1RT6A

Hiv-1 reverse transcriptase complexed with uc38
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
539
structure length
538
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 148
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt6A05
4FLWA 2VA2A 3D0PA 2Y1IA 4CF0A 3CJ5A 1D9FA 1JKHA 3NGIA 1BGXT 3SPYA 3K5NA 4B9VA 3TI0A 4U6PA 4DSKA 3TAPA 2F8EX 4RZRA 1RT6B 4MQ3A 4I7FB 3TVKA 4ZVFA 3NF7A 4ED7A 3V1RA 1A5XA 4ECYA 1SKSA 5HRSA 4DL2A 3IGVA 4LSNA 2BQ3A 3DM2A 1O1WA 2I1RA 4NCAA 4N41A 1I39A 4DSJA 3MEGB 1B92A 4URGA 3V1QA 1JLBA 3VQ6A 4ED3A 2OPQA 2OPSA 1RBSA 3KKRA 3N6LA 4F8RA 1D1UA 4ZP8A 1N56A 5KFZA 1XI1A 3K2PA 4MK9A 3ZCMA 2BE2B 1ZBFA 3AVHA 3KK2A 1FKOB 3FFIB 1HNIA 3MEDA 3QESA 4R0EA 3K5LA 4M3ZA 2FVCA 2HHWA 3ISNC 3NFAA 2VWJA 3KLEB 3M9NB 2VG5B 1FK9A 3CDEA 3CJ0A 3ZT3A 4CEBA 3RTVA 1TL1A 1X1PA 2W9BA 4L8RB 1U49A 1EX4A 4I2QB 3H2LA 3RAXA 4EP4A 3CO9A 5EDWA 4KHSA 2C2RA 2PYLA 4FXDA 4O3QA 5L9XA 2R2RA 1U4BA 3CM6A 3AO3A 5JXSA 2UVRA 4YR2A 3ASMA 4E7JA 5F9LA 2XI3A 4PWDA 2KTQA 4CERA 3VN5A 3NH2A 3K5OA 3M8SA 4ZTJA 4FZXC 3IG1B 4BDPA 5DLFA 4FJ5A 4GC6A 1C0UA 5CZ2A 3P1GA 4R8UB 4IFYB 3M9OB 2YHAA 4DG1A 1RBTA 4LH5A 5KG2A 4CFBA 4CGGA 1K1SA 3T5KA 4IBNA 1RBRA 3M8QB 3H98A 5KG1A 4YMEA 3OL8A 4KHRA 3OHBA 5KFJA 2GC8A 5J1EB 4IRCA 4W5TA 5CYMB 2RDJA 1WNEA 2GV9A 3OL9A 4QOZB 1C6VA 4BDYA 4J2DA 1FXXA 2XWYA 3Q8SB 1ZETA 4NLWA 1TKTB 1KFDA 4EP5A 2D3ZA 2XGPA 1UAXA 3LPUA 4AHTA 4OVLA 4F4WA 1BQNA 3TQ1A 1C1AA 3VA3A 1ZTWA 2O4IA 1IKWA 3KLGB 1XHXA 1TK0A 1S1VB 4HUGA 3ISND 1RTJB 2G8FA 5KFXA 3SV3A 4Y1CA 4QCLA 3KMSA 4DL3A 4E7HA 5HRRA 2AWZA 2D7SA 1RT1B 4MIBA 1RTDA 5KG7A 3QIOA 2IOCA 2QKKA 1LAWA 1REVB 4E7IA 1RDRA 4E89A 3HPOA 1B9DA 3ZT2A 1NKBA 1T8EA 1JLBB 4KHYA 3OYKA 2YNHA 2OPSB 3NH1A 4C8KA 2D3UA 4NYFA 1S9FA 3PY8A 4ELVA 2XY8A 2HVHA 1BCOA 3PJXA 2XI2A 3KD5E 2RF2A 1HNVA 4DLEA 1HNIB 1SL0A 1TQLA 4ZVEA 3LWLA 4HUEA 2R2SA 1IKXB 1SH2A 4DL6A 3K59A 1VSKA 3O3FA 2DFHA 3RB6A 1FK9B 5L1KA 2AU0A 3LPTA 4K4TA 2F96A 4FK0A 4WE1A 5F9NA 3ZT0A 3AVKA 3KLFA 3DRPA 3PW5A 4ECXA 4ICLA 4FJJA 1IM4A 4ZPBA 3GIMA 5KGWA 1RT3B 5DG8A 4J9KA 1C0TA 5K14A 1ZYQA 1Z25A 3ZSXA 1VRUB 1QTMA 4O4GA 4DEZA 2FBYA 4IH7A 3DLEB 3BGRA 2F8TA 1R0AB 1TV6A 4PQUA 3DRRA 4KV8A 5C5JA 2OPPB 3H5YA 4Q8EA 4DG1B 3QGHA 3QEWA 1RBUA 3HSTB 4WXWA 1RYRA 4QAGA 1L3TA 4CIGA 4CF1A 2IA6A 1RYSA 5KG5A 4HUFA 2HMIB 1QAIA 4TY9A 2HVIA 1FKPA 3SV4A 1SH0A 3H59A 1S0MA 1GX6A 1K1QA 2ALZA 1S1WB 3HHKA 3I0RA 4KB0A 4J9RA 4CFDA 3AVMA 1TAUA 4F50A 3SUOA 5KFIA 1YVFA 2NUBA 3OVNA 1BQNB 4QW8A 3E01B 3M8PA 3TAMA 4DTNA 4NZ0A 2UUWA 1Q9YA 3OL7A 5C25A 5F8LA 1CXQA 2WOMA 3TAFA 1D0EA 4FCYA 3SQ0A 3OLAA 4M94A 4OGCA 2QK9A 4E1NA 1SUQB 4EZ9A 4KAZA 3HYFA 4CGIA 1LWFB 4W5NA 3K57A 3MR3A 2DTUA 3VQ5A 3QNNA 3NAIA 5KFQA 4IG0A 4IKAA 1W25A 2Z1GA 4ZPDA 3CQ8A 3QERA 2D0CA 4DTPA 2JC1A 2C2DA 1S9GA 4NCGA 5L1IA 1KLMA 4CHOA 2JEGA 3QZ7A 4J9OA 3FDSA 1RTHA 1MMLA 2EX3A 4RW6B 1N6QA 1S97A 4WFYA 4MIAA 1S1TB 3SQ2A 2P51A 1X9MA 5KRSA 3QLHA 3HVWA 2JEJA 4MH8A 4CEZA 2W9CA 4WE1B 3I0SA 2IGIA 3TANA 3TWHA 4TYBA 4Y2CA 4E7LA 1NJZA 4GW6A 2B5JA 1JLQA 2ASDA 5EWFA 2ASLA 4NYNA 4DMNA 2ZQBA 1LWCA 4FM2A 1TP7A 3GIIA 3VQSA 2BANB 3AVLA 3BSOA 1C0TB 5K14B 4O5BA 4ELTA 4ZVHA 3QO9A 3KK1B 3LP0A 4OPJA 4FM1A 4NLSA 3BGRB 1TV6B 3DRRB 5FDLA 1TKDA 3HP6A 2FBTA 3NAEA 2VG6A 3ZSVA 1U47A 4YR0A 4O44A 5KFRA 2RN2A 2XC9A 4Q8FA 2BRKA 2Z1IA 1NOZA 4DU4A 2FVPA 2D41A 4B9NA 5DGBA 4EYIB 2O5DA 4J9LA 4DSEA 3BJYA 4J9NA 4RW7A 3OYGA 4TQRA 2W8KA 4NCBA 2Z1JA 2ZKUA 5KT6A 4E3SA 4FJIA 2KZZA 4BE0A 4DSLA 1GOBA 1QSLA 3RMDA 1BL3A 2LSNA 5L1JA 3JSMB 1C1CB 1WSGA 4G3IA 4R5PA 1ASWA 5JS2A 3DYAA 4OPKA 1S48A 3PW4A 4CHYA 4O3RA 1S6QB 1S6PA 3M8PB 5DQGA 1JLCB 4B9TA 3ZT4A 3RB3A 4H4OB 1JLGA 5C25B 4N47A 3ICLA 1Z26A 1Y97A 5CY4A 1QS4A 3OS0A 2G8WA 2AJQA 3VQ9A 4YR3A 1RT2A 3DMJA 5KFVA 3GQCA 1DLOA 4FZZA 5DMRA 3KLHA 1RT5A 5J2NA 3I5BA 4QWEA 4IFVA 4ZPCA 4BACA 4DFKA 1D8YA 4M3YA 3OS2A 4LSLA 4KRFA 3UDLA 4ECUA 1TGOA 3NBPA 4ZP6A 4FLVA 5D3GA 3ZSOA 1SH3A 1GOAA 1VSMA 3E51A 4OGEA 1HQUA 1LWEB 4XO0A 2AGQA 1ZBUA 1J5OB 3RB4A 1WSEA 5KT5A 4CIFA 4DLGA 4J2BA 3OYNA 3OYJA 3F9KA 4BWJA 3DRSB 3VQEA 1RTHB 1N6QB 1HYZA 2FJWA 2WONA 4AHCA 3AA5X 3QIPA 2AGPA 3ZSYA 3VQQA 3NL0A 3QLHB 1KHWA 2HNZB 2W9CB 4ID1A 1DTQA 4KB1A 5KFAA 4KSEB 2X78A 4Y34A 4PUOA 1JLQB 1CSJA 1S9EB 2IDOA 4CJRA 4CEAA 4Y2AA 4FJGA 5J2QB 1Z4UA 3PX6A 2DPIA 3QO9B 1VRTA 1WAFA 3HK2A 4FK4A 3VQCA 3L2RA 4M42A 1EETB 4IR9A 3WNHA 5HRNA 1BQMB 5FDLB 3LANA 5HBMB 1RDAA 3L3UA 1QHTA 3V4IA 4NLYA 3DLRA 4K4YA 3PHEA 3OS1A 4B8CA 1HQEB 3MR2A 2XY5A 3ZT1A 4RUCA 4RW7B 4CF9A 2VG7A 1T03A 4MKAA 3KHGA 3PO4A 1HRHA 3TR8A 2I5JB 1C1BB 4I9QA 4OLBA 3GIKA 4EZ6A 4TQSA 2YKMA 3UR0A 4CEEA 3RRGA 4R5PB 4CHZA 3LDSA 5L1LA 3DYAB 1S5JA 3OYEA 2IC3A 5CZ1A 3IRXA 3AA3A 1NK7A 2OPRA 3C6TA 4JV0A 4Q0BB 2W9AA 1JLGB 5KFBA 1U04A 2PZSA 3QGIA 3VQPA 1QE1A 3DOKA 5HP1A 4JS4A 1RTIA 4B9UA 3MFHA 1LAVA 2FBXA 4CK1A 3KLHB 4N76A 2HHVA 3TAGA 4HVJA 3ULDA 1UOCA 2O4GA 4FW1A 2DFFA 1KSPA 4DFJA 4AILC 5D3GB 1QAJA 3L2VA 4CGJA 3Q8QB 1RAJA 2C2EA 2XY6A 1KFSA 3L2UA 2YNGB 1BIZA 5F8GA 4F4ZA 4ED0A 3C6UB 3G86A 3MF5A 4H54A 3WNFA 3FQKA 4CGFA 1XC9A 3EYZA 5KT7A 2FJXA 3PV8A 4TYAA 1N4LA 4FLXA 4DQRA 3QIPB 1GOCA 1L3SA 1CLQA 4B3OA 4HHTA 4ID5A 4JRQA 2FVSA 3H4DA 5KT3A 4X2BA 3KKSA 1L3UA 3K58A 4PUOB 4DF8A 3ITHA 4TN2A 1U48A 1HYSA 1JLAB 2ATQA 1TK8A 3BREA 4JV2A 4FJXA 2V0NA 3DOLA 3NF8A 4O3NA 3ZSWA 1JLFB 3B6OA 5KT2A 4F3TA 4WFZA 3MECA 4O3OA 3LP2A 3EZUA 4FLUA 2IM1A 4DWIA 1NHUA 2OH2A 2FLLA 3V4IB 1JKHB 3HP9A 2BDPA 1QQCA 4AHRA 4KI4A 3TARA 4K4SA 4ZMMA 4DTOA 2EC0A 4O4RA 2R8JA 1JLEA 4IDKA 1XR5A 4IRKA 2HNDA 4FZYA 3QZ8A 3DLGA 2VG7B 4O0IA 3GV5B 5KFMA 1KVCA 4MK8A 4K4XA 3MR6A 2YHBA 3OJUA 5C42A 4URQU 1D5AA 4LSNB 3DM2B 4HTUA 2ILZA 2B4JA 3U3YA 3OL6A 3NGYA 2FC0A 1G15A 2OPQB 3IRXB 3PX0A 2C22A 1W0HA 2OPRB 3C6TB 3HVAA 3THVA 4TXSA 4TY8A 2HAIA 4DS5A 1QE1B 3BSAA 2GIRA 2E9TA 2KQ2A 3RR7A 4FJ7A 4PY5A 4KFBA 5HP1B 3OYHA 5KFLA 3EPGA 1N5YA 1IKVA 3KK2B 3KNAA 2R7YA 2Z1HA 5KFCA 3MEDB 1RTIB 4QWCA 4B9SA 1IH7A 1RDBA 2B6AA 4M95A 2FBVA 4M41A 4WYWA 5SZTA 1VK0A 4CJ4A 3S9HA 4FS1A 1TL1B 4JRPA 2W9BB 3NGDA 2RDIA 3NDKA 2RPIA 4ELUA 1DTTA 4RNHA 4IKFA 4FBUA 1JL2A 5KFEA 3KHHA 4K4UA 1VSEA 1NOYA 3DLHA 1A5VA 1HPZA 1HYVA 4PWDB 4Q43A 2G8VA 4J2EA 5I3UA 5KFYA 2DY4A 4EEYA 1SKWA 1L5UA 4CCHA 4BWMA 3Q8PB 1X9WA 1C0UB 4ID5B 1SV5A 3V6KA 4Q5VA 1TKZA 3G6XA 2XRIA 3H40A 2G8KA 3ITHB 4Z4CA 1ASUA 4OKJA 1L3VA 4DU3A 3SQ4A 3MXJA 4WZQA 5DG9A 3HXMA 4O55A 5KG4A 1RT7A 3N6NA 3RMCA 3MECB 2AGOA 4Q45A 3LP2B 4NLUA 2E6LA 3KTQA 4G1QA 4CEQA 3QETA 4I9LA 1IG9A 3GYNA 3CWJA 3IS9A 2E9ZA 1W9HA 4YFUA 2YNFA 5J2MA 1IKWB 3CM5A 2IAJA 4XIUA 3LAKA 4IDKB 4DTMA 3CDWA 2JGUA 4EO6A 1J54A 4CF2A 3OYFA 3HT3A 2QKBA 1EP4A 3O4NA 3KIOA 4RW8A 4WXOA 1S0NA 4J9PA 5KFKA 5EU7A 1B9FA 4NLVA 5C42B 2P5GA 4M3XA 3I5CA 1RTDB 3AO4A 4QWAA 3PZPA 2R8KA 4ECQA 5I42A 2ZE2A 3M9MB 2IMWP 1RT4A 5EWEA 4W5QA 3V6DA 3RAQA 1IO2A 2BR0A 1K6YA 4DQQA 3FSIA 5KTQA 3GV7B 3F73A 1YVUA 4ECWA 2YNHB 5HROA 4NRUA 2A1SA 2BQUA 3L3VA 2E6MA 4TY8B 4K4WA 3AA2A 4XPCA 2Q3SA 4CJKA 4C8NA 3QNOA 5SWMA 1BCMA 2RF2B 1HNVB 3MXIA 3AVJA 2IM0A 4RNOA 2D0BA 2B6AB 2X74A 4FJKA 3VA0A 5J2PA 2YKNA 2QE5A 3PW2A 3BQ0A 1CZ9A 3KLFB 3DRPB 3C94A 1RILA 4ICLB 2ITGA 5F8NA 2B43A 3FQLA 1BI4A 3HKWA 3AVFA 4DL5A 4RU9A 1T3NA 3KLIA 4MK7A 1WSFA 4CFAA 5I3UB 1TL3A 4KB7A 4O4GB 1J53A 3S3OA 3T1AA 4LQ3A 4KKOA 4FJHA 4PQUB 4EBCA 2X6SA 4CEOA 1KTQA 4FM0A 4KV8B 3JYTA 3SUNA 1T94A 3OYBA 3S3NA 3CJ4A 4IOBA 5KFSA 3V9WA 1MU2A 5KRTA 4K4VA 4AHSA 5C24A 4B08A 3IN5A 1UWBA 2CJQA 1TK5A 4CJQA 3SZ2A 2WK4A 1NNDA 4CJSA 3OYAA 1FKPB 1EKEA 4FVMA 4RNNA 4DFMA 4C8LA 2OA8A 4G1QB 3HO1A 2HHSA 5DG7A 4F2SA 3IS9B 3I0RB 2IJNA 2WRMA 4CHPA 4E19A 4DQPA 4HCBA 5KFPA 4KO0A 4I7FA 1WLJA 5KI6A 5J2MB 3SFUA 3I8DA 1RDCA 1S1XA 5DQHA 1S49A 2IM3A 3TAMB 3AVAA 1JX4A 1VSLA 2KFNA 1RDDA 3MTKA 3Q8RB 2OZSA 4F3OA 4ED1A 2WOMB 1EP4B 4O3PA 3CFOA 4NLGA 3DLBA 3SFGA 2Y1JA 3A2FA 3VQ4A 2ZE2B 1C2PA 4FS2A 2JEFA 4JV1A 3V6DB 3O3GA 2WHOA 3D28A 2JEIA 4IR1A 4I2PA 4IG0B 3SUPA 3V9SA 2BE2A 3N6MA 3FFIA 5KFGA 2WB4A 2HHUA 3PR4A 4KTZA 4HCCA 4DS4A 1LW0A 1S9GB 4NCGB 1KLMB 3ZSRA 4I2QA 1ITGA 5T14A 3OYLA 3QGGA 2BQRA 3NCIA 3K5MA 3V9UA 2R8IA 3HPGA 3CG7A 1RA6A 5J2PB 2HNYA 2YKNB 1S10A 4CJ3A 4DTJA 3I0SB 5KFTA 4Z4HA 3G0ZA 2B5JB 3V9ZA 3M8RA 3GILA 4KBIA 5KFWA 1LWCB 1BI4B 4NRTA 2VA3A 2HHQA 3IG1A 1KRPA 1VSIA 4R8UA 4IFYA 3LP0B 3IAYA 4KKOB 3I5AA 2KW4A 3V9XA 3JYTB 2VG6B 1RBVA 4KTWA 3CIZA 4O44B 3LP3A 1KVAA 4NYZA 3SJJA 4RUAA 1HJRA 2IJFA 2E4LA 1MU2B 4DQIA 4CFCA 5J1EA 4NLXA 1U09A 3AO5A 4DFPA 5KFOA 3HJFA 3PW7A 4UQGA 3RRHA 1S1UA 2ATLA 4CK3A 1TKTA 2JC0A 1I3AA 1HMVA 4KPYA 3G6YA 4B8AB 4ECRA 5KFHA 3KLGA 2KZMA 1S1VA 4KO0B 4FK2A 3CJ3A 1RTJA 1SL1A 3VQ7A 3LWMA 3RBDA 4FBTA 2HB5A 1S1XB 4CHQA 1S6PB 1T7PA 4ECTA 3MXMA 1RT1A 1LV5A 1XHZA 3MAQA 4CGHA 5KG0A 1REVA 3CFPA 2PY5A 2V4RA 1RT2B 1ZBHA 3DMJB 3H5XA 1Q8IA 1DLOB 3DI6A 4CESA 3AA4A 2P5OA 4B9MA 1RT5B 5J2NB 1SKRA 4IFVB 3HM9A 2UVUA 4OKKA 4FW2A 1NKCA 4I2PB 4LSLB 2J6SA 3QEIA 2XO7A 3NBPB 1GX5A 2VWKA 3P83D 5T7BA 4YNQA 3V6HA 1HQUB 1IKXA 1HARA 3L2WA 2HWIA 3P5JA 4J2AA 1LW0B 4CJWA 4C8OA 1Q9XA 3BQ1A 1QSYA 4ED2A 3RMBA 2D5RA 3D5MA 5DQIA 4GVMA 2WONB 1NK6A 4BE1A 2F8SA 4HYKA 2HNYB 3RBEA 4DU1A 2E9RX 4YP3A 1DTQB 1ZBLA 1RT3A 4CE9A 5DGAA 1TVRA 5FRNA 1QUVA 1CZBA 3NGZA 1VRUA 3KMQA 4DSFA 3DLEA 2EHGA 5KT4A 2OZMA 1R0AA 1RCHA 4NLTA 3KD1E 1ZTTA 3EY1A 2OPPA 3TAEA 4Z4GA 1VRTB 4K50A 3MR5A 4NLRA 2J6UA 4OLAA 4KTQA 3BSCA 1BIUA 4CGDA 2P1JA 3RB0A 2X6NA 1D9DA 2RKIA 1VSFA 3QINA 2HWHA 3V81A 2D0AA 1ASVA 4TLRA 3LALA 1N48A 4KAIA 3OSPA 4ZHRA 4OL8A 4ZPAA 3NAHA 4MKBA 1UA1A 2HMIA 3V6JA 4CHNA 4RW9A 3KK3A 1JXEA 4M3UA 2W8LA 4CJTA 3PW0A 4CJFA 2FVRA 3CVKA 3HL8A 2FJVA 1YTAA 3RWUA 3SI8A 4RG8A 4QW9A 1S1WA 4C8MA 1S1UB 2ZD1A 1T03B 3H4BA 2V4QA 1HMVB 1NK5A 3LP1A 2WTFA 1WN7A 1UA0A 5KGXA 2YKMB 3PX4A 3E01A 4IH6A 4ZVGA 4ED8A 3UIQA 4JLHA 3VQBA 2IC3B 1TKXA 4DTSA 2A1RA 5KFFA 3SNNA 1RNHA 3MEEA 4K4ZA 4Y3CA 3VQAA 1SUQA 1VSHA 1IKYA 3OYCA 4ZP7A 3DOKB 3BSNA 1LWFA 4CEDA 4YQWA 2HHXA 3WNEA 3DI6B 5F8IA 4K8XA 2G8UA 3FRZA 2ETJA 3SPZA 1WSHA 3QEPA 4J9QA 2UUTA 4OKEA 2IM2A 4J9MA 4F4YA 1NJXA 1OS5A 2R8HA 2YNIA 1CXUA 3VQDA 3QYYA 1KLNA 3NE6A 3AVCA 4KREA 4RW6A 3AVBA 1S1TA 1T05A 1NKEA 5HLFA 3OYMA 3RR8A 5CYQA 3KHRA 4Z4IA 4EBEA 4IG3A 2DFEA 3TABA 3H5SA 2V9WA 3UPFA 2AX1A 2FLPA 3OYDA 3OHAA 1S0OA 4ZP9A 4B3OB 1TAQA 2BANA 3SQ1A 4M45A 4CK2A 2XY7A 2XCAA 1TVRB 3KK1A 1RA7A 4JUZA 4E0DA 1HYSB 4EYHB 3HVTA 5F8HA 3DOLB 4NLOA 3CYMA 3QEVA 2QXFA 4NLQA 3T5LA 1C0MA 2AX0A 3SCXA 3G6VA 2OYQA 2RKIB 1QSSA 3NF6A 4U7CA 3V81B 3C95A 2ASJA 5EWGA 4ZHRB 3QEXA 4W5OA 4DTXA 3DLKA 1NJWA 3OY9A 4CF8A 1SL2A 5E41A 4CJVA 1BHLA 4RW9B 3H08A 3KK3B 3AV9A 4W5RA 5F8JA 1JLEB 3GIJA 1VSJA 1ZBIA 2HNDB 3JSMA 5FROA 1C1CA 1JIHA 3DLGB 2ZD1B 4CJUA 3BDPA 3D45A 3AVGA 3LP1B 4XPEA 3T3FA 3U3GA 4URSA 2R2UA 4LD0A 1S6QA 3L8BA 1JLCA 4RNMA 4CJPA 4H4OA 3B6PA 4KHMA 1NK9A 3OSNA 4DQSA 1TKXB 4KI6A 4QWBA 2PYJA 3S3MA 2G8IA 2R2TA 2IBKA 3O4QA 3MEEB 4DL4A 4CJEA 1JXBA 3AO1A 4LH4A 4O0JA 4E7KA 4QWDA 1IKYB 3HPHA 3ZSQA 4ZTFA 1WSJA 4KFBB 2R8GA 3OYIA 1N5YB 1IKVB 4IQXA 4FLZA 4QPXA 5KG6A 4F4XA 2AQ4A 4EO8A 3KJVA 3ZSZA 4ED6A 2BRLA 3T5HA 4FJNA 3V1OA 1LWEA 1DTTB 3DDKA 5DK5A 1NK4A 3LZIA 1J5OA 2IS3A 2YNIB 2BGGA 4KE5A 4CJLA 2KFZA 2JLEA 3DRSA 4N56A 1T05B 3NF9A 5HLFB 1HPZB 3OJSA 5CYQB 3PJWA 4H4MA 3ALYA 1I6JA 3SUQA 1NK8A 2HNZA 2GBZA 1KHVA 4IG3B 1NJYA 3KLVA 3H5UA 4IH5A 4DF4A 3BQ2A 4MFBA 1S9EA 1SV5B 1YT3A 5J2QA 1TKZB 4KHWA 3AVIA 3NHGA 4BE2A 5DLGA 3KHLA 4PA1A 1LW2A 1BISA 3U6FA 4RW4A 3EZ5A 1A5WA 1JXLA 1EETA 3HVTB 4FJMA 4EBDA 1BQMA 3VQ8A 2WCXA 2UVVA 5HBMA 1RT7B 3CFRA 5KFNA 3BR9A 1KVBA 2FVQA 4WFXA 3HVRA 4FLYA 1XR6A 4DL7A 2HW3A 1X9SA 3LAMA 3T5JA 3O3HA 4M3RA 3SYZA 1U45A 3PVXA 1HQEA 4DTRA 1RT6A 4J9SA 4CJ5A 4FJLA 3DLKB 3RMAA 3WNGA 4AHVA 4HKQA 4GC7A 2J6TA 1NHVA 2YNFB 2W7OA 4K8ZA 5FRMA 4F2RA 3PR5B 4DSIA 5HRPA 2IAJB 2XHBA 4N5SA 4KHNA 2I5JA 4CEFA 4GMJB 3OLBA 1C1BA 3CJ2A 4OJRA 1WNSA 3MEGA 4RW8B 4AHUA 1JL1A 4BDZA 1XWLA 3AO2A 3IGNA 3LZJA 4Q44A 4FJ9A 3EPIA 5I42B 3TAQA 1F21A 4TSXA 1RT4B 4WZMA 4B9LA 4KHUA 4Q0BA 3T19A 2QV6A 2DPJA 3KOAA 2XCPA 3UQSA 2CKWA 2YV0X 5HROB 4Z4FA 1FKOA 3AVNA 4FYDA 4NLDA 5KFDA 3NKYA 4Y1DA 2GIQA 1WAJA 4FLTA 3KLEA 2VG5A 1XR7A 5JUMA 4KHQA 1KCFA 4F4KA 4IRDA 4JS5A 5JS1A 3KJVB 3NMAA 4ECVA 5KFUA 4M3TA 2UVWA 3GV8B 4WYLA 4O3SA 1WSIA 4RNFA 1S4FA 3NH0A 1EXQA 2G8HA 2YNGA 4LQ9A 4Z0UA 4AH9A 4Z4EA 3PO5A 3G10A 3C6UA 2XGQA 3QIDA 3CDUA 5KG3A 5EUHA 4LY7A 2W42A 3KLIB 4H4MB 4ECZA 1TL3B 4E1MA 2ILYA 2W7PA 1NK0A 3PUFA 1J9AA 4DTUA 3L2QA 1JLAA 1VSDA 2GUIA 2FLNA 4MFBB 4NLPA 4CECA 3M8QA 2HHTA 1YTUA 1JLFA 1LW2B 4RW4B 5F8MA 4M3WA 2C28A 3SI6A 5CYMA 4FJ8A 4ECSA 5C24B 4H8KA 3MFIA 4CIEA 1UWBB
chains in the Genus database with same CATH superfamily
4FLWA 4OYIA 2XYHB 2O8CA 4NA2A 2XYPB 2RD5C 3CCTA 2O67A 1CC8A 2NSBA 2F8EX 1JB0C 3R1XA 4IYQA 5BPLA 1S6UA 3J80U 4WFAL 1Y3JA 1HBMB 2UV8G 4ZVFA 2CDRB 3J7AN 4JK7A 2V9KA 4F4AA 2A1BA 3WIVA 4EHUA 3SBGA 2JRSA 3R97A 3IGVA 4LSNA 3L6QA 4YDDB 3ZX2A 3K5PA 4NCAA 4NA1A 4N41A 4QU6A 1GQEA 1WELA 2O8BB 3BKUA 3WXLA 1FJGF 2PA3A 4USTA 4XAKA 1CBKA 2JSXA 1IVZA 4DMZA 1IBCB 4F8RA 5EX5A 5TKYA 3CJAA 2BE2B 2QWOA 5AZJB 2GHWA 4RJVA 2RU3A 4R0EA 5MAOA 1MROA 2FVCA 3NFAA 2VWJA 3KLEB 1FK9A 3RTVA 1U49A 1IBKJ 4EP4A 2PYLA 2OFHX 4FXDA 2IA0A 5LMNF 1XIQA 1N8RT 3M1VA 4PWWA 1JCEA 2UVRA 4E7JA 4M5JA 4ZN1A 4WK1A 4HDGA 1XNQK 5HVHA 3NH2A 3HLUA 4JAXA 3J7AP 1T9XA 2LQBA 7FD1A 4FJ5A 2KXNB 3P1GA 5GAGP 4IFYB 3AXKA 3M9OB 4DG1A 2VZ9A 3LPYA 5KG2A 4CFBA 1K1SA 1VQ6S 3MM5A 4JK8A 2PE8A 4LFCJ 3VF2A 2ATCB 3VALA 1RBRA 2M70A 2FSNA 4I69A 4ZPTR 2KVIA 3OL8A 1X3MA 3QSYB 4F0MA 3OL9A 3AOAA 4P10A 1C6VA 2NXUA 3Q8SB 1ZETA 4DR6K 4OJHA 1HHTP 1TKTB 4AXJA 1IR0A 1KFDA 2D3ZA 2XGPA 1UAXA 4EP5A 4I56A 3SDEA 4LBIA 1P1LA 4RUBA 2DHHA 4H0YB 1XHXA 1S1VB 1VHIA 4CZLA 3E9LA 4A48A 1EHWA 2G8FA 1H98A 5KFXA 2XBPA 2VH7A 4DL3A 2OD6A 2D7SA 4MIBA 1FDAA 3EE3A 2RILA 3BGLA 1RTDA 5KG7A 3ID6A 1DEJA 2IOCA 4O5FA 2L9WA 3E66A 1LAWA 3BUZB 3VEZA 2NREA 1RUSA 4E7IA 1B99A 1NKBA 1G6BA 4ERDA 4JKHA 3OYKA 2YNHA 4Z37A 3PY8A 3CC4S 4OYBA 3PJXA 5AQSA 2CQ1A 2ASPA 2RF2A 3GCWP 3VERA 1IKXB 2OSQA 4JHDB 1MROB 3K59A 4F7VA 4GKKK 1FK9B 3GJQB 2HHHJ 5D4PA 2F96A 4M5NA 4FK0A 5F9NA 2BV3A 3AVKA 2DHSA 2FGCA 1GH8A 3PW5A 3K0JA 2F4VJ 4CZCA 4ICLA 4ZPBA 3H25A 2CJKA 3GIMA 3P96A 4OHYA 2ALYB 4J9KA 4KH5A 3ONQA 4O4GA 4B1XB 5C5JA 2I7PA 3W9IA 1FXLA 4JI6K 1BLUA 1JK9B 3WQPA 4DG1B 2GX9A 3HSZA 4Q7AA 3JAMO 3QEWA 1FNMA 1NHKL 2DR6A 3MM5B 3AY9A 4DX8H 1OPZA 4Y00A 1GXLA 1TELA 4I6MA 5BJRA 4LF6K 3AB4B 5D4NA 1O6XA 4F0KA 2HHPA 1BWFO 2DNPA 4CF1A 3D6TB 2QN6B 1H7XA 3BS9A 3V5RA 3NGUA 3PYGA 5L38A 4B3RF 1WKJA 1SH0A 2GV1A 3A8EA 2WBNA 1K1QA 5BYQA 1S1WB 2F7VA 4JI8K 4UOHA 3SSQA 4G9ZA 3I87A 4LRFA 1GK8A 1N34F 2NUBA 2MSTA 1XQSC 4CT9A 1JJHA 5EHHA 4OHVA 4BQLA 2K8GA 4NZ0A 4C97A 4P74A 2A18A 5D0HA 3OL7A 2NZ4A 4QR0A 1VGYA 3LGHA 3FCWA 5CD4A 2VOOA 3OLAA 2HGLA 1A9NB 3FMWA 1J27A 4E1NA 1SUQB 3HHDA 5EN1A 4QU7A 4CGIA 5EY4A 2GX8A 2HEKA 4W5NA 2GJ2A 1H74A 4LJMA 5F3TA 3R5AA 3MM6B 3MR3A 5D6GA 3VQ5A 2KLAA 1W25A 4DPOA 1AYEA 2P5VA 2D0CA 4P9SA 4PKDB 3G6ES 2PI5A 3VMFB 4DTPA 3IAM9 4MO4A 4OI0A 2QA1A 2BVZA 1VK3A 4HHHA 5AQQA 1KLMA 2JEGA 2R7UA 3OPKA 1S97A 2EX3A 4WF9Q 2ZHAA 2P51A 1X9MA 3M05A 4ENOA 1DGKN 3D9BA 4MH8A 4CEZA 4X4QA 3I0SA 2BYCA 4PPDA 3TWHA 3QATA 4ZS6A 1NJZA 1KP6A 5DM6Q 2V69A 3MAAB 4FM2A 3CCLN 2BANB 3IBCB 2FSKA 4A46A 3KK1B 2HBZB 4H4KC 4OPJA 1ZOTA 5C2FA 5FDLA 2V52B 5D4LA 3NAEA 3I55S 1OMSA 4O44A 3CERA 3OVAA 1S59A 4A8YA 4DU4A 1PAEX 2FVPA 2O5DA 4J9LA 4DV5K 4LFAK 4J9NA 4RW7A 2HQFA 2W8KA 4C3KA 1NSPA 2ZKUA 1UVKA 4YOWA 4BE0A 1NGDA 2CAJA 4M5MA 3U27A 2F5GA 1U26A 1UW4A 3DGVA 2ZH5A 1S48A 3PLAA 2W6LA 5DQGA 2KJWA 3SMSA 3ZT4A 3RB3A 4H4OB 4TU8A 1WUAA 3UCUP 5CY4A 1QS4A 1RT2A 3L4BC 5KFVA 1VC6A 2NLXA 1YRTA 4FZZA 2Z57B 3I5BA 1Z6RA 4IOAQ 1LCUA 5G4DA 1VJQA 5JMNA 3M5RA 4B3SJ 3Q8YA 3H3NO 1RHUB 3W8PA 4DUZF 4KRFA 1TGOA 3NBPA 4FLVA 5CCLA 4Y2MA 4LC9B 1NGIA 1HQUA 4XO0A 3WBZA 4MLHA 2C2ZB 1ZBUA 3RB4A 3P8BB 2XO6A 4J2BA 2JLFA 2PFFB 4XH4A 1VQON 1HYZA 1PIEA 4OHXA 3QIPA 2AGPA 3NG8A 3NL0A 2DGVA 4WKRA 2HNZB 1DTQA 4DR1J 5KFAA 1AZSB 2Q1NA 2GZOA 1S9EB 3MCNA 2IDOA 2JZ5A 4GKKF 1OYDA 4Y2AA 2BABA 2J7KA 1Z4UA 2CRLA 6FDRA 3KUEA 5EVZA 1YWXA 1VHFA 3T6BA 1S77D 1Q7LB 1EETB 2Z8QA 3EEQA 3KKFA 5EX3A 3BPDA 5HANA 2Q66A 5FDLB 3LANA 5HBMB 2DEJA 2QL5B 3V4IA 2NZTA 3PHEA 3HTVA 2QWRA 3BF3A 4CD1A 4B8CA 2HIQA 2XY5A 5AQUA 4CH7A 2VU5A 4RW7B 1NBEB 4JI6F 1FD2A 4QYZK 3MN6A 1IBLJ 2MJNA 1VBXA 4DV7K 4MKAA 2MDAA 2KU7A 1C1BB 4I9QA 2M8DB 4JKBA 4OLBA 4TQSA 3C19A 4CEEA 2KHDA 5L1LA 3MDFA 5FPMA 3NGKA 1S5JA 3OYEA 3OVSA 4F3QA 5ADXH 5CZ1A 1RAFB 1YJRA 3GPAA 2OPRA 3C6TA 4JV0A 2YJEA 1S5ZA 3GWCA 1Q5VA 4C2MA 1B64A 3U02A 1QE1A 3DOKA 1VQOS 2B9WA 2XZWA 4OJ1A 1HKBA 3HSCA 4BS2A 1RTIA 1DBDA 1LK7A 4B9UA 3W1YC 4CK1A 1N8RO 2HS4A 1HQ2A 2E7WA 2D0OA 1ZM3A 3C66A 2X7IA 3M30A 2EBGA 3WXMB 3ULDA 2NRHA 2QEXN 1ZH5A 2B51A 4DFJA 4E1JA 1QAJA 3BBFA 3L2VA 2Y1LB 3Q8QB 2BMBA 2C2EA 1X4BA 1DFDA 2XY6A 3MN7A 5F8GA 2OSRA 4ED0A 1XC9A 4H54A 3TSUA 3DXMA 3PV8A 1TUGB 4IZ9A 4ISGA 4DQRA 4RBTA 3QIPB 2C3MA 1CLQA 5D4OA 4B3OA 4PG4A 4HHTA 2FVSA 1RHMB 3G96A 3H4DA 5KT3A 2AYMA 2Y0SD 1L3UA 1N5SA 2QLWA 3K58A 3CCES 4DF8A 3ITHA 2FZGB 3UVJA 3BO2A 3A5NC 2CPIA 3CQYA 5DDPC 4JV2A 4PPZA 2V0NA 2CWKA 3DOLA 3K9JA 3ZSWA 1WEXA 2M0GB 2FLOA 5KT2A 3H46O 3CTRA 3LP2A 2WW8A 4J8FA 3LM2A 1NGGA 1PILA 2CQ3A 1MWKA 2E5LJ 1NHUA 1FD8A 4DR5J 4B3TJ 4YOVA 1RHRB 1Z1ZA 3V4IB 1JKHB 2BDPA 1I3OB 1U7LA 2HLUA 3J81O 1BOTO 3CJ7A 1BU6O 4AHRA 2NYHA 2G0IA 3FRYA 3VTHA 2BKOA 1C0GA 1OWXA 2ZH4A 3HBTA 1FFGB 4FZYA 2PFDA 4O0IA 4IEIA 1KVCA 4MK8A 1IBKK 2ZVSA 3MR6A 3R5GA 3OJUA 1PJ5A 4URQU 3DM2B 1XMQF 5DRKA 2B9EA 3U3YA 2ZNZA 2AZ1A 2KFYA 1YJNN 1CJTB 1XEZA 2C22A 1VQ8S 2P6SA 2IBOA 1SAZA 2OPRB 3C6TB 4OZJA 4WIIA 2P9NA 1F3VA 1QE1B 2Z58B 2KQ2A 4KFBA 1U25A 3OYHA 3UFCX 5GMEA 1N5YA 3KK2B 3MEDB 1RTIB 1IH7A 1VIXA 1YJVA 1NLVA 1RQ0A 4M95A 3M30B 4LFCK 1TL1B 3NDKA 2RPIA 4ELUA 3LDNA 4IKFA 1CJVB 2EBEA 3AOCA 2XMAA 3KHHA 5HJXA 3CCMN 3IP0A 1NOYA 3CDAA 2VGMA 3CO0P 4Y0FA 4GNIA 1HYVA 1BHNA 4DV6F 2G8VA 5I3UA 1KDNA 1FE0A 4EEYA 3W5YA 4KRWA 1S6OA 4CCHA 2MQLA 4N7TA 4BWMA 4QZVB 3JB9k 1UJ4A 1C0UB 2CIMA 4GRSA 2CQGA 5KAKA 4Q5VA 4IQMA 1VQ7N 2VF3A 1UFKA 2G8KA 3ITHB 4Z4CA 1KBRA 4OKJA 4J5OA 1RHJB 3HMJG 2MKIA 3HXMA 1N5VA 4O55A 5KG4A 1RT7A 1SS6A 3LP2B 4KPCA 5HMXA 3KTQA 4I4BA 4I9LA 1WI6A 3CWJA 3IS9A 2L9DA 1M5KC 3CD6S 1HJOA 2VFVA 2LMIA 2E9ZA 1IR2A 3NOGA 5J2MA 3IM9A 3SQGA 3DDNA 3W60A 1VQYA 3JQJA 4M8LA 3O5BA 3LAKA 1XERA 5L9NA 5A6PA 1WF0A 2HHHK 1EP4A 4RW8A 4OIXA 4J9PA 3MUMP 4JI5J 1Q5YA 4ZN3A 3W65A 1RT4A 1NPKA 2F4VK 1GXUA 3V6DA 2HVZA 3W66A 2BR0A 2CPEA 2VODA 4OX9F 1YVUA 4ECWA 2A1SA 5AQKA 2E6MA 1GLAG 2P9NB 4XPCA 2MKSA 3VAKA 4CJKA 4C1NK 3QNOA 1T44A 4LR7A 1HNVB 3VQTA 2IM0A 2ZHBA 2X74A 1U1MA 3VA0A 4X62F 3QMLA 5MLCV 2YKNA 3PACA 3NCQA 3BQ0A 5M1KA 3PIPL 3V2UC 1RILA 4BCAA 2RE2A 4A4JA 3AVFA 3DOMA 5I3UB 3AOBA 2H1YA 5A6WA 2V6AA 3HJVA 3CJCA 4KKOA 3T1YJ 3F41A 3MCAB 4PQUB 1TTHB 4EBCA 2X6SA 1OH5A 1R0CB 1BE4A 1VR6A 3W2VB 4KV8B 2GHVC 3NMRA 3L4IA 1SVDA 2V94A 3OYBA 2XYGB 5KFSA 4PHTX 3V9WA 3VPZA 3BP8A 2JOQA 1QDUB 1UWBA 2CJQA 1VCTA 4CJQA 1Y3KA 2HIYA 1WBBA 2AA4A 2OCEA 1KONA 3R3LA 3CJ1A 3FUYA 4Y65A 4DR3J 4PYDA 4DHYA 5DG7A 3IS9B 4DQPA 1PJ7A 3AAPA 4I7FA 4NE9C 1WLJA 1CJKB 2ZC3A 5J2MB 3SFUA 3I8DA 1S1XA 3SQGB 5GINA 2ZBQA 1TZ0A 3HHLC 3TAMB 1A6LA 2DVIA 2LXIA 1JX4A 2CZVC 2HLTA 4C0OC 3Q8RB 4ED1A 2WOMB 1EP4B 4H0XB 4DV0J 5E33A 2J7UA 4CLZA 3SFGA 3MTJA 1C2PA 5FD1A 3PYDA 3I4HX 3V6DB 2WHOA 2ZWPA 4BRPA 1B70B 1SQKA 5KFGA 2HHUA 1RLDA 4CZJA 3L3CA 3PR4A 4KTZA 1S9GB 3GE1A 3ZSRA 2J9CA 4I2QA 1ITGA 1C4AA 1X4AA 4MLEA 3QGGA 3KK7A 3K5MA 4Z2XA 4HHUA 2DHXA 2QFJA 4USMA 1BUPA 4K42A 4NL5A 2YKNB 4LVNP 4CJ3A 3CC7S 2XMVA 4DTJA 1EZZB 3MR7A 4G65A 2LDIA 2P9KA 3FVYA 1W2BM 3V9ZA 3WXJA 1NSQA 4DR2F 3GILA 1SC6A 1PC4A 5AFUH 1YRUA 2VA3A 3DOMB 2F9TA 2ZH2A 1UKUA 2ZJPQ 4RTFD 3LP0B 3MOJB 4KKOB 1WC6A 3I5AA 3V9XA 2GQ2A 2JX2A 2AP6A 3NRBA 1QM9A 2CNNB 4KTWA 2W41A 1YXQA 5U47A 1HJRA 2VPWB 3UKUA 2LXFA 4B3MJ 1YJ9N 3PCOB 4CFCA 1NXIA 1U1LA 3FZKA 5AT1B 3EJMA 4BRIA 1U09A 3AO5A 3A4TA 5M1FA 5KFOA 4FF1A 1RKIA 2JC0A 3ZZUA 3VEOA 3OTCA 1VC0A 4B3SK 3MUTP 3A5MC 1HMVA 4KR0B 4HT7A 5AXNA 4DR4J 1BD6A 3G6YA 4ECRA 5KFHA 3THWA 2O01C 2UZAA 1FFWB 4FK2A 2XM3A 1RTJA 4WTYA 3LWMA 5ETLA 1U1RA 2HB5A 1IUJA 1S1XB 2J8AA 3M6GA 4CHQA 1S99A 3PYEA 5EX0A 4CM0A 4TVAB 3EX7B 3MAQA 2DBBA 1YJWS 1BWEA 3CFPA 2PY5A 1FNOA 3H5XA 1Q8IA 3FGVA 4UQTA 2P5OA 5B0FA 1RT5B 2V50A 3HM9A 1SQEA 1Y0HA 4PR6A 4LSLB 2JHEA 1R27B 3CPWR 4ILMA 3WEEA 5BR8J 3LO3A 4X64K 2LQ8A 1SQFA 1HWLA 3I9V9 4P2MA 2MLXA 3GL1A 1U0HB 3RMBA 2D5RA 5DQIA 3CCJN 3MPWA 2C2KB 4YOXA 1NK6A 2OMOA 4CH0S 3I6PA 2RIJA 3F2KA 3BGUA 3RBEA 1DJ0A 1T9YA 4CVNE 1DRZA 1TVRA 1R8AA 1IBLK 1CZBA 3KMQA 2CQ4A 3DLEA 1CJUB 2EHGA 5ITHA 1H2UX 5TKWA 1WG5A 1ZTTA 3EY1A 5HMZA 4FWPA 3TSQA 3MR5A 3BSCA 1FF2A 4CGDA 2P1JA 2LQ9A 2X6NA 2HWHA 2V63A 1ASVA 4TLRA 3LALA 4KAIA 4ZPAA 3M1FA 1UA1A 1H38A 2JWKA 3N5FA 3UKUB 3ZZOA 2DGUA 5HK4A 3S6EA 2BW2A 3OR2A 2W8LA 4WU3A 3CVKA 2XTJP 2KDOA 1AT1B 2ZD1A 1T03B 1R6YA 3VGMA 3D0HE 1HMVB 1NK5A 2WTFA 2QMWA 2N7YA 2KT3A 5ETPA 2IIRA 1F9FA 1OH6A 3TQEA 2GCFA 3R8YA 4ES1A 3UIQA 3QFPA 1TKXA 4E2FB 3BKFA 2A1RA 3CMEN 1Y7PA 1U6FA 4U7UD 3MEEA 5CH7B 2DITA 2ASYA 2LYVA 1LWFA 4WFBQ 3CEDA 3PIOQ 1WTBA 1YTYA 4UT4A 3FRZA 3SPZA 3QEPA 1WB9A 4B1VA 2HQDA 3CCUS 4OKEA 4F4YA 3RJMB 1OS5A 3TJAA 2YNIA 1APSA 3WEEB 4QIGA 4QIWD 4RW6A 5E0OA 3EXYA 2P9IA 4LF9K 1KQGB 2W24A 3QNWB 3WDOA 3IA0A 2E5LK 1F5CA 2BJEA 2VUGA 4DR5K 4B3TK 3Q86A 2B8QA 3SLCA 4RU2A 2V9WA 3OXFA 1RLCL 3DLLQ 1SZ2A 2MKKA 2FLPA 3OYDA 2GQQA 2LEAA 2FZKB 1TAQA 3UN5A 2KL8A 3PSIA 1QAYA 1U2VA 4CK2A 3HZEA 1TVRB 1T11A 4BHQA 1BO5O 4W98A 1I5OB 3HVTA 1N0VC 1R8CA 3R7NB 1J5EJ 5JJBA 4AFFA 1DT9A 2OYQA 3BH6B 1QSSA 2OUGA 4J37A 1XNRJ 2GA7A 3IUCA 4IOXA 4UUXA 4KHPJ 4FXVA 2E1YA 2J0WA 4ISEA 1SL2A 3WQUA 2DNRA 4IUFA 3OR2B 3AV9A 2MQOA 2Q6BA 2HRTA 3QFUA 1WHYA 5B7WA 4LF5J 2KT2A 5FROA 3JAMU 2VJVA 1C1CA 5M2UA 2WW4A 4WJBA 2ZD1B 3BDPA 2XMUA 1O0PA 2M8HA 4DDFA 3CXCR 1D4XA 1OJ4A 2I2YA 2QJ3A 4URSA 2PIIA 3L8BA 4F0HA 4RR5A 3ENOA 1C4CA 4DQSA 3ZTOA 3LPEA 1TKXB 4NA3A 4ILHA 4QWBA 2B0GA 3R6MA 2ROGA 2R2TA 3MEEB 1RAGB 4CJEA 1U8WA 3L7PA 2YHYA 1HKCA 2Q3PA 3ZSQA 2QWPA 2R8GA 1HR0K 3M8YA 4FLZA 3A8KA 2RT3A 4QPXA 5KG6A 3CC2S 3CB4A 3ZSZA 4JI1J 2DCUB 4FJNA 4LRDA 3G8SA 2ZH8A 2EWSA 1WHWA 1DTTB 3LZIA 3G9CA 2YNIB 3O9TA 2KFZA 4EFHA 2JLEA 2FZCB 2LDYA 5ELZA 3CCZA 1HPZB 3OJSA 5CABA 5CE3A 1UVMA 1V3SA 2HOEA 2GBZA 1GT8A 2DO0A 1NJYA 3HOSA 3H5UA 5CHCB 1YIJN 2UUAF 3TR5A 1RAAB 1XMBA 4X64F 3C14A 3GJRB 4MFBA 1SV5B 3M2UA 5J2QA 3AVIA 4HDHA 2IVYA 1PCAA 3FCHA 2MKYA 3IRWP 4BE2A 4PA1A 1BISA 4RW4A 5B0GA 1A5WA 1JXLA 4H5NA 3HVTB 3ZZRA 4EBDA 3VQ8A 2WCXA 2UVVA 2ZH3A 1KVBA 3W3DA 3POTA 4FVUA 1R8HA 3HVRA 3A5LC 2YX7A 3O44A 4KGZB 4Z7YA 3W8GA 4DU7A 2LEPA 2W25A 3TJ9A 4HKQA 3U9ZA 3BBCA 3L0QA 4CT8A 5FRMA 3T9ZA 1V4SA 4A47A 4KH0B 4N5SA 4KGVB 3MEGA 5AQMA 4AHUA 3TW0A 2WVFA 4NXMJ 2DIVA 3IGNA 4Q44A 2V8PA 5I42B 4IJAA 2DGSA 4KHUA 5C2CA 3T19A 2GFFA 1RBLA 4A8SA 3KOAA 4CLPA 3TUJC 1VQLN 2CKWA 2YV0X 3SCJE 3G4SS 6FD1A 2N3OA 2AZ3A 3B4MA 3FJ2A 5BR9A 3AVNA 4GVBA 4NEYA 1HBOA 3NKYA 3T1YK 3MM8A 4Y1DA 1WAJA 2HPUA 1KAXA 1XR7A 2APOA 1KCFA 2A5XA 3VOVA 2Q2RA 4CM2A 4LREA 4JS5A 5CD4H 5JS1A 2AHOB 3GV8B 1EQ0A 1U1OA 4OQJA 2OLWA 1Q4RA 2YNGA 4LQ9A 1HD1A 4Z0UA 2K7JA 3G10A 4FYYB 1ZC6A 2XGQA 4CI0B 3QIDA 4CBUA 2OTJN 4L73A 5EUHA 3E1YA 4X4VA 3GFHA 5CAAA 3UDCA 2DH8A 1TL3B 2ILYA 1WHVA 4P7VA 2CDQA 2FJDB 3PUFA 1RP5A 4LF9F 2GUIA 4MFBB 2BUNA 3CCSN 3VEYA 4CECA 3M8QA 1A7GE 3M2UB 1FRKA 3UO0A 4ES2A 4RW4B 5H1SV 4M3WA 3SI6A 1D9AA 4DV0K 4ECSA 4CIEA 5BREA 1V9OA 1N36J 4QJVA 1HNWF 1S4EA 1D9FA 3POTB 1F2GA 1YG0A 3KFWX 1TFWA 1UCNA 4JD2A 2H4WB 2VQFJ 3UD3P 1G4CA 2KI2A 2SXLA 3N28A 3NF7A 2WC9A 3L4QA 2Y0BB 1SKSA 2CXEA 3U9DA 1RACB 2XLJA 4OHZA 1O1WA 3GE9A 1IQTA 1JJ2R 4IDHA 3MEGB 1B92A 3D67A 1RDWX 4RX6A 1HWUA 3MMAA 5AJ3K 3KKRA 5E3CA 1T3OA 5GAGU 4XEIA 2G1HA 1XI1A 3B8AX 1HW8A 5T7LA 1PJ6A 2P9PB 2GS8A 1NO8A 3AVHA 2EEYA 4GVBB 5CXTA 5DM6L 1HBOB 3O1BA 3MM8B 2OJ3A 1WWHA 5IXUA 4ILJA 2HHWA 3ISNC 4UY8O 3ZT3A 4CEBA 2RE1A 4L8RB 1X1PA 2D3O1 2DEIA 1EX4A 4K59A 2KM8C 2F9JA 1HLUA 2E8AA 2OAUA 5L9XA 4AQYJ 3CM6A 5ETRA 3CD5A 3AO3A 4ALZA 5JXSA 2GAGC 3H42A 2I7NA 1QAXA 3ASMA 1HR0F 4RKUC 2KTQA 3AAQA 3QMQA 4CI6A 1Y5LB 2UXBJ 2VOPA 5GADI 3VAHA 3M8SA 3B6BA 4DR4K 2NXEA 4GC6A 3G8QA 3M32A 5IWAF 2CPYA 3PHTA 4ISFA 3VAJA 1YHQN 4LUBA 3T5KA 5ETTA 2ZGYA 3LH2S 1X4HA 3M8QB 3H98A 4PXEA 3OXLA 4U67Q 3JS9A 4KHRA 3NMUA 2GC8A 3C15A 2FPHX 1S7IA 4DXLA 2RDJA 3AXMA 3CCVN 4JNEA 1WI8A 1GLJO 5M2RA 2ZBRA 4DCPB 2FY8A 3LPUA 4TU7A 3TQ1A 1Q1KA 3BN4A 1EJ7L 3P31A 3KLGB 4IWVA 1TK0A 4HUGA 2QLXA 5RUBA 3ISND 2XLKA 3VZHA 2GGPA 2NUUG 3SV3A 4QCLA 3KMSA 4E7HA 4FOIA 4MIWA 5HRRA 2AWZA 1EARA 2NRTA 3VAFA 1KOOA 3C46A 3QIOA 3J81U 2RJZA 5AQIA 1MDUB 4CO5A 1S3XA 4MYUA 1IBMK 4KHYA 3KJNB 3NH1A 4QS8A 3QQCD 4NYFA 1S9FA 2HVHA 1HI1A 2ROPA 5T7LB 5AQJA 1FJGJ 2ZZMA 3KD5E 3CJKB 3HZGA 1SL0A 1TQLA 3H7HB 3LWLA 2R2SA 4KGKA 1SH2A 4DL6A 3IR6B 3P39A 4M1KA 1T9WA 2AU0A 3LPTA 3S8SA 3FZBA 2R7QA 3OT9A 2H3EB 4EFAC 3DRPA 5IT9Y 4ECXA 1IM4A 1FRIA 3GMGA 3B82A 1X0FA 1C0TA 5K14A 5FLXO 2OANA 3FZHA 3MN5A 2QGFB 1TR0A 1VRUB 1YRXA 3D66A 3OFFA 5LMNJ 3ZZZA 3BGRA 2F8TA 4A8MP 2QFIA 5D78A 3H5YA 3M32B 4ZOSA 3T1HF 3BZKA 2IY5B 2ERRA 3QGHA 1NBWA 1RBUA 2AF6A 2W2NP 3L7OA 3HSTB 4WXWA 3RBXA 3CCQN 1L3TA 4CIGA 1RYSA 5KG5A 1VI7A 3DHXA 2HMIB 2GO8A 4MMOA 5HL7Q 1IXKA 3UN3A 4TY9A 3C15B 3SV4A 2W1BA 4PWUA 3H59A 3ZZPA 2CWXA 3ZFVA 1QQMA 2NRXA 1QZ5A 4KB0A 2OEMA 4J9RA 1NGAA 1TUVA 3HKZD 1AUDA 4D3HA 3SUOA 3VGTA 4QW8A 2XSFA 3GP9A 1R6VA 4BG9A 3E01B 3M8PA 1Q9YA 4WKYA 5F8LA 1F5AA 1HNZK 1U02A 2EWHA 4LSZB 3I31A 3I33A 5BPNA 3SQ0A 1VQPN 4M94A 2HFSA 2QK9A 1WC5A 2H9ZA 2M9KA 2NZCA 3A8JA 3HYFA 3HI9A 2DTUA 2E2PA 3QNNA 3NAIA 2MEWA 5KFQA 4IKAA 2PD1A 4KH4A 3J81j 3CQ8A 3WX8A 3QERA 3TA2A 2Q43A 2FYXA 2ZHOA 1YZ6A 1HA1A 1ATNA 3QAUA 1IWGA 2OO4A 4HI2A 1J5EK 1HNXK 4LF7F 2R7VA 4J9OA 4ZVRB 1RTHA 1MMLA 2A10A 5F41A 3O1WA 5AJ3F 4MIAA 2UUBK 1S1TB 5HQLA 2ZJRL 3QLHA 3DXSX 1W7AA 1G3OA 2UU9J 2W9CA 5E5NA 1IWAA 2IGIA 1Q16B 5CQGA 4TYBA 4YDUA 5IM0B 1JLQA 2E88A 4IFEA 3TRGA 4DMNA 4JKFA 1TP7A 2QG9B 3VQSA 4H03B 3AVLA 5I3PA 1C0TB 5K14B 1KNZA 3I56N 2RU9A 2B4PA 1WBDA 2VBYA 3C6AA 2DGXA 3BGRB 2ITMA 3BYPA 4USWA 1VQMS 1S0VA 3TP2A 3J7A1 2VG6A 1U47A 4JKGA 1ATRA 4K0KK 1KQSM 2BRKA 1NJIO 3AH6A 4NOHA 2V5HG 2VC0A 2V8HA 3H8YA 1NWKA 3OYGA 4NCBA 2Z1JA 1HL6A 5KT6A 2PMWA 4BR4A 1S79A 2NYIA 3G25A 3RMDA 1BL3A 2C42A 4CYUB 4RO0A 1NG9A 1NGJA 4I64A 3JSMB 2JL9A 2WVEA 1I94K 4JI1K 3CMQA 1REGX 2AYBA 3PW4A 4B3RJ 1WKLA 1M5SA 4CHYA 1OO0B 1Q86O 1S6QB 3M8PB 2NS1B 1JLCB 4ED4A 4WQ5A 4B9TA 3SCIE 3UD5A 1JLGA 4N47A 3M6UA 1Y97A 3ENAA 3HSGA 3SSSA 4AYBD 3ULEA 3VQ9A 4YR3A 3DMJA 1DLOA 2YCHA 2WAQD 1MLAA 3U8XA 5GMKa 5J2NA 1H72C 5BRFA 2FSJA 3DWLA 4HVZA 4CDIA 1D8YA 3MM9B 3MZIA 2QTWA 4CZIA 1SH3A 3E51A 2CPHA 1RAEB 4OGEA 1LWEB 3OFHA 2DNQA 2AGQA 1J5OB 1WSEA 3I56S 4MJKA 1IBMF 2Z2MA 3R1HA 2MZJA 2J76E 3LGNA 1RTHB 1M5OC 1TL4A 1VQ5N 3QLHB 2DKOB 2C2NA 2JH3A 4U95A 2W9CB 4ID1A 3GZ7A 4KSEB 2X78A 3H0PA 1JLQB 1U2CA 1HPMA 4CEAA 2DNYA 2GVZA 1VQ4N 2MPUA 3UNYA 1WC0A 2CUYA 2FHMA 1U6BA 4FK4A 3VQCA 3L2RA 4M42A 5AQPA 4NXMK 3DNCA 5FPNA 3PRVA 2FHOB 1BQMB 5HRNA 3P38A 3H2UB 2PT0A 5I4MA 4JKGB 3OTOF 4P72A 1ZA1B 1RDAA 5EOYA 3HSDA 2DGOA 3AHPA 3NWGA 1HQEB 4EUVA 3DXKA 1WORA 3KWMA 5E84A 2VG7A 2DHAA 4CZEA 3EE9A 3TR8A 4OI1A 2QL9B 4BY9C 1VQ9N 5L39A 4ETXA 4EZ6A 2YKMA 3UR0A 3RRGA 2VCPA 1FXDA 1OSDA 5B8HA 1HWJA 1NK7A 4K41A 3QFHA 3WUHA 2W9AA 1JLGB 2E5JA 2B4OA 1NU4A 2PZSA 3QGIA 3KG0A 4JS4A 3M8WA 4L76A 4NEZA 3C7NA 3MFHA 3QWUA 1VQ5S 1LAVA 2FBXA 4XK8C 2LXUA 3ATVA 3A8IA 1HNZF 2BW7A 3SAGA 1WOOA 2DFFA 1ZAXA 2CH5A 1KSPA 2V51B 4USVA 3G87A 1IQZA 1RAJA 3O80A 4GY2B 1R8PA 3B8HA 3KG4A 4JKEA 3ZNJ1 3C6UB 3WNFA 3E8OA 4PQAA 1N36K 3EYZA 1E6YB 4DUZJ 4GO5X 2NR0A 1JXVA 2AJ4A 1N4LA 4DL0C 3MX2A 2DB1A 4FWRA 4PG7A 1RCXB 2AW0A 2VQFK 1M5VC 1HNXF 1SIWB 4WCEL 3PKYA 1U48A 1HYSA 2D1KA 2UUBF 2P9SB 1YDLA 1TK8A 4P52A 1FJ7A 4FJXA 2GVZB 4C1NI 1OY6A 1T6CA 4ZCIA 1E3MA 1F1BB 4MKYA 4KYZA 1D3WA 4X65F 3EZUA 4B02A 1G99A 1Q53A 4FLUA 1LKZA 4GKKJ 1WJ9A 1TUWA 2YHXA 2FLLA 2ZKTA 3E9PA 5AXLA 1QQCA 4BR9A 3W2WA 3I82A 2F7TA 4JP8A 2YTCA 4DTOA 2EKYA 2AEFA 2DPNA 1NGEA 1JLEA 4K0KF 3Q8UA 1M1HA 3VR1A 3QZ8A 3DLGA 4ANCA 2VG7B 3GV5B 5KFMA 2YHBA 4I67A 1ZM4A 4HTUA 4AQYK 4JI6J 2Z2ZA 2W40A 1VLOA 2FC0A 2OPQB 1EB0A 3PX0A 3N9UC 2UXBK 4IJNA 1I94F 3THVA 1X4CA 4TXSA 2NPFA 2HAIA 2A6OA 4PY5A 5KFLA 5A2QO 4ZVUB 4ZPVR 5KFCA 2UUCF 1VQKS 4ZK7M 1RDBA 2GQCA 5CHIA 2FBVA 1R3NA 3DN9A 4M41A 2V68A 4DCOB 2NUHA 4JRPA 2W9BB 2ZJPL 4RNHA 1FHTA 5AQRA 2JVOA 2XSJA 2KYXA 3THXA 4FBUA 1JL2A 5KFEA 4A57A 2FQQB 1G7CB 5BRDA 2BKPA 2CJXB 2GJIA 5GAHP 1Y9OA 4PWDB 5DM7Q 2H3GX 4UUWA 1TL7A 1NZ8A 2QA4S 1SKWA 2E44A 4ZCKA 4JKDA 2G1DA 3ATUA 2CJYB 3Q8PB 1X9WA 3FEZA 1ZPWX 2H4YB 2HBLA 3V6KA 3VAMA 1HKGA 3BY5A 1P9QC 3I8BA 2RSQA 4R25A 4J9VA 3SQ4A 1X31C 4YHHK 5DG9A 2E66A 1HFEL 4A8WA 4AL6A 4YOEA 3RMCA 2AGOA 2C3YA 3JS6A 1J6ZA 2E6LA 4OZ2A 1IG9A 3GYNA 2KJVA 4B1WB 2YNFA 3EO3A 1RWUA 2MYFA 3ZETA 1FJGK 1IKWB 3K8WA 3CM5A 2IAJA 1RU1A 4DTMA 3LDQA 3QFWA 2K3IA 3OYFA 4C3MA 1RWPB 2OEJA 1NB7A 1S0NA 4WXOA 4AUKA 4OX7A 2P5GA 3I4PA 1RADB 4DR7F 3CDBA 2DNHA 3RRKA 4W5QA 5JLFA 2EPIA 1IO2A 1N32F 2P9UA 3SK3A 3F73A 4F26A 4NRUA 5HAOA 2G2ZA 3MUVP 3QWPA 1XMQJ 2EW9A 4K4WA 4BGBA 4OYAA 2Q0RA 2Q3SA 3P5BP 2YKQA 1WDDA 2F3JA 4YOTA 3VGVA 2L9NA 1ZA2B 3F5TA 2VL1A 3MXIA 2YWKA 1S72S 5LL6Z 1QVFM 2FJEB 4FKYA 5C2DA 1Y11A 2C3PA 3NCPA 3THXB 3KLFB 4ILGB 1RWNB 5LJ5Y 2ITGA 2CQHA 2FHJD 1FX2A 2B43A 3JTNA 1BI4A 3HKWA 3CMAS 4DL5A 3KLIA 4MK7A 2HK3A 4Y2KA 4BR2A 4M5GA 2RNEA 1J53A 4LQ3A 1EKRA 2ACYA 4FJHA 5HMYA 4O0NA 4OLPA 3LOUA 4A59A 3JYTA 5A8WA 2UXCF 5AZIA 1T94A 4DV6J 2P9CA 2VQEK 2RVJA 4DUTA 4IOBA 1MU2A 5KRTA 2PSZA 2G2OA 2LP4A 3R2DJ 3EZOA 3MAHA 3IN5A 5G0RB 3HF5A 3SZ2A 1NNDA 4AF1A 4CJSA 2D9PA 1FKPB 3OYAA 3TZZA 4DUYK 4FVMA 5K8NA 4RNNA 2W4DA 4C8LA 2OA8A 1M1GA 4UZBA 2GNKA 3GYGA 1WOQA 3I0RB 2IJNA 3ZZYA 4CHPA 4E19A 2V67A 4HCBA 5KFPA 4BVPA 2CYYA 1HBMA 2V34A 4WFBL 4HACB 5KI6A 3CT9A 3M6WA 4J90A 1RDCA 4KGXB 1SKUB 5DQHA 2XZTB 3AVAA 1VSLA 3MTKA 3U1MA 4Y2IA 2OZSA 3GG0A 3EGVA 2HZCA 2E1ZA 2UU9K 3CFOA 3CF5L 2Y1JA 3VQ4A 3K89A 1S57A 2JEFA 1R7IA 4QR2A 1UP1A 4JV1A 3O3GA 2IPOB 3D28A 4DHVA 4IR1A 3VVUA 4IG0B 2X1AA 2BE2A 2BJ3A 1LWXA 4DS4A 3ILJA 1LW0A 4NCGB 4V19X 3VEVA 5KQDA 3DU6A 3FC9A 4OX9J 3HZ6A 1LXNA 1TMJA 1FX4A 2GW8A 2H5IB 5M1QA 3NCIA 3V9UA 3CG7A 4IXCA 2NLWA 2HNYA 3G71S 1ICEB 4LIWA 4CLKA 4CLWA 5ETSA 5KFTA 3G0ZA 1EKSA 2B5JB 1LWCB 4X62J 1BI4B 1KRPA 2AKWB 3Q83A 4IFYA 3IAYA 2N7CA 1EX8A 4Q2LA 2OI2A 1CVJA 1CULB 3JYTB 5A8WB 5B0DA 1N33K 4M5LA 3A3PB 4LF2A 3MWPA 2IJFA 1MU2B 2HFNA 4DQIA 4FNHA 4DPWA 3D6RA 2QXLA 4GV3A 2VD3A 5D0EA 3HJFA 4UQGA 2ATLA 4WU2A 1TKTA 1I3AA 3R6LB 3PDNA 1H3DA 2DH9A 3PRBA 1AA1B 3ZTQA 3Q8VA 4ZVTB 2K2PA 3THYB 4YHHF 2KZMA 4BR0A 3EM1A 4HLBA 1S1VA 3KNGA 2YPZA 3CJ3A 1SL1A 3VVTA 2FTRA 2GTDA 1S6PB 3AD7C 1T7PA 1R89A 4HTLA 3SAHA 1GLDG 2O8EA 5ETOA 1E6VA 3AA4A 1VDHA 4WIQA 4B9MA 4IFVB 3UCGA 2RRNA 1DAXA 1NKCA 4OKKA 2XO7A 1HLWA 3QAEA 3R9PA 1GX5A 4NYPA 2CGLA 3CPEA 2IFXA 2BM0A 2E1RA 1IKXA 3L2WA 4JHDA 1LW0B 1YI2N 1FRLA 4X4TA 3CI5A 4RWTA 4LRBA 5DJBA 4NZ7A 4CZFA 2K1RA 3MDQA 3D5MA 3IAS9 3D7EO 2WONB 3OBYA 1H1VA 4HYKA 3O8WA 2HNYB 3TZXA 3WZ0A 2CPJA 2E9RX 1GLEG 5AQOA 2FJAB 4C23A 3ZNUA 5FRNA 1YITN 5D0RA 5KT4A 3ENBA 1OIAA 4Z4GA 1VRTB 4CNYA 4NLRA 3M6XA 4KTQA 1BIUA 1X3NA 3RB0A 1M90T 4MKVA 2OD4A 4DR2J 3V81A 1DURA 2YQ1A 1N48A 3NAHA 4KT0C 4MKBA 3ZEUB 1WEYA 5IV3A 3CD7A 4CHNA 3KK3A 2FD2A 2MHEA 4LF4K 4CJFA 3TZYA 3HL8A 3SAFA 4H5VA 2HZAA 3QRPA 3RWUA 4RG8A 2VQEF 1S1WA 1GNKA 4C8MA 3RAMA 3H4BA 1FDBA 4OV1A 2BZ2A 1WN7A 4IH6A 4JBCA 4ZVGA 1WC1A 2QIFA 4JLHA 2IC3B 1F60B 4DUYF 2CH6A 1NUEA 4M5DA 4DUZK 1RNHA 2CJBA 3HFZB 2ZJQL 1GAOA 4Y28C 1SUQA 1VSHA 3OYCA 4ZP7A 2EFPA 4YQWA 4FWNA 2O8EB 3ET6B 2HHXA 5JVGQ 1X0PA 3MM6A 5F3ZA 2E5HA 3WNEA 2HBRB 1E6VB 5F8IA 2LVWA 4ZA1A 2ETJA 3Q24A 2XEXA 5E26A 3UD4P 5GMDA 2HK2A 2UUTA 3W61A 1NJXA 4ZCLA 5GAEP 2UU9F 3QYYA 3CJQA 1KLNA 3NE6A 5JMVA 4KREA 4FVCA 3W5XA 1KVIA 4LT6A 1NKEA 5HLFA 3OYMA 5CYQA 4K8RA 2JJ4D 4LRAA 3TUPA 5GIPA 1R43A 2K1RB 2QA2A 2BXJA 3TABA 4OYXA 3R7BB 2YBVA 1YKWA 1NDCA 3MAAA 1U24A 2BANA 2J9DA 1UEKA 2XCAA 1SI9A 1RK8A 3HOTA 3KK1A 1RA7A 4JUZA 4E0DA 2LEBA 2YVSA 1AB8A 2ADBA 1YK9A 5F8HA 4NLOA 2NSCA 3CYMA 3QEVA 5B0EA 2QXFA 2PN6A 3WC2A 3T5LA 3HFKA 2YX4A 2AX0A 1X4FA 4FNIA 3NF6A 4U7CA 3V81B 3BO3A 2CQ0A 5FLXU 1NGFA 4A61A 4DTXA 3VHQA 1NJWA 1M5HA 2O8DB 2HVEA 5E41A 1V3RA 4YDUC 2OHDA 4KBOA 3KK3B 3GDQA 3MD3A 3GIJA 3WXIA 1ZBIA 2HNDB 1N33F 2WSCC 4O8UA 3A3OB 2J7WA 3K0SA 3AVGA 4XPEA 3MPVA 4M7YA 2R2UA 1FEHA 1RWMB 2ZFHA 4C0BA 2FHKA 2LA6A 4H4OA 1KAYA 1NK9A 4OZ3A 2VBWA 2QYGA 4FZVA 2PYJA 2G8IA 4M5DB 2J8SA 2VBXA 1LK5A 1JXBA 3AO1A 2WVCA 4E7KA 3VGSA 4EWTA 2ASOA 4I6AA 4RWXA 4ZTFA 1IKVB 2FY1A 2I38A 4OI2A 3OUYA 4GKJF 4F4XA 1K8AT 4BC7A 2AQ4A 3KJVA 2J5AA 4ED6A 2BRLA 3T5HA 2MGZB 3O9UA 3KHYA 2VHGA 4IO1A 3V1OA 5FPEA 1NK4A 1VFJA 1RDUA 2ZM6F 4CJLA 2AEMA 4CO1A 3VWSA 4WQ5C 1IR1A 5HLFB 3I96A 5CYQB 4H4MA 3GIRA 1NK8A 2HNZA 1W97L 2Y8WA 2RAQA 3OW2R 1AZSA 3KLVA 4IH5A 4NXNF 4N8NA 3SBTA 1S9EA 1NLKL 3CE8A 2DD8S 2UXDF 4KHWA 1TKZB 3NHGA 1FWLA 1VK8A 2OGUA 1SC3B 2LU1A 5JICA 3KHLA 1FTRA 3CHWA 1VYAA 3BDEA 1EETA 3GSDA 4FJMA 1VOMA 2W2PP 1SQGA 3R8EA 3SMPA 4BRNA 5HBMA 2KT5A 2P2CB 3BR9A 1KC8O 4IOCL 4WFXA 3TX0A 3AGRA 4DL7A 2HW3A 3LAMA 3T5JA 3O3HA 2C1EB 3KWGA 3PVXA 4DTRA 3EVWA 3ILLA 2EXUA 4J9SA 3N0VA 1XMQK 4FJLA 1DQ8A 1GLFO 3PJ9A 4LFBF 3M2VA 4L75A 4CH1A 2VGNA 1SC4B 2HGNA 1NDKA 4KHNA 2ZDPA 4CEFA 1C1BA 3DFEA 3TTFA 3G82A 4OJRA 2JNJA 2BJ7A 2NRZA 1LNQA 1XWLA 5DDOC 3AO2A 1UAWA 5AE1A 5FJ4A 3RBZA 3EPIA 4LF4F 3TAQA 1F21A 4WZMA 4B9LA 3C8YA 4V19S 4I6WA 2XCPA 2Z4PA 4C11B 5HROB 3VZIA 4Z4FA 1FKOA 3MPDA 2GIQA 2AP1A 1GLBG 3OBWA 3F44A 2VG5A 1N88A 4JI3F 4KHQA 2GWJA 3RSEB 3KJQB 4DV6K 2HQ3A 3OUYB 1OSCA 2F40A 3WQTA 4A2AA 3KJVB 3NMAA 4M3TA 3CCLS 2G8HA 4AH9A 1BA0A 5LXYA 4Z4EA 3PO5A 2GVDB 3OA9A 4BRHA 3CDUA 1BXNA 4LY7A 2W42A 3CCRN 1JJCB 4H4MB 2WZ1A 2WSFC 2CG4A 3CJRA 3BV8A 3KZBA 3W9JA 2QLJB 5M1NA 3DRXA 2OFGX 4P2SA 3SEOA 1CEZA 2GEMA 3AFGA 2HHTA 1ZAWA 3EMTA 1CLFA 5F8MA 2UUAJ 3GTYX 2FJBB 1QJHA 4X64J 5C24B 4H8KA 3MFIA 5B0BA 1XMOK 2DXEA 3IWXA 3P6YC 1NM2A 2Y1IA 2ZC4A 1QQNA 1JKHA 3NGIA 1BGXT 4B9VA 4YY3K 4YN3B 2AIRB 5BYSA 4JKAA 3R6GB 4DSKA 3MMCB 3TAPA 5HQMA 2WB1D 4MQ3A 2ABYA 3SCLE 4U96A 2ZGZA 1ZM2A 3M2VB 3JXOA 4ED7A 3V1RA 1A5XA 4OX9K 4ECYA 1ITPA 4DL2A 4JI0F 3DM2A 2RQCA 3C16A 1UPPA 3G82B 1I39A 1WSRA 1WKKA 4DSJA 2BOAA 4WQ4C 2P9EA 1WOPA 3A13A 4URGA 1UVNA 1CJTA 3SMZA 1Q8BA 5JLHA 5C2GA 1JLBA 4CLSA 3E3XA 1FE4A 4DV1F 5C10A 4X62K 4N77A 5KFZA 3JSYA 1YBUA 3J7ZO 5BXIA 3K2PA 5LXRA 4MK9A 3ZCMA 2B4VA 1ZBFA 3KK2A 1FKOB 3FFIB 2B9XA 1HNIA 4OYMA 3MEDA 1OQ6A 1HBUB 3QESA 2PMHA 5GAHI 2AJ0A 4ZLNA 3M9NB 2VG5B 3CDEA 1TL1A 2HFVA 3T9NA 3CO9A 3FMBA 5FPDA 4H0VB 1CJVA 5T41A 1ZZNA 3IR7B 4O3QA 2R2RA 1U4BA 2IVPA 3A0IX 5BRHA 3MD1A 4XDDA 1FW6A 2PGCA 2W2QP 1RAIB 3KVGA 2XI3A 1S76D 4FWLA 2HMPA 1M90O 4ZJLA 3UE5A 2A3ZA 1IJJA 3UW1A 4FZXC 4DV2F 3IG1B 2DNZA 5AQFA 3D4JA 1C0UA 2VC1A 4R8UB 1NAQA 4LH5A 3TU5A 3PIPQ 4CGGA 1H2TZ 2YX1A 3EGWB 4B1UB 2P6TA 4YMEA 3LTOA 3KDOA 5J1EB 1MMDA 2DNNA 3EVMA 4IRCA 4W5TA 1TL5A 4LF9J 3HSJA 3MHYA 4QOZB 4BDYA 2V8GA 3TUIC 4NI2B 4NLWA 2VFUA 4OVLA 1JWWA 1BQNA 1C1AA 3VA3A 2O4IA 5E3PA 4OZ1A 2WVDA 1HNWJ 1U2RA 4C0HA 3B4DA 1RT1B 1WOSA 4GVEA 2PAVA 3C16B 5D77A 4ZJOA 3T41A 1LEOA 2QEXS 1REVB 1Q7YO 1I51B 1RDRA 3IFRA 3M2RB 1T8EA 2X1BA 1JLBB 1RKJA 4F3MA 4LRCA 3KDNA 3ELHA 2DO4A 2ZBIA 3M4XA 1V5IB 4HTIA 3JQMA 4U8VA 4JYAF 4XTTA 1XN9A 4WTOB 2XI2A 1UPMB 4DV4K 1HNVA 3CJTA 5IT0A 4DLEA 1HNIB 2EFQA 1NPPA 4IEEA 4DR2K 1VSKA 3O3FA 3NS7B 3VETA 1O5JA 2DFHA 4K4TA 3VF0B 4OI3A 4WPAA 3ZT0A 2DGTA 1XUPO 1QHAA 3HCXA 2CQBA 5A2QU 1RT3B 1B0TA 5DG8A 1MA9B 1HW9A 5CA5A 1ZYQA 1Z25A 2MZTA 4LF1A 1QTMA 4IH7A 3FSXA 4FO0A 1R0AB 1TV6A 4PQUA 3DRRA 3W2VA 4KV8A 2B9YA 2OPPB 4BRAA 4Q8EA 4K7QA 1HR0J 3QT5A 2GMHA 2ZITA 4X4UA 4BGAA 5DZ6A 1RYRA 2N3LA 3U7JA 5IWAJ 1H2VZ 4PCQA 3M7VA 3W63A 2HVIA 1KAZA 1X60A 2ALZA 3HHKA 2PMZD 1YJNS 4CFDA 1TAUA 3AVMA 2XG8A 4F50A 5KFIA 3AD9C 3KYLA 1FWKA 1CJKA 3OVNA 1BQNB 4JB8B 4CD3A 2HBQB 4UY85 2IDLA 1XMOF 3TAMA 3C2PA 5C25A 4K5RA 3IDHA 4YY3F 2WOMA 2ZOFA 1D0EA 4FCYA 1K8AO 4ZJQA 4AT1B 2DRBA 1VBYA 4EZ9A 4M5HA 1YLXA 4FOEA 4CP5A 4KAZA 4KQZA 4CRJA 2WTUA 3CCMS 3QBWA 5AFUA 2Z1GA 4ZPDA 1HBNB 2HZVA 5JVHL 4RCHA 3R3TA 3TVZA 1Z2ZA 3FBEA 4P2XA 1S9GA 4M7XA 5L1IA 1NRKA 2E2QA 4ZLJA 4CHOA 3FDSA 3JSBA 4F36A 3SQ2A 2ZEJA 2BBEA 2MHNA 3SXLA 2FF3B 1VQ7S 3H2VE 1SJ1A 5LSOA 2MZQA 3DU5A 3TANA 2RB7A 3OFEA 3BF4A 4Y2CA 4E7LA 1IV0A 5EGYA 4XH1A 2ZQBA 4H0OA 3GIIA 4BC2A 3BSOA 1MWMA 4ELTA 5DZ7A 2A42A 2GO9A 3LP0A 2ZOGA 2LLZA 4FM1A 4NLSA 4P71A 1TV6B 2MKJA 3DRRB 3HP6A 2FBTA 4YR0A 2RN2A 1MNEA 1WF2A 1NOZA 4BC9A 3DJCA 4CWBA 5DGBA 4RBVA 3FZLA 4DSEA 3BJYA 2XMWA 3T1HJ 4E3SA 1FXRA 4Z7CA 4FJIA 2VWBA 1UVJA 3AA8A 4DSLA 2K06A 2QWMA 3P3DA 2LSNA 3MX5A 5L1JA 4TLQA 1M1KO 1WSGA 1AFJA 2PO4A 5JS2A 3DYAA 2Q0UA 4OPKA 3TA0A 4O3RA 2IRYA 2W2MP 2ZOMA 2HS0A 5HVFA 5C25B 3HDSA 2R7WA 2IJRA 4Y0WA 2G8WA 2AJQA 1YGYA 4FWSA 2YWHA 2UP1A 5DMRA 4Y6IA 3KLHA 1RT5A 3CQXA 3IMXA 4ZPCA 4BACA 4X84A 5DM7L 3RW6A 3QSIA 3MGJA 2V7ZA 4YOUA 1Q8KA 4LSLA 2XHWA 4ECUA 3ZSOA 1GOAA 1VSMA 3AD8C 5A0YB 2HURA 4CIFA 5KT5A 4DLGA 3UDEA 3OYJA 4X4RA 2DNKA 4JI2K 2CA9A 3SSRA 4RUHA 2RHQB 3F9KA 4BWJA 1U0HA 3DRSB 3D68A 3VQEA 3WT0A 2FXUA 2E7XA 4DZDA 3VEXA 4P73A 2RS8A 3VQQA 1KEKA 4PKHA 1PYOB 1K0TA 1PYSB 3D2WA 4CLTA 5GAGI 4JK9A 1OYEA 2H54B 3MWBA 4KB1A 4DV4F 2YPYA 3FSYA 3VESA 1BUXA 4Y34A 4LF7J 1AFIA 2M5YA 1JCFA 1F3FA 2N82B 5AJ3J 1YSJA 1CJUA 3D2EA 3DGPB 4CJRA 4FJGA 1SJQA 3PX6A 2DPIA 3D1QA 1WAFA 3ENVA 4IR9A 1UJ6A 2ZH7A 3MMBB 3IC1A 4NLYA 3DLRA 3TOQA 3NGTA 2MQMA 2I6WA 3OS1A 1GMWA 1VQ6N 1YX2A 1QVGR 2XULA 3OR1B 4DJBA 4RUCA 2EFOA 4CF9A 1T03A 2DGQA 2AYGA 2YQ0A 1X4EA 3PO4A 1HRHA 4FDFA 3IMQJ 2A3JA 3F56A 2I5JB 4C8ZA 4CNZA 3N4QA 3GIKA 3EKUA 3LDSA 3FZMA 3CPWM 1PG5B 3DYAB 5F2RA 1QZ6A 2CQPA 1BG3A 3IRXA 3PFOA 4Q0BB 1JQGA 5C12A 1SJFA 2H5EA 3VQPA 5GAEI 1H73A 1HHSA 4MDBA 1MN7A 5HP1A 7AT1B 4CZKA 3ZX0A 2IMOA 4ER8A 3MM7A 2R7SA 4B17A 3KLHB 4GMKA 3CETA 2EI5A 8RUCA 3TAGA 2NXCA 4HVJA 2DT9A 4L72B 1UOCA 2NRVA 1UVIA 4X66K 4DB3A 4AILC 5KOWA 1B0PA 3Q2SC 2UUAK 4AL5A 3ZTSA 3L2UA 2PA8D 2WVBA 4WP8A 1BIZA 5CR4A 3HI0A 3G86A 2JVRA 3CC4N 4DN9A 2FJXA 3UI3A 3D3BJ 4JV5K 4FLXA 1BQXA 5AQGA 4FPRA 4K25A 3CNQP 3FFKB 3MWTA 1WSVA 4ID5A 4JRQA 4UY8T 1P1TA 1YJ9S 1IBMJ 1GXTA 2J9EA 4TN2A 1JLAB 1EQYA 3HHLB 2YY3A 3D2EB 5F1XA 3BREA 4GO7X 2PBDA 1JLFB 4J9UE 5BYRA 3B6OA 4CLFA 3MECA 1ZBSA 3TSPA 1X9JA 2CQIA 4FP9A 4DWIA 3MI7X 1KXPA 2O8CB 5ETVA 2QRRA 2IVFB 4ID8A 2K3KA 3AA9A 4JOUA 4KI4A 3TARA 3TPQA 4M63A 3W9HA 4ZMMA 4ILLA 1UFLA 4O4RA 4IDKA 1XR5A 4IRKA 3OTOJ 3WXKA 3NGRA 1EWQA 2KYZA 2V2VA 2M2BA 1Y64A 4AM7A 2KG0A 2YJFA 5C42A 1D5AA 1WG1A 4LSNB 2X1GA 5GAHU 1PYTA 1CQMA 2GIFA 4LF8J 2Q31A 5BPMA 4LBPA 1SPBP 4OPAA 4PL8A 1G15A 3IRXB 2Y9HA 2ADCA 2AJ2A 3Q89A 4F04B 4TY8A 4L3QA 4NPOA 1KVJA 3BSAA 2GIRA 5CCMA 5HP1B 4BC3A 1Y10A 5C7PA 3EPGA 1TYQA 3CCJS 3KNAA 1WEZA 3MM7B 2R7YA 1U1NA 4YOYA 1DARA 4QWCA 2CZ9A 4B9SA 3TEGA 2B6AA 4OYPA 4WYWA 5SZTA 4DV3K 4CJ4A 4BRLA 4FS1A 3NGDA 2RDIA 4U7UK 1DTTA 4P2FA 2DR8A 1ESVA 4DN0A 3QBXA 2KVQE 2DTJA 3ZO7A 1VSEA 1KQFB 3M1VB 4BR5A 1HPZA 2BACA 3G6EN 1HNZJ 4J2EA 2BE7D 5KFYA 4FYVB 4JI4K 2HFZA 2QZ8A 2LQJA 4WBFA 2NXJA 4ID5B 1SV5A 1T9VA 4JI2F 3H40A 1HNWK 2ACMA 1L3VA 2BX6A 3PEJA 3MXJA 4WZQA 3A1YG 1W7WA 1HNXJ 3CXCM 3MECB 2D74B 2UUBJ 4G1QA 4EMDA 1HD0A 2CNKB 4YORA 3BGFA 3IBFB 3I55N 3MXHP 2EC2A 3SDEB 2BOPA 3CMES 4FYXB 1T3VA 3P5TL 4X65J 4K2JA 4XIUA 3HHNB 4IDKB 4OYOA 3CDWA 2JGUA 3W7BA 3L09A 4HEA9 4EO6A 4OZ5A 1J54A 3UNGC 1Q8LA 2QKBA 2N4DA 1HWKA 3O4NA 3KIOA 3VF6A 5KFKA 2W2OP 5C42B 4M3XA 2ZH9A 1LOUA 3I5CA 1FNXH 5LMUK 1RTDB 3AO4A 2B7CB 4OLOA 5I42A 2ZE2A 3M9MB 2IMWP 4K0KJ 5EWEA 3O6WA 3CCWA 3RAQA 3HX9A 3K8VA 1K6YA 3FSIA 2VASA 5KTQA 4OO1J 3FZFA 2YNHB 2XZDB 4CZHA 3L3VA 4NZ6A 1SJ4P 4TY8B 4ZCMA 1HI0P 3D0GE 2FIUA 5GIOA 3JAMY 5SWMA 2RF2B 1TYQB 2BM1A 1N5TA 2XMKA 2D0BA 2B6AB 1WUUA 1I94J 3P49B 5H9FK 2K7KA 3R5CA 2LQ5A 5LJVA 1K0VA 3AJDA 3OFGA 4CO2A 1XBWA 2CZ4A 2DISA 4A8OA 5IWAK 1XTZA 2LA4A 1VAZA 2UUCJ 3NNCA 3C94A 3OHRA 2FGOA 2CPZA 4ICLB 3GONA 4WFNQ 3NWRA 2FHJA 3CULA 5F8NA 2H48B 3G2XA 1T3NA 4UZCA 1WSFA 4X66F 1TL3A 3PNIA 4KB7A 2QW9A 3UCZP 4O4GB 3S3OA 3T1AA 3AAWB 2L3MA 1V6HA 3BZQA 1VISA 2DXDA 4CEOA 1I1GA 4A8XA 9RUBA 5I3QA 3SUNA 3Q7BA 3EE8A 4FKXA 4Q2MA 2ROEA 1XNQF 2FF6A 4JV5F 3E2EA 4I6MB 1OPIA 4K4VA