1RT6A

Hiv-1 reverse transcriptase complexed with uc38
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 148
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt6A05
1J5OB 3LP1A 4HKQA 2J6TA 4DTOA 1A5WA 5C25A 3MECB 2C22A 4WZQA 1HNVA 3E51A 2Z1HA 5L1JA 1RT7A 4CF8A 3ASMA 4NLWA 3BSCA 4DL3A 4M42A 1VRUB 3M8QB 2G8VA 3E01B 4KHNA 2P51A 4HCBA 2JEFA 4JV1A 3U6FA 4ECYA 2OYQA 4ICLA 4W5QA 4KREA 3VQBA 3DYAA 3HL8A 3SQ4A 1S9FA 4KTZA 3DMJA 4EBEA 1RDCA 3T5JA 1HRHA 4YR2A 1S1WA 2OZSA 4K4TA 1C0MA 3KOAA 5KFGA 4DLEA 4YNQA 3JSMA 3SZ2A 2YNHB 3Q8PB 2KFNA 2X6SA 4AH9A 3SI6A 4CHPA 4KHUA 3FFIA 3JYTB 4NLTA 4CEEA 2W9BB 3OHAA 4EP5A 3CJ5A 2ETJA 4OGEA 3F9KA 4TSXA 2HNZA 5EWGA 1RBRA 5F9NA 2Y1IA 2OPPA 3QGGA 2ZKUA 1JLCB 2HMIB 3G10A 3H08A 3QNNA 2BE2A 3RMAA 1NK9A 1RT6B 4ED0A 2I1RA 4DFJA 2NUBA 2XCAA 2IJNA 5F8HA 3NH2A 2VWKA 4PQUB 4DSEA 3OYIA 5F8MA 4CF9A 4RW4A 1RTDB 5KFZA 1C0TA 4M45A 3IG1B 5HRNA 3IS9B 4BDYA 3EPGA 2UUWA 4F4KA 1EX4A 3KHHA 3M8RA 3SV4A 1TKTA 1K6YA 4HUEA 3T5KA 2JC0A 5C42A 2DFEA 2HHWA 1RT2B 2HHTA 5D3GA 3OL8A 5CYMB 4QCLA 3TAMB 3ZSVA 1RBSA 2HHUA 4WFZA 3D45A 4DU3A 3CO9A 2X78A 4F50A 3NAHA 1FKPB 2FC0A 4MH8A 4FJMA 1YVFA 3D5MA 3TVKA 4RW8A 1LW2A 5HLFB 4CESA 4K4XA 4WZMA 1BISA 1NOYA 4JS5A 4B9NA 2DPIA 3RTVA 4ZVGA 3SFUA 1D0EA 2XCPA 3HPGA 3LP2B 1CLQA 3KK3A 1UA0A 4DSFA 4C8MA 1WSFA 3GYNA 4G1QA 2AGQA 4CEAA 4DSKA 5DLFA 1KFDA 3BDPA 1S6PA 5C24A 2IC3B 4KO0A 1BI4B 4CGJA 1KVCA 1WNEA 3KLHB 3QETA 1S9EA 3M8PB 3I5AA 3PR4A 2D0CA 3OVNA 2CJQA 2R8HA 3DOLB 5DG8A 4FJGA 1U48A 3H4DA 4F4XA 4B8CA 1X9SA 4K4ZA 2RF2A 2FBYA 2HWIA 3T5LA 4LH4A 4NLUA 3HKWA 3AVHA 3LWMA 3Q8SB 3KK2A 3DM2B 1TVRB 5KFPA 1Z26A 4IKFA 2HB5A 4MFBB 2ZD1B 1RCHA 4URGA 4FS1A 2QKKA 2UVRA 4MK8A 3GILA 1KFSA 4RNOA 2IAJA 3GV8B 2R8IA 4MK7A 4ED3A 2D3UA 3KD1E 1WN7A 1T7PA 3MFHA 1S1UB 2VG7B 4C8NA 1SV5B 1C1CB 4DS5A 3UR0A 4LSNA 2I5JA 1U47A 1ZBHA 4CF1A 1F21A 2WTFA 3A2FA 1CZ9A 2E9RX 4E0DA 2R7YA 3AV9A 3DLGA 3ZT3A 3LAKA 4ZVEA 3DRSB 2FVPA 3QYYA 3S3NA 5J1EA 4DL5A 3AA4A 3QEVA 1SL1A 1QSYA 2G8KA 2AWZA 4KB7A 1TKXA 3TAEA 4AHRA 3TANA 3KLFB 1JLGB 1TKZB 2AGPA 2R2SA 1S1VB 3G86A 2OPPB 4CCHA 1J53A 3OYCA 5KG2A 2BDPA 3K58A 1NJWA 1SKRA 4HUGA 4O3NA 4M95A 2AX1A 2HHVA 3RMCA 4E7JA 3ISNC 4X2BA 4ECQA 2ITGA 4O3SA 3QINA 3PW7A 4O0IA 4AHCA 5KFMA 4NRUA 2C28A 4OGCA 1GX5A 4F2RA 2IMWP 1NJYA 3QO9A 1TKTB 3HJFA 4QAGA 3L2UA 4WXWA 4EO8A 4E1NA 1C0UB 4KRFA 4H4OA 1TP7A 4TY9A 4IG3A 4KHYA 4K4SA 3ZCMA 2DY4A 5CYQB 1IKXA 1IM4A 3AVNA 2JEIA 2YNIA 5KFCA 4R0EA 5EDWA 4IFYB 3LAMA 5KFSA 3QIDA 4OKKA 4W5TA 1XHZA 3AA5X 4FJLA 2XY7A 4MIBA 2VG6B 1RBVA 1JXBA 4W5OA 4RW8B 5KT6A 4YR3A 1FXXA 3AVBA 1I6JA 4OKJA 1HMVA 1RT3B 1YTUA 3LPUA 1UAXA 1TAUA 3EY1A 3AVMA 1JLAA 4KI6A 5J2PB 1EETA 1RT4A 4QW8A 2D41A 3B6PA 4MKAA 5KFEA 3OLBA 3V6HA 2O5DA 4ECUA 4RW7B 5KRTA 5FRNA 3HVTA 4LQ3A 1TKDA 2RF2B 2W9AA 3FQKA 3RB3A 3L2RA 3OHBA 4R8UA 3G6YA 4FJIA 2Z1IA 1L3VA 2BQ3A 3AVGA 1QSLA 1TV6B 3H5XA 1SKWA 3C6TB 4RNMA 5KG7A 3HVRA 3PHEA 4F4ZA 3HPOA 4FK2A 3HP6A 1RYRA 3NE6A 5HP1B 3QERA 4DL6A 5CZ2A 1NKCA 2BANB 3IGNA 3QEIA 4EZ6A 1L5UA 5CZ1A 4HYKA 3U3YA 4IKAA 4M3YA 4CJQA 3AVJA 1T8EA 4ED1A 1BQNB 1FK9A 3RMBA 4FK4A 1C2PA 5JXSA 4OPJA 3ISND 3NMAA 3OYLA 3AO5A 1R0AA 3K5LA 4O5BA 1JIHA 3KLIB 3NAEA 3AVIA 3CFPA 4Y1DA 3AA3A 4ZHRA 3FQLA 2R8JA 1ZETA 4I2PA 1T3NA 3DLGB 3MTKA 4EBCA 5JS1A 3BSNA 3CDEA 1Z4UA 4DFPA 4PWDA 1TKXB 1ASVA 3BQ0A 4ZP9A 1WSGA 3PY8A 3MAQA 1CZBA 1GOBA 4DS4A 1XR6A 2B6AA 4IOBA 4CEBA 1CXQA 4ID5B 5L1KA 2HW3A 4BDZA 3HPHA 4URQU 3P1GA 1S6QB 1RTIA 3V1OA 2PY5A 2KZMA 4NRTA 2GIRA 2QKBA 3VQ7A 2J6UA 4IG0A 5T7BA 3KLGA 2PYJA 3GIKA 5HROA 4CHOA 2KTQA 3QGIA 3PR5B 1VSIA 5KFDA 5KG1A 1BQMA 2HNDB 1QS4A 5KGWA 1D9FA 1RTHA 3VQAA 2IS3A 3UIQA 5KRSA 2E6LA 3C95A 4IG3B 1RA7A 3MEGB 1TL3A 4PA1A 4LD0A 2R8KA 1QE1B 1SL2A 1KLMB 3V6KA 2AQ4A 4LQ9A 2W9CA 2E9TA 1JL2A 3KMQA 3MEDB 3H40A 5FDLA 4FJJA 3LP0B 1BL3A 3ZSRA 2YKMB 2G8FA 4EO6A 4YFUA 3PW2A 1N6QB 3ZT4A 4J9PA 1LAVA 4FJHA 3SV3A 4O4GA 1EETB 4CJUA 3OYBA 2R2TA 4J2DA 3CYMA 4CJPA 1YVUA 2G8UA 1NKBA 1TL1B 5I3UA 1QAIA 3CJ0A 1DLOB 2F96A 2A1SA 3HVTB 1B92A 1KLNA 2B5JA 5J2MA 3SQ1A 1IKVA 1KHWA 4I9LA 4OJRA 4M3ZA 3HHKA 3QZ7A 1EXQA 2F8EX 2WONA 1JKHA 3CFRA 2WB4A 4J9LA 1RILA 3O3GA 1S1XA 4R5PA 3HK2A 2HHXA 1JLFA 4CJ4A 2OZMA 4KFBA 2HHQA 3HP9A 4B08A 3VQ9A 2C2DA 1HQUA 4CF2A 1VSDA 2VG5A 4IR9A 2ASLA 5K14A 1HYSB 3RB6A 3NBPA 3CM5A 3V4IA 3MEEA 3CDWA 4CJEA 4NCBA 1FK9B 3KK1B 4QWAA 4QWCA 3OYEA 3OYHA 3MR2A 1DTQA 2OA8A 4FJXA 4FYDA 5DQGA 1R0AB 1JLEA 3V9WA 3OJSA 3S3OA 2GIQA 4O44A 4MQ3A 3C6UB 4FJNA 4FLYA 2GBZA 4KHSA 4LSLA 3HO1A 3DI6B 5KT2A 1VSEA 4RU9A 4CFCA 4CGFA 1LWEA 3L2QA 4B9SA 3VQ8A 1VRTA 1K1QA 4AILC 4EYHB 4XPCA 4KAIA 4ELTA 2B6AB 3L2WA 4TY8B 2C2RA 2ZQBA 4EP4A 2KW4A 3OYAA 1VSMA 4CJWA 3OL9A 2P5GA 1HPZA 3TAGA 4TXSA 3V1QA 3V9UA 3KLGB 3K5NA 1NHVA 3M9MB 3L3UA 1TAQA 4B3OA 4OPKA 1CSJA 2GC8A 1LWCB 2GUIA 2YKNA 1J9AA 3AA2A 2FLNA 3L2VA 3OS0A 4B9TA 4ELVA 1VSLA 4Q0BA 3K5OA 4CIFA 2B4JA 5JS2A 4CJ3A 2HWHA 4ECWA 4RUCA 1S48A 4H4MA 2BR0A 3ICLA 4K4YA 4WE1A 1G15A 3V9ZA 2FJWA 1RTJB 2OH2A 3RMDA 4NLSA 2W7OA 2OPRA 3ULDA 4EBDA 4IDKA 1JLQA 1N5YB 3BJYA 3GIJA 1C1BA 2FBVA 5KGXA 3NL0A 3V81B 1W9HA 4IRCA 2R8GA 4O4GB 4TQRA 4M3TA 4F3OA 5KFKA 4CJRA 4DTPA 2UVUA 1SH2A 2E9ZA 1D9DA 2JEJA 4B9VA 3H5SA 3DRRB 2D5RA 2IDOA 3CVKA 3BGRA 5J2MB 1U09A 5DGBA 2XY8A 1MMLA 1WLJA 3EPIA 2EX3A 2W7PA 2HAIA 5KG3A 5KFUA 2YNGA 1IKWA 1J54A 5L1IA 3O3HA 4G3IA 4CJVA 3SI8A 1N56A 2ILZA 1RBUA 3ZT0A 3AVKA 3DLKB 1IH7A 4KTQA 1S1XB 4UQGA 2ZE2A 5F8NA 4BE1A 2XHBA 4N56A 1ZBLA 1EKEA 4KKOA 4OLBA 1JLBB 4Z0UA 3G0ZA 3VQSA 4DU4A 1MU2A 4CIEA 3I0SA 3I0RA 4CJLA 3NHGA 5HBMA 3LP1B 4OVLA 4M41A 4DFMA 5C25B 1RDRA 3IAYA 3QEXA 1HNVB 3DRPA 1DTTA 3QIOA 1FKOA 1RT7B 3PVXA 3T5HA 1JLEB 1OS5A 1BCOA 2R2RA 4O44B 4ZVFA 2WK4A 1S10A 3HVWA 4CGDA 4LSLB 3G6VA 4IRKA 1QAJA 4FS2A 4J9RA 1IKYA 3AVLA 4GW6A 4FJ5A 4KB1A 3OL7A 3IN5A 5F9LA 2KZZA 1LWEB 4CK2A 4ICLB 3DYAB 1CXUA 3DMJB 1S1WB 3I5BA 4Z4HA 2XI3A 1RDDA 3JSMB 2BRKA 4RW6A 2YHBA 2JC1A 2RDJA 3VQ6A 4C8LA 3FFIB 3KHGA 3AO1A 1GOAA 4FZZA 2G8WA 3SPYA 4NLGA 4KPYA 4FJ8A 4L8RB 4ED7A 2JLEA 3SUQA 4FZYA 3KKRA 2HNZB 3HM9A 3P83D 4PUOA 4CHZA 4DF4A 1KRPA 3FDSA 2BE2B 3T1AA 5I42A 4I7FA 4NCGA 3RWUA 2WOMA 2IM0A 1L3UA 2XGQA 3NH0A 4RW4B 2FJXA 1HYZA 1LW0A 1C0TB 3PW0A 2XC9A 4FZXC 3VQCA 4ZTFA 2AX0A 5KFOA 2AU0A 3VA0A 3KLEA 1N4LA 4JUZA 3MF5A 3PX4A 5C42B 2A1RA 4IFVA 1S1TA 4WYWA 4FM0A 2EC0A 2RKIA 1VSKA 5D3GB 4CJFA 4JV2A 4CIGA 1NK5A 3N6MA 2DPJA 1WSIA 4FK0A 5J2NA 5L9XA 3NGZA 4E7IA 4DEZA 2ALZA 3TI0A 4DG1A 1BGXT 3Q8RB 2EHGA 1YTAA 3RR8A 1LW2B 3BGRB 3M9NB 2E4LA 4IQXA 3MR6A 1BIZA 1WNSA 3OS1A 4QWBA 3I8DA 4ZTJA 3BQ1A 5KFBA 3KK3B 1IKWB 3SJJA 3QEWA 3SNNA 4FXDA 4J2BA 3M9OB 4G1QB 2YNFA 4JS4A 4Z4GA 1S6PB 5C24B 3HSTB 1REVA 4KO0B 2ASDA 4CJKA 1S9EB 4WFYA 1JXLA 1B9FA 2OPQA 2ATLA 2BQUA 1ASUA 3ZSZA 4CK3A 2J6SA 2FJVA 3D0PA 3AO4A 4B9MA 2Y1JA 1U45A 1XI1A 3KK2B 2Z1GA 2IBKA 4FLXA 5KFWA 3CDUA 5T14A 3VQEA 4Q45A 3LALA 4O3PA 2R2UA 3KMSA 1NK4A 1I39A 1LWFA 3DRPB 1DTTB 4O4RA 1Q8IA 4DQPA 1FKOB 1S49A 2XY5A 3VA3A 3OY9A 4DL4A 3QEPA 4DL7A 2BGGA 3DDKA 4IR1A 2IAJB 4QW9A 4I9QA 4CEFA 2IM3A 4Q8EA 3VQ5A 5J2QA 4CE9A 3BREA 4CGGA 1O1WA 4KV8A 4XPEA 3QGHA 1KCFA 4TN2A 3RBDA 4LSNB 2I5JB 4KB0A 2HNYA 4KE5A 1BHLA 3IGVA 3NGDA 3DOKA 3QIPA 5EWFA 1RT1A 5KFAA 1ZBFA 3MECA 1RA6A 2C2EA 5J1EB 3SUPA 4GC6A 5EU7A 3PW4A 2W8KA 1W25A 1VRUA 2WRMA 3E01A 4PUOB 5KG4A 3U3GA 1LAWA 3CJ4A 3LANA 4YP3A 3WNFA 3NGIA 1B9DA 3H4BA 4WYLA 1TGOA 2QV6A 3TABA 4Z4FA 4IH7A 3KD5E 2YNHA 2Q3SA 2G8HA 4E3SA 3RAQA 3AVFA 4F2SA 1K1SA 3QZ8A 3JYTA 3HYFA 4ECTA 1ASWA 3QO9B 1NJXA 2X6NA 4EEYA 3BQ2A 3SCXA 4H4OB 4U6PA 4TQSA 3SYZA 3NCIA 1IKXB 3LZIA 3VQPA 3PX6A 2YNIB 5KT7A 1EP4A 2BRLA 3FSIA 1S4FA 1QHTA 3VQ4A 1VSJA 5J2NB 1RT6A 3EZ5A 4DSIA 3N6NA 3MR3A 2F8TA 4NZ0A 3LZJA 4FLWA 1WSHA 3AO3A 5EWEA 3B6OA 4PQUA 1S97A 3RR7A 5E41A 3PO5A 3MXJA 3WNEA 1S0OA 4ED6A 4NCAA 1HMVB 3IG1A 3NF9A 3TAFA 4NLXA 1JLAB 5FRMA 4MIAA 3ALYA 1RT4B 2GV9A 2YNFB 3KLVA 2UVWA 4FW2A 1HYVA 4I2QA 2OPQB 2V9WA 4E7KA 5F8LA 1RT2A 3CG7A 3T19A 4M3RA 4Y3CA 1C6VA 5KFRA 2LSNA 5DQIA 4BE2A 3TAMA 2XO7A 2FBTA 4OLAA 1X1PA 4R8UB 2QK9A 1SUQA 5KT5A 2W42A 2YHAA 5HRRA 1L3TA 4ED8A 4IH5A 1FKPA 3OYDA 3SFGA 3P5JA 3OJUA 3N6LA 4IBNA 4O3RA 5KFLA 1RDBA 4CHNA 1SH3A 3KHLA 3LP2A 1T94A 3QESA 1JX4A 4KHRA 4CK1A 1LV5A 2RDIA 1ZBIA 1ITGA 3NGYA 2IJFA 1VSHA 2V0NA 2IGIA 4FM1A 2IC3A 5J2QB 1BI4A 2JEGA 5F8IA 1U4BA 1ZTTA 4KV8B 3TAQA 5DMRA 4Y2CA 5DLGA 1KHVA 4XO0A 3DOLA 1IG9A 1NKEA 3PW5A 4FM2A 4AHUA 4DTUA 3VN5A 3MXMA 1S9GA 4RW9A 4ZHRB 4E89A 3KHRA 1XR7A 4DQSA 4XIUA 5KG0A 1NOZA 4I2PB 4J9QA 1RT1B 3DM2A 2RPIA 3DLRA 1TVRA 4N41A 1D5AA 2WHOA 4DTNA 3KTQA 4HVJA 4PWDB 2UUTA 2OPSA 4NYZA 4MFBA 4DF8A 2ZD1A 4J2EA 4Z4CA 4NYFA 1TK5A 3KJVA 1T03A 3RB0A 1T05A 3IRXA 2E6MA 1IO2A 3LWLA 3Q8QB 4YR0A 4CEDA 4DTMA 5DG7A 1S1UA 1RTIB 2VG7A 3H59A 1SV5A 1XR5A 3CJ2A 4ECXA 1C1CA 4EYIB 2UVVA 4IG0B 5FROA 5HROB 1X9MA 2PZSA 5KFIA 2IA6A 4B9UA 1D8YA 3DRSA 3V6DA 1BQMB 3PUFA 4J9KA 1RT5A 1RTHB 1VSFA 5KT4A 2IM2A 1TL3B 2HVHA 3SQ2A 3KLFA 1JLGA 4GC7A 1TK8A 1TKZA 1S1VA 4K50A 1NK6A 1EP4B 3L3VA 3ZSQA 4CEQA 3BSAA 4CECA 2W9CB 2FLLA 1NK8A 4HCCA 3MXIA 4ECVA 3RAXA 1NK0A 4K8XA 5FDLB 2D0BA 3PO4A 1HARA 1Q9XA 4Q8FA 4BE0A 2X74A 4DQQA 4ZPAA 4KHMA 2F8SA 1Z25A 1X9WA 3NDKA 4LH5A 1HNIA 3V1RA 4FJKA 4FJ7A 4N47A 4W5RA 3DLBA 1C0UA 4NLQA 4JV0A 5I3UB 4I2QB 3OL6A 5CYQA 2B5JB 4ED2A 1IKVB 2O4GA 1HQEA 3K57A 4IFYA 3OLAA 4LY7A 3GIIA 1SUQB 2KFZA 2WONB 4K8ZA 2VG6A 1JKHB 1KTQA 2RN2A 2D3ZA 1GX6A 2ILYA 4R5PB 3GIMA 4K4UA 3CFOA 4CF0A 1NJZA 5HRPA 2AGOA 1JLFB 1UOCA 4NLDA 1RT3A 4KFBB 3WNHA 4Y2AA 4JLHA 2XY6A 3GV5B 3DLEA 1HQUB 3H98A 5J2PA 2VG5B 2IOCA 5K14B 2FVQA 4CHQA 1JL1A 1VK0A 3NBPB 1NHUA 3V4IB 4E1MA 1WSEA 3MEEB 4H54A 2FLPA 3PZPA 1GOCA 3L8BA 4RW7A 4DU1A 3PJWA 4Q44A 3RB4A 2AJQA 1DTQB 2V4QA 3O3FA 4RZRA 1C1AA 4HUFA 1XHXA 1S9GB 4RW9B 3AVAA 3H5UA 4Q43A 1TV6A 4FLTA 1QTMA 3NF7A 4E19A 3CWJA 3C6TA 1WAJA 2G8IA 2OPSB 5HP1A 1UWBA 5SZTA 4B8AB 2HVIA 1KVBA 1VRTB 4KBIA 1HJRA 2BANA 3OSNA 2B43A 3NAIA 3KJVB 3VQQA 4DFKA 1T03B 2KQ2A 2WCXA 1T05B 4ZPBA 3IRXB 5HRSA 4AHVA 2FVCA 5JUMA 3NKYA 4CERA 4M3WA 1A5XA 1BQNA 3SPZA 3O4NA 1HPZB 4NLOA 3NF6A 4F4WA 3KLIA 4FBTA 4FVMA 4ECSA 4W5NA 4URSA 4KHQA 3TQ1A 4RNNA 4DSJA 1SH0A 4B3OB 2JGUA 1L3SA 4U7CA 4WFXA 4QWEA 2YKNB 3HVAA 5KFXA 3UDLA 5KFHA 3V6DB 3FRZA 4N5SA 1RT5B 4CFBA 4AHSA 3CIZA 1UA1A 4CHYA 3TARA 4ZVHA 3AVCA 3PX0A 4Q0BB 1U49A 4ZMMA 3CM6A 3OYJA 4KSEB 4IH6A 4BWMA 1S5JA 3BR9A 3QLHA 1BIUA 4H4MB 1Y97A 3D28A 2P1JA 4ID5A 1I3AA 4WE1B 4M94A 2ASJA 2P5OA 4NYNA 1S6QA 4CGHA 2OPRB 5CY4A 1SKSA 4IDKB 1JLQB 4ZP7A 2CKWA 3CQ8A 4DQIA 4NLVA 1C1BB 4FLZA 1NK7A 4Y34A 3GQCA 4OL8A 4CEZA 1HNIB 3S9HA 3LP3A 2DFHA 4DSLA 4RNFA 3NH1A 4JRPA 3SUOA 1N48A 2HNDA 5KFFA 3MR5A 4TLRA 3MEGA 5KFVA 3OYMA 2PYLA 4B9LA 3BSOA 3EYZA 4KHWA 4ID1A 4CJTA 1QE1A 1HQEB 1KLMA 3OYNA 2YNGB 3HT3A 3GV7B 3MEDA 5KTQA 4NLPA 4RG8A 4Y1CA 4DL2A 4J2AA 3LP0A 2ZE2B 2XWYA 2YKMA 5KFQA 1ZTWA 5KG5A 1N6QA 4KKOB 1RNHA 4F3TA 4ELUA 1MU2B 2W8LA 3DLEB 3I0SB 4KAZA 1KSPA 4M3XA 4MKBA 4C8KA 3I0RB 4CGIA 5C5JA 5HBMB 1TL1A 4TYBA 1DLOA 4QWDA 3PJXA 1XC9A 4MK9A 3OSPA 4GVMA 5KFTA 4DMNA 4J9NA 3OS2A 3RRHA 4FBUA 3MFIA 4ZP6A 1RDAA 1W0HA 4PY5A 3ZT1A 3ITHA 1RAJA 5KFJA 3CJ3A 5DK5A 4EZ9A 5KT3A 2XRIA 4ZP8A 1IKYB 3OYFA 4FJ9A 1U04A 4DQRA 4HHTA 2IM1A 3ZSXA 4BDPA 3VQDA 1UWBB 1RYSA 3SUNA 1S0NA 3V9XA 4Z4EA 3KKSA 4CFDA 4RW6B 3KIOA 4CFAA 1XWLA 2XGPA 3ZSWA 1HYSA 1J5OA 4JRQA 4E7LA 2BQRA 3NFAA 3KK1A 4Z4IA 3G6XA 2Z1JA 4QOZB 2QE5A 1Q9YA 4J9MA 2VA3A 3M8QA 4BWJA 3C6UA 4DTXA 2DFFA 3DI6A 5F8JA 4DTJA 5I42B 3V9SA 4I7FB 4NCGB 1WSJA 2WOMB 2VWJA 4K4VA 1QQCA 3K2PA 4O3QA 4WXOA 4K4WA 1QSSA 4YMEA 3SQ0A 1LW0B 4J9OA 2V4RA 3QLHB 3LPTA 4TY8A 2VA2A 4CEOA 1D1UA 3TR8A 2W9BA 4E7HA 1NNDA 5DG9A 4OKEA 3T3FA 3RBEA 3RRGA 3KLEB 3F73A 1JXEA 2XI2A 1SL0A 4IFVB 3V6JA 1S1TB 3QNOA 2RKIB 4IRDA 1TQLA 2D0AA 1JLCA 2HMIA 4FLUA 3UQSA 3DLHA 5KG6A 1LWCA 1TK0A 1KVAA 4TYAA 3H2LA 3ZSYA 4KTWA 4DG1B 4FCYA 1RTDA 4DWIA 2HHSA 3O4QA 4NLYA 4O0JA 2YV0X 4YQWA 5SWMA 2D7SA 4DTSA 5EUHA 3HXMA 3IS9A 3PV8A 3WNGA 3EZUA 4CJSA 1RTJA 4NLRA 3ZT2A 5DQHA 4ZPCA 5KFNA 4FLVA 5L1LA 1REVB 2ATQA 3AO2A 1N5YA 4HTUA 3K5MA 4GMJB 1A5VA 3V81A 5CYMA 3TAPA 3KNAA 2FBXA 3UPFA 4J9SA 4QPXA 3OYGA 2DTUA 4F8RA 4AHTA 3K59A 1WAFA 3C94A 3DRRA 5F8GA 1ZBUA 3I5CA 1LWFB 3TWHA 4CJ5A 5HLFA 3M8SA 1BCMA 4H8KA 1ZYQA 3LDSA 3H5YA 4ZPDA 4O55A 4N76A 4C8OA 3ITHB 1S0MA 4M3UA 1QUVA 1RBTA 2QXFA 3OYKA 2O4IA 5KI6A 3DLKA 4BACA 4DLGA 5DGAA 3THVA 4DTRA 3KLHA 3ZSOA 3M8PA 1YT3A 2FVRA 4RNHA 4KI4A 4FW1A 4RUAA 3S3MA 2FVSA 1JLBA 4F4YA 3NF8A 4ECZA 5KFYA 4O3OA 2HNYB 4Q5VA 3DOKB 3QIPB 4ECRA
chains in the Genus database with same CATH superfamily
1XUPO 2QZ8A 1YBUA 4A47A 3LP1A 4HKQA 3HSJA 1J5EJ 1A5WA 3FMWA 3UKUA 5C25A 4DTOA 4WZQA 3ENOA 1LFPA 8ATCB 2L08A 3ZTSA 3D6FB 2FZKB 2HQ3A 3HSCA 5L1JA 4AXIA 3QT5A 1RAOA 1D9AA 4YHHK 3M8QB 4CH1A 1FNMA 3TZXA 3E01B 3Q7BA 1V3ZA 3C65A 2MSSA 3OD2A 1IJEB 3KWMA 4ICLA 3R3LA 4W5QA 4V19J 3VQBA 3DYAA 1S9FA 1S1WA 4YNQA 3JSMA 1N32F 4QU7A 1RI7A 3Q8PB 4AH9A 4Y28C 1TFWA 4OQJA 4HWIA 4L6V3 3MM8A 3MMCA 2ZBCA 4EP5A 3MAAB 3L9ZA 3QBWA 4XAKA 1FJGF 1FTCA 4OGEA 3NNAA 1KOHA 2Y1IA 3C15B 4CM2A 3FSXA 4UF4A 4JI0J 3H08A 1KC8O 2IVOA 2BE2A 3RMAA 1PC5A 4LSZB 5SUHA 2V4JA 3NH2A 3JXUA 4PQUB 1SJRA 1SQGA 2UXCJ 1S6OA 3O4WA 4M45A 3IG1B 2O8DB 4DPWA 1SZ2A 4BDYA 5D4OA 1IXKA 4F4KA 5EGYA 2G1HA 3CMES 5HL7L 4QIEA 1Q53A 4HUEA 2YHWA 2V68A 2JC0A 2DFEA 2HHWA 1U1RA 2HQGA 2WB1D 3IWLA 4C1NI 3OL8A 3KG1A 5CYMB 3WXIA 4QCLA 2VWBA 3R5CA 3GFZA 2HHUA 4WFZA 4DU3A 1JJCB 2XMJA 4FJMA 3W66A 2AW0A 3PYFA 2E44A 5IT9O 2RU3A 4YOXA 3MM6B 1UA0A 1KWMA 3GYNA 3HFZB 5DLFA 1FE0A 1S6PA 4CH0S 1YRUA 4FYWB 2E29A 3KLHB 2D0CA 3OVNA 2CJQA 2KM8B 5CXTA 2BKOA 3H4DA 1U7LA 2O8EB 3HKWA 4C8ZA 3AVHA 4JI8J 4NXMJ 2RQCA 4DR3J 3OBIA 4P7VA 1VI7A 2VUGA 1R31A 1U6ZA 2CPHA 1OVYA 4URGA 3NGSA 2KXNB 2CPJA 4MK8A 3GV8B 4OJHA 1TMJA 4A46A 2R8IA 5AQLA 2ASMA 4JI6J 4BRIA 1IWAA 4G9ZA 4YEAA 2LDIA 3C3LA 2WBMA 1IG8A 1SV5B 1IVZA 1T9YA 1C1CB 5E0OA 1U47A 5AXMA 2MJUA 1ZBHA 4PKHA 3VGLA 3MXHP 2WTFA 4L76A 2XZDB 2Y1RI 3AOAA 3DLGA 3LAKA 4YOYA 3DRSB 2E5LK 4LMZA 1I1GA 4QIWD 4DL5A 2RU9A 1VQ6N 1B64A 2AWZA 2HZAA 1JLGB 2R2SA 2VICA 1J5EF 3G86A 2Q0UA 2JNJA 2DR5A 3F2KA 4J5OA 4U8YA 3MCNA 1V5VA 4M95A 1S77D 2HHVA 2J76E 4ZJQA 3RMCA 1W7WA 1M5HA 3ZZRA 4E7JA 4X2BA 4ECQA 2ITGA 1AA1B 1A6LA 3GJSB 2PIIA 5KFMA 4UZCA 5M1OA 4KH5A 2Q3PA 1KTVA 4OGCA 1VBYA 5LJ3Y 3TQEA 4LF6J 4F2RA 3G6EN 1NJYA 3HJFA 5C2DA 3HZ6A 1ZPWX 2V63A 1TP7A 2OGUA 4C6AA 2Y0BB 5CYQB 1Y5IB 3DGVA 1TR0A 2JEIA 3EVMA 4IFYB 4OKKA 4W5TA 2ZJRL 1XHZA 3AA5X 4FJLA 4KT0C 2CPZA 4MIBA 4K8RA 5CZVA 4BRGA 1VQOS 2MEWA 9RUBA 1JXBA 4YR3A 4JHDB 1WJ9A 1HMVA 1RT3B 2E1CA 3H3OB 2P9UA 1JLAA 4QR2A 1U02A 1V6HA 1NGJA 1BY9A 2D41A 3B6PA 3M1VB 2D3OR 3FSYA 1WWHA 4ECUA 3HVTA 3VF6A 5MAOA 2GJIA 4U67Q 3L3CA 4BRCA 2VQEK 1M5VC 1APSA 1IBLF 2EVZA 3NRBA 2ZH4A 2VHGA 2G2OA 4DV4K 1F5AA 1PJ7A 5FJ4A 4RNMA 2QYGA 1RAAB 2KL8A 2D9OA 3HPOA 4KBOA 1MW7A 5LMUF 1RQ0A 1HNXK 1NKCA 2FSKA 2HQIA 2OEKA 2WVCA 5C0YA 3R5DA 4BR7A 4A48A 3U1NA 2W01A 3GONA 2XSJB 1C2PA 4DJBA 3CF5Q 3NMAA 2NNWA 1JIHA 3NAEA 2EBGA 3AVIA 3AA3A 2VBWA 2XMVA 3G96A 1T3NA 3R6GB 1CQMA 5J1NA 4EBCA 3BSNA 1Z4UA 5KQDA 4XTTA 2YKAA 1CJTA 4JI8F 3LH2S 3S41A 1ASVA 5AQZA 1T3VA 3M6GA 1VQ8N 3AAWB 1CZBA 1XMOF 4IFEA 4FWNA 1JK9B 4ID5B 1ZM3A 1ITPA 4RO0A 1PJ5A 3HHNB 2QLFB 1YRXA 3V1OA 4O8UA 2N82B 4AE5A 4CO4A 2GIRA 2QKBA 2NZTA 4DU8A 2J6UA 4CHOA 3QGIA 4MLHA 2BJEA 4CNYA 1VSIA 5KFDA 1QHAA 2HFZA 2NXUA 5KG1A 1H73A 1BQMA 1QS4A 1ZA1B 5KGWA 1K0VA 3SMZA 4QU6A 1RCXB 3D2EB 1RA7A 4FYYB 5G4DA 2MZRA 4PA1A 2A41A 4LF9F 5BPMA 2BA9A 2XMMA 5AQMA 3KMQA 4CTAB 2YX4A 3LP0B 2EG2A 2OD6A 3BKUA 5AJ3K 2YKMB 2P9SB 2DCUB 3PW2A 3ZO7A 3ZT4A 1QZ6A 4FJHA 4FKYA 2YVSA 4K2XA 4P7TA 2R2TA 4OYIA 3CJ0A 3F41A 2XSFA 1RHMB 4USVA 1YHQS 1KLNA 4IJNA 3SQ1A 1TZ0A 1KHWA 2CWKA 3VALA 3HHKA 3QZ7A 4N8NA 5H9FK 3EE3A 2L9DA 3CDAA 4R5PA 1H72C 2HHPA 4UTGA 1F5CA 3GMGA 2ZITA 2OZMA 3EUNA 4LR8A 1MN7A 2HS4A 2MTLA 3JB9k 4CYUB 3CCUS 4ZS6A 5K14A 3PHTA 4GKJF 3NBPA 2QT7A 1K8KB 3MEEA 2F40A 3CHWA 3OYEA 3SSSA 5FLXY 4FJXA 2WC9A 3S3OA 5I4MA 5BRDA 4FF2A 4FLYA 3J7A1 1GAOA 4KC5A 4DV3F 3FGUA 3AQPA 3DKDA 2GJFA 4CO1A 3THXA 1LWEA 2V94A 3ZZUA 3WQPA 3VQ8A 3SDEA 3QAEA 2BACA 1K1QA 4EYHB 5LXYA 1W26A 3J7YP 3L2WA 2VKRA 1TTHB 1N8RT 1LQ9A 3KHYA 2P9LB 5HQMA 3W61A 2FYXA 2R7TA 2J8AA 4J91A 2HRUA 3D4JA 1Y3JA 2D69A 1KS2A 2BJ9A 3V1QA 3KLGB 4B3RF 1NHVA 4DV5F 4UW2A 3M5RA 1W7AA 1SVDA 2LYVA 3M8ZA 1CSJA 3PXGa 1XMQJ 4PXDA 3L2VA 2V8VA 2X51A 1VSLA 4CIFA 4YDXA 5CZXA 1M1KT 1S48A 4NI2B 3H0PA 3FZMA 4B1ZA 3MI7X 5F3TA 4JNEA 3JAMY 4IO1A 2HBYB 2PDAA 3VENA 3RMDA 2W7OA 1VOMA 2VKZG 3I31A 1HBNB 1JLQA 3PEJA 1N5YB 4X64K 3BJYA 3GIJA 1E3MA 2FBVA 5IWAJ 4C0HA 3PIOQ 2LVWA 1BWVA 3V81B 1W9HA 3O44A 3N4QA 2R8GA 1OH8A 1X4CA 2E2PA 4M3TA 4F3OA 2UUBF 4RR5A 1VQNN 2MSTA 2JEJA 3H5SA 1WUUA 2IDOA 4PKGA 3ZZZA 2DGTA 5J2MB 4HEA9 2R4FA 2AEMA 5JMNA 1U09A 5DGBA 2NZ4A 4QZVB 1YQHA 3WX8A 5GAHU 2KM8C 2CJKA 2YNGA 2XZTB 2O3DA 2PFFB 3BEXA 1ZOTA 2AP6A 3SI8A 1N56A 3FLCO 1IQZA 4UY8O 1EHWA 3ZT0A 1IH7A 2DK2A 4UQGA 2ZE2A 4H5RA 5FLXO 4I69A 2FD2A 3GJRB 3D6TB 2DGWA 4KKOA 5IT0A 3ZZPA 3W5XA 4B17A 3I0SA 5B0FA 4LREA 4JI3J 3I0RA 4JKCA 4M7XA 4LF7J 3LP1B 3UKUB 4JKAA 4M41A 5C25B 5A76A 4LFAK 1RDRA 4OFZA 3IAYA 1J27A 2R7RA 3N0VA 2E1AA 2DY9A 3PVXA 3IM9A 1OS5A 4EK2A 3O9TA 2CJBA 2QWOA 1T9TA 4FN5A 1HWJA 2DH8A 3MMAA 2OTJN 1VQ8S 3SCKE 1NGDA 4FJ5A 4OO1J 1P8GA 2DRDA 3CJSA 1U1NA 2UP1A 1CJKA 4ICLB 2IYIA 3DYAB 2P9IA 2HSEB 3K2YA 3J7ZT 2YWFA 1S1WB 2QM1A 4J7CA 3JSMB 1ZM4A 2YHBA 2JC1A 4ZIWA 2W2OP 1PC4A 3TJAA 4D3HA 4C8LA 4HACA 1RHQB 4L3NA 3MM8B 3MMCB 1EKSA 3SPYA 4NLGA 2GGPA 4FJ8A 5HANA 4L8RB 5KQ8A 3SCLE 2GAHC 5AQTA 3SUQA 3VAHA 4FZYA 3RBZA 4PUOA 2LLZA 3FDSA 2BE2B 3F0NA 3QAUA 3JAMO 4BC7A 2KB2A 4GKKF 3DHXA 1L3UA 2V4JB 2XGQA 2P9NA 1FKAF 4WTOB 2FZGB 4Y2KA 4LC9B 4FKXA 2DCLA 4HTJA 5A8RB 4DR6F 2V2ZA 5CD4H 2BE9B 4NLCA 3C7NA 4JUZA 2A1RA 5I9EB 3THTA 2HHHK 5A0YB 4WFAQ 1S1TA 3WIUA 2H48B 3CCZA 2DHXA 2A6AA 3ZZOA 4CIGA 4JKGB 4DV6J 2GAGC 3VTHA 1UVJA 3BKFA 3WXJA 4OJGA 1E6VB 3FBFA 5K5MA 4DEZA 4DG1A 1XNQJ 4B02A 4JI4J 3Q8RB 2EHGA 3BGRB 3QDKA 1YK9A 2LDYA 1KQGB 2HF4A 3N01A 4IQXA 3VF2A 1BIZA 2DHSA 2XMTA 3FVYA 5KFBA 5LMNF 3GDQA 4J2BA 2HF3A 1S6PB 4Z7YA 3AJ1A 3FEXB 2YXLA 2RHQB 2OPQA 1RWMB 2ZH9A 4DR4K 4P75A 3DN9A 4CLTA 7FD1A 4CK3A 1J6ZA 2W4CA 2FJVA 3W3DA 4PYAA 3KG4A 1NPKA 3TPQA 1Q7YO 2Z1GA 3P8BB 3CDUA 4YOWA 1ULRA 3ZYYX 2R2UA 1YAGA 4CP5A 1I39A 3G82A 3EKSA 3DRPB 2MLZA 1FKOB 1S49A 4QS8A 3OY9A 3ZLJA 1ZBTA 3TJ8A 1W2BM 4M5HA 2BGGA 2XTJP 1BU6O 1HNZF 3DDKA 4LFCF 4I9QA 3OT9A 3BGOP 5J2QA 4CE9A 3BREA 1O1WA 1KCFA 1XC3A 4UOFA 1FDDA 3BH6B 4KE5A 2QYCA 2B51A 4E1JA 3IGVA 2OANA 5CH7B 3CJCA 5LSRA 1S79A 1RA6A 3ZTRA 2C2EA 2G9OA 5L8RC 4YN3B 3HX9A 2GUPA 3PW4A 2E5IA 1VRUA 3SSRA 4MO5A 5KG4A 1PYOB 3HRGA 1N5SA 1B9DA 2BUNA 1DQ8A 3VGTA 3PG9A 4OX8A 3B4MA 3HOTA 4C23A 3AOCA 3IBWA 5ELZA 5AT1B 5B0EA 5C10A 5GAGP 4UOCA 3NGKA 4FF1A 3KD5E 2K7KA 5CAAA 3RAQA 3H45C 1K1SA 3HYFA 2VOOA 4DV1F 3HJVA 2DGXA 1ATSA 1ASWA 3IRWP 3JS9A 2F9DA 3A5OC 2VFTA 5I3QA 3D67A 2BRLA 3FSIA 4WK1A 2VPWB 5AQVA 5J2NB 2OSRA 3MR3A 2ZM6F 2DEIA 1UJ5A 4NZ0A 3LZJA 4FLWA 4DR2J 3KUHA 3R1XA 3B6OA 2A18A 1S6UA 3MXJA 2K3IA 1S0OA 4MDBA 2JL9A 4NCAA 1HMVB 3NGTA 1FX2A 1H6KX 3TAFA 3S6EA 2P9UB 1JLAB 5FRMA 3FCWA 2Q6BA 1IJJA 2YNFB 4NA3A 3QFPA 3EMTA 5AZJA 4YB7A 4I2QA 4USWA 2CQ2A 2GCFA 1RT2A 1LKZA 1KAXA 3QNWB 2DRBA 2FLOA 5BJRA 1M5KC 1O6XA 4LF8K 5KT5A 2YHAA 1HWLA 2DNPA 1L3TA 4ED8A 1R6VA 3OYDA 2IBOA 2XB2D 3OJUA 1IBMJ 2OTJS 5TKYA 1BC6A 4X4OA 2MKIA 5KFLA 1RDBA 4YORA 2ZF5O 2JWNA 1OY8A 4IEIA 3LP2A 1T94A 4KHRA 1KP6A 1JWWA 2W2MP 3TEGA 2V0NA 2IGIA 2PA3A 2OTLN 4U95A 1BI4A 1VAZA 2JEGA 5HSPA 3OTOJ 5DMRA 2E2OA 2QLJB 5AQOA 4N77A 1OQ6A 4AHUA 5HN0A 4DTUA 4WFBL 1S9GA 4E89A 2ITMA 5KG0A 1NOZA 1FNOA 5H9EJ 1RT1B 3DM2A 5DETA 3CQXA 3J7AN 2ZD1A 5E5NA 4J2EA 4NYFA 1TK5A 3KJVA 4F7VA 4P10A 1T03A 5E33A 2BJ3A 1N34K 4OI4A 3Q8QB 1NLVA 3RU0A 1X8DA 1S1UA 2VG7A 3WUHA 4I64A 1KAYA 3D7SB 3LUYA 2UVVA 1NGAA 4DR7K 2CQ3A 3MCOA 1D8YA 3HHDA 3O3LA 1RLCL 3VHQA 1RWOB 3J81Y 2B7BB 4YS2A 3LA0A 5IZHA 3V6DA 1BQMB 2F4VF 3OTBA 4Q2LA 1RHJB 3PRBA 1HBMA 3AY9A 4ZVRB 5KT4A 3WBZA 4JI5K 3SXLA 1S1VA 1CULA 2K7JA 2LQ8A 1NK6A 5E26A 1UZDA 2MKCA 1NK8A 4ECVA 3D2WA 4A8WA 1Q9XA 1ZC6A 4JI2K 2ZJQL 4OV6A 4DQQA 1RB0A 5DZ7A 3WDOA 1RE1B 2ZOGA 1SC1B 4PXEA 3DWLA 1X9WA 4B3SJ 2L3MA 1N36F 3OXGA 2PFUA 1OY9A 1X3NA 3FC9A 4JYAJ 1C0UA 2CQPA 2PAVA 2LXUA 1IR0A 2NRRA 1JCGA 3OR1A 3OL6A 4CZCA 1R7IA 2O4GA 3PIOL 1WHWA 1KQSM 2Q1NA 1SUQB 3DU6A 4RWTA 4DV7K 1VQSA 3FMBA 2D3ZA 2IVFB 4R5PB 1GMVA 1G2EA 4CF0A 4B3TJ 4DPTA 1WC3A 1OH7A 4NLDA 5AQSA 3IR5B 3CEDA 2KKZA 4DUYJ 5K14B 2FVQA 3NBPB 2QA1A 3MEEB 3PZPA 1X4AA 2QN6B 3NCPA 2V4QA 5GAEU 1C1AA 4I6MA 1Q8BA 3Q7CA 4H0YB 1BE4A 4RW9B 1V3SA 2MMYA 2DKOB 1K8AO 1TV6A 4FLTA 1C0GA 1U2RA 3THXB 2DNNA 2PD1A 3O6QA 1IQTA 3K8WA 5HP1A 5SZTA 4ZVSB 2HVIA 3SDEB 1HJRA 2BANA 3TR5A 3OSNA 5AQFA 1Z2LA 4HR2A 4OZ3A 3R5AA 3BN4A 1H2UX 3J81O 3FCHA 3ILJA 2WAQD 4LF4F 4UUWA 3NKYA 2BJ8A 4Y2MA 3SPZA 3JSRA 4C3LA 2NSCA 2F5GA 1VJQA 1NDCA 3O5TB 1HR0K 4F4WA 2PBDA 3T1HK 4FVMA 4LBIA 4ZKAA 4W5NA 2HS3A 4URSA 4KHQA 3TQ1A 4DSJA 3OTOF 2YTCA 2ZUGA 1L3SA 4WFNL 4U7CA 3D3CJ 3KNGA 3UDLA 5KFHA 3FRZA 2Z2MA 4AHSA 5U47A 3PIPL 4CHYA 3QT8A 4JKHA 3WHIA 1T6DA 4ZMMA 3PSFA 4BGAA 3PJ9A 3OYJA 4EWTA 1WORA 2ZNZA 5AE1A 4BWMA 1S5JA 2ASJA 1HJOA 1Y5NB 1H7WA 1I94K 1S6QA 3UN2A 1WHVA 3ZX2A 4L73A 3GR0A 1RU1A 5BPNA 4ZP7A 1JLQB 2AKWB 2MKHA 3CQ8A 4KGKA 4XDDA 4Y34A 3GYXB 3GQCA 1FERA 2J8SA 1RABB 1VCTA 1HNIB 4DSLA 3OVSA 2F9JA 1XJWB 3NH1A 1N48A 3A3PB 3P49B 1K47A 2QLWA 5K8OA 3MEGA 5KFVA 2LECA 3JS6A 4ZDNA 4OLOA 1HQEB 2V51B 1Q81O 2J0WA 1QY7A 1VR6A 2B56A 4DL0C 4YDUA 2YNGB 3AA8A 3GV7B 2VQFJ 1ZM9A 3RVCA 4TVAB 4J2AA 4A8XA 1ZAVA 2DR7A 2JFDA 2ZE2B 4DN0A 1RCOB 4JV5J 2EFNA 1FWKA 4M5IA 3M2VA 1ZTWA 2OTLS 4KKOB 4TNOA 1RNHA 4X66J 2KHOA 3I0SB 2HWTA 2GVDA 3I0RB 2KHDA 2VOPA 1FFSB 2WVDA 2R7VA 1TL1A 2IA0A 4B3SF 2EWSA 4GVMA 4DMNA 1GLCG 4J9NA 1U0SA 3RRHA 3U9ZA 2MHEA 3MFIA 3ZT1A 3ITHA 3X3UA 1RAJA 2V8HA 1UVMA 5JJBA 4FL9A 2XRIA 4ZP8A 3MMAB 4FJ9A 4DQRA 1IBKJ 2IM1A 1CJKB 3M6XA 1NGCA 4Z2XA 4LF5K 1RYSA 2VZ9A 2C3OA 4ERDA 3KKSA 4HACB 5IM0A 2BJDA 5M1KA 4JRQA 4E7LA 3NFAA 1V9OA 2GGPB 2E1PA 4QOZB 4DCOB 3UNYA 2VDHA 4DUYF 2BKNA 1YI2N 3QWPA 4PL7A 2NYIA 4R79A 4MYTA 2YWHA 2DFFA 3DI6A 2X3DA 2QA2A 3V9SA 1WSJA 4K4VA 2P9NB 1G6BA 4O3QA 1M5SA 2Y8WA 2BM0A 2B8PA 1DQ9A 4UOGA 3LGNA 2V4RA 2VA2A 4IO9Q 2IVMA 3BN7A 3BY5A 2VFRA 3RBEA 1VK3A 2AP1A 3C7NB 3F73A 2ZHBA 3TYTA 1JXEA 3A3OB 1SL0A 3QNOA 1S1TB 3VAJA 2D0AA 1JLCA 2HMIA 2DNHA 2Z8QA 5KG6A 2OI2A 4YB1P 2J4RA 2YQ0A 3H2LA 3NWRA 4DG1B 4FCYA 5B0AA 4OHYA 3IBCB 2E66A 4F4AA 2HHSA 1X4FA 4NLYA 1LCUA 5EUHA 3ENHA 2ERRA 2CRLA 4PPZA 4K0KJ 4CLLA 2YX7A 2E5JA 2VC0A 3B6BA 4C3KA 5KFNA 2NR0A 5C15A 2M3DA 4U9RA 4DDFA 1A5VA 3HKZD 1IR1A 3TAPA 3CC2N 3CXCM 4GV9A 4H4KA 2HFSA 1VQ9N 1NM2A 2GQCA 1H74A 2NXJA 4ZCKA 4CLUA 2BJ1A 3C94A 1P6TA 2LEAA 4LFBK 2V7ZA 1ZBUA 3MAHA 3TWHA 5CHCB 3M8SA 5HJYA 1FD2A 3U1MA 5E3CA 5E7OB 3QFWA 1QUVA 2MKYA 2IRUA 5IOLA 5D15A 3OYKA 4DLGA 4PG5A 1OO0B 5JVHL 4RUAA 3S3MA 3P4UB 1HNWF 1JLBA 4F4YA 1QD1A 2GIFA 5KFYA 2NQPA 4O3OA 4AT1B 3M8WA 7AT1B 4YHHJ 4JV5F 4ECRA 2AEFA 1J5OB 4IOCQ 2J6TA 1X5OA 1XNRF 3TA1A 1FF2A 1HNVA 2Z1HA 2VC1A 1RWVB 1RT7A 1VHFA 3ASMA 2FJEB 3CCMN 4ZN1A 3BSCA 4A57A 1RP5A 4DL3A 2G4BA 1VRUB 3AB4B 3OFEA 4HTLA 2BEFA 5HAOA 3BBBA 4PG4A 4IQMA 3J80U 3U6FA 4ECYA 2OYQA 3SQ4A 1DAXA 3DMJA 2V9KA 1RDCA 3T5JA 2HYIB 4PHTX 2OZSA 1HFEL 1C0MA 1N88A 4DLEA 2ROEA 2KFNA 3FFKB 3Q8YA 2X6SA 4K42A 4KHUA 1NJIO 4NLTA 4CBXA 2AJ1A 5C7PA 2UXBK 4WJBA 4ZJLA 1U2VA 3J7YU 2ETJA 2K8GA 3F9KA 1LWXA 1RBRA 4I4BA 3QGGA 2CPDA 2ZKUA 3SCIE 1VLOA 3G10A 4FWOA 3QNNA 4XK8C 4BRMA 1VQLN 2LKZA 1HKAA 2XCAA 5F8HA 5B7WA 4WU2A 1H3DA 2VWKA 3WEEA 3NXZA 4M5MA 4ALZA 1IWGA 4OHZA 1OH5A 1C0TA 1FW6A 1YITN 3H8YA 3ZZ0A 1TMMA 3A1YG 2NPFA 4ZOSA 2IIRA 4HH1A 3V4MA 5GADP 3SAHA 5AZJB 3QGPA 2F8MA 1Q1KA 1RT2B 2HHTA 4HHHA 1BHNA 4G1PA 3OUYA 2CQCA 3MDQA 3CO9A 3FJ2A 4F50A 3NAHA 1Q82T 2VH7A 4MH8A 3Q0AA 3CQYA 1LW2A 5HLFB 4CESA 5DS7A 2MQMA 2E1RA 1BISA 1CJUA 3BEGB 4ZVGA 3LP2B 2Z0GA 3KK3A 4DSFA 2H3GX 5F2RA 1T02A 1U6FA 3BDPA 3EKUA 3VESA 4RUBA 4KO0A 1BI4B 1KVCA 3VEOA 1S3XA 1GTEA 3BUZB 1RBLA 2NUHA 4B8CA 3HHLB 5M1PA 2HWIA 3T5LA 4LH4A 2AJ2A 3E66A 1EIYB 3T6JA 2O8BA 3DM2B 1RZMA 1NGGA 3POTB 1QVGR 4MT1A 4CW7B 3BPDA 2EFQA 4CZEA 1WOQA 2HB5A 2GJ2A 1JCFA 2ZD1B 4OZ0A 4NPOA 4FS1A 3VGKA 4RBVA 3GL1A 3FZLA 2FGCA 2M70A 3TTCA 1KKHA 2C2OB 4DUZK 4MK7A 4ED3A 4FWRA 2ZBPA 4KGXB 1WN7A 1KN6A 2DB1A 1S1UB 3QATA 5DM6Q 2E5LJ 4C0BA 2VG7B 3GLJA 2XLJA 1FEEA 3UR0A 4CF1A 3S01A 2E9RX 4E0DA 3AV9A 1UFLA 3ZT3A 4ZVEA 2UUCK 3DOMA 5J1EA 2HGMA 2J0QD 1VQKS 2YPZA 1T11A 1SL1A 4JN4A 1QSYA 4KB7A 3W8PA 4CLPA 4AHRA 2JRSA 5EHHA 1S1VB 2OPPB 2N7CA 4I68A 1J53A 5KG2A 5THWA 1NJWA 4O3NA 5DZ6A 2ZDPA 4CNZA 2CPIA 2HBQB 1KQKA 5B0BA 2MQPA 3OW2R 5D4NA 1Q95G 5EN1A 4EHTA 3M05A 3QINA 3PW7A 4O0IA 1JQGA 4AHCA 3G4SN 3LOUA 4JI7F 3HI9A 3H7HB 1RWXB 4NRUA 2C28A 3W9JA 2HQFA 2KVIA 1TKTB 1KONA 1SC3B 1Y0HA 4FYXB 4DHVA 1GXLA 4EO8A 1C0UB 1JJ2R 5KPRA 1XQIA 3NG8A 4TY9A 4IG3A 1M90T 4KHYA 3OR1B 3MX2A 3HD2A 1IKXA 3GCWP 4CO2A 3AVNA 2IY5B 1KOOA 4R0EA 5EDWA 3BO2A 4P2MA 3LAMA 1RKIA 5BYQA 2JFKA 5KOXA 1GMUA 4OZ1A 3CCTA 4OYOA 4RW8B 1FA0A 3ENBA 2JJ4D 4FWLA 1HBUA 1YTUA 1OY6A 3HLUA 1TAUA 4I67A 4KI6A 2ZHAA 6AT1B 2VQEJ 3VEXA 1RT4A 5KFEA 2X7IA 3CCRN 4DV4J 5JVGQ 3ULEA 3E2EA 2HBZB 1AW0A 4LQ3A 1TKDA 2NXEA 2RF2B 1ZXOA 3FQKA 4I6MB 1HNXJ 3RB3A 2MZQA 3G6YA 3CCMS 4FJIA 2Z1IA 2NUUG 1TV6B 4A62A 3H5XA 1SKWA 4PQAA 5KG7A 3W9HA 5FPNA 4F4ZA 4FK2A 3HP6A 1RYRA 5HP1B 1FE4A 1WG4A 4G1IA 5CZ2A 1A0OB 2BANB 1HHTP 4EZ6A 3I33A 3MURP 2DRAA 2PMZD 4K43A 2GHVC 1N32K 3U3YA 2ZVIA 2W25A 1FDBA 4CJQA 3PDNA 3OFGA 2MQLA 4X4UA 1R0AA 3C14A 4O5BA 3QT6A 1FJGK 4ZHRA 3NWGA 1YJ9N 1ZETA 3N5FA 1AXQA 2CUYA 1BWEA 2KT2A 4DFPA 4PWDA 1VQLS 4CBWA 2X1BA 1TKXB 3V2UC 1VC0A 4ZP9A 1WSGA 2V7YA 1UKUA 2F9WA 2B6AA 4IOBA 3VV2B 1SI9A 2A2CA 2XEXA 1K44A 2XYGB 3I82A 1YITS 3IDHA 2BVZA 1O0PA 3T41A 1FWLA 2NRZA 1S6QB 1RTIA 1QAXA 5BXIA 4X62F 2KZMA 1MLAA 5IS2A 4IG0A 2PYJA 2B0GA 3GIKA 5HROA 3D6MB 1RDWX 2KTQA 4ILHA 1M1KO 3PR5B 2E5LF 3EICA 3GWCA 1RAHB 3MR7A 3SEOA 2KRBA 3G8QA 2C42A 5GAGU 5EY4A 4YY3J 1FXDA 2B9XA 4ZPVR 5H1SV 2E6LA 3AT1B 3CJBA 3MEGB 1TL3A 5AJ3J 1WC6A 1RISA 3AH6A 2R8KA 5LXRA 2HLTA 3V6KA 2BTFA 3LM9A 4MTPA 2RVJA 4CO0A 2Q6CA 2YWKA 2KG0A 1UAWA 1EZZB 2MZJA 3ZXWA 3UN3A 2G8FA 1VBZA 1F3FA 5L39A 1BLUA 3BB5A 3CC4N 4YFUA 3M2VB 2XMUA 2V67A 2CQBA 1DURA 2YQ1A 3SV3A 2GVDB 2I7PA 1EETB 1REGX 2Z4PA 2Q31A 2VCPA 5H9FJ 4CJUA 4CJPA 1YVUA 2G8UA 3H46O 1NKBA 1TL1B 5I3UA 1QAIA 1FWPA 3CCQS 2F96A 2A3JA 2KU7A 2O8CA 1U8WA 1B92A 4BR4A 2FSNA 5BYSA 1IKVA 1WF0A 4CZLA 1EXQA 1HKCA 3L09A 2Z30B 4H5TA 1JKHA 4LR7A 3CFRA 2WB4A 3O3GA 1S1XA 3I55S 1JLFA 1KNZA 4CJ4A 3UKRB 1WG1A 1N0VC 2HHQA 3W2WB 4CF2A 1Q7YT 4UQTA 3LW5C 3RB6A 5IM0B 4A8MP 2MZTA 3CJAA 2RD5C 4BRDA 1FK9B 1NGHA 4QWAA 4ITSA 2R7WA 4PZVA 1NPRA 1X4BA 1SKUB 3MR2A 3OYHA 4FYDA 2M0GB 5DQGA 3J7ZO 1JLEA 3V9WA 4HDGA 2GIQA 4O44A 2QTDA 4DV4F 2COLA 1T44A 4KHSA 1Y11A 3BV8A 1J5EK 3HO1A 3TX0A 3DI6B 2IRXA 5KT2A 3OTCA 2MQOA 2VB6A 4DV2J 3EGNA 1YJWN 4IOCL 4CFCA 1HX1A 4CGFA 3PM9A 1HNXF 3A8YA 1NMEB 3FGVA 4AILC 2LQ5A 4KAIA 3T1YK 1FRIA 3DXSX 1R0BG 1CBKA 2ZQBA 5K8NA 1HWKA 3G4SS 4UY85 2KW4A 4NL5A 3AA9A 2P5GA 1O13A 3TAGA 5D0EA 1AFIA 4XDCA 3TWZA 4A59A 3V9UA 2E1MC 3L3UA 2HBKA 5ETTA 3OR2A 4OPKA 4BC4A 2GC8A 3CNQP 3EVOA 2RRBA 3TUZC 3AAPA 1R8BA 1IV0A 3NY0A 1U1LA 4K5RA 1P27B 2B4JA 4JK7A 5AQKA 4CJ3A 3ISZA 2JLGA 2OKQA 2V2QA 4X64J 3DJCA 4USUA 2FHOB 4H4MA 3WXKA 4BC3A 3ICLA 4KHPF 3P5TL 3I4HX 5HMYA 3V9ZA 3VF0B 4BG8A 4NLSA 3W2VA 4ZJOA 2VF3A 4IDKA 4PG6A 1LOTB 4KGZB 3NMUA 3AD8C 3AGKA 4IRCA 4O4GB 1T0TV 4M63A 4Q2MA 1K9MO 3IWXA 1SC4B 1WSRA 5ETSA 1T9XA 5BYRA 3TSQA 1M5OC 4DTPA 2B4UA 3L4IA 1YJNN 1SH2A 1XERA 2MKJA 1IBLK 1KXPA 1D9DA 2AHOB 4UOHA 4B9VA 2LXIA 3M2RA 2D5RA 2HIYA 3HULA 5A2QO 4FVUA 1BA0A 2XY8A 2EX3A 2W7PA 4YY3F 2M9KA 2BYCA 2QMXA 5LMUK 1IKWA 1SB6A 4G3IA 4CJVA 1OPZA 3VF4A 2HZCA 3HHLC 2QTWA 3RRKA 1UW9A 4NWBA 4KTQA 5F8NA 5F3ZA 2XHBA 4LFAJ 3EXYA 1EKEA 3QBXA 2MQQA 1JLBB 5GINA 3G0ZA 3VQSA 1MU2A 4X4RA 2IRYA 3CPWR 5IT9U 8RUCA 1FRHA 2G13A 1N33J 1YJ9S 2E20A 2J9CA 3LGMA 1LK7A 2CVEA 1HNVB 3MM5A 1DTTA 3I4PA 4MYUA 3QIOA 4Y0WA 1RT7B 5CE3A 3T5HA 4M5KA 4C9DA 4QBUA 4ZVFA 3HVWA 3BGFA 4CIOA 1UP1A 1EAYC 4LSLB 3G6VA 1QAJA 1XMOK 2XBPA 1VBXA 4KB1A 5F9LA 2KZZA 3VVUA 3DMJB 5CD4A 4M5LA 2Z2YB 1QM9A 2WBRA 2XI3A 4Z4HA 3E1YA 1X4EA 2BRKA 2P6TA 1VFJA 3GP9A 1RU2A 4P71A 2ZH7A 4OZ2A 4CH7A 3KHGA 4X4SA 2YKOA 4RPFA 5LL6Z 3F9MA 2HSTA 4KPYA 2CDRB 3LDPA 2JLEA 3D2FA 1PSDA 1GNKA 1U2VB 2YBVA 1OKJA 5AXKA 4CM0A 4I6YA 4LF9K 2AEJA 2AYGA 3P83D 2RQMA 5A8KA 1KRPA 4V19S 1KQFB 2V50A 4JI1F 1KR4A 2UXDK 2JLFA 5KAKA 4A2AA 4I7FA 4NCGA 4P2SA 2WOMA 1RWWB 3NH0A 2RAQA 5GADI 2MLYA 2FJXA 2A2DA 1HYZA 1C0TB 2HHHJ 4DV2F 3BF4A 3CC4S 1VQ4S 4DBQA 2QWQA 1VQMN 1X5SA 3BDEA 2BW7A 2OAUA 3OA9A 3VQCA 1VQYA 2AU0A 2B8QA 4DI6A 3WIVA 1Z05A 1N4LA 2ZJPQ 4ZCMA 1FJCA 5ADXH 1RACB 4WYWA 1VSKA 2AJ4A 2JZ5A 4JV2A 2WVEA 4UUXA 1NSKL 2OEJA 2H5EA 3W65A 1Z6RA 3JQMA 3FBBA 4WF9Q 1YTAA 3CCJS 3RR8A 1LW2B 3MR6A 3BR8A 4ZA1A 4DR4J 4R0JA 4ILGB 3I8DA 3BQ1A 4DQ8A 3KK3B 3SNNA 1DFDA 1VYAA 4DXLA 3B78A 3DXMA 4JS4A 4Z4GA 3HSTB 1REVA 2G0JA 4KO0B 4U96A 4GKJK 4CJKA 4ES3A 1EJ7L 1JXLA 1QVFR 4PKIA 3G71N 4OX9F 2BQUA 4L74A 1ASUA 2PEBA 4LUBA 2J6SA 2AF6A 2HAFA 2Y1JA 3R2CJ 3EO3A 4PXBA 3OXLA 2IBKA 2Z2LA 4FPAA 1WSVA 5GMDA 1HKGA 3VQEA 1P9YA 3JSBA 2DNKA 3KMSA 1NZAA 4DV3K 1S76D 4O4RA 1A9NB 2JSXA 2XY5A 4ETZA 3QEPA 1JMTA 3PCOB 3GG4A 3ID8A 4HI1A 2YJEA 2EG1A 4QW9A 3H1QA 1WDTA 4OI0A 3CB4A 2SXLA 2W24A 4KV8A 3QGHA 5DM7L 2ZC3A 3AB2B 3P3DA 2HNYA 5ETPA 1VGYA 3HOSA 3NGDA 1VJWA 1K8AT 4B3RK 5EWFA 4DV5K 2J7KA 3MECA 3DOMB 5EXWA 2Z56B 5J1EB 2DGVA 4GMKA 4GC6A 3MPYA 3PRVA 1GXUA 2YWWA 2LEPA 5DDPC 2W8KA 2DT9A 3A0IX 1N33F 1DARA 3U3GA 1UTAA 3CJ4A 3NGIA 3M32A 3H4BA 4WYLA 1UZHA 3PACA 3DFEA 2N3LA 1FFGB 3AD9C 3TO8A 3OFFA 2Q3SA 1VBKA 2Q1LA 4F2SA 2ZFHA 3QRQA 1NUEA 2MJNA 3JYTA 1I51B 2EW9A 3O2IA 1NJXA 4YDUC 3JTPA 2UUBK 4A8OA 3BQ2A 3QMLA 2LQJA 3SIPB 3LDOA 3NCIA 2I2YA 1IKXB 1IUJA 1BOTO 3VQPA 1EP4A 4C4WA 3QB0A 2A1BA 1RT6A 4DSIA 2VPXB 2C2MB 5M1FA 1P1TA 2CH6A 4P72A 3RR7A 3MHYA 2YWGA 4ED6A 1LEOA 3NF9A 4L75A 4M5JA 4WIQA 4OI2A 2CPEA 1JB0C 3M7VA 4A8YA 1WI8A 3TSPA 1P90A 1RT4B 2M2BA 3KLVA 2UVWA 3X1LB 3ULEB 3QJJA 1V4TA 2BM1A 4E7KA 5F8LA 5LM7E 2OCEA 4M3RA 4BVOA 3TSUA 1URNA 5DQIA 4K59A 2NSBA 4BRFA 3TAMA 5I3PA 2QK9A 2W42A 4WQ5A 5HRRA 4IH5A 3P5JA 2C3UA 2IHR1 2DISA 2AT1B 4Y65A 3G25A 3N6LA 4O3RA 2QEXN 3KHLA 5IQ6A 1JX4A 4CLSA 4CK1A 4LT6A 3HBTA 2DNOA 2VBYA 4IOAL 2QG9B 4FM1A 4F0KA 2P9KA 4I0WA 4JEPA 1ZTTA 1OSDA 3GFHA 3LO3A 3CJKA 4Y2CA 2A6OA 5DLGA 4XO0A 3M30B 5AFUH 1N52B 3C14B 4HTIA 3PW5A 1T6CA 3US5A 2DH7A 1F60B 4ZHRB 2CQGA 2RPIA 5GIPA 1N34J 1ATRA 4USKA 2WHOA 4DTNA 4HVJA 4PWDB 2UUTA 4MFBA 1TU0B 4GKKK 5DDOC 4BRQA 2DXEA 2M52A 3AHPA 2O01C 3CCLS 3IRXA 1IO2A 3AJDA 4YR0A 3CMAS 2L9WA 2ZHOA 1VQMS 1RTIB 4DR6K 3H59A 3CJ2A 4ECXA 2EK6A 4RCHA 1AZSA 3MTJA 4JI5J 2FB0A 1R43A 4IG0B 2ZOMA 5HROB 4KGMA 4B9UA 3WQTA 1UEKA 2JHEA 3K0JA 3JQKA 3A8JA 4ISFA 2H5IB 1W2BR 3LDLA 1TL3B 3G8TA 2HVHA 4JI2J 3KLFA 1TKZA 4K50A 3ZSQA 2FLLA 2MB0B 3MXIA 4C1NK 2KXFA 1NK0A 3HTVA 1FNXH 5LMNK 3FEYB 2KVQE 4H4KC 4QJVA 1B7YB 2X74A 2QO3A 4USTA 4X4QA 2XYPB 2JWLA 3SMPA 2O1PA 4OZJA 3BPSP 4PPDA 3G71S 4DV0F 2ZGYA 4H5VA 4FJKA 1SBRA 3EN9A 1WB9A 4QS7A 4DV7J 2RHKA 4JV0A 5I3UB 2AZ3A 4ATNA 4XH4A 3MCAB 2LA4A 1IKVB 2ZGZA 1X0FA 3OLAA 5GADU 3IMQJ 3IO1A 2DXFA 2GHWA 1KTQA 1JKHB 1HNZK 3RSEA 2OELA 1Q78A 4LFCK 2OP5A 2MPUA 1BQXA 3GIMA 3CUNA 5HRPA 2AGOA 1JLFB 2YX1A 2NRWA 2DD8S 4DX7A 3GE9A 4Z7CA 4O23A 3WNHA 1YLXA 1P1LA 3GV5B 3DLEA 3P39A 1GT8A 1YKWA 2IOCA 5GAEP 4NLBA 5EOYA 1VK0A 4C97A 2ABYA 3BGLA 3NEKA 4E1MA 3W60A 3N5BA 3B54A 2XS7A 4OIXA 2AZ1A 4Q44A 2R42A 3CJQA 4DR1F 3RB4A 3THPA 3N79A 3TUIC 3O3FA 1EQ0A 5FLXU 4RZRA 4IO8A 2MGZA 4HUFA 2P9PA 3C8YA 2DIUA 2RSQA 3C6AA 3OV7A 3K89A 3C6TA 1ZAWA 2WSFC 2OPSB 2MLXA 2V52B 2UUAF 2QL7B 1KVBA 2HBJA 3NAIA 4DFKA 3T1HJ 2OUGA 2WCXA 1T05B 4AHVA 4HVZA 1FRKA 3RYLA 3LPEA 4H0XB 4TU7A 4DV1K 1HLUA 3WX4A 1C0FA 3KLIA 1B7FA 3FCVA 2JDJA 1NRKA 4L3QA 1YG0A 1YRTA 3A8IA 3OR2B 3TZWA 2JGUA 4OZNA 3CCVN 4PR6A 1NGIA 3TTDA 1RT5B 4CFBA 3D66A 5ITHA 4ZVHA 1I94J 4IJAA 1MMNA 2ZM6K 5CCLA 3I6PA 3CM6A 4KSEB 4OLPA 2I0XA 4IH6A 1BIUA 3QLHA 1NJIT 2OD4A 4H4MB 3B8HA 3D28A 2P1JA 4OX7A 4M94A 3W0LA 3CD6S 1OYEA 2BE7D 3CE8A 1G1XA 3JAMU 3W2VB 5GAHI 2VJVA 1SKSA 1UJ4A 4IDKB 5AQJA 3CULA 2PFDA 4FLZA 3OBWA 1NK7A 2AJFE 3P38A 3E9OA 3S9HA 3LP3A 3DLLQ 3SUOA 1S72N 3OYMA 2PYLA 4BREA 3EYZA 5HATA 2DGSA 1SC6A 3OXFA 3HT3A 5GIOA 1HL6A 3MEDA 2QEXS 3LQVA 4JKFA 2RILA 4DL2A 3PYEA 4CQ1A 4JI0F 3DDIA 4CZJA 3CCEN 2VL1A 4P9SA 3R3TA 2FXUA 1MU2B 3IFRA 4KAZA 4C8KA 4CGIA 2UXCF 4BRAA 5C5JA 3PNIA 4PEOA 1DLOA 4QWDA 4YOTA 5LJVA 4MK9A 3OSPA 1ZZFA 2FDNA 5T7LA 3D0IE 2KO1A 1X9JA 2C3YA 3OS2A 4LF5J 4LJMA 2W2QP 3NVMA 4PY5A 3Q86A 3CCWA 3O8MA 3ATVA 2RS8A 4EZ9A 4DZ6A 4ZVPB 4HDHA 5AQIA 5AZIB 2LP4A 3QSIA 4BDPA 3VQDA 2UU9K 1UWBB 2D0OA 4M5DA 5AQWA 2P6SA 6FDRA 3A4TA 1TUWA 3KIOA 5AQUA 3R8YA 2XGPA 3ZSWA 4ER8A 2E7WA 4WCEQ 8AT1B 1YZ6A 3AJ2A 4Z4IA 4A5AA 2Z1JA 1ICEB 1M0SA 2PMWA 3D2FB 5D0RA 1Q9YA 2F4VK 4DUTA 2IIHA 2WVBA 5A6WA 3M8QA 5AE2A 3C6UA 4DTXA 1WC5A 5A8KB 3L6QA 1UVNA 5IFMA 3L0QA 5FD1A 1HQ2A 2HGNA 2KG1A 1PBAA 2L9NA 4I7FB 4NCGB 2BZ2A 2WOMB 3A12A 4NXMF 5B09A 3O1BA 1QSSA 4BGBA 2ZH2A 3TP2A 4B3MJ 1VRQC 1HUXA 5DDQC 1ROFA 3LPTA 4CI0B 4DR3F 4ZPTR 1D1UA 1N36K 1NSQA 4E7HA 1NNDA 4ZCLA 2PGCA 1PYSB 1UJ6A 4I6AA 5M2PA 2XI2A 3I87A 2A6MA 4JI6F 4X65K 1TQLA 1NH7A 4ZITA 1LWCA 1TK0A 3W3SA 3MMVA 3ZSYA 4KTWA 1EQYA 5M2RA 5D0GA 1WHXA 4YQWA 2D7SA 2QGFB 1NBWA 2CJAA 1ZA2B 2B9YA 2DNYA 2ZEJA 4CJSA 1RTJA 2QFJA 2RQKA 1U1OA 3ZT2A 4ZPCA 4FLVA 1Q82O 3D1OA 1REVB 1LNQA 1B99A 2XHCA 4LFBJ 4HTUA 3ELHA 3T7ZA 1F1BB 5CYMA 3ET6A 2QA4N 3KNAA 4QPXA 4GVBB 4YB5A 5L46A 4MO4A 3M2UB 5MLCQ 4AHTA 3U27A 4USHA 1MWZA 1PGZA 5F8GA 2KFYA 3I5CA 5LY3A 4KH1B 4LF6F 2VYPA 1RWUA 4C11A 4F9OA 3HZGA 2A5XA 2OFGX 5HMWA 2ACYA 3MCSA 1S0MA 3TUPA 2BW2A 2E7VA 1WC4A 5JLHA 2O4IA 3DLKA 5E3RA 4BACA 3PSIA 3THVA 3S8SA 1WBBA 3KLHA 5KOWA 2PO4A 4G6VB 4LF4K 1YT3A 4KI4A 2FY8A 2E88A 4FW1A 2CZ4A 4H5NA 4IDHA 4ECZA 1L3KA 1SQKA 2HNYB 2O8EA 2HVEA 4DOZA 4BHQA 1AUDA 3MECB 1PCAA 4W92B 4ZLLA 2QSFA 3BZKA 3GFXA 1H38A 3CCVS 1TUYA 2R7QA 4HLBA 4NLWA 4FDFA 3EE8A 5AE3A 4M42A 1VQ6S 2G8VA 2UZAA 4KHNA 2P51A 4NX9A 3EGZA 5BRFA 2WUSA 2JEFA 3NGUA 3M32B 1X3MA 2ASOA 2Q0RA 2UXBJ 5K8PA 2CNOB 5CCMA 3HL8A 1RBOB 4PABA 2FJDB 3TX8A 3KOAA 1H98A 5KFGA 3R9LA 3DXKA 3TU5A 1U24A 2VGMA 4CHPA 4N8OA 3VEYA 2HFNA 3JYTB 4WU3A 4CT8A 1CEZA 2W9BB 1JNRB 3OHAA 2POKA 3CJ5A 3G6ES 4BROA 2XWXA 2F9TA 3UI3A 4TSXA 5FPMA 1S72S 2CWXA 4R25A 3M4XA 4LF2A 3R7BB 4I56A 5HL7Q 1NK9A 1RT6B 1Y10A 2I1RA 4ED0A 4DFJA 2NUBA 2IJNA 2QWMA 3CD5A 4CZGA 1WKKA 4U7UK 3OYIA 4CF9A 1M90O 4RW4A 5J1PA 1CZAN 1RTDB 4P52A 5HRNA 4ID8A 2EFOA 1S22A 4J8FA 3IS9B 1RUSA 3CCES 3CJ8A 1RAFB 1J2VA 3EPGA 2UUWA 4QIGA 3ZZYA 5RUBA 1EX4A 3M8RA 1K6YA 3D68A 4B3MF 1S57A 4JK9A 4DR5J 3T5KA 5C42A 3UD5A 2ROPA 4B3SK 5D3GA 4I6WA 3N9UC 4AXJA 3TAMB 4U7BA 1DGKN 3MM9B 3D45A 4BRHA 3B4DA 2X78A 4LRAA 1YVFA 3D5MA 3TVKA 3R7SB 3QRRA 4K4XA 4Q7AA 4WZMA 2DPIA 3RTVA 3SFUA 1D0EA 3A8EA 1CLQA 5LSLA 3R1HA 2GA7A 4C8MA 1WSFA 4DSKA 1KFDA 1WOOA 3E9PA 2P9KB 4CGJA 2CQDA 1S9EA 3M8PB 3I5AA 3CJKB 5LJ5Y 1NEEA 2XLIA 5DG8A 4FJGA 1U48A 1NDPA 4K4ZA 4CD3A 1NO8A 1UWAA 4DUYK 3MPVA 3PRDA 3KK2A 2F7VA 1NGBA 4DUZJ 5KFPA 2P9GA 1Z26A 2EFGA 3VGMA 4IKFA 4ZVTB 4MFBB 1UFWA 1RCHA 1B0TA 2QKKA 4OYWA 3GILA 4RNOA 2IAJA 3MEKA 1X5PA 4C2MA 3D6RA 4QOTA 3KD1E 1T7PA 2UUCJ 2FF6A 3TJ9A 4C8NA 3VQTA 4DS5A 4ZLNA 1RAGB 3O5BA 3UVJA 3O9SA 2MKSA 1KAZA 4F3MA 1X7VA 3A2FA 2R7YA 3VAKA 2WSEC 1MNEA 2FVPA 3J81U 3AODA 3KFWX 1Y64A 3AA4A 3QEVA 1NM1A 3TAEA 3SAGA 1MA9B 1HHSA 4B9QA 3KLFB 2FHMA 1TKZB 3GCXP 5BRHA 5IC6B 5AXLA 3ZNUA 2BDPA 1D8ZA 1BDGA 3K58A 2D4WA 4HUGA 1MMDA 3HCXA 2X1GA 4AL5A 3UFCX 3MM7A 4M63C 2DYAA 2FPHX 3IAM9 3NLCA 2X3GA 3SCJE 1YX2A 2FTRA 4NOHA 4O3SA 4ED4A 1VDHA 2ZJRQ 1ZBSA 1GX5A 1FEHA 3RAMA 2IMWP 4QAGA 4OPHA 4KRFA 4H4OA 5HQLA 1OYDA 2YNIA 4RBUA 4M1KA 1I3OB 3QIDA 2DEJA 4LRCA 1BD6A 4CTAA 1QDUB 4IXCA 5GAEI 1FVQA 3RSEB 3PEHA 1RBVA 4ZIVA 4ZVOB 4W5OA 3I8BA 5KT6A 4GVLA 1FXXA 2P9SA 4ES2A 4OKJA 4FYVB 3EY1A 3AVMA 4QYZK 1K9MT 1HNWK 1XMQF 5BR8K 3C16A 4QW8A 2D0PA 1VC5A 3ZEUA 1XEZA 4MKAA 1FT8A 4JV5K 1EO1A 1TELA 3ZTQA 1WC0A 5FRNA 3LDNA 1YDLA 1XNRK 3VEZA 4BR2A 3UDVA 2W9AA 2MGZB 1EKRA 2V8GA 3L2RA 1O51A 2C2KB 4R8UA 2MY7A 4DR5F 3PYDA 4F02A 5B0CA 3AVGA 5IWAF 3MWPA 3C6TB 3R27A 1TFYA 2G2ZA 1NSPA 1S0VA 3NE6A 2GVZA 3R5BA 4U67L 3QEIA 1L5UA 1M5PC 4CYUA 4CZIA 2HOEA 1FJGJ 4HYKA 4NMLA 1HI1A 1YIJN 4ED1A 5JXSA 1KVKA 5BPLA 3ISND 2BOAA 3K5LA 3CGIA 3KLIB 4F36A 3CFPA 2XS2A 4Y1DA 3FQLA 2R8JA 3WT0A 4I2PA 3DLGB 3MTKA 4ZN3A 1Y3KA 1QQMA 2DNQA 2GNKA 4OI3A 4JI3F 2NS1B 4QR1A 2Q79A 2WFBA 3CF5L 4J9VA 3BQ0A 4LF7F 3FKBA 3ID6A 3PY8A 3C6HA 4CBUA 1Y4ZB 4DS4A 2Y9HA 3IC1A 3HT0A 3KXDA 2P9LA 5L1KA 2HW3A 4BDZA 3HPHA 5CYJA 2VIHA 3P1GA 4H03B 2DR6A 1WTFA 2PY5A 1F2HA 3VR1A 1ACMB 2M5YA 3VQ7A 2YQ3A 3KLGA 4V19X 2Z2ZA 1BO5O 2CZVC 3UIQA 3KWGA 3NS5A 3C95A 3J7Z5 1OMSA 1VQNS 4LD0A 1QVGM 1SL2A 2NRHA 2AV5A 4NI2A 2CA9A 3TZYA 2AQ4A 1BWFO 2W9CA 2E9TA 1YXQA 1OIAA 3MEDB 1S12A 5L38A 2JVOA 4FJJA 4LRFA 4Z94A 1IN0A 1BL3A 3ZSRA 4QYRA 4EO6A 1BUPA 4J9PA 4FO0A 4H0PA 4RJVA 2PN6A 3R5GA 1EWQA 4J2DA 3CYMA 3IKMA 1HW8A 1DLOB 1VK8A 1GFWB 2CNLB 3HVTB 2GTDA 2J0XA 2B5JA 1UEVA 5T7LB 4O0NA 5J2MA 4Y00A 4I9LA 4OJRA 1SCJB 2VONA 1SJQA 2WONA 5TKWA 4DU7A 2EWHA 1RILA 3H20A 3TRGA 3HK2A 4DV6F 2CGKA 2GELA 4M5DB 3MDFA 2RJZA 3HP9A 4B08A 3WC2A 2QXLA 3OW2M 1VSDA 1XNQF 4IR9A 2ASLA 4JI4F 3MMJA 3CM5A 1NLKL 3R8EA 3CDWA 4CJEA 2QL9B 2OMLA 2HKEA 4FWQA 1EX8A 1DTQA 2OA8A 1DEJA 2CGJA 1JJ2M 4ZK7M 4MQ3A 4JKBA 3C6UB 4KRWA 4FJNA 1HWIA 2GBZA 3W8GA 1UPPA 3T1YJ 1U1QA 4ILRA 4RU9A 1B4SA 3L2QA 4ETXA 1RGIA 1CJTB 2M4MA 2H51B 2NZCA 4ES1A 1CC8A 5AQRA 3A5MC 4LVOP 4ELTA 2M7SA 2ZBIA 2C2ZB 4YB6A 4JI7K 1DHMA 1Y00A 3LTOA 4C0OC 1VSMA 4CJWA 3OL9A 1HPZA 3VZHA 2O8FA 1NHKL 3O9RA 2ZVSA 3GB0A 2E1YA 1GLFO 3BO4A 3K5NA 4IYQA 4GO7X 3M9MB 1MN9A 3CW2C 1TAQA 4B3OA 1GQEA 1B70B 4YOUA 1LWCB 2YKNA 3T9ZA 3MN9A 4RWXA 3AA2A 3K0SA 2A3ZA 1UVLA 3QFHA 4B9TA 5M1NA 3OS0A 4CRJA 3P45B 3K5OA 1Q7LB 2YWEA 2HBLA 2F8HA 3BYPA 2BR0A 4K4YA 3LM2A 5A8RA 1X4GA 3DU5A 1YJTA 1RTJB 2OH2A 4F26A 4EBDA 1IBLJ 4CLWA 4WQ5C 5A0YA 5KGXA 4RWWA 4M5NA 3AFGA 3NL0A 3FE1A 1UL3A 4PWUA 2IFXA 3ET6B 4TQRA 1U2FA 2RRNA 5HVHA 4JKGA 3JSYA 3ATUA 2BBEA 5LMUJ 4O8KA 4CJRA 2UVUA 2ACMA 1E6VA 2E9ZA 2XMKA 3FBEA 1NCLA 3SLCA 3BGRA 4DPUA 4C11B 1WLJA 3EPIA 2HAIA 5JICA 5KFUA 4JKDA 4OYZA 3O3HA 2HQCA 2DNLA 2ILZA 3AVKA 3DLKB 1OQ3A 3DDNA 1VQ7N 4GVEA 4WP9A 3E3XA 2HFOA 1YIJS 1MSWD 4C7QA 4OLBA 4Z0UA 4IOXA 4RKUC 2Z58B 4DR2F 1KD1T 4OYAA 3EZOA 5HBMA 1YHQN 1RHKB 1XMOJ 1Q86T 3DRPA 4EFHA 1FKOA 5K8MA 2YI1A 3PYGA 5CR4A 3ZX0A 1BCOA 1NPPA 3OBYA 4PAAA 2WK4A 5H1SQ 1QLNA 2C2NA 3UNGC 4FS2A 3J7YI 4J9RA 1IKYA 3AVLA 4JK8A 3OL7A 4QQBA 4LRBA 1LWEB 2FSJA 4CK2A 1PYTA 2HBRB 1CXUA 1GMWD 3CCUN 3I5BA 5D4LA 2GW8A 4X62K 3DXKB 1IBMF 3VQ6A 4CZHA 5ADXA 4CZFA 4LF9J 3GYGA 1GOAA 3UCGA 4FZZA 2G8WA 4LBHA 2UXDJ 3TNVA 2CJYB 5MLCV 4ED7A 3K7RA 2VPZB 5C2GA 4F04B 3KKRA 2ZOFA 3WC0A 1ZS6A 4DF4A 4CHZA 4DPOA 2RMLA 1FRJA 2I9SA 3T1AA 1NB7A 2YX6A 1FTRA 5I42A 3MN5A 4RUHA 3HI0A 3EGWB 2WSCC 1RFQA 1T9VA 2O66A 4U7UD 4RW4B 3T1YF 3IA0A 2QJ3A 3PW0A 1VQ5N 2XC9A 4FZXC 3CJRA 1LFWA 3RGIA 2RT3A 4FWMA 3VA0A 3KLEA 2QIFA 5C42B 4IFVA 4FM0A 2EC0A 5E3QA 2RKIA 1JJHA 4ED5A 5D3GB 3EZWA 3TOQA 2PC6A 3HDSA 3N6MA 2DPJA 4FK0A 1PAEX 2HEKA 5J2NA 3QICA 3NGZA 3K17A 3QMQA 4E7IA 4I1TA 4GRSA 2YH1A 2VDIA 4GKJJ 3M9NB 2E4LA 4AUKA 4WFAL 2B4PA 2XG8A 2DO0A 2KN4A 3RBXA 3OS1A 4QWBA 3TUJC 4ZTJA 3SJJA 3D7EO 3QEWA 2CADA 4FXDA 2GFFA 3M9OB 3IXQA 2YNFA 5DJBA 2GWJA 3KJQB 1S9EB 2CG8A 4WFYA 2FJBB 1B9FA 3OTEA 4QPTA 4DV3J 5AQQA 2ATLA 3ZSZA 5GMEA 2BX6A 3D0PA 1VLYA 4EFAC 4FWKA 2OHDA 3KK2B 2FC8A 4P6QA 3LALA 3T9NA 4O3PA 1U1KA 1PAUB 3F5TA 1LWFA 4WKYA 2YKQA 1Q8IA 2CXEA 3VA3A 3C66A 2DIVA 3VEVA 1CQNA 4DL7A 4JYAF 2QSWA 4HH0A 2IAJB 3ZETA 4CEFA 1MROA 2IM3A 2PSZA 4Q8EA 4B3RJ 3VQ5A 4DV5J 2CQHA 4CGGA 4B1VA 5HVGA 2P9IB 3VWSA 3RBDA 5KPTA 1S4EA 3UVJB 3CJTA 1BHLA 1B0PA 5JMVA 4X4NA 4BY9C 1N5QA 3DOKA 4B3TF 1RT1A 5KFAA 3NNCA 2ZH1A 1EQMA 5DO2A 4KY3A 1QJHA 3W5ZA 3VZIA 3SUPA 5EU7A 3WXLA 2EEYA 2NLXA 4AQYK 2HLUA 1SAZA 2OEMA 2CQ1A 4PUOB 1EWRA 1LAWA 5FPEA 3LANA 1NXIA 4WP8A 4YP3A 4W90B 2LEBA