4H4OA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
549
structure length
549
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 141
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4oA05
3JYTB 1HYSA 3QIDA 4E89A 1G15A 4K50A 1WSGA 3PW2A 4KHUA 4ZPDA 1ZTWA 1HPZA 2KQ2A 3T1AA 3KLHA 5L1JA 3SUQA 2P51A 5DQHA 3OYFA 5KG3A 4KTZA 4RUAA 1QAJA 1SL0A 1D9DA 4ED8A 4F3TA 4E7JA 4K8XA 3SFUA 4FCYA 3HVWA 3MEDB 3H4BA 4KREA 2FLNA 5HRSA 4NLYA 3DMJB 4FJKA 4L8RB 1S9GB 2IM2A 4E3SA 3KLVA 4FM0A 2RPIA 3K5MA 3CVKA 1VSLA 2XO7A 1QE1B 2YNFA 1S10A 3OL6A 4CJWA 3DYAA 1HQUA 4NLUA 4DL6A 4CF0A 3QYYA 4TYBA 1DTTA 1R0AA 1KVCA 2R2UA 2HHQA 3ITHB 5HP1A 4NLWA 1RDAA 1ZYQA 2IDOA 4PY5A 3SQ0A 1X1PA 2OYQA 3QETA 2IM0A 1RT7B 5KRSA 4OPKA 4ZTFA 2QE5A 2V0NA 4J2BA 4W5RA 2RF2A 4DSEA 3OLBA 3DRPA 1WSJA 1GOCA 4TY8B 3NF7A 3KK3A 1SKSA 3LP0A 2R8HA 5CYMB 4ECXA 4CK1A 2VG7A 3KK2A 4M3XA 2AWZA 2C28A 4CHPA 3ALYA 1RT4B 4LQ9A 3KD5E 3A2FA 1TK5A 1C2PA 1S1UA 3VQBA 2J6UA 4LSLB 3HL8A 3IG1B 1C1BA 4N47A 4IFYA 3EPGA 3I0SB 5KG4A 1TKTB 3HPGA 3KHGA 2F8EX 3DRRB 2XY8A 5KFFA 5J1EB 2D41A 3C6UA 4OPJA 4N41A 2G8HA 3PHEA 2BRLA 3OSPA 4W5NA 3CDWA 3H98A 2JEFA 3TAEA 4CHOA 4MIAA 2F96A 3K57A 3UIQA 3FSIA 4WFXA 4ZP9A 1ZTTA 1S5JA 4NLRA 3PV8A 4IR9A 4DLGA 5KT6A 4OKEA 1RDBA 1LWCA 2FJVA 2YNIB 4I2QB 4F4KA 3OYDA 1K1SA 1ZBIA 3H40A 1S6QB 3CJ4A 3CIZA 5KFPA 3RAXA 4FLVA 3MEDA 5J2QB 3PVXA 3GIMA 2XC9A 1VSHA 3O3FA 3ZSQA 4FK4A 3QIOA 1NOZA 1J53A 3G0ZA 2GV9A 3L8BA 2W9AA 4CJFA 3TAQA 5DQIA 1JLFB 4TN2A 3NL0A 3OYHA 3RB6A 3BQ2A 1QE1A 3P83D 2AGPA 1ZBHA 4X2BA 1UWBA 4ECYA 2XHBA 4B8CA 5FRMA 3IRXB 4O3NA 3NGYA 4DFMA 2R2RA 2D0AA 2YKMB 3AO5A 4FBUA 3VQ5A 2RN2A 5KT3A 4ICLB 5F8NA 1ASWA 1RDRA 3OYNA 3OY9A 1RT7A 2JC0A 4Z4FA 4KFBA 4K4YA 3T5LA 4CEQA 1BI4A 4DL4A 4CF9A 1Y97A 5J2MB 4I2PB 4RUCA 1VSKA 1WAJA 1S9EB 4Y1CA 1JXLA 4DS5A 2UUWA 2G8WA 4ZVFA 4TY8A 4M45A 3RBDA 3TAMB 5KG1A 4O4GB 1WSFA 4DTXA 4EYIB 3OYGA 4Q44A 1QHTA 3NFAA 3AVIA 3LP3A 5DG9A 2XI2A 3I5BA 3H5YA 5HRNA 3JSMB 4HHTA 3V4IA 3TQ1A 1TVRA 3KHRA 1RA6A 1EP4B 4LSLA 3IG1A 3K2PA 4TQSA 1LAVA 1TKTA 3AVLA 4Y2CA 5DGBA 1TAQA 1RDCA 1HNIA 3DLHA 1LW2A 4NLXA 3CYMA 5J1EA 3GV5B 3V1QA 1U09A 2HNDB 3FRZA 3OYKA 1S97A 3HM9A 4AHVA 4OKJA 1TL3A 2AGOA 2WCXA 4CF1A 1A5VA 3V9XA 4ECVA 3MEEA 4KI4A 4M3ZA 1QQCA 3G6XA 3M8PB 4ECTA 2BQUA 2V4QA 4F4YA 4FS2A 5KFNA 2YNIA 2IC3B 3BSAA 4Q8EA 3SCXA 4K4ZA 4OVLA 1VSIA 1L3UA 4YP3A 4HVJA 4NYZA 1VSFA 4JUZA 2KTQA 3PR5B 4IBNA 4NRUA 1WSHA 4C8MA 4HYKA 3EPIA 4B9SA 3MFHA 4GC6A 3D0PA 4KE5A 3PX0A 3KLGB 2D7SA 2YNHB 4MFBB 5KFGA 3CWJA 3O4NA 3TR8A 1JXBA 4N56A 3SYZA 4KB7A 4MH8A 4NLQA 4CIFA 4HTUA 3ZT3A 3IRXA 1ASUA 2YKMA 2DFFA 2HNYA 1NNDA 4E7LA 1TP7A 2HWHA 4E0DA 5I3UB 4NCAA 2B43A 2YKNB 4JS5A 4KHMA 4FJ7A 3ZSRA 4AILC 4FJNA 3RMCA 4I2PA 2B6AB 4NZ0A 1S9EA 2ASLA 4Q43A 3L2VA 3CFOA 4I9QA 3SUPA 2P5GA 5KFRA 4C8KA 3HP6A 3RMBA 3TAMA 4FXDA 4O4GA 2WONB 4NLPA 1KFSA 2D5RA 2FVCA 4CJQA 4E19A 5KFBA 1T94A 3QEIA 2A1SA 3H4DA 3SI6A 3KLFA 3SV3A 4LH4A 3SI8A 4ZPBA 4BE2A 3AA2A 4FJHA 3SNNA 1JLQB 3PW0A 3I0RA 3DI6B 2G8IA 1EP4A 3U3YA 3DOKA 3FQKA 2FLLA 4EO8A 4GW6A 3L2WA 3L2QA 3ZSVA 3SV4A 3OVNA 3AVMA 1FXXA 4CFDA 1IKXB 3QINA 2JLEA 1EXQA 1HYSB 1NK4A 2HHWA 1S1WB 5EWFA 4RNFA 3U6FA 3MEGA 4IKFA 3KLHB 2IBKA 3H5SA 1NOYA 4Z4IA 5KI6A 4IG3A 3AVKA 1BL3A 3GQCA 3CDUA 4B9UA 1VRTB 2VWJA 4EZ9A 1LAWA 1CXQA 2GBZA 2Z1HA 5JXSA 1VSEA 3NAHA 1N48A 1S1XB 1WNEA 3MR6A 4RW7B 2I5JB 1D0EA 1O1WA 3VQ4A 2W8LA 3ZSOA 4MK8A 5KFZA 4CFAA 4O3OA 1N4LA 3QGIA 2YNFB 4DL5A 1SH0A 4MFBA 1XR5A 1L3SA 2IAJB 2X6SA 3DOLB 1GX5A 3ZT0A 3DYAB 1HQUB 3ULDA 4HCCA 5KFVA 4ELVA 1R0AB 1TAUA 5I42B 5HP1B 5DQGA 1Z26A 1D9FA 1JLCB 4B3OB 5KRTA 4R5PB 1SL1A 1NKBA 4CJRA 3LAKA 4NLSA 4G3IA 4LSNA 4WYWA 3KKRA 3S3OA 5I3UA 4E7IA 1JX4A 4EBDA 2UUTA 1I3AA 2RF2B 1ZBLA 4F4XA 3MXIA 4HUGA 4MKAA 4XPEA 3KK3B 1C0UA 5HRPA 1RBVA 3LP0B 5KTQA 4ZP8A 4ECWA 1JLGA 2YNGB 3D45A 1L3VA 5C5JA 4LY7A 1BQMA 4ED0A 1NK9A 4KB1A 4DQRA 1W0HA 3NHGA 3SPYA 4ECSA 3BSNA 3H5UA 4FLZA 3N6NA 4U7CA 4Z0UA 4ZPCA 4G1QB 1TKDA 4CJ4A 3DRSB 2CJQA 1U48A 3GV7B 1C1BB 2ILYA 4IFYB 2GIQA 3HT3A 4J9NA 5SZTA 4OLBA 3PUFA 4FJMA 4DQSA 3ICLA 2B4JA 1JL2A 2O5DA 3C6UB 3PJWA 1KHWA 5KFSA 3OL7A 3RR8A 4PWDA 2FVPA 4IR1A 2FVSA 4NLTA 1IKXA 3UR0A 4K4WA 1S1WA 1YTUA 5FDLB 1QS4A 5C25B 1HQEA 3KMSA 3OYMA 4BE1A 1RTHB 3VQPA 1LWCB 3G6YA 3Q8PB 3HVRA 3DDKA 3DM2A 4KHYA 1VRTA 1QSYA 4CGJA 3V6KA 3ZSYA 2IS3A 4TYAA 3NDKA 3U3GA 2ILZA 4LQ3A 1S1XA 2HNZA 4URGA 4IRDA 4RW7A 2X6NA 2I5JA 1YT3A 4WFZA 1F21A 1U45A 1ZBUA 4DSJA 5KFWA 3TVKA 2ASDA 4HKQA 4W5TA 3NKYA 1UWBB 4IFVB 4PA1A 2IAJA 3VQAA 3DOLA 2W7OA 4RW4A 3PR4A 5C24B 2C22A 5I42A 1IKWB 4KAIA 2DFEA 1QUVA 2FBYA 1JLCA 4B3OA 4R5PA 4B9VA 3BR9A 1LWEB 4CEEA 1DTQB 1KLMB 4ECZA 4JS4A 1RBSA 2IM3A 3E51A 4KFBB 3FDSA 2XGQA 5DG7A 5HROA 2RDJA 3VQQA 1CLQA 1BI4B 2Y1JA 4FM1A 3AO4A 3T3FA 3BQ0A 3OYIA 4W5QA 3EYZA 4C8NA 3NH2A 1NHVA 2YNGA 3NH0A 3QIPB 4DEZA 3HO1A 3DLEA 5L1LA 4JV0A 2QK9A 2VG5A 1T05A 3MR2A 1ZBFA 1NJYA 4TLRA 2RKIB 2R2SA 3I5AA 4R8UB 4ID1A 3ZSXA 4O3SA 1TKZA 2WRMA 2XRIA 3V4IB 3PY8A 1TVRB 4G1QA 3MFIA 3HYFA 3DRSA 4KKOB 1RT5A 3K59A 2JEGA 5DMRA 4Z4HA 5KFLA 4H8KA 4ZP7A 4FW1A 1HNIB 4C8OA 5KFJA 2FVRA 1XI1A 1LW2B 4EYHB 3LAMA 4WZQA 3CJ5A 1JLBA 4DQQA 1BHLA 4IG0A 5D3GA 3PZPA 3F9KA 1TL3B 3K5LA 1ITGA 1TKXB 4F8RA 4KI6A 2E4LA 2EC0A 4DG1A 4CEZA 3MEEB 5FDLA 5C25A 5FROA 4CHNA 3V1RA 3M8QB 1LV5A 2B5JB 1KHVA 1RTHA 1T7PA 1FKOB 3CFPA 1ASVA 1SKRA 3HSTB 2XCPA 1SV5A 5EWEA 4DL3A 2PYJA 3OJSA 1TGOA 1TL1B 3NAEA 2HHSA 4DTMA 5KFKA 3M8RA 4CHZA 4E1NA 2QV6A 2UVUA 4DQIA 3QLHB 4YNQA 1LW0B 1BQNA 4CJVA 3UDLA 3GYNA 1IM4A 5C42B 1JLEA 4J2EA 3WNFA 1KCFA 4O44A 4KHQA 3PX6A 1JLAA 2UVWA 3RRGA 4IFVA 1HARA 3TABA 4CERA 3AVJA 2HNYB 5C24A 1C1CB 4ID5B 4KTWA 1IKWA 3ZT2A 3AVNA 3QEVA 4FJXA 2ZQBA 4B9TA 1LWEA 1DTQA 1KLMA 2XY7A 4WZMA 3I5CA 2QXFA 3NF6A 4FJ9A 4ECUA 1GOBA 1KSPA 3LPUA 4RW6A 5DLGA 3S9HA 1S1TA 3AVCA 1J54A 3N6MA 2KZMA 2ALZA 2OPSA 4Q5VA 3CO9A 4DTOA 4BWJA 3GIJA 3MECA 4CIEA 4TQRA 1NK0A 4J2DA 4CJTA 3QIPA 4FK0A 3V9SA 2ETJA 1WNSA 1UOCA 4CF2A 5KT7A 3KLFB 4IQXA 2RKIA 4R8UA 5HRRA 3DLGB 4ZHRB 2HHTA 3I0RB 3AVHA 1BGXT 4KKOA 4DQPA 2Q3SA 4B8AB 3DOKB 3C6TB 4OGEA 4CCHA 5KFCA 3KHHA 3DLKB 3KK1B 2IGIA 3TI0A 1HYZA 3K5NA 1I6JA 4YR3A 2C2DA 4MK9A 1U04A 1REVB 1TV6A 4UQGA 2IA6A 4CJLA 2X74A 2QKKA 1TKXA 5KFTA 4J2AA 3MEGB 2PYLA 3MR5A 2WTFA 3AVAA 5E41A 4IG3B 2YHBA 4BE0A 4F2RA 3LPTA 4M3TA 3M8QA 2B5JA 2BDPA 4LH5A 4DSIA 1FKOA 4KHRA 3CFRA 1N5YA 3RMAA 3HKWA 4FJ8A 3ZT1A 4AHRA 2WK4A 3LZJA 1TL1A 4DTJA 1Z4UA 1KVAA 4DFJA 2C2RA 3VQ6A 3QGHA 3VQSA 4DU1A 4NRTA 5SWMA 3QLHA 1LW0A 1VSMA 3VQ7A 1EETA 3VQEA 5F9LA 4QOZB 5C42A 2Z1GA 4QWBA 1NK8A 4CEFA 3QZ7A 1KFDA 3VQDA 4K4UA 2FBTA 1NK6A 4KTQA 3Q8RB 4B9LA 4OJRA 3LP2A 3VA0A 4WXOA 2DTUA 5EUHA 1FK9A 1C1CA 1IH7A 3E01B 4ID5A 4LSNB 2JEIA 1SH3A 3HVTB 3HXMA 3BSOA 1JKHA 4KB0A 4CEDA 1RT2A 4M3UA 4ZVGA 1T8EA 1RT1B 1FKPB 5F8MA 1EKEA 2IOCA 4QCLA 4DS4A 5KFQA 1C0UB 4DU3A 4E1MA 1KRPA 2C2EA 4Y3CA 4W5OA 3T5HA 1JLGB 4DFKA 1S9FA 4M42A 1BQMB 2DFHA 3GV8B 1CZ9A 2I1RA 4DTRA 3ZT4A 3KHLA 2ZKUA 4FJIA 3HVAA 4EZ6A 1MU2B 3RTVA 1TQLA 2UVVA 1QSLA 2J6TA 1GX6A 1HRHA 2V9WA 3OS1A 2W9BA 2IJFA 3VN5A 5T14A 3EZ5A 3DLGA 4EO6A 1IKYB 4ZHRA 5JS1A 1RTJB 3SPZA 4O5BA 1RYSA 2XWYA 4AHSA 3C6TA 3G10A 3OL8A 4PQUA 4NLVA 3DLKA 3KK1A 3VQ9A 1A5XA 3QNNA 1NHUA 3NGZA 4JRPA 5KFAA 1VSJA 3IS9A 3PJXA 2J6SA 4RNMA 1RTIB 1S48A 4PWDB 1X9WA 2GC8A 4GVMA 1REVA 1NK7A 2RDIA 3OYEA 1MMLA 3OYAA 2D0CA 3O3HA 1C0MA 1HQEB 5EWGA 5J2PA 2YV0X 3QEXA 2R8KA 4IH5A 2HMIB 3DM2B 1WAFA 3GIKA 4H54A 1RBTA 3NBPB 3SUOA 1Q9XA 3V6HA 2AX1A 4DF4A 1D8YA 3L2RA 1J5OB 1DLOA 3AA4A 2HNZB 1GOAA 4YQWA 3HJFA 1D5AA 4J9SA 3RB4A 1B92A 2DPIA 4YR2A 2E6LA 4O3QA 2VG6A 5KFIA 3AO2A 3MXJA 4BDPA 2VWKA 1C0TA 4DTNA 1K6YA 4RW4B 4O0IA 2XY6A 3NE6A 3ZCMA 5CYQB 3GILA 3OHBA 1UA1A 3MF5A 3QO9A 4AH9A 3KLEA 4PUOB 4MK7A 4YFUA 4QWEA 3ZSWA 1RCHA 1XC9A 4K4SA 1N56A 3E01A 1XWLA 3HVTA 1S6PA 3TANA 1I39A 5HROB 3H5XA 3RMDA 4CJPA 1T03A 1NJWA 3P5JA 3V81A 4ZTJA 4CHQA 1RT1A 5J2NA 3PO5A 1FKPA 5KG7A 3HP9A 1RDDA 4FLTA 3B6OA 4DFPA 2OH2A 3P1GA 1B9DA 2D3ZA 3V6DB 4CK3A 5KFUA 5KG0A 4CFBA 1WN7A 3QEPA 4Q8FA 2FJXA 2HB5A 4NCGB 4KO0B 3DLEB 4IH7A 4IDKB 2VG5B 1T05B 2G8FA 1IKVB 3DLRA 2BE2A 2FBVA 1RTDB 4N76A 3AO1A 3L3VA 1TKZB 2A1RA 1MU2A 4CHYA 3M9OB 4DL7A 1LWFB 1W25A 3NAIA 2R8IA 4KV8A 4Y1DA 1RT5B 4CEOA 4CESA 1IKYA 1RTJA 2OA8A 5KG2A 2G8KA 2FVQA 2JGUA 1JLBB 4EBEA 4IG0B 1HMVA 4O4RA 5D3GB 3OYLA 4F2SA 4GC7A 1RTIA 3VA3A 4CJSA 1HNVB 4DG1B 4RNNA 2E6MA 1RAJA 4TXSA 3V1OA 2ITGA 4K4TA 4CJKA 1U47A 4RNOA 2O4IA 1RA7A 5KFYA 4HCBA 2AU0A 1SV5B 4QPXA 2IJNA 1S0OA 3G6VA 2HMIA 5HBMB 4MIBA 3OHAA 3IN5A 2O4GA 4R0EA 4IRCA 2PZSA 4BDZA 3L2UA 3NBPA 1U49A 4DSKA 4Q0BA 2ZE2A 4NLOA 4FVMA 3PX4A 1J5OA 1RILA 2BANA 4BDYA 1BQNB 2Z1JA 4Y34A 1WSIA 2HHXA 1JLEB 3VQCA 3NGDA 4B9NA 4ZP6A 3V9ZA 3T5KA 2PY5A 3QZ8A 3CJ0A 4O44B 2OPPA 1JLAB 4Z4GA 4M41A 4EP4A 1OS5A 3T19A 1BCMA 4KPYA 5L1IA 2BQRA 3O4QA 1X9MA 2CKWA 3T5JA 5CYQA 1TK8A 1BIUA 3SQ1A 3O3GA 1XR6A 4PUOA 4IRKA 1UA0A 3H59A 1CZBA 3DLBA 1XHXA 4RW8A 4FZXC 3OJUA 4NLGA 4Z4CA 1RT6A 4YR0A 4KHWA 3NGIA 3H08A 4RW6B 4F50A 2JEJA 5JS2A 4JLHA 1S1TB 2D3UA 2OPSB 4CJEA 4CF8A 2EHGA 3MECB 2AQ4A 5CY4A 3CJ3A 4IKAA 1IG9A 4CGDA 3V6DA 2IM1A 1WLJA 4NCGA 4KO0A 1SH2A 1QAIA 4EEYA 4IDKA 4I9LA 3H2LA 1IKVA 1Q8IA 2R8GA 4DSLA 4CGGA 1BIZA 1RTDA 3NF9A 3B6PA 5K14B 1JIHA 1LWFA 3MR3A 3WNHA 1UAXA 4IH6A 3CQ8A 4KRFA 4O3PA 1S1VB 4Y2AA 5DK5A 3S3NA 4CFCA 1Q9YA 4HUFA 4CGFA 1N6QB 3ASMA 4Q45A 4FJGA 1TV6B 1VK0A 3QESA 2OPRB 4FYDA 5DG8A 3VQ8A 2Y1IA 2FC0A 3ZSZA 3KOAA 1HNVA 4KBIA 2F8SA 4J9MA 3QGGA 1S4FA 2W9CA 2VA2A 2E9ZA 3RB0A 1VRUB 1KTQA 1NJXA 2IMWP 4NCBA 2DPJA 4I7FA 3NCIA 1N5YB 4J9KA 1QSSA 5HBMA 4J9OA 5CZ1A 4ZPAA 3JYTA 1IO2A 3V9UA 3PW5A 3LALA 2P1JA 3QERA 1CXUA 3PO4A 2FLPA 3GIIA 2ATLA 3WNGA 3TAGA 4C8LA 5L9XA 1EETB 4CGIA 4JRQA 1RNHA 3BQ1A 5T7BA 3TAFA 3CM5A 4JV1A 3AV9A 3Q8SB 3NF8A 3KLIB 3N6LA 5F8GA 4FW2A 3LP2B 4FLUA 5KGWA 4J9QA 5KG6A 3DMJA 1FK9B 1S9GA 4CE9A 2HWIA 5EU7A 1JKHB 5F8LA 3AVGA 4OL8A 4CJUA 5KFOA 1RT2B 4MQ3A 4ECQA 4FLYA 1L3TA 2HVIA 2YHAA 3THVA 4J9RA 4CEAA 4HUEA 4B08A 1JXEA 2E9TA 1C1AA 3IGVA 3ITHA 4DWIA 4ELUA 4NLDA 3C94A 3OS0A 2P5OA 3MXMA 2HHUA 2OZMA 2BQ3A 3M9MB 3OS2A 5KFXA 4ED1A 3AA3A 1TK0A 5KFHA 5KFMA 2KW4A 3NMAA 4MKBA 1KLNA 2W9BB 4CJ3A 1ZETA 4FZZA 5K14A 4EBCA 3V9WA 1D1UA 2E9RX 2XGPA 3BSCA 1S0NA 1SUQB 4N5SA 2JC1A 5CYMA 4DLEA 4PQUB 2FBXA 5CZ2A 3TWHA 1S1VA 3OYBA 4OKKA 3IS9B 3UPFA 1RT4A 3S3MA 3FFIB 4JV2A 1N6QA 2AX0A 2W8KA 4DL2A 2KFZA 2OPRA 5DLFA 2GUIA 2OPQB 3RRHA 3L3UA 2ZD1B 1B9FA 3I0SA 5J2PB 4DTPA 2BR0A 4M94A 1S49A 3DRRA 5F8HA 3AVBA 3OL9A 1VRUA 4NYNA 4J9PA 4M3RA 3LP1B 4QW8A 3OLAA 4NYFA 2LSNA 4DF8A 4CGHA 2R7YA 4QW9A 1DLOB 4FK2A 2OZSA 4FJLA 3HPOA 3IGNA 4BWMA 3OYCA 3FQLA 3CG7A 3CM6A 4FJJA 3ISNC 4J9LA 4F4WA 4FS1A 3V6JA 3RBEA 1SKWA 1YVFA 2VG6B 4IOBA 4RZRA 1NKCA 4I2QA 4KSEB 4F4ZA 3RAQA 4K8ZA 2NUBA 4O55A 3HPHA 1S6QA 1C0TB 3KLIA 2HW3A 3WNEA 3M8SA 3KNAA 1WSEA 3HHKA 5J2QA 3SQ2A 3LDSA 4WE1B 1JL1A 3QO9B 3SJJA 3KLEB 2WOMB 2AGQA 1KVBA 1HJRA 4ED3A 5KFDA 2EX3A 4WFYA 1S6PB 5HLFB 4TSXA 1JLFA 4K4VA 4CJ5A 1T03B 2AJQA 4ED7A 3V81B 4M3YA 2XI3A 4O0JA 5DGAA 5J2NB 1S0MA 3QNOA 4AHUA 4DU4A 3QEWA 5KT4A 1XHZA 2G8UA 4ELTA 4EP5A 3PW7A 1C6VA 1VSDA 4OGCA 1HYVA 4ICLA 1QTMA 3LANA 3SZ2A 4Z4EA 3AA5X 4QWDA 1J9AA 4U6PA 4DSFA 2WB4A 4F3OA 3KJVB 2W7PA 2XY5A 5F8JA 2BE2B 4QAGA 5J2MA 4H4MB 4XPCA 4E7HA 4KV8B 3BGRB 1U4BA 2R2TA 3LWLA 4LD0A 2VA3A 4ECRA 2ASJA 4H4OB 1SUQA 1NJZA 1EX4A 2R8JA 4E7KA 4K4XA 4DTUA 1HMVB 2F8TA 4FM2A 1NKEA 1RT3B 3FFIA 4ZVHA 3JSMA 5F8IA 4CIGA 3KTQA 2OPQA 2ZD1A 3HK2A 2BRKA 2W42A 3BREA 3EZUA 4FLWA 1YVUA 5JUMA 5KT5A 4RW9B 3OYJA 2X78A 1X9SA 3RWUA 2KFNA 2HNDA 4FJ5A 4RG8A 1XR7A 3RR7A 4M3WA 3LP1A 4Q0BB 2ZE2B 3CJ2A 3K5OA 1SL2A 2D0BA 1HPZB 2BANB 2HHVA 3Q8QB 5KG5A 3LWMA 2QKBA 3M8PA 5KGXA 2GIRA 2ATQA 1L5UA 4AHTA 4KHSA 3C95A 3SUNA 4URSA 3MAQA 4DTSA 2IC3A 3BJYA 3K58A 4FBTA 2OPPB 3IAYA 3I8DA 4XO0A 3MTKA 4YMEA 1Z25A 4DMNA 2G8VA 3NH1A 1T3NA 4FZYA 2HVHA 2UVRA 4WE1A 5EDWA 4XIUA 3BDPA 2WOMA 4GMJB 3KLGA 4M95A 4RW8B 1K1QA 3PW4A 3UQSA 2YNHA 1RT6B 5HLFA 3KKSA 2XCAA 1NK5A 3KD1E 2Z1IA 4URQU 4KAZA 1DTTB 4WYLA 3AVFA 4OLAA 1W9HA 1BISA 3D28A 2BGGA 3F73A 1CSJA 2YKNA 4BACA 4AHCA 3KJVA 3DRPB 4CK2A 5F9NA 3RB3A 4QWAA 3CDEA 4H4MA 2B6AA 3G86A 4ED2A 2FJWA 2V4RA 2KZZA 1RBUA 1RYRA 3BGRA 1YTAA 3TAPA 4RU9A 3OSNA 3KMQA 3SFGA 5KFEA 4ZMMA 3EY1A 5KT2A 3M9NB 4TY9A 2VG7B 3KK2B 4H4OA 2WONA 1BCOA 5L1KA 4RNHA 3TARA 5FRNA 1S1UB 2HAIA 1A5WA 4FLXA 4QWCA 1RT3A 2DY4A 4ED6A 4O3RA 1JLQA 3DI6A 4ZVEA 4WXWA 3ISND 2W9CB 3SQ4A 2WHOA 3KIOA 1RBRA 3D5MA 3AO3A 4KHNA 4CEBA 4I7FB 4RW9A 4B9MA 3LZIA 4CECA
chains in the Genus database with same CATH superfamily
2E5LK 5LJWA 1VRQC 4CZJA 1G15A 4K50A 2B4OA 2VQFK 1ZTWA 1HPZA 2KQ2A 4CNZA 3SUQA 1HBNA 5G0RB 5A76A 3DRYA 1SL0A 4ED8A 2PFDA 2BTFA 2J8AA 2DITA 3O8WA 4KGXB 3H4BA 5KPZA 1LKZA 2K7JA 1NBWA 4KH4A 4E3SA 3KLVA 5AXMA 2O8DB 2VL1A 1J5EF 4USTA 1UW9A 2XO7A 3EZOA 1RDWX 2OAUA 2H65B 2QW9A 1WOQA 4AL7A 1HQUA 3L95X 4CF0A 5E84A 3QYYA 4TYBA 5K8PA 2Z2MA 1OY6A 2OFGX 2O8FA 2BV3A 1X1PA 1OY9A 1IBCB 1X0FA 2XLJA 2IM0A 1RT7B 3I56N 4OJGA 4OPKA 2DNYA 2F3JA 4ZTFA 2MGZA 1SQKA 1IJEB 2PEBA 4JI6K 3CJ9A 3OLBA 4DV0F 3DRPA 3WC0A 4A8WA 3D4JA 1DQ9A 4TY8B 3R5CA 1HD0A 3T6BA 4PAAA 3R7NB 1UFLA 3LP0A 1EX8A 1RLCL 2R8HA 3ZLJA 2DXFA 3KXDA 3QFHA 3UKUB 2HRTA 2VG7A 3MTJA 4M3XA 2C28A 1CJUB 4TVAB 1YK9A 3KD5E 3K8VA 1FJCA 4MTPA 3DXKA 1G2EA 1P8ZA 2J6UA 1RLDA 3ZNJ1 2ZUGA 5JJBA 4HHJA 4FF3A 5KG4A 2GZOA 4BBYA 4Z7CA 2XQCA 4AL5A 4JYAK 2JWNA 1RWPB 2D41A 1N34K 4N41A 4OPJA 1ATNA 3PHEA 4FPRA 1FERA 5J1PA 2V8HA 3CDWA 4FKXA 1DAXA 5AXKA 4OHZA 4ZP9A 3OFGA 5F0UA 3PV8A 3DJCA 4DLGA 3P6YC 4OKEA 3MM5A 1FXLA 1ZAWA 1YLXA 3NG8A 4F4KA 3OYDA 5EN1A 2MY8A 4DCHA 3CIZA 3RAXA 5A8KB 4FLVA 4BC5A 1EAYC 3MEDA 1VSHA 4F7VA 3PIOL 3L8BA 2Y9HA 4P2SA 2KO1A 2A2CA 3CERA 2KFYA 1JLFB 4TN2A 3P83D 1HFEL 4UOHA 4X66F 3KJFB 1F9HA 3CMES 2D9OA 4G65A 1T0TV 4JKGA 4DFMA 1XJWB 1RU1A 3AO5A 4YN3B 2OO4A 2OGUA 3AHPA 1ASWA 3J7ZO 3J7YU 2F4VF 1RDRA 3OYNA 2XYPB 4GKJJ 4Z4FA 4CEQA 1BI4A 4DL4A 3JB9k 3THWB 1NDCA 4CF9A 4ILLA 3RAMA 4RUCA 2O8CA 4A47A 5AQNA 2RSQA 4DS5A 3LM2A 2U1AA 4E1JA 2YHXA 2G8WA 4DV0J 4M5LA 3RBDA 2YQ1A 4O4GB 4LVNP 4EYIB 2DNPA 2IVYA 1REGX 1N52B 1X0PA 4E98A 3I5BA 3JAMU 4LF9J 1M90O 5FIIA 3P49B 5HRNA 3KWIA 1N36K 3TQ1A 1U8SA 3VZHA 3PTWA 2Q66A 1S4EA 4PKDB 2FC9A 5AQVA 3GIRA 1CJKB 4OYXA 4KY3A 4F26A 1PAUB 5KOWA 3R1HA 3GV5B 3AXMA 3FRZA 1S97A 4I6MB 1TL3A 2GEMA 2AGOA 2WCXA 4OZ5A 3E1YA 4CF1A 1KOHA 1A5VA 1ZPWX 4KI4A 4HI1A 3AB4B 2V4QA 4M5DA 4F4YA 5D0HA 2BVZA 4B9QA 3BSAA 2CQ1A 3D2EA 3SCXA 1FE4A 1Q8BA 3VZIA 3ZZ0A 1VSIA 4M5KA 1L3UA 4YP3A 4NYZA 2KTQA 1CJVB 2DNNA 4BRDA 1S6OA 4KHPF 1UPPA 2O8EB 3J81U 4MO5A 4HTJA 3H2UB 2LKZA 4NB4A 3MFHA 3UWTA 2XLKA 2YNHB 4MFBB 5KFGA 4NLBA 3CWJA 1JXBA 3CMAN 2A0FB 4OLOA 4QYZK 2CG4A 1DZ5A 4CZMA 1QVFR 2O66A 2XNQA 2JOQA 3AFGA 4GKKJ 2FGCA 4LIWA 3IRXA 3C15B 4RWWA 4X66J 2DGTA 3R8YA 3NOCA 3AODA 2YKMA 3EX7B 3W5ZA 2MKYA 4E0DA 1Q18A 1LFWA 3HZ6A 3ONQA 2F7TA 3ET6B 4KHMA 4FJ7A 1YRUA 2IYIA 3ZSRA 5C12A 4AILC 4FJNA 3W65A 3RMCA 3L4BC 1H2VZ 4Q43A 3IBWA 2ZZMA 2BJ7A 2G1DA 4WU2A 2UUBK 3HP6A 3AD9C 4H03B 1A7GE 4HHHA 4GNIA 1KFSA 4XEIA 3NCPA 2K8GA 4ES3A 3QEIA 2A1SA 2FPHX 1YBAA 2FY1A 4LH4A 3SI8A 4ZPBA 4BE2A 2HGNA 3T9NA 2G8IA 2NPFA 3FQKA 3O6QA 4CZLA 4M7XA 2YTCA 2OTLN 2BA9A 2FLLA 4EO8A 3Q86A 3EL2A 3VEZA 2AJ2A 1XERA 4CLFA 2EPIA 3D6HB 5AT1B 1FXXA 3MZIA 1ZAVA 3JQKA 2X51A 1OH8A 1T95A 3BM7A 1SAZA 3CD6S 1WACA 5D0RA 3H45C 5KI6A 2RRBA 3OR2B 5JLFA 4DCPB 3CDBA 4PCQA 4CP5A 3CDUA 4B9UA 1VRTB 5DM6L 4DV1K 3DKDA 1UTAA 2V8VA 1YJ9N 2VB6A 3MMAA 4K0KF 3WBZA 1VSEA 3VAIA 1S1XB 4HACB 3D6FB 1MROB 1O1WA 5GADU 1OJ4A 2VJUA 4MK8A 4CFAA 3NY0A 3P5BP 3QGIA 1SBRA 3DLJA 2QLJB 4ZOSA 3ULDA 2DHSA 5KFVA 4Y0WA 5HP1B 2VPYB 4PWUA 1Z26A 4B3OB 2XHWA 4R5PB 2Z2LA 4CJRA 2OI2A 4KGMA 3KKRA 3S3OA 3EJMA 2UUTA 4ID8A 3CPWR 4F4XA 3MXIA 1H2TZ 2VQEJ 2PE8A 5KTQA 4FOEA 1JLGA 4WIIA 1X4AA 1S5ZA 4QS9A 4DQ8A 2XMKA 1R43A 5D4PA 4DQRA 1W0HA 3NHGA 3H5UA 2HHHK 3VVTA 1E4FT 4FZVA 3ILLA 4DJBA 3ZX2A 1CJTB 3DRSB 3HOSA 1U48A 3GV7B 1C1BB 2GIQA 1YITN 3L09A 4LF2A 4DV2J 1JJ2M 4OLBA 3PUFA 1NDPA 3HDSA 5M1OA 3C6UB 2RHKA 2VBZA 3EM1A 5KFSA 2Y3YA 4I56A 4ED5A 4PWDA 4OYWA 3C2PA 4DUYF 2D3O1 1IKXA 4O23A 2PA3A 4DCJB 1YTUA 5FDLB 4HT7A 2Q1NA 3IMQJ 2BABA 3W66A 2N3LA 3FLCO 4JKFA 4DV5J 4ZVPB 4X65K 2BACA 2LXIA 3KKFA 5BR8F 4B1ZA 4OI0A 3SBTA 1QSYA 2MZ1A 5B0CA 4CGJA 3U1LA 3MM8A 3V6KA 3ZSYA 1BOTO 1C4CA 3NDKA 3WXMB 4BS2A 2MJNA 4FSVA 4IRDA 2QLXA 3MOJB 2C3MA 1ZBTA 5A8WA 4B1YB 1U45A 1RQ0A 2WVDA 3MDQA 1R6YA 5AQHA 1ZBUA 3CI5A 1C0GA 4U96A 3TVKA 5CXTA 2RS8A 4PA1A 1R89A 2IAJA 2ZJQQ 3LGMA 2GV1A 2PDAA 4DV3K 4RW4A 1Q5VA 4AQYK 5C24B 2C22A 3WX4A 1IKWB 3SQOP 1UVIA 1QUVA 3OTOK 1JLCA 5B0FA 3HX9A 3JQJA 2JNJA 1RBSA 2CZ4A 2HS0A 2CDRB 3VQQA 1CLQA 4M5IA 1BUXA 2V67A 2ZH8A 3OYIA 4N77A 4A8SA 2WSCC 4BVOA 4BVPA 1LOTB 5B0BA 2YNGA 3NH0A 1YJWN 2B9XA 4PXCA 3G71S 4H0VB 3CD7A 4ID1A 1FD2A 4CW7B 4UF4A 3V4IB 3HD1A 4YOEA 3Q7CA 3KG4A 2XS5A 2DEJA 1ZZNA 3FZMA 5KFLA 2QEXN 4DPWA 2J8SA 1HNIB 5KFJA 1B0VA 5GAHU 2FVRA 1LW2B 3LAMA 2UU9J 2Q2RA 1ITGA 2EC0A 4CEZA 4BRPA 3MEEB 2SXLA 3V1RA 3I33A 1FFWB 1KHVA 1FKOB 1ASVA 5F3ZA 1RWVB 3ATUA 4UT4A 5EWEA 5CHIA 2PYJA 3O08A 4DTMA 4PYAA 5GAEP 3TTCA 2UVUA 4DQIA 2ZUAA 2E7WA 3UDLA 5C42B 1VBKA 1JLEA 3WNFA 4DUZJ 4K7QA 1E4GT 2F7VA 1KCFA 3VGTA 3GOIA 1JLAA 3C14B 3RRGA 1OQ6A 3TABA 1M5PC 3EKUA 3D2FB 3QEVA 5H9FJ 1VQKN 3Q22A 1LWEA 2XY7A 3I5CA 3NF6A 3KZBA 4FJ9A 1U2VB 1KSPA 3LPUA 1WHXA 1YHQS 4KGZB 1NPRA 4HWIA 2KZMA 2NLXA 1YIJN 2ALZA 4BR5A 3ID8A 4BWJA 2VJVA 4TQRA 3HCXA 2AT1B 4JI6F 1ZS6A 1Q86O 3V9SA 2V69A 4BC4A 1V3SA 1WOOA 1UOCA 5KT7A 5JMVA 3AJ2A 4W4MA 4R8UA 3W9IA 3R2CJ 3DLGB 4BRQA 3ENBA 2EFPA 4RU2A 2KG1A 3CCJS 3AVHA 4KKOA 4DQPA 1K9MT 3DOKB 4EFAC 3C6TB 4OGEA 1LCUA 5KFCA 3DGPB 3QT8A 3ILJA 1Y0HA 2MZRA 1GLJO 2HZAA 3D1QA 4JD2B 2IA6A 2BE9B 3SSSA 4B3TK 1TKXA 2ZBIA 3MEGB 2W24A 4CRJA 2KM8C 1IQTA 3MMBB 1N34F 2AZ3A 3C66A 3KUGA 5JLHA 1LQ9A 3T9ZA 1R8BA 4LH5A 3ZO7A 4KT0C 4B3MK 8ATCB 2P9LB 1N5YA 2NXEA 1JCEA 3RMAA 1Y64A 1EQMA 4JI2J 3ZT1A 4AHRA 3ULEB 1TL1A 1FW6A 1KVAA 4DFJA 3VQ6A 2NREA 4BRIA 2QXLA 3VF4A 1EKSA 4FXWA 2OJ3A 2LA4A 1VSMA 2GNKA 4QOZB 2MEWA 5IZHA 2Z1GA 4QWBA 3L3CA 1FRMA 3TSPA 1OMSA 3DFEA 4CEFA 2XMWA 4NO7A 1APSA 4PEOA 1KFDA 4K4UA 1XQSC 4KH0B 1Q0NA 1F1BB 3Q8RB 3SQGB 4RX6A 2B4PA 3VA0A 2YKPA 3B82A 1RHUB 2PAVA 1IH7A 4C11B 1W7WA 3HVTB 3BSOA 1JKHA 1OH5A 2GMLA 1R8AA 1P1LA 4PG7A 1RT2A 1Q81T 5HATA 4JK9A 3CCZA 2IOCA 2HFVA 4QCLA 3T1HJ 2B7CB 4LF4J 3LQVA 4L75A 4X4TA 3CE8A 2LP4A 1BQMB 3M30B 3A8KA 4DR6J 2WFBA 1UAWA 4DTRA 4RKUC 2ZKUA 3GPAA 4EZ6A 1WEYA 3GFZA 3RTVA 1NB7A 1HRHA 4P10A 1EZZB 3EZ5A 3R6MA 1IKYB 1OQ3A 5JS1A 3PJ9A 2HS3A 4LRAA 3L7PA 2ZOMA 3G10A 3L7OA 1N36F 2P9GA 1X31C 1X9WA 4W90B 4DX8H 2DY9A 2L48A 3OYAA 1GAOA 3O3HA 3Q8UA 2M9KA 1HQEB 5EWGA 1YSJA 2NRRA 5AE3A 2YV0X 2RQCA 5A2QU 4UY8T 5FPDA 5HMYA 1N5SA 3DM2B 1WAFA 3IC1A 2DPNA 4M5JA 3NBPB 3CCRS 1FESA 3MR7A 1J5OB 3BGUA 3OTDA 2HNZB 2GAHC 3WQTA 1D5AA 1PYSB 3IUCA 2DPIA 2NSBA 2E6LA 4X62J 3AO2A 2ROGA 5FPNA 4WIQA 1FJ7A 4OLPA 4OYAA 1C0TA 2ZH1A 1BUPA 4O0IA 2ZDOA 2XY6A 3CXCM 3NE6A 3ZCMA 2V63A 4DL0C 3CJTA 3H3NO 1PIEA 4PUOB 1XC9A 4K4SA 3E01A 3TW0A 3TANA 5HROB 4DBQA 3RMDA 3DDIA 5E5NA 3P5JA 2ZNYA 4DR1J 3PRVA 3WEEA 3PO5A 1FKPA 1RDDA 3N0VA 3CDAA 1WHVA 1B7FA 2NZTA 4JHDB 3VERA 3V6DB 4LR7A 5KFUA 5KG0A 1WN7A 3VEOA 3X3UA 3PM9A 2EFVA 1S6UA 2GIFA 2YWFA 3DLEB 2W25A 4IH7A 4OHWA 1T05B 2G8FA 1KQFB 1IKVB 2Y1LB 3DLRA 2GUPA 5C2FA 2BE2A 2FBVA 2VPZB 4F0KA 5ETLA 3L3VA 4BRNA 3R3LA 1HWUA 3D6TB 4KV8A 1PO6A 5HOOA 2DCUB 1FJGK 1M5VC 1RT5B 4U9RA 3VGKA 2P6SA 3MCNA 5KG2A 2G8KA 3CNQP 3PSFA 1UZDA 3K89A 1IBLK 1JLBB 2VODA 4IG0B 1HMVA 2KI2A 2RT3A 1N5TA 3VGVA 2AKWB 4F2SA 1W2IA 2EG2A 5LSRA 1GH8A 5IV4A 2J0XA 4KYZA 2PFFB 4P7VA 3GCXP 2RE2A 2HRUA 5BYRA 4J9UE 4KRWA 4QR2A 2FY8A 2RUGA 1VBXA 3M5RA 2MKKA 2IJNA 3G6VA 3THXA 4MIBA 2JDJA 2O4GA 3KNGA 4BDZA 2V94A 3W2VB 3L2UA 4IO9L 5LMUJ 3GDQA 1Y3JA 2NPIA 2P5VA 3H46O 1YRXA 3ZEUA 1B70B 4BDYA 2V4JB 1BQNB 1M5KC 3AD7C 4DV1F 1WSIA 2W6KA 2CWKA 3T5KA 2LA6A 3CJ0A 4M7YA 1NO8A 5BREA 2IJRA 4EP4A 4ZLJA 1YTYA 3MAHA 3PIPL 4KPYA 3R9PA 2OEJA 2CKWA 5CYQA 2MZJA 3ULHA 1XR6A 4H0XB 3CC7S 3W9JA 3OJUA 2JWKA 4DR3K 4Z4CA 1RT6A 4KHWA 4RW6B 4QJVA 1S1TB 2QA4S 5HJXA 4W92B 1HKCA 4MDAA 2OPSB 4CJEA 3B54A 4FP9A 4IKAA 4CJ7A 2CNNB 2XMJA 4EAHD 1WLJA 2L08A 5AQGA 1SH2A 4IDKA 3MPVA 1TU0B 5LMNJ 1R31A 3UDEA 1BIZA 1RTDA 3QSIA 3NF9A 5K14B 2YWKA 4MO4A 1LWFA 3WNHA 4XK8C 1UAXA 4IH6A 2KHOA 4FWNA 4FWQA 2QWPA 5B0EA 3A13A 1OVQA 4DR4J 2HHHF 2R9LA 4JI7K 3TTDA 4CFCA 4CLZA 5LJ5Y 3ZETB 1EO1A 3ASMA 5ADXA 1TV6B 4GRSA 4FYDA 3VQ8A 3EZWA 1H1VA 3FZLA 1KP6A 1U1QA 3FBBA 4F25A 1FRKA 2NRVA 1R27B 3M32A 4OX9K 3M2RB 5AZIA 4QBUA 5G4DA 1KTQA 3VF2A 5AQQA 3ZTSA 2DPJA 3NCIA 1NGGA 4CTAB 4G1IA 3U1NA 4J9KA 4RJVA 4ZPAA 4Y28C 1IO2A 2DO4A 4X65F 4USVA 5I3QA 2LMIA 1IWGA 4JRQA 5G0RA 2HBRB 2Z2YB 3TZXA 5T7BA 3CM5A 4IOXA 2KJVA 5ETOA 3N4QA 2Q31A 3Q8SB 2BX6A 2AJFE 4FW2A 1HWJA 3OXLA 3LP2B 4J9QA 1FK9B 2QYGA 3OD2A 3F2KA 2O8DA 4OI6A 5F8LA 3AVGA 3NCRA 3BR8A 2GFFA 4MQ3A 3M6GA 2HVIA 2JLFA 2RRAA 3THVA 2LQ5A 4HUEA 4B08A 4D3HA 3OTOF 1DARA 2E9TA 1FKAF 3CIPA 1RAAB 5E0OA 2W1BA 4IZ9A 4FWRA 2IYGA 3OS0A 2PT0A 3DHWC 1WSRA 3S41A 2BQ3A 1KBRA 1LEOA 3D2WA 3SBGA 1S72S 5KFXA 3OVBA 4IJNA 1VQ9N 3H25A 3B4MA 1FWKA 1RWNB 4MKBA 4CH7A 2QO3A 1ZETA 3TVZA 3I4PA 4LIRA 3GR1A 2XO6A 3CJ1A 2XGPA 3J80O 2L3MA 3CJRA 2BZ2A 2KVQE 2W2OP 5CZ2A 2FBXA 2I0XA 1GLBG 1LNQA 1VQ8N 3S8SA 4BCAA 1CJUA 3AA9A 4JV2A 2HBKA 4PXEA 1NH8A 2OPRA 3CC2S 2GUIA 4JI5K 1JQGA 1Z2LA 3K9JA 4USJC 2RDDA 5JICA 1P9YA 4AL6A 4JI8J 1NU0A 3AVBA 2QG9B 4J9PA 3A12A 3A5NC 1OSCA 3R5AA 1Q7YO 4HTIA 4DF8A 3CHWA 4CGHA 2R7YA 4QW9A 2HF4A 2OZSA 4CYUB 3MCSA 3CM6A 4FJJA 4QIEA 4F4WA 3V6JA 1D8ZA 1CULB 2X7IA 1YVFA 2MYFA 3SAFA 1NKCA 1T6DA 4UUXA 4F4ZA 4DN9A 1QAYA 1RCOB 2NUBA 2WUSA 3VF0B 4FKYA 1R7IA 2HBLA 4B3SK 3D1OA 3LDSA 1QLNA 4WE1B 1I94K 3QO9B 5IOLA 3BBFA 5KFDA 2EX3A 4L72B 4WFYA 2DGWA 1S6PB 4HHUA 5HLFB 1JLFA 2IMOA 4K4VA 1T03B 1HHTP 3V81B 1IBMJ 5DGAA 5IWAK 3QNOA 1MN7A 1HNZJ 4ELTA 2G8UA 4EP5A 1VSDA 4ERDA 4OGCA 1HYVA 4DV4F 3AA5X 4QWDA 1J9AA 5AE1A 5K5MA 1Y5IB 2W2MP 2ZJPL 3CPEA 3BPSP 3THWA 2RH3A 2ZH4A 3ZFVA 1GNKA 3BS9A 1EIYB 3MUMP 2GWKA 1U4BA 5M2RA 1UJ6A 1VR6A 1YVNA 1FF2A 1HJOA 4ECRA 2HPUA 1KC8T 1SUQA 1RUSA 2FZKB 3PRBA 1EX4A 1VHXA 4LFBK 3D7SB 4QZVB 1GMVA 3AOAA 4L6V3 1AUDA 4FM2A 1RT3B 1XBWA 2I8EA 2B9YA 3PHTA 4DR5K 4LFAK 3KTQA 2OPQA 2ZD1A 3EMTA 3HK2A 4LBIA 1N54B 3HFZB 1CJKA 4PPDA 4FLWA 4OHVA 5JUMA 2BJ8A 3GJTB 4NI2B 2BEFA 3AXKA 2VFTA 4RG8A 1XR7A 3LP1A 3K5OA 2ZE2B 3CJ2A 1WDDA 1SL2A 3G71N 4IOAL 3NMUA 1HPZB 1RADB 3Q2SC 3GU0A 2YPZA 2QKBA 1UPMB 4YY3F 3HKZD 1GMUA 3C95A 3VTHA 3SUNA 4DTSA 3BJYA 4FBTA 1VFJA 1A6LA 4XO0A 1Z25A 1RI7A 3VEVA 2G8VA 1EB0A 5ADXH 3NH1A 4Y2IA 3C6HA 4FZYA 2UVRA 3MURP 3O6WA 3BDPA 1O8BA 5CR4A 3N5BA 3HTVA 1U1KA 2YNHA 3UR3C 4BHQA 4JKBA 1X3NA 3B6BA 1YJVA 3KDNA 1M0SA 4OHXA 4WYLA 3AVFA 4GV6A 3C15A 5GIOA 1RAOA 3AJDA 1W9HA 5IM0A 3MCMA 2DR6A 3ZZOA 2BGGA 2HQDA 3CF5Q 4H5TA 1S3XA 3EICA 4CI0B 5M1KA 2MGZB 3ZXWA 5L9NA 3DRPB 3JXOA 4DV4J 2PA8D 4QWAA 3CDEA 4H4MA 2FJWA 2V4RA 3HI0A 2CPDA 1RBUA 1YTAA 4BREA 1CBKA 3OSNA 3KMQA 3W2WA 5KFEA 3LH2S 2FJDB 3D54A 2VG7B 4H4OA 1O13A 4Y2KA 3MX2A 3TRGA 3MMVA 5FRNA 4QWCA 3DC2A 1CC7A 3M6WA 1VQYA 1X5TA 1KD1T 5FD1A 2W9CB 2KJWA 2GHVC 2LU1A 3BF4A 3D5MA 3KIOA 4JAXA 1IN0A 4WP9A 3SAGA 3QRRA 4WBFA 2YX6A 5AQTA 4RW9A 4MYUA 1JXVA 3LZIA 3ADAC 2P2CB 4YOXA 5GMDA 2BKOA 2ZM6J 3ENQA 3PW2A 4CLUA 3T1AA 1HL6A 2HBZB 1RAEB 1QJHA 5D15A 5DQHA 5KG3A 4RUAA 5IT0A 2KT5A 4F3TA 4YY3J 3BH6B 3QBXA 3POTB 2OD6A 4H0TB 3SFUA 4FCYA 3MEDB 5LJ3Y 2FSKA 5GAHP 3MI7X 5HRSA 4A46A 3DMJB 1FDAA 1MROA 2D3OR 1TFYA 1FT8A 3HHEA 2V5HG 4FM0A 3U1MA 2B3TB 3MPUB 4C3KA 3W8PA 4UY85 1HKBA 4JKGB 4CJWA 5KOXA 4DL6A 4BG8A 4UZBA 4LF8K 1DTTA 1FD8A 5HI7A 3D67A 2HHQA 5FPMA 3ITHB 5HP1A 4NLWA 3GFHA 1BDGA 4PY5A 3SQ0A 2H5JB 4V1Ak 4Z94A 1XNQK 3UNGC 1JNZB 5DZ6A 4CI6A 5SUHA 2QE5A 4J2BA 4I4BA 3NF7A 1S0VA 2DNZA 4ECXA 1LOUA 3KK2A 3UN2A 2KDOA 3LDNA 4I0WA 5C10A 3A8JA 4LQ9A 1FJGF 1SVDA 2VKZG 1CJTA 1U24A 4JI4F 1OIAA 3VQBA 3HL8A 2EG1A 1C1BA 2YJEA 3HHLC 3EPGA 2IIHA 5DDOC 1T44A 3R1XA 2QL9B 2GWJA 2V51B 3HPGA 4C0BA 2F8EX 3DRRB 4BLGA 2XY8A 5KFFA 2KG0A 1IWAA 4F3QA 3C6UA 2OEMA 1K73T 3OSPA 4W5NA 4NZ6A 1AFIA 3H98A 3PYFA 3TAEA 4CHOA 4Y65A 2RAQA 3FBEA 3FVYA 2IY5B 1S5JA 1QQOA 4M5DB 4NLRA 1WD6A 1Q1KA 2FJVA 2CVEA 2D74B 2RILA 4I2QB 2V2KA 3D2EB 2CGKA 1ZBIA 3BP8A 1ZAXA 1S6QB 1GLEG 3PVXA 2XC9A 2FTRA 3T7ZA 3ZSQA 3QIOA 4AYBD 3G0ZA 4C2MA 3BKFA 2E2OA 1SJFA 3CCQS 4N7TA 5DQIA 3NL0A 5AQLA 2QZ8A 3RB6A 3BQ2A 2B7BB 4X2BA 2A6AA 4ECYA 2XHBA 4B8CA 3IRXB 3C6AA 2YKMB 4LFCK 4FBUA 2VYPA 1X4FA 3J7AP 4DR3F 3CCRN 5KT3A 2ATCB 2JC0A 5KQ8A 2J0QD 4K4YA 1Y97A 5J2MB 1WAJA 3CCMS 2G1HA 3MCOA 4OZ3A 1HX1A 2E5HA 1LK5A 4J90A 1HBUA 2ZITA 2JFKA 4Q44A 1QHTA 3NFAA 3QJJA 5DG9A 3EVOA 4MYTA 4CLTA 4CIOA 2XI2A 3MWTA 2F4FA 1NDKA 3JSMB 3V4IA 2VH7A 3IKMA 4NWBA 3K8WA 4LSLA 6FD1A 2HZVA 4PL7A 3IG1A 1S7IA 4JI4J 1KAZA 1VQ6S 4TQSA 1LAVA 3C0BA 5F0WA 4F0HA 2H5EA 1HNWK 3B8HA 1HNIA 1N0UA 4AE5A 3DLHA 1LW2A 4NLXA 3UW1A 2AZ1A 1HW9A 1TTHB 2DY1A 4KBOA 4CDIA 3OYKA 4AHVA 2EFNA 1W97L 1SJ3P 3R7BB 4OX9F 4ECVA 3MEEA 2CFXA 4JP8A 2VQFJ 1QQCA 2BH1A 5CE3A 3LW5C 1ROFA 4YB7A 5B7WA 2YNIA 2IC3B 2WVCA 5IV3A 5AXNA 2I2YA 2XMUA 4Q8EA 3O5TB 1I3OB 1NZ8A 3M7VA 2ZWHA 1XMOJ 1VSFA 3DU5A 3PR5B 1SC1B 4IBNA 2AD9A 1SQEA 5GAEI 4A2AA 2AEFA 1RAHB 3GJSB 3THTA 2W4PA 4B9SA 2H51B 4KB7A 1EWRA 4MH8A 4NLQA 2ACYA 2CPXA 3C14A 3ZT3A 2KT3A 3D6RA 1F5BA 2MXYA 1YBTA 4PYDA 2MKHA 1WF2A 4GV9A 4PRFA 2RRNA 1CEZA 4Z37A 3TA1A 2NLWA 2B43A 1U2VA 4U8YA 3VAHA 3MK6A 4NZ0A 1CPZA 1S9EA 1VQ5S 1NSQA 2ASLA 4WFBQ 3CFOA 4CLWA 2DH8A 2OMOA 2P5GA 5KFRA 1HR0J 3RMBA 3TAMA 4FXDA 2MJUA 2WONB 4NLPA 3AAPA 1Y10A 2FVCA 3W1YC 1HLUA 2FZGB 3IBCB 5AJ3F 5K20B 4FJHA 3SSRA 2ZWPA 4LF7J 1JLQB 3PW0A 2KYXA 4QR0A 3DOKA 2QA4N 2E7XA 3HZEA 2HVDA 2F8MA 3OFHA 2MQQA 1HQ2A 1GK8A 3DGPA 3FE1A 3L2WA 2B51A 4JYAJ 2YVSA 3SEOA 4ZJLA 4OI1A 4CFDA 1IKXB 3K2YA 1EXQA 2Q36A 4ZLNA 4JD2A 2HVZA 3U6FA 3MEGA 2KL8A 4IKFA 3KLHB 2IBKA 1U2CA 3WT0A 3MMBA 1B64A 2B9WA 4R25A 5F41A 4A59A 5AQUA 2E1PA 2VPWB 2IVFB 1N5QA 2P9LA 4EZ9A 4C9DA 2IDLA 1CC8A 2HFSA 5JXSA 3G8SA 3ULEA 5LJVA 2EFOA 3NAHA 7AT1B 1JB0C 3SAHA 1QQMA 1D0EA 3I55S 4JV5F 4USKA 3VQ4A 1IR1A 3AARA 5F3TA 2W8LA 1KWMA 4CH1A 2EEYA 3UFCX 3IR6B 4ILGB 1WOSA 2YWWA 2YNFB 4WQ5C 3NVKA 4DV6J 1L3SA 4CZKA 2IAJB 2X3GA 3ZT0A 1GX5A 4B3SF 3DYAB 5L39A 3WXKA 4P52A 3HRGA 3SQGA 2GVDB 2FQQB 1D9FA 1JLCB 1U1RA 2FHJA 2WVEA 1NKBA 4BGBA 2V8GA 4NLSA 4G3IA 4C11A 5ETMA 2OD4A 3A5OC 4GKJK 1JX4A 4XH1A 2Z30B 5IWAF 2RF2B 1CZAN 2ADCA 3A4TA 3EKSA 3OR1B 4ZVUB 3GFYA 1GLCG 4DV0K 2CXEA 1E3MA 4B3RF 4OO1J 2YNGB 1L3VA 1DY3A 4LF5J 1DFDA 1BQMA 2W6LA 2MQLA 1WSVA 5E3RA 3S01A 4DPTA 1SQGA 4ECSA 3BSNA 4LF9K 3N6NA 1SI9A 1UEVA 4U7CA 3EXYA 2MZTA 4OIXA 3TZWA 1VIXA 2R7TA 4J9NA 1RISA 3PEHA 4OZNA 5AQOA 2B4JA 2O5DA 5LSLA 1U0HB 3RZAA 1KHWA 3NGRA 4LFAF 1RKIA 2FVPA 4X64F 4IR1A 2FVSA 1HKGA 5A0YB 1AZSB 3PDNA 5B0DA 4K4WA 2F9DA 1WC5A 3BZKA 1QS4A 1HQEA 3OYMA 1K8KB 4BE1A 1LWCB 4W98A 5H9EJ 3K7RA 3Q8PB 3WXJA 1YZ7A 3HVRA 1LWXA 3DM2A 4KHYA 3BEXA 1ZH5A 1UFWA 3I9V9 2IDEA 2W41A 4LQ3A 2ZJQL 2HNZA 4URGA 2JFDA 3DCAA 2X6NA 1YT3A 1F21A 1AXQA 4HT5A 2CJKA 2KXHA 5CYJA 2DTJA 4DSJA 2C2ZB 4OMFG 3L6QA 2EFQA 3NKYA 1UWBB 2E20A 5C15A 4GKKK 3QFPA 3VQAA 3DOLA 2W7OA 3BKTA 4FF4A 4X66K 2WVBA 4YOTA 4DMZA 1KQSM 4MKVA 5I42A 4KAIA 4LF1A 4R0JA 3IWXA 5DM7Q 1NMNA 2MMYA 2ABYA 1LWEB 4CEEA 4JS4A 3A3PB 1WELA 2E5GA 2JLGA 4MLHA 4I68A 4KFBB 3FDSA 2XGQA 5HROA 5CZXA 3OBWA 1FEHA 3T3FA 2A3ZA 4AFFA 4RPFA 3EYZA 4XDCA 1A0OB 4BR0A 4C8YA 1TZ0A 3NH2A 1NHVA 4DEZA 4B3RJ 3DLEA 4JV0A 1T05A 2C2MB 1NJYA 4K5RA 2R2SA 3W3DA 3I82A 3I5AA 2D1CA 1W2BR 4R8UB 4O3SA 4ISEA 5U47A 2LCWA 4G1QA 3O44A 4KKOB 2YY3A 1RT5A 3K59A 5DMRA 2P9SB 1RU2A 4B02A 5IT9Y 4KPCA 4H5WA 2HBJA 1V9OA 3CJ5A 4U7BA 1JLBA 3VHQA 1BHLA 4IG0A 2B4VA 3QAEA 4J91A 3DU6A 2XMMA 2J5AA 4EHTA 1TKXB 3H0PA 4X64J 1T6CA 2NZCA 1UP1A 3CCUS 5FROA 1Q78A 2V2VA 3ENAA 5KPTA 5F2RA 3HSTB 1FFGB 2FIUA 3CC4N 1U6BA 4YHHJ 1TGOA 1TL1B 4U67Q 2DJWA 4DX5A 2DIUA 3M8RA 5CABA 2QV6A 2YQ3A 3FGVA 2KM8B 1FXDA 4UZCA 1R8PA 2CYYA 1YF5L 4YNQA 2YCHA 1BQNA 1DT9A 4CJVA 3GYNA 3TJ9A 4CO0A 4J2EA 1KQGB 1HW8A 1XEZA 4NXNJ 2ZHBA 1G3OA 4KHQA 2UVWA 4IFVA 3GSDA 3AVJA 2HNYB 4B1UB 1X5PA 1YZ6A 2ZOGA 3J80U 3AVNA 1ZM3A 4B9TA 2KXNB 1KLMA 3GE1A 4LF8F 1GOBA 4RW6A 5DLGA 3S9HA 1S1TA 1WKLA 3NS5A 1IV0A 2QWNA 5BPLA 2DB1A 2E1CA 2VQEK 1IBKJ 2OPSA 4OYPA 2B8QA 1RP5A 3CO9A 1DQAA 5E33A 4DI6A 3GIJA 1XNQF 4L3QA 4CIEA 4CJTA 3TWZA 2AEMA 3KUEA 3LDPA 4FK0A 2PN6A 2X1AA 4BR7A 3KLFB 4IQXA 4FYVB 2DHAA 1QHAA 4QQBA 3WQUA 1F2GA 4DV2K 3DHXA 3TUJC 4CCHA 1QAXA 3D6MB 3K5NA 4OJ3A 1I6JA 2C2DA 3ZETA 1TV6A 5CZVA 2XSJA 3MXHP 2QKKA 5KFTA 3D0IE 2ZNZA 2PYLA 3AVAA 4IG3B 4BE0A 4DV5K 4F2RA 3LPTA 4M3TA 2BDPA 3M2RA 3CJKB 1DJ0A 3CFRA 4DPUA 2HVEA 4CTAA 3VGLA 4CBUA 2WZ1A 4FJ8A 4YB6A 4PKGA 3LZJA 1EQYA 3HI9A 1PGZA 4NRTA 2D1KA 4WYBA 2E1AA 2DIVA 2MPUA 3VQ7A 3VQEA 3UCZP 3CJBA 5D8HB 1M5SA 1HWLA 1NK8A 2ZBRA 4CLKA 2NRTA 3QZ7A 3FZFA 5LXRA 4DKWA 1NK6A 2CPFA 1BWVA 4OJRA 3LP2A 3ZZYA 4ZLPA 5DETA 5DDRC 5EUHA 1FK9A 1C1CA 3E01B 4ID5A 3CJAA 3OVAA 1VS3A 2JEIA 3HXMA 3AOCA 1KNZA 3T41A 2Q1LA 1UVKA 4ZVGA 2ZH5A 1FKPB 4DS4A 2IVNA 1C0UB 4DU3A 2C2EA 4Y3CA 5D77A 4W5OA 3ISZA 2GVZA 3QRQA 2NS1B 1S9FA 1GLDG 4M42A 1ZXOA 4L3KA 4YORA 2QT7A 1UVMA 2I1RA 3K9KA 1VYAA 2CGJA 1XMQF 1TQLA 2NRHA 1GX6A 1NJIO 4PKHA 4X4RA 4H5RA 3GB0A 2IJFA 1MDUB 4JKDA 5T14A 1FRXA 4MLEA 4O5BA 1ZM9A 3Q83A 1RXOB 1K8AO 3CJ7A 4CVNE 3OL8A 3DLKA 3KK1A 2F65A 1DQ8A 4P75A 2VOPA 1VQ7S 1A5XA 3QNNA 5KFAA 2J6SA 4RNMA 2ZVSA 1ZPVA 2GC8A 1REVA 2LQBA 4DV7F 2D0CA 3H1VX 4DR7F 1U8WA 1H74A 4YDUC 1HNWF 4X4OA 1Z1ZA 3NVMA 2CDQA 3GE9A 3QEXA 2NXCA 5D4LA 1RBTA 5BR8K 3D3BJ 1U7LA 2XMVA 3V6HA 5M1QA 1Q9XA 4A8FA 4WQ4C 4JI0J 9RUBA 3ZEUB 4ZJQA 4CYUA 4RLEA 3HJFA 4GO5X 2P9CA 2HF3A 1RWWB 1NAQA 2EVZA 1B92A 4FL9A 4YR2A 3P96A 4DUZK 4H4KC 1PC5A 4JK8A 2WTUA 1MSWD 4BRKA 2PMWA 3N5FA 3UDCA 2NXJA 2DGSA 4B1WB 5CYQB 3OHBA 3MF5A 1O51A 3QO9A 4AH9A 5H9FK 4YFUA 4QWEA 1U1MA 1N56A 1S6PA 1I39A 1T03A 2KHDA 3V81A 3H7HB 1RT1A 4U7UK 1Q86T 3B6OA 4DFPA 1WC1A 2D3ZA 4WF9Q 4CK3A 4OX6A 2HB5A 3MWBA 4IDKB 2VG5B 1RBOB 2KRRA 4LRCA 3DLLQ 3OT9A 3F44A 4ZPTR 1RTDB 4N76A 1TKZB 1MU2A 3CCQN 3M9OB 1LWFB 1W25A 3NAIA 2R8IA 1HI1A 1Q4RA 4JOUA 4CESA 3VAMA 2KLAA 2NNWA 4EFHA 3OFEA 1KONA 4KH5A 2R7OA 1WKJA 4EBEA 3WX8A 1X4DA 2M8HA 4GC7A 1RTIA 1MWZA 3PFOA 4BR9A 3A8EA 2I6WA 1Q53A 3PKYA 2ITGA 1VLOA 3CCMN 4PABA 3VAGA 3LM9A 4DV7J 4CJKA 4RNOA 4DR7J 5AZIB 4HCBA 1GXTA 1IJJA 1S0OA 1UEUA 3OTEA 4WTOB 1C0FA 3IN5A 4JI2K 4NI2A 3A8YA 2UYTA 5C7PA 3R5JB 2ZE2A 2OCEA 2QA4G 3PX4A 5B8HA 1N8RO 1RILA 2Q79A 4FWSA 2Z1JA 5ETRA 3L4IA 2HHXA 3VQCA 3V9ZA 4QYRA 3IM8A 3QZ8A 1MWMA 1VQ6N 2ADBA 4F4AA 1FX4A 2V34A 4A4JA 3O4QA 3M2VA 2Z0GA 3T5JA 1VBZA 3TYTA 3SQ1A 5THWA 3AGKA 2DXDA 2DR8A 3O3GA 1F5CA 1XHXA 1FJEB 3MM7B 4NLGA 4K8RA 1O6XA 2UXDF 4LF4K 2D3UA 2GS8A 5B09A 2I7PA 5BN8A 5CY4A 2AQ4A 4GKJF 3CJ3A 1IG9A 2G4BA 2XZDB 2IM1A 2UUCF 4M1KA 4DR6K 4WK3A 1CS4A 1KN6A 4KO0A 1PKUA 1QAIA 4GVLA 4EEYA 2LEAA 4ETZA 4WCEQ 2D4WA 1KR4A 2CJBA 3B6PA 3KFWX 2YXLA 2F5GA 3BH7B 5HQ8A 2DVIA 3J7Z5 1WC0A 3O1LA 4A8OA 2MKCA 1NGCA 1CQNA 4KRFA 4O3PA 3G4SS 3QB0A 4LF9F 5DK5A 3SCKE 2VU5A 1S59A 3IFEA 1NDLA 3FZKA 4FJGA 2DYAA 3QESA 1KVIA 2OPRB 1HHSA 5DG8A 3QSYB 2OANA 1G7CB 2FC0A 3ZSZA 3C16A 3W60A 3FFKB 1HNVA 3FR0A 2FHJD 4IEIA 3GYXB 2W9CA 4X84A 2E9ZA 2JX2A 2RB7A 1WOPA 3QFWA 2IMWP 1XC3A 4RL1A 1ZOTA 4EIAA 4CZGA 2OSRA 4NASA 5HBMA 3SJHA 4WFAQ 3V9UA 3I31A 1F6TA 1S77D 3GIIA 5T7LB 4C8LA 1TL7B 1EETB 2DHGA 4X62K 1QVGR 4C3LA 5HVGA 2UXBF 3ZTOA 2UP1A 3UI3A 4OX7A 1I1GA 3POTA 3N6LA 3GBTA 2ERRA 3ZZZA 3LDLA 1RB0A 2H3EB 4DOZA 5GAHI 1VQPS 2MLYA 5KG6A 3O9RA 3DMJA 2CNKB 4CZCA 4ZVSB 4WK1A 2A10A 4B17A 5EU7A 3CETA 4ZITA 4GKKF 2RUSA 5K8NA 4OYBA 3VMFB 4BGAA 1L3TA 4DR1K 2LECA 3CCWA 4FLYA 1JJHA 1R0BG 4J9RA 1U0SA 3ZNUA 1JXEA 5JVGQ 1G99A 5GVQA 1VQNN 4JI3J 5B0AA 2UXDJ 1BY9A 3DOMB 3ITHA 1X4HA 4ELUA 2E29A 2ZWOA 3C94A 3Q23A 1ZA1B 1FNOA 2WAQD 2UUCJ 1Q82O 4OI4A 2GO9A 4ED1A 1J27A 4FNHA 3PYEA 1KLNA 3WQPA 2HGMA 4CJ3A 1O0PA 2DNLA 4ZLLA 5AQJA 2DR7A 4ANEA 1D1UA 2E9RX 3BSCA 1SUQB 4DLEA 4PQUB 3W0LA 4IWVA 1S1VA 3IS9B 4CZIA 1B7YB 3S3MA 4ZDNA 1N6QA 2W8KA 2KFZA 3NP5A 2OPQB 3L3UA 1SS6A 2ZD1B 2DT9A 1KAYA 5J2PB 4DTPA 3FCVA 4HDHA 3PSIA 2BR0A 1K44A 3N79A 3DRRA 1WG1A 3OL9A 4LR9A 1VRUA 1YJUA 2ZDPA 3DN9A 4M3RA 3LP1B 3U9ZA 3U9DA 5LMUK 1YJNN 3EWGA 5JVHQ 1GXLA 5IT9O 1VQ4N 1DLOB 4FK2A 1VMBA 3I56S 4BWMA 3FQLA 1FO1A 3CG7A 2E7VA 3EN9A 2NCKL 1SKWA 2CG8A 4RBUA 2VG6B 4O8UA 4DN0A 4IOBA 4RZRA 1AA1B 1VQSA 4I2QA 2BJ3A 4K8ZA 2J76E 2UXBJ 1S76D 3A0IX 1S6QA 2LQ8A 4QIGA 3KLIA 5C2GA 4CZFA 3EUNA 3SQ2A 1JL1A 3QATA 2HQCA 1KVBA 3E66A 2BM1A 2XS7A 3ZTPA 1ILYA 5M1PA 2Q6CA 4O0JA 4WPAA 1S0MA 4DUTA 2BM0A 1Z05A 4C0OC 5KT4A 4LVOP 5IM0B 3RVCA 3MPDA 1C6VA 1JCGA 1D9AA 2AP1A 2XB2D 1X4EA 1QVFM 4U6PA 2W7PA 2ZVIA 3EGNA 2XY5A 5LMNK 5F8JA 2QTDA 2VQEF 1NB2A 3MDFA 3UD5A 5I9EB 5J2MA 4H4MB 4V19J 4XPCA 2D0PA 2J7KA 1MW7A 3W2WB 2HURA 4H4OB 1DKGD 2K3KA 1KXPA 2I9SA 2FJBB 4E7KA 4JI7J 4DTUA 4CO4A 2F8TA 2H48B 4NL5A 3G6ES 4DV2F 1M1GA 1MWYA 3JSMA 1P90A 5F8IA 5MAOA 1P6TA 1IUJA 2RD5C 3QJLA 2BRKA 3VETA 4JNEA 1HBMB 3W8GA 2J4RA 3EZUA 2ITMA 3CD5A 3UCUP 4RW9B 2KFNA 1T3OA 2CZVC 2HKEA 1V5VA 4Y0FA 4DV5F 3F0NA 2CQPA 4EUVA 3LWMA 2BYCA 4BG9A 2CVIA 1OPIA 4JI1J 2VGNA 1NH7A 1FTCA 4AHTA 4KHSA 1SKUB 3MAQA 2IC3A 3BBCA 5EX0A 2OPPB 4AF1A 2G2YA 4M5GA 3MTKA 3QDKA 4DMNA 3OA9A 1P1TA 3QPIA 3THYA 2UV8G 1H7XA 4GMJB 1K1QA 1TUGB 2DGUA 3CF5L 3PYDA 4NXMF 2XCAA 2PIIA 4A8KA 1DTTB 4H0PA 2MKSA 1PJ7A 4USMA 4OLAA 1BISA 3D28A 1B0TA 1FEEA 2CNOB 2ZKTA 5IC6B 2XYGB 3F73A 1CSJA 4LF6J 3K0JA 2IVOA 1NUEA 4BACA 4AUKA 3VEYA 4NYPA 4USIA 3RB3A 1DRZA 4ED2A 3OW2R 2KZZA 3O9TA 4KGKA 1S57A 3BGRA 3TAPA 4RU9A 1VQMN 4FF2A 4ZMMA 3EY1A 3QMQA 5KT2A 3KK2B 4YOWA 2WONA 1BCOA 1VQLN 3CPWM 1M5HA 1GFWB 5L1KA 1ZM2A 2DGQA 2KB2A 1A5WA 3HBTA 2WC9A 1JLQA 2CNLB 1Z2ZA 2C42A 4WXWA 3RSEA 3ISND 5HMZA 3SQ4A 5GINA 2WHOA 2UU9F 3PKMA 3OUYB 2PD1A 1NGEA 4KHNA 4CEBA 3QMLA 1N32J 4B9MA 3UB5A 1V4TA 3QIDA 4E89A 1WSGA 1ESVA 3CCVN 4KHUA 3KLHA 5L1JA 4KIAA 2G2OA 2P51A 5L8RC 2A6OA 1JJ4A 3N4WA 1NHKL 2BOPA 1MLAA 2H1YA 4ZVOB 3QJPA 1WC3A 2V9KA 2FLNA 4DUZF 4FJKA 3UD4P 1S9GB 2IM2A 1RWUA 1FI4A 2WSEC 1I94J 4ISFA 3AY9A 3NNCA 2RPIA 5KAKA 3I6PA 2AJ1A 2RQ4A 4LBPA 2YNFA 3LGNA 1IBMK 1TR0A 3I4HX 4V19X 3GSIA 1FA0A 3DYAA 4NLUA 3ZTQA 1HNZK 2OTLS 5BPMA 2GVDA 4NXMJ 1KVCA 2R2UA 2IDOA 4DPYA 5HVFA 3MPYA 1BO5O 2OYQA 5ITHA 2ROEA 3KK7A 3J80Y 1RWMB 2V0NA 2RF2A 2DGOA 2YWGA 1WSJA 2HQGA 3CTRA 3V5RA 3OR1A 4ZCKA 3VV2B 2CH5A 1SKSA 1HBUB 1HUXA 5GAGP 1SB6A 5GIPA 5CYMB 5AQIA 1TELA 4CK1A 4U7UD 2AWZA 4LFBJ 4BRHA 1RT4B 2W2PP 1TK5A 2UXCF 3KWMA 1KC8O 5A8RB 2CJAA 4LSLB 1HD1A 4MT1A 3O2IA 3IG1B 4N47A 2OLWA 4S0MA 3R9LA 4XAKA 4BRFA 4G1PA 4XH5A 3KHGA 3R5BA 1U0HA 1TUWA 1Y7PA 2BW7A 4A8YA 2JEFA 2M8DB 2GX9A 3Q0AA 2QGFB 3S1TA 3RGIA 1M1KO 5A0YA 1AZSA 4P72A 3FSIA 2FB0A 5HANA 1ZTTA 2HQFA 4IR9A 1K8KA 1RDBA 1LWCA 2YNIB 3V4MA 4JI2F 1F3FA 1J2VA 2K06A 4OYOA 2VONA 5KFPA 3BEGB 1D4XA 3GIMA 1WG5A 2MSTA 4FK4A 1NOZA 1J53A 2GV9A 2NR0A 4CJFA 2EK1A 1KTVA 3TX8A 3R6GB 1QE1A 1YITS 3L7UA 1UWBA 2FJAB 5FRMA 4O3NA 3NGYA 2D0AA 4ILHA 4A8MP 1QY7A 3R1LA 2Y8WA 2RN2A 3MEKA 4ICLB 1BG3A 4CWBA 3IFRA 5AQXA 4F3MA 1WBBA 2W2QP 4E8UA 2QWMA 3T1HF 4ZN3A 4KFBA 4DV4K 4LF4F 1RHMB 2ZH3A 5H1SQ 2BXJA 3HJVA 1S9EB 4OJ1A 1UW4A 4ZVFA 2XYHB 4DR6F 4M45A 2JHEA 3TAMB 5KG1A 2KXFA 1WSFA 3H90A 1WUUA 3DXMB 2M0GB 3ZZTA 5F1XA 3AVIA 1H73A 1RABB 4YB1P 3U7JA 3H5YA 1T3VA 5CA5A 3EGVA 2F63A 2DK2A 3KHRA 2EKNA 2CIMA 2UXCJ 3K2PA 2WBMA 2P9SA 1TKTA 2AYEA 2LQJA 4Y2CA 2V7YA 1TAQA 1RDCA 2E5IA 5J1EA 1ELOA 5AZJA 3MM6A 3V1QA 1U09A 2P9IB 2YX7A 4OKJA 6AT1B 3T1YF 1F9FA 4KGVB 3M8PB 3ZX3A 3CGIA 1SJ4P 5KFNA 2K1RA 3FZBA 4YY3K 2DD8S 4K4ZA 1T9YA 4Z7YA 4OVLA 3JS6A 4WWSA 3W9HA 1Z6RA 2Y0SD 4PG6A 2RHQB 3J7A1 2QX0A 1WSHA 4C8MA 4X62F 1CLFA 3EPIA 3KLGB 2J7WA 4BY9C 2D7SA 2E2QA 3TR8A 4KH1B 2P9KB 3O9QA 4CIFA 4X4QA 4M63C 2XLIA 4HTUA 4I67A 1OVYA 3CCLN 3WUHA 1ASUA 2ACMA 2HNYA 3OPKA 1NNDA 4E7LA 2HWHA 4OYZA 2CQHA 4DR1F 4WFBL 1Q16B 2YX1A 3CEDA 2CJYB 4JS5A 2OP5A 4I2PA 1FDDA 2AW0A 4FPAA 1IQZA 2MQOA 2H3GX 2XULA 3L2VA 1PAEX 2F9TA 3SUPA 3WXIA 2CPYA 5KFBA 2FZCB 1MMDA 4RO0A 3FCWA 2HFUA 3BUZB 3KLFA 4DZDA 3SV3A 2XZWA 3RBXA 5AQSA 4C0HA 3EEQA 2YJFA 1MN9A 3SNNA 2H9ZA 3JTNA 1EP4A 3U3YA 3UN3A 4ZIWA 3F41A 4M5NA 3SSQA 4GW6A 4ZIVA 5CCMA 3AGRA 3L2QA 5ETTA 3SV4A 3ZSVA 4F0MA 5BYQA 1HYSB 1TL5A 1NK4A 2YPYA 1VQKS 5LSOA 5EWFA 4J7CA 3HFKA 3H3OB 3UVJA 4RBTA 4Z4IA 3T1YJ 3UN5A 4IG3A 5LM7E 3TUZC 3AVKA 1Q95G 2MHEA 4FYWB 1BL3A 5LT5A 1UJ5A 4NYOA 1B99A 4DR2J 3CJKA 2VD3A 5LMUF 2VWJA 1T9XA 1CXQA 4NLCA 2ZHAA 1WF1A 2Z1HA 1RE1B 4G9ZA 4YOVA 1X8DA 3AQOA 2VOOA 4O3OA 1N4LA 2D0OA 3T6JA 1SH0A 1HWKA 1XR5A 2ZBPA 3ENWA 3DOLB 2V52B 3LDQA 3UE2A 4ELVA 1R0AB 3SLCA 2CADA 4BQLA 2WB1D 5I42B 4J9VA 1VHFA 5KRTA 5I3UA 2F9WA 3OBIA 4FWMA 2H4YB 1I3AA 4JKEA 2KN4A 4HUGA 4TNOA 4MKAA 3KK3B 1C0UA 4K5SA 5HRPA 4ECWA 5C5JA 4ED0A 5LMNF 2O1PA 2CPEA 4KB1A 4P71A 2C2NA 1VQPN 2FD2A 3SPYA 1KOOA 1TYQA 5ETNA 3IXQA 5A6WA 4Z0UA 3F5TA 4G1QB 2GTDA 1VLYA 4DR4F 5EY4A 2JVRA 2ILYA 4IFYB 4JI4K 4ZPVR 3CMEN 5SZTA 1GLLO 2OELA 4DQSA 4UOGA 3NS7B 1JL2A 3PJWA 2J9DE 1F3VA 2Q3PA 1V6HA 3BY5A 4QS8A 1IG8A 2QWLA 1NZAA 3RR8A 2QL5B 4NLTA 3UR0A 2W4DA 1S12A 3AAWB 5ETQA 5HMXA 2IRUA 1S1WA 4O0NA 3U8XA 1SC4B 5L38A 2KVIA 3KMSA 3VEXA 3J7AN 2PI5A 2APOA 3G6YA 2UV8A 3C65A 4KH6A 3Q8VA 3BB5A 1PC4A 1XMOK 2V50A 4MAKA 1KQKA 1KKHA 2IS3A 4TYAA 5E3PA 4RW7A 2RS2A 2I5JA 3FRYA 4WFZA 1UVJA 1VJWA 2ZEJA 1V4SA 4ATNA 1JK9B 5DM7L 2ASDA 2J9EA 3ZTRA 5M2UA 2VFSA 4IFVB 4CNYA 3H1QA 2MQ8A 3KJNB 1PJ6A 1WC4A 3IP0A 3SCLE 5HO4A 2PBDA 4B9VA 4DDFA 2GCFA 4QIWD 1KLMB 2CQCA 3E51A 2VBWA 5DG7A 3GFXA 4F36A 2Y1JA 3JXUA 4JKAA 1SXLA 4FM1A 3P38A 2LEPA 3BQ0A 3R3TA 2UUAF 2DEIA 4C8NA 4UTGA 1HR0K 3FZ2A 2LDYA 4XTTA 1NLKL 3HO1A 4AD6A 2ZC4A 4Q2MA 2VG5A 3MR2A 2M4MA 4TLRA 1X4GA 3ENVA 3KG0A 2PO4A 2GGPA 2P9NB 1MWKA 1TKZA 2XRIA 4LF7K 1TVRB 2K3IA 1JCFA 1VHIA 2ZOFA 3C19A 1AFJA 1FWPA 3MCAB 4H8KA 4RTFD 1W7AA 4ZP7A 1RHJB 3HSDA 4C8OA 4EYHB 2CQDA 2MKJA 2R7RA 2ASYA 1HI0P 5EXWA 4F02A 2BBEA 3P45B 1VK8A 3RG6A 2XSJB 3PZPA 2AA4A 3F9KA 2HBYB 3TQEA 3K5LA 4F8RA 4KI6A 4JI8F 3E9PA 2C3OA 4LR8A 2E4LA 4U67L 1Y9OA 2LXUA 5C25A 4CHNA 1LV5A 1FNMA 4ZCIA 3T69A 1RTHA 1H0HB 1T7PA 1SKRA 2XCPA 4F04B 1F0XA 3KG1A 4DPXA 4CM0A 1EQ0A 4L3NA 1FX2A 3VR1A 2NQPA 2PFUA 4PPZA 3ENOA 3G6EN 1IM4A 1Y3KA 1WHYA 2R3VA 5DJBA 3X1LB 2DCLA 4DV6K 4K43A 1J5EJ 2XZTB 4FVUA 1X7VA 4NA1A 4CERA 2JZ5A 3GCWP 1C1CB 4ID5B 4KTWA 2FSNA 1GQEA 1IBMF 3OXGA 2ZQBA 2EFGA 1G6BA 3M8ZA 1DTQA 2MSSA 3CD6N 3MM7A 4WZMA 2QXFA 1HNZF 3JSBA 3N4PA 3N6MA 2QMWA 2DRDA 3RJMB 2GVZB 2L9WA 4ISGA 4LF5K 2HK2A 1RK8A 2UUAJ 4J2DA 3QIPA 2VKRA 1RHKB 1Y00A 3RUBL 1WNSA 4P2MA 4CF2A 2ZJRQ 2RKIA 1WWHA 3MN6A 5HRRA 1I5OB 5AJ3K 1BMQB 4YDDB 3I0RB 1FRJA 5IT9U 5ETKA 2Q3SA 2OMLA 3L4QA 3PCOB 3PLAA 3N01A 3DLKB 3KK1B 2IGIA 3TI0A 3SBMA 2CJ9A 1B3TA 2ZGZA 1RJJA 2ROPA 4OFZA 1M5OC 4YR3A 1REVB 2RMLA 4UQGA 4X4NA 2X74A 3EGWB 1Y4ZB 3CW2C 2ZGYA 2JSXA 2B4UA 4MKYA 3ELHA 3KJQB 5H9EK 5AQZA 4A57A 2CJXB 3M8QA 2B5JA 3OHRA 2VFVA 3W61A 4DSIA 1XNRF 2EXUA 3HKWA 8RUCA 3R97A 4P9SA 2NRWA 3TP2A 2Y0BB 4DU1A 4J37A 5SWMA 5T7LA 5KQDA 1TL7A 3QLHA 2P9UB 5IXUA 1LW0A 1EETA 3WHIA 4JV5K 4HLBA 5DDQC 4BC7A 4WFNQ 3HFVA 1U1NA 3VQDA 4WTYA 5IQQA 2C2OB 4KTQA 4B9LA 2DTUA 4C97A 5IS2A 4LSNB 1SH3A 3PFEA 2DNMA 1UETA 2V7ZA 2YHWA 1T8EA 1RT1B 4IO8A 1EKEA 2F4VJ 5AQFA 1HNXF 1UFKA 4E1MA 4GVBA 1KRPA 3T5HA 2XSFA 3O1WA 1E6VB 2A5XA 4P2FA 4DFKA 3DOMA 2LLZA 3GJQB 3IA0A 2L41A 4B3RK 3VQTA 5DS7A 2YQ0A 2DGXA 2Y1RI 1CZ9A 2FXUA 3HT0A 3DXBA 2CQ2A 4YOUA 2PC6A 3EE3A 1MU2B 3UKRB 1QSLA 2UVVA 2BUNA 4OV6A 3OS1A 2CAJA 4BRCA 4PR6A 3SCJE 4ZHRA 3SPZA 2VBXA 1RYSA 1T9VA 2DR5A 3P8BB 3LL3A 4AHSA 1N33F 4PQUA 1N5VA 4NLVA 3VQ9A 2BJ1A 3G87A 1NHUA 4JRPA 5A6PA 3IS9A 3PJXA 1OKJA 4HH1A 1RTIB 1FVSA 2RDIA 3HSCA 3MWPA 3G96A 1MMLA 2GELA 4X64K 3Q8YA 1C0MA 3FUYA 3I96A 2XG8A 5J2PA 2NXUA 2H4WB 4RWTA 3HSJA 5M1FA 4IJAA 2HSTA 4OHYA 2ZM6F 3GIKA 2MZSA 2PI4A 1RWKB 4YHHK 1WEXA 2YKOA 1NM1A 3MAAB 4X4PA 1EARA 3L2RA 1NCLA 1XNRJ 2KKHA 1U1OA 1DLOA 1ICEB 3IBFB 3AA4A 1ZC6A 1GOAA 4PG8A 4AXIA 2QA2A 4J9SA 3A8IA 1VQ9S 2A3JA 4KHPJ 2VG6A 5KFIA 4NXNK 3MXJA 1ULRA 3LOUA 4BDPA 2MLXA 2VWKA 4DTNA 3A3NB 4UUWA 2AYBA 3P3DA 4ITSA 3M2VB 3GILA 1UA1A 2A1BA 1FRIA 1VQ8S 3O9SA 4U8VA 3RBZA 3ZSWA 4L76A 3O1BA 4WF9L 1XWLA 1U02A 5IT4A 3H5XA 4CJPA 1NJWA</