5LMUK

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5lmuK00
4DV0K 4NXNK 4B3RK 4LF5K 4LF9K 4DR1K 4KHPK 4X66K 4DV2K 4YY3K 4X64K 4JI6K 4JI4K 4DR3K 1HNWK 2UUAK 4V19S 1XNQK 4LFCK 2UXDK 5BR8K 2UUBK 2UXBK 2VQFK 4JI1K 4LFAK 1IBLK 2UXCK 4NXMK 4DV4K 4AQYK 1HNXK 4DV6K 1N33K 4DV5K 4JI5K 4JI2K 5LMNK 1HNZK 1IBMK 1I94K 3JAMO 4GKKK 4JI0K 4JYAK 4DUYK 1N36K 5A2QO 4DR2K 4DUZK 5LL6Z 4OX9K 4YHHK 4CVNE 4LF4K 4DR6K 4B3MK 2UUCK 3T1YK 2HHHK 2UU9K 3OTOK 1J5EK 4GKJK 2ZM6K 4K0KK 4X65K 4LF8K 4DR5K 4LF6K 3T1HK 1XNRK 1HR0K 4JV5K 1IBKK 4JI8K 4CW7B 5LMUK 3J7AP 1N32K 2VQEK 4JI7K 3J80O 4X62K 4DV7K 2F4VK 4LF7K 3J81O 4DR4K 2E5LK 5IT9O 4DV3K 4DR7K 3J7YP 4LFBK 4DV1K 4B3SK 1XMQK 1FJGK 5FLXO 4B3TK 5IWAK 1XMOK 4JI3K 5AJ3K 1N34K
chains in the Genus database with same CATH superfamily
3H3OB 4CJ3A 1IKWA 3V1OA 4A59A 1NK7A 3QERA 5ADXA 4YOWA 4JKFA 4IG3A 4ID5A 3ZSZA 3KLIA 3PX4A 3DXKA 3ATUA 3AAPA 3JYTA 2IC3A 3O3FA 4W5OA 1HNWK 1XWLA 2NRZA 4M63C 5J2MA 4AM6A 3MCAB 3WXKA 4BREA 4CD1A 2BE2A 1RDDA 2RF2A 2O8EB 3VGMA 4BRAA 3O4WA 2Q1NA 3AVKA 4OKKA 3C0BA 2H3GX 2Z1HA 3C65A 4DFMA 4JAXA 3PX0A 4IEIA 2CH6A 3M3ZA 4IOAL 4PUOA 2ZJPL 2GX9A 4HUFA 4M3YA 1KAYA 4J2BA 4NYFA 2IVOA 3U9DA 4O5BA 1M90O 3G6EN 3AVFA 5B8HA 1Q82O 2FBYA 4FJIA 4LF4K 3C7NB 3NF6A 2OA8A 2LSNA 4WF9L 3G0ZA 2QTDA 4JK8A 4CBWA 3OTOK 3V9WA 2UU9K 3NE6A 4FVUA 4KPYA 4ILHA 4CFAA 3HL8A 4YDUC 4CBXA 3ZEUB 4KH4A 4CEFA 4DFKA 4LF8K 4GNIA 4FJJA 3CPEA 3CCMN 3ULEA 2VWBA 1Z26A 3N4PA 1XNRK 1T6DA 2A42A 3G4SN 1X9MA 3D6RA 2ZJQL 5HBMA 1C0UA 3OYCA 3WXIA 3SPZA 3CIPA 1WUAA 4HCBA 1EP4A 4M7XA 4DCHA 3SZ2A 5GIPA 2D0AA 5C24A 4MDAA 3TTFA 3TAFA 5KGXA 3O3HA 4B9TA 5AQKA 2PBDA 4U7BA 4H0XB 3ITHA 4ELVA 5KQ8A 2A40A 3HM9A 3AA3A 1LW0A 2OZSA 2P51A 3L8BA 3CYMA 1B9FA 2Z1IA 1CZ9A 1KVBA 1WSHA 4H03B 5JVHL 3TI0A 1ILYA 4JKAA 1HUXA 4H0VB 1TKZA 1VHXA 4BR0A 1XNQK 1SKSA 1W97L 2I7NA 3S41A 1WSIA 1V4SA 1YITN 1ZBIA 4AILC 3WXMB 1FXXA 1JLQA 3LP3A 2OTJN 1KFSA 2UXCK 4PKGA 3AVMA 2HHQA 5I9EB 2G8IA 5SZTA 2HF4A 4JI2K 1Z6RA 2QWNA 4F9OA 5LMNK 4CZGA 4GKKK 4OJRA 3MN9A 4JI0K 2ZF5O 4ISEA 3NVMA 1S1XA 3VPZA 2HHUA 3V6DA 5GAEP 2FBXA 4OX9K 4H0PA 2Q3SA 3K0SA 4B9UA 1J53A 3E9OA 3LDSA 4O44A 4FJXA 4CJKA 4H0OA 1ASUA 1RTHA 3KKRA 2O8FA 3W0LA 4JKCA 4B9SA 1YTUA 2A5XA 5TKYA 3CQXA 3GDQA 2VG6A 5C15A 4BC4A 4K25A 1VSEA 2HB5A 2XRIA 1NG9A 2KFNA 3K5MA 4JKDA 4ELTA 3PIOL 4CJRA 3T1HK 1NLVA 3VESA 4Z4GA 5C0YA 3RR8A 3LDPA 5JVGL 1G15A 2O4GA 5BPNA 3H08A 2ZJRL 3J81O 5CHIA 3LP2A 4PQUA 3AVBA 4OGEA 1NGIA 5IT9O 1UAXA 3L2VA 1QSLA 1Q9YA 2PY5A 3NH1A 4EZ9A 4FM0A 5I42A 3VEOA 3SBTA 4GVEA 4FK4A 3TABA 3SI6A 4JI3K 2RHKA 1XQSC 4M3TA 4Z4CA 1NGCA 4RW6A 1GOAA 4FWMA 4CGIA 4BRLA 5M1QA 4DV2K 3NGIA 3O5BA 4GY2B 4X64K 4K42A 1NJZA 3MEGA 2HNZA 5JICA 1XC9A 4BR4A 3SAFA 1TVRA 3C6UA 1RBUA 1L3SA 3T69A 3MECA 4FWKA 4KI4A 4LSLA 1RFQA 3OS0A 4CJPA 4F2SA 4CHNA 3CCQN 2IIRA 1NK5A 3U3GA 4XIUA 4DSEA 1I94K 3D45A 2IDOA 4FK0A 1X3MA 4CK1A 4JYAK 4LD0A 1BA1A 4DUZK 3ZLJA 3E66A 1BIUA 3E9PA 1T3VA 1LW2A 3ENHA 2OTLN 1QTMA 4N47A 3DOLA 4EHUA 3S9HA 4KFBA 4FJLA 4B9VA 3CFRA 1HKBA 3A5MC 2HHVA 1CLQA 3OY9A 4FWLA 2HMIA 3CJ7A 5FRNA 4ISGA 5HL7L 4RW4A 4FW2A 3CPWM 4EIAA 1LWCA 2A3ZA 4DU3A 4J2DA 1NGFA 1YVNA 1MDUB 4HWIA 2HHXA 4K0KK 4U67L 3AO4A 1WLJA 4IJAA 1RCHA 4NB4A 5HOOA 4EFHA 1BWFO 4A61A 5LMUK 2VWJA 2HNYA 3K5NA 3SAGA 3AVIA 3SV3A 4CHPA 5AQTA 4E0DA 4B3OA 1YJWN 2Y1JA 5KI6A 3B8AX 4DSIA 3ZYYX 3DAWA 3S3NA 3TAEA 1BCOA 3OYIA 3FZHA 2D4WA 3DM2A 3MN5A 3ZSRA 5MLCQ 4W5TA 1BCMA 1FJGK 4BG9A 3BZKA 4CGJA 4IDKA 2F7TA 4GW6A 2E2QA 3LM2A 4I6MA 3SBGA 2PYLA 4DB3A 3WEEB 5HP1A 2BH1A 3I0RA 3LAKA 4ID1A 1HJRA 4E7HA 1F21A 4DQSA 4H8KA 3V9XA 4FVMA 3THWB 4R79A 3D7EO 2OPRA 1TKXA 3IKMA 3KLEA 3DLRA 4WQ4C 4PA1A 3BF1A 2UUBK 3HJFA 2JWKA 4BRNA 2EHGA 4YNQA 4CEZA 4HUEA 4FK2A 1U6ZA 3BP8A 3ALYA 3CC4N 4O8UA 2ZE2A 3H1QA 5LJVA 2KW4A 1LAVA 3FZKA 2HHSA 4KB1A 2GV9A 1NK4A 3C6TA 4CHYA 1RGIA 5CR4A 4IZ9A 4LY7A 3NHGA 1KXPA 2G8UA 5DM6L 3NFAA 4ZTFA 4IG0A 3C6AA 4EP5A 1QQMA 3LDLA 4YHHK 2EX3A 1I39A 3CQ8A 4BRIA 5KPTA 3QB0A 1JLBA 1D8YA 4AH9A 3PY8A 4BDPA 1KLMA 1RT7A 1S22A 3TARA 1DEJA 3PSFA 1QE1A 2E8AA 2E1ZA 1QQNA 4FJ9A 3CCLN 1Q81O 2NUBA 1NGEA 1RNHA 1K8KA 4WCEL 1EWRA 3KJVA 5BRDA 3I33A 3A8YA 3CMEN 2G8VA 5K14A 5CY4A 3L2RA 1VQ5N 3HO1A 1S1UA 3J7AP 3CJ1A 5AQMA 1SKRA 2YV0X 3U6FA 2FF3B 2RPIA 2NRTA 5FROA 3VF6A 2ASOA 3HSCA 4LH5A 3HP6A 2E5LK 1OH8A 2E20A 5AQOA 2QEXN 2V52B 3OYDA 1ZBUA 2D0CA 5KQDA 1WOQA 4LFBK 1RTJA 3AVNA 1NKEA 2ETJA 4Y0WA 3VGKA 3VA0A 3FGUA 3CCRN 2YNGA 1BU6O 3P38A 3VEWA 3DLEA 4NXNK 3AA5X 3VN5A 2ATQA 3IS9A 4IBNA 5ADXH 3HI0A 2ZGYA 1KC8O 4OLBA 4DFPA 4FZYA 1QSYA 1WSEA 4DWIA 2YKNA 1BI4B 1SV5A 4OVLA 1D9DA 4I9LA 4CFCA 4Z94A 1C0TA 2O8BA 1CZAN 4CERA 4FJ7A 4N5SA 3HPOA 3AVHA 3KHYA 5AQPA 1K73O 4QOZB 5KPZA 3WQTA 4BRPA 3EL2A 3QBWA 3VQ5A 5AZJA 4AQYK 1U2VA 3V1QA 5M1KA 2P9PA 4JI5K 4IFVA 3RMCA 4FW1A 3QEWA 3JAMO 4B1WB 5AQFA 4BE2A 5C42A 3AVGA 3NVKA 2W6LA 3HBTA 3F9KA 4JS4A 4E7IA 3AV9A 3F9MA 4HVJA 4MO5A 4NLCA 4CEOA 2W41A 4CGHA 4DR6K 4AM7A 3IRXA 3QNOA 1NGHA 2WC9A 4YOUA 3ZSYA 1D4XA 3LALA 4E7LA 3A5LC 1TV6A 4BY9C 4BRDA 3QEVA 4E19A 3RWUA 2G8WA 1FKPA 3BEXA 2QKBA 4DHYA 4RW9A 3THYA 3Q7CA 4BQZA 1S6QA 4FWQA 4CBUA 3U3YA 4RG8A 1HKGA 1GLFO 5HLFA 3ISNC 1U48A 1NMDA 4IKFA 5D3GA 3C95A 3O3GA 1UOCA 3MAQA 2GBZA 2W40A 2O8BB 5GIOA 4LF7K 2VCPA 2FXUA 2NZTA 4BDYA 5AQLA 3IAYA 4FJGA 3HOTA 3FZFA 3UE5A 3EEQA 4B9NA 1S5JA 3L3UA 1J54A 1U2VB 2P9PB 3DLLL 4G1QA 5FLXO 2ZGZA 5M1NA 1L5UA 1QHTA 3L2QA 1HPMA 1BQMA 3QESA 3ZETB 2ZD1A 1T03A 2P9KB 3PSIA 3KK7A 1BQNA 1YXQA 2P9SB 2XY7A 2JLEA 4H5TA 1FKOA 5AQNA 4YFUA 4CJTA 3ENOA 3KLHA 4DSJA 1HJOA 3K57A 2NRWA 2AP1A 3OBYA 3NGYA 4PKIA 1NWKA 1RTIA 2J4RA 3P31A 3EE9A 3R1XA 1RT3A 4KHQA 2I7PA 3AGKA 5C12A 3S3OA 4CZIA 4GV3A 3WNGA 1S1TA 3BY5A 3ZX2A 1KVAA 1GLCG 4Z4FA 1HNXK 4IJNA 5DMRA 4Y1DA 3QEIA 3KD5E 3KWGA 4OPHA 1NJIO 5CZ1A 4FPBA 3H46O 4DS5A 4J8FA 5FPMA 5GAGP 4E3SA 1GLAG 4DG1A 2CH5A 4DKWA 3QEXA 3RMBA 1GOCA 4O0IA 4DLEA 4B3MK 2RKIA 3T1YK 4XH4A 4JKBA 5GAHP 1A5XA 3M8PA 4KBOA 2B5JA 5AQSA 4WFBL 4FLXA 3T7ZA 4C1NK 2QXFA 4AHRA 4DQIA 3QIPA 1VSMA 4K8XA 3SUOA 1T05A 4DS4A 4H4MA 1B92A 4BVOA 4CZFA 2XY8A 1SQKA 4AHUA 3DJCA 3KK3A 1N6QA 3FFKB 3O1WA 2QWOA 4JHDB 1LWFA 3LAMA 3EN9A 4X62K 2P5GA 1BGXT 4I2PA 3BUZB 4DR4K 3E1YA 3B6PA 1JLCA 4C1NI 4DR7K 3L4QA 3VQ9A 3HZ6A 3NCIA 4B3SK 4H0YB 4CCHA 3IUCA 4B1YB 3T1AA 4KREA 4DTMA 3DXKB 2D1KA 3EKSA 4H5NA 4K43A 4NCGA 4CZMA 4DTUA 4DU4A 3TTDA 2VG5A 1DT9A 1X1PA 1Q7YO 4C8NA 4JI4K 3MEDA 3R9PA 2YJFA 4BR7A 4WQ5A 2QWQA 2X6NA 4PWDA 2OCEA 3OYGA 4JI1K 1NGAA 3NF9A 1X9WA 3DYAA 5DM7L 5KRTA 2KHOA 4BQLA 4PY5A 4KTWA 3HPHA 5AQHA 4CZLA 3OJSA 3MN6A 1BISA 3MX5A 1R0AA 2YJEA 2D0BA 4ICLA 2Y1IA 2VG7A 3ATVA 4KHUA 5J2PA 5FPNA 3VF4A 1HRHA 2CGLA 5EOYA 3TSUA 4NYNA 3ZT1A 1T6CA 4BGAA 4YOYA 3VQEA 3ULEB 4BE1A 1IO2A 4Z4EA 3RSEA 3OS2A 2OPPA 3N4QA 1TYQA 1T7PA 1YIJN 1X9JA 4CD3A 4OGCA 1XC3A 2F8TA 2VGNA 5C10A 3O1BA 3OA9A 5AQIA 3D0PA 3S3MA 4C8KA 1SZ2A 2HNDA 5AQWA 1EQYA 1QZ5A 3J80O 4IO9L 3VQ4A 2BDPA 3KLFA 4IWVA 4KI6A 1A5WA 5KPRA 1HYZA 4H4OA 4DSFA 4BG8A 1YTAA 2WOMA 2YHWA 1XMQK 4CJUA 4EHTA 5IWAK 1NKCA 2P9UA 4BR5A 2UXBK 4ILJA 2F9TA 4FLZA 1KAXA 3WUHA 1ESVA 3SJHA 1NGGA 3PIPL 4MLHA 1WBDA 5C2FA 3V9ZA 3WXJA 1HPZA 2DFEA 3K5OA 3PUFA 3TAMA 1U4BA 3K9JA 2HBJA 4Z4IA 2DFFA 4MO4A 4YY3K 3HK2A 1RDUA 3L6QA 1ASWA 2IS3A 2OYQA 1YI2N 1HNIA 4CF9A 1NJXA 1S6PA 3CJ9A 1BDGA 4GVMA 3SMSA 5E41A 1TYQB 3AO3A 3CF5L 1VQ6N 2F8SA 4KH5A 2P5OA 4WYBA 4CZJA 4Z4HA 5AQZA 1HNZK 3WXLA 1MA9B 3VF2A 4BWJA 4M3ZA 4CZEA 1VRUA 4OO1J 1JCFA 2O8FB 4BGBA 3MX2A 2QA4N 4FJ5A 1UWBA 3DLGA 4C8OA 1HQUA 3PV8A 4M41A 2R7YA 2YKMA 3O8MA 1TK5A 4J2AA 5BPMA 3ZSQA 2UYTA 3CJAA 1J5EK 1C1AA 3CC2N 3A0IX 5H1SQ 2ASMA 3NH2A 2E4LA 4PKHA 1EX4A 4CF2A 2X6SA 3H1VX 1FK9A 2E88A 4CZHA 3RMAA 1VQON 4LF6K 4KHYA 3SCXA 5HRSA 1WB9A 3IG1A 3VQCA 3WT0A 4NLBA 4FO0A 4ZTJA 1RDWX 2O8CA 4KKOA 1KD1O 1HKCA 3NBPA 1RBSA 4H5VA 4EZ6A 1LWEA 3OYHA 1J9AA 3EKUA 3WNEA 1WBBA 3CCJN 4F3TA 4QAGA 1VQLN 1XMOK 1IG8A 5J2QA 1N34K 2ZQBA 1NMNA 3M1FA 3A5NC 4M3WA 4YDUA 3FE1A 5BN9A 4X66K 1RTDA 3TAGA 3M5RA 4DTXA 3LL3A 3F2KA 3O4NA 2BANA 1C0GA 3P4IA 4I9QA 3AO1A 4A2BA 2RN2A 4O4GA 4CGDA 4XH1A 1GLDG 1RDAA 4CFDA 2KLAA 1SL0A 3CI5A 4CHZA 1KVCA 3ULDA 1Z25A 3WNHA 2VGMA 4QS8A 3MWPA 2NLXA 2BUPA 3AVCA 3O9SA 3QDKA 1KFDA 3KZBA 3WQUA 2KFZA 4I7FA 2AJQA 1S9EA 3F73A 4CHQA 4DMNA 2GUPA 3GG4A 5EU7A 3DXMA 3O80A 4RTFD 4CJQA 3SJJA 2GUIA 2O8CB 2OPQA 1WAJA 2HOEA 3HPGA 2WTUA 3SUPA 2QK9A 1BOTO 4KTQA 3R8EA 2KZZA 4Z0UA 4DFJA 3VQ8A 5I3UA 4ELUA 4FJMA 1ITGA 3IDHA 3OYBA 1EETA 1HNVA 2E2NA 1GOBA 3I55N 3AA4A 1SAZA 4FZXC 4Q5VA 3OYEA 1QVFM 3I56N 3CERA 4X65K 1VSDA 1REVA 2YHBA 3PO5A 4Y1CA 1B9DA 3NDKA 1S1WA 2CGJA 5AQQA 1OKJA 4FLTA 1ATSA 1O13A 1VSJA 4FYDA 1LAWA 4IOXA 3DRPA 4FWNA 3G71N 4FOIA 4M7YA 4I6MB 4FJNA 4DV1K 4BWMA 4F2RA 4CF0A 4O5FA 4IOCL 4DTJA 2ZWHA 3W3DA 5AJ3K 3MCPA 3VTIA 4XH5A 4DV0K 2QI2A 2XY6A 1W2BM 3KWIA 3O9TA 3QMLA 2V7YA 3VEYA 2VYPA 3DXMB 2XO7A 3NMUA 3FZLA 3VQAA 3CCUN 2F9WA 3SQ0A 3CHWA 4IFEA 4CZKA 1WNSA 3CJCA 3P5JA 5TKWA 2KQ2A 3K9KA 2VWKA 2DY4A 3O6WA 4LFCK 1HMVA 3L4IA 2GELA 1MU2A 1NK6A 4CEEA 1JXEA 3CC7N 4FSVA 5JMVA 3VQBA 1N8RO 1GLLO 1N5YA 1IBLK 3OW2M 4BACA 2ITGA 4C23A 1W7AA 4CIEA 3CCVN 3VQ7A 5AQYA 3PLAA 3HVRA 4MFBA 3TWHA 1E3MA 2O4IA 3NF8A 1LOTB 3OYNA 3AO5A 1P8ZA 4N41A 1RT4A 1VSHA 3P39A 3T19A 4CVNE 2FBTA 4NO7A 4B1UB 1NJWA 2HHTA 2YI1A 1UA1A 4OKJA 3VTHA 3OYMA 2X78A 4WQ5C 1U47A 2QXLA 3GOIA 4IEEA 5AQXA 3NH0A 1K8KB 4PL8A 4GKJK 1TGOA 4YORA 1VQ9N 3VEVA 3J7ZO 2ZM6K 1GLBG 2A1RA 3K59A 4CJLA 1NKBA 3QETA 4BC5A 2I5JA 3VOVA 3D2FA 3H3NO 3CCSN 5HRRA 1SUQA 1VK0A 1RT6A 5JLHA 2ITMA 1RT5A 2IOCA 4KO0A 4CGFA 1DTQA 3CFPA 5LY3A 1M1KO 4CEQA 4FLWA 1KLNA 3TSPA 4B9LA 4GV9A 1TAQA 3QICA 3TR8A 5BR9A 5FDLA 5AR0A 5F2RA 4EP4A 1TUUA 4M45A 2D0PA 3FZMA 5BPLA 3OHRA 3P83D 3QLHA 4BC2A 2P9IA 1ZC6A 4A5BA 1Q18A 1KSPA 2O8DA 1BUPA 1ZBHA 4KAZA 1RBRA 3QINA 3KK1A 4CEDA 4ISFA 1ASVA 3OYFA 5AZJB 4BR2A 5AFUA 3QBXA 3QNNA 4BROA 5BR8K 3R3LA 1T8EA 4OLAA 4IXCA 2WBNA 3EY1A 1S3XA 5AQGA 2YNIA 4CGGA 2Z1GA 4DF4A 4JEPA 1JXBA 1OH7A 3C94A 1I3AA 4DSLA 1RBTA 1SL2A 4QS9A 1N33K 1QHAA 1WSJA 3O9QA 3D2FB 3T3FA 2O8EA 3OVNA 4WE1A 3THXA 4FL9A 3VMFB 2HHWA 2F96A 1VRTA 2W6KA 3OJUA 4K8ZA 4CEBA 2PAVA 1EO1A 3EO3A 2NRVA 5F1XA 1TKTA 4K41A 2OZMA 2UUCK 1RDCA 1HYVA 2YNHA 3F5TA 3OBWA 4CE9A 5BN8A 4DQPA 1VSKA 3THYB 5SWMA 4B1ZA 4BE0A 1EKEA 2WONA 4IDHA 5FPDA 4GV6A 1JLEA 4RW7A 5GINA 2E1YA 5E26A 2YNFA 5JS2A 3G25A 5EVZA 2P9IB 3ZCMA 1EWQA 4CJ5A 1C6VA 4FXDA 3LZIA 1IBKK 3RMDA 3GL1A 2NRXA 3OYLA 1BA0A 4CIFA 3ZEUA 5AQJA 2A1SA 3TU5A 4JI7K 1HX1A 4N56A 2F4VK 4I2QA 1DKGD 4F3OA 4E1NA 4AHSA 2A6AA 1OVYA 2P9LA 4DV3K 4N76A 3RRHA 3J7YP 1Q86O 1YT3A 1NBWA 2AA4A 1QQOA 1VQMN 1EXQA 2XY5A 1Z05A 2KZMA 2G8HA 1YUWA 5C2DA 1CXUA 4MQ3A 4G9ZA 4KHWA 4E7KA 1ZXOA 3THXB 3SPYA 4IO8A 2Q0RA 3E01A 4M3XA 2E2OA 4H5WA 4CI6A 3JSMA 1D9FA 3HT3A 3OYJA 3M8QA 4JI6K 3MXMA 3LPTA 1TAUA 3LANA 3QFUA 1YJNN 1Y64A 4DSKA 3QFPA 4CJ4A 3HYFA 4DQRA 1W9HA 4LSNA 1WAFA 5HROA 1S72N 3PO4A 1ZBSA 5EX5A 1O1WA 5JLFA 4CIGA 4CJ7A 5CZ2A 1U49A 4GMJB 3CG7A 3BF3A 3O4QA 1R59O 2P9NA 5A2QO 1QZ6A 4E89A 3RTVA 2IVPA 3ZSWA 3MDQA 2DPNA 4CJSA 2HVHA 4JS5A 2FSNA 1JCGA 1OH5A 3DMJA 3LZJA 1YHQN 1TK0A 1ATNA 2P9LB 1MWMA 4TSXA 4BRMA 2IVNA 4DTNA 4OPAA 4FJKA 3JS6A 3THVA 3A2FA 5EY4A 1DTTA 1X3NA 4OPJA 3AAQA 3I8BA 2Q36A 4W5NA 1ZBFA 3ASMA 4JLHA 4UQGA 1JCEA 2E6MA 4CJVA 3RR7A 3SQ1A 4FZZA 5KRSA 1D5AA 3DLKA 3DWLA 3DRRA 2JGUA 4BRGA 1VQ4N 5FRMA 1NGDA 2G8KA 1XUPO 3MN7A 4CHOA 1A5VA 1S1VA 4BR9A 5J2NA 3ZSVA 4FLYA 4JKEA 1ATRA 3AVJA 4B1VA 5AQRA 1IV0A 5LJWA 2HBKA 5AZIA 2HBLA 2V51B 2W42A 5CYMA 4Q0BA 4JK9A 3J8AA 4A5AA 3SK3A 2GTDA 3OYKA 4B9MA 4HTLA 3CETA 2P9NB 3ENBA 4B3RK 4LF5K 1VQPN 4DR1K 2YHYA 3H6EA 4AF1A 4YOTA 3ZT4A 1NGJA 4AHVA 3PX6A 3AARA 1J5OA 3Q7BA 2RE2A 3SV4A 1IJJA 4DQ8A 4V19S 2QWLA 3HM8A 3P1GA 2UXDK 2BTFA 4KRFA 1H1VA 4O55A 1L3UA 4FWSA 3G10A 1BL3A 2E2PA 2HSTA 4EAHD 1YF5L 3SUNA 4H5RA 5KTQA 4OKEA 3CXCM 4BDZA 1IBMK 1NGBA 4CEAA 4DQQA 1KAZA 1JLAA 3ZX3A 3BDPA 3HOSA 4DUYK 2KKZA 3CFOA 4E1MA 3HP9A 1LV5A 3DI6A 2G8FA 3IFRA 4B8CA 5LL6Z 5BRHA 1CXQA 4YOXA 2FF6A 2HF3A 3VA3A 1C1CA 3KLGA 3ZSOA 1NK9A 3AGRA 5AZIB 3AVLA 3RSEB 4FCYA 3ZT2A 3CJBA 4CK3A 3AVAA 1QQCA 3K5LA 1DGKN 4JNEA 2OPSA 3LDQA 4KB0A 1CZBA 3LPUA 5HRPA 4CJWA 3LWMA 1WN7A 4BRQA 1FW6A 5F0XA 3KIOA 1T44A 4DR5K 1OVQA 1RILA 1ZYQA 3AO2A 4FJHA 4JI8K 1GLJO 2FC0A 4JD2A 1BIZA 1QVGM 1SS6A 3L2WA 3M8SA 5HRNA 2P9UB 4JRPA 1WSGA 3OYAA 4PL7A 4WFAL 3HXMA 4BRFA 2D0OA 1E4FT 3HSTB 1IH7A 4M42A 3HTVA 3NAEA 4CK2A 3H45C 1JLGA 4H0TB 1U45A 4F8RA 1VSLA 3VQPA 4HUGA 3MXJA 2IGIA 4DTSA 2CGKA 4KHPK 2HW3A 5CYQA 3VENA 5AQVA 1VQKN 3CM6A 2XHBA 3FFIA 3WEEA 4A2AA 4CF8A 4B1XB 4L3QA 3OS1A 2FLOA 1VAZA 3O9RA 1Y97A 2WUSA 4OPKA 4LFAK 1W0HA 1KCFA 4KV8A 3U4LA 3THWA 1IKYA 4RWTA 3KD1E 1KTQA 4DV4K 1VQ8N 4DV6K 4FJ8A 4KHNA 2Q31A 4WFNL 4W5QA 3TANA 3EE8A 1JKHA 3MEEA 4QS7A 3V1RA 3VEXA 1N36K 4DLGA 2NRRA 1K6YA 3VQDA 4JD2B 5KGWA 1JLFA 1TL1A 3V81A 3U9ZA 3FR0A 1P90A 1YVUA 1JJ2M 4JRQA 1IG9A 4W5RA 5M1FA 2Q97A 2HHHK 4NCBA 2X74A 3RVCA 1L3TA 4DTRA 2QM1A 1OH6A 1C1BA 3ID6A 4RCHA 3E9LA 1VSFA 4XEIA 3KK2A 1XI1A 3SLCA 1L3VA 4MDBA 4J2EA 1XHXA 4AHCA 1N32K 1K9MO 4ILGB 4YOVA 2QWMA 4JN4A 2QW9A 1HYSA 5C25A 4JK7A 3CD6N 3UIQA 4BRHA 4F4KA 2Q0UA 4UY8O 1VSIA 3VETA 3UB5A 5BREA 4QCLA 3L0QA 2YCHA 2ASPA 1NOZA 3NGZA 2GEMA 1NM1A 3BZCA 3SUQA 3GBTA 1X9SA 5T7BA 2YHXA 2GWKA 4FWOA 4AHTA 5BRFA 5J1EA 1RBVA 2FBVA 4FM2A 4FWRA 3V9UA 4JKHA 3U8XA 3DRSA 3LM9A 4M3RA 3C6HA 4DR3K 1C0MA 3ZX0A 4BRKA 1YAGA 4B9QA 5AFUH 1QS4A 4FM1A 3K58A 1KRPA 3DLHA 1QSSA 3MWTA 2VQFK 4B8AB 2B4JA 4KH6A 1K8AO 1BI4A 2Z1JA 3WNFA 5CE3A 4E7JA 3TSQA 1TKDA 4O0JA 3V9SA 4RW8A 4BRCA 4DV5K 3TAQA 2KTQA 5AQUA 3LDNA 4FOEA 3CQYA 3SNNA 3SQ4A 3LWLA 3SMPA 1JL2A 3SAHA 3QO9A 5GADP 1RDBA 3SYZA 4HTUA 3EZ5A 1XHZA 3ID8A 4CFBA 1TK8A 1HLUA 4FLVA 3ZSXA 3TAPA 4PHTX 2OANA 1IKVA 1BO5O 2WFBA 3DOKA 1NK8A 1SL1A 3QIOA 1MWKA 3TTCA 4L8RB 4CESA 2E6LA 3I0SA 3HRGA 2QKKA 1V4TA 3FLCO 5M1PA 3AA2A 4C8LA 5ELZA 1TL3A 4C8MA 3RRGA 4DTOA 1E4GT 3VQQA 4CW7B 1YJ9N 3UKUA 2VQEK 3CM5A 4DV7K 1VQ7N 3KKSA 3V4IA 3LDOA 1Q9XA 3VQ6A 1ZBLA 2YX6A 2FSKA 3L3VA 1RT1A 3SQ2A 1NJYA 3O9UA 5JS1A 4JKGA 2HBMA 4E1JA 4A57A 2P1JA 3CCEN 1BHLA 2JWLA 4KHSA 3VERA 4KTZA 3BGRA 3K2PA 1NK0A 4LF9K 2HMPA 5E84A 3I8DA 1VQNN 3LP1A 3MMVA 4HHTA 1LCUA 3O08A 1U04A 2GWJA 1S9GA 3ZETA 1WSFA 2UUAK 3VEZA 2P9KA 4DU1A 2P9SA 3HVTA 1J6ZA 3B6OA 3UKRA 2HVIA 4CJFA 4NXMK 4LC9B 1NOYA 3MK6A 4BVPA 4BC3A 2DTUA 4CJEA 2PZSA 3D2EA 1BG3A 1C0FA 2FSJA 1TUYA 3LP0A 1IKXA 4DR2K 3UKUB 5FPEA 3CMAN 4O8KA 1JL1A 2D5RA 1NNEA 2B6AA 2IAJA 4LH4A 3QEPA 5EXWA 2BGGA 1RT2A 2QWRA 3GE1A 4NCAA 2PYJA 4CF1A 3DLBA 4JKGB 2PFUA 1HQEA 4R5PA 2NNWA 3EYZA 3MXIA 3ZT3A 4CECA 1SKWA 5M1OA 3EZWA 3AY9A 2V7ZA 3A5OC 3KVGA 1UA0A 2DFHA 3TPQA 4FLUA 3JXUA 1Q8IA 2QWPA 3ZT0A 4FWPA 3IMXA 2NRHA 3M8RA 1HR0K 4JV5K 2Q2RA 3R6MA 1DLOA 1GLEG 1KQSM 4DTPA 4A62A 4M3UA 4B08A 4DF8A 1G99A 3NF7A 4WQ4A 3UKRB 4FPAA 4JHDA 1NU0A 3C7NA 4HCCA 3VGLA 4IFYA 5DK5A 3KTQA 2YHAA 4B3TK 4ZHRA 2EWSA 2O8DB 4MLEA 2A41A 3M6GA 3D2EB 3L2UA
chains in the Genus database with same CATH topology
4DV0K 4NXNK 4B3RK 4LF5K 4LF9K 4DR1K 4KHPK 4X66K 4DV2K 4YY3K 4X64K 4JI6K 4JI4K 4DR3K 1HNWK 2UUAK 4V19S 1XNQK 4LFCK 2UXDK 5BR8K 2UUBK 2UXBK 2VQFK 4JI1K 4LFAK 1IBLK 2UXCK 4NXMK 4DV4K 4AQYK 1HNXK 4DV6K 1N33K 4DV5K 4JI5K 4JI2K 5LMNK 1HNZK 1IBMK 1I94K 3JAMO 4GKKK 4JI0K 4JYAK 4DUYK 1N36K 5A2QO 4DR2K 4DUZK 5LL6Z 4OX9K 4YHHK 4CVNE 4LF4K 4DR6K 4B3MK 2UUCK 3T1YK 2HHHK 2UU9K 3OTOK 1J5EK 4GKJK 2ZM6K 4K0KK 4X65K 4LF8K 4DR5K 4LF6K 3T1HK 1XNRK 1HR0K 4JV5K 1IBKK 4JI8K 4CW7B 5LMUK 3J7AP 1N32K 2VQEK 4JI7K 3J80O 4X62K 4DV7K 2F4VK 4LF7K 3J81O 4DR4K 2E5LK 5IT9O 4DV3K 4DR7K 3J7YP 4LFBK 4DV1K 4B3SK 1XMQK 1FJGK 5FLXO 4B3TK 5IWAK 1XMOK 4JI3K 5AJ3K 1N34K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 K;  4NXN K;  4B3R K;  4LF5 K;  4LF9 K;  4DR1 K;  4KHP K;  4X66 K;  4DV2 K;  4YY3 K;  4X64 K;  4JI6 K;  4JI4 K;  4DR3 K;  1HNW K;  2UUA K;  4V19 S;  1XNQ K;  4LFC K;  2UXD K;  5BR8 K;  2UUB K;  2UXB K;  2VQF K;  4JI1 K;  4LFA K;  1IBL K;  2UXC K;  4NXM K;  4DV4 K;  4AQY K;  1HNX K;  4DV6 K;  1N33 K;  4DV5 K;  4JI5 K;  4JI2 K;  5LMN K;  1HNZ K;  1IBM K;  1I94 K;  3JAM O;  4GKK K;  4JI0 K;  4JYA K;  4DUY K;  1N36 K;  5A2Q O;  4DR2 K;  4DUZ K;  5LL6 Z;  4OX9 K;  4YHH K;  4CVN E;  4LF4 K;  4DR6 K;  4B3M K;  2UUC K;  3T1Y K;  2HHH K;  2UU9 K;  3OTO K;  1J5E K;  4GKJ K;  2ZM6 K;  4K0K K;  4X65 K;  4LF8 K;  4DR5 K;  4LF6 K;  3T1H K;  1XNR K;  1HR0 K;  4JV5 K;  1IBK K;  4JI8 K;  4CW7 B;  5LMU K;  3J7A P;  1N32 K;  2VQE K;  4JI7 K;  3J80 O;  4X62 K;  4DV7 K;  2F4V K;  4LF7 K;  3J81 O;  4DR4 K;  2E5L K;  5IT9 O;  4DV3 K;  4DR7 K;  3J7Y P;  4LFB K;  4DV1 K;  4B3S K;  1XMQ K;  1FJG K;  5FLX O;  4B3T K;  5IWA K;  1XMO K;  4JI3 K;  5AJ3 K;  1N34 K; 
#chains in the Genus database with same CATH topology
 3H3O B;  4CJ3 A;  1IKW A;  3V1O A;  4A59 A;  1NK7 A;  3QER A;  5ADX A;  4YOW A;  4JKF A;  4IG3 A;  4ID5 A;  3ZSZ A;  3KLI A;  3PX4 A;  3DXK A;  3ATU A;  3AAP A;  3JYT A;  2IC3 A;  3O3F A;  4W5O A;  1HNW K;  1XWL A;  2NRZ A;  4M63 C;  5J2M A;  4AM6 A;  3MCA B;  3WXK A;  4BRE A;  4CD1 A;  2BE2 A;  1RDD A;  2RF2 A;  2O8E B;  3VGM A;  4BRA A;  3O4W A;  2Q1N A;  3AVK A;  4OKK A;  3C0B A;  2H3G X;  2Z1H A;  3C65 A;  4DFM A;  4JAX A;  3PX0 A;  4IEI A;  2CH6 A;  3M3Z A;  4IOA L;  4PUO A;  2ZJP L;  2GX9 A;  4HUF A;  4M3Y A;  1KAY A;  4J2B A;  4NYF A;  2IVO A;  3U9D A;  4O5B A;  1M90 O;  3G6E N;  3AVF A;  5B8H A;  1Q82 O;  2FBY A;  4FJI A;  4LF4 K;  3C7N B;  3NF6 A;  2OA8 A;  2LSN A;  4WF9 L;  3G0Z A;  2QTD A;  4JK8 A;  4CBW A;  3OTO K;  3V9W A;  2UU9 K;  3NE6 A;  4FVU A;  4KPY A;  4ILH A;  4CFA A;  3HL8 A;  4YDU C;  4CBX A;  3ZEU B;  4KH4 A;  4CEF A;  4DFK A;  4LF8 K;  4GNI A;  4FJJ A;  3CPE A;  3CCM N;  3ULE A;  2VWB A;  1Z26 A;  3N4P A;  1XNR K;  1T6D A;  2A42 A;  3G4S N;  1X9M A;  3D6R A;  2ZJQ L;  5HBM A;  1C0U A;  3OYC A;  3WXI A;  3SPZ A;  3CIP A;  1WUA A;  4HCB A;  1EP4 A;  4M7X A;  4DCH A;  3SZ2 A;  5GIP A;  2D0A A;  5C24 A;  4MDA A;  3TTF A;  3TAF A;  5KGX A;  3O3H A;  4B9T A;  5AQK A;  2PBD A;  4U7B A;  4H0X B;  3ITH A;  4ELV A;  5KQ8 A;  2A40 A;  3HM9 A;  3AA3 A;  1LW0 A;  2OZS A;  2P51 A;  3L8B A;  3CYM A;  1B9F A;  2Z1I A;  1CZ9 A;  1KVB A;  1WSH A;  4H03 B;  5JVH L;  3TI0 A;  1ILY A;  4JKA A;  1HUX A;  4H0V B;  1TKZ A;  1VHX A;  4BR0 A;  1XNQ K;  1SKS A;  1W97 L;  2I7N A;  3S41 A;  1WSI A;  1V4S A;  1YIT N;  1ZBI A;  4AIL C;  3WXM B;  1FXX A;  1JLQ A;  3LP3 A;  2OTJ N;  1KFS A;  2UXC K;  4PKG A;  3AVM A;  2HHQ A;  5I9E B;  2G8I A;  5SZT A;  2HF4 A;  4JI2 K;  1Z6R A;  2QWN A;  4F9O A;  5LMN K;  4CZG A;  4GKK K;  4OJR A;  3MN9 A;  4JI0 K;  2ZF5 O;  4ISE A;  3NVM A;  1S1X A;  3VPZ A;  2HHU A;  3V6D A;  5GAE P;  2FBX A;  4OX9 K;  4H0P A;  2Q3S A;  3K0S A;  4B9U A;  1J53 A;  3E9O A;  3LDS A;  4O44 A;  4FJX A;  4CJK A;  4H0O A;  1ASU A;  1RTH A;  3KKR A;  2O8F A;  3W0L A;  4JKC A;  4B9S A;  1YTU A;  2A5X A;  5TKY A;  3CQX A;  3GDQ A;  2VG6 A;  5C15 A;  4BC4 A;  4K25 A;  1VSE A;  2HB5 A;  2XRI A;  1NG9 A;  2KFN A;  3K5M A;  4JKD A;  4ELT A;  3PIO L;  4CJR A;  3T1H K;  1NLV A;  3VES A;  4Z4G A;  5C0Y A;  3RR8 A;  3LDP A;  5JVG L;  1G15 A;  2O4G A;  5BPN A;  3H08 A;  2ZJR L;  3J81 O;  5CHI A;  3LP2 A;  4PQU A;  3AVB A;  4OGE A;  1NGI A;  5IT9 O;  1UAX A;  3L2V A;  1QSL A;  1Q9Y A;  2PY5 A;  3NH1 A;  4EZ9 A;  4FM0 A;  5I42 A;  3VEO A;  3SBT A;  4GVE A;  4FK4 A;  3TAB A;  3SI6 A;  4JI3 K;  2RHK A;  1XQS C;  4M3T A;  4Z4C A;  1NGC A;  4RW6 A;  1GOA A;  4FWM A;  4CGI A;  4BRL A;  5M1Q A;  4DV2 K;  3NGI A;  3O5B A;  4GY2 B;  4X64 K;  4K42 A;  1NJZ A;  3MEG A;  2HNZ A;  5JIC A;  1XC9 A;  4BR4 A;  3SAF A;  1TVR A;  3C6U A;  1RBU A;  1L3S A;  3T69 A;  3MEC A;  4FWK A;  4KI4 A;  4LSL A;  1RFQ A;  3OS0 A;  4CJP A;  4F2S A;  4CHN A;  3CCQ N;  2IIR A;  1NK5 A;  3U3G A;  4XIU A;  4DSE A;  1I94 K;  3D45 A;  2IDO A;  4FK0 A;  1X3M A;  4CK1 A;  4JYA K;  4LD0 A;  1BA1 A;  4DUZ K;  3ZLJ A;  3E66 A;  1BIU A;  3E9P A;  1T3V A;  1LW2 A;  3ENH A;  2OTL N;  1QTM A;  4N47 A;  3DOL A;  4EHU A;  3S9H A;  4KFB A;  4FJL A;  4B9V A;  3CFR A;  1HKB A;  3A5M C;  2HHV A;  1CLQ A;  3OY9 A;  4FWL A;  2HMI A;  3CJ7 A;  5FRN A;  4ISG A;  5HL7 L;  4RW4 A;  4FW2 A;  3CPW M;  4EIA A;  1LWC A;  2A3Z A;  4DU3 A;  4J2D A;  1NGF A;  1YVN A;  1MDU B;  4HWI A;  2HHX A;  4K0K K;  4U67 L;  3AO4 A;  1WLJ A;  4IJA A;  1RCH A;  4NB4 A;  5HOO A;  4EFH A;  1BWF O;  4A61 A;  5LMU K;  2VWJ A;  2HNY A;  3K5N A;  3SAG A;  3AVI A;  3SV3 A;  4CHP A;  5AQT A;  4E0D A;  4B3O A;  1YJW N;  2Y1J A;  5KI6 A;  3B8A X;  4DSI A;  3ZYY X;  3DAW A;  3S3N A;  3TAE A;  1BCO A;  3OYI A;  3FZH A;  2D4W A;  3DM2 A;  3MN5 A;  3ZSR A;  5MLC Q;  4W5T A;  1BCM A;  1FJG K;  4BG9 A;  3BZK A;  4CGJ A;  4IDK A;  2F7T A;  4GW6 A;  2E2Q A;  3LM2 A;  4I6M A;  3SBG A;  2PYL A;  4DB3 A;  3WEE B;  5HP1 A;  2BH1 A;  3I0R A;  3LAK A;  4ID1 A;  1HJR A;  4E7H A;  1F21 A;  4DQS A;  4H8K A;  3V9X A;  4FVM A;  3THW B;  4R79 A;  3D7E O;  2OPR A;  1TKX A;  3IKM A;  3KLE A;  3DLR A;  4WQ4 C;  4PA1 A;  3BF1 A;  2UUB K;  3HJF A;  2JWK A;  4BRN A;  2EHG A;  4YNQ A;  4CEZ A;  4HUE A;  4FK2 A;  1U6Z A;  3BP8 A;  3ALY A;  3CC4 N;  4O8U A;  2ZE2 A;  3H1Q A;  5LJV A;  2KW4 A;  1LAV A;  3FZK A;  2HHS A;  4KB1 A;  2GV9 A;  1NK4 A;  3C6T A;  4CHY A;  1RGI A;  5CR4 A;  4IZ9 A;  4LY7 A;  3NHG A;  1KXP A;  2G8U A;  5DM6 L;  3NFA A;  4ZTF A;  4IG0 A;  3C6A A;  4EP5 A;  1QQM A;  3LDL A;  4YHH K;  2EX3 A;  1I39 A;  3CQ8 A;  4BRI A;  5KPT A;  3QB0 A;  1JLB A;  1D8Y A;  4AH9 A;  3PY8 A;  4BDP A;  1KLM A;  1RT7 A;  1S22 A;  3TAR A;  1DEJ A;  3PSF A;  1QE1 A;  2E8A A;  2E1Z A;  1QQN A;  4FJ9 A;  3CCL N;  1Q81 O;  2NUB A;  1NGE A;  1RNH A;  1K8K A;  4WCE L;  1EWR A;  3KJV A;  5BRD A;  3I33 A;  3A8Y A;  3CME N;  2G8V A;  5K14 A;  5CY4 A;  3L2R A;  1VQ5 N;  3HO1 A;  1S1U A;  3J7A P;  3CJ1 A;  5AQM A;  1SKR A;  2YV0 X;  3U6F A;  2FF3 B;  2RPI A;  2NRT A;  5FRO A;  3VF6 A;  2ASO A;  3HSC A;  4LH5 A;  3HP6 A;  2E5L K;  1OH8 A;  2E20 A;  5AQO A;  2QEX N;  2V52 B;  3OYD A;  1ZBU A;  2D0C A;  5KQD A;  1WOQ A;  4LFB K;  1RTJ A;  3AVN A;  1NKE A;  2ETJ A;  4Y0W A;  3VGK A;  3VA0 A;  3FGU A;  3CCR N;  2YNG A;  1BU6 O;  3P38 A;  3VEW A;  3DLE A;  4NXN K;  3AA5 X;  3VN5 A;  2ATQ A;  3IS9 A;  4IBN A;  5ADX H;  3HI0 A;  2ZGY A;  1KC8 O;  4OLB A;  4DFP A;  4FZY A;  1QSY A;  1WSE A;  4DWI A;  2YKN A;  1BI4 B;  1SV5 A;  4OVL A;  1D9D A;  4I9L A;  4CFC A;  4Z94 A;  1C0T A;  2O8B A;  1CZA N;  4CER A;  4FJ7 A;  4N5S A;  3HPO A;  3AVH A;  3KHY A;  5AQP A;  1K73 O;  4QOZ B;  5KPZ A;  3WQT A;  4BRP A;  3EL2 A;  3QBW A;  3VQ5 A;  5AZJ A;  4AQY K;  1U2V A;  3V1Q A;  5M1K A;  2P9P A;  4JI5 K;  4IFV A;  3RMC A;  4FW1 A;  3QEW A;  3JAM O;  4B1W B;  5AQF A;  4BE2 A;  5C42 A;  3AVG A;  3NVK A;  2W6L A;  3HBT A;  3F9K A;  4JS4 A;  4E7I A;  3AV9 A;  3F9M A;  4HVJ A;  4MO5 A;  4NLC A;  4CEO A;  2W41 A;  4CGH A;  4DR6 K;  4AM7 A;  3IRX A;  3QNO A;  1NGH A;  2WC9 A;  4YOU A;  3ZSY A;  1D4X A;  3LAL A;  4E7L A;  3A5L C;  1TV6 A;  4BY9 C;  4BRD A;  3QEV A;  4E19 A;  3RWU A;  2G8W A;  1FKP A;  3BEX A;  2QKB A;  4DHY A;  4RW9 A;  3THY A;  3Q7C A;  4BQZ A;  1S6Q A;  4FWQ A;  4CBU A;  3U3Y A;  4RG8 A;  1HKG A;  1GLF O;  5HLF A;  3ISN C;  1U48 A;  1NMD A;  4IKF A;  5D3G A;  3C95 A;  3O3G A;  1UOC A;  3MAQ A;  2GBZ A;  2W40 A;  2O8B B;  5GIO A;  4LF7 K;  2VCP A;  2FXU A;  2NZT A;  4BDY A;  5AQL A;  3IAY A;  4FJG A;  3HOT A;  3FZF A;  3UE5 A;  3EEQ A;  4B9N A;  1S5J A;  3L3U A;  1J54 A;  1U2V B;  2P9P B;  3DLL L;  4G1Q A;  5FLX O;  2ZGZ A;  5M1N A;  1L5U A;  1QHT A;  3L2Q A;  1HPM A;  1BQM A;  3QES A;  3ZET B;  2ZD1 A;  1T03 A;  2P9K B;  3PSI A;  3KK7 A;  1BQN A;  1YXQ A;  2P9S B;  2XY7 A;  2JLE A;  4H5T A;  1FKO A;  5AQN A;  4YFU A;  4CJT A;  3ENO A;  3KLH A;  4DSJ A;  1HJO A;  3K57 A;  2NRW A;  2AP1 A;  3OBY A;  3NGY A;  4PKI A;  1NWK A;  1RTI A;  2J4R A;  3P31 A;  3EE9 A;  3R1X A;  1RT3 A;  4KHQ A;  2I7P A;  3AGK A;  5C12 A;  3S3O A;  4CZI A;  4GV3 A;  3WNG A;  1S1T A;  3BY5 A;  3ZX2 A;  1KVA A;  1GLC G;  4Z4F A;  1HNX K;  4IJN A;  5DMR A;  4Y1D A;  3QEI A;  3KD5 E;  3KWG A;  4OPH A;  1NJI O;  5CZ1 A;  4FPB A;  3H46 O;  4DS5 A;  4J8F A;  5FPM A;  5GAG P;  4E3S A;  1GLA G;  4DG1 A;  2CH5 A;  4DKW A;  3QEX A;  3RMB A;  1GOC A;  4O0I A;  4DLE A;  4B3M K;  2RKI A;  3T1Y K;  4XH4 A;  4JKB A;  5GAH P;  1A5X A;  3M8P A;  4KBO A;  2B5J A;  5AQS A;  4WFB L;  4FLX A;  3T7Z A;  4C1N K;  2QXF A;  4AHR A;  4DQI A;  3QIP A;  1VSM A;  4K8X A;  3SUO A;  1T05 A;  4DS4 A;  4H4M A;  1B92 A;  4BVO A;  4CZF A;  2XY8 A;  1SQK A;  4AHU A;  3DJC A;  3KK3 A;  1N6Q A;  3FFK B;  3O1W A;  2QWO A;  4JHD B;  1LWF A;  3LAM A;  3EN9 A;  4X62 K;  2P5G A;  1BGX T;  4I2P A;  3BUZ B;  4DR4 K;  3E1Y A;  3B6P A;  1JLC A;  4C1N I;  4DR7 K;  3L4Q A;  3VQ9 A;  3HZ6 A;  3NCI A;  4B3S K;  4H0Y B;  4CCH A;  3IUC A;  4B1Y B;  3T1A A;  4KRE A;  4DTM A;  3DXK B;  2D1K A;  3EKS A;  4H5N A;  4K43 A;  4NCG A;  4CZM A;  4DTU A;  4DU4 A;  3TTD A;  2VG5 A;  1DT9 A;  1X1P A;  1Q7Y O;  4C8N A;  4JI4 K;  3MED A;  3R9P A;  2YJF A;  4BR7 A;  4WQ5 A;  2QWQ A;  2X6N A;  4PWD A;  2OCE A;  3OYG A;  4JI1 K;  1NGA A;  3NF9 A;  1X9W A;  3DYA A;  5DM7 L;  5KRT A;  2KHO A;  4BQL A;  4PY5 A;  4KTW A;  3HPH A;  5AQH A;  4CZL A;  3OJS A;  3MN6 A;  1BIS A;  3MX5 A;  1R0A A;  2YJE A;  2D0B A;  4ICL A;  2Y1I A;  2VG7 A;  3ATV A;  4KHU A;  5J2P A;  5FPN A;  3VF4 A;  1HRH A;  2CGL A;  5EOY A;  3TSU A;  4NYN A;  3ZT1 A;  1T6C A;  4BGA A;  4YOY A;  3VQE A;  3ULE B;  4BE1 A;  1IO2 A;  4Z4E A;  3RSE A;  3OS2 A;  2OPP A;  3N4Q A;  1TYQ A;  1T7P A;  1YIJ N;  1X9J A;  4CD3 A;  4OGC A;  1XC3 A;  2F8T A;  2VGN A;  5C10 A;  3O1B A;  3OA9 A;  5AQI A;  3D0P A;  3S3M A;  4C8K A;  1SZ2 A;  2HND A;  5AQW A;  1EQY A;  1QZ5 A;  3J80 O;  4IO9 L;  3VQ4 A;  2BDP A;  3KLF A;  4IWV A;  4KI6 A;  1A5W A;  5KPR A;  1HYZ A;  4H4O A;  4DSF A;  4BG8 A;  1YTA A;  2WOM A;  2YHW A;  1XMQ K;  4CJU A;  4EHT A;  5IWA K;  1NKC A;  2P9U A;  4BR5 A;  2UXB K;  4ILJ A;  2F9T A;  4FLZ A;  1KAX A;  3WUH A;  1ESV A;  3SJH A;  1NGG A;  3PIP L;  4MLH A;  1WBD A;  5C2F A;  3V9Z A;  3WXJ A;  1HPZ A;  2DFE A;  3K5O A;  3PUF A;  3TAM A;  1U4B A;  3K9J A;  2HBJ A;  4Z4I A;  2DFF A;  4MO4 A;  4YY3 K;  3HK2 A;  1RDU A;  3L6Q A;  1ASW A;  2IS3 A;  2OYQ A;  1YI2 N;  1HNI A;  4CF9 A;  1NJX A;  1S6P A;  3CJ9 A;  1BDG A;  4GVM A;  3SMS A;  5E41 A;  1TYQ B;  3AO3 A;  3CF5 L;  1VQ6 N;  2F8S A;  4KH5 A;  2P5O A;  4WYB A;  4CZJ A;  4Z4H A;  5AQZ A;  1HNZ K;  3WXL A;  1MA9 B;  3VF2 A;  4BWJ A;  4M3Z A;  4CZE A;  1VRU A;  4OO1 J;  1JCF A;  2O8F B;  4BGB A;  3MX2 A;  2QA4 N;  4FJ5 A;  1UWB A;  3DLG A;  4C8O A;  1HQU A;  3PV8 A;  4M41 A;  2R7Y A;  2YKM A;  3O8M A;  1TK5 A;  4J2A A;  5BPM A;  3ZSQ A;  2UYT A;  3CJA A;  1J5E K;  1C1A A;  3CC2 N;  3A0I X;  5H1S Q;  2ASM A;  3NH2 A;  2E4L A;  4PKH A;  1EX4 A;  4CF2 A;  2X6S A;  3H1V X;  1FK9 A;  2E88 A;  4CZH A;  3RMA A;  1VQO N;  4LF6 K;  4KHY A;  3SCX A;  5HRS A;  1WB9 A;  3IG1 A;  3VQC A;  3WT0 A;  4NLB A;  4FO0 A;  4ZTJ A;  1RDW X;  2O8C A;  4KKO A;  1KD1 O;  1HKC A;  3NBP A;  1RBS A;  4H5V A;  4EZ6 A;  1LWE A;  3OYH A;  1J9A A;  3EKU A;  3WNE A;  1WBB A;  3CCJ N;  4F3T A;  4QAG A;  1VQL N;  1XMO K;  1IG8 A;  5J2Q A;  1N34 K;  2ZQB A;  1NMN A;  3M1F A;  3A5N C;  4M3W A;  4YDU A;  3FE1 A;  5BN9 A;  4X66 K;  1RTD A;  3TAG A;  3M5R A;  4DTX A;  3LL3 A;  3F2K A;  3O4N A;  2BAN A;  1C0G A;  3P4I A;  4I9Q A;  3AO1 A;  4A2B A;  2RN2 A;  4O4G A;  4CGD A;  4XH1 A;  1GLD G;  1RDA A;  4CFD A;  2KLA A;  1SL0 A;  3CI5 A;  4CHZ A;  1KVC A;  3ULD A;  1Z25 A;  3WNH A;  2VGM A;  4QS8 A;  3MWP A;  2NLX A;  2BUP A;  3AVC A;  3O9S A;  3QDK A;  1KFD A;  3KZB A;  3WQU A;  2KFZ A;  4I7F A;  2AJQ A;  1S9E A;  3F73 A;  4CHQ A;  4DMN A;  2GUP A;  3GG4 A;  5EU7 A;  3DXM A;  3O80 A;  4RTF D;  4CJQ A;  3SJJ A;  2GUI A;  2O8C B;  2OPQ A;  1WAJ A;  2HOE A;  3HPG A;  2WTU A;  3SUP A;  2QK9 A;  1BOT O;  4KTQ A;  3R8E A;  2KZZ A;  4Z0U A;  4DFJ A;  3VQ8 A;  5I3U A;  4ELU A;  4FJM A;  1ITG A;  3IDH A;  3OYB A;  1EET A;  1HNV A;  2E2N A;  1GOB A;  3I55 N;  3AA4 A;  1SAZ A;  4FZX C;  4Q5V A;  3OYE A;  1QVF M;  3I56 N;  3CER A;  4X65 K;  1VSD A;  1REV A;  2YHB A;  3PO5 A;  4Y1C A;  1B9D A;  3NDK A;  1S1W A;  2CGJ A;  5AQQ A;  1OKJ A;  4FLT A;  1ATS A;  1O13 A;  1VSJ A;  4FYD A;  1LAW A;  4IOX A;  3DRP A;  4FWN A;  3G71 N;  4FOI A;  4M7Y A;  4I6M B;  4FJN A;  4DV1 K;  4BWM A;  4F2R A;  4CF0 A;  4O5F A;  4IOC L;  4DTJ A;  2ZWH A;  3W3D A;  5AJ3 K;  3MCP A;  3VTI A;  4XH5 A;  4DV0 K;  2QI2 A;  2XY6 A;  1W2B M;  3KWI A;  3O9T A;  3QML A;  2V7Y A;  3VEY A;  2VYP A;  3DXM B;  2XO7 A;  3NMU A;  3FZL A;  3VQA A;  3CCU N;  2F9W A;  3SQ0 A;  3CHW A;  4IFE A;  4CZK A;  1WNS A;  3CJC A;  3P5J A;  5TKW A;  2KQ2 A;  3K9K A;  2VWK A;  2DY4 A;  3O6W A;  4LFC K;  1HMV A;  3L4I A;  2GEL A;  1MU2 A;  1NK6 A;  4CEE A;  1JXE A;  3CC7 N;  4FSV A;  5JMV A;  3VQB A;  1N8R O;  1GLL O;  1N5Y A;  1IBL K;  3OW2 M;  4BAC A;  2ITG A;  4C23 A;  1W7A A;  4CIE A;  3CCV N;  3VQ7 A;  5AQY A;  3PLA A;  3HVR A;  4MFB A;  3TWH A;  1E3M A;  2O4I A;  3NF8 A;  1LOT B;  3OYN A;  3AO5 A;  1P8Z A;  4N41 A;  1RT4 A;  1VSH A;  3P39 A;  3T19 A;  4CVN E;  2FBT A;  4NO7 A;  4B1U B;  1NJW A;  2HHT A;  2YI1 A;  1UA1 A;  4OKJ A;  3VTH A;  3OYM A;  2X78 A;  4WQ5 C;  1U47 A;  2QXL A;  3GOI A;  4IEE A;  5AQX A;  3NH0 A;  1K8K B;  4PL8 A;  4GKJ K;  1TGO A;  4YOR A;  1VQ9 N;  3VEV A;  3J7Z O;  2ZM6 K;  1GLB G;  2A1R A;  3K59 A;  4CJL A;  1NKB A;  3QET A;  4BC5 A;  2I5J A;  3VOV A;  3D2F A;  3H3N O;  3CCS N;  5HRR A;  1SUQ A;  1VK0 A;  1RT6 A;  5JLH A;  2ITM A;  1RT5 A;  2IOC A;  4KO0 A;  4CGF A;  1DTQ A;  3CFP A;  5LY3 A;  1M1K O;  4CEQ A;  4FLW A;  1KLN A;  3TSP A;  4B9L A;  4GV9 A;  1TAQ A;  3QIC A;  3TR8 A;  5BR9 A;  5FDL A;  5AR0 A;  5F2R A;  4EP4 A;  1TUU A;  4M45 A;  2D0P A;  3FZM A;  5BPL A;  3OHR A;  3P83 D;  3QLH A;  4BC2 A;  2P9I A;  1ZC6 A;  4A5B A;  1Q18 A;  1KSP A;  2O8D A;  1BUP A;  1ZBH A;  4KAZ A;  1RBR A;  3QIN A;  3KK1 A;  4CED A;  4ISF A;  1ASV A;  3OYF A;  5AZJ B;  4BR2 A;  5AFU A;  3QBX A;  3QNN A;  4BRO A;  5BR8 K;  3R3L A;  1T8E A;  4OLA A;  4IXC A;  2WBN A;  3EY1 A;  1S3X A;  5AQG A;  2YNI A;  4CGG A;  2Z1G A;  4DF4 A;  4JEP A;  1JXB A;  1OH7 A;  3C94 A;  1I3A A;  4DSL A;  1RBT A;  1SL2 A;  4QS9 A;  1N33 K;  1QHA A;  1WSJ A;  3O9Q A;  3D2F B;  3T3F A;  2O8E A;  3OVN A;  4WE1 A;  3THX A;  4FL9 A;  3VMF B;  2HHW A;  2F96 A;  1VRT A;  2W6K A;  3OJU A;  4K8Z A;  4CEB A;  2PAV A;  1EO1 A;  3EO3 A;  2NRV A;  5F1X A;  1TKT A;  4K41 A;  2OZM A;  2UUC K;  1RDC A;  1HYV A;  2YNH A;  3F5T A;  3OBW A;  4CE9 A;  5BN8 A;  4DQP A;  1VSK A;  3THY B;  5SWM A;  4B1Z A;  4BE0 A;  1EKE A;  2WON A;  4IDH A;  5FPD A;  4GV6 A;  1JLE A;  4RW7 A;  5GIN A;  2E1Y A;  5E26 A;  2YNF A;  5JS2 A;  3G25 A;  5EVZ A;  2P9I B;  3ZCM A;  1EWQ A;  4CJ5 A;  1C6V A;  4FXD A;  3LZI A;  1IBK K;  3RMD A;  3GL1 A;  2NRX A;  3OYL A;  1BA0 A;  4CIF A;  3ZEU A;  5AQJ A;  2A1S A;  3TU5 A;  4JI7 K;  1HX1 A;  4N56 A;  2F4V K;  4I2Q A;  1DKG D;  4F3O A;  4E1N A;  4AHS A;  2A6A A;  1OVY A;  2P9L A;  4DV3 K;  4N76 A;  3RRH A;  3J7Y P;  1Q86 O;  1YT3 A;  1NBW A;  2AA4 A;  1QQO A;  1VQM N;  1EXQ A;  2XY5 A;  1Z05 A;  2KZM A;  2G8H A;  1YUW A;  5C2D A;  1CXU A;  4MQ3 A;  4G9Z A;  4KHW A;  4E7K A;  1ZXO A;  3THX B;  3SPY A;  4IO8 A;  2Q0R A;  3E01 A;  4M3X A;  2E2O A;  4H5W A;  4CI6 A;  3JSM A;  1D9F A;  3HT3 A;  3OYJ A;  3M8Q A;  4JI6 K;  3MXM A;  3LPT A;  1TAU A;  3LAN A;  3QFU A;  1YJN N;  1Y64 A;  4DSK A;  3QFP A;  4CJ4 A;  3HYF A;  4DQR A;  1W9H A;  4LSN A;  1WAF A;  5HRO A;  1S72 N;  3PO4 A;  1ZBS A;  5EX5 A;  1O1W A;  5JLF A;  4CIG A;  4CJ7 A;  5CZ2 A;  1U49 A;  4GMJ B;  3CG7 A;  3BF3 A;  3O4Q A;  1R59 O;  2P9N A;  5A2Q O;  1QZ6 A;  4E89 A;  3RTV A;  2IVP A;  3ZSW A;  3MDQ A;  2DPN A;  4CJS A;  2HVH A;  4JS5 A;  2FSN A;  1JCG A;  1OH5 A;  3DMJ A;  3LZJ A;  1YHQ N;  1TK0 A;  1ATN A;  2P9L B;  1MWM A;  4TSX A;  4BRM A;  2IVN A;  4DTN A;  4OPA A;  4FJK A;  3JS6 A;  3THV A;  3A2F A;  5EY4 A;  1DTT A;  1X3N A;  4OPJ A;  3AAQ A;  3I8B A;  2Q36 A;  4W5N A;  1ZBF A;  3ASM A;  4JLH A;  4UQG A;  1JCE A;  2E6M A;  4CJV A;  3RR7 A;  3SQ1 A;  4FZZ A;  5KRS A;  1D5A A;  3DLK A;  3DWL A;  3DRR A;  2JGU A;  4BRG A;  1VQ4 N;  5FRM A;  1NGD A;  2G8K A;  1XUP O;  3MN7 A;  4CHO A;  1A5V A;  1S1V A;  4BR9 A;  5J2N A;  3ZSV A;  4FLY A;  4JKE A;  1ATR A;  3AVJ A;  4B1V A;  5AQR A;  1IV0 A;  5LJW A;  2HBK A;  5AZI A;  2HBL A;  2V51 B;  2W42 A;  5CYM A;  4Q0B A;  4JK9 A;  3J8A A;  4A5A A;  3SK3 A;  2GTD A;  3OYK A;  4B9M A;  4HTL A;  3CET A;  2P9N B;  3ENB A;  4B3R K;  4LF5 K;  1VQP N;  4DR1 K;  2YHY A;  3H6E A;  4AF1 A;  4YOT A;  3ZT4 A;  1NGJ A;  4AHV A;  3PX6 A;  3AAR A;  1J5O A;  3Q7B A;  2RE2 A;  3SV4 A;  1IJJ A;  4DQ8 A;  4V19 S;  2QWL A;  3HM8 A;  3P1G A;  2UXD K;  2BTF A;  4KRF A;  1H1V A;  4O55 A;  1L3U A;  4FWS A;  3G10 A;  1BL3 A;  2E2P A;  2HST A;  4EAH D;  1YF5 L;  3SUN A;  4H5R A;  5KTQ A;  4OKE A;  3CXC M;  4BDZ A;  1IBM K;  1NGB A;  4CEA A;  4DQQ A;  1KAZ A;  1JLA A;  3ZX3 A;  3BDP A;  3HOS A;  4DUY K;  2KKZ A;  3CFO A;  4E1M A;  3HP9 A;  1LV5 A;  3DI6 A;  2G8F A;  3IFR A;  4B8C A;  5LL6 Z;  5BRH A;  1CXQ A;  4YOX A;  2FF6 A;  2HF3 A;  3VA3 A;  1C1C A;  3KLG A;  3ZSO A;  1NK9 A;  3AGR A;  5AZI B;  3AVL A;  3RSE B;  4FCY A;  3ZT2 A;  3CJB A;  4CK3 A;  3AVA A;  1QQC A;  3K5L A;  1DGK N;  4JNE A;  2OPS A;  3LDQ A;  4KB0 A;  1CZB A;  3LPU A;  5HRP A;  4CJW A;  3LWM A;  1WN7 A;  4BRQ A;  1FW6 A;  5F0X A;  3KIO A;  1T44 A;  4DR5 K;  1OVQ A;  1RIL A;  1ZYQ A;  3AO2 A;  4FJH A;  4JI8 K;  1GLJ O;  2FC0 A;  4JD2 A;  1BIZ A;  1QVG M;  1SS6 A;  3L2W A;  3M8S A;  5HRN A;  2P9U B;  4JRP A;  1WSG A;  3OYA A;  4PL7 A;  4WFA L;  3HXM A;  4BRF A;  2D0O A;  1E4F T;  3HST B;  1IH7 A;  4M42 A;  3HTV A;  3NAE A;  4CK2 A;  3H45 C;  1JLG A;  4H0T B;  1U45 A;  4F8R A;  1VSL A;  3VQP A;  4HUG A;  3MXJ A;  2IGI A;  4DTS A;  2CGK A;  4KHP K;  2HW3 A;  5CYQ A;  3VEN A;  5AQV A;  1VQK N;  3CM6 A;  2XHB A;  3FFI A;  3WEE A;  4A2A A;  4CF8 A;  4B1X B;  4L3Q A;  3OS1 A;  2FLO A;  1VAZ A;  3O9R A;  1Y97 A;  2WUS A;  4OPK A;  4LFA K;  1W0H A;  1KCF A;  4KV8 A;  3U4L A;  3THW A;  1IKY A;  4RWT A;  3KD1 E;  1KTQ A;  4DV4 K;  1VQ8 N;  4DV6 K;  4FJ8 A;  4KHN A;  2Q31 A;  4WFN L;  4W5Q A;  3TAN A;  3EE8 A;  1JKH A;  3MEE A;  4QS7 A;  3V1R A;  3VEX A;  1N36 K;  4DLG A;  2NRR A;  1K6Y A;  3VQD A;  4JD2 B;  5KGW A;  1JLF A;  1TL1 A;  3V81 A;  3U9Z A;  3FR0 A;  1P90 A;  1YVU A;  1JJ2 M;  4JRQ A;  1IG9 A;  4W5R A;  5M1F A;  2Q97 A;  2HHH K;  4NCB A;  2X74 A;  3RVC A;  1L3T A;  4DTR A;  2QM1 A;  1OH6 A;  1C1B A;  3ID6 A;  4RCH A;  3E9L A;  1VSF A;  4XEI A;  3KK2 A;  1XI1 A;  3SLC A;  1L3V A;  4MDB A;  4J2E A;  1XHX A;  4AHC A;  1N32 K;  1K9M O;  4ILG B;  4YOV A;  2QWM A;  4JN4 A;  2QW9 A;  1HYS A;  5C25 A;  4JK7 A;  3CD6 N;  3UIQ A;  4BRH A;  4F4K A;  2Q0U A;  4UY8 O;  1VSI A;  3VET A;  3UB5 A;  5BRE A;  4QCL A;  3L0Q A;  2YCH A;  2ASP A;  1NOZ A;  3NGZ A;  2GEM A;  1NM1 A;  3BZC A;  3SUQ A;  3GBT A;  1X9S A;  5T7B A;  2YHX A;  2GWK A;  4FWO A;  4AHT A;  5BRF A;  5J1E A;  1RBV A;  2FBV A;  4FM2 A;  4FWR A;  3V9U A;  4JKH A;  3U8X A;  3DRS A;  3LM9 A;  4M3R A;  3C6H A;  4DR3 K;  1C0M A;  3ZX0 A;  4BRK A;  1YAG A;  4B9Q A;  5AFU H;  1QS4 A;  4FM1 A;  3K58 A;  1KRP A;  3DLH A;  1QSS A;  3MWT A;  2VQF K;  4B8A B;  2B4J A;  4KH6 A;  1K8A O;  1BI4 A;  2Z1J A;  3WNF A;  5CE3 A;  4E7J A;  3TSQ A;  1TKD A;  4O0J A;  3V9S A;  4RW8 A;  4BRC A;  4DV5 K;  3TAQ A;  2KTQ A;  5AQU A;  3LDN A;  4FOE A;  3CQY A;  3SNN A;  3SQ4 A;  3LWL A;  3SMP A;  1JL2 A;  3SAH A;  3QO9 A;  5GAD P;  1RDB A;  3SYZ A;  4HTU A;  3EZ5 A;  1XHZ A;  3ID8 A;  4CFB A;  1TK8 A;  1HLU A;  4FLV A;  3ZSX A;  3TAP A;  4PHT X;  2OAN A;  1IKV A;  1BO5 O;  2WFB A;  3DOK A;  1NK8 A;  1SL1 A;  3QIO A;  1MWK A;  3TTC A;  4L8R B;  4CES A;  2E6L A;  3I0S A;  3HRG A;  2QKK A;  1V4T A;  3FLC O;  5M1P A;  3AA2 A;  4C8L A;  5ELZ A;  1TL3 A;  4C8M A;  3RRG A;  4DTO A;  1E4G T;  3VQQ A;  4CW7 B;  1YJ9 N;  3UKU A;  2VQE K;  3CM5 A;  4DV7 K;  1VQ7 N;  3KKS A;  3V4I A;  3LDO A;  1Q9X A;  3VQ6 A;  1ZBL A;  2YX6 A;  2FSK A;  3L3V A;  1RT1 A;  3SQ2 A;  1NJY A;  3O9U A;  5JS1 A;  4JKG A;  2HBM A;  4E1J A;  4A57 A;  2P1J A;  3CCE N;  1BHL A;  2JWL A;  4KHS A;  3VER A;  4KTZ A;  3BGR A;  3K2P A;  1NK0 A;  4LF9 K;  2HMP A;  5E84 A;  3I8D A;  1VQN N;  3LP1 A;  3MMV A;  4HHT A;  1LCU A;  3O08 A;  1U04 A;  2GWJ A;  1S9G A;  3ZET A;  1WSF A;  2UUA K;  3VEZ A;  2P9K A;  4DU1 A;  2P9S A;  3HVT A;  1J6Z A;  3B6O A;  3UKR A;  2HVI A;  4CJF A;  4NXM K;  4LC9 B;  1NOY A;  3MK6 A;  4BVP A;  4BC3 A;  2DTU A;  4CJE A;  2PZS A;  3D2E A;  1BG3 A;  1C0F A;  2FSJ A;  1TUY A;  3LP0 A;  1IKX A;  4DR2 K;  3UKU B;  5FPE A;  3CMA N;  4O8K A;  1JL1 A;  2D5R A;  1NNE A;  2B6A A;  2IAJ A;  4LH4 A;  3QEP A;  5EXW A;  2BGG A;  1RT2 A;  2QWR A;  3GE1 A;  4NCA A;  2PYJ A;  4CF1 A;  3DLB A;  4JKG B;  2PFU A;  1HQE A;  4R5P A;  2NNW A;  3EYZ A;  3MXI A;  3ZT3 A;  4CEC A;  1SKW A;  5M1O A;  3EZW A;  3AY9 A;  2V7Z A;  3A5O C;  3KVG A;  1UA0 A;  2DFH A;  3TPQ A;  4FLU A;  3JXU A;  1Q8I A;  2QWP A;  3ZT0 A;  4FWP A;  3IMX A;  2NRH A;  3M8R A;  1HR0 K;  4JV5 K;  2Q2R A;  3R6M A;  1DLO A;  1GLE G;  1KQS M;  4DTP A;  4A62 A;  4M3U A;  4B08 A;  4DF8 A;  1G99 A;  3NF7 A;  4WQ4 A;  3UKR B;  4FPA A;  4JHD A;  1NU0 A;  3C7N A;  4HCC A;  3VGL A;  4IFY A;  5DK5 A;  3KTQ A;  2YHA A;  4B3T K;  4ZHR A;  2EWS A;  2O8D B;  4MLE A;  2A41 A;  3M6G A;  3D2E B;  3L2U A; 
#chains in the Genus database with same CATH homology
 4DV0 K;  4NXN K;  4B3R K;  4LF5 K;  4LF9 K;  4DR1 K;  4KHP K;  4X66 K;  4DV2 K;  4YY3 K;  4X64 K;  4JI6 K;  4JI4 K;  4DR3 K;  1HNW K;  2UUA K;  4V19 S;  1XNQ K;  4LFC K;  2UXD K;  5BR8 K;  2UUB K;  2UXB K;  2VQF K;  4JI1 K;  4LFA K;  1IBL K;  2UXC K;  4NXM K;  4DV4 K;  4AQY K;  1HNX K;  4DV6 K;  1N33 K;  4DV5 K;  4JI5 K;  4JI2 K;  5LMN K;  1HNZ K;  1IBM K;  1I94 K;  3JAM O;  4GKK K;  4JI0 K;  4JYA K;  4DUY K;  1N36 K;  5A2Q O;  4DR2 K;  4DUZ K;  5LL6 Z;  4OX9 K;  4YHH K;  4CVN E;  4LF4 K;  4DR6 K;  4B3M K;  2UUC K;  3T1Y K;  2HHH K;  2UU9 K;  3OTO K;  1J5E K;  4GKJ K;  2ZM6 K;  4K0K K;  4X65 K;  4LF8 K;  4DR5 K;  4LF6 K;  3T1H K;  1XNR K;  1HR0 K;  4JV5 K;  1IBK K;  4JI8 K;  4CW7 B;  5LMU K;  3J7A P;  1N32 K;  2VQE K;  4JI7 K;  3J80 O;  4X62 K;  4DV7 K;  2F4V K;  4LF7 K;  3J81 O;  4DR4 K;  2E5L K;  5IT9 O;  4DV3 K;  4DR7 K;  3J7Y P;  4LFB K;  4DV1 K;  4B3S K;  1XMQ K;  1FJG K;  5FLX O;  4B3T K;  5IWA K;  1XMO K;  4JI3 K;  5AJ3 K;  1N34 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...