4H4OA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 141
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4oA05
1JKHA 1BISA 4CJRA 2HHTA 3VQCA 2C28A 5C5JA 4YNQA 5C25B 5F8MA 1RT6B 3NFAA 1RAJA 3GIJA 1LAVA 4MFBB 3JSMB 3CDWA 4M3WA 3UPFA 4E1MA 2CKWA 4DQIA 3K58A 2I5JB 3MTKA 1KRPA 2HMIB 3KLIA 4XPEA 3L2UA 4EYIB 1T3NA 5L1IA 2AX1A 5KFXA 4LSLB 2D7SA 4QPXA 2B6AA 1UA1A 1J5OA 5EUHA 4ED0A 1NJWA 2R2SA 4B9SA 4WZMA 4KBIA 3CJ3A 3QIDA 5KG7A 4Q44A 4CFDA 4KB0A 2HNDB 3OYIA 1F21A 4O3OA 4ZP8A 4PQUB 4ED2A 4CESA 4KSEB 1SH2A 3AA2A 5J2NB 3ISND 1C0TA 4FW2A 3HPOA 4MIAA 3DDKA 1T03B 1TKXA 1HNVB 1VSMA 3SFUA 2R8JA 3HT3A 3OYEA 3E51A 2G8FA 2RDIA 3T5KA 1RT4A 3HVWA 4J9SA 2OA8A 2ZE2B 4K50A 5KG6A 4ZTJA 4I2PB 1W9HA 4F3TA 5DG7A 3V6DA 4DLGA 1HNIA 1L3VA 2KTQA 1S9GB 5KFCA 3M9OB 2HVIA 2YKMA 4ZPBA 4O4GB 3F9KA 4IG3B 4DU1A 1DLOA 1DTTB 2W9BB 1GX5A 4YR0A 1BHLA 4DFJA 1CZBA 1S1XA 2YNFB 1XR7A 3V9UA 4URSA 1ASUA 4DTOA 5KFTA 2FBYA 4F2SA 4J2BA 2HNYB 3CG7A 4XO0A 3HHKA 3EY1A 3SI8A 4WZQA 3HO1A 1Q9YA 3FQLA 1RTDA 3B6PA 5DQGA 1HQEA 2HB5A 5JS1A 3UR0A 2QXFA 3S3MA 2O5DA 3KHGA 4W5QA 3OL7A 4ZPDA 3DI6A 5KT4A 3LPUA 4JS4A 4CJSA 1TVRA 4KHRA 4O0JA 2WONA 1FKOA 2RKIB 4KRFA 4EO8A 5F9LA 4Y1CA 3VQBA 2UUTA 2BQRA 1HYVA 2QV6A 3RBEA 2DPJA 4E0DA 5F9NA 4CJEA 3HSTB 3EYZA 5F8NA 2JEJA 1K6YA 2JC1A 1BQMB 4J9QA 1JLEB 1RT3B 5KFDA 2QK9A 4N47A 4LD0A 1EETA 1BCOA 4IFYB 4BWJA 1J54A 4NCAA 3DLHA 2OPQB 4I2QA 4ID5A 3HPHA 4FJKA 4FVMA 3SQ2A 1S1TA 4NYNA 3QO9A 2P51A 3AO3A 2IAJB 2DY4A 3IRXA 3FFIA 4WFXA 1QSSA 3H5UA 4PUOA 3ZT1A 4FW1A 3WNEA 4Q43A 4BDZA 1SL2A 1SH0A 3FQKA 3DRSA 2RDJA 4ELVA 4ZHRA 4NLSA 2R2UA 3T5LA 4IBNA 2BQUA 4DSLA 3OYBA 4ECVA 4FK4A 1RYRA 3VQDA 1XR5A 3U3GA 4O3NA 4WFYA 3LAMA 2IOCA 1C6VA 2ZQBA 3QZ7A 1CSJA 3LP1B 4TY8A 3LP0B 4ZPAA 3WNGA 1U04A 2ITGA 5I3UA 1LWFA 5EDWA 1LW0B 3KIOA 4JLHA 4E7JA 2XY5A 4IFVA 5KFNA 4DSJA 3AVJA 1BQNA 3DMJB 3LWLA 3SUPA 3ZSOA 1R0AA 4RG8A 4K4UA 3GYNA 1S9EA 3SI6A 3T1AA 1JLGB 4YFUA 2D5RA 1NKEA 4FJGA 5FDLB 4RNFA 1Q8IA 3MR3A 4NLQA 4H54A 4FS1A 4HHTA 3NMAA 3HM9A 3VQ4A 4N41A 5J2QA 5DG9A 2E6LA 3HVTB 2FJXA 4TQRA 4NCBA 5C42A 3H5YA 1ZYQA 4IH5A 2FLLA 1HYZA 4FLXA 3AVFA 1HYSB 4WXOA 4KHYA 2BDPA 1Z4UA 2XWYA 4KI6A 2YHBA 4MK7A 4ZVEA 5E41A 1S1WB 1S6PB 3AA5X 1UOCA 4Y3CA 4CJUA 3DRPA 1VSLA 3HL8A 3V1QA 2ASJA 3BQ1A 4BDPA 3KHRA 1NHUA 5KRTA 2F8EX 3BGRB 3RBDA 4Z4GA 1RTHA 4ICLA 2OPPB 2FVRA 4K4XA 3IN5A 4O0IA 5KFHA 4QOZB 2YNIA 2YNHA 2XHBA 3MXJA 4URGA 5KRSA 1TKTA 1ZBFA 4PA1A 2C2EA 3QIPB 2GBZA 1T8EA 3M8PA 3N6MA 3SUQA 3C95A 2FVQA 1LWCB 4QAGA 3S3NA 2JC0A 1IKXB 3PW5A 4M3RA 4FBTA 4G1QA 1RT5B 1L5UA 3KK1B 4OKJA 3L2WA 3RTVA 3PX6A 1S10A 2VG5A 3OYFA 1KHVA 3D45A 4FJNA 4FXDA 2J6SA 1RA6A 4NLGA 4M3XA 3DLEA 2AGPA 3V1RA 4FLTA 4FM2A 4TSXA 2FJVA 3T19A 3ULDA 1S1UB 4Q45A 3KK3B 2W8LA 1XWLA 4J9KA 4F4YA 3KLFB 1JLBA 3SPYA 3RMAA 4OKEA 3OYHA 2P1JA 3RR7A 5DK5A 3PW4A 1QSLA 1FKPA 2G8WA 3DM2A 2ZD1B 3G6VA 4FM1A 4RW4A 2I1RA 2VG7B 3H40A 4LH5A 4EZ6A 1C1CB 3DRRB 1JL1A 3S3OA 2VWKA 1U4BA 2F8SA 4F4KA 1NJYA 1NK7A 1X9SA 3OSNA 5KFVA 1T94A 4CE9A 4HUGA 5DG8A 4ELTA 4ECSA 2QKKA 3O4NA 3HVRA 4H4OB 1YTUA 1EKEA 3MR6A 4BDYA 1RT2A 4RW8B 1D1UA 3E01A 4MK8A 4KTWA 3RAQA 1I39A 1QAIA 5KT2A 2V4QA 3L2QA 3HP6A 4TLRA 1NNDA 1RBSA 1NHVA 5J2MB 2WRMA 5KI6A 2VG6A 4KFBA 2DPIA 2A1SA 3AVBA 1B92A 3LANA 1QUVA 4ECQA 3V9XA 5I42A 3PJWA 1L3SA 3AVAA 3UDLA 1SUQA 4M45A 3TQ1A 2OPRA 2IJNA 5KT5A 2B5JA 4J9LA 1WLJA 3KHHA 3ZT4A 5KT3A 2IJFA 4TYBA 1TAQA 1RDDA 1J53A 4ED1A 5K14B 4O3RA 4CHOA 3VQQA 1ZBHA 1HQUA 3T3FA 3LP2A 1VSDA 2BE2B 3C6TA 2DFFA 4YMEA 3RMDA 4CHQA 1RYSA 3B6OA 3KKSA 3I0SB 5KFYA 4LSNA 1KHWA 3DLRA 2D0CA 2X74A 1RT7B 3SFGA 3MEEA 4QWEA 4ECTA 2W7OA 2C2DA 3PJXA 4DTPA 4DSFA 1KTQA 3RRHA 4OJRA 4CK2A 3AO4A 3M8QB 4IG0B 4ECXA 2YNGB 3UQSA 4CHYA 4RNHA 2GV9A 4KKOB 3WNFA 4CEDA 5CYMA 1K1SA 1DTQA 1TL1A 1TK5A 1A5WA 3OVNA 4NLOA 1NK9A 2E9RX 4XIUA 1JLFA 2W9CA 3RRGA 2Z1GA 4RNNA 4KHMA 1RILA 3CM6A 2IC3B 1RA7A 2RF2A 3L2VA 2HHWA 1N5YB 4DSKA 3C6UA 4FCYA 2FJWA 5C24B 3DLGA 4K4ZA 5DLGA 4H4MB 4MKBA 3ASMA 2XGQA 4KHUA 2FVSA 2BGGA 1VRTA 5HBMA 5HRPA 4IRDA 4FJ5A 1UWBA 1REVA 4NCGA 3CO9A 3V4IB 3QYYA 3OS0A 1ZBUA 4EYHB 2RPIA 4F2RA 2ATLA 1JKHB 1NJZA 4B08A 4B8CA 5KFKA 3ZSQA 3BSAA 1VRUA 3OHAA 4NYZA 3VN5A 3NH0A 3KLIB 1RBUA 1GOAA 1MU2A 2EHGA 1S0MA 4CEOA 1IKYA 2B6AB 3V9SA 2XY8A 4KE5A 1J5OB 1WNEA 1S9FA 3AA4A 3ALYA 3PW7A 5T7BA 4ECYA 3ZCMA 2R8HA 1HMVA 4F8RA 3BSNA 1JLCA 4C8OA 4CFAA 2C2RA 3H5SA 1KVCA 2XGPA 2BR0A 3IS9A 1BIUA 3HP9A 4DFMA 1C0TB 3NGIA 3TABA 1WSHA 4E7HA 2R8GA 2Z1IA 3MAQA 4Q0BA 1TKXB 2UVRA 3BQ0A 4AHVA 4E89A 1IKWA 2AWZA 4CIEA 1RT4B 1KFSA 4J2DA 4FM0A 1NKCA 3KLHA 1UA0A 4LH4A 4URQU 3OYDA 1LW2B 1YVFA 3TR8A 3CFOA 3V6DB 2ILZA 1HNIB 4K4TA 4F50A 2YKNA 3DYAA 2YKMB 4U6PA 1Z25A 4Z4HA 4DQQA 4ED6A 1DLOB 1QE1A 3GV5B 1RTJA 2Q3SA 4GVMA 3NL0A 1TV6B 3ZSZA 3NH2A 1S1XB 4G3IA 4CERA 1TKZA 4CEFA 1SV5A 5KFEA 3DOLA 1NK4A 3IAYA 3VQ8A 1FK9A 2IMWP 2ILYA 2BRLA 3QLHA 4DQPA 2FBTA 1RTDB 4MIBA 3OJSA 3QETA 1HQEB 4IR1A 4FLUA 4FJ7A 4CGDA 2LSNA 3OL9A 4CJ4A 1RBTA 3V9ZA 3DI6B 2OPSA 4B3OA 4Y1DA 1TVRB 3KLEA 1GOCA 1TQLA 5L1LA 2BQ3A 2WONB 1FKOB 2ETJA 4GC6A 3IG1A 3LAKA 4HYKA 2O4GA 2GC8A 3G6XA 1X1PA 3BJYA 4RNOA 1RDRA 4O4RA 4ECWA 1TL3A 5CYQA 4IRKA 3ZSWA 4CCHA 2HWHA 5SZTA 2PZSA 3N6NA 4JRQA 2WHOA 3U6FA 3CFPA 4CJTA 1S97A 1BGXT 4ZP6A 5HRSA 4KB1A 4CFCA 4DFKA 1RDAA 3RB0A 4DEZA 5HRNA 5DGAA 3PR5B 3MEGB 4DSEA 1T05A 4QW9A 4DQRA 1EETB 1OS5A 3M9NB 2X6SA 4DL6A 4AHCA 4CGJA 3NF7A 3AVKA 4CF2A 4I2QB 4ID5B 2W8KA 2FVCA 1S1TB 3QO9B 1JLAA 1C0UB 3M8RA 3NCIA 4WE1A 3TAPA 4J9OA 4YR3A 5L9XA 3IRXB 3FFIB 3H59A 4Y2CA 4ED7A 4PUOB 3V6HA 2Z1HA 2XY7A 3MXMA 3DRSB 1SKWA 2JLEA 4ZHRB 3QEXA 2JEFA 1XI1A 1U45A 1IKVA 3FSIA 2X78A 1WAFA 2IBKA 4JS5A 5JUMA 1ASWA 1JXBA 4HTUA 3LZIA 3NF8A 1YT3A 3AVGA 4CEEA 4K8XA 4TY8B 3L3VA 4M94A 4FLVA 3NDKA 5I3UB 1LWFB 3Q8RB 3CDEA 5EU7A 4O55A 4BE2A 4IFVB 3P83D 4EBDA 1JXEA 1BQNB 3QESA 3PX4A 2DFEA 3SQ1A 3F73A 2OPQA 1SL1A 2R2TA 1WSFA 1R0AB 2AQ4A 2V4RA 1S9EB 4DTMA 3G10A 3OLBA 2V0NA 3LP3A 4RW9A 4CECA 2BANA 5HROA 3CWJA 4IR9A 3RB4A 1S5JA 3TAMA 5J2QB 4CIFA 4I9QA 1QSYA 3H4DA 1NKBA 4OGCA 3ZSVA 4E1NA 5C42B 2EX3A 4KB7A 2F8TA 3KHLA 3OYGA 4NLYA 2E9TA 4Q8EA 4F4WA 3K2PA 4QWAA 3SUNA 3AO1A 1HARA 4FS2A 3OYLA 4CF9A 3GV8B 3DRPB 4YP3A 1LW0A 1KLMA 1C1BA 3RB3A 3L2RA 3TWHA 2JEIA 1RTHB 4ICLB 1XR6A 3QEIA 2PYJA 4HCCA 1O1WA 4DTJA 3KK2A 3VQ5A 1D9DA 4LQ9A 2YNIB 1L3UA 4B9NA 4RW6A 2J6TA 4I7FA 1WNSA 2YNHB 1VSIA 1TKTB 2FBVA 2JEGA 3M8PB 3RMBA 2KW4A 2F96A 2GUIA 4Y34A 3SZ2A 4KO0A 2XY6A 4QWDA 4K4VA 4FZZA 1U09A 4G1QB 4ZVFA 2KZZA 2G8HA 1VK0A 2VG5B 1HYSA 3KMSA 5JS2A 4Z4EA 3CVKA 4F3OA 1BI4A 1A5XA 3V81A 3DLEB 4DF4A 1W25A 2R8IA 1S6PA 1NK5A 4WYWA 2UUWA 3KLGA 4B9TA 2HHXA 2Z1JA 4FK0A 4O44A 3H4BA 2D3ZA 3K57A 3KJVA 4CEBA 4LY7A 1SH3A 1JLBB 3EZ5A 4J9PA 1EXQA 4ZPCA 1FKPB 1N6QA 3DM2B 4RW4B 2KQ2A 1NOYA 1ZTTA 3VQ6A 4YQWA 1HPZA 4CIGA 3G86A 1QHTA 4CGHA 2UVWA 3D28A 5F8LA 3HJFA 3DOKA 3I8DA 4M3TA 3MEDA 1RT2B 4K4SA 4OPJA 3E01B 1QS4A 4R8UA 1JXLA 3PO4A 4JUZA 5KFMA 3OLAA 1S4FA 2CJQA 2FLPA 4PWDA 3MF5A 1JLQA 1A5VA 4M42A 3NHGA 4IKFA 2X6NA 2VG6B 3ITHA 4KFBB 3UIQA 4FLYA 3SQ0A 1RTIA 5I42B 3TAGA 5J2PA 1IM4A 3EPGA 4DS5A 4B8AB 2G8KA 2IDOA 3GIKA 1ZTWA 1KCFA 5EWGA 2XI2A 1SUQB 5KFWA 3Q8QB 2WOMA 4CF1A 2PYLA 2D3UA 2NUBA 4UQGA 3KD1E 2OPRB 1RDCA 2OZSA 2B5JB 3NAEA 4C8LA 2JGUA 4RU9A 5T14A 4DTRA 5D3GA 1WSGA 4OLAA 1HQUB 3VA0A 3RR8A 3LP2B 1S48A 5CY4A 3CFRA 4AHRA 1Q9XA 3O3HA 3C6TB 4DG1A 3OL6A 4IH7A 4JV2A 4LSNB 4NLPA 5EWEA 5L1KA 2DTUA 3QERA 2XO7A 3MEEB 2PY5A 4HKQA 4ED8A 1FXXA 4H8KA 1U48A 2G8UA 4EBEA 4DL3A 3L3UA 1S0OA 4OGEA 4CK3A 5KTQA 3NE6A 2OH2A 4WFZA 1EP4A 4RW7A 1EX4A 3HYFA 5KT6A 2HNZA 2IGIA 4KHSA 5KFBA 5CYMB 5KFJA 4FJIA 1DTQB 4U7CA 1TL1B 1WN7A 3BQ2A 2Y1IA 3GQCA 1ITGA 1YTAA 4IDKA 5J1EA 4CHPA 3ICLA 2Y1JA 3OS2A 3TANA 1JLFB 4DL7A 4KAZA 4CFBA 4DS4A 1C1AA 3V1OA 4L8RB 1TAUA 3JYTA 4M41A 4RZRA 3AO5A 2RF2B 4ZTFA 4FBUA 4CJFA 2HHUA 4NLXA 3C6UB 3RB6A 3LALA 3K5OA 1LWEA 3DLGB 4BE1A 3CDUA 2DFHA 1C2PA 1S6QA 3VQAA 2HHVA 3M8SA 4BWMA 1VRTB 5HBMB 2IM0A 3KOAA 1UWBB 1REVB 3LWMA 1SKSA 4NCGB 3I0RA 2IM3A 3D5MA 4NLVA 3QZ8A 4NLDA 4DL5A 3V6KA 2VWJA 4QCLA 3MECA 5KFLA 4B9MA 4W5NA 1D9FA 2GIRA 1VRUB 2O4IA 4KV8A 4R5PA 2IM2A 5HP1A 2AGOA 4CGIA 4QWBA 1IH7A 4FJHA 5F8IA 1WSEA 3PVXA 1MU2B 2J6UA 3OYAA 5HLFA 4DTSA 4ELUA 1IKYB 1S1VA 4NZ0A 2OZMA 3FDSA 5FRMA 2AGQA 1N56A 3SV4A 5KG4A 1HMVB 1RT1A 3SYZA 1JLCB 4CK1A 3VQ9A 5KFGA 3OYMA 4BE0A 4N5SA 1B9FA 5KGWA 2KZMA 3IS9B 3RWUA 3VQPA 2EC0A 1XHXA 5KG1A 3AA3A 3QEVA 2WTFA 1RNHA 3FRZA 4Q0BB 5KFIA 4AILC 3NBPA 2FC0A 3MXIA 1IKWB 4MKAA 3SPZA 4FZXC 3KLHB 1J9AA 1D8YA 3QNNA 3DLKA 4CF8A 1TV6A 4XPCA 4Q5VA 2OYQA 2YKNB 3DYAB 5C25A 2E6MA 1RT6A 4TN2A 4KHWA 3OL8A 4MFBA 4TYAA 1QE1B 3JSMA 1RTJB 1CLQA 4FJJA 2I5JA 1TP7A 2UVUA 2HMIA 1RCHA 1ZETA 4O5BA 1TKZB 4CJVA 3QGIA 3VQ7A 3QIOA 4LSLA 2HHQA 3THVA 1SV5B 2D0BA 4MQ3A 4IKAA 3DOLB 3GIIA 1B9DA 2C22A 4CF0A 4F4XA 1FK9B 4NLTA 3VQEA 3QLHB 5KFSA 2HNDA 4PQUA 4N56A 4QWCA 4CJQA 4C8KA 1C0MA 5J2NA 4DL2A 2OPSB 4B3OB 3SCXA 4FK2A 3KLEB 3HPGA 3NGYA 4NRTA 3PZPA 4YR2A 3IG1B 3QINA 1NK0A 1LW2A 1TL3B 1T03A 5CYQB 5KFQA 4NLRA 3OY9A 2G8VA 1HNVA 3OHBA 1TK8A 5JXSA 1CXUA 3AVIA 3P5JA 3BR9A 1I6JA 3PR4A 4M95A 2ZE2A 3I5CA 2ZKUA 4ECUA 4I2PA 1N4LA 3V6JA 1T05B 3HXMA 1S9GA 2D41A 1HRHA 5CZ1A 1WSIA 4O4GA 4IG3A 2YHAA 3SUOA 2XC9A 2YV0X 1DTTA 2W9BA 3NGDA 4DFPA 3VQSA 4E7KA 1CZ9A 4EZ9A 3CJ0A 5KFUA 3ISNC 1JL2A 3KKRA 4E7LA 4J2AA 4DWIA 1VSHA 2YNFA 4FJ8A 1JLAB 3OYCA 4WE1B 2HNYA 4J2EA 4Z0UA 4K8ZA 1ZBIA 3O3FA 3TVKA 3WNHA 1U47A 3U3YA 4Z4CA 1IKVB 4IH6A 4LQ3A 2VA3A 4NLUA 1RBVA 4W5TA 3K5MA 3ZT3A 3TARA 3VA3A 3NF9A 5EWFA 4Q8FA 3AVNA 4DQSA 3PO5A 2RKIA 2GIQA 1S0NA 3H5XA 2HW3A 2WK4A 1QQCA 4DTXA 5KG2A 2ASLA 3K5LA 3MEGA 3MFHA 3OYNA 4W5RA 3TAEA 2RN2A 5KFOA 4J9NA 4EEYA 4AH9A 1BQMA 3ZSYA 1JLEA 3SJJA 1C0UA 3QGHA 1RT3A 2WCXA 4B9LA 3PHEA 4IFYA 3KD5E 4RW9B 2BANB 5HROB 2IM1A 3PY8A 2HHSA 1KVBA 1BIZA 1NK8A 2D0AA 4CJLA 4CEAA 3TAMB 5KT7A 1XC9A 3C94A 1JIHA 4X2BA 5F8GA 5KFPA 4FLWA 1TK0A 2IAJA 3EZUA 1UAXA 4C8NA 3SQ4A 4OKKA 3SV3A 2XI3A 2KFNA 1CXQA 4IOBA 5KFAA 3AV9A 3OYJA 4KREA 1N48A 3PW2A 5DGBA 4DLEA 4AHSA 4O3PA 2V9WA 3CM5A 3KMQA 2XCPA 1KLMB 1C1BB 4IQXA 1KSPA 4MH8A 3LP1A 1ASVA 2B43A 4OLBA 3LP0A 3QEWA 2XCAA 3KK2B 2ASDA 4AHTA 4RW6B 3P1GA 2WB4A 2B4JA 5KG0A 4I7FB 4J9RA 4CJ5A 3M9MB 4HVJA 1TGOA 2W7PA 3DMJA 3BREA 3AVHA 1QAJA 4CJPA 3PX0A 3LZJA 1XHZA 3GIMA 4OVLA 4KO0B 1NK6A 5FROA 4RUAA 1X9WA 1JLGA 5FDLA 4FZYA 2ALZA 4DTNA 2AX0A 4EP4A 4EBCA 1BI4B 3AO2A 3V81B 4ZVHA 3GV7B 3A2FA 3HVTA 3KLGB 4W5OA 4OPKA 5SWMA 3OJUA 3TAQA 4DMNA 1L3TA 1QTMA 1GOBA 4O44B 4CEZA 4ZP9A 3KJVB 3NF6A 3H08A 3KTQA 3NH1A 4M3YA 1S1WA 3TI0A 4AHUA 1LAWA 4FJXA 1N6QB 2QE5A 4ID1A 2AJQA 4TY9A 3G6YA 4TQSA 1W0HA 5KFRA 3ZSXA 3IGNA 1HPZB 3EPIA 1VSKA 4C8MA 3BGRA 2P5GA 2OPPA 4DL4A 3QNOA 3H2LA 4KPYA 3Q8PB 4E7IA 5CZ2A 3DOKB 3CJ2A 4ZP7A 4J9MA 4KHQA 3KNAA 1WSJA 3SNNA 3MEDB 2FLNA 4R8UB 4ED3A 4M3ZA 1Y97A 4GMJB 3QIPA 1RBRA 3NAIA 4FJ9A 4PWDB 4I9LA 1LWCA 1JLQB 1IKXA 2BRKA 5KGXA 1RT5A 2IA6A 3ITHB 3T5HA 3KK1A 2HWIA 3Q8SB 3OYKA 4HUEA 1RTIB 5J2PB 4RUCA 4DTUA 5KFFA 5DLFA 3CQ8A 1VSFA 2HAIA 3HKWA 1S1UA 3KK3A 2WOMB 3NKYA 4ECRA 4KAIA 3ZT2A 4DF8A 3ZSRA 2IS3A 4CJWA 4FJLA 3N6LA 1BCMA 3AVCA 5F8HA 4DU4A 3KLFA 3OSPA 2AU0A 4IRCA 4O3QA 3O4QA 2P5OA 1I3AA 1HJRA 2ZD1A 1U49A 4PY5A 3MFIA 5D3GB 2VG7A 5FRNA 4NLWA 1K1QA 4Z4FA 1C1CA 3DRRA 4B9VA 5KG3A 1ZBLA 1IO2A 1TKDA 3BSOA 4GC7A 4DG1B 4BACA 2A1RA 3OS1A 1NJXA 4CEQA 3QGGA 4R0EA 5KG5A 4H4OA 3LPTA 4E19A 3MR2A 1Z26A 4RW8A 3K5NA 4CHZA 3CJ4A 4KI4A 3L8BA 1X9MA 4NRUA 2W9AA 3LDSA 5J2MA 1EP4B 4RW7B 3GILA 5DQIA 4ECZA 2HNZB 3I5BA 1BL3A 4DU3A 4FYDA 2W42A 5L1JA 5DMRA 3PUFA 1LV5A 4IDKB 2HVHA 5J1EB 1MMLA 4DSIA 3NAHA 4B9UA 2QKBA 1GX6A 3JYTB 3CYMA 1T7PA 4ZVGA 3NGZA 4KTQA 4K4YA 2VA2A 3QEPA 2G8IA 4ZMMA 3IGVA 4JV1A 1D0EA 3D0PA 4HUFA 4Z4IA 1VSJA 2FBXA 3H98A 1LWEB 3PV8A 2W9CB 4F4ZA 1S6QB 4OL8A 5K14A 3CIZA 3BSCA 1NOZA 4N76A 1YVUA 3KLVA 4EO6A 2BE2A 1KLNA 4CGGA 3I0SA 3I0RB 2UVVA 4TXSA 2XRIA 3AVLA 1SKRA 1RT7A 1JX4A 3CJ5A 2ATQA 3O3GA 4GW6A 4KTZA 2KFZA 3S9HA 3MECB 4QW8A 4E3SA 5DQHA 3AVMA 4KV8B 3HVAA 4R5PB 4CJ3A 5HP1B 3M8QA 4IG0A 4O3SA 2E4LA 4M3UA 4MK9A 2R8KA 1WAJA 3HK2A 2YNGA 4KHNA 4WXWA 3MR5A 3PW0A 4KKOA 5HLFB 1S1VB 4HCBA 5KFZA 4JV0A 1IG9A 4FJMA 3RMCA 1RT1B 4K4WA 3G0ZA 3BDPA 4FLZA 3DLBA 3ZT0A 2R7YA 3V9WA 1G15A 3I5AA 1S49A 5F8JA 2R2RA 2IC3A 4CJKA 1VSEA 1KVAA 4WYLA 3TAFA 1D5AA 1N5YA 4CGFA 5HRRA 5C24A 4Y2AA 3T5JA 4EP5A 4H4MA 1SL0A 4NYFA 2FVPA 3NBPB 4CHNA 3K59A 1RDBA 3V4IA 3RAXA 4RNMA 1KFDA 3DLKB 4JRPA 2E9ZA
chains in the Genus database with same CATH superfamily
2MLYA 1M0SA 3BKFA 1PC5A 3M8WA 5HO4A 1RAJA 3NFAA 3VAGA 1LAVA 3SDEB 3JSMB 3JSYA 4E1MA 2CKWA 3K58A 2I5JB 1REGX 3D3CJ 1KRPA 2RUGA 3THXB 4XPEA 4EYIB 3HOTA 2D7SA 1UA1A 2H5JB 5EUHA 4ED0A 2R2SA 1FRLA 1LXJA 1U25A 4BRFA 1ZC6A 2NREA 1F21A 5AQXA 4CNYA 3H45C 1FHTA 1SH2A 1U26A 1H2UX 1X8DA 3I9ZA 1P9QC 4A4JA 4A46A 4MDAA 2GJIA 4MIAA 1HNVB 4BR9A 3RSEB 2DR9A 5AQMA 3U9ZA 3E51A 2G8FA 4W98A 4B3RF 3NP5A 4IJAA 3T5KA 1TFWA 1RT4A 3HVWA 2OA8A 3BR8A 2ZE2B 1NUEA 4K50A 1W9HA 4M63C 2GTDA 4U9RA 3MUTP 3ZFVA 5F1XA 1DLOA 2Q0RA 4R79A 1GX5A 5B08A 3V9UA 3CDBA 3PKMA 1JNRB 8AT1B 1JXVA 2CZ4A 2HNYB 4FYVB 3MM5A 5DS7A 1PILA 3VAFA 3HO1A 3MM7B 5LXRA 1Q82T 3F41A 3DDNA 4RTFD 3B6PA 5DQGA 4OZ1A 5JS1A 2QYGA 1Y10A 1NB2A 1S77D 4ZPDA 3DI6A 4KHRA 4O0JA 2XMKA 4GKJK 2WONA 3LGMA 3ZTQA 4EO8A 3VQBA 2CWXA 4HI1A 2DGOA 4USIA 2QV6A 2KXNB 3RBEA 4E0DA 4X4UA 4DMZA 6FD1A 5F8NA 2GNKA 3RUBL 2RE1A 3TUZC 1K6YA 5CCLA 2QK9A 2BV3A 3DLHA 1ZS6A 4I2QA 4ID5A 4FJKA 4FVMA 4B3RJ 3MWTA 3CCUN 4CH0S 4X62K 5BPNA 2GJ2A 1B0VA 4JBCA 1R3NA 4OZ3A 3D66A 2J0SD 3DGPB 4FW1A 3MGJA 4BDZA 3HFVA 3FQKA 4ELVA 1RU1A 2YX1A 4J91A 4NLSA 1MN7A 4DSLA 3R9PA 3CERA 5LT5A 4PG4A 4FK4A 4BR7A 1S57A 3NG8A 1RAAB 3UW1A 1W2BM 5HVHA 2R7VA 4U96A 2LEBA 4CLTA 1CJUB 1CSJA 3HMJG 2JNJA 1BHNA 2IRYA 4ZPAA 1NRKA 2ITGA 2YX7A 3Q8YA 4OX7A 4K0KF 4E7JA 2EVZA 4DSJA 4DXLA 3OFHA 4A8YA 1EKSA 1YI2N 2VCPA 4K4UA 2CQ2A 3N4WA 3W5XA 3MD1A 3SI6A 4DX6A 2VPYB 1SJQA 3PACA 4FJGA 1FNOA 3ENWA 1I51B 2XWXA 1EJ7L 4B3RK 4FF3A 4H5VA 3NMAA 3VQ4A 2YWWA 2RAQA 5DG9A 4CO2A 3HVTB 4NCBA 3HX9A 5C42A 3CT9A 1FEHA 2NZ4A 4FLXA 2JL9A 2ZH3A 3HF5A 4I6MB 3VAHA 3X1LB 1U2VA 2DR6A 3BGOP 5A8RB 2N4CA 3DRPA 4M5KA 2ASJA 3BQ1A 4BDPA 3CCQS 1IG8A 3J81Y 1RTHA 4ICLA 2FVRA 4DR2K 2ZDPA 2DNHA 2CQ4A 2W2NP 3JQJA 5C15A 1KBRA 2YNHA 1DEJA 3P4IA 3MXJA 4URGA 2C2EA 2AHOB 1UVKA 1T8EA 1S3XA 1ZA2B 1QVGM 4M3RA 2HKEA 4JAXA 5JMVA 1YG0A 3W2VA 5KAKA 1F1BB 3Q7CA 2ZBCA 3C3LA 3L2WA 3RTVA 3PX6A 4FJNA 1KHVA 1LNQA 4K0KJ 3C16A 1RA6A 4FWSA 1ILYA 4NLGA 4GO7X 5HN0A 3AHPA 3DLEA 2OTLN 4Y2KA 3PSFA 2QO3A 3OXFA 4Q45A 3MM9B 4YY3F 5C12A 4XAKA 2MQLA 3S1TA 3W62A 3SPYA 5RUBA 3RMAA 1UW4A 2P1JA 1CC8A 1RTZA 2IRXA 1QSLA 2G8WA 5HQLA 1ZM4A 5C0YA 3R5BA 2VG7B 2DD8S 2I0XA 3P31A 2YHXA 5IT9O 2HZVA 3FBEA 1ZZNA 6AT1B 4CH7A 3OSNA 1H2TZ 2YKOA 4YN3B 3ZLJA 1T94A 5LJ3Y 4HUGA 3MM6A 1YTUA 3MR6A 4RW8B 1ZAWA 1VBZA 4ILMA 3UCUP 1KVJA 1K8KA 1I39A 2ASYA 5KT2A 1V3ZA 2V4QA 3HP6A 4TLRA 4C0BA 1NHVA 5J2MB 2WRMA 2UXCF 2OKQA 3AVBA 3CCLS 1FRHA 1B92A 3GOIA 5BXIA 2EFQA 4Y0WA 4A61A 2VONA 4JK9A 1V3SA 2NRXA 1FERA 4FPAA 4YORA 2A0FB 2ZH6A 4U67Q 2V69A 4M45A 2DITA 3VQTA 3J7A1 2B5JA 5KT5A 3T1YF 4K8RA 5HMWA 1KOOA 3LUYA 4CI6A 2LQBA 1RDDA 5K14B 4O3RA 1HQUA 3AAWB 3LP2A 3QJPA 4DUYJ 2JLFA 2V8VA 2YKAA 3B6OA 2DNKA 5KFYA 1KHWA 3DLRA 4C8ZA 2D0CA 2BKPA 3I87A 2XHWA 2X1AA 1LFWA 4QWEA 4NLBA 5D6GA 3O6WA 4DTPA 2AW0A 1X4AA 4IG0B 3WX4A 4DBQA 3LW5C 1QHAA 4CHYA 3I56S 4HHJA 3O8MA 2GGPA 5E84A 2LQ5A 3MWPA 1YSJA 3BPDA 3Q89A 2HGNA 3TEHB 5CYMA 1NM1A 2OTJS 1VYAA 4M7XA 2YQ0A 1TK5A 1GTHA 4JP8A 3GG0A 4HEA9 2E9RX 4C6AA 3RRGA 5E3CA 3NS5A 2Z1GA 2MZTA 1F6TA 4CLWA 1U1LA 2IC3B 2HHWA 3G8SA 4DSKA 2YH0A 1GNKA 1FJCA 4P73A 2FJWA 2FZCB 1FE4A 2YBVA 3J80U 3ASMA 2XGQA 4KHUA 4YY3K 1F2GA 3AXKA 3BYRA 4ZLNA 5GAEI 2AJ4A 3TUPA 4MLEA 3T1YJ 3M2VB 3V4IB 3PCOB 4FWRA 2VBZA 2HQCA 1T9XA 4EYHB 2RPIA 4J37A 3TZWA 5D0GA 1JKHB 4PKHA 4B1YB 1X5TA 4X66J 7FDRA 2JH3A 1VRUA 2ITMA 4NYZA 2EEYA 2YHWA 2C2OB 1ACMB 5BN8A 3NH0A 2RRBA 4MKVA 5DDPC 1UETA 1MU2A 2QGFB 3J7Z5 4CEOA 1NZAA 1NLKL 2ZH4A 2RDDA 2FZGB 2QXLA 3QBCA 1YGYA 4MLHA 5T7BA 1VQKN 3X3UA 3VV2B 4CFAA 1DQAA 3AH6A 4LF8F 3EKUA 1VAZA 1KVCA 2UXCK 2DRAA 5K9FA 2CJ9A 1OWXA 1KTVA 4BQLA 3TABA 2DGSA 3OT9A 2IMOA 3MAQA 4Q0BA 3PEJA 3BQ0A 1UEVA 3QRPA 3T1YK 2P9SA 3CDAA 5CABA 5IT4A 3MM8B 4CIEA 2P2CB 2CJKA 4FM0A 4J2DA 1NKCA 1UA0A 3EZWA 4LH4A 4OPAA 1M1KO 3CFOA 4UW2A 4CQ1A 4F50A 2O8FB 1YIJS 4U6PA 2AYGA 4HH0A 5A8KA 4AQYF 1RTJA 2Q3SA 3TSQA 1VQ7N 1TV6B 2DH8A 1KONA 2HF3A 3ZTSA 2IVOA 2GQ2A 5ETVA 1FRXA 1WACA 1X4GA 2EFOA 2A41A 1RHJB 2R3VA 4XDDA 3IAYA 3UKRA 2E88A 3QLHA 2DGWA 5A6WA 4JI4F 3ZZZA 3GCXP 4IR1A 2ZBQA 1YJ7A 2IVPA 4B3OA 5EHHA 1GOCA 3KLEA 1TQLA 2LDIA 1HNWK 2BQ3A 1AZSB 3UDEA 5LXYA 4ECWA 1TL3A 5CYQA 1XIQA 4HHUA 2DEIA 4P72A 3WXLA 2DNYA 1BGXT 4ZP6A 3PYGA 4FYYB 2I7NA 3W65A 4DEZA 1VQ5N 3A12A 5HRNA 2D0PA 3MEGB 3ULHA 3U1LA 1YUWA 1OS5A 2QWRA 2QFJA 2VZ9A 3TU5A 4DL6A 1K73O 3B54A 3NF7A 1DGKN 3HI9A 3QO9B 1FX4A 1JLAA 1C0UB 2LQ8A 5C2DA 4WE1A 2NCKL 3R6MA 3ZZRA 4J9OA 3IRXB 4ED7A 3FFIB 3H59A 5HSPA 4PL8A 2W4CA 2XY7A 2VC0A 3MXMA 1M90T 2VFRA 1S79A 4QZVB 3DRSB 4AQYJ 3R27A 1SKWA 4ZHRB 1G2EA 5T7LA 2Z30B 1U45A 2ACYA 1XI1A 2DISA 4CLZA 4MJKA 2X78A 4JS5A 5AE1A 4CLFA 2HWTA 2J0WA 5CR4A 5AQYA 1WG4A 4HTUA 5LMNF 4WK1A 1RAHB 3FZBA 3MX5A 2C3UA 3L3VA 3UO0A 1LKZA 2LQJA 4JI4J 2YKQA 4LF8K 4BE2A 1LWFB 3M6VA 4BY9C 3I6PA 3P83D 4EBDA 4DR5K 1BQNB 3H6EA 1N54B 2F4VK 2OLWA 1U0HA 1WDTA 4TU9A 5BJRA 5HAOA 2AQ4A 2HBLA 1MW7A 3UDVA 3G10A 4Y2MA 1IBMF 5JVGL 1FEEA 4FPRA 2WC9A 4CECA 1PCAA 3PRDA 1GK8A 3ELHA 2RT3A 3TAMA 4I9QA 1QSYA 1WC6A 4DV4F 4OYMA 2F8TA 4MTPA 3Q7BA 2E9TA 4AQYK 4TVAB 4C7QA 4BGBA 3SUNA 1GMWA 1E6YB 3NEKA 3NLCA 2FGCA 2V4JA 3GV8B 4YP3A 5HI7A 3L2RA 3TWHA 3W5ZA 3QEIA 1YJVA 4IOAQ 1GLFO 3BZKA 4M5HA 3KK2A 3HSCA 3GIRA 1GLDG 4LQ9A 3RW6A 5D0HA 4RW6A 3E9PA 4CNZA 2OGUA 2XZWA 5IXUA 1VSIA 2FBVA 2LXIA 1U7LA 4DR1F 5LMNJ 3R2DJ 4N77A 4CVNE 2Z2LA 4FKXA 2GUIA 4Y34A 2W4DA 2XY6A 2ZFHA 4G1QB 1YHQS 3UD4P 1AROP 4G6VB 3ENHA 2VG5B 2B4UA 4Z4EA 1BI4A 1A5XA 3OTEA 4DF4A 2ZBPA 1DJ0A 2R8IA 3IFRA 1Q82O 2MQNA 2HHXA 3O08A 5HQ8A 1HA1A 3WUHA 2D3ZA 3POTB 3K57A 2CUYA 1JLBB 1IBMJ 3U02A 4UOGA 4ZVSB 3TOQA 4YOXA 1FKPB 4RW4B 2FSJA 3W9IA 4YQWA 4USMA 1HPZA 4DV4J 3DXSX 1HI8A 4NZ7A 2I6WA 2YJEA 3DOKA 3I8DA 4OI0A 4DR7F 1YK9A 3E01B 1AFIA 4R8UA 1JXLA 3PO4A 3OVAA 2A3ZA 4L6V3 3P6YC 1JLQA 4LMZA 4I56A 4XEIA 3A5NC 3BGLA 3NHGA 3OBIA 1RI7A 2XMVA 4EU0A 2VG6B 4ANDA 3T7ZA 3ITHA 4ANCA 2L08A 1OVQA 2VKRA 4FLYA 2CPEA 4BRPA 1RTIA 2V2ZA 5I42B 1IM4A 1NDLA 4B8AB 2IDOA 5CD4A 2QMUB 5EWGA 1SUQB 1XTZA 4UQGA 2OPRB 4QR2A 3Q23A 3H46O 1IBMK 2KKZA 4C8LA 4LFBK 2MKJA 1N34F 2GQQA 3AODA 2XS7A 3W64A 1VQMS 3DU5A 4AT1B 4RU9A 1FXLA 2XSJB 4JI7F 1WSGA 3D0GE 3VA0A 3D6TB 3HSDA 5HANA 3A8YA 3FK4A 1S48A 1KAYA 1Q9XA 3O3HA 5CHIA 2JVRA 4DG1A 1OPIA 4IH7A 4LSNB 3VEXA 2XO7A 3R7NB 3FCWA 4ED8A 1FXXA 4H8KA 3CJ1A 1VQLS 4CLLA 3D67A 1S0OA 4H0TB 2F8HA 3MMBB 2NSBA 5KTQA 2AIRB 3NE6A 4ZKAA 1VMBA 4X4OA 5KT6A 2HNZA 4Y00A 4KHSA 4PG5A 8RUCA 1TL1B 4QOTA 3C14A 1YTAA 4O5FA 1TR0A 4DR1K 3OS2A 1JLFB 4P9SA 3AT1B 3GE1A 2E44A 4KGKA 4JKGA 3I31A 2PEHA 2RF2B 3L7UA 4ZTFA 4IQMA 1S7IA 3C6UB 2J9DE 1VJWA 3LALA 2ZKTA 1LWEA 1HBOB 3LA0A 3A3PB 1C2PA 1S6QA 1T9TA 2P9NA 2HHVA 1RAFB 4F3MA 3C15A 5K20B 3TJ9A 3KOAA 3CJQA 4I6WA 3TPQA 1HFEL 1REVB 3AB4B 5A76A 3I0RA 3CD0A 2GEMA 2IM3A 2VYPA 3MCOA 4NLDA 1NPKA 1N34J 4A8OA 2E5LJ 2Y0BB 4QCLA 4JI3F 2QA4G 5KFLA 4B9MA 1D9FA 4CZLA 4KV8A 4R5PA 4CGIA 4QWBA 1IH7A 3BDEA 4K41A 4Z94A 3LPEA 3OYAA 1HWUA 4ZVQB 1IKYB 1AFJA 1S1VA 3CCTA 3CJ9A 4DR7K 4UOHA 4UT4A 1VRQC 3CSKA 2W40A 4ILHA 2DNRA 1HMVB 1RT1A 3SYZA 2ZH8A 5BREA 4CK1A 2W41A 1N33K 1Z2ZA 2XNRA 5KFGA 4DQ8A 4N5SA 2AJ1A 5D77A 3WXMB 5KGWA 4TKTA 3VQPA 2EC0A 3WXKA 1RWUA 2C3MA 4P2FA 3AA3A 3BPSP 1T9YA 1UVNA 2D69A 4CIOA 1RDUA 1TL7A 2NXJA 5KFIA 2G2ZA 2ATCB 4P71A 4AILC 3MAAA 2XYHB 4Z2XA 4IO8A 2XB2D 1IKWB 3SPZA 4RUHA 1N34K 3KLHB 2DHHA 3HHNB 3QNNA 4CF8A 1TV6A 4C23A 4JI7K 3SCJE 3DYAB 2M2BA 4OYXA 2R7WA 3TYTA 4ZCIA 3SDEA 2HQ3A 1QE1B 3JSMA 2RQKA 3ZTOA 3PYDA 2I5JA 4PG6A 3MAHA 4O5BA 3THXA 2ZJPQ 4YDUA 1NGAA 3QGIA 3MMVA 1RHUB 4RLEA 3FEYB 4UTGA 2DEJA 1FWLA 2D0BA 3PRBA 3DOLB 4LF2A 3GIIA 5LL6Z 4JI3J 4CF0A 2KVQE 4IZ9A 4PG8A 2MJNA 5KPZA 4WP9A 4N56A 4DV1K 4CJQA 3G8QA 4C8KA 2OPSB 1GLBG 1FJGJ 2B3TB 4YR2A 3KDNA 1T6CA 1S7HA 2ERRA 2K3IA 2GWKA 2VQFK 2BA9A 1NSAA 5KFQA 3GONA 3OY9A 1MG7A 1HNVA 3RSEA 2RUSA 4X4NA 3D1QA 3CW2C 3AVIA 3P5JA 1I6JA 3PR4A 3W8PA 1CULB 1U2CA 2ZE2A 3I5CA 4CTAB 4AFFA 1N4LA 2Q6BA 2D1KA 3VAIA 1YBAA 2M70A 4USHA 3Q0AA 1YITN 3FZLA 1QAXA 5AXNA 2XC9A 3O9UA 1WTFA 4E7KA 3BN7A 5J1NA 3ISNC 3G4SN 2FYXA 4HVZA 4J90A 5IWAF 3SSRA 5U47A 4LF7F 2JFKA 4K7QA 4JI3K 2HNYA 4K5RA 1K0TA 3VPZA 5CZVA 3AD9C 3MM7A 2VL1A 4A47A 3VVUA 3WNHA 3G9CA 2RD5C 4A8KA 4DV7F 1NLVA 3VOVA 4K25A 4Z7YA 2VA3A 2NS1B 3P5TL 4WTOB 4Q8FA 3PO5A 1QQCA 5KG2A 2ASLA 3K5LA 2DVIA 2C2ZB 2MSSA 5IFMA 3MFHA 5ETSA 2CQ1A 4W92B 4W5RA 4I1TA 3TAEA 1WJ9A 1IBKF 2E2OA 2RN2A 1SZ2A 5KFOA 3G8TA 4EEYA 4AH9A 3FMWA 1SJ1A 3OBWA 4AYBD 1F0XA 2OEKA 4FP9A 3M6WA 2E20A 3H2UB 1V9OA 2WVDA 2WCXA 4CRJA 4B9LA 2VIHA 4FF1A 2HFOA 2BANB 4DV5F 3PY8A 1KVBA 1BIZA 2D0AA 4CEAA 4IOCL 3CCQN 2DH7A 1XC9A 3A8JA 3MCAB 4GVBB 5KFPA 5I4MA 3DC2A 1K44A 4C8NA 3BO4A 3DGPA 2UUBF 4OKKA 2APOA 1UVLA 2KFNA 3LDQA 3F56A 4IOBA 3AV9A 4KREA 2W2MP 1XQIA 2HIQA 4O3PA 4S0MA 5IWAJ 1C1BB 1YDLA 4LF7J 1CJUA 1KSPA 4ZVOB 4MH8A 5F0UA 3ETOA 5HOOA 2ASDA 3LDLA 4AHTA 2XHCA 2JJ4D 2NLWA 2RMLA 1JK9B 1RHRB 3MTJA 5BR8K 4DV7J 4I7FB 2W7PA 3AVHA 3NWRA 3VWSA 1RKJA 3BEXA 2D4WA 1NSPA 3CCVN 1XHZA 3CGIA 3WT0A 2CGKA 4RUAA 2HBRB 1X9WA 3PNIA 2XLJA 5E2QA 2ALZA 5FPMA 4DTNA 2AX0A 4EP4A 4BROA 3AO2A 3THWB 1FRKA 1LK5A 3FBFA 4LRCA 4ZVHA 4ZN1A 2G1HA 1VQOS 3HVTA 4OPKA 1WKJA 4NMXA 2P6TA 4M5MA 4ZP9A 3PHTA 4I6MA 4DV2K 1UZHA 4RWXA 1BQXA 4JI8J 4LR8A 3CJ8A 2UUCK 5A8RA 1NHKL 4FJXA 2P5VA 2QE5A 5IWAK 4Q2LA 4ID1A 3G82B 2AJQA 3THTA 4LF7K 4CLUA 1X3NA 3ZSXA 4C8MA 3EPIA 1VSKA 1SJ3P 2MKCA 2DNPA 1KKHA 3JSRA 2UUBJ 2AJFE 3FZKA 3O2IA 3Q8PB 3ZX0A 5CZ2A 3O1WA 4ZP7A 3R8EA 1WSJA 3MEDB 1EHWA 2UV8G 1XN9A 1Y97A 2AEMA 1VDHA 3RU0A 1S12A 1WBBA 3NAIA 5HJXA 2BJ7A 2VPXB 4JOUA 4H0XB 1N36F 4AM6A 2R7TA 3VEOA 3CPWR 1QUPA 1QVFM 3J80Y 1Z2LA 1FWKA 3MN5A 1IBKK 2G0IA 2V8PA 4RUCA 3CQ8A 4A59A 3HKWA 4NEZA 1M90O 3MM9A 5M2PA 2WOMB 4KAIA 4DF8A 4FWPA 2IS3A 2JZ5A 3J7ZT 1GFWB 3GJQB 4BBYA 3AVCA 4BREA 5F8HA 1CVJA 3O1LA 2AU0A 4DV5K 2AYEA 3Q8VA 1SXLA 3SSSA 4O3QA 1GXLA 3MFIA 2C3YA 2VG7A 3CC7S 3GDQA 3MPYA 4NLWA 3PIPQ 4B9VA 4DHYA 5F2RA 1Y11A 1IO2A 4WQ4C 2A1RA 4DPOA 1KEKA 3QGGA 4PRFA 2OTJN 4GO5X 3JQKA 1RBLA 4QIGA 3MR2A 5C2GA 4RW8A 2PEBA 3PLAA 4CHZA 4CD1A 4NRUA 5J2MA 1KN6A 4RW7B 4PKGA 2OIHA 2HURA 4DU3A 3GP9A 2AA4A 2H3EB 5L1JA 3ZEUB 5DMRA 3PUFA 1BY9A 3SMZA 2ZJRL 2EWSA 1X5OA 2NXCA 4B9UA 2QFIA 1X4HA 1N36J 1OQ3A 1T7PA 2VA2A 1VQ8S 1IJEB 2G8IA 4ZMMA 3N4QA 4Z4IA 2FBXA 3H98A 3PIOL 2HFZA 3GCWP 2YVSA 2W9CB 3ZZUA 4OL8A 2N4DA 5K14A 3D1HA 4HI2A 4YOTA 4NXMK 1KLNA 1HJOA 1VISA 1BWFO 4TXSA 3PXGa 2ATQA 3O3GA 2CJYB 3OR2B 3QMQA 4CZGA 4LRDA 4Z7CA 3DHWC 5AQZA 4CJ3A 1RKIA 4IG0A 3M1VB 1UMJA 2VBYA 2R8KA 2DRDA 3HK2A 2XMUA 2VB6A 4GV6A 4WXWA 1YVNA 3R5JB 4KY3A 3F0NA 1MNEA 4PL7A 2X7IA 4ITSA 1RAOA 2YX4A 2RS8A 1IG9A 4PXCA 3ILOA 3RMCA 3G0ZA 3T6BA 2ABYA 3TSUA 3CPEA 3ZT0A 3UNGC 3BBBA 5IC6B 4A57A 3J7AP 2BACA 2X3GA 3I5AA 2R2RA 4J5OA 2DHXA 2IC3A 4CJKA 4WKYA 4CT8A 3HHDA 2E2QA 1D5AA 4BRLA 1LCUA 3JTPA 5J1PA 1X5PA 3KUHA 4Y2AA 3LL3A 3E1YA 4EP5A 5M1FA 2HRTA 2FVPA 1IBCB 3PJ9A 3GLJA 4JNEA 4WCEL 4RCHA 2D1CA 3AD7C 1RDBA 3UE5A 1F9FA 3M2VA 3V4IA 2P9KB 4RWTA 1GAOA 3JS9A 3R8YA 4OJGA 1FX2A 1UTAA 3OTDA 1RCXB 3OFEA 1JKHA 1BISA 3C65A 2O8DB 2C28A 1VBYA 4JB8B 2GFFA 1TU0B 1FO1A 5C25B 1RT6B 4LIRA 4PQAA 2DJWA 4M3WA 4DCHA 1FDAA 2YX6A 1YF5L 3MTKA 1ITPA 1Y3JA 2FSKA 4WBFA 2DCLA 2B4PA 3MR7A 4ZS6A 2J7WA 3NS7B 4QPXA 2IVFB 4UF4A 1UZDA 1XNQK 1U6FA 3CJ3A 4F4AA 4Q44A 3G6ES 4KB0A 3UNYA 2XLKA 4YB7A 4PQUB 2BJ9A 1N32F 5J2NB 2PI5A 3QWPA 3O80A 1WC1A 5H9FJ 2LU1A 3NWGA 4DV0F 2V2VA 2R8JA 2F7TA 3CF5Q 2EPIA 5AFUA 3KVGA 3MM8A 5A2QO 2QEXS 4CZFA 3ID6A 5KG6A 4P2SA 3RGIA 4F3TA 2IHR1 3M9OB 2O8FA 4RR5A 2HZCA 2HVIA 3F9KA 1ZPVA 4LFAF 4BRQA 3IWXA 1DTTB 1BHLA 3KWGA 4DFJA 3M32B 1UPPA 4X65J 3QICA 5KFTA 5ETOA 4F2SA 3CG7A 4XO0A 1WC4A 3EY1A 2CNNB 1C0FA 2N7YA 1U8WA 3PTWA 1QD1A 2HB5A 3SQGB 3K5PA 1YRTA 4MMOA 3UR0A 2QXFA 2HVZA 1O51A 3KHGA 4PAAA 1XEZA 4JS4A 3J81j 1AZSA 1S72S 2RKIB 2KU7A 4Y1CA 3W3DA 1WHXA 2N3OA 2M0GB 5M1OA 3R3LA 1VQ9S 4TNOA 5F9NA 1QY7A 2VU5A 2ZM6K 2WUSA 2OSQA 5B0CA 3BBCA 3TRGA 2JEJA 2QL5B 1BQMB 1JLEB 1TUUA 3QSIA 4N47A 2DR8A 2CH5A 2LXFA 4PXEA 2Z8QA 4BG8A 3SAGA 3OTCA 4DV0J 3M6XA 4BWJA 5GAGI 1J54A 2OPQB 2Y1RI 4JKAA 3P3DA 4JKEA 3SQ2A 3G71S 3QO9A 1M5KC 2XNQA 1TMJA 2HFUA 2GO9A 3MXHP 1BU6O 3IRXA 3FFIA 4L73A 1QSSA 2B51A 3ZT1A 3RW7A 1F3VA 3NVKA 1WKLA 1SH0A 2VH7A 4LFAJ 3DRSA 2RDJA 4ZHRA 3R1XA 5FLXO 3T5LA 5M2RA 2DPNA 4IBNA 4EHUA 4JI5J 1FA0A 2G2YA 1XR5A 5TKYA 3CIMA 3C6HA 1W7WA 3LAMA 3UKUB 1C6VA 1YHQN 4DJBA 3QZ7A 3B82A 5CYJA 3LP0B 3MN7A 4BRDA 3O6QA 1U04A 2H51B 1XQSC 5GAHU 1LWFA 1MA9B 1LW0B 3NCQA 2D0OA 1HD0A 5KFNA 2QL7B 1N32K 4A5BA 1BQNA 3NOGA 5DO2A 1R0CB 2AEFA 2A2CA 3IKMA 4P75A 5AZIB 3ZSOA 2Z2MA 2GVDB 3U1MA 3TA0A 4Y2IA 4OZNA 2OAUA 1AUSL 5IQQA 5A2QU 1Y64A 2OMOA 1Q8IA 4H54A 4HHTA 3SQOP 2E6LA 2RQ4A 3H5YA 1IBLK 3MCSA 3GPAA 2HGLA 2ZGYA 1HYZA 3CCMS 2HOEA 2GO8A 4B3TF 4WXOA 4KHYA 2OHDA 4O0NA 3GSIA 5HL7L 1VQPS 3BYPA 2YHBA 4ISGA 4MK7A 1S1WB 1E6YA 1A0OB 1S6PB 4A2BA 4CJUA 1VSLA 4C48A 3HL8A 1YJTA 3J81O 3VVTA 5KRTA 2CQBA 4Z4GA 1S5ZA 2NXUA 1Q4RA 3TA2A 3IUCA 2MEWA 3CJ7A 3U8XA 4IEIA 4OYAA 4KIAA 3NXZA 3CUNA 2RSQA 5KRSA 4FNHA 3AD8C 2WW8A 3KK7A 1HKBA 5CXTA 2JC0A 1IKXB 2O8BB 4FBTA 4G1QA 1RT5B 1GTEA 1QZ6A 1BO5O 2X51A 2Q2RA 2C42A 3OYFA 2VG5A 1DBDA 2ZBIA 3D45A 1UL3A 3V1RA 4FLTA 4TSXA 2FJVA 3T19A 1SQEA 1S1UB 4ZK7M 3D68A 1QQMA 2W8LA 4F67A 2RVJA 4B1UB 3POTA 4F4YA 3DCAA 1LEOA 4WFNL 3KLFB 1VQLN 1JLBA 4OKEA 2IBOA 2ZUGA 5DK5A 1VIXA 1FKPA 1WG5A 3G6VA 2FHOB 1WG1A 4RW4A 1HW8A 2JOQA 3O3LA 1CC7A 3DRRB 4KGXB 1U4BA 2F8SA 1EB0A 1NJYA 1KDNA 2XEXA 5FLXU 3EDRB 2DB1A 4DDFA 4B3TJ 2P9UB 2EFGA 1QJHA 3FEZA 5DG8A 3N5BA 2QKKA 3I4HX 1FI4A 4H4OB 3HVRA 1EKEA 3H3NO 2KHCA 1FF2A 5L46A 1GLCG 3E01A 4MK8A 4FF2A 3ZC4A 3CC2N 3HI0A 1C4CA 4FOIA 3EDQB 3UI3A 4WFAQ 3EVOA 2W01A 4LFCF 4OHVA 4M1KA 1YJUA 1NM2A 3W63A 5KI6A 1N5TA 2VG6A 2HHHF 2MHNA 3DNCA 2HBMA 4RBTA 1KOHA 2C1EB 1RWKB 5I42A 1T9VA 3UDLA 1SUQA 1YX2A 1I1GA 3C46A 3QB0A 4BC5A 2MQPA 2OPRA 4YDUC 2HG4A 2KT2A 4EHTA 2P8IA 1N88A 1WLJA 4OYOA 3S8SA 3J7YU 2F65A 3R7BB 5G0RB 2ZBRA 3LOUA 5C2FA 2XSJA 1YJNS 3VQQA 2CZVC 1YZ6A 1VSDA 2I7PA 3AGRA 4B3TK 4IO1A 1RYSA 3I0SB 4LSNA 3D1OA 1RT7B 3SFGA 4DUZF 4EK2A 1NJIO 2HQFA 3MPDA 2C2DA 2QG9B 5LSRA 1RBAA 4KR0B 3MMBA 5JJBA 4LR7A 4RBUA 3AO4A 1UFWA 1WF2A 2IYIA 1U1QA 2YQ3A 1MROB 4DV6F 2A40A 3CCES 1JJHA 4EAHD 4OZ0A 4OHWA 1TL1A 2D3OR 2BX6A 3R2CJ 3HJVA 2BUPA 3KG1A 4PXBA 4LFCJ 4U67L 1YJ9S 1JLFA 2Z2YB 1WC5A 2VPWB 1YRUA 1RILA 3QJJA 2NRRA 1VK8A 2RF2A 2VV5A 1W2IA 2HHHJ 3L2VA 3C6UA 4FCYA 1ULRA 4NXNF 5C24B 1HBOA 1Q86T 2RRAA 4H4MB 2CJBA 2FD2A 2NNWA 2FJAB 3B4DA 2U1AA 4MKBA 2QA2A 3WXIA 5HRPA 2OEJA 3BKUA 4X4VA 3VGVA 1ESVA 1REVA 4HR2A 2DY1A 3QYYA 3OS0A 2J8AA 5JVHQ 1KD1T 3K9KA 1FVSA 4OV6A 3ZSQA 1Y5LB 1VHXA 4Y28C 3LM9A 4N8NA 4RKUC 3KLIB 2ROPA 3HT0A 3WBZA 4E1JA 2NYHA 4KPCA 1S0MA 2VQEF 1IKYA 4KGVB 3S6EA 4DUZJ 1BDGA 3VMFB 3AA4A 3ALYA 1HMVA 4F8RA 5AQRA 3J7ZO 3MOJB 4C8OA 1QTNB 4GV9A 3H5SA 1FE0A 5BN9A 2HHHK 3GSDA 1CBKA 4DV6J 4V1Ak 2AD9A 4C3LA 1UP1A 1P9YA 1PC4A 1R43A 1WSHA 2JLGA 3EE9A 3BB5A 4U95A 4FO0A 2UVRA 3KZBA 1UW9A 1XC3A 4AL6A 1IKWA 2A6AA 2LA4A 4F0HA 5KQ8A 1KFSA 3KLHA 3BKTA 3OYDA 3CCSS 1LW2B 1YVFA 3IFEA 3G87A 3V6DB 2ILZA 3ENVA 4NXNJ 4L3QA 3DYAA 3VHQA 3P96A 1L3KA 4Z4HA 5HMZA 1G7CB 1RWWB 1QE1A 3B78A 3GV5B 4YB1P 4GVMA 2PFUA 3VALA 3NL0A 4HTJA 2A6OA 3ZTRA 2NPIA 3R7SB 4AXJA 4CZHA 4XH1A 2H3GX 2VFVA 4CO4A 2O3DA 2BVZA 5KFEA 3DOLA 1NK4A 5AJ3K 2HZAA 3W9JA 2IMWP 2BRLA 2AEJA 2M5YA 5FD1A 4JI1J 1RTDB 4MIBA 4JYAJ 1Q53A 4FLUA 1HKAA 4C11B 2QW9A 4HACB 1RBTA 4CJ4A 3V9ZA 4H0YB 5AE3A 2OPSA 4Y1DA 1TVRB 4GC6A 3LAKA 2GZOA 4MO4A 3BJYA 2F63A 4CCHA 5SZTA 2PZSA 5KPRA 2WHOA 3D6HB 3U6FA 3CFPA 1NGHA 1R6YA 1CULA 4CFCA 1ZM2A 1F9HA 2M4MA 3I4PA 1IR0A 5AQLA 5AQPA 4CTAA 3PR5B 5LSOA 1KNZA 2Q6CA 5D4LA 2CPZA 2UXDK 4CGJA 2R42A 2I2YA 1J5EK 2CA9A 2H4WB 1S1TB 3QJLA 4FWLA 1R27B 3IM9A 4PUOB 2Z1HA 3QFPA 1QDUB 2BYCA 4LT6A 2JLEA 3QEXA 3QFHA 4USTA 2HYIB 3FE1A 1WAFA 2IBKA 2VQEK 1PBUA 2XMAA 4PXDA 2E29A 1N8RO 3AVGA 4EI2A 4CEEA 1RGIA 4FLVA 2E1AA 5HMXA 2RRNA 5EU7A 3ZZPA 4IFVB 3AJDA 4YB6A 1VQON 3TVYA 1JXEA 1U0SA 2QLJB 2KM8B 3F73A 3TZXA 5TKWA 3GB0A 2R2TA 3H42A 5F0XA 4QIEA 1HLWA 1B64A 3AQOA 2QT7A 5IQ6A 1S9EB 2HBJA 3VF6A 5AQKA 3MCNA 1MLAA 3OLBA 2QIFA 3UB5A 2D9OA 5AQNA 3GJTB 2BANA 4IR9A 3V2UC 1VQSA 1S5JA 2CNOB 3CMAS 2DNLA 4GVBA 2EX3A 1P6TA 2GHPA 2V34A 4NLYA 5DETA 3OTOF 4F4WA 3K2PA 2D3O1 3BGUA 1KS2A 2QLFB 3BUZB 2AZ1A 4IWVA 2K1RB 1OYDA 1NMNA 1C1BA 3RB3A 1FFWB 2R7RA 2E1PA 2JEIA 2H9ZA 2ZGZA 4HCCA 4P52A 1D9DA 3VQ5A 3M4XA 2QYCA 2YNIB 1L3UA 2QWPA 5CD4H 4I7FA 1WNSA 4DHVA 4B3MF 3H25A 3IXQA 1TKTB 4B1ZA 1BA1A 3FBBA 5E0OA 2HS0A 3M8PB 3DRXA 2KW4A 1HKGA 3O9SA 3H2VE 3QT7A 2F96A 4LJMA 4QWDA 1U09A 4OQJA 1R0BG 3CB4A 3NGKA 1VK0A 1HYSA 1RCOB 3CC7N 2HBYB 2ZVIA 3THWA 4JKHA 4LREA 1U02A 4WYWA 2UUWA 4R0JA 2Z1JA 3WZ0A 2DNZA 3E3XA 4WYBA 4LY7A 1SH3A 2CG8A 3IR6B 1FXRA 3DM2B 2CH6A 3ISZA 3BV8A 3G82A 4U8YA 4CO1A 1ZTTA 3IRWP 1QAYA 1NXIA 4IOAL 2J9DA 3OTOJ 1U1MA 3HD1A 3MEDA 1RT2B 4K4SA 4K2XA 4JUZA 5KFMA 1Q8BA 2CJQA 2FLPA 4A5AA 3MF5A 2LU2A 1A5VA 1VQ8N 2NQPA 2VOPA 4M42A 1Y5IB 4GVEA 5AQFA 1NGJA 4KFBB 2Y8WA 1WHWA 1JWWA 4ISEA 1HBUB 3SQ0A 2V8GA 4B3MJ 1S4EA 3TAGA 4DS5A 1NCLA 1Y9OA 4ZA1A 1ZTWA 1KCFA 4HL9A 4MAKA 2DBBA 5KFWA 2WOMA 1ZA1B 2PYLA 2D3UA 3HCXA 2OZSA 1KQSM 5AQTA 2KKHA 3NAEA 4LRFA 4I4BA 1E6VB 4KBOA 2JGUA 2ASPA 2N7CA 4DKWA 5T14A 4DTRA 1FTCA 3SEOA 4WPAA 5CY4A 4AHRA 1N5SA 3C6TB 2XG8A 2DH9A 3OL6A 1ATNA 2QTDA 4JV2A 4NASA 2DNMA 2Z56B 4U7UD 1KC8T 3A8KA 5L1KA 5HK4A 5EWEA 3CXCM 3L4BC 2PY5A 4HKQA 2L48A 3EE3A 4BRAA 1U48A 5BYSA 4UY85 2FSNA 3PYFA 3W2WB 4OGEA 8ATCB 2PIIA 3W61A 2HSTA 4RW7A 3QDKA 5I3PA 1OH7A 3HYFA 3J8AA 2EFNA 2IGIA 5HJYA 1W97L 5KFBA 5ADZA 3ZEUA 4LUBA 5KFJA 2ZC3A 3IMXA 2A1BA 1DTQB 1GMUA 2VHGA 2A3JA 5GIPA 4CFBA 1NGDA 3R97A 1TAUA 4IFEA 4L8RB 1S59A 3K8WA 4FBUA 4CJFA 3MMCA 3CJAA 2RHSB 4BE1A 4DV3J 2DFHA 4LF1A 2GMLA 3M8SA 2DGQA 2IM0A 3L6QA 1UVIA 4CP5A 1SKSA 4I67A 4NCGB 4WJBA 2J9CA 3D5MA 5AZJB 4U7UK 4C97A 3CC4N 3V6KA 2VWJA 3OR2A 1T11A 2MY7A 1WUAA 5G4DA 5B7WA 4GKJF 3M1VA 2ZH2A 2K06A 5F8IA 1WSEA 4WIIA 2AV5A 5AQSA 3O5BA 4ELUA 2XBPA 4NZ0A 5THWA 5DDRC 1N56A 3SV4A 5DM7Q 5KG4A 1C4AA 4I68A 4Q2MA 1TL4A 3K8VA 2QEXN 3OYMA 1Y7PA 5KOXA 3D2WA 3Q86A 3QBWA 2C2MB 3IS9B 3RWUA 3EKSA 1XHXA 1CS4B 3CJKB 2ADCA 4C8YA 1JCFA 3VGKA 1XMBA 1FCAA 1VJQA 2BXJA 3QT6A 3QATA 3FRZA 4USVA 2B9EA 4BRIA 4KRWA 2V7ZA 3K7RA 1WB9A 2FC0A 3MXIA 1RACB 1IWAA 3I33A 1RWMB 1QM9A 1HQ2A 2P9KA 3EXCX 3T41A 2LKZA 2Q79A 4Q5VA 2OYQA 2O8DA 5F0WA 2YKNB 4LBHA 2CIMA 5C25A 4I0WA 3CCJN 1RT6A 2E6MA 2PAVA 4KHWA 3OL8A 3V5RA 3EVWA 1TP7A 1TKZB 3IC1A 1S72N 3VQ7A 3QIOA 5GMDA 1B9DA 1ZPWX 4F4XA 4LF5K 1FK9B 1HW9A 4NLTA 5EX5A 1SKUB 4GKJJ 1X9JA 4DPWA 2F9TA 4PQUA 3UN3A 3AA8A 3BZCA 4P10A 4QWCA 1U2FA 1C0MA 5J2NA 2WTUA 4QIVA 9ATCB 3SCXA 3PZPA 1VQ4S 3MD3A 1UPMB 5A2QY 1NK0A 4NLRA 2G8VA 2H54B 3VF2A 5CA5A 2RU3A 3G71N 2V9KA 2CPJA 2J9EA 2MMYA 2YWFA 3F5TA 3Q2SC 2AKWB 3GFYA 4M95A 1NDPA 2VGNA 3KNGA 1RK8A 3AY0A 1T05B 4X62J 1VQ6S 5JLFA 2FDNA 2YHAA 3SUOA 1NH7A 1DTTA 2YV0X 3TJ8A 4M5DB 4ED5A 1CZ9A 3CD6N 4DR2F 3A8IA 3KKRA 3M32A 3EGWB 2ZJPL 4FJ8A 4LC9B 3DKDA 3TP2A 2QM1A 2RS2A 5JVGQ 4FWOA 1P90A 2UU9F 3O3FA 1HHQA 4OX8A 3TVKA 1NO8A 3BBFA 3U3YA 1IKVB 3SQGA 5IS2A 4LQ3A 3GBTA 1Q86O 3O9RA 3QMLA 3K5MA 1HNXF 3ZT3A 3VA3A 5EWFA 3AVNA 5H9EK 2RB7A 2RKIA 2BKOA 2B9XA 4PPZA 3H5XA 4M5JA 1VOMA 3OYNA 2VF3A 5D4OA 4H0VB 1KD1O 4OJ1A 1HIYA 3HKZD 3PSIA 4J9NA 3CCMN 3RYLA 1BQMA 2MQMA 1JLEA 3SJJA 1VQPN 1FDDA 2OEMA 1R59O 5F3TA 3ZETB 4KH0B 4ANEA 4JV5F 2BBEA 3M2UB 4H5WA 1NDCA 2MKIA 2XULA 2Q0UA 5KT7A 5FLXY 1MMNA 2HBKA 3C19A 4KHPF 2KXFA 3NCPA 3SQ4A 4H5TA 5KFAA 4K59A 4LF4F 4WFBQ 3PW2A 5K8PA 4DR2J 4DLEA 3LTOA 1JB0C 2V9WA 1VCTA 3CM5A 3KMQA 2U2FA 4WP3A 3UKUA 3GR0A 2Y0SD 2UU9J 4OLBA 3LP0A 2XCAA 4ZCMA 4NI2B 2B8PA 1U1NA 3P1GA 1XMQK 3LGNA 4CJ5A 2XQCA 1Q79A 4HVJA 3CCUS 2DHAA 1WBDA 1H2VZ 1HNXJ 1HWKA 3EJMA 1VLYA 3PX0A 2ZC4A 5AZIA 2GVDA 4H4KA 3GIMA 4KO0B 4PPDA 4KGZB 1SJRA 5ETMA 2DNOA 4EBCA 3NNHA 3RVCA 1F60B 3GV7B 2E1ZA 5D0EA 1F5CA 4O44B 4F25A 3KJVB 3NF6A 1KAZA 1Z6RA 1E4FT 2KYXA 1HNZK 1S1WA 4PWUA 3MURP 3EEQA 4AHUA 1LAWA 3FZHA 1N6QB 2DY9A 2GIFA 2DCUB 1YI2S 3SAFA 3QGPA 2UU9K 3M2RB 2IA0A 5IOLA 4KPYA 3UD5A 4LF4J 1MDUB 4J9MA 3KNAA 3BN4A 1NH8A 1M5VC 5F3ZA 2HAFA 4OHXA 1HNXK 3TW0A 1HD1A 4FJ9A 1XMOK 1OH6A 1IKXA 2O8BA 2A5XA 1IM6A 5ETPA 1RT5A 2IA6A 3J80O 3MCPA 3IBCB 1LXNA 4DR6F 3OD2A 2HWIA 1YJNN 4ZVRB 3PM9A 5J2PB 4DTUA 4RO0A 3BH7B 1VSFA 1S1UA 2KT3A 2MKHA 2I8EA 3NKYA 4ECRA 1HBNB 3MN6A 4CJWA 3L4IA 4W4MA 4FJLA 3N6LA 2QWOA 2KG1A 1CPZA 4H03B 3WQTA 4JV5K 4DU4A 2Q31A 3KLFA 1H72C 2VASA 4KJIA 4IRCA 3O4QA 3W1YC 1I3AA 1T9UA 4WU3A 1U49A 1SQKA 5D3GB 2PT0A 5BYRA 4JI6F 1OH8A 2POKA 4YUDA 4LIWA 4KHPK 3DRRA 5KG3A 1ZBLA 4GC7A 5GADU 3OS1A 4CEQA 2N3LA 3CCEN 2P9UA 4LF4K 4BVPA 2IFXA 1H7XA 2BOPA 4H4OA 1RLCL 1SJFA 3P5BP 4KC5A 5LSLA 1Z26A 1HWLA 1AA1B 3JTOA 3K5NA 4BC3A 5C7PA 2ZZTA 1ZBTA 2GCFA 2H4YB 1W2BR 1CJKB 2WVCA 1O6XA 2W24A 4DCJB 3GILA 3FC9A 2XTJP 4D3HA 4ECZA 3H0PA 3D2FB 1WEYA 2RJZA 4PG7A 2CFXA 4I64A 2KT5A 3FNNA 4A48A 1T0TV 5J1EB 3L0QA 2QKBA 3JYTB 4ZVGA 3NGSA 3MN9A 2QA4S 4YY3J 1O5JA 2QN6B 5G0RA 4IYQA 4JV1A 2CQHA 2NYIA 1VSJA 1RHMB 2DYAA 2YI1A 2C2KB 5CAAA 3KLVA 3NNAA 2CJXB 2DO0A 3I0SA 2B9WA 3AVLA 1RT7A 1ZH5A 5ADXH 3GFZA 1PSDA 2VD3A 4OYBA 3EZOA 2IVNA 5CQGA 3HULA 2A42A 4CO0A 1HNWF 3AAPA 3HVAA 4M3UA 4A62A 3CHWA 2CJAA 2MDAA 1WAJA 1RGVA 1JJCB 4C1NK 1MROA 4LRBA 3L4QA 1CEZA 2UXCJ 5KFZA 1WDDA 2KJVA 4FJMA 1OH5A 1R7IA 3BDPA 2HMPA 3M05A 3ID8A 3O4WA 4FWNA 2R7YA 3V9WA 5F8JA 3CCSN 5D4NA 3I55S 1VSEA 4DR6K 1HHTP 2CNKB 2BTFA 1QVGR 3ADAC 1VC6A 5HRRA 3S7RA 5C24A 3T5JA 4QS8A 3SLCA 4H4MA 4NYFA 4GRSA 1TUWA 2QZ8A 2AYBA 2PFFB 3DAWA 3DDIA 2VPZB 3T1HK 1Y5NB 4NYOA 3L09A 4MT1A 2F1FA 2BH1A 1FT8A 2HHTA 1X3MA 4JI6K 3VQCA 4N8OA 5C5JA 4YNQA 3W60A 3GIJA 4MFBB 3AFGA 3UPFA 4DQIA 5K5MA 3KLIA 2B4VA 5KFXA 4LSLB 4NA2A 1UFKA 2V68A 1KQKA 4DR5F 4WQ4A 1NJWA 1SIWB 2LVWA 4WZMA 2ZHAA 4KBIA 2F4VF 3QIDA 5KG7A 1HNWJ 4CFDA 3WQPA 3OYIA 3OW2M 4O3OA 3IR5B 4QYZK 1PJ7A 4ZP8A 3FCHA 3SBMA 4ED2A 4KSEB 1CJVB 2O8EB 1V4SA 3AA2A 2LEAA 4FDFA 3FVYA 4FW2A 5EOYA 3HM8A 3OUYB 5BRHA 5K8NA 2V52B 2GA7A 3I96A 1VSMA 4BR2A 3HT3A 3OYEA 1RP5A 3SMPA 1FKAF 4J9SA 2HBZB 3EXYA 3LDOA 3HSJA 5DG7A 3ATVA 3V6DA 1ZAXA 2KTQA 5KFCA 3IWNC 1VQKS 1OPZA 4O4GB 1BWEA 3HHLD 4DU1A 4FKYA 3O9QA 2V8DA 4YR0A 2KXHA 4URSA 1NGFA 1ATSA 3DLLQ 2QSFA 4J2BA 5ETQA 4NLCA 3HHKA 3I82A 2V5HG 1XBWA 2IRUA 3FLCO 2MLZA 3ZXWA 2FB0A 3FQLA 3TTFA 3ZNJ1 1RTDA 4OI4A 1RABB 4C11A 1APSA 1UFLA 3S3MA 4HACA 3L3CA 5KT4A 4LF8J 4CJSA 1TVRA 2YHYA 4DR5J 5F9LA 2F4VJ 2BQRA 3E66A 1G1XA 2P9IB 1HYVA 2QLXA 1NGIA 1VQ7S 2DPJA 1JMTA 4CJEA 4OZJA 1H3DA 3HSTB 3CF5L 4NMLA 2FTRA 3WQUA 4NZ6A 2JC1A 2UXBF 4PYDA 3D6FB 2O67A 1RT3B 1GH8A 4LD0A 2C3PA 4NCAA 5MLCQ 3ET6B 2KRBA 1NAQA 1S1TA 3QRRA 2MTLA 4YOWA 2Z58B 3AO3A 2IAJB 4WFXA 4PUOA 4Q43A 2PD1A 1SL2A 4KQZA 1D8ZA 2R2UA 2BQUA 3OYBA 2RQCA 3TUIC 4ECVA 5JICA 1RYRA 3D4JA 3VQDA 3R1LA 3UWTA 2VUGA 4O3NA 4OI1A 1VQ5S 1XNRK 2IOCA 1YBTA 4QYRA 4XH5A 3LP1B 4L75A 1SIZA 2GAGC 3H1VX 3IM8A 4IFVA 1KVIA 3SSQA 2ZF5O 4LFBF 3LWLA 2Z4PA 2E1CA 2B9YA 1FFSB 4RG8A 1S9EA 4USJC 2HQIA 2ZOMA 1JLGB 4YFUA 5FDLB 1G3OA 1R8HA 2PE8A 3I8BA 3ZNUA 4ENOA 1PKUA 4UY8T 1K9MT 4FS1A 4QBUA 4M5NA 3E8OA 4N41A 3A3OB 1HR0F 3IO1A 4U8VA 1Y0HA 2FJDB 1FFGB 2ZITA 2FJXA 4TQRA 3N9UC 2X1BA 2MSTA 4IH5A 2UXBJ 3PKYA 1AW0A 2FLLA 2Q1LA 5DJBA 2ZWHA 1Z4UA 2XWYA 4KI6A 2JX2A 4ZVEA 2IJRA 3ZZ0A 1FJ7A 2K1RA 2VDIA 4LR9A 4N7TA 3IAS9 4ERDA 1NHUA 2F8EX 3BGRB 3RBDA 4K4XA 3IN5A 1I3OB 3JS6A 2YNIA 3PG9A 4B3SF 1U1PA 4JI2F 3C0BA 5AE2A 4A8MP 4JI0F 1TKTA 4A8WA 4PA1A 3M8PA 3SUQA 3C95A 2FVQA 4QAGA 3S3NA 3VETA 1VBKA 1OJ4A 3LPYA 1VQNS 3PW5A 4ZPVR 5DDQC 3IP0A 1S10A 1G99A 3EE8A 2MGZB 2QLBB 1Q5YA 5AQGA 3D2EB 4LFBJ 1TMMA 3CULA 2CADA 2UXBK 2J0XA 4USKA 4J9KA 1WEZA 3H1QA 3C6AA 2J8SA 1WOPA 1Q5VA 4OJ3A 1J2VA 2HFSA 2E7WA 2VODA 1RLDA 4BGAA 3DM2A 2F3JA 4EZ6A 1QQNA 4LH5A 1C1CB 3T6JA 1JL1A 2VWKA 4F4KA 3M3ZA 3OA9A 4I69A 2DKOB 3B8HA 1Q0NA 1KQGB 4OO1J 4QIFA 5IT0A 3JXUA 3VF0B 4UZBA 4CYUB 4ELTA 1N33F 4ECSA 2ZEJA 3O4NA 2O8CB 1EAYC 1RT2A 1M1HA 2E5IA 3HSZA 3TSPA 3OQ2A 1NU0A 1QAIA 3L2QA 3KJNB 3RRKA 1NNDA 1QLNA 2MKYA 1RBSA 2P9LB 4GKKK 4DR1J 4KYZA 2VICA 1JCEA 4KFBA 2DPIA 5MAOA 4B3SJ 2JWLA 3D6MB 4JI2J 1HBUA 4JI0J 1L3SA 2FHMA 1TZ0A 1KVKA 3CI5A 1NB7A 1AUDA 4CI0B 3TQ1A 2KL8A 2IJNA 1BG3A 2V6AA 3DXKB 3SBGA 1E6VA 4MKYA 2HQGA 4U7BA 5KT3A 3C7NB 1HR0K 2CPXA 1KXPA 3FZFA 4ED1A 1OQ6A 4RWWA 5E33A 3KHYA 1ZBHA 3CCWA 1BMQB 1BD6A 2VC1A 2RU9A 3T3FA 4AXIA 3C6TA 4YMEA 3KKSA 2OJ3A 5BRFA 2X74A 2G1DA 4DV1F 1OY8A 4OHYA 2W7OA 1URRA 3PJXA 2ROEA 2PN6A 3W2WA 2FY1A 4DSFA 2A10A 4WFAL 4DR7J 3RRHA 4OJRA 4CK2A 3M8QB 2VFSA 2VQFF 2VWBA 1H73A 2MPUA 4RNHA 4KKOB 4B3SK 1UAWA 3WNFA 4JI2K 3WC0A 1N33J 3TTDA 2O66A 4XTTA 4JI0K 2VJUA 1K1SA 1DTQA 2RHKA 5M1NA 2B7CB 3KKFA 1NK9A 4NLOA 3W3SA 4XIUA 4RNNA 4KHMA 1WF0A 1A6LA 3CM6A 4ZN3A 1RA7A 4FF4A 3AQPA 3EMTA 2IIRA 4ETXA 4OMFG 4WQ5A 3KG0A 1NGGA 1GMVA 5T41A 3TZYA 3UN5A 2DNGA 5DLGA 3L95X 2FVSA 4JKBA 2BGGA 3AAQA 4IRDA 4P74A 4JI7J 4FJ5A 2OO4A 4NCGA 3CO9A 2W6KA 3A5LC 5AZJA 3QFUA 3CCZA 4F2RA 4BR0A 4B08A 4B8CA 5KFKA 4WU2A 4L3KA 3OHAA 4JKCA 5GAEP 5D15A 4DB3A 4OYIA 1LK7A 2R7UA 3VN5A 2YWEA 3GFXA 4YOUA 1RBUA 1ZM9A 2EHGA 2B6AB 2XY8A 4DOZA 4KE5A 1J5OB 1WNEA 4DV1J 1S9FA 3PW7A 2R8HA 3BSNA 3OV7A 1A9NB 1FVQA 2CQGA 3K17A 2C2RA 3DN9A 5JLHA 3CTRA 3VERA 2VQFJ 2BR0A 5AQWA 3IS9A 3BS9A 3IBFB 4FVUA 1CS4A 3HHEA 3CJKA 3O9TA 1C0TB 3NGIA 1VQ6N 3M7VA 5GIOA 1IXKA 1DQ8A 2Z1IA 1TKXB 2PDAA 2HBQB 4AHVA 4FNIA 2MB0B 2NZCA 4BRGA 1RXOB 4RPFA 2AWZA 3G25A 1GLJO 1VHIA 2EKYA 1RU2A 4URQU 3AJ2A 3EGZA 5JVHL 1HNIB 4V19S 2YKNA 4EWTA 1VGYA 2GW8A 2YKMB 2I9SA 1D4XA 3CJBA 4DQQA 4ED6A 4LRAA 1SAZA 2OFHX 3NH2A 1Y3KA 3TTCA 1S1XB 4G3IA 4CERA 1TKZA 3AOCA 4J9UE 4H4KC 5BR8F 2GS8A 5KOWA 1CJTB 4DL0C 5BRDA 1DQ9A 1FK9A 1HI1A 4DQPA 4JEPA 1RAGB 4LVOP 3QETA 4DN0A 1HQEB 3U4LA 1O13A 2M88A 4G9ZA 4FJ7A 2BW7A 1FDBA 5L1LA 2DT9A 1FKOB 4YOYA 4LBIA 4EGLA 3K0JA 3UVJB 4EMDA 4RNOA 3ZYYX 3IWLA 3ZSWA 2HWHA 3ZTPA 3N6NA 4CJTA 2BJ8A 4DV2F 5HRSA 4DFKA 5CE3A 2YPYA 4HTLA 5IM0B 1URNA 2UUCF 4IO9L 2Y8YA 4DSEA 3OHRA 2V94A 1T05A 1M5SA 3V4MA 3D7SB 2M52A 3PYEA 1BE4A 4YDXA 4QW9A 1EETB 2R9LA 4OI3A 4JKFA 4M5DA 4CLYA 3AVKA 4CF2A 2NPFA 3R5DA 3IMQJ 3M8RA 3NCIA 3TAPA 1NDKA 1NBWA 3JAMU 5L9XA 4A8XA 3S01A 1ELOA 4OX9F 1IJFB 3MI7X 1IKVA 5M1KA 2E1YA 3EGVA 3VTIA 1ASWA 1JXBA 1VHFA 4JK7A 5BR8J 1GLLO 5HL7Q 3A1YG 2LQ9A 4TY8B 3VEVA 4QR0A 1YITS 3NDKA 5A0YB 1W26A 5I3UB 3Q8RB 3OTBA 3G4SS 1RHKB 3NRBA 3FBCA 3FJ2A 3PX4A 3QESA 2DFEA 2HSEB 1SL1A 3KG4A 1WSFA 3TX0A 1R0AB 2GAHC 1HI0P 4DTMA 3ZETA 2AJ0A 2NXEA 1FXDA 3SAHA 3CWJA 3M2UA 3RB4A 4CW7B 5J2QB 4DV2J 5DZ7A 1YXQA 4CIFA 3H4DA 3C66A 4E1NA 1B99A 2E1MC 2UUCJ 3AB2B 3EX7B 4Q8EA 4QWAA 1P8GA 2QSWA 1YAGA 3OFGA 4CF9A 3OBYA 1FJEB 3BEGB 1RWPB 4RL1A 2P9CA 1S6UA 4WFNQ 2D9PA 3CMES 4DX8H 1XR6A 1GXUA 2DIUA 3KDOA 1RSCA 4OX9J 3G2XA 4NI2A 2KG0A 3ENOA 4K42A 4CO5A 2ADBA 3VESA 2R7SA 4L74A 4XH4A 5GMEA 2GV1A 3TO8A 1IBKJ 3C8YA 3RMBA 4P2XA 3SZ2A 4KO0A 1R6VA 3MPVA 2OUGA 5ETKA 2W2PP 1HX1A 4NXMF 2CWKA 1X5SA 1EQMA 5FPNA 4QU6A 3AOBA 4DV5J 1NK5A 2MZ1A 4O44A 3HHLB 1MWQA 3QAUA 3KJVA 3N01A 4CEBA 1KAXA 2GMJA 3ENAA 3DXBA 1WOOA 3MWBA 3CCLN 4ZPCA 4RUBA 2RNEA 1N6QA 5AQQA 1AYEA 1NOYA 4RBVA 4DUYF 1IR2A 3CCVS 4YOVA 1V6HA 1WOSA 3G86A 3M2RA 5EX0A 1QHTA 2UVWA 3D28A 4NB4A 4OX9K 1Q78A 2F4FA 2CVEA 3UN2A 3R5AA 3HJFA 2DR5A 5JMNA 4M3TA 2CDQA 5GAEU 1S4FA 2L9NA 3MUVP 2QA4N 3A4TA 1EWQA 3N5FA 1EWRA 4IKFA 2X6NA 2IY5B 3CE8A 3A3NB 1BLUA 4OHZA 1FRMA 2X1FA 4WF9Q 4Y6IA 2G8KA 5J2PA 3EPGA 2UYTA 3GIKA 1P1TA 3NGRA 2NUBA 1HBNA 4K0KK 1DT9A 1PJ6A 3VAKA 3ULEB 3I56N 2VFTA 2GVZB 4NXMJ 2YJFA 3SMSA 5D3GA 5GAHP 2KFYA 1MN9A 1XNQF 3QAEA 2W7AA 5AQIA 4NLPA 4X66F 2DTUA 2HFNA 1WD6A 4M5LA 3MEEB 5DZ6A 1ZBSA 2Z0GA 4HLBA 2KVIA 4FZVA 1RADB 4KH6A 2GUPA 2G8UA 4EBEA