1HJRA

Atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOLLIDAY JUNCTION RESOLVASE (RUVC)
publication title Atomic structure of the RuvC resolvase: a holliday junction-specific endonuclease from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
total genus 38
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 1994-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hjrA00
3KK1A 4N5SA 3LP1A 3KK2A 3L8BA 2KZZA 3SUPA 2HVHA 3TR8A 1B9FA 4AHTA 1WSJA 2YKNA 3QO9A 1XI1A 1NK4A 1WAJA 3HO1A 1ZBUA 3HXMA 4CGIA 3AVMA 4DLGA 4BDYA 3TAFA 3TARA 2VG5A 3KLEA 2DFHA 1BI4B 3TAQA 4CHYA 4E7IA 1REVA 4JS4A 4F2SA 5KGXA 4CGJA 2XY7A 1BI4A 3VQQA 1DTTA 3ZSYA 4FLYA 4CERA 2VWKA 5HRSA 4CFCA 3NBPA 1LW0A 2YNFA 1RT3A 3LANA 1RT5A 5HRRA 3IS9A 4KREA 2G8IA 4HUEA 3QEWA 3C6TA 2OZMA 4CECA 1T05A 1RBVA 4DU3A 4CJ3A 4NYNA 3OS0A 3MXMA 3ZSXA 3OYCA 1Q9YA 2XY5A 3QEVA 1TKDA 2IDOA 4FZYA 4M45A 4DQSA 3V9SA 4H4MA 4CIGA 4EZ9A 1SKSA 4OLBA 1RT1A 3LP3A 3S9HA 4FLVA 2Z1GA 1KSPA 4C8OA 4KHUA 4PUOA 1U4BA 4ZTFA 3SQ4A 5KRSA 5CZ1A 3AVJA 3RWUA 4KPYA 4DTRA 4DG1A 1J9AA 1RDCA 2ETJA 4O5BA 3LDSA 3AA2A 1CLQA 3OVNA 4BWJA 4WE1A 3VQBA 3ZSQA 2KFNA 3SUOA 4FW1A 3L2QA 3U3YA 3HK2A 4KB0A 4E1NA 2IS3A 2GV9A 1TL1A 4FVMA 4KHSA 4F8RA 1HYZA 1VSKA 4OLAA 3H08A 3P1GA 1A5XA 4CF2A 4KB1A 3M8QA 2HHTA 4KI4A 2FBTA 1ASWA 2P51A 4RW9A 4CF8A 1JLFA 1WSIA 4FW2A 4CK3A 3SQ2A 1BQNA 4NYFA 1X1PA 4GMJB 4CK2A 4YNQA 3DI6A 3OY9A 4DQIA 1BHLA 4YFUA 1RTDA 1S9GA 3VQ9A 3QINA 4F4KA 2D5RA 3CYMA 3OYEA 1WSEA 3DMJA 4Z4EA 1IH7A 3VQPA 4M41A 4DU4A 3L3VA 4DSFA 1HMVA 3OYJA 4CGHA 4DS5A 3SNNA 5FRNA 1C1BA 4M3UA 3OYBA 2G8UA 1NK9A 3SUNA 4B9UA 2ATQA 2E4LA 1IKYA 4N76A 1KVAA 4FJ7A 4RG8A 4H8KA 4K8XA 4BDZA 4HTUA 3SJJA 1LV5A 4Q0BA 1S9EA 1VSIA 2HNDA 2YNGA 3V6DA 3OYMA 5DK5A 3C6UA 3LZIA 3ISNC 4DTNA 1TL3A 4ID1A 2R7YA 1MU2A 4KHYA 5CYQA 1RT2A 3NFAA 1D8YA 1HYSA 2BDPA 1A5WA 3DM2A 1JXBA 1K6YA 5KTQA 1HNVA 2Z1JA 1RDDA 4RW6A 1S1TA 3L2VA 4BE1A 4PY5A 4CK1A 1RDAA 3QNNA 3ZSOA 4FK2A 4OPKA 4BDPA 3CQ8A 2QKBA 2OPSA 4JRPA 3JSMA 3VQ4A 4J2AA 4PQUA 1NJXA 4C8KA 2X74A 3CFPA 1LAVA 4FJLA 3OYLA 3NHGA 3QIPA 2HVIA 4DSIA 4OKEA 1LAWA 4CGFA 1QQCA 1NOZA 1X9MA 3THVA 4PA1A 4NCGA 4BWMA 3AVFA 1SUQA 3AVNA 4I2QA 2P1JA 2QXFA 2FC0A 3HL8A 3AO2A 1C6VA 1GOAA 3AA3A 3V1OA 4M3YA 4E1MA 1SV5A 2YV0X 3KK3A 1S6PA 2E6LA 3AVKA 3UIQA 4E89A 4N41A 3VQ6A 1BCOA 3HP6A 5JS2A 3NH0A 3JYTA 4FK4A 2OYQA 3EYZA 3V9WA 3PX0A 1WN7A 3NGIA 3LZJA 4DQRA 1JLEA 3AA5X 4CJ4A 3KLFA 3RRHA 3TAPA 3HPOA 3S3NA 4B9VA 3OYHA 3RTVA 1Q8IA 3AO4A 3DLRA 3K58A 3SV3A 4DU1A 3VA0A 3OYIA 4CEEA 1NJYA 4K8ZA 1ZBIA 2F8SA 3MXIA 3NGYA 1U04A 4CHPA 5J1EA 4BACA 3RMDA 4ICLA 4J2EA 4CEQA 1YTAA 2X78A 4W5NA 3VQAA 3L2RA 3LWLA 1UWBA 3KLIA 1ASVA 3V9XA 3L2WA 4DFKA 1RT7A 2I5JA 3ZSVA 4CFDA 4FZZA 4F3TA 4XIUA 4CGDA 4CFAA 4W5QA 4FLUA 2GBZA 3RMBA 3L3UA 3DOLA 1BQMA 1J54A 4CJEA 3C95A 4KTZA 3VA3A 3PO4A 1ITGA 5HLFA 4I9QA 1ZBFA 2ZQBA 1ASUA 2HHUA 4ELTA 2DY4A 1X9SA 1TKZA 4ZTJA 4ELVA 4E7LA 1BIZA 1W0HA 2JGUA 3NF8A 4HVJA 2WONA 3OYKA 4Y1CA 3K57A 3KD5E 2KTQA 1J53A 5CYMA 3C94A 3QLHA 1C1CA 3NF6A 4DWIA 4N47A 3RR8A 2FBXA 3VQ5A 5SZTA 3L2UA 4IBNA 3QETA 1C0UA 4B8AB 1S1UA 4AHUA 3KTQA 3AVLA 4LD0A 3O3FA 3PV8A 5HRNA 4B08A 4CEOA 4B9TA 3NF7A 4LSLA 2G8VA 4B9MA 1KFSA 4IG3A 4IFVA 1L3VA 4FXDA 1EXQA 3TAGA 1U45A 3SCXA 1KRPA 4PWDA 3HVRA 4AILC 2DTUA 3AO5A 4HHTA 4I2PA 3K5MA 4DFMA 4KFBA 4DF8A 3CM6A 4C8NA 4LY7A 4Z0UA 4FJNA 3TAMA 2A1RA 1NK6A 5I3UA 1XHZA 3SV4A 1HYVA 4FJJA 4J2BA 2HW3A 4OKKA 2RF2A 1ZBLA 4CJUA 1FKPA 1Z25A 5I42A 2HHXA 3DLGA 2XY6A 4DSKA 3D45A 3BGRA 4JLHA 3T3FA 4FJHA 4CJRA 4DS4A 4DSEA 1EP4A 2YHAA 2F8TA 2YNIA 1JLBA 1JKHA 2HB5A 3VQDA 1WSFA 1TK0A 4FYDA 2OPQA 4DFPA 4DMNA 2EX3A 2PZSA 4Z4GA 3HP9A 4OJRA 2IAJA 1RBUA 5CZ2A 4C8MA 5JS1A 3O4QA 1NOYA 3KD1E 3V9ZA 2QKKA 4DTUA 5J2MA 1C1AA 1TKTA 1HQEA 4M42A 3K5NA 3PY8A 4CE9A 4DTJA 1LWCA 4Z4HA 2XO7A 1TAQA 3K2PA 4DTOA 4G1QA 1X9WA 1Y97A 2OA8A 2B4JA 5C42A 3RMAA 4KRFA 3IRXA 2BGGA 3IAYA 4AHSA 1VRTA 1HJRA 4R5PA 1TK5A 3AV9A 1BGXT 4RW4A 5SWMA 4CJPA 4DTMA 1HRHA 4FCYA 3TI0A 4EZ6A 3KIOA 3HJFA 1D9FA 4CJ5A 3T19A 1B92A 3AO3A 3WNEA 3HT3A 3QEIA 2E6MA 1WAFA 3HPGA 4B3OA 3ALYA 3V1QA 3HSTB 3T1AA 4H4OA 2Z1IA 4AHVA 3NDKA 5C24A 3AVGA 3ZT2A 2HNYA 1NK0A 4IFYA 1IG9A 3OJSA 3NF9A 3OYDA 1TVRA 2G8HA 3ZT4A 4CF9A 2D0BA 1WSHA 4E19A 1RDBA 3ZSZA 4L8RB 2ZD1A 3DRRA 4EP5A 1TK8A 4M3ZA 2RKIA 3MEDA 4FM2A 4CFBA 3NGZA 1R0AA 3NAEA 1KLNA 1QSSA 2O4GA 4Z4IA 1LWFA 1VSEA 1L3TA 4RW7A 4CHQA 5DMRA 4UQGA 1RILA 4GVMA 4DTSA 2IGIA 4M3WA 3DRPA 1QHTA 1S1VA 1VSDA 1IO2A 1NJZA 1SL2A 1WSGA 2Z1HA 1QS4A 3OJUA 2YKMA 5J2PA 2XHBA 3U6FA 4JS5A 4B9LA 4DTPA 4CJFA 1F21A 4QAGA 1RT6A 3AVBA 4E3SA 1FXXA 5C25A 4CEFA 2RPIA 3PX4A 1N6QA 3SUQA 5J2NA 1JLQA 1UOCA 3OS1A 1LW2A 2W42A 3SYZA 3QERA 2OZSA 1S1XA 1QTMA 2KFZA 3HVTA 4FJXA 3M8SA 2DFEA 1T8EA 2D0AA 1I3AA 2WOMA 2O4IA 5E41A 3SPYA 4CF1A 4FJMA 5KI6A 3I0SA 1RNHA 5K14A 3ZSWA 3V81A 3OYFA 1RCHA 2FBVA 4CEBA 4W5OA 1LWEA 3TANA 1QE1A 4HUGA 4LH4A 1J5OA 4CF0A 4KHNA 4I7FA 3AVCA 1XWLA 1JXEA 2YHBA 4ID5A 1L5UA 3F9KA 4E7HA 3O4NA 4N56A 3KLGA 3OYAA 3K5LA 3RR7A 2P5GA 2G8FA 2NUBA 3U3GA 4CIFA 3O3GA 4CIEA 4DQQA 1NK8A 3M8PA 4DFJA 4OGEA 3A2FA 1XC9A 1D9DA 4CJSA 1KTQA 1EKEA 1FK9A 4CJKA 4KHWA 3MAQA 4ZHRA 1RTHA 3MXJA 5D3GA 1S5JA 1DLOA 1GOBA 1VSLA 3I8DA 1UA0A 1VK0A 2HNZA 2IC3A 1CZBA 4OVLA 2OPRA 3V1RA 3M8RA 3VN5A 4O4GA 4IKFA 1YVUA 1KFDA 1HQUA 4O0JA 4QCLA 1Z26A 4C8LA 4BE0A 1IKVA 2QK9A 4B8CA 3SQ1A 1FKOA 3QEPA 1JL2A 1UAXA 4LSNA 3VQCA 2VG6A 3AVHA 5HP1A 4B9SA 1NK7A 1N5YA 4DQPA 3ASMA 3KJVA 4RW8A 4CEZA 1JLCA 2HHQA 5J2QA 2D0CA 1T7PA 3MEGA 3DLHA 2B6AA 1S1WA 3G0ZA 2PYJA 2GUIA 2PYLA 4O55A 4CJQA 3SQ0A 1SL0A 3SZ2A 3S3MA 2F96A 2Y1JA 1NK5A 1HPZA 4HUFA 4FZXC 4FLTA 1NJWA 1CXUA 2XRIA 3WNFA 1TGOA 4FM1A 4E7KA 1NKBA 2HMIA 3QIOA 1WNSA 3D0PA 1NKCA 4FJ5A 5T7BA 1G15A 1EETA 1RBSA 2A1SA 4CCHA 3NCIA 1I39A 2IOCA 2AJQA 5FRMA 3EY1A 1YTUA 3LAKA 1HNIA 4DSLA 3LP2A 3CFOA 3DLBA 1C0MA 1D5AA 2Q3SA 3DRSA 4OPJA 4FLWA 5HROA 4ELUA 1U49A 4M3TA 3ZT1A 4KO0A 2G8WA 4OKJA 2KZMA 4FJKA 3NE6A 4HCCA 3KLHA 2DFFA 1Q9XA 3HPHA 4F2RA 4CEDA 4CJWA 4KHQA 4FJIA 4M3RA 3LPTA 1JLGA 1KVCA 3EZ5A 1IKWA 1O1WA 1TV6A 4Y1DA 4CJLA 2KQ2A 5FDLA 4CJTA 1A5VA 4TSXA 2G8KA 1W9HA 4CGGA 2P5OA 4M3XA 4GW6A 4QOZB 3OS2A 1UA1A 3K5OA 4MQ3A 5KRTA 1NKEA 1YT3A 3VQEA 1BISA 4DTXA 5HBMA 4FLZA 1SKRA 2PY5A 2ZE2A 4E7JA 4HCBA 4KV8A 1JL1A 4W5TA 4FJ9A 4KI6A 3KKRA 1RTIA 1SKWA 2VG7A 3AVAA 1DTQA 1S6QA 1RTJA 3KKSA 4DF4A 1RBRA 4O44A 2YNHA 3LPUA 3V4IA 2LSNA 4NCAA 4KKOA 4AH9A 4KTWA 4CEAA 5FROA 4CHZA 3SPZA 3MEEA 4DSJA 4Z4FA 3CG7A 4KTQA 2FBYA 1KLMA 3B6OA 4O0IA 2Y1IA 3LP0A 3TWHA 1U48A 4DLEA 4JRQA 3TABA 2BANA 4LH5A 3RRGA 3DYAA 1TAUA 4OGCA 4FJ8A 3TAEA 3V9UA 2RN2A 3NH1A 2X6SA 1IKXA 1SL1A 3ZSRA 4NCBA 2HHVA 3ZT3A 3HYFA 1EX4A 3E01A 3QESA 3B6PA 5KGWA 1RBTA 2XY8A 3BDPA 4EP4A 2EHGA 3ZT0A 4B9NA 3WNHA 3ULDA 1BIUA 3G10A 3OYNA 4FJGA 4E0DA 5CY4A 1KCFA 3AA4A 3VQ8A 4FM0A 1BCMA 1VSHA 3LALA 3AO1A 1XHXA 2B5JA 1C0TA 3ZCMA 3HM9A 3QEXA 1QSLA 1TKXA 1VRUA 3SI6A 1JLAA 3CM5A 3I0RA 3LAMA 4IG0A 3PUFA 3LWMA 2KW4A 4AHCA 3IG1A 4CESA 3O3HA 1L3SA 4AHRA 3CFRA 4F3OA 3P5JA 1QSYA 4CHNA 3K59A 3PO5A 1VSMA 2X6NA 3PX6A 4W5RA 4J2DA 2HHSA 4Z4CA 4I9LA 4FLXA 3RMCA 4BE2A 1U47A 1T03A 3OYGA 4Q5VA 3DLEA 4KAZA 3NH2A 3FFIA 2BE2A 3DOKA 1L3UA 1RT4A 1KVBA 3DLKA 3VQ7A 2HHWA 1BL3A 1B9DA 1VSJA 4CHOA 3ITHA 3P83D 1VSFA 2OPPA 1CXQA 4MFBA 1ZYQA 4FK0A 3MECA 2ITGA 1WLJA 3WNGA 3S3OA 2VWJA 5HRPA 4CJVA 2JLEA 1CZ9A 1GOCA 1ZBHA 3QNOA 4IDKA 3F73A 3AVIA 5EU7A
chains in the Genus database with same CATH superfamily
4N5SA 3LP1A 3KK2A 2KZZA 1IBKK 4AHTA 2KHOA 2O8CA 2AA4A 3CCMN 3GBTA 2Q2RA 4CGIA 4BDYA 3TARA 2VG5A 2UXBK 1BI4B 4BRCA 4AM6A 4CHYA 4QS7A 5BN9A 1W97L 3QFPA 3O9RA 4FLYA 4CERA 4CFCA 2FSNA 1GLJO 1RT5A 3QFUA 2G8IA 4HUEA 3QEWA 3OS0A 2ZGZA 3QEVA 1TKDA 4A61A 3C6AA 4H4MA 3LP3A 4FLVA 4C8OA 3THYB 4JKCA 4FWMA 2O8DA 5KRSA 3LDSA 1RDCA 2D0PA 3AA2A 4ILJA 3G71N 2KFNA 4IOXA 3SUOA 4FOIA 3RSEB 1ILYA 3L2QA 3HK2A 4YORA 3HBTA 1TL1A 2NLXA 4K25A 1N36K 1ASWA 2P51A 3VEXA 3SQ2A 1OVQA 4GMJB 4YNQA 1E4FT 3DI6A 3SBTA 4ISEA 3M3ZA 1BHLA 1RTDA 2P9SB 3CYMA 1DT9A 1HMVA 4DS5A 3SNNA 4QS8A 3SUNA 2ATQA 1IKYA 4N76A 1KVAA 2Q97A 4K8XA 2NRVA 4BG9A 4C1NK 1J6ZA 1LV5A 4Q0BA 1GLAG 3V6DA 2W41A 3OYMA 5DK5A 5F1XA 1VHXA 3C6UA 3H3OB 3LZIA 3SLCA 1TL3A 4ID1A 2R7YA 4KHYA 5EY4A 3E9OA 2QWLA 1HKGA 1JXBA 5KTQA 1HNVA 1QQOA 2YHXA 1RDDA 1LCUA 2P9KA 5GAEP 1BUPA 4YOYA 4BRLA 1RDAA 4JKBA 3B8AX 4IDHA 3CQ8A 3F9MA 5GADP 2OPSA 4JRPA 2NRTA 3VQ4A 3I56N 4B1ZA 2F7TA 4PQUA 4YY3K 1NJXA 2F9WA 4I6MA 4FJLA 3NHGA 2HVIA 1TUYA 1QQCA 3K9JA 4JI2K 4NLCA 4BWMA 3AVFA 4I2QA 3MWTA 4FVUA 5M1FA 3AO2A 1C6VA 1GOAA 3KK3A 3UIQA 4E89A 3VQ6A 1BCOA 3LDLA 5JS2A 4YDUC 4UY8O 1JLEA 3AA5X 2QWNA 2A41A 1NJYA 4LFAK 3RMDA 3CJ1A 1YTAA 2GX9A 2X78A 3TSUA 3TSPA 2Q31A 4CFDA 3ZSVA 4FZZA 3P31A 4YOXA 1J54A 3PO4A 4IJNA 2ZQBA 1ASUA 4ZTJA 4ELVA 2JGUA 3QB0A 1IBLK 1J53A 3C94A 4BRNA 4ISGA 3TTCA 3NF6A 4N47A 2ASOA 3VQ5A 1S1UA 4CW7B 2HBLA 3O3FA 4LD0A 3KTQA 5HRNA 3NF7A 1KFSA 1U2VB 4WQ5A 1K73O 4FXDA 1EXQA 5BRFA 3HVRA 4PWDA 4DFMA 3K5MA 4FO0A 5EXWA 1KAZA 1NJIO 3CCUN 2A1RA 3U8XA 1XHZA 4FJJA 2HW3A 4JK8A 2BUPA 4OKKA 1ZBLA 3OA9A 1K8KA 3DLGA 4JLHA 3O5BA 3T3FA 4CJRA 4DSEA 5CE3A 5JVHL 3SJHA 3JAMO 3G4SN 5LMUK 4NXNK 1XMQK 4OJRA 4CZEA 1RBUA 2A42A 1R59O 1HUXA 2VQFK 3KD1E 5J2MA 2O8EA 1C1AA 1HQEA 4FL9A 2QWRA 3PY8A 4DTJA 2XO7A 4G1QA 5GAGP 2B4JA 5C42A 2P9UA 3IRXA 3FLCO 5H1SQ 3AV9A 1BGXT 3VESA 2VYPA 2QI2A 4CJPA 1HRHA 2JWKA 3TI0A 4EZ6A 3VF6A 3T19A 1B92A 3QEIA 3WNEA 3VF2A 2E6MA 1VQ6N 1WBDA 3HSTB 5AJ3K 1NGIA 4H4OA 3AVGA 1NK0A 3VETA 3BY5A 4IO9L 1IG9A 2P9NA 2I7NA 4CZHA 4XH1A 1TK8A 1MWKA 3NGZA 1R0AA 5AQPA 1HX1A 1VSEA 4CHQA 2CGKA 4GVMA 4BRKA 3DRPA 1IO2A 3BP8A 1NM1A 3H1QA 1VQ5N 2YKMA 4BG8A 4B9LA 3CJCA 4KH6A 1N6QA 3OS1A 2W42A 3SYZA 4LFCK 1QTMA 3HVTA 3M8SA 2D0AA 1I3AA 2FSJA 2WOMA 3CPWM 5E41A 1BA1A 3O80A 4CF1A 3ULEB 5K14A 3V81A 1RCHA 1NG9A 1BWFO 4I7FA 5B8HA 1XWLA 1JXEA 4ID5A 1QZ5A 3RVCA 3C7NB 1ATNA 4BROA 5M1NA 3OYAA 3K5LA 3CCEN 3U3GA 4CIFA 4DQQA 4DV1K 4OGEA 1XC9A 2V7YA 4KH4A 4FOEA 4ZHRA 3MXJA 2P9LB 3HTVA 2HBKA 1VK0A 2IC3A 3V1RA 1CZBA 3PIOL 2OPRA 4IKFA 3A8YA 1KFDA 3O9QA 5M1PA 4DUZK 4B8CA 3A5OC 1UAXA 4O8UA 3VQCA 4B1YB 3CCQN 1X3MA 3ASMA 4FWSA 3WXMB 3KJVA 1P90A 3TSQA 3MCPA 1GLFO 3K0SA 1S1WA 2PYJA 2PYLA 4O55A 5KPRA 3S3MA 1HPZA 4FZXC 3ENBA 1GLDG 3A0IX 1CXUA 2XRIA 3HSCA 1HKBA 1NKCA 4KH5A 5T7BA 4JKAA 1RBSA 4CCHA 1I39A 4J8FA 2IOCA 3EY1A 4B3TK 1N32K 3LP2A 4K8ZA 2Q3SA 3DRSA 4OPJA 4FLWA 5HROA 4ELUA 3ZT1A 2G8WA 2Q0RA 5AQKA 4FJKA 1HJOA 4HCCA 4AM7A 4KHQA 4CEDA 3WQUA 4BRPA 1JLGA 4CJLA 1NGHA 5FDLA 3TU5A 5AFUH 4GW6A 1VQON 1KD1O 4QOZB 1UA1A 4MQ3A 3D2FB 1YT3A 1KAYA 4DTXA 4FLZA 1E3MA 4E7JA 4HCBA 1TYQA 1JL1A 4W5TA 4FJ9A 4B1UB 2ZWHA 2GUPA 4JKHA 3DXKB 2D1KA 3SPZA 5FROA 4IZ9A 3B6OA 4O0IA 3LP0A 1U48A 4H5RA 1BO5O 1VQ9N 2HHVA 5AZIA 1EX4A 4FWLA 3B6PA 4IXCA 3T7ZA 2I7PA 3CC2N 3ZT0A 1OH6A 4B9NA 5AR0A 1P8ZA 3VQ8A 5FPNA 2ASMA 1C0TA 2YX6A 4FWQA 3ZCMA 3J7AP 1TKXA 1VRUA 1JLAA 1M1KO 3LAMA 4AHRA 4JEPA 3U9DA 3PO5A 3D2EA 4H5WA 4W5RA 4J2DA 2HHSA 3G6EN 2UYTA 3EE9A 3RMCA 1U47A 5BN8A 3NH2A 3DOKA 4X66K 1RT4A 2UU9K 3T1HK 1OVYA 4H5NA 4OX9K 3AAPA 4MFBA 1CXQA 5AQGA 2ITGA 4CJVA 1H1VA 1CZ9A 4WQ4A 3QNOA 3F73A 4JKEA 2E5LK 2XY8A 4YOWA 3TR8A 1WSJA 3HO1A 1WAJA 3TTFA 2WBNA 4H5VA 2IIRA 3EEQA 3TAFA 2A6AA 3KLEA 5C12A 4CGJA 1DTTA 3W3DA 3ZSYA 1LW0A 2YNFA 5ADXH 4WCEL 1RT3A 4DV6K 3CQYA 4M7XA 4LF4K 2OZMA 4CECA 1T05A 2JWLA 1VQNN 1RBVA 4CJ3A 3MXMA 3OYCA 1NMNA 4OPAA 1QZ6A 3MN9A 2XY5A 3H1VX 1Q9YA 4M45A 4DQSA 3V9SA 1HR0K 4CIGA 2O8DB 3S9HA 5MLCQ 2Z1GA 1KSPA 3ZX0A 4ZTFA 3RWUA 3U9ZA 3ZLJA 1J9AA 4DR2K 2E1ZA 3CC7N 4WE1A 3HM8A 4X62K 2FSKA 4FVMA 5C2DA 4KHSA 1IV0A 3CCVN 2O8FA 4OLAA 3H08A 4CF2A 2KKZA 4MLEA 1ATRA 4G9ZA 1BQNA 2RE2A 2E2OA 4YFUA 3OHRA 3VQ9A 4X64K 2D5RA 4AQYK 1WSEA 4Z4EA 1IH7A 3A5MC 4DSFA 4CGHA 3DXMA 3I8BA 4JD2A 4IEEA 2G8UA 3O1BA 1NGJA 4B9UA 3ZX3A 4WFAL 2IVPA 4RG8A 4H8KA 4BDZA 4HTUA 1OH7A 2VGNA 2HNDA 1VSIA 2YNGA 2AP1A 1N34K 3ISNC 3ZEUA 3AARA 1RT2A 2P9KB 1D8YA 1A5WA 3GE1A 3KZBA 4BE1A 4RW6A 4PY5A 1Z05A 3I55N 3ZSOA 4CZKA 4OPKA 1SS6A 1YJNN 2QKBA 4A5BA 4J2AA 3O9SA 2GTDA 4C8KA 2X74A 5KPTA 3CFPA 3CXCM 4OKEA 1C0FA 4CZGA 3AVNA 3WT0A 3V1OA 3L6QA 4BRAA 4N41A 3JYTA 4FK4A 3NH0A 4EFHA 3DWLA 4B9VA 3SV3A 1Q8IA 3DLRA 3K58A 3VA0A 3OYIA 4CEEA 3NGYA 4CHPA 4BACA 4CI6A 3UKUA 2VCPA 4DCHA 3OBYA 3M6GA 1UWBA 2QW9A 3KLIA 4B1XB 4U7BA 3L2WA 4DFKA 5BPNA 4XIUA 4CFAA 4KHPK 3VA3A 3C95A 4RTFD 4I9QA 1ITGA 4E7LA 1BIZA 4HVJA 3KD5E 2WONA 3K57A 2YCHA 1YHQN 4PL8A 1XUPO 4JHDB 3BZCA 3L2UA 4IBNA 3C65A 3AVLA 1XMOK 3H3NO 5AQVA 1JJ2M 3LM9A 2DTUA 4LF5K 4HHTA 4FPAA 4A59A 4Z0UA 3FR0A 4YOTA 4FJNA 3U4LA 5C2FA 1K8KB 1NK6A 3R1XA 4BC4A 4O5FA 3SV4A 5HOOA 3A5NC 5F0XA 5I42A 2XY6A 3D45A 3BGRA 3VGMA 3KK7A 2ZGYA 4DS4A 1IG8A 4JKDA 3QMLA 2F8TA 3KWGA 5FLXO 3O9TA 3UKRA 3VGKA 2NRHA 4MLHA 5C10A 2EX3A 1HLUA 4WFNL 2O8EB 1M90O 5F2RA 2IAJA 5CZ2A 1NOYA 1Q81O 4M42A 4Z4HA 4DTOA 4GV3A 2WUSA 3K2PA 1X9WA 5AQFA 3D6RA 3ENHA 3SK3A 3VTHA 2OA8A 5AZJA 2BGGA 5AQTA 5AQXA 1TK5A 1VRTA 4R5PA 4RW4A 5SWMA 5GAHP 4FCYA 1YAGA 3HT3A 5BRHA 4IFEA 4DR1K 1ATSA 1WAFA 1NGEA 1YUWA 3NDKA 2P9PB 3KVGA 4IFYA 3NF9A 3T1YK 1T6DA 4BQZA 1WSHA 4E19A 1RDBA 1ESVA 4XEIA 3WXKA 3O4WA 4M3ZA 3MEDA 3CJAA 2A40A 3FZLA 3O6WA 4DR3K 3CJBA 2O4GA 1YITN 1QSSA 1LWFA 3SAGA 5DMRA 2IGIA 3VOVA 1QHTA 1MWMA 1IJJA 4B1WB 4B1VA 3M1FA 4JS5A 4PL7A 4QAGA 1Q7YO 5C25A 4CEFA 4A2AA 1HNZK 5GINA 4OO1J 4BC2A 2OZSA 1S1XA 1EWRA 1T8EA 3VEOA 4FJMA 4FWKA 3GL1A 1RNHA 3ZSWA 4BRDA 4BREA 2FBVA 4CEBA 1LWEA 4LH4A 5DM7L 4YOVA 4KHNA 2FF6A 4BRIA 3KHYA 1N8RO 4CJ7A 2P5GA 3Q7BA 2NUBA 3WXIA 4BRQA 4CIEA 4DFJA 4X65K 3A2FA 5KQDA 1FK9A 4CJKA 3MAQA 2HSTA 1RTHA 3CMAN 3I8DA 2OANA 5AQRA 4BRMA 1UA0A 3THWA 4O4GA 1Z26A 4BE0A 3CIPA 2QK9A 3BF1A 1FKOA 3QEPA 1JL2A 5HP1A 3IUCA 1NK7A 4DQPA 5TKWA 2HHQA 1T7PA 3J80O 3HRGA 5CR4A 1MDUB 4FSVA 3CCLN 5AQZA 2GUIA 1VQKN 3J7YP 4CJQA 4NB4A 3SZ2A 1RDWX 1NK5A 2Y1JA 1XQSC 3WXLA 4BRHA 1NJWA 4CZLA 1TGOA 4FM1A 2HMIA 4XH5A 4FJ5A 3D0PA 2A1SA 3NCIA 5FRMA 3PIPL 4BVOA 2HHHK 1D5AA 1WUAA 4M3TA 4KO0A 2J4RA 5AFUA 3NE6A 1VQ4N 3QICA 1Q9XA 3HPHA 4FWRA 2NZTA 1IKWA 3BUZB 4A57A 3HOTA 3RSEA 5EVZA 2A5XA 4M3XA 1TYQB 2GWJA 2Q1NA 1S22A 4Y0WA 2PY5A 2ZE2A 4KI6A 2D0OA 3KKRA 2ITMA 1DTQA 3KKSA 1RTJA 4DF4A 3IKMA 4O44A 1RBRA 3IFRA 2F4VK 1XNQK 4JI4K 2GELA 4KKOA 4JI0K 4HWIA 3MX2A 3CG7A 2FBYA 2CGJA 2Y1IA 4LC9B 4JRQA 1NBWA 3TABA 4LH5A 3RRGA 5AZIB 2HF3A 2UXCK 1BDGA 2YHWA 2WFBA 3ZSRA 4NCBA 4O8KA 3PLAA 2QWPA 3BDPA 3ULDA 3G10A 3FZHA 2Q0UA 3AO1A 3HM9A 1E4GT 3BZKA 2WC9A 3CM5A 4CBXA 2VGMA 3PUFA 4CESA 3IG1A 4AF1A 4F3OA 3P5JA 3BF3A 4JK9A 4CHNA 3PX6A 3PSIA 1VQMN 4Z4CA 4U67L 3DLEA 2QM1A 1HPMA 3UE5A 1L3UA 3DLKA 1KVBA 5GIOA 2HHWA 1VSJA 3CHWA 1VSFA 3PSFA 1W2BM 3MECA 5BPMA 3W0LA 3WNGA 4BRGA 2JLEA 4MDAA 4RCHA 2V52B 5EU7A 3KK1A 4FWPA 3CC4N 1VQPN 1B9FA 2HVHA 2YI1A 1OH5A 2YKNA 3QO9A 4JN4A 1ZBUA 1EWQA 4WQ5C 3HXMA 3MWPA 4JKGA 2HMPA 4DLGA 5ADXA 1NGAA 3Q7CA 3TAQA 4IOCL 1REVA 2XY7A 1I94K 3VQQA 2VWKA 4A2BA 2UUAK 1NMDA 3LANA 5HRRA 3IS9A 4KREA 3EN9A 3HI0A 1N33K 4DU3A 4NYNA 1V4SA 3ZSXA 4CD3A 3FZKA 2VWBA 2E1YA 2ZF5O 3MK6A 1SKSA 1RT1A 4R79A 1DGKN 5A2QO 4PUOA 1U4BA 1MA9B 3SQ4A 3MX5A 4KPYA 4DTRA 4DG1A 4PKGA 2ETJA 4O5BA 5GIPA 4BR4A 4BWJA 1U2VA 5BREA 4K0KK 4C1NI 3VQBA 3ZSQA 5AQJA 2F9TA 1YXQA 2O8FB 3U3YA 1QVFM 4E1NA 2IS3A 2GV9A 4F8RA 1HYZA 3ZETA 1VSKA 1J5EK 1A5XA 2HHTA 4KI4A 2FBTA 4RW9A 1HKCA 1JLFA 1WSIA 4FW2A 4ILGB 2QA4N 4NYFA 4CK2A 1X1PA 3OY9A 1GLCG 1S9GA 4H0TB 3E1YA 4NO7A 4JI7K 3QBXA 3CCRN 5KPZA 3JS6A 3DMJA 3DXMB 3VQPA 4JD2B 4M41A 3OYJA 4DR5K 1ZC6A 1C1BA 2DPNA 2E4LA 5C15A 2E8AA 5AQOA 1WBBA 3ZEUB 3SJJA 1HNWK 2BH1A 3P38A 4JKFA 3J81O 2BDPA 4PKHA 2Z1JA 3L2VA 1WOQA 4CK1A 2CH6A 3GOIA 3UB5A 4M63C 5AQSA 4BY9C 1BU6O 1Z6RA 4PKIA 3QIPA 3SMPA 1X9MA 3THVA 4PA1A 4NCGA 1SUQA 3R6MA 2V51B 2QXFA 4H0YB 4M3YA 4E1MA 1SV5A 2YV0X 2OTLN 3AVKA 4WYBA 2O8CB 4A5AA 3HP6A 3EYZA 3PX0A 3NGIA 3LZJA 4DQRA 3KLFA 4CJ4A 3RRHA 2VQEK 3OYHA 3AO4A 4DU1A 3UKUB 3NMUA 3ULEA 2F8SA 3L0QA 1T44A 3MCAB 4W5NA 3VQAA 3L2RA 5JVGL 1ASVA 4A62A 4ILHA 2I5JA 2NNWA 3VMFB 2W6LA 4CGDA 1FJGK 4FLUA 3VENA 3DOLA 4KTZA 5LL6Z 2HHUA 4ELTA 2E2QA 1TKZA 1X9SA 4KHUA 3NF8A 1CZAN 1QQMA 1GLBG 1XC3A 4BVPA 2ZJQL 2CGLA 1NGCA 1RFQA 5CYMA 4B3SK 3QLHA 3MMVA 1W7AA 2FBXA 4CZFA 4BR2A 5SZTA 1C0UA 5AQLA 1FW6A 4DUYK 4CVNE 3CI5A 2G8VA 4B9MA 3TAGA 1U45A 3SCXA 3DAWA 1KRPA 1VAZA 3MN6A 4I2PA 4DF8A 3CM6A 2W6KA 3TAMA 4BR7A 1HYVA 1FKPA 2O8BA 1NU0A 3C0BA 3UKRB 3CCSN 2GEMA 1EP4A 3G25A 5C0YA 3LL3A 4IJAA 4F9OA 4JI5K 3CMEN 1JKHA 2HB5A 3VQDA 1WSFA 4FYDA 2OPQA 4H0XB 4DFPA 2PZSA 5JS1A 3CPEA 3C6HA 3V9ZA 2QKKA 5AQUA 5AZJB 4CE9A 1LWCA 1TAQA 1DEJA 4WFBL 3IAYA 4AHSA 1HJRA 4GNIA 3D2FA 3R9PA 2PBDA 2HF4A 3ATUA 3AO3A 3O8MA 3AGRA 3ALYA 3T1AA 2Z1IA 3D7EO 3DXKA 3F2KA 3ZT2A 3OJSA 3OYDA 1TVRA 2D0BA 3ZSZA 2ZJPL 1KXPA 2ZD1A 3DRRA 4EP5A 2RKIA 1KAXA 4NXMK 4FM2A 4CFBA 1KLNA 4Z4IA 4I6MB 3H6EA 1L3TA 3O08A 3ZX2A 4WQ4C 4JI6K 1RILA 4DTSA 4M3WA 1S1VA 1VSDA 4K42A 4WF9L 1NJZA 1SL2A 1WSGA 2Z1HA 1G99A 2HOEA 2XHBA 4MDBA 4DTPA 4CJFA 4LFBK 1RT6A 4E3SA 1FXXA 5BR8K 3SUQA 1JLQA 1S72N 3QDKA 3KWIA 4FJXA 2O4IA 1DKGD 3SPYA 1YIJN 3JXUA 1T6CA 5M1QA 3I0SA 3THXA 4HTLA 5LMNK 4W5OA 3TANA 1QE1A 2P9IA 4CF0A 1L5UA 4E7HA 2KLAA 5AQWA 4N56A 4GVEA 2A3ZA 3RR7A 3O3GA 3MN5A 1QVGM 1NLVA 2GWKA 3LDOA 5E26A 3THWB 4KHWA 1DLOA 1GOBA 1Q18A 4OVLA 5BPLA 1YVUA 2YHYA 4QCLA 1IKVA 4CBWA 3SQ1A 4LSNA 4GV9A 2VG6A 3AVHA 4B9SA 1N5YA 4YDUA 3CD6N 4RW8A 3M5RA 1JLCA 2OTJN 2D0CA 3DLHA 3MEGA 3TPQA 3G0ZA 1NNEA 1SL0A 2F96A 4HUFA 3J7ZO 5BRDA 1NKBA 3QIOA 1WNSA 1G15A 4GY2B 3SAHA 1ZXOA 1NGBA 3LAKA 4DSLA 3DLBA 1C0MA 2RHKA 4CZJA 3FFKB 1K9MO 4BR9A 3KLHA 1JCGA 4FJIA 4M3RA 5EX5A 1KVCA 1O1WA 2P9UB 1RDUA 2KQ2A 1A5VA 4E1JA 2P5OA 1NKEA 1BISA 1EO1A 3I33A 5AQHA 1RTIA 1SKWA 3AVAA 4RWTA 3E9LA 2QEXN 1SQKA 1GLLO 3V4IA 2LSNA 4CEAA 4YHHK 2P9NB 4Z4FA 2AJQA 4DSJA 4KTQA 4YOUA 1D4XA 1KLMA 4FWNA 5LJVA 1WB9A 4DLEA 2BANA 3DYAA 3WEEA 4OGCA 1TAUA 3V9UA 3NH1A 2X6SA 4H03B 3E01A 1JCFA 1QHAA 5KGWA 2EHGA 3WNHA 3SBGA 5CY4A 1KCFA 3AA4A 4FM0A 4EIAA 3NVKA 3LALA 2NRRA 1XHXA 2W40A 3QEXA 1QSLA 3I0RA 5AQYA 2E20A 3CFRA 4PHTX 1QSYA 1NGGA 1VSMA 2X6NA 4I9LA 3OTOK 4H0VB 3OYGA 4Q5VA 2FXUA 3VQ7A 1B9DA 3EZWA 4CHOA 3L4QA 4IEIA 1ZYQA 2UXDK 1XNRK 1WLJA 4JAXA 2VWJA 1ZBHA 5JMVA 4IDKA 3L8BA 3SUPA 1VQ7N 4JKGB 3CCJN 1XI1A 1NK4A 3S41A 5EOYA 3AVMA 2PFUA 1T3VA 2DFHA 4DKWA 4E7IA 4JS4A 4F2SA 5KGXA 1BI4A 1NK8A 1EQYA 2YJEA 5HRSA 3NBPA 4CD1A 4JI8K 3C6TA 3VEVA 4L3QA 4K43A 2IDOA 4FZYA 4OLBA 4EZ9A 4DV5K 5ELZA 1KQSM 4JHDA 2IVNA 5CZ1A 3AVJA 1VQLN 3THYA 3CQXA 1CLQA 3OVNA 4DB3A 2NRZA 4FW1A 3ZETB 5M1KA 4GKKK 4KB0A 4GV6A 3VERA 2PAVA 3P1GA 4KB1A 2HBMA 4BRFA 3M8QA 5DM6L 5BR9A 4CK3A 3E9PA 4CF8A 3EKSA 1X9JA 4DQIA 1BG3A 1BA0A 3QINA 4F4KA 3OYEA 1C0GA 4DU4A 2BTFA 3L3VA 4B9QA 2P9SA 5FRNA 1GLEG 5JICA 4M3UA 3OYBA 4GKJK 1NK9A 5E84A 4FJ7A 3J8AA 3H46O 5JLHA 1S9EA 3DLLL 4DTNA 1MU2A 1K8AO 5CYQA 2QWOA 3NFAA 2QWMA 1HYSA 3QBWA 4DQ8A 3DM2A 1K6YA 1JCEA 1S1TA 3VTIA 3QNNA 2P9PA 3WQTA 4FK2A 3OW2M 1ZBSA 4BDPA 3D2EB 1SZ2A 1BOTO 3JSMA 4EAHD 3L4IA 2UUCK 3ZYYX 2D4WA 1LAVA 2ZJRL 3CETA 3OYLA 3SMSA 4DSIA 3AAQA 4CGFA 1LAWA 4M7YA 4IO8A 3CJ7A 1NOZA 3O9UA 3CJ9A 1YVNA 4MO5A 4IWVA 2P1JA 2FF3B 2FC0A 3HL8A 3AA3A 1S6PA 2E6LA 1NWKA 4DR4K 3EO3A 2OYQA 3V9WA 1WN7A 3TAPA 4LF6K 3S3NA 4DHYA 3HPOA 4FPBA 3VEWA 3RTVA 3ID6A 4QS9A 1ZBIA 4BR0A 5J1EA 1U04A 3MXIA 4ICLA 4J2EA 4CEQA 3E66A 2NRWA 5HL7L 3LWLA 3V9XA 3VEZA 1RT7A 1Y64A 4H0PA 4F3TA 3MDQA 4W5QA 2GBZA 3RMBA 3L3UA 1BQMA 4CJEA 4IOAL 5HLFA 1ZBFA 2DY4A 5AQQA 1W0HA 2KTQA 1Q82O 3OYKA 4Y1CA 3ENOA 5IWAK 1YJWN 3CF5L 4BGAA 1C1CA 4DWIA 3RR8A 2ZM6K 2H3GX 3QETA 4B8AB 4AHUA 4B9TA 3PV8A 3DJCA 4B08A 4CEOA 4LSLA 4JK7A 4IG3A 4IFVA 1L3VA 3FZFA 3O1WA 2QWQA 4AILC 3AO5A 4KFBA 4C8NA 1NGFA 4LY7A 4DR6K 2O8BB 5I3UA 4DV4K 1YF5L 4J2BA 2RF2A 2HHXA 4CJUA 1Z25A 3F5TA 1SAZA 4DSKA 4FJHA 2UUBK 4EHTA 4B3MK 2YHAA 4V19S 3FZMA 2YNIA 1JLBA 3OBWA 1TK0A 4DMNA 4Z4GA 3HP9A 3P4IA 4C8MA 3O4QA 4DTUA 1TKTA 3WXJA 3K5NA 4C23A 1Y97A 4KRFA 3RMAA 3ID8A 3VF4A 3IMXA 4DTMA 3EKUA 3LDNA 3KIOA 3HJFA 3NVMA 4CJ5A 1D9FA 3HPGA 4B3OA 3V1QA 3N4PA 4AHVA 5C24A 2HNYA 1NGDA 1VQ8N 3FE1A 2G8HA 3ZT4A 4CF9A 1X3NA 4L8RB 4DV3K 2QTDA 2YJFA 5LJWA 4OPHA 3NAEA 3HOSA 4RW7A 5TKYA 2QXLA 4UQGA 1OKJA 2V7ZA 2E2NA 5M1OA 4NLBA 3OJUA 1QS4A 5J2PA 3U6FA 1F21A 3AVBA 3HZ6A 2RPIA 3PX4A 3LDPA 5J2NA 1UOCA 1LW2A 4LF8K 3QERA 2KFZA 3MN7A 2DFEA 3THXB 3SAFA 2P9IB 5KI6A 2E2PA 2Q36A 3OYFA 3EE8A 1J5OA 4HUGA 1LOTB 3P39A 3VEYA 3TTDA 3AVCA 3R8EA 2YHBA 1U6ZA 3F9KA 3O4NA 4ISFA 3KLGA 1YI2N 2G8FA 2IVOA 3M8PA 3C7NA 5I9EB 1D9DA 4CJSA 1KTQA 1EKEA 4DR7K 3CERA 1QQNA 5D3GA 4DV7K 1S5JA 1VSLA 4LF9K 2HNZA 3M8RA 4JI1K 3VN5A 2P9LA 1HQUA 4O0JA 3T69A 4C8LA 1TUUA 1HNXK 4H0OA 4EHUA 2HBJA 1S3XA 1OH8A 5AQIA 4CEZA 5FPEA 5LY3A 5J2QA 5IT9O 2B6AA 4KBOA 4JYAK 5FPDA 5FPMA 3EL2A 3SQ0A 4CBUA 1KC8O 2FLOA 4FLTA 1YJ9N 4E7KA 3WNFA 4BC5A 2E88A 4K41A 1EETA 1YTUA 1HNIA 3H45C 3CFOA 3A5LC 1U49A 3ATVA 4Z94A 4OKJA 2NRXA 4DV2K 2KZMA 3VPZA 2DFFA 4F2RA 3GDQA 4CJWA 3LDQA 3LPTA 3FGUA 3EZ5A 3K9KA 1TV6A 4Y1DA 1Q86O 4LF7K 4CJTA 4TSXA 2G8KA 1W9HA 4CGGA 4B3RK 3GG4A 3OS2A 2ASPA 3K5OA 5KRTA 3VQEA 4JV5K 5HBMA 1SKRA 4KV8A 2VG7A 1S6QA 2OCEA 2YNHA 3LPUA 3N4QA 4NCAA 4AH9A 5AQNA 4KTWA 4CHZA 3MEEA 3WEEB 3TWHA 4FJ8A 3TAEA 4BGBA 2RN2A 1IKXA 1SL1A 3ZT3A 4FWOA 3HYFA 4XH4A 3R3LA 3QESA 4BR5A 1V4TA 4MO4A 1RBTA 4EP4A 4CZIA 3BEXA 3VGLA 1BIUA 4BQLA 3OYNA 4FJGA 4E0DA 1BCMA 1VSHA 1RGIA 4BC3A 2B5JA 3AGKA 3SI6A 4IG0A 5CHIA 3LWMA 2KW4A 4AHCA 3O3HA 1L3SA 4JNEA 3AY9A 3K59A 2WTUA 3LM2A 4FLXA 2CH5A 4CZMA 4BE2A 1T03A 5AQMA 4KAZA 1IBMK 3FFIA 2BE2A 3WUHA 4H5TA 1BL3A 4JI3K 3IDHA 4DV0K 3ITHA 3P83D 1O13A 2OPPA 4FK0A 5KQ8A 5JLFA 3S3OA 5HRPA 1GOCA 2EWSA 3AVIA
chains in the Genus database with same CATH topology
3KK1A 4N5SA 3LP1A 3KK2A 3L8BA 2KZZA 3SUPA 2HVHA 3TR8A 1B9FA 4AHTA 1WSJA 2YKNA 3QO9A 1XI1A 1NK4A 1WAJA 3HO1A 1ZBUA 3HXMA 4CGIA 3AVMA 4DLGA 4BDYA 3TAFA 3TARA 2VG5A 3KLEA 2DFHA 1BI4B 3TAQA 4CHYA 4E7IA 1REVA 4JS4A 4F2SA 5KGXA 4CGJA 2XY7A 1BI4A 3VQQA 1DTTA 3ZSYA 4FLYA 4CERA 2VWKA 5HRSA 4CFCA 3NBPA 1LW0A 2YNFA 1RT3A 3LANA 1RT5A 5HRRA 3IS9A 4KREA 2G8IA 4HUEA 3QEWA 3C6TA 2OZMA 4CECA 1T05A 1RBVA 4DU3A 4CJ3A 4NYNA 3OS0A 3MXMA 3ZSXA 3OYCA 1Q9YA 2XY5A 3QEVA 1TKDA 2IDOA 4FZYA 4M45A 4DQSA 3V9SA 4H4MA 4CIGA 4EZ9A 1SKSA 4OLBA 1RT1A 3LP3A 3S9HA 4FLVA 2Z1GA 1KSPA 4C8OA 4KHUA 4PUOA 1U4BA 4ZTFA 3SQ4A 5KRSA 5CZ1A 3AVJA 3RWUA 4KPYA 4DTRA 4DG1A 1J9AA 1RDCA 2ETJA 4O5BA 3LDSA 3AA2A 1CLQA 3OVNA 4BWJA 4WE1A 3VQBA 3ZSQA 2KFNA 3SUOA 4FW1A 3L2QA 3U3YA 3HK2A 4KB0A 4E1NA 2IS3A 2GV9A 1TL1A 4FVMA 4KHSA 4F8RA 1HYZA 1VSKA 4OLAA 3H08A 3P1GA 1A5XA 4CF2A 4KB1A 3M8QA 2HHTA 4KI4A 2FBTA 1ASWA 2P51A 4RW9A 4CF8A 1JLFA 1WSIA 4FW2A 4CK3A 3SQ2A 1BQNA 4NYFA 1X1PA 4GMJB 4CK2A 4YNQA 3DI6A 3OY9A 4DQIA 1BHLA 4YFUA 1RTDA 1S9GA 3VQ9A 3QINA 4F4KA 2D5RA 3CYMA 3OYEA 1WSEA 3DMJA 4Z4EA 1IH7A 3VQPA 4M41A 4DU4A 3L3VA 4DSFA 1HMVA 3OYJA 4CGHA 4DS5A 3SNNA 5FRNA 1C1BA 4M3UA 3OYBA 2G8UA 1NK9A 3SUNA 4B9UA 2ATQA 2E4LA 1IKYA 4N76A 1KVAA 4FJ7A 4RG8A 4H8KA 4K8XA 4BDZA 4HTUA 3SJJA 1LV5A 4Q0BA 1S9EA 1VSIA 2HNDA 2YNGA 3V6DA 3OYMA 5DK5A 3C6UA 3LZIA 3ISNC 4DTNA 1TL3A 4ID1A 2R7YA 1MU2A 4KHYA 5CYQA 1RT2A 3NFAA 1D8YA 1HYSA 2BDPA 1A5WA 3DM2A 1JXBA 1K6YA 5KTQA 1HNVA 2Z1JA 1RDDA 4RW6A 1S1TA 3L2VA 4BE1A 4PY5A 4CK1A 1RDAA 3QNNA 3ZSOA 4FK2A 4OPKA 4BDPA 3CQ8A 2QKBA 2OPSA 4JRPA 3JSMA 3VQ4A 4J2AA 4PQUA 1NJXA 4C8KA 2X74A 3CFPA 1LAVA 4FJLA 3OYLA 3NHGA 3QIPA 2HVIA 4DSIA 4OKEA 1LAWA 4CGFA 1QQCA 1NOZA 1X9MA 3THVA 4PA1A 4NCGA 4BWMA 3AVFA 1SUQA 3AVNA 4I2QA 2P1JA 2QXFA 2FC0A 3HL8A 3AO2A 1C6VA 1GOAA 3AA3A 3V1OA 4M3YA 4E1MA 1SV5A 2YV0X 3KK3A 1S6PA 2E6LA 3AVKA 3UIQA 4E89A 4N41A 3VQ6A 1BCOA 3HP6A 5JS2A 3NH0A 3JYTA 4FK4A 2OYQA 3EYZA 3V9WA 3PX0A 1WN7A 3NGIA 3LZJA 4DQRA 1JLEA 3AA5X 4CJ4A 3KLFA 3RRHA 3TAPA 3HPOA 3S3NA 4B9VA 3OYHA 3RTVA 1Q8IA 3AO4A 3DLRA 3K58A 3SV3A 4DU1A 3VA0A 3OYIA 4CEEA 1NJYA 4K8ZA 1ZBIA 2F8SA 3MXIA 3NGYA 1U04A 4CHPA 5J1EA 4BACA 3RMDA 4ICLA 4J2EA 4CEQA 1YTAA 2X78A 4W5NA 3VQAA 3L2RA 3LWLA 1UWBA 3KLIA 1ASVA 3V9XA 3L2WA 4DFKA 1RT7A 2I5JA 3ZSVA 4CFDA 4FZZA 4F3TA 4XIUA 4CGDA 4CFAA 4W5QA 4FLUA 2GBZA 3RMBA 3L3UA 3DOLA 1BQMA 1J54A 4CJEA 3C95A 4KTZA 3VA3A 3PO4A 1ITGA 5HLFA 4I9QA 1ZBFA 2ZQBA 1ASUA 2HHUA 4ELTA 2DY4A 1X9SA 1TKZA 4ZTJA 4ELVA 4E7LA 1BIZA 1W0HA 2JGUA 3NF8A 4HVJA 2WONA 3OYKA 4Y1CA 3K57A 3KD5E 2KTQA 1J53A 5CYMA 3C94A 3QLHA 1C1CA 3NF6A 4DWIA 4N47A 3RR8A 2FBXA 3VQ5A 5SZTA 3L2UA 4IBNA 3QETA 1C0UA 4B8AB 1S1UA 4AHUA 3KTQA 3AVLA 4LD0A 3O3FA 3PV8A 5HRNA 4B08A 4CEOA 4B9TA 3NF7A 4LSLA 2G8VA 4B9MA 1KFSA 4IG3A 4IFVA 1L3VA 4FXDA 1EXQA 3TAGA 1U45A 3SCXA 1KRPA 4PWDA 3HVRA 4AILC 2DTUA 3AO5A 4HHTA 4I2PA 3K5MA 4DFMA 4KFBA 4DF8A 3CM6A 4C8NA 4LY7A 4Z0UA 4FJNA 3TAMA 2A1RA 1NK6A 5I3UA 1XHZA 3SV4A 1HYVA 4FJJA 4J2BA 2HW3A 4OKKA 2RF2A 1ZBLA 4CJUA 1FKPA 1Z25A 5I42A 2HHXA 3DLGA 2XY6A 4DSKA 3D45A 3BGRA 4JLHA 3T3FA 4FJHA 4CJRA 4DS4A 4DSEA 1EP4A 2YHAA 2F8TA 2YNIA 1JLBA 1JKHA 2HB5A 3VQDA 1WSFA 1TK0A 4FYDA 2OPQA 4DFPA 4DMNA 2EX3A 2PZSA 4Z4GA 3HP9A 4OJRA 2IAJA 1RBUA 5CZ2A 4C8MA 5JS1A 3O4QA 1NOYA 3KD1E 3V9ZA 2QKKA 4DTUA 5J2MA 1C1AA 1TKTA 1HQEA 4M42A 3K5NA 3PY8A 4CE9A 4DTJA 1LWCA 4Z4HA 2XO7A 1TAQA 3K2PA 4DTOA 4G1QA 1X9WA 1Y97A 2OA8A 2B4JA 5C42A 3RMAA 4KRFA 3IRXA 2BGGA 3IAYA 4AHSA 1VRTA 1HJRA 4R5PA 1TK5A 3AV9A 1BGXT 4RW4A 5SWMA 4CJPA 4DTMA 1HRHA 4FCYA 3TI0A 4EZ6A 3KIOA 3HJFA 1D9FA 4CJ5A 3T19A 1B92A 3AO3A 3WNEA 3HT3A 3QEIA 2E6MA 1WAFA 3HPGA 4B3OA 3ALYA 3V1QA 3HSTB 3T1AA 4H4OA 2Z1IA 4AHVA 3NDKA 5C24A 3AVGA 3ZT2A 2HNYA 1NK0A 4IFYA 1IG9A 3OJSA 3NF9A 3OYDA 1TVRA 2G8HA 3ZT4A 4CF9A 2D0BA 1WSHA 4E19A 1RDBA 3ZSZA 4L8RB 2ZD1A 3DRRA 4EP5A 1TK8A 4M3ZA 2RKIA 3MEDA 4FM2A 4CFBA 3NGZA 1R0AA 3NAEA 1KLNA 1QSSA 2O4GA 4Z4IA 1LWFA 1VSEA 1L3TA 4RW7A 4CHQA 5DMRA 4UQGA 1RILA 4GVMA 4DTSA 2IGIA 4M3WA 3DRPA 1QHTA 1S1VA 1VSDA 1IO2A 1NJZA 1SL2A 1WSGA 2Z1HA 1QS4A 3OJUA 2YKMA 5J2PA 2XHBA 3U6FA 4JS5A 4B9LA 4DTPA 4CJFA 1F21A 4QAGA 1RT6A 3AVBA 4E3SA 1FXXA 5C25A 4CEFA 2RPIA 3PX4A 1N6QA 3SUQA 5J2NA 1JLQA 1UOCA 3OS1A 1LW2A 2W42A 3SYZA 3QERA 2OZSA 1S1XA 1QTMA 2KFZA 3HVTA 4FJXA 3M8SA 2DFEA 1T8EA 2D0AA 1I3AA 2WOMA 2O4IA 5E41A 3SPYA 4CF1A 4FJMA 5KI6A 3I0SA 1RNHA 5K14A 3ZSWA 3V81A 3OYFA 1RCHA 2FBVA 4CEBA 4W5OA 1LWEA 3TANA 1QE1A 4HUGA 4LH4A 1J5OA 4CF0A 4KHNA 4I7FA 3AVCA 1XWLA 1JXEA 2YHBA 4ID5A 1L5UA 3F9KA 4E7HA 3O4NA 4N56A 3KLGA 3OYAA 3K5LA 3RR7A 2P5GA 2G8FA 2NUBA 3U3GA 4CIFA 3O3GA 4CIEA 4DQQA 1NK8A 3M8PA 4DFJA 4OGEA 3A2FA 1XC9A 1D9DA 4CJSA 1KTQA 1EKEA 1FK9A 4CJKA 4KHWA 3MAQA 4ZHRA 1RTHA 3MXJA 5D3GA 1S5JA 1DLOA 1GOBA 1VSLA 3I8DA 1UA0A 1VK0A 2HNZA 2IC3A 1CZBA 4OVLA 2OPRA 3V1RA 3M8RA 3VN5A 4O4GA 4IKFA 1YVUA 1KFDA 1HQUA 4O0JA 4QCLA 1Z26A 4C8LA 4BE0A 1IKVA 2QK9A 4B8CA 3SQ1A 1FKOA 3QEPA 1JL2A 1UAXA 4LSNA 3VQCA 2VG6A 3AVHA 5HP1A 4B9SA 1NK7A 1N5YA 4DQPA 3ASMA 3KJVA 4RW8A 4CEZA 1JLCA 2HHQA 5J2QA 2D0CA 1T7PA 3MEGA 3DLHA 2B6AA 1S1WA 3G0ZA 2PYJA 2GUIA 2PYLA 4O55A 4CJQA 3SQ0A 1SL0A 3SZ2A 3S3MA 2F96A 2Y1JA 1NK5A 1HPZA 4HUFA 4FZXC 4FLTA 1NJWA 1CXUA 2XRIA 3WNFA 1TGOA 4FM1A 4E7KA 1NKBA 2HMIA 3QIOA 1WNSA 3D0PA 1NKCA 4FJ5A 5T7BA 1G15A 1EETA 1RBSA 2A1SA 4CCHA 3NCIA 1I39A 2IOCA 2AJQA 5FRMA 3EY1A 1YTUA 3LAKA 1HNIA 4DSLA 3LP2A 3CFOA 3DLBA 1C0MA 1D5AA 2Q3SA 3DRSA 4OPJA 4FLWA 5HROA 4ELUA 1U49A 4M3TA 3ZT1A 4KO0A 2G8WA 4OKJA 2KZMA 4FJKA 3NE6A 4HCCA 3KLHA 2DFFA 1Q9XA 3HPHA 4F2RA 4CEDA 4CJWA 4KHQA 4FJIA 4M3RA 3LPTA 1JLGA 1KVCA 3EZ5A 1IKWA 1O1WA 1TV6A 4Y1DA 4CJLA 2KQ2A 5FDLA 4CJTA 1A5VA 4TSXA 2G8KA 1W9HA 4CGGA 2P5OA 4M3XA 4GW6A 4QOZB 3OS2A 1UA1A 3K5OA 4MQ3A 5KRTA 1NKEA 1YT3A 3VQEA 1BISA 4DTXA 5HBMA 4FLZA 1SKRA 2PY5A 2ZE2A 4E7JA 4HCBA 4KV8A 1JL1A 4W5TA 4FJ9A 4KI6A 3KKRA 1RTIA 1SKWA 2VG7A 3AVAA 1DTQA 1S6QA 1RTJA 3KKSA 4DF4A 1RBRA 4O44A 2YNHA 3LPUA 3V4IA 2LSNA 4NCAA 4KKOA 4AH9A 4KTWA 4CEAA 5FROA 4CHZA 3SPZA 3MEEA 4DSJA 4Z4FA 3CG7A 4KTQA 2FBYA 1KLMA 3B6OA 4O0IA 2Y1IA 3LP0A 3TWHA 1U48A 4DLEA 4JRQA 3TABA 2BANA 4LH5A 3RRGA 3DYAA 1TAUA 4OGCA 4FJ8A 3TAEA 3V9UA 2RN2A 3NH1A 2X6SA 1IKXA 1SL1A 3ZSRA 4NCBA 2HHVA 3ZT3A 3HYFA 1EX4A 3E01A 3QESA 3B6PA 5KGWA 1RBTA 2XY8A 3BDPA 4EP4A 2EHGA 3ZT0A 4B9NA 3WNHA 3ULDA 1BIUA 3G10A 3OYNA 4FJGA 4E0DA 5CY4A 1KCFA 3AA4A 3VQ8A 4FM0A 1BCMA 1VSHA 3LALA 3AO1A 1XHXA 2B5JA 1C0TA 3ZCMA 3HM9A 3QEXA 1QSLA 1TKXA 1VRUA 3SI6A 1JLAA 3CM5A 3I0RA 3LAMA 4IG0A 3PUFA 3LWMA 2KW4A 4AHCA 3IG1A 4CESA 3O3HA 1L3SA 4AHRA 3CFRA 4F3OA 3P5JA 1QSYA 4CHNA 3K59A 3PO5A 1VSMA 2X6NA 3PX6A 4W5RA 4J2DA 2HHSA 4Z4CA 4I9LA 4FLXA 3RMCA 4BE2A 1U47A 1T03A 3OYGA 4Q5VA 3DLEA 4KAZA 3NH2A 3FFIA 2BE2A 3DOKA 1L3UA 1RT4A 1KVBA 3DLKA 3VQ7A 2HHWA 1BL3A 1B9DA 1VSJA 4CHOA 3ITHA 3P83D 1VSFA 2OPPA 1CXQA 4MFBA 1ZYQA 4FK0A 3MECA 2ITGA 1WLJA 3WNGA 3S3OA 2VWJA 5HRPA 4CJVA 2JLEA 1CZ9A 1GOCA 1ZBHA 3QNOA 4IDKA 3F73A 3AVIA 5EU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KK1 A;  4N5S A;  3LP1 A;  3KK2 A;  3L8B A;  2KZZ A;  3SUP A;  2HVH A;  3TR8 A;  1B9F A;  4AHT A;  1WSJ A;  2YKN A;  3QO9 A;  1XI1 A;  1NK4 A;  1WAJ A;  3HO1 A;  1ZBU A;  3HXM A;  4CGI A;  3AVM A;  4DLG A;  4BDY A;  3TAF A;  3TAR A;  2VG5 A;  3KLE A;  2DFH A;  1BI4 B;  3TAQ A;  4CHY A;  4E7I A;  1REV A;  4JS4 A;  4F2S A;  5KGX A;  4CGJ A;  2XY7 A;  1BI4 A;  3VQQ A;  1DTT A;  3ZSY A;  4FLY A;  4CER A;  2VWK A;  5HRS A;  4CFC A;  3NBP A;  1LW0 A;  2YNF A;  1RT3 A;  3LAN A;  1RT5 A;  5HRR A;  3IS9 A;  4KRE A;  2G8I A;  4HUE A;  3QEW A;  3C6T A;  2OZM A;  4CEC A;  1T05 A;  1RBV A;  4DU3 A;  4CJ3 A;  4NYN A;  3OS0 A;  3MXM A;  3ZSX A;  3OYC A;  1Q9Y A;  2XY5 A;  3QEV A;  1TKD A;  2IDO A;  4FZY A;  4M45 A;  4DQS A;  3V9S A;  4H4M A;  4CIG A;  4EZ9 A;  1SKS A;  4OLB A;  1RT1 A;  3LP3 A;  3S9H A;  4FLV A;  2Z1G A;  1KSP A;  4C8O A;  4KHU A;  4PUO A;  1U4B A;  4ZTF A;  3SQ4 A;  5KRS A;  5CZ1 A;  3AVJ A;  3RWU A;  4KPY A;  4DTR A;  4DG1 A;  1J9A A;  1RDC A;  2ETJ A;  4O5B A;  3LDS A;  3AA2 A;  1CLQ A;  3OVN A;  4BWJ A;  4WE1 A;  3VQB A;  3ZSQ A;  2KFN A;  3SUO A;  4FW1 A;  3L2Q A;  3U3Y A;  3HK2 A;  4KB0 A;  4E1N A;  2IS3 A;  2GV9 A;  1TL1 A;  4FVM A;  4KHS A;  4F8R A;  1HYZ A;  1VSK A;  4OLA A;  3H08 A;  3P1G A;  1A5X A;  4CF2 A;  4KB1 A;  3M8Q A;  2HHT A;  4KI4 A;  2FBT A;  1ASW A;  2P51 A;  4RW9 A;  4CF8 A;  1JLF A;  1WSI A;  4FW2 A;  4CK3 A;  3SQ2 A;  1BQN A;  4NYF A;  1X1P A;  4GMJ B;  4CK2 A;  4YNQ A;  3DI6 A;  3OY9 A;  4DQI A;  1BHL A;  4YFU A;  1RTD A;  1S9G A;  3VQ9 A;  3QIN A;  4F4K A;  2D5R A;  3CYM A;  3OYE A;  1WSE A;  3DMJ A;  4Z4E A;  1IH7 A;  3VQP A;  4M41 A;  4DU4 A;  3L3V A;  4DSF A;  1HMV A;  3OYJ A;  4CGH A;  4DS5 A;  3SNN A;  5FRN A;  1C1B A;  4M3U A;  3OYB A;  2G8U A;  1NK9 A;  3SUN A;  4B9U A;  2ATQ A;  2E4L A;  1IKY A;  4N76 A;  1KVA A;  4FJ7 A;  4RG8 A;  4H8K A;  4K8X A;  4BDZ A;  4HTU A;  3SJJ A;  1LV5 A;  4Q0B A;  1S9E A;  1VSI A;  2HND A;  2YNG A;  3V6D A;  3OYM A;  5DK5 A;  3C6U A;  3LZI A;  3ISN C;  4DTN A;  1TL3 A;  4ID1 A;  2R7Y A;  1MU2 A;  4KHY A;  5CYQ A;  1RT2 A;  3NFA A;  1D8Y A;  1HYS A;  2BDP A;  1A5W A;  3DM2 A;  1JXB A;  1K6Y A;  5KTQ A;  1HNV A;  2Z1J A;  1RDD A;  4RW6 A;  1S1T A;  3L2V A;  4BE1 A;  4PY5 A;  4CK1 A;  1RDA A;  3QNN A;  3ZSO A;  4FK2 A;  4OPK A;  4BDP A;  3CQ8 A;  2QKB A;  2OPS A;  4JRP A;  3JSM A;  3VQ4 A;  4J2A A;  4PQU A;  1NJX A;  4C8K A;  2X74 A;  3CFP A;  1LAV A;  4FJL A;  3OYL A;  3NHG A;  3QIP A;  2HVI A;  4DSI A;  4OKE A;  1LAW A;  4CGF A;  1QQC A;  1NOZ A;  1X9M A;  3THV A;  4PA1 A;  4NCG A;  4BWM A;  3AVF A;  1SUQ A;  3AVN A;  4I2Q A;  2P1J A;  2QXF A;  2FC0 A;  3HL8 A;  3AO2 A;  1C6V A;  1GOA A;  3AA3 A;  3V1O A;  4M3Y A;  4E1M A;  1SV5 A;  2YV0 X;  3KK3 A;  1S6P A;  2E6L A;  3AVK A;  3UIQ A;  4E89 A;  4N41 A;  3VQ6 A;  1BCO A;  3HP6 A;  5JS2 A;  3NH0 A;  3JYT A;  4FK4 A;  2OYQ A;  3EYZ A;  3V9W A;  3PX0 A;  1WN7 A;  3NGI A;  3LZJ A;  4DQR A;  1JLE A;  3AA5 X;  4CJ4 A;  3KLF A;  3RRH A;  3TAP A;  3HPO A;  3S3N A;  4B9V A;  3OYH A;  3RTV A;  1Q8I A;  3AO4 A;  3DLR A;  3K58 A;  3SV3 A;  4DU1 A;  3VA0 A;  3OYI A;  4CEE A;  1NJY A;  4K8Z A;  1ZBI A;  2F8S A;  3MXI A;  3NGY A;  1U04 A;  4CHP A;  5J1E A;  4BAC A;  3RMD A;  4ICL A;  4J2E A;  4CEQ A;  1YTA A;  2X78 A;  4W5N A;  3VQA A;  3L2R A;  3LWL A;  1UWB A;  3KLI A;  1ASV A;  3V9X A;  3L2W A;  4DFK A;  1RT7 A;  2I5J A;  3ZSV A;  4CFD A;  4FZZ A;  4F3T A;  4XIU A;  4CGD A;  4CFA A;  4W5Q A;  4FLU A;  2GBZ A;  3RMB A;  3L3U A;  3DOL A;  1BQM A;  1J54 A;  4CJE A;  3C95 A;  4KTZ A;  3VA3 A;  3PO4 A;  1ITG A;  5HLF A;  4I9Q A;  1ZBF A;  2ZQB A;  1ASU A;  2HHU A;  4ELT A;  2DY4 A;  1X9S A;  1TKZ A;  4ZTJ A;  4ELV A;  4E7L A;  1BIZ A;  1W0H A;  2JGU A;  3NF8 A;  4HVJ A;  2WON A;  3OYK A;  4Y1C A;  3K57 A;  3KD5 E;  2KTQ A;  1J53 A;  5CYM A;  3C94 A;  3QLH A;  1C1C A;  3NF6 A;  4DWI A;  4N47 A;  3RR8 A;  2FBX A;  3VQ5 A;  5SZT A;  3L2U A;  4IBN A;  3QET A;  1C0U A;  4B8A B;  1S1U A;  4AHU A;  3KTQ A;  3AVL A;  4LD0 A;  3O3F A;  3PV8 A;  5HRN A;  4B08 A;  4CEO A;  4B9T A;  3NF7 A;  4LSL A;  2G8V A;  4B9M A;  1KFS A;  4IG3 A;  4IFV A;  1L3V A;  4FXD A;  1EXQ A;  3TAG A;  1U45 A;  3SCX A;  1KRP A;  4PWD A;  3HVR A;  4AIL C;  2DTU A;  3AO5 A;  4HHT A;  4I2P A;  3K5M A;  4DFM A;  4KFB A;  4DF8 A;  3CM6 A;  4C8N A;  4LY7 A;  4Z0U A;  4FJN A;  3TAM A;  2A1R A;  1NK6 A;  5I3U A;  1XHZ A;  3SV4 A;  1HYV A;  4FJJ A;  4J2B A;  2HW3 A;  4OKK A;  2RF2 A;  1ZBL A;  4CJU A;  1FKP A;  1Z25 A;  5I42 A;  2HHX A;  3DLG A;  2XY6 A;  4DSK A;  3D45 A;  3BGR A;  4JLH A;  3T3F A;  4FJH A;  4CJR A;  4DS4 A;  4DSE A;  1EP4 A;  2YHA A;  2F8T A;  2YNI A;  1JLB A;  1JKH A;  2HB5 A;  3VQD A;  1WSF A;  1TK0 A;  4FYD A;  2OPQ A;  4DFP A;  4DMN A;  2EX3 A;  2PZS A;  4Z4G A;  3HP9 A;  4OJR A;  2IAJ A;  1RBU A;  5CZ2 A;  4C8M A;  5JS1 A;  3O4Q A;  1NOY A;  3KD1 E;  3V9Z A;  2QKK A;  4DTU A;  5J2M A;  1C1A A;  1TKT A;  1HQE A;  4M42 A;  3K5N A;  3PY8 A;  4CE9 A;  4DTJ A;  1LWC A;  4Z4H A;  2XO7 A;  1TAQ A;  3K2P A;  4DTO A;  4G1Q A;  1X9W A;  1Y97 A;  2OA8 A;  2B4J A;  5C42 A;  3RMA A;  4KRF A;  3IRX A;  2BGG A;  3IAY A;  4AHS A;  1VRT A;  1HJR A;  4R5P A;  1TK5 A;  3AV9 A;  1BGX T;  4RW4 A;  5SWM A;  4CJP A;  4DTM A;  1HRH A;  4FCY A;  3TI0 A;  4EZ6 A;  3KIO A;  3HJF A;  1D9F A;  4CJ5 A;  3T19 A;  1B92 A;  3AO3 A;  3WNE A;  3HT3 A;  3QEI A;  2E6M A;  1WAF A;  3HPG A;  4B3O A;  3ALY A;  3V1Q A;  3HST B;  3T1A A;  4H4O A;  2Z1I A;  4AHV A;  3NDK A;  5C24 A;  3AVG A;  3ZT2 A;  2HNY A;  1NK0 A;  4IFY A;  1IG9 A;  3OJS A;  3NF9 A;  3OYD A;  1TVR A;  2G8H A;  3ZT4 A;  4CF9 A;  2D0B A;  1WSH A;  4E19 A;  1RDB A;  3ZSZ A;  4L8R B;  2ZD1 A;  3DRR A;  4EP5 A;  1TK8 A;  4M3Z A;  2RKI A;  3MED A;  4FM2 A;  4CFB A;  3NGZ A;  1R0A A;  3NAE A;  1KLN A;  1QSS A;  2O4G A;  4Z4I A;  1LWF A;  1VSE A;  1L3T A;  4RW7 A;  4CHQ A;  5DMR A;  4UQG A;  1RIL A;  4GVM A;  4DTS A;  2IGI A;  4M3W A;  3DRP A;  1QHT A;  1S1V A;  1VSD A;  1IO2 A;  1NJZ A;  1SL2 A;  1WSG A;  2Z1H A;  1QS4 A;  3OJU A;  2YKM A;  5J2P A;  2XHB A;  3U6F A;  4JS5 A;  4B9L A;  4DTP A;  4CJF A;  1F21 A;  4QAG A;  1RT6 A;  3AVB A;  4E3S A;  1FXX A;  5C25 A;  4CEF A;  2RPI A;  3PX4 A;  1N6Q A;  3SUQ A;  5J2N A;  1JLQ A;  1UOC A;  3OS1 A;  1LW2 A;  2W42 A;  3SYZ A;  3QER A;  2OZS A;  1S1X A;  1QTM A;  2KFZ A;  3HVT A;  4FJX A;  3M8S A;  2DFE A;  1T8E A;  2D0A A;  1I3A A;  2WOM A;  2O4I A;  5E41 A;  3SPY A;  4CF1 A;  4FJM A;  5KI6 A;  3I0S A;  1RNH A;  5K14 A;  3ZSW A;  3V81 A;  3OYF A;  1RCH A;  2FBV A;  4CEB A;  4W5O A;  1LWE A;  3TAN A;  1QE1 A;  4HUG A;  4LH4 A;  1J5O A;  4CF0 A;  4KHN A;  4I7F A;  3AVC A;  1XWL A;  1JXE A;  2YHB A;  4ID5 A;  1L5U A;  3F9K A;  4E7H A;  3O4N A;  4N56 A;  3KLG A;  3OYA A;  3K5L A;  3RR7 A;  2P5G A;  2G8F A;  2NUB A;  3U3G A;  4CIF A;  3O3G A;  4CIE A;  4DQQ A;  1NK8 A;  3M8P A;  4DFJ A;  4OGE A;  3A2F A;  1XC9 A;  1D9D A;  4CJS A;  1KTQ A;  1EKE A;  1FK9 A;  4CJK A;  4KHW A;  3MAQ A;  4ZHR A;  1RTH A;  3MXJ A;  5D3G A;  1S5J A;  1DLO A;  1GOB A;  1VSL A;  3I8D A;  1UA0 A;  1VK0 A;  2HNZ A;  2IC3 A;  1CZB A;  4OVL A;  2OPR A;  3V1R A;  3M8R A;  3VN5 A;  4O4G A;  4IKF A;  1YVU A;  1KFD A;  1HQU A;  4O0J A;  4QCL A;  1Z26 A;  4C8L A;  4BE0 A;  1IKV A;  2QK9 A;  4B8C A;  3SQ1 A;  1FKO A;  3QEP A;  1JL2 A;  1UAX A;  4LSN A;  3VQC A;  2VG6 A;  3AVH A;  5HP1 A;  4B9S A;  1NK7 A;  1N5Y A;  4DQP A;  3ASM A;  3KJV A;  4RW8 A;  4CEZ A;  1JLC A;  2HHQ A;  5J2Q A;  2D0C A;  1T7P A;  3MEG A;  3DLH A;  2B6A A;  1S1W A;  3G0Z A;  2PYJ A;  2GUI A;  2PYL A;  4O55 A;  4CJQ A;  3SQ0 A;  1SL0 A;  3SZ2 A;  3S3M A;  2F96 A;  2Y1J A;  1NK5 A;  1HPZ A;  4HUF A;  4FZX C;  4FLT A;  1NJW A;  1CXU A;  2XRI A;  3WNF A;  1TGO A;  4FM1 A;  4E7K A;  1NKB A;  2HMI A;  3QIO A;  1WNS A;  3D0P A;  1NKC A;  4FJ5 A;  5T7B A;  1G15 A;  1EET A;  1RBS A;  2A1S A;  4CCH A;  3NCI A;  1I39 A;  2IOC A;  2AJQ A;  5FRM A;  3EY1 A;  1YTU A;  3LAK A;  1HNI A;  4DSL A;  3LP2 A;  3CFO A;  3DLB A;  1C0M A;  1D5A A;  2Q3S A;  3DRS A;  4OPJ A;  4FLW A;  5HRO A;  4ELU A;  1U49 A;  4M3T A;  3ZT1 A;  4KO0 A;  2G8W A;  4OKJ A;  2KZM A;  4FJK A;  3NE6 A;  4HCC A;  3KLH A;  2DFF A;  1Q9X A;  3HPH A;  4F2R A;  4CED A;  4CJW A;  4KHQ A;  4FJI A;  4M3R A;  3LPT A;  1JLG A;  1KVC A;  3EZ5 A;  1IKW A;  1O1W A;  1TV6 A;  4Y1D A;  4CJL A;  2KQ2 A;  5FDL A;  4CJT A;  1A5V A;  4TSX A;  2G8K A;  1W9H A;  4CGG A;  2P5O A;  4M3X A;  4GW6 A;  4QOZ B;  3OS2 A;  1UA1 A;  3K5O A;  4MQ3 A;  5KRT A;  1NKE A;  1YT3 A;  3VQE A;  1BIS A;  4DTX A;  5HBM A;  4FLZ A;  1SKR A;  2PY5 A;  2ZE2 A;  4E7J A;  4HCB A;  4KV8 A;  1JL1 A;  4W5T A;  4FJ9 A;  4KI6 A;  3KKR A;  1RTI A;  1SKW A;  2VG7 A;  3AVA A;  1DTQ A;  1S6Q A;  1RTJ A;  3KKS A;  4DF4 A;  1RBR A;  4O44 A;  2YNH A;  3LPU A;  3V4I A;  2LSN A;  4NCA A;  4KKO A;  4AH9 A;  4KTW A;  4CEA A;  5FRO A;  4CHZ A;  3SPZ A;  3MEE A;  4DSJ A;  4Z4F A;  3CG7 A;  4KTQ A;  2FBY A;  1KLM A;  3B6O A;  4O0I A;  2Y1I A;  3LP0 A;  3TWH A;  1U48 A;  4DLE A;  4JRQ A;  3TAB A;  2BAN A;  4LH5 A;  3RRG A;  3DYA A;  1TAU A;  4OGC A;  4FJ8 A;  3TAE A;  3V9U A;  2RN2 A;  3NH1 A;  2X6S A;  1IKX A;  1SL1 A;  3ZSR A;  4NCB A;  2HHV A;  3ZT3 A;  3HYF A;  1EX4 A;  3E01 A;  3QES A;  3B6P A;  5KGW A;  1RBT A;  2XY8 A;  3BDP A;  4EP4 A;  2EHG A;  3ZT0 A;  4B9N A;  3WNH A;  3ULD A;  1BIU A;  3G10 A;  3OYN A;  4FJG A;  4E0D A;  5CY4 A;  1KCF A;  3AA4 A;  3VQ8 A;  4FM0 A;  1BCM A;  1VSH A;  3LAL A;  3AO1 A;  1XHX A;  2B5J A;  1C0T A;  3ZCM A;  3HM9 A;  3QEX A;  1QSL A;  1TKX A;  1VRU A;  3SI6 A;  1JLA A;  3CM5 A;  3I0R A;  3LAM A;  4IG0 A;  3PUF A;  3LWM A;  2KW4 A;  4AHC A;  3IG1 A;  4CES A;  3O3H A;  1L3S A;  4AHR A;  3CFR A;  4F3O A;  3P5J A;  1QSY A;  4CHN A;  3K59 A;  3PO5 A;  1VSM A;  2X6N A;  3PX6 A;  4W5R A;  4J2D A;  2HHS A;  4Z4C A;  4I9L A;  4FLX A;  3RMC A;  4BE2 A;  1U47 A;  1T03 A;  3OYG A;  4Q5V A;  3DLE A;  4KAZ A;  3NH2 A;  3FFI A;  2BE2 A;  3DOK A;  1L3U A;  1RT4 A;  1KVB A;  3DLK A;  3VQ7 A;  2HHW A;  1BL3 A;  1B9D A;  1VSJ A;  4CHO A;  3ITH A;  3P83 D;  1VSF A;  2OPP A;  1CXQ A;  4MFB A;  1ZYQ A;  4FK0 A;  3MEC A;  2ITG A;  1WLJ A;  3WNG A;  3S3O A;  2VWJ A;  5HRP A;  4CJV A;  2JLE A;  1CZ9 A;  1GOC A;  1ZBH A;  3QNO A;  4IDK A;  3F73 A;  3AVI A;  5EU7 A; 
#chains in the Genus database with same CATH topology
 4N5S A;  3LP1 A;  3KK2 A;  2KZZ A;  1IBK K;  4AHT A;  2KHO A;  2O8C A;  2AA4 A;  3CCM N;  3GBT A;  2Q2R A;  4CGI A;  4BDY A;  3TAR A;  2VG5 A;  2UXB K;  1BI4 B;  4BRC A;  4AM6 A;  4CHY A;  4QS7 A;  5BN9 A;  1W97 L;  3QFP A;  3O9R A;  4FLY A;  4CER A;  4CFC A;  2FSN A;  1GLJ O;  1RT5 A;  3QFU A;  2G8I A;  4HUE A;  3QEW A;  3OS0 A;  2ZGZ A;  3QEV A;  1TKD A;  4A61 A;  3C6A A;  4H4M A;  3LP3 A;  4FLV A;  4C8O A;  3THY B;  4JKC A;  4FWM A;  2O8D A;  5KRS A;  3LDS A;  1RDC A;  2D0P A;  3AA2 A;  4ILJ A;  3G71 N;  2KFN A;  4IOX A;  3SUO A;  4FOI A;  3RSE B;  1ILY A;  3L2Q A;  3HK2 A;  4YOR A;  3HBT A;  1TL1 A;  2NLX A;  4K25 A;  1N36 K;  1ASW A;  2P51 A;  3VEX A;  3SQ2 A;  1OVQ A;  4GMJ B;  4YNQ A;  1E4F T;  3DI6 A;  3SBT A;  4ISE A;  3M3Z A;  1BHL A;  1RTD A;  2P9S B;  3CYM A;  1DT9 A;  1HMV A;  4DS5 A;  3SNN A;  4QS8 A;  3SUN A;  2ATQ A;  1IKY A;  4N76 A;  1KVA A;  2Q97 A;  4K8X A;  2NRV A;  4BG9 A;  4C1N K;  1J6Z A;  1LV5 A;  4Q0B A;  1GLA G;  3V6D A;  2W41 A;  3OYM A;  5DK5 A;  5F1X A;  1VHX A;  3C6U A;  3H3O B;  3LZI A;  3SLC A;  1TL3 A;  4ID1 A;  2R7Y A;  4KHY A;  5EY4 A;  3E9O A;  2QWL A;  1HKG A;  1JXB A;  5KTQ A;  1HNV A;  1QQO A;  2YHX A;  1RDD A;  1LCU A;  2P9K A;  5GAE P;  1BUP A;  4YOY A;  4BRL A;  1RDA A;  4JKB A;  3B8A X;  4IDH A;  3CQ8 A;  3F9M A;  5GAD P;  2OPS A;  4JRP A;  2NRT A;  3VQ4 A;  3I56 N;  4B1Z A;  2F7T A;  4PQU A;  4YY3 K;  1NJX A;  2F9W A;  4I6M A;  4FJL A;  3NHG A;  2HVI A;  1TUY A;  1QQC A;  3K9J A;  4JI2 K;  4NLC A;  4BWM A;  3AVF A;  4I2Q A;  3MWT A;  4FVU A;  5M1F A;  3AO2 A;  1C6V A;  1GOA A;  3KK3 A;  3UIQ A;  4E89 A;  3VQ6 A;  1BCO A;  3LDL A;  5JS2 A;  4YDU C;  4UY8 O;  1JLE A;  3AA5 X;  2QWN A;  2A41 A;  1NJY A;  4LFA K;  3RMD A;  3CJ1 A;  1YTA A;  2GX9 A;  2X78 A;  3TSU A;  3TSP A;  2Q31 A;  4CFD A;  3ZSV A;  4FZZ A;  3P31 A;  4YOX A;  1J54 A;  3PO4 A;  4IJN A;  2ZQB A;  1ASU A;  4ZTJ A;  4ELV A;  2JGU A;  3QB0 A;  1IBL K;  1J53 A;  3C94 A;  4BRN A;  4ISG A;  3TTC A;  3NF6 A;  4N47 A;  2ASO A;  3VQ5 A;  1S1U A;  4CW7 B;  2HBL A;  3O3F A;  4LD0 A;  3KTQ A;  5HRN A;  3NF7 A;  1KFS A;  1U2V B;  4WQ5 A;  1K73 O;  4FXD A;  1EXQ A;  5BRF A;  3HVR A;  4PWD A;  4DFM A;  3K5M A;  4FO0 A;  5EXW A;  1KAZ A;  1NJI O;  3CCU N;  2A1R A;  3U8X A;  1XHZ A;  4FJJ A;  2HW3 A;  4JK8 A;  2BUP A;  4OKK A;  1ZBL A;  3OA9 A;  1K8K A;  3DLG A;  4JLH A;  3O5B A;  3T3F A;  4CJR A;  4DSE A;  5CE3 A;  5JVH L;  3SJH A;  3JAM O;  3G4S N;  5LMU K;  4NXN K;  1XMQ K;  4OJR A;  4CZE A;  1RBU A;  2A42 A;  1R59 O;  1HUX A;  2VQF K;  3KD1 E;  5J2M A;  2O8E A;  1C1A A;  1HQE A;  4FL9 A;  2QWR A;  3PY8 A;  4DTJ A;  2XO7 A;  4G1Q A;  5GAG P;  2B4J A;  5C42 A;  2P9U A;  3IRX A;  3FLC O;  5H1S Q;  3AV9 A;  1BGX T;  3VES A;  2VYP A;  2QI2 A;  4CJP A;  1HRH A;  2JWK A;  3TI0 A;  4EZ6 A;  3VF6 A;  3T19 A;  1B92 A;  3QEI A;  3WNE A;  3VF2 A;  2E6M A;  1VQ6 N;  1WBD A;  3HST B;  5AJ3 K;  1NGI A;  4H4O A;  3AVG A;  1NK0 A;  3VET A;  3BY5 A;  4IO9 L;  1IG9 A;  2P9N A;  2I7N A;  4CZH A;  4XH1 A;  1TK8 A;  1MWK A;  3NGZ A;  1R0A A;  5AQP A;  1HX1 A;  1VSE A;  4CHQ A;  2CGK A;  4GVM A;  4BRK A;  3DRP A;  1IO2 A;  3BP8 A;  1NM1 A;  3H1Q A;  1VQ5 N;  2YKM A;  4BG8 A;  4B9L A;  3CJC A;  4KH6 A;  1N6Q A;  3OS1 A;  2W42 A;  3SYZ A;  4LFC K;  1QTM A;  3HVT A;  3M8S A;  2D0A A;  1I3A A;  2FSJ A;  2WOM A;  3CPW M;  5E41 A;  1BA1 A;  3O80 A;  4CF1 A;  3ULE B;  5K14 A;  3V81 A;  1RCH A;  1NG9 A;  1BWF O;  4I7F A;  5B8H A;  1XWL A;  1JXE A;  4ID5 A;  1QZ5 A;  3RVC A;  3C7N B;  1ATN A;  4BRO A;  5M1N A;  3OYA A;  3K5L A;  3CCE N;  3U3G A;  4CIF A;  4DQQ A;  4DV1 K;  4OGE A;  1XC9 A;  2V7Y A;  4KH4 A;  4FOE A;  4ZHR A;  3MXJ A;  2P9L B;  3HTV A;  2HBK A;  1VK0 A;  2IC3 A;  3V1R A;  1CZB A;  3PIO L;  2OPR A;  4IKF A;  3A8Y A;  1KFD A;  3O9Q A;  5M1P A;  4DUZ K;  4B8C A;  3A5O C;  1UAX A;  4O8U A;  3VQC A;  4B1Y B;  3CCQ N;  1X3M A;  3ASM A;  4FWS A;  3WXM B;  3KJV A;  1P90 A;  3TSQ A;  3MCP A;  1GLF O;  3K0S A;  1S1W A;  2PYJ A;  2PYL A;  4O55 A;  5KPR A;  3S3M A;  1HPZ A;  4FZX C;  3ENB A;  1GLD G;  3A0I X;  1CXU A;  2XRI A;  3HSC A;  1HKB A;  1NKC A;  4KH5 A;  5T7B A;  4JKA A;  1RBS A;  4CCH A;  1I39 A;  4J8F A;  2IOC A;  3EY1 A;  4B3T K;  1N32 K;  3LP2 A;  4K8Z A;  2Q3S A;  3DRS A;  4OPJ A;  4FLW A;  5HRO A;  4ELU A;  3ZT1 A;  2G8W A;  2Q0R A;  5AQK A;  4FJK A;  1HJO A;  4HCC A;  4AM7 A;  4KHQ A;  4CED A;  3WQU A;  4BRP A;  1JLG A;  4CJL A;  1NGH A;  5FDL A;  3TU5 A;  5AFU H;  4GW6 A;  1VQO N;  1KD1 O;  4QOZ B;  1UA1 A;  4MQ3 A;  3D2F B;  1YT3 A;  1KAY A;  4DTX A;  4FLZ A;  1E3M A;  4E7J A;  4HCB A;  1TYQ A;  1JL1 A;  4W5T A;  4FJ9 A;  4B1U B;  2ZWH A;  2GUP A;  4JKH A;  3DXK B;  2D1K A;  3SPZ A;  5FRO A;  4IZ9 A;  3B6O A;  4O0I A;  3LP0 A;  1U48 A;  4H5R A;  1BO5 O;  1VQ9 N;  2HHV A;  5AZI A;  1EX4 A;  4FWL A;  3B6P A;  4IXC A;  3T7Z A;  2I7P A;  3CC2 N;  3ZT0 A;  1OH6 A;  4B9N A;  5AR0 A;  1P8Z A;  3VQ8 A;  5FPN A;  2ASM A;  1C0T A;  2YX6 A;  4FWQ A;  3ZCM A;  3J7A P;  1TKX A;  1VRU A;  1JLA A;  1M1K O;  3LAM A;  4AHR A;  4JEP A;  3U9D A;  3PO5 A;  3D2E A;  4H5W A;  4W5R A;  4J2D A;  2HHS A;  3G6E N;  2UYT A;  3EE9 A;  3RMC A;  1U47 A;  5BN8 A;  3NH2 A;  3DOK A;  4X66 K;  1RT4 A;  2UU9 K;  3T1H K;  1OVY A;  4H5N A;  4OX9 K;  3AAP A;  4MFB A;  1CXQ A;  5AQG A;  2ITG A;  4CJV A;  1H1V A;  1CZ9 A;  4WQ4 A;  3QNO A;  3F73 A;  4JKE A;  2E5L K;  2XY8 A;  4YOW A;  3TR8 A;  1WSJ A;  3HO1 A;  1WAJ A;  3TTF A;  2WBN A;  4H5V A;  2IIR A;  3EEQ A;  3TAF A;  2A6A A;  3KLE A;  5C12 A;  4CGJ A;  1DTT A;  3W3D A;  3ZSY A;  1LW0 A;  2YNF A;  5ADX H;  4WCE L;  1RT3 A;  4DV6 K;  3CQY A;  4M7X A;  4LF4 K;  2OZM A;  4CEC A;  1T05 A;  2JWL A;  1VQN N;  1RBV A;  4CJ3 A;  3MXM A;  3OYC A;  1NMN A;  4OPA A;  1QZ6 A;  3MN9 A;  2XY5 A;  3H1V X;  1Q9Y A;  4M45 A;  4DQS A;  3V9S A;  1HR0 K;  4CIG A;  2O8D B;  3S9H A;  5MLC Q;  2Z1G A;  1KSP A;  3ZX0 A;  4ZTF A;  3RWU A;  3U9Z A;  3ZLJ A;  1J9A A;  4DR2 K;  2E1Z A;  3CC7 N;  4WE1 A;  3HM8 A;  4X62 K;  2FSK A;  4FVM A;  5C2D A;  4KHS A;  1IV0 A;  3CCV N;  2O8F A;  4OLA A;  3H08 A;  4CF2 A;  2KKZ A;  4MLE A;  1ATR A;  4G9Z A;  1BQN A;  2RE2 A;  2E2O A;  4YFU A;  3OHR A;  3VQ9 A;  4X64 K;  2D5R A;  4AQY K;  1WSE A;  4Z4E A;  1IH7 A;  3A5M C;  4DSF A;  4CGH A;  3DXM A;  3I8B A;  4JD2 A;  4IEE A;  2G8U A;  3O1B A;  1NGJ A;  4B9U A;  3ZX3 A;  4WFA L;  2IVP A;  4RG8 A;  4H8K A;  4BDZ A;  4HTU A;  1OH7 A;  2VGN A;  2HND A;  1VSI A;  2YNG A;  2AP1 A;  1N34 K;  3ISN C;  3ZEU A;  3AAR A;  1RT2 A;  2P9K B;  1D8Y A;  1A5W A;  3GE1 A;  3KZB A;  4BE1 A;  4RW6 A;  4PY5 A;  1Z05 A;  3I55 N;  3ZSO A;  4CZK A;  4OPK A;  1SS6 A;  1YJN N;  2QKB A;  4A5B A;  4J2A A;  3O9S A;  2GTD A;  4C8K A;  2X74 A;  5KPT A;  3CFP A;  3CXC M;  4OKE A;  1C0F A;  4CZG A;  3AVN A;  3WT0 A;  3V1O A;  3L6Q A;  4BRA A;  4N41 A;  3JYT A;  4FK4 A;  3NH0 A;  4EFH A;  3DWL A;  4B9V A;  3SV3 A;  1Q8I A;  3DLR A;  3K58 A;  3VA0 A;  3OYI A;  4CEE A;  3NGY A;  4CHP A;  4BAC A;  4CI6 A;  3UKU A;  2VCP A;  4DCH A;  3OBY A;  3M6G A;  1UWB A;  2QW9 A;  3KLI A;  4B1X B;  4U7B A;  3L2W A;  4DFK A;  5BPN A;  4XIU A;  4CFA A;  4KHP K;  3VA3 A;  3C95 A;  4RTF D;  4I9Q A;  1ITG A;  4E7L A;  1BIZ A;  4HVJ A;  3KD5 E;  2WON A;  3K57 A;  2YCH A;  1YHQ N;  4PL8 A;  1XUP O;  4JHD B;  3BZC A;  3L2U A;  4IBN A;  3C65 A;  3AVL A;  1XMO K;  3H3N O;  5AQV A;  1JJ2 M;  3LM9 A;  2DTU A;  4LF5 K;  4HHT A;  4FPA A;  4A59 A;  4Z0U A;  3FR0 A;  4YOT A;  4FJN A;  3U4L A;  5C2F A;  1K8K B;  1NK6 A;  3R1X A;  4BC4 A;  4O5F A;  3SV4 A;  5HOO A;  3A5N C;  5F0X A;  5I42 A;  2XY6 A;  3D45 A;  3BGR A;  3VGM A;  3KK7 A;  2ZGY A;  4DS4 A;  1IG8 A;  4JKD A;  3QML A;  2F8T A;  3KWG A;  5FLX O;  3O9T A;  3UKR A;  3VGK A;  2NRH A;  4MLH A;  5C10 A;  2EX3 A;  1HLU A;  4WFN L;  2O8E B;  1M90 O;  5F2R A;  2IAJ A;  5CZ2 A;  1NOY A;  1Q81 O;  4M42 A;  4Z4H A;  4DTO A;  4GV3 A;  2WUS A;  3K2P A;  1X9W A;  5AQF A;  3D6R A;  3ENH A;  3SK3 A;  3VTH A;  2OA8 A;  5AZJ A;  2BGG A;  5AQT A;  5AQX A;  1TK5 A;  1VRT A;  4R5P A;  4RW4 A;  5SWM A;  5GAH P;  4FCY A;  1YAG A;  3HT3 A;  5BRH A;  4IFE A;  4DR1 K;  1ATS A;  1WAF A;  1NGE A;  1YUW A;  3NDK A;  2P9P B;  3KVG A;  4IFY A;  3NF9 A;  3T1Y K;  1T6D A;  4BQZ A;  1WSH A;  4E19 A;  1RDB A;  1ESV A;  4XEI A;  3WXK A;  3O4W A;  4M3Z A;  3MED A;  3CJA A;  2A40 A;  3FZL A;  3O6W A;  4DR3 K;  3CJB A;  2O4G A;  1YIT N;  1QSS A;  1LWF A;  3SAG A;  5DMR A;  2IGI A;  3VOV A;  1QHT A;  1MWM A;  1IJJ A;  4B1W B;  4B1V A;  3M1F A;  4JS5 A;  4PL7 A;  4QAG A;  1Q7Y O;  5C25 A;  4CEF A;  4A2A A;  1HNZ K;  5GIN A;  4OO1 J;  4BC2 A;  2OZS A;  1S1X A;  1EWR A;  1T8E A;  3VEO A;  4FJM A;  4FWK A;  3GL1 A;  1RNH A;  3ZSW A;  4BRD A;  4BRE A;  2FBV A;  4CEB A;  1LWE A;  4LH4 A;  5DM7 L;  4YOV A;  4KHN A;  2FF6 A;  4BRI A;  3KHY A;  1N8R O;  4CJ7 A;  2P5G A;  3Q7B A;  2NUB A;  3WXI A;  4BRQ A;  4CIE A;  4DFJ A;  4X65 K;  3A2F A;  5KQD A;  1FK9 A;  4CJK A;  3MAQ A;  2HST A;  1RTH A;  3CMA N;  3I8D A;  2OAN A;  5AQR A;  4BRM A;  1UA0 A;  3THW A;  4O4G A;  1Z26 A;  4BE0 A;  3CIP A;  2QK9 A;  3BF1 A;  1FKO A;  3QEP A;  1JL2 A;  5HP1 A;  3IUC A;  1NK7 A;  4DQP A;  5TKW A;  2HHQ A;  1T7P A;  3J80 O;  3HRG A;  5CR4 A;  1MDU B;  4FSV A;  3CCL N;  5AQZ A;  2GUI A;  1VQK N;  3J7Y P;  4CJQ A;  4NB4 A;  3SZ2 A;  1RDW X;  1NK5 A;  2Y1J A;  1XQS C;  3WXL A;  4BRH A;  1NJW A;  4CZL A;  1TGO A;  4FM1 A;  2HMI A;  4XH5 A;  4FJ5 A;  3D0P A;  2A1S A;  3NCI A;  5FRM A;  3PIP L;  4BVO A;  2HHH K;  1D5A A;  1WUA A;  4M3T A;  4KO0 A;  2J4R A;  5AFU A;  3NE6 A;  1VQ4 N;  3QIC A;  1Q9X A;  3HPH A;  4FWR A;  2NZT A;  1IKW A;  3BUZ B;  4A57 A;  3HOT A;  3RSE A;  5EVZ A;  2A5X A;  4M3X A;  1TYQ B;  2GWJ A;  2Q1N A;  1S22 A;  4Y0W A;  2PY5 A;  2ZE2 A;  4KI6 A;  2D0O A;  3KKR A;  2ITM A;  1DTQ A;  3KKS A;  1RTJ A;  4DF4 A;  3IKM A;  4O44 A;  1RBR A;  3IFR A;  2F4V K;  1XNQ K;  4JI4 K;  2GEL A;  4KKO A;  4JI0 K;  4HWI A;  3MX2 A;  3CG7 A;  2FBY A;  2CGJ A;  2Y1I A;  4LC9 B;  4JRQ A;  1NBW A;  3TAB A;  4LH5 A;  3RRG A;  5AZI B;  2HF3 A;  2UXC K;  1BDG A;  2YHW A;  2WFB A;  3ZSR A;  4NCB A;  4O8K A;  3PLA A;  2QWP A;  3BDP A;  3ULD A;  3G10 A;  3FZH A;  2Q0U A;  3AO1 A;  3HM9 A;  1E4G T;  3BZK A;  2WC9 A;  3CM5 A;  4CBX A;  2VGM A;  3PUF A;  4CES A;  3IG1 A;  4AF1 A;  4F3O A;  3P5J A;  3BF3 A;  4JK9 A;  4CHN A;  3PX6 A;  3PSI A;  1VQM N;  4Z4C A;  4U67 L;  3DLE A;  2QM1 A;  1HPM A;  3UE5 A;  1L3U A;  3DLK A;  1KVB A;  5GIO A;  2HHW A;  1VSJ A;  3CHW A;  1VSF A;  3PSF A;  1W2B M;  3MEC A;  5BPM A;  3W0L A;  3WNG A;  4BRG A;  2JLE A;  4MDA A;  4RCH A;  2V52 B;  5EU7 A;  3KK1 A;  4FWP A;  3CC4 N;  1VQP N;  1B9F A;  2HVH A;  2YI1 A;  1OH5 A;  2YKN A;  3QO9 A;  4JN4 A;  1ZBU A;  1EWQ A;  4WQ5 C;  3HXM A;  3MWP A;  4JKG A;  2HMP A;  4DLG A;  5ADX A;  1NGA A;  3Q7C A;  3TAQ A;  4IOC L;  1REV A;  2XY7 A;  1I94 K;  3VQQ A;  2VWK A;  4A2B A;  2UUA K;  1NMD A;  3LAN A;  5HRR A;  3IS9 A;  4KRE A;  3EN9 A;  3HI0 A;  1N33 K;  4DU3 A;  4NYN A;  1V4S A;  3ZSX A;  4CD3 A;  3FZK A;  2VWB A;  2E1Y A;  2ZF5 O;  3MK6 A;  1SKS A;  1RT1 A;  4R79 A;  1DGK N;  5A2Q O;  4PUO A;  1U4B A;  1MA9 B;  3SQ4 A;  3MX5 A;  4KPY A;  4DTR A;  4DG1 A;  4PKG A;  2ETJ A;  4O5B A;  5GIP A;  4BR4 A;  4BWJ A;  1U2V A;  5BRE A;  4K0K K;  4C1N I;  3VQB A;  3ZSQ A;  5AQJ A;  2F9T A;  1YXQ A;  2O8F B;  3U3Y A;  1QVF M;  4E1N A;  2IS3 A;  2GV9 A;  4F8R A;  1HYZ A;  3ZET A;  1VSK A;  1J5E K;  1A5X A;  2HHT A;  4KI4 A;  2FBT A;  4RW9 A;  1HKC A;  1JLF A;  1WSI A;  4FW2 A;  4ILG B;  2QA4 N;  4NYF A;  4CK2 A;  1X1P A;  3OY9 A;  1GLC G;  1S9G A;  4H0T B;  3E1Y A;  4NO7 A;  4JI7 K;  3QBX A;  3CCR N;  5KPZ A;  3JS6 A;  3DMJ A;  3DXM B;  3VQP A;  4JD2 B;  4M41 A;  3OYJ A;  4DR5 K;  1ZC6 A;  1C1B A;  2DPN A;  2E4L A;  5C15 A;  2E8A A;  5AQO A;  1WBB A;  3ZEU B;  3SJJ A;  1HNW K;  2BH1 A;  3P38 A;  4JKF A;  3J81 O;  2BDP A;  4PKH A;  2Z1J A;  3L2V A;  1WOQ A;  4CK1 A;  2CH6 A;  3GOI A;  3UB5 A;  4M63 C;  5AQS A;  4BY9 C;  1BU6 O;  1Z6R A;  4PKI A;  3QIP A;  3SMP A;  1X9M A;  3THV A;  4PA1 A;  4NCG A;  1SUQ A;  3R6M A;  2V51 B;  2QXF A;  4H0Y B;  4M3Y A;  4E1M A;  1SV5 A;  2YV0 X;  2OTL N;  3AVK A;  4WYB A;  2O8C B;  4A5A A;  3HP6 A;  3EYZ A;  3PX0 A;  3NGI A;  3LZJ A;  4DQR A;  3KLF A;  4CJ4 A;  3RRH A;  2VQE K;  3OYH A;  3AO4 A;  4DU1 A;  3UKU B;  3NMU A;  3ULE A;  2F8S A;  3L0Q A;  1T44 A;  3MCA B;  4W5N A;  3VQA A;  3L2R A;  5JVG L;  1ASV A;  4A62 A;  4ILH A;  2I5J A;  2NNW A;  3VMF B;  2W6L A;  4CGD A;  1FJG K;  4FLU A;  3VEN A;  3DOL A;  4KTZ A;  5LL6 Z;  2HHU A;  4ELT A;  2E2Q A;  1TKZ A;  1X9S A;  4KHU A;  3NF8 A;  1CZA N;  1QQM A;  1GLB G;  1XC3 A;  4BVP A;  2ZJQ L;  2CGL A;  1NGC A;  1RFQ A;  5CYM A;  4B3S K;  3QLH A;  3MMV A;  1W7A A;  2FBX A;  4CZF A;  4BR2 A;  5SZT A;  1C0U A;  5AQL A;  1FW6 A;  4DUY K;  4CVN E;  3CI5 A;  2G8V A;  4B9M A;  3TAG A;  1U45 A;  3SCX A;  3DAW A;  1KRP A;  1VAZ A;  3MN6 A;  4I2P A;  4DF8 A;  3CM6 A;  2W6K A;  3TAM A;  4BR7 A;  1HYV A;  1FKP A;  2O8B A;  1NU0 A;  3C0B A;  3UKR B;  3CCS N;  2GEM A;  1EP4 A;  3G25 A;  5C0Y A;  3LL3 A;  4IJA A;  4F9O A;  4JI5 K;  3CME N;  1JKH A;  2HB5 A;  3VQD A;  1WSF A;  4FYD A;  2OPQ A;  4H0X B;  4DFP A;  2PZS A;  5JS1 A;  3CPE A;  3C6H A;  3V9Z A;  2QKK A;  5AQU A;  5AZJ B;  4CE9 A;  1LWC A;  1TAQ A;  1DEJ A;  4WFB L;  3IAY A;  4AHS A;  1HJR A;  4GNI A;  3D2F A;  3R9P A;  2PBD A;  2HF4 A;  3ATU A;  3AO3 A;  3O8M A;  3AGR A;  3ALY A;  3T1A A;  2Z1I A;  3D7E O;  3DXK A;  3F2K A;  3ZT2 A;  3OJS A;  3OYD A;  1TVR A;  2D0B A;  3ZSZ A;  2ZJP L;  1KXP A;  2ZD1 A;  3DRR A;  4EP5 A;  2RKI A;  1KAX A;  4NXM K;  4FM2 A;  4CFB A;  1KLN A;  4Z4I A;  4I6M B;  3H6E A;  1L3T A;  3O08 A;  3ZX2 A;  4WQ4 C;  4JI6 K;  1RIL A;  4DTS A;  4M3W A;  1S1V A;  1VSD A;  4K42 A;  4WF9 L;  1NJZ A;  1SL2 A;  1WSG A;  2Z1H A;  1G99 A;  2HOE A;  2XHB A;  4MDB A;  4DTP A;  4CJF A;  4LFB K;  1RT6 A;  4E3S A;  1FXX A;  5BR8 K;  3SUQ A;  1JLQ A;  1S72 N;  3QDK A;  3KWI A;  4FJX A;  2O4I A;  1DKG D;  3SPY A;  1YIJ N;  3JXU A;  1T6C A;  5M1Q A;  3I0S A;  3THX A;  4HTL A;  5LMN K;  4W5O A;  3TAN A;  1QE1 A;  2P9I A;  4CF0 A;  1L5U A;  4E7H A;  2KLA A;  5AQW A;  4N56 A;  4GVE A;  2A3Z A;  3RR7 A;  3O3G A;  3MN5 A;  1QVG M;  1NLV A;  2GWK A;  3LDO A;  5E26 A;  3THW B;  4KHW A;  1DLO A;  1GOB A;  1Q18 A;  4OVL A;  5BPL A;  1YVU A;  2YHY A;  4QCL A;  1IKV A;  4CBW A;  3SQ1 A;  4LSN A;  4GV9 A;  2VG6 A;  3AVH A;  4B9S A;  1N5Y A;  4YDU A;  3CD6 N;  4RW8 A;  3M5R A;  1JLC A;  2OTJ N;  2D0C A;  3DLH A;  3MEG A;  3TPQ A;  3G0Z A;  1NNE A;  1SL0 A;  2F96 A;  4HUF A;  3J7Z O;  5BRD A;  1NKB A;  3QIO A;  1WNS A;  1G15 A;  4GY2 B;  3SAH A;  1ZXO A;  1NGB A;  3LAK A;  4DSL A;  3DLB A;  1C0M A;  2RHK A;  4CZJ A;  3FFK B;  1K9M O;  4BR9 A;  3KLH A;  1JCG A;  4FJI A;  4M3R A;  5EX5 A;  1KVC A;  1O1W A;  2P9U B;  1RDU A;  2KQ2 A;  1A5V A;  4E1J A;  2P5O A;  1NKE A;  1BIS A;  1EO1 A;  3I33 A;  5AQH A;  1RTI A;  1SKW A;  3AVA A;  4RWT A;  3E9L A;  2QEX N;  1SQK A;  1GLL O;  3V4I A;  2LSN A;  4CEA A;  4YHH K;  2P9N B;  4Z4F A;  2AJQ A;  4DSJ A;  4KTQ A;  4YOU A;  1D4X A;  1KLM A;  4FWN A;  5LJV A;  1WB9 A;  4DLE A;  2BAN A;  3DYA A;  3WEE A;  4OGC A;  1TAU A;  3V9U A;  3NH1 A;  2X6S A;  4H03 B;  3E01 A;  1JCF A;  1QHA A;  5KGW A;  2EHG A;  3WNH A;  3SBG A;  5CY4 A;  1KCF A;  3AA4 A;  4FM0 A;  4EIA A;  3NVK A;  3LAL A;  2NRR A;  1XHX A;  2W40 A;  3QEX A;  1QSL A;  3I0R A;  5AQY A;  2E20 A;  3CFR A;  4PHT X;  1QSY A;  1NGG A;  1VSM A;  2X6N A;  4I9L A;  3OTO K;  4H0V B;  3OYG A;  4Q5V A;  2FXU A;  3VQ7 A;  1B9D A;  3EZW A;  4CHO A;  3L4Q A;  4IEI A;  1ZYQ A;  2UXD K;  1XNR K;  1WLJ A;  4JAX A;  2VWJ A;  1ZBH A;  5JMV A;  4IDK A;  3L8B A;  3SUP A;  1VQ7 N;  4JKG B;  3CCJ N;  1XI1 A;  1NK4 A;  3S41 A;  5EOY A;  3AVM A;  2PFU A;  1T3V A;  2DFH A;  4DKW A;  4E7I A;  4JS4 A;  4F2S A;  5KGX A;  1BI4 A;  1NK8 A;  1EQY A;  2YJE A;  5HRS A;  3NBP A;  4CD1 A;  4JI8 K;  3C6T A;  3VEV A;  4L3Q A;  4K43 A;  2IDO A;  4FZY A;  4OLB A;  4EZ9 A;  4DV5 K;  5ELZ A;  1KQS M;  4JHD A;  2IVN A;  5CZ1 A;  3AVJ A;  1VQL N;  3THY A;  3CQX A;  1CLQ A;  3OVN A;  4DB3 A;  2NRZ A;  4FW1 A;  3ZET B;  5M1K A;  4GKK K;  4KB0 A;  4GV6 A;  3VER A;  2PAV A;  3P1G A;  4KB1 A;  2HBM A;  4BRF A;  3M8Q A;  5DM6 L;  5BR9 A;  4CK3 A;  3E9P A;  4CF8 A;  3EKS A;  1X9J A;  4DQI A;  1BG3 A;  1BA0 A;  3QIN A;  4F4K A;  3OYE A;  1C0G A;  4DU4 A;  2BTF A;  3L3V A;  4B9Q A;  2P9S A;  5FRN A;  1GLE G;  5JIC A;  4M3U A;  3OYB A;  4GKJ K;  1NK9 A;  5E84 A;  4FJ7 A;  3J8A A;  3H46 O;  5JLH A;  1S9E A;  3DLL L;  4DTN A;  1MU2 A;  1K8A O;  5CYQ A;  2QWO A;  3NFA A;  2QWM A;  1HYS A;  3QBW A;  4DQ8 A;  3DM2 A;  1K6Y A;  1JCE A;  1S1T A;  3VTI A;  3QNN A;  2P9P A;  3WQT A;  4FK2 A;  3OW2 M;  1ZBS A;  4BDP A;  3D2E B;  1SZ2 A;  1BOT O;  3JSM A;  4EAH D;  3L4I A;  2UUC K;  3ZYY X;  2D4W A;  1LAV A;  2ZJR L;  3CET A;  3OYL A;  3SMS A;  4DSI A;  3AAQ A;  4CGF A;  1LAW A;  4M7Y A;  4IO8 A;  3CJ7 A;  1NOZ A;  3O9U A;  3CJ9 A;  1YVN A;  4MO5 A;  4IWV A;  2P1J A;  2FF3 B;  2FC0 A;  3HL8 A;  3AA3 A;  1S6P A;  2E6L A;  1NWK A;  4DR4 K;  3EO3 A;  2OYQ A;  3V9W A;  1WN7 A;  3TAP A;  4LF6 K;  3S3N A;  4DHY A;  3HPO A;  4FPB A;  3VEW A;  3RTV A;  3ID6 A;  4QS9 A;  1ZBI A;  4BR0 A;  5J1E A;  1U04 A;  3MXI A;  4ICL A;  4J2E A;  4CEQ A;  3E66 A;  2NRW A;  5HL7 L;  3LWL A;  3V9X A;  3VEZ A;  1RT7 A;  1Y64 A;  4H0P A;  4F3T A;  3MDQ A;  4W5Q A;  2GBZ A;  3RMB A;  3L3U A;  1BQM A;  4CJE A;  4IOA L;  5HLF A;  1ZBF A;  2DY4 A;  5AQQ A;  1W0H A;  2KTQ A;  1Q82 O;  3OYK A;  4Y1C A;  3ENO A;  5IWA K;  1YJW N;  3CF5 L;  4BGA A;  1C1C A;  4DWI A;  3RR8 A;  2ZM6 K;  2H3G X;  3QET A;  4B8A B;  4AHU A;  4B9T A;  3PV8 A;  3DJC A;  4B08 A;  4CEO A;  4LSL A;  4JK7 A;  4IG3 A;  4IFV A;  1L3V A;  3FZF A;  3O1W A;  2QWQ A;  4AIL C;  3AO5 A;  4KFB A;  4C8N A;  1NGF A;  4LY7 A;  4DR6 K;  2O8B B;  5I3U A;  4DV4 K;  1YF5 L;  4J2B A;  2RF2 A;  2HHX A;  4CJU A;  1Z25 A;  3F5T A;  1SAZ A;  4DSK A;  4FJH A;  2UUB K;  4EHT A;  4B3M K;  2YHA A;  4V19 S;  3FZM A;  2YNI A;  1JLB A;  3OBW A;  1TK0 A;  4DMN A;  4Z4G A;  3HP9 A;  3P4I A;  4C8M A;  3O4Q A;  4DTU A;  1TKT A;  3WXJ A;  3K5N A;  4C23 A;  1Y97 A;  4KRF A;  3RMA A;  3ID8 A;  3VF4 A;  3IMX A;  4DTM A;  3EKU A;  3LDN A;  3KIO A;  3HJF A;  3NVM A;  4CJ5 A;  1D9F A;  3HPG A;  4B3O A;  3V1Q A;  3N4P A;  4AHV A;  5C24 A;  2HNY A;  1NGD A;  1VQ8 N;  3FE1 A;  2G8H A;  3ZT4 A;  4CF9 A;  1X3N A;  4L8R B;  4DV3 K;  2QTD A;  2YJF A;  5LJW A;  4OPH A;  3NAE A;  3HOS A;  4RW7 A;  5TKY A;  2QXL A;  4UQG A;  1OKJ A;  2V7Z A;  2E2N A;  5M1O A;  4NLB A;  3OJU A;  1QS4 A;  5J2P A;  3U6F A;  1F21 A;  3AVB A;  3HZ6 A;  2RPI A;  3PX4 A;  3LDP A;  5J2N A;  1UOC A;  1LW2 A;  4LF8 K;  3QER A;  2KFZ A;  3MN7 A;  2DFE A;  3THX B;  3SAF A;  2P9I B;  5KI6 A;  2E2P A;  2Q36 A;  3OYF A;  3EE8 A;  1J5O A;  4HUG A;  1LOT B;  3P39 A;  3VEY A;  3TTD A;  3AVC A;  3R8E A;  2YHB A;  1U6Z A;  3F9K A;  3O4N A;  4ISF A;  3KLG A;  1YI2 N;  2G8F A;  2IVO A;  3M8P A;  3C7N A;  5I9E B;  1D9D A;  4CJS A;  1KTQ A;  1EKE A;  4DR7 K;  3CER A;  1QQN A;  5D3G A;  4DV7 K;  1S5J A;  1VSL A;  4LF9 K;  2HNZ A;  3M8R A;  4JI1 K;  3VN5 A;  2P9L A;  1HQU A;  4O0J A;  3T69 A;  4C8L A;  1TUU A;  1HNX K;  4H0O A;  4EHU A;  2HBJ A;  1S3X A;  1OH8 A;  5AQI A;  4CEZ A;  5FPE A;  5LY3 A;  5J2Q A;  5IT9 O;  2B6A A;  4KBO A;  4JYA K;  5FPD A;  5FPM A;  3EL2 A;  3SQ0 A;  4CBU A;  1KC8 O;  2FLO A;  4FLT A;  1YJ9 N;  4E7K A;  3WNF A;  4BC5 A;  2E88 A;  4K41 A;  1EET A;  1YTU A;  1HNI A;  3H45 C;  3CFO A;  3A5L C;  1U49 A;  3ATV A;  4Z94 A;  4OKJ A;  2NRX A;  4DV2 K;  2KZM A;  3VPZ A;  2DFF A;  4F2R A;  3GDQ A;  4CJW A;  3LDQ A;  3LPT A;  3FGU A;  3EZ5 A;  3K9K A;  1TV6 A;  4Y1D A;  1Q86 O;  4LF7 K;  4CJT A;  4TSX A;  2G8K A;  1W9H A;  4CGG A;  4B3R K;  3GG4 A;  3OS2 A;  2ASP A;  3K5O A;  5KRT A;  3VQE A;  4JV5 K;  5HBM A;  1SKR A;  4KV8 A;  2VG7 A;  1S6Q A;  2OCE A;  2YNH A;  3LPU A;  3N4Q A;  4NCA A;  4AH9 A;  5AQN A;  4KTW A;  4CHZ A;  3MEE A;  3WEE B;  3TWH A;  4FJ8 A;  3TAE A;  4BGB A;  2RN2 A;  1IKX A;  1SL1 A;  3ZT3 A;  4FWO A;  3HYF A;  4XH4 A;  3R3L A;  3QES A;  4BR5 A;  1V4T A;  4MO4 A;  1RBT A;  4EP4 A;  4CZI A;  3BEX A;  3VGL A;  1BIU A;  4BQL A;  3OYN A;  4FJG A;  4E0D A;  1BCM A;  1VSH A;  1RGI A;  4BC3 A;  2B5J A;  3AGK A;  3SI6 A;  4IG0 A;  5CHI A;  3LWM A;  2KW4 A;  4AHC A;  3O3H A;  1L3S A;  4JNE A;  3AY9 A;  3K59 A;  2WTU A;  3LM2 A;  4FLX A;  2CH5 A;  4CZM A;  4BE2 A;  1T03 A;  5AQM A;  4KAZ A;  1IBM K;  3FFI A;  2BE2 A;  3WUH A;  4H5T A;  1BL3 A;  4JI3 K;  3IDH A;  4DV0 K;  3ITH A;  3P83 D;  1O13 A;  2OPP A;  4FK0 A;  5KQ8 A;  5JLF A;  3S3O A;  5HRP A;  1GOC A;  2EWS A;  3AVI A; 
#chains in the Genus database with same CATH homology
 3KK1 A;  4N5S A;  3LP1 A;  3KK2 A;  3L8B A;  2KZZ A;  3SUP A;  2HVH A;  3TR8 A;  1B9F A;  4AHT A;  1WSJ A;  2YKN A;  3QO9 A;  1XI1 A;  1NK4 A;  1WAJ A;  3HO1 A;  1ZBU A;  3HXM A;  4CGI A;  3AVM A;  4DLG A;  4BDY A;  3TAF A;  3TAR A;  2VG5 A;  3KLE A;  2DFH A;  1BI4 B;  3TAQ A;  4CHY A;  4E7I A;  1REV A;  4JS4 A;  4F2S A;  5KGX A;  4CGJ A;  2XY7 A;  1BI4 A;  3VQQ A;  1DTT A;  3ZSY A;  4FLY A;  4CER A;  2VWK A;  5HRS A;  4CFC A;  3NBP A;  1LW0 A;  2YNF A;  1RT3 A;  3LAN A;  1RT5 A;  5HRR A;  3IS9 A;  4KRE A;  2G8I A;  4HUE A;  3QEW A;  3C6T A;  2OZM A;  4CEC A;  1T05 A;  1RBV A;  4DU3 A;  4CJ3 A;  4NYN A;  3OS0 A;  3MXM A;  3ZSX A;  3OYC A;  1Q9Y A;  2XY5 A;  3QEV A;  1TKD A;  2IDO A;  4FZY A;  4M45 A;  4DQS A;  3V9S A;  4H4M A;  4CIG A;  4EZ9 A;  1SKS A;  4OLB A;  1RT1 A;  3LP3 A;  3S9H A;  4FLV A;  2Z1G A;  1KSP A;  4C8O A;  4KHU A;  4PUO A;  1U4B A;  4ZTF A;  3SQ4 A;  5KRS A;  5CZ1 A;  3AVJ A;  3RWU A;  4KPY A;  4DTR A;  4DG1 A;  1J9A A;  1RDC A;  2ETJ A;  4O5B A;  3LDS A;  3AA2 A;  1CLQ A;  3OVN A;  4BWJ A;  4WE1 A;  3VQB A;  3ZSQ A;  2KFN A;  3SUO A;  4FW1 A;  3L2Q A;  3U3Y A;  3HK2 A;  4KB0 A;  4E1N A;  2IS3 A;  2GV9 A;  1TL1 A;  4FVM A;  4KHS A;  4F8R A;  1HYZ A;  1VSK A;  4OLA A;  3H08 A;  3P1G A;  1A5X A;  4CF2 A;  4KB1 A;  3M8Q A;  2HHT A;  4KI4 A;  2FBT A;  1ASW A;  2P51 A;  4RW9 A;  4CF8 A;  1JLF A;  1WSI A;  4FW2 A;  4CK3 A;  3SQ2 A;  1BQN A;  4NYF A;  1X1P A;  4GMJ B;  4CK2 A;  4YNQ A;  3DI6 A;  3OY9 A;  4DQI A;  1BHL A;  4YFU A;  1RTD A;  1S9G A;  3VQ9 A;  3QIN A;  4F4K A;  2D5R A;  3CYM A;  3OYE A;  1WSE A;  3DMJ A;  4Z4E A;  1IH7 A;  3VQP A;  4M41 A;  4DU4 A;  3L3V A;  4DSF A;  1HMV A;  3OYJ A;  4CGH A;  4DS5 A;  3SNN A;  5FRN A;  1C1B A;  4M3U A;  3OYB A;  2G8U A;  1NK9 A;  3SUN A;  4B9U A;  2ATQ A;  2E4L A;  1IKY A;  4N76 A;  1KVA A;  4FJ7 A;  4RG8 A;  4H8K A;  4K8X A;  4BDZ A;  4HTU A;  3SJJ A;  1LV5 A;  4Q0B A;  1S9E A;  1VSI A;  2HND A;  2YNG A;  3V6D A;  3OYM A;  5DK5 A;  3C6U A;  3LZI A;  3ISN C;  4DTN A;  1TL3 A;  4ID1 A;  2R7Y A;  1MU2 A;  4KHY A;  5CYQ A;  1RT2 A;  3NFA A;  1D8Y A;  1HYS A;  2BDP A;  1A5W A;  3DM2 A;  1JXB A;  1K6Y A;  5KTQ A;  1HNV A;  2Z1J A;  1RDD A;  4RW6 A;  1S1T A;  3L2V A;  4BE1 A;  4PY5 A;  4CK1 A;  1RDA A;  3QNN A;  3ZSO A;  4FK2 A;  4OPK A;  4BDP A;  3CQ8 A;  2QKB A;  2OPS A;  4JRP A;  3JSM A;  3VQ4 A;  4J2A A;  4PQU A;  1NJX A;  4C8K A;  2X74 A;  3CFP A;  1LAV A;  4FJL A;  3OYL A;  3NHG A;  3QIP A;  2HVI A;  4DSI A;  4OKE A;  1LAW A;  4CGF A;  1QQC A;  1NOZ A;  1X9M A;  3THV A;  4PA1 A;  4NCG A;  4BWM A;  3AVF A;  1SUQ A;  3AVN A;  4I2Q A;  2P1J A;  2QXF A;  2FC0 A;  3HL8 A;  3AO2 A;  1C6V A;  1GOA A;  3AA3 A;  3V1O A;  4M3Y A;  4E1M A;  1SV5 A;  2YV0 X;  3KK3 A;  1S6P A;  2E6L A;  3AVK A;  3UIQ A;  4E89 A;  4N41 A;  3VQ6 A;  1BCO A;  3HP6 A;  5JS2 A;  3NH0 A;  3JYT A;  4FK4 A;  2OYQ A;  3EYZ A;  3V9W A;  3PX0 A;  1WN7 A;  3NGI A;  3LZJ A;  4DQR A;  1JLE A;  3AA5 X;  4CJ4 A;  3KLF A;  3RRH A;  3TAP A;  3HPO A;  3S3N A;  4B9V A;  3OYH A;  3RTV A;  1Q8I A;  3AO4 A;  3DLR A;  3K58 A;  3SV3 A;  4DU1 A;  3VA0 A;  3OYI A;  4CEE A;  1NJY A;  4K8Z A;  1ZBI A;  2F8S A;  3MXI A;  3NGY A;  1U04 A;  4CHP A;  5J1E A;  4BAC A;  3RMD A;  4ICL A;  4J2E A;  4CEQ A;  1YTA A;  2X78 A;  4W5N A;  3VQA A;  3L2R A;  3LWL A;  1UWB A;  3KLI A;  1ASV A;  3V9X A;  3L2W A;  4DFK A;  1RT7 A;  2I5J A;  3ZSV A;  4CFD A;  4FZZ A;  4F3T A;  4XIU A;  4CGD A;  4CFA A;  4W5Q A;  4FLU A;  2GBZ A;  3RMB A;  3L3U A;  3DOL A;  1BQM A;  1J54 A;  4CJE A;  3C95 A;  4KTZ A;  3VA3 A;  3PO4 A;  1ITG A;  5HLF A;  4I9Q A;  1ZBF A;  2ZQB A;  1ASU A;  2HHU A;  4ELT A;  2DY4 A;  1X9S A;  1TKZ A;  4ZTJ A;  4ELV A;  4E7L A;  1BIZ A;  1W0H A;  2JGU A;  3NF8 A;  4HVJ A;  2WON A;  3OYK A;  4Y1C A;  3K57 A;  3KD5 E;  2KTQ A;  1J53 A;  5CYM A;  3C94 A;  3QLH A;  1C1C A;  3NF6 A;  4DWI A;  4N47 A;  3RR8 A;  2FBX A;  3VQ5 A;  5SZT A;  3L2U A;  4IBN A;  3QET A;  1C0U A;  4B8A B;  1S1U A;  4AHU A;  3KTQ A;  3AVL A;  4LD0 A;  3O3F A;  3PV8 A;  5HRN A;  4B08 A;  4CEO A;  4B9T A;  3NF7 A;  4LSL A;  2G8V A;  4B9M A;  1KFS A;  4IG3 A;  4IFV A;  1L3V A;  4FXD A;  1EXQ A;  3TAG A;  1U45 A;  3SCX A;  1KRP A;  4PWD A;  3HVR A;  4AIL C;  2DTU A;  3AO5 A;  4HHT A;  4I2P A;  3K5M A;  4DFM A;  4KFB A;  4DF8 A;  3CM6 A;  4C8N A;  4LY7 A;  4Z0U A;  4FJN A;  3TAM A;  2A1R A;  1NK6 A;  5I3U A;  1XHZ A;  3SV4 A;  1HYV A;  4FJJ A;  4J2B A;  2HW3 A;  4OKK A;  2RF2 A;  1ZBL A;  4CJU A;  1FKP A;  1Z25 A;  5I42 A;  2HHX A;  3DLG A;  2XY6 A;  4DSK A;  3D45 A;  3BGR A;  4JLH A;  3T3F A;  4FJH A;  4CJR A;  4DS4 A;  4DSE A;  1EP4 A;  2YHA A;  2F8T A;  2YNI A;  1JLB A;  1JKH A;  2HB5 A;  3VQD A;  1WSF A;  1TK0 A;  4FYD A;  2OPQ A;  4DFP A;  4DMN A;  2EX3 A;  2PZS A;  4Z4G A;  3HP9 A;  4OJR A;  2IAJ A;  1RBU A;  5CZ2 A;  4C8M A;  5JS1 A;  3O4Q A;  1NOY A;  3KD1 E;  3V9Z A;  2QKK A;  4DTU A;  5J2M A;  1C1A A;  1TKT A;  1HQE A;  4M42 A;  3K5N A;  3PY8 A;  4CE9 A;  4DTJ A;  1LWC A;  4Z4H A;  2XO7 A;  1TAQ A;  3K2P A;  4DTO A;  4G1Q A;  1X9W A;  1Y97 A;  2OA8 A;  2B4J A;  5C42 A;  3RMA A;  4KRF A;  3IRX A;  2BGG A;  3IAY A;  4AHS A;  1VRT A;  1HJR A;  4R5P A;  1TK5 A;  3AV9 A;  1BGX T;  4RW4 A;  5SWM A;  4CJP A;  4DTM A;  1HRH A;  4FCY A;  3TI0 A;  4EZ6 A;  3KIO A;  3HJF A;  1D9F A;  4CJ5 A;  3T19 A;  1B92 A;  3AO3 A;  3WNE A;  3HT3 A;  3QEI A;  2E6M A;  1WAF A;  3HPG A;  4B3O A;  3ALY A;  3V1Q A;  3HST B;  3T1A A;  4H4O A;  2Z1I A;  4AHV A;  3NDK A;  5C24 A;  3AVG A;  3ZT2 A;  2HNY A;  1NK0 A;  4IFY A;  1IG9 A;  3OJS A;  3NF9 A;  3OYD A;  1TVR A;  2G8H A;  3ZT4 A;  4CF9 A;  2D0B A;  1WSH A;  4E19 A;  1RDB A;  3ZSZ A;  4L8R B;  2ZD1 A;  3DRR A;  4EP5 A;  1TK8 A;  4M3Z A;  2RKI A;  3MED A;  4FM2 A;  4CFB A;  3NGZ A;  1R0A A;  3NAE A;  1KLN A;  1QSS A;  2O4G A;  4Z4I A;  1LWF A;  1VSE A;  1L3T A;  4RW7 A;  4CHQ A;  5DMR A;  4UQG A;  1RIL A;  4GVM A;  4DTS A;  2IGI A;  4M3W A;  3DRP A;  1QHT A;  1S1V A;  1VSD A;  1IO2 A;  1NJZ A;  1SL2 A;  1WSG A;  2Z1H A;  1QS4 A;  3OJU A;  2YKM A;  5J2P A;  2XHB A;  3U6F A;  4JS5 A;  4B9L A;  4DTP A;  4CJF A;  1F21 A;  4QAG A;  1RT6 A;  3AVB A;  4E3S A;  1FXX A;  5C25 A;  4CEF A;  2RPI A;  3PX4 A;  1N6Q A;  3SUQ A;  5J2N A;  1JLQ A;  1UOC A;  3OS1 A;  1LW2 A;  2W42 A;  3SYZ A;  3QER A;  2OZS A;  1S1X A;  1QTM A;  2KFZ A;  3HVT A;  4FJX A;  3M8S A;  2DFE A;  1T8E A;  2D0A A;  1I3A A;  2WOM A;  2O4I A;  5E41 A;  3SPY A;  4CF1 A;  4FJM A;  5KI6 A;  3I0S A;  1RNH A;  5K14 A;  3ZSW A;  3V81 A;  3OYF A;  1RCH A;  2FBV A;  4CEB A;  4W5O A;  1LWE A;  3TAN A;  1QE1 A;  4HUG A;  4LH4 A;  1J5O A;  4CF0 A;  4KHN A;  4I7F A;  3AVC A;  1XWL A;  1JXE A;  2YHB A;  4ID5 A;  1L5U A;  3F9K A;  4E7H A;  3O4N A;  4N56 A;  3KLG A;  3OYA A;  3K5L A;  3RR7 A;  2P5G A;  2G8F A;  2NUB A;  3U3G A;  4CIF A;  3O3G A;  4CIE A;  4DQQ A;  1NK8 A;  3M8P A;  4DFJ A;  4OGE A;  3A2F A;  1XC9 A;  1D9D A;  4CJS A;  1KTQ A;  1EKE A;  1FK9 A;  4CJK A;  4KHW A;  3MAQ A;  4ZHR A;  1RTH A;  3MXJ A;  5D3G A;  1S5J A;  1DLO A;  1GOB A;  1VSL A;  3I8D A;  1UA0 A;  1VK0 A;  2HNZ A;  2IC3 A;  1CZB A;  4OVL A;  2OPR A;  3V1R A;  3M8R A;  3VN5 A;  4O4G A;  4IKF A;  1YVU A;  1KFD A;  1HQU A;  4O0J A;  4QCL A;  1Z26 A;  4C8L A;  4BE0 A;  1IKV A;  2QK9 A;  4B8C A;  3SQ1 A;  1FKO A;  3QEP A;  1JL2 A;  1UAX A;  4LSN A;  3VQC A;  2VG6 A;  3AVH A;  5HP1 A;  4B9S A;  1NK7 A;  1N5Y A;  4DQP A;  3ASM A;  3KJV A;  4RW8 A;  4CEZ A;  1JLC A;  2HHQ A;  5J2Q A;  2D0C A;  1T7P A;  3MEG A;  3DLH A;  2B6A A;  1S1W A;  3G0Z A;  2PYJ A;  2GUI A;  2PYL A;  4O55 A;  4CJQ A;  3SQ0 A;  1SL0 A;  3SZ2 A;  3S3M A;  2F96 A;  2Y1J A;  1NK5 A;  1HPZ A;  4HUF A;  4FZX C;  4FLT A;  1NJW A;  1CXU A;  2XRI A;  3WNF A;  1TGO A;  4FM1 A;  4E7K A;  1NKB A;  2HMI A;  3QIO A;  1WNS A;  3D0P A;  1NKC A;  4FJ5 A;  5T7B A;  1G15 A;  1EET A;  1RBS A;  2A1S A;  4CCH A;  3NCI A;  1I39 A;  2IOC A;  2AJQ A;  5FRM A;  3EY1 A;  1YTU A;  3LAK A;  1HNI A;  4DSL A;  3LP2 A;  3CFO A;  3DLB A;  1C0M A;  1D5A A;  2Q3S A;  3DRS A;  4OPJ A;  4FLW A;  5HRO A;  4ELU A;  1U49 A;  4M3T A;  3ZT1 A;  4KO0 A;  2G8W A;  4OKJ A;  2KZM A;  4FJK A;  3NE6 A;  4HCC A;  3KLH A;  2DFF A;  1Q9X A;  3HPH A;  4F2R A;  4CED A;  4CJW A;  4KHQ A;  4FJI A;  4M3R A;  3LPT A;  1JLG A;  1KVC A;  3EZ5 A;  1IKW A;  1O1W A;  1TV6 A;  4Y1D A;  4CJL A;  2KQ2 A;  5FDL A;  4CJT A;  1A5V A;  4TSX A;  2G8K A;  1W9H A;  4CGG A;  2P5O A;  4M3X A;  4GW6 A;  4QOZ B;  3OS2 A;  1UA1 A;  3K5O A;  4MQ3 A;  5KRT A;  1NKE A;  1YT3 A;  3VQE A;  1BIS A;  4DTX A;  5HBM A;  4FLZ A;  1SKR A;  2PY5 A;  2ZE2 A;  4E7J A;  4HCB A;  4KV8 A;  1JL1 A;  4W5T A;  4FJ9 A;  4KI6 A;  3KKR A;  1RTI A;  1SKW A;  2VG7 A;  3AVA A;  1DTQ A;  1S6Q A;  1RTJ A;  3KKS A;  4DF4 A;  1RBR A;  4O44 A;  2YNH A;  3LPU A;  3V4I A;  2LSN A;  4NCA A;  4KKO A;  4AH9 A;  4KTW A;  4CEA A;  5FRO A;  4CHZ A;  3SPZ A;  3MEE A;  4DSJ A;  4Z4F A;  3CG7 A;  4KTQ A;  2FBY A;  1KLM A;  3B6O A;  4O0I A;  2Y1I A;  3LP0 A;  3TWH A;  1U48 A;  4DLE A;  4JRQ A;  3TAB A;  2BAN A;  4LH5 A;  3RRG A;  3DYA A;  1TAU A;  4OGC A;  4FJ8 A;  3TAE A;  3V9U A;  2RN2 A;  3NH1 A;  2X6S A;  1IKX A;  1SL1 A;  3ZSR A;  4NCB A;  2HHV A;  3ZT3 A;  3HYF A;  1EX4 A;  3E01 A;  3QES A;  3B6P A;  5KGW A;  1RBT A;  2XY8 A;  3BDP A;  4EP4 A;  2EHG A;  3ZT0 A;  4B9N A;  3WNH A;  3ULD A;  1BIU A;  3G10 A;  3OYN A;  4FJG A;  4E0D A;  5CY4 A;  1KCF A;  3AA4 A;  3VQ8 A;  4FM0 A;  1BCM A;  1VSH A;  3LAL A;  3AO1 A;  1XHX A;  2B5J A;  1C0T A;  3ZCM A;  3HM9 A;  3QEX A;  1QSL A;  1TKX A;  1VRU A;  3SI6 A;  1JLA A;  3CM5 A;  3I0R A;  3LAM A;  4IG0 A;  3PUF A;  3LWM A;  2KW4 A;  4AHC A;  3IG1 A;  4CES A;  3O3H A;  1L3S A;  4AHR A;  3CFR A;  4F3O A;  3P5J A;  1QSY A;  4CHN A;  3K59 A;  3PO5 A;  1VSM A;  2X6N A;  3PX6 A;  4W5R A;  4J2D A;  2HHS A;  4Z4C A;  4I9L A;  4FLX A;  3RMC A;  4BE2 A;  1U47 A;  1T03 A;  3OYG A;  4Q5V A;  3DLE A;  4KAZ A;  3NH2 A;  3FFI A;  2BE2 A;  3DOK A;  1L3U A;  1RT4 A;  1KVB A;  3DLK A;  3VQ7 A;  2HHW A;  1BL3 A;  1B9D A;  1VSJ A;  4CHO A;  3ITH A;  3P83 D;  1VSF A;  2OPP A;  1CXQ A;  4MFB A;  1ZYQ A;  4FK0 A;  3MEC A;  2ITG A;  1WLJ A;  3WNG A;  3S3O A;  2VWJ A;  5HRP A;  4CJV A;  2JLE A;  1CZ9 A;  1GOC A;  1ZBH A;  3QNO A;  4IDK A;  3F73 A;  3AVI A;  5EU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...