1S1VA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
539
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 145
structure length 533
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1vA05
3SUNA 2ILZA 2W7PA 4CE9A 3U6FA 5CZ1A 5E41A 3ICLA 3B6PA 4E7IA 4KHRA 3CJ3A 3DRPA 3QGHA 3K5MA 4NLUA 3BR9A 4KPYA 1IH7A 4E3SA 1EETA 2R8KA 3V9UA 1D1UA 4ED8A 3HPGA 2FJWA 1NHUA 5KFNA 2E4LA 4RG8A 3GIKA 4DTNA 2OPRA 3Q8PB 2YNFA 2V4RA 2XY7A 1NK4A 2IS3A 5C42B 3PUFA 2FBXA 3OYGA 2HAIA 1FKOB 4H8KA 4J2BA 4I2QB 2W9BA 4CGDA 1S1XB 4U7CA 4Q8FA 5T7BA 4QOZB 2QV6A 1KHWA 3PR5B 3RMBA 2XCAA 4OVLA 3ZT0A 2ALZA 3OYAA 4LQ9A 3M9MB 4O0JA 3MEGB 1NK8A 1KLNA 4O4GA 3U3YA 5J2PA 2G8IA 1Z25A 4RW7A 3GILA 2DFHA 5KFSA 1B9FA 4CHNA 3MFIA 5HBMB 2GV9A 1HARA 3M8PB 3AA2A 3AVBA 2KW4A 4CEBA 4B9MA 4IRCA 4FJNA 3KK2A 5KFMA 3NF6A 3WNGA 2C28A 3QZ7A 3HVTA 5F8IA 2Z1IA 4NLYA 1LAWA 4EYIB 3MECA 4ED2A 1BQNA 3PHEA 4F4WA 3QGIA 3CVKA 3G6XA 5DLGA 4AILC 3H59A 1S9FA 1FK9A 1D9DA 4B9UA 2OH2A 5KG3A 3M9OB 2XI2A 2BRLA 4DL4A 1C2PA 1N6QA 2AWZA 1NK5A 1CSJA 2ZE2B 3HKWA 5DQIA 2AGPA 3GV5B 3PO5A 2RKIA 4DS4A 1RT6B 5KFCA 3CJ2A 4DU3A 4FLVA 4QWEA 3DM2A 3E51A 5KT4A 2CKWA 4GW6A 3DI6B 3AA4A 3SPYA 2HNDA 3RBDA 4CGJA 4M3YA 1RT5B 1BCMA 5D3GA 4AHRA 4M42A 4FK0A 3QINA 5KFWA 4OLAA 1XR7A 4Y34A 4OKKA 1IKWB 3K5NA 1S6PA 1LW0B 3GIMA 4H54A 4NLOA 4F4YA 4GVMA 4R0EA 5KG0A 5F8LA 4CCHA 3SFGA 3LP2A 4DSFA 4EBCA 5F8HA 3SUOA 3ASMA 2R8HA 2FLPA 1CLQA 3I5BA 1TV6B 2DPJA 2OPRB 1QAJA 4RUAA 3MEEB 3IS9A 1EP4A 3I5AA 3V81A 4E89A 4DLGA 2PYLA 1UWBA 4Q0BB 1ZTWA 3RR8A 1TKZA 2YNIB 4CHYA 1KLMA 1S97A 3KD5E 2XGPA 4CFCA 4KE5A 5L1JA 3QLHB 1NNDA 5KRTA 2RDIA 3KMSA 5DGBA 3BJYA 2UVWA 2BRKA 1RT1B 4BWMA 2BDPA 3DMJA 4O44A 1IKXB 4WYLA 3DRRB 3MXJA 2WOMA 1TKTA 4W5OA 4DMNA 3PX4A 3AO1A 4CF9A 2HB5A 1VRTA 1C0UB 4RW4A 4IR9A 4HUFA 4R5PB 2E6MA 4IG3B 1BISA 3LWMA 4ZVHA 2A1SA 3CDUA 4DU4A 2FVSA 4XPEA 3MR6A 4KV8B 3TQ1A 4Z4FA 2Y1JA 4M41A 2IM3A 1S1UA 2GUIA 3PW5A 5KFJA 2KZMA 4KTZA 3WNFA 2R2UA 2G8WA 3OYNA 3NCIA 4IRDA 1RNHA 3DRSA 4ZP9A 4G3IA 4URGA 1QTMA 3ZSYA 4CGGA 1HMVB 2FBYA 2F8SA 5L1IA 3T5KA 1O1WA 4CF0A 3H2LA 2HMIA 1RTDA 4URQU 1B9DA 4ZPDA 1KVBA 3KLEB 4TLRA 4KB1A 2ZD1B 1I6JA 4NLRA 4XIUA 3OYEA 4DU1A 4FLXA 2HHUA 3HK2A 3PVXA 5FRNA 1RT6A 4MK9A 3NH1A 1NKBA 3H4DA 1JL1A 1JLFB 4Y3CA 3DYAA 3O4QA 3OJSA 1TKDA 2P1JA 1IO2A 4RU9A 2IM2A 1NK9A 4ECXA 3MEEA 3DLGA 4Q8EA 2V9WA 4IDKA 2PZSA 1JLQA 2IAJA 3TAPA 3KNAA 2OA8A 4DG1B 3LZIA 4M3ZA 4WFYA 4YR3A 5J2PB 4Y2CA 5KFLA 1REVB 4I2PA 3ZT2A 3AO4A 2IOCA 5KFQA 1LW0A 3OL6A 3OL9A 1S49A 4CJTA 2ILYA 2X74A 4EZ6A 3EPIA 4IG0B 2OZMA 3IG1A 5HP1A 2RN2A 4DSIA 3K5LA 4TSXA 3B6OA 2YKMB 2X6NA 2QK9A 4NYNA 3ZSVA 1Q9XA 3RB4A 4M3XA 4FM1A 1ZETA 4FLWA 4ZPCA 1X9MA 1TV6A 4ZVEA 4F4XA 2V0NA 2ATQA 1X9WA 3MECB 3L2QA 2VWKA 1S1UB 1DTTA 1FKPB 2IJFA 5KG1A 1EP4B 2R8IA 1ASWA 3SUQA 3UR0A 4F3OA 1GX5A 4FJGA 4G1QB 2HHQA 3O4NA 3DRSB 4RNMA 4NCGA 4O5BA 4KTQA 4GC7A 4ECUA 2OPSB 3QEIA 3KLHA 1RT1A 5KTQA 3DMJB 2VA2A 3LWLA 3DM2B 2J6TA 2ZQBA 3T5HA 3C94A 1NK6A 4M45A 2IM0A 4AHSA 4DTJA 3BSNA 3HO1A 4F50A 1VRTB 2YNGA 5EDWA 3KHRA 4B3OA 4CJKA 3HP9A 4K4SA 1VSKA 2KFNA 4E19A 3LP1B 4NRTA 5I42A 4CJLA 3L2VA 5F9NA 5DLFA 4FYDA 3OSPA 3KMQA 4TY8B 3SQ2A 4CEDA 4PWDA 2KQ2A 5KG5A 1LV5A 2GIQA 4K50A 1LWCB 1W0HA 3LP2B 4WE1A 1BQMA 3HM9A 3OYMA 1SH0A 3V6KA 1RBRA 4HCCA 4LH5A 5C24A 3DLBA 3IG1B 4YNQA 1K1QA 2VWJA 1JLCA 5KFXA 4CHOA 1NKEA 1NJXA 4RW9B 5KFAA 3OYJA 3HYFA 3KLFA 4OGEA 3EPGA 4ECZA 1MU2A 2W8LA 4PQUB 4DL5A 4NLVA 3TVKA 4KO0B 3S3MA 4TXSA 5KG7A 3CO9A 4IDKB 1NJZA 2G8HA 4G1QA 5KFIA 2D0CA 2LSNA 3ALYA 4CJWA 4XO0A 5F8JA 4CEOA 3GIIA 3VQ5A 4NCGB 1N5YA 4IH5A 2FLNA 3BQ1A 3G10A 1S9GA 2HHWA 3ISNC 4DFMA 5CYMA 3ZSOA 4KV8A 4W5NA 3U3GA 1JXEA 3VQ8A 4IH6A 4EO8A 4Q45A 4K4XA 4JRQA 5KFEA 2DPIA 4B8AB 3DOLA 2RPIA 1RAJA 1IG9A 1J53A 2ASDA 3K57A 2R8JA 1NJWA 1DTTB 5KI6A 5KFYA 4J9OA 2W8KA 4ICLA 5HROB 4PWDB 1U48A 1D5AA 4HUEA 4B9VA 5J2NB 4O3OA 2OPSA 1GOBA 3FDSA 4CERA 4W5TA 1JLFA 5EWEA 3BGRB 3H4BA 1RA7A 1LWEB 4KAIA 3HPHA 3LALA 4J9LA 4K4VA 4NZ0A 1TAQA 3AVGA 3PW2A 1W9HA 3NGIA 4O4RA 3SYZA 3KLFB 3QIPA 4QPXA 4K4TA 3OYLA 3IGVA 2YKNA 5KG4A 2JLEA 1EXQA 1TL1B 4FVMA 4NCBA 1T05B 4R8UA 3SV4A 4F4KA 4CF8A 1J54A 1KRPA 1J9AA 4CGHA 4YMEA 2P5OA 4JS4A 1BIZA 5J1EB 1NKCA 1LWCA 2RDJA 1BQMB 3SUPA 1RDCA 2A1RA 3LANA 5KGWA 1A5XA 5JS2A 4CK3A 3AVIA 4O3QA 1K6YA 4ZPBA 3Q8RB 3QO9A 2YNFB 1QUVA 4F2SA 4OJRA 4ZP6A 1NOZA 2YHAA 4M3TA 2X78A 3K2PA 2F96A 4DTPA 4BE2A 4ID1A 1SUQA 3JSMA 5JXSA 5C5JA 1RCHA 3SPZA 5F9LA 3H08A 3KJVA 1RT5A 1RDRA 1HQEB 5L1LA 5D3GB 1FK9B 1TL3B 3ITHA 4DWIA 3JYTA 4NRUA 2QKKA 3RMCA 4FZZA 2V4QA 1S0NA 1N5YB 3BSAA 2D0BA 1L3VA 4DQIA 3SFUA 4FJHA 2KZZA 4LH4A 5KG6A 3DDKA 4F4ZA 4CK2A 3P1GA 3D28A 1SKWA 1HRHA 1KHVA 2Z1JA 3CJ0A 1CXUA 4K4UA 5J2QA 4E7HA 1TK8A 2OYQA 3LAKA 1VSIA 3L2UA 3NGDA 2DTUA 4KREA 3MEDB 4CHPA 3NE6A 4M3RA 4Q0BA 5DGAA 4ECQA 1WNSA 3TAGA 3OLAA 3V9SA 2D0AA 3QERA 1IKWA 4FJJA 1S6PB 4O3RA 4MIBA 4FJLA 4CF1A 1CXQA 2WHOA 3A2FA 4CFDA 4O44B 2VG6A 2FVQA 3RB0A 4DEZA 3AO2A 1HNVA 3H5SA 2W42A 4BE0A 2WOMB 2EX3A 3LP3A 3VQQA 2Q3SA 3ZSWA 3KLIB 2UUWA 3P5JA 4PUOB 1D9FA 4B9LA 1IKYA 3DLHA 1RYSA 5HRRA 4E1MA 3TAQA 4QAGA 3IS9B 2BR0A 1L3TA 2BE2B 4O3NA 5DQGA 2HNYB 4BWJA 1J5OB 4BE1A 1ASVA 1C6VA 4ZHRA 1DLOB 3G86A 1NJYA 5KFKA 2B5JA 3BSCA 3KK1B 4FZYA 1T05A 4RW7B 5KFFA 4Y1CA 4C8LA 5CYMB 3JYTB 2BQ3A 2J6UA 4RW6B 4Q43A 1XR5A 1RDAA 4CESA 3TANA 3CG7A 4J2EA 4FBTA 1RTDB 3EZ5A 4NYFA 3EYZA 4HTUA 4H4OB 3UQSA 4ED0A 1C0UA 4CEQA 4K4ZA 2I5JB 3AVHA 1L3SA 3G6YA 4TQRA 1RT4B 1RA6A 1VSFA 3O3HA 4ICLB 5HROA 2R8GA 1WSIA 2IA6A 1HYVA 4BDPA 3PO4A 3SZ2A 2RKIB 1WNEA 3AA5X 1SKSA 4FK2A 2XI3A 4MFBB 3QEXA 2W9CA 4LY7A 2VG5B 1LWEA 3HP6A 1TKTB 4WFZA 4DSEA 1SL2A 1T94A 2JEFA 1WSJA 5KGXA 3GV7B 1LWFA 3KHLA 3KLIA 3C6UA 1RTJB 1JLEA 3PJWA 3GV8B 3AVLA 1JL2A 2WTFA 3CYMA 5J2QB 5DMRA 1RT3B 4CEFA 5FDLB 3OYKA 3KTQA 1G15A 2Y1IA 3OS1A 3V1RA 3I5CA 3MEDA 4U6PA 3VQSA 3IAYA 1BCOA 4Q5VA 4CGFA 4Z0UA 4FJIA 4DQRA 1WLJA 4FJ8A 3ZT1A 3RMDA 2HVIA 3CFPA 1VSDA 2FC0A 4IG0A 1BHLA 1XI1A 4OPJA 1CZ9A 2AX1A 5F8MA 4CIFA 3V81B 1CZBA 4QW8A 1UWBB 1RYRA 4IFVB 4KTWA 4DF8A 3S3OA 3E01B 3FRZA 1RDBA 1ZBFA 3DYAB 1N56A 2NUBA 2G8VA 4RW8B 5KG2A 2IDOA 3KKRA 4JLHA 1TVRB 1S4FA 3ITHB 2IBKA 1WAFA 1S1VA 2RF2A 5KT5A 3HL8A 1JLQB 2J6SA 4CJ5A 4EZ9A 1HNIB 2JEIA 4O3SA 2D3ZA 4TY8A 1S0MA 3KOAA 3CWJA 1RTIB 3L2RA 4KFBB 2AQ4A 4RW4B 4I2PB 1REVA 3OLBA 4ELUA 2GC8A 3MR3A 3MXIA 4DQPA 4CF2A 2XWYA 5EWFA 1A5WA 3QEVA 3PW4A 4W5QA 3OS0A 4Z4GA 3NF9A 5DG9A 1OS5A 3VQ4A 3NMAA 1JLAA 1S10A 4XPCA 2YHBA 3NL0A 4DSLA 5HRSA 3BDPA 1HMVA 5JUMA 1RBTA 1L3UA 3TAFA 4FJ9A 3KIOA 3WNHA 3CDEA 4BACA 4B9TA 4MKBA 2AJQA 3KHHA 1QSLA 1TK5A 3DRPB 3CFOA 1C1BA 4AH9A 1S48A 3FQLA 2C22A 1T3NA 2JEJA 3ULDA 1SH2A 4E7JA 2VG5A 3MXMA 4O4GB 4EP4A 1QS4A 4RZRA 3EY1A 3CM5A 1JLBA 4DTSA 3QEWA 5DQHA 1TQLA 3VQ9A 1C1CA 1ZBHA 4ZTJA 5HBMA 4KB7A 4W5RA 4I2QA 2W9BB 4N56A 2YNHB 1JLEB 4PQUA 4DG1A 4DQSA 2ITGA 5J2MB 3CJ4A 5F8NA 5I42B 1SL1A 3OYBA 2QKBA 2KFZA 4CIEA 3GQCA 2WONB 4ZVFA 3SV3A 1Z4UA 4J9NA 5K14B 4H4OA 3VQBA 2C2RA 2Z1GA 3O3FA 2ZE2A 4HYKA 2BGGA 1U45A 4QWDA 4KHNA 3RAXA 2OPPA 1WAJA 3D5MA 4EEYA 3RWUA 3IRXB 3NF7A 2D5RA 3HT3A 3KK2B 3PX6A 3HSTB 5JS1A 3HVTB 3I8DA 3G6VA 1Z26A 4PY5A 4KO0A 3MR2A 3CFRA 4F3TA 1HPZA 1X9SA 2UVVA 3UDLA 2XCPA 4B9SA 5DG7A 3VA0A 1R0AB 3H40A 4IFYB 1HNIA 3PX0A 1T7PA 5KFGA 1YTAA 1NOYA 1U47A 2OPQB 3TABA 4BDYA 4CEZA 2FLLA 1TP7A 4FBUA 4GMJB 3NH2A 3N6NA 3N6LA 4NLSA 2W7OA 3H5UA 3OYFA 3LAMA 5KFZA 4ID5A 1RT3A 2ASLA 3LP1A 5HLFA 3FFIB 3SQ0A 3SI8A 3OS2A 1KSPA 4EYHB 4LSLA 4EBEA 4L8RB 3QO9B 2HWHA 2ETJA 4JS5A 5KFPA 2FBTA 3PW0A 2VG7B 3ZSXA 3HXMA 3BREA 2Z1HA 3T1AA 2HHVA 4B08A 3SJJA 2HWIA 3KJVB 2IJNA 2VA3A 1W25A 1D0EA 4OGCA 3NHGA 2DFEA 4AHVA 1VSMA 3QNNA 5T14A 2PY5A 3WNEA 1DTQB 1RBVA 3NAIA 3MAQA 4B9NA 1ASUA 1HQUA 3PZPA 4O55A 4CHQA 4MK8A 3SQ1A 1KTQA 3ZCMA 4CK1A 3V9WA 1QQCA 3LDSA 4K4WA 2YNIA 1RT7A 4NLGA 3ZSZA 1S9EA 1JXLA 1VSJA 4TYBA 2O5DA 4FLYA 5KT7A 5I3UA 3OL8A 1BI4B 1TL1A 4HUGA 1F21A 3M8RA 4WXWA 1S5JA 1S1WA 4CJFA 3OY9A 2WONA 1ITGA 4IFYA 2XC9A 1UA1A 4KHMA 2C2DA 4ECYA 1ZYQA 1S6QA 5HRPA 3S9HA 3AO3A 2HMIB 2I1RA 3RTVA 4R5PA 3DLEA 1JLGA 4IG3A 3O3GA 3IGNA 2E9ZA 4DF4A 4KBIA 1GX6A 1Q9YA 4N47A 1LAVA 3F9KA 3KLGB 3K5OA 2IC3A 3IRXA 4CJEA 3QNOA 1IKYB 3AVMA 3OYIA 3NGYA 3T5JA 5CYQA 3OYCA 1C1BB 4E1NA 1FKOA 3K59A 3MTKA 3NAHA 1J5OA 1HQEA 4E0DA 2JEGA 2B6AA 1NK7A 5CZ2A 4ZHRB 3PR4A 2JC1A 5F8GA 3C6TB 2C2EA 4DTXA 1JLBB 3AVAA 3VQ7A 4Z4HA 1VSHA 2UVUA 2BQRA 3SCXA 2WB4A 5KT3A 3OHBA 4PUOA 5C25A 1HJRA 2D3UA 2ASJA 4C8OA 3FFIA 1XC9A 2WRMA 4KKOA 5DK5A 4LSLB 1RTHA 3V9XA 2HNZA 3V6DB 3M8SA 5DG8A 3TAMB 1GOAA 2ZKUA 4KHQA 3AVNA 3DLKB 3I0RB 3RBEA 4UQGA 4J9MA 3CIZA 1S0OA 3M8QB 4DL3A 4MQ3A 4FJXA 5HRNA 3NAEA 4EO6A 2G8KA 2WK4A 2AGOA 1RT2B 4KHUA 3QIDA 1HNVB 1YTUA 2ATLA 4IR1A 4TYAA 4X2BA 3M9NB 4HVJA 4FJMA 3PW7A 2E9RX 2I5JA 1SUQB 4JV1A 4CJPA 3RR7A 4FW2A 3T3FA 4ZVGA 4F2RA 5EU7A 2AU0A 3N6MA 1FKPA 1VSEA 3T5LA 5L9XA 1JKHA 3KHGA 4YFUA 3HVRA 4FS1A 3LZJA 4HKQA 1QE1B 1DLOA 1IKVB 4CGIA 4IOBA 3KLHB 4KHSA 4C8MA 3V6JA 4DFKA 4J9RA 3KK1A 5L1KA 4K4YA 3LP0B 3ZSRA 4MFBA 2R2TA 3RRHA 1SV5B 2QE5A 4DFPA 4J2AA 3CQ8A 3VA3A 4M3UA 1S6QB 3AO5A 4Y1DA 1C0TA 5C24B 2X6SA 4KSEB 4FLTA 1JLGB 4J9PA 1LWFB 3OL7A 2P51A 5C42A 4CJ4A 4NCAA 1RTJA 2HW3A 2HHTA 2WCXA 1WSGA 4PA1A 4IFVA 3OYHA 3S3NA 5EWGA 3DOKB 3QESA 4KB0A 1RT4A 4JV0A 2IC3B 1UOCA 2D7SA 4KAZA 4KHWA 4KRFA 2IM1A 3NGZA 1U4BA 2KTQA 4NLQA 2FJVA 4DTRA 3NF8A 1U04A 4IQXA 4M3WA 5EUHA 1NK0A 2BANA 4CJVA 2XRIA 1B92A 5FROA 2PYJA 3RAQA 1U49A 3TI0A 4DSJA 1QAIA 4E7KA 3V6HA 3OYDA 2HHXA 2IMWP 3KK3B 5KFOA 4JV2A 3QYYA 4KI6A 2FVRA 5KFTA 2HNYA 4FCYA 1RT7B 4RNOA 4CECA 4Z4CA 4AHTA 4DFJA 1JLAB 1QSYA 2XY6A 5SZTA 4DS5A 4K8XA 3NDKA 1TVRA 3BSOA 1QSSA 3BQ2A 1BQNB 4Z4EA 4IKAA 4WZQA 2B4JA 4M95A 5KFHA 3DLKA 3MEGA 4KFBA 1S9GB 3VQAA 1TKXB 1RBUA 3DLEB 4CJUA 3M8QA 3GYNA 3RB3A 4RNNA 3KLVA 3MF5A 3M8PA 4RNFA 2O4IA 3MFHA 4ZPAA 3K58A 4NLXA 1LW2B 1WN7A 4DL2A 3E01A 3QETA 4KI4A 2HNDB 4RW8A 1TKZB 3D0PA 4QCLA 2B6AB 2W9CB 3DLRA 3L3UA 4CJRA 3PJXA 3C6TA 4R8UB 3Q8SB 1SH3A 1N6QB 1BGXT 2DFFA 1X1PA 1QE1A 3NKYA 3EZUA 3NBPA 1IKXA 1IKVA 4IKFA 3FSIA 3TWHA 2BANB 4JUZA 1TGOA 4DTUA 3QIOA 4ECSA 4QWAA 3GIJA 4DL6A 2UVRA 4I9LA 1XHZA 1ZTTA 4OKEA 3PY8A 4KHYA 5FDLA 4F8RA 4LSNB 3OSNA 3QEPA 1XR6A 4FM2A 4FJ5A 4JRPA 4C8KA 2BQUA 5HP1B 1C0MA 4CJQA 4WYWA 4OL8A 4NLWA 3L3VA 1TAUA 5J2MA 1ZBUA 4RUCA 3SNNA 4NLPA 2QXFA 4I9QA 2JC0A 2DY4A 3RRGA 1HPZB 4DQQA 4ZP7A 2XY5A 1KFSA 1TL3A 2GIRA 5J1EA 2FJXA 2F8TA 3SI6A 4CJ3A 3DRRA 1VK0A 1TKXA 4YR0A 3TAEA 4O3PA 3OJUA 3CM6A 3V1OA 1JXBA 4URSA 2JGUA 1KVAA 1K1SA 4YP3A 4B8CA 1ZBIA 1T8EA 1I39A 3VQCA 3MR5A 1S1VB 4ELVA 4EP5A 2FVPA 3ZSQA 2YNHA 3DLGB 1KLMB 4FK4A 3JSMB 2XGQA 3UIQA 3HVAA 3KKSA 1RILA 3VN5A 3CDWA 5KFBA 3TR8A 3QLHA 2FVCA 2EHGA 3V4IA 3LP0A 3NFAA 3OVNA 2OZSA 1T03A 1VSLA 1YVFA 2R7YA 4MK7A 4ZMMA 1SV5A 3AA3A 4J9KA 2XO7A 4CEAA 4OKJA 3BQ0A 2XY8A 4AHCA 3NBPB 2OPQA 1NHVA 2R2RA 1S1TB 3KLEA 4DTOA 2VG6B 4HHTA 4NLTA 2ZD1A 1UA0A 1JX4A 4Y2AA 3TARA 2YKMA 4N76A 5KT6A 3LPUA 1DTQA 3Q8QB 4MKAA 3VQDA 4ID5B 5HLFB 4H4MB 1N48A 4FW1A 3I0SA 3H98A 1RBSA 2P5GA 4RNHA 4BDZA 4OPKA 4FJ7A 1LW2A 1WSFA 1C1AA 3THVA 1IM4A 4FLZA 1XWLA 3AV9A 2O4GA 4ECTA 4J9SA 4N41A 3VQEA 5I3UB 5CY4A 3FQKA 2B5JB 1R0AA 4CFAA 1BIUA 1S1WB 5KRSA 3HVWA 4CHZA 2F8EX 5KFRA 4QWBA 1FXXA 3NH0A 4ECVA 1C1CB 3ZT3A 3KK3A 4ZP8A 4TQSA 4ELTA 4LQ3A 4MH8A 4LD0A 1ZBLA 3T19A 1HYSB 1XHXA 4O0IA 4CFBA 3RMAA 4ED1A 4ECWA 2YV0X 4CEEA 4FS2A 1VRUB 5SWMA 4FM0A 1HYZA 4ZTFA 3P83D 3KLGA 1KCFA 2BE2A 2IAJB 4ED7A 1BL3A 3SQ4A 1A5VA 3PV8A 2D41A 4YQWA 4GC6A 4OLBA 1BI4A 5K14A 2HVHA 4QW9A 4ECRA 4FXDA 3AVJA 4TY9A 1I3AA 4WE1B 4FLUA 1D8YA 1WSEA 1EX4A 4WZMA 4RW6A 3OHAA 2OPPB 3L8BA 4WFXA 2AGQA 4IH7A 1KVCA 1N4LA 3IN5A 1SL0A 3KD1E 4IRKA 3VQ6A 1JLCB 1HQUB 1U09A 3VQPA 4RW9A 4EBDA 2XHBA 3D45A 3QGGA 5FRMA 4CIGA 2B43A 3QZ8A 1YVUA 3BGRA 3AVFA 4H4MA 4I7FB 3I0SB 1S1XA 5KFVA 4DLEA 3DI6A 1SKRA 4Z4IA 3F73A 3HPOA 4NLDA 1Y97A 3L2WA 4E7LA 3QIPB 1UAXA 1T03B 4DL7A 1EKEA 1Q8IA 4HCBA 3V9ZA 2G8FA 1EETB 2R2SA 1L5UA 3H5YA 4J9QA 4N5SA 2GBZA 4J2DA 4LSNA 1KFDA 2W9AA 1S1TA 2YNGB 4CJSA 4YR2A 3C6UB 1RT2A 4B3OB 2VG7A 2AX0A 4ED3A 5C25B 3ISND 1TK0A 2E9TA 4AHUA 1VRUA 1MU2B 4FJKA 4QWCA 3RB6A 4K8ZA 5CYQB 4DTMA 2HHSA 5KFDA 3HHKA 2FBVA 4WXOA 1JIHA 2IGIA 3I0RA 4TN2A 5J2NA 1QHTA 1MMLA 4Q44A 3H5XA 3AVKA 2E6LA 1RTIA 2G8UA 2UUTA 4ED6A 4FZXC 4C8NA 3AVCA 4IBNA 4NYZA 3G0ZA 3C95A 4MIAA 3V1QA 4DSKA 3HJFA 1HYSA 5KFUA 3UPFA 1YT3A 1C0TB 3LPTA 1S9EB 2CJQA 1GOCA 1RDDA 3DOLB 2EC0A 3ZT4A 4M94A 4I7FA 3V4IB 4KKOB 3CJ5A 1RTHB 2YKNB 5KT2A 2HNZB 3V6DA 3DOKA 1JKHB 3TAMA 2RF2B 1WSHA
chains in the Genus database with same CATH superfamily
2AYBA 5E84A 2M8DB 5CD4H 4JI0K 3U9ZA 4X4RA 3MOJB 3B54A 3J7ZT 5ETLA 3MHYA 4FDFA 3RAMA 3BR9A 1WG4A 4HLBA 4WKRA 3W9IA 1NHUA 2UUBF 2E4LA 4RG8A 2OPRA 3GOIA 1X4BA 2V4RA 2GS8A 3HULA 1HBUA 2IS3A 2R7TA 2UXBJ 2IA0A 5IXUA 2HSEB 2FBXA 2D1CA 1K0TA 2ZNYA 2V34A 1FT8A 1WBDA 1X3NA 4W98A 3ETOA 3D0IE 3HZGA 3PR5B 2JWKA 3RMBA 2RRAA 1OH5A 2PGCA 2GQCA 4M1KA 4A5BA 3FCWA 3BB5A 1LOUA 3M9MB 3MEGB 3ENQA 3HD1A 3U3YA 2A6OA 3KDNA 4IDHA 1KXPA 3GILA 1PO6A 2GV9A 3M8PB 2OMOA 2C2KB 1RAGB 3KWGA 3AVBA 4B9MA 4CEBA 2DHAA 1RWWB 4ZOSA 4FJNA 3KK2A 3BH6B 3NF6A 2GW8A 4YB6A 2RHSB 4FPAA 1JK9B 5F8IA 2Z1IA 2E5LF 3D0GE 3C8YA 2NRHA 4ED2A 3SMZA 4AL5A 3G6XA 5DLGA 4BRNA 4X64K 5F0UA 1FK9A 4WP9A 3Q0AA 4B9UA 3J7YP 1EJ7L 1RWUA 3THPA 4WCEL 2Q97A 1TYQB 1C2PA 5AZJB 2ZE2B 5B0GA 3CJSA 3GV5B 3RRKA 3QFWA 1SQFA 1AB8A 1UJ4A 3TUZC 3MPUB 1FTCA 1VHXA 4WYBA 2UU9K 4GW6A 3VQTA 5AZIA 5C15A 4ZITA 4M42A 4UZCA 5KFWA 1NAQA 1HBNA 2QRRA 2MTLA 3MCAB 4Y34A 3JAMO 5H9FK 4OKKA 2LKZA 3K5NA 1VQ4N 1S6PA 4GY2B 3WUHA 1R3NA 1EKRA 2VHGA 1OSDA 1SXLA 4NLOA 3UR3C 4C98A 1SZ2A 5KG0A 1X5PA 2RQMA 3SFGA 3LP2A 4DSFA 4EBCA 3GDQA 1HNWK 3ASMA 2CGJA 4JEPA 5B0FA 4CDIA 3CPEA 2FLPA 1CLQA 3PHTA 4QS7A 2KJVA 2OPRB 4PRFA 3VHQA 4RUAA 3IS9A 1JNRB 1JQGA 1TKZA 2CQ2A 2GO9A 1X4EA 3HSCA 2Y3YA 1S97A 2XGPA 4CFCA 4KE5A 3QLHB 3G6ES 3KMSA 4A8QA 3S01A 2BRKA 1RT1B 1CJTA 3NCPA 4DPWA 3R5AA 4DV5K 4WYLA 4FZVA 2WOMA 3ZZ0A 3WX4A 4B1XB 3HHLB 4F3MA 3AO1A 2HB5A 1RGIA 4HUFA 4RW4A 5L46A 2WW8A 1BUXA 1OVYA 3HRGA 2WB1D 4DCOB 2BKNA 3D4JA 2FVSA 3MDQA 2FQQB 2VD3A 2HS0A 3CSKA 4M41A 2IM3A 3OW2R 3R9PA 3OR1B 2GUIA 5KFJA 2KZMA 2DGUA 2IRYA 2FHJA 3DXKB 2XZDB 3DRSA 2JVOA 4URGA 1QTMA 4CNZA 1LK5A 4NXNJ 3JTNA 3MM8B 5CHCB 1KOOA 2IFXA 2OANA 1S72S 1KVBA 2GQ2A 2IPOB 4FXWA 1I6JA 3OYEA 5AXKA 2IVPA 2YQ3A 3HK2A 2NCKL 3I32A 2QXLA 3BBCA 1BWFO 2VCPA 3DYAA 1U6FA 2X7IA 3BR8A 4MDBA 1TKDA 1MWQA 3OTCA 3G8QA 1Q4RA 3IM9A 6FDRA 4JKHA 4Q8EA 2V9WA 4FWOA 4A4JA 1NSQA 2PZSA 4L3NA 4F0HA 1QDUB 2IAJA 4C8ZA 4DG1B 4M3ZA 2R7QA 3ULHA 4YR3A 4A47A 3I4HX 4I2PA 1CC8A 4X84A 3ZT2A 4BC7A 2Q79A 1R8HA 2X74A 5G0RB 4DQ8A 2OZMA 5B0EA 3LDOA 5HP1A 3K5LA 4RUHA 1S5ZA 3ZSVA 5D4LA 1Q9XA 3RB4A 3LOUA 4FM1A 4FLWA 3O6QA 4L6V3 5IFMA 3DWLA 1DTTA 5DZ7A 4NOHA 3JSBA 4PKDB 2A10A 3Q22A 4G1QB 2HHQA 2VBZA 5AJ3F 2ROPA 1WB9A 3NS6A 5KTQA 2L08A 4QR0A 4GVLA 2VA2A 4WFAL 3DM2B 2ZQBA 2H5IB 1IJJA 3QAUA 3BSNA 1M0SA 4F50A 4ISGA 3KHRA 1LFPA 4CJKA 4JHDA 1NEEA 1WC6A 1V6HA 2CPYA 4PAAA 4E19A 1SJ4P 3GFZA 4NI2B 4YB1P 1VFJA 4QS8A 1IUJA 4CJLA 2OIHA 4LFCK 4FYDA 3KMQA 4CEDA 1IBMK 2NXUA 4JI6K 4K50A 4BRAA 8ATCB 3HM9A 3OYMA 3LGNA 2R4FA 1F9EB 4X65F 4X4QA 3CMQA 3T7ZA 2XMAA 1NKEA 2F4VF 1AXQA 4DX7A 4ZIWA 4RU2A 3OBWA 3ET6A 3EPGA 5IQ6A 4ECZA 2W8LA 2VL1A 5EGYA 4QZVB 4NLVA 4CZFA 4KO0B 3S3MA 4TXSA 2AMCB 3LGMA 4IYQA 1MN7A 4OZLA 1Q82T 3ENVA 3ALYA 4CEOA 3VQ5A 1N5YA 4GKJF 3BO4A 2FLNA 1HKBA 1F5AA 1UFWA 4UOGA 2ZM6K 3PJ9A 3N0VA 2HHWA 1K0VA 2MLYA 2HK2A 1UVNA 1JJ2R 3A1YG 4KH0B 3MZIA 4KV8A 2RMLA 2M5YA 1EQYA 1VQ6S 1JXEA 3CNQP 3L95X 3UN3A 4DR2K 2MZQA 4JRQA 4DR7F 5AQHA 2NYHA 4A8OA 3UE5A 3EZWA 2R7OA 3K57A 3CB4A 4EFAC 4GKKK 3CC7N 5KI6A 4UUXA 5HROB 5E5NA 1RSCA 1U48A 2E20A 1FE0A 4CLTA 2W2QP 1X3MA 2QM1A 2LXIA 5DDQC 4IOXA 3BGRB 3KG4A 4CYUB 4KAIA 3HPHA 4OYPA 4AXIA 5CHIA 2E1RA 4K4VA 3CJAA 3L7UA 3FSYA 3QQCD 2C3PA 2F4VJ 3P6YC 2JZ5A 2F8HA 3AVGA 2RQ4A 3H1VX 1DURA 4O4RA 3KLFB 3O1LA 2M9KA 2EPIA 3OV7A 3W2VA 4Z7CA 2ZH9A 3BGOP 4FVMA 1BA1A 2KU7A 3BKTA 3D2EB 3R5DA 3B4MA 3HJVA 3KG0A 4OYIA 1PG5B 2KI2A 1LWCA 3RG6A 3CCES 3SUPA 2P9SB 3QMQA 2A6MA 4ATNA 1A5XA 5JS2A 5AE3A 2FZGB 2KXFA 1JXVA 4YOTA 4FVCA 4BVPA 1TMMA 1NOZA 2DY9A 2F96A 2MGZA 1VYAA 4ID1A 5KQDA 3R5CA 3PIPL 1R7IA 4OHWA 3VEVA 3SPZA 4RX6A 1RT5A 4OQJA 1YF5L 1FK9B 5D15A 4DWIA 1HD0A 2VPYB 2DNZA 3LQVA 3I56S 1OPZA 4CO2A 3RMCA 2OTLS 1FO1A 3LTOA 5EX5A 2N4DA 2V4QA 1N5YB 3BSAA 1RBLA 3BS9A 1D3WA 3BEXA 3P1GA 3VENA 3D28A 1SKWA 3SMSA 3CJ0A 2F8MA 1MWKA 2UXDJ 3LGHA 4YHHF 3LAKA 4DZDA 4KREA 2D9OA 1RAOA 3CW2C 4LBIA 4JN4A 4M3RA 4Q0BA 4FF4A 2I8EA 3UB5A 3QERA 4DV2J 1XEZA 3H0PA 2GA7A 4OYMA 3QSYB 4CF1A 2E5LJ 3VTIA 3A2FA 4CFDA 4O44B 3RZAA 2ZFHA 3S7RA 1NMDA 3RB0A 3AO2A 4DV1J 3NWRA 2LVWA 3LP3A 4H0PA 3ZSWA 4ZCIA 2WFBA 3PTWA 1F0XA 5HVHA 2LQ8A 1NMNA 4EAHD 2Q6CA 1UVJA 3DLHA 3SAFA 3VGVA 3IS9B 1RU2A 2H65B 3D1HA 2Z8QA 1CJKA 4O3NA 5DQGA 4BE1A 1YBTA 2F7TA 1HI8A 1QQMA 4ZHRA 3G86A 1NJYA 2B5JA 3ILIA 3BSCA 3KK1B 5KFFA 4C8LA 2W6KA 4RW6B 4CESA 1NBWA 3TANA 3OHRA 5M2PA 4J2EA 4HR2A 5GINA 4HTUA 3UQSA 2DGVA 1CVJA 3UI3A 2ZBCA 5GADP 1VHFA 2I5JB 3WDOA 4DX5A 5E7OB 5A6PA 1NZ8A 4AQYF 2HFSA 1Y5NB 4K0KJ 5EVZA 4CO5A 2DXFA 2EWHA 5BRFA 3O6WA 4FWKA 2BX6A 2R8GA 1WSIA 2FZCB 2HBLA 1OMSA 3P96A 4QIGA 1HYVA 2HVZA 4DV4K 1S79A 5MLCV 4F02A 4LY7A 1LWEA 1DRZA 1TKTB 2B8PA 3PFEA 1IR2A 4DI6A 4LF5J 1WSJA 1VLYA 3GV7B 1LWFA 2HEKA 5D6GA 3C6UA 3DGPB 5IWAK 1BC6A 5J2QB 3O1WA 4XH5A 3BPSP 4OZ5A 3G6EN 4L74A 2YKPA 4JI8F 2Y1IA 3N4WA 1UAWA 3HZEA 1T9WA 5KPTA 3POTA 3F0NA 1WC3A 3EGZA 3R8YA 4CGFA 2XSFA 4Z0UA 3AAPA 5JVGQ 4JKCA 4DV6F 1IR1A 2OEMA 4O5FA 2BW2A 2C3UA 2AX1A 2DNMA 4K25A 2HRTA 4TKTA 5LT5A 1QHAA 1ZBFA 3FRZA 5H9FJ 2HBKA 2LP4A 1NDKA 1HNXF 3IKMA 3GBTA 1TVRB 3MD1A 3ITHB 2IBKA 2PFDA 4CJ5A 2D3ZA 1R0CB 3GJQB 4DR7K 2AQ4A 1REVA 4NA1A 2D1KA 2MYFA 2AJFE 4DQPA 1OQ3A 3CCRS 1OYDA 4G9ZA 3QEVA 3OR1A 4PXDA 3RVCA 1TUUA 2VB6A 5M1NA 3AARA 4P52A 1GXUA 1OVQA 1XQIA 2FF3B 2H5JB 4JI3K 3TZYA 3U8XA 4BACA 1BG3A 4AD6A 2YBVA 2FY8A 1WJ9A 4A8YA 3FQLA 2CDRB 1U1PA 1T3NA 2JEJA 3ULDA 3PIOL 1B3TA 2VFRA 4O4GB 4RZRA 4DTSA 3U4LA 3QEWA 5HQMA 1ZBHA 3C46A 1M5SA 1OKJA 1Y9OA 3TJAA 2P9IA 5HBMA 4ZTJA 2W9BB 2YNHB 1K47A 1JLEB 1DHMA 3N4PA 1YQHA 4DMZA 5IM0A 5I42B 3M2VB 2G0CA 2QKBA 4PR6A 5IT9Y 2LA6A 1Z4UA 2IBOA 1XNRF 3EWGA 1YGYA 4J9NA 5FLXO 2OEKA 3VQBA 1TYQA 2QMWA 2ZE2A 1Q81T 2BGGA 3VVUA 2WSCC 3RAXA 4C9DA 1WAJA 1RP5A 4WFBL 3MPWA 4B3TF 2AZ3A 1SVDA 3HT3A 2XMKA 3AB2B 3QJLA 2MZRA 3PX6A 3UKUA 3HSTB 2YHYA 3I8DA 4PWUA 1R6YA 2J0WA 1HBNB 3UDLA 2XCPA 3VA0A 1R0AB 3M6GA 1RISA 3A13A 5K8NA 5LMUK 4B9QA 2OPQB 3TABA 2DR6A 1TP7A 2CRLA 4KH5A 3R6LB 4FBUA 4WFBQ 3N6NA 1RFQA 3N6LA 3O9RA 1YZ6A 3HHNB 1KAXA 3CERA 4ID5A 1X60A 1NM2A 2HWHA 4JS5A 2VBYA 4B1UB 1Y5LB 2VG7B 3ZSXA 1I51B 2Z1HA 2K8GA 1KC8T 1EARA 3DU6A 4ZPVR 3R1HA 1VQNN 1KKHA 4LBHA 2Z2YB 1S6OA 4AL6A 3NOGA 1NM1A 1UETA 2EFVA 3W2WB 1A9NB 4OGCA 2DFEA 3CT9A 1VSMA 5T14A 1U7LA 2BUPA 1DTQB 2ZH8A 4KHPK 3NAIA 4B9NA 2MPUA 4Q7AA 4FPBA 1CJVB 3PZPA 3MCMA 1KTQA 4CK1A 3VWSA 3FZHA 4LF6J 4LFCJ 3J81O 2EEYA 3BF1A 4K4WA 1YJNN 5IQQA 7FD1A 4IJNA 1LEOA 3ZSZA 1S9EA 3J7YI 1VSJA 5KT7A 2CADA 4HUGA 3M8RA 4AF1A 3B8HA 1YVNA 3L4BC 2N7YA 4CW7B 1WKLA 1UA1A 2P9KB 2C2DA 3CJBA 3W3DA 2CUYA 4H0OA 4NEYA 2CPZA 3LM9A 5M1OA 3CJ8A 5BJRA 2Q1LA 3DGVA 3DLEA 3O9SA 3IGNA 1CEZA 2ADCA 2KKZA 3GYXB 2HS4A 2F4FA 4DUYF 3W8GA 1LAVA 2X1GA 3KLGB 1SC6A 2IC3A 2Z57B 5DJBA 4XK8C 4LFAF 2Q36A 4CJEA 4KGVB 2IVYA 3T5JA 5CYQA 2QI2A 5BRDA 3UKUB 1N33J 5A2QO 4MYTA 4E1NA 3M7VA 2L9NA 2DNGA 3NAHA 1J5OA 1KTVA 4E0DA 3A12A 1QY7A 5CZ2A 1U0HB 2JC1A 5B7WA 4DTXA 1E6YB 2BE7D 4JK7A 3ENOA 4OYOA 5G0RA 1KD1T 3AY0A 3Q89A 2W2MP 1E3MA 4IZ9A 1U0SA 5D78A 1M1GA 1ZBSA 1YJWS 2D3UA 3P3DA 1FFGB 1XC9A 2ERRA 2NUUG 3HM8A 3J81U 4B3MF 5DG8A 3CJRA 3BZCA 4NA3A 2FHOB 4KHQA 1TU0B 1MW7A 2XLIA 1ZS6A 3K8WA 1J6ZA 3ONQA 2VQFJ 5BREA 3G8TA 5A8KB 4DL3A 4Z37A 4MQ3A 3W0LA 5HRNA 3HCXA 2G8KA 4HWIA 4KHUA 3QIDA 2ATLA 3OR2A 4TYAA 4X2BA 5T7LA 1DFDA 3RR7A 2UUCJ 3MCNA 2K1RA 2NRVA 3R5GA 5EU7A 4JHDB 3HZ6A 2NPFA 1XJWB 1BXNA 2V7YA 1P27B 2GHWA 4C48A 3CF5Q 3LZJA 4ES1A 2AJ1A 1QE1B 4USKA 2ZZMA 2PC6A 1DLOA 4DFKA 1H7WA 4K4YA 4MFBA 2R2TA 1G6BA 3GG1A 4OI3A 3QT5A 4YEAA 3CQ8A 2H54B 1S6QB 5M1PA 1ZZFA 1H2TZ 1C0TA 2G9OA 3UW1A 2I7PA 1MWZA 3UDEA 5AE2A 1FNXH 4DV5F 1LWFB 3OL7A 2P51A 4LF8J 2AKWB 3HI9A 1X5TA 2HHTA 1WSGA 4IFVA 5AQIA 5EWGA 2PFUA 3QESA 5CQGA 3QRQA 1UOCA 2L3MA 2D7SA 2JNJA 3AD8C 3CJ1A 1J5EJ 4TU9A 1PBUA 3LF0A 4JV5J 3M6WA 3QBWA 3HF5A 5MAOA 4KRFA 2IM1A 2FJVA 3NF8A 4IQXA 1X4HA 3BN7A 3AAQA 4FVUA 3ILJA 5FROA 4DSJA 4NLCA 2H4WB 5D0HA 1ZOTA 3VGTA 1RAIB 4AYBD 3OYDA 4MIWA 1OY6A 2IMWP 5BN8A 3KK3B 5KFOA 2C3MA 3QNWB 4JV2A 4B1ZA 1LXJA 3NGSA 3VGUA 2GVDB 5KFTA 2HNYA 1RT7B 2HK3A 1FE4A 4RNOA 1K8AO 4WP8A 2PEBA 1JLAB 1AT1B 1QZ6A 1BQNB 3ADAC 1Y64A 4AQYK 1GNKA 2B4JA 5FIIA 6FD1A 4Y00A 1S9GB 3VQAA 3PFOA 4JYAK 3M1VB 5ADZA 3M8ZA 3GYNA 2CA9A 3DLLL 1I94J 3M8PA 3UO0A 2IY5B 4CVNE 4NLXA 1H38A 2KN4A 4K41A 4DL2A 2HNDB 2V2VA 4RW8A 2NYIA 1VRQC 4L3KA 2RHKA 2ATCB 4ETXA 3D0PA 4QCLA 2P6TA 3R2DJ 5BR8F 3PJXA 3C6TA 4U7UK 5AQUA 5D4OA 1N6QB 2DFFA 4LBPA 2CZ9A 3TWHA 4IOCL 1JCGA 2LCWA 4ZS6A 3QIOA 4ECSA 2BJEA 2PDAA 3SIPB 4AM7A 4DL6A 3WQTA 1ZTTA 4OKEA 2HURA 3EKUA 3MUMP 2BJDA 5FDLA 4LSNB 3EXCX 1C0MA 3D6RA 2M70A 2VJUA 5HN0A 1V4TA 4OPAA 3SNNA 5L8RC 2FLOA 4PCQA 3IAM9 2BV3A 4LF1A 5D0EA 3CCRN 3IP0A 2ZOFA 1FVQA 5KQ8A 2GGPB 3U1MA 1PSDA 2DIVA 3CM6A 1JXBA 2GWKA 1WG5A 5BPLA 9ATCB 4YP3A 3MM5A 2E29A 1T8EA 3RW6A 4DV2K 1H72C 5LJ5Y 4EWTA 1XERA 3ZSQA 2RE1A 3O9UA 2XGQA 3UIQA 1IM6A 3CDWA 3TR8A 3QLHA 1VQ7S 4EIAA 3R5BA 3V4IA 2QWPA 1KDNA 1T03A 3CPWM 1TL7B 5BRHA 2HHHF 4OFZA 1JNZB 3AA3A 2HLUA 2XO7A 1VQ9S 2XBPA 1MWYA 2VPWB 4FOEA 3OTBA 1RLCL 3TPQA 1FDAA 3KLEA 2PMZD 2KG1A 4RKUC 4N76A 3THXA 3DDIA 3KXDA 3D1OA 4ID5B 2DNPA 4OYBA 3DOMA 4ZVTB 3D54A 3BH7B 1KN6A 3EGWB 1ZC6A 4JI8K 4LF5F 3UNYA 1C1AA 1WF0A 3AV9A 4WFNL 1YJTA 4A8MP 4ECTA 1YTYA 3FEXB 4JI2F 3JTOA 2LMIA 5I3UB 1XBWA 2QEXS 1Q8KA 3FQKA 4CFAA 3MM8A 2NZTA 1S1WB 2HYIB 3NH0A 3NNAA 2XULA 4TQSA 4CZKA 3CC4N 1GLBG 1ZBLA 1HYSB 3BY5A 1ZPVA 4ECWA 2CGLA 3BPDA 2GUPA 2XMWA 1HYZA 5AQTA 3H3OB 2DNOA 2UXDK 2DH8A 3CC7S 3J81j 1W2BM 2N3OA 4YQWA 2EBGA 5GMKa 4B3TK 4QW9A 1Q18A 3AVJA 1K8KB 1I3AA 4LF9J 5B8HA 4FLUA 2AJ0A 1EX4A 2HQFA 3HI0A 3SQOP 3A5MC 3J7A1 3SCJE 1N5VA 2HS3A 1KWMA 2C2OB 4K2XA 5IT0A 3A8KA 4RW9A 1RDWX 2XHBA 2GELA 4CIGA 2B43A 3QZ8A 3J7Z5 4DR3F 1S6UA 4H4MA 3HT0A 3VETA 4X62K 1S1XA 1E4FT 1HBMA 4N8NA 3N9UC 3U1NA 1X5OA 4C3KA 2HLTA 2OFHX 2AA4A 4WIQA 1VISA 5E3PA 3EE9A 4X4OA 3HPOA 4NLDA 4JI1F 1T03B 1RZMA 1EWRA 3CD0A 1Q8IA 3POTB 2G8FA 1N5QA 5LMNF 3H5YA 1L5UA 4CZEA 3ZZOA 4J9QA 4YOUA 2GBZA 3OT9A 2VBWA 5IT4A 2XS2A 3TSUA 4LFBJ 4DZ6A 1R43A 1S1TA 4CJSA 2G2OA 1RT2A 4QIWD 2CPEA 4CLYA 1TK0A 3WT0A 3TTFA 1SKUB 2QL9B 4MKYA 4HEA9 4QWCA 1RGVA 4DPOA 2HHSA 5KFDA 3HHKA 2FBVA 4OHVA 3GONA 2B4UA 3K9KA 3A0IX 1G3OA 4WBFA 5JLHA 2UXCK 3AA8A 4FZXC 1UKUA 2GX8A 4C8NA 1RWNB 5JMVA 1YI2S 4H0VB 3C95A 3ZETA 4LT6A 1HHTP 3HJFA 3CIMA 5KFUA 3HDSA 4IOCQ 1S9EB 1VJQA 2HWTA 3IMXA 3Q83A 1JWWA 1QQOA 4E1JA 3D7SB 2D3OR 3ZT4A 2M4MA 5IV3A 2YKNB 1JKHB 3TAMA 2RF2B 3M2UA 4CLSA 4JOUA 2ILZA 2W7PA 4H5WA 2B51A 1GFWB 3ICLA 1RLDA 1ZAWA 4KHRA 3QGHA 4CZHA 4E7IA 3DCAA 2EG2A 4NLUA 4DPTA 1JJHA 1IH7A 1UFLA 2R8KA 4ZVOB 2GVZB 1D1UA 4ED8A 4XDDA 3LDQA 1RABB 2OFGX 3WX8A 4V1Ak 2DB1A 1NK4A 2E7XA 2XY7A 5A8RA 4DCJB 3PUFA 4MLHA 5IC6B 1NSKL 2HAIA 4J2BA 4I2QB 3VZHA 2OUGA 4LF7F 3VEXA 3NNCA 2XMTA 2XSJA 3TOQA 4KBOA 3M1FA 4CGDA 1S1XB 3M6UA 2HIYA 4M7XA 4U7CA 1Y00A 2MKSA 2FJEB 1F9HA 1RWMB 1JMTA 2Y1RI 1PC4A 2L9DA 5I4MA 1N5TA 2XZWA 3V4MA 4O0JA 2FC8A 3KUGA 2G8IA 2Q0UA 1Z25A 3WXJA 2Q6BA 1FA0A 1VLOA 1B9FA 3AGKA 3I55S 3AFGA 2XHCA 1OH7A 4USWA 2DITA 2OMLA 3D9BA 3QZ7A 4A8WA 5ETNA 3H8YA 5B0CA 1BQNA 4LFCF 3LH2S 3MM9A 2Q1NA 4M63C 3KUEA 1TL5A 5GAEI 3H59A 1S9FA 2OH2A 5KG3A 2FTRA 3SDEB 1RWXB 2FHKA 2FJAB 1NK5A 3ZTOA 1Q79A 4CZCA 1U2CA 1BQXA 2RKIA 5AQFA 2CQHA 4K7QA 1K73O 5H9EK 5GAGU 5KFCA 2RIJA 1HQ2A 4F7VA 2OSRA 3Q24A 2AV5A 4DV6K 2HNDA 3MM7B 4A62A 4CGJA 1P9QC 4M3YA 1A0OB 5H1SQ 3OFHA 3FEZA 6AT1B 3ZYYX 2V50A 1DKGD 3N28A 3MN9A 3GIMA 1YJRA 2RU9A 4LVNP 1R0BG 2WAQD 4R0EA 4KJIA 5ETMA 1QM9A 2FD2A 2IRUA 2A6AA 5F3TA 5F8HA 4JI5J 2CNLB 2E5IA 1NMEB 2R8HA 4DV0J 4RL1A 2UV8A 3H42A 4FNHA 2E2OA 1QAJA 2MKJA 1FCAA 3LDNA 3IR6B 3V81A 2MQLA 2P8IA 4M5DA 4ZVPB 4Q0BB 1ZTWA 4OZ0A 4JB8B 1X4GA 1VR6A 1ATNA 5L1JA 1NNDA 2M52A 5KRTA 4YOVA 5DGBA 2O8CB 1YBAA 4Y6IA 2YX1A 2AW0A 2BJ9A 4LR9A 1TKTA 4DMNA 2ZWHA 2QWMA 3PX4A 4CD1A 5DETA 3MTJA 1VRTA 4KH1B 1O8BA 3D68A 5GAHI 1PGZA 1XNQF 2R7WA 2OJ3A 2FGOA 2A1SA 4ZPWR 3MR6A 1DAXA 1J5EK 4BC4A 1NPRA 1FXLA 3PRVA 4FXVA 2X1AA 4KTZA 4H4KC 3AD9C 5FLXU 2R2UA 3J7ZO 2G8WA 4IRDA 1RNHA 4G3IA 4WPAA 4ANDA 4USVA 2F8SA 5HMZA 3H2LA 3O9TA 1KAYA 3SCKE 3DLLQ 3FBFA 2ZD1B 4DU1A 1IG8A 3DHXA 1CC7A 4PG4A 5FRNA 1NKBA 4FWLA 4OI2A 2P1JA 2IM2A 3CJQA 1NK9A 4ECXA 3MEEA 3TTDA 4IDKA 2CNNB 3QT7A 4OPHA 3TAPA 2GZOA 2OA8A 1QVGR 2LFVA 5KFLA 1REVB 5B09A 5A8KA 3VVTA 1FRKA 1WHVA 1N32J 1SBRA 3MN6A 3RU0A 4DHYA 4EZ6A 1CULB 3D1QA 3EPIA 4IG0B 1UVIA 2NNWA 2RN2A 3FFKB 4TSXA 2X6NA 4M3XA 3MPYA 1ZETA 3GPAA 1OJ4A 1P8GA 1TV6A 2NRZA 4BR4A 4G6VB 4PWWA 2MKHA 4F0MA 2RD5C 5KG1A 1ASWA 2P9LA 4F3OA 4J91A 3DRSB 4DR4K 4YDUA 1B0PA 3BP8A 1F5CA 5A6WA 1WUUA 4X64F 2EFQA 2Y0BB 1HHQA 2DCUB 3C94A 3T5HA 4M45A 2N7CA 2E1CA 1WACA 3JSYA 3HO1A 1VRTB 2MZSA 5CCLA 4XDCA 4I6MA 4B3OA 3HP9A 4R25A 4YB7A 3DJCA 4HTLA 3KJQB 2QEXN 5I42A 4LF7J 3OSPA 2HBRB 3SQ2A 2WC9A 3OFGA 2FDNA 2LECA 5E2QA 2GIQA 4LF2A 1U1KA 2BMBA 4WE1A 1BQMA 1SH0A 2QWQA 3MM6A 5A0YB 4HCCA 4LH5A 1LWXA 4CYUA 3DLBA 4YNQA 3WZ0A 1AFIA 2RVJA 3PNIA 2BJ3A 3HYFA 1WDTA 1D09B 1YXQA 2LDYA 2DT9A 4K0KK 3CO9A 4ZLJA 2CQBA 2G8HA 4G1QA 1T6CA 3KUHA 4XO0A 2RUGA 1EHWA 4NCGB 2DR5A 3X3UA 3G10A 2O8BA 2PI5A 2ZJQL 2DNNA 2EK1A 2LLZA 5CYMA 4LR8A 4W5NA 4WQ5A 3U3GA 3VQ8A 4EO8A 5KFEA 4L75A 2F7VA 4LF5K 1RAJA 2GCFA 2QA4S 2QA4G 1IG9A 1M5KC 1TFYA 2U2FA 4FF1A 3ATUA 1NJWA 3M8WA 1BWEA 4CZGA 3RJMB 4P7TA 4Y28C 3AOAA 5E26A 1NRKA 3I8BA 2W8KA 4DV3K 1NG9A 1D5AA 1S3XA 5J2NB 1Y3KA 1EIYB 4O3OA 4B3MJ 3R9LA 2Z2LA 1WF1A 3G96A 4W5TA 5EWEA 3CJKA 5AQQA 1LWEB 2PSZA 3GIRA 2PI4A 2ZJPL 2QTWA 4J9LA 2NS1B 4FYYB 1VQMN 4C11B 4B02A 5AFUA 1NO8A 3MEKA 3DGPA 3IGVA 5E3CA 3CD6S 4WF9Q 3VESA 2JLEA 3SV4A 2Z2MA 1UVLA 3PXGa 2P5OA 3A3OB 2NLXA 3CIPA 3LANA 4LFAJ 4YHHK 3M3ZA 3FBEA 4O3QA 3UD5A 1K6YA 1EQMA 2YCHA 2ASOA 3QO9A 3CCUS 4MAKA 4BRKA 4DR3K 1AROP 1NGEA 5DM6L 3DXSX 3VEWA 2RDDA 3K2PA 2G1HA 2YKAA 3N5BA 1VK3A 4PQAA 1SUQA 1QAYA 5C5JA 1UEKA 1RCHA 4LUBA 3NOCA 3H08A 4ZVRB 4Z2XA 3W3SA 2F9WA 3ETMA 4K42A 1TL3B 3ITHA 2CWXA 2GWJA 1VQPS 3JYTA 2HQGA 2QKKA 1NGBA 4JV5K 5ADXH 1WEZA 4YDDB 2UUAF 2K7JA 1S0NA 1H2UX 4EU0A 2KZZA 4LH4A 2O8BB 3CCQN 5LMNJ 3AGRA 1D9AA 4F4ZA 2B7CB 2YH0A 3DDKA 1FRHA 3IXQA 5DM6Q 2QLBB 2I38A 3MPDA 3UKRB 5M1KA 1KHVA 2EG1A 5GIPA 1CXUA 4K4UA 1UWAA 1MMNA 1TK8A 3W66A 2KG0A 2OYQA 1VQKN 5HQLA 1VSIA 1SPBP 2EKYA 2DTUA 1HJOA 2C2NA 3R3TA 3CJ7A 5BPNA 3MEDB 3KJFB 4I6WA 1HIYA 3NE6A 1YWXA 1WNSA 3OLAA 5DDPC 2AYMA 4BGAA 4AFFA 2UXCF 3NLCA 4IOAQ 3R7SB 2WHOA 1PJ5A 4MTPA 4CLZA 5K8PA 1OH6A 5GAHU 1ZH5A 2O8EA 2FVQA 2P9NB 3ZX0A 1BU6O 3I55N 2OP5A 3G2XA 4M5KA 2W4PA 3H5SA 3DFEA 4MDAA 2I7NA 3KJNB 2LQJA 2Q3SA 2XEXA 5BPMA 4PUOB 4P2MA 4QAGA 4K8RA 2IVMA 2BR0A 5AQMA 4DV7J 2P9IB 4BWJA 4NZ6A 3W62A 2WVDA 3AH6A 1FERA 1C6VA 1DLOB 2DGOA 3GFYA 3CDAA 1NGAA 2YQ0A 3VF0B 1X0FA 3P49B 3FE1A 3EYZA 3CCSN 3CCJS 5IWAF 4X4TA 4CEQA 2E1AA 1SIZA 3WXLA 2QC3A 3R1XA 3C19A 1H7XA 3AVHA 1L3SA 4DV0K 3G6YA 4TQRA 1R6VA 2WSEC 3MURP 1RA6A 1VSFA 3O3HA 1J27A 2VICA 5HROA 4CO0A 3CEDA 1RACB 3VGMA 3J80Y 3PO4A 3IWNC 2RKIB 2XI3A 9RUBA 3DNCA 3ZTQA 2P9PB 4DSEA 4EHTA 2CQIA 4PPDA 5KGXA 3KLIA 2KYXA 1RTJB 3L09A 3GV8B 3QICA 5DRKA 3AVLA 2B9YA 4JI3F 2WTFA 3IBCB 1RT3B 3S1TA 4I4BA 2ZDPA 4CEFA 1FJCA 2EWSA 1VQLN 2CVEA 1E6VB 3OS1A 3V1RA 3MEDA 1XUPO 2ZC4A 3BYRA 2OHDA 1FRLA 1T9YA 2NUHA 5CXTA 4G65A 4FJIA 5AE1A 4H0TB 4DQRA 3ZT1A 3RMDA 1VSDA 3HX9A 3Q8YA 1XI1A 1RAHB 4WFAQ 2DHHA 4NZ7A 3CCMN 2B3TB 3J8AA 4GO7X 1WWHA 4CIFA 3T1YJ 4QW8A 1UWBB 3VOVA 4IFVB 2C3OA 4DF8A 4IFEA 3T9ZA 3L0QA 2OI2A 2G8VA 1VQ7N 4JI4K 3TYTA 5F1XA 3BZKA 4JLHA 1S4FA 1UMJA 1UFKA 2MHNA 1VQ9N 1F2HA 4EZ9A 4MJKA 4C6AA 3GLJA 2HFNA 4TY8A 1S0MA 3MMAB 3KOAA 3CWJA 3NGTA 3FVYA 4X4PA 3GB0A 4I2PB 5GVQA 1HR0J 3NG8A 4LF4K 2EBEA 1HI1A 2XWYA 4ALZA 4DR5K 3O2IA 3OS0A 3NF9A 4HHHA 2OGUA 2E88A 1OS5A 2O8FA 3D6TB 2G1DA 3BZQA 3NMAA 1S10A 2HIQA 3QFHA 2JFKA 1FFSB 3A8JA 2YHBA 4DSLA 5HRSA 5AXNA 4GMKA 3CTRA 3E1YA 1RQ0A 1FRMA 4PG7A 4P75A 3KHHA 4M8LA 1IBKJ 3OVBA 1C1BA 1RCXB 3TZZA 4C1NI 1S48A 3T9NA 2A0FB 3AD7C 2E7WA 3TNVA 4Y2IA 1DARA 3CPWR 4EP4A 3MXMA 3EY1A 1FNMA 2OELA 5HJXA 1WC0A 3CM5A 3J7YU 2OTJN 2V2KA 1TQLA 3VQ9A 1KP6A 2CJXB 3KG1A 2FY1A 2NPIA 1C4CA 1UZHA 4N56A 5KAKA 1N34F 2QTDA 1H3DA 4NA2A 1NDLA 4CIEA 1NB2A 2RILA 2BJ7A 4ZVFA 3SV3A 1HW9A 5CZVA 1U1NA 4QYRA 3UD4P 2LA4A 1PJ6A 3THWB 5K14B 4YS2A 5HL7Q 3O3FA 4I64A 1U45A 2OPPA 2Y1LB 3D5MA 3CJ9A 3BBFA 1MSWD 4I1TA 3NF7A 1FX4A 4JI2J 1MWMA 1MA9B 3KK2B 4QIEA 2B4VA 2UU9F 5JS1A 2DJWA 1Y10A 1B70B 3CFRA 4F3TA 2ACYA 1Y7PA 3LO3A 1YIJN 3MDFA 5DG7A 2P9KA 3FRYA 1HNIA 2NRXA 5LY3A 4BDYA 2PEHA 1BD6A 4CIOA 4I68A 3LAMA 4JNEA 5HLFA 3ILLA 3FFIB 3HSJA 3OW2M 3ZZZA 3TVZA 1KSPA 4EYHB 4LSLA 4EBEA 5AZIB 1RHQB 2AJ4A 3PW0A 2ABYA 3BREA 4C97A 4M5NA 1CS4B 1H1VA 2V8GA 4LREA 4IXCA 3R5JB 2MZ1A 4BCAA 3KJVB 4CM2A 1AW0A 3FK4A 2VA3A 2F4VK 1RKIA 1W25A 3WIUA 3IDHA 3EVOA 5FPEA 1WSRA 1H98A 5FD1A 3C16A 1AFJA 2DH7A 4ETZA 4CLKA 2MKYA 2P9CA 2QA4N 2VUGA 2AF6A 3B82A 2F5GA 3ZCMA 3CCVN 2YKQA 3FCVA 1M90O 2HBYB 3VERA 3EVMA 2HBZB 2X3DA 1O0PA 3SQGB 1RT7A 1JXLA 2M0GB 5K8MA 3OL8A 4P6QA 3TVYA 3Q8VA 1BDGA 5ADXA 4WXWA 1S5JA 1S1WA 2UZAA 4KRWA 2QSFA 4CJFA 3UD3P 1RI7A 2WONA 3EN9A 4KHMA 4ANCA 3S9HA 2HMIB 1SAZA 1FWPA 2VQEF 2MKIA 3RTVA 4U67L 4R5PA 2DR8A 4IG3A 3NVMA 2E9ZA 2VQEK 4X4UA 2XM3A 1RCOB 4DF4A 3QATA 2IMOA 4KBIA 1W2BR 1NDPA 1WC4A 1FEEA 1GTEA 2YH1A 5AQPA 1IKYB 3NGYA 3MUVP 4L76A 3VR1A 2V68A 3K59A 3MTKA 1HQEA 3LA0A 4OIXA 2B6AA 3PR4A 4DUYJ 3C6TB 2C2EA 4PEOA 1JLBB 4P10A 4Z4HA 2CAJA 4JI7J 2J4RA 3SCXA 2SXLA 1RHMB 4HACA 5KT3A 4UY8O 2ZUGA 3IMQJ 2ZJQQ 3E2EA 3NGRA 2YPYA 3FFIA 1S99A 5DK5A 3DXBA 2LQ5A 4LSLB 3V9XA 3TAMB 1GOAA 3JS6A 1T02A 3QRPA 2X51A 4NMXA 4X4SA 3DLKB 3P38A 4TU7A 3BKFA 1GTHA 1S0OA 5AQNA 4I0WA 1EX8A 4UOFA 1LQ9A 4FJXA 3NAEA 4EO6A 2DR9A 1U2VA 1PJ7A 1D4XA 2AGOA 2QLFB 4QBUA 4IR1A 2HBQB 2HBMA 4NB4A 3C15B 4RWWA 4CJPA 4FW2A 3T3FA 3DN9A 3T41A 4Y0WA 2ZM6F 4F2RA 4H0YB 4RBTA 3MI7X 4MO4A 3ZZUA 1HI0P 2W4DA 3PDNA 5L9XA 4JAXA 1VGYA 4CZIA 4YFUA 3HVRA 2IHR1 2Z2ZA 1SQKA 2NZCA 1YITN 4HKQA 1GXTA 2X1FA 2D4WA 2COLA 2YWKA 2BOPA 4CGIA 1IBMF 3KLHB 4KHSA 1ZA2B 4ANEA 3KK1A 1DJ0A 3FZBA 1SV5B 2KDOA 2IVNA 4J2AA 1FHTA 1R31A 3AO5A 3BDEA 1N34K 4ISFA 2ZWPA 2X6SA 5E3RA 4IWVA 4J9PA 1UVKA 4CJ4A 1ZBTA 1GLEG 2WCXA 4PA1A 3OYHA 1FDDA 3M30B 1RT4A 2I2YA 3I6PA 3DOMB 4PG8A 4FKXA 3H25A 1EO1A 3CC2S 3O8WA 5IOLA 2VFVA 3NGZA 4JKAA 4DTRA 1VI7A 1U04A 4M3WA 3C0BA 3EKSA 1E4GT 5EUHA 3W61A 1WD6A 1NK0A 4WTOB 1B92A 2PYJA 3TI0A 5KOXA 4U96A 1QAIA 3V6HA 1GQEA 3J80O 1GMWA 1N88A 5TKWA 3ZNJ1 4CRJA 1G2EA 4KI6A 1ILYA 1WUAA 3ZX3A 3CMAS 1GH8A 4FCYA 2ASMA 2YWFA 3I9ZA 1IWAA 2VBXA 4CECA 3ID6A 5BR8K 4DFJA 1QSYA 1LNQA 2NSCA 2XY6A 5SZTA 3EX7B 4CP5A 1YK9A 3TJ9A 4WK1A 2YXLA 3PCOB 1K73T 4DN9A 4BRQA 2DNKA 3NEKA 2BTFA 1DT9A 3O80A 5HATA 3QBXA 4BRIA 2KJWA 4CJUA 3M8QA 2KVIA 3ZX2A 3RB3A 3G8SA 4RNNA 1FRJA 4I56A 4WQ5C 4P2SA 2NXCA 3E9PA 1U2VB 1F60B 1GEHA 1N32K 4PKIA 3ZZRA 3K58A 1HBOA 2IJRA 2AD9A 4GV6A 3THYB 2EFNA 3RW7A 1WN7A 3E01A 3QETA 4KI4A 3VTHA 4ENOA 4K59A 3PEJA 4JKGB 3T69A 4LFAK 2W9CB 3L3UA 1TL7A 5DS7A 3DKDA 3Q8SB 3M2VA 3H20A 5EX3A 2I9SA 3NKYA 3EZUA 1GLAG 1QAXA 4B17A 1IKXA 3BBBA 1Q7YT 3ELHA 1N36K 4IKFA 4IO9Q 1TTHB 3Q23A 4JUZA 4DTUA 5GADU 4B3RF 3OQ2A 4F4AA 1PILA 3ZO7A 3PY8A 5ETVA 4KHYA 2ZJRL 4FM2A 1E6VA 2BQUA 3H90A 5HP1B 3C7NA 4JI1K 1QVFR 3W5ZA 2HAFA 3SSRA 3L3VA 2R7VA 1TAUA 2CPFA 1ZBUA 4LVOP 4NLPA 2AT1B 2QXFA 4I9QA 1SJFA 2JC0A 2K3KA 2E1ZA 3HFZB 1FNOA 2XY5A 2GNKA 5AQRA 4ZJOA 2PA3A 1IBLJ 4P71A 3FGUA 1HKGA 2F8TA 2VQFF 3SI6A 1VQ6N 4RPFA 3THWA 3DRXA 1TKXA 2VC0A 2QN6B 3TAEA 4L72B 5K5MA 3ZNUA 1K8AT 3MCOA 1OY9A 5F41A 1VQ5N 2HVDA 2KKHA 3VQCA 3ZTSA 3MR5A 1T44A 1S1VB 3FZKA 4JI5F 2N82B 2YNHA 3DLGB 1KLMB 2GIFA 4FK4A 3JSMB 3KKSA 2ZDOA 4Y0FA 3FZMA 1HLUA 2EHGA 3DXKA 3NFAA 2OZSA 4ZMMA 2XO6A 4J9KA 2DNHA 4OKJA 3BQ0A 3DAWA 2QWRA 1NHVA 1YJVA 4I6AA 4NLTA 5FLXY 4AE5A 1RHUB 2YKMA 4A2AA 3GE1A 4MKAA 3O4WA 5SUHA 1RBSA 2P5GA 4RNHA 5CH7B 4BDZA 4OPKA 2OD6A 3M2RB 2IVFB 2D74B 1XWLA 3QGPA 1FDNA 2JWLA 2O4GA 2XSJB 4N41A 2QLWA 1R0AA 5KRSA 4OZ2A 4CZMA 1CJUA 1Q78A 2F8EX 4QWBA 2VFSA 2E5HA 1WOPA 4IO8A 1LCUA 1XHXA 4H4KA 5JLFA 4ZLNA 3T1HJ 4ED1A 4JI4F 4FM0A 4HDHA 3P83D 4ZTFA 3KLGA 2BE2A 3C7NB 4NXNK 2ZH2A 3SEOA 3CCLN 3H45C 3A3NB 4GC6A 1Q53A 2XS7A 1H6KX 2BKOA 4WE1B 1D8YA 1WSEA 1U02A 4WZMA 4RW6A 3BF4A 1PKUA 2CJ9A 4USUA 1MLAA 1KONA 2AGQA 2D0PA 3PEHA 4DPYA 2BH1A 2ZJPQ 4AT1B 1Z05A 1CJVA 3BN4A 5HMWA 4LF9K 4EBDA 2RB7A 3MPVA 1HNZJ 1YVUA 3BGRA 3AVFA 4I7FB 4TU8A 2QA1A 5RUBA 4DLEA 3CD6N 4FWPA 3GG4A 5D0GA 4UOCA 3AT1B 3MM7A 4KIAA 3L2WA 4M5GA 1UAXA 2BABA 4DL7A 5EHHA 4FSVA 4ZJLA 1TR0A 3A5LC 4J2DA 4UY8T 1N33K 2OSQA 2YNGB 3VCDA 2BM0A 1WEXA 4I67A 2AX0A 2UUBJ 5HMXA 3FZLA 4E2FB 4GNIA 3MX2A 1MU2B 4DU8A 4HTIA 5HMYA 3TO8A 5B0AA 1W7WA 2BW7A 5CYQB 2I6WA 2YWWA 3H2VE 1T3VA 1VQPN 3I0RA 2XG8A 2DH9A 2B56A 4FWQA 2DEJA 4TN2A 5J2NA 3AVKA 1K44A 1YJUA 4X66K 3HOTA 1RTIA 2VPXB 1KVJA 2QMUB 2VONA 2KLAA 3OA9A 2FGCA 4X66F 1W2IA 3MD3A 4IBNA 2C2ZB 4MIAA 5EN1A 3UPFA 4V19J 1C0TB 2YKOA 2V2QA 3LPTA 4OX9J 2ITMA 2BA9A 1RBAA 2CJQA 4LRAA 5IZHA 4X65J 1GOCA 4IEEA 2EC0A 3M6XA 3SAGA 4KKOB 2CJBA 4LFBF 5TKYA 1KNZA 3GR0A 1RTHB 5KT2A 3PSFA 2HNZB 3V6DA 3PKMA 4A46A 1N0VC 3SUNA 2DYAA 3EM1A 2FF6A 4CE9A 2R7XA 3U6FA 5CZ1A 4JK8A 2AEMA 1UJ6A 2K2PA 3CJ3A 4PZVA 2W41A 1J5EF 4KPYA 4CI6A 3V9UA 1S77D 5AQXA 1B0VA 2QFIA 3HPGA 2FJWA 5KFNA 2WVFA 2JJ4D 4BHQA 4OJ1A 4JI0J 3M6VA 3FCHA 3OR2B 2YNFA 3N01A 1GLFO 4C2MA 3OYGA 2HQDA 4H8KA 1XMOK 3PIOQ 3LL3A 4OO1J 4JI4J 3IBFB 4EHUA 1Q7LB 2BOAA 1G7CB 5T7BA 4QOZB 3QSIA 3WC0A 2E5JA 3CI5A 1NGCA 3O5BA 2G2YA 4IJAA 5HO4A 4OVLA 3Q7CA 4LQ9A 1KLNA 4O4GA 5HI7A 1IBLF 3DXMB 1HR0K 3ISZA 2HG4A 2DFHA 1BMQB 1ZM4A 4ZVUB 1GMWD 1N52B 5HBMB 3MFIA 3WC2A 1UPPA 5DM7Q 4TLQA 4IRCA 2DBBA 5KFMA 2C28A 4NLYA 5IV4A 3MECA 3PHEA 1F3VA 2RH3A 2UP1A 3W5YA 4XH4A 4AILC 1D9DA 4BR5A 5JJBA 5M1FA 3QBCA 2Q0RA 4NO7A 1XMQK 3NWGA 2XNRA 5GAGP 4DL4A 1N6QA 2R9LA 2HSTA 3HKWA 2AGPA 3C14B 5DQIA 4QYZK 3C15A 4EFHA 3H46O 2DGWA 2GMHA 4DU3A 4DR1J 4FLVA 1SQGA 4N7TA 5KT4A 1VQLS 3AA4A 3BGFA 3RBDA 3WXMB 3MK6A 1QJHA 2K7KA 1YLXA 4BR2A 4OZ1A 1U1OA 4AHRA 1OSCA 3QINA 4HI2A 4OLAA 3GZ7A 1IKWB 4BC2A 2D9PA 3FEYB 1LW0B 1U1LA 4H54A 4HT7A 4GVMA 4DR3J 4UT4A 4X4VA 2HFZA 4CCHA 3CMAN 3SUOA 4OV6A 3I5BA 1FDBA 2DPJA 1CZAN 2QX0A 3C3LA 1FKAF 1XMBA 3MEEB 2WUSA 1EP4A 3I5AA 2AZ1A 4E89A 2J7UA 4JI2K 2BBEA 2PYLA 2YNIB 2V2ZA 4OYZA 3UCZP 4BS2A 2O8DA 4BWMA 3MMBA 3BJYA 2UVWA 2V4JB 1TL4A 2BDPA 3DMJA 5LL6d 3MXJA 1RAAB 1CULA 1N8RO 4W5OA 2DISA 1X4CA 3M4XA 4CF9A 4R5PB 4IG3B 1BISA 3F5TA 3AQPA 4ZVHA 4DU4A 3CDUA 4KC5A 4XPEA 1HWKA 2ZNZA 1S1UA 4DBQA 3PW5A 3PIPQ 3SK3A 1WI8A 3WNFA 1N8RT 1WF2A 3A8EA 1WHXA 2KYZA 3OYNA 1O6XA 2WVEA 1Q81O 2FBYA 1FWKA 3U02A 2GVZA 3T5KA 2F63A 1O1WA 3NMRA 2RHQB 1B0TA 1RAFB 2XYPB 4KT0C 4CF0A 1RTDA 1B9DA 4ZPDA 2RS8A 3RSEA 3SXLA 2DVIA 3PVXA 1K9MT 4MK9A 3NH1A 2VQFK 1JLFB 2KL8A 3O4QA 1M1KT 4KGXB 2AEFA 4LIRA 3OJSA 4OX8A 1VQNS 2HHHJ 1IO2A 4RU9A 2CWKA 5HVFA 2CFXA 1JLQA 3KNAA 3OBIA 3HHLC 4WFYA 1X31C 3GSIA 5J2PB 4Y2CA 4HHUA 3U7JA 3AO4A 2IOCA 2P9PA 1LW0A 1M1KO 1S49A 4ZCKA 4CJTA 2HGMA 2NSBA 2NRWA 2WBMA 5FJ4A 3B6OA 4Z94A 3TSPA 4NYNA 3THXB 1V3RA 3WXIA 4ZPCA 2QL7B 4OJGA 4CBWA 4ZVEA 1FXDA 4F4XA 2V0NA 1X9WA 2G0JA 3L2QA 2VWKA 4BRHA 3OXGA 2IJFA 3DDNA 1EP4B 3PG9A 1YIJS 5A2QU 4U8YA 3SUQA 2QLJB 1GMVA 3ZEUB 4FJGA 1X0PA 3O4NA 4NXMK 4NCGA 3IRWP 4O5BA 4KTQA 1U2FA 4GC7A 3QEIA 3KLHA 4ZVQB 1RT1A 1SJ3P 3DMJB 3KWMA 5JVHL 4JI3J 3OBYA 3LWLA 2A18A 4ITSA 4JI1J 1NK6A 3IR7B 2IM0A 4DTJA 1NXIA 1NGFA 4R0JA 4PYAA 5ETSA 2CQPA 3A8YA 4A57A 2OAUA 4QR2A 2HF4A 3P39A 3T1HK 4K4SA 3TSQA 4RR5A 1SJ1A 2KFNA 1VSKA 5AQVA 1RB0A 3LP1B 2MQQA 4NRTA 1IBLK 3L2VA 3CF5L 2RRBA 2PT0A 1KAZA 4TY8B 4PWDA 4JD2B 1ZAXA 1HWUA 5KG5A 1YJ9N 3KFWX 4W4MA 2DKOB 1LWCB 1B64A 2E44A 2GQQA 1SJQA 3D2WA 4CI0B 1RBRA 1PBAA 2CQ0A 2ZZNA 4OZJA 4B3RJ 3CE8A 3RBXA 1NNEA 5C24A 3OD2A 3MR7A 4DPUA 3IG1B 1QVGM 1K1QA 2VWJA 5KFXA 2GJFA 2AIRB 4DU7A 1NJXA 1F2GA 4RW9B 1B99A 4NMLA 2HBJA 5KFAA 2A41A 5LSOA 1U1RA 2Z56B 4M5HA 3DU5A 1OIAA 4OGEA 1FFWB 1MU2A 4DL5A 4PQUB 1X4DA 2NXJA 2V9KA 3TVKA 2GJ2A 4MKVA 3H7HB 2DR7A 1U2RA 1WOOA 4BBYA 2N4CA 3EUNA 4FNIA 3IR5B 3EZOA 1V4SA 4CLLA 4OHZA 5KFIA 2D0CA 2LSNA 4QJVA 4CJWA 3OTDA 3GIIA 4IH5A 3BQ1A 5FPDA 3JQMA 1VMBA 2ZWOA 3ZSOA 2QA2A 4K4XA 1HBOB 4OLOA 2RQKA 2Q66A 5A8WA 4DR6J 1NLKL 3DOLA 2RPIA 3BO2A 1J53A 2KHCA 3E3XA 1DQ8A 2R8JA 3KZBA 1DTTB 1HD1A 5KFYA 3M32A 3CD5A 2MKCA 2DXDA 3NRBA 1SI9A 4HUEA 4B9VA 2QYCA 2RUSA 4V19S 3HHDA 3EGVA 1GOBA 2ZVIA 4O23A 2JRSA 1NGJA 4USHA 2AJ2A 1RA7A 1S57A 3K17A 2MLZA 1QLNA 5GIOA 3LALA 4WQ4C 2XS5A 4NZ0A 1TAQA 4CO3A 3PW2A 3SYZA 3K0JA 4OLPA 1VQ8N 1ULRA 4KPCA 3OYLA 2YKNA 4UQTA 1EXQA 1TL1B 3AB4B 1T05B 4R8UA 3VPZA 4CT8A 4DDFA 4GVBB 4J9VA 1WKKA 2B9XA 3G87A 3NGKA 3GYGA 4RWXA 3QPIA 1FD8A 4U8VA 2E2NA 4ZPBA 3Q8RB 1RBOB 4F2SA 4OJRA 4JI6F 2YHAA 4M3TA 3KNGA 4ES3A 3EE8A 4GV9A 1YITS 3IM8A 3JSMA 5F9LA 3ZXWA 3KJVA 1PC5A 3PYGA 1HQEB 4H5TA 5D3GB 1RK8A 2H1YA 3P5TL 1KBRA 2FJBB 3J80U 1VHIA 1TMJA 4NRUA 3X1LB 2W1BA 1Y5IB 4JK9A 3OUYB 4DCHA 4FJHA 2D0BA 4JI8J 2DHXA 2FHJD 1IBCB 5KG6A 3F41A 3CQYA 4CK2A 4MT1A 4DV0F 1P1TA 3FUYA 5J2QA 3D2FB 2MKKA 1NLVA 3L2UA 5HSPA 3NGDA 4GKJJ 2EXUA 2QT7A 3CC2N 3UVJA 1DY3A 2ZEJA 5DGAA 3C6AA 2XYGB 3TAGA 3V9SA 1Q5VA 1IKWA 4YY3J 1S6PB 2G0IA 4FJLA 4RCHA 2QL5B 4B1VA 4OHYA 2AHOB 1CJUB 2VG6A 1U8WA 5L39A 2DGTA 3OFFA 2MQNA 1M5OC 1BY9A 1PCAA 4DEZA 2W42A 3FR0A 2HKEA 3FBBA 3VQQA 4V19X 3KLIB 1S12A 2UUWA 4B1YB 1IKYA 5HRRA 4E1MA 3TAQA 2H5EA 3TUIC 1L3TA 2V8HA 2BE2B 1XNQJ 2HNYB 2XTJP 3FKBA 1ASVA 1Z1ZA 5AQZA 4BRDA 1S76D 4CLWA 3D6HB 2MQPA 3DXMA 1OYEA 2JH3A 1T05A 4K0KF 1CJTB 4FZYA 3G82A 1RHKB 4Y1CA 5CYMB 3JYTB 2BQ3A 2J6UA 2A2CA 4Q43A 1XR5A 1K9MO 4HACB 3MWBA 4DUZJ 2K3IA 1ZM9A 3S8SA 3EZ5A 5ETPA 4H4OB 1UVMA 4K4ZA 3M1VA 4WCEQ 5K8OA 3CHWA 3ENAA 2FSJA 4ZDNA 4EGLA 1RT4B 3P4UB 4DUTA 3HSDA 2LEBA 4ZCMA 4DV1F 4ICLB 4DR6F 2RE2A 4WWSA 4BRFA 3UWTA 4A5AA 3W64A 1TUVA 5C2CA 2W24A 4OMFG 3GMGA 1RTZA 2CPJA 3R7BB 3SZ2A 5D0RA 3AA5X 1WC5A 4FK2A 4MFBB 3N79A 3E8OA 1I5OB 2VG5B 2J9DA 3HP6A 2Z4PA 4WFZA 3R8EA 1T94A 1RAEB 4XTTA 2VF3A 4I6YA 2JEFA 4M5LA 2ZGYA 4C23A 2E5GA 4RLEA 4DX6A 2AEJA 1JLEA 3PJWA 1JL2A 2C42A 4Q2LA 1HBMB 3CYMA 4GKKJ 3D2FA 5FDLB 3OVAA 1RHJB 2QGFB 2V51B 1G15A 3HSGA 3I5CA 2CPXA 5ETQA 2XMJA 4B3TJ 2WVBA 1W7AA 1Q86T 2E66A 3IAYA 2YPZA 1GLLO 4NYOA 2E2PA 1RJJA 1WLJA 1NCLA 2HVIA 1AUDA 4DKWA 2FC0A 1BHLA 3TW0A 4A8KA 1EWQA 4WU3A 2GFFA 4DN0A 3TR5A 1C0GA 5F8MA 2GGPA 1RYRA 3VGKA 4KTWA 3JQJA 2E1PA 3E66A 1YJNS 2V8DA 3E01B 1RDBA 2MMYA 3GG0A 2NUBA 2J5AA 2O8DB 2HGNA 5G4DA 5I3QA 4FPIA 2YHXA 5JVGL 1WAFA 2YY3A 3HL8A 3JAMY 5AQLA 4OI6A 2J6SA 2GEMA 3D6FB 4A8FA 3Q8UA 2NR0A 2FSNA 5FPMA 5C2GA 3R7NB 2XZTB 3L2RA 1SCJB 1OY8A 4RW4B 5C12A 4B1WB 3IBWA 1PAEX 1ZM3A 1TZ0A 3QFPA 1A5WA 1KD1O 4M5JA 4W5QA 1OH8A 3K7RA 4Z4GA 5DG9A 5DDRC 5HANA 2CQDA 2QG9B 3D3CJ 4EI2A 3BDPA 2W6LA 4ZLLA 1VQOS 2D3O1 1RBTA 3ENBA 5F2RA 3BEGB 3NMUA 2F65A 3TAFA 4FJ9A 3WNHA 1HFEL 3ULEB 4AXJA 1TK5A 3DRPB 3P31A 3CFOA 1IBKF 4AH9A 1CG2A 4FWNA 1WKJA 2O01C 1UEUA 3KYLA 1SH2A 4GRSA 3OVSA 2VG5A 3D0HE 1QS4A 5HOOA 5DO2A 1JLBA 1IV0A 3C66A 5C10A 1VK8A 5CCMA 4I2QA 3LPEA 2EVZA 4RJVA 4JKGA 2DRAA 4R79A 2C2MB 1F6TA 4PQUA 2ROGA 4DG1A 1GAOA 3O3LA 5F0XA 4DQSA 2ITGA 3AHPA 3CJ4A 2KVQE 1SL1A 3OYBA 2W25A 4DHVA 1RADB 4E8UA 2BKPA 3WBZA 4HDGA 4ER8A 3C16B 4F9OA 2PE8A 2A40A 1S7IA 1GLJO 3VV2B 5LL6Z 4HYKA 1F9FA 3UNGC 1R8AA 4FYXB 2HVEA 4KHNA 4B3RK 3P4IA 2BXJA 2W01A 3RWUA 3IRXB 4KGKA 2V7ZA 4J7CA 1FJGF 1HWLA 4BRMA 1FJGJ 2ACMA 1FW6A 3HVTB 2DNYA 1L3KA 2P9GA 3KK7A 2CG4A 1Z26A 4DXLA 2V6AA 1YJ9S 5F3ZA 3LDPA 2AP6A 1UW9A 2UVVA 2CPIA 4OYWA 2JDJA 4B9SA 1SC4B 3H40A 2UUCF 2ZJRQ 4IFYB 3PX0A 4ZN3A 1T7PA 1TUYA 1YTAA 3GSDA 1QTNB 4CEZA 2FLLA 4LSZB 4GMJB 3NH2A 4NLSA 4B3SF 2W7OA 4BQLA 2BYCA 3H5UA 5CE3A 3OYFA 1RT3A 3LP1A 2DNQA 1KVIA 3SQ0A 1S72N 2GMJA 1NGDA 4L8RB 3QO9B 4CO1A