4H4OA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
total genus 141
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4oA05
1HMVB 3NGDA 4I2QB 2AWZA 3T5HA 3FDSA 3FQKA 4K4YA 4CHQA 2OH2A 1XR5A 1I39A 4TYBA 2A1RA 3H59A 3PW2A 3DMJB 5KFFA 2GUIA 3T5KA 1UOCA 4HCCA 2FLLA 4OL8A 3KK1B 1RA6A 3KMSA 2HHQA 4Q8FA 1GOBA 2YHAA 4C8MA 3DLGA 4K4VA 1IKVB 3L2VA 1UWBA 3DLKB 4EBEA 2VG5A 3AVNA 2VWKA 4O0JA 4FS1A 3NDKA 2HNZB 3CFRA 2KTQA 3N6NA 2V4QA 2W7PA 4IRKA 4IBNA 1NKCA 3HPGA 2BRLA 2ZQBA 4TY8B 4CF9A 4DTMA 4IR9A 5F8LA 1HYSA 3KLHA 1YVUA 1J5OB 4B9MA 1NJYA 1BQNB 4DQQA 4RUAA 1RBUA 3PY8A 3MAQA 4W5RA 4FBTA 3SQ4A 2ASLA 1I3AA 4XPEA 3RWUA 3NAHA 4J9NA 2W7OA 4M95A 2WHOA 5DQGA 3V6HA 4G3IA 1RDBA 1S9GB 2FBYA 4FLXA 2ETJA 3SJJA 2HHTA 4FLUA 1HQUB 2WRMA 3Q8RB 4U6PA 2ALZA 4CHOA 1YTUA 4WFZA 2VA2A 5DLFA 3QLHB 5JS1A 4CGDA 1DLOB 1S1VB 4DWIA 1T7PA 3IS9B 4B3OA 4WZQA 1SUQA 3O4NA 4LY7A 4E7IA 4M45A 2X6SA 4CGHA 3CJ2A 3HSTB 1L3SA 4YR2A 3OY9A 4Q44A 2FJVA 3SV3A 4RW6B 3SFGA 3TVKA 3QEXA 3NL0A 5KG0A 5HBMA 3CYMA 4FVMA 3T5JA 4CHPA 2G8HA 4MIBA 4RNHA 3KJVB 4CJ4A 3P5JA 2HNDA 5J2PA 4CCHA 4MH8A 1N48A 4GW6A 4HUGA 3K58A 1DTTA 3P1GA 1D9FA 1NKEA 4CJ3A 4WXOA 1TK8A 2B6AA 2AU0A 3OS0A 4FZYA 4K4UA 4F2RA 5CZ1A 3LAMA 1TKTA 3TABA 2ATLA 3NFAA 4HVJA 2OPPA 5F8MA 1QQCA 1KFDA 5K14A 1VSIA 3TAEA 5KG6A 4KV8B 1RT6A 1ZBFA 3OYHA 2FBVA 3RRGA 4CFDA 3QLHA 2XC9A 3GQCA 4K4SA 1TKDA 3DLGB 4CEEA 1JLAA 4DSFA 1S9FA 3NF6A 2EHGA 4DTRA 1S9EB 1TP7A 4KAIA 4QOZB 3F9KA 1FXXA 1JKHB 3MFIA 4TYAA 3MEEA 4E19A 4QCLA 2JEJA 1VSMA 4E0DA 4RW4B 5KFNA 3TAQA 4JRQA 1SH2A 4FK4A 1MU2B 3I0SA 4CESA 3OHBA 3ZT2A 4TSXA 5L9XA 4Y1CA 2IMWP 1Z26A 4DFJA 3SPYA 1DTTB 2BQRA 1EETA 4WYWA 4F3TA 1EP4A 3VA0A 3QNNA 3UIQA 2UUWA 4FLTA 3KLIB 3DLKA 2OPQB 4G1QA 1HQEA 4ED8A 3DRPB 2O4IA 2X6NA 4DSJA 5EWFA 3SUPA 5EWGA 3L2RA 4ZTJA 4KREA 3BJYA 3I0RB 4MKBA 1RNHA 3DLEA 4MK7A 1X9WA 1IG9A 4MK9A 1CSJA 2FBTA 3DMJA 4LH5A 4YNQA 4BDZA 4B9UA 1HNVA 1KVAA 4ED2A 1W9HA 4I7FB 4QWEA 5J2MB 5FDLA 4AHSA 1RTJA 3HVAA 3D28A 5KFWA 4FJ5A 4F4WA 1LW2B 4BDPA 4DTXA 3V6JA 1HNIB 1C0MA 2C22A 4B9VA 5KTQA 3VQQA 5KFRA 4MFBA 2RDIA 3RMDA 3PUFA 1NKBA 1NHUA 4LD0A 4DL7A 2IM3A 4NCAA 1T03B 2F8EX 5F9NA 1R0AA 2W9CA 3CJ5A 3RBEA 4CJSA 4CEZA 2V4RA 3H5YA 1TKZA 2DPIA 1S6QB 3N6LA 1VSEA 3RR8A 3P83D 1WSHA 3C95A 4CFBA 1N5YA 4ECTA 5KFMA 4FJ9A 3C6UA 5J1EB 5KFEA 2IDOA 3EY1A 1TK5A 1KHVA 3N6MA 4WE1B 4KKOA 2YNIB 2HNYA 1KLMB 3C6TB 1RTDB 4PY5A 3OYMA 4E7HA 4AH9A 3SUNA 4Z4HA 1S1UB 4JV2A 3V4IB 4GMJB 3V9ZA 4NLOA 2ATQA 1LAWA 5J2QA 1S5JA 5DG9A 1TKXB 5J2NB 1BL3A 3MXIA 3OHAA 2YNHB 3TAMA 1NK7A 2BGGA 4DTUA 3DDKA 1BQMB 3ISNC 4NRUA 1KTQA 3L2WA 3NGIA 3HK2A 4R8UB 5I42B 3AVFA 3WNEA 3SNNA 3H98A 5L1LA 3NBPA 2OYQA 3V1RA 4FK0A 1Q8IA 3AO4A 2Z1JA 1C1BA 4J2DA 1KCFA 2HHXA 2E6MA 4OKKA 2B4JA 1S1XA 1LW0A 1S6QA 1ZBIA 5KFAA 5F9LA 4IOBA 4CF8A 3MFHA 4BWJA 2DFFA 1REVA 4H8KA 4RW8A 5HLFB 4IRDA 3CJ4A 3PV8A 3OS1A 4DQSA 1RTHA 4BE1A 3OYGA 4R0EA 4KB7A 1RDRA 2HAIA 1QE1A 4FJXA 1I6JA 5CZ2A 1IKWB 1RT5B 3BQ2A 4ZVEA 1D1UA 1JXBA 1NK4A 3MECB 2IAJA 1RCHA 3TARA 5KI6A 3QEWA 1HPZA 1KLMA 1HNVB 3JSMA 2HMIB 5KG3A 2G8VA 4ZHRB 4J9KA 3K5MA 2XY6A 4F50A 4RU9A 2IOCA 3OYNA 3QEVA 3ZT4A 2QKKA 3KLVA 4FXDA 3RB0A 3VQDA 5EDWA 2GBZA 4J2EA 1SKRA 5C25B 4FJ8A 4I9LA 4X2BA 4LSLA 1RBVA 3AA3A 3G6VA 1SL0A 2ZE2B 1ZBHA 3UR0A 3VQ6A 1JLCB 2AX0A 4KRFA 3RB3A 4CJRA 3EZ5A 3AA2A 1RTJB 5DG7A 2EC0A 1XHZA 4DG1A 4FJLA 2Y1JA 2DY4A 4WZMA 4E7LA 3FFIB 3ZSYA 2IM0A 1DTQB 5CY4A 3CQ8A 4URSA 4NYZA 3QIOA 3PZPA 4M3TA 4MFBB 4DFMA 3RRHA 4KHRA 2VG7B 3KK3B 4Y1DA 1T05B 4Q43A 4IH6A 4Y3CA 2FC0A 5DG8A 2YHBA 1L3TA 3TANA 1NOYA 4DU4A 4QW9A 3PW5A 3G0ZA 3MECA 1RAJA 1Q9YA 5FRMA 4RNNA 3OLBA 4Q0BA 4DU3A 1W25A 4LSNB 1ZBLA 5J2MA 3OSNA 2PY5A 4Y2CA 4DSIA 4Q8EA 4AHUA 2XY5A 3I5BA 1RTIA 4B3OB 1ASWA 3VA3A 4O4GA 2WOMA 4OKEA 4N76A 1ZTTA 4CEQA 1Z25A 3QZ7A 1SV5A 1R0AB 1XWLA 1XC9A 2XRIA 2XHBA 2C2RA 4HUEA 2P5OA 4CJVA 1OS5A 1C1BB 3AO1A 3PW0A 3S3OA 1NK9A 1FK9B 3PX0A 3V6KA 1A5XA 2E9TA 5CYMA 4CJ5A 4DTSA 5HP1B 3KHGA 2FVQA 1VRUB 4EYHB 1FKOB 5I3UA 3LP0A 3DLBA 5HBMB 5KFDA 3THVA 1JLEB 4F2SA 1QS4A 1KSPA 4DSKA 4RW9A 2ILZA 4IFYA 3NAIA 3QGGA 2HNDB 1S0MA 2HNYB 4RZRA 5L1IA 2C2DA 4FBUA 4C8LA 3E01B 1JX4A 3KHLA 2HVHA 1IKXA 2HWIA 3QZ8A 4CERA 3CM6A 2D3ZA 4HCBA 3KIOA 3RMAA 2DPJA 2OA8A 2AGQA 1S9GA 2YNIA 4KO0B 3OS2A 4FZXC 1RYSA 2BRKA 3SUOA 5KT3A 1HQUA 2I5JB 2YNFA 5F8IA 4RW7A 3NBPB 4NLUA 4R5PA 1U47A 1RT4B 3PHEA 2J6UA 1QSSA 1TL3A 1C0UA 2AJQA 4CECA 2JEGA 3VQPA 1FKPA 4DQPA 4ZPDA 1B9DA 2XCPA 4OLBA 3PJWA 4J9SA 4B8CA 3OYJA 3M8PB 1GX5A 2JGUA 5C5JA 1BI4B 2P1JA 3MEEB 3PO5A 4QAGA 4DTOA 3MEDA 4LQ3A 5L1JA 4C8NA 3KK3A 1EX4A 3KLHB 1IKYA 3K5OA 3LWMA 5KT6A 4DTJA 4NCGA 5KT4A 1TVRA 3AVKA 3BGRA 5KRSA 1WN7A 3F73A 4FW1A 1S6PA 4ID1A 1LV5A 2RF2B 4IRCA 3NF7A 3LAKA 4KSEB 2BQ3A 1JIHA 3AVHA 2JEIA 3DRPA 3EPIA 2I5JA 2FBXA 4K8ZA 4AHVA 1T8EA 4FJ7A 1C1AA 3OL6A 1HMVA 3TI0A 4Z0UA 3QINA 3DRRB 3M8RA 2UUTA 1U09A 1QTMA 4CHZA 3K2PA 3K5NA 4FW2A 4B9LA 4J9MA 4K4XA 3E51A 3V81B 4IDKB 2F8SA 3M8PA 1LWEB 2RKIA 4ZPCA 4MKAA 4H54A 4O3PA 3ZSQA 1J53A 4PA1A 5CYMB 4F4YA 1N4LA 5KFTA 3SQ0A 4CEAA 3PO4A 1TKZB 1JXEA 4L8RB 1JL2A 1L3UA 1KLNA 3C94A 4O0IA 3NF8A 5D3GA 5KFPA 3LALA 3GILA 4DLEA 2IM1A 2G8IA 3QIPA 2UVWA 4NLPA 4E7KA 3O3HA 3DLEB 4FCYA 5K14B 4HUFA 2ASJA 2KZZA 4CGGA 4RNMA 1JLEA 4DMNA 3CJ3A 1SH0A 3LZIA 1D8YA 2GIRA 3QGHA 4QWBA 4E89A 4I2PB 2QKBA 3GIMA 3GIIA 3TAFA 1D5AA 3OSPA 4O4GB 1KVBA 1FK9A 3M9OB 5KFIA 4DF8A 2YNGA 4W5QA 2OPRA 3CM5A 2QK9A 2HHWA 3V1OA 3V81A 5T14A 2B5JA 4AHCA 3RAQA 3OL7A 4F4KA 4M41A 4FJMA 3V4IA 2RDJA 2HVIA 4PUOB 1F21A 1VSHA 2FJXA 4U7CA 4RW4A 4Q45A 2G8KA 4TQRA 2JC0A 1BI4A 3V6DB 1EKEA 3H40A 2ZD1B 3K5LA 1Q9XA 3ZSRA 4Z4IA 3DM2A 4KB1A 2F8TA 2RF2A 3T3FA 1RT3B 3PW7A 4EEYA 4O3NA 1MMLA 3TR8A 4DU1A 1NOZA 4CJUA 4GVMA 1XI1A 3EZUA 2JEFA 3QIPB 2QV6A 4IH5A 3OYKA 4M3WA 3PVXA 1LWFA 3KK2A 5KFJA 4ZMMA 4KHNA 5JXSA 4CJWA 3K57A 4M3UA 4KTZA 2OZSA 3OJSA 2A1SA 1RTDA 1XR6A 1UA0A 2R2SA 3AV9A 5KFHA 2FVPA 3HL8A 3AVLA 2OPRB 4BE0A 1WSJA 3T1AA 1G15A 2UVRA 2IBKA 3KLEB 4NLTA 4EP4A 1FKPB 3M8SA 2G8UA 5DMRA 1HRHA 3OYEA 4ELVA 1JKHA 3I5AA 2HWHA 4KTWA 3VQCA 3QETA 3ASMA 3KLGB 3VQSA 4LSLB 3PJXA 3PW4A 4DTNA 1ASVA 5J2QB 3HVTB 1VSFA 3DYAB 1JLGB 1B9FA 4YMEA 2IA6A 4YP3A 4CF1A 3KD1E 4M3XA 4FM0A 2AGPA 3CG7A 1YVFA 3K59A 5HRRA 2VA3A 2OPSA 4W5NA 1UWBB 4LH4A 4ID5B 2BQUA 1T3NA 4FLVA 3ZSOA 4ECUA 3UPFA 4MIAA 5SZTA 4ZVFA 1TQLA 3VQAA 4B9TA 5EU7A 1RDDA 4DSEA 3V9SA 1JLBB 1RDAA 3S3NA 4J2BA 3I0RA 4OGEA 5CYQA 2DFEA 1RT7B 4URQU 4WFXA 4RUCA 3DOLA 4HYKA 3HP6A 4I7FA 1CXUA 4PUOA 4AHRA 4LQ9A 3AVIA 2VG6A 1HYSB 1J54A 3L8BA 1SKSA 4PQUB 1IH7A 4DF4A 2YKNB 4FJIA 2R2TA 1RDCA 2GV9A 3GIJA 1BQMA 5KFSA 1KHWA 4TLRA 4FS2A 2RKIB 1W0HA 2VG5B 3H08A 1WSEA 4CK2A 3HT3A 3KJVA 3M8QB 4Y34A 4QWDA 4EP5A 3HM9A 3BQ0A 2IGIA 3SFUA 5KFQA 4CIGA 5KFKA 1TV6B 4R8UA 2FVRA 3NE6A 4E1MA 1JLFA 3Q8SB 3GV5B 2R8JA 3KKSA 1NNDA 4F4XA 4B9NA 2W8LA 1DLOA 1S1VA 2D3UA 3KHHA 3CDWA 1KRPA 4KI6A 4OKJA 2W9BA 3S3MA 3SCXA 1JLBA 1CZ9A 1IKXB 2R2UA 4OLAA 3CJ0A 5C42A 1JLQA 4NLRA 3CDUA 3QNOA 5EUHA 5HLFA 1QAJA 4WYLA 3ITHB 3HXMA 2X74A 3WNGA 5F8JA 1GX6A 3HPOA 2YNFB 4NLWA 2D5RA 3QEIA 4IG0A 5J2PB 4ECWA 4AHTA 1T94A 4DL2A 1NJZA 1JXLA 4CEBA 4K4TA 2FVSA 3I5CA 4ZHRA 4DL6A 4YFUA 3MR3A 4CEDA 4RNOA 4R5PB 3MEGB 3LPUA 1JLAB 4JV0A 3HPHA 2KFNA 4DG1B 3MR6A 1S1TA 1BCOA 3AVMA 1RT6B 1U48A 4I9QA 3TAGA 4K4WA 5KFBA 1A5VA 2R8HA 1HARA 4KV8A 3NCIA 4RW8B 4KHMA 2RN2A 1RT7A 3O4QA 1T05A 4ELTA 1HYVA 3KLFB 2ASDA 1Z4UA 1VRUA 5KG5A 3L2QA 1S6PB 3MEDB 1S97A 2E9ZA 3MXJA 4K8XA 4J9LA 5DK5A 4ED3A 3PR4A 1S9EA 2XI2A 1WLJA 3VQBA 4CF2A 4BWMA 3KMQA 2VG7A 1WAFA 4ECQA 2IAJB 2WCXA 1QSLA 4ICLB 1VRTB 3SI6A 4ID5A 3SUQA 3HHKA 4O3OA 1TKTB 4B08A 3I0SB 2EX3A 3M9NB 4CJPA 2R2RA 3OYAA 4FLYA 2G8WA 2WTFA 4E7JA 4ZP8A 4CEFA 1HYZA 4KHYA 4F4ZA 2J6TA 1C6VA 4ED7A 1LAVA 4EZ9A 2V0NA 4NLXA 3DOLB 1S0OA 4IR1A 5DQIA 1D9DA 4IH7A 3ISND 4DEZA 4OJRA 4CF0A 3MR2A 1U04A 5KG2A 2D7SA 2BE2B 4TQSA 3H5UA 1GOAA 2WK4A 1TAUA 4C8OA 3NKYA 4XIUA 1EP4B 3SPZA 4EO8A 4ED0A 2P51A 1C1CA 3NHGA 1EXQA 3RMBA 4CJEA 4IKAA 4NYNA 3BQ1A 1S0NA 5KRTA 4ECRA 5KT5A 2J6SA 3OYFA 2XY8A 2YKMA 3E01A 4CGFA 4KAZA 1BQNA 4FJKA 3OJUA 3EPGA 1EETB 5CYQB 4NCGB 3SYZA 1VK0A 4NLVA 1X9MA 4IG0B 3BSNA 4B9SA 3WNFA 4OPKA 3BSAA 3IRXA 3AVAA 4ECSA 1ZYQA 2I1RA 1RBRA 4DQIA 2VG6B 4ZVGA 3MEGA 3U3YA 4J9OA 3KOAA 2D0AA 4EBDA 4KB0A 4PQUA 5C42B 5C24B 3KHRA 2YV0X 4TXSA 4NZ0A 3ZT3A 4CGJA 2B5JB 1TAQA 3OYCA 3ITHA 2JC1A 5FROA 3VQEA 1TV6A 4CHYA 2O5DA 3OVNA 5L1KA 3VN5A 5KFZA 3LDSA 1RT1B 3SZ2A 4M42A 3ICLA 1SL1A 2WONB 3I8DA 5KG1A 3LANA 1BISA 1B92A 4KPYA 3C6UB 1N56A 4KI4A 1FKOA 5I3UB 3BSOA 3VQ7A 2Z1GA 1LWCB 2BANB 4CK1A 5KFVA 1N5YB 4NLGA 3SI8A 1U45A 4WFYA 3G10A 4QW8A 2Q3SA 3VQ9A 4CGIA 1WNEA 2IC3B 4QPXA 4FLZA 4HTUA 1ITGA 4FJGA 4ZP7A 4M3YA 3SQ2A 4YR3A 2FJWA 4O5BA 2WB4A 4J2AA 1VSLA 1LW0B 3OLAA 4NCBA 3NH0A 1GOCA 4O55A 4CK3A 5J1EA 4CHNA 3VQ8A 1SUQB 5C24A 3O3GA 2BR0A 3D5MA 1BCMA 3VQ4A 5JS2A 4ECYA 5KFXA 1QHTA 1JLCA 3KK1A 3AVCA 3GYNA 4O3RA 3BSCA 2UVVA 4W5OA 3Q8PB 1X1PA 2GC8A 1CZBA 3RBDA 2O4GA 2IJNA 1ZBUA 2YNGB 3V1QA 4MK8A 1IKWA 3V9XA 4YQWA 3G86A 4FZZA 1C1CB 4ZTFA 1NJXA 4J9RA 3MF5A 3AO5A 4ZPBA 3AA5X 1IKYB 2X78A 2ZD1A 3CIZA 4ZVHA 4N5SA 2PYJA 1QE1B 3L3UA 1IO2A 4NLQA 2QE5A 3IRXB 3RB4A 3EYZA 3H4DA 3QO9B 3MXMA 2HB5A 4CJFA 1HQEB 2BDPA 1SL2A 4CJLA 3IG1A 2W9AA 3AVJA 2OPPB 3OL8A 2JLEA 4HHTA 3H5SA 1KFSA 1SKWA 4GC7A 2XGPA 3IS9A 1NK8A 3GV8B 3IGNA 3ZSZA 3CVKA 3UDLA 3OYIA 4O4RA 3AA4A 2XGQA 1CLQA 4DLGA 4IG3A 1C0TB 1K6YA 3ZCMA 5KT7A 2XY7A 4JUZA 4I2PA 4IQXA 3ULDA 5T7BA 2W42A 3HJFA 1S4FA 3B6PA 1WSIA 2RPIA 5C25A 1D0EA 1IM4A 3FRZA 2IJFA 2ILYA 2PZSA 3LP1A 1WSFA 1TL1B 1N6QB 3AVBA 4O44A 3NH2A 3LZJA 3GV7B 1S49A 1JLFB 4J9QA 3QERA 4M3ZA 3QYYA 4WXWA 1RT3A 4TN2A 2XI3A 4H4MB 2W9CB 5JUMA 1MU2A 2D0CA 1S48A 3DOKB 5HROA 2OPQA 3DLHA 4F3OA 4F8RA 1JLGA 4EZ6A 3RAXA 4W5TA 5FRNA 4ED1A 4J9PA 2IC3A 1DTQA 4K4ZA 4N56A 1SV5B 1VSJA 1A5WA 3DRSB 1J5OA 4ED6A 4JS5A 1NK6A 4G1QB 3OYLA 4RW7B 4EBCA 3TWHA 1WNSA 2Z1HA 1Y97A 2W8KA 3DI6A 3JYTB 2C28A 1L5UA 2DTUA 3AO2A 2DFHA 1QSYA 4N41A 1C2PA 1TL3B 5KG4A 3OL9A 2HHSA 1JL1A 2HW3A 4CIFA 4QWAA 4H4OA 1S1UA 3MR5A 3CWJA 3G6XA 2FVCA 2IM2A 1BHLA 4LSNA 2HHUA 3MTKA 3NF9A 4FYDA 4BACA 1TKXA 5J2NA 4Z4GA 2HHVA 3UQSA 3M8QA 1KVCA 3ZT1A 1HNIA 1N6QA 3M9MB 4TY9A 2ITGA 2UVUA 2AGOA 3U3GA 3LP0B 4K50A 5KG7A 3H4BA 3QIDA 1YTAA 1LWCA 3L2UA 2AQ4A 4DL3A 4AILC 3DOKA 4FM1A 1SH3A 4KHQA 3HVRA 4RW9B 2KQ2A 4IFYB 4C8KA 1RT2A 4JRPA 4YR0A 2B6AB 4IFVB 2W9BB 4DL5A 1S1WB 1RILA 5KFYA 2XWYA 4ZP9A 4DL4A 1BIZA 4JS4A 4HKQA 5KFGA 3BR9A 3HVWA 4KO0A 1XHXA 1RBTA 1C0UB 1XR7A 3QEPA 4Z4EA 4EYIB 1QUVA 4RNFA 5HRNA 3NGYA 5KFCA 1ZETA 3KD5E 3RMCA 2R8KA 3WNHA 4ELUA 3HKWA 1HPZB 4Z4FA 1TGOA 3NH1A 4WE1A 3QO9A 1LW2A 1VSDA 3ZSVA 1L3VA 3V9UA 2QXFA 4CFAA 3ALYA 1C0TA 3TQ1A 3IN5A 3DLRA 3QESA 4URGA 3BGRB 4Z4CA 3ZSWA 4E3SA 3DRRA 2ZE2A 1WSGA 4CEOA 1WAJA 5KFOA 1TVRB 4UQGA 5KT2A 3LP1B 1TL1A 4RG8A 1RT4A 2R8IA 3T5LA 5DQHA 3DYAA 3AO3A 4I2QA 3LP3A 4ECZA 4CJQA 4DQRA 3AVGA 1RT2B 3CO9A 4MQ3A 4O3QA 1NK0A 4ZPAA 4DS5A 2OPSB 2CKWA 4OGCA 4EO6A 1RBSA 2BE2A 1S1XB 3IAYA 3NMAA 4FJNA 1REVB 5KFUA 5DGBA 4TY8A 1RA7A 4IDKA 1IKVA 4KFBB 5SWMA 3O3FA 4M3RA 2HMIA 4DSLA 2HNZA 4N47A 2CJQA 3KLFA 4OVLA 5KGXA 5HROB 3FSIA 4IG3B 3BDPA 4B8AB 2NUBA 3JYTA 2P5GA 4KTQA 1NJWA 2FLPA 4Q0BB 4NLYA 3QGIA 4FK2A 3ZT0A 1JLQB 1UAXA 3KNAA 4GC6A 4NLSA 2E6LA 4PWDB 3TAPA 1UA1A 4XO0A 4H4OB 2F96A 1U4BA 4CJTA 2YKNA 4O44B 3G6YA 3KTQA 1RYRA 5FDLB 4ECXA 2D41A 4H4MA 1CXQA 4FLWA 4IKFA 1BGXT 5D3GB 3BREA 5KFLA 3CFPA 4CJKA 4KE5A 4O3SA 4KHSA 1RT1A 1TK0A 4DS4A 1NK5A 1LWEA 4KBIA 1T03A 2OZMA 3S9HA 4E1NA 5HRPA 5EWEA 1ZTWA 4NYFA 3GIKA 5DGAA 4CIEA 3HYFA 2VWJA 2KW4A 4OPJA 4FM2A 3H2LA 3KK2B 2R8GA 1RT5A 3OYBA 2YKMB 1HJRA 2Z1IA 3DRSA 2G8FA 1VSKA 3JSMB 3HO1A 4KKOB 4CFCA 4CE9A 3Q8QB 2D0BA 1VRTA 2KFZA 3C6TA 3DI6B 4IFVA 1S1WA 1RTIB 3H5XA 5F8HA 1J9AA 3LWLA 2B43A 4M94A 1LWFB 3U6FA 3HP9A 3VQ5A 3V9WA 3SQ1A 4QWCA 3LP2B 3CFOA 4RW6A 2YNHA 3TAMB 3SV4A 2PYLA 3T19A 4NLDA 2WOMB 5F8GA 3A2FA 3L3VA 3LPTA 2WONA 5E41A 4ZP6A 4Y2AA 3KKRA 2XCAA 1K1QA 2GIQA 3PR5B 1YT3A 3DM2B 5HRSA 4Q5VA 1S1TB 2AX1A 1U49A 1QAIA 4NRTA 3IGVA 4ECVA 5I42A 2V9WA 4KFBA 1NHVA 5KGWA 4BE2A 4DFKA 3KLGA 3PX6A 4FJHA 4JV1A 2XO7A 5HP1A 2E4LA 4JLHA 3FFIA 3HVTA 3V6DA 2ZKUA 3FQLA 1RTHB 3KLEA 2R7YA 4DTPA 3ZSXA 2LSNA 3B6OA 2BANA 3RR7A 1X9SA 4PWDA 2KZMA 3KLIA 3RTVA 4DFPA 3IG1B 2E9RX 4FJJA 5F8NA 3D0PA 3NAEA 2C2EA 4ICLA 5DLGA 1BIUA 1K1SA 2Y1IA 2IS3A 3D45A 3NGZA 3PX4A 1ASUA 3LP2A 3CDEA 4KHWA 1O1WA 4BDYA 1S10A 2FLNA 3RB6A 3OYDA 4KHUA 4XPCA
chains in the Genus database with same CATH superfamily
1PYOB 1HMVB 2GVZA 1X60A 3TTFA 1SKUB 1KXPA 3LGMA 3EMTA 4DPOA 3FQKA 1XR5A 3FC9A 4CYUA 1HLUA 1HR0K 4S0MA 3H59A 3PW2A 3DMJB 3M6UA 5KFFA 2RU9A 3T1YK 1R6VA 1VI7A 2X7IA 1SJFA 4OL8A 1KQSR 3KK1B 1RA6A 1VQLS 1V4SA 2FGOA 4Q8FA 2XMJA 1UWBA 4KH4A 2V67A 5I3PA 2VWKA 2NPIA 2EG1A 2RE2A 3CFRA 3IA0A 4IRKA 2V4QA 4DL0C 3HPGA 3OW2R 2BRLA 3IDHA 4AQYK 1RADB 3UB5A 4CF9A 5F8LA 4J37A 3SJHA 4LF5K 1RAIB 4WK1A 1SIZA 1OVYA 1FJ7A 1NGDA 2XYPB 3MAQA 2KG0A 2K3IA 3SQ4A 2ASLA 1I3AA 3RWUA 3NAHA 1SI9A 2PN6A 3WIVA 3BO3A 2Z0GA 4TKTA 2G1DA 5DQGA 4YB1P 5JLFA 3HBTA 4FLXA 3F2KA 3K5PA 2CQPA 1R31A 3M6GA 2HHTA 4X4QA 1HQUB 2WRMA 2ALZA 4U6PA 1W97L 1YTUA 5BRDA 5JS1A 3H6EA 4B3OA 4WZQA 5HOOA 3BKTA 4GVBB 4RTFD 2WB1D 3UW1A 3QEXA 1TMJA 5KG0A 3GCWP 3CYMA 1M5KC 4CHPA 1K73O 4TVAB 4MIBA 4DN9A 1IG8A 4LR8A 3PCOB 2XBPA 2ASPA 1P27B 4MH8A 2CPJA 1K0VA 4LF2A 5EX0A 4GW6A 2P5VA 4JI6J 1BU6O 3R5AA 1NKEA 4WXOA 1TK8A 3OS0A 4K4UA 4AFFA 2AJFE 3TABA 2E20A 2ATLA 4HVJA 4KHPK 2RRNA 1U1RA 1QQCA 5K14A 1LNQA 5KG6A 4KV8B 3T1HK 1RBAA 3RRGA 2XC9A 4K4SA 3FBBA 3DLGB 3ZYYX 4DV4J 5D4OA 2V34A 4M63A 4DSFA 4KAIA 1OSCA 2DBBA 2J7UA 1UVNA 1FXXA 3MEEA 3ZC4A 4P10A 5AR0A 2QM1A 1VSMA 4E0DA 4RW4B 5KFNA 5C2GA 3JQMA 3TAQA 4YOEA 1SH2A 2E5LJ 1PYSB 2GGPB 4FK4A 3MM5B 2Y8WA 1MU2B 4CESA 3ZT2A 3MOJB 3G25A 2DPNA 4RWTA 5L9XA 1NGEA 2WVEA 4KGKA 2MKJA 4IWVA 4C3LA 2JRSA 4BR7A 2R4FA 4WYWA 5AZJA 2W4PA 3UIQA 4G1QA 3L4IA 1HQEA 4ED8A 4CLLA 3BKUA 1FXDA 4I68A 5HO4A 3O9TA 3M1VB 1JJ4A 1RNHA 3DLEA 5AQFA 1RKIA 4LF7F 4BDZA 4LH5A 4YNQA 4JV5F 3D2EA 4EHUA 2A2CA 1KVAA 4ED2A 4JK8A 4C1NK 1BD6A 5J2MB 3GJRB 4AHSA 2DXDA 1N52B 4FJ5A 1WBBA 4FWKA 1LW2B 4YDUA 2J0XA 3BYPA 1PC5A 3GFZA 3DXMA 4CH1A 1HNIB 3I96A 4WF9Q 1UEUA 2NXNA 5KFRA 5I9EB 4B17A 3TJ8A 3R5JB 1DARA 3F44A 5F1XA 4PL7A 3SQGB 4CEZA 2RIJA 3DLLQ 2WSCC 2B4PA 3K0JA 2OFGX 1YXQA 2KO1A 5F3TA 3RR8A 5AJ3J 4BS2A 5LL6Z 1CLFA 5DM7L 2ZITA 4ECTA 5KFMA 3W7BA 1MROB 2Q1LA 1Y5LB 2A41A 2BX6A 2VU5A 2DNYA 4B1ZA 1KHVA 4KKOA 4QR0A 1RKJA 1KS2A 3HULA 3UKUA 1KLMB 1HHQA 4PY5A 1B7FA 1IV0A 3SUNA 1VOMA 1S1UB 2P9SA 4LF4F 4NLOA 3OFFA 1LAWA 4AD6A 1BWVA 4QQBA 3LDQA 2EFOA 1BL3A 4NRUA 3ISNC 5LJ5Y 4JYAF 4R8UB 5I42B 3WNEA 3H8YA 3DLLL 1UEVA 3QBXA 4UZCA 3SQGA 3F9MA 2HHXA 1QY7A 3ZTRA 2YPYA 1V3SA 1S6QA 1RK8A 4IOBA 4UOCA 2Y9HA 1XNQF 1REVA 5F0UA 2AF6A 4ZIVA 3WXKA 1FXRA 1RAFB 4IRDA 2AP1A 4BE1A 2EFNA 4ZLNA 4KB7A 1RDRA 3JTPA 2E2OA 2ASYA 4ZS6A 3DRYA 4ZVEA 4QS9A 1Q78A 3CJAA 3D6TB 2IAJA 3BPDA 3I55N 3VEWA 1HPZA 4GVLA 3CC4N 3JSMA 5C10A 2B4VA 1UW9A 1SIWB 3F41A 2CJKA 4FXDA 4ILLA 4J2EA 3C6AA 5C25B 3M1VA 3I33A 2RVJA 3P49B 3AA3A 1M1HA 1RE1B 2FF6A 1TUWA 5FJ4A 3VQ6A 1J5EJ 3MAAA 4NYOA 1VQOS 3ID6A 3RB3A 2EC0A 5DG7A 1XHZA 4WBFA 4WZMA 2LXUA 2J9EA 5JVHL 2IIRA 1C4AA 4E98A 2IM0A 4WQ5C 4NYZA 3QIOA 5HK4A 1DURA 1N88A 1H7XA 4M3TA 3CJSA 3KK3B 4DCOB 4CO1A 4DV0F 2P9KB 2GWJA 2OEKA 3CCLN 1PYTA 1NOYA 3PW5A 1YJRA 4RWWA 4HT5A 4USKA 5FRMA 1PAEX 4HDHA 2YX7A 4RNNA 2EK6A 1M1GA 3KJQB 1FDDA 1KNZA 2R7QA 2QA1A 2CG8A 1PG5B 1ZBLA 2VQEJ 3AXMA 4DSIA 4PAAA 3M30B 5AQSA 4Q8EA 3I5BA 1RTIA 3HHEA 4F02A 2WOMA 3R5BA 3SCKE 3W62A 1TL7A 1Z25A 2ZM6K 1SV5A 3M6VA 1R0AB 1WG5A 1XWLA 1XC9A 2DB1A 1XBWA 1LFPA 4LF9J 3VAIA 5FLXO 1HNWF 4IFEA 2MMYA 2P5OA 4CJVA 4ZCIA 4AM6A 4RUHA 3WXMB 4G9ZA 4FPIA 2X3GA 4C8ZA 3PX0A 1DEJA 1A5XA 4DTSA 3TZZA 5EX3A 1EQYA 1F5BA 3LP0A 3ZTQA 1GLDG 2VPXB 4YHHF 4PHTX 4OJHA 4DV6J 2KJVA 1FRMA 3M2UA 5KFDA 5DETA 5IT4A 5A8RA 3CI5A 2RH3A 4DSKA 2M5YA 4RW9A 2YQ3A 4IFYA 3GFXA 4OI0A 4FBUA 3WEEA 4C8LA 2QEXN 4KYZA 3W63A 4OX9K 2N82B 2DHGA 1FA0A 3KIOA 1R0CB 4LF6F 5LXRA 1PJ7A 5DO2A 1V4TA 3OS2A 4P9SA 1GMWA 4FZXC 3FUYA 4W4MA 2QWRA 4JI4F 2GTDA 1OH8A 1K73T 3NBPB 3H25A 2P9NA 2ZJPQ 4DV3F 4B3RF 4JD2B 1QSSA 5H9EJ 4A5AA 2RNEA 1TL3A 1RWUA 4P74A 2AJQA 2YCHA 3VQPA 3FR0A 1Q82T 2XS5A 5D78A 3JQKA 4J9SA 2LQ8A 3OTOF 2V8DA 1FRHA 3M8PB 2YKAA 5H9FK 1BI4B 4CTAA 2WC9A 2KT2A 3JS6A 3PO5A 4QYZK 4QAGA 2EXUA 3MM8A 1NJIO 5L1JA 3KK3A 1T0TV 2COLA 3K5OA 4L76A 4DTJA 2UZAA 1FRKA 3IBWA 1TVRA 1GQEA 1WC6A 3CCUS 5ADXH 4M5HA 5KRSA 3SBMA 4NLCA 2ADBA 1O8BA 1YTYA 2KM8B 1Q81T 4JKHA 4BRPA 4GVEA 2PDAA 1VQ8N 2BQ3A 4NA3A 2VB6A 4G1IA 3OUYB 2HRYA 3VZHA 1RUSA 2I5JA 2FBXA 4PKHA 1NLVA 3CC2S 4FJ7A 3CNQP 4Z0UA 3LL3A 3DRRB 2RRBA 4LVNP 4U8YA 4K4XA 2F8SA 2RKIA 1V6HA 4DMZA 1WI8A 1Q5YA 5CYMB 4M5MA 2BV3A 4F4YA 4F26A 5KFTA 4BRIA 3PO4A 1VLOA 3MCPA 3VQTA 4LR9A 1VHFA 4PWUA 1EWQA 3N5BA 2ZJRL 3CF5L 2AJ2A 1KWMA 3WUHA 3BM7A 1KAXA 3A3NB 4C2MA 2O66A 4O0IA 5KFPA 1QUPA 2Q3PA 3RBZA 2G8IA 2UVWA 4NLPA 3ADAC 3DLEB 4NYPA 2FC9A 4FCYA 1ZA1B 1VQMN 2ZH9A 2ASJA 4FVUA 3W9HA 2DT9A 4RNMA 1JLEA 3R3TA 4JI0J 2VYPA 5LJWA 3QGHA 1FO1A 1OO0B 3GIMA 1D5AA 4O4GB 3I55S 1KVBA 3RW6A 3J8AA 1WEZA 1FK9A 3BH6B 4H5NA 2W2PP 1P9QC 3W2VA 1N34F 2QK9A 4DR4K 1PJ6A 4M63C 1RLDA 4PUOB 2AD9A 3PFEA 1RLCL 4Q45A 2G8KA 2CA9A 1BI4A 1ATSA 4DUZF 3EZOA 1OQ6A 4PG6A 4KB1A 4QYRA 3PW7A 1FJGF 3HSGA 2QMUB 4DV2F 4DU1A 3MZIA 3J7ZO 2O8FB 1XI1A 2CWXA 2JEFA 1MWQA 4LREA 4LF4K 2B9YA 3FCWA 4M3WA 2NSCA 3FCVA 5A6PA 3K9JA 1IR1A 1ACMB 3IXQA 3VGVA 2YWKA 1UEKA 1X4BA 3HX9A 4ZMMA 5JXSA 3K57A 3CCRS 4M3UA 4AF1A 1KTVA 1NPKA 2F9TA 2A1SA 5E3AA 1UA0A 2J5AA 2FSNA 3P5BP 2HBQB 1WSJA 2IBKA 2LECA 4LF6J 1NU0A 4EP4A 2MGZA 2AKWB 3BF3A 3OYEA 1HRHA 3MURP 4DPXA 3NLCA 2HWHA 4QOTA 4LSLB 3PJXA 4DTNA 5J2QB 3Q2SC 3GL1A 2I6WA 4Z7CA 2J8SA 2GUPA 4YMEA 3WC0A 2DIVA 3D2FB 3EE9A 3MCOA 1VHXA 1UWBB 2BQUA 2B56A 1T3NA 1T9UA 4UW2A 5GMEA 2OJ3A 2M8DB 2DGOA 3EGZA 4ZVFA 1TYQB 3HF5A 2VOOA 4LF8F 1YJ9N 1RDAA 4J2BA 3H90A 5L46A 5ETRA 2Z2MA 3TQEA 1JQGA 2DFEA 5C7PA 3RG6A 3HP6A 4BRKA 4PUOA 4DX6A 1VGYA 1FEEA 1DQAA 3JXUA 3TEGA 4DZDA 2VG6A 2ZEJA 3J7Z5 4ALZA 1SKSA 3L8BA 1VJWA 2G0JA 2HS4A 2N4DA 1HIYA 2XSJB 3VAKA 3H3NO 1E6VA 4DUTA 2BJ8A 3GIJA 2FJDB 4FS2A 4F3MA 2XMVA 2ZZTA 1AFIA 5DJBA 3THWB 1TL7B 3HT3A 3K8WA 4KC5A 4C1NI 3PEJA 3HM9A 2IGIA 1YJ7A 5HMYA 3R1LA 2PD1A 2HURA 5KFQA 4U67Q 2XZTB 4B3SJ 2PE8A 2W8LA 1S1VA 2Z2LA 4CLTA 3CIPA 1OVQA 2DY9A 3R5GA 4OHZA 3KHHA 1U1NA 4FO0A 3CDWA 3S3MA 3IR6B 4H0PA 4IDHA 1CZ9A 2WAQD 1JLQA 1U02A 5HLFA 1QAJA 4A8WA 4HHJA 3ITHB 1U8WA 3HXMA 4B3MJ 2YX4A 4GVBA 3HPOA 2YNFB 2B9EA 4IG0A 3O1BA 5J2PB 2AT1B 2G2OA 2WW4A 1VJQA 4AHTA 4JKGB 1WBDA 2XM3A 1JXLA 1VYAA 3A8KA 4K4TA 2CJAA 4ZHRA 4DL6A 1HLWA 4OIXA 1RGIA 2GGPA 4F0HA 3W9JA 2ZDOA 3BZKA 4RNOA 2GVDB 3LPUA 4JV0A 1UJ6A 2HBJA 1B99A 3NEKA 3S7RA 4I9QA 3CCVN 3TAGA 3VPZA 4K4WA 4EI2A 8AT1B 2R8HA 4DR5J 1B0PA 3MMCA 2MHEA 4X4RA 3NCIA 5AQJA 1FX4A 1T05A 4ELTA 3FGUA 1F0XA 1Z4UA 2A3JA 3PRVA 4HTLA 2E9ZA 2K2PA 3GLJA 3MXJA 4X4UA 1EQMA 2QSWA 2DKOB 2QJ3A 3ET6B 3OXGA 1KVKA 2LP4A 2NRTA 1HNZF 3D6RA 4HH0A 4ECQA 2IAJB 4L3QA 4ICLB 2EFVA 3MM7A 2BBEA 3EX7B 4FYYB 4LF4J 3DJCA 1N33K 1TKTB 2HIYA 4B08A 4DN0A 2R2RA 4LBIA 2PA8D 3AY9A 2HFUA 2J6TA 1C6VA 5AQIA 3J7YP 4EZ9A 2CADA 4NLXA 3M30A 1S0OA 5DQIA 1WF1A 3QB0A 4PXCA 3J7A1 2F9DA 4B3MK 3OBWA 4M5NA 2DJWA 2WK4A 4RBUA 1U0HB 1HKAA 3NKYA 4ZVSB 4CLWA 4PRFA 3MWPA 4OFZA 1C1CA 3NHGA 3NOCA 5AFUA 2XS7A 3Q8UA 3RMBA 4CJEA 2GQCA 4IKAA 1W2BR 4ZCMA 4H5TA 5KRTA 4ECRA 2VBZA 4DV3K 3UDVA 4NMXA 4J9UE 4JI7J 3VENA 4WFAL 3E01A 1BQNA 3ILOA 3OJUA 1EETB 4HLBA 3H3OB 3SYZA 2FY1A 4NLVA 1OH6A 4B9SA 3WNFA 2UYTA 1MROA 3AVAA 2I1RA 4DQIA 1M1KO 2H51B 4J9OA 3DOMB 2JVRA 4KB0A 1DBDA 2K3KA 4PQUA 5C24B 2YV0X 1N34J 2RRAA 3EVWA 1HUXA 1F3FA 3ZT3A 4CGJA 1K44A 3ITHA 3F56A 2GELA 4OI2A 4CHYA 3QFHA 3C46A 3OVNA 1M90O 3VN5A 2VFRA 1RXOB 1T6CA 3D9BA 3G87A 3MMAA 1G7CB 4ISEA 1BISA 4JAXA 3CDBA 1B92A 4KPYA 2IVYA 1I94F 1WUUA 3PIOQ 1N56A 2ROEA 2A6OA 2BOPA 1S99A 5E7OB 3AQOA 1LWCB 4DBQA 1ROFA 3S41A 2OLWA 4GV6A 3E2EA 2ZJQL 2MKCA 1XK8A 2I0XA 3SI8A 2OTLN 3SBTA 6FD1A 4ZVQB 4W98A 4JKFA 4BG9A 3PG9A 3VQ9A 4CGIA 5AQYA 1KOOA 1TL5A 2G13A 4M3YA 2IFXA 4YR3A 4KH5A 1LW0B 3R7SB 1R0BG 2FPHX 5J1EA 1WB9A 3VQ8A 5T7LA 5C24A 2P9UB 4H4KC 3O3GA 5C0YA 1NRKA 4KH6A 1AROP 4DUYJ 4YOVA 2LMIA 3R7NB 4ZCLA 3GYNA 2UVVA 4CBUA 4W5OA 1QDUB 3FFKB 3GBTA 2O4GA 3ZO7A 2OI2A 3NGRA 3VAFA 3QRQA 2V63A 1A6LA 1HNWK 3OXFA 4YQWA 3KWMA 1C1CB 3CC2N 2VICA 4J9RA 1CJTA 1IN0A 1V9OA 5B0GA 1IKYB 2P9LB 1XERA 4ZVHA 3A0IX 2PEHA 4OYOA 3L3UA 2QE5A 3DGPB 1OY9A 3M32A 2GJFA 4U7UD 3KUGA 4NPOA 4FWRA 3SAHA 4DUZJ 5AQQA 2F9WA 3Q83A 5K9FA 2W9AA 1H2UX 2UV8A 3JTOA 4G65A 1CJVB 3IS9A 4LRCA 1NK8A 2NYIA 3JSBA 1XQSC 1KQFB 2HOEA 1WORA 4M5DB 1VQ4S 4O4RA 2D4WA 1C0TB 3ZZOA 2XY7A 4BGAA 4I2PA 1RBLA 3CCRN 1S4FA 4LIWA 3DLJA 5IT9O 3B6BA 2YXLA 4DUYF 3B6PA 4KQZA 5C25A 1D0EA 3T9ZA 2ILYA 1N6QB 1FJGJ 3LZJA 3GV7B 1S49A 5DDRC 3GU0A 3QERA 4XDCA 3EM1A 4WXWA 2ZC3A 4TN2A 2MJUA 2EW9A 1S48A 5CA5A 3DLHA 5HROA 3FK4A 2YJFA 3WEEB 2XTJP 2FXUA 5AJ3K 4BLGA 2WBRA 5M1OA 4W5TA 5FRNA 1VCTA 3QWPA 4ED1A 1ZA2B 3HMJG 4M5LA 1DTQA 4HHUA 4GNIA 1J5OA 1KC8T 4ED6A 3CMAS 1WNSA 1GLBG 4OZJA 5G0RB 3JYTB 2LLZA 4LFBJ 3EO3A 2DTUA 3AO2A 3A1YG 2DFHA 2CPXA 3AOCA 3U9DA 2QWPA 3HRGA 2GJIA 3GONA 1FCAA 2KXHA 1JL1A 4PKGA 4CIFA 3C66A 3LDPA 1VQ9S 3CWJA 1T02A 2IM2A 4FOIA 4PG5A 5I3QA 4FYDA 3CW2C 3W3DA 4NO7A 4CDIA 2C2OB 1NMEB 3M8QA 4DUZK 1KVCA 2E66A 2A42A 3AD7C 4TY9A 3M9MB 4JD2A 4ENOA 3I4PA 2AGOA 1GLAG 2HVZA 3H4BA 3L2UA 4A2BA 2D9PA 5J1NA 4FM1A 2NXJA 3Q23A 4J90A 4QYZJ 2V68A 4RW9B 3AOBA 2YWHA 2V2ZA 5HVFA 4IFVB 3PYEA 2W9BB 2O67A 1KKHA 4IJAA 2POKA 1SC1B 2IVFB 4GO7X 4JI3F 4JS4A 2P9UA 1X4CA 4HKQA 4FYWB 4DR3F 5AZJB 3FMWA 1YZ7A 3BR9A 4KO0A 3VF0B 1XHXA 1C0UB 2Q6BA 1XR7A 3KG0A 5HRNA 4AL6A 3GE9A 2DVIA 4DR3K 5KFCA 5M1QA 2OTJN 4ELUA 4WFBL 2RQCA 3N0VA 2J7KA 1XMQF 2QXFA 3ALYA 2ZH2A 4QR1A 3DLRA 3QESA 1J5EK 3BGRB 2JVOA 4Z4CA 2DH9A 4WWSA 3TA2A 1VMBA 1YJVA 4W92B 1Y5NB 2H9ZA 3TZYA 4BRCA 4CEOA 4UQGA 1TVRB 3LP1B 1QTNB 2CZ9A 3SAFA 3DYAA 4I2QA 2VD3A 1RT2B 3CO9A 2EBGA 4O3QA 4ZPAA 4RWXA 1U7LA 2RHQB 3M6WA 2PMHA 2BE2A 4X4NA 3IAYA 1AT1B 3SCJE 5KFUA 4BREA 2EPIA 4C0HA 5BPLA 2PI5A 1HNWJ 2P2CB 2C2ZB 4LVOP 4OJGA 2XWXA 4C8YA 5GAGI 1U1PA 2DRBA 3FSIA 3VEYA 3JYTA 4EU0A 4Q0BB 1WDDA 4IXCA 3ZT0A 3EDRB 1FDAA 4NLSA 4A61A 1OYEA 3FCHA 4R25A 1WSRA 2XMKA 4O44B 1VQPS 2FJAB 4X62J 2DNPA 1N33F 1UZHA 4FLWA 5LJ3Y 1RZMA 3P38A 3BREA 2M9KA 3S01A 4UY8T 4OYAA 4KRWA 5L9NA 3I56S 3GFYA 4O3SA 1NMDA 1B3TA 3HHLD 5DZ6A 4R0JA 2A40A 1TK0A 2CZ4A 2ZUAA 2OZMA 1HI1A 3GIKA 3RVCA 3HYFA 3CCZA 2VWJA 2KW4A 4OZ0A 4FM2A 1G6BA 1YJ9S 3PM9A 1J27A 2QXLA 3DRSA 3CPEA 1SQKA 3OPKA 3MWTA 2AJ0A 4EHTA 2ACYA 5CH7B 2KB2A 3C6TA 4IFVA 4HHHA 3H5XA 2UU9F 1J5EF 3A5NC 1FHTA 4M94A 2BM1A 3O9RA 3ELHA 4LF8K 4OHXA 1W2BM 3VQ5A 4LSZB 3Q8YA 1CBKA 3CFOA 1P9YA 3T19A 2QA2A 1R3NA 2J8AA 1N5SA 2EWHA 3G8TA 2QTWA 3HZGA 2HFVA 1NDLA 2GIQA 2RS2A 4GRSA 1AFJA 4ECVA 2OD4A 4KFBA 1NHVA 2HQGA 4FJHA 2XG8A 5HP1A 4JLHA 3HVTA 1RTHB 3KLEA 1WUAA 4DTPA 4B1XB 2Q79A 4WIQA 3ZSXA 1UFWA 3O9SA 2LSNA 3HJVA 4UQTA 4XK8C 2F5GA 1M90T 2Q6CA 2YJEA 3W5XA 3IG1B 2E9RX 2EVZA 4C7QA 4FJJA 2FUG9 3HD2A 4Y6IA 4ICLA 2M88A 3BUZB 2UUAK 1K1SA 3IBFB 3LP2A 3CDEA 4CWBA 4G1PA 3I8BA 4KHWA 1S10A 1VQSA 2OTLS 1NSPA 3OYDA 3I9V9 4CZCA 3EKSA 3BP8A 3NGDA 4I2QB 4CHQA 1JK9B 2PO4A 2A1RA 4B3MF 3K9KA 2J0QD 5CAAA 2H1YA 2GUIA 1TTHB 3LM9A 3HCXA 2FLLA 2FTRA 1GOBA 4C8MA 3DLGA 5I4MA 3L2VA 2CPIA 4FWNA 2CH5A 3AVNA 4O0JA 4WFNL 1VR6A 3FZMA 3MUMP 2W7PA 4FSVA 4IBNA 1E6VB 4F0KA 4H0XB 5JVGQ 2ZQBA 5E26A 4DTMA 4IR9A 3KLHA 5B0EA 4XDDA 4K8RA 1WC3A 3MR7A 3C7NB 3PY8A 1U2VA 3WIUA 4B1WB 4W5RA 2VQFJ 4FBTA 3UVJB 3N5FA 4J9NA 2W7OA 1BA0A 1F9FA 2CQDA 2G9OA 2GIFA 2BYCA 2HWTA 1S9GB 3W64A 5ETPA 1KP6A 3FZKA 3VGKA 4WFZA 3THWA 1X5OA 1S1VB 5LMNJ 1T7PA 3L7OA 2O8EA 3G4SS 4LY7A 4E7IA 4TLQA 4CGHA 3HSTB 1FESA 1L3SA 4YR2A 4Q44A 1HJOA 2FJVA 4ZVOB 1Z1ZA 3IO1A 3TVKA 2BKPA 1FRXA 1MWYA 3C65A 5TKYA 3JAMY 2G8HA 4RNHA 3RGIA 1M5SA 4LIRA 1BA1A 1FE0A 1FERA 2HNDA 1KN6A 4CCHA 3MAHA 1MMNA 4YORA 1VQ7N 2ZBIA 4ZIWA 3ATUA 3K58A 1UVIA 2VL1A 4OV6A 1G99A 3MX2A 3EEQA 4WTYA 1U1MA 1TKTA 3NFAA 4IO9Q 2OPPA 2F8HA 1KFDA 1VSIA 3TAEA 4JI7F 4FWMA 3ET6A 4IO1A 1ZBFA 3OYHA 1TKDA 2D69A 3A8EA 2VQFK 1T44A 1H1VA 3THXA 1JLAA 1S9FA 3NF6A 1TP7A 2VOPA 1U6FA 2APOA 2Y0BB 4JBCA 1JKHB 1X4GA 4TYAA 4LRAA 5C12A 1R8HA 2JEJA 2DHXA 4PXEA 4F25A 4WU3A 1VQNN 2DISA 3GWCA 3OT9A 2IMWP 4P2MA 5HMXA 4QIEA 3LTOA 1P90A 2B3TB 1EETA 4LT6A 4Y2MA 4F3TA 2JLGA 1HA1A 2UUWA 2VFSA 2QA4N 3KLIB 2OPQB 1T9XA 2E5LF 3GDQA 3HLUA 4DSJA 4P7TA 1GXUA 4JYAK 3O9UA 3I0RB 4K43A 3S6EA 2KYXA 1T3VA 3ZZRA 4USTA 2DEJA 1DAXA 4NOHA 4QJVA 2FBTA 4Y00A 2KT3A 1HNVA 1NO8A 1W9HA 4I7FB 3BF1A 4DPYA 4M5DA 1RTJA 3HVAA 1WHWA 3DDNA 1Y11A 3A5MC 3SMZA 2MZTA 3SCIE 4DTXA 3W2VB 1NXIA 2RS8A 3V6JA 4B9VA 3VQQA 3RSEA 2ZOFA 5HVGA 3RMDA 3PUFA 2HLUA 3SQOP 2IM3A 2H3GX 2VPWB 4A8OA 1CJUB 2L9WA 4YS2A 2HG4A 4DV2J 2UUCF 3AB4B 3EJMA 2V4RA 4BC2A 2OELA 4N7TA 3DCAA 4P71A 3VOVA 1NBEB 1S6QB 3JAMO 3QQCD 1VSEA 2LFVA 4AQYJ 2AYGA 1FXLA 4LBPA 4CIOA 3P83D 3C95A 1HWKA 1TUGB 1IJJA 2HYIB 4FJ9A 3R8EA 5K20B 2CQ0A 4ETXA 5KFEA 2IDOA 1JJHA 1TK5A 3QMQA 3T6BA 1PCAA 5KPTA 2HKEA 4HDGA 1C0FA 4HTJA 4ZPTR 3TEHB 2FZKB 4NEZA 3TPQA 2YNIB 2UXCJ 2HNYA 2P9KA 1RTDB 1Y0HA 3AGKA 4ZPWR 4DV0K 3W0LA 4GO5X 4DKWA 3OYMA 2V2VA 3Q8VA 4Z4HA 4JV2A 4FNHA 4WYBA 1GMVA 2DH8A 1CEZA 3MTJA 1BXNA 1S5JA 5DG9A 1TKXB 1FDNA 1VQ5S 3MXIA 3OHAA 3TAMA 3IMXA 2BGGA 2EBEA 1VS3A 3DDKA 1BQMB 1KTQA 3NGIA 3HK2A 3AVFA 2YPZA 5L1LA 4L73A 2JHEA 2OYQA 3V1RA 1DKGD 2E29A 2WVDA 1KCFA 2E6MA 4OKKA 1S1XA 5JJBA 1X4DA 3MOZA 2MXYA 4CF8A 3MFHA 4BWJA 1Q8LA 4V19X 5HLFB 4WP3A 2QYGA 3BGLA 2V6AA 2R7SA 3CJ4A 3PV8A 5ETKA 4DQSA 3CPWM 1TYQA 4FJXA 1I6JA 2E2PA 5CZ2A 2CJ9A 2RUGA 1RT5B 1Q95G 3LGNA 1NK4A 1RCHA 4K0KF 4JK9A 3S8SA 1HNVB 4YY3F 5KG3A 2XLJA 3CCVS 3HHLC 1KQKA 4RU9A 2IOCA 5IC6B 3ZT4A 3OYNA 2QKKA 2ZM6F 4ILJA 3RB0A 1YRUA 2LU1A 4LSLA 1O13A 4V1Ak 3TJ9A 3G6VA 2ZE2B 2V8HA 3UR0A 2NR0A 2MGZB 1JLCB 4B3SK 4UZBA 3HFZB 1EO1A 4KRFA 3EZ5A 4CJRA 3AA2A 4AXIA 3CCMN 5AQVA 5BN8A 4FJLA 2DNQA 4DV7K 5ETVA 3ZSYA 4NWBA 4UF4A 1DTQB 5CY4A 4URSA 3CXCM 5IZHA 4BRHA 4Y2KA 2X3DA 3RRHA 1CJKA 2IYGA 2OMLA 4KHRA 1YBAA 4WFAQ 3E9OA 4Y1DA 4IH6A 4Y3CA 3EE8A 4M7XA 5DG8A 3CCWA 3CCES 1CC8A 1NB2A 4HT7A 1SCJB 3ILLA 1B64A 2BOAA 3VWSA 5HQ8A 3M32B 3OLBA 4USHA 4LFBK 2KRBA 2J7WA 4P73A 5C2CA 5J2MA 2PY5A 2RQ4A 2PT0A 1ASWA 3VA3A 3QZ7A 2O8BA 5GAGU 2XLKA 2XHBA 2CPDA 3TVZA 1Q8BA 4ZLPA 2C2RA 5GAHI 3D3BJ 3AJ2A 3S3OA 1NJIT 5AQGA 5CYMA 3J7YI 3AJ1A 5I3UA 4DOZA 4AQYF 4DV6F 1M5VC 3DLBA 5D0GA 3EKUA 1RU2A 3THVA 5B0AA 1KSPA 2E5HA 3QICA 5E3QA 3ILIA 2HIQA 2ILZA 3QGGA 3H0PA 2HNDB 4BBYA 2C2DA 1JMTA 2Z57B 1N33J 4Y0FA 1JX4A 3KHLA 2HVHA 1IKXA 4DR2J 4X64F 4CERA 4WTOB 4NXMJ 1RAOA 4GKKK 1S9GA 2YNIA 4KO0B 4AYBD 5F41A 2MSSA 1HQUA 5E84A 1BG3A 2YNFA 2LDIA 4DR7J 2QO3A 4R5PA 3U7JA 2J6UA 4JKAA 1K8AT 1FKPA 4ZPDA 1B9DA 4MLHA 1MW7A 2YWFA 3VEZA 4QZVB 4P6QA 3PJWA 4EUVA 1VQMS 1FJCA 2OO4A 3UD4P 3OBYA 4B8CA 2JJ4D 2DGTA 2FSJA 4X4VA 2J0WA 4BG8A 2P1JA 1FF2A 3TUJC 2LQ9A 4DTOA 4DR5K 3KDOA 1VQKN 3VVTA 1OKJA 2H65B 1ZAWA 4TU7A 2I7PA 3KLHB 1IKYA 3LWMA 2UXDF 2IPOB 1HKBA 5KT4A 5GADU 2GZOA 3AVKA 3BGRA 2DGXA 3F73A 1S6PA 2D3OR 3IBCB 1LV5A 2RF2B 3UI3A 5BYRA 4USJC 2MQMA 4O5FA 4YDDB 2JEIA 2KG1A 3DRPA 2CNOB 4K8ZA 1S79A 4OYMA 1C1AA 2AA4A 1HMVA 2CRLA 3QINA 3W66A 3VF6A 5IOLA 3M8RA 3QJLA 4Q2LA 4F9OA 1U09A 4FW2A 4J9MA 2IRYA 5AQRA 3C16A 2Q43A 1ZC6A 4ZLJA 3V81B 2NLWA 4CZJA 1RHJB 1O6XA 1VQ8S 4H54A 2RHSB 4CTAB 3CTRA 4LFBF 3N28A 4CEAA 1TKZB 2IA0A 1UW4A 5BYQA 3AODA 3O8WA 3LW5C 1L3UA 3CCMS 3EGNA 5C2FA 3TA0A 3GILA 3PEHA 2Z4PA 4DLEA 3QIPA 3H42A 1KC8O 2DGWA 3O3HA 2AEFA 1UJ5A 2F3JA 4U9RA 5GVQA 2ZH6A 4CGGA 2CNKB 4DMNA 3C19A 2RDDA 1FEHA 2MZJA 3CJ3A 1D8YA 3RBXA 4QWBA 2QKBA 4I2PB 1XNQK 4DCPB 2AEJA 1FTCA 3G8QA 1KEKA 8RUCA 3GIIA 1F9HA 4FWSA 3M9OB 4DF8A 4ZJOA 2YNGA 3V1OA 4C23A 1XNRJ 3V81A 5B09A 2PFDA 5T14A 2B5JA 3T1HF 4AHCA 4M41A 4FJMA 4OZLA 1VSHA 1V3ZA 1IJEB 4DV1K 4RW4A 1X5PA 4TQRA 2Q66A 2YX1A 4XH1A 3H40A 2VFVA 2ZWOA 3CJ1A 2NXUA 3ZSRA 4K59A 5ETSA 1RT3B 1MMLA 1FRLA 4EAHD 1UPPA 4CJUA 2DXFA 2WFBA 5BR9A 1HWUA 3NP5A 1G3OA 2QV6A 4IH5A 3PVXA 1VBYA 5FD1A 1NH7A 1OJ4A 3IAM9 4CJWA 4F4AA 3CHWA 3OJSA 1S72N 4JKEA 4K2JA 2M7SA 4CNZA 1RTDA 5F2RA 3LPYA 4FF3A 3AV9A 3ID8A 2NZTA 2OPRB 4BE0A 1BOTO 4JKGA 1PAUB 4QU6A 1G15A 1YUWA 3M5RA 3KLEB 4NLTA 2H5JB 3M8SA 5DMRA 2HFZA 2NQPA 4KTWA 2HFOA 3GJSB 3GFHA 4ED4A 3PW4A 1ICEB 4A8KA 2VGNA 3OXLA 4NXNK 3DYAB 1JLGB 1S4EA 4YB6A 4WCEQ 2GFFA 4YP3A 2IA6A 2QFIA 8ATCB 3CJCA 1S7HA 2M2BA 4FM0A 3CG7A 3NVKA 2ZHOA 3K59A 1NGCA 3E3XA 3WQUA 2OPSA 4W5NA 2MKSA 3FEXB 4FNIA 4ID5B 1UVMA 4H5RA 2GQ2A 2IIHA 3ZSOA 4IQMA 3QFPA 2C3OA 2DITA 5SZTA 3CD6S 4B9TA 1BE4A 2BJDA 1RDDA 4R79A 3V9SA 4CT9A 3K8VA 5LSRA 1VQON 3EE3A 1C0GA 3VAJA 1H3DA 3VGUA 1WOSA 4CI6A 1RT7B 1RJJA 4URQU 1Q7YT 3VV2B 4JI1K 4I7FA 3C14A 1VQ7S 5IWAK 2DNNA 3FEYB 4B1VA 1HYSB 3UN3A 3F0NA 4PQUB 2YKNB 4FJIA 2AJ4A 2BEFA 3EICA 1RDCA 2IVPA 1H6KX 3E66A 1KHWA 4C11A 2W2MP 4TLRA 3T7ZA 2BE7D 4PABA 3LF0A 4F67A 4BVPA 3CXCR 4X84A 3BQ0A 3SFUA 4DPTA 1X31C 5JMNA 4R8UA 2BJ9A 3GV5B 3MWBA 4B9NA 3TUZC 4H4KA 2DH7A 1Q1KA 2P6SA 2D3UA 4V19S 5ETLA 3L3CA 2W9BA 1XMQJ 4FN5A 2QL5B 2R7TA 4HR2A 1IR2A 4OLAA 1N0VC 3CDUA 4DV0J 1VQNS 1F2GA 2OD6A 1NEEA 3O2IA 1YJNN 2CH6A 2M52A 2MZSA 2O01C 2E8AA 3CEDA 4MYTA 4BROA 5HI7A 2IVNA 4NLWA 1KR4A 1WEXA 2H4YB 3QEIA 4MO4A 5ELZA 3CC7N 1N32K 2NRZA 1NGAA 3U4LA 5B7WA 2OCEA 1YRXA 4BRGA 1IBKK 3QFUA 3KNGA 1U2FA 2CQ1A 1EQ0A 4K5RA 3ULEA 5K5MA 3G71N 4YFUA 3MR3A 1X4EA 2C2NA 1XNQJ 3QPIA 5EN1A 1JLAB 3HPHA 4DG1B 1WD6A 1U48A 3PLAA 3MUTP 1FD8A 4ED5A 1BMQB 5AXKA 2RUSA 1BWFO 2WSFC 3R6MA 3O4QA 1ESVA 2XHCA 3DNCA 2ASDA 1Y5IB 3L2QA 4ATNA 1HBMA 3H1VX 3V2UC 4K8XA 2GHPA 3PR4A 1LK7A 2XI2A 5AXLA 2F9JA 2AMCB 1RAHB 4DX7A 3WHIA 2WCXA 1VRTB 3NS7B 1WF0A 2HBYB 3LOUA 4O3OA 1TFYA 2FZGB 3H46O 5HL7Q 1UZDA 4BHQA 3MM5A 3I0SB 2O8CB 3ZETB 2V4JB 4CJPA 3OYAA 4FLYA 2G8WA 4BRMA 2NYHA 1NSKL 2PFFB 3GR0A 1HYZA 3NWGA 2W1BA 4ANDA 2NPFA 2Z2ZA 1OY6A 1LAVA 3DOLB 4IR1A 4DEZA 3WQTA 2HS0A 1YITN 3MR2A 1NHKL 3MDFA 5KG2A 3WX4A 2D7SA 2BE2B 3A5LC 1GOAA 3H45C 2XULA 1Y4ZB 4L3KA 1TAUA 3HSZA 4ZPVR 2GO9A 4XIUA 1EP4B 3UD5A 3SPZA 2XYHB 3MPWA 4ED0A 5SUHA 2AJ1A 2BMBA 4FYVB 5CCLA 3BQ1A 4RKUC 5KT5A 3OYFA 4JP8A 5DDQC 4FJKA 3L0QA 2FHMA 2Q0UA 2N7CA 3ATVA 2WZ1A 4EMDA 1X9MA 4IG0B 4ILHA 3D6FB 1LXNA 1KVIA 1EIYB 2VG6B 4ZVGA 4EBDA 4DR2F 2IY5B 1R8BA 2PMZD 5LOQA 4HEA9 3RYLA 1EKRA 1HNXK 2FLOA 4TXSA 3BGOP 2KHOA 4I6MA 3WX8A 5FROA 3VQEA 5D15A 5L1KA 3ZFVA 1UTAA 4A59A 4C3MA 5KG1A 3UNYA 2DNKA 2HFNA 1P1LA 3OTEA 3TNVA 1YX2A 4P2FA 1OWXA 2KFYA 3BSOA 1E6YA 3VQ7A 2IJRA 4C98A 3ENBA 2B7CB 2GWKA 2BANB 1N5YB 4NLGA 5KQ8A 5HANA 4JHDB 2ZDPA 2QLWA 2E1RA 3O3LA 4WFYA 1HHSA 2MLYA 2BACA 4CZGA 4H0YB 2YWGA 4GKKF 4QPXA 2V94A 4ZP7A 3QBCA 4YEAA 3IP0A 5JMVA 4J2AA 1BQXA 4JI0F 4GKJJ 1GOCA 4JEPA 4JNEA 1QHAA 4CHNA 5G0RA 1SUQB 4OHYA 4OYBA 3T41A 4JI5F 1FX2A 3D5MA 4QU7A 3VF2A 3VQ4A 3CDAA 3BBCA 1F5AA 2EC2A 2V51B 3GJQB 3C8YA 3BSCA 3U9ZA 3Q8PB 1VLYA 3RBDA 3PIPQ 1ZBUA 5HMZA 5DZ7A 3UFCX 2NS1B 1T3OA 3V1QA 1Q7LB 1NDKA 4LF5J 1ZS6A 4BY9C 3G86A 1F3VA 3I31A 5B08A 3NWRA 2O8FA 1QAYA 3OVAA 2ZD1A 1IJFB 2QA4S 2RU3A 1EB0A 2PYJA 3I56N 1IO2A 3IRXB 3U02A 3RB4A 3H4DA 4NLBA 1D9AA 3QO9B 1F1BB 3MXMA 1R27B 4WJBA 3OVBA 2KVIA 4B3TJ 1HD0A 4ZVRB 2HB5A 4KIAA 1IBLJ 1SL2A 3WXLA 4CJLA 1NGJA 1NDPA 3FZHA 4CLZA 2UXBK 2JLEA 4HHTA 3H5SA 4DV4F 1KFSA 1WJ9A 1SKWA 1HR0F 4GC7A 1DZ5A 2F4VF 4UOGA 2ZZNA 2VONA 4FDFA 4AM7A 2DHAA 1GT8A 2KU7A 3UDLA 4MJKA 3OYIA 4ILRA 3EXCX 3O4WA 3GYXB 4DLGA 3ISZA 1K6YA 3TVYA 4YOYA 3R6LB 3I32A 3HJFA 3JSRA 3QRRA 4NA1A 2RPIA 1SVDA 1CPZA 5RUBA 3OA9A 3N9UC 2PZSA 2PEBA 4RCHA 1PIEA 4O44A 3NH2A 2OSRA 4EGLA 1JLFB 4H4MB 2W9CB 1MU2A 3GG4A 1Z6RA 1VQ9N 4F3OA 3EN9A 4EZ6A 2EK1A 3RAXA 4USUA 3W2WA 1K9MT 4J9PA 3ENVA 4U7UK 3LDOA 1VSJA 1A5WA 4JS5A 4EBCA 2Z1HA 2W8KA 2QFJA 1L5UA 2AZ1A 2JNJA 3GOIA 1U1KA 3OL9A 4IOAQ 3FRYA 1VQLN 4QWAA 3G6XA 4C4WA 4JI1F 1BHLA 2ZWPA 2UXBJ 1PKUA 2HHVA 4Z4GA 3CSKA 5L8RC 3ZT1A 1FVSA 3OBIA 2UVUA 3U3GA 2FD2A 1XNRK 5KG7A 4FWOA 2W2NP 3UCUP 1YTAA 2FHJA 3OW2M 1LWCA 2AQ4A 4AILC 4AT1B 1SH3A 4KHQA 2KQ2A 1HNXJ 3HI9A 2UUBJ 1RT2A 4C8KA 2C2MB 5GAHP 4JRPA 1X8DA 5BPMA 3ZNJ1 3L4QA 4DL5A 3UKRB 2HQDA 2XWYA 1CVJA 4NEYA 2KI2A 3DXSX 1UMJA 5ETOA 5B0BA 3M2RA 1JCGA 4ZVUB 1RBTA 1P8GA 2VC1A 2VWBA 2QN6B 3OHRA 2X1GA 1QUVA 3T1YJ 4JI8F 1L3KA 2R7VA 4WE1A 3TUPA 3JB9k 4M7YA 1NWKA 4DR6F 2A0FB 3V9UA 4CFAA 1EJ7L 2H3EB 3IRWP 3IN5A 2M3DA 1U1OA 3TR5A 3CJBA 1RHQB 5AJ3F 4GKJK 1XN9A 1YWXA 2XHWA 3Q2TC 3ZNUA 2ROPA 2I7NA 2RQKA 3DXMB 5KT2A 2P9PA 1TL1A 1RT4A 1BUXA 2R8IA 4I6AA 3AO3A 4PPZA 3LP3A 3ULEB 2ALYB 1VBXA 3ZZ0A 3AVGA 4UTGA 1VIOA 3EZWA 3BYRA 2FB0A 2GVDA 3BO4A 2DHHA 3BN4A 4WQ5A 2CKWA 4EO6A 1WC1A 3KG4A 2N7YA 4BC3A 4DUYK 1OIAA 2V7ZA 4FJNA 3Q24A 2UXCF 1A7GE 3NGTA 1REVB 2K7JA 3CJ9A 3MDQA 1IBLF 2LYVA 4KFBB 3O3FA 4MDBA 3C16B 3LGHA 1GXLA 2HNZA 4N47A 4OZ2A 4OVLA 5GAGP 2DXEA 3MD3A 1HNZJ 3BDPA 2NUBA 4RUBA 1GTHA 1JLQB 4OLOA 5IV3A 4WKRA 2E6LA 3ZLJA 1F60B 3TAPA 5JICA 5FPMA 3FEZA 1TUUA 4XO0A 1FWLA 2HFSA 4DV1J 4CJTA 1RYRA 2XNQA 4OV1A 4ECXA 1P1TA 4H0OA 3HHDA 2VQEK 1BGXT 4BR2A 4IKFA 5KFLA 3BZQA 4I6MB 4OZ1A 3O6WA 2ZH7A 4JI6K 3NRBA 4KY3A 4ILGB 1RDUA 4KBIA 1T03A 3I87A 4E1NA 5BR8F 5EWEA 2YY3A 1ZTWA 3LDNA 4CIEA 5DGAA 4KGZB 4OPJA 3AY0A 4KGVB 5FLXY 3D1HA 2R8GA 1X4HA 1N36F 4NXMK 1U6ZA 2Z1IA 5KPRA 3JSMB 2E44A 3HO1A 4ILMA 3DN9A 5A2QY 4CE9A 3VMFB 2CYYA 3J81O 3D6MB 2A6AA 2IDEA 4MIWA 3DXKA 1VBZA 4FKYA 3LWLA 2B43A 1LWFB 3TO8A 5M2PA 3U6FA 3SQ1A 2MZRA 4DR7K 3A13A 3L09A 4RW6A 3RW7A 2YNHA 3N01A 2RSQA 3QDKA 3SV4A 2IRUA 2WW8A 2PYLA 4NLDA 2MSTA 1TL4A 4YB5A 1Y3JA 1K1QA 3PR5B 3DM2B 1S1TB 2ZH5A 1QAIA 3A8JA 5I42A 4I0WA 1NBWA 5KGWA 4DFKA 4BE2A 3JQJA 5ETQA 4MMOA 3IUCA 2AYEA 2XO7A 2LEAA 4BC9A 2SXLA 2E4LA 2DEIA 2MLZA 2ZUGA 5BRHA 3VR1A 5GADI 1K8KA 2FF3B 4FXWA 3HT0A 2UUAJ 2Y1RI 1MDUB 4CZHA 3RR7A 3FE1A 1H73A 3BKFA 1O0PA 2XSFA 3A3OB 3J80Y 4FWQA 3D0PA 3NAEA 4K0KK 5DLGA 3PFOA 3NGZA 5DM6L 3DOMA 2P9GA 4I1TA 1FD2A 4KHUA 2WVCA 1AZSA 2AV5A 4XTTA 3SXLA 2YHYA 4X65F 1TFWA 3M4XA 3G6EN 4TYBA 5GMKa 2D1CA 1VC6A 3T5KA 1UOCA 1NM2A 4E2FB 2HHQA 3D3CJ 5IQ6A 2YHAA 1WC0A 4K4VA 1IKVB 2GX8A 3DLKB 4JI5J 1GFWB 2VG5A 1SQFA 2JFKA 2DCLA 4FKXA 3J81Y 3N6NA 2Y3YA 2EKYA 4K5SA 4TY8B 3U1MA 2FQQB 3HHLA 1YVUA 1J5OB 5CABA 4B9MA 1NJYA 4OHVA 2XMTA 1TUYA 4DQQA 5M2UA 4RUAA 9ATCB 1VQ5N 4CP5A 2HBKA 3M8ZA 4A8MP 1RCOB 1CQMA 1UPMB 4M95A 4G3IA 2EKNA 2FBYA 1VIXA 3D2EB 3SJJA 4CLKA 3Q8RB 2HVDA 4OYWA 1D4XA 1YDLA 2VJUA 2VA2A 5DLFA 1R8PA 2FJEB 4CGDA 1DLOB 3TYTA 2P9NB 4DWIA 3IS9B 2E7WA 3KDNA 1U1LA 3H2UB 1SUQA 2QG9B 4I6WA 3O4NA 2BH1A 3ZZZA 4BVOA 3CJ2A 2HGMA 3R3LA 1T9WA 2YH1A 1X9JA 4DI6A 5AQPA 3SV3A 2VDHA 4QIFA 3I9ZA 3T5JA 4LF1A 1YIJS 3SCLE 2YKQA 4OYXA 4CJ4A 4DCHA 3P5JA 3M1FA 5J2PA 2K8GA 3W5ZA 3TA1A 5DRKA 5KOWA 2Y1LB 3HM8A 4HUGA 2B4UA 1DTTA 1D9FA 1RCXB 1T11A 5H1SV 4CJ3A 2B6AA 2F4FA 3FSYA 4FZYA 2RJZA 4F2RA 1N5VA 3AA8A 5JVGL 3UKRA 1PC4A 1VISA 4CBWA 4BGBA 2VKZG 1YF5L 5F8MA 1YRTA 4E8UA 1XTZA 2CJBA 3D2WA 1RT6A 1SQGA 3IKMA 2FBVA 2CNNB 4IOAL 2XZWA 3BPSP 4CFDA 4A62A 3QLHA 1T6DA 4V19J 1BY9A 4CEEA 1NG9A 1C4CA 4DTRA 2EHGA 2HZAA 4I69A 4LFCJ 5H1SQ 2NRWA 2N4CA 2LQBA 5LY3A 3L4BC 3MFIA 1NH8A 4QCLA 3ULHA 4JRQA 1BUPA 2E7VA 4C0OC 4JK7A 2KRRA 3I0SA 3KK7A 5G4DA 2AYBA 4Y1CA 4C48A 5DM7Q 2W4DA 4CLPA 4WP8A 1DTTB 2BQRA 1SPBP 1EP4A 2RILA 3AHPA 2CQIA 1SAZA 4FLTA 2AW0A 2X6NA 5EWFA 1ILYA 2V7YA 1NPRA 2XB2D 5EWGA 4K0KJ 2Y8YA 3L2RA 4ZTJA 4X64J 3H1QA 3CCJS 3OTBA 5KQDA 3ZTSA 4MK7A 1HNXF 1CSJA 4B9UA 3MM6A 2XMMA 5F0WA 4ZCKA 4QWEA 5HSPA 5FDLA 2VFUA 5KFWA 1OYDA 4ZA1A 4DR3J 4BRDA 4X62K 3ONQA 4PG8A 2XQCA 4F4WA 2R7XA 5A0YB 4WF9L 4BDPA 4ES2A 3D7EO 2C22A 3MN5A 2PSZA 1N5QA 3LPEA 4DPWA 5KTQA 5HAOA 3UN2A 2WVBA 1CJKB 2MQLA 1NKBA 4LD0A 4EFAC 4DU7A 4DL7A 3GZ7A 1HBOB 4RJVA 1T03B 4NCAA 5B0CA 3CUNA 3CJ5A 1MMDA 5IQQA 1HR0J 4CJSA 3H5YA 4I56A 1TKZA 2DPIA 3OR1A 3DU5A 4A4JA 4CZEA 3N6LA 3MAAB 1XMQK 3HHLB 3FNNA 1XUPO 4B3TF 4CFBA 1N5YA 3NMUA 3W5YA 4K42A 2DHSA 4DHYA 2MQ8A 1N32J 2ZHAA 3EY1A 5DDOC 2FY8A 4BR4A 1FI4A 3THTA 4WE1B 1SC4B 4LRFA 3W8PA 4DV3J 1OSDA 1RBOB 3DDIA 3TSUA 4A57A 3C6TB 4YB7A 2ZH1A 3CMAN 2GA7A 3V4IB 3W8GA 3D0HE 3V9ZA 5J2NB 3C3LA 3E9LA 3O5BA 1XQIA 2YNHB 1NK7A 4DTUA 3L2WA 2GV1A 3BO2A 3SNNA 1QVFR 3NBPA 4WU2A 1C1BA 1N36K 3CJTA 2WTUA 3D54A 4OPHA 2B4JA 1ZBIA 5KFAA 5F9LA 3BS9A 2DFFA 1VQ6N 5T7LB 4H8KA 4Q7AA 1CULB 3CULA 2YX6A 4HACA 2NRXA 5LXYA 2ZM6J 3G96A 3OS1A 2G0IA 3OYGA 4R0EA 3GSDA 1QE1A 3HOTA 2YWEA 5DM6Q 1D1UA 1JXBA 1Q5VA 1Y3KA 4EK2A 1SB6A 1CQNA 3GG1A 3MECB 3QEWA 2X1FA 4ZHRB 3ENAA 3K5MA 2QWQA 3QEVA 4AXJA 1QZ5A 2UUBF 3PXGa 4LFCF 3O8MA 1SKRA 1Z2LA 2GMJA 5KAKA 2B51A 4I9LA 4X2BA 3PKYA 3SBGA 4E1JA 1SL0A 1ZBHA 3VGLA 3B82A 2R7WA 2AX0A 3FGVA 1X3MA 1RTJB 1FWKA 4BR9A 4EIAA 2Y1JA 3VTIA 1R8AA 3FFIB 3KFWX 1Q86T 2L9NA 2E88A 3ENQA 3JXOA 4FXVA 4DFMA 2GNKA 2M8HA 2VG7B 1ZBTA 2VV5A 3GYGA 5BN9A 2FC0A 4A8FA 5LMNK 2W7AA 3D66A 3TANA 4JV5J 5BRFA 4DU4A 4QW9A 3MM9B 3MECA 1RAGB 1JCEA 1Q9YA 4CZKA 1I1GA 2MY7A 4Q0BA 3O1LA 4DHVA 1B70B 2KLAA 1W25A 4LSNB 4Y2CA 5CCMA 4AHUA 4B3OB 4ZOSA 3A5OC 4N76A 4OKEA 3TP2A 4CEQA 4FP9A 4PYAA 1CJUA 3PSIA 2L9DA 3M3ZA 3TX0A 2PI4A 5KOXA 1WHYA 3BGFA 2NZ4A 1OS5A 5F3ZA 2K1RB 1C1BB 2HPUA 3AO1A 3VALA 4HL9A 1NK9A 2NRVA 2MLXA 3C0BA 3V6KA 4CZMA 5HP1B 2FVQA 1VRUB 5AQHA 2V52B 1FKOB 1CG2A 2CGJA 4P7VA 3ZTOA 1QS4A 4U67L 3NAIA 4HTIA 4ZK7M 2VASA 1S0MA 4FPRA 1LEOA 2CQCA 2D0OA 5LSLA 2DGSA 3E01B 2YHWA 4CD1A 4NX9A 2FZCB 3CT9A 2D3ZA 5CD4A 3RMAA 2DPJA 2OA8A 2AGQA 4FF4A 2J9CA 2ZH8A 1S5ZA 4FOEA 3SUOA 5KT3A 3IC1A 2I5JB 2JX2A 3R9PA 4FF2A 1LWXA 1U47A 1NPPA 1RT4B 4M5GA 4PL8A 3AB2B 3AFGA 4M5KA 4CECA 2JEGA 4RL1A 4DQPA 1NB7A 3VCDA 2XCPA 1NZ8A 2R42A 1I94K 3L7PA 2JGUA 1UAWA 4LF7K 4MDAA 3MEEB 3MPYA 2R7OA 1VBKA 1RWWB 4C8NA 1ZM2A 1UETA 1MLAA 2CVEA 3G82A 5KT6A 5MLCV 2WBMA 1WN7A 4ID1A 1S77D 3NF7A 4Z7YA 4CBXA 3AVHA 2J76E 1QQMA 4AHVA 3C7NA 2CFXA 3HZEA 1NMNA 2G1HA 4U8VA 2DGVA 1QTMA 4U95A 4CHZA 3K2PA 4JKCA 3K5NA 3L9ZA 4M5IA 3R5CA 3BV8A 5AE1A 1YQHA 2BUPA 3CCSS 2H5IB 2V8VA 4IDKB 4B3RJ 4ZPCA 2DNOA 4MKAA 4O3PA 5T41A 3ZSQA 1J53A 2ZH3A 4CO5A 1YIJN 1QD1A 3MX5A 2R9LA 2XSJA 2Q97A 3SQ0A 3TTDA 4L8RB 4USWA 1RHMB 2FJBB 2CQ3A 5AQXA 2M0GB 4WFNQ 1KLNA 2ZNYA 3M05A 5D0RA 3NF8A 3LALA 1URRA 1DJ0A 2G4BA 2IM1A 4JKBA 2U1AA 3QSYB 2CXEA 1S72S 2YKPA 5BR8K 5K14B 2NREA 2HHHJ 2IMOA 5H9FJ 3IMQJ 4GV9A 3Q89A 1SH0A 2KDOA 2G2ZA 1Y10A 3TAFA 2DCUB 1SC6A 1ZAVA 3TSQA 2DYAA 5KFIA 2ZJPL 2QMXA 4W5QA 2OPRA 3CM5A 3SDEA 5EVZA 4OZ5A 2UUCJ 4F4KA 4B3TK 2HVIA 1F21A 4OHWA 3NOGA 2UUBK 4U7CA 3AH6A 2JC0A 3V6DB 1EKEA 4RX6A 2ZD1B 5K8NA 5CXTA 1Q9XA 1HD1A 2GS8A 2D1KA 2F8TA 4AUKA 4RR5A 5KPZA 1VC5A 1UVJA 4EEYA 4O3NA 3TR8A 2ZKTA 1YITS 4GVMA 1M5PC 4LF9K 1WKKA 3EZUA 5GMDA 1HHTP 3OYKA 3EGWB 1CULA 4H03B 4ISFA 1YG0A 4IO8A 1HBNB 1CC7A 3A3PB 1K9MO 4JI4J 3QAEA 3DU6A 2W24A 4OMFG 4KHNA 2LDYA 2OZSA 3MEKA 2NRHA 5IWAF 2FVPA 3NVMA 1H72C 3AVLA 2ZNZA 3TZWA 2CG4A 4PKIA 3T1AA 1RU1A 1EX8A 4CRJA 1KAYA 4ELVA 1JKHA 3VQCA 3A12A 3THYA 2DGQA 1W26A 2WBNA 4YDUC 3EWGA 3HVTB 1VSFA 3FMBA 1FNMA 3ZTPA 1J6ZA 4Z2XA 3OFHA 1K8KB 2E5GA 3MCMA 4M3XA 1WHXA 4UUWA 1YHQS 1YVFA 5HRRA 3B4DA 1RSCA 2HGLA 3P4IA 4FLVA 1RB0A 3UCGA 4ZJQA 1UFLA 3GE1A 3UPFA 4MIAA 4NXNF 3VQAA 4DV7F 3CJQA 3QJPA 4DSEA 1JLBB 4OGEA 1OH7A 1GLJO 2A5XA 4DV5J 2GQQA 4RUCA 2B4OA 3R9LA 3MM9A 5LJVA 4LQ9A 3AVIA 1DRZA 3L95X 4PG4A 4KH0B 2HQFA 5IT9Y 1GAOA 1QQOA 1ZXOA 3WXJA 1FWPA 1J54A 3WXIA 4DV6K 4DF4A 4WFBQ 4P2XA 4RPFA 4JI1J 3QT7A 4YN3B 3UWTA 1KVJA 4M8LA 2GV9A 1BQMA 5D4LA 5KFSA 3HOSA 3DHXA 2NZCA 2PGCA 4DV2K 2RKIB 3KJFB 1DQ9A 4JI3J 1W0HA 2GMHA 1E4FT 1WSEA 5GIPA 1U1QA 3WT0A 4Y34A 4QWDA 3E9PA 1Y7PA 1MG7A 1FJEB 3J80O 3HI0A 2GAHC 9RUBA 1TV6B 5HQMA 2FVRA 1H7WA 3NE6A 4E1MA 1JLFA 3KKSA 2ZWHA 4CO2A 2F4VK 2AHOB 4KHPJ 1VFJA 3R2CJ 1U2CA 1KRPA 4QIGA 3JTNA 4NE9C 4IOCQ 1IKXB 2VPYB 5D77A 2DR6A 5C42A 4NLRA 3QNOA 2N3OA 5EUHA 1RWMB 4OJ3A 2KM8C 4WYLA 4WPAA 4TNOA 3KYLA 4CQ1A 2X74A 5CE3A 4OQJA 3WNGA 5F8JA 1FT8A 4OYIA 1N8RT 5DS7A 3MMAB 1UVKA 5CYJA 3Q0AA 1S7IA 4TU8A 1T94A 2B7BB 4DL2A 1NJZA 5BYSA 3ENHA 4CEBA 2FVSA 3I5CA 4PKDB 4CLFA 1SQEA 4R5PB 4XH5A 2CQHA 3CQXA 3D7SB 1RI7A 2KFNA 1YBUA 4J8FA 3MR6A 3CD6N 1S1TA 2RD5C 1BCOA 1RT6B 2XMUA 5KFBA 5AQWA 3TSPA 1W7WA 1HARA 3B78A 2VQFF 3HSJA 4KV8A 3M8WA 4KHMA 2RN2A 2QX0A