1HJRA

Atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Site-specific recombinase
molecule keywords HOLLIDAY JUNCTION RESOLVASE (RUVC)
publication title Atomic structure of the RuvC resolvase: a holliday junction-specific endonuclease from E. coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 1994-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hjrA00
1EP4A 2VG7A 5HP1A 1YTUA 2XO7A 2IC3A 4CEEA 4CERA 3AVAA 4DSIA 3OYGA 4EZ6A 1TAUA 3HVTA 3HL8A 3ZT1A 2G8VA 4B3OA 1SKSA 2BANA 5CZ1A 2KFNA 3TARA 5C25A 4DSKA 2F96A 3AVNA 3M8QA 4B9MA 3IAYA 3SZ2A 3TAEA 4M3ZA 3QEIA 4RW8A 4NCBA 1BHLA 2HMIA 4DF4A 3KD5E 4F4KA 4H4OA 1C1AA 4B8CA 4CJUA 4CJPA 1SUQA 3KLGA 3OYFA 1RT1A 2Y1JA 1KFDA 1ZYQA 2IS3A 1BIZA 3LPUA 4RW9A 1NK0A 4H4MA 3RMAA 3DOKA 2KZMA 3JYTA 1LWEA 3PO5A 4FJIA 2YNGA 5J1EA 1XC9A 3RMDA 3K59A 1WAJA 4QAGA 1YT3A 3DLBA 4FVMA 4CHPA 4W5TA 3L2VA 4HUFA 3QIOA 4DSFA 1UA1A 4F3OA 4DF8A 1KLMA 1NJZA 1JKHA 2EX3A 2E6MA 4CESA 3VN5A 1J53A 2WONA 4CGJA 4DG1A 4HCCA 1WSHA 1RBTA 4O5BA 5I3UA 4FZZA 3K5MA 1UOCA 3HO1A 2G8KA 4C8MA 2NUBA 4KFBA 3KKSA 3U3YA 3NH2A 4KHUA 5J2PA 3OYAA 3AO1A 4CHYA 1D8YA 1UA0A 3IG1A 3EYZA 3HXMA 1SKRA 3DLRA 4Z4CA 2YHAA 4CJ3A 3KJVA 3SPZA 4IFVA 3NE6A 3QNOA 2D0AA 4W5RA 4FLVA 1L3SA 4ELTA 1S1TA 3VQ8A 4KTQA 3AO5A 4DTNA 1BCOA 4OVLA 1L3UA 4KTWA 4FJMA 4L8RB 3V1QA 4M3UA 3QERA 1XHZA 1FXXA 2G8HA 2IOCA 1QSYA 4I2PA 4LSLA 4CE9A 1JLBA 1RCHA 4CEZA 3LAKA 4M3YA 4AHTA 4DTMA 3HT3A 4FLWA 3FFIA 4WE1A 3V81A 2HHSA 4O44A 1WSFA 1J9AA 3SQ0A 1EXQA 3OYLA 1LAWA 1YVUA 3M8RA 4DSLA 4B08A 1O1WA 3SV3A 4DQIA 2WOMA 3HP6A 2XY8A 3PO4A 3SQ2A 3P83D 3V9XA 1U49A 3AV9A 4MFBA 1C6VA 4CJEA 3EZ5A 5HRNA 1JL2A 4DFKA 3K5OA 4FJ9A 1TL3A 4O0JA 4KHYA 3S9HA 4CJLA 2W42A 3VQ9A 1J5OA 4KO0A 3TR8A 4B9TA 1RBUA 2YV0X 3HSTB 3DLGA 3LAMA 2PZSA 1VSMA 2FBXA 3AA5X 1TKDA 2F8TA 1HRHA 5SWMA 2P51A 4DTUA 3IS9A 3KD1E 1QTMA 3OS1A 2QK9A 3SUQA 1QS4A 4M42A 3UIQA 2YNIA 3L3VA 1QE1A 1ZBUA 3DI6A 2B5JA 4CJSA 1U45A 3AVCA 4LH4A 2GV9A 4FW2A 3MXMA 2PYJA 1BI4B 3MEEA 3OJUA 1YTAA 5HROA 3SJJA 2VG6A 1KFSA 4NCGA 1XHXA 1RILA 1DTTA 1TV6A 1KTQA 3CM6A 3AVIA 5FDLA 3QESA 3D45A 2OZMA 4KAZA 4Z4IA 2ZD1A 3TABA 1RTIA 4C8NA 3K5NA 4DQRA 3RMCA 3VQCA 5J2MA 2G8WA 4E7KA 2RF2A 4KV8A 1C0MA 1JLEA 3LP3A 1RBRA 4CHOA 4FK2A 1S6QA 4R5PA 4CK3A 3LWMA 3LALA 1KVAA 1HQUA 2ETJA 4GVMA 3SQ1A 4CFCA 3QETA 4I9LA 1ITGA 1TL1A 3DMJA 3OYBA 4Z4EA 1RNHA 2Q3SA 1DLOA 4CJ4A 4CFBA 1UAXA 3OJSA 3QINA 1R0AA 1GOBA 1CXQA 3L2WA 3LZJA 3RR7A 3PUFA 3CFRA 4AHSA 3AA3A 1CLQA 3ZSYA 1NOZA 1GOCA 1D5AA 3AVBA 3WNHA 2DY4A 5FROA 1VRUA 1VK0A 4FJHA 4FM0A 5HBMA 4OGEA 4OGCA 3K2PA 2XY5A 3SUNA 1C0TA 1REVA 4CFAA 4CJVA 3LANA 3M8SA 3QEWA 2FBVA 1Y97A 1D9DA 4CJWA 4CF2A 3CG7A 3OYMA 4JRPA 1ZBHA 4OJRA 3C6UA 3K57A 1VSEA 3CFOA 1HNIA 4LSNA 4DQPA 3LP1A 1RBVA 4BWMA 4QCLA 1TK0A 3ALYA 4KTZA 3KK3A 3PX6A 4DS5A 4CF8A 4CF9A 2YKNA 4KHNA 3I0SA 4FJ7A 4N47A 3TAFA 1K6YA 3SCXA 1FK9A 4CJQA 4FZYA 5C42A 2Z1JA 3O4QA 4Z4FA 2OPQA 1J54A 1CZ9A 1HYVA 4CGFA 3ZSWA 3MAQA 1RT5A 3AO2A 1N6QA 4E7HA 1HQEA 4DFMA 1WAFA 4J2DA 3ZCMA 2HVIA 3OYIA 3OYEA 3OVNA 4W5QA 4I7FA 3V1OA 4B9SA 3QIPA 1S1XA 4CEOA 3SV4A 4Y1CA 3VQBA 1DTQA 1QQCA 4H8KA 3A2FA 4HVJA 4DMNA 1RDCA 4N56A 3QEPA 3NCIA 1TK5A 2O4GA 2I5JA 4K8ZA 4Z4GA 1NK7A 1TKXA 1LAVA 1A5WA 1WSEA 3ASMA 4CGDA 4BE0A 4E89A 3SQ4A 1VSFA 4FXDA 4KPYA 4FZXC 1RT6A 5J2NA 4YFUA 5T7BA 4FLXA 1L3TA 4B9LA 5D3GA 3VQ5A 4LY7A 2YKMA 3ITHA 1QSSA 1HPZA 1WN7A 4BDPA 1TGOA 4EP4A 2RN2A 3VQAA 5I42A 1BISA 4CGGA 4JS4A 3AA4A 2G8IA 4ELVA 4CEDA 2P1JA 1KLNA 5DMRA 1VSIA 3ZSXA 4AILC 4CGIA 2XY7A 1Q9YA 3ZT2A 4O0IA 4E0DA 3RRGA 1T03A 4DSJA 4O55A 4AHVA 4FJNA 2X6SA 3B6OA 1ASUA 4IKFA 2X74A 3L2UA 1NJYA 3L3UA 4IG3A 1F21A 3PX4A 4ID1A 3NHGA 4HHTA 4DTSA 1BI4A 4HTUA 3AVKA 2VWJA 1RT2A 5CYQA 4E7JA 4Z0UA 3HPGA 1NKEA 1HYZA 2P5GA 1NK6A 2XRIA 2RPIA 1JL1A 1WSGA 2ITGA 1U4BA 3NGZA 1VSDA 1SV5A 3CQ8A 4J2EA 4CIEA 2HW3A 4FJLA 4RW6A 4CHNA 3NFAA 3AO4A 3SUPA 4KREA 3B6PA 1S9EA 3ISNC 3F9KA 4PA1A 3NH0A 3LDSA 2YNFA 3DM2A 1ZBLA 3AO3A 2HHVA 3DLEA 4NYNA 4KKOA 3AVMA 4ID5A 2XHBA 3KTQA 4JLHA 4CJTA 3I8DA 3S3MA 4RW7A 3V6DA 4CEAA 3ZSQA 3CYMA 3KLIA 4Y1DA 2F8SA 4FW1A 3ZT3A 2G8FA 4EP5A 5JS1A 4B8AB 1ASVA 4KB1A 1JXBA 1TAQA 1S5JA 4M3XA 1BGXT 4OLAA 4C8KA 2OZSA 3VQPA 4CK2A 4W5OA 2E4LA 5KRTA 3VQDA 4DQQA 2R7YA 4HCBA 3K5LA 3LP0A 4DQSA 3PV8A 1N5YA 4CF1A 3KK1A 1B9FA 3H08A 2B6AA 2HNZA 3O3HA 1XWLA 1S1VA 3HVRA 4JRQA 5DK5A 4E1MA 2ZQBA 1JLGA 3HPOA 4CHQA 4DLEA 4ELUA 1RT3A 4M45A 3RWUA 3V9SA 5FRMA 3LWLA 1WLJA 3L8BA 1BL3A 1CZBA 4YNQA 1XI1A 4BE1A 3SYZA 3VQ6A 1JLAA 1NK8A 4M41A 1VSJA 4CEFA 1I3AA 1HYSA 2DTUA 4N5SA 5CYMA 1RDAA 4FLYA 1VSHA 3ZSVA 3PY8A 2A1SA 3NGIA 1TKZA 3HK2A 4IDKA 2HNYA 1IKXA 3VQ4A 3BDPA 4I2QA 3ZT0A 2HVHA 4IFYA 4LD0A 3TAPA 2E6LA 3TWHA 4JS5A 3S3NA 3U6FA 4CJ5A 4I9QA 3NF9A 1FKOA 2Z1IA 1S1UA 1IKVA 3AVGA 4OKJA 2OPRA 3ZSRA 1Q8IA 4E1NA 3OYCA 3V9ZA 1S1WA 4F2SA 4J2AA 1IG9A 3V9WA 2QKBA 3OYNA 4FJ5A 2DFHA 3CFPA 3O3GA 4KHQA 3AVLA 2P5OA 2KTQA 2FBYA 1NOYA 1RT4A 5C24A 3C94A 3TI0A 3LP2A 4DTRA 2LSNA 3RR8A 3DLKA 3NBPA 3OS2A 3KLFA 4CHZA 2A1RA 4DLGA 3SUOA 4CGHA 3HYFA 2G8UA 3NGYA 5FRNA 2Y1IA 2HB5A 1U48A 5J2QA 2VG5A 1Z25A 1A5VA 3QEVA 3AVFA 1JLCA 4K8XA 3KIOA 1Z26A 4DTXA 4CFDA 4F3TA 2GUIA 2ZE2A 3DYAA 4FLTA 4KHWA 1NJXA 2HHWA 1RTJA 1TVRA 5KI6A 1L5UA 2D5RA 1JXEA 4FLZA 4CJFA 3OS0A 4Q0BA 1RTHA 3VQEA 3F73A 2FBTA 1NK5A 2IAJA 3NF6A 1CXUA 1WNSA 4RW4A 2FC0A 3T1AA 4CJKA 4KI6A 1RBSA 3PX0A 2X6NA 3DRRA 2BDPA 2OPPA 2RKIA 3G10A 3MECA 3ZSOA 3RMBA 1T7PA 1BQMA 1VSKA 5E41A 1D9FA 3K58A 4M3RA 4BDYA 1LW0A 4CF0A 2BGGA 3SNNA 2D0BA 4HUEA 4PY5A 4OKEA 4ICLA 1HMVA 3NF7A 4CJRA 5KTQA 2DFEA 4AHCA 3S3OA 1I39A 4MQ3A 2Z1GA 4F8RA 3CM5A 1IKYA 3HJFA 4DTOA 4BE2A 3IRXA 2B4JA 3QEXA 1X9SA 1NKCA 2OYQA 2Z1HA 4F2RA 1ASWA 2YNHA 4GW6A 1SKWA 1C1BA 5KGXA 3V4IA 3HP9A 3P1GA 3MXJA 4RG8A 3TAQA 4W5NA 2IDOA 3O3FA 3SI6A 5EU7A 1EX4A 4N76A 3TANA 2DFFA 4IG0A 5CY4A 1VSLA 3L2QA 1IH7A 3HM9A 2EHGA 3WNFA 3O4NA 3NH1A 4DS4A 4FLUA 1BQNA 3U3GA 1JLQA 2JLEA 4Z4HA 4O4GA 3D0PA 3M8PA 5JS2A 2X78A 3AA2A 3WNGA 1KSPA 4AHUA 4HUGA 3ZSZA 4ZTFA 3C95A 5HRRA 1B9DA 4UQGA 3HPHA 1SL1A 4DFPA 4C8OA 4FJKA 3DOLA 4B9VA 1IKWA 3OYDA 1IO2A 2VWKA 2ATQA 3G0ZA 2OA8A 3E01A 3I0RA 3T3FA 4PQUA 1HJRA 1T05A 1LW2A 1UWBA 3NF8A 5CZ2A 4GMJB 4CIGA 3VA3A 1EETA 4N41A 2D0CA 4KI4A 1U04A 4ZHRA 4OPJA 1LWFA 1RDDA 4OKKA 1Q9XA 3DRSA 4KHSA 1EKEA 1VRTA 2BE2A 1X9WA 1SL2A 1WSJA 3QLHA 4AHRA 1B92A 1C0UA 3AVHA 3RTVA 4DU4A 3L2RA 4DTPA 4ZTJA 2KQ2A 5SZTA 4OPKA 4TSXA 4M3WA 5K14A 1KCFA 1WSIA 4NCAA 5HLFA 2KFZA 1X1PA 3DLHA 2IGIA 4FJ8A 2JGUA 1NKBA 5KGWA 1L3VA 4B9NA 3KLEA 1C1CA 1MU2A 3OY9A 1RTDA 4CIFA 3NAEA 1TKTA 3BGRA 2GBZA 3KKRA 1KRPA 4FJXA 3DRPA 3OYHA 4E7IA 4E3SA 4EZ9A 2HHTA 2YHBA 4DSEA 2O4IA 3C6TA 4IBNA 4DTJA 2PYLA 5KRSA 4PWDA 4Q5VA 3P5JA 4BACA 1W0HA 2QXFA 4CECA 2HHXA 2XY6A 3AVJA 4NYFA 4CK1A 4CEBA 2OPSA 3T19A 1KVBA 1BIUA 1TK8A 2PY5A 1LV5A 3ULDA 3KLHA 4CCHA 4KB0A 3THVA 1GOAA 3EY1A 3JSMA 1S9GA 4DWIA 1BCMA 4DU1A 2QKKA 4G1QA 4FM1A 1U47A 1G15A 4OLBA 2AJQA 2HHQA 1JLFA 3MEGA 1NK9A 1A5XA 4C8LA 4J2BA 3V1RA 4FYDA 3OYKA 3WNEA 4FK4A 4QOZB 4E19A 3OYJA 1S6PA 3LPTA 3VQQA 3KK2A 3LZIA 4FJGA 4LH5A 2HHUA 3MEDA 1X9MA 3V9UA 1QSLA 4FM2A 4CEQA 1NJWA 3SPYA 1QHTA 3QO9A 4FJJA 3TAMA 1ZBFA 3ZT4A 4KRFA 4DU3A 4FK0A 1FKPA 4XIUA 4BWJA 1KVCA 1SL0A 3RRHA 2KZZA 4M3TA 5HRSA 1LWCA 2HNDA 3MXIA 1W9HA 3VA0A 3TAGA 4B9UA 3NDKA 4FCYA 1RT7A 1T8EA 4AH9A 3VQ7A 1RDBA 3QNNA 4PUOA 4DFJA 1NK4A 2KW4A 1HNVA 4BDZA 1ZBIA 4E7LA 5HRPA
chains in the Genus database with same CATH superfamily
1GLLO 5HP1A 2IC3A 1NGJA 3AVAA 5A2QO 1NGBA 4DSIA 2DPNA 2VGNA 4H5NA 1NGHA 4A59A 4EZ6A 3HVTA 3HL8A 1KQSM 5BN9A 2KFNA 3SMPA 2ZJRL 3TARA 4B9MA 3IAYA 3QEIA 1BHLA 4DF4A 3KD5E 4H4OA 5HL7L 5H1SQ 3OYFA 3KLGA 1ZYQA 5AQTA 2IS3A 1BIZA 3LPUA 4H4MA 2P9IB 4YDUC 1YAGA 2HSTA 2W40A 1K73O 3PO5A 4ILGB 5E26A 3RMDA 1XQSC 5GIPA 1WAJA 5BN8A 3DLBA 4FVMA 1VQPN 4CGJA 1J53A 2WONA 3VGKA 5CR4A 1RBTA 4FWQA 4O5BA 3GG4A 3HO1A 4C8MA 4WFNL 3O4WA 4GV6A 3U3YA 2O8BB 2GX9A 1D8YA 3EYZA 3DLRA 3SPZA 4CJ3A 2HBLA 4K41A 3NE6A 3QNOA 3LL3A 4M7XA 4ELTA 3VQ8A 1BCOA 2RHKA 2A41A 3D2EA 4KTWA 3V1QA 4QS7A 5ADXA 4H5VA 1H1VA 2G8HA 4I2PA 4J8FA 1RCHA 4CEZA 3LAKA 3HI0A 2GWKA 1GLEG 3VEVA 3VESA 2HF4A 4FLWA 3V81A 4BRKA 3C6HA 1WSFA 4GNIA 3W0LA 3PSIA 4PL7A 3SV3A 3HP6A 3K9KA 3SQ2A 1U49A 3SJHA 3D2FB 4DV3K 1G99A 5HRNA 1DT9A 4V19S 3HTVA 4B9TA 1HNZK 5BR9A 2FBXA 3AAQA 2F8TA 4YOTA 1BOTO 4DTUA 2O8FA 3IS9A 1GLJO 4CJSA 1QE1A 2B5JA 4NB4A 2Q31A 5GAHP 4LH4A 2GV9A 3MXMA 5EVZA 1VQMN 1KFSA 1RILA 4KAZA 1KTQA 1VQNN 2ZJPL 2ZD1A 1RTIA 3QMLA 4OPAA 2G8WA 4E7KA 4KV8A 3LP3A 4FK2A 1S6QA 4CK3A 3LALA 2ETJA 3C0BA 5FPMA 2Q2RA 4CFCA 1XMQK 2O8DA 1WBBA 4NLCA 3OYBA 4IOAL 2Q3SA 1DLOA 4CJ4A 4CFBA 1UAXA 4FWNA 1R0AA 1CXQA 3LZJA 3PUFA 2FLOA 5AQMA 1GOCA 1D5AA 3AVBA 3WNHA 1LCUA 4MLEA 4FJHA 4OGCA 5BREA 4IEIA 4BRHA 5AQKA 3QEWA 4CJVA 3M8SA 3LANA 2UYTA 3VGLA 3CG7A 5JVGL 4OJRA 2QI2A 1Q18A 3THXB 2QWRA 3LP1A 1RBVA 4KBOA 5AQHA 4FL9A 4M63C 3PX6A 3ENHA 2IVNA 4CF8A 4CF9A 3I0SA 4FJ7A 1N33K 4CJQA 1YUWA 5C42A 3WUHA 5BRFA 2HBJA 4CGFA 1N6QA 3ZSWA 4J2DA 4E7HA 4DFMA 1U2VA 4R79A 3OYIA 4W5QA 4CEOA 4H8KA 4CZIA 4N56A 4DMNA 4ISEA 4K8ZA 4FWRA 1TKXA 5AFUA 1RDUA 4E89A 4YHHK 4FZXC 5J2NA 4WQ5C 3MN6A 1Y64A 1QQOA 1HPZA 1TGOA 3VQAA 1BISA 4CGGA 4JS4A 2G8IA 4IJNA 1KLNA 5DM6L 5DMRA 3ULEA 3ZSXA 3R9PA 4AILC 4CGIA 1Q9YA 3QBWA 3P31A 3ZYYX 3RRGA 5AQLA 1T03A 1IBKK 3BF1A 4FJNA 2YI1A 3T1YK 1ASUA 5GADP 1NJYA 3BEXA 1N32K 1F21A 3NHGA 4DTSA 1BI4A 1KAXA 2WTUA 4CZJA 5CYQA 2RPIA 3NGZA 3LDNA 4IWVA 4FJLA 4CHNA 2YNFA 4KKOA 3E9PA 1QHAA 3S3MA 3VPZA 4CEAA 4JI6K 1XUPO 3ZSQA 3CYMA 2F8SA 1S72N 2UUBK 4KB1A 1JXBA 4EAHD 3T7ZA 5F1XA 1QVGM 3CXCM 4W5OA 1X9JA 3CCLN 5C10A 3VETA 4CZHA 4C1NK 2NRZA 1YI2N 3Q7BA 3ID8A 1B9FA 3H08A 2Q36A 3C7NB 1BA0A 1XWLA 3HVRA 4E1MA 2FF6A 3TSPA 1YHQN 1RT3A 3RWUA 2E5LK 4MO4A 1JLAA 2DTUA 4N5SA 1RDAA 3GE1A 3HK2A 1TYQA 3BDPA 2HVHA 5KPZA 1IJJA 3TAPA 3TWHA 1S1UA 1IKVA 3ZSRA 4E1NA 2FSKA 1NM1A 3G6EN 3V9ZA 1S1WA 3AGRA 2CGJA 3CFPA 1BO5O 3AVLA 3AGKA 5AQNA 5KQDA 2HOEA 3C94A 4NLBA 4CHZA 4DLGA 2IVOA 2G8UA 4FOEA 5AQUA 4HTLA 5J2QA 2HF3A 1ILYA 4B1XB 4FLTA 4H03B 4X64K 1RTJA 5KI6A 4X66K 2D5RA 1JXEA 2E2OA 2QTDA 2IAJA 4EFHA 1CXUA 4CJKA 3O1BA 3DRRA 4JYAK 2RKIA 1D9FA 4FWSA 2D0BA 4OKEA 4Z94A 4ICLA 4F8RA 3CM5A 1ASWA 2YNHA 4GW6A 3P1GA 1ATSA 4JKFA 3QICA 3OBYA 1Q81O 5EU7A 5LY3A 2DFFA 4IG0A 5CY4A 1NWKA 3HM9A 3A0IX 3WNFA 3NMUA 1DKGD 3O4NA 5C15A 5JICA 1BQNA 1BUPA 4AM7A 1YXQA 3C95A 1X3MA 2FXUA 1SL1A 5M1FA 4ILHA 3KVGA 4NXNK 3SMSA 2OA8A 4PQUA 3L4IA 4WYBA 1UWBA 1EETA 4KI4A 4OPJA 1Q9XA 1VRTA 1X9WA 2UXDK 4AHRA 3MCPA 3RTVA 3L2RA 3VEOA 3SAHA 2YCHA 5K14A 4BRCA 1HX1A 4ILJA 2FSJA 1NJIO 2HHHK 4H0VB 1TKTA 3BGRA 3KKRA 3DRPA 4E7IA 2ZGYA 4RTFD 3N4QA 2PYLA 4PWDA 3P5JA 2CH6A 1VHXA 2XY6A 2I7NA 3KWIA 1EQYA 2OPSA 3T19A 1TK8A 3CJAA 3IDHA 2HMPA 4JI8K 1S9GA 2P9NA 3CERA 3WQUA 4DU1A 3F9MA 1NMNA 4WF9L 2WFBA 1U47A 1G15A 3U4LA 3V1RA 2HBKA 4FYDA 3Q7CA 4E19A 1S6PA 3LPTA 3KK2A 3ID6A 4EHUA 4FJGA 4B9QA 3V9UA 3SPYA 3VGMA 4FJJA 3AARA 3A8YA 4XIUA 1NNEA 3LM2A 3RRHA 4JI2K 3M1FA 3KHYA 5HRSA 4GVEA 3NDKA 1T8EA 5FPNA 3VQ7A 4AH9A 3QNNA 4PUOA 1ZBIA 2O8CB 5AZIB 3CCVN 4FWPA 5JLHA 2XO7A 1OH8A 3MCAB 3P4IA 4XEIA 3ZX3A 3ZT1A 3C6AA 4B3OA 2BANA 5C25A 1NBWA 1WB9A 2E1YA 3CI5A 4NCBA 2HMIA 3CQXA 2D0OA 4B8CA 4CJUA 3VEWA 4FWMA 4RW9A 3RMAA 3DOKA 1LWEA 3QDKA 3GOIA 3JXUA 3O6WA 4FWOA 4HUFA 1UA1A 3QIOA 1N34K 5C12A 5AQIA 4H5RA 4XH1A 3CJCA 1JKHA 4CESA 2W6KA 4CJ7A 4BRLA 2G8KA 2NUBA 4KFBA 2VWBA 4DB3A 4KHUA 2NLXA 5EY4A 5J2PA 4CHYA 3T1HK 3IMXA 4IFEA 1OKJA 3KJVA 3R1XA 2D0AA 4W5RA 1L3SA 4KTQA 2VYPA 4BC4A 2GELA 4FJMA 4L8RB 4H0YB 1XHZA 2GTDA 3HOSA 3G4SN 1JCEA 2IOCA 3LDQA 4F9OA 1QSYA 4LSLA 1JLBA 3MN9A 4M3YA 4AHTA 4MLHA 2F9TA 3FFIA 2HHSA 4XH5A 3OYLA 4DSLA 4CD1A 1YVNA 4YDUA 4DQIA 1K8KB 4MFBA 1C6VA 4CJEA 3EZ5A 1JL2A 4DFKA 1SS6A 1V4SA 4KHYA 3S9HA 4JK9A 4CJLA 2W42A 4K43A 3TR8A 1RBUA 2YV0X 5HOOA 4BRDA 5SWMA 1HKCA 3KD1E 2BTFA 3H1VX 1QS4A 3OBWA 4M42A 4FVUA 3L3VA 1U45A 3UE5A 3WXKA 3OJUA 1YTAA 5HROA 2VG6A 4B3RK 4Z4IA 3QESA 4H0OA 3K5NA 3WXIA 1YIJN 2H3GX 2RF2A 3ZETA 1KVAA 4DV5K 4GVMA 3SQ1A 4NO7A 4I9LA 5AQRA 4LF5K 3R8EA 2E20A 1GOBA 3J81O 3L2WA 5FLXO 4IZ9A 4JD2A 1NOZA 3TTDA 2P9SB 1TUYA 1ZC6A 4DV4K 4FM0A 2QWPA 4CFAA 2P9KB 4CF2A 3OYMA 4JRPA 1ZBHA 1EWQA 4DQPA 3CFOA 1HNIA 4BR2A 1NGCA 3KK3A 4DS5A 3J7ZO 3IFRA 3TAFA 3SCXA 2Z1JA 2E2NA 1RT5A 3AO2A 1HQEA 1WAFA 3H46O 3OYEA 3OVNA 4LC9B 1YJNN 2Q1NA 2ASOA 2O8EB 3HBTA 3VQBA 1QZ6A 1ATRA 1DTQA 1QQCA 4HVJA 2KFZA 4IDHA 3E66A 2O4GA 2QW9A 1LAVA 4BE0A 1VSFA 5C2DA 1TUUA 2V7YA 5JLFA 4YFUA 1VQKN 1NGDA 4B9LA 1QSSA 4BDPA 2YKMA 1K8AO 1WN7A 2RN2A 1DEJA 4CEDA 1CZAN 3IKMA 3ZT2A 4O0IA 4DV0K 2Q0RA 1XNQK 4BRMA 2X6SA 3QFPA 4OO1J 4B1ZA 4ID1A 3CCRN 4HHTA 4HTUA 3AVKA 3A5LC 1HPMA 5AQYA 4I6MA 4JKGB 4E7JA 1NKEA 3HPGA 2QWOA 1HYZA 3VF6A 1NK6A 2P5GA 2XRIA 1WSGA 3VEZA 3CPWM 2YHWA 1SV5A 4CIEA 4H5WA 3WXLA 4BVPA 1Q82O 3NFAA 4KREA 1SAZA 4BRNA 1ZBLA 3NH0A 4DV6K 3AO3A 2HHVA 1YJ9N 3KTQA 4X62K 2OTJN 3I8DA 3V6DA 3ZT3A 1HUXA 3CMAN 3QFUA 3VF2A 4B8AB 1S5JA 3UKRB 2ZJQL 4WQ5A 2E4LA 5KRTA 2A3ZA 2GWJA 4DQQA 2R7YA 3K5LA 4JI5K 3LP0A 2NRWA 5C0YA 4YORA 3THWB 3RVCA 1OVQA 5ELZA 4CHQA 4CZEA 4BREA 3V9SA 3LWLA 1WLJA 3L8BA 4FO0A 4DR1K 3ENOA 3SYZA 3WEEA 3VQ6A 1HYSA 1W7AA 2GUPA 4BG9A 4FLYA 3ZSVA 5GIOA 5JS1A 4IDKA 1IKXA 4I2QA 2QXLA 3S3NA 4JS5A 3NF9A 2Z1IA 3IUCA 3VENA 3OYNA 4EIAA 5FPDA 2AA4A 4A2AA 2GEMA 3TI0A 4DTRA 3RR8A 3OS2A 3KLFA 1X3NA 3SUOA 4CZGA 4DUZK 3HYFA 2UUAK 3O8MA 1N8RO 5FPEA 3QEVA 3AVFA 4AF1A 3KZBA 1Z26A 4GY2B 4CFDA 2GUIA 2ZE2A 4E1JA 4A62A 4U67L 1L5UA 4FLZA 4JI7K 2QEXN 4Q0BA 1RTHA 3CCQN 5C2FA 1SQKA 1NK5A 1MDUB 5AQQA 4KI6A 1P8ZA 4LFAK 2BDPA 3QB0A 1NGAA 2OPPA 3J8AA 3CCMN 3UKUB 4BC5A 4RCHA 4JKHA 4CF0A 3CCJN 2BGGA 3AY9A 4BR5A 4HUEA 4JHDB 4GKKK 5KTQA 1I39A 2V7ZA 1IKYA 4DTOA 4BE2A 1X9SA 2B4JA 2Z1HA 1SKWA 3V4IA 5KGXA 4BRFA 1JCGA 4IO9L 3O3FA 2Q97A 5EOYA 1VSLA 4JKCA 2EHGA 3J80O 4FLUA 3U3GA 1JLQA 2JLEA 2X78A 3AA2A 1KSPA 3CD6N 4B1VA 5KPRA 1B9DA 3TU5A 1R59O 1T44A 1Q7YO 4B9VA 4LF4K 2VWKA 2P9UA 3E01A 3I0RA 1O13A 3NF8A 4CIGA 4N41A 4ZHRA 1RDDA 4KHSA 1EKEA 1SL2A 1KAYA 3FZKA 1BDGA 1B92A 3AVHA 4ZTJA 3D7EO 5SZTA 4OPKA 4M3WA 1KCFA 4NCAA 5HLFA 3E1YA 2NZTA 1X1PA 4FJ8A 3CC2N 1L3VA 5GAEP 3KLEA 2IIRA 1MU2A 3DXKA 4BVOA 3HRGA 3NAEA 2GBZA 4E3SA 4EZ9A 2YHBA 4DV2K 1OH6A 4DTJA 3A5MC 3CC4N 4DUYK 4CECA 2HHXA 3D2EB 2PY5A 3VERA 4KB0A 3KLHA 1JJ2M 3FZFA 3EY1A 1BCMA 2QKKA 4G1QA 4C23A 3BY5A 5B8HA 4K42A 1HJOA 1JLFA 4C8LA 2E88A 3DXMA 3OYKA 3OYJA 2I7PA 3TPQA 1X9MA 4FM2A 1QHTA 3GL1A 3QO9A 4KRFA 3H3NO 4FK0A 1FKPA 4JNEA 4BWJA 1SL0A 1E4GT 5LJWA 4M3TA 4KH4A 5EX5A 4FCYA 3MWTA 5AJ3K 4DFJA 3RSEA 2O8FB 4BDZA 5HRPA 1EP4A 4DR2K 4CERA 1WBDA 3LM9A 3I8BA 2G8VA 1J6ZA 2YJFA 4A2BA 3FZHA 5CZ1A 1U6ZA 4DSKA 3L0QA 3AVNA 4EHTA 3SZ2A 3JS6A 3OTOK 4RW8A 4CZMA 4F4KA 4WQ4C 4BC2A 3SK3A 1RT1A 4MDAA 2Y1JA 1HKBA 1HR0K 2Q0UA 3EKUA 2KZMA 2YNGA 5J1EA 4A61A 2O8DB 4QAGA 1YT3A 3THYA 3FFKB 4W5TA 1NG9A 3H1QA 4F3OA 4DF8A 2UXCK 2E6MA 2BUPA 2FF3B 4DG1A 1FJGK 5I3UA 4YOUA 1UOCA 4QS8A 4Y0WA 1W97L 4JI0K 3KKSA 3NH2A 2BH1A 3OYAA 3HSCA 3CJ1A 5CE3A 1SKRA 1BWFO 4FPAA 4Z4CA 2YHAA 2WUSA 5AZJA 3EE9A 2E1ZA 3AO5A 5AR0A 1HLUA 5M1OA 4OVLA 4M3UA 3QERA 1FXXA 1QVFM 1HNWK 3EE8A 4CVNE 3DWLA 4CE9A 4BGAA 4DTMA 3HT3A 1S22A 4WE1A 4FOIA 1J9AA 1IV0A 3F2KA 4B08A 1P90A 5IWAK 1W2BM 1MWKA 2XY8A 3V9XA 3AV9A 4ISGA 3ATVA 3O9TA 2A6AA 4O0JA 3W3DA 1NGEA 1T3VA 4KH6A 4BRPA 3VQ9A 3A5NC 4KO0A 3LAMA 2PZSA 1HRHA 4AQYK 2P51A 3ULEB 1QTMA 4B3TK 3OS1A 3M3ZA 3CC7N 1QQMA 4JKEA 4FWLA 3AVCA 2ITMA 4FW2A 2YHXA 2PYJA 1BI4B 3MEEA 3I55N 4BY9C 3SJJA 1YITN 1XHXA 1TV6A 5FDLA 3AVIA 3ZLJA 4C8NA 3RMCA 4DQRA 5J2MA 3J7YP 3E9OA 1C0MA 5BPLA 4CHOA 1NU0A 3EZWA 5DM7L 3LWMA 2P9IA 1HQUA 3U9ZA 2JWKA 3OA9A 4CZLA 2ZM6K 3QETA 1TL1A 4B1WB 4Z4EA 1RNHA 3OJSA 5TKWA 1MA9B 3E9LA 1CLQA 2ZGZA 5FROA 2IVPA 1VK0A 5HBMA 2O8BA 1FW6A 2XY5A 3SUNA 1E4FT 1Y97A 1D9DA 3K57A 1ZBSA 4MDBA 3MN7A 4QCLA 4HWIA 3ALYA 2E8AA 1GLCG 4N47A 1K6YA 1FK9A 4FZYA 2OPQA 3MAQA 1TYQB 2HBMA 1LOTB 3ZCMA 4CBXA 4BQZA 2HVIA 4B9SA 3QIPA 1GLAG 1RDCA 3VMFB 3D2FA 3NCIA 1NK7A 1IG8A 1S3XA 3ASMA 3SQ4A 4FXDA 4KPYA 1RT6A 5D3GA 3VQ5A 4LY7A 3ITHA 2A5XA 4CZKA 4EP4A 4DV1K 5I42A 3AA4A 4ELVA 4JKDA 3FZMA 1BA1A 2P1JA 3MX5A 5AQPA 1VSIA 2QWQA 2ZF5O 5JVHL 4E0DA 4DSJA 4O55A 2V51B 4CBWA 4B1YB 4IKFA 2UXBK 5BRDA 5F0XA 4IG3A 5KQ8A 2VWJA 3CQYA 2UUCK 1K9MO 3CIPA 2ITGA 2JWLA 5AQVA 4RW6A 3SUPA 1GLFO 1S9EA 3ISNC 4JI1K 3F9KA 4PA1A 4A57A 5M1KA 3DM2A 3DLEA 4NYNA 4JV5K 1OVYA 2XHBA 4JLHA 4AM6A 4CJTA 3SBTA 2QWLA 2G8FA 4DV7K 3F5TA 1ASVA 4LF7K 1MWMA 1TAQA 4M3XA 4OLAA 1I94K 4BGBA 4CK2A 4B3SK 3VQDA 1J5EK 3C65A 4DQSA 3PV8A 1N5YA 4CF1A 3MWPA 2B6AA 2HNZA 4BR9A 3I56N 3O3HA 2F9WA 1NGFA 3THXA 2ZQBA 1JLGA 4ELUA 5AQSA 1QQNA 5FRMA 4M45A 5AQZA 1BL3A 1CZBA 4H0PA 4YNQA 1XI1A 5AQWA 1HNVA 1VSJA 4CEFA 1I3AA 5CYMA 1VQLN 4JN4A 3J7AP 5AQOA 1Z05A 3PY8A 1TKZA 3VQ4A 3ZT0A 4LD0A 2E6LA 4CJ5A 5BRHA 4I9QA 3B8AX 4OKJA 1FKOA 3OYCA 1XNRK 3AVGA 2OPRA 1Q8IA 2KKZA 1IG9A 3V9WA 4FJ5A 3CJBA 4YOYA 1RT4A 5C24A 1OH5A 4H0TB 4BRAA 2Y1IA 3VEXA 1E3MA 1Z25A 2P9NB 3MDQA 2P9PB 4K8XA 3KIOA 4F3TA 4OX9K 4KHWA 2HHWA 1NJXA 1WOQA 4CJFA 1EO1A 3MMVA 3VQEA 3F73A 2FBTA 3O9QA 1N36K 1IBMK 3NF6A 1WNSA 3T1AA 4RW4A 2FC0A 5F2RA 2X6NA 5JMVA 3MECA 3RMBA 1T7PA 1VSKA 3K58A 1LW0A 5AQJA 1HMVA 3NF7A 3KWGA 4CJRA 4AHCA 4MQ3A 3TTCA 3HJFA 3QEXA 3VOVA 4LFBK 1NKCA 4F2RA 3FE1A 1C1BA 3HP9A 3MXJA 3O5BA 4W5NA 4L3QA 2IDOA 5AQXA 1EX4A 3PSFA 4DS4A 3VTHA 4Z4HA 4O4GA 3D0PA 3HZ6A 3WNGA 4HUGA 2NRRA 3ZSZA 3VF4A 3C7NA 4UQGA 3CCUN 1VQ6N 3CETA 4DFPA 4FJKA 1GLBG 3G25A 4CW7B 3OYDA 1IO2A 2ATQA 3G0ZA 3T3FA 3WQTA 1VQ9N 1VQ7N 1HJRA 1VQ4N 1LW2A 5CZ2A 4GMJB 1BG3A 1SZ2A 2D0CA 3A5OC 3DRSA 3R6MA 3TTFA 3QLHA 1WSIA 1NKBA 5KGWA 3FGUA 3ZX0A 5IT9O 2PBDA 3OY9A 1KRPA 3OYHA 4BR4A 4LF6K 2O4IA 1C0GA 2ZWHA 4WCEL 1VQON 5KRSA 3LDPA 3CCSN 3TSUA 1W0HA 3O08A 3MN5A 3PLAA 4CBUA 4DKWA 3DAWA 4NYFA 1LV5A 3ULDA 3THVA 4YOXA 1GOAA 3JSMA 4DWIA 3T69A 4FM1A 3M6GA 4OLBA 2A40A 1NK9A 1A5XA 1M90O 3U9DA 4JAXA 2OTLN 4A5BA 1IBLK 3L4QA 4FPBA 3WNEA 4JKBA 1V4TA 2HHUA 3SLCA 3SAFA 4CEQA 3ZEUB 4BRIA 4IOCL 4DU3A 4O8UA 1HKGA 4JI3K 1KC8O 1LWCA 3MXIA 3TAGA 3VA0A 4QS9A 1RT7A 3I33A 1RDBA 4BG8A 3UB5A 1NK4A 4E7LA 2VG7A 3R3LA 4BR7A 1YTUA 4CEEA 2CH5A 2E2PA 3OYGA 1TAUA 3OHRA 2F4VK 1SKSA 3O1WA 4YOVA 2F96A 3M8QA 4M3ZA 1T6DA 3TAEA 1C1AA 2YHYA 4CJPA 1SUQA 2KHOA 3L6QA 1KFDA 3ZETB 2P9LB 2VQFK 1NK0A 5M1PA 3JYTA 5GINA 4FJIA 1XC9A 3K59A 4BC3A 4CHPA 3L2VA 4DSFA 3SBGA 1KLMA 1NJZA 2EX3A 3VN5A 2W6LA 4LF8K 4HCCA 1WSHA 4JD2B 1OH7A 4FZZA 2CGKA 3K5MA 1HNXK 3AO1A 3WXJA 1UA0A 3IG1A 3HXMA 4IFVA 4FLVA 2VCPA 1S1TA 3NVMA 4DTNA 3OW2M 2D1KA 1L3UA 5ADXH 4JI4K 4U7BA 3WXMB 3AAPA 4NXMK 1ESVA 4O44A 1VAZA 4WQ4A 3SQ0A 1EXQA 3CJ9A 1LAWA 1YVUA 4C1NI 3M8RA 5LMUK 1O1WA 3M5RA 2WOMA 5E84A 3CCEN 3DLLL 3CMEN 3P83D 3PO4A 3MK6A 1NGIA 4FJ9A 1Z6RA 3K5OA 1TL3A 4BR0A 4KHPK 1J5OA 2QA4N 1NLVA 3HSTB 3DLGA 4M7YA 1VSMA 3AA5X 4IXCA 1TKDA 3BZCA 1M1KO 4DCHA 2O8CA 2QK9A 3SUQA 5AZIA 3UIQA 2YNIA 3DI6A 1ZBUA 3S41A 5LL6Z 4PKIA 2ASPA 4LFCK 4NCGA 2WBNA 4I6MB 1DTTA 3CM6A 4DR4K 2OZMA 3D45A 5I9EB 3TABA 4WFAL 3VQCA 1BU6O 2PFUA 3FLCO 1JLEA 1RFQA 1RBRA 3PIPL 4R5PA 4UY8O 4GV9A 3EL2A 1ITGA 3FR0A 3DMJA 3NVKA 3QINA 3EKSA 3RR7A 3CFRA 4AHSA 3AA3A 5EXWA 3ZSYA 2WC9A 2OCEA 4CD3A 2KLAA 2DY4A 1VRUA 1EWRA 3VEYA 4OGEA 4BRGA 1NGGA 3K2PA 1ATNA 1C0TA 4KH5A 1REVA 4DR6K 4FSVA 2FBVA 3H45C 1ZXOA 4CJWA 5TKYA 3C6UA 1VSEA 4DR3K 5GAGP 4BROA 4BWMA 1KD1O 1TK0A 4KTZA 2YKNA 3WEEB 4KHNA 1XMOK 3SAGA 1YF5L 3O4QA 4Z4FA 1J54A 1CZ9A 1HYVA 5AQGA 1VQ5N 1RDWX 2NRVA 3CF5L 4I7FA 3V1OA 2AP1A 4LF9K 1KXPA 1S1XA 3SV4A 4Y1CA 3QEPA 4Z4GA 1K8KA 3A2FA 1TK5A 2I5JA 5AFUH 4CGDA 1A5WA 1WSEA 2RE2A 1WUAA 1QZ5A 5M1NA 5T7BA 4FLXA 1L3TA 4CI6A 4JK7A 4DHYA 3K9JA 2XY7A 3CPEA 3VTIA 4AHVA 3B6OA 2X74A 3L2UA 2VQEK 4DR5K 3L3UA 3PX4A 3WT0A 1GLDG 5LMNK 1NMDA 1U2VB 3BZKA 4B1UB 1RT2A 4IO8A 4Z0UA 3EN9A 3MX2A 1JL1A 1U4BA 3PIOL 1VSDA 3CQ8A 4J2EA 2HW3A 3BF3A 3AO4A 3B6PA 3ENBA 3U8XA 4RWTA 3LDSA 3AVMA 4ID5A 4RW7A 3KLIA 4Y1DA 4FW1A 4EP5A 3G71N 4PL8A 4IOXA 3N4PA 1BGXT 3BUZB 4C8KA 2P9SA 2OZSA 3VQPA 4HCBA 3GDQA 4DR7K 3KK1A 2P9KA 4PKHA 5BPNA 3FZLA 1S1VA 4JRQA 5DK5A 3HPOA 4DLEA 2P9UB 5KPTA 1D4XA 2PAVA 4BE1A 5BR8K 4DQ8A 3ATUA 4M41A 1NK8A 2P9PA 2QM1A 4CZFA 4GV3A 1VSHA 2A1SA 3NGIA 4BQLA 2HNYA 4IFYA 2NRTA 3U6FA 2OANA 2O8EA 2D0PA 4F2SA 3DXKB 4J2AA 4IEEA 2QKBA 2DFHA 4B3MK 1C0FA 3O3GA 4KHQA 2F7TA 2P5OA 3BP8A 2FBYA 2KTQA 1KAZA 5BPMA 1NOYA 3O80A 2NRHA 3ZX2A 3LP2A 2LSNA 3DLKA 3NBPA 2A1RA 4CGHA 3NGYA 5FRNA 2HB5A 3O9SA 1U48A 2VG5A 4MO5A 2YJEA 1A5VA 1JLCA 4K0KK 4IJAA 2QWMA 4OPHA 4H0XB 2UU9K 4DTXA 1DGKN 3DYAA 1TVRA 4A5AA 1XC3A 3OS0A 3DXMB 4O8KA 2FSNA 5LJVA 4JKGA 1RBSA 1Q86O 3PX0A 3G10A 3ZSOA 1BQMA 5E41A 4M3RA 4BDYA 4JKAA 3SNNA 4PY5A 1T6CA 3O9RA 3LDLA 2DFEA 3S3OA 2Z1GA 4PHTX 3IRXA 2OYQA 3GBTA 3RSEB 4RG8A 3TAQA 4WFBL 3SI6A 3JAMO 4N76A 3TANA 3UKRA 4GKJK 3L2QA 1IH7A 5CHIA 3HOTA 3NH1A 4XH4A 3M8PA 4O5FA 2J4RA 5JS2A 4AHUA 3QBXA 4ZTFA 5HRRA 2NNWA 4K25A 3HPHA 4C8OA 2NRXA 3DOLA 3THWA 1IKWA 5M1QA 1T05A 3VA3A 5AQFA 1U04A 1LWFA 4OKKA 4X65K 2BE2A 3THYB 1WSJA 2QWNA 2VGMA 1C0UA 4JK8A 4DTPA 4DU4A 2KQ2A 4TSXA 3H6EA 3DLHA 2IGIA 2JGUA 4B9NA 2D4WA 3D6RA 1C1CA 1YJWN 1RTDA 4CIFA 3ZEUA 3P39A 4FJXA 2HHTA 4DSEA 3C6TA 4BRQA 4IBNA 3DJCA 5AZJB 4Q5VA 3LDOA 4BACA 2QXFA 3H3OB 4G9ZA 4ISFA 3EEQA 3KK7A 3AVJA 2V52B 4CK1A 1VQ8N 4CEBA 1KVBA 1BIUA 4CCHA 2A42A 4H5TA 1JCFA 3HM8A 4YOWA 3P38A 3TSQA 2AJQA 2HHQA 2E2QA 3MEGA 4YY3K 4J2BA 4FWKA 3EO3A 4FK4A 4JEPA 3K0SA 4QOZB 1RGIA 3CJ7A 3VQQA 3LZIA 4LH5A 3MEDA 2YX6A 1QSLA 3UKUA 1NJWA 2P9LA 4PKGA 2CGLA 3TAMA 1ZBFA 3ZT4A 4JHDA 2ASMA 2W41A 1KVCA 3CHWA 3O9UA 2KZZA 5MLCQ 2HNDA 1W9HA 4B9UA 2EWSA 2KW4A 4LSNA
chains in the Genus database with same CATH topology
1EP4A 2VG7A 5HP1A 1YTUA 2XO7A 2IC3A 4CEEA 4CERA 3AVAA 4DSIA 3OYGA 4EZ6A 1TAUA 3HVTA 3HL8A 3ZT1A 2G8VA 4B3OA 1SKSA 2BANA 5CZ1A 2KFNA 3TARA 5C25A 4DSKA 2F96A 3AVNA 3M8QA 4B9MA 3IAYA 3SZ2A 3TAEA 4M3ZA 3QEIA 4RW8A 4NCBA 1BHLA 2HMIA 4DF4A 3KD5E 4F4KA 4H4OA 1C1AA 4B8CA 4CJUA 4CJPA 1SUQA 3KLGA 3OYFA 1RT1A 2Y1JA 1KFDA 1ZYQA 2IS3A 1BIZA 3LPUA 4RW9A 1NK0A 4H4MA 3RMAA 3DOKA 2KZMA 3JYTA 1LWEA 3PO5A 4FJIA 2YNGA 5J1EA 1XC9A 3RMDA 3K59A 1WAJA 4QAGA 1YT3A 3DLBA 4FVMA 4CHPA 4W5TA 3L2VA 4HUFA 3QIOA 4DSFA 1UA1A 4F3OA 4DF8A 1KLMA 1NJZA 1JKHA 2EX3A 2E6MA 4CESA 3VN5A 1J53A 2WONA 4CGJA 4DG1A 4HCCA 1WSHA 1RBTA 4O5BA 5I3UA 4FZZA 3K5MA 1UOCA 3HO1A 2G8KA 4C8MA 2NUBA 4KFBA 3KKSA 3U3YA 3NH2A 4KHUA 5J2PA 3OYAA 3AO1A 4CHYA 1D8YA 1UA0A 3IG1A 3EYZA 3HXMA 1SKRA 3DLRA 4Z4CA 2YHAA 4CJ3A 3KJVA 3SPZA 4IFVA 3NE6A 3QNOA 2D0AA 4W5RA 4FLVA 1L3SA 4ELTA 1S1TA 3VQ8A 4KTQA 3AO5A 4DTNA 1BCOA 4OVLA 1L3UA 4KTWA 4FJMA 4L8RB 3V1QA 4M3UA 3QERA 1XHZA 1FXXA 2G8HA 2IOCA 1QSYA 4I2PA 4LSLA 4CE9A 1JLBA 1RCHA 4CEZA 3LAKA 4M3YA 4AHTA 4DTMA 3HT3A 4FLWA 3FFIA 4WE1A 3V81A 2HHSA 4O44A 1WSFA 1J9AA 3SQ0A 1EXQA 3OYLA 1LAWA 1YVUA 3M8RA 4DSLA 4B08A 1O1WA 3SV3A 4DQIA 2WOMA 3HP6A 2XY8A 3PO4A 3SQ2A 3P83D 3V9XA 1U49A 3AV9A 4MFBA 1C6VA 4CJEA 3EZ5A 5HRNA 1JL2A 4DFKA 3K5OA 4FJ9A 1TL3A 4O0JA 4KHYA 3S9HA 4CJLA 2W42A 3VQ9A 1J5OA 4KO0A 3TR8A 4B9TA 1RBUA 2YV0X 3HSTB 3DLGA 3LAMA 2PZSA 1VSMA 2FBXA 3AA5X 1TKDA 2F8TA 1HRHA 5SWMA 2P51A 4DTUA 3IS9A 3KD1E 1QTMA 3OS1A 2QK9A 3SUQA 1QS4A 4M42A 3UIQA 2YNIA 3L3VA 1QE1A 1ZBUA 3DI6A 2B5JA 4CJSA 1U45A 3AVCA 4LH4A 2GV9A 4FW2A 3MXMA 2PYJA 1BI4B 3MEEA 3OJUA 1YTAA 5HROA 3SJJA 2VG6A 1KFSA 4NCGA 1XHXA 1RILA 1DTTA 1TV6A 1KTQA 3CM6A 3AVIA 5FDLA 3QESA 3D45A 2OZMA 4KAZA 4Z4IA 2ZD1A 3TABA 1RTIA 4C8NA 3K5NA 4DQRA 3RMCA 3VQCA 5J2MA 2G8WA 4E7KA 2RF2A 4KV8A 1C0MA 1JLEA 3LP3A 1RBRA 4CHOA 4FK2A 1S6QA 4R5PA 4CK3A 3LWMA 3LALA 1KVAA 1HQUA 2ETJA 4GVMA 3SQ1A 4CFCA 3QETA 4I9LA 1ITGA 1TL1A 3DMJA 3OYBA 4Z4EA 1RNHA 2Q3SA 1DLOA 4CJ4A 4CFBA 1UAXA 3OJSA 3QINA 1R0AA 1GOBA 1CXQA 3L2WA 3LZJA 3RR7A 3PUFA 3CFRA 4AHSA 3AA3A 1CLQA 3ZSYA 1NOZA 1GOCA 1D5AA 3AVBA 3WNHA 2DY4A 5FROA 1VRUA 1VK0A 4FJHA 4FM0A 5HBMA 4OGEA 4OGCA 3K2PA 2XY5A 3SUNA 1C0TA 1REVA 4CFAA 4CJVA 3LANA 3M8SA 3QEWA 2FBVA 1Y97A 1D9DA 4CJWA 4CF2A 3CG7A 3OYMA 4JRPA 1ZBHA 4OJRA 3C6UA 3K57A 1VSEA 3CFOA 1HNIA 4LSNA 4DQPA 3LP1A 1RBVA 4BWMA 4QCLA 1TK0A 3ALYA 4KTZA 3KK3A 3PX6A 4DS5A 4CF8A 4CF9A 2YKNA 4KHNA 3I0SA 4FJ7A 4N47A 3TAFA 1K6YA 3SCXA 1FK9A 4CJQA 4FZYA 5C42A 2Z1JA 3O4QA 4Z4FA 2OPQA 1J54A 1CZ9A 1HYVA 4CGFA 3ZSWA 3MAQA 1RT5A 3AO2A 1N6QA 4E7HA 1HQEA 4DFMA 1WAFA 4J2DA 3ZCMA 2HVIA 3OYIA 3OYEA 3OVNA 4W5QA 4I7FA 3V1OA 4B9SA 3QIPA 1S1XA 4CEOA 3SV4A 4Y1CA 3VQBA 1DTQA 1QQCA 4H8KA 3A2FA 4HVJA 4DMNA 1RDCA 4N56A 3QEPA 3NCIA 1TK5A 2O4GA 2I5JA 4K8ZA 4Z4GA 1NK7A 1TKXA 1LAVA 1A5WA 1WSEA 3ASMA 4CGDA 4BE0A 4E89A 3SQ4A 1VSFA 4FXDA 4KPYA 4FZXC 1RT6A 5J2NA 4YFUA 5T7BA 4FLXA 1L3TA 4B9LA 5D3GA 3VQ5A 4LY7A 2YKMA 3ITHA 1QSSA 1HPZA 1WN7A 4BDPA 1TGOA 4EP4A 2RN2A 3VQAA 5I42A 1BISA 4CGGA 4JS4A 3AA4A 2G8IA 4ELVA 4CEDA 2P1JA 1KLNA 5DMRA 1VSIA 3ZSXA 4AILC 4CGIA 2XY7A 1Q9YA 3ZT2A 4O0IA 4E0DA 3RRGA 1T03A 4DSJA 4O55A 4AHVA 4FJNA 2X6SA 3B6OA 1ASUA 4IKFA 2X74A 3L2UA 1NJYA 3L3UA 4IG3A 1F21A 3PX4A 4ID1A 3NHGA 4HHTA 4DTSA 1BI4A 4HTUA 3AVKA 2VWJA 1RT2A 5CYQA 4E7JA 4Z0UA 3HPGA 1NKEA 1HYZA 2P5GA 1NK6A 2XRIA 2RPIA 1JL1A 1WSGA 2ITGA 1U4BA 3NGZA 1VSDA 1SV5A 3CQ8A 4J2EA 4CIEA 2HW3A 4FJLA 4RW6A 4CHNA 3NFAA 3AO4A 3SUPA 4KREA 3B6PA 1S9EA 3ISNC 3F9KA 4PA1A 3NH0A 3LDSA 2YNFA 3DM2A 1ZBLA 3AO3A 2HHVA 3DLEA 4NYNA 4KKOA 3AVMA 4ID5A 2XHBA 3KTQA 4JLHA 4CJTA 3I8DA 3S3MA 4RW7A 3V6DA 4CEAA 3ZSQA 3CYMA 3KLIA 4Y1DA 2F8SA 4FW1A 3ZT3A 2G8FA 4EP5A 5JS1A 4B8AB 1ASVA 4KB1A 1JXBA 1TAQA 1S5JA 4M3XA 1BGXT 4OLAA 4C8KA 2OZSA 3VQPA 4CK2A 4W5OA 2E4LA 5KRTA 3VQDA 4DQQA 2R7YA 4HCBA 3K5LA 3LP0A 4DQSA 3PV8A 1N5YA 4CF1A 3KK1A 1B9FA 3H08A 2B6AA 2HNZA 3O3HA 1XWLA 1S1VA 3HVRA 4JRQA 5DK5A 4E1MA 2ZQBA 1JLGA 3HPOA 4CHQA 4DLEA 4ELUA 1RT3A 4M45A 3RWUA 3V9SA 5FRMA 3LWLA 1WLJA 3L8BA 1BL3A 1CZBA 4YNQA 1XI1A 4BE1A 3SYZA 3VQ6A 1JLAA 1NK8A 4M41A 1VSJA 4CEFA 1I3AA 1HYSA 2DTUA 4N5SA 5CYMA 1RDAA 4FLYA 1VSHA 3ZSVA 3PY8A 2A1SA 3NGIA 1TKZA 3HK2A 4IDKA 2HNYA 1IKXA 3VQ4A 3BDPA 4I2QA 3ZT0A 2HVHA 4IFYA 4LD0A 3TAPA 2E6LA 3TWHA 4JS5A 3S3NA 3U6FA 4CJ5A 4I9QA 3NF9A 1FKOA 2Z1IA 1S1UA 1IKVA 3AVGA 4OKJA 2OPRA 3ZSRA 1Q8IA 4E1NA 3OYCA 3V9ZA 1S1WA 4F2SA 4J2AA 1IG9A 3V9WA 2QKBA 3OYNA 4FJ5A 2DFHA 3CFPA 3O3GA 4KHQA 3AVLA 2P5OA 2KTQA 2FBYA 1NOYA 1RT4A 5C24A 3C94A 3TI0A 3LP2A 4DTRA 2LSNA 3RR8A 3DLKA 3NBPA 3OS2A 3KLFA 4CHZA 2A1RA 4DLGA 3SUOA 4CGHA 3HYFA 2G8UA 3NGYA 5FRNA 2Y1IA 2HB5A 1U48A 5J2QA 2VG5A 1Z25A 1A5VA 3QEVA 3AVFA 1JLCA 4K8XA 3KIOA 1Z26A 4DTXA 4CFDA 4F3TA 2GUIA 2ZE2A 3DYAA 4FLTA 4KHWA 1NJXA 2HHWA 1RTJA 1TVRA 5KI6A 1L5UA 2D5RA 1JXEA 4FLZA 4CJFA 3OS0A 4Q0BA 1RTHA 3VQEA 3F73A 2FBTA 1NK5A 2IAJA 3NF6A 1CXUA 1WNSA 4RW4A 2FC0A 3T1AA 4CJKA 4KI6A 1RBSA 3PX0A 2X6NA 3DRRA 2BDPA 2OPPA 2RKIA 3G10A 3MECA 3ZSOA 3RMBA 1T7PA 1BQMA 1VSKA 5E41A 1D9FA 3K58A 4M3RA 4BDYA 1LW0A 4CF0A 2BGGA 3SNNA 2D0BA 4HUEA 4PY5A 4OKEA 4ICLA 1HMVA 3NF7A 4CJRA 5KTQA 2DFEA 4AHCA 3S3OA 1I39A 4MQ3A 2Z1GA 4F8RA 3CM5A 1IKYA 3HJFA 4DTOA 4BE2A 3IRXA 2B4JA 3QEXA 1X9SA 1NKCA 2OYQA 2Z1HA 4F2RA 1ASWA 2YNHA 4GW6A 1SKWA 1C1BA 5KGXA 3V4IA 3HP9A 3P1GA 3MXJA 4RG8A 3TAQA 4W5NA 2IDOA 3O3FA 3SI6A 5EU7A 1EX4A 4N76A 3TANA 2DFFA 4IG0A 5CY4A 1VSLA 3L2QA 1IH7A 3HM9A 2EHGA 3WNFA 3O4NA 3NH1A 4DS4A 4FLUA 1BQNA 3U3GA 1JLQA 2JLEA 4Z4HA 4O4GA 3D0PA 3M8PA 5JS2A 2X78A 3AA2A 3WNGA 1KSPA 4AHUA 4HUGA 3ZSZA 4ZTFA 3C95A 5HRRA 1B9DA 4UQGA 3HPHA 1SL1A 4DFPA 4C8OA 4FJKA 3DOLA 4B9VA 1IKWA 3OYDA 1IO2A 2VWKA 2ATQA 3G0ZA 2OA8A 3E01A 3I0RA 3T3FA 4PQUA 1HJRA 1T05A 1LW2A 1UWBA 3NF8A 5CZ2A 4GMJB 4CIGA 3VA3A 1EETA 4N41A 2D0CA 4KI4A 1U04A 4ZHRA 4OPJA 1LWFA 1RDDA 4OKKA 1Q9XA 3DRSA 4KHSA 1EKEA 1VRTA 2BE2A 1X9WA 1SL2A 1WSJA 3QLHA 4AHRA 1B92A 1C0UA 3AVHA 3RTVA 4DU4A 3L2RA 4DTPA 4ZTJA 2KQ2A 5SZTA 4OPKA 4TSXA 4M3WA 5K14A 1KCFA 1WSIA 4NCAA 5HLFA 2KFZA 1X1PA 3DLHA 2IGIA 4FJ8A 2JGUA 1NKBA 5KGWA 1L3VA 4B9NA 3KLEA 1C1CA 1MU2A 3OY9A 1RTDA 4CIFA 3NAEA 1TKTA 3BGRA 2GBZA 3KKRA 1KRPA 4FJXA 3DRPA 3OYHA 4E7IA 4E3SA 4EZ9A 2HHTA 2YHBA 4DSEA 2O4IA 3C6TA 4IBNA 4DTJA 2PYLA 5KRSA 4PWDA 4Q5VA 3P5JA 4BACA 1W0HA 2QXFA 4CECA 2HHXA 2XY6A 3AVJA 4NYFA 4CK1A 4CEBA 2OPSA 3T19A 1KVBA 1BIUA 1TK8A 2PY5A 1LV5A 3ULDA 3KLHA 4CCHA 4KB0A 3THVA 1GOAA 3EY1A 3JSMA 1S9GA 4DWIA 1BCMA 4DU1A 2QKKA 4G1QA 4FM1A 1U47A 1G15A 4OLBA 2AJQA 2HHQA 1JLFA 3MEGA 1NK9A 1A5XA 4C8LA 4J2BA 3V1RA 4FYDA 3OYKA 3WNEA 4FK4A 4QOZB 4E19A 3OYJA 1S6PA 3LPTA 3VQQA 3KK2A 3LZIA 4FJGA 4LH5A 2HHUA 3MEDA 1X9MA 3V9UA 1QSLA 4FM2A 4CEQA 1NJWA 3SPYA 1QHTA 3QO9A 4FJJA 3TAMA 1ZBFA 3ZT4A 4KRFA 4DU3A 4FK0A 1FKPA 4XIUA 4BWJA 1KVCA 1SL0A 3RRHA 2KZZA 4M3TA 5HRSA 1LWCA 2HNDA 3MXIA 1W9HA 3VA0A 3TAGA 4B9UA 3NDKA 4FCYA 1RT7A 1T8EA 4AH9A 3VQ7A 1RDBA 3QNNA 4PUOA 4DFJA 1NK4A 2KW4A 1HNVA 4BDZA 1ZBIA 4E7LA 5HRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EP4 A;  2VG7 A;  5HP1 A;  1YTU A;  2XO7 A;  2IC3 A;  4CEE A;  4CER A;  3AVA A;  4DSI A;  3OYG A;  4EZ6 A;  1TAU A;  3HVT A;  3HL8 A;  3ZT1 A;  2G8V A;  4B3O A;  1SKS A;  2BAN A;  5CZ1 A;  2KFN A;  3TAR A;  5C25 A;  4DSK A;  2F96 A;  3AVN A;  3M8Q A;  4B9M A;  3IAY A;  3SZ2 A;  3TAE A;  4M3Z A;  3QEI A;  4RW8 A;  4NCB A;  1BHL A;  2HMI A;  4DF4 A;  3KD5 E;  4F4K A;  4H4O A;  1C1A A;  4B8C A;  4CJU A;  4CJP A;  1SUQ A;  3KLG A;  3OYF A;  1RT1 A;  2Y1J A;  1KFD A;  1ZYQ A;  2IS3 A;  1BIZ A;  3LPU A;  4RW9 A;  1NK0 A;  4H4M A;  3RMA A;  3DOK A;  2KZM A;  3JYT A;  1LWE A;  3PO5 A;  4FJI A;  2YNG A;  5J1E A;  1XC9 A;  3RMD A;  3K59 A;  1WAJ A;  4QAG A;  1YT3 A;  3DLB A;  4FVM A;  4CHP A;  4W5T A;  3L2V A;  4HUF A;  3QIO A;  4DSF A;  1UA1 A;  4F3O A;  4DF8 A;  1KLM A;  1NJZ A;  1JKH A;  2EX3 A;  2E6M A;  4CES A;  3VN5 A;  1J53 A;  2WON A;  4CGJ A;  4DG1 A;  4HCC A;  1WSH A;  1RBT A;  4O5B A;  5I3U A;  4FZZ A;  3K5M A;  1UOC A;  3HO1 A;  2G8K A;  4C8M A;  2NUB A;  4KFB A;  3KKS A;  3U3Y A;  3NH2 A;  4KHU A;  5J2P A;  3OYA A;  3AO1 A;  4CHY A;  1D8Y A;  1UA0 A;  3IG1 A;  3EYZ A;  3HXM A;  1SKR A;  3DLR A;  4Z4C A;  2YHA A;  4CJ3 A;  3KJV A;  3SPZ A;  4IFV A;  3NE6 A;  3QNO A;  2D0A A;  4W5R A;  4FLV A;  1L3S A;  4ELT A;  1S1T A;  3VQ8 A;  4KTQ A;  3AO5 A;  4DTN A;  1BCO A;  4OVL A;  1L3U A;  4KTW A;  4FJM A;  4L8R B;  3V1Q A;  4M3U A;  3QER A;  1XHZ A;  1FXX A;  2G8H A;  2IOC A;  1QSY A;  4I2P A;  4LSL A;  4CE9 A;  1JLB A;  1RCH A;  4CEZ A;  3LAK A;  4M3Y A;  4AHT A;  4DTM A;  3HT3 A;  4FLW A;  3FFI A;  4WE1 A;  3V81 A;  2HHS A;  4O44 A;  1WSF A;  1J9A A;  3SQ0 A;  1EXQ A;  3OYL A;  1LAW A;  1YVU A;  3M8R A;  4DSL A;  4B08 A;  1O1W A;  3SV3 A;  4DQI A;  2WOM A;  3HP6 A;  2XY8 A;  3PO4 A;  3SQ2 A;  3P83 D;  3V9X A;  1U49 A;  3AV9 A;  4MFB A;  1C6V A;  4CJE A;  3EZ5 A;  5HRN A;  1JL2 A;  4DFK A;  3K5O A;  4FJ9 A;  1TL3 A;  4O0J A;  4KHY A;  3S9H A;  4CJL A;  2W42 A;  3VQ9 A;  1J5O A;  4KO0 A;  3TR8 A;  4B9T A;  1RBU A;  2YV0 X;  3HST B;  3DLG A;  3LAM A;  2PZS A;  1VSM A;  2FBX A;  3AA5 X;  1TKD A;  2F8T A;  1HRH A;  5SWM A;  2P51 A;  4DTU A;  3IS9 A;  3KD1 E;  1QTM A;  3OS1 A;  2QK9 A;  3SUQ A;  1QS4 A;  4M42 A;  3UIQ A;  2YNI A;  3L3V A;  1QE1 A;  1ZBU A;  3DI6 A;  2B5J A;  4CJS A;  1U45 A;  3AVC A;  4LH4 A;  2GV9 A;  4FW2 A;  3MXM A;  2PYJ A;  1BI4 B;  3MEE A;  3OJU A;  1YTA A;  5HRO A;  3SJJ A;  2VG6 A;  1KFS A;  4NCG A;  1XHX A;  1RIL A;  1DTT A;  1TV6 A;  1KTQ A;  3CM6 A;  3AVI A;  5FDL A;  3QES A;  3D45 A;  2OZM A;  4KAZ A;  4Z4I A;  2ZD1 A;  3TAB A;  1RTI A;  4C8N A;  3K5N A;  4DQR A;  3RMC A;  3VQC A;  5J2M A;  2G8W A;  4E7K A;  2RF2 A;  4KV8 A;  1C0M A;  1JLE A;  3LP3 A;  1RBR A;  4CHO A;  4FK2 A;  1S6Q A;  4R5P A;  4CK3 A;  3LWM A;  3LAL A;  1KVA A;  1HQU A;  2ETJ A;  4GVM A;  3SQ1 A;  4CFC A;  3QET A;  4I9L A;  1ITG A;  1TL1 A;  3DMJ A;  3OYB A;  4Z4E A;  1RNH A;  2Q3S A;  1DLO A;  4CJ4 A;  4CFB A;  1UAX A;  3OJS A;  3QIN A;  1R0A A;  1GOB A;  1CXQ A;  3L2W A;  3LZJ A;  3RR7 A;  3PUF A;  3CFR A;  4AHS A;  3AA3 A;  1CLQ A;  3ZSY A;  1NOZ A;  1GOC A;  1D5A A;  3AVB A;  3WNH A;  2DY4 A;  5FRO A;  1VRU A;  1VK0 A;  4FJH A;  4FM0 A;  5HBM A;  4OGE A;  4OGC A;  3K2P A;  2XY5 A;  3SUN A;  1C0T A;  1REV A;  4CFA A;  4CJV A;  3LAN A;  3M8S A;  3QEW A;  2FBV A;  1Y97 A;  1D9D A;  4CJW A;  4CF2 A;  3CG7 A;  3OYM A;  4JRP A;  1ZBH A;  4OJR A;  3C6U A;  3K57 A;  1VSE A;  3CFO A;  1HNI A;  4LSN A;  4DQP A;  3LP1 A;  1RBV A;  4BWM A;  4QCL A;  1TK0 A;  3ALY A;  4KTZ A;  3KK3 A;  3PX6 A;  4DS5 A;  4CF8 A;  4CF9 A;  2YKN A;  4KHN A;  3I0S A;  4FJ7 A;  4N47 A;  3TAF A;  1K6Y A;  3SCX A;  1FK9 A;  4CJQ A;  4FZY A;  5C42 A;  2Z1J A;  3O4Q A;  4Z4F A;  2OPQ A;  1J54 A;  1CZ9 A;  1HYV A;  4CGF A;  3ZSW A;  3MAQ A;  1RT5 A;  3AO2 A;  1N6Q A;  4E7H A;  1HQE A;  4DFM A;  1WAF A;  4J2D A;  3ZCM A;  2HVI A;  3OYI A;  3OYE A;  3OVN A;  4W5Q A;  4I7F A;  3V1O A;  4B9S A;  3QIP A;  1S1X A;  4CEO A;  3SV4 A;  4Y1C A;  3VQB A;  1DTQ A;  1QQC A;  4H8K A;  3A2F A;  4HVJ A;  4DMN A;  1RDC A;  4N56 A;  3QEP A;  3NCI A;  1TK5 A;  2O4G A;  2I5J A;  4K8Z A;  4Z4G A;  1NK7 A;  1TKX A;  1LAV A;  1A5W A;  1WSE A;  3ASM A;  4CGD A;  4BE0 A;  4E89 A;  3SQ4 A;  1VSF A;  4FXD A;  4KPY A;  4FZX C;  1RT6 A;  5J2N A;  4YFU A;  5T7B A;  4FLX A;  1L3T A;  4B9L A;  5D3G A;  3VQ5 A;  4LY7 A;  2YKM A;  3ITH A;  1QSS A;  1HPZ A;  1WN7 A;  4BDP A;  1TGO A;  4EP4 A;  2RN2 A;  3VQA A;  5I42 A;  1BIS A;  4CGG A;  4JS4 A;  3AA4 A;  2G8I A;  4ELV A;  4CED A;  2P1J A;  1KLN A;  5DMR A;  1VSI A;  3ZSX A;  4AIL C;  4CGI A;  2XY7 A;  1Q9Y A;  3ZT2 A;  4O0I A;  4E0D A;  3RRG A;  1T03 A;  4DSJ A;  4O55 A;  4AHV A;  4FJN A;  2X6S A;  3B6O A;  1ASU A;  4IKF A;  2X74 A;  3L2U A;  1NJY A;  3L3U A;  4IG3 A;  1F21 A;  3PX4 A;  4ID1 A;  3NHG A;  4HHT A;  4DTS A;  1BI4 A;  4HTU A;  3AVK A;  2VWJ A;  1RT2 A;  5CYQ A;  4E7J A;  4Z0U A;  3HPG A;  1NKE A;  1HYZ A;  2P5G A;  1NK6 A;  2XRI A;  2RPI A;  1JL1 A;  1WSG A;  2ITG A;  1U4B A;  3NGZ A;  1VSD A;  1SV5 A;  3CQ8 A;  4J2E A;  4CIE A;  2HW3 A;  4FJL A;  4RW6 A;  4CHN A;  3NFA A;  3AO4 A;  3SUP A;  4KRE A;  3B6P A;  1S9E A;  3ISN C;  3F9K A;  4PA1 A;  3NH0 A;  3LDS A;  2YNF A;  3DM2 A;  1ZBL A;  3AO3 A;  2HHV A;  3DLE A;  4NYN A;  4KKO A;  3AVM A;  4ID5 A;  2XHB A;  3KTQ A;  4JLH A;  4CJT A;  3I8D A;  3S3M A;  4RW7 A;  3V6D A;  4CEA A;  3ZSQ A;  3CYM A;  3KLI A;  4Y1D A;  2F8S A;  4FW1 A;  3ZT3 A;  2G8F A;  4EP5 A;  5JS1 A;  4B8A B;  1ASV A;  4KB1 A;  1JXB A;  1TAQ A;  1S5J A;  4M3X A;  1BGX T;  4OLA A;  4C8K A;  2OZS A;  3VQP A;  4CK2 A;  4W5O A;  2E4L A;  5KRT A;  3VQD A;  4DQQ A;  2R7Y A;  4HCB A;  3K5L A;  3LP0 A;  4DQS A;  3PV8 A;  1N5Y A;  4CF1 A;  3KK1 A;  1B9F A;  3H08 A;  2B6A A;  2HNZ A;  3O3H A;  1XWL A;  1S1V A;  3HVR A;  4JRQ A;  5DK5 A;  4E1M A;  2ZQB A;  1JLG A;  3HPO A;  4CHQ A;  4DLE A;  4ELU A;  1RT3 A;  4M45 A;  3RWU A;  3V9S A;  5FRM A;  3LWL A;  1WLJ A;  3L8B A;  1BL3 A;  1CZB A;  4YNQ A;  1XI1 A;  4BE1 A;  3SYZ A;  3VQ6 A;  1JLA A;  1NK8 A;  4M41 A;  1VSJ A;  4CEF A;  1I3A A;  1HYS A;  2DTU A;  4N5S A;  5CYM A;  1RDA A;  4FLY A;  1VSH A;  3ZSV A;  3PY8 A;  2A1S A;  3NGI A;  1TKZ A;  3HK2 A;  4IDK A;  2HNY A;  1IKX A;  3VQ4 A;  3BDP A;  4I2Q A;  3ZT0 A;  2HVH A;  4IFY A;  4LD0 A;  3TAP A;  2E6L A;  3TWH A;  4JS5 A;  3S3N A;  3U6F A;  4CJ5 A;  4I9Q A;  3NF9 A;  1FKO A;  2Z1I A;  1S1U A;  1IKV A;  3AVG A;  4OKJ A;  2OPR A;  3ZSR A;  1Q8I A;  4E1N A;  3OYC A;  3V9Z A;  1S1W A;  4F2S A;  4J2A A;  1IG9 A;  3V9W A;  2QKB A;  3OYN A;  4FJ5 A;  2DFH A;  3CFP A;  3O3G A;  4KHQ A;  3AVL A;  2P5O A;  2KTQ A;  2FBY A;  1NOY A;  1RT4 A;  5C24 A;  3C94 A;  3TI0 A;  3LP2 A;  4DTR A;  2LSN A;  3RR8 A;  3DLK A;  3NBP A;  3OS2 A;  3KLF A;  4CHZ A;  2A1R A;  4DLG A;  3SUO A;  4CGH A;  3HYF A;  2G8U A;  3NGY A;  5FRN A;  2Y1I A;  2HB5 A;  1U48 A;  5J2Q A;  2VG5 A;  1Z25 A;  1A5V A;  3QEV A;  3AVF A;  1JLC A;  4K8X A;  3KIO A;  1Z26 A;  4DTX A;  4CFD A;  4F3T A;  2GUI A;  2ZE2 A;  3DYA A;  4FLT A;  4KHW A;  1NJX A;  2HHW A;  1RTJ A;  1TVR A;  5KI6 A;  1L5U A;  2D5R A;  1JXE A;  4FLZ A;  4CJF A;  3OS0 A;  4Q0B A;  1RTH A;  3VQE A;  3F73 A;  2FBT A;  1NK5 A;  2IAJ A;  3NF6 A;  1CXU A;  1WNS A;  4RW4 A;  2FC0 A;  3T1A A;  4CJK A;  4KI6 A;  1RBS A;  3PX0 A;  2X6N A;  3DRR A;  2BDP A;  2OPP A;  2RKI A;  3G10 A;  3MEC A;  3ZSO A;  3RMB A;  1T7P A;  1BQM A;  1VSK A;  5E41 A;  1D9F A;  3K58 A;  4M3R A;  4BDY A;  1LW0 A;  4CF0 A;  2BGG A;  3SNN A;  2D0B A;  4HUE A;  4PY5 A;  4OKE A;  4ICL A;  1HMV A;  3NF7 A;  4CJR A;  5KTQ A;  2DFE A;  4AHC A;  3S3O A;  1I39 A;  4MQ3 A;  2Z1G A;  4F8R A;  3CM5 A;  1IKY A;  3HJF A;  4DTO A;  4BE2 A;  3IRX A;  2B4J A;  3QEX A;  1X9S A;  1NKC A;  2OYQ A;  2Z1H A;  4F2R A;  1ASW A;  2YNH A;  4GW6 A;  1SKW A;  1C1B A;  5KGX A;  3V4I A;  3HP9 A;  3P1G A;  3MXJ A;  4RG8 A;  3TAQ A;  4W5N A;  2IDO A;  3O3F A;  3SI6 A;  5EU7 A;  1EX4 A;  4N76 A;  3TAN A;  2DFF A;  4IG0 A;  5CY4 A;  1VSL A;  3L2Q A;  1IH7 A;  3HM9 A;  2EHG A;  3WNF A;  3O4N A;  3NH1 A;  4DS4 A;  4FLU A;  1BQN A;  3U3G A;  1JLQ A;  2JLE A;  4Z4H A;  4O4G A;  3D0P A;  3M8P A;  5JS2 A;  2X78 A;  3AA2 A;  3WNG A;  1KSP A;  4AHU A;  4HUG A;  3ZSZ A;  4ZTF A;  3C95 A;  5HRR A;  1B9D A;  4UQG A;  3HPH A;  1SL1 A;  4DFP A;  4C8O A;  4FJK A;  3DOL A;  4B9V A;  1IKW A;  3OYD A;  1IO2 A;  2VWK A;  2ATQ A;  3G0Z A;  2OA8 A;  3E01 A;  3I0R A;  3T3F A;  4PQU A;  1HJR A;  1T05 A;  1LW2 A;  1UWB A;  3NF8 A;  5CZ2 A;  4GMJ B;  4CIG A;  3VA3 A;  1EET A;  4N41 A;  2D0C A;  4KI4 A;  1U04 A;  4ZHR A;  4OPJ A;  1LWF A;  1RDD A;  4OKK A;  1Q9X A;  3DRS A;  4KHS A;  1EKE A;  1VRT A;  2BE2 A;  1X9W A;  1SL2 A;  1WSJ A;  3QLH A;  4AHR A;  1B92 A;  1C0U A;  3AVH A;  3RTV A;  4DU4 A;  3L2R A;  4DTP A;  4ZTJ A;  2KQ2 A;  5SZT A;  4OPK A;  4TSX A;  4M3W A;  5K14 A;  1KCF A;  1WSI A;  4NCA A;  5HLF A;  2KFZ A;  1X1P A;  3DLH A;  2IGI A;  4FJ8 A;  2JGU A;  1NKB A;  5KGW A;  1L3V A;  4B9N A;  3KLE A;  1C1C A;  1MU2 A;  3OY9 A;  1RTD A;  4CIF A;  3NAE A;  1TKT A;  3BGR A;  2GBZ A;  3KKR A;  1KRP A;  4FJX A;  3DRP A;  3OYH A;  4E7I A;  4E3S A;  4EZ9 A;  2HHT A;  2YHB A;  4DSE A;  2O4I A;  3C6T A;  4IBN A;  4DTJ A;  2PYL A;  5KRS A;  4PWD A;  4Q5V A;  3P5J A;  4BAC A;  1W0H A;  2QXF A;  4CEC A;  2HHX A;  2XY6 A;  3AVJ A;  4NYF A;  4CK1 A;  4CEB A;  2OPS A;  3T19 A;  1KVB A;  1BIU A;  1TK8 A;  2PY5 A;  1LV5 A;  3ULD A;  3KLH A;  4CCH A;  4KB0 A;  3THV A;  1GOA A;  3EY1 A;  3JSM A;  1S9G A;  4DWI A;  1BCM A;  4DU1 A;  2QKK A;  4G1Q A;  4FM1 A;  1U47 A;  1G15 A;  4OLB A;  2AJQ A;  2HHQ A;  1JLF A;  3MEG A;  1NK9 A;  1A5X A;  4C8L A;  4J2B A;  3V1R A;  4FYD A;  3OYK A;  3WNE A;  4FK4 A;  4QOZ B;  4E19 A;  3OYJ A;  1S6P A;  3LPT A;  3VQQ A;  3KK2 A;  3LZI A;  4FJG A;  4LH5 A;  2HHU A;  3MED A;  1X9M A;  3V9U A;  1QSL A;  4FM2 A;  4CEQ A;  1NJW A;  3SPY A;  1QHT A;  3QO9 A;  4FJJ A;  3TAM A;  1ZBF A;  3ZT4 A;  4KRF A;  4DU3 A;  4FK0 A;  1FKP A;  4XIU A;  4BWJ A;  1KVC A;  1SL0 A;  3RRH A;  2KZZ A;  4M3T A;  5HRS A;  1LWC A;  2HND A;  3MXI A;  1W9H A;  3VA0 A;  3TAG A;  4B9U A;  3NDK A;  4FCY A;  1RT7 A;  1T8E A;  4AH9 A;  3VQ7 A;  1RDB A;  3QNN A;  4PUO A;  4DFJ A;  1NK4 A;  2KW4 A;  1HNV A;  4BDZ A;  1ZBI A;  4E7L A;  5HRP A; 
#chains in the Genus database with same CATH topology
 1GLL O;  5HP1 A;  2IC3 A;  1NGJ A;  3AVA A;  5A2Q O;  1NGB A;  4DSI A;  2DPN A;  2VGN A;  4H5N A;  1NGH A;  4A59 A;  4EZ6 A;  3HVT A;  3HL8 A;  1KQS M;  5BN9 A;  2KFN A;  3SMP A;  2ZJR L;  3TAR A;  4B9M A;  3IAY A;  3QEI A;  1BHL A;  4DF4 A;  3KD5 E;  4H4O A;  5HL7 L;  5H1S Q;  3OYF A;  3KLG A;  1ZYQ A;  5AQT A;  2IS3 A;  1BIZ A;  3LPU A;  4H4M A;  2P9I B;  4YDU C;  1YAG A;  2HST A;  2W40 A;  1K73 O;  3PO5 A;  4ILG B;  5E26 A;  3RMD A;  1XQS C;  5GIP A;  1WAJ A;  5BN8 A;  3DLB A;  4FVM A;  1VQP N;  4CGJ A;  1J53 A;  2WON A;  3VGK A;  5CR4 A;  1RBT A;  4FWQ A;  4O5B A;  3GG4 A;  3HO1 A;  4C8M A;  4WFN L;  3O4W A;  4GV6 A;  3U3Y A;  2O8B B;  2GX9 A;  1D8Y A;  3EYZ A;  3DLR A;  3SPZ A;  4CJ3 A;  2HBL A;  4K41 A;  3NE6 A;  3QNO A;  3LL3 A;  4M7X A;  4ELT A;  3VQ8 A;  1BCO A;  2RHK A;  2A41 A;  3D2E A;  4KTW A;  3V1Q A;  4QS7 A;  5ADX A;  4H5V A;  1H1V A;  2G8H A;  4I2P A;  4J8F A;  1RCH A;  4CEZ A;  3LAK A;  3HI0 A;  2GWK A;  1GLE G;  3VEV A;  3VES A;  2HF4 A;  4FLW A;  3V81 A;  4BRK A;  3C6H A;  1WSF A;  4GNI A;  3W0L A;  3PSI A;  4PL7 A;  3SV3 A;  3HP6 A;  3K9K A;  3SQ2 A;  1U49 A;  3SJH A;  3D2F B;  4DV3 K;  1G99 A;  5HRN A;  1DT9 A;  4V19 S;  3HTV A;  4B9T A;  1HNZ K;  5BR9 A;  2FBX A;  3AAQ A;  2F8T A;  4YOT A;  1BOT O;  4DTU A;  2O8F A;  3IS9 A;  1GLJ O;  4CJS A;  1QE1 A;  2B5J A;  4NB4 A;  2Q31 A;  5GAH P;  4LH4 A;  2GV9 A;  3MXM A;  5EVZ A;  1VQM N;  1KFS A;  1RIL A;  4KAZ A;  1KTQ A;  1VQN N;  2ZJP L;  2ZD1 A;  1RTI A;  3QML A;  4OPA A;  2G8W A;  4E7K A;  4KV8 A;  3LP3 A;  4FK2 A;  1S6Q A;  4CK3 A;  3LAL A;  2ETJ A;  3C0B A;  5FPM A;  2Q2R A;  4CFC A;  1XMQ K;  2O8D A;  1WBB A;  4NLC A;  3OYB A;  4IOA L;  2Q3S A;  1DLO A;  4CJ4 A;  4CFB A;  1UAX A;  4FWN A;  1R0A A;  1CXQ A;  3LZJ A;  3PUF A;  2FLO A;  5AQM A;  1GOC A;  1D5A A;  3AVB A;  3WNH A;  1LCU A;  4MLE A;  4FJH A;  4OGC A;  5BRE A;  4IEI A;  4BRH A;  5AQK A;  3QEW A;  4CJV A;  3M8S A;  3LAN A;  2UYT A;  3VGL A;  3CG7 A;  5JVG L;  4OJR A;  2QI2 A;  1Q18 A;  3THX B;  2QWR A;  3LP1 A;  1RBV A;  4KBO A;  5AQH A;  4FL9 A;  4M63 C;  3PX6 A;  3ENH A;  2IVN A;  4CF8 A;  4CF9 A;  3I0S A;  4FJ7 A;  1N33 K;  4CJQ A;  1YUW A;  5C42 A;  3WUH A;  5BRF A;  2HBJ A;  4CGF A;  1N6Q A;  3ZSW A;  4J2D A;  4E7H A;  4DFM A;  1U2V A;  4R79 A;  3OYI A;  4W5Q A;  4CEO A;  4H8K A;  4CZI A;  4N56 A;  4DMN A;  4ISE A;  4K8Z A;  4FWR A;  1TKX A;  5AFU A;  1RDU A;  4E89 A;  4YHH K;  4FZX C;  5J2N A;  4WQ5 C;  3MN6 A;  1Y64 A;  1QQO A;  1HPZ A;  1TGO A;  3VQA A;  1BIS A;  4CGG A;  4JS4 A;  2G8I A;  4IJN A;  1KLN A;  5DM6 L;  5DMR A;  3ULE A;  3ZSX A;  3R9P A;  4AIL C;  4CGI A;  1Q9Y A;  3QBW A;  3P31 A;  3ZYY X;  3RRG A;  5AQL A;  1T03 A;  1IBK K;  3BF1 A;  4FJN A;  2YI1 A;  3T1Y K;  1ASU A;  5GAD P;  1NJY A;  3BEX A;  1N32 K;  1F21 A;  3NHG A;  4DTS A;  1BI4 A;  1KAX A;  2WTU A;  4CZJ A;  5CYQ A;  2RPI A;  3NGZ A;  3LDN A;  4IWV A;  4FJL A;  4CHN A;  2YNF A;  4KKO A;  3E9P A;  1QHA A;  3S3M A;  3VPZ A;  4CEA A;  4JI6 K;  1XUP O;  3ZSQ A;  3CYM A;  2F8S A;  1S72 N;  2UUB K;  4KB1 A;  1JXB A;  4EAH D;  3T7Z A;  5F1X A;  1QVG M;  3CXC M;  4W5O A;  1X9J A;  3CCL N;  5C10 A;  3VET A;  4CZH A;  4C1N K;  2NRZ A;  1YI2 N;  3Q7B A;  3ID8 A;  1B9F A;  3H08 A;  2Q36 A;  3C7N B;  1BA0 A;  1XWL A;  3HVR A;  4E1M A;  2FF6 A;  3TSP A;  1YHQ N;  1RT3 A;  3RWU A;  2E5L K;  4MO4 A;  1JLA A;  2DTU A;  4N5S A;  1RDA A;  3GE1 A;  3HK2 A;  1TYQ A;  3BDP A;  2HVH A;  5KPZ A;  1IJJ A;  3TAP A;  3TWH A;  1S1U A;  1IKV A;  3ZSR A;  4E1N A;  2FSK A;  1NM1 A;  3G6E N;  3V9Z A;  1S1W A;  3AGR A;  2CGJ A;  3CFP A;  1BO5 O;  3AVL A;  3AGK A;  5AQN A;  5KQD A;  2HOE A;  3C94 A;  4NLB A;  4CHZ A;  4DLG A;  2IVO A;  2G8U A;  4FOE A;  5AQU A;  4HTL A;  5J2Q A;  2HF3 A;  1ILY A;  4B1X B;  4FLT A;  4H03 B;  4X64 K;  1RTJ A;  5KI6 A;  4X66 K;  2D5R A;  1JXE A;  2E2O A;  2QTD A;  2IAJ A;  4EFH A;  1CXU A;  4CJK A;  3O1B A;  3DRR A;  4JYA K;  2RKI A;  1D9F A;  4FWS A;  2D0B A;  4OKE A;  4Z94 A;  4ICL A;  4F8R A;  3CM5 A;  1ASW A;  2YNH A;  4GW6 A;  3P1G A;  1ATS A;  4JKF A;  3QIC A;  3OBY A;  1Q81 O;  5EU7 A;  5LY3 A;  2DFF A;  4IG0 A;  5CY4 A;  1NWK A;  3HM9 A;  3A0I X;  3WNF A;  3NMU A;  1DKG D;  3O4N A;  5C15 A;  5JIC A;  1BQN A;  1BUP A;  4AM7 A;  1YXQ A;  3C95 A;  1X3M A;  2FXU A;  1SL1 A;  5M1F A;  4ILH A;  3KVG A;  4NXN K;  3SMS A;  2OA8 A;  4PQU A;  3L4I A;  4WYB A;  1UWB A;  1EET A;  4KI4 A;  4OPJ A;  1Q9X A;  1VRT A;  1X9W A;  2UXD K;  4AHR A;  3MCP A;  3RTV A;  3L2R A;  3VEO A;  3SAH A;  2YCH A;  5K14 A;  4BRC A;  1HX1 A;  4ILJ A;  2FSJ A;  1NJI O;  2HHH K;  4H0V B;  1TKT A;  3BGR A;  3KKR A;  3DRP A;  4E7I A;  2ZGY A;  4RTF D;  3N4Q A;  2PYL A;  4PWD A;  3P5J A;  2CH6 A;  1VHX A;  2XY6 A;  2I7N A;  3KWI A;  1EQY A;  2OPS A;  3T19 A;  1TK8 A;  3CJA A;  3IDH A;  2HMP A;  4JI8 K;  1S9G A;  2P9N A;  3CER A;  3WQU A;  4DU1 A;  3F9M A;  1NMN A;  4WF9 L;  2WFB A;  1U47 A;  1G15 A;  3U4L A;  3V1R A;  2HBK A;  4FYD A;  3Q7C A;  4E19 A;  1S6P A;  3LPT A;  3KK2 A;  3ID6 A;  4EHU A;  4FJG A;  4B9Q A;  3V9U A;  3SPY A;  3VGM A;  4FJJ A;  3AAR A;  3A8Y A;  4XIU A;  1NNE A;  3LM2 A;  3RRH A;  4JI2 K;  3M1F A;  3KHY A;  5HRS A;  4GVE A;  3NDK A;  1T8E A;  5FPN A;  3VQ7 A;  4AH9 A;  3QNN A;  4PUO A;  1ZBI A;  2O8C B;  5AZI B;  3CCV N;  4FWP A;  5JLH A;  2XO7 A;  1OH8 A;  3MCA B;  3P4I A;  4XEI A;  3ZX3 A;  3ZT1 A;  3C6A A;  4B3O A;  2BAN A;  5C25 A;  1NBW A;  1WB9 A;  2E1Y A;  3CI5 A;  4NCB A;  2HMI A;  3CQX A;  2D0O A;  4B8C A;  4CJU A;  3VEW A;  4FWM A;  4RW9 A;  3RMA A;  3DOK A;  1LWE A;  3QDK A;  3GOI A;  3JXU A;  3O6W A;  4FWO A;  4HUF A;  1UA1 A;  3QIO A;  1N34 K;  5C12 A;  5AQI A;  4H5R A;  4XH1 A;  3CJC A;  1JKH A;  4CES A;  2W6K A;  4CJ7 A;  4BRL A;  2G8K A;  2NUB A;  4KFB A;  2VWB A;  4DB3 A;  4KHU A;  2NLX A;  5EY4 A;  5J2P A;  4CHY A;  3T1H K;  3IMX A;  4IFE A;  1OKJ A;  3KJV A;  3R1X A;  2D0A A;  4W5R A;  1L3S A;  4KTQ A;  2VYP A;  4BC4 A;  2GEL A;  4FJM A;  4L8R B;  4H0Y B;  1XHZ A;  2GTD A;  3HOS A;  3G4S N;  1JCE A;  2IOC A;  3LDQ A;  4F9O A;  1QSY A;  4LSL A;  1JLB A;  3MN9 A;  4M3Y A;  4AHT A;  4MLH A;  2F9T A;  3FFI A;  2HHS A;  4XH5 A;  3OYL A;  4DSL A;  4CD1 A;  1YVN A;  4YDU A;  4DQI A;  1K8K B;  4MFB A;  1C6V A;  4CJE A;  3EZ5 A;  1JL2 A;  4DFK A;  1SS6 A;  1V4S A;  4KHY A;  3S9H A;  4JK9 A;  4CJL A;  2W42 A;  4K43 A;  3TR8 A;  1RBU A;  2YV0 X;  5HOO A;  4BRD A;  5SWM A;  1HKC A;  3KD1 E;  2BTF A;  3H1V X;  1QS4 A;  3OBW A;  4M42 A;  4FVU A;  3L3V A;  1U45 A;  3UE5 A;  3WXK A;  3OJU A;  1YTA A;  5HRO A;  2VG6 A;  4B3R K;  4Z4I A;  3QES A;  4H0O A;  3K5N A;  3WXI A;  1YIJ N;  2H3G X;  2RF2 A;  3ZET A;  1KVA A;  4DV5 K;  4GVM A;  3SQ1 A;  4NO7 A;  4I9L A;  5AQR A;  4LF5 K;  3R8E A;  2E20 A;  1GOB A;  3J81 O;  3L2W A;  5FLX O;  4IZ9 A;  4JD2 A;  1NOZ A;  3TTD A;  2P9S B;  1TUY A;  1ZC6 A;  4DV4 K;  4FM0 A;  2QWP A;  4CFA A;  2P9K B;  4CF2 A;  3OYM A;  4JRP A;  1ZBH A;  1EWQ A;  4DQP A;  3CFO A;  1HNI A;  4BR2 A;  1NGC A;  3KK3 A;  4DS5 A;  3J7Z O;  3IFR A;  3TAF A;  3SCX A;  2Z1J A;  2E2N A;  1RT5 A;  3AO2 A;  1HQE A;  1WAF A;  3H46 O;  3OYE A;  3OVN A;  4LC9 B;  1YJN N;  2Q1N A;  2ASO A;  2O8E B;  3HBT A;  3VQB A;  1QZ6 A;  1ATR A;  1DTQ A;  1QQC A;  4HVJ A;  2KFZ A;  4IDH A;  3E66 A;  2O4G A;  2QW9 A;  1LAV A;  4BE0 A;  1VSF A;  5C2D A;  1TUU A;  2V7Y A;  5JLF A;  4YFU A;  1VQK N;  1NGD A;  4B9L A;  1QSS A;  4BDP A;  2YKM A;  1K8A O;  1WN7 A;  2RN2 A;  1DEJ A;  4CED A;  1CZA N;  3IKM A;  3ZT2 A;  4O0I A;  4DV0 K;  2Q0R A;  1XNQ K;  4BRM A;  2X6S A;  3QFP A;  4OO1 J;  4B1Z A;  4ID1 A;  3CCR N;  4HHT A;  4HTU A;  3AVK A;  3A5L C;  1HPM A;  5AQY A;  4I6M A;  4JKG B;  4E7J A;  1NKE A;  3HPG A;  2QWO A;  1HYZ A;  3VF6 A;  1NK6 A;  2P5G A;  2XRI A;  1WSG A;  3VEZ A;  3CPW M;  2YHW A;  1SV5 A;  4CIE A;  4H5W A;  3WXL A;  4BVP A;  1Q82 O;  3NFA A;  4KRE A;  1SAZ A;  4BRN A;  1ZBL A;  3NH0 A;  4DV6 K;  3AO3 A;  2HHV A;  1YJ9 N;  3KTQ A;  4X62 K;  2OTJ N;  3I8D A;  3V6D A;  3ZT3 A;  1HUX A;  3CMA N;  3QFU A;  3VF2 A;  4B8A B;  1S5J A;  3UKR B;  2ZJQ L;  4WQ5 A;  2E4L A;  5KRT A;  2A3Z A;  2GWJ A;  4DQQ A;  2R7Y A;  3K5L A;  4JI5 K;  3LP0 A;  2NRW A;  5C0Y A;  4YOR A;  3THW B;  3RVC A;  1OVQ A;  5ELZ A;  4CHQ A;  4CZE A;  4BRE A;  3V9S A;  3LWL A;  1WLJ A;  3L8B A;  4FO0 A;  4DR1 K;  3ENO A;  3SYZ A;  3WEE A;  3VQ6 A;  1HYS A;  1W7A A;  2GUP A;  4BG9 A;  4FLY A;  3ZSV A;  5GIO A;  5JS1 A;  4IDK A;  1IKX A;  4I2Q A;  2QXL A;  3S3N A;  4JS5 A;  3NF9 A;  2Z1I A;  3IUC A;  3VEN A;  3OYN A;  4EIA A;  5FPD A;  2AA4 A;  4A2A A;  2GEM A;  3TI0 A;  4DTR A;  3RR8 A;  3OS2 A;  3KLF A;  1X3N A;  3SUO A;  4CZG A;  4DUZ K;  3HYF A;  2UUA K;  3O8M A;  1N8R O;  5FPE A;  3QEV A;  3AVF A;  4AF1 A;  3KZB A;  1Z26 A;  4GY2 B;  4CFD A;  2GUI A;  2ZE2 A;  4E1J A;  4A62 A;  4U67 L;  1L5U A;  4FLZ A;  4JI7 K;  2QEX N;  4Q0B A;  1RTH A;  3CCQ N;  5C2F A;  1SQK A;  1NK5 A;  1MDU B;  5AQQ A;  4KI6 A;  1P8Z A;  4LFA K;  2BDP A;  3QB0 A;  1NGA A;  2OPP A;  3J8A A;  3CCM N;  3UKU B;  4BC5 A;  4RCH A;  4JKH A;  4CF0 A;  3CCJ N;  2BGG A;  3AY9 A;  4BR5 A;  4HUE A;  4JHD B;  4GKK K;  5KTQ A;  1I39 A;  2V7Z A;  1IKY A;  4DTO A;  4BE2 A;  1X9S A;  2B4J A;  2Z1H A;  1SKW A;  3V4I A;  5KGX A;  4BRF A;  1JCG A;  4IO9 L;  3O3F A;  2Q97 A;  5EOY A;  1VSL A;  4JKC A;  2EHG A;  3J80 O;  4FLU A;  3U3G A;  1JLQ A;  2JLE A;  2X78 A;  3AA2 A;  1KSP A;  3CD6 N;  4B1V A;  5KPR A;  1B9D A;  3TU5 A;  1R59 O;  1T44 A;  1Q7Y O;  4B9V A;  4LF4 K;  2VWK A;  2P9U A;  3E01 A;  3I0R A;  1O13 A;  3NF8 A;  4CIG A;  4N41 A;  4ZHR A;  1RDD A;  4KHS A;  1EKE A;  1SL2 A;  1KAY A;  3FZK A;  1BDG A;  1B92 A;  3AVH A;  4ZTJ A;  3D7E O;  5SZT A;  4OPK A;  4M3W A;  1KCF A;  4NCA A;  5HLF A;  3E1Y A;  2NZT A;  1X1P A;  4FJ8 A;  3CC2 N;  1L3V A;  5GAE P;  3KLE A;  2IIR A;  1MU2 A;  3DXK A;  4BVO A;  3HRG A;  3NAE A;  2GBZ A;  4E3S A;  4EZ9 A;  2YHB A;  4DV2 K;  1OH6 A;  4DTJ A;  3A5M C;  3CC4 N;  4DUY K;  4CEC A;  2HHX A;  3D2E B;  2PY5 A;  3VER A;  4KB0 A;  3KLH A;  1JJ2 M;  3FZF A;  3EY1 A;  1BCM A;  2QKK A;  4G1Q A;  4C23 A;  3BY5 A;  5B8H A;  4K42 A;  1HJO A;  1JLF A;  4C8L A;  2E88 A;  3DXM A;  3OYK A;  3OYJ A;  2I7P A;  3TPQ A;  1X9M A;  4FM2 A;  1QHT A;  3GL1 A;  3QO9 A;  4KRF A;  3H3N O;  4FK0 A;  1FKP A;  4JNE A;  4BWJ A;  1SL0 A;  1E4G T;  5LJW A;  4M3T A;  4KH4 A;  5EX5 A;  4FCY A;  3MWT A;  5AJ3 K;  4DFJ A;  3RSE A;  2O8F B;  4BDZ A;  5HRP A;  1EP4 A;  4DR2 K;  4CER A;  1WBD A;  3LM9 A;  3I8B A;  2G8V A;  1J6Z A;  2YJF A;  4A2B A;  3FZH A;  5CZ1 A;  1U6Z A;  4DSK A;  3L0Q A;  3AVN A;  4EHT A;  3SZ2 A;  3JS6 A;  3OTO K;  4RW8 A;  4CZM A;  4F4K A;  4WQ4 C;  4BC2 A;  3SK3 A;  1RT1 A;  4MDA A;  2Y1J A;  1HKB A;  1HR0 K;  2Q0U A;  3EKU A;  2KZM A;  2YNG A;  5J1E A;  4A61 A;  2O8D B;  4QAG A;  1YT3 A;  3THY A;  3FFK B;  4W5T A;  1NG9 A;  3H1Q A;  4F3O A;  4DF8 A;  2UXC K;  2E6M A;  2BUP A;  2FF3 B;  4DG1 A;  1FJG K;  5I3U A;  4YOU A;  1UOC A;  4QS8 A;  4Y0W A;  1W97 L;  4JI0 K;  3KKS A;  3NH2 A;  2BH1 A;  3OYA A;  3HSC A;  3CJ1 A;  5CE3 A;  1SKR A;  1BWF O;  4FPA A;  4Z4C A;  2YHA A;  2WUS A;  5AZJ A;  3EE9 A;  2E1Z A;  3AO5 A;  5AR0 A;  1HLU A;  5M1O A;  4OVL A;  4M3U A;  3QER A;  1FXX A;  1QVF M;  1HNW K;  3EE8 A;  4CVN E;  3DWL A;  4CE9 A;  4BGA A;  4DTM A;  3HT3 A;  1S22 A;  4WE1 A;  4FOI A;  1J9A A;  1IV0 A;  3F2K A;  4B08 A;  1P90 A;  5IWA K;  1W2B M;  1MWK A;  2XY8 A;  3V9X A;  3AV9 A;  4ISG A;  3ATV A;  3O9T A;  2A6A A;  4O0J A;  3W3D A;  1NGE A;  1T3V A;  4KH6 A;  4BRP A;  3VQ9 A;  3A5N C;  4KO0 A;  3LAM A;  2PZS A;  1HRH A;  4AQY K;  2P51 A;  3ULE B;  1QTM A;  4B3T K;  3OS1 A;  3M3Z A;  3CC7 N;  1QQM A;  4JKE A;  4FWL A;  3AVC A;  2ITM A;  4FW2 A;  2YHX A;  2PYJ A;  1BI4 B;  3MEE A;  3I55 N;  4BY9 C;  3SJJ A;  1YIT N;  1XHX A;  1TV6 A;  5FDL A;  3AVI A;  3ZLJ A;  4C8N A;  3RMC A;  4DQR A;  5J2M A;  3J7Y P;  3E9O A;  1C0M A;  5BPL A;  4CHO A;  1NU0 A;  3EZW A;  5DM7 L;  3LWM A;  2P9I A;  1HQU A;  3U9Z A;  2JWK A;  3OA9 A;  4CZL A;  2ZM6 K;  3QET A;  1TL1 A;  4B1W B;  4Z4E A;  1RNH A;  3OJS A;  5TKW A;  1MA9 B;  3E9L A;  1CLQ A;  2ZGZ A;  5FRO A;  2IVP A;  1VK0 A;  5HBM A;  2O8B A;  1FW6 A;  2XY5 A;  3SUN A;  1E4F T;  1Y97 A;  1D9D A;  3K57 A;  1ZBS A;  4MDB A;  3MN7 A;  4QCL A;  4HWI A;  3ALY A;  2E8A A;  1GLC G;  4N47 A;  1K6Y A;  1FK9 A;  4FZY A;  2OPQ A;  3MAQ A;  1TYQ B;  2HBM A;  1LOT B;  3ZCM A;  4CBX A;  4BQZ A;  2HVI A;  4B9S A;  3QIP A;  1GLA G;  1RDC A;  3VMF B;  3D2F A;  3NCI A;  1NK7 A;  1IG8 A;  1S3X A;  3ASM A;  3SQ4 A;  4FXD A;  4KPY A;  1RT6 A;  5D3G A;  3VQ5 A;  4LY7 A;  3ITH A;  2A5X A;  4CZK A;  4EP4 A;  4DV1 K;  5I42 A;  3AA4 A;  4ELV A;  4JKD A;  3FZM A;  1BA1 A;  2P1J A;  3MX5 A;  5AQP A;  1VSI A;  2QWQ A;  2ZF5 O;  5JVH L;  4E0D A;  4DSJ A;  4O55 A;  2V51 B;  4CBW A;  4B1Y B;  4IKF A;  2UXB K;  5BRD A;  5F0X A;  4IG3 A;  5KQ8 A;  2VWJ A;  3CQY A;  2UUC K;  1K9M O;  3CIP A;  2ITG A;  2JWL A;  5AQV A;  4RW6 A;  3SUP A;  1GLF O;  1S9E A;  3ISN C;  4JI1 K;  3F9K A;  4PA1 A;  4A57 A;  5M1K A;  3DM2 A;  3DLE A;  4NYN A;  4JV5 K;  1OVY A;  2XHB A;  4JLH A;  4AM6 A;  4CJT A;  3SBT A;  2QWL A;  2G8F A;  4DV7 K;  3F5T A;  1ASV A;  4LF7 K;  1MWM A;  1TAQ A;  4M3X A;  4OLA A;  1I94 K;  4BGB A;  4CK2 A;  4B3S K;  3VQD A;  1J5E K;  3C65 A;  4DQS A;  3PV8 A;  1N5Y A;  4CF1 A;  3MWP A;  2B6A A;  2HNZ A;  4BR9 A;  3I56 N;  3O3H A;  2F9W A;  1NGF A;  3THX A;  2ZQB A;  1JLG A;  4ELU A;  5AQS A;  1QQN A;  5FRM A;  4M45 A;  5AQZ A;  1BL3 A;  1CZB A;  4H0P A;  4YNQ A;  1XI1 A;  5AQW A;  1HNV A;  1VSJ A;  4CEF A;  1I3A A;  5CYM A;  1VQL N;  4JN4 A;  3J7A P;  5AQO A;  1Z05 A;  3PY8 A;  1TKZ A;  3VQ4 A;  3ZT0 A;  4LD0 A;  2E6L A;  4CJ5 A;  5BRH A;  4I9Q A;  3B8A X;  4OKJ A;  1FKO A;  3OYC A;  1XNR K;  3AVG A;  2OPR A;  1Q8I A;  2KKZ A;  1IG9 A;  3V9W A;  4FJ5 A;  3CJB A;  4YOY A;  1RT4 A;  5C24 A;  1OH5 A;  4H0T B;  4BRA A;  2Y1I A;  3VEX A;  1E3M A;  1Z25 A;  2P9N B;  3MDQ A;  2P9P B;  4K8X A;  3KIO A;  4F3T A;  4OX9 K;  4KHW A;  2HHW A;  1NJX A;  1WOQ A;  4CJF A;  1EO1 A;  3MMV A;  3VQE A;  3F73 A;  2FBT A;  3O9Q A;  1N36 K;  1IBM K;  3NF6 A;  1WNS A;  3T1A A;  4RW4 A;  2FC0 A;  5F2R A;  2X6N A;  5JMV A;  3MEC A;  3RMB A;  1T7P A;  1VSK A;  3K58 A;  1LW0 A;  5AQJ A;  1HMV A;  3NF7 A;  3KWG A;  4CJR A;  4AHC A;  4MQ3 A;  3TTC A;  3HJF A;  3QEX A;  3VOV A;  4LFB K;  1NKC A;  4F2R A;  3FE1 A;  1C1B A;  3HP9 A;  3MXJ A;  3O5B A;  4W5N A;  4L3Q A;  2IDO A;  5AQX A;  1EX4 A;  3PSF A;  4DS4 A;  3VTH A;  4Z4H A;  4O4G A;  3D0P A;  3HZ6 A;  3WNG A;  4HUG A;  2NRR A;  3ZSZ A;  3VF4 A;  3C7N A;  4UQG A;  3CCU N;  1VQ6 N;  3CET A;  4DFP A;  4FJK A;  1GLB G;  3G25 A;  4CW7 B;  3OYD A;  1IO2 A;  2ATQ A;  3G0Z A;  3T3F A;  3WQT A;  1VQ9 N;  1VQ7 N;  1HJR A;  1VQ4 N;  1LW2 A;  5CZ2 A;  4GMJ B;  1BG3 A;  1SZ2 A;  2D0C A;  3A5O C;  3DRS A;  3R6M A;  3TTF A;  3QLH A;  1WSI A;  1NKB A;  5KGW A;  3FGU A;  3ZX0 A;  5IT9 O;  2PBD A;  3OY9 A;  1KRP A;  3OYH A;  4BR4 A;  4LF6 K;  2O4I A;  1C0G A;  2ZWH A;  4WCE L;  1VQO N;  5KRS A;  3LDP A;  3CCS N;  3TSU A;  1W0H A;  3O08 A;  3MN5 A;  3PLA A;  4CBU A;  4DKW A;  3DAW A;  4NYF A;  1LV5 A;  3ULD A;  3THV A;  4YOX A;  1GOA A;  3JSM A;  4DWI A;  3T69 A;  4FM1 A;  3M6G A;  4OLB A;  2A40 A;  1NK9 A;  1A5X A;  1M90 O;  3U9D A;  4JAX A;  2OTL N;  4A5B A;  1IBL K;  3L4Q A;  4FPB A;  3WNE A;  4JKB A;  1V4T A;  2HHU A;  3SLC A;  3SAF A;  4CEQ A;  3ZEU B;  4BRI A;  4IOC L;  4DU3 A;  4O8U A;  1HKG A;  4JI3 K;  1KC8 O;  1LWC A;  3MXI A;  3TAG A;  3VA0 A;  4QS9 A;  1RT7 A;  3I33 A;  1RDB A;  4BG8 A;  3UB5 A;  1NK4 A;  4E7L A;  2VG7 A;  3R3L A;  4BR7 A;  1YTU A;  4CEE A;  2CH5 A;  2E2P A;  3OYG A;  1TAU A;  3OHR A;  2F4V K;  1SKS A;  3O1W A;  4YOV A;  2F96 A;  3M8Q A;  4M3Z A;  1T6D A;  3TAE A;  1C1A A;  2YHY A;  4CJP A;  1SUQ A;  2KHO A;  3L6Q A;  1KFD A;  3ZET B;  2P9L B;  2VQF K;  1NK0 A;  5M1P A;  3JYT A;  5GIN A;  4FJI A;  1XC9 A;  3K59 A;  4BC3 A;  4CHP A;  3L2V A;  4DSF A;  3SBG A;  1KLM A;  1NJZ A;  2EX3 A;  3VN5 A;  2W6L A;  4LF8 K;  4HCC A;  1WSH A;  4JD2 B;  1OH7 A;  4FZZ A;  2CGK A;  3K5M A;  1HNX K;  3AO1 A;  3WXJ A;  1UA0 A;  3IG1 A;  3HXM A;  4IFV A;  4FLV A;  2VCP A;  1S1T A;  3NVM A;  4DTN A;  3OW2 M;  2D1K A;  1L3U A;  5ADX H;  4JI4 K;  4U7B A;  3WXM B;  3AAP A;  4NXM K;  1ESV A;  4O44 A;  1VAZ A;  4WQ4 A;  3SQ0 A;  1EXQ A;  3CJ9 A;  1LAW A;  1YVU A;  4C1N I;  3M8R A;  5LMU K;  1O1W A;  3M5R A;  2WOM A;  5E84 A;  3CCE N;  3DLL L;  3CME N;  3P83 D;  3PO4 A;  3MK6 A;  1NGI A;  4FJ9 A;  1Z6R A;  3K5O A;  1TL3 A;  4BR0 A;  4KHP K;  1J5O A;  2QA4 N;  1NLV A;  3HST B;  3DLG A;  4M7Y A;  1VSM A;  3AA5 X;  4IXC A;  1TKD A;  3BZC A;  1M1K O;  4DCH A;  2O8C A;  2QK9 A;  3SUQ A;  5AZI A;  3UIQ A;  2YNI A;  3DI6 A;  1ZBU A;  3S41 A;  5LL6 Z;  4PKI A;  2ASP A;  4LFC K;  4NCG A;  2WBN A;  4I6M B;  1DTT A;  3CM6 A;  4DR4 K;  2OZM A;  3D45 A;  5I9E B;  3TAB A;  4WFA L;  3VQC A;  1BU6 O;  2PFU A;  3FLC O;  1JLE A;  1RFQ A;  1RBR A;  3PIP L;  4R5P A;  4UY8 O;  4GV9 A;  3EL2 A;  1ITG A;  3FR0 A;  3DMJ A;  3NVK A;  3QIN A;  3EKS A;  3RR7 A;  3CFR A;  4AHS A;  3AA3 A;  5EXW A;  3ZSY A;  2WC9 A;  2OCE A;  4CD3 A;  2KLA A;  2DY4 A;  1VRU A;  1EWR A;  3VEY A;  4OGE A;  4BRG A;  1NGG A;  3K2P A;  1ATN A;  1C0T A;  4KH5 A;  1REV A;  4DR6 K;  4FSV A;  2FBV A;  3H45 C;  1ZXO A;  4CJW A;  5TKY A;  3C6U A;  1VSE A;  4DR3 K;  5GAG P;  4BRO A;  4BWM A;  1KD1 O;  1TK0 A;  4KTZ A;  2YKN A;  3WEE B;  4KHN A;  1XMO K;  3SAG A;  1YF5 L;  3O4Q A;  4Z4F A;  1J54 A;  1CZ9 A;  1HYV A;  5AQG A;  1VQ5 N;  1RDW X;  2NRV A;  3CF5 L;  4I7F A;  3V1O A;  2AP1 A;  4LF9 K;  1KXP A;  1S1X A;  3SV4 A;  4Y1C A;  3QEP A;  4Z4G A;  1K8K A;  3A2F A;  1TK5 A;  2I5J A;  5AFU H;  4CGD A;  1A5W A;  1WSE A;  2RE2 A;  1WUA A;  1QZ5 A;  5M1N A;  5T7B A;  4FLX A;  1L3T A;  4CI6 A;  4JK7 A;  4DHY A;  3K9J A;  2XY7 A;  3CPE A;  3VTI A;  4AHV A;  3B6O A;  2X74 A;  3L2U A;  2VQE K;  4DR5 K;  3L3U A;  3PX4 A;  3WT0 A;  1GLD G;  5LMN K;  1NMD A;  1U2V B;  3BZK A;  4B1U B;  1RT2 A;  4IO8 A;  4Z0U A;  3EN9 A;  3MX2 A;  1JL1 A;  1U4B A;  3PIO L;  1VSD A;  3CQ8 A;  4J2E A;  2HW3 A;  3BF3 A;  3AO4 A;  3B6P A;  3ENB A;  3U8X A;  4RWT A;  3LDS A;  3AVM A;  4ID5 A;  4RW7 A;  3KLI A;  4Y1D A;  4FW1 A;  4EP5 A;  3G71 N;  4PL8 A;  4IOX A;  3N4P A;  1BGX T;  3BUZ B;  4C8K A;  2P9S A;  2OZS A;  3VQP A;  4HCB A;  3GDQ A;  4DR7 K;  3KK1 A;  2P9K A;  4PKH A;  5BPN A;  3FZL A;  1S1V A;  4JRQ A;  5DK5 A;  3HPO A;  4DLE A;  2P9U B;  5KPT A;  1D4X A;  2PAV A;  4BE1 A;  5BR8 K;  4DQ8 A;  3ATU A;  4M41 A;  1NK8 A;  2P9P A;  2QM1 A;  4CZF A;  4GV3 A;  1VSH A;  2A1S A;  3NGI A;  4BQL A;  2HNY A;  4IFY A;  2NRT A;  3U6F A;  2OAN A;  2O8E A;  2D0P A;  4F2S A;  3DXK B;  4J2A A;  4IEE A;  2QKB A;  2DFH A;  4B3M K;  1C0F A;  3O3G A;  4KHQ A;  2F7T A;  2P5O A;  3BP8 A;  2FBY A;  2KTQ A;  1KAZ A;  5BPM A;  1NOY A;  3O80 A;  2NRH A;  3ZX2 A;  3LP2 A;  2LSN A;  3DLK A;  3NBP A;  2A1R A;  4CGH A;  3NGY A;  5FRN A;  2HB5 A;  3O9S A;  1U48 A;  2VG5 A;  4MO5 A;  2YJE A;  1A5V A;  1JLC A;  4K0K K;  4IJA A;  2QWM A;  4OPH A;  4H0X B;  2UU9 K;  4DTX A;  1DGK N;  3DYA A;  1TVR A;  4A5A A;  1XC3 A;  3OS0 A;  3DXM B;  4O8K A;  2FSN A;  5LJV A;  4JKG A;  1RBS A;  1Q86 O;  3PX0 A;  3G10 A;  3ZSO A;  1BQM A;  5E41 A;  4M3R A;  4BDY A;  4JKA A;  3SNN A;  4PY5 A;  1T6C A;  3O9R A;  3LDL A;  2DFE A;  3S3O A;  2Z1G A;  4PHT X;  3IRX A;  2OYQ A;  3GBT A;  3RSE B;  4RG8 A;  3TAQ A;  4WFB L;  3SI6 A;  3JAM O;  4N76 A;  3TAN A;  3UKR A;  4GKJ K;  3L2Q A;  1IH7 A;  5CHI A;  3HOT A;  3NH1 A;  4XH4 A;  3M8P A;  4O5F A;  2J4R A;  5JS2 A;  4AHU A;  3QBX A;  4ZTF A;  5HRR A;  2NNW A;  4K25 A;  3HPH A;  4C8O A;  2NRX A;  3DOL A;  3THW A;  1IKW A;  5M1Q A;  1T05 A;  3VA3 A;  5AQF A;  1U04 A;  1LWF A;  4OKK A;  4X65 K;  2BE2 A;  3THY B;  1WSJ A;  2QWN A;  2VGM A;  1C0U A;  4JK8 A;  4DTP A;  4DU4 A;  2KQ2 A;  4TSX A;  3H6E A;  3DLH A;  2IGI A;  2JGU A;  4B9N A;  2D4W A;  3D6R A;  1C1C A;  1YJW N;  1RTD A;  4CIF A;  3ZEU A;  3P39 A;  4FJX A;  2HHT A;  4DSE A;  3C6T A;  4BRQ A;  4IBN A;  3DJC A;  5AZJ B;  4Q5V A;  3LDO A;  4BAC A;  2QXF A;  3H3O B;  4G9Z A;  4ISF A;  3EEQ A;  3KK7 A;  3AVJ A;  2V52 B;  4CK1 A;  1VQ8 N;  4CEB A;  1KVB A;  1BIU A;  4CCH A;  2A42 A;  4H5T A;  1JCF A;  3HM8 A;  4YOW A;  3P38 A;  3TSQ A;  2AJQ A;  2HHQ A;  2E2Q A;  3MEG A;  4YY3 K;  4J2B A;  4FWK A;  3EO3 A;  4FK4 A;  4JEP A;  3K0S A;  4QOZ B;  1RGI A;  3CJ7 A;  3VQQ A;  3LZI A;  4LH5 A;  3MED A;  2YX6 A;  1QSL A;  3UKU A;  1NJW A;  2P9L A;  4PKG A;  2CGL A;  3TAM A;  1ZBF A;  3ZT4 A;  4JHD A;  2ASM A;  2W41 A;  1KVC A;  3CHW A;  3O9U A;  2KZZ A;  5MLC Q;  2HND A;  1W9H A;  4B9U A;  2EWS A;  2KW4 A;  4LSN A; 
#chains in the Genus database with same CATH homology
 1EP4 A;  2VG7 A;  5HP1 A;  1YTU A;  2XO7 A;  2IC3 A;  4CEE A;  4CER A;  3AVA A;  4DSI A;  3OYG A;  4EZ6 A;  1TAU A;  3HVT A;  3HL8 A;  3ZT1 A;  2G8V A;  4B3O A;  1SKS A;  2BAN A;  5CZ1 A;  2KFN A;  3TAR A;  5C25 A;  4DSK A;  2F96 A;  3AVN A;  3M8Q A;  4B9M A;  3IAY A;  3SZ2 A;  3TAE A;  4M3Z A;  3QEI A;  4RW8 A;  4NCB A;  1BHL A;  2HMI A;  4DF4 A;  3KD5 E;  4F4K A;  4H4O A;  1C1A A;  4B8C A;  4CJU A;  4CJP A;  1SUQ A;  3KLG A;  3OYF A;  1RT1 A;  2Y1J A;  1KFD A;  1ZYQ A;  2IS3 A;  1BIZ A;  3LPU A;  4RW9 A;  1NK0 A;  4H4M A;  3RMA A;  3DOK A;  2KZM A;  3JYT A;  1LWE A;  3PO5 A;  4FJI A;  2YNG A;  5J1E A;  1XC9 A;  3RMD A;  3K59 A;  1WAJ A;  4QAG A;  1YT3 A;  3DLB A;  4FVM A;  4CHP A;  4W5T A;  3L2V A;  4HUF A;  3QIO A;  4DSF A;  1UA1 A;  4F3O A;  4DF8 A;  1KLM A;  1NJZ A;  1JKH A;  2EX3 A;  2E6M A;  4CES A;  3VN5 A;  1J53 A;  2WON A;  4CGJ A;  4DG1 A;  4HCC A;  1WSH A;  1RBT A;  4O5B A;  5I3U A;  4FZZ A;  3K5M A;  1UOC A;  3HO1 A;  2G8K A;  4C8M A;  2NUB A;  4KFB A;  3KKS A;  3U3Y A;  3NH2 A;  4KHU A;  5J2P A;  3OYA A;  3AO1 A;  4CHY A;  1D8Y A;  1UA0 A;  3IG1 A;  3EYZ A;  3HXM A;  1SKR A;  3DLR A;  4Z4C A;  2YHA A;  4CJ3 A;  3KJV A;  3SPZ A;  4IFV A;  3NE6 A;  3QNO A;  2D0A A;  4W5R A;  4FLV A;  1L3S A;  4ELT A;  1S1T A;  3VQ8 A;  4KTQ A;  3AO5 A;  4DTN A;  1BCO A;  4OVL A;  1L3U A;  4KTW A;  4FJM A;  4L8R B;  3V1Q A;  4M3U A;  3QER A;  1XHZ A;  1FXX A;  2G8H A;  2IOC A;  1QSY A;  4I2P A;  4LSL A;  4CE9 A;  1JLB A;  1RCH A;  4CEZ A;  3LAK A;  4M3Y A;  4AHT A;  4DTM A;  3HT3 A;  4FLW A;  3FFI A;  4WE1 A;  3V81 A;  2HHS A;  4O44 A;  1WSF A;  1J9A A;  3SQ0 A;  1EXQ A;  3OYL A;  1LAW A;  1YVU A;  3M8R A;  4DSL A;  4B08 A;  1O1W A;  3SV3 A;  4DQI A;  2WOM A;  3HP6 A;  2XY8 A;  3PO4 A;  3SQ2 A;  3P83 D;  3V9X A;  1U49 A;  3AV9 A;  4MFB A;  1C6V A;  4CJE A;  3EZ5 A;  5HRN A;  1JL2 A;  4DFK A;  3K5O A;  4FJ9 A;  1TL3 A;  4O0J A;  4KHY A;  3S9H A;  4CJL A;  2W42 A;  3VQ9 A;  1J5O A;  4KO0 A;  3TR8 A;  4B9T A;  1RBU A;  2YV0 X;  3HST B;  3DLG A;  3LAM A;  2PZS A;  1VSM A;  2FBX A;  3AA5 X;  1TKD A;  2F8T A;  1HRH A;  5SWM A;  2P51 A;  4DTU A;  3IS9 A;  3KD1 E;  1QTM A;  3OS1 A;  2QK9 A;  3SUQ A;  1QS4 A;  4M42 A;  3UIQ A;  2YNI A;  3L3V A;  1QE1 A;  1ZBU A;  3DI6 A;  2B5J A;  4CJS A;  1U45 A;  3AVC A;  4LH4 A;  2GV9 A;  4FW2 A;  3MXM A;  2PYJ A;  1BI4 B;  3MEE A;  3OJU A;  1YTA A;  5HRO A;  3SJJ A;  2VG6 A;  1KFS A;  4NCG A;  1XHX A;  1RIL A;  1DTT A;  1TV6 A;  1KTQ A;  3CM6 A;  3AVI A;  5FDL A;  3QES A;  3D45 A;  2OZM A;  4KAZ A;  4Z4I A;  2ZD1 A;  3TAB A;  1RTI A;  4C8N A;  3K5N A;  4DQR A;  3RMC A;  3VQC A;  5J2M A;  2G8W A;  4E7K A;  2RF2 A;  4KV8 A;  1C0M A;  1JLE A;  3LP3 A;  1RBR A;  4CHO A;  4FK2 A;  1S6Q A;  4R5P A;  4CK3 A;  3LWM A;  3LAL A;  1KVA A;  1HQU A;  2ETJ A;  4GVM A;  3SQ1 A;  4CFC A;  3QET A;  4I9L A;  1ITG A;  1TL1 A;  3DMJ A;  3OYB A;  4Z4E A;  1RNH A;  2Q3S A;  1DLO A;  4CJ4 A;  4CFB A;  1UAX A;  3OJS A;  3QIN A;  1R0A A;  1GOB A;  1CXQ A;  3L2W A;  3LZJ A;  3RR7 A;  3PUF A;  3CFR A;  4AHS A;  3AA3 A;  1CLQ A;  3ZSY A;  1NOZ A;  1GOC A;  1D5A A;  3AVB A;  3WNH A;  2DY4 A;  5FRO A;  1VRU A;  1VK0 A;  4FJH A;  4FM0 A;  5HBM A;  4OGE A;  4OGC A;  3K2P A;  2XY5 A;  3SUN A;  1C0T A;  1REV A;  4CFA A;  4CJV A;  3LAN A;  3M8S A;  3QEW A;  2FBV A;  1Y97 A;  1D9D A;  4CJW A;  4CF2 A;  3CG7 A;  3OYM A;  4JRP A;  1ZBH A;  4OJR A;  3C6U A;  3K57 A;  1VSE A;  3CFO A;  1HNI A;  4LSN A;  4DQP A;  3LP1 A;  1RBV A;  4BWM A;  4QCL A;  1TK0 A;  3ALY A;  4KTZ A;  3KK3 A;  3PX6 A;  4DS5 A;  4CF8 A;  4CF9 A;  2YKN A;  4KHN A;  3I0S A;  4FJ7 A;  4N47 A;  3TAF A;  1K6Y A;  3SCX A;  1FK9 A;  4CJQ A;  4FZY A;  5C42 A;  2Z1J A;  3O4Q A;  4Z4F A;  2OPQ A;  1J54 A;  1CZ9 A;  1HYV A;  4CGF A;  3ZSW A;  3MAQ A;  1RT5 A;  3AO2 A;  1N6Q A;  4E7H A;  1HQE A;  4DFM A;  1WAF A;  4J2D A;  3ZCM A;  2HVI A;  3OYI A;  3OYE A;  3OVN A;  4W5Q A;  4I7F A;  3V1O A;  4B9S A;  3QIP A;  1S1X A;  4CEO A;  3SV4 A;  4Y1C A;  3VQB A;  1DTQ A;  1QQC A;  4H8K A;  3A2F A;  4HVJ A;  4DMN A;  1RDC A;  4N56 A;  3QEP A;  3NCI A;  1TK5 A;  2O4G A;  2I5J A;  4K8Z A;  4Z4G A;  1NK7 A;  1TKX A;  1LAV A;  1A5W A;  1WSE A;  3ASM A;  4CGD A;  4BE0 A;  4E89 A;  3SQ4 A;  1VSF A;  4FXD A;  4KPY A;  4FZX C;  1RT6 A;  5J2N A;  4YFU A;  5T7B A;  4FLX A;  1L3T A;  4B9L A;  5D3G A;  3VQ5 A;  4LY7 A;  2YKM A;  3ITH A;  1QSS A;  1HPZ A;  1WN7 A;  4BDP A;  1TGO A;  4EP4 A;  2RN2 A;  3VQA A;  5I42 A;  1BIS A;  4CGG A;  4JS4 A;  3AA4 A;  2G8I A;  4ELV A;  4CED A;  2P1J A;  1KLN A;  5DMR A;  1VSI A;  3ZSX A;  4AIL C;  4CGI A;  2XY7 A;  1Q9Y A;  3ZT2 A;  4O0I A;  4E0D A;  3RRG A;  1T03 A;  4DSJ A;  4O55 A;  4AHV A;  4FJN A;  2X6S A;  3B6O A;  1ASU A;  4IKF A;  2X74 A;  3L2U A;  1NJY A;  3L3U A;  4IG3 A;  1F21 A;  3PX4 A;  4ID1 A;  3NHG A;  4HHT A;  4DTS A;  1BI4 A;  4HTU A;  3AVK A;  2VWJ A;  1RT2 A;  5CYQ A;  4E7J A;  4Z0U A;  3HPG A;  1NKE A;  1HYZ A;  2P5G A;  1NK6 A;  2XRI A;  2RPI A;  1JL1 A;  1WSG A;  2ITG A;  1U4B A;  3NGZ A;  1VSD A;  1SV5 A;  3CQ8 A;  4J2E A;  4CIE A;  2HW3 A;  4FJL A;  4RW6 A;  4CHN A;  3NFA A;  3AO4 A;  3SUP A;  4KRE A;  3B6P A;  1S9E A;  3ISN C;  3F9K A;  4PA1 A;  3NH0 A;  3LDS A;  2YNF A;  3DM2 A;  1ZBL A;  3AO3 A;  2HHV A;  3DLE A;  4NYN A;  4KKO A;  3AVM A;  4ID5 A;  2XHB A;  3KTQ A;  4JLH A;  4CJT A;  3I8D A;  3S3M A;  4RW7 A;  3V6D A;  4CEA A;  3ZSQ A;  3CYM A;  3KLI A;  4Y1D A;  2F8S A;  4FW1 A;  3ZT3 A;  2G8F A;  4EP5 A;  5JS1 A;  4B8A B;  1ASV A;  4KB1 A;  1JXB A;  1TAQ A;  1S5J A;  4M3X A;  1BGX T;  4OLA A;  4C8K A;  2OZS A;  3VQP A;  4CK2 A;  4W5O A;  2E4L A;  5KRT A;  3VQD A;  4DQQ A;  2R7Y A;  4HCB A;  3K5L A;  3LP0 A;  4DQS A;  3PV8 A;  1N5Y A;  4CF1 A;  3KK1 A;  1B9F A;  3H08 A;  2B6A A;  2HNZ A;  3O3H A;  1XWL A;  1S1V A;  3HVR A;  4JRQ A;  5DK5 A;  4E1M A;  2ZQB A;  1JLG A;  3HPO A;  4CHQ A;  4DLE A;  4ELU A;  1RT3 A;  4M45 A;  3RWU A;  3V9S A;  5FRM A;  3LWL A;  1WLJ A;  3L8B A;  1BL3 A;  1CZB A;  4YNQ A;  1XI1 A;  4BE1 A;  3SYZ A;  3VQ6 A;  1JLA A;  1NK8 A;  4M41 A;  1VSJ A;  4CEF A;  1I3A A;  1HYS A;  2DTU A;  4N5S A;  5CYM A;  1RDA A;  4FLY A;  1VSH A;  3ZSV A;  3PY8 A;  2A1S A;  3NGI A;  1TKZ A;  3HK2 A;  4IDK A;  2HNY A;  1IKX A;  3VQ4 A;  3BDP A;  4I2Q A;  3ZT0 A;  2HVH A;  4IFY A;  4LD0 A;  3TAP A;  2E6L A;  3TWH A;  4JS5 A;  3S3N A;  3U6F A;  4CJ5 A;  4I9Q A;  3NF9 A;  1FKO A;  2Z1I A;  1S1U A;  1IKV A;  3AVG A;  4OKJ A;  2OPR A;  3ZSR A;  1Q8I A;  4E1N A;  3OYC A;  3V9Z A;  1S1W A;  4F2S A;  4J2A A;  1IG9 A;  3V9W A;  2QKB A;  3OYN A;  4FJ5 A;  2DFH A;  3CFP A;  3O3G A;  4KHQ A;  3AVL A;  2P5O A;  2KTQ A;  2FBY A;  1NOY A;  1RT4 A;  5C24 A;  3C94 A;  3TI0 A;  3LP2 A;  4DTR A;  2LSN A;  3RR8 A;  3DLK A;  3NBP A;  3OS2 A;  3KLF A;  4CHZ A;  2A1R A;  4DLG A;  3SUO A;  4CGH A;  3HYF A;  2G8U A;  3NGY A;  5FRN A;  2Y1I A;  2HB5 A;  1U48 A;  5J2Q A;  2VG5 A;  1Z25 A;  1A5V A;  3QEV A;  3AVF A;  1JLC A;  4K8X A;  3KIO A;  1Z26 A;  4DTX A;  4CFD A;  4F3T A;  2GUI A;  2ZE2 A;  3DYA A;  4FLT A;  4KHW A;  1NJX A;  2HHW A;  1RTJ A;  1TVR A;  5KI6 A;  1L5U A;  2D5R A;  1JXE A;  4FLZ A;  4CJF A;  3OS0 A;  4Q0B A;  1RTH A;  3VQE A;  3F73 A;  2FBT A;  1NK5 A;  2IAJ A;  3NF6 A;  1CXU A;  1WNS A;  4RW4 A;  2FC0 A;  3T1A A;  4CJK A;  4KI6 A;  1RBS A;  3PX0 A;  2X6N A;  3DRR A;  2BDP A;  2OPP A;  2RKI A;  3G10 A;  3MEC A;  3ZSO A;  3RMB A;  1T7P A;  1BQM A;  1VSK A;  5E41 A;  1D9F A;  3K58 A;  4M3R A;  4BDY A;  1LW0 A;  4CF0 A;  2BGG A;  3SNN A;  2D0B A;  4HUE A;  4PY5 A;  4OKE A;  4ICL A;  1HMV A;  3NF7 A;  4CJR A;  5KTQ A;  2DFE A;  4AHC A;  3S3O A;  1I39 A;  4MQ3 A;  2Z1G A;  4F8R A;  3CM5 A;  1IKY A;  3HJF A;  4DTO A;  4BE2 A;  3IRX A;  2B4J A;  3QEX A;  1X9S A;  1NKC A;  2OYQ A;  2Z1H A;  4F2R A;  1ASW A;  2YNH A;  4GW6 A;  1SKW A;  1C1B A;  5KGX A;  3V4I A;  3HP9 A;  3P1G A;  3MXJ A;  4RG8 A;  3TAQ A;  4W5N A;  2IDO A;  3O3F A;  3SI6 A;  5EU7 A;  1EX4 A;  4N76 A;  3TAN A;  2DFF A;  4IG0 A;  5CY4 A;  1VSL A;  3L2Q A;  1IH7 A;  3HM9 A;  2EHG A;  3WNF A;  3O4N A;  3NH1 A;  4DS4 A;  4FLU A;  1BQN A;  3U3G A;  1JLQ A;  2JLE A;  4Z4H A;  4O4G A;  3D0P A;  3M8P A;  5JS2 A;  2X78 A;  3AA2 A;  3WNG A;  1KSP A;  4AHU A;  4HUG A;  3ZSZ A;  4ZTF A;  3C95 A;  5HRR A;  1B9D A;  4UQG A;  3HPH A;  1SL1 A;  4DFP A;  4C8O A;  4FJK A;  3DOL A;  4B9V A;  1IKW A;  3OYD A;  1IO2 A;  2VWK A;  2ATQ A;  3G0Z A;  2OA8 A;  3E01 A;  3I0R A;  3T3F A;  4PQU A;  1HJR A;  1T05 A;  1LW2 A;  1UWB A;  3NF8 A;  5CZ2 A;  4GMJ B;  4CIG A;  3VA3 A;  1EET A;  4N41 A;  2D0C A;  4KI4 A;  1U04 A;  4ZHR A;  4OPJ A;  1LWF A;  1RDD A;  4OKK A;  1Q9X A;  3DRS A;  4KHS A;  1EKE A;  1VRT A;  2BE2 A;  1X9W A;  1SL2 A;  1WSJ A;  3QLH A;  4AHR A;  1B92 A;  1C0U A;  3AVH A;  3RTV A;  4DU4 A;  3L2R A;  4DTP A;  4ZTJ A;  2KQ2 A;  5SZT A;  4OPK A;  4TSX A;  4M3W A;  5K14 A;  1KCF A;  1WSI A;  4NCA A;  5HLF A;  2KFZ A;  1X1P A;  3DLH A;  2IGI A;  4FJ8 A;  2JGU A;  1NKB A;  5KGW A;  1L3V A;  4B9N A;  3KLE A;  1C1C A;  1MU2 A;  3OY9 A;  1RTD A;  4CIF A;  3NAE A;  1TKT A;  3BGR A;  2GBZ A;  3KKR A;  1KRP A;  4FJX A;  3DRP A;  3OYH A;  4E7I A;  4E3S A;  4EZ9 A;  2HHT A;  2YHB A;  4DSE A;  2O4I A;  3C6T A;  4IBN A;  4DTJ A;  2PYL A;  5KRS A;  4PWD A;  4Q5V A;  3P5J A;  4BAC A;  1W0H A;  2QXF A;  4CEC A;  2HHX A;  2XY6 A;  3AVJ A;  4NYF A;  4CK1 A;  4CEB A;  2OPS A;  3T19 A;  1KVB A;  1BIU A;  1TK8 A;  2PY5 A;  1LV5 A;  3ULD A;  3KLH A;  4CCH A;  4KB0 A;  3THV A;  1GOA A;  3EY1 A;  3JSM A;  1S9G A;  4DWI A;  1BCM A;  4DU1 A;  2QKK A;  4G1Q A;  4FM1 A;  1U47 A;  1G15 A;  4OLB A;  2AJQ A;  2HHQ A;  1JLF A;  3MEG A;  1NK9 A;  1A5X A;  4C8L A;  4J2B A;  3V1R A;  4FYD A;  3OYK A;  3WNE A;  4FK4 A;  4QOZ B;  4E19 A;  3OYJ A;  1S6P A;  3LPT A;  3VQQ A;  3KK2 A;  3LZI A;  4FJG A;  4LH5 A;  2HHU A;  3MED A;  1X9M A;  3V9U A;  1QSL A;  4FM2 A;  4CEQ A;  1NJW A;  3SPY A;  1QHT A;  3QO9 A;  4FJJ A;  3TAM A;  1ZBF A;  3ZT4 A;  4KRF A;  4DU3 A;  4FK0 A;  1FKP A;  4XIU A;  4BWJ A;  1KVC A;  1SL0 A;  3RRH A;  2KZZ A;  4M3T A;  5HRS A;  1LWC A;  2HND A;  3MXI A;  1W9H A;  3VA0 A;  3TAG A;  4B9U A;  3NDK A;  4FCY A;  1RT7 A;  1T8E A;  4AH9 A;  3VQ7 A;  1RDB A;  3QNN A;  4PUO A;  4DFJ A;  1NK4 A;  2KW4 A;  1HNV A;  4BDZ A;  1ZBI A;  4E7L A;  5HRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...