1HPZA

Human immunodeficiency virus type 1
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 122
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hpzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hpzA05
4ZVGA 2VG7A 1VSDA 4N76A 1SKWA 1WSEA 5I3UA 3NKYA 3HXMA 4GC6A 2YNHA 1JKHA 1GX5A 2Z1GA 5HROA 1RDBA 3CJ3A 3EZUA 3UDLA 3QIDA 1YVFA 3QLHB 4M3XA 1LAVA 4KKOB 3AVNA 3SQ1A 1RDCA 1KVCA 1N56A 3KIOA 3L2QA 3OHAA 4AH9A 3V6DB 5DQIA 2UVUA 1SKRA 5HBMB 4CEEA 1QSYA 4Y3CA 4EO8A 3DOKA 3VQ4A 3UIQA 2XRIA 5KFLA 1FXXA 2YNGA 4M94A 4IFYA 3FQKA 5J1EA 1S5JA 2WK4A 1TVRB 2R8GA 4NLOA 5KFNA 2R8IA 4BDZA 3E01B 3T5JA 4HCCA 2B5JB 1A5WA 3TI0A 4CEDA 4DFPA 4O4GA 4E0DA 2O5DA 4B3OA 4E19A 1CLQA 3KHHA 1TVRA 2AWZA 3C94A 3AV9A 2LSNA 1KHWA 4GMJB 2ITGA 3KJVB 3L3UA 4FBUA 4CJ3A 5KFRA 3HPGA 2J6UA 3V4IB 1T03A 5HLFA 3H5XA 4ICLA 2BDPA 3CQ8A 5KI6A 5D3GA 4ECUA 4IG3A 4HUFA 4CHOA 1JLFA 4M3RA 3DM2A 4WFXA 2B43A 4ED3A 3G6YA 4AHVA 3H2LA 3OYHA 1B9FA 4EP4A 3NCIA 4WXWA 4RNOA 3D5MA 2R8JA 1SKSA 2FC0A 4WZMA 1LWEB 3RB6A 3CFPA 1W0HA 2FJWA 2YKNA 1JX4A 1TV6B 2XI2A 4DQSA 5J2MB 4O44A 1JLBB 1NHUA 5CY4A 4IFVB 2Y1IA 5DMRA 3GV5B 1TAUA 3H98A 3OYEA 1RA6A 3QEXA 3T19A 1JLAA 2HNDB 2V9WA 2FLPA 4L8RB 2YNFB 5KT3A 4FLXA 1HYVA 4IG0A 4DL6A 3OJUA 3IG1B 3DOLB 2BQUA 4C8KA 5SWMA 5F8JA 3OYLA 4I2QB 4KO0B 3VQ9A 4KV8B 2BR0A 4LQ3A 3D28A 3SPYA 4J9MA 4RW4A 3T5LA 4EZ6A 3PR5B 4O5BA 5J2NA 1D1UA 3EYZA 3MFIA 3N6LA 2G8WA 3V9ZA 3KJVA 1QE1A 1KHVA 3OL6A 4IRKA 4DL5A 1VSJA 4KHYA 1N5YB 3T5KA 4J9QA 1RILA 2JC0A 4JRPA 1G15A 2FBXA 4CHPA 4E7LA 1LW0A 1KVAA 3HL8A 3CIZA 5KFUA 4E7JA 4M3YA 4Y1CA 2B5JA 2HVHA 1TGOA 3P83D 2RDIA 1DTQA 1QS4A 4KPYA 2BRKA 5F8NA 2P51A 3PX4A 3HM9A 4I2PA 4O3SA 5KRSA 3QZ8A 4FJJA 3SFUA 4B9UA 3ZCMA 2FVSA 3OYJA 2C2EA 2I5JA 5KT5A 3QGGA 2P1JA 1XHZA 4OJRA 4PUOA 5L1KA 4DG1B 4KBIA 2YNHB 3M9OB 2WHOA 3RMAA 3GV8B 1BIUA 1T8EA 3SPZA 1S6PB 2HNDA 5FRMA 1SUQA 4H4OB 3H5SA 3QNOA 5CYMB 1S1TB 3IAYA 4KTQA 3ASMA 2BRLA 3VQ8A 3MF5A 4TY9A 1T05A 1HYZA 1JLGB 1RT7B 3EPGA 1SH2A 3AVCA 2D3UA 4ZHRA 3PX6A 3SZ2A 4CJPA 4LD0A 2OZMA 3VQDA 1LWFA 1YTAA 3LPUA 4Q44A 3ISND 4J9KA 5DG9A 2UUWA 3ALYA 1YTUA 3OS1A 3BQ0A 4KHWA 2BQRA 3HO1A 4FJMA 2VG5B 1NKCA 4JUZA 4W5OA 4CJKA 4FW1A 4CIEA 3O3HA 3NF6A 3B6PA 2HNYA 4DTJA 4DTSA 4YR0A 3SUOA 3V81B 2BQ3A 4R5PA 4RZRA 4IG3B 1S1WA 1QQCA 4FLUA 2O4GA 2IJFA 4B08A 1S9FA 1NOYA 2W7OA 3DLBA 3K59A 5KFCA 3FRZA 3ZSRA 2A1SA 1F21A 3SUQA 4F8RA 1RYRA 4ECYA 4FM2A 2WTFA 3BSNA 3NMAA 2AJQA 2FBVA 4NLQA 3RAXA 1B9DA 1U49A 3IRXA 2HHWA 2PY5A 4ZVFA 4Z4GA 2VG7B 4O0IA 3Q8PB 1NKBA 4ECZA 1ZBIA 3RB4A 1C1CB 2DPJA 3H40A 2PYLA 3DRPB 4YNQA 2C2DA 5HBMA 4RNFA 4M41A 5DG8A 2KW4A 2ASDA 2XY5A 2D41A 4PUOB 1JLEB 3C6UA 4NLTA 4PWDB 2R2RA 1HNVB 1TL3A 5C24A 3FFIB 2UUTA 4F4YA 4WFZA 3EY1A 4F2RA 4RNHA 3MR6A 2XGPA 4RW4B 4ED1A 2HB5A 1LWFB 3NAIA 3V9UA 4WE1A 4NCBA 4DTPA 1S1TA 4K8ZA 3KLVA 4DTXA 4KI4A 1VSIA 5HRSA 5T7BA 1UA0A 5KFSA 1XR5A 1EX4A 4HCBA 4RW8B 3KLIB 3BQ2A 1KFSA 3N6MA 2AU0A 4C8LA 4Z4IA 3I0SB 2UVWA 3QZ7A 4FLVA 3RTVA 2R8HA 4OKEA 4WZQA 2W7PA 3RWUA 1U04A 1HNIA 1BI4B 3NH0A 4NYNA 1LWEA 3V6KA 4FK2A 1S1XB 1K1SA 4LSNB 2IC3B 3EPIA 3QEWA 5JXSA 4Q0BA 4NCGB 2IS3A 5KFBA 4E7KA 5SZTA 3AA4A 3VQCA 1S0MA 4NLVA 1S4FA 1VSKA 4K50A 3M9NB 1BQMA 1TL1B 3TAPA 4DS4A 2W9AA 2IJNA 3DYAA 2C2RA 4DFMA 1NJXA 5L1IA 2KQ2A 5KGWA 3NBPB 3MECB 4FXDA 3BGRA 2XHBA 3DMJB 4ZP9A 1RA7A 4CEBA 4ID1A 4CEOA 4QAGA 1FKOA 3HVTA 3M8QA 4IH5A 4B9SA 2HHSA 2ZE2A 2E4LA 1IKVB 4K4ZA 4IKFA 4IDKA 3QGHA 1BISA 1RDDA 4N47A 4OPKA 3NH1A 1C0TB 4CCHA 4RW8A 3U3YA 2YHAA 3LP1A 3L8BA 2C28A 3Q8SB 1RTIA 5DLFA 4C8MA 1RBRA 4FZYA 2RKIA 4DTUA 2YNIA 4ZPDA 1U48A 4FVMA 3HVWA 3CM6A 2G8VA 5C25B 4ZPCA 4CJRA 3KK2B 5CYQB 3VQ5A 2VG5A 2JC1A 3IS9A 4FYDA 3U6FA 3PR4A 3QNNA 2IAJB 4DF4A 4ELUA 4IOBA 4ECQA 3T1AA 1L5UA 3AVMA 3H4DA 4CFBA 1RTDA 3PW4A 3KK1B 3U3GA 1ASUA 4OGCA 2IOCA 3GQCA 4M3TA 1D0EA 2BGGA 2FVRA 4F3OA 1S9EB 4FS1A 4Z4HA 4BE0A 3HP6A 4CJLA 2FVQA 3MXIA 3NHGA 3KLEB 3HK2A 3VN5A 4ICLB 5JS2A 3CG7A 4WYWA 4TN2A 1X1PA 1U4BA 2HHVA 4OKKA 3L3VA 4KREA 2ZQBA 3DLEB 3CJ0A 1C1AA 4RNMA 1S1VB 3MEGA 5C5JA 4Q5VA 3I8DA 2R7YA 4KHMA 2OYQA 3KHLA 4CEZA 2WB4A 2YNGB 4IFYB 3TAEA 2FBYA 4ED8A 4DTMA 3HJFA 4NLWA 3LPTA 4MKAA 3I5AA 1N6QA 4W5QA 3DLGB 3V6DA 4IRCA 3AVFA 4IQXA 3PY8A 1ITGA 2G8IA 3RMBA 3DOKB 4KHQA 1J5OA 3I0RA 3LAKA 1NJZA 4Z4FA 3OL8A 3VQAA 4DL4A 4J2AA 2KFNA 4Q43A 4QPXA 1VSLA 4CK2A 1T3NA 4K8XA 3MEDB 5L1JA 5J2PA 1J5OB 2QKBA 1HNIB 3LAMA 1TKTA 4G1QA 2W9BA 1GX6A 4FK0A 4URSA 4ECVA 2B6AA 2OPPA 3QESA 2BE2B 5KG1A 3KNAA 3M8RA 4PQUB 3VQSA 3CYMA 3C6TA 3KLFA 4DWIA 4F2SA 2D5RA 3SQ2A 1I3AA 1XC9A 1S9GB 3BJYA 1IH7A 4LSLB 5EU7A 4K4SA 3I0SA 2Z1HA 1BGXT 4KHUA 1KCFA 3O3FA 3GIMA 2ZD1B 4JV0A 4NYFA 3P5JA 3MECA 3NBPA 3AVBA 4DSLA 4RW6B 2WOMB 4AILC 1XWLA 2BANA 2JEGA 3HPOA 2J6SA 1ZETA 4ED0A 3FQLA 3TABA 1NK9A 3FFIA 2IA6A 2F96A 1IKYA 1NKEA 1HQEB 1RT6A 3KLHB 4YQWA 3OL7A 1QSLA 2VA3A 5EWGA 3OYCA 3QYYA 4TXSA 4DSKA 1WNEA 4FJHA 1KRPA 3TWHA 5KFDA 2NUBA 4FJ5A 3WNHA 4KSEB 3DRPA 1DTTA 3O4NA 2EX3A 2ZE2B 3KD5E 1S49A 4K4VA 3KMQA 5F8MA 3SUPA 3ZSZA 4CJEA 2D0AA 4UQGA 3MEEB 4ZVHA 1VSHA 2OPQA 5KG2A 3GIJA 4DTNA 1ASWA 3LP2A 3ZT0A 4NLXA 4MIAA 4IH7A 1DTTB 4I7FA 4CJVA 1RT7A 4CESA 2G8HA 3MEDA 3SFGA 3MXJA 1FK9A 2X6SA 4CK3A 2WONB 5KFPA 5J1EB 3RRGA 4QWEA 4CECA 5L9XA 4YFUA 3G10A 4I2QA 4Y34A 1UWBA 2P5OA 4C8OA 3LANA 3SQ4A 4NLDA 1BCMA 4N56A 1HPZA 3OYGA 2FJVA 1CXUA 1RDRA 1QAJA 3AO5A 3O3GA 1BI4A 3QIPA 4ECSA 5J2QA 1Z4UA 4CHNA 1RBUA 4DL2A 4DMNA 3QETA 4DU1A 3KK1A 3AVLA 5FROA 3UPFA 2PYJA 4EP5A 1RT5A 3WNFA 2HNYB 3PZPA 5KFYA 4CF9A 4NLRA 3CVKA 4MH8A 4FZZA 3NDKA 3LWMA 5C42B 5FDLB 2BE2A 1RTJB 1EKEA 4QCLA 3RR8A 3KLEA 4URGA 4IRDA 3OYIA 4RNNA 3KOAA 3PX0A 4EBEA 1IM4A 4KHNA 2HMIA 4Z4EA 5JS1A 2HMIB 1YVUA 1GOAA 3DLHA 1C1BB 4B8AB 5KG4A 4B9NA 4CK1A 1LAWA 1JKHB 3PO4A 2HW3A 3BR9A 3ZSQA 3VQBA 4E7HA 1BQNB 2JLEA 3DLKB 2IM2A 3AVHA 3L2WA 1RCHA 4YR3A 1S0NA 1Z25A 3ZSXA 2UVRA 4JS5A 1WAFA 4ZMMA 4M3ZA 3RB0A 5J2MA 3IS9B 2IDOA 2AGPA 2F8EX 4DSEA 3QEIA 3QIPB 3M8QB 3KLGB 1HQUB 4F4XA 3NGDA 4IKAA 2IBKA 4RW9A 5KFIA 2R8KA 4OLAA 3V9SA 1RTIB 4OGEA 3PW5A 4H4MA 1JLQA 1WSFA 3P1GA 5HP1A 2Q3SA 3ZSYA 1JLFB 3PUFA 1S1WB 4BDPA 3I5BA 4LSNA 4DLEA 1RTHB 1S0OA 4NCAA 3C6TB 3KLFB 4JRQA 1TQLA 1KLMA 4BACA 3TAMA 3H08A 3H4BA 4KAIA 1RT3B 2AX1A 4O3OA 3HT3A 3SQ0A 1S1XA 4KB7A 2B6AB 4FJLA 1HRHA 3KK3A 2IMWP 1QE1B 4CF0A 1TK8A 3RBDA 4ZPAA 5HRPA 4WYLA 1D9FA 1C6VA 4O3QA 4F4KA 4J9PA 3K58A 1W25A 4CJQA 1MU2A 1BQMB 1TL1A 5KG3A 4FZXC 1U47A 3PO5A 5KFXA 4NLSA 3QEVA 3VQPA 3TVKA 3IGVA 4IBNA 4CGJA 3MR3A 4QWAA 4WE1B 1KVBA 1SH3A 2RDJA 3OYBA 5CYMA 4K4TA 4FS2A 1IKXB 5F8LA 1HMVA 4KFBB 5KRTA 3M8SA 1U45A 2ILZA 3SYZA 3RRHA 1JLBA 3DRRB 5DLGA 1RYSA 3KD1E 3M9MB 3TAFA 4CHQA 2YKNB 1NK7A 3V6HA 4PQUA 2QK9A 1X9MA 4KB1A 5KG5A 5T14A 3AO4A 4BE1A 4H8KA 2WCXA 2DPIA 2WONA 3NE6A 2FJXA 3TAMB 4KKOA 1BL3A 1Z26A 2CJQA 1GOCA 3AVKA 4Q45A 4Y1DA 2DFHA 4CGDA 1HYSB 2HHXA 3IN5A 1LWCA 2Z1JA 2V4RA 1RTHA 2FLLA 2W8LA 4IR9A 4NCGA 4Z0UA 5HLFB 2Z1IA 5HRNA 2EHGA 3S9HA 1JXBA 2D7SA 3OYNA 1GOBA 4CJ5A 4DF8A 1Q9YA 3KKSA 5F9NA 5DG7A 3B6OA 3V1QA 2F8SA 4QWCA 5KFAA 3PW0A 2HAIA 2OZSA 1T7PA 1RT5B 4NLUA 1TKZB 3V81A 4QOZB 2ATQA 3LALA 3VQEA 4GVMA 4KTWA 1HMVB 2OPSA 5EUHA 4RUAA 1VSFA 3QO9A 1KTQA 2OH2A 3HPHA 4KAZA 4FBTA 4E1NA 3LP0A 1IKWB 5K14B 4ZP6A 3LP1B 4K4UA 3K57A 4FJKA 3MTKA 3OYKA 1JLAB 3BSOA 1L3UA 5KFKA 1BCOA 2QKKA 5DQGA 3QIOA 1JLEA 1C0UA 4ZPBA 4MFBA 3S3OA 3NAEA 1Y97A 3ZSVA 2D0CA 4EZ9A 3CWJA 3OYDA 5J2NB 4FJ8A 4ID5B 5J2QB 4MFBB 4CHYA 3F73A 1VSMA 2VG6A 3NF7A 1S10A 4NLGA 4KV8A 4URQU 2ETJA 3LZIA 4ED2A 4BWMA 4H4MB 4Q8FA 4WXOA 1WSJA 3IG1A 2OA8A 5D3GB 1J53A 4M3WA 4XIUA 5FDLA 1VRTA 4U6PA 1Q8IA 5KFZA 3BSCA 3H5UA 2HNZA 2GC8A 3PVXA 3ULDA 1TKZA 4B9LA 4B3OB 2W42A 2G8FA 5KGXA 4LSLA 4EBCA 1I6JA 4W5RA 5KFGA 4HVJA 4YR2A 1NJYA 3AVGA 2KZZA 1N5YA 4O3RA 4QWBA 4EYHB 3V9XA 4I9LA 3TAQA 4W5NA 1L3TA 1BHLA 4X2BA 1EXQA 5I42A 4E1MA 4TSXA 4E3SA 2XGQA 1RTDB 4LH5A 1C0MA 4JS4A 4DSIA 1IKYB 3V9WA 1SH0A 3RMCA 4MK7A 4KRFA 1X9SA 2ALZA 1CXQA 3Q8RB 4FLZA 5DGAA 4LH4A 3G86A 2BANB 3AVJA 4G3IA 3ZT4A 5K14A 4DFKA 1C2PA 2X78A 4PWDA 4KFBA 4C8NA 4NZ0A 2ASJA 2V0NA 2HWHA 1S6PA 5KT7A 4J9NA 4CJTA 3GV7B 4LY7A 4DEZA 1K1QA 4TY8B 2J6TA 4CF8A 1C0UB 4YP3A 4CJWA 3KKRA 4DS5A 4DTRA 1SL2A 1VSEA 1RT1B 5C25A 2DTUA 4CFCA 1S6QA 4FLYA 2G8UA 3S3NA 1SL1A 2EC0A 4DSFA 4DU4A 4W5TA 2HNZB 3TARA 1C0TA 3H5YA 3JSMB 4NRTA 3ZSOA 1S9GA 4TQRA 3KHGA 1TKTB 1IO2A 3THVA 3OHBA 4DQIA 1J9AA 1VRTB 4J9RA 1EETA 2E9RX 4O3NA 5J2PB 2XWYA 4OL8A 3EZ5A 3ICLA 4FM0A 3DRSA 1KLMB 4F4WA 4CIFA 1XHXA 4OPJA 4FJ7A 4CEAA 1LW0B 1S9EA 1EP4B 4NLPA 2E9ZA 5I42B 5E41A 3KK3B 4HTUA 5HP1B 1RT4A 4FW2A 3K5NA 1VK0A 4NYZA 5EWFA 4K4YA 2OPPB 2HVIA 5KT4A 4M95A 4E7IA 1BIZA 5DQHA 1RT4B 1LW2A 2JEJA 2ASLA 4MQ3A 2JEIA 3M8PA 3IRXB 3CO9A 4Q8EA 1TKXA 4HUGA 3MEGB 1S1VA 5L1LA 3CDEA 5KFOA 4KHSA 4FM1A 4E89A 3JSMA 4O4RA 3SV3A 2R2UA 1ASVA 4JLHA 3OLBA 3V1OA 4GC7A 3E51A 1NK5A 2XO7A 1XR6A 3DLRA 2YKMA 1JXEA 1LWCB 3KHRA 4BE2A 1IG9A 3NAHA 4CERA 4KE5A 1KFDA 2ILYA 2P5GA 1XI1A 5KFVA 5I3UB 2B4JA 4K4WA 4RG8A 3MR2A 4DQRA 3T5HA 3PW2A 1TK5A 3OVNA 1RT2A 3Q8QB 1TP7A 3SCXA 4FJXA 2QV6A 4ED7A 4B9TA 1S1UA 1U09A 3QERA 2IM3A 3KK2A 4I7FB 1JLGA 5CYQA 5DGBA 1CZBA 1QAIA 4ZHRB 4AHRA 4Q0BB 4KTZA 3RAQA 4FCYA 1CZ9A 3UQSA 3WNGA 4DQPA 3L2RA 4DU3A 2XCAA 2WOMA 1A5XA 1RT3A 1IKWA 3CJ4A 2YHBA 1QHTA 1QUVA 1ZTTA 1S48A 3G0ZA 2ZD1A 2AX0A 3E01A 5KG6A 4CJUA 2OPRB 4N41A 4XPCA 1VRUB 2ATLA 4R5PB 4ECRA 4I2PB 3CDWA 4M42A 2HHTA 2VA2A 4J9OA 3F9KA 2E6MA 1IKVA 2VWKA 3OYFA 1UA1A 3GILA 1MMLA 1CSJA 4CHZA 2R2SA 2C22A 4RW6A 3H59A 4YMEA 4J9LA 1C1BA 3K2PA 4AHSA 1R0AA 1ZBLA 4ECWA 4TQSA 2GIRA 3VQ7A 3N6NA 3K5LA 3TQ1A 1NJWA 3OS2A 1TK0A 4I9QA 4F50A 3MEEA 3NF9A 2JGUA 3PJWA 1WNSA 3QLHA 1UAXA 3C6UB 3LP0B 2E6LA 3AA5X 1K6YA 4J2BA 1RNHA 3LP2B 1L3VA 1N48A 3FSIA 4RW9B 3OYAA 1SL0A 5KFWA 4ZTFA 3I5CA 3NH2A 2GIQA 2E9TA 5CZ2A 4ZVEA 3ZT1A 1NOZA 3DOLA 2KTQA 1NHVA 5JUMA 4MIBA 2XY7A 3FDSA 2RF2B 2OPRA 1JLQB 3V4IA 2W8KA 3KLIA 3SJJA 3I0RB 2ZKUA 2R2TA 5EDWA 1SV5A 5KT6A 5FRNA 1ZBUA 4HYKA 3PHEA 4CF2A 3CDUA 1EETB 3TANA 3V6JA 3D45A 2OPSB 3OY9A 4Y2CA 3MAQA 3HVAA 4B9MA 3HHKA 1LW2B 4EYIB 4R8UA 5F8GA 4TYAA 4JV2A 4FLTA 2GBZA 3RR7A 3VQQA 2XY6A 1TV6A 1RTJA 3DDKA 3AO3A 4ED6A 2V4QA 4O0JA 1NK4A 2HHUA 2FVPA 1N6QB 3S3MA 3OSNA 1C1CA 3KTQA 4IH6A 4F3TA 1I39A 5KT2A 3V1RA 3SUNA 2XC9A 4IG0B 4R0EA 5KTQA 5C24B 3KLGA 4QW9A 1J54A 4KO0A 5CZ1A 3LWLA 1LV5A 1SUQB 4H4OA 2VWJA 3RBEA 2IGIA 4DSJA 4LQ9A 3NFAA 1D9DA 3RB3A 2YNFA 4IFVA 4O4GB 4B8CA 4CJ4A 4ECTA 3JYTB 4DG1A 4TYBA 1RT1A 1S6QB 2IM1A 4CGHA 5KFQA 1TAQA 3TAGA 1T94A 1HPZB 2DY4A 2OPQB 4J2DA 4ID5A 1S97A 1RAJA 2W9BB 1SV5B 1TKDA 4BWJA 3NGYA 3RMDA 4OLBA 3NF8A 4CJSA 4CEFA 1A5VA 1JLCA 4GW6A 3LP3A 3CFRA 4M45A 3IGNA 1W9HA 1WSHA 3DI6A 3PJXA 3QGIA 3BSAA 3LDSA 1KSPA 4M3UA 4DLGA 4G1QB 3GIIA 4JV1A 3OJSA 3AVAA 1HYSA 4ZP7A 3D0PA 4KI6A 4AHUA 1JIHA 2FVCA 4FK4A 3SI8A 3L2UA 3DMJA 4EO6A 1NNDA 3L2VA 2F8TA 5KFFA 3GIKA 2HWIA 2CKWA 3OLAA 4AHCA 2G8KA 3AO2A 1VRUA 2RN2A 1HQEA 1RT6B 3KLHA 3ZT2A 4CIGA 3BREA 3CM5A 3SNNA 3SV4A 1R0AB 3DM2B 3GYNA 1IKXA 3OSPA 2AGQA 1WLJA 3A2FA 2DFFA 4H54A 4FLWA 3OS0A 3DLGA 3UR0A 1FK9B 2XY8A 4WFYA 4BDYA 1JXLA 3PW7A 3MR5A 1YT3A 3AVIA 1QSSA 4B9VA 2KZMA 1S1UB 2JEFA 4CJFA 3LZJA 3C95A 4ELTA 5F8IA 5KFJA 1DLOA 4N5SA 1RDAA 3VA0A 4F4ZA 4ZTJA 1NK8A 2GUIA 3DLKA 4MKBA 1FKPB 3NGIA 1HARA 3JYTA 1RBSA 2VG6B 1L3SA 4O55A 4PY5A 2GV9A 4HHTA 1UOCA 3PV8A 3ITHB 3HVRA 1B92A 5KFHA 1REVA 2AGOA 4MK8A 2WRMA 1Q9XA 1O1WA 3ISNC 4FJNA 1EP4A 2QE5A 3OYMA 4PA1A 1WAJA 4NRUA 4ZP8A 4CEQA 4CGFA 4MK9A 2PZSA 4J2EA 1T03B 2KFZA 4KB0A 3ITHA 3DRSB 3AA3A 2YV0X 1RT2B 2X74A 1X9WA 3QEPA 4FJ9A 2W9CA 3BDPA 1JL1A 4QWDA 5KG0A 4EBDA 1WN7A 4NLYA 5EWEA 1JLCB 1RBVA 1RBTA 3KMSA 4DL3A 1JL2A 2UVVA 3VQ6A 3QINA 4DL7A 3QO9B 4AHTA 4IDKB 2I5JB 4RW7B 5DK5A 2IM0A 4RW7A 2W9CB 1ZYQA 1FKOB 3HVTB 4CE9A 3MFHA 3DLEA 4ECXA 4FJIA 4CF1A 2HHQA 2XCPA 4CFDA 2YKMB 3NL0A 3NGZA 3G6VA 4OVLA 1QTMA 4TY8A 2AQ4A 3ZSWA 1MU2B 4HKQA 3K5MA 4TLRA 3MXMA 4J9SA 5KG7A 3OL9A 4DQQA 3DYAB 1TKXB 2O4IA 1N4LA 1D5AA 5F9LA 4O44B 2DFEA 3HP9A 4CGIA 2X6NA 1REVB 2YNIB 3O4QA 3VA3A 4CFAA 4XPEA 1HQUA 1D8YA 1ZBHA 1HNVA 1TL3B 2A1RA 2RPIA 4HUEA 5KFEA 1HJRA 1DLOB 4RU9A 3DRRA 4Y2AA 1XR7A 2IAJA 1FKPA 4IR1A 4R8UB 4FJGA 3CFOA 3T3FA 4EEYA 3CJ5A 1T05B 3TR8A 3AO1A 1WSGA 3G6XA 1OS5A 5HRRA 3SI6A 3DI6B 1KLNA 5KFTA 2RKIB 4DTOA 5F8HA 3BQ1A 2Y1JA 1UWBB 3HSTB 2FLNA 4K4XA 4Z4CA 3HKWA 2RF2A 1ZTWA 2XI3A 1WSIA 2FBTA 4OKJA 3M8PB 1NK0A 5C42A 3CJ2A 3WNEA 4RUCA 4XO0A 4DFJA 2IC3A 5KFMA 3HYFA 5HROB 4U7CA 4QW8A 1NK6A 2I1RA 2QXFA 4KHRA 4CGGA 1ZBFA 2D0BA 3ZT3A 4O3PA 1DTQB 3BGRB 3K5OA 1BQNA 3AA2A 4ELVA 2D3ZA
chains in the Genus database with same CATH superfamily
4N76A 2QTWA 4EMDA 3BF3A 2Z1GA 5DDPC 3CJ3A 2ADCA 2XMMA 3K8WA 3ILJA 2XNQA 1LAVA 4M3XA 5AE2A 3AVNA 4UOCA 1RDCA 2QZ8A 4CTAB 3KIOA 4GKJK 1NGGA 3WUHA 5TKYA 2MGZB 2DR9A 2UVUA 1U6ZA 1QSYA 3QT8A 4Y3CA 4EO8A 3DOKA 3W66A 3VQ4A 1EARA 1FXXA 3HZEA 2DIVA 4AD6A 2XMJA 2QL7B 5AQMA 3K9KA 5HMWA 2R7XA 1ZM3A 1Z1ZA 2R8GA 4DV5K 4BR2A 2HVDA 2R8IA 4YB1P 4BDZA 4DMZA 4UUXA 4F0HA 3TI0A 4H5RA 1NGJA 2O5DA 1CLQA 3DLJA 4CW7B 4A8XA 3H20A 2LSNA 1KHWA 4GMJB 2ITGA 5HI7A 1VHXA 4NASA 5KFRA 4YDDB 5AQTA 5LMUK 1WKLA 1D3WA 3V4IB 1T03A 2J6UA 3KVGA 1V3RA 1F3VA 1JLFA 4M3RA 3H2LA 3N01A 1B9FA 1ACMB 4O5FA 1TL5A 3OUYB 4KR0B 1MMDA 1WC0A 2R8JA 3X1LB 1LWEB 3MCPA 2M88A 5E3PA 2FXUA 1H2UX 1X5OA 1UL3A 1YJ9S 3MMAA 3HHLC 2XI2A 3U7JA 4Y2IA 3GCWP 1VQLS 1JLBB 1PJ6A 1XQSC 3GV5B 1RA6A 4ANDA 3CD0A 2MLYA 3U1LA 4LFCF 2V9WA 1H98A 2VV5A 5AQVA 3JAMU 4IOCQ 4A8SA 3VESA 2OMOA 1HYVA 3E9PA 4YOVA 5U47A 2DR7A 1RLCL 2E1YA 3OYLA 3DOMB 4KO0B 4NZ6A 4RW4A 1XBWA 4USWA 1KVKA 2NYIA 3UVJB 4O5BA 1HWKA 3EYZA 2GWKA 4ZIVA 3N6LA 3UW1A 1LKZA 1WORA 2MY7A 4IRKA 4DL5A 4BGBA 4KHYA 1VS3A 3C66A 2CJKA 3T5KA 1YJNS 3PFOA 2FBXA 4E7LA 2PN6A 4UT4A 4PXBA 1WC1A 4E7JA 3R5CA 4Y1CA 1YK9A 5AR0A 1DJ0A 2POKA 2EKNA 5ETTA 2YH1A 2RDIA 1DTQA 4LFBF 1UVLA 4RUHA 5F8NA 1J5EF 3HM9A 2ASMA 4KGVB 3BN4A 3ZCMA 5GAEI 4V19S 2C2EA 2I5JA 3GU0A 5KT5A 2XSJB 2XSJA 2P1JA 5IS2A 4JI7F 2D0OA 2YJEA 2VQFJ 4CD3A 3VZIA 4LF8F 3HMJG 2YNHB 3WQTA 1FNXH 3MCSA 3O8WA 3SPZA 1S6PB 2HNDA 4H4OB 3H5SA 3CC7S 3H25A 3QNOA 1C0FA 4H0TB 1X4GA 2VGNA 1S1TB 1Z2ZA 3QDKA 3VQ8A 4K42A 3EPGA 4ZHRA 4MAKA 1H2VZ 4PYDA 2HEKA 3LPUA 5ETVA 2HURA 3WQPA 4Q44A 3BUZB 2UXDK 2MZRA 4NA3A 3FKBA 4KHWA 1PAEX 2VG5B 1DHMA 1U1RA 3SSQA 3NF6A 4DTSA 4YR0A 2BQ3A 1BA1A 4IG3B 4EK2A 1WOOA 2QG9B 3IBFB 2FPHX 4B08A 3QJJA 3EE9A 1FJGK 3DLBA 3L4BC 5IFMA 1JJCB 1B99A 4BGAA 1OQ6A 4K8RA 2WW8A 4B3SK 2VGMA 4OZJA 2UXDF 3NMAA 2AJQA 1NAQA 2FBVA 2X3DA 2C42A 3MHYA 3FC9A 5C2CA 3BKUA 3Q8PB 4JI6J 3H45C 2GW8A 3DRPB 5D78A 2C2DA 5E84A 4M41A 3ENOA 2I9SA 2ASDA 9RUBA 3I56S 2ZM6F 2Y1RI 2DNZA 1RXOB 2KB2A 1HNVB 4ERDA 2RDDA 2C3OA 3FFIB 1WTFA 4XEIA 2HSTA 3G6ES 1NZ8A 2HGMA 2QWNA 1NXIA 3SMSA 3R5GA 1H2TZ 2FGOA 1VSIA 3I4HX 3QSYB 2WSCC 2QYGA 6AT1B 3E2EA 1HWLA 1VQNN 3M6VA 1J5EK 1XR5A 4HCBA 2OSQA 3HOSA 1JNZB 3N6MA 2XZTB 3IC1A 1IJEB 2H5JB 4C8LA 4X4SA 3DU6A 2EG1A 5GAHP 1R27B 2HLTA 3QZ7A 2MXYA 1WEXA 2P9SA 1IVZA 4LFCJ 2W7PA 2DCUB 4Z94A 4PG5A 1U04A 4DR7K 1Q86O 2H4YB 2CNKB 2QL9B 1RKIA 1K1SA 4KRWA 2DHGA 3HZ6A 3ENWA 5JXSA 3AOCA 4FYYB 4B1WB 9ATCB 1BQXA 3MPWA 1YLXA 3UD4P 1S0MA 1S4FA 1BQMA 3TAPA 1MG7A 2A42A 4CZFA 4E1JA 1NJXA 1JNRB 4JKBA 2KQ2A 3VGLA 5KGWA 4WWSA 3NBPB 2VPZB 3BGRA 4CWBA 1OH6A 2KKHA 4UZCA 3KWMA 2BJEA 5AQUA 2VFVA 4B9SA 3QBWA 4CM2A 1S5ZA 1NGFA 2HHSA 4H5NA 2E4LA 1IKVB 2DO0A 3BYRA 1NGDA 4IDKA 2XMTA 4N47A 3PIOL 3T9ZA 4CZMA 2NLXA 5AQHA 3UN5A 2C28A 3M8YA 2IBOA 3NCRA 4C8MA 1RHRB 4OX7A 4BRHA 3Q8YA 3O08A 5HO4A 2HYIB 3R3LA 3O9TA 4BRKA 3CM6A 3W5XA 2ZHOA 3G2XA 3KK2B 3V5RA 1VYAA 2XMAA 4FYDA 3H3NO 1LOUA 4DF4A 4ELUA 5LMUJ 4ECQA 2QWOA 1HBOB 1AUSL 3H4DA 4G1PA 3G9CA 1RTDA 2AYEA 2XWXA 3PW4A 1U1NA 1YJVA 2NYHA 1IR1A 2IOCA 2PA3A 5GVQA 1RWXB 1VQPS 2KLAA 3CT9A 2FVRA 2AKWB 2JHEA 4M5KA 4FS1A 4F3OA 4BE0A 4ZDNA 1U1LA 1XNQJ 2FVQA 3HLUA 5H9EK 3KLEB 3HK2A 4OIXA 5JS2A 1RZMA 1UCNA 3Q2SC 1WHVA 4WYWA 2HHVA 4KREA 2ZQBA 2IVPA 3CCZA 3ZLJA 2H5IB 4ID8A 4LFBJ 4RNMA 3V2UC 2AA4A 3MEGA 3GJSB 1I94F 1OJ4A 2G9OA 3CIMA 1U1OA 5CCMA 1UPMB 2FSKA 2ZH8A 1P6TA 2FBYA 4ED8A 2M4MA 4DTMA 3W61A 4BG8A 1RWVB 5BYQA 1F2GA 3LDQA 3V6DA 3KFWX 2CZVC 4YY3F 2G8IA 4IO9Q 3HSGA 4KHQA 3AQPA 4Z4FA 5A0YB 2ZBQA 3VQAA 4J2AA 5K5MA 2VICA 3MEDB 4CI0B 2HMPA 2R9LA 2VL1A 1NWKA 4HTLA 3CD6S 4K7QA 5K8MA 4G1QA 1GX6A 4URSA 4LFAK 2B8QA 3QESA 2BE2B 2MSSA 3M8RA 4JV5F 1E6YA 3C6TA 3KLFA 4DWIA 3EE8A 2D5RA 5EX3A 2E44A 2VBYA 4K4SA 1SIWB 1YDLA 4ZN3A 2JLGA 1KCFA 3GIMA 3M2UB 2XS2A 1SBRA 5C2FA 1NPKA 3ILIA 4J9UE 2UXBF 4DPUA 1EQYA 3DGVA 1NK9A 2F96A 2Y9HA 1NKEA 3CHWA 4FWOA 1SQGA 2QLBB 2VA3A 4BRGA 4FJ5A 4DR1K 2EVZA 3DRPA 4NPOA 2ZE2B 2Y0BB 3KMQA 2RE2A 3SUPA 3A13A 2ZVSA 1HJOA 3MEEB 4LJMA 3NGTA 4GKKF 4ZPTR 3EM1A 1DTTB 3R7BB 2RQCA 3BM7A 4EI2A 4WYBA 2VONA 4CESA 4ENOA 4CK3A 4HT5A 5K9FA 5J1EB 4QWEA 2GZOA 3ADAC 5L9XA 1Q79A 2HS4A 4ILGB 4K0KK 4FVCA 5H1SV 3LTOA 1HPZA 2E1MC 4RLEA 3DKDA 2FJVA 2FZCB 1RDRA 3OTOK 3AO5A 3O3GA 3QIPA 5J2QA 4PZVA 4CHNA 3D3CJ 5LM7E 4DL2A 3OD2A 4LBPA 3VGKA 1HD1A 1A6LA 5FROA 1G7CB 4DR6F 5A6PA 2AYGA 4FF1A 1RT5A 1HR0J 1VHIA 1T6CA 3WNFA 1SXLA 5KFYA 2ZM6J 2XYHB 2ROPA 4NLRA 3CVKA 3TZWA 7FD1A 5C42B 2QM1A 4C1NI 1EKEA 5JLFA 3CTRA 3SQGA 2A40A 4URGA 3B6BA 4IRDA 4GNIA 3PX0A 2HMIA 2J0XA 1VAZA 2HMIB 3G82A 1YVUA 1U8SA 3DLHA 3G82B 1C1BB 3AHPA 3AH6A 4FKXA 1WD6A 4CK1A 4L3QA 4WPAA 3BR9A 1TYQB 3HHNB 3ZSQA 4NA1A 1O13A 2JLEA 2XS5A 1WHWA 1VQKS 3MM7A 3HM8A 2R7WA 4BC9A 3L2WA 4YR3A 1S0NA 1Z25A 2RQMA 1XNQF 4JS5A 4M5HA 2V4JB 1RWKB 4FWNA 3VEVA 4FF2A 1R89A 3UD3P 2F8EX 4YDUA 2X1FA 4DPOA 2KRBA 3QIPB 2Q3PA 1K73O 5GIPA 4IKAA 2IBKA 1FEEA 4NB4A 2PSZA 1EAYC 3PW5A 3KWIA 1WSFA 2CJ9A 5HP1A 3VEOA 1KQFB 4EHUA 2K7KA 2RQ4A 1JLFB 2EXUA 3L7PA 4BDPA 3OA9A 3I5BA 3QRPA 3IMXA 1RTHB 3RGIA 4BACA 4LF2A 3H4BA 1FVQA 4JYAF 1RT3B 4DR7F 2AX1A 4O3OA 3WHIA 1HBOA 3SQ0A 1S1XA 3E66A 3VAIA 3HJVA 3QJPA 1QE1B 3OFHA 2MJNA 4CYUA 1EHWA 2P9KB 2O66A 1OVYA 4WYLA 2NSCA 2BH1A 1JMTA 4O3QA 5LJVA 4J9PA 3MUTP 3DC2A 2AJFE 4HACB 1W25A 4CJQA 1HNZK 1RAAB 2CXEA 2HBRB 5DS7A 1WB9A 1U25A 1G99A 4ZVPB 1ZS6A 3VQPA 3TVKA 3MR3A 1SJ4P 1YJ9N 3MMBB 4OI4A 1SH3A 2QFIA 1X5SA 2RDJA 5CYMA 4K4TA 4FS2A 1IKXB 1BC6A 5K8OA 1HMVA 2P9LB 2HBQB 2JFKA 3VTHA 5FPDA 4CM0A 2RT3A 1YJRA 2PGCA 1X60A 5DM7Q 4MDAA 3SYZA 1R8BA 5DLGA 1K8AT 4DUTA 4ALZA 1NK7A 4F26A 4O8UA 3V6HA 2E5GA 4PQUA 1X9MA 5KG5A 5T14A 3THYA 4H8KA 2DPIA 3NE6A 1PG5B 2LA4A 2CJQA 1GOCA 3NRBA 3IN5A 1LWCA 2Z1JA 2V4RA 2V2VA 1S72S 2W8LA 4IR9A 4Z0UA 5HRNA 2EHGA 3OYNA 4G9ZA 4DF8A 4DUYF 1Q9YA 5CE3A 5F9NA 1SB6A 5DG7A 3V1QA 1J2VA 1FA0A 4CRJA 4QWCA 3PW0A 1KC8O 3WEEA 1T7PA 4NLUA 1EKRA 2MLZA 2VU5A 2Q1LA 3LALA 2D69A 3VQEA 4KTWA 3LW5C 1HMVB 2HPUA 4CBXA 3R1XA 3FZFA 2O8EA 1VSFA 1FDNA 5LXRA 2FDNA 4WU2A 2NSBA 2NZ4A 3QPIA 3HPHA 2EFQA 2IPOB 7FDRA 2E1CA 3EJMA 2CQDA 4ED4A 2AMCB 1JLAB 4ZIWA 4JI6F 2QKKA 2SXLA 5DQGA 3AFGA 3FEZA 4FWSA 1W2IA 2WZ1A 4ZPBA 2I0XA 1YIJN 1VDHA 1FDBA 3G8TA 2PT0A 2R7TA 2MTLA 3NMRA 3GIRA 1FRJA 1AFIA 4FJ8A 4ID5B 1EZZB 3BR8A 3M2RA 3D6RA 3Q23A 3TUZC 1S10A 4URQU 2ETJA 3PJ9A 5F0XA 4BWMA 1ZPWX 2VDHA 4Q8FA 4P74A 4DR5F 5BN9A 1WEYA 3ZEUA 1Q18A 1OPIA 2FD2A 3GE1A 3MAAB 5FPNA 3IG1A 3MM9A 4ATNA 5KPRA 3JSYA 2OUGA 4U6PA 4EIAA 3BSCA 2AHOB 4I6YA 3W5YA 2HFUA 3H5UA 2HNZA 3ULDA 3CCUS 2KH9A 4BR5A 4AQYJ 4L3KA 1IG8A 2W2NP 1YXQA 3VGUA 2ZH1A 4LSLA 4JI8K 4EBCA 4U7UK 2O3DA 1FEHA 4ILLA 4HVJA 3AVGA 2KZZA 1N5YA 4O3RA 1G3OA 3THXA 1T95A 4Y6IA 2XMWA 5BN8A 4JK9A 1VGYA 1L3TA 1BHLA 4R79A 2ZH5A 1RTDB 4OYBA 1C0MA 3HD1A 4ZITA 3FE1A 4JP8A 2K7JA 3DAWA 4KRFA 1X9SA 1RBLA 4X65J 1NJIO 2MMYA 4FLZA 1N34F 4LH4A 3AVJA 5K14A 2MQLA 2HFVA 3VAFA 2NXEA 3U27A 4C8NA 4NZ0A 2HGLA 3H42A 3NY0A 2FSJA 1GAOA 1KKHA 5KT7A 2FZGB 1TL7B 5LJ5Y 4DEZA 4M7XA 1CULB 1Q78A 3ZZZA 4CF8A 1C0UB 3R2CJ 4DS5A 4W4MA 2QSFA 4U67L 2DTUA 4CFCA 1S6QA 4FLYA 4ETXA 2HF4A 3CCJN 1TUYA 4DSFA 2YX7A 2MYFA 3W9HA 2HNZB 1R8CA 3H5YA 3POTB 1TUUA 1S9GA 3W5ZA 2P6TA 4TQRA 4KHPJ 2DHXA 4CQ1A 3NNAA 1VRQC 1J9AA 2E9RX 3DHXA 2XLJA 4FJ7A 3O6WA 2LXFA 2DNMA 4DV0J 2WTUA 1S9EA 1FXRA 1XMQF 4U7UD 4CZCA 2VZ9A 1U2FA 2C2NA 2LXIA 1UEVA 1HLUA 3VEWA 3NCPA 3K5NA 3AJDA 3MX5A 2QN6B 3A3OB 1HW8A 2E8AA 2HVIA 2ZKTA 5KT4A 2J9DA 4FWMA 4LC9B 1MNEA 1RFQA 2M0GB 3HHLA 1NDLA 3TUPA 1BIZA 1LW2A 2ASLA 2DO4A 3BO3A 1NMNA 4KGKA 3ID6A 1OH8A 2KM8C 4Q8EA 3MEGB 3CDEA 5KFOA 4GKJF 4F4AA 3D4JA 1N34K 3MM6A 4WFAL 2R2UA 1NB2A 3V1OA 4XH5A 4GC7A 1X7VA 1XR6A 2YKMA 4OQJA 3TSQA 1IBLF 2DYAA 4BE2A 4JI0J 2GVZB 2YHXA 1IQZA 4DHYA 1S12A 4CERA 3H90A 1K9MO 3VZHA 2P5GA 3FVYA 4PQAA 2GX8A 2F9TA 3AOAA 3MR2A 4DQRA 3T5HA 2O8CB 3CPWM 1JK9B 1TP7A 3SCXA 1FTRA 4DQ8A 4J91A 4B9TA 2NRXA 2IM3A 1WKJA 2P9PA 5CYQA 1T9WA 1CZBA 1HNZJ 3RAQA 3JAMY 5EXWA 4DU3A 1WC5A 2WOMA 1RCOB 2OAUA 2YHBA 4QYZJ 5B08A 2N7YA 5A8WB 4ZJQA 3FR0A 1I1GA 3G0ZA 1KWMA 4N41A 3T69A 2P9GA 1IBKF 2LVWA 2NPFA 2ATLA 3EGNA 1FD8A 4L75A 3C15A 4KJIA 2LEPA 3ZTRA 4J9OA 2E6MA 2A2DA 3I55N 2VWKA 3OYFA 3DGPA 1MMLA 2UU9J 3DHWC 2W1BA 5FLXY 2HS3A 2XHWA 3N6NA 3ZTPA 3TQ1A 1TK0A 4CT8A 2V2KA 5I4MA 4WP3A 3VWSA 4A2AA 2J8SA 2JGUA 3PJWA 3OPKA 5A8RA 3VAKA 3R7SB 2HBKA 2KT2A 3EICA 3FSIA 3PRDA 1U24A 2KKZA 4RW9B 2ZJQQ 3NGSA 4BVPA 3MPDA 2Y8WA 1UW4A 2J7WA 1MA9B 2DGSA 5CZ2A 1KD1T 4AT1B 3QFUA 3DOLA 3Q22A 4MIBA 2OP5A 2HFNA 4X64J 5B09A 1CJTB 2EPIA 1CJTA 3CPWR 2R2TA 3I4PA 4FWLA 1SV5A 5KT6A 4XK8C 4CF2A 1EETB 1M1KT 4DV4F 3LDNA 2IDLA 4K43A 3HHKA 5JJBA 4DHVA 4H5WA 2VKRA 4EYIB 1FFSB 1RBAA 1X4EA 4TYAA 1VMBA 3H3OB 3S01A 2XY6A 5GAGP 1Q7YO 3DDKA 4JHDB 2DITA 3AD7C 2WBNA 3L4QA 5A8RB 2E7XA 3M8WA 2KRRA 4L73A 2JWNA 2VQFK 3S3MA 2X1AA 4YOTA 3KTQA 4IH6A 4TNOA 3HRGA 4CZGA 3FBEA 4F3TA 3NGUA 4PXEA 3IAM9 2UUCF 4ISEA 1AZSB 1IBKK 5KTQA 1ICEB 1WDTA 3CMQA 3KLGA 2CPHA 5CZ1A 2DNRA 1U7LA 1LV5A 1SUQB 1HNWJ 2C1EB 4ETZA 2I38A 2EC2A 1S76D 4LF4F 3LM2A 1DRZA 1FXDA 4X66F 2UUAJ 2XBPA 1WC3A 1S6QB 4RX6A 1HBNB 3K89A 2MKKA 5KFQA 2G2YA 2DY4A 3EUNA 4C48A 2OPQB 1PSDA 4DPYA 4DJBA 3ZETA 1N5VA 3QFWA 1TKDA 4BWJA 1X4DA 4YHHF 3NF8A 5H9FK 1A5VA 2RMLA 4M45A 1AB8A 3LDSA 3SK3A 2EFNA 4USKA 1ZA2B 4DLGA 4HHHA 4JV1A 3AVAA 1WSVA 3C14B 4I6AA 4BRCA 1JIHA 5H9FJ 3SI8A 3ATVA 3L2UA 1OYEA 1O8BA 3EGZA 4JI2J 2OHDA 1OWXA 2LDIA 3HSCA 4C0HA 1NNDA 3NS7B 3JXUA 1RHKB 1N36K 4C0OC 5KFFA 1HI0P 3MCMA 3WIVA 5HL7L 1HQEA 4H5TA 2KVIA 3O4WA 3J80O 4QIEA 1R0AB 2EI5A 3GYNA 1S7HA 1IKXA 1DBDA 1WLJA 4FLWA 3OS0A 5L39A 3UR0A 2B9YA 1UZDA 4HVZA 3MM6B 3P4UB 5HVHA 1WHXA 3PW7A 3OR1B 1YT3A 4B9VA 3JB9k 5LSRA 1S1UB 5LY3A 4YB5A 1VQSA 4DR2J 4JEPA 5K20B 2XM3A 1DLOA 2ZOFA 4F4ZA 1TL4A 1YKWA 3FK4A 1NK8A 2HFSA 1NGCA 2BM0A 3JYTA 4X4VA 5F3TA 4O55A 2AJ0A 4NYOA 1EWRA 1BHNA 3SAGA 2FC9A 3ITHB 2AGOA 1HBMA 4MK8A 2WRMA 1Q9XA 2ZH7A 1O1WA 2QE5A 3KUHA 1NDCA 4ZP8A 5AZJB 4CGFA 2KFZA 3DRSB 3AA3A 1YZ6A 3J80U 1VQYA 1RT2B 2PEHA 1X9WA 4QS7A 1H0HB 2QWRA 3BDPA 2E5LJ 3KMSA 3Q8VA 4HEA9 4LF6J 3P5BP 1VBXA 2UVVA 4DL7A 3QO9B 3N9UC 1EJ7L 4X4RA 4JYAK 3OTEA 1WF1A 3CCRS 2NXUA 1KVIA 2HHQA 2XCPA 5LMNJ 3DLLQ 1QTMA 3SBGA 3K5MA 4FWKA 4YN3B 2NRRA 3OL9A 3I87A 2NRZA 4A57A 5IT9U 3TNVA 4YUDA 5IT0A 1NPRA 2DFEA 4X66K 4GO7X 1WWHA 4CGIA 4C11A 2X6NA 4LRAA 3O4QA 4RTFD 4DR4K 1D8YA 3F9MA 1HNVA 3NXZA 2J9EA 3CCVN 1I51B 4CLTA 2LDYA 4JI2K 4NYPA 1XR7A 2DNNA 1SC1B 1FKPA 4JI5F 2AP6A 2PMHA 1RGIA 3D0HE 3AAPA 3EWGA 1HQ2A 2HRUA 4FJGA 3CFOA 2A6AA 1T05B 4IOAL 3AO1A 4I68A 2F9JA 1YJWS 5HRRA 3SI6A 1GLAG 4P52A 2C3YA 3HI0A 3CCVS 4DV1J 1B0VA 2GMJA 3M2VB 3HKWA 1AT1B 2RF2A 2XI3A 1WSIA 3SQGB 1PBAA 3TA1A 4W90B 2BE9B 5C42A 2RILA 2CDRB 1F3FA 4RUCA 1LK7A 4XO0A 5KFMA 2DNQA 4C2MA 3MMAB 5JVHL 5B0GA 3ZT3A 3BGRB 1IJJA 5C2DA 5DZ7A 1UVKA 2W6KA 1SKWA 3ZNJ1 3NKYA 1I94K 4M5MA 1GX5A 2ZH4A 5HROA 4WCEL 3OR2B 3J7ZT 3N4WA 3QIDA 1D09B 3RSEA 1A7GE 3RSEB 3QLHB 3W0LA 1D4XA 1KVCA 4I56A 4MLEA 3L2QA 4AH9A 2ZDPA 5DQIA 5HBMB 3MN9A 4CEEA 1BOTO 4GY2B 1JJHA 2XRIA 5KFLA 4M94A 3BDEA 1S5JA 3HF5A 2PI4A 3NMUA 4NLOA 4E98A 3K0SA 1WKKA 3A8EA 3E01B 3O1LA 1JJ4A 3O9SA 3UFCX 3T5JA 3EO3A 2B5JB 4O4GA 4E0DA 2XLKA 4FF4A 1TVRA 3MM8B 3AV9A 2W01A 3NWGA 1YI2S 5DJBA 3K17A 2HS0A 4A8OA 3DWLA 3HPGA 4ISFA 4USIA 3PM9A 4ICLA 4BREA 1RISA 2BDPA 1JWWA 4UW2A 1NDPA 3DM2A 3L9ZA 3V4MA 3OYHA 2V2ZA 4EP4A 5E3RA 4DN0A 4AM6A 4RNOA 1SKSA 3H6EA 1IWAA 1U8WA 3O80A 4A46A 1XMOF 4RBVA 2FJWA 4JV5K 1JX4A 1OY8A 3D2FA 1YQHA 1CQMA 2LQ9A 4DQSA 4LFAF 3W63A 1QQNA 1NHUA 3PYGA 5M2RA 2Y1IA 3T41A 3O2IA 3M1VA 1HA1A 2MKYA 3QEXA 3T19A 2V6AA 3WBZA 2MKIA 1S6OA 2HNDB 4K0KJ 1SPBP 1ZM4A 4IZ9A 2M70A 3OJUA 2RHQB 5AT1B 3CCMN 3CIPA 4IO9L 3H1VX 5HVFA 1U1QA 4KV8B 4WIQA 2BR0A 3D28A 1W26A 2AYMA 3PYFA 3T5LA 2WB1D 5J2NA 1D1UA 1YVNA 2RUSA 2ASOA 2G8WA 3KJVA 1QE1A 4UUWA 3OL6A 4B3TF 4GVLA 1YITN 4J9QA 2JC0A 1G15A 2GHVC 1FF2A 4CHPA 1KVAA 3HL8A 3WT0A 1KEKA 1AFJA 4FVUA 1QVFM 3SMZA 2HVHA 1TGOA 4RBUA 4ZCLA 2UU9K 1QS4A 1RWMB 2P51A 4JI5J 3PX4A 4WQ5C 4O3SA 3C2PA 2DNPA 4FJJA 4C3LA 3SFUA 5JMVA 5B0FA 4DUZJ 1SS6A 1XHZA 5AQWA 2DEJA 5L1KA 1LXNA 2A6MA 4KBIA 3M6GA 3OUYA 5HQLA 4X4NA 2J0WA 4JOUA 4GVEA 5BYSA 4C8YA 3ASMA 2FHKA 3EL2A 2GTDA 2QA4G 1HYZA 1N33J 2P9PB 4M8LA 3AVCA 5C12A 3ZYYX 2P9EA 4P2XA 2OZMA 2HQGA 3OTOF 3SXLA 4HHUA 2UUWA 3CJ9A 3CJTA 1FJGF 2J7UA 2NZCA 4C9DA 4BRFA 2BQRA 4LIWA 4X62J 4JUZA 2W2OP 1XUPO 4MIWA 5AZIA 4CIEA 3TX8A 3B6PA 2HNYA 1CJVA 4NWBA 3CC2N 1S1WA 2E7WA 4FLUA 1VQ6N 2HF3A 4ES3A 4KBOA 2O4GA 3NG8A 3O9UA 1M5SA 3Q89A 5DZ6A 5CD4A 4H0OA 5A6WA 3AXMA 2CPZA 4PKHA 3HI9A 5KFCA 4M5GA 5EOYA 2YKAA 3ZSRA 1BUXA 1P1LA 2A1SA 3SUQA 3FZ2A 4F8RA 1RYRA 1NH8A 3DJCA 3TJ8A 4I67A 4JD2A 3C8YA 3I55S 3MM5A 2PFUA 3RAXA 2VUGA 1DEJA 3HX9A 1BXNA 2HHWA 2PY5A 1SIZA 3SAHA 4Z4GA 1NKBA 4OX9K 2KYXA 1C1CB 3RB4A 4ZPWR 4DN9A 2P9KA 4IEIA 1A0OB 2Z30B 3RW7A 3BP8A 5F3ZA 2XY5A 2D41A 2VIHA 4U67Q 4WFNL 4KHPF 1JLEB 4P75A 2R2RA 1XQIA 4ZJLA 3PDNA 4CZEA 3EY1A 2V67A 3MR6A 4ED1A 1LWFB 4JK8A 4LFBK 4C6AA 2PD1A 2JFDA 3M6UA 3KLVA 1AW0A 4DTXA 2BOPA 4KI4A 2NREA 3QT6A 1QQMA 5HRSA 2CQ2A 3BZKA 2IMOA 2P9SB 3W3SA 3CD6N 5KFSA 2F9DA 3W2WB 4XDCA 1KFSA 4UY8T 1F9HA 5F1XA 5GAHI 1N5SA 1GXLA 1APSA 2R8HA 4OKEA 4WZQA 2IRXA 2HSEB 4G65A 4L76A 4EFHA 3GBTA 3KNGA 1HNIA 1RHUB 3M3ZA 2X1GA 1LK5A 1LWEA 4NYNA 3VENA 1AUDA 1S1XB 4EWTA 8AT1B 1V9OA 3R6LB 3IR5B 3EPIA 5KFBA 3A8KA 3F41A 1KBRA 2H48B 3THPA 2UXCJ 3BN7A 3HSDA 3R8EA 1YJUA 3AA4A 1NGBA 2YI1A 1VSKA 5AQQA 5IZHA 2RJZA 4LR9A 2XSFA 2IJNA 2BTFA 3DYAA 1FI4A 4A61A 3AY9A 2DBBA 3P3DA 2AJ4A 1Y10A 3M32B 1CC8A 1LOTB 3HULA 4FXDA 2DEIA 3DMJB 1URRA 1RA7A 4CEBA 1HD0A 3HVTA 2MY8A 5BREA 4AF1A 5D4LA 4IKFA 1GTHA 3ENVA 1BISA 4CCHA 1S59A 2V51B 2VBWA 1RU1A 3L8BA 4B1YB 1AYEA 5SUHA 1T9YA 1NSAA 2PA8D 4ZPDA 1U48A 2UV8A 1MDUB 1RWUA 2DGVA 1YF5L 5C25B 2B7BB 4ZPCA 3SQOP 4CJRA 2XMKA 3MR7A 5CYQB 3J7A1 5AQJA 2VG5A 3VQ5A 3IS9A 1TUWA 3HHLD 4JI0F 2CG8A 3QNNA 3KZBA 1T9XA 2IAJB 2H9ZA 1FJEB 4IOBA 3A4TA 1N54B 1WC6A 3T1AA 4M5IA 4CFBA 2BJ8A 4CO0A 2LU2A 4E8UA 2PI5A 3GYGA 3U3GA 4MYTA 3M32A 2DB1A 3GQCA 4P9SA 4OZ2A 1HX1A 5HMYA 2WC9A 4OI6A 3UKUB 3HP6A 4CJLA 2CGJA 3CULA 4JV5J 2WVEA 4WP8A 1RWWB 3CG7A 1HKAA 2V69A 2AEFA 4TN2A 1U4BA 3KUEA 2YPZA 2DR6A 1S1VB 1Y00A 2D74B 3I8DA 4KHMA 1IXKA 3KHLA 3SDEA 2IVFB 4B1ZA 4CEZA 4OZ3A 4IFYB 3GR0A 4H03B 4QZVB 4B17A 3PTWA 3I5AA 1N6QA 4USMA 3K8VA 3GSDA 4LF9J 2R7UA 4MO4A 3I0RA 2MKCA 1NJZA 3CDBA 4USVA 3OL8A 1N32F 1VSLA 5B0AA 2YH0A 3VCDA 1XNQK 5IV3A 2CQBA 2ZHAA 1J5OB 4R0JA 3QMQA 1N36J 2F4FA 2Y3YA 1EQ0A 2B6AA 5ADZA 3GFXA 5KG1A 2ZF5O 5EX5A 3CYMA 2VB6A 4HI2A 2M2BA 2GAGC 1S9GB 5AQKA 1LXJA 3BJYA 3L4IA 2QIFA 4DU7A 2PAVA 2DY9A 3E3XA 1BGXT 3L0QA 4BRLA 4KHUA 2IRUA 1IBMJ 2GWJA 1RWPB 2AV5A 3CEDA 4NYFA 5EGYA 3MECA 4WFBL 2BANA 4JI6K 2JEGA 4ZS6A 3HPOA 1CJUA 1XMBA 3FQLA 5MLCQ 3FFIA 5GADU 1K44A 4OHWA 1RT6A 3M8ZA 3G71N 3OL7A 5HAOA 5EWGA 4F3QA 1KONA 3UDCA 2QI2A 4KH6A 4DCPB 3UR3C 4FJHA 1KRPA 1EQMA 3TWHA 2V7ZA 4WBFA 1DTTA 3KD5E 4DV5F 2J0QD 3M6WA 4CJEA 2D0AA 4ZVHA 5A2QU 3VEYA 1K9MT 3D68A 1NMEB 3TUJC 4NLXA 3RVCA 5D0GA 1IBMK 4MIAA 3Q0AA 4OLPA 4IH7A 1WOQA 4I7FA 1SC6A 4B9QA 4CJVA 1HBNA 1KVJA 1RT7A 1HHSA 2EFPA 2CAJA 3SFGA 2W4DA 5HSPA 3T1HJ 2WONB 1GMWD 5AXNA 2P5OA 4P73A 4C8OA 2G0JA 4L6V3 3SCKE 2RU3A 2E5JA 3OYGA 1FWLA 3LGHA 4GVBA 4HDGA 2EFGA 3TTCA 1R3NA 4DMNA 3KK1A 1WOSA 5D15A 3ULHA 3UPFA 8RUCA 2IHR1 4I69A 1XNRJ 3PZPA 2BJ9A 4CF9A 2MZJA 3U9ZA 1F2HA 3CCQS 2DNGA 1HR0F 4PKIA 5M1QA 1V5VA 2G2OA 3CE8A 5MLCV 5AQXA 3ETOA 2K3IA 2BE2A 1RTJB 1FO1A 1DARA 1PKUA 2Q6CA 3KLEA 1K0TA 2ZUAA 3OYIA 5ETOA 3KOAA 2GCFA 4EBEA 4Z4EA 3FNNA 1GOAA 4JI2F 2CH6A 4B8AB 5KG4A 1ZZFA 1R59O 4B9NA 1JKHB 1ZAVA 2P9UA 1VC5A 2HQ3A 1YI2N 5KPTA 4DBQA 4DR3J 4CZJA 4V19J 2PC6A 1YJTA 1RCHA 2G13A 1WAFA 4FP9A 3FZMA 3RB0A 3EX7B 2ZVIA 2J9CA 5J2MA 4F7VA 2IDOA 4WK1A 2AGPA 1X4HA 3U4LA 3QEIA 4YOWA 1U0HA 3BPSP 2U1AA 1KD1O 4N77A 1WI8A 3M8QB 1EO1A 1HQUB 3EXYA 3NGDA 5KFIA 1YBUA 3WXLA 5AE3A 2R8KA 4OLAA 2ZJPQ 3V9SA 2KI2A 4IUFA 4MKYA 1JLQA 2E20A 2W2MP 3ZSYA 3A12A 1GQEA 1RWOB 3JAMO 2Y8YA 4CZKA 3LO3A 2YVSA 1CC7A 3O44A 5GADI 1S0OA 5J1PA 3BEXA 3ZZPA 1TQLA 1ZM9A 1KLMA 4FXWA 5D0RA 3TAMA 3H08A 4JKHA 2WFBA 2FJBB 2OEJA 3HT3A 3Q2TC 2IMWP 3BZCA 4LFCK 3CCLS 4CF0A 3L3CA 1VQOS 1HWIA 4ZPAA 1ELOA 3GFYA 1VQMN 4DUYK 3TSUA 3AB2B 1S57A 1TL1A 4FZXC 1J6ZA 2QA2A 2ZITA 2BJ1A 2ZWPA 3M2UA 4CGJA 3CCSN 4XH4A 1KVBA 4KPCA 3TZZA 5ADXH 2AEMA 1KOHA 3C15B 5F8LA 2D0PA 5KRTA 2QO3A 1EWQA 4U8VA 3DRRB 4OJ1A 1BA0A 3JS6A 2IY5B 3ZX3A 3C7NA 4CHQA 2YKNB 3KUGA 1BU6O 4IYQA 2QK9A 3CCQN 4KB1A 3A3NB 3AO4A 2Q0RA 3PXGa 2UU9F 4C11B 2FJXA 3TAMB 4K25A 3MAAA 2WVBA 4NXMF 1HBMB 4XAKA 1BL3A 1Z26A 3PYDA 3AVKA 4Q45A 2DFHA 4CGDA 2QGFB 3MPYA 4JKGB 3GONA 2DGQA 2FLLA 1ATSA 1KAXA 5T7LB 5HLFB 3S9HA 1JXBA 2D7SA 1GOBA 4CJ5A 4CO5A 3KKSA 3OTBA 4DV6J 3B6OA 4KY3A 1DURA 3WXJA 1FNMA 2O8EB 3NOGA 1Y5NB 1NDKA 1EKSA 4DR5J 3V81A 2NNWA 4DPXA 1JJ2R 2ATQA 4GVMA 1Q86T 1G2EA 2G0IA 2NRWA 3CERA 4RUAA 1P27B 3U1NA 1VQ4S 3DNCA 2OH2A 2HVZA 3P45B 4FBTA 1X8DA 3WX8A 3BS9A 5K14B 2P5VA 2AJ1A 3K57A 4K4UA 3MTKA 1V4SA 1W7AA 1MWYA 3BSOA 1NZAA 1L3UA 4OHXA 2UXBK 1UTAA 4OHVA 1QAYA 1C0UA 2EKYA 3QRRA 5I9EB 1BD6A 2LQ8A 2FSNA 1Y3JA 2CDQA 2CYYA 2UUCK 5J2QB 3F73A 1IBCB 1OSCA 3EZOA 4NLGA 3LZIA 3VEXA 4K5SA 2IRYA 4H4MB 4BRIA 3NGKA 1WSJA 2GO8A 3GPAA 2OA8A 4A48A 3CC2S 2Y0SD 2O8BA 4XIUA 2O8BB 1AXQA 3M30A 2KXNB 1Q8IA 3D0IE 3D3BJ 1TKZA 2VQEJ 2W42A 4MLHA 2NLWA 5GAEP 3VOVA 2B56A 3J7YU 4DV4K 5KFGA 4JKFA 1NJYA 2ZEJA 1WF0A 1WHYA 4EYHB 5E5NA 4U9RA 3TAQA 1EIYB 2NCKL 3IM9A 4E1MA 4TSXA 4OZ1A 4JS4A 1CVJA 1OVQA 4DSIA 3A0IX 1IKYB 1SH0A 4MK7A 2ALZA 4CLSA 5LL6Z 5DGAA 3G86A 4DFKA 3N5BA 1C2PA 4CJ7A 2E7VA 3RJMB 4KFBA 2A3ZA 1CZAN 3CC7N 3NLCA 3GV7B 2VH7A 2VC1A 2ASPA 2J6TA 3CJ8A 4PWWA 1N5QA 4YP3A 4DTRA 4X4QA 2P9LA 1RT1B 1OO0B 1FERA 4CZLA 2GIFA 3AY0A 3S3NA 3TARA 1C0TA 1K8KB 4NRTA 3W2VA 1DY3A 3TTFA 1HKBA 1V5IB 1NGHA 1TKTB 2A6OA 1IO2A 1Y5IB 3NS5A 4OX6A 3MCAB 1VRTB 3KYLA 4OL8A 3ICLA 4LF8K 3D9BA 1KLMB 4F4WA 3HBTA 2F4VF 3J7YP 3I9V9 3LPYA 1EP4B 4NLPA 1FDAA 3TVZA 2MZSA 5E41A 4HTUA 3Q24A 1XERA 3HT0A 5E0OA 4NYZA 5F0WA 4K4YA 1RAEB 2GS8A 3GP9A 1VQ5N 1U0SA 4E7IA 5DQHA 2JEJA 2VF3A 2JEIA 3M8PA 3MN5A 3M5RA 4L3NA 1Q8KA 4FPIA 4HUGA 1S1VA 2GJIA 1S0VA 4JKDA 4KHSA 4FM1A 1F9FA 3W62A 2VJVA 4WQ4C 5GAHU 3O6QA 3SV3A 4USTA 1ASVA 2FHMA 3P39A 3QWPA 2F3JA 3E51A 5JVGL 1NK5A 2XO7A 3DLRA 1JXEA 1LWCB 2OFGX 3KHRA 1PIEA 2JJ4D 4WF9Q 2O8CA 1FRKA 3HFZB 1KXPA 1NJIT 2BVZA 4K4WA 3VGMA 2QLFB 3DFEA 4OX8A 2JH3A 3PG9A 3GG1A 3AQOA 1TK5A 1B70B 3OVNA 3T1YK 1RT2A 3H8YA 2B9XA 4OV1A 1U09A 1P9QC 2CIMA 1HNXK 2J8AA 2CZ9A 4I7FB 1JLGA 2MQQA 5DGBA 1QAIA 4Q0BB 4OV6A 4KTZA 3CCMS 4QR0A 4LBIA 3THWB 1OH7A 3ULEB 2RH3A 2YWKA 2XCAA 4DZDA 1A5XA 3K9JA 3J81U 3CCSS 1QZ6A 3SEOA 3PIPQ 1QUVA 1ZTTA 1CBKA 3E01A 1XMQK 1V3SA 4XPCA 5CAAA 1VRUB 2CQ4A 4LRBA 3GOIA 4R5PB 2EG2A 2Q36A 4A2BA 4ECRA 3IMQJ 3CDWA 2AEJA 3MEKA 2KO1A 3CB4A 1REGX 1CJUB 2UUCJ 1NM2A 2Z8QA 3CJQA 4QOTA 4LT6A 4CHZA 5EY4A 2DNLA 2JDJA 3H59A 3GLJA 1BO5O 1M1GA 4J9LA 3BV8A 1C1BA 1F60B 1Q53A 4WTYA 3EZWA 3CJBA 4B3SF 1KNZA 5CR4A 4ECWA 4TQSA 1RHMB 3VQ7A 2QLWA 2YWHA 4LF4J 4FYVB 4X66J 4I9QA 4F50A 3MEEA 1X31C 1QAXA 3OV7A 2GFFA 4LIRA 3T6JA 1UAXA 3QLHA 3PHTA 3PKYA 2OELA 3FBCA 2E6LA 1UZHA 1K6YA 1Q8LA 2BBEA 4ZVOB 1L3VA 2UUBF 1N48A 1SL0A 1KQKA 5KFWA 3I5CA 3NH2A 2VPWB 3R1HA 4BR7A 2WSFC 3M05A 2E9TA 3MUMP 1B7FA 2IJRA 2U2FA 2HBZB 4Y2MA 1K73T 4LF7F 1NHVA 2F7TA 4OZ5A 2RF2B 3V4IA 1VLYA 2V50A 2GA7A 4DU8A 3PLAA 2OTJN 3CDAA 1ZBUA 4BROA 1AROP 1KDNA 1Q81O 3TANA 3LH2S 3V6JA 1YBAA 1N0VC 3R3TA 4DXLA 1X4AA 2XHCA 4B9MA 3HVAA 4A8MP 1VQPN 2QRRA 3JXOA 3CSKA 1UJ4A 4R8UA 4BCAA 3O5TB 3J7YI 2JX2A 5A2QY 3G6EN 3VQQA 3M4XA 4CVNE 3HZGA 1RTJA 4C98A 2DY1A 2I8EA 5JMNA 5FIIA 1JB0C 2R42A 2NRHA 3AJ2A 2Q31A 4O0JA 3B4MA 2VPYB 3R6GB 1YTYA 1NK4A 2FVPA 3TVYA 2V7YA 3BH7B 4HLBA 1FE4A 2O67A 5G4DA 1T9UA 5FJ4A 2CPFA 2XB2D 1XC3A 2D1CA 3SUNA 2W41A 3IWXA 4HR2A 4LF6K 3FBBA 5C24B 1PAUB 4QW9A 1T6DA 1Q82O 1J54A 4KO0A 4H4OA 4QIWD 3VR1A 3RBEA 2CQ3A 3N28A 2IGIA 2ACMA 4QIGA 4RU2A 5KOWA 3VAMA 2ZH6A 4O4GB 1K8KA 4B8CA 5CCLA 4ECTA 3JYTB 1WDDA 3UDVA 4JNEA 2HRYA 5ADXA 4TYBA 1RT1A 2PE8A 3PKMA 3CUNA 1F1BB 3F44A 5HVGA 2ZOGA 2GVZA 4CGHA 2ZFHA 3CW2C 3VQTA 1TAQA 3TAGA 1T94A 2BXJA 3ZTSA 1TZ0A 2V8PA 4J2DA 2PEBA 5DO2A 2H3EB 1RAJA 4LF1A 3NGYA 4GW6A 1VQ8N 1WSHA 4QS8A 3DI6A 3CQYA 4LF7K 1KSPA 4JI7J 3HCXA 5GAGU 4HACA 4G1QB 4MT1A 5GAEU 1Y5LB 4A8QA 3TQEA 4H0VB 3OBYA 3TA0A 3OJSA 4BY9C 3IA0A 4CYUB 5HJYA 1DFDA 2OJ3A 3D0PA 3VHQA 2FVCA 2WVCA 1M5HA 4FF3A 5LJ3Y 1SVDA 4F0KA 3DMJA 4JI3J 3UD5A 2F8TA 4LFAJ 2EK6A 1BG3A 2VBXA 2DGOA 2JOQA 1C4CA 3BREA 1T11A 4KGXB 3MURP 2DR5A 3OR1A 2R7RA 4BLGA 3AARA 2DFFA 2OD4A 4H54A 2QL5B 4OYPA 1XK8A 1K47A 1FK9B 3NEKA 4WFYA 3AVIA 4H5VA 3A1YG 2GMHA 3CCES 4NI2B 4BC3A 4CJFA 5F8IA 5KFJA 5AXLA 4BRMA 1VQ9S 4JI7K 4PYAA 1H7WA 3HD2A 1WELA 1IJFB 3DLKA 4MKBA 1FKPB 4DR2K 2XO6A 2DH9A 3GMGA 4PY5A 1N8RT 2MSTA 2ZJRL 4NEZA 1B3TA 3CMAN 3BY5A 5KFHA 3BGUA 4CH1A 4TU9A 3ISNC 4M5LA 4OYMA 2I7PA 1M0SA 4CNYA 4FOEA 3OYMA 1OY6A 2J76E 1OQ3A 2QEXS 1GMUA 2B0GA 1VCTA 4D3HA 2GQ2A 4J2EA 4PEOA 4KB0A 4C8ZA 2DT9A 3W2WA 5C0YA 2YV0X 1Q8BA 4BR0A 1LNQA 1Y9OA 1E4FT 1FJGJ 1WN7A 5EWEA 4RUBA 1RBTA 1Y64A 4A62A 4LVNP 4DL3A 2RHSB 2N7CA 1FRHA 4KQZA 3QINA 1GTEA 3VGVA 1SQEA 1IQTA 3LM9A 1ZYQA 4Z7YA 1FKOB 4IJNA 3MFHA 3DLEA 5D0EA 2DNOA 4DV1F 1CS4B 4ECXA 4CF1A 1IBLK 4K2JA 2KYZA 3QGPA 5HATA 1JJ2M 2GVDB 2WVDA 4J5OA 3NL0A 3MN6A 4TY8A 4J37A 1MU2B 1ATRA 4FN5A 4TLRA 2Z57B 3AJ1A 2ZJQL 3W9IA 3DYAB 3VMFB 4JKGA 1TKXB 4ZVUB 2AYBA 4OX9J 5IV4A 4CLUA 1CG2A 2HG4A 3VF0B 1WF2A 2YNIB 3M2RB 4CD1A 3VA3A 4XPEA 1ZBHA 2A1RA 1T0TV 4FYXB 2ZZMA 4HUEA 3ISZA 1FE0A 4M5DA 2YHYA 5LOQA 3WXMB 3J7AN 1T3OA 1YWXA 2QTDA 3KG1A 2FJAB 3T1HF 3S8SA 3T3FA 1CQNA 2ZBIA 3CJ5A 4ILHA 1WSGA 2ROEA 2XTJP 3G6XA 3N4PA 1KLNA 5ETNA 1IV0A 4DTOA 2VFRA 4LF5F 4NLCA 3VETA 1UWBB 2HQDA 5LMUF 1PJ5A 3JQJA 4LRFA 2KHDA 3IR7B 5IC4B 4BBYA 1BWEA 4BRAA 1Z05A 3D6FB 2N4DA 5DDRC 1N33K 4DFJA 1R31A 2KJWA 4JN4A 2CPJA 3HYFA 5HROB 4K0KF 2HRTA 4QW8A 1NK6A 3IWLA 2QT7A 4KHRA 4CGGA 1KC8T 1VIOA 2XS7A 1JCGA 4O3PA 1DTQB 1HWJA 4ELVA 2D3ZA 4FNIA 5LSOA 1VSDA 1PYTA 3D7EO 2YKOA 5I3UA 2L9DA 2NQPA 3HXMA 4S0MA 2YNHA 1JKHA 1RDBA 3EZUA 3CCRN 4B3RK 3K7RA 2C2MB 3UDLA 3TEHB 3DXKA 3GSIA 1I94J 1S4EA 4KKOB 4DV7F 3N0VA 3THTA 2OD6A 3ZETB 3OHAA 4UZBA 3V6DB 3NS6A 1SKRA 1E4GT 3R5BA 2ZC4A 5ETRA 4A59A 1XIQA 1U2VB 3UIQA 4IFYA 3FQKA 3W2VB 2HK3A 3GDQA 2WK4A 1TVRB 1FX2A 4Q2MA 4JI4F 3K5PA 3CJRA 5KFNA 5ETMA 1RB0A 3HFVA 1RKJA 2CQIA 4H0XB 4DFPA 5FPEA 3JTNA 3QAUA 3G87A 4E19A 2AWZA 3GR1A 3KJVB 3J7Z5 4FBUA 4CJ3A 4PWUA 1TUGB 2CQHA 3H5XA 5D3GA 4IG3A 4HUFA 2PMZD 1H38A 2B43A 4M7YA 1B7YB 2JWKA 2ZOMA 3HHLB 3MPUB 1RI7A 2QFJA 2GELA 4KHPK 1P1TA 5B0EA 2FC0A 1WUAA 4QYZK 1GXTA 1OYDA 3KK7A 1R8HA 3TSPA 3CFPA 1W0HA 1TV6B 2B8PA 2UXBJ 3VAHA 5J2MB 2QXLA 4O44A 5CY4A 4B02A 4BS2A 5DMRA 5KQ8A 1TAUA 3A3PB 1JLAA 5A76A 1SAZA 3FRYA 2HBYB 3B8AX 1SJFA 5KT3A 1IBLJ 4IG0A 2L3MA 3H0PA 4DUZF 4DL6A 3P6YC 2CFXA 2X1BA 3A5LC 4QIFA 1YJ7A 5C15A 2BQUA 1JXVA 2BV3A 4C8KA 5SWMA 1S77D 4I2QB 1U1MA 1RLDA 2RHKA 3GYXB 3WZ0A 4LQ3A 4J9MA 2YQ0A 2BW2A 4EZ6A 2BKPA 2HBJA 4DDFA 3W3DA 2B51A 2FF3B 2NXJA 1U6BA 3MFIA 3V9ZA 3QBXA 4EU0A 3TA2A 4QS9A 3ZNUA 1NSPA 1X3MA 4GV6A 4PRFA 3CJKA 1RILA 3MAHA 2E66A 2Q97A 3CIZA 2DGUA 5IM0B 4DL0C 3EVOA 1KOOA 2B5JA 3P83D 4KPYA 4FPRA 3OTDA 5KRSA 1F5CA 3DLLL 2LU1A 3QZ8A 1CS4A 4B9UA 2FVSA 3OYJA 4OJHA 3CI5A 2XNRA 2V8DA 1DQ9A 2KDOA 1TMJA 4PG7A 5JICA 4DG1B 3UO0A 4OYWA 3M9OB 2WHOA 3M1FA 1MN9A 1T8EA 1BIUA 1TL7A 4QR1A 4UY8O 1M5PC 1W97L 1Y3KA 2VOPA 5M1OA 3HTVA 3BYPA 5H9EJ 5AQFA 4KTQA 2BRLA 3MF5A 3UDEA 2EK1A 1T05A 1JLGB 2D3UA 3SZ2A 1FDDA 5L8RC 1QTNB 3VQDA 1LWFA 4AQYF 4N7TA 4J9KA 1FW6A 1ESVA 3AGKA 3ALYA 1YTUA 3OS1A 3BQ0A 3LDPA 2XYGB 2YX4A 1FJCA 3HO1A 3FJ2A 3MGJA 1NKCA 4CJKA 4CIOA 1NB7A 3O3HA 4OZLA 1R8PA 1CEZA 4DTJA 3POTA 4RPFA 3W64A 3SUOA 3V81B 2M5YA 3AB4B 4R5PA 1FWPA 1QQCA 3J7AP 2D4WA 1QJHA 3HFKA 2IJFA 2A3JA 2DHHA 1S9FA 2FF6A 1RU2A 1VI7A 3FLCO 4PG8A 2W7OA 1RQ0A 3K59A 3TZYA 1YSJA 3FRZA 2HIYA 1VFJA 1BUPA 2G1HA 4ECYA 2WTFA 3BSNA 1B9DA 1UVIA 4X4PA 3IRXA 2CZ4A 1X0PA 2VWBA 4ZVFA 5KPZA 4OPHA 2CPYA 4JI3K 1ZBIA 5ETPA 3H40A 2PYLA 4YNQA 4NXNJ 5HBMA 5K8PA 2DHSA 1PC5A 1TYQA 5DG8A 2P9UB 3RG6A 2HQFA 1RAOA 4PUOB 3C6UA 1ZOTA 4NLTA 2K1RA 3QSIA 2N3OA 5C24A 2VQFF 3OTCA 5D6GA 2UUTA 4F4YA 5HMXA 5AQLA 2XGPA 1TFWA 4RW4B 4LF7J 2HB5A 1FVSA 2KT3A 3BF4A 3NAIA 4ER8A 3V9UA 4NCBA 1VR6A 4K8ZA 4FDFA 5HK4A 1W2BR 2F1FA 4CI6A 2FYXA 3GCXP 1UA0A 2YY3A 5LXYA 1UETA 2NRVA 1T9TA 2AU0A 1HNXJ 4Z4IA 3R5AA 3I0SB 1NNEA 4FLVA 1YHQS 2ZWOA 1U02A 3RWUA 2DXDA 2MZTA 1BI4B 2MLXA 4FK2A 4HDHA 3J8AA 4KH5A 2FIUA 3QEWA 3NGRA 2UYTA 4E7KA 2MKHA 4YOUA 4NLVA 3C46A 4K50A 4EUVA 2M52A 1TL1B 5LMNF 2E5HA 1XMQJ 4DFMA 5L1IA 4FWPA 2KG1A 1MMNA 1FFWB 1Q4RA 1S79A 4B3MJ 4ZP9A 3FBFA 1TMMA 3M8QA 4IH5A 3BBBA 4KH4A 5B0CA 1RADB 4DR1F 4RKUC 4CLPA 1C0TB 4JBCA 1F6TA 3U3YA 2YHAA 3ZZ0A 6FD1A 2KXFA 4WKYA 3F5TA 3Q8SB 3GZ7A 1RTIA 1RBRA 2RKIA 4Z2XA 2P9NB 4DV3J 4CDIA 3JQKA 4WIIA 3ILLA 2JC1A 5AZJA 3U6FA 3PR4A 4P7TA 4I64A 1IR0A 1UP1A 5BR8F 3R27A 5T7LA 1HKCA 4M3TA 1HR0K 1QZ5A 1D0EA 4Z4HA 4H0YB 5CQGA 4ZLNA 1B0PA 3IUCA 2CPIA 4F0MA 3AOBA 4JI4K 3VN5A 2CNLB 4OHYA 1X1PA 2N82B 4KC5A 5L38A 1YRTA 4X84A 3DLEB 2HWTA 1NH7A 4Y28C 4Q5VA 2R7YA 2W40A 3J81O 4KT0C 3QJLA 3SAFA 4C0BA 3VF2A 3CJ7A 2YNGB 3VTIA 3TAEA 1VQ7N 1ZPVA 2FQQB 1ATNA 1M1KO 3P96A 3HJFA 3TTDA 1KS2A 4NLWA 2MGZA 2B4VA 4IQXA 2UUBK 5L9NA 3PY8A 1ITGA 3RMBA 3RYLA 3DOKB 1J5OA 3LAKA 1S22A 1R0CB 3MMJA 2DNYA 4DL4A 3H1QA 4RJVA 2KFNA 2FHOB 1ITPA 4CK2A 2CQ1A 2DTJA 3FFKB 5L1JA 5J2PA 2YWFA 1T44A 2QKBA 3CMAS 4X4UA 3LAMA 2W9BA 4FK0A 3KNAA 1FRMA 3L95X 3O9QA 2LMIA 2VFUA 4F2SA 1XC9A 3AGRA 2CPDA 3T6BA 1IH7A 4LSLB 5EU7A 1VQON 4L72B 1X9JA 1WG1A 1VQMS 3M2VA 2C3UA 3IRWP 3O3FA 2I7NA 2ZD1B 4JV0A 4V19X 3TEGA 3NBPA 1HBUA 3AVBA 2DISA 1DGKN 3T7ZA 2J6SA 4NO7A 5DRKA 4BRQA 4ED0A 1QVGR 4DOZA 3ZZRA 2IA6A 4DI6A 1TFYA 1IKYA 1FFGB 4DR3F 3KLHB 4J8FA 3JQMA 1QSLA 1XNRF 1X4CA 2VQEF 2UUAF 4TXSA 4DSKA 5KFDA 2HGNA 3WNHA 1MLAA 2IIRA 3OVBA 1S49A 4K4VA 3LA0A 1N32K 3OBIA 4PPZA 3ZSZA 3EXCX 1SJ1A 3ID8A 2IYIA 2MZ1A 2OPQA 3GIJA 4DTNA 3LP2A 4ZVQB 3DOMA 4X65K 4OJGA 4CO3A 4BR9A 2UXCK 2G8HA 2D3O1 4FO0A 2JNJA 4HHJA 1U2VA 2DH7A 2X6SA 4C7QA 5KFPA 4YOYA 3RRGA 4F02A 4CECA 5IWAK 4YFUA 4BC7A 1NU0A 4Y34A 1UWBA 1HLWA 3LANA 3QFPA 4NLDA 3KDNA 3BKTA 1CXUA 1BI4A 4ECSA 4PG6A 3TJ9A 4F3MA 3SCLE 4M1KA 3AVLA 3MCOA 3OXFA 1IN0A 2PYJA 4HTJA 3JS9A 3MWTA 5M1NA 2F7VA 2OTLS 4FPBA 3SCJE 4TLQA 4MH8A 2GEMA 5FDLB 1KQGB 2HZAA 4O23A 3SCIE 4QCLA 3KXDA 3A5NC 3KG0A 3GWCA 3RR8A 3FSXA 4LRDA 3KWGA 2CPXA 1FESA 1RE1B 4RNNA 1IM4A 4KHNA 4JYAJ 3UKUA 2CGLA 2ZDOA 4F25A 4KH1B 3MMCB 2YQ3A 3ENQA 1QQOA 2NXNA 1LAWA 4WP9A 3DGPB 4NXNK 1U26A 1X5PA 2QX0A 2Y1LB 2CH5A 2BEFA 2ZM6K 1BQNB 3G8QA 4AXJA 3J81Y 2IM2A 2V8HA 1N8RO 1WEZA 1AA1B 2OO4A 3ZSXA 2UVRA 3QNWB 4M3ZA 3IS9B 4RBTA 4WQ4A 2Z2ZA 4DSEA 2L9NA 3I32A 5AJ3J 4USHA 2H65B 4RWWA 1TUVA 3WC0A 4OJ3A 4F4XA 4NZ7A 4RW9A 1RTIB 5LMNK 3FZLA 2B4UA 3P1GA 5HMZA 1X0FA 4B1VA 1KAYA 3PUFA 1U6FA 4CTAA 4QQBA 1VQLN 5M1FA 4LSNA 4DLEA 1UW9A 2CRLA 2XZDB 3C6TB 3KLFB 2LKZA 3CJKB 2A18A 2UV8G 4KAIA 2BM1A 5EHHA 1GFWB 5CYJA 4KB7A 2B6AB 2Q2RA 1HRHA 3KK3A 1TK8A 1N32J 2WVFA 3AA9A 5BR8J 1D9FA 4F4KA 3PIPL 1FNOA 1UEKA 3PEJA 4QJVA 3K58A 4GO5X 4WFBQ 4B1UB 1U47A 4TU8A 2DCLA 1B64A 2V68A 4NLSA 3QEVA 2Q6BA 2WBMA 3IGVA 4IBNA 3L7UA 2RSQA 3W7BA 4RWTA 2PIIA 2XMVA 4WE1B 2GQCA 3CD5A 1KTVA 3IR6B 4GV3A 3QQCD 3A8YA 3M8SA 2W4PA 3PIOQ 3OR2A 1TTHB 1NEEA 1NLVA 5AQRA 4IFEA 2E5IA 4GRSA 1RYSA 3KD1E 3TAFA 3MD1A 1ZXOA 1YAGA 4CH7A 5A8KA 4BE1A 1CULA 2XULA 2WCXA 3THWA 3NOCA 4A8WA 3PSFA 4FOIA 1YJWN 8ATCB 4Q7AA 1GLLO 4B3TK 1UFWA 1HYSB 1HL6A 1ULRA 1KAZA 3AAWB 4LREA 4OYZA 4NCGA 2HFZA 1CLFA 1H7XA 4X62F 4I0WA 1FWKA 2