1RT6A

Hiv-1 reverse transcriptase complexed with uc38
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 148
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt6A05
3BSNA 4MFBB 4OVLA 4DF8A 2IAJB 1RT1A 4CF8A 1VSKA 1NNDA 1IG9A 5DLFA 3U6FA 3HYFA 3CDEA 5C25A 5F8IA 4J9LA 4YR3A 4ED6A 3DLHA 3QGHA 1X9SA 1HMVA 1TKTB 3C6TA 3LP1B 4NLTA 1HNIA 1BQMA 1T03B 1KCFA 3EPGA 3KD1E 3VQSA 4QWCA 4J9QA 2G8WA 4WXWA 4DTMA 4Z0UA 1QUVA 4JUZA 1JL1A 1DTQA 4ZP9A 2ZKUA 4IKFA 4DSFA 4O3PA 4B9VA 5KFDA 2D3UA 1SV5A 4ECZA 2UVWA 4MIAA 4J9OA 4K4UA 1T8EA 4IG0A 1C1BB 1WSHA 1FKPA 2Q3SA 3MF5A 4M3YA 2ASDA 1S9EB 3TAEA 3AV9A 4KAZA 3DLGA 1RT2B 2P5OA 3ZSWA 1JLEB 1B9DA 2OPPB 1TKDA 4PUOB 3DLRA 1HQEB 4FJMA 4W5QA 3MTKA 4I9LA 3QGGA 4CIEA 5DG9A 3DRSA 4DS4A 1S1XB 3MEEA 5HLFA 1S1TB 1RTIB 2A1SA 1JKHA 2R7YA 4LQ9A 1XR7A 4CFAA 3GV8B 4UQGA 4BDZA 3HPGA 3OL6A 1JLGA 3P83D 1BI4A 3RBDA 4CF2A 3L2RA 4CFDA 3NKYA 1W0HA 1KLNA 3IAYA 4J9NA 3NF6A 3KKSA 2RKIA 1TK8A 4HYKA 3ZSQA 1W25A 4TQRA 3AVGA 3A2FA 3V9XA 3QEPA 2GBZA 3VQ6A 4NLOA 1D1UA 4DS5A 3RRHA 2HMIB 5J1EB 3M9NB 4CHNA 3FSIA 4GC6A 3HPHA 1LV5A 3P5JA 3NF8A 4DF4A 1ITGA 4IDKB 1JLAB 3DLKB 3LDSA 1LWFA 4K8ZA 3ISNC 1JXEA 1NHVA 4DSIA 5CYMA 4BWMA 1JIHA 3Q8PB 4I2PB 2KFZA 4FJ5A 2O5DA 1S5JA 1ASUA 4KHWA 4CERA 2Z1JA 3WNGA 3OYFA 4ECVA 1SL0A 4MIBA 2D0AA 1KVCA 4GMJB 1ZYQA 3L2VA 3SCXA 4CEQA 2XGPA 3CDUA 5KFEA 3NE6A 2QXFA 5KFLA 1R0AB 4IRCA 5JUMA 4H4MA 3H59A 4ZPAA 5F8NA 1B92A 4EYIB 1YVUA 5L1LA 4I7FB 1D0EA 2D5RA 2R2SA 4F3TA 4C8LA 3V4IA 3ZSOA 3LWLA 3VQ5A 2KQ2A 3DM2A 2F8EX 3QIDA 2X6SA 2W7OA 3HM9A 4IH7A 5J2QA 1RYRA 4CEFA 3V6HA 1RDRA 4KAIA 1S6QB 2KW4A 3NAEA 4IG0B 2ZE2A 3OYHA 4KRFA 4ECYA 4QPXA 2DFEA 4G1QA 2HNZA 4CECA 1BISA 3DLGB 3OY9A 2E6LA 3NCIA 2XY8A 4ZVHA 4FJHA 2R8IA 3HVWA 1KLMA 4URSA 4NRUA 4F4YA 2OPRA 4ELVA 3KMQA 4XO0A 1TL1A 3BQ2A 3HVTB 3N6NA 4F4KA 1T94A 1IKXA 4I2PA 3RMCA 2FLLA 2R8JA 3ZSRA 4CFCA 4RW4B 4LY7A 3KLFB 1IKWB 1NKCA 2JC0A 4O0JA 4NLSA 4RNOA 2BQ3A 2IC3B 3AVIA 3N6LA 2ATQA 4EZ9A 3GV7B 3RB4A 3HSTB 1YTUA 3AVMA 3OJSA 1QS4A 4OLAA 1IKYA 5EWEA 4NYZA 2FVSA 4O3NA 4IFYB 2JC1A 4HCCA 4WE1B 1C0TA 2Z1GA 4F8RA 4KHQA 1JXBA 4M94A 3CJ5A 1Z25A 1FK9B 3AA4A 4ELTA 2AGQA 2WRMA 4E0DA 3VQ8A 4Z4EA 4CF0A 4ZPBA 3PJWA 3ITHB 5HROA 3NGDA 4DEZA 4Q8FA 1S4FA 3KK2B 2J6SA 3K5LA 1ZBHA 2FJVA 3I0RA 1EETA 1L3SA 3DRRB 4MFBA 1C1BA 2JLEA 1YTAA 1NK4A 5JS2A 2B5JA 3KLGA 3V1QA 3MXIA 5JXSA 3VN5A 4KB1A 1TKXA 1EP4B 1RTDA 2XO7A 1G15A 1JLBA 2VG7A 2P51A 3I0SB 4MK9A 3TR8A 5KFNA 3K5MA 4LSLA 2J6UA 2E9ZA 1RTJA 3IRXA 2IM2A 3KKRA 5KRTA 2AU0A 2HAIA 2G8KA 1N56A 3UIQA 4CJ5A 3HL8A 4OLBA 2EHGA 2FBVA 1DTQB 3KLFA 3GILA 3SJJA 3DM2B 3OS0A 2VA2A 2XY7A 4K50A 3PW0A 3VA3A 3S3OA 3BR9A 2JEJA 4KV8A 1IKYB 3V81A 4I2QA 4K4YA 2RPIA 3QNOA 3SNNA 1KVAA 1BCMA 1S9EA 5KFYA 5T14A 2FBTA 4ID5A 1U09A 5J2PB 1S0OA 5CYQA 4DL6A 3I8DA 1RT1B 4NLVA 3B6PA 3VQCA 5L9XA 4KHRA 2D0CA 4DTUA 3OL9A 3QINA 4NZ0A 4G3IA 4JLHA 1S1XA 1KLMB 4OGCA 4DU3A 4KB0A 4NYFA 4EP4A 4ZVEA 1S10A 3I0RB 1TKTA 1NJXA 1O1WA 3E01B 2FBXA 2LSNA 4OKKA 5I42A 1BI4B 1HRHA 2B5JB 1S1UA 5I3UB 4CE9A 4C8KA 4FZZA 2W9BA 3V9WA 3QZ8A 3PUFA 3VQPA 2FJWA 4GW6A 1RDBA 3HVRA 2RF2B 3AA5X 3OSNA 3EZUA 1K6YA 3LP0A 4O5BA 4IRDA 4DL2A 3GIJA 3RAQA 4H4OA 1SH2A 4KHNA 2QE5A 1QAJA 1JLQB 4DL5A 5KT4A 4FJ9A 4R8UB 1QTMA 3TANA 1HARA 1RDDA 4CF1A 4Y1CA 4F2RA 3L2QA 4CGGA 4JV2A 3Q8RB 5F9LA 4Z4HA 3JYTB 3SUQA 4M3RA 1GOBA 4CHOA 3V4IB 1RTHB 1B9FA 4Q5VA 3F73A 1S0NA 5KFOA 2DTUA 4F4WA 4FK0A 3WNFA 1N48A 3RRGA 3KHGA 1OS5A 4E7LA 4DQIA 3I5CA 2W42A 2D7SA 5DQIA 4FLWA 1RT4A 4FJIA 3LANA 4I2QB 4J2EA 4DSJA 3OSPA 2O4IA 3BQ1A 3OS1A 3DOLB 1VK0A 3QGIA 2C28A 2C22A 5KFZA 4HVJA 1GX5A 1CSJA 5C5JA 3THVA 3RB6A 3CQ8A 4L8RB 3M8QB 3BREA 3CG7A 2DY4A 1JLFB 4IFVA 4B8AB 4ZMMA 4BDYA 1RDCA 3KNAA 1XC9A 3L3VA 1RDAA 3TAPA 2GIQA 2IMWP 3BQ0A 1RTJB 3QIPB 4CGIA 4O44A 4FJNA 3KK1B 1A5VA 4KKOB 5D3GB 4Q43A 4HCBA 1F21A 4FLXA 2XI2A 5J1EA 1S9GA 4KSEB 4J9PA 4KHYA 5F8GA 3LAKA 4WFXA 1JLAA 1S6QA 4ED1A 1VSFA 4R8UA 4CJSA 4DSLA 4R5PA 3AVBA 3SI6A 4E7KA 2G8VA 4KHSA 4FJXA 1HQUA 1BQNB 1UA1A 3JYTA 3V6KA 4DTXA 5KFWA 3KK3B 3L2WA 2WK4A 3OYMA 3HVAA 2KTQA 2GC8A 5HRSA 4IQXA 2OPRB 2IBKA 3RWUA 3QEVA 2ALZA 1HMVB 5L1KA 3GIIA 5KG7A 4ZP8A 3T1AA 3UPFA 4B08A 4TY9A 3AA3A 4CGDA 1QSSA 4E7IA 5KFHA 4QWEA 4WXOA 2QKBA 5I42B 4MKAA 4I7FA 1S1UB 5I3UA 2OPSA 1RILA 5CZ2A 1YT3A 3MR5A 4AH9A 1RT3A 2BANA 3NHGA 1JLFA 3PO5A 1RNHA 2HHXA 2J6TA 2XCAA 4CCHA 2GIRA 5HRNA 4LH5A 1C0TB 3NBPB 4CHZA 3OYKA 4K4VA 3HHKA 2OPQA 5KFRA 3CFOA 4W5NA 4CJ4A 4NCAA 3KK1A 2W8LA 4N56A 1RT2A 3ISND 4ZHRA 1RTHA 3MEDB 2OZSA 5HROB 5F8HA 1UAXA 3LP2B 5KG2A 2DFFA 1ZBLA 1EETB 4KTWA 4FJKA 3CVKA 2B43A 4WZQA 1BIZA 2YNGA 3QO9B 3OYCA 3D45A 4J9KA 1JLCB 1HPZA 2ITGA 3AVCA 5CY4A 3M8PA 2W9CB 1TKXB 1RTDB 1GX6A 1QQCA 5DLGA 1NK8A 4URGA 3LP3A 4KFBA 3H5SA 1VSIA 4DU1A 3HT3A 2XY5A 2I5JA 4CJKA 3DDKA 5HRPA 1ASVA 4JS5A 4ID1A 2YNHA 3NMAA 4KTZA 4FLYA 4RW8A 3KLHB 4X2BA 2YNIB 1L3VA 4KI4A 1ZETA 4HKQA 3MR3A 3DRPB 4FJ8A 4WE1A 3LAMA 4B9SA 4Q0BA 2ILZA 4MKBA 2FJXA 5T7BA 3O4QA 3ZCMA 3MAQA 3VQ9A 4NLPA 5KG6A 1BCOA 4K4XA 2RDJA 5FRNA 2WOMB 3C95A 3ASMA 4DG1B 2VG6B 5FDLA 1KFSA 2HNYB 3D0PA 3KK2A 3KLEB 1N5YA 4MQ3A 3PX0A 4PWDA 2IM0A 4W5OA 1ZBIA 4YP3A 2AQ4A 3OYLA 5KRSA 4CJVA 1HQUB 3KLGB 4QWAA 4FLVA 3DMJA 3V9UA 4YFUA 5C25B 3MEDA 5HBMA 3RMAA 4LH4A 4DLEA 3SV4A 3RTVA 2I1RA 4EBDA 1DLOB 1TV6B 3G6VA 2HHWA 3OYDA 3H5XA 4CHQA 4M3TA 3C6TB 3H5YA 3UDLA 4FXDA 4PY5A 1VRTA 3RR7A 1X9WA 3KLIA 2VG5A 4LSNB 4U6PA 5DQHA 4ICLA 1KTQA 2WONA 3K58A 4KHUA 4E7HA 4JS4A 4O3OA 1LAWA 4KE5A 1U04A 5FRMA 4CJWA 3OYNA 4AHUA 3LWMA 4FM0A 3PX4A 4FW1A 2YV0X 2W9AA 2ZD1A 4CEEA 4MK8A 4CESA 1FKPB 3KD5E 1TK5A 2XRIA 1VRUA 4N41A 4OGEA 3KMSA 1TAUA 5KT3A 2OYQA 2NUBA 3T19A 4O4GA 3NH0A 1SL1A 3ALYA 3ZT2A 4DTJA 3FFIA 1D5AA 4TSXA 4EEYA 3K57A 1S0MA 1JKHB 2KFNA 3HVTA 2RN2A 4CJUA 4XPEA 3QEXA 4QW9A 1A5XA 1N5YB 1RT5B 3M8PB 2E9RX 3DI6B 4FJJA 4DFJA 4RW4A 1BGXT 3DYAA 1BQNA 3OYBA 1C0UA 5KGWA 4KO0B 5KTQA 1CZBA 4E1MA 3DMJB 2X74A 3SUNA 1FKOA 1TKZB 2FC0A 2RKIB 1L5UA 5HBMB 4RU9A 1D9DA 3GQCA 4ECWA 3MXMA 1T3NA 3CO9A 5F8MA 5KG0A 3CJ3A 1BQMB 2BQUA 4H54A 3IGVA 3SQ1A 1TQLA 2HMIA 2ASJA 4AHCA 1LW2A 1RBTA 3VQEA 2X78A 5C42A 5DG8A 3PZPA 4K4TA 1Q9YA 3KHHA 4ED3A 1ZTTA 4CF9A 4EO6A 4K4SA 5DMRA 4QCLA 4JRQA 1N6QA 2EX3A 3DLEA 1WSGA 1KVBA 3V6JA 5JS1A 2O4GA 4CJTA 1WSJA 3OLBA 3PJXA 2HNYA 2QKKA 4R5PB 2F96A 3O3FA 3K5NA 4RUCA 3AO4A 1ZBUA 4PWDB 3MR2A 1C1AA 4DFPA 1BL3A 3ZT4A 4DL3A 1X1PA 3KK3A 4ED7A 3SQ4A 4E7JA 5L1IA 3OHBA 4ELUA 4CJRA 5KGXA 2YNFA 3BSAA 1SH3A 4IRKA 4F2SA 3ZSYA 3LP2A 2RDIA 2UVUA 2Z1HA 4FLZA 1TV6A 2OH2A 2WB4A 3KIOA 3SV3A 4J2BA 4M3UA 3HPOA 3SI8A 3AVHA 3QO9A 4M95A 1RBSA 3IRXB 4W5RA 3CWJA 1JL2A 3FRZA 3NGIA 4ECTA 2E6MA 5EWFA 4ECUA 4BE0A 2CKWA 1T05B 4GC7A 4KO0A 5KFQA 3MFHA 5DGAA 3JSMB 1J5OA 4TN2A 2XI3A 4FS2A 4RW8B 4DTRA 4Z4GA 2YNIA 3PR5B 1VSEA 2Y1IA 4OJRA 3AVJA 4XPCA 3EY1A 2W7PA 5KFKA 1IKVA 4EP5A 3CJ4A 4DLGA 3M8SA 4ED0A 5CYQB 4JV0A 3P1GA 2AX1A 4RNHA 1MMLA 3HJFA 4FBTA 4ZVGA 5DG7A 1SH0A 2D41A 3GV5B 2HB5A 4OKJA 4DQRA 3MEEB 4ECSA 5HLFB 1S1TA 4ZTFA 3PR4A 4W5TA 5KT7A 1QSYA 2ILYA 2Z1IA 1HPZB 5KFTA 3I5AA 2HHSA 3SQ0A 1IKXB 4TXSA 4WYWA 1EX4A 3O3GA 1WN7A 4M3ZA 1NHUA 4CEAA 2HVHA 5KFJA 1VSDA 2BR0A 1WNSA 5HP1B 1IKWA 2R8HA 5E41A 4FCYA 2IC3A 2D0BA 5DK5A 2YNHB 4CFBA 4N47A 1TKZA 2E9TA 3AO1A 4H4OB 1NKEA 4URQU 3UR0A 3S3NA 4AHVA 4YNQA 3FQKA 4DQQA 4LD0A 3ZT3A 3OHAA 4CJEA 4TY8A 1NK9A 5KT2A 1VRTB 3PY8A 1R0AA 4M41A 1D8YA 2FVQA 2OPQB 2VG5B 1C0MA 3AVAA 4OPKA 4F4ZA 2PYLA 4PQUB 4WYLA 2G8IA 3D28A 5KFSA 3FDSA 4R0EA 1T05A 4IDKA 4Q44A 3ICLA 5KFIA 3OS2A 3PX6A 4IG3B 2EC0A 4Y2CA 3KLVA 4WFZA 1J9AA 1SV5B 3TABA 2B6AB 3KLEA 1XI1A 2GUIA 1S1VB 1NK6A 1TP7A 4QWDA 3N6MA 3M8RA 4NLXA 4ECQA 4JV1A 3HP9A 3SPYA 4CEBA 1XHXA 3L8BA 1SUQB 3NGYA 3H98A 3I5BA 1TK0A 2WTFA 4C8MA 1EP4A 3G6XA 3PW7A 2XC9A 4NCBA 1NJZA 3QLHA 3VA0A 3TAMB 1WSIA 3U3YA 1Z4UA 4HUEA 3GYNA 2VWKA 4CEZA 2FBYA 3DRSB 4HHTA 3NH1A 5KFFA 4AHRA 5KFGA 3KLHA 3ZSZA 3TAQA 3KLIB 5KFAA 4HUGA 3CDWA 1WSEA 4LSNA 4O3QA 4CJ3A 3DYAB 4CHPA 4I9QA 1I3AA 1IH7A 1QAIA 2GV9A 4RNNA 2VA3A 3DOKB 5SWMA 2FVPA 3Q8SB 4DU4A 4Q8EA 5J2QB 4NCGB 1ZBFA 3OJUA 1J5OB 3TWHA 5KT6A 2UUWA 4GVMA 4DFKA 3V1RA 4CJFA 2HWHA 1SKWA 4J2DA 1RAJA 4KV8B 3M9OB 4KI6A 4B9LA 4G1QB 1DTTB 4TY8B 4RNMA 2ETJA 2R2RA 4ZVFA 1GOCA 4FLUA 2G8HA 4J9SA 5KFXA 4O4GB 1IM4A 1UWBB 3AO2A 1Q8IA 3H2LA 2CJQA 5F9NA 4NLDA 1LWFB 4NLWA 4ZPCA 1TVRB 3O4NA 1DLOA 4QOZB 4FW2A 1NK7A 1RT6B 1KHVA 3GIKA 2FVRA 4CGFA 1TL3A 4O0IA 4B3OB 4K4WA 3VQBA 4EZ6A 1A5WA 1KSPA 4XIUA 4B8CA 4RW6A 4AILC 4ED8A 3IN5A 1C2PA 5HP1A 2OPSB 2W9BB 2QK9A 2YKNA 1RT7B 4ICLB 4FZXC 2YNFB 2AGOA 2RF2A 3QLHB 3T5JA 4YQWA 4BE2A 3SUPA 3V1OA 3SQ2A 2AX0A 1WAFA 4CEDA 2HWIA 3SZ2A 4BACA 2WHOA 4FVMA 2JEGA 3I0SA 2XHBA 1WAJA 1HYZA 4O55A 3QNNA 4YMEA 3OYEA 4NLUA 2XY6A 4FK4A 3H4DA 4PQUA 4DMNA 2BRKA 5SZTA 4EYHB 1Z26A 4KB7A 4AHTA 4IR1A 4DTNA 4Y1DA 4KBIA 1I6JA 2BDPA 3LZJA 5K14B 3AVKA 2YHBA 4NCGA 3PV8A 2HW3A 1HNVB 2JGUA 3NH2A 4B9NA 3DRRA 5EU7A 2YNGB 3K59A 2ZE2B 4HUFA 4J9RA 3OLAA 2HNZB 3SFUA 5KFMA 2OZMA 4N5SA 2BGGA 4ECXA 2AWZA 3CM6A 4C8OA 3V9SA 3NAIA 1JLBB 4DQPA 2KZMA 3IS9B 3TVKA 2IA6A 5EUHA 1UWBA 4PA1A 1HQEA 1REVA 1FKOB 3PW4A 3G6YA 4RW9A 1C6VA 3G86A 4CJQA 2BE2B 3MEGA 4E3SA 3E51A 3AA2A 4E89A 3QIPA 4CK1A 1KHWA 4DFMA 3DRPA 3E01A 3HO1A 3RBEA 4B3OA 1JLGB 2HHUA 4QW8A 4Y3CA 1TGOA 5C42B 1RYSA 3JSMA 4M3WA 2YKNB 4NLYA 1S97A 2WOMA 5KFUA 2YHAA 1IO2A 3OL8A 1N6QB 5FDLB 3QESA 2F8TA 1K1QA 1S1WB 2IDOA 3H08A 4IH5A 4F4XA 1DTTA 4FJ7A 3LPUA 1S49A 4Q45A 5J2PA 4BDPA 5FROA 4OL8A 1NKBA 2P1JA 2X6NA 4DTSA 1QE1A 1ASWA 3ZT0A 1T7PA 5J2NB 4JRPA 3TAGA 2QV6A 1L3TA 1NJYA 4ZTJA 2V4RA 1RA7A 1QHTA 1TVRA 1U45A 4KHMA 3ZT1A 3OVNA 4OKEA 2OA8A 2IAJA 3OL7A 3CM5A 1RT4B 4KREA 3AVNA 2F8SA 1JX4A 3L3UA 4KTQA 1TAQA 4J9MA 3QEWA 4B9TA 4RW6B 1S48A 1UA0A 3RMDA 4Z4FA 2WONB 2XGQA 3VQ4A 3FQLA 3LP0B 2JEIA 1RT7A 3TAMA 4FBUA 3H5UA 2BANB 1VSJA 1BIUA 1BHLA 3M8QA 2IJFA 4J2AA 1LW0B 1WSFA 3VQDA 1J53A 2XCPA 1N4LA 2IGIA 2C2EA 1T03A 2UUTA 1XHZA 1U49A 1CZ9A 1KFDA 2Y1JA 3S3MA 3MR6A 4H4MB 3CFPA 3OYGA 5F8LA 4DTOA 3RMBA 1RA6A 2R8KA 4CIFA 3DOKA 5D3GA 3KTQA 3K2PA 2HHQA 5KFVA 2FLNA 3ULDA 1C1CA 5F8JA 1WLJA 1D9FA 3BSCA 3NDKA 5C24A 3FFIB 4QWBA 4RUAA 5HRRA 1EXQA 1HJRA 1RBVA 3HXMA 3C6UB 3T5LA 1S1WA 3RB3A 3CIZA 1RT5A 1Y97A 3PHEA 3CFRA 3F9KA 4IOBA 3G0ZA 1NK5A 3ZSXA 1LWCA 3KOAA 1MU2A 1W9HA 4Z4IA 3C94A 2I5JB 4B9MA 2C2RA 4CK3A 4FLTA 1QE1B 3IG1B 1Q9XA 3RAXA 5J2NA 1REVB 5EDWA 5DGBA 4NLQA 3T5HA 3WNEA 4AHSA 3SUOA 1LWEB 3OYAA 1HYSA 2YKMA 2PYJA 3NF9A 5KT5A 4E19A 4F3OA 4CHYA 4TYAA 3QERA 3QZ7A 2DPJA 1LW2B 4FJGA 4ZP6A 2ASLA 3EZ5A 5J2MB 3V6DA 3HKWA 3PVXA 2IM1A 4MK7A 4M42A 3U3GA 1HYVA 3HP6A 1S6PA 4RW7B 1SKSA 3DLEB 4B9UA 4DG1A 1JLQA 5KFBA 4M45A 2V9WA 2VG6A 1S9FA 4H8KA 2KZZA 4TYBA 1LW0A 3BDPA 4ECRA 2B6AA 4U7CA 1NOZA 3NBPA 2HNDA 3ZSVA 4K8XA 3QIOA 3NAHA 1EKEA 3DLBA 1LAVA 2P5GA 3T5KA 1FK9A 3NGZA 3EPIA 4CJPA 1YVFA 2FVCA 4ZHRB 3DLKA 4RNFA 2UVRA 1JLEA 4EBCA 1CLQA 3OYIA 3TI0A 5KG3A 5CYMB 3EYZA 1U48A 3AVFA 5C24B 1XR6A 3RB0A 3LP1A 4DL7A 5KFCA 1TL3B 4WFYA 3TAFA 1RBRA 1RCHA 2DFHA 2G8FA 1WNEA 3LPTA 3NFAA 1K1SA 1GOAA 4ZPDA 3IS9A 3HK2A 1RT3B 2W8KA 1MU2B 3L2UA 3MECA 4CJLA 3Q8QB 4ED2A 1X9MA 2IJNA 5KG5A 1VSMA 4KPYA 1ZTWA 3VQAA 1VSHA 1SL2A 4IR9A 2BE2A 3MEGB 2IM3A 2BQRA 4LSLB 4NYNA 3O3HA 2PY5A 4N76A 4CGJA 1RBUA 4CIGA 4WZMA 4NRTA 4O44B 1HYSB 1UOCA 4C8NA 4FK2A 3BGRB 1L3UA 2A1RA 4Q0BB 3H40A 1KRPA 4O4RA 5CZ1A 2V4QA 2HHTA 2V0NA 4DSKA 3NL0A 1S9GB 5J2MA 3V6DB 2OPPA 3BSOA 1NOYA 2UVVA 4PUOA 1HNVA 3BJYA 3KJVB 3AVLA 1RTIA 3PW5A 3V81B 4FJLA 4DTPA 1JXLA 1CXUA 4FS1A 2AGPA 4KFBB 2HNDB 3AO3A 4RZRA 1LWCB 3OYJA 3GIMA 5DQGA 4BE1A 3CJ0A 3IG1A 4RW9B 1I39A 2XWYA 4ZP7A 1LWEA 3LZIA 1HNIB 4IKAA 2ATLA 1FXXA 2YKMB 3TQ1A 2DPIA 2C2DA 3SFGA 4MH8A 3IGNA 3MXJA 5EWGA 3WNHA 2ZQBA 3VQ7A 5KI6A 4Z4CA 2JEFA 4BWJA 5L1JA 2IS3A 2AJQA 1S6PB 3SYZA 4IG3A 4FYDA 2G8UA 3MECB 5KG1A 3QYYA 3B6OA 5K14A 3VQQA 4IFYA 3PO4A 4Y2AA 1S1VA 5KG4A 5KFPA 1U47A 1SKRA 3S9HA 4EBEA 4LQ3A 4OPJA 1SUQA 1XWLA 4QAGA 4K4ZA 4YR2A 3BGRA 2R8GA 3QEIA 2E4LA 4DSEA 4HTUA 4YR0A 3ITHA 2D3ZA 3RR8A 3KHLA 3KHRA 4TLRA 4CK2A 4DWIA 1CXQA 3D5MA 3TARA 1NJWA 4M3XA 1VSLA 2PZSA 3UQSA 1JLCA 3H4BA 3CJ2A 3QETA 4Y34A 3G10A 2W9CA 3DOLA 3NF7A 4DQSA 4IH6A 3T3FA 3DI6A 4F50A 4NLRA 2VG7B 3LALA 4O3SA 1C0UB 2BRLA 3MFIA 4E1NA 4TQSA 4IFVB 1NK0A 4CEOA 3AO5A 2ZD1B 2WCXA 3SPZA 2IOCA 2HHVA 2HVIA 3V9ZA 1VRUB 3PW2A 1XR5A 3M9MB 4IBNA 3CYMA 1IKVB 2B4JA 1J54A 4KKOA 3K5OA 1U4BA 4FZYA 2VWJA 4RG8A 4DL4A 1C1CB 2FLPA 4RW7A 4FM2A 4NLGA 3KJVA 4O3RA 4FM1A 4CGHA 1QSLA 2R2TA 1TL1B 4EO8A 3C6UA 1RT6A 2R2UA 4ID5B
chains in the Genus database with same CATH superfamily
3BSNA 4MFBB 1BOTO 4M5KA 3CCLN 2F65A 3JAMY 2VU5A 3PNIA 2GVZB 4K7QA 5C25A 1GFWB 4J9LA 4BR5A 2PSZA 3I31A 2OTJN 1S79A 4G65A 1TKTB 5M2PA 1BQMA 1S0VA 2UP1A 1H73A 4EWTA 3H25A 4NOHA 3EX7B 3LOUA 4V19J 5IT9O 2A40A 2VICA 1DTQA 1UZHA 3SK3A 4IKFA 4DSFA 4CYUA 3AODA 3ZETA 2QGFB 4PKIA 1SV5A 3RYLA 1E6YB 1S72N 2CQPA 2CJXB 1C1BB 3Q23A 1WSHA 3BEGB 1FKPA 2Q3SA 1URNA 2J7KA 2P9IA 2OFHX 4B3MK 3K7RA 1S9EB 3TAEA 3PIPL 3DLGA 4C0OC 3M6WA 4H5WA 2HFUA 3SMZA 1VBYA 4ZVSB 4USKA 4WTOB 2ZWOA 4JI1J 2O8FA 4CZHA 2YXLA 1TL5A 4CIEA 4DS4A 3DRSA 2HBYB 4DR3F 1RWKB 5HLFA 1S1TB 1YJ7A 3TNVA 1VK3A 2DNYA 3GU0A 2IYIA 2LXUA 2JZ5A 5BYQA 3VESA 4BDZA 1RWUA 3P39A 4PG5A 5ETNA 3RBDA 3MDQA 1SB6A 4CF2A 4RU2A 4CFDA 3NKYA 5IV3A 1HWIA 2VQEJ 2OEKA 3IAYA 3NF6A 3KKSA 3CGIA 1WOSA 4YEAA 4JI8F 4HYKA 3QRQA 4NA1A 4ENOA 3TZZA 1WKKA 4TQRA 3AVGA 3A2FA 4ZVPB 3SXLA 3FNNA 4W92B 1D1UA 3TR5A 2QFIA 2RQMA 5HI7A 1NGEA 4LF4F 2XYPB 4B3MJ 4CHNA 1FRXA 4ZIVA 5I3QA 2MZRA 3VEYA 3W2WB 4TU9A 3EJMA 3LDSA 1UL3A 3L09A 1XTZA 3BH6B 4CI6A 2N4CA 1JIHA 3Q8PB 3MOZA 1FDAA 2NXNA 4LFAK 4FJ5A 2CQBA 2KXFA 1NGCA 4X4PA 1S5JA 4FL9A 4CERA 2G2OA 2Z1JA 4H5TA 3OYFA 3NEKA 3LGMA 2DR9A 1U1NA 4NYPA 2VKZG 4GKKK 3BBFA 4GMJB 4KIAA 2QJ3A 1AYEA 3SCXA 3G2XA 3CDUA 2QXFA 1R0AB 1IQTA 1R8HA 2JWNA 1N34J 2GA7A 2R7XA 3NCRA 1D0EA 3CJ9A 4DZDA 3FGVA 2VASA 3JAMU 2D5RA 1ZA1B 1G6BA 3HBTA 6FD1A 4JBCA 2QWRA 3DM2A 4AXJA 1WG5A 4IH7A 4DUYK 4CEFA 3V6HA 2DEIA 3VGKA 4KAIA 1UEKA 1NJIT 3NAEA 4OLOA 4IG0B 4DV1K 3OYHA 4R79A 1BC6A 1ZAWA 2HEKA 1RXOB 4ECYA 1IBLK 2LDYA 5CR4A 2DFEA 2UXCJ 3THWA 3CCRS 2X1BA 2KHCA 3D1QA 4M5IA 1KBRA 3ZO7A 2XY8A 4ZVHA 2F4VF 4FJHA 3QSYB 2R8IA 1S99A 4BR2A 4IOXA 5AQPA 4CTAB 5BRFA 2OPRA 4ELVA 3KMQA 4XO0A 1N32J 3OW2R 4F4KA 1VQPS 4TVAB 4RW4B 4LY7A 3TEHB 1LOTB 3KLFB 1IKWB 3SBGA 5D4NA 2UXDJ 3UVJB 3A0IX 2VV5A 1F1BB 5H9EK 2RHKA 4BG8A 2ATQA 2H3EB 5A2QY 3RB4A 1VQ8S 1IKYA 2DYAA 1KVIA 3GMGA 3OW2M 2FVSA 1K73O 1HL6A 1FEHA 2Z1GA 1VC0A 1Z25A 5D0RA 1OPIA 2UXCK 4DR5J 3FVYA 4E0DA 3PJWA 4Z2XA 2ASYA 4JYAF 2LQ8A 3KK2B 2J6SA 1ZBHA 2FJVA 3I0RA 1TL7B 2OELA 1FA0A 4MFBA 3MN5A 2JLEA 2VGMA 1VQPN 1IG8A 3KUGA 4OJ1A 1EP4B 5E2QA 5AQWA 2CPYA 1G15A 4FKXA 1P9YA 1JLBA 1YJTA 2VG7A 4WQ4C 3TO8A 3R7NB 3D2FA 2BOPA 1S7HA 5JLFA 3K5MA 3J81U 4LSLA 4OYZA 1SIZA 2E9ZA 2C42A 2IM2A 1N56A 2C3MA 4NA3A 4A8YA 2D3O1 4I4BA 4DPYA 4DR6F 4K50A 3H3OB 3VWSA 3ID6A 3VA3A 3S3OA 3BR9A 2CPJA 2RUSA 2V2KA 3E66A 1BCMA 1S9EA 2EG1A 3NXZA 3OVBA 5T14A 1U09A 2FBTA 5J2PB 2XQCA 5CYQA 1SJRA 2ALYB 1VQNN 4X64F 5JMNA 2MY7A 1OPZA 3OL9A 5TKYA 1HNZK 4OGCA 2WUSA 1ZM2A 1VQ9S 5A6PA 4ZVEA 2RVJA 3TSUA 3FMWA 3QPIA 4MTPA 2DY9A 5HJYA 1O1WA 3E01B 3W65A 2MZ1A 4FPAA 4I6YA 4U96A 2CFXA 2XHWA 3A5LC 2XLKA 3NGTA 5HOOA 5I3UB 5AJ3F 4CE9A 2VFTA 1GH8A 3FEZA 4GW6A 1RDBA 5JVGQ 1WJ9A 5C2CA 2QMUB 4RWWA 4IRDA 4H4OA 1SH2A 1P90A 1LK7A 3SCLE 1JLQB 4R8UB 4OHVA 1WF2A 4CO1A 3TANA 1HARA 3UDEA 4CF1A 3PKYA 4JV2A 5F9LA 2ASOA 1DQAA 3AOAA 1GLCG 2JVRA 1YJNS 3MM8B 2R7QA 4EFAC 4CHOA 4G9ZA 1VQKN 3L7OA 5KFOA 3UNYA 3GCXP 4Y2KA 4E7LA 1OS5A 2W42A 2RS8A 3R7SB 4FLWA 1FE0A 2WVFA 3LANA 4NYOA 3OSPA 3C6HA 1VQON 1WSVA 3BPSP 4ZDNA 3QGIA 1K73T 2E2QA 5AQXA 5AQJA 2WAQD 3J80Y 4BRDA 1V5VA 3RAMA 2DY4A 3CG7A 1U8WA 1JLFB 4IFVA 4DV6F 4ZMMA 1VIXA 1GMVA 4HACA 2KLAA 3TZXA 1XC9A 1VBKA 1R59O 3L3VA 2IMWP 4KGMA 4BROA 2L48A 2MGZB 2HIYA 1RTJB 3UE2A 1GXTA 2COLA 4Z94A 4BR9A 4USJC 1KXPA 4WWSA 2ZBQA 3BY5A 4ZJOA 3ZYYX 2BJ7A 2H5EA 1F21A 1O51A 2XI2A 5TKWA 4J9PA 3EZWA 2XEXA 3J7AN 5F8GA 1WD6A 4F0MA 4IEEA 5HMXA 3MMBB 4XDDA 1H72C 3UB5A 4R5PA 4X66F 2HHHJ 4M5HA 2DXDA 3JYTA 2W2QP 4V19S 1DAXA 2WK4A 2FHOB 2VYPA 1SC3B 5HRSA 3PKMA 2Z0GA 4IQXA 2OPRB 3MMVA 3QEVA 2XM3A 4K43A 4ZP8A 3Q89A 3T1AA 4DV5F 3HMJG 3QT5A 3O9RA 1HR0K 3UDCA 4QWEA 2B9XA 2ZDPA 2L41A 2QKBA 5I42B 1YGYA 2OPSA 5CZ2A 5D0EA 3DOMA 3FJ2A 2Q97A 3W66A 2IPOB 2BANA 1RQ0A 2E5IA 2HIQA 5GADU 1P1LA 3C19A 2GIRA 5HRNA 4CHZA 3HHKA 2OPQA 2KM8C 2XG8A 4QS9A 4N56A 4NXNK 2VPWB 2KDOA 1RTHA 2V7ZA 3TPQA 4CT8A 2WBRA 3U9DA 3LP2B 4YY3F 5KG2A 5D0GA 2KVIA 4B1YB 1F2HA 3J80O 2DFFA 1WHYA 3IKMA 4KTWA 4FJKA 1EKRA 3ZTRA 3LM9A 3D45A 3N4QA 2ITGA 8RUCA 2W9CB 5DLGA 1NK8A 4GKJJ 4KFBA 2YKAA 1KS2A 4BR7A 3DXKB 5T41A 3O8WA 3HT3A 3NVKA 4NEZA 4JS5A 3VAHA 3K89A 4O8KA 2QM1A 1GTEA 2B7CB 3C6AA 3LF0A 2IVOA 3M6GA 3RUBL 2YNIB 4DUZJ 2FIUA 3B8AX 3UN2A 2V8VA 2EFQA 4WE1A 3LAMA 5H9FJ 4B9SA 2NS1B 3MAQA 2LQBA 2Q0RA 2QL9B 1ZAVA 2DNNA 2ZH1A 4GV6A 4IYQA 3C95A 3BO2A 4ER8A 3CJAA 4A8OA 3T1YJ 2GFFA 5FDLA 1KFSA 3CCQS 4I68A 2MKYA 4MLHA 2P9SB 1IJJA 4LFAJ 4W5OA 2QO3A 2PMHA 4B9QA 2AQ4A 1FNXH 5HAOA 1GLEG 3O4WA 5KRSA 4CJVA 1HQUB 2H51B 4JHDB 3ENAA 4NLBA 5GADI 4CZGA 4YFUA 5C25B 3RMAA 3MCAB 4LH4A 1SPBP 4FPBA 2OI2A 4EBDA 2I1RA 1OJ4A 2CPZA 3A8JA 5E84A 2HHWA 2HLUA 2VPXB 3EDRB 5IWAJ 3SCIE 3UDLA 4FXDA 3VAKA 4PY5A 4DHYA 1VRTA 1KTVA 3RR7A 4W90B 1HKGA 1HNWF 4WP9A 3A12A 2V9KA 1W2BR 1LEOA 1YRTA 5BRHA 1EZZB 3M6VA 2CPFA 1KTQA 4WK1A 4WBFA 2V8HA 4ZCLA 4JS4A 1LAWA 4KE5A 2YX6A 1U04A 4FM0A 3D0GE 3H0PA 2I2YA 1LXJA 3G96A 3C46A 1APSA 4B3SJ 3OTBA 5D78A 2B8PA 4MK8A 4CESA 2PEHA 3VGVA 4ILRA 3R3LA 1YBTA 2P9GA 2QLXA 1TAUA 2B51A 2PFDA 5KT3A 2OYQA 1CVJA 3HT0A 1SL1A 3SSQA 3ZT2A 5AQZA 5BRDA 2YWKA 4HL9A 3WXMB 3J7ZT 4P10A 4TSXA 1GMUA 1AA1B 3K57A 2CUYA 4HTIA 2MEWA 1AUSL 3QEXA 2E2OA 3ILLA 2BJ1A 3I56S 4FWQA 4FJJA 4RW4A 3DYAA 3OYBA 3AT1B 3DMJB 1K44A 1Z2ZA 3I87A 4X4NA 2IIRA 1TKZB 2FC0A 3CJRA 5HBMB 3GQCA 3TUZC 4ECWA 4QS7A 2V67A 1N5TA 3C15B 2ZOGA 1TFWA 1QAYA 1BQMB 2MKKA 5ITHA 3AH6A 3IGVA 5B0GA 1KD1O 1FERA 5DG8A 2CPEA 2Y1RI 4ED3A 3RJMB 4K4SA 5A2QO 1U6BA 5DMRA 4QCLA 3WHIA 3D3CJ 5F1XA 3DLEA 5ETTA 1N36K 4B1WB 2O4GA 2Z57B 3CUNA 4NMXA 2ZBIA 3OLBA 2HNYA 3DAWA 2F96A 3AO4A 2HRYA 4YHHJ 1HNWK 1Q7LB 4HTJA 2NRRA 4U9RA 4AL5A 1VQKS 4DL3A 3GCWP 2DIUA 4ED7A 4KH4A 4E7JA 5KGXA 1SH3A 4IRKA 4F2SA 3ZSYA 1FE4A 4V19X 3LP2A 4FLZA 3SV3A 4J2BA 3QO9A 1U8SA 2KYXA 2QZ8A 2DIVA 3IRXB 2QEXN 5ADZA 2HQDA 1JL2A 3FRZA 2HZAA 4LF8J 4NX9A 5AXNA 3VF0B 2Z2YB 4GC7A 3VETA 2XZTB 1OKJA 4RBVA 5DGAA 4K0KF 3OTEA 2XI3A 2V63A 1EWRA 2P9LB 2YNIA 4FWOA 3CCUN 2QLBB 4NA2A 4HH1A 3PR5B 4BVOA 3SAGA 2Y1IA 2OEJA 4EP5A 3W2VB 4YB1P 4ED0A 1FHTA 2JH3A 5BYRA 3D0IE 5DG7A 4A57A 2XS2A 5ETQA 3QMQA 3GV5B 4DQRA 3MEEB 4ZTFA 2UYTA 1PIEA 5F41A 4OZ3A 4C98A 4OYMA 2HHSA 2J0XA 3AJ2A 4JKBA 2AJ1A 4M3ZA 4C9DA 2QEXS 1VSDA 1WNSA 4PHTX 3MMAB 5HP1B 5DRKA 2R8HA 2IC3A 4Y0WA 2CQ1A 4C23A 3MGJA 4N47A 3AO1A 5D6GA 4H4OB 1F5CA 2HPUA 2V7YA 4AHVA 4CJ7A 3ZZYA 4OZ2A 3IUCA 2VJVA 2NRWA 1D8YA 3GLJA 4PEOA 1F3FA 2W01A 4OQJA 2VOOA 2O8DA 4N8OA 2N82B 5F3ZA 2Y8WA 5B0EA 2FJAB 1J9AA 3WDOA 1V4SA 4ZVOB 2MZTA 1XI1A 2GUIA 2XSJA 1TL7A 1Y5LB 4PCQA 4UZCA 1TP7A 4ATNA 2RH3A 3N6MA 4NLXA 2EVZA 2CWKA 4CEBA 1XHXA 1TK0A 1K9MT 4JI1K 1EP4A 1NJZA 3E8OA 1WKJA 3QLHA 3VA0A 3R7BB 2FPHX 2VWKA 5KQDA 1XMBA 2HWTA 4AXIA 2FBYA 2BM0A 1PJ7A 3MOJB 2V2ZA 4A4JA 4DUTA 2B56A 3KDNA 5KFAA 3TAQA 1J5EJ 3GR1A 1WSEA 4L75A 2J76E 4CHPA 3TUIC 2A3ZA 4LC9B 1GLFO 4LF9J 2XWXA 2YHYA 1D3WA 5J2QB 2DRDA 1R8PA 4FOEA 3CCES 1J5OB 4JI5F 2M5YA 3IXQA 4GVMA 4K42A 1NPRA 1X0PA 3O44A 3KYLA 1N5VA 2HBQB 3ENHA 4U95A 5A2QU 2ETJA 4JKHA 1FWKA 4ZVFA 1GOCA 3QWUA 4FO0A 1IM4A 4EHUA 3CCSS 2A2DA 3M8ZA 4GKJF 3ILOA 1Q8IA 3BZKA 3H2LA 1UVLA 2CJQA 4JI0J 1U1LA 4KRWA 2RQCA 4BLGA 1VQSA 2E1YA 2MQMA 4DX8H 4FW2A 4A5AA 4H4KC 2LA6A 1RT6B 1FDNA 1P27B 4NE9C 3EE9A 1X5SA 2E5LK 1A5WA 4XIUA 4AILC 2N7CA 4DX5A 1C2PA 3SSRA 2OPSB 2W9BB 4WF9Q 3CTRA 3GL1A 2KXHA 5GAHU 2AX0A 4CEDA 2O67A 4GVLA 3GB0A 4BREA 4Q2MA 5LMUF 2XHBA 3NCQA 1U2VB 3THTA 3QNNA 5HL7Q 2LEAA 3OYEA 2OSRA 3FUYA 4IO9Q 1FF2A 5IM0A 4PQUA 4DMNA 4RBTA 4EYHB 1T02A 4KB7A 1VOMA 2CNOB 4BVPA 1I6JA 2DR5A 3LZJA 1Q8BA 1M5PC 3AVKA 2NNWA 2L9NA 3NH2A 5EU7A 3MCNA 3FLCO 2GTDA 3K59A 2MSSA 5JVHQ 3SFUA 3IM8A 2LECA 3N28A 4EHTA 4ECXA 2C2MB 3CM6A 5K8OA 3NAIA 1S5ZA 4DQPA 2KZMA 3IS9B 1HBMB 2Q31A 1V5IB 2E5LJ 4LBHA 4CH7A 3J81j 3TVKA 4OX9K 5EUHA 4PA1A 4ZS6A 1O6XA 2VQEF 2CPIA 4RW9A 1RWWB 1C6VA 3MUMP 2YCHA 3MD1A 4OX7A 3E51A 3AA2A 4OHWA 1HI0P 3ZLJA 5G0RA 3G9CA 3E01A 4B3OA 2Q0UA 4JI4K 4QW8A 4Y3CA 1IXKA 2WVBA 3MN9A 2W6LA 1RYSA 4M3WA 1Z2LA 2YKNB 1R0CB 3T6JA 4F26A 2M0GB 3VGLA 1EIYB 4ZIWA 2OO4A 5FDLB 1L3KA 3DHWC 1K1QA 2JRSA 2IDOA 4E98A 3H08A 4Q45A 3D54A 4BDPA 1Q95G 2GZOA 5KPZA 2HQIA 2EFPA 5FPNA 2X6NA 4AYBD 1RBOB 5E0OA 2QV6A 3T1HF 5F0XA 3E3XA 3VAGA 1TVRA 1IVZA 1U45A 1M1KT 4JD2B 2IBOA 3ZT1A 5HMZA 3WQUA 3UKRB 1RHQB 4PPZA 1VJQA 4OKEA 5BPNA 3R1LA 2I38A 2IAJA 4FSVA 4KREA 3BGLA 3OFEA 3ZZUA 4XK8C 1JX4A 1N33F 4KTQA 2FD2A 5GMEA 1Q86O 4J9MA 2JX2A 3QJPA 3R3TA 1RT7A 3D4JA 1UETA 4CH1A 2BANB 2UXDK 3N5FA 1LW0B 1WACA 1J53A 4OYBA 1XHZA 2DH9A 4X62K 2RB7A 4A61A 1KFDA 2Y1JA 4USTA 2VBXA 1YJWN 2HMPA 3LL3A 3CFPA 2LKZA 1WG4A 2JL9A 3A8EA 2MSTA 5E33A 4CIFA 1U24A 5D3GA 3K2PA 3L95X 3ULDA 3EWGA 4FWNA 1C1CA 5F8JA 2WVDA 4BR0A 4NB4A 3BSCA 3NDKA 3FFIB 4NI2B 5HRRA 5GINA 2DRAA 1S1WA 3RB3A 3CIZA 3THPA 1Y97A 2UUBK 3J7YU 1QUPA 3FSYA 4DV4K 4QIVA 4DV4F 3KWIA 4A5BA 3WT0A 2NYHA 3FRYA 5C10A 3KOAA 2I5JB 3D66A 2IMOA 4B9MA 3IG1B 1K8AT 2RT3A 3JTOA 1V9OA 3T5HA 1LWEB 3MMJA 3G4SS 1SQEA 1B70B 4DR6J 5B0CA 3SQOP 3MPYA 3ZTPA 4JB8B 2ASLA 3EZ5A 3QJJA 3HKWA 4DR2J 1YJRA 2WTUA 1SKSA 3WQPA 3W61A 5IOLA 1S9FA 4X64J 2KZZA 2R9LA 3JSYA 5AJ3K 4IOAQ 4ECRA 2WW8A 2B6AA 2P9KA 4QIGA 6AT1B 2HNDA 3KZBA 1S59A 3DLBA 2C2KB 2Z8QA 3T1HJ 3POTA 2CJKA 3NGZA 3EPIA 4CJPA 2CJBA 3CJSA 4JI8J 3ULEA 4X84A 5GMDA 3PCOB 3OUYA 1NH8A 2RRNA 4OI6A 1TFYA 1PILA 1GLJO 1KR4A 1CLQA 5KPTA 1RU1A 1VBZA 5KG3A 1U48A 2L9WA 5C24B 3MM9A 1XR6A 3VTHA 5KFCA 1YIJN 2KRRA 3QDKA 2AW0A 1XMQK 1PAEX 2QC3A 1RCHA 4C11B 5ADXA 2G8FA 1I1GA 3NFAA 1PYTA 3WC0A 3TX0A 1GOAA 1FVSA 5AFUH 3IS9A 1V4TA 3CXCM 1ATSA 5DDOC 2F4FA 3HK2A 1MN7A 4P9SA 3UI3A 3BGUA 1IBKF 1MU2B 1VBXA 3MECA 3Q8QB 4KPYA 1FTCA 1SL2A 4FXWA 4CGJA 4Z7YA 1QY7A 3M7VA 3GIRA 2FDNA 1XNRJ 3R6MA 1U7LA 4PRFA 4JI8K 3BSOA 1HNVA 2QSFA 2CYYA 2K06A 2CQ0A 4BR4A 4DB3A 2DGVA 4OX9F 2HRUA 1H2UX 2N3OA 3MM6A 2A6OA 1GLBG 3O9SA 3JQKA 4CI0B 2JHEA 1LWCB 4P2XA 1BU6O 4ILMA 4LVNP 2KT2A 2OEMA 4RW9B 2HZCA 1FJ7A 1KVKA 2XWYA 5EOYA 3ZZTA 1HA1A 3A3NB 2YKMB 4LF6J 1FDDA 4LR7A 3SFGA 2G4BA 3CPWM 4MH8A 1OVYA 3WNHA 1XNRK 1QM9A 3VQ7A 1C0GA 1NZ8A 2PI4A 2EBEA 3D7EO 3F0NA 2B9YA 4FKYA 5K14A 4GO7X 1QVFR 3T69A 1SKRA 1YDLA 3H2UB 5AR0A 4LQ3A 1NSKL 4JI7F 3C8YA 3HD2A 2EFGA 4QAGA 1JCFA 1MMDA 3Q2SC 2AV5A 4K4ZA 1MA9B 3BGRA 1T3VA 2JWKA 2CQIA 3QB0A 4HTUA 2QYCA 4K2JA 1SJQA 4ZK7M 2LDIA 3RR8A 4LUBA 1U1PA 2WVEA 3KHRA 3FZFA 3UCGA 4F3QA 1RKIA 4M3XA 1FJCA 3CJ2A 3JQMA 1IUJA 3CEDA 3G10A 4ETZA 4ZN3A 4C3KA 4G6VB 2Z2ZA 3T3FA 3CD0A 4F50A 5C2DA 2VG7B 5H1SQ 4E1NA 4IO1A 3PRBA 4CIOA 3I9V9 4ES1A 4F4AA 3UKUA 4BC9A 1NK0A 2XZWA 1OYEA 2WCXA 4K5SA 4KC5A 2HVIA 1RCXB 5GADP 1EAYC 1XR5A 4IBNA 3DU5A 3NWRA 2B4JA 1T6DA 3ENWA 3R1XA 4BRAA 5L9NA 1C1CB 1HBUB 3H8YA 3KG4A 3VVTA 4ISEA 4CGHA 4RBUA 5DDPC 3C6UA 2P9UA 3TSPA 4DCJB 3FZMA 2BZ2A 1CS4A 2Q1LA 2CQGA 4H5VA 2H54B 4JKDA 1NNDA 1Q5YA 3M30A 3U6FA 3TA0A 3VAMA 3HYFA 2B9WA 3CDEA 3ZTSA 5F8IA 5AQQA 4ED6A 3DLHA 1PKUA 3T41A 3MPDA 3QGHA 3LP1B 1HNIA 3M1VA 5I3PA 5JICA 1KCFA 3EPGA 3KD1E 1GLDG 1RAFB 3F9MA 4J9QA 2G8WA 4WXWA 3NGSA 1TUWA 5L39A 3KXDA 4Z0UA 4IOAL 2H48B 4X4TA 4JUZA 1JL1A 2ZKUA 3J7YI 2IYGA 1U6FA 3THXB 2AYEA 2FC9A 5F3TA 2UVWA 4MIAA 3TSQA 1T8EA 2FY1A 3ZZPA 1RB0A 1PAUB 3MF5A 2H5JB 3THWB 2KG0A 4KAZA 5KQ8A 4PG7A 5HO4A 2UUCK 4MMOA 4KPCA 2WBMA 3HSCA 1TKDA 3UCZP 1HQEB 4GKJK 1AFIA 4W5QA 3VHQA 4I9LA 2LFVA 5DG9A 3NNCA 1JKHA 2F63A 4OMFG 4LQ9A 2CVIA 3SCJE 2I7PA 2F9DA 4UOFA 3UD4P 2VFRA 2W41A 4UT4A 3OL6A 4FF4A 4OFZA 5IZHA 4KYZA 5CYJA 7FDRA 1ZM3A 2RJZA 4J9NA 2E1CA 4HACB 1OY8A 4MT1A 3O08A 2DHXA 3G87A 1TK8A 3IP0A 2E5HA 2HRTA 3V9XA 2GBZA 3VQ6A 1FJGF 4JAXA 5DJBA 1NDLA 1T9YA 3UCUP 2HBJA 5ETLA 2HMIB 3SBTA 1EHWA 1NGIA 4M5NA 5J1EB 1Y3JA 2MQPA 3M9NB 3U9ZA 1RWOB 3FSIA 4GC6A 4DF4A 1B4SA 1WG1A 4RUBA 1JLAB 3DLKB 1GTHA 2A0FB 3SAFA 1JXEA 3H46O 1ZZNA 1NHVA 2MQOA 5CYMA 1SI9A 2KFZA 2P9NA 4DR7J 3CC4N 1ASUA 4KHWA 5CABA 3WC2A 2V6AA 4X65K 5G4DA 3FCVA 2F7VA 2VF3A 3AD8C 1IBMF 3L2VA 1NLKL 2A41A 3P49B 5CCMA 2XGPA 4YOEA 4DQ8A 1JCGA 1ZS6A 2NRVA 1HHSA 4H4MA 5F8NA 4QYRA 2QYGA 3MCOA 1YRXA 1H98A 4EYIB 1WBDA 4F25A 4WFNL 4F3TA 4C8LA 3V4IA 3ZSOA 3LWLA 1VQOS 3Q83A 3VQ5A 2F8EX 3QIDA 2Q43A 2W7OA 2DNMA 2QA2A 5J2QA 1QJHA 4ZOSA 5HN0A 1WOOA 1KONA 1E6YA 4DR7F 2KW4A 5IC4B 3CIMA 3B6BA 2HG4A 1NMEB 4M5GA 3U1MA 2UXBK 4QPXA 4CECA 4CH0S 2XNQA 3OY9A 4CVNE 3V2UC 3MAHA 2PA3A 3R9PA 2CQ3A 2O8FB 2XZDB 3HVWA 3EVOA 4URSA 3QBWA 2P2CB 4DV6J 2B4OA 1BUPA 1TL1A 6FDRA 4OJGA 3CMAN 2BJ9A 5A8KA 2W24A 4F36A 2Q79A 1CS4B 3RMCA 2FLLA 2R8JA 3RW6A 1AB8A 4WKYA 2XS7A 3BS9A 2JC0A 4O0JA 2VWBA 2BQ3A 2AYMA 4JV5K 3LPYA 4EZ9A 4EFHA 2KO1A 3FZKA 3HSJA 2DT9A 3E9PA 3AVMA 5AQYA 3A5NC 1XIQA 4HCCA 1C0TA 3S1TA 4F8RA 1KC8O 1ZC6A 1JXBA 4P7VA 2XS5A 1AZSB 2R7RA 2GHVC 1NB2A 1IWAA 1HBUA 3VGUA 2IRUA 4KH6A 5J1PA 2O1PA 2YQ3A 1K8KA 3ITHB 4WFAL 4DEZA 4Q8FA 4WF9L 4Y2MA 4R25A 5T7LA 3MM9B 1EETA 1L3SA 2F40A 1QAXA 3DRRB 3R5GA 4DV0K 4LBPA 4A47A 3Q0AA 5HVFA 5JS2A 4CM2A 4USIA 1VQYA 1FFSB 3AHPA 5JXSA 3VN5A 3GFZA 5B8HA 1TKXA 4KB1A 5HMYA 4L3NA 2CA9A 3BKFA 2FY8A 1WC5A 2P51A 1UCNA 4J37A 2B4UA 2C2NA 1UP1A 2UU9J 3I0SB 4MK9A 1HD0A 1R8AA 3A1YG 2J6UA 2DNPA 1EARA 2D9OA 1NNEA 2ZJRL 2DHAA 2HS4A 2HAIA 2G8KA 3UIQA 3HL8A 4OLBA 2XB2D 2FBVA 3P5BP 4A2AA 1T11A 1M0SA 3KLFA 3TTCA 3SJJA 3DM2B 2AF6A 3CC2N 2VA2A 1Q1KA 2AMCB 4YHHK 4KV8A 2DNGA 3CMQA 4CZFA 2QMXA 5KFYA 4B02A 9ATCB 4NASA 3AB2B 3TOQA 1S0OA 2VONA 1RT1B 4NLVA 5FLXO 4CP5A 1VQ5N 2A3JA 2H4WB 1GAOA 4DTUA 3QINA 2J8SA 2Z56B 3ZNJ1 2ZH4A 2E2PA 4G3IA 1S1XA 2G1HA 2A6AA 5CAAA 4YY3K 4DU3A 1S10A 1NJXA 1VR6A 1VLOA 3HZEA 5DM6Q 2LSNA 3HM8A 5I42A 1VAZA 1S1UA 4C8KA 3J80U 1VHFA 1U2RA 3QZ8A 3VQPA 3PEJA 3HVRA 1UJ6A 1FWLA 2FUG9 3AA5X 3OSNA 1K6YA 4ZITA 2QE5A 1QAJA 4BC4A 3OBYA 4FJ9A 5CH7B 5AQVA 1Z1ZA 1QTMA 4PWUA 4PZVA 1HFEL 4Y1CA 3L2QA 3Q8RB 4KHPK 4Z4HA 4X65F 4BRLA 4BRHA 4HEA9 1X4FA 3GG1A 1S6OA 2YPZA 3V4IB 1B9FA 4Q5VA 3I9ZA 1S0NA 4GY2B 1VIOA 4WFAQ 4FK0A 3T1YK 4A62A 3WNFA 1NMNA 2E44A 3RRGA 3EZOA 3I5CA 5DQIA 2A2CA 2IJRA 3ZC4A 4LFBK 2O4IA 4B1VA 1NH7A 1RHKB 3BF1A 2DGOA 1BE4A 4HI2A 5C5JA 3Q7CA 1WELA 4BDYA 2JWLA 3CDAA 1RDCA 1VMBA 5M1OA 4X4SA 1VQMS 3TAPA 2GIQA 3BBCA 1XMOK 3CJTA 4ISGA 1VQ6S 2ZWHA 4KKOB 1ATRA 4Q43A 3O2IA 1NU0A 5A76A 1S9GA 3R2CJ 3W2WA 4ZVTB 3TW0A 4KHYA 3TJ9A 4WFXA 2YHXA 1VSFA 3RGIA 5BREA 2ZHOA 5FPMA 3SI6A 1VI7A 1T6CA 2CZVC 4KH0B 3QT6A 3LH2S 1BQNB 3PRDA 2DK2A 3KK3B 3L2WA 2BM1A 3OYMA 1KQSR 2J5AA 2PIIA 4JI3F 2YWFA 5J1NA 2J9DA 3GIIA 5KG7A 2AIRB 2W4DA 2A10A 2Z2MA 1NPKA 4TY9A 2YKOA 3AA3A 4CGDA 4E7IA 1IQZA 5FIIA 2EW9A 4I7FA 1RILA 1YT3A 1U25A 1NB7A 1CC8A 3QFPA 4LFCF 2WFBA 3O9UA 4H0TB 1JLFA 1SJ1A 4PG8A 4PKDB 1IBKK 1FEEA 1A0OB 1SJ3P 1VQ4N 2YX7A 4DV7K 3O6WA 4K8RA 5IC6B 4FWLA 1D9AA 5IFMA 1WOPA 4PXBA 4BC3A 2IVNA 3KWMA 4ZHRA 2CJAA 1KAXA 4HI1A 3CCJN 4DN0A 1UWAA 3HRGA 2OZSA 5HROB 1UAXA 2G0CA 4DR4J 3RSEB 3G6EN 3E2EA 1ZBLA 2I8EA 3R2DJ 4E8UA 3CVKA 2B43A 4M7YA 2QG9B 1JNRB 3VEZA 1HPZA 2DR6A 1EQYA 3MD3A 5CY4A 4MIWA 3ZX2A 1RTDB 3E1YA 2AT1B 2K7KA 2XYHB 3LP3A 2Q2RA 4EAHD 5AQSA 4C8YA 3H5SA 4DU1A 3M8WA 2F5GA 3DWLA 3BV8A 1WEYA 1YJNN 3EDQB 2ZZTA 5A0YB 4OYPA 5HRPA 3VCDA 4ID1A 4DXLA 4FWSA 4DHVA 1E4FT 1FFGB 2EPIA 1L3VA 1ZETA 2BMBA 2J4RA 3MR3A 1YHQN 2RRBA 4XH4A 1U1OA 5M2RA 4Q0BA 1N0VC 2ILZA 4C7QA 3WUHA 3S01A 3O4QA 3ZCMA 2P8IA 1I94K 4NLPA 3D2EB 2V8PA 3HI9A 5KG6A 2P6TA 4K4XA 1Y7PA 2RDJA 1KWMA 5FRNA 1T9WA 1C4AA 5M1KA 2LQ9A 4ID8A 2WOMB 3MM5B 3UN3A 1X5PA 4J9VA 2JFDA 1UTAA 2VG6B 5LMNK 2GHWA 3I55S 3CB4A 3KLEB 4MQ3A 3PX0A 3M5RA 1ZBIA 3OYLA 4FPRA 1CULB 3A8KA 4QWAA 3W0LA 2DNLA 4O0NA 1CQMA 2VFUA 4L76A 4LF7K 3MEDA 1P1TA 4EIAA 4WKRA 4PL8A 3ULHA 5IXUA 3G6VA 3H5XA 3TTFA 5M1PA 2MDAA 4LSNB 2P9PA 5DQHA 4ICLA 2WONA 1S6UA 2AA4A 4MAKA 3KUEA 1RAAB 4B17A 5FRMA 1J5EK 1SQGA 1N54B 2R3VA 2K1RB 3R6GB 1RE1B 1M1GA 2IVPA 1MWMA 2DHSA 2W9AA 3CDBA 3MN6A 4CEEA 3C7NB 2IVFB 3HHLD 4N41A 4B3RJ 4LJMA 2NUBA 4JI2J 1R43A 1Q8KA 4CBXA 1W7AA 4I67A 2EXUA 2KXNB 1TMMA 3QATA 2DVIA 2K2PA 1PC5A 1D5AA 4AQYF 3H6EA 2KRBA 2BUNA 1JKHB 1S0MA 2XTJP 1R7IA 1XQIA 3BYRA 3OQ2A 5GAEI 1A5XA 1N5YB 3JB9k 1RT5B 4DKWA 2FZGB 4DV7F 2NREA 1BGXT 1YG0A 1C0UA 1DQ9A 5KGWA 4A8KA 2DH7A 5KTQA 4DR6K 5HVHA 4LR8A 5H9FK 3L0QA 2GJIA 3WXLA 1FKOA 3NVMA 1L5UA 2XMUA 4RU9A 4ED5A 3H2VE 3MXMA 1UKUA 5G0RB 3CO9A 5F8MA 4WYBA 5K20B 3PLAA 1XK8A 5D4OA 2AJ2A 1RHJB 2BQUA 1RBLA 4YB7A 4AHCA 3PFOA 1RBTA 3DLJA 4NEYA 1YQHA 4K4TA 3VPZA 2O8DB 1ZTTA 3MCPA 2GGPB 5IS2A 1O13A 3P31A 3OTDA 3Q8UA 2DCLA 1H0HB 2ASMA 1UFKA 1WSGA 2CGKA 5AZIB 1V3ZA 2ZDOA 2DEJA 2C3PA 2CGJA 4RUCA 1ZBUA 5BXIA 1FRIA 1BHNA 3ZT4A 1X1PA 3EE8A 1SQFA 2OTLS 3QICA 4ELUA 3S7RA 1WORA 2H1YA 4USUA 1FD8A 5ETVA 3A3OB 3DGPA 2Z1HA 4OIXA 4ALZA 1FDBA 1SCJB 2UXCF 3BM7A 4M3UA 1IBKJ 4DX6A 2GWJA 2UV8A 4CT9A 4YDXA 2GVDB 3VQTA 4XTTA 3NGIA 4ECTA 2CNKB 1RSCA 5KOXA 4ECUA 2LCWA 5LL6Z 2ZUGA 2YH1A 3SDEA 3MFHA 3DJCA 3JSMB 1J5OA 5IQQA 2NRTA 1VJWA 3B78A 1P9QC 4CLTA 4WPAA 1FT8A 2W7PA 3JXUA 1CEZA 1NPPA 2XHCA 2AX1A 3EGWB 1WOQA 4LBIA 1RABB 3DNCA 3BP8A 2RRAA 1DFDA 3TZYA 2IFXA 5LMNF 4FBTA 4ZVGA 3T1YF 1SH0A 4OKJA 4ECSA 5HLFB 3PR4A 4W5TA 1QSYA 3KG1A 2WC9A 1W26A 2ZF5O 3HZGA 4H0PA 4WYWA 1EX4A 2HVHA 4CEAA 4EK2A 4FXVA 2JDJA 2BR0A 4FCYA 3V4MA 1F2GA 2D0BA 2YNHB 2OMLA 4QU7A 5E26A 3UR0A 2PD1A 4LFCJ 2CWXA 3C15A 5GAHP 4TY8A 1NK9A 2AD9A 3PY8A 1C4CA 1KP6A 3R5JB 2OPQB 2E1AA 1F5BA 3R1HA 4AUKA 4OPKA 3LM2A 2PYLA 1H6KX 2G8IA 2O8BA 5KFSA 3G82B 2CJYB 1T05A 5K8MA 4GKKF 4J9UE 3AARA 1YZ7A 4IG3B 4Y2CA 2QWLA 4WFZA 5JJBA 1SV5B 2O8CA 3ILJA 1E6VA 2B6AB 3TABA 2BJ8A 1U26A 4AT1B 1OH6A 4QWDA 4PPDA 4ECQA 3HP9A 3OVAA 2VZ9A 2MKIA 3S41A 2IA0A 4ZVRB 4IOCQ 2W4PA 2QW9A 2ROGA 5GAHI 4NCBA 2BE7D 1K0VA 3GJQB 1N36J 2KM8B 1Z4UA 4HUEA 2JNJA 4ZCMA 3AOBA 4CEZA 3OV7A 4HHTA 4CLUA 1ZPVA 3JS9A 2I9SA 4OYOA 4BQZA 5KFGA 2QX0A 4DU7A 3O8MA 2ZFHA 2HBKA 2F8MA 4CW7B 4LSNA 3MWTA 2YWHA 4CJ3A 4I9QA 4EUVA 3CF5L 1IH7A 4RNNA 2VA3A 1YITS 4FF1A 3K0JA 1RFQA 4EGLA 3OTOF 1CPZA 5SWMA 3Q8SB 4DU4A 4H5RA 1WC0A 3KG0A 2V94A 4K0KJ 2R7VA 4DFKA 3V1RA 4CJFA 1YUWA 1FRJA 1SKWA 4LF6F 5LJ3Y 1SKUB 4S0MA 4KI6A 3HTVA 1XMQJ 1VQ5S 1JJHA 4CLZA 1MROA 3RBZA 2AEFA 2G8HA 4CZCA 4J9SA 1WTBA 5KFXA 3IC1A 1ZH5A 1UWBB 2ZVSA 4DPOA 1WF1A 1HHTP 1CJVB 1LWFB 5A8RB 1U2FA 4X4VA 2E2NA 2VPZB 1Q82T 4N77A 2Y1LB 3MM6B 3VQBA 1JK9B 3G71N 3MAAB 4OYXA 4Y6IA 4D3GA 3PSIA 1TUUA 5HP1A 3M2VB 4JKGB 2QK9A 2YKNA 1RGVA 1RT7B 1F9EB 4R0JA 3QLHB 3DHXA 3SQ2A 5ETPA 2HWIA 3SZ2A 5BR8F 4BACA 4LF7F 2CIMA 1HI1A 3IFRA 3MPWA 4KGVB 1FFWB 3CCUS 4LF1A 4AL6A 5SZTA 2AEJA 2YKQA 4JYAJ 4IR1A 1OO0B 2MJUA 3NG8A 2BDPA 4DOZA 1UEVA 4KT0C 3G4SN 3AXKA 3UN5A 3MPUB 2YHBA 2R7OA 2D0PA 3FGUA 4MO4A 2JGUA 4P7TA 3CC7N 5F0WA 2O3DA 3H42A 2ZE2B 4YDDB 2FYXA 4HUFA 2D69A 4HT7A 4CO4A 3QWPA 4DR7K 4DR1K 3AA9A 4LF9K 3J7Z5 3FZ2A 4DUZK 3CMAS 2DCUB 2WVCA 4ZJLA 3PW4A 3G6YA 3R27A 4OZLA 3G86A 4KJIA 4CJQA 2BW2A 3MEGA 2D0OA 4IO8A 3CCTA 4E3SA 4E89A 1KKHA 4CK1A 1KHWA 3DRPA 1M90O 3RBEA 3GJRB 3FR0A 2BJ3A 2FLOA 5LL6d 2PGCA 3JSMA 2NCKL 4NLYA 1IO2A 2WOMA 4DV3F 4DR1F 3OL8A 3OHRA 4DR2F 2MY8A 4M5DB 2DXEA 5E3QA 3P3DA 2VIHA 1S1WB 4IH5A 4H0XB 2HYIB 3FKBA 1KN6A 4OL8A 1X4BA 1NKBA 2ZOFA 1U6ZA 1ACMB 2UUAJ 5DZ6A 1ASWA 4WU2A 4JRPA 3O5TB 1NJYA 2FXUA 3FE1A 4ZTJA 1RA7A 1QHTA 1XN9A 4NO7A 4DI6A 4A59A 2L3MA 5GAGP 2OA8A 1RT4B 2V68A 3AVNA 1WC1A 2GMLA 2I7NA 3GZ7A 4QYZJ 3QEWA 3T9NA 4LF8K 1UA0A 1KOOA 4Z4FA 2FSKA 1NSPA 3FQLA 4PG4A 3TAMA 3PYGA 1LOUA 1Y11A 1VSJA 4J2AA 1B7FA 1S22A 4LREA 4A2BA 2IGIA 2C2EA 1T03A 2UUTA 2VBZA 1U49A 2FGCA 1NM1A 2FC8A 3D6HB 3DXMB 3HSGA 3RVCA 1Q4RA 2RMLA 3SJHA 1X4GA 3M2RA 4G1PA 2GQQA 3CPWR 2PC6A 3TUJC 4KH1B 2R8KA 2PI5A 3KTQA 1WF0A 4ZCKA 3HHLA 1MNEA 1WLJA 1HQ2A 1D9FA 3TRGA 4QWBA 1K47A 3T5LA 1RT5A 3PHEA 3G0ZA 1NK5A 1LWCA 1MU2A 2QMWA 2KHDA 2HAFA 3OTOK 5EDWA 5DGBA 4C1NK 5BR9A 4AHSA 4YOXA 3LUYA 4K0KK 3OYAA 3PIPQ 1KQFB 2YKMA 2D3OR 1SBRA 4E19A 4F3OA 4TYAA 2G2YA 3QZ7A 3PYDA 4MYUA 1DARA 3RG6A 4FJGA 3W5ZA 2ZHBA 1W7WA 5J2MB 2V52B 1KVJA 2B7BB 3C16B 2DXFA 2U1AA 2MKCA 1T9VA 4DG1A 2DISA 5KFBA 2V9WA 2O8EB 2VG6A 4TYBA 1LW0A 1J2VA 2XSFA 5AQGA 4QIEA 3BDPA 1NOZA 3NBPA 1VQ4S 2P5GA 3T5KA 1CULA 4YOTA 2PEBA 4JK8A 3DLKA 4RNFA 1JLEA 4M7XA 4DN9A 5HMWA 3TI0A 4BGBA 3RB0A 4DL7A 2OIHA 2QSWA 1RBRA 2QWPA 2O66A 2ZJPQ 2GVDA 3LPTA 1K1SA 4ZPDA 3GFHA 3THYB 2W8KA 2GELA 1RTZA 3L2UA 1BG3A 4A48A 1N5QA 4ED2A 2WZ1A 3D2FB 1U0SA 3MEGB 2IM3A 3O3HA 4LSLB 4PQAA 1RBUA 1HW9A 4O44B 3A13A 3H1VX 1IR0A 1ZBTA 1FKAF 5M1QA 4C8NA 1L3UA 1RAIB 4MDBA 4ANDA 5BN9A 4Q0BB 3H40A 1KRPA 4WK3A 2HHTA 2V0NA 2OCEA 3V6DB 3P96A 3T7ZA 2UVVA 3BJYA 4MDAA 3K9KA 4M63A 3MI7X 5HVGA 4TU7A 3AA8A 1HLUA 3V81B 4XEIA 1VQ8N 5DO2A 4X4UA 5DZ7A 1JXLA 2MHEA 3AO3A 1GXLA 3ILIA 2IY5B 1FJGK 3U8XA 2I0XA 1YX2A 5BR8K 3GIMA 4JN4A 4BE1A 3CJ0A 1JCEA 1WBBA 4B1UB 2FHJA 4U8YA 3CCQN 1IV0A 1I39A 5ETMA 4X65J 4X4RA 1BA1A 3LZIA 1LWEA 1HNIB 1JWWA 4IKAA 1OIAA 4PAAA 1RU2A 4ES2A 1FXXA 3UE5A 3FEXB 3TQ1A 1V6HA 1U2VA 2C2DA 3UWTA 1M5HA 2VL1A 2LVWA 3AY9A 3MXJA 3N4PA 5EWGA 4B3RK 3PM9A 2OANA 2ZQBA 5KI6A 4LF4J 2HK2A 1HBOA 2ATCB 2NLWA 2IS3A 4DL0C 4IG3A 4FYDA 2DNHA 2ZH6A 3SYZA 2J0QD 4OX8A 3QYYA 1F0XA 4IFYA 4Y2AA 1FO1A 2YQ1A 5KG4A 1U47A 3G71S 5FPEA 4XH5A 5LM7E 4B3RF 2WSEC 2NXEA 4OPJA 1HWJA 1XWLA 2VJUA 2CNLB 2DNOA 2CRLA 3QEIA 4DSEA 3HOSA 1B3TA 3JTPA 1YBAA 4DR5K 3RBXA 1N52B 1OWXA 3OXGA 1RACB 3D9BA 4OI2A 4DWIA 4CK2A 1IM6A 4C0HA 1VSLA 3UQSA 1JLCA 1RWXB 3QETA 4Y34A 2QXLA 1SJ4P 3SIPB 2W9CA 3NF7A 5CD4A 1F60B 4M8LA 3FBFA 1C0UB 4PWWA 3MFIA 4WQ5A 5DM7Q 4LMZA 1RI7A 3D68A 1Z05A 3NGKA 2E20A 4FDFA 2HHVA 1CQNA 1VRUB 5A6WA 2CGLA 2M2BA 3R5BA 1RISA 3EUNA 3K5OA 1HKBA 3B82A 3AXMA 4RG8A 4DL4A 5LXYA 5D15A 3IR6B 4IQMA 2UU9F 1HBNA 4USMA 2F9JA 3L7UA 3QFWA 4WQ5C 2BX6A 4B3TK 3GYGA 2NZCA 3OTOJ 5DM7L 3MK6A 4OV1A 3I56N 1XC3A 2R2UA 3KK7A 5E3AA 4L72B 2IAJB 1RT1A 4QIWD 3CULA 4O5FA 3GOIA 2EWSA 1IG9A 2V2QA 2ZNYA 4XAKA 1PYOB 4CZEA 1UW4A 2LA4A 4YR3A 4JEPA 2MLXA 2VH7A 4RPFA 4ZVQB 1X9SA 1HMVA 2C2OB 2EFVA 4FWMA 3IM9A 5AXLA 4CLYA 1LQ9A 3OXFA 3HHEA 2YVSA 3HSZA 1JJ2R 4DTMA 2MB0B 2IVMA 3PJ9A 2ITMA 3CCRN 3DRYA 2W2OP 1UVNA 5KFDA 2NRXA 2D3UA 4ECZA 4J9OA 1D09B 5BPMA 3LDQA 5FPDA 2BTFA 4DPWA 4LRAA 4HH0A 3VGMA 3FCHA 2ASDA 3W8PA 1RT2B 1GXUA 3ZSWA 2AYGA 2CH6A 1JLEB 2XMWA 2OPPB 3CD6S 4PUOB 1MLAA 4ANCA 4BC7A 3MTKA 3QGGA 5AQLA 2JFKA 1RTIB 2A1SA 2R7YA 1XR7A 5CD4H 1QVGM 1P6TA 3O80A 4UQGA 1VQLS 3HPGA 3DXKA 2E66A 4ILHA 2O01C 1W0HA 3R5CA 5SUHA 3WQTA 3P4UB 2RKIA 1R31A 3FZHA 3QEPA 2MKHA 3TUPA 4NLOA 4BBYA 5B08A 1J27A 1IBLJ 1LFWA 4L74A 3CJ1A 1Y9OA 4DS5A 1KQGB 3Q8YA 1AZSA 2KN4A 5C0YA 1S12A 1HWKA 2ZM6J 3P5JA 4HDHA 3NF8A 5AQMA 1WKLA 3OUYB 3T1HK 1LWFA 3ISNC 4WTYA 2ZKTA 3DLLL 5C12A 2F4VK 4DSIA 3D7SB 2YJEA 2P9SA 4OI1A 1URRA 1NM2A 1AT1B 1JJ2M 2GHPA 3FSXA 4FYVB 1EQ0A 4RKUC 1YI2N 2XULA 1X31C 3VVUA 2DTJA 4PABA 2ZH7A 4ECVA 2GO9A 2J9CA 4MIBA 3HX9A 1VQ7S 4O8UA 4LFBJ 1ZYQA 3ZX0A 2ACYA 1AUDA 2R4FA 2D9PA 3L7PA 2AP1A 5EGYA 1ELOA 4FOIA 4IRCA 5AQKA 4ZPAA 1B92A 5EVZA 4DUYJ 1X9JA 4QR0A 3MXHP 2FF6A 4BQLA 4JK9A 4I7FB 2KI2A 2R2SA 3TJ8A 4E2FB 4UY8O 2KQ2A 2X6SA 1VLYA 2UV8G 1R0BG 4Q2LA 4WJBA 1RYRA 2CADA 5E5NA 2KKZA 3OXLA 2ZE2A 1WI8A 1ZPWX 4KRFA 3WEEA 2HNZA 3QGPA 4LF2A 3EGZA 3BYPA 5GIPA 3QSIA 3KFWX 1KQKA 1Q53A 3C65A 2E7VA 1KLMA 2E5GA 4F4YA 3HHLC 2QI2A 1TTHB 1G3OA 3N6NA 2PMWA 2CH5A 2Q6BA 4HHUA 4X62J 1IKXA 4I2PA 1YBUA 3A5OC 4CFCA 1NKCA 1F5AA 2GVZA 3HFZB 4NLSA 3C16A 4RNOA 2IC3B 3D3BJ 3AVIA 3N6LA 4LRFA 3GV7B 3ZXWA 3VEXA 4BRFA 1YTUA 3OJSA 1S57A 5GMKa 3HF5A 2HGLA 1OH7A 4OLAA 5EWEA 3W60A 3IO1A 3LPEA 2JC1A 1KC8T 2RU3A 1Q7YT 1EO1A 1UAWA 3GG4A 4M94A 3QJLA 1FK9B 1BQXA 2W4CA 4ELTA 1RDUA 3KWGA 2AGQA 5LOQA 2WRMA 1NO8A 3VQ8A 4Z4EA 4CF0A 3SAHA 3NGDA 1WWHA 1BWVA 3K5LA 2V8DA 3Q86A 4GVBA 3LDOA 1C1BA 4IXCA 3CERA 2P9IB 3RRKA 3FBEA 2B5JA 3GR0A 3KLGA 5B0FA 1P8ZA 3AFGA 4ZJQA 2ZH8A 5HATA 1U1MA 2HQCA 2DRBA 4CZLA 3CW2C 2GIFA 3EKUA 4Z37A 3VEWA 1UZDA 3AJDA 4USWA 4RWTA 4RX6A 3NRBA 5KFNA 2CVEA 3SQGA 3IRXA 5A8KB 2NZTA 2NRHA 2L9DA 3W3SA 2AU0A 1CJUB 2EHGA 1DTQB 2ZH5A 4CO5A 3CNQP 3HHNB 3P8BB 3ENBA 1I94J 3V81A 4I2QA 4K4YA 3QNOA 3SNNA 1KVAA 3R8YA 5EN1A 3PG9A 4WFBL 1ZBSA 4ID5A 2YPYA 3IBFB 2CQ4A 3I8DA 2H3GX 3SEOA 3B6PA 1M5VC 3UD3P 3M30B 1HHQA 4KHRA 3W62A 1NMDA 2E1MC 2OJ3A 4JLHA 5AZJA 4KB0A 4NYFA 4DU8A 5BN8A 3UW1A 2Y0BB 2MLZA 2NPIA 3EGVA 2FBXA 3FMBA 1HRHA 2W9BA 3W63A 1XMQF 3V9WA 3PUFA 2FJWA 1SS6A 1HBOB 3EZUA 4JI2F 2NZ4A 4DL2A 2IDEA 4JKFA 4KHNA 4HVZA 5IT9Y 1EX8A 5KT4A 1YZ6A 1VGYA 2KB2A 2MLYA 3W9HA 4OZNA 3TU5A 4QR2A 2IRXA 3ZZOA 4F2RA 1DBDA 1KOHA 4ERDA 3K9JA 3SUQA 2GGPA 2W2PP 3W9JA 1NU4A 3F73A 2A18A 1K0TA 3O1BA 2PDAA 3AGRA 3L4IA 1J5EF 2M7SA 3KHGA 4DQIA 2MMYA 2FF3B 4J2EA 4DSJA 4JKCA 3BQ1A 3OS1A 3DOLB 4WU3A 2C28A 2C22A 5KFZA 4HVJA 1OSCA 4J90A 2H65B 3THVA 1NZAA 4JV5F 4I64A 3M8QB 4BC5A 1NBWA 3GG0A 4B8AB 3KNAA 2QT7A 3LTOA 4WQ4A 1RP5A 1RDAA 1ZAXA 3L6QA 2AZ3A 3BQ0A 4O44A 3ZFVA 3R97A 3NGRA 1NDPA 1FTRA 1CZAN 2W2NP 1A5VA 5D3GB 1NGBA 4HCBA 4NL5A 1RWMB 5E3RA 5J1EA 1G7CB 1Q82O 2HFVA 4M63C 2OTLN 3N0VA 2BKPA 2X1GA 1ROFA 3LAKA 1JLAA 1MWYA 4P6QA 5HQLA 1M5SA 4OHZA 5K8NA 2HVEA 5LXRA 4FYWB 2SXLA 2GV1A 4DSLA 3AVBA 2QL5B 4PXCA 1UA1A 2FSNA 3V6KA 4DTXA 5A0YA 3O3LA 1KEKA 3HVAA 2KTQA 1PCAA 2HQ3A 4MO5A 4FPIA 3CJKA 4ED4A 1NSQA 3OR1B 2IBKA 4GO5X 2UXDF 2XMAA 2GAHC 4YOUA 1HMVB 3UPFA 2F3JA 4B08A 3M05A 4HHHA 4YORA 2PO4A 3FFKB 5KFHA 4WXOA 2G13A 1I51B 1XEZA 3D2EA 3VF4A 3MMCB 1S1UB 1U0HB 2QWQA 2DY1A 3EM1A 1VQ9N 4IDHA 1C0FA 1RT3A 4F04B 3NHGA 2NRZA 2VQFJ 3ZEUB 2CQDA 2ZH9A 2K1RA 4KBOA 2MZJA 1YIJS 2GUPA 4FF3A 1YKWA 2XCAA 1UJ4A 1F9HA 1OY6A 3LGNA 4LH5A 3O6QA 4PKGA 1FRMA 1VQNS 2HFOA 8ATCB 3CFOA 2ZH3A 4NCAA 3KK1A 3P5TL 1RT2A 4JOUA 4H5NA 4JI6J 4AE5A 3ISND 2RIJA 2J0WA 1UW9A 3MEDB 5AFUA 1QTNB 5F8HA 4N7TA 2UUAK 2DNKA 1XBWA 2Q36A 4WZQA 1BIZA 2YNGA 4USHA 3QO9B 1QVFM 2LEPA 4J9KA 1JLCB 3HHDA 3BGOP 1ITPA 5E3PA 1QQCA 4DPUA 5D8HB 3W1YC 1W2IA 4BRMA 1VSIA 2C3YA 2X7IA 2XY5A 2I5JA 4CJKA 4USVA 1ASVA 3KDOA 4OJHA 4ILLA 4KTZA 2OFGX 4FLYA 4RW8A 3K8VA 3AB4B 2YKPA 4OZ5A 4KI4A 4DV3J 3U4LA 2M52A 1GLAG 4FJ8A 2F8HA 1CJUA 3D6MB 1RAOA 1X8DA 4MKBA 3VQ9A 2B3TB 2V51B 1M5OC 4ILGB 2H4YB 1X4HA 3HULA 4OX9J 3EL2A 3ASMA 3GFYA 3CIPA 1K8KB 1RHUB 2M3DA 1Q18A 1HLWA 1N5YA 5GVQA 1U1RA 4PWDA 2IM0A 1N32F 1JQGA 3C3LA 1NCLA 2EKNA 3LQVA 4JI3J 5I9EB 3NMUA 5HK4A 3V9UA 5LMUK 3BZQA 3RTVA 1DLOB 1X5OA 3RSEA 4JD2A 4BHQA 4M3TA 4IUFA 5LY3A 4DV2F 5CQGA 1X9WA 3EN9A 2XMTA 3KLIA 4DV5J 2E5LF 1VISA 2OUGA 1JMTA 3H20A 2M70A 3H1QA 4KHUA 1VDHA 1HI8A 1VQ6N 1QZ5A 1X4EA 3OYNA 3LWMA 4AHUA 5ETSA 5AZIA 1N34F 5IWAK 4IJAA 4FW1A 2D1KA 2YJFA 3Q8VA 2ZD1A 3OTCA 4I6WA 3BF4A 1FKPB 1EQMA 2GQCA 3KD5E 2XMJA 3X1LB 5LJVA 2VGNA 1I94F 2UXBF 1VRUA 4OGEA 3KMSA 3IWXA 3MUVP 4NXMF 1T9UA 4O4GA 1E3MA 2RE1A 4CLPA 3ALYA 1N36F 3K8WA 4DTJA 3FFIA 2VFSA 3Q7BA 4EEYA 2M88A 1HKAA 2MJNA 4DR4F 1BDGA 5CZVA 3W3DA 2ZZMA 5BR8J 4QW9A 1PBAA 3M8PB 2E9RX 3DI6B 3H7HB 4DR4K 4L73A 2PN6A 3IFEA 1D8ZA 2B4VA 2DITA 1CZBA 1HNXK 2X74A 3SUNA 5CE3A 4F9OA 4DUZF 4QPTA 3CO0P 3TEGA 2RKIB 4LF9F 1GQEA 3X3UA 2GW8A 3AQOA 4HT5A 5JVGL 1CLFA 1T3NA 5KG0A 3CJ3A 4YOVA 3OA9A 1BWFO 3MURP 2LXIA 2CPDA 3PZPA 1RLDA 4TU8A 2VODA 4TNOA 1N6QA 4W4MA 2EX3A 4CLKA 1KVBA 3ZETB 2O8CB 4CJTA 4OI0A 2EC2A 2OTJS 3LO3A 3PJXA 4JI7K 4R5PB 3O3FA 1YJVA 3MR2A 2ERRA 2N4DA 2ZJQQ 1C1AA 1SC6A 3IBCB 3C7NA 4LVOP 3GSIA 2HFSA 4WIIA 1BL3A 4RR5A 3JQJA 3SQ4A 2OSQA 3A4TA 1PJ6A 5L1IA 1K8AO 2YNFA 3BSAA 3S6EA 1RDWX 2YX1A 4K2XA 3CCVN 1YXQA 1TV6A 1MSWD 2OH2A 3KIOA 3OD2A 4JV5J 2HHHF 3AVHA 1DRZA 3ENVA 4F0HA 4HDGA 3CWJA 3OT9A 4CNZA 1FCAA 2R7SA 2E6MA 5IM0B 5EWFA 3NNHA 5D0HA 1T05B 7FD1A 4KO0A 2OLWA 5KFQA 2YBVA 1QQMA 4DV6K 5H9EJ 2CZ4A 2AKWB 1VFJA 4FS2A 2UUCF 4RW8B 4DTRA 2VD3A 4Z4GA 1N8RO 4CNYA 5HANA 2HQGA 2PMZD 3PIOQ 1VSEA 1YJ9N 4OJRA 3AVJA 3EY1A 3CI5A 2J7WA 4OLPA 2JLFA 1TUGB 5KFKA 1R27B 4DLGA 3CJ4A 3PTWA 3M8SA 4KH5A 1OH8A 5CYQB 2CDRB 4JV0A 3VEOA 2HHHK 4X66J 1RK8A 4RNHA 1XMOF 1MMLA 3HJFA 3BPDA 2Y9HA 4UQTA 4LF5J 4M5LA 1QZ6A 2KKHA 3Q22A 2APOA 2QN6B 5KT7A 3AAPA 2ILYA 2MHNA 5KFTA