1S1VA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
539
structure length
533
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 145
structure length 533
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1vA05
1VSFA 1NK8A 1ZBHA 3QEVA 2DTUA 3KLFA 4DL3A 3VQCA 3WNGA 2R2SA 2DPJA 1NK7A 4FJGA 5K14A 4J2EA 1TQLA 4TXSA 4HCBA 4CEQA 2C22A 2JEFA 4EBDA 1F21A 4ID1A 2YNIA 2Y1JA 4JV0A 4ZP9A 3MFIA 4DTUA 2VG5B 4FYDA 3V6DA 4ICLB 1T05A 4AHRA 1S5JA 4M41A 4CFAA 4JUZA 1JLCB 1S1WB 3ZSZA 3VQ8A 2FVSA 5KFAA 4E7IA 4JRPA 3ZSWA 4GMJB 4DSIA 4FJ7A 1RTJA 2E6LA 3FDSA 3MR6A 1QTMA 5EWGA 4WXOA 4Z4CA 4ECZA 3QIOA 4I2PA 2JEJA 3BQ2A 2B4JA 3IRXB 1TKXB 3KK3A 2WK4A 4CK1A 4JLHA 1W0HA 1C0UA 4CHPA 3U3YA 5CZ2A 4CFDA 4FZZA 4YR3A 4BDZA 3T3FA 3QEXA 5KFXA 3HHKA 4NYNA 4O55A 4WE1B 1SV5B 4DFMA 4QOZB 1HRHA 1WAFA 2FJWA 2Z1IA 2FJVA 4M3XA 3N6LA 3C6UB 2J6UA 5KFWA 2A1RA 1IKXA 4QWDA 2IOCA 2AGOA 2GIRA 1BL3A 1D8YA 1BISA 2HHWA 3RB6A 3IAYA 1S1WA 4CHOA 4NCBA 4Z4EA 1XI1A 4B9TA 3TI0A 1NJWA 3CFPA 4Q8EA 2FJXA 3T1AA 3KIOA 1NK0A 1KHWA 2R8KA 4FJ5A 3SV3A 5F9NA 4K8ZA 1DTQB 1JLEA 3KLIB 3VQDA 4KTWA 4CJRA 4E0DA 1TKXA 4ELTA 5KFYA 4NZ0A 3NGDA 4DU3A 3NCIA 3ZT1A 5KT5A 3BSNA 4HUEA 5EDWA 4FJ8A 4NLXA 4IQXA 1JLQB 4YNQA 5EU7A 2D5RA 4O44A 2VG6B 3C6TB 3OYEA 4WE1A 1SV5A 3ITHA 4IH6A 4I9LA 1VSJA 2WONB 5CYQB 4RW8A 1RBRA 2DFHA 4Y2AA 4HTUA 3RB3A 1L3VA 3QLHB 4E1NA 4DL4A 4ECWA 1ZBFA 3GIJA 3CVKA 5FROA 3ZT4A 2HHVA 4ZPCA 4OJRA 1VSMA 3T5LA 3K5NA 3RMBA 3HSTB 5L1JA 3H4DA 3G10A 4CF1A 1TK5A 2IJFA 2HHTA 1I39A 3OY9A 5KFSA 1A5XA 1DTQA 3KLIA 3DRRB 4EO6A 3D28A 3NAEA 4MQ3A 1J5OB 1TAUA 4O3SA 4PWDB 3BDPA 3O4NA 1LWEB 1WNSA 3DRPB 2O4GA 3ICLA 3C95A 3G6XA 2LSNA 1LW0A 1HQUA 4AHTA 1JLQA 1XHXA 5I42B 1RDDA 3GV8B 3QESA 1N5YB 3EYZA 2VG6A 2XI3A 3C6TA 3V1OA 3HK2A 3D45A 3M8QA 3UDLA 5CYQA 2BANB 2CKWA 4MK8A 3DI6A 4ECUA 3M9MB 3SYZA 2OH2A 4CHZA 3MXJA 5KFPA 5DQIA 3T5KA 4G1QB 5J2QB 2V0NA 3U6FA 3QLHA 4GW6A 1QAJA 4WYWA 3DLEB 4NLGA 2OPPB 2B43A 4NLSA 2PYJA 3U3GA 3G86A 1WSHA 4FM1A 2OPRA 4IR1A 5C5JA 5L1IA 4CESA 5E41A 3ASMA 5KT2A 3TANA 2IGIA 1UA0A 1HYVA 1S4FA 4ZHRB 3DLGA 1BI4B 1RT3A 2HHQA 4PUOB 2XY5A 3CDEA 4J2DA 2UVUA 3NGYA 1RT1B 4URQU 4ECTA 4Y3CA 1U49A 2FVCA 1LWEA 1RTHB 3DRPA 1TL1B 1S9GA 4URSA 1RTDB 1LAVA 3ZSXA 5I3UB 1RYSA 2FBXA 4O3RA 4KAZA 4N76A 4KHUA 3CFOA 1LW2B 3DYAB 1N5YA 3O3HA 4FS2A 4OKEA 3HT3A 5FRNA 1NNDA 4ELUA 2XY7A 2DY4A 3HPOA 3PO5A 2XRIA 4KHMA 2BANA 3UR0A 1L5UA 3OSNA 4CJSA 4E7JA 1NKBA 4N56A 2F8TA 4OPJA 2XGPA 2P1JA 5KFKA 4G1QA 5J2QA 4ZP7A 3SUNA 1LWCB 1XR5A 2I1RA 3BSAA 3CFRA 4KTQA 4U6PA 2I5JA 4IG3B 2OPPA 3LAMA 2X6SA 2Z1JA 2JEIA 1D5AA 4R8UB 3VA0A 4FJMA 3OHAA 1RT6B 4CF8A 2BR0A 5CY4A 4TQSA 2R8JA 2YNGB 4DTJA 4FZYA 5KG4A 3K57A 3QO9A 2FLNA 1ZBUA 4KTZA 4ZHRA 2WTFA 1BI4A 3RBEA 4PUOA 4O5BA 1HNIB 1IKYB 1RT1A 4LQ9A 4B9NA 4F3TA 3MEGB 4I7FA 2D0AA 1RTHA 4FJJA 4FVMA 1TL1A 2IM1A 1WSEA 2XCPA 1S1XB 3DLKB 1EX4A 5I3UA 3HXMA 1S9EA 5HRNA 2J6TA 4DFPA 5DMRA 3SPZA 4IDKB 1LW2A 5F8NA 4YFUA 3DRSB 3DYAA 5FDLB 5DK5A 1J53A 4RW6A 4KHSA 1BIUA 3PVXA 5KGXA 4J2AA 5KFUA 1ZTTA 4K4XA 3VQ5A 3RMCA 3OS2A 2IDOA 3FRZA 4WFXA 2F96A 1ASWA 1LWCA 3DOLB 4H54A 4ECSA 1WNEA 4Q0BB 1BQMB 3TABA 1YT3A 1CSJA 4R8UA 2W7PA 3IG1A 3AVCA 3TAPA 5FRMA 4ZPAA 2D0CA 1D0EA 4DG1A 1TP7A 2W9BB 4IRCA 4WZMA 2D41A 2ITGA 3ZSRA 2ZQBA 2FBVA 3ZSOA 1HNIA 3L8BA 3OYAA 2Z1HA 3HVTB 2HVIA 2G8KA 4FJXA 1MU2A 3SI6A 1EETB 1S10A 3OL8A 4EBCA 3SQ2A 4MIAA 1S1XA 3H40A 3DLKA 3I5CA 3QZ7A 3MECA 3A2FA 4K4YA 4IDKA 2R7YA 4ZVEA 1NKEA 2HNYB 3BQ0A 1ZBLA 4IKAA 4O3NA 3L2RA 4CEZA 1B92A 3EPGA 1RBVA 3GIIA 4IFVB 1IH7A 4DQIA 4NLYA 4CJQA 2BQ3A 1DTTB 3DOLA 4ED0A 2O4IA 3DDKA 3LWLA 4BE0A 4C8LA 2RF2B 1CXQA 4AHCA 1VRUB 2BQRA 1FKOA 3NL0A 1WSJA 4OGEA 4CERA 4ED7A 1CZBA 3TR8A 4CK3A 3L2UA 5DGBA 2W9BA 1WSIA 1GOCA 4AHVA 4DL7A 2Y1IA 1RT7B 2V9WA 1FKPB 2G8UA 3H5UA 2DFEA 3OYKA 3HVTA 5KT6A 1WN7A 3NF8A 3NF9A 1S9FA 3CM6A 4OLBA 2W8KA 2FLLA 4BWMA 3MR5A 1HMVB 1HQEB 2W9CA 3O4QA 5F8IA 3AVHA 5DGAA 2AX0A 1JL1A 4GVMA 2HHXA 2ALZA 4DTNA 4DTMA 4ZPBA 3KTQA 1EXQA 5KG7A 2IM0A 4WZQA 4RG8A 4KHNA 3PW5A 4XO0A 4H4MB 4IFVA 2YNHB 2IC3A 4HCCA 2E9ZA 2D0BA 5KFZA 1GX6A 2UVRA 1DTTA 4IFYB 4RW4A 4TQRA 4E1MA 5C42B 4J9PA 4QWEA 3G0ZA 2RF2A 5KI6A 3QIPB 4O4RA 1X9WA 4TY8B 2ILZA 4Z4HA 4OPKA 2V4QA 1UOCA 3D5MA 3M8SA 1BQNB 4RW9B 4N47A 4N5SA 4EYIB 2GC8A 4YR2A 3T5JA 1RILA 5DG8A 5KFLA 1QSYA 2OZMA 4YR0A 3KMSA 3KJVB 4CK2A 1RNHA 3QGIA 4RZRA 3PV8A 4F4YA 1FK9A 2P51A 3SV4A 1D9DA 1VRTB 3EZUA 3NF7A 4KO0B 1HARA 1HMVA 1HQEA 3HP9A 3LP2A 1KHVA 4GC7A 1NHUA 4CHYA 4FLXA 1JX4A 3AVIA 1T94A 1UWBA 3VQQA 3VQAA 4O4GB 2XY6A 3THVA 1QHTA 3PW2A 3MXMA 3G6YA 1TGOA 3OSPA 4W5RA 4OGCA 2Z1GA 1JLBB 2YNHA 2WCXA 2WOMB 4K4ZA 3VQ9A 4IFYA 4LH4A 4QWAA 1MMLA 3V6HA 5CYMB 5J2MA 1FXXA 1S1VA 3LALA 4CGDA 4NLPA 4RNFA 4DTXA 1CZ9A 4TY8A 5KFVA 1KLNA 1QE1A 3QNNA 1RCHA 1S6QB 1U09A 4O0JA 1BCMA 2IA6A 3DM2B 3AVAA 5F8JA 5KTQA 4CEAA 2HB5A 5KFCA 4DTSA 2YKMB 3KJVA 4DQRA 1N6QB 5F8GA 1VRTA 4J2BA 4MFBB 2AX1A 3LZIA 4BDPA 3DOKB 3KLHB 1U47A 1SH3A 5HBMB 3QEWA 3QNOA 1LWFB 4J9OA 4IRDA 1JXEA 4JS5A 4FS1A 5DLGA 4O4GA 4DL6A 1VSHA 4NCGB 4QW9A 1SL2A 2OYQA 4F4KA 1JLBA 2WOMA 2WB4A 2XO7A 5SZTA 2VG5A 3NH2A 4EZ6A 3SZ2A 1Z4UA 4ICLA 5CYMA 2C28A 3GV5B 3KHHA 1U04A 3RRGA 1JLCA 4ED6A 3QGHA 4K4TA 4O0IA 3Q8SB 4EP5A 4J9NA 2AGQA 4XIUA 3KLEB 3JYTB 1C1BB 2XCAA 4K4SA 4LQ3A 3DM2A 1RBUA 4DQPA 4C8MA 4NLDA 2W9AA 3H59A 4IRKA 2YKMA 2E4LA 3AA3A 4FLYA 3IRXA 1JKHB 5EUHA 1N6QA 1EKEA 2RPIA 1J9AA 5KT3A 3BSCA 4KBIA 4M3YA 3PHEA 4FJHA 3LP1B 4ZPDA 1TK0A 5JXSA 4E7LA 3DOKA 3KLHA 2GIQA 3M8RA 4DSJA 4M42A 3ISNC 4HVJA 4I9QA 3BJYA 4CCHA 4ECRA 4KV8B 4NCGA 4EEYA 2JGUA 1T03B 3PW7A 1Z25A 2ZKUA 3H08A 3CQ8A 4IR9A 3C6UA 4X2BA 3OL6A 1IKWB 3TQ1A 3QYYA 1K6YA 2BQUA 1QS4A 4Y34A 3SJJA 5KFFA 3GQCA 4IOBA 5HROB 3K59A 3TAFA 4FK4A 4UQGA 4EYHB 2X6NA 1TKZB 3DLBA 3KLEA 5KGWA 1Q9YA 3KLGB 3JYTA 4FLTA 1DLOB 2PYLA 3S9HA 5KRTA 3OS1A 3V4IB 4NRUA 2G8WA 3OJUA 4J9LA 4FLZA 5HLFB 1O1WA 4C8NA 4OKJA 3S3MA 4DMNA 3LP1A 4MK9A 2VG7B 2W8LA 3MEEB 3CYMA 3AO2A 4ZMMA 4MIBA 4FBUA 4U7CA 3ZT0A 5KT7A 3KOAA 3KD1E 4DFJA 2WONA 3UPFA 1GX5A 1T03A 3OYDA 3SQ4A 2JC1A 1SUQB 3NE6A 4DWIA 1SH2A 1KVAA 1NJXA 2B6AB 3Q8QB 3OYCA 1C0TB 4BE1A 1CXUA 2O5DA 4F4ZA 2YKNB 1WSFA 1RDCA 3FQLA 3N6NA 4Q43A 1W9HA 5F9LA 3H4BA 2P5OA 3KLGA 2OPQB 1DLOA 3EY1A 2ZE2B 4CIGA 2RN2A 4C8KA 3V4IA 3DRRA 2EX3A 3RWUA 1XR6A 3CIZA 3RMAA 1J5OA 4FJLA 4PWDA 1S6PB 3PX0A 4GC6A 1R0AB 3AO3A 4BE2A 3DMJB 3MEEA 4JV2A 1XC9A 4LSLB 2FVQA 5JUMA 5I42A 2IJNA 2J6SA 3GYNA 3Q8RB 4IKFA 1TV6B 4CJLA 1HYZA 1TAQA 2HNZB 3AVGA 4QWCA 3QETA 3S3NA 3ZCMA 1IKVB 4TLRA 1SUQA 4TN2A 4ID5B 3KK2B 3VQ4A 4Z4GA 1I3AA 1S1UB 4B9MA 1S0OA 4B3OB 3ULDA 2B6AA 3BQ1A 4K50A 4FJIA 3PJWA 3DLEA 5J2NB 1C0TA 3BSOA 2F8SA 5EWFA 3F73A 2ASJA 1SL1A 3LANA 2Q3SA 3OHBA 2W42A 3OYLA 2YKNA 1U45A 3FSIA 3QEPA 4EO8A 1HPZB 4CJUA 3TVKA 5KFHA 5HRPA 4RU9A 3RAQA 1BCOA 4C8OA 4J9RA 4DS4A 4FM2A 1HNVB 3RBDA 4XPCA 3I5BA 3BREA 2FVRA 1XWLA 2BDPA 1S6PA 4PQUB 3L2QA 3P83D 4F4XA 1RTDA 5L9XA 1KLMB 3DMJA 4FLUA 1J54A 4CHQA 5T7BA 4WYLA 4H4OB 4B8AB 3ALYA 1EP4B 3SNNA 2RDIA 1LV5A 5KG2A 4DSFA 1N48A 4M45A 1CLQA 3AVKA 2HNZA 3VQ6A 2HWIA 1JXLA 3I0SB 3NH0A 4FCYA 4CEOA 1IKVA 3MFHA 1VSIA 3RTVA 3KK2A 3PY8A 1SL0A 1L3UA 1S1UA 2UUTA 5KG6A 4DSEA 4CHNA 3GIKA 4CJKA 4CGGA 1TK8A 1REVB 1QSLA 4IG3A 3VQBA 1T3NA 4J9KA 3VQSA 2E9TA 3IGVA 4B08A 1WSGA 3SFUA 1RT6A 1NOZA 3NBPB 4FK0A 3GV7B 3HVAA 1KFSA 2YNGA 3KKRA 4ZTFA 3KHLA 4CF9A 3OL7A 3HVWA 2AGPA 3F9KA 1IKYA 1C0MA 1HNVA 3L2VA 3ZSQA 2QE5A 4YQWA 4DTPA 1ZBIA 3K5MA 3MEGA 2YNFB 4KHYA 1ZETA 2G8HA 3TAMB 1IM4A 4R5PB 3PZPA 1QUVA 1UA1A 4W5TA 3TWHA 1KLMA 1RDBA 4CJ5A 2KW4A 4FW1A 2VA2A 3MTKA 1EP4A 3V6KA 4FBTA 4Z0UA 3DRSA 5FDLA 4OL8A 4DSKA 3WNEA 4MH8A 4WXWA 4KI6A 3LP3A 4FXDA 5KFQA 4DLEA 4Y1DA 1RA7A 3E01B 3PJXA 4Q0BA 4OKKA 4DFKA 1BQMA 2PZSA 2RDJA 3RAXA 3CO9A 3HYFA 3OYGA 4DQSA 3KD5E 4CJPA 2E9RX 3NBPA 3AVJA 4ELVA 3OL9A 5KFOA 5HRSA 2HHUA 1U48A 4Z4IA 2HWHA 5JS1A 2RKIB 2ZD1B 4KFBB 4W5NA 2UVWA 4G3IA 2ETJA 3AVBA 3GIMA 2R8GA 1EETA 3TAMA 5DLFA 4R5PA 3AV9A 2YV0X 1JXBA 1BIZA 3SI8A 4KREA 4IG0B 4E7HA 4AHUA 1G15A 5C24B 4FLVA 3SUQA 2HNYA 3H98A 3BR9A 3KHRA 3B6PA 1YTAA 3NKYA 3HPHA 2KZMA 4B8CA 4NLOA 1YTUA 3MXIA 4CJFA 2GBZA 4LH5A 1IG9A 3QZ8A 5J2PB 5K14B 4L8RB 1VRUA 4QW8A 4DLGA 5KFDA 2YNIB 2HW3A 4FW2A 3D0PA 2ASDA 4CJ3A 3AO4A 1RT5B 1L3TA 4KSEB 2YHAA 3V6DB 2PY5A 3CDUA 1RT7A 1FKPA 4KE5A 2RKIA 3WNHA 3B6OA 4KFBA 3AVLA 4NRTA 2HVHA 3IS9B 3V1QA 4OVLA 1HJRA 3K5OA 2FBTA 1NOYA 1TKTB 1UAXA 1RTJB 4M3RA 4HUGA 4ZP6A 2HMIB 1Q8IA 4IG0A 4KB7A 2VWJA 3LDSA 4NLQA 3HPGA 3V9SA 1GOAA 4CJVA 2D7SA 4Q8FA 1TVRB 1C1CB 1T8EA 3NFAA 4KPYA 1BGXT 4LSNB 4DS5A 5DQHA 1QAIA 1B9FA 3E51A 3QINA 3ZSYA 4H4MA 3OYBA 2FLPA 4CF2A 2KQ2A 1C0UB 4ZTJA 3QEIA 3AA5X 3QIDA 3UQSA 4K4UA 1JLAB 4B9VA 5C42A 5J2PA 2OPSB 4WFYA 2B5JB 4HYKA 3QIPA 1S1TB 3AA4A 3OYIA 5KFEA 5KFBA 1W25A 1RYRA 1BQNA 4RW9A 4DQQA 3S3OA 5KG0A 4DU1A 1RT5A 1IKXB 2WHOA 3MF5A 3JSMB 2BGGA 4YMEA 1ASVA 3PUFA 3BGRB 2ASLA 2X78A 2C2RA 4ZVHA 3OVNA 5EWEA 3IS9A 4ED2A 1ZYQA 3G6VA 1TKTA 4DU4A 2R2UA 2HMIA 4KO0A 4DL5A 4M3UA 3M9OB 3HVRA 1TVRA 1C1CA 1JLEB 4EZ9A 1XR7A 4M95A 3V9WA 5F8LA 1YVUA 4LSNA 3HM9A 4M94A 1RDRA 4F50A 2ATQA 1OS5A 3H2LA 3GILA 3SQ0A 1JLAA 4XPEA 3V6JA 4HUFA 3HJFA 4O44B 2OPSA 4KAIA 2B5JA 2XY8A 2IBKA 3ITHB 3HP6A 1S1TA 4H8KA 3K2PA 4RW8B 3CJ5A 4K8XA 4KKOB 3L3VA 4ED3A 4EP4A 3V9ZA 4PA1A 2KZZA 4K4VA 1S6QA 4Q45A 1RDAA 2XWYA 3LZJA 3RMDA 4RNOA 3JSMA 4M3WA 3LPUA 3ZT3A 2V4RA 3BGRA 4E19A 2XI2A 1NHVA 1KRPA 5KFJA 1NK4A 3CM5A 5D3GB 1NJZA 2FBYA 1RTIB 1A5WA 2VA3A 4MFBA 4CFBA 3CJ0A 2NUBA 2OA8A 5HBMA 4CGHA 1RBTA 1LWFA 4DL2A 4CIFA 4RNMA 4TY9A 4QPXA 3OYFA 3MEDB 1N56A 1D9FA 4CEEA 1WLJA 4JS4A 1C1AA 1VSDA 3FQKA 3HL8A 5F8HA 1XHZA 4NLWA 1S0MA 1LW0B 1HQUB 1VK0A 4M3ZA 3Q8PB 4CGJA 5KG1A 1RT4B 4BWJA 2DFFA 1S97A 4DF4A 2KFZA 4I2QB 1U4BA 3M8QB 1KFDA 3DI6B 5HP1B 4KKOA 3KKSA 2IMWP 3C94A 2QXFA 3V9XA 4FJNA 1RT2B 2YHBA 1C1BA 2FVPA 3SFGA 2IAJB 5C25B 4F4WA 1X1PA 4J9QA 2OPRB 5D3GA 1JKHA 4ECVA 1YVFA 1RTIA 4CJEA 2OZSA 1KSPA 2D3ZA 4RNNA 4K4WA 4JV1A 2JLEA 4ECYA 1SKRA 2GUIA 5JS2A 2XC9A 1SKSA 3DLGB 4JRQA 3PX6A 5F8MA 1RT3B 3L2WA 3NHGA 4NLRA 3MEDA 4KV8A 2HAIA 1D1UA 4YP3A 4RW7B 2R8IA 1S9GB 2A1SA 1RBSA 3PW4A 3P5JA 1S48A 1IKWA 4F8RA 2QV6A 1Q9XA 4HKQA 4N41A 2BRLA 1RT4A 4TYAA 5KT4A 4O3OA 5DG9A 4I2QA 4KRFA 5HROA 3AVMA 1VSEA 5KFMA 5HP1A 1X9SA 1TKZA 4ZP8A 3OS0A 4B9LA 1RT2A 4TYBA 4DTOA 3KK1B 1Z26A 4MKAA 3OLBA 5DG7A 4FZXC 2IAJA 2I5JB 5C25A 2QKKA 1ZTWA 2X74A 1K1QA 1LAWA 3SPYA 4IH5A 2IM3A 1RA6A 4PY5A 1C2PA 5HLFA 2AU0A 3NF6A 4CF0A 4B9UA 4F2RA 2VG7A 3M8PB 3QGGA 1Y97A 1JL2A 3QO9B 3PW0A 3VA3A 4AHSA 3RR7A 3V81B 3H5XA 4LY7A 3MR3A 4CFCA 4M3TA 1KVCA 3O3FA 3DLRA 4F2SA 3CJ4A 3IN5A 3MAQA 2P5GA 3VQEA 3NAHA 4I7FB 4RW7A 4E7KA 1S9EB 3SUOA 2VWKA 2XGQA 4RW6B 1JLFB 4ED8A 4F3OA 2G8FA 4CEDA 3VN5A 3KHGA 3PX4A 4KB0A 3OYJA 3AVNA 2QKBA 4CEFA 3LAKA 2OPQA 4QCLA 3KK1A 3RRHA 4ECXA 2ZE2A 4NLUA 5KFIA 3I8DA 4URGA 3AA2A 3CJ3A 4AH9A 4BACA 5KFRA 2UVVA 3IG1B 4DTRA 4DSLA 2G8IA 2IS3A 3TAQA 1R0AA 3M9NB 4DG1B 3RR8A 3M8PA 4W5OA 4LSLA 2E6MA 2EHGA 1BHLA 4Q44A 1QQCA 5CZ1A 4IH7A 4CJ4A 3V81A 1KCFA 1TV6A 1C6VA 4QWBA 3N6MA 4RUAA 4ECQA 3LP0B 1N4LA 1WAJA 5KFTA 4EBEA 2G8VA 1MU2B 4NLVA 4ID5A 3PR5B 1K1SA 3K5LA 4B3OA 3NGZA 4CGFA 4KHRA 3K58A 3MECB 3HKWA 2JEGA 3DLHA 5J2NA 3ZT2A 1JLFA 2F8EX 2HNDB 5L1KA 1SH0A 2DPIA 3CG7A 4IBNA 3OLAA 1IO2A 3NGIA 3FFIB 4Y1CA 2C2EA 1X9MA 1HPZA 4NLTA 1QSSA 3AVFA 5HRRA 4RNHA 4RUCA 2R8HA 4J9MA 4O3PA 1ITGA 4CECA 1SKWA 2AQ4A 5KFGA 1FKOB 3SUPA 4PQUA 3EPIA 1L3SA 3SQ1A 3TARA 4FJ9A 4CE9A 2QK9A 4CJTA 4H4OA 3CJ2A 4E3SA 2JC0A 2AJQA 4W5QA 3LP0A 3MR2A 3I0SA 2BRKA 3NH1A 1B9DA 4CEBA 5J1EB 2FC0A 1VSLA 2UUWA 1I6JA 3AO5A 1JLGB 2W9CB 3KLVA 4AILC 1JIHA 4E89A 2HHSA 1A5VA 1REVA 3I0RB 2R2RA 3UIQA 5L1LA 2HNDA 2W7OA 3EZ5A 1VSKA 3PO4A 3TAEA 3OYNA 3FFIA 4NYZA 4QAGA 3T19A 4Z4FA 3NDKA 1S49A 2IC3B 3P1GA 4RW4B 3SCXA 2KTQA 3NMAA 2D3UA 4MKBA 5KFNA 3L3UA 3RB0A 4ED1A 4HHTA 3LPTA 2R2TA 2KFNA 5T14A 4FM0A 2YNFA 4KHWA 3KNAA 3I5AA 4CIEA 1HYSB 3CDWA 3WNFA 2BE2B 1NK6A 4OLAA 4KB1A 2AWZA 1NK9A 3IGNA 5SWMA 4KHQA 1KTQA 3PR4A 3AO1A 4FK2A 5KG5A 5KG3A 1T7PA 1TL3B 1RAJA 4FLWA 3QERA 5J1EA 1FK9B 4J9SA 4Y2CA 1GOBA 3V1RA 2ATLA 3KLFB 4TSXA 1JLGA 3H5YA 4KI4A 3LP2B 2IM2A 4ZVGA 3E01A 3RB4A 3TAGA 3I0RA 1S0NA 1UWBB 2C2DA 3T5HA 4CGIA 3OJSA 5KRSA 4O3QA 3OYHA 3OYMA 1NKCA 1NK5A 4DEZA 4FJKA 5J2MB 3V9UA 1TKDA 1T05B 4DF8A 1S1VB 2ZD1A 3O3GA 1ASUA 3ISND 3CWJA 2WRMA 4B9SA 3LWMA 3KMQA 2CJQA 4MK7A 4WFZA 4CJWA 2ILYA 2EC0A 2XHBA 1QE1B 1KVBA 4Q5VA 1HYSA 2BE2A 4LD0A 3NAIA 1NJYA 5DQGA 3VQPA 4BDYA 4NCAA 4ZVFA 5C24A 4I2PB 4R0EA 4NYFA 3HO1A 3VQ7A 3ZSVA 1TL3A 2GV9A 3H5SA 3KK3B
chains in the Genus database with same CATH superfamily
5F0XA 1WC3A 3QEVA 2DTUA 3JAMU 3FK4A 1X3NA 5AQIA 2J9EA 1RGIA 3R8YA 4U67Q 1RB0A 1HNXJ 1J27A 4LVOP 2ZJRL 3H90A 4H5WA 5KPTA 4ID1A 4FN5A 2B9EA 3N0VA 2YKPA 2C2ZB 4PL8A 1ZZNA 4WFAL 4HHJA 4JYAJ 4ICLB 1HBMA 2DNPA 3EUNA 3JTOA 2RT3A 2DXEA 4JUZA 4OYWA 4PRFA 4NXMF 1JLCB 5G0RA 4A8SA 2FD2A 4UOGA 4FJ7A 3E2EA 3FDSA 2GJIA 3MR6A 1QTMA 5EWGA 1CEZA 5AZIA 2G1HA 4I68A 1YJRA 4Z94A 2ZZTA 3QMQA 3ETMA 3VALA 3BQ2A 1G3OA 3TVZA 2WK4A 2XMJA 3U3YA 4ZPVR 4FPAA 4JK9A 3B82A 2EK6A 1JMTA 1FKAF 2I0XA 2M9KA 2P9EA 4YR3A 4BDZA 1Q86T 5KFXA 2YKAA 4K8RA 4C11A 1WDDA 4NMXA 3LUYA 2RUSA 5KFWA 1UZHA 3W2WB 2HWTA 2LXUA 3RB6A 2V5HG 1HA1A 3J81O 1S1WA 4HHUA 3W61A 2E29A 2R7QA 2FHKA 4FPIA 4B9TA 2JSXA 3TI0A 4JKAA 1VQLN 3PYEA 1NJWA 3CFPA 2FJXA 3KIOA 4NMLA 2BEFA 4CO2A 1DTQB 2A18A 2ASYA 3MAHA 2DHSA 4KTWA 4DR5K 2V9KA 3K5PA 2PSZA 2CGJA 4NZ0A 3R7NB 1VI7A 3NEKA 4ZLLA 4NLXA 4YNQA 3LQVA 2CQ1A 3EVOA 3C6TB 3CCMN 1SV5A 3FKBA 1XNRF 1VSJA 2WONB 2CNLB 5H9EK 4P52A 5CYQB 3GMGA 4M7XA 3BBBA 2HIQA 2B3TB 1RBRA 5K8OA 1N88A 4LFAJ 1NM2A 3D3CJ 4Y2AA 2NLWA 1OIAA 3JSBA 4ECWA 1HD0A 1ZBFA 3HHDA 1UAWA 1R0CB 1LEOA 4U67L 4RWWA 5A6PA 1MWYA 5FROA 4FDFA 4P2MA 2NXNA 2ZJPQ 1MSWD 3MR7A 3T5LA 3PYDA 2VJUA 2HG4A 3G10A 4CF1A 2WSEC 4JI5F 1VQ7N 1ATRA 4IJAA 3IM8A 3BF3A 3MX5A 2CQDA 1PJ7A 2R9LA 3BY5A 2N7YA 4H03B 2DIVA 4PWDB 4JI1J 2LDYA 4USUA 2LSNA 4ANDA 3KG1A 1JLQA 5JLFA 3J7YU 3QESA 1N5YB 3EYZA 4AQYJ 3F9MA 3TX8A 2QI2A 2AJ4A 3D45A 5E0OA 3M8QA 3CD6S 2BANB 3DI6A 3UN2A 4ECUA 4LC9B 3UDCA 3K9KA 3J7YI 4CHZA 5J2QB 1BXNA 2E1MC 3FBEA 2J9CA 1QAJA 4C0HA 3QBXA 1N54B 4WIIA 3T1YK 2PYJA 1FT8A 3G86A 3FEZA 5MLCQ 5CZVA 4IR1A 1Q7LB 2VL1A 5L1IA 2DBBA 1SCJB 5E41A 2JLGA 3TANA 5DM7Q 4UOFA 1UA0A 1HYVA 2H5EA 4CTAB 1QD1A 5IOLA 1MWQA 2UVUA 1NGAA 1YRUA 2GVDA 4URQU 3MMBA 4GKJF 1ZM2A 2FVCA 1RTHB 2FB0A 1WG4A 2F4FA 1H2VZ 3SEOA 3G4SN 1RYSA 4LBPA 4KHUA 3JQJA 3D2WA 2KFYA 4FS2A 5FRNA 3CCUS 3D0IE 4ELUA 4LF2A 4JI0K 2D9PA 1UVNA 3UR0A 1L5UA 4CJSA 3MD3A 3CCQS 5AZJB 1GLCG 4G1QA 1NMDA 3TA1A 4CZHA 2WB1D 4C97A 4IG3B 3TZZA 2OPPA 1IWGA 2X6SA 3CJQA 2E66A 3IMXA 4UUWA 4R8UB 4YB5A 2PO4A 4FJMA 5CY4A 4TQSA 1EKRA 1Q7YO 2R8JA 1HNWF 2AT1B 4PKIA 5KG4A 3K57A 2DRAA 4KTZA 4ZHRA 3RBEA 4PUOA 4KH6A 3L6QA 2RE1A 2CQGA 4GV9A 2AV5A 4M8LA 2V8VA 2KYZA 1IBLK 3PTWA 2AJ0A 1TL1A 3SCJE 3QRQA 2NLXA 2XCPA 2ZJPL 2O3DA 3CJRA 1S9EA 2GO8A 5DMRA 2BW7A 5F8NA 1LW2A 5GAEU 4YFUA 3DYAA 2HZVA 4RBVA 4DPTA 4KHSA 1BIUA 5BRDA 4K4XA 3MN6A 2G13A 3OS2A 5GAEI 2FJDB 1ASWA 1KTVA 3U9ZA 5J1PA 3DOLB 3VEOA 1WNEA 4Q0BB 1BQMB 4QIFA 2MJUA 4QS9A 4B3SK 3TABA 1YT3A 3UE2A 2O8DB 3BGLA 3TAPA 3AVCA 1A6LA 1NGJA 4ES1A 5H9FK 4Y2MA 5FJ4A 3I55N 3AOCA 2VIHA 1YAGA 1KQSM 3BPDA 5AQYA 3W64A 2XS7A 3L8BA 3BZQA 2Z1HA 4CYUB 4C98A 2RE2A 2MGZB 2G8KA 3I4PA 6AT1B 4B3TJ 1EETB 2DEJA 3OL8A 3SQ2A 4FKYA 4MIAA 5M1QA 1S1XA 3KUEA 2L9WA 4LT6A 1UMJA 5GAHU 3CDBA 1R27B 3B4DA 3MECA 3A2FA 5DM7L 4K4YA 1ZBLA 2WAQD 4O3NA 3L2RA 5GAHI 2MDAA 1B92A 3EPGA 2MKKA 1JCGA 4NLYA 2MJNA 2GFFA 1KC8T 5E26A 3L0QA 2O4IA 3LWLA 1I94J 3NCRA 3FEYB 3WXIA 1CXQA 3RW7A 1IVZA 4ZOSA 3OTOJ 2ASOA 3MCOA 2VKRA 4CZKA 4CERA 4OGEA 1CZBA 3TR8A 4HT5A 3DXBA 3VR1A 1M1KT 4CK3A 4BRFA 2W9BA 3MCNA 1NPKA 2J4RA 1FKPB 4JI7F 1FXLA 2DFEA 3HVTA 1FDAA 4L76A 3NF8A 2Y0SD 2O8BA 1RCOB 1RE1B 1CJUB 3AGKA 1XC3A 2H65B 1N0VC 2W9CA 4K7QA 4MMOA 1WC5A 1JL1A 3KZBA 1PBAA 2DR6A 4HLBA 3L4QA 3KTQA 3D54A 5KG7A 5B0EA 3PW5A 4XO0A 2GEMA 4IFVA 1RAOA 5BPLA 1IM6A 2D0BA 4IFYB 3CJKA 4DR4K 5D0GA 4O4RA 1X9WA 4TY8B 2ILZA 4GKKF 2AMCB 4UOCA 4RW9B 1KQFB 3U4LA 4QU7A 4LRDA 4YHHJ 3KMSA 3DRXA 2NPFA 1FK9A 3SV4A 1VRTB 3EZUA 2I8EA 3ZTSA 4DR3F 1Q18A 1NHUA 1FNMA 2UUAF 4LF7K 1JX4A 1S72S 1VIXA 2M7SA 3VQAA 3BKUA 2VD3A 1ELOA 1RADB 1NDCA 3PW2A 3MXMA 4CLZA 4DV2F 1TGOA 2LA6A 4W5RA 2Z1GA 1EQ0A 2HKEA 1Y0HA 4F02A 1K44A 3TUPA 5AQSA 3W8GA 4WF9Q 3NOGA 3TR5A 4CGDA 2IYIA 2AKWB 1HKGA 3CPWM 1CZ9A 1GEHA 3NCQA 4TNOA 3RSEB 1TL5A 1Z1ZA 1WC1A 3QNNA 3MOJB 1NZAA 3G8SA 1S6QB 2P8IA 5GAGP 4E98A 4O0JA 2OANA 1HR0F 4FWNA 3DM2B 3AVAA 4L6V3 2HB5A 4USKA 3GDQA 3BKFA 4DTSA 2V8DA 4RWXA 2HBJA 2UUCK 2A3JA 4DQRA 1P27B 5F8GA 3RJMB 4Z7CA 1K0TA 3LZIA 2GMHA 4FZVA 3KLHB 1YJNS 2HLUA 1CPZA 3QNOA 5ETSA 1RDWX 3P5BP 1VLYA 5AQMA 4PG8A 1PGZA 5B0BA 2CPZA 1SL2A 2OYQA 4KHPJ 3RW6A 4BS2A 3A5OC 2NYIA 2IRYA 2YCHA 2WOMA 4J37A 2RJZA 3SZ2A 2DB1A 3HHLB 4WPAA 1MWKA 2OO4A 1WOQA 4ED6A 4O0IA 1URRA 1JNZB 1GMUA 4J9NA 2VU5A 3A8YA 1OSDA 3CD6N 1QZ6A 1X8DA 4P75A 1G99A 3JYTB 2YJEA 4MLEA 5HQMA 2KRRA 2ZM6F 1U1PA 3H59A 3GFXA 3AA3A 3UR3C 1JKHB 3SCIE 1N6QA 3IBWA 3P31A 5KT3A 4KBIA 3VAKA 3PHEA 2OD4A 3PG9A 2H3GX 5JXSA 3DOKA 1XQIA 3PFEA 4DV0J 3LOUA 4I9QA 3BJYA 5U47A 2VQEK 2JGUA 2VBZA 4DCJB 1YBAA 2ZKUA 4WYBA 3CQ8A 4IR9A 3QYYA 3GBTA 1QS4A 2YWGA 1S79A 2MKYA 3PM9A 3SJJA 3AY9A 1K8KA 2MZTA 3K59A 3TAFA 4UQGA 2M0GB 3CCUN 2ZHAA 3A5NC 2O01C 4ALZA 1TKZB 2YX7A 5AXLA 4HH1A 2ZHBA 3CCQN 1HJOA 2CJ9A 3HI9A 3ZNJ1 3AJ2A 5RUBA 4WF9L 2HGMA 2CQCA 3CCSS 4C8NA 1U6ZA 4UF4A 3MEEB 4EUVA 2GAHC 4U7CA 5A8RA 3KOAA 3ENAA 3KD1E 4NXNF 1X5TA 2HMPA 1T03A 4F7VA 3VGUA 1X7VA 2D3OR 3O9SA 4N8NA 2XMAA 2QT7A 1SI9A 1GK8A 1HBOA 2B6AB 3BO4A 1R8BA 3Q8QB 1TYQA 2MMYA 3OQ2A 3OYCA 1C0TB 4BE1A 4NXMJ 4NA1A 4ANEA 2PI5A 5JICA 1O13A 4MO4A 1VYAA 1YKWA 2IPOB 3LDOA 4A8XA 4H4KC 4Q43A 3UN5A 3H46O 2COLA 1NLKL 2DGSA 3MM8B 1DLOA 3C16A 3EE8A 3EY1A 2ZE2B 1SXLA 4C8KA 3TJAA 2RN2A 3HBTA 4KGMA 2ZH5A 3OFEA 3MM7A 1XBWA 3WQUA 5AQFA 3G8TA 1NSQA 3RWUA 3GP9A 4K59A 1S6PB 3VTHA 4GC6A 3CXCR 1R0AB 5EGYA 4BE2A 2MKJA 2XULA 2IJNA 3Q8RB 4CJLA 3AVGA 4U7BA 2P9CA 4QWCA 4WTOB 1IKVB 4TLRA 1SUQA 4TLQA 4ID5B 3VQ4A 2HOEA 2XNRA 5E3AA 3ULDA 5IQ6A 4FJIA 4FVCA 3UW1A 2CXEA 3UFCX 2ROPA 4LF4K 1SL1A 4I67A 2OP5A 2VQFK 3IDHA 2NYHA 4GVLA 2BE9B 2Z2YB 1ZM3A 3TVKA 3T1YF 1J5EK 2P9LA 4RU9A 3G82B 3RAQA 3SCKE 1BCOA 4J9RA 2NRTA 5B0FA 4FP9A 3OV7A 2Q43A 3I5BA 1XWLA 4NASA 4HT7A 1YZ7A 4PQUB 4F4XA 2LDIA 4M5GA 1OH8A 5T7BA 4H4OB 5C2FA 5KPRA 4LRAA 1LV5A 5KG2A 1X4GA 5HQLA 2HWIA 1XNRJ 3THWB 2F40A 1P6TA 4IJNA 3MFHA 5B8HA 2YQ1A 1N5TA 3KK2A 4M5MA 1SL0A 1L3UA 4BC4A 1PC4A 4UTGA 3ZXWA 3FBCA 2EFVA 3VQBA 1T3NA 4J9KA 3SBMA 2GQCA 1Q4RA 2HK3A 1MNEA 4HACB 3SFUA 4R25A 1NOZA 4FK0A 3IFEA 2YNGA 2QLJB 3FR0A 4JI5J 4ZTFA 2W1BA 5GADU 1GH8A 2BMBA 3WDOA 1KD1O 1PO6A 3HVWA 3H2UB 2BX6A 3F9KA 4M5DB 1IKYA 4OHYA 1YITS 1HNVA 1KVKA 4KIAA 1KAYA 3MEGA 5GADI 2G8HA 1IM4A 4R5PB 3BB5A 4RLEA 1KLMA 3PRBA 1RDBA 2KW4A 4L3KA 4FW1A 2UV8G 2UYTA 5FDLA 4ZVTB 4CLFA 1FRMA 2HBLA 2G1DA 2HPUA 2WZ1A 4Y28C 3S8SA 2MKSA 4FXDA 4DLEA 1ESVA 4Y1DA 1RA7A 3E01B 3PJXA 3M30B 1M90T 3VENA 1U0SA 2NRHA 2HFSA 1DFDA 4ETXA 5LM7E 4FKXA 2N7CA 4YB6A 4DR6K 3TP2A 2V63A 4CW7B 5HRSA 4XK8C 3ID6A 3FVYA 4Z4IA 3AH6A 4YB7A 4B3SF 4W5NA 3S01A 4C6AA 2UVWA 4K25A 3FCVA 1P90A 4GKJJ 4CO3A 4OZLA 3TAMA 5DLFA 3VGLA 2MXYA 1JXBA 3JSYA 4Q2LA 1BIZA 2CDRB 3SI8A 2E2PA 2YX1A 4AHUA 4KH4A 2HNYA 2OTLS 3D66A 1REGX 3BR9A 2R7SA 2VHGA 1WTBA 2RRAA 3HPHA 4M63C 2AJFE 4B8CA 4NLOA 5ETQA 3J7YP 2O66A 3MMCB 1IG9A 4XH4A 5HJYA 5J2PB 2MQ8A 5C15A 1YJNN 1CQMA 4BRDA 1X4BA 1VRUA 2DITA 2P9IB 1DARA 4DX8H 2PIIA 4HWIA 2IFXA 4DLGA 2P9SA 3W8PA 2YNIB 2HW3A 3DXKA 2DNGA 2KT2A 2N4DA 1HNWJ 2ASDA 4CJ3A 1U2VB 1RT5B 1L3TA 3V6DB 3M2VA 3CDUA 3HMJG 3C15B 4AL7A 4FSVA 3B6OA 4KFBA 1NZ8A 2V69A 4BRIA 3DU5A 1GAOA 2HVHA 3D7EO 3IS9B 4CLWA 5THWA 2YHYA 4JI2K 1T3OA 1UVMA 4M3RA 4HUGA 4ZP6A 4EFHA 4KB7A 3M8WA 1H2UX 2LQ5A 4PKHA 3CULA 2RS2A 4Q8FA 1TVRB 4K42A 4ZS6A 1UJ6A 1LOUA 3TEHB 3K17A 4DS5A 2DRDA 1GTEA 1B9FA 4X4QA 5HMWA 4H4MA 5H1SV 3EE3A 4K4UA 1HD1A 5C42A 3SAHA 1GXLA 2E5IA 3VMFB 3FLCO 3RAMA 3IO1A 3BBCA 3JXUA 1VQ6S 3AA4A 2MQOA 2EBEA 2LQBA 2UXCK 4NOHA 1GMWD 1BQNA 4OHWA 4FYVB 1IKXB 2WHOA 4DR4F 3JSMB 2BGGA 4YMEA 1EIYB 1VK3A 2AYMA 2AYEA 4ZVHA 3W63A 3OVSA 1NG9A 4ED2A 2RMLA 5A8KA 4DPXA 3G6VA 1TKTA 1MG7A 2R2UA 2HMIA 4OJHA 3THTA 3EM1A 3HVRA 4H5RA 4QJVA 1TELA 2WFBA 1JLEB 4AM7A 2XMMA 4BG9A 5F8LA 4F50A 3C7NA 3H2LA 3CCSN 3GILA 5GAEP 5A76A 4LF7F 1FESA 4M5IA 3CCEN 4BRNA 3C14B 4JEPA 3QQCD 4IO8A 1S1TA 1TUUA 5AQNA 1MA9B 1H74A 4K8XA 3L3VA 3PEHA 2X7IA 4PA1A 3PLAA 4Q45A 1RDAA 2XWYA 5DETA 4JI7J 3T7ZA 4CZJA 2V4RA 3BGRA 1BDGA 4MDBA 3HSJA 2OTJS 3FUYA 1TL7A 5KFJA 4W90B 3M1VA 3CM5A 5D3GB 1NJZA 2FBYA 4MFBA 4CFBA 3I32A 3CJ0A 3L3CA 1WOOA 3Q89A 4DHYA 2OA8A 2RHQB 1FVQA 1K73O 1ZAVA 2QTDA 4CGHA 2GMLA 3LDNA 3FNNA 4TY9A 3IXQA 3U8XA 5IV3A 5IZHA 2UUCF 2CG8A 1W2BR 4H5NA 1D9FA 3GCWP 3MM5B 3WXJA 1CBKA 1WLJA 4JS4A 1VSDA 3AHPA 4QYZK 1M5OC 4OZNA 1S0MA 3IR7B 4I6YA 4BRLA 4JI8K 3QBCA 1S97A 4I2QB 4OO1J 2NPIA 2X1AA 4JHDB 4GKKJ 3MD1A 3R8EA 3M6XA 5HP1B 4KKOA 3V9XA 3U7JA 4OI6A 1FI4A 4FJNA 1WACA 1S57A 4BRAA 4X4VA 4BCAA 2QLXA 2FVPA 3AXMA 1R7IA 2XMWA 2MKIA 5C25B 3CCJS 5KAKA 4WKYA 1QDUB 4H5TA 1YVFA 2XLKA 1RTIA 2XB2D 1I51B 3HHEA 4DR3J 1X4HA 3N4QA 1XNQF 2GUIA 3WHIA 4L3QA 2UUAJ 4P6QA 2YKQA 3R6GB 1RT3B 4HI2A 2DXFA 3NHGA 1CJVB 1FX2A 3HD1A 2OCEA 4DV2J 2FZCB 2KT5A 3HHNB 2R8IA 1RBSA 1X4DA 3PW4A 1IKWA 1ZM9A 4B1WB 4N41A 1IXKA 3S6EA 2VQEF 4TYAA 4JI3F 4PXCA 5HROA 2FUG9 3TSUA 3R3TA 2J0QD 1X9SA 4ZP8A 3GZ7A 3GCXP 5GMEA 1RT2A 3KK1B 3RGIA 1HR0J 3QFHA 2WVDA 4CDIA 2V2QA 1Q81O 1ZTWA 3SDEA 1WC0A 5EHHA 2XSFA 3SPYA 2KT3A 4JN4A 1RA6A 7FDRA 3IR5B 1N0UA 1Y97A 3DGVA 3PW0A 4OMFG 3V81B 4LY7A 4F2SA 4D3HA 5AE1A 3VAHA 1VDHA 2UU9K 3VQEA 5E33A 3ELHA 4I7FB 1YITN 1R8HA 3BF4A 1UZDA 1HLWA 4TU8A 4A62A 1KQKA 5ETLA 2O8FA 5CD4A 2VWKA 2XGQA 4NX9A 4F3OA 2AYBA 3LDPA 4KGVB 3DLLQ 4KB0A 3AVNA 3LAKA 3GG0A 2OPQA 4BR7A 3RRHA 4ECXA 3SSRA 3MMAB 5CYJA 1Q82T 3VESA 2A10A 3ID8A 3AA2A 1RU1A 5KFRA 2LXFA 1LFPA 3IG1B 2CQBA 3MK6A 2G8IA 2IS3A 3JB9k 3VGMA 5L8RC 3M9NB 4P71A 4DG1B 3P6YC 2E6MA 4CJ4A 3UKRB 4FVUA 3FRYA 4DV1K 5BPMA 1VQPS 3LP0B 3DXMB 4EBEA 2G8VA 4OZ5A 2OIHA 1WD6A 2CGKA 2I7NA 2P9NA 2IRUA 4CGFA 3DU6A 1TMMA 2JEGA 2WBNA 2C2KB 3DLHA 5J2NA 3ZT2A 2F8EX 2DPIA 2OTLN 3OLAA 3H8YA 3NGIA 4FWMA 1KS2A 2D1KA 3QT7A 3ILOA 5HRRA 3L7UA 4RNHA 4RUCA 3FFKB 3ENQA 4IEIA 1QQMA 2BXJA 1SKWA 4LF4F 2J0XA 2VQFF 2R7RA 1FKOB 3EPIA 3SQ1A 5AQTA 1FJGK 4CE9A 2R42A 1VQ8S 4CJTA 3MMJA 1K8AT 2J7UA 2MHEA 5E3QA 1QM9A 4W5QA 3I0SA 3NH1A 1P9QC 2BW2A 3D9BA 3HI0A 4CEBA 2JDJA 3KWIA 1HIYA 2NXUA 1Q5YA 2FGOA 3K7RA 4H0PA 3CETA 1YWXA 5L1LA 4HDHA 3LL3A 2HNDA 3OBIA 1FFWB 2QEXS 3OYNA 1DHMA 3D6HB 2W2MP 3O1WA 1S49A 2IC3B 1B3TA 3OHRA 8ATCB 5IM0A 2GO9A 3RB0A 1WUAA 4OJGA 2V94A 3VPZA 1VQ6N 4KHWA 3I5AA 3DLLL 4OLAA 2AWZA 1NGCA 4BRKA 3IGNA 2YY3A 2YKOA 4FK2A 1V4SA 4O0NA 1RAJA 3OFGA 4M1KA 1WG1A 5C0YA 2H3EB 2LU2A 4HR2A 1P8GA 3SAGA 3W5ZA 1PYOB 4ZVGA 3P4IA 3TEGA 3I0RA 1UWBB 2Y8YA 3HOTA 4LFBF 2W40A 3KVGA 2X1GA 3TRGA 2VCPA 1BUPA 4ZJLA 2RRNA 3DJCA 3T1YJ 3MN9A 1HBMB 1NDKA 3JQKA 3LPYA 1YJVA 2HAFA 2V7ZA 1S1VB 3A4TA 1ASUA 1SZ2A 4JKDA 3ET6A 3KMQA 4MK7A 4DR6F 3CPEA 2EC0A 1N36K 1QE1B 3D6FB 4MT1A 1HYSA 1V4TA 1EB0A 3UE5A 5LL6Z 1HW8A 1MLAA 1NSKL 4ZJQA 5AZIB 5AE3A 3O6QA 1KXPA 1TL3A 3MM9A 2HYIB 1X4FA 2OTJN 1NK8A 1HBUA 2QFIA 3J81j 2GX8A 1NPRA 1W7WA 4DL3A 4K5SA 4A8YA 4IEEA 5LL6d 5KQDA 3U1LA 4CEQA 1S5ZA 4C11B 3SIPB 5GIOA 3KK7A 1FRLA 3W9IA 2D4WA 2VC1A 5D0HA 4CLLA 3R5AA 3FGVA 4ZVPB 5LJVA 4FYDA 3CTRA 1KWMA 5L39A 1S6UA 2DNYA 1S5JA 3AA9A 5I4MA 2ZJQL 2YJFA 4CFAA 1XTZA 2ZEJA 1S1WB 3ZSZA 2FVSA 3QPIA 5KFAA 3ZSWA 1X4AA 1RTJA 4NE9C 4WXOA 4ECZA 5HO4A 2CYYA 4I2PA 1SVDA 1SC4B 1FFSB 2EKNA 1Q8BA 4Z7YA 2GNKA 3BZKA 3IRXB 3CCJN 2A2CA 4J90A 3M1FA 5DO2A 5CZ2A 4FZZA 4OIXA 3RBXA 3QEXA 4NYNA 4FF4A 1SV5B 3OUYA 1GLAG 2V4JA 2YWKA 2FJWA 1CJKA 2IDLA 5FPDA 2EBGA 5BR8K 2BZ2A 2R7VA 2FF6A 3VVUA 4B3SJ 2KN4A 2GIRA 1O8BA 4CHOA 3LA0A 4L75A 1ZBSA 2UXCF 2A6AA 5H9FJ 4Z4EA 2EKYA 3GL1A 1T0TV 2B8PA 5GADP 4A8MP 3T1AA 1A9NB 2R8KA 4NPOA 4FJ5A 4EK2A 3NCPA 4CT9A 5F9NA 5HVHA 1RTZA 4CJRA 1TKXA 3LGHA 4K0KK 2PA8D 4KH5A 4DU3A 5A6WA 3ZT1A 1FNOA 5KT5A 3BSNA 4HUEA 5EDWA 2IVYA 1NMEB 3GSIA 2DR5A 4FJ8A 1JLQB 1PYSB 3ZX3A 4O44A 3MM6A 2HFUA 1AZSA 4EWTA 1U8WA 3C3LA 3ITHA 4IH6A 3UDEA 3G6ES 4DXLA 3MXHP 3A1YG 1ZAWA 4HTUA 2P2CB 2POKA 3TJ8A 4DL4A 1WEYA 5SUHA 1K0VA 3UVJA 1YJ7A 4XAKA 2HHVA 2W4DA 2M88A 2ZWPA 3A8EA 4EGLA 3HOSA 4DUYK 1SJ3P 4BC2A 3HSTB 1KVIA 3H4DA 3M8YA 5KFSA 3VHQA 3KLIA 3SJHA 5F41A 3PHTA 4G9ZA 3DRRB 4JKEA 1T9TA 2GVDB 4MQ3A 1OKJA 4DX6A 1J5OB 3MMBB 2J7WA 4NI2A 3MN7A 2ZH2A 1YF5L 2HURA 1WNSA 2DNRA 3ICLA 2VPXB 3C95A 1V5IB 1FXRA 5AQRA 1LW0A 2DHXA 5I42B 1UEKA 3CUNA 4AFFA 2HGLA 4CNZA 2VG6A 2XI3A 3V1OA 4GO7X 4WFNQ 1XQSC 3J7AP 1FWPA 1VQPN 1EQMA 1WEZA 2OH2A 2XMUA 2O1PA 2AIRB 4G1QB 4DR4J 1HWKA 5IT0A 2UXDK 3QLHA 4U7UK 3I56S 5M2PA 4WYWA 2WW8A 2G2YA 1O51A 3DLEB 4I6AA 4NLGA 2OPPB 2HFVA 1DQ8A 3U3GA 4FM1A 2OPRA 4XH5A 5C5JA 3CC2S 1RDUA 1VJWA 3MPYA 1NGGA 5KT2A 1FJ7A 2QX0A 3EZWA 5FLXO 3L9ZA 2IGIA 2MQLA 1S4FA 4ZHRB 3DLGA 4PUOB 3ZZ0A 3VZHA 3NGYA 2XZTB 3K89A 4Y3CA 2DH9A 1TL1B 1S9GA 3R7SB 1RTDB 4LF7J 2FBXA 3ZETA 1LW2B 3DYAB 1VQ8N 2GELA 5ETMA 3PO5A 2XRIA 2ZBPA 4E7JA 2ZH1A 2ZITA 4N56A 1SQFA 2F8TA 2XGPA 5KFKA 4DPUA 4ZP7A 2I1RA 3CFRA 4KTQA 4U6PA 2I5JA 3RRKA 3LAMA 4MKVA 5IXUA 2DR7A 2Z1JA 1D5AA 1NH7A 3VA0A 2E5JA 3OHAA 3UCGA 5GIPA 4ZLPA 4PQAA 2LYVA 3QO9A 1BE4A 1ZBUA 3O2IA 3VEXA 2WTFA 3HCXA 2UUCJ 5LXRA 2ASPA 3TSPA 4ZITA 4B9NA 3SMSA 2J5AA 3QSYB 2BJ9A 2IM1A 1WSEA 4CI6A 5M1NA 1S1XB 3DRSB 4NO7A 5DK5A 3HULA 1J53A 4RW6A 4IYQA 2AJ2A 2UU9F 4J2AA 5KFUA 3FBFA 3VQ5A 3WIVA 5E3RA 3R6MA 2C3OA 4GV3A 3O9QA 1Z2LA 1VBYA 2I7PA 4WFXA 2F96A 3SQGA 3OVBA 1LWCA 1AB8A 1VJQA 3WT0A 4ECSA 3OBYA 2KVIA 4UT4A 4C3LA 1ROFA 2WVCA 1D0EA 1XNQJ 2UXBK 2A40A 1TP7A 2W9BB 4IRCA 1YQHA 2LFVA 3NLCA 2B9YA 4C1NK 4BC7A 2CPYA 2FBVA 3ZSOA 2Z2ZA 1H7WA 4JD2A 1RBAA 4KGZB 3HVTB 2HZCA 4FJXA 1MU2A 3SI6A 2O8BB 2KI2A 3IR6B 3H40A 4JOUA 1V3ZA 1K47A 3I5CA 1RWVB 1D4XA 2R7YA 4IDKA 2VQEJ 4DV1F 4ZVEA 4JI3J 4U9RA 5C10A 5FIIA 3H1VX 3I82A 3GIIA 2BBEA 4IFVB 5I9EB 1TZ0A 4DQIA 2QWLA 4CJQA 3TSQA 2BQ3A 2XSJA 4ED0A 2QL7B 2B9WA 3B8HA 4PG7A 4AHCA 5BYSA 3Q0AA 1HLUA 1QAXA 5CAAA 4ED7A 2DO0A 1E4FT 4OI3A 4PPDA 1TUGB 2VBXA 3EGWB 2DGTA 3CCVS 1WHVA 3MURP 4DL7A 2PFDA 2G8UA 3H5UA 1R89A 5K5MA 3OYKA 4BC3A 4UY8T 1WN7A 4ILJA 3CM6A 1FJGF 5AJ3K 4BWMA 2IVPA 3WXMB 3O4QA 1Y11A 2JRSA 3P5TL 4F04B 3R3LA 2AX0A 4GVMA 1EQYA 5IQQA 3F2KA 2HRUA 4DTNA 3VEYA 2ZBIA 2ABYA 1U1OA 4NLCA 2IM0A 4WZQA 4RG8A 4X84A 5C7PA 2HBQB 1XMQK 4QQBA 1N8RT 2AF6A 5KFZA 1BOTO 3VERA 4DV4K 4QWEA 1UEUA 3M32A 4DPOA 2RF2A 4CBXA 3N5BA 1UVKA 1WOSA 2V4QA 3CJAA 1IJJA 3M8SA 3NMUA 4N5SA 2YQ0A 3IUCA 2H9ZA 3SK3A 4X4PA 4YR2A 4E2FB 3QATA 1BU6O 3T5JA 1RILA 3F0NA 2OZMA 1RNHA 4NYOA 3PV8A 3W2VB 2HQFA 3NF7A 4OX7A 4KO0B 1HQEA 4QR0A 3LP2A 4GC7A 1T94A 5LXYA 3THVA 3M6WA 3OSPA 4OGCA 3IWNC 2EG2A 2YNHA 2WCXA 2YPZA 1AROP 4P2FA 2WOMB 4BVPA 4K4ZA 3VQ9A 2CQIA 4LH4A 5E84A 2BJ1A 1U26A 4LF4J 3LALA 4NLPA 4DTXA 2ZOMA 2VQFJ 1OY9A 1X3MA 5KFVA 1KLNA 5FPNA 4I64A 3G6EN 1J5EJ 5IFMA 3NNCA 3EGNA 1XIQA 2PFFB 4Q2MA 1QZ5A 5FPMA 1N6QB 1N36F 4J2BA 1VQKS 4BDPA 2EFGA 3DOKB 1U47A 2IJRA 1WF0A 4PG6A 1KC8O 5DLGA 4O4GA 4DL6A 1VSHA 4QW9A 4FWLA 1FX4A 1H0HB 1PCAA 3W66A 2KL8A 2DRBA 1ZH5A 3HSCA 3OD2A 1YSJA 2X51A 4EZ6A 2N3OA 2C3MA 1YJUA 4ICLA 5CYMA 1E6VB 3GV5B 1BA1A 1KDNA 2MKHA 4C9DA 1U04A 3L4IA 1JLCA 3QGHA 2I2YA 4K4TA 3NMRA 2RU9A 4GV6A 4XIUA 1KP6A 3HSDA 1U0HA 5M1PA 1C1BB 3IAS9 1H6KX 2GCFA 2XCAA 4LQ3A 1R0BG 3J80Y 3M2UB 4EHUA 4C8MA 3I56N 2ZNYA 4IRKA 2YKMA 4FLYA 3I33A 4LR8A 2RD5C 2KYXA 1RHUB 3BSCA 3CC2N 4FJHA 4ZPDA 1LK5A 1BLUA 4NWBA 2W41A 4E7LA 2MZQA 2W2PP 3H20A 4DSJA 2CJBA 2B4OA 1NJIT 4CBWA 2B4PA 1X31C 4HVJA 1FRKA 3OVAA 5A8RB 2ZOGA 4LFBJ 3AA8A 3TTFA 4NCGA 2GGPB 4EEYA 1T03B 1Z25A 2UP1A 3H08A 4X2BA 1K6YA 2FC9A 1WF2A 3W2WA 1HBOB 2V2VA 2VPZB 2A1BA 4Y34A 3GQCA 5BRFA 3FE1A 4CM2A 4DR6J 4FK4A 2L08A 4HVZA 3QFPA 3I6PA 3US5A 1R59O 1Q9YA 4YS2A 5BR8F 1FRXA 1DLOB 3C16B 2PYLA 2DIUA 3ZZRA 1SIWB 1AFJA 3OS1A 4C23A 3MM7B 3KG4A 2E1YA 2G8WA 4M5LA 2KJVA 5HLFB 5K8PA 4OKJA 4GKJK 3LM9A 4DMNA 3S3MA 1IJEB 1HHSA 4RJVA 2O67A 3MPWA 3MN5A 3AO2A 4ZMMA 3SAFA 3IA0A 4X65K 2ZH6A 3MCAB 4DFJA 4K0KF 2CQ3A 2WONA 1UTAA 2ERRA 3OYDA 4ZLNA 3SQ4A 2JC1A 1SUQB 3NE6A 2RNEA 4WU2A 4Y00A 3LO3A 1SIZA 3PNIA 1EX8A 3K0JA 1CXUA 4RCHA 1HI1A 3CD0A 1OO0B 1VQLS 3EEQA 5FPEA 2YBVA 2V52B 1WSFA 1WG5A 5F9LA 3H4BA 2P5OA 3KLGA 4GMKA 3ZTRA 1NDPA 5CE3A 4F36A 4ID8A 4P2SA 2CDQA 3G25A 1E4GT 2EX3A 4PWDA 4DUYF 4RTFD 5JMVA 3HTVA 2D74B 2F7TA 1FTCA 4DKWA 3AO3A 5ADXH 2YWWA 4LSLB 2FVQA 4B1ZA 4HH0A 3QMLA 1YUWA 1TV6B 1HYZA 1TAQA 1F5BA 2E1PA 2FXUA 2GA7A 1X4CA 4TN2A 2MLYA 3KK2B 4CP5A 3BUZB 3THPA 4Z4GA 1S0OA 4B3OB 4W4MA 1VGYA 4BQLA 3ENOA 3A8KA 3J80U 3BSOA 2F8SA 2EEYA 4ZVSB 2FHMA 2UXCJ 2Q3SA 3KXDA 2KH9A 1HPZB 5AQXA 3CCLS 2MYFA 2UXDF 1GTHA 2ZF5O 4YOYA 3TWZA 5HRPA 1SJ4P 4C8OA 5LOQA 3QFWA 1HNVB 3RBDA 4ETZA 3UD3P 3BREA 2VZ9A 3L2QA 2BV3A 4F0HA 5L9XA 1KLMB 2W4CA 5CABA 4FLUA 3P3DA 4CHQA 2RDIA 1N48A 4O23A 2HNZA 4CT8A 3VQ6A 3CCVN 1JXLA 4RU2A 1ACMB 3NH0A 3R1HA 4CEOA 3R9PA 3PY8A 5AQVA 1S1UA 2UUTA 2G4BA 5AZJA 4IOAQ 3BP8A 1WUUA 3ZYYX 4H5VA 2GHPA 3E9LA 3I4HX 4IG3A 3MAAB 2QYCA 3IGVA 1T6CA 3VVTA 1X5OA 3JAMY 2CQ2A 1WSGA 4CZFA 3HVAA 3L4BC 3D1QA 2AEMA 1ULRA 3KKRA 3O1LA 2RVJA 2VASA 3KYLA 1C0MA 2RSQA 2QE5A 1XJWB 4YQWA 4DTPA 5AQKA 4MYTA 2YNFB 4DU8A 4KHYA 1FRIA 3TAMB 1UA1A 3J7A1 2JWNA 4USIA 1NWKA 3ULEB 3V6KA 2G0JA 3HF5A 2G0CA 3A5MC 5EY4A 1RACB 4PKDB 4DSKA 3FCHA 2H51B 2GX9A 4QYZJ 2H5JB 2HQDA 3WC0A 4MH8A 1LXNA 3AB4B 1IBKK 1RI7A 2W6KA 4N7TA 9RUBA 5HANA 4AXJA 4Q0BA 3MDQA 1BQMA 1DBDA 1R8AA 4CH0S 4H0YB 4P7TA 2O8DA 1OVYA 3O8WA 3CO9A 2YX4A 4DI6A 3H25A 4DQSA 2P9SB 3HYFA 3OYGA 3DXKB 1A7GE 2JNJA 4ELVA 3OL9A 1FERA 3TW0A 5AQGA 2N82B 3F56A 4I6MA 5JS1A 2ZNZA 3KKFA 1BWVA 4KFBB 4OZ3A 4CYUA 3AVBA 1R3NA 1EETA 2UXBF 2E44A 3T1HK 2QZ8A 4MJKA 4E7HA 4DR3K 2LKZA 1G15A 1RABB 5MLCV 3E1YA 4FOIA 3NNHA 2UUAK 4UZCA 3TU5A 3KHRA 1QAYA 2KZMA 3Q23A 2NRXA 1YTUA 3WIUA 2GUPA 3MXIA 4ILGB 1VQKN 4JKFA 3PIOQ 3QZ8A 5K14B 5D4PA 4L8RB 5B0DA 2CPFA 4FWSA 1XMOK 5JJBA 2LCWA 4A61A 3J7AN 1FDBA 3AJDA 3AO4A 4KR0B 4A8FA 3IM9A 4KSEB 3ZZTA 2YHAA 1EAYC 4IOAL 1FKPA 4KE5A 2RKIA 4OX8A 3ZX0A 1GLDG 4GNIA 3V1QA 1UVLA 3G71S 1H38A 3K8WA 4DR1K 1TKTB 1CJUA 3OR2B 2HMIB 1NGDA 3VQTA 2VWJA 3LDSA 4NLQA 1RAGB 1AA1B 4JAXA 4CJVA 1U1NA 3V9SA 2D7SA 1X4EA 1GQEA 1RWNB 2UU9J 1I1GA 2ZZMA 2OEMA 2KXNB 1YXQA 5AJ3F 1R8CA 1N33K 3C7NB 5LJWA 1FA0A 3OYBA 4CF2A 2DGXA 1C0UB 4ZTJA 3UQSA 2NZ4A 3SBTA 4HYKA 3B4MA 2FHOB 3T6JA 1S1TB 3VAIA 1YBUA 1XMQF 5KFBA 1RYRA 4RW9A 4DV4F 1UFWA 4UOHA 1B70B 4ZVRB 3DOMB 5T7LB 2E1CA 1NGIA 3MF5A 4AXIA 1YTYA 2PD1A 3AB2B 1WTFA 1D8ZA 1KBRA 1U1QA 3BGRB 2C2RA 3OVNA 2BYCA 2ZM6K 5BPNA 4B1UB 3Q22A 3M1VB 2BJ8A 5EWEA 5JVHQ 2DXDA 1ZYQA 3D2FA 4EHTA 4X4SA 3NXZA 2CPEA 1KAXA 3TOQA 2AP1A 1UPMB 2P9KA 5GINA 4DV1J 3M9OB 3GR0A 1C1CA 2BKNA 4ZPWR 4EZ9A 2ZUAA 1M5VC 1M90O 2RB7A 2Q31A 4LSNA 4F26A 2OJ3A 1RDRA 3W62A 3CB4A 1KN6A 1JLAA 4XPEA 3V6JA 1VS3A 1LWXA 2F65A 2XY8A 2B5JA 1OSCA 2Q0RA 4LSZB 3QWUA 2DYAA 1LOTB 4RW8B 4DOZA 3W7BA 3Q83A 4KKOB 3PDNA 1S6QA 3TUJC 3N9UC 3LZJA 4QOTA 3THYB 3PIOL 2MPUA 1KRPA 5ETPA 3PKMA 3A0IX 1FJGJ 5M1FA 1RTIB 2P9PA 4N8OA 4Y6IA 5IWAK 4JB8B 4M63A 5LMNF 4FPBA 4JP8A 4RNMA 1F0XA 4KQZA 4QPXA 1FW6A 3BKTA 3OYFA 1N56A 3MUMP 1AUDA 1WC6A 4NXNK 3JXOA 2DGOA 1YDLA 1LXJA 3FQKA 1WDTA 5F8HA 4MDAA 2K7JA 1UWAA 2NZTA 1XHZA 4USVA 4TU9A 1HQUB 1FRJA 2JX2A 2FC8A 2NRZA 3T9ZA 3Q8PB 5KG1A 3HHLA 2KFZA 3BO3A 4BRGA 2DNOA 4EU0A 5HSPA 5EX3A 2IMWP 4G65A 1RT2B 3GU0A 1AW0A 3SFGA 4OI0A 2FPHX 2OI2A 2QGFB 4F4WA 5K9FA 3QJPA 1JKHA 3ZZOA 4ECVA 1APSA 2HSTA 3DDNA 2D3ZA 4JV1A 2JLEA 3QGPA 2KJWA 2YXLA 2OEJA 2L3MA 5JS2A 4PR6A 3CCLN 2DGVA 3M6VA 2M4MA 3VEVA 3L2WA 2QG9B 3DNCA 3VAGA 5AQWA 4OHXA 4YP3A 3P45B 1S48A 4F8RA 3GSDA 1F3VA 4BVOA 2BOAA 2OELA 1FJCA 1S0VA 4DV5K 3R1LA 2BRLA 1RT4A 1A0OB 1UFLA 4KGKA 4OX6A 5HK4A 1NO8A 3RU0A 5KFMA 1VR6A 2KHOA 4G6VB 2QRRA 2YHWA 1TKZA 2HRTA 1KVJA 1Z2ZA 1H1VA 3R5JB 3FGUA 4DTOA 2BOPA 4MKAA 4USWA 2IAJA 5ETRA 2OSQA 3TZWA 3D6TB 2X74A 1LAWA 2V7YA 1T02A 2MTLA 1V3RA 1N36J 3CERA 4CLKA 2VYPA 4WBFA 3WEEB 4A59A 3LF0A 1X60A 3BEGB 3PRDA 1OPZA 3QGGA 1JL2A 4DUZK 1SKUB 3RR7A 4P7VA 2ROGA 3H5XA 3MR3A 2NQPA 1KVCA 3DLRA 3CJ4A 2L9NA 1NPPA 1ZS6A 3TPQA 2CUYA 4BROA 2DNZA 4OYMA 5F1XA 2NUHA 5LJ5Y 1UJ5A 2DNLA 3H0PA 4X65F 2H5IB 2AZ3A 3SUOA 1QQOA 1VHFA 2ZGZA 4ED8A 2NSCA 3PJ9A 3FSXA 2C2OB 4FXVA 3VN5A 3PX4A 3CEDA 4FYWB 2QKBA 1TFYA 4CEFA 4OPHA 2V8PA 3ZZPA 2ZE2A 5A8WB 1VHXA 4A47A 3DWLA 2HQIA 2UVVA 4DTRA 3S1TA 1IR2A 4JK7A 1R0AA 3M8PA 2CQ4A 1BHLA 1ATSA 4IH7A 2M3DA 2G2ZA 3N6MA 3O8MA 1WAJA 5KFTA 4A5AA 4EFAC 3O6WA 4ID5A 5AXMA 1K1SA 4ZCKA 2XMVA 1NDLA 3P49B 5HAOA 3K5LA 1B0TA 3LDQA 1G4CA 3AXKA 2IVNA 3K58A 2EI5A 2WUSA 2HNDB 5L1KA 1SH0A 3CG7A 4TKTA 4ZK7M 4LMZA 4J9VA 4M5NA 3C66A 4YUDA 2VDHA 5A2QY 4Y1CA 3UB5A 2LEBA 5BR8J 4PWUA 4NLTA 3AVFA 4ZCIA 3G82A 1M5PC 4DHVA 3LGMA 2NRWA 3OW2M 4UQTA 4O3PA 3FMBA 3NS5A 4B1XB 2BM0A 4IOCQ 2BTFA 2Q1LA 4PQUA 1L3SA 3TARA 2XYPB 2PGCA 2XMTA 1QVFR 4H4OA 2B4VA 1YGYA 4K0KJ 2KVQE 3THWA 2XWXA 4RX6A 2UZAA 3OTEA 2MZRA 4FWRA 2UUWA 1I6JA 3G71N 3HSZA 2A2DA 1JIHA 4USMA 4E89A 3H42A 1WBBA 1A5VA 3I0RB 2G2OA 3MPDA 1D3WA 2EPIA 2W7OA 3EZ5A 3PO4A 3TAEA 3F41A 2MSSA 3GIRA 3MPUB 2QTWA 1BC6A 3ADAC 3P1GA 2L9DA 3HJVA 4RW4B 3SCXA 3GONA 4IO9Q 2CJKA 2D3UA 3L3UA 4M5DA 2KHCA 3HZ6A 2CZ9A 4HHTA 3HFZB 2PT0A 2VFVA 4DUYJ 2R2TA 2KFNA 2PEHA 3OXLA 1HYSB 1GMVA 3NP5A 1NK9A 1G1XA 3CMES 1C4AA 5SWMA 2GW8A 5LMUK 3BS9A 2OSRA 5KG3A 1TL3B 1RHQB 3MM9B 3ILJA 3RZAA 4JI4K 4FLWA 1EWRA 4E8UA 1AUSL 2BJEA 3BF1A 1HBUB 1GOBA 5HI7A 2A0FB 1K73T 4X4TA 1JLGA 3H5YA 4KI4A 3QRRA 1IBMF 3E01A 3RB4A 1NNEA 1S0NA 5IS2A 4DV7K 5AQLA 2OAUA 1NM1A 3T5HA 4CGIA 2PN6A 1V6HA 3NGRA 3OJSA 1NH8A 3IP0A 1IBKF 3K0SA 4X4OA 2UXDJ 3OYMA 2BACA 3M2RB 2VV5A 4YDUA 2KM8C 2QA4G 5J2MB 1NSPA 3V9UA 2F5GA 5G4DA 2UV8A 4B9SA 4FNHA 4WFZA 4CJWA 2ILYA 2XHBA 3CT9A 5EXWA 2BE2A 3NAIA 3MUTP 1XMBA 4ZVFA 4NCAA 3ENHA 4I2PB 4NYFA 2QWQA 2QW9A 4HI1A 3ZSVA 2RHKA 3H5SA 4DR7K 4UW2A 4JBCA 3T1HF 5A2QU 4IOCL 2QYGA 3VQCA 3WNGA 1SJ1A 1NK7A 1IUJA 1CJTB 4TXSA 3A13A 4KBOA 2C22A 3OUYB 1U6BA 5AXNA 2P9IA 4MLHA 1F21A 2CNKB 1O6XA 4WU3A 3SQOP 2YNIA 1F9FA 4LUBA 1VQ9S 1WKJA 4JV0A 3DLJA 3MFIA 1U2VA 2VG5B 4X64K 1U02A 3V6DA 1T05A 1T3VA 5HMZA 3BYPA 5F0WA 3ZZZA 4M41A 3OA9A 1XMOF 3OTBA 4YN3B 3VQ8A 1OMSA 5GMDA 4RUBA 2PMZD 4JRPA 4GMJB 3MUVP 4C8ZA 1XEZA 4LF8K 2CH5A 3D7SB 4JNEA 1YZ6A 1Q81T 3QIOA 1AT1B 3TYTA 4IO9L 3EL2A 5BR9A 1TKXB 4HTIA 4DR1F 5AE2A 4CK1A 4IFEA 2CVEA 4JLHA 1W0HA 4CHPA 4P9SA 5M2RA 3SSQA 3U1MA 1VRQC 3RYLA 2ZBRA 4BREA 3HHKA 1C0GA 4O55A 4QOZB 2V2KA 1N33F 2VBWA 1WAFA 2DH8A 3MEKA 2Q3PA 2FJVA 3N6LA 2I9SA 3OTDA 3C6UB 3D0HE 2J6UA 1FD2A 1M0SA 1IKXA 2F7VA 1HBNA 2IOCA 4ILRA 3T9NA 1HKBA 3DKDA 1D8YA 1RHJB 2ZH3A 1BISA 2RDDA 2LQJA 2VONA 3UVJB 2F9TA 4NCBA 2NR0A 2UXBJ 4MTPA 4DV6F 4UY85 1XI1A 1G6BA 2MY7A 1NK0A 1KHWA 3ULHA 1XNQK 3AD9C 4K8ZA 1JLEA 3KLIB 2B8QA 3W65A 3MWTA 3THXB 3M6UA 2HVEA 3VQDA 4NI2B 1TL4A 3B78A 1VC6A 2RQMA 3NGDA 4O8KA 3NCIA 5HATA 5HOOA 1E6YA 4OYOA 4IQXA 1WJ9A 5EU7A 2D5RA 2Q36A 3C14A 1HFEL 4CO1A 2VG6B 1WHYA 3X3UA 4WE1A 2BA9A 4JI3K 4I9LA 4BRCA 2AW0A 2DFHA 2NNWA 3QAEA 1U24A 1Q8KA 4OQJA 1K9MO 3QLHB 4E1NA 3BPSP 3GIJA 3CVKA 2MQQA 2CQHA 4KYZA 2BUPA 2AZ1A 4ZPCA 4OJRA 1VSMA 3K5NA 4WP3A 1QVGM 5L1JA 3MTJA 4OZ1A 3CF5Q 3UKUB 1CS4B 2IJFA 2HHTA 5LSOA 2J8AA 1SJQA 4EO6A 5F0UA 2GJFA 2H54B 2XQCA 4JKHA 4CD3A 3D4JA 4FNIA 5HL7Q 3NAEA 3MM5A 2F8MA 5AJ3J 2O8CB 2JOQA 1HX1A 3BDPA 3O4NA 2BKOA 5IWAF 2O4GA 4B3TF 1YK9A 3N4PA 3CCES 3FZHA 3ZETB 3GV8B 4ZCLA 4OZ2A 2LP4A 5B0AA 3WX4A 3GJSB 1X9JA 1PSDA 4JHDA 3I87A 1XMQJ 4MK8A 3BGUA 3RBZA 1S59A 3EWGA 1T44A 3MXJA 4DV4J 5DQIA 3TO8A 3T5KA 2V0NA 1VK8A 1RWKB 2ZZNA 2KB2A 4R79A 2KRBA 2B43A 2WVEA 3DHWC 2P6TA 1NEEA 3SXLA 2ACYA 3ASMA 3A3OB 1B0PA 2Y1RI 1FHTA 4QR2A 3GG1A 5MAOA 2FIUA 2LEPA 4C2MA 3VWSA 1RT3A 3VGKA 2DH7A 1U1KA 1YIJS 3NWRA 4AF1A 1LWEA 3B54A 3DRPA 1GLJO 4URSA 1WORA 2ASMA 3D6RA 2YH1A 4KAZA 2PMHA 1RAHB 3CFOA 3O3HA 2ZDOA 4CWBA 3O3LA 4OKEA 3HT3A 1RK8A 4P74A 5B0GA 2XY7A 2DY4A 3P8BB 4EI2A 4ZIVA 1PKUA 4DV3K 4I56A 2A6MA 1U8SA 4OPJA 3SCLE 4DV5F 1LWCB 1XR5A 3BSAA 4DCOB 4WKRA 1KEKA 4AL5A 4RBTA 2JEIA 3DRYA 2HQCA 4N77A 2NXEA 1RT6B 4CF8A 5IT4A 4LIRA 3DGPA 2BR0A 4LIWA 2W25A 2GVZA 5LMNJ 3G9CA 3BGOP 4DTJA 4FZYA 3CGIA 1B0VA 1BI4A 1TUVA 4W92B 3HZGA 4O5BA 4CLUA 2RILA 4JD2B 2WW4A 1RT1A 4NA2A 3KWGA 4QS7A 3PYGA 4BRPA 4YHHF 4LQ9A 4F3TA 4DPYA 4I7FA 2D0AA 4BGAA 3F44A 4USJC 1B7YB 4DUZF 1EX4A 5I3UA 3HXMA 3OR1B 5HRNA 2J6TA 3SPZA 4HHHA 4B17A 3CF5L 4IDKB 4KRWA 3CMEN 5KGXA 3H6EA 1UJ4A 4IZ9A 3A12A 3QWPA 4IWVA 3BN4A 4QIVA 3RMCA 4NB4A 5HL7L 2MLZA 2V51B 3JS9A 3FRZA 2U2FA 2OUGA 5IC6B 4RUHA 3MMAA 1Y00A 5IV4A 1NGBA 4JV5K 1RFQA 1N5QA 1CSJA 4A4JA 3IG1A 4MAKA 2KO1A 4DL0C 2HLTA 3QICA 4QZVB 4DG1A 3GFZA 4AYBD 1EARA 2ITGA 3UKRA 1HNIA 1S77D 2Z8QA 3DXMA 1JJHA 3U27A 2HVIA 4A46A 1S10A 1WC4A 2CNNB 3DLKA 3AAQA 4ZVUB 3QZ7A 2DY9A 3D6MB 3KJQB 2RQKA 2PEBA 3BQ0A 2EFNA 2GWJA 3AAPA 1OY6A 2CA9A 2GQQA 1R6YA 1NUEA 6FD1A 4CEZA 1T9UA 3WZ0A 1U2RA 2P6SA 4LFBK 3P96A 3R2DJ 8AT1B 1PIEA 1RBVA 5C2DA 2FZKB 4ED5A 3DDKA 4C8LA 2OLWA 1RAIB 4BE0A 1MWZA 3M32B 3QNWB 2RF2B 2D9OA 2WBRA 2E1AA 1FKOA 1WSJA 4LF6F 4DZDA 1KONA 3L2UA 2Q2RA 1WSIA 1VQ9N 1U1LA 1NGHA 4AHVA 2Y1IA 1RT7B 2V9WA 3NS6A 1M1GA 2CG4A 5KT6A 1RWWB 3NF9A 5M2UA 1S9FA 4OLBA 2W8KA 2QXLA 2BJ7A 3MR5A 4A2AA 4X65J 1RUSA 1HQEB 5LT5A 3AVHA 2PAVA 2HHXA 2YPYA 4CZGA 3EXYA 3G96A 5TKYA 2ZWHA 5AQZA 4ZPBA 1RBLA 2JHEA 5HQ8A 2RQCA 1EXQA 5IC4B 1YJWS 1FCAA 3QFUA 3EDRB 2YNHB 2IC3A 4HCCA 2VWBA 2UVRA 1DTTA 3O08A 2QL9B 4E1MA 1GFWB 3G0ZA 4RO0A 3ZX2A 2L48A 2D69A 3QIPB 1MMNA 4OPKA 3CCZA 3ZTOA 2FY1A 3D5MA 4WQ4A 2GC8A 3AQPA 3CMAS 2QFJA 1NCLA 3D68A 1S6OA 1ZC6A 3O1BA 1FRHA 1JCFA 5HVGA 2B7CB 5A0YA 4CVNE 5KFLA 1QSYA 4YR0A 4CK2A 3QGIA 4LRFA 4F4YA 1FF2A 3DN9A 2P51A 2E5LK 3FJ2A 2P9UA 4YORA 1HARA 1HMVA 2FSJA 3HP9A 4H0TB 5LMUF 1UETA 4CHYA 5CHCB 1HI0P 2ITMA 3AVIA 3VQQA 1UWBA 3LTOA 4O4GB 5D78A 1QHTA 4JI4F 2H4YB 2R7OA 4P73A 2BH1A 2EFPA 3ZTPA 3WUHA 4QWAA 1MMLA 5CYMB 4DV7F 1S1VA 4K2XA 4CNYA 4RNFA 3M4XA 5F2RA 4FF1A 2QC3A 3J80O 2KG1A 1QE1A 1RCHA 2GAGC 1U0HB 3UD5A 2B56A 2IA6A 3OBWA 3ILIA 4OYBA 5F8JA 4CEAA 2YKMB 3KJVA 4LBIA 3KDNA 5C2CA 4TU7A 2QMWA 4X4UA 2K3IA 4V1Ak 3TA0A 3W3DA 1SH3A 5HBMB 1LWFB 1DEJA 4J9OA 4JS5A 4J8FA 4GVBA 5E2QA 4DR7F 3J7ZT 4NCGB 1YRXA 2JH3A 4C0BA 1R6VA 5K20B 1JLBA 3NWGA 1RXOB 2WB4A 2XO7A 1NXIA 2KHDA 1QUPA 1Z4UA 4CRJA 4WQ5A 3VTIA 3KHHA 2ZKTA 3R2CJ 4D3GA 3Q8SB 4EP5A 4UY8O 1IBCB 3CQYA 2AGQA 3PCOB 3I31A 1JJ4A 4U7UD 1P8ZA 4X64F 1RBUA 3ZNUA 4DQPA 5M1OA 2W9AA 2E4LA 4BR9A 3IRXA 3OTCA 4LF8F 2O8EA 3CJ9A 4M3YA 4GO5X 3PRVA 2GIQA 2ZWOA 1YJ9S 4A8OA 2WTUA 1N8RO 1IBMJ 4M42A 2HS4A 3CJCA 2GZOA 4CCHA 4KV8B 4DX7A 4R0JA 2Z0GA 2YTCA 4NA3A 5DDQC 3O9RA 1IBKJ 1QY7A 5GAHP 4WJBA 5BYQA 1YIJN 2YH0A 1GLEG 3IWXA 4PG5A 3CMQA 1FDDA 4BRHA 5J1NA 2W24A 5KFFA 2DTJA 4IOBA 2E7WA 1CG2A 2LMIA 4ISFA 2CPHA 1Q5VA 3KLEA 3KLGB 4NEYA 4FLTA 3MMVA 2EW9A 3S9HA 3JS6A 2VBYA 2LEAA 4RL1A 2ADBA 4AUKA 2GTDA 3T1HJ 1N5SA 2HFOA 4CZLA 3DDIA 1ZA1B 3WX8A 1O1WA 5E7OB 3LP1A 4MK9A 2VG7B 3CYMA 4MIBA 4FBUA 3PIPQ 1GXUA 5KT7A 3GPAA 3UDVA 3EO3A 3ENBA 2W4PA 3UPFA 1GX5A 5DJBA 2Y9HA 1N5VA 2XZWA 1SH2A 1KVAA 3ILLA 1XMOJ 5BREA 2A6OA 4F4ZA 1X5SA 1RDCA 3FQLA 5KOWA 1HKCA 2EC2A 4F0KA 2QL5B 3L09A 3V4IA 4OI2A 3DRRA 1PG5B 1XR6A 3CIZA 4KC5A 3RMAA 5KPZA 1J2VA 4DR1J 4FOEA 1J5OA 4FJLA 3R5CA 4CM0A 5F3TA 3DAWA 4Y2IA 1DKGD 1M5KC 2A41A 2V8HA 4JV2A 1XC9A 4PYAA 5JUMA 5I42A 2J6SA 4NYPA 8RUCA 4PG4A 2HNZB 1Q0NA 2DR9A 1N33J 3HSGA 3QETA 5C12A 1WBDA 3V2UC 1S1UB 4B9MA 1H98A 4FF2A 3VAMA 6FDRA 3JAMO 1WOPA 3M3ZA 2RRBA 3VGTA 3PJWA 3DLEA 1EJ7L 2ASJA 3ZLJA 4OLOA 5K8MA 4DV6J 2W42A 3OYLA 2YKNA 1YBTA 3FSIA 3QEPA 2OEKA 1QLNA 1NU0A 2N4CA 3C0BA 4I4BA 5KFHA 1U7LA 2NREA 4NZ7A 2ZM6J 1NJIO 2FGCA 4FM2A 3EICA 1HPMA 5FLXY 4EIAA 4XPCA 4OHZA 2K2PA 2JWLA 5LJ3Y 3AQOA 1RTDA 2QA4S 3DMJA 1J54A 5ETKA 3R27A 4B8AB 4JKGB 4S0MA 3HHLD 2CVIA 4DSFA 3AVKA 4BBYA 1Y10A 3E3XA 3U02A 4FCYA 1FEEA 1VSIA 1NGEA 4CHNA 2CAJA 1RHKB 2VFUA 3GIKA 2MEWA 1NHKL 1JK9B 4KT0C 1B99A 4CGGA 4M5HA 4B3RK 1TK8A 4ISEA 1REVB 2FJEB 1QSLA 2Q79A 3PIPL 4ANCA 3W60A 4X62K 2E1ZA 4B08A 3OT9A 1BO5O 3VF0B 4DV3F 2NRVA 3I9ZA 4K5RA 1UP1A 2E2OA 4JI6K 3GV7B 2K7KA