1HPZA

Human immunodeficiency virus type 1
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 122
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hpzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hpzA05
2ZQBA 3QYYA 2ZE2B 2JC0A 4OKJA 5J2PA 4IBNA 3TAMA 1C1CA 3RB3A 4FLZA 2FVCA 3ZCMA 2KFNA 4KKOA 2IBKA 2LSNA 3MR3A 4NZ0A 3EZUA 1B9DA 3GV8B 3QESA 4O4RA 3KKSA 4IH5A 2JEIA 3BQ2A 1WLJA 4PY5A 2ASJA 2ZD1A 3CDUA 1S9EB 4CHPA 1IKYB 2AX1A 4JV0A 3GV7B 4MQ3A 4NCGA 2QV6A 2XI3A 5KFVA 2W8LA 1KFDA 3RMBA 2FJVA 1T3NA 4EZ9A 1VSKA 3ZSWA 2J6TA 1LW0A 3G6XA 1LWEB 4PUOA 5F8GA 4F3TA 1YVFA 5HRPA 4CEDA 1SKSA 5FRMA 2G8FA 1CLQA 4HYKA 4RG8A 4MK9A 3ZT3A 1YTUA 2W9BA 4IFYB 4DG1A 2IJFA 1S1TB 4RUCA 3ZT2A 4DSLA 3CM5A 2B5JA 1TL1A 3SZ2A 3RMAA 4ZTJA 4CF0A 4K50A 2HVIA 2W7OA 4AILC 2C2EA 3L3UA 4C8LA 3OL6A 4KAIA 3AVMA 4O55A 2IM2A 3H2LA 1NJWA 4KB7A 1YTAA 1TKZB 3DRPA 1J5OA 3CJ3A 3CWJA 3B6PA 3SPZA 4H4MB 1KSPA 3SCXA 3RBDA 2P5GA 3TABA 2BQRA 2GIRA 4O5BA 4CK2A 3CFRA 1RCHA 4J9QA 1TL3A 5C24A 3QERA 1D8YA 5KT3A 4ZP7A 1OS5A 1K1SA 4CEOA 1ZBHA 2R8KA 4EO8A 3ITHB 3T5HA 1JLBA 3UDLA 3KLGB 1N48A 1XI1A 3QNNA 1NK5A 4TY8A 5J2QA 1HRHA 1QSYA 4NCAA 3CJ4A 2ETJA 3VQ7A 1DTTA 4BE0A 4YFUA 3RB4A 2VA2A 4R8UB 1S0NA 5DG8A 3KK3B 2ILZA 5FDLB 2YNHB 4IDKB 3OHBA 1TKXA 4ID5B 1VRTA 4YR3A 3T3FA 4Z4FA 5KFCA 3SYZA 1T05A 4DQRA 1XR5A 4EZ6A 3V81A 4FCYA 1KLMA 4DTRA 3DRRA 3OVNA 4JRPA 1A5WA 4IH7A 2C2DA 1HQEB 1BHLA 3BQ1A 3U3GA 3KLFB 4IG3B 2NUBA 3DOLA 1KVAA 3P1GA 3VQPA 2AX0A 3I0RA 1ITGA 4B9LA 2AU0A 4QWEA 1C1BA 1RILA 5KI6A 3C6TB 3CDEA 2RF2A 2HHQA 1D0EA 3KHGA 1IKWA 4FK2A 2FJXA 4HUEA 4IQXA 3G10A 1N6QB 1W25A 1JLQB 1BQNB 1QS4A 1RT1A 3O3HA 4DU3A 4ZVHA 4F2RA 3OS1A 1JLFA 4NLXA 2W42A 4E7LA 1CXUA 3GQCA 4RW6B 3RR7A 1RBTA 4N56A 4ZVGA 5FRNA 4F4KA 4Q5VA 4CEFA 3OLBA 4LSNB 4QWCA 5KG4A 4LSLA 1S1UA 4M94A 1RT5A 5CYMA 4CESA 3K5MA 4OLAA 3MEEB 5KT7A 4QCLA 2IM0A 3HVTB 2Z1JA 3CFPA 2G8VA 5F9LA 3OYGA 3ZSVA 1IKVB 3L2VA 4H54A 3LP1A 1HMVB 4O3PA 1T03A 1T7PA 3V4IA 4MFBB 1RYRA 5CZ2A 3BGRB 4N41A 3G86A 1LW2A 5HBMA 1RTDA 4NYNA 1EETB 2PYJA 3O4NA 2FLPA 4KO0A 3GILA 1X9SA 3V9WA 1SL2A 3IG1A 4ELUA 4DL2A 1GX6A 5KRSA 3ZSRA 2XRIA 5SZTA 3NAEA 4YR0A 3PW7A 1SL0A 1JLCB 1S49A 1VSHA 4DQSA 5KFTA 4I9QA 4EEYA 3B6OA 3DLGA 1JL2A 3Q8PB 5HLFB 3OYCA 4KE5A 3OYDA 4LQ9A 2HNYB 1FK9A 5KFLA 1QTMA 1C0TB 3KJVA 1BIUA 4XO0A 1C0UB 1WSIA 3F9KA 3TANA 1TAQA 4ZPBA 4FJIA 3KLEB 4K4YA 1C0MA 1ZBUA 4CE9A 4DFKA 5J2MA 1LWFB 4EYIB 5J2NA 3S9HA 3MAQA 3GIJA 2G8KA 1UA1A 3CJ5A 3AV9A 3ISND 2AGOA 4CECA 1XR6A 4UQGA 3VQQA 4Q0BA 2FVQA 3NGIA 4K4XA 3MEGA 3LWLA 4OGCA 5HRSA 4RW4A 2V4QA 1BI4B 3LP0B 4Y1CA 2YNGA 4DSKA 4AHUA 1IKXB 3AVNA 3KMSA 3MR5A 4ED8A 2GUIA 3LWMA 2ZE2A 3LZJA 1SV5B 5C25B 1JKHB 4JV2A 4FJ8A 4ECWA 3MEDB 3N6NA 1ZETA 3H08A 4ECSA 4F2SA 1VSLA 4OL8A 1NK9A 4NYZA 4NLVA 3IS9B 5K14B 4KHRA 5D3GB 4FZXC 1L5UA 1S9EA 4DTMA 1IKYA 4RNOA 2KTQA 1ASVA 4TYAA 3KK2B 4K4WA 4CIGA 2G8WA 3RAXA 1X9MA 2YKNB 4F8RA 5T14A 3KK1B 1LWEA 3UPFA 2W9CB 1U47A 3VN5A 4M42A 3DM2B 3E01A 2HNDB 4NLQA 1JIHA 4IFYA 4LY7A 1NK0A 1S9FA 2YHAA 1YT3A 3AVJA 2OH2A 4O44A 1S1TA 4CF1A 3DLBA 2B6AB 3V9UA 5L1LA 3QGHA 2EHGA 4M3YA 5HRNA 3M8QB 3UQSA 2R8JA 1RT6B 3EZ5A 1CSJA 3AO1A 4EP4A 2KFZA 5KFSA 1SKRA 2JEJA 2VG5B 4GMJB 4MIBA 4XPEA 5DQIA 3OYNA 1VK0A 4FM0A 2G8HA 1EP4B 1X9WA 2PY5A 2R8GA 3SNNA 3CFOA 4H4MA 2PYLA 3E51A 4E7IA 4O4GB 2Y1IA 1BCOA 3DI6B 3OYLA 4TLRA 3NE6A 3QIPA 3OJUA 4RW7A 4MKAA 3LPUA 4ZPDA 1HARA 4ZMMA 3OYAA 3KLIA 3OS2A 3PUFA 2RPIA 1GOAA 4NLDA 3H5SA 3S3NA 4DTSA 2HWHA 1T94A 4E7JA 4RUAA 4CFAA 1UWBB 2YKMB 4GW6A 1XWLA 4NLOA 3SQ4A 1VSIA 4FLVA 3DMJA 1S5JA 2OPSB 4KFBB 4QWDA 1J54A 4W5QA 3FFIA 4KHWA 4CCHA 3LP2B 3H40A 4R8UA 4CJ4A 5L1KA 4FK4A 4U6PA 5HRRA 2ILYA 3KK3A 4DL4A 2GBZA 5FDLA 4CJSA 3M9OB 4IDKA 5KG1A 1WSEA 4DFJA 4ID5A 2OYQA 1KFSA 4IH6A 3LALA 1DTQB 4M41A 4CJLA 1HQEA 4O0IA 1Q9XA 2ATQA 2YNFB 3KLFA 4KV8B 3PV8A 1RDRA 4QW8A 4DFPA 2C28A 3IRXB 2UVVA 3C6TA 4J9SA 2WB4A 1UOCA 3BSNA 5F8NA 1WSHA 2D5RA 1NJXA 3BJYA 1JLQA 1RT4A 4BDZA 3H4BA 2DPIA 1WAFA 3PO5A 1BCMA 4EP5A 4IR9A 1BQMA 2XC9A 5F8HA 1T8EA 1S9GB 3V6KA 3KMQA 3K5NA 2HB5A 3U3YA 5KGWA 4ZTFA 1D1UA 3MF5A 5I3UA 4B3OB 2D3ZA 3OL7A 3K59A 3VQCA 4IKFA 1CXQA 4IRDA 4K4VA 1RBVA 2QKBA 2HMIA 5CYQA 3MEEA 3HVTA 2IDOA 2E6LA 2R8IA 3OYHA 2X6NA 3M9NB 1IKVA 3AA5X 5JUMA 4ECUA 4TSXA 1W9HA 1FXXA 4AHSA 3HPHA 4ED1A 3RMCA 5HP1B 1EETA 5FROA 3EYZA 1B9FA 3M8PB 4DWIA 1RNHA 4RW9B 2VG6B 1D5AA 4K4SA 4MK8A 1HPZB 4HVJA 1NJYA 4DLEA 1IO2A 5L1IA 3TI0A 1U4BA 5KFNA 3TAQA 1DLOA 2FLLA 4XIUA 4JLHA 1U45A 2JC1A 4FBUA 1JX4A 3KD1E 1JLCA 3KHRA 3HL8A 1K6YA 4ID1A 2WONB 5HLFA 5C42B 2UUTA 2OA8A 2ASLA 2HNYA 2UVRA 2ITGA 1O1WA 3CQ8A 1C0UA 4YMEA 4FZZA 3AVHA 4AHRA 4WFXA 1XC9A 4I2PB 2YHBA 3KKRA 4NLRA 3T1AA 3SJJA 1ZBLA 4Z4HA 4FXDA 1HQUB 2FLNA 3O3GA 4TXSA 5KG7A 3K2PA 3KNAA 1FKPB 2O5DA 2AGPA 2G8IA 4HCCA 1ZYQA 4HCBA 2XCAA 3NMAA 3HP9A 5CY4A 2DY4A 4CEBA 3QEXA 4J2DA 2HNZA 5KFFA 3EY1A 4DQQA 3HKWA 4YP3A 1RTHB 3BSAA 3CO9A 2UVWA 2HHWA 3NKYA 4KTZA 3LP0A 4DL3A 2ASDA 4CK3A 4FLWA 2FC0A 3ALYA 4O0JA 1YVUA 3HSTB 1SV5A 5C25A 2XY5A 5DG9A 1RT7B 2V0NA 4CEAA 3TVKA 4F50A 2Z1GA 3MEDA 1BGXT 3IAYA 2HVHA 3KLHB 3LP3A 3P5JA 1G15A 1XHZA 1WSJA 3PX0A 5KG3A 2X78A 5L9XA 3QZ8A 2HHSA 4OVLA 5F9NA 4ZP6A 5KG2A 3ZSZA 3RR8A 2HHXA 3LAMA 4FJLA 1RT2B 1HNIB 4KREA 3KK2A 4FJKA 3SFGA 3DLEB 3HT3A 3SQ2A 3OY9A 4Z4IA 4O3OA 3I0SB 2YKNA 1JLAB 4CK1A 3KK1A 2V4RA 3OL9A 2W9CA 3QIDA 3QO9B 4KBIA 3DM2A 4ELVA 3Q8RB 3PW2A 3ASMA 1S4FA 2HNDA 1QE1A 5KFRA 4JRQA 3NAIA 3OHAA 1FKOB 5F8IA 3VA0A 1NOYA 4LQ3A 1CZBA 2B6AA 2B4JA 4JV1A 3PVXA 3QGGA 4CF9A 2B43A 4K4UA 4I2QB 3S3MA 3M8QA 2HW3A 2HHUA 3CG7A 1RYSA 4TQRA 4KPYA 3OYBA 3H5YA 1WAJA 3TQ1A 4BACA 4CGGA 3JYTA 2IOCA 2D41A 2VG5A 2AWZA 5KFYA 1TKTB 3JSMA 4FM2A 1WNSA 4O3NA 1ASUA 1EP4A 3RB6A 3DYAB 3MECA 4ED2A 1JLEB 1VSDA 4ZPAA 1SH0A 1GOCA 3SQ0A 2BRLA 2DFFA 4O4GA 2BQ3A 4M3UA 4IG0B 3DI6A 3Q8SB 2F8TA 4ED6A 3HHKA 2WOMB 4HUGA 3VQBA 3FDSA 1RT3A 1JLGA 3BREA 4DU4A 1KRPA 3QLHB 4CJRA 3NF8A 4IFVB 5HROB 4DTPA 2IM1A 3I5BA 3KOAA 2ZKUA 1UWBA 5DQHA 2D3UA 2HHVA 4FW2A 2YKMA 4CIFA 2E9TA 3NL0A 3K5OA 4CJEA 2KQ2A 3QEIA 3AA2A 2OPSA 4KFBA 3VQ9A 4RW8B 5KFIA 1RTJB 4H4OB 1N5YB 4F4YA 3FSIA 1KVBA 4C8OA 1EX4A 4TN2A 2DPJA 3OYEA 1R0AA 4CJVA 3TAMB 3GIMA 4EBCA 1WSFA 1I39A 4CJFA 2RDJA 1RTIB 1DTQA 1U09A 1S10A 3ULDA 3V1QA 4QOZB 3VQEA 5KFPA 4O3SA 2YNFA 4J9PA 4KI4A 2Q3SA 4DTNA 2OPRB 1U49A 3I5AA 3V9SA 3H59A 3L2QA 4Y2AA 3IRXA 1MMLA 2E6MA 3L2RA 1NHVA 4EO6A 4DEZA 4J9RA 4NCGB 4DF8A 5KFZA 3SV3A 2C22A 3ZT0A 4Y2CA 5KFKA 4CGDA 2O4IA 3DLRA 1JXEA 4R5PA 4KHMA 4OKKA 1RA7A 3GIKA 4PUOB 2DFEA 4CFBA 4ECYA 3H98A 1S9GA 1ZTWA 3T5KA 2W9BB 3TAEA 3BSOA 2QXFA 4DG1B 2DFHA 4B3OA 2VG7B 4WFYA 3HK2A 4K8XA 1W0HA 5DGBA 2B5JB 1U04A 1TL1B 1C2PA 1QUVA 4CJTA 2QK9A 2EC0A 4JUZA 3PZPA 1TVRA 3AO5A 2JEFA 2R7YA 4J9OA 2QE5A 2D7SA 4XPCA 4FJXA 1RAJA 3HPGA 1S48A 4H8KA 1I6JA 4Z4GA 5HP1A 4NLUA 1TQLA 5J1EB 4LH4A 3TWHA 3LPTA 5C24B 4IOBA 4ZP8A 1TKDA 5EWEA 1NK4A 1TK8A 1REVB 4FJHA 1HJRA 1S6PB 4N5SA 4E7KA 2FVSA 1NHUA 3MFIA 4DSJA 2IS3A 1BISA 3MR6A 3HVWA 4TY9A 4J2EA 5KFMA 4TY8B 4F4XA 5KGXA 4I2PA 1XR7A 3HVAA 3AVGA 4Q43A 3UIQA 3KIOA 3WNGA 2EX3A 1HQUA 4OGEA 1EXQA 4CJ3A 2F8EX 1S97A 2D0AA 4K8ZA 1SH3A 1FKPA 4MKBA 3U6FA 5KFHA 4RNHA 4YNQA 2E4LA 3OYJA 3TAPA 2XGPA 4Y34A 2IGIA 1KHWA 3QINA 3V81B 1NK8A 4ZHRB 1IM4A 1NOZA 1TKZA 3ZSQA 4Q45A 1KTQA 3LAKA 3RWUA 3I0RB 3THVA 3MXMA 3AVFA 2CKWA 1C1BB 5E41A 1BIZA 2E9ZA 3A2FA 4YQWA 4HTUA 1IKWB 4E89A 3DOKB 1ZTTA 3AVAA 1S1WB 4M3TA 2BANB 4KTWA 1SKWA 4W5RA 3AVBA 1CZ9A 4FLXA 3NF7A 2XY6A 3NGYA 1RT1B 3NH1A 1S1VB 3ITHA 3SUQA 5KT6A 2HHTA 2P5OA 2R2UA 3RB0A 4DFMA 3SPYA 4CJWA 3M8RA 1VSFA 4BE2A 2UUWA 2ALZA 3KLGA 1RT2A 1HNIA 2OZSA 1LWCB 4B9NA 4F4WA 3MXJA 3DLEA 3M9MB 4AHTA 4FM1A 1NNDA 4CHNA 5KFJA 1S0OA 4KHUA 1JLAA 1S1UB 5CYMB 1HNVB 1C1AA 1NK6A 3BDPA 3D5MA 3NF9A 1L3UA 2VWJA 4NLWA 5C5JA 4FS2A 4CJUA 5DK5A 4DS4A 2YNHA 1S6QB 1LAVA 2GIQA 4O3RA 3OYFA 4W5OA 2RKIB 3HJFA 5KT4A 3PW4A 3IGVA 3D0PA 3LP1B 4IR1A 2I5JB 3AVIA 1QQCA 1WN7A 4AHVA 3CJ2A 5KG0A 3QEVA 5F8MA 4O3QA 2R8HA 3V1OA 4IG3A 4QW9A 3NH2A 1RA6A 4MK7A 4J2BA 4M3XA 2VA3A 3VQ6A 3HYFA 3NH0A 2RDIA 4ECTA 4KSEB 4HUFA 4NCBA 3BSCA 1N6QA 1WSGA 1BQNA 4MH8A 4WZMA 3AA4A 3NAHA 4QAGA 3HPOA 1FK9B 4ECQA 3QEPA 3KJVB 4B9MA 3BR9A 3I8DA 1NK7A 3C95A 4IG0A 5KFQA 2OPQB 4RW6A 5KFEA 3BQ0A 1VRUB 3VQ8A 3PR4A 5KG5A 1N56A 2WOMA 1ZBFA 4LSNA 4WXWA 4FLYA 4C8NA 4EBEA 3TARA 3QLHA 3MXIA 1QAIA 4IFVA 5HROA 3CDWA 4DTJA 4CF8A 3ISNC 1MU2B 4HHTA 3WNHA 3V9XA 4FVMA 3DLHA 1HMVA 3K57A 4HKQA 2YNIB 1HYZA 1A5XA 4RZRA 1TK0A 4MFBA 3BGRA 2OPPB 1N5YA 1Q8IA 4CF2A 4DS5A 4RNMA 4CHZA 4FK0A 3AO2A 4BE1A 2WHOA 1TV6B 4ZPCA 1L3VA 1NJZA 1RTIA 2A1RA 4ZP9A 2XCPA 1ASWA 2FVRA 2X74A 2I1RA 2OPRA 3H4DA 2BR0A 2BE2B 4CGFA 3SFUA 1C0TA 4PQUB 4WXOA 4PWDB 4CEZA 5DLFA 3V1RA 3KLEA 4M3ZA 5KT2A 4B9TA 3DRSB 3PX6A 2FBXA 1LWFA 3V6HA 2KW4A 4N47A 3TAFA 2JEGA 4YR2A 4E0DA 4DL6A 4NLTA 1UA0A 5SWMA 3VQDA 3E01B 3F73A 4GC6A 4DQIA 4CHYA 1IG9A 2HAIA 1F21A 4G1QB 4O44B 2VG7A 4GC7A 4B9UA 4ECRA 3L2WA 2XWYA 4DLGA 3SI8A 1BI4A 3RRHA 3V6DB 4RNFA 4WZQA 4WFZA 4URGA 1IKXA 4W5NA 1Z4UA 4NLPA 3L2UA 1JKHA 1SUQB 1HYSB 4CGJA 3SUPA 2IC3B 2XY8A 4CERA 3V9ZA 4KHQA 4BWMA 2FBTA 3Q8QB 4ECXA 5T7BA 3IS9A 5K14A 1X1PA 5KTQA 5J1EA 5D3GA 3PO4A 1QAJA 4I7FB 5I42B 5F8JA 2A1SA 2WK4A 3V6JA 4CHOA 4F3OA 2D0BA 3OJSA 4WE1B 4DF4A 3QIPB 5KFUA 4RW7B 2WTFA 5KT5A 5KG6A 4ICLB 4DMNA 1REVA 3QETA 3KLIB 4E1MA 1S1XB 1S6PA 3SUOA 3KHLA 3OL8A 4JS5A 4Q8FA 4DU1A 3L8BA 1TP7A 3CM6A 4BDYA 4ED0A 3DMJB 5L1JA 3SUNA 2G8UA 3FFIB 5F8LA 2PZSA 2IAJB 5EWGA 5KFOA 3AA3A 3NBPB 2V9WA 1RT6A 1RDCA 4U7CA 4E7HA 2GV9A 1D9FA 3I5CA 4ZHRA 4KB0A 4RU9A 3H5XA 2KZZA 4FW1A 3CVKA 2ATLA 3LZIA 4KAZA 2FBYA 3WNEA 2Z1IA 4NRUA 2AJQA 3AVCA 3OS0A 4FLUA 5EWFA 3QIOA 3DOKA 4K4ZA 5KFXA 2O4GA 3RMDA 1S1WA 4M3WA 1RT4B 1J9AA 2BANA 4IRCA 4FYDA 1D9DA 3ZSXA 2Y1JA 3FQKA 3C6UB 1HYVA 1S1VA 1BQMB 4DTUA 3VA3A 2IM3A 4FS1A 2R2RA 1LWCA 2C2RA 3AVKA 4GVMA 4B08A 1C6VA 1QSLA 5I3UB 4OJRA 3PW5A 4W5TA 1WNEA 2FVPA 5EUHA 4CHQA 4ELTA 1HNVA 4C8MA 3LP2A 2HMIB 3DLKB 3IN5A 5CYQB 4FJ5A 4TQSA 4J9NA 3ZT1A 1K1QA 4Z0UA 4URSA 3GYNA 2J6UA 1S6QA 2E9RX 2FBVA 2RKIA 3NDKA 1RDAA 3M8SA 3IGNA 5J2PB 1C1CB 2YV0X 5CZ1A 1I3AA 4FJGA 1Q9YA 2I5JA 4KKOB 2W9AA 5EDWA 2IMWP 3SQ1A 3NGZA 4E3SA 3OYMA 4KV8A 4Y1DA 3HXMA 1JXLA 2XHBA 4B9VA 3VQAA 4Y3CA 3OSNA 2F96A 4CJQA 3LANA 3MR2A 4CFCA 4URQU 2ZD1B 4FLTA 4E1NA 4CFDA 4G3IA 1DLOB 3PJXA 4FJ7A 4KRFA 5KFAA 1S0MA 3RRGA 3PW0A 3K5LA 3GV5B 2XO7A 1GX5A 3KLVA 1TGOA 1LW0B 1NKBA 2WCXA 4J9KA 2UVUA 2BRKA 4KHSA 4ZVEA 4CJKA 4ED7A 2OPQA 3KHHA 1VRUA 1L3SA 4NRTA 4K4TA 1RBUA 1RBSA 4QPXA 3HVRA 3PY8A 4AH9A 1VSMA 5DMRA 4FJNA 1MU2A 4CGHA 1KHVA 4NLSA 4M45A 3D28A 3L3VA 5JS1A 2X6SA 2HNZB 4WYWA 2P51A 2YNIA 4OPKA 2JLEA 4QWBA 1A5VA 2OPPA 4X2BA 3DRPB 1J5OB 4Q44A 4J9MA 3M8PA 4I9LA 4RW9A 2VG6A 1SH2A 3T5LA 1UAXA 4JS4A 3RAQA 3QGIA 1HPZA 3PR5B 3FRZA 1J53A 3EPGA 3C94A 4LH5A 4CJPA 1TL3B 1TV6A 4CEEA 1SL1A 4KTQA 3G6VA 4LD0A 3P83D 4CEQA 2D0CA 2P1JA 4M3RA 3NF6A 5KFBA 2WONA 3QNOA 3ZSYA 1ZBIA 2XY7A 5C42A 3CIZA 1QHTA 2BE2A 3T19A 1JLBB 4N76A 4PQUA 4QWAA 4PWDA 5J2QB 4Z4EA 3DRSA 1TAUA 4NLYA 5JXSA 5KRTA 4ED3A 1DTTB 3S3OA 4FZYA 4NYFA 1LV5A 2VWKA 4EYHB 4NLGA 1KVCA 3CYMA 3OYKA 1JXBA 2W7PA 5KFWA 3OSPA 1TKXB 1QE1B 1VRTB 4Q8EA 3O4QA 1U48A 3ZSOA 3MTKA 4G1QA 4ZVFA 3NFAA 4AHCA 1T05B 1QSSA 3NCIA 1KLMB 3DRRB 3ZT4A 3N6LA 2GC8A 4WYLA 4B8CA 1Z25A 4OLBA 2BGGA 3QZ7A 1RTHA 4M95A 5KFGA 3FQLA 3QEWA 5DLGA 4DTOA 3OYIA 3DOLB 2AQ4A 4BWJA 4TYBA 2F8SA 4IKAA 3AO4A 1VSJA 2CJQA 3V6DA 3D45A 4KHYA 1KCFA 2RF2B 3KD5E 3TAGA 1RT7A 2FJWA 4DSEA 3JYTB 4CIEA 2QKKA 1SUQA 4F4ZA 3HP6A 4DSFA 1HYSA 4DQPA 1RBRA 2IC3A 3JSMB 3KLHA 3PJWA 3LDSA 4DTXA 5DG7A 3DDKA 3MECB 1NKCA 5KFDA 3O3FA 5JS2A 1JLFB 4I7FA 5I42A 3RTVA 1NKEA 4WE1A 5EU7A 1B92A 1XHXA 3SI6A 4ICLA 3PHEA 1VSEA 1GOBA 1RT3B 3I0SA 4ECZA 1JLGB 4LSLB 1S1XA 1RT5B 3HO1A 3G6YA 1IH7A 4DL5A 4DL7A 3SV4A 3EPIA 1KLNA 3QO9A 3ICLA 2R2TA 2XGQA 3MFHA 2WRMA 2IJNA 1RDBA 4B9SA 1FKOA 1T03B 1JL1A 4ECVA 4OPJA 4IRKA 3WNFA 4CJ5A 3V4IB 2KZMA 1N4LA 3VQSA 2W8KA 1LW2B 5HBMB 1RTDB 4I2QA 3AVLA 2IAJA 4KHNA 3NBPA 4KO0B 4MIAA 2BDPA 2XI2A 3IG1B 5DGAA 2RN2A 2AGQA 4J9LA 1R0AB 4KB1A 3TR8A 2BQUA 4L8RB 1Y97A 1TKTA 3OLAA 3PX4A 3DLGB 1BL3A 2OZMA 3DYAA 2J6SA 1JLEA 3CJ0A 4B8AB 3KTQA 1Z26A 4R0EA 1TK5A 3N6MA 2R2SA 4PA1A 1L3TA 3H5UA 4J2AA 4EBDA 4R5PB 5J2MB 3G0ZA 4E19A 5J2NB 3C6UA 4BDPA 4CGIA 4C8KA 2JGUA 3VQ5A 3T5JA 2Z1HA 1EKEA 5DQGA 4OKEA 4FJMA 4FBTA 3NGDA 3GIIA 3VQ4A 2HWIA 4FJ9A 3NHGA 4FJJA 4KI6A 4Q0BB 3K58A 4RW8A 3AO3A 3RBEA 3MEGB 1LAWA 2IA6A 1RTJA 4H4OA 3UR0A 3DLKA 4RW4B 4Z4CA 4DSIA 2DTUA 1RDDA 3HM9A 2YNGB 4RNNA 1TVRB
chains in the Genus database with same CATH superfamily
4B1ZA 3QYYA 3ZTRA 2JC0A 1C1CA 3B4DA 3W62A 4FLZA 3ZCMA 3ETMA 4QPTA 2IBKA 1M1HA 4D3GA 4WF9L 1YRXA 4YUDA 3GV8B 3HD1A 3BZQA 2Z4PA 2JHEA 4K5SA 2L9DA 5AFUH 4K59A 1U0SA 3GV7B 4MQ3A 1YJNS 2QV6A 2XZTB 1OPZA 1T3NA 2V7ZA 2YWHA 2XSJA 3QT8A 3OVSA 2QXLA 5G0RB 1U1NA 4IO9Q 2ZOMA 2J6TA 1LW0A 4JHDA 5F8GA 4F3TA 4ITSA 5HRPA 1BLUA 4Z2XA 1YLXA 1X4BA 4H5VA 2G8FA 1VBYA 2L41A 1CLQA 2UUCK 4MK9A 1YTUA 4BY9C 2MTLA 1SJQA 2RU3A 4ER8A 3HKZD 1I94F 3CM5A 4KR0B 2O8DA 2Z2YB 3RMAA 1KOOA 4ZTJA 3CB4A 3UVJB 1UP1A 1XC3A 4P75A 2C2EA 3L3UA 2LMIA 4C8LA 2DNNA 1T6CA 2CJAA 2A6OA 1NJWA 1IQZA 1PILA 1WEYA 2A6AA 1GMWA 2DNKA 5DM7Q 3DRPA 4A48A 4KHPJ 3UB5A 3CCLN 2AEJA 3CWJA 2P9KA 2OFGX 4IWVA 3TABA 4O5BA 1TL3A 2GX8A 4C0OC 5C24A 1UJ4A 4BRAA 4ZP7A 1F5BA 3BBCA 4TU9A 1NBWA 4DOZA 4JK9A 3GJTB 4YB7A 1TZ0A 1H7WA 1N48A 4TY8A 4CLKA 2CWXA 1HRHA 1YI2N 4NCAA 2FUG9 4FWOA 4M63C 2ETJA 3EKSA 4H0TB 6FD1A 5AXKA 2YI1A 3VQ7A 4LJMA 4BE0A 1EWRA 2VA2A 2V8GA 3RYLA 3D6TB 3BGOP 2HWTA 3OHBA 2D0OA 4CP5A 4MIWA 3EM1A 2DNHA 4ID5B 1VRTA 3SYZA 4DQRA 1XR5A 2AMCB 4YY3K 4DTRA 4I6MB 3DRRA 3OVNA 3G8TA 4JRPA 2FB0A 5H9EJ 1X7VA 3W0LA 1P6TA 4ZOSA 1CPZA 4B9LA 1V3ZA 3D0IE 1RILA 3C6TB 2QTDA 3I55S 2R7QA 4F3MA 2HHHK 2HHQA 1A7GE 1D0EA 1FNMA 2PMZD 3FZ2A 3W7BA 1RK8A 3NVMA 2CJYB 2CGJA 5KOXA 4DV5F 1QS4A 3O3HA 3KFWX 4F2RA 3CMQA 3ADAC 5A8KB 3W66A 4HHHA 2W42A 2GO8A 2PAVA 1NXIA 4QS7A 5FRNA 1RBTA 4N56A 2F5GA 2WSEC 1H38A 2DGTA 1KD1T 4QWCA 1WC0A 3PACA 5KG4A 2DKOB 4LSLA 3AXMA 2DNRA 3K5MA 3MEEB 3OR2A 5HJYA 1FWLA 2DBBA 1KVKA 3FMBA 3B8HA 3OYGA 3IFEA 4H54A 4JI7J 5AQTA 1N54B 4O3PA 3OFFA 2WVFA 3I33A 4ETXA 5HBMA 4DJBA 1EETB 2KRRA 4Y2KA 3P96A 2F8MA 1IQTA 1VR6A 4DL2A 2E1YA 4R79A 4R0JA 3OD2A 3CJSA 1O5JA 1UVNA 4PKDB 1KQFB 4YR0A 3PW7A 1WHWA 2WB1D 2E1PA 2VBYA 4C0BA 3GFXA 2GHWA 3OYDA 1QTMA 5KFLA 5GAEI 1UMJA 4ZCKA 1RHKB 3TANA 3F9KA 1G4CA 3BKUA 4JK7A 3MCPA 2LU2A 3GCXP 4CE9A 3FZHA 1S72N 5J2NA 4WU2A 4XH1A 5GAGP 2BOAA 5AQYA 3O80A 2CQ1A 2G8KA 2EPIA 1RDWX 3ILOA 1EB0A 3FBFA 3HOTA 1ZBSA 3ISND 2E5GA 2AGOA 4BR5A 5IZHA 3RBXA 1XR6A 4TU7A 3THXA 4JKDA 3RU0A 4B1WB 5LMUK 2GA7A 4BG8A 4NMLA 3LWLA 4JN4A 5HRSA 2LVWA 5IQQA 1S3XA 4Y1CA 2E7VA 3GE9A 1AUDA 2Y0SD 3IR5B 3AVNA 3MR5A 1CJTB 1T9UA 3LWMA 2ZE2A 1IBMF 2PT0A 4ILJA 1UFKA 1JKHB 1M5OC 3MEDB 1SVDA 3O5TB 2GX9A 2NZCA 3SMPA 1H0HB 1ZETA 2IVPA 3VEZA 4F2SA 3CQXA 4LVNP 2X1AA 4C3LA 4FZXC 4B3RJ 2ROGA 1IKYA 3EGNA 1SIWB 2KTQA 3KK2B 3VTIA 4K4WA 5EY4A 4CIGA 2JFKA 1TU0B 1KQGB 3RAXA 5J1PA 3BF4A 2DT9A 3KK1B 3UPFA 5T14A 1U47A 4IQMA 3DM2B 2C3MA 1XMOK 1IR1A 1PCAA 1PYSB 2PO4A 4WQ4A 3T69A 1FJEB 1VQMN 4CF1A 3DFEA 4M1KA 3MTJA 5L1LA 1VBKA 5HRNA 1MWMA 3SJHA 1MWQA 2ZF5O 1FJ7A 3MWTA 1CSJA 2B9XA 3DRYA 3M2VB 3TWZA 4RWWA 2VQEJ 3WIUA 4ZVSB 4HR2A 3QRRA 1F2GA 4DHYA 4K42A 4U8VA 1SQEA 2W6KA 5AT1B 4MIBA 3UR3C 5I3PA 5FPNA 4CBUA 3OBYA 2DNZA 1FERA 3D54A 5KPRA 2R8GA 3SNNA 4I56A 3CFOA 3O9SA 4U67Q 1X9JA 3DI6B 2QW9A 3NE6A 4IJNA 3OJUA 1KN6A 4MKAA 2CQCA 4RBTA 2N4DA 4C98A 3IO1A 3OYAA 3QWPA 3OS2A 2QWPA 4UOGA 4RJVA 2CAJA 1ATNA 2QA1A 4NLDA 3K7RA 2ZVIA 1NZAA 2BKOA 4DTSA 1FWPA 1T94A 4E7JA 1VQ5N 4GW6A 4NLOA 1OYEA 4FLVA 1S5JA 4KFBB 1WBBA 1FXDA 3LP2B 3H40A 5L46A 4R8UA 2KM8C 2ILYA 3KK3A 4DL4A 2YH0A 2GBZA 5FDLA 3M9OB 4DDFA 4A8KA 1AW0A 2NUHA 4PWWA 2ADCA 1XJWB 4F67A 5A2QO 2OYQA 1MROA 4X4TA 4IH6A 1R8CA 4GVBB 4NA1A 4P52A 3LALA 1DTQB 3TZWA 4FWPA 4CVNE 2DIUA 4ZVUB 1HQEA 1H7XA 3EJMA 1JCFA 3HD2A 2YNFB 3KLFA 4KV8B 3PV8A 2NREA 1RDRA 3PKYA 2C28A 2GV1A 3TP2A 3CCJS 1HNWJ 2CUYA 1UOCA 1WSHA 4FWKA 3KWGA 2LLZA 3HZGA 3HHLC 4BDZA 4DR2F 1WAFA 1BQMA 4BBYA 4M5JA 2H4YB 3MM5A 2FC8A 3KMQA 3V6KA 4YOTA 3U3YA 3HM8A 4LF7J 2YPYA 3MF5A 4H4KA 3GFZA 3L95X 4LT6A 3W2WB 1S77D 4OJ1A 4UZBA 4JI6K 5K8OA 3EE3A 4FXVA 2YX4A 2HMIA 5CYQA 4DUTA 3L4IA 2R8IA 4NEZA 3M9NB 5DJBA 2J76E 5E3QA 4X66J 1IKVA 3TW0A 1X4EA 4X65K 2RH3A 4ECUA 2VFSA 4QU6A 3HPHA 3NCRA 3A8KA 5HP1B 5FROA 3AJDA 4K4SA 2CFXA 5AXLA 2BE9B 3QT7A 2Q66A 2JRSA 1U4BA 4E1JA 3W5YA 2VQFF 2JC1A 4FBUA 3QJLA 1JX4A 3ZEUB 2ZHBA 1JWWA 1HNZK 3HL8A 2Q6BA 4P2XA 4ID1A 2CNKB 1X4AA 1U8SA 1UCNA 2ASLA 3CQ8A 2FSJA 4YMEA 1VC0A 3AVHA 4WFXA 2I9SA 2NYHA 2YHBA 1RWWB 4ISGA 4UY85 1CULA 2OSQA 2KN4A 3AQPA 1VLOA 1NPKA 3E9OA 3RJMB 2X1BA 2GJ2A 3O3GA 3G9CA 4OZ0A 2HZVA 2H3GX 1VYAA 1IJFB 1HIYA 2G8IA 1ULRA 2X3DA 2HS4A 2KJWA 3M2UA 2J0XA 5E5NA 3NMAA 1M1KT 4NXMF 4CEBA 1YHQN 4QOTA 4DR3F 2VD3A 2YX7A 3CCUN 3R5CA 1RTHB 1HA1A 3CSKA 2K7JA 3CO9A 3WXLA 1OVQA 2H54B 2ZJPQ 4DL3A 2EFOA 4CK3A 1ZBTA 2FC0A 2KG0A 3ALYA 1YBUA 4B3TJ 1SV5A 5C25A 2UV8A 4OQJA 1U1QA 2AKWB 2FTRA 5L39A 1VQON 1BGXT 2BACA 2GGPA 1Q79A 3MPWA 2NXEA 2CG8A 1FRXA 5EX5A 3QZ8A 3CE8A 2HHSA 4TLQA 1QZ6A 1VQSA 3PM9A 1LOUA 2YJEA 1YF5L 1S59A 1S72S 3LAMA 1RT2B 1HNIB 5EX3A 4QIWD 2RE1A 1Q81O 1FA0A 1Q5YA 1NH7A 3HT3A 3SQ2A 2IPOB 4A8FA 4JKBA 3VV2B 5MAOA 2KFYA 1NU0A 1DZ5A 4CK1A 1YWXA 2I0XA 3QO9B 1Q78A 4YS2A 2CPFA 1U2RA 2EVZA 4CT9A 3UN5A 4JKFA 3J7YI 3QGGA 2B43A 2IRYA 4I2QB 1T9WA 3M8QA 2BJEA 1S4EA 1PAEX 2HHUA 5EOYA 2E5HA 1HNXF 5B0AA 2LCWA 3MDQA 4AL7A 3WC2A 2FF3B 4NMXA 2IOCA 1RHMB 1YJTA 4D3HA 2N82B 4USWA 1EP4A 5F3ZA 1D4XA 2HFZA 2NXUA 3RB6A 3DYAB 2B56A 4X4PA 1T9TA 1GOCA 2Q3PA 3WQPA 4O4GA 2Z2MA 2MQPA 1VCTA 1CQNA 3VAGA 1PKUA 5GAGU 3HHKA 3WIVA 2QLBB 2RQ4A 1DBDA 1GLBG 3VQBA 4I64A 3FDSA 4LF6F 4DU4A 3JTOA 4LFAF 1KRPA 4QYRA 3QLHB 4CJRA 4NXNF 3J7ZO 1U6BA 1VHFA 1VQMS 4FXWA 2IM1A 3KOAA 2RSQA 3C19A 4Y6IA 4LIWA 2VF3A 4WQ5C 2D3UA 3VGLA 4NI2A 2HHVA 2FGCA 2HF3A 2YKMA 3NLCA 1F9FA 2YQ0A 4DCJB 2ZJQL 3QEIA 1ZA1B 3PIOQ 1QQMA 4Y0FA 1RTJB 4H4OB 1N5YB 3H2UB 4A8QA 3R97A 4CBXA 2POKA 4OYWA 4NLBA 3QFWA 5A2QY 1Q8LA 2E2QA 3VVUA 3A5MC 3CJKA 1SCJB 1B0TA 2IFXA 4CJFA 1WBDA 4CO3A 1RKIA 1GXLA 1HI8A 2F4VJ 5KFPA 4Y65A 2Q3SA 4DTNA 3R5AA 4MT1A 2AIRB 3L2QA 3QDKA 1MMLA 5BRFA 1NHVA 3LTOA 3NMRA 1MN9A 1VBZA 2C22A 1RCOB 2UUCF 4Y2CA 1F5CA 5CQGA 1JXEA 4R5PA 2BW7A 3KG1A 3GIKA 2MZSA 5A6PA 2ZWOA 4PUOB 2PSZA 2L48A 4PABA 2BA9A 4GO5X 1ZTWA 3T5KA 2W9BB 1BE4A 3TAEA 2DB1A 2AF6A 2UUBJ 2OELA 1HD1A 2C2OB 4ZPWR 1W0HA 3UKUA 2APOA 1EQ0A 2J9EA 1TL1B 3H25A 2W01A 3M05A 2EC0A 2XG8A 4JUZA 1TVRA 1VQ7N 2VOPA 2D7SA 1FVQA 4U96A 4ZVQB 4N77A 4AUKA 3D1HA 3QAEA 2GQQA 4NZ7A 4NLUA 4WK3A 1TQLA 3NXZA 2MZRA 4LBPA 3VGUA 4WFBL 3MPVA 3IXQA 5JJBA 2VGNA 1RAGB 3AXKA 4UOHA 2EI5A 4ZP8A 5F3TA 3E3XA 1HJRA 3H3OB 4P2MA 1NHUA 4DSJA 4CLFA 1B64A 3Q2SC 4OIXA 4ZK7M 4J2EA 2RVJA 5AE3A 2ZDPA 3KIOA 4DR5F 1DURA 3P5TL 4JI5K 1P8GA 1EXQA 2G2YA 1FKPA 4MKBA 1G6BA 3G6EN 5CCMA 3DXMA 3OYJA 4NYOA 3OA9A 2XGPA 3D6FB 4Y34A 3LA0A 3OTEA 3M2RB 2G0CA 2VFTA 4PAAA 1NK8A 2HGLA 4M8LA 1IM4A 3EXYA 2I7NA 1VQ8S 4IOAL 1NJIT 1KTQA 4Q45A 4DU8A 3LAKA 4FVUA 4K25A 2W2PP 3AVFA 2AJ1A 3KJFB 3FK4A 1CZAN 3CHWA 2FHJA 5JVGL 2QA2A 3X3UA 2YJFA 1IKWB 1OPIA 1ZTTA 3Q89A 2LYVA 2BYCA 2BANB 2ASMA 4W5RA 4FLXA 3L7OA 1RT1B 1S1VB 2CQ0A 1WC4A 5KT6A 2M88A 4DFMA 4CJWA 4UT4A 4J9VA 2EFNA 2OZSA 4B9NA 4F4WA 5HAOA 3KUEA 3D7SB 3A5OC 1VI7A 4FM1A 1Y5LB 4ZJQA 2E1RA 2V2QA 5KFJA 2G9OA 1IBLJ 1HNVB 3SLCA 3T1HK 4Y2MA 4DV3K 2DEJA 2YWEA 3QBCA 1NK6A 1C1AA 3TJ8A 5GADI 2VWJA 4NLWA 1YHQS 4CJUA 1S99A 3CCUS 1RZMA 3D1QA 2GIQA 3OYFA 4W5OA 2RKIB 2CQGA 3PW4A 3LP1B 3PYEA 1W2IA 1RABB 1D09B 3CCQN 3GIRA 4JYAK 4IR1A 1SQGA 2EFPA 1QQCA 1WN7A 3QEVA 4I69A 2R8HA 2Q2RA 4QU7A 4YDXA 3NH2A 3Q7BA 2NXCA 5CYJA 2HF4A 3MZIA 3N4QA 3BSCA 1N6QA 1WSGA 2ZJRL 2OEMA 2E1ZA 4WZMA 5KPZA 1N32J 4FO0A 1GLAG 3TRGA 1YZ7A 3BR9A 2P9NA 2CQ4A 3IAS9 2KO1A 3M30B 2EK6A 3BQ0A 2CPJA 4FWMA 2WOMA 4LSNA 1KDNA 2W7AA 4FLYA 4EBEA 3MXIA 1QAIA 5LMUF 1S57A 2BXJA 5AZJA 4ED4A 3WNHA 1JCGA 1V5VA 3A13A 2BKNA 2XYHB 2B9WA 1DHMA 3L0QA 3MM7A 1LFWA 3LDPA 4BRHA 1IJJA 2OPPB 4RNMA 3P45B 2NS1B 4KYZA 1YRTA 4FK0A 3AO2A 1MN7A 4ZPCA 1UEKA 1ZOTA 1RTIA 2MZJA 2DNLA 4DPYA 3A3PB 1ASWA 2X74A 3BPSP 2J9DE 5IWAK 2W41A 3EICA 5HJXA 5BR9A 3GL1A 4PWDB 5JICA 1XMOF 2HFVA 1ACMB 3R8EA 2KM8B 3PX6A 2MJNA 1LWFA 3K0SA 5AQSA 3P3DA 4HL9A 5BXIA 3SAHA 2YHWA 1FI4A 4N47A 4LF9F 4E0DA 1YX2A 1HWKA 4HHUA 1R8AA 4QYZJ 1F3FA 4CHYA 1IG9A 1JJ2R 1F21A 3IWLA 3L4QA 2HPUA 1LKZA 3EEQA 1HHTP 1FRKA 4Y0WA 4RNFA 4URGA 2OEJA 4BVOA 1IKXA 1UEVA 2MB0B 4W5NA 1E6YB 4DR4F 3L2UA 4DB3A 2WVDA 2XY8A 3CI5A 4CERA 2JSXA 1LK7A 3JAMY 2E5LJ 3Q8QB 2GS8A 3U9DA 4YDUA 1TMMA 5K14A 5KTQA 3OW2M 5AQUA 5ETLA 5D3GA 4I7FB 5LMNF 2A1SA 3OJSA 5LJVA 1H6KX 3QIPB 5KT5A 4DMNA 3U1MA 1REVA 4WFAQ 1S6PA 2D69A 3CXCR 2ZFHA 3KHLA 3AJ2A 5F0XA 3CJ7A 1SJRA 4ZPTR 3R2DJ 5CZVA 4DR7K 3BGUA 4W92B 3SUNA 1VQ7S 3BYPA 2VFVA 4DV7J 5EWGA 5KFOA 3AA3A 5B0DA 2PEHA 4DV0F 4U7CA 4RWXA 4A62A 1NSAA 1DARA 2E29A 1D9FA 3T1YK 3EDRB 2QYCA 4ZHRA 4J9UE 5HI7A 2KZZA 3VGSA 3LZIA 4LFBK 1UFLA 5DDPC 3ENWA 4OHVA 2RRBA 3DLLL 2NCKL 4NRUA 1NMDA 2UU9F 2CWKA 1J5EF 3TX0A 2V63A 5EWFA 2JJ4D 3POTA 5KFXA 4K4ZA 1F3VA 4M3WA 4FYDA 4OYAA 2NLWA 2Y1JA 2V2ZA 2Q36A 2J7WA 1GEHA 4DTUA 3C14A 2VZ9A 4K8RA 4ERDA 4ZN1A 2PD1A 4FS1A 2R2RA 2Z56B 3AVKA 2EWHA 1DT9A 3OTBA 3QSIA 3IBCB 5EUHA 5ETNA 4C8MA 2Y8YA 2FJEB 2HRUA 4TQSA 3ZT1A 1BY9A 4Z0UA 4URSA 4DXLA 2NRXA 1C1CB 2GWKA 5CZ1A 3FSXA 3ZZRA 1RB0A 1NGGA 3SQ1A 2R4FA 4V1Ak 1EQMA 4Y1DA 4HTJA 1GLJO 1FNXH 4BR7A 2F96A 4CJQA 2P9EA 3MR2A 4OX9J 3ZZPA 2L9NA 1C0GA 3PJXA 4CLTA 5FIIA 4FJ7A 2RD5C 2YWKA 5KFAA 5HATA 2XSJB 3FZFA 2MY8A 1LW0B 3V5RA 1NKBA 4JHDB 2UVUA 1P9QC 4LF4F 3I9V9 5JMVA 2W2MP 4WCEQ 2OPQA 3KHHA 4UQTA 3I8BA 1HPMA 4NRTA 1WKJA 1X4FA 2LEAA 4XDDA 5BPMA 2P9PA 3HHEA 3M5RA 1R8PA 4AH9A 5M2PA 2O8DB 3P49B 1VSMA 1KC8O 2J0QD 4DR1K 4CGHA 3CD0A 2GWJA 3VR1A 4ANDA 2R42A 1N34J 2HNZB 4QIVA 1P8ZA 2YNIA 1Y5NB 1IWGA 1VGYA 3ZNJ1 4IUFA 4JV5J 4JI4J 1IBKK 3M6VA 3DRPB 2PMHA 4Q44A 1SH2A 3T5LA 2YBVA 1DJ0A 3PR5B 3D3CJ 3FRZA 1H1VA 1HR0J 1SC3B 4CJPA 1TL3B 2ZC4A 3HBTA 3GR1A 5LL6d 1SL1A 1NO8A 1YBAA 3G6VA 3R7SB 4X4OA 5IV4A 4ZLPA 4LRDA 3FSYA 3C65A 4N76A 4PQUA 2IBOA 2ZBCA 2KYZA 4CZKA 3K8VA 4HVZA 4AXJA 1K0TA 4Z4EA 3DRSA 2I8EA 3S3OA 2V2KA 2ZITA 1I5OB 2HVZA 3W65A 3BF1A 5AJ3F 3KNGA 4EYHB 2A5XA 4NLGA 4U8YA 3OTCA 2MY7A 3DXKB 3JAMU 5JVHL 1QQNA 2RQCA 4K41A 3OYKA 2W7PA 3E9LA 2EXUA 4PPDA 1VRTB 4Q8EA 3K8WA 1VQNS 2LKZA 2OMOA 2QWRA 1XNQJ 3NCIA 4FNIA 3DRRB 4DN0A 4B8CA 1Z25A 3QZ7A 3TSUA 5HMWA 4M95A 4KHPK 2ZDOA 2EKYA 4J8FA 2P6TA 1VSJA 5JVHQ 2J7UA 1KCFA 3TAGA 5AQKA 2FHOB 1WUAA 4CIEA 3HP6A 2A2DA 3P8BB 3PSFA 2IC3A 1F1BB 3JSMB 3KLHA 5B7WA 4XH5A 4BRCA 3GTYX 1NKCA 2CQPA 4DV1J 1VOMA 5KFDA 3O3FA 2RUGA 2KJVA 5I42A 2MMYA 3QMLA 2YPZA 4C7QA 4CZGA 2VL1A 4WE1A 4FVCA 1TUVA 2COLA 2CVEA 5EU7A 5AQWA 3VGKA 4BRLA 4A59A 1RT3B 3C16A 3I0SA 4ECZA 1JLGB 4LSLB 2GAHC 4KGZB 3VENA 3HO1A 1TELA 1EARA 4DL7A 3EPIA 2CA9A 3OR2B 3ICLA 3MFHA 1CBKA 4ZCIA 2J0SD 3S8SA 3EGZA 4A46A 5H9EK 4NX9A 1YBTA 1FW6A 5HBMB 2YY3A 1XMQJ 4MYTA 2PDAA 2Z30B 2HGNA 4MIAA 2P9CA 1MLAA 4LFCJ 4E2FB 4J9LA 4YEAA 1R0AB 4KB1A 4MO5A 3MM6A 2JLFA 1J6ZA 1FRIA 2QLXA 1NSQA 2UXCF 2W40A 1TKTA 2YX6A 1QM9A 2J6SA 1JLEA 3CJ0A 4R0EA 2YWGA 4B3MJ 2M4MA 3R7BB 1VISA 2ZHAA 5BYRA 4J2AA 4EBDA 3H20A 1B7YB 3FRYA 4E19A 1LWXA 5J2NB 3HZEA 4KJIA 2KT5A 4C8KA 1ATSA 3T5JA 1WJ9A 5B09A 2F7TA 2HIYA 2HS3A 1WWHA 3C66A 3THXB 4JI7K 2Q31A 1ZA2B 4KI6A 3CJAA 4L74A 4Z7CA 1T3OA 3AO3A 3RBEA 1LAWA 1V4TA 3MCSA 3DLKA 3KUGA 4DSIA 2MKHA 3F2KA 1W2BM 1RDDA 3AAQA 4EUVA 4G6VB 2ZE2B 4M5HA 2JZ5A 1VJQA 5E84A 5J2PA 3SSSA 3RB3A 4DV6J 2KFNA 2DR9A 2LSNA 5LY3A 3JSRA 5K8NA 2YHYA 1XERA 3FZLA 3EDQB 2HEKA 1B9DA 2V52B 3SQGA 3BB5A 2XMMA 3KKSA 5ETKA 4PY5A 2ZD1A 1URRA 3CDUA 1IKYB 1HHQA 2M8HA 2DRAA 4O5FA 4NCGA 5A6WA 2XI3A 4X62J 4CH7A 2MKSA 1KFDA 2KH9A 2LFVA 9ATCB 1FKAF 3EX7B 2CGKA 4EZ9A 2BE7D 4CH0S 1VSKA 2XTJP 1UKUA 3W8GA 4DZDA 1J2VA 4OI6A 4CEDA 4DCPB 3VAFA 5FRMA 2D1CA 4RG8A 4DN9A 3O9RA 1VHXA 2CQIA 3JQMA 4DG1A 3T41A 4W4MA 1MG7A 5F2RA 4YORA 3PNIA 4M7YA 1QAYA 5GMEA 1NSKL 3CCVN 4OZ2A 3J7AN 4CF0A 1Y5IB 3I4HX 1T95A 3FEXB 2DTJA 3PKMA 1MA9B 2HFUA 3UD4P 5E2QA 1YTAA 2Q0RA 1TKZB 1NH8A 3QBWA 2D3OR 3I4PA 1MWYA 3MUMP 2RJZA 1ATRA 1IUJA 4B3RK 4LMZA 3SCXA 3RBDA 2D1KA 2BQRA 2GIRA 3O44A 1RCHA 1BHNA 1VQ6S 2XSFA 3RVCA 2HHPA 3KUHA 2AZ1A 1JB0C 3CEDA 1K1SA 3MGJA 1GLCG 1NNEA 4OHWA 3ITHB 3L7PA 1M5VC 1ZZFA 2BJ3A 4DV3F 1JLBA 3QT6A 3KLGB 2E1CA 3QNNA 2FSNA 3GB0A 3CJ4A 3E66A 3R5GA 1T02A 3CC7N 2GZOA 2RHSB 1DTTA 1YZ6A 4YFUA 4R8UB 4MLHA 3KK3B 2ILZA 3ULEB 5FDLB 3RBZA 2D0PA 1NCLA 1HX1A 3O9UA 2J9DA 3PYFA 7FD1A 3UDCA 2VQEK 3MWBA 1TUGB 4EFHA 4EZ6A 2VH7A 3V81A 3NS7B 4IH7A 2C2DA 1HQEB 1Y00A 2BABA 3KLFB 3W8PA 2NUBA 3DOLA 2HRYA 3VQPA 3CPWM 3F56A 3TQEA 5KI6A 3CDEA 2RF2A 1VFJA 1UVJA 3KHGA 1VQ9S 4FK2A 2MZTA 4AT1B 1ESVA 2KLAA 4USTA 2BW2A 1FESA 1AFJA 1RAEB 2MQQA 2MQNA 1PJ7A 2W2OP 4ZVHA 3MM5B 3GCWP 4YHHJ 1Q7YT 3CCSN 2C3PA 1CXUA 3GQCA 5FLXO 4ZVGA 4F4KA 2XZDB 3D68A 4CEFA 4DV5J 2DGQA 5ITHA 1S1UA 2EG2A 2RS2A 4CESA 1TL7A 4QCLA 3CFPA 4BCAA 2G8VA 3ZSVA 1IKVB 3VZHA 1BXNA 3H8YA 3OR1A 1T03A 1T7PA 2QI2A 4C11A 1XN9A 4MFBB 5CZ2A 2UUAF 3G86A 1LW2A 1RTDA 4NYNA 1FX2A 5SUHA 4KO0A 2FLPA 3MCMA 3V9WA 4ELUA 3N5BA 5KRSA 3ZSRA 1HNWK 4HHJA 1IR0A 3R8YA 1WG1A 4DQSA 2H5IB 5FD1A 2C1EB 3IA0A 4EEYA 1U25A 3Q8PB 1X5SA 4YB1P 8AT1B 1K8KA 1K47A 1FK9A 1VK3A 3LPYA 2JDJA 1WSIA 2V4JA 4LF7K 4WYBA 2DY9A 1H72C 1C0MA 1ZBUA 4BREA 4DFKA 3VEXA 1CULB 4GRSA 3L3CA 1UA1A 3CT9A 3CJ9A 4NA2A 3C15A 3NY0A 3CJ5A 4KBOA 4USMA 4CECA 4X66K 1GXTA 3SSRA 1EKSA 4UQGA 4RU2A 2CZVC 4F0HA 1NM1A 3VQQA 2PFFB 3EVOA 2FVQA 3NGIA 3N4PA 4RW4A 4U7UK 2K1RA 2VWBA 3ZZZA 2YNGA 3J7Z5 4DSKA 3KMSA 2YX1A 1VQKS 3VEYA 1UETA 1SV5B 2SXLA 5C25B 4JV2A 1OH7A 4FJ8A 2XNRA 2GGPB 1BWFO 3N6NA 4CWBA 1KQSR 2XNQA 2XS7A 2G1HA 3DOMA 1WI6A 2V69A 1L5UA 5AQPA 1S9EA 4DTMA 1VQLN 1ASVA 1YJ9N 4TYAA 1A6LA 4MO4A 1HI1A 2MHEA 1DY3A 1FTRA 2G13A 3N79A 4L72B 4F8RA 2N3OA 3BR8A 5FPMA 2A0FB 3BGFA 3VN5A 1ZPVA 8ATCB 1N33F 2H5EA 3E2EA 2PMWA 4NLQA 1JIHA 1NK0A 3CTRA 2YHAA 3FGVA 3AVJA 2H9ZA 3EN9A 2OH2A 2CADA 2QEXN 3DLBA 1DQ8A 1WUUA 3QGHA 4EK2A 2EHGA 2QFJA 4HEA9 3M8QB 4X84A 4EWTA 3UO0A 2HQIA 3J80O 2O8CA 4B3TK 1SKRA 3ENOA 4KGXB 4GMJB 3IM8A 5DQIA 4LR9A 3E1YA 2AYMA 4FM0A 2G8HA 1ROFA 1EP4B 3PFEA 1X9WA 4F02A 2YQ1A 4H4MA 3E51A 5AQNA 4O4GB 2Y1IA 1BCOA 4EHUA 2O1PA 5EN1A 5AR0A 3C6HA 4MAKA 4OZ1A 2V7YA 1O0PA 3PUFA 3CPEA 5ADZA 2HWHA 2UZAA 1RGIA 1ZPWX 2FXUA 4RUAA 4CFAA 3W9IA 2MSTA 2YKMB 4EGLA 3CCVS 1XWLA 1VQ4S 1VSIA 5GAGI 3ULHA 3MI7X 3ZZ0A 1NWKA 1YUWA 5I4MA 4U6PA 5HRRA 4CJSA 4IDKA 1RWNB 2CDRB 4DFJA 3LF0A 2X3GA 1BUXA 3CJKB 1HI0P 1FJCA 2R3VA 2B3TB 3RSEA 1Q0NA 4O0IA 4CJLA 2ATQA 2E88A 3MURP 3H6EA 5E3CA 1GK8A 1ZM2A 2PIIA 4YOYA 2D5RA 1NJXA 3CJTA 3BJYA 1RT4A 2W25A 2DPIA 1AA1B 1UJ5A 2CZ9A 2GO9A 3OT9A 1WELA 3PO5A 1XK8A 4IR9A 2XC9A 5F8HA 5FLXY 5IT9Y 2FIUA 2HBYB 3K59A 3VQCA 3UKUB 4IRDA 1VIXA 1RBVA 2ZKTA 3CMEN 3I96A 4ZS6A 2U1AA 4CD1A 3D2WA 3HVTA 2JOQA 3AOCA 2X6NA 1U0HA 4FZVA 1WI8A 2DD8S 2DGOA 4FF4A 4GVLA 1FXXA 4ED1A 2WW4A 3RMCA 2F4VK 2WSCC 3EYZA 1X31C 2VG6B 4MK8A 3HMJG 4HVJA 4J5OA 5L1IA 4IEIA 1CJUB 5ETRA 3D3BJ 2QLWA 1XNRF 1K8AT 5KFNA 2VKZG 1DLOA 1U45A 1FDAA 1DFDA 1JLCA 3KHRA 2IRUA 3F44A 3CCSS 5HLFA 5C42B 1EX8A 2UVRA 1HBOB 3H1QA 1C0UA 3THYB 1X5OA 4BRKA 4LBHA 5D8HB 1N8RT 3KKRA 2UUBK 4UUXA 3Q24A 3LDNA 3SJJA 4A8YA 2YKAA 4Z4HA 1FRHA 2DO0A 1QJHA 4FXDA 3QSYB 2FLNA 1NGCA 2W2NP 1BOTO 4TXSA 3ZX3A 3K2PA 3KNAA 1FKPB 2LU1A 2O5DA 2XO6A 5C15A 4I0WA 4KHPF 1YKWA 3DXMB 2M52A 5IOLA 4GNIA 2DY4A 4WWSA 3QEXA 3ZTOA 2CPZA 4LF5F 5KFFA 4DQQA 3HKWA 1GMUA 3SSQA 5F41A 4RWTA 1LXNA 2UVWA 3KZBA 3Q23A 2NRHA 1RLDA 3LP0A 3HT0A 3A8JA 3CF5Q 4LR8A 1YVUA 3MOZA 4DR3J 3PRDA 5ETTA 2O01C 4ZIWA 2E7XA 2ACYA 4IFEA 2XULA 2K7KA 2HVHA 2BM1A 4M5NA 2IVOA 1XUPO 2X78A 4JI1F 2R7TA 5F9NA 5KG2A 3B78A 3W9HA 3OQ2A 2JWNA 3R6LB 4KREA 3R9LA 3OY9A 4PXDA 4FYWB 1OH5A 2L9WA 2OUGA 2W9CA 4F36A 3P4IA 5GINA 1PC4A 2IVYA 2E5JA 4ELVA 1H2UX 3UN3A 2HNDA 1QE1A 1NGJA 4JRQA 3NAIA 3OHAA 2P9LA 5F8IA 2AW0A 3QICA 3NWGA 2B6AA 4CLPA 4BC7A 3BUZB 3PVXA 4CF9A 2BJ8A 3T1HJ 3VF6A 4DCHA 2RAQA 2GQCA 1P1LA 2NXJA 3S6EA 4TQRA 3KG0A 1WAJA 4C2MA 2WC9A 4BACA 3JYTA 5C2FA 1Y10A 2VG5A 5BR8F 2NZ4A 1VQLS 1E6VA 3SMSA 4FM2A 2UXBF 5T7LA 1YJ9S 3THWA 1HNXJ 3MECA 1VSDA 4ZPAA 3B82A 1SH0A 2EFQA 1M0SA 4OZJA 3WBZA 5HVGA 3VF0B 2WOMB 2HFSA 2GTDA 2B7CB 1IBLK 2O8EA 1YJNN 1REGX 2DRBA 3W9JA 2C3YA 3NF8A 4DTPA 4LF2A 3GYGA 3I5BA 5CA5A 5AZJB 2RU9A 3J81O 2UV8G 4FW2A 3B4MA 3K5OA 2AJFE 4DPXA 3MM7B 1Q8KA 4LFAJ 4RW8B 4NXNJ 3KJNB 2F1FA 3NCQA 3X1LB 3C7NA 1BD6A 3GJQB 3T7ZA 3G71N 1Q86T 3FBBA 4EHTA 5IV3A 4TN2A 3EZWA 3BBFA 3D6RA 3OBWA 5IT9U 3TAMB 3GIMA 5CHIA 1WSFA 3FLCO 1RAHB 2Q0UA 1K73O 2HFNA 2RDJA 1RTIB 3ULDA 2OTJS 3VQEA 4O3SA 4K43A 1N32K 4J9PA 3H45C 1RCXB 2DCUB 1U49A 4M5DB 3V9SA 3LM2A 3IRXA 2G0JA 2CQ2A 3FGUA 4PG8A 5KFKA 1VIOA 2O4IA 1PJ6A 4KHMA 2FHJD 4QIGA 2ZH3A 5IXUA 4Z7YA 1RA7A 4OKKA 4I4BA 4QIFA 5IWAJ 3LDQA 2BZ2A 2KKHA 2QXFA 4KH6A 3ZXWA 2DFHA 3F0NA 2CNOB 4B3OA 1M90T 3ISZA 5HMZA 4K2JA 5DGBA 2B5JB 4A8WA 2E1AA 2H3EB 5AQGA 1C2PA 4CJTA 5AQJA 3AH6A 3PZPA 3F41A 3D7EO 2M2BA 4ES1A 4J9OA 2XBPA 2QE5A 2DHHA 4B3RF 4XPCA 4IOCL 2DPNA 2QTWA 1EAYC 3NEKA 3FEYB 4LH4A 2HYIB 1U2FA 5B0CA 3M3ZA 2E2NA 1NK4A 1TK8A 1REVB 4FJHA 1S6PB 1KS2A 2YVSA 4CTAA 4BR2A 5IM0B 3HVWA 4TY9A 3O8WA 5KFMA 4QYZK 3QT5A 1VQYA 4F4XA 5KGXA 3PRVA 4NL5A 4Q43A 2VQEF 1KVIA 1VDHA 1Y3JA 1A0OB 4CLLA 4DV4J 4K8ZA 2LDIA 4DI6A 4RNHA 4F0MA 2H51B 3TAPA 3VETA 5BN9A 4DR5J 3QINA 3GDQA 4ZHRB 4B9QA 1FFSB 2RRNA 5JLHA 1U2VB 4N7TA 2LEPA 4C1NK 4HT7A 3I0RB 3THVA 3MXMA 2CKWA 1C1BB 5E41A 2DEIA 2ZNZA 4PPZA 4BRIA 4HTUA 1Y0HA 3POTB 4KT0C 3AVAA 3A0IX 4GKJF 4KTWA 4I6WA 3AVBA 3NF7A 1JJHA 1IWAA 3NH1A 1TL4A 4NWBA 1RKJA 2KT3A 1XQIA 4A8XA 3SPYA 1PBAA 3CJRA 1VSFA 4DBQA 4BC3A 1ITPA 1UTAA 2OFHX 3MXJA 4NLCA 4H0VB 4DV7K 5CYMB 1Q82T 2DNOA 2Q43A 3LDOA 4FS2A 2V67A 1BWEA 5DK5A 4DS4A 1LAVA 2P9GA 4O3RA 4LBIA 3ENVA 2GVDB 3IGVA 3D0PA 1HNWF 3AVIA 3L9ZA 2A6MA 4AHVA 5KG0A 1NEEA 5F8MA 2CPHA 2WZ1A 3GU0A 3TPQA 2FC9A 4UY8T 4C23A 3KJQB 4Y00A 2MGZA 3VQ6A 3Q83A 3EWGA 4ECTA 4KSEB 4NCBA 3NCPA 1EZZB 3ETOA 4MH8A 4PZVA 3CJCA 2DXEA 2HG4A 2EK1A 3AA4A 3HPOA 1YJRA 3HSCA 4BS2A 3KJVB 1NK7A 3IUCA 3I8DA 2V8HA 4IG0A 5GMDA 4FWRA 2OPQB 3PR4A 1N56A 3MPDA 4CO1A 2QWMA 3K9JA 2BV3A 4ZCMA 3H42A 4C8NA 2P9PB 1PAUB 4JD2B 3UD5A 2R7SA 5HROA 4CF8A 5K5MA 1TUUA 1OH6A 3DGVA 1YIJN 4FVMA 3DLHA 2IVMA 3VVTA 2VFRA 2YNIB 3TJ9A 1HYZA 2NRZA 4RZRA 2ZZTA 4JK8A 1Q8IA 4DS5A 4CNYA 5B08A 2GUPA 4OX9K 1X4DA 5K8MA 2DGXA 2YWFA 4BE1A 2NPIA 2F40A 3GBTA 1L3VA 4MLEA 4CRJA 1CQMA 1IBKJ 1I3OB 5AQZA 2XCPA 3ENQA 2I1RA 2G4BA 2BR0A 1RDUA 2OJ3A 1R6YA 3ID6A 5E0OA 2ZM6J 4PQUB 2CJXB 2I7PA 4WXOA 3CCZA 3CJQA 4UW2A 4IYQA 5DLFA 1RADB 4B9TA 3DRSB 2HZCA 2XZWA 3OV7A 2WVBA 4HACA 3LDLA 2QFIA 1V9OA 4WF9Q 2VC1A 2KW4A 4R25A 4ILLA 3TAFA 2E2PA 1RBOB 2MKIA 1HWJA 1SC1B 3HSJA 3VQDA 3RG6A 3E01B 3C8YA 4GC6A 4DQIA 1N34K 4QIEA 4O44B 1DAXA 5IT4A 2VG7A 3G71S 4JI8F 3CO0P 3BBBA 4LF9J 4JI4K 4JV5K 2H65B 3M8YA 2XWYA 3SI8A 3GMGA 3RRHA 5ETSA 2RQMA 1NHKL 3W5ZA 1HR0K 1HKGA 2PE8A 1Z4UA 1U1LA 1JKHA 4L73A 4CT8A 1P9YA 4OYIA 3SUPA 2IC3B 4KHQA 2GHVC 5B0EA 3C2PA 2D4WA 3MMVA 4BWMA 3CC2S 4JP8A 4RUHA 1IN0A 3AAWB 2QN6B 1HBMA 5J1EA 4OZ3A 3PO4A 4USJC 5I42B 2WK4A 4DR4J 5E3RA 1IM6A 3F5TA 4WE1B 2IMOA 4DF4A 4RW7B 3GFYA 2NRWA 3C16B 3KLIB 3CCJN 4AD6A 4L3QA 2IY5B 3WT0A 3SUOA 3A3OB 4JS5A 5LMNJ 2BJDA 2RDDA 2F9WA 1KQKA 4DU1A 3L8BA 2J8AA 3CM6A 2KDOA 4X64F 4BDYA 2QL5B 2NYIA 2Y9HA 1XNQK 3DMJB 5L1JA 1X5PA 3FFIB 3TO8A 2PZSA 4XDCA 3R1LA 2V9WA 2PI4A 4JI2J 4PWUA 3TX8A 4E7HA 4ILGB 1M1GA 5A8WA 2C3UA 3I5CA 2IVFB 3MM6B 1ZS6A 4OZLA 3I56S 4L3NA 1WTFA 4QQBA 4KB0A 1GLEG 4RU9A 3ZZYA 5M1PA 3AA9A 4KAZA 2N7CA 4DV0J 3TSQA 4DV1K 3ATVA 4FF3A 4AL5A 4FLUA 2XQCA 5D6GA 3DOKA 2PA3A 2DH7A 3WHIA 1DGKN 3MOJB 1O8BA 3MN5A 4CZHA 1KEKA 1FO1A 4KY3A 3ZSXA 3FQKA 5BREA 1M5PC 4PR6A 3CJBA 4O8UA 2KRBA 5AE2A 2UU9J 3OXLA 1T0TV 1C6VA 1QSLA 3J7AP 4PG6A 5I3UB 2P9SA 1R6VA 3PW5A 4W5TA 2FVPA 4CHQA 3LP2A 1XMQK 3DLKB 3IN5A 5JLFA 2DVIA 4J9NA 2F4VF 1FXLA 4CO2A 2J6UA 4LFCK 2FPHX 2E9RX 1Y64A 2FBVA 3NDKA 3TZYA 3D2EA 5J2PB 2PFDA 3AHPA 2YV0X 4NB4A 1I3AA 1HKBA 1Q9YA 3CERA 1HKCA 2Y8WA 5HMXA 1SXLA 3RW6A 3NGZA 3SQGB 4E3SA 1ZM9A 4KV8A 4B9VA 3VQAA 3OSNA 1S76D 2OAUA 4CFCA 2OLWA 2ZD1B 4FLTA 4B3MK 2KHCA 3D6HB 1BG3A 1OIAA 4OFZA 3OTOJ 4ES3A 3OVAA 4DPWA 3G2XA 1U2CA 3EE9A 2CYYA 4GKKF 1UL3A 1TGOA 1HFEL 2GHPA 3O9TA 4J9KA 4KHSA 2ZHOA 4YN3B 1DQAA 3TA2A 4ED7A 4HLBA 5GADP 2DNGA 2CJKA 1RTZA 1VRUA 3D9BA 3W2WA 1BA1A 1X0PA 1RBSA 3DU6A 1RBUA 3WDOA 3BS9A 1QY7A 2W4PA 4LF4J 1KAYA 1NMEB 5B0FA 5MLCV 2NRRA 4FWQA 1MU2A 4FJNA 1V6HA 1KHVA 3MX5A 3AD9C 5BN8A 2P2CB 3D28A 1ZC6A 3L3VA 2ZWHA 4DV6K 3OXGA 2P51A 4ZA1A 3IMXA 4ILHA 4O23A 1H98A 1NB2A 2K2PA 3RAQA 2PC6A 1OQ6A 1WKLA 5L8RC 3BO2A 3CMAN 4X62K 4RNNA 3AB2B 3ZEUA 3P83D 4CEQA 5HVFA 4C0HA 2CQHA 2P1JA 4M3RA 5KFBA 2PN6A 3CIMA 1RAFB 1YG0A 1QHTA 4BC5A 2BE2A 1UAWA 3T19A 1JLBB 4I1TA 1H73A 3TUIC 3QFUA 4F9OA 3O4WA 2ASPA 1YJUA 2O8BB 2VJUA 1TAUA 1MDUB 2UXDF 5KRTA 1DTTB 1KVJA 4PXBA 3MN9A 5M1QA 1YIJS 4NYFA 1RXOB 4F0KA 5I3QA 1B7FA 7FDRA 3CYMA 3OSPA 1IR2A 1U48A 4G1QA 3KXDA 1RBAA 4CO5A 3ZT4A 4WYLA 5AJ3J 3DN9A 3VOVA 2P9IA 1UVMA 1RTHA 3IMQJ 1NB7A 1UZHA 3GWCA 4FOIA 5DLGA 4DTOA 3DOLB 4BWJA 2AQ4A 4OZNA 4TYBA 4USVA 2F8SA 2QSFA 4IKAA 4BLGA 3V6DA 3D0HE 2GMLA 4DL0C 4N8OA 2RF2B 4CZIA 2FJWA 4LREA 1H74A 3M6GA 2HQ3A 4F4ZA 5HK4A 4DSFA 1SUQA 3DRXA 3O3LA 1HYSA 3EUNA 4OO1J 4M5MA 2F4FA 2A10A 1WOSA 2OGUA 2H5JB 3ENAA 5AQHA 2EBEA 3AT1B 4PG5A 2EEYA 1NKEA 4LF8J 4OYXA 3O08A 1XHXA 2C2KB 1RWPB 1GOBA 3ZZTA 1S1XA 1X3NA 1FTCA 2DY1A 4H5RA 3M8WA 1IH7A 1TL7B 3TTDA 1VQPS 3QO9A 1UFWA 3HI9A 5JMNA 4C48A 2XGQA 5D77A 3RUBL 1R8HA 3OR1B 4FWSA 1T03B 1JJCB 1JL1A 4C11B 2Q97A 4W98A 2KVIA 2LQ9A 3WNFA 4CJ5A 3S7RA 4ZVPB 1LW2B 4BRGA 1RTDB 4DUYJ 4I2QA 4BR4A 2IAJA 4KHNA 2XLIA 1SAZA 4KO0B 2BDPA 4UOFA 4M5GA 2RN2A 3N4WA 4PL7A 3IKMA 4GV3A 1HW8A 3JQKA 2DXFA 3RRKA 5EGYA 2HBJA 3TR8A 3TVZA 4O8KA 1RI7A 3P38A 3PX4A 2B8PA 2HOEA 3Q2TC 2QC3A 4DUZJ 1T11A 3DYAA 1K8KB 2CH6A 3KTQA 3HSZA 1B0VA 5A0YB 1T3VA 1KAXA 1YK9A 4K0KF 3N6MA 4YHHK 1OVYA 4PA1A 4DX5A 4P73A 1O51A 2UXCJ 3CULA 4JAXA 3Q7CA 2AJ0A 4DV5K 3G25A 1HD0A 3VGMA 4A2AA 3G0ZA 5DM6L 1GLDG 3C6UA 3L09A 2JGUA 2DITA 3VQ5A 1NDCA 1XEZA 1K9MO 3NGDA 3NNCA 3GIIA 3C15B 1VMBA 1ICEB 3NHGA 5D4LA 4M5LA 4A8SA 4P74A 5LT5A 3EZOA 4DX8H 5HO4A 4QBUA 3EGWB 4DPUA 2HIQA 1RTJA 4H4OA 1KONA 4G65A 4C4WA 4RW4B 2QMXA 1SQKA 2YNGB 4C8YA 3W64A 2ZQBA 4ID8A 2E8AA 2JWKA 2Q6CA 4CLSA 1H2VZ 4B02A 4IBNA 1JJ2M 1QQOA 4NZ0A 3EZUA 2FHKA 1VS3A 4O4RA 4IH5A 3THPA 2JEIA 2V5HG 4ZPVR 3VALA 2KL8A 1VQ8N 2NLXA 2DR8A 3PDNA 1S9EB 4M63A 4ZN3A 4CIOA 4JV0A 1Q7LB 3NGTA 4MKVA 2RIJA 1Z2LA 5KFVA 3AARA 2W8LA 1XBWA 2X51A 2M0GB 3D0GE 3A1YG 2W4DA 2GFFA 1LCUA 1YSJA 3G6XA 3KKFA 4PUOA 2M8DB 3E8OA 3QJPA 1SKSA 3SDEA 4HYKA 2OANA 2W9BA 1G1XA 2BUNA 4RUCA 2MSSA 1T9XA 3VQTA 2OCEA 3N01A 2BJ1A 1TL1A 3SZ2A 5C2DA 4CM0A 2XLKA 2E5LF 4JKCA 2QM1A 4PKIA 4JI3F 1S5ZA 2W7OA 4CLWA 4AILC 5HQMA 2FZCB 4KAIA 3AVMA 4O55A 2BOPA 4KB7A 1HLUA 3HDSA 4FL9A 3H7HB 3P31A 1J5OA 2VPZB 2KXHA 3CJ3A 1U6FA 2KU7A 3B6PA 2ZVSA 4KH5A 4H4MB 3J7A1 3IM9A 3CFRA 3T6BA 3VWSA 1D8YA 3QERA 1OY6A 5KT3A 2LA4A 4XAKA 4CEOA 1ZBHA 2QZ8A 3TVYA 3PTWA 2A2CA 2ZH7A 1EJ7L 3FVYA 3UDLA 1XI1A 4XK8C 3GE1A 2XMAA 3O1LA 3SCKE 5LOQA 2QL7B 3SBTA 2VB6A 3KWMA 3OFHA 5DG8A 1OY8A 4FKXA 2YNHB 4IDKB 2ZBQA 5DDRC 1WF2A 1UEUA 3K17A 2VKRA 3T3FA 1GLLO 4FCYA 2EW9A 1A5WA 3CMAS 1BHLA 3BQ1A 3JB9k 3KDOA 4F04B 1B3TA 3U3GA 4IG3B 2LXIA 2ACMA 1U7LA 1D9AA 2NR0A 2V8PA 1QVFR 3CCRS 5AZIB 5D4PA 4DR6F 1IKWA 2CRLA 2HURA 2DGSA 3S1TA 2NSBA 1Z05A 1XMBA 1BQNB 4LRFA 2RE2A 1RT1A 5GADU 3N0VA 5HOOA 4DU3A 3OS1A 1JLFA 5E7OB 4NLXA 1N0UA 1ZXOA 3FE1A 2QT7A 4RW6B 3RR7A 2LA6A 2Z8QA 5ETQA 3QWUA 4Q5VA 2MQLA 4OJGA 1Q16B 2B7BB 4M94A 1N36F 5FPEA 3US5A 5AQVA 2ROPA 1R3NA 5L38A 4WFNL 4OLAA 5KT7A 1FJGF 3I87A 3HVTB 2Z1JA 1KD1O 1U0HB 3H1VX 5E33A 3LP1A 1HMVB 2ASOA 2M7SA 1S7IA 2HBKA 3V4IA 2DGUA 4N41A 3BGRB 1OSDA 1W97L 2PYJA 3QGPA 2QA4N 1UW9A 4X4QA 1X9SA 1WSVA 3M6WA 4MTPA 2ZJQQ 4KH0B 2DRDA 2NRTA 2UUAJ 1S0VA 1JLCB 1S49A 1VSHA 1T6DA 2QIFA 2IDLA 3VAJA 3PIPL 3DLGA 1JL2A 3QAUA 3Q86A 5HLFB 2HSEB 3U7JA 3OYCA 3NS6A 2IA0A 4PKHA 4KE5A 3W1YC 1C0TB 4XO0A 1C0UB 3CCMS 3KG4A 3HTVA 5M2RA 4FJIA 3KLEB 2CGLA 1SIZA 4X4SA 4K4YA 5J2MA 4JEPA 5IQ6A 1N34F 4EYIB 2CPYA 3PXGa 3GIJA 4CQ1A 4JV5F 3IAM9 3G4SN 4LVOP 1E4FT 4JKGB 4X4NA 1HR0F 1OQ3A 3U1LA 4FWNA 4NO7A 1NZ8A 4K4XA 3WEEA 1P90A 2FLOA 4OGCA 4IO8A 4WBFA 4F26A 2V4QA 1BI4B 3VERA 3LP0B 1PYTA 1GTHA 4M5IA 3A3NB 2GUIA 4BG9A 5MLCQ 4LRCA 2I2YA 4ECWA 5KQ8A 4ECSA 2F8HA 4WJBA 4NYZA 2HK3A 2ZUGA 2DJWA 3IS9B 2GMJA 3IR6B 4OYMA 4ZVOB 3M4XA 1KAZA 4AL6A 3NMUA 2VC0A 5AQMA 1X9MA 2WTUA 3P5BP 1XNQF 3D67A 4WFBQ 1LWEA 2W9CB 2LQ5A 3R1XA 5BPNA 4JOUA 1QDUB 2HNDB 4WK1A 5GMKa 2RQKA 4IFYA 1YT3A 1TYQA 2P9LB 3QATA 4WP9A 2B4OA 1S1TA 4A61A 2AJ2A 3PG9A 2B6AB 3V9UA 4YY3F 2V8VA 4M3YA 2HMPA 2OKQA 3UQSA 1UWAA 1N33J 1RT6B 3MAAA 3ZO7A 3EZ5A 3DKDA 4USHA 2DCLA 4DV1F 3DHWC 1YXQA 3EVWA 4DR3K 3R5DA 4A8MP 5CABA 3SEOA 5KFSA 5DDQC 3HHLA 4ENOA 4HH0A 2JEJA 2HHHF 2VG5B 1E6VB 5T7LB 3THWB 2BEFA 4OV1A 2PY5A 5EXWA 2PYLA 1MMNA 1Q1KA 5GAHI 4TLRA 3VGTA 3QIPA 5A76A 3LPUA 1HARA 3MN6A 4ZMMA 4IOAQ 2O8EB 3W2VA 1NLVA 3AY9A 3H5SA 3S3NA 1XMQF 5JVGQ 2V8DA 4Q2LA 3BF3A 1EHWA 3SQ4A 4QWDA 1J54A 3M1FA 4W5QA 4KHWA 1HWLA 3ID8A 5L1KA 3CD6S 2FSKA 4FK4A 3G87A 1V3SA 1SPBP 5KG1A 1Z6RA 2ALYB 3HFKA 1KFSA 4Q7AA 1JNRB 2GMHA 1ZZNA 4QR0A 4WQ4C 3U1NA 5D4NA 4M41A 4OX8A 1HNXK 4J37A 4WU3A 3IRXB 4ZVRB 2UVVA 4H0XB 4J9SA 3VAKA 4HT5A 3BSNA 2J9CA 1IG8A 3BY5A 4X4UA 1JLQA 4HDHA 2IVNA 3H4BA 2XS5A 5H9FJ 1BCMA 5HL7L 4EP5A 2ZNYA 4RBUA 1T8EA 3ILJA 3K5NA 2Y3YA 5A2QU 1BA0A 2JVRA 2GVZA 5KGWA 3OBIA 1D1UA 1RP5A 1X5TA 2FGOA 1WC6A 1YGYA 4B3OB 2ZJRQ 3MK6A 4LFAK 3OL7A 4IKFA 2VFUA 4DV6F 2VHGA 4K4VA 4NXNK 1HBNB 2QKBA 1JQGA 4QZVB 1NGAA 2GJIA 2P9UA 3SQOP 5TKYA 4I68A 2IYIA 3JTPA 2MLYA 1R7IA 3C6AA 4K7QA 5CAAA 4TSXA 4X62F 4AHSA 3EMTA 2Q79A 4IO9L 1VQNN 1B9FA 3M8PB 4DWIA 3M1VA 1RNHA 4RW9B 3BEGB 4DMZA 1D5AA 1HPZB 3PEHA 2B8QA 1NJYA 1IO2A 2EBGA 1F60B 3TAQA 4XIUA 2FLLA 3C46A 1F2HA 1KR4A 2HFOA 1E3MA 2AEFA 1BQXA 1K6YA 3ZZOA 1N0VC 2WW8A 4OMFG 2QLJB 2WONB 3WX4A 2OI2A 2UUTA 2OA8A 4ZLLA 1XNRJ 2HNYA 4CTAB 1X0FA 2ITGA 4RKUC 1O1WA 2QLFB 2KHDA 4H0OA 5ETOA 1U26A 3FBCA 1U1PA 1ZBLA 3LUYA 4MJKA 4P9SA 3FC9A 2RS8A 2YH1A 4ILRA 5DM7L 2N4CA 5KG7A 3V4MA 1GLFO 2AGPA 3QQCD 4CI0B 3ZX2A 4FPRA 1ZYQA 3GYXB 2QA4S 1WEXA 2NRVA 2HNZA 2GQ2A 4CD3A 4H4KC 2GELA 2A42A 3BSAA 4H5NA 2HHWA 1R89A 1M1KO 4FLWA 5C2CA 2CQBA 3HSTB 2WSFC 2XY5A 5DG9A 1RT7B 2V0NA 4LF5J 3TVKA 4F50A 2XS2A 2Z1GA 4ZJOA 3A5LC 3LP3A 5IC6B 3KVGA 1Q81T 2VIHA 3P5JA 1R59O 1WSJA 1N5QA 4OVLA 1NSPA 4WQ5A 2HQDA 4Q2MA 2HHXA 1V4SA 3E9PA 4FJKA 3SFGA 3WXIA 3HCXA 2HSTA 4Z4IA 3MM9B 3G4SS 4OPHA 2YKNA 5HN0A 4JI1J 2LXFA 4DV4K 3OTDA 3IBFB 2QRRA 4KBIA 4PL8A 3DXKA 4DCOB 3M7VA 1SZ2A 3ASMA 1S4FA 3MM8A 4CZMA 4DR5K 1FEHA 1FKOB 2QMWA 1XTZA 4C8ZA 1NOYA 4OV6A 3CCES 1CZBA 2XYPB 4JV1A 4K4UA 3S3MA 1NGFA 1RGVA 2JNJA 2HW3A 3GLJA 3CG7A 2MGZB 1RYSA 4KPYA 3ET6A 4BRMA 4OJ3A 3TQ1A 1RHRB 4CGGA 4YHHF 1DEJA 5D0EA 5KFYA 1M5KC 3AB4B 4F3QA 3JSMA 1C0FA 1WNSA 4U7UD 4O3NA 1ASUA 1RSCA 1D8ZA 2HBRB 2E1MC 4ED2A 4AE5A 3MPUB 4K5RA 3SQ0A 2BRLA 5KQDA 1WEZA 4DV2J 3D6MB 4IG0B 3JSYA 2AHOB 5BR8J 3J7ZT 3Q8SB 2F8TA 4NYPA 4ED6A 1RACB 2ZOFA 2UXBJ 4HUGA 1RT3A 1JLGA 3ZYYX 4EAHD 2AZ3A 4JI6F 4BR9A 4JB8B 3DLLQ 4V19X 3M6UA 5HROB 3OUYA 1G7CB 2FJDB 2C3OA 1UWBA 5DQHA 1FNOA 3ZC4A 4CIFA 1HWIA 2KQ2A 2ZGYA 1NGHA 4X65F 2OPSA 2GJFA 5KFIA 4ILMA 3FZMA 4C8OA 2CXEA 2W24A 1WKKA 1APSA 1VC6A 3OYEA 1R0AA 4CJVA 1M5SA 4P2FA 1I39A 3DGPA 1QZ5A 4CDIA 1U09A 3V1QA 4DX7A 1HNZF 3H59A 3L2RA 1NPRA 1PBUA 3CJ1A 2LP4A 4J9RA 3GPAA 2W2QP 3MUVP 1WC1A 4CGDA 3DLRA 4RCHA 2BKPA 4HACB 4WTOB 1RWUA 2X1GA 3LGNA 3MMBA 4ZCLA 3L7UA 1VQ6N 2V68A 2DFEA 2R7VA 4CFBA 2CH5A 3H98A 1S9GA 1KQSM 1S12A 4GO7X 3M8ZA 3BO4A 2CQDA 1DKGD 2VG7B 3LW5C 1WG4A 4K8XA 4NE9C 1YITS 1U04A 5THWA 1NGEA 2QK9A 1SI9A 5AQFA 4OLOA 1QVGM 5CXTA 3V2UC 1BUPA 1TFWA 2JEFA 2QSWA 4FJXA 1RAJA 3HPGA 1S48A 3IFRA 5BYQA 4Z4GA 3PYDA 3SBMA 5LL6Z 4BVPA 3CD7A 4CO4A 1OO0B 2P9KB 4EMDA 1HBMB 5J1EB 2ZM6K 1JK9B 2JVOA 3TWHA 1WC5A 3W3DA 4CZCA 3LPTA 5C24B 4FP9A 1GNKA 2OTLS 1TKDA 1RE1B 4N5SA 2FVSA 1VQ9N