3ZSYA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsyA00
3VQ4A 2VWKA 3AVKA 1D5AA 1C1CA 4W5NA 1WSJA 1U47A 4GMJB 2FBVA 4CIGA 1BQMA 3O4QA 4FJGA 3VQ8A 5FDLA 4O0IA 4FYDA 1DTQA 1HNVA 2XRIA 4RG8A 4DS5A 4L8RB 3NGIA 4F3TA 3V4IA 1TKTA 1WSGA 1WSIA 4RW4A 4CFAA 4DTUA 1L3UA 2B6AA 2QK9A 3I0RA 1FKPA 2IS3A 4UQGA 3V9ZA 2HNZA 5I42A 2IOCA 1R0AA 4CJ4A 4Z4HA 1ZYQA 1QTMA 4OKEA 1REVA 1O1WA 3G10A 1XHXA 5CY4A 5HRNA 4DFPA 3O3HA 4DSJA 3DRPA 1BCOA 3QEPA 1RDAA 1NK0A 4FXDA 1TVRA 2OZMA 1CXQA 4DSLA 4CGGA 1L5UA 4KHNA 3AVFA 1VSFA 1CZ9A 4C8MA 4CGIA 3OYEA 4FZYA 3ZSVA 3S3MA 2PZSA 4F4KA 1BL3A 1RNHA 4CGFA 1RTHA 3SJJA 4FJMA 4FJXA 1X9WA 4DLEA 4KTQA 1HYVA 3ZSYA 3KLHA 4DQQA 4CJWA 5KTQA 5I3UA 4K8ZA 3M8SA 2YNGA 4CE9A 3I0SA 4DF8A 2HHSA 1GOBA 5SZTA 2Q3SA 3HP9A 4B3OA 2X78A 2ETJA 3C6TA 2IGIA 4CJVA 2OA8A 1S9GA 3AVGA 3TARA 2VG7A 1Z26A 2X6NA 1WAJA 3D0PA 5CYMA 3HXMA 3SCXA 4FJJA 1LWEA 3DLHA 1WNSA 3U6FA 4FM1A 3MXMA 4O55A 4PUOA 3MECA 3VA3A 2A1RA 3OYBA 3KTQA 3LP1A 4Y1CA 3E01A 3HPHA 4FJ5A 4C8LA 2IC3A 1RT1A 1TKDA 2QKBA 2G8KA 4Q0BA 1C1AA 3TABA 4FW2A 4M3RA 3PO4A 1L3SA 4CECA 2Z1JA 3T19A 5J2MA 2OZSA 4KB0A 4ZTFA 3AVHA 3VQ5A 5J2NA 1RDDA 4DU4A 3HVTA 1RDBA 1S1WA 4OVLA 3L2VA 4B9UA 1CZBA 3FFIA 4DFMA 3L3UA 4I9LA 3OJSA 2QKKA 1TKZA 2ZQBA 4E7IA 1BI4A 4W5RA 3U3YA 3VQQA 3S3OA 3AA5X 4HUFA 1XC9A 3LALA 3WNFA 1J53A 3ZT2A 4DTOA 4FZZA 4JS4A 3RR7A 3TAEA 3M8QA 3F9KA 2XY5A 1KLMA 4O5BA 2O4IA 4KB1A 3LZIA 4Z4GA 4DSFA 1RT3A 3OYGA 2HVHA 4CJTA 1D8YA 4RW8A 3KD1E 1EX4A 3ZSRA 3L8BA 4OKKA 1RT4A 2YNFA 4KREA 3OY9A 1S9EA 1TAQA 3KK3A 3V6DA 4H4OA 2Y1JA 4W5OA 1HYZA 3TAGA 1TL3A 1RTIA 3LPUA 3QIOA 3OVNA 1IKWA 1RT6A 3KK1A 3IG1A 3JYTA 2E4LA 2R7YA 3OYIA 1CLQA 4CEAA 4LSLA 4FZXC 4FJNA 4AHCA 3SV3A 4N5SA 4M42A 3HO1A 3KKRA 4FM0A 3SQ0A 1T03A 4E3SA 5J1EA 4BE1A 2OPRA 1C0MA 2DFFA 5SWMA 5HROA 1BGXT 3VQ9A 1RCHA 2OPPA 3SNNA 2KZZA 4FLVA 3RMCA 4B8CA 3O3FA 2ZE2A 3RR8A 1DTTA 2RKIA 1NOYA 2PYJA 4M3TA 3NDKA 4KI4A 1KVAA 3C95A 4IDKA 4M3XA 3AO1A 3EYZA 4DSKA 2FBYA 2ZD1A 4M3ZA 3H08A 4CHQA 4DU3A 3DLGA 3V1QA 2QXFA 1ZBUA 4CESA 3HP6A 4DS4A 1ZBLA 2PY5A 3AVLA 4NCGA 4CHOA 2FC0A 3IRXA 1JXEA 3SQ1A 4J2AA 4CIFA 1VSEA 1WAFA 3MXJA 4R5PA 3LWLA 4F8RA 2PYLA 3V9XA 4NCBA 3QLHA 1SL0A 4LY7A 1UA1A 3AV9A 3K57A 1JXBA 2YHAA 3RTVA 5FRNA 4QCLA 4JS5A 3ALYA 2RN2A 3HYFA 4M45A 4CJUA 4HUGA 4E7JA 3SUQA 1S1XA 3U3GA 1J5OA 3CFPA 1U49A 3K5OA 4CJ3A 3M8RA 4KHSA 2WOMA 3SV4A 2E6LA 3G0ZA 2FBXA 1XI1A 5DK5A 4M3WA 3HT3A 4FK4A 3AO3A 4FJ8A 4B8AB 5HRPA 3V9SA 1RBUA 3NH0A 3QNNA 1L3TA 5CZ1A 1HRHA 4FLYA 4AHSA 4B9LA 3LP0A 4BE2A 1X9SA 1I39A 3HSTB 3DMJA 1TKXA 3RMBA 1RBSA 4JLHA 1Z25A 1JLCA 3DLEA 4DTJA 4W5QA 1ASWA 1XHZA 4J2BA 4DG1A 3QO9A 1A5XA 4CHPA 2KFNA 1T7PA 1ZBHA 3ISNC 4KFBA 4E0DA 4BDYA 3QINA 1NKCA 1N5YA 1KTQA 4F3OA 5JS2A 4Z0UA 1DLOA 3NF6A 4CF8A 3RRHA 2B5JA 1NK6A 4KHYA 4CK2A 3NH1A 4DU1A 1D9DA 2XY7A 4GW6A 3QEXA 1QS4A 3PO5A 3RWUA 2VG5A 3JSMA 2Z1HA 4FJLA 4CJLA 1JLQA 4E19A 4OPKA 2ITGA 4CJ5A 2G8HA 2KFZA 4DFKA 4AHTA 4IG0A 5E41A 2XY8A 1VSJA 4J2DA 3OYDA 3KKSA 3L3VA 1NJZA 3B6OA 3S3NA 1RTDA 3MEDA 1LV5A 5HRRA 4CHZA 1UA0A 1B9FA 4LD0A 4I7FA 4CEZA 4AHRA 1G15A 3OYLA 4JRQA 1JL1A 3D45A 4FK2A 1I3AA 4IBNA 3TWHA 1HQEA 4IG3A 4CEFA 3V81A 5J2QA 3DM2A 4DFJA 3AO2A 3CG7A 5CYQA 3AVAA 2X6SA 3PX0A 3OYKA 3TAQA 1BQNA 4PQUA 3ULDA 1HJRA 1YTUA 3AA4A 3BGRA 2HB5A 1JKHA 4K8XA 5KRSA 3O3GA 3VQDA 2P5GA 3OYNA 3KLEA 4CEDA 4CEOA 2HNYA 4CK3A 1RBTA 3C94A 3MAQA 3OS1A 4BDPA 4Z4CA 3QEWA 3PX4A 3P5JA 1TAUA 2GV9A 3L2QA 1SUQA 3VQ6A 1JLAA 3QEIA 3ZSQA 1IH7A 1WN7A 1NK8A 3K58A 2O4GA 2X74A 3WNHA 4B08A 4CHYA 4EZ9A 3V1RA 4HVJA 1S1TA 1QHTA 2HHUA 4EZ6A 3AVCA 2OYQA 1ASVA 1RBRA 3SUPA 4GVMA 1BIZA 3AVJA 4FLZA 2DY4A 3L2UA 3NAEA 4DTSA 5C42A 3OS0A 4CF0A 1NKEA 2KTQA 1MU2A 3B6PA 2F96A 2Z1GA 3LAKA 3QNOA 4PY5A 1QSSA 2EHGA 3PV8A 3LP2A 4CJEA 3TI0A 4NYFA 1B92A 1UOCA 1VK0A 1LW2A 3K59A 1VSLA 1KCFA 1NK4A 2HHVA 2DTUA 4ICLA 3CM6A 3DRRA 5K14A 3KJVA 3OS2A 3HPGA 3NHGA 3IAYA 2BGGA 2F8SA 4QOZB 4CGJA 1S5JA 2GUIA 4DTXA 1JLFA 4RW6A 5KGXA 1RDCA 2G8WA 1TV6A 3ZSOA 4IKFA 3CFOA 1WSHA 4Y1DA 1BIUA 3HL8A 3LP3A 5HBMA 1SKSA 1TK5A 4JRPA 3ZT3A 1LWCA 3IS9A 3SZ2A 3MEGA 3K5MA 4CIEA 4HTUA 4FLTA 1CXUA 3SYZA 4I2QA 1X1PA 3HVRA 1NJWA 4B9MA 4IFYA 4CEBA 4DQSA 4ID1A 3VQBA 1NJYA 4QAGA 1LAVA 1HQUA 2D0AA 4RW7A 3I8DA 4FW1A 4AHVA 3OYJA 2D0BA 3NFAA 3M8PA 4CF9A 2YKMA 2HVIA 4Z4IA 3PX6A 3PY8A 4M3UA 1ASUA 4PWDA 4PA1A 3ZT1A 2HHQA 3AA3A 3NF8A 3MXIA 2IDOA 4W5TA 4DTMA 4B9NA 4CEEA 1HYSA 4EP4A 4BACA 2G8FA 2F8TA 1JLEA 3ZSXA 1LAWA 4CJRA 1HPZA 2YNIA 4FCYA 4B9VA 1X9MA 1XWLA 2HW3A 4OJRA 1KVBA 4YFUA 2G8VA 3K5LA 1UAXA 2I5JA 4KO0A 3V9WA 1KRPA 1EKEA 4B9TA 3VN5A 1TGOA 4KTZA 3VA0A 1ZBFA 1C0UA 1J54A 1YVUA 2DFEA 4CJFA 3NH2A 2Y1IA 1FKOA 4DF4A 3SPYA 3TR8A 2LSNA 3DRSA 3TAFA 3NBPA 4KTWA 4NCAA 3AA2A 1J9AA 1BCMA 3ASMA 4E7LA 1RT7A 5C25A 3CYMA 1TK8A 4BWMA 1VRUA 3SUNA 1Q8IA 4C8OA 4OLAA 2A1SA 4KI6A 3ZCMA 1ZBIA 3OJUA 2G8UA 1VSHA 3QIPA 3OYHA 1HMVA 1QQCA 4OPJA 5D3GA 3DOKA 4BE0A 3AO5A 5JS1A 4O44A 4DQRA 4KRFA 4FJIA 2G8IA 4FK0A 1SKWA 1SKRA 4ID5A 4CJPA 4CFDA 4FVMA 1U04A 4N76A 4KAZA 2BDPA 4FJ7A 3BDPA 2YNHA 2RF2A 4HHTA 1WLJA 5EU7A 1VRTA 2Z1IA 4LSNA 5DMRA 4KHWA 3OYFA 4FJKA 1KFDA 3HPOA 2OPQA 3NF7A 1QSLA 3DLRA 1UWBA 4H4MA 1C0TA 3V1OA 3K2PA 1W9HA 4I2PA 4DTRA 4ELUA 4MQ3A 4O0JA 1Y97A 4CFCA 1S1VA 4KHUA 1IKXA 3VQEA 4CHNA 4FLUA 3THVA 3LANA 1IKYA 3WNGA 3TANA 4E7HA 1NOZA 1KLNA 4KHQA 4KKOA 2YKNA 1GOAA 3C6UA 1NKBA 1IO2A 3UIQA 3AVNA 2XY6A 3OYCA 4E7KA 4F2RA 1VSIA 3P83D 5HP1A 1GOCA 5C24A 3AVMA 4AH9A 1RTJA 1S6PA 2B4JA 3RMAA 4FJHA 4HCBA 2HHXA 2FBTA 4BDZA 4CJSA 3SUOA 2HMIA 4E1MA 3S9HA 3T3FA 4AHUA 4KPYA 1U48A 5J2PA 3SQ4A 3AVIA 3ZT0A 3CQ8A 4Z4FA 4CF1A 4RW9A 2YV0X 3MEEA 3KLFA 3QERA 3F73A 3SPZA 2P5OA 1JL2A 4C8KA 4WE1A 1ITGA 1JLBA 3HK2A 1FK9A 4KV8A 4C8NA 4OKJA 4E89A 4CCHA 1KSPA 3VQ7A 3DLKA 4YNQA 3AVBA 5FROA 4XIUA 2BANA 1KFSA 3PUFA 1Q9YA 4AILC 3OYMA 2AJQA 2KQ2A 3EZ5A 3CFRA 1FXXA 4FM2A 4I9QA 4OLBA 3ZT4A 3L2RA 2JLEA 3QETA 1W0HA 3NF9A 1RILA 4OGEA 3DOLA 1RT2A 4M41A 3WNEA 1SV5A 4CGDA 3KK2A 1U4BA 1NK9A 3TAMA 1D9FA 4DSIA 1WSEA 2XHBA 3QESA 4TSXA 2VWJA 4FJ9A 1SL2A 3AO4A 4BWJA 2VG6A 3VQCA 2BE2A 3HM9A 1VSMA 2D0CA 4OGCA 4DLGA 1B9DA 3KLIA 1EP4A 4CK1A 4HCCA 2RPIA 3T1AA 3VQAA 3ZSWA 1U45A 3LDSA 2YHBA 4N47A 4ELVA 4F2SA 4M3YA 3HJFA 4IFVA 5T7BA 2EX3A 2IAJA 3NGZA 4HUEA 4CERA 1JLGA 1S1UA 5KGWA 1Q9XA 4G1QA 3LZJA 1VSDA 1RBVA 3V9UA 1A5WA 1L3VA 1IG9A 3RRGA 4CGHA 1EETA 4B9SA 4DWIA 3NE6A 1LW0A 1YTAA 3O4NA 4MFBA 1T05A 1K6YA 1T8EA 4N41A 4LH4A 3LWMA 3KLGA 3VQPA 4DQPA 2HHTA 4CEQA 4H8KA 3OYAA 3EY1A 4LH5A 4CFBA 1NJXA 2ATQA 1WSFA 3P1GA 4EP5A 3NCIA 4O4GA 1LWFA 4N56A 3L2WA 1TL1A 2P1JA 3DI6A 1QSYA 1BHLA 1C6VA 4ZHRA 2WONA 2OPSA 1VSKA 1S6QA 2HHWA 2W42A 4CF2A 4CJQA 3K5NA 1F21A 3KD5E 5CZ2A 3A2FA 3QEVA 3LPTA 5HLFA 1RT5A 4E1NA 2JGUA 4J2EA 4Q5VA 3KIOA 4DTPA 1SL1A 3TAPA 4ELTA 3SI6A 2D5RA 4DSEA 1TK0A 4Z4EA 3CM5A 1EXQA 4CJKA 2XO7A 5KRTA 4NYNA 5KI6A 1BI4B 4FLWA 2KZMA 1A5VA 4DTNA 3DLBA 1HNIA 3DYAA 3LAMA 3NGYA 2HNDA 2DFHA 1NK7A 4FLXA 3SQ2A 2KW4A 5FRMA 3ZSZA 1KVCA 1C1BA 1NK5A 2E6MA 2GBZA 3ITHA 4DMNA 3RMDA 4ZTJA 1BISA 1IKVA 5HRSA 4DQIA 1YT3A 2P51A 1N6QA 2NUBA 1QE1A
chains in the Genus database with same CATH superfamily
3I33A 2E2QA 4GMJB 3VQ8A 2FF6A 4CZLA 2XRIA 1HNVA 5FPNA 4BGBA 4L8RB 4F3TA 4CBXA 2KHOA 2ZJRL 1L3UA 4B1VA 2QK9A 3I0RA 4UQGA 2HNZA 1ZYQA 1QTMA 3G10A 4DR4K 4DFPA 4H0XB 4DSJA 4X64K 3DRPA 3QEPA 1RDAA 5AQLA 1NK0A 4DSLA 1L5UA 4EHTA 3EE9A 4CGIA 2F7TA 4FZYA 2VCPA 3S3MA 2FXUA 3FE1A 4FJMA 3SJJA 1X9WA 2DPNA 4DQQA 5I3UA 3I56N 2GWJA 4DV2K 3M8SA 1T6DA 2HBMA 2YNGA 1HKCA 1KAXA 4DF8A 3MX5A 4FSVA 1YITN 2QWPA 5AQYA 4B3OA 4XEIA 3LDLA 4CI6A 1HJOA 2OA8A 3TARA 2Q2RA 3D0PA 3DLHA 3VEWA 3NVMA 4PUOA 4JN4A 3OYBA 4Y1CA 3E01A 2PFUA 1X3NA 1TKDA 2IVOA 3TABA 4CECA 3AVHA 4DU4A 4OVLA 4B9UA 3OBWA 3FFIA 3L3UA 4I9LA 1TKZA 1BUPA 3U3YA 3AA5X 4HUFA 4JAXA 4DTOA 3RR7A 3M8QA 3F9KA 2VGNA 3OYGA 3ZSRA 4OKKA 4B1ZA 2YNFA 3KK3A 1HNWK 3CD6N 3J7YP 3TAGA 4BRKA 5TKYA 1Q86O 3KK1A 3PSFA 3IG1A 3JYTA 3HM8A 2R7YA 1CLQA 1X9JA 3E9OA 4ILJA 4FZXC 3SV3A 3UKUA 4G9ZA 3SQ0A 1T03A 4QS8A 1K73O 3MX2A 4BE1A 2OANA 1C0MA 5HROA 3SNNA 2KZZA 1ESVA 3RMCA 2P9PA 1NOYA 4BR4A 4O5FA 3HBTA 3QFUA 3EYZA 4H0OA 3H08A 4CHQA 3DLGA 3V1QA 4CESA 1ZBUA 4F9OA 3AVLA 4CHOA 1VQON 4LF4K 4J2AA 4CIFA 5AQPA 3MXJA 1WAFA 2ZGYA 1SL0A 2QM1A 3CPEA 4BRPA 2F9WA 3O6WA 4E7JA 1S1XA 4IEEA 3K5OA 4YDUC 4M7YA 3HT3A 4FK4A 3AO3A 1U2VB 4FJ8A 5HRPA 1RBUA 1SQKA 1L3TA 4FLYA 4YOUA 4BE2A 1X9SA 2NRZA 3DMJA 4JKAA 3DLEA 5AQIA 5GAHP 1QVGM 3QO9A 3GG4A 4CHPA 1W97L 1N5YA 1KTQA 1VQPN 3QFPA 1ZXOA 1HR0K 3NH1A 1D9DA 5M1KA 1QZ6A 4GW6A 3QEXA 2XY7A 3JSMA 2ITGA 4CJ5A 4JD2A 4DFKA 4AHTA 3ENBA 4BQZA 3KKSA 3L3VA 1LV5A 3CJCA 3MMVA 1B9FA 4I7FA 1WB9A 4QS9A 2E20A 3OYLA 1JL1A 3D45A 1I3AA 4IBNA 5MLCQ 3TWHA 4IG3A 2E2OA 3AO2A 3PX0A 1BQNA 1R59O 3MN7A 2Q0RA 3KWIA 1JKHA 3VF6A 1Z6RA 4DV1K 4CEDA 4CK3A 2H3GX 1NBWA 1S3XA 1T6CA 2VYPA 3E66A 2D0OA 5E84A 1TAUA 1P8ZA 3L2QA 3ENOA 1FJGK 1LOTB 3G71N 1VQ9N 4AM6A 1QQNA 1WN7A 4JKDA 2O4GA 1BG3A 2D1KA 4HVJA 4JD2B 4EZ6A 4NO7A 3IKMA 4GVMA 1BIZA 3L2UA 4H5VA 4YY3K 2KTQA 4EIAA 4H0YB 1QSSA 3PV8A 3LP2A 1YJWN 1VK0A 3K59A 4ICLA 1GLEG 3M1FA 3HPGA 2GUIA 4RW6A 5KGXA 1RDCA 3MWTA 4BRIA 4Y1DA 1WSHA 4BC4A 1TK5A 1LWCA 3MN6A 3MEGA 2UU9K 3HVRA 1NJWA 4B9MA 1MWKA 4NB4A 4DQSA 4ID1A 1HQUA 4NXMK 3WXIA 1K8AO 4BR9A 3PY8A 4M3UA 4BVOA 4PA1A 3P39A 3BF1A 4FWSA 1BOTO 1J6ZA 4BR7A 4B9NA 4CZHA 1HYSA 3ZX0A 1LAWA 4DHYA 1EWQA 2NRVA 4OO1J 3WT0A 3HTVA 3VOVA 4OJRA 4YFUA 1TUYA 2I5JA 3V9WA 3TU5A 1TGOA 3VA0A 1ZBFA 1V4SA 4CJFA 4KTWA 3CC7N 5FPEA 1TK8A 1Q8IA 2HBJA 3ZCMA 1ZBIA 1VSHA 3OYHA 1RDUA 4BE0A 4HWIA 1SKWA 3ATVA 5KQ8A 2NRWA 4HHTA 2A40A 5KPTA 1Q82O 1WLJA 3EKSA 3CCQN 3OYFA 3NF7A 3AARA 3DLRA 4H4MA 3ZX2A 3LDNA 3V1OA 2E1ZA 4C23A 3B8AX 3KHYA 1S1VA 3VQEA 3THVA 4WF9L 4FVUA 3KZBA 4CJ7A 4BC3A 1NKBA 5A2QO 1IO2A 4H5WA 3AVNA 4BRCA 2GEMA 2XY6A 3P83D 4IDHA 4AH9A 3T1HK 4FJHA 1BO5O 2FBTA 3THYB 4KPYA 5AZIB 4AHUA 3UB5A 2IVNA 4Z4FA 4FO0A 3CXCM 4DUZK 2YV0X 3KLFA 3I8BA 1N32K 3F73A 1NLVA 3ULEB 1HPMA 2E5LK 3HK2A 2WC9A 4KV8A 4C8NA 1X3MA 4E89A 3VQ7A 3DLKA 4YNQA 1KFSA 4H0VB 1Q9YA 4AILC 4OLBA 1NGGA 5M1NA 1VQNN 1RILA 4CGDA 3DOLA 1RT2A 3KK2A 1NK9A 1SV5A 4DV3K 4A61A 3WUHA 3QESA 1SL2A 3AO4A 1TYQB 1NGFA 4JI3K 3D2FA 1VSMA 4LC9B 4OGCA 4DLGA 3FLCO 5LJWA 3VQAA 4F2SA 4M3YA 4ELVA 4IXCA 1JCGA 5T7BA 4HUEA 1JLGA 2FSJA 2IIRA 5BRHA 2W40A 4G1QA 3LZJA 1L3VA 1A5WA 3RRGA 4DWIA 1EETA 2HOEA 4JEPA 1T05A 1QZ5A 1SS6A 2HSTA 4N41A 2UUAK 1HUXA 3KLGA 3VQPA 4CEQA 3EY1A 2UUBK 2ATQA 1WSFA 3ZX3A 4GKKK 1LWFA 4GVEA 4N56A 1NWKA 5AFUA 4XH1A 4BRFA 3A2FA 3FZLA 1WUAA 5HLFA 1ZBSA 3KIOA 4DTPA 2HF4A 4I6MA 4ELTA 3R8EA 4BRLA 1TK0A 4Z4EA 3CM5A 4CJKA 3WEEA 2P9IB 5KI6A 5KRTA 3TSPA 3DLBA 1HNIA 3DYAA 1XNQK 1I94K 1NK7A 2WFBA 3CERA 1JCFA 2CGLA 3DJCA 3HOTA 4CBUA 4DMNA 2YHXA 4IEIA 1YT3A 2P51A 1S72N 5F1XA 1H1VA 5TKWA 5JMVA 3THXB 3R1XA 2IVPA 1YIJN 4CIGA 3ID8A 3O4QA 4IJAA 3DWLA 3V4IA 2YJFA 4CFAA 2B6AA 4BC5A 3NMUA 2IS3A 1R0AA 4OPHA 1REVA 2NZTA 5HRNA 3O3HA 3D2EB 4FWKA 3VENA 1NGIA 2OZMA 3QBXA 1CXQA 4KHNA 3AVFA 1CZ9A 3SLCA 3ZSVA 5CHIA 1BL3A 2EWSA 5AQGA 4KTQA 3ZSYA 3ZYYX 5KTQA 4JI6K 1NG9A 2ZJPL 3R9PA 2HHSA 2YX6A 5SZTA 3CCLN 3HP9A 4LF9K 2ZJQL 1XQSC 1Y64A 2V7ZA 3AVGA 2VG7A 4U7BA 1WAJA 3W0LA 5CYMA 3HXMA 2CH5A 3J7AP 1LWEA 4H0PA 3U6FA 2QWRA 3MXMA 4O55A 5GIPA 2HMPA 3MECA 4J8FA 2A1RA 3THXA 1QHAA 4DV5K 3O9QA 1VHXA 4AM7A 2IC3A 3PO4A 2YHYA 3A0IX 3T19A 5J2MA 1YXQA 2OZSA 2HF3A 4H5TA 3VQ5A 4KB0A 1RDDA 3PIOL 1RDBA 3L2VA 1CZBA 4DFMA 1IG8A 1VQKN 3DXKA 4E7IA 1XC9A 3LALA 2XY5A 2O4IA 4EFHA 4Z4GA 2BUPA 4DSFA 2F9TA 2HVHA 4RW8A 5GAEP 4M63C 1YI2N 1RT4A 2WUSA 1S9EA 4FWNA 4H4OA 1HX1A 2A41A 2Y1JA 4W5OA 1HYZA 1TL3A 3LPUA 4MO5A 1IKWA 4UY8O 3HO1A 5JVHL 4AF1A 3C0BA 1E4GT 2E1YA 2FSNA 5J1EA 1M1KO 2OPRA 1Q7YO 3WXKA 5SWMA 1BGXT 2OPPA 4QS7A 3AGKA 3SBGA 2ZE2A 3FGUA 1DTTA 2PYJA 3NDKA 4IDKA 2QWMA 4DU3A 2QXFA 2PY5A 2CGKA 1JXEA 5EXWA 1NGBA 3I55N 5EX5A 3LWLA 5C0YA 2O8CA 4NCBA 3QLHA 3K57A 5FRNA 3RTVA 4YOXA 4CJUA 3SUQA 1J5OA 4HUGA 1M90O 4X62K 4WFNL 3M8RA 5AQRA 1VQ4N 5BN8A 4M3WA 1XI1A 5DK5A 5F2RA 2OTJN 5M1QA 5KPRA 3V9SA 3OW2M 3H6EA 3L0QA 2P9NB 3SMSA 4JLHA 4EAHD 1Z25A 4DTJA 4W5QA 1XHZA 4LFCK 2KFNA 1T7PA 4KFBA 3MN5A 4Z0UA 3O1WA 1YAGA 2A5XA 2A3ZA 4CF8A 1V4TA 4BC2A 1NK6A 3FZHA 3A8YA 1N34K 2VG5A 3IUCA 2O8DB 4CJLA 1JLQA 3EN9A 4A5AA 3C7NB 2XY8A 3OYDA 1RTDA 4YOYA 3R3LA 3K0SA 4JRQA 3O4WA 1HLUA 3Q7BA 3AAPA 4IFEA 4PKGA 5J2QA 3DM2A 5AQNA 3AVAA 5LMNK 3EKUA 2ITMA 3UKRA 3ULDA 1YTUA 3BGRA 2QA4N 4I6MB 3O9UA 2A6AA 3LM9A 2OTLN 4DR2K 5KRSA 1OVYA 3KLEA 4B3MK 1XMQK 3F2KA 4Z4CA 1SUQA 1OH6A 1NGCA 4DB3A 2WBNA 3QEIA 3ZSQA 1IH7A 4CHYA 4EZ9A 3WNHA 3A5NC 4B08A 1QHTA 1ASVA 1KC8O 4DTSA 3OS0A 1BA0A 4FWQA 3CQYA 3B6PA 1MDUB 3LAKA 3GL1A 4BQLA 2RE2A 3ZEUB 3OA9A 5B8HA 1NK4A 1E4FT 4HTLA 3TTDA 3OS2A 4K41A 3IAYA 4CGJA 1S5JA 4JI8K 4DTXA 4BRNA 1JLFA 4GNIA 1VQ8N 4JKCA 3ZSOA 3CFOA 5HBMA 2NRXA 2E88A 4PL8A 1KAYA 2JWLA 4HTUA 3K5MA 4CIEA 5KPZA 1CXUA 4FLTA 3SYZA 4CZMA 1CZAN 2QTDA 4IFYA 3VQBA 1LAVA 4KH4A 2P9LB 4AHVA 1N36K 2YKMA 4Z4IA 1GLCG 2NRTA 3PX6A 4PWDA 3BEXA 3ZT1A 2HHQA 2BTFA 2P9LA 3AA3A 4FPBA 3MXIA 4W5TA 3RSEB 4EP4A 5BR8K 3ZSXA 4CJRA 4FCYA 1YJNN 1X9MA 1XWLA 1QQMA 1NNEA 3W3DA 4A5BA 3UKRB 2JWKA 4KO0A 4R79A 1EKEA 1J54A 2Y1IA 3SPYA 2I7PA 5DM7L 3J7ZO 1RT7A 2QWNA 2UXCK 3CYMA 2A1SA 3ZLJA 5M1FA 1QQCA 4OPJA 3DOKA 2A42A 3AO5A 4O44A 3H3OB 4DQRA 3THWA 2G8IA 2WTUA 4CFDA 4KAZA 3WXMB 4FJ7A 3BDPA 2F4VK 4KHWA 2UYTA 1KFDA 5ELZA 1QSLA 1UWBA 4GV3A 1C0TA 4ELUA 1W9HA 3KVGA 4MQ3A 1MA9B 1IKXA 1KLNA 4E7HA 1NOZA 4KKOA 5BRDA 3OYCA 4E7KA 4F2RA 5JLFA 5HP1A 3CETA 1S6PA 2B4JA 4B9QA 4BDZA 3S9HA 3T3FA 3AVIA 4DR3K 2VGMA 4RW9A 2QWOA 1NGJA 2YHWA 3QERA 3H1VX 4L3QA 3G6EN 4K43A 1KD1O 4WE1A 1EWRA 5BPNA 4B3RK 3EE8A 4KH5A 1KSPA 3QICA 5FROA 2P9KB 3CCUN 3CFRA 4I9QA 2P9UB 2CH6A 4BRMA 1W0HA 1J5EK 4JI2K 4FZZA 5C2FA 1D9FA 1WOQA 3TAMA 4DSIA 2XHBA 3QMLA 3T7ZA 2VWJA 4FJ9A 4ISFA 3FR0A 3HM9A 2D0CA 4HCCA 2RPIA 3WQUA 3CMEN 2P9NA 3LDSA 2YHBA 4N47A 4CERA 1OH5A 1LW0A 3O4NA 4MFBA 5BREA 3D7EO 1K6YA 4DQPA 4H8KA 4LH5A 4JKHA 3NCIA 4O4GA 5FPDA 4CF2A 4CJQA 4H5NA 2QWQA 3S41A 3VGMA 3SAFA 4CBWA 1RT5A 1SAZA 2JGUA 4E1NA 4Q5VA 4J2EA 3TAPA 2ZGZA 3SBTA 4DSEA 2XO7A 4V19S 4H03B 3LDOA 4FLXA 1ATNA 4H0TB 3SQ2A 5FRMA 1KVCA 4H5RA 2GBZA 3RMDA 3ITHA 1E3MA 4JKGA 5HRSA 4DR1K 4MDBA 2VWKA 1DGKN 1U6ZA 1D5AA 4W5NA 1WSJA 1BQMA 4O0IA 4ILGB 1DTQA 4RG8A 3VERA 5AZJA 5AQQA 3SAHA 3NGIA 1WSGA 4CZEA 4RW4A 1W7AA 3CJAA 4CW7B 3V9ZA 5I42A 4CJ4A 4Z4HA 3M6GA 1O1WA 5CY4A 4YOVA 1VQ6N 1NMNA 1BCOA 1TYQA 4FXDA 1GLLO 1TVRA 1BU6O 1DEJA 4CGGA 1VSFA 4C8MA 4DR7K 2PZSA 4KHPK 1U2VA 4FPAA 4F4KA 4CGFA 4DLEA 1HYVA 2VQEK 1QVFM 3MCPA 4CE9A 3I0SA 1GOBA 2Q3SA 4FWMA 5HL7L 2X78A 4CJVA 2IGIA 5AR0A 3VEOA 3N4PA 4B1WB 3ATUA 2E2PA 2Q36A 2X6NA 1JJ2M 3SCXA 2HBKA 3J8AA 4FM1A 2Q1NA 3HPHA 4FJ5A 4C8LA 1RT1A 2Z1JA 5J2NA 4B3TK 3TSQA 4CZKA 4BY9C 3HVTA 1O13A 4MDAA 2QKKA 2ZQBA 2PAVA 3S3OA 3VQQA 3WNFA 4CZJA 4JS4A 3TAEA 5ADXA 1KLMA 3TTCA 4O5BA 1W2BM 4DR5K 4KB1A 3AAQA 3TTFA 4OPAA 2I7NA 4CD1A 3H1QA 3L8BA 4KREA 3OY9A 1TAQA 4PL7A 3VTIA 4IZ9A 4BRQA 1RTIA 3O9TA 3G4SN 1EO1A 4A2AA 4FJNA 4AHCA 4M42A 4N5SA 3JAMO 4E3SA 3OTOK 3AY9A 3H46O 3VQ9A 4FLVA 2RKIA 4WYBA 5C12A 4M3TA 2QW9A 3BP8A 4KI4A 1KVAA 4M3XA 5LL6Z 1VQMN 4DSKA 2ZD1A 4M3ZA 4DS4A 1ZBLA 2FC0A 1GLFO 3O1BA 4R5PA 4WQ4A 4PKIA 4LY7A 3T1YK 1UA1A 3AV9A 2YHAA 4PKHA 1YUWA 3ALYA 4YHHK 3GE1A 1U49A 4CJ3A 4KHSA 1TUUA 2WOMA 2E6LA 3SV4A 3G0ZA 2FBXA 1NU0A 4JK7A 4IO9L 1HRHA 4AHSA 4B9LA 3LP0A 1N33K 4U67L 3RMBA 2GWKA 1MWMA 1JLCA 3EO3A 1ASWA 4WCEL 4J2BA 1A5XA 5EOYA 3ISNC 4E0DA 1KAZA 1NKCA 4JKEA 4F3OA 5JS2A 1DLOA 3RRHA 1S22A 4DU1A 3PO5A 4E19A 4OPKA 2G8HA 2KFZA 5EY4A 3HI0A 3CJ7A 5E41A 1VSJA 4J2DA 2UXBK 3B6OA 4JI7K 3DLLL 3MEDA 5HRRA 1NGAA 2ASOA 3ZEUA 4LD0A 2Q0UA 3ULEA 3FFKB 1ZC6A 3PSIA 5C15A 1XUPO 3ZETB 4DFJA 3CG7A 5CYQA 2X6SA 3TAQA 1YJ9N 3QBWA 3SK3A 3N4QA 4K8XA 3OHRA 4CEOA 3RVCA 2HNYA 3SMPA 1RBTA 2HBLA 3C94A 3H3NO 4LF8K 3VF2A 4BDPA 3ZETA 4MO4A 3PX4A 4LFBK 4FWOA 4FOEA 4A62A 3VQ6A 1JLAA 4BRDA 5JVGL 1BDGA 3VGKA 1S1TA 2Q97A 2HHUA 3LL3A 1QQOA 5C10A 1RGIA 3AVJA 4FLZA 3LDPA 4CF0A 1NKEA 1MU2A 3JXUA 1C0GA 4PY5A 2EHGA 4CJEA 3TI0A 4NYFA 2HHVA 3H45C 5LMUK 3CM6A 3NHGA 2J4RA 2F8SA 4DQ8A 4QOZB 3JS6A 5CR4A 2G8WA 4BG8A 1BIUA 3HL8A 5AQMA 1SKSA 4JRPA 3VETA 3SZ2A 4BR0A 2AA4A 4I2QA 3WQTA 3KWGA 1C0FA 4QAGA 4RW7A 2D0AA 3CC4N 4JKGB 1K8KA 2D0BA 3NFAA 3EL2A 5IT9O 1IBKK 5C2DA 2IDOA 3K9JA 5AQSA 4DTMA 4CEEA 4BACA 2G8FA 3MCAB 2F8TA 1JLEA 1HPZA 2YNIA 4IOCL 2HW3A 3IMXA 3K5LA 3EZWA 1UAXA 4GKJK 1XC3A 1KRPA 2W6LA 1YVUA 3NH2A 4DF4A 2KKZA 3LM2A 3TR8A 3DRSA 5GINA 3NBPA 4NCAA 1J9AA 1BCMA 4E7LA 2OCEA 4RTFD 5C25A 1YHQN 3P4IA 1VRUA 4BWMA 1NMDA 5E26A 4C8OA 4KI6A 4X66K 2P9PB 2G8UA 3QIPA 5D3GA 4JHDA 4B1UB 4DUYK 4FK0A 1SKRA 4ID5A 3G25A 1JCEA 4FVMA 4JI4K 2YNHA 2RF2A 4FWRA 1VRTA 2Z1IA 4LSNA 3Q7CA 5I9EB 2E8AA 2ASMA 5BR9A 3HOSA 3K2PA 1VAZA 4CFCA 4CHNA 1Z05A 4FLUA 1IKYA 1GLBG 4DV0K 5AQUA 4KHQA 3NVKA 1GOAA 3C6UA 1HNXK 3UIQA 1HKBA 1VSIA 4BROA 4JNEA 5C24A 1RTJA 2HHXA 2GELA 1GLJO 3SUOA 4E1MA 1OH8A 3ZT0A 3CQ8A 1IBMK 4CF1A 4IOAL 4BREA 3SPZA 2P5OA 2P9KA 4YDUA 4C1NK 1DKGD 4FL9A 1FK9A 3C65A 4OKJA 4CCHA 4BGAA 2VWBA 3CF5L 3AVBA 2BANA 2V51B 3PUFA 4CVNE 4DV7K 1ILYA 2AJQA 2KQ2A 4ILHA 5AQHA 3ZT4A 4FOIA 2JLEA 3QETA 3NF9A 4OGEA 4M41A 3O9SA 1U4BA 1WSEA 4BWJA 3VQCA 2QEXN 2BE2A 4A57A 4BRGA 3C6AA 3KLIA 1EP4A 3HJFA 4IFVA 3NGZA 3MN9A 3LDQA 3CJ1A 1Q9XA 5BN9A 5AZJB 1IG9A 4CGHA 3A5OC 1GLAG 5AQWA 3HRGA 1OVQA 3J80O 4LH4A 3LWMA 4NXNK 2AP1A 3OYAA 1NJXA 4FWLA 3CHWA 4XH4A 3M3ZA 3L2WA 1TL1A 2P1JA 3DI6A 5CE3A 1BHLA 1C6VA 2WONA 2OPSA 1VSKA 3K5NA 1F21A 5AQJA 5CZ2A 3VGLA 3IDHA 4B3SK 4JI1K 1ATSA 3CI5A 4O8UA 3SI6A 2D5RA 2ZM6K 5FLXO 1BI4B 2KZMA 4DTNA 3LAMA 2HNDA 2DFHA 2NRHA 4E1JA 3BY5A 4GV9A 2E6MA 4BR2A 4ZTJA 1IKVA 4DQIA 5M1PA 2NUBA 5AQXA 3VQ4A 3AVKA 4BR5A 1C1CA 1U47A 5DM6L 2FBVA 3WXJA 4FJGA 4CZFA 4FYDA 5FDLA 4IO8A 4BVPA 3J81O 2O8EA 3F9MA 3VTHA 4DS5A 1HNZK 2O8BA 1TKTA 1WSIA 1FW6A 4DTUA 3CJBA 4IWVA 1FKPA 2IOCA 3VEZA 4C1NI 4OKEA 1XHXA 1Q18A 1NM1A 3GBTA 3OYEA 1RNHA 1VQ7N 1RTHA 4FJXA 3QDKA 5JICA 4LF6K 3KLHA 5BPMA 2ZWHA 4K8ZA 4CJWA 2GX9A 3GOIA 2P9UA 3CIPA 3O9RA 4JK8A 2ETJA 3C6TA 4JI5K 1S9GA 5AQOA 1IBLK 3KK7A 3R6MA 1Z26A 4FJJA 4WFBL 1WNSA 3VA3A 4KBOA 3KTQA 3LP1A 5AJ3K 2YI1A 3RSEA 2QKBA 3ID6A 2G8KA 4JV5K 1C1AA 4MLEA 3MK6A 3MDQA 4FW2A 4M3RA 2E2NA 1L3SA 3T69A 4ZTFA 3D6RA 3CCVN 1S1WA 3CC2N 4DR6K 1IV0A 3OJSA 3O80A 3TSUA 1T44A 1BI4A 4W5RA 3SAGA 1J53A 4FWPA 3ZT2A 3O08A 5H1SQ 3C7NA 4CZGA 3LZIA 1RFQA 1RT3A 4M7XA 4CJTA 1D8YA 3KD1E 4DV4K 1EX4A 3FZMA 3THWB 3V6DA 4XH5A 4JI0K 3QIOA 3OVNA 1RT6A 2E4LA 2GTDA 3OYIA 4CEAA 4LSLA 3DXMA 3KKRA 4AQYK 4FM0A 3U4LA 1Q81O 2P9SA 2DFFA 1RCHA 4B8CA 3O3FA 3RR8A 3L4QA 4ISGA 3C95A 3AO1A 2FBYA 1U45A 3HP6A 4NCGA 3SQ1A 3IRXA 1VSEA 4F8RA 3CJ9A 2PYLA 5AQVA 3V9XA 4QCLA 1JXBA 5AQZA 3CCSN 4JS5A 3F5TA 3VF4A 2RN2A 3HYFA 4M45A 2W6KA 3U3GA 3CFPA 4K42A 5AQTA 3AGRA 4YORA 4B8AB 2D0PA 2YJEA 3QNNA 3NH0A 5CZ1A 2GUPA 4JK9A 1VQ5N 3O8MA 1I39A 3BF3A 3HSTB 1TKXA 1RBSA 1XMOK 4B1YB 4DG1A 1ZBHA 4DCHA 1P90A 3QINA 4JKBA 4BDYA 2UXDK 4DV6K 2O8BB 3NF6A 1VQLN 2B5JA 4IOXA 1D4XA 4KHYA 4CK2A 1QS4A 3RWUA 4FJLA 2Z1HA 3L4IA 4IG0A 5IWAK 4YOWA 4JYAK 4GV6A 1NJZA 3S3NA 5GAGP 1NGHA 5FPMA 2O8CB 2Q31A 4CHZA 1UA0A 4CEZA 1YVNA 3IFRA 4Y0WA 4AHRA 1G15A 3HZ6A 2V7YA 4FK2A 3DXKB 1HQEA 4K25A 4CEFA 3V81A 2RHKA 3OYKA 4PQUA 1HJRA 5M1OA 3AA4A 2HB5A 5BPLA 3O3GA 3VQDA 2P5GA 3OYNA 4BRHA 3MAQA 1IJJA 3OS1A 3QEWA 3P5JA 2GV9A 2O8FB 2HHHK 2P9IA 5LY3A 4ISEA 2NLXA 1NK8A 3K58A 2X74A 2QI2A 3V1RA 4PHTX 3CMAN 4A59A 3AVCA 2OYQA 1BA1A 1RBRA 3SUPA 2O8DA 2DY4A 3NAEA 5C42A 4CD3A 2F96A 2Z1GA 1HKGA 3QNOA 4WFAL 3K9KA 5AQKA 3CCEN 1B92A 3L6QA 2FSKA 1UOCA 1LW2A 1T3VA 1VSLA 3GDQA 1KCFA 2DTUA 3DRRA 5K14A 3BZCA 3KJVA 2BGGA 2ZF5O 3OBYA 3FZKA 3EEQA 1OKJA 1TV6A 2NRRA 4IKFA 1NJIO 3LP3A 3ZT3A 3IS9A 3VESA 3VEXA 1X1PA 4CEBA 1NJYA 2KLAA 3I8DA 4FW1A 3E9LA 3OYJA 3M8PA 4CF9A 2VQFK 2HVIA 4RWTA 1ASUA 2CGJA 5GADP 1DT9A 3NF8A 2O8FA 1NGDA 4IJNA 3C6HA 3U9ZA 3U8XA 4CZIA 4X65K 3PLAA 3M5RA 4B9VA 4OX9K 3WXLA 1KVBA 2BH1A 2G8VA 3O5BA 4WQ5A 3FZFA 1WBBA 4B9TA 1NGEA 3VN5A 2P9SB 4KTZA 3D2EA 1C0UA 2DFEA 4A2BA 1LCUA 1FKOA 3TAFA 2LSNA 3AA2A 3UE5A 2V52B 3ASMA 4KH6A 3CQXA 3SUNA 4JKFA 4OLAA 3OJUA 3P31A 1HMVA 2ASPA 5JS1A 4KRFA 4FJIA 4BG9A 4CJPA 1U04A 4N76A 2BDPA 3HSCA 4MLHA 2FF3B 4JHDB 5EU7A 5DMRA 3U9DA 1KXPA 3CCRN 3DXMB 1N8RO 4FJKA 3UKUB 3HPOA 4B1XB 2OPQA 2UUCK 4NLCA 4I2PA 4DTRA 4O0JA 1Y97A 2YCHA 3TPQA 4KHUA 3LANA 3WNGA 3TANA 3D2FB 3MWPA 5EVZA 2YKNA 4BRAA 3E1YA 2W41A 4DKWA 1GOCA 4HCBA 3AVMA 1RDWX 3RMAA 4WQ4C 3DAWA 4CJSA 2HMIA 1U48A 5J2PA 3SQ4A 4EHUA 5BRFA 3MEEA 1KQSM 1JL2A 4C8KA 3VEVA 1ITGA 1JLBA 3PIPL 4XIUA 4LF7K 5LJVA 3OYMA 3EZ5A 4FM2A 1FXXA 4LFAK 5AZIA 3L2RA 2NNWA 2QWLA 3WNEA 3QB0A 4TSXA 2VG6A 5ADXH 5AQFA 4LF5K 1B9DA 4CK1A 1K8KB 3T1AA 3ZSWA 4Q0BA 3A5MC 2EX3A 2IAJA 4RCHA 2PBDA 1S1UA 1GLDG 3A5LC 5GIOA 5KGWA 4Z94A 1G99A 2O8EB 1VSDA 1RBVA 3V9UA 3P38A 5HOOA 4B9SA 3NE6A 1YTAA 4O8KA 5KQDA 3CCJN 1T8EA 1YF5L 3BUZB 1XNRK 2HHTA 3E9PA 3VEYA 4CFBA 4YOTA 3P1GA 4EP5A 3CPWM 3CCMN 1QSYA 4ZHRA 3VMFB 1S6QA 1SZ2A 2HHWA 2W42A 4WQ5C 1OH7A 3KD5E 1ATRA 5JLHA 4NLBA 5AFUH 3QEVA 3LPTA 3WEEB 4K0KK 3THYA 2FLOA 4GY2B 1SL1A 1EXQA 4NYNA 3VPZA 4FLWA 2QXLA 1A5VA 1WBDA 1BWFO 1EQYA 3NGYA 2KW4A 2D4WA 3ZSZA 1NK5A 1C1BA 5F0XA 3ENHA 1BISA 1K9MO 1N6QA 3BZKA 3SJHA 1QE1A
chains in the Genus database with same CATH topology
3VQ4A 2VWKA 3AVKA 1D5AA 1C1CA 4W5NA 1WSJA 1U47A 4GMJB 2FBVA 4CIGA 1BQMA 3O4QA 4FJGA 3VQ8A 5FDLA 4O0IA 4FYDA 1DTQA 1HNVA 2XRIA 4RG8A 4DS5A 4L8RB 3NGIA 4F3TA 3V4IA 1TKTA 1WSGA 1WSIA 4RW4A 4CFAA 4DTUA 1L3UA 2B6AA 2QK9A 3I0RA 1FKPA 2IS3A 4UQGA 3V9ZA 2HNZA 5I42A 2IOCA 1R0AA 4CJ4A 4Z4HA 1ZYQA 1QTMA 4OKEA 1REVA 1O1WA 3G10A 1XHXA 5CY4A 5HRNA 4DFPA 3O3HA 4DSJA 3DRPA 1BCOA 3QEPA 1RDAA 1NK0A 4FXDA 1TVRA 2OZMA 1CXQA 4DSLA 4CGGA 1L5UA 4KHNA 3AVFA 1VSFA 1CZ9A 4C8MA 4CGIA 3OYEA 4FZYA 3ZSVA 3S3MA 2PZSA 4F4KA 1BL3A 1RNHA 4CGFA 1RTHA 3SJJA 4FJMA 4FJXA 1X9WA 4DLEA 4KTQA 1HYVA 3ZSYA 3KLHA 4DQQA 4CJWA 5KTQA 5I3UA 4K8ZA 3M8SA 2YNGA 4CE9A 3I0SA 4DF8A 2HHSA 1GOBA 5SZTA 2Q3SA 3HP9A 4B3OA 2X78A 2ETJA 3C6TA 2IGIA 4CJVA 2OA8A 1S9GA 3AVGA 3TARA 2VG7A 1Z26A 2X6NA 1WAJA 3D0PA 5CYMA 3HXMA 3SCXA 4FJJA 1LWEA 3DLHA 1WNSA 3U6FA 4FM1A 3MXMA 4O55A 4PUOA 3MECA 3VA3A 2A1RA 3OYBA 3KTQA 3LP1A 4Y1CA 3E01A 3HPHA 4FJ5A 4C8LA 2IC3A 1RT1A 1TKDA 2QKBA 2G8KA 4Q0BA 1C1AA 3TABA 4FW2A 4M3RA 3PO4A 1L3SA 4CECA 2Z1JA 3T19A 5J2MA 2OZSA 4KB0A 4ZTFA 3AVHA 3VQ5A 5J2NA 1RDDA 4DU4A 3HVTA 1RDBA 1S1WA 4OVLA 3L2VA 4B9UA 1CZBA 3FFIA 4DFMA 3L3UA 4I9LA 3OJSA 2QKKA 1TKZA 2ZQBA 4E7IA 1BI4A 4W5RA 3U3YA 3VQQA 3S3OA 3AA5X 4HUFA 1XC9A 3LALA 3WNFA 1J53A 3ZT2A 4DTOA 4FZZA 4JS4A 3RR7A 3TAEA 3M8QA 3F9KA 2XY5A 1KLMA 4O5BA 2O4IA 4KB1A 3LZIA 4Z4GA 4DSFA 1RT3A 3OYGA 2HVHA 4CJTA 1D8YA 4RW8A 3KD1E 1EX4A 3ZSRA 3L8BA 4OKKA 1RT4A 2YNFA 4KREA 3OY9A 1S9EA 1TAQA 3KK3A 3V6DA 4H4OA 2Y1JA 4W5OA 1HYZA 3TAGA 1TL3A 1RTIA 3LPUA 3QIOA 3OVNA 1IKWA 1RT6A 3KK1A 3IG1A 3JYTA 2E4LA 2R7YA 3OYIA 1CLQA 4CEAA 4LSLA 4FZXC 4FJNA 4AHCA 3SV3A 4N5SA 4M42A 3HO1A 3KKRA 4FM0A 3SQ0A 1T03A 4E3SA 5J1EA 4BE1A 2OPRA 1C0MA 2DFFA 5SWMA 5HROA 1BGXT 3VQ9A 1RCHA 2OPPA 3SNNA 2KZZA 4FLVA 3RMCA 4B8CA 3O3FA 2ZE2A 3RR8A 1DTTA 2RKIA 1NOYA 2PYJA 4M3TA 3NDKA 4KI4A 1KVAA 3C95A 4IDKA 4M3XA 3AO1A 3EYZA 4DSKA 2FBYA 2ZD1A 4M3ZA 3H08A 4CHQA 4DU3A 3DLGA 3V1QA 2QXFA 1ZBUA 4CESA 3HP6A 4DS4A 1ZBLA 2PY5A 3AVLA 4NCGA 4CHOA 2FC0A 3IRXA 1JXEA 3SQ1A 4J2AA 4CIFA 1VSEA 1WAFA 3MXJA 4R5PA 3LWLA 4F8RA 2PYLA 3V9XA 4NCBA 3QLHA 1SL0A 4LY7A 1UA1A 3AV9A 3K57A 1JXBA 2YHAA 3RTVA 5FRNA 4QCLA 4JS5A 3ALYA 2RN2A 3HYFA 4M45A 4CJUA 4HUGA 4E7JA 3SUQA 1S1XA 3U3GA 1J5OA 3CFPA 1U49A 3K5OA 4CJ3A 3M8RA 4KHSA 2WOMA 3SV4A 2E6LA 3G0ZA 2FBXA 1XI1A 5DK5A 4M3WA 3HT3A 4FK4A 3AO3A 4FJ8A 4B8AB 5HRPA 3V9SA 1RBUA 3NH0A 3QNNA 1L3TA 5CZ1A 1HRHA 4FLYA 4AHSA 4B9LA 3LP0A 4BE2A 1X9SA 1I39A 3HSTB 3DMJA 1TKXA 3RMBA 1RBSA 4JLHA 1Z25A 1JLCA 3DLEA 4DTJA 4W5QA 1ASWA 1XHZA 4J2BA 4DG1A 3QO9A 1A5XA 4CHPA 2KFNA 1T7PA 1ZBHA 3ISNC 4KFBA 4E0DA 4BDYA 3QINA 1NKCA 1N5YA 1KTQA 4F3OA 5JS2A 4Z0UA 1DLOA 3NF6A 4CF8A 3RRHA 2B5JA 1NK6A 4KHYA 4CK2A 3NH1A 4DU1A 1D9DA 2XY7A 4GW6A 3QEXA 1QS4A 3PO5A 3RWUA 2VG5A 3JSMA 2Z1HA 4FJLA 4CJLA 1JLQA 4E19A 4OPKA 2ITGA 4CJ5A 2G8HA 2KFZA 4DFKA 4AHTA 4IG0A 5E41A 2XY8A 1VSJA 4J2DA 3OYDA 3KKSA 3L3VA 1NJZA 3B6OA 3S3NA 1RTDA 3MEDA 1LV5A 5HRRA 4CHZA 1UA0A 1B9FA 4LD0A 4I7FA 4CEZA 4AHRA 1G15A 3OYLA 4JRQA 1JL1A 3D45A 4FK2A 1I3AA 4IBNA 3TWHA 1HQEA 4IG3A 4CEFA 3V81A 5J2QA 3DM2A 4DFJA 3AO2A 3CG7A 5CYQA 3AVAA 2X6SA 3PX0A 3OYKA 3TAQA 1BQNA 4PQUA 3ULDA 1HJRA 1YTUA 3AA4A 3BGRA 2HB5A 1JKHA 4K8XA 5KRSA 3O3GA 3VQDA 2P5GA 3OYNA 3KLEA 4CEDA 4CEOA 2HNYA 4CK3A 1RBTA 3C94A 3MAQA 3OS1A 4BDPA 4Z4CA 3QEWA 3PX4A 3P5JA 1TAUA 2GV9A 3L2QA 1SUQA 3VQ6A 1JLAA 3QEIA 3ZSQA 1IH7A 1WN7A 1NK8A 3K58A 2O4GA 2X74A 3WNHA 4B08A 4CHYA 4EZ9A 3V1RA 4HVJA 1S1TA 1QHTA 2HHUA 4EZ6A 3AVCA 2OYQA 1ASVA 1RBRA 3SUPA 4GVMA 1BIZA 3AVJA 4FLZA 2DY4A 3L2UA 3NAEA 4DTSA 5C42A 3OS0A 4CF0A 1NKEA 2KTQA 1MU2A 3B6PA 2F96A 2Z1GA 3LAKA 3QNOA 4PY5A 1QSSA 2EHGA 3PV8A 3LP2A 4CJEA 3TI0A 4NYFA 1B92A 1UOCA 1VK0A 1LW2A 3K59A 1VSLA 1KCFA 1NK4A 2HHVA 2DTUA 4ICLA 3CM6A 3DRRA 5K14A 3KJVA 3OS2A 3HPGA 3NHGA 3IAYA 2BGGA 2F8SA 4QOZB 4CGJA 1S5JA 2GUIA 4DTXA 1JLFA 4RW6A 5KGXA 1RDCA 2G8WA 1TV6A 3ZSOA 4IKFA 3CFOA 1WSHA 4Y1DA 1BIUA 3HL8A 3LP3A 5HBMA 1SKSA 1TK5A 4JRPA 3ZT3A 1LWCA 3IS9A 3SZ2A 3MEGA 3K5MA 4CIEA 4HTUA 4FLTA 1CXUA 3SYZA 4I2QA 1X1PA 3HVRA 1NJWA 4B9MA 4IFYA 4CEBA 4DQSA 4ID1A 3VQBA 1NJYA 4QAGA 1LAVA 1HQUA 2D0AA 4RW7A 3I8DA 4FW1A 4AHVA 3OYJA 2D0BA 3NFAA 3M8PA 4CF9A 2YKMA 2HVIA 4Z4IA 3PX6A 3PY8A 4M3UA 1ASUA 4PWDA 4PA1A 3ZT1A 2HHQA 3AA3A 3NF8A 3MXIA 2IDOA 4W5TA 4DTMA 4B9NA 4CEEA 1HYSA 4EP4A 4BACA 2G8FA 2F8TA 1JLEA 3ZSXA 1LAWA 4CJRA 1HPZA 2YNIA 4FCYA 4B9VA 1X9MA 1XWLA 2HW3A 4OJRA 1KVBA 4YFUA 2G8VA 3K5LA 1UAXA 2I5JA 4KO0A 3V9WA 1KRPA 1EKEA 4B9TA 3VN5A 1TGOA 4KTZA 3VA0A 1ZBFA 1C0UA 1J54A 1YVUA 2DFEA 4CJFA 3NH2A 2Y1IA 1FKOA 4DF4A 3SPYA 3TR8A 2LSNA 3DRSA 3TAFA 3NBPA 4KTWA 4NCAA 3AA2A 1J9AA 1BCMA 3ASMA 4E7LA 1RT7A 5C25A 3CYMA 1TK8A 4BWMA 1VRUA 3SUNA 1Q8IA 4C8OA 4OLAA 2A1SA 4KI6A 3ZCMA 1ZBIA 3OJUA 2G8UA 1VSHA 3QIPA 3OYHA 1HMVA 1QQCA 4OPJA 5D3GA 3DOKA 4BE0A 3AO5A 5JS1A 4O44A 4DQRA 4KRFA 4FJIA 2G8IA 4FK0A 1SKWA 1SKRA 4ID5A 4CJPA 4CFDA 4FVMA 1U04A 4N76A 4KAZA 2BDPA 4FJ7A 3BDPA 2YNHA 2RF2A 4HHTA 1WLJA 5EU7A 1VRTA 2Z1IA 4LSNA 5DMRA 4KHWA 3OYFA 4FJKA 1KFDA 3HPOA 2OPQA 3NF7A 1QSLA 3DLRA 1UWBA 4H4MA 1C0TA 3V1OA 3K2PA 1W9HA 4I2PA 4DTRA 4ELUA 4MQ3A 4O0JA 1Y97A 4CFCA 1S1VA 4KHUA 1IKXA 3VQEA 4CHNA 4FLUA 3THVA 3LANA 1IKYA 3WNGA 3TANA 4E7HA 1NOZA 1KLNA 4KHQA 4KKOA 2YKNA 1GOAA 3C6UA 1NKBA 1IO2A 3UIQA 3AVNA 2XY6A 3OYCA 4E7KA 4F2RA 1VSIA 3P83D 5HP1A 1GOCA 5C24A 3AVMA 4AH9A 1RTJA 1S6PA 2B4JA 3RMAA 4FJHA 4HCBA 2HHXA 2FBTA 4BDZA 4CJSA 3SUOA 2HMIA 4E1MA 3S9HA 3T3FA 4AHUA 4KPYA 1U48A 5J2PA 3SQ4A 3AVIA 3ZT0A 3CQ8A 4Z4FA 4CF1A 4RW9A 2YV0X 3MEEA 3KLFA 3QERA 3F73A 3SPZA 2P5OA 1JL2A 4C8KA 4WE1A 1ITGA 1JLBA 3HK2A 1FK9A 4KV8A 4C8NA 4OKJA 4E89A 4CCHA 1KSPA 3VQ7A 3DLKA 4YNQA 3AVBA 5FROA 4XIUA 2BANA 1KFSA 3PUFA 1Q9YA 4AILC 3OYMA 2AJQA 2KQ2A 3EZ5A 3CFRA 1FXXA 4FM2A 4I9QA 4OLBA 3ZT4A 3L2RA 2JLEA 3QETA 1W0HA 3NF9A 1RILA 4OGEA 3DOLA 1RT2A 4M41A 3WNEA 1SV5A 4CGDA 3KK2A 1U4BA 1NK9A 3TAMA 1D9FA 4DSIA 1WSEA 2XHBA 3QESA 4TSXA 2VWJA 4FJ9A 1SL2A 3AO4A 4BWJA 2VG6A 3VQCA 2BE2A 3HM9A 1VSMA 2D0CA 4OGCA 4DLGA 1B9DA 3KLIA 1EP4A 4CK1A 4HCCA 2RPIA 3T1AA 3VQAA 3ZSWA 1U45A 3LDSA 2YHBA 4N47A 4ELVA 4F2SA 4M3YA 3HJFA 4IFVA 5T7BA 2EX3A 2IAJA 3NGZA 4HUEA 4CERA 1JLGA 1S1UA 5KGWA 1Q9XA 4G1QA 3LZJA 1VSDA 1RBVA 3V9UA 1A5WA 1L3VA 1IG9A 3RRGA 4CGHA 1EETA 4B9SA 4DWIA 3NE6A 1LW0A 1YTAA 3O4NA 4MFBA 1T05A 1K6YA 1T8EA 4N41A 4LH4A 3LWMA 3KLGA 3VQPA 4DQPA 2HHTA 4CEQA 4H8KA 3OYAA 3EY1A 4LH5A 4CFBA 1NJXA 2ATQA 1WSFA 3P1GA 4EP5A 3NCIA 4O4GA 1LWFA 4N56A 3L2WA 1TL1A 2P1JA 3DI6A 1QSYA 1BHLA 1C6VA 4ZHRA 2WONA 2OPSA 1VSKA 1S6QA 2HHWA 2W42A 4CF2A 4CJQA 3K5NA 1F21A 3KD5E 5CZ2A 3A2FA 3QEVA 3LPTA 5HLFA 1RT5A 4E1NA 2JGUA 4J2EA 4Q5VA 3KIOA 4DTPA 1SL1A 3TAPA 4ELTA 3SI6A 2D5RA 4DSEA 1TK0A 4Z4EA 3CM5A 1EXQA 4CJKA 2XO7A 5KRTA 4NYNA 5KI6A 1BI4B 4FLWA 2KZMA 1A5VA 4DTNA 3DLBA 1HNIA 3DYAA 3LAMA 3NGYA 2HNDA 2DFHA 1NK7A 4FLXA 3SQ2A 2KW4A 5FRMA 3ZSZA 1KVCA 1C1BA 1NK5A 2E6MA 2GBZA 3ITHA 4DMNA 3RMDA 4ZTJA 1BISA 1IKVA 5HRSA 4DQIA 1YT3A 2P51A 1N6QA 2NUBA 1QE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ4 A;  2VWK A;  3AVK A;  1D5A A;  1C1C A;  4W5N A;  1WSJ A;  1U47 A;  4GMJ B;  2FBV A;  4CIG A;  1BQM A;  3O4Q A;  4FJG A;  3VQ8 A;  5FDL A;  4O0I A;  4FYD A;  1DTQ A;  1HNV A;  2XRI A;  4RG8 A;  4DS5 A;  4L8R B;  3NGI A;  4F3T A;  3V4I A;  1TKT A;  1WSG A;  1WSI A;  4RW4 A;  4CFA A;  4DTU A;  1L3U A;  2B6A A;  2QK9 A;  3I0R A;  1FKP A;  2IS3 A;  4UQG A;  3V9Z A;  2HNZ A;  5I42 A;  2IOC A;  1R0A A;  4CJ4 A;  4Z4H A;  1ZYQ A;  1QTM A;  4OKE A;  1REV A;  1O1W A;  3G10 A;  1XHX A;  5CY4 A;  5HRN A;  4DFP A;  3O3H A;  4DSJ A;  3DRP A;  1BCO A;  3QEP A;  1RDA A;  1NK0 A;  4FXD A;  1TVR A;  2OZM A;  1CXQ A;  4DSL A;  4CGG A;  1L5U A;  4KHN A;  3AVF A;  1VSF A;  1CZ9 A;  4C8M A;  4CGI A;  3OYE A;  4FZY A;  3ZSV A;  3S3M A;  2PZS A;  4F4K A;  1BL3 A;  1RNH A;  4CGF A;  1RTH A;  3SJJ A;  4FJM A;  4FJX A;  1X9W A;  4DLE A;  4KTQ A;  1HYV A;  3ZSY A;  3KLH A;  4DQQ A;  4CJW A;  5KTQ A;  5I3U A;  4K8Z A;  3M8S A;  2YNG A;  4CE9 A;  3I0S A;  4DF8 A;  2HHS A;  1GOB A;  5SZT A;  2Q3S A;  3HP9 A;  4B3O A;  2X78 A;  2ETJ A;  3C6T A;  2IGI A;  4CJV A;  2OA8 A;  1S9G A;  3AVG A;  3TAR A;  2VG7 A;  1Z26 A;  2X6N A;  1WAJ A;  3D0P A;  5CYM A;  3HXM A;  3SCX A;  4FJJ A;  1LWE A;  3DLH A;  1WNS A;  3U6F A;  4FM1 A;  3MXM A;  4O55 A;  4PUO A;  3MEC A;  3VA3 A;  2A1R A;  3OYB A;  3KTQ A;  3LP1 A;  4Y1C A;  3E01 A;  3HPH A;  4FJ5 A;  4C8L A;  2IC3 A;  1RT1 A;  1TKD A;  2QKB A;  2G8K A;  4Q0B A;  1C1A A;  3TAB A;  4FW2 A;  4M3R A;  3PO4 A;  1L3S A;  4CEC A;  2Z1J A;  3T19 A;  5J2M A;  2OZS A;  4KB0 A;  4ZTF A;  3AVH A;  3VQ5 A;  5J2N A;  1RDD A;  4DU4 A;  3HVT A;  1RDB A;  1S1W A;  4OVL A;  3L2V A;  4B9U A;  1CZB A;  3FFI A;  4DFM A;  3L3U A;  4I9L A;  3OJS A;  2QKK A;  1TKZ A;  2ZQB A;  4E7I A;  1BI4 A;  4W5R A;  3U3Y A;  3VQQ A;  3S3O A;  3AA5 X;  4HUF A;  1XC9 A;  3LAL A;  3WNF A;  1J53 A;  3ZT2 A;  4DTO A;  4FZZ A;  4JS4 A;  3RR7 A;  3TAE A;  3M8Q A;  3F9K A;  2XY5 A;  1KLM A;  4O5B A;  2O4I A;  4KB1 A;  3LZI A;  4Z4G A;  4DSF A;  1RT3 A;  3OYG A;  2HVH A;  4CJT A;  1D8Y A;  4RW8 A;  3KD1 E;  1EX4 A;  3ZSR A;  3L8B A;  4OKK A;  1RT4 A;  2YNF A;  4KRE A;  3OY9 A;  1S9E A;  1TAQ A;  3KK3 A;  3V6D A;  4H4O A;  2Y1J A;  4W5O A;  1HYZ A;  3TAG A;  1TL3 A;  1RTI A;  3LPU A;  3QIO A;  3OVN A;  1IKW A;  1RT6 A;  3KK1 A;  3IG1 A;  3JYT A;  2E4L A;  2R7Y A;  3OYI A;  1CLQ A;  4CEA A;  4LSL A;  4FZX C;  4FJN A;  4AHC A;  3SV3 A;  4N5S A;  4M42 A;  3HO1 A;  3KKR A;  4FM0 A;  3SQ0 A;  1T03 A;  4E3S A;  5J1E A;  4BE1 A;  2OPR A;  1C0M A;  2DFF A;  5SWM A;  5HRO A;  1BGX T;  3VQ9 A;  1RCH A;  2OPP A;  3SNN A;  2KZZ A;  4FLV A;  3RMC A;  4B8C A;  3O3F A;  2ZE2 A;  3RR8 A;  1DTT A;  2RKI A;  1NOY A;  2PYJ A;  4M3T A;  3NDK A;  4KI4 A;  1KVA A;  3C95 A;  4IDK A;  4M3X A;  3AO1 A;  3EYZ A;  4DSK A;  2FBY A;  2ZD1 A;  4M3Z A;  3H08 A;  4CHQ A;  4DU3 A;  3DLG A;  3V1Q A;  2QXF A;  1ZBU A;  4CES A;  3HP6 A;  4DS4 A;  1ZBL A;  2PY5 A;  3AVL A;  4NCG A;  4CHO A;  2FC0 A;  3IRX A;  1JXE A;  3SQ1 A;  4J2A A;  4CIF A;  1VSE A;  1WAF A;  3MXJ A;  4R5P A;  3LWL A;  4F8R A;  2PYL A;  3V9X A;  4NCB A;  3QLH A;  1SL0 A;  4LY7 A;  1UA1 A;  3AV9 A;  3K57 A;  1JXB A;  2YHA A;  3RTV A;  5FRN A;  4QCL A;  4JS5 A;  3ALY A;  2RN2 A;  3HYF A;  4M45 A;  4CJU A;  4HUG A;  4E7J A;  3SUQ A;  1S1X A;  3U3G A;  1J5O A;  3CFP A;  1U49 A;  3K5O A;  4CJ3 A;  3M8R A;  4KHS A;  2WOM A;  3SV4 A;  2E6L A;  3G0Z A;  2FBX A;  1XI1 A;  5DK5 A;  4M3W A;  3HT3 A;  4FK4 A;  3AO3 A;  4FJ8 A;  4B8A B;  5HRP A;  3V9S A;  1RBU A;  3NH0 A;  3QNN A;  1L3T A;  5CZ1 A;  1HRH A;  4FLY A;  4AHS A;  4B9L A;  3LP0 A;  4BE2 A;  1X9S A;  1I39 A;  3HST B;  3DMJ A;  1TKX A;  3RMB A;  1RBS A;  4JLH A;  1Z25 A;  1JLC A;  3DLE A;  4DTJ A;  4W5Q A;  1ASW A;  1XHZ A;  4J2B A;  4DG1 A;  3QO9 A;  1A5X A;  4CHP A;  2KFN A;  1T7P A;  1ZBH A;  3ISN C;  4KFB A;  4E0D A;  4BDY A;  3QIN A;  1NKC A;  1N5Y A;  1KTQ A;  4F3O A;  5JS2 A;  4Z0U A;  1DLO A;  3NF6 A;  4CF8 A;  3RRH A;  2B5J A;  1NK6 A;  4KHY A;  4CK2 A;  3NH1 A;  4DU1 A;  1D9D A;  2XY7 A;  4GW6 A;  3QEX A;  1QS4 A;  3PO5 A;  3RWU A;  2VG5 A;  3JSM A;  2Z1H A;  4FJL A;  4CJL A;  1JLQ A;  4E19 A;  4OPK A;  2ITG A;  4CJ5 A;  2G8H A;  2KFZ A;  4DFK A;  4AHT A;  4IG0 A;  5E41 A;  2XY8 A;  1VSJ A;  4J2D A;  3OYD A;  3KKS A;  3L3V A;  1NJZ A;  3B6O A;  3S3N A;  1RTD A;  3MED A;  1LV5 A;  5HRR A;  4CHZ A;  1UA0 A;  1B9F A;  4LD0 A;  4I7F A;  4CEZ A;  4AHR A;  1G15 A;  3OYL A;  4JRQ A;  1JL1 A;  3D45 A;  4FK2 A;  1I3A A;  4IBN A;  3TWH A;  1HQE A;  4IG3 A;  4CEF A;  3V81 A;  5J2Q A;  3DM2 A;  4DFJ A;  3AO2 A;  3CG7 A;  5CYQ A;  3AVA A;  2X6S A;  3PX0 A;  3OYK A;  3TAQ A;  1BQN A;  4PQU A;  3ULD A;  1HJR A;  1YTU A;  3AA4 A;  3BGR A;  2HB5 A;  1JKH A;  4K8X A;  5KRS A;  3O3G A;  3VQD A;  2P5G A;  3OYN A;  3KLE A;  4CED A;  4CEO A;  2HNY A;  4CK3 A;  1RBT A;  3C94 A;  3MAQ A;  3OS1 A;  4BDP A;  4Z4C A;  3QEW A;  3PX4 A;  3P5J A;  1TAU A;  2GV9 A;  3L2Q A;  1SUQ A;  3VQ6 A;  1JLA A;  3QEI A;  3ZSQ A;  1IH7 A;  1WN7 A;  1NK8 A;  3K58 A;  2O4G A;  2X74 A;  3WNH A;  4B08 A;  4CHY A;  4EZ9 A;  3V1R A;  4HVJ A;  1S1T A;  1QHT A;  2HHU A;  4EZ6 A;  3AVC A;  2OYQ A;  1ASV A;  1RBR A;  3SUP A;  4GVM A;  1BIZ A;  3AVJ A;  4FLZ A;  2DY4 A;  3L2U A;  3NAE A;  4DTS A;  5C42 A;  3OS0 A;  4CF0 A;  1NKE A;  2KTQ A;  1MU2 A;  3B6P A;  2F96 A;  2Z1G A;  3LAK A;  3QNO A;  4PY5 A;  1QSS A;  2EHG A;  3PV8 A;  3LP2 A;  4CJE A;  3TI0 A;  4NYF A;  1B92 A;  1UOC A;  1VK0 A;  1LW2 A;  3K59 A;  1VSL A;  1KCF A;  1NK4 A;  2HHV A;  2DTU A;  4ICL A;  3CM6 A;  3DRR A;  5K14 A;  3KJV A;  3OS2 A;  3HPG A;  3NHG A;  3IAY A;  2BGG A;  2F8S A;  4QOZ B;  4CGJ A;  1S5J A;  2GUI A;  4DTX A;  1JLF A;  4RW6 A;  5KGX A;  1RDC A;  2G8W A;  1TV6 A;  3ZSO A;  4IKF A;  3CFO A;  1WSH A;  4Y1D A;  1BIU A;  3HL8 A;  3LP3 A;  5HBM A;  1SKS A;  1TK5 A;  4JRP A;  3ZT3 A;  1LWC A;  3IS9 A;  3SZ2 A;  3MEG A;  3K5M A;  4CIE A;  4HTU A;  4FLT A;  1CXU A;  3SYZ A;  4I2Q A;  1X1P A;  3HVR A;  1NJW A;  4B9M A;  4IFY A;  4CEB A;  4DQS A;  4ID1 A;  3VQB A;  1NJY A;  4QAG A;  1LAV A;  1HQU A;  2D0A A;  4RW7 A;  3I8D A;  4FW1 A;  4AHV A;  3OYJ A;  2D0B A;  3NFA A;  3M8P A;  4CF9 A;  2YKM A;  2HVI A;  4Z4I A;  3PX6 A;  3PY8 A;  4M3U A;  1ASU A;  4PWD A;  4PA1 A;  3ZT1 A;  2HHQ A;  3AA3 A;  3NF8 A;  3MXI A;  2IDO A;  4W5T A;  4DTM A;  4B9N A;  4CEE A;  1HYS A;  4EP4 A;  4BAC A;  2G8F A;  2F8T A;  1JLE A;  3ZSX A;  1LAW A;  4CJR A;  1HPZ A;  2YNI A;  4FCY A;  4B9V A;  1X9M A;  1XWL A;  2HW3 A;  4OJR A;  1KVB A;  4YFU A;  2G8V A;  3K5L A;  1UAX A;  2I5J A;  4KO0 A;  3V9W A;  1KRP A;  1EKE A;  4B9T A;  3VN5 A;  1TGO A;  4KTZ A;  3VA0 A;  1ZBF A;  1C0U A;  1J54 A;  1YVU A;  2DFE A;  4CJF A;  3NH2 A;  2Y1I A;  1FKO A;  4DF4 A;  3SPY A;  3TR8 A;  2LSN A;  3DRS A;  3TAF A;  3NBP A;  4KTW A;  4NCA A;  3AA2 A;  1J9A A;  1BCM A;  3ASM A;  4E7L A;  1RT7 A;  5C25 A;  3CYM A;  1TK8 A;  4BWM A;  1VRU A;  3SUN A;  1Q8I A;  4C8O A;  4OLA A;  2A1S A;  4KI6 A;  3ZCM A;  1ZBI A;  3OJU A;  2G8U A;  1VSH A;  3QIP A;  3OYH A;  1HMV A;  1QQC A;  4OPJ A;  5D3G A;  3DOK A;  4BE0 A;  3AO5 A;  5JS1 A;  4O44 A;  4DQR A;  4KRF A;  4FJI A;  2G8I A;  4FK0 A;  1SKW A;  1SKR A;  4ID5 A;  4CJP A;  4CFD A;  4FVM A;  1U04 A;  4N76 A;  4KAZ A;  2BDP A;  4FJ7 A;  3BDP A;  2YNH A;  2RF2 A;  4HHT A;  1WLJ A;  5EU7 A;  1VRT A;  2Z1I A;  4LSN A;  5DMR A;  4KHW A;  3OYF A;  4FJK A;  1KFD A;  3HPO A;  2OPQ A;  3NF7 A;  1QSL A;  3DLR A;  1UWB A;  4H4M A;  1C0T A;  3V1O A;  3K2P A;  1W9H A;  4I2P A;  4DTR A;  4ELU A;  4MQ3 A;  4O0J A;  1Y97 A;  4CFC A;  1S1V A;  4KHU A;  1IKX A;  3VQE A;  4CHN A;  4FLU A;  3THV A;  3LAN A;  1IKY A;  3WNG A;  3TAN A;  4E7H A;  1NOZ A;  1KLN A;  4KHQ A;  4KKO A;  2YKN A;  1GOA A;  3C6U A;  1NKB A;  1IO2 A;  3UIQ A;  3AVN A;  2XY6 A;  3OYC A;  4E7K A;  4F2R A;  1VSI A;  3P83 D;  5HP1 A;  1GOC A;  5C24 A;  3AVM A;  4AH9 A;  1RTJ A;  1S6P A;  2B4J A;  3RMA A;  4FJH A;  4HCB A;  2HHX A;  2FBT A;  4BDZ A;  4CJS A;  3SUO A;  2HMI A;  4E1M A;  3S9H A;  3T3F A;  4AHU A;  4KPY A;  1U48 A;  5J2P A;  3SQ4 A;  3AVI A;  3ZT0 A;  3CQ8 A;  4Z4F A;  4CF1 A;  4RW9 A;  2YV0 X;  3MEE A;  3KLF A;  3QER A;  3F73 A;  3SPZ A;  2P5O A;  1JL2 A;  4C8K A;  4WE1 A;  1ITG A;  1JLB A;  3HK2 A;  1FK9 A;  4KV8 A;  4C8N A;  4OKJ A;  4E89 A;  4CCH A;  1KSP A;  3VQ7 A;  3DLK A;  4YNQ A;  3AVB A;  5FRO A;  4XIU A;  2BAN A;  1KFS A;  3PUF A;  1Q9Y A;  4AIL C;  3OYM A;  2AJQ A;  2KQ2 A;  3EZ5 A;  3CFR A;  1FXX A;  4FM2 A;  4I9Q A;  4OLB A;  3ZT4 A;  3L2R A;  2JLE A;  3QET A;  1W0H A;  3NF9 A;  1RIL A;  4OGE A;  3DOL A;  1RT2 A;  4M41 A;  3WNE A;  1SV5 A;  4CGD A;  3KK2 A;  1U4B A;  1NK9 A;  3TAM A;  1D9F A;  4DSI A;  1WSE A;  2XHB A;  3QES A;  4TSX A;  2VWJ A;  4FJ9 A;  1SL2 A;  3AO4 A;  4BWJ A;  2VG6 A;  3VQC A;  2BE2 A;  3HM9 A;  1VSM A;  2D0C A;  4OGC A;  4DLG A;  1B9D A;  3KLI A;  1EP4 A;  4CK1 A;  4HCC A;  2RPI A;  3T1A A;  3VQA A;  3ZSW A;  1U45 A;  3LDS A;  2YHB A;  4N47 A;  4ELV A;  4F2S A;  4M3Y A;  3HJF A;  4IFV A;  5T7B A;  2EX3 A;  2IAJ A;  3NGZ A;  4HUE A;  4CER A;  1JLG A;  1S1U A;  5KGW A;  1Q9X A;  4G1Q A;  3LZJ A;  1VSD A;  1RBV A;  3V9U A;  1A5W A;  1L3V A;  1IG9 A;  3RRG A;  4CGH A;  1EET A;  4B9S A;  4DWI A;  3NE6 A;  1LW0 A;  1YTA A;  3O4N A;  4MFB A;  1T05 A;  1K6Y A;  1T8E A;  4N41 A;  4LH4 A;  3LWM A;  3KLG A;  3VQP A;  4DQP A;  2HHT A;  4CEQ A;  4H8K A;  3OYA A;  3EY1 A;  4LH5 A;  4CFB A;  1NJX A;  2ATQ A;  1WSF A;  3P1G A;  4EP5 A;  3NCI A;  4O4G A;  1LWF A;  4N56 A;  3L2W A;  1TL1 A;  2P1J A;  3DI6 A;  1QSY A;  1BHL A;  1C6V A;  4ZHR A;  2WON A;  2OPS A;  1VSK A;  1S6Q A;  2HHW A;  2W42 A;  4CF2 A;  4CJQ A;  3K5N A;  1F21 A;  3KD5 E;  5CZ2 A;  3A2F A;  3QEV A;  3LPT A;  5HLF A;  1RT5 A;  4E1N A;  2JGU A;  4J2E A;  4Q5V A;  3KIO A;  4DTP A;  1SL1 A;  3TAP A;  4ELT A;  3SI6 A;  2D5R A;  4DSE A;  1TK0 A;  4Z4E A;  3CM5 A;  1EXQ A;  4CJK A;  2XO7 A;  5KRT A;  4NYN A;  5KI6 A;  1BI4 B;  4FLW A;  2KZM A;  1A5V A;  4DTN A;  3DLB A;  1HNI A;  3DYA A;  3LAM A;  3NGY A;  2HND A;  2DFH A;  1NK7 A;  4FLX A;  3SQ2 A;  2KW4 A;  5FRM A;  3ZSZ A;  1KVC A;  1C1B A;  1NK5 A;  2E6M A;  2GBZ A;  3ITH A;  4DMN A;  3RMD A;  4ZTJ A;  1BIS A;  1IKV A;  5HRS A;  4DQI A;  1YT3 A;  2P51 A;  1N6Q A;  2NUB A;  1QE1 A; 
#chains in the Genus database with same CATH topology
 3I33 A;  2E2Q A;  4GMJ B;  3VQ8 A;  2FF6 A;  4CZL A;  2XRI A;  1HNV A;  5FPN A;  4BGB A;  4L8R B;  4F3T A;  4CBX A;  2KHO A;  2ZJR L;  1L3U A;  4B1V A;  2QK9 A;  3I0R A;  4UQG A;  2HNZ A;  1ZYQ A;  1QTM A;  3G10 A;  4DR4 K;  4DFP A;  4H0X B;  4DSJ A;  4X64 K;  3DRP A;  3QEP A;  1RDA A;  5AQL A;  1NK0 A;  4DSL A;  1L5U A;  4EHT A;  3EE9 A;  4CGI A;  2F7T A;  4FZY A;  2VCP A;  3S3M A;  2FXU A;  3FE1 A;  4FJM A;  3SJJ A;  1X9W A;  2DPN A;  4DQQ A;  5I3U A;  3I56 N;  2GWJ A;  4DV2 K;  3M8S A;  1T6D A;  2HBM A;  2YNG A;  1HKC A;  1KAX A;  4DF8 A;  3MX5 A;  4FSV A;  1YIT N;  2QWP A;  5AQY A;  4B3O A;  4XEI A;  3LDL A;  4CI6 A;  1HJO A;  2OA8 A;  3TAR A;  2Q2R A;  3D0P A;  3DLH A;  3VEW A;  3NVM A;  4PUO A;  4JN4 A;  3OYB A;  4Y1C A;  3E01 A;  2PFU A;  1X3N A;  1TKD A;  2IVO A;  3TAB A;  4CEC A;  3AVH A;  4DU4 A;  4OVL A;  4B9U A;  3OBW A;  3FFI A;  3L3U A;  4I9L A;  1TKZ A;  1BUP A;  3U3Y A;  3AA5 X;  4HUF A;  4JAX A;  4DTO A;  3RR7 A;  3M8Q A;  3F9K A;  2VGN A;  3OYG A;  3ZSR A;  4OKK A;  4B1Z A;  2YNF A;  3KK3 A;  1HNW K;  3CD6 N;  3J7Y P;  3TAG A;  4BRK A;  5TKY A;  1Q86 O;  3KK1 A;  3PSF A;  3IG1 A;  3JYT A;  3HM8 A;  2R7Y A;  1CLQ A;  1X9J A;  3E9O A;  4ILJ A;  4FZX C;  3SV3 A;  3UKU A;  4G9Z A;  3SQ0 A;  1T03 A;  4QS8 A;  1K73 O;  3MX2 A;  4BE1 A;  2OAN A;  1C0M A;  5HRO A;  3SNN A;  2KZZ A;  1ESV A;  3RMC A;  2P9P A;  1NOY A;  4BR4 A;  4O5F A;  3HBT A;  3QFU A;  3EYZ A;  4H0O A;  3H08 A;  4CHQ A;  3DLG A;  3V1Q A;  4CES A;  1ZBU A;  4F9O A;  3AVL A;  4CHO A;  1VQO N;  4LF4 K;  4J2A A;  4CIF A;  5AQP A;  3MXJ A;  1WAF A;  2ZGY A;  1SL0 A;  2QM1 A;  3CPE A;  4BRP A;  2F9W A;  3O6W A;  4E7J A;  1S1X A;  4IEE A;  3K5O A;  4YDU C;  4M7Y A;  3HT3 A;  4FK4 A;  3AO3 A;  1U2V B;  4FJ8 A;  5HRP A;  1RBU A;  1SQK A;  1L3T A;  4FLY A;  4YOU A;  4BE2 A;  1X9S A;  2NRZ A;  3DMJ A;  4JKA A;  3DLE A;  5AQI A;  5GAH P;  1QVG M;  3QO9 A;  3GG4 A;  4CHP A;  1W97 L;  1N5Y A;  1KTQ A;  1VQP N;  3QFP A;  1ZXO A;  1HR0 K;  3NH1 A;  1D9D A;  5M1K A;  1QZ6 A;  4GW6 A;  3QEX A;  2XY7 A;  3JSM A;  2ITG A;  4CJ5 A;  4JD2 A;  4DFK A;  4AHT A;  3ENB A;  4BQZ A;  3KKS A;  3L3V A;  1LV5 A;  3CJC A;  3MMV A;  1B9F A;  4I7F A;  1WB9 A;  4QS9 A;  2E20 A;  3OYL A;  1JL1 A;  3D45 A;  1I3A A;  4IBN A;  5MLC Q;  3TWH A;  4IG3 A;  2E2O A;  3AO2 A;  3PX0 A;  1BQN A;  1R59 O;  3MN7 A;  2Q0R A;  3KWI A;  1JKH A;  3VF6 A;  1Z6R A;  4DV1 K;  4CED A;  4CK3 A;  2H3G X;  1NBW A;  1S3X A;  1T6C A;  2VYP A;  3E66 A;  2D0O A;  5E84 A;  1TAU A;  1P8Z A;  3L2Q A;  3ENO A;  1FJG K;  1LOT B;  3G71 N;  1VQ9 N;  4AM6 A;  1QQN A;  1WN7 A;  4JKD A;  2O4G A;  1BG3 A;  2D1K A;  4HVJ A;  4JD2 B;  4EZ6 A;  4NO7 A;  3IKM A;  4GVM A;  1BIZ A;  3L2U A;  4H5V A;  4YY3 K;  2KTQ A;  4EIA A;  4H0Y B;  1QSS A;  3PV8 A;  3LP2 A;  1YJW N;  1VK0 A;  3K59 A;  4ICL A;  1GLE G;  3M1F A;  3HPG A;  2GUI A;  4RW6 A;  5KGX A;  1RDC A;  3MWT A;  4BRI A;  4Y1D A;  1WSH A;  4BC4 A;  1TK5 A;  1LWC A;  3MN6 A;  3MEG A;  2UU9 K;  3HVR A;  1NJW A;  4B9M A;  1MWK A;  4NB4 A;  4DQS A;  4ID1 A;  1HQU A;  4NXM K;  3WXI A;  1K8A O;  4BR9 A;  3PY8 A;  4M3U A;  4BVO A;  4PA1 A;  3P39 A;  3BF1 A;  4FWS A;  1BOT O;  1J6Z A;  4BR7 A;  4B9N A;  4CZH A;  1HYS A;  3ZX0 A;  1LAW A;  4DHY A;  1EWQ A;  2NRV A;  4OO1 J;  3WT0 A;  3HTV A;  3VOV A;  4OJR A;  4YFU A;  1TUY A;  2I5J A;  3V9W A;  3TU5 A;  1TGO A;  3VA0 A;  1ZBF A;  1V4S A;  4CJF A;  4KTW A;  3CC7 N;  5FPE A;  1TK8 A;  1Q8I A;  2HBJ A;  3ZCM A;  1ZBI A;  1VSH A;  3OYH A;  1RDU A;  4BE0 A;  4HWI A;  1SKW A;  3ATV A;  5KQ8 A;  2NRW A;  4HHT A;  2A40 A;  5KPT A;  1Q82 O;  1WLJ A;  3EKS A;  3CCQ N;  3OYF A;  3NF7 A;  3AAR A;  3DLR A;  4H4M A;  3ZX2 A;  3LDN A;  3V1O A;  2E1Z A;  4C23 A;  3B8A X;  3KHY A;  1S1V A;  3VQE A;  3THV A;  4WF9 L;  4FVU A;  3KZB A;  4CJ7 A;  4BC3 A;  1NKB A;  5A2Q O;  1IO2 A;  4H5W A;  3AVN A;  4BRC A;  2GEM A;  2XY6 A;  3P83 D;  4IDH A;  4AH9 A;  3T1H K;  4FJH A;  1BO5 O;  2FBT A;  3THY B;  4KPY A;  5AZI B;  4AHU A;  3UB5 A;  2IVN A;  4Z4F A;  4FO0 A;  3CXC M;  4DUZ K;  2YV0 X;  3KLF A;  3I8B A;  1N32 K;  3F73 A;  1NLV A;  3ULE B;  1HPM A;  2E5L K;  3HK2 A;  2WC9 A;  4KV8 A;  4C8N A;  1X3M A;  4E89 A;  3VQ7 A;  3DLK A;  4YNQ A;  1KFS A;  4H0V B;  1Q9Y A;  4AIL C;  4OLB A;  1NGG A;  5M1N A;  1VQN N;  1RIL A;  4CGD A;  3DOL A;  1RT2 A;  3KK2 A;  1NK9 A;  1SV5 A;  4DV3 K;  4A61 A;  3WUH A;  3QES A;  1SL2 A;  3AO4 A;  1TYQ B;  1NGF A;  4JI3 K;  3D2F A;  1VSM A;  4LC9 B;  4OGC A;  4DLG A;  3FLC O;  5LJW A;  3VQA A;  4F2S A;  4M3Y A;  4ELV A;  4IXC A;  1JCG A;  5T7B A;  4HUE A;  1JLG A;  2FSJ A;  2IIR A;  5BRH A;  2W40 A;  4G1Q A;  3LZJ A;  1L3V A;  1A5W A;  3RRG A;  4DWI A;  1EET A;  2HOE A;  4JEP A;  1T05 A;  1QZ5 A;  1SS6 A;  2HST A;  4N41 A;  2UUA K;  1HUX A;  3KLG A;  3VQP A;  4CEQ A;  3EY1 A;  2UUB K;  2ATQ A;  1WSF A;  3ZX3 A;  4GKK K;  1LWF A;  4GVE A;  4N56 A;  1NWK A;  5AFU A;  4XH1 A;  4BRF A;  3A2F A;  3FZL A;  1WUA A;  5HLF A;  1ZBS A;  3KIO A;  4DTP A;  2HF4 A;  4I6M A;  4ELT A;  3R8E A;  4BRL A;  1TK0 A;  4Z4E A;  3CM5 A;  4CJK A;  3WEE A;  2P9I B;  5KI6 A;  5KRT A;  3TSP A;  3DLB A;  1HNI A;  3DYA A;  1XNQ K;  1I94 K;  1NK7 A;  2WFB A;  3CER A;  1JCF A;  2CGL A;  3DJC A;  3HOT A;  4CBU A;  4DMN A;  2YHX A;  4IEI A;  1YT3 A;  2P51 A;  1S72 N;  5F1X A;  1H1V A;  5TKW A;  5JMV A;  3THX B;  3R1X A;  2IVP A;  1YIJ N;  4CIG A;  3ID8 A;  3O4Q A;  4IJA A;  3DWL A;  3V4I A;  2YJF A;  4CFA A;  2B6A A;  4BC5 A;  3NMU A;  2IS3 A;  1R0A A;  4OPH A;  1REV A;  2NZT A;  5HRN A;  3O3H A;  3D2E B;  4FWK A;  3VEN A;  1NGI A;  2OZM A;  3QBX A;  1CXQ A;  4KHN A;  3AVF A;  1CZ9 A;  3SLC A;  3ZSV A;  5CHI A;  1BL3 A;  2EWS A;  5AQG A;  4KTQ A;  3ZSY A;  3ZYY X;  5KTQ A;  4JI6 K;  1NG9 A;  2ZJP L;  3R9P A;  2HHS A;  2YX6 A;  5SZT A;  3CCL N;  3HP9 A;  4LF9 K;  2ZJQ L;  1XQS C;  1Y64 A;  2V7Z A;  3AVG A;  2VG7 A;  4U7B A;  1WAJ A;  3W0L A;  5CYM A;  3HXM A;  2CH5 A;  3J7A P;  1LWE A;  4H0P A;  3U6F A;  2QWR A;  3MXM A;  4O55 A;  5GIP A;  2HMP A;  3MEC A;  4J8F A;  2A1R A;  3THX A;  1QHA A;  4DV5 K;  3O9Q A;  1VHX A;  4AM7 A;  2IC3 A;  3PO4 A;  2YHY A;  3A0I X;  3T19 A;  5J2M A;  1YXQ A;  2OZS A;  2HF3 A;  4H5T A;  3VQ5 A;  4KB0 A;  1RDD A;  3PIO L;  1RDB A;  3L2V A;  1CZB A;  4DFM A;  1IG8 A;  1VQK N;  3DXK A;  4E7I A;  1XC9 A;  3LAL A;  2XY5 A;  2O4I A;  4EFH A;  4Z4G A;  2BUP A;  4DSF A;  2F9T A;  2HVH A;  4RW8 A;  5GAE P;  4M63 C;  1YI2 N;  1RT4 A;  2WUS A;  1S9E A;  4FWN A;  4H4O A;  1HX1 A;  2A41 A;  2Y1J A;  4W5O A;  1HYZ A;  1TL3 A;  3LPU A;  4MO5 A;  1IKW A;  4UY8 O;  3HO1 A;  5JVH L;  4AF1 A;  3C0B A;  1E4G T;  2E1Y A;  2FSN A;  5J1E A;  1M1K O;  2OPR A;  1Q7Y O;  3WXK A;  5SWM A;  1BGX T;  2OPP A;  4QS7 A;  3AGK A;  3SBG A;  2ZE2 A;  3FGU A;  1DTT A;  2PYJ A;  3NDK A;  4IDK A;  2QWM A;  4DU3 A;  2QXF A;  2PY5 A;  2CGK A;  1JXE A;  5EXW A;  1NGB A;  3I55 N;  5EX5 A;  3LWL A;  5C0Y A;  2O8C A;  4NCB A;  3QLH A;  3K57 A;  5FRN A;  3RTV A;  4YOX A;  4CJU A;  3SUQ A;  1J5O A;  4HUG A;  1M90 O;  4X62 K;  4WFN L;  3M8R A;  5AQR A;  1VQ4 N;  5BN8 A;  4M3W A;  1XI1 A;  5DK5 A;  5F2R A;  2OTJ N;  5M1Q A;  5KPR A;  3V9S A;  3OW2 M;  3H6E A;  3L0Q A;  2P9N B;  3SMS A;  4JLH A;  4EAH D;  1Z25 A;  4DTJ A;  4W5Q A;  1XHZ A;  4LFC K;  2KFN A;  1T7P A;  4KFB A;  3MN5 A;  4Z0U A;  3O1W A;  1YAG A;  2A5X A;  2A3Z A;  4CF8 A;  1V4T A;  4BC2 A;  1NK6 A;  3FZH A;  3A8Y A;  1N34 K;  2VG5 A;  3IUC A;  2O8D B;  4CJL A;  1JLQ A;  3EN9 A;  4A5A A;  3C7N B;  2XY8 A;  3OYD A;  1RTD A;  4YOY A;  3R3L A;  3K0S A;  4JRQ A;  3O4W A;  1HLU A;  3Q7B A;  3AAP A;  4IFE A;  4PKG A;  5J2Q A;  3DM2 A;  5AQN A;  3AVA A;  5LMN K;  3EKU A;  2ITM A;  3UKR A;  3ULD A;  1YTU A;  3BGR A;  2QA4 N;  4I6M B;  3O9U A;  2A6A A;  3LM9 A;  2OTL N;  4DR2 K;  5KRS A;  1OVY A;  3KLE A;  4B3M K;  1XMQ K;  3F2K A;  4Z4C A;  1SUQ A;  1OH6 A;  1NGC A;  4DB3 A;  2WBN A;  3QEI A;  3ZSQ A;  1IH7 A;  4CHY A;  4EZ9 A;  3WNH A;  3A5N C;  4B08 A;  1QHT A;  1ASV A;  1KC8 O;  4DTS A;  3OS0 A;  1BA0 A;  4FWQ A;  3CQY A;  3B6P A;  1MDU B;  3LAK A;  3GL1 A;  4BQL A;  2RE2 A;  3ZEU B;  3OA9 A;  5B8H A;  1NK4 A;  1E4F T;  4HTL A;  3TTD A;  3OS2 A;  4K41 A;  3IAY A;  4CGJ A;  1S5J A;  4JI8 K;  4DTX A;  4BRN A;  1JLF A;  4GNI A;  1VQ8 N;  4JKC A;  3ZSO A;  3CFO A;  5HBM A;  2NRX A;  2E88 A;  4PL8 A;  1KAY A;  2JWL A;  4HTU A;  3K5M A;  4CIE A;  5KPZ A;  1CXU A;  4FLT A;  3SYZ A;  4CZM A;  1CZA N;  2QTD A;  4IFY A;  3VQB A;  1LAV A;  4KH4 A;  2P9L B;  4AHV A;  1N36 K;  2YKM A;  4Z4I A;  1GLC G;  2NRT A;  3PX6 A;  4PWD A;  3BEX A;  3ZT1 A;  2HHQ A;  2BTF A;  2P9L A;  3AA3 A;  4FPB A;  3MXI A;  4W5T A;  3RSE B;  4EP4 A;  5BR8 K;  3ZSX A;  4CJR A;  4FCY A;  1YJN N;  1X9M A;  1XWL A;  1QQM A;  1NNE A;  3W3D A;  4A5B A;  3UKR B;  2JWK A;  4KO0 A;  4R79 A;  1EKE A;  1J54 A;  2Y1I A;  3SPY A;  2I7P A;  5DM7 L;  3J7Z O;  1RT7 A;  2QWN A;  2UXC K;  3CYM A;  2A1S A;  3ZLJ A;  5M1F A;  1QQC A;  4OPJ A;  3DOK A;  2A42 A;  3AO5 A;  4O44 A;  3H3O B;  4DQR A;  3THW A;  2G8I A;  2WTU A;  4CFD A;  4KAZ A;  3WXM B;  4FJ7 A;  3BDP A;  2F4V K;  4KHW A;  2UYT A;  1KFD A;  5ELZ A;  1QSL A;  1UWB A;  4GV3 A;  1C0T A;  4ELU A;  1W9H A;  3KVG A;  4MQ3 A;  1MA9 B;  1IKX A;  1KLN A;  4E7H A;  1NOZ A;  4KKO A;  5BRD A;  3OYC A;  4E7K A;  4F2R A;  5JLF A;  5HP1 A;  3CET A;  1S6P A;  2B4J A;  4B9Q A;  4BDZ A;  3S9H A;  3T3F A;  3AVI A;  4DR3 K;  2VGM A;  4RW9 A;  2QWO A;  1NGJ A;  2YHW A;  3QER A;  3H1V X;  4L3Q A;  3G6E N;  4K43 A;  1KD1 O;  4WE1 A;  1EWR A;  5BPN A;  4B3R K;  3EE8 A;  4KH5 A;  1KSP A;  3QIC A;  5FRO A;  2P9K B;  3CCU N;  3CFR A;  4I9Q A;  2P9U B;  2CH6 A;  4BRM A;  1W0H A;  1J5E K;  4JI2 K;  4FZZ A;  5C2F A;  1D9F A;  1WOQ A;  3TAM A;  4DSI A;  2XHB A;  3QML A;  3T7Z A;  2VWJ A;  4FJ9 A;  4ISF A;  3FR0 A;  3HM9 A;  2D0C A;  4HCC A;  2RPI A;  3WQU A;  3CME N;  2P9N A;  3LDS A;  2YHB A;  4N47 A;  4CER A;  1OH5 A;  1LW0 A;  3O4N A;  4MFB A;  5BRE A;  3D7E O;  1K6Y A;  4DQP A;  4H8K A;  4LH5 A;  4JKH A;  3NCI A;  4O4G A;  5FPD A;  4CF2 A;  4CJQ A;  4H5N A;  2QWQ A;  3S41 A;  3VGM A;  3SAF A;  4CBW A;  1RT5 A;  1SAZ A;  2JGU A;  4E1N A;  4Q5V A;  4J2E A;  3TAP A;  2ZGZ A;  3SBT A;  4DSE A;  2XO7 A;  4V19 S;  4H03 B;  3LDO A;  4FLX A;  1ATN A;  4H0T B;  3SQ2 A;  5FRM A;  1KVC A;  4H5R A;  2GBZ A;  3RMD A;  3ITH A;  1E3M A;  4JKG A;  5HRS A;  4DR1 K;  4MDB A;  2VWK A;  1DGK N;  1U6Z A;  1D5A A;  4W5N A;  1WSJ A;  1BQM A;  4O0I A;  4ILG B;  1DTQ A;  4RG8 A;  3VER A;  5AZJ A;  5AQQ A;  3SAH A;  3NGI A;  1WSG A;  4CZE A;  4RW4 A;  1W7A A;  3CJA A;  4CW7 B;  3V9Z A;  5I42 A;  4CJ4 A;  4Z4H A;  3M6G A;  1O1W A;  5CY4 A;  4YOV A;  1VQ6 N;  1NMN A;  1BCO A;  1TYQ A;  4FXD A;  1GLL O;  1TVR A;  1BU6 O;  1DEJ A;  4CGG A;  1VSF A;  4C8M A;  4DR7 K;  2PZS A;  4KHP K;  1U2V A;  4FPA A;  4F4K A;  4CGF A;  4DLE A;  1HYV A;  2VQE K;  1QVF M;  3MCP A;  4CE9 A;  3I0S A;  1GOB A;  2Q3S A;  4FWM A;  5HL7 L;  2X78 A;  4CJV A;  2IGI A;  5AR0 A;  3VEO A;  3N4P A;  4B1W B;  3ATU A;  2E2P A;  2Q36 A;  2X6N A;  1JJ2 M;  3SCX A;  2HBK A;  3J8A A;  4FM1 A;  2Q1N A;  3HPH A;  4FJ5 A;  4C8L A;  1RT1 A;  2Z1J A;  5J2N A;  4B3T K;  3TSQ A;  4CZK A;  4BY9 C;  3HVT A;  1O13 A;  4MDA A;  2QKK A;  2ZQB A;  2PAV A;  3S3O A;  3VQQ A;  3WNF A;  4CZJ A;  4JS4 A;  3TAE A;  5ADX A;  1KLM A;  3TTC A;  4O5B A;  1W2B M;  4DR5 K;  4KB1 A;  3AAQ A;  3TTF A;  4OPA A;  2I7N A;  4CD1 A;  3H1Q A;  3L8B A;  4KRE A;  3OY9 A;  1TAQ A;  4PL7 A;  3VTI A;  4IZ9 A;  4BRQ A;  1RTI A;  3O9T A;  3G4S N;  1EO1 A;  4A2A A;  4FJN A;  4AHC A;  4M42 A;  4N5S A;  3JAM O;  4E3S A;  3OTO K;  3AY9 A;  3H46 O;  3VQ9 A;  4FLV A;  2RKI A;  4WYB A;  5C12 A;  4M3T A;  2QW9 A;  3BP8 A;  4KI4 A;  1KVA A;  4M3X A;  5LL6 Z;  1VQM N;  4DSK A;  2ZD1 A;  4M3Z A;  4DS4 A;  1ZBL A;  2FC0 A;  1GLF O;  3O1B A;  4R5P A;  4WQ4 A;  4PKI A;  4LY7 A;  3T1Y K;  1UA1 A;  3AV9 A;  2YHA A;  4PKH A;  1YUW A;  3ALY A;  4YHH K;  3GE1 A;  1U49 A;  4CJ3 A;  4KHS A;  1TUU A;  2WOM A;  2E6L A;  3SV4 A;  3G0Z A;  2FBX A;  1NU0 A;  4JK7 A;  4IO9 L;  1HRH A;  4AHS A;  4B9L A;  3LP0 A;  1N33 K;  4U67 L;  3RMB A;  2GWK A;  1MWM A;  1JLC A;  3EO3 A;  1ASW A;  4WCE L;  4J2B A;  1A5X A;  5EOY A;  3ISN C;  4E0D A;  1KAZ A;  1NKC A;  4JKE A;  4F3O A;  5JS2 A;  1DLO A;  3RRH A;  1S22 A;  4DU1 A;  3PO5 A;  4E19 A;  4OPK A;  2G8H A;  2KFZ A;  5EY4 A;  3HI0 A;  3CJ7 A;  5E41 A;  1VSJ A;  4J2D A;  2UXB K;  3B6O A;  4JI7 K;  3DLL L;  3MED A;  5HRR A;  1NGA A;  2ASO A;  3ZEU A;  4LD0 A;  2Q0U A;  3ULE A;  3FFK B;  1ZC6 A;  3PSI A;  5C15 A;  1XUP O;  3ZET B;  4DFJ A;  3CG7 A;  5CYQ A;  2X6S A;  3TAQ A;  1YJ9 N;  3QBW A;  3SK3 A;  3N4Q A;  4K8X A;  3OHR A;  4CEO A;  3RVC A;  2HNY A;  3SMP A;  1RBT A;  2HBL A;  3C94 A;  3H3N O;  4LF8 K;  3VF2 A;  4BDP A;  3ZET A;  4MO4 A;  3PX4 A;  4LFB K;  4FWO A;  4FOE A;  4A62 A;  3VQ6 A;  1JLA A;  4BRD A;  5JVG L;  1BDG A;  3VGK A;  1S1T A;  2Q97 A;  2HHU A;  3LL3 A;  1QQO A;  5C10 A;  1RGI A;  3AVJ A;  4FLZ A;  3LDP A;  4CF0 A;  1NKE A;  1MU2 A;  3JXU A;  1C0G A;  4PY5 A;  2EHG A;  4CJE A;  3TI0 A;  4NYF A;  2HHV A;  3H45 C;  5LMU K;  3CM6 A;  3NHG A;  2J4R A;  2F8S A;  4DQ8 A;  4QOZ B;  3JS6 A;  5CR4 A;  2G8W A;  4BG8 A;  1BIU A;  3HL8 A;  5AQM A;  1SKS A;  4JRP A;  3VET A;  3SZ2 A;  4BR0 A;  2AA4 A;  4I2Q A;  3WQT A;  3KWG A;  1C0F A;  4QAG A;  4RW7 A;  2D0A A;  3CC4 N;  4JKG B;  1K8K A;  2D0B A;  3NFA A;  3EL2 A;  5IT9 O;  1IBK K;  5C2D A;  2IDO A;  3K9J A;  5AQS A;  4DTM A;  4CEE A;  4BAC A;  2G8F A;  3MCA B;  2F8T A;  1JLE A;  1HPZ A;  2YNI A;  4IOC L;  2HW3 A;  3IMX A;  3K5L A;  3EZW A;  1UAX A;  4GKJ K;  1XC3 A;  1KRP A;  2W6L A;  1YVU A;  3NH2 A;  4DF4 A;  2KKZ A;  3LM2 A;  3TR8 A;  3DRS A;  5GIN A;  3NBP A;  4NCA A;  1J9A A;  1BCM A;  4E7L A;  2OCE A;  4RTF D;  5C25 A;  1YHQ N;  3P4I A;  1VRU A;  4BWM A;  1NMD A;  5E26 A;  4C8O A;  4KI6 A;  4X66 K;  2P9P B;  2G8U A;  3QIP A;  5D3G A;  4JHD A;  4B1U B;  4DUY K;  4FK0 A;  1SKR A;  4ID5 A;  3G25 A;  1JCE A;  4FVM A;  4JI4 K;  2YNH A;  2RF2 A;  4FWR A;  1VRT A;  2Z1I A;  4LSN A;  3Q7C A;  5I9E B;  2E8A A;  2ASM A;  5BR9 A;  3HOS A;  3K2P A;  1VAZ A;  4CFC A;  4CHN A;  1Z05 A;  4FLU A;  1IKY A;  1GLB G;  4DV0 K;  5AQU A;  4KHQ A;  3NVK A;  1GOA A;  3C6U A;  1HNX K;  3UIQ A;  1HKB A;  1VSI A;  4BRO A;  4JNE A;  5C24 A;  1RTJ A;  2HHX A;  2GEL A;  1GLJ O;  3SUO A;  4E1M A;  1OH8 A;  3ZT0 A;  3CQ8 A;  1IBM K;  4CF1 A;  4IOA L;  4BRE A;  3SPZ A;  2P5O A;  2P9K A;  4YDU A;  4C1N K;  1DKG D;  4FL9 A;  1FK9 A;  3C65 A;  4OKJ A;  4CCH A;  4BGA A;  2VWB A;  3CF5 L;  3AVB A;  2BAN A;  2V51 B;  3PUF A;  4CVN E;  4DV7 K;  1ILY A;  2AJQ A;  2KQ2 A;  4ILH A;  5AQH A;  3ZT4 A;  4FOI A;  2JLE A;  3QET A;  3NF9 A;  4OGE A;  4M41 A;  3O9S A;  1U4B A;  1WSE A;  4BWJ A;  3VQC A;  2QEX N;  2BE2 A;  4A57 A;  4BRG A;  3C6A A;  3KLI A;  1EP4 A;  3HJF A;  4IFV A;  3NGZ A;  3MN9 A;  3LDQ A;  3CJ1 A;  1Q9X A;  5BN9 A;  5AZJ B;  1IG9 A;  4CGH A;  3A5O C;  1GLA G;  5AQW A;  3HRG A;  1OVQ A;  3J80 O;  4LH4 A;  3LWM A;  4NXN K;  2AP1 A;  3OYA A;  1NJX A;  4FWL A;  3CHW A;  4XH4 A;  3M3Z A;  3L2W A;  1TL1 A;  2P1J A;  3DI6 A;  5CE3 A;  1BHL A;  1C6V A;  2WON A;  2OPS A;  1VSK A;  3K5N A;  1F21 A;  5AQJ A;  5CZ2 A;  3VGL A;  3IDH A;  4B3S K;  4JI1 K;  1ATS A;  3CI5 A;  4O8U A;  3SI6 A;  2D5R A;  2ZM6 K;  5FLX O;  1BI4 B;  2KZM A;  4DTN A;  3LAM A;  2HND A;  2DFH A;  2NRH A;  4E1J A;  3BY5 A;  4GV9 A;  2E6M A;  4BR2 A;  4ZTJ A;  1IKV A;  4DQI A;  5M1P A;  2NUB A;  5AQX A;  3VQ4 A;  3AVK A;  4BR5 A;  1C1C A;  1U47 A;  5DM6 L;  2FBV A;  3WXJ A;  4FJG A;  4CZF A;  4FYD A;  5FDL A;  4IO8 A;  4BVP A;  3J81 O;  2O8E A;  3F9M A;  3VTH A;  4DS5 A;  1HNZ K;  2O8B A;  1TKT A;  1WSI A;  1FW6 A;  4DTU A;  3CJB A;  4IWV A;  1FKP A;  2IOC A;  3VEZ A;  4C1N I;  4OKE A;  1XHX A;  1Q18 A;  1NM1 A;  3GBT A;  3OYE A;  1RNH A;  1VQ7 N;  1RTH A;  4FJX A;  3QDK A;  5JIC A;  4LF6 K;  3KLH A;  5BPM A;  2ZWH A;  4K8Z A;  4CJW A;  2GX9 A;  3GOI A;  2P9U A;  3CIP A;  3O9R A;  4JK8 A;  2ETJ A;  3C6T A;  4JI5 K;  1S9G A;  5AQO A;  1IBL K;  3KK7 A;  3R6M A;  1Z26 A;  4FJJ A;  4WFB L;  1WNS A;  3VA3 A;  4KBO A;  3KTQ A;  3LP1 A;  5AJ3 K;  2YI1 A;  3RSE A;  2QKB A;  3ID6 A;  2G8K A;  4JV5 K;  1C1A A;  4MLE A;  3MK6 A;  3MDQ A;  4FW2 A;  4M3R A;  2E2N A;  1L3S A;  3T69 A;  4ZTF A;  3D6R A;  3CCV N;  1S1W A;  3CC2 N;  4DR6 K;  1IV0 A;  3OJS A;  3O80 A;  3TSU A;  1T44 A;  1BI4 A;  4W5R A;  3SAG A;  1J53 A;  4FWP A;  3ZT2 A;  3O08 A;  5H1S Q;  3C7N A;  4CZG A;  3LZI A;  1RFQ A;  1RT3 A;  4M7X A;  4CJT A;  1D8Y A;  3KD1 E;  4DV4 K;  1EX4 A;  3FZM A;  3THW B;  3V6D A;  4XH5 A;  4JI0 K;  3QIO A;  3OVN A;  1RT6 A;  2E4L A;  2GTD A;  3OYI A;  4CEA A;  4LSL A;  3DXM A;  3KKR A;  4AQY K;  4FM0 A;  3U4L A;  1Q81 O;  2P9S A;  2DFF A;  1RCH A;  4B8C A;  3O3F A;  3RR8 A;  3L4Q A;  4ISG A;  3C95 A;  3AO1 A;  2FBY A;  1U45 A;  3HP6 A;  4NCG A;  3SQ1 A;  3IRX A;  1VSE A;  4F8R A;  3CJ9 A;  2PYL A;  5AQV A;  3V9X A;  4QCL A;  1JXB A;  5AQZ A;  3CCS N;  4JS5 A;  3F5T A;  3VF4 A;  2RN2 A;  3HYF A;  4M45 A;  2W6K A;  3U3G A;  3CFP A;  4K42 A;  5AQT A;  3AGR A;  4YOR A;  4B8A B;  2D0P A;  2YJE A;  3QNN A;  3NH0 A;  5CZ1 A;  2GUP A;  4JK9 A;  1VQ5 N;  3O8M A;  1I39 A;  3BF3 A;  3HST B;  1TKX A;  1RBS A;  1XMO K;  4B1Y B;  4DG1 A;  1ZBH A;  4DCH A;  1P90 A;  3QIN A;  4JKB A;  4BDY A;  2UXD K;  4DV6 K;  2O8B B;  3NF6 A;  1VQL N;  2B5J A;  4IOX A;  1D4X A;  4KHY A;  4CK2 A;  1QS4 A;  3RWU A;  4FJL A;  2Z1H A;  3L4I A;  4IG0 A;  5IWA K;  4YOW A;  4JYA K;  4GV6 A;  1NJZ A;  3S3N A;  5GAG P;  1NGH A;  5FPM A;  2O8C B;  2Q31 A;  4CHZ A;  1UA0 A;  4CEZ A;  1YVN A;  3IFR A;  4Y0W A;  4AHR A;  1G15 A;  3HZ6 A;  2V7Y A;  4FK2 A;  3DXK B;  1HQE A;  4K25 A;  4CEF A;  3V81 A;  2RHK A;  3OYK A;  4PQU A;  1HJR A;  5M1O A;  3AA4 A;  2HB5 A;  5BPL A;  3O3G A;  3VQD A;  2P5G A;  3OYN A;  4BRH A;  3MAQ A;  1IJJ A;  3OS1 A;  3QEW A;  3P5J A;  2GV9 A;  2O8F B;  2HHH K;  2P9I A;  5LY3 A;  4ISE A;  2NLX A;  1NK8 A;  3K58 A;  2X74 A;  2QI2 A;  3V1R A;  4PHT X;  3CMA N;  4A59 A;  3AVC A;  2OYQ A;  1BA1 A;  1RBR A;  3SUP A;  2O8D A;  2DY4 A;  3NAE A;  5C42 A;  4CD3 A;  2F96 A;  2Z1G A;  1HKG A;  3QNO A;  4WFA L;  3K9K A;  5AQK A;  3CCE N;  1B92 A;  3L6Q A;  2FSK A;  1UOC A;  1LW2 A;  1T3V A;  1VSL A;  3GDQ A;  1KCF A;  2DTU A;  3DRR A;  5K14 A;  3BZC A;  3KJV A;  2BGG A;  2ZF5 O;  3OBY A;  3FZK A;  3EEQ A;  1OKJ A;  1TV6 A;  2NRR A;  4IKF A;  1NJI O;  3LP3 A;  3ZT3 A;  3IS9 A;  3VES A;  3VEX A;  1X1P A;  4CEB A;  1NJY A;  2KLA A;  3I8D A;  4FW1 A;  3E9L A;  3OYJ A;  3M8P A;  4CF9 A;  2VQF K;  2HVI A;  4RWT A;  1ASU A;  2CGJ A;  5GAD P;  1DT9 A;  3NF8 A;  2O8F A;  1NGD A;  4IJN A;  3C6H A;  3U9Z A;  3U8X A;  4CZI A;  4X65 K;  3PLA A;  3M5R A;  4B9V A;  4OX9 K;  3WXL A;  1KVB A;  2BH1 A;  2G8V A;  3O5B A;  4WQ5 A;  3FZF A;  1WBB A;  4B9T A;  1NGE A;  3VN5 A;  2P9S B;  4KTZ A;  3D2E A;  1C0U A;  2DFE A;  4A2B A;  1LCU A;  1FKO A;  3TAF A;  2LSN A;  3AA2 A;  3UE5 A;  2V52 B;  3ASM A;  4KH6 A;  3CQX A;  3SUN A;  4JKF A;  4OLA A;  3OJU A;  3P31 A;  1HMV A;  2ASP A;  5JS1 A;  4KRF A;  4FJI A;  4BG9 A;  4CJP A;  1U04 A;  4N76 A;  2BDP A;  3HSC A;  4MLH A;  2FF3 B;  4JHD B;  5EU7 A;  5DMR A;  3U9D A;  1KXP A;  3CCR N;  3DXM B;  1N8R O;  4FJK A;  3UKU B;  3HPO A;  4B1X B;  2OPQ A;  2UUC K;  4NLC A;  4I2P A;  4DTR A;  4O0J A;  1Y97 A;  2YCH A;  3TPQ A;  4KHU A;  3LAN A;  3WNG A;  3TAN A;  3D2F B;  3MWP A;  5EVZ A;  2YKN A;  4BRA A;  3E1Y A;  2W41 A;  4DKW A;  1GOC A;  4HCB A;  3AVM A;  1RDW X;  3RMA A;  4WQ4 C;  3DAW A;  4CJS A;  2HMI A;  1U48 A;  5J2P A;  3SQ4 A;  4EHU A;  5BRF A;  3MEE A;  1KQS M;  1JL2 A;  4C8K A;  3VEV A;  1ITG A;  1JLB A;  3PIP L;  4XIU A;  4LF7 K;  5LJV A;  3OYM A;  3EZ5 A;  4FM2 A;  1FXX A;  4LFA K;  5AZI A;  3L2R A;  2NNW A;  2QWL A;  3WNE A;  3QB0 A;  4TSX A;  2VG6 A;  5ADX H;  5AQF A;  4LF5 K;  1B9D A;  4CK1 A;  1K8K B;  3T1A A;  3ZSW A;  4Q0B A;  3A5M C;  2EX3 A;  2IAJ A;  4RCH A;  2PBD A;  1S1U A;  1GLD G;  3A5L C;  5GIO A;  5KGW A;  4Z94 A;  1G99 A;  2O8E B;  1VSD A;  1RBV A;  3V9U A;  3P38 A;  5HOO A;  4B9S A;  3NE6 A;  1YTA A;  4O8K A;  5KQD A;  3CCJ N;  1T8E A;  1YF5 L;  3BUZ B;  1XNR K;  2HHT A;  3E9P A;  3VEY A;  4CFB A;  4YOT A;  3P1G A;  4EP5 A;  3CPW M;  3CCM N;  1QSY A;  4ZHR A;  3VMF B;  1S6Q A;  1SZ2 A;  2HHW A;  2W42 A;  4WQ5 C;  1OH7 A;  3KD5 E;  1ATR A;  5JLH A;  4NLB A;  5AFU H;  3QEV A;  3LPT A;  3WEE B;  4K0K K;  3THY A;  2FLO A;  4GY2 B;  1SL1 A;  1EXQ A;  4NYN A;  3VPZ A;  4FLW A;  2QXL A;  1A5V A;  1WBD A;  1BWF O;  1EQY A;  3NGY A;  2KW4 A;  2D4W A;  3ZSZ A;  1NK5 A;  1C1B A;  5F0X A;  3ENH A;  1BIS A;  1K9M O;  1N6Q A;  3BZK A;  3SJH A;  1QE1 A; 
#chains in the Genus database with same CATH homology
 3VQ4 A;  2VWK A;  3AVK A;  1D5A A;  1C1C A;  4W5N A;  1WSJ A;  1U47 A;  4GMJ B;  2FBV A;  4CIG A;  1BQM A;  3O4Q A;  4FJG A;  3VQ8 A;  5FDL A;  4O0I A;  4FYD A;  1DTQ A;  1HNV A;  2XRI A;  4RG8 A;  4DS5 A;  4L8R B;  3NGI A;  4F3T A;  3V4I A;  1TKT A;  1WSG A;  1WSI A;  4RW4 A;  4CFA A;  4DTU A;  1L3U A;  2B6A A;  2QK9 A;  3I0R A;  1FKP A;  2IS3 A;  4UQG A;  3V9Z A;  2HNZ A;  5I42 A;  2IOC A;  1R0A A;  4CJ4 A;  4Z4H A;  1ZYQ A;  1QTM A;  4OKE A;  1REV A;  1O1W A;  3G10 A;  1XHX A;  5CY4 A;  5HRN A;  4DFP A;  3O3H A;  4DSJ A;  3DRP A;  1BCO A;  3QEP A;  1RDA A;  1NK0 A;  4FXD A;  1TVR A;  2OZM A;  1CXQ A;  4DSL A;  4CGG A;  1L5U A;  4KHN A;  3AVF A;  1VSF A;  1CZ9 A;  4C8M A;  4CGI A;  3OYE A;  4FZY A;  3ZSV A;  3S3M A;  2PZS A;  4F4K A;  1BL3 A;  1RNH A;  4CGF A;  1RTH A;  3SJJ A;  4FJM A;  4FJX A;  1X9W A;  4DLE A;  4KTQ A;  1HYV A;  3ZSY A;  3KLH A;  4DQQ A;  4CJW A;  5KTQ A;  5I3U A;  4K8Z A;  3M8S A;  2YNG A;  4CE9 A;  3I0S A;  4DF8 A;  2HHS A;  1GOB A;  5SZT A;  2Q3S A;  3HP9 A;  4B3O A;  2X78 A;  2ETJ A;  3C6T A;  2IGI A;  4CJV A;  2OA8 A;  1S9G A;  3AVG A;  3TAR A;  2VG7 A;  1Z26 A;  2X6N A;  1WAJ A;  3D0P A;  5CYM A;  3HXM A;  3SCX A;  4FJJ A;  1LWE A;  3DLH A;  1WNS A;  3U6F A;  4FM1 A;  3MXM A;  4O55 A;  4PUO A;  3MEC A;  3VA3 A;  2A1R A;  3OYB A;  3KTQ A;  3LP1 A;  4Y1C A;  3E01 A;  3HPH A;  4FJ5 A;  4C8L A;  2IC3 A;  1RT1 A;  1TKD A;  2QKB A;  2G8K A;  4Q0B A;  1C1A A;  3TAB A;  4FW2 A;  4M3R A;  3PO4 A;  1L3S A;  4CEC A;  2Z1J A;  3T19 A;  5J2M A;  2OZS A;  4KB0 A;  4ZTF A;  3AVH A;  3VQ5 A;  5J2N A;  1RDD A;  4DU4 A;  3HVT A;  1RDB A;  1S1W A;  4OVL A;  3L2V A;  4B9U A;  1CZB A;  3FFI A;  4DFM A;  3L3U A;  4I9L A;  3OJS A;  2QKK A;  1TKZ A;  2ZQB A;  4E7I A;  1BI4 A;  4W5R A;  3U3Y A;  3VQQ A;  3S3O A;  3AA5 X;  4HUF A;  1XC9 A;  3LAL A;  3WNF A;  1J53 A;  3ZT2 A;  4DTO A;  4FZZ A;  4JS4 A;  3RR7 A;  3TAE A;  3M8Q A;  3F9K A;  2XY5 A;  1KLM A;  4O5B A;  2O4I A;  4KB1 A;  3LZI A;  4Z4G A;  4DSF A;  1RT3 A;  3OYG A;  2HVH A;  4CJT A;  1D8Y A;  4RW8 A;  3KD1 E;  1EX4 A;  3ZSR A;  3L8B A;  4OKK A;  1RT4 A;  2YNF A;  4KRE A;  3OY9 A;  1S9E A;  1TAQ A;  3KK3 A;  3V6D A;  4H4O A;  2Y1J A;  4W5O A;  1HYZ A;  3TAG A;  1TL3 A;  1RTI A;  3LPU A;  3QIO A;  3OVN A;  1IKW A;  1RT6 A;  3KK1 A;  3IG1 A;  3JYT A;  2E4L A;  2R7Y A;  3OYI A;  1CLQ A;  4CEA A;  4LSL A;  4FZX C;  4FJN A;  4AHC A;  3SV3 A;  4N5S A;  4M42 A;  3HO1 A;  3KKR A;  4FM0 A;  3SQ0 A;  1T03 A;  4E3S A;  5J1E A;  4BE1 A;  2OPR A;  1C0M A;  2DFF A;  5SWM A;  5HRO A;  1BGX T;  3VQ9 A;  1RCH A;  2OPP A;  3SNN A;  2KZZ A;  4FLV A;  3RMC A;  4B8C A;  3O3F A;  2ZE2 A;  3RR8 A;  1DTT A;  2RKI A;  1NOY A;  2PYJ A;  4M3T A;  3NDK A;  4KI4 A;  1KVA A;  3C95 A;  4IDK A;  4M3X A;  3AO1 A;  3EYZ A;  4DSK A;  2FBY A;  2ZD1 A;  4M3Z A;  3H08 A;  4CHQ A;  4DU3 A;  3DLG A;  3V1Q A;  2QXF A;  1ZBU A;  4CES A;  3HP6 A;  4DS4 A;  1ZBL A;  2PY5 A;  3AVL A;  4NCG A;  4CHO A;  2FC0 A;  3IRX A;  1JXE A;  3SQ1 A;  4J2A A;  4CIF A;  1VSE A;  1WAF A;  3MXJ A;  4R5P A;  3LWL A;  4F8R A;  2PYL A;  3V9X A;  4NCB A;  3QLH A;  1SL0 A;  4LY7 A;  1UA1 A;  3AV9 A;  3K57 A;  1JXB A;  2YHA A;  3RTV A;  5FRN A;  4QCL A;  4JS5 A;  3ALY A;  2RN2 A;  3HYF A;  4M45 A;  4CJU A;  4HUG A;  4E7J A;  3SUQ A;  1S1X A;  3U3G A;  1J5O A;  3CFP A;  1U49 A;  3K5O A;  4CJ3 A;  3M8R A;  4KHS A;  2WOM A;  3SV4 A;  2E6L A;  3G0Z A;  2FBX A;  1XI1 A;  5DK5 A;  4M3W A;  3HT3 A;  4FK4 A;  3AO3 A;  4FJ8 A;  4B8A B;  5HRP A;  3V9S A;  1RBU A;  3NH0 A;  3QNN A;  1L3T A;  5CZ1 A;  1HRH A;  4FLY A;  4AHS A;  4B9L A;  3LP0 A;  4BE2 A;  1X9S A;  1I39 A;  3HST B;  3DMJ A;  1TKX A;  3RMB A;  1RBS A;  4JLH A;  1Z25 A;  1JLC A;  3DLE A;  4DTJ A;  4W5Q A;  1ASW A;  1XHZ A;  4J2B A;  4DG1 A;  3QO9 A;  1A5X A;  4CHP A;  2KFN A;  1T7P A;  1ZBH A;  3ISN C;  4KFB A;  4E0D A;  4BDY A;  3QIN A;  1NKC A;  1N5Y A;  1KTQ A;  4F3O A;  5JS2 A;  4Z0U A;  1DLO A;  3NF6 A;  4CF8 A;  3RRH A;  2B5J A;  1NK6 A;  4KHY A;  4CK2 A;  3NH1 A;  4DU1 A;  1D9D A;  2XY7 A;  4GW6 A;  3QEX A;  1QS4 A;  3PO5 A;  3RWU A;  2VG5 A;  3JSM A;  2Z1H A;  4FJL A;  4CJL A;  1JLQ A;  4E19 A;  4OPK A;  2ITG A;  4CJ5 A;  2G8H A;  2KFZ A;  4DFK A;  4AHT A;  4IG0 A;  5E41 A;  2XY8 A;  1VSJ A;  4J2D A;  3OYD A;  3KKS A;  3L3V A;  1NJZ A;  3B6O A;  3S3N A;  1RTD A;  3MED A;  1LV5 A;  5HRR A;  4CHZ A;  1UA0 A;  1B9F A;  4LD0 A;  4I7F A;  4CEZ A;  4AHR A;  1G15 A;  3OYL A;  4JRQ A;  1JL1 A;  3D45 A;  4FK2 A;  1I3A A;  4IBN A;  3TWH A;  1HQE A;  4IG3 A;  4CEF A;  3V81 A;  5J2Q A;  3DM2 A;  4DFJ A;  3AO2 A;  3CG7 A;  5CYQ A;  3AVA A;  2X6S A;  3PX0 A;  3OYK A;  3TAQ A;  1BQN A;  4PQU A;  3ULD A;  1HJR A;  1YTU A;  3AA4 A;  3BGR A;  2HB5 A;  1JKH A;  4K8X A;  5KRS A;  3O3G A;  3VQD A;  2P5G A;  3OYN A;  3KLE A;  4CED A;  4CEO A;  2HNY A;  4CK3 A;  1RBT A;  3C94 A;  3MAQ A;  3OS1 A;  4BDP A;  4Z4C A;  3QEW A;  3PX4 A;  3P5J A;  1TAU A;  2GV9 A;  3L2Q A;  1SUQ A;  3VQ6 A;  1JLA A;  3QEI A;  3ZSQ A;  1IH7 A;  1WN7 A;  1NK8 A;  3K58 A;  2O4G A;  2X74 A;  3WNH A;  4B08 A;  4CHY A;  4EZ9 A;  3V1R A;  4HVJ A;  1S1T A;  1QHT A;  2HHU A;  4EZ6 A;  3AVC A;  2OYQ A;  1ASV A;  1RBR A;  3SUP A;  4GVM A;  1BIZ A;  3AVJ A;  4FLZ A;  2DY4 A;  3L2U A;  3NAE A;  4DTS A;  5C42 A;  3OS0 A;  4CF0 A;  1NKE A;  2KTQ A;  1MU2 A;  3B6P A;  2F96 A;  2Z1G A;  3LAK A;  3QNO A;  4PY5 A;  1QSS A;  2EHG A;  3PV8 A;  3LP2 A;  4CJE A;  3TI0 A;  4NYF A;  1B92 A;  1UOC A;  1VK0 A;  1LW2 A;  3K59 A;  1VSL A;  1KCF A;  1NK4 A;  2HHV A;  2DTU A;  4ICL A;  3CM6 A;  3DRR A;  5K14 A;  3KJV A;  3OS2 A;  3HPG A;  3NHG A;  3IAY A;  2BGG A;  2F8S A;  4QOZ B;  4CGJ A;  1S5J A;  2GUI A;  4DTX A;  1JLF A;  4RW6 A;  5KGX A;  1RDC A;  2G8W A;  1TV6 A;  3ZSO A;  4IKF A;  3CFO A;  1WSH A;  4Y1D A;  1BIU A;  3HL8 A;  3LP3 A;  5HBM A;  1SKS A;  1TK5 A;  4JRP A;  3ZT3 A;  1LWC A;  3IS9 A;  3SZ2 A;  3MEG A;  3K5M A;  4CIE A;  4HTU A;  4FLT A;  1CXU A;  3SYZ A;  4I2Q A;  1X1P A;  3HVR A;  1NJW A;  4B9M A;  4IFY A;  4CEB A;  4DQS A;  4ID1 A;  3VQB A;  1NJY A;  4QAG A;  1LAV A;  1HQU A;  2D0A A;  4RW7 A;  3I8D A;  4FW1 A;  4AHV A;  3OYJ A;  2D0B A;  3NFA A;  3M8P A;  4CF9 A;  2YKM A;  2HVI A;  4Z4I A;  3PX6 A;  3PY8 A;  4M3U A;  1ASU A;  4PWD A;  4PA1 A;  3ZT1 A;  2HHQ A;  3AA3 A;  3NF8 A;  3MXI A;  2IDO A;  4W5T A;  4DTM A;  4B9N A;  4CEE A;  1HYS A;  4EP4 A;  4BAC A;  2G8F A;  2F8T A;  1JLE A;  3ZSX A;  1LAW A;  4CJR A;  1HPZ A;  2YNI A;  4FCY A;  4B9V A;  1X9M A;  1XWL A;  2HW3 A;  4OJR A;  1KVB A;  4YFU A;  2G8V A;  3K5L A;  1UAX A;  2I5J A;  4KO0 A;  3V9W A;  1KRP A;  1EKE A;  4B9T A;  3VN5 A;  1TGO A;  4KTZ A;  3VA0 A;  1ZBF A;  1C0U A;  1J54 A;  1YVU A;  2DFE A;  4CJF A;  3NH2 A;  2Y1I A;  1FKO A;  4DF4 A;  3SPY A;  3TR8 A;  2LSN A;  3DRS A;  3TAF A;  3NBP A;  4KTW A;  4NCA A;  3AA2 A;  1J9A A;  1BCM A;  3ASM A;  4E7L A;  1RT7 A;  5C25 A;  3CYM A;  1TK8 A;  4BWM A;  1VRU A;  3SUN A;  1Q8I A;  4C8O A;  4OLA A;  2A1S A;  4KI6 A;  3ZCM A;  1ZBI A;  3OJU A;  2G8U A;  1VSH A;  3QIP A;  3OYH A;  1HMV A;  1QQC A;  4OPJ A;  5D3G A;  3DOK A;  4BE0 A;  3AO5 A;  5JS1 A;  4O44 A;  4DQR A;  4KRF A;  4FJI A;  2G8I A;  4FK0 A;  1SKW A;  1SKR A;  4ID5 A;  4CJP A;  4CFD A;  4FVM A;  1U04 A;  4N76 A;  4KAZ A;  2BDP A;  4FJ7 A;  3BDP A;  2YNH A;  2RF2 A;  4HHT A;  1WLJ A;  5EU7 A;  1VRT A;  2Z1I A;  4LSN A;  5DMR A;  4KHW A;  3OYF A;  4FJK A;  1KFD A;  3HPO A;  2OPQ A;  3NF7 A;  1QSL A;  3DLR A;  1UWB A;  4H4M A;  1C0T A;  3V1O A;  3K2P A;  1W9H A;  4I2P A;  4DTR A;  4ELU A;  4MQ3 A;  4O0J A;  1Y97 A;  4CFC A;  1S1V A;  4KHU A;  1IKX A;  3VQE A;  4CHN A;  4FLU A;  3THV A;  3LAN A;  1IKY A;  3WNG A;  3TAN A;  4E7H A;  1NOZ A;  1KLN A;  4KHQ A;  4KKO A;  2YKN A;  1GOA A;  3C6U A;  1NKB A;  1IO2 A;  3UIQ A;  3AVN A;  2XY6 A;  3OYC A;  4E7K A;  4F2R A;  1VSI A;  3P83 D;  5HP1 A;  1GOC A;  5C24 A;  3AVM A;  4AH9 A;  1RTJ A;  1S6P A;  2B4J A;  3RMA A;  4FJH A;  4HCB A;  2HHX A;  2FBT A;  4BDZ A;  4CJS A;  3SUO A;  2HMI A;  4E1M A;  3S9H A;  3T3F A;  4AHU A;  4KPY A;  1U48 A;  5J2P A;  3SQ4 A;  3AVI A;  3ZT0 A;  3CQ8 A;  4Z4F A;  4CF1 A;  4RW9 A;  2YV0 X;  3MEE A;  3KLF A;  3QER A;  3F73 A;  3SPZ A;  2P5O A;  1JL2 A;  4C8K A;  4WE1 A;  1ITG A;  1JLB A;  3HK2 A;  1FK9 A;  4KV8 A;  4C8N A;  4OKJ A;  4E89 A;  4CCH A;  1KSP A;  3VQ7 A;  3DLK A;  4YNQ A;  3AVB A;  5FRO A;  4XIU A;  2BAN A;  1KFS A;  3PUF A;  1Q9Y A;  4AIL C;  3OYM A;  2AJQ A;  2KQ2 A;  3EZ5 A;  3CFR A;  1FXX A;  4FM2 A;  4I9Q A;  4OLB A;  3ZT4 A;  3L2R A;  2JLE A;  3QET A;  1W0H A;  3NF9 A;  1RIL A;  4OGE A;  3DOL A;  1RT2 A;  4M41 A;  3WNE A;  1SV5 A;  4CGD A;  3KK2 A;  1U4B A;  1NK9 A;  3TAM A;  1D9F A;  4DSI A;  1WSE A;  2XHB A;  3QES A;  4TSX A;  2VWJ A;  4FJ9 A;  1SL2 A;  3AO4 A;  4BWJ A;  2VG6 A;  3VQC A;  2BE2 A;  3HM9 A;  1VSM A;  2D0C A;  4OGC A;  4DLG A;  1B9D A;  3KLI A;  1EP4 A;  4CK1 A;  4HCC A;  2RPI A;  3T1A A;  3VQA A;  3ZSW A;  1U45 A;  3LDS A;  2YHB A;  4N47 A;  4ELV A;  4F2S A;  4M3Y A;  3HJF A;  4IFV A;  5T7B A;  2EX3 A;  2IAJ A;  3NGZ A;  4HUE A;  4CER A;  1JLG A;  1S1U A;  5KGW A;  1Q9X A;  4G1Q A;  3LZJ A;  1VSD A;  1RBV A;  3V9U A;  1A5W A;  1L3V A;  1IG9 A;  3RRG A;  4CGH A;  1EET A;  4B9S A;  4DWI A;  3NE6 A;  1LW0 A;  1YTA A;  3O4N A;  4MFB A;  1T05 A;  1K6Y A;  1T8E A;  4N41 A;  4LH4 A;  3LWM A;  3KLG A;  3VQP A;  4DQP A;  2HHT A;  4CEQ A;  4H8K A;  3OYA A;  3EY1 A;  4LH5 A;  4CFB A;  1NJX A;  2ATQ A;  1WSF A;  3P1G A;  4EP5 A;  3NCI A;  4O4G A;  1LWF A;  4N56 A;  3L2W A;  1TL1 A;  2P1J A;  3DI6 A;  1QSY A;  1BHL A;  1C6V A;  4ZHR A;  2WON A;  2OPS A;  1VSK A;  1S6Q A;  2HHW A;  2W42 A;  4CF2 A;  4CJQ A;  3K5N A;  1F21 A;  3KD5 E;  5CZ2 A;  3A2F A;  3QEV A;  3LPT A;  5HLF A;  1RT5 A;  4E1N A;  2JGU A;  4J2E A;  4Q5V A;  3KIO A;  4DTP A;  1SL1 A;  3TAP A;  4ELT A;  3SI6 A;  2D5R A;  4DSE A;  1TK0 A;  4Z4E A;  3CM5 A;  1EXQ A;  4CJK A;  2XO7 A;  5KRT A;  4NYN A;  5KI6 A;  1BI4 B;  4FLW A;  2KZM A;  1A5V A;  4DTN A;  3DLB A;  1HNI A;  3DYA A;  3LAM A;  3NGY A;  2HND A;  2DFH A;  1NK7 A;  4FLX A;  3SQ2 A;  2KW4 A;  5FRM A;  3ZSZ A;  1KVC A;  1C1B A;  1NK5 A;  2E6M A;  2GBZ A;  3ITH A;  4DMN A;  3RMD A;  4ZTJ A;  1BIS A;  1IKV A;  5HRS A;  4DQI A;  1YT3 A;  2P51 A;  1N6Q A;  2NUB A;  1QE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...