1S1VA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
539
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 145
structure length 533
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1vA05
3VQPA 1RDDA 1T7PA 1IKYA 1RTHA 3BSNA 4KHUA 4KTWA 2GIRA 3D28A 2HMIB 3HVTA 2W9BA 1S49A 2VG6B 2YNGB 1HQEB 4ECVA 2HHUA 2QKKA 4M3TA 3C6UB 4J2DA 3QLHB 3V9UA 2XY5A 1EXQA 3SZ2A 1S0MA 3MR2A 4YQWA 1IM4A 5K14A 1IKWA 1XHZA 4C8LA 4WE1B 3KMSA 4Y1DA 3QNOA 3QINA 4B9MA 3JSMB 2F8EX 2C2RA 4JUZA 1JLCA 5CYMA 2I1RA 3DMJB 3NF8A 1QSSA 4IDKB 4O55A 1RBUA 2C22A 4FK2A 3OYAA 2FBYA 4CFCA 5HRNA 4DTSA 5DLFA 2KFZA 1BQNB 2ASLA 4ECTA 4ZP7A 5KFPA 1L5UA 2P5OA 3CJ3A 3QZ8A 3K2PA 3SI6A 5J2QB 4B08A 2ATLA 5JUMA 4J9QA 3T5JA 1T05A 3WNEA 3SUPA 1A5WA 1TKZA 4PUOA 4MK7A 4CHZA 1S1TB 4IH6A 4NYNA 3V6DB 1OS5A 1S1UA 3GV8B 3D5MA 4IG3A 4C8NA 2VA2A 4NZ0A 4AHRA 5CYQB 4KREA 1BCMA 3GV5B 3SPYA 4ID1A 2DFEA 4I7FB 3NF9A 3BGRB 3H40A 4LSNA 4QW8A 4N76A 2B6AB 3S9HA 4DL3A 3UQSA 4J9LA 2FLPA 2IM1A 2FVSA 3NH2A 2YKNB 4O0JA 3LP0B 4IRCA 3QGGA 4KO0A 4CHYA 2JGUA 4URGA 1TKTB 1NK6A 1LWFB 4H4OB 3KD5E 4FJMA 4DLGA 4ZP6A 4WYWA 4F4WA 2AU0A 3N6LA 3DLGB 3CJ5A 3K57A 3OYHA 3HYFA 3OY9A 3BSAA 2LSNA 4FJ9A 4M3ZA 5SWMA 3KK1B 4CJQA 3QGHA 1BHLA 1HJRA 2EHGA 3OYMA 5HP1B 3TAEA 4CF1A 4KB1A 1IKVA 3KLHB 2B5JB 2W42A 1S6QA 4NCBA 3QIDA 4E1MA 4W5RA 4W5QA 4K4SA 5F9NA 2QKBA 3V1OA 3Q8SB 1C1BA 1RTIB 5CZ2A 3S3MA 4QWAA 4O44A 4H4MA 1HQUB 4RW4B 4ECUA 4IH7A 4JLHA 2IBKA 1D0EA 2HWIA 4KFBB 4RW6A 3HP9A 4CHPA 4ZP8A 2G8HA 3RB4A 1X9MA 5KG3A 5KG7A 1HPZB 2GUIA 1J5OB 3KLGB 2GV9A 4QCLA 3OL8A 3KK3A 3VQQA 2I5JB 1QE1B 4ECQA 4HVJA 2WOMA 1NK0A 3AO1A 1KVBA 3G86A 1JLAA 3HKWA 1S1WB 4Q0BA 2E4LA 4HCBA 4J2EA 2RKIB 3CO9A 5F8IA 4Q43A 3I5CA 4K50A 5C42B 4F50A 1IKXB 4RU9A 1HNIA 2BR0A 2GC8A 4O3QA 2ZE2A 4RNHA 2QE5A 4DL5A 4RNNA 1JLEA 3DLEB 4I2QB 1ZBIA 4CCHA 2ZD1A 4FJGA 3RB0A 3VQ4A 5EDWA 1TK8A 4KV8A 4ED8A 2O4GA 1R0AA 2PY5A 4O4RA 1ASVA 2D7SA 3IS9B 1HNVA 1TVRB 1KTQA 2IJNA 4CECA 3UIQA 4FK0A 2F8SA 4TY9A 1JIHA 3S3OA 3GIJA 3GIIA 3U6FA 1HARA 3GIKA 4F4KA 4DTRA 3LAKA 4QWEA 3TAMB 1I3AA 3DLRA 4AHVA 3OYIA 3L2RA 3LP1B 1DTTA 4CJPA 4DSEA 4TQSA 4C8MA 5KFEA 5HBMB 5HRPA 2WB4A 4F3OA 2KQ2A 4O3OA 4AILC 4Q44A 3SQ1A 1VSMA 3NH0A 3SQ2A 1EX4A 3L2WA 2R2SA 4OPKA 1L3TA 4QPXA 1EETA 4Z4FA 2UUWA 2RF2A 3PUFA 1C0MA 2FC0A 4ICLB 3V4IA 3CJ4A 3H4DA 3MXIA 1RDRA 2IGIA 3V81A 3IGVA 4B3OA 1NKBA 4NLXA 2P5GA 3DI6A 1UA0A 3G6YA 4HTUA 4IG0B 4ECZA 2HNZB 4ZTJA 1KLMB 4M45A 3WNGA 4I9LA 1LWCA 5HRSA 4B9SA 4LY7A 1S9FA 3BJYA 1T3NA 1C0TA 4RZRA 3V6KA 2W8LA 4ZPDA 1VSLA 3RMDA 3G10A 1RT1B 2NUBA 5HLFB 4ZPBA 3OS1A 3QO9B 3V6JA 3M8RA 4ECXA 4ZP9A 1VRUA 1X9WA 5KG2A 4B9NA 5KTQA 4DFKA 4CK1A 4CK3A 4CF0A 3AVHA 3ZT2A 1RTJB 4FJHA 2X6NA 5J2PB 3OLAA 4CGFA 4H54A 4YR2A 3FQKA 1VSEA 3ZCMA 2IC3A 2ITGA 4K4TA 1Q9XA 5DQGA 1KSPA 3AVJA 4NLTA 2OPRB 3FQLA 1GX6A 2YHAA 3RAXA 4R5PA 2KFNA 4PWDB 1LWEB 3VQ7A 3H5UA 1D5AA 3PW2A 3F9KA 4NRUA 3OJSA 3TQ1A 4ED7A 2ILYA 1RT3B 3PVXA 3KKRA 3NFAA 3OL6A 3GIMA 4CJEA 3ZSQA 3IG1B 3QGIA 3LPTA 1D9FA 3AVCA 3K59A 4DQRA 4KPYA 4EEYA 4ELTA 3V9WA 3NL0A 5KFCA 1KVAA 4PA1A 5KFHA 1WAJA 3K5OA 3KTQA 1WNSA 1QAJA 3NCIA 2DTUA 2XC9A 2R2RA 4WXOA 2F8TA 5C25B 1NK5A 1UWBB 4J9OA 2Z1HA 3CQ8A 2HNYB 1S9GA 4K4YA 5KRSA 3CWJA 3H5XA 5KFOA 2OPPA 3MR5A 2HB5A 2DFFA 5KGXA 1VRTA 1ASUA 3PX0A 4O3SA 1U49A 1KRPA 2W7PA 3KLEB 4J9KA 3PV8A 5I3UA 4FLZA 2AJQA 1N48A 1LW2B 3FFIA 4DQQA 3M8PA 3DYAB 3OYKA 4ZHRB 1FK9B 3NF6A 4M94A 1UA1A 4CIGA 4J9MA 2E6MA 1S4FA 1L3UA 5F8NA 3KHRA 5KFTA 1SL1A 4KKOA 1GOCA 1S9EA 4Y3CA 3DRSA 5KFLA 4LQ3A 4NLQA 1WSFA 1C0UB 1DTQA 4MFBB 3LPUA 4DFJA 2OPSA 1TL1A 4FLUA 4DFMA 3EZUA 4KSEB 2AQ4A 3OS0A 3JYTB 2HHQA 1QSLA 3BSOA 1HRHA 2D3UA 2JEJA 3AA4A 3HSTB 3G6XA 3H4BA 4FM2A 4E7JA 4NRTA 4E7IA 2R7YA 2C2EA 3MEEB 5D3GA 4CESA 4Q8EA 3LAMA 1TK0A 2CJQA 4DTOA 1ZBLA 2RN2A 3O4NA 4FJNA 4DL7A 1IKYB 1RTHB 1HYVA 4F8RA 3HVTB 2XO7A 2W9BB 1JLQA 2JC0A 4KHWA 3HVWA 2OH2A 4KAZA 4WZMA 2QV6A 1CLQA 4DTUA 3DOLA 2ASJA 3NH1A 4DSJA 2ZKUA 2HHVA 4YP3A 5K14B 1SUQA 3VN5A 2DPJA 3D45A 1JLCB 5CYMB 1S0NA 4ED2A 5KT6A 3DM2A 4FBUA 1C1CA 3SCXA 1TQLA 3KK2A 5L9XA 3HPHA 4OKEA 3KJVA 5KFIA 3T5HA 4HUGA 2YNIA 4O5BA 2YNFA 3K58A 1T05B 3BR9A 2BE2A 3O3FA 1TKZB 4PUOB 4E0DA 3QESA 1NJWA 4CF8A 1B92A 1S1UB 5KG5A 4IG3B 1K1SA 4CJ3A 3V9ZA 1NJZA 4CIFA 2AX0A 4EO6A 2YHBA 1U48A 4E7LA 4NCAA 1S10A 3M8QA 2ATQA 2IA6A 5L1IA 1RILA 3QYYA 1JXLA 4W5NA 4R0EA 2BANA 2R8IA 5KG0A 3MFHA 1FKPA 1S1VA 3CM5A 1HYSB 1LW0A 1NOYA 3KHLA 2WK4A 3CVKA 3LANA 4KO0B 5KFWA 2JEFA 4R8UA 2HW3A 4QWCA 1DLOA 1T8EA 2BQRA 4Q5VA 4FM1A 2HVHA 4TQRA 4EBCA 4M3YA 3B6OA 4NLSA 5KG1A 3L8BA 2WTFA 4E19A 4Z0UA 3V9XA 1ZYQA 5DGAA 4CJTA 4AHUA 1JLGA 3K5NA 2JEGA 4BDPA 3TAQA 3SUQA 2FVPA 5DGBA 2VWJA 5I42A 1RT4A 3NBPA 5C24A 4C8OA 5F8LA 1CXUA 3I0SA 5KFYA 1XHXA 2XCPA 1IKVB 4GW6A 1RTDB 4ZPAA 1T03A 1YTUA 3SQ0A 5T14A 3ULDA 4CEEA 4LSLA 1S6QB 3PY8A 5DG8A 4IFVA 3VQEA 1XR7A 3ZSZA 3FRZA 2FJXA 3L3UA 2FJWA 4KI4A 1C1BB 4IH5A 4ECRA 1HMVA 4O44B 4H4MB 2WCXA 5F8GA 1W9HA 3H5YA 5KT7A 2VWKA 3M9NB 4Z4GA 4BDZA 3DRPA 3V9SA 5KI6A 3SUNA 3RMCA 4O3RA 3AO4A 5KFFA 3N6MA 3DLKA 4M3XA 4CJRA 4JV2A 1ZBUA 2HWHA 4GC7A 4CGHA 2AGPA 3PO4A 3KK3B 3SQ4A 3RRHA 4MQ3A 2WOMB 1SH0A 3M8SA 2V9WA 4O4GB 1JLAB 4BDYA 4FLVA 2IM2A 2HNDA 5DG9A 4U6PA 3OSNA 3NDKA 4ZTFA 4IKAA 3U3GA 1N5YA 4QWDA 3MXMA 1X9SA 3MF5A 4MK8A 2HHSA 4ELUA 4CFDA 3AO3A 1TAUA 4Z4IA 4U7CA 2ZE2B 4ZPCA 5KT2A 3L2QA 3OYBA 3GILA 4CJFA 3MR6A 3PW0A 2G8WA 2HMIA 1JLEB 2ZD1B 1HQEA 3ZT1A 3M9OB 4KV8B 2AX1A 1Q9YA 1R0AB 4RG8A 3UPFA 1HNVB 4PY5A 1TV6A 4DL6A 2W7OA 4K4ZA 4XIUA 4FW2A 1CZ9A 1TL3A 3MAQA 2OYQA 3JSMA 3T3FA 4HHTA 3OJUA 2VA3A 3P1GA 2KW4A 2QK9A 1DTTB 2D3ZA 3AVAA 5EU7A 4KI6A 5KT5A 1C1AA 1D9DA 4RUCA 5HRRA 4MIAA 3P83D 4FLWA 1ITGA 4FM0A 4B9LA 1BQMB 4C8KA 3KLFA 4H8KA 2QXFA 4M3UA 3OYJA 3THVA 1FKOB 4ED1A 3HL8A 2Q3SA 3TR8A 1UOCA 4EZ9A 1EP4A 4JS4A 3N6NA 2RF2B 4F4ZA 4ELVA 4AHTA 1SV5B 4WYLA 4GVMA 5KFMA 3SFGA 4B3OB 4ID5A 3DI6B 1B9DA 4MKBA 2G8IA 4CJ4A 4CJVA 3ZT4A 1IH7A 3VQ8A 4KHSA 4I7FA 4JRQA 3SJJA 1SKWA 4F3TA 1JLBA 1LWCB 3BGRA 4CHOA 1RT5B 4WFYA 4CJWA 4Z4HA 4FCYA 4FYDA 2F96A 1WSHA 5KFNA 1C0TB 2ETJA 3B6PA 5F8HA 3QIOA 2Z1JA 3FSIA 3LP0A 1JXEA 2HVIA 1WAFA 3QERA 4FJ8A 3LP2A 3AVLA 3G0ZA 1TKTA 3T1AA 2B43A 5KT4A 3PW5A 4IRKA 1VRUB 1NJYA 4DU4A 4HUFA 2RDJA 4CFBA 1NJXA 1QQCA 1KCFA 5DMRA 4NLOA 4G1QA 4JRPA 3HHKA 4L8RB 3KLIA 1VSDA 3ZSYA 2IC3B 3RMBA 5FDLA 3NKYA 1NK8A 3PR4A 1RT2B 4LQ9A 1CXQA 2BQ3A 3AV9A 1S1XA 2X74A 1XC9A 2WRMA 3KLHA 3SV3A 1YTAA 5J2NA 1WSGA 2EX3A 3H5SA 4F2RA 4G3IA 4OGCA 2KZMA 3MECB 4PQUA 4M3WA 3HK2A 4KHYA 2R2UA 2FBVA 4RW4A 2HHTA 4J9SA 1BIZA 4CJKA 2G8KA 3ZSRA 3NGIA 4X2BA 4K8ZA 2XI3A 1QHTA 4DL2A 1RBSA 1TKDA 2WONA 4TXSA 2JLEA 4CF9A 1S9GB 1CSJA 1BGXT 3NHGA 4EO8A 4ED3A 4DFPA 2FVCA 1S97A 2OPPB 3QIPA 5J1EA 3K5MA 3LWLA 1VRTB 3PO5A 5C42A 4ZVEA 1S6PB 2RPIA 4RW9A 3TI0A 4ED0A 3FFIB 3HXMA 3M8PB 1BI4B 3LZJA 3CYMA 3IRXA 3OL9A 5DQHA 3HVRA 3CG7A 4EYHB 2GIQA 2FBXA 3AO5A 5F8JA 2IAJA 2V4RA 4KKOB 1S9EB 1EKEA 4DSFA 4LD0A 4F4YA 4CERA 5FRNA 4NYFA 1DTQB 4NCGA 2OPSB 1TL1B 1MMLA 4LH4A 1QTMA 3SV4A 1SL0A 3D0PA 5FRMA 1U04A 3ITHA 4CGIA 3RRGA 1TVRA 1UAXA 3SUOA 3I0RB 4CEZA 3CM6A 3PR5B 1K1QA 2YKMA 2W9CB 4DQPA 1ZETA 1RT6B 3TAMA 4FBTA 1U45A 5D3GB 2VG5A 1JKHA 4CGGA 3L2UA 3VQBA 3RTVA 5JS2A 2VG7A 1JL1A 1VSFA 3HPGA 4CFAA 4EYIB 3PX4A 3C6TA 4RW7A 4EP5A 1WSEA 3HJFA 1ZBFA 4Q8FA 1JLQB 1RT7A 4DG1A 4Z4CA 3I5BA 1RBTA 2DY4A 3LZIA 2PYLA 4ICLA 1T94A 4FS2A 2FLLA 4CJLA 3KNAA 1BCOA 1W25A 4GMJB 1SUQB 1YVUA 1S0OA 1MU2A 4I2PA 4IG0A 4NLYA 4CHNA 1JLFA 2HNZA 1QS4A 3DM2B 3CDEA 5KFGA 4IFYB 1RYRA 4YFUA 1QUVA 4IR1A 1VSHA 1WN7A 1TGOA 4N56A 3KJVB 3EZ5A 3VA0A 4M95A 2YNIB 4B8CA 4NLUA 4DQSA 1JL2A 2YNFB 3M9MB 4J9RA 2R2TA 3TWHA 4BE1A 3HP6A 4EBDA 4YR0A 5KGWA 4M41A 3Q8RB 1X1PA 2Y1IA 4J2AA 5KFDA 3DLHA 5EUHA 4FJ7A 4FS1A 2A1RA 4TN2A 2XGQA 4CGDA 4CE9A 3TARA 4TY8A 5HROA 2D5RA 1Z26A 3ZSOA 4ZMMA 2BANB 3PZPA 4EBEA 1FKPB 1S1VB 3RR7A 1LW0B 3I5AA 4WFZA 3PX6A 1C2PA 4ZVHA 3CDUA 3RBDA 2G8FA 1BL3A 2AGQA 4PWDA 4WXWA 2D0BA 3V6HA 3KIOA 3IGNA 4QWBA 4R8UB 1SH2A 3QNNA 2HAIA 3NE6A 1DLOB 5JS1A 1WLJA 4ECSA 3AVNA 3MEDA 1RT3A 3OYLA 4J9PA 1D8YA 4DSKA 4ECWA 4CEBA 1IKWB 1JLGB 4TLRA 3DRRA 3VQSA 1XI1A 4DEZA 3ZT0A 4MH8A 4NLGA 5L1LA 5SZTA 3EPGA 2J6SA 1CZBA 4DU1A 3LP3A 5I42B 4Y34A 1RT4B 3RR8A 5C24B 2D41A 3AVMA 3DLBA 5KFZA 3OLBA 4AHCA 3I0SB 3CFOA 2CKWA 1N6QA 5F8MA 1Y97A 1T03B 5EWGA 4CJUA 3MR3A 4LSLB 2FJVA 4FJKA 4DTPA 4IFVB 2BRLA 5J2MA 4DF4A 5KFRA 4CIEA 4CHQA 1J54A 3ALYA 3QEIA 1FK9A 3ZSXA 4N41A 3DOKA 2JC1A 3SNNA 1TKXA 3AVKA 4FJLA 3OYCA 3DRPB 4Y2CA 1NK7A 4BE2A 3BSCA 3ZSWA 2C28A 1KFDA 1RYSA 1C0UA 2O4IA 3LDSA 3E01A 3AVFA 5CY4A 4LSNB 4KE5A 3KHHA 4BWJA 4CJ5A 3Q8PB 3WNFA 5KFSA 2HNDB 3T5LA 4HUEA 4NLDA 4FZXC 4UQGA 3SI8A 5JXSA 3MEEA 4FW1A 1N5YB 4URSA 1TP7A 3VQCA 1QAIA 3VQ5A 2IM0A 4E7KA 4ECYA 1LAWA 5KRTA 2XRIA 3TABA 3OS2A 2R8JA 2XGPA 3NGZA 3MEGA 3BREA 4AHSA 4HYKA 2FVQA 4DQIA 5KFKA 2AGOA 1VSKA 4O3PA 3ISNC 1VK0A 2Y1JA 4FLYA 4M3RA 1TV6B 2E9TA 4DTMA 2PZSA 3V1RA 1TL3B 4NLVA 3KOAA 4IBNA 4KB0A 1NNDA 1N4LA 1RNHA 1GOAA 4NLRA 3CJ0A 3OSPA 4FZYA 4JS5A 1REVA 3GQCA 1NHVA 4Y1CA 2V4QA 1J9AA 3ASMA 3OL7A 3GV7B 4RW6B 3SFUA 2IS3A 3KLFB 5DLGA 3OYGA 1VSIA 1ASWA 5L1KA 2W9AA 1EP4B 2XCAA 4CEQA 4EZ6A 3FDSA 4Q0BB 1L3SA 4ID5B 3PJWA 4K8XA 3C94A 1RAJA 4RW8A 3G6VA 4KHRA 1U4BA 1JLBB 4QAGA 3NGYA 4DL4A 3QEVA 1HNIB 2OPQA 4DS5A 2ALZA 2YNHA 1HYSA 5KFAA 4ED6A 3PHEA 1G15A 4Z4EA 2Z1GA 3LP2B 2VG6A 3EPIA 5DQIA 2YNGA 4DS4A 3C6UA 3QLHA 2E9ZA 1YT3A 3NAEA 4CJSA 4WZQA 2RDIA 4G1QB 3CJ2A 4WE1A 4KAIA 3O3GA 3KLIB 3KMQA 4KHMA 1K6YA 3CDWA 4FK4A 5FDLB 3DMJA 2E6LA 1NK4A 2OZMA 4IDKA 5F9LA 2Z1IA 1BQNA 3KD1E 3T5KA 3CFPA 3RWUA 3L3VA 1RTDA 2IM3A 4RNOA 1S1XB 1D1UA 4HKQA 3MXJA 5J2QA 3SYZA 5J2NB 2B4JA 1L3VA 1RCHA 4B9UA 1S1TA 4PQUB 3V6DA 4E7HA 3OHAA 1EETB 4GC6A 5FROA 3TAGA 3AA5X 3RMAA 3V4IB 3NAIA 3KHGA 1S48A 4BE0A 3O3HA 4IOBA 2X6SA 3V81B 1F21A 4DLEA 3OVNA 5CYQA 3IN5A 4B8AB 1YVFA 3LWMA 4YR3A 4KHQA 4TSXA 2R8GA 4DMNA 4O3NA 3OYEA 3V1QA 1RDCA 1KFSA 2WONB 4FLXA 2WHOA 3HPOA 2B6AA 1RBRA 4O4GA 4K4XA 4LH5A 3IAYA 4YMEA 3QIPB 2YKNA 5J1EB 4QOZB 1SL2A 2EC0A 3NGDA 1LWFA 4H4OA 4E3SA 4RW9B 4CEAA 2P51A 3TAFA 3T19A 1WSIA 3DLGA 3IRXB 4OL8A 3SPZA 4DF8A 3PW7A 2IJFA 2XI2A 1U09A 1QSYA 2FLNA 4WFXA 1RA6A 2IAJB 1NKCA 3KK1A 3H59A 1KHWA 4ZVGA 5HP1A 1NKEA 4NCGB 3CFRA 3QEWA 5EWFA 3ITHB 2FVRA 1GX5A 5E41A 3TVKA 3AVIA 4MKAA 2B5JA 4YNQA 2YKMB 4R5PB 4OPJA 3GYNA 1IO2A 3KLVA 3MFIA 3AVBA 4F2SA 3H2LA 1RTIA 3RAQA 1O1WA 4OVLA 2VG5B 2C2DA 1N56A 1HQUA 2G8VA 1JKHB 2VG7B 2JEIA 1BQMA 4KFBA 3C6TB 4RW7B 2PYJA 3AO2A 4BWMA 1LV5A 1VSJA 1FKOA 1RT7B 4DG1B 5KG4A 1HPZA 1J5OA 3KLGA 2I5JA 1QE1A 4QW9A 1SV5A 3F73A 4FLTA 1S1WA 2KTQA 2ZQBA 1A5XA 3UDLA 2OA8A 2R8KA 2ASDA 2UVRA 4RUAA 2RKIA 4XPEA 2D0CA 1MU2B 4I2PB 3AVGA 1JLFB 4K4VA 3RBEA 2ILZA 1IKXA 4XPCA 1U47A 5I3UB 3VQDA 4B9TA 4JV0A 1RT5A 2GBZA 5KT3A 3H08A 4KHNA 2BRKA 2XY6A 1JX4A 4TYAA 2D0AA 4DSLA 4N47A 4IKFA 4I2QA 3DLEA 1RDBA 1WNEA 4OGEA 4DTNA 3PW4A 3BDPA 3Q8QB 3DRSB 2P1JA 2YV0X 2HHXA 4N5SA 4TYBA 4RNMA 3VQ6A 4I9QA 3IS9A 4BACA 4CF2A 4NLPA 1KVCA 3AA3A 2XHBA 4TY8B 5HROB 1Z25A 3RB3A 3LP1A 4E1NA 2UVWA 1HYZA 4FXDA 1KHVA 3C95A 1RT2A 4OLAA 3K5LA 5HBMA 4FJ5A 1S5JA 3VA3A 2IMWP 2KZZA 2HHWA 3OYNA 3ZT3A 1ZTTA 3UR0A 3TAPA 4DTJA 4FJXA 4E89A 3MECA 4OLBA 4FVMA 3ICLA 3VQ9A 3WNHA 2A1SA 4AH9A 3MEDB 3DOLB 2W8KA 2J6TA 1WSJA 5KFXA 3HM9A 1XR5A 5KFUA 4FJJA 3DRRB 2V0NA 4IR9A 4K4UA 5KFQA 1KLMA 4ZVFA 1A5VA 4CK2A 1NOZA 4F4XA 3CIZA 4NLWA 3HO1A 3BQ2A 5T7BA 4CEDA 1C1CB 3I8DA 3KK2B 4HCCA 3BQ0A 3ISND 1N6QB 5C5JA 3E51A 1NHUA 2IDOA 4Q45A 4K4WA 2XY8A 1RT1A 2G8UA 1IG9A 5HLFA 3VQAA 2O5DA 3QO9A 1S6PA 4DU3A 2BE2B 3P5JA 4M42A 5KG6A 3QETA 1XR6A 1FXXA 5KFBA 3AA2A 5J2MB 1C6VA 1ZBHA 4B9VA 3ZSVA 1BI4A 2X78A 1RTJA 3O4QA 1Z4UA 5J2PA 3DOKB 2IOCA 2XWYA 1TKXB 3EY1A 4KB7A 4J2BA 3LALA 3M8QB 4J9NA 2UUTA 4W5OA 3E01B 3H98A 4EP4A 1TAQA 1I6JA 4OJRA 3DDKA 1I39A 1TK5A 3I0RA 2OPRA 5EWEA 1SKRA 1B9FA 2AWZA 3BQ1A 1RA7A 1LWEA 2W9CA 4IRDA 1RT6A 4DSIA 3QZ7A 3NMAA 3HT3A 3HVAA 3NF7A 3IG1A 2J6UA 2DPIA 5KFVA 5CZ1A 3S3NA 4NYZA 2BGGA 1JXBA 4Y2AA 3MEGB 2DFHA 2BQUA 1RDAA 5C25A 1UWBA 4KTZA 3NBPB 2OZSA 2HNYA 4URQU 2UVUA 4DWIA 3RB6A 2BDPA 2UVVA 1BISA 3KKSA 3EYZA 3KLEA 3PJXA 1LW2A 4IFYA 3NAHA 3U3YA 4JV1A 4O0IA 3OYFA 3L2VA 1REVB 4KTQA 3OYDA 2R8HA 3DYAA 5DG7A 1HMVB 1BIUA 4OKKA 4ZHRA 4DTXA 2FBTA 4W5TA 1Q8IA 1NK9A 1ZTWA 4KRFA 3QEXA 1SKSA 4FJIA 3DLKB 4RNFA 5L1JA 4CGJA 1KLNA 4KBIA 4MK9A 4MFBA 5DK5A 3QEPA 3TANA 1SH3A 4XO0A 1W0HA 3JYTA 3MTKA 4FZZA 4IQXA 2E9RX 4OKJA 4MIBA 4CEFA 1LAVA 4CEOA 4RW8B 3OHBA 1J53A 1RBVA 3A2FA 1XWLA 5KFJA 2OPQB 1GOBA 2YNHB 2XY7A
chains in the Genus database with same CATH superfamily
1HI8A 1ZC6A 2OMLA 3SK3A 2W2NP 2GIRA 3MPWA 3ZTRA 1XNQF 1S49A 2VG6B 2Z30B 1S12A 2CPYA 3MXHP 1KTVA 4M3TA 1TL7A 1K9MO 1VIXA 3KDNA 1EXQA 1HL6A 1WC0A 4UUWA 4DJBA 3B6BA 1XHZA 4C8LA 4Y1DA 4YHHF 4BRDA 2C2RA 2YWWA 1P1TA 3MAHA 3MMBB 4UY8T 3NF8A 4IDKB 3WDOA 2Q97A 3CCJN 5HRNA 5DLFA 2KFYA 2WSFC 1BQNB 2VC0A 5KFPA 3MZIA 4WIIA 3CJ3A 3K2PA 4YB6A 1GQEA 1R6VA 2DGSA 1T05A 1FRXA 1RCXB 3SUPA 3CO0P 1TKZA 1A5WA 2DNHA 5B0DA 4QIVA 1H6KX 4IH6A 2XHCA 2P9NB 4C1NI 3GG4A 2GX9A 4NZ6A 4IQMA 3D0GE 4ANCA 5CYQB 1BUPA 3KUGA 3GV5B 3SPYA 2R7VA 2QWLA 2DFEA 2ASPA 2MHNA 2P9SB 3H40A 3NGSA 4N76A 2UXDF 4DL3A 3P5BP 4DUYJ 1IXKA 2NZ4A 4FWNA 2YKNB 5F3TA 4KO0A 4CHYA 1X8DA 1NK6A 3GBTA 3KD5E 1YRTA 2DRBA 3CCLN 4F4WA 3N6LA 1FRIA 3CJ5A 1M5HA 4A8QA 2F40A 1FDAA 4EI2A 2BA9A 4KR0B 5F0XA 4NL5A 2LSNA 4M3ZA 3M30B 3GSDA 4CJQA 1K8AO 1HJRA 3OYMA 2F4VK 3CCVS 1PAEX 1Q95G 5B8HA 4CO3A 4B3MJ 1K47A 1Q8KA 3DJCA 2QKBA 5GMKa 1NNEA 1C1BA 1RTIB 3S3MA 5IWAJ 4ZDNA 1HQUB 4RW4B 1PJ6A 2FDNA 1D0EA 4KFBB 2J7WA 2XLKA 4CHPA 4DCPB 3KG1A 2G8HA 3AQPA 3D0IE 3FC9A 5HVHA 3C15B 3O2IA 2GUIA 3KLGB 4ECQA 1ZPVA 3R9LA 1DRZA 4JBCA 3HKWA 3ZZYA 2HVDA 3ZLJA 4FF2A 1E6VB 4J2EA 3DXKB 1F9HA 2RKIB 5C42B 1T9VA 2LDIA 4JI4F 3CB4A 3GPAA 4OFZA 4RNHA 4DL5A 1DJ0A 3W1YC 1GEHA 3D68A 2ZD1A 3RB0A 5EDWA 4GKKJ 4AUKA 4ED8A 3MM6B 2PY5A 4O4RA 3GL1A 3AJ2A 1VDHA 3J7ZO 2IJNA 4QR0A 4TY9A 3MM8A 1HQ2A 3GIJA 3GIIA 4F4KA 3LAKA 4AHVA 1FKAF 3OYIA 3LP1B 4C9DA 4WIQA 5KOWA 4CD3A 1U6BA 5KFEA 1VC6A 3S7RA 4RU2A 5D8HB 3C7NA 2R7XA 2YWKA 5GINA 3M2VB 3KJQB 5H9FJ 2R4FA 3RGIA 3GFXA 4OPKA 4DUYK 1L3TA 4Z4FA 2UUWA 2E1PA 4DR3J 3MXIA 1P90A 3CJ4A 2H51B 1FWPA 3V81A 1V5VA 2B56A 3K8WA 1DQAA 4YS2A 5JMNA 2HNZB 1KLMB 3CIPA 3WNGA 3U1MA 4I9LA 5HRSA 2PAVA 1UEVA 4FZVA 2HPUA 1T3NA 2B7BB 2ZM6J 4HT7A 4FOEA 4RZRA 2FC8A 5AQJA 2W8LA 5DETA 1XTZA 3RMDA 2L9DA 3QRQA 2WB1D 2NUBA 3OS1A 4YDDB 2QWQA 9RUBA 5KTQA 1VQ9S 3W2VB 3SCIE 1ELOA 2WW4A 1HNWJ 3QT8A 2R7SA 3AVHA 4FJHA 1RTJB 4B3MK 2X6NA 3AJ1A 2H3EB 4RO0A 1M0SA 3T7ZA 4DXLA 4YR2A 3FQKA 2B9WA 3B82A 3ZCMA 4DR7J 5IWAK 5AQQA 1G99A 3QB0A 3BBBA 1Q9XA 5DQGA 3R8YA 1YJUA 2LEAA 4HDGA 2OPRB 3FQLA 5IT9Y 4R5PA 4WQ4A 3G96A 4BS2A 4ANDA 3RW7A 3PW2A 4CBUA 3FBFA 3DNCA 2OO4A 1RT3B 5CZVA 3NFAA 2R7WA 3IG1B 3CJAA 3QGIA 3GOIA 2YWHA 3SQGA 1D9FA 4I1TA 2AT1B 4HHHA 4WJBA 4XEIA 1RWWB 4PXCA 5KFHA 3K5OA 1QAJA 4QIEA 2XC9A 2F8TA 5C25B 5JMVA 4V19S 1UWBB 3P3DA 3D6TB 1K44A 3J81Y 2Z1HA 2HNYB 3QAUA 4K4YA 4Z37A 3CWJA 5CZXA 4B3SF 3HZGA 4Z94A 4GKKK 1K9MT 1UPMB 3ZXWA 2W7PA 1SZ2A 2CPIA 4K42A 1KNZA 1X5OA 2LECA 3IM8A 3VPZA 4DQQA 2E2PA 4B3RJ 4CIGA 4A8YA 1S4FA 1XNRJ 5K8OA 3MPUB 5F8NA 2RHSB 5KFTA 5A0YA 3M2RB 1VMBA 4CO5A 1PJ5A 3C6HA 3IA0A 5LL6d 1QZ5A 3NXZA 4WTYA 5H9FK 4CLSA 2YKOA 4UF4A 2AYBA 3AA4A 3G6XA 3H4BA 5T7LA 4DR3K 2GGPB 5D3GA 3CD5A 4Q8EA 2IRXA 1V3SA 3PJ9A 3WQUA 3VCDA 1X9JA 4IOCL 1VK3A 5LY3A 2CJQA 2GJ2A 2EWHA 4MYUA 1VC5A 1NGCA 1HD1A 1ZBLA 2HRUA 2RN2A 1E4GT 1K8KA 2EG1A 3OTEA 4F8RA 1HYVA 5EY4A 5AJ3J 2DR6A 1HHQA 3QDKA 3ZEUA 2JC0A 1P9QC 4PG4A 3RJMB 2ZM6K 1UVNA 2QV6A 1TL7B 3GYGA 2OEJA 2E5LJ 3DOLA 2ASJA 1FFSB 3PSIA 5HSPA 4FYWB 3PFEA 2E44A 3VN5A 4OHYA 4DUZJ 1HNWK 1S0NA 1YI2N 2MMYA 1TR0A 3HHNB 3SCXA 1FWKA 3ZZPA 2F4VF 4UOHA 2HF4A 3KJVA 2FD2A 4BROA 1HWLA 5E5NA 2DNGA 3FRYA 2YY3A 3NGRA 2YNIA 1QQMA 4JK8A 2A3JA 1K8AT 3K58A 2VH7A 2MHEA 2WW8A 1OPZA 1T05B 2DR7A 1TKZB 5C2CA 1RAIB 1W2BM 5KG5A 2YX4A 3V9ZA 2K06A 2AX0A 5HL7Q 1NDLA 2YHBA 1U48A 5J1PA 3M8QA 4I69A 4RWWA 2ATQA 1KEKA 1JXLA 2CQGA 1N5TA 2FZGB 4R0EA 4X4OA 3K89A 1TMJA 5KG0A 2EBEA 3LO3A 4LFAJ 2D3OR 3KHLA 2WK4A 3LANA 5IV3A 4KO0B 2QL7B 5KFWA 5A76A 2BQRA 2HVHA 4NLSA 4IO8A 5KG1A 1AZSA 2QWPA 2YI1A 1ZYQA 4DV6J 5DGAA 3OTBA 3RRKA 4AHUA 3T1YJ 4BDPA 1ZOTA 2K2PA 4H4KC 2DNKA 4B3RK 5DGBA 2QXLA 5I42A 3NBPA 4BC2A 1CXUA 1XNRK 3I0SA 5KFYA 4J7CA 2XCPA 3N5FA 2Z56B 1YLXA 2ADCA 1YTUA 2VZ9A 2CG8A 3NY0A 1UVKA 1XR7A 3TUZC 3KKFA 3CERA 3J7ZT 1FTCA 1C1BB 2YH1A 3UKUA 1W9HA 1Q7LB 4Z4GA 1X3NA 6AT1B 1OVQA 3DRPA 4FYYB 3QSIA 4ZCKA 4FSVA 3AO4A 1W7AA 1U2RA 2ZH2A 3C0BA 4JV2A 2MZ1A 4DUYF 3POTA 2AGPA 2GMLA 2ZZMA 5LJ3Y 1SH0A 5AJ3K 2V9WA 4O4GB 1Y0HA 1CBKA 2HNDA 4BR9A 3EGVA 1NPRA 5HN0A 3KWMA 2E5LK 3CHWA 4DX8H 3MXMA 5DRKA 4P75A 3OVAA 3MF5A 4MMOA 3A4TA 4USKA 3TTFA 4CFDA 5KT2A 4ZPCA 1SJ4P 3L2QA 3GILA 3PW0A 4RBUA 1K0TA 3CMAN 2ZD1B 2ZNZA 4LF4J 4P2MA 1VC0A 4YOWA 4HI2A 1QLNA 4B3MF 1CZ9A 3MM8B 1FNOA 2ZJRL 2J9CA 1OQ3A 3ENBA 3ENVA 1FX2A 1U2VA 2ZH7A 4PYDA 2D3ZA 4KI6A 5L9NA 5A8RB 1S0VA 4HH0A 3WC2A 5HRRA 4MIAA 3M1FA 2DB1A 3C7NB 2JRSA 3D7SB 3M2UA 5DS7A 4FM0A 4B9LA 2BW7A 3EGNA 4H8KA 1HW9A 3VAJA 1QVGM 3MR7A 2DGTA 4A61A 3EGZA 4LFAK 3R5GA 3I55S 3HFVA 4ELVA 1CS4B 4WQ4C 1MW7A 1SV5B 3AY0A 3SFGA 1GLBG 3VEZA 2W41A 1MA9B 4CJ4A 4CJVA 4CI6A 4JRQA 3SJJA 1WOQA 4DV6K 4CHOA 1RT5B 2L9NA 3T1YK 3NS5A 5ITHA 2F96A 4JI6J 4G65A 2M0GB 2J0SD 2ETJA 5F8HA 4I56A 1NU4A 2Z1JA 3FSIA 2QYCA 1JXEA 2P9GA 3WUHA 4J8FA 4FJ8A 4GKKF 3AVLA 3PW5A 5BR8J 1FXDA 3TO8A 3BEXA 4DPTA 2K8GA 1QJHA 2E7XA 2GO9A 4NLOA 2ZOMA 4XK8C 3U8XA 1JJCB 2LU2A 3PYEA 1X5TA 4MDBA 5AQRA 5FDLA 2ZH4A 4FPIA 1CXQA 1Q7YO 4ISEA 3AV9A 3W66A 3P39A 2AP6A 7FD1A 4CZCA 2KXHA 5C2FA 3THTA 5J2NA 1WSGA 2J4RA 3H5SA 3DDNA 4F2RA 4G3IA 2O8FA 2YHYA 4PQUA 2Y1RI 1VLOA 2ACMA 2HIYA 4RJVA 4ZK7M 5ETRA 2F65A 4J9SA 1X60A 3ZSRA 3DWLA 3K5PA 4K8ZA 3D2FB 4OPHA 2XI3A 1VLYA 4DL2A 2ZM6F 4GVBA 4TXSA 4V19X 2ZC4A 5E33A 1VQ6N 4DFPA 2JVRA 4LF4K 3VTIA 1ZA1B 4ZVEA 1HNWF 2JWNA 4N8OA 3HXMA 1ACMB 3ZZZA 4YDXA 1XIQA 1ZH5A 3CG7A 2CGLA 2FBXA 2OAUA 5F8JA 3IR6B 2RUGA 3HKZD 5A0YB 2NRWA 5ETTA 2G1DA 4FPRA 3KWIA 1IN0A 1MMLA 1JCGA 3SV4A 5FRMA 3RRGA 1FRJA 3I0RB 4CEZA 3CM6A 2V7ZA 2PC6A 1RKIA 4DQPA 1LEOA 2FLOA 5T7LB 3TAMA 3LOUA 3CCSN 5D3GB 3AA9A 4FWOA 2BX6A 3QATA 1NM1A 1OSDA 3HBTA 4Y0FA 4FXVA 3L2UA 1S3XA 5JS2A 1K8KB 4UZCA 4EYIB 3PX4A 3HHDA 4ES2A 2LXUA 3HJFA 3LPYA 3ZEUB 4Q8FA 4DU8A 4DG1A 4FKYA 3I5BA 4JI6K 1RBTA 1UW4A 2PYLA 3O9TA 2I8EA 4DHYA 4BCAA 2YJFA 1W2BR 5ADXH 1BCOA 4ZPVR 5BR8K 3VGMA 5AQGA 2CZVC 4CLLA 1S0OA 1MU2A 4I2PA 4ZITA 1FRLA 3JTNA 4IR1A 3KJVB 3KYLA 2ROPA 4ERDA 2YNIB 2BJEA 1HBNA 2L08A 1NBWA 4ZN1A 4X64J 3M9MB 1YBUA 2KKHA 1R8BA 2FPHX 2Y1IA 2JJ4D 3NVMA 3LA0A 1NPKA 5JVHQ 2A1RA 2YCHA 3TARA 1RISA 4IEIA 5GMEA 1YTYA 3ZSOA 4NA2A 4LIWA 4IJNA 3HTVA 2CJKA 2B9XA 3RR7A 3PX6A 2G0IA 1C2PA 3CDUA 1G1XA 1X4EA 4FF3A 4K2XA 3NGKA 2CJBA 2AGQA 4PWDA 5K5MA 5BPNA 3MDQA 4QWBA 5B0BA 3NE6A 2E5LF 1WLJA 2H4YB 4OX9J 1NDPA 3ZX3A 3M7VA 3WXLA 2K7JA 4DSKA 4MO5A 3DRRA 2OTLS 3Q89A 2IJRA 4DEZA 2XLJA 1RKJA 3EPGA 2CWKA 2PMHA 4X84A 3W64A 5I42B 2D41A 3I0SB 4CBXA 1Y97A 3D3BJ 5EWGA 2N82B 3OPKA 2FJVA 1SC3B 1RE1B 4FJKA 4DTPA 2N4DA 3JQKA 3VAGA 4DF4A 4BBYA 2QWOA 5KFRA 3UKUB 5G0RA 2HVEA 3K9KA 1M5VC 1B0TA 5LMUJ 4N41A 1TKXA 1FDNA 3QICA 3DRPB 1NK7A 3BSCA 5M2UA 4LFAF 1C0UA 3POTB 5CY4A 4KE5A 2RILA 1RZMA 1VBKA 5A8WA 1NGHA 4CJ5A 3AD7C 4IUFA 1CULA 2HNDB 3BYRA 3W3DA 4ID8A 1AT1B 1U1NA 4UQGA 3O4WA 4J90A 2ZZTA 4DV6F 2CPEA 4OQJA 2XRIA 4PKIA 1DEJA 1CJKB 3CJKB 4F9OA 2V50A 2R8JA 5A6WA 2HHHJ 4ZVOB 2C3YA 3BKTA 2RB7A 2AGOA 1QVGR 4WCEL 4USMA 1DY3A 5AQXA 3ISNC 1QVFM 3DRYA 4B1VA 4FLYA 3UB5A 4X64K 3GFYA 3KG4A 2G2YA 2E9TA 1HKAA 2PZSA 3D6FB 3KOAA 5FPNA 1N4LA 1RNHA 1UCNA 4USHA 1U2VB 3QRRA 4NLRA 1VHFA 3OSPA 2V63A 1U1MA 4FZYA 2H9ZA 2YBVA 1A7GE 3GQCA 3R5BA 1LCUA 3ZTPA 4XDCA 4R25A 2FQQB 1J9AA 1IJFB 3M2UB 3LUYA 3ASMA 3EICA 3OL7A 4KGMA 4RW6B 4WP8A 2RRNA 1VSIA 3Q83A 5L1KA 1Q7YT 2WBRA 2KI2A 2DK2A 4EZ6A 2DEJA 3TZZA 4Q0BB 4OYBA 4KGKA 3L95X 3PJWA 2DY1A 4A8SA 1RAJA 4USWA 3K2YA 3DOMB 4OX9K 2QEXN 2VFTA 1NH8A 1YITN 2RQ4A 4U8VA 2LEBA 2CPHA 4DS5A 2D9PA 2R9LA 3BP8A 4ILMA 2QTWA 5AQMA 4WF9Q 4NMLA 4WQ5C 1G15A 3VF2A 4LF4F 1OYEA 1FD8A 2DO4A 3EPIA 2LEPA 5DQIA 5CH7B 3C6UA 4PKGA 2ROGA 1YT3A 3NAEA 5AE2A 2RDIA 4WZQA 1HX1A 3KVGA 2H5JB 1O13A 3VGKA 5BJRA 1K6YA 5FDLB 4KBOA 2VIHA 2KT3A 4LFCK 3UDCA 3KD1E 2CPFA 3R1LA 5BPMA 3PM9A 1RTDA 4A59A 4C23A 2V34A 1D1UA 1WC3A 5J2QA 3SYZA 5J2NB 2B4JA 1XJWB 2MGZA 3R3LA 1QDUB 2RJZA 3R6LB 4B9UA 2O8FB 4PQUB 3V6DA 4E7HA 1EETB 5AQSA 3V4IB 3KHGA 1P1LA 1YZ7A 3CJCA 3E2EA 4BE0A 4KGVB 3O3HA 4OLPA 4F02A 3QT5A 4BC4A 3AFGA 1VR6A 4L72B 3CCES 2XHWA 4JI5J 4YR3A 2HK2A 5E0OA 3OA9A 4DMNA 4O3NA 4JI6F 5L8RC 2L3MA 4GVBB 2B6AA 2KYXA 4M7XA 3B78A 3JTOA 2HHHK 4K4XA 3K17A 3IAYA 4HTLA 4DBQA 4QOZB 1WC1A 3SDEA 5BR8F 4AL6A 1SL2A 1T9UA 4Y6IA 4X4VA 3JS9A 3D2WA 1UKUA 1WDTA 1Y5NB 4DV5J 5EOYA 3TAFA 2E29A 1WSIA 4G1IA 4ZVRB 2QM1A 3W5YA 4OL8A 3SPZA 4CBWA 1JB0C 2Q43A 1U09A 4ITSA 2NXCA 1IR0A 1H7WA 2FHJA 2D9OA 5AE1A 2YVSA 4ZVGA 6FDRA 5HP1A 4F3QA 1UJ4A 3QEWA 1EWQA 2D1KA 2HLTA 2V4JA 1GX5A 2NXJA 5E41A 4MKAA 2CPZA 3OUYA 1O8BA 4B17A 2IRUA 4UOGA 4OPJA 2DNYA 3X3UA 1M1KO 3SBTA 1N8RO 2D0PA 2FF6A 3H2LA 4OVLA 3OBYA 3NNCA 3VHQA 1VOMA 3O6QA 1VYAA 2PYJA 1AXQA 4DG1B 1NZAA 3I82A 3AAPA 4DOZA 1NBEB 3ETMA 2I5JA 1YQHA 1H0HB 4NLBA 4NXMF 1S1WA 2KTQA 4ZJLA 1M1GA 2ZQBA 3PIPL 2OA8A 2B8QA 4ILLA 5B0EA 1BU6O 1MU2B 1JWWA 4I2PB 4H0OA 4K4VA 4KJIA 1IKXA 4XPCA 2CDRB 4B9TA 1I3OB 1G6BA 3B54A 3LDNA 4RX6A 5KPRA 1N0UA 1JX4A 4TYAA 2D0AA 2DKOB 1X31C 2WVEA 1HBNB 2VONA 2ZJPL 3IAM9 2I2YA 1WNEA 2MZQA 1PJ7A 4HHJA 3T41A 1RWKB 2BE9B 2P1JA 1HA1A 2KM8C 3TOQA 3VQ6A 4I9QA 1Y10A 4BACA 1BA0A 4CF2A 2BJ9A 4NLPA 1KVCA 3AA3A 5H9EJ 2CAJA 3PXGa 1HYZA 3WQTA 5AT1B 4NEYA 2UUAJ 1H7XA 3C95A 3K5LA 5HBMA 4WU3A 4Z2XA 1S77D 3VA3A 3EEQA 4GV6A 2KZZA 2HHWA 3ZT3A 1VQMN 3UR0A 2DBBA 2QLXA 3VQ9A 3WNHA 3DLJA 1CC8A 2J0XA 1SQKA 2ZOGA 1WSJA 2A5XA 1ULRA 2HS3A 1S4EA 4FJJA 5MLCV 3DRRB 2V0NA 4DV5K 4K4UA 1GFWB 3DCAA 3B8AX 4X66J 1YHQN 1URNA 5T7BA 1C1CB 3I8DA 4E1JA 4RUBA 2BJ8A 3BQ0A 5D4NA 2N4CA 3E51A 2X7IA 4X64F 2DNOA 2XY8A 2GEMA 1RT1A 2G8UA 3GR1A 2B9EA 2O5DA 3P5JA 4JKAA 3G4SN 3SSSA 4H0XB 4DZDA 4NA3A 3ZSVA 4DPYA 1BI4A 5G0RB 4LR9A 3UW1A 1L3KA 3PYDA 5BYRA 2RE1A 3CC4N 1WACA 2IOCA 5JICA 1TKXB 3EY1A 3MM7B 3TA1A 1Q79A 2UUTA 1PO6A 2QA4N 4N7TA 3H3OB 4RCHA 4N8NA 3IMQJ 3H98A 1TAQA 2ZBIA 2LFVA 2YX1A 3P4IA 4OJRA 1P8GA 3R2DJ 2XQCA 4ILHA 1GLDG 1CULB 2XYGB 1OY6A 1RA7A 1LWEA 4HVZA 4IRDA 4QZVB 4OX9F 3FGUA 1JK9B 2O66A 3L6QA 3JXOA 4IJAA 1SJ3P 4EMDA 3GDQA 2WSCC 2PA8D 4BVOA 4P7TA 5KFVA 2RVJA 3A3NB 2BGGA 1JXBA 2IRYA 2KHOA 2CADA 3CT9A 1RDAA 4I4BA 4PXEA 2COLA 2VQFJ 2OZSA 2KKZA 1NGJA 1NJIO 5ETKA 2UVUA 5AE3A 3NCPA 1FW6A 1EWRA 3G71S 2CQIA 3AB4B 3EXYA 4BC3A 3RB6A 1V9OA 3KLEA 1SI9A 2XMVA 3OYDA 3DYAA 3WT0A 1HMVB 4LFCF 3HHLA 5H9EK 4DTXA 1Q8IA 2UUAK 2UU9J 1VQ4N 1ZTWA 1HNXJ 4J9VA 3THPA 1SKSA 1CC7A 5DM6Q 3M1VA 3EE8A 2ZH8A 3VOVA 2GZOA 2RDDA 1SCJB 3DGPA 2ROEA 1YJNS 3JYTA 3HZ6A 4FZZA 1T95A 2BJ1A 4IQXA 2EXUA 1TU0B 4MIBA 4LF1A 1Z2ZA 1J53A 1RBVA 3A2FA 5KFJA 5IC4B 1GOBA 1VQ8N 2NXUA 4OHWA 2XY7A 4HT5A 3WIUA 4BRLA 2HHHF 4X66K 3BSNA 1RTHA 3BO3A 3PHTA 3D28A 4DR6J 3HVTA 2OUGA 1W2IA 4EWTA 1HQEB 1ZAVA 1SJ1A 2V9KA 2VQEJ 2JSXA 2QKKA 3TTDA 3C6UB 1FESA 3IFEA 4FN5A 4FPAA 4F4AA 3MR2A 4YQWA 4LVNP 3M6UA 3F0NA 1IKWA 3KMSA 3QNOA 2C1EB 2F8EX 4ILJA 3R3TA 3MD3A 2U1AA 1WEYA 4O55A 1RBUA 4DTSA 3FZ2A 3CCUS 4OI4A 4CO0A 2CNNB 3Q8UA 1VQ7S 4QJVA 2Q2RA 2JWKA 3CJBA 2P5OA 2GAHC 2AHOB 4KIAA 3OW2M 2GCFA 5J2QB 5M2RA 3WXJA 3PEHA 4CHZA 4NYNA 3V6DB 1OS5A 5ELZA 2MQPA 3KXDA 4BRNA 3A13A 3D5MA 4DV7J 2EVZA 3CXCM 4EIAA 3JAMO 2P9LA 3CCMN 1M1KT 4AHRA 1BCMA 1N8RT 4ID1A 1MSWD 2YTCA 3NF9A 4EFAC 4PRFA 3VGVA 4PQAA 2B6AB 3S9HA 3UQSA 1S5ZA 5KOXA 3SDEB 3QGGA 2VQFK 5IC6B 4LF5J 5D0EA 5E2QA 1M5SA 3H0PA 2AU0A 3D2EB 1NDCA 3OY9A 2HRYA 3BSAA 3CMES 4FJ9A 4B3TF 4Y65A 3KJNB 1YZ6A 4BRQA 3MCNA 3N0VA 5SWMA 3QGHA 1BHLA 2MYFA 5HP1B 3QJJA 1RU1A 3VEXA 4CF1A 1WHYA 1IKVA 1HNXK 3N4WA 2V4JB 2Z2MA 2HBYB 1WJ9A 3KLHB 3G8SA 2FUG9 3OUYB 1S6QA 1XMQJ 3VGLA 3QIDA 4E1MA 2DNLA 3R7BB 4W5QA 4KHPK 3IR7B 2W4PA 5F9NA 1RHRB 5D4PA 1VQNS 5CZ2A 2E2QA 3FE1A 4USUA 4QIGA 2IBKA 2CIMA 2HWIA 1DARA 2LQBA 5GAEI 3DLLQ 4ZP8A 2HGMA 3BGUA 3GZ7A 3Q8VA 5KG7A 5M1PA 2I5JB 2ZNYA 2Q6CA 2WOMA 1BWFO 3JB9k 2VJVA 5A2QO 1S1WB 2RHQB 2VQEK 3C46A 5F8IA 4Q43A 1DAXA 4DV5F 3H20A 1IKXB 3G8TA 3UCGA 2MQNA 2VKZG 4GKJJ 4O3QA 3MM9A 2QE5A 3CF5L 5A8KA 4FF4A 3KZBA 4JD2A 4USJC 4KV8A 2O4GA 1ASVA 1HNVA 4KRWA 2JH3A 1TVRB 4FK0A 3UIQA 1JIHA 2Z8QA 3R5DA 1I3AA 1PSDA 3F9MA 4DV7K 2MPUA 5EX0A 2E20A 5GADU 5HBMB 1LFPA 4EHUA 2KQ2A 1XERA 5TKWA 4O3OA 1Y00A 3VEYA 4AILC 2XSJA 3CQXA 1WHVA 3SQ2A 1EX4A 3L2WA 2R2SA 2R7UA 1X4AA 2NREA 4LVOP 4ICLB 3H4DA 2IGIA 1FJEB 5LMNJ 2DHSA 2QWNA 3IGVA 1D4XA 1NKBA 2P5GA 3DI6A 4L75A 4LF5K 2MXYA 4BLGA 3I9ZA 3G6YA 3W8PA 4HTUA 4IG0B 1KQFB 1YUWA 1ZZFA 4ECZA 4LUBA 4JK9A 4ZTJA 2WUSA 2OP5A 3K9JA 4GNIA 4B9SA 2NRTA 4KH4A 1O51A 3LDOA 4QBUA 3BJYA 3THWB 2BYCA 1NGBA 3J80O 1U8SA 4RBTA 2C2NA 4F67A 4ZPDA 3G10A 1RT1B 2Y9HA 2ZEJA 3ZO7A 3M8RA 3W62A 4ZP9A 4ECXA 1YJ9S 3P38A 1NJIT 4B9NA 1U26A 4DFKA 5B0FA 4CK1A 4OYAA 2UV8G 4CF0A 1FA0A 5C12A 3A12A 2QW9A 4P7VA 3Q23A 4FF1A 3CC2N 4M5GA 1GK8A 1VSEA 3MX2A 4ALZA 3HHLC 2HQGA 3MMCA 4WK3A 5THWA 1KSPA 3AVJA 1TUVA 3BZKA 2XMMA 1F2HA 3OFFA 2J9EA 2BM1A 5JLHA 1HHTP 1LWEB 1N36J 2MQQA 2DNNA 1RDUA 1BOTO 5HMWA 4K7QA 3OJSA 2RQMA 3TQ1A 4BHQA 4ED7A 1R59O 3BGOP 3ZSQA 3LPTA 4BRAA 4OYMA 4KPYA 2VC1A 4DPOA 5KFCA 2DPNA 4PA1A 3TX0A 1WAJA 4PL7A 4GKJK 2DTUA 4WXOA 4YOVA 2F9TA 4C0HA 4OI6A 1ZA2B 2OLWA 3FZMA 3MR5A 4A8XA 3TZYA 1VRTA 2WBNA 4XH5A 1VGYA 1KRPA 3KLEB 2HHPA 5I3UA 2AJQA 3W3SA 1ZM3A 3CIMA 1U0SA 1Y11A 3H42A 3DYAB 3W5XA 4ZPWR 1UTAA 1FK9B 4M94A 1UA1A 1TYQA 4PL8A 2BUPA 1UWAA 4M5JA 5GADI 3HSDA 4CYUB 4LRDA 1S9EA 3ELHA 3DRSA 4LQ3A 4NLQA 3M1VB 1K73O 3TNVA 1DTQA 1MWMA 4DFJA 1S72N 3VAMA 3J8AA 1AROP 4DFMA 3DXMA 3DGPB 3JYTB 2HHQA 2EFNA 4NPOA 2JEJA 2G0JA 3C66A 2JWLA 3QBWA 1H2VZ 4FVCA 1LWXA 2P6SA 1RGVA 4K0KJ 3LAMA 2NXEA 1TK0A 2MKIA 4DTOA 2IVYA 2I7PA 2E1CA 4F0MA 3O4NA 3CQYA 1IBKJ 4A47A 4FJNA 1RTHB 4CLWA 2KXNB 1UZHA 2W1BA 1WG1A 1N32K 3HVTB 2SXLA 3OW2R 2VQFF 1JLQA 3TYTA 3IUCA 3HVWA 1WEZA 2CQ1A 4I6AA 4WZMA 3AB2B 1CLQA 4WU2A 2Y3YA 4CZFA 4DTUA 4DSJA 1UFKA 1ICEB 4GV3A 2DNPA 3NWGA 3RW6A 1QUPA 1VJQA 2EFGA 1OPIA 2NRRA 3B8HA 3DM2A 4FBUA 2NRXA 4LC9B 4W98A 4CW7B 4OKEA 2XYHB 3HPHA 1GLEG 3FZFA 4HH1A 5B0CA 2VCPA 4HUGA 4O5BA 4CLZA 3HHEA 4L3QA 3UVJA 1CQNA 1YBTA 4JI0J 4BR2A 3RG6A 2RD5C 2BE2A 3CD6S 4KHPF 4E0DA 2EBGA 5IFMA 2MKCA 3W61A 2MLZA 1N36K 3RVCA 1RFQA 4EO6A 1N54B 2QMUB 4ED5A 4PG8A 4NCAA 3FMBA 1S10A 2YHWA 1VQLN 4YY3J 3QYYA 1B64A 2W6LA 4W5NA 2R8IA 4NYPA 1FKPA 1EAYC 2XMTA 1DKGD 3GJRB 3IXQA 1LW0A 1NOYA 1X0FA 4C0BA 3VVTA 3FFKB 4FYVB 2JEFA 1DLOA 5M1OA 4C1NK 2NZTA 3VAIA 3ZNUA 4TQRA 1HKBA 2O8CA 4EBCA 1YG0A 2ZH3A 5K9FA 3L8BA 2WTFA 4E19A 4Z0UA 3V9XA 4CJTA 4PG5A 2JEGA 1RHUB 2ZOFA 4FWQA 1APSA 3TAQA 3SUQA 2FVPA 2VWJA 3O5TB 1RT4A 1IKVB 3RZAA 3ULDA 4CEEA 1S6QB 4AF1A 2C3MA 4J91A 4V1Ak 5DG8A 3MCOA 4NOHA 4IFVA 1H1VA 3ZSZA 4LT6A 1RBAA 2QC3A 1O5JA 4DV7F 4BREA 4KI4A 5BRFA 3C65A 1RHKB 2M9KA 5KT7A 2VWKA 3UO0A 1NU0A 1ROFA 2IA0A 5KI6A 4K0KK 3WHIA 3N6MA 1HFEL 3DLKA 4M3XA 4WFNL 3PRDA 3PO4A 3SQ4A 1MNEA 2WOMB 2VV5A 1J6ZA 4BDYA 4DPWA 4K5RA 4U6PA 4LF5F 3GTYX 3QJLA 2V8VA 2VF3A 4IKAA 3U3GA 1GXUA 1X9SA 3A3OB 3LPEA 3R5CA 5LJVA 5A8KB 3OYBA 2PE8A 5BYSA 1GMWA 2QX0A 4TNOA 1WELA 3MCMA 4JD2B 4KV8B 2AX1A 4E2FB 1Q9YA 3UPFA 3W8GA 1SAZA 5IT9O 1FJGJ 1WUAA 1HNVB 2RMLA 1TV6A 4JI0K 3ZZTA 1VS3A 4FW2A 3GR0A 3MAQA 3T3FA 3OJUA 5ETNA 3MMBA 1TUYA 2KW4A 2QK9A 3AVAA 2O8DA 3NMRA 4OYIA 3PDNA 5LSLA 1D9DA 5LSRA 4JV5J 1J5EJ 4YY3K 5U47A 1NB7A 4OMFG 4DX5A 1BQMB 2KB2A 2BVZA 2DISA 2QXFA 5GAHU 3T6JA 4DX7A 3OYJA 3THVA 4ED1A 3M6VA 3HL8A 5MLCQ 4JS4A 3FZLA 3FZHA 3ULEA 1PIEA 1ZBSA 3DI6B 3UI3A 1FT8A 3CPEA 5FIIA 2P9IA 3VQ8A 3HOTA 1FRMA 2WFBA 4F3TA 5IXUA 5CHCB 4GKJF 1JLBA 2W4DA 4WFYA 4CJWA 4FCYA 2OTJN 5L46A 1T9WA 4OHZA 3B6PA 3QQCD 5AXKA 3TPQA 1HWKA 4L76A 1BO5O 4JN4A 4NASA 3LP2A 1EKRA 3T1AA 3HULA 3GE1A 2MZJA 1NJYA 3O9UA 5GMDA 3LDLA 1WTFA 1QQCA 1R0CB 3I56S 4BRGA 3E3XA 3CCLS 4A8KA 4JRPA 2E1MC 4F26A 1AFJA 4OHVA 8AT1B 4IOAL 4JI1K 3ZSYA 4H0YB 1H98A 3MMCB 4AD6A 1RT2B 5GAGU 4OLOA 1NSQA 1XC9A 2WRMA 3SV3A 2LMIA 3PIOL 1K73T 1V4TA 3DN9A 2ZC3A 3BH6B 1MMDA 3MECB 3CNQP 4CZGA 2KRBA 4M3WA 3HZEA 3HK2A 4RW4A 3BO2A 1IBLJ 2NYIA 4CJKA 4DV0J 4X2BA 1N32F 2ZHOA 3C15A 5E3PA 4JKDA 1GMUA 3QMQA 4CF9A 1BGXT 1QAXA 1YJRA 2FVCA 4LR7A 3T1HJ 3K5MA 1M1HA 3LWLA 3W60A 1VRTB 5C42A 1T9XA 3TI0A 3OVSA 2DNRA 2G1HA 4ED0A 3NLCA 1IR2A 3W9JA 1H74A 2NRZA 2QWRA 5DQHA 1B7FA 2OANA 3N9UC 5AXLA 3AO5A 2IAJA 2WC9A 1HHSA 1S9EB 4JV5K 3AGRA 1R8HA 3MM6A 1J5EK 1DTQB 4NCGA 2D0OA 3DXMB 1VIOA 3BKFA 3NNAA 4DPUA 3SUOA 5AQHA 5E7OB 4DX6A 2RIJA 1OH8A 4CJ7A 3AJDA 1RT6B 1U45A 1RHQB 2CJYB 4NYOA 1KAXA 2PBDA 3VWSA 1SXLA 2DEIA 3CI5A 3AA8A 1VSFA 4RW7A 4HTJA 2CG4A 4DV3F 1C0FA 3S8SA 3HD1A 1JLQB 1ZBFA 3VR1A 3E8OA 1F9FA 3LZIA 3SSRA 2NRVA 1U1KA 2FLLA 2V8GA 1VI7A 1YVUA 2VPYB 2DH7A 2HNZA 3MM5A 3R9PA 1QS4A 3DM2B 3CDEA 5DJBA 3L4BC 5KFGA 4IFYB 2E7VA 4YFUA 1RYRA 2DIVA 1D9AA 3EZ5A 1WN7A 4FNIA 4M95A 3PYGA 1P9YA 4NLUA 3CETA 3VESA 5A2QY 2A6MA 3G6ES 5HVGA 3SBGA 2ZH1A 3UVJB 3ADAC 1KAZA 2R2TA 4BE1A 3HP6A 3K8VA 4YR0A 3EJMA 2MKKA 2GW8A 5F1XA 4R0JA 3DLHA 4HEA9 5EUHA 4FJ7A 2X51A 4CE9A 2P9PB 4K0KF 1ZBTA 2E5IA 4EBEA 1IBLK 2LXIA 1FKPB 3AOBA 4IYQA 1LW0B 3I5AA 1BDGA 4M5NA 4ZVHA 1HBMA 1JXVA 1BL3A 3E9PA 3KIOA 5D77A 4EUVA 1PYSB 1ZS6A 1DLOB 3AAWB 2O8CB 1PYOB 3T1HK 3MEDA 1RT3A 4CM0A 1JQGA 3I87A 3VENA 5K8MA 1X3MA 3HM8A 4BRIA 3TVYA 4TLRA 4OYWA 2ZJQQ 2XM3A 3ZT0A 3QBCA 2DTJA 4UUXA 2E2OA 1FO1A 4DU1A 5HJXA 3L9ZA 1RT4B 3RR8A 4GRSA 3DLBA 5F8MA 1MROA 3CCQN 4PPDA 2C3OA 1Q86O 4JI0F 3KHYA 2V2QA 4B02A 4YB5A 3MMAA 3MR3A 2C3PA 5C2GA 4JYAJ 3EE9A 1DT9A 2D74B 4IFVB 1KR4A 2BRLA 1OH5A 5J2MA 1MN9A 1T9TA 2A40A 4WFAQ 4CHQA 4TU9A 2YH0A 1G2EA 3QEIA 4YY3F 3SNNA 4FJLA 3OYCA 2QJ3A 2QA1A 1IR1A 1RYSA 2O4IA 2LDYA 3CUNA 3AVFA 4LSNB 1FTRA 4BWJA 3Q8PB 3WNFA 5KFSA 3QSYB 2CGJA 3SI8A 2MSSA 4URSA 4BGAA 1TP7A 4PG6A 1QAIA 2IM0A 1BWEA 3CTRA 3IKMA 1LAWA 2R7RA 3TABA 3OS2A 1B0VA 2XNQA 1KVIA 2XGPA 3MN7A 3BREA 3VETA 2AEFA 2EI5A 3ZNJ1 2AYMA 2B4OA 2B4PA 4M3RA 1TV6B 1FEEA 4DTMA 5ETLA 2OD6A 2XZTB 4KQZA 4GO5X 3M32B 4JI1F 4FOIA 2LXFA 2O8DB 3G82A 1REVA 1YI2S 2Z2LA 3UN2A 3BGLA 4Y1CA 1XEZA 2V4QA 3VEVA 3CCEN 1SJRA 3ILIA 2XLIA 3SFUA 2HRTA 4C48A 4LBHA 2IS3A 2I7NA 2FIUA 3WEEA 3HMJG 1UP1A 4KPCA 2BMBA 1UVJA 3FDSA 3VGTA 3ULEB 2HZAA 3BM7A 4K8XA 4M1KA 1R6YA 2IVMA 3L0QA 3T9NA 2P9IB 2FTRA 3G6VA 1JLBB 1QZ6A 1SB6A 1HNIB 2ALZA 2YNHA 2EFQA 1GAOA 3LH2S 3PHEA 2KG1A 3IO1A 3BY5A 2W25A 2Z1GA 3LP2B 3VEOA 2G4BA 2KU7A 4DPXA 3QLHA 2AF6A 2E9ZA 1ZAWA 4S0MA 1SIZA 4TU8A 5M1FA 2MKSA 2CQCA 3C16A 4AT1B 4JYAK 1XC3A 3MK6A 4WE1A 4KAIA 1Y3JA 4U96A 3O3GA 2WVFA 2PGCA 4CM2A 2VGMA 4KHMA 1H2UX 3CDWA 2FY8A 3KNGA 5IV4A 1S76D 3C14A 1HBOA 2PT0A 4QR2A 3T6BA 4JV5F 4UOCA 3FZBA 2DHAA 1J5EF 5E84A 1WI8A 2BACA 1NSAA 3T5KA 2KHCA 4F36A 3L3VA 4BR0A 2IM3A 4HKQA 3MXJA 4LRBA 3CPWR 5CHIA 2NRHA 1RCHA 1BC6A 3O6WA 2CJXB 1S1TA 2M88A 4GC6A 7AT1B 1CEZA 3OT9A 1S48A 1VQSA 2QI2A 3K0JA 2X6SA 3S41A 1W97L 4MLHA 1X4GA 3KK7A 4PEOA 1NGGA 4TSXA 2R8GA 4H0VB 3JQMA 3OYEA 2AEJA 4FLXA 2WHOA 3H6EA 1W7WA 1HNZJ 4O4GA 4LF7J 1Q8BA 1OY9A 3UN5A 2RRAA 2GHVC 3H90A 4JI8J 3LDQA 4CEAA 3WZ0A 3OTOJ 4YOUA 3T19A 3CC7N 3QFPA 3DLGA 1K0VA 2KLAA 3TEHB 3GFZA 2MZRA 1QSYA 2IVOA 1VRQC 2BJ3A 4HACB 2HBLA 1SC4B 2IAJB 2A2CA 3KK1A 1VCTA 3V4MA 4NCGB 2HVZA 1I51B 3BF4A 1S79A 3AXMA 2FVRA 3F56A 2B5JA 1FE4A 4YNQA 3DFEA 2DH8A 4BC9A 1YIJN 2HZVA 1FERA 3KFWX 3KLVA 2VBZA 5LM7E 3MDFA 3AVBA 5A8RA 4F2SA 2YWEA 3RAQA 3FJ2A 1IBLF 2G8VA 4A5BA 2J8SA 3W9IA 3BKUA 5CQGA 4UTGA 1WDDA 3HSGA 4RW7B 4WKYA 2LQ9A 1VSJA 4JAXA 1X4CA 3U02A 3Q2TC 1YX2A 4MO4A 1QE1A 4QW9A 1CS4A 3T1HF 1SV5A 2HFZA 3F73A 1YJTA 1A5XA 2A18A 3U4LA 2OGUA 2UVRA 2O8EB 2D0CA 4AL7A 2MZTA 3R5JB 3AVGA 1CQMA 3MM5B 3O8MA 3NP5A 2ILZA 4H5NA 2QMWA 3SAHA 3VQDA 4JV0A 1RT5A 5CE3A 3H08A 4ZN3A 1PC5A 5DDQC 2Y8WA 1RLDA 4YB1P 4DSLA 4OX8A 4IKFA 2DJWA 4BY9C 4CZJA 5DM7L 4PXDA 3ENQA 1RDBA 3GCWP 5IOLA 1B3TA 3PW4A 5DZ6A 2LYVA 4CLKA 3D6MB 1UEUA 4TYBA 2NNWA 1Q86T 4L3NA 4NE9C 4PG7A 1GTHA 5M1NA 1RSCA 3UD5A 4HL9A 1U8WA 5FD1A 4JI2J 3DAWA 2QG9B 2UZAA 1RDWX 5GIOA 2UVWA 4FXDA 2E1AA 2HFOA 1DZ5A 1HBMB 2IMWP 2CFXA 3Q24A 4DV1F 3OYNA 2DR9A 1HNZK 4FVMA 5F2RA 5MAOA 4LF7K 3MEDB 2J6TA 2P9UA 2HMPA 4JI8K 3HM9A 4K43A 5KFUA 3OTOK 3AODA 4BRCA 3D2FA 2Q1LA 3IDHA 2X1BA 2JFKA 1NGIA 4ZVFA 2Q66A 1NMDA 4NLWA 1UFWA 4CEDA 3KK2B 1Z05A 4HCCA 2QTDA 1Q5VA 1WC5A 1WUUA 1FEHA 3ISND 5C5JA 2IDOA 1MROB 3EWGA 2V2ZA 4K4WA 1VQ6S 3MMAB 1NDKA 4USTA 1IG9A 5HLFA 3LL3A 3TSPA 3QO9A 4DDFA 1IG8A 1QTNB 2QMXA 1I5OB 2EK6A 4MJKA 3WX4A 3AA2A 5J2MB 3GWCA 4ZKAA 1VQ5N 2X78A 1KQSM 4GMKA 1N5VA 5J2PA 3C2PA 4J5OA 4J2BA 4PCQA 4J9NA 2BKOA 3NRBA 4DI6A 2LA6A 2PEBA 4M7YA 5GAEP 1MWKA 2GIFA 4LMZA 4YB7A 1F3FA 4YEAA 3I6PA 4WBFA 1I39A 3I0RA 5EWEA 1B9FA 5AFUA 2VPZB 1CG2A 1IQTA 3M6GA 3UNGC 5M1QA 3DU5A 2E66A 2UUCJ 3HT3A 1RWMB 2HBRB 3MN5A 3CCSS 3NF7A 4BQZA 5F0UA 3BR8A 2NLXA 2J6UA 3QFHA 4CNZA 5BN8A 2JL9A 3S3NA 3BEGB 4U67Q 4IO9L 1MDUB 3OBWA 2P9KA 3MEKA 3I9V9 3CCUN 2BQUA 3QWUA 4FL9A 2YPZA 2F8HA 4C4WA 1NGDA 4URQU 3LGMA 3SIPB 1FHTA 1GLLO 1RADB 3U3YA 4O0IA 4KTQA 3G82B 1REVB 3OYFA 4W92B 4OYPA 2RQCA 5DG7A 2OCEA 2VD3A 4JI2K 3IMXA 4ZHRA 3LGHA 4CTAA 4DR7K 3TZXA 3CJSA 1M90O 2ZH9A 3QEXA 3WEEB 4FJIA 2RE2A 4CGJA 1KLNA 4MK9A 5DK5A 3J7YU 3QEPA 1QD1A 4XO0A 5FPDA 2KDOA 3MTKA 3MGJA 5EX5A 2JHEA 3CCRN 1H3DA 2BW2A 3PSFA 4PABA 4BVPA 1R8CA 1NGFA 3GP9A 2YNHB 3H8YA 1TL4A 2VKRA 3G9CA 3CMEN 3EKUA 3VQPA 3AXKA 4KHUA 2HMIB 2W9BA 1RAHB 4ECVA 2HHUA 3S1TA 3QLHB 2XY5A 3SZ2A 1S0MA 3C16B 3MTJA 2KJVA 4BC5A 4X4SA 5K14A 4WE1B 5C10A 3N79A 3JSMB 4JUZA 3CMQA 5FPEA 1EQMA 3H2UB 1JLCA 2I1RA 3D67A 4YHHJ 3C14B 1HBOB 5AQOA 4FK2A 2FBYA 4CFCA 1L5UA 3L7OA 1U25A 1G3OA 1W26A 3QZ8A 4B08A 1IJEB 5JUMA 3T5JA 4WYBA 3WNEA 3C3LA 3FSXA 4PUOA 1S1TB 3MCSA 4BRPA 2VPWB 2QZ8A 1S1UA 2V68A 3GV8B 4C8NA 5J1NA 3O5BA 4X4NA 3WXMB 3SCKE 4FNHA 2GVZA 4NZ0A 4KREA 1FNMA 2UUCK 4PWWA 1S7HA 4I7FB 5EGYA 3BGRB 1HLWA 4WP3A 2CNLB 4XDDA 4J9LA 5LXYA 2MTLA 2FVSA 3D3CJ 2W4CA 4I64A 4A57A 5FLXU 2UXDJ 1HWUA 4O0JA 3LP0B 4IRCA 3QT7A 2UP1A 2JGUA 4URGA 1TKTB 2CQ4A 1YAGA 2QLJB 4FJMA 4WYWA 4EAHD 3DLGB 3CJRA 2NQPA 3OYHA 3HYFA 4DUZK 5HK4A 1CJKA 2XBPA 3CJKA 1OYDA 2Q31A 3KK1B 5GADP 5HMZA 3W2WA 3TAEA 3VGSA 4KB1A 4IO1A 2IFXA 3MMJA 4XTTA 2B5JB 3EUNA 3J7YI 4W5RA 4CH0S 4K4SA 4JKBA 1ATNA 5IWAF 2FHKA 1KC8O 2GNKA 3Q8SB 1PC4A 1RTZA 3TA2A 4QWAA 4H4MA 2KT2A 4ECUA 3NS7B 4IH7A 2NXNA 4RW6A 3HP9A 2W2MP 2OEMA 2GMJA 2Y0BB 2VGNA 3H45C 2Y1LB 5KG3A 2XZWA 3ZFVA 3NVKA 2FJBB 2BBEA 1HIYA 1HNZF 4QCLA 3OL8A 2GV9A 3KK3A 2C3UA 1QE1B 1NK0A 4LF7F 3AO1A 5FLXY 1KVBA 3G86A 1JLAA 4Q0BA 2EKYA 4JI8F 2PO4A 3DOMA 2XWXA 1HBUA 1SQGA 4CT9A 4ES1A 4RU9A 2MDAA 2BR0A 3R6GB 2QEXS 2YWGA 1SQEA 3BB5A 4JI4J 2HQCA 1YITS 4RNNA 3TZWA 3HJVA 3OR2A 2BTFA 1KP6A 5BXIA 4CCHA 4FJGA 1E6YB 1XN9A 3VQ4A 2GELA 3WXIA 4D3GA 1TK8A 1N52B 4MKVA 2D7SA 3I4PA 1KTQA 2GAGC 4CECA 1RWUA 5HATA 3S3OA 2NLWA 1F6TA 2Q3PA 1HARA 3U6FA 1IWGA 1EARA 4QS8A 3L2RA 2M7SA 4CJPA 1DHMA 4DSEA 4TQSA 4C8MA 2HBQB 5HRPA 2WB4A 3VALA 1NLVA 2QA4G 2HBJA 5BR9A 3QWPA 5AQUA 3DRXA 4DR3F 2V6AA 4QPXA 4C8YA 1EETA 2I38A 4CQ1A 1RWNB 2UXDK 3V4IA 1RDRA 4F3MA 2P9UB 4OX7A 2OEKA 2VB6A 3A8JA 1KQGB 2HIQA 4H0PA 4BRFA 4OZ1A 1G7CB 4M45A 3QAEA 3TX8A 4PWUA 2IDEA 3QJPA 4BRKA 2F63A 1FJCA 1KAYA 5JLFA 3EVWA 3ID6A 1QM9A 5HLFB 3QO9B 3V6JA 1VRUA 1X9WA 5KG2A 5HL7L 4CK3A 2OELA 2Q36A 2NYHA 5E3AA 3ZT2A 5HQMA 4DMZA 5J2PB 3OLAA 2M4MA 4DR7F 4CGFA 4H5VA 1SBRA 4KYZA 1U2FA 2FF3B 2QWMA 1O0PA 4PYAA 2YWFA 4USVA 4NLTA 1T11A 1M90T 2ZBPA 3LF0A 5DZ7A 5HAOA 2OJ3A 4ER8A 3RAXA 2KFNA 1D5AA 3L4QA 1NG9A 3CE8A 4DU7A 3H1VX 1OMSA 3BYPA 1CJVA 3F9KA 4NRUA 4BR5A 5HI7A 2E5HA 4P72A 3EXCX 1TZ0A 1KOOA 3BZQA 2ZVSA 4QQBA 3KKRA 5D0RA 4IZ9A 1VAZA 4FO0A 4ZLLA 1NHKL 2X1GA 5F0WA 3K59A 3AVCA 4FP9A 4DQRA 4EEYA 3V9WA 3NL0A 3FR0A 2VBYA 3KTQA 2P9KB 4JI4K 4G1PA 2DR5A 3UDEA 2R2RA 3UD4P 1NK5A 3CQ8A 1S9GA 5KRSA 5KFOA 5HO4A 2HB5A 1ZM9A 3CD6N 3D1QA 1Q4RA 2E5GA 2PA3A 2ACYA 4B3SJ 4O3SA 2P9EA 1RWPB 3QT6A 4B3RF 5KQ8A 1N48A 2CNOB 2GQCA 1RABB 1DQ8A 1NB2A 1WWHA 4A8FA 1WBBA 3GE9A 1XNRF 3OYKA 4ZHRB 3NF6A 4CTAB 2FHJD 1S22A 4ZLNA 2DHXA 2MQMA 3KHRA 3SAFA 3TUJC 1U1PA 1SL1A 4KKOA 2A1BA 3O44A 5AXNA 1D8ZA 5KFLA 1WSFA 5LT5A 3LPUA 2OPSA 1TL1A 3I4HX 4FLUA 5ETQA 4ISFA 2G9OA 4KSEB 2AQ4A 4ILGB 4A2BA 1QSLA 4O8KA 2MJUA 1HRHA 5LXRA 2D3UA 4CLPA 1EO1A 2UUCF 3EZOA 3JTPA 4NRTA 3VAFA 3MEEB 3RSEB 3ISZA 2VBXA 2GQQA 2ZBRA 1NWKA 3TUIC 1BMQB 5AJ3F 5HANA 1OIAA 3DU6A 1KWMA 2BZ2A 4JKHA 7FDRA 2W9BB 1BHNA 3HF5A 4KHWA 4KAZA 3MUVP 5K8NA 1S6UA 1VQMS 5C0YA 3R1XA 3NH1A 3H3NO 1WG4A 5G4DA 5K14B 4DUZF 1SUQA 4OI3A 2Y0SD 2CPXA 2HFVA 1RK8A 3D45A 1XUPO 2YHXA 1JLCB 5JVGL 2VODA 4JKGB 2RHKA 2J0QD 1C1CA 1TQLA 2HG4A 1NCLA 1YHQS 5KQDA 5KFIA 3BPDA 4HI1A 3U9ZA 3T5HA 2CVEA 2YNFA 4FYXB 4Y2IA 2HGLA 3BR9A 3O3FA 4OZ0A 4PUOB 3HDSA 5DM7Q 1NJWA 3QESA 4CF8A 1B92A 1S1UB 2F4FA 4KH6A 1K1SA 2H4WB 4CJ3A 1NJZA 4CIFA 2GVZB 2ZH5A 3MM7A 4E7LA 3CC4S 1RILA 4KGXB 2BANA 1OQ6A 3M3ZA 1V4SA 3MFHA 3ZX0A 4DN9A 2QA4S 4O23A 3CM5A 1HYSB 2EEYA 5IM0A 4BRHA 1X4BA 4X4TA 3TSUA 5HQLA 3H7HB 1NO8A 2E5JA 4AXIA 1VQPN 3FVYA 1T8EA 2PIIA 2VWBA 4Q5VA 4FM1A 4PPZA 3MN6A 3T1YF 4DV4J 4B3SK 5A6PA 3N5BA 3Q86A 2FC9A 3GJQB 4K25A 4AL5A 3M4XA 2ZHAA 2XYPB 3P96A 3W2WB 3RU0A 1VHXA 2VL1A 3I96A 4LRFA 1YJWN 3A5LC 1M5KC 4PKDB 3SQ0A 1VQON 4QYZJ 5GAHP 4LSLA 2ZHBA 3PY8A 2JLFA 4ES3A 1NXIA 3L3UA 2FJWA 5LJWA 4IH5A 2DCLA 1RGIA 4ECRA 1HMVA 4ZVSB 4H4MB 2WCXA 1R8PA 3M9NB 2BV3A 4BDZA 3SUNA 4Z7CA 4DZ6A 4M8LA 2PDAA 1VQ4S 2HWHA 1ZBUA 4YOYA 2CPJA 3KK3B 3GU0A 4MQ3A 2QSWA 4LR8A 1JLAB 4FLVA 4RLEA 5DG9A 1QAYA 4O8UA 3OSNA 4ZTFA 1HBUB 4CO1A 3I56N 1P27B 4OIXA 3DHWC 1RACB 1WOSA 3AO3A 2VOPA 4Z4IA 4U7CA 2HBZB 4JB8B 2C2OB 1I1GA 2OHDA 4IOCQ 1VQ8S 4CWBA 3OR2B 1HQEA 3ZT1A 3I8BA 4CP5A 3MHYA 4IO9Q 4M63A 3DGVA 1HKCA 2KG0A 5GAGP 2CDQA 2E1ZA 5ETOA 4I6WA 4DL6A 2W7OA 3U1LA 4K4ZA 4XIUA 1N5SA 4W90B 2CRLA 1WF2A 2DGVA 1GMVA 3P1GA 4N77A 2O3DA 5I9EB 4ISGA 5EU7A 1RHMB 5LMUK 2G2ZA 2ERRA 1C1AA 3HHLD 3LTOA 5ETMA 1AFIA 1HPMA 1XBWA 4K2JA 1B70B 3KLFA 3DXSX 4M3UA 2MKYA 1FKOB 2MY8A 4IEEA 2Q3SA 3TR8A 4EZ9A 1EP4A 1VBZA 3X1LB 3L3CA 3N6NA 2DGOA 4GVMA 5KFMA 3EL2A 4A2AA 5L38A 3ZC4A 2XS2A 4MKBA 1Q1KA 2H5IB 3CCMS 2KHDA 4KHSA 3LW5C 1OJ4A 4HDHA 2GWJA 1SKWA 1R89A 4DV4K 4CI0B 4Z4HA 4H4KA 2HKEA 1WSHA 5KFNA 3IFRA 1WKKA 3QIOA 3P5TL 1RAOA 2HVIA 1WAFA 5AQYA 3QERA 2UXCJ 4QYRA 3QNWB 1FFWB 2B43A 4IRKA 1RBOB 2KXFA 1VRUB 4QIWD 5JVHL 4DU4A 4HUFA 4DQ8A 2RDJA 4CFBA 1KCFA 2YJEA 2LLZA 3D2EA 5DMRA 4QYZK 2CNKB 2RS2A 2WVCA 3IWXA 3HHKA 3KG0A 1VSDA 3H2VE 1X4DA 3RMBA 2IYGA 3CCWA 2KVIA 3SMZA 4LQ9A 1WEXA 1Q81O 2AYGA 2BE7D 3BGFA 2X74A 3KLHA 4ZPTR 4CDIA 3O9SA 5C15A 5IT9U 2ADBA 1CJVB 4OGCA 2CUYA 2KZMA 2EW9A 2M8DB 3F44A 2DVIA 1YJVA 2H48B 2R2UA 9ATCB 3SEOA 2YKAA 1WKJA 5D78A 1RAAB 2DD8S 4YN3B 1GTEA 2IIRA 2H54B 3MN9A 1BIZA 3J7A1 4YOXA 1YK9A 5EHHA 3JSBA 1IUJA 1TKDA 1X4HA 1U0HB 2JLEA 1VFJA 2CZ9A 1OVYA 5CD4A 1S9GB 4OYXA 1FNXH 3G6EN 1T3OA 4QU6A 4EO8A 3J81U 4ED3A 3NHGA 1S97A 3PFOA 3QIPA 3TTCA 3L09A 2UXBJ 3U7JA 3TR5A 2IPOB 1JNZB 1S6PB 4M5MA 4RW9A 3D7EO 5EVZA 4AYBD 3CYMA 3OL9A 4LBIA 1XQSC 3HVRA 4C8ZA 1AB8A 1VK8A 4KKOB 2E8AA 1R0BG 1WC6A 4DSFA 4LD0A 4F4YA 2LU1A 5FRNA 4LF8J 2OPSB 1TL1B 3R7NB 1QTMA 4LH4A 1VQKS 1NGAA 3ITHA 4CGIA 1TVRA 1UAXA 5IS2A 4OZNA 2E88A 3G87A 5CYJA 3PR5B 1K1QA 5GIPA 3MOZA 3FNNA 2W9CB 3L7PA 1ZETA 2FJAB 3M8YA 1LXNA 2DGQA 2ZJRQ 2ZZNA 2LKZA 4JP8A 2MQOA 3IBCB 2VG5A 2NZCA 3FBCA 4CGGA 4JI5K 3BBCA 3RTVA 3HPGA 3QMLA 4CFAA 5M1KA 1RWXB 3C6TA 5AQLA 3MPDA 3AD9C 2DY4A 4ICLA 1T94A 2M52A 4FS2A 2VYPA 3KNAA 2UXCK 2EFVA 2BOAA 3MWPA 2AJ4A 1SUQB 4DR4J 4IG0A 4C11A 2CH5A 5ETSA 4CHNA 1JLFA 1Q78A 3CJ9A 4L73A 2F8MA 4I6YA 2Z0GA 4N56A 1VSHA 3THWA 2MKJA 2DRAA 2ZBQA 3VA0A 4DQSA 2PEHA 1PG5B 2YNFB 1WHWA 3TWHA 2AZ3A 4EBDA 5KGWA 3Q8RB 1X1PA 2AJ0A 3HT0A 3H1QA 1U7LA 3VGUA 5KFDA 4DR1J 2HSTA 2XGQA 4CGDA 4TU7A 2OKQA 3BN7A 4TY8A 5HROA 2D5RA 4WP9A 3BS9A 2FYXA 4ZMMA 4FWLA 3CC2S 2BANB 3PZPA 4WF9L 3GB0A 2V52B 2CPDA 4J37A 2CQ3A 3AGKA 2NSBA 1QVFR 5IM0B 2G8FA 4Z7YA 4P6QA 1T02A 2ZVIA 1P8ZA 2BEFA 4WXWA 2D0BA 2ZWPA 4EFHA 3IGNA 2M8HA 1DQ9A 4NZ7A 3QNNA 2HAIA 4ECSA 2IDLA 1V3RA 3AVNA 2UXBK