4H4OA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 141
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4oA05
4GC6A 3VQ7A 3HHKA 1XHXA 5KFUA 5KRSA 2RPIA 1TV6A 2YKMB 3V81A 3VQ6A 2IGIA 4NLWA 3TAFA 1L3SA 3V6HA 2WOMA 3KJVB 4DL2A 4M3TA 3RAXA 3M9NB 4O44A 1CSJA 3RRHA 1S1TB 4IH6A 2W7OA 1HQUB 4B8AB 2O4IA 3LP2B 3DYAB 2IM1A 4O3QA 1KVCA 1NKBA 4WE1A 2F96A 4O4RA 5JS1A 3OJSA 4DSFA 5KG3A 3RMCA 1FXXA 2R2RA 4OLBA 4NLUA 3SNNA 1NK0A 4DTUA 4FJXA 1HNIB 3IGNA 4J9SA 3SUQA 1LW2A 2JGUA 1C0TB 2BGGA 1LAWA 3HK2A 1C1CB 3OSNA 1RYSA 5J1EB 2RDIA 2A1RA 3Q8RB 2IM3A 1S1XA 3AV9A 5J2MA 3PHEA 1RBVA 2IC3B 3GILA 3HYFA 3AA2A 3OYNA 1X9SA 2HB5A 4NLGA 5KT3A 1TKXB 1VSJA 4ECRA 3CM5A 4ZVFA 1LW0A 2B6AA 4J9MA 3GV7B 3LWLA 1VK0A 3CO9A 1EETB 2YNGA 5KG1A 4RW8B 4F4KA 1MU2A 1S9EA 3V1OA 4HCCA 1BISA 3HT3A 3CDUA 4HYKA 3QGIA 2XY5A 1A5WA 3DI6B 4Z4EA 4ECVA 2XGQA 4BDPA 3RB3A 2J6TA 4OGEA 1KHVA 4ID1A 4AHUA 5KTQA 2O4GA 2G8FA 4IR1A 4M42A 3SQ0A 3KLHA 2YHAA 4IFVA 3ISNC 4YQWA 2R2SA 2HHWA 1A5VA 3H2LA 2WB4A 4AHRA 1SKWA 2IBKA 1R0AA 3O3HA 3MF5A 1JLCB 4H8KA 2P51A 1SL0A 5KFXA 3OY9A 1N5YA 2DPIA 3QNNA 3QNOA 4CJSA 5EU7A 1Q8IA 4R8UA 2EHGA 1RT2A 2IM2A 1JXEA 2W9CA 4DU1A 1X9MA 2IAJA 3LANA 3TAGA 4IDKA 3V4IB 1GOBA 3PW7A 5I3UA 1TVRB 4KV8A 5HP1B 5KFVA 4B9NA 3VQ9A 4E89A 4DFJA 3PX0A 3T1AA 2E9RX 1T3NA 1L3TA 4LSLA 3PW5A 4EP5A 4FXDA 5KFFA 3QESA 5KFSA 3DMJB 2Z1IA 3SCXA 4DS5A 3EPGA 4DL7A 3GIJA 4B9SA 1ASWA 5DG7A 4J9NA 3HPOA 1RTHA 2DY4A 2FJXA 1JLEA 4CFAA 5KFNA 4CJTA 4IFYA 4DTRA 3IS9B 4FK2A 1RT5A 3CJ4A 4M45A 4FJ9A 4DSLA 3OL9A 5HBMA 1JKHB 1KTQA 5KFGA 1IG9A 4N56A 5T14A 3LP0B 1U48A 3ZT1A 2C22A 2AQ4A 2RKIB 3EYZA 3DRSB 2W9BA 2D0CA 4QWAA 4EEYA 2QXFA 4H4OA 4MFBB 4KRFA 1N48A 1RT4A 4NLVA 1RT3A 4B8CA 3RWUA 4G1QA 2AWZA 2UUTA 5DQIA 4LSNA 1KVAA 5KFMA 5HLFA 3QO9A 1ZTWA 2YNFB 3TAQA 1BIZA 3AVLA 2OPPA 1SL1A 1S4FA 4K8XA 4KFBB 5KFYA 1LWCA 1S1WA 1TKTB 3GIKA 2QKKA 3OYFA 3DM2B 1C1BA 3DLBA 4FJ7A 2WTFA 2V0NA 2F8TA 2HHTA 1K1QA 2XWYA 1L3VA 4E1NA 1L3UA 4ZP7A 2ETJA 3KLGA 5JS2A 1TL1A 3L2UA 1SUQB 3LWMA 4IKAA 3QGGA 4JV0A 1Z4UA 2R8GA 4B9MA 3LP3A 5HRRA 3B6OA 5C25B 4ZPBA 4EYIB 4NYFA 2ATQA 5KT5A 4QWDA 4WXOA 3HJFA 3OS2A 3KJVA 1TV6B 4F3TA 5KT2A 4RNNA 1Q9XA 3JYTB 4CJRA 4H54A 3DDKA 3GV5B 1HQUA 1VSKA 3V81B 3DYAA 3C6UB 4J2BA 1IKYB 2XY6A 3TAMB 3QZ8A 4CJPA 3H40A 1B9FA 5DGBA 4BWJA 4KHNA 3DLGB 1HARA 1C0TA 3FDSA 2HAIA 3OYAA 3OL7A 5J1EA 1BQMB 4BE2A 1A5XA 3E01B 4ZMMA 2IS3A 5SWMA 3SUNA 4DTOA 1NKCA 1RBRA 1N6QA 5F8NA 4RZRA 1GOAA 3DOLA 3AVJA 2IC3A 5KFJA 2FLNA 3KKSA 4LD0A 1I3AA 4CJKA 3LPTA 5KGXA 1ZBFA 3T5KA 2HNDA 2Y1IA 1U45A 1TKXA 3GIMA 4F8RA 1S10A 3AO3A 3V1RA 3OYMA 4MIAA 5KFOA 4TSXA 1IO2A 2J6UA 3TI0A 1EETA 3L2QA 1WSFA 4LY7A 4J9RA 4RW8A 4E3SA 4EBCA 5FROA 4M41A 3M8RA 2D3ZA 2IJFA 5KG7A 3OL8A 3RMBA 4OKKA 4CJ5A 3DI6A 1QSYA 1HNVB 3HPHA 3OVNA 2HHQA 3ZT3A 4ELVA 1S9EB 3T19A 4J2EA 4YR2A 1QQCA 1ASVA 2C2EA 4HVJA 4WFXA 3G0ZA 1NK8A 1HPZB 2G8KA 3AA3A 3RB0A 4BWMA 2OPRB 3RMDA 4EO8A 2I1RA 4GVMA 1JLCA 5KG5A 4FJ5A 2AX0A 5D3GB 2UVWA 4J9OA 4WZMA 1WSGA 5KG2A 1O1WA 4Z0UA 5KG0A 3BGRB 1S1UB 2GC8A 4RW4B 1VSMA 5KFTA 4CGHA 4CEDA 1D9DA 4FZXC 1NKEA 3V4IA 2BR0A 1VSLA 4CGFA 1ZBIA 1G15A 2EC0A 4KHUA 4DL4A 4N76A 5J2QB 4DF8A 2CKWA 3QGHA 1J9AA 5KG6A 2HHUA 1TK8A 4ECWA 4DU4A 3MEEA 4KV8B 5FDLB 3OYEA 1JL1A 3MTKA 3QIDA 4CJFA 3DMJA 5I42A 1UA0A 4ED2A 3OYKA 2QK9A 2D7SA 1TK5A 4TYAA 1MMLA 3CYMA 4FBTA 3CWJA 2AGQA 4AHCA 5F9NA 3NL0A 4IG3B 4ZP9A 4DSIA 5KFRA 3IS9A 2C28A 3M9OB 2IDOA 3DLRA 1JKHA 5EWFA 2XRIA 4FLTA 2HNZB 2HNYB 3LP0A 1RT5B 2JC0A 2RKIA 3KHLA 4Y1CA 3DRSA 4ECXA 4ECUA 4JV1A 4OJRA 3OYIA 4C8KA 4MFBA 4EZ6A 4CEZA 4MK9A 1HRHA 3HM9A 1N4LA 2W9BB 4M94A 3SQ1A 5FRMA 2JEFA 3V6JA 3RR7A 4Q8FA 2YNFA 2R8KA 4G1QB 4E7IA 4JS4A 5CYMB 4L8RB 2KZMA 4KFBA 3NGZA 3KHHA 5KFKA 4FLXA 3T3FA 4DFMA 4FLUA 1TKTA 3KLFB 4DL6A 3RB4A 5KRTA 3OYJA 1SH0A 1TAUA 4MKAA 3DM2A 2B43A 1I6JA 2XC9A 4HUGA 1S1WB 1ZBLA 1QSSA 4FBUA 4WZQA 3PX4A 2BQRA 1SKSA 1HMVA 1SUQA 3CQ8A 3D5MA 4NLDA 3TAPA 3PR5B 3C6TB 4CF9A 2BANB 2W8KA 4MH8A 3KLGB 4ICLB 4CJVA 4FVMA 4URQU 1QAJA 2VA2A 3RRGA 3SI6A 1DTQB 4FK4A 4CJLA 1EKEA 3HP6A 3KK3B 4E7HA 4CEOA 5L9XA 2Z1HA 1JLAB 3NAEA 1TKZB 1S6QB 3AVKA 3PJXA 3JYTA 2GIQA 3MAQA 4H4MA 4O3NA 3C6UA 4DLEA 1IKYA 1RBTA 3K5LA 1C0MA 3TAMA 1CLQA 4ELUA 1Z25A 3KMSA 3T5JA 3G86A 3QYYA 1ZBHA 2G8IA 1XHZA 4U7CA 3VQCA 3KLIB 3DLGA 1XWLA 3S9HA 3ASMA 4NLQA 3CFPA 3NGYA 5L1JA 2FJVA 1Y97A 4Z4IA 1BQMA 1GX5A 3PR4A 3E01A 4B3OB 3NF9A 1HQEA 3AVHA 3NMAA 2GUIA 1XI1A 2VG5B 3H5SA 1W0HA 2ITGA 1D5AA 4DTNA 2X6NA 1QUVA 4OPKA 4J9QA 3NAIA 5KT4A 1N6QB 4FJ8A 1UWBA 3IG1B 3DOLB 1ZYQA 1Z26A 4I9LA 3ULDA 4Q45A 4YNQA 4CHNA 2XY7A 3TWHA 1FKOB 4Q0BA 1ZBUA 1NK4A 4FJJA 2KFNA 4LQ3A 3NGIA 2HNDB 4NLPA 4NLTA 2YHBA 1T7PA 3IN5A 4DMNA 4FLVA 3P83D 3WNGA 2JEIA 3MR3A 1K6YA 1I39A 3VA3A 2XGPA 4ED6A 5DQGA 1HNVA 4ZPCA 3HL8A 4HKQA 5HROB 4J2AA 4FZYA 1SV5A 1FKPB 3BSNA 1HPZA 1RBUA 4ED3A 4FJKA 4ZP8A 1NNDA 2OPRA 2PZSA 5KFPA 3NBPB 2D3UA 1TP7A 3U3GA 4F4XA 3IAYA 4JUZA 5D3GA 3AO1A 4EBEA 1WLJA 3NF7A 4FJIA 4CHZA 1C1AA 3BGRA 1S1UA 1RTIB 4YMEA 1VSDA 3AVAA 2P5GA 3QIPB 3VQ4A 3AVCA 1VRTB 4E1MA 4XIUA 4RW4A 2I5JB 4DG1B 3N6LA 4CERA 2OPQB 3CJ3A 4O0JA 3N6NA 4IRKA 3QLHB 3SYZA 4ZTFA 4K4XA 2RF2A 4ECSA 3ZSWA 3M8SA 3LZJA 1JIHA 5F8IA 4DTSA 4CJEA 4CIFA 5J2QA 3SUOA 3I5AA 1UA1A 4IR9A 2P5OA 2BQ3A 3MEDB 5FDLA 2FBVA 3SI8A 1SL2A 1SH2A 3AA5X 4KKOB 5KFEA 2XCPA 3PV8A 1NOZA 3MEEB 3I5CA 2ZKUA 4DSEA 3TANA 5I42B 2FBTA 4IG3A 4UQGA 2R8HA 4QW9A 2BE2A 3Q8SB 4KHWA 3L2RA 2YNIB 3HVAA 1EX4A 3DLEB 3PJWA 1WNEA 2P1JA 2HNZA 3RBDA 2HNYA 4ELTA 3UPFA 3AO4A 2IMWP 3OYDA 3UQSA 5DG9A 4IQXA 1QHTA 4W5QA 3AVFA 3LPUA 4J9KA 1X1PA 3MXIA 3LP1B 3NGDA 4XPCA 4KHRA 4DSJA 1UOCA 4AILC 4W5NA 1NJWA 1TGOA 3O3FA 4TXSA 1RTJB 1RA7A 2G8UA 1CXUA 4ECZA 3K5NA 5CYMA 1S49A 3TABA 2UVRA 3M8QB 1RT1A 4RW9B 5F8GA 5KT7A 3HO1A 4I2PB 3I0SB 3Q8PB 3H59A 3KLFA 4Y2AA 1J54A 3NH2A 4OKEA 4DFPA 4IBNA 4QW8A 4DF4A 1RCHA 4FS2A 3MECA 1JLQB 2YNHA 4N41A 4ED8A 4M3UA 2WONB 4NCGB 3KK1B 3JSMB 4FJMA 4DU3A 2BDPA 3C6TA 4MKBA 2BANA 4CIGA 3M8PB 4K4WA 1HMVB 3PY8A 3SJJA 3KLEB 4ICLA 3Q8QB 1KVBA 4FCYA 3QEPA 4FLWA 2HHXA 4ECQA 3DRRB 3ZCMA 3SV4A 1DTQA 4PA1A 4KHYA 3O4NA 3KK3A 4R0EA 2R7YA 2AU0A 1NJXA 3NF6A 1JLAA 2LSNA 1TKZA 1S6QA 4O3PA 4ED0A 1ZETA 1L5UA 2Z1GA 3ZSQA 1D8YA 3NAHA 4HCBA 4H4MB 3VQAA 5KFLA 3I8DA 4WFYA 1C0UB 2D41A 3OS1A 4CESA 4ZVGA 3KLIA 1KCFA 4ZPAA 3VQSA 2YKNB 4DQSA 4C8MA 1BI4B 4KAIA 1RNHA 3NF8A 4IOBA 3KLVA 4B3OA 3KHRA 4KO0A 4F2SA 4Q43A 5CZ2A 4BE0A 3F9KA 4ZVHA 2VG5A 5KFZA 4J9PA 3K2PA 3PVXA 4G3IA 4OPJA 3VQBA 1S1VB 1S0OA 3NDKA 1NOYA 1HQEB 4CGIA 1JLFB 2FBXA 1YVFA 3IG1A 2UVVA 2A1SA 2KQ2A 3P5JA 4O3SA 2IA6A 1FKOA 5F8JA 1JXBA 4DFKA 3HVWA 2G8VA 2WRMA 1UWBB 3CM6A 4IRDA 4CK2A 4BDZA 3D28A 5CZ1A 1NK9A 4Q0BB 4F4WA 2UVUA 4RUAA 4I2QB 4FYDA 3PX6A 1BHLA 5F9LA 3LALA 3MR5A 4KB7A 1JXLA 1QSLA 5HROA 4HUFA 3WNFA 3RTVA 1QTMA 5HRNA 1S9GB 4FK0A 1BIUA 4ZPDA 1FKPA 4F3OA 5L1IA 3GIIA 3SPZA 1X9WA 3ZSRA 3BSOA 3O3GA 1HYSB 3NBPA 3RR8A 2ASLA 2VWJA 1SV5B 2EX3A 3PW2A 1WSEA 3B6PA 2D0AA 1WAFA 3CJ0A 2OZMA 3GV8B 5KG4A 4HUEA 4TYBA 4DSKA 3VQ8A 2FBYA 5T7BA 1RTIA 3D0PA 3BSAA 3QIPA 3K57A 1VRTA 3KK2B 2GBZA 2KW4A 3C94A 2I5JA 4DG1A 4EYHB 2OPQA 1GOCA 4C8NA 3L8BA 5J2NB 4K4SA 3QLHA 5DG8A 3ZSOA 5EUHA 3KKRA 2XHBA 3H5XA 4PQUB 4YP3A 4KPYA 4OVLA 4KHQA 2RF2B 3DOKB 3MEDA 4XPEA 2O5DA 2AX1A 4DQQA 2Z1JA 3ICLA 4W5RA 5FRNA 3AVMA 3NFAA 4CF8A 1RDBA 1T03B 2DFFA 1RDAA 4KKOA 2BQUA 2QKBA 5F8HA 1EP4A 3G10A 3T5LA 4Z4CA 4NCAA 1B92A 3QZ7A 3IGVA 4E0DA 3KTQA 3TR8A 2YNIA 2NUBA 4DQPA 1RTDB 3DLEA 4Z4HA 1IM4A 2ILYA 1RAJA 3DRPB 4Q44A 2IJNA 3CIZA 2XI3A 2BE2B 5EWEA 3PW4A 2CJQA 4FZZA 5DMRA 3O4QA 4WYWA 3G6YA 3OYLA 2F8SA 2HVIA 3CDWA 1RYRA 3BREA 3VN5A 5SZTA 2Y1JA 2UUWA 3I5BA 1RT6B 3TAEA 2X78A 2E4LA 3OL6A 2JC1A 4IRCA 4JRQA 3LP1A 1WSJA 4FJLA 1WN7A 1RTJA 1NJYA 1Q9YA 1WSHA 1T05B 3OYBA 3M8QA 4RW9A 3SZ2A 3NH1A 2QE5A 4I2PA 1IKVB 3I0SA 1JLGB 4NLRA 4NRTA 2ASDA 2PYLA 3BJYA 5KGWA 1RT1B 4RUCA 1BQNB 3AO2A 1BL3A 1JLQA 3L3VA 2WONA 4NCGA 4E19A 3QERA 1JLBA 4CJQA 5HRPA 3KK1A 2HWIA 3SPYA 3JSMA 1ITGA 2DFEA 3MECB 5KFAA 3WNHA 2YNHB 3NH0A 3M8PA 1KSPA 5CYQB 1JL2A 4KE5A 4M3RA 3KLEA 5DLGA 2JLEA 3QIOA 1CZBA 3DRRA 3QEXA 3I0RB 3CJ5A 2E9ZA 4M3WA 5KFCA 2FC0A 2JEGA 3FQKA 4EO6A 4IKFA 3FRZA 4Y34A 4KTZA 5F8MA 4RU9A 2R8JA 3CG7A 4BACA 4IH7A 3P1GA 2B5JA 1U09A 3AVBA 2KZZA 1WNSA 4K50A 4O55A 4K4UA 4M3XA 4B08A 1C0UA 4TLRA 2OH2A 4E7LA 4NLYA 4ECTA 4Y3CA 4F50A 3VQQA 2YKNA 1BI4A 2VWKA 4ZVEA 3QEVA 1OS5A 4JLHA 1NHUA 4RW7A 3S3OA 4W5OA 3RB6A 1S0NA 1S1VA 1C2PA 4KO0B 2V9WA 2XCAA 3ITHB 1JLFA 2FVCA 3RMAA 4M3ZA 2OPSA 1LWFA 2FJWA 3OJUA 3QEWA 3MXMA 5K14B 1LV5A 2HHVA 2R2UA 1TK0A 2HMIB 2X74A 4RNOA 4CF0A 5C42A 3CDEA 4CGDA 4GMJB 3OSPA 2WHOA 1KLMA 3OS0A 4I2QA 4PUOB 4KB0A 3NKYA 4FM0A 4E7JA 4NLSA 4CK3A 2F8EX 3H98A 1J5OA 2AGOA 2ILZA 3PZPA 2ASJA 3KD1E 4CJWA 4XO0A 3WNEA 1S9GA 4OGCA 1D1UA 4X2BA 5E41A 4FS1A 4Z4GA 2E6LA 3G6XA 3C95A 1HYSA 1NK7A 3H5YA 2FLPA 1C6VA 4BE1A 1FK9A 3L2WA 4DTMA 2VG6B 4K4YA 2DFHA 3V6DB 2XO7A 4R5PB 4DWIA 3FSIA 1VRUA 4GW6A 1IKWB 2ZD1B 3KK2A 3KD5E 3LZIA 5DQHA 2V4RA 1JX4A 1DTTB 3MXJA 4KAZA 5J2NA 3M9MB 1IKXB 4CIEA 4O3OA 2FVRA 3HSTB 3BSCA 3S3MA 4CEQA 2VG7B 3AVIA 4DL3A 4PQUA 3HXMA 3ZT0A 1QE1B 3TVKA 3AA4A 3DOKA 4DS4A 4FM2A 4QCLA 5DLFA 3HKWA 2J6SA 2XI2A 1RILA 1NK6A 3UR0A 3H4DA 1J53A 1T03A 4N5SA 1VSIA 4MQ3A 3NCIA 3V9WA 4AH9A 2ATLA 4CEFA 4ID5B 4Y1DA 3V1QA 5C24B 3V9XA 1VSHA 1SKRA 4DTXA 4EZ9A 1W25A 3V9SA 1RA6A 3H5UA 4KHMA 2AJQA 3VQPA 4CEEA 2B4JA 1EP4B 1RTDA 1YTUA 2R2TA 4AHVA 2ZE2B 3DRPA 4CFCA 3ZSVA 1U4BA 1U49A 5JUMA 4ED1A 1S0MA 4JS5A 4MIBA 4O4GB 3KOAA 1HJRA 4MK8A 4K8ZA 4DQIA 1S6PB 1KRPA 3AO5A 4CJ4A 3NHGA 1LAVA 3OYGA 1CXQA 4URSA 1RT6A 4B9VA 1DLOB 3KMQA 3CFOA 1RDDA 4C8LA 4B9UA 2WCXA 1YVUA 4I7FA 5KFWA 5HRSA 5EDWA 5J2PB 1XR7A 4EBDA 1T05A 3DLHA 1REVA 1IKVA 3ALYA 1JLGA 4RNHA 3VQDA 3QEIA 1YT3A 1BQNA 3MEGB 1T94A 3AVGA 4QAGA 3MFHA 4CGGA 3K59A 4WXWA 3PUFA 4RW6B 2HW3A 4Z4FA 4CK1A 4PWDB 3FFIB 1BCOA 4CF2A 1VSEA 4IG0B 1ASUA 5F8LA 4CEAA 4EP4A 3H08A 4CECA 1RDRA 2FLLA 5CYQA 2GV9A 4IH5A 4TY9A 1JLBB 3MR2A 1IH7A 3HVTB 3BQ0A 4KI6A 1LWEB 3KHGA 4LH5A 2PY5A 4FW2A 1NHVA 3I0RA 3ISND 4CE9A 4TY8B 3UIQA 5KT6A 2KFZA 5JXSA 4FLZA 2QV6A 1B9DA 3ZSXA 4AHSA 4OL8A 1D9FA 3HP9A 2ZQBA 2W8LA 3LAMA 1KFSA 1RT7B 1YTAA 4J9LA 4RNFA 1TL3B 3BQ1A 3TARA 1F21A 3TQ1A 2B5JB 1EXQA 3S3NA 3K5MA 4HTUA 4Q5VA 1S5JA 4K4VA 4K4TA 3IRXB 1TKDA 4ZHRB 2YKMA 1U04A 2IM0A 4K4ZA 4DL5A 3DLKB 1KLNA 3E51A 4CEBA 1N56A 4BDYA 2KTQA 2HWHA 3RAQA 4RNMA 4DTJA 4DTPA 2C2RA 3L2VA 2YV0X 3ITHA 4RW7B 4LQ9A 1S1TA 1D0EA 1WAJA 1GX6A 3LP2A 1QAIA 2WOMB 3ZSYA 5K14A 4B9LA 4O44B 4ECYA 3BR9A 4F4YA 1KFDA 4TQSA 4RG8A 2HMIA 3CFRA 4DLGA 2OPSB 1LWFB 4WYLA 4M95A 1HNIA 4WE1B 2FVQA 4PUOA 3AVNA 4PY5A 1C1CA 2FVSA 1ZTTA 5C42B 3V6KA 4ZP6A 3EZUA 2OA8A 1KLMB 1LW2B 4NCBA 2C2DA 1CZ9A 4CFBA 1VSFA 2X6SA 1J5OB 3BDPA 1HYVA 2IOCA 1S1XB 1K1SA 2VA3A 4CJUA 2JEJA 5J2MB 3ZSZA 4CJ3A 3V9ZA 4HHTA 5EWGA 3GQCA 2VG6A 4FM1A 2RN2A 4QPXA 3V6DA 4CHPA 4F2RA 1LW0B 3KNAA 4DQRA 1FK9B 2B6AB 4R5PA 3OLAA 3T5HA 4Y2CA 1IKWA 2ZD1A 4KB1A 4M3YA 1W9HA 3U6FA 2YNGB 4DEZA 2OZSA 3ZT2A 3CVKA 4U6PA 1MU2B 1DTTA 2G8WA 1IKXA 1VRUB 4B9TA 1BCMA 4TQRA 3HVRA 2VG7A 4YR3A 2ALZA 1XR6A 2GIRA 1SH3A 1HYZA 2DTUA 1QE1A 3THVA 5KFIA 4CHYA 4OKJA 1NJZA 3KLHB 3UDLA 4IFVB 3EY1A 1TAQA 4CCHA 1UAXA 4GC7A 4W5TA 3K5OA 1R0AB 2FVPA 4ID5A 3U3YA 5C24A 3HPGA 3SUPA 3BQ2A 1QS4A 3OYHA 4CHQA 3RBEA 4FJNA 1XC9A 1N5YB 1RBSA 3A2FA 3SFGA 3NE6A 2R8IA 4NYZA 4Q8EA 3H4BA 5L1KA 3QINA 4CGJA 2ZE2A 3OYCA 4R8UB 1RT2B 4E7KA 3OLBA 4F4ZA 1TVRA 5HP1A 3L3UA 1BGXT 3D45A 4QWBA 2W9CB 5KI6A 1S48A 3EPIA 4KHSA 4O4GA 2IAJB 4KTWA 3PW0A 5KFBA 4IDKB 4JRPA 1S6PA 5I3UB 1TQLA 4ZTJA 2WK4A 4ED7A 4LH4A 1DLOA 2W42A 1KHWA 2V4QA 2W7PA 4YFUA 4KSEB 3LDSA 4LSLB 2HVHA 2XY8A 3MR6A 4QWCA 4NLOA 2D0BA 3LAKA 5J2PA 5CY4A 2E9TA 4I7FB 1RTHB 3G6VA 3SQ4A 2G8HA 4FJGA 1JLEB 1S97A 4IFYB 5KFHA 1NK5A 1REVB 3N6MA 4CHOA 3MEGA 5HBMB 4RW6A 3VA0A 1T8EA 3MFIA 4CF1A 4PWDA 3FFIA 5KFDA 4MK7A 4KBIA 4NLXA 4IG0A 3PO4A 2DPJA 4O0IA 4H4OB 4KREA 3QETA 4O5BA 3VQ5A 3K58A 1RT4B 3OHBA 3SV3A 1RT3B 1WSIA 1XR5A 4FLYA 2PYJA 4C8OA 3HVTA 2BRKA 1S9FA 2D5RA 1LWEA 4AHTA 4LSNB 2AGPA 5HLFB 4TN2A 4NYNA 4JV2A 3QO9B 3F73A 4NZ0A 2RDJA 4TY8A 3KIOA 4KI4A 3FQLA 2OPPB 5C5JA 3CJ2A 3SFUA 1LWCB 4CFDA 2OYQA 4QOZB 3SQ2A 4FW1A 4J2DA 2W9AA 5DK5A 3V9UA 3ZT4A 4WFZA 3PO5A 1C1BB 1RT7A 1TL3A 4O3RA 2Q3SA 3VQEA 1U47A 4OLAA 4FJHA 5L1LA 2HHSA 3GYNA 4I9QA 4KTQA 4NRUA 5DGAA 3OHAA 1TL1B 3EZ5A 5C25A 2BRLA 4URGA 4YR0A 2E6MA 5KFQA 3IRXA 4ZHRA 4N47A 1RDCA 4QWEA 3DLKA
chains in the Genus database with same CATH superfamily
3WX4A 1VLYA 4WP3A 1DAXA 4UY85 1SC6A 3HHKA 1XHXA 3NGUA 2RE2A 2QIFA 3UDEA 1NUEA 4IOAL 3V81A 5AQKA 2IGIA 3TAFA 2WOMA 3KJVB 1FRIA 1FT8A 1S1TB 1HQUB 2P9PB 2Y1LB 1SB6A 3M1FA 3MMCB 2IM1A 4O3QA 1KVCA 1GQEA 3I31A 4DSFA 4NOHA 2R2RA 1XNQJ 2AKWB 1Q7YT 3LPYA 4A47A 3D2FA 1FXDA 4RPFA 1HX1A 3CJ7A 4OLBA 4A8XA 2OFGX 3LO3A 1HNIB 3I4HX 4ISEA 2JGUA 2BGGA 1C1CB 4HHUA 1R8HA 4AQYK 1IJFB 2QA4G 2IM3A 1RBVA 2GEMA 2RRBA 3MAHA 3GILA 3C7NB 3OYNA 2QA1A 4OZ5A 3ZZYA 3W9HA 1QVFR 2GX9A 1AW0A 1RACB 3LOUA 2ASPA 3CJKB 1OYEA 1TKXB 1BC6A 3CM5A 2MQQA 4H0TB 4GKKK 1IBLJ 3B8HA 3EVOA 1EETB 1WG5A 1SCJB 2IFXA 2V4JA 3V1OA 2FZKB 2XSJA 3CDUA 3TZZA 3GCWP 2DITA 4G65A 1UFWA 4YB7A 3RB3A 1KHVA 3DAWA 3M6GA 1K0TA 4U7UD 3ATUA 5GADU 2WFBA 5I3QA 3GFHA 1Z05A 2WB4A 2YVSA 4CBUA 2OAUA 2IBKA 3O3HA 4S0MA 1SI9A 2I38A 4TVAB 2KO1A 5KFXA 1XMQJ 3WXKA 4CJSA 2U2FA 1Q8IA 4JI1J 5BR9A 2EHGA 1RT2A 2IM2A 3CIMA 4ANDA 3A8KA 5FIIA 5HL7Q 4FNIA 3LANA 2ZOGA 3PW7A 1J5EF 2E2OA 1TVRB 5HP1B 1M5SA 5KFVA 3KJNB 5C2FA 3GR0A 4E89A 4C4WA 5THWA 1S57A 3DU5A 4JKBA 4YUDA 3SCLE 3PW5A 2MGZA 1KD1O 4FXDA 2XMVA 3SCXA 2M8DB 4DL7A 4B9SA 3IRWP 4BHQA 1IBKK 4A2AA 1S0VA 3MMVA 4KHPK 1Q8BA 4J9NA 2P9NB 3U9DA 4IEEA 2GGPB 2B3TB 4TNOA 2A18A 3C6HA 4YEAA 4B3MJ 3B4MA 4FK2A 3UVJB 2EI5A 3B4DA 5KFGA 2KHCA 4N56A 2OSQA 2W41A 3OXLA 4JI5J 2QMWA 3LQVA 1FE4A 2CG4A 2D1CA 2J7KA 3H0PA 1RFQA 2CQIA 4LBIA 2V51B 2UU9K 3UN3A 2VDHA 2CPYA 3RAMA 5HLFA 2DNYA 1U0HA 4A8FA 4HHJA 2PSZA 4ZPVR 5A76A 4RU2A 1H7XA 1HR0K 2NRRA 1SQFA 4QR1A 4X4PA 2YWKA 3J7AN 2Q66A 2PT0A 3DLBA 2WTFA 2NNWA 5CA5A 4ER8A 4FWLA 2A2CA 4E1NA 5K8PA 2CQ4A 3HMJG 1TL1A 3AY0A 3R6MA 4IKAA 1Y0HA 1FJCA 5HRRA 5E84A 2F9JA 2YPYA 4EYIB 4F67A 4G1PA 5ETQA 4X66F 4U8YA 4RX6A 2Q6CA 2WB1D 4YS2A 3OS2A 3FUYA 4RNNA 3R9PA 4A8YA 3MWTA 4LF7J 2P6SA 3V81B 2XB2D 4OHXA 2HQGA 5BR8F 4E98A 4DZDA 1WEZA 2OEKA 1G2EA 1XBWA 4CJPA 4U7UK 1SS6A 3H40A 1B9FA 4UTGA 2Q0UA 3O44A 2Q3PA 2OJ3A 4BWJA 4KRWA 1GFWB 1Y11A 4TU7A 2HBKA 3JAMO 3AXKA 3CJ8A 2VFSA 3SSSA 1HBMB 3GFYA 2E5HA 5F8NA 1G4CA 1HHQA 1PC5A 1WI6A 3HOSA 2IC3A 3F5TA 2FLNA 1I3AA 1FRXA 5KGXA 3NMUA 2HNDA 2UYTA 4ZK7M 1U1PA 4UOFA 3SEOA 4MTPA 2MQMA 3QICA 4F8RA 3Q86A 4A61A 3M2VA 5L8RC 1KWMA 2VWBA 4MIAA 3AH6A 5AXLA 2LP4A 2J6UA 1N0VC 3DLLQ 1WSFA 4RW8A 2RAQA 4E3SA 4EBCA 1WC3A 4DUTA 1NLVA 4DOZA 4DMZA 3OL8A 2PFUA 4OKKA 3MN6A 4HT7A 3O5BA 4BRIA 2UUCJ 2V4JB 4R79A 3SIPB 5C15A 3LA0A 1QQCA 5B0EA 2C2EA 4M63C 3QAEA 3OFFA 2E5IA 2HURA 2ZUGA 4I6MA 4P7TA 4DR7F 5KG5A 1RBAA 5D3GB 1GXUA 2AX0A 3ZYYX 4J9OA 1V9OA 3O8WA 3L4QA 3R5JB 5KG2A 1T9WA 5AT1B 5ETKA 1S1UB 3QFPA 2GC8A 1Y5IB 3NCQA 2NYHA 3DWLA 1U1LA 3TUIC 3G2XA 3IBCB 4CGHA 1I51B 4BRQA 4FZXC 2OGUA 2ZBCA 5L9NA 2H65B 1YJNN 3LDQA 1G15A 3ONQA 3PHTA 3B78A 5J2QB 4LFAK 3PJ9A 5KG6A 2AIRB 3RVCA 1TK8A 4ECWA 2D0PA 3OYEA 1JL1A 3CHWA 5AQGA 2MQOA 4X64K 3QIDA 1KBRA 4HWIA 3L95X 1UA0A 3Q7CA 2D7SA 1MA9B 1TK5A 4NB4A 3D68A 5B0DA 2PC6A 3D2EB 2MGZB 4FBTA 3O9QA 1NXIA 2PO4A 5TKYA 2AGQA 4WP9A 3UW1A 4ZP9A 5KFRA 4TU8A 3IS9A 1X3MA 3Q2TC 2XS7A 1E4FT 2OTLN 3AQPA 4DV3F 5EWFA 1HW9A 5ETVA 1HBUB 2ZJRQ 1H2UX 2JC0A 1CG2A 3KHLA 1QLNA 4C8KA 5K20B 2FSNA 4MFBA 2BXJA 2C3YA 3VAMA 1X4FA 2U1AA 2BOPA 2QL9B 4MK9A 2P9UA 2QX0A 1F5BA 2YPZA 1YVNA 5JMVA 2DIVA 4M94A 2P9KB 2NZTA 4CWBA 2B4UA 2R8KA 1LK7A 3Q8VA 3T3FA 4DFMA 3UFCX 1UPPA 4FLUA 3KLFB 4BRFA 3OYJA 5KRTA 2QTWA 2GS8A 1SH0A 2GO8A 2B43A 4UOHA 1UPMB 3GYXB 3GE9A 4HUGA 4DX8H 1OSCA 1RSCA 1DARA 1OY8A 3UKRA 4WZQA 1F0XA 1F5AA 2BQRA 1SKSA 3PIPL 4BC4A 1SUQA 4NLDA 5GMDA 2W01A 4JI3K 3OA9A 1WC0A 3CC7S 4MH8A 1CC7A 7FDRA 3F56A 4URQU 2M88A 2EFQA 3BN4A 2I2YA 4C0HA 3HP6A 5LJ5Y 4E7HA 1HWUA 2VQEJ 3SMZA 3C15A 5CD4H 2Z1HA 3NAEA 1TKZB 1VYAA 4OZ3A 3MAQA 3CCES 1IBMK 4F3QA 3PDNA 3O1LA 2R7XA 2Q43A 3PSIA 3K9JA 2FHOB 2GMJA 2RU9A 1PYOB 3ISZA 1WOSA 2UXBF 3CJ1A 1ZBHA 1XHZA 3KLIB 3DLGA 1XWLA 2Z4PA 5AZJA 1U1NA 2UUAK 3CFPA 2FJVA 4Z4IA 1W97L 1CJUB 4B3OB 1A7GE 3NF9A 1SC4B 2J0XA 3AVHA 3I82A 2YH1A 2DNHA 2VG5B 1XI1A 2ITGA 1R7IA 3NAIA 3NVMA 1UWBA 1Z26A 4I9LA 1VLOA 4CO5A 4FL9A 3TWHA 3IKMA 3VPZA 3K89A 1ZBUA 3NGIA 2HNDB 2LQBA 4NLTA 1NPRA 3IN5A 3AXMA 1OKJA 4Y2KA 2DGOA 3M2VB 1FFSB 2HFSA 2JSXA 1I39A 2YCHA 3VA3A 2P2CB 1VBZA 1YLXA 4ED6A 4X84A 5HAOA 3AY9A 2Z0GA 2P9IA 5M1NA 4K5SA 3MWPA 2DIUA 2P9GA 2WSCC 3OVBA 4FZYA 2B0GA 1Z6RA 4AXJA 1R8PA 3TVYA 4ED3A 4AQYJ 2PZSA 1OQ3A 4M7YA 1VQ5S 4ZVTB 3BGUA 1NCLA 1NM2A 4L74A 3VGTA 4HL9A 2RIJA 3J7A1 1S4EA 3P96A 3EVMA 2OD4A 1RTIB 1VSDA 3AVAA 5EX0A 3AVCA 5GADP 4E1MA 3MUVP 3W61A 5HMYA 4XIUA 4GKKJ 3NP5A 3N6LA 1CJKA 4O0JA 3MN7A 2HFZA 3SYZA 4Q2LA 4K4XA 1QZ5A 4O8UA 4DTSA 4BVOA 1F6TA 2J9DA 3N4WA 4CJEA 2NZ4A 1JNRB 2DGTA 2F8HA 3SUOA 3I5AA 3E1YA 2BQ3A 2CQ0A 5FDLA 4FF1A 2FBVA 3AA5X 4HH1A 4USWA 4KKOB 2HFOA 4CH1A 3VEYA 3ENOA 4DSEA 3THTA 3TANA 2R8HA 4FYVB 2DY9A 3Q8SB 3L2RA 4LFCJ 4DN0A 3DLEB 4DR4K 2LQ8A 4MLEA 2QMUB 5BXIA 2P1JA 1BWVA 3RBDA 3AJ1A 3UPFA 3BGFA 3OBIA 4OPHA 3KFWX 3U7JA 4YB5A 4LF5K 2ZNZA 2MXYA 5DG9A 4BC3A 2E1PA 4RKUC 1MWZA 5LT5A 4B3TK 4K0KF 1UEVA 1T11A 4DSJA 4W5NA 3FBBA 3R27A 1U8SA 4TXSA 2P9UB 3JSYA 2ZH2A 2G8UA 3VF4A 4PXEA 2PFDA 2YWHA 2BJ8A 4ES1A 5F8GA 4LRBA 3I0SB 5LJWA 5IQQA 3Q8PB 4NYPA 2BBEA 2NXUA 2WSFC 5E3AA 3FK4A 1HL6A 4LRDA 1YRXA 2MZQA 4YY3J 4Z7CA 3LGMA 2IY5B 4FS2A 2A2DA 1DJ0A 2H4YB 2YNHA 3OTBA 4M3UA 2WONB 2HKEA 4JV5F 3R2CJ 4WP8A 3GJRB 4NLCA 2BANA 2EBEA 3KLEB 4ICLA 3QEPA 4FLWA 2UU9J 4ECQA 1RE1B 3BBCA 1Y5NB 1VOMA 1SJFA 3VGKA 4KHYA 3O4NA 1SZ2A 1AUSL 2VDIA 4O3PA 1ZETA 4HDHA 3FZKA 3EWGA 4BBYA 4NASA 3NAHA 3AGKA 1X5PA 4Z2XA 4DBQA 3BM7A 3GJTB 1N5QA 2D41A 1NB7A 4FO0A 3TJ9A 2MZSA 3NWRA 1U0SA 4L75A 3M6UA 3KHRA 3LUYA 4F2SA 3DXMA 1NU4A 4BE0A 3VZIA 1JJ2M 3C6AA 1AYEA 1YJVA 2HSTA 1WKJA 3VQBA 4CIOA 1R43A 3JB9k 4O23A 1YVFA 3NWGA 2A1SA 2HK2A 2FSKA 4AL6A 5HATA 1P1LA 2IA6A 5F8JA 4RR5A 4DFKA 2YWWA 2F9WA 2WRMA 1UWBB 4IRDA 4CK2A 3ZTPA 4KGKA 5CZ1A 4F4WA 2UVUA 4C1NK 4WTOB 3CD5A 1PGZA 3A4TA 5F9LA 2BEFA 1XQSC 5IT9O 4KB7A 1QSLA 4LVOP 1HNZK 1QTMA 3DXKA 5HRNA 3MM8A 1CZAN 2DNRA 3SPZA 3ZETB 3MX5A 3TA1A 2Q6BA 2X1GA 2H3GX 3GDQA 3NBPA 1VFJA 2ASLA 2C42A 4ES3A 2EX3A 3A8IA 1WSEA 2B9XA 1IVZA 4V19S 2HSEB 1NJIO 3QT6A 3CJ0A 3GV8B 3EVWA 4HUEA 3BS9A 2QWRA 3TUPA 2MY7A 2PEBA 4OI0A 1H0HB 1WUUA 2FHKA 1G3OA 1W2BR 2KW4A 3C94A 2I5JA 4DG1A 4EYHB 2N7YA 3CC4N 3PACA 3CCSS 4K4SA 4NO7A 4OYAA 4ZITA 5IS2A 3CDBA 2YX6A 2VC0A 2PI4A 4ANEA 4XPEA 3MEDA 2O5DA 3ZZUA 1D9AA 5GINA 1FKAF 1GLAG 5FRNA 4DR5K 2BABA 1RDBA 3CCJN 1RDAA 3NY0A 5BRHA 4C7QA 1WI8A 4ZJOA 4IO9L 3G10A 1TL7A 3QFHA 4QR0A 1B92A 3KTQA 4K42A 2YNIA 2NUBA 1RTDB 4EIAA 3FZBA 1F9HA 2W2QP 3H25A 2ILYA 4NA1A 5EWEA 2A6OA 2CJQA 4Y28C 4JKCA 1U1QA 3H45C 3OYLA 2HVIA 4H5NA 1O6XA 2V7ZA 3VN5A 3BN7A 4KY3A 2UUWA 2CQGA 4JKGB 2J9CA 1RLCL 3D4JA 1ITPA 1RT6B 3AB4B 4L72B 2CUYA 5IC6B 2X78A 3E2EA 2K2PA 2M2BA 1WSJA 2AD9A 2RNEA 4LFAJ 1WN7A 3R7SB 4U96A 1RTJA 3PSFA 4WFBQ 1P6TA 1T05B 4GKJF 3R97A 2F4VF 1S72S 1N32K 3S7RA 4I2PA 2ASDA 2MLXA 4J5OA 2CNOB 5KGWA 2QEXN 3THWA 1OY6A 2DGQA 3SDEA 1QAYA 1JLBA 1RAGB 1H38A 3SPYA 1ITGA 5KFAA 3G4SN 2YNHB 3NH0A 5DJBA 1GLBG 1LXJA 1VC6A 4H5RA 1OMSA 3QFUA 3DRRA 4KQZA 3CCQS 4PKHA 2DR6A 2UV8G 1T9VA 2N4DA 3RBZA 4EO6A 4KTZA 3BZKA 5D15A 2LLZA 3F41A 2XZWA 3M1VB 2R8JA 1HLWA 2A3JA 3EUNA 1VC0A 2WBMA 4FKXA 3CMAN 3AVBA 3GG4A 1WNSA 4O55A 5BN8A 5GMEA 1RHUB 3FSYA 4K4UA 3TX8A 4B08A 1UTAA 1C0UA 2V2KA 4E7LA 1UKUA 4ECTA 3QJJA 4LUBA 1LK5A 2G2ZA 4F50A 2YKNA 3EGVA 2O8DB 3QEVA 2WBNA 3D0IE 5ADZA 1KAXA 1NHUA 4JI3J 1RABB 2HVEA 2QLWA 2Q1LA 2R7OA 2P9LA 2YJFA 5HVHA 1P27B 3DXMB 2LVWA 2FVCA 2L9NA 3CCTA 3M05A 1N36F 1ACMB 2OPSA 4DV5J 3MMAB 1LV5A 1RWUA 2HHVA 4JI4K 2R2UA 3KUHA 1TK0A 1GTEA 2LXUA 2HMIB 3G71N 4YDXA 2F63A 5AQLA 2QLXA 1IBMJ 2FGCA 5GAEU 1VQPS 3S1TA 1KLMA 4I2QA 4C9DA 2YX7A 4PPZA 2AGOA 2E1RA 3PZPA 2Q31A 3IP0A 4DV1J 1KD1T 2JL9A 4CT8A 1S9GA 4OGCA 3GTYX 3FBFA 1FWPA 4IJNA 2UUAJ 4P52A 3FJ2A 5JLHA 5E26A 2CH5A 2E6LA 1HYSA 3EE3A 3TA0A 4ALZA 3O9RA 3H5YA 2ZHBA 2APOA 3LTOA 4CW7B 4FNHA 4OJGA 3WEEA 1AZSA 2GQCA 3CF5L 5GADI 2ZBPA 4DTMA 5CXTA 1U2VA 1UZDA 3PYFA 2XS2A 3C16B 2XO7A 1PC4A 4OYBA 4FWQA 4CZCA 1VRUA 4GW6A 2ZD1B 1VQ4N 5H1SV 3LZIA 1ZS6A 4ILJA 5DQHA 1CPZA 4KAZA 5J2NA 5DRKA 1YK9A 4CEQA 3AVIA 4DL3A 4NE9C 4PQUA 2V6AA 4M63A 1QE1B 5L46A 3CE8A 4OJ3A 4A2BA 2HBRB 3DOKA 1VHFA 2J6SA 3W3DA 2NXEA 3UDVA 4WQ5C 4ANCA 1OH7A 3QSYB 4IO8A 2EFOA 2ZZMA 2CIMA 3AODA 2E88A 3FVYA 1U6ZA 4Y1DA 5CD4A 3V9XA 4DTXA 2GNKA 2B8QA 3BH7B 1SC3B 2BX6A 4KHMA 4OYMA 4GVLA 1IR0A 3THXB 2YX1A 2KLAA 1YTUA 2ZE2B 2BTFA 4L3NA 3TTCA 1Y3KA 2BM0A 2DNGA 1KQSR 4MIBA 3MCPA 2BKPA 3THPA 3PG9A 2XHWA 4MK8A 3OTOJ 1KRPA 4CJ4A 1CXQA 1DKGD 3ET6A 2FPHX 3KMQA 3HSCA 3CFOA 1J27A 4C8LA 2WCXA 4I7FA 1U26A 1WSVA 5HL7L 4EBDA 4W92B 2GW8A 4YOEA 2EFGA 2V34A 3UD4P 3MM6A 1Y9OA 2V52B 4KPCA 4AM6A 1ZM4A 4CD3A 3K59A 3MFHA 4QAGA 4OV6A 3OD2A 4CK1A 3TA2A 4OYXA 3RJMB 2DISA 3FFIB 2KXHA 3THWB 1VSEA 4DR4J 1ASUA 5F8LA 4CLYA 4EP4A 3H2UB 3KG1A 3SDEB 3HZEA 1JLBB 3MR2A 4LBPA 2EFNA 4H5VA 1IH7A 1WEXA 4X65F 4LF5J 2ZJQL 1ZC6A 1MLAA 1NHVA 2ZHOA 3ISND 4F0MA 4B3TJ 2ZOFA 1XEZA 2KFZA 1HNXJ 4CLZA 3ZSXA 4AHSA 1D9FA 5AQYA 2VBZA 2ZQBA 1GK8A 1WD6A 5M1OA 4RNFA 3CB4A 4P75A 2VICA 3TARA 1SJRA 2E5LF 2MLZA 4DV4F 4Q5VA 1S5JA 3IXQA 2IRXA 4K4VA 4RBUA 5A2QO 1X4DA 1U04A 2IM0A 2IVFB 8AT1B 1N5VA 4W90B 1N56A 4BDYA 3T1HF 2DH7A 2HWHA 4ZN1A 4DTPA 4DCHA 2H3EB 3Q24A 2ZVSA 4LQ9A 3UB5A 4CI0B 2P9LB 1GX6A 3LP2A 5FPMA 2UXDF 1QAIA 4B9LA 3BR9A 4F4YA 4RG8A 2XHCA 4WWSA 2BA9A 3CFRA 1X7VA 4DLGA 3R3LA 2ZDOA 1S5ZA 2OPSB 2HVDA 4NXMK 2MKKA 2FVQA 4U67L 2EPIA 3AVNA 5AE1A 2FVSA 4N8NA 1HI8A 3W2VB 2O8BA 3EZUA 1KLMB 4NCBA 1N34F 4JYAF 3CDAA 3DKDA 2C2DA 3T1YF 4CFBA 1VSFA 3CD6N 2C2KB 1GLCG 2AJ1A 3BDPA 1HYVA 1XERA 1S1XB 1K1SA 2VA3A 3OHRA 4CJUA 2C3UA 4DV6K 2VD3A 3T69A 4ZOSA 4DUYF 2MB0B 3J7YU 4CLFA 3MR7A 3V6DA 4F2RA 1LW0B 4R5PA 3T5HA 1FD8A 2HQCA 3CJTA 1YDLA 1U2VB 1NM1A 3K17A 4CBXA 4M3YA 1W9HA 3U6FA 4JK8A 4WPAA 5IV4A 3O5TB 4U6PA 2EBGA 1DTTA 1IKXA 1VRUB 1JNZB 2A41A 5K5MA 3HRGA 1HWIA 4WFAQ 1XR6A 2GIRA 1WHWA 1SH3A 1I1GA 1HYZA 1WOOA 4CHYA 4YN3B 4P6QA 4A8KA 1NJZA 2RS8A 4LF1A 2HFUA 3KLHB 3QB0A 3R7NB 4IFVB 1TAQA 2FTRA 1F9FA 3GZ7A 1HNZJ 1V4SA 1LCUA 3K5OA 1VRQC 5HSPA 1R0AB 4BRDA 3VAKA 3VESA 1T6CA 2FJDB 3U3YA 4NX9A 3SUPA 1QS4A 4IOCL 3RBEA 4FJNA 5CZVA 5ETNA 1XC9A 2CQPA 2GHVC 2R7UA 3NE6A 1WC4A 2R8IA 4Q8EA 3H4BA 3CCWA 1VHIA 4CGJA 1Y3JA 4R8UB 2VODA 2V8GA 4F4ZA 4IJAA 3L3UA 2QO3A 5KI6A 2CPXA 1LXNA 1VIXA 4R25A 4O4GA 2D3OR 4KTWA 3PW0A 2QWOA 3ILLA 4IDKB 5I3UB 4ZS6A 2CGJA 3JXOA 4KGVB 4ED7A 4FF4A 2ZH5A 2DY1A 4ZCKA 1XNQF 3ZX3A 2RRAA 4LSLB 2R7WA 2XY8A 1T9UA 5IXUA 2R7VA 4QWCA 3R1LA 3THYB 2RT3A 2E9TA 1HQ2A 1XNRK 4I7FB 4DR5J 1RTHB 2GVZA 3G6VA 3SQ4A 4FJGA 1JLEB 1KDNA 2LDIA 2RUGA 3CPWR 2D4WA 1E6VA 3FBEA 3HHEA 3N6MA 3J8AA 1ZA2B 1YUWA 3ZEUA 4RW6A 3MM6B 2KVIA 3MM7B 2YI1A 2WTUA 2XMAA 3N28A 4PWDA 1N88A 5LSRA 4IG0A 2WUSA 1DZ5A 3P5TL 3QETA 3K58A 2NXNA 4EFAC 1NSAA 4FLYA 2QYGA 2PYJA 3HVTA 2BRKA 4LREA 2RVJA 4AHTA 2LECA 4LIWA 4F25A 4NYNA 3F73A 4NZ0A 1NDPA 4TY8A 2ZJRL 3KIOA 3FQLA 4ZN3A 5C5JA 3CJ2A 3SFUA 4GNIA 4Y6IA 4XK8C 3SQGA 1ZBSA 2OYQA 2YH0A 3S8SA 1WJ9A 2ZH8A 3L3CA 2Y0BB 2W9AA 4DR2K 1N32J 3V9UA 1AA1B 2XLIA 4IOAQ 3D6TB 4HLBA 4CJ7A 4IXCA 4ENOA 2KH9A 2HBLA 1IN0A 3UE5A 1EJ7L 1D3WA 2KJVA 5EVZA 4YR0A 2E6MA 3LM9A 3BF3A 2QTDA 1YHQS 1B0TA 2HBQB 4YHHK 1UVMA 1MROA 5KFUA 4BRMA 4K8RA 3H3NO 2V2QA 2RMLA 1F60B 4I0WA 2ZBQA 4F7VA 4M3TA 2FY1A 3RAXA 1IQTA 3RRHA 5CYJA 4QBUA 4RTFD 2BW7A 4IH6A 2ASOA 3TSQA 3LP2B 3DYAB 1HKGA 1U02A 3VOVA 4K59A 4WE1A 4M8LA 2F96A 1DEJA 2XMUA 2LEPA 4PAAA 4NZ6A 2HGMA 4OX9K 4NLUA 4DTUA 2XEXA 3SUQA 1LW2A 1U25A 4A8OA 4D3GA 3N4PA 1C0TB 2B4PA 5ELZA 1LAWA 3OSNA 5B0CA 3I4PA 1RYSA 4QIVA 2DR8A 3CW2C 4JI5F 2O8BB 4OIXA 1I5OB 5GAEP 3PHEA 2RRNA 3HYFA 1WF0A 1RKIA 4GV6A 3CMQA 2HB5A 5KT3A 2FHJA 2HRTA 5A8WA 2B6AA 2L9DA 1RCXB 3IBFB 1KAZA 3GV7B 1VK0A 4A46A 3WC0A 3FE1A 4JI4J 4X4UA 4L76A 1MU2A 4USTA 4HCCA 1BISA 4L73A 3QGIA 2W2MP 2ZC3A 4Z4EA 2OD6A 4ECVA 2HZAA 4BDPA 2J6TA 2VQFK 2GHWA 2O4GA 1W7WA 3SQ0A 4MAKA 4CM2A 1NGJA 3KWGA 3ISNC 1BO5O 3SBTA 1PSDA 1A5VA 4F04B 3BO3A 3H2LA 3T7ZA 3S01A 3MF5A 3GG0A 3AJDA 3O80A 2E5GA 1YKWA 3BKTA 3FFKB 1Q86O 2RUSA 1HWKA 1SJ1A 1N5YA 1RWVB 3QNOA 1VJWA 2BOAA 2LQJA 5EU7A 2N82B 3GJQB 2K3KA 2Q79A 3MCMA 1JXEA 1WTBA 4HDGA 2W9CA 2EEYA 2IAJA 2DJWA 3SAHA 4LF7F 3V4IB 1U6FA 3IAM9 1GOBA 3ADAC 2KDOA 1T95A 4B9NA 3AAQA 1KNZA 4DFJA 1F5CA 2M3DA 2VF3A 2DHAA 3O1BA 3QESA 5A0YB 5KFSA 3DMJB 2DGWA 3R1XA 3WXIA 2LEAA 4C6AA 3FEXB 5DG7A 3E9LA 1CQMA 3WZ0A 3ZNJ1 4CFAA 3POTA 2HRUA 4IFYA 3OW2M 1NMNA 3CJ4A 2W1BA 4I6AA 3C14B 1SPBP 4DSLA 1L3KA 4KT0C 3RRKA 3OL9A 1JKHB 4EK2A 2OIHA 1E6VB 1R31A 5GAGU 4KYZA 2Q97A 4DHVA 3HD1A 2C22A 3ZEUB 3EYZA 2D0CA 3AJ2A 4EEYA 2AJ4A 4H4OA 1ILYA 2NUHA 4NLVA 4G1QA 4AD6A 3TW0A 3QO9A 2DXEA 1BIZA 3AVLA 3W66A 2DVIA 4KFBB 4FWRA 2I7NA 1J5EK 2FSJA 1C1BA 1M5KC 2F8TA 2IYGA 2YKAA 2ETJA 2DKOB 8ATCB 4CTAA 2I7PA 4CDIA 1RGIA 1OY9A 1SIWB 4IQMA 1FRJA 1NJIT 2HG4A 2ATQA 5EXWA 3CC7N 3FEYB 1MMDA 3KUGA 2GAGC 4H0XB 2QLBB 3W2WA 1RZMA 4OYIA 1Q9XA 3JYTB 3JSRA 3DDKA 4CH7A 1IKYB 2XY6A 3TAMB 3QZ8A 4WKRA 2A0FB 2JHEA 3G87A 4X4QA 3CCEN 5AQOA 2VGNA 1FI4A 2HRYA 1N0UA 2XLJA 4YOWA 2PDAA 4AXIA 1HARA 2HAIA 3OYAA 2J9EA 5J1EA 2NRXA 2KYXA 3E01B 4ZMMA 3ENAA 2YWEA 4DTOA 6FD1A 4PXBA 4RZRA 2ZM6K 4LF2A 1TMJA 2Y1IA 3P8BB 1UVIA 3OYMA 3US5A 1BY9A 2GIFA 3CJQA 5DZ6A 3LL3A 3A5OC 4J9RA 1HBOB 5GVQA 4X62K 2Z56B 5A6PA 4M41A 1VIOA 2D3ZA 2G0IA 4IEIA 4X66K 3DI6A 1HNVB 2HHQA 3OVNA 2OHDA 3VF2A 3RW7A 3MM5B 1HPZB 4JOUA 2G8KA 1NGEA 3RB0A 4BWMA 1PO6A 5T41A 5BR8K 2I1RA 1NDKA 5E3RA 3CCLS 4GVMA 2IMOA 1JLCA 3N0VA 4DV6J 3J80O 4NA3A 2ZITA 4CBWA 3TEGA 1OH6A 1VQ5N 1O1WA 4A57A 4BG8A 4NMXA 2DRAA 3MWBA 4RWTA 1VSMA 5KFTA 1EQYA 4CEDA 2DT9A 4BR5A 3MAAA 5EX5A 3I56S 4V19X 3OV7A 2BR0A 4CGFA 3QGHA 3J81Y 4WQ5A 1S59A 4DU4A 3MEEA 2HQDA 5HMZA 4ED2A 5ETMA 3OYKA 4OZ1A 3VAHA 4D3HA 3VTHA 1CJVA 2F1FA 3PIOQ 1LOTB 4USUA 1NMDA 1H98A 3Q83A 3VR1A 1WEYA 3NNHA 1VI7A 3M9OB 3PYGA 4IUFA 1JQGA 3KJQB 3LP0A 2EWSA 2OSRA 3FGUA 1VK8A 4NXNK 2O67A 2RKIA 4Y1CA 3DRSA 4OJRA 2BUNA 4EZ6A 3E3XA 4DR7K 2W24A 1NGHA 3JSBA 1B99A 3V6JA 3RR7A 2YNFA 3ETOA 4G1QB 4QYZK 2KFYA 2D69A 5CYMB 4ZCLA 2ZGZA 1FDNA 4L8RB 1UVKA 5KFKA 5AQVA 4FLXA 1TKTA 4DL6A 3RB4A 2YTCA 3AAPA 2MSTA 3DM2A 1TUVA 1I6JA 3QT8A 1ZBLA 1MWKA 2H51B 4FBUA 1O13A 1M0SA 4WFBL 5HJYA 4DHYA 2H5EA 1YIJN 2E7VA 3CCMS 3C6TB 4CF9A 1FJGF 2KJWA 1RHQB 3SI6A 3EL2A 1LKZA 1EKEA 2JOQA 4DV3K 5ETOA 1QVFM 4CEOA 2CRLA 5JVGL 2MHEA 1S6QB 3PJXA 2C3MA 2JFKA 2N4CA 1HW8A 2BJ1A 1X60A 1SIZA 4O3NA 3C6UA 1FCAA 4FYYB 4CM0A 2MTLA 5KPTA 4OX8A 2NS1B 2G8IA 5AQQA 3D66A 2ZH9A 1K9MO 3VQCA 4H4KC 5GAEI 4NLQA 4LFCF 3NGYA 5L1JA 1S7IA 1CLFA 1BQMA 1GX5A 3PR4A 1VQNS 3NMAA 2O8FA 3G82B 4YHHJ 3K7RA 4OPKA 2BYCA 2GELA 4C3LA 1PJ7A 1ZYQA 3VEWA 2BW2A 3O1WA 1NMEB 4Q0BA 4LQ3A 4LVNP 3P45B 1TTHB 1PYTA 1NDCA 3A5MC 2F8MA 1EQMA 4DL0C 1IR1A 3HFKA 2XGPA 3GB0A 5DQGA 4DCPB 4YY3F 2HF4A 1QD1A 4OX9J 2Q0RA 1SV5A 1FKPB 1RJJA 4CZEA 3VVTA 2QC3A 4ZP8A 3H46O 2OPRA 1NGGA 3PRBA 3CC4S 4NLBA 3I96A 1QHAA 2D3UA 4FPAA 4F4XA 5A8KB 4XDDA 2GMHA 4KIAA 2UXBK 3NF7A 1FRLA 2UU9F 3MM9A 1WBDA 3LPEA 3BGRA 2OMLA 1KVKA 2QW9A 3QIPB 3PM9A 3CI5A 3MCSA 3O9TA 4RW4A 3CJ3A 1FX4A 4IRKA 1S77D 3QLHB 4ZTFA 3LDPA 4RUHA 3ZSWA 3LZJA 4JKHA 2B9EA 5F8IA 3UDCA 4CIFA 1UA1A 4IR9A 3CCSN 4DDFA 5HI7A 3VMFB 4YDUA 5L38A 2VQFJ 1SH2A 1C0GA 1NOZA 3MEEB 3I5CA 1HWJA 4IG3A 4UQGA 2NLXA 4R0JA 1CJVB 3HVAA 3PJWA 3T6BA 2Z8QA 1WNEA 2HS0A 2HNZA 1T6DA 2HNYA 2FZGB 4J91A 3TJ8A 2Q36A 4JKEA 4CQ1A 5A8RB 2FYXA 5IM0A 4UY8O 1RTZA 3BPDA 5D78A 1WHVA 3OUYA 2G2OA 2MEWA 3AVFA 5T7LA 2ZH1A 4J9KA 2QEXS 3MXIA 1ZAWA 4XH1A 1BU6O 4AILC 2C3PA 3N5FA 1RA7A 3CETA 4I67A 4ECZA 5GAGP 1YWXA 1S49A 2IVYA 4RW9B 3HFZB 2PI5A 1Q18A 3U1LA 4OZLA 3EO3A 3NH2A 2XYGB 4CZHA 4DFPA 1S72N 5E5NA 4QW8A 4G6VB 4ZLJA 4NPOA 3KG4A 3MUTP 1T9XA 4FWSA 1VMBA 2QL7B 4MKBA 3M8PB 5CCLA 3SJJA 4F3MA 3OXGA 3Q8QB 2DBBA 1TYQB 4FCYA 2BZ2A 2HHXA 1MN9A 3OTCA 3NCRA 3W0LA 1DTQA 1QY7A 2FDNA 3KK3A 2R7YA 1NJXA 1UWAA 1JLAA 2LSNA 5IT9U 3CCQN 3PCOB 3M4XA 3W8GA 1X5SA 3HHLC 4HCBA 5MLCV 3R8EA 2QJ3A 4FWOA 3WT0A 5KFLA 1K8AO 4WFYA 2DO4A 4C2MA 2OUGA 3OS1A 1GMUA 1Q4RA 3IBWA 1KCFA 4ZPAA 4DQSA 4JKDA 4C8MA 3UCUP 1BI4B 3DNCA 4KAIA 3BKUA 3CSKA 2XZDB 3G71S 5JICA 5CZ2A 1LNQA 5DS7A 1WBBA 4C3KA 2RS2A 4J9PA 1QTNB 3R5GA 3K2PA 3H6EA 2B7CB 4X4OA 3I55N 1S1VB 2DNLA 1S0OA 1S76D 1NOYA 3ULEA 1JLFB 4UUXA 3IG1A 2HQ3A 1H72C 2MLYA 3VF6A 4JV5K 1FKOA 2CJ9A 2XLKA 1N52B 2ZNYA 1K73O 3GFZA 1FWKA 1PJ5A 3D28A 1NK9A 4Q0BB 4M5GA 4RUAA 3PX6A 2QXLA 1UZHA 4OHYA 5IV3A 1RHJB 1IJEB 3MR5A 1ATRA 2RHSB 1JXLA 2X3DA 3SSRA 3CEDA 1VQPN 1P9QC 4LF6J 3H7HB 5HROA 4HUFA 3JQKA 4PL8A 4ZPDA 2QI2A 4F3OA 4BQZA 1VQ4S 4ISFA 3ZSRA 5LMUK 2D1KA 3A3NB 2DHHA 1SV5B 1JJHA 3PW2A 1JJ2R 2D0AA 5RUBA 2ZM6J 1RAAB 3GBTA 3IWXA 2MKCA 4OO1J 2DHGA 3VQ8A 2WVFA 4BC7A 3D0PA 4PPDA 1VRTA 3KK2B 4IO9Q 4XAKA 2OPQA 4C8NA 2AMCB 2GCFA 3T9NA 1T02A 5EUHA 5LL6d 4A59A 4X62J 4K7QA 1FNOA 2GX8A 1PG5B 4AL5A 4KPYA 3D6FB 1XJWB 3WC2A 4XDCA 4OVLA 4HHHA 1ATSA 4C3MA 1URNA 1CS4A 4DQQA 4W5RA 3AVMA 1UP1A 1F2HA 2DFFA 5HN0A 2PA3A 2BQUA 2QKBA 5HQMA 1XMOK 2CDQA 2P9SA 2POKA 4HEA9 3WHIA 2WW8A 1EP4A 1TUWA 5BR8J 1M90O 3T5LA 4Z4CA 4JI3F 3G96A 1F2GA 1DT9A 3QZ7A 4E0DA 3NGRA 2AZ3A 4JD2A 2CNNB 4C11A 3G6ES 4DKWA 3ZZRA 1SJQA 1BOTO 2XI3A 4DV5F 3PW4A 3MN5A 4H0VB 4FZZA 2C2NA 2CGLA 3O4QA 3G6YA 5AJ3K 4HACB 1QVGR 1RYRA 4N7TA 2Y1JA 3OR1A 1FFGB 1IBMF 3R1HA 1X4GA 3EGWB 2NPIA 2O8CA 1C4CA 4IRCA 4JI2J 3EMTA 3LP1A 4LR8A 1TL4A 2QWNA 4FJLA 3R9LA 1YXQA 5C2DA 3OUYB 1Q9YA 4DV1F 1K0VA 1T0TV 1WSHA 5T7LB 2YXLA 1M5OC 2CQHA 3M8QA 2KRBA 4W98A 2BH1A 2QE5A 2KRRA 1IKVB 4OI3A 1JLGB 2HIQA 4NLRA 2UUAF 3E66A 2UV8A 2BVZA 1V3ZA 2KM8C 4QU7A 5BRFA 1BQNB 3AO2A 3W9JA 5AQXA 1JLQA 1KQKA 5AQIA 4X4SA 4NCGA 2V68A 3GPAA 4E19A 4DU7A 3KK1A 3JSMA 3TP2A 2DFEA 3MUMP 1HPMA 3HOTA 4NXNJ 4KE5A 5DLGA 2HZCA 1CZBA 3O6WA 4B1VA 3H90A 2MQLA 4DR7J 3I0RB 3J81j 2E9ZA 1VR6A 4C1NI 5D77A 2CPHA 4CZGA 2V8VA 2JEGA 2VV5A 4OZ0A 4IKFA 1TL5A 4Y34A 5F8MA 5C7PA 2CQ2A 4RU9A 5G0RA 4QYZJ 1QAXA 2V67A 3CG7A 3A8YA 4F0KA 4IH7A 3P1GA 4EMDA 3N9UC 4K50A 2EWHA 1Z1ZA 5AZIA 4BR2A 4K41A 1RAHB 4TLRA 2KT5A 1IM6A 4PQAA 4CO0A 4NLYA 4Y3CA 3SBMA 4GKJK 2F4VK 3M8YA 1OS5A 3UO0A 1NGDA 4RW7A 1R8CA 1R0CB 1Q86T 5H9FK 3OTOF 2V9WA 2XCAA 3ITHB 4PWWA 1J6ZA 4LF9K 3GL1A 1MW7A 1DRZA 1HKAA 1LWFA 2FB0A 4Z7YA 3QEWA 2RD5C 3EDQB 3SAFA 5K14B 2F3JA 4JP8A 4DV3J 3ULEB 2HLUA 3CD6S 1XK8A 5LMNK 2FHMA 3CDEA 4CYUA 4DPXA 3CF5Q 4GMJB 5BRDA 1KQFB 3NKYA 4IOXA 2VFUA 3H98A 5E0OA 1FERA 3HSGA 3W60A 4XO0A 2HS3A 3VCDA 2HQIA 3O9SA 3MEKA 4FS1A 3C95A 3JTNA 2YQ1A 4KH4A 4LF4K 2FLPA 1FK9A 1OPIA 2FC8A 5LSLA 2VG6B 4USKA 3LM2A 4K4YA 4B3RF 1X4CA 1VBYA 2NZCA 1TUUA 1Q5YA 1IKWB 3TO8A 4B3TF 1NSKL 4OLOA 1YZ6A 5KOXA 3KXDA 1HNXF 1JX4A 2DXDA 1FDDA 4EU0A 3HI9A 5E3CA 4BR0A 3HXMA 3FRYA 3NNCA 4FWPA 4B9QA 2E29A 5DLFA 2H5IB 3FEZA 3HKWA 1DQ8A 2O1PA 5C2GA 2XI2A 1RILA 3H4DA 3N5BA 1T03A 3IR7B 4N5SA 3OR2B 4P7VA 3ZC4A 2WVCA 1YJ9S 5HJXA 1CS4B 1ATNA 2QZ8A 2ATLA 3V9WA 4JI0F 3M32A 2HPUA 3V1QA 1RU1A 5C24B 3MK6A 1SKRA 3DU6A 3VEXA 1MG7A 2M5YA 4LJMA 1RA6A 3H5UA 2AYBA 2HFVA 1SVDA 3BYPA 4CEEA 2B4JA 3UE2A 1EP4B 3ILIA 2Z30B 4AHVA 2KG1A 1PILA 2G9OA 3DRPA 2H48B 1FRHA 4CFCA 1KN6A 4JS5A 1HJRA 1E3MA 2VIHA 3MOZA 2LXFA 1FEEA 3MX2A 4K8ZA 4DQIA 3AO5A 1LAVA 3OYGA 4URSA 5GAGI 5AQZA 1RWNB 3IA0A 3OR1B 4I1TA 1YVUA 2CH6A 2K8GA 1W2IA 5KFWA 2EFPA 4YOTA 1CVJA 5HRSA 1Q81O 5J2PB 1XR7A 1OYDA 2PA8D 1LFPA 2B9WA 2VPXB 1KKHA 4JBCA 4DV0K 2ZJQQ 1E6YB 3QAUA 3QPIA 1RWOB 4Q2MA 1O0PA 1M1KO 5A2QU 3TEHB 2OCEA 3MEGB 4C8YA 1UAWA 4EGLA 3TPQA 4OV1A 1I94J 2XYHB 4CECA 2FLLA 5CYQA 4IH5A 2E1YA 3BQ0A 4KI6A 1LWEB 4LH5A 4FW2A 2CWKA 1EWQA 1FJ7A 2Y3YA 3NGTA 4CE9A 2ZDPA 1JB0C 2QMXA 8RUCA 1ZM2A 3MZIA 4PWUA 3R6GB 2CG8A 5LJ3Y 1NH8A 1B9DA 4NI2B 1H7WA 3HP9A 3AT1B 1AFIA 2GJ2A 4CZMA 2MPUA 4J9LA 1TL3B 3I8BA 1U2RA 2GVDB 1RWXB 1RAFB 5SUHA 3UD5A 3O3LA 2WC9A 2L08A 3TWZA 5ETTA 4ZHRB 4U67Q 2YKMA 4DL5A 3DLKB 1UVLA 4PG8A 3R5BA 2OP5A 2FGOA 2KTQA 1S3XA 3IFRA 1ZPWX 2C2RA 3L2VA 2YV0X 1YHQN 1EO1A 1HBNA 4RW7B 2P5VA 4NEZA 3D6RA 1B3TA 2WOMB 2W2OP 2CGKA 3GCXP 4TQSA 3KWMA 3DCAA 2LA4A 2KHDA 1LWFB 4WYLA 3QGPA 4LR7A 2W4CA 4QR2A 3ULHA 4M95A 3ZTSA 4FOEA 1W2BM 1RK8A 4PUOA 4X65K 3IM9A 3D2FB 2BJ9A 1ZTTA 3U02A 1H74A 2RHKA 4CYUB 2FF6A 2OA8A 2W40A 5BPMA 3WDOA 3G8TA 2DGUA 1GMVA 2X6SA 2JWLA 4PKGA 3PRVA 1Q8KA 1WF1A 3QRQA 2JEJA 3BB5A 4E8UA 4HHTA 1ELOA 5FJ4A 2EG2A 2BE7D 3M2RA 1H6KX 1YX2A 2E5LK 3IM8A 4CHPA 3K0JA 4DQRA 5B0BA 1FK9B 4DQ8A 2E1ZA 3HLUA 1HHTP 4Y2CA 4A8WA 4WK1A 1FXLA 2J76E 3ZNUA 4KB1A 4JV5J 2FXUA 2W6KA 3BUZB 2I6WA 3ZT2A 2CYYA 3CVKA 1GLEG 3Q7BA 2G8WA 3K8WA 4IOCQ 2XSJB 5BPNA 4ID8A 2VG7A 1OSDA 1N32F 2ALZA 2GUPA 3G8SA 1VHXA 1ZAXA 1UJ4A 2CPJA 4JI7F 2CQBA 5LXYA 2ABYA 2ADCA 2UXDK 5JVHL 1PBUA 2RJZA 3EY1A 1JWWA 4W5TA 3BZQA 5BN9A 4ZLPA 3C46A 2FVPA 2X1AA 4ID5A 2FQQB 5LMUJ 2XMWA 3BQ2A 3NOGA 1YSJA 3LGHA 2A42A 2QA2A 5AXMA 3SFGA 3G25A 1N34K 4JYAK 4NYZA 5L1KA 3T1YK 2AV5A 1HNWJ 4X4NA 1RT2B 4E7KA 5MAOA 3DOMA 3C2PA 3SCJE 1S48A 3ZZZA 4JRPA 1PKUA 1S6PA 4DUYK 1Q95G 3D3CJ 4CT9A 4LC9B 4LH4A 1DLOA 2DO0A 1G6BA 2IRYA 5DM7L 1U2CA 2W7PA 4YFUA 1A6LA 3VGSA 3W1YC 1X4EA 3DGPA 3MR6A 3CC2S 2KB2A 1VQ8S 4RLEA 2C2OB 1MWMA 5AQFA 5EOYA 3SAGA 2G8HA 2COLA 1S97A 1XMOJ 4U7BA 3J81U 3TOQA 3M6XA 1NK5A 3CQYA 1GMWD 1BQXA 5CQGA 2JLGA 4B1XB 4CHOA 2W7AA 1K9MT 1A9NB 2XMKA 5AQPA 1T8EA 3MFIA 3P4IA 3G9CA 5DDOC 3LF0A 1YJRA 1NGAA 1VISA 5BYSA 2DCUB 2HBZB 1S6OA 2KG0A 2Q1NA 3PIOL 4O0IA 4KREA 3SV3A 4Y00A 3OHBA 4JI4F 5AJ3J 2CJKA 2MZRA 2JVRA 3SK3A 5IWAK 4L6V3 5HLFB 1U0HB 2B4OA 2V5HG 4TN2A 4JV2A 3H2VE 4BY9C 1ZH5A 1SAZA 4QOZB 2QWMA 3SQ2A 3HSZA 4G1IA 2DHSA 1YBAA 1SC1B 2FJAB 4J2DA 4O5FA 3PO5A 1RT7A 3KUEA 2NQPA 4P72A 5L1LA 4I9QA 4KTQA 1XNQK 1C0FA 3CJ9A 2CQCA 3FNNA 4NRUA 5DGAA 3OHAA 1TL1B 4JNEA 5C25A 3O9UA 2R7SA 3IRXA 2R7TA 4LBHA 3IWLA 3VQ7A 2KXNB 1AB8A 1T44A 2DR5A 3ZLJA 2YKMB 1XC3A 4PL7A 3VQ6A 4NLWA 5JMNA 2HAFA 1L3SA 2CPDA 4CLKA 3V6HA 4DL2A 4O44A 1CSJA 3TJAA 1QQOA 3HHLA 3ILOA 2EG1A 3W65A 2W7OA 4B8AB 1N8RO 2O4IA 5D0RA 4NL5A 4E2FB 4BQLA 4O4RA 5JS1A 3OJSA 3BF1A 2BMBA 4G9ZA 2HGLA 6AT1B 4DR6K 2VB6A 4FJXA 1BD6A 3UKUA 2CJAA 4J9SA 5TKWA 1Q5VA 2IDLA 1GLFO 5H1SQ 2UUBK 2A1RA 3Q8RB 3ZX0A 1BMQB 3AV9A 1BUXA 2F4VJ 5J2MA 3CIPA 3K9KA 2IC3B 3MMBA 2ROEA 1RGVA 3R5DA 1X9SA 9ATCB 2VC1A 4NLGA 5H9FJ 4ZVFA 3J7ZO 3PXGa 4LF9J 2JNJA 4J9MA 3LWLA 3HZ6A 2HEKA 2QWQA 3QFWA 3CO9A 4FYXB 2YNGA 1SJ3P 4DV2F 5KG1A 4RW8B 1Y10A 2LYVA 4UY8T 2N3OA 3EM1A 3VGLA 5LMNJ 3HT3A 4MMOA 4HYKA 1KQSM 2XY5A 2XNRA 3SSQA 2XGQA 1RB0A 1U8WA 1VQKS 3W9IA 4GVEA 2V50A 4QIWD 5F0UA 5KTQA 3LW5C 4M42A 2YHAA 3MMJA 4YQWA 2R2SA 2N7CA 2HHWA 1P1TA 2IDEA 4BRGA 2Y1RI 1SKWA 3DRYA 4PXCA 4I6MB 4PRFA 2HBJA 1T3VA 2P51A 3O4WA 4P74A 3M8ZA 2CPFA 3OY9A 4LF4J 5FPDA 3CCLN 4MIWA 2DNKA 3KYLA 1RHKB 4GVBA 1QQMA 4DU1A 1X9MA 4OHWA 3GFXA 5HMXA 3TAGA 3IC1A 1RISA 2M7SA 4KV8A 2E44A 1CJTA 3VQ9A 5LSOA 1YITN 4FYWB 3I56N 1EAYC 3T6JA 4EP5A 2FUG9 2XMJA 3EPGA 1NRKA 4P71A 2UP1A 2QWPA 3SLCA 1ASWA 4B3SK 3CUNA 1LOUA 2DY4A 3EKSA 1OVYA 5KFNA 4CJTA 2XWXA 3L7OA 3IS9B 1K8AT 1RT5A 4DR3F 5M1PA 5HBMA 1IG9A 2BJ7A 5T14A 3JS9A 3RBXA 1RP5A 2HGNA 5HVGA 3L0QA 3R6LB 3Q23A 2AQ4A 1CULA 4I56A 2OTJS 2QXFA 4MFBB 3R5CA 1N48A 4KRFA 1EZZB 1RT4A 1RT3A 4JK9A 3LDOA 3K8VA 4HVZA 3PKMA 1IXKA 1G1XA 5DQIA 4LSNA 1KVAA 5KFMA 3PNIA 3B82A 3ID6A 4FWNA 4KGZB 2A3ZA 1ZTWA 3BEGB 3TAQA 1Z2ZA 2ZWPA 1IBKJ 2OPPA 1SL1A 1VQLN 1ZPVA 1S4FA 4KHPJ 3JXUA 5KFYA 1LWCA 4DR1F 1K73T 1YIJS 1ZOTA 4LF7K 3GIKA 2QKKA 3OYFA 2ZGYA 4MDBA 3P49B 3BDEA 4FJ7A 4DV0J 2GJFA 2HHTA 3CT9A 1VJQA 3OW2R 2D9PA 1L3UA 3UKRB 4NEYA 4RO0A 1Y00A 1QDUB 3KLGA 3L2UA 1SUQB 1C4AA 3M7VA 3D1HA 4JV0A 1NPPA 2CQ3A 3A5NC 4A8SA 1Z4UA 2R8GA 4M5DA 3B6OA 5C25B 1ZZFA 4ZPBA 3UR3C 1I3OB 3QRPA 3IR6B 1PAUB 3CCMN 2GFFA 4W4MA 3D1QA 5KT5A 4QWDA 3VAGA 1HR0J 4WXOA 4H5TA 3VQTA 4ATNA 4YDDB 3C15B 3HJFA 4FF2A 3KJVA 4F3TA 5KT2A 1YF5L 4CJRA 2JRSA 1P9YA 1HQUA 2P9PA 3KDNA 5AFUH 1RKJA 4J2BA 1SQEA 3MMCA 4ZLNA 1UW9A 1RQ0A 2ZF5O 1FWLA 5D4OA 4BS2A 2QYCA 1RI7A 2PBDA 3GG1A 3DLGB 5AZJB 1WKKA 3DN9A 3FDSA 3J80U 3OL7A 2QA4S 3SUNA 4NA2A 5U47A 4BLGA 4Z94A 3CD0A 1XMBA 1GOAA 1M90T 3KKSA 4CJKA 3GMGA 2Y8YA 2GQ2A 3LPTA 1VQNN 3T5KA 2AYMA 3CJKA 3EICA 1U45A 1TKXA 4OI6A 2OEMA 1S10A 2HVZA 3RSEA 5LL6Z 3AO3A 2UXCK 2J8SA 5KFOA 2Y8WA 1E4GT 3TI0A 1EETA 4LY7A 5FROA 4A48A 2EXUA 3M8RA 2IJFA 5KG7A 3UI3A 2IYIA 4CNYA 3HPHA 2PGCA 4CZIA 1BXNA 1FTRA 4X65J 3T19A 2P9IB 5I3PA 2HBMA 4YORA 5EY4A 1MWQA 2AEFA 3VGVA 1ASVA 4HVJA 4WFXA 4PZVA 4F4AA 4ZDNA 5C2CA 3MHYA 4PG5A 4EO8A 1FX2A 3M8WA 4KH6A 5D6GA 2R7QA 5HK4A 2ZJPQ 3AQOA 3MDFA 3IMQJ 3CPWM 1PIEA 1KS2A 4Z0UA 5KG0A 4NWBA 2E5LJ 2WVBA 1CJKB 3AOAA 4PKIA 2KXFA 2G1HA 1NU0A 2PD1A 4HTIA 3CGIA 1ZBIA 4KHUA 4GVBB 2ZEJA 1X4AA 2M8HA 4PCQA 4KH1B 1J9AA 2RQ4A 4DJBA 4KV8B 5FDLB 3FR0A 1VDHA 5I42A 3J7AP 5BJRA 1IQZA 4TYAA 1MMLA 1URRA 3J7Z5 4BGAA 2P9NA 4AHCA 3NL0A 3V2UC 3QWPA 4C8ZA 4DSIA 4CLUA 4JN4A 2IDOA 2RQCA 3N4QA 2XRIA 4FLTA 2IA0A 1RT5B 2JX2A 5G4DA 2G0JA 4MKYA 3T1YJ 4ECUA 4B17A 4E1JA 2MDAA 3OYIA 2PMZD 1QJHA 1WDTA 2OO4A 1NPKA 4WCEQ 1HRHA 2PAVA 1Q78A 3HM9A 1N4LA 3AOCA 3GONA 1NGBA 4DUYJ 2R42A 5FRMA 2JEFA 4X64J 4Q8FA 1KVJA 1BWEA 1KOOA 4FXWA 3FCWA 2DXFA 3NGZA 2MZ1A 2QG9B 5IT4A 2NR0A 1TAUA 3NS5A 2XC9A 4DZ6A 3CPEA 5D4LA 4ZKAA 4LMZA 5D8HB 4J8FA 5JVGQ 5F3ZA 1S99A 1KONA 5FD1A 1HMVA 1Q82O 3CQ8A 2DR9A 3D5MA 4Y2MA 3TAPA 4OYPA 3OBYA 4QIGA 2BANB 3GP9A 3L09A 3KLGB 4ICLB 4CJVA 1U2FA 3UD3P 5CAAA 1VC5A 3TZYA 3W64A 2VA2A 3RRGA 3U9ZA 1OPZA 4FWKA 2AP6A 1GT8A 4CJLA 1UJ5A 5IWAJ 1NBEB 1ZAVA 1QM9A 3TSUA 1KEKA 2GIQA 2J7WA 2ATCB 2ZZNA 4H4MA 2VQFF 1N54B 4DV7F 4QZVB 4DLEA 1RBTA 1C0MA 2X1BA 1CLQA 4ELUA 1X5TA 3KMSA 3T5JA 3I55S 5DM6L 4HI1A 3QYYA 3NXZA 1YRTA 5AQUA 4K43A 3S9HA 5J1PA 3ASMA 2VFTA 1HBMA 3N01A 2AEMA 2I8EA 3QBCA 2Z2MA 1JCGA 2V2ZA 2WW4A 1W0HA 1D5AA 2X6NA 1EARA 1QUVA 1M1HA 1JCFA 4EI2A 1QZ6A 5KT4A 3LGNA 2GA7A 2IRUA 4QIFA 3JTOA 4Q45A 2VFRA 2XY7A 4CHNA 4FJJA 3UNYA 2KFNA 4NLPA 4ILLA 2YHBA 1T7PA 4PABA 2LKZA 3ZTQA 4FLVA 4ZCIA 3P83D 3RSEB 3WNGA 2JEIA 1FJGK 1T3OA 5I4MA 3MR3A 1K6YA 3PRDA 1S6UA 4I6YA 5AR0A 1MNEA 3IAS9 4ZPCA 1KQGB 1CBKA 4WK3A 4J2AA 4OX7A 2VFVA 4DR6J 3DXKB 5L39A 3MM8B 1Q81T 4BRNA 3H42A 4P9SA 3HHNB 5LOQA 2HWTA 2QLFB 1V4TA 4J7CA 2UUBJ 3P39A 1XTZA 3NBPB 3HZGA 1YAGA 1TP7A 1M1KT 5D3GA 5AQMA 1VQ7S 3A3OB 4CHZA 4B1ZA 3AD9C 1C1AA 4LFBK 2Y9HA 2PMWA 1IJJA 1S1UA 4LFCK 4WYBA 4OQJA 3M6VA 4DX5A 2XBPA 2I5JB 4DG1B 4CRJA 3N6NA 4ILGB 1O5JA 3NOCA 3KJFB 3QJLA 2RF2A 4ECSA 4CZKA 3M8SA 1JIHA 2XMMA 3TNVA 1YJWS 2HHHK 2G0CA 2BUPA 5J2QA 4C0OC 4PYDA 5AE2A 1U7LA 1YI2S 3MEDB 1HFEL 5EX3A 5KQ8A 1SL2A 1M5HA 2L9WA 4MKVA 1SBRA 2XCPA 3OQ2A 3PV8A 3D2EA 2ZKUA 2AHOB 4PG4A 5I42B 2W4PA 2FBTA 1TL7B 2ACMA 4KHWA 2YNIB 2KL8A 2RSQA 4YY3K 4FPRA 4FSVA 4QS7A 5AQSA 1HBUA 3CCVN 1FW6A 5KPZA 1NAQA 3G6EN 3R5AA 2IMWP 3OYDA 3PEJA 3UQSA 4N77A 4IQXA 1GH8A 2FC9A 3QBWA 1QHTA 2QN6B 4NMLA 4W5QA 3W3SA 3OPKA 2FZCB 3D2WA 4XPCA 3W8PA 1JK9B 4KHRA 2P9KA 3O3FA 3R8YA 1RTJB 2V69A 3OFEA 1CXUA 4LF6F 2ZOMA 3K5NA 3LH2S 2CNKB 5KT7A 3HO1A 2DR7A 1RAEB 4KH0B 5CCMA 4I2PB 5HMWA 5CHIA 2DEJA 2RILA 3KLFA 3HSDA 1PJ6A 2VZ9A 4B3SJ 2KU7A 4IBNA 1RCHA 3MECA 4DUZK 2ZM6F 4ED8A 4M5MA 2LFVA 4AT1B 1NLKL 1S79A 1Q53A 4CP5A 4FJMA 3BGLA 2BDPA 4DU3A 4IYQA 1HMVB 3PY8A 2G2YA 1OH5A 1KVBA 2P9EA 3DRRB 3SV4A 2VCPA 1VAZA 4PA1A 4M5NA 4X62F 2AU0A 4QS8A 4PYAA 3MPVA 1TKZA 4OI4A 4M7XA 4BRHA 1NEEA 2Z1GA 1U24A 3I9V9 3U1NA 1YGYA 2QSWA 2ZZTA 3EGNA 1VQOS 1XIQA 4H4MB 3VQAA 1H73A 1PCAA 3I8DA 1C0UB 4CESA 2JWNA 3KLIA 2YKNB 5AQRA 4X4TA 1NWKA 3NF8A 3KLVA 1CJUA 2IHR1 4B3OA 1FTCA 3F9KA 1UVJA 3VAIA 4ZVHA 4LR9A 2VG5A 3QNWB 2GMLA 3PVXA 4G3IA 1SKUB 4BRCA 1KXPA 3UWTA 3CMEN 4B1YB 2UVVA 2RB7A 3P5JA 4JI2F 4O3SA 1V3RA 3HVWA 2NXCA 2CPEA 3CM6A 3KK7A 1LFWA 4BDZA 2RQMA 5AXNA 4I2QB 3VWSA 3W62A 4FYDA 3SJHA 1BHLA 2NSCA 1R3NA 3C8YA 5BYQA 5DDQC 5IZHA 2FLOA 2K7KA 1S9GB 1BIUA 3A13A 4YB6A 3QT5A 2P9CA 2ZWOA 3WIVA 1VS3A 1VK3A 1HYSB 4CLTA 3C3LA 4JHDA 3WEEB 1AZS