3ZSYA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsyA00
3OYDA 3M8RA 1JLCA 3DM2A 4E7KA 2EHGA 4FCYA 1U48A 3KLIA 3HK2A 2FBYA 4HTUA 3VQDA 1BI4A 4ZHRA 3MEGA 4O0JA 3PY8A 4KTQA 4Q0BA 2VG7A 4BE1A 4KV8A 4NYNA 3OYHA 1RTDA 1QQCA 2HMIA 2D0BA 1S1WA 5DK5A 3H08A 5HBMA 4CJUA 4FJMA 4E19A 2QXFA 1RBRA 4DSIA 2OYQA 4B9MA 1L3VA 3QNOA 3VQQA 3RR7A 4DSFA 5HRSA 1BISA 3OYJA 3DLBA 3VQ5A 4EZ9A 2X74A 2HHSA 4M3UA 2P5OA 1HQUA 4FXDA 1A5XA 2D5RA 1C0MA 5EU7A 5C24A 4CEQA 2OPRA 4RW4A 3NH2A 4DLEA 3AVIA 3ZSWA 2OA8A 3BDPA 3RR8A 1FK9A 2F96A 2EX3A 4K8XA 3NF9A 4CHNA 3KLGA 3HM9A 3VQ4A 4CGHA 4KAZA 4KHWA 1L3TA 1BL3A 3CYMA 5HP1A 4CF1A 1VSFA 3LALA 4E1NA 3QLHA 2KW4A 3HVTA 5KRSA 1NKEA 3ASMA 3LANA 1UOCA 3MXJA 3QIOA 3OYNA 3DLKA 3HPOA 3VQAA 4CJ3A 3SI6A 4M3ZA 2YKMA 1C0TA 2G8WA 4IFVA 3AO2A 3AO1A 4FJXA 1BCMA 3V1OA 4CGJA 4OKKA 1YVUA 3LWMA 3SQ0A 4N5SA 1TAQA 4GW6A 1SKRA 4E7IA 1JXBA 3ITHA 4ID1A 3VQBA 4N56A 4DTUA 3PX0A 3RMBA 4FJHA 4KI6A 1XHXA 3OYIA 1IO2A 1MU2A 2W42A 1XHZA 4J2BA 2Y1IA 4IFYA 3K5NA 2B4JA 1UAXA 1S5JA 2Z1GA 3LP1A 4CGIA 1N5YA 3AVBA 2G8HA 3PO5A 2IOCA 3V81A 4CEAA 4DFKA 2NUBA 1C1AA 4O0IA 4HUGA 4DF8A 1XI1A 3O4NA 4CEOA 4PUOA 4YFUA 4OVLA 1JLQA 2HB5A 4TSXA 3VN5A 1TK5A 3QETA 2IDOA 2WONA 4Y1DA 2PYLA 4FW2A 4CJ5A 2HHVA 3HL8A 4CJ4A 2DFHA 1VRUA 3IRXA 2OZSA 1TKXA 1NK6A 1JXEA 4DQSA 5SWMA 1RNHA 1LV5A 4RG8A 3L2UA 2KTQA 2BDPA 3PUFA 3ALYA 4FM0A 2BGGA 1WAJA 2QK9A 3CFPA 4F3OA 4DLGA 3RRHA 3U6FA 3CG7A 4FZZA 4QCLA 1ZBLA 3L8BA 2X6NA 2HNZA 3DOLA 4DTMA 3L3UA 4Z4GA 4CFBA 1ZBHA 2VWJA 4O44A 3NH0A 3L2VA 4H4MA 1U45A 3V9SA 1SKSA 1QHTA 4N41A 4E3SA 4FJJA 3VA3A 1Q8IA 4CE9A 3LWLA 2G8FA 3ZT0A 4KI4A 3F9KA 3TR8A 4OPJA 1LWFA 3P83D 3VQCA 3ZSQA 1UWBA 4IG0A 3AO5A 4OKEA 1JL1A 3HPGA 4CJKA 3TI0A 1T03A 3OS1A 4DS5A 4R5PA 1NK9A 4BE0A 3U3YA 2E6MA 3P5JA 3VQPA 1KVCA 2Z1JA 1FXXA 4AHUA 4F8RA 2XRIA 1WSJA 3QEVA 4GVMA 4E7JA 1RCHA 1SUQA 4I9LA 5JS1A 1TK0A 4DU3A 4B8CA 2ZQBA 1T05A 4Z0UA 4E89A 4DTJA 4F4KA 3EYZA 4FJIA 2YHBA 3QEIA 4CHZA 1EETA 1QSLA 4KHQA 4FVMA 1HYSA 1RT2A 4LY7A 2ITGA 3L2WA 2KQ2A 3VQ7A 2QKKA 3VQ9A 4CHPA 2HNDA 5J2QA 1RBUA 4CCHA 2P5GA 5J2NA 1BHLA 4DFJA 2ETJA 3ZT1A 1D8YA 3AVJA 3QESA 3V9UA 3T19A 4EZ6A 4IKFA 4I7FA 1TV6A 1NKBA 3QIPA 3S3NA 1N6QA 5D3GA 3AVNA 1IKXA 4H8KA 3L2RA 4FLTA 1L3SA 4IDKA 4KFBA 4AHCA 4CF8A 5CZ1A 1F21A 1X9WA 4BWJA 4AHVA 4Z4CA 3VA0A 4B9VA 2DFEA 1WSFA 4KTWA 1WN7A 2HHXA 4W5NA 1JLEA 3OYAA 4M45A 2OPSA 1CZBA 4OPKA 4UQGA 1VSKA 4BWMA 5KRTA 1XWLA 4GMJB 4BE2A 4KB1A 1RDAA 1VSLA 4FJLA 1RT7A 3DLEA 2BANA 4H4OA 4PA1A 1JL2A 2ATQA 1TKZA 4B08A 2Q3SA 3V1QA 3MXIA 3KLHA 3D45A 1S6PA 4NYFA 4CJVA 2KFZA 3T1AA 4FK4A 5I42A 4O55A 3K5OA 4Y1CA 1S1TA 3VQEA 1LW0A 3V1RA 3OYMA 2PZSA 4FK2A 2ZD1A 3AV9A 2IAJA 3KK3A 3ULDA 2PYJA 2F8TA 2YNHA 1LW2A 2IGIA 2YV0X 4C8OA 3ZSRA 2RPIA 3PO4A 3AVAA 2HVHA 1BQMA 5CY4A 2O4GA 3OJUA 1WLJA 3MXMA 2RKIA 1NJYA 1GOCA 3MEDA 1Y97A 4DTSA 3QEWA 1BGXT 3KD5E 2F8SA 2HW3A 1J9AA 3SZ2A 4KRFA 1RT4A 4ELVA 1IKYA 1CXUA 4KHUA 4CESA 1J53A 1JLGA 1BIZA 3CFOA 3LAMA 1QS4A 4CIFA 1K6YA 3OYCA 3PX6A 1UA0A 1NK8A 4PWDA 4O5BA 1XC9A 3OY9A 3TWHA 1GOBA 3OYGA 4DTNA 3UIQA 3PX4A 1TL1A 1W0HA 3TAQA 3NH1A 3RRGA 1S1VA 4B9TA 3LP3A 1HQEA 2XY7A 1RDCA 3JSMA 1HRHA 1S1XA 4JLHA 4LD0A 2QKBA 4FLVA 4CJPA 4HVJA 1UA1A 1B92A 3AA3A 2Z1HA 1S9GA 4FLWA 3TABA 4Z4FA 4LH5A 4F2RA 5C42A 4JRQA 2D0AA 4RW6A 4HCBA 3HXMA 4J2AA 3DYAA 3B6OA 3P1GA 3LP0A 3C94A 1SL0A 1HNIA 2XY8A 1ASUA 1IH7A 3G0ZA 2VWKA 1ZBIA 4ELTA 1U4BA 5KGXA 4DG1A 4I9QA 3AVMA 4OJRA 3SUQA 1KRPA 5FROA 5JS2A 4CHYA 4B9LA 1ASWA 2FBXA 5SZTA 4LH4A 1VK0A 4CJQA 4DFMA 4KREA 1WSIA 1DTQA 3SV3A 4IBNA 3ZT4A 2PY5A 1FKOA 3HPHA 4EP4A 5C25A 3SV4A 2RF2A 3ZT2A 4DSJA 4LSLA 3SUOA 1VSMA 2KZZA 4AH9A 4DTXA 5FRNA 4FLYA 2HHUA 1CLQA 3S3OA 4DS4A 4M3RA 3NGIA 2OPQA 1C6VA 4CK1A 1NJZA 1X9MA 4CF2A 3TAPA 4B9NA 2R7YA 3AO3A 1ZBUA 3K59A 1VSHA 5CYMA 1JLFA 3KLEA 3K5LA 2FBVA 4NCGA 1CXQA 3LPUA 5HRNA 2JGUA 3LZJA 3IAYA 3G10A 1KCFA 1JKHA 4HUEA 3RTVA 4CF9A 1T8EA 1HPZA 2ZE2A 3KIOA 4CEEA 4DFPA 1T7PA 1EX4A 3AVHA 2I5JA 3NAEA 1Q9YA 4B3OA 4FJ5A 4F2SA 3K58A 3AA4A 1NK5A 4CJRA 1QSYA 4DSLA 3DRRA 1A5WA 1D9FA 4AILC 1BIUA 3V9XA 1WAFA 3S9HA 4QOZB 1QSSA 4CJWA 3DLRA 4QAGA 3K5MA 4LSNA 4Z4HA 1Q9XA 4KPYA 4CJLA 4DU1A 4C8NA 4OLBA 3CM5A 2RN2A 3BGRA 1HMVA 4DSEA 1LAVA 3NDKA 3AVKA 1D5AA 3AVGA 3NBPA 4CF0A 3SQ1A 3ZSVA 2HHQA 1WSEA 1NK7A 1TK8A 2E4LA 3CFRA 4BDZA 3T3FA 1NKCA 3O3GA 4CERA 1TKDA 1I39A 1I3AA 4MFBA 1Z25A 4DMNA 4JS4A 3AA2A 5J1EA 1ITGA 2G8IA 3NE6A 3ZCMA 4M3WA 4ICLA 3AVFA 3RMDA 4CJFA 5T7BA 3SJJA 3NGZA 4FLUA 4KKOA 4W5QA 4E1MA 3OYKA 2GUIA 1YTAA 2YKNA 3D0PA 3HT3A 1KLNA 4FLXA 3B6PA 3AVCA 2D0CA 4M3TA 1WNSA 3O3HA 2HHTA 4YNQA 1IG9A 5CYQA 2DY4A 4DQPA 1QE1A 1KTQA 4OKJA 4CEFA 4CEZA 4W5RA 4W5OA 1TVRA 3HVRA 4C8MA 4CIEA 3S3MA 3L2QA 3KK2A 1SL1A 1JLBA 2OPPA 4J2EA 4G1QA 2X6SA 1VRTA 3WNHA 3ZSZA 4E7LA 4ZTJA 4ELUA 4M42A 1C0UA 3SNNA 4CECA 1RTHA 1BCOA 2P1JA 4C8LA 1TAUA 3I0SA 1DLOA 1HYZA 3QEXA 3WNEA 1SV5A 1SKWA 3ZSXA 2GV9A 4Q5VA 3O4QA 4XIUA 2HVIA 3V9ZA 1Z26A 1IKWA 3I8DA 3LZIA 3O3FA 3DLGA 3WNFA 1SL2A 4C8KA 2AJQA 4KB0A 4DQQA 3HJFA 3SPZA 3OVNA 1L3UA 2KFNA 1DTTA 2XO7A 2LSNA 4CFAA 4BDPA 3V6DA 1HJRA 3TAFA 3JYTA 1KSPA 4KHNA 4OLAA 4J2DA 3EY1A 1VSEA 4RW7A 3ZT3A 1LAWA 2B6AA 4FW1A 4CJEA 4FLZA 1U47A 2IS3A 1REVA 4E0DA 4FK0A 4HUFA 3AO4A 4CHQA 4KO0A 2FC0A 3HSTB 4JRPA 4FJ7A 3NFAA 1C1CA 1RT3A 4N47A 1W9HA 3U3GA 5HROA 1RBVA 2WOMA 1HYVA 2B5JA 3ZSYA 5E41A 2O4IA 2YNFA 1G15A 1KFSA 4NCAA 2FBTA 2VG5A 4E7HA 3KLFA 2XY6A 1C1BA 4WE1A 1TKTA 2YHAA 1EP4A 1L5UA 4F3TA 2DTUA 3C95A 3C6TA 4ID5A 3C6UA 3QINA 3DMJA 1ZBFA 2X78A 3LP2A 4CK2A 5J2MA 2YNIA 3OYLA 1RTIA 4B8AB 3NF6A 4FJGA 1TL3A 1BI4B 3MECA 4CHOA 3F73A 5DMRA 4AHSA 3V4IA 4FJ9A 3AVLA 1VSJA 2DFFA 3ZSOA 5HRPA 2IC3A 3KJVA 3MAQA 3RMCA 3TANA 1U49A 3HO1A 3MEEA 4HCCA 1GOAA 4DQRA 4FM2A 1FKPA 4I2PA 1KLMA 3IG1A 4MQ3A 4CIGA 4B9SA 3TARA 3TAEA 4CFCA 4FJKA 1A5VA 1VSIA 2GBZA 1J54A 3RMAA 1R0AA 1X9SA 3THVA 1EKEA 1LWEA 1CZ9A 4DTPA 4PY5A 2A1RA 2HHWA 2KZMA 3OYEA 1NK4A 3OS2A 3QERA 3EZ5A 1RT1A 3DOKA 5FDLA 4JS5A 4K8ZA 1B9DA 3M8SA 3SCXA 1NOYA 3ISNC 5HLFA 5I3UA 1NJWA 3QEPA 1TGOA 3A2FA 3K2PA 1RILA 3TAMA 4DSKA 1X1PA 5K14A 4RW9A 4FJ8A 4DWIA 3OYBA 3KTQA 3SYZA 5KTQA 1RT6A 5KGWA 3VQ8A 4KHSA 2Z1IA 4Z4IA 3KD1E 3QO9A 4M3XA 4IG3A 1NK0A 3AA5X 3FFIA 4M41A 4I2QA 4AHTA 3E01A 2P51A 3KK1A 3NHGA 4DTRA 3V9WA 3NF7A 3SQ4A 3DRSA 4OGCA 1LWCA 5KI6A 1S6QA 3NCIA 1RT5A 4CFDA 4CGFA 4Z4EA 3CQ8A 4BDYA 1IKVA 2XHBA 1RBTA 3OYFA 1YT3A 1KVBA 4W5TA 3OS0A 2Y1JA 3LDSA 1D9DA 1U04A 4FZXC 1YTUA 4DTOA 3PV8A 4DF4A 3DLHA 3I0RA 1WSGA 1KVAA 2YNGA 3LPTA 3M8QA 2G8UA 4B9UA 4NCBA 4DU4A 4RW8A 2E6LA 1RBSA 3WNGA 2A1SA 3SUPA 1J5OA 4M3YA 4EP5A 4CEBA 3OJSA 4PQUA 1NOZA 1JLAA 2VG6A 4CEDA 3L3VA 1O1WA 4KTZA 3NF8A 1RTJA 5CZ2A 1S1UA 4CJTA 4BACA 4FM1A 1ZYQA 4DQIA 5HRRA 1EXQA 3RWUA 2OZMA 3DI6A 3TAGA 4FYDA 2XY5A 4CJSA 3K57A 3SQ2A 4CGGA 1B9FA 1BQNA 1RDBA 2BE2A 4OGEA 4CGDA 4HHTA 4ZTFA 1QTMA 1HNVA 3HYFA 3LAKA 4FZYA 3QNNA 4KHYA 3VQ6A 1VSDA 3DRPA 5J2PA 1S9EA 4O4GA 3CM6A 2HNYA 3SUNA 2G8KA 4AHRA 4CK3A 3M8PA 2G8VA 4L8RB 4FJNA 4N76A 3NGYA 3HP6A 5FRMA 3HP9A 1ASVA 2JLEA 1KFDA 3KKSA 1WSHA 1NJXA 3IS9A 3SPYA 1RDDA 3KKRA
chains in the Genus database with same CATH superfamily
4FWLA 1GLJO 4FCYA 1U48A 4LF5K 3H3OB 4HTUA 1BI4A 4O0JA 1U2VB 3L0QA 3D2EB 4JI3K 4BRCA 2D0BA 1S1WA 5DK5A 4CJUA 2QXFA 1RBRA 1N32K 4FWQA 1YVNA 3MN5A 4DSFA 1BISA 1HJOA 4GVEA 2YI1A 4M3UA 4IEEA 4FO0A 2E2QA 4IO9L 3BDPA 1FK9A 4CHNA 3VQ4A 4KAZA 4KHWA 4BR4A 5AZJA 1NMNA 2RHKA 4H5NA 1VSFA 2P9KB 3H6EA 1HKCA 3MXJA 1UOCA 4JNEA 2O8CB 4WQ4A 1BCMA 2QM1A 3IFRA 4ILJA 1YVUA 3WUHA 1DKGD 1SKRA 4H0XB 3A5MC 3IMXA 3N4QA 4H5TA 1MU2A 2W42A 1YI2N 5AQGA 2Z1GA 3K5NA 3BEXA 4H5WA 1XQSC 1NGHA 1N5YA 1P90A 3AVBA 3V81A 3NMUA 4A61A 3CD6N 4JEPA 3VN5A 4CJ7A 2PYLA 5AQVA 4H0YB 4CJ4A 2DFHA 2ZM6K 4NO7A 1TKXA 1NK6A 1YJWN 2BDPA 1WAJA 5GADP 4DR1K 4YDUC 3THYB 4F3OA 3U6FA 3IDHA 4QCLA 1NWKA 5AFUA 5AQFA 2ITMA 4WFNL 2YX6A 1SKSA 1NGEA 4FJJA 2OCEA 4YORA 2CGJA 3F9KA 2IVNA 4JYAK 1LWFA 2KKZA 3DXKA 1DGKN 1UWBA 1JL1A 4WFAL 3W0LA 1NK9A 2E6MA 2QW9A 1FXXA 4JKDA 4GVMA 4PKIA 4JI4K 4I9LA 1XMOK 4B8CA 2ZQBA 1T05A 3BZKA 4Z0UA 2AA4A 3WEEA 3RSEA 4LY7A 3L2WA 3QBXA 3U8XA 3VQ9A 3G71N 4CHPA 2HNDA 4CCHA 1RDUA 2P5GA 5J2NA 1BHLA 1ESVA 3CETA 3SAHA 4I7FA 3M1FA 3S3NA 3L2RA 2P9NA 1L3SA 2YHXA 4CF8A 1F21A 4AHVA 3VA0A 4KTWA 1WN7A 4K41A 4IEIA 1X3NA 4DUZK 1XWLA 1XMQK 3HI0A 4H4OA 4AF1A 2QA4N 2ATQA 4B08A 3MXIA 5LMNK 3KLHA 4NYFA 1HX1A 5I42A 2A5XA 3LDNA 1MWMA 2Q36A 3OYMA 3ULDA 2PYJA 2YNHA 1VQLN 4FWKA 3J7AP 2O4GA 1GOCA 4FOEA 3QEWA 2F8SA 3SZ2A 5BN8A 1IKYA 3PIPL 1TUYA 4KHUA 4CIFA 3CFOA 1QS4A 4BROA 4PWDA 4OX9K 1X3MA 3PX4A 1TL1A 1W0HA 3RRGA 1HRHA 1S1XA 1WBBA 4BRHA 4CJPA 1B92A 4A5BA 3AA3A 4FWOA 1QQMA 1HKGA 4FLWA 3TABA 4F2RA 3VMFB 2D0AA 3HXMA 3DYAA 3B6OA 4UY8O 3P1GA 3C94A 1ASUA 3FZLA 1C0GA 3R6MA 4ELTA 1U4BA 5KGXA 5FLXO 4DG1A 3AVMA 1SS6A 1VK0A 4DFMA 3GOIA 1GLCG 5JLFA 1FKOA 2UUAK 2RF2A 3O1BA 4BRKA 4DSJA 3D2FA 3F5TA 4AH9A 3HBTA 4GV6A 3AAPA 3TAPA 3EL2A 2R7YA 1I94K 5CYMA 4CZFA 3KLEA 3K5LA 5C12A 1CXQA 2JGUA 3IAYA 3G10A 3EE9A 3D2EA 4F4KA 3KK7A 2I5JA 4FJ5A 3AA4A 4CBXA 1BOTO 3CCUN 1NK5A 3DAWA 1BIUA 3S9HA 4CJWA 1Q9XA 4C8NA 4LF9K 4CW7B 3O8MA 4FWPA 2A40A 5AQXA 4DSEA 5AQJA 2HMPA 2HBLA 3AVGA 3CERA 3AY9A 1WSEA 1NGDA 2E4LA 4WCEL 3CFRA 3O3GA 1GLAG 4MFBA 4DMNA 2O8CA 4BC2A 4ICLA 3ZX3A 3K9KA 4CJFA 3RMDA 4KKOA 2A3ZA 2GUIA 1YTAA 2HOEA 2YKNA 4DCHA 3D0PA 3CCRN 1KLNA 4FLXA 2P9LB 3B6PA 3AVCA 5TKYA 5AR0A 1IG9A 3EO3A 4C8MA 4J2EA 4G1QA 2X6SA 3ZSZA 1V4TA 5HOOA 5BRDA 4M42A 4EAHD 1C0UA 1TAUA 1RTHA 5AQRA 3ZEUA 3C0BA 2I7PA 1SV5A 1K8KB 3ZSXA 1VQKN 4Q5VA 3VGLA 5ADXH 1OH8A 4KBOA 4XEIA 3LZIA 4EFHA 2AJQA 1SL2A 4KB0A 1DTTA 5JMVA 3HOTA 1KSPA 1HJRA 3EY1A 4RW7A 1NLVA 4FW1A 4FK0A 4E0DA 1REVA 2FC0A 2QWLA 1RT3A 1W9HA 2WTUA 3WT0A 4BRQA 3UKRB 4KH5A 3KLFA 2XY6A 3T1HK 3L4QA 1L5UA 2DTUA 3C95A 3MMVA 4ID5A 4J8FA 4JI0K 3LP2A 3OYLA 1BI4B 3MECA 4DUYK 4FJ9A 1VSJA 2DFFA 5HRPA 1X9JA 3KJVA 3RMCA 2V7ZA 3HO1A 1RDWX 4EIAA 1ATSA 3TAEA 4CFCA 1A5VA 2GBZA 4PY5A 2A1RA 3KZBA 1VQ9N 3OYEA 2VGMA 1NK4A 5ELZA 3EZ5A 3DOKA 4K8ZA 3M8SA 4OO1J 3ISNC 1NJWA 5JICA 3TAMA 3VTHA 1X1PA 5K14A 4RW9A 4JAXA 3VENA 3TTFA 1YAGA 5AZJB 3SYZA 1RT6A 3VQ8A 1T6CA 1VQ4N 2Z1IA 3KD1E 1NGBA 3VEVA 2GUPA 2VGNA 3OBYA 3V9WA 3NF7A 2FF6A 1LWCA 5KI6A 1S6QA 4CFDA 2W6LA 3VEYA 1RBTA 1YT3A 3CJCA 2HSTA 2Y1JA 3OS0A 3CPEA 3CI5A 2UUCK 1U04A 3HTVA 5AQNA 5BPNA 2O8FA 4B1YB 3DLHA 2YNGA 4CI6A 4FOIA 2E6LA 4GNIA 1Z05A 1KXPA 3SUPA 3FZHA 4CEBA 4EP5A 1NOZA 4CEDA 4KTZA 3NF8A 5CZ2A 4BACA 1S1UA 4YOVA 3J80O 3HOSA 3DI6A 3P4IA 4ILGB 5AFUH 4C23A 3H46O 2G8WA 1RDBA 2BE2A 3CJAA 3O9SA 3F9MA 3VEXA 5BPLA 1VSDA 3MN7A 2G8KA 5AQZA 4N76A 3CHWA 3PIOL 2Q1NA 2UXBK 4CJQA 5KPRA 3IS9A 3B8AX 1RDDA 3OYDA 3O08A 4E1JA 2FBYA 3VQDA 4CZHA 4ZHRA 3MEGA 2E2NA 1RTDA 4JD2A 4FJMA 3AGRA 3E9PA 3DXKB 4B9MA 3VQQA 3RR7A 3ZX2A 5HRSA 1W97L 3DLBA 4EZ9A 3WXJA 1HQUA 5C0YA 2QWNA 2D5RA 1C0MA 5EU7A 4RW4A 2OA8A 3RR8A 4K8XA 3CXCM 3WEEB 3RSEB 3R1XA 1JCGA 1BL3A 5HP1A 1DEJA 3LALA 3L6QA 2KW4A 1M1KO 4M3ZA 2NNWA 2YKMA 4OPHA 4IFVA 2W41A 3AO1A 4C1NK 1KD1O 3V1OA 1TUUA 4FWNA 2P9NB 2FSJA 1JXBA 4ID1A 4N56A 3RMBA 1FJGK 4J2BA 1UAXA 1S5JA 1ATRA 3R8EA 3FLCO 2IOCA 4CEAA 1J6ZA 4HUGA 1C1AA 1H1VA 5AQQA 3O4NA 3CC4N 3P38A 1TK5A 4XH5A 2IDOA 3ID6A 2WONA 1Q81O 3HM8A 4FW2A 5AQWA 5H1SQ 1K9MO 4RG8A 4AM7A 2KTQA 1OVYA 3PUFA 3ALYA 4I6MB 3J7ZO 4FM0A 1K73O 4DV1K 3OHRA 3CFPA 4GY2B 4DLGA 3RRHA 2X6NA 1Q86O 3VEOA 3DOLA 2YCHA 3LDOA 4Z4GA 1ZBHA 3NH0A 4H4MA 1U45A 2E1ZA 3V9SA 2ASOA 1YHQN 2G8FA 2W40A 1HPMA 3ZT0A 4OPJA 3ZSQA 3ULEA 3HPGA 4CJKA 3OS1A 4DS5A 4R5PA 1KVCA 2Z1JA 4DV4K 3M5RA 4F8RA 2XRIA 3QEVA 4E7JA 1K8AO 3T7ZA 1RCHA 2PBDA 4B3MK 4FJIA 3EYZA 1QSLA 4CHZA 3OA9A 1HYSA 3BZCA 3D2FB 5AQOA 4IKFA 3AVJA 5M1FA 3V9UA 5EX5A 3QIPA 5D3GA 4H8KA 3KVGA 4FLTA 3CCSN 4IDKA 1C0FA 3TU5A 1GLBG 1Z6RA 4YOYA 3C65A 1JLEA 4M45A 1CZBA 1RGIA 4OPKA 2BUPA 3FR0A 4LF4K 4H0VB 1VSLA 3DLEA 4PA1A 2ZGZA 3V1QA 5C2FA 4WYBA 3D45A 4CJVA 3CIPA 4A5AA 1HKBA 4FK4A 4Y1CA 1S1TA 3VQEA 1IJJA 3V1RA 3EKSA 4FVUA 1HNXK 2FF3B 5KPTA 3ZSRA 2I7NA 2RPIA 3PO4A 1BQMA 2QWQA 2NRVA 1NJYA 1OH6A 4DTSA 3KD5E 2HW3A 3G6EN 1CXUA 4H5VA 1J53A 1BIZA 3LAMA 3OYCA 3PX6A 3UIQA 3OYGA 4BQZA 1S1VA 3LP3A 5EVZA 1RDCA 4JLHA 4GKKK 3EEQA 4FLVA 5AQHA 5AQYA 3CJBA 2Z1HA 4FSVA 4CZIA 1W7AA 2ASPA 4LH5A 3ZEUB 4HCBA 3VF4A 3QMLA 1HNIA 2XY8A 1ZBIA 1HLUA 4JK7A 4HWIA 3SUQA 4A62A 4CHYA 5JS2A 1ATNA 4X64K 3O80A 2FBXA 5SZTA 2QI2A 1DTQA 2E20A 5IWAK 4EP4A 5C25A 2EWSA 2KZZA 4DTXA 2KLAA 4FLYA 1CLQA 4DS4A 4M3RA 3NGIA 1NJZA 1C6VA 1ZBSA 3AO3A 3K59A 1JLFA 3GBTA 3LPUA 2DPNA 3LZJA 1JKHA 4HUEA 5GAGP 5KQDA 3WXKA 4CEEA 4DFPA 1EX4A 3NAEA 4B3OA 4MLEA 3BF1A 4F2SA 4CJRA 4F9OA 4ISFA 3DRRA 4XH1A 1IG8A 1KC8O 2UUBK 4QOZB 3HRGA 3K5MA 3DLRA 4LSNA 3CJ7A 4CJLA 4DU1A 1YIJN 4BR2A 5JLHA 3NDKA 3AVKA 1BG3A 5CR4A 4MDBA 3SQ1A 4FL9A 4LF8K 3JXUA 1NKCA 1MA9B 3O1WA 4CERA 1Z25A 4JS4A 3AA2A 5J1EA 1ITGA 3A8YA 1G99A 4FLUA 4W5QA 3A5OC 4E1MA 1GLDG 4BR0A 4JHDA 1CZAN 2DY4A 4DQPA 3SK3A 1QE1A 3U4LA 2CH5A 4CEFA 2FLOA 4W5OA 4CBUA 1NGJA 1HR0K 3PSIA 3MCPA 3WNHA 1VRTA 4DR5K 4ELUA 1XNQK 2P1JA 1DLOA 1HYZA 4M7YA 4QS9A 4YOUA 4BRNA 3O4QA 4WQ4C 4XIUA 2O8FB 1IKWA 3R3LA 4DQ8A 4CZLA 4YY3K 4C8KA 4I6MA 3CCVN 5EOYA 3SPZA 3OVNA 1L3UA 3CCEN 4O8KA 2ZJRL 2XO7A 2LSNA 4CFAA 3S41A 3TAFA 2GX9A 4J2DA 1YJNN 2IS3A 3CC7N 3AO4A 3C6AA 3NFAA 2QWMA 2QWRA 5E26A 3BF3A 3VEWA 2GEMA 5E41A 4NCAA 1QVFM 1Q82O 2VYPA 2GELA 2VG5A 1SZ2A 1JCFA 1EP4A 3QBWA 4X65K 4G9ZA 2GWKA 4IWVA 1HNWK 1RTIA 4B8AB 1E4GT 3NF6A 3ZETB 3F73A 3V4IA 3MAQA 3MX5A 4JD2B 4DQRA 4FM2A 4MQ3A 4LF6K 3IG1A 4JK9A 3OBWA 2P9SA 3AARA 1J54A 1LWEA 4DTPA 4X62K 2KZMA 5IT9O 4B3SK 5HLFA 1TGOA 1E3MA 1RILA 1OKJA 3VGKA 4YOWA 4BRDA 2O8BA 2O8EA 3CPWM 3NHGA 3FZMA 5F0XA 4DV5K 4DTRA 1RT5A 4CGFA 5AQLA 4BDYA 2XHBA 3OYFA 2Q2RA 4W5TA 3LDSA 4FZXC 2UXDK 1YTUA 3SLCA 1WSGA 3LPTA 3M8QA 2G8UA 4BG8A 2AP1A 2BTFA 1NGGA 1RBSA 4M3YA 4U67L 3D7EO 3CQXA 4PQUA 1JLAA 3WXLA 3BUZB 3T69A 4IOAL 1ZYQA 5HRRA 4PL8A 3VF2A 4FYDA 2QTDA 3K57A 3SQ2A 4DKWA 4CGDA 1BQNA 1QTMA 4FZYA 4ZTFA 3LAKA 3HYFA 2GWJA 3NVKA 1S9EA 1WB9A 3CM6A 2HNYA 3QFPA 2G8VA 1EWQA 5KPZA 2JLEA 1N33K 1KFDA 4H0TB 3KKSA 4FJGA 3ID8A 3LL3A 3DM2A 1ILYA 2EHGA 2F9WA 3PY8A 3CQYA 1NBWA 4KTQA 2VG7A 5MLCQ 4CZMA 4BE1A 4NYNA 3OYHA 1EQYA 5AJ3K 1QQCA 2UYTA 2HMIA 3H08A 4DSIA 2OYQA 1YITN 3DJCA 1L3VA 3ULEB 1MWKA 4JN4A 3OYJA 3K0SA 4B9QA 2P5OA 3GL1A 1VQ6N 4CEQA 5AQUA 4DLEA 2OPRA 3NH2A 2E2PA 3AVIA 3ZSWA 2UXCK 2F96A 3A5LC 3NF9A 3KLGA 3HM9A 4CGHA 3CYMA 4CF1A 5JVGL 2OTJN 4E1NA 4GKJK 3QLHA 5KRSA 3ASMA 4CJ3A 1C0TA 4M63C 2KHOA 3AO2A 3MCAB 4FJXA 1EO1A 1V4SA 5GINA 3SQ0A 4AM6A 3ITHA 3VQBA 4DTUA 4FJHA 3PX0A 4KI6A 1XHXA 3I8BA 3OYIA 1IO2A 2Y1IA 4IFYA 2GTDA 5AQPA 3LP1A 4CGIA 4RWTA 1NGIA 2G8HA 3PO5A 5JVHL 2V7YA 4DFKA 4DF8A 4O0IA 4PUOA 2HB5A 3SBGA 2NRRA 1VQ8N 3KHYA 4CJ5A 1NU0A 1FW6A 2OZSA 2E1YA 5SWMA 1RNHA 3BP8A 4BR9A 5TKWA 2HBKA 4JKHA 1HNZK 4K43A 4EHTA 3QB0A 1QQOA 3Q7CA 4JKEA 5E84A 1P8ZA 2CH6A 1QHAA 2HNZA 3L3UA 3DLLL 4CFBA 2VWJA 4O44A 3L2VA 1Q7YO 1N34K 1QHTA 4N41A 4E3SA 3VA3A 3C6HA 1KAYA 3TR8A 1E4FT 3P83D 2A41A 4IG0A 3AO5A 1T03A 3U3YA 3GDQA 4AHUA 1GLFO 2CGLA 5JS1A 1TK0A 3WXMB 4E89A 4H0PA 4A2AA 1EETA 4MDAA 3HSCA 4FVMA 1OH7A 4JV5K 1RT2A 2ITGA 2F4VK 2KQ2A 2QKKA 4JKGA 1NGCA 3GE1A 3NVMA 4DFJA 1D8YA 2ETJA 3ZT1A 4EZ6A 3T19A 1TV6A 1N6QA 4NLBA 3ZETA 5EXWA 4KFBA 5CZ1A 4BWJA 4Z4CA 2A6AA 1WSFA 4YHHK 3FZFA 3OYAA 1T6DA 2OPSA 4UQGA 3CMAN 4BWMA 5KRTA 4GMJB 4KB1A 2E88A 4FJLA 2BANA 2NZTA 3O4WA 1TKZA 3F2KA 2KFZA 1DT9A 4DB3A 3T1AA 2D1KA 4O55A 2NRTA 1VQMN 1KAXA 3UKUA 4JK8A 2PZSA 3AV9A 3KK3A 2F8TA 2IGIA 2WC9A 2YV0X 3RVCA 2QWOA 4BY9C 4C8OA 4ISEA 4WQ5A 3AVAA 5C10A 5CY4A 3OJUA 1WLJA 3MXMA 3KWIA 3MEDA 1Y97A 3N4PA 3A0IX 1RT4A 5GAEP 4ELVA 4H03B 1NK8A 1U6ZA 4BRMA 4O5BA 5M1OA 1XC9A 3TWHA 4JHDB 3TAQA 4B9TA 4B1WB 3JSMA 4CZEA 4NXNK 5AQTA 4HVJA 1UA1A 4BC5A 1S9GA 4A57A 4JKBA 5LJVA 4JRQA 3KWGA 3LP0A 4FWRA 1IH7A 4IZ9A 4U7BA 2F7TA 4DV6K 4OJRA 1KRPA 5FROA 4B9LA 4GV3A 1ASWA 3P39A 4KREA 1WSIA 4IBNA 3ZT4A 3HPHA 1VSMA 2HHUA 3S3OA 2OPQA 2ZF5O 1X9MA 4BRGA 1ZBUA 1VSHA 2D0PA 5F2RA 2FBVA 4NCGA 5HRNA 1KCFA 3RTVA 4JI1K 1T7PA 1HPZA 3KIOA 3AVHA 4DR2K 1Q9YA 1VHXA 1BO5O 3K58A 3G25A 3SMSA 1QSYA 4DSLA 4AILC 1IV0A 3V9XA 3I33A 3JAMO 1QSSA 4BG9A 4Z4HA 4KPYA 2D0OA 5LJWA 4OLBA 4FWSA 1LCUA 3CM5A 4IJNA 2RN2A 1HMVA 1LAVA 1D5AA 2YJFA 5GIPA 2OANA 2YHYA 3ZSVA 1NK7A 1TK8A 2P9SB 4BDZA 1D4XA 5GIOA 1TKDA 4LF7K 4B1XB 3AVFA 5BR8K 2O8DA 5CE3A 1SQKA 3O9UA 3OYKA 2FXUA 5CHIA 2D0CA 4M3TA 1WNSA 3O3HA 4YNQA 2O8BB 5CYQA 4DR7K 3CCMN 2O8EB 1KTQA 4CEZA 4W5RA 3H1VX 1TVRA 3HVRA 4CIEA 5M1PA 3L2QA 5FPEA 1SL1A 1JLBA 2OPPA 1XNRK 4WQ5C 4CECA 1BCOA 4C8LA 3QEXA 1SKWA 3M6GA 2GV9A 2HVIA 3LM2A 4MLHA 1Z26A 5FPDA 4LC9B 3DLGA 3E9OA 4JI2K 4BRAA 4CZGA 1WOQA 2KFNA 3FZKA 4IO8A 3UB5A 1EWRA 4IDHA 3SMPA 3JYTA 4OLAA 1U47A 4CJEA 3ZT3A 4FLZA 4AQYK 4JI7K 3VGMA 4KO0A 4CHQA 5AQKA 4JRPA 4CD3A 2ZGYA 5HROA 2WOMA 1HYVA 2O4IA 2YNFA 1G15A 3THWA 2FBTA 4E7HA 1C1BA 1TKTA 2YHAA 4CVNE 5BR9A 1Y64A 4F3TA 4BRPA 3C6TA 1IBKK 3QINA 4CK2A 1ZBFA 3J8AA 1O13A 4B1UB 1TL3A 5DMRA 4AHSA 3AVLA 2H3GX 3C7NA 3TANA 3MEEA 4HCCA 1GOAA 1JCEA 1T44A 4CIGA 3ZYYX 3TARA 3MDQA 4NB4A 4FJKA 1VSIA 1R0AA 3RMAA 1X9SA 3THVA 1EKEA 3ZLJA 1CZ9A 2HHWA 3EN9A 3QERA 3SJHA 1B9DA 5KQ8A 3A5NC 1NOYA 3TSPA 3QEPA 3AGKA 4FJ8A 3QICA 3OYBA 4PKHA 1TYQB 3KTQA 5KTQA 5KGWA 5BN9A 1RFQA 4Z4IA 2A42A 3QO9A 4M3XA 1QQNA 4AHTA 3E01A 2P51A 3KK1A 2YHWA 3SQ4A 1ZXOA 3DRSA 4Z4EA 3NCIA 2FSKA 3CQ8A 2P9IA 3CC2N 3WQTA 2Q0UA 4H5RA 3G4SN 1D9DA 4HTLA 4L3QA 3PV8A 4K0KK 3I0RA 1KVAA 3FE1A 4B9UA 4NCBA 5BREA 4DU4A 4BVPA 4JI8K 2WUSA 3OJSA 3ATVA 4LFCK 1WBDA 3ZX0A 3THXB 4OPAA 2P9PA 4CJTA 4ISGA 1EXQA 3RWUA 3TAGA 3H3NO 4CJSA 4CZKA 1B9FA 4PL7A 3UE5A 2JWLA 1S22A 3QNNA 4PKGA 2QWPA 3VQ6A 4KHYA 3DRPA 3SBTA 3I55N 4O4GA 3SUNA 4L8RB 4CD1A 1IBMK 2QXLA 3NGYA 3TPQA 1WSHA 1NJXA 2QKBA 3SPYA 5BRFA 3JS6A 1QZ6A 5DM6L 3M8RA 1JLCA 4E7KA 1QZ5A 3KLIA 2UU9K 3HK2A 4Z94A 2HBJA 5C15A 4NXMK 2WBNA 4DR6K 3VF6A 4Q0BA 3QFUA 4KV8A 2ZJQL 5HBMA 4E19A 1R59O 3QNOA 4BRFA 3VQ5A 2X74A 2HHSA 4IXCA 4BQLA 4FXDA 4A2BA 1A5XA 5C24A 2ASMA 3IUCA 2EX3A 5AZIB 2P9UA 3LDQA 3J7YP 1L3TA 3P31A 1XUPO 2Q31A 2D4WA 5B8HA 3HVTA 4JKGB 1NKEA 2E2OA 2HBMA 3LANA 2HF3A 3QIOA 3OYNA 3DLKA 3HPOA 3VQAA 5A2QO 3SI6A 1NM1A 2JWKA 4CGJA 3GG4A 1BA1A 4OKKA 2Q0RA 3LWMA 4N5SA 1TAQA 4GW6A 3MN6A 4E7IA 3VESA 3K9JA 4A59A 4BRIA 1YF5L 5AQIA 1YUWA 1XHZA 2NRXA 2B4JA 3CJ1A 4M7XA 3ENBA 2NUBA 1XI1A 1S3XA 4CEOA 4YFUA 3BY5A 4OVLA 1JLQA 4TSXA 3QETA 1NJIO 4Y1DA 3VOVA 3M3ZA 2HF4A 2HHVA 3HL8A 3TSUA 1VRUA 3IRXA 3U9ZA 3UKUB 4MO5A 5M1KA 4DV7K 1JXEA 4DQSA 1VQNN 1LV5A 3L2UA 3DXMB 3VERA 4B1VA 2QEXN 2BGGA 4EHUA 4DV3K 2QK9A 4B1ZA 3CJ9A 2ZJPL 3CG7A 4FZZA 1ZBLA 3L8BA 4BRLA 4JI5K 4XH4A 4DTMA 2NRZA 3VEZA 1VAZA 5FPMA 3OW2M 4LFAK 1U2VA 4FWMA 1Q8IA 4CE9A 3LWLA 2VQFK 1VQPN 3MWPA 4KI4A 3E9LA 3VQCA 3VETA 5I9EB 4OKEA 4Y0WA 3TI0A 4NLCA 2V51B 4BE0A 3P5JA 5LL6Z 3VQPA 1M90O 4KH4A 1WSJA 3SAFA 4MO4A 1SUQA 4ILHA 4YOTA 4H0OA 4DU3A 3I56N 4DTJA 3O5BA 4DV2K 2YHBA 3QEIA 3TTCA 3CCQN 4KHQA 3MN9A 2P9KA 3VQ7A 3R9PA 5J2QA 1RBUA 3LDLA 3QESA 1N8RO 1NKBA 5HL7L 3AVNA 1IKXA 3FFKB 1ZC6A 2HHHK 4AHCA 1X9WA 2RE2A 4B9VA 2DFEA 4V19S 2HHXA 4W5NA 3CCJN 1VSKA 3CF5L 3AAQA 4BE2A 1RDAA 1RT7A 1JL2A 3T1YK 2Q3SA 4O5FA 4JKCA 1S6PA 3VTIA 3U9DA 1IBLK 3LM9A 3K5OA 1LW0A 4FK2A 2ZD1A 3O9QA 2IAJA 1LW2A 1TYQA 2HVHA 3THYA 4BGAA 2RKIA 3WXIA 1BGXT 4QS8A 1J9AA 4KRFA 3L4IA 2O8DB 4CESA 1OVQA 1JLGA 1UA0A 1K6YA 3OY9A 1GOBA 4DTNA 4DV0K 3EZWA 3NH1A 3CCLN 1HQEA 2XY7A 4LD0A 2BH1A 3E66A 3FGUA 2NLXA 1WUAA 4Z4FA 3THXA 3EKUA 1W2BM 5C42A 4RW6A 4J2AA 4DR3K 1SL0A 3G0ZA 2VWKA 2IVPA 4CZJA 2J4RA 4I9QA 3QDKA 5FPNA 4LH4A 5AQSA 1NNEA 3SV3A 1BUPA 2PY5A 3SV4A 3ZT2A 4LSLA 3SUOA 2ZWHA 3MX2A 4CK1A 1NGFA 4CF2A 4B9NA 2VQEK 4WF9L 2FSNA 1BWFO 2Q97A 3PSFA 1JJ2M 4RTFD 4CF9A 4BC3A 1T8EA 2ZE2A 5BPMA 1YXQA 3W3DA 3THWB 1SAZA 4R79A 1VQ5N 3MWTA 1A5WA 1XC3A 1D9FA 3H1QA 1WAFA 5BRHA 4JI6K 4QAGA 1N36K 3ENOA 4DR4K 3BGRA 3C7NB 5AZIA 3NBPA 4CF0A 4FPAA 4KH6A 2HHQA 5M1NA 2WFBA 3T3FA 1I39A 1I3AA 3TTDA 3SAGA 2YJEA 2E5LK 2G8IA 3NE6A 1NMDA 3ZCMA 4M3WA 5AQMA 5T7BA 3SJJA 2VCPA 4QS7A 3NGZA 3DWLA 4BC4A 3IKMA 4LFBK 1HUXA 3HT3A 1BA0A 1VQ7N 3EE8A 2HHTA 3LDPA 4JKAA 4K42A 4BR5A 4OKJA 3D6RA 3S3MA 3KK2A 5FRNA 4E7LA 3O6WA 4ZTJA 1NG9A 3SNNA 3I0SA 2P9IB 3WNEA 4BR7A 4KHPK 3V9ZA 1Q18A 3I8DA 1GLLO 5F1XA 4B3RK 3O3FA 2W6KA 3WNFA 3DXMA 4GV9A 4DQQA 3HJFA 1NGAA 3O9RA 1T3VA 3PLAA 4X66K 2P9PB 4BDPA 3V6DA 1OH5A 4KHNA 1VSEA 2B6AA 2E8AA 4HUFA 3HSTB 4IJAA 4FJ7A 5DM7L 1C1CA 3TSQA 4N47A 3U3GA 4BGBA 1RBVA 3ZSYA 2B5JA 3MK6A 1KAZA 1KFSA 2NRHA 4O8UA 4WE1A 4BREA 3C6UA 2VWBA 3DMJA 5J2MA 2X78A 2YNIA 4YOXA 5LMUK 2OTLN 2F9TA 4CHOA 2PFUA 4IOCL 3ZSOA 2IC3A 1U49A 3Q7BA 1BU6O 1LOTB 1FKPA 4I2PA 1KLMA 5M1QA 4B9SA 1YJ9N 1VQON 4BVOA 1J5EK 3OS2A 1RT1A 5FDLA 5GAHP 4JS5A 3OTOK 3SCXA 5EY4A 4FPBA 5I3UA 3A2FA 3K2PA 4DSKA 1S72N 2P9UB 1MDUB 3J81O 4DWIA 3WQUA 2P9LA 4JKFA 4KHSA 4IG3A 1NK0A 3AA5X 3FFIA 4IOXA 4M41A 4I2QA 3E1YA 4OGCA 4CBWA 3H45C 1IKVA 3VPZA 1K8KA 1KVBA 4B3TK 4DTOA 3ENHA 4YDUA 4DF4A 4RCHA 5C2DA 3ATUA 4RW8A 4PHTX 3WNGA 2A1SA 1BDGA 2NRWA 1J5OA 2VG6A 2IIRA 3HZ6A 3L3VA 1O1WA 1RTJA 4DQIA 4FM1A 3O9TA 4C1NI 2OZMA 4DHYA 4IFEA 1KQSM 2XY5A 2V52B 5ADXA 1GLEG 4CGGA 5LY3A 4HHTA 4OGEA 3CMEN 1HNVA 2CGKA 4K25A 5J2PA 4FJNA 2IVOA 4AHRA 3M8PA 4CK3A 4WFBL 1QVGM 3UKRA 3HP6A 5FRMA 3HP9A 1ASVA 2PAVA 1LAWA 3KKRA
chains in the Genus database with same CATH topology
3OYDA 3M8RA 1JLCA 3DM2A 4E7KA 2EHGA 4FCYA 1U48A 3KLIA 3HK2A 2FBYA 4HTUA 3VQDA 1BI4A 4ZHRA 3MEGA 4O0JA 3PY8A 4KTQA 4Q0BA 2VG7A 4BE1A 4KV8A 4NYNA 3OYHA 1RTDA 1QQCA 2HMIA 2D0BA 1S1WA 5DK5A 3H08A 5HBMA 4CJUA 4FJMA 4E19A 2QXFA 1RBRA 4DSIA 2OYQA 4B9MA 1L3VA 3QNOA 3VQQA 3RR7A 4DSFA 5HRSA 1BISA 3OYJA 3DLBA 3VQ5A 4EZ9A 2X74A 2HHSA 4M3UA 2P5OA 1HQUA 4FXDA 1A5XA 2D5RA 1C0MA 5EU7A 5C24A 4CEQA 2OPRA 4RW4A 3NH2A 4DLEA 3AVIA 3ZSWA 2OA8A 3BDPA 3RR8A 1FK9A 2F96A 2EX3A 4K8XA 3NF9A 4CHNA 3KLGA 3HM9A 3VQ4A 4CGHA 4KAZA 4KHWA 1L3TA 1BL3A 3CYMA 5HP1A 4CF1A 1VSFA 3LALA 4E1NA 3QLHA 2KW4A 3HVTA 5KRSA 1NKEA 3ASMA 3LANA 1UOCA 3MXJA 3QIOA 3OYNA 3DLKA 3HPOA 3VQAA 4CJ3A 3SI6A 4M3ZA 2YKMA 1C0TA 2G8WA 4IFVA 3AO2A 3AO1A 4FJXA 1BCMA 3V1OA 4CGJA 4OKKA 1YVUA 3LWMA 3SQ0A 4N5SA 1TAQA 4GW6A 1SKRA 4E7IA 1JXBA 3ITHA 4ID1A 3VQBA 4N56A 4DTUA 3PX0A 3RMBA 4FJHA 4KI6A 1XHXA 3OYIA 1IO2A 1MU2A 2W42A 1XHZA 4J2BA 2Y1IA 4IFYA 3K5NA 2B4JA 1UAXA 1S5JA 2Z1GA 3LP1A 4CGIA 1N5YA 3AVBA 2G8HA 3PO5A 2IOCA 3V81A 4CEAA 4DFKA 2NUBA 1C1AA 4O0IA 4HUGA 4DF8A 1XI1A 3O4NA 4CEOA 4PUOA 4YFUA 4OVLA 1JLQA 2HB5A 4TSXA 3VN5A 1TK5A 3QETA 2IDOA 2WONA 4Y1DA 2PYLA 4FW2A 4CJ5A 2HHVA 3HL8A 4CJ4A 2DFHA 1VRUA 3IRXA 2OZSA 1TKXA 1NK6A 1JXEA 4DQSA 5SWMA 1RNHA 1LV5A 4RG8A 3L2UA 2KTQA 2BDPA 3PUFA 3ALYA 4FM0A 2BGGA 1WAJA 2QK9A 3CFPA 4F3OA 4DLGA 3RRHA 3U6FA 3CG7A 4FZZA 4QCLA 1ZBLA 3L8BA 2X6NA 2HNZA 3DOLA 4DTMA 3L3UA 4Z4GA 4CFBA 1ZBHA 2VWJA 4O44A 3NH0A 3L2VA 4H4MA 1U45A 3V9SA 1SKSA 1QHTA 4N41A 4E3SA 4FJJA 3VA3A 1Q8IA 4CE9A 3LWLA 2G8FA 3ZT0A 4KI4A 3F9KA 3TR8A 4OPJA 1LWFA 3P83D 3VQCA 3ZSQA 1UWBA 4IG0A 3AO5A 4OKEA 1JL1A 3HPGA 4CJKA 3TI0A 1T03A 3OS1A 4DS5A 4R5PA 1NK9A 4BE0A 3U3YA 2E6MA 3P5JA 3VQPA 1KVCA 2Z1JA 1FXXA 4AHUA 4F8RA 2XRIA 1WSJA 3QEVA 4GVMA 4E7JA 1RCHA 1SUQA 4I9LA 5JS1A 1TK0A 4DU3A 4B8CA 2ZQBA 1T05A 4Z0UA 4E89A 4DTJA 4F4KA 3EYZA 4FJIA 2YHBA 3QEIA 4CHZA 1EETA 1QSLA 4KHQA 4FVMA 1HYSA 1RT2A 4LY7A 2ITGA 3L2WA 2KQ2A 3VQ7A 2QKKA 3VQ9A 4CHPA 2HNDA 5J2QA 1RBUA 4CCHA 2P5GA 5J2NA 1BHLA 4DFJA 2ETJA 3ZT1A 1D8YA 3AVJA 3QESA 3V9UA 3T19A 4EZ6A 4IKFA 4I7FA 1TV6A 1NKBA 3QIPA 3S3NA 1N6QA 5D3GA 3AVNA 1IKXA 4H8KA 3L2RA 4FLTA 1L3SA 4IDKA 4KFBA 4AHCA 4CF8A 5CZ1A 1F21A 1X9WA 4BWJA 4AHVA 4Z4CA 3VA0A 4B9VA 2DFEA 1WSFA 4KTWA 1WN7A 2HHXA 4W5NA 1JLEA 3OYAA 4M45A 2OPSA 1CZBA 4OPKA 4UQGA 1VSKA 4BWMA 5KRTA 1XWLA 4GMJB 4BE2A 4KB1A 1RDAA 1VSLA 4FJLA 1RT7A 3DLEA 2BANA 4H4OA 4PA1A 1JL2A 2ATQA 1TKZA 4B08A 2Q3SA 3V1QA 3MXIA 3KLHA 3D45A 1S6PA 4NYFA 4CJVA 2KFZA 3T1AA 4FK4A 5I42A 4O55A 3K5OA 4Y1CA 1S1TA 3VQEA 1LW0A 3V1RA 3OYMA 2PZSA 4FK2A 2ZD1A 3AV9A 2IAJA 3KK3A 3ULDA 2PYJA 2F8TA 2YNHA 1LW2A 2IGIA 2YV0X 4C8OA 3ZSRA 2RPIA 3PO4A 3AVAA 2HVHA 1BQMA 5CY4A 2O4GA 3OJUA 1WLJA 3MXMA 2RKIA 1NJYA 1GOCA 3MEDA 1Y97A 4DTSA 3QEWA 1BGXT 3KD5E 2F8SA 2HW3A 1J9AA 3SZ2A 4KRFA 1RT4A 4ELVA 1IKYA 1CXUA 4KHUA 4CESA 1J53A 1JLGA 1BIZA 3CFOA 3LAMA 1QS4A 4CIFA 1K6YA 3OYCA 3PX6A 1UA0A 1NK8A 4PWDA 4O5BA 1XC9A 3OY9A 3TWHA 1GOBA 3OYGA 4DTNA 3UIQA 3PX4A 1TL1A 1W0HA 3TAQA 3NH1A 3RRGA 1S1VA 4B9TA 3LP3A 1HQEA 2XY7A 1RDCA 3JSMA 1HRHA 1S1XA 4JLHA 4LD0A 2QKBA 4FLVA 4CJPA 4HVJA 1UA1A 1B92A 3AA3A 2Z1HA 1S9GA 4FLWA 3TABA 4Z4FA 4LH5A 4F2RA 5C42A 4JRQA 2D0AA 4RW6A 4HCBA 3HXMA 4J2AA 3DYAA 3B6OA 3P1GA 3LP0A 3C94A 1SL0A 1HNIA 2XY8A 1ASUA 1IH7A 3G0ZA 2VWKA 1ZBIA 4ELTA 1U4BA 5KGXA 4DG1A 4I9QA 3AVMA 4OJRA 3SUQA 1KRPA 5FROA 5JS2A 4CHYA 4B9LA 1ASWA 2FBXA 5SZTA 4LH4A 1VK0A 4CJQA 4DFMA 4KREA 1WSIA 1DTQA 3SV3A 4IBNA 3ZT4A 2PY5A 1FKOA 3HPHA 4EP4A 5C25A 3SV4A 2RF2A 3ZT2A 4DSJA 4LSLA 3SUOA 1VSMA 2KZZA 4AH9A 4DTXA 5FRNA 4FLYA 2HHUA 1CLQA 3S3OA 4DS4A 4M3RA 3NGIA 2OPQA 1C6VA 4CK1A 1NJZA 1X9MA 4CF2A 3TAPA 4B9NA 2R7YA 3AO3A 1ZBUA 3K59A 1VSHA 5CYMA 1JLFA 3KLEA 3K5LA 2FBVA 4NCGA 1CXQA 3LPUA 5HRNA 2JGUA 3LZJA 3IAYA 3G10A 1KCFA 1JKHA 4HUEA 3RTVA 4CF9A 1T8EA 1HPZA 2ZE2A 3KIOA 4CEEA 4DFPA 1T7PA 1EX4A 3AVHA 2I5JA 3NAEA 1Q9YA 4B3OA 4FJ5A 4F2SA 3K58A 3AA4A 1NK5A 4CJRA 1QSYA 4DSLA 3DRRA 1A5WA 1D9FA 4AILC 1BIUA 3V9XA 1WAFA 3S9HA 4QOZB 1QSSA 4CJWA 3DLRA 4QAGA 3K5MA 4LSNA 4Z4HA 1Q9XA 4KPYA 4CJLA 4DU1A 4C8NA 4OLBA 3CM5A 2RN2A 3BGRA 1HMVA 4DSEA 1LAVA 3NDKA 3AVKA 1D5AA 3AVGA 3NBPA 4CF0A 3SQ1A 3ZSVA 2HHQA 1WSEA 1NK7A 1TK8A 2E4LA 3CFRA 4BDZA 3T3FA 1NKCA 3O3GA 4CERA 1TKDA 1I39A 1I3AA 4MFBA 1Z25A 4DMNA 4JS4A 3AA2A 5J1EA 1ITGA 2G8IA 3NE6A 3ZCMA 4M3WA 4ICLA 3AVFA 3RMDA 4CJFA 5T7BA 3SJJA 3NGZA 4FLUA 4KKOA 4W5QA 4E1MA 3OYKA 2GUIA 1YTAA 2YKNA 3D0PA 3HT3A 1KLNA 4FLXA 3B6PA 3AVCA 2D0CA 4M3TA 1WNSA 3O3HA 2HHTA 4YNQA 1IG9A 5CYQA 2DY4A 4DQPA 1QE1A 1KTQA 4OKJA 4CEFA 4CEZA 4W5RA 4W5OA 1TVRA 3HVRA 4C8MA 4CIEA 3S3MA 3L2QA 3KK2A 1SL1A 1JLBA 2OPPA 4J2EA 4G1QA 2X6SA 1VRTA 3WNHA 3ZSZA 4E7LA 4ZTJA 4ELUA 4M42A 1C0UA 3SNNA 4CECA 1RTHA 1BCOA 2P1JA 4C8LA 1TAUA 3I0SA 1DLOA 1HYZA 3QEXA 3WNEA 1SV5A 1SKWA 3ZSXA 2GV9A 4Q5VA 3O4QA 4XIUA 2HVIA 3V9ZA 1Z26A 1IKWA 3I8DA 3LZIA 3O3FA 3DLGA 3WNFA 1SL2A 4C8KA 2AJQA 4KB0A 4DQQA 3HJFA 3SPZA 3OVNA 1L3UA 2KFNA 1DTTA 2XO7A 2LSNA 4CFAA 4BDPA 3V6DA 1HJRA 3TAFA 3JYTA 1KSPA 4KHNA 4OLAA 4J2DA 3EY1A 1VSEA 4RW7A 3ZT3A 1LAWA 2B6AA 4FW1A 4CJEA 4FLZA 1U47A 2IS3A 1REVA 4E0DA 4FK0A 4HUFA 3AO4A 4CHQA 4KO0A 2FC0A 3HSTB 4JRPA 4FJ7A 3NFAA 1C1CA 1RT3A 4N47A 1W9HA 3U3GA 5HROA 1RBVA 2WOMA 1HYVA 2B5JA 3ZSYA 5E41A 2O4IA 2YNFA 1G15A 1KFSA 4NCAA 2FBTA 2VG5A 4E7HA 3KLFA 2XY6A 1C1BA 4WE1A 1TKTA 2YHAA 1EP4A 1L5UA 4F3TA 2DTUA 3C95A 3C6TA 4ID5A 3C6UA 3QINA 3DMJA 1ZBFA 2X78A 3LP2A 4CK2A 5J2MA 2YNIA 3OYLA 1RTIA 4B8AB 3NF6A 4FJGA 1TL3A 1BI4B 3MECA 4CHOA 3F73A 5DMRA 4AHSA 3V4IA 4FJ9A 3AVLA 1VSJA 2DFFA 3ZSOA 5HRPA 2IC3A 3KJVA 3MAQA 3RMCA 3TANA 1U49A 3HO1A 3MEEA 4HCCA 1GOAA 4DQRA 4FM2A 1FKPA 4I2PA 1KLMA 3IG1A 4MQ3A 4CIGA 4B9SA 3TARA 3TAEA 4CFCA 4FJKA 1A5VA 1VSIA 2GBZA 1J54A 3RMAA 1R0AA 1X9SA 3THVA 1EKEA 1LWEA 1CZ9A 4DTPA 4PY5A 2A1RA 2HHWA 2KZMA 3OYEA 1NK4A 3OS2A 3QERA 3EZ5A 1RT1A 3DOKA 5FDLA 4JS5A 4K8ZA 1B9DA 3M8SA 3SCXA 1NOYA 3ISNC 5HLFA 5I3UA 1NJWA 3QEPA 1TGOA 3A2FA 3K2PA 1RILA 3TAMA 4DSKA 1X1PA 5K14A 4RW9A 4FJ8A 4DWIA 3OYBA 3KTQA 3SYZA 5KTQA 1RT6A 5KGWA 3VQ8A 4KHSA 2Z1IA 4Z4IA 3KD1E 3QO9A 4M3XA 4IG3A 1NK0A 3AA5X 3FFIA 4M41A 4I2QA 4AHTA 3E01A 2P51A 3KK1A 3NHGA 4DTRA 3V9WA 3NF7A 3SQ4A 3DRSA 4OGCA 1LWCA 5KI6A 1S6QA 3NCIA 1RT5A 4CFDA 4CGFA 4Z4EA 3CQ8A 4BDYA 1IKVA 2XHBA 1RBTA 3OYFA 1YT3A 1KVBA 4W5TA 3OS0A 2Y1JA 3LDSA 1D9DA 1U04A 4FZXC 1YTUA 4DTOA 3PV8A 4DF4A 3DLHA 3I0RA 1WSGA 1KVAA 2YNGA 3LPTA 3M8QA 2G8UA 4B9UA 4NCBA 4DU4A 4RW8A 2E6LA 1RBSA 3WNGA 2A1SA 3SUPA 1J5OA 4M3YA 4EP5A 4CEBA 3OJSA 4PQUA 1NOZA 1JLAA 2VG6A 4CEDA 3L3VA 1O1WA 4KTZA 3NF8A 1RTJA 5CZ2A 1S1UA 4CJTA 4BACA 4FM1A 1ZYQA 4DQIA 5HRRA 1EXQA 3RWUA 2OZMA 3DI6A 3TAGA 4FYDA 2XY5A 4CJSA 3K57A 3SQ2A 4CGGA 1B9FA 1BQNA 1RDBA 2BE2A 4OGEA 4CGDA 4HHTA 4ZTFA 1QTMA 1HNVA 3HYFA 3LAKA 4FZYA 3QNNA 4KHYA 3VQ6A 1VSDA 3DRPA 5J2PA 1S9EA 4O4GA 3CM6A 2HNYA 3SUNA 2G8KA 4AHRA 4CK3A 3M8PA 2G8VA 4L8RB 4FJNA 4N76A 3NGYA 3HP6A 5FRMA 3HP9A 1ASVA 2JLEA 1KFDA 3KKSA 1WSHA 1NJXA 3IS9A 3SPYA 1RDDA 3KKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYD A;  3M8R A;  1JLC A;  3DM2 A;  4E7K A;  2EHG A;  4FCY A;  1U48 A;  3KLI A;  3HK2 A;  2FBY A;  4HTU A;  3VQD A;  1BI4 A;  4ZHR A;  3MEG A;  4O0J A;  3PY8 A;  4KTQ A;  4Q0B A;  2VG7 A;  4BE1 A;  4KV8 A;  4NYN A;  3OYH A;  1RTD A;  1QQC A;  2HMI A;  2D0B A;  1S1W A;  5DK5 A;  3H08 A;  5HBM A;  4CJU A;  4FJM A;  4E19 A;  2QXF A;  1RBR A;  4DSI A;  2OYQ A;  4B9M A;  1L3V A;  3QNO A;  3VQQ A;  3RR7 A;  4DSF A;  5HRS A;  1BIS A;  3OYJ A;  3DLB A;  3VQ5 A;  4EZ9 A;  2X74 A;  2HHS A;  4M3U A;  2P5O A;  1HQU A;  4FXD A;  1A5X A;  2D5R A;  1C0M A;  5EU7 A;  5C24 A;  4CEQ A;  2OPR A;  4RW4 A;  3NH2 A;  4DLE A;  3AVI A;  3ZSW A;  2OA8 A;  3BDP A;  3RR8 A;  1FK9 A;  2F96 A;  2EX3 A;  4K8X A;  3NF9 A;  4CHN A;  3KLG A;  3HM9 A;  3VQ4 A;  4CGH A;  4KAZ A;  4KHW A;  1L3T A;  1BL3 A;  3CYM A;  5HP1 A;  4CF1 A;  1VSF A;  3LAL A;  4E1N A;  3QLH A;  2KW4 A;  3HVT A;  5KRS A;  1NKE A;  3ASM A;  3LAN A;  1UOC A;  3MXJ A;  3QIO A;  3OYN A;  3DLK A;  3HPO A;  3VQA A;  4CJ3 A;  3SI6 A;  4M3Z A;  2YKM A;  1C0T A;  2G8W A;  4IFV A;  3AO2 A;  3AO1 A;  4FJX A;  1BCM A;  3V1O A;  4CGJ A;  4OKK A;  1YVU A;  3LWM A;  3SQ0 A;  4N5S A;  1TAQ A;  4GW6 A;  1SKR A;  4E7I A;  1JXB A;  3ITH A;  4ID1 A;  3VQB A;  4N56 A;  4DTU A;  3PX0 A;  3RMB A;  4FJH A;  4KI6 A;  1XHX A;  3OYI A;  1IO2 A;  1MU2 A;  2W42 A;  1XHZ A;  4J2B A;  2Y1I A;  4IFY A;  3K5N A;  2B4J A;  1UAX A;  1S5J A;  2Z1G A;  3LP1 A;  4CGI A;  1N5Y A;  3AVB A;  2G8H A;  3PO5 A;  2IOC A;  3V81 A;  4CEA A;  4DFK A;  2NUB A;  1C1A A;  4O0I A;  4HUG A;  4DF8 A;  1XI1 A;  3O4N A;  4CEO A;  4PUO A;  4YFU A;  4OVL A;  1JLQ A;  2HB5 A;  4TSX A;  3VN5 A;  1TK5 A;  3QET A;  2IDO A;  2WON A;  4Y1D A;  2PYL A;  4FW2 A;  4CJ5 A;  2HHV A;  3HL8 A;  4CJ4 A;  2DFH A;  1VRU A;  3IRX A;  2OZS A;  1TKX A;  1NK6 A;  1JXE A;  4DQS A;  5SWM A;  1RNH A;  1LV5 A;  4RG8 A;  3L2U A;  2KTQ A;  2BDP A;  3PUF A;  3ALY A;  4FM0 A;  2BGG A;  1WAJ A;  2QK9 A;  3CFP A;  4F3O A;  4DLG A;  3RRH A;  3U6F A;  3CG7 A;  4FZZ A;  4QCL A;  1ZBL A;  3L8B A;  2X6N A;  2HNZ A;  3DOL A;  4DTM A;  3L3U A;  4Z4G A;  4CFB A;  1ZBH A;  2VWJ A;  4O44 A;  3NH0 A;  3L2V A;  4H4M A;  1U45 A;  3V9S A;  1SKS A;  1QHT A;  4N41 A;  4E3S A;  4FJJ A;  3VA3 A;  1Q8I A;  4CE9 A;  3LWL A;  2G8F A;  3ZT0 A;  4KI4 A;  3F9K A;  3TR8 A;  4OPJ A;  1LWF A;  3P83 D;  3VQC A;  3ZSQ A;  1UWB A;  4IG0 A;  3AO5 A;  4OKE A;  1JL1 A;  3HPG A;  4CJK A;  3TI0 A;  1T03 A;  3OS1 A;  4DS5 A;  4R5P A;  1NK9 A;  4BE0 A;  3U3Y A;  2E6M A;  3P5J A;  3VQP A;  1KVC A;  2Z1J A;  1FXX A;  4AHU A;  4F8R A;  2XRI A;  1WSJ A;  3QEV A;  4GVM A;  4E7J A;  1RCH A;  1SUQ A;  4I9L A;  5JS1 A;  1TK0 A;  4DU3 A;  4B8C A;  2ZQB A;  1T05 A;  4Z0U A;  4E89 A;  4DTJ A;  4F4K A;  3EYZ A;  4FJI A;  2YHB A;  3QEI A;  4CHZ A;  1EET A;  1QSL A;  4KHQ A;  4FVM A;  1HYS A;  1RT2 A;  4LY7 A;  2ITG A;  3L2W A;  2KQ2 A;  3VQ7 A;  2QKK A;  3VQ9 A;  4CHP A;  2HND A;  5J2Q A;  1RBU A;  4CCH A;  2P5G A;  5J2N A;  1BHL A;  4DFJ A;  2ETJ A;  3ZT1 A;  1D8Y A;  3AVJ A;  3QES A;  3V9U A;  3T19 A;  4EZ6 A;  4IKF A;  4I7F A;  1TV6 A;  1NKB A;  3QIP A;  3S3N A;  1N6Q A;  5D3G A;  3AVN A;  1IKX A;  4H8K A;  3L2R A;  4FLT A;  1L3S A;  4IDK A;  4KFB A;  4AHC A;  4CF8 A;  5CZ1 A;  1F21 A;  1X9W A;  4BWJ A;  4AHV A;  4Z4C A;  3VA0 A;  4B9V A;  2DFE A;  1WSF A;  4KTW A;  1WN7 A;  2HHX A;  4W5N A;  1JLE A;  3OYA A;  4M45 A;  2OPS A;  1CZB A;  4OPK A;  4UQG A;  1VSK A;  4BWM A;  5KRT A;  1XWL A;  4GMJ B;  4BE2 A;  4KB1 A;  1RDA A;  1VSL A;  4FJL A;  1RT7 A;  3DLE A;  2BAN A;  4H4O A;  4PA1 A;  1JL2 A;  2ATQ A;  1TKZ A;  4B08 A;  2Q3S A;  3V1Q A;  3MXI A;  3KLH A;  3D45 A;  1S6P A;  4NYF A;  4CJV A;  2KFZ A;  3T1A A;  4FK4 A;  5I42 A;  4O55 A;  3K5O A;  4Y1C A;  1S1T A;  3VQE A;  1LW0 A;  3V1R A;  3OYM A;  2PZS A;  4FK2 A;  2ZD1 A;  3AV9 A;  2IAJ A;  3KK3 A;  3ULD A;  2PYJ A;  2F8T A;  2YNH A;  1LW2 A;  2IGI A;  2YV0 X;  4C8O A;  3ZSR A;  2RPI A;  3PO4 A;  3AVA A;  2HVH A;  1BQM A;  5CY4 A;  2O4G A;  3OJU A;  1WLJ A;  3MXM A;  2RKI A;  1NJY A;  1GOC A;  3MED A;  1Y97 A;  4DTS A;  3QEW A;  1BGX T;  3KD5 E;  2F8S A;  2HW3 A;  1J9A A;  3SZ2 A;  4KRF A;  1RT4 A;  4ELV A;  1IKY A;  1CXU A;  4KHU A;  4CES A;  1J53 A;  1JLG A;  1BIZ A;  3CFO A;  3LAM A;  1QS4 A;  4CIF A;  1K6Y A;  3OYC A;  3PX6 A;  1UA0 A;  1NK8 A;  4PWD A;  4O5B A;  1XC9 A;  3OY9 A;  3TWH A;  1GOB A;  3OYG A;  4DTN A;  3UIQ A;  3PX4 A;  1TL1 A;  1W0H A;  3TAQ A;  3NH1 A;  3RRG A;  1S1V A;  4B9T A;  3LP3 A;  1HQE A;  2XY7 A;  1RDC A;  3JSM A;  1HRH A;  1S1X A;  4JLH A;  4LD0 A;  2QKB A;  4FLV A;  4CJP A;  4HVJ A;  1UA1 A;  1B92 A;  3AA3 A;  2Z1H A;  1S9G A;  4FLW A;  3TAB A;  4Z4F A;  4LH5 A;  4F2R A;  5C42 A;  4JRQ A;  2D0A A;  4RW6 A;  4HCB A;  3HXM A;  4J2A A;  3DYA A;  3B6O A;  3P1G A;  3LP0 A;  3C94 A;  1SL0 A;  1HNI A;  2XY8 A;  1ASU A;  1IH7 A;  3G0Z A;  2VWK A;  1ZBI A;  4ELT A;  1U4B A;  5KGX A;  4DG1 A;  4I9Q A;  3AVM A;  4OJR A;  3SUQ A;  1KRP A;  5FRO A;  5JS2 A;  4CHY A;  4B9L A;  1ASW A;  2FBX A;  5SZT A;  4LH4 A;  1VK0 A;  4CJQ A;  4DFM A;  4KRE A;  1WSI A;  1DTQ A;  3SV3 A;  4IBN A;  3ZT4 A;  2PY5 A;  1FKO A;  3HPH A;  4EP4 A;  5C25 A;  3SV4 A;  2RF2 A;  3ZT2 A;  4DSJ A;  4LSL A;  3SUO A;  1VSM A;  2KZZ A;  4AH9 A;  4DTX A;  5FRN A;  4FLY A;  2HHU A;  1CLQ A;  3S3O A;  4DS4 A;  4M3R A;  3NGI A;  2OPQ A;  1C6V A;  4CK1 A;  1NJZ A;  1X9M A;  4CF2 A;  3TAP A;  4B9N A;  2R7Y A;  3AO3 A;  1ZBU A;  3K59 A;  1VSH A;  5CYM A;  1JLF A;  3KLE A;  3K5L A;  2FBV A;  4NCG A;  1CXQ A;  3LPU A;  5HRN A;  2JGU A;  3LZJ A;  3IAY A;  3G10 A;  1KCF A;  1JKH A;  4HUE A;  3RTV A;  4CF9 A;  1T8E A;  1HPZ A;  2ZE2 A;  3KIO A;  4CEE A;  4DFP A;  1T7P A;  1EX4 A;  3AVH A;  2I5J A;  3NAE A;  1Q9Y A;  4B3O A;  4FJ5 A;  4F2S A;  3K58 A;  3AA4 A;  1NK5 A;  4CJR A;  1QSY A;  4DSL A;  3DRR A;  1A5W A;  1D9F A;  4AIL C;  1BIU A;  3V9X A;  1WAF A;  3S9H A;  4QOZ B;  1QSS A;  4CJW A;  3DLR A;  4QAG A;  3K5M A;  4LSN A;  4Z4H A;  1Q9X A;  4KPY A;  4CJL A;  4DU1 A;  4C8N A;  4OLB A;  3CM5 A;  2RN2 A;  3BGR A;  1HMV A;  4DSE A;  1LAV A;  3NDK A;  3AVK A;  1D5A A;  3AVG A;  3NBP A;  4CF0 A;  3SQ1 A;  3ZSV A;  2HHQ A;  1WSE A;  1NK7 A;  1TK8 A;  2E4L A;  3CFR A;  4BDZ A;  3T3F A;  1NKC A;  3O3G A;  4CER A;  1TKD A;  1I39 A;  1I3A A;  4MFB A;  1Z25 A;  4DMN A;  4JS4 A;  3AA2 A;  5J1E A;  1ITG A;  2G8I A;  3NE6 A;  3ZCM A;  4M3W A;  4ICL A;  3AVF A;  3RMD A;  4CJF A;  5T7B A;  3SJJ A;  3NGZ A;  4FLU A;  4KKO A;  4W5Q A;  4E1M A;  3OYK A;  2GUI A;  1YTA A;  2YKN A;  3D0P A;  3HT3 A;  1KLN A;  4FLX A;  3B6P A;  3AVC A;  2D0C A;  4M3T A;  1WNS A;  3O3H A;  2HHT A;  4YNQ A;  1IG9 A;  5CYQ A;  2DY4 A;  4DQP A;  1QE1 A;  1KTQ A;  4OKJ A;  4CEF A;  4CEZ A;  4W5R A;  4W5O A;  1TVR A;  3HVR A;  4C8M A;  4CIE A;  3S3M A;  3L2Q A;  3KK2 A;  1SL1 A;  1JLB A;  2OPP A;  4J2E A;  4G1Q A;  2X6S A;  1VRT A;  3WNH A;  3ZSZ A;  4E7L A;  4ZTJ A;  4ELU A;  4M42 A;  1C0U A;  3SNN A;  4CEC A;  1RTH A;  1BCO A;  2P1J A;  4C8L A;  1TAU A;  3I0S A;  1DLO A;  1HYZ A;  3QEX A;  3WNE A;  1SV5 A;  1SKW A;  3ZSX A;  2GV9 A;  4Q5V A;  3O4Q A;  4XIU A;  2HVI A;  3V9Z A;  1Z26 A;  1IKW A;  3I8D A;  3LZI A;  3O3F A;  3DLG A;  3WNF A;  1SL2 A;  4C8K A;  2AJQ A;  4KB0 A;  4DQQ A;  3HJF A;  3SPZ A;  3OVN A;  1L3U A;  2KFN A;  1DTT A;  2XO7 A;  2LSN A;  4CFA A;  4BDP A;  3V6D A;  1HJR A;  3TAF A;  3JYT A;  1KSP A;  4KHN A;  4OLA A;  4J2D A;  3EY1 A;  1VSE A;  4RW7 A;  3ZT3 A;  1LAW A;  2B6A A;  4FW1 A;  4CJE A;  4FLZ A;  1U47 A;  2IS3 A;  1REV A;  4E0D A;  4FK0 A;  4HUF A;  3AO4 A;  4CHQ A;  4KO0 A;  2FC0 A;  3HST B;  4JRP A;  4FJ7 A;  3NFA A;  1C1C A;  1RT3 A;  4N47 A;  1W9H A;  3U3G A;  5HRO A;  1RBV A;  2WOM A;  1HYV A;  2B5J A;  3ZSY A;  5E41 A;  2O4I A;  2YNF A;  1G15 A;  1KFS A;  4NCA A;  2FBT A;  2VG5 A;  4E7H A;  3KLF A;  2XY6 A;  1C1B A;  4WE1 A;  1TKT A;  2YHA A;  1EP4 A;  1L5U A;  4F3T A;  2DTU A;  3C95 A;  3C6T A;  4ID5 A;  3C6U A;  3QIN A;  3DMJ A;  1ZBF A;  2X78 A;  3LP2 A;  4CK2 A;  5J2M A;  2YNI A;  3OYL A;  1RTI A;  4B8A B;  3NF6 A;  4FJG A;  1TL3 A;  1BI4 B;  3MEC A;  4CHO A;  3F73 A;  5DMR A;  4AHS A;  3V4I A;  4FJ9 A;  3AVL A;  1VSJ A;  2DFF A;  3ZSO A;  5HRP A;  2IC3 A;  3KJV A;  3MAQ A;  3RMC A;  3TAN A;  1U49 A;  3HO1 A;  3MEE A;  4HCC A;  1GOA A;  4DQR A;  4FM2 A;  1FKP A;  4I2P A;  1KLM A;  3IG1 A;  4MQ3 A;  4CIG A;  4B9S A;  3TAR A;  3TAE A;  4CFC A;  4FJK A;  1A5V A;  1VSI A;  2GBZ A;  1J54 A;  3RMA A;  1R0A A;  1X9S A;  3THV A;  1EKE A;  1LWE A;  1CZ9 A;  4DTP A;  4PY5 A;  2A1R A;  2HHW A;  2KZM A;  3OYE A;  1NK4 A;  3OS2 A;  3QER A;  3EZ5 A;  1RT1 A;  3DOK A;  5FDL A;  4JS5 A;  4K8Z A;  1B9D A;  3M8S A;  3SCX A;  1NOY A;  3ISN C;  5HLF A;  5I3U A;  1NJW A;  3QEP A;  1TGO A;  3A2F A;  3K2P A;  1RIL A;  3TAM A;  4DSK A;  1X1P A;  5K14 A;  4RW9 A;  4FJ8 A;  4DWI A;  3OYB A;  3KTQ A;  3SYZ A;  5KTQ A;  1RT6 A;  5KGW A;  3VQ8 A;  4KHS A;  2Z1I A;  4Z4I A;  3KD1 E;  3QO9 A;  4M3X A;  4IG3 A;  1NK0 A;  3AA5 X;  3FFI A;  4M41 A;  4I2Q A;  4AHT A;  3E01 A;  2P51 A;  3KK1 A;  3NHG A;  4DTR A;  3V9W A;  3NF7 A;  3SQ4 A;  3DRS A;  4OGC A;  1LWC A;  5KI6 A;  1S6Q A;  3NCI A;  1RT5 A;  4CFD A;  4CGF A;  4Z4E A;  3CQ8 A;  4BDY A;  1IKV A;  2XHB A;  1RBT A;  3OYF A;  1YT3 A;  1KVB A;  4W5T A;  3OS0 A;  2Y1J A;  3LDS A;  1D9D A;  1U04 A;  4FZX C;  1YTU A;  4DTO A;  3PV8 A;  4DF4 A;  3DLH A;  3I0R A;  1WSG A;  1KVA A;  2YNG A;  3LPT A;  3M8Q A;  2G8U A;  4B9U A;  4NCB A;  4DU4 A;  4RW8 A;  2E6L A;  1RBS A;  3WNG A;  2A1S A;  3SUP A;  1J5O A;  4M3Y A;  4EP5 A;  4CEB A;  3OJS A;  4PQU A;  1NOZ A;  1JLA A;  2VG6 A;  4CED A;  3L3V A;  1O1W A;  4KTZ A;  3NF8 A;  1RTJ A;  5CZ2 A;  1S1U A;  4CJT A;  4BAC A;  4FM1 A;  1ZYQ A;  4DQI A;  5HRR A;  1EXQ A;  3RWU A;  2OZM A;  3DI6 A;  3TAG A;  4FYD A;  2XY5 A;  4CJS A;  3K57 A;  3SQ2 A;  4CGG A;  1B9F A;  1BQN A;  1RDB A;  2BE2 A;  4OGE A;  4CGD A;  4HHT A;  4ZTF A;  1QTM A;  1HNV A;  3HYF A;  3LAK A;  4FZY A;  3QNN A;  4KHY A;  3VQ6 A;  1VSD A;  3DRP A;  5J2P A;  1S9E A;  4O4G A;  3CM6 A;  2HNY A;  3SUN A;  2G8K A;  4AHR A;  4CK3 A;  3M8P A;  2G8V A;  4L8R B;  4FJN A;  4N76 A;  3NGY A;  3HP6 A;  5FRM A;  3HP9 A;  1ASV A;  2JLE A;  1KFD A;  3KKS A;  1WSH A;  1NJX A;  3IS9 A;  3SPY A;  1RDD A;  3KKR A; 
#chains in the Genus database with same CATH topology
 4FWL A;  1GLJ O;  4FCY A;  1U48 A;  4LF5 K;  3H3O B;  4HTU A;  1BI4 A;  4O0J A;  1U2V B;  3L0Q A;  3D2E B;  4JI3 K;  4BRC A;  2D0B A;  1S1W A;  5DK5 A;  4CJU A;  2QXF A;  1RBR A;  1N32 K;  4FWQ A;  1YVN A;  3MN5 A;  4DSF A;  1BIS A;  1HJO A;  4GVE A;  2YI1 A;  4M3U A;  4IEE A;  4FO0 A;  2E2Q A;  4IO9 L;  3BDP A;  1FK9 A;  4CHN A;  3VQ4 A;  4KAZ A;  4KHW A;  4BR4 A;  5AZJ A;  1NMN A;  2RHK A;  4H5N A;  1VSF A;  2P9K B;  3H6E A;  1HKC A;  3MXJ A;  1UOC A;  4JNE A;  2O8C B;  4WQ4 A;  1BCM A;  2QM1 A;  3IFR A;  4ILJ A;  1YVU A;  3WUH A;  1DKG D;  1SKR A;  4H0X B;  3A5M C;  3IMX A;  3N4Q A;  4H5T A;  1MU2 A;  2W42 A;  1YI2 N;  5AQG A;  2Z1G A;  3K5N A;  3BEX A;  4H5W A;  1XQS C;  1NGH A;  1N5Y A;  1P90 A;  3AVB A;  3V81 A;  3NMU A;  4A61 A;  3CD6 N;  4JEP A;  3VN5 A;  4CJ7 A;  2PYL A;  5AQV A;  4H0Y B;  4CJ4 A;  2DFH A;  2ZM6 K;  4NO7 A;  1TKX A;  1NK6 A;  1YJW N;  2BDP A;  1WAJ A;  5GAD P;  4DR1 K;  4YDU C;  3THY B;  4F3O A;  3U6F A;  3IDH A;  4QCL A;  1NWK A;  5AFU A;  5AQF A;  2ITM A;  4WFN L;  2YX6 A;  1SKS A;  1NGE A;  4FJJ A;  2OCE A;  4YOR A;  2CGJ A;  3F9K A;  2IVN A;  4JYA K;  1LWF A;  2KKZ A;  3DXK A;  1DGK N;  1UWB A;  1JL1 A;  4WFA L;  3W0L A;  1NK9 A;  2E6M A;  2QW9 A;  1FXX A;  4JKD A;  4GVM A;  4PKI A;  4JI4 K;  4I9L A;  1XMO K;  4B8C A;  2ZQB A;  1T05 A;  3BZK A;  4Z0U A;  2AA4 A;  3WEE A;  3RSE A;  4LY7 A;  3L2W A;  3QBX A;  3U8X A;  3VQ9 A;  3G71 N;  4CHP A;  2HND A;  4CCH A;  1RDU A;  2P5G A;  5J2N A;  1BHL A;  1ESV A;  3CET A;  3SAH A;  4I7F A;  3M1F A;  3S3N A;  3L2R A;  2P9N A;  1L3S A;  2YHX A;  4CF8 A;  1F21 A;  4AHV A;  3VA0 A;  4KTW A;  1WN7 A;  4K41 A;  4IEI A;  1X3N A;  4DUZ K;  1XWL A;  1XMQ K;  3HI0 A;  4H4O A;  4AF1 A;  2QA4 N;  2ATQ A;  4B08 A;  3MXI A;  5LMN K;  3KLH A;  4NYF A;  1HX1 A;  5I42 A;  2A5X A;  3LDN A;  1MWM A;  2Q36 A;  3OYM A;  3ULD A;  2PYJ A;  2YNH A;  1VQL N;  4FWK A;  3J7A P;  2O4G A;  1GOC A;  4FOE A;  3QEW A;  2F8S A;  3SZ2 A;  5BN8 A;  1IKY A;  3PIP L;  1TUY A;  4KHU A;  4CIF A;  3CFO A;  1QS4 A;  4BRO A;  4PWD A;  4OX9 K;  1X3M A;  3PX4 A;  1TL1 A;  1W0H A;  3RRG A;  1HRH A;  1S1X A;  1WBB A;  4BRH A;  4CJP A;  1B92 A;  4A5B A;  3AA3 A;  4FWO A;  1QQM A;  1HKG A;  4FLW A;  3TAB A;  4F2R A;  3VMF B;  2D0A A;  3HXM A;  3DYA A;  3B6O A;  4UY8 O;  3P1G A;  3C94 A;  1ASU A;  3FZL A;  1C0G A;  3R6M A;  4ELT A;  1U4B A;  5KGX A;  5FLX O;  4DG1 A;  3AVM A;  1SS6 A;  1VK0 A;  4DFM A;  3GOI A;  1GLC G;  5JLF A;  1FKO A;  2UUA K;  2RF2 A;  3O1B A;  4BRK A;  4DSJ A;  3D2F A;  3F5T A;  4AH9 A;  3HBT A;  4GV6 A;  3AAP A;  3TAP A;  3EL2 A;  2R7Y A;  1I94 K;  5CYM A;  4CZF A;  3KLE A;  3K5L A;  5C12 A;  1CXQ A;  2JGU A;  3IAY A;  3G10 A;  3EE9 A;  3D2E A;  4F4K A;  3KK7 A;  2I5J A;  4FJ5 A;  3AA4 A;  4CBX A;  1BOT O;  3CCU N;  1NK5 A;  3DAW A;  1BIU A;  3S9H A;  4CJW A;  1Q9X A;  4C8N A;  4LF9 K;  4CW7 B;  3O8M A;  4FWP A;  2A40 A;  5AQX A;  4DSE A;  5AQJ A;  2HMP A;  2HBL A;  3AVG A;  3CER A;  3AY9 A;  1WSE A;  1NGD A;  2E4L A;  4WCE L;  3CFR A;  3O3G A;  1GLA G;  4MFB A;  4DMN A;  2O8C A;  4BC2 A;  4ICL A;  3ZX3 A;  3K9K A;  4CJF A;  3RMD A;  4KKO A;  2A3Z A;  2GUI A;  1YTA A;  2HOE A;  2YKN A;  4DCH A;  3D0P A;  3CCR N;  1KLN A;  4FLX A;  2P9L B;  3B6P A;  3AVC A;  5TKY A;  5AR0 A;  1IG9 A;  3EO3 A;  4C8M A;  4J2E A;  4G1Q A;  2X6S A;  3ZSZ A;  1V4T A;  5HOO A;  5BRD A;  4M42 A;  4EAH D;  1C0U A;  1TAU A;  1RTH A;  5AQR A;  3ZEU A;  3C0B A;  2I7P A;  1SV5 A;  1K8K B;  3ZSX A;  1VQK N;  4Q5V A;  3VGL A;  5ADX H;  1OH8 A;  4KBO A;  4XEI A;  3LZI A;  4EFH A;  2AJQ A;  1SL2 A;  4KB0 A;  1DTT A;  5JMV A;  3HOT A;  1KSP A;  1HJR A;  3EY1 A;  4RW7 A;  1NLV A;  4FW1 A;  4FK0 A;  4E0D A;  1REV A;  2FC0 A;  2QWL A;  1RT3 A;  1W9H A;  2WTU A;  3WT0 A;  4BRQ A;  3UKR B;  4KH5 A;  3KLF A;  2XY6 A;  3T1H K;  3L4Q A;  1L5U A;  2DTU A;  3C95 A;  3MMV A;  4ID5 A;  4J8F A;  4JI0 K;  3LP2 A;  3OYL A;  1BI4 B;  3MEC A;  4DUY K;  4FJ9 A;  1VSJ A;  2DFF A;  5HRP A;  1X9J A;  3KJV A;  3RMC A;  2V7Z A;  3HO1 A;  1RDW X;  4EIA A;  1ATS A;  3TAE A;  4CFC A;  1A5V A;  2GBZ A;  4PY5 A;  2A1R A;  3KZB A;  1VQ9 N;  3OYE A;  2VGM A;  1NK4 A;  5ELZ A;  3EZ5 A;  3DOK A;  4K8Z A;  3M8S A;  4OO1 J;  3ISN C;  1NJW A;  5JIC A;  3TAM A;  3VTH A;  1X1P A;  5K14 A;  4RW9 A;  4JAX A;  3VEN A;  3TTF A;  1YAG A;  5AZJ B;  3SYZ A;  1RT6 A;  3VQ8 A;  1T6C A;  1VQ4 N;  2Z1I A;  3KD1 E;  1NGB A;  3VEV A;  2GUP A;  2VGN A;  3OBY A;  3V9W A;  3NF7 A;  2FF6 A;  1LWC A;  5KI6 A;  1S6Q A;  4CFD A;  2W6L A;  3VEY A;  1RBT A;  1YT3 A;  3CJC A;  2HST A;  2Y1J A;  3OS0 A;  3CPE A;  3CI5 A;  2UUC K;  1U04 A;  3HTV A;  5AQN A;  5BPN A;  2O8F A;  4B1Y B;  3DLH A;  2YNG A;  4CI6 A;  4FOI A;  2E6L A;  4GNI A;  1Z05 A;  1KXP A;  3SUP A;  3FZH A;  4CEB A;  4EP5 A;  1NOZ A;  4CED A;  4KTZ A;  3NF8 A;  5CZ2 A;  4BAC A;  1S1U A;  4YOV A;  3J80 O;  3HOS A;  3DI6 A;  3P4I A;  4ILG B;  5AFU H;  4C23 A;  3H46 O;  2G8W A;  1RDB A;  2BE2 A;  3CJA A;  3O9S A;  3F9M A;  3VEX A;  5BPL A;  1VSD A;  3MN7 A;  2G8K A;  5AQZ A;  4N76 A;  3CHW A;  3PIO L;  2Q1N A;  2UXB K;  4CJQ A;  5KPR A;  3IS9 A;  3B8A X;  1RDD A;  3OYD A;  3O08 A;  4E1J A;  2FBY A;  3VQD A;  4CZH A;  4ZHR A;  3MEG A;  2E2N A;  1RTD A;  4JD2 A;  4FJM A;  3AGR A;  3E9P A;  3DXK B;  4B9M A;  3VQQ A;  3RR7 A;  3ZX2 A;  5HRS A;  1W97 L;  3DLB A;  4EZ9 A;  3WXJ A;  1HQU A;  5C0Y A;  2QWN A;  2D5R A;  1C0M A;  5EU7 A;  4RW4 A;  2OA8 A;  3RR8 A;  4K8X A;  3CXC M;  3WEE B;  3RSE B;  3R1X A;  1JCG A;  1BL3 A;  5HP1 A;  1DEJ A;  3LAL A;  3L6Q A;  2KW4 A;  1M1K O;  4M3Z A;  2NNW A;  2YKM A;  4OPH A;  4IFV A;  2W41 A;  3AO1 A;  4C1N K;  1KD1 O;  3V1O A;  1TUU A;  4FWN A;  2P9N B;  2FSJ A;  1JXB A;  4ID1 A;  4N56 A;  3RMB A;  1FJG K;  4J2B A;  1UAX A;  1S5J A;  1ATR A;  3R8E A;  3FLC O;  2IOC A;  4CEA A;  1J6Z A;  4HUG A;  1C1A A;  1H1V A;  5AQQ A;  3O4N A;  3CC4 N;  3P38 A;  1TK5 A;  4XH5 A;  2IDO A;  3ID6 A;  2WON A;  1Q81 O;  3HM8 A;  4FW2 A;  5AQW A;  5H1S Q;  1K9M O;  4RG8 A;  4AM7 A;  2KTQ A;  1OVY A;  3PUF A;  3ALY A;  4I6M B;  3J7Z O;  4FM0 A;  1K73 O;  4DV1 K;  3OHR A;  3CFP A;  4GY2 B;  4DLG A;  3RRH A;  2X6N A;  1Q86 O;  3VEO A;  3DOL A;  2YCH A;  3LDO A;  4Z4G A;  1ZBH A;  3NH0 A;  4H4M A;  1U45 A;  2E1Z A;  3V9S A;  2ASO A;  1YHQ N;  2G8F A;  2W40 A;  1HPM A;  3ZT0 A;  4OPJ A;  3ZSQ A;  3ULE A;  3HPG A;  4CJK A;  3OS1 A;  4DS5 A;  4R5P A;  1KVC A;  2Z1J A;  4DV4 K;  3M5R A;  4F8R A;  2XRI A;  3QEV A;  4E7J A;  1K8A O;  3T7Z A;  1RCH A;  2PBD A;  4B3M K;  4FJI A;  3EYZ A;  1QSL A;  4CHZ A;  3OA9 A;  1HYS A;  3BZC A;  3D2F B;  5AQO A;  4IKF A;  3AVJ A;  5M1F A;  3V9U A;  5EX5 A;  3QIP A;  5D3G A;  4H8K A;  3KVG A;  4FLT A;  3CCS N;  4IDK A;  1C0F A;  3TU5 A;  1GLB G;  1Z6R A;  4YOY A;  3C65 A;  1JLE A;  4M45 A;  1CZB A;  1RGI A;  4OPK A;  2BUP A;  3FR0 A;  4LF4 K;  4H0V B;  1VSL A;  3DLE A;  4PA1 A;  2ZGZ A;  3V1Q A;  5C2F A;  4WYB A;  3D45 A;  4CJV A;  3CIP A;  4A5A A;  1HKB A;  4FK4 A;  4Y1C A;  1S1T A;  3VQE A;  1IJJ A;  3V1R A;  3EKS A;  4FVU A;  1HNX K;  2FF3 B;  5KPT A;  3ZSR A;  2I7N A;  2RPI A;  3PO4 A;  1BQM A;  2QWQ A;  2NRV A;  1NJY A;  1OH6 A;  4DTS A;  3KD5 E;  2HW3 A;  3G6E N;  1CXU A;  4H5V A;  1J53 A;  1BIZ A;  3LAM A;  3OYC A;  3PX6 A;  3UIQ A;  3OYG A;  4BQZ A;  1S1V A;  3LP3 A;  5EVZ A;  1RDC A;  4JLH A;  4GKK K;  3EEQ A;  4FLV A;  5AQH A;  5AQY A;  3CJB A;  2Z1H A;  4FSV A;  4CZI A;  1W7A A;  2ASP A;  4LH5 A;  3ZEU B;  4HCB A;  3VF4 A;  3QML A;  1HNI A;  2XY8 A;  1ZBI A;  1HLU A;  4JK7 A;  4HWI A;  3SUQ A;  4A62 A;  4CHY A;  5JS2 A;  1ATN A;  4X64 K;  3O80 A;  2FBX A;  5SZT A;  2QI2 A;  1DTQ A;  2E20 A;  5IWA K;  4EP4 A;  5C25 A;  2EWS A;  2KZZ A;  4DTX A;  2KLA A;  4FLY A;  1CLQ A;  4DS4 A;  4M3R A;  3NGI A;  1NJZ A;  1C6V A;  1ZBS A;  3AO3 A;  3K59 A;  1JLF A;  3GBT A;  3LPU A;  2DPN A;  3LZJ A;  1JKH A;  4HUE A;  5GAG P;  5KQD A;  3WXK A;  4CEE A;  4DFP A;  1EX4 A;  3NAE A;  4B3O A;  4MLE A;  3BF1 A;  4F2S A;  4CJR A;  4F9O A;  4ISF A;  3DRR A;  4XH1 A;  1IG8 A;  1KC8 O;  2UUB K;  4QOZ B;  3HRG A;  3K5M A;  3DLR A;  4LSN A;  3CJ7 A;  4CJL A;  4DU1 A;  1YIJ N;  4BR2 A;  5JLH A;  3NDK A;  3AVK A;  1BG3 A;  5CR4 A;  4MDB A;  3SQ1 A;  4FL9 A;  4LF8 K;  3JXU A;  1NKC A;  1MA9 B;  3O1W A;  4CER A;  1Z25 A;  4JS4 A;  3AA2 A;  5J1E A;  1ITG A;  3A8Y A;  1G99 A;  4FLU A;  4W5Q A;  3A5O C;  4E1M A;  1GLD G;  4BR0 A;  4JHD A;  1CZA N;  2DY4 A;  4DQP A;  3SK3 A;  1QE1 A;  3U4L A;  2CH5 A;  4CEF A;  2FLO A;  4W5O A;  4CBU A;  1NGJ A;  1HR0 K;  3PSI A;  3MCP A;  3WNH A;  1VRT A;  4DR5 K;  4ELU A;  1XNQ K;  2P1J A;  1DLO A;  1HYZ A;  4M7Y A;  4QS9 A;  4YOU A;  4BRN A;  3O4Q A;  4WQ4 C;  4XIU A;  2O8F B;  1IKW A;  3R3L A;  4DQ8 A;  4CZL A;  4YY3 K;  4C8K A;  4I6M A;  3CCV N;  5EOY A;  3SPZ A;  3OVN A;  1L3U A;  3CCE N;  4O8K A;  2ZJR L;  2XO7 A;  2LSN A;  4CFA A;  3S41 A;  3TAF A;  2GX9 A;  4J2D A;  1YJN N;  2IS3 A;  3CC7 N;  3AO4 A;  3C6A A;  3NFA A;  2QWM A;  2QWR A;  5E26 A;  3BF3 A;  3VEW A;  2GEM A;  5E41 A;  4NCA A;  1QVF M;  1Q82 O;  2VYP A;  2GEL A;  2VG5 A;  1SZ2 A;  1JCF A;  1EP4 A;  3QBW A;  4X65 K;  4G9Z A;  2GWK A;  4IWV A;  1HNW K;  1RTI A;  4B8A B;  1E4G T;  3NF6 A;  3ZET B;  3F73 A;  3V4I A;  3MAQ A;  3MX5 A;  4JD2 B;  4DQR A;  4FM2 A;  4MQ3 A;  4LF6 K;  3IG1 A;  4JK9 A;  3OBW A;  2P9S A;  3AAR A;  1J54 A;  1LWE A;  4DTP A;  4X62 K;  2KZM A;  5IT9 O;  4B3S K;  5HLF A;  1TGO A;  1E3M A;  1RIL A;  1OKJ A;  3VGK A;  4YOW A;  4BRD A;  2O8B A;  2O8E A;  3CPW M;  3NHG A;  3FZM A;  5F0X A;  4DV5 K;  4DTR A;  1RT5 A;  4CGF A;  5AQL A;  4BDY A;  2XHB A;  3OYF A;  2Q2R A;  4W5T A;  3LDS A;  4FZX C;  2UXD K;  1YTU A;  3SLC A;  1WSG A;  3LPT A;  3M8Q A;  2G8U A;  4BG8 A;  2AP1 A;  2BTF A;  1NGG A;  1RBS A;  4M3Y A;  4U67 L;  3D7E O;  3CQX A;  4PQU A;  1JLA A;  3WXL A;  3BUZ B;  3T69 A;  4IOA L;  1ZYQ A;  5HRR A;  4PL8 A;  3VF2 A;  4FYD A;  2QTD A;  3K57 A;  3SQ2 A;  4DKW A;  4CGD A;  1BQN A;  1QTM A;  4FZY A;  4ZTF A;  3LAK A;  3HYF A;  2GWJ A;  3NVK A;  1S9E A;  1WB9 A;  3CM6 A;  2HNY A;  3QFP A;  2G8V A;  1EWQ A;  5KPZ A;  2JLE A;  1N33 K;  1KFD A;  4H0T B;  3KKS A;  4FJG A;  3ID8 A;  3LL3 A;  3DM2 A;  1ILY A;  2EHG A;  2F9W A;  3PY8 A;  3CQY A;  1NBW A;  4KTQ A;  2VG7 A;  5MLC Q;  4CZM A;  4BE1 A;  4NYN A;  3OYH A;  1EQY A;  5AJ3 K;  1QQC A;  2UYT A;  2HMI A;  3H08 A;  4DSI A;  2OYQ A;  1YIT N;  3DJC A;  1L3V A;  3ULE B;  1MWK A;  4JN4 A;  3OYJ A;  3K0S A;  4B9Q A;  2P5O A;  3GL1 A;  1VQ6 N;  4CEQ A;  5AQU A;  4DLE A;  2OPR A;  3NH2 A;  2E2P A;  3AVI A;  3ZSW A;  2UXC K;  2F96 A;  3A5L C;  3NF9 A;  3KLG A;  3HM9 A;  4CGH A;  3CYM A;  4CF1 A;  5JVG L;  2OTJ N;  4E1N A;  4GKJ K;  3QLH A;  5KRS A;  3ASM A;  4CJ3 A;  1C0T A;  4M63 C;  2KHO A;  3AO2 A;  3MCA B;  4FJX A;  1EO1 A;  1V4S A;  5GIN A;  3SQ0 A;  4AM6 A;  3ITH A;  3VQB A;  4DTU A;  4FJH A;  3PX0 A;  4KI6 A;  1XHX A;  3I8B A;  3OYI A;  1IO2 A;  2Y1I A;  4IFY A;  2GTD A;  5AQP A;  3LP1 A;  4CGI A;  4RWT A;  1NGI A;  2G8H A;  3PO5 A;  5JVH L;  2V7Y A;  4DFK A;  4DF8 A;  4O0I A;  4PUO A;  2HB5 A;  3SBG A;  2NRR A;  1VQ8 N;  3KHY A;  4CJ5 A;  1NU0 A;  1FW6 A;  2OZS A;  2E1Y A;  5SWM A;  1RNH A;  3BP8 A;  4BR9 A;  5TKW A;  2HBK A;  4JKH A;  1HNZ K;  4K43 A;  4EHT A;  3QB0 A;  1QQO A;  3Q7C A;  4JKE A;  5E84 A;  1P8Z A;  2CH6 A;  1QHA A;  2HNZ A;  3L3U A;  3DLL L;  4CFB A;  2VWJ A;  4O44 A;  3L2V A;  1Q7Y O;  1N34 K;  1QHT A;  4N41 A;  4E3S A;  3VA3 A;  3C6H A;  1KAY A;  3TR8 A;  1E4F T;  3P83 D;  2A41 A;  4IG0 A;  3AO5 A;  1T03 A;  3U3Y A;  3GDQ A;  4AHU A;  1GLF O;  2CGL A;  5JS1 A;  1TK0 A;  3WXM B;  4E89 A;  4H0P A;  4A2A A;  1EET A;  4MDA A;  3HSC A;  4FVM A;  1OH7 A;  4JV5 K;  1RT2 A;  2ITG A;  2F4V K;  2KQ2 A;  2QKK A;  4JKG A;  1NGC A;  3GE1 A;  3NVM A;  4DFJ A;  1D8Y A;  2ETJ A;  3ZT1 A;  4EZ6 A;  3T19 A;  1TV6 A;  1N6Q A;  4NLB A;  3ZET A;  5EXW A;  4KFB A;  5CZ1 A;  4BWJ A;  4Z4C A;  2A6A A;  1WSF A;  4YHH K;  3FZF A;  3OYA A;  1T6D A;  2OPS A;  4UQG A;  3CMA N;  4BWM A;  5KRT A;  4GMJ B;  4KB1 A;  2E88 A;  4FJL A;  2BAN A;  2NZT A;  3O4W A;  1TKZ A;  3F2K A;  2KFZ A;  1DT9 A;  4DB3 A;  3T1A A;  2D1K A;  4O55 A;  2NRT A;  1VQM N;  1KAX A;  3UKU A;  4JK8 A;  2PZS A;  3AV9 A;  3KK3 A;  2F8T A;  2IGI A;  2WC9 A;  2YV0 X;  3RVC A;  2QWO A;  4BY9 C;  4C8O A;  4ISE A;  4WQ5 A;  3AVA A;  5C10 A;  5CY4 A;  3OJU A;  1WLJ A;  3MXM A;  3KWI A;  3MED A;  1Y97 A;  3N4P A;  3A0I X;  1RT4 A;  5GAE P;  4ELV A;  4H03 B;  1NK8 A;  1U6Z A;  4BRM A;  4O5B A;  5M1O A;  1XC9 A;  3TWH A;  4JHD B;  3TAQ A;  4B9T A;  4B1W B;  3JSM A;  4CZE A;  4NXN K;  5AQT A;  4HVJ A;  1UA1 A;  4BC5 A;  1S9G A;  4A57 A;  4JKB A;  5LJV A;  4JRQ A;  3KWG A;  3LP0 A;  4FWR A;  1IH7 A;  4IZ9 A;  4U7B A;  2F7T A;  4DV6 K;  4OJR A;  1KRP A;  5FRO A;  4B9L A;  4GV3 A;  1ASW A;  3P39 A;  4KRE A;  1WSI A;  4IBN A;  3ZT4 A;  3HPH A;  1VSM A;  2HHU A;  3S3O A;  2OPQ A;  2ZF5 O;  1X9M A;  4BRG A;  1ZBU A;  1VSH A;  2D0P A;  5F2R A;  2FBV A;  4NCG A;  5HRN A;  1KCF A;  3RTV A;  4JI1 K;  1T7P A;  1HPZ A;  3KIO A;  3AVH A;  4DR2 K;  1Q9Y A;  1VHX A;  1BO5 O;  3K58 A;  3G25 A;  3SMS A;  1QSY A;  4DSL A;  4AIL C;  1IV0 A;  3V9X A;  3I33 A;  3JAM O;  1QSS A;  4BG9 A;  4Z4H A;  4KPY A;  2D0O A;  5LJW A;  4OLB A;  4FWS A;  1LCU A;  3CM5 A;  4IJN A;  2RN2 A;  1HMV A;  1LAV A;  1D5A A;  2YJF A;  5GIP A;  2OAN A;  2YHY A;  3ZSV A;  1NK7 A;  1TK8 A;  2P9S B;  4BDZ A;  1D4X A;  5GIO A;  1TKD A;  4LF7 K;  4B1X B;  3AVF A;  5BR8 K;  2O8D A;  5CE3 A;  1SQK A;  3O9U A;  3OYK A;  2FXU A;  5CHI A;  2D0C A;  4M3T A;  1WNS A;  3O3H A;  4YNQ A;  2O8B B;  5CYQ A;  4DR7 K;  3CCM N;  2O8E B;  1KTQ A;  4CEZ A;  4W5R A;  3H1V X;  1TVR A;  3HVR A;  4CIE A;  5M1P A;  3L2Q A;  5FPE A;  1SL1 A;  1JLB A;  2OPP A;  1XNR K;  4WQ5 C;  4CEC A;  1BCO A;  4C8L A;  3QEX A;  1SKW A;  3M6G A;  2GV9 A;  2HVI A;  3LM2 A;  4MLH A;  1Z26 A;  5FPD A;  4LC9 B;  3DLG A;  3E9O A;  4JI2 K;  4BRA A;  4CZG A;  1WOQ A;  2KFN A;  3FZK A;  4IO8 A;  3UB5 A;  1EWR A;  4IDH A;  3SMP A;  3JYT A;  4OLA A;  1U47 A;  4CJE A;  3ZT3 A;  4FLZ A;  4AQY K;  4JI7 K;  3VGM A;  4KO0 A;  4CHQ A;  5AQK A;  4JRP A;  4CD3 A;  2ZGY A;  5HRO A;  2WOM A;  1HYV A;  2O4I A;  2YNF A;  1G15 A;  3THW A;  2FBT A;  4E7H A;  1C1B A;  1TKT A;  2YHA A;  4CVN E;  5BR9 A;  1Y64 A;  4F3T A;  4BRP A;  3C6T A;  1IBK K;  3QIN A;  4CK2 A;  1ZBF A;  3J8A A;  1O13 A;  4B1U B;  1TL3 A;  5DMR A;  4AHS A;  3AVL A;  2H3G X;  3C7N A;  3TAN A;  3MEE A;  4HCC A;  1GOA A;  1JCE A;  1T44 A;  4CIG A;  3ZYY X;  3TAR A;  3MDQ A;  4NB4 A;  4FJK A;  1VSI A;  1R0A A;  3RMA A;  1X9S A;  3THV A;  1EKE A;  3ZLJ A;  1CZ9 A;  2HHW A;  3EN9 A;  3QER A;  3SJH A;  1B9D A;  5KQ8 A;  3A5N C;  1NOY A;  3TSP A;  3QEP A;  3AGK A;  4FJ8 A;  3QIC A;  3OYB A;  4PKH A;  1TYQ B;  3KTQ A;  5KTQ A;  5KGW A;  5BN9 A;  1RFQ A;  4Z4I A;  2A42 A;  3QO9 A;  4M3X A;  1QQN A;  4AHT A;  3E01 A;  2P51 A;  3KK1 A;  2YHW A;  3SQ4 A;  1ZXO A;  3DRS A;  4Z4E A;  3NCI A;  2FSK A;  3CQ8 A;  2P9I A;  3CC2 N;  3WQT A;  2Q0U A;  4H5R A;  3G4S N;  1D9D A;  4HTL A;  4L3Q A;  3PV8 A;  4K0K K;  3I0R A;  1KVA A;  3FE1 A;  4B9U A;  4NCB A;  5BRE A;  4DU4 A;  4BVP A;  4JI8 K;  2WUS A;  3OJS A;  3ATV A;  4LFC K;  1WBD A;  3ZX0 A;  3THX B;  4OPA A;  2P9P A;  4CJT A;  4ISG A;  1EXQ A;  3RWU A;  3TAG A;  3H3N O;  4CJS A;  4CZK A;  1B9F A;  4PL7 A;  3UE5 A;  2JWL A;  1S22 A;  3QNN A;  4PKG A;  2QWP A;  3VQ6 A;  4KHY A;  3DRP A;  3SBT A;  3I55 N;  4O4G A;  3SUN A;  4L8R B;  4CD1 A;  1IBM K;  2QXL A;  3NGY A;  3TPQ A;  1WSH A;  1NJX A;  2QKB A;  3SPY A;  5BRF A;  3JS6 A;  1QZ6 A;  5DM6 L;  3M8R A;  1JLC A;  4E7K A;  1QZ5 A;  3KLI A;  2UU9 K;  3HK2 A;  4Z94 A;  2HBJ A;  5C15 A;  4NXM K;  2WBN A;  4DR6 K;  3VF6 A;  4Q0B A;  3QFU A;  4KV8 A;  2ZJQ L;  5HBM A;  4E19 A;  1R59 O;  3QNO A;  4BRF A;  3VQ5 A;  2X74 A;  2HHS A;  4IXC A;  4BQL A;  4FXD A;  4A2B A;  1A5X A;  5C24 A;  2ASM A;  3IUC A;  2EX3 A;  5AZI B;  2P9U A;  3LDQ A;  3J7Y P;  1L3T A;  3P31 A;  1XUP O;  2Q31 A;  2D4W A;  5B8H A;  3HVT A;  4JKG B;  1NKE A;  2E2O A;  2HBM A;  3LAN A;  2HF3 A;  3QIO A;  3OYN A;  3DLK A;  3HPO A;  3VQA A;  5A2Q O;  3SI6 A;  1NM1 A;  2JWK A;  4CGJ A;  3GG4 A;  1BA1 A;  4OKK A;  2Q0R A;  3LWM A;  4N5S A;  1TAQ A;  4GW6 A;  3MN6 A;  4E7I A;  3VES A;  3K9J A;  4A59 A;  4BRI A;  1YF5 L;  5AQI A;  1YUW A;  1XHZ A;  2NRX A;  2B4J A;  3CJ1 A;  4M7X A;  3ENB A;  2NUB A;  1XI1 A;  1S3X A;  4CEO A;  4YFU A;  3BY5 A;  4OVL A;  1JLQ A;  4TSX A;  3QET A;  1NJI O;  4Y1D A;  3VOV A;  3M3Z A;  2HF4 A;  2HHV A;  3HL8 A;  3TSU A;  1VRU A;  3IRX A;  3U9Z A;  3UKU B;  4MO5 A;  5M1K A;  4DV7 K;  1JXE A;  4DQS A;  1VQN N;  1LV5 A;  3L2U A;  3DXM B;  3VER A;  4B1V A;  2QEX N;  2BGG A;  4EHU A;  4DV3 K;  2QK9 A;  4B1Z A;  3CJ9 A;  2ZJP L;  3CG7 A;  4FZZ A;  1ZBL A;  3L8B A;  4BRL A;  4JI5 K;  4XH4 A;  4DTM A;  2NRZ A;  3VEZ A;  1VAZ A;  5FPM A;  3OW2 M;  4LFA K;  1U2V A;  4FWM A;  1Q8I A;  4CE9 A;  3LWL A;  2VQF K;  1VQP N;  3MWP A;  4KI4 A;  3E9L A;  3VQC A;  3VET A;  5I9E B;  4OKE A;  4Y0W A;  3TI0 A;  4NLC A;  2V51 B;  4BE0 A;  3P5J A;  5LL6 Z;  3VQP A;  1M90 O;  4KH4 A;  1WSJ A;  3SAF A;  4MO4 A;  1SUQ A;  4ILH A;  4YOT A;  4H0O A;  4DU3 A;  3I56 N;  4DTJ A;  3O5B A;  4DV2 K;  2YHB A;  3QEI A;  3TTC A;  3CCQ N;  4KHQ A;  3MN9 A;  2P9K A;  3VQ7 A;  3R9P A;  5J2Q A;  1RBU A;  3LDL A;  3QES A;  1N8R O;  1NKB A;  5HL7 L;  3AVN A;  1IKX A;  3FFK B;  1ZC6 A;  2HHH K;  4AHC A;  1X9W A;  2RE2 A;  4B9V A;  2DFE A;  4V19 S;  2HHX A;  4W5N A;  3CCJ N;  1VSK A;  3CF5 L;  3AAQ A;  4BE2 A;  1RDA A;  1RT7 A;  1JL2 A;  3T1Y K;  2Q3S A;  4O5F A;  4JKC A;  1S6P A;  3VTI A;  3U9D A;  1IBL K;  3LM9 A;  3K5O A;  1LW0 A;  4FK2 A;  2ZD1 A;  3O9Q A;  2IAJ A;  1LW2 A;  1TYQ A;  2HVH A;  3THY A;  4BGA A;  2RKI A;  3WXI A;  1BGX T;  4QS8 A;  1J9A A;  4KRF A;  3L4I A;  2O8D B;  4CES A;  1OVQ A;  1JLG A;  1UA0 A;  1K6Y A;  3OY9 A;  1GOB A;  4DTN A;  4DV0 K;  3EZW A;  3NH1 A;  3CCL N;  1HQE A;  2XY7 A;  4LD0 A;  2BH1 A;  3E66 A;  3FGU A;  2NLX A;  1WUA A;  4Z4F A;  3THX A;  3EKU A;  1W2B M;  5C42 A;  4RW6 A;  4J2A A;  4DR3 K;  1SL0 A;  3G0Z A;  2VWK A;  2IVP A;  4CZJ A;  2J4R A;  4I9Q A;  3QDK A;  5FPN A;  4LH4 A;  5AQS A;  1NNE A;  3SV3 A;  1BUP A;  2PY5 A;  3SV4 A;  3ZT2 A;  4LSL A;  3SUO A;  2ZWH A;  3MX2 A;  4CK1 A;  1NGF A;  4CF2 A;  4B9N A;  2VQE K;  4WF9 L;  2FSN A;  1BWF O;  2Q97 A;  3PSF A;  1JJ2 M;  4RTF D;  4CF9 A;  4BC3 A;  1T8E A;  2ZE2 A;  5BPM A;  1YXQ A;  3W3D A;  3THW B;  1SAZ A;  4R79 A;  1VQ5 N;  3MWT A;  1A5W A;  1XC3 A;  1D9F A;  3H1Q A;  1WAF A;  5BRH A;  4JI6 K;  4QAG A;  1N36 K;  3ENO A;  4DR4 K;  3BGR A;  3C7N B;  5AZI A;  3NBP A;  4CF0 A;  4FPA A;  4KH6 A;  2HHQ A;  5M1N A;  2WFB A;  3T3F A;  1I39 A;  1I3A A;  3TTD A;  3SAG A;  2YJE A;  2E5L K;  2G8I A;  3NE6 A;  1NMD A;  3ZCM A;  4M3W A;  5AQM A;  5T7B A;  3SJJ A;  2VCP A;  4QS7 A;  3NGZ A;  3DWL A;  4BC4 A;  3IKM A;  4LFB K;  1HUX A;  3HT3 A;  1BA0 A;  1VQ7 N;  3EE8 A;  2HHT A;  3LDP A;  4JKA A;  4K42 A;  4BR5 A;  4OKJ A;  3D6R A;  3S3M A;  3KK2 A;  5FRN A;  4E7L A;  3O6W A;  4ZTJ A;  1NG9 A;  3SNN A;  3I0S A;  2P9I B;  3WNE A;  4BR7 A;  4KHP K;  3V9Z A;  1Q18 A;  3I8D A;  1GLL O;  5F1X A;  4B3R K;  3O3F A;  2W6K A;  3WNF A;  3DXM A;  4GV9 A;  4DQQ A;  3HJF A;  1NGA A;  3O9R A;  1T3V A;  3PLA A;  4X66 K;  2P9P B;  4BDP A;  3V6D A;  1OH5 A;  4KHN A;  1VSE A;  2B6A A;  2E8A A;  4HUF A;  3HST B;  4IJA A;  4FJ7 A;  5DM7 L;  1C1C A;  3TSQ A;  4N47 A;  3U3G A;  4BGB A;  1RBV A;  3ZSY A;  2B5J A;  3MK6 A;  1KAZ A;  1KFS A;  2NRH A;  4O8U A;  4WE1 A;  4BRE A;  3C6U A;  2VWB A;  3DMJ A;  5J2M A;  2X78 A;  2YNI A;  4YOX A;  5LMU K;  2OTL N;  2F9T A;  4CHO A;  2PFU A;  4IOC L;  3ZSO A;  2IC3 A;  1U49 A;  3Q7B A;  1BU6 O;  1LOT B;  1FKP A;  4I2P A;  1KLM A;  5M1Q A;  4B9S A;  1YJ9 N;  1VQO N;  4BVO A;  1J5E K;  3OS2 A;  1RT1 A;  5FDL A;  5GAH P;  4JS5 A;  3OTO K;  3SCX A;  5EY4 A;  4FPB A;  5I3U A;  3A2F A;  3K2P A;  4DSK A;  1S72 N;  2P9U B;  1MDU B;  3J81 O;  4DWI A;  3WQU A;  2P9L A;  4JKF A;  4KHS A;  4IG3 A;  1NK0 A;  3AA5 X;  3FFI A;  4IOX A;  4M41 A;  4I2Q A;  3E1Y A;  4OGC A;  4CBW A;  3H45 C;  1IKV A;  3VPZ A;  1K8K A;  1KVB A;  4B3T K;  4DTO A;  3ENH A;  4YDU A;  4DF4 A;  4RCH A;  5C2D A;  3ATU A;  4RW8 A;  4PHT X;  3WNG A;  2A1S A;  1BDG A;  2NRW A;  1J5O A;  2VG6 A;  2IIR A;  3HZ6 A;  3L3V A;  1O1W A;  1RTJ A;  4DQI A;  4FM1 A;  3O9T A;  4C1N I;  2OZM A;  4DHY A;  4IFE A;  1KQS M;  2XY5 A;  2V52 B;  5ADX A;  1GLE G;  4CGG A;  5LY3 A;  4HHT A;  4OGE A;  3CME N;  1HNV A;  2CGK A;  4K25 A;  5J2P A;  4FJN A;  2IVO A;  4AHR A;  3M8P A;  4CK3 A;  4WFB L;  1QVG M;  3UKR A;  3HP6 A;  5FRM A;  3HP9 A;  1ASV A;  2PAV A;  1LAW A;  3KKR A; 
#chains in the Genus database with same CATH homology
 3OYD A;  3M8R A;  1JLC A;  3DM2 A;  4E7K A;  2EHG A;  4FCY A;  1U48 A;  3KLI A;  3HK2 A;  2FBY A;  4HTU A;  3VQD A;  1BI4 A;  4ZHR A;  3MEG A;  4O0J A;  3PY8 A;  4KTQ A;  4Q0B A;  2VG7 A;  4BE1 A;  4KV8 A;  4NYN A;  3OYH A;  1RTD A;  1QQC A;  2HMI A;  2D0B A;  1S1W A;  5DK5 A;  3H08 A;  5HBM A;  4CJU A;  4FJM A;  4E19 A;  2QXF A;  1RBR A;  4DSI A;  2OYQ A;  4B9M A;  1L3V A;  3QNO A;  3VQQ A;  3RR7 A;  4DSF A;  5HRS A;  1BIS A;  3OYJ A;  3DLB A;  3VQ5 A;  4EZ9 A;  2X74 A;  2HHS A;  4M3U A;  2P5O A;  1HQU A;  4FXD A;  1A5X A;  2D5R A;  1C0M A;  5EU7 A;  5C24 A;  4CEQ A;  2OPR A;  4RW4 A;  3NH2 A;  4DLE A;  3AVI A;  3ZSW A;  2OA8 A;  3BDP A;  3RR8 A;  1FK9 A;  2F96 A;  2EX3 A;  4K8X A;  3NF9 A;  4CHN A;  3KLG A;  3HM9 A;  3VQ4 A;  4CGH A;  4KAZ A;  4KHW A;  1L3T A;  1BL3 A;  3CYM A;  5HP1 A;  4CF1 A;  1VSF A;  3LAL A;  4E1N A;  3QLH A;  2KW4 A;  3HVT A;  5KRS A;  1NKE A;  3ASM A;  3LAN A;  1UOC A;  3MXJ A;  3QIO A;  3OYN A;  3DLK A;  3HPO A;  3VQA A;  4CJ3 A;  3SI6 A;  4M3Z A;  2YKM A;  1C0T A;  2G8W A;  4IFV A;  3AO2 A;  3AO1 A;  4FJX A;  1BCM A;  3V1O A;  4CGJ A;  4OKK A;  1YVU A;  3LWM A;  3SQ0 A;  4N5S A;  1TAQ A;  4GW6 A;  1SKR A;  4E7I A;  1JXB A;  3ITH A;  4ID1 A;  3VQB A;  4N56 A;  4DTU A;  3PX0 A;  3RMB A;  4FJH A;  4KI6 A;  1XHX A;  3OYI A;  1IO2 A;  1MU2 A;  2W42 A;  1XHZ A;  4J2B A;  2Y1I A;  4IFY A;  3K5N A;  2B4J A;  1UAX A;  1S5J A;  2Z1G A;  3LP1 A;  4CGI A;  1N5Y A;  3AVB A;  2G8H A;  3PO5 A;  2IOC A;  3V81 A;  4CEA A;  4DFK A;  2NUB A;  1C1A A;  4O0I A;  4HUG A;  4DF8 A;  1XI1 A;  3O4N A;  4CEO A;  4PUO A;  4YFU A;  4OVL A;  1JLQ A;  2HB5 A;  4TSX A;  3VN5 A;  1TK5 A;  3QET A;  2IDO A;  2WON A;  4Y1D A;  2PYL A;  4FW2 A;  4CJ5 A;  2HHV A;  3HL8 A;  4CJ4 A;  2DFH A;  1VRU A;  3IRX A;  2OZS A;  1TKX A;  1NK6 A;  1JXE A;  4DQS A;  5SWM A;  1RNH A;  1LV5 A;  4RG8 A;  3L2U A;  2KTQ A;  2BDP A;  3PUF A;  3ALY A;  4FM0 A;  2BGG A;  1WAJ A;  2QK9 A;  3CFP A;  4F3O A;  4DLG A;  3RRH A;  3U6F A;  3CG7 A;  4FZZ A;  4QCL A;  1ZBL A;  3L8B A;  2X6N A;  2HNZ A;  3DOL A;  4DTM A;  3L3U A;  4Z4G A;  4CFB A;  1ZBH A;  2VWJ A;  4O44 A;  3NH0 A;  3L2V A;  4H4M A;  1U45 A;  3V9S A;  1SKS A;  1QHT A;  4N41 A;  4E3S A;  4FJJ A;  3VA3 A;  1Q8I A;  4CE9 A;  3LWL A;  2G8F A;  3ZT0 A;  4KI4 A;  3F9K A;  3TR8 A;  4OPJ A;  1LWF A;  3P83 D;  3VQC A;  3ZSQ A;  1UWB A;  4IG0 A;  3AO5 A;  4OKE A;  1JL1 A;  3HPG A;  4CJK A;  3TI0 A;  1T03 A;  3OS1 A;  4DS5 A;  4R5P A;  1NK9 A;  4BE0 A;  3U3Y A;  2E6M A;  3P5J A;  3VQP A;  1KVC A;  2Z1J A;  1FXX A;  4AHU A;  4F8R A;  2XRI A;  1WSJ A;  3QEV A;  4GVM A;  4E7J A;  1RCH A;  1SUQ A;  4I9L A;  5JS1 A;  1TK0 A;  4DU3 A;  4B8C A;  2ZQB A;  1T05 A;  4Z0U A;  4E89 A;  4DTJ A;  4F4K A;  3EYZ A;  4FJI A;  2YHB A;  3QEI A;  4CHZ A;  1EET A;  1QSL A;  4KHQ A;  4FVM A;  1HYS A;  1RT2 A;  4LY7 A;  2ITG A;  3L2W A;  2KQ2 A;  3VQ7 A;  2QKK A;  3VQ9 A;  4CHP A;  2HND A;  5J2Q A;  1RBU A;  4CCH A;  2P5G A;  5J2N A;  1BHL A;  4DFJ A;  2ETJ A;  3ZT1 A;  1D8Y A;  3AVJ A;  3QES A;  3V9U A;  3T19 A;  4EZ6 A;  4IKF A;  4I7F A;  1TV6 A;  1NKB A;  3QIP A;  3S3N A;  1N6Q A;  5D3G A;  3AVN A;  1IKX A;  4H8K A;  3L2R A;  4FLT A;  1L3S A;  4IDK A;  4KFB A;  4AHC A;  4CF8 A;  5CZ1 A;  1F21 A;  1X9W A;  4BWJ A;  4AHV A;  4Z4C A;  3VA0 A;  4B9V A;  2DFE A;  1WSF A;  4KTW A;  1WN7 A;  2HHX A;  4W5N A;  1JLE A;  3OYA A;  4M45 A;  2OPS A;  1CZB A;  4OPK A;  4UQG A;  1VSK A;  4BWM A;  5KRT A;  1XWL A;  4GMJ B;  4BE2 A;  4KB1 A;  1RDA A;  1VSL A;  4FJL A;  1RT7 A;  3DLE A;  2BAN A;  4H4O A;  4PA1 A;  1JL2 A;  2ATQ A;  1TKZ A;  4B08 A;  2Q3S A;  3V1Q A;  3MXI A;  3KLH A;  3D45 A;  1S6P A;  4NYF A;  4CJV A;  2KFZ A;  3T1A A;  4FK4 A;  5I42 A;  4O55 A;  3K5O A;  4Y1C A;  1S1T A;  3VQE A;  1LW0 A;  3V1R A;  3OYM A;  2PZS A;  4FK2 A;  2ZD1 A;  3AV9 A;  2IAJ A;  3KK3 A;  3ULD A;  2PYJ A;  2F8T A;  2YNH A;  1LW2 A;  2IGI A;  2YV0 X;  4C8O A;  3ZSR A;  2RPI A;  3PO4 A;  3AVA A;  2HVH A;  1BQM A;  5CY4 A;  2O4G A;  3OJU A;  1WLJ A;  3MXM A;  2RKI A;  1NJY A;  1GOC A;  3MED A;  1Y97 A;  4DTS A;  3QEW A;  1BGX T;  3KD5 E;  2F8S A;  2HW3 A;  1J9A A;  3SZ2 A;  4KRF A;  1RT4 A;  4ELV A;  1IKY A;  1CXU A;  4KHU A;  4CES A;  1J53 A;  1JLG A;  1BIZ A;  3CFO A;  3LAM A;  1QS4 A;  4CIF A;  1K6Y A;  3OYC A;  3PX6 A;  1UA0 A;  1NK8 A;  4PWD A;  4O5B A;  1XC9 A;  3OY9 A;  3TWH A;  1GOB A;  3OYG A;  4DTN A;  3UIQ A;  3PX4 A;  1TL1 A;  1W0H A;  3TAQ A;  3NH1 A;  3RRG A;  1S1V A;  4B9T A;  3LP3 A;  1HQE A;  2XY7 A;  1RDC A;  3JSM A;  1HRH A;  1S1X A;  4JLH A;  4LD0 A;  2QKB A;  4FLV A;  4CJP A;  4HVJ A;  1UA1 A;  1B92 A;  3AA3 A;  2Z1H A;  1S9G A;  4FLW A;  3TAB A;  4Z4F A;  4LH5 A;  4F2R A;  5C42 A;  4JRQ A;  2D0A A;  4RW6 A;  4HCB A;  3HXM A;  4J2A A;  3DYA A;  3B6O A;  3P1G A;  3LP0 A;  3C94 A;  1SL0 A;  1HNI A;  2XY8 A;  1ASU A;  1IH7 A;  3G0Z A;  2VWK A;  1ZBI A;  4ELT A;  1U4B A;  5KGX A;  4DG1 A;  4I9Q A;  3AVM A;  4OJR A;  3SUQ A;  1KRP A;  5FRO A;  5JS2 A;  4CHY A;  4B9L A;  1ASW A;  2FBX A;  5SZT A;  4LH4 A;  1VK0 A;  4CJQ A;  4DFM A;  4KRE A;  1WSI A;  1DTQ A;  3SV3 A;  4IBN A;  3ZT4 A;  2PY5 A;  1FKO A;  3HPH A;  4EP4 A;  5C25 A;  3SV4 A;  2RF2 A;  3ZT2 A;  4DSJ A;  4LSL A;  3SUO A;  1VSM A;  2KZZ A;  4AH9 A;  4DTX A;  5FRN A;  4FLY A;  2HHU A;  1CLQ A;  3S3O A;  4DS4 A;  4M3R A;  3NGI A;  2OPQ A;  1C6V A;  4CK1 A;  1NJZ A;  1X9M A;  4CF2 A;  3TAP A;  4B9N A;  2R7Y A;  3AO3 A;  1ZBU A;  3K59 A;  1VSH A;  5CYM A;  1JLF A;  3KLE A;  3K5L A;  2FBV A;  4NCG A;  1CXQ A;  3LPU A;  5HRN A;  2JGU A;  3LZJ A;  3IAY A;  3G10 A;  1KCF A;  1JKH A;  4HUE A;  3RTV A;  4CF9 A;  1T8E A;  1HPZ A;  2ZE2 A;  3KIO A;  4CEE A;  4DFP A;  1T7P A;  1EX4 A;  3AVH A;  2I5J A;  3NAE A;  1Q9Y A;  4B3O A;  4FJ5 A;  4F2S A;  3K58 A;  3AA4 A;  1NK5 A;  4CJR A;  1QSY A;  4DSL A;  3DRR A;  1A5W A;  1D9F A;  4AIL C;  1BIU A;  3V9X A;  1WAF A;  3S9H A;  4QOZ B;  1QSS A;  4CJW A;  3DLR A;  4QAG A;  3K5M A;  4LSN A;  4Z4H A;  1Q9X A;  4KPY A;  4CJL A;  4DU1 A;  4C8N A;  4OLB A;  3CM5 A;  2RN2 A;  3BGR A;  1HMV A;  4DSE A;  1LAV A;  3NDK A;  3AVK A;  1D5A A;  3AVG A;  3NBP A;  4CF0 A;  3SQ1 A;  3ZSV A;  2HHQ A;  1WSE A;  1NK7 A;  1TK8 A;  2E4L A;  3CFR A;  4BDZ A;  3T3F A;  1NKC A;  3O3G A;  4CER A;  1TKD A;  1I39 A;  1I3A A;  4MFB A;  1Z25 A;  4DMN A;  4JS4 A;  3AA2 A;  5J1E A;  1ITG A;  2G8I A;  3NE6 A;  3ZCM A;  4M3W A;  4ICL A;  3AVF A;  3RMD A;  4CJF A;  5T7B A;  3SJJ A;  3NGZ A;  4FLU A;  4KKO A;  4W5Q A;  4E1M A;  3OYK A;  2GUI A;  1YTA A;  2YKN A;  3D0P A;  3HT3 A;  1KLN A;  4FLX A;  3B6P A;  3AVC A;  2D0C A;  4M3T A;  1WNS A;  3O3H A;  2HHT A;  4YNQ A;  1IG9 A;  5CYQ A;  2DY4 A;  4DQP A;  1QE1 A;  1KTQ A;  4OKJ A;  4CEF A;  4CEZ A;  4W5R A;  4W5O A;  1TVR A;  3HVR A;  4C8M A;  4CIE A;  3S3M A;  3L2Q A;  3KK2 A;  1SL1 A;  1JLB A;  2OPP A;  4J2E A;  4G1Q A;  2X6S A;  1VRT A;  3WNH A;  3ZSZ A;  4E7L A;  4ZTJ A;  4ELU A;  4M42 A;  1C0U A;  3SNN A;  4CEC A;  1RTH A;  1BCO A;  2P1J A;  4C8L A;  1TAU A;  3I0S A;  1DLO A;  1HYZ A;  3QEX A;  3WNE A;  1SV5 A;  1SKW A;  3ZSX A;  2GV9 A;  4Q5V A;  3O4Q A;  4XIU A;  2HVI A;  3V9Z A;  1Z26 A;  1IKW A;  3I8D A;  3LZI A;  3O3F A;  3DLG A;  3WNF A;  1SL2 A;  4C8K A;  2AJQ A;  4KB0 A;  4DQQ A;  3HJF A;  3SPZ A;  3OVN A;  1L3U A;  2KFN A;  1DTT A;  2XO7 A;  2LSN A;  4CFA A;  4BDP A;  3V6D A;  1HJR A;  3TAF A;  3JYT A;  1KSP A;  4KHN A;  4OLA A;  4J2D A;  3EY1 A;  1VSE A;  4RW7 A;  3ZT3 A;  1LAW A;  2B6A A;  4FW1 A;  4CJE A;  4FLZ A;  1U47 A;  2IS3 A;  1REV A;  4E0D A;  4FK0 A;  4HUF A;  3AO4 A;  4CHQ A;  4KO0 A;  2FC0 A;  3HST B;  4JRP A;  4FJ7 A;  3NFA A;  1C1C A;  1RT3 A;  4N47 A;  1W9H A;  3U3G A;  5HRO A;  1RBV A;  2WOM A;  1HYV A;  2B5J A;  3ZSY A;  5E41 A;  2O4I A;  2YNF A;  1G15 A;  1KFS A;  4NCA A;  2FBT A;  2VG5 A;  4E7H A;  3KLF A;  2XY6 A;  1C1B A;  4WE1 A;  1TKT A;  2YHA A;  1EP4 A;  1L5U A;  4F3T A;  2DTU A;  3C95 A;  3C6T A;  4ID5 A;  3C6U A;  3QIN A;  3DMJ A;  1ZBF A;  2X78 A;  3LP2 A;  4CK2 A;  5J2M A;  2YNI A;  3OYL A;  1RTI A;  4B8A B;  3NF6 A;  4FJG A;  1TL3 A;  1BI4 B;  3MEC A;  4CHO A;  3F73 A;  5DMR A;  4AHS A;  3V4I A;  4FJ9 A;  3AVL A;  1VSJ A;  2DFF A;  3ZSO A;  5HRP A;  2IC3 A;  3KJV A;  3MAQ A;  3RMC A;  3TAN A;  1U49 A;  3HO1 A;  3MEE A;  4HCC A;  1GOA A;  4DQR A;  4FM2 A;  1FKP A;  4I2P A;  1KLM A;  3IG1 A;  4MQ3 A;  4CIG A;  4B9S A;  3TAR A;  3TAE A;  4CFC A;  4FJK A;  1A5V A;  1VSI A;  2GBZ A;  1J54 A;  3RMA A;  1R0A A;  1X9S A;  3THV A;  1EKE A;  1LWE A;  1CZ9 A;  4DTP A;  4PY5 A;  2A1R A;  2HHW A;  2KZM A;  3OYE A;  1NK4 A;  3OS2 A;  3QER A;  3EZ5 A;  1RT1 A;  3DOK A;  5FDL A;  4JS5 A;  4K8Z A;  1B9D A;  3M8S A;  3SCX A;  1NOY A;  3ISN C;  5HLF A;  5I3U A;  1NJW A;  3QEP A;  1TGO A;  3A2F A;  3K2P A;  1RIL A;  3TAM A;  4DSK A;  1X1P A;  5K14 A;  4RW9 A;  4FJ8 A;  4DWI A;  3OYB A;  3KTQ A;  3SYZ A;  5KTQ A;  1RT6 A;  5KGW A;  3VQ8 A;  4KHS A;  2Z1I A;  4Z4I A;  3KD1 E;  3QO9 A;  4M3X A;  4IG3 A;  1NK0 A;  3AA5 X;  3FFI A;  4M41 A;  4I2Q A;  4AHT A;  3E01 A;  2P51 A;  3KK1 A;  3NHG A;  4DTR A;  3V9W A;  3NF7 A;  3SQ4 A;  3DRS A;  4OGC A;  1LWC A;  5KI6 A;  1S6Q A;  3NCI A;  1RT5 A;  4CFD A;  4CGF A;  4Z4E A;  3CQ8 A;  4BDY A;  1IKV A;  2XHB A;  1RBT A;  3OYF A;  1YT3 A;  1KVB A;  4W5T A;  3OS0 A;  2Y1J A;  3LDS A;  1D9D A;  1U04 A;  4FZX C;  1YTU A;  4DTO A;  3PV8 A;  4DF4 A;  3DLH A;  3I0R A;  1WSG A;  1KVA A;  2YNG A;  3LPT A;  3M8Q A;  2G8U A;  4B9U A;  4NCB A;  4DU4 A;  4RW8 A;  2E6L A;  1RBS A;  3WNG A;  2A1S A;  3SUP A;  1J5O A;  4M3Y A;  4EP5 A;  4CEB A;  3OJS A;  4PQU A;  1NOZ A;  1JLA A;  2VG6 A;  4CED A;  3L3V A;  1O1W A;  4KTZ A;  3NF8 A;  1RTJ A;  5CZ2 A;  1S1U A;  4CJT A;  4BAC A;  4FM1 A;  1ZYQ A;  4DQI A;  5HRR A;  1EXQ A;  3RWU A;  2OZM A;  3DI6 A;  3TAG A;  4FYD A;  2XY5 A;  4CJS A;  3K57 A;  3SQ2 A;  4CGG A;  1B9F A;  1BQN A;  1RDB A;  2BE2 A;  4OGE A;  4CGD A;  4HHT A;  4ZTF A;  1QTM A;  1HNV A;  3HYF A;  3LAK A;  4FZY A;  3QNN A;  4KHY A;  3VQ6 A;  1VSD A;  3DRP A;  5J2P A;  1S9E A;  4O4G A;  3CM6 A;  2HNY A;  3SUN A;  2G8K A;  4AHR A;  4CK3 A;  3M8P A;  2G8V A;  4L8R B;  4FJN A;  4N76 A;  3NGY A;  3HP6 A;  5FRM A;  3HP9 A;  1ASV A;  2JLE A;  1KFD A;  3KKS A;  1WSH A;  1NJX A;  3IS9 A;  3SPY A;  1RDD A;  3KKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...