1HPZA

Human immunodeficiency virus type 1
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 122
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hpzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hpzA05
3I8DA 3DI6B 4J9LA 4FM2A 1HYSB 3AVFA 4RU9A 1ZYQA 3L3VA 2BANA 1YT3A 2OPRB 3B6OA 1BI4B 4DTRA 1T3NA 1RTIB 2C2DA 4ZMMA 1X9MA 3DM2B 3DRPB 2GIQA 3PUFA 1RT3A 3ISNC 5CYMB 4RUCA 3KK2B 3CVKA 2Z1IA 4CHQA 1JLFA 3QESA 1NJZA 3CG7A 2PYJA 1FKPB 1HPZB 1RA7A 4FJ9A 4TQRA 4RZRA 1C0UA 1QSLA 4CHOA 2ZKUA 3FQLA 3NGIA 3MEGB 4QPXA 1RAJA 1S1TB 5DG7A 5J1EB 4IR1A 1CXUA 1RBRA 3AVKA 1HARA 5DQIA 3DRRB 1HQEA 2OPSA 1TQLA 1CLQA 2P1JA 3KLEA 2LSNA 2YNHA 5HROA 4DSIA 4CJ4A 3HKWA 2RDIA 2BE2A 3KLHA 4C8MA 1T05B 4JS5A 3OSPA 1QUVA 5KG0A 4JLHA 2ZQBA 1REVA 4FK4A 4B9VA 4K50A 3Q8PB 3ZCMA 3U3GA 2E9RX 3KMSA 3WNEA 2Z1HA 5KFLA 4M3TA 4RW9B 2KFZA 5KFXA 2HWIA 4TY8A 3AA2A 1GX5A 4H4OA 2F8EX 3LP1B 2YV0X 3SYZA 3SQ4A 5DMRA 1RT2A 5KG5A 3VQDA 1L3VA 1WN7A 3NF7A 5SWMA 1NKBA 3KKRA 5FRNA 4CIEA 2D3ZA 1NK8A 2VG7B 3FFIB 1ZBFA 4K4UA 4CE9A 4ZVEA 2V9WA 4DFPA 1C1BA 3OYGA 3DI6A 3OL9A 2FJWA 2FJVA 1HYSA 1XR6A 4IFVB 2BR0A 4B3OB 2VWKA 2RF2B 4IDKB 4NLTA 3TVKA 2FVQA 3N6MA 4Q8EA 2VA3A 4LSLA 3VA3A 3RAXA 2WCXA 4JV1A 3DM2A 3RTVA 4MH8A 3CO9A 3LAMA 4K8ZA 3ZSXA 4ELVA 3KK2A 4ZPBA 4BE1A 4U6PA 5DLGA 3OJSA 3VQSA 1JXEA 2R8HA 3EPIA 4E1NA 2P5GA 3GV5B 1TV6B 4K4YA 4KHWA 1UA0A 5J2NB 3PJWA 2HMIB 4TYBA 3DRRA 3V1OA 4LQ9A 5KG3A 5KFDA 2BRLA 1VRTB 5KFPA 3HPGA 5EU7A 4CJWA 4O3OA 1JLEB 4ZP6A 4FCYA 3OYNA 2D0CA 4DL7A 2IM3A 4KHYA 2JEJA 4FJ7A 1N6QA 3LZIA 3WNGA 3MECB 3PO5A 4W5NA 3BQ1A 1DTTA 4KB7A 2C2EA 1BISA 1J5OB 4ZVFA 4FJMA 3OS0A 4R0EA 4ED2A 1N56A 1L3SA 1WAJA 1RDBA 1Z26A 4C8NA 4CGHA 2E9TA 3VQ8A 3OVNA 3C6UA 1RT4A 1U45A 3KK3B 1FK9A 1B9FA 4O3QA 4DTNA 1N5YB 1RYRA 3TAQA 4CIGA 3CFRA 4DQSA 1IG9A 4CGIA 1X9SA 4LH4A 1D1UA 3LP2A 1GOBA 4M3XA 3FRZA 4ZPAA 2YHAA 3GV7B 2F8SA 5CZ1A 5KGXA 2QV6A 1RBSA 4IFVA 4K4WA 4J9QA 4C8KA 4OPKA 5KG6A 4IDKA 2VG5B 1IKXA 1S97A 3ASMA 3HO1A 1XHXA 1C0TB 4ZP7A 4O3PA 4PQUB 4E0DA 4X2BA 1S1UA 3V9ZA 1IH7A 4U7CA 3K58A 2G8WA 4Y34A 4GW6A 1BCOA 2E9ZA 1YTUA 5DQGA 1JLGB 3EZ5A 1Z4UA 4OKJA 4F50A 1S9EB 3F9KA 3WNHA 3S3MA 3HHKA 1RNHA 3GIIA 3ZSOA 3ITHA 5FRMA 5J2PB 3ISND 4R5PB 1KVAA 4IFYB 2I1RA 5C24B 4QWBA 1VRTA 2R8KA 4DL4A 3RRHA 4AILC 4N5SA 2ASJA 2QKBA 4FBUA 4NLRA 1D5AA 4QW9A 4EP4A 1JLCB 4EEYA 4I7FB 3NDKA 2QKKA 4G3IA 4IBNA 1TL1B 3MECA 4MIAA 4HCBA 4XIUA 4JRQA 3M8SA 3KK1B 2AJQA 1NNDA 4FJ8A 2WTFA 2B5JB 3NH2A 3UQSA 4KAIA 1J5OA 4C8OA 4HHTA 1BQNB 4LSNA 4QW8A 2IBKA 4CEAA 3MTKA 1LWEB 1IKWB 3TWHA 4CEZA 1DTQB 4CFCA 4M3UA 4B9MA 2W9BB 1ITGA 4CGFA 4MK8A 1U4BA 3SFUA 4OGCA 1IKVA 3PW2A 3S3NA 2ILZA 3KK3A 1J9AA 2HHTA 3SNNA 3QZ8A 3NCIA 3K5MA 2FLPA 3I5CA 3K5LA 3IRXB 1QTMA 5F8MA 1LV5A 2HW3A 5KFTA 2HNZA 1TKDA 3OYHA 4DSFA 3NL0A 1RTDA 5L1LA 4N47A 3HVTA 2HNDB 3GYNA 5F8IA 1WSFA 3SJJA 3O4NA 2C22A 1JLQB 3AV9A 3CYMA 4XO0A 4FJLA 3QIOA 1TKZB 1ZTWA 4BE2A 3B6PA 3DLKB 5KFCA 3AVAA 3MR2A 3QIDA 4KSEB 3TR8A 1GOAA 1TAQA 4CJ5A 3AVHA 4F3TA 3QEIA 1KVBA 3NFAA 1RT7A 1KHWA 1JLGA 1I39A 4OL8A 4CK1A 1R0AB 4WZQA 3TQ1A 4CHPA 3M8QB 1I6JA 1K1QA 3NH0A 3KTQA 4R5PA 4ZPCA 3MR5A 3TANA 2QK9A 3OHAA 1RT5A 4O3RA 4FW2A 3V9WA 4KTZA 1D8YA 4PUOA 2BANB 4I7FA 3T5KA 4OLAA 5FROA 4WXOA 3DLRA 3QNOA 4M3WA 4EBCA 3CQ8A 1RT3B 3HVRA 4RW6A 2HHVA 4K4TA 3CM5A 1B92A 1JLFB 2B5JA 3OYMA 4ECWA 2D7SA 1JKHA 3ZSYA 1BL3A 1ASVA 1UOCA 3O3HA 3MXJA 3OYKA 3L2QA 2XI3A 1IKWA 3BGRA 2UVUA 4RUAA 4DFKA 1SUQA 3PX6A 4FK2A 4O0IA 2HAIA 2D3UA 4DF4A 3LPUA 4ECVA 3L2UA 1UA1A 3CIZA 4OVLA 4RNFA 2OPSB 4CJTA 1WSIA 2KQ2A 1WNSA 2XHBA 4NYNA 2R2SA 3NGZA 1S1XB 1NJYA 4AHSA 1S9GB 3QO9A 3HM9A 3IS9A 4TQSA 2BE2B 2RKIA 4CK2A 3OLBA 2HNDA 3KLHB 4ECSA 4OPJA 1NOYA 4KB0A 4Z4IA 4B9NA 1WSJA 4TXSA 1JLQA 2YNGA 3H4DA 1REVB 5F8LA 3K59A 4J2BA 4EZ9A 1C1CA 5KG4A 3PW7A 3VA0A 3AO4A 3KMQA 4LQ3A 4EYIB 4RNHA 3H40A 4IG3A 2W7OA 5HLFB 4GC6A 1NKCA 4HKQA 4LY7A 1VRUA 3NGYA 4CHNA 4FZZA 4H4OB 1TVRB 4M42A 1TKTB 3JYTA 1VSKA 1K1SA 4ED3A 3SUNA 2AX0A 3IAYA 3E01A 2HWHA 4Q43A 4F4XA 1WSGA 4DU1A 4DFJA 1NOZA 3ZT0A 2UVRA 3V6HA 1C1BB 3OYCA 2IJNA 5DGAA 3FSIA 1EXQA 1C2PA 4RG8A 1RBVA 3CJ0A 4I2QA 4WYLA 2XO7A 4LSLB 3V6JA 4ECUA 4IQXA 1T7PA 4KE5A 3ICLA 2GIRA 2D5RA 5F8HA 4AHVA 4CGJA 4F8RA 2HHXA 4TYAA 3CJ4A 4QWCA 5KFFA 2RDJA 4WFYA 4KHRA 1SL2A 2O4IA 3ZSQA 4TLRA 3QGIA 2D41A 2E6MA 2G8KA 5KG7A 3WNFA 5I42A 2UVWA 2HB5A 3ZSVA 4Q45A 3V6DA 4O44A 2BQRA 1S6PA 4ECQA 4C8LA 4BWJA 3RR8A 1FXXA 5KFUA 2V4RA 1S1XA 3SUQA 5T14A 3RB0A 4EZ6A 1S9GA 3VQ7A 2WB4A 5JS1A 3MFHA 3ZSWA 3RMAA 1X9WA 3OJUA 1TL3B 4DF8A 1N6QB 4DFMA 3PW0A 2V4QA 2GUIA 4JV2A 4J2DA 4EO6A 4B9SA 2O5DA 1GOCA 3C95A 3PX4A 1DTTB 4DU3A 1ZBUA 1U09A 3HL8A 2KW4A 4PA1A 4FJJA 3LP3A 4YR3A 5KFVA 3QNNA 5HLFA 3OY9A 2D0AA 1QAIA 4ZPDA 4M3RA 1RDDA 3C6UB 1RT4B 3V81A 4QCLA 2ATLA 4E3SA 1TVRA 1FK9B 3NAIA 4NRTA 3ULDA 1TKTA 3MR3A 3OS2A 2HNYB 2WONA 4CJRA 3FDSA 3I0RB 5KFYA 4DL2A 4W5OA 3DLHA 3LP2B 3K2PA 2OZMA 1SH3A 5CYQB 1BHLA 3HJFA 2RN2A 1S0OA 1NK9A 4KI4A 4M45A 1C0MA 2OA8A 1UWBA 4E89A 4F2SA 5K14A 4FJGA 3V4IA 3CJ3A 1IKXB 4H8KA 3DLBA 3MR6A 3QEPA 3NE6A 3H5UA 2F8TA 5L1JA 3QZ7A 1L5UA 1JLAB 1TKXA 4HYKA 1S1UB 2IAJA 3A2FA 5KFNA 3AVLA 4KAZA 4ECTA 3LWLA 4DSKA 3PJXA 3RWUA 1S1VB 2OPPB 3ITHB 2W9AA 1SV5A 3D0PA 3K5OA 2XWYA 1VSLA 1Q9YA 1RILA 3M9NB 2X6SA 3LALA 2B4JA 3QEWA 2BGGA 2VG6A 2AGQA 4F4YA 5KTQA 3TAMA 2AGOA 1TL3A 4ZVGA 4RNNA 4CJEA 3QIPB 2DTUA 1U47A 4HVJA 3CDUA 4M41A 4NCGA 1RDRA 1N4LA 1WNEA 2PY5A 5T7BA 3KJVA 4FM0A 4MKAA 5KFHA 1VSJA 4BDZA 1BQMA 3O3GA 4LSNB 2FBYA 3V9SA 2B43A 3V6KA 4M95A 2YNIB 4F4WA 4FJXA 1KFSA 5HRRA 1SH0A 3H4BA 1U48A 4AHTA 1IKVB 4O4GA 1QS4A 3ZT3A 4NLWA 5D3GA 4M3ZA 2XY7A 2J6SA 4NLPA 2HNYA 1RT1A 4Q44A 4DTJA 2ASDA 3I0RA 4JUZA 4NRUA 4Z4GA 2HNZB 3H5SA 3C6TA 4CF2A 1Q9XA 5CYQA 4HCCA 1S1WA 2KFNA 5KT7A 1RTDB 4DQQA 3HVTB 2Z1GA 3DDKA 3T5HA 2BQUA 4GC7A 1RA6A 4KPYA 2C2RA 2UVVA 1Y97A 4DL5A 2DFHA 4E7IA 4AHRA 3BSCA 3DYAB 3DOKA 3MEDB 1QSSA 2A1SA 4DTPA 4DSJA 1LW0B 1XWLA 2PYLA 4DQIA 4EO8A 1JLAA 3PVXA 2ALZA 1RTJA 2R7YA 4QWDA 4O3SA 4KRFA 3DLGB 5KFZA 3NGDA 3TAGA 4FJKA 4KKOB 4J9PA 1RT7B 2ETJA 1ASWA 3IGNA 4WE1A 3SPZA 3CFOA 4CEFA 1JL1A 2FJXA 3VN5A 1S1VA 4KB1A 3P1GA 4CFBA 2OPPA 3LAKA 3GIJA 3NKYA 4NLXA 3RB4A 4CHYA 1CSJA 3G6XA 4ID5A 1W9HA 4FW1A 4CEQA 1RT5B 5EWGA 4CEEA 4CJUA 3NAEA 3G6VA 1BIZA 3OYEA 1YVFA 5KFQA 4O55A 4CJ3A 3HT3A 1WSHA 2XCPA 3GILA 4PUOB 3L2VA 4CFDA 5KRSA 4CF1A 3OL8A 2CKWA 3O3FA 3NF8A 3T19A 3QIPA 2QE5A 2IS3A 3RB3A 3EPGA 3P83D 3AA4A 3SCXA 2JEGA 3VQEA 3VQCA 4RW6B 4LH5A 3BDPA 1O1WA 4N76A 2X6NA 5KFMA 1JKHB 4W5QA 3G6YA 4J9SA 1KFDA 2YNIA 5L9XA 3BGRB 3IN5A 1SUQB 1SL0A 3QEVA 2R2UA 1DLOA 5DQHA 3MEEA 2ZD1A 5KFJA 2W7PA 2Z1JA 3KKSA 3KNAA 3NMAA 1S4FA 4WFZA 3OYIA 3QO9B 3IS9B 3RMBA 2RKIB 1SL1A 1HNVA 3VQ9A 3F73A 3T5JA 2GC8A 3K5NA 3V1RA 2YNGB 4Y2CA 4FZYA 4J2EA 1T03A 4EYHB 2QXFA 3ALYA 3DYAA 4W5TA 1L3TA 4G1QA 3MEDA 3KLVA 3AO1A 3PV8A 1I3AA 1C1CB 3QGHA 1LW0A 2FLLA 1B9DA 4J9NA 3PO4A 3N6LA 4BE0A 1RYSA 4IG3B 1BIUA 3DLGA 4OGEA 1VRUB 4KKOA 2OYQA 4Q0BB 4F2RA 4DU4A 3JYTB 5DG9A 5KFGA 1EP4A 4DL3A 2XRIA 4O4RA 3V1QA 3QEXA 1XI1A 4N56A 1JXBA 4CHZA 3E01B 4KO0A 1HJRA 2BQ3A 4ED1A 2P51A 3RMCA 2IM2A 1A5WA 5E41A 3H98A 1C1AA 4BDPA 1L3UA 2B6AB 3Q8RB 1NK4A 5KFKA 2WHOA 4FJHA 1JLBA 4ED7A 4ZTJA 4HUGA 4EP5A 1K6YA 4CJSA 4FLVA 4I2QB 2IM0A 1S0NA 4NLSA 5L1IA 3SFGA 3KLFA 3JSMB 5C25A 3KHRA 1JXLA 2FBVA 2JLEA 2AWZA 1XC9A 4KHNA 3UPFA 3TABA 4DTOA 3RMDA 3NBPA 3C94A 3NF6A 1GX6A 5F8JA 4NYZA 3CWJA 5F8NA 4DTUA 2WRMA 4RW7A 3VQBA 5I42B 5SZTA 4DQPA 1VSEA 4I2PA 1XR5A 1N48A 4J9MA 3IG1A 3V6DB 4FS2A 4O44B 1S6PB 3AO2A 4JV0A 1XR7A 3OYJA 1LWFB 2G8IA 2JEFA 1HYZA 2C28A 5HBMA 3LWMA 3GV8B 4IRDA 5KRTA 2R2TA 4RW4B 3T1AA 3KD1E 2E6LA 4FVMA 4FJNA 3CJ2A 4CFAA 2V0NA 4TY9A 4K8XA 2XC9A 4FJIA 1W25A 4IH6A 4FLWA 3S3OA 4FK0A 4TSXA 3AVBA 1IO2A 4GMJB 4YR2A 4WXWA 4CGDA 4QOZB 3PR4A 1T94A 3HPHA 2ZE2A 3OYDA 3IGVA 1SKRA 1FKOB 3V81B 4Q0BA 2BRKA 3KHGA 1CZ9A 2W9CB 3OSNA 4PWDB 4J9OA 2WONB 3VQPA 4IH5A 3T3FA 5KFRA 2X74A 2E4LA 4E7KA 4Z4FA 3LPTA 2XY8A 2HHSA 2OZSA 1S9FA 5KFOA 4OKKA 5J2QB 4M94A 1UWBB 2B6AA 5K14B 1WAFA 3V4IB 4CJPA 2OPQA 4E7LA 3SQ0A 3G86A 3VQ5A 5JS2A 3GQCA 4Y2AA 4Y1CA 5FDLA 5KT5A 1TKXB 4NLYA 1MMLA 1RDCA 2IAJB 1NHUA 3JSMA 2ILYA 3KIOA 2A1RA 3QINA 4Q5VA 2AQ4A 3DOLA 3VQQA 1TAUA 3RRGA 4PY5A 4MFBB 3H08A 2XY6A 2JGUA 4YMEA 5C42B 1YVUA 2G8FA 4RNOA 2ASLA 5DK5A 3DRSB 1ZBIA 1SV5B 4MK7A 3MFIA 1TP7A 5DLFA 3ZSRA 5KFEA 2YNFB 4DEZA 4F3OA 5HRNA 1LWFA 2ITGA 3M8RA 4FLTA 4NYFA 2VG6B 3TAMB 3OYAA 3OL7A 4IRCA 3KHHA 3AVJA 4CEOA 2DY4A 2WOMA 1HMVB 1QSYA 4RW4A 4J2AA 4J9KA 4NCGB 4BACA 1X1PA 3KJVB 1SH2A 1NK0A 4DWIA 4IG0B 2GBZA 4WZMA 1BQMB 1EX4A 5I3UA 1LW2A 1RBTA 4NLOA 4MK9A 2J6UA 1NHVA 1HRHA 1FKOA 1J54A 4O4GB 3OYBA 4RW8B 2DPJA 3GIKA 5D3GB 4QWEA 2W9CA 3EYZA 1NK7A 5KI6A 4JRPA 4PWDA 4NLDA 4FM1A 1RT1B 5L1KA 1D0EA 2FVSA 3UR0A 4DSEA 1EETA 4FLZA 3C6TB 5KG2A 1S1WB 5DGBA 3AA5X 3AA3A 2W8KA 1S48A 4NLQA 3OL6A 2WK4A 1KLNA 3KLIA 2J6TA 3DMJA 1CXQA 1RT6A 4CJVA 1KLMA 5J2QA 3Q8SB 4YR0A 1VK0A 3BREA 2G8VA 3OHBA 4KFBA 2YKMA 3DOKB 5F9NA 3EY1A 1TK0A 3D28A 3LP0B 1QAJA 3OLAA 4NLVA 3BSOA 2HHUA 4W5RA 4KV8B 5KFWA 1RTJB 4FJ5A 4IKFA 2YKNB 2EX3A 3SV3A 3BQ0A 2OPRA 3OYLA 4MFBA 1BI4A 3AO5A 2HVHA 4WE1B 1BGXT 1RTIA 4CEDA 4ED0A 1VSHA 1BCMA 4JS4A 4KHMA 5C42A 2DFEA 3H5XA 3DRPA 1U04A 4DS5A 5CYMA 4DTMA 3DRSA 4H54A 1KCFA 4IH7A 4LD0A 4OLBA 1LAWA 4ID5B 2XI2A 4MQ3A 1FKPA 1HPZA 5EUHA 2YNFA 1RDAA 4ICLB 1CZBA 4AHCA 1KSPA 3L3UA 1ASUA 5HP1B 2HHWA 4YFUA 4FLUA 3S9HA 3MEGA 4E7JA 1S1TA 3G0ZA 5J1EA 3DLEB 2KTQA 1HMVA 2FLNA 3AO3A 1U49A 5EWFA 3I0SB 3SV4A 4IG0A 3PR5B 2OH2A 3KLGB 3AVMA 3AVNA 1XHZA 1S6QB 4ELUA 4K4XA 1T05A 4FS1A 2AGPA 4B9UA 1NJWA 1JL2A 3CM6A 3SPYA 4E7HA 4O3NA 2VWJA 4L8RB 2R2RA 3MF5A 4ED8A 3ZSZA 5F8GA 1DLOB 2R8GA 3L2WA 4RW8A 4Z0UA 3KOAA 4MKBA 4QAGA 4CIFA 3MEEB 2ZD1B 2XGQA 2IDOA 3PX0A 4KBIA 4RW9A 3LZJA 2RPIA 3TI0A 3SUPA 2R8IA 2ATQA 4FLXA 5JXSA 4URQU 1HNVB 1OS5A 1A5VA 4K4ZA 3LP1A 3QETA 4QWAA 3D5MA 4URSA 4ID1A 2Y1IA 3TAEA 4ZTFA 1HQUB 1T03B 3AVCA 2KZMA 3CFPA 4G1QB 5J2MB 1Z25A 3PZPA 3RR7A 4DG1B 4WFXA 4XPEA 1A5XA 3LP0A 4N41A 2VG7A 3FFIA 3EZUA 3BSNA 3NAHA 4KV8A 3RBDA 5C5JA 3P5JA 3HPOA 5KT3A 2FVRA 2IA6A 4IR9A 3BJYA 4TN2A 4DLEA 2YKNA 1J53A 4B3OA 2X78A 1C6VA 2CJQA 2RF2A 2XGPA 4AH9A 4Q8FA 3SZ2A 2DFFA 4ZP8A 1EP4B 4YNQA 3LANA 2JEIA 4I9LA 1KTQA 1IKYB 3MXMA 1MU2B 4KO0B 4ZVHA 4O0JA 4KREA 4ICLA 1TGOA 5KFAA 4Z4CA 1NK5A 3V9UA 4KI6A 3BR9A 1KVCA 5HP1A 1S5JA 3VQ6A 1TV6A 4I9QA 1JLBB 4OJRA 4KTWA 3SUOA 5J2NA 4CJLA 4ZHRB 3DLEA 3SQ2A 1D9FA 2KZZA 2HMIA 4Z4HA 3D45A 3O4QA 3VQ4A 3KLFB 3L2RA 4FXDA 3I0SA 1HNIB 1JLEA 2IOCA 5C25B 3PY8A 3QLHB 3KLGA 4ZP9A 4GVMA 2P5OA 1S6QA 5EDWA 3PW4A 4DLGA 3PHEA 4YP3A 4FZXC 4DL6A 3ZT2A 3NBPB 3HP9A 2G8HA 2AX1A 3N6NA 2I5JB 4RW7B 5KT4A 5KFBA 2IC3B 4ECXA 4I2PB 4KHSA 3SI8A 3M8PB 1TK5A 3CDEA 3G10A 3I5AA 1KRPA 3IG1B 4ECRA 4K4VA 4NCAA 4UQGA 1S0MA 4H4MB 3VQAA 4ELTA 2BDPA 4NCBA 3OS1A 2XCAA 4Y3CA 1VSMA 5HBMB 4HUEA 5KG1A 3HK2A 3V9XA 3QYYA 1N5YA 1VSDA 1HQUA 1TK8A 4FLYA 2UUTA 5F9LA 5J2MA 4F4ZA 4BDYA 2W8LA 2GV9A 1W0HA 2PZSA 1ZBLA 2UUWA 1YTAA 4F4KA 4DG1A 1ZBHA 4ECYA 5KT2A 3QERA 5KFIA 3OYFA 3UDLA 2FBXA 4KTQA 4CESA 3KD5E 2EHGA 3CDWA 1UAXA 2F96A 4EBDA 4HTUA 3H2LA 3U3YA 4K4SA 4WYWA 3AVGA 3U6FA 2ZE2B 5KT6A 1QQCA 4DMNA 4CJKA 2VG5A 4ECZA 4Y1DA 3HVWA 4FBTA 1QE1B 4Z4EA 4B9TA 3Q8QB 3NHGA 3PW5A 5DG8A 1C0TA 1LWCB 5HRSA 1ZTTA 3L8BA 4PQUA 1NK6A 4E19A 4OKEA 2XY5A 4CF8A 2FVPA 2JC1A 1IKYA 2Y1JA 3ZT1A 1D9DA 1MU2A 1JIHA 4R8UB 5CY4A 4XPCA 3UIQA 3SI6A 3THVA 4RNMA 4DTXA 3HP6A 1S9EA 4J9RA 4CECA 1KHVA 3BSAA 4MIBA 1G15A 4CCHA 3H59A 2EC0A 2O4GA 4IOBA 2OPQB 4ZHRA 4HUFA 4DS4A 4KHUA 5J2PA 3RAQA 2W42A 1WLJA 1RTHB 4IFYA 5FDLB 5KFSA 5KGWA 4B8CA 1SKSA 5C24A 4NLUA 1HNIA 1EKEA 2G8UA 4DTSA 3QLHA 2VA2A 3CJ5A 4CERA 1WSEA 3T5LA 3HSTB 1JLCA 3DOLB 2NUBA 2FVCA 1VSFA 4DSLA 1TL1A 4CK3A 4NZ0A 2I5JA 4E1MA 3KK1A 4IKAA 3RBEA 3E51A 4O5BA 3MAQA 2IC3A 4B8AB 1VSIA 3M8PA 1QHTA 2IMWP 5EWEA 1BQNA 3HVAA 3AVIA 1ZETA 1LWEA 4H4MA 3NH1A 4B9LA 4FYDA 1NJXA 4CGGA 1C0UB 2DPIA 1DTQA 1S10A 3FQKA 4CF9A 4CJQA 2W9BA 4KHQA 2IM1A 4M3YA 2WOMB 4AHUA 1T8EA 1S49A 4ED6A 1HQEB 4YQWA 2YHBA 3HXMA 4B08A 1HYVA 4NLGA 3IRXA 3KLEB 2YNHB 5HROB 2FBTA 4BWMA 1IM4A 2FC0A 4URGA 1JX4A 1Q8IA 3RB6A 3KHLA 1NKEA 5I3UB 2HVIA 1LW2B 2HHQA 3NF9A 3MXIA 2JC0A 3K57A 4IRKA 1TKZA 3HYFA 1QE1A 3I5BA 3DLKA 4EBEA 2R8JA 1LWCA 3SQ1A 2IGIA 1RBUA 4CJFA 4DQRA 1EETB 5JUMA 2AU0A 1RCHA 3TAPA 4R8UA 4TY8B 2Q3SA 3TAFA 3TARA 3KLIB 3DMJB 1RT6B 1KLMB 4CEBA 1R0AA 2IJFA 3QGGA 3M9MB 4KFBB 1RT2B 2YKMB 5HRPA 2D0BA 1LAVA 3LDSA 5CZ2A 1SKWA 3M8QA 4CF0A 1F21A 3GIMA 3ZT4A 1RTHA 3BQ2A 3M9OB 3H5YA
chains in the Genus database with same CATH superfamily
3KDNA 2AYGA 1XQIA 3OVAA 3WT0A 1KQFB 4OYZA 4RU9A 1BLUA 2MSTA 3ZZPA 1RTZA 4OHVA 3EXYA 1RHJB 3B6OA 7FDRA 1BI4B 3M1FA 4OLOA 2C2DA 2ZVSA 4ZMMA 4DUYJ 2NS1B 4MJKA 3PEHA 2RE2A 1ZM9A 3HD1A 5FIIA 3V2UC 1KD1O 2NNWA 3CVKA 1M90T 2Z1IA 4K25A 5B0FA 4DUYK 1FKPB 1HPZB 2OFGX 2YKOA 1XNQJ 4CHOA 3M2UA 4EWTA 3NGIA 2FHJD 3MEGB 4F3QA 1RAJA 4Y00A 5BRHA 2VD3A 2X1GA 3B82A 1BE4A 1RBRA 2BMBA 5DQIA 3MX5A 5FLXU 3DFEA 3BF3A 1XNQK 1OO0B 5HJYA 4FWRA 4YDUC 1FRMA 2LSNA 4F3MA 5HROA 5LMNF 5CA5A 4CH1A 4CJ4A 7FD1A 1HBOB 3MN7A 2BE2A 1TYQA 2PFFB 3KLHA 1T05B 4JS5A 3TP2A 1BHNA 5KG0A 1N33J 1CPZA 2F8MA 1YHQN 4K41A 4DCHA 4NYPA 2IIRA 4OX9J 2VQEF 1N88A 1N33K 3GYXB 4CLPA 2Z1HA 2G1DA 4OX9K 5IT9U 1R8AA 3D2EA 4TY8A 1MA9B 4CVNE 1N34J 5F0XA 2BX6A 4DZDA 3OTEA 1ZZNA 1XJWB 1K8KA 1HW9A 1WN7A 1N34K 5SWMA 2UP1A 3KKRA 1M1KO 1X60A 1P27B 1NK8A 3FFIB 1BXNA 1XC3A 2FJVA 2OSRA 4IFVB 3TZYA 4NLTA 3TX8A 2FVQA 3N6MA 2HBMA 3RAXA 4JV1A 4MH8A 4KC5A 1UZDA 4W90B 2QA2A 4BC2A 1VIXA 5I9EB 4FWQA 1EWRA 4XDCA 1BD6A 3VV2B 4C2MA 1KC8O 1Q95G 2R8HA 1G1XA 3GV5B 2HF4A 1YLXA 3R5JB 5GAEI 1TV6B 4KHWA 5FPNA 3PJWA 4B3SF 2BXJA 4TYBA 5KG3A 2BRLA 5KFPA 5HN0A 4ZP6A 2HIQA 1BU6O 1HBOA 2KKHA 4KHYA 1SJ4P 1HHSA 3TSPA 1N6QA 2XQCA 3JXOA 3M8YA 1SIWB 4W5NA 2UXBJ 1VK8A 3OTOF 3BQ1A 2FF6A 1G7CB 1HIYA 5GMEA 4CNYA 1N56A 2RJZA 4C8ZA 2UXBK 1Z26A 4DDFA 4LIRA 4CGHA 1CC7A 3P4IA 5KQDA 2FQQB 4OX6A 1U45A 2ZJQL 4DTNA 5A8KB 4CIGA 1C4AA 1A0OB 2O1PA 2ZKTA 4M3XA 3LTOA 2YX4A 1ZAWA 3FRZA 2YHAA 3GV7B 3IWXA 2F8SA 3ZZTA 4LF8F 4C3MA 2VYPA 1VQPN 3NCPA 2ZH7A 8ATCB 3J7AP 3VEXA 4IFVA 2YPZA 1I5OB 4OPKA 4CH7A 2RVJA 2DGXA 4O3PA 4E0DA 4X2BA 3V9ZA 1CJUB 5M1PA 2HBLA 1YTUA 2ZGZA 3AJ1A 4KHPF 4BC9A 3OXGA 1Z4UA 2N4DA 3PIOQ 2PI4A 1S9EB 4A8SA 4IUFA 2VB6A 3HHKA 3IO1A 2J0QD 5CZXA 1KONA 3GIIA 1M1GA 4K8RA 3LPEA 4C3KA 5FRMA 1MLAA 4IFYB 4IO1A 2CPHA 5C24B 5D4PA 4DL4A 4DPXA 4AILC 2YWKA 4M5IA 4DZ6A 2QKBA 4NLRA 4QW9A 1TZ0A 4EP4A 5BRFA 2QKKA 4G3IA 1G2EA 2GJ2A 2RNEA 4MIAA 4BRKA 4HCBA 1V3RA 1YKWA 4JRQA 5CH7B 4PRFA 3M8SA 2ADBA 1HR0J 2AJQA 1S59A 2WTFA 2B5JB 3NH2A 3UQSA 4KAIA 4OI4A 3FNNA 3AFGA 4QW8A 5B0AA 3LM2A 1HR0K 2WW8A 1U2CA 4WFAQ 4I6MB 3MDQA 2HFUA 2P9KA 4CGFA 2QTWA 4RJVA 3PW2A 3S3NA 1SBRA 3C65A 5A8KA 3CQXA 2VQFF 3I5CA 4UF4A 5AQPA 1TKDA 3K9KA 4DSFA 1RTDA 3EKSA 3HVTA 2G0IA 1W97L 1JJ4A 4CZLA 3AV9A 2YVSA 2EK6A 3CYMA 4FYYB 4LRCA 4ZKAA 1CZAN 4FJLA 1GLFO 4AUKA 1TUUA 3DLKB 4BR9A 5KFCA 2ZVIA 4WP3A 1ILYA 4CJ5A 1S4EA 3QEIA 1KHWA 3NCRA 1JWWA 1R0AB 2C2OB 2ADCA 1LXNA 1HNWF 3QGPA 3M8QB 4F25A 1XBWA 2C3OA 1UVJA 4CZCA 3LDOA 1YRUA 1RT5A 2A5XA 3OR1B 4OI3A 4DR6F 2W4CA 2BANB 3T5KA 1J6ZA 5FROA 1SC4B 3DLRA 1VFJA 2QEXS 1HNZJ 3QNOA 2VL1A 2FLOA 4EBCA 1RT3B 4RW6A 4I6AA 2HHVA 2W2MP 4K4TA 2B5JA 1HNZK 5DJBA 1BL3A 4KJIA 1ASVA 3O3HA 4DB3A 4L3KA 1EZZB 3ZTQA 3OYKA 1VQ8N 1X0PA 3J7YU 4DFKA 2QC3A 1RFQA 1U1MA 1FJEB 2U1AA 2OPSB 1WACA 2EWHA 2BEFA 1WSIA 4USWA 4IFEA 1WNSA 1BWEA 1EARA 3GG0A 4J9VA 3NGZA 1WEYA 3GFXA 1EKRA 1ZH5A 4JD2B 3QO9A 3ULEB 1CJKB 3VOVA 4JI4J 4ECSA 4KB0A 3OW2R 2XSFA 4TXSA 1REVB 1VQ9N 3PJ9A 5F8LA 3K59A 1QQOA 4JI4K 3M8ZA 2QWLA 4X4NA 4EYIB 3VGUA 5HLFB 2NXJA 4OZ0A 2E2NA 2B7BB 2ZJPL 4ZIVA 2ZH6A 2LEAA 2QLXA 4CHNA 1RWXB 2CQGA 1Q82T 3V5RA 1U8WA 1K1SA 2RRBA 4Q7AA 3E01A 4Q43A 3OHRA 4F4XA 4DJBA 4F7VA 1GLCG 2HRYA 4DFJA 1CEZA 3D1OA 1U1RA 4NXMF 3OYCA 3W61A 2XHCA 3FSIA 1C2PA 1RBVA 1NSAA 1O6XA 2BKPA 4PAAA 4CRJA 4I2QA 4WYLA 4LSLB 4ECUA 4IQXA 1T7PA 5AXLA 1OPZA 4JK9A 4CGJA 2HRTA 4F8RA 3WDOA 4BGBA 3UFCX 5DDRC 3UNYA 2YBVA 2O4IA 2P9IA 2BJDA 3D66A 4DR2F 2E6MA 1QZ5A 2DNOA 3WQUA 2IRYA 1KOOA 3BKFA 3M32A 4GRSA 4P72A 3TZWA 3CJCA 2G8KA 5KG7A 4C23A 3RRKA 2HB5A 4DR1F 4ECQA 1CS4B 1FXXA 3DLJA 5KFUA 5T14A 4JV5J 2NRXA 3R27A 2QL5B 3VQ7A 2Q1LA 1X9WA 5A2QU 4DF8A 2GUIA 4LF5J 4ISFA 3SMPA 4JV2A 4J2DA 1IJEB 4YY3F 4JV5K 5IT0A 2EK1A 4EO6A 3SK3A 4YOTA 2NYHA 5JMNA 4U96A 3NS6A 1NPRA 1H2UX 1GNKA 3SSSA 4LF5K 4C0OC 5EHHA 1ZPWX 2KW4A 4JI1J 3TZZA 3AA9A 3LP3A 5IXUA 5KFVA 2BM1A 5AJ3F 3KYLA 2YQ1A 2DNZA 3QNNA 2NPFA 5HLFA 1TFWA 4JI1K 2D0AA 1RT4B 2ATLA 1HD0A 4E3SA 1FK9B 4P75A 2CUYA 4OI2A 2HNYB 3S1TA 2WONA 4AQYF 4QR2A 4DL2A 1LQ9A 4W5OA 3HHEA 3K2PA 2OZMA 5CAAA 1QVFR 2CVIA 4M45A 1C0MA 1T0TV 2RU3A 2MPUA 4RWWA 1IKXB 2N3OA 3DLBA 4YOXA 2V4JA 3QZ7A 3D2FA 3A2FA 5KFNA 4JI3J 1T95A 3F9MA 5T7LA 2VUGA 1NBWA 3U1LA 4KAZA 2VONA 3ID8A 2V2QA 4DSKA 3PEJA 4JI3K 2QXLA 1JJHA 1HKBA 1BWFO 2ZJQQ 4ISEA 2B8QA 4HR2A 1UEKA 5B7WA 3LGNA 4LR7A 3M9NB 3I4HX 4AXIA 2HS4A 1BY9A 1KP6A 1JJ2M 4C7QA 4RNNA 4LRDA 2DTUA 5HMZA 4HVJA 2KHCA 4NCGA 2J7KA 2GIFA 5A0YA 3KJVA 1M5OC 3NS5A 5AQXA 3K7RA 1YDLA 4U8YA 3WXLA 1YXQA 1TU0B 1SJ3P 2YNIB 3Q0AA 4CO2A 5HRRA 4GVEA 1SH0A 3RAMA 5BREA 5GAHP 2GW8A 3OBIA 1TUYA 1U48A 1IKVB 1QS4A 2RQKA 2MZ1A 4NLWA 3O1WA 5HVGA 2XY7A 4LF2A 1I1GA 2HNYA 1RT1A 4GKKF 1NAQA 3US5A 2ZFHA 1HHTP 5IQQA 1GLJO 4Z4GA 2KFNA 1FDDA 3D1HA 1PJ7A 2P9UA 3T5HA 2BQUA 4JI6J 2UVVA 2J0XA 2DFHA 1F60B 4AHRA 3BSCA 3DYAB 4HDHA 1RK8A 3MEDB 3MURP 2QN6B 2K7KA 1T02A 2IIHA 3G2XA 1LW0B 2PYLA 4DQIA 4JI6K 2YHWA 1H72C 1X5OA 1KVIA 1N0VC 2VJVA 3PVXA 2X1FA 3VALA 2AYEA 4O3SA 4KRFA 4DL0C 4Y65A 4BRFA 4FJKA 5E3QA 1VHIA 2A1BA 4U95A 4PG5A 3G8SA 4H5VA 3SPZA 2MDAA 2JFKA 1QAYA 2YQ0A 1FD8A 2CQHA 5AQUA 3LAKA 3HULA 1NM2A 3GIJA 4NLXA 4BRCA 4ID5A 1W9HA 1HQ2A 1PJ6A 4OI6A 3NAEA 1NSKL 2VFSA 3M8WA 3OYEA 4G1PA 2ZZMA 2V63A 2F7VA 3HT3A 4DR3F 1U6FA 4DR4F 2XCPA 2R7XA 3L2VA 1R0BG 3HFKA 2HAFA 3GBTA 5BR9A 4NA2A 3T19A 2QE5A 2RQMA 3ISZA 3AA4A 1NPPA 3SCXA 1NSQA 1V5VA 1O13A 3BDPA 3UD4P 3DHXA 1RU1A 3NEKA 4V1Ak 4UQTA 2X6NA 4P52A 2Y0BB 4W5QA 4KGKA 2F1FA 2B8PA 2YNIA 3HF5A 1PC5A 3N28A 3BGRB 3SLCA 2G2YA 1HX1A 3PIPQ 5JLFA 3CMES 1VQON 2R2UA 3D6HB 5E7OB 5DQHA 1R0CB 3MEEA 1FWLA 2Z1JA 4P71A 2HHHF 1S4FA 2XM3A 3D6MB 1CQMA 2A40A 3EE8A 1HNVA 1QDUB 3F73A 1NGHA 1EQ0A 1VCTA 3V1RA 2YNGB 3HSZA 4EYHB 3DYAA 4G1QA 3MEDA 5G0RA 3I6PA 1C1CB 3QGHA 4WIIA 3O9UA 1LW0A 2FLLA 3R8EA 1X4AA 4IG3B 3T1HF 3L6QA 4O8KA 1VLYA 1VRUB 5F1XA 1XMQK 4WFNQ 2XLJA 1LXJA 4DU4A 3JYTB 3FFKB 3Q2TC 4G6VB 4MDAA 1XI1A 4N56A 1JXBA 4H5TA 4ZA1A 3W65A 3ZTPA 2E5LJ 3CJ1A 3CJQA 2MB0B 3ILIA 1QM9A 4FZVA 1HJRA 2HZAA 3BPSP 4QS9A 3N5FA 4DPYA 3RMCA 4LF9F 2E5LK 4ZPVR 2CVEA 4BDPA 1L3UA 3Q8RB 2QFJA 2P9NB 3W3DA 4ZTJA 4EP5A 4CJSA 2M7SA 1S0NA 5AQQA 1VBZA 2XTJP 4X84A 1JXLA 3W8GA 1H74A 3AAQA 4LT6A 3NF6A 4OMFG 4NYZA 2CDQA 2EFVA 2KHOA 1RDUA 5AQSA 3VQBA 4WCEL 3GFYA 5IM0B 1HHQA 1I94F 3V6DB 3JAMY 4LF7J 1QQNA 4L3NA 2R4FA 2XMMA 4OI1A 1ZPVA 3LWMA 2FPHX 3GV8B 1NMNA 4LF7K 2J76E 5KRTA 2OTLN 2HVEA 3TZXA 4JKFA 3QMQA 4TY9A 2OO4A 1RKIA 5K8OA 5ETTA 1W25A 1WUAA 3EZOA 1GLAG 4TSXA 4CI6A 1V3SA 1OVQA 1ZZFA 4YR2A 4CGDA 1T94A 2DGSA 4OO1J 2GGPA 1FKOB 2ZITA 3KK7A 2W9CB 3OSNA 5AQVA 5ETVA 2IVNA 1AXQA 3T3FA 4IH5A 1IR0A 2FY8A 1OSCA 1V5IB 6FDRA 4PZVA 3HI9A 1ULRA 1REGX 1NRKA 2OGUA 2HHSA 5KFOA 4AL7A 5J2QB 5DZ6A 4M94A 2G13A 1GEHA 3GYGA 3D0IE 5K14B 3D68A 4RO0A 3Q83A 2OPQA 1PAUB 1ZBTA 2EI5A 4E7LA 3SQ0A 4HT7A 3OTDA 3A8EA 2GO9A 3VAKA 1TKXB 4NLYA 1MMLA 2OSQA 2IAJB 2VICA 3KJQB 2K8GA 3QINA 4FVCA 1N5VA 1V6HA 5CABA 2XY6A 2JGUA 1QUPA 3MMBA 1YX2A 5C42B 1YVUA 3CQYA 1TP7A 4OJHA 1Y3JA 4DHVA 2M88A 3U7JA 3GTYX 4P2FA 3DCAA 4JI8F 3TAMB 2CDRB 3CXCR 3KHHA 2GMJA 4CEOA 2DY4A 2WOMA 3C46A 3M05A 2YJFA 4JK8A 4J2AA 4J9KA 5L9NA 1HKCA 4N77A 2H4WB 1SH2A 4IG0B 4IOAL 2GBZA 4EIAA 4DX5A 1EX4A 1RBTA 4CLYA 3UR3C 4CO4A 3EEQA 1Z05A 1UZHA 4NLOA 1TFYA 1YBUA 3ZZOA 2J6UA 1HRHA 1FKOA 1NUEA 3VGLA 3ILLA 4RW8B 2W9CA 3EYZA 2J5AA 3LDNA 3H90A 2LCWA 1GLDG 2HLUA 4UZBA 4M5KA 4G9ZA 4X65J 2H65B 3FMBA 3C6TB 4FLZA 4EK2A 1U1NA 3CC4N 4ZCKA 2OD4A 2KFYA 1KLNA 2J6TA 1RT6A 5J2QA 2DGUA 1YZ7A 4X65K 1KXPA 4H4KA 3DOKB 5F9NA 3J7ZT 2YH1A 1R3NA 2VF3A 4NLVA 5EXWA 4W5RA 1VQ5S 3B6BA 1RAFB 1RTJB 3J7Z5 2QI2A 4JP8A 2U2FA 2VBYA 3PYFA 2YKNB 4ZN1A 3SV3A 2ZH9A 1D8ZA 2LECA 5GMDA 2OPRA 4WE1B 1RTIA 1VSHA 1GTHA 2A10A 4A8QA 5C42A 2DFEA 1MROA 2FTRA 3H5XA 1U04A 5SUHA 5FLXY 4P2MA 2VFRA 3OXLA 3HFVA 4IH7A 4LD0A 4BCAA 1F1BB 2MLZA 3MCOA 4M8LA 1LAWA 3D7EO 4MQ3A 5EUHA 1RDAA 1N54B 1WUUA 4AHCA 1MW7A 1KSPA 3GJTB 4U67Q 4CJ7A 5HP1B 2HHWA 3LO3A 1HI8A 4DMZA 4AXJA 3FCHA 2FC8A 1S1TA 5AE1A 3DLEB 4C0HA 4DV6F 5B0DA 2AT1B 2FLNA 3AO3A 2HOEA 1U49A 2FJBB 4WQ4C 1K44A 2NSBA 2D3OR 3ULHA 4F0KA 1AYEA 1UPMB 1N8RO 3SV4A 4IG0A 3O1BA 4OYIA 2IVPA 4K2XA 5HAOA 1Y5IB 3VAJA 1S6QB 5IT9Y 2AP1A 4K4XA 1PSDA 1U2VB 2G1HA 2CG8A 5E3PA 2Z56B 2AF6A 2XMWA 1X4GA 4CZKA 3R3LA 4L8RB 3BZKA 4F26A 2GWJA 1DLOB 5BPMA 3UCUP 3KUHA 3L2WA 4RW8A 1PJ5A 5B09A 2HURA 4MKBA 2NXEA 6AT1B 3BR8A 3O3LA 4KBIA 4HI1A 2PC6A 2DHXA 2ATQA 3VEYA 2P9SB 4URQU 1VGYA 2W6LA 3QETA 4QWAA 4ZTFA 1HQUB 3CFPA 5J2MB 1NGFA 4WQ5C 4RKUC 2CQ4A 2R7QA 3BSNA 5C0YA 3NAHA 2CA9A 5C5JA 1N52B 2PA8D 3P5JA 2BM0A 2QL9B 4R79A 3RUBL 3AHPA 2YKNA 1J53A 5CYJA 1C6VA 3EN9A 2WW4A 4Q8FA 1EP4B 1VK3A 4YNQA 4OPHA 2G0JA 4KO0B 2CH6A 1F2HA 2P9GA 2RQCA 3TUZC 4O0JA 5KFAA 3CC2S 4YB1P 1S77D 5HP1A 2RU9A 4FPIA 2I7NA 1X4EA 4DV3F 3A5LC 5DM6L 4M63C 1B7FA 5J2NA 5HQMA 4ZHRB 3DLEA 3HDSA 3L95X 4CBUA 4YS2A 3KLFB 1HNIB 5LMUJ 2B3TB 2OJ3A 4OQJA 1AB8A 2RT3A 4ZP9A 2F9WA 1S6QA 3RSEB 4DLGA 1FEEA 3NBPB 5LMUK 3HRGA 2G8HA 1BUXA 4BROA 1HNXJ 1YJTA 5F3TA 4CO1A 5KFBA 4ECXA 4KHSA 4ECRA 4NCAA 1HNXK 3FSXA 3W5ZA 4H4MB 2WSFC 5D0GA 4NCBA 3GJSB 3GIRA 1WKKA 5HBMB 2D1CA 4CTAB 3FBBA 2LU2A 2GVZA 2NRRA 3QYYA 3K9JA 3FVYA 3SDEB 1HQUA 1TK8A 2UUTA 5F9LA 5J2MA 2PZSA 2RMLA 3KG4A 1IM6A 3JTPA 3OYFA 4KTQA 2PFUA 3IDHA 3CJSA 3BEGB 4MKYA 3NGUA 3U3YA 4EHUA 4WYWA 4P2XA 4FOEA 3QFPA 4X64F 1CULA 4OFZA 5IT4A 2BABA 4CO3A 3HVWA 4Y1DA 4WCEQ 4B9TA 3T1YF 3PW5A 5DG8A 2C2NA 5T41A 1QLNA 4NO7A 1LWCB 4PQUA 3VAFA 2ZUGA 4E19A 3CSKA 1RU2A 2XNQA 3O8MA 4NB4A 3VMFB 1D9DA 1JIHA 2VJUA 4DN9A 3JTNA 5IV3A 1WHVA 3UIQA 3SI6A 4DTXA 2G0CA 5IZHA 2LEBA 1Z6RA 2JWLA 3H59A 3HHLD 1Q79A 4ZHRA 4HUFA 1FX2A 1HKAA 1S76D 3NMUA 2W42A 1WLJA 4DV1J 3EGVA 2DR8A 1HNIA 2BBEA 2NR0A 2QIFA 2VA2A 3ENVA 1WSEA 4DV1K 3HSTB 3MCPA 3JTOA 4DSLA 2C1EB 1TL1A 3A0IX 1J5EF 5AQLA 4NZ0A 4YDXA 4E1MA 3MUVP 4O5BA 2XO6A 4RUBA 4RBUA 1TUWA 1AZSA 1BQNA 1QJHA 1UKUA 3FEXB 4H4MA 4FYDA 3UKUB 1NJXA 4CGGA 3UW1A 1E6YA 1DTQA 1R8PA 1S10A 4CJQA 3QFWA 4JI7J 1O51A 3MUTP 1KQSR 2KG1A 1HQEB 4HTIA 3C16B 4X4UA 2FBTA 2HBQB 1IM4A 4URGA 4JI7K 3J81U 1NKEA 3GJQB 2FHKA 5I3UB 1R59O 1LW2B 2J8SA 3D6TB 2BJ8A 4BRGA 3QJJA 1TKZA 3JS9A 1PAEX 5BPLA 3ID6A 1YTYA 3MXHP 2R8JA 1LWCA 3D67A 3L7PA 2IGIA 2YH0A 2NLWA 1EETB 2A2DA 2BUNA 5ETRA 2GCFA 5JUMA 2AU0A 1RCHA 2RHSB 3DN9A 3KLIB 3H2UB 2IJFA 3QGGA 1WB9A 3NY0A 2GEMA 1EB0A 3ZZYA 4KFBB 1RT2B 2YKMB 3E9PA 2FC9A 1SKWA 1PYOB 3GR0A 1M5HA 1CC8A 1IBCB 3UN3A 3I8DA 2DGTA 4QQBA 1CLFA 3MM8B 1BA0A 4MLHA 3AVFA 1ZYQA 1T9TA 1YT3A 2EFQA 3QT8A 2E44A 3MI7X 1X9MA 3DM2B 1FF2A 2GIQA 5H9FJ 3CCRS 4IOCQ 4E2FB 3CG7A 1NMEB 4PXBA 5H9FK 4FJ9A 2Q79A 1DQ9A 3UKUA 4TQRA 2O8BB 1QSLA 3SBGA 2ZKUA 3FQLA 4PXEA 3AAPA 1FXLA 3IFRA 2DNYA 5J1EB 4IR1A 1CXUA 3AVKA 1HARA 1HQEA 3C16A 1OY8A 2P1JA 1FDAA 4JEPA 2Q6BA 1WELA 5CCLA 4RWXA 3HKWA 1NMDA 2CQ0A 5GAGI 1GLEG 1QUVA 4YOVA 2DNQA 3G8QA 4K50A 1Y10A 3U3GA 3KMSA 2DGVA 3L4QA 2V6AA 2CGKA 5BR8J 3KZBA 5KFLA 1IBLF 4M3TA 3VPZA 4RW9B 2KFZA 4A47A 2WVBA 3ZXWA 3NWGA 3P6YC 2OMOA 4X4SA 2FD2A 3MM7A 5BR8K 1GX5A 3LP1B 3KJFB 1YBAA 4ANDA 2YV0X 4A48A 3SYZA 2IYIA 4J8FA 1YF5L 2V51B 1RT2A 5KG5A 2F4VF 4RCHA 2ZH4A 5FRNA 2RH3A 4CIEA 3BN4A 2VG7B 1ZBFA 3TR5A 1UVMA 5A8WB 5EVZA 1IR2A 4K7QA 2AJ0A 3IAS9 1C1BA 3OTOJ 3GDQA 2DTJA 4I1TA 3MM8A 3NGTA 1XR6A 3O6QA 4NA1A 4IJNA 4B3OB 3GONA 2VWKA 5AQKA 2RF2B 2KYZA 1PBUA 2F3JA 3DM2A 3TTFA 5IV4A 3VAMA 4K8ZA 3LAMA 1VQ6S 2IHR1 2MZRA 3ZSXA 4YHHJ 3E8OA 3GSIA 3R3TA 2HFOA 1KVJA 1AA1B 4CLWA 4C0BA 3MN9A 1U26A 4GO5X 4BE1A 4U6PA 2DEJA 4YHHK 2J7UA 2NREA 2O8BA 2P5GA 5A2QY 4I64A 2JVOA 3H46O 3KFWX 5AZJB 1NEEA 2DYAA 1P8GA 5ETKA 1HBUB 3PFOA 4JAXA 2DCLA 3RW7A 2DK2A 1VRTB 2IY5B 1NBEB 5EU7A 4O3OA 1JLEB 4FCYA 3CI5A 2O8FB 1YVNA 2D0CA 1N5QA 2HPUA 4DL7A 2IM3A 1P1TA 2EXUA 3QT7A 3WNGA 1HD1A 3MECB 1UVIA 3PO5A 4DV2J 4JN4A 2P9EA 1VQYA 2UUAJ 2M3DA 2C2EA 1BISA 2QFIA 1M1KT 4EU0A 4DV2K 5C7PA 2MZTA 5EY4A 2AW0A 4C8NA 2UUAK 2E9TA 4BG8A 3C6UA 2JVRA 4IO9Q 1RZMA 5LM7E 1IG9A 4LH4A 3Q7CA 3P3DA 5CZ1A 1KC8T 1KS2A 3K8WA 3WC2A 3B4MA 1FFSB 5D15A 1QHAA 2V94A 2DEIA 5AR0A 5DDOC 2OHDA 4ANEA 2HWTA 5KG6A 4E8UA 4DR7J 2YPYA 1RI7A 2Z57B 1ZM2A 3HO1A 1C0TB 5BYQA 4H0XB 1F5CA 3S7RA 1N5TA 4DR7K 4UOGA 4ERDA 3K58A 2G8WA 4Y34A 4GW6A 1BCOA 1OKJA 4OPAA 5MLCQ 2F9JA 5DQGA 2VQFJ 1KQGB 1DEJA 4F50A 5AE3A 2CWXA 4AFFA 3SQGA 3W0LA 3LA0A 2N3LA 5AZJA 3A1YG 1NHKL 2VQFK 3X3UA 2NXCA 4ZDNA 2FSNA 5AQJA 3ISND 2HVZA 1KVAA 1PGZA 4CIOA 2E1MC 1VRTA 2R8KA 2IFXA 3RRHA 2MYFA 2ASJA 4K42A 2Q0UA 1JCGA 3NNAA 1D5AA 4KY3A 3H20A 1JLCB 2NZ4A 2EWSA 2KXNB 3PACA 5KOXA 4A5BA 2CJAA 3MECA 2XULA 2QWPA 3KK1B 1NNDA 4FJ8A 4M5MA 4BRAA 4LFBF 3SSRA 1RHUB 4LSNA 1LWEB 3SMSA 3TWHA 4CEZA 2CG4A 3U4LA 4CFCA 4M3UA 4B9MA 1ITGA 1ZM4A 5KPZA 4OGCA 3CMEN 2Q66A 2ILZA 3KUGA 1RAGB 2DR6A 3H3NO 4ITSA 2HHTA 3CJKA 3QZ8A 3NCIA 4OZ2A 5JVHQ 1KAXA 2FLPA 3KNGA 3K5LA 3L7UA 1RGIA 3CCSS 1CJVB 2HNZA 2AA4A 1PC4A 2VU5A 5L1LA 1NH8A 2HNDB 4LVOP 1VQ4N 5F8IA 3P8BB 2EG1A 1WSFA 4PG4A 4V19X 5AXNA 2YY3A 3HX9A 1WEZA 2CNLB 3QIOA 2XMVA 3IR7B 3B6PA 2A6MA 5BJRA 3FSYA 1FJ7A 4U7BA 1VQNS 2IMOA 4ER8A 1RT7A 1I39A 1EQYA 3FGVA 1K0VA 4EFHA 3ATUA 1WJ9A 4WZQA 3R7SB 3UVJB 4G1IA 3TQ1A 4B1XB 4CHPA 3MMAA 3BH6B 1YUWA 3KTQA 4DV7J 3TANA 1IBKJ 4CZJA 3TO8A 1JJCB 2BACA 1Y00A 1D8YA 3CDBA 4PUOA 4DV7K 3I8BA 2AEFA 1IBKK 4OLAA 1VRQC 2BZ2A 2Z58B 2MY7A 4X4VA 3SCIE 4L76A 2SXLA 2D4WA 1FO1A 1FVSA 3HVRA 2DR9A 3JQJA 3OYMA 1JLFB 2MGZB 4ECWA 2DR7A 1JKHA 1UOCA 5M2PA 3LGHA 4O0NA 3BPDA 2UVUA 2GTDA 4RPFA 4RUAA 3UE5A 3PX6A 5HO4A 4FK2A 2HAIA 2D3UA 1UVKA 2VHGA 1X4HA 3CIZA 5GADU 2XZDB 1M1HA 2XHBA 4NYNA 4OYBA 1SJQA 1CJVA 3BO3A 4CLSA 1NJYA 2UUBF 3HM9A 1Q8BA 3UB5A 4TQSA 2RKIA 4CK2A 2HNDA 1RE1B 1NOYA 3AA8A 3FK4A 4CT9A 3R2DJ 5K20B 1Y7PA 5FPDA 1ATRA 4EZ9A 3CCJS 4XEIA 1YJNN 3U1NA 3PW7A 3VA0A 1YITS 2RUSA 4CD3A 4NASA 4B3MJ 1NSPA 5E26A 2BE9B 4GC6A 3ENOA 4DR1J 2QWQA 4LY7A 4B3MK 3NGYA 3AOAA 2HG4A 3EICA 2I9SA 4H4OB 1TVRB 3JAMO 3KXDA 2WUSA 1TKTB 4DR1K 3SUNA 3W2WA 2AX0A 3IAYA 3KWIA 5AQNA 3ENWA 4CLKA 2NRVA 4DU1A 2YHYA 3ETOA 4M5DB 1X4DA 3ZT0A 4PEOA 5E3RA 3MCNA 4L73A 2IJNA 3GWCA 3LDLA 4JYAF 1T3VA 5E3AA 4DV0J 2WBMA 4ILRA 1JCFA 2M8DB 4RG8A 4PQAA 4A2AA 2QWNA 2C42A 3CJ0A 1ZOTA 2XO7A 1S57A 1IV0A 4DV0K 4LF6J 2Z0GA 2D5RA 3TUIC 5F8HA 4AHVA 2UXCK 1IWAA 2H1YA 2HHXA 3LDPA 2Y8YA 1FFGB 5KFFA 2RDJA 4LF6K 1UWAA 2VBWA 3VGMA 4ENOA 5I42A 3TX0A 3CCUS 4NLBA 3BBFA 2EBGA 4Q45A 2BQRA 1S6PA 1UFKA 2YX6A 4EZ6A 3DU6A 1E6VB 5JS1A 5LJWA 2M70A 3FCWA 1TL3B 5EN1A 3PW0A 1W7WA 4BC5A 2O5DA 1DRZA 4V19J 4PR6A 3GR1A 2QJ3A 2PDAA 1DTTB 3DXMB 1ZBUA 1U09A 2DNLA 1Q18A 4PA1A 2CPEA 4H0PA 3WQPA 3IWNC 3H0PA 3CHWA 3LL3A 4B9QA 4DUYF 4HDGA 4MO4A 1QAIA 2PN6A 3DXBA 4ZPDA 2XMAA 3QJPA 3V81A 2E7WA 4QCLA 1TVRA 3RGIA 1FTCA 1TKTA 3MR3A 2W25A 1IBMK 3HFZB 5E3CA 4XTTA 3I0RB 2QLWA 2LDYA 2E8AA 3LP2B 1NU4A 4ES2A 1XNQF 4BR7A 3MM9B 1SH3A 3HJFA 2RN2A 3FBEA 4KI4A 4DX6A 4USKA 1U0HB 3EGZA 2E5GA 2OA8A 2L9NA 2VOPA 3CJ3A 2B4PA 2VODA 4CQ1A 3MR6A 4FWPA 3AB2B 2RRNA 3U9DA 4RUHA 4JKGB 3H5UA 1S1UB 1HL6A 5IWAJ 1N33F 1K9MO 3N0VA 4UOCA 1X4BA 2E1AA 3FZ2A 4OJGA 2EW9A 3LWLA 4OX9F 5IWAK 1EX8A 3PJXA 3M3ZA 1VC5A 2OPPB 1FNOA 3ITHB 1IJJA 1SV5A 4LBPA 3HM8A 3H1QA 3ET6B 2XWYA 5AQIA 5E33A 1N34F 3TJAA 4OV6A 3RJMB 2FIUA 1RHKB 2VG6A 1HLWA 2HFSA 2KU7A 2AGQA 4F4YA 5KTQA 2AGOA 1TL3A 4OZNA 4CJEA 3TA0A 3QIPB 1U47A 4BRDA 3CDUA 1V4SA 2UZAA 1NJIO 1N4LA 3BUZB 4NEZA 2V68A 1Y3KA 4FM0A 3BY5A 1B0TA 1QVFM 2J9DA 1BQMA 4WK1A 2LU1A 4HEA9 3O9TA 3V9SA 2W2QP 4FJXA 3THYB 5FLXO 3ZTOA 2L9WA 4BR5A 3H4BA 1T11A 5DM7Q 2IRUA 1OVYA 1SC6A 2ALYB 2V34A 4O4GA 3DAWA 1TMJA 3I55S 4DR3J 4A8XA 4DR4J 2J6SA 3CGIA 2A3JA 3I0RA 3HHLA 3MM9A 4CF2A 1S1WA 3A13A 2DPNA 4FWOA 4AD6A 4GC7A 3ADAC 3CD0A 4PHTX 1RA6A 5HANA 1U0HA 2MQMA 1AFIA 2C2RA 1Y97A 3M1VB 2DH7A 1PYTA 5IT9O 4DSJA 3HZEA 1HBMB 1XWLA 2CQ1A 4JKGA 4AM7A 1OPIA 2ZEJA 1TL5A 3C7NA 3BO2A 2R7YA 4QWDA 3NGDA 2B9XA 4YOYA 4J9PA 2AYMA 4ZVTB 3VEZA 2HHHJ 3CFOA 4CH0S 3VN5A 4KB1A 3P1GA 4W98A 2ROEA 4CBWA 2OPPA 3E9LA 3WEEB 2VPXB 4BRMA 3JSBA 3RB4A 4CHYA 2BV3A 3N9UC 4CEQA 1YVFA 1Q8KA 3CC2N 4JKEA 3M6VA 4O55A 1WSHA 4YORA 2C2MB 1DY3A 4CFDA 1FE0A 3OL8A 1DAXA 3H7HB 3O3FA 4USVA 3R9LA 1H0HB 3NF8A 4NMLA 3QIPA 3EE9A 3RB3A 3EPGA 2JEGA 3TA1A 1Z1ZA 3VQCA 4LH5A 2E5JA 3G8TA 3VEVA 3EZWA 2FGOA 4DPTA 5KFMA 3P38A 2XS2A 1YQHA 2CH5A 4J9SA 3HSGA 5L9XA 3THYA 1DQAA 2AEJA 1SUQB 1WHYA 1VQOS 4GY2B 5KFJA 2ZD1A 4TU7A 2MKIA 2Z2LA 4LR9A 1XMOJ 3AB4B 3KKSA 2MKHA 3EGWB 4DR5J 2O8CA 3IS9B 1U0SA 3NCQA 3VQ9A 3PIOL 1XMOK 2PA3A 3VQTA 1Q7YT 3M30A 5AQZA 3K5NA 3ENHA 2HQCA 4Y2CA 4DR5K 4J2EA 2QXFA 3ALYA 4W5TA 5THWA 3GJRB 4W4MA 3EVMA 3PV8A 1I3AA 5G4DA 4ZVQB 3KG1A 4BRIA 4J9NA 3N6LA 2Q3PA 2NUHA 1IWGA 3R5BA 3BKUA 3G4SS 1I94J 4KH4A 4OGEA 4Z7YA 5LOQA 2NXNA 3NVKA 1HR0F 4F2RA 3H6EA 1X9JA 4DL3A 3GFZA 1SQKA 3OR2A 5KOWA 3QEXA 3WEEA 2JL9A 1YIJS 4CHZA 1GXUA 3MAAB 3R5DA 3PTWA 2MEWA 2HBYB 1Q53A 2L48A 1FX4A 2BQ3A 4ED1A 3G71S 2KVQE 4WFAL 1NK4A 2X3DA 3FZBA 1JLBA 4CP5A 4HUGA 5A8RB 1K6YA 4FLVA 4ISGA 4NLSA 5L1IA 2DNNA 1S72N 5C25A 2FBVA 2CQDA 4JHDB 2ZOGA 3N01A 1H2TZ 2R3VA 3T9ZA 2IVFB 4DTOA 2Q2RA 3RMDA 1UJ5A 3C94A 3IP0A 3CWJA 4M7YA 4LFAJ 5F8NA 4DTUA 2PI5A 2UUCF 4ZJOA 4RW7A 4DQPA 3U8XA 2CPXA 3MM5B 2R42A 4NPOA 2YKPA 2JSXA 3IG1A 4LFAK 2ZGYA 4O44B 1UL3A 1RWMB 4JV0A 1NGDA 3OYJA 4OHZA 1VDHA 3QJLA 2OLWA 4HI2A 2MQLA 5K9FA 1WI8A 1UPPA 1WWHA 4NLCA 2QGFB 2OTLS 2R2TA 4RW4B 3T1AA 4FVMA 3PYGA 4UUXA 5AQMA 2DKOB 2XC9A 4FLWA 4FK0A 3AVBA 1DHMA 2MZJA 2HK3A 1IO2A 5AFUH 3QQCD 3ZZZA 3J80O 5LJ3Y 4WXWA 3KG0A 3QT5A 3PR4A 1HNZF 2ZE2A 3IGVA 3U9ZA 4WP9A 3MK6A 5AZIB 1CZ9A 4ZJLA 2JHEA 2H54B 4PWDB 4JI8J 3LQVA 1EIYB 2X74A 2F63A 4GVBA 3HKZD 4E7KA 1FRIA 3Q2SC 2XY8A 1R43A 3OVSA 4OKKA 4ZPWR 1BOTO 1VQSA 2E5IA 1UWBB 3J7A1 4DPOA 3IM8A 1U1QA 1DFDA 3V4IB 4A8OA 1V4TA 1MDUB 5A8RA 3OFGA 3G86A 3VF0B 4ILHA 4Y1CA 5FDLA 3ETMA 2E20A 2O01C 4JI4F 3MMVA 2E1YA 4RTFD 1U02A 1WF2A 2ILYA 3FUYA 2A1RA 3PLAA 4WK3A 2AQ4A 4JHDA 3DOLA 3VQQA 1TAUA 5HATA 4TNOA 3H08A 2HBJA 2RIJA 2N82B 2R7RA 5DK5A 2MQPA 5KPTA 4MK7A 3E9OA 3CCRN 4NWBA 3QBWA 3C0BA 2KRRA 3J81Y 3IXQA 1WTBA 5HRNA 3CC7S 2ITGA 4CNZA 2I7PA 3OYAA 4XAKA 2Q31A 3AVJA 4WWSA 4RW4A 2ATCB 3B8HA 1UCNA 3CETA 3THPA 2ABYA 3HT0A 2RUGA 4WZMA 2EBEA 4PKDB 2DNKA 2GHVC 1PBAA 2DISA 5AQWA 1U24A 4BR4A 5B0BA 2KH9A 1G4CA 1PG5B 2BOPA 3OYBA 3GIKA 5D3GB 1JJ2R 2GV1A 2VPYB 1NK7A 4PWDA 2WVCA 2CGJA 4FM1A 3BM7A 2H3GX 1D0EA 1QD1A 2Y0SD 3G82A 3CC4S 3IR5B 1NGGA 1S48A 2CJBA 3DGPB 3DMJA 4CJVA 3TTCA 4YR0A 4AE5A 4FF4A 3BREA 3OHBA 3SEOA 3PNIA 1ZA1B 1WSVA 4JV5F 1TK0A 3LP0B 1QAJA 3BSOA 2HHUA 3R1HA 4USUA 2HEKA 4LF5F 4GVLA 2Z4PA 4CD1A 2L9DA 4FJ5A 3B78A 3CXCM 3EM1A 4DBQA 3OYLA 1BI4A 4B02A 4L75A 4JI1F 4ED0A 3HTVA 1VC6A 3UD5A 3OD2A 3S6EA 1VQ6N 1KCFA 4H54A 4ZOSA 2O67A 4OLBA 2HBKA 3DJCA 3HSDA 2QMWA 2GVDB 3W9IA 1FKPA 1HPZA 1LWXA 4BVOA 3DRYA 4A8KA 4M5GA 3K8VA 1ASUA 3L3CA 4PKHA 4FLUA 3S9HA 3MEGA 5LXRA 5CXTA 1UFWA 4E7JA 2QYGA 3GSDA 5C2CA 3OQ2A 4FN5A 2WFBA 2KTQA 3TEHB 1B99A 1S7IA 2PD1A 3FZHA 5EWFA 2XZWA 2R7UA 1VHFA 1VQLN 3I0SB 1OIAA 4ILGB 3O44A 1B3TA 1XHZA 4ELUA 4QR1A 4CM2A 1T05A 4FS1A 3GE9A 1JL2A 3CM6A 1T9UA 4O3NA 3ZETB 1WSRA 4ED8A 4I6WA 5F8GA 4JI3F 3AXKA 3ZNUA 5DDQC 4Z0UA 3KOAA 4KBOA 1H98A 1A6LA 2XGQA 5A2QO 3I9ZA 3OTBA 3PX0A 3LZJA 1RWKB 5AQFA 3H42A 2R8IA 4GNIA 3G96A 1FXDA 4M1KA 3DGPA 1VLOA 3OT9A 2NSCA 2Y1IA 3TAEA 2LA4A 9RUBA 1T03B 2NCKL 2KZMA 4G65A 2UV8A 2UU9J 5AE2A 2Y1LB 4DG1B 4AF1A 3EDRB 3LP0A 2KT2A 3FFIA 3EZUA 1U25A 1FXRA 2UU9K 3M7VA 3J7YI 4H0TB 3DXKB 1WC5A 4Z2XA 3QRPA 4IR9A 3BJYA 4TN2A 4DLEA 2ZZNA 5L38A 2X78A 2GAGC 5D4OA 4XH1A 2XGPA 2E1CA 3LF0A 2C2KB 3F41A 2ZBCA 2JEIA 1KTQA 1N8RT 4PABA 3MXMA 1MU2B 4RU2A 4KT0C 4O8UA 4X62J 4KREA 3OVBA 1RHQB 5DO2A 1KTVA 2CZVC 4WBFA 2B9WA 1F3FA 4OZ5A 1TV6A 4X62K 4I9QA 4OJRA 2UYTA 4KTWA 3SUOA 4CJLA 4TLQA 1RDWX 3O4WA 3D45A 3EO3A 2L3MA 2ZNYA 1HI1A 3FZFA 3L2RA 4QOTA 3I0SA 1V9OA 2I6WA 1X5PA 4JI6F 3SCJE 3QLHB 3FGUA 2WBNA 2P5OA 3AQOA 1P9YA 5EDWA 4YP3A 5E2QA 2CPIA 4FZXC 2G9OA 1S22A 5MAOA 4CI0B 1NGAA 2VKZG 5KT4A 3Q24A 4I2PB 4PXCA 1M5KC 3A8YA 3I5AA 1KRPA 5C2GA 4AL5A 4K4VA 2DHGA 1S0MA 1FTRA 3OS1A 2COLA 4Y3CA 1VSMA 3NXZA 5KG1A 1NU0A 3V9XA 1WBDA 2D0PA 1JQGA 4A8WA 3DDNA 5ETOA 5GINA 4Z7CA 3RG6A 2EC2A 4FLYA 1FDNA 3HOTA 3CCSN 1ZBLA 3C15B 2UUWA 4DG1A 3O9SA 5CD4A 2X3GA 2A2CA 5KFIA 2ZWHA 2FBXA 4QIFA 2EHGA 2V2VA 3WXIA 1JMTA 1NXIA 4CZMA 4K4SA 3AVGA 3BBCA 1WC0A 4LVNP 3U6FA 1HJOA 1QQCA 1UEVA 3ZZRA 2CZ9A 2RAQA 5IC6B 4ECZA 2F9TA 1QE1B 4Z4EA 3Q8QB 3NHGA 3K2YA 4OV1A 2C3PA 4S0MA 3VGSA 1WF1A 2VH7A 1CJUA 1MU2A 4R8UB 1VQNN 3O2IA 1WC4A 3KWMA 2QA4G 4J90A 4JOUA 1S9EA 4F67A 4UY8O 3PIPL 1KHVA 2P9PB 3WZ0A 4UTGA 1K8AT 4FNHA 1T9WA 1W7AA 3RAQA 3I56N 1RTHB 4IFYA 5KFSA 5KGWA 4OJ1A 1SKSA 5C24A 4QU7A 2CJ9A 1YG0A 1FJCA 1P6TA 2DCUB 3QLHA 3CJ5A 4CERA 1Z2LA 4N7TA 2HZCA 2NUBA 2LXUA 2KJVA 3PRVA 3C8YA 5EX5A 2JZ5A 2ZHAA 2YWFA 1XMQF 2K7JA 3P49B 3D1QA 3CJAA 1FA0A 1HI0P 1B0PA 3NP5A 3CT9A 5CCMA 2GQ2A 2EVZA 3ZX3A 2DPIA 3JSYA 2VFUA 1QTNB 1HW8A 1ROFA 2W24A 2M5YA 3MUMP 4I6MA 4WFNL 3FQKA 1NWKA 4KHQA 3I32A 2E5LF 1VBYA 1T8EA 1DBDA 2EG2A 1LEOA 1D4XA 4YQWA 3HXMA 2O8DB 2FHMA 3KLEB 2YNHB 4JI2J 4H0OA 2HHQA 3VGKA 3WBZA 4UZCA 4JI2K 4PPDA 4BR2A 2GJIA 4IRKA 2VKRA 2N4CA 3HYFA 5CQGA 1L3KA 3MPWA 3CCJN 1QE1A 3DLKA 1YITN 4EBEA 5FD1A 3BB5A 2BJ3A 3N5BA 1RLCL 4CJFA 4PWWA 2K1RB 3CCQN 2ASYA 4EAHD 4R8UA 3TAFA 1NLKL 1WOOA 1KLMB 4CEBA 1R0AA 3JXUA 4DU8A 4LF7F 2YJEA 4R25A 2EPIA 2P9PA 2ZM6J 1ZM3A 3M8QA 3QAEA 4CF0A 2AHOB 4GO7X 4LF1A 3ZT4A 1RTHA 5ITHA 3D3BJ 4HH1A 3MN6A 3M9OB 1XK8A 2VBXA 3OR1A 4USHA 2ZM6K 1A9NB 4IEIA 3X1LB 3DI6B 1VOMA 4FM2A 4DUZJ 3BGOP 2BJ7A 3MTJA 1NM1A 4LFCJ 2BANA 1FVQA 1KQSM 2V2KA 3TNVA 1T3NA 4A46A 1I51B 2L08A 4DUZK 3DRPB 3TA2A 3PUFA 1RT3A 5CYMB 4LFCK 4RUCA 1HWJA 3KK2B 2VC1A 2ZH2A 3QESA 4Y28C 5ETNA 3AOCA 4QIEA 2PYJA 1RA7A 4F02A 4H4KC 1X3NA 1D09B 2FY1A 1SPBP 2RSQA 4I67A 3NWRA 5DG7A 2MJUA 3OV7A 3CCUN 2KM8B 3DRRB 3THWB 2OPSA 3P45B 3IR6B 3CUNA 2YWEA 2O8DA 5GIOA 3KLEA 3CPWR 2HQFA 1OH5A 3CJTA 2YNHA 4OYWA 3HOSA 4JD2A 5AQRA 4KIAA 1CJKA 3ULEA 4GMKA 1QQMA 5H1SQ 2NRWA 4C8MA 2X1AA 2RHQB 4FVUA 4OYAA 2ZQBA 1REVA 3DLLQ 4ZLPA 3Q8PB 3ZCMA 2ZBPA 4BLGA 4Q2MA 3WNEA 2VV5A 2CJXB 2FZKB 4YUDA 2A18A 3HZ6A 2EKNA 5KFXA 1GMWA 2HWIA 5BXIA 2QL7B 2VWBA 3PFEA 3AA2A 3NG8A 3SQ4A 1R8CA 5D0EA 3VQDA 1L3VA 1YBTA 2AZ1A 1RBLA 1NKBA 1U7LA 5LJVA 4QZVB 4PG8A 2D3ZA 4K4UA 3L0QA 3TUPA 4DFPA 3OYGA 5JVGL 3DI6A 4MMOA 2YX1A 3OL9A 5C2FA 2KXHA 3DDIA 2BR0A 3R5AA 1BG3A 4IDKB 4FNIA 3SJHA 4IOXA 1WG1A 4Q8EA 4HVZA 4LSLA 3VA3A 2WCXA 4MAKA 5EOYA 1YGYA 2PBDA 4K5RA 2ASMA 4ELVA 3KK2A 1FE4A 3R1LA 4HACB 3VEOA 1W2IA 4ZPBA 5DLGA 3OJSA 3HHNB 2HGMA 1RHMB 3VQSA 3EPIA 1U8SA 4EGLA 3VZHA 2GAHC 4X65F 4WKYA 2HMIB 3DRRA 3THWA 3A8KA 2DGQA 4QBUA 3MM6B 4B3TJ 3HPGA 1CS4A 4CJWA 3U02A 2GJFA 1SAZA 2X7IA 3EX7B 3OYNA 4Y0FA 2XMKA 5HMYA 4B3TK 2JEJA 2VDHA 3LZIA 3P96A 1KQKA 1N5SA 3UDVA 1T6CA 1O5JA 5JMVA 2DGWA 2QW9A 2X1BA 1YI2S 2HBRB 4F04B 2R7WA 4BC4A 5KPRA 1JNRB 5HJXA 5M1NA 4ED4A 4ZVFA 4FJMA 3OS0A 2Z30B 4MDBA 4R0EA 3GLJA 1L3SA 3H25A 2D9OA 3BN7A 1GFWB 3VQ8A 1RT4A 4ALZA 1UJ4A 1IR1A 2JJ4D 4LR8A 4B1VA 2FB0A 3KK3B 1FK9A 1WOSA 1B9FA 3FRYA 4BY9C 3I55N 1OH6A 3POTB 1N5YB 3TAQA 2LXFA 3CFRA 2LDIA 1X9SA 3NNCA 1D1UA 1Q8LA 2IVYA 4WPAA 2PIIA 4ZPAA 2R9LA 1V3ZA 3PRDA 4U67L 1BC6A 5KGXA 2QV6A 2QA1A 1RBSA 1E4FT 3MCMA 4A61A 1B4SA 2DD8S 1HBNB 4IDKA 2VG5B 1IKXA 3A5OC 1WDDA 3ASMA 1K0TA 3FC9A 4U7CA 1HUXA 5HI7A 3OXFA 3JB9k 2E9ZA 1F9FA 3TWZA 1KKHA 1JLGB 3R7BB 4OKJA 4HWIA 4ILLA 4FWNA 1H7WA 2KG0A 1RNHA 3ZSOA 5B0EA 3G6EN 5J2PB 2QMUB 4R5PB 3MPVA 4KH5A 4QWBA 4L3QA 1RAOA 4N5SA 4PYAA 2KHDA 1NO8A 3ZNJ1 4EEYA 3ZEUB 4I7FB 1XN9A 2AZ3A 1KAZA 3HHDA 1X4CA 3VETA 1WTFA 2KLAA 4CM0A 3G87A 2ACYA 3R5CA 1DKGD 2ZWPA 5M1OA 3MTKA 4TKTA 4BRNA 1JK9B 1IKWB 5M2RA 3QT6A 1U2RA 3TW0A 2W9BB 4MK8A 1U4BA 3SFUA 1IKVA 4FXWA 3KK3A 1J9AA 3SNNA 4ZVPB 3TSUA 3IRXB 1QTMA 2HZVA 2WBRA 3L4BC 2VIHA 3VF6A 4NA3A 3OYHA 4N47A 1UW9A 2DT9A 1VQ4S 3GYNA 3EJMA 3D7SB 4DV4J 5AQOA 3PKMA 2V8DA 1HBNA 4TU8A 3HD2A 5LMUF 2P6TA 1DQ8A 1YWXA 4DV4K 2JWNA 2VZ9A 4ILJA 5BYRA 2MLXA 3MR2A 2ROPA 3QIDA 4LBIA 5D8HB 1FWPA 1ELOA 4P74A 3B8AX 1GOAA 3G4SN 1TAQA 3AVHA 2D1KA 1YSJA 4NXNJ 1HNXF 1KVBA 1JLGA 3ZZUA 4JKDA 2MKCA 3Q8VA 2M8HA 3BGUA 2E1RA 2PO4A 5K8NA 2CGLA 2UUBJ 3SQOP 4NXNK 5D0RA 5GAEP 1VQMS 4ATNA 1YIJN 3NH0A 2IDEA 1Q86O 4R5PA 4ZPCA 4MYTA 3OHAA 3ZX2A 4CT8A 3RYLA 3G71N 3V9WA 4KTZA 2AJ2A 2QWRA 3ZEUA 4I7FA 4WXOA 3PSIA 3GG1A 4PG7A 1GXTA 4JI0J 3CQ8A 2ERRA 3CM5A 1B92A 4W92B 1FDBA 4JI0K 3A8IA 1WHWA 1ZAVA 5A76A 2C2ZB 3QNWB 3L2QA 1RAHB 1IKWA 3BGRA 3M2UB 5D6GA 1UTAA 3LPUA 3L2UA 1RAEB 3CCLN 4RX6A 4OVLA 1QVGM 4RNFA 1H73A 3QWPA 4JYAJ 2KQ2A 1RISA 2ZUAA 2R2SA 3W64A 3VENA 2M9KA 1CQNA 3B54A 4AHSA 2H5EA 5HL7Q 2BE2B 1TYQB 2BE7D 3OLBA 3D54A 3KLHB 1BDGA 4U7UK 3SIPB 4Z4IA 4B9NA 4DV1F 2YNGA 2OFHX 3O1LA 1F3VA 4BG9A 4FOIA 1YJNS 3R6GB 1YJ7A 1C1CA 5KG4A 2NRHA 4LQ3A 4TVAB 3DWLA 2A3ZA 3CMQA 4O23A 4RNHA 3H40A 4IG3A 2W7OA 1NKCA 5GAHI 3D2EB 2GX9A 1VRUA 4ZCLA 4M42A 2FGCA 4FKXA 2F7TA 3JYTA 1VSKA 4ED3A 1K8KB 2HS0A 1G99A 3P5TL 2HIYA 2HWHA 1WSGA 5D0HA 2UXDJ 2F5GA 1NH7A 2OUGA 2QWMA 2UVRA 5F0UA 4JI7F 3MMCB 2V8GA 3IMXA 5DGAA 2MTLA 2P9NA 2UXDK 1W2BM 3CCWA 3CEDA 1X4FA 3V6JA 4DXLA 3CERA 5I3QA 4KE5A 2ZHOA 3ICLA 3MOZA 1F5AA 1P9QC 2ZH8A 1IXKA 4TYAA 3CJ4A 9ATCB 4QWCA 4XH4A 1SL2A 3Q22A 2MLYA 2ASOA 1N32J 3QGIA 1VS3A 1BUPA 3WNFA 1R8BA 5IM0A 2UVWA 3RVCA 4UT4A 4X66J 3ZSVA 1N32K 3V6DA 3QFUA 2B7CB 4BWJA 4DV5J 2V4RA 3SUQA 4X66K 3RB0A 3CC7N 5JVGQ 1NCLA 1X5SA 2DNMA 3RMAA 3IKMA 3OJUA 1N6QB 4DV5K 2V4QA 1D3WA 1GK8A 1ZS6A 4OHXA 3R7NB 4N8NA 4NOHA 4FF2A 3PX4A 4F0HA 2MQ8A 3CULA 3HL8A 2MKYA 2J7WA 3OUYB 2BA9A 4YR3A 2CWKA 1OH7A 3W66A 1S12A 4LRBA 1H38A 3CNQP 1RDDA 2XB2D 2DY9A 3BYRA 2KO1A 3NAIA 4NRTA 3J81O 4IO8A 3OS2A 4HT5A 4C1NI 4CJRA 3FDSA 4IOCL 4WFBQ 1MN9A 5CYQB 1S0OA 3KUEA 2HF3A 2B4OA 1SB6A 4ES1A 4MIWA 3AARA 2XS7A 4RLEA 2OEMA 4B3RJ 3MMCA 5ADZA 1WOQA 2X51A 4F2SA 2XWXA 5K14A 1FHTA 4BR0A 1Q7LB 4QR0A 4LF4J 1Q81O 4FJGA 3WIVA 2XHWA 2YKQA 4DQ8A 4B3RK 1OSDA 1C0FA 3QEPA 4UUWA 2F8TA 5L1JA 1L5UA 3MAHA 1TKXA 1U1KA 4LF4K 2IAJA 2K3KA 3PSFA 4BRLA 3AVLA 2HVDA 4KQZA 3N4WA 2J9CA 5J1PA 4B1YB 1VJWA 4DU7A 4BRHA 1S1VB 5BR8F 1U1LA 5LXYA 2W9AA 3BZCA 4HHJA 4K5SA 4NL5A 1Q9YA 2RQ4A 3MCSA 2X6SA 2EFNA 3LALA 2B4JA 3QEWA 4CYUB 2HS3A 1VQ7S 1ACMB 2BGGA 2OKQA 3DRXA 1FRLA 3TAMA 4ZVGA 5LL6d 3CCVN 2B4VA 4YOUA 1WHXA 1A7GE 5CD4H 3TEGA 3QFHA 4KRWA 5H9EJ 2A0FB 1VSJA 4BDZA 1FD2A 3OUYA 3O3GA 3V6KA 4M95A 2V7YA 3VAGA 2RS8A 5DRKA 4PL8A 5H9EK 4OIXA 1S5ZA 2KKZA 2P9KB 4P7VA 4YHHF 4YDDB 1FJGJ 2FHOB 2XLIA 4H0VB 3ZT3A 3VAHA 2C3UA 3EXCX 5C2DA 1N36J 2D9PA 4Q44A 3W3SA 1AUDA 1FJGK 3QICA 2Q43A 3W1YC 1K9MT 3H5SA 3C6TA 1Q9XA 5CYQA 4HCCA 1RTDB 4DQQA 3HVTB 1N36K 5D4NA 1EJ7L 4KPYA 4MKVA 2WVDA 1RLDA 1ATNA 4K0KJ 3DOKA 3CCMN 3MCAB 2A1SA 1OYEA 1RWWB 4UW2A 4F4AA 3O9QA 4F9OA 4EO8A 4FWKA 4K0KK 4OYOA 1E3MA 5C15A 2ALZA 1RTJA 4ZPTR 2ZHBA 3TAGA 3BQ2A 4DV2F 2N7CA 2OCEA 2GHPA 2QYCA 3MDFA 3M2RB 3NGSA 1ASWA 2ETJA 3IGNA 1JNZB 4WE1A 2UUAF 3TTDA 1AUSL 3O5BA 3DU5A 2FJXA 3BS9A 1S1VA 2O66A 1NJIT 3NKYA 4ZIWA 1SQGA 5FPMA 7AT1B 2CQCA 1RT5B 3G6VA 1BIZA 2FF3B 4MT1A 2QMXA 2DO0A 5KFQA 3DNCA 2AP6A 4CYUA 4UOFA 4D3HA 4CF1A 5KRSA 4U7UD 4IO9L 3VAIA 2KYXA 4LC9B 2IS3A 4Y2MA 1Y5LB 3P83D 2XS5A 4KGMA 3I4PA 2MKJA 4IEEA 4RW6B 5BRDA 1XNRJ 1B7YB 1O1WA 3M5RA 2VOOA 4I4BA 3EKUA 4DR7F 3G6YA 4C4WA 1KFDA 1U2VA 3CB4A 1XNRK 4GKJJ 1VJQA 5ADXA 4ILMA 3QEVA 5HVFA 1DLOA 3J80U 2KN4A 1R31A 4GKJK 2W7PA 1ZBSA 3HLUA 1MNEA 4WFZA 3CJ9A 3OYIA 2KB2A 2E29A 2P9SA 3QO9B 3GE1A 1CBKA 3RMBA 5K8PA 1SL1A 3N4QA 3UE2A 3T5JA 2V9KA 2ZBRA 3NLCA 4HHUA 2HFZA 2MSSA 4FZYA 3KLVA 5GAEU 3AY0A 2K06A 5AQGA 3FZKA 4OZ1A 3ZX0A 2RE1A 2HGNA 2UUCJ 2Q36A 1RYSA 2LVWA 1Y9OA 1BIUA 4C11B 3HSCA 4QU6A 3M2RA 2UUCK 4Q0BB 1SC1B 1MMDA 3OFFA 2BKNA 2B56A 3VVTA 1VBKA 5DG9A 1EP4A 4O4RA 2QT7A 3V1QA 1KN6A 4C9DA 2RS2A