4MFBA

Crystal structure of hiv-1 reverse transcriptase in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
544
structure length
544
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Picomolar Inhibitors of HIV Reverse Transcriptase Featuring Bicyclic Replacement of a Cyanovinylphenyl Group.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 143
structure length 544
sequence length 544
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4mfbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4mfbA05
3I0RB 1HYZA 1RT7A 4X2BA 1LW2B 1TP7A 3MECB 3IAYA 4Z4IA 4DL7A 5J1EB 4CFAA 3FDSA 4IFVA 4N76A 4DQQA 2XY7A 3NF6A 2DFHA 5F8GA 4CEDA 3F9KA 4G3IA 3PJWA 3AO4A 2FBTA 3C6TA 4G1QB 2D41A 3L2RA 4AH9A 2QK9A 1VSHA 3ISND 4M3TA 2R8JA 1LW0A 1S6PB 3DRSB 4EBDA 2UVUA 2HW3A 4H54A 4OJRA 3HYFA 2YNIB 5KG0A 1LWFA 3VQAA 3DYAA 5KFTA 5T14A 3OJSA 3PVXA 1S10A 1SL0A 4HKQA 2HMIB 4FVMA 2D3ZA 4ECTA 4B9NA 3IG1A 3LPUA 5KFZA 1J5OA 1S5JA 2YHBA 5J2PB 3C6UB 4ZPCA 1K6YA 3VA0A 4AHSA 3OYMA 4ED2A 4IRKA 1KCFA 3MEGB 4ZTFA 1LW0B 1RT2B 3S3MA 2VWJA 4NLSA 4RUCA 3V6KA 1WSEA 2ZQBA 3OYCA 2HNZA 5HRRA 3FQLA 1IKVA 2WOMB 3MEDA 5C24B 4KB7A 1JLEA 3V9SA 3DMJB 5DQIA 3N6LA 1S6QA 3HP9A 4FLUA 5HROB 1VRTA 3DRPB 5C42B 5HBMB 5KFJA 3O3GA 3CFPA 2RDIA 3G6VA 3AVFA 4F4ZA 3OHAA 4CEZA 1UWBB 4DFJA 3F73A 5DGAA 3KD5E 4KTQA 2IMWP 5J2NA 1U04A 2IC3B 1RCHA 4ZVFA 3OYHA 1RTIA 4URGA 2OYQA 3VQPA 4ID5A 5E41A 3FQKA 4Y2CA 1J9AA 3VQ9A 1IKYA 4EEYA 3CDUA 3PZPA 1CXQA 4O4GA 5J2QA 4DQIA 4K50A 4ELUA 4DL3A 2UVWA 3ZT0A 1KFSA 3TVKA 3NBPB 3CIZA 4OGEA 1R0AA 5DK5A 3QEIA 3TWHA 3OL9A 4B3OB 4IKAA 3HXMA 4WXWA 3M9NB 2YNGA 1RYSA 4OKKA 4AHCA 3CVKA 2BRKA 2FLNA 2V4RA 4FZZA 1WNSA 4O55A 3PR5B 1JLGB 1RT4B 3TAMB 1ZTWA 3HO1A 1GX6A 5KGWA 1QUVA 2HHVA 4CJSA 1A5VA 4FBUA 4BDPA 2C28A 1C2PA 3DRRA 3ZSOA 1T05B 3ZSRA 4RUAA 5FRMA 4E7KA 2Z1GA 3AO1A 4NLQA 4NRTA 5DG8A 3OS1A 3GV7B 3OSPA 3SI8A 1S0OA 4IR1A 5HRNA 2B6AA 2V4QA 3SJJA 4FS2A 1TK5A 3OLAA 4E7HA 2OPSB 3EPGA 4DTOA 4F8RA 1NOYA 4ED7A 1QSSA 1TK0A 5FRNA 5I42A 4LD0A 4DQPA 3QIPA 3V1RA 2CJQA 4KO0A 3K5OA 2OA8A 1B9DA 1NHUA 3ITHA 4FJMA 2F96A 1J54A 3SI6A 3AVHA 4Q44A 5CZ1A 4E7IA 2AU0A 4ZMMA 4ZHRA 4I2QA 2GUIA 3GQCA 3NGIA 1BHLA 2YKMA 3IGNA 5KTQA 1S1WA 3PX6A 4OKJA 3LP1A 2DFFA 3WNFA 2FBVA 4FS1A 4JS5A 5KFDA 4F4XA 3DOKA 1F21A 1X9SA 3JYTB 1WNEA 2YNHB 4PA1A 4ZVGA 3H59A 4I9LA 4DTUA 4WYWA 3QO9B 2IGIA 2HHTA 4E1MA 4O5BA 1D9FA 1BISA 4FM1A 4WXOA 4H4OA 2GIQA 1EX4A 4XPEA 1T7PA 3E01A 4CEAA 1YTAA 4FW1A 4U7CA 3M8PA 3V1OA 1UAXA 4CCHA 1S1UB 2BANB 1EETA 3PO5A 4TXSA 2YKNA 4DU3A 4RNMA 4K4TA 1FKOB 3PX0A 1JL2A 1S0MA 2XI2A 1JLCA 4AHVA 3B6PA 3KKRA 3LALA 2IAJB 4IDKA 2HNDB 3ZSWA 4LSLB 4CECA 4E7LA 4OGCA 4Q0BA 1UA1A 3AVJA 5F8LA 3MR6A 1IKXB 2I1RA 1JIHA 3HL8A 4CHNA 4ED8A 1GX5A 3AVCA 4J9MA 3D45A 2XO7A 4TY8B 4FLYA 2ASJA 2KZMA 4OPKA 1WSFA 4IH5A 4MIAA 5DLFA 3PY8A 4FK0A 3ZT4A 4IKFA 2FJWA 3OVNA 3H5SA 4DTMA 3PJXA 2DFEA 5SWMA 4DL6A 5KFBA 4PWDB 1WN7A 2FBYA 2RF2B 3KK2B 1WSIA 4M3UA 2VG7B 4JRQA 5EU7A 4CJVA 3SUQA 4NLPA 1LWCB 2XGQA 4CF1A 4DEZA 5DMRA 5CYMB 4DTNA 4NYNA 4CESA 5C25A 3K5LA 2ITGA 3OL6A 3E51A 4F4YA 1RILA 3ZT3A 3RAQA 4KI4A 3QEWA 1HQEB 4NLXA 3DDKA 2X74A 1VSDA 4NZ0A 4IG3A 3QGGA 2JC1A 4N56A 1D9DA 3HPGA 3M8QB 4RNFA 2AQ4A 3S3NA 4FLWA 1RDBA 2RPIA 1KHVA 4FJ7A 3D28A 4J2DA 4WYLA 3DLEB 4RNNA 4MFBB 3NL0A 3MR2A 1QQCA 4CIEA 4HUFA 2AX1A 3WNGA 4BE0A 1S97A 2DY4A 3NE6A 3I0SB 3NF8A 2V0NA 1JLQA 4K4YA 5KFKA 3RMCA 4Y2AA 2QKBA 3KHLA 4CJLA 1TKDA 3O4NA 5D3GB 4DSJA 3RMBA 2AWZA 5KG1A 4UQGA 2HNYA 5T7BA 1SKWA 4CEBA 1VRUB 3KK1A 1YT3A 2RKIA 3UR0A 4W5OA 3SQ4A 1RTDA 1LWEB 4GVMA 4KRFA 1J53A 4QW8A 4IQXA 3ZSZA 1BQNA 4PQUB 3P83D 4OPJA 3HVTA 1QSYA 2WB4A 1X9WA 3KLIA 2JEFA 3CDEA 1Z26A 2X78A 3LP0A 4RZRA 4KFBB 1MU2A 3SPYA 4ZP6A 4FJLA 4NLTA 4XPCA 4QCLA 4ECYA 3KLEA 4FJ9A 1RBVA 3KHGA 4AHUA 4CFBA 2G8WA 5HLFA 2HHUA 3SV3A 4OVLA 1HNVA 5F9NA 2Z1IA 1LAWA 1L3UA 4F4WA 1RT1B 4ECZA 3V9ZA 2C2RA 5EDWA 2R2RA 3I5AA 3RWUA 3NKYA 4NCGB 3PW2A 1C1AA 4EZ6A 3L2VA 4B9SA 4NYZA 2NUBA 4K4XA 3SV4A 4KHNA 1XC9A 1S1TB 3QLHB 1TKZB 5K14A 2GBZA 4CJ5A 3U3GA 2JLEA 3AO3A 3OY9A 2AGOA 5KFUA 1IM4A 1VK0A 3CJ4A 1N5YA 3QGHA 3KLHA 3KIOA 2OZSA 3SFGA 5I3UB 3T1AA 3SUPA 1UA0A 3N6NA 3DLGB 1S9EB 3IS9A 2XCAA 1WSJA 3N6MA 2VG6A 4XO0A 1NOZA 3LANA 5F8HA 1RT3A 4J9KA 2BE2B 3P5JA 2P1JA 1ZBUA 2W9CA 2E6MA 1FK9A 3O3HA 5KI6A 3NFAA 1VSMA 1VSLA 1RDDA 3V81A 4MH8A 4M94A 1EP4B 1RBSA 1RTJB 4CK2A 1N6QB 5CYQA 4ED0A 4FCYA 3G6YA 4DG1B 2W8KA 3L2WA 5KFLA 3I8DA 4M45A 3T3FA 4FW2A 5L1KA 3OS0A 1QE1B 2XY6A 4B9VA 3PW5A 1ASUA 4ID1A 4R8UA 3FFIB 4LSNB 3QZ8A 2FVPA 4HUGA 1DLOB 4TN2A 2UVRA 4J2AA 4ZP9A 2FC0A 1NJXA 4C8KA 4TYBA 2V9WA 1S1VA 3V4IB 1HJRA 3SZ2A 5KFFA 1JXLA 4PUOA 4DF4A 3HJFA 2R8HA 1RT7B 2HVHA 1S49A 1RBUA 4KHMA 5F9LA 1XI1A 3NF9A 2OPQA 3K5NA 3KJVA 4O3OA 3VQ6A 4IFVB 2IBKA 4CF2A 3NCIA 4FJGA 5EWFA 2W42A 2QE5A 4B9TA 5JUMA 4BWMA 4MIBA 4WFXA 4RW8A 3RRHA 2UUTA 4DU1A 1S9GA 2BQ3A 3C6TB 4WZMA 3NH2A 4DTJA 1FKPA 2AGQA 1JLFA 5DQHA 1VSIA 4AHRA 4ECQA 4FJHA 1Q9XA 4FJ8A 4YR3A 3CJ3A 4CJUA 5J2MA 2IS3A 1WSHA 3HPOA 3EYZA 3CG7A 4WFYA 4DF8A 1T8EA 1JLBA 1LWFB 3DYAB 4KAZA 1RT6A 4O44A 3AV9A 3ULDA 3AO2A 4CJFA 2F8EX 4ELTA 4Z4EA 3OS2A 4WZQA 5EUHA 2ETJA 4RW9A 4CGGA 5KFCA 1LAVA 3IG1B 2IA6A 3AA5X 1J5OB 4FJNA 5KT7A 5CZ2A 4DSEA 4CF0A 2HVIA 2B5JA 4CERA 5KFOA 4I7FA 4KHRA 1Z25A 2IOCA 1U47A 4DTPA 4K4UA 1BI4A 3BSCA 2KW4A 4YR0A 3V9XA 1ZBLA 2HNZB 3CJ5A 1QHTA 1NK7A 1NK6A 4H4MA 3L2QA 1IKVB 3MEDB 1QSLA 1KTQA 1RA6A 1JLEB 3G0ZA 1S6QB 1VRTB 1S48A 4CJRA 4CFCA 4E1NA 3TI0A 3SPZA 1SV5A 3D0PA 2Y1JA 4RW9B 1ZBHA 3QESA 1W9HA 4CGFA 2DPIA 5J2NB 3KOAA 1RTIB 2YHAA 4KKOA 3VN5A 1HQUA 2HB5A 3AA4A 4ID5B 1TAUA 4KB0A 3VQCA 4CJ4A 3O3FA 4ZPDA 3BR9A 4ZVHA 5KFXA 1IKYB 3Q8SB 1KLNA 4E7JA 3QEPA 1SL1A 1QAJA 1BQMA 2IDOA 4IFYA 4O4GB 5J2QB 5C5JA 4RW7A 1NK9A 2BDPA 3DM2A 3Q8PB 2GV9A 4ZTJA 2IM0A 1R0AB 3T5LA 5KG3A 1TV6A 5KG2A 1U4BA 2C22A 2DPJA 1I39A 1IKWA 3VQEA 3VA3A 2W8LA 3MXJA 4C8OA 3U3YA 2YNGB 2QXFA 3KLFA 2O4IA 3AVBA 4NCBA 4DTXA 4KHQA 3OJUA 4KHYA 2ILYA 2P5GA 5HRPA 1SL2A 4DS5A 4F2RA 1S4FA 3MTKA 5F8MA 4OLAA 3L3UA 4YQWA 3DRRB 1NKCA 1CZBA 5JS1A 4DQSA 4AILC 3V6HA 4CJKA 3EZUA 4QWAA 4OLBA 3VQQA 3BJYA 2D0CA 4FXDA 5KT5A 4IH6A 3AA3A 1EKEA 3AVMA 1L3SA 2HWHA 3OYKA 1RBRA 3T5JA 3HK2A 4QOZB 3H4DA 3SYZA 4IBNA 5HP1A 2IM1A 1U48A 2Y1IA 1QTMA 4DSLA 4F50A 4QWDA 2B6AB 3UIQA 2JGUA 4NLDA 3MXIA 2I5JA 1VSKA 4J9QA 4DLGA 1KVCA 4MKAA 5I42B 1C0UA 3KHHA 3QIPB 3TABA 5KG5A 3D5MA 4KO0B 5F8IA 2RDJA 1JXBA 3LZIA 2GC8A 3RB6A 4BDYA 2PYJA 2X6SA 2FJXA 4AHTA 4H8KA 3ITHB 5KFGA 3TQ1A 4NLRA 4KTZA 3RAXA 4ZHRB 4TQRA 4I2QB 4ECUA 3BQ1A 4R5PA 4ZP7A 5DQGA 2O5DA 2YKMB 1RTHA 1S1WB 4CF8A 2XY5A 3LP1B 4Q8FA 5KFAA 3DOKB 4BWJA 3PHEA 3ZSXA 3H5YA 4NLWA 4M3YA 1HPZA 3CQ8A 4B9LA 1C0TA 2D3UA 3NH1A 4MKBA 3OYIA 4H4OB 3G86A 1BL3A 3TAQA 5KFWA 1S1XA 3TARA 3GV8B 3E01B 4CGJA 1RBTA 4ECSA 4WFZA 3M8PB 4FK2A 2C2DA 2P51A 3NGDA 1EETB 2YKNB 2A1RA 4CFDA 1SKSA 2IJFA 2W9BA 1JLCB 2RN2A 3PO4A 1N48A 3GV5B 4CHZA 4IDKB 3ZSVA 1I3AA 4IH7A 5KT3A 3BQ0A 4CGDA 1RT5A 4I2PA 4KREA 4Q0BB 3NAHA 5EWGA 4ED6A 1DTTA 2KQ2A 3VQ5A 5FDLA 5HRSA 2AGPA 4FLTA 4WE1A 1U09A 4HCBA 4CEOA 4O0JA 3IRXA 1TKTA 2HAIA 4IG0A 3A2FA 4U6PA 4EO8A 4KV8A 1CLQA 3V9WA 1TVRA 2W9BB 3V6DA 3QZ7A 3SQ1A 4J9RA 1ZYQA 4O3PA 3DI6A 3C94A 3HP6A 2R7YA 2ASDA 1HRHA 5DGBA 4ICLA 3DOLA 1HNIA 3DLKA 4BACA 2CKWA 4GW6A 1REVA 3RBDA 1I6JA 4Z0UA 1LV5A 1TL1A 2XHBA 1SUQA 4NLVA 4KHSA 5C25B 1DTQA 5KFEA 1L5UA 2LSNA 3PX4A 5KFVA 3G10A 2B4JA 2UVVA 3MR5A 4LY7A 4IG3B 4RW4A 1KHWA 4DU4A 1C1CA 3LAKA 2FBXA 4FJIA 3KK3A 4CHYA 2E4LA 3KMQA 1ZBIA 4RW6A 3MEEA 3OYBA 3CM6A 4DQRA 1TK8A 1WAFA 2WK4A 4R0EA 3H5XA 5KRSA 3LP2A 3PW7A 1JL1A 4MK7A 1NKEA 2DTUA 2JEGA 3NH0A 2OPRA 4J9LA 3LWLA 1JLQB 1HYSA 1RDRA 2D0BA 3HSTB 4HHTA 3CFRA 1CSJA 1HARA 1TL3A 4ECRA 1KLMA 1RDCA 1NJYA 1T03A 2D0AA 3CO9A 2HNYB 2Z1JA 1JKHA 3KK1B 3RMAA 2RKIB 1L3TA 4CGIA 3H40A 1RTDB 4NLOA 5L1IA 4FLXA 2XC9A 3GIIA 1JLAA 2WCXA 3SUOA 3QERA 3JSMA 2E6LA 2BR0A 1BQNB 4M3RA 3FSIA 3HVTB 1BCMA 4F2SA 1HMVA 3KLIB 4ECXA 3KD1E 1HYVA 2KFNA 4FJJA 2X6NA 3LP0B 2F8SA 1NHVA 4MQ3A 4DMNA 1MU2B 3OYEA 4EP4A 2OPPA 4DTSA 2VG5A 1XHXA 2YNFA 4DFKA 1TKXA 2ZD1A 4TLRA 3AVAA 2ZE2A 3RR8A 3KLEB 4JV0A 4NYFA 1SKRA 4K8XA 4M3ZA 1FXXA 1JXEA 5HLFB 1YVUA 2WONA 4URQU 1WSGA 3GIJA 4Z4FA 4IOBA 2ALZA 1HNVB 1RNHA 2EHGA 1S0NA 3LZJA 2BQUA 4O3NA 1ASVA 3KNAA 2FVRA 4N5SA 2VWKA 1C1BA 2KTQA 3NAIA 1C6VA 3I0RA 3CJ2A 3OYFA 4YNQA 1LW2A 4RG8A 3MECA 3LPTA 4DSIA 1U49A 3AVLA 5K14B 5J1EA 3M9OB 2BGGA 4HTUA 4KPYA 3V1QA 3NF7A 2G8IA 1ZBFA 1N5YB 1N56A 1UOCA 3KLHB 2EC0A 3KTQA 4G1QA 3QYYA 3GILA 4CJWA 1YVFA 3IS9B 3C95A 3UDLA 4O3QA 3BSNA 1S6PA 4CJEA 3DRSA 2VG6B 2ATQA 3T5KA 3KHRA 3U6FA 4N47A 3KKSA 1IG9A 2YNIA 3V9UA 1RT3B 3TANA 4CIGA 4ED1A 3DLRA 3NMAA 3BSAA 4FZXC 3SCXA 3H98A 2W9CB 4FJXA 1FK9B 4HCCA 3QNOA 4EZ9A 1TGOA 1D5AA 3RTVA 2HMIA 2J6TA 2WHOA 4CEFA 1CXUA 3K58A 3V81B 4KSEB 4Q5VA 5J2PA 3C6UA 4K4VA 5CYQB 4JV2A 3MFHA 4HYKA 2ILZA 4N41A 2PY5A 1KVBA 2IM2A 2YV0X 4QWBA 4KB1A 3MEGA 2W9AA 3H08A 1TQLA 4W5TA 2FVSA 3CJ0A 3LDSA 1RT2A 1CZ9A 2G8HA 3OSNA 3OL7A 3B6OA 1N4LA 4E0DA 1SH0A 3PV8A 3RB4A 4R8UB 2WOMA 3L8BA 1QAIA 5C24A 4FJ5A 3QNNA 4I9QA 3DMJA 4OL8A 1S1VB 4URSA 5HROA 3H2LA 3DRPA 4MK9A 5C42A 5HBMA 3RR7A 3TAEA 4PUOB 4QWCA 3AVGA 1KVAA 2WRMA 1UWBA 4JUZA 3G6XA 4O4RA 2IC3A 4Q45A 2OPQB 1XR7A 3KJVB 3ICLA 3MFIA 4HVJA 3S3OA 4O3SA 2E9TA 4CE9A 1A5WA 4W5RA 4C8MA 4RW8B 3LWMA 3CFOA 1K1QA 3L3VA 3V6JA 1S9GB 1K1SA 4J2EA 1RA7A 4DSFA 1FKPB 4FM2A 4K8ZA 1W25A 2XI3A 1JLFB 4C8LA 4EYIB 5KG7A 3NBPA 5J2MB 3OYLA 5KFQA 4DL5A 5KFRA 5F8JA 1JLBB 3AVKA 4FM0A 2D5RA 1ASWA 5L1JA 1RT6B 4O44B 1NK0A 3L2UA 4B3OA 3BGRA 4QPXA 4JS4A 3CDWA 4C8NA 3KLVA 4YP3A 1RDAA 4M41A 1JLGA 1RT4A 3TAMA 5L1LA 4E19A 3MXMA 3SUNA 4M3XA 4GC6A 5CY4A 2B5JB 4EBCA 1BGXT 4I7FB 1Y97A 2AJQA 3BREA 1BI4B 3HT3A 3GYNA 4JV1A 4GC7A 4Y1CA 4CHOA 4JRPA 4ZPBA 2G8FA 3OYNA 4H4MB 3M8RA 1T05A 4B9MA 1NKBA 4BE2A 1SH3A 4B8CA 2XCPA 3ALYA 4W5QA 1KFDA 3TAFA 2C2EA 4DTRA 1MMLA 3BGRB 1XWLA 1SV5B 1GOAA 3ZSYA 4LH5A 5KFNA 2OPSA 3PW0A 4KKOB 1HQUB 4CHPA 4J2BA 5DG7A 4Q8EA 4TYAA 4TY9A 2F8TA 2R2TA 4YR2A 1L3VA 5KG6A 4ECVA 3TAPA 4KBIA 1NK4A 4CHQA 1BQMB 4IFYB 3GIMA 3Q8QB 4RW7B 3QIOA 3SQ2A 3DM2B 4RNHA 5KT2A 3O4QA 3RB0A 4IRCA 2A1SA 2BQRA 1JX4A 1TV6B 1S9FA 1BCOA 1Z4UA 1G15A 1IKWB 3WNHA 3ZT2A 3FRZA 3I5CA 4Y34A 3H4BA 2J6SA 1KSPA 3OLBA 1VSFA 3KLFB 2IJNA 3AVNA 2PZSA 3PUFA 3JYTA 2YNHA 3M9MB 3CM5A 1Q8IA 3RMDA 1IO2A 3QO9A 4LH4A 4EP5A 2HWIA 4KE5A 3K5MA 4E3SA 3MF5A 5KRTA 2QKKA 5KFHA 5KFPA 4M42A 3K2PA 1BIUA 3PR4A 3QEXA 1S1UA 2BANA 4DL2A 4F3OA 3UQSA 4EBEA 3QIDA 3UPFA 1FKOA 4XIUA 2FLPA 4KHUA 5HP1B 1T94A 4FLVA 2IAJA 4ZP8A 2HNDA 1BIZA 4LSLA 3ZCMA 2OH2A 2FVCA 4JLHA 1XR6A 3HPHA 2I5JB 1IKXA 4IR9A 3IN5A 2KZZA 5KFMA 2AX0A 3EY1A 2G8VA 2R2SA 2XGPA 1C0UB 3M8SA 2D7SA 1D0EA 4TY8A 2HHWA 2JEJA 3ZSQA 4J9NA 4TSXA 3H5UA 3HVAA 2BRLA 3QGIA 4J9OA 4PWDA 3KLGA 1T3NA 4B08A 2RF2A 4LQ3A 1XR5A 3KK2A 4R5PB 3QEVA 3DLHA 2VG7A 4FK4A 1RTHB 5JS2A 3DLBA 2E9RX 1NNDA 1YTUA 2HHQA 1LWCA 3QINA 4J9PA 1O1WA 4W5NA 4YMEA 4NLGA 3OYGA 4NLUA 4DS4A 5CYMA 3SQ0A 4J9SA 3BDPA 1XHZA 4K4ZA 4KI6A 4O3RA 5SZTA 2VA3A 1HPZB 1C0TB 3OL8A 3LP3A 1HQEA 5DG9A 1IH7A 1S1XB 3KLGB 5F8NA 4CIFA 4OKEA 4PY5A 3M8QA 4YFUA 2IM3A 2XY8A 1B92A 4QWEA 4ELVA 4M3WA 1C0MA 2JEIA 3DLEA 4MFBA 4FLZA 2GIRA 3AO5A 3S9HA 1EXQA 5JXSA 3RB3A 1D1UA 5KT6A 4CJTA 1RT5B 4I2PB 4Y1DA 2ZKUA 1DTTB 1OS5A 3I0SA 5FDLB 1NK8A 3IGVA 4CEQA 2W7OA 3OYJA 2XWYA 3MAQA 4WE1B 1SH2A 3IRXB 5D3GA 4TQSA 1TKTB 2E9ZA 5KT4A 4IG0B 4CJ3A 4CF9A 1VRUA 5KFYA 1D8YA 2R8GA 2G8UA 4KV8B 3I5BA 1TVRB 1LWEA 3V6DB 3HVWA 1X9MA 3DI6B 3T19A 4ZPAA 4ED3A 4PQUA 1WLJA 1KRPA 4FBTA 3VQSA 4ICLB 3DOLB 1NK5A 4CK3A 2VA2A 1HNIB 3DLKB 3SFUA 2ASLA 3AVIA 3Q8RB 1REVB 1NJWA 4NCAA 1TL1B 3QETA 3RRGA 3VQ4A 2EX3A 1SUQB 1WAJA 3BSOA 3CYMA 4KFBA 1DTQB 1W0HA 3HVRA 3TAGA 5KGXA 3RBEA 4FJKA 1GOCA 4QAGA 1NJZA 5KFSA 4RU9A 4K4WA 4ECWA 4RW4B 4DFMA 4DFPA 1C1CB 3HHKA 4CJPA 4HUEA 3KK3B 4B8AB 2R8IA 2KFZA 3ISNC 4RW6B 3MEEB 4KHWA 4DLEA 2R8KA 4CK1A 2W7PA 1X1PA 4NLYA 4Z4HA 1A5XA 1RT1A 3SNNA 2HHXA 5FROA 3LP2B 3GIKA 4CGHA 4KTWA 4NRUA 2P5OA 4NCGA 1RAJA 3LAMA 3NDKA 2OPRB 3VQDA 4E89A 4BE1A 4O0IA 1HYSB 3VQBA 3WNEA 3AA2A 3NGYA 2XRIA 3K57A 1S1TA 3QLHA 5DLGA 3CWJA 1TKZA 3HM9A 5KFIA 4K4SA 1TL3B 2FVQA 4Z4CA 1KLMB 2OZMA 3EZ5A 1T03B 1U45A 1B9FA 4F4KA 2O4GA 3NGZA 3VQ8A 3OYDA 1JKHB 3EPIA 3OYAA 5I3UA 4RNOA 3ZT1A 3MR3A 4Q43A 4LQ9A 1JLAB 3P1GA 3DLGA 3T5HA 1S9EA 1VSJA 1ITGA 5EWEA 3JSMB 4IRDA 4L8RB 4BDZA 3PW4A 5KG4A 2ATLA 4B9UA 2B43A 1HMVB 3VQ7A 2HHSA 4EO6A 3K59A 2BE2A 5L9XA 2UUWA 4M95A 3HKWA 2WTFA 1GOBA 4GMJB 4CEEA 4F3TA 4DL4A 1Q9YA 3NAEA 3NHGA 4DWIA 4FYDA 4KAIA 2OPPB 2VG5B 2YNFB 1TKXB 2ZD1B 4Z4GA 1EP4A 2ZE2B 3ASMA 1RTJA 1N6QA 4EYHB 2JC0A 4Y3CA 2Z1HA 4DSKA 2PYLA 3KMSA 3THVA 4DG1A 1TAQA 2R2UA 2WONB 1ZETA 1QE1A 4ZVEA 2J6UA 3BQ2A 3TR8A 2FJVA 4QW9A 2Q3SA 3FFIA 4LSNA 3OHBA 1QS4A 1VSEA 1DLOA 1C1BB 4CJQA 2QV6A 1RYRA 1ZTTA 3V4IA 2FLLA 4MK8A 2G8KA 4FZYA
chains in the Genus database with same CATH superfamily
4FZVA 1HHQA 1RT7A 1GXTA 5AQYA 2I2YA 1LW2B 2JVOA 6FD1A 3WIUA 1E6YA 3THWB 2PT0A 3IAYA 3N01A 4Z4IA 4WTOB 1NM2A 3M4XA 4JOUA 3MM6B 3I56S 3FDSA 4IFVA 1IJFB 4DR4J 4N76A 4DQQA 2XY7A 3J7A1 2QTWA 3NF6A 3QRPA 2ZGYA 1EQYA 1W26A 3PJWA 3AO4A 3KHYA 3C6TA 4V19X 1R8BA 3L2RA 3L7UA 1OQ6A 1Q7LB 4GVBB 4KY3A 3W5XA 2P9KB 3IAS9 4OJRA 1UJ5A 1FJGJ 1LWFA 3VQAA 3I9V9 2QLJB 5KFTA 3OJSA 2V34A 1S10A 5JVHL 4HKQA 3G71N 1H0HB 1U8SA 2DITA 4ECTA 4NXNK 3IG1A 5HMXA 3LPUA 5KFZA 4E1JA 1JJCB 1YJ9S 2UUBF 1PAUB 2ZJRL 4AHSA 1JQGA 1MN7A 3TZZA 4ED2A 3MEGB 3U7JA 1RT2B 4I56A 1WSEA 2GVZB 3OYCA 1YRXA 4ID8A 5HRRA 4RUBA 3CT9A 3OBYA 5B0GA 4TKTA 2E2QA 4P72A 3D2FA 1R59O 3DMJB 1S6QA 4CH1A 3DRPB 3IR7B 2AD9A 4EIAA 4DV3F 4BHQA 2QRRA 3KDNA 2ZUGA 3OHAA 4CZGA 4LF6J 1RCHA 3EE8A 3EE9A 3W3DA 4JAXA 3CCWA 5DM6L 2E66A 1PIEA 4ID5A 4YY3J 4DOZA 5BN9A 1IKYA 1XMOK 5U47A 2W41A 3VTIA 2B0GA 5HL7L 3UKUA 1S59A 4ELUA 2CADA 2UVWA 1U0HA 1KFSA 4ZPVR 1RAOA 4OGEA 2N7YA 3W5YA 3D6MB 3FEYB 5H9FK 4P74A 3QT8A 5HJYA 3OL9A 2AHOB 4IKAA 4BGBA 3UE5A 4WXWA 4AHCA 4OKKA 3UN5A 4DPUA 2FLNA 2F9TA 5DM7Q 3GFXA 2DNPA 3CB4A 1UVNA 4CLKA 2IDEA 5A8WA 2DEIA 4DHVA 4CJSA 2JWNA 1OSCA 4FBUA 2OCEA 5IT9Y 3A4TA 4DV6F 1NLKL 4JI4J 2Q97A 5KPTA 4DR4F 2VC1A 2HF4A 1N5QA 3OR2B 4L72B 5DM7L 4LRFA 2MQOA 2BJ7A 5B8HA 2CVEA 2MJUA 2J9CA 1GEHA 1RHKB 1F1BB 2ASPA 4JI1J 3SI8A 4IR1A 2UV8G 2CH6A 2ATCB 1PJ5A 3MTJA 4ZIWA 2VU5A 1TK0A 2B8QA 2ZVSA 4UQTA 3I87A 4JKFA 1RI7A 3SSRA 3NS6A 1Q82T 2CJQA 2PFFB 2Q31A 1Q53A 4XAKA 1UP1A 2OA8A 2DGXA 3UCUP 3R2CJ 1OSDA 2P2CB 3EVWA 5FLXU 4WF9L 4CD3A 5EX5A 3W8PA 2GUIA 2VF3A 2QWRA 4K42A 3GQCA 3NGIA 1S3XA 2NYHA 2XS2A 4JI8K 3LP1A 1I94K 4NWBA 3C7NA 1AZSA 4FS1A 1RBLA 4JS5A 4QR2A 2YNHB 3SMSA 4QIGA 2HHTA 4E1MA 4UY85 3AOBA 1M0SA 4C0BA 2L9DA 4XPEA 3DRXA 3TWZA 4BREA 4C8ZA 4LR7A 1RAIB 3BH6B 3M8PA 3DXKA 1UAXA 3ZTOA 1EETA 3PO5A 1YIJN 4DU3A 1N5TA 3MHYA 4RWTA 4YY3F 1Y00A 4KRWA 1JL2A 3AAQA 3MMAA 4AHVA 1RB0A 1U2FA 1H2VZ 4Q0BA 3WDOA 3CJTA 3AVJA 2O67A 2DR9A 1IKXB 2F65A 1JIHA 4CHNA 4J9MA 4DR7F 2HEKA 1RWWB 3R5GA 4OZ5A 2HRYA 2OUGA 4OPKA 4M5NA 4MIAA 5DLFA 4IKFA 2GJFA 3UWTA 2L9NA 5KFBA 1QQOA 1IWGA 2E5GA 2AYBA 1CULB 5CA5A 2VG7B 5GMKa 4OX7A 2XGQA 5DMRA 4O23A 2CRLA 3GR0A 4DTNA 4CESA 1NGEA 2J7WA 3E51A 2D69A 3ZT3A 1E6VA 4C11B 2CQCA 1V4SA 4QU6A 4KYZA 4JI1F 3DDKA 1V5IB 1K73O 1D9DA 3M8QB 3S3NA 1RDBA 3ZLJA 3D28A 4H0VB 2DT9A 2JLFA 1KVJA 1HNXJ 1ROFA 3VF2A 1XNQK 4CO0A 2VOPA 4HUFA 2G2YA 3CCUS 2FD2A 1JMTA 2YQ0A 2DY4A 2X3GA 4LRCA 2V0NA 2KFYA 2GO8A 1TKDA 1HWUA 3O4NA 1YK9A 3CCMS 4NOHA 4Z7CA 2AWZA 5KG1A 3R3TA 1IQZA 3C46A 1SKWA 3KUGA 3FE1A 4W5OA 3PKYA 2UUCF 1VJWA 3O9UA 1J53A 4QW8A 4BRQA 3LDOA 2IVYA 2CJKA 3F9MA 4PQUB 1H38A 3L6QA 4A61A 5FPEA 4OPJA 1TU0B 1WDDA 3HVTA 3MDFA 4QQBA 2B7CB 4M5LA 3KLIA 3P6YC 3SXLA 3MCSA 3LM2A 3CDEA 4MLEA 1Z26A 3PSIA 1GXUA 4RZRA 4NASA 3EJMA 4ATNA 4DUYJ 3HZEA 2HHHF 3M6VA 4NLTA 4XPCA 3QFUA 3LW5C 4QCLA 3KLEA 5IS2A 1ZAVA 1CQNA 2FUG9 4CFBA 2MKJA 4DV0J 3T1YJ 2HBKA 4OVLA 1HNVA 3CCVN 1LAWA 1FDNA 2W2MP 5JLHA 4ECZA 1HBNB 3V9ZA 1NB7A 1PYSB 3NKYA 3AXMA 1C1AA 3NEKA 3VERA 3GG0A 2CPIA 5IQ6A 4ES2A 3KFWX 1HBOB 2CQ2A 3VGSA 1HUXA 3ZZYA 3ISZA 2JLEA 2A6AA 3AO3A 3Q22A 3DGPB 2AGOA 2E7VA 1TYQB 2LEBA 3QGHA 3G6ES 2ZWHA 1F2HA 4UTGA 2OZSA 3SFGA 2ZOFA 3N6NA 2XWXA 3SQGA 1YJUA 3QSIA 1VQPN 2XCAA 3FZLA 3M2RA 3F5TA 3FGUA 4XO0A 3BM7A 2FY8A 4FWOA 1VLOA 3SMPA 1NOZA 4V19S 1YAGA 1NH7A 3LANA 4FDFA 2UZAA 3ONQA 3EICA 4J9KA 2BE2B 3P5JA 3G25A 4AE5A 3DNCA 1PG5B 2PE8A 1T11A 3UKRB 1FK9A 1HW8A 1VQNN 5CYQA 1Y9OA 3BN4A 3G6YA 5ELZA 4DG1B 4ZLJA 3RZAA 3CMQA 3DN9A 3D2WA 3WX8A 3PW5A 4BC2A 2PMWA 2Z30B 2NRVA 4KH1B 4LSNB 1FRHA 3QZ8A 2E7WA 1DLOB 4TN2A 4LFAJ 4J2AA 1NJXA 1Y10A 2FC0A 4S0MA 1S1VA 3V4IB 4UY8T 5KFFA 2MHNA 4DF4A 2K2PA 3BUZB 2DVIA 1MA9B 1XI1A 2BKNA 2ZFHA 4W98A 4RBUA 2P6TA 2B51A 1VLYA 2VPWB 4LF4K 3BY5A 2UUTA 3W60A 2G2OA 4DU1A 3UI3A 2MQQA 3NH2A 1FKPA 2AGQA 3EWGA 3H8YA 1VSIA 4ZVSB 4FJHA 2DNLA 4DV3K 4FJ8A 1HBUB 5IFMA 2YWFA 3CJ3A 3MGJA 3EYZA 1NUEA 1Y3KA 1YJWS 5B0AA 1HKAA 3FC9A 2CNLB 1RWUA 2V4JA 3ULDA 1Q18A 2MQNA 4RU2A 4C0OC 4X64F 5MLCQ 5JVGL 4WTYA 1EARA 3DHWC 1I94J 2IA6A 3AA5X 3VESA 1FWKA 1FFSB 2Q79A 4CERA 1VQ7S 1Y64A 1U47A 3CCQS 4PKIA 2KW4A 1WUUA 1NK6A 1E3MA 4LT6A 3MEDB 3VEVA 2I7NA 1KTQA 5ETOA 1RA6A 1JLEB 1VQKN 1VRTB 4CJRA 1NDLA 1GLLO 4E1NA 4O5FA 3TI0A 3SPZA 1ZBHA 3D0PA 2Y1JA 2FGCA 3QESA 1W9HA 3K5PA 2DPIA 3T7ZA 3GTYX 3OVSA 4WPAA 1LFWA 1RTIB 2NRWA 2YHAA 3WIVA 2E5HA 4MDAA 1W2IA 2D4WA 3VQCA 4DHYA 1B0TA 4DV6K 3EXCX 3W66A 5AQHA 4OI1A 1IVZA 2IDOA 5J2QB 5C5JA 1AYEA 2BDPA 4WKRA 3DM2A 4DR2J 3A3OB 1NDCA 3A8EA 5IT4A 3CD6N 1IKWA 1ZPWX 3M30B 2VH7A 2W8LA 3GG4A 1NMNA 4C8OA 1XERA 4CVNE 4C1NK 2DXDA 1IXKA 2AEMA 1KS2A 2QXFA 1M1HA 5TKWA 2J0WA 4KHQA 1KWMA 4X62J 3MTKA 5F8MA 1NPPA 2C1EB 1N88A 4P2SA 3MUVP 4M5IA 4YQWA 2CJXB 1CZBA 3D1OA 4DQSA 1X4EA 2EC2A 3V6HA 4OLBA 3BJYA 2D0CA 5I3QA 3JSBA 3WC2A 3HK2A 4OX8A 4IBNA 2WVDA 3PIPQ 2LQ9A 4IOAQ 4USKA 5AE2A 1RGVA 2Y1IA 4DSLA 3P38A 2JGUA 3CJQA 2MQLA 1RKIA 1KVIA 4MKAA 4LBIA 4Z2XA 2FQQB 2GHWA 3L09A 4ANEA 3QIPB 1UVKA 3TABA 2BKPA 9ATCB 4PKGA 4KO0B 3IM8A 2GC8A 2PYJA 1SBRA 1T3VA 5CHCB 1VR6A 2CZ4A 2XULA 2OTLS 3TQ1A 4NLRA 4FXWA 2ZKTA 1YHQN 5D0GA 3RGIA 4B3SF 4R5PA 4ZP7A 1DHMA 2YKMB 1RTHA 3CCSS 4KH6A 1S1WB 1X4AA 3BO2A 3EO3A 3VENA 4DR7K 5L9NA 2P9PA 1J5EJ 4KH4A 4DV1F 3AARA 2G9OA 1GQEA 1F60B 2RRBA 3H5YA 3CQ8A 5H9EK 1C0TA 3DAWA 3TJAA 2HBRB 3WXLA 3G86A 2FGOA 1UPMB 2EWSA 1SPBP 2EFQA 1CJKA 2LECA 2WC9A 4CFDA 4M5GA 2VYPA 4AQYK 1JLCB 4ZCKA 1N48A 2DGOA 4IDKB 4R0JA 1BA1A 1HD1A 3VEOA 2Z57B 3OFGA 3VEWA 3NAHA 5EWGA 1FRMA 4ED6A 2KG1A 2DCUB 2ZH6A 4WE1A 3B78A 4RX6A 3U9ZA 4J9UE 4C6AA 1BWFO 3A2FA 2K7JA 1UCNA 3G87A 1R8HA 2QEXN 4KV8A 1VC6A 4ZVRB 4DBQA 1GXLA 1CPZA 3DI6A 2JL9A 3HP6A 2R7YA 3AJ1A 1HRHA 5DGBA 4ICLA 2EK1A 1HNIA 4HT5A 1NU4A 4RPFA 4UF4A 1T9TA 2ZJPQ 3N9UC 3MMVA 4PXDA 1DTQA 5KFEA 1X4DA 2DXEA 3HHLB 3FBFA 3VAHA 2VCPA 2UUCK 2LXFA 3UR3C 2AZ1A 4CM0A 2FHOB 1ZBIA 2OFHX 2C3MA 3L7OA 1EX8A 1U2VB 2CZVC 2WK4A 3N28A 3LP2A 1JL1A 3N5FA 3MWBA 4FNHA 2DTUA 2LA4A 2CXEA 3MR7A 5AQSA 3NH0A 4MO5A 2HHHK 4J9LA 1HYSA 3ZEUA 3JSYA 3RUBL 1CSJA 3QRRA 2CGKA 2EG1A 1KLMA 2OFGX 3D3CJ 1T03A 3QDKA 3W5ZA 1L3TA 4MMOA 3TUZC 2MSTA 4LF4J 4DPOA 4CGIA 2QFJA 3KNGA 3GIIA 5AZJA 4L3KA 4YDXA 2E6LA 2BR0A 2CPXA 5ETKA 3LL3A 2NXNA 3SDEA 3A5LC 1K73T 1Q5YA 5K8NA 3J7ZO 2GVDB 4M7XA 1FTRA 3LP0B 3H45C 1NHVA 1SJ4P 3BF3A 3Q8YA 2ZD1A 3HHEA 3PRBA 1FRIA 4JV0A 4K8XA 3BBFA 4M3ZA 5HLFB 1R0CB 2WONA 4EK2A 8RUCA 2DNRA 1Q81O 3MM9B 4USJC 2VIHA 1S0NA 1RNHA 3H7HB 3LZJA 2YY3A 5EVZA 2VQFF 1VBZA 2VWKA 3P4UB 4BRCA 2BVZA 2AYGA 2V6AA 3Q83A 4NZ7A 1GMUA 2PDAA 4WCEL 5BPNA 3MECA 2EFNA 2YXLA 1FW6A 2XLKA 4Y0FA 3LDLA 2DNQA 1U26A 5A6WA 1WBBA 4CZHA 2G8IA 2EFOA 1XNRF 1N56A 1UOCA 4AUKA 3KLHB 4DCJB 2VC0A 3L4QA 4G1QA 3I9ZA 5L46A 1XN9A 3CCRN 2ZM6J 3IS9B 4CM2A 4O3QA 3BSNA 1S6PA 3UDCA 3DRSA 4WFNL 1MROA 3ILIA 3KHRA 3U6FA 2J7KA 4FPAA 3V9UA 2BJ3A 5EX0A 1KAYA 3BSAA 1U1OA 1E4FT 1SAZA 2RRNA 4JI2J 3CO0P 2N3OA 1TGOA 1D5AA 2HMIA 2WHOA 1M5HA 2ILZA 2D9OA 3Q8VA 1KVBA 4MKYA 2YV0X 2DR6A 4FWQA 1S4EA 3VVTA 3MM7A 3W62A 3O4WA 4DR1F 3CJ0A 1QAXA 2NQPA 2QX0A 4BRMA 4OI4A 4UOCA 5C24A 2M9KA 2GGPB 2G0CA 5IWAK 2FDNA 4OJ1A 3VAJA 3TAEA 4PUOB 4QWCA 3FZMA 2NS1B 3VTHA 2CQDA 2ZHAA 2H9ZA 1YKWA 2AP1A 3W2VB 4Q45A 3G96A 2OPQB 4X66F 4HVJA 3UFCX 1JJ4A 2GW8A 2E29A 1YBUA 5C2FA 4UZBA 2BABA 2DH8A 1A5WA 4C8MA 3CFOA 2W2OP 3V6JA 4J2EA 1QQNA 1NDPA 2M52A 3WX4A 4AL5A 1RJJA 3BKUA 4C8LA 1UTAA 5K9FA 4PQAA 3OUYA 5KG7A 3NBPA 5J2MB 3TA0A 3WZ0A 4F04B 4CI0B 3QJJA 4DL5A 4I67A 1F5AA 3FRYA 1ASWA 1W7AA 1RT6B 4O44B 4F3QA 1XMBA 5L39A 2CQPA 1HNWF 2YX6A 4C8NA 1HNZF 5A76A 4DR6F 1RDAA 4M41A 5CABA 1JLGA 1RT4A 1P8ZA 5LMNF 5L1LA 4WP9A 2B5JB 4EBCA 1BGXT 5KPRA 5H9EJ 1KP6A 4CZJA 2HURA 4ZPBA 4B1WB 4H4MB 1EIYB 1NKBA 1SH3A 4B8CA 1X60A 3TAFA 4DTRA 5AXLA 2DNYA 4C3KA 3M32B 3CMAN 2OEJA 3IA0A 4AQYJ 2YH1A 4P10A 2XNRA 3AOAA 1PBAA 1A7GE 3M3ZA 4DR3F 4NB4A 2HVZA 4KKOB 1HQUB 3TZWA 3EUNA 4J5OA 5IT9U 3MM5B 2F8TA 3W65A 3EN9A 4M8LA 2R2TA 5KG6A 4U9RA 4KBIA 4CHQA 3ILJA 3GIMA 4RW7B 3JS6A 2XMJA 3O4QA 2X7IA 3G82B 2IIHA 1JJHA 1TV6B 1S9FA 2VONA 1K0TA 1G15A 2CGLA 3EKUA 3WNHA 2BUPA 2DHGA 2Y0BB 4F0MA 3BV8A 4WU3A 1VQ8N 4PZVA 3OLBA 1VSFA 1ZC6A 5AT1B 2DTJA 2V8PA 4A48A 2IJNA 2PZSA 3JYTA 3MN6A 3BBBA 1YSJA 3QO9A 4EP5A 3K5MA 3WXJA 4HACB 2QKKA 1U2CA 1ZA1B 5IC4B 1XEZA 3K2PA 3ULEB 3QICA 4IOXA 1S1UA 4DL2A 4B3SK 3OTOF 4F9OA 3UPFA 2HBJA 4ZVUB 4HTLA 2VICA 1U1LA 1FKOA 4DR5F 3C3LA 2FLPA 1T94A 4CO4A 3I4HX 4ZP8A 2WSFC 4MYTA 4DV1K 1MWMA 4LSLA 3ZCMA 1ATNA 4ILMA 1IBMF 2YQ3A 2FVCA 3UD4P 4JLHA 1XR6A 3HPHA 2I5JB 4IR9A 1N36F 2KZZA 1ZZNA 5KFMA 1MDUB 3PEHA 3O8MA 2O8BA 3FMBA 3IAM9 4TY8A 1CVJA 4YDDB 2HHWA 3J80O 4GVLA 2ZNZA 3MN5A 1GLBG 4LR9A 4KT0C 3HVAA 1IUJA 3QGIA 1YIJS 3KJNB 4FYYB 3AT1B 1BMQB 1T3NA 2IRUA 2Z58B 2P9SA 4J9VA 2QIFA 3Q0AA 4JI6F 3OW2R 2P8IA 2CDRB 5AFUH 4HI1A 4FK4A 5JS2A 2CFXA 1NNDA 2CDQA 1GMWD 1LWCA 2MZRA 4J9PA 4LF8J 4W5NA 1RWNB 2O8CB 4LREA 4FWNA 2C42A 2CVIA 3OYGA 2BBEA 5DDOC 2B3TB 2HK2A 1SJ1A 3BDPA 2DRAA 4PG7A 4EMDA 1HPZB 3HD1A 3F41A 2UU9J 2MB0B 4FYXB 5IXUA 1HQEA 5DG9A 1IH7A 1HWLA 1P9YA 5LM7E 1M5VC 4OKEA 1FX2A 3KWGA 2IM3A 2Z2YB 1KD1O 3ENBA 4ALZA 5A8KA 2R7VA 1KTVA 3S41A 4AL6A 1YRUA 2XHWA 2JEIA 3DLEA 2GIRA 3S9HA 2PEBA 3DCAA 1OIAA 3B82A 3VAIA 2VHGA 4I2PB 1DQ9A 2FHJD 2ZKUA 1DTTB 3Q24A 4KIAA 4X65K 1VHIA 1TKTB 3MMBB 1DQAA 1VRUA 3CJ8A 2QO3A 3R9PA 3HVWA 5BPLA 4CT9A 4H5WA 1RK8A 3P8BB 1WLJA 5LY3A 2RUSA 2QMUB 2ZH1A 5GAHP 3DOLB 4CK3A 2AT1B 3DLKB 2ASLA 3C66A 1TL1B 4V1Ak 3D9BA 5HI7A 1SUQB 3CYMA 1JNRB 4LFBK 2VJUA 2LMIA 2DEJA 3TAGA 2KU7A 3RBEA 2PC6A 2HVDA 4QAGA 2Y1LB 1ZM2A 4Y0WA 4DFMA 4DFPA 1B7FA 1WB9A 4B8AB 3MEEB 3NGTA 2LKZA 3M6WA 2PO4A 2R8KA 3SNNA 3MZIA 2P9CA 1F2GA 1WF2A 2XQCA 4CZKA 4CGHA 3LAMA 5IWAJ 5HVFA 4NEZA 5BRDA 4E89A 4G65A 5DO2A 1KOHA 5DLGA 5GVQA 4NYOA 3HM9A 5KFIA 1H72C 5T41A 4ILGB 4OX6A 5AQFA 4MLHA 1U45A 3VZIA 2M70A 3CCVS 3IC1A 3IBFB 3OYAA 5I3UA 4DPYA 2VQFK 4BY9C 3IWXA 3MK6A 3DLGA 1S9EA 1I5OB 3JSMB 4OYMA 2XSFA 2Q1NA 4WFBL 3H3OB 1N34F 1ACMB 1HMVB 4EO6A 5LT5A 3K59A 4J91A 4F4AA 5L9XA 3HKWA 1GOBA 2YCHA 1I51B 4FYDA 3HD2A 2OPPB 4A8YA 1TKXB 4Z4GA 2JHEA 1EP4A 1RTJA 4Y3CA 2Z1HA 2M4MA 3KMSA 3THVA 1S76D 1TAQA 3R2DJ 2V52B 1BHNA 5AQGA 3TSUA 1RISA 1VQPS 1IBCB 3MAHA 1PC5A 3FGVA 4ZVEA 2J6UA 1N32F 3BQ2A 2FIUA 4CYUB 3A0IX 2QTDA 1VYAA 4P2FA 5A8RA 1ELOA 4CJQA 2CJBA 2QV6A 2QL5B 2FLLA 4MK8A 3WEEA 3I0RB 5AQKA 4M5HA 3UO0A 4HH1A 1VQNS 2HIQA 3HFVA 1OVYA 1DAXA 4CFAA 4MAKA 1OO0B 5C0YA 4DR1K 2AYEA 3VGTA 3BBCA 2DFHA 5F8GA 4NZ6A 5F0WA 3J7ZT 5AR0A 3OBIA 2D41A 3RYLA 2QK9A 4M3TA 3ISND 5HQMA 2R8JA 1X5PA 2AJ2A 1XMQF 2FF6A 4EBDA 5B0DA 2UVUA 1VFJA 2VBWA 3ZZPA 4FWLA 4LBPA 3Q23A 3SLCA 2XMWA 5LSRA 2MPUA 3T69A 2WBMA 3FCVA 2PFDA 1Q81T 1GLDG 2NCKL 4H5TA 4IDHA 4B9NA 2KN4A 1IM6A 5J2PB 3C6UB 4ZPCA 2MKKA 2Y0SD 4DQ8A 4ZITA 4HHHA 2ALYB 2QMXA 1GMWA 2ZQBA 3FQLA 1IKVA 2WOMB 2KHDA 4KB7A 4DV2F 5HROB 1HNWK 2IPOB 5C42B 5HBMB 1UFKA 2DBBA 5D4OA 2QLWA 3O3GA 1HNZK 3AVFA 3PDNA 4F4ZA 2PA3A 3D0GE 3Q7BA 1UWBB 2FHKA 3F73A 5LMNK 2BJEA 5J2NA 3NLCA 2IC3B 3KYLA 4ZVFA 3B6BA 2HAFA 3CJRA 3JAMY 2YHXA 1TUVA 3PYGA 2V63A 4DV7J 1YJ7A 1VBYA 4A8MP 3PZPA 2FHJA 5M1QA 1VC5A 4O4GA 4DQIA 1VQKS 3NP5A 2HHPA 5FLXO 3TVKA 4RLEA 1YUWA 2DXFA 3D54A 2CQGA 1R0AA 2XEXA 3TUJC 2QL9B 2A6MA 2R7QA 1URRA 4CTAB 2ZZMA 5KQ8A 4DR3K 2WUSA 3HXMA 3G4SN 4UOHA 4WP8A 3M9NB 2XYGB 3CVKA 2BRKA 3LDPA 4IQMA 4X4OA 2RB7A 2OELA 5IV4A 1WNSA 3MWTA 3MUTP 3HSGA 3HO1A 1TMMA 4L3QA 4IYQA 1KR4A 3ZXWA 2P9NA 3ZETB 2YKAA 1YITN 3CD6S 3MAAA 2Z1GA 2D1CA 4NRTA 3QWUA 1WEZA 5ADXA 1ZM9A 2W25A 3PLAA 4JKBA 4PAAA 1WSVA 4OMFG 4FS2A 1BDGA 1I3OB 2UV8A 4DUTA 4MT1A 2KHOA 4DTOA 2QC3A 4F8RA 4ED7A 4G1IA 5I42A 4FWMA 4LD0A 2HIYA 3V1RA 1JXVA 3ZYYX 2WSCC 5EOYA 5GIPA 3T1HJ 5B0EA 3K5OA 3OTOK 1WTBA 3W7BA 1NHUA 1IV0A 3GYXB 4FJMA 2ZWPA 2F96A 4DUZJ 3AVHA 1YTYA 4Q44A 3KUEA 2CNOB 2AU0A 4YB1P 4ZHRA 4I2QA 1IBMK 1BHLA 5GINA 5KTQA 4G1PA 2DYAA 3PX6A 1N36K 2J5AA 1NPKA 2A3ZA 4OKJA 1Q4RA 5DDQC 3W8GA 4EUVA 1AUSL 1X9SA 1H6KX 1KDNA 2Q43A 1O51A 1JJ2R 1XQIA 1D9FA 4LFBJ 4H4OA 1GTEA 1YHQS 4JI6K 2ZF5O 1VQYA 4CI6A 2ZH9A 5BJRA 1OH7A 3LGNA 2BANB 3W9JA 4TXSA 3F56A 3BF1A 5AZIA 2YKNA 1RDWX 2M88A 3PX0A 3HHNB 1RWVB 1S0MA 2XI2A 1NDKA 3KKRA 2JJ4D 3LALA 3R9LA 1WACA 4WFAL 2HNDB 4E7LA 1Y7PA 4OGCA 4FP9A 1S22A 2LEPA 2BV3A 4YDUC 4ED8A 3OTCA 4RTFD 8AT1B 2O8EB 1EO1A 3TYTA 2ASJA 2KZMA 2LU2A 4QYRA 4C7QA 4GMKA 3C15A 4RJVA 2DD8S 3M5RA 2FJWA 1NBEB 2VDIA 3H5SA 5SWMA 4DL6A 1QZ6A 1WN7A 3SBTA 1FWLA 2FBYA 4TVAB 3O5TB 3O9QA 1WSIA 2YTCA 5C2DA 5GAGP 1UWAA 4JD2A 2DHHA 4M3UA 3ZX2A 3O3LA 2IY5B 4NLPA 3J81Y 2JWKA 3AY9A 1CS4B 2RU3A 5CZXA 5BYQA 4NYNA 5C25A 2ITGA 5GADU 4CLYA 3OL6A 3DC2A 4F4YA 3SAFA 4DMZA 2QEXS 3QEWA 4KH5A 5GAEU 2X74A 4IG3A 2JC1A 2F9WA 4USWA 4NXMF 4HLBA 1XTZA 4FJ7A 1AT1B 4MFBB 1W7WA 4PXEA 1S7IA 1QQCA 5L38A 3IKMA 1WI8A 2NXUA 3EVOA 2BJDA 3WT0A 5LJWA 2DNKA 1K9MO 3I0SB 3NF8A 4LF7J 2OSRA 4K4YA 3C65A 2UXDF 4YORA 3RMCA 2QKBA 4CJLA 5D4PA 3CCMN 5D3GB 4DSJA 3MM8A 3RMBA 3V5RA 2IYGA 2BE9B 5T7BA 4DCPB 1LNQA 4CEBA 1OY9A 1YT3A 3I31A 1LWEB 3QQCD 2DR8A 1MW7A 1TMJA 2IFXA 4RWXA 1T6CA 5EN1A 3P83D 3QFWA 5THWA 2CH5A 3S8SA 1DRZA 1BY9A 3AY0A 1KD1T 1FHTA 3MMCA 2X78A 4KPCA 2LA6A 4QIFA 5I3PA 1CBKA 1Z1ZA 1F9HA 3C6HA 2FTRA 1UPPA 2PIIA 3DOMB 4FJ9A 4OLPA 2HHUA 3J7YU 4F0KA 4OYZA 1N34K 3VHQA 5F9NA 4Q2MA 4BR4A 2B9YA 2Z1IA 1R8AA 1WC1A 1R27B 2OGUA 5ADZA 2CJYB 3NXZA 2C2RA 4X4VA 3RWUA 4NCGB 3PW2A 4JYAF 4DKWA 3GFYA 2HS3A 4B9SA 3L2VA 3ILOA 4NYZA 4ZVQB 1TFYA 2NUBA 4MO4A 4G9ZA 1XBWA 1B70B 1XC9A 1FI4A 3QLHB 5K14A 1CG2A 2GBZA 2UXBF 2ROPA 3OY9A 4U7UD 3HLUA 4JV5K 1N32K 1VK0A 1N5YA 1ZPVA 1CJUA 2BACA 3KIOA 1X9JA 1ZXOA 3J81j 3T1AA 1UA0A 3IFEA 3UVJA 1O6XA 1IBLJ 4HR2A 3MPWA 1HL6A 1WSJA 3RSEA 3OV7A 3UN2A 1T9UA 3BDEA 4IFEA 3RBXA 3VGLA 3FLCO 1BUXA 2XLJA 2CJ9A 4GKJJ 2ZOMA 2W9CA 1DURA 1SJFA 2PSZA 3ZX3A 1VSMA 1RDDA 4MH8A 4FVUA 1N6QB 1IJJA 1NU0A 2MZSA 1D09B 2WSEC 2MQPA 2FJDB 5KFLA 1WOQA 4FW2A 2ROGA 1U1QA 1XMQK 2BEFA 1BE4A 1P90A 1ASUA 4ID1A 3JTNA 3CD7A 3FFIB 4C3LA 3CC2N 3AH6A 3TUPA 1SZ2A 3P49B 2F7TA 3NG8A 2I0XA 4ZP9A 4O8KA 2V9WA 1HJRA 5AXMA 4IOCQ 4EI2A 1S6OA 1SS6A 4PPZA 3SEOA 3HJFA 2R8HA 3H20A 3ZTQA 2DY1A 3FZHA 4O8UA 4IO1A 3VZHA 1KQSR 4KHMA 2QSFA 5F9LA 3K5NA 2ZC4A 2IBKA 3NCIA 2VBYA 5EWFA 2W42A 3DXSX 3AD9C 5JUMA 5FPMA 5JJBA 1HX1A 4MIBA 3QPIA 4RW8A 1YWXA 1FWPA 3PIOQ 2KM8C 1S9GA 5D0EA 5LXYA 1Q7YO 4YHHF 2X3DA 1JLFA 1RWOB 1W2BR 2E8AA 1Q9XA 4PG5A 3MCMA 2IS3A 3E9LA 1ZOTA 5GAGU 1LXJA 1WSHA 3HPOA 3CG7A 4QBUA 3TOQA 3DYAB 1VHFA 4YEAA 2V2ZA 3AV9A 2QMWA 3TX0A 3RU0A 2F8EX 4FWPA 1ATRA 5G4DA 4RW9A 4GV6A 4CGGA 3C16A 2XSJA 3GG1A 1YVNA 2YI1A 1J5OB 4JKGB 5CZ2A 4DSEA 1WHVA 4CF0A 2HFVA 3CCZA 4BC9A 2RD5C 3SCJE 2HVIA 3BYPA 1HKCA 2BM1A 5A2QY 1VQ7N 2OKQA 4I7FA 4M5DB 1AXQA 3SMZA 3CXCR 1BI4A 3I82A 5AJ3F 1ZBLA 2HNZB 3CJ5A 1QHTA 1H3DA 4J7CA 3VAMA 2NR0A 4CO5A 3G0ZA 3IWNC 4ETXA 4OQJA 3K2YA 4KR0B 1SV5A 4RW9B 2H1YA 2A42A 3D1HA 3L95X 3WQUA 4RBVA 2QA1A 4CGFA 3THXB 4JI0F 2QZ8A 3TQEA 4I6MB 1XIQA 5LJVA 2RHSB 3AA4A 2AIRB 1NBWA 2F8HA 2W2PP 1CEZA 1LK5A 2GX9A 1SL1A 3BH7B 1BQMA 1NK9A 4OPHA 2DNMA 3R3LA 2DRDA 3AFGA 1IBKF 3CMAS 2IM0A 3NCRA 5KG3A 3NNAA 2GQQA 2C22A 3VQEA 1RHMB 3EGVA 3MXJA 4P75A 3EL2A 5CCMA 3CGIA 2YNGB 1WELA 3LPYA 4QOTA 2QM1A 1GH8A 1RU2A 2VQEK 3KLFA 3AVBA 1AB8A 4FPRA 2ILYA 1SL2A 2E1YA 3P45B 1N33J 1HFEL 3OXGA 4F3MA 3DRRB 1NKCA 5JS1A 4AILC 3N4PA 4CJKA 3R6MA 3VQQA 4FXDA 1T9YA 5KT5A 4IH6A 1VRQC 3VAKA 3AVMA 3CUNA 3T5JA 2ZNYA 3H4DA 3SYZA 4GKKF 5HP1A 3VF4A 1U48A 4FWSA 1VQ8S 1UVLA 2D9PA 4IEIA 3HMJG 3C14A 2B6AB 4K0KJ 4UOFA 1VSKA 2CQIA 1ZA2B 4DLGA 1WSRA 1YRTA 3FFKB 5HMYA 2KKZA 5KG5A 3D5MA 3LZIA 1JXBA 4U8VA 4BDYA 2RRAA 4AHTA 4H8KA 3ITHB 4ES3A 2OTLN 3NRBA 3EMTA 3S1TA 2UUAK 2V94A 2P9LB 4F25A 3BQ1A 5AQTA 2ZZNA 5DQGA 3RVCA 3A3PB 1UVIA 1VAZA 4BRIA 2RNEA 3AOCA 4OYPA 1NSQA 1H98A 1OH6A 4UUWA 4DV4F 3DOKB 1V9OA 4LF9F 3ZSXA 1V4TA 3ZTSA 4RBTA 3O8WA 4MKBA 1LXNA 3OYIA 2M0GB 4H5VA 1BL3A 1S1XA 2P9IB 3E01B 3GIRA 2J8SA 4P52A 1RBTA 3CJKB 4FK2A 1VQSA 2OMOA 3D7EO 2A1RA 2V67A 3RG6A 2GAHC 2MHEA 2RN2A 3GV5B 4HEA9 2RMLA 4U95A 3CDBA 5KT3A 3BQ0A 3IUCA 3OTDA 2YHYA 4CGDA 1RT5A 1GAOA 4DX8H 3HZGA 3VPZA 4Z94A 4KREA 3GWCA 2EW9A 2H48B 5FDLA 2CQ0A 5HRSA 5F0UA 4E98A 2AGPA 3JXOA 2NUHA 2AF6A 3H42A 4BC7A 2A6OA 4NXMK 2HAIA 5ETRA 4JHDA 3LQVA 4JV5J 1GTHA 1CLQA 3WXIA 3V6DA 5AXNA 3SQ1A 2E5LK 5BPMA 1VQLN 3ZZOA 2ASDA 1PYOB 2C2OB 5ETMA 2HFUA 3AQOA 5AQWA 2NPIA 2PBDA 5BR8J 4NLVA 4KHSA 2W24A 2YQ1A 3TEGA 2DNHA 3QNWB 4CH7A 3ZZZA 2LSNA 4PYDA 3PX4A 1OYEA 4LY7A 4RW4A 2Q0RA 1PJ7A 1C1CA 4DDFA 2YWGA 4FJIA 3KK3A 3AB2B 1TELA 4RW6A 5E26A 1Y11A 5AFUA 1WAFA 3S7RA 2ZH3A 1NKEA 4BGAA 1FJ7A 4WIQA 1Y4ZB 2K1RA 2JEGA 5IM0A 3EM1A 4Y2MA 4QYZJ 3LWLA 1JLQB 1RDRA 3GE9A 2ERRA 1F0XA 4ECRA 1FJCA 1RDCA 1NJYA 2VOOA 2E44A 2WVCA 2HNYB 3NVMA 1JKHA 3KK1B 2HGNA 3RMAA 2RKIB 4AL7A 4F02A 4B9QA 1RTDB 4NLOA 3ENWA 4WYBA 4ZVTB 5LMUF 3SUOA 2OSQA 3K9JA 4FF2A 4H5NA 1BQNB 2VD3A 4JYAK 1NGCA 3DHXA 1CJTA 3WC0A 3MCNA 1SC3B 3SCIE 1FF2A 1U0SA 4CLFA 5E3AA 1VS3A 3M1VA 2KXNB 3FCWA 1HYVA 2DO0A 2RQKA 4FJJA 3M2UB 3MCPA 1TL7B 4OHVA 1VQON 4MQ3A 1MU2B 1NMDA 1HLWA 3OYEA 4EP4A 4DFKA 2P6SA 4TLRA 3AVAA 2ZE2A 5HAOA 3FKBA 3NCPA 4NYFA 2CQ3A 2CQ1A 3D0HE 4H0YB 2W4DA 2H5EA 2W4CA 4B17A 3TEHB 1K9MT 1W2BM 2M7SA 3GIJA 1K8KA 1HKGA 2NSBA 2AJFE 3ZTPA 1MWQA 2EHGA 1WOSA 2FYXA 1X4BA 2FVRA 4C9DA 1C1BA 3VETA 1OKJA 2AP6A 1F5BA 4AXIA 3Q2TC 1LW2A 3NY0A 3LPTA 3THWA 4ZJOA 3AVLA 3LDQA 2BYCA 4KHPF 4HTUA 4PCQA 1JB0C 3MM6A 4OX9J 3ETMA 1Q86O 3NF7A 1SJQA 2ZH8A 2DPNA 1OMSA 1HHTP 2R4FA 4FL9A 4ITSA 2R42A 1S99A 1FDDA 2QFIA 2MGZB 3H1QA 4I4BA 4GVBA 1N8RO 2AW0A 1YG0A 1YXQA 2VG6B 2ATQA 2P9KA 3KKSA 5AQMA 1VQ6N 1RT3B 3TANA 3CC4N 4ED1A 4OI2A 5D15A 4FZXC 4X4TA 3SCXA 2GS8A 4HCCA 4KGMA 4EZ9A 2J6TA 4CEFA 1FO1A 1FERA 2YKQA 1CXUA 3V81B 5JVHQ 2VQEJ 1NG9A 4PKDB 2IM2A 1HR0J 4KB1A 2B56A 4YHHK 3MEGA 1UJ6A 1UVJA 4U7BA 2ZJRQ 1RT2A 1CZ9A 5GADI 2GVZA 2MZJA 4K5SA 4CLPA 1N4LA 1SH0A 1N5VA 4R8UB 4OZNA 1FVSA 1VOMA 5GAEI 3L8BA 4OPAA 1QAIA 4FJ5A 3QNNA 2XMMA 4I9QA 3DMJA 3H2LA 3DRPA 3U1LA 1G2EA 5HATA 3RR7A 3ET6B 1XK8A 2AEJA 3AVGA 3VEYA 3NGRA 1KVAA 2RDDA 5DJBA 3CF5L 3HKZD 4O4RA 3GJRB 4B3TF 5D4NA 3GP9A 1XR7A 3KJVB 3MFIA 3H46O 3R1HA 3S3OA 4O3SA 1OQ3A 2PI5A 4B3RF 4PL8A 4B3MJ 4CE9A 5AJ3K 5IT9O 2A10A 4A2BA 3LWMA 2RHQB 3BGFA 1U6FA 3L3VA 1H7WA 1K1SA 5DM6Q 3OFHA 2R7SA 5B09A 1K47A 1KQKA 5CE3A 3SCKE 5C2CA 4K7QA 5HL7Q 4DV5K 5KFQA 1N0UA 2UUAJ 1JLBB 5M1FA 4JI0K 2HWTA 1EWRA 5J1NA 2D5RA 5L1JA 3N79A 3JAMU 3BGRA 2F4VK 2HQCA 2BMBA 2B9EA 2WVBA 3QMLA 1DARA 5G0RB 4USTA 4USHA 3MXMA 4M3XA 2HFSA 5CY4A 4KH0B 4CZEA 3OR1B 3KK7A 4JI5J 1SIWB 2AJQA 1Z6RA 4OLOA 3K17A 1RAAB 5BXIA 3HT3A 4JRPA 2HRUA 4JI7F 1IBKK 2O8FB 1H2TZ 3R5DA 4OJHA 2WW4A 5ETQA 3EDQB 4ZCIA 2ZHBA 1NNEA 1YZ7A 4W5QA 3OR2A 2C2EA 5HJXA 1Z2LA 1MMLA 3BGRB 2NXCA 3J7YI 2GQCA 3G4SS 3EKSA 2O8DB 2UXCF 2CPHA 1Q7YT 3QB0A 3PFEA 1NRKA 3ZSYA 4LH5A 4LFCF 2VPXB 5KFNA 5IT0A 5DETA 1ZAWA 1TUUA 3ATUA 5I4MA 1HBMB 1YITS 3TAPA 2NYIA 1NK4A 2Z2ZA 4ZJQA 2ZH4A 4IFYB 1DBDA 3QIOA 3OVAA 2DJWA 2HQ3A 4RNHA 5D0RA 4GKKK 3CJBA 1VI7A 1GLAG 4HDGA 4OZ0A 4OZ3A 3TZXA 3R5AA 2E5LJ 4IRCA 2A3JA 2G0JA 2BQRA 2A1SA 5E84A 4QR0A 4WF9Q 3I5CA 4FYWB 2D3O1 4P6QA 1B7YB 1NJIO 4CBWA 1FRXA 4N8OA 2V8GA 1FJGF 2YPYA 3AVNA 2YNHA 2AYMA 3THTA 4JI3K 2MSSA 2O1PA 4P7TA 2YX1A 5MLCV 5GMDA 4WU2A 3U27A 3MF5A 5KRTA 2HFOA 5KFHA 4M42A 1P6TA 1VQ9S 1HWIA 3ZZUA 4EBEA 3QIDA 3KJFB 2ROEA 4XIUA 3I4PA 5H1SQ 4KHUA 3CJ1A 4UOGA 2EEYA 2YX4A 3B4MA 5M1PA 5CCLA 2ZH7A 4OYWA 2J76E 5A0YB 2OH2A 1Q78A 3S01A 2N4DA 3ENOA 1IKXA 2G8VA 1RGIA 2R2SA 2B8PA 4LVNP 1C0UB 3M8SA 4LF5J 4LF6F 4GVEA 3ZSQA 2B9WA 4NMLA 3H5UA 2BRLA 2IIRA 2MLZA 4A5AA 3KLGA 4LQ3A 2FPHX 4YB6A 4C97A 3GU0A 4U7UK 1CULA 1B0PA 2VG7A 3NGSA 4AF1A 2Q1LA 3DLBA 2GJIA 1YTUA 3QINA 3F44A 1M5OC 1O1WA 2RT3A 4NLGA 4NLUA 4DS4A 1RHJB 3RBZA 3TRGA 2CPYA 2VA3A 5E0OA 1FE0A 2DNGA 4C11A 4E2FB 3K8WA 3KLGB 4OI0A 3N5BA 4PY5A 2CPFA 3M8QA 4YFUA 3ID8A 3O6QA 2OI2A 1X8DA 2WVFA 2XYPB 4M3WA 5D0HA 2C2KB 3GFZA 4FLZA 3QJPA 3P5BP 5B0CA 4JI4F 5JXSA 3RB3A 1D1UA 5KT6A 4CJTA 1FVQA 2EVZA 2KHCA 2X1FA 1T3OA 1ICEB 4CEQA 2W7OA 1WKLA 3VGVA 1A0OB 3MAQA 3CPEA 3FBEA 3DLJA 2M8DB 4IWVA 1SH2A 2HZAA 3IRXB 3CPWM 2E9ZA 5HVHA 5KT4A 4IG0B 4J8FA 3A3NB 4PR6A 2HBYB 2R8GA 2G8UA 1TVRB 2HPUA 1X9MA 4PG6A 3T19A 2MKCA 1KRPA 4PQUA 3FZFA 4XH5A 4EU0A 3BZCA 3SFUA 3AVIA 1REVB 1NJWA 5FIIA 2JDJA 2CQBA 3QETA 3RRGA 1H73A 4DZ6A 3A5NC 5BRFA 2IHR1 3I32A 1UVMA 4CNZA 2E20A 4BR7A 2KXHA 2B4VA 3O1LA 1UEUA 5LMUK 5KFSA 3D4JA 4P2XA 4RU9A 4K4WA 1JNZB 4ZKAA 2VGNA 2R8IA 2KFZA 5ETNA 4KHWA 4NLYA 2HHXA 1HBNA 2JLGA 4QZVB 5FROA 2N4CA 1IR1A 2ZOGA 3D66A 1RTZA 3GIKA 2RUGA 2P5OA 2GZOA 2OPRB 1UMJA 3VQDA 4BE1A 1WHWA 1HBOA 3AA2A 3DGVA 4NXNJ 7FD1A 2J9EA 5HMZA 4K4SA 1TL3B 4NMXA 4Z4CA 1OH5A 1FA0A 3BR8A 3EZ5A 3CCLN 4DCHA 3DGPA 1B9FA 2O4GA 4HWIA 2LQBA 1TYQA 1ULRA 2EKNA 4RNOA 3ZT1A 4HHJA 1JLAB 3IP0A 3DLLL 3P1GA 2Y1RI 1VSJA 5AQIA 5EWEA 2J0QD 1X4GA 4L8RB 4BDZA 5KG4A 3VQ7A 4DV5J 2A18A 2BE2A 4KQZA 2UUWA 4M95A 4CEEA 2WTFA 2ZUAA 4M5JA 4KHPK 2H4YB 4DL4A 1GLCG 5B08A 3UKRA 4CBXA 3NHGA 1NGIA 3QGPA 3OD2A 4KAIA 2F4VJ 2VG5B 2YNFB 3ASMA 2DGVA 2JC0A 2JOQA 2R7WA 4DG1A 1QM9A 1PC4A 2HQFA 2VASA 2R2UA 1XMOJ 2QWNA 2GQ2A 5AQPA 1HKBA 2FJVA 1P1TA 4PWUA 2Q3SA 4IO8A 4LSNA 1DLOA 1GLJO 3H3NO 5AQVA 1RYRA 3V4IA 2D0PA 5H9FJ 4FZYA 1HYZA 4X2BA 1TP7A 5A6PA 2CG8A 2L08A 1HNXF 3QBCA 2BTFA 3ZNJ1 3G8TA 1NZ8A 5C10A 5J1EB 1HHSA 2XZTB 2UP1A 3HOTA 2BW7A 4MIWA 3DKDA 4CEDA 3F9KA 4OYXA 3GJSB 4G3IA 3I55N 2FBTA 3CC2S 2Z2LA 2A2CA 4F26A 5SUHA 1DY3A 1VQ4N 5JMVA 1HBUA 2BKOA 3LO3A 3HHLD 2C3UA 4H54A 1QVGM 4I64A 3WUHA 3QSYB 3HYFA 2CIMA 2YNIB 2UUBK 4QIVA 2EK6A 4B3TK 4ANDA 5T14A 3M2VB 1ZAXA 5EHHA 4CZCA 2AKWB 4B3RK 1WF1A 3R1XA 3UB5A 4FVMA 2D3ZA 2M3DA 4CBUA 1L3KA 1BWVA 3VA0A 2KKHA 4WBFA 2NPFA 5JVGQ 3PG9A 3W3SA 4JI3J 3GBTA 1RZMA 4DUYF 4IRKA 1KCFA 4ZTFA 4NX9A 1WEYA 3HCXA 2VWJA 4LVOP 4WQ5A 3WXMB 2R9LA 3MEDA 5B0FA 4DV0F 1Q86T 2ADBA 3T1YF 1JLEA 5ADXH 1Q95G 1D4XA 3V9SA 5DQIA 3N6LA 3K8VA 1VRTA 1NPRA 2NRZA 5LL6Z 4BRNA 5KFJA 4JI8J 4IO9L 4CEZA 4DFJA 2R7XA 5DGAA 4KTQA 1N8RT 4JKHA 1SJ3P 3KD5E 1U04A 5A2QU 1RTIA 4URGA 3CSKA 2GIFA 5M2RA 4ETZA 2OYQA 3VQPA 5E41A 4JI7K 3FQKA 4Y2CA 1YDLA 3VQ9A 2DNNA 1KNZA 3CDUA 3POTB 5J2QA 2F1FA 2BZ2A 3NOGA 2UXCK 3CIZA 3V4MA 2EKYA 4JK7A 4QS9A 4Y28C 1LOTB 3QEIA 3TWHA 2BM0A 4LFCK 3M30A 2DCLA 4FYVB 4LC9B 3SAHA 1O13A 4JNEA 4B3OB 2L41A 1RYSA 1SB6A 4LRDA 3R5CA 4O55A 3PR5B 3TAMB 2F40A 5HN0A 3IO1A 1QUVA 4DR4K 3BEGB 4X4QA 1A5VA 3AD8C 4BDPA 2C28A 1C2PA 3Q86A 2P9UB 4QIEA 1IR2A 1SQKA 1T05B 4CO1A 1VHXA 2B7BB 3NNCA 3E8OA 2DHAA 2IVOA 3M1FA 4RUAA 4RL1A 3SAGA 2G1DA 4E7KA 2Y3YA 3AGRA 1OWXA 3OS1A 3SJHA 1F3VA 5KAKA 3OSPA 1FJGK 1FDAA 2V2QA 1S0OA 4LFAF 2NNWA 1EZZB 5K8MA 4HDHA 2OPSB 3MPVA 2EXUA 3JB9k 1QSSA 2K06A 3B4DA 4LRAA 3BO3A 5FRNA 4DQPA 2WZ1A 3QIPA 2AJ4A 2J0XA 4KO0A 1WUAA 1UL3A 2FC8A 2QLXA 1J54A 5CZ1A 3RJMB 4E7IA 3ZZRA 4BRPA 2FJBB 3DRYA 3JXUA 1XNQJ 2YKMA 3BZKA 2IVMA 3IGNA 3VF6A 1S1WA 5DRKA 3W2WB 3FZBA 2FBVA 1RAEB 3KKFA 5KFDA 4F4XA 4LF6K 4PA1A 1WNEA 1UETA 3U4LA 4I9LA 5HOOA 4WYWA 2IGIA 4O5BA 1BISA 4YY3K 1I94F 3E2EA 2GIQA 5AXKA 2VPZB 2GFFA 4HH0A 4CCHA 2C3OA 2VUGA 4LSZB 1F3FA 3MMJA 4AFFA 1JLCA 4XDDA 2AZ3A 2IAJB 3DU6A 4IDKA 2W40A 2J9DE 4CECA 4YS2A 3GOIA 4BQLA 3R97A 3FZ2A 4PXBA 1WG4A 3MR6A 4Q2LA 2I1RA 4X4SA 3HL8A 1KC8O 1GX5A 3AVCA 3D45A 2XO7A 1T6DA 2Z2MA 1WSFA 3N0VA 1NJIT 2Z8QA 3ZT4A 2QL7B 1HLUA 2QWMA 3OVNA 2XZDB 3PJXA 4I0WA 2I38A 1OVQA 4CT8A 2HQIA 4PWDB 1UEKA 4OZ2A 2RF2B 4ERDA 4JI4K 3R7NB 3KK2B 2W4PA 2GHPA 4JRQA 5EU7A 4U8YA 4CJVA 2WBNA 4BRFA 3SUQA 4DR2F 2KLAA 3E9OA 4JI1K 3B54A 2MXYA 5IC6B 5CYMB 3K5LA 2QN6B 1P27B 2VBZA 4DL0C 2VZ9A 3HHLA 2RQ4A 5TKYA 1VSDA 1WKKA 4NZ0A 3QGGA 8ATCB 1G4CA 1LOUA 2WW8A 1VQLS 4M5KA 4X62F 2AQ4A 4ZLNA 4FLWA 2RPIA 4J2DA 3HSJA 2OAUA 4RNNA 3NL0A 1U2VA 4QJVA 2KO1A 4CJ7A 1LFPA 3WNGA 1YI2N 4BE0A 2QLBB 2IRXA 1S97A 4DZDA 3HI0A 2WFBA 3A12A 1UJ4A 2ZBCA 4LF2A 2ACMA 2KDOA 1JCFA 4FNIA 1WJ9A 4RUHA 3UR0A 3PNIA 1S77D 5F1XA 3SQ4A 4GVMA 1U25A 3QMQA 3ZSZA 1M5KC 1FE4A 2NXEA 3JS9A 3KG4A 2GEMA 2WB4A 2XTJP 1NGFA 2OJ3A 2NUUG 5GIOA 2JZ5A 2GVDA 2UUBJ 2OANA 2JEFA 3LP0A 1Y3JA 4KFBB 1FD2A 4H0PA 3TU5A 4CO3A 2HS4A 1NGGA 4FJLA 2MKSA 1J5EF 2C2ZB 4ECYA 3VGKA 1V3SA 1RBVA 3HI9A 4ISFA 3KHGA 4TU9A 3D2EB 1SCJB 4GO7X 5HLFA 2ZJQL 2G1HA 3R27A 1PYTA 2CA9A 3SV3A 3NS7B 4DV3J 3MM9A 4C0HA 1NGJA 1PKUA 3CJCA 1RT1B 2L48A 4NI2B 1O0PA 3PYFA 5EDWA 2R2RA 3NGKA 2MDAA 1SI9A 1VQOS 2V8DA 4EZ6A 6FDRA 6AT1B 2XM3A 2IVPA 2ITMA 2JX2A 1WC4A 1S1TB 3MDQA 1TKZB 4ILRA 4WCEQ 3TJ9A 1HIYA 2BXJA 3D67A 5AQNA 1FT8A 5KFUA 3CJ4A 3MOZA 3KLHA 3SUPA 3L7PA 1KN6A 1YBAA 4YOEA 3IS9A 2W6KA 2H3GX 1S5ZA 3N6MA 1BXNA 1FCAA 1BWEA 1DZ5A 2Y9HA 2YHWA 1HNXK 2JNJA 4D3GA 1OPZA 2P1JA 3NGUA 4WFNQ 4TU7A 3AHPA 4N8NA 3IRWP 2QYGA 1ZBUA 2E6MA 4JKCA 5KI6A 1KKHA 2PMHA 2VFTA 3NFAA 5CH7B 4QS7A 2ZDOA 4J90A 4NLCA 1QAYA 4CK2A 2RVJA 3BPDA 5EX3A 1U1NA 1YF5L 4DV6J 2W8KA 4ER8A 4M45A 3AODA 3OS0A 1AUDA 1QE1B 2XY6A 4USIA 1EQMA 3HULA 4JK8A 1VQ6S 2FVPA 2GGPA 1RADB 3CC4S 4TYBA 1U1MA 4ZS6A 2G4BA 1JXLA 4PUOA 3NVKA 3TW0A 4A8WA 3CCTA 1QJHA 1RT7B 4PKHA 2HVHA 1NCLA 1E6YB 3FUYA 4FF4A 1RBUA 1RWKB 3W2VA 4OV6A 3IM9A 3NF9A 4B1YB 7FDRA 2OPQA 4C1NI 4DUYK 4IFVB 2CQHA 4CF2A 4FJGA 2YWKA 4B9TA 4LR8A 4ZA1A 3VOVA 3BZQA 4BWMA 4WFXA 4HHUA 3JTPA 3FZKA 1R8CA 2BQ3A 3C6TB 4DV0K 4DTJA 3T1YK 2DO4A 3M8YA 3KWMA 5DQHA 3VAFA 2XMKA 4X64K 5J2MA 5HQLA 4LF4F 4CLTA 4YB7A 3A8JA 5K8OA 4BC5A 1WC6A 1QVFM 1Y5LB 4WFYA 1T8EA 1LWFB 1LWXA 3RW6A 4KAZA 5K20B 2ASYA 4BG9A 1RT6A 4O44A 2DK2A 1SIZA 3M6GA 1RBAA 4CJFA 3RAMA 4Z4EA 4WZQA 3UNGC 5KFCA 2M8HA 4BC3A 3TUIC 3IG1B 2ACYA 4FJNA 1VQ5N 3GJQB 1WC3A 2ZBRA 3VCDA 2B5JA 3PRDA 5KFOA 3K0SA 4K4UA 2G13A 3BSCA 4YR0A 4ILJA 5ETLA 1WC5A 4H4MA 2ASMA 3D2FB 1T0TV 1S6QB 4A62A 1RUSA 1S48A 4ILLA 4CFCA 3M32A 3M05A 3FEXB 4DR7J 4JKEA 3D6TB 2DHSA 3D0IE 3KOAA 4M7YA 2DGTA 1YJNN 4DX6A 1H2UX 3DU5A 4KKOA 2GNKA 3VN5A 1HQUA 1RHQB 1GT8A 4OZJA 2GMHA 4FF3A 3EZWA 4ID5B 1TAUA 3MM5A 1T9XA 3ELHA 2NXJA 3BR9A 4ZVHA 1IKYB 4E7JA 3OA9A 3QEPA 2HMPA 3UKUB 4RW7A 3Q8PB 1MMNA 1U0HB 2GV9A 3G82A 4JN4A 1RE1B 4LFAK 3T5LA 1TV6A 5KG2A 1U4BA 2DPJA 1I39A 2ZM6F 3VA3A 4N7TA 2HBZB 1WOOA 1Q8LA 1UAWA 3VAGA 1B0VA 4YUDA 4PPDA 4PYAA 4K43A 4CW7B 1NH8A 3PM9A 2HSEB 3OJUA 4AXJA 4JI2F 4DS5A 5A8WB 4F2RA 1S4FA 1ZM3A 4A8FA 1RAGB 4HACA 3L3UA 3O9TA 3ULEA 3EZUA 4QWAA 3CERA 2Y8WA 3AA3A 4H4KA 1L3SA 5ETVA 5FPDA 1RBRA 4QOZB 1K8AO 3ENAA 2IM1A 1U6BA 5M1NA 1FXRA 1UZHA 4QWDA 3UIQA 3FBBA 4NLDA 1RXOB 2I5JA 4CZIA 3M7VA 4BRDA 1KVCA 5CQGA 4PXCA 3KHHA 1SJRA 2UUCJ 2HBMA 5F8IA 2RDJA 2BOPA 3RB6A 2KI2A 2X6SA 5FD1A 2RILA 2FJXA 1H7XA 4F67A 1W97L 4JB8B 3T9NA 5KFGA 3Q89A 5T7LA 2O3DA 4A8XA 4KTZA 2HGMA 3J7Z5 3RAXA 2VFRA 1YBTA 4WWSA 4TQRA 3R5JB 4A8SA 1HJOA 4FXVA 4I6WA 4KGKA 1S12A 1NO8A 2XY5A 3LP1B 2HYIB 2HHHJ 5AE3A 2MY7A 3PXGa 3C7NB 1AZSB 2O8CA 1MSWD 1FJEB 4BWJA 4M3YA 1HPZA 4B9LA 2ZC3A 4U67Q 1CC7A 3NH1A 3ULHA 4B1VA 3TAQA 5KFWA 2WTUA 5T7LB 3GV8B 1X0PA 4H4KC 2GA7A 4ECSA 3TTFA 3M8PB 1X3MA 3DXKB 2C2DA 2P51A 1TZ0A 4HTJA 3HM8A 1EETB 4PHTX 5CD4H 4DR2K 2D3OR 3J7AP 2XMTA 3FSYA 3MMAB 1P8GA 2I7PA 2P9EA 3TTCA 4U67L 1PO6A 4I2PA 4Q0BB 1SVDA 1DTTA 1S72N 2KQ2A 3IXQA 3VQ5A 2MZTA 4FLTA 4DX5A 4AQYF 1A9NB 4D3HA 4ED5A 1KXPA 1U09A 4HCBA 3R8EA 4UUXA 4CEOA 4O0JA 1TKTA 3MMBA 4X62K 3T9ZA 3L0QA 5EY4A 2EI5A 3MCOA 4EO8A 1DT9A 4XDCA 1NGHA 4OI6A 3QZ7A 1U02A 4J9RA 3GLJA 2ABYA 4O3PA 3TO8A 3FVYA 3C94A 2POKA 2QWLA 3DOLA 4CO2A 1U1RA 3DLKA 3NOCA 4BACA 1X4CA 4A8KA 1I6JA 3CQXA 1TL1A 4QIWD 3BPSP 2UYTA 2XHBA 1SUQA 3OTEA 4BRKA 1E6VB 5D4LA 3G10A 1RWMB 2QSWA 3OFFA 1FD8A 3MR5A 1KHWA 4DU4A 2CUYA 1R3NA 2KRRA 2ZH5A 1KC8T 1HW9A 2FBXA 3U8XA 3CW2C 3KMQA 4HT7A 3MEEA 3W9HA 1BQXA 3QATA 3ZO7A 1QDUB 3CCJS 1TK8A 2NREA 1OJ4A 3QT7A 1EHWA 4MK7A 2VJVA 3QBXA 3HBTA 3G8QA 3MUMP 3LPEA 3CJSA 3BP8A 1RWXB 1NGDA 1J5EK 4WKYA 2DH9A 1FNXH 4JKDA 2IA0A 2ZEJA 2N7CA 1ZM4A 4BROA 2D0AA