4MFBA

Crystal structure of hiv-1 reverse transcriptase in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
544
structure length
544
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Picomolar Inhibitors of HIV Reverse Transcriptase Featuring Bicyclic Replacement of a Cyanovinylphenyl Group.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 143
structure length 544
sequence length 544
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4mfbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4mfbA05
4CGHA 1W25A 2YNFA 4DFJA 5L9XA 5HROA 3OL8A 1KVAA 1K6YA 3AO1A 2HMIA 4R8UB 3VQEA 4PY5A 1X9WA 3T1AA 4NLVA 4ZP9A 4CFBA 3E51A 3LZJA 4J2BA 3V6DA 3B6OA 4J2EA 1BCOA 3I0SA 1TKZB 5SZTA 4DSEA 3AA2A 1LWFA 2FVCA 3V6JA 4DFKA 1O1WA 3HL8A 3C6TA 3CQ8A 4CHZA 4NLRA 4BE0A 2IM1A 4Y34A 3MTKA 3FQKA 4ZVGA 3Q8PB 2HNZA 1HQEB 4K8ZA 3M8QB 5HRRA 2IBKA 3OS2A 4RW6B 3UDLA 5HBMB 1SKSA 1QAJA 3S9HA 1S0MA 4AH9A 5KRTA 3F9KA 4O5BA 4J9RA 3DRPB 2XRIA 4ELTA 5C24A 1S1XA 2LSNA 2B5JA 3ISND 3ZSOA 4I9LA 4B8CA 4DTSA 2GV9A 4CEDA 2IM0A 3NHGA 1LW0B 4JRPA 2JC0A 4CHQA 2QKBA 4CEEA 3LP1B 4FBUA 2C2RA 3HKWA 4FW1A 3V9XA 4DU3A 3B6PA 4KTWA 1B9FA 3TAGA 1VSDA 4QWEA 5CYQB 4JV2A 3DOKA 5FRNA 3H2LA 5J1EA 4ECXA 1IKWA 3V1RA 5CYMB 2YKMA 2ZE2B 3LP2A 1TKDA 3FRZA 4DFMA 1LAVA 1B9DA 1L3SA 4EO8A 3AVBA 3ZT0A 3PW2A 4PQUB 1QUVA 3N6NA 3H40A 3AA5X 1S0OA 3PHEA 4MKBA 1L3VA 4CESA 1RT1B 1RT3A 1TK8A 4FJGA 2HNYB 3QEWA 2VA3A 3GV8B 1XR5A 4MIBA 2RF2B 2DFHA 2HWIA 2R8KA 1BI4A 1JLAB 4IQXA 3ZCMA 1FKOA 1TKTA 1R0AA 3ZT3A 1NKBA 4FJ5A 2BDPA 5JS2A 1WSEA 4IR9A 3NF6A 3DMJA 3C6UA 3RB3A 3MR6A 4J2AA 4Y2CA 1QTMA 3Q8QB 3BQ0A 3PW7A 3HP9A 4F4ZA 3WNFA 1JLGB 4H4OA 3DRRA 4GVMA 3KLFB 3ZSYA 4B3OB 2W42A 3C94A 2HVHA 1RBUA 3MXIA 3MEEB 1S1WB 4CEFA 1TL3B 1S9EB 3KLHB 3I8DA 3NDKA 1N6QA 1XHZA 4WXOA 3PV8A 3IGNA 1BQMA 4M3RA 4F3TA 2AGOA 4KI6A 1HMVA 4FLYA 2R2UA 1EP4A 4CFCA 5HP1B 3QGHA 3ZT4A 4B9MA 4TQRA 2IJNA 5EWEA 3D45A 2F8SA 1VSJA 3LALA 4WZQA 3OL7A 4FJIA 2CJQA 4NCGB 3ULDA 5FROA 4TY8B 4CEQA 4JS4A 5KG3A 3OJUA 3VA3A 1KLMB 4CJKA 1RBVA 4LH4A 2B43A 4CF9A 5KFFA 3T5HA 5F8NA 2ETJA 1BQNA 3MEGB 4KKOA 2HNDB 3MXJA 3H59A 2OPSA 1I6JA 2V4QA 2RN2A 4FLXA 1Z25A 4Z4IA 2PYJA 4FJ9A 4LSLB 4IH6A 3CDWA 4KTZA 3L2VA 1HYSB 5JXSA 4NLWA 1IM4A 3OL6A 1X9SA 3DLEA 1T05B 4QWBA 5EU7A 4E7KA 3G0ZA 4W5QA 3K57A 1IKXB 5HRSA 4NLYA 3KLGB 1S97A 3NGYA 4N41A 1GOAA 3OYJA 3NF9A 3MR3A 4ED7A 3NH2A 4GC7A 1DTTB 3KNAA 3S3MA 4O4RA 1RTDA 2P5GA 1U49A 1VRUA 5KFWA 1RYSA 3L8BA 2AJQA 4FZYA 1RDCA 4M3TA 4E7HA 3GILA 4FLVA 3T19A 1RT5B 3QERA 3MECB 3K5NA 1HYVA 4C8OA 2C2EA 2OPPB 4FM1A 3QLHA 3D5MA 4ZP8A 1C0TB 2ASLA 4B9UA 3ZSRA 3AVFA 2XY5A 1HPZB 3KLEB 4PA1A 1ZBLA 3SV3A 4ICLB 3FFIB 3HYFA 4ZHRB 5K14B 5J2NA 3ZSQA 4J9PA 1JLFA 3VQAA 4KB1A 2BQRA 4R8UA 3CWJA 4ZMMA 4RNNA 3SUPA 2E4LA 1KFDA 1TKZA 3QIPB 4KO0A 4HCCA 4FJKA 3CYMA 3N6MA 1RTIB 1Y97A 2BR0A 4I7FB 2VG7B 3NGDA 2G8VA 3NGIA 4AILC 4ECVA 1HQEA 4H4MB 1NK9A 3M8QA 2IC3A 5KT5A 4DL4A 3AVHA 5HBMA 4FK4A 1C1BB 1TV6B 3M8PA 4ID1A 4K50A 4RW9A 3KHHA 5T14A 4DSIA 2VWJA 2YV0X 4DSFA 3TAPA 4KHNA 2BRKA 4KRFA 2WOMA 3MFIA 1WN7A 4ECQA 1NJXA 1QHTA 1X9MA 3PX0A 4RG8A 1LW0A 3HO1A 3RB4A 4U7CA 4ED6A 3NF8A 4FJXA 1HQUB 3VQ6A 3KMSA 4IRKA 4I2PB 1D5AA 4Y2AA 1LWCB 5C25A 3OYCA 4MH8A 2G8UA 4IG0B 4FK0A 1QSLA 4J9LA 1YTUA 3QINA 4GC6A 2WCXA 3NFAA 5I42B 3QYYA 1SL1A 3AVAA 2ZE2A 4AHSA 3V9ZA 4CGDA 4FXDA 1RTHA 1MU2A 2ZQBA 4KV8B 2EC0A 2GBZA 2KZZA 5EWFA 2ATQA 4OKJA 1GX5A 4Y1DA 4ZTJA 5KFBA 4ECTA 4B8AB 3CFPA 5KG4A 3KOAA 1FKPA 3E01B 2HHXA 1TAUA 4CCHA 4Z4HA 3NAIA 4BE1A 3DRSA 4DEZA 4IFVB 2AX1A 4O3SA 1JL2A 1TVRA 4YMEA 4J9MA 3P83D 3BQ2A 3BSOA 4R5PB 4DQQA 3BDPA 2IDOA 3LPTA 1NK7A 2IAJA 4FLZA 1NKEA 1UWBB 2XY8A 4B9VA 5KFIA 4G1QB 4ZVFA 2RDIA 1HNVB 1S1TA 3RAQA 4FZZA 5KFVA 5HRNA 3VN5A 5FRMA 2QE5A 3ZSXA 4RNFA 2UVUA 5L1LA 3SZ2A 4NLXA 3OJSA 4MK8A 5C42B 3AO4A 3CVKA 4K4SA 4ID5B 1KSPA 4J9OA 3O4QA 1TKXB 2XGPA 1CZBA 4KBIA 1TL3A 2BANB 4IFYA 3KLHA 3UR0A 3T5LA 3AVLA 1KHWA 2V4RA 5EWGA 3PY8A 1T03A 2HWHA 2AWZA 2YNGA 5C5JA 3LP0A 3TAMB 4DQRA 3IS9B 2ILYA 5J2PB 3HVWA 4NRTA 1QE1B 5KT3A 1BHLA 3V81A 5KFMA 2VG5A 4NLUA 4K4TA 4OPKA 4CJFA 4MQ3A 4NCGA 2G8HA 2E9TA 1JLEB 3OHBA 3RR8A 4IBNA 3OYKA 1VK0A 3MFHA 5FDLB 2W9BA 3NBPA 1SL0A 1JLCA 1SH0A 4CF1A 3MEGA 4F4WA 5L1KA 2HNDA 1W0HA 2HHQA 3DM2B 2E9ZA 1W9HA 4FVMA 2B6AB 1JLBA 4ZPCA 3VQBA 1QAIA 3Q8RB 4DTXA 3KLVA 4XPCA 4EBEA 1BGXT 1S1VA 1C1CB 1U47A 1ZETA 3SPYA 3MXMA 4PUOB 4DU4A 3Q8SB 1MMLA 1B92A 3VQPA 1HNIB 1IKXA 4QW9A 2OZSA 4R0EA 4E7LA 4CJUA 2HHWA 1SUQB 2R8GA 4BE2A 2XC9A 3HVTA 1RT6A 5KFGA 3TANA 3BR9A 1J53A 1K1SA 2ITGA 2ZD1B 4KAIA 3V1OA 3KHRA 4RW7B 4MFBB 1RDBA 2FJWA 4DLGA 5KT7A 4OLAA 2HHTA 4DQPA 3QETA 3PW0A 3RMAA 4KPYA 2KTQA 1L5UA 5KG1A 5DMRA 1IKYB 3NCIA 1SV5B 4QAGA 2XY6A 5L1JA 1RT5A 3RWUA 3RR7A 3S3NA 4DS5A 3NL0A 1S1UA 3DLGB 1JXLA 5J2QB 5KT4A 1RCHA 4JRQA 5DG9A 1C0TA 4IH7A 3SQ4A 1IKVB 4CECA 1S6QB 4PWDB 4YP3A 3SJJA 4B9SA 2Z1JA 3G6YA 3I5CA 1S48A 4TSXA 3CFRA 3KK1A 5DLFA 4MIAA 3FFIA 4E89A 3BGRA 5K14A 4HTUA 2ALZA 2OPRB 4OPJA 3HM9A 4K4UA 1FK9B 3JYTB 4JUZA 3SUNA 3DYAB 3VQDA 3THVA 2EHGA 1Q8IA 2W8LA 3AO2A 4TQSA 3QIOA 1T8EA 3D0PA 3IRXB 3GV5B 2W8KA 4ECUA 2YNIA 3KHGA 3MEDA 1UA1A 4JV1A 1OS5A 3U6FA 4RW4B 3KJVA 1ZTTA 4KHUA 3RBEA 3RMCA 2XI2A 3OYBA 4ZPAA 3BJYA 2WTFA 3I0RB 4F8RA 1LAWA 3VQ4A 5I3UB 1NOYA 3V9WA 4N56A 4J9SA 3EPGA 2I5JB 4XPEA 3LP3A 3KLIB 4DTNA 3DLHA 3CDUA 1TV6A 3LDSA 1KCFA 2EX3A 1ZBFA 1SH3A 4YQWA 4ELVA 4ED0A 4DU1A 1ZYQA 1SKRA 2Z1GA 1RT7B 5KFNA 2A1SA 3U3YA 1RT4A 2DPJA 3OYAA 1EETB 5HLFA 2FBTA 1XWLA 3FDSA 4DSKA 4FLWA 5KG5A 1VSIA 3DOLB 4EZ9A 3QZ7A 5SWMA 4LQ3A 4ZP6A 1RTJB 4DMNA 4EYHB 1WLJA 2GUIA 3ICLA 3JSMB 4NZ0A 2X78A 3FSIA 3H5UA 2FVQA 4I2PA 3OYMA 1LWCA 3OYGA 1J5OB 3EPIA 1RDAA 5CZ1A 5KG0A 1JLQB 4QWAA 1S6PB 1DLOB 4CHYA 4K4ZA 2IS3A 4BACA 4O4GA 4Q43A 1IG9A 1JKHA 4CGJA 4I2QA 3HJFA 3QEIA 3H4BA 3QO9A 1YT3A 3V4IB 2W9CA 4M42A 2NUBA 5KFJA 1ZBIA 1NK5A 1NHVA 2HAIA 4O55A 2GIRA 4TN2A 4DFPA 4FS1A 1RBRA 3GV7B 4F50A 2WONA 4K4XA 4F3OA 3AO3A 1JXEA 3CJ4A 3ZSWA 2Y1JA 3DLKB 4FW2A 3S3OA 4TYAA 4E7JA 3KK2B 3V9UA 1S5JA 4WYWA 2X6NA 1LWEB 3QEPA 2FBVA 2C2DA 3LWLA 4EP5A 4YNQA 4CEAA 2ZKUA 2YKNB 3D28A 4Q0BA 3ZSZA 4NCBA 5CZ2A 2KZMA 4M95A 1XHXA 3CJ5A 2BRLA 2VG6A 2XY7A 2OZMA 3HXMA 3UIQA 1S9GB 2RDJA 4U6PA 1CZ9A 5KGXA 1N5YB 1TGOA 2OPQB 4URGA 2YHBA 1SL2A 2R8HA 1ZTWA 4HUEA 3OLAA 1RNHA 2D5RA 4Q8FA 2FVSA 2F8TA 4KE5A 3UQSA 3BREA 3V6KA 1RBSA 2IM2A 3IGVA 2W7PA 3TAMA 4OKKA 3M9MB 2YNHA 3IS9A 4DS4A 1BISA 3PJWA 5J2PA 2F96A 5F9NA 2R2SA 1S0NA 4OGCA 4CJ3A 3CJ3A 4DG1A 3DI6A 4IDKB 2WB4A 5KT2A 4RUAA 3GIIA 4FS2A 4H8KA 5D3GA 4FJ7A 4HUGA 2R8IA 4CHOA 1RT2A 2RKIB 1JLEA 1D8YA 3IG1B 1C1AA 1VSLA 4CJ4A 4FYDA 1TP7A 1U09A 4CJEA 4M45A 2OYQA 3IN5A 4IR1A 2UVWA 4NLPA 3L3VA 3KK3B 5KFQA 5EUHA 2J6UA 1A5XA 5KRSA 2DTUA 3P1GA 1RDDA 4DL5A 3WNGA 3DM2A 3OYIA 1DTQA 1WSGA 3PO4A 3CFOA 4DWIA 4EBCA 4DLEA 2XO7A 4AHCA 3V6DB 3RMDA 2XI3A 4FJMA 4W5RA 1LWFB 4NRUA 3NMAA 3PO5A 3C6TB 3QGGA 3QIDA 3DDKA 3TARA 4I9QA 5HRPA 3G6VA 4KREA 1HNIA 2B4JA 3NF7A 3U3GA 4NLOA 4CFDA 2XGQA 3G86A 4M3XA 3SQ0A 3O4NA 4IG3B 2GC8A 3PR4A 1L3TA 5F8IA 2IMWP 5KI6A 3PVXA 3OSNA 3QGIA 4Q8EA 1S1XB 3L2WA 5KG7A 4NLTA 2R7YA 2B5JB 1BIZA 4CJRA 4Z4GA 1IKYA 1SV5A 3RAXA 4HVJA 3QEXA 2XWYA 2X6SA 5J2QA 1JL1A 3QEVA 1QS4A 4RW6A 2BQUA 4YR2A 3O3HA 3AVNA 4WFXA 4CJVA 1S6QA 3SFUA 2BQ3A 3DOKB 3L2QA 1I39A 2D3UA 5J1EB 4EO6A 4Q45A 3DRPA 3MR5A 3LP2B 4CIFA 3PW4A 3KIOA 4B9NA 4E7IA 4BDZA 1SKWA 1FK9A 3M9NB 4QWDA 3DYAA 4IRCA 1KTQA 3OYHA 3V6HA 3LP1A 3SV4A 4M41A 3CM6A 2J6TA 3IRXA 4KHRA 4WE1B 1RT3B 3K2PA 1KVBA 3DLBA 4O3RA 2QXFA 1A5WA 4AHTA 3VA0A 5CYQA 3GIMA 4IH5A 1CSJA 3I0RA 4M3YA 2IOCA 4CF0A 5I3UA 2Y1IA 1N48A 5CYMA 2ILZA 4IOBA 4TXSA 5KFLA 4IKFA 4L8RB 3I5BA 5J2MB 1U04A 1D1UA 2ASJA 4BWMA 4PQUA 4MK7A 4CK2A 2JEJA 3AO5A 4DTMA 5DQIA 3NH0A 4NCAA 1EKEA 1UOCA 4H4OB 3DRRB 1RT1A 2HNYA 1YTAA 1NK6A 2G8WA 4AHRA 3CJ2A 1WAJA 2RF2A 3TQ1A 5DG7A 1JLAA 4ECZA 1T7PA 3TAEA 3ISNC 1XR7A 1N6QB 3BSCA 3L2RA 3JSMA 4QCLA 2C22A 1HMVB 1EP4B 4J9NA 3FQLA 1JLQA 2OH2A 5KFEA 5KFYA 4CFAA 1JLGA 2HHVA 3LAMA 3AVJA 4DTUA 5T7BA 4CK1A 3KLFA 4RW8B 4B3OA 3OYFA 2FLPA 3V4IA 3EZUA 5KFRA 1VSMA 4O44B 3MEEA 1YVUA 1S1WA 4FJ8A 4JV0A 4EEYA 1S9EA 4J9QA 1BQNB 2AQ4A 4URSA 3OY9A 4KKOB 4DTJA 3SNNA 2OPSB 2VA2A 3K5OA 1WAFA 4F2RA 4MK9A 5KFUA 3MAQA 4E3SA 4CGIA 1NNDA 5HP1A 4RUCA 4K4YA 1C0UB 4KHSA 3G6XA 2RPIA 3OLBA 3KMQA 3EZ5A 1FXXA 4FJNA 2FBYA 3TWHA 1TQLA 2R8JA 4F4KA 1RA6A 4O3OA 4CF2A 3DLEB 2JEGA 4TY8A 1NK4A 4G3IA 1KLMA 4ED3A 5KT6A 4HCBA 2FLLA 3RB6A 3HVAA 1S9GA 1RA7A 2JEIA 4ELUA 2Q3SA 4FZXC 4LSLA 1RTDB 4URQU 2G8IA 3KKSA 3PX4A 3A2FA 1J9AA 1HYSA 3I5AA 4CHNA 4IKAA 1TL1B 2V0NA 5DQGA 1T05A 3MR2A 1G15A 1UAXA 4CGGA 4KB7A 3KLGA 4HKQA 1VSHA 3NH1A 1Q9XA 4M3WA 1K1QA 3AA4A 2QKKA 2O4GA 4E1NA 1U45A 2HW3A 4IDKA 1D0EA 1DTTA 4CGFA 1U48A 3OYEA 1UA0A 4WXWA 4NLGA 4OKEA 4UQGA 3ALYA 5KFZA 2Z1HA 3SI8A 3C95A 4KFBB 5J2NB 4RZRA 4J2DA 4K4WA 1NJZA 3SUOA 1JLFB 2D0CA 3PW5A 3MECA 1WSHA 2BE2B 2IA6A 2R2RA 2D0AA 3HK2A 5DGAA 4F2SA 2OPPA 4QW8A 4B9TA 4KO0B 4O0JA 3GYNA 3WNEA 1HPZA 3KLEA 2GIQA 3QZ8A 4CEBA 2PZSA 3RMBA 5KGWA 4ED8A 4ICLA 3LZIA 2D7SA 4ZPDA 4CERA 4H54A 5KFCA 4ZHRA 4KHMA 2IC3B 2E9RX 3KHLA 1TK5A 1YVFA 3M9OB 3M8PB 5F8HA 5DQHA 4DTOA 4IG3A 4RW9B 4DTRA 4M3ZA 4KAZA 1X1PA 2WOMB 3G10A 3BSNA 1ASUA 3QIPA 2AGQA 4FK2A 2AX0A 1C2PA 1RTIA 1JIHA 4DL2A 3TAQA 1WSJA 4I7FA 1EX4A 2VG7A 5KG6A 3AA3A 4H4MA 1BCMA 1CLQA 5C25B 1C1BA 4K4VA 1VSFA 4LSNB 5DG8A 1NKCA 4ED2A 3LANA 3VQ8A 4CJTA 5KFKA 3GIJA 3AVCA 3WNHA 3PUFA 4HHTA 3NAHA 1RTHB 4CHPA 1MU2B 2HVIA 4EZ6A 1ZBUA 2QK9A 4CJLA 1RBTA 2YHAA 1HQUA 1FKPB 4CK3A 1VRTB 4KHYA 2FLNA 3AVGA 4WE1A 3O3FA 3DRSB 4FM2A 4WYLA 1NHUA 2AGPA 4IG0A 4WZMA 1TVRB 2O4IA 4YR3A 5L1IA 4OJRA 3ITHB 3HPHA 3NKYA 4AHUA 2IGIA 5I42A 3M8RA 2KFZA 4AHVA 2UVVA 4KV8A 2IAJB 5J2MA 1NJWA 4FJLA 4N76A 4O3NA 1LW2B 1TK0A 1RILA 1QSSA 4Y3CA 2J6SA 3ZT1A 1S1TB 4OL8A 3E01A 4TLRA 4FM0A 1U4BA 3OS0A 4YFUA 4DF4A 5JS1A 2UVRA 4CJWA 2G8FA 1T94A 4IFVA 3CDEA 3GIKA 1HJRA 3LWMA 4CE9A 1ZBHA 4IFYB 1C6VA 3K58A 4R5PA 2OA8A 2P5OA 1T03B 3F73A 2YNGB 2G8KA 3LP0B 4Z4FA 1RAJA 2E6MA 2VWKA 1UWBA 4DSJA 3ZT2A 1JXBA 4G1QA 1HNVA 4DQIA 3V81B 1L3UA 3RRGA 2VG5B 1REVB 4RW8A 5KFOA 2XCPA 2FJVA 4FCYA 1S4FA 4XIUA 4HYKA 1QSYA 3TABA 3RB0A 5C42A 1CXQA 4O44A 4ID5A 3H5XA 2W9BB 5DLGA 1TKXA 3NBPB 4LY7A 3V1QA 1JLCB 2BANA 2PY5A 2BGGA 1ASWA 4NLDA 2DPIA 3OYLA 1J54A 4ED1A 4Z0UA 2HHUA 1LV5A 1JLBB 1C0UA 3RBDA 1IH7A 4ECSA 4C8NA 3HVRA 3KD5E 3EYZA 3QNOA 1QE1A 4HUFA 4TYBA 1S1VB 4KTQA 4DL6A 2D41A 1S10A 1RDRA 4FBTA 2UUWA 4YR0A 2D0BA 4LQ9A 4RNHA 5KTQA 1SH2A 5FDLA 4CJQA 4M3UA 4DTPA 1S9FA 4F4YA 5E41A 1HYZA 3HVTB 1RT6B 4CJPA 3OYDA 2YNFB 1KHVA 5HROB 3SYZA 2ATLA 3L3UA 2B6AA 2HMIB 2UUTA 4ZPBA 2P51A 2HHSA 5KFTA 3LAKA 3OVNA 3OSPA 1CXUA 4ECWA 3AV9A 4OGEA 3I0SB 1TL1A 3CO9A 1C1CA 3SI6A 3PZPA 1XR6A 4FJJA 4W5NA 3KKRA 4CIEA 2FVRA 4PUOA 2WK4A 1GX6A 2WHOA 4C8MA 3HP6A 2AU0A 3DLRA 2QV6A 1RYRA 3VQ7A 1S1UB 1SUQA 5F8LA 1Z4UA 2HNZB 4O0IA 1QQCA 4FLUA 4W5TA 1WSIA 2R2TA 2KW4A 2ZD1A 3VQ5A 3AVIA 4RW7A 2CKWA 4MFBA 3SCXA 1ITGA 4LH5A 1JX4A 3LPUA 3T5JA 3SUQA 3AVKA 4E1MA 5C24B 3KK1B 3BGRB 1C0MA 4KFBA 5F8MA 4FJHA 2P1JA 5KFSA 4CF8A 2JGUA 2I1RA 2BE2A 4B9LA 3DLGA 4OVLA 3IAYA 4XO0A 2DFEA 4NLQA 2YNIB 3QNNA 2KFNA 4E19A 3MEDB 4WFYA 5KG2A 4EP4A 3O3GA 4GMJB 3KJVB 1IKVA 4PWDA 3TAFA 5DGBA 4ZTFA 2FJXA 5DK5A 4QOZB 4DL3A 4Q5VA 1IKWB 2YKMB 4GW6A 2JC1A 3HPGA 1XI1A 3TR8A 3V9SA 3VQ9A 2O5DA 2OPRA 4EYIB 2Z1IA 4W5OA 1NK0A 3JYTA 2V9WA 5KFPA 1RT4B 3CG7A 3ASMA 1BL3A 2KQ2A 5HLFB 1D9DA 4RW4A 3MF5A 1N56A 4X2BA 3UPFA 3OYNA 3H08A 1BI4B 2ASDA 1FKOB 1EXQA 1TKTB 1R0AB 3P5JA 2FVPA 2I5JA 4ECYA 3T3FA 3KLIA 3SFGA 4C8KA 4Z4EA 4WFZA 3DMJB 3C6UB 3VQCA 2JEFA 4ZVEA 2WRMA 3OS1A 4Q44A 4CEOA 2XCAA 4BDYA 4O3QA 1HRHA 4LSNA 3K59A 1I3AA 3H5SA 2XHBA 4JS5A 4O4GB 4BDPA 1NK8A 1RT7A 1JKHB 3PR5B 4I2QB 3QO9B 4Y1CA 4F4XA 1Z26A 2W9CB 1EETA 2IJFA 2D3ZA 3BQ1A 4N47A 4KHQA 5CY4A 2W9AA 1VSKA 1IO2A 4EBDA 1GOBA 3DOLA 4CJSA 3SPZA 2PYLA 2WONB 1RTJA 1VRTA 4QWCA 1BQMB 4DSLA 2A1RA 1J5OA 3M8SA 3QESA 1VSEA 3NE6A 1S6PA 1DLOA 3CIZA 4JLHA 1KVCA 3ITHA 4ZVHA 1D9FA 2FBXA 1KFSA 1KRPA 4RNOA 3HPOA 3H5YA 4E0DA 4Q0BB 3SQ2A 1LW2A 3PX6A 3H4DA 1N4LA 2VG6B 3HHKA 3AVMA 1TAQA 3VQSA 4LD0A 2C28A 3ZSVA 3T5KA 1NOZA 4NLSA 4CJ5A 3DLKA 3PJXA 1A5VA 4Z4CA 2FC0A 3KK2A 3TVKA 2DY4A 3KD1E 1WSFA 3EY1A 1LWEA 4KSEB 1S49A 1F21A 4CEZA 4NYNA 4N5SA 5KFAA 3K5MA 4TY9A 4FLTA 2X74A 4BWJA 2YKNA 2YNHB 5KFXA 4C8LA 3CJ0A 1KLNA 3HT3A 4NYFA 4DG1B 4MKAA 3DI6B 3BSAA 4B08A 3KTQA 5D3GB 4M94A 4QPXA 3TI0A 4IRDA 5EDWA 1RT2B 3OL9A 1REVA 4RNMA 1N5YA 3K5LA 5F8GA 4K8XA 2OPQA 3N6LA 1WNSA 3NAEA 2DFFA 2E6LA 1VRUB 4DL7A 3VQQA 4DF8A 2HB5A 4CIGA 1GOCA 5F9LA 3H98A 2F8EX 5JUMA 4OLBA 3NGZA 4ECRA 4KB0A 1HARA 4ZP7A 1DTQB 3RTVA 1Q9YA 1XC9A 1NJYA 1T3NA 4RU9A 3CM5A 2W7OA 3QLHB 4O3PA 2JLEA 5KFHA 1ASVA 1WNEA 4KI4A 4DQSA 2RKIA 1BIUA 3HSTB 3RRHA 3IG1A 2IM3A 5F8JA 5KFDA 3OHAA 3GQCA 4J9KA 3KK3A 4KHWA 3L2UA 3SQ1A 4NYZA
chains in the Genus database with same CATH superfamily
1W25A 4GY2B 2YNFA 1D4XA 5HROA 1G2EA 4C48A 2GQQA 5IC4B 2J9CA 3J81Y 4PPDA 3T1AA 3E51A 3B6OA 1B0VA 5BREA 1BCOA 1S79A 5SZTA 4DFKA 1O1WA 5A2QO 2ACMA 4ED4A 1Q86T 5IM0B 4QS9A 4Y34A 4WP9A 3M8QB 5B0AA 5HRRA 2YKAA 3OS2A 3LDQA 1G4CA 5HBMB 1F5AA 1QAJA 2BJ1A 4J9UE 3F9KA 1NB7A 4O5BA 5A8RA 1U1LA 3DDIA 4LRCA 4OYPA 1Q7LB 2LSNA 4ZJQA 3C3LA 1Q1KA 1OSCA 3ISND 3MCSA 4B8CA 1HBMB 3NHGA 4H5TA 4JRPA 1KAYA 4B02A 4EUVA 1FFSB 1CS4B 1YI2S 4FBUA 2L3MA 3NLCA 4FW1A 3V9XA 2DY1A 4H03B 1EB0A 3O2IA 2OP5A 3TAGA 2YY3A 1HWJA 4QWEA 4JV2A 1H74A 2YKMA 1H1VA 2ZE2B 1TKDA 3FRZA 1WEZA 2FZKB 2P9IB 4NEZA 1L3SA 2I9SA 3IC1A 1VQLS 2JDJA 3HFKA 4J91A 2KM8C 1S0OA 3AA5X 1IV0A 4NOHA 2DHGA 3GLJA 2DY9A 3FZFA 3LPEA 3CJCA 1RT1B 4X62J 4FPAA 3GOIA 1XR5A 4X66K 4MLEA 2RF2B 2YVSA 2R8KA 1SC3B 1RAIB 2GWKA 4LREA 3ZT3A 1SVDA 4CLUA 2BDPA 1K8KA 4NZ7A 5HL7Q 4WFBQ 4UY85 1DQ9A 1W7WA 3MR6A 4OJ3A 2H5IB 4J2AA 4GRSA 2KM8B 4FL9A 4K8RA 3NGTA 4I6WA 3HP9A 5CR4A 4F4ZA 3DU5A 1Q8BA 5T7LB 2UUAJ 3CCVS 3C46A 3DRRA 4GVMA 2BXJA 2MHEA 4LF9K 2W42A 2UXCF 4I0WA 1TUYA 3MXIA 3MEEB 1DBDA 1QAXA 4CEFA 2AYBA 4U7BA 3NDKA 5F0XA 1N6QA 4FF3A 6FD1A 3PV8A 3ILOA 2UUBF 1BQMA 4WKYA 4DR5J 3O5BA 1BXNA 1HBNA 2AGOA 1EP4A 5HP1B 3I32A 3QGHA 4OYZA 2IJNA 2XYGB 1LCUA 1QZ5A 5GAHU 4NWBA 3LALA 1VQ4N 2CJQA 3VPZA 4NCGB 3K0JA 3BO3A 4PR6A 4CBWA 3PDNA 1Y7PA 2ABYA 5F8NA 2QA1A 2QMXA 2OJ3A 2ETJA 3MEGB 3HM8A 3EVMA 4ZVPB 3J7YP 3TWZA 3H59A 1I6JA 2B4OA 5IS2A 1LXJA 3QJLA 4DPUA 1O5JA 4ILGB 1UMJA 1VQ6N 1FRJA 2E1RA 1BUXA 2DRAA 1EWRA 3DLEA 2HRTA 1U8WA 3RZAA 4OYMA 1WHWA 1IKXB 4NLYA 3KLGB 4DB3A 4N41A 3BY5A 1N8RO 4DPWA 3ADAC 2KJWA 2YKQA 1PAEX 1OY9A 4O4RA 1M90T 1RHUB 4HEA9 2E44A 3RU0A 2LECA 5GAGP 1VQ8N 3HSDA 4Z37A 4DR2K 4FLVA 5A6PA 1F9EB 1RT5B 4FSVA 3R8EA 2ZHBA 3K5NA 3PYGA 1BDGA 1H7WA 3R3TA 1Q8KA 4ZP8A 1C0TB 2MQOA 4LRBA 4PCQA 2ASLA 3UNYA 2CJXB 4X64F 1UJ6A 2AP6A 3ZZYA 2DISA 2LQ5A 2DGUA 3M32B 2R7TA 1FJGF 2ZJRL 1KC8O 2BBEA 2H1YA 3K5PA 4KB1A 2HIQA 2QLWA 2CJBA 4LFAF 2BM0A 2BQRA 4R8UA 3CWJA 2ZH2A 3EVOA 4K7QA 2AJFE 4YOWA 2W01A 2ITMA 1D8ZA 2LFVA 3UN2A 3ZLJA 2FJAB 2E4LA 1TKZA 3IRWP 1T0TV 2DR9A 1HKCA 1E6VB 4PYAA 4ITSA 1WG1A 4ECVA 3CTRA 4OPHA 4U67L 4FK4A 3KJFB 4JP8A 1TUWA 3E3XA 2IDEA 3M2VB 4K50A 2H3GX 5HVGA 3V2UC 1VQKS 4UOCA 2VWJA 2FZGB 4OJHA 2WOMA 5F0WA 4PKIA 4ECQA 3L7OA 4WFAL 3OTOK 1NPKA 2CA9A 4DPOA 4ZJLA 1PG5B 2YXLA 3G96A 1LW0A 4KY3A 3RB4A 4U7CA 2GUPA 4L75A 4C7QA 4IRKA 4OX9K 4DL0C 1VDHA 4MH8A 1S12A 2G8UA 4Q2LA 2NXCA 2GX8A 2MY8A 1T3VA 5AQNA 3CJRA 3OFGA 4NXNJ 4M5IA 4GC6A 3WQTA 1SL1A 1H2UX 4AHSA 4CGDA 2F3JA 5LOQA 2EC0A 2GBZA 4F0HA 2QI2A 2QWNA 2ATQA 2OO4A 5G0RB 4Y1DA 3DXKB 3QAEA 4K5RA 4HWIA 2V51B 4WP3A 1UPPA 2BOPA 4B1VA 4K0KJ 1CJTB 3R8YA 2ZH1A 3VAJA 1FESA 4IFVB 1WEYA 2HHPA 2E7XA 3P83D 5HQLA 4P9SA 4CZKA 4R5PB 4DQQA 3RJMB 3BDPA 2IDOA 1E6YB 3TTCA 4FLZA 2AHOB 3AGKA 4JK7A 3PACA 2KXNB 2V8DA 1M1GA 1RABB 2QA2A 2YX7A 2RDIA 4FZZA 2ZEJA 2LU2A 2RAQA 2BX6A 2Y0SD 2YX1A 5JJBA 2AEMA 4HDHA 4KJIA 5KQ8A 1VIXA 3WXJA 3R97A 5IQQA 4EFAC 3CCLS 3RSEA 4DV2K 3O4QA 1JNZB 4B3SF 2BANB 2DGVA 1P8GA 4QZVB 3PY8A 2AWZA 4DQRA 3NP5A 1O13A 1W7AA 2ZH9A 3VGSA 5J2PB 3EKSA 1U6FA 4X66F 3MM8A 5KT3A 4IZ9A 1BHLA 1BHNA 1PO6A 5KOXA 4MQ3A 1HLUA 4ZIWA 2E9TA 2XG8A 3RR8A 1BMQB 2RMLA 1Q78A 2OD4A 3MFHA 3QFUA 2C2KB 3NBPA 5D0EA 4PKGA 1SH0A 7FD1A 2MQNA 2GVDB 5ADXH 1W0HA 2HHQA 1W9HA 5DETA 4FVMA 3TW0A 1JLBA 1IQZA 2C2OB 2PAVA 3ZX3A 4OI3A 3UD3P 3KLVA 4XPCA 4EBEA 3TZWA 1RWWB 2ZF5O 1U47A 2GTDA 4CM0A 1BLUA 3WQUA 1MMLA 4UW2A 2HFOA 3ENHA 4E7LA 1DURA 3ZTRA 4YS2A 3TANA 1LWXA 1HNZK 3POTA 2OD6A 3J7ZT 4ZVOB 2ZD1B 3V1OA 3M6WA 3E2EA 4RW7B 1X5SA 2QFIA 2FJWA 4DLGA 2HHTA 5HOOA 5JVHL 2O66A 4HTIA 3CCJS 4AL7A 3M1FA 2K3IA 4QAGA 3C0BA 4RJVA 1GMWD 3RWUA 2NLXA 2B56A 4ZLPA 2P6TA 3VAFA 1ICEB 5J2QB 3T7ZA 2NRVA 1RCHA 4CI0B 2BKOA 4ETZA 5DG9A 4Y0WA 4DUYK 3JQMA 2W4PA 5LL6d 4BHQA 2VL1A 3QAUA 2UYTA 2Z1JA 3I5CA 4B3RJ 1X4DA 4WFAQ 5C15A 3CFRA 1HWUA 3KK1A 2IYGA 4C4WA 4E89A 3BGRA 2FHJD 2KG0A 2YWGA 4PAAA 4TNOA 3HM9A 2KXFA 2EFGA 3VQDA 1X4BA 1Q8IA 4CZEA 5LMNK 2LA6A 4TQSA 1EQMA 3Q24A 3QJJA 3GV5B 4ECUA 2YNIA 4K5SA 1S57A 3MEDA 1OS5A 2DEJA 3HLUA 3F2KA 4KHUA 1M90O 4DR2F 3ID8A 1QVGR 3OYBA 4CI6A 5JLFA 4F8RA 3P96A 5I3UB 2VQEK 3V9WA 4J9SA 2CDQA 3MM9A 3KLIB 4DTNA 1F5CA 3JAMO 3LDSA 1KCFA 1T9VA 5A8KB 4ED0A 4P74A 1ZYQA 4KH6A 2Z1GA 4W90B 3U3YA 1YI2N 3JXOA 1SC4B 4OI4A 3EE9A 3R9LA 4FLWA 4FNHA 3DOLB 2KT2A 2OSRA 2O8BA 2XNQA 4EZ9A 4LQ3A 5AR0A 4BLGA 3CGIA 4EYHB 4Z7CA 3A5NC 3JSMB 3B82A 4W98A 4DUZK 4NA3A 2LDIA 5CZ1A 3Q22A 1SIWB 4QWAA 3BKUA 2DNNA 2CZ4A 2O8CA 1RSCA 4O4GA 4Q43A 1VQLN 2O8DB 1YT3A 4JI7K 2LQJA 2NUBA 4JI6K 3QNWB 4C8YA 1NK5A 3R7SB 1NHVA 2HAIA 2CVIA 4CO1A 6FDRA 2D3OR 4TN2A 4DFPA 3MCAB 4FS1A 1RBRA 2CNLB 1N5TA 3GV7B 4F04B 4F50A 4NA1A 3O8MA 4ANEA 3NNHA 2Y1JA 3ZSWA 4DX6A 2XMUA 2UP1A 4FW2A 3S3OA 3OTOF 2QEXS 3MEKA 3Q0AA 5A8WB 4EK2A 2FSJA 3QFPA 2ZUAA 2FBVA 4LFCK 5M2RA 3CCVN 2KN4A 4OX9F 4Z7YA 2ZKUA 3D28A 3VZIA 4QJVA 2G1DA 5BR8J 3UIQA 1GQEA 4USTA 2AD9A 1CZ9A 4OZ1A 4URGA 1FNXH 3M2UB 5IT9O 1UZDA 3Q89A 4JI4K 5I4MA 1ZTWA 4Q8FA 2FVSA 4KE5A 1XNQK 2IM2A 4I67A 3IKMA 3M9MB 1RP5A 4P2XA 1BISA 3CJ7A 3PJ9A 2CGJA 2F96A 2BA9A 3ONQA 2OMOA 3CJ3A 4DG1A 3DI6A 4RUAA 2ROEA 1YRXA 1RT2A 2RKIB 1JLEA 4FYDA 4CJ4A 5JVHQ 2VFUA 1HBUB 1K73T 3IN5A 4WBFA 3WUHA 4NLPA 3T1YF 1EIYB 1TYQA 4ZJOA 3FZLA 2PEHA 2ZWHA 5EUHA 3J8AA 1NH8A 2J6UA 5KRSA 4A2BA 2E1AA 4ZVTB 3DM2A 1DTQA 2XTJP 2M52A 1RK8A 1KEKA 4DLEA 3K8WA 4AHCA 4DV2F 3BDEA 3RMDA 3BPSP 2QWQA 3W9JA 1WORA 3QGGA 2RE2A 3QIDA 4CJ7A 4IQMA 1FXDA 4OZ2A 2YHXA 4CFDA 3DRXA 2FC9A 4M3XA 4CLYA 3SQ0A 5B8HA 1RHMB 4OV1A 3MCPA 2WFBA 2B4PA 2GC8A 2OEJA 2K06A 2BE7D 1S1XB 5KG7A 4Z4GA 1IKYA 1SV5A 8ATCB 2YWHA 1I5OB 3A3PB 2DO4A 3B4MA 4O5FA 3R6MA 3SSRA 5IM0A 2XWYA 3G82B 1YJ9S 2CQ2A 1JL1A 1QS4A 2W6LA 2RQ4A 1S6QA 2F9JA 3SFUA 2LXFA 1HNWJ 3F56A 2JWKA 2UU9J 1WOPA 2OCEA 3MR5A 1T11A 2W40A 4P7VA 1HNZF 1FK9A 4IEIA 3DYAA 3CJSA 2OI2A 1CS4A 3MCOA 3ZEUB 3HHLC 2J5AA 4NLBA 1SJFA 3IRXA 3J7ZO 4RPFA 3UWTA 1LFWA 3D9BA 3QPIA 3SSSA 3CEDA 4E1JA 3GIMA 3M8YA 4M3YA 2IOCA 4CF0A 1VQKN 1N48A 2ILZA 2WBNA 1U2RA 2YPZA 4TXSA 5KFLA 5H9EK 1U04A 3A5LC 1YVNA 2P9IA 1UW4A 2M8DB 3HHLB 4DUYF 2ZGZA 3IR6B 4IOXA 4C3MA 4NCAA 1EKEA 4H4OB 1RT1A 1QY7A 4DX5A 1NK6A 2A42A 1PBUA 1D09B 5HAOA 2N4DA 1U1NA 3ZZUA 2VQFK 2RF2A 3SJHA 3P8BB 4ZLLA 4GO5X 1U2FA 4ECZA 4IO9Q 3WXKA 3E9PA 2HSEB 1N5QA 5LMNF 3JSBA 1RQ0A 1WUUA 3L2RA 1E4GT 2YJFA 3TO8A 1NO8A 3VF0B 3CMQA 5T7LA 5A0YB 4CZJA 2VQEF 4QBUA 2ASPA 3OYFA 2V4JA 4ZS6A 2UXDJ 1R8CA 4EGLA 3TZYA 1T44A 4JKCA 3MEEA 1YVUA 4CZIA 4FJ8A 2EXUA 4AUKA 3DGPB 2X51A 3ZTOA 1BQNB 2DIUA 2LXIA 4KKOB 1YLXA 4JKFA 2E29A 1XMOJ 3SMSA 3SNNA 3K5OA 1NBWA 1WAFA 4MK9A 1RAGB 4LF2A 4CGIA 2DPNA 4DV6K 5HP1A 1N32K 3V4MA 2ZNYA 4JBCA 1YRUA 5CE3A 3TWHA 2BH1A 4A8FA 3BB5A 5E7OB 1KNZA 1RA6A 1NHKL 4CF2A 1RKIA 3MMBB 3CQXA 2VPXB 3AJ1A 2EFPA 4DUZF 2BMBA 4HCBA 2FLLA 3CCLN 3RB6A 1VC6A 2HZCA 1S9GA 3ET6B 2RT3A 4XH1A 3SBGA 4JI7F 2Q3SA 4FZXC 4JI6F 1RU2A 3H20A 1J9AA 3I5AA 3J7YI 1EZZB 2NYHA 5DQGA 1X0FA 4OMFG 5ETMA 3M7VA 4CGGA 4KB7A 3SQGA 3KLGA 4HKQA 1P6TA 2KU7A 1VSHA 3NH1A 5H1SQ 4M3WA 1WG5A 4E1NA 2VICA 2B3TB 1XC3A 1U48A 4CGFA 3OYEA 4LFCF 1UA0A 3GYGA 5E26A 4OKEA 4WP8A 1CBKA 3ULEB 1VIOA 2Z1HA 5AQJA 4J2DA 4K4WA 3OQ2A 1JLFB 3H1QA 2Q6BA 2HMPA 5GAGI 4YORA 1FVSA 2ZH4A 2D0AA 4JI4F 1N33J 4BCAA 1APSA 3TUPA 3VVUA 1QVFR 4FF1A 1EHWA 1XNQF 2GIQA 3QZ8A 3RMBA 3M32A 2D7SA 4MKVA 4H54A 1FEHA 2VV5A 5KFCA 4WK1A 1TK5A 3M9OB 3CCJN 2NS1B 3L4BC 3TP2A 3R5CA 3BSNA 1ASUA 3SAFA 1MWYA 2HQIA 2AGQA 1K73O 4C3KA 2MZSA 2PA8D 1E6VA 1YRTA 3CO0P 4BRLA 3AA3A 2XMKA 3KFWX 3BP8A 1FRXA 2GNKA 1BCMA 1CLQA 3F41A 1VSFA 2GJIA 3M2VA 4E98A 1V6HA 4WQ4C 1O0PA 2WC9A 4LF6K 3LANA 4CJTA 3AARA 3GIJA 2XYPB 2PFDA 3AVCA 5D77A 3PUFA 4HHTA 2IVNA 4YDUC 4OX6A 2CPHA 1JWWA 4U8VA 4IXCA 3PKMA 5H9FK 1IVZA 1PJ7A 3HX9A 5GADU 1FKPB 4CK3A 3THWA 4L3QA 1VRTB 1I1GA 2CFXA 1LKZA 2XHWA 2FLNA 4DN0A 2Q1LA 4P2MA 1FHTA 3C66A 2AGPA 4WZMA 2P9CA 3JSYA 1TVRB 3ILLA 1GNKA 3ITHB 2MZJA 3MD1A 5M1FA 4AHUA 3CJAA 3EO3A 4U9RA 2NUUG 4ERDA 1NCLA 1P8ZA 5M1QA 2IAJB 5J2MA 3HFVA 3DRYA 3BR8A 3C6AA 3LF0A 3W66A 1ZH5A 6AT1B 5G0RA 1S1TB 4S0MA 4A8SA 2BE9B 4TLRA 5DDRC 3O9QA 2PD1A 3D4JA 4BBYA 1RDUA 4JI5J 4JI0J 3N5BA 5G4DA 4UOHA 2QWPA 3MD3A 1CJTA 4IFVA 5B0DA 1VJQA 2FHMA 3J81O 1MN9A 4CE9A 2VONA 4IFYB 1VQ7S 5AZJB 3DGVA 2M5YA 5ITHA 4R5PA 1RKJA 1NGDA 2P5OA 1T03B 5D4OA 1E6YA 3TPQA 1UVLA 4PXDA 1NSKL 2E6MA 3ZT2A 4ZPWR 4K2XA 2PN6A 3R27A 4DQIA 2MTLA 1L3UA 3D1QA 3W1YC 3TJ8A 5AJ3K 5KPRA 1VI7A 1REVB 4RW8A 2XCPA 1CJVB 4XIUA 4A8YA 1QSYA 3TABA 2FY8A 2GVZB 4DR1J 4A5BA 1KVKA 2BANA 2QEXN 2CG4A 3P4UB 1ASWA 2HIYA 4KHPF 2DPIA 3OYLA 2DHXA 5AFUH 3C6HA 2HHUA 2HRUA 1U1PA 3OUYB 1C0UA 3L7PA 3HVRA 3KD5E 1FO1A 2VQFF 4TYBA 3IBWA 1S1VB 3I87A 2D41A 2U1AA 4DOZA 1S10A 4P2FA 1JJ2R 4GKJK 2VBYA 2J7WA 4FBTA 3AY0A 1PSDA 2I8EA 4USVA 2W2PP 5F41A 4BG9A 1WKKA 4RNHA 2DH7A 5KTQA 3U1MA 2NRXA 1SH2A 1YZ6A 4CJQA 4M3UA 3ZZTA 1YJTA 4CJPA 1HNXF 3OYDA 3ENOA 4I6YA 3L3UA 1XNRK 3HKZD 3NCRA 3W9IA 4JYAJ 5HSPA 1FD8A 3FSYA 1XR6A 3WBZA 4LF8J 2FVRA 2Q3PA 1MWZA 3EGWB 1KAXA 1GXLA 1RYRA 4F36A 4U7UK 4DV6F 1S1UB 4BR0A 3I4HX 3R1HA 4FLUA 3OVAA 1R8HA 1R8BA 4DDFA 1WSIA 3ENWA 2R2TA 1YGYA 2ZD1A 4J9VA 5BYSA 2IDLA 3FEXB 4RW7A 2CKWA 1OPZA 3DXBA 3SCXA 5IT4A 2O8FA 1FRMA 4LH5A 1Y10A 3LPUA 3T5JA 4DHYA 2VZ9A 2WVDA 3PIPL 3OBIA 5FPEA 2NQPA 3AB4B 2EVZA 3GG0A 4KFBA 5F8MA 5AQYA 1A9NB 2NZ4A 1T95A 2AZ3A 3C19A 5AQFA 4AL6A 1FTCA 2EKNA 1DQAA 2BYCA 1MWKA 2BE2A 2P9NB 1GLBG 4NLQA 3IA0A 4CH0S 2P9GA 1B4SA 3OV7A 4M8LA 3KJVB 5EX5A 1T9UA 2XSJB 4JI2K 2PI4A 2DNKA 1LOUA 2Y3YA 4JKAA 1CZAN 2O5DA 3SXLA 4DV7K 4NA2A 4LUBA 5K5MA 4L76A 2DNHA 4LVNP 3C14B 1JK9B 1EWQA 4K43A 1N56A 1YJ9N 1VC5A 3UPFA 3H08A 1BI4B 4N7TA 1WHYA 2A40A 4G1IA 1FKOB 1TKTB 2B8QA 2FVPA 4ECYA 4HH1A 3KLIA 3DMJB 5J1NA 3C6UB 4EI2A 2GAGC 4ZVEA 3OS1A 4LSNA 3K59A 2J76E 2E2NA 2XHBA 1OO0B 1JKHB 2DIVA 2MZQA 4I2QB 1RE1B 1QLNA 1JB0C 1Z2ZA 4GNIA 2ZOFA 5FPNA 4N47A 2JH3A 2W9AA 1VSKA 1YTYA 3AQPA 4EBDA 2HHHJ 3UW1A 3DOLA 3SAGA 4CJSA 4IYQA 3SPZA 2QGFB 3PCOB 2WONB 4PG5A 4QWCA 4TKTA 5AQLA 5DRKA 3CD7A 3QESA 4ZKAA 1A0OB 2CQHA 2FBXA 1KFSA 1KRPA 1KS2A 2X1GA 4NYOA 2O8DA 4RUBA 2FXUA 4CP5A 3U7JA 4LIRA 3H5YA 4X84A 2OFHX 3FBCA 3PX6A 2VJUA 4LF6F 3AVMA 3CXCR 4Y2IA 4QR0A 1TAQA 5ETSA 2JVOA 3IWNC 1M5KC 2C28A 2VGNA 3KG0A 3KWMA 2HQCA 1FDDA 1HR0F 4P10A 2ALYB 3KD1E 3MUVP 3P3DA 4KSEB 1F21A 2BJ7A 2OELA 5KQDA 1AYEA 1DARA 5KFAA 3K5MA 4TY9A 4FLTA 4M5DB 2AP1A 4ZDNA 2YNHB 2R3VA 1X31C 2NXUA 1G3OA 1Y5LB 1VLYA 2IRXA 2HGMA 3F0NA 3BSAA 5D3GB 4C98A 3TI0A 5EDWA 1Y3JA 1FWPA 4RNMA 5F8GA 3WQPA 3N6LA 2B0GA 3MN5A 3M2UA 1Q0NA 1VRUB 4UT4A 4LVOP 4DL7A 1NLKL 2F9DA 2PMWA 1ZBSA 4OLBA 2O3DA 3NGZA 3JS6A 5B0BA 1HARA 4ZVUB 3GL1A 4AE5A 4RX6A 3RTVA 5FJ4A 3PSFA 2VBZA 2CRLA 5AQKA 1YJRA 4A8OA 1X4GA 2YQ3A 4O3PA 2PBDA 3M6VA 2JSXA 2HFUA 2RKIA 2ZVIA 1YX2A 3B6BA 2N7CA 3DC2A 4AF1A 1CQNA 4BRPA 3ZTSA 4ENOA 3IFEA 5KFDA 3GQCA 2NZTA 2XSFA 2XLJA 2UV8G 2DJWA 1IJJA 4CGHA 5M2PA 4A5AA 1CVJA 2OANA 4CT9A 4BVPA 5L9XA 1GLEG 5B08A 3KXDA 5AJ3F 3IBCB 3CCES 1OVYA 4LF4J 4NLVA 1N5VA 3QBCA 2CNKB 2ZKTA 1MG7A 2WW4A 3M05A 1B7FA 3W2VB 4CHZA 1XN9A 4BRHA 1YK9A 2RQMA 3FQKA 2MEWA 1HQEB 3CCMS 3UDLA 5TKYA 5H1SV 4GKJF 3S9HA 1H0HB 5KRTA 2D1KA 2PGCA 4I68A 2EWSA 2XMVA 2XRIA 2OUGA 3H8YA 2HEKA 4F67A 5HQMA 5C24A 1S1XA 3ZSOA 4I9LA 1DZ5A 4ZCKA 2UZAA 1IBLJ 4DTSA 2JLFA 4CEDA 1N34K 4PKDB 4CHQA 1XERA 4CEEA 3QJPA 1XNRF 4QS8A 3G82A 4PL7A 2NZCA 2H5EA 3B6PA 1B9FA 4NL5A 3NGKA 5JICA 2Y8WA 3H2LA 4ECXA 1IKWA 2QFJA 1B0TA 5CHCB 3X3UA 1LAVA 1B9DA 4EO8A 2HS0A 3ZT0A 4PQUB 1QUVA 3CPEA 3GE1A 3ZEUA 5ADXA 3PHEA 4HI2A 3KZBA 2FPHX 2W24A 1L3VA 2YI1A 4FKXA 4O8KA 3WIVA 2HNYB 2HVZA 3N01A 3QEWA 3GV8B 2F4VJ 4ZLJA 1KDNA 1R6VA 3IP0A 1SQKA 2HWIA 1JLAB 3W2WB 1NKBA 4FJ5A 1F9HA 5JS2A 3EGVA 1DEJA 1NM1A 1SQFA 1XMQJ 2AIRB 4Y2CA 3HHLA 3UCUP 1UJ5A 2MDAA 4JI2F 3OFEA 2Z2YB 4H4OA 1TL7B 3KLFB 3ZSYA 4B3OB 1P1LA 4AT1B 3C94A 2RNEA 3THTA 1P9YA 2BUNA 3VVTA 4X62K 1R8AA 4OYBA 1EKSA 4DV7F 1TL3B 3KLHB 5K20B 3MMCB 1XHZA 4WXOA 2ATCB 2WVFA 4M3RA 1R6YA 4DR3J 1UAWA 4F3TA 1V9OA 4FLYA 5IT0A 3ZT4A 2VKZG 5BR9A 2V8GA 2ZH7A 1NLVA 1T6CA 5EWEA 3U9DA 5D4NA 2CAJA 5A0YA 2A3ZA 4XH5A 4FJIA 2QIFA 4ILMA 4JS4A 4LFBJ 3VA3A 2I38A 4CJKA 1RBVA 4LH4A 3DGPA 1BQNA 4KKOA 3I8BA 1VQ7N 5LJ5Y 3OXFA 4Z4IA 4FJ9A 2ZNZA 4BC7A 3VTIA 2B9WA 2QO3A 3G4SS 1OH5A 4NLWA 2ZHOA 3ZFVA 2CJYB 1DRZA 3D54A 3MMBA 4QWBA 2C42A 3K57A 2DGXA 1S97A 2B7BB 3OYJA 3MR3A 4DN9A 4GC7A 3NH2A 2GO9A 3S3MA 5LMUK 3FUYA 5AE3A 1NXIA 3GP9A 1YDLA 3SMZA 3RUBL 3W0LA 4YB7A 2VCPA 1WBDA 3J7A1 2FIUA 1RYSA 3TTFA 4FZYA 4NI2B 3GILA 3T19A 2QLFB 4FXWA 3MECB 1HYVA 1B64A 3W62A 4C8OA 4B3TK 3HSZA 1CPZA 2DT9A 4ZCMA 3ATUA 3TTDA 3QLHA 2CUYA 1U24A 1RAFB 1TR0A 3ZSRA 3OVBA 4I6MB 1HPZB 3KLEB 1ZBTA 3F9MA 4Y2MA 3SV3A 1X3NA 2QLXA 3M2RB 3MMAA 3PRBA 3ULEA 3MTJA 3HYFA 4ZHRB 3ZZRA 1DGKN 1U1QA 2UUBJ 4J9PA 1JLFA 2ERRA 1KQSR 2CPFA 3LTOA 2M0GB 3SK3A 4ZMMA 2FF6A 3SUPA 3P31A 4JKGB 3R7NB 4HCCA 2GHVC 1S77D 3CYMA 3E1YA 1RTIB 3TR5A 1AXQA 1WUAA 4IFEA 2MKCA 5KT5A 3AVHA 2CQDA 4A8KA 4HHHA 3KHHA 4DSIA 2E1CA 3FR0A 3GIRA 4A46A 4CH7A 1V4SA 4PRFA 4KRFA 2HQFA 4P6QA 4HLBA 1MMNA 3HO1A 2Y9HA 1O6XA 3VQ6A 1OPIA 2Y8YA 3PYDA 2V8HA 2DHAA 2G13A 3MX2A 2WTUA 1FT8A 4I2PB 4Y2AA 1LWCB 3OYCA 4ANDA 3ZO7A 3MM7B 3A8EA 1RGIA 4MO5A 5EHHA 1WC0A 4J9LA 3QQCD 2ZITA 2JFKA 3NFAA 4HL9A 5I42B 3QYYA 3AVAA 2CPXA 1ZM2A 4FXDA 2ZQBA 5EWFA 1UZHA 2VFSA 2ZBRA 2WSEC 4KGKA 1QD1A 4ECTA 3GWCA 1FKPA 3H46O 2HHXA 1YHQN 4JB8B 3Q23A 4Z4HA 3NAIA 4DJBA 2FYXA 4BE1A 3BV8A 2CNOB 3O1WA 4WQ4A 1U1OA 3FZBA 4O3SA 1JL2A 1TVRA 4RBTA 2MQMA 1WOOA 1N34F 1RZMA 3BSOA 5M1OA 4NXNK 1FJGJ 4JV5J 2IAJA 4B9VA 5KAKA 5CA5A 5KFIA 4G1QB 1NSQA 3RAQA 1S1TA 2VPWB 1QVGM 5KFVA 5SUHA 1WKJA 1IBKK 2DVIA 1R59O 2GS8A 2RD5C 2W25A 2DEIA 3EM1A 3NWRA 2SXLA 5L1LA 3SZ2A 3OJSA 3GJTB 4K0KK 4KBIA 4CLWA 4IFYA 1Q4RA 2HLUA 5AZJA 5BPNA 1KHWA 2Q31A 3JQKA 3GBTA 2QMWA 1T03A 3NRBA 1VBKA 4TVAB 4DQ8A 3TAMB 2ZWPA 3TOQA 2IMOA 3IS9B 4Y00A 4NRTA 5GAHP 1QE1B 2EK6A 3JXUA 1CJVA 5ETOA 3OHBA 2BJDA 1SJRA 1YJWS 4IBNA 4CBXA 3MWTA 3OYKA 2E5GA 2A0FB 1U1MA 4CF1A 4KBOA 2HNDA 4KIAA 4BC9A 3LDLA 2EPIA 4KC5A 4ZVRB 2DGWA 4ZPCA 3VQBA 1QAIA 4DTXA 3R5DA 4X62F 1S1VA 2BJ8A 1U2VB 2BKPA 4EAHD 3SPYA 4RL1A 2NUHA 2CG8A 3BF1A 4Y0FA 4CJUA 2R8GA 2XMWA 4FYXB 5KFGA 1K1SA 3A4TA 1U0SA 1FRKA 2GCFA 4KAIA 1X4CA 3Q7BA 4OI0A 1X5TA 4O8UA 1RDBA 3TVZA 2P5VA 3BZQA 4YOVA 1IQTA 3RMAA 4KPYA 2KTQA 2GX9A 3NCIA 2KHDA 5L1JA 3FRYA 2MMYA 3GG4A 1SJQA 1JJ4A 2B51A 1AW0A 5BYQA 4LR9A 1HFEL 5E3AA 3THYB 1WEXA 2UV8A 2KT5A 1OH8A 1S1UA 3DLGB 1PKUA 3J7Z5 5AQTA 4EHTA 3HRGA 4DMZA 4JKEA 2EI5A 3GJSB 3SQ4A 5AQSA 4AXJA 3CCSS 2LEAA 4I69A 1KVJA 2R7XA 4B9SA 1S48A 4TSXA 3NS6A 3CCEN 3CD0A 5DLFA 4MIAA 3FFIA 3ZTPA 5K14A 5B0EA 1GMUA 2ALZA 2OPRB 1WI8A 4ZK7M 3Q2SC 4JUZA 3SUNA 2AKWB 2EHGA 2Q0UA 5KPTA 5LMUF 2P9NA 2KH9A 2E1YA 3KHGA 1CQMA 4K42A 4BRNA 1YSJA 4JV1A 5DO2A 3KJVA 3CJBA 3W65A 1PAUB 3CCMN 2XSJA 1C0FA 4OHVA 3KDOA 3I0RB 3UN3A 1LAWA 1NOYA 2OTJS 1LOTB 4N56A 4HT7A 3EPGA 3LP3A 4B3RK 4GVBB 1IBCB 5D4PA 4UY8T 1TV6A 2J0WA 2K8GA 5DS7A 3A5MC 4USUA 4F0KA 1Q82O 1SKRA 4LF9J 4RUHA 1RT7B 5KFNA 3SCKE 2DPJA 4OQJA 3OYAA 3C14A 2FBTA 1U6ZA 1Q7YT 2XMAA 1XWLA 2Z4PA 4DU7A 2YCHA 2ZC4A 3IR7B 5KG5A 1RBAA 2F1FA 3BO2A 5SWMA 2OAUA 2XS7A 2DNYA 1EJ7L 1WLJA 3ICLA 4NZ0A 1JMTA 3FSIA 3H5UA 4IOAL 3LGMA 3OVSA 3J7AN 3OYGA 3EPIA 4JAXA 3BKFA 1S6PB 1DLOB 1U25A 3H7HB 2QXLA 1IG9A 3K9JA 3MM6B 1JKHA 4CGJA 4I2QA 4F4AA 3HJFA 4WWSA 2F40A 1M1HA 3FZ2A 3H6EA 4O55A 1W2BR 2GIRA 3HOSA 1VQ4S 2Z8QA 4LJMA 3U4LA 2WONA 4K4XA 4F3OA 1TMMA 3AO3A 1CULB 3DLLQ 3AGRA 1AT1B 1WF2A 4YY3J 3DLKB 5HVHA 1RHJB 1UFWA 1YWXA 2JWLA 1WC3A 4EMDA 2X6NA 4WYWA 3R5JB 2YH1A 2CQIA 2C2DA 3T6BA 3LWLA 4EP5A 2HSTA 4CEAA 2PA3A 3ZSZA 3DFEA 2LYVA 2WW8A 1EARA 4NCBA 3CJ5A 1OKJA 2XY7A 1GH8A 1I94J 5IZHA 5KGXA 1VHFA 1UW9A 3D6TB 1SL2A 3D0IE 4X4VA 1F0XA 2Q97A 3V6KA 5BN9A 3MZIA 3ZETB 5B0GA 3BGOP 2HKEA 2IRUA 4M5DA 1YG0A 2LCWA 2W7PA 1UPMB 2YNHA 1VK3A 1VQ8S 3MWPA 3KVGA 3K9KA 3QICA 3KWGA 2R2SA 4X65K 2KRBA 4FOIA 5TKWA 4CJ3A 2DGQA 3U1NA 4IDKB 5KT2A 1FKAF 1Q53A 3GIIA 4FS2A 2FJEB 4H8KA 5D3GA 2G4BA 2JNJA 4GO7X 2R8IA 4CHOA 5BR8K 2JLGA 4NXNF 3IG1B 1VSLA 1U09A 4CJEA 3FE1A 4PPZA 2OYQA 1OY6A 1N5SA 4DV0J 3G4SN 3KK3B 3CETA 2E2PA 4WIIA 2DTUA 3P1GA 3WNGA 2IBOA 2KG1A 4DWIA 4CDIA 2CJKA 3TSUA 5DM6L 4K0KF 3OFHA 2XI3A 3M1VA 1WJ9A 1YXQA 1HQ2A 4H0OA 4ILLA 3PO5A 4FPRA 5HRPA 4P73A 1VQOS 1HNIA 3U3GA 2CDRB 1FE4A 4I4BA 5C2GA 4NZ6A 3PR4A 2IMWP 1AROP 3PVXA 2XB2D 3QGIA 3SQOP 2Q2RA 3CCZA 2R7YA 4NLTA 2B5JB 4L3NA 1AUDA 4R0JA 2X6SA 4CM2A 3VEYA 4FWOA 1S99A 1NMEB 3O3HA 3AVNA 2M8HA 2Z0GA 2CGLA 2BQ3A 1FRIA 4EO6A 2JX2A 2JFDA 4NE9C 1BWVA 3KIOA 4B9NA 1X4FA 3B78A 2FQQB 4DI6A 4BRFA 3M9NB 3M30B 2GELA 4QWDA 1GAOA 1SBRA 4PG8A 5AFUA 2J6TA 1BU6O 4WE1B 1ELOA 4A4JA 1A5WA 2QXFA 4AHTA 5J1PA 4DU8A 2X1BA 2RH3A 2V34A 2CADA 1M5PC 1HNWK 4B17A 1JCFA 3I5BA 3R7BB 2UU9K 3S01A 3UFCX 1FXRA 2LEBA 4OHYA 2P9KB 1UFLA 2DNZA 4BWMA 4PQUA 1QVFM 1W26A 5E5NA 2JEJA 1HD0A 2EFNA 4OX7A 2GWJA 2CJAA 2N3OA 1UOCA 1UP1A 2GEMA 2HNYA 2LEPA 1YTAA 5GINA 3CJ2A 5L39A 3TQ1A 1JLAA 3O5TB 2BOAA 4TU8A 3CMAS 4DCJB 3W2WA 3BSCA 2H65B 1YBUA 3O3LA 4DV3K 4DV1J 3HJVA 4L3KA 1HMVB 3MOJB 1X5PA 1JLQA 2OH2A 1MROB 1OYDA 1GLCG 4KRWA 4R25A 5C0YA 2HHVA 1RWNB 1TL7A 3KLFA 4B3OA 3V4IA 4B3RF 3EZUA 1WF1A 4QQBA 1VSMA 4O44B 2WBMA 3QT8A 2HFNA 1UVIA 2PO4A 2KB2A 2EFVA 2R7RA 2AQ4A 3MMCA 2ADCA 2VA2A 4UY8O 4F2RA 1J2VA 3MAQA 1FVQA 4K4YA 2RPIA 2MPUA 3EZ5A 2PMHA 2FBYA 4JD2B 4YB1P 3CIPA 2R8JA 4O3OA 1QJHA 4LRFA 2Q43A 1TMJA 1S59A 1Q7YO 4CO4A 1NK4A 1XBWA 1G7CB 2Z2LA 1M1KT 2XM3A 1RHRB 3BZKA 1RJJA 2QWOA 1NUEA 3I4PA 3HVAA 2JEIA 3FGUA 3RBXA 2Q0RA 4PEOA 1XMOK 5CQGA 1BD6A 1KQFB 5HN0A 5DM6Q 1R43A 1RTDB 2Z56B 2DXDA 2G8IA 3KKSA 4CHNA 4IKAA 4DR6K 3LQVA 3AB2B 1OVQA 1TL4A 3G8QA 2RU9A 2LQ9A 1KWMA 1O8BA 1S76D 5DJBA 1YJWN 4J7CA 1Q9XA 3B4DA 2B8PA 2CQGA 2QKKA 4DUYJ 3PG9A 3T1HJ 1U45A 2KKZA 1D0EA 2GMHA 4L6V3 4UUWA 4U95A 3PLAA 2W2OP 3K17A 4LRAA 3D3BJ 5KFZA 3C95A 4WFNL 4NI2A 2XO6A 3LM9A 1NJZA 2PSZA 3MECA 1WSHA 1UVMA 2R2RA 3HK2A 2RIJA 1XQIA 2HURA 3OBWA 3PM9A 5DGAA 3VEVA 4O0JA 3GYNA 2NREA 5CXTA 4A8MP 2VODA 3WNEA 2VPYB 1HPZA 3KLEA 4X4TA 2PZSA 2HBLA 1Y3KA 4ED8A 4RTFD 3NMUA 4ZPDA 4CERA 4QR2A 1NM2A 1UTAA 2Z2MA 4ZHRA 4X65F 2IC3B 1YVFA 3M8PB 5F8HA 2E5LJ 4DTOA 1JJ2M 4IG3A 4FPBA 2VD3A 5EGYA 5BR8F 1X1PA 2M88A 1NGFA 4DBQA 2GV1A 1HIYA 4H5NA 4JKGA 1N33K 1SIZA 4FNIA 4C1NK 2AX0A 1RTIA 4DL2A 1VHIA 3TAQA 4ISGA 3CCSN 3VQTA 5RUBA 3A8IA 3AXMA 3SBTA 1RWVB 4FXVA 4FYYB 3EKUA 1JQGA 1PC4A 1NKCA 4ED2A 4CZFA 5KFKA 4JI7J 1X60A 2CQPA 4JI6J 5C10A 3FVYA 3NAHA 3P45B 1RTHB 1MU2B 4EZ6A 2D4WA 3C2PA 3DHWC 1ZBUA 1QQMA 2QK9A 3MAAB 1RBTA 4B3SK 4CZMA 4TU7A 5AQUA 5AQMA 3PNIA 4KHYA 4B1WB 3QRPA 2OTJN 1NSPA 2RSQA 3ZTQA 3MM7A 4YEAA 2XEXA 4A48A 3QDKA 4YR3A 5L1IA 1LFPA 4OJRA 1NBEB 2YQ0A 3HPHA 5I42A 3D1OA 4AHVA 4P7TA 3BYPA 2UVVA 3CPWM 3LOUA 5D0HA 1NJWA 4IO1A 4P2SA 1G99A 4O3NA 2B9EA 3UR3C 3QBWA 3ZX0A 3CCQS 1QSSA 1U26A 3NEKA 5LXRA 1KOOA 3OS0A 3ILJA 2P9PB 4CJWA 4X4UA 1T94A 1VK8A 3CDEA 4ILHA 3LWMA 1T6DA 1ZBHA 3K58A 2ZOGA 3H2UB 2QW9A 3LP0B 5THWA 3FSXA 4DSJA 3UKRB 4G1QA 2QL7B 1EO1A 3V81B 2CGKA 3RRGA 1HNWF 3TU5A 2UU9F 2VDHA 4JI5K 1CXQA 3UVJB 3H5XA 1WOQA 2W9BB 1YBAA 4LY7A 3V1QA 2D0OA 2PY5A 1PYSB 2DITA 4RO0A 2DR8A 4NLDA 4YOYA 1J54A 3MM5B 5D0GA 2HF4A 3OW2R 3RBDA 4ECSA 4HHUA 1GXTA 3EYZA 3VOVA 1QE1A 2LQBA 3EGNA 3LGHA 3AJDA 2CZVC 4CD3A 1UEKA 4DV3F 5MLCV 4NXMJ 1X4AA 1WDDA 4KH5A 2D0BA 1WF0A 5GAHI 4WFNQ 3MCMA 1F9FA 4DR1K 1HYZA 1RT6B 1JCGA 3GTYX 2YNFB 1N36J 3VF2A 4W92B 3D2EB 5IV4A 5HROB 2N82B 4CYUB 4M63C 4ZPBA 3AQOA 4KGZB 2P51A 2NSCA 3I9V9 2HHSA 3SMPA 2ZBPA 2Z58B 4BC2A 1CXUA 1TL1A 2V69A 3CO9A 3PZPA 1U2VA 3CXCM 4FJJA 4CIEA 5FLXU 1JXVA 1GX6A 2E1PA 2WK4A 5JVGL 2KXHA 4M5GA 1ZOTA 1Q18A 2GJFA 3TX8A 5F8LA 1Z4UA 3HHDA 2DH8A 1AFJA 1QQCA 3O8WA 1C4CA 7FDRA 1E3MA 4FZVA 1NDLA 5D15A 5DDOC 1ITGA 4HTLA 1ZZNA 5A76A 3CIMA 3AVKA 2D9OA 4QIFA 3RW7A 1C0MA 3O4WA 3VZHA 4JYAK 4FJHA 3QSYB 2P1JA 2RRBA 5KFSA 4CF8A 4GVEA 1M1KO 3THYA 1XMOF 2VFVA 4B9LA 3IMQJ 3DLGA 1VQON 3JB9k 4WFYA 2DHSA 5KG2A 1FX4A 4DR6F 4OZ5A 5ELZA 1TL5A 2C1EB 3CF5Q 2NPIA 4Q5VA 2YKMB 4GW6A 3WEEA 2RS8A 3VGLA 3C65A 2OPRA 3R1XA 4W5OA 2ZUGA 3CDAA 1GMVA 1S5ZA 4HHJA 3A0IX 4F02A 5KFPA 1RT4B 3ASMA 2ZJQQ 5DDQC 1NAQA 5U47A 1D9DA 2F8MA 3QRQA 2DNOA 5L8RC 4QR1A 2ASDA 2C2MB 3HZ6A 2HBQB 3FLCO 1NDCA 4GVBA 3SFGA 4IJNA 2MGZB 4JI8K 4X4QA 1M5VC 2JEFA 3FZMA 4PXBA 1J27A 4Q44A 4CEOA 1V5VA 4BDYA 3PYFA 1VQNS 1DFDA 1I3AA 3M4XA 1RT7A 4QIGA 3BGLA 4IOCL 2XZWA 2M2BA 2W9CB 2IJFA 1Q86O 2D3ZA 3QT6A 2JVRA 4KHQA 2F65A 2AYMA 5GADP 2KYXA 1S6UA 2PYLA 1OQ6A 1BQMB 1QUPA 4CNZA 1T9TA 4DV6J 3CD6S 2B9XA 1N32J 2HYIB 4KR0B 3VAIA 1OJ4A 3CC2S 1N33F 3NE6A 1S6PA 1DLOA 3CIZA 3DLJA 3R5BA 3BEXA 2KL8A 4ZVHA 4BRIA 4FYWB 4Q0BB 4A8WA 1LW2A 3EL2A 3T1YK 4N8NA 3KJQB 3H4DA 3O6WA 2VG6B 2HHHK 4C0OC 1CULA 3CMAN 4CJ5A 3DXMB 3DLKA 2E1ZA 1KTVA 2FC0A 2YQ1A 1PYTA 3IFRA 1KR4A 3TVKA 2DY4A 3A3NB 1U1RA 5AQRA 2XHCA 3C8YA 2ZZMA 4NYNA 2DHHA 5LT5A 2NSBA 4UQTA 1F2GA 5FPDA 4LF7K 4BWJA 3GMGA 3BYRA 2HBRB 5KFXA 3UDCA 2RVJA 1KOHA 2XMJA 3CJ0A 1HW9A 3MGJA 2MSSA 4ZA1A 2C3UA 4NYFA 4WK3A 3G8TA 4B08A 3KTQA 4M94A 3C7NA 2FD2A 4K8XA 3K5LA 3NG8A 1WNSA 1WBBA 2DR7A 1H73A 2LDYA 4D3GA 2K3KA 2E6LA 3HHNB 5F1XA 5HJXA 1Q81T 2A3JA 1GOCA 3H98A 2F8EX 5I9EB 2AMCB 1X5OA 5JVGQ 4ETXA 4ECRA 3ZETA 4CTAA 4KB0A 1T9YA 3PFEA 3BBBA 2QT7A 4M5MA 1XC9A 1NJYA 1H3DA 3QB0A 2DNRA 1VR6A 2W41A 1ASVA 4JI1J 2D0PA 3SLCA 4DQSA 3T9ZA 1BIUA 3IG1A 1CEZA 1YBTA 3WHIA 4CT8A 3OHAA 1BOTO 3KK3A 5F3TA 5BRDA 3SQ1A 2V52B 4BRCA 3S8SA 1KVAA 1K6YA 4G1PA 2HMIA 4R8UB 1YIJS 3VQEA 4BRDA 4JI5F 1X9WA 4JI0F 3W5XA 3LZJA 2L9WA 2XBPA 4J2EA 3A12A 3I0SA 1TKZB 4DSEA 3AA2A 3V6JA 2FVCA 3CCUS 3HL8A 2XS5A 4NLRA 1ZM4A 2MSTA 5HMXA 4L73A 4ZVGA 2HNZA 4K8ZA 2IVPA 2IBKA 4RW6B 2KKHA 4LF6J 3TA1A 1SKSA 2M4MA 5ETNA 4AH9A 5GAEU 1T3OA 1SQEA 3DCAA 4J9RA 3DRPB 4ELTA 2MKIA 4LF4K 3CJ1A 3FEZA 2B5JA 4DR1F 2X1FA 2CZ9A 5H9FJ 4NPOA 4OZJA 2GV9A 1LW0B 1SZ2A 2PFUA 2QKBA 3CJQA 3LP1B 1NMDA 2C2RA 3HKWA 4DU3A 4KTWA 4HT5A 2E8AA 1U7LA 3HSGA 5CYQB 1F2HA 5FRNA 4IOCQ 3EUNA 3V1RA 5CYMB 4ED5A 1UCNA 1HX1A 4ISFA 1VQ5S 4DFMA 1RWKB 4RWTA 1IBLK 3N6NA 5EXWA 3JS9A 2FC8A 3I6PA 4CESA 1N54B 3O9SA 1RXOB 2FUG9 4ES1A 4MIBA 4JYAF 2DFHA 2H54B 2JRSA 1KQSM 1HBOA 1R0AA 3VGVA 2FJDB 2H48B 4IR9A 3VWSA 2KJVA 2P9KA 3RB3A 1ZS6A 1QTMA 2XYHB 4BY9C 4YB6A 5AJ3J 3GFZA 2VIHA 3WNFA 3HDSA 1HW8A 2P6SA 5CD4A 1NB2A 2YKPA 3KKFA 1SC6A 3NXZA 5GMKa 1X4HA 2HVHA 1RBUA 3N9UC 3AXKA 1HD1A 3VAKA 3CT9A 2LQ8A 2AF6A 5B0FA 1S9EB 3I8DA 1GMWA 2QA4S 2VH7A 1NZ8A 3IGNA 2QJ3A 5T41A 1HPMA 1B7YB 1HMVA 4KI6A 2R2UA 4CFCA 1HJOA 2A41A 3ZZZA 4B9MA 9RUBA 1MROA 2F8SA 3D45A 3CCQN 3P5BP 3J80U 1VSJA 2JWNA 2G1HA 1FRHA 3OL7A 4G65A 2IIRA 4BC5A 4IO9L 3ULDA 4TY8B 1P90A 1RCOB 4JI8F 5KG3A 3OJUA 1KLMB 2FHJA 4CIOA 2B43A 1O51A 4UZCA 5KFFA 3T5HA 2MB0B 2JJ4D 1K0TA 5M1KA 3WX8A 3MXJA 3WC2A 2V4QA 4FLXA 2DCUB 2MLXA 1MWMA 1WHXA 4DR3K 3TJAA 4IH6A 1Z6RA 3L2VA 1S0VA 3E8OA 5F0UA 4JD2A 1HYSB 1OY8A 2J0XA 2IJRA 3OL6A 2MKYA 1X9SA 3AAPA 5AQZA 3KJNB 4E7KA 3G0ZA 4YOXA 2R42A 1UJ4A 1N52B 3TQEA 4IJAA 4LFBK 3IBFB 2BABA 1F6TA 3POTB 2DGOA 1OYEA 1DTTB 1X4EA 2HQDA 1T9XA 1RTDA 4BC4A 2P5GA 1U49A 1Q5VA 5KFWA 5DM7Q 3L8BA 2AJQA 1RDCA 4E7HA 3FK4A 1QAYA 1B3TA 3RW6A 2HHHF 3R9PA 2M9KA 2HBJA 2HWTA 2JOQA 2HQ3A 5JLHA 3TSQA 4JEPA 5KOWA 4H0VB 1DQ8A 2MKHA 3HZEA 5EX0A 2OPPB 1N0UA 5GMDA 5F3ZA 3MN7A 4MYUA 5KPZA 3AA8A 3AVFA 2XY5A 5HANA 3FBEA 4LF7F 2G0CA 1TFYA 4RCHA 4ICLB 2ZM6K 2Q1NA 3JTNA 1IR2A 4HACB 4YDDB 2ZDOA 3OTDA 1HLWA 1NGAA 1E4FT 3HT0A 3UNGC 4FJKA 1KFDA 2Q6CA 3QIPB 1ZPVA 4C9DA 3CJ8A 2FY1A 2YX6A 2HFZA 1Q81O 3D2FB 4I7FB 1NNEA 3NGDA 3N4PA 2G8VA 3NGIA 5E2QA 2V5HG 4P72A 1IWAA 1NK9A 4H4MB 1JJCB 2OKQA 3M8QA 2IC3A 1X8DA 1FJEB 5HBMA 4Y6IA 3M8PA 3DHXA 5T14A 2QA4G 1V3SA 1UVJA 1FNMA 4CVNE 2V8PA 4DSFA 3SCLE 2V50A 3CE8A 1WN7A 2QN6B 2GHWA 1QHTA 1X9MA 1HBMA 2YPYA 2V68A 3NF8A 3EVWA 2VOPA 4RWXA 1B0PA 5AQHA 1RWPB 1D5AA 1WACA 3VGUA 4LF1A 3UN5A 2E2QA 1YTUA 5ETPA 2HPUA 1RI7A 2HLTA 3QINA 2LP4A 2H5JB 2BZ2A 2UUCJ 3IWXA 2ZE2A 3NGSA 1RTHA 2VB6A 1MU2A 3V5RA 4KV8B 2KZZA 1TUUA 4V19X 4WIQA 2O01C 3MAAA 3G71S 5KFBA 4B8AB 1ITPA 3KOAA 3TRGA 1N8RT 4CCHA 4KHPK 2YWWA 1GK8A 1PBAA 2ZWOA 5EX3A 4JOUA 4LF4F 1JJHA 3DN9A 3SIPB 2EC2A 3UD4P 3VF4A 4J9MA 1UKUA 1OWXA 3BQ2A 1VQNN 3L95X 3LPTA 5C2CA 1NKEA 4HTJA 1EAYC 1RCXB 2XY8A 4ZVFA 1HNVB 2CPZA 3AD7C 5HRNA 3VN5A 1HNXK 3WXLA 2YBVA 4RNFA 5LM7E 2P9PA 1GLLO 4X4OA 1T02A 1VLOA 4ZVSB 3CD6N 5C42B 1HI0P 4ID5B 4J9OA 3QMLA 1IBLF 3CC2N 3UR0A 8AT1B 2V4RA 1H98A 5EWGA 4EHUA 3WXIA 5E3CA 5C5JA 3N28A 3LP0A 2LLZA 1RUSA 1YITS 3UKRA 4JV5K 2G2ZA 3H45C 4ZPVR 1VQ9N 5CZVA 1C0GA 3V81A 2Y1RI 5IQ6A 2QLJB 3FJ2A 2AW0A 4B3MJ 4NLUA 4K4TA 4OPKA 4NCGA 1JLEB 3S41A 3UVJA 1VK0A 2W9BA 4JN4A 3MEGA 5L1KA 1NPPA 3QBXA 2DO0A 3DM2B 2E9ZA 2ZBIA 3MM5A 1U6BA 1TU0B 3UDEA 3Q8RB 2L41A 3S6EA 3DDNA 3MPWA 1W2BM 2FGOA 1BGXT 1RDWX 2J0SD 5ETVA 1C1CB 2MZRA 2YTCA 3MUMP 1XJWB 2Y0BB 2ZHAA 3Q8SB 1B92A 4H5RA 3NGUA 1IKXA 2OZSA 4R0EA 2HHWA 1SUQB 4LF5K 4BE2A 2XC9A 1RT6A 4YHHK 3BR9A 1QZ6A 3A8KA 3W8GA 3D2EA 1K0VA 4CYUA 3NOGA 4MFBB 3QMQA 3EZWA 4UOFA 3I82A 5KT7A 3QETA 2J7KA 3RAMA 1N34J 1ULRA 1S72S 5DMRA 1WD6A 1IKYB 4M5HA 1SV5B 3TA0A 1RT5A 1GXUA 3AOCA 3RR7A 3GE9A 3NL0A 4GMKA 3GFHA 2XZTB 4DR3F 4DX7A 4JRQA 1C0TA 4M63A 3OHRA 4FP9A 1IKVB 5B09A 1XIQA 1BA0A 1S6QB 4PWDB 1MSWD 4H5VA 4YP3A 1KONA 4DV5K 4B1YB 4DZDA 3L6QA 1YIJN 4LFBF 1J5EJ 2ASMA 4HTUA 2EBGA 1HL6A 3EJMA 1FK9B 2RQCA 3FNNA 3DYAB 3ENAA 5ETKA 4OI1A 3THXB 3CCUN 2W8LA 2I6WA 3D0PA 2P2CB 2KFYA 3IRXB 1F3VA 4CLSA 5ETTA 1P1TA 3ZZPA 4F25A 1M5OC 3IUCA 1CC8A 4ZPAA 3BJYA 4L74A 2WTFA 3VQ4A 5K9FA 4GKKJ 1VBXA 3K0SA 4XPEA 5IWAJ 2K7KA 2ZH3A 4KGVB 3DLHA 2E2OA 2C3YA 4W4MA 4LMZA 4RWWA 2EX3A 5C7PA 3NMRA 1SPBP 3VAHA 4ELVA 1S3XA 4PL8A 1RT4A 4XAKA 4Y28C 1EETB 1HR0K 3L3CA 2ZM6F 5BPLA 3QFHA 4OJGA 1I51B 2K1RB 1A7GE 4CLFA 4PYDA 3HMJG 2COLA 5BPMA 1RTJB 2QYGA 4DMNA 1ATSA 2GUIA 2X78A 4R79A 2MGZA 2FVQA 2IA0A 3OYMA 3FCVA 4ID8A 1OIAA 2DR5A 1VQ5N 3BH6B 2I7PA 4CHYA 3JSRA 4OHWA 2IS3A 4BACA 4QPTA 3NOCA 1MLAA 2DRBA 3H4BA 3U9ZA 2V4JB 1FWLA 2W9CA 4M42A 1BG3A 2YWEA 3TZXA 2H51B 2AYEA 2P9SB 1ZBIA 2IPOB 4MAKA 4E2FB 4OYIA 2KVIA 5D4LA 1MMDA 3DXKA 4BGBA 2VBWA 4P52A 2OEKA 1FD2A 2WBRA 2AA4A 3GPAA 3CJ4A 3ENBA 2BM1A 1IG8A 4TYAA 1BO5O 1KVIA 4FOEA 5GADI 1EX8A 1R27B 2UXBJ 3J7AP 3DXSX 1S5JA 1LWEB 2I2YA 5BXIA 4IDHA 2U2FA 3QEPA 1OH7A 3QFWA 1SCJB 3HULA 1PILA 1QTNB 2D74B 4Q0BA 2JZ5A 3ILIA 4M95A 1XHXA 1HKGA 2VG6A 4USIA 2F9TA 2QG9B 2RQKA 3HXMA 1S9GB 2RDJA 5LMUJ 4U6PA 4KH1B 2QA4N 3DXMA 3HZGA 1TGOA 4YY3K 3ZZOA 1YJUA 2V7YA 3OLAA 1RNHA 2D5RA 1RLCL 3UQSA 3BREA 1K8AT 2XMTA 3SQGB 3IGVA 4B3TJ 3OFFA 4DCPB 4DS4A 2YKOA 3PJWA 5J2PA 4ZVQB 5F9NA 3QSIA 4OLOA 3MURP 1VCTA 2WB4A 1Z2LA 2DKOB 4FJ7A 1I94K 1D8YA 1C1AA 1TP7A 4IR1A 2GAHC 2GVDA 5KFQA 1RDDA 4OIXA 4XK8C 2IVFB 3CFOA 1RWMB 1NGGA 4JI3J 4EBCA 2XO7A 5ETRA 3V6DB 1H2VZ 4LBIA 4FJMA 1K44A 1HI1A 3RG6A 2VF3A 1LWFB 1Q95G 3C6TB 3DDKA 3TARA 4KREA 3G6VA 2B4JA 3NF7A 2E66A 2VFRA 3D7EO 2Z57B 3UE2A 2F9WA 3G86A 4JV5F 1WI6A 1SB6A 4DV0K 3O4NA 1R0CB 5A6WA 4OV6A 4DPYA 1EQ0A 2ZDPA 2CQ1A 5KI6A 1R3NA 5GIPA 3OSNA 4CLZA 2AEJA 1VQPS 4Q8EA 5K8MA 3S7RA 2NXNA 2G2OA 1S22A 3ISZA 5FLXY 2ACYA 3RYLA 1C4AA 2MHNA 3RAXA 3MMVA 3QEXA 2PFFB 5J2QA 3CPWR 3QEVA 5EVZA 4RW6A 2BQUA 4YR2A 3PSIA 1CC7A 1DY3A 1DKGD 1VQSA 4EWTA 4CJVA 3KHYA 3OXGA 3DOKB 3L2QA 3RBZA 2QX0A 2D3UA 5J1EB 4AYBD 3DRPA 3HHEA 3HSJA 2VC0A 3LP2B 4CIFA 3PW4A 2CPYA 4LF5F 2GHPA 4E7IA 3K7RA 4YHHF 4BDZA 1YKWA 3H1VX 4TLQA 2LKZA 3OYHA 5EY4A 3THWB 1VC0A 3LP1A 4M41A 3CM6A 4B1XB 1RT3B 3K2PA 1KVBA 4MO4A 3D0HE 4O3RA 5A2QU 5E3RA 2VUGA 2HVDA 5CYQA 1YHQS 3G6ES 1CSJA 3I56S 1IJEB 3NCQA 5I3UA 1TFWA 1S7IA 2Y1IA 4BRAA 5CYMA 2PE8A 3U27A 3PEJA 2RHQB 3RRKA 5J2MB 5BRHA 2V67A 4DUTA 4JKBA 1D1UA 2KRRA 2QL9B 5HATA 4NMLA 3HOTA 3DKDA 4CK2A 1IBKJ 2EFQA 3MX5A 5A8KA 5FD1A 4DTMA