3ZSYA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsyA00
2DY4A 3WNEA 1N5YA 2BANA 5KRSA 1VSDA 4Z4FA 4G1QA 3AVJA 1RBSA 3DLBA 3CFOA 1J5OA 4OKJA 1WNSA 4EP4A 3PY8A 1RNHA 4KB1A 3V4IA 1TKZA 3G10A 3BGRA 3QIOA 1X9SA 1KVBA 3F73A 3SZ2A 4FK0A 4CK1A 4O0IA 1DTQA 4KHUA 1HRHA 3SJJA 3UIQA 1U47A 4FJ5A 4CEOA 4BDYA 4C8MA 3L2WA 1RDBA 3OYDA 4DU3A 4IKFA 1TKXA 3QLHA 4CEDA 1VSHA 4NCAA 1NK7A 5HRNA 3OYEA 3EZ5A 4BE0A 1ZBFA 3KKRA 3HK2A 4ZTJA 3SUNA 3NF9A 3ZSZA 1IKYA 4KHWA 5CYQA 4JRPA 5J2MA 3AO4A 1C0MA 3L3VA 1RBTA 3LAKA 3ZCMA 3ZSQA 3O3GA 4B8CA 3BDPA 2Z1HA 3C6UA 3OY9A 1YVUA 3SNNA 1D9DA 3VQDA 3RMAA 1C6VA 4W5RA 4CJRA 3IG1A 4AILC 3I0RA 4CIEA 4DWIA 1I3AA 2E6LA 2VWKA 1NOZA 3ZT2A 4M3XA 1J9AA 4W5TA 1B9DA 3O3HA 1QTMA 2XY6A 4KHYA 4M45A 1F21A 1Z25A 4FJIA 5C24A 2I5JA 5KGXA 4UQGA 1WSHA 1NK8A 2ZD1A 4DFPA 1RDAA 4DTJA 1VRUA 1IH7A 1WSGA 4CJSA 3QINA 1K6YA 3VA0A 4ZHRA 3OVNA 3AO5A 3IRXA 1EP4A 4CGFA 3NE6A 1QS4A 3VQBA 2YV0X 3DI6A 3QETA 4KV8A 1D9FA 3HO1A 4Z0UA 1FKPA 4RW9A 4I2PA 3VQ8A 1L3SA 3QERA 2IS3A 1RT5A 4N47A 4FJ8A 3DLEA 1ASVA 3QNNA 3LANA 1C0TA 1SL2A 3TAMA 4DQIA 4C8NA 1SKSA 4IDKA 3VQ7A 4CK3A 3TR8A 1HYZA 5J1EA 4ZTFA 4B9SA 5JS1A 4DU1A 4B9TA 2VG7A 3HPGA 3VQQA 4J2EA 4J2AA 3HVTA 3LALA 4DQQA 3OYNA 2DTUA 3ISNC 3RR8A 4M3WA 5C25A 1CXUA 4CK2A 2G8KA 1W0HA 1XHZA 2VWJA 4B9VA 2O4IA 3I8DA 3FFIA 1C0UA 4FCYA 2QXFA 3VQ4A 1TAQA 3QEXA 4Z4HA 4HVJA 4J2DA 2Q3SA 3NH1A 3OS2A 1TK5A 1SUQA 4FJMA 1QSYA 3HPHA 4CJ5A 3VQEA 2P5OA 1RTIA 4KHQA 4CJQA 4IBNA 1L5UA 1ZBIA 4KKOA 1LW0A 1UA0A 1Q8IA 2HNDA 2IC3A 3B6OA 3DRPA 3P1GA 3TWHA 3C6TA 4E19A 4FLYA 2O4GA 3NFAA 2X74A 4AHCA 3TAQA 3C94A 1WSEA 1YT3A 2G8FA 2B4JA 3RR7A 4BDPA 2Y1JA 3NGYA 4CHYA 1EX4A 1HYVA 3LDSA 3K5OA 1RDCA 3NF8A 4LY7A 4AHSA 4GMJB 4H4OA 1ASWA 2P5GA 1GOAA 4CJKA 3OYMA 3HXMA 3SUQA 1ZBHA 2G8VA 3THVA 1KFDA 1RT4A 3NF7A 4QAGA 3HM9A 4E0DA 2ZQBA 3DRRA 3LWLA 4FLWA 1NKBA 4KFBA 4KREA 3OYJA 4B9NA 3AVGA 2KZZA 3H08A 1RTHA 1WN7A 1C1AA 4EZ9A 1S1TA 3SUOA 3VA3A 2Z1IA 3VQ5A 4RW8A 2ETJA 1VSJA 5SZTA 1C1CA 3LWMA 3RMDA 2HHSA 3RRHA 1S1VA 3VQ6A 4Z4CA 4CHQA 3VQCA 4AHUA 2GUIA 3VQPA 5J2QA 4ELUA 4PA1A 4FLTA 2IDOA 3KLEA 2PZSA 4L8RB 2BDPA 2OPRA 1X9MA 2HNYA 4E7HA 1CLQA 3ZT3A 4CJVA 1LV5A 1G15A 1LWCA 1S9GA 3OYKA 4QOZB 3TAEA 2DFFA 5FDLA 4DF8A 3AVLA 3LP3A 1NKEA 3U3YA 2HHTA 1L3UA 1LWFA 3MXJA 1RT2A 3V1QA 4E7KA 1VSIA 3CQ8A 3QIPA 4DFJA 4F2RA 4CHZA 3L3UA 1TK0A 3V1RA 4KI6A 4KHSA 3LP0A 4M3UA 3K57A 3MEEA 2FBVA 3CFRA 3DLHA 1UAXA 4K8XA 1RDDA 3KLHA 2OYQA 2AJQA 4AHTA 1X1PA 1NJZA 1CXQA 3DLKA 1WAFA 4R5PA 2YNHA 4DMNA 3MXIA 4FW1A 4Z4GA 1S6PA 4HTUA 3AA3A 1REVA 5DMRA 4LH4A 1GOCA 4B9UA 1NJXA 3ZT0A 4DLEA 1SKWA 2X6SA 2X78A 3HYFA 2KFZA 2RN2A 4FM1A 3KKSA 1ITGA 3F9KA 3SQ2A 1JLAA 3ZSXA 4CGHA 4GVMA 2OZMA 4F3TA 4CEBA 4DF4A 3LPTA 4ID5A 3L2RA 3PX6A 5KI6A 4C8KA 4DFKA 1TVRA 2P51A 3ZT1A 4DTXA 5HROA 4OLAA 1JKHA 3LP2A 5J2NA 4NCGA 1RT3A 3SPYA 3AO2A 4W5OA 4CIGA 4M3RA 1RT7A 3K5LA 1NK4A 1BGXT 4IFVA 3M8RA 2IGIA 1B92A 2F8TA 4F3OA 4CFCA 2QKBA 1XWLA 4FZYA 3AO1A 3U6FA 1KSPA 2WOMA 4IFYA 2ZE2A 3U3GA 1KVAA 3SQ0A 4CJFA 4HHTA 2KFNA 3KLFA 2HHXA 4CHPA 3OJUA 3K58A 1VSLA 5FRMA 4GW6A 1CZ9A 4E7JA 4KB0A 4FJ7A 3NCIA 1Q9YA 4M3ZA 4OLBA 4B3OA 1SL1A 3KD1E 1ASUA 2HVHA 1JL1A 4JS5A 3CYMA 3M8PA 1A5WA 1T03A 1HYSA 2YHBA 4DQSA 5CYMA 4CHOA 1NKCA 3RRGA 1XC9A 4LD0A 3AA5X 4AHVA 1QE1A 4DLGA 1L3VA 4PUOA 1QSLA 2OZSA 1KVCA 5T7BA 1MU2A 4W5QA 3TAFA 1RCHA 3QO9A 4JS4A 1BISA 4B08A 3K59A 1WSIA 4I2QA 1FKOA 1BHLA 1RT6A 1NK6A 3PO5A 1Z26A 4PQUA 3ITHA 1IKWA 4AHRA 3LZJA 4DG1A 2A1SA 1T7PA 3QEIA 1HJRA 4MQ3A 1JLEA 5K14A 3K5NA 4Q0BA 3QEVA 1U45A 2QKKA 4FJLA 4CF0A 1NOYA 2OA8A 4C8OA 1JLCA 1ZBLA 4DFMA 1HQEA 1LAWA 1KRPA 1S5JA 4FZXC 4BWMA 2GBZA 2XO7A 4CCHA 5I42A 4FLUA 4CF9A 1HMVA 3DM2A 4TSXA 4M3YA 3KIOA 4CIFA 2HW3A 4CESA 2P1JA 3DLGA 3E01A 3SQ1A 2RKIA 4FXDA 5KRTA 3VQAA 3MEDA 1QQCA 3AVFA 2X6NA 2E6MA 5CY4A 4BWJA 4DTPA 3NDKA 4O55A 4N41A 3RTVA 4KTWA 4E1NA 3SCXA 5HLFA 2HHVA 3TI0A 3DOKA 4NCBA 1YTUA 3TAPA 3D0PA 4OPKA 2YKMA 4I7FA 4B9MA 1RBRA 4LSNA 2VG5A 1S1XA 3V1OA 3QEWA 2FBXA 3PX0A 1XI1A 1ZYQA 1JXEA 1LW2A 4FZZA 4CEQA 1VRTA 3LAMA 1RILA 3AVNA 4NYNA 2ATQA 2W42A 2HHUA 3SV4A 1TGOA 4KRFA 3LZIA 4RG8A 4FJGA 4JRQA 3EYZA 1T8EA 4K8ZA 3CM6A 4RW7A 3SUPA 4CFBA 2XY5A 4DTRA 5KTQA 4DQPA 3L2VA 1TAUA 3OYAA 2G8IA 4W5NA 3OYGA 4F4KA 1YTAA 2KW4A 1TL3A 3PUFA 1EKEA 3O4QA 4LSLA 4O44A 4DU4A 3QEPA 4OKKA 4EZ6A 2D5RA 1KTQA 1BCOA 2IAJA 3MXMA 1KLNA 3M8QA 3HSTB 2YKNA 4CEZA 4Z4IA 3PV8A 1HPZA 5I3UA 1GOBA 2QK9A 1O1WA 1BQMA 1SKRA 1JXBA 4FLXA 4B8AB 5HRSA 3QESA 3AVBA 4FLZA 1XHXA 1TV6A 3LPUA 4KTQA 4IG3A 2GV9A 3QNOA 3DOLA 2OPPA 3CG7A 2BE2A 4NYFA 1S1WA 3V81A 3S3OA 4KHNA 4O4GA 2EX3A 3NGZA 4ELTA 4CJPA 4HCBA 2FBYA 4HUGA 2F8SA 3M8SA 1RT1A 4OPJA 2YNFA 4N76A 3KLGA 1BQNA 4M42A 4J2BA 4Z4EA 1J53A 3WNFA 1C1BA 3RMBA 4CJEA 5D3GA 4CJ3A 4FJ9A 3KD5E 3JYTA 3V9UA 5FRNA 3VN5A 2YHAA 3A2FA 2JLEA 5JS2A 3L2UA 3KK3A 5KGWA 1HNVA 1UOCA 4CGIA 4CFAA 4PY5A 4E1MA 4CF2A 3NF6A 1U04A 4JLHA 3DMJA 3DRSA 1IKVA 4CEAA 4E89A 3OYBA 4HUEA 1T05A 2KZMA 1JL2A 4ID1A 3TANA 4DSJA 3AA2A 3HP9A 3D45A 1A5XA 1U49A 1I39A 3MECA 3SPZA 3ZSYA 1JLFA 1X9WA 1N6QA 4CJUA 2Y1IA 1WSFA 3NH2A 3AVCA 2ITGA 4OJRA 4DSLA 4Q5VA 3HP6A 3OYCA 3K5MA 3G0ZA 3IS9A 1FXXA 4WE1A 1BCMA 1QHTA 1TKDA 1BL3A 1UWBA 4H8KA 4CERA 5DK5A 3JSMA 1WSJA 2HNZA 2LSNA 4YFUA 3AVIA 4I9QA 3P5JA 4IG0A 4O0JA 4DS5A 1Q9XA 4CEFA 3NH0A 1NK9A 2XRIA 3KJVA 1IO2A 5J2PA 3SQ4A 5FROA 2EHGA 3S9HA 4EP5A 3WNGA 2A1RA 3ZSWA 2XY7A 1U4BA 1RTDA 4Y1CA 5SWMA 3RWUA 2DFEA 3B6PA 1D8YA 3S3MA 4BE2A 3AVHA 5HRPA 3NGIA 4O5BA 2HVIA 1RBVA 4KI4A 4DTOA 4MFBA 4CFDA 5EU7A 2KQ2A 4LH5A 3V9XA 2FBTA 1IKXA 1HNIA 1KFSA 3ALYA 3OS0A 4FJXA 2OPSA 3CFPA 4DTMA 5HRRA 4DSFA 1DLOA 5CZ1A 4CJTA 3V9WA 3S3NA 4CGDA 4YNQA 1S9EA 3AV9A 3HPOA 4DQRA 3VQ9A 4QCLA 3SV3A 3V6DA 4C8LA 3DYAA 4RW4A 4PWDA 4OKEA 3NHGA 3PX4A 3OS1A 1NJYA 1TK8A 4FJJA 4DSIA 1VSEA 1LAVA 2D0AA 5HBMA 5HP1A 1SV5A 4KO0A 1S6QA 3AVMA 4CGGA 1BI4B 1EETA 2VG6A 4CJ4A 2Z1JA 2OPQA 4FM2A 3C95A 2JGUA 4DTNA 2G8WA 4FYDA 3MEGA 3P83D 2E4LA 3AA4A 4CHNA 3T3FA 1R0AA 4DSEA 2HHQA 2G8UA 3KTQA 1Y97A 4E3SA 3OYIA 4DTSA 3OJSA 2HMIA 4E7IA 2Z1GA 4FLVA 2DFHA 1JLQA 1ZBUA 3ASMA 4DSKA 2HHWA 4M41A 4F2SA 4CEEA 2XHBA 1NK5A 3TARA 2B6AA 4ICLA 1KCFA 2YNIA 1JLGA 1RBUA 1TKTA 3EY1A 1CZBA 1WAJA 4HUFA 4OGCA 3PO4A 2D0BA 4B9LA 1KLMA 1VSFA 1J54A 1IG9A 4N5SA 1NJWA 3LP1A 2WONA 1DTTA 1B9FA 2D0CA 3AVKA 3KK2A 1A5VA 2IOCA 5CZ2A 4CJWA 3ZT4A 1SL0A 3CM5A 3NBPA 3ZSVA 4CGJA 4BE1A 1FK9A 2PY5A 1VSKA 4AH9A 3T1AA 2RF2A 1JLBA 2RPIA 4CE9A 2YNGA 3ZSOA 4XIUA 4FM0A 3OYFA 1QSSA 4FJNA 1LWEA 2XY8A 1VK0A 4FVMA 3MAQA 3V9ZA 3HVRA 4KAZA 1BIUA 3ZSRA 4RW6A 1BIZA 2BGGA 3T19A 4KTZA 3O4NA 4OGEA 4CF1A 4N56A 2R7YA 1VSMA 4DS4A 4KPYA 2FC0A 3AO3A 5C42A 3O3FA 1UA1A 4HCCA 4FJHA 1U48A 2F96A 3HL8A 4CECA 3SYZA 4ELVA 4BDZA 1BI4A 4FK4A 4DTUA 2PYLA 3SI6A 1NK0A 2B5JA 3AVAA 2NUBA 4FK2A 4H4MA 3HT3A 4CJLA 5E41A 3NAEA 1EXQA 3KK1A 3ULDA 3HJFA 3KLIA 4Y1DA 3L8BA 2G8HA 1WLJA 3I0SA 3L2QA 1L3TA 4M3TA 4CF8A 1HQUA 2PYJA 3OYLA 4FW2A 1TL1A 3OYHA 2HB5A 4I9LA 4OVLA 4BACA 3IAYA 3RMCA 3TABA 3DLRA 3K2PA 1D5AA 4E7LA 1S1UA 1W9HA 1RTJA 4F8RA 4FJKA 3V9SA 2KTQA 3TAGA 3WNHA
chains in the Genus database with same CATH superfamily
2DY4A 3WNEA 4BC3A 5JVHL 3J7YP 3CFOA 1HNXK 3MN5A 3R1XA 4KB1A 3V4IA 1TKZA 1KVBA 1Q18A 4BVOA 4JI1K 4FK0A 4NXNK 1DTQA 5AQQA 3UIQA 3UKUB 4JV5K 4CEOA 2QWMA 4DU3A 1RDBA 4IKFA 1TKXA 3QLHA 4CEDA 1NK7A 5BRHA 4K43A 3CQYA 3FZKA 4BE0A 3KKRA 3HK2A 4GKKK 3SUNA 4FOIA 3CPEA 4H0PA 3CCQN 4JRPA 4BRQA 5J2MA 3ZEUA 3L3VA 1VQMN 1RBTA 4EHUA 2E2NA 4W5RA 3IG1A 1I3AA 3VGKA 1J9AA 3U8XA 1B9DA 4FJIA 5C24A 2I5JA 5KGXA 3GG4A 2ZD1A 4DTJA 1IBLK 3AO5A 3NE6A 3QETA 5LJWA 3HO1A 4Z0UA 4I2PA 3NMUA 3QERA 4FJ8A 4JEPA 3T1YK 1VQKN 3QNNA 1C0TA 4DQIA 5AQRA 5C0YA 1HYZA 1C0GA 3ID6A 5FPEA 3EE8A 5C2DA 5BREA 4CZEA 3M3ZA 3OYNA 1QQOA 4DR3K 1K8KA 4BRDA 5TKYA 3KVGA 2UU9K 2BUPA 4Z4HA 3NH1A 1SUQA 3CXCM 2P9NA 1RTIA 4CJQA 4IBNA 1JCGA 1L5UA 3S41A 3ENBA 2IC3A 3P1GA 3DRPA 3C6TA 3MCAB 1WBDA 3ATUA 3ENHA 1YJNN 3J7ZO 2Q97A 3RR7A 4CHYA 4PHTX 1X9JA 1RDWX 3MWPA 2P5GA 1ASWA 2PBDA 4YORA 3OYMA 1QQNA 3SUQA 2HBLA 1ZBHA 4DV1K 2G8VA 2GWKA 4CZMA 1KFDA 3NF7A 4QAGA 4E0DA 4JN4A 3LWLA 4WF9L 5IT9O 1NMDA 4K0KK 2GWJA 4KREA 2KZZA 4EZ9A 1C1AA 4DV0K 1VSJA 1C1CA 3RMDA 1YUWA 4CHQA 4QS8A 4AHUA 4DR2K 4L8RB 3KWGA 1MWMA 3PSFA 3WEEB 1X9MA 2HNYA 3ZT3A 1FJGK 1HR0K 4QOZB 3TAEA 1G99A 5FDLA 4FL9A 2GEMA 3AVLA 1JJ2M 3VEOA 1DKGD 1QVFM 1VSIA 3QIPA 3HI0A 4F2RA 3ZLJA 3V1RA 5F0XA 3K57A 4K41A 3DLHA 4K8XA 1RDDA 3RVCA 5EX5A 4LF6K 1NJZA 2YNHA 1JCEA 3AA3A 1REVA 4JKEA 4M63C 5DMRA 2A6AA 4LH4A 2JWKA 4B9UA 1NJXA 3CCEN 3KKSA 1ITGA 3F9KA 3FFKB 3SQ2A 4GVMA 4DF4A 3PX6A 5KI6A 1TVRA 4DTXA 5HROA 4GVEA 3AO2A 3T7ZA 4W5OA 1NK4A 2A5XA 1YI2N 2IGIA 1B92A 2F8TA 1GLLO 2E2QA 3AO1A 4I6MA 1KSPA 4IFYA 2AA4A 4JAXA 4LF4K 2KFNA 3H46O 3OJUA 5FRMA 1CZ9A 4FJ7A 4B3OA 4OLBA 1SL1A 3KD1E 1ASUA 4IOAL 4A2AA 1MWKA 1T03A 1HYSA 1A5WA 4BRPA 2YHBA 4CHOA 3RRGA 2P9PB 1QSLA 4FPAA 2Q1NA 5T7BA 1MU2A 5C2FA 4DKWA 1NGDA 1WSIA 2BTFA 1S72N 1KD1O 3H1QA 1U2VA 3A8YA 5BR9A 4PQUA 3MN7A 4H0XB 3SAGA 5CR4A 3FZHA 3O9SA 3KWIA 2ZJPL 3CD6N 3VEWA 5E84A 3MX5A 1E3MA 5HL7L 1KRPA 5I42A 4JK9A 1HMVA 4M3YA 3DLGA 3E01A 3SQ1A 4FXDA 3CC2N 1GLBG 3BEXA 2X6NA 3FZLA 3U9DA 1VQ7N 1IBKK 4KTWA 4E1NA 1TYQA 3SCXA 5HLFA 2HHVA 3DOKA 1DGKN 4YHHK 3O4WA 1N34K 1ESVA 4BRHA 1JXEA 1LW2A 2HMPA 4FZZA 1RILA 4NYNA 2W42A 3C6HA 3VEXA 4IO8A 3EYZA 1T8EA 3CC7N 3SUPA 4CFBA 4B3RK 1U6ZA 1TAUA 3OYGA 4F4KA 1YTAA 1SAZA 3AARA 3PUFA 3O4QA 4LSLA 3QEPA 3EKUA 4EZ6A 1KLNA 3M8QA 4CEZA 1D4XA 4DV6K 1SKRA 1JXBA 3K0SA 4FLXA 3AVBA 3CIPA 3LPUA 4CI6A 2E2PA 2OPPA 2BE2A 3S3OA 3V81A 4ELTA 4XEIA 3NGZA 4FWRA 3G6EN 1Z05A 4HUGA 2HBMA 4FWKA 5BPNA 1EWQA 4WFBL 1J53A 4JKGA 4CJ3A 5AZIB 4X65K 5FRNA 3VN5A 5M1FA 2UYTA 5JS2A 3L2UA 3MN6A 3GBTA 4PY5A 2VWJA 3NF6A 1U04A 4CEAA 3DRSA 1T05A 1IKVA 1EO1A 4DSJA 1KC8O 3HOTA 1I39A 3MECA 4JKFA 3ZSYA 3CF5L 2ITGA 2ZGYA 3K5MA 3OYCA 1BL3A 4H8KA 3JSMA 3CI5A 2LSNA 4YFUA 4I9QA 3OBYA 2I7PA 4IG0A 4CEFA 2XRIA 3KJVA 1IO2A 2QWQA 3N4QA 5FROA 5J2PA 3I33A 3S9HA 4EP5A 4NO7A 5LMNK 2XY7A 3VF4A 2PFUA 3TU5A 2IVOA 5JMVA 1HUXA 3A0IX 5JLFA 4XH4A 3U9ZA 4O5BA 3A5OC 2W41A 2QEXN 2KQ2A 4LH5A 4YOWA 4V19S 4FJXA 3CMAN 2O8DA 1DLOA 3S3NA 3VQ9A 1IBMK 4C8LA 1NJYA 1NNEA 1IJJA 3D6RA 4BRGA 1VSEA 2D0AA 5HBMA 5GIPA 1NGCA 3OBWA 2QWOA 1BI4B 1EETA 4CJ4A 3C95A 3CERA 5LL6Z 3T3FA 2E4LA 3Q7CA 5AZJB 4FWMA 3CJ1A 2G8UA 3KTQA 3OYIA 1DEJA 2HMIA 4CZIA 2O8CB 1JLQA 2HHWA 3ASMA 1E4FT 4DSKA 1W7AA 3F9MA 1NK5A 3TARA 1NGHA 3ENOA 1ILYA 2YNIA 2P9SB 3C65A 4HUFA 1WAJA 4WQ4A 3PO4A 2D0BA 3BUZB 3H6EA 3CCSN 1VSFA 4IJNA 4N5SA 3H45C 3LP1A 1DTTA 1B9FA 5M1KA 2IOCA 5CZ2A 3NBPA 3SMSA 4JI3K 1FK9A 1VSKA 3T1AA 2O8BA 3QFUA 3WXJA 1LWEA 4FVMA 3O1WA 3GOIA 2YCHA 4H03B 2Q0RA 2BGGA 5LY3A 4N56A 1QQMA 3EE9A 5AQIA 3VESA 1UA1A 4DQ8A 4BQLA 3DAWA 4FK4A 1NGEA 2GTDA 4DTUA 3SI6A 4GV9A 2B5JA 3AVAA 2NUBA 4FK2A 4H4MA 1BG3A 4CJLA 2EWSA 3KK1A 3G71N 3HJFA 3KLIA 3SMPA 1L3TA 3EN9A 4M3TA 1LCUA 4I9LA 3J7AP 4BACA 4BR2A 1NG9A 4F8RA 4UY8O 3V9SA 3TAGA 5KRSA 1VSDA 4G1QA 3K9JA 3A5MC 3VEVA 1J5OA 1KQSM 4OKJA 1WNSA 4EP4A 3W3DA 4CZHA 3G10A 3BGRA 1NGBA 4O0IA 4KHUA 1HRHA 3G25A 3THXB 2P9IB 4X62K 1U47A 3DXMA 4C8MA 4KH4A 5AJ3K 4M7XA 1ZBFA 4CZGA 4ZTJA 3NF9A 3ZSZA 3WT0A 1R59O 2UUBK 1C0MA 4WFNL 3M5RA 5HOOA 3ZCMA 3BDPA 3C6UA 3OY9A 3VETA 2F7TA 1D9DA 3VQDA 5EOYA 4CJRA 3VEZA 3HM8A 4CIEA 2J4RA 2VWKA 2NNWA 2OCEA 5EXWA 4M3XA 4JI0K 2F9WA 2XY6A 1F21A 1Z25A 4UQGA 5GAGP 1NK8A 4O8KA 4DFPA 1RDAA 3H1VX 1VRUA 3O80A 1WSGA 1YAGA 2IVNA 4CJSA 3OVNA 5KPRA 3DI6A 4KV8A 1FKPA 4RW9A 4NB4A 1L3SA 4N47A 3AAQA 5GIOA 4BRCA 1X3MA 3LANA 5KPZA 3QB0A 3TAMA 4IDKA 3LDOA 3TR8A 5J1EA 3WXLA 3VQQA 5BR8K 2E88A 3QFPA 3UKUA 4KH6A 4J2AA 1NGJA 3LDQA 5BRDA 4J2EA 2DTUA 4M3WA 3A5NC 4CVNE 2RHKA 3FFIA 3QEXA 2Q3SA 3OS2A 4EAHD 4MO5A 1QSYA 3M6GA 3VQEA 5F2RA 1ZBIA 3CJAA 3QDKA 4KKOA 3B6OA 3K9KA 4FLYA 5DM6L 4AHCA 1BWFO 3TAQA 3R6MA 3C94A 1WSEA 2NZTA 2Y1JA 3NGYA 3NF8A 4LY7A 4AHSA 4GMJB 4H4OA 1GOAA 3HXMA 3THVA 4LF9K 2ZQBA 4FLWA 4B9NA 4WQ5A 2ETJA 2HHSA 3D2EA 4FPBA 3RRHA 1N33K 1P8ZA 2IDOA 3KLEA 4F9OA 2OPRA 4E7HA 1LV5A 1OH7A 1S9GA 3IMXA 4DF8A 1LWFA 3MXJA 1RT2A 3V1QA 3CQ8A 4DFJA 4CHZA 3R3LA 1ZXOA 3BZKA 4KHSA 3LM9A 3RSEB 4HTLA 1VAZA 3AGRA 1UAXA 3CFRA 4AM6A 2AJQA 4AHTA 3VPZA 4ISFA 2VWBA 1CXQA 3DLKA 4R5PA 5B8HA 1GOCA 3DJCA 2X78A 2HHUA 2ZM6K 1JLAA 3ZSXA 5EY4A 4QS9A 3L2RA 4GKJK 4C8KA 4OLAA 2P51A 3ZT1A 3UB5A 1JKHA 5J2NA 3CQXA 3SPYA 2P9LB 4CIGA 3CJCA 1RT7A 2NRRA 1BGXT 3ZX3A 3M8RA 4CFCA 1XWLA 1Y64A 3U6FA 3ULEB 4KBOA 3HTVA 3U3GA 1KVAA 4IEEA 4A57A 4CJFA 3SQ0A 3WEEA 4CHPA 3CPWM 3OA9A 3OTOK 1Q9YA 4M7YA 3C0BA 2HVHA 3CYMA 5AR0A 3O9RA 4LD0A 4DLGA 1L3VA 3BF3A 1ZBSA 2OZSA 4W5QA 3TAFA 3G4SN 4JS4A 1BISA 3K59A 3TTFA 3PO5A 5AQFA 3PIOL 2W6LA 1NGIA 5ADXA 3QEVA 4FJLA 2UUAK 1JCFA 4C8OA 1JLCA 1LAWA 1S5JA 2GBZA 4FLUA 4TSXA 1WB9A 3C6AA 2P1JA 4CESA 1GLEG 3L4IA 4IOXA 4OPAA 1QQCA 1YXQA 3AVFA 3UKRB 4JKHA 5CY4A 4BWJA 4DTPA 1I94K 3HZ6A 4O55A 3RTVA 1NMNA 3TI0A 3LDLA 5AQXA 3KK7A 2Q0UA 2YKMA 4OPKA 4B9QA 5JVGL 4LSNA 2VG5A 3V1OA 3E66A 2FBXA 1Q81O 4R79A 2GUPA 3BF1A 1NGAA 3SV4A 3O1BA 2P9PA 4KRFA 3O6WA 4K8ZA 4WQ4C 4H5TA 1ZC6A 5KTQA 5FLXO 2G8IA 2PAVA 1EKEA 4O44A 4DU4A 4OKKA 1HPMA 5LMUK 1KTQA 3IKMA 3MXMA 4Z4IA 5BRFA 2D0OA 4JI6K 3QESA 1XHXA 1TV6A 4KTQA 4IG3A 2GV9A 2WC9A 5H1SQ 2IIRA 4NYFA 4X66K 4DB3A 3AY9A 4KHNA 4CJPA 2F8SA 2ASOA 3M8SA 2A42A 4Z4EA 4M42A 2P9KB 2E5LK 1C1BA 1C0FA 5AQYA 4FJ9A 3V9UA 3A2FA 3O8MA 4PKIA 4E1MA 4E89A 5EVZA 2KZMA 1JL2A 3TANA 3SLCA 3HP9A 3D45A 3O9QA 3VENA 3SPZA 1X9WA 4MO4A 1N6QA 4CJUA 3CC4N 3NH2A 4DV3K 4DSLA 1XQSC 3F5TA 1FXXA 4WE1A 1QHTA 3HSCA 5DK5A 3TTCA 3NH0A 1NK9A 2EHGA 1J6ZA 2A1RA 1XNQK 4JD2B 5MLCQ 1VQLN 5F1XA 4MDBA 5AQZA 2DFEA 1D8YA 4BY9C 3S3MA 5HRPA 4DTOA 4CFDA 5AQUA 3R9PA 3IUCA 1IKXA 3ALYA 4DSFA 5CZ1A 4CJTA 4CGDA 5AZIA 3AV9A 3SV3A 3V6DA 4RW4A 3NHGA 1TK8A 1BU6O 1S6QA 3AVMA 4YOUA 4CGGA 3EO3A 4PKHA 4BC4A 2GELA 2JGUA 4DTNA 3MK6A 4FYDA 3MEGA 2FF6A 1QZ6A 5FPNA 2JWLA 2VQEK 2FSJA 3OJSA 2UXCK 4DV5K 4IZ9A 2OTJN 3THYB 2OANA 2Z1GA 2DFHA 5ADXH 1ZBUA 1Q7YO 2GX9A 3FZMA 2B6AA 4ICLA 4H5VA 1TKTA 5GAHP 4B9LA 1KLMA 1NJWA 2WONA 3AVKA 3AAPA 5AQJA 4CJWA 2PY5A 2RF2A 2RPIA 2W40A 4CE9A 2YNGA 3ZSOA 4A59A 4FM0A 1J5EK 4FJNA 2WUSA 1VK0A 5AQHA 4MLEA 3L4QA 3P39A 1NGFA 3HVRA 1VQNN 4LF8K 2YI1A 3JXUA 3O4NA 3SAHA 5AQVA 2FC0A 5C42A 2RE2A 2F96A 3HL8A 4ELVA 1BI4A 4J8FA 2PYLA 2NRWA 5AZJA 3HT3A 1MDUB 2CH5A 1EXQA 3JS6A 4Y1DA 4BRMA 3I0SA 3WQUA 4CF8A 1HQUA 2PYJA 2QM1A 3TTDA 4JNEA 1TL1A 4BRLA 4OVLA 3VGLA 3RMCA 3TABA 3DLRA 2HBJA 4JKBA 1V4TA 1S1UA 1W9HA 2P9SA 4FJKA 1N32K 3CMEN 4GV3A 1N5YA 2BANA 4Z4FA 3AVJA 1RBSA 4BR4A 2HF4A 4DR7K 3DXKB 1SS6A 4DR6K 2QW9A 3BP8A 4BDYA 4IDHA 1VSHA 3OYEA 2O8EB 3EZ5A 4KHWA 3LAKA 3ZSQA 4FWNA 5BN8A 4LFAK 3RMAA 1C6VA 1RGIA 1DT9A 3O5BA 4C1NK 2QA4N 3B8AX 2E6LA 4G9ZA 1NOZA 4W5TA 3O3HA 1QTMA 4BR7A 4KHYA 3H3NO 4FWQA 1WSHA 4B1UB 3O9UA 4C23A 1IH7A 2ITMA 3ZX0A 3TSQA 3QINA 1K6YA 2QI2A 1N36K 1QS4A 3VQBA 4FSVA 4HWIA 1ASVA 1SL2A 1SKSA 1BA1A 1CZAN 3VQ7A 4EHTA 2HOEA 4CK3A 4B9SA 2YX6A 3I56N 4DU1A 4B9TA 2VG7A 1T44A 3HPGA 3W0LA 3THXA 2V52B 2P9IA 3HVTA 3SAFA 5LJVA 3ISNC 4BROA 2A40A 5C25A 2G8KA 4B9VA 3WQTA 3I8DA 1C0UA 2QXFA 3VQ4A 3THWA 2ASPA 1HKBA 4HVJA 1ATNA 2QWRA 4FJMA 2CGLA 1VQ5N 2P5OA 4KHQA 1LW0A 1Q8IA 3TWHA 2O4GA 1KXPA 2Q2RA 4ILHA 4BDPA 4PKGA 1HYVA 3CCMN 3K5OA 2VGMA 1RDCA 3ZETA 3LDNA 3L6QA 3T1HK 3LDPA 1RT4A 5IWAK 3OYJA 5KQDA 3AVGA 3VQ5A 4RW8A 2QTDA 3LWMA 3MWTA 5SZTA 4H0TB 3VQ6A 3VQCA 4B1ZA 2CGKA 4ELUA 4YOTA 4PA1A 1OH5A 4FLTA 2PZSA 2BDPA 3NVKA 3OHRA 1CLQA 4DV7K 4CZKA 3OYKA 2DFFA 1M90O 1NKEA 4CD1A 4A2BA 3U3YA 2HHTA 1L3UA 4E7KA 2FLOA 3L3UA 3LP0A 4M3UA 1FW6A 3MEEA 5ELZA 2FBVA 3E1YA 3KLHA 1X1PA 4RWTA 1Z6RA 4WCEL 1MA9B 1WAFA 5AQKA 3MXIA 5GADP 3ZT0A 1SKWA 2RN2A 4FM1A 3CJ9A 4CZLA 4CEBA 1BA0A 4ID5A 1OH8A 4DFKA 3LP2A 2UXBK 4H0YB 1YHQN 4CD3A 1BO5O 3VOVA 4JI2K 4F3OA 2E8AA 5JICA 3T69A 2O8FB 2ZE2A 4JI8K 1W2BM 4HHTA 4A5BA 1VSLA 4BQZA 4GW6A 4E7JA 4M3ZA 1JL1A 4GY2B 4JS5A 3M8PA 3JAMO 3TSPA 1NKCA 3LL3A 1XC9A 3AA5X 5AQSA 1QE1A 4U7BA 4LFBK 1SZ2A 3RSEA 4PUOA 1KVCA 2WFBA 3P38A 3QO9A 4B08A 4DUYK 2QWNA 4I2QA 1FKOA 1BHLA 1RT6A 4H5NA 1Z26A 4FVUA 1T7PA 4MQ3A 3K5NA 4FWOA 1QZ5A 4CF0A 2W6KA 2WBNA 1VQPN 1NOYA 3ZX2A 1ZBLA 1HQEA 4BWMA 3VMFB 3O9TA 2XO7A 4GNIA 4IEIA 3KIOA 5FPMA 4CIFA 2P9LA 2HW3A 3Q7BA 4KH5A 2RKIA 2Q36A 4WYBA 3QBXA 5KRTA 3VQAA 1K9MO 2E6MA 3NDKA 4N41A 3ULEA 3DWLA 3TAPA 3A5LC 3D0PA 3CCRN 4B9MA 2OTLN 3P4IA 3QEWA 4BR5A 1XI1A 1Q86O 5JLHA 4O8UA 3AVNA 2ATQA 4RG8A 5AQGA 2XY5A 2NRHA 4DTRA 1GLFO 3OYAA 1TL3A 1T6CA 1H1VA 2D5RA 1E4GT 1BCOA 2IAJA 3HSTB 2YKNA 3J81O 3PV8A 5I3UA 3D7EO 3MDQA 3KZBA 4JI5K 4L3QA 1S22A 3CCLN 4JYAK 3DOLA 3CG7A 2YHWA 1S1WA 3UKRA 4O4GA 3TPQA 3PIPL 4HCBA 2FBYA 4C1NI 4CZFA 2NRZA 4BVPA 2YNFA 1NU0A 3KLGA 1BQNA 3CCJN 2E1ZA 3RMBA 2VQFK 2V51B 5D3GA 3KD5E 3JYTA 1HNVA 1UOCA 1T6DA 4CFAA 4JLHA 3DMJA 4HUEA 2NLXA 4U67L 2H3GX 1VQON 2F4VK 4H0OA 2A41A 4BGAA 1YVNA 1A5XA 4B1XB 1JLFA 2D0PA 2Y1IA 1WSFA 4OJRA 4DV4K 5AFUA 4Q5VA 3IS9A 1BCMA 3BY5A 1TKDA 4H5RA 1UWBA 4CERA 3C7NB 3FZFA 3LM2A 1WSJA 2HNZA 4DS5A 4BREA 3SQ4A 4NXMK 5AQPA 4NLBA 1VHXA 3RWUA 1K8AO 3B6PA 1K73O 4WFAL 4BE2A 3AVHA 4LF7K 4MFBA 3GL1A 3HRGA 1KFSA 3FGUA 5KQ8A 2OPSA 3CFPA 4BRKA 2P9KA 5HRRA 3V9WA 1RFQA 4LFCK 3HPOA 4AF1A 4FJJA 3OS1A 2D1KA 1HNWK 4JK8A 5AQNA 2VG6A 2I7NA 2Z1JA 4CHNA 3AA4A 3D2EB 1R0AA 2KLAA 2P9UB 4XH1A 2HHQA 4B3MK 1V4SA 4OPHA 3M1FA 3CCUN 3KHYA 4FWPA 4E7IA 4FLVA 1OKJA 4Y0WA 5GAEP 4F2SA 4CEEA 1O13A 2ASMA 3D2FB 4CBXA 1IG8A 2XHBA 1LOTB 4BG9A 1KCFA 4JHDB 4JKCA 4DV2K 4JD2A 1T3VA 1A5VA 4BC2A 5FPDA 3CM5A 4CBWA 4CGJA 4BE1A 4AH9A 3I8BA 3MN9A 1JLBA 2QXLA 2XY8A 3V9ZA 3MAQA 4KAZA 3ZSRA 1BIZA 1NM1A 3L0QA 3SBGA 3T19A 1HNZK 3ZEUB 2R7YA 1VSMA 3O3FA 4HCCA 1U48A 4CECA 3SYZA 1TUUA 3VERA 1BDGA 4A62A 1VQ8N 4A61A 4IFEA 5E41A 1KAZA 2HBKA 3VEYA 3L8BA 2VYPA 3AGKA 3L2QA 4B3TK 4MDAA 2F9TA 3THYA 1RDUA 3OYHA 2HB5A 5AQLA 4E7LA 4H5WA 2YHYA 3FLCO 3WNHA 4B1VA 1HKCA 3CJ7A 3DLBA 3PY8A 3MCPA 4CJ7A 1RNHA 3QIOA 1X9SA 3F73A 3SZ2A 3CCVN 4CK1A 3SJJA 4IXCA 4FJ5A 3L2WA 3OYDA 1K8KB 4NCAA 5HRNA 4RCHA 1IKYA 5CYQA 3AO4A 3O3GA 4B8CA 2Z1HA 1YVUA 2KKZA 3SNNA 1YJ9N 2P9NB 5AFUH 1YITN 3E9OA 5C10A 4AILC 3I0RA 4DWIA 5BN9A 4YOXA 1XMOK 4DUZK 3ZT2A 3FE1A 2BH1A 4BR9A 2Q31A 1EWRA 4M45A 4LF5K 1KAYA 3VA0A 3WXKA 4ZHRA 3IRXA 4CGFA 1EP4A 2QWPA 4YDUA 2YV0X 1D9FA 3VQ8A 2IS3A 1RT5A 4B1YB 4FOEA 5M1PA 3WUHA 3DLEA 3DXKA 4C8NA 4E1JA 5JS1A 4ZTFA 3CHWA 4JKAA 3SK3A 1HKGA 3LALA 4DQQA 3RR8A 3EKSA 3H3OB 3CETA 1CXUA 4IJAA 4CK2A 2ZJRL 2ZWHA 1W0HA 1XHZA 2O4IA 2O8EA 1YJWN 2IVPA 4FCYA 1TAQA 4EIAA 4DR5K 4J2DA 1TK5A 3HPHA 4CJ5A 3OW2M 1UA0A 2HNDA 1ATSA 4E19A 3NFAA 2X74A 1YT3A 2G8FA 2B4JA 1EX4A 3LDSA 4BC5A 1XNRK 4CJKA 3HM9A 4ILJA 5CHIA 3DRRA 1NKBA 4KFBA 3QMLA 3H08A 1RTHA 1WN7A 1S1TA 4YOVA 4O5FA 3VA3A 2Z1IA 3SUOA 5M1NA 1SQKA 1VQ4N 2HSTA 1S1VA 1QVGM 4Z4CA 4BR0A 4I6MB 2GUIA 3VQPA 5J2QA 5C12A 3VF2A 1OVYA 4CJVA 2O8CA 4WQ5C 1G15A 1LWCA 3R8EA 3LP3A 1OVQA 4B3SK 4JKDA 1TK0A 4KI6A 4OO1J 2E2OA 3DLLL 1GLJO 2OYQA 4NLCA 4BRNA 1U2VB 4DMNA 4FW1A 3VGMA 4Z4GA 1S6PA 4HTUA 5KPTA 2YJEA 4CBUA 4DLEA 2X6SA 3HYFA 3QBWA 5TKWA 1NJIO 2KFZA 4BGBA 5BPMA 2OZMA 4CZJA 3EEQA 4F3TA 4CGHA 3LPTA 2CH6A 4NCGA 1RT3A 5E26A 3CJBA 1WUAA 2AP1A 4M3RA 5A2QO 3MX2A 2V7ZA 4IWVA 4IFVA 2QKBA 1M1KO 4FZYA 2WOMA 2FSNA 4MLHA 1TYQB 3KLFA 2HHXA 1HLUA 4X64K 3K58A 4KB0A 2FF3B 2FSKA 3NCIA 2V7YA 4DQSA 2D4WA 5CYMA 3VTIA 4AHVA 3E9PA 4AM7A 3IDHA 1RCHA 4DR1K 1NK6A 3ITHA 1IKWA 4AHRA 3LZJA 4DG1A 5BPLA 1XMQK 2E1YA 2A1SA 3QEIA 1HJRA 4JI4K 5CE3A 1JLEA 5K14A 4Q0BA 1U45A 2QKKA 3HBTA 2OA8A 4PL7A 4DFMA 4FZXC 1BOTO 4KHPK 4CCHA 4CF9A 3DM2A 5AQTA 1IV0A 3MEDA 4BRFA 4B1WB 3P31A 2O8FA 2YHXA 4JKGB 2HF3A 4NCBA 1YTUA 3QICA 4I7FA 3VF6A 3ID8A 4JI7K 1GLCG 1EQYA 2QWLA 3SBTA 1RBRA 1S1XA 2ZF5O 1X3NA 3PX0A 1ZYQA 3EL2A 4CEQA 1VRTA 3LAMA 5M1QA 1XUPO 1TGOA 4YOYA 3LZIA 4FJGA 4JRQA 2DPNA 3CM6A 4RW7A 3EZWA 3N4PA 1KAXA 4DQPA 3L2VA 4W5NA 2KW4A 3IFRA 3F2KA 4LC9B 3UE5A 2ZJQL 1YIJN 1HPZA 3HOSA 1GOBA 2QK9A 3VTHA 1ATRA 1O1WA 1BQMA 5DM7L 4B8AB 5HRSA 2KHOA 4FLZA 1TUYA 1QHAA 2ZGZA 3QNOA 1N8RO 4OX9K 2EX3A 5I9EB 2HHHK 1RT1A 1NBWA 4OPJA 4N76A 2O8DB 4J2BA 3WNFA 5AQOA 4CJEA 3GE1A 2YHAA 2JLEA 3KK3A 2A3ZA 4H0VB 5KGWA 4CGIA 4CF2A 3K5LA 3OYBA 4ID1A 1XC3A 3AA2A 2UXDK 3PLAA 1U49A 2E20A 2FXUA 4ILGB 4QS7A 5AQMA 3AVCA 4Z94A 3HP6A 5GINA 4BRIA 3G0ZA 4YY3K 1NLVA 1WBBA 4ISEA 3AVIA 4IO9L 3P5JA 4O0JA 1Q9XA 3ATVA 3THWB 5AQWA 4K42A 4IOCL 3PSIA 3WNGA 3TSUA 2NRXA 3ZSWA 1U4BA 1RTDA 4Y1CA 2CGJA 5SWMA 4DR4K 5M1OA 2HVIA 3NGIA 1RBVA 4AQYK 4KI4A 2VCPA 2UUCK 5EU7A 1OH6A 2O8BB 3FR0A 3V9XA 2FBTA 1HNIA 3OS0A 4DTMA 1Q82O 3ZYYX 3ZETB 4YNQA 1S9EA 4QCLA 4DQRA 3E9LA 3DYAA 4PWDA 4OKEA 3PX4A 4DSIA 1LAVA 5HP1A 1SV5A 4KO0A 4BG8A 4DCHA 2NRVA 2WTUA 4PL8A 4FM2A 2OPQA 1GLAG 2G8WA 3MMVA 4K25A 4FWLA 3P83D 1HX1A 1W97L 4DSEA 1Y97A 4E3SA 2VGNA 4EFHA 4DTSA 1P90A 4YDUC 3J8AA 3C7NA 1VQ6N 4FWSA 3WXIA 4M41A 3GDQA 2NRTA 4GV6A 1JLGA 1RBUA 3EY1A 1CZBA 3NVMA 4OGCA 1VQ9N 1YF5L 4FO0A 1J54A 1NGGA 1IG9A 1GLDG 1WOQA 3J80O 2D0CA 3KK2A 3ZT4A 1SL0A 4JK7A 3ZSVA 3SJHA 4A5AA 4XIUA 3DXMB 4CW7B 3OYFA 1QSSA 1HJOA 3BZCA 3I55N 1BIUA 4RW6A 4KTZA 4OGEA 4CF1A 4BRAA 4DS4A 4DHYA 5C15A 4KPYA 3AO3A 4FJHA 1NWKA 4ISGA 4XH5A 4BDZA 1NK0A 2P9UA 3NAEA 3ULDA 2G8HA 1WLJA 1S3XA 1BUPA 3OYLA 4FW2A 3WXMB 2YJFA 3IAYA 3K2PA 3U4LA 3D2FA 1D5AA 3O08A 4RTFD 1RTJA 2KTQA 4JHDA
chains in the Genus database with same CATH topology
2DY4A 3WNEA 1N5YA 2BANA 5KRSA 1VSDA 4Z4FA 4G1QA 3AVJA 1RBSA 3DLBA 3CFOA 1J5OA 4OKJA 1WNSA 4EP4A 3PY8A 1RNHA 4KB1A 3V4IA 1TKZA 3G10A 3BGRA 3QIOA 1X9SA 1KVBA 3F73A 3SZ2A 4FK0A 4CK1A 4O0IA 1DTQA 4KHUA 1HRHA 3SJJA 3UIQA 1U47A 4FJ5A 4CEOA 4BDYA 4C8MA 3L2WA 1RDBA 3OYDA 4DU3A 4IKFA 1TKXA 3QLHA 4CEDA 1VSHA 4NCAA 1NK7A 5HRNA 3OYEA 3EZ5A 4BE0A 1ZBFA 3KKRA 3HK2A 4ZTJA 3SUNA 3NF9A 3ZSZA 1IKYA 4KHWA 5CYQA 4JRPA 5J2MA 3AO4A 1C0MA 3L3VA 1RBTA 3LAKA 3ZCMA 3ZSQA 3O3GA 4B8CA 3BDPA 2Z1HA 3C6UA 3OY9A 1YVUA 3SNNA 1D9DA 3VQDA 3RMAA 1C6VA 4W5RA 4CJRA 3IG1A 4AILC 3I0RA 4CIEA 4DWIA 1I3AA 2E6LA 2VWKA 1NOZA 3ZT2A 4M3XA 1J9AA 4W5TA 1B9DA 3O3HA 1QTMA 2XY6A 4KHYA 4M45A 1F21A 1Z25A 4FJIA 5C24A 2I5JA 5KGXA 4UQGA 1WSHA 1NK8A 2ZD1A 4DFPA 1RDAA 4DTJA 1VRUA 1IH7A 1WSGA 4CJSA 3QINA 1K6YA 3VA0A 4ZHRA 3OVNA 3AO5A 3IRXA 1EP4A 4CGFA 3NE6A 1QS4A 3VQBA 2YV0X 3DI6A 3QETA 4KV8A 1D9FA 3HO1A 4Z0UA 1FKPA 4RW9A 4I2PA 3VQ8A 1L3SA 3QERA 2IS3A 1RT5A 4N47A 4FJ8A 3DLEA 1ASVA 3QNNA 3LANA 1C0TA 1SL2A 3TAMA 4DQIA 4C8NA 1SKSA 4IDKA 3VQ7A 4CK3A 3TR8A 1HYZA 5J1EA 4ZTFA 4B9SA 5JS1A 4DU1A 4B9TA 2VG7A 3HPGA 3VQQA 4J2EA 4J2AA 3HVTA 3LALA 4DQQA 3OYNA 2DTUA 3ISNC 3RR8A 4M3WA 5C25A 1CXUA 4CK2A 2G8KA 1W0HA 1XHZA 2VWJA 4B9VA 2O4IA 3I8DA 3FFIA 1C0UA 4FCYA 2QXFA 3VQ4A 1TAQA 3QEXA 4Z4HA 4HVJA 4J2DA 2Q3SA 3NH1A 3OS2A 1TK5A 1SUQA 4FJMA 1QSYA 3HPHA 4CJ5A 3VQEA 2P5OA 1RTIA 4KHQA 4CJQA 4IBNA 1L5UA 1ZBIA 4KKOA 1LW0A 1UA0A 1Q8IA 2HNDA 2IC3A 3B6OA 3DRPA 3P1GA 3TWHA 3C6TA 4E19A 4FLYA 2O4GA 3NFAA 2X74A 4AHCA 3TAQA 3C94A 1WSEA 1YT3A 2G8FA 2B4JA 3RR7A 4BDPA 2Y1JA 3NGYA 4CHYA 1EX4A 1HYVA 3LDSA 3K5OA 1RDCA 3NF8A 4LY7A 4AHSA 4GMJB 4H4OA 1ASWA 2P5GA 1GOAA 4CJKA 3OYMA 3HXMA 3SUQA 1ZBHA 2G8VA 3THVA 1KFDA 1RT4A 3NF7A 4QAGA 3HM9A 4E0DA 2ZQBA 3DRRA 3LWLA 4FLWA 1NKBA 4KFBA 4KREA 3OYJA 4B9NA 3AVGA 2KZZA 3H08A 1RTHA 1WN7A 1C1AA 4EZ9A 1S1TA 3SUOA 3VA3A 2Z1IA 3VQ5A 4RW8A 2ETJA 1VSJA 5SZTA 1C1CA 3LWMA 3RMDA 2HHSA 3RRHA 1S1VA 3VQ6A 4Z4CA 4CHQA 3VQCA 4AHUA 2GUIA 3VQPA 5J2QA 4ELUA 4PA1A 4FLTA 2IDOA 3KLEA 2PZSA 4L8RB 2BDPA 2OPRA 1X9MA 2HNYA 4E7HA 1CLQA 3ZT3A 4CJVA 1LV5A 1G15A 1LWCA 1S9GA 3OYKA 4QOZB 3TAEA 2DFFA 5FDLA 4DF8A 3AVLA 3LP3A 1NKEA 3U3YA 2HHTA 1L3UA 1LWFA 3MXJA 1RT2A 3V1QA 4E7KA 1VSIA 3CQ8A 3QIPA 4DFJA 4F2RA 4CHZA 3L3UA 1TK0A 3V1RA 4KI6A 4KHSA 3LP0A 4M3UA 3K57A 3MEEA 2FBVA 3CFRA 3DLHA 1UAXA 4K8XA 1RDDA 3KLHA 2OYQA 2AJQA 4AHTA 1X1PA 1NJZA 1CXQA 3DLKA 1WAFA 4R5PA 2YNHA 4DMNA 3MXIA 4FW1A 4Z4GA 1S6PA 4HTUA 3AA3A 1REVA 5DMRA 4LH4A 1GOCA 4B9UA 1NJXA 3ZT0A 4DLEA 1SKWA 2X6SA 2X78A 3HYFA 2KFZA 2RN2A 4FM1A 3KKSA 1ITGA 3F9KA 3SQ2A 1JLAA 3ZSXA 4CGHA 4GVMA 2OZMA 4F3TA 4CEBA 4DF4A 3LPTA 4ID5A 3L2RA 3PX6A 5KI6A 4C8KA 4DFKA 1TVRA 2P51A 3ZT1A 4DTXA 5HROA 4OLAA 1JKHA 3LP2A 5J2NA 4NCGA 1RT3A 3SPYA 3AO2A 4W5OA 4CIGA 4M3RA 1RT7A 3K5LA 1NK4A 1BGXT 4IFVA 3M8RA 2IGIA 1B92A 2F8TA 4F3OA 4CFCA 2QKBA 1XWLA 4FZYA 3AO1A 3U6FA 1KSPA 2WOMA 4IFYA 2ZE2A 3U3GA 1KVAA 3SQ0A 4CJFA 4HHTA 2KFNA 3KLFA 2HHXA 4CHPA 3OJUA 3K58A 1VSLA 5FRMA 4GW6A 1CZ9A 4E7JA 4KB0A 4FJ7A 3NCIA 1Q9YA 4M3ZA 4OLBA 4B3OA 1SL1A 3KD1E 1ASUA 2HVHA 1JL1A 4JS5A 3CYMA 3M8PA 1A5WA 1T03A 1HYSA 2YHBA 4DQSA 5CYMA 4CHOA 1NKCA 3RRGA 1XC9A 4LD0A 3AA5X 4AHVA 1QE1A 4DLGA 1L3VA 4PUOA 1QSLA 2OZSA 1KVCA 5T7BA 1MU2A 4W5QA 3TAFA 1RCHA 3QO9A 4JS4A 1BISA 4B08A 3K59A 1WSIA 4I2QA 1FKOA 1BHLA 1RT6A 1NK6A 3PO5A 1Z26A 4PQUA 3ITHA 1IKWA 4AHRA 3LZJA 4DG1A 2A1SA 1T7PA 3QEIA 1HJRA 4MQ3A 1JLEA 5K14A 3K5NA 4Q0BA 3QEVA 1U45A 2QKKA 4FJLA 4CF0A 1NOYA 2OA8A 4C8OA 1JLCA 1ZBLA 4DFMA 1HQEA 1LAWA 1KRPA 1S5JA 4FZXC 4BWMA 2GBZA 2XO7A 4CCHA 5I42A 4FLUA 4CF9A 1HMVA 3DM2A 4TSXA 4M3YA 3KIOA 4CIFA 2HW3A 4CESA 2P1JA 3DLGA 3E01A 3SQ1A 2RKIA 4FXDA 5KRTA 3VQAA 3MEDA 1QQCA 3AVFA 2X6NA 2E6MA 5CY4A 4BWJA 4DTPA 3NDKA 4O55A 4N41A 3RTVA 4KTWA 4E1NA 3SCXA 5HLFA 2HHVA 3TI0A 3DOKA 4NCBA 1YTUA 3TAPA 3D0PA 4OPKA 2YKMA 4I7FA 4B9MA 1RBRA 4LSNA 2VG5A 1S1XA 3V1OA 3QEWA 2FBXA 3PX0A 1XI1A 1ZYQA 1JXEA 1LW2A 4FZZA 4CEQA 1VRTA 3LAMA 1RILA 3AVNA 4NYNA 2ATQA 2W42A 2HHUA 3SV4A 1TGOA 4KRFA 3LZIA 4RG8A 4FJGA 4JRQA 3EYZA 1T8EA 4K8ZA 3CM6A 4RW7A 3SUPA 4CFBA 2XY5A 4DTRA 5KTQA 4DQPA 3L2VA 1TAUA 3OYAA 2G8IA 4W5NA 3OYGA 4F4KA 1YTAA 2KW4A 1TL3A 3PUFA 1EKEA 3O4QA 4LSLA 4O44A 4DU4A 3QEPA 4OKKA 4EZ6A 2D5RA 1KTQA 1BCOA 2IAJA 3MXMA 1KLNA 3M8QA 3HSTB 2YKNA 4CEZA 4Z4IA 3PV8A 1HPZA 5I3UA 1GOBA 2QK9A 1O1WA 1BQMA 1SKRA 1JXBA 4FLXA 4B8AB 5HRSA 3QESA 3AVBA 4FLZA 1XHXA 1TV6A 3LPUA 4KTQA 4IG3A 2GV9A 3QNOA 3DOLA 2OPPA 3CG7A 2BE2A 4NYFA 1S1WA 3V81A 3S3OA 4KHNA 4O4GA 2EX3A 3NGZA 4ELTA 4CJPA 4HCBA 2FBYA 4HUGA 2F8SA 3M8SA 1RT1A 4OPJA 2YNFA 4N76A 3KLGA 1BQNA 4M42A 4J2BA 4Z4EA 1J53A 3WNFA 1C1BA 3RMBA 4CJEA 5D3GA 4CJ3A 4FJ9A 3KD5E 3JYTA 3V9UA 5FRNA 3VN5A 2YHAA 3A2FA 2JLEA 5JS2A 3L2UA 3KK3A 5KGWA 1HNVA 1UOCA 4CGIA 4CFAA 4PY5A 4E1MA 4CF2A 3NF6A 1U04A 4JLHA 3DMJA 3DRSA 1IKVA 4CEAA 4E89A 3OYBA 4HUEA 1T05A 2KZMA 1JL2A 4ID1A 3TANA 4DSJA 3AA2A 3HP9A 3D45A 1A5XA 1U49A 1I39A 3MECA 3SPZA 3ZSYA 1JLFA 1X9WA 1N6QA 4CJUA 2Y1IA 1WSFA 3NH2A 3AVCA 2ITGA 4OJRA 4DSLA 4Q5VA 3HP6A 3OYCA 3K5MA 3G0ZA 3IS9A 1FXXA 4WE1A 1BCMA 1QHTA 1TKDA 1BL3A 1UWBA 4H8KA 4CERA 5DK5A 3JSMA 1WSJA 2HNZA 2LSNA 4YFUA 3AVIA 4I9QA 3P5JA 4IG0A 4O0JA 4DS5A 1Q9XA 4CEFA 3NH0A 1NK9A 2XRIA 3KJVA 1IO2A 5J2PA 3SQ4A 5FROA 2EHGA 3S9HA 4EP5A 3WNGA 2A1RA 3ZSWA 2XY7A 1U4BA 1RTDA 4Y1CA 5SWMA 3RWUA 2DFEA 3B6PA 1D8YA 3S3MA 4BE2A 3AVHA 5HRPA 3NGIA 4O5BA 2HVIA 1RBVA 4KI4A 4DTOA 4MFBA 4CFDA 5EU7A 2KQ2A 4LH5A 3V9XA 2FBTA 1IKXA 1HNIA 1KFSA 3ALYA 3OS0A 4FJXA 2OPSA 3CFPA 4DTMA 5HRRA 4DSFA 1DLOA 5CZ1A 4CJTA 3V9WA 3S3NA 4CGDA 4YNQA 1S9EA 3AV9A 3HPOA 4DQRA 3VQ9A 4QCLA 3SV3A 3V6DA 4C8LA 3DYAA 4RW4A 4PWDA 4OKEA 3NHGA 3PX4A 3OS1A 1NJYA 1TK8A 4FJJA 4DSIA 1VSEA 1LAVA 2D0AA 5HBMA 5HP1A 1SV5A 4KO0A 1S6QA 3AVMA 4CGGA 1BI4B 1EETA 2VG6A 4CJ4A 2Z1JA 2OPQA 4FM2A 3C95A 2JGUA 4DTNA 2G8WA 4FYDA 3MEGA 3P83D 2E4LA 3AA4A 4CHNA 3T3FA 1R0AA 4DSEA 2HHQA 2G8UA 3KTQA 1Y97A 4E3SA 3OYIA 4DTSA 3OJSA 2HMIA 4E7IA 2Z1GA 4FLVA 2DFHA 1JLQA 1ZBUA 3ASMA 4DSKA 2HHWA 4M41A 4F2SA 4CEEA 2XHBA 1NK5A 3TARA 2B6AA 4ICLA 1KCFA 2YNIA 1JLGA 1RBUA 1TKTA 3EY1A 1CZBA 1WAJA 4HUFA 4OGCA 3PO4A 2D0BA 4B9LA 1KLMA 1VSFA 1J54A 1IG9A 4N5SA 1NJWA 3LP1A 2WONA 1DTTA 1B9FA 2D0CA 3AVKA 3KK2A 1A5VA 2IOCA 5CZ2A 4CJWA 3ZT4A 1SL0A 3CM5A 3NBPA 3ZSVA 4CGJA 4BE1A 1FK9A 2PY5A 1VSKA 4AH9A 3T1AA 2RF2A 1JLBA 2RPIA 4CE9A 2YNGA 3ZSOA 4XIUA 4FM0A 3OYFA 1QSSA 4FJNA 1LWEA 2XY8A 1VK0A 4FVMA 3MAQA 3V9ZA 3HVRA 4KAZA 1BIUA 3ZSRA 4RW6A 1BIZA 2BGGA 3T19A 4KTZA 3O4NA 4OGEA 4CF1A 4N56A 2R7YA 1VSMA 4DS4A 4KPYA 2FC0A 3AO3A 5C42A 3O3FA 1UA1A 4HCCA 4FJHA 1U48A 2F96A 3HL8A 4CECA 3SYZA 4ELVA 4BDZA 1BI4A 4FK4A 4DTUA 2PYLA 3SI6A 1NK0A 2B5JA 3AVAA 2NUBA 4FK2A 4H4MA 3HT3A 4CJLA 5E41A 3NAEA 1EXQA 3KK1A 3ULDA 3HJFA 3KLIA 4Y1DA 3L8BA 2G8HA 1WLJA 3I0SA 3L2QA 1L3TA 4M3TA 4CF8A 1HQUA 2PYJA 3OYLA 4FW2A 1TL1A 3OYHA 2HB5A 4I9LA 4OVLA 4BACA 3IAYA 3RMCA 3TABA 3DLRA 3K2PA 1D5AA 4E7LA 1S1UA 1W9HA 1RTJA 4F8RA 4FJKA 3V9SA 2KTQA 3TAGA 3WNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY4 A;  3WNE A;  1N5Y A;  2BAN A;  5KRS A;  1VSD A;  4Z4F A;  4G1Q A;  3AVJ A;  1RBS A;  3DLB A;  3CFO A;  1J5O A;  4OKJ A;  1WNS A;  4EP4 A;  3PY8 A;  1RNH A;  4KB1 A;  3V4I A;  1TKZ A;  3G10 A;  3BGR A;  3QIO A;  1X9S A;  1KVB A;  3F73 A;  3SZ2 A;  4FK0 A;  4CK1 A;  4O0I A;  1DTQ A;  4KHU A;  1HRH A;  3SJJ A;  3UIQ A;  1U47 A;  4FJ5 A;  4CEO A;  4BDY A;  4C8M A;  3L2W A;  1RDB A;  3OYD A;  4DU3 A;  4IKF A;  1TKX A;  3QLH A;  4CED A;  1VSH A;  4NCA A;  1NK7 A;  5HRN A;  3OYE A;  3EZ5 A;  4BE0 A;  1ZBF A;  3KKR A;  3HK2 A;  4ZTJ A;  3SUN A;  3NF9 A;  3ZSZ A;  1IKY A;  4KHW A;  5CYQ A;  4JRP A;  5J2M A;  3AO4 A;  1C0M A;  3L3V A;  1RBT A;  3LAK A;  3ZCM A;  3ZSQ A;  3O3G A;  4B8C A;  3BDP A;  2Z1H A;  3C6U A;  3OY9 A;  1YVU A;  3SNN A;  1D9D A;  3VQD A;  3RMA A;  1C6V A;  4W5R A;  4CJR A;  3IG1 A;  4AIL C;  3I0R A;  4CIE A;  4DWI A;  1I3A A;  2E6L A;  2VWK A;  1NOZ A;  3ZT2 A;  4M3X A;  1J9A A;  4W5T A;  1B9D A;  3O3H A;  1QTM A;  2XY6 A;  4KHY A;  4M45 A;  1F21 A;  1Z25 A;  4FJI A;  5C24 A;  2I5J A;  5KGX A;  4UQG A;  1WSH A;  1NK8 A;  2ZD1 A;  4DFP A;  1RDA A;  4DTJ A;  1VRU A;  1IH7 A;  1WSG A;  4CJS A;  3QIN A;  1K6Y A;  3VA0 A;  4ZHR A;  3OVN A;  3AO5 A;  3IRX A;  1EP4 A;  4CGF A;  3NE6 A;  1QS4 A;  3VQB A;  2YV0 X;  3DI6 A;  3QET A;  4KV8 A;  1D9F A;  3HO1 A;  4Z0U A;  1FKP A;  4RW9 A;  4I2P A;  3VQ8 A;  1L3S A;  3QER A;  2IS3 A;  1RT5 A;  4N47 A;  4FJ8 A;  3DLE A;  1ASV A;  3QNN A;  3LAN A;  1C0T A;  1SL2 A;  3TAM A;  4DQI A;  4C8N A;  1SKS A;  4IDK A;  3VQ7 A;  4CK3 A;  3TR8 A;  1HYZ A;  5J1E A;  4ZTF A;  4B9S A;  5JS1 A;  4DU1 A;  4B9T A;  2VG7 A;  3HPG A;  3VQQ A;  4J2E A;  4J2A A;  3HVT A;  3LAL A;  4DQQ A;  3OYN A;  2DTU A;  3ISN C;  3RR8 A;  4M3W A;  5C25 A;  1CXU A;  4CK2 A;  2G8K A;  1W0H A;  1XHZ A;  2VWJ A;  4B9V A;  2O4I A;  3I8D A;  3FFI A;  1C0U A;  4FCY A;  2QXF A;  3VQ4 A;  1TAQ A;  3QEX A;  4Z4H A;  4HVJ A;  4J2D A;  2Q3S A;  3NH1 A;  3OS2 A;  1TK5 A;  1SUQ A;  4FJM A;  1QSY A;  3HPH A;  4CJ5 A;  3VQE A;  2P5O A;  1RTI A;  4KHQ A;  4CJQ A;  4IBN A;  1L5U A;  1ZBI A;  4KKO A;  1LW0 A;  1UA0 A;  1Q8I A;  2HND A;  2IC3 A;  3B6O A;  3DRP A;  3P1G A;  3TWH A;  3C6T A;  4E19 A;  4FLY A;  2O4G A;  3NFA A;  2X74 A;  4AHC A;  3TAQ A;  3C94 A;  1WSE A;  1YT3 A;  2G8F A;  2B4J A;  3RR7 A;  4BDP A;  2Y1J A;  3NGY A;  4CHY A;  1EX4 A;  1HYV A;  3LDS A;  3K5O A;  1RDC A;  3NF8 A;  4LY7 A;  4AHS A;  4GMJ B;  4H4O A;  1ASW A;  2P5G A;  1GOA A;  4CJK A;  3OYM A;  3HXM A;  3SUQ A;  1ZBH A;  2G8V A;  3THV A;  1KFD A;  1RT4 A;  3NF7 A;  4QAG A;  3HM9 A;  4E0D A;  2ZQB A;  3DRR A;  3LWL A;  4FLW A;  1NKB A;  4KFB A;  4KRE A;  3OYJ A;  4B9N A;  3AVG A;  2KZZ A;  3H08 A;  1RTH A;  1WN7 A;  1C1A A;  4EZ9 A;  1S1T A;  3SUO A;  3VA3 A;  2Z1I A;  3VQ5 A;  4RW8 A;  2ETJ A;  1VSJ A;  5SZT A;  1C1C A;  3LWM A;  3RMD A;  2HHS A;  3RRH A;  1S1V A;  3VQ6 A;  4Z4C A;  4CHQ A;  3VQC A;  4AHU A;  2GUI A;  3VQP A;  5J2Q A;  4ELU A;  4PA1 A;  4FLT A;  2IDO A;  3KLE A;  2PZS A;  4L8R B;  2BDP A;  2OPR A;  1X9M A;  2HNY A;  4E7H A;  1CLQ A;  3ZT3 A;  4CJV A;  1LV5 A;  1G15 A;  1LWC A;  1S9G A;  3OYK A;  4QOZ B;  3TAE A;  2DFF A;  5FDL A;  4DF8 A;  3AVL A;  3LP3 A;  1NKE A;  3U3Y A;  2HHT A;  1L3U A;  1LWF A;  3MXJ A;  1RT2 A;  3V1Q A;  4E7K A;  1VSI A;  3CQ8 A;  3QIP A;  4DFJ A;  4F2R A;  4CHZ A;  3L3U A;  1TK0 A;  3V1R A;  4KI6 A;  4KHS A;  3LP0 A;  4M3U A;  3K57 A;  3MEE A;  2FBV A;  3CFR A;  3DLH A;  1UAX A;  4K8X A;  1RDD A;  3KLH A;  2OYQ A;  2AJQ A;  4AHT A;  1X1P A;  1NJZ A;  1CXQ A;  3DLK A;  1WAF A;  4R5P A;  2YNH A;  4DMN A;  3MXI A;  4FW1 A;  4Z4G A;  1S6P A;  4HTU A;  3AA3 A;  1REV A;  5DMR A;  4LH4 A;  1GOC A;  4B9U A;  1NJX A;  3ZT0 A;  4DLE A;  1SKW A;  2X6S A;  2X78 A;  3HYF A;  2KFZ A;  2RN2 A;  4FM1 A;  3KKS A;  1ITG A;  3F9K A;  3SQ2 A;  1JLA A;  3ZSX A;  4CGH A;  4GVM A;  2OZM A;  4F3T A;  4CEB A;  4DF4 A;  3LPT A;  4ID5 A;  3L2R A;  3PX6 A;  5KI6 A;  4C8K A;  4DFK A;  1TVR A;  2P51 A;  3ZT1 A;  4DTX A;  5HRO A;  4OLA A;  1JKH A;  3LP2 A;  5J2N A;  4NCG A;  1RT3 A;  3SPY A;  3AO2 A;  4W5O A;  4CIG A;  4M3R A;  1RT7 A;  3K5L A;  1NK4 A;  1BGX T;  4IFV A;  3M8R A;  2IGI A;  1B92 A;  2F8T A;  4F3O A;  4CFC A;  2QKB A;  1XWL A;  4FZY A;  3AO1 A;  3U6F A;  1KSP A;  2WOM A;  4IFY A;  2ZE2 A;  3U3G A;  1KVA A;  3SQ0 A;  4CJF A;  4HHT A;  2KFN A;  3KLF A;  2HHX A;  4CHP A;  3OJU A;  3K58 A;  1VSL A;  5FRM A;  4GW6 A;  1CZ9 A;  4E7J A;  4KB0 A;  4FJ7 A;  3NCI A;  1Q9Y A;  4M3Z A;  4OLB A;  4B3O A;  1SL1 A;  3KD1 E;  1ASU A;  2HVH A;  1JL1 A;  4JS5 A;  3CYM A;  3M8P A;  1A5W A;  1T03 A;  1HYS A;  2YHB A;  4DQS A;  5CYM A;  4CHO A;  1NKC A;  3RRG A;  1XC9 A;  4LD0 A;  3AA5 X;  4AHV A;  1QE1 A;  4DLG A;  1L3V A;  4PUO A;  1QSL A;  2OZS A;  1KVC A;  5T7B A;  1MU2 A;  4W5Q A;  3TAF A;  1RCH A;  3QO9 A;  4JS4 A;  1BIS A;  4B08 A;  3K59 A;  1WSI A;  4I2Q A;  1FKO A;  1BHL A;  1RT6 A;  1NK6 A;  3PO5 A;  1Z26 A;  4PQU A;  3ITH A;  1IKW A;  4AHR A;  3LZJ A;  4DG1 A;  2A1S A;  1T7P A;  3QEI A;  1HJR A;  4MQ3 A;  1JLE A;  5K14 A;  3K5N A;  4Q0B A;  3QEV A;  1U45 A;  2QKK A;  4FJL A;  4CF0 A;  1NOY A;  2OA8 A;  4C8O A;  1JLC A;  1ZBL A;  4DFM A;  1HQE A;  1LAW A;  1KRP A;  1S5J A;  4FZX C;  4BWM A;  2GBZ A;  2XO7 A;  4CCH A;  5I42 A;  4FLU A;  4CF9 A;  1HMV A;  3DM2 A;  4TSX A;  4M3Y A;  3KIO A;  4CIF A;  2HW3 A;  4CES A;  2P1J A;  3DLG A;  3E01 A;  3SQ1 A;  2RKI A;  4FXD A;  5KRT A;  3VQA A;  3MED A;  1QQC A;  3AVF A;  2X6N A;  2E6M A;  5CY4 A;  4BWJ A;  4DTP A;  3NDK A;  4O55 A;  4N41 A;  3RTV A;  4KTW A;  4E1N A;  3SCX A;  5HLF A;  2HHV A;  3TI0 A;  3DOK A;  4NCB A;  1YTU A;  3TAP A;  3D0P A;  4OPK A;  2YKM A;  4I7F A;  4B9M A;  1RBR A;  4LSN A;  2VG5 A;  1S1X A;  3V1O A;  3QEW A;  2FBX A;  3PX0 A;  1XI1 A;  1ZYQ A;  1JXE A;  1LW2 A;  4FZZ A;  4CEQ A;  1VRT A;  3LAM A;  1RIL A;  3AVN A;  4NYN A;  2ATQ A;  2W42 A;  2HHU A;  3SV4 A;  1TGO A;  4KRF A;  3LZI A;  4RG8 A;  4FJG A;  4JRQ A;  3EYZ A;  1T8E A;  4K8Z A;  3CM6 A;  4RW7 A;  3SUP A;  4CFB A;  2XY5 A;  4DTR A;  5KTQ A;  4DQP A;  3L2V A;  1TAU A;  3OYA A;  2G8I A;  4W5N A;  3OYG A;  4F4K A;  1YTA A;  2KW4 A;  1TL3 A;  3PUF A;  1EKE A;  3O4Q A;  4LSL A;  4O44 A;  4DU4 A;  3QEP A;  4OKK A;  4EZ6 A;  2D5R A;  1KTQ A;  1BCO A;  2IAJ A;  3MXM A;  1KLN A;  3M8Q A;  3HST B;  2YKN A;  4CEZ A;  4Z4I A;  3PV8 A;  1HPZ A;  5I3U A;  1GOB A;  2QK9 A;  1O1W A;  1BQM A;  1SKR A;  1JXB A;  4FLX A;  4B8A B;  5HRS A;  3QES A;  3AVB A;  4FLZ A;  1XHX A;  1TV6 A;  3LPU A;  4KTQ A;  4IG3 A;  2GV9 A;  3QNO A;  3DOL A;  2OPP A;  3CG7 A;  2BE2 A;  4NYF A;  1S1W A;  3V81 A;  3S3O A;  4KHN A;  4O4G A;  2EX3 A;  3NGZ A;  4ELT A;  4CJP A;  4HCB A;  2FBY A;  4HUG A;  2F8S A;  3M8S A;  1RT1 A;  4OPJ A;  2YNF A;  4N76 A;  3KLG A;  1BQN A;  4M42 A;  4J2B A;  4Z4E A;  1J53 A;  3WNF A;  1C1B A;  3RMB A;  4CJE A;  5D3G A;  4CJ3 A;  4FJ9 A;  3KD5 E;  3JYT A;  3V9U A;  5FRN A;  3VN5 A;  2YHA A;  3A2F A;  2JLE A;  5JS2 A;  3L2U A;  3KK3 A;  5KGW A;  1HNV A;  1UOC A;  4CGI A;  4CFA A;  4PY5 A;  4E1M A;  4CF2 A;  3NF6 A;  1U04 A;  4JLH A;  3DMJ A;  3DRS A;  1IKV A;  4CEA A;  4E89 A;  3OYB A;  4HUE A;  1T05 A;  2KZM A;  1JL2 A;  4ID1 A;  3TAN A;  4DSJ A;  3AA2 A;  3HP9 A;  3D45 A;  1A5X A;  1U49 A;  1I39 A;  3MEC A;  3SPZ A;  3ZSY A;  1JLF A;  1X9W A;  1N6Q A;  4CJU A;  2Y1I A;  1WSF A;  3NH2 A;  3AVC A;  2ITG A;  4OJR A;  4DSL A;  4Q5V A;  3HP6 A;  3OYC A;  3K5M A;  3G0Z A;  3IS9 A;  1FXX A;  4WE1 A;  1BCM A;  1QHT A;  1TKD A;  1BL3 A;  1UWB A;  4H8K A;  4CER A;  5DK5 A;  3JSM A;  1WSJ A;  2HNZ A;  2LSN A;  4YFU A;  3AVI A;  4I9Q A;  3P5J A;  4IG0 A;  4O0J A;  4DS5 A;  1Q9X A;  4CEF A;  3NH0 A;  1NK9 A;  2XRI A;  3KJV A;  1IO2 A;  5J2P A;  3SQ4 A;  5FRO A;  2EHG A;  3S9H A;  4EP5 A;  3WNG A;  2A1R A;  3ZSW A;  2XY7 A;  1U4B A;  1RTD A;  4Y1C A;  5SWM A;  3RWU A;  2DFE A;  3B6P A;  1D8Y A;  3S3M A;  4BE2 A;  3AVH A;  5HRP A;  3NGI A;  4O5B A;  2HVI A;  1RBV A;  4KI4 A;  4DTO A;  4MFB A;  4CFD A;  5EU7 A;  2KQ2 A;  4LH5 A;  3V9X A;  2FBT A;  1IKX A;  1HNI A;  1KFS A;  3ALY A;  3OS0 A;  4FJX A;  2OPS A;  3CFP A;  4DTM A;  5HRR A;  4DSF A;  1DLO A;  5CZ1 A;  4CJT A;  3V9W A;  3S3N A;  4CGD A;  4YNQ A;  1S9E A;  3AV9 A;  3HPO A;  4DQR A;  3VQ9 A;  4QCL A;  3SV3 A;  3V6D A;  4C8L A;  3DYA A;  4RW4 A;  4PWD A;  4OKE A;  3NHG A;  3PX4 A;  3OS1 A;  1NJY A;  1TK8 A;  4FJJ A;  4DSI A;  1VSE A;  1LAV A;  2D0A A;  5HBM A;  5HP1 A;  1SV5 A;  4KO0 A;  1S6Q A;  3AVM A;  4CGG A;  1BI4 B;  1EET A;  2VG6 A;  4CJ4 A;  2Z1J A;  2OPQ A;  4FM2 A;  3C95 A;  2JGU A;  4DTN A;  2G8W A;  4FYD A;  3MEG A;  3P83 D;  2E4L A;  3AA4 A;  4CHN A;  3T3F A;  1R0A A;  4DSE A;  2HHQ A;  2G8U A;  3KTQ A;  1Y97 A;  4E3S A;  3OYI A;  4DTS A;  3OJS A;  2HMI A;  4E7I A;  2Z1G A;  4FLV A;  2DFH A;  1JLQ A;  1ZBU A;  3ASM A;  4DSK A;  2HHW A;  4M41 A;  4F2S A;  4CEE A;  2XHB A;  1NK5 A;  3TAR A;  2B6A A;  4ICL A;  1KCF A;  2YNI A;  1JLG A;  1RBU A;  1TKT A;  3EY1 A;  1CZB A;  1WAJ A;  4HUF A;  4OGC A;  3PO4 A;  2D0B A;  4B9L A;  1KLM A;  1VSF A;  1J54 A;  1IG9 A;  4N5S A;  1NJW A;  3LP1 A;  2WON A;  1DTT A;  1B9F A;  2D0C A;  3AVK A;  3KK2 A;  1A5V A;  2IOC A;  5CZ2 A;  4CJW A;  3ZT4 A;  1SL0 A;  3CM5 A;  3NBP A;  3ZSV A;  4CGJ A;  4BE1 A;  1FK9 A;  2PY5 A;  1VSK A;  4AH9 A;  3T1A A;  2RF2 A;  1JLB A;  2RPI A;  4CE9 A;  2YNG A;  3ZSO A;  4XIU A;  4FM0 A;  3OYF A;  1QSS A;  4FJN A;  1LWE A;  2XY8 A;  1VK0 A;  4FVM A;  3MAQ A;  3V9Z A;  3HVR A;  4KAZ A;  1BIU A;  3ZSR A;  4RW6 A;  1BIZ A;  2BGG A;  3T19 A;  4KTZ A;  3O4N A;  4OGE A;  4CF1 A;  4N56 A;  2R7Y A;  1VSM A;  4DS4 A;  4KPY A;  2FC0 A;  3AO3 A;  5C42 A;  3O3F A;  1UA1 A;  4HCC A;  4FJH A;  1U48 A;  2F96 A;  3HL8 A;  4CEC A;  3SYZ A;  4ELV A;  4BDZ A;  1BI4 A;  4FK4 A;  4DTU A;  2PYL A;  3SI6 A;  1NK0 A;  2B5J A;  3AVA A;  2NUB A;  4FK2 A;  4H4M A;  3HT3 A;  4CJL A;  5E41 A;  3NAE A;  1EXQ A;  3KK1 A;  3ULD A;  3HJF A;  3KLI A;  4Y1D A;  3L8B A;  2G8H A;  1WLJ A;  3I0S A;  3L2Q A;  1L3T A;  4M3T A;  4CF8 A;  1HQU A;  2PYJ A;  3OYL A;  4FW2 A;  1TL1 A;  3OYH A;  2HB5 A;  4I9L A;  4OVL A;  4BAC A;  3IAY A;  3RMC A;  3TAB A;  3DLR A;  3K2P A;  1D5A A;  4E7L A;  1S1U A;  1W9H A;  1RTJ A;  4F8R A;  4FJK A;  3V9S A;  2KTQ A;  3TAG A;  3WNH A; 
#chains in the Genus database with same CATH topology
 2DY4 A;  3WNE A;  4BC3 A;  5JVH L;  3J7Y P;  3CFO A;  1HNX K;  3MN5 A;  3R1X A;  4KB1 A;  3V4I A;  1TKZ A;  1KVB A;  1Q18 A;  4BVO A;  4JI1 K;  4FK0 A;  4NXN K;  1DTQ A;  5AQQ A;  3UIQ A;  3UKU B;  4JV5 K;  4CEO A;  2QWM A;  4DU3 A;  1RDB A;  4IKF A;  1TKX A;  3QLH A;  4CED A;  1NK7 A;  5BRH A;  4K43 A;  3CQY A;  3FZK A;  4BE0 A;  3KKR A;  3HK2 A;  4GKK K;  3SUN A;  4FOI A;  3CPE A;  4H0P A;  3CCQ N;  4JRP A;  4BRQ A;  5J2M A;  3ZEU A;  3L3V A;  1VQM N;  1RBT A;  4EHU A;  2E2N A;  4W5R A;  3IG1 A;  1I3A A;  3VGK A;  1J9A A;  3U8X A;  1B9D A;  4FJI A;  5C24 A;  2I5J A;  5KGX A;  3GG4 A;  2ZD1 A;  4DTJ A;  1IBL K;  3AO5 A;  3NE6 A;  3QET A;  5LJW A;  3HO1 A;  4Z0U A;  4I2P A;  3NMU A;  3QER A;  4FJ8 A;  4JEP A;  3T1Y K;  1VQK N;  3QNN A;  1C0T A;  4DQI A;  5AQR A;  5C0Y A;  1HYZ A;  1C0G A;  3ID6 A;  5FPE A;  3EE8 A;  5C2D A;  5BRE A;  4CZE A;  3M3Z A;  3OYN A;  1QQO A;  4DR3 K;  1K8K A;  4BRD A;  5TKY A;  3KVG A;  2UU9 K;  2BUP A;  4Z4H A;  3NH1 A;  1SUQ A;  3CXC M;  2P9N A;  1RTI A;  4CJQ A;  4IBN A;  1JCG A;  1L5U A;  3S41 A;  3ENB A;  2IC3 A;  3P1G A;  3DRP A;  3C6T A;  3MCA B;  1WBD A;  3ATU A;  3ENH A;  1YJN N;  3J7Z O;  2Q97 A;  3RR7 A;  4CHY A;  4PHT X;  1X9J A;  1RDW X;  3MWP A;  2P5G A;  1ASW A;  2PBD A;  4YOR A;  3OYM A;  1QQN A;  3SUQ A;  2HBL A;  1ZBH A;  4DV1 K;  2G8V A;  2GWK A;  4CZM A;  1KFD A;  3NF7 A;  4QAG A;  4E0D A;  4JN4 A;  3LWL A;  4WF9 L;  5IT9 O;  1NMD A;  4K0K K;  2GWJ A;  4KRE A;  2KZZ A;  4EZ9 A;  1C1A A;  4DV0 K;  1VSJ A;  1C1C A;  3RMD A;  1YUW A;  4CHQ A;  4QS8 A;  4AHU A;  4DR2 K;  4L8R B;  3KWG A;  1MWM A;  3PSF A;  3WEE B;  1X9M A;  2HNY A;  3ZT3 A;  1FJG K;  1HR0 K;  4QOZ B;  3TAE A;  1G99 A;  5FDL A;  4FL9 A;  2GEM A;  3AVL A;  1JJ2 M;  3VEO A;  1DKG D;  1QVF M;  1VSI A;  3QIP A;  3HI0 A;  4F2R A;  3ZLJ A;  3V1R A;  5F0X A;  3K57 A;  4K41 A;  3DLH A;  4K8X A;  1RDD A;  3RVC A;  5EX5 A;  4LF6 K;  1NJZ A;  2YNH A;  1JCE A;  3AA3 A;  1REV A;  4JKE A;  4M63 C;  5DMR A;  2A6A A;  4LH4 A;  2JWK A;  4B9U A;  1NJX A;  3CCE N;  3KKS A;  1ITG A;  3F9K A;  3FFK B;  3SQ2 A;  4GVM A;  4DF4 A;  3PX6 A;  5KI6 A;  1TVR A;  4DTX A;  5HRO A;  4GVE A;  3AO2 A;  3T7Z A;  4W5O A;  1NK4 A;  2A5X A;  1YI2 N;  2IGI A;  1B92 A;  2F8T A;  1GLL O;  2E2Q A;  3AO1 A;  4I6M A;  1KSP A;  4IFY A;  2AA4 A;  4JAX A;  4LF4 K;  2KFN A;  3H46 O;  3OJU A;  5FRM A;  1CZ9 A;  4FJ7 A;  4B3O A;  4OLB A;  1SL1 A;  3KD1 E;  1ASU A;  4IOA L;  4A2A A;  1MWK A;  1T03 A;  1HYS A;  1A5W A;  4BRP A;  2YHB A;  4CHO A;  3RRG A;  2P9P B;  1QSL A;  4FPA A;  2Q1N A;  5T7B A;  1MU2 A;  5C2F A;  4DKW A;  1NGD A;  1WSI A;  2BTF A;  1S72 N;  1KD1 O;  3H1Q A;  1U2V A;  3A8Y A;  5BR9 A;  4PQU A;  3MN7 A;  4H0X B;  3SAG A;  5CR4 A;  3FZH A;  3O9S A;  3KWI A;  2ZJP L;  3CD6 N;  3VEW A;  5E84 A;  3MX5 A;  1E3M A;  5HL7 L;  1KRP A;  5I42 A;  4JK9 A;  1HMV A;  4M3Y A;  3DLG A;  3E01 A;  3SQ1 A;  4FXD A;  3CC2 N;  1GLB G;  3BEX A;  2X6N A;  3FZL A;  3U9D A;  1VQ7 N;  1IBK K;  4KTW A;  4E1N A;  1TYQ A;  3SCX A;  5HLF A;  2HHV A;  3DOK A;  1DGK N;  4YHH K;  3O4W A;  1N34 K;  1ESV A;  4BRH A;  1JXE A;  1LW2 A;  2HMP A;  4FZZ A;  1RIL A;  4NYN A;  2W42 A;  3C6H A;  3VEX A;  4IO8 A;  3EYZ A;  1T8E A;  3CC7 N;  3SUP A;  4CFB A;  4B3R K;  1U6Z A;  1TAU A;  3OYG A;  4F4K A;  1YTA A;  1SAZ A;  3AAR A;  3PUF A;  3O4Q A;  4LSL A;  3QEP A;  3EKU A;  4EZ6 A;  1KLN A;  3M8Q A;  4CEZ A;  1D4X A;  4DV6 K;  1SKR A;  1JXB A;  3K0S A;  4FLX A;  3AVB A;  3CIP A;  3LPU A;  4CI6 A;  2E2P A;  2OPP A;  2BE2 A;  3S3O A;  3V81 A;  4ELT A;  4XEI A;  3NGZ A;  4FWR A;  3G6E N;  1Z05 A;  4HUG A;  2HBM A;  4FWK A;  5BPN A;  1EWQ A;  4WFB L;  1J53 A;  4JKG A;  4CJ3 A;  5AZI B;  4X65 K;  5FRN A;  3VN5 A;  5M1F A;  2UYT A;  5JS2 A;  3L2U A;  3MN6 A;  3GBT A;  4PY5 A;  2VWJ A;  3NF6 A;  1U04 A;  4CEA A;  3DRS A;  1T05 A;  1IKV A;  1EO1 A;  4DSJ A;  1KC8 O;  3HOT A;  1I39 A;  3MEC A;  4JKF A;  3ZSY A;  3CF5 L;  2ITG A;  2ZGY A;  3K5M A;  3OYC A;  1BL3 A;  4H8K A;  3JSM A;  3CI5 A;  2LSN A;  4YFU A;  4I9Q A;  3OBY A;  2I7P A;  4IG0 A;  4CEF A;  2XRI A;  3KJV A;  1IO2 A;  2QWQ A;  3N4Q A;  5FRO A;  5J2P A;  3I33 A;  3S9H A;  4EP5 A;  4NO7 A;  5LMN K;  2XY7 A;  3VF4 A;  2PFU A;  3TU5 A;  2IVO A;  5JMV A;  1HUX A;  3A0I X;  5JLF A;  4XH4 A;  3U9Z A;  4O5B A;  3A5O C;  2W41 A;  2QEX N;  2KQ2 A;  4LH5 A;  4YOW A;  4V19 S;  4FJX A;  3CMA N;  2O8D A;  1DLO A;  3S3N A;  3VQ9 A;  1IBM K;  4C8L A;  1NJY A;  1NNE A;  1IJJ A;  3D6R A;  4BRG A;  1VSE A;  2D0A A;  5HBM A;  5GIP A;  1NGC A;  3OBW A;  2QWO A;  1BI4 B;  1EET A;  4CJ4 A;  3C95 A;  3CER A;  5LL6 Z;  3T3F A;  2E4L A;  3Q7C A;  5AZJ B;  4FWM A;  3CJ1 A;  2G8U A;  3KTQ A;  3OYI A;  1DEJ A;  2HMI A;  4CZI A;  2O8C B;  1JLQ A;  2HHW A;  3ASM A;  1E4F T;  4DSK A;  1W7A A;  3F9M A;  1NK5 A;  3TAR A;  1NGH A;  3ENO A;  1ILY A;  2YNI A;  2P9S B;  3C65 A;  4HUF A;  1WAJ A;  4WQ4 A;  3PO4 A;  2D0B A;  3BUZ B;  3H6E A;  3CCS N;  1VSF A;  4IJN A;  4N5S A;  3H45 C;  3LP1 A;  1DTT A;  1B9F A;  5M1K A;  2IOC A;  5CZ2 A;  3NBP A;  3SMS A;  4JI3 K;  1FK9 A;  1VSK A;  3T1A A;  2O8B A;  3QFU A;  3WXJ A;  1LWE A;  4FVM A;  3O1W A;  3GOI A;  2YCH A;  4H03 B;  2Q0R A;  2BGG A;  5LY3 A;  4N56 A;  1QQM A;  3EE9 A;  5AQI A;  3VES A;  1UA1 A;  4DQ8 A;  4BQL A;  3DAW A;  4FK4 A;  1NGE A;  2GTD A;  4DTU A;  3SI6 A;  4GV9 A;  2B5J A;  3AVA A;  2NUB A;  4FK2 A;  4H4M A;  1BG3 A;  4CJL A;  2EWS A;  3KK1 A;  3G71 N;  3HJF A;  3KLI A;  3SMP A;  1L3T A;  3EN9 A;  4M3T A;  1LCU A;  4I9L A;  3J7A P;  4BAC A;  4BR2 A;  1NG9 A;  4F8R A;  4UY8 O;  3V9S A;  3TAG A;  5KRS A;  1VSD A;  4G1Q A;  3K9J A;  3A5M C;  3VEV A;  1J5O A;  1KQS M;  4OKJ A;  1WNS A;  4EP4 A;  3W3D A;  4CZH A;  3G10 A;  3BGR A;  1NGB A;  4O0I A;  4KHU A;  1HRH A;  3G25 A;  3THX B;  2P9I B;  4X62 K;  1U47 A;  3DXM A;  4C8M A;  4KH4 A;  5AJ3 K;  4M7X A;  1ZBF A;  4CZG A;  4ZTJ A;  3NF9 A;  3ZSZ A;  3WT0 A;  1R59 O;  2UUB K;  1C0M A;  4WFN L;  3M5R A;  5HOO A;  3ZCM A;  3BDP A;  3C6U A;  3OY9 A;  3VET A;  2F7T A;  1D9D A;  3VQD A;  5EOY A;  4CJR A;  3VEZ A;  3HM8 A;  4CIE A;  2J4R A;  2VWK A;  2NNW A;  2OCE A;  5EXW A;  4M3X A;  4JI0 K;  2F9W A;  2XY6 A;  1F21 A;  1Z25 A;  4UQG A;  5GAG P;  1NK8 A;  4O8K A;  4DFP A;  1RDA A;  3H1V X;  1VRU A;  3O80 A;  1WSG A;  1YAG A;  2IVN A;  4CJS A;  3OVN A;  5KPR A;  3DI6 A;  4KV8 A;  1FKP A;  4RW9 A;  4NB4 A;  1L3S A;  4N47 A;  3AAQ A;  5GIO A;  4BRC A;  1X3M A;  3LAN A;  5KPZ A;  3QB0 A;  3TAM A;  4IDK A;  3LDO A;  3TR8 A;  5J1E A;  3WXL A;  3VQQ A;  5BR8 K;  2E88 A;  3QFP A;  3UKU A;  4KH6 A;  4J2A A;  1NGJ A;  3LDQ A;  5BRD A;  4J2E A;  2DTU A;  4M3W A;  3A5N C;  4CVN E;  2RHK A;  3FFI A;  3QEX A;  2Q3S A;  3OS2 A;  4EAH D;  4MO5 A;  1QSY A;  3M6G A;  3VQE A;  5F2R A;  1ZBI A;  3CJA A;  3QDK A;  4KKO A;  3B6O A;  3K9K A;  4FLY A;  5DM6 L;  4AHC A;  1BWF O;  3TAQ A;  3R6M A;  3C94 A;  1WSE A;  2NZT A;  2Y1J A;  3NGY A;  3NF8 A;  4LY7 A;  4AHS A;  4GMJ B;  4H4O A;  1GOA A;  3HXM A;  3THV A;  4LF9 K;  2ZQB A;  4FLW A;  4B9N A;  4WQ5 A;  2ETJ A;  2HHS A;  3D2E A;  4FPB A;  3RRH A;  1N33 K;  1P8Z A;  2IDO A;  3KLE A;  4F9O A;  2OPR A;  4E7H A;  1LV5 A;  1OH7 A;  1S9G A;  3IMX A;  4DF8 A;  1LWF A;  3MXJ A;  1RT2 A;  3V1Q A;  3CQ8 A;  4DFJ A;  4CHZ A;  3R3L A;  1ZXO A;  3BZK A;  4KHS A;  3LM9 A;  3RSE B;  4HTL A;  1VAZ A;  3AGR A;  1UAX A;  3CFR A;  4AM6 A;  2AJQ A;  4AHT A;  3VPZ A;  4ISF A;  2VWB A;  1CXQ A;  3DLK A;  4R5P A;  5B8H A;  1GOC A;  3DJC A;  2X78 A;  2HHU A;  2ZM6 K;  1JLA A;  3ZSX A;  5EY4 A;  4QS9 A;  3L2R A;  4GKJ K;  4C8K A;  4OLA A;  2P51 A;  3ZT1 A;  3UB5 A;  1JKH A;  5J2N A;  3CQX A;  3SPY A;  2P9L B;  4CIG A;  3CJC A;  1RT7 A;  2NRR A;  1BGX T;  3ZX3 A;  3M8R A;  4CFC A;  1XWL A;  1Y64 A;  3U6F A;  3ULE B;  4KBO A;  3HTV A;  3U3G A;  1KVA A;  4IEE A;  4A57 A;  4CJF A;  3SQ0 A;  3WEE A;  4CHP A;  3CPW M;  3OA9 A;  3OTO K;  1Q9Y A;  4M7Y A;  3C0B A;  2HVH A;  3CYM A;  5AR0 A;  3O9R A;  4LD0 A;  4DLG A;  1L3V A;  3BF3 A;  1ZBS A;  2OZS A;  4W5Q A;  3TAF A;  3G4S N;  4JS4 A;  1BIS A;  3K59 A;  3TTF A;  3PO5 A;  5AQF A;  3PIO L;  2W6L A;  1NGI A;  5ADX A;  3QEV A;  4FJL A;  2UUA K;  1JCF A;  4C8O A;  1JLC A;  1LAW A;  1S5J A;  2GBZ A;  4FLU A;  4TSX A;  1WB9 A;  3C6A A;  2P1J A;  4CES A;  1GLE G;  3L4I A;  4IOX A;  4OPA A;  1QQC A;  1YXQ A;  3AVF A;  3UKR B;  4JKH A;  5CY4 A;  4BWJ A;  4DTP A;  1I94 K;  3HZ6 A;  4O55 A;  3RTV A;  1NMN A;  3TI0 A;  3LDL A;  5AQX A;  3KK7 A;  2Q0U A;  2YKM A;  4OPK A;  4B9Q A;  5JVG L;  4LSN A;  2VG5 A;  3V1O A;  3E66 A;  2FBX A;  1Q81 O;  4R79 A;  2GUP A;  3BF1 A;  1NGA A;  3SV4 A;  3O1B A;  2P9P A;  4KRF A;  3O6W A;  4K8Z A;  4WQ4 C;  4H5T A;  1ZC6 A;  5KTQ A;  5FLX O;  2G8I A;  2PAV A;  1EKE A;  4O44 A;  4DU4 A;  4OKK A;  1HPM A;  5LMU K;  1KTQ A;  3IKM A;  3MXM A;  4Z4I A;  5BRF A;  2D0O A;  4JI6 K;  3QES A;  1XHX A;  1TV6 A;  4KTQ A;  4IG3 A;  2GV9 A;  2WC9 A;  5H1S Q;  2IIR A;  4NYF A;  4X66 K;  4DB3 A;  3AY9 A;  4KHN A;  4CJP A;  2F8S A;  2ASO A;  3M8S A;  2A42 A;  4Z4E A;  4M42 A;  2P9K B;  2E5L K;  1C1B A;  1C0F A;  5AQY A;  4FJ9 A;  3V9U A;  3A2F A;  3O8M A;  4PKI A;  4E1M A;  4E89 A;  5EVZ A;  2KZM A;  1JL2 A;  3TAN A;  3SLC A;  3HP9 A;  3D45 A;  3O9Q A;  3VEN A;  3SPZ A;  1X9W A;  4MO4 A;  1N6Q A;  4CJU A;  3CC4 N;  3NH2 A;  4DV3 K;  4DSL A;  1XQS C;  3F5T A;  1FXX A;  4WE1 A;  1QHT A;  3HSC A;  5DK5 A;  3TTC A;  3NH0 A;  1NK9 A;  2EHG A;  1J6Z A;  2A1R A;  1XNQ K;  4JD2 B;  5MLC Q;  1VQL N;  5F1X A;  4MDB A;  5AQZ A;  2DFE A;  1D8Y A;  4BY9 C;  3S3M A;  5HRP A;  4DTO A;  4CFD A;  5AQU A;  3R9P A;  3IUC A;  1IKX A;  3ALY A;  4DSF A;  5CZ1 A;  4CJT A;  4CGD A;  5AZI A;  3AV9 A;  3SV3 A;  3V6D A;  4RW4 A;  3NHG A;  1TK8 A;  1BU6 O;  1S6Q A;  3AVM A;  4YOU A;  4CGG A;  3EO3 A;  4PKH A;  4BC4 A;  2GEL A;  2JGU A;  4DTN A;  3MK6 A;  4FYD A;  3MEG A;  2FF6 A;  1QZ6 A;  5FPN A;  2JWL A;  2VQE K;  2FSJ A;  3OJS A;  2UXC K;  4DV5 K;  4IZ9 A;  2OTJ N;  3THY B;  2OAN A;  2Z1G A;  2DFH A;  5ADX H;  1ZBU A;  1Q7Y O;  2GX9 A;  3FZM A;  2B6A A;  4ICL A;  4H5V A;  1TKT A;  5GAH P;  4B9L A;  1KLM A;  1NJW A;  2WON A;  3AVK A;  3AAP A;  5AQJ A;  4CJW A;  2PY5 A;  2RF2 A;  2RPI A;  2W40 A;  4CE9 A;  2YNG A;  3ZSO A;  4A59 A;  4FM0 A;  1J5E K;  4FJN A;  2WUS A;  1VK0 A;  5AQH A;  4MLE A;  3L4Q A;  3P39 A;  1NGF A;  3HVR A;  1VQN N;  4LF8 K;  2YI1 A;  3JXU A;  3O4N A;  3SAH A;  5AQV A;  2FC0 A;  5C42 A;  2RE2 A;  2F96 A;  3HL8 A;  4ELV A;  1BI4 A;  4J8F A;  2PYL A;  2NRW A;  5AZJ A;  3HT3 A;  1MDU B;  2CH5 A;  1EXQ A;  3JS6 A;  4Y1D A;  4BRM A;  3I0S A;  3WQU A;  4CF8 A;  1HQU A;  2PYJ A;  2QM1 A;  3TTD A;  4JNE A;  1TL1 A;  4BRL A;  4OVL A;  3VGL A;  3RMC A;  3TAB A;  3DLR A;  2HBJ A;  4JKB A;  1V4T A;  1S1U A;  1W9H A;  2P9S A;  4FJK A;  1N32 K;  3CME N;  4GV3 A;  1N5Y A;  2BAN A;  4Z4F A;  3AVJ A;  1RBS A;  4BR4 A;  2HF4 A;  4DR7 K;  3DXK B;  1SS6 A;  4DR6 K;  2QW9 A;  3BP8 A;  4BDY A;  4IDH A;  1VSH A;  3OYE A;  2O8E B;  3EZ5 A;  4KHW A;  3LAK A;  3ZSQ A;  4FWN A;  5BN8 A;  4LFA K;  3RMA A;  1C6V A;  1RGI A;  1DT9 A;  3O5B A;  4C1N K;  2QA4 N;  3B8A X;  2E6L A;  4G9Z A;  1NOZ A;  4W5T A;  3O3H A;  1QTM A;  4BR7 A;  4KHY A;  3H3N O;  4FWQ A;  1WSH A;  4B1U B;  3O9U A;  4C23 A;  1IH7 A;  2ITM A;  3ZX0 A;  3TSQ A;  3QIN A;  1K6Y A;  2QI2 A;  1N36 K;  1QS4 A;  3VQB A;  4FSV A;  4HWI A;  1ASV A;  1SL2 A;  1SKS A;  1BA1 A;  1CZA N;  3VQ7 A;  4EHT A;  2HOE A;  4CK3 A;  4B9S A;  2YX6 A;  3I56 N;  4DU1 A;  4B9T A;  2VG7 A;  1T44 A;  3HPG A;  3W0L A;  3THX A;  2V52 B;  2P9I A;  3HVT A;  3SAF A;  5LJV A;  3ISN C;  4BRO A;  2A40 A;  5C25 A;  2G8K A;  4B9V A;  3WQT A;  3I8D A;  1C0U A;  2QXF A;  3VQ4 A;  3THW A;  2ASP A;  1HKB A;  4HVJ A;  1ATN A;  2QWR A;  4FJM A;  2CGL A;  1VQ5 N;  2P5O A;  4KHQ A;  1LW0 A;  1Q8I A;  3TWH A;  2O4G A;  1KXP A;  2Q2R A;  4ILH A;  4BDP A;  4PKG A;  1HYV A;  3CCM N;  3K5O A;  2VGM A;  1RDC A;  3ZET A;  3LDN A;  3L6Q A;  3T1H K;  3LDP A;  1RT4 A;  5IWA K;  3OYJ A;  5KQD A;  3AVG A;  3VQ5 A;  4RW8 A;  2QTD A;  3LWM A;  3MWT A;  5SZT A;  4H0T B;  3VQ6 A;  3VQC A;  4B1Z A;  2CGK A;  4ELU A;  4YOT A;  4PA1 A;  1OH5 A;  4FLT A;  2PZS A;  2BDP A;  3NVK A;  3OHR A;  1CLQ A;  4DV7 K;  4CZK A;  3OYK A;  2DFF A;  1M90 O;  1NKE A;  4CD1 A;  4A2B A;  3U3Y A;  2HHT A;  1L3U A;  4E7K A;  2FLO A;  3L3U A;  3LP0 A;  4M3U A;  1FW6 A;  3MEE A;  5ELZ A;  2FBV A;  3E1Y A;  3KLH A;  1X1P A;  4RWT A;  1Z6R A;  4WCE L;  1MA9 B;  1WAF A;  5AQK A;  3MXI A;  5GAD P;  3ZT0 A;  1SKW A;  2RN2 A;  4FM1 A;  3CJ9 A;  4CZL A;  4CEB A;  1BA0 A;  4ID5 A;  1OH8 A;  4DFK A;  3LP2 A;  2UXB K;  4H0Y B;  1YHQ N;  4CD3 A;  1BO5 O;  3VOV A;  4JI2 K;  4F3O A;  2E8A A;  5JIC A;  3T69 A;  2O8F B;  2ZE2 A;  4JI8 K;  1W2B M;  4HHT A;  4A5B A;  1VSL A;  4BQZ A;  4GW6 A;  4E7J A;  4M3Z A;  1JL1 A;  4GY2 B;  4JS5 A;  3M8P A;  3JAM O;  3TSP A;  1NKC A;  3LL3 A;  1XC9 A;  3AA5 X;  5AQS A;  1QE1 A;  4U7B A;  4LFB K;  1SZ2 A;  3RSE A;  4PUO A;  1KVC A;  2WFB A;  3P38 A;  3QO9 A;  4B08 A;  4DUY K;  2QWN A;  4I2Q A;  1FKO A;  1BHL A;  1RT6 A;  4H5N A;  1Z26 A;  4FVU A;  1T7P A;  4MQ3 A;  3K5N A;  4FWO A;  1QZ5 A;  4CF0 A;  2W6K A;  2WBN A;  1VQP N;  1NOY A;  3ZX2 A;  1ZBL A;  1HQE A;  4BWM A;  3VMF B;  3O9T A;  2XO7 A;  4GNI A;  4IEI A;  3KIO A;  5FPM A;  4CIF A;  2P9L A;  2HW3 A;  3Q7B A;  4KH5 A;  2RKI A;  2Q36 A;  4WYB A;  3QBX A;  5KRT A;  3VQA A;  1K9M O;  2E6M A;  3NDK A;  4N41 A;  3ULE A;  3DWL A;  3TAP A;  3A5L C;  3D0P A;  3CCR N;  4B9M A;  2OTL N;  3P4I A;  3QEW A;  4BR5 A;  1XI1 A;  1Q86 O;  5JLH A;  4O8U A;  3AVN A;  2ATQ A;  4RG8 A;  5AQG A;  2XY5 A;  2NRH A;  4DTR A;  1GLF O;  3OYA A;  1TL3 A;  1T6C A;  1H1V A;  2D5R A;  1E4G T;  1BCO A;  2IAJ A;  3HST B;  2YKN A;  3J81 O;  3PV8 A;  5I3U A;  3D7E O;  3MDQ A;  3KZB A;  4JI5 K;  4L3Q A;  1S22 A;  3CCL N;  4JYA K;  3DOL A;  3CG7 A;  2YHW A;  1S1W A;  3UKR A;  4O4G A;  3TPQ A;  3PIP L;  4HCB A;  2FBY A;  4C1N I;  4CZF A;  2NRZ A;  4BVP A;  2YNF A;  1NU0 A;  3KLG A;  1BQN A;  3CCJ N;  2E1Z A;  3RMB A;  2VQF K;  2V51 B;  5D3G A;  3KD5 E;  3JYT A;  1HNV A;  1UOC A;  1T6D A;  4CFA A;  4JLH A;  3DMJ A;  4HUE A;  2NLX A;  4U67 L;  2H3G X;  1VQO N;  2F4V K;  4H0O A;  2A41 A;  4BGA A;  1YVN A;  1A5X A;  4B1X B;  1JLF A;  2D0P A;  2Y1I A;  1WSF A;  4OJR A;  4DV4 K;  5AFU A;  4Q5V A;  3IS9 A;  1BCM A;  3BY5 A;  1TKD A;  4H5R A;  1UWB A;  4CER A;  3C7N B;  3FZF A;  3LM2 A;  1WSJ A;  2HNZ A;  4DS5 A;  4BRE A;  3SQ4 A;  4NXM K;  5AQP A;  4NLB A;  1VHX A;  3RWU A;  1K8A O;  3B6P A;  1K73 O;  4WFA L;  4BE2 A;  3AVH A;  4LF7 K;  4MFB A;  3GL1 A;  3HRG A;  1KFS A;  3FGU A;  5KQ8 A;  2OPS A;  3CFP A;  4BRK A;  2P9K A;  5HRR A;  3V9W A;  1RFQ A;  4LFC K;  3HPO A;  4AF1 A;  4FJJ A;  3OS1 A;  2D1K A;  1HNW K;  4JK8 A;  5AQN A;  2VG6 A;  2I7N A;  2Z1J A;  4CHN A;  3AA4 A;  3D2E B;  1R0A A;  2KLA A;  2P9U B;  4XH1 A;  2HHQ A;  4B3M K;  1V4S A;  4OPH A;  3M1F A;  3CCU N;  3KHY A;  4FWP A;  4E7I A;  4FLV A;  1OKJ A;  4Y0W A;  5GAE P;  4F2S A;  4CEE A;  1O13 A;  2ASM A;  3D2F B;  4CBX A;  1IG8 A;  2XHB A;  1LOT B;  4BG9 A;  1KCF A;  4JHD B;  4JKC A;  4DV2 K;  4JD2 A;  1T3V A;  1A5V A;  4BC2 A;  5FPD A;  3CM5 A;  4CBW A;  4CGJ A;  4BE1 A;  4AH9 A;  3I8B A;  3MN9 A;  1JLB A;  2QXL A;  2XY8 A;  3V9Z A;  3MAQ A;  4KAZ A;  3ZSR A;  1BIZ A;  1NM1 A;  3L0Q A;  3SBG A;  3T19 A;  1HNZ K;  3ZEU B;  2R7Y A;  1VSM A;  3O3F A;  4HCC A;  1U48 A;  4CEC A;  3SYZ A;  1TUU A;  3VER A;  1BDG A;  4A62 A;  1VQ8 N;  4A61 A;  4IFE A;  5E41 A;  1KAZ A;  2HBK A;  3VEY A;  3L8B A;  2VYP A;  3AGK A;  3L2Q A;  4B3T K;  4MDA A;  2F9T A;  3THY A;  1RDU A;  3OYH A;  2HB5 A;  5AQL A;  4E7L A;  4H5W A;  2YHY A;  3FLC O;  3WNH A;  4B1V A;  1HKC A;  3CJ7 A;  3DLB A;  3PY8 A;  3MCP A;  4CJ7 A;  1RNH A;  3QIO A;  1X9S A;  3F73 A;  3SZ2 A;  3CCV N;  4CK1 A;  3SJJ A;  4IXC A;  4FJ5 A;  3L2W A;  3OYD A;  1K8K B;  4NCA A;  5HRN A;  4RCH A;  1IKY A;  5CYQ A;  3AO4 A;  3O3G A;  4B8C A;  2Z1H A;  1YVU A;  2KKZ A;  3SNN A;  1YJ9 N;  2P9N B;  5AFU H;  1YIT N;  3E9O A;  5C10 A;  4AIL C;  3I0R A;  4DWI A;  5BN9 A;  4YOX A;  1XMO K;  4DUZ K;  3ZT2 A;  3FE1 A;  2BH1 A;  4BR9 A;  2Q31 A;  1EWR A;  4M45 A;  4LF5 K;  1KAY A;  3VA0 A;  3WXK A;  4ZHR A;  3IRX A;  4CGF A;  1EP4 A;  2QWP A;  4YDU A;  2YV0 X;  1D9F A;  3VQ8 A;  2IS3 A;  1RT5 A;  4B1Y B;  4FOE A;  5M1P A;  3WUH A;  3DLE A;  3DXK A;  4C8N A;  4E1J A;  5JS1 A;  4ZTF A;  3CHW A;  4JKA A;  3SK3 A;  1HKG A;  3LAL A;  4DQQ A;  3RR8 A;  3EKS A;  3H3O B;  3CET A;  1CXU A;  4IJA A;  4CK2 A;  2ZJR L;  2ZWH A;  1W0H A;  1XHZ A;  2O4I A;  2O8E A;  1YJW N;  2IVP A;  4FCY A;  1TAQ A;  4EIA A;  4DR5 K;  4J2D A;  1TK5 A;  3HPH A;  4CJ5 A;  3OW2 M;  1UA0 A;  2HND A;  1ATS A;  4E19 A;  3NFA A;  2X74 A;  1YT3 A;  2G8F A;  2B4J A;  1EX4 A;  3LDS A;  4BC5 A;  1XNR K;  4CJK A;  3HM9 A;  4ILJ A;  5CHI A;  3DRR A;  1NKB A;  4KFB A;  3QML A;  3H08 A;  1RTH A;  1WN7 A;  1S1T A;  4YOV A;  4O5F A;  3VA3 A;  2Z1I A;  3SUO A;  5M1N A;  1SQK A;  1VQ4 N;  2HST A;  1S1V A;  1QVG M;  4Z4C A;  4BR0 A;  4I6M B;  2GUI A;  3VQP A;  5J2Q A;  5C12 A;  3VF2 A;  1OVY A;  4CJV A;  2O8C A;  4WQ5 C;  1G15 A;  1LWC A;  3R8E A;  3LP3 A;  1OVQ A;  4B3S K;  4JKD A;  1TK0 A;  4KI6 A;  4OO1 J;  2E2O A;  3DLL L;  1GLJ O;  2OYQ A;  4NLC A;  4BRN A;  1U2V B;  4DMN A;  4FW1 A;  3VGM A;  4Z4G A;  1S6P A;  4HTU A;  5KPT A;  2YJE A;  4CBU A;  4DLE A;  2X6S A;  3HYF A;  3QBW A;  5TKW A;  1NJI O;  2KFZ A;  4BGB A;  5BPM A;  2OZM A;  4CZJ A;  3EEQ A;  4F3T A;  4CGH A;  3LPT A;  2CH6 A;  4NCG A;  1RT3 A;  5E26 A;  3CJB A;  1WUA A;  2AP1 A;  4M3R A;  5A2Q O;  3MX2 A;  2V7Z A;  4IWV A;  4IFV A;  2QKB A;  1M1K O;  4FZY A;  2WOM A;  2FSN A;  4MLH A;  1TYQ B;  3KLF A;  2HHX A;  1HLU A;  4X64 K;  3K58 A;  4KB0 A;  2FF3 B;  2FSK A;  3NCI A;  2V7Y A;  4DQS A;  2D4W A;  5CYM A;  3VTI A;  4AHV A;  3E9P A;  4AM7 A;  3IDH A;  1RCH A;  4DR1 K;  1NK6 A;  3ITH A;  1IKW A;  4AHR A;  3LZJ A;  4DG1 A;  5BPL A;  1XMQ K;  2E1Y A;  2A1S A;  3QEI A;  1HJR A;  4JI4 K;  5CE3 A;  1JLE A;  5K14 A;  4Q0B A;  1U45 A;  2QKK A;  3HBT A;  2OA8 A;  4PL7 A;  4DFM A;  4FZX C;  1BOT O;  4KHP K;  4CCH A;  4CF9 A;  3DM2 A;  5AQT A;  1IV0 A;  3MED A;  4BRF A;  4B1W B;  3P31 A;  2O8F A;  2YHX A;  4JKG B;  2HF3 A;  4NCB A;  1YTU A;  3QIC A;  4I7F A;  3VF6 A;  3ID8 A;  4JI7 K;  1GLC G;  1EQY A;  2QWL A;  3SBT A;  1RBR A;  1S1X A;  2ZF5 O;  1X3N A;  3PX0 A;  1ZYQ A;  3EL2 A;  4CEQ A;  1VRT A;  3LAM A;  5M1Q A;  1XUP O;  1TGO A;  4YOY A;  3LZI A;  4FJG A;  4JRQ A;  2DPN A;  3CM6 A;  4RW7 A;  3EZW A;  3N4P A;  1KAX A;  4DQP A;  3L2V A;  4W5N A;  2KW4 A;  3IFR A;  3F2K A;  4LC9 B;  3UE5 A;  2ZJQ L;  1YIJ N;  1HPZ A;  3HOS A;  1GOB A;  2QK9 A;  3VTH A;  1ATR A;  1O1W A;  1BQM A;  5DM7 L;  4B8A B;  5HRS A;  2KHO A;  4FLZ A;  1TUY A;  1QHA A;  2ZGZ A;  3QNO A;  1N8R O;  4OX9 K;  2EX3 A;  5I9E B;  2HHH K;  1RT1 A;  1NBW A;  4OPJ A;  4N76 A;  2O8D B;  4J2B A;  3WNF A;  5AQO A;  4CJE A;  3GE1 A;  2YHA A;  2JLE A;  3KK3 A;  2A3Z A;  4H0V B;  5KGW A;  4CGI A;  4CF2 A;  3K5L A;  3OYB A;  4ID1 A;  1XC3 A;  3AA2 A;  2UXD K;  3PLA A;  1U49 A;  2E20 A;  2FXU A;  4ILG B;  4QS7 A;  5AQM A;  3AVC A;  4Z94 A;  3HP6 A;  5GIN A;  4BRI A;  3G0Z A;  4YY3 K;  1NLV A;  1WBB A;  4ISE A;  3AVI A;  4IO9 L;  3P5J A;  4O0J A;  1Q9X A;  3ATV A;  3THW B;  5AQW A;  4K42 A;  4IOC L;  3PSI A;  3WNG A;  3TSU A;  2NRX A;  3ZSW A;  1U4B A;  1RTD A;  4Y1C A;  2CGJ A;  5SWM A;  4DR4 K;  5M1O A;  2HVI A;  3NGI A;  1RBV A;  4AQY K;  4KI4 A;  2VCP A;  2UUC K;  5EU7 A;  1OH6 A;  2O8B B;  3FR0 A;  3V9X A;  2FBT A;  1HNI A;  3OS0 A;  4DTM A;  1Q82 O;  3ZYY X;  3ZET B;  4YNQ A;  1S9E A;  4QCL A;  4DQR A;  3E9L A;  3DYA A;  4PWD A;  4OKE A;  3PX4 A;  4DSI A;  1LAV A;  5HP1 A;  1SV5 A;  4KO0 A;  4BG8 A;  4DCH A;  2NRV A;  2WTU A;  4PL8 A;  4FM2 A;  2OPQ A;  1GLA G;  2G8W A;  3MMV A;  4K25 A;  4FWL A;  3P83 D;  1HX1 A;  1W97 L;  4DSE A;  1Y97 A;  4E3S A;  2VGN A;  4EFH A;  4DTS A;  1P90 A;  4YDU C;  3J8A A;  3C7N A;  1VQ6 N;  4FWS A;  3WXI A;  4M41 A;  3GDQ A;  2NRT A;  4GV6 A;  1JLG A;  1RBU A;  3EY1 A;  1CZB A;  3NVM A;  4OGC A;  1VQ9 N;  1YF5 L;  4FO0 A;  1J54 A;  1NGG A;  1IG9 A;  1GLD G;  1WOQ A;  3J80 O;  2D0C A;  3KK2 A;  3ZT4 A;  1SL0 A;  4JK7 A;  3ZSV A;  3SJH A;  4A5A A;  4XIU A;  3DXM B;  4CW7 B;  3OYF A;  1QSS A;  1HJO A;  3BZC A;  3I55 N;  1BIU A;  4RW6 A;  4KTZ A;  4OGE A;  4CF1 A;  4BRA A;  4DS4 A;  4DHY A;  5C15 A;  4KPY A;  3AO3 A;  4FJH A;  1NWK A;  4ISG A;  4XH5 A;  4BDZ A;  1NK0 A;  2P9U A;  3NAE A;  3ULD A;  2G8H A;  1WLJ A;  1S3X A;  1BUP A;  3OYL A;  4FW2 A;  3WXM B;  2YJF A;  3IAY A;  3K2P A;  3U4L A;  3D2F A;  1D5A A;  3O08 A;  4RTF D;  1RTJ A;  2KTQ A;  4JHD A; 
#chains in the Genus database with same CATH homology
 2DY4 A;  3WNE A;  1N5Y A;  2BAN A;  5KRS A;  1VSD A;  4Z4F A;  4G1Q A;  3AVJ A;  1RBS A;  3DLB A;  3CFO A;  1J5O A;  4OKJ A;  1WNS A;  4EP4 A;  3PY8 A;  1RNH A;  4KB1 A;  3V4I A;  1TKZ A;  3G10 A;  3BGR A;  3QIO A;  1X9S A;  1KVB A;  3F73 A;  3SZ2 A;  4FK0 A;  4CK1 A;  4O0I A;  1DTQ A;  4KHU A;  1HRH A;  3SJJ A;  3UIQ A;  1U47 A;  4FJ5 A;  4CEO A;  4BDY A;  4C8M A;  3L2W A;  1RDB A;  3OYD A;  4DU3 A;  4IKF A;  1TKX A;  3QLH A;  4CED A;  1VSH A;  4NCA A;  1NK7 A;  5HRN A;  3OYE A;  3EZ5 A;  4BE0 A;  1ZBF A;  3KKR A;  3HK2 A;  4ZTJ A;  3SUN A;  3NF9 A;  3ZSZ A;  1IKY A;  4KHW A;  5CYQ A;  4JRP A;  5J2M A;  3AO4 A;  1C0M A;  3L3V A;  1RBT A;  3LAK A;  3ZCM A;  3ZSQ A;  3O3G A;  4B8C A;  3BDP A;  2Z1H A;  3C6U A;  3OY9 A;  1YVU A;  3SNN A;  1D9D A;  3VQD A;  3RMA A;  1C6V A;  4W5R A;  4CJR A;  3IG1 A;  4AIL C;  3I0R A;  4CIE A;  4DWI A;  1I3A A;  2E6L A;  2VWK A;  1NOZ A;  3ZT2 A;  4M3X A;  1J9A A;  4W5T A;  1B9D A;  3O3H A;  1QTM A;  2XY6 A;  4KHY A;  4M45 A;  1F21 A;  1Z25 A;  4FJI A;  5C24 A;  2I5J A;  5KGX A;  4UQG A;  1WSH A;  1NK8 A;  2ZD1 A;  4DFP A;  1RDA A;  4DTJ A;  1VRU A;  1IH7 A;  1WSG A;  4CJS A;  3QIN A;  1K6Y A;  3VA0 A;  4ZHR A;  3OVN A;  3AO5 A;  3IRX A;  1EP4 A;  4CGF A;  3NE6 A;  1QS4 A;  3VQB A;  2YV0 X;  3DI6 A;  3QET A;  4KV8 A;  1D9F A;  3HO1 A;  4Z0U A;  1FKP A;  4RW9 A;  4I2P A;  3VQ8 A;  1L3S A;  3QER A;  2IS3 A;  1RT5 A;  4N47 A;  4FJ8 A;  3DLE A;  1ASV A;  3QNN A;  3LAN A;  1C0T A;  1SL2 A;  3TAM A;  4DQI A;  4C8N A;  1SKS A;  4IDK A;  3VQ7 A;  4CK3 A;  3TR8 A;  1HYZ A;  5J1E A;  4ZTF A;  4B9S A;  5JS1 A;  4DU1 A;  4B9T A;  2VG7 A;  3HPG A;  3VQQ A;  4J2E A;  4J2A A;  3HVT A;  3LAL A;  4DQQ A;  3OYN A;  2DTU A;  3ISN C;  3RR8 A;  4M3W A;  5C25 A;  1CXU A;  4CK2 A;  2G8K A;  1W0H A;  1XHZ A;  2VWJ A;  4B9V A;  2O4I A;  3I8D A;  3FFI A;  1C0U A;  4FCY A;  2QXF A;  3VQ4 A;  1TAQ A;  3QEX A;  4Z4H A;  4HVJ A;  4J2D A;  2Q3S A;  3NH1 A;  3OS2 A;  1TK5 A;  1SUQ A;  4FJM A;  1QSY A;  3HPH A;  4CJ5 A;  3VQE A;  2P5O A;  1RTI A;  4KHQ A;  4CJQ A;  4IBN A;  1L5U A;  1ZBI A;  4KKO A;  1LW0 A;  1UA0 A;  1Q8I A;  2HND A;  2IC3 A;  3B6O A;  3DRP A;  3P1G A;  3TWH A;  3C6T A;  4E19 A;  4FLY A;  2O4G A;  3NFA A;  2X74 A;  4AHC A;  3TAQ A;  3C94 A;  1WSE A;  1YT3 A;  2G8F A;  2B4J A;  3RR7 A;  4BDP A;  2Y1J A;  3NGY A;  4CHY A;  1EX4 A;  1HYV A;  3LDS A;  3K5O A;  1RDC A;  3NF8 A;  4LY7 A;  4AHS A;  4GMJ B;  4H4O A;  1ASW A;  2P5G A;  1GOA A;  4CJK A;  3OYM A;  3HXM A;  3SUQ A;  1ZBH A;  2G8V A;  3THV A;  1KFD A;  1RT4 A;  3NF7 A;  4QAG A;  3HM9 A;  4E0D A;  2ZQB A;  3DRR A;  3LWL A;  4FLW A;  1NKB A;  4KFB A;  4KRE A;  3OYJ A;  4B9N A;  3AVG A;  2KZZ A;  3H08 A;  1RTH A;  1WN7 A;  1C1A A;  4EZ9 A;  1S1T A;  3SUO A;  3VA3 A;  2Z1I A;  3VQ5 A;  4RW8 A;  2ETJ A;  1VSJ A;  5SZT A;  1C1C A;  3LWM A;  3RMD A;  2HHS A;  3RRH A;  1S1V A;  3VQ6 A;  4Z4C A;  4CHQ A;  3VQC A;  4AHU A;  2GUI A;  3VQP A;  5J2Q A;  4ELU A;  4PA1 A;  4FLT A;  2IDO A;  3KLE A;  2PZS A;  4L8R B;  2BDP A;  2OPR A;  1X9M A;  2HNY A;  4E7H A;  1CLQ A;  3ZT3 A;  4CJV A;  1LV5 A;  1G15 A;  1LWC A;  1S9G A;  3OYK A;  4QOZ B;  3TAE A;  2DFF A;  5FDL A;  4DF8 A;  3AVL A;  3LP3 A;  1NKE A;  3U3Y A;  2HHT A;  1L3U A;  1LWF A;  3MXJ A;  1RT2 A;  3V1Q A;  4E7K A;  1VSI A;  3CQ8 A;  3QIP A;  4DFJ A;  4F2R A;  4CHZ A;  3L3U A;  1TK0 A;  3V1R A;  4KI6 A;  4KHS A;  3LP0 A;  4M3U A;  3K57 A;  3MEE A;  2FBV A;  3CFR A;  3DLH A;  1UAX A;  4K8X A;  1RDD A;  3KLH A;  2OYQ A;  2AJQ A;  4AHT A;  1X1P A;  1NJZ A;  1CXQ A;  3DLK A;  1WAF A;  4R5P A;  2YNH A;  4DMN A;  3MXI A;  4FW1 A;  4Z4G A;  1S6P A;  4HTU A;  3AA3 A;  1REV A;  5DMR A;  4LH4 A;  1GOC A;  4B9U A;  1NJX A;  3ZT0 A;  4DLE A;  1SKW A;  2X6S A;  2X78 A;  3HYF A;  2KFZ A;  2RN2 A;  4FM1 A;  3KKS A;  1ITG A;  3F9K A;  3SQ2 A;  1JLA A;  3ZSX A;  4CGH A;  4GVM A;  2OZM A;  4F3T A;  4CEB A;  4DF4 A;  3LPT A;  4ID5 A;  3L2R A;  3PX6 A;  5KI6 A;  4C8K A;  4DFK A;  1TVR A;  2P51 A;  3ZT1 A;  4DTX A;  5HRO A;  4OLA A;  1JKH A;  3LP2 A;  5J2N A;  4NCG A;  1RT3 A;  3SPY A;  3AO2 A;  4W5O A;  4CIG A;  4M3R A;  1RT7 A;  3K5L A;  1NK4 A;  1BGX T;  4IFV A;  3M8R A;  2IGI A;  1B92 A;  2F8T A;  4F3O A;  4CFC A;  2QKB A;  1XWL A;  4FZY A;  3AO1 A;  3U6F A;  1KSP A;  2WOM A;  4IFY A;  2ZE2 A;  3U3G A;  1KVA A;  3SQ0 A;  4CJF A;  4HHT A;  2KFN A;  3KLF A;  2HHX A;  4CHP A;  3OJU A;  3K58 A;  1VSL A;  5FRM A;  4GW6 A;  1CZ9 A;  4E7J A;  4KB0 A;  4FJ7 A;  3NCI A;  1Q9Y A;  4M3Z A;  4OLB A;  4B3O A;  1SL1 A;  3KD1 E;  1ASU A;  2HVH A;  1JL1 A;  4JS5 A;  3CYM A;  3M8P A;  1A5W A;  1T03 A;  1HYS A;  2YHB A;  4DQS A;  5CYM A;  4CHO A;  1NKC A;  3RRG A;  1XC9 A;  4LD0 A;  3AA5 X;  4AHV A;  1QE1 A;  4DLG A;  1L3V A;  4PUO A;  1QSL A;  2OZS A;  1KVC A;  5T7B A;  1MU2 A;  4W5Q A;  3TAF A;  1RCH A;  3QO9 A;  4JS4 A;  1BIS A;  4B08 A;  3K59 A;  1WSI A;  4I2Q A;  1FKO A;  1BHL A;  1RT6 A;  1NK6 A;  3PO5 A;  1Z26 A;  4PQU A;  3ITH A;  1IKW A;  4AHR A;  3LZJ A;  4DG1 A;  2A1S A;  1T7P A;  3QEI A;  1HJR A;  4MQ3 A;  1JLE A;  5K14 A;  3K5N A;  4Q0B A;  3QEV A;  1U45 A;  2QKK A;  4FJL A;  4CF0 A;  1NOY A;  2OA8 A;  4C8O A;  1JLC A;  1ZBL A;  4DFM A;  1HQE A;  1LAW A;  1KRP A;  1S5J A;  4FZX C;  4BWM A;  2GBZ A;  2XO7 A;  4CCH A;  5I42 A;  4FLU A;  4CF9 A;  1HMV A;  3DM2 A;  4TSX A;  4M3Y A;  3KIO A;  4CIF A;  2HW3 A;  4CES A;  2P1J A;  3DLG A;  3E01 A;  3SQ1 A;  2RKI A;  4FXD A;  5KRT A;  3VQA A;  3MED A;  1QQC A;  3AVF A;  2X6N A;  2E6M A;  5CY4 A;  4BWJ A;  4DTP A;  3NDK A;  4O55 A;  4N41 A;  3RTV A;  4KTW A;  4E1N A;  3SCX A;  5HLF A;  2HHV A;  3TI0 A;  3DOK A;  4NCB A;  1YTU A;  3TAP A;  3D0P A;  4OPK A;  2YKM A;  4I7F A;  4B9M A;  1RBR A;  4LSN A;  2VG5 A;  1S1X A;  3V1O A;  3QEW A;  2FBX A;  3PX0 A;  1XI1 A;  1ZYQ A;  1JXE A;  1LW2 A;  4FZZ A;  4CEQ A;  1VRT A;  3LAM A;  1RIL A;  3AVN A;  4NYN A;  2ATQ A;  2W42 A;  2HHU A;  3SV4 A;  1TGO A;  4KRF A;  3LZI A;  4RG8 A;  4FJG A;  4JRQ A;  3EYZ A;  1T8E A;  4K8Z A;  3CM6 A;  4RW7 A;  3SUP A;  4CFB A;  2XY5 A;  4DTR A;  5KTQ A;  4DQP A;  3L2V A;  1TAU A;  3OYA A;  2G8I A;  4W5N A;  3OYG A;  4F4K A;  1YTA A;  2KW4 A;  1TL3 A;  3PUF A;  1EKE A;  3O4Q A;  4LSL A;  4O44 A;  4DU4 A;  3QEP A;  4OKK A;  4EZ6 A;  2D5R A;  1KTQ A;  1BCO A;  2IAJ A;  3MXM A;  1KLN A;  3M8Q A;  3HST B;  2YKN A;  4CEZ A;  4Z4I A;  3PV8 A;  1HPZ A;  5I3U A;  1GOB A;  2QK9 A;  1O1W A;  1BQM A;  1SKR A;  1JXB A;  4FLX A;  4B8A B;  5HRS A;  3QES A;  3AVB A;  4FLZ A;  1XHX A;  1TV6 A;  3LPU A;  4KTQ A;  4IG3 A;  2GV9 A;  3QNO A;  3DOL A;  2OPP A;  3CG7 A;  2BE2 A;  4NYF A;  1S1W A;  3V81 A;  3S3O A;  4KHN A;  4O4G A;  2EX3 A;  3NGZ A;  4ELT A;  4CJP A;  4HCB A;  2FBY A;  4HUG A;  2F8S A;  3M8S A;  1RT1 A;  4OPJ A;  2YNF A;  4N76 A;  3KLG A;  1BQN A;  4M42 A;  4J2B A;  4Z4E A;  1J53 A;  3WNF A;  1C1B A;  3RMB A;  4CJE A;  5D3G A;  4CJ3 A;  4FJ9 A;  3KD5 E;  3JYT A;  3V9U A;  5FRN A;  3VN5 A;  2YHA A;  3A2F A;  2JLE A;  5JS2 A;  3L2U A;  3KK3 A;  5KGW A;  1HNV A;  1UOC A;  4CGI A;  4CFA A;  4PY5 A;  4E1M A;  4CF2 A;  3NF6 A;  1U04 A;  4JLH A;  3DMJ A;  3DRS A;  1IKV A;  4CEA A;  4E89 A;  3OYB A;  4HUE A;  1T05 A;  2KZM A;  1JL2 A;  4ID1 A;  3TAN A;  4DSJ A;  3AA2 A;  3HP9 A;  3D45 A;  1A5X A;  1U49 A;  1I39 A;  3MEC A;  3SPZ A;  3ZSY A;  1JLF A;  1X9W A;  1N6Q A;  4CJU A;  2Y1I A;  1WSF A;  3NH2 A;  3AVC A;  2ITG A;  4OJR A;  4DSL A;  4Q5V A;  3HP6 A;  3OYC A;  3K5M A;  3G0Z A;  3IS9 A;  1FXX A;  4WE1 A;  1BCM A;  1QHT A;  1TKD A;  1BL3 A;  1UWB A;  4H8K A;  4CER A;  5DK5 A;  3JSM A;  1WSJ A;  2HNZ A;  2LSN A;  4YFU A;  3AVI A;  4I9Q A;  3P5J A;  4IG0 A;  4O0J A;  4DS5 A;  1Q9X A;  4CEF A;  3NH0 A;  1NK9 A;  2XRI A;  3KJV A;  1IO2 A;  5J2P A;  3SQ4 A;  5FRO A;  2EHG A;  3S9H A;  4EP5 A;  3WNG A;  2A1R A;  3ZSW A;  2XY7 A;  1U4B A;  1RTD A;  4Y1C A;  5SWM A;  3RWU A;  2DFE A;  3B6P A;  1D8Y A;  3S3M A;  4BE2 A;  3AVH A;  5HRP A;  3NGI A;  4O5B A;  2HVI A;  1RBV A;  4KI4 A;  4DTO A;  4MFB A;  4CFD A;  5EU7 A;  2KQ2 A;  4LH5 A;  3V9X A;  2FBT A;  1IKX A;  1HNI A;  1KFS A;  3ALY A;  3OS0 A;  4FJX A;  2OPS A;  3CFP A;  4DTM A;  5HRR A;  4DSF A;  1DLO A;  5CZ1 A;  4CJT A;  3V9W A;  3S3N A;  4CGD A;  4YNQ A;  1S9E A;  3AV9 A;  3HPO A;  4DQR A;  3VQ9 A;  4QCL A;  3SV3 A;  3V6D A;  4C8L A;  3DYA A;  4RW4 A;  4PWD A;  4OKE A;  3NHG A;  3PX4 A;  3OS1 A;  1NJY A;  1TK8 A;  4FJJ A;  4DSI A;  1VSE A;  1LAV A;  2D0A A;  5HBM A;  5HP1 A;  1SV5 A;  4KO0 A;  1S6Q A;  3AVM A;  4CGG A;  1BI4 B;  1EET A;  2VG6 A;  4CJ4 A;  2Z1J A;  2OPQ A;  4FM2 A;  3C95 A;  2JGU A;  4DTN A;  2G8W A;  4FYD A;  3MEG A;  3P83 D;  2E4L A;  3AA4 A;  4CHN A;  3T3F A;  1R0A A;  4DSE A;  2HHQ A;  2G8U A;  3KTQ A;  1Y97 A;  4E3S A;  3OYI A;  4DTS A;  3OJS A;  2HMI A;  4E7I A;  2Z1G A;  4FLV A;  2DFH A;  1JLQ A;  1ZBU A;  3ASM A;  4DSK A;  2HHW A;  4M41 A;  4F2S A;  4CEE A;  2XHB A;  1NK5 A;  3TAR A;  2B6A A;  4ICL A;  1KCF A;  2YNI A;  1JLG A;  1RBU A;  1TKT A;  3EY1 A;  1CZB A;  1WAJ A;  4HUF A;  4OGC A;  3PO4 A;  2D0B A;  4B9L A;  1KLM A;  1VSF A;  1J54 A;  1IG9 A;  4N5S A;  1NJW A;  3LP1 A;  2WON A;  1DTT A;  1B9F A;  2D0C A;  3AVK A;  3KK2 A;  1A5V A;  2IOC A;  5CZ2 A;  4CJW A;  3ZT4 A;  1SL0 A;  3CM5 A;  3NBP A;  3ZSV A;  4CGJ A;  4BE1 A;  1FK9 A;  2PY5 A;  1VSK A;  4AH9 A;  3T1A A;  2RF2 A;  1JLB A;  2RPI A;  4CE9 A;  2YNG A;  3ZSO A;  4XIU A;  4FM0 A;  3OYF A;  1QSS A;  4FJN A;  1LWE A;  2XY8 A;  1VK0 A;  4FVM A;  3MAQ A;  3V9Z A;  3HVR A;  4KAZ A;  1BIU A;  3ZSR A;  4RW6 A;  1BIZ A;  2BGG A;  3T19 A;  4KTZ A;  3O4N A;  4OGE A;  4CF1 A;  4N56 A;  2R7Y A;  1VSM A;  4DS4 A;  4KPY A;  2FC0 A;  3AO3 A;  5C42 A;  3O3F A;  1UA1 A;  4HCC A;  4FJH A;  1U48 A;  2F96 A;  3HL8 A;  4CEC A;  3SYZ A;  4ELV A;  4BDZ A;  1BI4 A;  4FK4 A;  4DTU A;  2PYL A;  3SI6 A;  1NK0 A;  2B5J A;  3AVA A;  2NUB A;  4FK2 A;  4H4M A;  3HT3 A;  4CJL A;  5E41 A;  3NAE A;  1EXQ A;  3KK1 A;  3ULD A;  3HJF A;  3KLI A;  4Y1D A;  3L8B A;  2G8H A;  1WLJ A;  3I0S A;  3L2Q A;  1L3T A;  4M3T A;  4CF8 A;  1HQU A;  2PYJ A;  3OYL A;  4FW2 A;  1TL1 A;  3OYH A;  2HB5 A;  4I9L A;  4OVL A;  4BAC A;  3IAY A;  3RMC A;  3TAB A;  3DLR A;  3K2P A;  1D5A A;  4E7L A;  1S1U A;  1W9H A;  1RTJ A;  4F8R A;  4FJK A;  3V9S A;  2KTQ A;  3TAG A;  3WNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...