 3MN9A 4OPJA 3DKDA 1HJRA 4RLEA 4JKEA 4KIAA 4QIGA 4YOTA 1U25A 1VQKN 4DR5F 2HNDA 2DTJA 5E5NA 3A8JA 4J9SA 4JV5K 3CPWR 4YY3J 1WSVA 1S6UA 2UVRA 3K5LA 2M4MA 1WOQA 4BRMA 3N5BA 3IN5A 4O4GA 4DTRA 3OLBA 2EK6A 3DMJB 4WU2A 2IM3A 1BGXT 2J6UA 1R8AA 4FZYA 3MCOA 3A3NB 3AHPA 1MDUB 3OW2R 4KAIA 1N36J 1S9EB 5E0OA 3SQ0A 1TKZB 4ELTA 4JYAF 5FLXU 1PYOB 2RKIA 3KLIB 2CRLA 2LU2A 4DPUA 1V4TA 4DX6A 1JCFA 4YQWA 1JLEB 3BQ1A 5KFDA 3DOKB 2IM1A 2Z30B 4CHZA 3D7EO 2GEMA 4I2QA 2CJKA 2JJ4D 2QA4G 3M8RA 1N32J 1HBUB 4MMOA 1NJWA 5KFKA 2J9DA 2P9UB 3C7NA 4A5BA 2XMMA 2QA1A 3HO1A 1QQCA 2QWPA 3I0RA 4KHYA 4OX9J 3EZOA 1Q16B 1FESA 3IGNA 1PILA 5HMXA 2R2TA 1VC6A 5GAHI 1HI1A 2ZE2A 1HBMA 3DXBA 4CGDA 3LP1B 1NPRA 3EVOA 2HHQA 3H4BA 1FX4A 2EFPA 4M5JA 3TEHB 1DQ8A 4K2XA 2HNYA 2AGQA 1JXEA 5AJ3J 4CF0A 3Q8RB 2QWOA 4GVBA 4KPCA 2P6TA 2V4JA 2DH9A 4TY9A 1Q7LB 2LA6A 3UDEA 4FZZA 2DGSA 1JWWA 4USIA 3P31A 5KOWA 2XS5A 2LXFA 4RUAA 3KLFA 1VOMA 5CD4H 3AB2B 1CJUB 3RB0A 4B08A 1D5AA 2XULA 3NDKA 3JSRA 1RDWX 3OLAA 2HEKA 4PKIA 5IV3A 2KKHA 3W5YA 2HIQA 5CCMA 3L7PA 4AHCA 2LQJA 1NU4A 3CD7A 2E1CA 4G1QB 1NMNA 4ER8A 4AQYF 2RN2A 2Q0UA 4CZEA 1TTHB 3DM2B 3VAGA 2ZJRL 3IBCB 2ZJQQ 3F9KA 1F3FA 1Y9OA 2WSEC 4LQ9A 3DRRA 4L74A 1W0HA 2J7UA 3IFEA 4M63C 2VQFK 1VQ8N 2FSNA 1R59O 2LEBA 2KG0A 2NRXA 2HAIA 2GA7A 4O0JA 2DEIA 2D41A 3P38A 3TUPA 1GT8A 5A8RB 2MQPA 1T03B 3KHYA 2HLUA 1LWCB 4DMNA 2XZWA 5A8WB 2OEKA 5F3TA 4GMKA 2F9TA 4CBUA 3DLJA 4WK3A 2F63A 3C15B 2OAUA 3HVTB 2AYMA 4UOFA 5BPLA 1KXPA 4FLYA 3EE9A 1TZ0A 3ZC4A 3KK3A 2XC9A 1QD1A 1FNOA 2WB4A 1UOCA 1H72C 1X9WA 1B0VA 5KFQA 4M5NA 1NWKA 4CF1A 4C7QA 3VQSA 3VQ5A 2AV5A 4CT9A 1OSCA 1M5OC 1HPZB 4IRDA 2ZHOA 5EY4A 2MEWA 4FVMA 3T1YF 2WVEA 4LFAJ 4ED0A 2GZOA 2W9CA 3U27A 3VZHA 1DFDA 4BVOA 4CZHA 3DXKB 3QERA 3WUHA 4DQ8A 2J76E 1U1RA 3M8QB 3M2VB 3I87A 3TRGA 3I32A 1SJFA 2HHHK 2G8VA 1F5BA 4ZVGA 4KGVB 4A8XA 3I56N 3MXIA 3MWTA 2KJVA 1UJ4A 3WC2A 1ZPWX 2V69A 5KFUA 4DPXA 4I6MA 2D3OR 2XMKA 4JD2A 2G8IA 1VHFA 2OEMA 6AT1B 1HLWA 1HBNB 2PI4A 3U9DA 1RT2A 3H3OB 1GXUA 1AROP 1L3KA 3CCWA 4KI4A 4DL5A 4GO7X 4PL7A 4Y1CA 3OTCA 3ZTPA 4A57A 4H8KA 3KK3B 1NAQA 3L3VA 1I39A 3SQOP 1DT9A 4IUFA 3CUNA 1JXBA 4KH6A 1FJ7A 3CJ4A 1X4DA 1KFSA 2WB1D 2YTCA 1VQOS 3VAHA 4NYOA 5LJ5Y 2M2BA 2OPQB 3UVJB 1WC1A 4DV5J 1YRXA 4U6PA 2Y1IA 1VQ7S 5CYJA 4JI0F 2HHSA 4OLPA 5KFGA 2KFZA 4O44B 2OD6A 1S7HA 2GJIA 3FSXA 2YX1A 2DGXA 4QQBA 4YP3A 1HA1A 1X4EA 7AT1B 2MQQA 4DTSA 1VQ5S 1GX5A 1UETA 3QGHA 3AD8C 2NS1B 1YZ7A 2IC3B 2WHOA 3NBPA 3VGLA 1YJWN 2M88A 3IAM9 1NJZA 2DY9A 4O5FA 4CJVA 2C2ZB 1LW2A 4BE0A 2ZHAA 4YR3A 4QW9A 1XI1A 3WX4A 1S9GA 2UP1A 4K5SA 2M0GB 1IN0A 3SV4A 5HP1B 3DC2A 4ID5B 4DV3J 1ITPA 1QS4A 1X0PA 2L9WA 3OYGA 4RNOA 3J80U 1PAUB 1YQHA 3A1YG 3UKUB 1PKUA 1A0OB 2IVPA 2GQCA 3OY9A 1S97A 3QGPA 4TXSA 3IDHA 1NKEA 1HD0A 5F8GA 3ZCMA 4J9MA 3CCZA 1NK7A 4Y6IA 3T7ZA 5CH7B 3RGIA 1RTDA 2BE2A 2V8DA 2OYQA 4ZCLA 4DR7J 5ADXA 2C3PA 3DOMA 2HVEA 3HPGA 2W6LA 1BQNB 5IT4A 2HHVA 2HGLA 1GMWA 3EYZA 1KVIA 4OV6A 5JXSA 1FRMA 2VG6A 3L3CA 3MCSA 4KHRA 2V0NA 3SIPB 1CQMA 4RL1A 3G9CA 3QO9A 3AOBA 2OZSA 3DLBA 2QMUB 1MSWD 1S0NA 2E1ZA 3UKRB 1RWXB 3V4MA 2IA6A 1V4SA 3SJHA 3TWHA 1UWBB 3SUOA 4RJVA 1VAZA 1TYQA 1NZAA 5LMNF 3QBCA 5FLXY 1J5EK 1BWEA 5E33A 1RUSA 1A6LA 1B0TA 4XAKA 5J1EB 1ZAWA 3AO4A 2PBDA 1TKXB 4JI8F 3MM9B 4X4NA 3TTFA 3LP1A 4BRCA 2W2MP 3BKTA 3GIMA 1X4GA 4NLWA 5GAGP 1IR0A 2AQ4A 2UUCK 3OHAA 1HWJA 3EX7B 4C9DA 4UUWA 1T11A 4CO1A 2Q3SA 1K0VA 4NA3A 3SUNA 4P2FA 4O55A 4JI1J 2EC2A 3RSEB 2UXDK 4FW1A 3SNNA 1Q78A 3QNNA 3QIPB 4MDBA 2I1RA 5LXYA 5ETSA 4LF5K 3OS2A 4B1YB 4HI1A 3ZFVA 1WSJA 1S48A 2IRYA 3J7A1 4ZLLA 5KG2A 2AT1B 3AY9A 2Y1LB 4B3MF 4B1WB 5BYSA 3V4IA 3P4UB 9ATCB 4MYUA 3VAFA 4Y2CA 4FLWA 1WD6A 4PAAA 4DV5F 1LK5A 1GH8A 1V3ZA 5JMVA 4FJLA 4J9RA 4DFMA 2KM8C 4U67L 4CNZA 3PYEA 3GG0A 3EGWB 5SUHA 2KHOA 1FFGB 1SJRA 1RTJB 3MM6A 4DEZA 1AYEA 1RAOA 4GKKJ 3B82A 2OZMA 3BN7A 3CW2C 1IQTA 3GIJA 3S9HA 1JLGB 1DTTA 3BSCA 2P8IA 2JEFA 5F8JA 4KHNA 5GAEI 3PSIA 5IOLA 1WN7A 3AT1B 1QE1A 1BLUA 2YNHA 4Y00A 4PHTX 3PW7A 2YQ1A 1R8HA 4OJ3A 2D74B 5FRNA 2I7PA 2CPDA 1ELOA 3RBZA 2E5IA 5KFLA 3W2WA 4ZVPB 2H4WB 3A5NC 1XMOK 1PGZA 4KV8A 2KRRA 5A8WA 1VHIA 4ZJOA 4CBWA 1C0TA 2AP6A 2HWTA 1RTHB 3MEKA 1RAIB 4PKDB 3B8HA 1IV0A 4OX7A 1DLOA 1QM9A 3LAMA 2VPWB 4FJ7A 1FXLA 4IDHA 1NGJA 3SI6A 3JTPA 3AVKA 4OYBA 4DZ6A 2FUG9 1UVNA 2H5EA 3UD3P 3H5YA 1SC4B 1WI8A 2QG9B 3WXKA 3PRBA 4ZP7A 4ECRA 1NGGA 2GMHA 4CZJA 5HROB 2P9LA 3IP0A 2DXDA 2YI1A 3BS9A 4DV0J 3KMSA 1UFLA 3RB3A 4KHPF 2B9WA 1C0MA 3JAMY 3T5LA 2BX6A 2AEMA 1EQ0A 2I5JB 3EVMA 4FJIA 2BQUA 4FWQA 1SIZA 1G2EA 5ETPA 1SQGA 2B0GA 4QU6A 1OS5A 5DDQC 1HPMA 1MNEA 5K8NA 5DG8A 1IKVB 4DCJB 3VQTA 3KJVB 2W2PP 1UA0A 3R1LA 4FS2A 2JLGA 3HFZB 2HNZB 4LD0A 1TUGB 3C6HA 3QETA 2IDOA 5KFVA 1JLFA 2YNIB 4WK1A 2BUNA 4NZ6A 5DGBA 1LW0B 3G71N 3AXMA 3C3LA 3EUNA 5AQHA 3GFXA 3U3YA 1PC4A 3CJKA 1PYTA 3SMSA 3I0RB 1JJ4A 4K0KK 5IM0A 1VQ8S 1Y5LB 1XNQK 4NL5A 3UFCX 1YF5L 2P6SA 4PL8A 5AFUH 3NOCA 3D6TB 1UKUA 3A8YA 3GZ7A 2BJ7A 3VQ9A 4M3ZA 1JIHA 5KFIA 4M8LA 2VWBA 2XG8A 4DXLA 2HSEB 3THXA 4FWPA 2DR5A 1MWMA 3HK2A 4DR7K 1M1KO 2YQ3A 2BJ3A 1J54A 3TJ8A 2OJ3A 5L1LA 5JJBA 1NU0A 4RW9A 1HBOB 2ZDOA 3AAPA 3SSQA 4K5RA 1XN9A 1QTMA 5KPZA 4NRUA 5EX3A 2FVCA 4OMFG 2R7YA 2B6AB 5LJ3Y 3ZZPA 5HBMA 2JEIA 4DV3K 3D2FB 4BC3A 4H4OB 3R3TA 3H7HB 4LUBA 1U04A 3QJLA 2QL7B 2ADCA 3C95A 2EKNA 4AFFA 2Z57B 1Z2ZA 3TAGA 2YKNA 1RT6A 3GV7B 3M32A 3SSRA 5EWFA 2CZ4A 2DITA 2B4PA 5CAAA 2NREA 3OTBA 5BRHA 3X3UA 2QYGA 1X9MA 5ELZA 5GMKa 1HWLA 5KT5A 2UVUA 3FBCA 4OI4A 4LVOP 5F2RA 3EKUA 1R89A 2RF2B 4HHTA 1FXRA 4JI5F 5F1XA 3U8XA 2R2SA 4PZVA 1GLDG 1A7GE 1DBDA 2ZHBA 2CAJA 3VENA 4X66F 4BC4A 2NZ4A 1Z26A 5CZ1A 3UB5A 4PXEA 1QUPA 3QWUA 3CCVS 4C8LA 3ENVA 3HSJA 1T44A 3W63A 5J1NA 4XO0A 4M5HA 4V19X 4PEOA 1QZ5A 4ECWA 1HPZA 4MFBB 1D8ZA 4GNIA 1K8KB 2JVOA 3M30A 3QFHA 5BXIA 4LF9F 4FCYA 4KHPJ 1VMBA 2RVJA 1KLNA 5B0EA 3OYIA 2PMWA 3ZTSA 1C1AA 2U1AA 1S1UA 1T7PA 3CCEN 4I7FA 3PYGA 2AW0A 4JI4F 3T69A 2WONA 4IG0B 4RNFA 4DLGA 3E9OA 4OJHA 1D0EA 2J8SA 2ZZMA 3MMAA 4DV2J 5F9NA 1PJ7A 4TNOA 5B0AA 1WHWA 4LFAF 4R25A 2WW8A 2CGLA 2Y0SD 3NH0A 4KT0C 4AL6A 1TAUA 1VQ6S 2HB5A 5DDPC 3QIDA 2EBGA 4CEOA 3OFEA 3CCMN 3M6XA 1M90O 1GAOA 1MMNA 1HWIA 2DHAA 3BYPA 3D67A 2LEAA 1X4AA 2A3ZA 2IRUA 1RKIA 3BO3A 3O80A 3BP8A 3LALA 2BR0A 3NLCA 4M94A 1O13A 2O8BA 2KVQE 2MZTA 4QWEA 3OL9A 1NK9A 2FVRA 7FD1A 2V6AA 2ZH9A 3KYLA 2NYHA 4CLSA 1KD1T 4M5MA 1XUPO 4H5VA 1RBOB 1S99A 3K9JA 2J9DE 2HGNA 2WAQD 3VGKA 3GG1A 4XH5A 3JSYA 3P39A 3VQEA 2JEGA 3T1HK 3PACA 1BQXA 2AKWB 1VIOA 2ZBPA 1X60A 2X1AA 3QSIA 2HGMA 4B9TA 3FZ2A 5HSPA 3R1HA 2AIRB 2RD5C 5AQTA 1S0OA 1U1OA 3ETMA 3OYBA 2QFJA 2ZWHA 1VQPN 3PV8A 4OVLA 3F5TA 2QL5B 3NGSA 2JLFA 3MCPA 4M95A 4B17A 4ETXA 1Z6RA 4LF5J 1JLCB 4R0EA 5A2QO 3W1YC 3GILA 4LRBA 4CEAA 1J6ZA 4NI2A 2XEXA 2AYEA 1RA6A 1U0SA 2B3TB 3C16A 2MZ1A 3ZETB 4L6V3 4F36A 1K8KA 4F2RA 4ELVA 4ZDNA 3HSZA 3CHWA 2A18A 1TL7B 4NLOA 4IR9A 3K59A 3LZIA 1TAQA 4DV2F 1S1UB 2E88A 2OPSA 4DLEA 3NRBA 2VG7B 3CMAN 3FCHA 3C7NB 1XR7A 2NRTA 1PBUA 3TYTA 3R9PA 4FKXA 2BQ3A 1KRPA 3OYLA 4FOIA 2D9OA 4KHMA 1O5JA 5ADZA 4P74A 1WTFA 1KWMA 3OXFA 4ELUA 3MTJA 1VBXA 4DTNA 1FJGF 4YB6A 4OL8A 5ADXH 1B9FA 3I96A 1XERA 1EJ7L 1T9WA 1RB0A 2D3UA 3AO3A 2QLXA 4BC9A 4KY3A 4ITSA 2OMLA 3TZWA 1H7WA 1CPZA 3OXGA 4ZLJA 3EZ5A 1H0HB 1OSDA 4E1MA 2YWHA 2AD9A 3M6WA 1YJTA 2RQCA 3UKRA 2DR9A 1RSCA 4M1KA 5GADU 2R2RA 3K5PA 3IM9A 3H08A 1BQMA 3KJQB 1W2BM 2XHWA 3F2KA 1Q86O 4OJ1A 2C22A 5KG3A 1TYQB 2I5JA 4KQZA 3FC9A 3RBDA 4DL0C 3AOCA 4CF8A 2O8EA 2OELA 3DHXA 2VYPA 1YRTA 3AARA 4CJ3A 2AJQA 4CI6A 2BRLA 4IQXA 3AVMA 1YITN 3SCLE 1TL3B 1B0PA 2EEYA 2P9EA 3CJ9A 2BTFA 1RBRA 5AQQA 3LZJA 4DV2K 2C1EB 2K3IA 4OX8A 4WJBA 2POKA 1I1GA 4M7XA 3QAUA 3T9NA 2J5AA 2NQPA 2F7TA 3OVAA 2N7CA 2D3ZA 3MM7A 2DHHA 2WBRA 1J5OA 2DXEA 3BUZB 4QAGA 4RU9A 4QYRA 4A47A 5JS1A 1WEXA 4RW9B 2W4CA 1E6YB 2V8VA 4CYUA 3ENAA 4BVPA 4BE2A 2AYBA 4QPXA 3PY8A 4RW7A 3CYMA 2QE5A 4PXBA 4YDDB 4YFUA 2RT3A 1ZTWA 4CJSA 3CE8A 4QR2A 2KT3A 4IBNA 2MZSA 1YITS 2OPRA 3BY5A 2QW9A 4OYOA 4AM7A 2ZBCA 1S6PB 3M9MB 3I6PA 1ZA2B 3TA1A 3M1FA 4LF1A 3O3LA 1RYRA 4UW2A 5M1PA 4G1IA 5K8PA 2V8GA 4XPCA 2HMPA 3A0IX 2AZ1A 4WYWA 5FPEA 1F1BB 2A5XA 5H9EJ 1TELA 1Y11A 4USHA 1U2CA 5BREA 2CPEA 1FD2A 3MN5A 3GCXP 5EDWA 1C1CB 1CBKA 1TU0B 4WU3A 1AZSB 1JNRB 2M8DB 4DU4A 1KC8T 1RT7A 4W4MA 3D7SB 3DYAB 8AT1B 2YKPA 4WZMA 1VISA 4DR2J 1N34K 2RE2A 4LFAK 2BJEA 3ZT1A 3GR0A 4GVBB 2BMBA 3C8YA 3ITHA 4P9SA 1S1XB 1MU2B 4JI4K 4M41A 2YKMB 2F3JA 3NF8A 4CWBA 3KHGA 4KV8B 4EO6A 2IY5B 2B9XA 3D2EA 3MR5A 2HS0A 4L3QA 1YAGA 4LF9K 2NZCA 2F8MA 5U47A 3TUJC 2NXEA 2HQGA 3CC7S 3OFFA 4I69A 3K89A 3GCWP 4NYNA 3UNGC 1LOUA 1HX1A 3IXQA 4J2AA 2GFFA 2XSJA 4RNHA 1TUWA 2XM3A 2W9AA 1DGKN 4OYZA 3LWMA 3FLCO 1X4FA 3OPKA 3M1VB 4OYPA 3W66A 2EW9A 3J8AA 4NCBA 4JKDA 4KHUA 3DM2A 3CIMA 1H2TZ 4DI6A 1D09B 1WDTA 2CXEA 3SPYA 1T3NA 4R79A 1HR0F 4F3QA 1JLQB 3ET6A 4ECZA 2E9RX 3FZFA 4TQRA 3NGDA 3MMJA 3B78A 3OHBA 1X3MA 1OYDA 5GAEP 3VERA 1WG4A 3VMFB 3W9JA 5DQIA 3N79A 2BEFA 1K44A 2ZH1A 3L2WA 2F4VJ 1XMQF 4OZJA 4WE1B 1IWAA 3RMBA 4NYZA 2IM2A 3RSEA 4TLQA 1LXNA 3AA3A 2W2OP 4DV3F 5HMZA 3SYZA 1UEKA 4ED1A 3AO2A 2P9GA 3W65A 1S1VB 3VGVA 1D4XA 3KD5E 1FKPB 2R8JA 2O4GA 2J8AA 3QPIA 4BR7A 3FMBA 2KXFA 3IWNC 4MAKA 4IOBA 2UYTA 2PY5A 3MGJA 2BGGA 4ECTA 4PR6A 2ZNZA 4PWWA 4Y65A 1WHVA 3CFPA 2VIHA 5IFMA 4C3KA 1JJ2R 4PXCA 5ETLA 4BGBA 3VPZA 4RNNA 1FKAF 1JNZB 5KGXA 5HL7L 2P9SB 4LSLA 2VWJA 1LEOA 3SZ2A 1T9TA 1EKEA 2PIIA 3OTOK 4CGIA 1TK0A 3TW0A 1NOYA 2AU0A 5CR4A 4K0KF 1XEZA 4JV2A 5A76A 3HM8A 4RNMA 3R7BB 2DY1A 3FBBA 2V2QA 1EWQA 5BYRA 1FWLA 1UZHA 3CSKA 1MLAA 3H2VE 3ZSRA 1RTIA 1JX4A 3CWJA 2H4YB 5I9EB 1HBNA 2IMWP 1U2VA 2HNDB 3KFWX 4CLTA 3R8EA 2ZOFA 3K57A 3CB4A 4E7KA 2H9ZA 1Y5IB 2DHGA 3WX8A 3AODA 1RHRB 4GRSA 3AXKA 3M5RA 4CGHA 3NAEA 2XRIA 2B4VA 4W5OA 3JSMA 1XMQJ 2Y3YA 2VB6A 4KHPK 2YPZA 2G8WA 3ZZ0A 3WEEB 4RWXA 2FJWA 2GBZA 3PIPL 1YBTA 1BCOA 1HHTP 3TOQA 1UPPA 2P1JA 4FJMA 3W64A 2BABA 2AA4A 1C4AA 3B8AX 2CQ2A 4NEYA 1BC6A 3D3BJ 5HVHA 4Z4IA 2ZFHA 2C2RA 3ZNJ1 1NJXA 4QPTA 1YWXA 4DSKA 4ED6A 2P9UA 2M7SA 1UJ5A 3G6VA 3GIKA 2E5GA 4CJ4A 1RZMA 1S1WA 2IVFB 3U02A 1GMWD 1Y3JA 2AJ2A 4WFBL 3P8BB 3VHQA 3Q8VA 2WONB 4P71A 2C3UA 4IFEA 3FCVA 2WW4A 4ZCMA 3HHLA 1Q5YA 3L4IA 3O3HA 2H51B 3KXDA 2ZJPQ 2F4VF 3SLCA 4CJQA 3I4PA 3EJMA 2DNKA 5KT6A 1YVNA 1O51A 3T9ZA 3LDLA 3CJ5A 5C2DA 4WPAA 1PJ6A 2F9JA 2E9TA 5J2PA 3GWCA 2VV5A 4LF4F 3PW0A 3DLEA 1ZM9A 4OYMA 1M0SA 3QNOA 4I56A 2WBMA 2MLXA 4RBVA 3IR6B 2E2QA 2ZH6A 2NNWA 4DV6F 9RUBA 1JCGA 1AW0A 4UY8O 4UF4A 4ZA1A 1HWUA 4B3OB 1NSKL 3FEXB 5E3QA 1RLDA 5KT4A 1ZH5A 5G0RB 1FNXH 3TAQA 1WSGA 4N56A 2E2NA 2E2OA 3HZ6A 4ZVFA 3VAMA 4FSVA 2Z1HA 3W5ZA 2ERRA 4NE9C 4XK8C 3Q23A 3WXLA 3KDNA 4IR1A 2BOPA 4MLHA 4XH1A 3ZTRA 5K9FA 4DS4A 5HRRA 1Z2LA 4OGEA 3ILIA 4R8UA 1XQSC 2G13A 4XEIA 4ZVHA 2QK9A 3C66A 3AVLA 2MKKA 1KOOA 2DJWA 4OYAA 2ASYA 2BE9B 3FRYA 1FVSA 4LF5F 2HQCA 2MPUA 4ZP9A 3MFHA 4A5AA 4OHXA 4A8KA 2HIYA 3C16B 4ZIWA 3ZETA 1IBMK 2GHPA 5SZTA 3LP0B 4URGA 1N56A 2CVEA 4AXIA 4Z7YA 2W9CB 4EZ9A 3KK7A 4BRPA 3MXMA 1K73T 3R5BA 3JQMA 3D3CJ 3PX0A 1R0BG 2CDQA 4JI8K 1OH6A 3WNEA 3J81Y 4FW2A 5C25B 3UCGA 2UXCK 5C42B 1SL2A 1J5EF 4DB3A 4LF4J 5LMNK 4RUBA 2VBWA 3C6UB 4IO8A 1RABB 4FLTA 1QDUB 1HJOA 4J90A 1IR1A 3G86A 2YKAA 2IDEA 3M8QA 1WSRA 5E3CA 2XMJA 4CH0S 2NXJA 4WFBQ 3DRRB 2G0JA 2MZJA 2CNLB 3ZXWA 2KI2A 5EX0A 2CG4A 1IG8A 3K8VA 1R0AA 3OV7A 2PZSA 1R6YA 2AJ4A 5T7LA 4AF1A 1M1HA 5HBMB 4QWCA 4IO9Q 1HYZA 4X4VA 4K42A 2E7VA 4UQGA 3TARA 2VBXA 2CWXA 2HHHJ 1FKOA 5JMNA 5HMWA 5JVHL 1JJHA 4H0VB 2RDJA 5FPNA 3QZ8A 4B02A 3F56A 2V4JB 2YHYA 3EPIA 1VQ5N 4C48A 4RKUC 3LM9A 3V1RA 2IS3A 1AXQA 4HR2A 3T19A 5KFRA 1YJWS 1GXLA 4QIVA 2FDNA 2IYIA 3L2VA 1SC6A 2A0FB 5KFBA 1GOCA 1TL4A 4KREA 4B1ZA 4DR6F 2N82B 4FKYA 3MTKA 4UQTA 3PJWA 4I6AA 3NGYA 4G65A 5E41A 2O8BB 1JLAB 1VLYA 4CJEA 2XZTB 1BMQB 3MUTP 3BH6B 4JI0K 1LWEB 1Q8IA 3VOVA 3I8DA 2ZM6K 1SJ4P 1VSEA 1IM6A 3QBWA 2I38A 4J9PA 2O8FB 2E7WA 1U48A 2E66A 2VPYB 3UCUP 3OS0A 1RHQB 3O4WA 4E0DA 3R2CJ 5EVZA 4X66J 2FHJD 1O8BA 1IXKA 1VC0A 3NNCA 2FJDB 3NE6A 4PCQA 3FE1A 1VFJA 1XR5A 3BYRA 3DLKA 2GJ2A 2P9NA 1Q5VA 5HROA 1ATRA 3JYTA 1LKZA 1LQ9A 3DXMB 2VQFJ 3DOMB 2UXDJ 1RCOB 1WAJA 5DM6L 3LDPA 3GIIA 4JI7J 2A6AA 2PDAA 1ILYA 2QFIA 4LR8A 4CFDA 3QEXA 1S0MA 5C24A 4O5BA 2UUBJ 4I6YA 3MK6A 2IAJB 3E01B 4HKQA 4LR9A 2CPYA 3OBIA 2DY4A 3MAAA 1EQYA 1FKOB 3KOAA 4WIQA 4Z2XA 4CZIA 4BRLA 2IBOA 5H9FK 1J5EJ 2PFFB 1IVZA 2HAFA 3QRQA 2E29A 1H38A 3QLHA 3ONQA 4K4YA 3TO8A 5AZIB 4Y2KA 3LWLA 1IKWA 4ID1A 3L09A 2BANB 3FNNA 2WVBA 1NB2A 2CQ4A 3R5DA 3A5LC 1K8AT 3IR7B 2J6SA 1NM2A 2WVDA 1C1BB 3RW6A 1HNXF 4CJTA 2VC1A 3AY0A 4M3WA 3EZUA 3UE2A 1Q81O 2FHKA 1RP5A 2CGJA 2XBPA 4KI6A 1XIQA 4OKKA 1HBOA 4EGLA 3M32B 5I3QA 3QMLA 2YHBA 3BSOA 2Z1IA 3WHIA 3J81O 3FEZA 4ICLA 2RUSA 1VQPS 4K8RA 1K8AO 1YJRA 2VQFF 4BREA 3I8BA 3EE3A 4QOTA 4WE1A 3NNAA 4J2BA 2QLJB 3SAHA 4U9RA 5CA5A 2ZDPA 3OFGA 4E8UA 4OHVA 4BWMA 5IV4A 3A3OB 1RGVA 2BQRA 4LRAA 1I51B 1LXJA 4QU7A 5JVGQ 1U8SA 4LBIA 1X5SA 1VBZA 3ALYA 1XC3A 3EMTA 4DF8A 3D28A 2PMZD 1N0UA 4USTA 1ASWA 1J53A 3B4DA 3CJRA 2FY8A 2XMUA 2GW8A 1W7WA 3HSTB 2HPUA 2QWMA 1RWWB 2JSXA 4OHWA 4IYQA 5C12A 4IG0A 4X62J 2D1KA 2IJNA 1TL1B 2YJEA 5L1JA 3VAJA 1C0TB 3UN2A 4KBIA 4Z7CA 2G8HA 2QZ8A 1GEHA 4UUXA 4ZK7M 1LW2B 4C4WA 2RMLA 3Q7CA 3CJ8A 2V51B 2IJFA 3KJFB 2Q3PA 5E3PA 2YV0X 5IWAF 1RAEB 2FGOA 4E7HA 3RMDA 3KKRA 5E84A 1PBAA 4J37A 2DYAA 4TU8A 4NOHA 4O3NA 2Z56B 3NS7B 3OYCA 1S9EA 4AD6A 3Q7BA 3NF7A 4L72B 3SUPA 1TL5A 3AA5X 5FLXO 2VQEJ 5TKWA 2FVPA 1RA7A 2R7WA 2CQPA 1B9DA 4NXNF 4XH4A 3PVXA 3NAIA 1CQNA 3NAHA 2G0CA 3VEZA 3IC1A 2BV3A 4KC5A 1RI7A 3RB4A 5FRMA 4BRDA 4LRCA 1LFPA 3UNYA 2BE2B 3EE8A 3A8EA 3S6EA 1W9HA 4H03B 3BPSP 2V2VA 4CO3A 4E7JA 3O6QA 3V81B 5LSRA 1HWKA 1VDHA 4RW7B 2GELA 3Q2SC 5K20B 4R5PA 4DU7A 1HLUA 1FK9A 4YOUA 4N41A 4ED5A 2XCAA 2A2DA 3EY1A 2PC6A 3QESA 4JV5F 4QS8A 1QSYA 5EX5A 3VTHA 1G6BA 2W01A 4L3NA 3SCKE 4RPFA 3H59A 4CD3A 2D0PA 1NK5A 2XO6A 2K1RA 4WWSA 5KFZA 3WQPA 1NOZA 3H20A 1FDDA 5F8HA 3TR8A 4BG8A 2JGUA 2H3EB 3CC2S 2Y9HA 3N6LA 1Y4ZB 1OQ6A 4R0JA 3OYNA 3PX4A 3M7VA 4OQJA 3C65A 4ETZA 4BRAA 3BBCA 1GLJO 3IS9B 4W90B 5B0DA 1S7IA 1WOSA 4RZRA 1RFQA 1JLQA 2HBYB 2QT7A 3BKFA 3UW1A 2GQQA 3DYAA 4CJKA 2FYXA 2XSJB 1T05A 1TMMA 2DNHA 4OI3A 2VBYA 3G8QA 2XYHB 4WXOA 3LDNA 2OPSB 2H3GX 1SBRA 3CIPA 2JNJA 5ETRA 2KYZA 2BZ2A 3ULEB 2VOOA 3HHEA 3DLEB 3THYB 2CQ1A 3D1HA 2E20A 1QQNA 3LTOA 5GAEU 4K50A 1IBKF 2HWHA 5D4LA 5LL6d 1DURA 5ETVA 4DCOB 1S76D 1Q79A 3HVWA 1MMLA 1OVYA 1UVIA 4IFVB 3CC2N 1DEJA 3S41A 3KMQA 2K2PA 1UVMA 3CERA 3KKSA 3AVAA 4DV6J 1F3VA 2IBKA 1QQMA 4Q2LA 2RU3A 2DRAA 4QCLA 3ZNUA 1R43A 2D5RA 1WC0A 4KKOA 1VQNN 2KT5A 2H5JB 1FRJA 2E1MC 4NLBA 3W8PA 4FPIA 2UUAK 1LAWA 2J9CA 4A8WA 3CCSS 1XTZA 3VEVA 3H2LA 2HK3A 5A2QU 4A61A 3PO4A 4PG5A 1AFJA 2RF2A 1WDDA 5KPRA 3CDWA 1KCFA 1F5AA 1NHVA 2YNHB 2BANA 3CJ3A 3AO1A 1EARA 3DRXA 1VQ9N 2Q97A 3AV9A 5LJWA 2CZVC 3TAPA 4YDUC 3SCXA 2RHQB 1C1BA 3E51A 4JEPA 2OTJN 3W2WB 1KLMB 1VQ4S 5HMYA 3US5A 4B3SK 3OW2M 3BF1A 3HT3A 3OQ2A 1F9FA 3I4HX 4F4YA 1N33F 3LPEA 4CLUA 3A3PB 1SUQB 2GTDA 4K41A 2W7PA 2HBJA 3CGIA 4P75A 1NBWA 3J7YU 2M5YA 3HTVA 3HYFA 3CCSN 1KQSM 2LU1A 5MAOA 3G4SS 2DNNA 3NOGA 3UN5A 1RWKB 1QY7A 4CLLA 3EO3A 2DD8S 5G4DA 1H98A 4NB4A 1X4BA 2UU9F 3BGOP 4PWDB 4OZ1A 2MZRA 4N7TA 2RDIA 1WUAA 1Q1KA 2DT9A 4H0XB 5AQLA 4A2BA 4JRPA 4ZCIA 5A2QY 3CXCR 3VQPA 2BE7D 2KXHA 4EHTA 4BRGA 4ZPTR 4ES2A 3KUGA 5HATA 2E8AA 1AB8A 3MUVP 1LW0A 4BDPA 1CJUA 1IKVA 3FDSA 2KT2A 1QVGM 5FROA 1DAXA 1ZTTA 3MD1A 3V9UA 4NPOA 3OBWA 3N9UC 3QT6A 4ZHRA 3UD5A 1EKSA 4RUHA 2CH5A 1VQ6N 4HUGA 3V9SA 4NWBA 5DS7A 2RH3A 2WSCC 5KT7A 4GKJJ 4DL7A 2K06A 3K0SA 3UI3A 1P9QC 4TU9A 4GO5X 2YWEA 3PYFA 8ATCB 2A42A 4LF2A 2YNFB 2LDYA 2NXCA 1VGYA 1PIEA 3VAKA 1WBBA 4Q7AA 1YTAA 2W24A 1IBLK 4FJKA 2FZGB 2VKZG 2AX1A 2XHBA 3NF9A 4CE9A 3MX5A 2DO0A 2P9KA 4WFZA 4NLRA 4E7IA 1WKJA 4U7UD 5J2QA 4YMEA 5KI6A 1YJ9S 4FBUA 1J27A 4DUYF 3KZBA 4OZ3A 3IRWP 3B6OA 3ZX3A 1CJKA 3HFVA 1RBVA 1VRTA 4LY7A 2B7BB 3HKWA 4FNIA 4KRWA 3THWA 4DN0A 4CLZA 1QVFM 3RWUA 4J5OA 4CLFA 4F7VA 1AA1B 3ET6B 2MJUA 3MCAB 3KD1E 2F96A 1LFWA 2OPQA 3BGRB 1NNDA 5AQVA 2I9SA 3TZYA 2XTJP 2DNZA 3K5MA 3MN6A 4YDUA 1TK8A 3TVYA 4FVUA 4XDDA 3TTDA 1ZM4A 5F8NA 4FLZA 4CEFA 1BIUA 1GLCG 2CQGA 3AJ2A 2B8PA 4NLTA 5HQMA 1U2FA 3Q8SB 3DXMA 2GJFA 1GTEA 1QHAA 4EBEA 4GKJK 1ZZNA 4ZOSA 4U96A 4DV7K 2ZNYA 3E1YA 3WT0A 4KR0B 4JI7F 2O8CB 4JD2B 3MECB 2UVWA 7FDRA 2XLIA 2UUAF 3SI8A 1FEEA 3VA3A 4BHQA 4KB0A 2HWIA 5IXUA 1FE0A 4Z4FA 1OPIA 4BWJA 1YX2A 1UL3A 2QTWA 1S12A 3H2UB 4E98A 4QIFA 2CA9A 4NYFA 2CUYA 4E2FB 5AQRA 3WNHA 2P5OA 4A2AA 1N5SA 4CTAA 1NHKL 4X4TA 4CD1A 3VQAA 4EI2A 3NGKA 3S3OA 3SFGA 2Q36A 4WP8A 5FDLB 1KVAA 1IBKK 1FERA 5KG7A 3UD4P 1ZC6A 2X3GA 5J2QB 4CP5A 4N8NA 1S59A 4X4UA 3H40A 4KTQA 1NJIO 4A59A 5BR9A 2XGPA 1L3TA 5IZHA 5IC6B 3ZYYX 3MEEA 3MFIA 3MWPA 4FK0A 1LAVA 1Q82O 5D0RA 2G2YA 1AUSL 1T8EA 1T05B 1V3SA 1RHMB 1YKWA 3DU6A 2OSQA 3RTVA 1M5PC 4B1VA 2DCLA 3H25A 2YWFA 4IJNA 3GP9A 4OZ0A 2UUWA 2J0QD 5LMUJ 3BGRA 3EWGA 2HBZB 4ICLB 3GYNA 3BSAA 2O5DA 4BQZA 2I8EA 1F5CA 1ZM2A 3GYXB 4H4MA 2QXFA 3O9RA 3FZMA 3EGVA 2RJZA 3H6EA 2M3DA 1R0AB 4DUYJ 1Y00A 3LDQA 5AQGA 2G9OA 2VOPA 1KDNA 1RWVB 3MEGA 2UUAJ 4TQSA 2CNNB 3MD3A 3AA2A 2QLFB 4IOXA 4YR2A 1ULRA 1K9MO 2PFUA 4EYHB 3M6VA 1L5UA 3DOLB 4IXCA 3CPEA 4BY9C 1YHQS 3IBFB 3SUQA 3QO9B 1TL1A 1RAGB 2OI2A 3HHDA 3THXB 5AZJA 2MKJA 2VJUA 3R6MA 2LCWA 4B8CA 1Y5NB 4KPYA 2PYLA 4B3RK 4P52A 4DQSA 2XWXA 4LIRA 3RVCA 1RISA 2OFHX 3DLLL 4QW8A 5F0UA 3KG4A 4CJRA 2V7ZA 4NXNK 3W7BA 1M5VC 1OQ3A 3BPDA 4AHVA 2ILYA 4ZJLA 2VZ9A 3ZTOA 4AHUA 1E3MA 2VONA 1NLVA 2EC0A 1S6QB 1VJQA 3Q8PB 3CCUS 4BE1A 2BVZA 4CEBA 5GADI 4X64J 1MWQA 5DLGA 2KRBA 4OPAA 5IWAK 5LMUF 3LDSA 5F0XA 3WIUA 3D9BA 4NXNJ 4C98A 1FWPA 1RBLA 3ZZZA 3FZLA 4WTYA 4K8ZA 3LO3A 1G99A 4K4SA 2E2PA 3G2XA 1KVKA 2V8PA 3SCJE 1SB6A 3U7JA 4F8RA 1RTZA 4AL7A 5DQHA 4UY8T 2MQNA 4FJGA 3CC7N 2DNQA 3PO5A 4DQRA 2QO3A 3VQ6A 4CO4A 1X4CA 2W2QP 1AFIA 1JLEA 3W0LA 4Z4CA 3B6PA 4CHPA 5KRSA 5M2UA 1RT7B 3DRSA 5A0YB 4FJ9A 1NO8A 3RB6A 3A2FA 4WQ5A 4IJAA 5DM7Q 3SCIE 3ENWA 4ED4A 4O0IA 3TSUA 4C1NI 1W26A 3THVA 4PPDA 2FGCA 2W9BA 2BM0A 1HQ2A 2AJ1A 2V7YA 2CDRB 2YQ0A 4QWBA 4I2PB 1WB9A 4K4XA 1SI9A 4USKA 2HQDA 2DFEA 2Q0RA 2QKKA 3QINA 2VQEK 3CPWM 3GONA 4BACA 3KLFB 2C42A 1HHQA 5KPTA 3QB0A 2X6NA 2Z2MA 1RBTA 3ULEA 3P45B 3HULA 5J1PA 4NMXA 2P9SA 1K73O 1HQEB 4ZN3A 3L2QA 1HHSA 3AA4A 4EO8A 1K0TA 1HNXK 3M9NB 3DDKA 4URSA 4KHQA 2CGKA 4P6QA 2HFNA 2FQQB 3HI0A 1YJNS 4WYLA 4CFBA 2IGIA 1XHXA 2IVNA 4JK9A 4F4KA 3DLLQ 3I55N 3THWB 3NEKA 3CMQA 2BACA 2IRXA 4JI2F 3GFYA 3C6UA 2LKZA 5LMNJ 3BZQA 2O01C 1SS6A 1Q9XA 1FRIA 1RWUA 3WIVA 2J0WA 1RKJA 4M3UA 4FP9A 3Q83A 1VHXA 3NCQA 1PC5A 4WP3A 2O8DA 5KGWA 1IQZA 2A41A 1HQUB 4MKYA 1FKPA 1TKDA 4CM0A 4U95A 2KLAA 3PRDA 2FJVA 3J80O 3ZSQA 3VQDA 4QIEA 2LLZA 4MKVA 5FPMA 4C2MA 4AHRA 3J7YI 2CFXA 1JJCB 2W25A 2GIQA 4RW8A 4J9OA 4YHHF 2K7KA 2FD2A 4ED2A 4NMLA 1RT3A 1IBMJ 2C2MB 2KW4A 4DF4A 3I31A 2HS4A 4OYIA 1EETA 5D4PA 4Q0BB 3E3XA 4A48A 2MLYA 4W5NA 3AVCA 3KWGA 4FJ5A 4FYDA 3K5NA 3J7YP 3H90A 5B0GA 4RX6A 2RB7A 2OLWA 1SKUB 2EI5A 1UA1A 3K2YA 2XO7A 4ILJA 3GLJA 5KFFA 3W3SA 2ZD1A 1WJ9A 4OZ2A 1UVJA 2BBEA 4ZIVA 2E7XA 4S0MA 3OXLA 4JP8A 3M2RA 2HVDA 3NFAA 2CQ3A 1SUQA 3GR1A 1B70B 2ZM6F 5FDLA 2HHXA 5LJVA 4CESA 5J2PB 4CEEA 3QRRA 1ZAXA 3J7ZO 4DR6K 2KU7A 4LBPA 3FK4A 2R7SA 1BHNA 3K8WA 4ZVTB 3VF0B 4K25A 1K1QA