4H4OA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
total genus 141
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4oA05
1WSJA 3L2WA 3AVGA 4DU3A 3AVHA 1J53A 4UQGA 3BREA 2UUTA 4DU1A 2E6LA 5KFCA 4ELVA 2AWZA 2ASDA 4B9MA 2YKMB 4FBUA 3DMJB 1CXQA 3KD1E 4RNNA 1TP7A 5DGBA 1T94A 1EXQA 4FLZA 1JL1A 3E01A 2XGQA 4ZVHA 3CM5A 3S3MA 3WNEA 2E9TA 2ATQA 2UVUA 3HPOA 5F8GA 5HRSA 2B6AA 3MR5A 3KTQA 4ZP6A 1WSIA 2RDIA 4IBNA 2YNFA 1QE1A 4CGJA 2A1RA 3VQAA 2A1SA 1HJRA 1IH7A 3AV9A 2JGUA 2VG5B 4DL7A 2ASLA 3C6TB 5CYQA 2IDOA 2WB4A 4BWMA 1C1CB 2F8SA 3NAHA 1ZBIA 1LW0B 1IO2A 1RT3A 4YQWA 4KKOA 3LDSA 3M8QA 1JLFB 3HVRA 3NH0A 3U3GA 4ZTFA 4W5TA 3OYJA 3OYKA 4L8RB 3OYCA 4E19A 4OKEA 1WNSA 1RTIA 3UQSA 1RDDA 3EZUA 3VQPA 1KHWA 3L3VA 4I9QA 5KG0A 5DG8A 2QKKA 2WHOA 2WTFA 2B43A 3LWMA 3OYLA 4E7KA 4N5SA 2HWHA 3VQDA 4JRPA 3AA4A 3NGYA 1CSJA 3SQ1A 1GOAA 3G6VA 4TN2A 3OL8A 1SKSA 5HRPA 4HKQA 2C2RA 4X2BA 4FJ5A 3QIDA 3MR6A 3K57A 1JIHA 4KHQA 3IS9A 2VG7B 4QWCA 4J9RA 4KKOB 4DSIA 3QLHA 4CEQA 4EP5A 2C2EA 4CK2A 3DLKB 1BCOA 2YNFB 2WONA 2E9RX 1K1SA 3JYTB 3RB4A 2BQRA 5FRMA 4NRTA 1J9AA 4AH9A 1GX5A 1T03B 5EU7A 3PW2A 4GC6A 4QCLA 4DQIA 3MR2A 4I2QA 1ZTTA 1LWEB 3DYAB 4AILC 1C0UB 3ISND 4DTSA 4YR3A 1SUQB 5L1JA 1UWBA 1R0AA 4CHZA 2V9WA 3ZSXA 5SZTA 1U4BA 4FJGA 3QEIA 3CDEA 4M3RA 1S5JA 4NLGA 3P83D 4DMNA 4DG1A 4M3YA 1RILA 2G8WA 4ICLA 2IM0A 3Q8SB 4ECTA 4DL6A 1D5AA 2Y1IA 3GIIA 1KFDA 2IJFA 3KK1A 3ZT3A 4FZZA 3LP0A 3NHGA 5HBMB 2OH2A 4WZMA 5C5JA 1S4FA 4CE9A 3B6OA 3QEPA 1KRPA 1X9SA 2W42A 4MKAA 3TAFA 1J5OA 1JLQA 3N6NA 4O3PA 3PR4A 4R8UA 3OYDA 3KKRA 1YT3A 4KTWA 4KHUA 1WSHA 4ID1A 5KRTA 2QK9A 4KFBA 4Q5VA 4B8CA 2IM3A 3NAIA 3LP1A 3LAMA 1S6QA 1DTTB 1RT2B 1T3NA 4Q8FA 4B08A 4IFYB 1KVBA 5L9XA 4DTUA 1U45A 5DG9A 3KMSA 2IS3A 1QTMA 4FM2A 3KLGA 5KFSA 3VA0A 3EYZA 1EKEA 3QEWA 5HP1A 4B9UA 2W9CB 4KB7A 4ED6A 4JV2A 4CF9A 2O4GA 1YVFA 1U04A 1VSMA 5DLGA 3DRRB 4CJUA 4HHTA 1FK9B 1S1TB 5J2QB 3NF7A 4E3SA 2D3ZA 4MIAA 1N48A 3VQCA 5DGAA 5J2MB 3AVNA 3HHKA 1IKWA 3MF5A 3PY8A 3MEEA 5I42B 1RYRA 4FZXC 3OYEA 2AX1A 3KJVB 5J2QA 1JLAB 1HYZA 2XCPA 4YR2A 1QUVA 1BQNA 1WLJA 2I5JA 1RT7B 1IKWB 4E7IA 4F4WA 2XY6A 5KFQA 2V4RA 4FXDA 2D0AA 4KHNA 4K50A 1QSSA 1TGOA 4O44A 2P5OA 5J2NA 2KZMA 2GC8A 5I3UB 4BDPA 1VK0A 3QNNA 4H4OB 4F2SA 4WXWA 3V6HA 3VQ9A 1W25A 1S1XA 4IH6A 2HHXA 2BDPA 1X9MA 2XWYA 4K4VA 2EX3A 4B3OB 3KLIB 1K6YA 2G8KA 1TL3B 3JSMA 3M8RA 3DLEA 2G8UA 3ZT4A 3GIKA 4E7JA 5DQGA 3H5YA 4EBDA 4RUCA 3MFIA 5KG1A 1RTDB 2Z1GA 5HLFA 4B8AB 1JLGB 4H4MA 1C1AA 4O44B 2XI3A 2O5DA 5CZ2A 3V9XA 3MECA 4TLRA 4OGEA 4ELUA 4J9QA 5I3UA 3KLEB 4Y1DA 4NLVA 4CJVA 4ID5A 4CF8A 3TANA 3OYHA 5C42A 1YTAA 1N5YB 3V9SA 2IA6A 2FJVA 2W7OA 4OVLA 3HM9A 3QEVA 1RBVA 3AA5X 5KGXA 4JV1A 3LZIA 3NCIA 4KO0A 4IDKB 4LH4A 3EZ5A 3LPTA 5DG7A 3SUPA 3GV5B 4FJ7A 3G86A 4CFCA 1OS5A 1TK0A 2BRLA 3NL0A 1RA6A 1ZBFA 4TY8A 3VN5A 2YKNA 4PUOB 5CY4A 2ZD1B 3CFPA 4DF4A 1X1PA 3DRPB 2V0NA 3NGIA 5E41A 2C28A 2F8TA 4FVMA 2DFHA 1UOCA 2XHBA 1FK9A 1S1TA 3H08A 3HSTB 3ALYA 4EO8A 2ALZA 4DSEA 3P5JA 3LPUA 2FJWA 1U09A 4RNHA 3BSOA 2GUIA 4TQSA 4IFYA 4FLTA 4CJ4A 3QIPA 5JUMA 4I9LA 4YNQA 5KFTA 2B4JA 3V9WA 4K8ZA 2W8LA 4R0EA 2R2RA 1N6QA 4K4YA 3KHHA 1BQMA 3I5AA 3RB3A 3RRHA 1Z25A 3D5MA 4ECVA 4I2QB 1VSDA 2HHWA 3L2QA 2OPRA 4KHMA 2YNGB 1D9DA 4EYIB 3DM2B 2IM2A 1RTIB 1DTTA 1R0AB 4WFYA 3V6JA 4DTPA 1XWLA 3H4BA 2IJNA 4E1MA 2OPPA 1S6PA 2OPRB 4F2RA 3V9UA 1CLQA 4F3TA 2AU0A 3OYIA 4ECUA 2GV9A 3ZSVA 4O3QA 3AO2A 4K4WA 2JLEA 3I5CA 4G1QA 3OHAA 1GOCA 3OLAA 3ISNC 4R5PB 3D28A 1C6VA 3HPHA 3QESA 4CJRA 3KLIA 1XHXA 2XRIA 4J9PA 4DTJA 1NHVA 3OYBA 2P5GA 3CM6A 4E7HA 4CESA 1TKXB 3I0RA 2RKIB 3NKYA 5KFZA 5CYQB 5JS2A 5C42B 5KFKA 4YR0A 3F9KA 1BIUA 2FLLA 3QERA 5KT5A 5FDLA 4O3RA 4PWDA 5DK5A 1JX4A 3DLRA 4HCCA 4XPCA 3P1GA 3FFIB 4I7FB 4WFZA 2KTQA 3LP1B 1RBSA 3I8DA 4PA1A 1LWCA 2ZKUA 5J2PA 4CJ3A 4CFDA 3CO9A 3QGIA 3DOKB 1ZYQA 1S9GB 3TI0A 3DLBA 3SFUA 3VA3A 4RW6B 5KT4A 3O3HA 3NF9A 4MH8A 3V4IB 4M41A 1LW0A 4NLDA 3OJSA 1IKVA 4W5QA 1S9FA 4CEEA 4IG3A 2HHUA 2IAJB 4DQQA 3AVCA 3ULDA 2WOMB 3WNFA 5C25A 1NK4A 2KW4A 2OPSB 3LWLA 2E4LA 3DRRA 4KHRA 4DQRA 3RMDA 5KFJA 3NH2A 4J2AA 4MFBB 5KFNA 3OS0A 4PQUA 4FBTA 4FM0A 1Q9YA 4HUFA 3SUOA 2CJQA 3I0SB 3HK2A 4RW7A 2Y1JA 2G8IA 3OYGA 4ZVFA 3RTVA 1JLBB 2G8FA 1ZTWA 2W8KA 4CHQA 1T7PA 3KLVA 5C24B 1C1BB 3OL6A 1BI4A 2QE5A 4TY8B 5J2NB 2VG5A 3BQ2A 4ECWA 2FBYA 2X74A 5KFVA 4N76A 4BE2A 1RT4B 4JS4A 4CJSA 4ECZA 2WCXA 1U48A 2PYJA 2R8GA 4TXSA 4NCBA 2HNZB 5J1EB 1KLMB 5CYMB 4YP3A 1NOZA 4B3OA 4Q0BA 2ZE2B 4OPKA 3TAPA 4NLTA 4MKBA 2JEJA 3HVAA 1ZBHA 4OLAA 5F8IA 3HO1A 3LAKA 2AQ4A 1O1WA 4K4TA 4M94A 3ITHA 3KLHA 1ZBLA 3BGRB 2VG6B 1REVB 1RTDA 2AGPA 3BDPA 2RF2A 4F8RA 2IC3B 1XR7A 1IKXA 4TQRA 2V4QA 2FLNA 4CEBA 1ITGA 3AO5A 4IKAA 3MTKA 3MFHA 1CZBA 4J2EA 3HPGA 3AVMA 3I0SA 4F4KA 1N6QB 1S1UB 1SL1A 3TAEA 4Y2AA 4O3OA 3V81B 1UA0A 4LH5A 4W5OA 3ASMA 4AHSA 2P1JA 4QWDA 4DS5A 4J9OA 5KT7A 3OL9A 4Q0BB 1I39A 1L3TA 4F50A 3SI6A 3CFRA 3KLFA 3AO3A 3KK2A 2GBZA 4IOBA 3CYMA 2FBVA 4QAGA 3GILA 1L3SA 4LQ3A 3CIZA 3OVNA 3FSIA 1TV6A 3NGDA 5T7BA 3RAXA 4CHOA 3KLGB 4DSLA 2QKBA 4CJWA 3UPFA 4URQU 1RBRA 3RMCA 1TKDA 3K5LA 3HP6A 5F9LA 3TAQA 2J6SA 4DFMA 3QIPB 2I5JB 4NLXA 5JXSA 3VQ7A 3U6FA 2JC1A 4CHYA 3CQ8A 3SCXA 4RW7B 3TVKA 1KVAA 5JS1A 1BCMA 1S6QB 3RR8A 2BQ3A 4KREA 4IR9A 3SFGA 4ELTA 4WYWA 2P51A 1RTHB 2WONB 3TAMB 2VA3A 3PX4A 3S9HA 5KFIA 4CK1A 3N6MA 3V6DA 1S0MA 5KFEA 3ZSQA 2IOCA 4XPEA 4IKFA 4HUGA 4LSLA 3ZSWA 4DLEA 2R8KA 1JXEA 3QIOA 5HBMA 3VQBA 1EP4A 3SQ2A 4J2DA 2BE2B 4IG3B 5KFBA 2WRMA 4OKKA 1RA7A 5CYMA 1N5YA 2X6SA 5J1EA 1NK9A 4DG1B 4ZTJA 4KHWA 2XI2A 4Z4EA 4CJQA 1S1XB 4ZHRA 4ED8A 5KG3A 3AVBA 2RKIA 2XCAA 4H4MB 4WXOA 3SPZA 1B9FA 4ECXA 5DLFA 3AO1A 4KPYA 4ED2A 1VSHA 2HNDA 5FDLB 3LANA 2RN2A 1WSEA 2YHAA 1HMVA 4J9MA 2XY5A 2XGPA 3TQ1A 4R8UB 4FS2A 2FBTA 1U49A 4FM1A 1TK5A 3K5OA 4K4XA 4IG0B 3RAQA 1T03A 3PO4A 1I3AA 4QW9A 1Q9XA 2BANA 2X78A 4B9LA 4OPJA 2HW3A 2KFZA 3OSNA 1FKPA 4C8KA 4CECA 1IG9A 4U6PA 3B6PA 3NAEA 4CJLA 5C25B 2DPJA 3FRZA 3IAYA 1SKWA 3RB6A 4O3NA 1VSIA 1HQEA 3IGNA 2OPPB 1S9GA 4FLYA 5HP1B 3PX6A 3KHRA 1SKRA 3D45A 4IRKA 3QZ8A 4ECYA 4CJTA 4M42A 4CFAA 3LALA 4KFBB 5HROB 4J9LA 4RW9A 3CWJA 3H2LA 3BQ1A 3SZ2A 3PO5A 3HYFA 4MK9A 4J9NA 4BE1A 4FJNA 1KCFA 2OPSA 4BE0A 3M8SA 3DI6A 3JYTA 3BSAA 4DFJA 5KFWA 4CK3A 5KFYA 4CIFA 3M8QB 4GMJB 1VRUA 3TABA 3TAGA 3BR9A 5DMRA 3NBPB 1HMVB 3V4IA 1C0TB 4IDKA 2RPIA 4BDZA 2HHSA 4Q8EA 1IKVB 3TAMA 4NLYA 4DL5A 2WK4A 1RBUA 2RDJA 3VQEA 5KFFA 4FJLA 4XIUA 4ZMMA 2OZMA 1HNIB 4CGHA 3VQQA 3CDWA 4QWEA 2JEIA 1S0OA 4H4OA 4LY7A 4Q43A 1LW2A 3FQKA 2D0CA 4QPXA 3AVIA 4ECRA 1JLGA 4DL2A 1S10A 3KLHB 2XY7A 4JUZA 3QGGA 3GIJA 4Z4FA 1NOYA 4ZPCA 1X9WA 4ZHRB 1MU2A 1HNVA 4CCHA 3KOAA 3HKWA 3SJJA 3SNNA 4LSLB 5F9NA 2G8HA 4JLHA 3O4QA 4IH7A 3H5SA 5KI6A 1BHLA 5KFAA 2FJXA 3PW4A 5EWFA 4I2PA 2DTUA 4FS1A 1D1UA 2J6UA 3OS1A 1S6PB 1QE1B 1JLEB 3SUQA 4URGA 3BSCA 1VRTA 2D41A 1NK7A 1JXLA 4W5RA 3HVTA 4Q44A 3JSMB 1WN7A 3CJ4A 1L3UA 4O3SA 3KLFB 3G6XA 1U47A 2ZD1A 3KKSA 3ZT0A 3CJ2A 3DM2A 3HL8A 4IR1A 1N56A 1JLCA 4E1NA 4DTXA 4TYBA 4CERA 4Q45A 4DF8A 3KHGA 2Q3SA 1HQUA 1SH2A 1G15A 4Z0UA 2JC0A 1IKXB 1TKZA 3UR0A 2E9ZA 2E6MA 4O5BA 3C6TA 4CHPA 1NK6A 2OZSA 2F96A 1IKYA 2CKWA 2HHVA 2B5JB 5FROA 2UVWA 3AVKA 1JL2A 3M9MB 1BQNB 5L1IA 3O3GA 2OPQA 3T1AA 4GC7A 4KTZA 1SH3A 4BDYA 2FC0A 4HYKA 4FK0A 2UVVA 4MK8A 5HRNA 4O4RA 2KZZA 1NKEA 4PY5A 1DTQA 3IRXA 5K14A 3PW5A 1JKHA 1D9FA 4ECSA 3C95A 3ZSZA 2C2DA 3M9NB 2W7PA 1XR6A 1T05A 1JKHB 2ZE2A 2YNHB 2HAIA 1I6JA 4ED0A 4CGIA 1HNIA 2FVPA 4LD0A 4JV0A 4NZ0A 2IGIA 4KRFA 3BJYA 4GW6A 1NHUA 4AHCA 1EETA 2R2SA 3K58A 5KG2A 5KFOA 4KV8A 3HVWA 5HRRA 5SWMA 3KK3B 3EY1A 3V9ZA 4RG8A 1JLAA 4ZVEA 1S1VA 4C8NA 2JEFA 2OYQA 1KSPA 1VSJA 4KV8B 5KFLA 3KNAA 3OJUA 4KB0A 1RTHA 3VQ8A 3V1OA 2O4IA 5L1KA 4KSEB 3K59A 4J2BA 1TVRB 3ZCMA 3DLGA 4CIEA 4N47A 3DRSB 3OHBA 1XI1A 1S1WB 1C2PA 4CGGA 3QZ7A 1TAUA 3GYNA 2Z1HA 1HRHA 3ZT1A 4M3ZA 2Z1IA 4TY9A 1NNDA 4RW9B 4QWAA 2WOMA 2VWKA 3SQ4A 4CJPA 2LSNA 4RW4A 1LWCB 4XO0A 2XC9A 5KFMA 3HVTB 4NYZA 4G3IA 3DOLB 1FKOA 1XC9A 4ED7A 1C0MA 4H8KA 4M3TA 3IN5A 2R8HA 4Y1CA 5KG5A 4CFBA 4FJXA 4CEDA 2IAJA 1LW2B 1ASVA 5KT3A 5KGWA 4M45A 3QEXA 3ZSOA 3I5BA 3RR7A 4DS4A 1GOBA 3ZSRA 4FYDA 3RWUA 2D0BA 3NF8A 2X6NA 4DEZA 2DPIA 3IG1A 4C8OA 3L2UA 4J9KA 4CF1A 1TKXA 3I0RB 4EZ9A 4ZP8A 4FCYA 3KK1B 4AHRA 3PVXA 3H98A 3IGVA 4ED3A 1RT4A 1ASUA 4KHSA 2VG6A 3Q8PB 3NBPA 4DTRA 4OKJA 4OLBA 3S3NA 3K5NA 3T5HA 2R2TA 1LAVA 3QNOA 3MR3A 1C0TA 1C1BA 3FFIA 4I7FA 1SV5A 4FJJA 3AA3A 3C6UA 3MXJA 4FLUA 4Z4GA 3VQSA 4BWJA 4FLXA 4HCBA 2HVHA 1DLOA 4WE1A 1RT7A 3ZT2A 3RRGA 3C94A 4ZPAA 3M8PB 2DFEA 3DI6B 3NH1A 4LQ9A 3GQCA 1LWEA 3DYAA 4RUAA 4JRQA 2FVQA 3T3FA 3L2RA 1RDBA 2HVIA 4G1QB 3AVAA 1JLEA 1J5OB 3GV7B 4NLUA 4IFVB 4FK2A 1TKTA 1QHTA 3NGZA 5HROA 3LP3A 3CDUA 3MEGB 5KFPA 1RTJA 1RAJA 4GVMA 1JLFA 3KJVA 3DLGB 2ITGA 4Z4IA 4QWBA 4EBEA 1RDRA 4DU4A 4B9SA 2BGGA 3OL7A 4ZVGA 2IBKA 1Z4UA 2KFNA 3PR5B 1RT6B 2HNYB 4NLWA 2IMWP 1NKCA 3IS9B 4O0JA 4KBIA 4CJ5A 1L5UA 1QSLA 3G0ZA 4DTNA 3DLKA 1VSFA 2YNGA 2D3UA 5J2PB 4PQUB 4FJMA 1KVCA 4NCGB 4AHTA 4RNFA 4CEFA 3ICLA 1HYVA 3G10A 4FLVA 1S97A 4KTQA 3LZJA 3OYNA 4EZ6A 3DMJA 1YTUA 3L3UA 3VQ6A 2HMIB 1RT1A 4RW8B 1SL2A 2YKNB 3H59A 1JLQB 1C1CA 3IG1B 1TAQA 1FKPB 1NJXA 2W9BB 4OJRA 3U3YA 3FQLA 3BQ0A 3DOKA 1KFSA 3TWHA 4EO6A 4CF2A 3NFAA 1L3VA 2DY4A 2HHQA 4FLWA 4E7LA 2VA2A 3MXIA 2DFFA 1BISA 5KFGA 3T5JA 1BGXT 4RNMA 2B5JA 1WAJA 3QGHA 1TL1B 2BR0A 3Q8RB 1BQMB 4IH5A 3GV8B 3M9OB 2EC0A 4TYAA 1K1QA 4IRCA 4OL8A 2B6AB 4FJIA 3SV3A 4FJHA 1A5XA 3S3OA 4EBCA 4RZRA 4N56A 3KHLA 3ZSYA 3L2VA 1S9EB 4HTUA 4RW4B 2GIQA 3T5LA 3NE6A 4CJEA 3V6DB 1ZETA 4DSJA 1QSYA 5EWEA 3GIMA 3NF6A 3K5MA 2YV0X 3KD5E 3OY9A 5EWGA 1RT3B 2AGOA 2Z1JA 4NYFA 1NK5A 5FRNA 1NKBA 4M3XA 3F73A 3IRXB 1RDAA 1NJWA 1TL1A 2IM1A 2AGQA 4WZQA 2W9BA 1RTJB 3N6LA 2ASJA 1WSGA 2R7YA 1LWFB 2ZQBA 4MK7A 4IG0A 3QO9A 4NLPA 2FBXA 4NLOA 3PX0A 4FK4A 5EUHA 3KLEA 3EPIA 5F8HA 1YVUA 3OSPA 4F4ZA 2QV6A 1JLCB 1S9EA 5L1LA 4LSNA 1HQUB 3PV8A 4DSKA 1D0EA 1S49A 1TKZB 1S1UA 2FVCA 4K4UA 3PJWA 3MXMA 5DQHA 3PHEA 1FXXA 1S0NA 4KI4A 3HT3A 1UWBB 4FZYA 3C6UB 3OLBA 1B9DA 4EYHB 5KTQA 3MEDA 2YKMA 3H5XA 3UIQA 1JLBA 3OS2A 1EX4A 2YNHA 4M95A 3MEEB 5I42A 4Z4CA 1W0HA 4WYLA 4ED1A 3O4NA 4O4GB 2UVRA 4DFPA 1T8EA 4FW1A 4QOZB 1F21A 5K14B 4MFBA 1ZBUA 3SV4A 1MU2B 3CG7A 1RDCA 1GX6A 1RCHA 3E51A 4O55A 2D5RA 1REVA 2HNZA 3AA2A 1NJZA 2ILYA 3QINA 3D0PA 2R8JA 3SUNA 4I2PB 4CGDA 1HPZB 3CJ0A 4CEZA 4CEAA 3V1RA 2PY5A 3HP9A 2HWIA 1W9HA 1RYSA 4CGFA 3KMQA 4YMEA 1BI4B 3LP0B 4CF0A 3OYAA 2YHBA 3ITHB 1N4LA 2ETJA 4URSA 5D3GA 3AVFA 3EPGA 1SV5B 4BACA 3THVA 1NK8A 2OA8A 4NRUA 3QYYA 1B92A 4TSXA 1A5VA 4HUEA 4NCGA 1JXBA 4DL4A 4PWDB 1TK8A 3M8PA 4F4YA 4NLRA 1VSKA 2GIRA 3RBDA 4R5PA 3DRSA 4M3WA 3PZPA 1QS4A 1NK0A 2HHTA 2HMIA 3V81A 4CJFA 1HNVB 4EEYA 3O3FA 4RNOA 3MEGA 1Y97A 4B9TA 4DTMA 4AHUA 5KRSA 2HB5A 3T19A 3OYMA 1RT5B 4F4XA 5KG6A 2IC3A 1MMLA 4ICLB 1J54A 1HYSA 1RT1B 4RW8A 3SI8A 3FDSA 4K8XA 1VSLA 3CVKA 2PZSA 1BIZA 3RMAA 2ATLA 4CIGA 4KAZA 5T14A 4K4ZA 4E89A 1KLNA 3NDKA 4MIBA 1DLOB 4WE1B 1RNHA 3AVJA 3VQ5A 2BANB 4OGCA 1TVRA 2AJQA 4DLGA 1XR5A 4Z4HA 4FW2A 4DQPA 3H40A 2FVSA 4NLSA 2BE2A 2VWJA 5F8MA 4DTOA 4O0IA 2YNIB 4B9VA 4DQSA 3L8BA 3PW0A 3VQ4A 1WAFA 5F8JA 3KK3A 3LP2B 1A5WA 4C8LA 1IKYB 1VRUB 3RB0A 2NUBA 4ZPBA 4KAIA 1Q8IA 2BRKA 4DFKA 4N41A 3QETA 4M3UA 4FJ9A 1XHZA 4KE5A 5KFXA 1UAXA 4W5NA 3PUFA 4DWIA 2HNDB 2UUWA 1D8YA 4NCAA 3MEDB 4IRDA 3AVLA 2ILZA 4CEOA 1IM4A 3Q8QB 2R8IA 2FLPA 1KHVA 4FJKA 1SUQA 1SH0A 4Y34A 4Y2CA 3CJ3A 3QLHB 2BQUA 3HJFA 2EHGA 1RT6A 2HNYA 3H4DA 3WNGA 2YNIA 1VSEA 4MQ3A 3MAQA 3NMAA 1VRTB 4DL3A 5KT6A 4KI6A 2J6TA 3CFOA 1EP4B 4RU9A 5KFRA 4IQXA 4RW6A 2PYLA 1BL3A 5KT2A 1RT5A 4B9NA 4KB1A 4IFVA 5KFDA 5KG4A 4O4GA 1QAJA 4CHNA 4H54A 3PW7A 4YFUA 1S1VB 4PUOA 1FKOB 1LAWA 4AHVA 2VG7A 3CJ5A 3RMBA 3PJXA 3KK2B 2C22A 3OYFA 2XO7A 5F8LA 1S48A 2AX0A 3SQ0A 1EETB 1RBTA 1SL0A 2I1RA 1S1WA 1ASWA 3WNHA 1LV5A 5DQIA 1C0UA 2QXFA 4LSNB 2R2UA 1HYSB 3BGRA 4JS5A 1QAIA 1QQCA 2FVRA 2KQ2A 4U7CA 3DRPA 3RBEA 4HVJA 3TARA 1T05B 4ZP9A 3V1QA 3DLHA 2JEGA 4ID5B 3BSNA 4DSFA 1KTQA 3TR8A 4Y3CA 3LP2A 5HLFB 4J9SA 1DTQB 4KO0B 3HXMA 1TKTB 4CJKA 5KFHA 5CZ1A 4C8MA 4QW8A 4E0DA 3DDKA 3T5KA 3A2FA 5D3GB 3UDLA 1UA1A 4WFXA 2D7SA 1NJYA 5F8NA 4FJ8A 1CZ9A 1Z26A 1WNEA 2F8EX 2W9CA 1WSFA 4F3OA 3AO4A 5KFUA 4NYNA 3G6YA 4NLQA 3KIOA 1HPZA 1HARA 1HQEB 4ECQA 3V6KA 4KHYA 1TL3A 3MECB 2OPQB 5KG7A 4ZPDA 3E01B 3DOLA 1RT2A 1KLMA 2G8VA 2RF2B 4EP4A 3DLEB 2XY8A 5C24A 1TQLA 5J2MA 3K2PA 1LWFA 5EDWA 3QO9B 1CXUA 4ZP7A 4K4SA 3SPYA 2W9AA 1TV6B 3SYZA 3H5UA
chains in the Genus database with same CATH superfamily
3L2WA 1V3SA 3I56S 3TX0A 1J53A 5JLHA 1SJRA 4LF4J 2LDYA 2QWNA 4DU1A 2YWFA 4N8OA 4P74A 4USMA 5KFCA 1E6VA 4LFBK 3CQXA 4B9MA 4C23A 3OFEA 1CC8A 2YKMB 1QQMA 4FBUA 1CXQA 4ALZA 2Z8QA 5M2RA 1JL1A 5T41A 1Q0NA 1RGVA 4ZVHA 3CM5A 4CZCA 3HPOA 4NYPA 3K9JA 1JQGA 4CO4A 4DUTA 2JH3A 2B6AA 2DRDA 4HDHA 5AXMA 2YNFA 4ZVOB 2RHQB 5GAHU 3RRKA 2O01C 4GRSA 4CGJA 1WWHA 1Y5IB 1IH7A 3AV9A 2VG5B 2AEMA 3C6TB 4NWBA 2IDOA 1NZ8A 2F8SA 1QZ5A 2GUPA 5AZIB 3H42A 4BREA 3ATUA 3Q83A 1RT3A 4YQWA 2G0IA 3WT0A 3NH0A 1IVZA 4G6VB 3MK6A 2YWEA 4L8RB 3OYKA 4ILRA 4OKEA 1G99A 3S1TA 1F3VA 1RTIA 2DXDA 3G25A 1FNMA 3AJ1A 2C3OA 4YB1P 5C15A 2WHOA 2CQ1A 5IM0A 5C2DA 1KAZA 3OYLA 4E7KA 2HWHA 3UKRA 3DFEA 1CSJA 3SQ1A 4TN2A 2VQEK 1SKSA 3O80A 4CO5A 3MMBA 1X7VA 3TA0A 1UFWA 2H3EB 3C14B 1JIHA 1TTHB 1TMJA 1V6HA 4CZGA 4K25A 2XO6A 3QLHA 2C2ZB 2C2EA 1OYEA 1RCXB 2E1CA 3EZOA 1BCOA 2WONA 3HI0A 2JSXA 2D0PA 2XSFA 1T03B 3WX8A 2XSJA 1Z2LA 1ZTTA 2V7YA 3CMAN 2MEWA 4KR0B 2DXEA 5L1JA 3CCUS 1R0AA 4AM6A 4CHZA 3ULHA 2ROEA 2E5LF 2ZC4A 1YAGA 5ETTA 3CDEA 1PAUB 2XMKA 5K8NA 2P2CB 4M3YA 3CT9A 4ICLA 4X4OA 2IM0A 3R27A 4K2JA 3Q8SB 1D5AA 3TZWA 3G8SA 1KFDA 3KK1A 1S6UA 2H4WB 1U1OA 3ZT3A 3LP0A 3NHGA 5C5JA 3B6OA 2RRNA 4MKAA 5ETPA 4M5MA 3TAFA 2PI5A 2JFDA 3N6NA 4O3PA 3G6EN 4K5RA 2VWBA 4YDDB 1EIYB 4FF2A 4I6AA 4RWTA 3AHPA 2JNJA 3KWGA 3OYDA 4QS9A 3O9SA 4NOHA 1N0UA 2CJAA 3I6PA 2ZM6J 4KHUA 3WBZA 2OSRA 4WKYA 4LF5J 4KFBA 4FF1A 3TEHB 3W65A 4P2SA 4DV3K 4B08A 4DV4F 1KVBA 3A13A 3KMSA 1NU0A 1B64A 1EKEA 2GEMA 2HAFA 2W9CB 4KB7A 1T9WA 2O4GA 2CPXA 2YX7A 4UY8T 1QHAA 2H5IB 2KFYA 4PG6A 2R7XA 4BRGA 3NF7A 2QYCA 3OTEA 1ZZNA 2CGLA 3KJVB 4ES3A 3FK4A 3LM2A 2ZITA 3DDIA 3HULA 3U9ZA 1E4FT 1G1XA 2I5JA 1RT7B 4E7IA 3CCVS 5A6PA 2E44A 2MGZA 2CDRB 2JVRA 2EFGA 1WI6A 5KFQA 4CO2A 3DDNA 2V4RA 4KHNA 4K50A 2VGNA 2J7UA 2R7WA 1E6VB 2VFRA 3JTNA 5B0EA 4LRAA 1RE1B 3SBTA 1RHJB 5I3UB 1NH8A 3R5GA 5ITHA 3QNNA 4H4OB 4BGAA 5LXYA 3VERA 1Y64A 2BDPA 2W4CA 1IJJA 2BH1A 1BA1A 2HFNA 1HKGA 5K5MA 2G8KA 1YJRA 1TL3B 2CNLB 2H4YB 5AJ3K 4JI4K 2YPYA 4PPZA 2VYPA 2GX9A 5AQRA 3H5YA 3CXCM 1WHYA 3ZZTA 4RUCA 3N5FA 5KG1A 7AT1B 2EFNA 1PILA 2CH5A 1JLGB 2R9LA 4H4MA 1C1AA 2XI3A 4FKYA 4L76A 4GKJK 2P9SA 4LF9J 2HBLA 3MECA 4OGEA 1Q53A 5I3UA 4XDCA 2GGPA 1YSJA 1Q81O 1GH8A 1SPBP 5IOLA 4Y1DA 3UE5A 3O6QA 1VQNS 5T7LB 3BO4A 3V9SA 3GG1A 1TZ0A 4BC3A 2W7OA 3HM9A 3AA5X 2AJ4A 2HWTA 3UWTA 1VMBA 5CCLA 2XMTA 5F0XA 3H7HB 3R9LA 1C0GA 2R42A 4IDKB 4LH4A 3FGUA 3LPTA 5AQUA 3OTOJ 1RBLA 2U1AA 3GV5B 4FJ7A 2DNZA 3G86A 3PYFA 3VOVA 2B4VA 1FRMA 1WTBA 3VN5A 5BR9A 2YKNA 4ISFA 4CI0B 4E98A 3HD1A 3GCWP 2ZD1B 3DRPB 1HLUA 1RWKB 3KDOA 2GVZB 4FVMA 5M2UA 1HR0K 4ZKAA 4FWRA 1HNZF 2LQBA 4DX7A 2DFHA 4JI5J 1FK9A 3HSTB 3GU0A 4ZOSA 4LRCA 4DSEA 3P5JA 1AW0A 2FJWA 2CGJA 4TQSA 4CJ4A 3C8YA 4YNQA 4ZLJA 2NZTA 2G9OA 4ANEA 3SBMA 4B3RK 2R2RA 1N6QA 5E3CA 1YRTA 4K4YA 4DPUA 3KHHA 5HJYA 2MXYA 5IWAF 3UR3C 2YNGB 2OP5A 2QYGA 3BV8A 4FWLA 1RI7A 2UUCK 2F65A 5LOQA 2CPYA 4YB6A 5HO4A 5DDQC 4L72B 2GV9A 3ZSVA 1RLDA 3BGUA 1UTAA 4Y28C 4O3QA 3VCDA 4K4WA 2DO4A 5GVQA 1Y5NB 3SCKE 4B3SF 3W9JA 2OJ3A 1KVKA 3P31A 3R5JB 3CJQA 3QESA 3HSGA 1HLWA 3KLIA 2XRIA 3WZ0A 4C11B 2NUHA 4J9PA 4BLGA 3W60A 2WBRA 2P5GA 3MM7A 3CM6A 3DJCA 1U1KA 1ZS6A 1UFKA 3NKYA 5KFZA 1ZPVA 4PG4A 3KFWX 2CQPA 3I33A 1RUSA 3F9KA 2VDIA 4B3TF 1P8ZA 3KJFB 1YITS 4PWDA 5DK5A 1JX4A 2AF6A 3P1GA 4B3SK 4KT0C 1RKJA 3I8DA 4NYOA 4LFAJ 4CJ3A 4CFDA 1NPRA 1QJHA 5D4NA 4N77A 3VA3A 3JTPA 4MH8A 1EWQA 3WQUA 2XZTB 2DIVA 1EHWA 4W5QA 6AT1B 4CEEA 3AOBA 4C11A 2CNNB 4FYVB 2WOMB 5C25A 1S0VA 3HM8A 3FCWA 1J2VA 2O8DB 1Q18A 3DRRA 3R1LA 4KHRA 3CC4S 3NH2A 4J2AA 4MFBB 5KFNA 4PXCA 4FBTA 1KQSR 3WQPA 3QBXA 4DCJB 5DDRC 3ZETA 2HK3A 5AJ3J 3HK2A 1IG8A 2G8IA 2G8FA 5D0GA 1ZTWA 1T7PA 4JI5F 2ZJRQ 5C24B 1C1BB 5ETNA 2AT1B 1J27A 2Q1NA 3T7ZA 3OL6A 3ELHA 2VG5A 4ECWA 3ILLA 3W9IA 2OHDA 1LKZA 1V5VA 3ZC4A 1IBCB 4CJSA 3BUZB 2ZFHA 4NCBA 3BGFA 1ZZFA 1YHQN 1TFWA 4FVCA 3QRRA 2BA9A 4QR1A 1TUWA 3VZIA 3K89A 4OPKA 5TKWA 3P5TL 3BN7A 2PE8A 2CDQA 2GTDA 2KRRA 2CRLA 3BGRB 3NP5A 3PYDA 3M6GA 4YOTA 2X1AA 2IBOA 4F8RA 1IR2A 3THXA 1XR7A 1YIJN 4CEBA 1ITGA 3I9ZA 1X4CA 5F0WA 1Z1ZA 5KOXA 2QLBB 3AVMA 3I0SA 4F4KA 1N6QB 2ZUGA 3EDQB 4U95A 4W5OA 3ASMA 3LDLA 1R89A 4OI6A 4PQAA 2E5LJ 2P1JA 1S5ZA 4J9OA 5CH7B 2BZ2A 4F50A 3N9UC 2RDDA 3QAEA 4CT8A 1M90T 1PKUA 3GILA 1NH7A 1YBAA 4X84A 3W2VA 2AW0A 3NGDA 2V9KA 1WOOA 3OXGA 4A48A 4DUYF 1N54B 3PYGA 4URQU 3RMCA 1TKDA 3K5LA 1GLJO 1OWXA 1F2HA 3DN9A 1MWKA 4DFMA 4JYAK 1YWXA 2B3TB 4C6AA 3MCPA 4NLXA 1APSA 1KN6A 1UJ5A 1N5QA 4JKGB 2F4VK 3ZZ0A 3N4WA 4RW7B 2H9ZA 1BCMA 4YS2A 2BQ3A 2OEJA 1ZM3A 1RWPB 2P51A 4JK9A 1HBNB 3PX4A 1N36K 4CK1A 1VK3A 2HS0A 3ZEUA 5ETRA 3ZSQA 1T9XA 4QU6A 3M8ZA 4R0JA 3SK3A 4ETXA 3E8OA 4JI2J 4ZJQA 1RA7A 5CYMA 1O13A 1VQ9S 2MHNA 2RD5C 3PIPL 4ED8A 2AA4A 3BB5A 4CLUA 3WUHA 4WXOA 3SPZA 3BO2A 2L9DA 2HNDA 2ASOA 1WSEA 1HMVA 1E6YB 4M1KA 4CZJA 4J9MA 4DR2F 2XGPA 3LL3A 4FXVA 4MO5A 4GO7X 2F63A 4H0TB 5AZIA 3K5OA 3OT9A 3SQGB 4IG0B 4JI1F 1VBKA 4OX9K 2LQ5A 4B9LA 1Q9XA 4YUDA 4OPJA 1FVSA 1DEJA 4CECA 1IG9A 1OPIA 2B9WA 4CJLA 2CG8A 5C25B 4ZIWA 3M6XA 4FXWA 2CVIA 1SKWA 5A8WA 2OPPB 1S9GA 5H1SQ 4M42A 3QZ8A 2A0FB 4UW2A 1T0TV 3D68A 3P4UB 3CWJA 1XMOK 4J9NA 3CJ7A 4UOHA 2BMBA 1VC0A 1KVJA 3PRVA 4CTAB 3AA8A 3GJTB 4W90B 5A2QY 2OPSA 1MG7A 5LSOA 4BC4A 1RHQB 4BC2A 4CK3A 2XMUA 5AQLA 1VRUA 3TABA 3TAGA 1EX8A 4CZMA 4YOVA 3K8WA 1UW9A 4EUVA 4YDXA 3M6WA 3VAFA 4Q8EA 3TAMA 2I2YA 4DL5A 3R3TA 5BRDA 2RU9A 1RBUA 2RDJA 2W4PA 2J7KA 3CF5Q 3NCPA 2JEIA 4FWOA 4H4OA 1KP6A 1LW2A 4HTLA 2D0CA 3AVIA 4OV1A 2M8HA 1CS4A 1JLGA 1PGZA 2P9KA 4ZCLA 3RBZA 3KLHB 4OQJA 2XY7A 2VUGA 2XULA 3U02A 5CD4H 4Z4FA 4OX7A 3HKWA 5IV4A 4ZVUB 4KH4A 4JLHA 2PFFB 2ASYA 4UOCA 1BHLA 5EWFA 2P6TA 5GAGU 2DTUA 4TU9A 5FPEA 2J6UA 3OS1A 3B82A 3VV2B 3SUQA 3H8YA 2BW2A 3B4DA 2A42A 4URGA 3BSCA 2BYCA 2J76E 1NK7A 4W5RA 2OD6A 4L75A 1SBRA 1W2BR 3TA2A 1U47A 2ZD1A 3SBGA 3HRGA 4H03B 1H74A 3D0IE 2UUBF 3AXKA 4A5BA 4IR1A 4H5RA 3UKRB 5F0UA 2RILA 1HX1A 5K8PA 1TL7A 3ETMA 1FHTA 4O5FA 1RWUA 4DU7A 1AB8A 4E2FB 4DTXA 4TYBA 1WKJA 4KHPK 2IVNA 5D8HB 2YKAA 3D2WA 3NWGA 3TTFA 2E9ZA 4B3TJ 2E6MA 2VQFJ 1JJ2R 1T6DA 3D67A 1N34F 2HHVA 3AODA 2B5JB 5FROA 3ONQA 3M9MB 1NGJA 2FC0A 2DGTA 3UO0A 2HLTA 4MK8A 5JVGL 3H45C 1YJVA 4CVNE 1HWIA 2DITA 2VKRA 2FDNA 3D7EO 4NX9A 3PW5A 1D9FA 3DXKA 2X7IA 4WYBA 4PL7A 4ECSA 3C95A 3O1WA 1PAEX 2D69A 3O2IA 2F5GA 1H0HB 3LDPA 4P6QA 1MMNA 1R31A 1JKHB 1FWPA 3IMXA 2ZE2A 2XLKA 2HAIA 1I6JA 1IR0A 2B7CB 3FBEA 4ED0A 4LD0A 2QFJA 1OY9A 2KXNB 4GW6A 4F9OA 2P9CA 1EETA 4ZJLA 1Q7YO 4NA2A 3K58A 4HI1A 3POTA 2YHYA 1CJVB 3HJVA 4JV5F 5AQWA 4I68A 4BVPA 2JEFA 2OYQA 2NCKL 3SMZA 3KNAA 2HQDA 5LL6Z 4KB0A 3D0HE 4MDAA 1NSKL 1UVKA 1TVRB 3OHBA 1MA9B 4CGGA 1VISA 3THXB 3ZT1A 4TY9A 2WOMA 3IAM9 3SQ4A 4CJPA 3MMAB 4DR3F 5KFMA 5AQKA 4ZCIA 4NYZA 2HBMA 3DOLB 3A12A 2V2VA 4H8KA 3QJLA 3BKTA 4K0KK 2NZCA 1FRKA 2R8HA 5EX3A 3R7BB 2UP1A 5KG5A 4B1XB 2W2NP 3CJRA 2L08A 3VGLA 1LW2B 1JJ2M 3CIPA 4CZFA 1RTZA 3SXLA 3ZSOA 2F4FA 3GOIA 2Q3PA 4FYDA 2D0BA 1REGX 2FZCB 2GIFA 5C2FA 2G2YA 3L2UA 4J9KA 2BBEA 1TKXA 2BEFA 4GVLA 1VI7A 4DV2F 1HW8A 4X66J 4USHA 4JI0K 3QQCD 1ASUA 3NNCA 3CUNA 3K5NA 4JK7A 2QMWA 4F0MA 3FJ2A 4HTIA 3MR3A 1C1BA 5U47A 3ADAC 3GONA 2JZ5A 4Z4GA 4BWJA 2UUCF 4X64J 3M8PB 3IM8A 3BKUA 2DFEA 3DI6B 4RUAA 2QLWA 3T3FA 3L2RA 3PRBA 1RDBA 1WEYA 1CJTB 1U0SA 2V8VA 2LQ9A 4A2BA 2GVDB 2XMVA 1FRXA 2KG1A 3CDUA 3MEGB 1VQOS 1RTJA 1ATSA 4GVMA 2W40A 3FUYA 1KXPA 1HIYA 3SQOP 1JB0C 1RAGB 4NLWA 2MLXA 4PHTX 3C14A 4W98A 2ZWPA 3R6MA 2IMWP 3G82A 5JICA 1I1GA 2FHKA 4JKCA 1L5UA 3EVMA 1IJEB 3CCSN 4CO0A 2YNGA 3CE8A 3HHLD 4FJMA 1E6YA 3ATVA 3G10A 4OX9J 1S97A 4KTQA 3W61A 3L3UA 2NYIA 2NNWA 2N82B 1VHFA 2CVEA 2HMIB 1RT1A 1SL2A 1XN9A 2YKNB 4DR4F 3IG1B 3DLLQ 3IBWA 1CJKB 4DMZA 3S6EA 4OJRA 4LSZB 3U3YA 2QM1A 3DOKA 2RT3A 3H46O 2HRYA 4CF2A 2LQ8A 4K59A 1WD6A 2HHQA 2MZ1A 1Y11A 2AIRB 2CYYA 2VA2A 2MJNA 1JJ4A 3T5JA 1SAZA 1JCFA 1H2UX 2BR0A 3MCNA 4DU8A 3EXCX 3CJAA 1OY8A 3G87A 1W26A 4DR4K 4TYAA 2E5GA 4OL8A 4FJIA 4FJHA 3HCXA 2JLFA 6FD1A 4RZRA 1OMSA 4ZITA 4N56A 4DCOB 3AAPA 4PXBA 5B0FA 4DSJA 1ZM9A 1BDGA 2MDAA 5AQPA 4I6WA 4OI0A 3GIMA 3OR2B 3K5MA 3ULEB 2NSBA 1RAIB 4USTA 2FZKB 4NYFA 4M3XA 2EFOA 3F73A 1FXDA 1NJWA 2GHWA 4ZLNA 4BRHA 1W97L 2IM1A 4WZQA 4FWNA 1K8KB 4MK7A 4IG0A 3PX0A 4NLPA 4FK4A 5EUHA 3KLEA 1YVUA 3QBWA 3TTCA 1NJIO 3IKMA 1KWMA 4PWUA 1MSWD 1D0EA 2FIUA 1VIOA 2FVCA 3MXMA 1DARA 1J6ZA 4JKDA 4EYHB 2YKMA 2P9IB 1JLBA 3LA0A 4YHHK 2GGPB 1VQ7S 1WSVA 3MEEB 5I42A 4Z4CA 1K73O 1W7AA 3LOUA 2UVRA 1FKAF 3OA9A 2O67A 3OVAA 3R5AA 2FD2A 1K8KA 1U2CA 4MFBA 1DAXA 2RHSB 3CG7A 4ZVSB 1RDCA 1GX6A 3M8WA 3VAJA 2AYMA 4I6MB 2HNZA 4LF6F 3MMCA 2ILYA 1NG9A 3OBIA 2R8JA 4OYZA 4CGDA 3KVGA 2E2NA 2XZWA 4YMEA 2YJEA 1OH5A 3ITHB 4M5HA 5D3GA 1SV5B 4GKJJ 2HBKA 3WXLA 4BACA 2OA8A 1NLVA 1S12A 1B92A 4GMKA 3TOQA 4QYZK 3VGMA 1JXBA 3M8PA 2LKZA 2CNKB 4USWA 1WHVA 4WJBA 1QS4A 3KJQB 2P9NA 1NK0A 3THPA 1ZA2B 4LIWA 3LM9A 4CJFA 3RG6A 5ETLA 4RNOA 3MEGA 3VENA 4FO0A 4B9TA 1T95A 2V63A 5KRSA 1U2FA 5HANA 2PMWA 3OTCA 1NPKA 1N34J 3Q7BA 2RS2A 4RU2A 3T1YF 5M2PA 4USUA 3FDSA 4OZ3A 2UYTA 3GBTA 3Q7CA 3L4IA 1Q7YT 1UVLA 2ZBCA 4E89A 1KDNA 3CMQA 1RNHA 1QAYA 4JP8A 3RW6A 3GFYA 1N88A 2ZZTA 4OGCA 3M30A 2B8PA 2MTLA 1VQ7N 1TVRA 1KR4A 3M32A 4BRFA 4DV1J 2GCFA 4BRKA 1YKWA 3E3XA 4JOUA 3ZTPA 4FN5A 4CYUA 4A62A 4NO7A 4HACA 1S6OA 2YNIB 4B9VA 2UXBJ 5MLCV 5F8JA 2GELA 3LP2B 2POKA 3V5RA 3RB0A 1U0HA 2NS1B 1XNQJ 2BRKA 4N41A 2YX4A 4FJ9A 3ETOA 1XHZA 5KFXA 3C7NB 3NVMA 1UAXA 4E1JA 2HNDB 1KAXA 1D8YA 3J81U 2KT3A 2HKEA 4DV5K 2ILZA 4YOUA 1IM4A 3W66A 2E7XA 5BYQA 3TUPA 5IT9O 4FJKA 5GAGI 3KUGA 5I4MA 1JCEA 1SUQA 2M2BA 1SH0A 3LGNA 1UJ4A 2AP1A 2HGNA 4WFBL 2FF6A 4ZN1A 2YNIA 1Q86T 1VSEA 3NMAA 3SSRA 3FLCO 3D2EA 3UB5A 5KT6A 2YTCA 1YI2S 5KFRA 2J9CA 1SIWB 2CWKA 1BO5O 4X64K 1VQLS 1V5IB 5KT2A 5DRKA 5CHCB 2NLXA 4KB1A 5KG4A 1K9MT 5LMNK 4H54A 2E5JA 1UEVA 4LT6A 4X4VA 1LAWA 1BQXA 2VG7A 3CJ5A 1RAOA 3CW2C 4M8LA 5F8LA 1S48A 3SQ0A 3NMRA 4DR6F 2DNMA 1WC5A 4XH5A 2OUGA 1LV5A 1T6CA 5E84A 3VF6A 2QXFA 1C0UA 5D4OA 2DGUA 4JS5A 1QQCA 3OTOK 2R7SA 2Z58B 4XAKA 4ID5B 1LXJA 5HLFB 2BM1A 5IC4B 2ZH2A 3SCLE 4KO0B 1WC1A 1TKTB 2V69A 3LUYA 3G6ES 4CJKA 5CZ1A 1WBBA 4QW8A 2ZGZA 4E0DA 2P9LA 4JI0F 3EKUA 3A2FA 1F0XA 3Q2TC 5E26A 1H72C 1NJYA 4A8WA 1Z26A 2X1BA 2FB0A 4HWIA 3AAQA 3OR1B 3D4JA 2IY5B 4FYXB 4NLQA 1HPZA 5C2GA 4CW7B 2H51B 1YBTA 1HBUB 3NWRA 4NLCA 3EVWA 3O9TA 3F41A 1TYQA 5M1PA 4QIGA 3MECB 2M7SA 4ZLPA 1RT2A 2G8VA 2RF2B 3DLEB 3GB0A 2Q97A 2EKNA 4YOXA 2RRAA 5J2MA 2KHCA 3K2PA 3QO9B 2FZGB 1CXUA 2N4DA 3M8YA 4ZP7A 4K4SA 2ZZNA 4JNEA 3SYZA 4ZCKA 5K8OA 3D6MB 4IOCQ 3M4XA 6FDRA 2B4OA 1K0TA 2E6LA 4HHUA 2ZKTA 3A8JA 3AGKA 4KPCA 1WG1A 1DZ5A 1S22A 3J8AA 2B7BB 2SXLA 2NRZA 1XERA 4RNNA 1EXQA 2NR0A 2NXUA 3S3MA 4EIAA 4DDFA 3J7YI 1BWEA 5FLXU 5F8GA 2ZH8A 4WFAL 3CCTA 2RDIA 4IBNA 4QR2A 4PPDA 2VBYA 2H1YA 4DR7K 2Q6BA 4UF4A 2JGUA 2QA1A 3MPWA 3L3CA 3VTIA 5LSRA 1NU4A 5G4DA 4MLHA 3NAHA 2KKZA 4DV7F 4EHUA 2HHHJ 2K1RA 2GA7A 4S0MA 1JLFB 3HVRA 3VAMA 4IO8A 1FXRA 4LF4K 4ZTFA 3TZZA 2XS2A 1WNSA 5EHHA 3DNCA 3L3VA 4I9QA 3MM7B 5CZXA 3L95X 1UKUA 5IC6B 1YUWA 2UXDJ 4YY3K 1GOAA 2XEXA 3OL8A 4LFCJ 3R6LB 2QI2A 2C2RA 4Y6IA 4X2BA 3QIDA 5BR8J 2JL9A 4EU0A 3KUHA 1XMOJ 3GZ7A 1S59A 2HRUA 2JX2A 4GKKJ 1UFLA 3IS9A 4GVBA 3Q0AA 4LF9F 3FSXA 4CEQA 2G0JA 1NM2A 4Y0WA 3WIVA 1N8RT 1Z6RA 3NOCA 1NGBA 4BROA 3MM5A 5LY3A 4HL9A 2BQRA 4NRTA 1E3MA 1J9AA 3PW2A 3C46A 4GC6A 2NRRA 4I2QA 1HHQA 2UZAA 1GK8A 4NPOA 4K8RA 2A3ZA 4YR3A 3OTOF 1CJTA 1U4BA 2OLWA 2DR7A 3NMUA 2BJ1A 2UXBF 4LF9K 1HHTP 3IRWP 4DG1A 2PSZA 3TJ9A 2FGCA 1VQLN 1VOMA 1RBAA 4DUYK 1HI1A 3IWNC 5LJVA 1ICEB 4WZMA 3QEPA 5LT5A 3PEHA 1G4CA 4P2MA 4OYAA 3CULA 3PR4A 1KD1T 2YX6A 3OBWA 1PG5B 1RAFB 4NL5A 4AYBD 1URNA 2VPXB 1WSHA 2NRXA 2HVDA 1FRLA 4B8CA 2IRYA 3LP1A 3FZLA 3ZTSA 3I9V9 5I9EB 1S6QA 2W6KA 1YI2N 4IFEA 1HD0A 1T3NA 1VC5A 4IFYB 2HEKA 2X3GA 1RAEB 4DTUA 1UW4A 1U45A 2VODA 2IS3A 5JMVA 3KLGA 4FOIA 1IBMJ 1YF5L 3A3PB 3R8EA 3QEWA 4B9UA 1QTNB 3UDEA 4JV2A 4CF9A 2VC0A 1U04A 1VSMA 1A7GE 5DLGA 3SCIE 2M8DB 3G82B 5GMEA 1S1TB 3H20A 3HHEA 1KQKA 2D3ZA 2PA8D 1FDBA 4JYAJ 1AT1B 5J2MB 3MF5A 3PY8A 4FZXC 2I7NA 1RYRA 3RYLA 3OYEA 5J2QA 1JLAB 1QUVA 2EFPA 2MKIA 4QIFA 1IKWB 2NRTA 4JKFA 3P3DA 1G3OA 3FGVA 4F4WA 4NA1A 3C0BA 4I69A 2AJFE 7FD1A 2P5OA 1SC3B 2DRAA 2GC8A 3A5OC 3W2VB 4F7VA 4MJKA 4AFFA 3BKFA 3A8YA 2VOOA 3NG8A 4BDPA 4QIEA 4WXWA 4C0HA 3IP0A 3ILOA 5EVZA 3F56A 1NJIT 4JI3K 1SC4B 2ZH4A 2EX3A 4BRMA 1K6YA 3KLIB 4E8UA 2HQCA 3MD1A 1FWLA 2NXNA 4JI6J 2LXIA 2HF3A 2G8UA 4K5SA 2PMHA 4C48A 3ZT4A 3POTB 1U6ZA 3GIKA 4EBDA 3DLLL 3MFIA 2ZJRL 3D0GE 2EWHA 2VICA 2R7TA 1RTDB 2K3KA 4B8AB 2VU5A 5AE2A 5JVHQ 5CZ2A 2EG2A 2ZBQA 2ZEJA 3BYRA 1U6BA 4WKRA 4HDGA 4ID5A 4CF8A 2CPFA 3OYHA 1YTAA 1WTFA 1M5HA 3CD6N 1LFPA 1NB2A 1C4AA 4KO0A 4IO9Q 3TJAA 2A40A 3FZ2A 5LSLA 4G9ZA 5CD4A 4A59A 3VGVA 2Y8YA 1Y3JA 3OQ2A 3JXUA 4DR5F 1NXIA 2DO0A 2MKCA 4DPXA 2PDAA 3CFPA 2QA2A 1HBMA 3VEWA 5H9EK 1MW7A 2C28A 4NMLA 2M3DA 4LR7A 2KH9A 1UOCA 1OO0B 3M1FA 2GUIA 3CCRN 2KXFA 4FLTA 1NM1A 3QIPA 4CM0A 5JUMA 4I9LA 3V9WA 4K8ZA 2WTUA 2Y8WA 3I5AA 1NMEB 3RRHA 3D5MA 4ECVA 4I2QB 3N01A 1EWRA 2OPRA 5GADU 2RMLA 1XNRK 5D15A 2E5LK 3MM9A 2KU7A 4P2FA 3HMJG 3MMAA 4DPOA 1RTIB 3O1BA 1NCLA 1R0AB 4JEPA 1XWLA 3H4BA 4E1MA 3J80U 3PFOA 2OPPA 4F2RA 4B1ZA 4H5NA 5GADP 3H2VE 4IQMA 3TSUA 1VQNN 3OYIA 2OMLA 2J0XA 4CLSA 2DY1A 1NGEA 3I5CA 4H0VB 4G1QA 3OHAA 5LM7E 1R43A 2ZJQQ 1C6VA 3HPHA 1R6VA 3BY5A 3ZFVA 1X4DA 3EJMA 5EY4A 4DTJA 3TVZA 4U8VA 1U1MA 1TKXB 3BYPA 3L7UA 1O5JA 4OHYA 1I51B 4YR0A 1Y7PA 3TSQA 5KT5A 4RCHA 3DLRA 4HCCA 1QVGR 2B9EA 3VZHA 3TW0A 4WFZA 4HLBA 4LMZA 3LP1B 4PA1A 1LWCA 1U25A 1ZH5A 2BV3A 2GQQA 4QZVB 3CO9A 3QMQA 4ID8A 3QGIA 3MM8A 2F9JA 4JI2F 2FTRA 4HACB 3G71S 1H2TZ 1YHQS 4LFAK 1MROB 1AA1B 1IKVA 3VTHA 4IYQA 2BTFA 1KOHA 3IR7B 2IAJB 3ULDA 4JBCA 5G0RA 3E66A 2GAGC 2W1BA 3J81j 1CJKA 1GLEG 2E4LA 2A41A 2EKYA 2MQQA 3RMDA 2EWSA 1YJNS 2DNNA 3OPKA 1V4SA 1MN7A 5C7PA 5A8KA 4JYAF 3CDAA 3UD4P 2ZOMA 4J5OA 2L3MA 2DHSA 3OYGA 2BE7D 4ZVFA 4ZJOA 5J1NA 4JI1K 2W8KA 2V68A 3CQYA 3MGJA 3CO0P 3W64A 1FJGF 1RCOB 4DL0C 1BI4A 3KK7A 2QE5A 4TY8B 1GLAG 2I38A 4RJVA 4UY85 2FBYA 4N76A 3MTJA 2WCXA 1U0HB 2K1RB 2VKZG 2E20A 2R8GA 2Y0BB 2MLYA 4WFNL 4HH0A 2MLZA 4RO0A 2J9DA 2QZ8A 3CCLS 1U02A 2C2NA 4WQ4A 2QWLA 1IQTA 1DJ0A 3TAPA 4NLTA 1K9MO 4MKBA 1XMOF 2DNPA 4KGVB 1S7HA 3HO1A 2FHJD 4K4TA 2VFTA 2IYGA 1P8GA 3O44A 1CJUB 1VBZA 2COLA 2IC3B 1HI8A 4TQRA 2V4QA 2FLNA 3AO5A 3QFUA 1RSCA 4MKVA 2JJ4D 3DRXA 1WOPA 4LF8F 5LJWA 1S1UB 2GO9A 5C0YA 4O3OA 1RHUB 1UPPA 3V81B 4LH5A 2R7VA 1SQEA 1YJ7A 5AQVA 3QNWB 4ZIVA 1NBWA 3MCOA 1L3TA 4QBUA 3KLFA 4IOBA 2ZF5O 2W2PP 3PJ9A 4QAGA 1LQ9A 4U67Q 1CJVA 1L3SA 2W6LA 4A8KA 4OZ2A 4LQ3A 3FSYA 2ZHOA 3RBXA 3KLGB 2QKBA 1F9FA 1FWKA 3UPFA 1HBUA 5C10A 3SIPB 3ZZRA 1TYQB 4FYYB 1UVNA 1RBRA 3QIPB 2I5JB 3KKFA 4DOZA 3U6FA 5DETA 3CQ8A 3SCXA 2F8HA 2BE9B 5JS1A 3RR8A 4KREA 4ENOA 4WK3A 2MMYA 3RW7A 4WYWA 2F7TA 3TAMB 5KFIA 1FJCA 1RACB 4X4TA 2BOAA 1S0MA 5KFEA 2IOCA 4XPEA 2D4WA 4IXCA 2ZHAA 4HUGA 4LSLA 4DLEA 3ZSWA 1WKKA 3U27A 1JXEA 3QIOA 4J2DA 2BE2B 4EK2A 1S7IA 2WRMA 1I3OB 1YZ6A 4DG1B 2ZM6K 1WC6A 3SDEB 4FOEA 1UJ6A 4RUHA 3AVBA 2NQPA 2ZWHA 2A2CA 3WC0A 4H4MB 3JB9k 4K41A 4CI6A 1VSHA 2WVBA 3I4HX 1WEZA 1FNOA 4BRNA 4OYIA 3C66A 3JXOA 2YWHA 3CC7N 3RAQA 2I8EA 1T03A 2E2PA 3W2WA 3N28A 4OYXA 3D7SB 2X78A 2KFZA 3IMQJ 1AZSA 3P5BP 3M32B 4C8KA 3R5CA 3C6AA 1SJ4P 3GR0A 2W01A 1LOTB 4DV2K 3EUNA 1VS3A 1FTCA 3L4QA 1KONA 4PCQA 3JSYA 2DPJA 4JI6F 3M2VB 3A3OB 1D09B 3G71N 3ET6A 5HP1B 3PX6A 2YXLA 2K7JA 4CFAA 5DZ6A 4KFBB 4XH4A 3R1HA 1XQIA 2Z2ZA 3C7NA 3PO5A 4MK9A 3CERA 3ZX0A 4RBTA 3GLJA 3NEKA 4X65J 3JYTA 2CPIA 3BSAA 3TUJC 3UW1A 5KFYA 2B8QA 1FJEB 3FVYA 1GNKA 1WBDA 1SI9A 5AQIA 4JK8A 2HHSA 4D3GA 2QN6B 3UD3P 5KAKA 3ENBA 3SSQA 4CZLA 2GWJA 3A5MC 3VQEA 4M63A 5KFFA 2AHOB 2UXBK 4J37A 4JKAA 1XK8A 4OZ0A 2MKSA 4LY7A 2XS7A 3TWZA 2Z56B 1QDUB 2OTLS 4ECRA 1BUXA 2UUAJ 3ZETB 3CCJS 4IO1A 7FDRA 5H9FK 2WW4A 1QQNA 2EBEA 4ZHRB 2RAQA 5B08A 4YHHJ 1GMWA 4M5NA 3SNNA 2MQMA 2P9PB 3HSZA 4IH7A 3AGRA 5KFAA 3BF1A 3PW4A 4I2PA 4QJVA 1VQON 5JMNA 1S6PB 2DNOA 2RUGA 2DRBA 1JLEB 3GJRB 3NRBA 4BR5A 2D41A 3I32A 1JXLA 2DCUB 1R3NA 5L38A 2HIQA 3P96A 3KLFB 1JMTA 2J8SA 1QLNA 4HVZA 3HL8A 3G4SN 2Y0SD 4M5DB 3K7RA 5BN9A 4E1NA 1X9JA 3CPWR 4Q45A 3AOAA 3G8TA 2Q3SA 3FC9A 3EEQA 1SH2A 4OO1J 1G15A 3UR0A 3C6TA 4CHPA 1NK6A 2OZSA 2F96A 2V8GA 4OZJA 1GLLO 1R0CB 2UVWA 1JL2A 3EE8A 4MYTA 2HBRB 4GC7A 4KTZA 3IBFB 5HQLA 4WU3A 4HYKA 3JQJA 1DQ8A 2RQKA 5IQ6A 4JI8F 1T9YA 4DPTA 4CD1A 1H38A 3QB0A 4DR5K 4DV1K 4PY5A 3HDSA 2AEFA 1Y5LB 1BY9A 2MB0B 1ZAWA 4C98A 4L3QA 3ZSZA 1Q78A 2E2QA 1T9TA 2W7PA 4NXNJ 4DV6F 1XR6A 1TR0A 3DAWA 2YNHB 3J80O 2FVPA 1IJFB 2QLXA 2WVFA 5E3QA 4NZ0A 2IGIA 1XIQA 2B9XA 1X5SA 3OXFA 1GEHA 1HNZK 3HSJA 1DGKN 2O8CB 5KFOA 4DV5F 5HRRA 4JI2K 4RG8A 4I4BA 1JLAA 2NRVA 3P8BB 4L74A 3N5BA 1S1VA 3NGUA 1SQFA 4OFZA 4KV8B 5EGYA 3I96A 1TMMA 4J2BA 1P1TA 4Z7CA 1C2PA 3QZ7A 1TAUA 1VIXA 2Z1HA 2K2PA 1MWQA 4M3ZA 3GFHA 4QWAA 4Y00A 3MXHP 1LWCB 4CH0S 4G3IA 2FHMA 2O3DA 1UEUA 4M3TA 3NNHA 3VEOA 1GAOA 2VQEF 1BG3A 2LLZA 2O8EA 5A8KB 4USIA 4X4QA 2XMWA 1WACA 4WP9A 2IAJA 1UPMB 3PSFA 3GSDA 4CZIA 2YBVA 4ZCMA 4DS4A 4YY3J 4R25A 4YORA 3P4IA 3H25A 2DPIA 3C19A 1GTHA 2F40A 2PIIA 4UZCA 2JWLA 1T3OA 4FCYA 3PVXA 5DDOC 4NASA 3S7RA 1GQEA 2W24A 4OPAA 4OLBA 3KWIA 4H0XB 3CCVN 4WE1A 2EC2A 3ZT2A 1F5AA 1NAQA 2WSFC 4BG9A 4JRQA 2FVQA 2WBMA 5KPTA 3MPVA 2DNGA 5F41A 3QBCA 5BJRA 5KQDA 4G1QB 1TUVA 4TU8A 1J5OB 1A6LA 3GV7B 4NLUA 3HTVA 3NGZA 1ZM4A 3U8XA 3LP3A 4QQBA 3DKDA 1UETA 2ITGA 3THWA 3KJVA 4QWBA 2RIJA 2BGGA 2CUYA 3FKBA 1OJ4A 2AV5A 2IBKA 3PR5B 3DGPB 2GHVC 4DPWA 3IS9B 2VJVA 4O0JA 1H6KX 4OZ1A 4DTNA 1LWXA 3CJCA 1V9OA 3FCHA 3B4MA 4HT5A 2CPEA 1F5BA 3EKSA 2F4VF 2D3UA 4Z94A 1KVCA 4AHTA 5J1PA 4CEFA 1IBKJ 3ICLA 1ELOA 4FLVA 5CAAA 4P72A 1OKJA 3ENHA 3CD6S 3LZJA 3VWSA 1ZM2A 1U2VA 3CCLN 4ER8A 3CSKA 4XK8C 4RW8B 2OFHX 5A0YB 2NXCA 3H59A 3U1NA 4NXMK 1IBLF 4RPFA 1NJXA 3A5NC 2K7KA 4L6V3 3UDCA 2W9BB 4USVA 3EZWA 2FJAB 3T1YK 2MKJA 2FHOB 4I6MA 1KFSA 3TWHA 4EO6A 3QMLA 1L3VA 2DY4A 3KJNB 3MMBB 3ZTRA 3BF3A 2EXUA 3MXIA 3GIRA 2B5JA 1WAJA 1GT8A 4F04B 1XJWB 1JJCB 2F9WA 2GO8A 2DHAA 4IH5A 3GV8B 2E8AA 3AY9A 3EO3A 4OI1A 5D6GA 2RQMA 4IRCA 2B6AB 1FJGK 3SV3A 4Y2IA 3S3OA 4EGLA 3Q24A 4EBCA 2NLWA 5GADI 3KHLA 3L2VA 5AQSA 4YB5A 4HTUA 4UQTA 2GIQA 1HA1A 1Y9OA 3I4PA 4CJEA 3V6DB 2VBWA 1ZETA 1TUYA 2H48B 4WBFA 1NBEB 2QA4S 1RT3B 1M1KT 1NK5A 5FRNA 1S57A 1NKBA 1WDDA 3IRXB 3KG4A 4J91A 3A4TA 3O1LA 2AGQA 1F9HA 3GE9A 4A57A 1RTJB 3NS5A 4KY3A 2R7YA 3ENQA 3CJKA 4DUZK 3QO9A 5IWAJ 2FBXA 2BKNA 4F4ZA 3R2CJ 3VEVA 1JLCB 3I55N 5L1LA 2CJYB 4LSNA 1HQUB 3PV8A 3JAMU 3OVBA 3W3SA 1KOOA 2OMOA 1TKZB 1S1UA 4X4SA 3PJWA 5F2RA 4L73A 2BXJA 9RUBA 3PHEA 1HD1A 1FXXA 4KI4A 3MPDA 3QRQA 4HHJA 3MEDA 1AUSL 5CZVA 2MKHA 4JKHA 3OS2A 2PFUA 2R7QA 4M95A 1W0HA 4ED1A 2KT2A 4DV6J 5AQZA 2Z2YB 4LF2A 1F21A 5K14B 1NSQA 2AYEA 5AQNA 3SV4A 4DR1J 1Q81T 1MU2B 2PD1A 8ATCB 3HX9A 2F3JA 1PJ5A 3VEZA 2VIHA 5THWA 1UZHA 4QS7A 1RGIA 3QINA 3D0PA 4LFCK 3CJ0A 3DU5A 2V8PA 2ZH6A 1Q5VA 3HP9A 4TKTA 4Q7AA 1RYSA 4CGFA 3FBCA 5AZJB 3ZNJ1 3KMQA 1BI4B 3LP0B 2YHBA 3CJ9A 1N4LA 4EHTA 3EPGA 3THVA 4NRUA 4B3RF 3T6JA 2G2OA 4TSXA 4B3MJ 2YHXA 4LRDA 4DR3K 1TK8A 2GFFA 4KHPJ 1VSKA 3TVYA 1HNZJ 4M5GA 4OHVA 4R5PA 4JI0J 3DRSA 4C7QA 1I94F 5KPZA 3JSBA 4GV6A 2MZQA 3MX2A 4ITSA 1VQPS 4DPYA 3LW5C 2GMLA 2OGUA 5IZHA 4JI4F 2CQ4A 1X5PA 4DTMA 4IO9L 3GJSB 1NGHA 3T19A 1MLAA 3ID8A 1RT5B 3ZNUA 4F4XA 3P39A 3NS6A 2IVOA 2IC3A 4C3LA 1U1NA 1P6TA 4BQLA 1TUGB 4MO4A 4AUKA 1HYSA 1RT1B 3SI8A 2DNYA 3MD3A 4JI8J 1VSLA 3CVKA 2PZSA 2KKHA 4KGZB 3RMAA 2GJ2A 4AF1A 2NRWA 4DBQA 3FZBA 4K4ZA 3QFWA 3GCXP 3R7SB 2MYFA 3NDKA 3AVJA 4IZ9A 3VQ5A 1Q5YA 2V2QA 3SLCA 5BPMA 3EE9A 2AJQA 1EJ7L 1DFDA 1XR5A 2YH0A 2BE2A 4N8NA 4IDHA 4UTGA 2UU9K 1RWMB 2XLJA 2NYHA 4DQSA 3PW0A 1WAFA 3AT1B 5LMUF 3KK3A 1VCTA 4C8LA 2V4JB 1U2RA 2Y9HA 1P9YA 2NUBA 5LL6d 4ZPBA 3A8IA 1Q8IA 4A8YA 2DB1A 4M3UA 3PUFA 3OHRA 4DWIA 3PKYA 2M52A 2O66A 4IRDA 4X66F 3JSRA 3D1OA 3AVLA 3ZTOA 2FLPA 2R8IA 3O5BA 1KHVA 4A4JA 3VVUA 2MKYA 4Y34A 5HSPA 5GMDA 2BQUA 1RT6A 2HNYA 4Q2LA 3WNGA 2U2FA 2WSEC 4USKA 2CZVC 1VK8A 2MZRA 1RWXB 4CH1A 2DT9A 2FJBB 1AROP 2R7RA 1VRTB 2HFVA 1MWZA 2VC1A 4CTAA 4RU9A 5CHIA 1VBXA 2O8BA 2ADBA 2H5EA 1B0PA 2P9NB 4CHNA 1R8AA 3PW7A 2QL5B 1S1VB 4PUOA 2RE2A 2DH7A 4AHVA 4YY3F 4PYDA 2G1HA 4AQYJ 1M5SA 2AZ1A 2BKPA 3CXCR 4U7BA 2V94A 3KK2B 2C22A 2HFUA 1GLCG 2BACA 3FE1A 2XM3A 3DU6A 3OYFA 2AX0A 3ID6A 1SL0A 3HD2A 4H5TA 4HR2A 4DV1F 2GJFA 2Z2LA 3C6HA 1WG5A 2ZJPL 4LSNB 1O6XA 3CC4N 4PXEA 2GV1A 2FVRA 2C1EB 4LF7F 3JS6A 3DRPA 2JLGA 4HVJA 4JD2B 4ZP9A 1VQMN 4PKIA 2VPZB 4PG8A 3BZQA 3CCMS 5CQGA 3FNNA 2JEGA 4CZEA 3BSNA 1AZSB 1KTQA 3TR8A 3LP2A 1R59O 4PXDA 3HT0A 5A8RA 2XHWA 4RKUC 1EQMA 5ETMA 2E1MC 1NMDA 2DEIA 1F9EB 3THYA 5KFHA 2CQDA 2GJIA 4BR4A 5BR8K 2DGOA 2N7YA 4KH1B 3DDKA 3U1LA 4NXNF 3R5BA 1FFWB 3T5KA 2ASPA 3HFKA 4NB4A 5D3GB 4YOWA 3UDLA 1OH6A 2ZJPQ 4CBWA 4WFXA 5M1QA 5B0BA 5F8NA 4FJ8A 2FHJA 1K73T 2DR6A 1WNEA 2F8EX 2PEHA 5KFUA 3G6YA 2V2KA 3SEOA 4CLLA 4ECQA 4KHYA 3VGSA 3BBBA 4A61A 1BXNA 2Z2MA 4ILGB 3NCRA 4DV0J 4BCAA 5KG7A 3BZCA 4ZPDA 3DOLA 2F4VJ 1XC3A 1KLMA 1DRZA 4DV3F 2ZJQL 4EP4A 4Y2KA 1L3KA 5C24A 2KHDA 2W2OP 3PDNA 1HNWK 1LWFA 4TU7A 4J9UE 3FMWA 5EDWA 1PYSB 1NGDA 5IFMA 3H5UA 1WSJA 3AVHA 1TUUA 2DKOB 4UQGA 3BREA 1RWWB 3MURP 2KM8C 5L46A 4ELVA 2LDIA 2ZOFA 5GAEU 2VQEJ 1P90A 2JWNA 4XEIA 2CQIA 1TP7A 5DGBA 3BZKA 2MSTA 1NWKA 2H65B 1JNZB 3QAUA 3CCZA 3CC2N 3WNEA 2E9TA 5BRHA 2ATQA 1JNRB 5HRSA 2FF3B 3KTQA 1WSIA 1M1KO 1SZ2A 3BPDA 3KG1A 3C2PA 2G1DA 2AD9A 5CYQA 3LTOA 1FRIA 2HBZB 2WB4A 3HSCA 2DD8S 1ZBIA 2VJUA 4C2MA 4YN3B 1IO2A 1Z05A 1PYTA 3LDSA 3M8QA 3U3GA 2IYIA 3OYJA 3OYCA 4E19A 3NY0A 3MN5A 5HOOA 1H3DA 2QTDA 3EZUA 1UAWA 3VQPA 1KHWA 5GAEP 4MKYA 1HNXJ 3CHWA 4H0YB 3LWMA 1M5KC 1BE4A 1NSPA 3A0IX 5ETSA 2UV8A 4HI2A 2JVOA 2LU2A 3G6VA 5D78A 4H5VA 1VR6A 2C42A 4KQZA 1EO1A 4DX8H 4CLYA 3O8WA 3MR6A 4CD3A 3FEZA 4KHQA 4LUBA 2VG7B 4MLEA 4J9RA 4DR7J 4DSIA 4P9SA 1JXVA 3AXMA 4CK2A 3DLKB 2YNFB 4EI2A 3JYTB 2IA0A 3RB4A 2WUSA 5FRMA 3W2WB 4B02A 1GX5A 5EU7A 4FWKA 3ET6B 2EI5A 4DQIA 4O0NA 3DYAB 1C0UB 2ZDOA 4DTSA 2CGKA 1A0OB 4ZDNA 2A3JA 3ZSXA 5SZTA 4FJGA 5BREA 3AQPA 3CD5A 2OD4A 3QEIA 2CFXA 1UMJA 1CLFA 4M3RA 1S5JA 4NLGA 2L9NA 1Y4ZB 1RILA 3UN3A 1KQFB 4ECTA 2K8GA 1VBYA 4DL6A 4DV7J 1LEOA 2HHHK 2E29A 2Q2RA 5FIIA 4FZZA 1N36F 2OH2A 2F8MA 1S4FA 3MDFA 1KRPA 2JDJA 1JLQA 5CABA 4B3RJ 3TYTA 4R8UA 3M2UB 4KTWA 2A18A 4N7TA 4CRJA 5KRTA 1WUAA 2XQCA 4LFCF 3LAMA 1RT2B 1U1LA 3LF0A 2HS4A 2KL8A 4HEA9 4EMDA 1XNQF 3P49B 4BRCA 1QTMA 1XMBA 2BX6A 3EYZA 3CETA 3AJ2A 5L9NA 4A2AA 2YKOA 4WQ5A 2CQ0A 4WTYA 4ED6A 3CMEN 1YVFA 4B9QA 4LF5F 3I55S 3D66A 4ZK7M 4HHTA 2DNRA 4PEOA 4DV0F 1N48A 4CLWA 3VQCA 3D54A 3AVNA 3HHKA 4DJBA 2AZ3A 3MEEA 5I42B 2QWRA 1HYZA 2P9UA 5HQMA 2DGVA 1BQNA 3MOJB 1GLFO 5HVGA 2DTJA 1WLJA 2IVPA 4LR9A 4AL7A 4DR7F 1GXUA 3JS9A 3TPQA 2XY6A 4RLEA 1QM9A 2XTJP 4FXDA 2D0AA 1QSSA 4O44A 2I0XA 2FLOA 1YJWS 2M4MA 2KZMA 4J9VA 1YX2A 2VD3A 3CMAS 3ILJA 4UUWA 2XZDB 1X4HA 4AT1B 4JI3J 2LECA 3AD9C 1VK0A 5HMXA 3V6HA 5IQQA 3VQ9A 1W25A 3D6RA 1S1XA 2HHXA 1XMQJ 3UDVA 2XWYA 4DR6J 4B3OB 3N0VA 4P52A 1UP1A 3DGPA 3JSMA 3TR5A 3M8RA 5JJBA 5KQ8A 5D77A 2ZVSA 3DLEA 1VAZA 1U1PA 3MN9A 1VQYA 3TRGA 2R3VA 4E7JA 2GHPA 5DQGA 2PFDA 4IUFA 4YOEA 4WWSA 2LP4A 1LCUA 2KM8B 2Z1GA 5HLFA 4O44B 4UOGA 4OJHA 3V9XA 1CVJA 1FW6A 4TLRA 2QXLA 4Y0FA 4J9QA 3KLEB 1EB0A 3TANA 5C42A 2IA6A 2FJVA 2DCLA 3KYLA 1NZAA 4JV1A 3NCIA 5JVHL 4KH6A 3RUBL 4Z37A 3WXIA 2GW8A 1TL7B 1FA0A 5DG7A 3THYB 2WVCA 3SUPA 4PR6A 3CGIA 4BRQA 3R5DA 1OS5A 1TK0A 1B7YB 3HZEA 1MDUB 3NL0A 1RA6A 5EX0A 4PUOB 2YJFA 5CY4A 3ZO7A 4IOCL 1X1PA 3NGIA 2D3OR 2IDEA 3H1VX 2QL7B 2XHBA 2FYXA 1S1TA 3H08A 2C3PA 2J0SD 3ALYA 3MCSA 1XMQK 2IHR1 4EO8A 2YPZA 4RNHA 2P9KB 2V6AA 3QPIA 4QU7A 3UCUP 3D2FB 2CAJA 5KFTA 2B4JA 4NE9C 1BQMA 4U9RA 1KBRA 1Z25A 1G2EA 1M5VC 1VSDA 2CQ2A 2HURA 4CLZA 3VALA 4KHMA 1D9DA 3DM2B 1Q82T 1DTTA 4WFYA 5HATA 4RBUA 4ANDA 3V9UA 4A8FA 4MIWA 3AFGA 1X0FA 4ZLLA 3UVJA 2O8DA 3AO2A 4DN0A 1S77D 4QOTA 4LR8A 4JI3F 1GOCA 4YB7A 1PC4A 3D28A 4JI6K 3VGKA 4ZN3A 1X0PA 1OH7A 3LGHA 3EVOA 2MQOA 1NHVA 3OYBA 3PKMA 4E7HA 4CESA 2RKIB 4NZ7A 1QD1A 2KN4A 5KFKA 1BIUA 3HI9A 3OTBA 4X4UA 4JI8K 1WHXA 3PRDA 2PT0A 2FLLA 5KPRA 1OIAA 4A47A 3B8HA 5FLXY 4XPCA 3O5TB 5E33A 2KTQA 4FYWB 2B4PA 3EWGA 2YWWA 2FGOA 3ENAA 1S9GB 3VAGA 3TI0A 2DJWA 3DLBA 4BY9C 3SFUA 1W7WA 5KT4A 3O3HA 3NF9A 3V4IB 1X4FA 4FPAA 4NLDA 2WC9A 3IBCB 2KO1A 4F4AA 3OJSA 5D0RA 3ENOA 3MN7A 3GYGA 2BW7A 3E9PA 2O8FB 4DQQA 2FPHX 3AVCA 5A6WA 4CBUA 2E1ZA 2RHKA 1NK4A 2KW4A 2OPSB 1YTYA 3KDNA 3LWLA 2NRHA 1EKRA 5IT9Y 5KFJA 4LF8J 3OS0A 1Q9YA 2UXCK 4HUFA 1OSCA 2Q6CA 2MQLA 2CJQA 2E2OA 1R8CA 3I0SB 4LF7J 3RTVA 1JLBB 2VCPA 4OLOA 3D3CJ 4CHQA 2XHCA 4WP3A 3DGVA 3MEKA 2UXDK 2HVZA 3BQ2A 2QLJB 1B70B 4H4KA 2X74A 5KFVA 4BE2A 2OELA 1X8DA 2GAHC 1VQ8S 4JS4A 4ECZA 3AARA 1U48A 2PYJA 3MR7A 1Y0HA 2HNZB 4YP3A 2HLUA 1NOZA 1FNXH 4B3OA 3W3DA 4JHDB 4Q0BA 2G2ZA 2HS3A 3HLUA 3OR1A 2FC8A 2E7WA 2LXFA 1ZBHA 4OLAA 5F8IA 2DH9A 1VQ9N 4WCEL 5E5NA 3ITHA 3MAHA 1ZBLA 2VG6B 2QWPA 1YITN 1RTDA 3DLJA 2AGPA 3BDPA 2RF2A 1ESVA 1KAYA 1M90O 4DV3J 3AY0A 1IKXA 5DJBA 4IKAA 4V19S 3MFHA 3MUVP 4J2EA 3HPGA 5K20B 4TNOA 1T3VA 5AQQA 1O0PA 4Z2XA 5A8RB 2ZZMA 3FMBA 1RKIA 1UA0A 1FEHA 3TX8A 4AHSA 3T1HK 4DS5A 2OTLN 3OVSA 3OL9A 3QWUA 4Q0BB 3B54A 4DKWA 5GAHP 1I39A 3SI6A 3CFRA 1NSAA 3AO3A 3KK2A 4C97A 2LVWA 2HYIB 3PTWA 1HI0P 4ED5A 3VGTA 4X65K 4DV6K 1IQZA 3SAFA 3OVNA 1N5TA 4OYBA 1WEXA 2XS5A 4FWPA 2VGMA 3RAXA 1NDCA 4DSLA 3F5TA 4CJWA 3RGIA 4BR9A 4BGBA 5IM0B 2X1FA 2B4UA 3HP6A 3L7OA 4FSVA 5F9LA 3TAQA 1JK9B 1QUPA 1UEKA 3OV7A 3QT5A 4P71A 3VQ7A 4NXMJ 2C3MA 2PEBA 4CHYA 4LBIA 1KVAA 4IR9A 3SFGA 4ELTA 3EX7B 5FPDA 1RTHB 2WONB 3M2UA 4JI7F 2VA3A 3S9HA 3GYXB 1RHMB 5FD1A 2UUAK 3CCQS 2UU9J 3OR2A 2AYBA 1TL4A 1R27B 2Q79A 3MWPA 5AXNA 4P2XA 1J5EF 2RNEA 3T41A 3SQ2A 5AFUA 4IG3B 1BMQB 5HMYA 4U67L 5IT4A 5KFBA 3U1MA 1HNXF 1N5YA 5J1EA 3M1VB 4KC5A 1U1QA 4QYZJ 4ZTJA 4KHWA 4PRFA 2XI2A 1IBKK 2W7AA 3MM8B 3CJTA 1S1XB 4CJQA 3NVKA 2EFQA 4ZHRA 2J8AA 5KG3A 4LFBF 4OHZA 2RKIA 2WZ1A 2XCAA 1B9FA 4ECXA 3NOGA 3AO1A 4KPYA 5AQMA 5K8MA 1ZXOA 2YHAA 4R8UB 2FBTA 4FM1A 3AD7C 4C4WA 4MMOA 2KT5A 3PO4A 2DHGA 5H9EJ 1I3AA 2BANA 4CO1A 1SS6A 5IT9U 1RU1A 1SJFA 2O8FA 1VLYA 3B6PA 1IN0A 1D9AA 3EICA 4AQYK 1IBLJ 3QATA 4U8YA 4DR2J 4O3NA 3FFKB 2R4FA 1M1HA 2EW9A 1BWFO 1SB6A 1SKRA 3CB4A 4IRKA 3D6FB 4ECYA 3VHQA 4CJTA 3SAGA 3LALA 4A46A 4J9LA 5HROB 2MJUA 4RW9A 3G8QA 3TZYA 5A8WB 2HGLA 3H2LA 3BGOP 3HYFA 2CQBA 4L3KA 1ROFA 1HFEL 2L48A 5JVGQ 4BE1A 3GG0A 5DM7L 1S99A 1FF2A 3OTDA 3TUIC 3DI6A 4B1YB 5E3PA 4DFJA 4FPIA 2CZ9A 3M8QB 3J7ZO 4ZPVR 4LRFA 3BR9A 5DMRA 3NBPB 1HMVB 3IFRA 2IIRA 1FO1A 1C0TB 4IDKA 2W41A 2RPIA 2WVDA 2O1PA 3QGPA 1IKVB 3JAMO 4YOYA 3D1HA 4FJLA 3VPZA 4ZMMA 2WB1D 2OZMA 1HNIB 5LMNF 2EG1A 2UU9F 4CGHA 4F3MA 3RJMB 3FEYB 4Q43A 2L41A 1G7CB 4FWSA 2RH3A 5AQFA 4ILLA 4DL2A 3OUYA 3ZX3A 3SDEA 1R0BG 4JKBA 4JUZA 2ZH1A 3QGGA 2VBZA 1NOYA 2XBPA 1VQ5N 1X9WA 2CA9A 2ZWOA 1HNVA 4DUZJ 4K43A 3QSIA 3KOAA 3SJJA 5F9NA 3PYEA 1NB7A 3N4PA 2QA4G 5KI6A 1U6FA 4OLPA 4FS1A 1D1UA 1QE1B 1VRTA 1VQ4S 4ERDA 4DR5J 3HVTA 1WN7A 3CJ4A 3QFPA 1WF2A 3EM1A 1QAXA 3IR6B 3KKSA 1OH8A 2Q0RA 3ZT0A 1FE0A 4RX6A 3CJ2A 3DM2A 1LFWA 4JI1J 2IVMA 1LNQA 2A6OA 1JLCA 5ELZA 3C65A 4DF8A 4PKDB 3QDKA 2BJ8A 1HQUA 2DGWA 4J7CA 4WK1A 1FFGB 4Z0UA 4K0KF 1F3FA 1TKZA 2QGFB 2VL1A 1M5OC 4O5BA 2P9EA 3MPUB 3KXDA 2CKWA 4PL8A 1BQNB 5L1IA 3O3GA 2CIMA 1HR0F 1SH3A 3VESA 3TZXA 4FK0A 3IXQA 1N8RO 5ADZA 4TLQA 2B0GA 4O4RA 3UN5A 3CIMA 5I3QA 2KZZA 3P6YC 1NKEA 2J5AA 2CPDA 3BN4A 1DTQA 5K14A 1JKHA 4OZNA 3FEXB 3CPWM 5IWAK 4FF3A 2ZM6F 2ZBIA 3LO3A 2KRBA 1CEZA 1T05A 4CP5A 2DGXA 1VQ6N 4KRFA 8AT1B 3BJYA 1KQSM 1NHUA 1DBDA 3HKZD 4AHCA 4GKKF 2APOA 5KG2A 2LCWA 2HQFA 4MYUA 4DR3J 4B3MK 1AUDA 5SWMA 4U96A 4PG7A 3V9ZA 3F2KA 1YJ9S 2P9UB 2CQGA 3W7BA 1IXKA 1VQSA 4ZVEA 4C8NA 3HZ6A