1RT6A

Hiv-1 reverse transcriptase complexed with uc38
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 148
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt6A05
4Y3CA 3B6OA 2HMIA 1WNEA 2AJQA 2ATLA 3RWUA 4IG3A 1EETB 5I42B 3CWJA 2F8TA 4IBNA 4C8MA 2P5GA 4JS4A 1S6PA 2XCPA 4J9OA 1XWLA 3TR8A 1TKZA 1CZ9A 2GV9A 4TY8B 1DLOB 3AVAA 3RR7A 1TKTA 1RAJA 4AHCA 2C2EA 3OYJA 3DYAB 3V6JA 1NK0A 3V81B 1ITGA 3AO5A 4DF8A 4NLPA 3PW5A 4ELVA 2D41A 5JUMA 5FDLB 3E51A 4B9SA 3CO9A 3UQSA 1NK9A 4ED6A 4E7IA 4AHVA 1VSLA 1RA7A 3O3GA 1XR5A 2HNYB 2HWHA 5KRSA 5KG3A 2D0CA 3ZT4A 1JLEB 2JEFA 4DTRA 1GOAA 2HW3A 4RNNA 4HYKA 4M3WA 4XPEA 4B9UA 4URSA 1J54A 4MKBA 1D9DA 1SH3A 5KFIA 4ZVGA 4O3QA 3NCIA 3S9HA 5HP1A 5L1IA 4DTUA 1MU2B 3OS1A 1WAJA 4YFUA 1TGOA 4TYAA 2B4JA 2KW4A 2IM0A 4OPKA 1TP7A 1ZTTA 4ED2A 1JLGA 2Z1HA 3T5JA 4QAGA 3JYTA 4OL8A 4W5QA 3GQCA 1ASVA 4KI6A 4J2DA 2OPRA 3H59A 5J1EB 3AO2A 2KFZA 4DQIA 2HWIA 1IKXA 3VQ7A 4KFBB 1IH7A 1LWFB 4ELTA 4DQQA 1T3NA 4DL2A 3VQCA 3KLIA 1N5YA 4JLHA 1TK0A 3LZJA 1TL3A 2ITGA 4FJKA 2IM3A 3BR9A 4J2EA 3KOAA 4IRDA 1VRTB 3KHRA 4HUEA 1FKOA 3C6TB 2PYJA 4EZ9A 4QWBA 1S1UB 3RBDA 4Y34A 3SV4A 3E01B 3TABA 5KFNA 4GC7A 4PWDA 4HCCA 3G6XA 4PUOA 2G8IA 3M8QA 4Q5VA 2HB5A 1D1UA 4HUFA 4ZP6A 4DS5A 2V4RA 4FYDA 4BDYA 4B08A 3LP2A 1HYVA 4DFMA 3PW0A 1FXXA 3PW7A 3D5MA 1FK9A 3NF6A 1RYSA 3CJ5A 4YNQA 4OKKA 3K57A 2B5JB 2F8EX 1QTMA 3LP1B 4MKAA 1XR7A 4M3XA 3ITHA 3QEVA 1DTQB 2ASDA 1N6QB 1BCMA 1T94A 4KKOB 1J9AA 2G8VA 3AO4A 3C6UA 4H4MB 2IOCA 1HMVB 4NLQA 2DPJA 4C8KA 4ECYA 1K6YA 3VQEA 3KIOA 4M3UA 2IGIA 4ZP7A 4YP3A 1LAWA 1RILA 4ED8A 3F73A 4IR1A 4FJJA 4CJ4A 3MECA 3IG1B 4FW1A 2HHTA 4MFBB 4O4RA 3OYKA 1RT7B 5KFVA 1RTHB 4KHMA 3G10A 1RTIB 1L3SA 4NCGA 3P83D 3CFRA 5KGXA 4CHQA 1NNDA 1SKSA 1JKHA 4OLAA 3OL9A 3PX4A 4BE2A 4KAIA 3KK2B 2RKIB 3NFAA 4CEEA 2WHOA 3DLBA 5F8IA 4QW9A 4FZZA 1Q9XA 3GV5B 4EP5A 4H8KA 3SQ2A 5KFKA 2E6LA 3CIZA 2W9CB 4DSKA 4KTQA 5KG5A 1JLQB 3ZCMA 4KO0A 3AVKA 4CEQA 4TY9A 1VK0A 5DLGA 3OY9A 1U09A 3NE6A 4JRPA 2FC0A 3QLHA 4WXWA 4FLTA 5KFMA 4TN2A 3SUOA 5EWEA 1RTJB 2ASLA 3AVBA 3HXMA 3OYCA 3SI6A 3OLAA 4I2QA 5CZ1A 2XY6A 2IC3B 4ZHRB 1U47A 2R8HA 3IN5A 1X9WA 1VSJA 3RRGA 4Z4EA 4J9MA 5D3GA 4WFYA 2DFEA 3OYFA 4DL6A 4O3OA 2OPPB 2EX3A 1RTDB 1JLCB 4Q0BB 1IKYB 3THVA 3T1AA 4ID5B 1LW0A 3K58A 2FBYA 2BANA 1VSFA 1HQEB 2EC0A 3LDSA 2XI3A 4ZPBA 3OYDA 4RG8A 4DTNA 1C0MA 3QESA 2V4QA 4FS1A 3I8DA 3MR3A 2KZZA 5KFHA 3RAQA 4WE1A 3PR4A 1RDCA 3AVGA 5C42B 4ECWA 4O4GA 3KHLA 4NLTA 5KFFA 3WNEA 1S9GA 4NLSA 3H4DA 3T5LA 3KTQA 3SI8A 4B3OA 5F8NA 2BGGA 5J2PA 1TKDA 4KRFA 1T05B 3N6LA 5JXSA 3V9XA 4CK2A 3M8PB 4HHTA 3AO3A 5KG6A 1HQUB 1SV5A 3AA4A 3VQAA 4CEDA 5F9NA 1ZTWA 1NK4A 4KV8B 2DY4A 2J6SA 4G1QB 2FBTA 3FFIB 4Z4CA 4KI4A 3LAMA 1RT2B 2YNFA 3DLHA 2J6TA 4DQRA 3RB6A 1S6QA 3RR8A 4DU4A 1NKCA 5DQHA 5KFTA 1WN7A 1JIHA 3SQ1A 5DG7A 2R2RA 3MFIA 3QNNA 1EETA 5I42A 3CYMA 4FBTA 2P51A 1ZYQA 4F4XA 4CFBA 5F8GA 3OJUA 1S9EB 3IGVA 1QHTA 1B92A 1K1QA 5KFLA 4NLGA 4CEZA 1CLQA 1KHVA 4TY8A 3MR2A 5FRNA 1DLOA 3I0SB 1KVCA 4CGIA 4O0JA 3MAQA 4DEZA 3DYAA 1RNHA 5CZ2A 3HHKA 2YNHB 3V81A 3KJVB 3GYNA 5FDLA 4DTJA 1U4BA 1TKXB 1TL1B 1R0AB 5L1JA 3BQ2A 1VSIA 4E7LA 1TVRB 3ZT3A 3QYYA 2HNYA 3AVFA 2R7YA 5SWMA 1JLEA 3NAEA 5DGAA 3EPGA 3BSCA 3Q8PB 2RDIA 3OYGA 4HUGA 5DGBA 3O4NA 1GX5A 2WONB 3QZ8A 2R2SA 5KFDA 5F8MA 2I1RA 5KG1A 3NKYA 1N48A 4EO8A 4CF8A 1TK5A 4DWIA 3RBEA 3HP9A 1MU2A 4QPXA 4MK7A 1SKRA 4Y2AA 2QKBA 2V0NA 3CVKA 2FJXA 3KLEB 3OJSA 1C2PA 3AVIA 4K50A 4RZRA 2OH2A 4ID1A 4OPJA 5F8LA 4C8NA 1Z4UA 3IRXB 3KHHA 3H5YA 2O5DA 1BI4B 2VWJA 2KTQA 1IKWB 3V1OA 5J1EA 2G8KA 2J6UA 3QGGA 3LPUA 1HPZB 4KFBA 4IH7A 1LWFA 4IFYB 3V6KA 1NKEA 1EX4A 4FK0A 5C25B 3UDLA 5C5JA 4FJ5A 4KSEB 4QWEA 3NGDA 4RNOA 3KLGB 3RB0A 2ASJA 2AU0A 2BE2B 4IQXA 3G6VA 1VRTA 3GIIA 3FQLA 4O44B 3C6TA 1S1UA 3NH1A 3E01A 1ASUA 1UAXA 3T5HA 5KG4A 3N6MA 4CJRA 3FSIA 1KCFA 4CHOA 3OYLA 1S9FA 4W5TA 3V4IB 4ZP9A 3ZT2A 5C24B 5DMRA 3L2QA 1VSMA 4YR2A 4IR9A 3QIOA 1XI1A 3D0PA 1T03B 2WTFA 4CF1A 3DRRB 4FM2A 1RDAA 4FJMA 2B5JA 3CFOA 3LP1A 4O3RA 1CXUA 3M9OB 3TARA 5KFAA 3HL8A 1DTTB 1DTQA 4CJUA 1N6QA 4FJGA 3EPIA 4KKOA 1QS4A 1HNVB 4CECA 1O1WA 3O3FA 4IG0B 4YR0A 2FLNA 4H4MA 1W25A 2G8HA 4FJLA 4IH6A 4ECUA 4B9TA 3AVCA 1HNIB 4FM1A 3DLRA 3QO9B 3GV8B 4X2BA 4ECXA 2E9TA 3QINA 3IG1A 1BGXT 1RBSA 4MFBA 3A2FA 4EZ6A 1RT7A 3MEDB 2X6SA 3KLHB 1RTHA 1RTIA 2HHUA 3T3FA 3I0RB 3DLKB 3U3YA 4DL5A 4JUZA 2R8JA 1YTUA 3CJ2A 4DL7A 3CG7A 2BRLA 4MK8A 3KK2A 5JS2A 2RKIA 2D7SA 2QKKA 4N47A 4NCAA 5DG9A 4M45A 3S3OA 2FVRA 4YQWA 2W9CA 2F8SA 1JLQA 2FJWA 3LWMA 1OS5A 3V1QA 1NJWA 4Z4IA 1RTJA 2G8WA 1C1AA 3AVNA 1QQCA 5KG7A 3NHGA 4E3SA 5CYQB 2IC3A 4ZHRA 4OVLA 2OZSA 4KHSA 2R2TA 3PJWA 3OSNA 3SV3A 4QWCA 4RNFA 3SQ4A 3KKRA 2OPPA 4IRKA 3LANA 1RTDA 3OL8A 4IFVB 1JLCA 4Q0BA 1IKYA 4ID5A 3ZSQA 1SH2A 1HQEA 4E7JA 4FVMA 1GX6A 4CIFA 2GC8A 2IBKA 1L3UA 3ALYA 1VSEA 4I9LA 1QSSA 2ZKUA 1BCOA 3TAGA 1L3TA 2W7PA 5C42A 5KT3A 1UA0A 4KE5A 1LV5A 4QW8A 4NRUA 4CEAA 3GIJA 1EKEA 2AGOA 2Y1JA 2VG7B 4CJVA 5HLFB 1T05A 1RDRA 2JEIA 1BISA 4BWMA 3ZSVA 3M8PA 1TAQA 3HM9A 5CY4A 1HQUA 3PO4A 5KFRA 1JLFB 2JEJA 5EUHA 4M3ZA 1YT3A 1KVBA 1C1BB 4KV8A 1XR6A 5T14A 4F3OA 4G1QA 1RYRA 2RN2A 4KB1A 4E7KA 3FFIA 4XPCA 3DI6B 1RT2A 3CM6A 3K2PA 3PO5A 1S5JA 3VQSA 4AH9A 3RMCA 3V9WA 2VA2A 2XHBA 4QCLA 1S1XB 4WFXA 5E41A 1SUQB 5T7BA 3TAEA 4O55A 1LWEB 3PX0A 4EO6A 3IS9B 2X74A 4NLOA 4Q8EA 3C94A 2YKNB 2OZMA 1S9EA 3CDWA 2WCXA 4CJWA 4F2RA 2QV6A 1G15A 4ZPAA 3RMDA 1RT6B 1NOZA 1ZBLA 4FLUA 3I0SA 4JV2A 2ATQA 1RDDA 4DFPA 3GV7B 1TQLA 4H4OB 2YNHA 3KJVA 1UA1A 5KFBA 1KLMB 5KT6A 5F8JA 3CDUA 1S1VB 2YHBA 1TKXA 1TL1A 1R0AA 4ZMMA 1TVRA 3SPYA 3MXJA 4F4WA 5FROA 4JRQA 3DRSB 3MTKA 3SQ0A 3AVMA 4FLWA 4CESA 4AILC 2IAJB 2VG6B 3KLVA 4CGJA 5DQGA 2WONA 2Z1JA 1TV6B 5KFOA 4ELUA 1J53A 1QSLA 4IKAA 3K5NA 4E19A 5KFGA 4M3RA 1RBRA 4RNMA 1IM4A 1JX4A 3KLEA 4N56A 3OYEA 4WFZA 5KI6A 4MIAA 4BE0A 4FZYA 3PW4A 1Q9YA 4K4YA 4FJ8A 3IRXA 4NLVA 4EEYA 3S3NA 1BI4A 4KAZA 2YKMB 1IKWA 3KK1B 5HRPA 2AGPA 1RT4B 3SYZA 1LAVA 1KLNA 3BSAA 1HPZA 4EBCA 1TK8A 4IFYA 5HRRA 5C25A 4CCHA 4KHYA 5DLFA 4DU1A 3BQ1A 4RW7B 4I7FB 3KLGA 4UQGA 3KKSA 2BE2A 4IDKB 2XGPA 3BGRB 2BR0A 4O44A 4CHPA 3PX6A 2C22A 3SFUA 1EP4B 1ASWA 1LWCB 1BQMB 3V6HA 3CJ0A 2W9AA 4CGGA 3V9UA 3KD1E 1U45A 3V4IA 4DMNA 5DK5A 4FXDA 5C24A 3EY1A 4ECVA 4W5RA 4OGEA 2OPQB 1T03A 3HPGA 3DMJB 1N4LA 5HRSA 2WRMA 3DRRA 4EP4A 2OA8A 4IH5A 4TLRA 4NYZA 4ECSA 4YR3A 3PW2A 1WAFA 3LP3A 5KTQA 4ED0A 4KBIA 2BRKA 2FVSA 1S1WB 2WOMB 2XY7A 5J2NB 4J9KA 1DTTA 1K1SA 2GIRA 4Q8FA 3MEEB 4CGHA 3RMAA 4KHQA 1HNVA 2R2UA 5I3UB 1XC9A 4IG0A 2HNZB 2QXFA 4DLGA 2V9WA 4KHWA 1HNIA 2X6NA 4HKQA 4ZP8A 4RW6B 5JS1A 2YNIB 1UWBB 4PY5A 3QO9A 2XRIA 4FLVA 4GC6A 4F3TA 4I2PB 5KFYA 3MEDA 1U49A 3KLHA 1Q8IA 4CK1A 4G3IA 4BWJA 3I0RA 1CSJA 3DLKA 3V1RA 2G8FA 4NLDA 4ZTJA 3TAQA 4AHUA 3EZ5A 4FK4A 2FBVA 3ICLA 4URQU 4CFAA 4OLBA 3LZIA 4NLUA 3OYNA 2P1JA 1RT5B 4M95A 4KHRA 3GIMA 4FJ9A 1RT1B 1SH0A 3D45A 1VRUB 1A5VA 3LAKA 4MIBA 4DL3A 2HNDB 3T19A 5DG8A 1C0TB 3RTVA 4DL4A 4HTUA 3WNHA 3TAPA 2G8UA 4RW9B 1I3AA 5CYMB 5CYQA 3U3GA 4O3PA 5KG2A 4TQRA 1VSDA 1XHXA 4NLRA 3BSOA 4CFDA 1IG9A 3L2UA 4FJNA 3M9MB 1REVB 4CJ3A 2IA6A 3CQ8A 4WYWA 2XI2A 4FJXA 4J9PA 2FLLA 2ZE2B 4ZPDA 4IFVA 5DQIA 3NAIA 4KTWA 2FVQA 3H40A 5F9LA 4B9NA 4BE1A 1LW2B 1S4FA 2CKWA 3OVNA 2RDJA 2FJVA 4EBDA 4B9LA 1JLAB 4BACA 3F9KA 4M41A 3PJXA 3VQBA 3SJJA 4RNHA 3PY8A 2VG7A 1HJRA 5KT7A 1NHVA 3L2RA 3AVLA 4TSXA 2E9RX 5HLFA 3DRPB 4CJSA 4DSFA 1ZBIA 3AA2A 1D8YA 3DLEB 3KK3B 3TVKA 4BDZA 1N56A 3NGYA 1JLFA 3NGZA 5EU7A 4KB0A 1D9FA 1C1BA 2XY8A 4F4KA 5L9XA 2Q3SA 3DLGB 4JS5A 4R0EA 4ED7A 3SPZA 3P1GA 3DI6A 1IO2A 4CGFA 4FBUA 3DOLB 4IOBA 3IGNA 4K4XA 5HBMB 1B9DA 3SUNA 1ZBHA 3QGIA 3MFHA 3H5XA 4KHNA 1S1XA 1SUQA 4R8UB 1QSYA 3BJYA 4CHNA 4J9QA 1LWEA 1HARA 1CZBA 2UUTA 3IS9A 4DG1B 4RW8B 3QNOA 4DFJA 4DSIA 1RA6A 4I9QA 1IKVB 5F8HA 4Q43A 3V9SA 1BQNB 3JSMB 4GVMA 1RCHA 4Y1DA 1RT6A 2BQ3A 2R8GA 1QE1B 5KT2A 1NK5A 3QGHA 1NK6A 3DM2B 3OS2A 2UVWA 4DS4A 1GOBA 3G86A 3M8RA 4DQPA 3AVHA 4H4OA 2WK4A 3L2WA 1KLMA 2A1SA 3SUPA 3VQ8A 1S1VA 2W9BB 4C8LA 2B6AB 2D0BA 3EYZA 1HMVA 3ZSWA 5HROB 2A1RA 4EYIB 2FVPA 2D5RA 3DRSA 4F4ZA 4R5PB 3NMAA 4KB7A 1S97A 3KD5E 1WSIA 4KHUA 5EWGA 3SNNA 2IAJA 2VG6A 1YVFA 4OJRA 4FM0A 1TV6A 3CM5A 3VQ6A 2VA3A 3ZT0A 3QEIA 3PVXA 4J9SA 4Z4GA 3PZPA 3LP0B 3QERA 1BIZA 4E1MA 3L3VA 4LH5A 5KFEA 4AHTA 2DFHA 3VA3A 3V6DB 4ED1A 1SKWA 5FRMA 3HVRA 3H08A 4TXSA 4RUCA 2YKMA 5KGWA 4LQ3A 2E4LA 4K4VA 3KK1A 3P5JA 3PV8A 1RT4A 1WSJA 1D5AA 3TAFA 1EXQA 3SCXA 4U6PA 1J5OB 5L1LA 3VQ5A 1GOCA 4ZVHA 1WLJA 2PZSA 3WNGA 1T7PA 1FKPB 3HPHA 4RW7A 1JL1A 4I7FA 4PQUB 5KFZA 2VG5B 1MMLA 3M8SA 4IDKA 3BGRA 3DDKA 5KRTA 4ZTFA 2JC0A 3NF7A 1EP4A 4CK3A 1L5UA 3G6YA 1HYSB 4CJQA 1LWCA 1BQMA 3QIPB 1S1TB 3U6FA 2HVIA 4JV1A 1BHLA 3K59A 3ZSXA 4M94A 3NBPB 1KSPA 5KT5A 2OPSB 2OPQA 3HVWA 3MR5A 1WSEA 3DMJA 2IJNA 3AA5X 3I5BA 4CJLA 4DLEA 2IS3A 1RT3B 3OHBA 1S0OA 1S1WA 2WOMA 1NJYA 5J2NA 3MEEA 2DPIA 3PUFA 3MEGB 3V9ZA 3N6NA 4QOZB 2IM2A 5I3UA 4Y1CA 3VQ4A 2HNZA 3HVTB 3RRHA 4ECZA 4PA1A 3VQQA 4U7CA 2BQRA 3L2VA 2P5OA 4B9VA 4RW6A 4K4UA 4DSJA 2YNIA 1UWBA 1U04A 2DFFA 3HJFA 1A5WA 3DOKB 3K5OA 4I2PA 3OLBA 4DSLA 4Q45A 1SL1A 2YV0X 3KHGA 5KFXA 4M3YA 2C2DA 3HT3A 4LY7A 4CEFA 3QEPA 4ICLB 4F50A 4FZXC 4EYHB 3RB4A 4GMJB 4CJPA 2ZD1B 4ECQA 1C0UB 1QUVA 1JXBA 4LSLB 3TAMB 4K4WA 4W5NA 1QAIA 4J9LA 1A5XA 3Q8SB 2Z1IA 4B8CA 4CE9A 4NRTA 4CHZA 2QE5A 2IMWP 1RT5A 4FK2A 1HRHA 2RF2B 4RW4B 3RMBA 4LSNB 4ZVFA 1D0EA 1F21A 1RT1A 1KRPA 3KLFB 1NHUA 5J2QB 2XC9A 1VRUA 1S49A 2HNDA 1C0TA 1JLBB 1VSKA 2PYLA 2CJQA 2D0AA 4MK9A 4NZ0A 3K5MA 1KFSA 4RW9A 5CYMA 2BQUA 2R8IA 4E89A 4FLXA 5J2MB 2XO7A 2ILYA 3O4QA 4DU3A 4CEOA 3I5CA 5K14B 2HHWA 4MQ3A 2AX0A 1REVA 4Y2CA 4FLYA 2I5JB 2ZE2A 3BREA 4FCYA 2GBZA 2W8LA 1SL0A 4WYLA 4QWAA 1C1CB 3HYFA 4CF2A 1RBTA 4B9MA 1WSFA 4N5SA 1X9SA 1LW2A 2VWKA 4RUAA 1BIUA 2KQ2A 3ZSZA 4L8RB 1JLAA 2YNGB 1UOCA 1S48A 2HMIB 1NKBA 2FVCA 3LPTA 4IG3B 2JEGA 3UIQA 4F8RA 2DTUA 3DRPA 3H4BA 4CJKA 1NJXA 3CFPA 2D3ZA 3HSTB 4M42A 3DLEA 1KHWA 1S6PB 4OGCA 3KK3A 1L3VA 3QIDA 1JXLA 3OYMA 2W8KA 2AGQA 1TKZB 4MH8A 4W5OA 4NYFA 4F4YA 3PR5B 3OL6A 2JGUA 1ZETA 3ZSRA 4FJIA 4LD0A 3D28A 1NJZA 1TKTB 3DLGA 2FLPA 3HK2A 5KT4A 4DTOA 3DOLA 1WSGA 4NLYA 4E7HA 4J9RA 5HBMA 3M9NB 2BDPA 2R8KA 4E0DA 2KZMA 4CJ5A 4J9NA 4R8UA 4Z4FA 4CJTA 3OS0A 2GUIA 4ZVEA 2O4IA 4CEBA 1W9HA 4K8ZA 3Q8RB 1U48A 2WB4A 4DG1A 4RW8A 4ECRA 3OYBA 3BDPA 1IKVA 1T8EA 1BQNA 3JSMA 3HP6A 4RU9A 4Z4HA 5KFCA 4EBEA 5KFWA 1QE1A 1S0MA 2E6MA 2YHAA 5HP1B 3DM2A 2B43A 4TQSA 2RPIA 4NCBA 2HHXA 2HVHA 1WNSA 2UUWA 1KTQA 3LALA 4B8AB 1JLGB 2W9BA 4K4TA 3NL0A 3O3HA 2B6AA 3CDEA 5KG0A 1WSHA 4O0IA 3L8BA 3JYTB 4CGDA 5HROA 4AHSA 4H54A 3AA3A 3ZSYA 1RBVA 2IDOA 2OPRB 4HCBA 1RDBA 4N41A 2XGQA 4R5PA 2UVRA 2HHQA 1IKXB 1QAJA 3QEXA 3ZT1A 4CHYA 3TANA 3OYIA 4XIUA 4FLZA 2C28A 3KLIB 1N5YB 4CIGA 1TL3B 2F96A 4K4ZA 1ZBUA 2ILZA 3ISNC 3UR0A 3VA0A 2ETJA 2JLEA 4JV0A 1FKOB 2FBXA 2IM1A 3LP0A 3TWHA 3BQ0A 4PWDB 3K5LA 3V6DA 4PUOB 4K8XA 3M8QB 3L3UA 4LQ9A 4GW6A 5KFSA 4O3SA 1HYZA 4CERA 3H98A 3AVJA 3LP2B 4WZQA 2QK9A 4CJEA 3H2LA 1FK9B 1J5OA 3QETA 2E9ZA 5L1KA 3QEWA 2HHSA 4URGA 4CF0A 3KNAA 1FKPA 2W42A 4PQUA 3HKWA 3MXIA 3ITHB 2VG5A 4Q44A 4E1NA 3NDKA 1Z25A 2W7OA 3MF5A 4FJHA 4J2AA 4WXOA 1HYSA 1S0NA 3KMQA 1X9MA 2JC1A 3C6UB 2AX1A 4K4SA 3NGIA 4XO0A 2D3UA 3QIPA 3H5UA 2O4GA 1NOYA 1S1TA 3OSPA 3ASMA 3OYHA 4ECTA 3HVAA 2C2RA 4KPYA 2KFNA 4CFCA 3T5KA 1KVAA 3MECB 3NBPA 1JXEA 2OPSA 3EZUA 4DTPA 4IKFA 4OKJA 1I39A 5HRNA 4FW2A 1SL2A 2HAIA 4F2SA 5KFJA 4NCGB 4N76A 1RT3A 4FJ7A 2AQ4A 3H5SA 4ED3A 4WZMA 1JKHB 1KFDA 3VQDA 5KFQA 4CIEA 4DF4A 4M3TA 3MEGA 3NAHA 3FQKA 3HO1A 3HVTA 1Y97A 3BSNA 1YTAA 4YMEA 1BL3A 4KTZA 1NK7A 1ZBFA 4KO0B 4AHRA 3OL7A 5EWFA 3C95A 4DSEA 4LH4A 3QLHB 4NLXA 2ZQBA 3DOKA 4BDPA 4O3NA 2ALZA 3ZSOA 2NUBA 4DFKA 3AV9A 4C8OA 1YVUA 4OKEA 3GILA 4I2QB 2XWYA 3AO1A 2UVVA 1XHZA 1VSHA 3TI0A 3ISND 4ICLA 4CJFA 1B9FA 3G0ZA 2XCAA 3PHEA 4ZPCA 2ZD1A 1C0UA 5D3GB 1RBUA 2YKNA 4LSLA 3CJ4A 3WNFA 3TAMA 3QZ7A 4IRCA 4CF9A 2PY5A 3CJ3A 3GIKA 2Z1GA 4FS2A 3I5AA 1LW0B 1CXQA 4J2BA 2BANB 3FDSA 5EDWA 1NK8A 2AWZA 4Z0UA 2RF2A 2X78A 2Y1IA 4RW4A 2GIQA 4O5BA 4DTSA 4LSNA 3OHAA 3ULDA 3IAYA 3KLFA 5J2QA 4TYBA 3SFGA 3VQ9A 1JL2A 3TQ1A 1JLBA 3Q8QB 4NYNA 4WE1B 3SUQA 3LWLA 2HHVA 2EHGA 4HVJA 4O4GB 4KREA 3RB3A 1S9GB 1W0HA 3HPOA 5J2MA 4B3OB 3NF8A 3B6PA 5J2PB 4DQSA 4DTXA 2OYQA 3OYAA 5K14A 3NF9A 3MR6A 1S10A 5KFUA 1X1PA 3NH0A 3KMSA 3S3MA 1I6JA 3NH2A 1C6VA 2I5JA 3MXMA 3FRZA 1SV5B 2IJFA 2UVUA 1TAUA 4QWDA 1C1CA 2LSNA 4DTMA 5KFPA 3SZ2A 5SZTA 3RAXA 2YNFB 3VN5A 2XY5A 3VQPA 1S6QB 2YNGA 4NLWA 3UPFA 1Z26A
chains in the Genus database with same CATH superfamily
4Y3CA 1VISA 3KYLA 4ZIWA 4NZ6A 1NH7A 4IWVA 2VYPA 4C8MA 2HGNA 3HI9A 5CD4A 2RQ4A 1XNQK 5KPRA 4CRJA 2GV9A 4GVEA 5DZ6A 4N7TA 2YVSA 1TKTA 3T1YJ 4AHCA 2UUAJ 1ITGA 5FDLB 4B9SA 1NK9A 2GTDA 5KPTA 1X5OA 4PKIA 4ZDNA 5KRSA 2JEFA 3PIPQ 4LF9J 4MMOA 1YTYA 4DTRA 1MN9A 2G2YA 1CBKA 2CZ9A 3Q23A 3QJJA 1J54A 2KXNB 4AM7A 2Y1LB 5L1IA 1APSA 4A2BA 1MU2B 2GQCA 4M5MA 2A0FB 3AQPA 4HHUA 2V2QA 1ZTTA 3MDQA 3CCJN 4FL9A 4FDFA 4B9QA 2F4VK 1S7IA 1S3XA 3P6YC 2Z2LA 4W5QA 2OPRA 2PC6A 3X1LB 4FWKA 2JH3A 3BZCA 4WFBL 4DQIA 5AR0A 4M5HA 2BA9A 3PSFA 2A5XA 1LWFB 4XH5A 1B4SA 5IC6B 2MJNA 2CPEA 1N5YA 1TK0A 3WT0A 2DGXA 1TL3A 2EVZA 2ITGA 1DT9A 3BR9A 3TPQA 2JFDA 3BBFA 4J2EA 2P8IA 3KOAA 4IRDA 1T0TV 4B1XB 4YHHK 2PYJA 4EZ9A 4QWBA 1S1UB 3TQEA 3RBDA 4OHXA 4FZVA 5IT9Y 3TABA 2L9NA 2V68A 5KFNA 2EC2A 2LCWA 2Q0RA 3BM7A 3BZQA 2G8IA 3FCWA 2Z8QA 2J9CA 4R0JA 1IR0A 3HCXA 2LA4A 2A1BA 1NZAA 3D1QA 1NDCA 3ZNJ1 1GNKA 3TSPA 4OKKA 4B1WB 3K57A 3LP1B 2KRBA 2XSJA 3MN5A 1NB2A 2XSFA 1XNRJ 2LQ8A 3U8XA 3C3LA 3TWZA 2G8VA 4YDUA 3AO4A 2R7VA 4H4MB 2IOCA 3LOUA 4BC9A 1HMVB 4NLQA 3EVMA 3KIOA 4M3UA 1NJIT 4ZP7A 4YP3A 3DRXA 3A1YG 3CCES 3ZLJA 4M7XA 1N52B 2BYCA 4O4RA 1AXQA 1VHIA 1FWKA 2F5GA 1SVDA 3P83D 5KGXA 4CWBA 1NAQA 1FXDA 1BA0A 4EAHD 1CS4B 5H9FJ 1HI8A 3PX4A 2SXLA 1HR0K 2DHGA 2RKIB 1PG5B 4DV5K 3MCMA 4MLHA 2HZVA 5IV3A 1YK9A 4FZZA 5ETNA 3BF3A 4U67Q 3SQ2A 3DHWC 5KFKA 2JOQA 4K0KF 2C2ZB 5KG5A 1R31A 3AVKA 3GP9A 1VK0A 3I4HX 3OVSA 4JRPA 1HUXA 3D1OA 1YJVA 5KFMA 4TN2A 3SUOA 3HFZB 2EXUA 2ZOGA 3SI6A 1PC4A 3OLAA 5CZ1A 4LF8J 3T6JA 2Z56B 4P71A 4IO1A 1JCEA 5CD4H 3SJHA 4JI5K 1VSJA 4Z4EA 4J9MA 5D3GA 3OTEA 4M5GA 1CULB 3WQUA 1FA0A 2FZKB 2OPPB 1QQOA 1RTDB 5AT1B 3F56A 3AB4B 1IKYB 4ID5B 4M8LA 1HQEB 3CUNA 1U1OA 2MQLA 4ZPBA 4RWWA 5CCMA 1RFQA 2LEAA 3M5RA 2ZJPL 5KFHA 3RAQA 1RDCA 2QJ3A 3OXGA 3FMBA 3MWPA 4EI2A 1U6FA 4IOCQ 3H4DA 3KTQA 4B3OA 1SAZA 2CQCA 3Q86A 2BGGA 1IR2A 3TZZA 4CK2A 4DR4K 4HHTA 2OKQA 4WIQA 1HQUB 1SV5A 4FVCA 2YH0A 3QBWA 5KOXA 4ZCKA 5H1SV 2FBTA 3FFIB 4KI4A 5B7WA 1RT2B 5DDPC 3RB6A 5DQHA 5JVGL 1FWLA 3CW2C 2CAJA 2LVWA 4F0MA 4WU2A 3MFIA 3THXB 4P10A 3VESA 2MLYA 2P51A 4CFBA 3OJUA 2D9OA 1QHTA 3H2UB 2DB1A 4JI2J 2E8AA 1BU6O 3SCLE 1NB7A 1CLQA 5FRNA 1X4EA 1KVCA 2DT9A 5D0GA 3MAQA 1O0PA 4DR2K 3HHKA 3DN9A 2BUPA 5FDLA 1UETA 4DL0C 4JI7K 1TKXB 4GV9A 1ZPWX 5L1JA 3EGWB 1VSIA 3R97A 4H0PA 3QYYA 4LMZA 2R7YA 4ZJOA 3NAEA 4RU2A 1YX2A 1ZAWA 3EPGA 1S7HA 4B3SJ 1S5ZA 2MQMA 4TU8A 3Q8PB 2B8QA 1H72C 1R8CA 2WONB 5M2UA 2XHCA 4H03B 1N48A 4P74A 3NKYA 1X3NA 2XNRA 3LF0A 4CF8A 3RBEA 3I56N 1MU2A 1BUPA 1SKRA 2FJXA 2V51B 1C2PA 4JI0K 4RZRA 3D66A 4FWRA 4OPJA 4RBVA 2OFGX 3IP0A 4PKGA 3KHHA 2XS5A 2VASA 1BI4B 2VWJA 3C14B 1XMQJ 1DY3A 1S79A 3EICA 1NWKA 3NY0A 3LPUA 1DZ5A 2OAUA 1LWFA 2JNJA 3G6EN 4IFYB 1EX4A 1WF0A 3DDIA 5C25B 1QY7A 1LOUA 3BH6B 5DDRC 1VQ5S 3RB0A 3WX8A 1LXJA 3G6VA 2HS3A 3GIIA 1K9MT 5HO4A 3SK3A 4BRCA 3GFZA 5ETPA 5HQ8A 1S1UA 4OYOA 3LDOA 2BVZA 3T5HA 5KG4A 3N6MA 2B8PA 4CJRA 1N36F 4BC7A 3TEHB 3V4IB 1DQ9A 4ZP9A 2DKOB 2QWOA 1QAXA 1CG2A 2LQJA 2IDEA 4MKVA 2CJKA 3MMAB 4DPOA 2UUCK 2CNNB 2WTFA 3EXCX 3DRRB 4FM2A 1FERA 3P39A 3CCZA 5MLCV 2LMIA 3LP1A 3EXYA 5A6PA 4O3RA 3AQOA 1BA1A 2H3GX 1YJTA 3QDKA 5LMUF 5GIOA 1DTTB 1GMUA 1E4FT 3ELHA 1U2FA 3KFWX 2QMUB 4CECA 4YR0A 2FLNA 4H4MA 2MKSA 1W25A 2G8HA 4P7VA 3AVCA 1HNIB 3QO9B 3GV8B 4ECXA 2E9TA 3QINA 4YUDA 4OYIA 3A2FA 2FHMA 2DH7A 2X6SA 2VV5A 3GFYA 5B08A 5AJ3J 2ZFHA 4DL5A 2DR7A 3VHQA 1KQFB 2R8JA 3JXOA 1LQ9A 1CS4A 3CG7A 1YIJN 1FRHA 4CVNE 2BRLA 1BHNA 4MK8A 4CO1A 2QKKA 2RKIA 1VLOA 2CQ3A 2HSEB 3NWRA 2EG2A 5C2CA 2LDYA 2A42A 3SXLA 3MUVP 3LWMA 1JCGA 2A18A 5HQMA 4W92B 2XYHB 1EQ0A 1HNZK 4DR5K 3SBMA 4A46A 5KG7A 3HSJA 2CPZA 2UXBK 5CYQB 4QS9A 4OVLA 1RHKB 2LEPA 2ATCB 3PJWA 2FUG9 3HSZA 3OSNA 3SV3A 4RNFA 1CULA 1WHXA 3DGVA 5ITHA 4UUXA 2OPPA 3LANA 1RTDA 3OL8A 3ULHA 5T41A 2DVIA 1IKYA 4ID5A 2Q3PA 4FXVA 1URNA 3MHYA 1HQEA 3FBCA 4E7JA 2V8HA 4CIFA 1QDUB 3CC2S 5L39A 2ZITA 4CH0S 3P8BB 4RJVA 2W7PA 3G9CA 3PYDA 4KE5A 3W9IA 3BY5A 4PEOA 3WX4A 3GIJA 1GMWA 4IDHA 3PHTA 1BISA 2VGNA 2FJDB 4PXEA 1G2EA 5ETMA 3TJAA 1HQUA 4DUYJ 3QJLA 2YQ1A 1VK8A 1UVIA 3ETMA 3W65A 4KQZA 6AT1B 4OO1J 1K8KB 4F3OA 2RN2A 4KB1A 1SB6A 3FFIA 4WF9Q 1RT2A 2NZCA 2YX6A 5FLXO 1N34J 3CM6A 5JJBA 4U7BA 4HL9A 3PO5A 1S5JA 3VQSA 1JJCB 2VDIA 4MKYA 1M90O 3QB0A 4YY3J 2BM1A 5AXMA 2KH9A 3M8ZA 4QCLA 2PD1A 2DRBA 2VQEJ 2WAQD 3THXA 4QR0A 3PX0A 4LR7A 1UW4A 3IS9B 2X74A 4Q8EA 1RK8A 4JYAF 3C94A 1HKAA 2OZMA 1UZDA 1Y10A 2OGUA 4F2RA 5D4OA 4XAKA 4J90A 2XLIA 4RX6A 1YG0A 3P45B 1ZBLA 4FLUA 4JKGB 1GLDG 4JV2A 2ATQA 2QIFA 1Q7YT 3GV7B 1GH8A 3H0PA 2ZM6K 4LRDA 3B8AX 1KLMB 1AA1B 2N3LA 5KT6A 2ZF5O 1O51A 3AOCA 1TKXA 2DH8A 3NNCA 3W2VB 2QFIA 4D3HA 3LDQA 3J80Y 3SPYA 3TU5A 2EFNA 3SMSA 5GADP 4JRQA 3DRSB 4FKXA 3EN9A 3NMUA 1WEXA 5DQGA 2WONA 5IQQA 4I0WA 1RWKB 1J53A 3TTFA 1NMEB 4ILHA 1M5VC 2BE7D 2CQ0A 2FC8A 2M8HA 2AJFE 3ENQA 2P2CB 5KFGA 2I2YA 4ID8A 1RGVA 2PI5A 3FZBA 2HFZA 4L3KA 2DHSA 2KYZA 3HHNB 3D6HB 4RTFD 4FZYA 3PW4A 3VGMA 4B02A 3OFFA 2ZJPQ 1VRQC 2HZCA 1BI4A 3E9PA 4KAZA 3C14A 2YKMB 3UD5A 4H4KC 3KK1B 2CDRB 2Z0GA 3CCWA 4E2FB 3SCKE 2DNOA 5LMNJ 4LBPA 4EBCA 4IFYA 3A13A 5C25A 2A10A 1S77D 4DU1A 2HBLA 4P2XA 4RW7B 3HZEA 4UQGA 3VR1A 3VV2B 4JI1K 3KKSA 1R8HA 2UUBJ 3O9SA 2DNKA 5DETA 2C22A 3HM8A 3SFUA 1EP4B 4WKYA 2AYEA 7AT1B 1IM6A 3V6HA 2FDNA 4AYBD 3V4IA 2J9DA 5CZXA 3AXMA 2DITA 3OQ2A 3QBCA 4FXDA 3R7SB 4ECVA 3NMRA 5JVGQ 1HNWJ 2DNMA 1SJ1A 2YCHA 3MMAA 4OGEA 3BO4A 3KZBA 3HPGA 5HRSA 3DRRA 2Q36A 4EP4A 3FSXA 4NYZA 3CD5A 3EVOA 3QWUA 2V7YA 2Z57B 1S1WB 1UTAA 4BHQA 1FVSA 1DTTA 2PFFB 4JKEA 3FNNA 1S0VA 3JTOA 2JX2A 2XHWA 4KHQA 1ZPVA 3MCSA 5F0XA 2HNZB 2V9WA 3BV8A 4KC5A 1HNIA 1GLCG 4HKQA 4RW6B 5JS1A 4PY5A 3QO9A 1T3OA 4AQYK 1WELA 3CCEN 3D4JA 2XRIA 1XIQA 2FY1A 1JB0C 2P5VA 2UV8G 3NVMA 2B56A 4I2PB 3WDOA 5AQMA 4RBTA 1Q8IA 4CK1A 4JEPA 1A7GE 3VAKA 4BWJA 3FR0A 3HOTA 1Q4RA 4PL8A 3VGKA 2YQ0A 3ICLA 3AODA 2GHVC 2CGLA 1UJ4A 4IQMA 4KHPK 1OWXA 3DJCA 5DM6Q 2VJUA 4FP9A 1EO1A 1Q82O 1TFWA 2EBEA 1VCTA 2ZUAA 5D4LA 1F6TA 4FYWB 4Y0FA 2EI5A 4JI3K 1SH0A 3HSGA 5GAEU 5GADI 2Y9HA 5L8RC 3T19A 5DG8A 3PLAA 1C0TB 3A12A 3MXHP 4DL4A 2O8BB 2YX1A 1BXNA 4HTUA 5C15A 4GVLA 2G8UA 4RBUA 4RW9B 4JN4A 5CYQA 3MN7A 1F5BA 4P73A 4PG4A 1HBUB 5KG2A 4K8RA 3OW2R 1V4SA 4FO0A 4PG6A 4N8NA 3GCWP 3CB4A 1WHWA 3T1YK 2ZE2B 3PIOQ 2KKZA 2BW7A 5DQIA 2LLZA 2MY8A 3R6MA 4QU6A 2FVQA 5F9LA 5HOOA 1S4FA 2OMOA 3JS9A 2YHYA 2FJVA 1RUSA 2BZ2A 4DUZJ 2W25A 4BACA 4LF7J 3GJRB 2VDHA 3F9KA 4RNHA 3UCGA 1YJWS 4LF9K 4CZLA 4KH0B 5CR4A 3B78A 4KYZA 4ES1A 1WC3A 2K2PA 2E9RX 3W66A 3J7YP 1D8YA 4JB8B 3DLEB 3EUNA 3DXKB 3KK3B 4DR7J 1VQLS 4PABA 4O0NA 2G9OA 4TNOA 3NGZA 4CO2A 1D9FA 2P9CA 3OR2B 2G13A 5GIPA 5B0CA 1K8KA 2HRTA 5L9XA 4LFAF 2IHR1 4OZ3A 1G1XA 1YSJA 2NYIA 3DOLB 4FBUA 1LWXA 1VQ7S 3F0NA 2OD4A 1AZSB 2JWKA 1ZBHA 3R2DJ 3MFHA 2MY7A 3H5XA 2IVMA 4DV1F 3W8PA 2UUTA 3IS9A 1IJJA 3DGPB 4DSIA 1IKVB 1BQNB 3C7NB 3VVTA 5K9FA 1VGYA 2Z30B 2B9EA 5KT2A 4JKGA 3QGHA 3MMBB 3DM2B 2UVWA 1GOBA 2VHGA 5I3QA 4QS7A 1KLMA 2A1SA 3SUPA 2HQDA 1R8AA 3RUBL 4OX8A 4C8LA 3U27A 2VICA 3W2VA 4EYIB 1GXUA 4JK9A 4FF2A 3NMAA 3DRSA 5E0OA 2GAGC 4F4ZA 2HIYA 4NZ7A 7FDRA 2W4DA 4ILLA 1FX2A 4FF4A 3CM5A 3BGLA 4NWBA 4RPFA 1FDBA 1RQ0A 4J9SA 3FZKA 3TTDA 3QERA 3VENA 2YKOA 4LSZB 3L3VA 3VA3A 1MG7A 4ED1A 2WUSA 4C0HA 3MK6A 3H08A 4RUCA 2YKMA 2WW4A 1OJ4A 2E4LA 3KK1A 3PV8A 4UOCA 3TAFA 3OW2M 1J5OB 1VQ5N 4R79A 2P9KB 5H9FK 3HPHA 2CPDA 4RW7A 3PRVA 1JL1A 3VZIA 1MWZA 5KFZA 3M8SA 1ZM3A 3PYGA 1OIAA 3DDKA 5HANA 2FJAB 1AUSL 1X4FA 2JC0A 4BR4A 1EP4A 3H45C 3G6YA 5DM7Q 1YZ7A 4Q2LA 4X84A 1S1TB 4X64J 1VQ6S 2C42A 3Q22A 1BHLA 2G1HA 2N3OA 2CJ9A 1V3ZA 3QATA 2DEIA 3C6HA 4M94A 3NBPB 3R5AA 3L6QA 4DU8A 3T69A 4LF8K 3TA1A 4C23A 2VJVA 2OCEA 3I5BA 3J7YI 3QRRA 3H3OB 4DV7J 1S1WA 2H4WB 3GSDA 4ANEA 3AHPA 2DPIA 3N6NA 3VQ4A 2HNZA 2O8CB 3HVTB 2QLWA 3RRHA 4UY8T 1Y3JA 4ECZA 5BPLA 4PA1A 3VQQA 2I9SA 4U7CA 3OR1B 3PJ9A 3ZZRA 4RW6A 3EJMA 4DSJA 3FJ2A 2DD8S 1A5WA 2HQCA 2K7KA 3M2UB 3U1LA 4DPWA 3DOKB 5A8WB 4I2PA 2B0GA 1HI1A 4BC4A 3AOAA 3V5RA 2DNGA 4CLZA 2ZC3A 2RVJA 3K8VA 4FZXC 2ZD1B 4B3TJ 2I6WA 4ECQA 2LU2A 3TP2A 4UZCA 1PBAA 4W5NA 4LUBA 2RDDA 1A5XA 4CHZA 2LA6A 4H5NA 2VZ9A 2IMWP 2F9DA 4BRHA 1C4CA 1IBLF 1VQMS 4FK2A 2RF2B 1NU0A 1NPPA 2OTLS 4LSNB 1F21A 1D0EA 2WBRA 1I3OB 1KRPA 2XC9A 1R89A 2Y8YA 2MGZB 1C0TA 1JLBB 2O8BA 1MWYA 4NA3A 4MK9A 4RW9A 4WQ4C 4LRAA 1T11A 1HBUA 2ILYA 4DU3A 2MEWA 3QT6A 4BG9A 5AQOA 3I5CA 1U2RA 1KVKA 1GLJO 4JI2K 2HHWA 1HWKA 3TA2A 3CHWA 4Y2CA 3D6RA 1YUWA 2PFDA 2ZE2A 2C1EB 1K47A 3GLJA 1SJ3P 3TW0A 2W8LA 4WYLA 1RBTA 3CC2N 2KVQE 3AJ2A 5AE2A 2QLFB 1H7XA 1NZ8A 3ZSZA 2G0CA 3KJFB 3OTDA 1NCLA 4YDXA 2W1BA 4DUTA 4B3SK 1FDNA 3UIQA 4BR7A 4DQ8A 4F8RA 2KHOA 2YKQA 2F7VA 3SMPA 4CJKA 3CFPA 4M42A 3DLEA 3DXKA 1KHWA 3MMVA 4L75A 3KK3A 3QIDA 5BN9A 1TKZB 3GR1A 4W5OA 4NYFA 4L76A 4QR1A 3OL6A 3ZSRA 3ULEB 4OQJA 3ZX2A 3D28A 3OR2A 1NM2A 3R8YA 3DXBA 3HJVA 4USKA 5LJVA 1SCJB 3CJ1A 1UAWA 2ZVIA 3DOLA 3BO3A 2IPOB 1MMNA 3GE1A 1XMQK 2DO0A 2P9SB 1AZSA 4E0DA 2OEJA 2MHEA 3Q8RB 2HHPA 2WB4A 3DGPA 4L74A 1TL7B 1IKVA 3I82A 1BC6A 3NGKA 4PYAA 1BQNA 3C7NA 3WXIA 3FZLA 4CO4A 3G8TA 3PTWA 3PDNA 2OFHX 4NEYA 3HP6A 4RU9A 3CCMN 4EBEA 5KFWA 3MMBA 4ZJLA 1ATSA 3DM2A 4TQSA 3RGIA 3JTPA 2UUWA 3LALA 1FRJA 4IEEA 2JVRA 4CZMA 4CGDA 3WIVA 1RBVA 1RDBA 2MTLA 2OTJS 2MZJA 2XGQA 1YBAA 2UVRA 2HHQA 1IKXB 3EX7B 5IOLA 2QN6B 2IIHA 4XIUA 4AL6A 1X31C 1H38A 2QWPA 2F96A 2M4MA 5DDQC 1NUEA 3ISNC 3DDNA 5B0GA 3UW1A 4DXLA 3JSBA 4P72A 1KC8O 2ZNZA 1T9XA 2FBXA 3THTA 2AP1A 4JAXA 1E6YB 4PR6A 4PWDB 1RCXB 2LYVA 4FN5A 3KK7A 3U9DA 2QK9A 4CJEA 4GKKF 4GKJF 5AJ3K 4K0KJ 1FK9B 1J5OA 1N8RT 2E9ZA 2F4FA 4FYYB 4URGA 4CF0A 2P9KA 1RAOA 3RU0A 3HKWA 2BACA 3MXIA 1Z25A 1ELOA 2W7OA 3MF5A 4FJHA 4BC5A 4ALZA 3O9TA 4J2AA 5CHIA 4USHA 2YPYA 1X9MA 2HLUA 2JC1A 4K4SA 4PAAA 1QQMA 4L3QA 3Q2SC 5FPDA 4XO0A 1NOYA 1S1TA 2J0WA 2BX6A 4KPYA 2KFNA 1IQZA 4HDGA 2EKYA 1UKUA 3QFWA 2BOAA 3MECB 3NBPA 2DY1A 4NI2B 2WFBA 1OYDA 1N32F 1VBKA 3MCNA 4EUVA 5HRNA 4KPCA 4FW2A 3VVUA 5KFJA 3KUEA 3KG0A 2P9LB 4N76A 2VBYA 2GJIA 1HFEL 5KOWA 1KFDA 2LQ5A 4DF4A 2IY5B 2CRLA 4M3TA 4M5NA 3JSYA 1AW0A 2ZH1A 2P6SA 3HO1A 3CJRA 2O8CA 3HVTA 4USTA 2VFSA 3OR1A 1BL3A 3O8WA 2YTCA 2MQQA 4WU3A 3QLHB 3M2UA 4ZCIA 3DOKA 5A8WA 4O3NA 2ALZA 2IVPA 4DFKA 3ZZUA 4LBIA 1WI6A 2PN6A 3TX0A 1GK8A 4C8OA 5AE3A 1UPMB 3TVYA 4I2QB 2ROEA 2NREA 2UVVA 1XHZA 3TI0A 3ISND 1B9FA 3BF1A 3G0ZA 2I8EA 2XCAA 3PHEA 2ZD1A 2H65B 4DUYK 4FSVA 3IMQJ 2GQQA 3QBXA 2ITMA 2ZHBA 3WNFA 3JAMO 1CQNA 1EQYA 2CQPA 2NR0A 1BG3A 1Q81T 1LW0B 1CXQA 5M1NA 2GIFA 2B3TB 2VFRA 2J0SD 2Y1IA 2RF2A 1NEEA 2FLOA 3LDPA 4O5BA 3WXMB 1N34K 4LSNA 2H1YA 3CCVS 2IFXA 3IAYA 2QZ8A 1EJ7L 3SFGA 2MGZA 1GAOA 1JLBA 4YY3K 3KG1A 3VEWA 1FT8A 2VQEK 2L48A 4HVJA 3ENOA 4I6AA 4PRFA 1S9GB 2IVNA 3B6PA 2BKPA 5J2PB 3MR6A 3CC7S 4A4JA 1I94F 4ISFA 3S3MA 1I6JA 1RTZA 2DNHA 2HLTA 2UVUA 3CMAS 5BRDA 1FNXH 2CPIA 1TYQB 4NEZA 4F4AA 5SZTA 4KGZB 2DNPA 1SC3B 1FW6A 2RHKA 2YNFB 2EK6A 3VQPA 5BR8F 1S6QB 3ZFVA 2HF4A 2AYBA 4DV0F 2AJQA 3RWUA 4YOEA 4CLFA 3CWJA 5HI7A 4C1NK 2F8TA 5K8OA 1FJGF 4C8YA 1H7WA 1FJCA 3QMLA 1DJ0A 4JS4A 1VQLN 4M5IA 1BD6A 1XWLA 1M1KT 3TR8A 1TKZA 2ZJRL 4JKBA 2ZBRA 1E3MA 2L9WA 3L4QA 2M88A 4BVOA 3ULEA 1QAYA 1RAJA 2C2EA 3O4WA 2VQFF 1YXQA 3AO5A 5IWAF 3UN5A 1IBMJ 1VQ7N 1X0PA 4OX7A 4WFAL 1HHTP 3TUIC 2P9SA 1RA7A 4ZOSA 2GJ2A 4LR9A 3C19A 2HNYB 5LMNK 2HWHA 2E1PA 3HHEA 2RE2A 3ZT4A 5F0WA 3M6XA 2HBRB 1RSCA 1N36J 2E20A 1TL7A 2HW3A 4RNNA 3ONQA 1IN0A 4M3WA 2ZNYA 1UJ6A 3RJMB 1SH3A 2UUBK 3CSKA 4EGLA 4QYRA 3OS1A 2B4JA 2KW4A 2PBDA 4CLYA 2IM0A 1LFPA 1TP7A 4I64A 2AJ0A 4OL8A 4ZLNA 5LMUJ 2BTFA 1HNWK 4UTGA 2HQFA 3GOIA 2O8DB 4LRBA 3UDCA 5J1EB 1WJ9A 3R6LB 1IKXA 4IO9L 4KFBB 1X4BA 3BEXA 2NLXA 1T9WA 4JHDB 4DL2A 3VQCA 2HKEA 3LZJA 2IM3A 2H5IB 1M0SA 3P31A 2YJFA 3GZ7A 5ETSA 5EOYA 4HUEA 1QD1A 2ADBA 3C6TB 2VPXB 4Y34A 3EWGA 3E01B 1P9QC 1WACA 1E6YA 2PIIA 4GC7A 4PWDA 4LC9B 1B0VA 3H46O 4H5VA 5AQPA 2CNLB 3ID6A 4HUFA 3LGMA 2V4RA 4XDDA 4FYDA 4B08A 3K2YA 4L6V3 3QFPA 1FXXA 3TRGA 3R7NB 1FK9A 4NXNF 4L72B 3VEYA 3HZ6A 4CLTA 4NXMF 2F8EX 4M3XA 3GIRA 1YZ6A 4X65F 3TTCA 1M5PC 3VTHA 2AP6A 5BR9A 2Q6CA 3J81U 4KKOB 2EG1A 1A0OB 1HBOB 1J9AA 1B7YB 2KU7A 4I69A 2WZ1A 2MLXA 4C8KA 3RVCA 1VQ6N 2HQ3A 2HHHF 2N4CA 8AT1B 4ED8A 3FEZA 3F73A 3BN4A 4IR1A 3MECA 1LKZA 2WB1D 3IG1B 3W7BA 4FW1A 4BREA 4NI2A 1YJ9S 2MYFA 4MFBB 4Q7AA 2RRAA 5KFVA 5D15A 3O2IA 3GBTA 3G10A 5CHCB 1RTIB 4M63C 1M5SA 2P9LA 1X8DA 4CHQA 2E2NA 3MAAB 4X4PA 3VAMA 4NPOA 2GV1A 3O9QA 5F8IA 4QW9A 2F65A 1Q9XA 3MCOA 3A8EA 3GV5B 4EP5A 5IFMA 3CIZA 1MROB 2W9CB 2G0IA 3ZCMA 4CEQA 5DLGA 2FHKA 2FC0A 3QLHA 4DUZK 2GMLA 4LF7K 1RDWX 1GMVA 2FJEB 4Y0WA 2CH6A 3MEKA 5EWEA 1RTJB 4BY9C 5AFUA 3WEEB 2K06A 2Y0BB 4I2QA 2CGJA 3ZTQA 2IC3B 1WC5A 2OP5A 4G1IA 2R8HA 5FLXU 4XDCA 4NA1A 4IEIA 4DR7K 2ZWPA 1MNEA 1HX1A 2HF3A 4WFYA 3BKFA 4DL6A 4O3OA 1VQMN 2DHXA 1KS2A 4BRGA 1LW0A 2OTLN 3ILJA 4JYAJ 4DPUA 2XI3A 1BY9A 3TSUA 3FC9A 4RG8A 5C2DA 1C0MA 2V4QA 1U7LA 1W26A 2KZZA 2GMJA 1YRTA 3A8KA 3AVGA 5C42B 4ECWA 3KHLA 5IT9O 5HATA 1S9GA 1CJVB 3SI8A 1TELA 2NRHA 5J2PA 1TKDA 3M6WA 3VOVA 3HFVA 5JXSA 4PHTX 3M8PB 5IT0A 3T1HF 2E5LF 3AO3A 2CQ1A 3VQAA 2E5IA 3G8SA 5CAAA 1Q53A 3TVZA 2HBZB 4G9ZA 2ZEJA 4OLPA 5E2QA 1MDUB 3MN9A 2DY4A 3S7RA 4G1QB 1TYQA 3D7EO 3LAMA 2YNFA 3CF5Q 3B82A 4DQRA 1BQXA 1S6QA 3U1NA 5HJYA 3S8SA 5KFTA 3WZ0A 1JIHA 2R2RA 2OEKA 1ZYQA 1ZOTA 2GGPB 2CQHA 5F8GA 3VZHA 2RT3A 1O13A 4CO0A 3IGVA 2ZGZA 2MKCA 2NXEA 1U1RA 2CQ4A 3W9HA 1WORA 3I0SB 4Y28C 3LL3A 1T6DA 4AL5A 1RNHA 1YJRA 3A5OC 3BH7B 3W5ZA 3GYNA 4DTJA 2R7OA 3ZXWA 2OO4A 2GELA 3ZT3A 4G6VB 2HNYA 2R42A 5LL6d 2AMCB 5SWMA 2MKIA 3GB0A 2YHXA 9ATCB 1WF1A 4DX6A 2RDIA 3OYGA 2PGCA 1GX5A 4WTYA 3QZ8A 5KFDA 2KXHA 5F8MA 3JQKA 5KQDA 4CLUA 5AQHA 2DXEA 4DWIA 4MK7A 4BRPA 2V0NA 5LY3A 4K50A 5HL7Q 4X64K 4ID1A 3I8BA 2CG8A 3UO0A 5E3CA 1JK9B 1WDDA 1Z4UA 2CQBA 2OTJN 2O5DA 5A0YB 3GE9A 2O8DA 1UEVA 2YX4A 2KTQA 5J1EA 3QGGA 4FF3A 4KFBA 4IH7A 1NKEA 5KAKA 4JHDA 1VYAA 1DBDA 4DV7K 2Q1NA 1KAYA 3NGDA 4CBXA 3UFCX 3GL1A 1Q1KA 2X3GA 4RNOA 3KLGB 2EPIA 3GG0A 1SS6A 2ASJA 3DNCA 4IQXA 4B1VA 3FQLA 5AQLA 4O44B 3C6TA 2OUGA 3E01A 2JZ5A 4WQ5C 4C0OC 1RACB 1KCFA 1W7AA 2AJ4A 1KP6A 4W5TA 3ZT2A 4IOAL 5C24B 4FOIA 5DMRA 1TUVA 2AEMA 1QZ6A 2RHQB 1DQ8A 4YR2A 2P9IB 4IR9A 1XI1A 1M5KC 2HVZA 2QG9B 1RB0A 2KB2A 1D4XA 2UV8A 4CF1A 3CD7A 1KTVA 4K5SA 2IYGA 1TU0B 3TARA 5AQZA 4LT6A 4FJGA 4KKOA 1HBOA 4Y2IA 1O1WA 3O3FA 1XEZA 3CCJS 1KBRA 2FB0A 3S1TA 4DPYA 4B9TA 2VBWA 3ZEUB 2RU9A 1AFJA 2VOOA 3VAFA 1DFDA 3IG1A 4J7CA 2HK2A 5IQ6A 1RBSA 2MSSA 4MFBA 1H2UX 2LQ9A 4EZ6A 3MEDB 2U2FA 3KLHB 1RTIA 3T3FA 4CT8A 2HVDA 4F0KA 1NGEA 3CD6S 4BRDA 1U02A 4JUZA 2CGKA 3MAAA 2D7SA 4RWXA 1EWRA 1BWVA 4M45A 1KEKA 3G8QA 3SQOP 1BWEA 3S3OA 1MROA 2W9CA 2F8SA 4OFZA 4LR8A 3MTJA 3HHLB 2BOPA 3OBYA 1RTJA 3R3LA 3FBEA 2Z2ZA 1C1AA 3WEEA 2DGOA 1KD1T 3MOJB 2G2OA 4PZVA 4LFAJ 2RU3A 2IC3A 2DHAA 4KHSA 2V2ZA 1FVQA 3SQ4A 2WVFA 4DV1J 3RYLA 4JI0J 5A8KB 4DV6F 3CCVN 2PFUA 4OV6A 2ZGYA 1QUPA 1WOPA 2VOPA 3IAM9 4I9LA 3ZX0A 5BJRA 2R7XA 4CH7A 3RBZA 1L3TA 5AE1A 3TAGA 4M7YA 5C42A 3SDEB 3HKZD 1S6OA 4QW8A 2RH3A 4NRUA 1CJVA 4CEAA 2Z2YB 2Y1JA 2FIUA 4HACA 3EKUA 4YN3B 4OZ5A 1JCFA 2JEIA 1FI4A 1PBUA 4WP8A 3ZSVA 2CG4A 2B9XA 3M8PA 4OYZA 1S22A 1NGBA 5KFRA 1JLFB 1G7CB 2FPHX 1NJIO 3CMAN 3J7AP 4M3ZA 1KVBA 5CXTA 3O9UA 2IRUA 3C46A 5T14A 4G1QA 4E7KA 3EZOA 3SEOA 2DY9A 2HFUA 3RG6A 1W2IA 1N5TA 2IVOA 4AH9A 2W24A 1EWQA 2ASMA 1XQIA 2VA2A 3VGUA 1RBAA 2HWTA 2XHBA 3PFEA 4WFXA 1SUQB 3EVWA 2E5HA 1RAAB 2GGPA 2U1AA 4ES2A 4KH6A 2YKNB 1R43A 4LF5F 4CJWA 2QV6A 1G15A 1CC8A 1OQ3A 4A8WA 3UCUP 2MQ8A 3QQCD 4BVPA 1D09B 3I0SA 1HBNB 2F8MA 5E26A 1V4TA 2QTDA 1UA1A 3A8YA 5KFBA 2ZH4A 1WUUA 2M70A 4OMFG 4F04B 4ZMMA 4ISEA 4F4WA 5FROA 2UP1A 4K0KK 2DXFA 1VQ9S 3FZHA 4GV6A 1XK8A 4X4OA 2IAJB 5C2FA 4DV4F 3FFKB 5E3AA 4W4MA 2P6TA 1TV6B 5KFOA 4ELUA 3H7HB 1ESVA 2C3YA 3NCRA 2B4PA 1H3DA 2ZM6F 2CJAA 2ZUGA 2EFPA 2M9KA 1IM4A 4RNMA 2QA2A 3R2CJ 3UDVA 3OYEA 5KI6A 4ZVUB 4MIAA 2W6LA 3BPDA 1Q9YA 3PKMA 5A0YA 3OVAA 1SC1B 3CMQA 1OY6A 3BEGB 3TUPA 4O8UA 1VS3A 4JOUA 3O9RA 1VQNS 3FSYA 3ILLA 5HRRA 2C3UA 3BQ1A 2BKNA 3KLGA 4OIXA 3L4IA 4F36A 4IDKB 2UU9F 3BGRB 2IRYA 3M6UA 4O44A 4JD2B 3EE3A 2QLBB 3D3BJ 4RCHA 3CJ0A 4CGGA 3V9UA 2K3IA 4DMNA 5DK5A 5C24A 3S41A 2P9IA 4EK2A 1V9OA 3CJAA 4W5RA 2H54B 2BJEA 2OPQB 3C8YA 2MDAA 1IBLJ 2YXLA 3UB5A 4IH5A 4TLRA 4YR3A 3LP3A 4KGVB 5KTQA 3AARA 4YDUC 2DTJA 4KBIA 5B0FA 3K0JA 2BRKA 1QVFR 2PDAA 3PNIA 2V94A 3THYB 3MEEB 4C6AA 5BPMA 2CPFA 2R2UA 1RADB 8ATCB 5I3UB 4CLKA 3HLUA 2QXFA 3G4SS 4DLGA 2PE8A 2R4FA 3ZEUA 3DHXA 3CTRA 4F25A 2AHOB 4FLVA 2AEFA 3HMJG 3VMFB 1YJ9N 4OZ2A 4GC6A 2NZTA 4F3TA 1RAGB 3G6ES 3MEDA 3KLHA 1GLFO 1O5JA 3I6PA 2G8FA 4NLDA 1RE1B 5LJWA 1ROFA 3TAQA 3WXLA 3J80O 1T95A 4FK4A 4I68A 4HI1A 2W2QP 1DQAA 1RDUA 2EKNA 3LZIA 2FTRA 5DS7A 2R7WA 4JKCA 3OYNA 2RSQA 1FRMA 1RT5B 4M95A 1FNMA 3GIMA 3EEQA 4FJ9A 3HHLA 4OYWA 1VRUB 2ZH5A 3P38A 3RTVA 1KQSR 5I4MA 3WNHA 1X5TA 1YWXA 5CYMB 1K9MO 4P52A 5AXLA 1TUYA 1Q79A 4NO7A 3BSOA 2EK1A 2BEFA 4ZN3A 3A5MC 4FWSA 4CJ3A 2IA6A 3LM9A 4WYWA 2FLLA 2M8DB 2VWBA 5A8KA 2P9GA 3MPVA 4TKTA 3LA0A 3MN6A 2BMBA 3NGUA 4BE1A 1LW2B 3OVNA 2RDJA 4ZKAA 3J81Y 3A8IA 5GAEP 4AF1A 3KUHA 3CO0P 3UWTA 3THWB 3ENVA 3SDEA 1U2VB 2NLWA 1ICEB 3PY8A 1N36K 5EXWA 2OI2A 3OVBA 5KT7A 3L2RA 2FZCB 3SMZA 3MX2A 1ZBIA 4CJSA 1FEEA 2B7BB 3O8MA 4P2FA 2D0OA 1NGCA 3BBBA 2UUAF 1JLFA 1WHYA 3BB5A 3FLCO 2OIHA 4K43A 3OFHA 3SBTA 2Q3SA 3DLGB 4R0EA 5LMUK 3P1GA 1IO2A 4OLOA 1RI7A 3IGNA 1F5AA 3SSRA 5HBMB 3SUNA 1R3NA 5EX3A 1SUQA 1CZBA 4DG1B 3CJCA 5M1OA 4RW8B 5AQKA 4DFJA 2V69A 5TKWA 1RA6A 4LF4F 1NPRA 3TZXA 5F8HA 2JRSA 3F44A 2K3KA 1YJNS 3JSMB 4GVMA 1RCHA 3HZGA 1QE1B 1NK5A 1NK6A 1ULRA 2V2VA 4ERDA 3OS2A 4GKKJ 4GKJJ 2BM0A 5CH7B 2NXUA 1HBNA 3EE9A 3M8RA 3AB2B 3NOGA 2WK4A 3L2WA 5F41A 1G3OA 3GWCA 2V8GA 3VQ8A 2W9BB 4RLEA 2AF6A 2V6AA 4LFCF 3ADAC 1RAFB 4NX9A 2A1RA 2HK3A 4PYDA 2CFXA 5GAHP 2JWNA 2R7QA 3CXCM 3ET6B 4R5PB 2YWEA 3AA9A 2WBMA 3GJQB 4NA2A 1S97A 3KD5E 3SNNA 1B3TA 2IAJA 1YVFA 4OJRA 4CIOA 4FM0A 1TV6A 5AQUA 5CA5A 4KBOA 3SSSA 2P9UB 4BRFA 3VQ6A 1C0FA 3FCHA 1N32J 3QEIA 1SXLA 1BIZA 2NSCA 3AH6A 4ZA1A 4LH5A 4AHTA 1CJUB 2GWJA 3V6DB 2CWXA 5FRMA 3HVRA 1HWIA 3VGLA 2CQIA 2MQOA 3ISZA 4BCAA 2DHHA 1EXQA 2ZJQL 3SCXA 4HH0A 4USVA 2KDOA 4ZVHA 1XNRF 1Q78A 4PQUB 2VG5B 4IDKA 3AAPA 3BGRA 1QJHA 4JD2A 2HBJA 2B4VA 4KH1B 1WC6A 4Z7CA 4CJQA 2MHNA 2Q79A 4CI0B 4FPRA 3BKUA 3QIPB 4HTJA 5EGYA 4K7QA 3U6FA 1OPZA 2PA3A 3MD1A 4DX7A 5GAEI 4JV1A 3K59A 3JAMU 5AQNA 3ZSXA 1R59O 5KT5A 3ZZZA 2OPQA 3L7OA 5HJXA 3AA5X 1WKLA 2HMPA 4KY3A 1Q7YO 4JKFA 1Y9OA 1VBYA 1S0OA 3B4MA 3VEVA 2NQPA 3THYA 4DV3F 3MEEA 3CDBA 4UOFA 1QVGM 3MEGB 3KDOA 5L46A 1D3WA 2KM8B 5I3UA 4JYAK 4C4WA 4P2MA 1RKJA 2P5OA 4K4UA 1U04A 2DFFA 1I94J 1U0SA 4K5RA 2UYTA 4CLWA 3MWTA 2DIVA 3K5OA 1J5EF 4OYMA 4DSLA 2YV0X 1UVJA 5F1XA 3IMXA 3CD6N 4B1ZA 3MM5B 4M3YA 2C2DA 2HBQB 4LY7A 4CEFA 4WP9A 2ZZMA 3QEPA 1V3RA 4EYHB 3RB4A 2DGQA 5A8RB 5BR8J 2KL8A 4USUA 4EWTA 1C0UB 1F3VA 3CJ7A 1QAIA 4DV0J 3DLJA 4J9LA 4CE9A 3MI7X 4LBHA 5F3TA 1RT5A 1FJGJ 3CJ9A 4IYQA 4ER8A 3RMBA 3IO1A 5C12A 1HWJA 1Y5IB 2FHOB 1VRUA 5GAHI 2XNQA 3VF4A 2QW9A 1CQMA 3W5XA 1RWVB 2XEXA 1QLNA 3K5MA 5CYMA 2NSBA 2QL5B 4E89A 4FLXA 1VQPS 3O4QA 5IWAJ 2CPXA 1VQ8S 3LDLA 3OXFA 3IAS9 4A8SA 2AX0A 2QWNA 5GVQA 2I5JB 4J91A 3BREA 1RWWB 1S12A 4YOTA 2XYPB 3HBTA 4DCPB 1SL0A 4QWAA 3HYFA 4B9MA 4DX5A 4A62A 1LW2A 3W3DA 4DR1F 1FRXA 2VWKA 2AW0A 4RUAA 4BGBA 2KKHA 2IMOA 1LK7A 4TVAB 3THWA 1XQSC 1U2VA 1VC5A 2HMIB 3E8OA 3MMJA 5B0AA 4IG3B 4NOHA 2DTUA 1NGHA 4JI8F 3W5YA 4I56A 3H4BA 1NJXA 3ENAA 2D3ZA 3HSTB 3POTB 1FNOA 1S6PB 1L3VA 2BJ8A 2VFVA 3G87A 3PR5B 2J4RA 2LECA 4IZ9A 1Y4ZB 2CQDA 3R9LA 3DLGA 4M5LA 1ILYA 3D2EB 3E3XA 4OI2A 1ZAXA 2KO1A 3HK2A 5KT4A 4DTOA 4BROA 1EAYC 4E7HA 4FKYA 2QLXA 4J9RA 5HBMA 3UVJB 1HKGA 2BDPA 2R8KA 2KZMA 4CJ5A 1B70B 2G0JA 4J9NA 2E29A 3L7UA 3OS0A 2GUIA 4ZVEA 5KQ8A 4PQAA 4CBUA 4DG1A 4RW8A 2FSNA 3OYBA 4UOGA 3D9BA 3BDPA 2CZ4A 1SI9A 4CM2A 2BH1A 3JSMA 4BR0A 4A61A 4I67A 3MCPA 1QE1A 1S0MA 5FD1A 2G2ZA 1Z2LA 2B43A 3K17A 3CCSS 4NCBA 2HHXA 4NXNJ 4CW7B 2HVHA 4Z94A 3CJKB 1LEOA 4NXMJ 5HVGA 4K2XA 2W9BA 4K4TA 3NL0A 3O3HA 4X65J 3CDEA 5KG0A 3DLLQ 3L8BA 4ETZA 1T9TA 4AHSA 4H54A 3AA3A 1UCNA 3AY9A 2IDOA 1XERA 3CGIA 4JBCA 1YRXA 4N41A 3ET6A 1VQ9N 4R5PA 3QFUA 4OHYA 3ZT1A 3MPDA 2HHHJ 1ZBSA 4FLZA 3ATUA 3KLIB 2J9EA 2R7UA 2XG8A 3LQVA 1FRKA 2P9UA 3W0LA 3MX5A 3JQJA 3VA0A 2KHDA 1A9NB 2ETJA 2E7XA 4PXBA 1D9AA 1GMWD 1PYSB 3BGFA 4Y65A 2RB7A 3TWHA 1HNXF 1CJUA 2VONA 2HYIB 3V6DA 4PUOB 3M8QB 4LQ9A 4GW6A 1UMJA 4LF6F 3CJTA 1HYZA 3AFGA 3AVJA 1ITPA 1VQNN 1RKIA 1YQHA 4PL7A 2XQCA 3SSQA 3H2LA 2DNRA 1W2BR 4OV1A 4LREA 3CMES 2FF6A 4P2SA 3NS6A 3C65A 4PQUA 2MZ1A 2VG5A 4Y6IA 3J7YU 2IA0A 1Q86T 2LQBA 4NMLA 1TMJA 4KRWA 5AQJA 1IWGA 3GG4A 3P49B 2AV5A 3OPKA 3TZWA 3NNHA 3C6UB 5BREA 2VU5A 3U9ZA 3M7VA 1HI0P 1NSPA 2D3UA 3QIPA 3H5UA 3CETA 3OSPA 3ASMA 3OYHA 2C2RA 1NBEB 3WUHA 5HSPA 4CFCA 3O6WA 5L38A 3KVGA 3EZUA 4IKFA 1I39A 4LFAK 1Q16B 3SQGB 3NEKA 1GTEA 3T9NA 4XH1A 2HAIA 2R7TA 2OANA 4NCGB 1JJ2R 4NYPA 3Q8YA 4FJ7A 3CD0A 5ADXH 2A6MA 1RABB 2QGFB 4DV1K 2OD6A 3QAEA 1IQTA 3MEGA 5IT9U 3NAHA 3G4SN 1Y97A 5IS2A 4KTZA 2XMJA 4DB3A 1NK7A 1ZBFA 1Y64A 5E3QA 4KO0B 2QMWA 4ZVRB 3N4QA 2HFSA 4DSEA 3BR8A 4C9DA 4K42A 3I9V9 3T1HJ 2E5LJ 3ZC4A 1KOHA 4BDPA 3CIMA 5GAGU 2YWKA 5B09A 2HEKA 3VAIA 3GILA 5LXYA 1KONA 3MM5A 4OJ3A 2ROGA 1RAHB 4M1KA 4ZPCA 5A8RA 3DKDA 5CQGA 1C0UA 3MPUB 5ETLA 4ED4A 4DMZA 4IRCA 4CF9A 3CJ3A 1VFJA 2FHJA 2Y8WA 1B0TA 1ZA1B 4J2BA 2BANB 5EDWA 1NK8A 1EQMA 2QLJB 2F63A 1IWAA 4WKRA 3FKBA 3OHAA 3LDNA 1N54B 5BXIA 4TYBA 3IBCB 1JL2A 2FF3B 3Q8QB 4A48A 3V4MA 3U7JA 4NYNA 3OTOF 3LWLA 2HHVA 4O4GB 4CZGA 4GMKA 4UOHA 1W0HA 4YB5A 2GVZB 5BYQA 1FTCA 4DQSA 3D67A 4B3MF 2OYQA 1X1PA 1KDNA 2HQIA 2A6AA 2I5JA 1VQYA 4DTMA 1SIWB 5KFPA 2YWGA 3RAXA 5BPNA 4OI3A 1PSDA 2JLFA 4NLWA 3UPFA 3LW5C 2HMIA 1NU4A 4ZLJA 1WD6A 2KVIA 2ATLA 4IG3A 1EETB 1FDAA 2ZHAA 2J8SA 6FD1A 1JMTA 2XMKA 4IBNA 1TUWA 2GWKA 4CZCA 4AM6A 3POTA 4UY8O 1S6PA 4J9OA 1Z05A 3GJSB 1RWXB 1CZ9A 2J7UA 4TY8B 3D6TB 3NGTA 1H1VA 5IT4A 3DYAB 3V6JA 1HWUA 3V81B 1GLAG 3D2EA 4NLPA 2DR9A 2D41A 5JUMA 3E51A 1U6ZA 1OO0B 3CO9A 4WFBQ 1PILA 3UQSA 5E3RA 2YWWA 3BS9A 1HQ2A 4ED6A 3CEDA 2ZOFA 3UVJA 1XR5A 5J1PA 3AD7C 1QZ5A 2D0CA 1RHMB 3OHRA 1IR1A 3JSRA 4K41A 3LH2S 3FK4A 4O23A 2HAFA 1YJNN 2RQMA 3R5DA 4B9UA 5C7PA 1KNZA 5E84A 1D9DA 4AD6A 3QGPA 4ZVGA 4O3QA 5KFIA 3NCIA 1FCAA 2I38A 1WAJA 4YFUA 2E66A 3CJKA 4B3RF 3KWGA 3IFEA 2LXUA 3VERA 2Z1HA 3T5JA 4QAGA 5LL6Z 4A8FA 3OA9A 2KI2A 3H90A 2V34A 3H59A 1IBLK 1P27B 4RR5A 5D8HB 2KFZA 2HWIA 1ZM2A 1TMMA 4ITSA 1SJQA 4CBWA 1T3NA 3KLIA 4JLHA 2IBOA 3VWSA 1KVJA 4YOVA 4FJKA 2NXJA 3PIPL 4OX9F 4A5BA 3ZNUA 3EDRB 2HBYB 3EMTA 4ZVTB 2HRUA 4W90B 4HCCA 2CPHA 2VC1A 4PUOA 3M8QA 1IBKF 2RAQA 3QSIA 2HB5A 4CZJA 1D1UA 4ZP6A 4CM0A 4BDYA 3P5TL 4DFMA 1SC6A 4L3NA 4GO5X 3D5MA 5DJBA 4E8UA 3CJ5A 2DO4A 2GX8A 1RYSA 5RUBA 2ZH3A 2B5JB 2NRVA 1QTMA 3ID8A 4MKAA 1XR7A 1CZAN 3CCMS 1OH7A 3R6GB 2JFKA 1DTQB 3LGNA 1T94A 4I6WA 1VHFA 5F2RA 3C6UA 4DV2J 5LOQA 4A8XA 2DPJA 2JWLA 3HI0A 3ZZOA 1VBXA 1LAWA 3K89A 4CJ4A 4FJJA 2V8DA 4HH1A 4GRSA 4X4VA 3SQGA 1WOOA 4HT7A 3OYKA 1RT7B 1UPPA 1U24A 4DV6J 3IRWP 2MKYA 5ADZA 5LSRA 4ZCMA 3I87A 5A2QY 4NCGA 4QZVB 2QEXN 2W4CA 4MDAA 4OI0A 2X3DA 4OLAA 3OL9A 1ZS6A 4BE2A 3VQTA 2DYAA 3KK2B 3MR7A 1BDGA 3NFAA 2O66A 2WHOA 4DN0A 3D2WA 4H8KA 3L7PA 2E6LA 1WC1A 4DSKA 4KTQA 2ZH9A 3UNYA 1GLLO 4KO0A 3UKUB 4TY9A 4UF4A 1SJ4P 3OY9A 1YGYA 2DGTA 3NE6A 1N33F 3AVBA 2AKWB 2QTWA 5AQYA 3HXMA 2XY6A 2BBEA 2H4YB 2BV3A 3BGOP 3C2PA 1X9WA 3E9OA 1IJFB 1WG4A 3CPWR 3RRGA 1U2CA 1EX8A 5K8NA 2DFEA 1PIEA 4FWMA 2W01A 3D68A 1KVIA 2QI2A 1X7VA 1N5VA 2ZH2A 1JLCB 3T1AA 2BANA 1VSFA 3G96A 4OJHA 4LF5J 4ANDA 2XS2A 3K9JA 4EHUA 2RE1A 1N8RO 4X66F 2HOEA 4U67L 3ATVA 2GNKA 3MR3A 3MCAB 3PR4A 5AXKA 2H3EB 4O4GA 4NLTA 4B1UB 1VQPN 4NLSA 1YBUA 1BO5O 1UVMA 1VQ8N 1QQNA 2GVZA 5F8NA 5FPEA 2NS1B 4KRFA 2RMLA 3NNAA 4USMA 1T9VA 1T05B 3N6LA 2KJWA 4LFBF 1X4AA 1P6TA 2RS2A 4P75A 4GKKK 4GKJK 5KG6A 5ELZA 3J7ZT 2DGUA 5BRFA 3M8WA 5F9NA 3G82B 3AGKA 4KV8B 4DV4J 2J6SA 4Z4CA 1HD0A 4QBUA 1Q0NA 1NKCA 2NUHA 2W4PA 3SQ1A 1EETA 5JICA 1YRUA 4ZIVA 4FBTA 2P9EA 4F4XA 3MM8B 2XYGB 1S9EB 4IOCL 5HQLA 4PWUA 4QR2A 1K1QA 5KFLA 3VALA 1F2HA 1N32K 2ZKTA 4TY8A 3DRYA 4O0JA 2QWRA 1Q8BA 1B64A 3DYAA 1RLCL 5CZ2A 4FNIA 2YNHB 3V81A 3KJVB 1ZZFA 4HTLA 2PEHA 3A8JA 2LEBA 1U4BA 1TL1B 3QWPA 3BQ2A 3TYTA 4OYXA 2UU9J 2UXDF 4DBQA 4E7LA 1HLUA 3BBCA 1NGAA 4WTOB 3AVFA 3IXQA 5E33A 1PJ5A 1T44A 3K8WA 1NGGA 3CULA 3ENBA 2RQKA 3ZTOA 3W8GA 5DGAA 1NG9A 4H0OA 3H8YA 3MM7B 3W64A 4YB6A 4HUGA 5DGBA 1CC7A 1Q81O 2R2SA 4YOXA 1VDHA 4DR6F 2ADCA 2I1RA 3CCSN 3G71S 3TZYA 3EE8A 2CXEA 1UW9A 3HP9A 3GFXA 2QKBA 3SBGA 3OJSA 3HSCA 4FYXB 5GMDA 3AVIA 1P1LA 3NCPA 3EGNA 4RUHA 3E2EA 4C8NA 3IRXB 3W63A 2MMYA 2V67A 1SQGA 1CPZA 3D2FB 4M5KA 3IUCA 4EU0A 3V1OA 2F9TA 3K0SA 5EVZA 2G8KA 3NGRA 3UDEA 3VGTA 2KT5A 3TUZC 3V6KA 1QM9A 3UDLA 5C5JA 1IG8A 4KSEB 4FJ5A 1F0XA 3D6MB 4F9OA 3OTBA 2AU0A 2BE2B 4QIWD 3C0BA 4YB7A 3PSIA 4OHZA 1NPKA 1UAXA 1RHQB 4G1PA 1I94K 3FSIA 4CHOA 1S9FA 1MWQA 4RWTA 3L2QA 3NCQA 1VSMA 1GEHA 4JK7A 2Y1RI 3QICA 4IJNA 4DV7F 1M1KO 1REGX 3CMEN 4J37A 3SIPB 3E66A 3KWMA 2AYMA 2B5JA 3NWGA 5BR8K 3MAHA 5D0RA 1CXUA 3M9OB 2V50A 4IUFA 2CUYA 4DV0K 2APOA 2COLA 1DTQA 4CJUA 1ATNA 2DIUA 1IXKA 1QS4A 1FJGK 1HNVB 1J2VA 4JI6F 2GHWA 4E98A 5BN8A 3QT5A 2KHCA 2DRAA 4FM1A 1X5SA 4X2BA 5LXRA 4YS2A 2POKA 3M2RB 1TUUA 2QA4G 1U1QA 2VQFK 2GQ2A 2JL9A 2E1ZA 1RT7A 5E5NA 4B3TF 3RRKA 2HHUA 5IWAK 2Q6BA 4OHWA 3I32A 4C98A 3GJTB 2CZVC 3KJQB 2GUPA 4DL7A 4M5JA 3KK2A 3JXUA 4N47A 4NCAA 4CZEA 2FVRA 2QA4S 1HD1A 3NRBA 2RJZA 2HSTA 2QL9B 1AROP 4DHYA 3UKUA 1NGIA 3QRPA 2FJWA 2YBVA 4J8FA 3P96A 3VAGA 1OS5A 3V1QA 3AD8C 1NJWA 1NGJA 3WBZA 4EHTA 2G8WA 1HBMB 3AVNA 3AGRA 1QQCA 3NHGA 6FDRA 2LXFA 2EEYA 2YJEA 3KWIA 1CJKB 2KG0A 1WKKA 3BDEA 5BYRA 4S0MA 2CPJA 2Q31A 3KKRA 4EIAA 4DR3F 2MQPA 4JP8A 4IFVB 5LJ3Y 1JLCA 1OH8A 3V2UC 5HVHA 3O80A 3FBBA 1GX6A 4LF4J 3H1VX 1FTRA 2GC8A 4AE5A 1VSEA 1QSSA 1GQEA 4DZ6A 2QYCA 4A8KA 3CCRS 1LV5A 3FMWA 1DARA 1N5QA 1YF5L 3IM9A 1ZZNA 2VG7B 1VR6A 4LFCJ 4CJVA 2NRXA 3TR5A 1T05A 1RDRA 1OPIA 2CVIA 4P6QA 1TAQA 3HM9A 4B17A 5AZJB 4NXNK 2HPUA 5I3PA 4XTTA 3G82A 4NXMK 1YT3A 1G4CA 4U95A 4KV8A 4X65K 2HQGA 2GVDB 2VL1A 2HG4A 1K73T 4XPCA 3DI6B 4BG8A 3S6EA 1S57A 3L09A 3IR6B 4MDBA 4OHVA 3V9WA 4JK8A 3D7SB 1FFWB 2YWHA 2E1YA 1Q95G 1S1XB 2HRYA 5T7BA 4O55A 5EHHA 2HHHK 5AQSA 1QTNB 3MM8A 2HS4A 2R9LA 1S9EA 3CDWA 2WCXA 1GXLA 2ROPA 2ZC4A 4ZPAA 1RT6B 1NOZA 1EZZB 3QT8A 1JJHA 3I55S 2ZH8A 1RHRB 4ZVPB 1Y11A 4DFPA 1TQLA 4H4OB 2YNHA 3W1YC 3KJVA 5M1PA 2OEMA 5F8JA 3CDUA 1S1VB 1TL1A 5H9EJ 1ATRA 4X4RA 3MXJA 4MAKA 1WTBA 4F02A 3H3NO 2PA8D 2XMTA 4ZLPA 1DRZA 3GU0A 4WF9L 4A5AA 2UXCF 3MM7A 2Y0SD 4KGKA 3KLVA 1UL3A 5DO2A 2Z1JA 1XBWA 1QSLA 3L9ZA 4E19A 4KGMA 4D3GA 4CYUB 1S6UA 2DJWA 4F0HA 1PCAA 1JX4A 4N56A 3EZWA 3WC0A 4CZKA 3QNWB 4WFZA 2FZGB 3IRXA 4NLVA 5D6GA 3S3NA 3W3SA 4DV3J 3D2FA 4I6MB 3M8YA 1XMOF 4MLEA 2YWFA 3A5NC 1RT4B 1LAVA 4TU9A 4F3MA 1R8PA 2C2NA 2D9PA 1YITS 4PG7A 4LF2A 4ZITA 3A5LC 2JJ4D 3CERA 1J5EJ 1NNEA 5HN0A 2BE2A 2XGPA 5FPNA 2RILA 2BR0A 3P4UB 4I6YA 1VQSA 1Z2ZA 4KJIA 1BQMB 1H2VZ 4ZPWR 2Z4PA 3KD1E 2MLZA 3T1HK 2E5LK 4QU7A 4FWOA 3ENHA 4JI4F 3EY1A 4HHHA 3FCVA 1XJWB 4PXDA 3QRQA 3QPIA 1N4LA 2OA8A 1WAFA 4BC2A 1ZBTA 4NMXA 4ED0A 2YKPA 2WOMB 2XY7A 4KIAA 1K1SA 2GIRA 4Q8FA 5M1KA 3RMAA 3L4BC 1YBTA 2Q43A 1HNVA 2GMHA 4WIIA 1XC9A 2P9NB 3M3ZA 2H5EA 2LXIA 4XH4A 1PKUA 3W2WB 2X6NA 3AJDA 4H0XB 4ZP8A 2YNIB 1UWBB 1NDPA 3GYGA 3M2RA 2O67A 2RUGA 3P5BP 4Q2MA 5C0YA 4BRLA 1U49A 5G0RB 3AJ1A 3ZYYX 4NLCA 2V52B 3IWLA 1RU2A 4DR1J 2FXUA 4ENOA 3NS5A 4ZTJA 1KAXA 3TSQA 2FBVA 1CVJA 1GTHA 3HF5A 2A2CA 4OLBA 1FD8A 1VIXA 4NLUA 3NXZA 4JI8J 1WF2A 1LNQA 2XS7A 5B0BA 1D8ZA 5E7OB 2AD9A 4HI2A 2L08A 5ETVA 2KG1A 2NRWA 1M5OC 1SKUB 2MQNA 4NYOA 4N8OA 2A3ZA 2OMLA 4TLQA 2K8GA 1HBMA 3OBIA 3TNVA 3TAPA 4MYTA 1UP1A 1I3AA 1RHUB