1RT6A

Hiv-1 reverse transcriptase complexed with uc38
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 148
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt6A05
4DU4A 1TKZB 3BSAA 2OZSA 2F8EX 1SV5B 3TANA 1XHZA 4FK2A 1RBSA 1L3TA 3DLHA 1WAFA 2UVUA 4MKAA 5L9XA 5F8GA 1RT6B 5FRNA 4RW4A 3ZSQA 3VQPA 2IM0A 1S9FA 2YHBA 4CE9A 2C22A 1WAJA 2ZE2A 3GIKA 4FJ8A 4NRTA 3SFGA 1KHWA 1J9AA 2YNFB 3L2QA 4FS2A 4OLBA 4IRCA 5KGWA 4FJXA 2YNGA 4Q5VA 2QXFA 2IBKA 4DTMA 3OYDA 3ZT1A 2GV9A 3DRRA 2WHOA 4ELVA 4KKOB 2ALZA 4BWJA 2HNZA 3OLBA 4ZVFA 1RTIA 1RT3B 2ZD1A 1RA6A 1BIZA 3RAXA 2W42A 3CDEA 1VSFA 3SPYA 3WNHA 2EX3A 4YR2A 4WFZA 2GIQA 4FM2A 3IS9B 1HQEA 4ZPAA 3ICLA 4FLYA 3ASMA 4ED0A 4R5PA 2W9CA 1IKVB 5HROA 4ID5B 4MFBA 3DYAB 1S1VB 5KG4A 4HCBA 2HVIA 3F73A 5J2MA 4FS1A 1RTDA 5HRRA 4ED1A 2HNYA 2IM1A 5HLFB 1KVCA 1LWFB 4HTUA 4F2SA 2BANB 4FVMA 3KLIB 4DTSA 3OJUA 3DOLA 4CJPA 1RT5A 2YNHA 3HVTA 1BQNB 4DQSA 3KD1E 1RDDA 3V9SA 4TY8B 2QK9A 5KRTA 3BGRB 1NK5A 4DQIA 1R0AA 1S6QB 1JL2A 4E3SA 1TL1A 2OPSA 1HYVA 3ALYA 1NJWA 4OKJA 3QIPA 3BSCA 4CGIA 2JEGA 4ECYA 4E7LA 4OJRA 4M41A 2G8KA 2V9WA 3VQSA 2FJVA 3DM2B 3M8QA 3KK2B 3OLAA 4QAGA 4U6PA 3Q8PB 3OYBA 1S0MA 4RU9A 4U7CA 4F4WA 2IJNA 1TGOA 2D0CA 5DK5A 5KFXA 5HRSA 3OYMA 5KFWA 4NCGA 4EO6A 2OPQB 3EPIA 4BDZA 1VRTA 3AA2A 3NH1A 1WSIA 3V81A 1RDBA 2ILZA 4TYAA 4CESA 4CHNA 5HP1A 2D7SA 4F4XA 1HQUB 2E9RX 4H4OA 1T05A 1L5UA 1MMLA 1QSLA 4B08A 4RZRA 4QWAA 3NL0A 3HHKA 4K4UA 1YT3A 4G3IA 3CWJA 3RMCA 4LY7A 3I0SA 2KFNA 4CECA 4EP5A 4FLWA 4ECSA 4N56A 2HWIA 2NUBA 1HNVA 3BR9A 3H4DA 1S0NA 4DU3A 2AU0A 2FVQA 3PW4A 1BHLA 3ZSVA 5DLGA 3PV8A 4ZMMA 1QUVA 4B9TA 3OY9A 4NLYA 1HMVA 2R2UA 1RTJB 2KFZA 2XHBA 3AO3A 2DFFA 3MEGB 4O55A 3IGVA 3MEDA 1LWCB 1VSMA 4LSLB 1EX4A 3CFPA 4JV1A 2P51A 2E9ZA 5F8MA 2JLEA 3C6TB 3IRXA 4CHOA 3TAEA 4B8CA 4RW7B 4H4OB 1FKOB 1S1WA 1GOBA 1IKWB 1NKBA 3IN5A 3OSPA 3H5YA 3CDWA 4B9LA 3H98A 4J2DA 3PR4A 2C2EA 3HVRA 1U48A 1JLEA 5KFEA 3ZSYA 4IKFA 1RCHA 4J9KA 2G8WA 1HYSA 3LDSA 4CJTA 3CO9A 3E51A 1JX4A 4Z4FA 3HT3A 3OHAA 2IM3A 4QWBA 4ED2A 5F9NA 4E7HA 4I7FA 4C8MA 3DMJA 4QWEA 5JUMA 1TK5A 3M9NB 4DSJA 3OS2A 3AA5X 4WFXA 1C1CA 5F8HA 4DG1A 2VA2A 3GYNA 1UAXA 1BI4A 1WSEA 2AQ4A 1C0TA 4CHQA 3UR0A 2DFHA 4EP4A 3TAMA 3HK2A 3CDUA 4NCBA 3HXMA 4FJJA 2XI3A 2HNDA 3HP9A 3ZSOA 3ULDA 4CF9A 5J2PA 4IKAA 3U3GA 2HMIA 2HHSA 3L2WA 3DRPA 1Z26A 2HHQA 4J2AA 3DLKA 1HYSB 3QO9A 1JLQA 1U09A 3ZT4A 1RT5B 3DOKA 1S1XA 5FDLA 2BR0A 3MR6A 1R0AB 5I3UB 3QGHA 4RW8B 2XY5A 1T7PA 4N41A 3QIPB 3IG1B 2FBTA 2IC3A 2YKMB 3DRSB 3GV8B 1QE1A 2Z1GA 1NK7A 1JLBA 4DFKA 5I42A 4MK9A 3DLEB 3V1OA 5HRNA 3AO1A 3PO4A 4EBDA 4TY9A 3RWUA 2HAIA 4FJ9A 4NLTA 4JV2A 4ZHRB 3S3MA 3CM5A 4F50A 2DTUA 1WNSA 3V6KA 1BIUA 3N6LA 4O44A 2XC9A 2GBZA 2HMIB 1S0OA 3KK1A 1IG9A 2D5RA 5CYQA 2XRIA 5JXSA 4FJ7A 4M3TA 1ASVA 3HVAA 2R8IA 4QCLA 4KHSA 3SQ2A 4B9NA 4ECRA 4B3OB 2OH2A 4RW6B 1TP7A 1HJRA 3B6OA 1S1UA 4G1QA 3RMDA 4FM1A 3SZ2A 4NLGA 4CHZA 3DLRA 1EXQA 3C95A 1W25A 3QEVA 3ZT2A 1LW0B 2FBYA 5KFNA 4DWIA 3PX4A 4M42A 3DLEA 3H4BA 1NJXA 4JRPA 2G8HA 5J2NB 4CF2A 3JYTA 3UDLA 3MF5A 3SUOA 1C1BA 4KB7A 1HMVB 3KIOA 4NLOA 3CJ3A 1LW2A 2HW3A 4O44B 1RDCA 4JRQA 1NK6A 1FKPA 1I39A 5KTQA 1XHXA 3QGGA 4ZTFA 4CEZA 3SNNA 1I6JA 4TSXA 4RW6A 3KHRA 2W7PA 2G8IA 1TKTB 1ZBFA 3MEEB 2VA3A 3O4QA 3SFUA 4K4WA 3SQ1A 3OYKA 3CVKA 1RT6A 1B92A 1LW0A 3MFHA 2R8KA 4DQQA 2IOCA 1IKVA 5HROB 3NF6A 4MH8A 4DMNA 3V1QA 4DFPA 4BACA 1IKXA 1J54A 1LAWA 1KVAA 3VQCA 5EDWA 4RNOA 4CJ4A 1ZBUA 4ZP7A 4NLSA 3QERA 3NKYA 4M94A 3VQ9A 4IR9A 2OZMA 3L2RA 2R2RA 1LW2B 1RT4B 1BISA 4GVMA 2YNGB 4IFYA 1G15A 1SL1A 1NKEA 3THVA 4WXWA 3V4IA 2IJFA 1VRUB 2IA6A 4ZVHA 4KKOA 4IRDA 3TAFA 4CJKA 1SL2A 3P1GA 3RBDA 4E19A 1O1WA 1ZTTA 1WNEA 3BJYA 2VG5A 2FVCA 1NNDA 1T8EA 5F8NA 2F8SA 1N5YB 3KJVB 3CM6A 1QQCA 4J9NA 4AHRA 1I3AA 1Z4UA 2A1SA 4K4ZA 2C28A 3I8DA 3WNEA 2R7YA 3OSNA 5J1EB 2XCAA 3LANA 1RDRA 4BE0A 3T19A 2F96A 4NLQA 1S9EB 1KHVA 2FLLA 4NCGB 3H5SA 4MFBB 3DYAA 1TKXA 1IO2A 4KHYA 1QSSA 4Q8EA 4KPYA 2VG7B 4CJSA 2IGIA 2W7OA 2BQUA 4I2PB 1REVA 2V4QA 2DFEA 5CYMB 1HYZA 3LP2B 4H4MA 4YFUA 3V9XA 3DLBA 3L2UA 1RNHA 3O3HA 3V1RA 3RB6A 1SKWA 1N56A 4I9QA 3DI6B 1IM4A 4YR3A 3QEPA 3S9HA 4NYZA 2B43A 1MU2A 5EWEA 5DMRA 3RMAA 5KFMA 4O3RA 4W5OA 3NF7A 4BDPA 5KFVA 3ITHA 3VA3A 1TQLA 3KK3A 1D0EA 4KI4A 3EYZA 4N47A 3DM2A 3M8QB 5KG1A 5EUHA 4CCHA 5KFPA 2KW4A 4CFAA 4PUOB 4RNNA 4J2BA 1S49A 1VSLA 4DSKA 4O5BA 5EWFA 3FFIB 1LAVA 3H2LA 4KTWA 4K4YA 4BWMA 1KLNA 1FK9A 4B9VA 1RDAA 2FLNA 3V6DB 1RBUA 1BGXT 3MTKA 2UVWA 1NJYA 3IRXB 4Y1DA 5HRPA 4DQRA 3SUNA 4J9SA 4I2QB 3KLHB 1D9DA 3NAIA 1LWEB 3KLEB 1UWBB 4DL6A 4YNQA 5KFCA 1S1WB 4CJ3A 3IS9A 2HHWA 1X9MA 3GV5B 3MXJA 3OVNA 2UVVA 1F21A 3S3OA 2KZZA 3DDKA 3QGIA 5KFBA 2ATLA 4ZPBA 5J2QB 2ZKUA 4CGDA 1VSDA 1JLFB 3QEXA 1KSPA 3KK3B 3CJ4A 4TN2A 4Y3CA 1J5OB 3PW5A 4KV8B 3G86A 1HNVB 1K6YA 1YTAA 1NHUA 2RDIA 4J9MA 4WZMA 1RTHB 1C0UB 4K8XA 1L3VA 5FROA 4QWDA 1KCFA 4CK2A 2GIRA 1RTJA 5F8IA 2ASLA 2W9AA 2R8GA 3TARA 2HNZB 4K50A 3I0RA 2P1JA 4FLXA 2E6MA 1SL0A 3PX6A 4DTXA 3KOAA 3MEEA 3G10A 3CIZA 4B9SA 3BQ2A 4GMJB 4M3RA 2ITGA 4PQUB 5DG8A 4DF4A 3CG7A 5J2QA 1HQEB 2EHGA 4PWDB 2D0BA 1JLFA 3K5MA 4DFJA 3MR3A 3OYLA 1HNIA 1N4LA 3DRPB 1GX5A 5J2MB 1TV6A 2BQ3A 1IKYB 1RT2A 1T03B 3VN5A 5HLFA 1ZTWA 5L1LA 4R8UA 3TI0A 4KREA 1D9FA 4FJHA 4IFVA 2OPPA 4IG3A 3LZJA 4CFBA 1X9SA 1S1XB 4KHMA 3V6HA 1DTQB 5KFSA 3DMJB 3SQ4A 3LWMA 4FJNA 4OGEA 1QE1B 3QLHB 1ZETA 1JLGA 4DG1B 3KJVA 4FZXC 3MECB 1ITGA 1BI4B 4IOBA 3Q8RB 4IDKB 3AVHA 4PQUA 2GUIA 5C24A 4CEAA 4KBIA 5KFOA 1BQMB 4DTJA 1HPZB 4PWDA 2I1RA 3LPTA 4I9LA 5DQHA 1CXQA 4O0JA 3JSMA 3KK1B 4OKKA 3RAQA 2DY4A 4FYDA 1KFSA 1TV6B 2KZMA 4F8RA 1IKYA 2WTFA 4KAIA 2FBXA 4C8LA 2XWYA 3MR2A 2C2RA 3RR7A 4KHQA 3C6UB 1QHTA 1UOCA 5CYMA 5D3GB 4R8UB 3KMSA 3AO4A 4IFVB 2XI2A 5DG9A 1JLQB 3SV3A 3FDSA 1OS5A 1HQUA 2PYJA 4KSEB 4IG0A 1JXEA 4E7KA 2XO7A 1ZBLA 5KT6A 3BQ0A 4WXOA 3D0PA 3QNOA 1HARA 3PVXA 2ZE2B 3ZT0A 3I0SB 3NGDA 5HBMA 3QEWA 2J6TA 2D0AA 4KHWA 2B6AA 1NK8A 4RW4B 4K4TA 4HYKA 5FRMA 1TAUA 1XR7A 3RB3A 4CHYA 2HB5A 3KMQA 3V6JA 1IH7A 3E01B 4DS4A 2WB4A 3QNNA 2AWZA 3HO1A 3GIJA 3OYJA 1HRHA 1S9GA 1NOYA 1RTIB 2ZD1B 5D3GA 3PO5A 1DLOB 3ZSRA 1Q8IA 4ICLA 4I2QA 3KLHA 3O3FA 1NK0A 2XY7A 4RW9B 4KFBA 1RA7A 4NZ0A 4FJGA 4N5SA 4O3QA 3PW7A 4YQWA 4CGHA 1S1TA 4IG0B 4WE1B 1W9HA 4KRFA 4O3SA 2AGQA 2V4RA 2AJQA 4AHCA 4J9PA 1VSJA 1VSIA 1J5OA 2RKIA 4LSNA 4MQ3A 3NF9A 5KFYA 3AV9A 3DLKB 4LH5A 1A5VA 2R8HA 4DLGA 3OYHA 1JXLA 4CF1A 2WOMB 4IFYB 2BE2A 3A2FA 4KTQA 2QV6A 3NDKA 2V0NA 2JC0A 5KFGA 1C6VA 4RUAA 4Z4HA 3QZ7A 4HHTA 1FKPB 4DSFA 2FJXA 4XPCA 2FVSA 3AVJA 4EYIB 3MXIA 2I5JB 4WYLA 4O3OA 1XI1A 3QEIA 2XCPA 4F3TA 1JXBA 2KTQA 4OL8A 3VQ7A 4CJUA 3SI8A 4DL5A 4L8RB 1S1TB 4PA1A 1S6QA 3OHBA 2PY5A 1DTTA 1SKRA 4M3YA 3M8RA 4DTOA 3KKRA 3EY1A 1WN7A 3L2VA 4DL4A 2IAJA 4FW1A 5JS2A 1XR6A 5KFDA 2RF2A 3TR8A 4ZVGA 2OPQA 1W0HA 2HVHA 2XY8A 1FXXA 5KRSA 3LP2A 5KFJA 1S6PB 3Q8QB 3SYZA 1JL1A 4KHRA 4BDYA 3LP0A 2KQ2A 3LAMA 5FDLB 3PX0A 2QKBA 1N6QA 1NJZA 1U4BA 3MR5A 4CJQA 1U04A 4BE2A 4KO0B 3O3GA 2FVPA 2UUWA 2O4GA 3AA4A 2HHXA 3SPZA 3OYNA 4C8OA 1X9WA 2VWJA 1T05B 4RNHA 2RPIA 1RBTA 2HHTA 3JYTB 1ZBIA 5C42B 3U6FA 4FJIA 4IQXA 1S48A 3KLGB 3DLGA 4CGGA 3NGZA 1EP4A 3DRRB 2YNFA 3P83D 1NOZA 2G8VA 2FC0A 1KVBA 1VSHA 4Z4CA 4CJEA 3MXMA 1BCMA 3D5MA 4CEOA 3LALA 3MEDB 1RT1A 1JLCB 3QZ8A 3DI6A 3HPOA 3SJJA 3QESA 4FJLA 4J9QA 3AVGA 4Z4EA 3OYGA 3OJSA 5KFUA 4YP3A 4KI6A 4RW7A 4M3XA 4NLUA 1RTDB 5C42A 4OPKA 3BQ1A 4FM0A 1B9DA 3RRGA 2QKKA 2Z1IA 1C0UA 1LWFA 4DTRA 3VQAA 4FJ5A 2R2SA 4TQRA 3K59A 4ECQA 4CERA 4Q44A 3AO5A 3HVTB 3QYYA 5L1IA 4Q45A 4RNMA 4DTPA 3LP1B 3HPGA 1WLJA 1D1UA 3I0RB 5KG3A 4ELUA 1ZBHA 5L1KA 4CIGA 2RDJA 3K57A 3H40A 2Y1JA 3FRZA 5JS1A 4RW9A 4KFBB 4FJMA 1SUQB 4HUFA 2YKNB 1BCOA 3ZSWA 1UWBA 4ECXA 4DTNA 5CZ1A 4M3ZA 4QWCA 3SCXA 3T5JA 3SUQA 4JS4A 3AVFA 4CIEA 2P5OA 5J1EA 3EZ5A 2CJQA 4FCYA 4FK4A 2ASJA 2JEFA 2R2TA 1NK9A 2X78A 4DSEA 2B5JB 4EBEA 1XR5A 5J2PB 3K5LA 2HWHA 1CZ9A 4HVJA 1T03A 2A1RA 4ZP6A 2YNIA 4K4SA 4CF8A 4DF8A 4HUEA 4WZQA 3QO9B 3HJFA 2IS3A 1RTHA 4MKBA 3V81B 2D3ZA 4CK1A 1C2PA 3NH2A 3PUFA 3DOKB 1X1PA 2P5GA 2OPRA 3VQ6A 1CZBA 4AHTA 2E4LA 1J53A 4WYWA 1VRTB 4ZP9A 3CJ0A 5KT5A 3AVCA 2CKWA 4Q0BA 5CZ2A 5F8LA 3WNGA 1SUQA 2IC3B 2YKMA 3AVBA 1YVUA 1KRPA 1C0MA 1QAIA 3H5XA 4DEZA 5I42B 4URGA 1T94A 3V9UA 4LQ9A 4Y1CA 3IG1A 3DRSA 4Z0UA 5KT4A 4JLHA 1RYSA 2IAJB 3UPFA 5KT7A 4FJKA 1SH0A 3OYAA 3AVIA 1FK9B 4WFYA 1HNIB 3VQBA 4LSLA 2ASDA 5CYQB 3T5LA 4URSA 3OYEA 4KB0A 5KG5A 4CEBA 4E0DA 1K1QA 3HYFA 4ECVA 4CFDA 3C6TA 3HSTB 3G6VA 2AGPA 3NF8A 4ED7A 4NYFA 4W5RA 3NBPB 4Y2CA 4CIFA 1SKSA 3ZSXA 1VSKA 4B3OA 4KO0A 2XGPA 1TAQA 4Q0BB 4IH6A 3OYCA 1RBVA 4YMEA 4FW2A 1TKZA 4JV0A 2JEIA 3QLHA 1FKOA 1IKWA 3BDPA 4MK7A 1KLMA 3QIOA 1SH3A 3HPHA 3RRHA 4QOZB 3KLFB 3PZPA 4HCCA 4R5PB 5DLFA 4C8KA 3E01A 1Q9YA 1S97A 4E1MA 3NAHA 4AH9A 1TKDA 5T14A 1QAJA 4URQU 3P5JA 3NCIA 3I5CA 4KHUA 1DLOA 4FLUA 3H5UA 2BANA 1A5WA 3D45A 1WSJA 2Y1IA 3M9MB 3AO2A 1BQNA 1Y97A 4E7IA 4Z4IA 4I7FB 4E7JA 4CK3A 4KB1A 4XPEA 1TL1B 1RT7A 2OPSB 4E89A 1JKHA 3T3FA 4F2RA 2FJWA 4EBCA 3CQ8A 4MIBA 4LD0A 2HHVA 1TKTA 3EZUA 1IKXB 5DG7A 3LZIA 2FBVA 4FZZA 3AA3A 4NLWA 3NH0A 4RUCA 4F4ZA 1GOCA 5KG6A 1Z25A 2RN2A 1TK8A 2ETJA 3NGYA 3VQ8A 4KV8A 3CJ2A 3MFIA 4QW8A 4DSIA 2WOMA 3L3VA 4ECZA 2E6LA 2X74A 4FXDA 1JLAA 1S10A 5K14B 3B6PA 1DTQA 3MAQA 2W9CB 1TL3B 3KHLA 1ASUA 4O0IA 3CFRA 5KFQA 1RYRA 4DSLA 1QS4A 4MIAA 1NHVA 4JS5A 1S9GB 4ED3A 2X6SA 1A5XA 4OKEA 3UQSA 4RW8A 3RB4A 2O4IA 3KLIA 4OGCA 2YKNA 4NLXA 5KFZA 3TVKA 4HUGA 2YNHB 3VQDA 3T5HA 5I3UA 1DTTB 1JKHB 1GOAA 1CSJA 4FK0A 5C25A 4GW6A 2ATQA 3I5BA 4CFCA 1HPZA 4B8AB 1TVRA 1NKCA 2PZSA 4N76A 4E1NA 4ZPCA 2E9TA 2W8KA 1Q9XA 4W5QA 1TKXB 3H59A 5KFKA 3TABA 4FBTA 3KK2A 4ZHRA 4ZPDA 2ILYA 1BL3A 3I5AA 3RB0A 1WSGA 5KFIA 3LPUA 2IM2A 1CLQA 3OYFA 3PY8A 3CFOA 4M3UA 1YVFA 3AVLA 2UUTA 4Y34A 2WONB 1REVB 3NHGA 4CEDA 4JUZA 2I5JA 3VQEA 4PY5A 2IDOA 3KKSA 4FLTA 4Q8FA 1UA1A 3M8SA 4DS5A 1JLGB 4CHPA 3KHGA 4CGJA 4QPXA 1RBRA 5EU7A 4B9UA 3KLGA 4EO8A 1UA0A 1TVRB 4ELTA 1S1VA 1CXUA 3GV7B 1BQMA 4RNFA 5KT2A 1VK0A 4ID1A 4NCAA 3ITHB 3JSMB 2HNYB 5T7BA 4KAZA 2IMWP 3V6DA 2D3UA 4OVLA 5E41A 3FFIA 3S3NA 2YHAA 2G8UA 3OS0A 1JLCA 2Q3SA 2HHUA 1QSYA 2R8JA 1LWCA 3IGNA 3SI6A 1C1CB 3NAEA 3NFAA 3C94A 4AILC 3FSIA 3Q8SB 4NYNA 2F8TA 3G6YA 5HBMB 1QTMA 4Q43A 3CYMA 3KLFA 4O3NA 3PJXA 3PW0A 3G0ZA 2OA8A 4EYHB 5KI6A 2UVRA 3PHEA 3DLGB 4Y2AA 3V9ZA 1RT4A 1WSFA 4ID5A 5KFAA 4DU1A 4M95A 4J9RA 2JGUA 3OL9A 3NGIA 3T1AA 3OL6A 4ZTJA 4MK8A 2VWKA 3KLVA 1JLEB 3M9OB 2WRMA 5HP1B 4ICLB 4DTUA 3DOLB 3V4IB 3L3UA 2DPJA 4TY8A 4LH4A 3LAKA 3GILA 1RT1B 3KNAA 4CJ5A 1U49A 3HKWA 5EWGA 3KD5E 3H08A 4IH5A 1KFDA 3O4NA 1L3SA 5KFFA 4NLPA 3M8PA 1TK0A 5C5JA 4CEFA 4FLVA 4UQGA 4FBUA 3VQQA 2XGQA 1K1SA 1S6PA 2AX1A 3LP3A 5KG0A 3TAMB 3NE6A 4AHUA 1U45A 4O3PA 1JLAB 3GIIA 2B4JA 2BRKA 4O4GA 2OPPB 3QETA 3MEGA 3QIDA 5F9LA 2HNDB 3VQ4A 2VG7A 1EETB 1N6QB 1RT2B 3WNFA 4DLEA 4IRKA 3TWHA 4I2PA 2ZQBA 3TAGA 1NK4A 3BREA 4H4MB 3K2PA 2FVRA 2W9BA 3GQCA 4IH7A 3EPGA 4CJLA 4EEYA 3OYIA 3G6XA 4FLZA 5F8JA 1SV5A 3FQKA 4R0EA 1VSEA 2W8LA 4CF0A 4C8NA 5KG7A 2Z1JA 2WCXA 2AX0A 1GX6A 1SH2A 3L8BA 4DL3A 5KGXA 4F4YA 4OLAA 3OL8A 2J6UA 3M8PB 3MECA 4NRUA 1JLBB 3HVWA 5KFHA 4IDKA 1B9FA 1WSHA 4W5TA 2J6SA 4FZYA 4IR1A 4B9MA 1C1BB 1JIHA 4PUOA 3TQ1A 2X6NA 3GIMA 4KTZA 3F9KA 4NLRA 1EKEA 4ECWA 1LV5A 3ISNC 4XIUA 3LP0B 3KHHA 4LQ3A 4DQPA 4CJFA 1RILA 3C6UA 1RT3A 4ED8A 2W9BB 2BRLA 1XC9A 2QE5A 4TXSA 2JC1A 1LWEA 3KLEA 3U3YA 2OYQA 2O5DA 4W5NA 1KLMB 1T3NA 3IAYA 4J9LA 4HKQA 4K8ZA 5KFRA 4ECUA 4TYBA 3PW2A 3PR5B 4ECTA 4NLVA 3RR8A 4ED6A 4O4RA 4DL7A 1S4FA 3RMBA 3LP1A 2B6AB 4EZ9A 4M3WA 3HL8A 1EP4B 5DQGA 4DL2A 2Z1HA 4OPJA 3UIQA 1D8YA 2AGOA 4GC6A 4RG8A 1VRUA 3AVAA 1ASWA 3NMAA 2BGGA 4Z4GA 3QINA 1XWLA 3BGRA 3N6MA 3NBPA 4F4KA 2VG5B 4TQSA 3D28A 2B5JA 3LWLA 4H54A 4TLRA 2LSNA 4CEQA 4M45A 3ZT3A 4WE1A 3AVKA 3TAPA 1C0TB 1YTUA 2PYLA 3T5KA 3HP6A 4QW9A 2EC0A 2DPIA 3VA0A 3K58A 1S9EA 2D41A 1TL3A 4KE5A 4YR0A 2OPRB 2RKIB 4LSNB 5SZTA 1U47A 3K5OA 2VG6A 2BQRA 5CY4A 4GC7A 4IG3B 2BE2B 4NLDA 1S1UB 4G1QB 2BDPA 5DQIA 4X2BA 5KG2A 2GC8A 3AVNA 4CJRA 3OL7A 3SV4A 5KFTA 4ZP8A 5C25B 1MU2B 3ISND 4K4VA 3TAQA 4DFMA 1RT7B 1D5AA 3CJ5A 2C2DA 4K4XA 3ZCMA 4XO0A 5L1JA 5DGAA 3N6NA 4H8KA 4AHVA 3HM9A 3KTQA 4KHNA 5J2NA 3RBEA 3SQ0A 1N5YA 2YV0X 4J2EA 5KT3A 3ZSZA 4CJVA 5C24B 4CEEA 1RAJA 3RTVA 4J9OA 4AHSA 3BSOA 4F3OA 1S5JA 1L3UA 2YNIB 4BE1A 1N48A 4CJWA 4IBNA 3VQ5A 4O4GB 3K5NA 5SWMA 3SUPA 2XY6A 1C1AA 2G8FA 5K14A 3PJWA 3OS1A 4CGFA 2RF2B 1EETA 1ZYQA 2FLPA 2VG6B 2WK4A 2JEJA 2WONA 5DGBA 3BSNA 3FQLA 3AVMA 1KTQA 5KFLA 3V9WA 4EZ6A 4ZVEA
chains in the Genus database with same CATH superfamily
5C0YA 4NYPA 2ZH6A 2OZSA 5K8MA 2F8EX 1SV5B 1XHZA 1L3TA 2UVUA 2NZ4A 3EX7B 4ZLJA 2UXDK 1NM1A 1KBRA 2JFKA 2HHHF 5ADXA 3ZSQA 3W62A 1HD0A 2ZE2A 1QAYA 3GIKA 1Q86T 2CXEA 1KHWA 5LXYA 2XB2D 2QFIA 5LJ3Y 1NGGA 3JAMY 3L6QA 4DR1F 4OLBA 4IRCA 3S7RA 2QRRA 3VEOA 2ZF5O 3B4DA 4YHHJ 4Q5VA 2QXFA 3GDQA 2JVRA 2UU9K 2CADA 5LSLA 2V51B 4ZVFA 1RTIA 2FYXA 2DR7A 1BIZA 4F3MA 4PABA 2W42A 1KQGB 3SPYA 1SJ1A 1X60A 2QGFB 4DV6J 1N8RT 2GGPA 1QQOA 3CCRN 1T9UA 4MYUA 5BRHA 2OMOA 3D3BJ 4DZDA 4IFEA 1RAHB 4EWTA 4RU2A 3KJFB 2XMJA 2DRAA 3ICLA 3K9JA 3TUIC 3UW1A 4ED0A 4R5PA 4USIA 2W9CA 4MFBA 4NOHA 3F73A 3LUYA 4FS1A 2D0PA 3KUGA 3TUJC 3D1HA 2LMIA 2IM1A 3ET6A 2BANB 4FVMA 3KLIB 1F2HA 4BRGA 4OZ1A 1RT5A 1XJWB 1CJVB 5IC4B 1SKUB 4TY8B 3ILJA 2QK9A 5KRTA 2C3YA 4DQIA 4OX9K 1JL2A 4WQ5A 1VJQA 4DR1K 3GL1A 1ZM4A 4NA3A 2YKAA 5BRFA 1G1XA 2G8KA 1HR0F 3TP2A 3UE5A 3Q8PB 3HJVA 2QLBB 1PAEX 2V8PA 4ZPVR 5ETSA 1U26A 3H25A 5KFXA 5HRSA 3OYMA 4XAKA 3E9PA 4EO6A 1CQNA 3TX0A 3V2UC 1VRTA 1IR2A 1BXNA 2WUSA 3AA2A 2Q36A 3NH1A 2P9IB 1RDBA 3O8MA 4M5JA 5HP1A 3EO3A 3DKDA 2QEXN 1HQUB 2E9RX 1HNWF 1Y0HA 4J5OA 3KWIA 1QSLA 4DV7F 2BJEA 3D66A 2LEBA 3D6HB 4ZITA 4KT0C 1XMOJ 4DX6A 4CECA 4EP5A 4C11A 2XS7A 3BR9A 2CH6A 4AXJA 3FMBA 2A6AA 1ZZFA 2VDHA 3PW4A 5CH7B 4CH7A 4P74A 1QUVA 1VQLN 2PFUA 1HMVA 1GLFO 3CQYA 2KFZA 4ISFA 2ZBIA 4O55A 3W3DA 3MEDA 3CFPA 3IFEA 2P51A 4CM2A 2RQ4A 2JLEA 1NWKA 1VCTA 3C6TB 1OY8A 1UJ4A 4B8CA 3H46O 4RW7B 1S1WA 1NKBA 4OJGA 2EPIA 4O0NA 3ZTRA 2JNJA 3H5YA 2NZCA 3CDWA 3W9JA 1XERA 3HOTA 2EW9A 1SPBP 3M32A 4L74A 1S4EA 3H98A 1UCNA 1WSVA 2QC3A 4H5NA 3CF5L 2C2EA 2OSQA 1VJWA 2D3OR 1UFLA 3PCOB 3FJ2A 1HKGA 1RCHA 4P6QA 4J9KA 4B3RF 3O3LA 1HYSA 1MNEA 3SSSA 5AJ3F 2OKQA 4DR4K 1RWNB 3VGVA 2KXHA 4Z4FA 2CJAA 1NH8A 3OHAA 4LFAF 3A5NC 1ELOA 2YX6A 4JOUA 1TK5A 2G13A 4DSJA 5D4NA 1GQEA 5LJWA 2BA9A 5F8HA 4USJC 3GYNA 1FD2A 2LECA 2P9NB 2EWHA 2ZM6K 3R27A 1WSEA 3HF5A 3G6ES 3ID8A 1S72S 5B0FA 3UR0A 2DFHA 4EP4A 2NRHA 3T1YJ 3HXMA 4FJJA 2HNDA 3IM8A 1UZHA 1MWYA 5CR4A 2VU5A 2HMIA 2GJ2A 1ZOTA 3VGKA 2HHQA 4J2AA 4HHHA 2NSCA 3QO9A 5AQHA 1DKGD 3ZT4A 4H5TA 5AQJA 2GV1A 3CMES 3DOKA 2N7YA 1YHQN 5FDLA 1HWUA 5AQYA 2KM8B 1R0AB 5DM7Q 5I3UB 3RGIA 5AQSA 2XY5A 1VGYA 2IVYA 3QIPB 1W97L 1K8AT 2VFTA 2YKMB 3DRSB 3GV8B 1QE1A 1WC3A 2CPYA 1Y5LB 2QZ8A 3DLEB 3GJTB 1N36K 2MQLA 3DGPB 1XC3A 2WZ1A 2J5AA 1V4SA 1HBUA 3RWUA 5ITHA 2HRYA 4ZHRB 2E7XA 4UOCA 2OFHX 3OXGA 1WNSA 2FUG9 3DRYA 3V6KA 4O44A 2XC9A 4I67A 2GBZA 4X62F 3SMSA 5IQ6A 2XRIA 4FJ7A 3J7AP 1ZM3A 4DV3J 5C15A 3SQ2A 3BF1A 2OH2A 2D74B 4YY3J 2FZCB 2JLFA 2HQDA 2RRNA 4KQZA 3B6OA 2AT1B 3IFRA 3FSXA 1F9FA 1W7WA 4FF3A 5DM6L 3SZ2A 1NMDA 2AP6A 5ETTA 4NLGA 1GH8A 5AR0A 3ZETA 4UZBA 9ATCB 3CMEN 1DBDA 1FF2A 2YPYA 1WELA 1YGYA 1NJXA 4BRAA 2G8HA 1RTZA 2XHCA 3UDLA 1SIWB 3SUOA 3A8IA 3AODA 1LW2A 3X3UA 1NLKL 3TSQA 1ACMB 1FKPA 2E5JA 3A13A 4ZTFA 3SK3A 1U6BA 3FRYA 3H45C 2QM1A 3SCKE 1UP1A 5ETPA 3O4QA 4IO9L 4K4WA 3BUZB 2C2ZB 2XMKA 4PYDA 1GXTA 4DUYK 4HR2A 3V1QA 3KKFA 5EDWA 4L73A 4ZJQA 4RNOA 1ZBUA 1R8BA 2KG1A 1DAXA 4DB3A 2QA4N 2G0JA 2QMWA 4IR9A 2MJNA 1WHWA 2R2RA 1V3RA 1SL1A 3O1BA 5EHHA 1NKEA 3H0PA 1N5SA 4DR1J 1S6OA 3T9NA 1S99A 3G87A 3PRBA 2IA6A 1VQ7N 2BE7D 1LXJA 3S1TA 2DD8S 1WNEA 2VPXB 1X0PA 1NNDA 1T8EA 4P75A 3UNGC 2W1BA 3CUNA 3LM2A 3I8DA 1HA1A 3OSNA 4WTYA 3EZWA 3JSBA 5J1EB 1K47A 3VGSA 2FLLA 1NZAA 4NCGB 4MFBB 3B78A 4U9RA 1QD1A 3H3NO 3DRXA 2IGIA 4I2PB 2V4QA 2DFEA 4YFUA 2NUHA 4M1KA 3L2UA 4JI0K 2W7AA 2HLUA 3CPWR 1S5ZA 3QEPA 4WK1A 4YOWA 3S9HA 4CLPA 4NYZA 2B43A 3A5MC 1OY6A 5KFMA 4W5OA 2MQMA 3H6EA 2OMLA 3HSJA 2Q0RA 5MAOA 3R97A 3VA3A 1TQLA 4X4RA 1D0EA 4ED4A 4KI4A 2GMLA 1WI8A 4U67L 5EUHA 4EFAC 5A8KA 1H0HB 4H0PA 4RNNA 4J2BA 4O5BA 3H2LA 4KTWA 4K4YA 4K2JA 4BWMA 2O8FB 4CYUB 1KLNA 1FK9A 5G0RB 2RE1A 1ZH5A 3MXHP 2ZJPQ 1NJYA 2UVWA 3TZYA 3CQXA 4QS9A 1CVJA 3O9TA 4M7YA 1U1KA 3SUNA 3UFCX 1D9DA 3WT0A 4YB7A 3FCVA 1VBZA 4JD2B 2L9DA 1Y3JA 2E2QA 1FJEB 4UTGA 2UVVA 2KZZA 3DDKA 4DV2F 4GMKA 4CGDA 5K5MA 2DGTA 1VSDA 5AQIA 1FI4A 2AZ1A 1SC3B 1AUDA 2UUAJ 3CJ4A 3WC2A 3M6GA 1NHUA 3C19A 3DU6A 3LGNA 4K8XA 4IOAL 1IWGA 1PJ6A 3IBCB 3N0VA 1Q8LA 4QWDA 2R7RA 2W9AA 2R8GA 1NGAA 3EZOA 3TARA 3NCRA 1GMWA 1RK8A 1XMBA 1PYTA 4RBVA 2OTJN 1SL0A 3PX6A 4ENOA 1IJJA 4L3QA 3MEEA 3GZ7A 1WHXA 4B9SA 1LFPA 3FZLA 1FFSB 1I94K 4YB1P 2E2PA 1NLVA 2H9ZA 1JLFA 2EFQA 3GOIA 4OPAA 1WTFA 3DRPB 1IBKJ 3SJHA 4JKEA 1FHTA 1RWPB 1Q18A 2VQFJ 3BO3A 3TI0A 4R8UA 1SC6A 4IFVA 2OPPA 4A8SA 2MLZA 2FC8A 4U8YA 4C97A 3V6HA 2DK2A 1FXDA 3O9UA 1S7HA 3CDAA 1XMOF 3LDPA 1ZAWA 4A46A 3SQ4A 3LWMA 1ZETA 3QLHB 1JLGA 3BGFA 1XQSC 2Q1NA 3ILLA 2OELA 3SMPA 3LGMA 1DRZA 2COLA 3J81j 1ITGA 4PWWA 3M1VB 2B7CB 1YJNN 2GUIA 3EM1A 4ZN1A 3GLJA 1PJ5A 4E1JA 1LCUA 2H4WB 4KC5A 1SBRA 1RWWB 2CWXA 1E6VA 4OKKA 2W40A 2KZMA 4DJBA 2XWYA 1D4XA 3RR7A 1QHTA 3WC0A 4A4JA 3TVYA 3SV3A 1GLBG 4OI4A 2PYJA 1M5OC 2PAVA 1ZBLA 2E66A 1VR6A 1YUWA 1NPKA 1BA0A 3ZT0A 3I0SB 3NGDA 1VFJA 1QQMA 3I96A 1FESA 2AYGA 5B0BA 4KHWA 1NK8A 4K4TA 5LMUF 1F6TA 3DGPA 3QNWB 4DS4A 5JVGL 3DXSX 3OYJA 2ZEJA 3BZQA 2ZH3A 4F36A 1VI7A 4AT1B 2O8DB 2B3TB 1DLOB 3JQJA 2X3GA 4ICLA 5E26A 3O3FA 2UU9F 8RUCA 2XY7A 2FJAB 2HHHJ 4NZ0A 2OO4A 3QFWA 4O3QA 3PW7A 1N36F 4CGHA 3FUYA 1S1TA 4IG0B 1EQYA 4KRFA 3AJDA 2J0WA 3G8QA 2KU7A 4BR5A 4K5RA 3MCMA 2V4RA 4QOTA 4RJVA 4CTAA 1CJTB 1XNRF 1Y9OA 5FPMA 1M5PC 1KVKA 2BV3A 4LSNA 2WBNA 4MQ3A 4YHHF 4P7TA 1N33F 2EBGA 2R8HA 1MWQA 1JXLA 4IFYB 1NGFA 4KTQA 2QV6A 2JC0A 3GONA 1EO1A 2Y8YA 2BJ8A 4Z4HA 1FKPB 4MO5A 4EYIB 2I5JB 1YZ6A 4YB5A 4U96A 1LNQA 2Z56B 2V67A 1OIAA 3VQ7A 2E8AA 1YHQS 4FWPA 3VTIA 2DGUA 1RWMB 1HBUB 4NE9C 4A5AA 1NHKL 3UKRB 3KKRA 4M5NA 1U1MA 2BVZA 3L2VA 4DL4A 2IAJA 1YI2S 4ZLNA 5KAKA 2MLXA 5JS2A 4ZVGA 1W0HA 5GAEU 1WF1A 4CT9A 2ZH4A 4LF4F 4C23A 3LP2A 3O8WA 4ES2A 5KFJA 5M1PA 2P9PB 2ZH7A 3SYZA 1IBKF 1MROA 3A5OC 1JL1A 4USHA 4TU8A 1BE4A 3IAM9 1KOHA 2O8BA 3MOZA 3BZCA 2F9JA 3PX0A 3EUNA 2QKBA 1RSCA 1N6QA 4DUTA 2O4GA 3AA4A 1RADB 3BBCA 3OYNA 5BRDA 1T05B 3MM6A 2LFVA 3TQEA 2WVBA 4NL5A 1RBTA 4LUBA 4QZVB 3MDFA 2QL5B 2DH7A 3CJKB 4OJHA 4AL7A 4M5MA 2BYCA 4LIWA 1EP4A 3PTWA 4CLWA 3OFHA 3P83D 1NOZA 2ZDPA 2F8HA 1T9YA 1VQ4S 5B0AA 1HNWJ 4X4PA 4Z4CA 4USMA 2RUSA 2IYGA 1HQ2A 4CEOA 4C1NI 3GBTA 4WPAA 1X9JA 2VV5A 2CQDA 3GJRB 2W2NP 4ZIWA 4ZVRB 3MI7X 4K0KJ 4YP3A 2KL8A 1X4EA 5AJ3J 1RTDB 3M4XA 9RUBA 3RRGA 1B9DA 4DR2J 2QKKA 1QVGR 4IO9Q 3ISZA 4DTRA 3VQAA 3O9RA 3MMBB 4TQRA 2HRUA 3K59A 3OTOJ 3W2VA 2YXLA 1UVIA 3HVTB 4NI2B 3POTA 5LMUJ 3DLLL 2POKA 4Q45A 4DTPA 4UY85 3HPGA 3I0RB 1T44A 1ZBHA 5L1KA 2RDJA 3PG9A 2VBWA 3J81Y 4QYZJ 3FRZA 4RW9A 1SUQB 4K59A 2RS8A 3Q24A 4K5SA 4ZVSB 4QWCA 1UAWA 2UP1A 4HTLA 3SUQA 2DEIA 5J1EA 3EZ5A 2ASJA 3D4JA 2QO3A 1AA1B 3BH7B 1DJ0A 5GMKa 3IR5B 3PKYA 2B5JB 1H7WA 2DCLA 1XR5A 5J2PB 4HLBA 5FLXU 2QWMA 4A8XA 4K4SA 3N9UC 4CF8A 3MUTP 4HUEA 2HHPA 2P9UA 3V5RA 3Q23A 3UNYA 3S8SA 5HMXA 1XNQJ 5GAEI 3PUFA 1GLDG 1RAFB 2Q3PA 4UW2A 2HFSA 1CZBA 5K9FA 5CXTA 4WYWA 5K20B 4ZP9A 3D1OA 4UT4A 4HEA9 2KKHA 4FVCA 1YVUA 4UY8O 2FZGB 4AE5A 2QSFA 5EXWA 4QR2A 4JI8K 4JP8A 4JI5F 3MCNA 2HBKA 4JLHA 2KJWA 2DNLA 5D78A 1SJ3P 4CZMA 1YJWS 4FJKA 3SDEA 3OYAA 1FK9B 2DHAA 5G0RA 1IQTA 4FWKA 4C9DA 2VHGA 3VQBA 2VKZG 2P8IA 1FW6A 2ASDA 4G1IA 1HLWA 4URSA 1XMQJ 1K1QA 2M9KA 3ZZPA 4DCPB 1RHJB 1K0TA 2ZJQL 2PE8A 1WOOA 2AGPA 4LREA 1Y5NB 2XGPA 4KO0A 3F5TA 1TAQA 4IH6A 3TEGA 2ZUGA 1IBMJ 3OYCA 2CJ9A 2GGPB 3QLHA 3PIOQ 3W5XA 1RBAA 2NRRA 3KLFB 4QOZB 2YKQA 3PZPA 4HCCA 1X5OA 4R5PB 4B3SF 3FK4A 3NMUA 4L3KA 3WIVA 1RHQB 2NYIA 1VQPN 2E29A 5H1SQ 3MCOA 5FPNA 3P5JA 1XMOK 3C15B 3M6WA 1QVFM 1WORA 4C0HA 2BANA 2GA7A 2Y1IA 3AO2A 5BR8F 5DRKA 2NXEA 2VFRA 1RU2A 4ATNA 4CK3A 2YH1A 4KB1A 4XPEA 3EVMA 3T3FA 3CQ8A 4LJMA 4JI4F 4LD0A 3K17A 1KS2A 4HACB 2CGKA 1HNZF 1VMBA 2FBVA 2XMVA 5EY4A 4NLWA 1HKAA 3EGVA 1Z25A 3NGYA 4KV8A 1PCAA 4DSIA 3RYLA 2X74A 2CNKB 4N8OA 2ALYB 3P5TL 3WQPA 1ASUA 2A18A 1U2FA 4CZKA 5L46A 5LOQA 5H9FK 3KFWX 3R5JB 2LLZA 2R7VA 4A2AA 4ED3A 3FGUA 3UQSA 4RW8A 3RB4A 1TL5A 1NMNA 5CCMA 5KFZA 3N5FA 2O66A 4NZ6A 2DNHA 2C1EB 1DTTB 2M0GB 1JKHB 2CG4A 4FK0A 4BC9A 5C25A 4GW6A 2QT7A 1CBKA 1R59O 4B8AB 2UUBJ 2CQGA 2PZSA 4ZPCA 1E6VB 4NZ7A 2W8KA 4ES3A 3UDVA 4W5QA 1TKXB 2QXLA 2DNOA 3AAWB 4FBTA 4JKGB 4QJVA 3KK2A 3ZFVA 4ZPDA 1H98A 2ILYA 3L4QA 3FEYB 4O8UA 4BCAA 3RB0A 4CP5A 1WSGA 1BWEA 1GMWD 1CLQA 3OYFA 3PY8A 3M6XA 3AVLA 2C3PA 4FF2A 2UUTA 3JS9A 4C7QA 1REVB 2OAUA 3DCAA 2I5JA 2HFNA 5H1SV 3QSIA 4RCHA 1WEZA 2HK2A 4A5BA 4CGJA 3T1HK 1C0FA 1T9WA 1UVLA 5E2QA 4EO8A 3WXLA 1UA0A 2KI2A 2J7UA 4YOUA 4ILJA 5F1XA 1S1VA 2C3UA 3ITHB 1TR0A 8ATCB 2VKRA 1MSWD 3ULEA 1XNRK 2O8DA 5BN8A 2G1DA 3CNQP 2QA4G 2ZH1A 4N7TA 3CF5Q 2NRTA 2MDAA 1S3XA 1U7LA 3IWXA 2YHAA 2G8UA 3OS0A 1JLCA 1JJCB 2HS4A 4ILMA 3R7BB 3CJCA 4M5IA 3TW0A 3NAEA 2VOOA 3HHEA 3Q8SB 2MQOA 3H7HB 3FLCO 4LFBF 2HS0A 3G6YA 5HBMB 3VQTA 3VGMA 1DURA 4OYWA 2KJVA 1GT8A 4Y0FA 4O3NA 3PJXA 3PW0A 1K73T 2DH8A 5HOOA 4DN9A 4QIVA 3I9ZA 2UVRA 2JHEA 1BWFO 2APOA 3VEYA 4Y2AA 3MCAB 1QTNB 4WJBA 1WSFA 2ZVIA 3FZMA 2Q79A 5KFAA 4J9RA 2VFSA 1I94J 3OL6A 1KC8T 3KLVA 2NRWA 2XMUA 2GS8A 2WRMA 1T9XA 3FCHA 4YOXA 1OH6A 2A3ZA 4FPRA 2KXFA 3TA1A 3DOLB 3V4IB 2XS5A 1FDBA 5D0GA 5ETLA 4LH4A 3KNAA 5L8RC 4M7XA 4IOXA 4IH5A 4PRFA 3GFZA 1IN0A 4NLPA 3M8PA 5DDOC 5C5JA 1YLXA 3D6FB 3VQQA 2DO0A 1X5PA 4I56A 3W9IA 4FWQA 5KQ8A 2P9PA 3LP3A 2K7KA 5KG0A 2IVOA 1QJHA 2O8BB 1WKKA 1W2IA 3DOMB 4OZNA 1EETB 1N6QB 1RT2B 4TVAB 3HHLD 2BJ1A 5FD1A 2ZQBA 1VQOS 1KAZA 2W9BA 4IH7A 3F2KA 3HD2A 1X4BA 3FQKA 5GADP 3FBFA 3CJKA 4Z7YA 3ZETB 2XBPA 2E5GA 4DL0C 4ER8A 2WCXA 3O08A 1SH2A 2YHXA 2VUGA 2SXLA 5IV4A 3UVJB 3VZIA 4WYBA 3SMZA 5GAEP 1JLBB 1GK8A 5KFHA 4IDKA 2MKKA 1WSHA 4W5TA 2J6SA 4FZYA 4B3RK 2DY9A 1NGHA 1RWKB 2BEFA 3PDNA 4UUWA 3MURP 3GIMA 2OJ3A 4E2FB 3CCLS 2XG8A 3MGJA 2P9EA 2KRBA 1S12A 4YEAA 1CEZA 1QUPA 3KHHA 3HFZB 1BLUA 2B8QA 2GJFA 3C6UA 3R1LA 3MAHA 4X66F 3KLEA 3U3YA 2OYQA 2O5DA 2RHSB 3NWGA 2DYAA 3PHTA 3GFXA 3R5AA 5KFRA 3PR5B 4ECTA 3RR8A 2ZJRL 4NI2A 2UXCF 2WAQD 2B6AB 3AAQA 4RR5A 4DR3K 2HKEA 1VK8A 4DL2A 1K8KA 2QA4S 4KH4A 1LKZA 2AGOA 2E1RA 4LFCJ 4NASA 1FE4A 2FSNA 1VOMA 1XWLA 3BGRA 3D0HE 2KT2A 4CI0B 2DGSA 4TQSA 4EHTA 3BO2A 4DV1J 4DV3K 1LK7A 4BRFA 1IJFB 2B5JA 3I33A 2DRDA 3UN5A 4K8RA 1R89A 2PYLA 3T5KA 3ENVA 5MLCQ 2NQPA 2DPIA 3HKZD 4F04B 1U1NA 4OYAA 1TL3A 3UDEA 4OX9J 1VHIA 3PIPQ 3K5OA 2ZJRQ 1VQ8N 2DEJA 1V3SA 3G96A 1PYSB 3MWTA 5GAGI 1T9VA 2ZGYA 5C2DA 3D2FA 2BKOA 2O8EA 2M7SA 1VC5A 3AVNA 4CJRA 5DZ7A 3SV4A 3OTBA 4GVBB 3M3ZA 4ZP8A 3AB2B 3CCQS 2NXNA 4OJ1A 3TAQA 2GHVC 1YRUA 3OPKA 2C2DA 4K4XA 2OIHA 3GCXP 3VETA 4NLCA 5L1JA 1R8CA 2HWTA 3HM9A 3KTQA 5J2NA 1T02A 2GMJA 3SQ0A 2ROEA 1OH5A 4AHSA 1RABB 4FPIA 4F3OA 1L3UA 2YNIB 5F0XA 3K2YA 3TPQA 5LSOA 4IBNA 5AZIB 4O4GB 5BR8K 3HLUA 5AXMA 1C1AA 1OSCA 1P1TA 3OS1A 2RF2B 4J90A 2WK4A 2JEJA 5A2QY 2WONA 3AOAA 2U1AA 3FQLA 1EAYC 1YTYA 4ZVEA 3T6JA 3CEDA 4MJKA 4X64F 4FK2A 1RBSA 3DLHA 2CVEA 1M1KT 1RT6B 1RWXB 4CZFA 3O9QA 1UKUA 2F7VA 4LT6A 4FOIA 5F3TA 1S9FA 3MMAA 4GO7X 2FDNA 4WF9Q 2DVIA 5F3ZA 4JI8J 1FRMA 2YNFB 1RU1A 4HTIA 4FS2A 2E1AA 4OX9F 3UN2A 4FJXA 2YNGA 5D15A 2IBKA 2C2NA 2KFYA 4DTMA 3DRRA 2A2DA 3VVTA 1YZ7A 2ZD1A 1RT3B 3MN9A 1HNZJ 4P2FA 3P49B 1RA6A 3O6WA 2V6AA 2MKHA 3CI5A 2VQEK 1VSFA 4LF1A 5AE2A 1IR0A 4FYYB 4YR2A 5LXRA 2W6LA 1M1KO 3QSYB 4ZPAA 4CNYA 3EVWA 4WFNL 3M2RB 5ADXH 2ERRA 3UKUB 3DYAB 1S1VB 4HCBA 1Q79A 4CLFA 3GWCA 2OCEA 4ED1A 5AQRA 1HBOB 1AZSA 4HTUA 1D09B 4H0YB 2CGJA 1ZXOA 1U1PA 4LVOP 3OJUA 3CDBA 4NEZA 3KD1E 1O5JA 5BPLA 1RDDA 4FWRA 2JWKA 1NK5A 1U25A 1S6QB 5IT9Y 1TL1A 3ALYA 3A8KA 1Q95G 2GFFA 4PPZA 4DV3F 4CGIA 2JEGA 4ECYA 4LF8F 2HQIA 4OJRA 3DHWC 2P9KB 2V9WA 4JV5J 3VQSA 3TTDA 3DM2B 3M8QA 4USKA 3KK2B 3UWTA 4QAGA 3MCSA 2E5LJ 1NSKL 4IUFA 4RU9A 4C6AA 2IJNA 1TGOA 1TFYA 1Z05A 2B4PA 2FF3B 3JS6A 1VQ6N 5IZHA 3D6RA 3SCIE 4JKCA 1SIZA 2MKCA 2RNEA 2PMZD 4OZLA 2JLGA 3V81A 2FD2A 1KQFB 3MM5A 5L38A 1R8AA 4OI3A 4PG6A 3OUYB 1U8SA 4RZRA 1ZBSA 4QIGA 4G3IA 2VPYB 3ZYYX 3CWJA 3RMCA 2FHKA 3I0SA 1Y00A 4FLWA 4ECSA 3ULEB 2HWIA 4KGVB 3CD7A 4YDXA 3IP0A 2ZHAA 1S0NA 4DU3A 2FVQA 1BA1A 1HWIA 3ZSVA 5DLGA 3WQUA 4ZMMA 3MPYA 2G2ZA 2R2UA 1RTJB 2HGLA 2J0SD 2BJDA 4LSLB 1EX4A 3CCZA 4B3MJ 2EWSA 3DOMA 4BGAA 5A2QU 2AV5A 3IRXA 4C3MA 3C46A 2RU9A 5HVHA 1FERA 1FKOB 3BBBA 1IKWB 3HHLA 1GOBA 3IN5A 4JKFA 3OSPA 4HVZA 4DPXA 4BHQA 1CJTA 2KVIA 3UCZP 1CJUB 1I1GA 1G2EA 1VQPS 3K9KA 2DIUA 2R3VA 2VCPA 4DPYA 1JCFA 2ZZMA 3K89A 1ROFA 4QIFA 1RQ0A 2ZH8A 4IKFA 5AZJA 2N7CA 4U7UD 2UXBK 3KG0A 2DR8A 1QZ6A 3BKTA 2IM3A 2DHHA 4E7HA 4C8MA 4QWEA 1DHMA 2VQEF 3E9LA 3C2PA 1NH7A 5GIOA 1B4SA 3QWUA 5C12A 1C1CA 2VA2A 3DU5A 3FKBA 1FT8A 4P10A 2XLJA 1KVIA 3TUZC 2AQ4A 1C0TA 3NGKA 4F25A 1NCLA 4LF8J 3GG0A 4XEIA 5A0YA 2P6SA 3HK2A 5HQ8A 2QWQA 4U7UK 3UD3P 4BRQA 2K2PA 4KHPF 1YWXA 3HP9A 1AT1B 3I55S 2OLWA 2EKNA 5AQFA 3FZKA 1Q7YO 3JAMU 3O6QA 2VWBA 1S1XA 1HKCA 4DV4K 1SB6A 4JKDA 1E3MA 2O3DA 3L3CA 3WUHA 2BXJA 1QQNA 3IG1B 2CQ3A 2ZFHA 3NEKA 3CE8A 2HBJA 2FC9A 1JLBA 4DFKA 2XS2A 2FGCA 5LT5A 3V1OA 3OTOK 3UN3A 3JSYA 5KPTA 4DX8H 5I4MA 2PA8D 4GKJF 2HAIA 1N32K 3Q89A 1B64A 4PKHA 4JV2A 4OV1A 3IUCA 1B3TA 4Q2MA 1BIUA 4UZCA 3KK1A 1IG9A 1U6ZA 5A8WA 2AHOB 1RLDA 1V5IB 2KG0A 4ECRA 4B3OB 3LDOA 1FCAA 1QZ5A 2O8EB 2CJBA 4JI4J 5LJVA 1W25A 1T95A 1U2CA 2ZBQA 3ZT2A 4JK7A 4A8MP 1HWKA 3GJSB 2FBYA 5KFNA 4DR3J 7FDRA 4F0KA 1RWUA 4JRPA 5J2NB 4LFCF 3AAPA 4M5HA 4R79A 1C1BA 3MMBA 3KIOA 1FE0A 3CJ3A 2ADCA 2OTJS 1NK6A 3RAMA 3J7ZT 3JB9k 2E5IA 2Z8QA 4CEZA 4FVUA 3G4SS 2B9EA 4TSXA 4OHYA 3J7A1 3KHRA 1H74A 2W7PA 4LIRA 1ZBFA 5AQWA 3NVKA 4NPOA 3OYKA 4BC4A 2Q43A 1RT6A 1N32J 1LW0A 4X4OA 2JX2A 3DWLA 2IOCA 3NF6A 3M5RA 2Q97A 4DMNA 3Q8VA 2DO4A 4BACA 1J54A 1KVAA 1QM9A 4CJ4A 3OBWA 4ZP7A 3EE3A 1GMUA 3QERA 2P9UB 3ID6A 5K8PA 3L2RA 1TMJA 4ZVQB 4JI0J 2YNGB 1G15A 3I4PA 4FSVA 3AFGA 4D3GA 4IRDA 3TAFA 4ZIVA 4G6VB 2CJYB 4CJKA 3P1GA 4E19A 1G99A 2H3GX 3NY0A 2VG5A 2RE2A 1APSA 3UD4P 5F8NA 2F8SA 1YRXA 3KJVB 1QQCA 3ZX2A 3CD5A 4WCEL 1Z4UA 2A1SA 3MAAB 2C28A 3MX5A 4LFBK 4KJIA 2KYZA 3LANA 4KH1B 2G0IA 1RDRA 3G82A 3T19A 4WU3A 4WTOB 2A0FB 2YHWA 1OQ3A 3DYAA 2MTLA 1IO2A 4GV9A 4Q8EA 1YX2A 2QL9B 2B9WA 4BVPA 1U02A 3H42A 4H4MA 4MIWA 1BHNA 3DLBA 5IV3A 1ZM9A 3V1RA 4A8KA 4V19J 3MK6A 4CZLA 5AT1B 5EWEA 1UJ6A 3A3OB 3RMAA 1RAAB 1FRJA 4P73A 1IBLF 3DHXA 4I4BA 3NF7A 3AH6A 3T6BA 2YX7A 4N47A 3DM2A 3M8QB 3PIPL 4CCHA 2KW4A 4CO4A 4CFAA 4PUOB 2DHXA 2D4WA 2YWWA 1S49A 1F9HA 1LAVA 4J8FA 4B9VA 4KPCA 3I82A 2FLNA 3V6DB 3K0JA 2LA6A 1BGXT 3F41A 3MTKA 2KB2A 2QWRA 5HRPA 2V5HG 1GLLO 4EFHA 4I2QB 3KLHB 5HJYA 4OX8A 1UWBB 4YNQA 1S1WB 3VMFB 2IVFB 3C7NB 1NDPA 2K3KA 3CJ8A 3OVNA 3S3OA 3BY5A 2ATLA 2EK1A 4AF1A 4DV5J 4CLYA 1R6YA 4Y65A 1BU6O 1JLFB 1V3ZA 6FD1A 1RBLA 3QEXA 3KK3B 2VPWB 2H5IB 4WIQA 1Y5IB 1RP5A 1ATNA 1J5OB 3LO3A 1N34K 1AZSB 1NAQA 2YQ0A 4LC9B 4KV8B 3G86A 2ZM6F 1K6YA 4WZMA 3SAHA 5BREA 4DV2J 1RTJA 4ZK7M 5F8IA 2C3MA 3J7YU 3GU0A 5LL6Z 2HNZB 4L75A 2I7PA 1JK9B 3OV7A 1IQZA 4LR8A 4AQYF 1KN6A 4IJNA 1NG9A 2P9KA 2XQCA 3IRWP 3DXBA 1WHVA 2ITGA 4DR7J 4DF4A 5L39A 4B3MF 2EHGA 2D0BA 3K5MA 4Y28C 2QWPA 3OYLA 1HNIA 1N4LA 1FNXH 2MSSA 1T03B 3EICA 4BRPA 2QI2A 2B4OA 4KREA 4X4VA 3RZAA 3CCSS 3LZJA 1X9SA 4CFBA 1CS4A 4EK2A 2P9LB 5GMDA 2LQBA 4CD3A 2JWNA 4PL8A 1PJ7A 3CGIA 5T7LA 3PYGA 2ZC3A 5AE3A 1DY3A 4JI0F 4JYAJ 1QE1B 2AJ1A 2GAGC 2B4VA 1NBEB 3T9ZA 3J81O 1TUVA 3ENOA 3HI9A 4ZPWR 3Q8RB 2G4BA 1Y7PA 3QJJA 5IS2A 1OVQA 2VZ9A 4YY3K 1AYEA 4DV0F 3LL3A 3RAQA 4FYDA 1TV6B 3OVAA 4KAIA 3MR2A 3PLAA 4KHQA 1FD8A 5CYMA 3KMSA 3AO4A 4EU0A 5DO2A 2VODA 1UVKA 1W7AA 1Q82O 3BPSP 1TFWA 3W65A 1PYOB 4KSEB 5IWAF 2YQ1A 4IG0A 3WX4A 2YCHA 3QBWA 4E7KA 3BQ0A 1TUYA 4BC2A 2M8DB 1CJUA 3FEXB 1E4FT 1HBNA 4CTAB 3PVXA 1MW7A 3SCJE 3TTCA 5HBMA 4YORA 2D0AA 4RW4B 4E98A 2XZWA 2BW7A 3ZTPA 4CHYA 2HB5A 3DXMB 4QIWD 3WXMB 2AEFA 1YIJS 3R8YA 3QNNA 3CJ7A 3BH6B 3GB0A 3HO1A 3GIJA 3WZ0A 2BX6A 1VLYA 2YH0A 1HRHA 1ZS6A 1NOYA 5E0OA 5D3GA 2E7WA 3PO5A 3NGSA 4KHPJ 1RAEB 1N34J 4RLEA 4N5SA 5E84A 5L9NA 2MZRA 4FF4A 4YQWA 4NEYA 1NSAA 3QBXA 1W9HA 2RH3A 4XDDA 1XN9A 4QYZK 5JMVA 1Q7LB 2AJQA 3UKRA 3VHQA 4S0MA 4ILRA 1VSIA 2RKIA 2C2MB 2Y1LB 3NF9A 1BO5O 2XTJP 2FIUA 4P72A 1QVFR 4CF1A 2WOMB 1U8WA 4FZVA 1B99A 4XH4A 2GWKA 3A2FA 1Y3KA 4NMLA 3X1LB 2F3JA 4HHTA 1NEEA 2MGZA 4XPCA 1YAGA 2ZNZA 3VEZA 3AVJA 3MXIA 1FDDA 1R0CB 5DDRC 4DR2K 1DQ9A 1NGEA 4FF1A 2KTQA 4ZS6A 4Z94A 4CJUA 4X4NA 2DR9A 3AB4B 4DL5A 4MYTA 1R8HA 4F9OA 3W1YC 2HVEA 4DBQA 1SKRA 1YQHA 4DTOA 3ZNJ1 3MD3A 2EG1A 2KHCA 2ZJPL 3CIMA 1KQKA 4MMOA 2DNGA 4FDFA 1WN7A 4FW1A 4DCHA 1KD1O 1XR6A 4CH1A 2UXDF 4OO1J 2OPQA 2UV8G 4USUA 3PKMA 3TR5A 5AQXA 1S6PB 3AARA 3PNIA 3RU0A 3ZZTA 4WFAL 3U4LA 2GTDA 2F4VF 3A8YA 4IZ9A 1U4BA 4A47A 4EI2A 4OZ3A 3TX8A 3MR5A 4JI2K 4CJQA 2YI1A 5AQLA 1U04A 5LMNK 2FVPA 1BWVA 4LF2A 4MKYA 2UUWA 2U2FA 4BRDA 1HI1A 2RPIA 2DNZA 3CC4S 3LF0A 5AXKA 2IVNA 2ASYA 4FJIA 2BH1A 1S48A 3A12A 3KLGB 1A7GE 4OZ2A 1ZPVA 5SUHA 3A4TA 3NGZA 2O8FA 3GP9A 2G8VA 2O01C 1RAIB 3OTDA 2PSZA 1KVBA 2BE9B 2Y9HA 1BCMA 3D5MA 3AGRA 1U1RA 2W41A 3IMXA 4F0MA 4K2XA 3HPOA 3SJJA 3O5TB 5IOLA 3QESA 4J9QA 4Z4EA 1RUSA 2RILA 3OYGA 4ZLLA 4M3XA 2NPFA 3KVGA 2HG4A 4NLUA 3IA0A 4LBHA 5C42A 3BQ1A 2Z2LA 1Q5YA 1E4GT 2Z1IA 3D6MB 2DR5A 1G7CB 2D9PA 3BF3A 3IWLA 2CPZA 5JMNA 4ECQA 2L3MA 1HW9A 5L1IA 2XYHB 3A3PB 4OLPA 1WLJA 1YBTA 4RPFA 2NXUA 2A2CA 3K57A 3CCVS 4OYIA 4FJMA 4KFBB 5ETMA 1CJVA 3J8AA 1UWBA 2I2YA 2MEWA 2P5OA 3P5BP 2CJQA 4FK4A 2R2TA 2UUAF 4FYXB 1NB2A 2HQFA 3NS6A 3BGLA 1VQ6S 3J80U 3SDEB 2C42A 3LDQA 1X3NA 3K5LA 3T1HJ 4G1PA 1CZ9A 2HWHA 2CWKA 4HVJA 4ZP6A 1C4AA 2YNIA 1NNEA 2ZZNA 2F4FA 3CCJN 2HVDA 2VPZB 3HJFA 3CD0A 2ZWOA 4MKBA 5FIIA 1R8PA 1JB0C 4CK1A 2ZITA 5I9EB 1U1QA 4DX5A 1X1PA 3VQ6A 4AHTA 1VRTB 3CO0P 3AXKA 3CJ0A 3C8YA 5CZ2A 4J9UE 4DR2F 3EE8A 2IC3B 3AVBA 1KRPA 2VL1A 2WB1D 1X4HA 1QAIA 1C0MA 5I42B 1SJ4P 4KH5A 1T94A 2HGNA 2DGXA 3BBFA 5KT4A 2GX9A 2V8DA 5JVGQ 3KJQB 5KT7A 5AQOA 1SH0A 4X65K 5GINA 2BMBA 4WFYA 4GY2B 2D0OA 1HNIB 3MPDA 5CYQB 3ADAC 4KB0A 4E0DA 4CEBA 1VQ9N 3HYFA 4ECVA 3C6TA 3VF4A 3NF8A 4W5RA 3KJNB 2OUGA 3ZO7A 1SKSA 4OI2A 3ZSXA 3EE9A 5CYJA 5KOXA 3SBMA 1OPZA 4Q0BB 2Z0GA 4OHVA 4FW2A 1TKZA 3VF2A 2JEIA 3FMWA 4G9ZA 2CPHA 4OYZA 3BDPA 1KLMA 4K43A 1RLCL 1TL4A 2DBBA 4JYAF 1SH3A 3QIOA 1FRHA 1WSRA 3RRHA 2OD6A 3TWZA 2IIHA 1DFDA 1SJFA 1UEVA 2EC2A 4CZEA 1XTZA 1T9TA 3NAHA 3OR2B 4FP9A 3ULHA 3L95X 5AXLA 4KHUA 1DLOA 1ZC6A 3H5UA 2LQ5A 1A5WA 3D45A 2HFUA 4CD1A 3R5GA 1UPPA 4JI6K 1SQKA 4HDGA 1Y97A 1B0TA 2DIVA 3UI3A 4JHDA 1TL1B 4E89A 2GQCA 2V94A 1JKHA 4F2RA 2FJWA 2AF6A 3HT0A 3W7BA 2LEAA 3QFUA 4IYQA 2HHVA 1N33J 1URNA 1TKTA 3FCWA 4GKKJ 1IKXB 4ES1A 5DG7A 1JCGA 4ETZA 3EJMA 1HLUA 4F4ZA 2E5HA 2LCWA 3M2UB 2E5LK 1TK8A 2NR0A 2RN2A 1NPPA 1UJ5A 4QW8A 4ZVOB 3CB4A 2Z57B 2EXUA 1T3OA 4ECZA 2P9LA 3F44A 3T1HF 1JLAA 5K14B 2D1CA 2GVDB 5FLXY 1H38A 4O0IA 2FJDB 1GLAG 3DNCA 4MIAA 3GTYX 2X6SA 3Q22A 4OKEA 4KIAA 3FFKB 3MM5B 2O4IA 5KPZA 2YKNA 5D4LA 3QRQA 4ILGB 1B7YB 2V8GA 3VQDA 4UQTA 5I3UA 4RUHA 2XLKA 3F56A 2AJFE 3HFKA 4CFCA 3OR1A 4RWTA 4MAKA 3GG1A 4U8VA 2E9TA 2QA2A 4TU9A 3VAJA 2R7OA 4UUXA 3RSEA 4C1NK 4JAXA 5KFKA 3TABA 2P9CA 3AT1B 3ZX0A 4HL9A 1I51B 4ZHRA 2LXIA 2MHEA 2RHQB 1DT9A 1YJRA 2MZ1A 4K42A 1ICEB 2HZAA 4JK9A 3D0GE 3VTHA 1WOSA 3CC4N 4M3UA 3W3SA 1YVFA 4MTPA 4DPOA 2FY8A 4JUZA 3L7OA 4RX6A 3KKSA 2X3DA 5IT9U 2F8MA 5HATA 4DS5A 3MX2A 2DNMA 4B3RJ 3CCSN 4QPXA 3RRKA 5EU7A 2CGLA 4H5VA 2YWHA 4KGMA 3C65A 3FVYA 1TVRB 1CXUA 1BQMA 3WEEA 3IC1A 4P2XA 3C3LA 3JSMB 1WWHA 2HNYB 2V2QA 1XUPO 1FX4A 2QMXA 1HUXA 2FQQB 4OVLA 2CNNB 4FWMA 2WC9A 2UXDJ 3R7NB 3FFIA 1U0HA 3THYA 3S3NA 2EKYA 4BLGA 4DDFA 2J9DA 1LWCA 3IGNA 3SI6A 1C1CB 1URRA 3NFAA 1S7IA 2PGCA 4AILC 3ILOA 2VB6A 2V50A 2OFGX 1QTMA 4DV4F 1F5BA 5IC6B 3MOJB 3CYMA 1PBAA 4LF7K 2YHYA 2WBMA 2HFVA 2CPJA 5KQDA 3V9ZA 4R0JA 4U67Q 2OHDA 4TNOA 4ID5A 2J0XA 2ZBPA 2MGZB 4M95A 1VIXA 4IQMA 2E88A 3NGIA 3T1AA 2EFGA 4ZTJA 2PD1A 4LRAA 1JLEB 3M9OB 1WKLA 4Z37A 2OGUA 1Q81T 3NGTA 3UCUP 5DM7L 2IY5B 4TLQA 4XTTA 4NXMK 4CBUA 3LAKA 4J37A 3HKWA 3KD5E 2VGMA 3H08A 1KFDA 3J7ZO 3V4MA 5BJRA 4K25A 3UVJA 3CCWA 4CEFA 3IBFB 4UQGA 2ZH2A 3AOCA 4YY3F 2XGQA 1S6PA 3W2WA 2AX1A 4PG8A 1EKRA 3TAMB 3PRVA 4GKKF 4AHUA 3GIIA 2B4JA 1S79A 3MEGA 3BYPA 4X84A 2J7WA 3CCES 1RHMB 4DXLA 3WNFA 4DLEA 1DQ8A 2MJUA 4I2PA 2MXYA 2OEJA 2KM8C 2HYIB 1SV5A 1R0BG 2HFOA 2J9CA 5M1KA 1VSEA 2FSJA 4DPWA 5KG7A 1WUUA 4AYBD 1GX6A 3GPAA 4OZ5A 2DHGA 5IT9O 5KGXA 2HFZA 4WFBL 3MECA 3J7YP 4NRUA 3HVWA 1FJ7A 2NLWA 4B1XB 4B9MA 3SIPB 1C1BB 2IMOA 3CIPA 1JIHA 5CHCB 1HFEL 3F9KA 4CZIA 4OZJA 1EKEA 4ECWA 2CVIA 4BQLA 1HI0P 4PWUA 4JI7K 4LQ3A 4DQPA 2NCKL 4CJFA 1TL7B 1HNXK 4YS2A 1S0VA 4TXSA 3MD1A 2VFVA 1T3NA 2D9OA 3PEJA 3N5BA 1VQSA 3U1MA 3JAMO 1HNXF 4AM6A 2VDIA 4E8UA 2X7IA 4Y2KA 3L7UA 3GE9A 1N88A 4EZ9A 1VQKS 5DQGA 4OPJA 3UIQA 2F65A 2MQQA 3D54A 1D8YA 2W4DA 3VGUA 3MM8B 5T41A 3WXIA 2L9WA 1PBUA 3PSIA 2UXBF 3O5BA 1MA9B 5FLXO 2R42A 2F9DA 2Y1RI 1DARA 3IR6B 2V2ZA 2VG5B 3D28A 4X4SA 3NCPA 3LPYA 3I32A 3LWLA 2C3OA 4QS7A 5AQPA 3ZZ0A 4CEQA 3ZT3A 4WE1A 4H4KC 3AVKA 2MQNA 3EGNA 1YTUA 3QT7A 3AY0A 2EC0A 4KE5A 1YF5L 1U47A 3OR2A 1GAOA 2XSFA 4AD6A 3D68A 2HGMA 3G9CA 1UVNA 3GR0A 2BE2B 2KH9A 2RIJA 4G1QB 2WSEC 4FWSA 3B8HA 2ZBRA 2AIRB 5C25B 4H0XB 3M1VA 2ZBCA 1NSQA 2FSKA 3ZCMA 3Q2SC 3N6NA 2L08A 1DEJA 4J2EA 3VWSA 4CJVA 4WKYA 2M5YA 4JI3K 4GKJK 5BYSA 2CFXA 2EK6A 3BS9A 2BJ3A 3N4WA 1N48A 1WF2A 1NDCA 2WVEA 5K14A 1ZYQA 4LF4J 1N34F 3W60A 5DGBA 4DKWA 1KTQA 3NGUA 5KFLA 3V9WA 3IM9A 2AYBA 1TKZB 3EGZA 3BSAA 3HM8A 3TANA 1FTCA 1WAFA 3AJ1A 3GCWP 4WK3A 2YKPA 5FRNA 4PZVA 2PI5A 4PPDA 5CABA 3R7SB 3VQPA 2IM0A 2YHBA 4EUVA 4PKDB 1JJHA 4DR4F 3M32B 3UKUA 2X1BA 4NRTA 3SFGA 1HNXJ 3PM9A 3DXKA 3P4IA 2KO1A 4KGXB 2EVZA 4I6AA 4DUZK 2PMWA 4ZA1A 1X4DA 3ZT1A 2EFNA 2GV9A 2WHOA 4P2MA 5M1QA 4UOGA 2HAFA 4ELVA 2HQ3A 2GWJA 4BWJA 2HNZA 3OLBA 1KP6A 4AL5A 4IDHA 2EG2A 4C4WA 3RAXA 1OJ4A 1RCOB 5AQTA 4LRFA 5D8HB 2F63A 5LMNF 3WNHA 3AY9A 5HMYA 3ZTQA 4PL7A 4PXBA 4P71A 2EX3A 4FNIA 2DITA 4CZGA 3AD7C 2LU1A 2HS3A 1YDLA 5D0EA 1M5KC 4FM2A 3IS9B 4DR5J 1OH8A 3TRGA 2HZVA 2PO4A 5IQQA 1ZAVA 3UDCA 2QJ3A 4W98A 2GVDA 1IKVB 5HROA 5KG4A 1K9MT 4B3SK 3WEEB 1Q86O 5G4DA 2HNYA 2OP5A 1LWFB 1KVCA 4M5KA 4RTFD 4F2SA 1NDLA 2Z2YB 3A3NB 1AFJA 1CS4B 3G71N 3DOLA 2J9DE 4CJPA 4DQSA 3V9SA 5CD4A 2Z2ZA 3OUYA 1R0AA 1XNQF 1F0XA 4A8FA 4E3SA 2OPSA 1MG7A 4AFFA 4CI6A 1U24A 3DDIA 4OKJA 3QIPA 3BSCA 2BTFA 3OBIA 3RSEB 4M41A 5BYRA 4WQ5C 2V52B 2O67A 1RHKB 2FJVA 2CQBA 4ISEA 4A8OA 4U6PA 2MZJA 3THXA 2AEJA 1S0MA 5FPDA 1RWVB 4JV5K 4F4WA 3PFEA 5DK5A 2QX0A 1PKUA 4X64K 3EPIA 5A6PA 5AQZA 5AQVA 4XH1A 2H51B 2OTLN 5AQGA 2AMCB 2CQ2A 4LRBA 4DV7K 1NO8A 1WSIA 3CCUN 3CW2C 2DGVA 4CESA 2D7SA 3C14A 2DH9A 4I6WA 4F4XA 1YK9A 2J9EA 2H5EA 1T05A 3BGUA 4YB6A 1MMLA 4B08A 4QWAA 5ELZA 2F1FA 1YT3A 4LY7A 3SQOP 3LDLA 2NUBA 1JJ2M 1HWLA 3RG6A 4M63C 2FHOB 1WC1A 3PV8A 3W2WB 2KXNB 2JJ4D 3ZZOA 1BMQB 4CO0A 2N4CA 4RO0A 4B3SJ 4NB4A 2YWEA 1XBWA 3AO3A 2DFFA 3MEGB 3J80Y 3QJPA 1LWCB 2MKIA 1VSMA 2CQ0A 2I38A 1T6DA 2WW8A 1CQMA 2DXDA 2G1HA 4CHOA 4ZVUB 2B8PA 2VOPA 4H4OB 1YI2N 3QT8A 4RBTA 3VF6A 3BGOP 5A0YB 4B9LA 2PBDA 3MN6A 5M2PA 1FKAF 2CQPA 3PR4A 1YJ7A 5DETA 3QICA 3HVRA 1U48A 3OA9A 1JLEA 2RT3A 5KFEA 3ZSYA 5GAHU 3LDSA 3CO9A 3E51A 1JX4A 3HT3A 4GVLA 1YSJA 3D67A 3GG4A 4I7FA 2KN4A 3QQCD 4DV5K 1X7VA 5IM0B 1XEZA 4KYZA 3AA5X 4HWIA 1R31A 1RGVA 1SQEA 1BD6A 1UAXA 1NDKA 2DNKA 1RKJA 1BI4A 4HHUA 4CJ7A 3CXCR 2FPHX 3BKFA 4W90B 3TAMA 4ZLPA 3AQPA 1KTVA 1P9QC 3CDUA 2L41A 3ZEUB 1SI9A 3FNNA 2XI3A 1WG5A 2PDAA 4FYWB 2QYGA 3ZSOA 3M8WA 1VQ5S 4CF9A 5J2PA 4IKAA 3R2DJ 2HHSA 3L2WA 2C2KB 2FB0A 2JRSA 2PI4A 3R8EA 3DLKA 4CT8A 1U09A 3C66A 1YJVA 2V63A 4I6MA 3U9DA 1RT5B 3ZZRA 4LF6J 4HI1A 4F26A 4WP3A 4MO4A 3BR8A 5B09A 3PIOL 3OD2A 2BR0A 3MR6A 1SQFA 1X3MA 3QGHA 3G2XA 3HHDA 3B6BA 2A42A 2FBTA 2OTLS 2AYMA 2YWGA 4I0WA 4MK9A 4BRKA 1CULB 3PO4A 3AO1A 3NNCA 3TSPA 4DV5F 2MY8A 4TY9A 3Q7BA 1WEYA 4NLTA 4BC5A 3S3MA 3CM5A 1PC4A 1Z6RA 1VQ7S 4LR9A 3LQVA 2MY7A 2DNNA 5JXSA 2A40A 4M3TA 2QFJA 2RDDA 1PILA 3HVAA 2R8IA 4QCLA 2XMMA 4B9NA 1HHSA 2X51A 2GELA 3GYGA 3ZX3A 1KVJA 1HJRA 2LQJA 4G1QA 1FWKA 3R2CJ 2M2BA 4CHZA 2RD5C 3DLRA 1EXQA 3QEVA 1LW0B 2GW8A 2J8AA 1AB8A 3EDQB 3PXGa 4DWIA 1ATRA 1NUEA 3CJTA 1ATSA 1Q1KA 3K8WA 3PX4A 3OW2M 3CXCM 1SC4B 3LTOA 3C15A 3JYTA 4CF2A 3HDSA 2VFUA 3MF5A 3WX8A 4KB7A 2DISA 1HMVB 4JI4K 4NLOA 1ESVA 2HW3A 4JRQA 5KTQA 1XHXA 2N3LA 5HVGA 2ZM6J 3SQGA 2VBYA 4OI0A 2CRLA 2IHR1 4RW6A 1VQLS 2BM0A 2ZNYA 1SJQA 3B4MA 2CZ4A 3MEEB 2JDJA 3SFUA 3SQ1A 5M1NA 3JXOA 4OLOA 3TJ8A 3MFHA 4A8WA 1AXQA 2R8KA 3O9SA 3Q8UA 3VQCA 3PACA 4NLSA 1P6TA 1SCJB 2VYPA 3S01A 1REGX 5AQQA 1RT4B 3MMCA 4IO1A 4GVMA 5GADU 3THVA 4WXWA 2NS1B 2V2KA 4JI3J 1SL2A 3EXYA 3RBDA 1KAYA 3W64A 1BY9A 2OSRA 3KDNA 3FGVA 1O6XA 2WSFC 3R3LA 4YDUC 4B3MK 2XYPB 1LQ9A 2WSCC 3CM6A 2GCFA 4J9NA 3OTCA 1I3AA 2GJIA 4K4ZA 2UUBK 3R6MA 3WNEA 2XCAA 1VBYA 4A8QA 1EWRA 1S9EB 1KHVA 3H5SA 1TKXA 1L3KA 4KHYA 1D3WA 5ADZA 2VG7B 1YKWA 1REVA 3RW7A 3JTPA 1OYEA 3CPWM 2A1BA 1RNHA 2XLIA 3O3HA 1N56A 4I9QA 4NO7A 2VJUA 4YR3A 4DR4J 1OYDA 4O5FA 2PFDA 3MHYA 3HBTA 5EGYA 4LF6F 1MU2A 3CT9A 5GAGP 1VC6A 3SLCA 2CPEA 2ROPA 3JTNA 3AGKA 1FJCA 4BC3A 5KFVA 3ITHA 4LF5F 3L7PA 3KK3A 3FE1A 2XNRA 1U6FA 2UXCJ 5KFPA 2CQ1A 2BKNA 4G65A 1EB0A 5DS7A 3T1YF 4DSKA 1UTAA 1VSLA 5EWFA 4DUYJ 2YPZA 4DOZA 5C2FA 1JNRB 5GAHP 3EMTA 1RDAA 2BACA 1N54B 2XM3A 2LDIA 1RBUA 1MMNA 3IRXB 3Q2TC 4QIEA 3UD5A 5HJXA 1ZA2B 1LWEB 4DL6A 5KFCA 4M5GA 2F9TA 4JHDB 5AXNA 3IS9A 2HHWA 1X9MA 3KZBA 3QGIA 5HQMA 5KFBA 2AEMA 2H65B 3R5DA 4ZPBA 1VBKA 2N82B 1NPRA 1NGDA 4USVA 4JKAA 2V69A 1WACA 1CC7A 3SSRA 2DXEA 1MWZA 3ZZZA 3OT9A 3D7EO 1C0UB 2R7QA 1YJ9S 1KOOA 2DHSA 4ETXA 5FROA 1KCFA 4CK2A 2GIRA 2V2VA 5F41A 2B9XA 4C48A 4IEEA 3NLCA 1SAZA 2P1JA 4L3NA 4FLXA 4H5WA 2FHJD 3KOAA 3B82A 3G10A 2L9NA 3D2WA 3QB0A 1A6LA 2YBVA 3D2EB 2JVOA 1PC5A 1P90A 4GMJB 2R4FA 3E9OA 3OR1B 3EVOA 5J2QA 3M30B 5HO4A 1HQEB 4BY9C 2CZVC 1KXPA 4JN4A 1IVZA 2ACYA 1GX5A 5J2MB 1AUSL 3LH2S 4LRDA 1TV6A 2BQ3A 1RT2A 1WD6A 4OPHA 3KWMA 3VN5A 3NWRA 5HLFA 5IT0A 1ZTWA 5L1LA 4JK8A 1D9FA 4FJHA 4IG3A 3QRPA 1S1XB 4XH5A 1DTQB 2W01A 2VASA 3CCTA 1CG2A 5A8RA 2GVZA 4FJNA 1I94F 3R9LA 4OGEA 4LF4K 4JI1J 1BI4B 4IOBA 2RAQA 1MWMA 4IDKB 4PQUA 5C24A 2KKZA 4CEAA 4KBIA 5KFOA 3SSQA 1BQMB 4UOFA 3ZEUA 2FJEB 4B3TF 1HPZB 4PWDA 1QHAA 2I1RA 4DX7A 4L76A 4CVNE 5DQHA 1CXQA 4OHWA 1J5EJ 4O0JA 2CQIA 3JSMA 3KK1B 2CYYA 2RB7A 1IKYA 1HX1A 4C8LA 5C2GA 2FBXA 2HBMA 2C2RA 3C6UB 5D3GB 1BOTO 3TNVA 2QIFA 5DG9A 2D3O1 3VENA 4M63A 1OS5A 4CLSA 3CC7N 2GHPA 3M2VB 3HSGA 4DR6K 4JKHA 1JXEA 4NXNK 5GAGU 2XO7A 4FL9A 5KT6A 3Q83A 4WXOA 3D0PA 5J1NA 1QDUB 1HARA 2ZE2B 1RB0A 1RDWX 2W2OP 2WVDA 2B6AA 5AJ3K 3AD8C 4WU2A 3RB3A 5A8KB 4RUBA 2LDYA 2CUYA 5D0RA 3E01B 4FPAA 2X1FA 3FC9A 2WB4A 1H2VZ 1QVGM 1EX8A 5E5NA 3K8VA 1S9GA 4IEIA 2W24A 1WBBA 1RTIB 2GZOA 5HVFA 2UZAA 1GLJO 3ZSRA 1Q8IA 4K41A 3CSKA 5B0EA 4LF9K 2RRBA 4RW9B 1N32F 4DV6K 4FXWA 4KRWA 1JNZB 5H9FJ 5E3QA 4O3SA 4PKGA 1S72N 2UV8A 4J9PA 1GNKA 1J2VA 2NREA 1RDUA 1ZZNA 2DR6A 3C16A 3TJAA 3DLKB 1A5VA 1TELA 4JV5F 3OYHA 1RCXB 3NDKA 3NXZA 5KFGA 4LFAK 4RUAA 3TZZA 4DSFA 2R7UA 2CG8A 2FVSA 3ET6B 4NA2A 2FTRA 1XI1A 3D2FB 3QEIA 2XCPA 1JXBA 2WW4A 5E3CA 1XNQK 1P9YA 4JNEA 1WOPA 4DV0K 3M8RA 2FZKB 4X4QA 1NZ8A 1IJEB 2I9SA 5AZIA 1NU0A 5MLCV 3EY1A 3H1QA 4C3KA 2RF2A 5THWA 1RKIA 2XY8A 2QLFB 2VD3A 1EZZB 3Q8QB 2UUAK 5JJBA 3JSRA 2CJXB 2X1AA 2Q1LA 4KHRA 2P9IA 5K8OA 2KQ2A 3TSUA 2J0QD 3RJMB 1VQNS 2K06A 4BE2A 4KO0B 2LVWA 2HHXA 3QPIA 3M6UA 4OX6A 4LRCA 3JYTB 1ZBIA 5C42B 3QFPA 2HQGA 2MSTA 3QT6A 3DLGA 4DU7A 4LMZA 4I68A 4BR9A 2P2CB 1KONA 2V68A 3UE2A 4CIOA 3AJ2A 4ZCIA 3DRRB 2Q66A 1U0SA 2YNFA 1N52B 3JXUA 2FC0A 1VSHA 4A59A 4CJEA 3MXMA 2FY1A 1B70B 4X65F 4A62A 3MEDB 1X4AA 4XK8C 2EBEA 4CLLA 1NGCA 3VZHA 2IDLA 1H3DA 3FBCA 5EX3A 3M2RA 5KFUA 3FZFA 3TJ9A 2GQQA 4KI6A 4RW7A 4GV6A 5HQLA 4OPKA 1FJGJ 2LXFA 2PT0A 3LA0A 3QGPA 4JYAK 5LJ5Y 3BYRA 3AO5A 2MKSA 1RJJA 3FZBA 4ZKAA 4RNMA 3LP1B 4P2SA 1D1UA 5KG3A 2ZHOA 3AXMA 1VQ8S 3IO1A 4CIGA 4MLEA 3H40A 2Y1JA 5JS1A 3EKUA 2IA0A 3U8XA 1PG5B 2LQ9A 3WXJA 4DTNA 5CZ1A 2W25A 4M3ZA 4CBXA 1X0FA 3SCXA