4MFBA

Crystal structure of hiv-1 reverse transcriptase in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
544
structure length
544
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picomolar Inhibitors of HIV Reverse Transcriptase Featuring Bicyclic Replacement of a Cyanovinylphenyl Group.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 143
structure length 544
sequence length 544
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4mfbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4mfbA05
3MXJA 3OL6A 4ECSA 1VSEA 3T3FA 5FRNA 2E9RX 2W9BB 4C8LA 1EETA 4IR9A 2IS3A 4YNQA 4Z4EA 3MF5A 3S9HA 5KGWA 2B6AA 2RF2A 4MK9A 5KFDA 1RT4B 3IAYA 5FDLB 1SL2A 4ED7A 1EP4A 4NCAA 5KTQA 4LSNA 3OYMA 1JLBA 5KG0A 3ZSYA 4IG0A 3SI8A 1YVFA 2XI2A 3QIPA 3SUQA 2HNYB 4Q0BA 3GV7B 5F8LA 1XR6A 2CJQA 1TV6B 3SI6A 3HPOA 4CGDA 4IFVB 4KV8A 4FJNA 3DLRA 3KHGA 2WHOA 1TL3A 4K4ZA 3OS0A 5KFUA 2R7YA 1HMVA 5C25A 4MIAA 2OPRA 3K5OA 3AA3A 5J2QA 4FJXA 4MK7A 4DTUA 5DG7A 4ZP8A 3CQ8A 3G6YA 4PWDB 3JYTA 3MR6A 4DTNA 4U7CA 4NLYA 4AHUA 4CK1A 2G8WA 5C24A 3ZCMA 4CF2A 2BQ3A 2VG5B 2C22A 1IKXB 2F8TA 3GV8B 4CHZA 4EBDA 2D41A 2BANA 1WSIA 4FYDA 3DI6B 4KE5A 4Q44A 3ZT1A 3PR5B 3SQ0A 4DL2A 4LH5A 4CJSA 4X2BA 4KV8B 3O4NA 1T03A 3OYIA 4CEAA 1T3NA 4LH4A 3LP2A 2V0NA 1QSYA 4CHOA 5KFAA 2OZMA 3LP1B 4OLBA 1UWBA 3TAQA 4JV0A 3SNNA 4DU1A 3KTQA 1HYZA 3CYMA 2RKIA 3ZT4A 1N4LA 3TANA 2HHQA 2OYQA 3T5KA 4PA1A 3QEWA 5J1EB 1JXLA 3OS2A 2UVVA 2RDJA 4M41A 5CZ1A 1X9SA 2ZE2B 3G10A 1KLNA 1WN7A 1RCHA 4XPEA 4CJFA 3L2QA 4GW6A 1JLQA 4K4VA 2OA8A 3ULDA 2YNHA 1RT7A 1GX6A 3DRRA 3GV5B 1CZ9A 1RA7A 4O3QA 5SWMA 3EZ5A 4DTJA 4IH5A 2V9WA 1TKXB 3H5XA 3C6UA 5K14A 1QUVA 1EX4A 2IAJA 2AX0A 3PX0A 3HSTB 4CCHA 1IKYB 3DLHA 4DQPA 5D3GA 3AA2A 5KFBA 3QLHB 3OSNA 1IH7A 1ZBFA 3EPGA 3NF9A 5KFEA 4ELUA 4AHCA 4R5PB 1EKEA 4M3XA 4W5TA 4ZP7A 2ALZA 2XHBA 3K58A 3KKRA 3TVKA 4OL8A 4ECRA 1C2PA 1QHTA 5KG3A 3JSMB 3PJWA 3S3NA 4CF0A 3NAEA 4F4XA 3KJVA 3QGIA 4B9LA 2XI3A 3NGDA 5FRMA 3M8PB 4CGHA 4DU3A 2HHSA 2D3ZA 4QWDA 2BE2A 1DLOA 3V6HA 3ZT0A 3FFIA 1LWCB 2CKWA 4J9OA 3D5MA 2JEGA 2VG7A 4RG8A 4WFYA 3DYAB 3MEDB 1VSJA 4KSEB 1RT1B 1REVA 4NCGA 3H40A 2UVRA 4Q0BB 3FQKA 3V9SA 1TKZA 3QZ8A 4ICLB 1QE1A 1WAFA 4DTRA 4JLHA 4CFBA 4CJVA 2ATQA 3H59A 4NLGA 1K1SA 3ZSOA 4WFZA 5FDLA 5F9LA 1LAWA 4B8AB 2RDIA 1JLAB 1TL1B 1TQLA 3OLAA 4FJMA 3VQ4A 4FLZA 3V6DA 1T8EA 4NLVA 3D0PA 2PY5A 4OPKA 4CERA 2HVHA 4RW4A 2IM3A 2BR0A 4B3OA 1NOYA 3IRXB 2FBVA 5KT6A 4AHTA 1O1WA 1BIUA 2P51A 1RNHA 3I5CA 4FZZA 1N56A 4K4UA 4Y34A 1S48A 2IC3B 5T14A 5KFLA 3T5JA 1SKWA 2D0AA 1VRUB 3VQBA 3OHAA 1RBSA 1JIHA 1WSFA 1BQNA 1TK0A 4DSKA 4YFUA 4TYBA 4IKAA 4NLUA 1TAUA 1WSJA 1TVRB 3TR8A 3PY8A 3PO5A 2HNYA 3AVHA 4LSLB 1RBUA 4CIFA 5F8GA 1VSHA 3H5UA 4J9RA 4FBUA 1U45A 4B9NA 4IG3A 4FXDA 3T1AA 5C42A 2UVUA 5KG7A 5C5JA 1WSEA 4HUGA 3BGRB 2ZE2A 3V9UA 3FFIB 5J2PB 1NK6A 3RTVA 3NKYA 1S6QB 1KRPA 3PW0A 2ILZA 4CJKA 4R0EA 4J9SA 4NRUA 4ZPDA 1NKEA 3CDWA 2W7OA 4CJTA 3NCIA 1LWEB 4WYLA 1VRUA 2Z1GA 2EC0A 3NF8A 3HPHA 3SFGA 1JLCA 4C8MA 4K4XA 4LQ3A 2UVWA 2IDOA 2RKIB 2KFZA 2C2DA 4AH9A 4HCBA 4J9PA 5F8IA 4HKQA 4TSXA 5CYMA 1RTDB 2VA3A 3O4QA 4M45A 4LQ9A 3UQSA 1NHVA 2W9AA 1KFSA 3QO9A 1SKSA 4KB7A 5L1KA 4ED8A 4H8KA 3QGHA 3L8BA 3CJ5A 5KFFA 4TQRA 3AO5A 2JC0A 1IKWB 1U09A 4OGEA 1YT3A 4MKBA 2R8KA 2IM0A 3AVJA 4OKJA 3SCXA 2HHVA 3PX4A 1HNVB 4HVJA 4Y3CA 3PW5A 3WNHA 3E01B 1VSMA 4FLXA 3LP3A 4TLRA 1RTJA 4FW1A 3VQAA 1DTTA 4JS5A 2LSNA 4G3IA 3RB3A 5CY4A 1S9GA 4TY8B 3LANA 1Z25A 3F9KA 1TK8A 4MFBB 4DG1B 4K4YA 2B6AB 2G8IA 4ECWA 2X78A 5I42B 3CJ0A 4ZPBA 2ZKUA 1CXUA 4OLAA 1VSLA 3NGZA 1MU2A 4DF8A 1Z4UA 1U4BA 2F96A 4KKOA 3QINA 4QWBA 3DLEB 1G15A 3V1QA 1RT2A 1TL1A 3L2VA 3WNFA 4MFBA 3OHBA 4OKEA 5KFQA 4URGA 4NLTA 5KFNA 4GC7A 4DTPA 1S9EA 5DGBA 3M9MB 1QE1B 4O55A 2DFEA 1HPZB 2XCPA 2I5JB 2JEJA 5L9XA 2RN2A 1CXQA 4B08A 4FJIA 4J9QA 3DRSA 5DLGA 4L8RB 3CFRA 1RT6A 3LPUA 4H54A 3AO2A 5HROA 2OPSB 5CYQB 2W9CB 5KFRA 3QETA 2WOMB 4FJHA 1HYSA 1BI4B 3NFAA 1D5AA 1RA6A 4E7IA 1MU2B 4N5SA 3SFUA 2ETJA 3NL0A 2KZZA 4PQUB 1K1QA 3GQCA 1LW0A 3V81B 2OPPB 4YQWA 2GUIA 1KLMB 1NOZA 1SL0A 4DL4A 2IM2A 4F8RA 4CECA 3NDKA 1C0TA 3M8QA 4I2PA 1IG9A 1LV5A 3AVBA 4E89A 1J53A 2HHWA 3BR9A 3CWJA 3QNOA 4U6PA 3SPYA 4IBNA 1XHXA 3DMJA 3HO1A 3LPTA 1ZBHA 1C0UB 4XO0A 2R8HA 3I0RA 5I3UA 4IRDA 2HMIA 1FKOA 3AVCA 1ZETA 4K4TA 4OJRA 1S0MA 4ZVHA 4J9MA 1NK0A 4M3WA 2IJFA 4Y2CA 1SUQB 4IR1A 3FQLA 5FROA 4FLYA 3IGVA 4IRCA 4KB0A 2DPIA 2ZQBA 1QAIA 3TAEA 4WXOA 3KLHA 4CEZA 1FK9B 4O4GB 1JL2A 2XGQA 3DLKA 3NHGA 4PY5A 4ED2A 3DRPA 3A2FA 4CJ5A 1ASUA 4PUOA 1W25A 5F8JA 4NYNA 3EYZA 1NK4A 4DQIA 1BL3A 1JXBA 4C8NA 1NKBA 3PW2A 2JGUA 3ISNC 1KTQA 1JLGA 3K2PA 4KI4A 3LAKA 3KLHB 1GOBA 3BGRA 4HUEA 3DOLB 3IGNA 1D9DA 5HBMB 5KG2A 1CLQA 2ASJA 3FSIA 3IG1A 4B3OB 4NZ0A 3BREA 5F8HA 3TAGA 4B9MA 2NUBA 3NF6A 1S1UB 5E41A 2BRKA 3I5AA 2R2UA 3ZSQA 4HUFA 3NF7A 1LAVA 5HRPA 3DMJB 4CF1A 1F21A 4M3RA 1VRTB 4WZMA 4QWAA 2BQUA 4ED1A 4NLDA 4H4MA 3H98A 2X6SA 3MXMA 1C0MA 3V9XA 4KRFA 5KG6A 3OJSA 4CEQA 1SKRA 5J2MA 1IKVA 1JLQB 2G8FA 1TKTA 2UUWA 3OYHA 3EPIA 5HLFA 3N6NA 4YMEA 1HQEB 1KCFA 5J2QB 4KKOB 3QLHA 4O3PA 4O3NA 2OH2A 2HNZA 4ID5B 4F2RA 5SZTA 3SJJA 3QEIA 2PYJA 3JSMA 3VQSA 1RT6B 5KFCA 4NLXA 1BQMA 3PJXA 3DI6A 3L3VA 4IRKA 3QO9B 2VG6A 4CJ4A 2XY7A 1KSPA 4Z4CA 3M8SA 2DTUA 4O3RA 3LAMA 3VQ7A 4IKFA 4CK3A 1VK0A 1HQUA 3NH1A 3RAXA 1RTIA 2HHXA 1WLJA 1S10A 2VG7B 4EBCA 3WNEA 1EXQA 3S3MA 4ZTJA 3SQ1A 2BE2B 1XWLA 1TGOA 2ZD1A 1NJXA 1ITGA 3CO9A 1U48A 3NBPB 3H2LA 3RBEA 3KOAA 1S1TB 3LWMA 1ASWA 2AGPA 2IA6A 4KPYA 1C1AA 3SPZA 5F8NA 3Q8SB 1YVUA 3D45A 4CHYA 1I6JA 4KHUA 1VSFA 3SUPA 1RDRA 1JKHA 2YHBA 3HVTA 1XC9A 4RW9B 3Q8QB 1S0NA 3OYLA 4CFCA 1N5YB 3M9NB 1LW2B 3E01A 4CJRA 2OPQA 4OGCA 1LWEA 4DL7A 4RNHA 1RYRA 4KO0A 4IFYB 4NLWA 5KFMA 1SV5A 5EUHA 2ASDA 2R2TA 2W8LA 1C0UA 4ZHRB 3M8RA 1LWCA 2B5JB 4CHQA 1XR5A 2IMWP 4CIGA 3K5NA 1S1WA 1WSHA 4CESA 3QIPB 3BDPA 3FDSA 2IOCA 1L5UA 3VQ9A 3CJ2A 2XGPA 2FVQA 1WSGA 4TXSA 3KNAA 4J9LA 5C24B 5KFGA 3HKWA 4RU9A 4UQGA 2A1RA 5DK5A 2HAIA 3ZSVA 3G6VA 3HJFA 1JLCB 1C1BB 3ZSRA 3N6MA 3VA3A 3BSCA 4PQUA 4QOZB 2OPRB 2FVCA 4E3SA 4HCCA 3TAFA 2OPQB 3NBPA 4KHNA 3KK3B 1CZBA 3KLIA 3V6KA 3U6FA 1S6QA 1HQEA 3KLVA 2FBTA 4DWIA 3P83D 4BDYA 2QV6A 2GIRA 4EO8A 4GC6A 3DLGB 3VQCA 4DSJA 3VQ5A 3QIDA 4TYAA 1HPZA 2I5JA 5L1LA 4TN2A 1J9AA 1VSKA 3TAMB 1QQCA 4CF9A 4FLWA 2WTFA 1JLEB 4I7FA 3B6PA 4CEFA 4RW7B 4KAIA 4Z0UA 1TVRA 4XIUA 4URSA 1T03B 2F8SA 3G6XA 2IAJB 2XY5A 1RT3B 5KGXA 3SUNA 1QAJA 2E9ZA 2PZSA 5EDWA 4ECTA 2ASLA 3VN5A 3NMAA 1LW2A 5KRSA 2WCXA 3C6TA 3D28A 3KHHA 2R2SA 4JUZA 2B4JA 2O4IA 2XY6A 4N56A 2F8EX 5HRNA 1NHUA 2YNFA 1RBTA 3RWUA 2BRLA 1SL1A 1T05A 3IRXA 4JS4A 1HNVA 2FJWA 5KI6A 4KREA 4CJ3A 1RT5B 3KMQA 3ZSWA 3LALA 2IJNA 2KFNA 5KFHA 1HRHA 1S1XB 4FJLA 4KHMA 5DG9A 2Z1HA 1QSSA 3BQ1A 1RTHB 3QNNA 3Q8PB 3CVKA 3CDEA 3O3FA 4DTSA 4KTQA 2XC9A 4J2EA 4KTWA 1XI1A 1TKZB 4FJ9A 3QIOA 1L3TA 1FXXA 3ITHA 5CYMB 1RTDA 2AU0A 4CJUA 3RMCA 2YNGA 3KK2A 2AGQA 5D3GB 2YNHB 3OYCA 4KB1A 4W5NA 3NH0A 4H4OB 4DTXA 4I9QA 3KK1A 3OL8A 3CFPA 3KLFA 1VSIA 3AA5X 3C6UB 4ELTA 2KZMA 1I3AA 3GIIA 3LP0B 1GOAA 2ITGA 3UPFA 4J9NA 4CE9A 1S6PB 3KD1E 2AGOA 3G0ZA 3VQPA 2W9CA 2GC8A 4MIBA 2KQ2A 4K8XA 3TARA 3NH2A 4FJ5A 3HHKA 4KBIA 2O4GA 2EHGA 2E9TA 3QGGA 3CJ4A 2DFFA 4AHVA 3QEPA 2FBXA 1S1TA 4HHTA 4E1MA 4FJJA 4WE1A 4CJQA 3LP2B 2OPSA 5CYQA 3KIOA 3P1GA 2YHAA 5JS1A 1BISA 4ZMMA 1KVCA 4TY9A 4CGFA 4Q45A 1RT2B 3PUFA 3OYNA 3QYYA 2J6TA 5DQHA 1TK5A 3RB0A 4NYFA 3G86A 4RUCA 5KG1A 4KHWA 5KG5A 4ICLA 4I2QA 4GMJB 4B9VA 1D1UA 2BQRA 1S4FA 4FK0A 4DSEA 3P5JA 4LSNB 5I3UB 4CFAA 4C8KA 4DFMA 4F2SA 4MKAA 2AQ4A 1BGXT 2YKMB 4Q8EA 2FC0A 1NJWA 4M3YA 3LZIA 1SH0A 1JL1A 4QCLA 3RR7A 1DLOB 4FJKA 1KVBA 1LW0B 3V81A 2C2RA 3KKSA 4QW8A 2W9BA 1IKYA 3SQ2A 3DM2B 1HMVB 1W9HA 3DLKB 1T05B 4DG1A 2G8VA 1RT3A 1OS5A 3KHLA 4R8UA 2YKMA 3RRHA 2G8HA 5C42B 4FK2A 1LWFA 4DSLA 4MK8A 1C6VA 3GIMA 3TAMA 1WNSA 5KFPA 5F8MA 4YR3A 4CEEA 1CSJA 3UDLA 4H4MB 4IH7A 1HNIB 1RAJA 2X6NA 1EP4B 4EYHB 2AX1A 4DS5A 5DGAA 4ZVGA 2E6MA 2FVSA 1UOCA 5KT3A 3N6LA 4KFBA 1T7PA 4BE2A 1RT1A 3TABA 3KLGB 4O5BA 5JS2A 1S5JA 3OYGA 4DQRA 2QK9A 3PZPA 4GVMA 5J2NA 4E7JA 5J2MB 3KK3A 4B9SA 4M3TA 3KLIB 3OY9A 1FKPB 2D0CA 3C95A 2P5OA 2EX3A 3ISND 5C25B 4Z4HA 2E6LA 3V1RA 3TI0A 5JXSA 4IDKB 3KLFB 1TL3B 4M42A 2IM1A 4RNMA 2HNDA 3L2UA 4ELVA 4H4OA 3VQEA 1UAXA 4Y1CA 4J2AA 4M3UA 2C2EA 4B9UA 4NLOA 4IG3B 3PR4A 3BSNA 4R5PA 5KFJA 4F3TA 4KTZA 3IG1B 2JEIA 3H4DA 4G1QB 5EU7A 1JXEA 1N6QB 3U3GA 1S1XA 2R2RA 4K4WA 4WXWA 3MEGB 2X74A 3AVGA 1HJRA 2YNIB 4HTUA 4EEYA 1TKXA 3MTKA 4ZTFA 1T94A 5F9NA 4O3SA 3K5MA 1NJYA 4CK2A 4WE1B 3UIQA 1NKCA 1GOCA 3O3HA 4Y2AA 4BE1A 2YKNA 1FKPA 3T19A 4BWJA 1UA1A 5KG4A 3DLBA 4F4KA 1FK9A 3NAHA 4FLTA 3V6JA 3RRGA 3BQ0A 4NCBA 4DQSA 4E7KA 2AJQA 4E7HA 2W8KA 2YKNB 1UWBB 2VA2A 2J6SA 4M94A 1BI4A 3MEEB 4I2QB 5KFTA 3ALYA 3HVRA 3QESA 3KLEA 4ED3A 1S9FA 1JLAA 1BQMB 3MAQA 4O4GA 3V4IB 1IKWA 3HK2A 3VA0A 4DFJA 4CEOA 2WONB 5KT7A 4HYKA 4FJ8A 1SV5B 4B9TA 1UA0A 4NLQA 4DL6A 4O0IA 3KHRA 1RILA 2DFHA 3MEEA 2VG6B 4LY7A 2Y1JA 1GX5A 3TWHA 2BDPA 2JC1A 1C0TB 1LWFB 5HBMA 4DL3A 2JLEA 1RTHA 2WRMA 1IO2A 1B9DA 1MMLA 4RW6A 4R8UB 4C8OA 2C28A 4DU4A 1U04A 2OZSA 3MR5A 4YR0A 4M3ZA 4DTOA 4F4WA 5KFZA 1RYSA 4RW4B 2GBZA 3LWLA 4NRTA 1IKXA 4O3OA 3THVA 3OVNA 1K6YA 4Z4FA 3GIKA 1NK8A 4Z4GA 3CDUA 3UR0A 2HHUA 2HWIA 3VQ8A 1YTUA 3U3YA 3S3OA 1Y97A 3CM5A 4RW7A 3NGIA 3I0SB 1ASVA 1SUQA 3DRSB 3BJYA 1ZTWA 1NK7A 4CF8A 3IN5A 3AVFA 3PV8A 3SUOA 1ZBLA 4MQ3A 1L3UA 1RDCA 2Q3SA 2I1RA 4NCGB 3SQ4A 1QS4A 4DLGA 3HP9A 2BGGA 3KMSA 1VSDA 3DYAA 4K8ZA 5KFSA 4FS1A 4FJGA 4CEDA 4CHNA 4OVLA 5L1JA 1Z26A 2XO7A 4CIEA 2PYLA 4DF4A 1I39A 2D5RA 4CJPA 4FCYA 1A5VA 4K4SA 3QEVA 4FZXC 2HW3A 4BWMA 4FLUA 4Z4IA 4DFKA 5EWGA 3V9WA 1S97A 2QXFA 3DRRB 1L3SA 1A5WA 2YV0X 3DLGA 4NLRA 4I2PB 3TQ1A 3GIJA 3OS1A 3HT3A 1TKTB 3AVMA 2XWYA 3KD5E 1J5OA 3HM9A 4DTMA 4QWEA 1DTTB 3C6TB 4EYIB 1JLFA 4J2DA 1QTMA 2IGIA 3QZ7A 5KFWA 4EP5A 4ZVEA 3V6DB 3DRPB 2VWKA 2KW4A 4KI6A 1VRTA 5KT2A 3MFHA 4FLVA 4F50A 3HL8A 2R8JA 1A5XA 2HWHA 4DSFA 1N6QA 3O3GA 1TV6A 3OYAA 1BQNB 1RTJB 4ECYA 4CGGA 5KT4A 4YR2A 4Q8FA 3OSPA 4XPCA 3SV3A 1ZBIA 2VG5A 3RMBA 4BDZA 3WNGA 2WONA 4FS2A 3T5LA 2ATLA 3DOKA 4URQU 3PW4A 2D3UA 3VQQA 4RNFA 2WK4A 4CJEA 1B9FA 4KO0B 3BSOA 1U49A 1RDDA 1EETB 2UUTA 4DEZA 3VQ6A 1NK9A 4WZQA 4JV2A 3OYFA 1L3VA 4FM2A 2ILYA 4O4RA 3OJUA 4RZRA 3ZSZA 3L2WA 4O44A 1JKHB 4JRPA 3MEGA 3HVTB 4FVMA 4Y1DA 1C1CA 3MECA 3PW7A 3CM6A 1SH2A 1HQUB 2JEFA 3OL7A 3MR3A 2IBKA 4AILC 2V4RA 2FVPA 3LP0A 3CJ3A 5KFYA 5EWEA 3K57A 3T5HA 2GV9A 4O0JA 1WAJA 5CZ2A 2HMIB 5HROB 4CGIA 1C1BA 3CG7A 4ZPAA 5J2PA 2D0BA 3LZJA 1B92A 1R0AA 2G8UA 5HRRA 3BSAA 4ZP6A 3OL9A 4ECXA 3GILA 4FBTA 2WB4A 5KRTA 3ICLA 4IG0B 1QSLA 4K50A 1HARA 4Q5VA 4ECQA 5HLFB 3AVAA 4W5QA 4WFXA 4E7LA 4QW9A 3BQ2A 2HNDB 3PO4A 4PWDA 3RB6A 3AVNA 3NGYA 1D8YA 4E0DA 4EO6A 1KFDA 1S6PA 4BACA 4B8CA 2Z1IA 1RDAA 2BANB 4IOBA 3HP6A 4KHQA 3OYJA 1RDBA 3AO4A 4ID1A 4I9LA 2HVIA 3MXIA 2AWZA 5KFVA 4CFDA 4RW9A 4NYZA 2FLNA 4FK4A 3AA4A 4N76A 1HNIA 1S9GB 4ECVA 1X1PA 3RMAA 3C94A 4CJLA 2W42A 3I8DA 1DTQB 4Q43A 3EZUA 3AVKA 1S1WB 4EP4A 4E19A 4JV1A 2KTQA 2B5JA 3TAPA 3MFIA 1ZBUA 3DLEA 4ZPCA 1S1UA 4N47A 3DM2A 4M95A 2YNGB 3KK2B 2O5DA 3HYFA 3QEXA 3E51A 4WYWA 1HYVA 2DY4A 3M8PA 1JLFB 5J2NB 3RMDA 3MEDA 1X9WA 2GIQA 3M8QB 1S49A 4FJ7A 1NK5A 3ZT2A 1J5OB 3H5SA 4RW8B 4TY8A 4TQSA 1RT4A 4YP3A 3MR2A 5HP1B 2QKBA 2HHTA 4IDKA 4ID5A 5HRSA 2OPPA 3ZT3A 4NLSA 1RT5A 2FJXA 2FVRA 5J1EA 3K59A 5DQGA 3NAIA 4BE0A 2B43A 2WOMA 1KHWA 2R8GA 4OKKA 1BIZA 4OPJA 3ZSXA 4IQXA 3I0RB 4BDPA 4DS4A 4RW6B 4DQQA 5HP1A 1Q9XA 3RR8A 4IFVA 1XHZA 1TAQA 4G1QA 2FJVA 4ED0A 3RAQA 3Q8RB 3M9OB 3LDSA 2DPJA 1ZYQA 3B6OA 4DLEA 4JRQA 1DTQA 1IM4A 3H4BA 1JLBB 2E4LA 2A1SA 2D7SA 4LSLA 5EWFA 4FM0A 1U47A 3GYNA 5KFIA 1Q8IA 1BCOA 1S1VA 1TP7A 4F4ZA 5KFOA 4KHYA 4F4YA 3V4IA 4O44B 2RF2B 4NLPA 3OYBA 4KHSA 4J2BA 3H5YA 2FLLA 2HNZB 4KHRA 3OYKA 3PHEA 4ECUA 4AHSA 3AO3A 2XCAA 2Z1JA 2Y1IA 2J6UA 4E1NA 4QWCA 2IC3A 1N5YA 2XRIA 3V9ZA 2YNFB 1C1CB 3MECB 4DSIA 4RW8A 3PX6A 3KLGA 2G8KA 5DLFA 1SH3A 1IKVB 4CGJA 1N48A 4F3OA 4CHPA 4DFPA 1D9FA 3LP1A 4ECZA 4LD0A 3K5LA 1S9EB 1HYSB 2YNIA 1R0AB 3IS9A 3HVAA 3CIZA 4ED6A 3QERA 1ZTTA 4CJWA 1RBVA 3OLBA 3KLEB 1W0HA 3AV9A 5KFXA 2HB5A 3OYDA 4DMNA 1KHVA 4IH6A 4FZYA 3I5BA 3SYZA 4EZ6A 2R8IA 2RPIA 3DOLA 3RBDA 4ZVFA 2VWJA 3L2RA 3VQDA 4W5OA 4DL5A 5KT5A 4W5RA 5DG8A 4QAGA 1D0EA 4RNNA 4IFYA 2P5GA 4J9KA 3SV4A 1Q9YA 2V4QA 2XY8A 5T7BA 4PUOB 3DDKA 2QKKA 3KJVB 2W7PA 4MH8A 2ZD1B 3NE6A 3AVLA 4N41A 2FBYA 3DOKB 5K14B 1S0OA 3HPGA 3AO1A 1S1VB 5JUMA 4QPXA 3HXMA 4I7FB 3H08A 3SZ2A 3PVXA 1KLMA 4KFBB 1RTIB 1BCMA 1JX4A 3V1OA 2QE5A 4EZ9A 5DQIA 4RNOA 3ITHB 3EY1A 1FKOB 1REVB 2P1JA 4FM1A 5KFKA 4EBEA 1J54A 2FLPA 4ZHRA 3IS9B 3KK1B 1XR7A 3FRZA 1RBRA 4RUAA 4CEBA 3OYEA 1TKDA 1JLEA 1BHLA 4ZP9A 1KVAA 3HVWA 1NJZA 1NNDA 5L1IA 4FW2A 4KAZA 5DMRA 1RT7B 1YTAA 1WNEA 5I42A 4AHRA 3L3UA 3AVIA 3I0SA 1X9MA 3F73A 3JYTB 3RB4A 3ASMA 3CFOA 1JLGB
chains in the Genus database with same CATH superfamily
1BUXA 3RUBL 3OL6A 2DH7A 3X3UA 3T3FA 5FRNA 1LWXA 3CC7N 1FDAA 2KT3A 3EVMA 1JB0C 1RZMA 3DKDA 1EETA 1WOPA 4LRFA 3MF5A 2RS8A 2RF2A 5KFDA 3IAYA 3QBWA 1EP4A 5KTQA 2DH9A 5AE3A 3HZ6A 2OEJA 5FLXO 1KC8T 4BROA 3SUQA 3CMAS 3GV7B 1XR6A 3M1VA 2L41A 1RWPB 4FJNA 2I8EA 1ZXOA 3MOZA 2CUYA 3QT6A 1SS6A 1QQMA 3GDQA 2XWXA 4IQMA 5J2QA 4FJXA 5FJ4A 4CZFA 3ATVA 3C66A 3CQ8A 4RBUA 4U7CA 3W60A 3ZCMA 2BQ3A 3M3ZA 2C22A 2F8TA 4EBDA 4FOIA 2YCHA 5KPRA 4DUYJ 4Q44A 2HZVA 4LH5A 4OHXA 4DUTA 3C6HA 3RJMB 4EIAA 2Y1RI 5LMUK 2VPWB 1N36J 1OSDA 1QSYA 4LH4A 3M6UA 5KFAA 3W7BA 4CHOA 3FZLA 3OA9A 1M1GA 4EI2A 3OTEA 4YOTA 4JV0A 1UZHA 3US5A 3BF1A 3EGWB 2EBEA 4HHJA 1N5VA 1WB9A 1RHMB 1RWWB 3N4WA 3CYMA 2RKIA 3LDNA 4XH5A 1SC4B 5F1XA 1N4LA 2WVFA 2HHQA 5IFMA 2OFHX 5A6WA 3TW0A 1VAZA 1QQOA 2RDJA 4P71A 3C7NB 2HZAA 5CZ1A 1WHXA 2XMWA 1ZS6A 3AGRA 4OLPA 5DO2A 3UDEA 2H65B 3M2VB 4GW6A 1U26A 2OA8A 1FXDA 3DRRA 3EZ5A 3IBFB 3LW5C 2V9WA 3MM6A 3QQCD 4KHPF 2CPDA 4MJKA 4LRDA 1QUVA 2MYFA 1EX4A 2VIHA 3OTDA 5H1SV 4DV1F 3JQKA 2ZJQL 4CCHA 2A42A 1XIQA 4CZCA 3TA1A 3C14A 3EN9A 4DB3A 4IYQA 3EPGA 2GVZA 5KFEA 3HHLB 1NMNA 3BR8A 1HNZF 4M3XA 4BY9C 2JWLA 1F60B 2XHBA 4OL8A 3HFZB 1QHTA 3JSMB 1HKGA 2HRTA 2AKWB 4RWWA 4L74A 4IUFA 4WBFA 2V8VA 1VQ6N 2EWHA 5HATA 4NXMK 5AQSA 3PFEA 5ETVA 4RJVA 3NGDA 5FRMA 4JI2J 4DU3A 5C2CA 2HHSA 1WJ9A 3Q7CA 1H2VZ 3CCES 2JEGA 4BR9A 4RG8A 2D69A 4HH1A 1NLKL 5I3QA 4OJHA 1VSJA 3M6WA 3H40A 4NCGA 2UVRA 1RUSA 5HO4A 4LFAJ 1FWLA 2VQEK 3I9V9 1TKZA 4KQZA 2E2NA 2O3DA 3CCRN 4WFZA 5FDLA 5B0GA 4B8AB 2RDIA 1TL1B 2VFVA 1HNWF 5T41A 4FLZA 3V6DA 2VOPA 2DRDA 1T8EA 2ZHBA 1FRXA 1TUYA 2ZH8A 1T9TA 4B3OA 5AXNA 3PKYA 3OUYB 4PWWA 4YOEA 1NO8A 5M1QA 4BRCA 3SEOA 2EFNA 1XJWB 3UE5A 2IC3B 3KJNB 4DR1K 4C6AA 1N0VC 4NX9A 5KFLA 3J7AP 2HS4A 4C11B 1VRUB 1OVYA 1JIHA 5F2RA 1WSFA 1QZ6A 3W5YA 3WC2A 2X3GA 1TVRB 3L4QA 3PO5A 2HNYA 1UVNA 4GV3A 1Y00A 5U47A 5ETQA 3H5UA 2ZBCA 4FBUA 3ENQA 2LEBA 2DNHA 2H1YA 5KG7A 3AAPA 3BGRB 3QT5A 3G71N 5J2PB 3VEXA 1S6QB 3TSUA 4R0EA 2XULA 4ZPDA 4I0WA 1MSWD 3NCIA 1LWEB 2VUGA 2Z1GA 4PL7A 1PYSB 4DV3F 3UKUA 4K4XA 3D1QA 1H7XA 3BF4A 3J81Y 2KFZA 2C2DA 1SVDA 4AH9A 1Q7YT 2BXJA 1BE4A 2MZRA 4J9PA 4HKQA 1WTFA 1Z6RA 3O4QA 4M45A 4F25A 4LQ9A 3N0VA 3J80U 4A5AA 2DNLA 2NPFA 4FYWB 4ED8A 2BZ2A 3QGHA 3L8BA 4IZ9A 5A8KA 3HT0A 4X62J 2KYZA 5KFFA 3AO5A 5HMWA 4Y28C 2JC0A 1IKWB 3FZBA 4NMLA 4AL7A 1YT3A 2CQ0A 3BO2A 2R8KA 1MG7A 5BYQA 3A5MC 1WC0A 1HNVB 2DR6A 4FLXA 1VHFA 1RTJA 3F44A 1AUDA 3VQAA 3R5DA 1DTTA 4G3IA 1PBUA 3CCUS 4FYYB 1Z25A 3F9KA 3CC4S 4MFBB 1ZBTA 2LQ5A 3QPIA 2W24A 4DG1B 2H5JB 1NEEA 2LP4A 2B6AB 1KQFB 2C3PA 1RCOB 1SXLA 3CJ0A 1Y7PA 4ZPBA 4H0VB 4OLAA 3ZEUB 3NGZA 1MU2A 4Q2LA 2V2ZA 3P3DA 4C0BA 1UVLA 3DLEB 1Q8KA 4L75A 1ATNA 3V1QA 1TL1A 3ENOA 5JMNA 5KFQA 5KFNA 1PC5A 4RWTA 3IR6B 1B0PA 2EEYA 2DGSA 4O55A 4PKHA 1FE0A 3MXHP 5AQOA 3HX9A 1CXQA 3UKRB 4WQ5C 1CJVA 4K43A 2XLJA 3FBFA 1EKSA 5F41A 1KR4A 1P27B 4IEEA 2XS2A 5KFRA 3UW1A 4FJHA 3HI0A 1HYSA 1JJ2M 4XEIA 1RA6A 2EI5A 2LFVA 3C7NA 4N5SA 2G0IA 2E5LK 2XMMA 4PQUB 3GQCA 3R5JB 4JYAK 4YQWA 2GUIA 3CERA 4BR0A 4DX6A 1C0TA 3M8QA 3J7AN 4MMOA 1FD8A 3AVBA 3R97A 1IBLK 5M1NA 2QLJB 4WQ4C 4USJC 2PD1A 3QATA 1TZ0A 2QWNA 3D68A 3GYGA 3CWJA 1APSA 1M1KO 3UN2A 1NZ8A 3LPEA 4V19J 2J4RA 3VZHA 2P9IA 4XO0A 2R8HA 2E1ZA 1NPPA 3MWPA 1XUPO 3MN7A 1FKOA 1Y3KA 4PAAA 2I2YA 4J9MA 3DXKB 3RRKA 4IR1A 4BS2A 5IWAJ 4X4UA 1R8CA 2NR0A 4BG8A 2DPIA 3TAEA 4JYAJ 3KLHA 1Q5VA 1S5ZA 1QZ5A 3CUNA 3NHGA 1Q5YA 2VDHA 4CJ5A 1ASUA 4PG7A 3M30B 1UCNA 1VJQA 1W25A 3EYZA 5F8JA 3O9TA 4Y0WA 1G6BA 3HFKA 1BL3A 1MMNA 3IR5B 3MMAA 3ZFVA 4CTAB 3IGNA 1D9DA 5HBMB 4ZVTB 3CCLS 2AA4A 3FSIA 4DR7J 3W63A 2BH1A 3IG1A 1PC4A 1UEUA 2E29A 3LPYA 5L9NA 2FSKA 3DCAA 1UKUA 3FZFA 4DDFA 1HWUA 3SMSA 1C4CA 2BRKA 3ENBA 3ZSQA 5LJWA 3WHIA 4HUFA 4USVA 2HZCA 3UN3A 5HRPA 3DMJB 3CD7A 3R8YA 1S57A 4M3RA 1VRTB 2MEWA 4H4MA 2E5JA 2DNKA 1WG4A 1T0TV 1FX4A 2QM1A 3MXMA 5KG6A 1UW4A 1IKVA 4I67A 4W4MA 1VS3A 5MLCQ 3OBWA 2ZF5O 2DK2A 4KH0B 5HLFA 4PEOA 5J2QB 1UVIA 3VGUA 2RNEA 4KKOB 2OSRA 2ZVIA 3QLHA 1HW9A 3NGRA 2OH2A 4FWOA 3NG8A 4K41A 4F2RA 5DM7Q 4DR5K 3QEIA 1RT6B 4NLXA 1G7CB 4A8XA 4JI8F 3L3VA 3QO9B 5T7LA 4CJ4A 2RE1A 2FXUA 3M8SA 2E1YA 1FNOA 4AYBD 1YBTA 3E3XA 1XEZA 4B3SJ 1RTIA 2F9DA 1IBLJ 1CULA 1WLJA 1N33K 2VL1A 4CH1A 1D3WA 3J7Z5 3UVJA 1F6TA 4MDAA 1GH8A 2HK3A 4FWKA 4UTGA 2KJVA 5DM6L 3CO0P 1FO1A 4DUZF 3KOAA 1ASWA 2AGPA 4KPYA 3W8PA 5F8NA 4HTIA 1MROB 2PFFB 1YVUA 3VOVA 2GZOA 1S99A 3SUPA 1CVJA 3R7SB 1RDRA 5A2QU 2YHBA 1JCFA 3HVTA 1XC9A 1O0PA 3UD5A 4NXNF 2DIUA 3M9NB 3GP9A 4B17A 1LWEA 3OQ2A 4Q7AA 5KFMA 1BWEA 1ZH5A 2W8LA 3EVOA 4LMZA 3H1VX 4DR4K 3MM7A 5IS2A 1WEZA 2CQ3A 1Z1ZA 1XR5A 5JMVA 2O8DB 1UW9A 3K5NA 1S1WA 1WSHA 1HHQA 4CESA 3KYLA 3GG4A 2GAGC 4YOVA 2W01A 3VQ9A 3CJ2A 2EFPA 2FGCA 5D4LA 4TXSA 3KNAA 4J9LA 3WXMB 4RU9A 4UQGA 2CDRB 1S76D 2VZ9A 2GNKA 4I6MB 3ZSVA 4LR8A 1JLCB 3WIUA 3VA3A 1DGKN 1Y9OA 3D6MB 3VF0B 3TAFA 3NBPA 4O8UA 4KHNA 3IC1A 3DU6A 4RCHA 3KLIA 5CR4A 3TUPA 3KLVA 2YWKA 4DWIA 2FBTA 3BN4A 4A62A 2RT3A 3MHYA 5JICA 4JI8K 2EFGA 3AOAA 3EM1A 2YKOA 3DLGB 5JVGL 1R27B 2M3DA 4BRNA 4X66F 3GFXA 1YVNA 3J7ZT 1XNRK 5IQ6A 2CXEA 2FYXA 3K89A 1VSKA 3TAMB 4CF9A 2OTJN 4LSZB 3CULA 2E7XA 1DRZA 5AQWA 5D8HB 4AM7A 2CWKA 4Y2MA 1TVRA 4DPXA 4URSA 1T03B 3UCGA 3QGPA 2IAJB 2BJ8A 2JX2A 4XK8C 2O66A 5AQQA 3WX8A 5A2QY 3GSDA 1KN6A 2W6KA 2UXBJ 2QEXN 1EQMA 1YRTA 1UZDA 1R7IA 4L3KA 2BJDA 3UDCA 4CLLA 1MDUB 2R2SA 4ZPVR 3QRQA 2O4IA 1WOQA 5HRNA 2Q2RA 1NHUA 2BMBA 3RWUA 1N33J 5AE2A 3ZLJA 1RT5B 3KMQA 3R2CJ 3BY5A 1SJRA 1D9AA 3POTB 3A8KA 4ZVUB 3DHXA 2MQOA 1N36F 3NS7B 2NRTA 1RWMB 1HRHA 1QSSA 3NRBA 1RTHB 3Q8PB 2IVMA 2MMYA 2XC9A 1VQLS 3R5CA 3AQOA 4FJ9A 1L3TA 2P5VA 1FXXA 3H7HB 4PL8A 4YOWA 2AU0A 3W62A 4ZIVA 2YNGA 3KK2A 4OYAA 3L7UA 2YNHB 2AGQA 1DFDA 4CZEA 4W5NA 1D4XA 4P2XA 3K8WA 1WHVA 1VSIA 3AA5X 3AJ2A 4ELTA 4BRIA 2DNOA 3CCSS 3FGVA 3MPVA 5J1NA 1VQNN 3GIIA 4CLKA 5E84A 2V7ZA 4B02A 4J9NA 2GC8A 2ZBIA 1LXNA 2B9XA 2VASA 3TARA 4CTAA 4QYZJ 2EHGA 5ADXH 5ETSA 2E9TA 3H25A 2JWKA 4USMA 3AFGA 5BPMA 3VERA 1YRUA 1ATRA 2XYPB 1S1TA 3G6ES 4FJJA 2NXEA 3HKZD 2QA4S 3KIOA 1GT8A 2DO0A 4LFBF 2LQJA 2YY3A 1RDUA 4TY9A 4CGFA 4Q45A 1S3XA 2D9PA 3OYNA 2RQCA 5DQHA 4HVZA 2UU9F 5JVHQ 4RUCA 3M2RA 3HMJG 5LMNJ 2FHKA 3U1NA 5HVHA 1ZPVA 3VVTA 1LEOA 3SXLA 1BA1A 2JSXA 4DSEA 2RE2A 2DCLA 4CFAA 3O8WA 4C8KA 2GEMA 4DFMA 1YUWA 4MKAA 2AQ4A 1QY7A 3CCVS 1JL1A 3SCLE 1DLOB 2B4UA 4OPAA 3V81A 2C2RA 2BJ9A 3O1WA 2U1AA 1H0HB 1GLFO 3DLKB 1T05B 4DG1A 2V7YA 3OD2A 1RT3A 4R8UA 2P6SA 4FYXB 2O8BA 1C6VA 5F3TA 4LF5J 1NBEB 2D1KA 4YR3A 4CO1A 3BZKA 3CD6N 3DU5A 4IEIA 2ZH3A 4OYZA 1MWYA 3F0NA 4OZ5A 4DS5A 4QIFA 5DGAA 1EQ0A 4GKJJ 9RUBA 2QMUB 2KFYA 2E6MA 2CJXB 4C8ZA 1UOCA 4HDHA 2ZC3A 2HBMA 1T7PA 1TELA 2YWWA 4NO7A 1YJWN 3O1BA 3CW2C 1S5JA 1SC6A 4J37A 1FRIA 2HQDA 3UKUB 4GVMA 2Z57B 1ZM3A 3THTA 1XMOK 1TL7B 2RRBA 3OY9A 2D0CA 2X1AA 3KK7A 2B7CB 2AJ0A 4GNIA 1U2RA 3W2VB 1MW7A 4IDKB 3SSRA 1KC8O 3L6QA 5TKYA 1MWQA 3VQEA 3MM5A 5D78A 3VEZA 2ACMA 4C3KA 2CPXA 4ZKAA 3PR4A 4R5PA 1FA0A 3BSNA 2QWQA 5AXKA 5JVGQ 2BKPA 5ETRA 4LF9J 1JXEA 3B8HA 2DGQA 1S1XA 4BRQA 2R2RA 3AA8A 3MEGB 2X74A 2AYEA 5EGYA 3AVGA 1HJRA 2XSFA 3RSEB 2PMZD 1T94A 2O8FB 4WU2A 3K5MA 1NJYA 1YJNN 1VQ8N 3UIQA 4JHDB 2EFVA 2YKNA 1FKPA 4BRGA 4DV7J 4DR2F 3DLBA 1IQTA 4FLTA 2KN4A 3N79A 2ASOA 2RIJA 3I55S 4DQSA 2AJQA 2PSZA 1Y5NB 1IR2A 4E7HA 3ULHA 4CDIA 1UWBB 1Q0NA 2QMXA 4I2QB 3IFRA 4LR9A 3TTFA 2B3TB 3DOMA 4DR7F 1BQMB 1EQYA 2E5HA 3FBBA 1NZAA 4DFJA 4GO7X 4FJ8A 2CQ1A 1SV5B 4B9TA 2YWHA 1UA0A 4NLQA 4DL6A 1RILA 3HLUA 1PAUB 4ZLNA 3WXLA 2DGUA 4DR3J 2Z4PA 2ZWOA 4NE9C 4F3QA 4GKKK 1CS4B 1F5AA 2P9PA 4DL3A 4FWNA 4JI1J 5AQFA 2DNPA 2A2CA 1VBYA 4CIOA 4DUYF 4ZLJA 5AQXA 3CMES 4YR0A 4L6V3 2DBBA 3TZYA 4DTOA 1B70B 1RBLA 2VFSA 2GBZA 4C8YA 1KDNA 1SKUB 2FY1A 5EXWA 5BJRA 3MCAB 4M5LA 4OQJA 5AFUH 3JXUA 3PG9A 4R0JA 4I6MA 1Y97A 3TYTA 3D6TB 2N82B 3DRSB 2UUBJ 3PV8A 1W2BM 4MQ3A 3H46O 2I1RA 4UOGA 1SAZA 5KQ8A 2BGGA 1FXRA 1ICEB 4I69A 3R3TA 1VSDA 4NXNJ 3DYAA 4FS1A 5HN0A 3MUTP 1YJTA 4EK2A 2KXNB 3FVYA 4MLEA 1FRKA 3WEEA 4K4SA 4FZXC 1WC1A 1HWIA 3M32B 4BWMA 4Z4IA 1HNZK 3JTNA 3MM8A 1S97A 2QXFA 3DRRB 2YV0X 3LOUA 3DLGA 2Y1LB 1GFWB 2OP5A 1ACMB 2XWYA 1IBKK 1J5OA 3RBZA 3FJ2A 1DTTB 3ULEA 1XMOF 4CWBA 1JLFA 1VYAA 4J2DA 4CLZA 2MGZA 4OZNA 5M2UA 2D1CA 3QZ7A 1ZM2A 5KFWA 2HIQA 4OJGA 4BVOA 3DRPB 4D3GA 4KI6A 1YJNS 4F50A 4MT1A 2M0GB 3MPYA 1N6QA 3VV2B 2VFRA 3DNCA 3PIOQ 1RTJB 2XMKA 5BR8F 4CGGA 2UUCF 5KT4A 2YH0A 3SV3A 4BDZA 2HBQB 2QT7A 3QJLA 1BWFO 3V2UC 1OMSA 3KWIA 1LK7A 2ATLA 4I6AA 2JH3A 3FKBA 4URQU 3AHPA 1B9FA 3BSOA 2UUTA 4JI7F 1NK9A 2GS8A 1KVJA 1IR0A 4JV2A 1U8WA 1L3VA 4FM2A 2OMOA 3OJUA 3ZSZA 1WDDA 1WBBA 1CJUB 4O44A 4FVMA 1AYEA 3JSRA 1RAIB 3PW7A 3I33A 3ZETB 2UUCK 3U4LA 1HQUB 2RB7A 3NGTA 2V52B 4JKGA 3OL7A 2DNNA 3DRXA 4ETXA 2FVPA 3LP0A 1YJWS 2Q97A 3UB5A 4DV3K 4B3RJ 1TL4A 2CFXA 2YQ3A 3MCOA 1VK3A 3SBMA 2E1MC 3CDAA 2HMIB 3GOIA 5HROB 3ENVA 4CGIA 4X64J 4JI2K 1C1BA 4IOCQ 4WFNL 2DHGA 2EWSA 3R1XA 3BSAA 3CJTA 2ZBPA 4B3MK 4JI0F 1VDHA 4EAHD 4IG0B 2DISA 2B7BB 1YGYA 4Q5VA 1EWRA 6FDRA 3AVAA 4W5QA 1RTZA 2DGWA 3BQ2A 3PO4A 4FNIA 4A8QA 2KB2A 3QFHA 2JLGA 4EO6A 4W90B 3MN9A 3GB0A 5EY4A 5G4DA 3OXLA 1H1VA 4M1KA 2UUCJ 1V5VA 3MXIA 4CH7A 1Q7LB 4EUVA 4D3HA 1T02A 3PRDA 4FK4A 1JJCB 2ZKTA 1S9GB 4USIA 1X1PA 2F4VF 3VF6A 3C94A 3MM8B 4ZCKA 3EEQA 2D74B 2PAVA 3QDKA 4EP4A 3VGTA 1FFSB 3MI7X 4FWPA 3BBFA 1PIEA 3M2VA 1WI8A 2NRWA 2LLZA 1R0BG 4PPDA 1TFWA 4FWSA 1HNWK 4H5WA 4C4WA 2FC9A 2BOAA 1RAAB 1QAYA 1HNXF 1W97L 4HHUA 2PA3A 2YNGB 3KK2B 1ZAXA 2QA4N 4JI4J 4WYWA 3M8PA 2OI2A 4K2JA 3BH6B 3JAMY 2KKZA 3RMDA 5GAEI 3M8QB 2X51A 3CC2S 2F65A 2HQ3A 4RW8B 2CPEA 2VGNA 4Y00A 4TY8A 3MR2A 3ZTPA 2QKBA 2CZ4A 1ULRA 4F26A 5DS7A 2OPPA 2NNWA 4WTOB 3QJJA 5HANA 3VTIA 3OVBA 2FJXA 2FVRA 1FFGB 1RAEB 4BE0A 3KDOA 1VQNS 3VGVA 1BIZA 4IQXA 2A6AA 3I8BA 1QJHA 4CZGA 3CCSN 3BGLA 1RU1A 3MMBA 2V50A 3M9OB 4DR6J 4X4RA 1ZYQA 4LBIA 1TMMA 3H4BA 2A1SA 1JLBB 2EG2A 2E4LA 4LSLA 2MQNA 2P6TA 4ILGB 2JNJA 3HRGA 1IM6A 4QIVA 3O44A 4E8UA 1BCOA 2F9TA 5KFOA 1P6TA 4F4YA 5GIPA 1AA1B 1UPPA 3H5YA 3H20A 4JAXA 3OYKA 3PHEA 4ECUA 1VLOA 2XS5A 2BJEA 1S7IA 4ZLLA 2Z1JA 3TSQA 4BVPA 2V67A 1N5YA 2XRIA 3TJAA 1C1CB 4DSIA 2W4PA 2HPUA 3MCSA 2G8KA 1H2TZ 2CPHA 1H7WA 4ZCMA 1NGGA 3JQMA 3K5LA 1HYSB 3F9MA 1R8PA 1BWVA 1VISA 2E7VA 3GFYA 3EO3A 4P2FA 4K5SA 5AZJB 3P45B 4ED6A 2XMTA 3PIPL 3DLJA 4USKA 2GWJA 2GVDA 1W2IA 3RBXA 3OYDA 2X1FA 1ZA1B 3R3LA 2G2YA 1NU4A 1X9JA 2RPIA 3DOLA 3RBDA 2AT1B 3DHWC 3L2RA 2PMHA 1FHTA 4W5RA 2JRSA 1K8KA 2A6MA 1VBZA 3Q83A 3A5NC 5DG8A 1UVJA 5HAOA 1NSQA 5AXLA 1IN0A 2W2OP 3AVLA 1HI0P 1IVZA 1HBNA 3S8SA 3SZ2A 2EG1A 8AT1B 2F8MA 4KFBB 1RTIB 4EZ9A 3C6AA 2VKRA 3JTOA 3EY1A 1JJHA 2P1JA 4QS9A 4RR5A 4LF5K 1GAOA 3IS9B 1XR7A 5HOOA 1RBRA 2ZOFA 4K7QA 4JBCA 4ZP9A 5BYSA 2EFOA 2LDIA 4FW2A 4IJNA 1F2HA 4QU7A 1JK9B 2VBWA 1NDKA 3FSYA 4B1YB 3FZMA 2IA0A 3CFOA 1F3VA 5CH7B 4C9DA 3BO3A 2CPJA 4ECSA 1Q81O 2PDAA 3PFOA 3MEKA 2ZJQQ 4C8LA 4ED5A 4HTJA 3CD0A 2IS3A 4YNQA 3S9HA 5ADZA 2L9NA 4C3LA 1AW0A 2B6AA 5AQRA 2BUNA 5FDLB 1GMWA 3I56S 3W9IA 3SAHA 4NCAA 2R7SA 4XTTA 4QR0A 4IG0A 1RWNB 2G1DA 1YVFA 4P9SA 5EX3A 3UNGC 3OVAA 5SUHA 2HNYB 3DRYA 2Q36A 4P2MA 5DDQC 5F8LA 3NGSA 3HPOA 5CD4A 1R3NA 2B9EA 1SJQA 4IFVB 3FEYB 3CIPA 3DLRA 5DM6Q 2WHOA 1TL3A 4K4ZA 4PKGA 1T9XA 3JB9k 1HMVA 4LF9K 5C25A 1T3OA 4KGKA 4FWMA 3TOQA 2OPRA 3AA3A 1U2VB 3K9JA 1AB8A 1UEVA 1NWKA 1NH8A 4PWDB 2OEMA 2RUSA 2G8WA 2Y9HA 2VG5B 3SQGB 2GVZB 3FRYA 3GV8B 3RG6A 1IJEB 4DR1F 2DKOB 3NMRA 2D41A 3A4TA 2BANA 3DI6B 2QTDA 3G4SN 2PMWA 4KV8B 3O4NA 1T03A 3MWTA 4YHHJ 4OYWA 2LQBA 5HL7L 3LP2A 5HMZA 3HCXA 3BPDA 3LP1B 1MMDA 2BV3A 2JFDA 2JL9A 1I94K 4OLBA 1UWBA 2NUUG 1FNMA 1DARA 1RHKB 4PG4A 3QSYB 4G9ZA 4MLHA 1HWLA 4DU1A 4DCHA 3VWSA 3VCDA 3KTQA 3CCLN 4F3MA 2HF3A 4BGAA 1FRJA 3MPUB 3TANA 5BN9A 1GTHA 1OY6A 2OYQA 4PA1A 4FN5A 1U8SA 3IRWP 1JXLA 3OS2A 2UVVA 2LQ8A 4OYPA 4UOCA 3PSFA 4LT6A 2XYHB 5MAOA 3M7VA 4B1XB 1GLBG 1RU2A 1X9SA 3BEXA 1RI7A 1X4GA 1WN7A 4FOEA 1QDUB 2VU5A 2OIHA 2XB2D 3ULDA 2MJNA 4LF7J 4WCEQ 3R7NB 2O8CB 4O3QA 4H5RA 3HJVA 3HZGA 1NGBA 4NPOA 2QXLA 4V1Ak 1H6KX 3P96A 4BRMA 5C7PA 2IAJA 2C3YA 5RUBA 3PX0A 4NL5A 4CZKA 5D3GA 1ROFA 1XTZA 2Z56B 1FRHA 3OSNA 1Q81T 1IBKJ 4C0OC 4YOXA 2O8EA 2HG4A 1KONA 1DQAA 3CPWM 4W5TA 2ALZA 4OPHA 4IXCA 4ECRA 1C2PA 2CA9A 2XHCA 3PJWA 3S3NA 3BS9A 4CF0A 4CYUA 2W25A 2HBKA 3D7EO 3NAEA 4F4XA 2HFUA 3QBXA 4B9LA 2XI3A 2CQPA 3SCJE 3GFZA 4QWDA 2BE2A 3Q8VA 3JQJA 3ZT0A 3FFIA 1NNEA 3KWGA 4MO5A 1YITS 4PRFA 4J9OA 3ET6B 3G2XA 1NLVA 4WFYA 2UXBK 3DYAB 4JV5K 1DZ5A 8RUCA 2LQ9A 1SQEA 4NWBA 3QZ8A 1CJKA 3NP5A 4ICLB 1QE1A 1WAFA 1Q8LA 2AV5A 4JLHA 7FD1A 3H59A 4NLGA 3ZSOA 2JVRA 4P6QA 1BLUA 3MAHA 1TQLA 3OLAA 5HVGA 3VQ4A 4KPCA 3EDRB 3CPEA 3D0PA 3TA2A 4ATNA 4E98A 2IM3A 1XBWA 5KT6A 5G0RB 1O13A 2P51A 4KGXB 1Z2ZA 5GMEA 2Y0SD 1HBNB 4LFBJ 1S48A 4OV1A 3T5JA 2B8PA 1C0FA 1YWXA 3VQBA 1RBSA 2KO1A 3FBCA 4B3MJ 4NLBA 3NNAA 4F7VA 2CNKB 4RU2A 6AT1B 2H54B 4JEPA 2HHPA 5D4OA 1WSJA 3PY8A 2ZH5A 1UTAA 4OI3A 1D8ZA 1VIOA 3G8TA 1RBUA 4FO0A 1E6YA 2MZQA 1U45A 1NGJA 2FSNA 2FF6A 1IUJA 4IG3A 3BO4A 1EHWA 4FXDA 2GJIA 5C42A 2UVUA 4Y0FA 3CJ7A 5C5JA 3ATUA 3NY0A 4HUGA 2ZE2A 2AJ1A 1X5TA 3NKYA 2ILZA 4J9SA 2V63A 4OZ0A 2FHJA 4KH5A 5D4NA 4CJTA 2U2FA 2Y0BB 4LFCF 1OY8A 1N34F 2R7RA 4F67A 4WJBA 4LQ3A 2UVWA 2WSEC 3AAQA 1UWAA 1Q95G 1FVSA 3M6GA 5GIOA 2RU9A 4TSXA 2O8EB 1V6HA 3L4BC 4GY2B 5AZIA 2BW7A 3UQSA 1QVFM 4XH4A 4YB5A 1WF0A 5AJ3J 4OX8A 4DU7A 4K42A 2MSSA 1VQPN 2DGOA 3CJ5A 2WVDA 3TQEA 2A40A 4NASA 2F8HA 4YDXA 1CULB 2M88A 2IM0A 3D0GE 4OKJA 3SCXA 3I4HX 2HHVA 4Y3CA 3O9UA 1RCXB 4YHHF 4JS5A 2P9KB 5CY4A 4ANCA 3LANA 1NAQA 3PEHA 3ETMA 1S72S 3G87A 2G8IA 5I42B 4JK7A 1CXUA 2I7PA 1VSLA 1GLEG 4O8KA 1VQ8S 3O9SA 3VETA 1UP1A 3JXOA 3L09A 4GV9A 2WVCA 4KKOA 3QINA 1KQSM 3IA0A 1G15A 1RT2A 1S4EA 2AZ1A 3WNFA 1P8ZA 4URGA 4H5VA 2CH5A 4MYUA 4GC7A 2QZ8A 1S9EA 5CHCB 5DGBA 3M9MB 2DCUB 2JEJA 4B08A 2CIMA 4G1PA 1AROP 3TR5A 1VGYA 1JQGA 4JYAF 4QIWD 4ZVOB 2OPSB 2W9CB 2BA9A 1BI4B 3I87A 1NRKA 2DIVA 1RGIA 4OX6A 1K1QA 4WIIA 1LW0A 2RUGA 5BRDA 2OPPB 4LF2A 1KLMB 1SQKA 4NA3A 3VGKA 1YIJS 4DL4A 3KZBA 2DPNA 2IM2A 3FZHA 4JKDA 2NRXA 2X1BA 1K0VA 3M8ZA 2A41A 4A8YA 1KS2A 1LV5A 2M8HA 5M1FA 3TZWA 4E89A 1J53A 3HD1A 4NEYA 2HHWA 4JKEA 3ZZUA 2JVOA 2ZH9A 3TTCA 2VWBA 1SJ4P 2HURA 4ZDNA 3BYPA 4U6PA 3SPYA 2BW2A 1XHXA 5BRHA 2ZZTA 3HO1A 3LPTA 1ZBHA 1T11A 3MTJA 5I3UA 4DV6J 2HMIA 3AVCA 3R6GB 3SDEB 1ZETA 3DJCA 5M1KA 4OJRA 3D6FB 1S0MA 4IJAA 3W9JA 2IJFA 5D6GA 1SUQB 3VAIA 4NB4A 4A8OA 4QR1A 4IRCA 3QWPA 4KB0A 1NGAA 2R7WA 4WXOA 4LF7K 4OO1J 4CEZA 1HLWA 4M5JA 3QT7A 1JL2A 2V68A 3DLKA 4DR5J 1IBCB 3MD3A 4B3SF 4PY5A 4LF8F 3A2FA 3M8WA 4NYNA 3MM9A 4DV4K 3OFHA 3WEEB 4QBUA 4JI8J 3IUCA 3ISNC 1KTQA 4KI4A 2VPYB 3LAKA 2B56A 3BGRA 2M5YA 2ASJA 1XMQF 1X0PA 3BREA 2PC6A 2P9CA 5F8HA 3CGIA 4YDDB 4B9MA 5L39A 1FEHA 2NUBA 3GBTA 2N7YA 2ZJRL 2PI4A 3I5AA 4RBTA 4C1NK 1LAVA 4OHVA 3ET6A 4J91A 4CF1A 2IMOA 2M9KA 4U8VA 4WZMA 4QWAA 2VQFF 4ED1A 4H0OA 3H98A 2CADA 1WC5A 4ES2A 2X6SA 1RFQA 4JI0J 1PAEX 3N28A 1JLQB 3ZETA 4BC9A 2V8DA 3MDQA 4HHHA 2R3VA 4CI6A 1MLAA 3W2WA 4ZJLA 4AM6A 1WSRA 1Q82O 1OQ3A 3L7OA 4O3NA 2HNZA 4M63A 3AD9C 1HKCA 2HLUA 2JHEA 1LFWA 3BBBA 2ZWPA 3SJJA 4BQZA 2RU3A 2IVYA 2FF3B 3MX2A 3A3OB 1VI7A 2QL9B 2A3ZA 4LF8K 3H2UB 3MN5A 3DI6A 2M7SA 2VG6A 2XY7A 3NCRA 2F3JA 3IBCB 2XTJP 2XYGB 4CK3A 1WOSA 2K7KA 3M2RB 3RAXA 2PO4A 2X3DA 2UUBK 1YBAA 4BRDA 2NZCA 1J5EK 3SJHA 2Z0GA 2VC0A 8ATCB 3QAEA 4NLCA 5C2FA 2PE8A 2UZAA 4OZLA 3SQ1A 5M1OA 2BE2B 1NJXA 4LR7A 1ITGA 3NBPB 3C15A 3LWMA 5IT9Y 1S1TB 2B8QA 1C1AA 3TEGA 4B3TF 4DZ6A 2J76E 4CYUB 4KHUA 5C2GA 4RW9B 3Q8QB 2AZ3A 3TP2A 2QEXS 4FWQA 4S0MA 3MMVA 1N5YB 1OY9A 3O5TB 4MTPA 2CGLA 2E1PA 3E01A 3U7JA 5B7WA 4KO0A 5E26A 4NI2B 1SV5A 1T9VA 5A0YB 4AL5A 4YY3K 2F4FA 1VQ5S 3KWMA 3M8RA 4FXWA 2B4VA 4CIGA 1Y11A 3CJRA 2XZDB 5LJ3Y 3UFCX 2Q0RA 2IOCA 5FPDA 1R31A 2EVZA 3GWCA 4M5MA 5DK5A 2HRUA 3HOSA 2HAIA 1FTRA 3MMAB 4U67Q 4UUXA 3ZSRA 2WC9A 2VBZA 4PQUA 1KEKA 1S6OA 1UETA 1S7HA 2D0PA 4ZPTR 4HCCA 3ZTOA 2UUBF 4OI1A 2YKPA 3KK3B 1FNXH 1Q86T 2XM3A 3U6FA 1M5PC 1T6DA 4BDYA 2QV6A 5A76A 2VJUA 3VQCA 4BR5A 2MQQA 2HFNA 3HHLA 3FCVA 1U1QA 5KPZA 1GXTA 1U02A 2I5JA 1TUVA 1J9AA 1U1RA 1QQCA 2BJ7A 4FLWA 2XS7A 4CEFA 1NHKL 4RW7B 4KAIA 4DPYA 1DJ0A 1OH6A 2F8SA 4WQ4A 1ZM4A 2KHCA 4TU7A 4WF9Q 2E9ZA 5EDWA 4ZA1A 2ASLA 3L7PA 1J6ZA 1UL3A 3U1LA 1RB0A 4QS8A 4V19X 1PYOB 1VK8A 4IDHA 2WCXA 5K8NA 4DV5K 3OPKA 4B9QA 4JUZA 4B1ZA 4I4BA 2F8EX 1RBTA 3CF5L 5AQLA 3VAJA 2EKYA 3L3CA 4PG6A 5KI6A 4KREA 5AXMA 3D2FB 1RADB 2J0WA 4QS7A 3ZSWA 5JLHA 4CO2A 2IJNA 2KFNA 1S1XB 2Z1HA 3CVKA 3SCIE 2LU2A 3THYA 3FGUA 4KTQA 4DTSA 4FZVA 3IR7B 2IVFB 3BKFA 4DV5F 3ITHA 4IWVA 1U1PA 2YPZA 3RMCA 3VQTA 2O01C 1Y10A 1GQEA 1WC4A 3NH0A 5BXIA 2ZNZA 5D0EA 3CFPA 4PKIA 4LF9F 3IXQA 4GVLA 3S7RA 2BJ1A 2KZMA 1TFYA 1GOAA 5K5MA 2ITGA 3UPFA 1WC6A 2P9GA 2AGOA 1AFJA 3QFPA 4JI4K 1ZBSA 2AIRB 4K8XA 4OYMA 4KBIA 4HHTA 3J81O 3CJBA 4CJQA 4X4VA 2RVJA 3EWGA 4G6VB 4ZMMA 1KVIA 4JKHA 3QYYA 4Z37A 4A8SA 1TK5A 4C23A 4KHWA 3HF5A 4TKTA 4GMJB 4B9VA 3CTRA 2XMJA 2BQRA 1WKKA 2DJWA 4PXEA 3P5JA 1HNWJ 4LSNB 5AQZA 4JKCA 4EHTA 4J9UE 1L3KA 1BGXT 2YKMB 3W0LA 4X66K 3MR7A 1RQ0A 4JI3J 3RR7A 4N77A 4FJKA 1KVBA 1LW0B 4QW8A 2W9BA 4LRCA 1X3MA 4LF6J 2XNQA 1W9HA 2ADCA 1NGDA 2G8VA 1OS5A 2WBMA 3OTBA 1HHTP 3O6WA 1LWFA 4KC5A 1EARA 4DSLA 4MK8A 3GIMA 3Q2TC 3TAMA 2LXUA 3H0PA 5IQQA 1OSCA 4LF4J 3VF2A 4H4MB 3FR0A 2LA4A 3R5GA 4BCAA 2FZGB 2QWRA 5E3AA 4ZVGA 3O4WA 2OTLS 1TUGB 3N6LA 3G82B 2NXJA 4KFBA 2DEIA 3TABA 5EVZA 2DXEA 2WBRA 2EPIA 4FWLA 3OYGA 2FC8A 1FDBA 5J2MB 4E7JA 3H3OB 3HBTA 3MM9B 3G82A 2P9UB 1J5EJ 3C95A 3D3CJ 2P5OA 4CNZA 1NBWA 2EX3A 3ISND 3LUYA 1AZSB 3CCJN 5C25B 4Z4HA 2E6LA 3TI0A 5JXSA 5MLCV 2QLWA 1VQ9S 2HNDA 4NZ6A 2FGOA 4WFAL 3IDHA 2KXFA 1R43A 3JSBA 3MMBB 4K4WA 4WXWA 4K5RA 3LA0A 2E1CA 4CZLA 4PXCA 4O3SA 4WE1B 1XMBA 2J8AA 1VHIA 1GOCA 3AD8C 2GELA 1U24A 2DHSA 2AJ4A 4F4KA 3P39A 1BUPA 3MGJA 3BM7A 1FK9A 4AQYF 3V6JA 3RRGA 2L9WA 2E1AA 1X0FA 3SIPB 3KG4A 2J6SA 1P9QC 3C15B 3LDOA 1BI4A 3MEEB 1RHUB 3HVRA 3QESA 1SZ2A 2MZTA 5B0AA 4ED3A 1S9FA 1MN7A 4LRAA 4ZVQB 1K73T 3HFVA 1H98A 3V4IB 4PABA 3VA0A 1D09B 4USHA 2WONB 2Q1LA 5KT7A 1WF1A 3O80A 2ZNYA 5GADI 3D2EA 1SC3B 4LY7A 4CO3A 4FF3A 2Y1JA 3TWHA 1RP5A 1LWFB 3TX8A 1H74A 5IC6B 2NLWA 2IDEA 4IO8A 4LF4K 4YB6A 1EZZB 3ZX3A 2C28A 1Y5LB 4DU4A 2ZZMA 2ASPA 3KJFB 2OZSA 2VFTA 1XNQJ 1RYSA 3LWLA 4HDGA 5IV4A 3LGMA 3RU0A 3G25A 4Z4FA 3ISZA 4Z4GA 3TJ9A 4X4SA 1F0XA 4M5NA 2MQPA 1YTUA 4WK3A 3U9DA 4CT9A 3CM5A 1ASVA 4CF8A 3IN5A 3V5RA 2G2ZA 1L3UA 1QS4A 2YQ1A 3KMSA 3SDEA 4FJGA 3K8VA 4Z7YA 4WK1A 1Z26A 1HWKA 5L1JA 2XO7A 1Y5IB 3MM7B 3CJQA 4B3TJ 4BG9A 4FCYA 1X4HA 2LKZA 2HWTA 4CD1A 3WXJA 3U27A 3PHTA 2HW3A 2R7QA 4DFKA 1E3MA 3N5BA 2MB0B 4WKRA 3A0IX 4AQYK 4I2PB 3TQ1A 3G96A 3OS1A 3OW2R 3A12A 1F5BA 3EXCX 1ZPWX 3HM9A 2YH1A 4QWEA 1XERA 4KR0B 3C6TB 4EYIB 1YJ7A 2A1BA 2LCWA 1QTMA 3SBTA 2F40A 1X8DA 4BRPA 4EP5A 4ZVEA 3ILIA 3CJSA 4L72B 2QG9B 1VRTA 5AQHA 2E5LJ 1YDLA 2CGKA 3WDOA 2K1RB 2R8JA 4GVBA 4DSFA 2H5IB 2VQEJ 3AODA 1TV6A 4Z94A 1Q53A 2GGPA 2GO9A 2IJRA 3EE9A 2C2NA 1V3RA 4BGBA 1KAXA 2QYCA 1WDTA 4NA2A 2WONA 5BRFA 4DBQA 4W92B 5GMKa 4DV2K 3M6VA 2IVOA 1YZ6A 1U49A 1EETB 3P5BP 2HMPA 5GADU 2QSWA 2IBOA 5A8WB 3LTOA 4O4RA 3T1HF 2R4FA 3R7BB 2YX4A 2CJKA 3MEGA 5FPMA 2HQIA 4DX8H 1C1CA 1X5OA 3CM6A 1SH2A 2IBKA 5AJ3F 3QT8A 2FHJD 1N34K 3K57A 3NCPA 1BHNA 4ZITA 5CZ2A 1MN9A 3CG7A 5J2PA 1CBKA 2CPZA 1Q86O 3MX5A 4YDUC 1NM2A 5DRKA 3BB5A 1U1NA 1ATSA 3IM8A 3NGUA 2WB4A 2GMHA 2RQKA 5KRTA 1QSLA 4K50A 2R7XA 4LFBK 3VPZA 1HARA 5HQ8A 4KH1B 4ECQA 1HBOA 4WFXA 4QW9A 4UT4A 3LM2A 5TKWA 3RB6A 1VQSA 2IFXA 1KFDA 3D2FA 2UUAJ 2W1BA 5D77A 3L0QA 2UV8G 4BACA 2AYBA 3J7A1 3Q23A 3O3LA 4E1JA 4KHQA 3OYJA 3A8EA 4DV0J 4ID1A 4I9LA 1F5CA 2OD6A 3M1FA 4N76A 2P9KA 1BD6A 3RMAA 2HAFA 3NWGA 1DTQB 4A61A 4Q43A 3C14B 3GSIA 3IO1A 3AVKA 5C2DA 1WACA 5CZVA 2KTQA 4XDDA 3A5OC 4JV5J 2RDDA 3BBCA 2Z2MA 1CJVB 4JKAA 3QEXA 4CLTA 2CPYA 1WD6A 3H90A 2ZZNA 3HD2A 1N32K 1LCUA 1S49A 1SBRA 3ILJA 3SLCA 4FJ7A 3ZT2A 2CQ2A 2R7UA 4FYVB 4B3SK 4JV5F 2HHTA 2A3JA 4IDKA 5AQTA 4ID5A 4UW2A 1NSAA 3W66A 3ZT3A 1RT5A 5C15A 2CVEA 4ISFA 2OO4A 3K59A 3Q8UA 1Y3JA 3NAIA 2WOMA 3H6EA 3SBGA 3I0RB 1S77D 4DS4A 4WF9L 4PXBA 4IFVA 3GU0A 1TAQA 1PJ7A 3RAQA 3Q8RB 1OQ6A 2EFQA 4DUZJ 3CNQP 4W98A 3ZX2A 2DPJA 3GTYX 4DLEA 1XNQF 5CHIA 1QVFR 4FM0A 5EWFA 2HHHF 3PYGA 4V19S 5D15A 2BACA 4ZCLA 2GJFA 1TP7A 2FD2A 5JLFA 2H9ZA 4YDUA 1UPMB 4O44B 3NOGA 4KHSA 4J2BA 1DT9A 2NYHA 2HNZB 1SB6A 1HD0A 2UU9K 3W9HA 2J6UA 4E1NA 4QWCA 3C0BA 2IYGA 4QU6A 2B9WA 3V9ZA 2YNFB 2FSJA 5AFUA 1SH3A 2O67A 4F9OA 5GAHP 1BXNA 4CHPA 2ZHOA 3P8BB 4ES1A 5FIIA 2Q66A 4CM0A 1Y4ZB 4DR7K 4GMKA 3CDBA 2FZCB 1YJ9S 3IS9A 2ZH4A 3QERA 5DETA 3J80O 3I96A 3OLBA 3NWRA 5BYRA 1DHMA 2ACYA 3KLEB 3LGNA 5GAGU 3AV9A 2HB5A 3TTDA 1FKAF 3WT0A 3I5BA 4EZ6A 2ZFHA 5HI7A 2BTFA 3BZQA 4ZVFA 2VWJA 3VQDA 4W5OA 5GVQA 2HGMA 3VZIA 2GWKA 4DV7K 1LK5A 4J5OA 4ZPWR 3CCMN 1U25A 2V4QA 1I3OB 1WF2A 4ILLA 5LSLA 3DDKA 1OYEA 2YVSA 2W7PA 4ED4A 2ZD1B 1YI2S 2KYXA 4ENOA 2OMLA 4N41A 2FBYA 4DZDA 2ASYA 5EX0A 3DOKB 2ZJPL 3AO1A 1BOTO 3H08A 4LF6K 4PG5A 1JX4A 1U1KA 4RNOA 3D1HA 3DXMB 1N8RO 2DR9A 4DR1J 1CC8A 3EZWA 2XLIA 2FLPA 5AQVA 1R89A 2CPFA 3AOBA 4LRBA 4ZHRA 5AZJA 5HSPA 4I6YA 1VQOS 3FRZA 4K2XA 4G1IA 3HVWA 1NNDA 4NZ7A 2AYMA 4KAZA 1RT7B 3AOCA 4PG8A 1WNEA 5I42A 3AVIA 2O8BB 2WTUA 3HHLC 5BR9A 3F73A 3JYTB 4UY8O 3D0HE 3MMCB 2P9PB 2HIYA 2HS3A 3FEZA 4HI2A 5E33A 2E9RX 3I4PA 2W2NP 3M2UA 1R6VA 4IR9A 2H48B 4EGLA 1CLFA 5KGWA 2LEPA 3VEWA 4R79A 1NDLA 2UU9J 4KIAA 3L9ZA 3IWLA 1RT4B 2FIUA 4I6WA 3AGKA 2W4DA 4TNOA 3JSYA 2QJ3A 4ED7A 3OYMA 1JLBA 2MKIA 3SI8A 3IM9A 2XI2A 3QIPA 2HHHK 2FPHX 1HR0K 5CA5A 4OJ3A 2CJQA 3PM9A 3SI6A 4Y6IA 4WKYA 1M5OC 1SI9A 3TWZA 1NB2A 2B0GA 2ZDOA 3SK3A 2W2PP 1EJ7L 4MIAA 4Z7CA 1CPZA 2E2QA 2DHHA 3A3PB 1M5KC 4CT8A 2C1EB 3E9LA 2QX0A 2G4BA 4MK7A 4DTUA 5DG7A 2A10A 3IMQJ 2PN6A 4ZP8A 4YS2A 2QFJA 2D0OA 3G6YA 1HI8A 3MR6A 4JK8A 3PTWA 4CK1A 1WTBA 4CF2A 1I94J 1IKXB 4CHZA 2H4YB 3PKMA 1E6YB 3NLCA 1FE4A 1WSIA 4FYDA 4KE5A 4LF7F 1KAZA 1RKIA 3ZT1A 2LXFA 1T3VA 1PGZA 4UZBA 4R25A 3UNYA 3NMUA 1T44A 4CJSA 2GMLA 1RLCL 2ASMA 4DOZA 3OYIA 2V0NA 4FSVA 2IIHA 2OZMA 1REGX 1HI1A 1IBMK 2WZ1A 2C3MA 2OGUA 2J7KA 2NZTA 1N33F 3FMWA 2GQCA 4LFCK 2YWGA 5FD1A 5K8OA 3AQPA 4DJBA 2YWFA 3GJTB 3VAKA 3T5KA 3QEWA 5J1EB 1FRLA 2X7IA 4ZN1A 2UXBF 4H0TB 3NCQA 3AXMA 3TVYA 2ZE2B 3G10A 2NQPA 5ADXA 4DCOB 1K47A 1RCHA 4B3RK 3CCJS 4CJFA 1XNRF 3L2QA 3CJ8A 2NRVA 1M1HA 4K4VA 3MMJA 3BGOP 1RT7A 1GX6A 3GV5B 1CZ9A 1RA7A 1U1OA 4X64K 2CYYA 2LU1A 1N32J 5SWMA 4OX9K 1KVKA 4B3TK 1DKGD 4IH5A 3HHLD 3RSEA 3H5XA 3C6UA 2HSEB 1NB7A 4H03B 2AX0A 4ZVRB 1HHSA 4DQPA 3DLHA 2DNYA 2QWMA 1FRMA 4X4TA 3AA2A 1E6VB 2MKSA 1R59O 4LBPA 2OUGA 3QLHB 2OTLN 1IH7A 4BC5A 1URRA 3EKUA 3NF9A 4AHCA 4R5PB 3W2WB 3O08A 4ZP7A 3KKRA 1XMQK 1P90A 1NDCA 3SSSA 2APOA 3W2VA 2HBRB 3PCOB 4CGHA 2B51A 2D3ZA 5H9EJ 2YHWA 3TJ8A 4CLWA 3D5MA 2HLTA 3OR1B 2QA2A 2V94A 3V4MA 2G1HA 1RT1B 1REVA 2QTWA 4Q0BB 3FQKA 2PIIA 4LC9B 3V9SA 1YHQS 4F04B 3M6XA 3QWUA 1XN9A 2F9JA 3P4IA 4FF2A 1VCTA 4CJVA 2ATQA 1K1SA 3C16B 3UN5A 3OR1A 5F9LA 2YX6A 2WSCC 1LAWA 1JLAB 4WQ5A 1PO6A 5BREA 1NSKL 3PJ9A 4FJMA 3ELHA 2C2OB 1NM1A 2DNGA 4NLVA 3C65A 2HVHA 5J1PA 3MURP 4C11A 5K8PA 1YLXA 1NOYA 3IRXB 4JI4F 2FBVA 4OHWA 4AHTA 1YTYA 2GX8A 3I5CA 4M5KA 4I1TA 4K4UA 3THWA 4BRHA 3BYRA 2FB0A 5D0GA 1UVKA 2HBJA 1SCJB 3OFEA 3O9RA 1GMVA 2KRRA 3BN7A 2D0AA 4YB1P 3OHAA 1BQNA 2GVDB 3TZZA 4DSKA 1IJJA 2V4JB 2W41A 4TYBA 1NMEB 2YKQA 4NLUA 1U1LA 1TAUA 3TR8A 1HNZJ 4C98A 2K06A 1OH7A 3AVHA 4CIFA 5LMNF 4X84A 1VSHA 1U6ZA 4HI1A 2GAHC 4DHVA 3OXGA 4B9NA 4DV1J 3T1AA 2AJFE 2HF4A 1WSEA 3V9UA 3FFIB 4DXLA 5IM0B 1RWOB 1DQ9A 3RTVA 3ZZPA 1TL5A 1U2VA 3C19A 3VGLA 4BC3A 1SJ1A 3DXSX 1NKEA 2DYAA 2W7OA 4DV5J 4JHDA 4WYLA 1VRUA 2V8GA 2EC0A 3HHDA 4IOAQ 1XNRJ 2HGLA 3EKSA 3TU5A 2KHDA 3VAHA 2PFDA 1PKUA 4QQBA 3O5BA 1SQGA 2C3OA 3VAGA 4X64F 4DV0K 2KVIA 4U9RA 1KFSA 2NUHA 1YG0A 4WIQA 5L1KA 4H8KA 3BDEA 3MPWA 1U09A 3FFKB 2ZJRQ 4OGEA 3D6HB 2C2KB 1UJ6A 2PGCA 3PX4A 4LIWA 2HKEA 4CP5A 3GG0A 4HVJA 4NXNK 5CZXA 5AT1B 3WNHA 3E01B 1VSMA 3LP3A 4IO9L 4FW1A 5CD4H 5HMYA 2LSNA 4UOFA 3RB3A 1S9GA 4TY8B 4RKUC 2MQLA 1CQMA 2QFIA 1TK8A 2X78A 1Q8BA 1RBOB 3UD3P 1Z4UA 2P9UA 3VEVA 3O2IA 1U4BA 2F96A 4JI3K 1HL6A 3N4PA 3R5BA 3AJDA 1S59A 3L2VA 4JI6K 4MFBA 3OHBA 3MMCA 4OKEA 1RJJA 2QLXA 1T6CA 4JI5K 4NLTA 3FCHA 1BU6O 4UQTA 5BPNA 1QE1B 3THPA 3CE8A 4Q2MA 5L9XA 2RN2A 4K25A 4FJIA 4J9QA 3T1YK 3S01A 4P7TA 2RRNA 1XMOJ 4A47A 3LPUA 4H54A 1TUWA 2DXDA 5HROA 5CYQB 3B4DA 1DAXA 3NFAA 1D5AA 1H73A 2MLYA 4E7IA 1MU2B 2KZZA 3V81B 3SQGA 2LVWA 5ETTA 2I38A 1NOZA 1VQ5N 2CG4A 4U7UK 4U67L 4F8RA 3H8YA 1M1KT 2F7TA 2QGFB 1XQSC 1FESA 1JCEA 3NDKA 4I2PA 2JJ4D 5E7OB 2GHWA 4H0PA 1BA0A 2QWOA 3ENWA 2DGVA 2CG8A 4MDBA 2JOQA 2NLXA 3BR9A 3QNOA 5K20B 4LJMA 5E3CA 1SQFA 3NVMA 2DH8A 3LH2S 1C0GA 1XK8A 4DV4J 2YHYA 4ZVHA 3AB4B 4X62K 3JAMU 1NK0A 1QVGR 4USWA 3RGIA 3W5ZA 2W7AA 4FVUA 3BZCA 3T6JA 3IGVA 2M4MA 3GMGA 1NSPA 3TEHB 2ZQBA 5AQNA 1QAIA 1PYTA 3K9KA 4O4GB 1R8AA 1X31C 4OX9J 3CCWA 2POKA 4DQIA 2P9NA 4C8NA 1NKBA 4FL9A 2HBYB 2JGUA 5FLXU 3SSQA 3K2PA 1VIXA 2MKJA 4BRKA 1GOBA 3KLHB 3EMTA 5THWA 4HUEA 1WOOA 3OFGA 5AQIA 1MWKA 3M5RA 5ETOA 3LL3A 5KG2A 2DB1A 2UXDJ 4DV0F 4X62F 4OJ1A 1AFIA 1B4SA 4OZ3A 4NZ0A 5LL6Z 1J2VA 1EAYC 4A8WA 3TAGA 1R0CB 2VODA 1S1UB 1X5SA 1KWMA 1BDGA 4B1UB 2R2UA 2W6LA 2MKYA 3NF7A 1S72N 1P9YA 4WP9A 1ZM9A 3UD4P 2OSQA 1F21A 3TVZA 2BQUA 3CJKA 3ADAC 2P9SA 5H9EK 1KP6A 3M30A 1C0MA 4DV7F 4DR2J 1SC1B 3V9XA 4ER8A 4KRFA 3OJSA 1X60A 2R42A 5J2MA 4FKXA 1LKZA 4C48A 2ZM6K 2P9LB 3AARA 3J7YI 3KJQB 1JWWA 3EVWA 3G8QA 2UUWA 4YMEA 1VQKN 1HQEB 3FUYA 4TU8A 4H4KA 5E5NA 3NXZA 2IY5B 3QMLA 4O3PA 5M1PA 3B54A 4F0MA 4ID5B 5KAKA 2AYGA 1Q4RA 2PYJA 2ZH7A 3JSMA 4J90A 5KFCA 1BQMA 3ZZOA 3E66A 2JZ5A 4L3NA 1KSPA 4Z4CA 2DTUA 4O3RA 4IKFA 2AF6A 1VK0A 2HHXA 3MAAA 1S10A 1RBAA 5EN1A 3NNHA 1EXQA 2HHHJ 4OHYA 5B08A 1XWLA 3I32A 3CO9A 1U48A 1X4AA 1OO0B 2AMCB 2IA6A 3I82A 3ENHA 3GCXP 2J0QD 4CHYA 3ILOA 1KTVA 3WZ0A 1RWVB 1S0NA 3R9PA 4A8FA 4C3MA 4JKBA 3CXCM 3HI9A 1FVQA 4DV1K 2R9LA 4CJRA 2OPQA 4OGCA 4DL7A 3TNVA 1RYRA 4IFYB 4OMFG 3ZXWA 4DV2J 2BABA 5EUHA 2XMAA 2ASDA 1C0UA 1YIJN 1NU0A 1H3DA 4ZJQA 4ZHRB 4HWIA 1LWCA 5IWAF 5FPEA 2B5JB 3W3SA 2IMWP 3VGSA 3H3NO 3J8AA 3KXDA 1NGFA 3OBIA 1GLLO 1QLNA 3FDSA 3GE1A 4BLGA 1L5UA 3W3DA 3H42A 4B1VA 1YKWA 4ZVPB 5C24B 2ZBRA 3HKWA 4JB8B 3G6VA 2G0CA 2MDAA 3HJFA 2YX1A 3QAUA 4F0HA 3N6MA 3MWBA 2I9SA 4QOZB 2OPRB 3DGPB 1ELOA 3O6QA 2OD4A 3BH7B 2OPQB 3O1LA 1WUAA 2J0SD 3V6KA 1HQEA 5C10A 3P83D 1DURA 5DDOC 5LM7E 4OZ2A 1X4CA 3EGNA 4GC6A 1YITN 1PJ5A 1HWJA 3VQ5A 1VBKA 2KL8A 2WTFA 1B7FA 1JLEB 4I7FA 3B6PA 4Z0UA 3G6XA 3K0SA 2FHMA 5B0FA 2MKCA 1GMUA 1RT3B 5KGXA 3SUNA 4ZCIA 1QAJA 3E2EA 3PIPQ 3KG1A 3NMAA 1LW2A 5KRSA 3C6TA 3X1LB 3D28A 3D2WA 1BO5O 3KHHA 2CWXA 2XY6A 4N56A 3ZTQA 2YNFA 1CJUA 1VQPS 2BRLA 1SL1A 1T05A 2R7OA 3IRXA 1GLJO 4JS4A 3T69A 1HNVA 2GJ2A 2FJWA 1T9WA 4CJ3A 3P49B 3EXYA 4YUDA 2NYIA 2PI5A 1CZAN 1F9FA 3LALA 1BQXA 5KOWA 5KFHA 1B64A 4FJLA 4KHMA 3R9LA 5DG9A 5CE3A 3QNNA 3T1HJ 1W7WA 3CDEA 3O3FA 1BY9A 1TTHB 1T9YA 3KUHA 4AF1A 3NOCA 5CYMB 1RTDA 2ATCB 4CJUA 5B0EA 4JNEA 2ZHAA 5HJYA 4GKKF 4GO5X 3KLFA 1VC0A 1LXJA 2CQHA 5GINA 4WYBA 1VQ7N 2FY8A 3IAM9 3T7ZA 3LP0B 2EW9A 3LF0A 2PA8D 3K17A 4CE9A 1S6PB 3KD1E 2CPIA 2W9CA 4FDFA 4K59A 4MIBA 2KRBA 3NH2A 3G4SS 2RQMA 3CJ4A 1HBUB 4AHVA 4A8MP 4CI0B 2FBXA 5KQDA 2ZUAA 3LP2B 5CYQA 3P1GA 1BISA 4WFAQ 4IOXA 3R6LB 2G13A 1RT2B 2DNQA 5ETPA 3GPAA 4RX6A 4WFNQ 3RB0A 4NYFA 3G86A 2CH6A 3GE9A 1CJKB 4ICLA 1Q79A 2OANA 5E2QA 1D1UA 1CJTA 2RQ4A 4FF1A 5I3UB 2J7WA 2L9DA 4NXMJ 3BEGB 1SIZA 2H51B 3CIMA 2FC0A 2Q1NA 4Q8EA 4U7UD 4RL1A 4MAKA 3ZTSA 3RW7A 5IZHA 1Q82T 2CJYB 2MZ1A 2KLAA 1FWKA 4CRJA 5K9FA 3CSKA 2C42A 2ZH1A 3QNWB 1IKYA 4NEZA 4CO4A 3SQ2A 3SMZA 5E0OA 2LA6A 2Q0UA 5LMUJ 4DL0C 1YRXA 2G8HA 4FK2A 3I56N 1V3ZA 3JTPA 4LF6F 4YY3J 2I7NA 4JD2A 1RGVA 1WNSA 2XLKA 2NRHA 4KY3A 5F8MA 3K0JA 2Q43A 1CSJA