1S1VA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
539
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 145
structure length 533
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1vA05
4DQPA 5KFKA 4I9QA 2KTQA 5KFOA 4Z0UA 4RW6B 2HNYA 4NYNA 4YFUA 1KLMB 3LWLA 2IOCA 2XI2A 4Q44A 3NF7A 1IKXA 3VQSA 1TQLA 4CJTA 4EBDA 3FSIA 4NLQA 1RT7B 3SI8A 5KRSA 5CYQB 1RT3A 4OPKA 2XGPA 4WFXA 3ZSWA 3MF5A 5J2MA 3GIKA 1ZBUA 4DTXA 4WFYA 3ZSVA 3OYNA 4H4OA 4E7HA 4FW2A 4O5BA 2EHGA 4DS4A 4DU1A 1R0AB 4BDZA 1D9DA 4M3YA 3IRXB 1Y97A 1ZETA 4CGHA 1RT2A 1ZBIA 3MFIA 3ZT3A 5C24A 4FJJA 3V9ZA 4CEQA 3G0ZA 1REVA 1SH0A 4CF0A 4CK1A 3OS0A 2V9WA 1TK8A 1L3SA 2HNZA 2KW4A 1JLGA 3QIOA 2WONB 3V1RA 1RBTA 3CFPA 4HKQA 4DL4A 2HMIB 4TY8A 4J2EA 3ZSQA 3T5KA 2KQ2A 2AX1A 2W9BA 1HYVA 4FCYA 4FW1A 3N6NA 1NK4A 2Y1JA 4KI6A 5KTQA 3FDSA 1TK0A 2R8GA 4RW8B 2W8KA 5J2PA 5T7BA 3TWHA 1SKWA 4IRKA 2HHUA 3QGGA 2GC8A 1TKZB 1FXXA 1JLCA 1J53A 1GOCA 5I3UA 3D5MA 4R0EA 4ZVEA 4IFVB 2FLPA 5KGWA 2AWZA 1FKOA 5CY4A 3WNEA 3MTKA 3PJXA 3L8BA 2Z1IA 4KHRA 4ZMMA 4NCAA 2HNYB 2IA6A 2IM0A 3O4NA 4ED7A 3DLGB 1IKXB 3AO3A 3HHKA 4CEZA 2WB4A 1RT3B 3BGRA 5J2MB 3V1OA 1RA6A 4K8ZA 3U3YA 4CEAA 1NKEA 4H4OB 3HPOA 2DY4A 1WAFA 1BIUA 4B9TA 3IN5A 1VSHA 2HB5A 3NMAA 3OHAA 1RT2B 4NLVA 2XY8A 1JKHA 5C24B 5D3GA 1REVB 4K50A 3AVMA 3KMQA 5F8MA 4E1MA 4DL3A 4OKJA 3PW0A 1GOAA 3KHLA 3HVTA 3HO1A 1JLGB 4W5OA 3HPGA 4KHSA 3K2PA 1NOZA 2QE5A 4ED6A 3WNHA 4TY8B 3OYJA 2G8UA 4KRFA 1XR7A 3SUQA 2HHWA 1WSGA 3Q8QB 3M8RA 2YNGA 4FJ7A 4O44A 2W9BB 1RTDA 2OPRA 5F9LA 3DRPA 4I9LA 4AILC 5L1IA 3CJ2A 3OS2A 2E6LA 1GX6A 2C2EA 3ZCMA 4XPCA 2ITGA 3HM9A 4DWIA 1SH2A 1U04A 5KGXA 5J2PB 4RNFA 4J9LA 1JLCB 2V0NA 5I3UB 3AVIA 4KAZA 1ZBFA 4ICLA 2WK4A 1FKOB 5DG9A 3AO1A 2E4LA 3CWJA 4CJFA 4QWCA 2RKIA 1RTHA 3PW2A 2PZSA 1YVUA 3RR7A 3DRRA 4IDKA 4C8MA 2XI3A 3NGYA 1KHVA 3AA2A 4ECRA 1IKYA 5K14A 1T7PA 3V81A 4JRPA 2C2RA 2BR0A 3BGRB 1BGXT 3CJ0A 4URGA 2OYQA 4LSNA 3BDPA 4FVMA 4FJ5A 5KFWA 3RWUA 4Z4GA 2P5OA 4JUZA 3BQ2A 5DK5A 1Q8IA 3TAPA 3P1GA 1W25A 3V6JA 2JEJA 1X1PA 1VSIA 4MH8A 5D3GB 2D5RA 4CGGA 1S6PA 3H59A 1SL1A 1NKCA 4NLRA 1L5UA 1NK0A 3SPYA 3HVTB 2WOMA 4MK9A 2I5JA 2J6TA 3OS1A 3KLGA 1NJXA 3ZSZA 4CJVA 4ED0A 2XHBA 2PYJA 4CEDA 4O44B 1RBRA 1RTDB 3H5UA 3HK2A 1O1WA 2OPRB 1S0MA 3DRPB 3KLIA 3IGNA 3HVAA 3DI6A 4I2QA 4DL6A 4E7LA 1LWFA 2WTFA 4KFBA 4URSA 4FJLA 5KFGA 5KFAA 2Y1IA 5KFVA 5JS2A 4ID5A 3BSCA 3RTVA 2KFNA 3T5HA 4NLXA 3L2VA 2HHXA 4DTUA 2XCPA 4WYLA 2HNDA 4ICLB 2AGQA 3NGDA 3UIQA 3IGVA 5HROA 2RKIB 1RTHB 5KG4A 4OVLA 4NCGA 3GIMA 3QIPA 1NK8A 3LDSA 3V9XA 4IBNA 3PW4A 4URQU 3DRRB 3S3OA 4IDKB 5EWGA 4FK2A 3CIZA 3V6DA 1U4BA 3ITHA 4KI4A 4DTOA 2ETJA 4MK7A 1HMVA 2B6AA 4NLOA 4O0JA 3MR5A 5I42A 1IKYB 5K14B 2UUTA 3V81B 3NDKA 1BL3A 5KG5A 3BSNA 2IGIA 3TR8A 2JEGA 4X2BA 1N4LA 2G8VA 5KFBA 3CFRA 1A5WA 4ED1A 1D5AA 1JLAA 3U3GA 3IG1A 1T94A 4W5NA 3ZSXA 5F8GA 4GMJB 4BWJA 5EDWA 3QO9A 3O3GA 3RRHA 1S6PB 1T8EA 1MU2A 3HL8A 3HVWA 1NJWA 4F4WA 4CECA 2I5JB 4KHMA 4HTUA 3LP1A 3KLGB 3CFOA 3FQKA 4TYAA 1RNHA 4BE2A 3PJWA 2IDOA 2PYLA 2G8HA 3V9WA 1KFSA 5KT5A 2JC1A 2LSNA 4KV8A 3GIIA 3LAMA 3KLIB 3DI6B 4I2QB 4G1QA 4FK0A 4DF8A 2YNIA 4J9KA 3HSTB 1S6QA 1LWFB 4WYWA 1MMLA 4KFBB 5DLGA 5DGAA 4K4WA 2FBYA 2UUWA 3BSAA 2XY7A 4Z4CA 4ID5B 1VSKA 1FK9A 5KFQA 1SKSA 2VG5A 4KREA 2HNDB 1BI4A 3PHEA 4Y1DA 4FJNA 3NFAA 3MXMA 3M9NB 2XO7A 2OZSA 4EBEA 3KMSA 4KKOA 2R8HA 1S10A 2GUIA 4NCGB 3QIPB 4E1NA 4XPEA 1VSJA 3DOLA 3AO5A 3V6DB 3MEGA 1NHVA 3ITHB 2RDIA 4H54A 4FJHA 4M94A 2B6AB 1HMVB 3NKYA 5KFXA 4ELTA 4O4RA 2X74A 3SFGA 4RW9A 3CG7A 2OZMA 3C6TB 4E7IA 1RT5A 1VK0A 3B6PA 2YKNB 4TQRA 3BQ0A 4MIBA 3IG1B 2CJQA 3QO9B 2XRIA 3LP0A 1MU2B 3NCIA 4KTZA 4CHQA 4AHSA 3CJ3A 2YHBA 3KLVA 3LP1B 1U45A 3LANA 3L3VA 4CGIA 4DG1A 5EWEA 1Z4UA 1C0UA 4E3SA 2E9TA 3VA3A 4KV8B 2W42A 1CXQA 4G1QB 3M9OB 4DLEA 1S6QB 4C8LA 4MQ3A 3KKRA 3RBEA 4ZHRA 1EXQA 1C1AA 2O4GA 1QTMA 1CLQA 3NGIA 2VG5B 4KB7A 1SL0A 4IRDA 4NLYA 4FS1A 1JXBA 1BI4B 2XY5A 5F9NA 4F4KA 3SQ0A 3VQQA 4KKOB 4WFZA 4IH5A 1SUQA 3H2LA 4JS5A 4B3OA 5KFFA 2VWKA 3OLBA 3O3FA 1VSEA 3DOLB 5KFSA 5EWFA 3PZPA 3MEGB 3RBDA 4F50A 3DLRA 3EY1A 4B9VA 2O4IA 3ZT0A 4IR1A 3KLEA 4DTRA 3RB3A 3OHBA 1S1VA 1J9AA 4R8UA 1JLEA 5J1EB 2JC0A 4JV2A 4RW9B 5E41A 3LWMA 2R2RA 1RT5B 5DQHA 4FJ9A 4NYFA 3LAKA 4FZXC 3ZT2A 4FLWA 4LH5A 1RDCA 3JYTA 1KHWA 5HRNA 1JL1A 3LP0B 3IAYA 3QEIA 3ASMA 3RMAA 2ATLA 3L3UA 4E0DA 1S9EA 1LAWA 1ITGA 3OYMA 2DFEA 2Z1JA 3VQPA 5J2NA 4FM0A 3VN5A 4DG1B 1KFDA 1C0UB 3HP9A 2W9CA 3I5AA 1IKWA 4OKEA 3SV4A 4J2BA 4WXOA 4M3ZA 5KFJA 5F8IA 4BE0A 4CJ3A 5KG6A 4ZHRB 3QYYA 4QWAA 4GVMA 4BDPA 3RMCA 4ED3A 4HUFA 3QERA 1S5JA 4YNQA 4IG3B 4DS5A 3KIOA 3PX0A 4J9QA 4K4TA 1KTQA 3PY8A 1SUQB 1TP7A 2FBXA 4B3OB 3M9MB 4FZZA 3AVFA 5DQGA 4DSJA 2HWIA 3PW5A 4M3XA 4KSEB 4TLRA 4M95A 2F8EX 5KT3A 3KLEB 4CK2A 1S1VB 5FDLA 2JGUA 4JLHA 4R8UB 4Y2CA 1LWCA 1JLEB 1D1UA 1I3AA 3QEWA 1OS5A 3K58A 5CYMA 4AHUA 4OKKA 2OPQA 4CFAA 4FM2A 2UVVA 1XR5A 3PUFA 3D45A 3OYCA 4PWDA 5KG3A 1NNDA 4CJSA 2A1RA 3JYTB 1B92A 1IKVA 5KFLA 3QGHA 4CE9A 1J54A 2IM3A 1WSFA 2BE2A 4DTNA 4W5RA 3BR9A 5HP1A 2HW3A 2P1JA 4BE1A 4ECZA 2OPSA 4BWMA 3DYAA 3SQ1A 4OL8A 1T03A 2W8LA 5J2NB 1SH3A 3KNAA 1QAJA 4CHOA 4B9MA 1A5XA 3M8PA 4NLDA 3VQ5A 2W9CB 4Q8FA 4K4VA 4FJXA 1IKWB 3AA4A 3L2RA 3HVRA 4J9OA 5EU7A 1WNSA 1T05A 4DTSA 3GYNA 1NK7A 1RYSA 3TARA 4OLAA 1C0TA 2VA3A 5FRMA 4TN2A 4CJLA 3KD5E 4Y2AA 3ALYA 1NHUA 1UOCA 2RN2A 1WAJA 1KRPA 4M3UA 4FJIA 4NRTA 2D0CA 3TAFA 3G6YA 1HYZA 3TAEA 4LD0A 4XIUA 4TSXA 2HNZB 3H5YA 3DLEA 4DL5A 2KFZA 4ZP6A 1BCOA 2E6MA 2B5JA 3ULDA 4B8AB 4RUAA 2WRMA 3KK3A 1S0OA 4CHPA 2QXFA 3P83D 3QINA 5FDLB 3KOAA 4ELUA 4IQXA 1LWCB 1LAVA 4MKAA 4Z4EA 2EC0A 1RBVA 5CYMB 4CIFA 3L2WA 3FRZA 2OPQB 3LP3A 3MXIA 1LWEA 4PWDB 3E01A 5HRRA 5KG7A 2PY5A 3H5SA 1YT3A 1IKVB 2B4JA 3ZT4A 2V4RA 3DDKA 3M8QA 3SNNA 5HP1B 4Q5VA 2AQ4A 2OPSB 1X9WA 2ALZA 3DYAB 1T03B 5C5JA 4DU3A 1X9SA 4H4MA 3T5LA 1SL2A 3H5XA 3I8DA 3N6MA 4U6PA 2YKMA 5HRPA 5DLFA 2IAJA 3K5OA 3M8PB 4CEEA 1S1WA 4DQSA 4O0IA 4ECTA 5SWMA 4K4YA 5J2QA 4KTQA 4LH4A 3S3NA 1T05B 3U6FA 3AVKA 4HVJA 3D28A 3QEPA 2AX0A 3BSOA 3VQ4A 1U48A 2JLEA 4DFMA 3PW7A 3NF9A 4F2SA 3VQBA 3QNOA 3B6OA 1I6JA 4O3PA 4W5TA 3MECA 2HHSA 4O3OA 5KT2A 4OLBA 3SFUA 1JKHB 3T3FA 2DPJA 1ZTTA 3ISND 3OLAA 5L1KA 3RAXA 1RA7A 2HAIA 3DLEB 3VQCA 4CGFA 3CO9A 1JLBA 4DSKA 2B5JB 4FZYA 2HHVA 3KK3B 4DSEA 2KZZA 3I0SA 3PX4A 2YNGB 4LY7A 4OJRA 2UVWA 2G8WA 2AGPA 3C6UA 3K5NA 4CF2A 4M3RA 2HHQA 3LPUA 4E7JA 3OL7A 4I2PA 4CIGA 4DF4A 1LWEB 4PUOA 3E01B 1RDRA 3SQ2A 1TGOA 3JSMA 4ECVA 1TL1A 3SCXA 3M8QB 4IG0A 5C42A 1RBSA 1T3NA 3LPTA 5KG2A 3O3HA 1XWLA 4H4MB 2YKMB 3UQSA 4CEOA 2IAJB 1XHZA 1S1WB 4NLTA 3CYMA 3RMDA 3OYFA 4CJ5A 3CJ4A 4LSNB 5J2QB 3OYBA 1RAJA 4Y34A 4K4ZA 4ZVGA 1N56A 3PX6A 4DQQA 4LSLA 3VQAA 4CEFA 1ZBLA 4RNMA 1ASVA 4CJKA 3NL0A 3MECB 4F4ZA 3KKSA 2FJXA 3MEDA 1CXUA 1XC9A 1EP4A 4DSLA 5KFZA 1S1TA 3GV8B 4OPJA 4O3NA 1IM4A 1RTJA 1DTQA 4CK3A 2WOMB 1KVAA 3TAQA 1JLBB 3NHGA 1WSJA 3EPGA 3CM6A 4M45A 1S9GA 2DFHA 2IS3A 4CJRA 3I0SB 1HNVA 2E9ZA 4Z4IA 3C6UB 2R8IA 4B9NA 5L9XA 3G10A 1UA1A 4N47A 1RDAA 1WLJA 1KVBA 2OPPA 1K1QA 1JLQA 5CZ2A 4PUOB 1HARA 1SV5A 5KFMA 3T1AA 4O3QA 3JSMB 3VQ7A 4IFYA 1TKTA 1TK5A 1TL1B 4IG0B 5C42B 5HROB 4C8OA 4KO0A 4CFDA 3HP6A 3NH2A 2J6UA 2B43A 4WZMA 1TVRA 3V4IA 4ECUA 1VSDA 3O4QA 3QIDA 4FJ8A 3CDUA 3V1QA 4FBUA 4ZTJA 3PVXA 3A2FA 4N56A 3G6XA 3V6HA 2RPIA 4YR3A 5I42B 2AU0A 1W9HA 4KPYA 3MEEA 3VQ6A 2J6SA 3EZ5A 1GX5A 4QOZB 1CZ9A 3L2QA 4IOBA 4QW9A 4MIAA 4LSLB 3SJJA 1C1CA 4ED8A 2BRKA 3UPFA 3CM5A 2ZD1A 4HCCA 5FRNA 1EX4A 1JLAB 3MEDB 1EP4B 3F9KA 1S1TB 3N6LA 1C2PA 3EYZA 1DTQB 4ZP9A 4M41A 4CGJA 5F8HA 3MR2A 1BCMA 1S9GB 4HCBA 1WN7A 2IC3A 4CJEA 3AVCA 1HNVB 2ZKUA 3T19A 4RZRA 4QCLA 2YNIB 4QWEA 5DMRA 4H8KA 3QEXA 1JXLA 3UDLA 2O5DA 2C28A 4YR2A 1FK9B 1RCHA 1JLQB 3SUPA 2RF2A 2FJWA 3WNFA 3HJFA 4AH9A 1SV5B 4FLYA 2D7SA 4TY9A 2ATQA 2F8TA 5KFDA 4JS4A 3NE6A 4WZQA 1NJZA 2E9RX 4IFYB 1TKTB 2V4QA 3G6VA 2VWJA 4KO0B 3LZIA 1U09A 3I0RA 2UVRA 4DMNA 3NF8A 1ZYQA 1TVRB 2C2DA 3V4IB 4NLWA 2ZQBA 1RILA 3I5BA 4FJKA 1C6VA 1RDBA 1UA0A 1QUVA 2OA8A 3BJYA 5KT7A 2BQUA 3CVKA 2BQRA 4FLTA 3WNGA 4IRCA 4CFBA 3NBPA 4KBIA 3QETA 2AJQA 3SQ4A 1RT4A 2FJVA 5SZTA 1S0NA 1KSPA 2JEIA 1C1CB 4EO6A 3QZ7A 2HVHA 4FLVA 4N41A 4E89A 4CJ4A 1S1UA 1RT1A 3SPZA 4ECXA 2XWYA 1YVFA 2ILZA 3IS9A 3KLHA 4CGDA 1U47A 3HYFA 5KFIA 1ASWA 4WXWA 2VG6A 4ED2A 4J9SA 2XY6A 5F8LA 3OYIA 4ECWA 3AO2A 2QKKA 3VQEA 4CCHA 1U49A 4ID1A 3TI0A 2IC3B 2FVPA 1JXEA 1Q9XA 3CDEA 1K6YA 3KD1E 1A5VA 4M42A 3RB4A 1JX4A 2ZE2A 3QNNA 4FS2A 2BRLA 2R2SA 4R5PA 5KFNA 3QGIA 1D8YA 3DLGA 1TKDA 2GV9A 2RF2B 2IM2A 1LW2A 4CJQA 1HJRA 4RNOA 4ZPAA 1JLFA 4KHYA 4CHYA 4E19A 3NAIA 4N5SA 3BQ1A 4DTJA 3RAQA 2YNFA 4DSIA 2Z1GA 3I0RB 4GW6A 3AO4A 3H4BA 4N76A 4FLXA 3HT3A 3BREA 3NAEA 3TANA 1BHLA 4UQGA 3DOKA 3OYGA 1LW0A 4Y3CA 4EEYA 4KB1A 1S1XA 3NBPB 2D3ZA 4RG8A 1RT4B 1EKEA 4EZ6A 1S4FA 4YMEA 3F73A 4IKFA 4CIEA 1ZTWA 1ASUA 1G15A 1CZBA 1XR6A 1C1BA 1FKPA 4C8KA 1S1UB 1RT1B 2D41A 1IH7A 3OYDA 3PO5A 3NH1A 2W7PA 2X6SA 3IS9B 5CZ1A 4KHWA 3KLHB 1S9EB 2VG7A 4GC6A 2VG6B 4KHNA 1RBUA 5EUHA 3KK1A 3OYKA 1TKXA 1CSJA 1S48A 1RYRA 4IKAA 4DTMA 4EO8A 2QV6A 2OH2A 1IO2A 4LQ9A 3SUNA 3MXJA 2QK9A 3S3MA 3KHHA 2ZE2B 1K1SA 1JL2A 1GOBA 3V6KA 1Z26A 1DLOA 4B08A 4R5PB 1BQNA 3Q8RB 4AHVA 4FM1A 3TQ1A 1VRUA 4EP4A 3KJVA 1S49A 5KFUA 4ZPDA 4WE1A 4ZVHA 1B9DA 1LW2B 3AA3A 4ELVA 1QSSA 1WNEA 1JLFB 4J9MA 4F3TA 5KG0A 2G8KA 2R7YA 2YNFB 4F3OA 4DFJA 2IMWP 2FVCA 3AV9A 4Z4HA 3K5LA 3HXMA 2P5GA 1KCFA 4KE5A 5KFTA 2IBKA 3DOKB 2DPIA 5C25A 5DG8A 1LW0B 3UR0A 1QSLA 3GILA 4KTWA 1S1XB 5KFHA 3MR3A 2GIQA 2XGQA 4DL7A 1NKBA 2HHTA 3TABA 5DG7A 4RNHA 4K4UA 1WSEA 4Q0BA 3I5CA 3OY9A 3TAGA 3SUOA 2BGGA 2R2UA 5L1LA 4B9SA 4CERA 1TL3A 4FLUA 1ZBHA 1C1BB 1FKPB 1QSYA 4QW8A 3OYLA 4DQRA 2FVQA 4J2AA 2ASDA 2AGOA 2IJNA 4F4YA 2BE2B 1VSLA 3DLKA 1L3VA 4AHTA 4J9NA 1NK9A 2VG7B 3EZUA 1EETA 1TV6A 1S9FA 2EX3A 4NYZA 3KK1B 1TKXB 1W0HA 3EPIA 4HUGA 3DMJA 4NZ0A 4M3TA 1HNIA 3NAHA 4FBTA 3VQDA 1DLOB 2D0BA 4JV1A 1TAUA 1HQUA 3E51A 4HYKA 1BQNB 2YNHA 1BISA 1VRUB 4W5QA 3KJVB 4J2DA 1C0TB 2Q3SA 4WE1B 3HKWA 1Q9YA 1NK5A 4TQSA 4O3SA 2W7OA 3DLHA 4FJMA 2G8FA 4DQIA 2F8SA 3ISNC 4MK8A 4IH7A 2XC9A 4EZ9A 4M3WA 2F96A 3OVNA 4QAGA 3RB0A 4U7CA 1N5YA 4RW7A 2WHOA 4RUCA 1L3UA 4DU4A 3DM2A 3GQCA 1RT6A 2VA2A 3OYEA 2FVRA 5C25B 4CHNA 4DEZA 2RDJA 4CJPA 3QESA 1X9MA 1L3TA 1DTTA 2YV0X 4KB0A 4YQWA 2D0AA 3ZT1A 4Q0BB 4F4XA 3NF6A 5HBMA 1TL3B 3C94A 3H08A 1D0EA 3ICLA 4EP5A 5JXSA 4FXDA 5KFPA 1N48A 5JS1A 3DRSA 1YTUA 4HUEA 2QKBA 3KK2A 3OJSA 4KHUA 3QZ8A 5KT6A 2W9AA 4DSFA 1SKRA 2Z1HA 4XO0A 1Z25A 4F8RA 3DLKB 1QHTA 4NLSA 3D0PA 3FFIA 1EETB 1TV6B 3SYZA 3H40A 3KHRA 2IM1A 4FLZA 1UWBA 4DFKA 3QLHA 1VSMA 3DMJB 1S97A 3THVA 1HNIB 5KT4A 2FBVA 4K8XA 1NK6A 3SV3A 3C95A 4E7KA 5HRSA 1HQUB 3G86A 2YNHB 2FLLA 3AVGA 2FC0A 1TAQA 4MKBA 4FYDA 5KFRA 3GV5B 3MR6A 4DLGA 4DL2A 5FROA 1IG9A 2BANA 4C8NA 2JEFA 4HHTA 3OYHA 5KI6A 3C6TA 1QS4A 3VQ8A 3PO4A 1QE1A 1BIZA 2YKNA 4RW7B 1N5YB 3AVNA 3OSNA 3K5MA 4J9PA 3DM2B 1RT6B 2P51A 3M8SA 3OSPA 2DTUA 2DFFA 4JRQA 3S9HA 4RU9A 4OGEA 4Z4FA 4LQ3A 3Q8SB 1DTTB 1BQMA 4Y1CA 3VQ9A 3LP2A 3QEVA 4Q8EA 5KRTA 5HBMB 4I2PB 4RNNA 1NOYA 4NCBA 2UVUA 3MFHA 1QAIA 4ECYA 4FK4A 4YR0A 4GC7A 2A1SA 4L8RB 3DRSB 3KK2B 3CQ8A 1HQEA 1RDDA 5DGBA 3SZ2A 4Q43A 2FBTA 1XHXA 3AVHA 4TYBA 2R8KA 4I7FA 4K4XA 3FFIB 1YTAA 4QWDA 1RTIA 2ASLA 1UWBB 2C22A 3AVBA 2X78A 3QLHB 2R2TA 3RB6A 4CEBA 1VSFA 5KFCA 4B8CA 1HYSA 3V9UA 2R8JA 3HPHA 3KLFA 1HRHA 3OL9A 5HLFA 2X6NA 4YP3A 1UAXA 4NRUA 3NH0A 3AVAA 3FQLA 2GIRA 1F21A 2G8IA 4NLUA 3KTQA 3TAMA 1WSHA 4B9UA 2GBZA 1HPZA 4RW4A 4ZP7A 3V9SA 4AHCA 1QQCA 3RMBA 2BANB 1VRTA 1RTJB 5J1EA 5L1JA 3ZSOA 3LZJA 4KHQA 2CKWA 4KAIA 3CJ5A 1C0MA 5F8NA 3OL8A 2BQ3A 3AVJA 4ZTFA 4B9LA 3GV7B 3OJUA 1NJYA 3OL6A 4OGCA 4CJWA 3MAQA 4BDYA 4NLPA 1QE1B 3K59A 1I39A 1B9FA 3NGZA 4FJGA 4MFBA 3RRGA 1N6QA 3RR8A 3P5JA 2I1RA 2KZMA 1XI1A 1J5OA 4PY5A 4PQUA 4O4GA 4G3IA 2D3UA 4O3RA 1BQMB 1JIHA 4IR9A 1LV5A 3PR4A 4CF8A 5DQIA 3LP2B 2FLNA 1KVCA 2OPPB 4RW6A 4EBCA 4DFPA 1KLMA 4CFCA 1KLNA 4ZPBA 3AVLA 1RT7A 3KHGA 3H4DA 5CYQA 1HQEB 3GIJA 4CESA 5KG1A 3ZSYA 4I7FB 2WCXA 4EYIB 5T14A 4TXSA 3AA5X 3ZSRA 2YHAA 1RTIB 4QWBA 3LALA 3PV8A 4ZPCA 2NUBA 1R0AA 4CJUA 3IRXA 1WSIA 4IG3A 3T5JA 2ASJA 5KFYA 4BACA 3H98A 4CHZA 3MEEB 1HYSB 3TVKA 3KLFB 5F8JA 4F2RA 1D9FA 4CF1A 4NLGA 5HLFB 2HWHA 2WONA 2XCAA 3L2UA 3DLBA 2ILYA 2HMIA 4ECSA 4QPXA 4O55A 3CDWA 2HVIA 3Q8PB 2ZD1B 3TAMB 1HPZB 4ECQA 4RW4B 2BDPA 4K4SA 5KFEA 5JUMA 4IH6A 3K57A 4JV0A 4PA1A 3SI6A 1VRTB 3VA0A 4AHRA 4RW8A 4EYHB 4ZP8A 3OYAA 4CF9A 4J9RA 3PR5B 1TKZA 4MFBB 2FVSA 2IJFA 1N6QB 4DTPA 4IFVA 1J5OB 4PQUB 4O4GB 4Q45A 4ZVFA
chains in the Genus database with same CATH superfamily
1FD8A 3N4QA 5LMNK 5KFOA 1E4GT 4DR1J 2EXUA 1IVZA 1NZ8A 3HRGA 2VQFK 4OV6A 1HNXK 4NYNA 4YFUA 2FJEB 3QWUA 2IOCA 2RJZA 3M6UA 5KRSA 5CYQB 2C42A 4IEEA 4LF6F 5J2MA 3GIKA 2M8DB 3BKTA 1UETA 4WFYA 3M2VB 2V52B 3ISZA 3OYNA 3OW2M 4DMZA 1EKSA 4O5BA 4A8XA 3ZZOA 1D9DA 1X4BA 3R7SB 1XIQA 1ZBIA 3VZIA 3ZT3A 4CT8A 3G0ZA 5KQ8A 4ZLPA 3L7OA 4PG8A 3CC2S 2B4PA 3VOVA 2HNZA 2KW4A 1JLGA 3A8YA 1H7XA 3CGIA 2WSEC 3G8TA 3T5KA 4HACA 5KOWA 2AJ2A 1JJCB 4DV2J 2AX1A 2DYAA 2DGSA 1HKGA 3FEYB 3N6NA 1PYSB 2CNNB 4AXJA 1KC8O 2FC9A 5T7BA 4IRKA 2HHUA 1M1KT 2GC8A 3W9IA 2POKA 3GCWP 4R0EA 4DPUA 5KGWA 4IFVB 2RE1A 4USMA 2E8AA 2YWFA 1FKOA 4OPHA 1REGX 4KGZB 1SAZA 2RHSB 4JI7F 2FYXA 2HNYB 4NCAA 2IA6A 1OSDA 1FHTA 2IM0A 1LCUA 4ED7A 4DV7F 1IKXB 5JVGQ 2GO9A 3WQPA 3HHKA 3I55N 2WB4A 3BGRA 4CZCA 3C6AA 3RGIA 1SS6A 3U3YA 3MAAA 1YBAA 1RAOA 2G4BA 2DY4A 1SJ1A 1U1PA 3UE5A 4HEA9 4G1PA 2HB5A 5BYRA 2Y9HA 4JKBA 1RHMB 3CCSS 3R6LB 1REVB 4DL3A 3NWGA 3VHQA 3HVTA 1NOZA 4ED6A 3WNHA 3H7HB 4TY8B 2CQ2A 2G8UA 1XR7A 3A8EA 4BC2A 5SUHA 3SUQA 2W2PP 5DDPC 2ZZNA 1WSGA 1VBYA 5KPTA 4O44A 1TUVA 2W9BB 2L48A 5F9LA 2P5VA 4I9LA 3K89A 3BO2A 5K5MA 2EW9A 5L46A 3R7BB 5FD1A 2D3OR 1GLAG 1G3OA 1NPKA 1WSRA 3MMJA 3VAHA 4DR4K 3VENA 3QT7A 1RWUA 3W5YA 1HHSA 1UEUA 3PIOQ 1JLCB 2VL1A 3AVIA 3T69A 4LF7F 4ICLA 3DXMB 5M1OA 5DG9A 3AO1A 1OPIA 3GG1A 1Q1KA 3W2WB 3PYEA 3PW2A 2PZSA 3ZETA 3DRRA 1QZ5A 2D1KA 3G2XA 3ENQA 1FXRA 3H1QA 3BBCA 3BKFA 4ZVOB 3AA2A 4K43A 2CVEA 2ZH4A 3CDAA 3HFKA 3CJ0A 3LTOA 4BR9A 3GMGA 5BYSA 1NGFA 4X65F 2UXCJ 5KFWA 4DQ8A 1VK3A 3H45C 2MGZA 4JUZA 3MN6A 2QWPA 2YPYA 3CJKB 5DK5A 3MN5A 1Q8IA 2GGPA 4GY2B 1H2TZ 4JI0F 3C8YA 4AT1B 1W25A 4DR6K 2OMOA 4MH8A 4CGGA 1SL1A 1T9XA 2MQOA 2DH9A 1NK0A 4GVEA 1WC0A 4MK9A 4BHQA 2J6TA 2GEMA 3KLGA 1UEVA 2A0FB 4ZN3A 1RHJB 3MMAB 2PYJA 4CEDA 1RBRA 1RTDB 3HK2A 4CBUA 1S0MA 4JKHA 1BWFO 3KLIA 2XMVA 3HVAA 5IT0A 4DN9A 1Y7PA 3BZKA 4KFBA 1R0BG 1JNRB 4OYIA 1EX8A 4K0KF 1RWKB 3BSCA 3RTVA 3G82B 3W2VA 4DUYK 2PO4A 2V4JA 4DU7A 4BC3A 3HHLB 5KG4A 4J5OA 2E2OA 3ZTSA 3LDSA 3B8AX 4IBNA 4URQU 4IDKB 2IHR1 4LR9A 4FK2A 1N32K 3CIZA 3V6DA 2UZAA 3ITHA 4KI4A 2CPXA 1LEOA 4DTOA 2BBEA 4MK7A 1IKYB 2PBDA 4OX7A 2HFUA 2CG4A 3BSNA 2VPWB 1SPBP 4DV5K 1X4GA 1N4LA 2LQ5A 5JICA 4GVBB 4O0NA 4ZVPB 3O9RA 3M4XA 4JKCA 1B99A 3MD1A 1M0SA 3U3GA 1CZAN 1KKHA 3JTOA 1OVYA 3RRHA 3EN9A 5IOLA 4B3RK 4CECA 2A40A 4HTUA 3LP1A 2H3GX 2HS0A 3Q7BA 2MY7A 3FQKA 2F5GA 1QQOA 1Y0HA 2GUPA 4OO1J 1KFSA 3L6QA 5MLCQ 4USWA 2JC1A 5KT5A 2LSNA 3GIIA 2OMLA 4I2QB 2AYEA 2CZ9A 4FK0A 4B1WB 1LWFB 7FDRA 4KT0C 4X4OA 1BHNA 3D4JA 2XY7A 3PFOA 4F3QA 5EHHA 5C7PA 3VGUA 4QYZJ 4ID5B 2EG1A 4M5NA 4PXBA 4C48A 5KFQA 4J91A 5IWAK 3THYA 1SKSA 4A46A 3LDOA 1AA1B 4JAXA 3LA0A 2HNDB 3G6ES 4FJNA 4K5RA 3NFAA 2XO7A 1R43A 1WELA 4NCGB 1PKUA 3LDNA 3TX8A 1WORA 2DT9A 1SBRA 5E26A 4H54A 3BV8A 4FJHA 1HMVB 5FPDA 2H48B 2DRAA 5LM7E 2LQJA 3IWXA 2MQQA 1H1VA 4JI4F 1VFJA 4UZBA 3T6BA 2M8HA 4ELTA 3GOIA 1VJWA 3SFGA 4RW9A 2FZCB 4WKYA 3FZHA 2OZMA 3D1QA 4RBTA 3U1LA 3VGMA 3B6PA 4DR7F 1UVNA 3ELHA 1LFPA 3TZZA 3IG1B 3TX0A 4ZLJA 4CHQA 4AHSA 3TUPA 2VFRA 4R0JA 2VBXA 2UXDK 1WC1A 4B1VA 2JSXA 3Q22A 3THWA 4DG1A 2KLAA 4WJBA 1CJTB 4ZPTR 4E3SA 1K73O 3AJDA 4KV8B 1CXQA 3D2EB 3OVSA 3QQCD 4G1QB 4DLEA 1S6QB 3KKRA 3FBBA 3RBEA 1C1AA 3KZBA 3RRKA 2VG5B 2K7JA 2BE7D 1SL0A 3JXOA 4NLYA 1HPMA 1V3ZA 4RU2A 4WFAL 5F9NA 4F4KA 3VQQA 5HL7L 2AV5A 4KKOB 3CD6N 3H2LA 5A0YB 3GDQA 4HH0A 3O3FA 2RUGA 2L41A 4MMOA 3OHRA 2ITMA 1FJGF 3MHYA 2P9CA 4P9SA 3QJLA 3C6HA 5IT9U 2J7KA 5L38A 1YWXA 1U26A 3ZT2A 3O9SA 1R7IA 2OANA 1TFYA 4CRJA 4DUZJ 5HRNA 4J9VA 3LP0B 1JCFA 2P9UB 3P6YC 1P8ZA 3ASMA 2ATLA 3GE1A 3MURP 2QWRA 1LAWA 1ITGA 3J7Z5 3VN5A 2Q43A 2FJBB 2YQ3A 1KFDA 2HYIB 2W9CA 1O0PA 2RHKA 1F5AA 1IKWA 1HHQA 4BE0A 5HAOA 5KG6A 3TQEA 2C2KB 3D54A 2M0GB 1B7YB 3AXMA 1AFJA 4DR2K 4N77A 3U7JA 3QERA 1S5JA 4IG3B 4DS5A 1VHXA 4L3NA 3LPEA 2CAJA 3KIOA 2QLWA 2AYMA 3I87A 2IVNA 2W4PA 3GSDA 1Y11A 5HVHA 2AYBA 2FBXA 4B3OB 4J37A 1VIOA 4JI2K 4M3XA 4A47A 4KSEB 4X66F 1Q4RA 3GJQB 3KLEB 3EGWB 2EK6A 4Z37A 4CK2A 1YRXA 3VWSA 1IBMK 2X1FA 4B9QA 4Y2CA 1LWCA 1JLEB 4RTFD 1I3AA 2RH3A 3AAQA 2RNEA 2I7NA 4NL5A 2DHGA 4OKKA 3VMFB 1XR5A 5L39A 4DR5K 2P9IA 3KHYA 3JYTB 1MN9A 4OV1A 1WSFA 3P5TL 4O23A 5D0GA 1J5EF 3ATVA 5E5NA 2ADBA 2HW3A 4EGLA 3LGMA 4M5KA 2GCFA 2IJRA 4BBYA 1UW9A 1ZAVA 1SH3A 1U8SA 5F41A 3B54A 2CQ4A 4OQJA 3CD7A 3VQ5A 4FJXA 3AA4A 1CC7A 3IC1A 1WNSA 3HTVA 2O8DB 4PG6A 3MM9B 4BC7A 3CIMA 4FWQA 4OLAA 2VA3A 2UUAF 4GO5X 3R7NB 5H1SQ 1OKJA 4PPZA 2F8MA 3TA1A 1NHUA 1UOCA 1KRPA 4OZ0A 3CCRS 5LMNF 2QW9A 5BR8J 2D0CA 3TAEA 5FJ4A 3R3TA 2HNZB 2YH1A 3DLEA 2D0PA 2ASYA 5ETTA 3PLAA 4ZLNA 3KK3A 4HACB 2O8CB 1V9OA 2QXFA 2D9OA 2QIFA 3K17A 2DHSA 5IZHA 3P83D 4AM6A 3HSZA 5AQIA 1OY8A 1EWQA 1SC3B 4LFBK 2ZH6A 4ZCIA 1RWVB 2J9EA 2DTJA 2WUSA 5CYMB 4CIFA 2OPQB 1KONA 5EGYA 4Q2LA 3VGTA 1NDPA 4FO0A 2XS7A 3TVYA 3M8QA 3KK7A 5E3RA 2MKJA 4Q5VA 2AQ4A 3CC7S 4C0OC 2OPSB 2CJAA 1T03B 1BE4A 2ZC3A 3AGRA 4H4MA 4PR6A 3OBYA 3I8DA 3GTYX 4U6PA 2YKMA 5LJWA 5DLFA 3NGTA 4ZJOA 2J0XA 1YHQS 5SWMA 4YOTA 3AHPA 2R7SA 4EHUA 5J2QA 4LH4A 3U6FA 3MAAB 2AX0A 1U48A 3VQ4A 1DQAA 4DFMA 3PW7A 4F2SA 3UN5A 3NRBA 2DXFA 4W5TA 4JI5J 1FJEB 4YB5A 1TU0B 1WEYA 1HX1A 4LBHA 4X62F 2N7YA 5E33A 2DXEA 2DR5A 1UPPA 2GQCA 1S12A 4K41A 4U67Q 3PYGA 2HHVA 1HNZK 3THTA 4H0VB 2GAHC 1WHWA 3KDNA 4DR1F 1XMOK 4YOVA 3G96A 5GMKa 2G8WA 4F0HA 1UVKA 4L73A 1S6UA 1YKWA 3AQPA 4X4QA 2DRBA 4DF4A 1LWEB 3E01B 5AFUA 2B9WA 3ZZYA 3QT6A 5C42A 2P9PB 2YCHA 1TMMA 3G8QA 2CPHA 2CDQA 2H4WB 5A2QU 1SC6A 2O8EB 1S1WB 3R1LA 3RMDA 3GFYA 3ZC4A 4HTLA 2AKWB 3S8SA 2E5GA 4X4TA 2GA7A 1VI7A 3JTPA 1UCNA 3M1FA 4LSLA 4CEFA 1F6TA 3P96A 4HI2A 2OSRA 2VU5A 2WSFC 1FJCA 1K8KB 2HRTA 5KFZA 3OTEA 1PIEA 3HHEA 3WQUA 5D0HA 2ZWPA 3NHGA 1WSJA 3JS6A 4M45A 1S9GA 2QA4N 2EFVA 1VQSA 2B56A 3I0SB 3DGPA 4U8YA 2NNWA 3I4HX 2F7VA 2E9ZA 3C6UB 1GT8A 1I94F 1J27A 1VQKS 1MDUB 4OYZA 1ESVA 5KFMA 2MHEA 2FHOB 2ZM6J 4UY85 5JMVA 3JSMB 4CM2A 4CBXA 1WDTA 3BEGB 1TL1B 4A8YA 3FSXA 5CHCB 2B43A 4FPAA 4A4JA 4ECUA 1VSDA 3QIDA 4FJ8A 3E8OA 5BPMA 3A2FA 3G6XA 1SXLA 2XWXA 1SQEA 2RPIA 1YTYA 3C16A 5C0YA 2ZBCA 3HDSA 1X60A 1W9HA 1LQ9A 1SI9A 4M5DA 2J6SA 3J7ZT 5AQFA 3EZ5A 1WHYA 4IOBA 1HBMA 2VB6A 4RCHA 4TU8A 4DUYF 2LVWA 2BRKA 3CM5A 5B8HA 2OIHA 2E1YA 3DAWA 3MEDB 3NCQA 3N6LA 3TTFA 1C2PA 2HVDA 2Q1NA 3EYZA 4OLOA 1FE0A 1RJJA 1N32F 4CGJA 5CAAA 5F8HA 1X5SA 5FPMA 1LOUA 1WN7A 2B3TB 2KVQE 3DLLQ 2IC3A 3HMJG 3R6GB 3AVCA 4DV5F 2IBOA 3W0LA 4QWEA 3UDLA 4BC4A 3H2UB 2UUCK 2RSQA 2O5DA 3UO0A 1RCHA 3PACA 2DD8S 4HI1A 4FLYA 3NE6A 1NJZA 1QVFM 3OUYA 2B7CB 3X3UA 4IFYB 1TKTB 3BF1A 1VQLN 1WJ9A 4NI2A 1TVRB 3ZXWA 2C2DA 3V4IB 4C1NK 1RDBA 2V7YA 1QUVA 5B09A 2FC8A 5DRKA 5KT7A 2J0WA 3CVKA 4KBIA 3HD2A 1RT4A 3KUHA 5HO4A 2G0IA 1IBLJ 1PYTA 2L9DA 4OYOA 4LRAA 2FSJA 4P2SA 4CJ4A 2XZTB 1RT1A 3A13A 1QHAA 1XN9A 3L4QA 1YVFA 2Z56B 2H9ZA 2J5AA 5DJBA 3Q24A 2ILZA 4CLFA 5T41A 3ZZUA 4C11A 2NSBA 3ZEUA 5KFIA 2VG6A 1YBTA 1M5OC 3AO2A 4FOIA 4CCHA 3MXHP 4KH1B 1NJIO 2FVPA 2OEMA 1JXEA 3SCJE 5I9EB 1X4HA 1IWGA 1K47A 3I6PA 2YTCA 1NG9A 4EFHA 4FS2A 3I8BA 2R2SA 3GFZA 5KFNA 1D8YA 5AQZA 1NPRA 3DLGA 1TKDA 1T44A 2GV9A 2OTJN 4CLWA 2C2ZB 3AAPA 4CJQA 3KJNB 4ZPAA 2PEBA 3GZ7A 1YJTA 4E19A 5AQLA 2YJEA 2YNFA 2VPYB 1HD1A 2HSEB 2UXDF 4I64A 3AO4A 3H4BA 1BOTO 1U6BA 4CYUB 3QGPA 2HEKA 3MN7A 4FWPA 3NAEA 3B8HA 1BHLA 3J80Y 2Y0BB 2D3ZA 3QNWB 4FKYA 5T7LA 2HQFA 3SAHA 2A18A 4EZ6A 3T7ZA 4P10A 4DV3F 1X4EA 4CIEA 1FFGB 1G15A 1XR6A 4RWWA 3L4BC 3ZX0A 2D41A 1XMQK 3OYDA 1ZPWX 1N34J 5JMNA 4BRHA 1KVIA 3IS9B 1U1LA 2NR0A 3MN9A 3NVMA 3IAS9 1NHKL 4DPOA 4KHNA 5EUHA 4K42A 2ASMA 2MQNA 3SQOP 3KK1A 2CH6A 4BRGA 3OYKA 2YKPA 4DTMA 4RBVA 1WOQA 3VALA 2DGQA 3MR7A 2OH2A 5ADXA 4RUBA 3ENBA 1N88A 1IO2A 2FHKA 2ZE2B 3OTOF 4FM1A 1DHMA 2PD1A 1W2BM 2UU9K 1VRUA 3DC2A 1M90T 3KJVA 4WE1A 2J9DE 1BC6A 1QSSA 2IVOA 1WNEA 2V8GA 1YJNN 1TL4A 4F3TA 1ZAWA 1XQSC 3GLJA 2BABA 5CQGA 2O8FA 1MN7A 3W66A 3VAJA 2Y0SD 1WC4A 4Z4HA 3SCKE 4B1UB 4J8FA 1SJ3P 5KFTA 4CZJA 3L7UA 5M1QA 3DOKB 1ACMB 2DPIA 3UR0A 5EX0A 4OJ1A 2NSCA 1U7LA 2C3UA 5KFHA 3C7NB 3TU5A 2GIQA 4OYWA 2OSQA 2FF6A 3H6EA 5DG7A 4K4UA 4DR2F 1WSEA 3OY9A 3P4UB 4ZKAA 3CCMS 2BGGA 1F2HA 4B9SA 4CERA 1TL3A 4DV2K 4FLUA 1ZBHA 3EDQB 1P1LA 1QSYA 4QW8A 3CMES 4QU6A 5GAEI 2P9IB 2WTUA 3C65A 4FSVA 4J2AA 4USTA 2ASDA 2IJNA 4F4YA 2CQHA 4PQAA 2KH9A 1L3VA 2QLBB 3CNQP 1NMDA 2EX3A 3FZ2A 1TKXB 2ZGZA 4KHPJ 3HHDA 1IBMF 1W0HA 1RHQB 4HUGA 1VQON 2ACMA 4LSZB 3N5FA 4CLPA 5EY4A 2D4WA 3E51A 2EWHA 3CCEN 1IM6A 4DR5F 4J2DA 1VQ5N 5AQTA 3HKWA 1CJVB 3MEKA 4BROA 1FTRA 1RAHB 4FJMA 2NRVA 3CDBA 3DN9A 2XC9A 4EZ9A 5DDOC 1X4FA 2F96A 1WBDA 2EPIA 3CTRA 4DUZF 3MPDA 3OVNA 4QAGA 4H5VA 3RB0A 4U7CA 2HZAA 4RUCA 2VA2A 3E1YA 2ZDPA 2QA4G 4UY8T 3OYEA 4OX9F 2FVRA 2HFZA 4CJPA 1D4XA 2FHJD 3SK3A 2YV0X 4YQWA 2D0AA 3EGVA 5HBMA 2XBPA 2YWGA 1FERA 3C94A 1HR0K 1UW4A 4FYXB 2B9YA 1N33K 1HBNA 2UP1A 3ICLA 1EKRA 4EP5A 1WC5A 1D3WA 5FPNA 3OJSA 1ZC6A 2VQEJ 4K59A 4LUBA 2W9AA 1VAZA 1SKRA 4XO0A 3O6QA 3Q8VA 4B3SK 3AOCA 2AF6A 4PYDA 4YY3J 3MZIA 1TV6B 3IBWA 1UFLA 4LFCK 3CCLS 4FNIA 2Q97A 1UWBA 2QZ8A 2CH5A 2BJ7A 2QWNA 1S97A 3UKUA 4ZOSA 3HZ6A 5KT4A 1Q82T 1S7IA 1XNQJ 3I82A 3SV3A 3CCJS 4DCPB 5BXIA 5HRSA 2MZJA 1HQUB 2FLLA 1FTCA 4HT7A 5CE3A 4MKBA 4FYDA 5KFRA 1CS4A 4B17A 3EEQA 5FROA 4HL9A 2BANA 2MZQA 4NXNF 1CULB 4U95A 1NGJA 1N36J 2CJBA 3D9BA 4EIAA 1RT6B 1UAWA 4JRQA 3S9HA 4OGEA 2KXHA 4NLCA 1DTTB 3HULA 3O3LA 3LP2A 2R42A 1NNEA 1VQPS 4PG4A 4NCBA 1QAIA 4ECYA 3L9ZA 4C4WA 4CP5A 3HF5A 4QS9A 4X4PA 3CQ8A 3Q8YA 4GV6A 3SZ2A 3RAMA 3VTIA 4Q43A 2FBTA 2G1DA 3KKFA 1VC6A 4I7FA 1JJ2M 2DHHA 3FFIB 1HNZF 5GAHP 2GX8A 1Q79A 5M2RA 3K9JA 1XMOF 3CJBA 4HLBA 4CEBA 2I38A 4P2MA 1VSFA 5KFCA 4L6V3 4A8SA 3KLFA 1BO5O 2CPIA 1FRKA 2MKKA 3AVAA 2BMBA 2GIRA 3SSSA 1WC3A 1BA1A 1EQ0A 4NLUA 3KTQA 1TELA 4R79A 2ZJRQ 1U2RA 4FXVA 1UFKA 4WF9Q 3V9SA 3VEYA 2J8AA 1HD0A 4DCHA 5J1EA 3LZJA 1QY7A 4ZTFA 3GV7B 3A1YG 2BW2A 3CCVS 3FEXB 1WSVA 4MYUA 2GHPA 1XNRJ 2O8BA 3TJAA 2I1RA 2KZMA 3VAMA 4TU9A 4C98A 4O4GA 2QWMA 2D3UA 5LL6d 3FEZA 2PFDA 4IR9A 5H9EJ 5DQIA 4JKEA 3CPWR 2FLNA 4RW6A 4O8UA 4DFPA 3FFKB 1KLMA 1KLNA 4WQ5C 4ZPWR 1NGAA 3J81U 1KC8T 1NXIA 4ED5A 3GIJA 4CZIA 1R8CA 1K0TA 3R1XA 1XMBA 4DX7A 3UVJA 3M8YA 3ZSYA 4QYZK 1W7AA 1ZM3A 1V5IB 5C2FA 1RTIB 4CVNE 2NUBA 1R0AA 4CJUA 3IRXA 5LJ3Y 2BJ1A 3T5JA 3CMAS 2AP6A 2Z2ZA 2FUG9 1HYSB 2GMJA 2FLOA 3TVKA 4F2RA 3MI7X 4NLGA 2KRRA 2WONA 3DLBA 2QG9B 1N5SA 4XDDA 3IRWP 3C14B 4ECSA 3HKZD 3CDWA 2YY3A 2MHNA 1HPZB 3GL1A 2ABYA 4CLUA 3K57A 3UD4P 3WC0A 2MZ1A 3DXKA 4RW8A 4EYHB 3L7PA 4LF4J 3FRYA 2LDYA 3PNIA 1FWPA 2WVCA 5G0RB 3PR5B 1TKZA 4MFBB 2FVSA 4YS2A 3D1HA 3GSIA 1LK5A 2BJDA 3TO8A 4WIQA 2EFGA 3EKSA 4FL9A 2YWHA 4JI1J 2X3DA 3MCOA 1M5PC 3DLJA 3LWLA 2XI2A 3MCNA 4USIA 4DJBA 1U2VA 4EBDA 3FSIA 4CH7A 4A59A 1T3OA 2CVIA 1CJUA 2W4DA 4OPKA 1RWOB 4NB4A 1ZBUA 3M8ZA 1BG3A 1O51A 1RKIA 3MMBA 4RJVA 4FW2A 2EHGA 3J7A1 2VFSA 2GHVC 3LGNA 1W7WA 3WUHA 2K3IA 1NB7A 1RT2A 4WU2A 1KQGB 5C24A 2FGOA 4CEQA 2F65A 1PILA 3BM7A 3JQMA 4MT1A 1RAGB 4CF0A 3HBTA 2V9WA 4DL4A 1QTNB 2L9NA 4J2EA 3VPZA 1OH6A 3IKMA 3ZSQA 4H5NA 3M2RA 3HHLD 1RHRB 4KGKA 2OUGA 1G7CB 1RTZA 1TK0A 2R8GA 1FWKA 4H0YB 1BDGA 1TZ0A 5J2PA 4RLEA 3TWHA 4FOEA 4CZGA 3GYGA 2NXCA 3QGGA 2WVFA 1FXXA 1GOCA 5I3UA 2FLPA 2AWZA 2ASPA 5CY4A 1GMVA 4PXCA 1AW0A 3CPEA 3VV2B 3NNAA 4HWIA 2HPUA 4FNHA 5GADP 2Z1IA 1W97L 1TL7A 5AQRA 4AM7A 4V19J 3O4NA 3DLGB 3MCSA 5AQYA 2P9KA 1RT3B 2H5IB 3T1YK 4C1NI 1WG4A 4CI0B 2C3MA 4KQZA 1WF1A 1KAZA 4CEAA 1NKEA 4H4OB 2R9LA 1ZZNA 2CYYA 1GLJO 3UCUP 2IRUA 4H03B 1BIUA 4B9TA 2WFBA 3NMAA 4NLVA 4CNYA 4G65A 4DB3A 5LL6Z 1XK8A 2GWJA 3KMQA 3PW0A 1GOAA 3KHLA 1P8GA 4ZITA 2QE5A 3M6GA 2WBRA 3M5RA 1NEEA 2CPFA 4M5GA 3R1HA 1JJ4A 2ERRA 5AQSA 4FJ7A 3WEEB 2MB0B 1B0VA 4AILC 4DV6J 1FJ7A 3CJ2A 3OS2A 1GX6A 2AW0A 2ZITA 2ITGA 4DWIA 5KGXA 3K8WA 3VEZA 4AL6A 2JVRA 4RNFA 1UWAA 5CD4A 3HOTA 2V0NA 4K7QA 4KAZA 3U9DA 1ZBFA 5LY3A 3I32A 2HSTA 1YI2S 1U25A 1VQPN 4LIWA 5LMUJ 2RKIA 5HVGA 3OFHA 1YVUA 3RR7A 5E0OA 1KD1O 3TSPA 1KHVA 1FNOA 1T7PA 3V81A 4JRPA 2C2RA 2BR0A 4CBWA 1URNA 1KOOA 4PPDA 4FVMA 4FJ5A 4PKDB 3R97A 3OVAA 2Y3YA 1R89A 1AT1B 3DU5A 5M2PA 1KTVA 1S77D 3TAPA 3P1GA 2BA9A 4I6AA 5BR9A 1X1PA 1VSIA 4LF5K 5D3GB 2D5RA 1NKCA 4OHYA 4NLRA 1E6VA 2WOMA 3OS1A 4ZVQB 1KAYA 2AJFE 2OKQA 3ZSZA 2XHBA 4GKJK 3DKDA 3MM5B 2W2QP 2OPRB 3DRPB 2VJUA 3QFWA 3DI6A 4DL6A 3RW7A 3AARA 4ANDA 4E7LA 4ZVRB 2WTFA 3TRGA 4URSA 5KFAA 4WFNL 5AQPA 1YGYA 2PAVA 5JLHA 4M7XA 3VR1A 2CPYA 2KFNA 2XNQA 3MPWA 3T5HA 2HHXA 4UZCA 2CWXA 4WYLA 1OH7A 1B3TA 5M1FA 1RTHB 4W90B 4OVLA 3UCZP 1NK8A 3QIPA 1RI7A 3MAHA 4QIGA 3QSIA 2FZKB 3NOGA 4Q7AA 3UN3A 4ZCMA 4RWTA 3E9PA 2B6AA 3MR5A 1OY9A 5K14B 2UUTA 4RWXA 1PSDA 4WTYA 4EHTA 4H0TB 3V2UC 3QDKA 3TUZC 5D77A 2W4CA 1N34F 4LF6J 3FGVA 4NMXA 4ED1A 4KH6A 2JJ4D 1Y5LB 2D3O1 1NBWA 3QAEA 2K1RB 4BWJA 5EDWA 3O3GA 1S6PB 3WQTA 1MU2A 1M5VC 3HL8A 3EUNA 2JLFA 3U02A 2I5JB 2OJ3A 2P8IA 4A62A 4TYAA 4WP3A 2MJUA 1RNHA 4BE2A 3PJWA 2IDOA 2HK2A 4PHTX 4GKKK 1SQFA 4ANEA 1RQ0A 3AFGA 4W92B 1ZH5A 4J9KA 4WYWA 3KJFB 5DLGA 4K4WA 4LF8K 3CETA 2QLJB 1FK9A 3FZKA 2CJXB 4Y1DA 3PHEA 3ZZ0A 4Y2KA 2V8PA 3DOMB 3M9NB 3CJ1A 4NXMK 4OMFG 3KMSA 2R8HA 1HKCA 2ZJQQ 2VPZB 4E1NA 1HR0F 2DH7A 1N33F 4FKXA 4TLQA 2NREA 3MEGA 2JVOA 1JJ2R 4M94A 4ZPVR 4NPOA 1CS4B 2CIMA 3BF3A 2YHYA 3W63A 3MMVA 4B3SF 4DV7J 5AXMA 2J0SD 1KNZA 1RWWB 2X1BA 3BH6B 1ATSA 4PAAA 1FNXH 2X74A 4YHHK 4BY9C 4JD2A 3AD8C 1PC5A 2V50A 1UVIA 4E7IA 1EO1A 4TQRA 4AL5A 1UKUA 1EHWA 4MIBA 5HMYA 4JHDA 3QO9B 2VBWA 4XEIA 2D69A 1YIJS 1V4TA 2YX4A 1WUUA 1QDUB 3KLVA 2VOPA 1UJ5A 3LANA 4A57A 4JI8K 3U1MA 2RE2A 4ILHA 2UXBK 2KB2A 2AJ0A 1FFWB 3H90A 1VQ9S 2NRWA 1H98A 4ZHRA 1EXQA 4KB7A 5GAHI 1T9UA 3GG4A 2E5LF 1BI4B 5LXYA 2XY5A 5GMDA 3M3ZA 2V2KA 3GIRA 1KQFB 3E9LA 4JS5A 2H54B 3H42A 2VASA 3OLBA 3PG9A 1VSEA 3DOLB 5KFSA 5AQUA 3PZPA 1TYQB 4B9VA 3EY1A 2XMWA 5JVGL 2O4IA 4IR1A 1F5BA 3OHBA 1VQ8N 2DNHA 2V7ZA 1J9AA 3CIPA 5J1EB 2JC0A 5EXWA 5DZ7A 3IAM9 1RT5B 5DQHA 3LDQA 2GZOA 1O5JA 3W9HA 3GP9A 1OVQA 2O8BB 1DT9A 1RDCA 3FZFA 3IAYA 4JI0J 1E6YA 3RMAA 1HWUA 3S01A 4E0DA 1S9EA 2DFEA 4C8YA 3VQPA 1C4CA 5CCLA 1C0UB 1B0PA 4C9DA 4DUTA 3I5AA 3VCDA 4HHUA 1EWRA 4OKEA 2I8EA 4TNOA 4M3ZA 5KFJA 5F8IA 3J80O 3NNHA 1FX4A 4A48A 4CJ3A 4QBUA 4F7VA 1IUJA 4LFAK 4BDPA 3GE9A 3WX4A 3PRVA 2PEHA 4HUFA 3PIOL 1NM2A 4K0KJ 1MG7A 3PX0A 4HTIA 3PJ9A 4K4TA 2XLKA 1KTQA 3PY8A 1SUQB 1TP7A 1ELOA 4XAKA 3AVFA 2GS8A 5DETA 3IBFB 5DQGA 3DHWC 5A8WB 3ZX2A 3K7RA 3M32A 4TLRA 4BR5A 4M95A 1SCJB 3UKRA 3IP0A 5TKYA 1FVQA 4IDHA 4QYRA 3AQOA 2KI2A 1S1VB 5FDLA 4R8UB 1U1QA 2Q6CA 4OJGA 4DV1K 4QR1A 1Y9OA 1OS5A 4AHUA 4I68A 2GV1A 1VQ6N 4A8QA 3D45A 5KG3A 1NDLA 4CJSA 2A1RA 1B92A 3WC2A 2IRXA 3BP8A 4TU7A 2P9NB 2GIFA 5E3AA 4DZDA 4FPIA 4W5RA 2BVZA 4C7QA 5HP1A 2A2CA 1H38A 3MK6A 3DYAA 3SQ1A 1YJ7A 2W8LA 3CF5Q 5J2NB 4RUHA 3KNAA 1ZM9A 1QAJA 4WK1A 2CQPA 4B9MA 3M8PA 1ZA1B 1JCEA 4K4VA 4F3MA 2HHHK 4RL1A 5KOXA 1PG5B 1TTHB 1T05A 3VEWA 3MMBB 3GYNA 2HF3A 3O9QA 1RYSA 1C0TA 1KQSR 1GMWA 4CJLA 3KD5E 1WAJA 1YJ9N 5B0DA 2LU2A 4NRTA 1QQNA 1N54B 4XH4A 3G6YA 1HYZA 2M3DA 4BRIA 2KFZA 4OYXA 2ADCA 2EBGA 4FYVB 4KR0B 5EX3A 5LT5A 4DHVA 2WRMA 4QR0A 1WC6A 3AH6A 3BPDA 4F25A 3QINA 2BM0A 5B0EA 4IQXA 2E1MC 2Z2YB 3MM7A 4L74A 1VC0A 4MKAA 2EC0A 1RBVA 2GAGC 4JI4J 4ES3A 2DISA 4H5WA 3LP3A 3MXIA 2B9EA 4PWDB 3I56N 2XHWA 2PY5A 4NASA 2I2YA 1YT3A 2G0JA 1IKVB 3ZT4A 1OPZA 1PBUA 1T9VA 3DDKA 2GVDB 4DR7J 3SNNA 3D3BJ 4MO5A 5M1PA 3OR2A 2ALZA 4DL0C 2FD2A 1X9SA 4OI4A 3T5LA 4FP9A 1RBLA 3H5XA 5GADI 2IAJA 2HOEA 2IFXA 4CEEA 3QT5A 5ETSA 2G9OA 2A6OA 4KTQA 1AFIA 1VJQA 3D28A 3QEPA 2JLEA 4LIRA 2HBZB 2E1AA 3VQBA 1HWJA 4OZ2A 3LOUA 2ZBRA 1I6JA 4N7TA 3T9ZA 1U0HB 3U8XA 4DV0F 3T3FA 5ETRA 1ZTTA 2BUPA 1HLWA 3ISND 1HHTP 3OLAA 1AB8A 3RAXA 4JI3K 1ZPVA 1WHVA 2GJFA 1OIAA 3C2PA 4ZCKA 2YHWA 3NCRA 5A8KA 2B5JB 2V69A 4Y2IA 2CQDA 3SQGA 1R27B 3PX4A 3T1YF 2CNLB 3M30A 3HSDA 2AGPA 3K5NA 3KNGA 1FJGJ 1FD2A 1VHFA 1NDKA 3QMLA 4USKA 3ULHA 3OR1B 3S7RA 3W60A 2IMOA 3F9MA 3C19A 3LH2S 4M5MA 1YJRA 2Y1RI 2OP5A 3MMCA 3SAFA 3I55S 3MCAB 2QEXN 2MKSA 2V94A 5IM0A 4CEOA 2WVBA 1JWWA 4NLTA 2FDNA 3OYFA 4OYMA 3CJ4A 4JKGA 1BLUA 1DQ9A 2CADA 5U47A 3OYBA 3TZYA 1DZ5A 1N56A 3CJAA 2SXLA 4LRDA 1YJUA 4UUWA 3MECB 2EFQA 3KKSA 2KVIA 4DSLA 2XS5A 1S1TA 3GV8B 4M7YA 4OPJA 5HQLA 1RTJA 5AJ3F 1DTQA 2KRBA 2WOMB 3ZZPA 3HI0A 2NRXA 1JLBB 2BKPA 3MUMP 3DWLA 2R4FA 3EPGA 3CM6A 4DR3K 4J9UE 4CJRA 2VDIA 3CCUN 4P6QA 1HNVA 4PABA 4Z4IA 7FD1A 4X66J 2ZF5O 1UA1A 3CHWA 4AE5A 2R7RA 5AT1B 2F40A 1K1QA 1JLQA 5C10A 5AZJA 4PUOB 2HG4A 3CUNA 4O3QA 3OV7A 4X4SA 4IG0B 4G6VB 3ZNUA 4YY3K 4C8OA 4GRSA 4KO0A 3HP6A 3NH2A 2JHEA 1PYOB 1NJIT 1J5EJ 2Y1LB 3V1QA 4FBUA 2LP4A 3O2IA 4CDIA 4N56A 1GFWB 1RAIB 2KHDA 3L3CA 4LRFA 3CCQN 3P39A 5RUBA 2AU0A 2XB2D 3MEEA 1AZSB 4X64K 4JYAJ 4IQMA 2Z8QA 4QW9A 2KKHA 1ZS6A 5AZIA 1C1CA 3ZZZA 5MAOA 4E1JA 5FRNA 4IOAL 5DM7Q 1EP4B 3TTDA 2UUAJ 4P2XA 1OMSA 2RRBA 2W2MP 4M41A 5LMNJ 1BCMA 4WP9A 2VDHA 3CT9A 4KGMA 3VGVA 1U0SA 3BR8A 3THXA 4CJEA 2AHOB 1RCXB 2BJ3A 3T19A 2CQ0A 4CLZA 4AQYK 4RZRA 4QCLA 3K9KA 2E1CA 1B64A 1P9YA 5GIOA 3QEXA 2FY8A 4F26A 1YF5L 2AZ1A 1OY6A 1MMNA 1FK9B 2OEKA 3NS6A 5IFMA 2G13A 2RF2A 2BJ8A 1IQZA 3WNFA 4AH9A 1SV5B 4PKHA 4JS4A 4WZQA 4CO5A 3E3XA 2VWJA 1BU6O 1G99A 5GVQA 1U09A 4P75A 3OXLA 4NLWA 4FJKA 3I5BA 4OHZA 1UA0A 3BGOP 4FF1A 3FVYA 3ILJA 2BQUA 2OFHX 4IRCA 3NBPA 1CJKB 6AT1B 1R6VA 2EKNA 2VC1A 4LF8F 3VGSA 1PBAA 2FJVA 4P73A 1S0NA 5IXUA 5ELZA 2JEIA 3UI3A 4EO6A 4E89A 4FWMA 4K25A 3MWPA 1S1UA 3NGRA 4NXMF 4JHDB 2CGLA 3GFHA 1PGZA 1YAGA 2JFDA 3P31A 2XMUA 3KLHA 2NYIA 1U47A 2P9LA 2VFTA 5BJRA 4JKAA 4C3KA 2XY6A 4KH5A 4ECWA 5I3QA 4ID1A 3RBXA 2ZOFA 5ETMA 3AGKA 1Y3KA 3TVZA 1K6YA 3F2KA 4YHHF 1F9FA 1A5VA 4M42A 1Q8BA 3RB4A 1JX4A 3ILLA 5H9EK 2WW8A 3J81Y 3VF4A 3CMQA 4B3TK 4R5PA 4Z7CA 1C0FA 4FF2A 5JVHQ 3RSEA 1VBZA 1LW2A 3A3NB 3N79A 3BQ1A 4I67A 1JK9B 3I0RB 4JI8F 3QFPA 4N76A 3I31A 4JV5F 3CD0A 4QPTA 4BGAA 3BREA 1M5SA 2YQ1A 4UQGA 1MLAA 3OYGA 1LW0A 4NX9A 4TVAB 1Z2LA 1SB6A 2HIYA 2DPNA 3F73A 1RAAB 4BRNA 1ZTWA 3JSYA 4AFFA 3T1HK 1CZBA 2O1PA 1C0GA 2RRAA 1C1BA 1FKPA 4C8KA 3AJ2A 4DR4J 4ZS6A 4QIEA 4F04B 1VQNN 3PO5A 2VHGA 5EN1A 3TP2A 3NMRA 1YJVA 4KHWA 2XQCA 1S9EB 1VQMN 2PN6A 2VG7A 3ID6A 3CE8A 4GC6A 3KUGA 3ULEB 1KBRA 1HW9A 4U67L 1WI6A 2DR6A 1T9TA 3IWLA 4EO8A 1I3OB 4CQ1A 1VS3A 3S3MA 1K1SA 4RBUA 4NYOA 1DLOA 1ZBSA 1BQNA 4U7UK 3MM6B 1HWLA 2HIQA 3CD6S 4LF9K 1M5HA 4ISEA 1I94J 3AA3A 4ELVA 1IG8A 2Q66A 1JLFB 4J9MA 1U24A 4AL7A 5HANA 4LRBA 1MROB 3MOZA 2FVCA 4K2XA 3AV9A 3J8AA 5K8OA 2VICA 4QS7A 5ADZA 2P5GA 1RUSA 4YUDA 2C1EB 2GVZB 1S1XB 3R5AA 4B3MK 1H6KX 2V34A 2MSTA 4LFAF 3SUOA 1NH7A 5L1LA 4V19S 5GAGP 2RS2A 1ATRA 1GLEG 1VC5A 4U7UD 5GAHU 4LT6A 4WTOB 4DUYJ 2DNQA 4BQLA 3GJSB 1E4FT 3LPYA 3DLKA 1EETA 3CJTA 3ENAA 2KN4A 2GELA 3A4TA 2ZH2A 1N32J 5M1KA 1WWHA 5KQDA 5IC6B 1FRLA 1G1XA 3AD9C 3NAHA 4DV1F 1G2EA 4G9ZA 1HWKA 5E7OB 1NGHA 3FCVA 2IPOB 2QTWA 2FXUA 4DV5J 2CDRB 5FPEA 1Y5IB 4W5QA 4PL8A 1FDNA 1C0TB 2W1BA 1Q9YA 1NK5A 1X7VA 2N4DA 2W7OA 1NU0A 3DLHA 3R9PA 4DQIA 3UDCA 2F8SA 1H0HB 2XSJA 4MK8A 4BRAA 1WF2A 4ID8A 1WG5A 4M3WA 1GLCG 3G9CA 2YI1A 4RW7A 2WHOA 1L3UA 4DU4A 2HHHF 3K0SA 5C25B 5HVFA 2FF3B 4CHNA 4DEZA 4Y28C 2RDJA 3M1VB 1S0VA 2VGMA 1HBOB 1YZ6A 3ZT1A 4Q0BB 1T0TV 3D2FB 3R5CA 4QS8A 1H3DA 1HNWF 2EWSA 3H08A 5CR4A 1SZ2A 5JXSA 4FXDA 1N48A 5JS1A 3DRSA 1OSCA 3KK2A 5C12A 3QZ8A 1EZZB 3ZNJ1 5KT6A 4DSFA 2DNGA 1Z25A 1YXQA 1HQ2A 3ENVA 3D0PA 2IA0A 3ZLJA 3GYXB 3IMXA 3DLLL 2DR8A 1FRXA 2XMAA 3DMJB 2LDIA 3THVA 1HNIB 2O01C 1QM9A 2YPZA 1NK6A 3C95A 1IV0A 2W41A 3T9NA 4LC9B 3G86A 1B4SA 3KWMA 2YNHB 1RBOB 3W62A 1P27B 3AVGA 2FC0A 1TAQA 1NWKA 2LCWA 3GV5B 2QSFA 1XEZA 3IM8A 3MR6A 5CCMA 2YX6A 3TZXA 1VISA 1BMQB 5ETLA 4OI2A 3CO0P 4GMKA 2JEFA 1S79A 3C6TA 1QS4A 1RHUB 2E7WA 3VQ8A 1WUAA 3VTHA 1N5YB 3AVNA 3K5MA 2UXDJ 3DM2B 3QJJA 1WEXA 3M8SA 2W40A 4M5LA 4DN0A 1T9WA 3POTB 3QICA 2FSKA 2HLUA 1QAYA 2BUNA 3D6HB 2VCPA 4FK4A 4GC7A 4DV3J 2HKEA 2NZ4A 3QB0A 1HQEA 4JI3F 5DGBA 5B0BA 1RDDA 4A5AA 2YXLA 1T11A 4TYBA 1YTAA 2J7WA 4QWDA 2BKNA 4JI6K 2C22A 3QLHB 4DV4F 2R2TA 3RB6A 1LK7A 3PIPQ 2KG1A 5D0RA 3V9UA 2R8JA 1IBKF 1Q0NA 2X6NA 3LL3A 3O5TB 2G8IA 3OTOJ 2MXYA 2MLYA 1WSHA 5A6PA 2GBZA 3FR0A 4ZP7A 3R6MA 3RMBA 1V3SA 4NZ7A 1FWLA 1RTJB 3CW2C 2N82B 4KHQA 4KAIA 3CJ5A 5F8NA 3OL6A 2E5JA 3F0NA 4NLPA 1QE1B 3WDOA 5CYJA 2JNJA 4CTAB 3UW1A 5LXRA 1I39A 4FJGA 2L3MA 2ZBIA 1N6QA 2BM1A 4QQBA 5GADU 2ZH3A 3EX7B 3SDEA 2H4YB 1J5OA 2E1RA 4PQUA 5ETOA 4I1TA 5J1NA 1N5VA 1QAXA 1BQMB 4CF8A 1KVCA 3BZCA 2M52A 3TEHB 2ASOA 1DKGD 3ENHA 5AZJB 4CFCA 4KRWA 4DR2J 1Y64A 2P6TA 5CYQA 3FZMA 1PAUB 3IXQA 3MPUB 4BR2A 5ETQA 3ETMA 2XMJA 4I6MB 2ZH1A 1HLUA 1HW8A 3M2VA 3HSJA 4EYIB 4DR3F 3ZSRA 1XBWA 4IUFA 1X4AA 5C2DA 1S5ZA 4LVOP 2HGLA 4CW7B 3MEEB 1HBUB 5HMWA 5F8JA 2G0CA 1IBMJ 2XMMA 4KJIA 5HLFB 4CLKA 2ILYA 2QLFB 2DY9A 2BV3A 2HVIA 3ZZTA 4JI7K 3TAMB 1KWMA 4RW4B 2BDPA 1Y00A 3BZQA 5JUMA 4DV7K 2YQ0A 4DR5J 4IH6A 5BN8A 3SI6A 1VRTB 2QA4S 2ZDOA 4M63C 4MDAA 4ZP8A 4CF9A 3P8BB 1TUGB 3US5A 1FRIA 3G8SA 3VAGA 4IFVA 3MDQA 2F4VF 1GLDG 1X5PA 2Z4PA 1EIYB 2A41A 5K9FA 4BCAA 4I9QA 2M7SA 4OX9J 2MKYA 2MLZA 4Z0UA 2FJAB 1GLLO 1FNMA 2HNYA 2BZ2A 4Q44A 1QUPA 2GFFA 1IKXA 3MD3A 1TQLA 3VQSA 4F0MA 1RT7B 2CUYA 3SI8A 3SSRA 2CJ9A 2XGPA 4WFXA 3ZSWA 3MF5A 1U6FA 4DTXA 2QL7B 1Z2ZA 1FXLA 3CCZA 4E7HA 2QMUB 3OTBA 4EAHD 2A42A 1R31A 4DU1A 4BDZA 4IOAQ 1A0OB 4CGHA 3IR7B 2V8DA 3CC4N 2HWTA 3AAWB 4KGXB 4FJJA 4Y65A 4EWTA 3V9ZA 3FBCA 1REVA 1XQIA 1SH0A 1KD1T 4LF7K 4ERDA 5GINA 2CPJA 1UJ4A 1WD6A 3OS0A 1TK8A 1RDWX 1L3SA 1UMJA 4WQ4A 3QIOA 3V1RA 1S57A 3CFPA 2HMIB 5AXKA 3WHIA 4TY8A 1PAEX 3OW2R 3SSQA 2W9BA 1HYVA 2CNOB 4FW1A 1NK4A 2ZJPQ 2Y1JA 5KTQA 2VBYA 1X31C 2W8KA 1GMUA 2MKHA 1RP5A 4ILMA 2YWEA 4X65K 3Q86A 1PC4A 4IO1A 3SXLA 4NXNJ 3M8WA 3C15B 3UDEA 3ZTOA 1WTFA 4K5SA 4D3HA 1JLCA 1J53A 1UVMA 4ZVEA 2KFYA 3DXMA 3QWPA 3EXYA 2MQPA 1RB0A 1V4SA 3W2WA 1TUUA 2IYGA 1UL3A 1A9NB 4ZMMA 1UFWA 2JH3A 3U1NA 4Z2XA 1VQLS 2KJVA 4JYAF 3O80A 3RSEB 5HK4A 3HFVA 3TR5A 4CZKA 3UFCX 2ZUAA 1KVKA 5J2MB 1RA6A 3NXZA 3ZTPA 1A7GE 1D09B 3ZTQA 2R7UA 1K0VA 1WAFA 1DARA 1SIWB 1DJ0A 3CJKA 3HSCA 2E7XA 3IN5A 1O8BA 4USHA 3EE3A 1LNQA 1HNZJ 3EMTA 4K50A 3W3SA 3AVMA 5F8MA 1XMOJ 2DIVA 4OKJA 2VQFF 1WF0A 3HO1A 4PKGA 2DIUA 1JLGB 1HNXF 4W5OA 5IV3A 1WKKA 3OYJA 4KRFA 4PEOA 2HHWA 1P9QC 3MMAA 2MZRA 2GQ2A 3EXCX 5J1PA 1RTDA 1VQYA 2QWLA 5L1IA 2QL5B 1NGIA 2E6LA 4BRFA 2C2EA 1HI1A 2NXUA 4XPCA 1FRMA 2ZH5A 1G4CA 3A0IX 4QIVA 4QR2A 1PJ5A 1WHXA 3G82A 4L75A 2WK4A 3H8YA 1FKOB 2E4LA 1FVSA 3CWJA 4CJFA 4QWCA 3U27A 2OTJS 4U7BA 2O66A 4IDKA 4C8MA 3G25A 3LM2A 4OLPA 3JS9A 2AJ4A 2HF4A 4ECRA 2DHAA 3D66A 3J7AP 1F5CA 2OAUA 1IKYA 5DM6Q 1OYDA 1Q18A 3BGRB 2CNKB 5CZVA 4URGA 1NLVA 4LSNA 3SMZA 4BVPA 1H2VZ 3BDPA 4BR0A 3K2YA 3G4SN 3RWUA 4Z4GA 1OQ6A 4GVBA 1U1KA 4ZVTB 4QZVB 3V6JA 2JEJA 2E66A 4NOHA 2J8SA 4F9OA 4PXEA 1L5UA 3J81j 2AA4A 3HVTB 3WXKA 4I56A 1VHIA 3QJPA 2H5EA 2PE8A 4GVLA 2WC9A 4I0WA 4LF9F 1NJXA 1TFWA 4KYZA 4I6WA 1RFQA 3H46O 2ZJRL 4WF9L 5GAGI 3R8EA 4O44B 2QJ3A 8ATCB 4D3GA 1VDHA 3H5UA 2HFSA 3MCMA 3IGNA 4I2QA 2Z30B 4JI4K 1LWFA 3DNCA 5KFGA 4ID5A 4PWUA 2HQCA 4N8NA 3L2VA 4X4VA 2NLWA 1UPMB 3FBFA 2HNDA 4B3MF 4ICLB 4PCQA 4WP8A 3TTCA 5HROA 3A8JA 1V5VA 4NCGA 3GIMA 4OPAA 2F4FA 3ZETB 3PW4A 3DRRB 2NRHA 3CXCM 5EWGA 2V8VA 1YJNS 4OYBA 2FY1A 3AXKA 1K8AO 2DGVA 1HMVA 4O0JA 5I42A 2DCLA 1ITPA 4MO4A 2HVZA 1JNZB 1BL3A 5KG5A 2IGIA 3TR8A 2JEGA 4DCJB 2WSCC 4DR4F 5KFBA 3IO1A 2MGZB 1A5WA 4OX6A 5HJXA 5AQOA 2F9TA 2GGPB 3TA0A 3ENOA 3IG1A 4W5NA 4GNIA 3ZSXA 2H5JB 5DO2A 2MKIA 4FPRA 2NS1B 1NJWA 2VFUA 4KHMA 3KLGB 1TMJA 1H2UX 3LDPA 2DRDA 3BBFA 1GH8A 2UUCJ 2PYLA 2G8HA 3V9WA 3RU0A 1CJTA 2L9WA 4KV8A 3WXJA 1FJGK 3KLIB 2LEBA 3D2EA 4CD1A 4CIOA 4U9RA 4G1QA 4DPWA 2YNIA 3HSTB 1S6QA 2PI4A 4KFBB 2FBYA 4NMLA 3UE2A 1VSKA 1VQOS 6FD1A 3R5GA 2IIHA 4MTPA 4DR6F 4V1Ak 2VG5A 3OQ2A 4KREA 1N8RO 1HWIA 1M1HA 3W2VB 3QRPA 2DH8A 2V4JB 2RQMA 4CNZA 4Y0FA 3CCES 2RUSA 2OZSA 4EBEA 4KKOA 1S10A 5AFUH 1VQ5S 4LRCA 5A0YA 4MJKA 3S6EA 3V6DB 3ITHB 2RDIA 3EDRB 4FF4A 4LF2A 2ZH7A 2UUBK 3NKYA 4Y6IA 4ES1A 1RXOB 5KFXA 3MTJA 1DAXA 3BB5A 1NMNA 1H74A 1GTHA 3C6TB 2PDAA 1GNKA 2F9WA 1HIYA 2KYZA 1KS2A 1HUXA 3CQXA 3BQ0A 2P9SA 3TA2A 3OBIA 2CJQA 1FEHA 3LP0A 4ZLLA 2A5XA 2P9UA 1RWPB 3B78A 4KTZA 2HQDA 1LKZA 4X4NA 2YHBA 2VZ9A 3LP1B 4ANCA 1U45A 3AT1B 5AE1A 3Q89A 5EWEA 1Z4UA 5GMEA 3JQKA 2E9TA 4WQ4C 2PA3A 2EBEA 3VA3A 2W42A 3J7AN 2I7PA 2KG0A 3O9UA 2FJDB 5CA5A 4BR4A 3Q2SC 2PIIA 3NNCA 2MSSA 3VF6A 2HQ3A 3DDNA 1WEZA 3JAMY 1QTMA 2IDLA 3THYB 1Y10A 5THWA 1VLYA 2Q31A 4IRDA 1EQYA 4FS1A 1JXBA 4DKWA 1H73A 4B3RF 4WPAA 4WFZA 4IH5A 1RAEB 1FA0A 2KT5A 2KJWA 4B3OA 1J5EK 5KFFA 1WTBA 1ZAXA 3EWGA 2NXNA 3RBDA 2YJFA 3DLRA 2A10A 3M05A 3N5BA 2QO3A 3KLEA 4DTRA 2DBBA 3RB3A 1JLEA 4YB1P 4JV2A 4RW9B 5IV4A 4JK7A 2RD5C 3LWMA 4HR2A 5HN0A 5IWAF 2R2RA 3I4PA 4FJ9A 4NYFA 4ES2A 3J81O 4BQZA 4LH5A 1GEHA 3JYTA 4CZLA 4CZEA 4BG8A 1JL1A 5BRDA 3L3UA 1CPZA 2Q0RA 3OYMA 4B1ZA 4P72A 2RIJA 1H7WA 4B1XB 5BPLA 3THWB 3L09A 2B4OA 5ETNA 5HOOA 4DG1B 2UU9J 3Q0AA 3HP9A 4PKIA 1X4CA 4C8ZA 3GPAA 1N5TA 4J2BA 5AQMA 1T6CA 3DRXA 3J7YP 1FFSB 4O5FA 3W5XA 3QYYA 2O8DA 4QWAA 3MM9A 2NUHA 4ED3A 4HHHA 2VOOA 4YNQA 4EUVA 3H3NO 1NRKA 5I3PA 4E98A 4J9QA 1RAFB 3R2DJ 3CJCA 1Q8LA 3TZWA 4X4UA 2E88A 3M9MB 4KIAA 1QLNA 3D68A 4LREA 1NDCA 4DSJA 2HWIA 3PW5A 2ZVIA 2A3JA 3HHLC 2O8CA 4Y0WA 2BKOA 5HSPA 5KT3A 5D15A 2DNKA 4AXIA 1WACA 1Q16B 4WQ5A 1URRA 3EO3A 4OX8A 3E2EA 3QEWA 4WFBQ 3K58A 5CYMA 3D2WA 4FM2A 2OPQA 1AYEA 4CFAA 4OIXA 5KFLA 3QGHA 4CE9A 1J54A 2COLA 2IM3A 2A6MA 2P1JA 3FZLA 4ECZA 2OPSA 1OQ3A 3CERA 4BWMA 4X62K 4OL8A 1T03A 1NMEB 3AB2B 1A5XA 4NLDA 2W9CB 4Q8FA 1IKWB 3L2RA 3M2UA 2LFVA 3D1OA 2C3OA 4DR1K 1O6XA 3DHXA 4HDGA 3TARA 1X5OA 2HRUA 5FRMA 5D4PA 2ZH8A 1HJOA 4Y2AA 2RN2A 3FKBA 3IFEA 4HDHA 2QFIA 4LD0A 2QN6B 2XULA 4DL5A 2J7UA 3VZHA 3S41A 4IEIA 2QL9B 2R7TA 3ULDA 4O8KA 4B8AB 4RUAA 1RADB 1S0OA 4CHPA 5CXTA 3D6FB 1HR0J 2HZCA 1N33J 1FW6A 4LF1A 1GLFO 3KOAA 1SKUB 3GB0A 1LWCB 4CO1A 1LAVA 2HLTA 4A8KA 1AXQA 1NLKL 3L2WA 4B3SJ 3FRZA 5LSRA 4P74A 1LWEA 3E01A 1S99A 5HRRA 5KG7A 2WBMA 4LFCJ 2EEYA 5K8PA 5FLXU 2B4JA 2B4VA 4ZCLA 3HCXA 2HZVA 2E1PA 2P9PA 1IR0A 1AUDA 2YH0A 5AQQA 1X9WA 4JI2F 3VVUA 4H0PA 4WCEL 5C5JA 4DU3A 4DU8A 3N6MA 2O8EA 2Z0GA 4ER8A 1S1WA 4DQSA 4O0IA 3E9OA 4X84A 3TWZA 3AY9A 4K4YA 4JP8A 1T6DA 5ADXH 3O8WA 4HVJA 3BSOA 4F0KA 1IWAA 1Q7LB 3UNGC 3NF9A 4YEAA 2V2QA 2XG8A 1ZBTA 1I94K 1U1OA 3B6OA 2EC2A 4O3PA 2NCKL 2J76E 2HHSA 1K8KA 5LJVA 1OO0B 1SJRA 5KT2A 3PEJA 3I9V9 4BVOA 1D8ZA 1S76D 3LM9A 5L1KA 2ZJQL 1RA7A 2E5LJ 2HAIA 3DLEB 3FMWA 3VQCA 4B1YB 2W01A 4DSKA 2M9KA 2V5HG 1YG0A 4LMZA 4TKTA 3KK3B 4DSEA 4B02A 2KZZA 3I0SA 3O8MA 2ZBQA 2X3GA 4LY7A 3L0QA 1YQHA 2UVWA 3O1BA 3C6UA 2OI2A 4Z7YA 4CF2A 4M3RA 1ZXOA 2HHQA 3LPUA 4E7JA 1KOHA 4OHWA 3OL7A 4I2PA 2KHCA 3RZAA 4A2AA 2MQMA 2Z2MA 2OEJA 5HI7A 1RDRA 3SQ2A 4PWWA 4MIWA 1TGOA 2HMPA 2QMWA 3JSMA 4ECVA 4YDDB 1TL1A 3M8QB 1RBSA 5IS2A 4OYPA 3EZOA 1T3NA 1VQ4N 2V9KA 4H4MB 2QI2A 3UN2A 3HI9A 2YKMB 1YRUA 5AQHA 4PYAA 1UVLA 4JEPA 3VGLA 1WKJA 3CYMA 4LFBF 2F9JA 3FNNA 4LSNB 3JXUA 4ZJLA 5J2QB 3W5ZA 1RAJA 2RDDA 4FN5A 2CZ4A 1YJWN 3D7EO 5B0GA 2QGFB 3PX6A 4DQQA 3VQAA 1HI8A 1ZBLA 1KDNA 4HTJA 4RNMA 3NL0A 3CXCR 3MEDA 2IYIA 3THPA 2V2ZA 3A8IA 3TJ9A 2NLXA 1IM4A 2UXCK 2QLXA 1O13A 3QBCA 2XYPB 3EVMA 1RU2A 4CK3A 1KVAA 3SCLE 3TAQA 2EFOA 2IS3A 1CBKA 3FGUA 2ZEJA 1ATNA 4NYPA 4L76A 1NCLA 4PRFA 2R8IA 2HBJA 3HHNB 3G10A 5HQMA 3CD5A 1WLJA 3FK4A 3RBZA 1ZM4A 1CG2A 4KPCA 1TUWA 5CZ2A 1HARA 4BREA 3HSGA 4Y2MA 4IFEA 1RGVA 3VQ7A 4IFYA 1TKTA 1TK5A 2ZUGA 2RVJA 3UCGA 5C42B 5HROB 4QJVA 1NO8A 4CFDA 2U2FA 1TVRA 2U1AA 3V4IA 3CDUA 2H1YA 4ZTJA 5LSLA 3PVXA 2FB0A 4LVNP 5K8NA 5I42B 2LMIA 5CH7B 4QOZB 1X8DA 2QA1A 2RS8A 4QOTA 4XDCA 4LSLB 1NAQA 4FF3A 2XTJP 3CC2N 1B70B 3UPFA 2ZD1A 2P2CB 5IQQA 3I96A 1EX4A 4PL7A 4LR8A 1R8AA 3QRRA 2B0GA 4I69A 4IXCA 1I51B 2O67A 3PTWA 3TUIC 1NZAA 1S9GB 2P6SA 4M1KA 2R7VA 1XUPO 2C3YA 3VF2A 4ITSA 3DGPB 1FXDA 2AEFA 1QD1A 4C0BA 3W7BA 1UEKA 2YNIB 3JTNA 1HI0P 1Q53A 3O08A 4YR2A