1HPZA

Human immunodeficiency virus type 1
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 122
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hpzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hpzA05
4OLBA 5KG2A 4CGDA 2GBZA 2IM1A 5KT7A 1S48A 3PUFA 3EYZA 1YVUA 2HVIA 4IFVB 2FBYA 4DSFA 3FSIA 2EHGA 3ZT0A 3HXMA 5L1KA 4CF0A 3QEPA 4ICLB 4ZP6A 3LP2B 5HRSA 5HLFA 4OLAA 4CGHA 5EUHA 4QPXA 3DRRA 2UUTA 5HP1A 2OH2A 3BQ1A 1BQMB 1ZETA 3AO4A 3OVNA 4O44B 3RMBA 4ECZA 3GILA 1NJXA 4N47A 4FJ8A 3QNNA 3RB3A 3NCIA 3I0RA 3CG7A 4G3IA 4ECRA 4EO8A 3L2VA 1XR5A 2YKNB 5CZ2A 1TAQA 4WE1A 4ED6A 1RILA 4R8UB 2HNDB 4DL7A 1N4LA 3O4QA 1RCHA 5JS2A 3JYTA 1TKDA 2IDOA 4ID5A 2WOMA 4WFYA 4DLGA 1KVBA 1NOZA 3D45A 1U49A 4J9SA 1NJYA 1TL1A 3HK2A 2OYQA 3OL6A 2R7YA 2IOCA 1EP4B 1RYSA 3SQ0A 2R8IA 1RTIA 3E51A 4ECXA 2AQ4A 2Y1JA 2AGPA 3RAQA 3VQ4A 5KT3A 4CE9A 4TLRA 2CKWA 4IH6A 2P5GA 4AILC 2GIRA 4LSNA 1IO2A 4RW9B 4F4YA 3HM9A 1W25A 4NCAA 2Z1IA 1Q9XA 1J53A 5J2QA 5KFXA 4Y34A 2G8KA 2BGGA 4ZVGA 1SUQB 4PUOB 3MEGA 4IBNA 2E4LA 5EWEA 3DLKB 1VSDA 1JLQB 3OHBA 4KI6A 1EETB 5K14A 2C28A 1GX6A 3PR5B 1RNHA 1UOCA 1MU2A 3NF6A 4ECWA 4NLXA 5KFVA 2VWJA 4NLWA 5KFYA 3NBPB 3DI6A 4DTUA 2YKMA 3LPUA 4AHTA 3HVRA 4OVLA 1HNIA 3RRGA 3VN5A 1HQUB 4GC7A 4J9PA 1S1VA 5JUMA 2JEGA 3PJXA 3C95A 2FJXA 5F8NA 4F4ZA 3M8SA 1FKOB 4KFBA 2FVSA 5EWFA 4NLOA 4DS4A 4DTJA 3UQSA 1KFDA 2J6SA 4H4OB 2I1RA 1RT2A 4FM1A 1DTQB 2BR0A 3OYJA 4DFJA 5T7BA 4DG1B 4ZP8A 5KFKA 3PV8A 1RT6B 2OA8A 1BI4B 3EPIA 4EP4A 2XCPA 1S0NA 2JEFA 2ATLA 4I7FB 2ZKUA 1HPZA 1D9FA 4RNMA 1S4FA 4CF2A 2HB5A 5KFRA 1CSJA 2W9BA 1HYZA 1FKPB 2NUBA 1RT7B 3C6UB 3DM2B 1LWEB 4CJ3A 4FBUA 3PX6A 5F9LA 2JEJA 4W5TA 1U09A 2KTQA 4MH8A 4YR3A 5J2PB 3OJSA 3I0SB 3U6FA 2VG6A 4KHSA 4HUEA 4EBEA 4R5PB 5E41A 4DTMA 4RW7B 3LAMA 4FJNA 4N56A 4E7KA 1N56A 2R2TA 1B92A 3T5HA 3KJVB 3MR6A 3NF8A 1LWCB 1S1WB 4MQ3A 2J6UA 4LY7A 3K57A 3CFOA 4JUZA 1KCFA 4CGIA 3OYHA 1S9EA 4M41A 1RT1A 3LP3A 4ZP7A 4K8XA 2X6NA 4CIFA 3PO4A 1VK0A 3IS9A 1W9HA 3ASMA 3U3GA 4EZ6A 1Z4UA 3NFAA 3LP1A 4LSLA 3OL8A 4M3XA 4IR1A 2XHBA 1C6VA 4B3OB 4NLTA 3O3GA 3IRXA 3OS1A 3NGIA 3QGHA 4MKBA 3MEEA 3QIDA 1N5YA 5KT4A 1SV5B 4K4XA 4YP3A 3TAPA 4ZPCA 1VSKA 1NHVA 3ZSZA 3TAMA 2OPQA 2YHBA 5DGBA 5J1EB 4XPCA 4FJ7A 5KFZA 1ASUA 3NKYA 5DGAA 4FYDA 4ZP9A 4DTSA 4RU9A 3WNEA 1X9SA 4RNHA 2KZZA 3AVMA 4B9VA 4E89A 3AVHA 2FLNA 1NK4A 2UVUA 4J9LA 1ZBHA 2IAJB 3QYYA 4M3TA 4ZHRB 4Y3CA 1WSGA 2A1RA 4DSKA 3OHAA 3V4IB 1TV6B 3HP6A 4Q8FA 3BSCA 1S0OA 1TK0A 2R2UA 4IFVA 2R8HA 2KFZA 3V9WA 2HAIA 2RF2B 3NF9A 4LQ3A 2R8GA 4ICLA 3LP2A 1O1WA 3TI0A 2G8HA 4JV2A 2HMIA 3NMAA 4HCBA 4BACA 4ECSA 4FJMA 1KTQA 4FJGA 3V1QA 2IM2A 4MK9A 4ZVFA 1J54A 2YKNA 3AVLA 3QLHB 4R8UA 3CFPA 5KFWA 3AA4A 4PA1A 4KO0B 3OL7A 1LAVA 3DMJB 2QKBA 1HNVB 4CEAA 3PW7A 2D0CA 1UWBB 4DSLA 2V0NA 3QZ7A 3F73A 2OPSB 3SFGA 1ASWA 4AHVA 3RMCA 1EP4A 1HJRA 4J2DA 1DLOA 3AO1A 1KLMB 1Y97A 4CEZA 2W42A 1U4BA 3OYGA 3M9OB 1NKBA 2PYLA 1LW0B 1RDRA 5HBMA 3ZCMA 4CGJA 1RA6A 4O4RA 4O3RA 4DMNA 2GC8A 3C94A 3RB6A 1YVFA 4FJ9A 4K4VA 3OYDA 4DU4A 2C2RA 3GV7B 4NYZA 4YR2A 3D28A 3PW5A 1KLNA 4RW9A 4IDKB 4EYHB 4DEZA 5KG5A 2BQRA 2G8UA 2F8TA 4JRPA 3NH1A 1BQNB 4M94A 5F8HA 3OSPA 3CIZA 4PUOA 4BE2A 5D3GA 3IGNA 3DRPB 2WB4A 3H4BA 3DLKA 3KLHA 1JLQA 3BQ0A 1EETA 3N6MA 3SV3A 4F4KA 3V81B 1C0UB 4CK3A 2UVWA 1SH0A 2YNGB 4QOZB 1IG9A 3NBPA 5C25B 2HHXA 3AVBA 3RR7A 3G86A 3V9UA 1S1TB 4FLXA 2X78A 4NLVA 3HVTA 2FC0A 4KHQA 1HQUA 2KW4A 2ASLA 3HHKA 3FQLA 2YNFB 4Q0BB 1HQEB 1QSYA 1S10A 3H08A 1Z25A 1FKOA 4CHOA 2O5DA 2XWYA 2PYJA 4DQQA 1S9GA 1QQCA 2B4JA 4DQSA 3DOLB 2W9CB 4H4OA 4CJTA 1DTQA 4QW9A 1RDCA 1JL1A 4DFKA 1C0TB 1L3TA 1K6YA 1RT6A 1BI4A 2E9RX 1NK0A 3SUPA 3CDWA 4NLQA 4HUGA 4KI4A 4I7FA 2CJQA 4E19A 3DLRA 5C5JA 3K2PA 4ED1A 3T5LA 3SZ2A 4KV8B 2ALZA 2BANA 3M8PB 1RT7A 3C6UA 1LWEA 3VQEA 4FK0A 1VRTB 1NKEA 3SQ2A 4F4WA 1FK9B 3CM5A 4O0IA 2C22A 5J2PA 2FVQA 4AHCA 3IN5A 5EU7A 1UAXA 4FK2A 4H8KA 4R5PA 3VA0A 4RW7A 3AA5X 3WNGA 4CEFA 4ZPAA 4KAZA 3KJVA 4IKFA 1S1WA 4TY8B 2VWKA 3UPFA 2IJFA 2V4RA 5FDLA 4NCGA 4I9LA 1VSMA 3QERA 2HHUA 3KMQA 3EY1A 3L3UA 4E7IA 5KFBA 3G6YA 2G8WA 3OYKA 3TAQA 3VQDA 5KFGA 3KLGA 4DLEA 1NK6A 3KHLA 3MAQA 4YNQA 1RBUA 5DG8A 4ID1A 1RT5A 1WLJA 4AHRA 3RMDA 4B3OA 4AHUA 4Z4GA 4E7JA 1C0MA 2W8KA 3RTVA 3D0PA 3E01B 2WONB 3CJ2A 3N6NA 4UQGA 2WHOA 1D9DA 4O5BA 4Z0UA 3FFIA 3VQPA 1SV5A 1S1XB 3RBEA 4O3SA 5KT2A 5KRTA 3TANA 4O3QA 1T05B 4KBIA 4WYWA 3KMSA 2ILZA 4E1NA 5KG0A 2O4IA 4PY5A 5JS1A 1KHVA 4HKQA 2HHSA 2JLEA 2HHWA 3I5BA 4FJIA 4M95A 4FW1A 1CLQA 5C24A 2HNZB 2IAJA 4ZHRA 3KLIB 3DLBA 3V4IA 3GIJA 1JLAB 1TV6A 5I42B 3NAEA 2JEIA 4IOBA 1VSFA 3SNNA 2WCXA 4NZ0A 1OS5A 4W5QA 4ZPBA 4DU3A 1QSLA 5F8JA 3CYMA 3PJWA 4QWBA 4Q5VA 4KKOB 3Q8PB 3CJ4A 4FLVA 3MR2A 4B9MA 2O4GA 3H5UA 3MTKA 4RUCA 3RWUA 2E9ZA 1RTHA 2ATQA 4WZQA 4Z4CA 3OYEA 3CWJA 4O3OA 2FBVA 3A2FA 4ZPDA 3HYFA 4Z4HA 4E7LA 3KHGA 3QLHA 4E3SA 2QK9A 3B6OA 4YQWA 3H98A 4K4TA 5KG6A 2HWIA 2AGOA 4CHYA 4KO0A 3CJ5A 3ZSXA 3DMJA 4RW4B 3AVFA 1HNVA 3IG1B 4DTXA 4NLYA 2P5OA 3ZSVA 2XCAA 2OPSA 3PO5A 2KFNA 4FJLA 1GOCA 2IM0A 2RKIB 4ZTJA 4FLWA 4URGA 1S0MA 4H4MB 5KT5A 1IKWB 4DU1A 4WFXA 3AVAA 1TKTB 4FW2A 1A5VA 3T19A 4M45A 2ZD1B 1LW0A 3KKSA 3DDKA 3OYMA 3NE6A 2AX0A 2OPRB 3PW4A 3PX4A 3KTQA 4IRCA 3MR3A 1SL1A 3ITHB 3TARA 1WN7A 3P83D 3BREA 1HMVB 3KK2B 1XR7A 1BQNA 1RBRA 4E0DA 1YT3A 2OPPA 4KHRA 4JRQA 3L2WA 1QE1B 1SKSA 4QCLA 3VQSA 2KZMA 4KHUA 4OJRA 3FRZA 1HYSB 1N48A 1L3SA 4M3WA 3T5JA 4EZ9A 1QSSA 2OZMA 1C0UA 4HCCA 3RB0A 4CEDA 4FS1A 4I2QB 2YNGA 1XR6A 2ITGA 4H54A 5FRMA 4DF4A 1SKWA 5C25A 2W8LA 3ZSRA 1TL3A 3DYAB 4TN2A 4J9NA 2HHVA 2ZE2B 5DMRA 2FVRA 5DQGA 5CYMA 5F9NA 4O4GB 2HNYA 4ECTA 4YFUA 4M42A 4RNNA 4Q0BA 3MF5A 1HQEA 1KHWA 1JXBA 3VQBA 4TQRA 1REVB 2YNHA 2IJNA 3VQ8A 1J9AA 4CGFA 4TY9A 1YTAA 1KSPA 2FJWA 4N41A 5EWGA 5KG7A 3KK3B 2AGQA 3CFRA 2FVPA 3L2QA 4MK8A 4OGCA 4RG8A 1JKHB 3H59A 3BGRA 4KHWA 1RTJB 3VQ6A 4NLRA 2YNIA 3NF7A 3VQ5A 4FJHA 3DOKB 1BGXT 4FZXC 4O3PA 1XHXA 4J9MA 2LSNA 1A5XA 2WRMA 3M8PA 1X1PA 3TR8A 3VQ7A 5C42A 3V9SA 4PQUA 1D0EA 1FK9A 4IG3B 4NRUA 2QKKA 3SYZA 3T3FA 1JLCA 1LW2B 4JS4A 3ALYA 4GVMA 1G15A 2XO7A 4J9RA 1B9FA 4Y1DA 5HRNA 5KFAA 4CJLA 4MKAA 2OZSA 4KHYA 3ZSQA 2HHTA 2P51A 4RW8A 4I2PA 5KFLA 4FJ5A 2BE2A 4EBDA 3L2RA 4KTQA 1X9WA 3UIQA 3S3NA 3MXIA 2IC3B 3K58A 2XY7A 1DTTA 4LD0A 3CQ8A 4DQRA 4Q44A 5J2NB 1C1BB 4KB1A 3LP0B 3SUNA 3KLEB 4ED2A 1Q9YA 2FLPA 3TAGA 4HHTA 2IS3A 3OL9A 3V9XA 3QZ8A 1WNEA 4KREA 3K5OA 4K4YA 1RYRA 1L3UA 3PY8A 5HROB 3QESA 3UDLA 3V6JA 3E01A 2WONA 2QXFA 4RNOA 4F3TA 3G10A 1S6QB 4FZZA 2D0AA 1S1XA 1L5UA 5FROA 1T05A 3PHEA 3ZT3A 2VG7B 3I0RB 3I5AA 1IKXB 2FBTA 1QAIA 1SKRA 1NNDA 4WE1B 1XI1A 5KG4A 1BQMA 2Z1GA 1CZBA 3SQ1A 4AHSA 4O44A 2D41A 2D7SA 4KPYA 4CJFA 1BIUA 4ELVA 5SZTA 2HNZA 3DRSB 4ID5B 3FQKA 2WOMB 5T14A 3OLAA 4FS2A 4Q8EA 4EEYA 3AVKA 3VA3A 3MR5A 4CF8A 4WXOA 3VQAA 3BSOA 2HNDA 5I42A 4FLTA 1TQLA 5L1IA 3VQ9A 3DLGB 1RT4B 3QEWA 3KLFB 3V9ZA 4ED8A 2JC0A 1TAUA 2XI3A 3LZJA 4AH9A 4N5SA 2AU0A 1JLBB 2HHQA 5KFIA 3SFUA 1RT3B 4KKOA 4CESA 5KFSA 4ECVA 3HKWA 3BR9A 1JLFB 3EPGA 1CXQA 4CFBA 4M3ZA 2B6AB 4HTUA 3Q8RB 1TKXB 1T03B 3AVCA 1YTUA 1C1AA 3ULDA 3TAEA 4U7CA 3CVKA 1XC9A 1NK9A 3K5LA 1LWFB 4FVMA 4R0EA 3AO2A 3QEIA 3S9HA 1IKVB 4RUAA 4FM0A 3SI6A 3JSMB 4ED7A 4RW4A 1BL3A 3BQ2A 3OYBA 3IG1A 4DTOA 2I5JB 3OS0A 3LALA 5CZ1A 1VSJA 1ZBIA 4FLUA 2RKIA 3DI6B 3H2LA 1GX5A 1SUQA 1X9MA 4XO0A 1IKWA 4IH7A 2FVCA 1TKTA 1I6JA 5KFHA 3FDSA 3AVGA 3OYLA 4J9KA 3SUOA 5KFDA 3RRHA 3GV8B 3L3VA 3OYFA 4FLZA 3NL0A 2OPRA 2EX3A 1KFSA 4KFBB 4Q43A 4O55A 3ZT4A 3ITHA 3MECB 3QO9B 3OSNA 3H4DA 3DLEB 1HMVA 4F2SA 2R2SA 2B5JB 1WSJA 4KTWA 3P5JA 1VSIA 4DTRA 5F8MA 4KSEB 5KFTA 3G6VA 1ITGA 3Q8QB 3N6LA 3GIMA 3T1AA 3OJUA 4DL2A 1D1UA 1HYSA 5F8IA 4CGGA 2X6SA 2FLLA 4TYAA 4DG1A 3TWHA 4FJXA 2JGUA 1JX4A 1I39A 4I2QA 5JXSA 1EX4A 4DL3A 4K4SA 1CXUA 1RDBA 3ICLA 3G6XA 1C1CB 4XIUA 1SL0A 3CDUA 2V9WA 4C8LA 4W5NA 1FKPA 4EP5A 3DM2A 4OKKA 4K8ZA 4O4GA 2E9TA 4Z4EA 3UR0A 1RBVA 4NYNA 3KD5E 2RN2A 5HRRA 4YR0A 1REVA 3I0SA 1A5WA 4K4UA 2Q3SA 3I5CA 2XY5A 2FBXA 3SV4A 4RW6B 1S9EB 3V6KA 2XY6A 2IGIA 4M3YA 3PVXA 2Z1HA 4CHQA 3ZSWA 1RT1B 3S3MA 5L9XA 1LWCA 3KK3A 4CCHA 3V6DB 4CJEA 1JKHA 3IS9B 1RTJA 3M9NB 4CJPA 2E6LA 3DOKA 4EO6A 4LSLB 4BE1A 4YMEA 1LV5A 4B08A 1K1QA 1RDAA 5L1JA 1JLEB 2R8KA 1HYVA 4LH5A 1NJZA 4L8RB 2DFFA 1WAFA 1FXXA 3MEEB 4IG3A 5CY4A 4DSEA 1LW2A 1J5OB 4CERA 3TAMB 1R0AB 5CYQB 1S5JA 3B6PA 4Y2CA 3HO1A 4QWAA 1ZYQA 4WZMA 3MFHA 1S49A 4QW8A 3AO5A 4CF1A 2IC3A 4OPJA 4G1QB 1K1SA 1TVRB 5KGXA 3G0ZA 1RTDB 1JLGB 2ZQBA 5J1EA 5J2NA 1C1BA 3KK1B 3IGVA 2V4QA 1RBSA 3LP0A 2C2EA 3KLEA 3QEVA 3HJFA 3TVKA 4DQIA 1S1UB 3LWMA 3THVA 2D0BA 5KFCA 1RBTA 2W7OA 3RMAA 1L3VA 5HROA 4JV0A 3H5XA 1U04A 3KKRA 4JS5A 2HMIB 3S3OA 4J2BA 1S6QA 4W5OA 4MIAA 5DG9A 5FRNA 2RF2A 3OY9A 2VG7A 4OKJA 4K4WA 3QIPB 4DTNA 1IKXA 4DFMA 3HPOA 5KG3A 3I8DA 2DTUA 4IR9A 4F8RA 4DSIA 4CFAA 1SH2A 3AA2A 4RNFA 2AJQA 4CF9A 4IFYB 1UA1A 4Y2AA 2D3ZA 4F2RA 3GIIA 4BDPA 4B9LA 4F3OA 3DRSA 3Q8SB 1VSLA 3AVIA 2F96A 3M9MB 1BCMA 4IRDA 3LDSA 3MEDB 1DLOB 4CK2A 2DPJA 1IKYB 2HVHA 3ZT1A 2XY8A 3DLGA 1RT4A 3KLFA 1I3AA 3MXJA 4IG0B 4MK7A 4BDZA 4M3UA 2XRIA 4CFCA 1KRPA 5HBMB 1JLBA 2ILYA 1TK5A 1UWBA 4WFZA 2RDJA 1RT3A 1S97A 4DFPA 1NJWA 1KLMA 1JLFA 2WTFA 5KT6A 1S9FA 2B6AA 1WSFA 1TKXA 3V1RA 1N6QB 1T03A 1EKEA 1U45A 1TKZB 3KD1E 3GYNA 3VQCA 4ZTFA 3HL8A 1WSEA 1SH3A 2PZSA 4J9OA 1S6PB 1LWFA 2GIQA 5EDWA 4Y1CA 2PY5A 5D3GB 4B9NA 3DLHA 4Z4IA 4O3NA 2YV0X 1Z26A 3KLHB 1IKVA 3BJYA 3H5YA 2DFEA 4IDKA 3JSMA 1LAWA 5J2MB 1VRUB 2I5JA 2G8VA 2BQ3A 3OYAA 1WSHA 4B8AB 4ECYA 5DLGA 4O0JA 4MFBB 2DPIA 4ED3A 3KLVA 2Y1IA 3CDEA 3DRPA 1QS4A 1IH7A 3QNOA 4CIGA 1VSEA 3O4NA 1D8YA 4I9QA 1JL2A 4PWDB 4LQ9A 4NLGA 3HVTB 3V81A 2IMWP 4IQXA 4E7HA 1MMLA 2P1JA 4Z4FA 2QE5A 5KFJA 5KFOA 4FJJA 4Q45A 4ED0A 2UUWA 2J6TA 4RZRA 4OGEA 4CJVA 4FXDA 3QINA 1ZBLA 2YHAA 5I3UB 3LWLA 4KHNA 5KFFA 3TABA 4EYIB 1S9GB 3MECA 3QO9A 3DLEA 1S1TA 3NDKA 4F50A 3M8RA 2AWZA 2B5JA 4KAIA 4IRKA 2YNFA 1XHZA 1QAJA 3U3YA 1ASVA 1BISA 3MXMA 1ZTTA 4ZVHA 4W5RA 4CEQA 3RBDA 1D5AA 3RR8A 2XGPA 3DOLA 2W9CA 3KHRA 4E1MA 4C8OA 3GIKA 5KFEA 1SL2A 2BANB 4C8KA 1C0TA 2UVRA 3C6TB 2C2DA 4QWCA 3M8QB 4NLPA 4NCBA 1UA0A 5F8GA 2VA3A 1C1CA 3NAHA 4N76A 4KV8A 3SJJA 3LAKA 1BCOA 3NH2A 1Q8IA 1CZ9A 2GUIA 2GV9A 3AV9A 4DL5A 2VG5B 1VRTA 3ISND 3OYNA 2BRKA 3BSNA 4CK1A 1TK8A 2AX1A 3GV5B 2E6MA 5FDLB 5DQIA 4URQU 4NCGB 4CECA 4RW6A 4CJSA 3KHHA 4OL8A 1NOYA 2W7PA 4FLYA 2F8EX 4TY8A 3KLGB 1IM4A 3V6DA 1T3NA 3ZT2A 2IA6A 3SI8A 4BE0A 4FZYA 2G8FA 3TAFA 2FJVA 1RT5B 3HT3A 5DQHA 4FJKA 1HARA 1WNSA 3AO3A 1T94A 1T7PA 4CJKA 1JLEA 2BDPA 4NRTA 3ZSOA 4HVJA 3QETA 4ELUA 3O3HA 1T8EA 1TP7A 3QGGA 3FFIB 4NYFA 4ELTA 3QIOA 3OS2A 2QV6A 3L2UA 4X2BA 1J5OA 3F9KA 4CEOA 4IKAA 2ASJA 3SPYA 3SCXA 4QAGA 5KFPA 4FM2A 1R0AA 5CYQA 1NHUA 4DS5A 2A1SA 5HLFB 3QEXA 3WNHA 3HPGA 3DRRB 4DSJA 5HP1B 3H5SA 4BDYA 1RAJA 2DFHA 4JV1A 4CJQA 2RPIA 3EZUA 4DWIA 4G1QA 4CIEA 1TVRA 5F8LA 1RTDA 5C24B 4CEEA 1JLGA 2G8IA 3T5KA 3NGYA 1VSHA 1QUVA 5KFMA 3KK1A 3NHGA 2DY4A 4KE5A 3H40A 3JYTB 4KB7A 1S1UA 2WK4A 3KIOA 2ASDA 2XI2A 3KLIA 4CHPA 2R2RA 3IAYA 1TL1B 2BRLA 4TQSA 1JLAA 4WYLA 1B9DA 1NK7A 1JXLA 4TXSA 4MIBA 3RB4A 1QHTA 3PX0A 4B9TA 1RTIB 1RTHB 3QIPA 2X74A 1HRHA 3O3FA 2RDIA 4B9SA 4HYKA 4QWEA 4IFYA 4LSNB 3CJ0A 1BHLA 5KG1A 2KQ2A 1ZTWA 2HW3A 1TGOA 2Z1JA 5J2QB 3TQ1A 5KI6A 4C8MA 4LH4A 5DK5A 2XGQA 1KVCA 3HSTB 5L1LA 3MEDA 2JC1A 2EC0A 3NH0A 4KHMA 4CHNA 3OLBA 1IKYA 3MEGB 3QGIA 4IG0A 5K14B 3WNFA 1RA7A 4CEBA 1NK5A 1MU2B 4OPKA 3K5MA 3NGZA 4ZMMA 4FK4A 3GQCA 4K50A 3SQ4A 4URSA 1F21A 2YKMB 4H4MA 1W0HA 3CO9A 2B43A 3EZ5A 2R8JA 4FBTA 3AVJA 1RDDA 1N6QA 3OYCA 4ECUA 1HNIB 1TKZA 4J2EA 2ZD1A 3AA3A 4TSXA 3PW0A 3K59A 1S1VB 4NLDA 1ZBUA 4GC6A 4CJWA 2OPPB 1S6PA 3KOAA 3LPTA 4CHZA 4EBCA 4WXWA 4ZVEA 4NLUA 3BSAA 1RT2B 1GOBA 1KVAA 5KFQA 3ZSYA 3KK2A 5KRSA 3V6HA 4JLHA 5J2MA 1VRUA 3LZIA 2VA2A 4M3RA 4C8NA 3P1GA 4B9UA 5SWMA 1QE1A 4CJRA 4MFBA 1HPZB 1JIHA 1NKCA 1TL3B 3CJ3A 3SUQA 1QTMA 4DL4A 4PWDA 4KTZA 2XC9A 4NLSA 2W9BB 4K4ZA 4CFDA 1ZBFA 4TYBA 1GOAA 4HUFA 5CYMB 4B8CA 2HNYB 4CJ4A 4FCYA 1U47A 4F4XA 5KTQA 1BIZA 5I3UA 2YNHB 3DYAA 4DQPA 2VG6B 3VQQA 3ISNC 3L8BA 2ZE2A 3LANA 2D3UA 3RAXA 4XPEA 4BWMA 3D5MA 4U6PA 3SPZA 4BWJA 4DL6A 3BGRB 3OYIA 1EXQA 1NK8A 2YNIB 2HWHA 2IM3A 1JXEA 3NAIA 4GW6A 3HVAA 2ETJA 3K5NA 5KFNA 5C42B 4DTPA 3C6TA 2UVVA 4PQUB 3CM6A 3M8QA 3HVWA 2D5RA 3LP1B 1JLCB 5DLFA 4KRFA 3PR4A 4J9QA 1WSIA 4CJ5A 3IRXB 3V1OA 3HP9A 3BDPA 3HPHA 1WAJA 2VG5A 3NGDA 4RW8B 4I2PB 1N5YB 4QWDA 4GMJB 3AVNA 5HRPA 2BE2B 2W9AA 4KB0A 4DF8A 2OPQB 1DTTB 2F8SA 1XWLA 5KGWA 4IH5A 2IBKA 5DG7A 5KFUA 3PW2A 1C2PA 3KNAA 4CJUA 1U48A 3MFIA 3PZPA 2BQUA 4ECQA 4OKEA 4J2AA
chains in the Genus database with same CATH superfamily
5AQZA 2W6KA 5KG2A 2GBZA 2IM1A 1HKGA 1YQHA 3PUFA 3H1QA 3EYZA 4CLUA 1MSWD 3HD2A 5D8HB 1UJ4A 4IFVB 2UUBJ 1RLCL 5L1KA 2LKZA 3GYXB 1M1KO 1FT8A 4OLAA 4CGHA 2M5YA 5EUHA 3J7AN 2DGXA 3DRRA 2OH2A 1BQMB 3OVAA 2ROGA 4ECZA 4N47A 4FJ8A 4I6AA 4QR1A 3NCIA 3HM8A 3CG7A 4ZCLA 2H54B 1TAQA 4ED6A 4R8UB 2HNDB 4JBCA 1URRA 3HOSA 3JYTA 1TKDA 5AXKA 1XNQK 1KVBA 1U49A 1NJYA 1TL1A 3U1NA 2OYQA 3OL6A 2R7YA 3EO3A 4JK7A 3GP9A 3E51A 2F7VA 3A8KA 2LQBA 2QGFB 3QT5A 3CJ1A 1DQ8A 4IH6A 1VISA 1VOMA 3DU6A 2GIRA 4LIRA 4LSNA 4YOEA 1JJ2R 1RXOB 3HM9A 4LF4J 2Z1IA 3PHTA 1Q9XA 3J81Y 3I9V9 5FIIA 2ZH2A 4ZVGA 1T0TV 5K20B 4IBNA 4X64F 2H5EA 1LXNA 3OHBA 1EETB 1GX6A 4CZIA 1RNHA 1UOCA 1MU2A 1C0FA 3KUEA 2E2NA 2ZBRA 2W01A 1KOOA 1BG3A 3DI6A 4B3SK 4GKKF 4DTUA 2YKMA 2JX2A 4JI2J 4I0WA 4ILRA 1ZAXA 1VQ7N 3P8BB 3PEHA 1UVMA 2AJ4A 3OHRA 2G0CA 3C95A 5I4MA 2KHDA 5F8NA 3M8SA 1MW7A 3BO3A 4DR1F 4KFBA 1VC5A 1YK9A 3RSEA 5AQVA 6FDRA 4XH5A 1RAEB 2YI1A 3HFZB 3PV8A 2P6TA 2VQFJ 2OA8A 1BI4B 2MJNA 1N32J 3MTJA 4DX5A 3TEGA 4CLWA 1S0NA 2OGUA 1KWMA 1D9FA 4RNMA 1MWYA 1YJ9N 1PJ6A 2ADBA 4M63C 1FKPB 4CJ3A 3THYB 5AXNA 3PX6A 3MAAA 4W5TA 1U09A 4ETXA 2NREA 4DV0K 5FJ4A 3UKRB 4EBEA 4R5PB 4M1KA 1F3FA 3VGMA 4N56A 4E7KA 3BPDA 3NF8A 3QATA 1E6YA 4Y0FA 4H5NA 2BJEA 4CGIA 1S9EA 4FWRA 4C3KA 1S22A 5H9FJ 2Q66A 1W7AA 1N34F 3LP3A 2KXNB 4K8XA 2IVMA 1W9HA 3ASMA 4K43A 5E26A 3NFAA 2FJAB 4ZN1A 3CQYA 3OL8A 2DY1A 2XHBA 4EAHD 4NLTA 3KDOA 2M88A 2O8EB 1VQ7S 2YTCA 1MROB 3QIDA 2E1YA 4K4XA 4YP3A 4M5IA 4TU9A 1NHVA 3LF0A 5EHHA 5GAHI 2YHBA 4AT1B 4ES2A 5J1EB 3W8PA 4PL7A 4FJ7A 3MN6A 1MDUB 2QM1A 5CHIA 5DGAA 2N7CA 4RU9A 4GV6A 2QTDA 1Q81O 2D0OA 1X4CA 1SC3B 4AM7A 4JYAF 3BF1A 4KGMA 1EB0A 1VHFA 1MMDA 2FLNA 1NK4A 2M2BA 3LA0A 1BY9A 5M2PA 4FVCA 1IBMK 4X62J 4ZHRB 1GLLO 1YJ9S 4DSKA 1WSGA 3V4IB 2JHEA 3HP6A 3IUCA 2DCUB 3FGVA 5M1OA 3VCDA 4LF8K 1S0OA 4UUXA 2R2UA 4OI1A 3V9WA 3NF9A 4LQ3A 2R8GA 1N5QA 5GADI 2LECA 2MZ1A 4IJAA 1S99A 2GMLA 4J5OA 2YWKA 5K9FA 4CNZA 1V3RA 4ECSA 2V69A 2YQ1A 2MZRA 1YZ6A 2QFIA 2YKNA 2GX9A 3AVLA 3FVYA 2ZJQL 3QLHB 2V7YA 2QI2A 1VQON 4ERDA 4DHVA 1PYOB 4PA1A 4DPTA 1VAZA 4CLLA 3OL7A 1LAVA 3DMJB 4IUFA 2KVIA 4CEAA 2D0CA 3QZ7A 2DNQA 3SFGA 1ASWA 3VF0B 1HJRA 4J2DA 2YHXA 1PYTA 4CEZA 5ETNA 2B9EA 2W42A 3OYGA 3AAWB 1PO6A 1RBLA 1KVJA 1CG2A 1LW0B 1EQ0A 3ZCMA 1IBCB 4CGJA 1OPIA 2XLJA 4DMNA 2BYCA 3QICA 3OYDA 4DU4A 3BO2A 2JLFA 3GV7B 1A6LA 1G2EA 2GQCA 4BVOA 1BA0A 4EYHB 3MMCA 1RWMB 2AJ1A 2F8TA 1XK8A 4JRPA 3NH1A 1BQNB 3CC4N 5F8HA 4ILJA 4YOTA 1Q4RA 4BE2A 1FJGJ 3CERA 3BKFA 1JLQA 1H73A 2A2CA 4HLBA 5BYQA 2IDLA 3B4DA 3ID8A 4G1PA 3HHNB 1N36K 4CK3A 2PDAA 4EGLA 2YNGB 2H65B 4B3RJ 4Z37A 2FLOA 1FNOA 5GAEI 3G86A 2HLTA 3J81U 1I94F 1Y5IB 2Q6BA 4LF7F 1QZ6A 4NLVA 1VLOA 4KHQA 2F8MA 1HQUA 1KVKA 1G4CA 3HHKA 1KVIA 1U6BA 1WSVA 3IWXA 1RK8A 2DISA 1QSYA 1ZPVA 3TNVA 4CHOA 2DHAA 1S9GA 1QQCA 4WFNQ 4CJTA 1VQOS 1DTQA 3MX5A 3FK4A 2Q97A 1NUEA 2ZNZA 1CULB 1RDCA 1JL1A 1X9JA 1C0TB 3MWPA 1K6YA 2HQCA 1HR0F 2E9RX 1M1GA 3CDWA 2Z30B 4NLQA 4I7FA 3K2PA 1N0UA 2Q79A 4IEIA 4KV8B 5DDOC 1RT7A 2K06A 2W2QP 1LWEA 2YWEA 2CZ9A 3SQ2A 3N01A 3CM5A 4DOZA 4DKWA 4WFBL 2HLUA 5ELZA 1REGX 4DCPB 4Z7CA 3AARA 3NMUA 4ZK7M 3BP8A 1YBUA 4V1Ak 1PGZA 2H5IB 3A5LC 4TY8B 3BY5A 2QL7B 2VWKA 1IN0A 3VAGA 1E6VA 4OV1A 1FRJA 4CQ1A 2UUCJ 4W98A 1VYAA 1NLKL 3GZ7A 4K8RA 4WFAL 2FY1A 2DY9A 2GVZB 3O6QA 5KFGA 1M5VC 1UEUA 4BRIA 3RUBL 3CD6S 1O5JA 3N5FA 1RBUA 3DU5A 4P10A 5DG8A 3MWTA 1YBTA 1S0VA 4AHRA 4E7JA 1Q79A 3D2FB 3D0PA 5LMNF 3LDNA 1WB9A 3E01B 1R43A 2GW8A 2DGOA 2NLXA 1WD6A 3R9LA 4Z0UA 3ID6A 3TANA 3QRPA 1VQ5N 2E1PA 2WW4A 5JVHL 4WYWA 4CIOA 3I87A 2HEKA 4E1NA 5KG0A 2O4IA 3CD5A 2GUPA 4HKQA 3PRDA 3ZTOA 2HHWA 3CJQA 3RW6A 4FJIA 5AXMA 1SCJB 2ZHOA 3OTOJ 4P2XA 3J7YI 2OSQA 2IAJA 1XTZA 3HZEA 1JLAB 5I42B 3N4PA 3R5DA 3SNNA 2WCXA 1KAYA 3UVJB 1OS5A 5GIOA 1HIYA 2LCWA 1QSLA 5F8JA 1I1GA 5LJ3Y 3U02A 4QWBA 3Q8PB 2E7XA 2GNKA 3H6EA 1W2BM 3GJSB 3H5UA 1U1LA 2QT7A 3DOMB 2V8GA 4ZVSB 3QGPA 2CPEA 5T41A 3O08A 2XMVA 4A8XA 1D4XA 3HYFA 2BABA 4E7LA 1HBMB 2WSEC 3NG8A 5KG6A 4LFAF 2HWIA 4DZ6A 2AGOA 3AVFA 5TKYA 3C6HA 2XCAA 1D9AA 1V6HA 2KFNA 2B7BB 1GOCA 2BX6A 3O80A 1Q82O 4URGA 3W3SA 2MHEA 5KT5A 3MOJB 4PCQA 2P9NA 1QVGM 3T19A 5CZVA 3D1HA 4UTGA 1PKUA 2EFNA 3LOUA 4A5BA 1X31C 3DDKA 2DNRA 2ZBIA 1VQ5S 5IM0A 4A48A 3VTIA 4IRCA 3QMLA 2BH1A 3ITHB 1ATRA 1XR7A 1NMDA 2B4VA 3DNCA 3A5MC 1Q8KA 4DUYJ 2KZMA 2M70A 3A3OB 2NLWA 3K89A 4KGZB 3R3LA 2UUAJ 2MGZA 2P9EA 1N48A 4M3WA 1GLDG 2OZMA 1C0UA 1UEVA 4CEDA 1WF0A 1NJIT 5E84A 5L38A 2ITGA 1XR6A 2MTLA 3AB2B 2VODA 2W8LA 4JI3J 3NNHA 4X4NA 4CZKA 4YS2A 3CW2C 1TL3A 3FBBA 4HH0A 4Y00A 5DMRA 3C16A 2ZH7A 1HWJA 5IFMA 2DTJA 2UV8G 2JL9A 1TTHB 4ILHA 4P73A 1PIEA 4GVEA 5LXRA 4YFUA 3MF5A 1IBKF 2J9DA 1JXBA 1R59O 3VQBA 4TQRA 2IJNA 3VQ8A 1RDWX 3UDVA 3O1WA 3W9HA 2HG4A 1U8SA 4CGFA 2GJFA 1KDNA 1KSPA 1R0CB 1YTAA 3QNWB 4O8UA 1Q16B 4P2MA 4DN0A 4B3RF 2W2PP 1GMVA 3KK3B 2AGQA 3CFRA 1JKHB 4P6QA 1ZS6A 3VQ6A 1V4TA 3AD9C 3CSKA 1BGXT 3POTB 4O3PA 5CA5A 1WF2A 2XEXA 3IR5B 4J9MA 5ITHA 1X1PA 3HHLA 3TR8A 4PG6A 5C42A 3PSIA 2X7IA 1D0EA 6AT1B 3W7BA 1I51B 3T3FA 2OEMA 2VB6A 3CPWM 3J80O 3ALYA 2XO7A 4JI1F 4J9RA 3VEOA 3MM7A 1V4SA 5HRNA 3W61A 1XIQA 4CJLA 2E29A 4KHYA 3ZSQA 2HHTA 2V8PA 2P9LB 3EGZA 3I8BA 4NA3A 4KTQA 1X9WA 2VJVA 2G0JA 3HI0A 1ATNA 3S3NA 3KWMA 5AQTA 3CCSN 4LD0A 1DRZA 2OTJN 2P6SA 2A42A 2RVJA 3TOQA 5J2NB 1IV0A 3HFVA 4C1NK 5BR8J 3OFGA 4CO1A 1S6OA 4ED2A 4CD1A 3OFHA 3TAGA 3RRKA 4HHTA 3FZBA 4C2MA 3QZ8A 3K9JA 4LBHA 3QJJA 4KYZA 1BUPA 1J5EJ 3QESA 5C10A 4LR7A 2WONA 3T1HJ 2QXFA 1U1KA 4F3TA 3G10A 2UUCF 4FZZA 2DR9A 2R7XA 4BC3A 1S1XA 4I67A 1N33J 4UOFA 5FROA 1DAXA 4A8WA 1S72N 5CH7B 3I0RB 3OFEA 4DBQA 1SIWB 2QA2A 2Q31A 1HNZF 2MQNA 5KG4A 1BQMA 3MCAB 4DXLA 4AHSA 4I68A 1FXLA 2LA4A 5LSRA 2JSXA 4ZVRB 4CJFA 2J7KA 3DRSB 4ID5B 3RZAA 5T14A 1FDAA 4FS2A 2RE2A 3VA3A 3MR5A 1NGFA 2F4VJ 4WXOA 3VQAA 3BSOA 3OUYA 3ZZRA 2HNDA 3DN9A 1N8RO 5BYSA 1RT4B 5D78A 3QEWA 4DV7F 3SQGA 2KKHA 3PRBA 2A6MA 3TTFA 2CPIA 3SFUA 1MWZA 5D4PA 3CJKA 3C15B 3HKWA 4G6VB 1B7YB 1VIXA 2HHHJ 3EPGA 3RG6A 3R5GA 3AODA 3K7RA 2B6AB 4M3ZA 3EGNA 2IHR1 4HTUA 1WEYA 2E1RA 3Q8RB 5IT9Y 4YHHK 1C1AA 4WKRA 3TAEA 1ZXOA 2ZZNA 5AQQA 2KYZA 3CCSS 2OI2A 5D0RA 1LWFB 4OHZA 2OTJS 4FVMA 2P9KB 1VJQA 4JYAK 3ULHA 4L75A 3S9HA 3VF2A 3EJMA 3SI6A 4RW4A 2QXLA 3BQ2A 2I5JB 3OS0A 2KXFA 1VSJA 4FLUA 2G2ZA 1XNRF 1X9MA 5GMKa 1I6JA 5HQMA 3B78A 3EUNA 2DJWA 3MPDA 1NGDA 3RRHA 3L3VA 5CE3A 1S72S 2OPRA 2EX3A 3NGTA 4C4WA 3ZT4A 3E9LA 3G25A 3H4DA 4WPAA 1S6UA 1HMVA 2VD3A 5C0YA 2B5JB 3VAFA 1XQIA 1VQLN 2UUBK 3RYLA 3JTOA 4DI6A 1XUPO 4KSEB 4JP8A 1YRXA 2CQ0A 2PFFB 1WC3A 3N6LA 5EY4A 3M8YA 2NUUG 3WBZA 4TYAA 1R6VA 3TWHA 4O23A 4AFFA 3VVUA 2HBRB 4D3HA 2EK1A 2P9IA 1RDBA 3DC2A 3M1VB 2ZH6A 5DJBA 1FERA 3TZWA 3OTEA 4NLBA 4CZJA 2Q2RA 1FKPA 4KBOA 1KS2A 4EP5A 2MY8A 3U9DA 4CM0A 1JCEA 3KD5E 2RN2A 4A57A 3I5CA 2FBXA 4M3YA 2IGIA 3PVXA 4KY3A 4B3TF 5AQIA 3AAQA 1PSDA 2AEJA 3ZSWA 5A8WA 3S3MA 2KXHA 3ILJA 5L9XA 3UNGC 4CJEA 3CXCR 3IS9B 1EQMA 2E6LA 5K5MA 4EO6A 4LSLB 3N0VA 3QWUA 1Z2LA 4B08A 5L1JA 3C65A 5IWAJ 4LF4K 3ZZYA 4YORA 2QO3A 1I94K 4IG3A 1GQEA 5CY4A 2FZGB 5AFUH 4LF7K 2ZVSA 3P38A 3TAMB 1R0AB 2QA4G 4CYUB 2O8EA 1RCXB 3VESA 4Y2CA 4QWAA 3UDCA 5BPMA 4USJC 3MFHA 3HZGA 1VQLS 1S49A 3WC2A 1VHXA 5IT0A 1TVRB 2LQ9A 1RTDB 4DV2J 4JI2K 1S59A 1GAOA 2ZQBA 4BG9A 5J1EA 1C1BA 4IFEA 3FZHA 1Z1ZA 2QA1A 3GOIA 3PLAA 1M5KC 3MXHP 3DXMA 1JQGA 1MWKA 4DDFA 1L3VA 3RMAA 1FTCA 4JV0A 4WJBA 2OJ3A 1UZDA 4OI3A 3KKRA 2HMIB 3W2VB 1S6QA 1NDLA 2UU9J 4W5OA 5DG9A 2VQFK 3CJTA 2H9ZA 5KPRA 5FRNA 3SAHA 4JD2A 4R0JA 3QIPB 2KH9A 5KG3A 3O9RA 3I8DA 2QIFA 4F8RA 4XH1A 3AA2A 2A10A 1UA1A 4Y2AA 3CJCA 1TFYA 2D3ZA 3UCUP 4F3OA 2L9NA 2WZ1A 1DEJA 1KOHA 1QVFR 1G99A 2YCHA 1KQSR 4PKDB 5IQ6A 3J7Z5 1N33F 1DLOB 4IWVA 4JI0F 1AB8A 1SJ3P 4IG0B 5D4LA 2XRIA 5HL7Q 3WDOA 1KC8T 2Y0BB 3VAHA 2YPZA 5H9FK 1CJVA 3JSYA 1S9FA 1HKAA 4F0HA 3V1RA 1EKEA 3PCOB 2IVYA 2F7TA 5C15A 2PZSA 4J9OA 1S6PB 1X3MA 2GIQA 2MKKA 3DLHA 4BVPA 3HT0A 3BJYA 1IKVA 2PA3A 3LW5C 4ZJOA 1LAWA 3E9OA 3M6GA 2LYVA 4OHYA 4ZLLA 1MNEA 3QJLA 4ISFA 2BQ3A 2G1HA 4FPIA 4TNOA 1FRLA 5DLGA 1JNZB 1WBBA 5IT9U 2PD1A 5FLXU 5H9EJ 3VEVA 3O4NA 2EG2A 1D8YA 4I9QA 4LQ9A 4DV4F 3W8GA 2QE5A 5KFOA 5HMWA 4ED0A 4FXDA 4BRAA 3QJPA 1Q0NA 3LWLA 5I3UB 2OD4A 3MECA 3QO9A 4F0KA 4NEYA 1R8CA 4HL9A 2AWZA 3PACA 3QSIA 5EX0A 4U67Q 3K0JA 1IXKA 1RAOA 3U3YA 1BISA 3CJRA 4OZ3A 1HUXA 3MX2A 3I56N 4LFCJ 2YWHA 2KL8A 2XGPA 4LRFA 2KJVA 4C8OA 3GIKA 2Y0SD 4WFNL 2XMTA 2EBGA 4C8KA 1C0TA 2G0IA 3M2VB 1B3TA 3KXDA 4JKGA 4HDHA 3G96A 5F8GA 4JOUA 2XBPA 1N5VA 4KV8A 3LAKA 3GFHA 3NH2A 4GO5X 4ZITA 1CZ9A 2DEJA 3Q2SC 1PC4A 3CIMA 3GSIA 1NDCA 1RWKB 1AZSA 1B70B 2AX1A 3GV5B 2E6MA 5FDLB 4NL5A 3ULEB 4URQU 2BKOA 2Z2ZA 3VGSA 3W5YA 2BJ9A 3WQPA 1WUAA 2W41A 2C3PA 4DV1F 2B9YA 3IR7B 4HHUA 2E2PA 3QT6A 2VIHA 3T7ZA 4TY8A 3CULA 4NLCA 3KLGB 1R3NA 1T3NA 2XNQA 3MMBA 4FPRA 1UVKA 4BE0A 3HCXA 3TAFA 2G2OA 1RT5B 4FJKA 3GJTB 1MWMA 2V52B 3CI5A 4CJKA 2ZH1A 2PE8A 4NRTA 2RMLA 2GVZA 3TA2A 4C48A 4MYUA 2YWGA 1T8EA 1TP7A 3PYEA 2N3OA 1LFPA 4P2SA 3QIOA 2QV6A 3L2UA 2MYFA 2ZGYA 1FX4A 3SCXA 4QAGA 1FJGK 2GGPB 5CYQA 4BCAA 4FVUA 4CO4A 2HPUA 2O67A 1AA1B 2NSCA 4DSJA 5HP1B 3O9TA 1K0TA 4JV1A 4IO8A 5AQFA 1WTFA 4IO9Q 4CIEA 3C2PA 4B3RK 3TX8A 4DN9A 3I56S 1JLGA 3T5KA 1TZ0A 3LO3A 2RS2A 1VSHA 2RNEA 4MJKA 3D6HB 4YY3J 2C2ZB 4HACB 2ABYA 2GFFA 1Z6RA 2WVDA 4KB7A 2WK4A 5F1XA 4MT1A 2XHWA 1TYQA 1JLAA 1WORA 2QEXN 1JXLA 3VALA 1UP1A 3BS9A 3EXCX 3AXMA 4B9TA 1RTIB 2GX8A 2NYIA 2CPYA 2B51A 4WQ5A 1OO0B 2Q0UA 1VQKN 1CLFA 1SIZA 1VQYA 2BM1A 4PEOA 2WBNA 4A8FA 2DXDA 4B9SA 3ZZPA 5HAOA 3MDFA 4S0MA 2N3LA 2KLAA 1BHLA 1RKIA 4NASA 4O8KA 1F9EB 1ZTWA 4LIWA 4OHWA 4U95A 5DK5A 3TZXA 3AOAA 5L1LA 3TJ9A 1CC7A 4UY8T 1IKYA 2GEMA 2VU5A 2UXDJ 3QGIA 4CH1A 5C2FA 5K14B 4NZ7A 4PKGA 3R1LA 2D74B 3FC9A 4BRPA 1OY6A 3NGZA 4EHTA 2UUCK 3SQ4A 2RQKA 2AZ3A 1W0HA 2KG0A 3W3DA 3CO9A 2B43A 1GT8A 3EZWA 2HRUA 4FBTA 1RDDA 1ZZNA 1VQPN 3TYTA 2L48A 2BKNA 1S1VB 3PG9A 5MLCV 4RBTA 3LPTA 1KD1O 4AXJA 3DRXA 1YGYA 3BSAA 4BREA 3HLUA 4E2FB 3V6HA 2RQCA 1T9UA 4M3RA 3R5CA 3SAFA 3KDNA 3R9PA 4DV7K 4MFBA 1RABB 3WUHA 1BHNA 3ZX2A 1HPZB 2QEXS 2XNRA 4DL4A 4PWDA 3ILLA 4KTZA 2XC9A 2W9BB 1ZBFA 4TYBA 1GOAA 3OR1B 3ADAC 2BTFA 4LR9A 3OA9A 2HNYB 4JI7J 4FCYA 1MG7A 3HJVA 2NXNA 2QRRA 5KTQA 3FZFA 4PL8A 2EFGA 4X4VA 2VG6B 3VQQA 1IWGA 3SSQA 3K2YA 3LANA 1EARA 3O6WA 3RAXA 3MMVA 2MZJA 3SPZA 4DL6A 5HVHA 5E5NA 4ZVOB 4K42A 2V7ZA 3Q83A 3U4LA 2V9KA 3HVAA 2DNPA 1HNWF 2ETJA 4LF5J 4H03B 4B9QA 5LOQA 3M8QA 1ZM2A 3HVWA 3G71N 3LP1B 5IT4A 4CH0S 2HF4A 5H1SV 2DEIA 4MO4A 1U0HB 3HI9A 3IRXB 4JKDA 4BRGA 3BDPA 1VQPS 1FDNA 4UF4A 3J7ZO 1CJUB 2JRSA 4DR2J 1Y00A 4F36A 2VG5A 4P52A 1C0GA 4QWDA 3AVNA 1CJKB 4QZVB 2IA0A 2HZVA 1NSAA 2OPQB 1VK3A 1XWLA 5JJBA 2ZFHA 5KFUA 4FWNA 2ZH5A 2P9LA 3MFIA 3PZPA 1B0VA 1G7CB 4V19X 2ZOGA 2MXYA 1NB7A 5ETVA 3FEZA 2GJ2A 4X4RA 2I8EA 3NEKA 4RU2A 4IOAQ 4OLOA 3VGTA 4DUYK 2FBYA 1SBRA 1T02A 4DSFA 3QEPA 3LP2B 3C7NA 3DDNA 4QPXA 2EKYA 3HSCA 3FEXB 3BQ1A 1F3VA 3AO4A 4O44B 3RMBA 1YF5L 2F65A 4QBUA 4B3TK 1MLAA 5DZ6A 4DV3F 4NMXA 3PTWA 3I0RA 3UD4P 3BF4A 1UJ5A 4U7UK 1VDHA 3I9ZA 1XMQJ 5CZXA 5JS2A 4DR5F 3CCLN 4ZVTB 2PI4A 2CDQA 3EICA 2VQEJ 3OVBA 4FP9A 4X65F 3G71S 4QQBA 2F5GA 4ID5A 2BUPA 4WFYA 4J9SA 3EMTA 3SQ0A 3VAJA 1IVZA 4RJVA 4ZCMA 2R8IA 4GV3A 3HDSA 4LF9J 3U27A 2DRDA 3BB5A 4CP5A 2AGPA 4CE9A 4AILC 2XO6A 1WHWA 5E3QA 1IO2A 4RW9B 4F4YA 4IOCL 1W25A 4NCAA 3MMAA 4ZPWR 1X60A 5GAGP 2KT5A 3F9MA 2DNLA 2NSBA 3VEWA 2CPDA 3DFEA 4JI8J 2KKZA 3MM5B 3AA9A 2NCKL 2JLGA 4X66F 4RUHA 2E4LA 5EWEA 1KKHA 2GMHA 4H4KC 2C28A 3OTCA 2QA4N 2FYXA 4AL6A 4OZ5A 4IJNA 1YJTA 4ECWA 1XERA 4NLXA 3FJ2A 1TFWA 3HVRA 5BR8K 4OVLA 2Z4PA 4NI2B 3VN5A 4GC7A 4J9PA 4FPBA 2FJXA 4DV5F 1J5EK 4WBFA 5EWFA 1YSJA 1S79A 4DTJA 4KGXB 1SI9A 1KFDA 3T1HK 3CCVS 1RT2A 2PBDA 3OYJA 3CCLS 4DFJA 5T7BA 4ZP8A 1N33K 5L39A 5AJ3J 4JI0K 1RT6B 5G4DA 4Y2MA 3TUZC 3EPIA 2LQ5A 3BPSP 4QIGA 2ZKUA 2Q36A 2L41A 3M6VA 2ITMA 2HVZA 1CS4B 5CYJA 4JKEA 4JEPA 6FD1A 2HKEA 4LVOP 4HTIA 3DM2B 3MM6B 4C0OC 2I7PA 3FSXA 3M1VA 4B02A 2YJEA 3VF4A 1RHUB 1HD0A 1IJFB 5E41A 4DTMA 4RW7B 3SAGA 4FJNA 3QQCD 5G0RB 2AJ2A 2LU2A 1B92A 1FD8A 3KJVB 1Y5NB 1HWUA 2FJBB 1S1WB 4MQ3A 3BKTA 4RUBA 2KU7A 2IJRA 4ZS6A 4CT9A 3QMQA 3THTA 1Y5LB 4GNIA 4OIXA 2CXEA 3O44A 2HHHK 3G8SA 1ZPWX 3BUZB 3KZBA 3KUGA 2R42A 4TU8A 3QFHA 2QA4S 1NGJA 4CW7B 3IS9A 3PYGA 3CNQP 2Q3PA 3D2WA 1Z4UA 3MM9A 2WAQD 3D6TB 1FFSB 4LSLA 2M8HA 4M3XA 4B3OB 3O3GA 1GLEG 4DR3F 3D7EO 3NGIA 3T9ZA 2Q43A 1BO5O 5FPEA 3O5TB 3QGHA 1Q5YA 2EWSA 5KT4A 2DT9A 5DM6L 3TAPA 2CQ4A 1R7IA 3EE3A 3TAMA 5DGBA 4CYUA 1LNQA 1ASUA 3W0LA 4ZP9A 1NHKL 3WNEA 4RNHA 4ZIVA 4ZLNA 3ZX3A 1TR0A 2Q1NA 1NZ8A 5AQYA 4E89A 4ES1A 1Q7LB 1CJTB 4K5RA 3AVHA 3CJ9A 4OMFG 2UVUA 2BBEA 4OYMA 2H3GX 3I6PA 4M3TA 4Y65A 3OHAA 3EE9A 5C7PA 4HEA9 1SJ1A 3C8YA 2RF2B 2VCPA 2NRVA 2CWKA 4ICLA 4UQTA 5DETA 3TI0A 1KAZA 2G8HA 2P5VA 2HMIA 3NMAA 3D54A 3UB5A 4HCBA 5GAEU 1SXLA 1AUDA 1SKUB 3FUYA 3IM9A 1HWKA 4FJMA 4GKJJ 3D3BJ 3V1QA 2IM2A 4WP9A 3H3OB 5HJXA 4H0OA 3CFPA 1OQ3A 1RADB 3D4JA 2ADCA 2XMAA 4DSLA 4LR8A 2OPSB 2CPHA 2MQ8A 3RMCA 1EP4A 1DLOA 1KLMB 1Y97A 4DX7A 1GLJO 4N8OA 3M9OB 1NKBA 2IVFB 2YY3A 1PBUA 1MN9A 3THXA 1RA6A 4O4RA 2GC8A 5HL7L 1YVFA 4FZVA 4DL0C 4P7VA 4YR2A 1W2BR 3PW5A 3KG1A 4IDKB 2BW2A 1RFQA 3P3DA 2BQRA 4F9OA 1AFIA 1Q86T 1ELOA 2I6WA 1FF2A 1I5OB 2DGSA 3KVGA 5LL6Z 3BN4A 4K5SA 4PUOA 2RRAA 2F40A 3IGNA 2WB4A 5MLCQ 3IDHA 3DLKA 1N5TA 4BRKA 5BYRA 1HBUA 3N6MA 3GDQA 5I3QA 4F4KA 4YOVA 4DR6J 4A8SA 4RLEA 3TX0A 2RILA 3TTCA 3NBPA 2D1KA 3AVBA 4CTAB 4OI0A 3MURP 1UAWA 3V9UA 4AQYJ 3NXZA 1QVGR 3FEYB 2FC0A 4I1TA 4K7QA 2QSFA 5KPZA 4EFHA 4Q0BB 4G65A 5D15A 1HQEB 1S10A 1FKOA 4J9UE 4XAKA 2O5DA 3D2EA 4DQQA 2B4JA 2AP6A 4DQSA 3DOLB 3UW1A 4H4OA 2W9CB 1X4HA 4QW9A 2UU9K 4KH6A 1EAYC 5I3PA 3K17A 1XQSC 3H42A 4JV5J 3VEYA 4A59A 2JWNA 2AZ1A 1HHSA 2CJQA 1DT9A 3T5LA 3SZ2A 1ZC6A 1H74A 2RB7A 3A5OC 2QN6B 2ALZA 2LDYA 3BBFA 4QIWD 3K9KA 3C6UA 2LVWA 2VGNA 4FK0A 1VRTB 4F4WA 2A2DA 3NGUA 5J2PA 3IN5A 3O9UA 2K7KA 2HOEA 4HI2A 1VIOA 2F9WA 1T11A 1VBZA 1QUPA 4CEFA 3BDEA 4LREA 3BN7A 4EI2A 5H1SQ 5HMYA 3JXOA 1HNXJ 4DB3A 3FCHA 3UPFA 4BRNA 2IJFA 1WC5A 1FVSA 1ZOTA 2AYMA 2V4RA 5FDLA 1ZM9A 4I9LA 3KMQA 3L3UA 4E7IA 3U1MA 2G8WA 3OYKA 4W4MA 3VQDA 1URNA 1XNQF 4ZDNA 4DUZJ 3KLGA 2E66A 3W9JA 4NXMJ 4DCHA 4OHVA 3KHLA 4YNQA 4ID1A 3ZNJ1 5AXLA 4OI4A 1RT5A 3IBWA 3WXKA 1MN7A 7AT1B 2F9DA 2PMHA 4MTPA 4AHUA 3R3TA 3AQOA 3DXKB 1TUGB 4TVAB 5A8RB 3HHDA 1D9DA 1PILA 4DPXA 1SV5A 2ZBPA 3RBEA 1U02A 5KT2A 5KRTA 3I96A 7FDRA 5H9EK 3H0PA 1OH6A 4PY5A 4MKVA 5JS1A 2A5XA 2OFHX 2JLEA 4MDAA 4M95A 1WWHA 3M2UB 2RH3A 2M52A 1O13A 4J90A 2HNZB 1FJCA 4R79A 1RUSA 4I6MB 3DLBA 3WIUA 2R7TA 1TV6A 2YKAA 5AZIB 2P9SB 1VSFA 4IOBA 1NCLA 1ZA1B 3CE8A 4W5QA 4XDDA 2DHGA 1R0BG 2V2KA 4KKOB 4FLVA 1U7LA 4LRDA 1NSQA 1NDKA 1OVQA 1B0PA 4RUCA 5GAHP 3VHQA 2ATQA 1SB6A 4Z4CA 2GHWA 4KC5A 1IWAA 3PKMA 3N9UC 3KHGA 1W26A 2RQ4A 3L09A 3MZIA 3WXJA 5C2DA 4RBVA 3VGKA 4CHYA 2CPFA 4KO0A 1TU0B 1EZZB 1HNVA 1XEZA 1VQ9N 1DHMA 4U8YA 2DR7A 4DTXA 4NLYA 3ZSVA 4OZJA 3PO5A 1FKAF 4FJLA 2RKIB 3ZYYX 4FLWA 4JHDB 3UD3P 4H4MB 3GJQB 5M2UA 1UWAA 1VMBA 3AVAA 5LJVA 2DNOA 4M45A 5GADP 4DV0F 2AYGA 3JTPA 3KKSA 1JB0C 1GMWA 2VBYA 2IVOA 2ZHBA 4GVLA 3OYMA 3QSYB 2Z2MA 4WYBA 4H5WA 3NRBA 4NPOA 1SC4B 3PX4A 3MR3A 3O5BA 3P83D 3BREA 4OQJA 2K3IA 2ZM6J 1RBRA 3PIPL 4E0DA 4KHRA 4DR5K 4JRQA 1QE1B 2CQ2A 4QCLA 5CXTA 3GBTA 4X65K 4YDXA 4OYOA 1L3SA 2MKHA 1HWIA 3RB0A 2RAQA 4H54A 2XLKA 3MAHA 4V19S 5C25A 4K2JA 4TN2A 3I82A 4J9NA 5MAOA 2ZE2B 2V4JB 2W4CA 5AE1A 5EX5A 3B8HA 5DQGA 2RHKA 3R6GB 2HNYA 5ETMA 4M42A 2F3JA 1AT1B 3TZZA 3U8XA 1GLCG 2QYGA 1REVB 4KHPF 2HF3A 2HGLA 3A8YA 2KT3A 4MO5A 4MLHA 1U6ZA 4TY9A 2WSFC 2B0GA 2E20A 1RWOB 4UUWA 5EWGA 3SDEA 5KG7A 1IBMF 1Q18A 1VQ9S 3M2RA 4OGCA 4RG8A 3L2QA 3H59A 4WFBQ 3BBBA 3ZXWA 4FF4A 4I56A 3NF7A 3T41A 2IRUA 2LP4A 1XHXA 1ROFA 1BC6A 4A8MP 2E5LJ 4GMKA 4WTOB 3M8PA 1YUWA 3VQ7A 2H48B 1CQNA 3TSQA 3V9SA 4OX9J 5GAEP 3NLCA 2W40A 1FK9A 4WQ5C 2M8DB 1RISA 1HLUA 1Y64A 3NGSA 1G15A 1K73T 2UXDK 4WFAQ 1FTRA 1B9FA 2IRXA 5CR4A 2X1FA 2DR8A 2VFVA 4TU7A 2E1ZA 2P51A 3NVMA 2KJWA 4QIFA 5KFLA 4FJ5A 4FWKA 3UIQA 2IC3B 3ENVA 1KQFB 1S4EA 4N7TA 3W5XA 3G9CA 3IMQJ 1RLDA 5A8KB 4KB1A 3SUNA 3GU0A 2P9UA 5JVHQ 3O1LA 3DRYA 1A9NB 2V5HG 3BH6B 3V6JA 1HWLA 3CEDA 1QJHA 1KP6A 2QWQA 4RNOA 2D0AA 3K0SA 4UZBA 1T05A 3ZT3A 2UXCJ 2VG7B 4IOAL 4DUZF 2FBTA 4PABA 1BOTO 1QAIA 1SKRA 2FC8A 1IR1A 3ENAA 1S77D 3WXIA 3SQ1A 3SJHA 4J91A 4O44A 5GIPA 4JI7K 5B7WA 5LM7E 2WVEA 5BXIA 5SZTA 3FQKA 2WOMB 5AQUA 2IRYA 1N36F 3UFCX 1TQLA 3R7NB 4CLTA 1KNZA 3KLFB 2JC0A 3IA0A 4OFZA 3ZNUA 2PC6A 4DR3K 4DX6A 2O8BA 1BUXA 3BZCA 2C1EB 2F4FA 4OJGA 5KFIA 1RT3B 1U2CA 5KFSA 4ECVA 1P6TA 2HS4A 3QWPA 1JLFB 4LF5K 3ATUA 1CXQA 2NZTA 2O8DA 5CHCB 1D8ZA 4G9ZA 2PMZD 1TKXB 1T03B 3AVCA 1VQ4S 3ULDA 2A3JA 3WEEB 2DO4A 2CJKA 3LPYA 4R0EA 2H1YA 1PC5A 3W64A 3AO2A 2QG9B 3IAM9 4DR2K 2RUGA 4LSZB 1Y3KA 3J7YP 3GYGA 3JSMB 3MEKA 3AGKA 1BL3A 4U9RA 4I4BA 3OYBA 3IG1A 5M1KA 2RD5C 5AZJA 2K1RB 4CD3A 3LALA 2FZCB 5ETLA 2OLWA 3WIVA 2BEFA 1IKWA 1TKTA 1XMBA 3FDSA 3AVGA 3OYLA 4MDBA 2A0FB 1WG1A 3OYFA 4FLZA 3EZOA 3ZZZA 3NL0A 4QS9A 1A0OB 3W1YC 2CJYB 1KFSA 3OSNA 1Q7YT 3CETA 2JVRA 3HKZD 2VFTA 4B3MF 1NGHA 4O0NA 4OYIA 5DZ7A 4DTRA 1EQYA 4PXCA 2LQ8A 1ITGA 2Y1LB 3GIMA 2MZSA 1D1UA 1HYSA 5F8IA 3ZLJA 4JI6J 3QFWA 3QBWA 4F4AA 3QFUA 3D9BA 3IXQA 1I39A 3TU5A 1P9YA 4I2QA 5JXSA 4DL3A 2DYAA 1NDPA 3CCRN 5IS2A 3ICLA 1SJRA 3R8YA 2NQPA 4N77A 1CS4A 1Y9OA 2ZH9A 3CDUA 1XMQK 1HBOB 3EXYA 2V9WA 1RAGB 4OJHA 4C8LA 3BBCA 5F3TA 4C11B 3DM2A 2VQEK 1U1NA 4O4GA 2E9TA 2ACYA 3MD3A 3RBZA 1RBVA 4CZLA 4DV6J 1LOUA 2XY5A 3MI7X 3H2VE 3SV4A 2FGOA 4LF9K 3DGPB 2ZOMA 3V6DB 1RTJA 3DOKA 4PRFA 5ETQA 4A8QA 2ZH4A 2EFQA 1K1QA 2Y8WA 2IVPA 2YX7A 3GG0A 2E7WA 1NJZA 1WAFA 3G87A 2PA8D 2MZTA 1X7VA 3MK6A 1RTZA 4USHA 2VKZG 2CYYA 1LW2A 2HIQA 4C0HA 1J5OB 4CERA 5IV4A 1M0SA 4PYAA 3ZO7A 2LQJA 2CG8A 3JQMA 4JKBA 2YBVA 1Z2ZA 1ZYQA 3OR2B 5LJWA 2RS8A 4RBUA 4QW8A 2E5LF 3AO5A 2J9DE 4OPJA 4G1QB 4NXNF 3W65A 4F26A 2DNGA 3G0ZA 2CFXA 2L9DA 4OX9F 1LXJA 2LLZA 2CH5A 4FYVB 1TL7B 4ALZA 3FCWA 2NXJA 3IGVA 1EIYB 3LP0A 2HS3A 4KJIA 3KLEA 3QEVA 4C3MA 1P90A 1S1UB 3CCRS 2Y3YA 2VBZA 1M5HA 4LFBJ 4OZNA 5AQNA 1TUWA 5HROA 4DR7F 1K8AO 5E3RA 3SBMA 4PKHA 1U04A 2HVEA 4I6YA 4JS5A 3LUYA 1V3SA 3TP2A 4DJBA 2GCFA 4WWSA 2RF2A 4K4WA 4ENOA 4F67A 3MCMA 2IVNA 1IKXA 3LDPA 1RAFB 2WBMA 2DTUA 4IR9A 4DSIA 4CFAA 1JJ4A 4C0BA 1U1MA 4IFYB 2GVDA 2VFRA 4F2RA 3GIIA 1U1QA 1F60B 2Z56B 4JKAA 4C3LA 3JQKA 4FYXB 3MEDB 4CK2A 2UYTA 3K5PA 3LH2S 3DLGA 1PCAA 2VPZB 2DPNA 2O8FA 5M2RA 4PKIA 2W2NP 3VQTA 5D0EA 4OI2A 1KRPA 1JLBA 1I3OB 4KH4A 2RHQB 3G82B 2NS1B 2LDIA 2B3TB 1NJWA 3IBCB 1KLMA 3AD8C 3GTYX 1B4SA 2CDRB 3MPWA 2F1FA 1U45A 3N28A 1LFWA 3ZZUA 3WC0A 3B6BA 1YDLA 1QLNA 2PY5A 2HFOA 4Z4IA 3ELHA 3KLHB 2CWXA 2DFEA 4IDKA 3J8AA 1YKWA 2JZ5A 1S76D 5J2MB 1VRUB 1KTVA 3EX7B 2G8VA 4MIWA 2CJAA 1WSHA 2MEWA 3OXFA 5ETKA 2CQ1A 3OXGA 4O0JA 3D6RA 1NGCA 4ED3A 2ASOA 3CDEA 1KR4A 2OELA 2K2PA 2GELA 3A4TA 1M1KT 3QNOA 1FWPA 1K8AT 4CVNE 2U1AA 4NLGA 3HVTB 5LMUF 3VERA 3LGHA 2J76E 3QT7A 2P1JA 4Z4FA 5KFJA 3THWB 2PI5A 3E2EA 2YHAA 3J7A1 5KFFA 3TABA 1OJ4A 3DLEA 3NDKA 1ILYA 1KQGB 3OW2R 2G1DA 2HBYB 5F2RA 1QAJA 1ASVA 1Q78A 2IIHA 1T6CA 3FFKB 2DKOB 5B8HA 1OSDA 1HKBA 3RBDA 1D5AA 3RR8A 4CEQA 2J0QD 3DOLA 4DUTA 2W9CA 4E1MA 3A3PB 4DPYA 4CO3A 4FF1A 2UVRA 4LMZA 4GKJK 2C2DA 1IG8A 1H2UX 2DR5A 4NCBA 5CABA 1UA0A 1GK8A 1C1CA 3BGFA 3BGUA 2F9JA 3HZ6A 3AY0A 2V63A 2NYHA 3CCUN 2E5IA 2GUIA 1NM2A 3AV9A 3T9NA 1VRTA 2J5AA 3ISND 4MAKA 4JI6F 4CK1A 3PIOL 4B1UB 2O3DA 2RHSB 4DR4F 4RW6A 3KHHA 1RZMA 2W7PA 2XQCA 2FJEB 2J8AA 2F8EX 1IM4A 2NRHA 2IA6A 1Q8LA 3HULA 2O8CB 3QB0A 2G8FA 2DIVA 1WNSA 3AO3A 2DRBA 1T94A 1JLEA 4B3SJ 2BDPA 3QETA 4A8OA 4IDHA 3R2CJ 4I69A 3QGGA 3FFIB 1HBNA 3PXGa 4X2BA 4EHUA 2MKIA 3F9KA 2HFVA 3A8JA 3QBCA 3W66A 2AP1A 1NHUA 2FHMA 4YHHF 3WNHA 3G8TA 1GFWB 5DDQC 3DRRB 2FHJA 2NPFA 4KHPK 5A8RA 4M63A 4XDCA 4DR6K 3J80U 3ATVA 2H51B 4CJQA 1PG5B 4FL9A 3HSZA 2J9CA 2MMYA 2CQIA 1OYEA 2Q1LA 2HK2A 1NLVA 2RRNA 4JK8A 3M32A 5KFMA 3KK1A 4AQYK 3NHGA 2MQQA 4KE5A 2HFZA 3T1YF 3JYTB 3M2UA 2W4PA 1WTBA 2JFDA 4WF9Q 4NA2A 2XI2A 4I6MA 2ZVIA 3SXLA 2DITA 2R2RA 1TL1B 2UXBJ 4TQSA 4WYLA 1B9DA 4K41A 3CCUS 2GO9A 1GMWD 5IC4B 3CDAA 4WIIA 1GLFO 3SMSA 4MIBA 3RB4A 3PX0A 1N5SA 1RTHB 4JV5K 1PAEX 2XSJA 2P2CB 1HRHA 2X74A 3AY9A 4CLZA 2DH9A 3O3FA 4CO0A 3CD7A 5HVFA 2UUBF 2FZKB 3H90A 4LSNB 4RPFA 5C2GA 5KAKA 1B64A 2Z1JA 2PEHA 2X3DA 3NNAA 2XGQA 3CD0A 1KVCA 3HSTB 2JC1A 4PG4A 4NA1A 1T9YA 4Y6IA 1JMTA 1RAAB 2AYEA 2R7RA 4CHNA 1WEZA 2Z57B 2FSJA 3JQJA 2X1GA 5HOOA 3H45C 2OSRA 4A61A 1MU2B 7FD1A 5EN1A 3GQCA 1KQKA 1BWEA 2YKMB 4H4MA 1FEHA 3ILIA 3EZ5A 2R8JA 2ZC4A 4DUZK 1N6QA 4ECUA 1TKZA 5AE3A 4CWBA 3GLJA 3ZTQA 2HSTA 4NLDA 2QLBB 1Q81T 2V2QA 2OPPB 1E3MA 3P45B 4WXWA 4ZVEA 2EK6A 4LRBA 1JJCB 1X4BA 4NLUA 2HSEB 1RWVB 4H0VB 3RSEB 1KVAA 5KFQA 3R5BA 5KRSA 3BKUA 3LZIA 4F25A 2VA2A 2YWWA 3CD6N 4LF8J 1N54B 4B9UA 2BMBA 1QE1A 3Q8VA 4LF4F 1FJ7A 2P8IA 4K25A 1VGYA 1X3NA 3SUQA 2YQ3A 4NLSA 1ZH5A 4CFDA 5CYMB 4OPHA 1NPKA 1U47A 3P5TL 2ZBCA 2YH1A 3EM1A 3OBWA 3TUIC 3HTVA 5T7LA 4DQPA 2JWLA 3ISNC 2ZE2A 1RHMB 3QT8A 4U6PA 4JI2F 4WU2A 4OYBA 3BGRB 1E6YB 1XC3A 2VFUA 1IBLJ 4GW6A 5IOLA 3K5NA 4GRSA 3U9ZA 2XS7A 2KO1A 2ACMA 4DTPA 3C6TA 2I9SA 4PQUB 1P8ZA 3WXMB 2H4YB 3M1FA 4M5DA 1HX1A 1JLCB 2DNKA 2ZJRQ 3PFOA 3PR4A 4J9QA 4LF6J 2VQFF 1NPPA 1N32F 1AUSL 3V1OA 4FOIA 1YVNA 4RW8B 4FOEA 3IR6B 1T9XA 5HRPA 2BE2B 5AT1B 4B3MK 4FDFA 2WC9A 4FO0A 1DTTB 2F8SA 1RWXB 4BR4A 2Z2YB 3NNCA 1JNRB 2GJIA 3VF6A 4USKA 4Y2KA 4OKEA 2FJDB 1DQAA 1GXUA 4CGDA 5KT7A 1S48A 1BMQB 1QAXA 2ZM6K 4ZPTR 1YVUA 3HFKA 3E1YA 1SQEA 1U1PA 5AFUA 3FSIA 3HXMA 2UZAA 4CF0A 4ZP6A 2WVFA 5HLFA 2ZUGA 2LEAA 2BXJA 3HRGA 4DPOA 2UUTA 3PYFA 1ZETA 1GH8A 2R7QA 2GIFA 3OVNA 4JI5J 1NJXA 3QNNA 2BOPA 4D3GA 3RB3A 4ECRA 1XR5A 2NPIA 2YKNB 1FDBA 5CZ2A 3FZKA 1RILA 4U8VA 1RCHA 3VENA 4A8KA 1WDDA 4PWUA 4USUA 2WOMA 4M7YA 4DLGA 3O2IA 4F7VA 1NOZA 3HK2A 2IOCA 1RYSA 4HT7A 2YX6A 3MHYA 4X62F 2KDOA 2AQ4A 2GHVC 4CRJA 1U0SA 3RAQA 1T9TA 3VQ4A 4Y28C 4TLRA 2CKWA 3H1VX 2P5GA 2E5LK 2CG4A 4NXNK 4OHXA 3BYRA 4OX9K 3EGVA 3MMCB 4H5VA 5E2QA 2V8VA 2CVIA 1J53A 5J2QA 3VZHA 2M7SA 3CHWA 2G8KA 2XG8A 2BGGA 3HX9A 4WKYA 1SUQB 1NBEB 3MEGA 1YBAA 4Z94A 5AQWA 1VSDA 1JLQB 4DR7K 3PR5B 1FXDA 2MPUA 3MCOA 3D66A 4FN5A 4P71A 3WX4A 2K1RA 5KFVA 2VWJA 4NLWA 4BGAA 2BM0A 3CMEN 5KFYA 2RRBA 4CZGA 2B7CB 4AHTA 1U2VB 1PJ5A 1V5IB 4LVNP 1HNIA 3RRGA 4H5TA 2CQPA 1HQUB 3F0NA 2JEGA 1HA1A 3PJXA 1FFGB 2KYXA 3JXUA 1WHXA 1H1VA 4WU3A 2L3MA 4F4ZA 1UFWA 3D0IE 4DS4A 3R6MA 4L3KA 2J6SA 2I1RA 1K9MO 2DGWA 4FM1A 1DTQB 4CBUA 3UI3A 2IMOA 1VBKA 1VRQC 1FRHA 2DRAA 3CXCM 1UETA 2UXCK 4K59A 1VK8A 4WIQA 3M4XA 2JEFA 2ATLA 3S41A 4I7FB 5EVZA 1S4FA 2ASPA 2HB5A 1UVLA 5KFRA 2LFVA 1CSJA 2NUBA 1RT7B 2O1PA 1LWEB 1FJGF 5BRHA 3W2WA 2JEJA 3CJ8A 4MH8A 3EWGA 4YR3A 3I0SB 2GQ2A 3KJQB 1RBOB 3BV8A 2ZF5O 3TPQA 3IP0A 4KHSA 4HUEA 1GTHA 4USIA 3M05A 2YH0A 3THPA 4C11A 3T5HA 1R89A 3MR6A 1LWCB 2MLZA 3Q7CA 3U7JA 1JCGA 4KT0C 1E6VB 3CJAA 1KCFA 3OYHA 4LT6A 1FD2A 1Q82T 3DGPA 2EFVA 2X6NA 3PO4A 1VK0A 1N52B 2HQDA 2ZZTA 4KPCA 1TL5A 1N88A 3CMES 5LMUK 4BRLA 2JNJA 3H25A 2QW9A 1F0XA 3OS1A 3ILOA 1HQ2A 2W7AA 3GFZA 4MKBA 1WI6A 1BWFO 1N5YA 1Z05A 4ZPCA 4DMZA 3ZSZA 3BR8A 5KFZA 3OR2A 1X9SA 3ENWA 3KK7A 4B9VA 3VMFB 1SZ2A 3BO4A 2HBLA 3UR3C 2HFUA 3B82A 5CCMA 4J9LA 1QVFM 4KRWA 1ZBHA 2IAJB 1KQSM 2L9WA 2XZDB 4Y3CA 4FYWB 4Q8FA 3ET6B 4CO2A 4WCEQ 3TSUA 4IFVA 2R8HA 2HAIA 2E8AA 4BC7A 4P9SA 5D0GA 1YJNN 4JI6K 3PFEA 4DR4K 1YG0A 4BACA 2AJ0A 3NGRA 4FJGA 4YOUA 4X64J 2AKWB 4ZVFA 1S57A 3Q86A 3I31A 4R8UA 2J0XA 5KFWA 3ZTRA 4BROA 1CPZA 3FBFA 2DNMA 4GKKJ 2QKBA 2CQDA 4UOGA 1FE4A 1UWBB 4Y2IA 3F73A 1G1XA 4AHVA 5A6WA 1DJ0A 4G1IA 3OTOF 5DS7A 4IOCQ 4YOXA 4TKTA 2PYLA 3M30B 3AJ2A 4DR1J 5AQXA 1RDRA 4QIEA 3B4MA 4FJ9A 3G82A 3RB6A 4K4VA 5IM0B 2XMMA 2C2RA 2POKA 4NYZA 3C6AA 5A2QO 4I6WA 3P39A 3WQUA 1KLNA 2YHWA 5KG5A 1GLAG 2QJ3A 4M94A 3KWIA 1GEHA 4C98A 3T1YK 1RSCA 3DLLQ 1FNXH 3WQTA 3DRPB 3KLHA 3BQ0A 1EETA 3LTOA 3SV3A 1C0UB 2R7OA 2VHGA 4U7BA 3OQ2A 1IG9A 1R31A 2ATCB 2HHXA 1YJNS 1SC6A 3RR7A 1B99A 4HHHA 1VFJA 4A2BA 1S1TB 4A47A 1AW0A 4FLXA 3HVTA 5D4NA 2M9KA 1ITPA 1FRMA 3C16B 2KW4A 2BE7D 3FQLA 3S1TA 4YDUC 3CF5L 3THWA 4LFBK 1N34J 1YJWS 3H08A 1Z25A 3FCVA 3O8WA 3IRWP 2A6OA 1FE0A 3EGWB 3TJAA 1NSPA 2QX0A 1N8RT 5AQHA 2AYBA 1X5SA 2GV1A 2B56A 1BI4A 3M8ZA 1NK0A 3SUPA 4HUGA 4WQ4A 4E19A 1P27B 2I7NA 5AQOA 4DUYF 1OH5A 3HHLB 3THYA 2LA6A 3O3LA 3VQEA 1NKEA 1D3WA 3H2UB 4C6AA 4O0IA 2UUAF 2FVQA 1WSRA 2FHJD 2VBWA 3UKRA 5EU7A 1CBKA 1R8AA 4R5PA 1YRUA 3AOCA 3MM7B 4JYAJ 4WP8A 4ZPAA 4CNYA 1TUUA 4RWXA 3MR7A 4JI3F 2HWTA 2IYGA 4BRHA 4YN3B 4JI4J 1KAXA 2RSQA 2LU1A 3SMZA 5AQJA 3C46A 3TRGA 1NU0A 4ED5A 1VSMA 1P9QC 3EY1A 3CC2S 5KFBA 2ZNYA 3P4UB 4ID8A 4DLEA 5DM6Q 1NK6A 3MAQA 1Y3JA 5LT5A 2O8CA 1M1HA 1M5SA 2I38A 4KIAA 1WLJA 3OD2A 3FGUA 3CQXA 1C0MA 4ZVQB 1FX2A 1MROA 1RACB 2DNHA 1EHWA 5B0BA 5LJ5Y 2WONB 1RCOB 3CJ2A 2CQBA 4UQGA 2QWOA 4O5BA 2DH7A 3CMAN 3SSSA 3FFIA 3VQPA 1S1XB 2ZDOA 2ZKTA 3W9IA 4O3SA 3D6MB 4O3QA 4KBIA 4DCOB 3RAMA 5L46A 2J0SD 2ILZA 5SUHA 5K8NA 2QWNA 2HURA 1KHVA 2HHSA 3AHPA 1G3OA 1VR6A 5DDRC 3H46O 4ANDA 2D3OR 1OYDA 1CLQA 3FRYA 3NCPA 2V2VA 2FUG9 4ZHRA 3KLIB 1BDGA 2R7UA 2ZWHA 5KOWA 3V4IA 1S7HA 5HVGA 3GIJA 3OUYB 3Q7BA 3NAEA 2D3O1 4BBYA 2XULA 1N32K 3SQGB 1EWRA 2D4WA 2DNYA 2KM8C 2HGMA 4DU3A 1WOOA 4PXBA 5BR8F 3CYMA 3PJWA 5BREA 3CJKB 4WF9L 1F2GA 4B9MA 4X4OA 2KI2A 1H2TZ 3Q8YA 3MTKA 1QTNB 3RWUA 1J5EF 2CNNB 2E9ZA 1RTHA 3TA1A 3MPYA 3BEGB 3OXLA 4LBIA 4LF2A 2APOA 1HPMA 3T1HF 1RAHB 2QC3A 3CWJA 4O3OA 3A2FA 4AYBD 2HFSA 3QLHA 3B6OA 3H98A 1ZM3A 3G4SN 4BC2A 3CJ5A 3DMJA 4RW4B 4DU7A 1I94J 4FPAA 4LF7J 3DKDA 1A7GE 2IM0A 2C2MB 1ICEB 2YKQA 1S0MA 1TL4A 4DU1A 4WFXA 1NBWA 4FW2A 1A5VA 3CMAS 2XSFA 2E2QA 1LW0A 2F4VF 4RKUC 4W90B 1RWUA 3DCAA 3TJ8A 4U96A 4MKYA 3IMXA 2ASMA 2OPRB 3CCWA 1VQ8N 3UD5A 1HR0J 3TSPA 1VS3A 3NP5A 3O4WA 1NGGA 3TARA 4P7TA 3M6UA 2OUGA 1FRIA 3WHIA 1HMVB 3AJDA 3KK2B 4L6V3 1HI8A 2XTJP 1QQOA 1BQNA 2HHHF 4B1VA 1YT3A 2OPPA 2QYCA 5ETSA 4KHUA 2MLYA 4H0XB 3FRZA 3IWLA 4EZ9A 5ADXA 4CBXA 1QSSA 4HCCA 2KRRA 3KFWX 1EX8A 2YNGA 2LXFA 4ZKAA 3VR1A 4DF4A 4X62K 3R5JB 2P9IB 1Q95G 2V94A 3KWGA 5AQSA 3ZSRA 4ISGA 2IBOA 1R8PA 2HAFA 3EVOA 3CT9A 2FVRA 3K8VA 2GS8A 5CYMA 2ZZMA 1U1OA 1T9WA 1WF1A 1KHWA 3IFEA 3FKBA 2PEBA 2UXBK 3IO1A 2HBMA 2CNLB 3HSGA 4YEAA 2BJDA 2BACA 2HBZB 2FJWA 4F3QA 2P9GA 5B0CA 1FJEB 1CULA 2B9XA 4N41A 3G4SS 2DGUA 1DZ5A 3GFYA 5A8WB 2FVPA 5I9EB 4KHWA 3BGRA 4NLRA 4H5RA 5LMNJ 3P6YC 2YXLA 2KFYA 1A5XA 2WRMA 2GWKA 2FHKA 1WUUA 4WP3A 2QWRA 4PQUA 4E8UA 4LRCA 4IG3B 4NRUA 5AE2A 3R97A 3SYZA 1JLCA 2MJUA 1WOQA 4JS4A 3J81j 1VQ8S 4V19J 2AEFA 2ZJRL 4Y1DA 4MKAA 2OZSA 3ETOA 4LRAA 4QYRA 1V9OA 2F9TA 4RW8A 1H7WA 4FWLA 2BE2A 4EBDA 3MXIA 2HMPA 3K58A 2XY7A 3D1OA 1DTTA 4P72A 4X4PA 3CQ8A 1Y4ZB 2CPXA 4Q44A 1C1BB 2C3OA 2K8GA 5AQKA 3CMQA 3AFGA 4MLEA 2IS3A 2VICA 3OL9A 2FSKA 2FF6A 3DXMB 1WNEA 4EIAA 1L3UA 3PY8A 4L73A 3UN2A 4JI4F 3D2FA 3UDLA 1F5CA 3E01A 5E7OB 5BPNA 1S6QB 4ED4A 1L5UA 1NEEA 2OD6A 3PHEA 5IWAF 5GVQA 1X8DA 4JD2B 4LFAJ 3AB4B 4CO5A 3I5AA 2Y9HA 2Z8QA 2CRLA 1NNDA 4WE1B 1O51A 4FNHA 4IO1A 5ETPA 2Z1GA 3F44A 1CZBA 2M4MA 1YI2N 2D41A 2BZ2A 3NOCA 4QR0A 1RU2A 4ELVA 1JJHA 2KN4A 5C12A 4EFAC 2RE1A 5D0HA 4LBPA 4GO7X 3JTNA 3UCZP 4ZJQA 4CF8A 1NU4A 3JAMO 5I42A 4FLTA 4PG8A 2HBQB 5L1IA 2ZDPA 2DK2A 4BLGA 4DV2F 2FD2A 4ED8A 3UVJA 1TAUA 2XI3A 3KHYA 3TO8A 3CJ7A 3CCQN 2AU0A 2HHQA 1IBLK 2V50A 4J9VA 1VJWA 1CJVB 4CFBA 1W2IA 1SVDA 4ETZA 2V67A 3DOMA 1YX2A 4AUKA 1YTUA 2ASYA 1U26A 3G2XA 1XC9A 4LF6K 3K5LA 2UU9F 3A3NB 2LEPA 5F0UA 2C2OB 1HBMA 2HQ3A 1NH8A 1IKVB 4RUAA 3I4PA 4ED7A 2LMIA 4QPTA 5CD4A 4DTOA 3E8OA 2FHOB 1VC0A 5A6PA 3P5BP 1OH8A 3H2LA 1SUQA 4GVBB 4M5GA 3HSDA 1IBKJ 1VCTA 2FVCA 1F6TA 2XWXA 5KFHA 4QYZJ 2ROEA 4J9KA 3PIPQ 3SUOA 5KFDA 3C14B 3GV8B 2CJ9A 1B0TA 2RT3A 2W1BA 4FWSA 3ZZ0A 3HOTA 4CZEA 4Q43A 3ITHA 3MECB