5LMUK

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5lmuK00
3JAMO 4B3RK 4CW7B 1XMOK 3J81O 4X66K 4JI5K 4JI4K 4DUZK 2UUBK 4DV3K 1HNXK 4YHHK 1XNRK 5FLXO 4DR4K 4V19S 4DV7K 4LF6K 4B3TK 4JV5K 1HR0K 4DUYK 3J7YP 4DR6K 3T1YK 1HNWK 4K0KK 5IT9O 4X62K 1FJGK 2UXBK 4B3MK 5LMNK 4LFAK 1N33K 5IWAK 4LF5K 4DV2K 1N36K 4DV1K 4DR3K 5LMUK 4NXNK 4DV0K 4B3SK 3J80O 4CVNE 2VQFK 1I94K 2E5LK 4YY3K 1N34K 4DR7K 1HNZK 4AQYK 5BR8K 1IBMK 3T1HK 4DR1K 2UXCK 4DV6K 5AJ3K 4LF8K 1IBKK 4LF4K 1N32K 4X65K 4JI1K 3J7AP 4JI3K 4LFBK 2UUCK 4LF7K 4DV5K 3OTOK 1XMQK 5LL6Z 2UU9K 4JI7K 4DR5K 4NXMK 4JI8K 2ZM6K 2UUAK 1IBLK 1XNQK 4LF9K 4JI6K 4OX9K 4DV4K 4DR2K 5A2QO 4JI0K 2F4VK 4JYAK 1J5EK 4GKKK 4GKJK 2UXDK 4LFCK 4X64K 4JI2K 2HHHK 4KHPK 2VQEK
chains in the Genus database with same CATH superfamily
3H08A 4CEOA 1R59O 4EP5A 4DU1A 3CETA 4H8KA 3K2PA 3MEGA 4HTLA 4YHHK 1EETA 3F5TA 2YNFA 3VGKA 5AQPA 4V19S 2NRXA 1I39A 4E19A 1RFQA 4DV7K 3AARA 1TL3A 1A5XA 2YKMA 4LD0A 3SYZA 4NO7A 4CJ5A 2BUPA 4O5FA 4DB3A 5LJWA 3T1YK 4L8RB 2O8FA 4ELUA 2OZMA 3GOIA 4X62K 2B6AA 1MDUB 4Y1CA 4MDBA 4FJ5A 4AHRA 3CPWM 1ZBHA 1TUUA 3D2EB 5M1PA 2A6AA 4BE0A 2A3ZA 4H5VA 2ITMA 3K5LA 4AILC 1A5VA 2FBVA 3NF7A 1WUAA 4W5TA 1D9FA 1DGKN 4BR4A 4RW7A 4BRPA 3SBTA 4QS7A 3PO5A 4KHUA 1S6QA 4FJJA 4U67L 2GUIA 3NH0A 1VAZA 2I5JA 1SL2A 4FWSA 3NMUA 4PA1A 2D0PA 3VENA 4JD2B 1HRHA 4B1YB 4FVMA 4DQ8A 1KTQA 3ZSZA 3CG7A 5SWMA 4CHOA 1S3XA 2KFZA 1L3VA 3UB5A 5E41A 1ZYQA 3R1XA 2B4JA 1YITN 3HO1A 4YOWA 3CC4N 1C6VA 4OKEA 1M1KO 3MDQA 5GAEP 5KGXA 3ZX0A 3CJCA 4N56A 1WSIA 1RBSA 3LALA 3CFRA 3ZSOA 3SV4A 4F8RA 4PHTX 4WQ5C 4B9NA 3AVFA 1HMVA 4BACA 4PKIA 5AQNA 3KK1A 3HSTB 4M3RA 4PY5A 3J81O 1X1PA 3O80A 2FF3B 4IFYA 1NGCA 4C1NK 2KFNA 3UKRB 2X74A 3AA3A 3CCQN 3V9WA 1GLBG 4OPJA 4UQGA 4CGHA 3MXMA 4JKGB 3NH1A 4O0JA 5HBMA 3OYMA 3K9KA 4Z4GA 2HOEA 4KHYA 2V7ZA 4DQRA 1VQON 1JLGA 3RMBA 1QTMA 1BL3A 5EOYA 4CJEA 5CZ1A 4A59A 2W6KA 1LOTB 1RT4A 5LJVA 3N4PA 4YOTA 4DUYK 4WQ4A 2PFUA 4BR0A 5EU7A 2P9NA 4W5QA 3KLIA 4CJ3A 5KQDA 4TSXA 3WT0A 1BHLA 1U48A 5AQHA 2NZTA 4KB0A 4LFAK 1XC3A 2QXLA 4IBNA 3BF3A 4C1NI 3R8EA 4LF5K 4IWVA 3HSCA 3AVJA 3QDKA 1D4XA 1OH5A 3LM2A 1ATRA 1KVCA 3KK3A 5AQWA 3I56N 1JL2A 1HNVA 4CFCA 3K0SA 2P9PA 3AO2A 2VG5A 3QB0A 4YY3K 4R79A 3IS9A 2QW9A 3VQQA 1QSSA 2UYTA 4JEPA 1Y97A 4H5WA 1A5WA 1RDCA 2KW4A 1BA0A 3DRSA 4ILJA 5J2QA 1N32K 3BY5A 4X65K 2Z1IA 3M8PA 4E1MA 2UUCK 4KB1A 4WE1A 5HRSA 3OTOK 1YF5L 4DF4A 2P9LA 2ZQBA 4DR5K 4CGIA 3HJFA 2QWOA 3OBYA 2W41A 4JD2A 2HNDA 2BANA 4ELTA 1RCHA 2AP1A 4CJKA 2KKZA 3ZSVA 3O3HA 3ZEUA 3QEPA 4MLEA 3ZCMA 4M7XA 1TAUA 3TTFA 4G9ZA 2GELA 1H1VA 4KHWA 1XNRK 4CECA 4H4OA 3ZT0A 2O4GA 4B9QA 4OLBA 1Q18A 1U6ZA 3E9PA 1SKSA 2IGIA 3IDHA 3W3DA 2G8KA 3NH2A 1GLEG 4M3YA 3EE9A 3SQ2A 4DTXA 3O08A 1BGXT 2QI2A 3HT3A 3TABA 4M45A 4AHUA 4GW6A 3HM8A 5AFUH 2KZZA 3SMSA 4O55A 3WXLA 3LWMA 3LP1A 5FPDA 2YHAA 1DTQA 3ZETA 2WBNA 4JKAA 4CIFA 3RRHA 4DS5A 3L2QA 1C0GA 2GEMA 1S9EA 3KK2A 3KTQA 3I0SA 1RT7A 2JWLA 3QEWA 1GLAG 3FGUA 5CYQA 2Q97A 3H45C 1HNZK 1NK9A 2LSNA 3O3FA 4KH5A 3WNHA 1RT2A 1L5UA 1K8KB 3QO9A 1U4BA 2VGNA 4LSNA 4YDUC 5D3GA 4JI3K 3K9JA 3EYZA 5JICA 2ZGZA 1BQNA 3AO5A 4H0TB 4WQ4C 3VA3A 2O8FB 4NCAA 5BN9A 3TAMA 3IMXA 5KQ8A 4CERA 3VQAA 5J1EA 3K59A 1CZBA 4KH4A 2QXFA 3C6HA 5AQTA 5CE3A 4FWKA 3MX5A 4O44A 3WNEA 1NOYA 4DQPA 2OPSA 5HROA 2D0BA 3FZMA 3SZ2A 1KCFA 3PO4A 4BQLA 2XRIA 3CCJN 3S3MA 2O8BA 1C0FA 1XMOK 4E1NA 1WAJA 4MLHA 3WQTA 3SBGA 4CZHA 2YJEA 4CF1A 4CEFA 3DWLA 3TAFA 3C6AA 2OTJN 1NGGA 1RILA 3S41A 4DFJA 2FC0A 2BDPA 1L3UA 4JV5K 5I9EB 4H0OA 4DQQA 4BR9A 3A5NC 4FJ8A 3SMPA 3KWGA 1JCFA 1TL1A 1RDDA 3SUOA 2QWPA 4A2BA 5HRNA 3CJ1A 3OYEA 4FJ9A 3QFUA 2PYLA 1BIUA 3QESA 1TGOA 3HP6A 1U2VB 2X6NA 3OHRA 4I7FA 1N36K 2AJQA 3OYJA 5F2RA 2VGMA 1HQEA 2Y1JA 1C1CA 2P9UA 3FZHA 3J80O 1KLMA 4EP4A 3CCMN 2NRTA 4CVNE 4CF0A 4HVJA 4FXDA 2EHGA 1NMNA 3RVCA 5KPRA 1G15A 3DOLA 4DTMA 1NK0A 1K6YA 3RR8A 1L3TA 3AO3A 4B8AB 5AJ3K 5FRMA 4KFBA 3MCAB 4ISGA 5EVZA 1C0TA 1TUYA 1V4SA 1S6PA 3HYFA 2NUBA 3W0LA 3HP9A 3SAGA 4FZZA 1ZBLA 3SJJA 1IBLK 3M1FA 3TTCA 4JHDB 3VA0A 4WFAL 4DR2K 3DXKB 3HTVA 5J2NA 2FSNA 4E7IA 1D5AA 4A5AA 1IV0A 2EWSA 4CEAA 3ATUA 3NVMA 4A62A 1T7PA 4C8KA 4FJHA 4CEEA 1IKYA 1S1TA 3M8QA 4CW7B 4RWTA 2ITGA 4Q0BA 2HBKA 3QEXA 1QSYA 1Q86O 3NGIA 3AO4A 3LP3A 4B1UB 3OBWA 2KTQA 1VRTA 3U9DA 2FSKA 5FLXO 3P31A 4DLGA 2P5GA 2E2QA 1KVAA 3O9SA 1BU6O 3NFAA 1LWCA 3F9KA 3RSEA 4FOEA 3V9ZA 5FPMA 1J9AA 1SL0A 2P9LB 4PKGA 4IJAA 3VETA 4IOAL 3CFPA 4CHNA 3H46O 4QS8A 5AQOA 1GOCA 5CY4A 3THYB 3BGRA 1WSEA 2OZSA 2E6MA 4XEIA 4BVOA 4KREA 5FROA 3A5LC 4KRFA 1GLJO 1NBWA 3VTIA 3KLFA 3HPGA 4M3TA 1M90O 3HXMA 1NGBA 1Q9YA 4FSVA 3IUCA 4HUEA 4Z4EA 3LDPA 3CJ9A 3CCEN 3VEZA 3G10A 2HHVA 4DKWA 4FWRA 1TKXA 5AQUA 1IG8A 4FWNA 4O8UA 1YI2N 2AA4A 4CJQA 3E9LA 4M41A 3P39A 4BRDA 3VTHA 4CZMA 1Z26A 4CZLA 3T1HK 4KV8A 4Z94A 3QIPA 1GLFO 3DRPA 4CK1A 4DV6K 4NYNA 3QERA 1U2VA 1SKWA 1BUPA 3VF6A 1YJWN 3PY8A 2E6LA 4CHZA 4IEEA 2ZJQL 4KHSA 4E3SA 3WXMB 1KRPA 2NLXA 3S3NA 1TYQB 1LWEA 3LDNA 5DM6L 3OW2M 4AM7A 3EKSA 1XNQK 2E2NA 4JS4A 3L2RA 1C1BA 4LF9K 4OX9K 3VQPA 1HKBA 5A2QO 2F4VK 5AQFA 4CGJA 3L2VA 1KFDA 1RTHA 1BOTO 3OYAA 4JRQA 4YDUA 3TAGA 3OYIA 3AY9A 5J2PA 1TVRA 1OVQA 4G1QA 3NAEA 3TWHA 3FFKB 1GLLO 1HX1A 4DS4A 4W5OA 1XC9A 4EAHD 3KVGA 5E26A 3LWLA 3KKRA 1VSIA 4BWJA 1S22A 3DAWA 3G71N 3LAKA 3NE6A 3AVCA 1HNXK 3DLEA 3H3OB 3M5RA 3WXIA 3EZ5A 1BO5O 4DTJA 4BRMA 3OJSA 1LAVA 1QHTA 2ZGYA 3WNGA 4FLWA 5HRPA 3ITHA 1WBBA 3BUZB 1HYZA 3ZSRA 3I0RA 3AAPA 1HR0K 1VSDA 4CFAA 3E1YA 1HQUA 1KFSA 5K14A 5J2MA 4DR6K 2A1RA 3G0ZA 3SQ0A 1RTJA 3CCRN 1VSKA 1KAYA 1YJ9N 3D2FB 5LY3A 1FJGK 4B3MK 1O13A 2IIRA 1IH7A 3KHYA 4CF9A 4NB4A 3MX2A 2BH1A 4DSJA 5DMRA 3ZSYA 3VQBA 4DV2K 4ILHA 3MCPA 3FZFA 3DLHA 4ZTFA 2HMPA 4HWIA 1TKDA 1EO1A 3KLGA 4F9OA 4JLHA 4FM0A 1YJNN 3H3NO 5CZ2A 2QKBA 1ASUA 4K43A 3JS6A 4BRHA 4I2PA 3UKUA 4A2AA 3PSFA 1IBMK 5C12A 1TAQA 3HPHA 4CGGA 3R6MA 2JGUA 1TK8A 1GLCG 4JKDA 4FK4A 3VQ4A 1X3MA 5LL6Z 4IG3A 3NGYA 1OKJA 3G4SN 3K5NA 1Q82O 4IDHA 3C7NA 3VEVA 4FVUA 2P9PB 3NBPA 3F9MA 3TPQA 4EIAA 2CGKA 4CJ4A 1NK7A 4CJRA 2DFEA 3SPZA 5C2DA 4IEIA 3EEQA 3LL3A 1RBTA 4BC5A 4OO1J 3OVNA 4DHYA 4FCYA 1KQSM 3BZKA 4BQZA 4CZEA 3FR0A 2NRRA 2OPQA 1U04A 4H03B 1SV5A 2Q1NA 4B1XB 5AQRA 4CHYA 1NGEA 1NOZA 2BE2A 3CCLN 4B9MA 3S3OA 1WSHA 2P9KA 4WFBL 4QS9A 3SK3A 2YHXA 3BZCA 2KLAA 4RCHA 5I3UA 4A57A 4DSKA 4OGCA 1NLVA 3L2WA 3TAQA 2VWKA 3FZKA 1C0MA 4CEDA 2HHWA 3V1RA 3ZSWA 3AVHA 3MN9A 2UXBK 2QA4N 3THXB 1QE1A 2E8AA 1EKEA 1S5JA 3DXKA 4CJWA 3LZJA 1JKHA 2A1SA 2X78A 4HCBA 1OH8A 4BR7A 1X9WA 3U9ZA 2G8UA 1XHXA 1K73O 3AV9A 3HZ6A 3ULEB 3U8XA 3EY1A 4JKEA 2XY5A 2Q36A 5M1OA 4H0YB 2FF6A 1C1AA 4LC9B 2ZWHA 5DK5A 1WNSA 4IG0A 3P83D 3Q7CA 3VF4A 4K25A 4ELVA 1WSJA 4DFPA 4J2AA 3CI5A 3K5OA 3B6PA 2I7PA 3VGMA 3J7AP 1BIZA 4AHCA 5H1SQ 1F21A 1N6QA 2BTFA 1RT3A 1XMQK 3HOSA 3SUPA 3CC2N 2PY5A 2HNZA 5ELZA 1ATNA 2V52B 4C8NA 2OA8A 4RG8A 3C0BA 3QLHA 1REVA 2GWKA 3L2UA 4IO8A 4IFEA 5EX5A 1D9DA 4BRQA 3RMDA 3SQ4A 4JI6K 5AQMA 4DG1A 4WYBA 4O4GA 4DV4K 1KAXA 2A42A 3TU5A 4RW8A 4IXCA 4CESA 4PL8A 3DLRA 4ZTJA 1S9GA 3ENOA 3VMFB 3OYHA 4CJUA 1DT9A 2WUSA 4FLUA 3KD5E 2YNHA 3ULDA 1EQYA 1L3SA 2D0AA 1D8YA 3MEEA 3B8AX 4CF8A 3MWTA 1YAGA 1JCGA 2ETJA 4CJLA 1QQNA 4FZYA 5ADXH 4Z0UA 3V9UA 2OYQA 2QWNA 4JRPA 3U4LA 3AO1A 3DLLL 3I8BA 2R7YA 4CZFA 3MWPA 5F1XA 3LPUA 4M3UA 3VEWA 1HNWK 1QSLA 4CBWA 3V81A 5IT9O 2J4RA 4PL7A 3M6GA 1BCMA 1Y64A 3WXJA 3OYBA 2O8CA 2ASPA 4FYDA 2GWJA 3ALYA 1IKWA 4DU4A 4MFBA 4Z4HA 1VSMA 4BC3A 3VERA 3ISNC 1N33K 3NCIA 4AH9A 4DR3K 3T3FA 3FLCO 1BQMA 3C95A 2G8WA 4B3SK 4BR5A 3M3ZA 4GMJB 5KRSA 2VWBA 1NGDA 3QETA 4CHQA 4FOIA 1NKBA 1DTTA 3T19A 1K8KA 3QEIA 2E4LA 1LWFA 3KLHA 1I3AA 4EHTA 2RE2A 2GX9A 4FK0A 1YTAA 4FW2A 3OA9A 2OPRA 4CZGA 2ZJRL 1RT5A 1KXPA 3PX0A 1GOAA 3EL2A 3THWB 1HPZA 2GTDA 3I33A 3D2FA 3T1AA 1SQKA 5AQIA 4EHUA 2E2OA 3TAPA 2IVOA 3CD6N 4RTFD 1JJ2M 2D4WA 1NWKA 3KWIA 4B9LA 4JKGA 1N8RO 3LP2A 3QBXA 1QVGM 1LW2A 1T6CA 2HHHK 1NJZA 1BWFO 4CJVA 4B9TA 5GINA 5AQZA 1DKGD 5B8HA 4O0IA 1VQNN 3OYDA 1YUWA 4A61A 4B9VA 2NNWA 3THVA 1YTUA 3AAQA 5BPLA 2HBMA 3ZSQA 3PIOL 4KAZA 5AQXA 3RMAA 3LM9A 1X9SA 3AA2A 1VSFA 5FDLA 1HYSA 3O4WA 4I9QA 2DTUA 3RR7A 2V7YA 4KTWA 3OJUA 4Z4IA 3HOTA 1O1WA 4DSIA 2YI1A 3CM5A 5BR9A 3PX4A 5HP1A 3LDQA 1UOCA 1RDAA 1MWMA 4PUOA 3IKMA 3AA5X 3WUHA 4HCCA 4NCBA 5GADP 3L8BA 5EXWA 3MMVA 5C0YA 1RGIA 4DQSA 3O3GA 4PKHA 4CZIA 1YIJN 4OKJA 3RMCA 1T03A 1BA1A 4NLCA 3ASMA 1HKCA 2E5LK 2ZF5O 1N34K 2QWLA 3IRXA 3QINA 5AQSA 3T7ZA 1VRUA 3VN5A 1NGHA 3UKUB 3VQ5A 1MWKA 4LF8K 1RT6A 4QOZB 1HUXA 1LW0A 1EWQA 2UU9K 2HHTA 3HPOA 3OYCA 4JI7K 3AVNA 4JKBA 1ZBFA 1S1VA 2QWQA 1VSJA 3QFPA 1QS4A 2UUAK 1QZ6A 5BRDA 2D1KA 1VQLN 3I55N 3AVAA 4OJRA 3MXJA 4CIGA 3KD1E 5GAGP 2A40A 1IKXA 4XIUA 4BWMA 2RKIA 1W2BM 2HBLA 1J6ZA 4N47A 4B1ZA 1NGIA 4K8XA 2VYPA 1S1UA 3C6TA 3CJ7A 1KSPA 3CYMA 1SS6A 4FLVA 1J53A 2XY6A 1NNEA 1LAWA 2Q31A 1HNIA 2P5OA 4M42A 5FRNA 2XY7A 3GBTA 2KZMA 3LP0A 4KHNA 1WLJA 1TYQA 3ZSXA 4XH5A 4IO9L 3SQ1A 1RTDA 4DR4K 2O8DB 4EFHA 4J2EA 3DOKA 2P9SA 2YKNA 4CGDA 2QM1A 3D45A 4CJ7A 1RDUA 2YV0X 3C65A 5TKWA 3IFRA 4RW9A 3R9PA 4CJFA 1VQ5N 1IO2A 4BC2A 3DI6A 2EX3A 2P1JA 3VF2A 5AZJB 2QTDA 2QWMA 3KKSA 4YOVA 4OGEA 1ESVA 2V51B 3MN5A 3J7ZO 3A5MC 5C10A 4ICLA 4DF8A 3CQXA 4XH1A 3THXA 1Q9XA 1T05A 1VK0A 2VCPA 3OYGA 3E9OA 2FXUA 1QQOA 3MXIA 5HRRA 5BREA 3ULEA 4R5PA 3P1GA 2Q0RA 4BDYA 3CMAN 1T44A 1VQ6N 1P90A 4JKCA 1WSGA 4BR2A 3SCXA 1YHQN 3K57A 1BI4A 4Y1DA 1XWLA 1WN7A 4GNIA 4KI6A 5ADXA 1X9JA 2RHKA 2DFHA 2FBYA 2XO7A 4CD1A 2WOMA 2PYJA 3A5OC 3RSEB 4QCLA 2DY4A 1JXEA 4DCHA 4BDZA 1SKRA 2IDOA 3EZWA 1Z05A 3THYA 2G8VA 5AQJA 2A5XA 4AHSA 3H6EA 3IG1A 2F8SA 4F2RA 3L0QA 5FPNA 2HHUA 4I6MA 4GKKK 4J2DA 1UA0A 3C94A 3SUNA 3V6DA 3O9QA 1NK4A 4KH6A 1S1XA 3ID8A 3EN9A 4A5BA 2VQEK 1TKTA 4BDPA 4N41A 4H5RA 5KI6A 1XI1A 3MEDA 4F4KA 3DYAA 2QK9A 4HTUA 2RF2A 4HUFA 1OH7A 1KLNA 4CD3A 3TSQA 3H1VX 2W42A 4F3TA 4K41A 1NM1A 3CCSN 3G6EN 1ZXOA 4E7KA 4FJKA 2O8EB 2PZSA 3V9SA 4MDAA 4DLEA 2NRZA 3Q7BA 4FJ7A 3VQ8A 4H5NA 3ENHA 2Z1HA 4CK3A 2PBDA 4K42A 4DTUA 2ZJPL 5KRTA 1UWBA 3E01A 3VEXA 1NJXA 4FJGA 4JK9A 2P9KB 2B5JA 3EO3A 3PX6A 2Z1GA 5BRHA 4DSEA 4O8KA 3O1BA 1IG9A 2E1YA 4BGAA 2ASMA 3ZX2A 1U49A 1W97L 4Y0WA 3TTDA 3V9XA 2W40A 1YVUA 3DLBA 5AQQA 2PAVA 1BDGA 4DTOA 2I7NA 1J54A 4BE2A 1JLCA 3AVGA 3FFIA 3AA4A 1K9MO 3KK7A 5BR8K 2WONA 3NGZA 4JHDA 4DTSA 5HLFA 3CF5L 1TK5A 2CH6A 3DJCA 2FSJA 5JLHA 3SLCA 1IBKK 4M3WA 3DM2A 3RTVA 4FM2A 5JLFA 5TKYA 3CJAA 4CF2A 4LF7K 2NRHA 1SZ2A 3QNOA 3V4IA 2HHQA 4YOXA 3QICA 4DSLA 3GL1A 1RNHA 3BP8A 4B1VA 3THWA 2GBZA 3QBWA 2YHWA 4GVMA 2BGGA 1UAXA 4CEQA 2IOCA 1JL1A 1YT3A 2UXDK 3V1OA 3U6FA 4X64K 1QQMA 3OYKA 5EY4A 3SJHA 1W7AA 1QQCA 3J8AA 4X66K 3LANA 3ZYYX 4EZ9A 2UUBK 4CBUA 4FM1A 4HUGA 3VOVA 3VESA 4ZHRA 1DEJA 4FPBA 5KPZA 1YXQA 3B6OA 3GE1A 2G8FA 1E4GT 3HI0A 5AQYA 3CFOA 3L4IA 3ZEUB 4H0PA 3WNFA 3ZX3A 1CZ9A 5M1KA 4K0KK 4BRCA 3CQYA 3SPYA 1HKGA 1T3VA 2RPIA 3L6QA 4KI4A 1FXXA 3TSPA 4CK2A 1CLQA 2HMIA 4B3OA 4CEBA 1EWRA 4OPKA 3NHGA 3E66A 3OYLA 5JMVA 5AQGA 4ISFA 1VQMN 3LDOA 1HLUA 3O4QA 3P38A 1JXBA 2GUPA 2NRVA 2H3GX 5GAHP 3TAEA 3NF6A 5T7BA 1Q7YO 2CGJA 2D0OA 3EE8A 3T69A 2FLOA 1WB9A 4PQUA 4JK7A 3CERA 3ZT1A 4BRIA 3L3VA 1SAZA 1VSLA 2G8IA 4AHVA 4U7BA 3D7EO 4W5RA 1NG9A 4FJMA 5C42A 3O9UA 2KHOA 4NXMK 3EKUA 2HB5A 4KTQA 3O4NA 5C24A 4B9SA 4AF1A 1KD1O 2F7TA 1ZBIA 1VSEA 4BGBA 4BY9C 3KZBA 2KQ2A 4B8CA 1E3MA 1CXUA 5GIPA 2WTUA 4FJLA 1MA9B 5CHIA 2YHBA 1T6DA 2YJFA 3TANA 4FLTA 5AQKA 1ZC6A 3CIPA 5DM7L 3FZLA 3NDKA 3G25A 4KTZA 3JAMO 3LZIA 3WEEB 3S9HA 2F9TA 4I9LA 2O4IA 2CGLA 2A41A 4IFVA 1U47A 1Z25A 4OLAA 2JLEA 4XH4A 4Z4FA 5JS2A 1ASVA 1YVNA 4OPHA 3U3YA 3JYTA 2JWKA 3UKRA 1RT1A 3VQEA 5F0XA 1SL1A 4LF6K 3NVKA 2O8DA 1NJIO 2XY8A 1NGFA 1RBUA 3VQCA 3WQUA 5AZIA 3CCVN 3KLEA 4YOUA 4KHQA 5I42A 3AVKA 4LY7A 3O6WA 1S1WA 2P9NB 4Q5VA 3TARA 1NMDA 4KBOA 1VQ4N 2F96A 5IWAK 4ID1A 5CR4A 4HHTA 1S72N 2X6SA 4M3XA 1Q8IA 4BRKA 4NXNK 1K8AO 2P51A 3MN7A 3VEYA 2E20A 1VQKN 4YOYA 5HL7L 1KC8O 4M3ZA 1QHAA 3O9RA 4M63C 4JNEA 3C7NB 1P8ZA 5M1NA 3PSIA 1BG3A 4E89A 2VWJA 3ZT2A 3O1WA 5AR0A 1NJYA 2UXCK 2Q2RA 3LAMA 4JI1K 3PV8A 2HF4A 2D5RA 4PWDA 4N76A 2P9UB 4JKHA 4LH4A 1JLFA 4WQ5A 3VEOA 5KPTA 4NCGA 2E1ZA 2DFFA 4CGFA 4FJNA 4B08A 3H1QA 2O8CB 2W6LA 3ZT4A 1Z6RA 2QWRA 2Q0UA 2HW3A 2HHSA 3O9TA 3SAHA 3SAFA 2RN2A 2ZD1A 5C2FA 4JI0K 4OKKA 4JYAK 3AGKA 4GKJK 1IKVA 2F9WA 4LFCK 3DXMB 4DU3A 4F2SA 4KHPK 4FWOA 5KTQA 4J2BA 3OY9A 2VG6A 3UE5A 3QMLA 4FL9A 2HSTA 4OVLA 2YX6A 2YHYA 1VQ8N 2HF3A 3PLAA 3NF9A 4MO4A 4CI6A 1FKOA 3N4QA 1TKZA 3V1QA 3PIPL 5KGWA 3VQ7A 2DPNA 3MN6A 4BE1A 1NGJA 4B3TK 3QEVA 3UIQA 2Z1JA 3L3UA 1W9HA 3AGRA 3AVIA 2CH5A 4BRLA 1B9DA 3CQ8A 3CHWA 1BI4B 4FZXC 2F8TA 2XHBA 3CXCM 4W5NA 4BRFA 4DTNA 1NK8A 2OTLN 1X9MA 4DSFA 1BCOA 3NF8A 4B1WB 4IOXA 1U45A 1KVBA 5LMUK 1ITGA 2WC9A 4BG8A 5M1FA 3DLKA 3D6RA 1VHXA 4EZ6A 4O5BA 3CMEN 4JK8A 2IC3A 5MLCQ 1I94K 1JLAA 2NRWA 4DR7K 4DTRA 1WOQA 3K58A 1RTIA 4I6MB 4JAXA 1NJWA 4DQIA 4LH5A 4FPAA 2OANA 4DR1K 4FO0A 1X3NA 3AVBA 4CZKA 4DFKA 3D0PA 1EXQA 3U3GA 4DV5K 3CPEA 1WBDA 3LPTA 3LDLA 4WF9L 4JN4A 4FWLA 5JS1A 3VQDA 4WCEL 1MU2A 1VQPN 4BRNA 3SI6A 4ID5A 2HVIA 1FK9A 4J8FA 3F73A 3D2EA 3RRGA 4BREA 3MAQA 5BN8A 5AQVA 4FJXA 4FW1A 4BG9A 2Q3SA 1R0AA 1Q81O 1DLOA 3I8DA 4C8LA 2ZE2A 4FWPA 4BVPA 5JVHL 1EX4A 4GY2B 4L3QA 4RW4A 4C8OA 2HHXA 1LCUA 4GV9A 4IOCL 4JS5A 4DUZK 4BRAA 4E1JA 4FWMA 4DV3K 1WAFA 2P9SB 3ATVA 1ZBUA 1G99A 2HNYA 1QVFM 4F3OA 3VQ6A 2OCEA 3SV3A 4H0VB 3HM9A 4GVEA 2YNGA 1VSHA 5AQLA 5E84A 3P4IA 2E2PA 2ATQA 4IJNA 4FLZA 3HVRA 3BEXA 4FWQA 2IVNA 3J7YP 1BISA 1W0HA 1FW6A 2IS3A 2WFBA 2VG7A 4QAGA 4CZJA 3DLGA 5LMNK 1XHZA 4FK2A 3HRGA 3OYNA 3CC7N 4CJPA 3HBTA 3TI0A 3F2KA 4IDKA 4NLBA 4C23A 3L4QA 3FE1A 1OH6A 1CZAN 1TK0A 3A0IX 3SUQA 4KPYA 2Y1IA 1ILYA 2FBTA 1B92A 3AVMA 4H4MA 4CIEA 1SUQA 2YNIA 4MO5A 3KJVA 1OVYA 3RWUA 2VQFK 3K5MA 1RBVA 4FLYA 4AQYK 3SNNA 4H0XB 2P9IA 1JLBA 3OS2A 1V4TA 1GOBA 2OPPA 1GLDG 4IKFA 4YNQA 4YORA 4LF4K 4CEZA 3C6UA 4LFBK 4DMNA 2IAJA 3TR8A 3A8YA 4N5SA 1RBRA 1B9FA 1ASWA 4ILGB 4JI8K 5AZJA 4B9UA 3DRRA 4KO0A 1RDWX 3OS1A 1EP4A 3GDQA 1JLQA 1XQSC 3HVTA 1HJOA 4E0DA 4UY8O 4JI2K 1NKEA 3ENBA 3JXUA 1IJJA 1TV6A 3PUFA 3M8SA 5CYMA 2D0CA 1J5OA 4DFMA 2GV9A 1NK6A 4B3RK 3VPZA 4DWIA 3ID6A 1XUPO 4JI5K 2G8HA 4JI4K 3BDPA 1HJRA 3P5JA 2QKKA 3O8MA 4C8MA 3WEEA 4YFUA 1KAZA 4H5TA 4CFDA 3OYFA 5JVGL 3CJBA 5BPNA 4DTPA 4CBXA 2YCHA 1HPMA 3O5BA 3HL8A 4ISEA 3AVLA 5FPEA 4E7LA 5SZTA 4K8ZA 3WXKA 3KIOA 4CCHA 2O8BB 5BRFA 2E88A 3ZETB 5AZIB 1FKPA 2QEXN 4E7JA 4CFBA 2HVHA 3A2FA 3CCUN 3IAYA 1VQ9N 3DXMA 1N5YA 4DV1K 2FBXA 4IZ9A 1RDBA 1UA1A 2ASOA 4M7YA 4DV0K 4GV3A 5AFUA 5GIOA 4BROA 1HYVA 3LDSA 1C0UA 1JCEA 3JSMA 4CHPA 4WFNL 3DMJA 4FLXA 4AHTA 4AM6A 1JLEA 4FJIA 1NKCA 5C25A 1E4FT 3BF1A 1ZBSA 3TSUA 1T8EA 5M1QA 4CE9A 3ZLJA 4E7HA 4MQ3A 3GG4A 1NGAA 1QZ5A 5BPMA 3MECA 1NK5A 3M8RA 4BRGA 2O8EA 4JKFA 4LSLA 3VQ9A 2IVPA 1ATSA 3MK6A 4I2QA 4CJTA 5HOOA 2ZM6K 4RW6A 3CM6A 1CXQA 3QNNA 4KKOA 2P9IB 5C15A 1NU0A 3R3LA 4BC4A 3QIOA 4GV6A 1J5EK 3ZT3A 4Z4CA 3OS0A 4NYFA 1LV5A 2HBJA 4CJSA 1WSFA 3HK2A 3VGLA 1VQ7N 4OPAA
chains in the Genus database with same CATH topology
3JAMO 4B3RK 4CW7B 1XMOK 3J81O 4X66K 4JI5K 4JI4K 4DUZK 2UUBK 4DV3K 1HNXK 4YHHK 1XNRK 5FLXO 4DR4K 4V19S 4DV7K 4LF6K 4B3TK 4JV5K 1HR0K 4DUYK 3J7YP 4DR6K 3T1YK 1HNWK 4K0KK 5IT9O 4X62K 1FJGK 2UXBK 4B3MK 5LMNK 4LFAK 1N33K 5IWAK 4LF5K 4DV2K 1N36K 4DV1K 4DR3K 5LMUK 4NXNK 4DV0K 4B3SK 3J80O 4CVNE 2VQFK 1I94K 2E5LK 4YY3K 1N34K 4DR7K 1HNZK 4AQYK 5BR8K 1IBMK 3T1HK 4DR1K 2UXCK 4DV6K 5AJ3K 4LF8K 1IBKK 4LF4K 1N32K 4X65K 4JI1K 3J7AP 4JI3K 4LFBK 2UUCK 4LF7K 4DV5K 3OTOK 1XMQK 5LL6Z 2UU9K 4JI7K 4DR5K 4NXMK 4JI8K 2ZM6K 2UUAK 1IBLK 1XNQK 4LF9K 4JI6K 4OX9K 4DV4K 4DR2K 5A2QO 4JI0K 2F4VK 4JYAK 1J5EK 4GKKK 4GKJK 2UXDK 4LFCK 4X64K 4JI2K 2HHHK 4KHPK 2VQEK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM O;  4B3R K;  4CW7 B;  1XMO K;  3J81 O;  4X66 K;  4JI5 K;  4JI4 K;  4DUZ K;  2UUB K;  4DV3 K;  1HNX K;  4YHH K;  1XNR K;  5FLX O;  4DR4 K;  4V19 S;  4DV7 K;  4LF6 K;  4B3T K;  4JV5 K;  1HR0 K;  4DUY K;  3J7Y P;  4DR6 K;  3T1Y K;  1HNW K;  4K0K K;  5IT9 O;  4X62 K;  1FJG K;  2UXB K;  4B3M K;  5LMN K;  4LFA K;  1N33 K;  5IWA K;  4LF5 K;  4DV2 K;  1N36 K;  4DV1 K;  4DR3 K;  5LMU K;  4NXN K;  4DV0 K;  4B3S K;  3J80 O;  4CVN E;  2VQF K;  1I94 K;  2E5L K;  4YY3 K;  1N34 K;  4DR7 K;  1HNZ K;  4AQY K;  5BR8 K;  1IBM K;  3T1H K;  4DR1 K;  2UXC K;  4DV6 K;  5AJ3 K;  4LF8 K;  1IBK K;  4LF4 K;  1N32 K;  4X65 K;  4JI1 K;  3J7A P;  4JI3 K;  4LFB K;  2UUC K;  4LF7 K;  4DV5 K;  3OTO K;  1XMQ K;  5LL6 Z;  2UU9 K;  4JI7 K;  4DR5 K;  4NXM K;  4JI8 K;  2ZM6 K;  2UUA K;  1IBL K;  1XNQ K;  4LF9 K;  4JI6 K;  4OX9 K;  4DV4 K;  4DR2 K;  5A2Q O;  4JI0 K;  2F4V K;  4JYA K;  1J5E K;  4GKK K;  4GKJ K;  2UXD K;  4LFC K;  4X64 K;  4JI2 K;  2HHH K;  4KHP K;  2VQE K; 
#chains in the Genus database with same CATH topology
 3H08 A;  4CEO A;  1R59 O;  4EP5 A;  4DU1 A;  3CET A;  4H8K A;  3K2P A;  3MEG A;  4HTL A;  4YHH K;  1EET A;  3F5T A;  2YNF A;  3VGK A;  5AQP A;  4V19 S;  2NRX A;  1I39 A;  4E19 A;  1RFQ A;  4DV7 K;  3AAR A;  1TL3 A;  1A5X A;  2YKM A;  4LD0 A;  3SYZ A;  4NO7 A;  4CJ5 A;  2BUP A;  4O5F A;  4DB3 A;  5LJW A;  3T1Y K;  4L8R B;  2O8F A;  4ELU A;  2OZM A;  3GOI A;  4X62 K;  2B6A A;  1MDU B;  4Y1C A;  4MDB A;  4FJ5 A;  4AHR A;  3CPW M;  1ZBH A;  1TUU A;  3D2E B;  5M1P A;  2A6A A;  4BE0 A;  2A3Z A;  4H5V A;  2ITM A;  3K5L A;  4AIL C;  1A5V A;  2FBV A;  3NF7 A;  1WUA A;  4W5T A;  1D9F A;  1DGK N;  4BR4 A;  4RW7 A;  4BRP A;  3SBT A;  4QS7 A;  3PO5 A;  4KHU A;  1S6Q A;  4FJJ A;  4U67 L;  2GUI A;  3NH0 A;  1VAZ A;  2I5J A;  1SL2 A;  4FWS A;  3NMU A;  4PA1 A;  2D0P A;  3VEN A;  4JD2 B;  1HRH A;  4B1Y B;  4FVM A;  4DQ8 A;  1KTQ A;  3ZSZ A;  3CG7 A;  5SWM A;  4CHO A;  1S3X A;  2KFZ A;  1L3V A;  3UB5 A;  5E41 A;  1ZYQ A;  3R1X A;  2B4J A;  1YIT N;  3HO1 A;  4YOW A;  3CC4 N;  1C6V A;  4OKE A;  1M1K O;  3MDQ A;  5GAE P;  5KGX A;  3ZX0 A;  3CJC A;  4N56 A;  1WSI A;  1RBS A;  3LAL A;  3CFR A;  3ZSO A;  3SV4 A;  4F8R A;  4PHT X;  4WQ5 C;  4B9N A;  3AVF A;  1HMV A;  4BAC A;  4PKI A;  5AQN A;  3KK1 A;  3HST B;  4M3R A;  4PY5 A;  3J81 O;  1X1P A;  3O80 A;  2FF3 B;  4IFY A;  1NGC A;  4C1N K;  2KFN A;  3UKR B;  2X74 A;  3AA3 A;  3CCQ N;  3V9W A;  1GLB G;  4OPJ A;  4UQG A;  4CGH A;  3MXM A;  4JKG B;  3NH1 A;  4O0J A;  5HBM A;  3OYM A;  3K9K A;  4Z4G A;  2HOE A;  4KHY A;  2V7Z A;  4DQR A;  1VQO N;  1JLG A;  3RMB A;  1QTM A;  1BL3 A;  5EOY A;  4CJE A;  5CZ1 A;  4A59 A;  2W6K A;  1LOT B;  1RT4 A;  5LJV A;  3N4P A;  4YOT A;  4DUY K;  4WQ4 A;  2PFU A;  4BR0 A;  5EU7 A;  2P9N A;  4W5Q A;  3KLI A;  4CJ3 A;  5KQD A;  4TSX A;  3WT0 A;  1BHL A;  1U48 A;  5AQH A;  2NZT A;  4KB0 A;  4LFA K;  1XC3 A;  2QXL A;  4IBN A;  3BF3 A;  4C1N I;  3R8E A;  4LF5 K;  4IWV A;  3HSC A;  3AVJ A;  3QDK A;  1D4X A;  1OH5 A;  3LM2 A;  1ATR A;  1KVC A;  3KK3 A;  5AQW A;  3I56 N;  1JL2 A;  1HNV A;  4CFC A;  3K0S A;  2P9P A;  3AO2 A;  2VG5 A;  3QB0 A;  4YY3 K;  4R79 A;  3IS9 A;  2QW9 A;  3VQQ A;  1QSS A;  2UYT A;  4JEP A;  1Y97 A;  4H5W A;  1A5W A;  1RDC A;  2KW4 A;  1BA0 A;  3DRS A;  4ILJ A;  5J2Q A;  1N32 K;  3BY5 A;  4X65 K;  2Z1I A;  3M8P A;  4E1M A;  2UUC K;  4KB1 A;  4WE1 A;  5HRS A;  3OTO K;  1YF5 L;  4DF4 A;  2P9L A;  2ZQB A;  4DR5 K;  4CGI A;  3HJF A;  2QWO A;  3OBY A;  2W41 A;  4JD2 A;  2HND A;  2BAN A;  4ELT A;  1RCH A;  2AP1 A;  4CJK A;  2KKZ A;  3ZSV A;  3O3H A;  3ZEU A;  3QEP A;  4MLE A;  3ZCM A;  4M7X A;  1TAU A;  3TTF A;  4G9Z A;  2GEL A;  1H1V A;  4KHW A;  1XNR K;  4CEC A;  4H4O A;  3ZT0 A;  2O4G A;  4B9Q A;  4OLB A;  1Q18 A;  1U6Z A;  3E9P A;  1SKS A;  2IGI A;  3IDH A;  3W3D A;  2G8K A;  3NH2 A;  1GLE G;  4M3Y A;  3EE9 A;  3SQ2 A;  4DTX A;  3O08 A;  1BGX T;  2QI2 A;  3HT3 A;  3TAB A;  4M45 A;  4AHU A;  4GW6 A;  3HM8 A;  5AFU H;  2KZZ A;  3SMS A;  4O55 A;  3WXL A;  3LWM A;  3LP1 A;  5FPD A;  2YHA A;  1DTQ A;  3ZET A;  2WBN A;  4JKA A;  4CIF A;  3RRH A;  4DS5 A;  3L2Q A;  1C0G A;  2GEM A;  1S9E A;  3KK2 A;  3KTQ A;  3I0S A;  1RT7 A;  2JWL A;  3QEW A;  1GLA G;  3FGU A;  5CYQ A;  2Q97 A;  3H45 C;  1HNZ K;  1NK9 A;  2LSN A;  3O3F A;  4KH5 A;  3WNH A;  1RT2 A;  1L5U A;  1K8K B;  3QO9 A;  1U4B A;  2VGN A;  4LSN A;  4YDU C;  5D3G A;  4JI3 K;  3K9J A;  3EYZ A;  5JIC A;  2ZGZ A;  1BQN A;  3AO5 A;  4H0T B;  4WQ4 C;  3VA3 A;  2O8F B;  4NCA A;  5BN9 A;  3TAM A;  3IMX A;  5KQ8 A;  4CER A;  3VQA A;  5J1E A;  3K59 A;  1CZB A;  4KH4 A;  2QXF A;  3C6H A;  5AQT A;  5CE3 A;  4FWK A;  3MX5 A;  4O44 A;  3WNE A;  1NOY A;  4DQP A;  2OPS A;  5HRO A;  2D0B A;  3FZM A;  3SZ2 A;  1KCF A;  3PO4 A;  4BQL A;  2XRI A;  3CCJ N;  3S3M A;  2O8B A;  1C0F A;  1XMO K;  4E1N A;  1WAJ A;  4MLH A;  3WQT A;  3SBG A;  4CZH A;  2YJE A;  4CF1 A;  4CEF A;  3DWL A;  3TAF A;  3C6A A;  2OTJ N;  1NGG A;  1RIL A;  3S41 A;  4DFJ A;  2FC0 A;  2BDP A;  1L3U A;  4JV5 K;  5I9E B;  4H0O A;  4DQQ A;  4BR9 A;  3A5N C;  4FJ8 A;  3SMP A;  3KWG A;  1JCF A;  1TL1 A;  1RDD A;  3SUO A;  2QWP A;  4A2B A;  5HRN A;  3CJ1 A;  3OYE A;  4FJ9 A;  3QFU A;  2PYL A;  1BIU A;  3QES A;  1TGO A;  3HP6 A;  1U2V B;  2X6N A;  3OHR A;  4I7F A;  1N36 K;  2AJQ A;  3OYJ A;  5F2R A;  2VGM A;  1HQE A;  2Y1J A;  1C1C A;  2P9U A;  3FZH A;  3J80 O;  1KLM A;  4EP4 A;  3CCM N;  2NRT A;  4CVN E;  4CF0 A;  4HVJ A;  4FXD A;  2EHG A;  1NMN A;  3RVC A;  5KPR A;  1G15 A;  3DOL A;  4DTM A;  1NK0 A;  1K6Y A;  3RR8 A;  1L3T A;  3AO3 A;  4B8A B;  5AJ3 K;  5FRM A;  4KFB A;  3MCA B;  4ISG A;  5EVZ A;  1C0T A;  1TUY A;  1V4S A;  1S6P A;  3HYF A;  2NUB A;  3W0L A;  3HP9 A;  3SAG A;  4FZZ A;  1ZBL A;  3SJJ A;  1IBL K;  3M1F A;  3TTC A;  4JHD B;  3VA0 A;  4WFA L;  4DR2 K;  3DXK B;  3HTV A;  5J2N A;  2FSN A;  4E7I A;  1D5A A;  4A5A A;  1IV0 A;  2EWS A;  4CEA A;  3ATU A;  3NVM A;  4A62 A;  1T7P A;  4C8K A;  4FJH A;  4CEE A;  1IKY A;  1S1T A;  3M8Q A;  4CW7 B;  4RWT A;  2ITG A;  4Q0B A;  2HBK A;  3QEX A;  1QSY A;  1Q86 O;  3NGI A;  3AO4 A;  3LP3 A;  4B1U B;  3OBW A;  2KTQ A;  1VRT A;  3U9D A;  2FSK A;  5FLX O;  3P31 A;  4DLG A;  2P5G A;  2E2Q A;  1KVA A;  3O9S A;  1BU6 O;  3NFA A;  1LWC A;  3F9K A;  3RSE A;  4FOE A;  3V9Z A;  5FPM A;  1J9A A;  1SL0 A;  2P9L B;  4PKG A;  4IJA A;  3VET A;  4IOA L;  3CFP A;  4CHN A;  3H46 O;  4QS8 A;  5AQO A;  1GOC A;  5CY4 A;  3THY B;  3BGR A;  1WSE A;  2OZS A;  2E6M A;  4XEI A;  4BVO A;  4KRE A;  5FRO A;  3A5L C;  4KRF A;  1GLJ O;  1NBW A;  3VTI A;  3KLF A;  3HPG A;  4M3T A;  1M90 O;  3HXM A;  1NGB A;  1Q9Y A;  4FSV A;  3IUC A;  4HUE A;  4Z4E A;  3LDP A;  3CJ9 A;  3CCE N;  3VEZ A;  3G10 A;  2HHV A;  4DKW A;  4FWR A;  1TKX A;  5AQU A;  1IG8 A;  4FWN A;  4O8U A;  1YI2 N;  2AA4 A;  4CJQ A;  3E9L A;  4M41 A;  3P39 A;  4BRD A;  3VTH A;  4CZM A;  1Z26 A;  4CZL A;  3T1H K;  4KV8 A;  4Z94 A;  3QIP A;  1GLF O;  3DRP A;  4CK1 A;  4DV6 K;  4NYN A;  3QER A;  1U2V A;  1SKW A;  1BUP A;  3VF6 A;  1YJW N;  3PY8 A;  2E6L A;  4CHZ A;  4IEE A;  2ZJQ L;  4KHS A;  4E3S A;  3WXM B;  1KRP A;  2NLX A;  3S3N A;  1TYQ B;  1LWE A;  3LDN A;  5DM6 L;  3OW2 M;  4AM7 A;  3EKS A;  1XNQ K;  2E2N A;  4JS4 A;  3L2R A;  1C1B A;  4LF9 K;  4OX9 K;  3VQP A;  1HKB A;  5A2Q O;  2F4V K;  5AQF A;  4CGJ A;  3L2V A;  1KFD A;  1RTH A;  1BOT O;  3OYA A;  4JRQ A;  4YDU A;  3TAG A;  3OYI A;  3AY9 A;  5J2P A;  1TVR A;  1OVQ A;  4G1Q A;  3NAE A;  3TWH A;  3FFK B;  1GLL O;  1HX1 A;  4DS4 A;  4W5O A;  1XC9 A;  4EAH D;  3KVG A;  5E26 A;  3LWL A;  3KKR A;  1VSI A;  4BWJ A;  1S22 A;  3DAW A;  3G71 N;  3LAK A;  3NE6 A;  3AVC A;  1HNX K;  3DLE A;  3H3O B;  3M5R A;  3WXI A;  3EZ5 A;  1BO5 O;  4DTJ A;  4BRM A;  3OJS A;  1LAV A;  1QHT A;  2ZGY A;  3WNG A;  4FLW A;  5HRP A;  3ITH A;  1WBB A;  3BUZ B;  1HYZ A;  3ZSR A;  3I0R A;  3AAP A;  1HR0 K;  1VSD A;  4CFA A;  3E1Y A;  1HQU A;  1KFS A;  5K14 A;  5J2M A;  4DR6 K;  2A1R A;  3G0Z A;  3SQ0 A;  1RTJ A;  3CCR N;  1VSK A;  1KAY A;  1YJ9 N;  3D2F B;  5LY3 A;  1FJG K;  4B3M K;  1O13 A;  2IIR A;  1IH7 A;  3KHY A;  4CF9 A;  4NB4 A;  3MX2 A;  2BH1 A;  4DSJ A;  5DMR A;  3ZSY A;  3VQB A;  4DV2 K;  4ILH A;  3MCP A;  3FZF A;  3DLH A;  4ZTF A;  2HMP A;  4HWI A;  1TKD A;  1EO1 A;  3KLG A;  4F9O A;  4JLH A;  4FM0 A;  1YJN N;  3H3N O;  5CZ2 A;  2QKB A;  1ASU A;  4K43 A;  3JS6 A;  4BRH A;  4I2P A;  3UKU A;  4A2A A;  3PSF A;  1IBM K;  5C12 A;  1TAQ A;  3HPH A;  4CGG A;  3R6M A;  2JGU A;  1TK8 A;  1GLC G;  4JKD A;  4FK4 A;  3VQ4 A;  1X3M A;  5LL6 Z;  4IG3 A;  3NGY A;  1OKJ A;  3G4S N;  3K5N A;  1Q82 O;  4IDH A;  3C7N A;  3VEV A;  4FVU A;  2P9P B;  3NBP A;  3F9M A;  3TPQ A;  4EIA A;  2CGK A;  4CJ4 A;  1NK7 A;  4CJR A;  2DFE A;  3SPZ A;  5C2D A;  4IEI A;  3EEQ A;  3LL3 A;  1RBT A;  4BC5 A;  4OO1 J;  3OVN A;  4DHY A;  4FCY A;  1KQS M;  3BZK A;  4BQZ A;  4CZE A;  3FR0 A;  2NRR A;  2OPQ A;  1U04 A;  4H03 B;  1SV5 A;  2Q1N A;  4B1X B;  5AQR A;  4CHY A;  1NGE A;  1NOZ A;  2BE2 A;  3CCL N;  4B9M A;  3S3O A;  1WSH A;  2P9K A;  4WFB L;  4QS9 A;  3SK3 A;  2YHX A;  3BZC A;  2KLA A;  4RCH A;  5I3U A;  4A57 A;  4DSK A;  4OGC A;  1NLV A;  3L2W A;  3TAQ A;  2VWK A;  3FZK A;  1C0M A;  4CED A;  2HHW A;  3V1R A;  3ZSW A;  3AVH A;  3MN9 A;  2UXB K;  2QA4 N;  3THX B;  1QE1 A;  2E8A A;  1EKE A;  1S5J A;  3DXK A;  4CJW A;  3LZJ A;  1JKH A;  2A1S A;  2X78 A;  4HCB A;  1OH8 A;  4BR7 A;  1X9W A;  3U9Z A;  2G8U A;  1XHX A;  1K73 O;  3AV9 A;  3HZ6 A;  3ULE B;  3U8X A;  3EY1 A;  4JKE A;  2XY5 A;  2Q36 A;  5M1O A;  4H0Y B;  2FF6 A;  1C1A A;  4LC9 B;  2ZWH A;  5DK5 A;  1WNS A;  4IG0 A;  3P83 D;  3Q7C A;  3VF4 A;  4K25 A;  4ELV A;  1WSJ A;  4DFP A;  4J2A A;  3CI5 A;  3K5O A;  3B6P A;  2I7P A;  3VGM A;  3J7A P;  1BIZ A;  4AHC A;  5H1S Q;  1F21 A;  1N6Q A;  2BTF A;  1RT3 A;  1XMQ K;  3HOS A;  3SUP A;  3CC2 N;  2PY5 A;  2HNZ A;  5ELZ A;  1ATN A;  2V52 B;  4C8N A;  2OA8 A;  4RG8 A;  3C0B A;  3QLH A;  1REV A;  2GWK A;  3L2U A;  4IO8 A;  4IFE A;  5EX5 A;  1D9D A;  4BRQ A;  3RMD A;  3SQ4 A;  4JI6 K;  5AQM A;  4DG1 A;  4WYB A;  4O4G A;  4DV4 K;  1KAX A;  2A42 A;  3TU5 A;  4RW8 A;  4IXC A;  4CES A;  4PL8 A;  3DLR A;  4ZTJ A;  1S9G A;  3ENO A;  3VMF B;  3OYH A;  4CJU A;  1DT9 A;  2WUS A;  4FLU A;  3KD5 E;  2YNH A;  3ULD A;  1EQY A;  1L3S A;  2D0A A;  1D8Y A;  3MEE A;  3B8A X;  4CF8 A;  3MWT A;  1YAG A;  1JCG A;  2ETJ A;  4CJL A;  1QQN A;  4FZY A;  5ADX H;  4Z0U A;  3V9U A;  2OYQ A;  2QWN A;  4JRP A;  3U4L A;  3AO1 A;  3DLL L;  3I8B A;  2R7Y A;  4CZF A;  3MWP A;  5F1X A;  3LPU A;  4M3U A;  3VEW A;  1HNW K;  1QSL A;  4CBW A;  3V81 A;  5IT9 O;  2J4R A;  4PL7 A;  3M6G A;  1BCM A;  1Y64 A;  3WXJ A;  3OYB A;  2O8C A;  2ASP A;  4FYD A;  2GWJ A;  3ALY A;  1IKW A;  4DU4 A;  4MFB A;  4Z4H A;  1VSM A;  4BC3 A;  3VER A;  3ISN C;  1N33 K;  3NCI A;  4AH9 A;  4DR3 K;  3T3F A;  3FLC O;  1BQM A;  3C95 A;  2G8W A;  4B3S K;  4BR5 A;  3M3Z A;  4GMJ B;  5KRS A;  2VWB A;  1NGD A;  3QET A;  4CHQ A;  4FOI A;  1NKB A;  1DTT A;  3T19 A;  1K8K A;  3QEI A;  2E4L A;  1LWF A;  3KLH A;  1I3A A;  4EHT A;  2RE2 A;  2GX9 A;  4FK0 A;  1YTA A;  4FW2 A;  3OA9 A;  2OPR A;  4CZG A;  2ZJR L;  1RT5 A;  1KXP A;  3PX0 A;  1GOA A;  3EL2 A;  3THW B;  1HPZ A;  2GTD A;  3I33 A;  3D2F A;  3T1A A;  1SQK A;  5AQI A;  4EHU A;  2E2O A;  3TAP A;  2IVO A;  3CD6 N;  4RTF D;  1JJ2 M;  2D4W A;  1NWK A;  3KWI A;  4B9L A;  4JKG A;  1N8R O;  3LP2 A;  3QBX A;  1QVG M;  1LW2 A;  1T6C A;  2HHH K;  1NJZ A;  1BWF O;  4CJV A;  4B9T A;  5GIN A;  5AQZ A;  1DKG D;  5B8H A;  4O0I A;  1VQN N;  3OYD A;  1YUW A;  4A61 A;  4B9V A;  2NNW A;  3THV A;  1YTU A;  3AAQ A;  5BPL A;  2HBM A;  3ZSQ A;  3PIO L;  4KAZ A;  5AQX A;  3RMA A;  3LM9 A;  1X9S A;  3AA2 A;  1VSF A;  5FDL A;  1HYS A;  3O4W A;  4I9Q A;  2DTU A;  3RR7 A;  2V7Y A;  4KTW A;  3OJU A;  4Z4I A;  3HOT A;  1O1W A;  4DSI A;  2YI1 A;  3CM5 A;  5BR9 A;  3PX4 A;  5HP1 A;  3LDQ A;  1UOC A;  1RDA A;  1MWM A;  4PUO A;  3IKM A;  3AA5 X;  3WUH A;  4HCC A;  4NCB A;  5GAD P;  3L8B A;  5EXW A;  3MMV A;  5C0Y A;  1RGI A;  4DQS A;  3O3G A;  4PKH A;  4CZI A;  1YIJ N;  4OKJ A;  3RMC A;  1T03 A;  1BA1 A;  4NLC A;  3ASM A;  1HKC A;  2E5L K;  2ZF5 O;  1N34 K;  2QWL A;  3IRX A;  3QIN A;  5AQS A;  3T7Z A;  1VRU A;  3VN5 A;  1NGH A;  3UKU B;  3VQ5 A;  1MWK A;  4LF8 K;  1RT6 A;  4QOZ B;  1HUX A;  1LW0 A;  1EWQ A;  2UU9 K;  2HHT A;  3HPO A;  3OYC A;  4JI7 K;  3AVN A;  4JKB A;  1ZBF A;  1S1V A;  2QWQ A;  1VSJ A;  3QFP A;  1QS4 A;  2UUA K;  1QZ6 A;  5BRD A;  2D1K A;  1VQL N;  3I55 N;  3AVA A;  4OJR A;  3MXJ A;  4CIG A;  3KD1 E;  5GAG P;  2A40 A;  1IKX A;  4XIU A;  4BWM A;  2RKI A;  1W2B M;  2HBL A;  1J6Z A;  4N47 A;  4B1Z A;  1NGI A;  4K8X A;  2VYP A;  1S1U A;  3C6T A;  3CJ7 A;  1KSP A;  3CYM A;  1SS6 A;  4FLV A;  1J53 A;  2XY6 A;  1NNE A;  1LAW A;  2Q31 A;  1HNI A;  2P5O A;  4M42 A;  5FRN A;  2XY7 A;  3GBT A;  2KZM A;  3LP0 A;  4KHN A;  1WLJ A;  1TYQ A;  3ZSX A;  4XH5 A;  4IO9 L;  3SQ1 A;  1RTD A;  4DR4 K;  2O8D B;  4EFH A;  4J2E A;  3DOK A;  2P9S A;  2YKN A;  4CGD A;  2QM1 A;  3D45 A;  4CJ7 A;  1RDU A;  2YV0 X;  3C65 A;  5TKW A;  3IFR A;  4RW9 A;  3R9P A;  4CJF A;  1VQ5 N;  1IO2 A;  4BC2 A;  3DI6 A;  2EX3 A;  2P1J A;  3VF2 A;  5AZJ B;  2QTD A;  2QWM A;  3KKS A;  4YOV A;  4OGE A;  1ESV A;  2V51 B;  3MN5 A;  3J7Z O;  3A5M C;  5C10 A;  4ICL A;  4DF8 A;  3CQX A;  4XH1 A;  3THX A;  1Q9X A;  1T05 A;  1VK0 A;  2VCP A;  3OYG A;  3E9O A;  2FXU A;  1QQO A;  3MXI A;  5HRR A;  5BRE A;  3ULE A;  4R5P A;  3P1G A;  2Q0R A;  4BDY A;  3CMA N;  1T44 A;  1VQ6 N;  1P90 A;  4JKC A;  1WSG A;  4BR2 A;  3SCX A;  1YHQ N;  3K57 A;  1BI4 A;  4Y1D A;  1XWL A;  1WN7 A;  4GNI A;  4KI6 A;  5ADX A;  1X9J A;  2RHK A;  2DFH A;  2FBY A;  2XO7 A;  4CD1 A;  2WOM A;  2PYJ A;  3A5O C;  3RSE B;  4QCL A;  2DY4 A;  1JXE A;  4DCH A;  4BDZ A;  1SKR A;  2IDO A;  3EZW A;  1Z05 A;  3THY A;  2G8V A;  5AQJ A;  2A5X A;  4AHS A;  3H6E A;  3IG1 A;  2F8S A;  4F2R A;  3L0Q A;  5FPN A;  2HHU A;  4I6M A;  4GKK K;  4J2D A;  1UA0 A;  3C94 A;  3SUN A;  3V6D A;  3O9Q A;  1NK4 A;  4KH6 A;  1S1X A;  3ID8 A;  3EN9 A;  4A5B A;  2VQE K;  1TKT A;  4BDP A;  4N41 A;  4H5R A;  5KI6 A;  1XI1 A;  3MED A;  4F4K A;  3DYA A;  2QK9 A;  4HTU A;  2RF2 A;  4HUF A;  1OH7 A;  1KLN A;  4CD3 A;  3TSQ A;  3H1V X;  2W42 A;  4F3T A;  4K41 A;  1NM1 A;  3CCS N;  3G6E N;  1ZXO A;  4E7K A;  4FJK A;  2O8E B;  2PZS A;  3V9S A;  4MDA A;  4DLE A;  2NRZ A;  3Q7B A;  4FJ7 A;  3VQ8 A;  4H5N A;  3ENH A;  2Z1H A;  4CK3 A;  2PBD A;  4K42 A;  4DTU A;  2ZJP L;  5KRT A;  1UWB A;  3E01 A;  3VEX A;  1NJX A;  4FJG A;  4JK9 A;  2P9K B;  2B5J A;  3EO3 A;  3PX6 A;  2Z1G A;  5BRH A;  4DSE A;  4O8K A;  3O1B A;  1IG9 A;  2E1Y A;  4BGA A;  2ASM A;  3ZX2 A;  1U49 A;  1W97 L;  4Y0W A;  3TTD A;  3V9X A;  2W40 A;  1YVU A;  3DLB A;  5AQQ A;  2PAV A;  1BDG A;  4DTO A;  2I7N A;  1J54 A;  4BE2 A;  1JLC A;  3AVG A;  3FFI A;  3AA4 A;  1K9M O;  3KK7 A;  5BR8 K;  2WON A;  3NGZ A;  4JHD A;  4DTS A;  5HLF A;  3CF5 L;  1TK5 A;  2CH6 A;  3DJC A;  2FSJ A;  5JLH A;  3SLC A;  1IBK K;  4M3W A;  3DM2 A;  3RTV A;  4FM2 A;  5JLF A;  5TKY A;  3CJA A;  4CF2 A;  4LF7 K;  2NRH A;  1SZ2 A;  3QNO A;  3V4I A;  2HHQ A;  4YOX A;  3QIC A;  4DSL A;  3GL1 A;  1RNH A;  3BP8 A;  4B1V A;  3THW A;  2GBZ A;  3QBW A;  2YHW A;  4GVM A;  2BGG A;  1UAX A;  4CEQ A;  2IOC A;  1JL1 A;  1YT3 A;  2UXD K;  3V1O A;  3U6F A;  4X64 K;  1QQM A;  3OYK A;  5EY4 A;  3SJH A;  1W7A A;  1QQC A;  3J8A A;  4X66 K;  3LAN A;  3ZYY X;  4EZ9 A;  2UUB K;  4CBU A;  4FM1 A;  4HUG A;  3VOV A;  3VES A;  4ZHR A;  1DEJ A;  4FPB A;  5KPZ A;  1YXQ A;  3B6O A;  3GE1 A;  2G8F A;  1E4G T;  3HI0 A;  5AQY A;  3CFO A;  3L4I A;  3ZEU B;  4H0P A;  3WNF A;  3ZX3 A;  1CZ9 A;  5M1K A;  4K0K K;  4BRC A;  3CQY A;  3SPY A;  1HKG A;  1T3V A;  2RPI A;  3L6Q A;  4KI4 A;  1FXX A;  3TSP A;  4CK2 A;  1CLQ A;  2HMI A;  4B3O A;  4CEB A;  1EWR A;  4OPK A;  3NHG A;  3E66 A;  3OYL A;  5JMV A;  5AQG A;  4ISF A;  1VQM N;  3LDO A;  1HLU A;  3O4Q A;  3P38 A;  1JXB A;  2GUP A;  2NRV A;  2H3G X;  5GAH P;  3TAE A;  3NF6 A;  5T7B A;  1Q7Y O;  2CGJ A;  2D0O A;  3EE8 A;  3T69 A;  2FLO A;  1WB9 A;  4PQU A;  4JK7 A;  3CER A;  3ZT1 A;  4BRI A;  3L3V A;  1SAZ A;  1VSL A;  2G8I A;  4AHV A;  4U7B A;  3D7E O;  4W5R A;  1NG9 A;  4FJM A;  5C42 A;  3O9U A;  2KHO A;  4NXM K;  3EKU A;  2HB5 A;  4KTQ A;  3O4N A;  5C24 A;  4B9S A;  4AF1 A;  1KD1 O;  2F7T A;  1ZBI A;  1VSE A;  4BGB A;  4BY9 C;  3KZB A;  2KQ2 A;  4B8C A;  1E3M A;  1CXU A;  5GIP A;  2WTU A;  4FJL A;  1MA9 B;  5CHI A;  2YHB A;  1T6D A;  2YJF A;  3TAN A;  4FLT A;  5AQK A;  1ZC6 A;  3CIP A;  5DM7 L;  3FZL A;  3NDK A;  3G25 A;  4KTZ A;  3JAM O;  3LZI A;  3WEE B;  3S9H A;  2F9T A;  4I9L A;  2O4I A;  2CGL A;  2A41 A;  4IFV A;  1U47 A;  1Z25 A;  4OLA A;  2JLE A;  4XH4 A;  4Z4F A;  5JS2 A;  1ASV A;  1YVN A;  4OPH A;  3U3Y A;  3JYT A;  2JWK A;  3UKR A;  1RT1 A;  3VQE A;  5F0X A;  1SL1 A;  4LF6 K;  3NVK A;  2O8D A;  1NJI O;  2XY8 A;  1NGF A;  1RBU A;  3VQC A;  3WQU A;  5AZI A;  3CCV N;  3KLE A;  4YOU A;  4KHQ A;  5I42 A;  3AVK A;  4LY7 A;  3O6W A;  1S1W A;  2P9N B;  4Q5V A;  3TAR A;  1NMD A;  4KBO A;  1VQ4 N;  2F96 A;  5IWA K;  4ID1 A;  5CR4 A;  4HHT A;  1S72 N;  2X6S A;  4M3X A;  1Q8I A;  4BRK A;  4NXN K;  1K8A O;  2P51 A;  3MN7 A;  3VEY A;  2E20 A;  1VQK N;  4YOY A;  5HL7 L;  1KC8 O;  4M3Z A;  1QHA A;  3O9R A;  4M63 C;  4JNE A;  3C7N B;  1P8Z A;  5M1N A;  3PSI A;  1BG3 A;  4E89 A;  2VWJ A;  3ZT2 A;  3O1W A;  5AR0 A;  1NJY A;  2UXC K;  2Q2R A;  3LAM A;  4JI1 K;  3PV8 A;  2HF4 A;  2D5R A;  4PWD A;  4N76 A;  2P9U B;  4JKH A;  4LH4 A;  1JLF A;  4WQ5 A;  3VEO A;  5KPT A;  4NCG A;  2E1Z A;  2DFF A;  4CGF A;  4FJN A;  4B08 A;  3H1Q A;  2O8C B;  2W6L A;  3ZT4 A;  1Z6R A;  2QWR A;  2Q0U A;  2HW3 A;  2HHS A;  3O9T A;  3SAH A;  3SAF A;  2RN2 A;  2ZD1 A;  5C2F A;  4JI0 K;  4OKK A;  4JYA K;  3AGK A;  4GKJ K;  1IKV A;  2F9W A;  4LFC K;  3DXM B;  4DU3 A;  4F2S A;  4KHP K;  4FWO A;  5KTQ A;  4J2B A;  3OY9 A;  2VG6 A;  3UE5 A;  3QML A;  4FL9 A;  2HST A;  4OVL A;  2YX6 A;  2YHY A;  1VQ8 N;  2HF3 A;  3PLA A;  3NF9 A;  4MO4 A;  4CI6 A;  1FKO A;  3N4Q A;  1TKZ A;  3V1Q A;  3PIP L;  5KGW A;  3VQ7 A;  2DPN A;  3MN6 A;  4BE1 A;  1NGJ A;  4B3T K;  3QEV A;  3UIQ A;  2Z1J A;  3L3U A;  1W9H A;  3AGR A;  3AVI A;  2CH5 A;  4BRL A;  1B9D A;  3CQ8 A;  3CHW A;  1BI4 B;  4FZX C;  2F8T A;  2XHB A;  3CXC M;  4W5N A;  4BRF A;  4DTN A;  1NK8 A;  2OTL N;  1X9M A;  4DSF A;  1BCO A;  3NF8 A;  4B1W B;  4IOX A;  1U45 A;  1KVB A;  5LMU K;  1ITG A;  2WC9 A;  4BG8 A;  5M1F A;  3DLK A;  3D6R A;  1VHX A;  4EZ6 A;  4O5B A;  3CME N;  4JK8 A;  2IC3 A;  5MLC Q;  1I94 K;  1JLA A;  2NRW A;  4DR7 K;  4DTR A;  1WOQ A;  3K58 A;  1RTI A;  4I6M B;  4JAX A;  1NJW A;  4DQI A;  4LH5 A;  4FPA A;  2OAN A;  4DR1 K;  4FO0 A;  1X3N A;  3AVB A;  4CZK A;  4DFK A;  3D0P A;  1EXQ A;  3U3G A;  4DV5 K;  3CPE A;  1WBD A;  3LPT A;  3LDL A;  4WF9 L;  4JN4 A;  4FWL A;  5JS1 A;  3VQD A;  4WCE L;  1MU2 A;  1VQP N;  4BRN A;  3SI6 A;  4ID5 A;  2HVI A;  1FK9 A;  4J8F A;  3F73 A;  3D2E A;  3RRG A;  4BRE A;  3MAQ A;  5BN8 A;  5AQV A;  4FJX A;  4FW1 A;  4BG9 A;  2Q3S A;  1R0A A;  1Q81 O;  1DLO A;  3I8D A;  4C8L A;  2ZE2 A;  4FWP A;  4BVP A;  5JVH L;  1EX4 A;  4GY2 B;  4L3Q A;  4RW4 A;  4C8O A;  2HHX A;  1LCU A;  4GV9 A;  4IOC L;  4JS5 A;  4DUZ K;  4BRA A;  4E1J A;  4FWM A;  4DV3 K;  1WAF A;  2P9S B;  3ATV A;  1ZBU A;  1G99 A;  2HNY A;  1QVF M;  4F3O A;  3VQ6 A;  2OCE A;  3SV3 A;  4H0V B;  3HM9 A;  4GVE A;  2YNG A;  1VSH A;  5AQL A;  5E84 A;  3P4I A;  2E2P A;  2ATQ A;  4IJN A;  4FLZ A;  3HVR A;  3BEX A;  4FWQ A;  2IVN A;  3J7Y P;  1BIS A;  1W0H A;  1FW6 A;  2IS3 A;  2WFB A;  2VG7 A;  4QAG A;  4CZJ A;  3DLG A;  5LMN K;  1XHZ A;  4FK2 A;  3HRG A;  3OYN A;  3CC7 N;  4CJP A;  3HBT A;  3TI0 A;  3F2K A;  4IDK A;  4NLB A;  4C23 A;  3L4Q A;  3FE1 A;  1OH6 A;  1CZA N;  1TK0 A;  3A0I X;  3SUQ A;  4KPY A;  2Y1I A;  1ILY A;  2FBT A;  1B92 A;  3AVM A;  4H4M A;  4CIE A;  1SUQ A;  2YNI A;  4MO5 A;  3KJV A;  1OVY A;  3RWU A;  2VQF K;  3K5M A;  1RBV A;  4FLY A;  4AQY K;  3SNN A;  4H0X B;  2P9I A;  1JLB A;  3OS2 A;  1V4T A;  1GOB A;  2OPP A;  1GLD G;  4IKF A;  4YNQ A;  4YOR A;  4LF4 K;  4CEZ A;  3C6U A;  4LFB K;  4DMN A;  2IAJ A;  3TR8 A;  3A8Y A;  4N5S A;  1RBR A;  1B9F A;  1ASW A;  4ILG B;  4JI8 K;  5AZJ A;  4B9U A;  3DRR A;  4KO0 A;  1RDW X;  3OS1 A;  1EP4 A;  3GDQ A;  1JLQ A;  1XQS C;  3HVT A;  1HJO A;  4E0D A;  4UY8 O;  4JI2 K;  1NKE A;  3ENB A;  3JXU A;  1IJJ A;  1TV6 A;  3PUF A;  3M8S A;  5CYM A;  2D0C A;  1J5O A;  4DFM A;  2GV9 A;  1NK6 A;  4B3R K;  3VPZ A;  4DWI A;  3ID6 A;  1XUP O;  4JI5 K;  2G8H A;  4JI4 K;  3BDP A;  1HJR A;  3P5J A;  2QKK A;  3O8M A;  4C8M A;  3WEE A;  4YFU A;  1KAZ A;  4H5T A;  4CFD A;  3OYF A;  5JVG L;  3CJB A;  5BPN A;  4DTP A;  4CBX A;  2YCH A;  1HPM A;  3O5B A;  3HL8 A;  4ISE A;  3AVL A;  5FPE A;  4E7L A;  5SZT A;  4K8Z A;  3WXK A;  3KIO A;  4CCH A;  2O8B B;  5BRF A;  2E88 A;  3ZET B;  5AZI B;  1FKP A;  2QEX N;  4E7J A;  4CFB A;  2HVH A;  3A2F A;  3CCU N;  3IAY A;  1VQ9 N;  3DXM A;  1N5Y A;  4DV1 K;  2FBX A;  4IZ9 A;  1RDB A;  1UA1 A;  2ASO A;  4M7Y A;  4DV0 K;  4GV3 A;  5AFU A;  5GIO A;  4BRO A;  1HYV A;  3LDS A;  1C0U A;  1JCE A;  3JSM A;  4CHP A;  4WFN L;  3DMJ A;  4FLX A;  4AHT A;  4AM6 A;  1JLE A;  4FJI A;  1NKC A;  5C25 A;  1E4F T;  3BF1 A;  1ZBS A;  3TSU A;  1T8E A;  5M1Q A;  4CE9 A;  3ZLJ A;  4E7H A;  4MQ3 A;  3GG4 A;  1NGA A;  1QZ5 A;  5BPM A;  3MEC A;  1NK5 A;  3M8R A;  4BRG A;  2O8E A;  4JKF A;  4LSL A;  3VQ9 A;  2IVP A;  1ATS A;  3MK6 A;  4I2Q A;  4CJT A;  5HOO A;  2ZM6 K;  4RW6 A;  3CM6 A;  1CXQ A;  3QNN A;  4KKO A;  2P9I B;  5C15 A;  1NU0 A;  3R3L A;  4BC4 A;  3QIO A;  4GV6 A;  1J5E K;  3ZT3 A;  4Z4C A;  3OS0 A;  4NYF A;  1LV5 A;  2HBJ A;  4CJS A;  1WSF A;  3HK2 A;  3VGL A;  1VQ7 N;  4OPA A; 
#chains in the Genus database with same CATH homology
 3JAM O;  4B3R K;  4CW7 B;  1XMO K;  3J81 O;  4X66 K;  4JI5 K;  4JI4 K;  4DUZ K;  2UUB K;  4DV3 K;  1HNX K;  4YHH K;  1XNR K;  5FLX O;  4DR4 K;  4V19 S;  4DV7 K;  4LF6 K;  4B3T K;  4JV5 K;  1HR0 K;  4DUY K;  3J7Y P;  4DR6 K;  3T1Y K;  1HNW K;  4K0K K;  5IT9 O;  4X62 K;  1FJG K;  2UXB K;  4B3M K;  5LMN K;  4LFA K;  1N33 K;  5IWA K;  4LF5 K;  4DV2 K;  1N36 K;  4DV1 K;  4DR3 K;  5LMU K;  4NXN K;  4DV0 K;  4B3S K;  3J80 O;  4CVN E;  2VQF K;  1I94 K;  2E5L K;  4YY3 K;  1N34 K;  4DR7 K;  1HNZ K;  4AQY K;  5BR8 K;  1IBM K;  3T1H K;  4DR1 K;  2UXC K;  4DV6 K;  5AJ3 K;  4LF8 K;  1IBK K;  4LF4 K;  1N32 K;  4X65 K;  4JI1 K;  3J7A P;  4JI3 K;  4LFB K;  2UUC K;  4LF7 K;  4DV5 K;  3OTO K;  1XMQ K;  5LL6 Z;  2UU9 K;  4JI7 K;  4DR5 K;  4NXM K;  4JI8 K;  2ZM6 K;  2UUA K;  1IBL K;  1XNQ K;  4LF9 K;  4JI6 K;  4OX9 K;  4DV4 K;  4DR2 K;  5A2Q O;  4JI0 K;  2F4V K;  4JYA K;  1J5E K;  4GKK K;  4GKJ K;  2UXD K;  4LFC K;  4X64 K;  4JI2 K;  2HHH K;  4KHP K;  2VQE K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...