1S1VA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
539
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 145
structure length 533
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1vA05
4RNNA 4IBNA 1S6PB 3BJYA 3D5MA 3GIIA 4KHRA 4DTJA 3OSNA 4ZPBA 4E3SA 1TKXA 2FC0A 1VSEA 3LWLA 4RNOA 3OL9A 1CZBA 1C0UB 3SPZA 1KCFA 4IG3B 1I6JA 4URGA 1ZETA 4FBUA 3CJ2A 3C6UA 2YHBA 2BE2B 2HNDA 2D0BA 2HHSA 3AVLA 4I9QA 1U49A 1HJRA 2J6UA 5CZ1A 2RF2A 3OYDA 3OYAA 2BQRA 4AHCA 5T7BA 5C42B 3FSIA 4J9KA 3TWHA 4HUFA 5KFQA 2HMIB 2AX1A 1D8YA 5L9XA 1XHZA 5KT6A 4DSIA 1EKEA 3AO1A 4OLAA 4WXWA 3ZSYA 2E4LA 3QEVA 5J2QB 4M41A 4CGGA 4TY8A 4QAGA 4CGJA 3CJ4A 3DLKB 1L5UA 1ZTWA 4CJSA 2IAJA 1QSLA 3VQAA 1FKOA 3QIPB 2ZQBA 1T05B 3FFIA 4F2SA 3CVKA 3TANA 5F8HA 4QWCA 1UA0A 1VSKA 2UVRA 3KLGA 4DTMA 5C25A 2FBYA 1NKBA 1FK9B 4NLSA 2GC8A 2G8WA 4EEYA 1HPZA 2ZE2A 4WFXA 4G3IA 3TI0A 3NH0A 3V4IA 4FK4A 1RBSA 4NYZA 4NLRA 2VG6A 1JXBA 2C28A 3VQQA 4AH9A 4FW2A 1REVB 1L3TA 4ED3A 3VQ4A 3HVTB 4CIFA 4ED8A 4J9LA 2EHGA 1NJWA 2XCAA 2D7SA 5DQIA 3OYGA 4O3QA 4FZXC 1VSHA 4CJWA 4FK2A 2XWYA 1UWBB 1EETA 4R8UB 1QAIA 1NK0A 3KLFA 4YR2A 4JUZA 1YT3A 2HNDB 3CYMA 1TKTA 2Z1JA 3AVAA 4B8CA 3I5AA 4KV8A 4TXSA 4C8MA 5FRNA 5EUHA 4W5NA 3OYEA 2PYJA 3QIOA 2BDPA 3HHKA 3O4NA 1TV6B 1SL1A 2HMIA 3RAQA 1NKCA 2AGOA 2YNIA 3DRRA 3H5UA 3IGVA 3SQ4A 3JSMA 3MEEA 1NKEA 3CFPA 3M8QB 3MR5A 2FVRA 4RU9A 2J6SA 2R2RA 1ZTTA 5KT5A 3DDKA 2HHWA 2JC0A 1U45A 1Q9YA 3HYFA 4RW8A 5J1EA 2XGQA 5KG2A 2I1RA 4WFZA 2AQ4A 4ID5B 4IG3A 4Q44A 4FJKA 1RT2A 4UQGA 4ECVA 3ZT3A 1MMLA 2G8FA 3QNNA 4RW6B 3CFOA 4NRTA 4FVMA 3VA0A 2GIRA 2F8EX 4J9MA 4FCYA 4OKJA 4MIAA 3RBDA 3AVNA 4DL7A 3V6KA 4FS2A 3RTVA 2HW3A 3OLAA 4FLYA 3IG1B 2ILZA 4HUEA 1VSFA 4FJ7A 2KFZA 3AVMA 3I8DA 4IH6A 3SCXA 1RTIA 3QYYA 1SV5B 1TL3B 5CYQB 4ZPDA 1JLQB 1YTAA 1S9EB 2DPIA 1D9DA 4NRUA 4QOZB 4TN2A 1LW0B 4K8XA 2XY5A 3MEDA 2Z1GA 1RT6B 2JEGA 5J2MB 2Z1IA 1TK5A 2WOMA 4O3OA 2E9RX 5KFWA 4MQ3A 2QKBA 5KFEA 1SKWA 3TAFA 5HBMA 5KG5A 5F8LA 3BSAA 2P5GA 1HYZA 4DTRA 1TL1A 4Z4HA 3C94A 4IH7A 1D1UA 4ZVFA 1JLFB 4CGHA 3G0ZA 4FJ9A 3SUQA 4O3RA 3RMBA 4EBEA 4ED0A 2FBTA 2XY8A 4HUGA 1HMVB 2XI2A 4FJIA 3QEWA 4ECXA 3CM6A 3SV3A 2KTQA 3RAXA 2VA3A 2YKMA 5KFFA 4QWEA 4LSNA 2XY7A 1Y97A 1RT2B 4N56A 3NE6A 3BQ0A 3A2FA 1BI4B 4E1MA 3GV5B 2D0AA 5K14A 1BQNA 4PUOA 4NCGA 4RW7B 5KFXA 2HVIA 2HWHA 1DLOA 4Y1CA 3KLEA 2PY5A 4RG8A 3TAGA 1HQEA 1YVFA 3V81A 4CGIA 4RUCA 4CJEA 2YHAA 3QZ8A 4E7HA 5KFZA 3ZSRA 2R8KA 2OZSA 2HAIA 1J53A 5JXSA 5DK5A 4CHYA 1C1CB 1S1UB 2JLEA 1FKPB 4I7FB 2ATLA 4BE2A 4JLHA 4CIEA 3SI8A 1W9HA 1NHVA 1IKYB 5J1EB 1Z26A 1RT5B 5F8NA 3OYNA 4WFYA 1KLNA 3K59A 3HVAA 4KHUA 2C2RA 1UAXA 2ASLA 1SH3A 3KK2A 4N76A 4TQSA 2HHQA 4QWDA 2DFFA 4PWDB 3BGRB 3RBEA 1EETB 3FQKA 4HKQA 1L3VA 1TGOA 1S1TA 2FVCA 4CK2A 2OPPA 4B3OB 4XO0A 3PR5B 4K4TA 4QWAA 3QEPA 4YR0A 1RTHB 3H08A 5KFSA 1S6PA 2UUWA 1QE1B 2WK4A 1RTIB 3LZIA 5FROA 4CHZA 4DSKA 4B9NA 4KHSA 2F8SA 4DF8A 3GV8B 3OYJA 1C1BA 2W7PA 4M94A 1B9FA 3OJUA 3KLIB 2AX0A 2ALZA 4IDKA 3MEEB 4EO6A 5J2MA 3L3UA 5K14B 3MEGB 5I3UB 4LSLA 2IM1A 1HARA 3PO5A 3OYLA 4CEAA 5DLFA 4CJQA 4Q45A 4MK8A 4RW7A 3AA2A 4E89A 3TAEA 1IM4A 2RKIB 3JYTB 4IRDA 1VRTA 4QPXA 3K5MA 2OPSB 4MH8A 4W5TA 3M9MB 4RW4B 3DLEA 4ECYA 5KFDA 3G86A 3ITHA 3FDSA 4ZPAA 4O0IA 3QLHB 4J2BA 4CHPA 2ASDA 2F8TA 1R0AB 4CGFA 1ZBFA 1LWFB 4JV2A 2IDOA 1K1QA 3QERA 3H59A 4MK7A 3L2QA 1N5YB 1KFSA 1S6QB 4E0DA 4ID1A 4M3YA 1X9SA 3IRXA 4EZ6A 4K4XA 1RCHA 1JL1A 4Y34A 3DMJA 4KKOB 1SV5A 1JX4A 3ISND 4W5OA 3V6HA 4DU1A 4M3RA 1T03B 2B5JA 1WLJA 4DL6A 2IC3B 3MEDB 1HNVA 3ULDA 1S1TB 3K5LA 2FLLA 4N5SA 3LP1B 4CE9A 3M8SA 4F4KA 4IFYB 4QCLA 3ZSQA 1RT4A 1SKSA 4CEBA 4QW8A 2YKNB 3IS9B 2HNZA 5J2PB 3OYMA 3HPHA 4XPCA 2KW4A 4FJHA 3MXJA 4O3SA 4CJRA 1GOAA 1S0OA 3HO1A 2IOCA 1N4LA 3C6TB 4KHNA 4ZP8A 3HP6A 1BIZA 4DQQA 2Z1HA 4FLUA 1MU2A 3DLGA 4J9OA 1IKWB 3VQ6A 2X78A 4BWJA 2E6LA 1IO2A 2KZZA 4O4GB 5KT4A 4E7IA 1U09A 5KFCA 4B9SA 4Z4CA 4F3OA 3NF6A 3Q8PB 3OYKA 3V9XA 3HT3A 5F9LA 3D45A 4IG0B 4TYBA 3KHHA 4DTUA 4C8LA 1JLBB 4YQWA 3HK2A 2BE2A 3V1RA 2HVHA 5KFTA 2IGIA 4JV1A 3PUFA 3ZCMA 3I0SB 5EWEA 4CK3A 3JSMB 3LP2A 5KFIA 4NCBA 1XR5A 4Z4FA 4JRPA 4DTNA 4HVJA 1JIHA 3LP0A 2B6AA 1IG9A 4J2EA 2JC1A 3V9ZA 2C2EA 2NUBA 4OGEA 2ASJA 4RUAA 4CFCA 3I5CA 1TK0A 3QO9B 4KKOA 4OPKA 1C1CA 4R0EA 1S1UA 2V4RA 3DM2A 3HVWA 2P1JA 4RNFA 1S9GB 1ITGA 2IAJB 3RMAA 2DY4A 2FJWA 5C5JA 3AVGA 3SFGA 2V4QA 2GBZA 3ZT2A 5JS2A 1JLEA 3SZ2A 3MFIA 1C0MA 1A5XA 4NLOA 4ECUA 5KG7A 1ZYQA 3BREA 4RW4A 4FJNA 1RT4B 3T5HA 1SH2A 3ZT0A 3PX4A 3V6JA 5HLFA 1LAWA 4Q8FA 4IQXA 4H54A 2VG6B 2BQ3A 4Y2AA 1FXXA 4Q5VA 2A1RA 1T7PA 3CDWA 1ZBUA 3MF5A 3PV8A 1REVA 3KHGA 2WB4A 5KFNA 4DS5A 2LSNA 3KLHA 2DTUA 4KBIA 1BGXT 1EP4A 1JXLA 3SI6A 4EP4A 1RBVA 3KJVB 2DFHA 2IMWP 3OL8A 2CJQA 4K4WA 4F4XA 3PX6A 1O1WA 4I2QA 1RNHA 1I3AA 1HNVB 2HNYB 4OLBA 2UVUA 3QGIA 4FJXA 4LSLB 5DLGA 1HRHA 4DTSA 1U48A 1TKTB 1Z4UA 3GYNA 1BL3A 4M3WA 1HMVA 4J9NA 2O4IA 1RTDA 1TK8A 3M8RA 3TQ1A 1NK7A 1T3NA 5CYMA 1RBRA 4EYIB 4LQ3A 1KVCA 3TVKA 3MR6A 2VG7A 4H4OA 4KSEB 1OS5A 3OL6A 3M8QA 3Q8RB 3PX0A 4K4YA 3DRSB 3DOLA 4F8RA 4RZRA 3WNFA 4NLDA 4RW8B 2RF2B 3QINA 1TVRA 2ITGA 1QHTA 5I42A 1NOZA 4CECA 1RDBA 1KHVA 1EX4A 1XHXA 3V6DA 3S3MA 4KHWA 2IC3A 1U4BA 3H5XA 2BRKA 4NLYA 4FZYA 4Q43A 3OHBA 1KLMB 1S4FA 3OS1A 3D0PA 4E1NA 3CJ3A 5JUMA 4K50A 1TKDA 1TP7A 2G8KA 1W0HA 4FM1A 1N6QA 4ECWA 1GOCA 3TAPA 1EP4B 1RDCA 1S9FA 4TSXA 2XRIA 2YNHA 2QV6A 3UR0A 5L1KA 3OVNA 1C0UA 4W5QA 1SL2A 4ELVA 3RMDA 1W25A 3LANA 3OS0A 2V0NA 5F8MA 4I2QB 1LV5A 4Q0BB 2JEJA 3BSCA 1J5OB 4FXDA 5KFJA 1C0TA 1IH7A 3DYAA 3VQDA 3CFRA 4FM2A 1XWLA 1BCMA 2P51A 4B9UA 5HBMB 4CHOA 2WRMA 4ZP9A 1WSIA 4E19A 4HCCA 3EZUA 3KK1A 1BISA 5KFGA 2YV0X 4LY7A 1LWCB 3WNHA 4L8RB 1JLAA 1WNSA 4IDKB 4FS1A 3RWUA 5J2QA 3PZPA 4BWMA 3VN5A 3GIKA 5KFMA 5DQGA 5KTQA 2ZD1B 1TKXB 3H5SA 2FJVA 1RDDA 2OYQA 4NLXA 3FFIB 4M95A 1RT3B 2W9BB 2FVSA 3QGHA 2ILYA 4K4SA 1G15A 3L2UA 4DQPA 1Z25A 3S3OA 2YNIB 3DRRB 2FLNA 1HPZB 2ZE2B 1S5JA 1R0AA 3G6YA 1DLOB 2IJNA 1JLGB 2J6TA 3KTQA 1RTDB 4PQUB 4KI4A 3LZJA 4O3NA 1HQEB 4ZVHA 3B6OA 4CJLA 4B9TA 1L3SA 3BR9A 4U6PA 1CXQA 3PW5A 4N41A 5EU7A 4CFAA 3BSOA 3RMCA 2VG7B 2CKWA 1XR6A 1HNIB 5KT3A 3PJWA 3VQ5A 4FLXA 3NMAA 3UDLA 1T03A 3OYCA 2G8UA 3VQ8A 4KB0A 4CIGA 5KFKA 4J9RA 4KHQA 1IKYA 1DTTB 2IM0A 4FLZA 1C0TB 4ED2A 4NLPA 3SJJA 4M42A 3TAMA 4M45A 5C25B 2IM3A 2D3ZA 4M3UA 5KFYA 3BGRA 1ASUA 3PR4A 1NHUA 4IOBA 4M3ZA 1SKRA 3DRPA 2O4GA 5KG3A 5HRPA 4MKBA 4J9QA 5T14A 4KAZA 4DL5A 4ZHRA 4C8OA 3P83D 2VA2A 1T94A 5L1JA 1ASWA 4Y2CA 3NF8A 3ALYA 2RDIA 1IKXA 1S1XB 4ZMMA 4DFMA 5HRNA 3SUNA 4Z4EA 1N56A 2WHOA 3AVBA 3V9WA 3PW7A 1LAVA 5KRTA 4O44A 2OA8A 1JLBA 4RNHA 1RT7B 2Q3SA 2FBVA 1QQCA 4NLUA 4CEDA 1NOYA 1IKVB 3RB4A 4OGCA 3DRSA 3SV4A 4DL3A 4YFUA 1X9MA 3P5JA 4DSLA 2ZKUA 1JLCB 1S1VB 2RKIA 3JYTA 4KE5A 3MXMA 1VSMA 3KK1B 4J9PA 1TV6A 4KI6A 1TVRB 5L1LA 5I42B 4CJ3A 3NGIA 5HROA 3L2RA 3NF9A 4DU4A 4G1QB 4RW9B 3V6DB 2E9ZA 3AO2A 3AA4A 1LW2A 3MAQA 3AVFA 1C2PA 3SQ1A 1ZBHA 1UOCA 2I5JA 5EWFA 4C8NA 4IFVA 4Z0UA 1GOBA 2BANA 4HTUA 2ATQA 3ZSZA 3AVHA 3TAMB 3SYZA 2GV9A 3PO4A 2B5JB 4FJLA 3M8PB 5FRMA 3RB6A 3CJ0A 3HP9A 4EBDA 4IR9A 4GMJB 2VWJA 1EXQA 5C24A 3N6NA 1RBUA 3LP1A 1B92A 3HSTB 5DMRA 4IFYA 2VG5B 1S0NA 2QXFA 5FDLA 1WN7A 1RT5A 3OYIA 4DLGA 3SFUA 1WNEA 3S9HA 4CJVA 4EZ9A 1QUVA 4FBTA 4AHUA 3KJVA 2W9AA 1TAQA 3ZSVA 4FLTA 4DMNA 4O44B 1JLAB 1KRPA 1RTJB 1MU2B 3DLGB 1NJZA 1WAFA 4KPYA 1IKWA 2OPPB 3TABA 4PUOB 3E01A 5KFOA 1D5AA 3BQ2A 4DQSA 1S1WA 2QK9A 3PW2A 5EWGA 1RT3A 2W9BA 1Q9XA 5KT7A 3WNEA 3K5OA 3V81B 4IKFA 3LP3A 4CEQA 2B4JA 4CEEA 3NDKA 1SUQB 4KFBB 1KSPA 4ZVGA 4ZHRB 2HHVA 5KT2A 4LQ9A 1HQUB 4EP5A 3Q8SB 2YNFB 3DOLB 4O5BA 1L3UA 3N6MA 3RRHA 4MFBA 4B9VA 3QIPA 4OKEA 3MR3A 3B6PA 4BACA 1TQLA 4TQRA 1VRTB 4KREA 5DQHA 2XY6A 2OPSA 3ASMA 4AHTA 5F8JA 1SH0A 4CF1A 4DLEA 3SUOA 3HXMA 2RDJA 2XCPA 1RT7A 2G8VA 2OZMA 4ELUA 3CDEA 1S9GA 3ITHB 4GW6A 5DGAA 2HWIA 5D3GA 2QE5A 5SWMA 1KFDA 2W9CA 3T5LA 3NHGA 2X6NA 1NK4A 1S0MA 5C42A 4Z4GA 2R7YA 3RR7A 5KI6A 4OJRA 4FYDA 4H8KA 3VQCA 5HRSA 3DMJB 1N6QB 3FQLA 3H2LA 4F50A 3KD1E 2W7OA 3T5KA 3CO9A 3DRPB 1NJYA 1CZ9A 2OPRB 4TYAA 4IKAA 2D3UA 3O3HA 1A5WA 3NAIA 4MKAA 2C2DA 1NK9A 4OKKA 1VSIA 4DTXA 4YR3A 3AV9A 4BDYA 2G8IA 4DWIA 1D0EA 5KFBA 4DF4A 1S49A 3NBPB 2W8LA 2D0CA 2W8KA 4K4ZA 4ZP7A 3VQBA 4KFBA 3CM5A 3NF7A 3QLHA 4JV0A 4WXOA 3NCIA 4IR1A 4O3PA 4CJUA 5FDLB 2JEFA 2KQ2A 4O0JA 3ZT1A 4NZ0A 3GILA 4DQIA 4F4ZA 1GX6A 3AVCA 1RBTA 3NH1A 3QZ7A 2WCXA 3T19A 2JGUA 2AJQA 3OS2A 2RN2A 3OJSA 1VSDA 4NLVA 3V9SA 4ECZA 2DFEA 2AWZA 2AGPA 1VRUB 4ICLA 3V1QA 3KMQA 1KTQA 2BANB 4PQUA 4IRCA 3TR8A 4DL4A 3V9UA 2B6AB 3LP0B 3HPGA 3QGGA 4ELTA 3AA5X 3DLEB 4Q8EA 4X2BA 4B08A 2R2SA 2YKNA 3UIQA 3DI6B 1NK5A 4FJMA 1D9FA 4DL2A 1S9EA 1LWFA 1CSJA 2D5RA 3DOKA 1BIUA 5DGBA 4WZQA 3T5JA 2R2TA 4I9LA 1TAUA 5F8IA 2G8HA 3KLVA 3NGZA 4B8AB 1LWEA 4KAIA 4DFPA 3MXIA 2HB5A 1KHWA 4FW1A 3DLBA 2XC9A 5D3GB 1TL1B 3H5YA 3LPUA 3U3YA 3VQ7A 2UVVA 4DQRA 1B9DA 5KFLA 3LP2B 4U7CA 5F9NA 3ICLA 4WYWA 3KLHB 1NK8A 3PY8A 4B9MA 4OPJA 1IKXB 1TL3A 5CYQA 1S97A 4I2PB 4BDZA 1SUQA 3OYBA 4H4MB 3L2VA 1LWCA 1N48A 3NFAA 3M9OB 1HYVA 2IM2A 3K5NA 1RT6A 1CLQA 2HNYA 4FK0A 1QTMA 3SNNA 2WOMB 4CK1A 1BQNB 1RILA 3SUPA 5KRSA 4JS4A 4AILC 4ICLB 2WTFA 2WONA 1WAJA 3HM9A 4NLTA 2HHUA 5KFUA 1X9WA 4OVLA 2E9TA 5E41A 1GX5A 3PW4A 5CYMB 3KIOA 4CF0A 4JS5A 2XO7A 4FJ8A 1TKZA 2FVPA 3S3NA 4LH4A 3PJXA 4G1QA 4RW9A 4H4OB 2XHBA 4Y3CA 1BCOA 4ZTJA 4Y1DA 3HPOA 3QNOA 1JLGA 1LW2B 4YMEA 3MFHA 1BHLA 1NNDA 4AHRA 1FKPA 3DLKA 4XIUA 3LALA 3IG1A 3BSNA 4CERA 1RYRA 1JKHB 4F3TA 4LD0A 2JEIA 1C1AA 3DM2B 4WZMA 4C8KA 4FLVA 3CIZA 3V1OA 4NCGB 4ZPCA 4M3TA 3PHEA 4O55A 4ED7A 4WYLA 4PY5A 3KLEB 3O4QA 3ZSXA 1RT1B 4HHTA 5C24B 4URSA 3I0RB 2KZMA 3P1GA 5EDWA 3WNGA 4LH5A 4K8ZA 3RRGA 1C6VA 4NCAA 3PVXA 2YNGA 3OYHA 3IGNA 3PW0A 2R2UA 5HRRA 5HLFB 2Y1IA 1JLFA 1C1BB 1RA6A 3CG7A 2YNHB 5KG0A 4CEOA 3H98A 3AA3A 5KFRA 4IH5A 1UWBA 2B43A 1XR7A 3EPIA 2VWKA 4J2DA 4R8UA 3NAEA 4CEFA 3N6LA 3MEGA 5I3UA 3KKSA 1J5OA 3L2WA 3G6VA 1SL0A 2UUTA 4ECSA 3E01B 3LAMA 4DU3A 1QSSA 1S1XA 4ECRA 3DLRA 4OL8A 5KGWA 2FVQA 4N47A 2F96A 1YVUA 3KK2B 4LSNB 2UVWA 1T8EA 4WE1B 3U3GA 1WSHA 4PA1A 3ZT4A 2FBXA 4DSFA 4NLWA 3VQSA 4FZZA 4KTQA 4AHSA 1YTUA 5CZ2A 2AGQA 3KHRA 3SPYA 2YNFA 1KLMA 3D28A 5KFAA 1U04A 2C22A 3OY9A 1VSLA 2O5DA 3C95A 4W5RA 4ED1A 3E51A 5HROB 2HHTA 5KFVA 2RPIA 1RAJA 1NK6A 2A1SA 4QWBA 3DI6A 4CFDA 1ZBIA 4J2AA 4RW6A 4CGDA 4AHVA 3OL7A 4GC6A 1WSJA 2R8GA 2IJFA 2OPQA 3CWJA 3BQ1A 3GV7B 3DOKB 4NYNA 3THVA 2W9CB 2EX3A 4CJFA 4R5PA 4YP3A 1VSJA 3I0RA 2R8IA 2FLPA 3MECB 5J2NA 1F21A 1LWEB 2IA6A 5KG1A 4MIBA 1BQMB 1HYSB 3HL8A 4JRQA 4CJPA 3RB3A 3HJFA 1RA7A 1DTQB 3F73A 1HNIA 3CJ5A 1K1SA 3EY1A 3V4IB 4GVMA 1RDAA 2BQUA 2V9WA 5DG8A 3U6FA 4B3OA 3VQPA 1S6QA 2OPRA 1RTHA 4HCBA 4M3XA 3MTKA 2VG5A 3RR8A 1RYSA 1S10A 2X74A 4DEZA 3T1AA 4MK9A 4FM0A 3KNAA 5HP1B 2ZD1A 4I2PA 3TARA 3G6XA 1Q8IA 4H4MA 4CFBA 1NJXA 3UQSA 3KMSA 3KOAA 2GUIA 3L8BA 3KLIA 4B9LA 3DLHA 3NBPA 4Q0BA 4IG0A 1JL2A 4QW9A 4DG1B 3NGDA 4KHYA 4DFKA 3CQ8A 3H4DA 2WONB 1S1WB 2ETJA 2W42A 3AVJA 2OH2A 3K58A 3GQCA 3OSPA 5JS1A 2HNZB 5J2PA 3KD5E 4F4WA 4FJ5A 2YKMB 2PYLA 3O3GA 3KK3A 2BRLA 1BI4A 3EYZA 3VQEA 3UPFA 1WSEA 1HQUA 1IKVA 4KB1A 4CJTA 1S48A 3NH2A 4MFBB 1VRUA 3OHAA 4BE0A 3G10A 4ED6A 3LAKA 4Z4IA 4ID5A 4F2RA 4K4UA 3GIJA 4O4RA 4WE1A 1BQMA 1HYSA 4ECQA 3I0SA 3KHLA 5L1IA 4ECTA 1X1PA 1DTQA 4KO0A 2QKKA 3GIMA 3RB0A 4TY8B 3QEXA 1RT1A 4CF2A 4I7FA 2D41A 3EPGA 2DPJA 2X6SA 4CESA 4ZVEA 4BE1A 4EBCA 2BR0A 5DG7A 3K57A 5SZTA 3MR2A 5CY4A 3VA3A 1J54A 1QS4A 2IS3A 5KGXA 4KTZA 5HP1A 4CCHA 1JLQA 3CDUA 3BDPA 3AO4A 1XI1A 2HHXA 1LW0A 3C6TA 4PWDA 3M8PA 4URQU 4EO8A 3H40A 4DTPA 1QAJA 4R5PB 2FJXA 3AVIA 3C6UB 4ZTFA 1DTTA 1JXEA 3LPTA 1JLEB 2AU0A 3NKYA 3MECA 5J2NB 3Q8QB 3ZSWA 4O4GA 4TLRA 1J9AA 4CJKA 3QEIA 1JLCA 1S1VA 4E7KA 2P5OA 4BDPA 4ZP6A 1ASVA 4CF8A 2XI3A 1QE1A 1WSFA 1KVBA 4J9SA 1WSGA 4XPEA 2XGPA 1QSYA 1ZBLA 1RTJA 3OLBA 5DG9A 1KVAA 3KLFB 2E6MA 1XC9A 3AO5A 3NGYA 3AVKA 4EYHB 3O3FA 4KV8B 2I5JB 1RDRA 3SQ0A 3F9KA 3L3VA 2Y1JA 3AO3A 3EZ5A 4DFJA 3QO9A 4DTOA 2KFNA 1TKZB 3VQ9A 2R8HA 1FK9A 4NLGA 4GC7A 3FRZA 2OPQB 1U47A 1UA1A 4KRFA 3K2PA 3LDSA 3NAHA 4KO0B 3M9NB 4FJGA 3KKRA 3TAQA 3IN5A 1K6YA 1VK0A 3NL0A 2EC0A 3SQ2A 1N5YA 4CEZA 4NLQA 4CF9A 4E7LA 1JKHA 3QESA 3IRXB 3HVTA 3HVRA 2IBKA 5KG6A 3I5BA 3KK3B 4KTWA 2BGGA 3QETA 2PZSA 4NYFA 4FLWA 3HKWA 3OYFA 1FKOB 4F4YA 4DSEA 4IFVB 1T05A 3QIDA 4YNQA 3ZSOA 3T3FA 4RNMA 4IRKA 4FJJA 4HYKA 3DYAB 4CJ5A 3KLGB 5KFPA 4K4VA 3LWMA 4TY9A 5KG4A 2R8JA 2YNGB 4DSJA 3ISNC 1CXUA 3IS9A 4CHNA 1A5VA 4DG1A 4CJ4A 5KFHA 4E7JA 5F8GA 4CHQA 2GIQA 1I39A 3IAYA 3H4BA 4DS4A 4KB7A 4KHMA
chains in the Genus database with same CATH superfamily
1Q8LA 4OI3A 2CH5A 2RHQB 1S6PB 3BJYA 3GIIA 4ZVOB 3OW2R 3J7AP 1RKIA 4RO0A 1TKXA 1EB0A 1WWHA 2BKNA 2FC0A 3LWLA 1VSEA 4RNOA 3ATUA 2YH1A 1WACA 4URGA 1Y64A 3VGLA 1ZETA 1N88A 2FY8A 1H7XA 4TKTA 4FBUA 3CJ2A 7AT1B 2HVZA 2RS8A 2BE2B 2HNDA 2D0BA 4IZ9A 4B3SJ 1MA9B 2FQQB 1RE1B 2GMJA 2GEMA 4AHCA 5T7BA 1HNZK 1WC6A 4OX7A 3FSIA 3TWHA 1FRHA 1D8YA 4A2BA 4CM2A 4JI1F 1KQKA 5L9XA 5K8MA 3AO1A 2HVDA 4A8QA 3QEVA 5GAGP 1NU4A 2HZVA 3DLKB 1ZTWA 2IAJA 3M32B 2NUHA 2JZ5A 2QYCA 1T05B 3FFIA 4I56A 2ZH9A 5B0EA 2RU3A 4JI0F 2E5LJ 5A6PA 3MM5A 3EUNA 4DV7K 1VQKN 1G7CB 1RBLA 3FEZA 4NZ6A 2R7TA 1WHVA 1H0HB 2UXCK 2GC8A 4CD1A 1HPZA 4LFBF 2RSQA 3G82A 4FK4A 3GG0A 2VG6A 3VQQA 4DV3K 4PKIA 5DDPC 3R6GB 4I6AA 4FW2A 1REVB 4J8FA 5CQGA 3MPUB 4ED3A 3EGNA 1FERA 2HBJA 4CIFA 4WBFA 1HNXJ 4JI8J 2EHGA 1NJWA 5DQIA 4FZXC 1VSHA 4ZA1A 4AYBD 4DUYJ 1SC1B 2P9IA 3QAUA 4B3MK 2HURA 3VF4A 2E7VA 3I5AA 4KV8A 3CJQA 5EUHA 3DAWA 3QIOA 1GLAG 3HHKA 3O4NA 1UZDA 2A6OA 2CPEA 3M5RA 2N4DA 4RJVA 3SQ4A 3JSMA 4H0TB 2DRAA 5CCMA 1YRXA 5L8RC 2FVRA 1F6TA 5IC6B 4CO2A 2GHPA 3CCES 2HHWA 2JC0A 3HYFA 5LSLA 1TUWA 2IBOA 2I1RA 2UXDF 2YHYA 1F9HA 3ZT3A 3ZZZA 4XTTA 4OFZA 3M2UA 4J9MA 4FCYA 2XHCA 4BCAA 3P96A 2HMPA 4DL7A 4X62J 4CO3A 1DEJA 3CD7A 2W24A 4OYIA 2KYXA 4HUEA 1BUPA 2KFZA 5B09A 4C0HA 3SCXA 1VC6A 3HHLC 3H2UB 2DITA 3QYYA 5CYQB 4ZPDA 4I6MA 1EWRA 1JMTA 3CCJN 3R3TA 2MKIA 2XY5A 3MEDA 2Z1GA 3SQOP 3OFEA 5J2MB 2V2VA 1H7WA 2WOMA 3QPIA 2AD9A 2E9RX 4KGXB 2GFFA 1UL3A 1A9NB 3TAFA 2L41A 3QNWB 3IR6B 3BF1A 5LXRA 1HYZA 1FX4A 3ZEUA 5LJWA 1VC0A 4ZVFA 3MM7B 1YSJA 5D6GA 3C19A 3RMBA 4FF3A 2FBTA 2XY8A 1HMVB 1OQ6A 1K9MT 1FJCA 5E3CA 1KQGB 2XI2A 1GEHA 3GCXP 2A5XA 3T6BA 3E2EA 1RQ0A 3R6MA 3SV3A 2KTQA 3RAXA 2VA3A 1WTBA 2MGZA 2ZC4A 4JD2A 4N56A 4K7QA 2FC9A 1FE4A 2HYIB 2D0AA 3L6QA 3RJMB 2QEXN 1FJGF 1DLOA 3WC0A 4JBCA 4PXDA 2PY5A 2GX8A 1WF0A 4RG8A 5CYJA 2PMZD 1HQEA 5BRFA 3C7NB 1Q0NA 1YVFA 3J7ZT 1YLXA 1YRUA 2YHAA 3NWGA 1B99A 2LXIA 4OZLA 2OZSA 4OHVA 2HAIA 1J53A 2VBYA 2V7ZA 1S1UB 4NXNF 1EZZB 2JLEA 3VF2A 1FKPB 4I7FB 3R5BA 4LF4F 4BE2A 4QOTA 2WAQD 3PEJA 1U1NA 1NAQA 1W9HA 1IKYB 5J1EB 2OMOA 2ZFHA 1JNRB 3OYNA 4OZNA 4KHUA 3R6LB 7FDRA 2X1GA 3KK2A 1BE4A 1HLWA 2VGNA 2DFFA 2B9EA 1V5VA 3K9KA 3GTYX 1TGOA 1S1TA 2OPPA 4B3OB 1FA0A 2NZCA 4YR0A 1YJWS 2YHXA 2QO3A 3RSEA 3L7PA 1RTIB 4B9NA 1FHTA 3RGIA 2WB1D 3GV8B 2JH3A 1C1BA 4M94A 4YN3B 2PGCA 1VBKA 4NYOA 3OV7A 5I3UB 4LSLA 1HARA 3ZX3A 1LNQA 1LOTB 3DNCA 4MK8A 1ZM3A 2F63A 4EHUA 3BYRA 3OTEA 4WPAA 2E2NA 4ZKAA 1N32J 4DV0F 1V4TA 4RW4B 1V4SA 3DLEA 1NH8A 4ZPAA 3B4MA 2ZJPQ 4JI4K 1ZBFA 1K1QA 4B3MF 3L2QA 3D2EB 2V4JA 1KFSA 4NXMJ 3W5YA 3IAM9 1LKZA 4M3YA 1X9SA 4K4XA 4Y34A 2AZ1A 3ISND 1DQAA 1S77D 1BC6A 4OHXA 1T3OA 2D9PA 4GVBA 5E7OB 4M3RA 2MSTA 4H03B 5IT4A 1DGKN 2QIFA 4Y28C 3P45B 5M1KA 2OTLS 2GELA 4JI3J 2FLLA 2ZUAA 2XG8A 3CSKA 4ZOSA 4IFYB 5AE2A 1TL7A 2Z4PA 3ZSQA 1W2BM 1RT4A 4DZDA 2IVPA 2YKNB 3EE8A 2HNZA 1VQ6N 4HACB 3HPHA 3D0IE 4H5NA 3VWSA 3MXJA 4O3SA 1S0OA 3HO1A 1H2UX 4USJC 2RRBA 4ZP8A 1OO0B 2W4PA 1MU2A 2VF3A 3MMJA 4CT8A 4CZLA 4M63A 2X78A 2GVDA 4OHZA 2YX1A 5KPTA 2RILA 5KFCA 4ILLA 2IVOA 5IOLA 3SXLA 3S8SA 1ZA2B 4F3OA 5F0XA 5FPDA 5F9LA 4IG0B 1G4CA 4YQWA 4H0PA 2DR5A 3V1RA 4CDIA 2H3GX 3PUFA 2UU9J 3I0SB 4CK3A 5KFIA 2G2ZA 2FJAB 1MROA 5DDOC 4Z4FA 2Y3YA 3QBWA 4HVJA 1HBOB 5ADXA 2B6AA 4J2EA 4PYAA 3UO0A 1YHQN 1SKUB 4RUAA 2UP1A 2FF3B 1WOPA 3ET6B 3UE2A 4OPKA 1C1CA 2DBBA 2V63A 4WWSA 1ITGA 1E6YA 4B3SF 5AQZA 3RMAA 5CXTA 3ULEB 2DY4A 4CP5A 1VLOA 3GYGA 2ASOA 4AL7A 1G2EA 2V4QA 2GBZA 1JLEA 4AQYF 3KVGA 2VQEF 3GJTB 4EHTA 2Z56B 2DNMA 5HLFA 2PFFB 1LAWA 4IQXA 4JKHA 1RAOA 2CRLA 2DJWA 2BBEA 4Y2AA 2P2CB 2B4PA 2A1RA 1T7PA 2HHPA 3CDWA 2HBKA 3UKUB 4DS5A 4H0OA 2F9JA 1SS6A 2O8EB 3MHYA 5B8HA 3CCSS 3L95X 1EP4A 3B6BA 3BBFA 4JYAF 5DM6Q 1SQGA 3PX6A 2D1KA 2CPYA 4X4RA 3FRYA 4OLBA 9ATCB 3QGIA 2KHOA 4AF1A 4FJXA 5DLGA 3A4TA 4JI1J 4CLLA 3HHDA 1KD1T 4FYXB 1BL3A 5A2QY 1N36K 4BR0A 4EFAC 2F9WA 3TQ1A 1SIZA 2QFJA 5CYMA 3MUTP 4YOEA 4YHHF 4LQ3A 3BV8A 3TNVA 1HW8A 3HFKA 1U0SA 3NCRA 3VTIA 4H4OA 5GAHU 3Q2SC 3OL6A 3GPAA 3PX0A 3C2PA 4RZRA 1BOTO 3WEEA 4BG9A 3THYB 4RW8B 4EGLA 3ZFVA 4HI1A 2BMBA 2VOPA 2ITGA 2W2OP 2MQ8A 4L72B 3KNGA 2W4CA 2ZGZA 4ES2A 1I1GA 4QS9A 2FIUA 2HFNA 3H5XA 2PFUA 3D0GE 1XERA 3GR1A 5JVGL 3SSRA 4FM1A 4WFNL 1HWJA 2XEXA 3Q83A 4ECWA 1GOCA 4MLHA 1S9FA 1EJ7L 3UB5A 1AT1B 1GT8A 1NH7A 1UJ6A 1C0UA 4W5QA 4LIWA 4ELVA 1W25A 2YX6A 1B0VA 4Q0BB 2JEJA 4C48A 2L9WA 4KGZB 3UW1A 3LF0A 3DDNA 1WG4A 3D2FB 4FM2A 3AXMA 1BCMA 2P51A 5HBMB 1WDDA 2YXLA 4CHOA 5BN9A 2QWOA 5AXNA 5HJXA 4OHYA 3EVWA 1OMSA 1BISA 3ZETA 3GFHA 3CC4N 2DO4A 1WOSA 1XNRF 4LIRA 2GWKA 1U8SA 1GFWB 1N33F 4FS1A 2XMJA 5J2QA 3RG6A 4DV7F 1T95A 2CIMA 4ZITA 4BY9C 5DQGA 1CZAN 1TKXB 1CQMA 4W90B 2X7IA 5H1SQ 1RT3B 2L9NA 4LSZB 2CQDA 1N8RT 5I3QA 4BR7A 1NJIO 1GXTA 3S3OA 2HBMA 1DQ8A 2I8EA 5FLXO 1XNQF 3WXKA 2KM8B 2QL5B 5F0WA 1RI7A 5ETKA 1R0AA 4M5KA 1TR0A 2OANA 2G1HA 2BJEA 3CD0A 1X4GA 4CJLA 1A7GE 1MMDA 3UWTA 1L3SA 3BO4A 5C15A 3MMCB 2J8AA 2J0XA 2G0CA 1YWXA 3PW5A 5EU7A 2DT9A 4KGKA 4F04B 5A76A 2MZTA 2BOAA 4JK9A 3UDLA 2ROPA 3VQ8A 3TUPA 1XTZA 2MXYA 4CIGA 2QZ8A 4J9RA 2W1BA 1YTYA 4JV5K 4DBQA 4DV1J 4ED2A 5MLCV 3SJJA 3TAMA 3IP0A 1HWUA 2VBWA 3L9ZA 1M5VC 3OQ2A 3PR4A 1WEZA 2O8FA 1NHUA 4IOBA 3GLJA 3ENOA 1SKRA 2MKJA 2IJRA 2LU2A 5A2QO 2QLXA 3FMBA 2P9GA 1H1VA 1WKKA 4ZHRA 4C8OA 4X4OA 3P83D 4NASA 5EXWA 2VA2A 1RGVA 4HH0A 1T94A 4CZCA 5HRNA 1VAZA 1LK7A 2BJ8A 4F67A 3UE5A 1NGIA 1PJ7A 3G71N 3V9WA 1QHAA 5AQWA 3ENVA 1KVJA 3D2WA 4NLUA 4CEDA 4OGCA 3DRSA 1N36F 4DL3A 2WBNA 4MDBA 1YJ9S 2ZKUA 3WQPA 2RKIA 3JYTA 1C0GA 4KE5A 4Y65A 3MXMA 3PIOL 4CZFA 2AYEA 4WFBQ 1IBKF 1YAGA 3TPQA 1JJCB 5L1LA 3IWNC 5I42B 2AIRB 3SBTA 3CEDA 4RW9B 3V6DB 4I69A 1S5ZA 2F3JA 3AA4A 3FKBA 2IYGA 2EI5A 1LW2A 3MAQA 4C3LA 4DPYA 3AVFA 2O8CA 2J7KA 2ZH1A 1UOCA 1RAHB 2I5JA 4YDUA 2XYPB 5EWFA 4IFVA 4Z0UA 5JVHL 4LFCK 3QJPA 3DU5A 3CGIA 3I8BA 3FVYA 1O51A 2Y8WA 3VETA 4ZCIA 2L9DA 1OH7A 1ZPWX 4QIEA 3RB6A 3H8YA 3CJ0A 5L38A 4A8OA 2QWQA 1SJQA 5DETA 1WI8A 1EXQA 5K5MA 3JAMU 2AJ1A 3X3UA 1JCFA 2W2NP 5BYQA 3LDNA 5FDLA 4O8UA 4ANEA 2W2MP 4LVOP 4DLGA 1WNEA 2RS2A 4CQ1A 2AYBA 1X4FA 1DHMA 3KJVA 1VIXA 1HNZJ 3KG4A 3CCVS 3FFKB 3DLGB 1IKWA 1IVZA 2OPPB 1RADB 4PUOB 2ZH4A 4JKFA 3PDNA 5D4NA 3BQ2A 2QT7A 2QK9A 4ZCKA 4WTOB 4USUA 3WNEA 3LP3A 1VK8A 4H4KA 2Z58B 2DIUA 2VASA 3A8JA 4ZVGA 5ETSA 1NM2A 3MCAB 4U8YA 2HHVA 5BR9A 1F3VA 3FLCO 2KO1A 2YNFB 5A0YA 3MOZA 2UUAJ 4B9VA 4PKGA 2YKAA 4BACA 5DQHA 2A2DA 2XY6A 4DR5F 3Q8YA 2XCPA 1RT7A 4ELUA 2A40A 1CPZA 1S9GA 2KJWA 2P6SA 3T5LA 3NHGA 3MPDA 3C15A 2XS7A 5C42A 3N79A 4Z4GA 2R7YA 5KI6A 1H3DA 4FYDA 3SK3A 4H8KA 3N4PA 2HVEA 4BR9A 3HDSA 1N6QB 3LPEA 3OVAA 2W7OA 3T5KA 4J37A 3CO9A 4HL9A 3SDEA 3QT5A 4LF9J 2DHXA 4TYAA 1KKHA 2D3UA 3IFEA 3WXIA 4MKAA 2POKA 5IM0B 3CIMA 1VR6A 4FOIA 2J7UA 4BQZA 2DB1A 1D0EA 5KFBA 4HACA 2W8KA 3MTJA 4NL5A 4KFBA 3CJ7A 3CM5A 3OUYB 3F56A 4DU7A 1LFPA 1QLNA 3SMPA 4RWWA 1U1MA 4B3TK 2OP5A 5EGYA 3GILA 1WC3A 1RBTA 2EFNA 3NH1A 2BJDA 4RR5A 3HSJA 3CW2C 4FXVA 2JGUA 2AJQA 1H2VZ 2RN2A 4QIVA 3EGWB 4M5GA 5AQGA 4F7VA 3GU0A 4CIOA 1GLFO 4HTLA 4LF7K 2BE7D 4CBXA 2BANB 2LA6A 4PQUA 4BC9A 3TR8A 4DL4A 2R4FA 3VERA 2B6AB 2QLBB 1FFSB 1IG8A 5LSOA 3DLEB 1S22A 1LCUA 1J5EF 1UVMA 2UUAF 4DL2A 4LBIA 2D5RA 3DOKA 1BIUA 1SJFA 3LGHA 2I6WA 2FGOA 4GY2B 4I9LA 2P9EA 3CJBA 1CJKB 5F8IA 4ZVSB 3KLVA 4FF4A 5GAGU 2HGMA 4NLBA 4GO5X 1RCXB 3A8KA 1TL1B 3FBFA 5F0UA 3LPUA 3BEGB 2ZHOA 2YQ0A 1DFDA 4D3GA 5LXYA 3LP2B 2ASYA 3C65A 2HSTA 3A12A 4FP9A 3ICLA 3CCUS 3CC7S 1VQLN 4WYWA 2UXBJ 3I55N 2VL1A 4DUZF 2DNPA 4OPJA 4TU9A 1TL3A 1M5SA 3SAFA 1NGBA 1FFGB 1SUQA 3OYBA 4H4MB 3SBGA 5K8OA 1N48A 3NFAA 3M9OB 2DIVA 1CLQA 1J27A 2CQ1A 1QTMA 4U95A 4ITSA 4ES1A 2D3OR 4BR5A 3ZTOA 3KDNA 5KRSA 3DRXA 3JB9k 2HHUA 1Q1KA 4M5DA 3PW4A 5CYMB 1WG1A 2XO7A 1TKZA 2KFYA 3P31A 4MLEA 1OH8A 1HKCA 4LH4A 3POTB 4DV5K 4G1QA 3CCMN 4H4OB 4BR2A 4ZVRB 4FZVA 3OTDA 3DLKA 1ZZNA 2E5IA 3M32A 3PYDA 1PBAA 1HA1A 2DHSA 1CULA 1HPMA 1WC4A 1UMJA 2PMHA 4WZMA 4FLVA 2BM0A 4WFBL 3V1OA 5HMXA 4M3TA 2D0PA 3GG4A 3DGPA 4O55A 3V5RA 4IO9Q 4PY5A 3KLEB 3ZSXA 5C24B 1F60B 3I0RB 1QAYA 4K8ZA 3TSPA 1PAEX 3RRGA 3OBIA 3PVXA 1SQKA 3GSDA 3OYHA 2LFVA 2Z2YB 3UKRB 2W6LA 5HLFB 3HF5A 1PILA 2E1ZA 3NGTA 2B4OA 1RA6A 1U26A 1NLKL 2B43A 1O13A 1B7FA 4DV0K 3DCAA 3L2WA 4P73A 1XK8A 3E01B 3LAMA 2DNZA 2VV5A 5IQ6A 4M5LA 4AT1B 2F96A 2CPDA 4LSNB 1ELOA 3MN9A 3U3GA 1WSHA 3IBWA 4K0KK 2FBXA 1IUJA 3CJKA 4FZZA 5M1FA 3IKMA 1YBUA 1YTUA 4X65F 4C9DA 5D0HA 3KHRA 4JK7A 1RAEB 4CNYA 1RABB 3SIPB 2EXUA 3W9HA 3CCWA 4W5RA 5HROB 2GO8A 2CNOB 1TZ0A 2RPIA 1RAJA 3DI6A 3G87A 1YXQA 3VAKA 4CGDA 2UUAK 1GQEA 3HSZA 4GC6A 2R8GA 2IJFA 4F4AA 5M1OA 3BQ1A 3GV7B 1U6BA 2BW7A 3DKDA 1RAIB 2DGUA 3HFZB 4CJFA 2A6MA 2FLPA 4DPTA 1AZSA 5J2NA 2QWRA 1DKGD 1LWEB 3CMAN 1BQMB 1HYSB 1XMBA 3MPWA 5T7LB 2KHCA 1O5JA 2E7WA 3HJFA 1E4FT 2VKZG 3G82B 2DNOA 1D3WA 2QA4S 2WUSA 4GVMA 3VPZA 3U6FA 3KWMA 1XUPO 1BMQB 1M90O 3ZZPA 4HCBA 2VC0A 3RR8A 2VICA 1PYTA 2K06A 4DEZA 3TW0A 4FM0A 3O8WA 3KNAA 4I2PA 4WIQA 3AQOA 3TSQA 4LF5J 1Q8IA 2E1MC 2B56A 3ETOA 3DLHA 4DOZA 4JI2F 4Q0BA 3GONA 1JL2A 5DM6L 3AA8A 4OYPA 4B1YB 3NGDA 1Q53A 2FC8A 2WONB 1TTHB 1S72S 1S1WB 3PACA 4F26A 2DH8A 4BRFA 3HX9A 1CJUA 5JS1A 5J2PA 1N32F 3NNAA 3FR0A 3LDLA 2O8DA 1NO8A 1FI4A 3O3GA 1VQNS 2BRLA 3EYZA 3GCWP 5G0RB 2X1FA 1HQUA 1S48A 1VRUA 3OHAA 4BE0A 4UF4A 3DLJA 3O08A 2W7AA 2DNNA 3W9JA 4LT6A 5BXIA 5K9FA 5K8NA 3WHIA 1N34K 4O4RA 4M5JA 4C1NI 4WE1A 4DB3A 1T0TV 1TL5A 4MJKA 3HSCA 4ECQA 3CC2S 1GLEG 3FZHA 2QKKA 3RB0A 3KJNB 2KLAA 1JB0C 2CYYA 4I7FA 5LMNF 4FN5A 3EE9A 4XH4A 4IOAL 4U7UK 5SZTA 3MR2A 1J54A 1QS4A 1NSPA 2MZJA 3CDUA 1VLYA 2KVIA 3MEKA 1N34F 1Z1ZA 4Y2IA 3AVIA 2IDEA 5L46A 3G25A 4QR1A 2QMWA 2DNKA 2AU0A 4JKDA 1GXLA 1KOOA 1BY9A 1JLCA 4ZP6A 2CQIA 4CF8A 2XI3A 2H9ZA 2OAUA 2XO6A 3DXMB 3OFFA 3TX0A 4RLEA 4PPDA 3QFHA 4JI2K 3NS6A 4CLPA 3TUIC 4DR6K 4QYZJ 1M5HA 2LXUA 4USMA 1KVAA 1YG0A 1U7LA 2DGWA 1XC9A 2COLA 1RDRA 4ANDA 3FC9A 3L3VA 2R7RA 4OX8A 3AO3A 2MDAA 3EZ5A 4JI0J 1RK8A 2MGZB 1YJTA 3SQGB 3QO9A 4JD2B 2KFNA 3NMUA 3FRZA 1WHWA 2B7CB 4KRFA 3NAHA 4X66J 3BF3A 1AUDA 4KO0B 3KKRA 3CCVN 3VEYA 1XMOK 5A0YB 3SQ2A 3A8IA 3D2EA 4NPOA 4DR2K 5DJBA 3C16B 4FPAA 3QESA 4DV5F 2NRRA 5KG6A 3I5BA 2ZM6F 1P90A 1R0BG 3KK3B 4WFAL 3MX5A 1U2RA 3VAGA 4NYFA 4BC3A 3EICA 1F5AA 4FLWA 2V6AA 3G8SA 2KB2A 2BOPA 3M3ZA 4IFVB 4I4BA 4FJJA 1RWOB 2LDYA 3DYAB 4CJ5A 2EFGA 2LDIA 2HS4A 1BXNA 4HEA9 1HNWK 3KZBA 2MJUA 4A8SA 3UNGC 4DSJA 3ISNC 1ROFA 2EFQA 1CXUA 3GR0A 2PFDA 3VMFB 3QICA 2RMLA 3GYXB 3MMVA 3TO8A 2LVWA 2QFIA 2YQ1A 5C2FA 4M7XA 1I39A 3CF5L 5BR8F 4KHMA 1M5PC 3EO3A 4IBNA 3MDFA 1M1KT 2CH6A 5CZVA 4WKRA 2LECA 3OSNA 2FZCB 4E3SA 4DV0J 1CZBA 3SPZA 1I6JA 4GVLA 1KP6A 4CLFA 2V9KA 4JKAA 3AGRA 4UOCA 2HHSA 3AVLA 4A5AA 1U49A 1FO1A 5CZ1A 3OYDA 2EG1A 3OYAA 3WIUA 3JXOA 1HHSA 3HLUA 2YWEA 3N01A 4MIWA 4J9KA 4HUFA 1OQ3A 5H9EK 4FWNA 3KXDA 5KT6A 2PO4A 1EKEA 1HFEL 2G13A 1UVLA 5IT9Y 2E4LA 4I6MB 4TY8A 4UTGA 2OELA 3HJVA 4CJSA 3QT7A 2ZQBA 3EJMA 4F2SA 4DR1K 1VBYA 5IC4B 2FXUA 1VSKA 5CA5A 5C25A 2RQKA 2H65B 1FK9B 5FLXY 4CBWA 4EK2A 4EEYA 4WFXA 3Q24A 3NH0A 3V4IA 1RBSA 3D7SB 3US5A 2E8AA 4KT0C 4CTAA 1NSQA 2C28A 1FXLA 3D6FB 1L3TA 4OI2A 3VQ4A 2NLWA 3IAS9 1RSCA 3CF5Q 5HQ8A 2XTJP 2ACYA 5HSPA 2KRBA 2KXFA 2D7SA 4O3QA 2VQFJ 3PHTA 4CJWA 3C66A 4FK2A 1UWBB 1G3OA 1OWXA 1EETA 2HZCA 3KLFA 2P9KB 3W64A 1YT3A 2Z1JA 2GVDB 3AVAA 4B8CA 3GE1A 4TXSA 4C8MA 1VQ6S 4OHWA 2RT3A 3I56S 2BX6A 1UCNA 2PYJA 1VFJA 2GX9A 2BDPA 1TV6B 5K8PA 2HMIA 3RAQA 2V94A 1YIJS 1KOHA 3ISZA 3OTCA 4PCQA 1CEZA 3MEEA 2MYFA 3DGVA 4RU9A 5LL6d 1ITPA 1RAAB 1HD0A 5KT5A 4DR4F 4HHJA 3SAHA 2C2KB 4Y0WA 5DZ7A 4RW8A 3IO1A 5J1EA 5KG2A 4WFZA 2AQ4A 1IBMF 4Q44A 1RT2A 4UQGA 4QIFA 2G8FA 3CT9A 4KBOA 1FRMA 3WX8A 2F8EX 1HL6A 5D0GA 4O0NA 3RBDA 2PEBA 3AVNA 3VEWA 1VI7A 1DURA 4FLYA 3I31A 1VBXA 4DX8H 1XNRJ 1ESVA 4E1JA 1Y3JA 3AVMA 3I8DA 1VJWA 5FD1A 3RSEB 2M88A 2WW8A 2JJ4D 5L9NA 1RTIA 3T1HF 1CULB 2KKZA 1LEOA 5HQLA 2ZH2A 1JLQB 2NXJA 1D9DA 2KH9A 4QOZB 4PKHA 4DCPB 2H5EA 4K8XA 3R9PA 5B0BA 1RT6B 2DYAA 2Z1IA 4M5HA 4F02A 2ROEA 1QQOA 4DN9A 3NLCA 5KFWA 4MQ3A 3D2FA 2NRZA 2BXJA 4MTPA 5HBMA 4AXJA 4OZ2A 5F8LA 4A8KA 4WIIA 5CCLA 2XLJA 2UXDJ 1YQHA 1TL1A 4XH1A 3ZETB 4Z4HA 4LFAK 1NGFA 4CGHA 3SUQA 1TMMA 1KTVA 1FXDA 4DR1J 4RUBA 1AFIA 3MDQA 4BR4A 4FWMA 2WC9A 4HUGA 4OZ5A 2ZC3A 2OEJA 1Q86T 1S0VA 4AL5A 3AAPA 3CM6A 4JI4J 4CWBA 1R6VA 3QQCD 4QWEA 4LSNA 3BQ0A 1FTCA 1BI4B 4E1MA 1X4EA 5K14A 3D6TB 4XDDA 1TUUA 2JDJA 4NCGA 4RW7B 3W1YC 2HWHA 1Q82T 4H5WA 4CLWA 3TP2A 1I5OB 3K5PA 2ZOMA 4RUCA 4CJEA 3EM1A 4WQ4C 3KFWX 5KFZA 2R8KA 3POTA 5JXSA 5DK5A 5H1SV 1V3SA 1V3RA 4QS8A 1T9TA 5E33A 4CIEA 4KC5A 1Z26A 4JI6K 3S1TA 4W4MA 5F8NA 2Z57B 5T7LA 4KHPK 2Q6BA 2ZVIA 4N76A 2KT3A 1Q18A 3JS6A 4QWDA 1KAYA 5L39A 4DV6K 2CQBA 1QQNA 4HKQA 1L3VA 3ZYYX 1H74A 3JSRA 4K4TA 2N7YA 1X60A 1UW9A 4FYVB 3ZTQA 5KFSA 3VALA 5BPNA 4OI0A 3LZIA 4DSKA 4PG5A 3UCGA 4DF8A 1HNXF 3B8HA 1R27B 1ZM9A 2DGSA 1QVFM 3G2XA 2NR0A 3T1YF 1FEEA 3TX8A 2ZBRA 4DKWA 2BACA 4BS2A 1XBWA 2IM1A 3ILJA 4CJQA 1EKRA 4BRPA 3AARA 2RKIB 3JYTB 3MCOA 4ANCA 5F2RA 3IWLA 5HO4A 2OPSB 2LMIA 3FEYB 1P1TA 3FDSA 4O0IA 4CHPA 2ASDA 1R0AB 1FNOA 4MO4A 4CGFA 1LWFB 1KXPA 2IDOA 3H59A 2HS3A 1YJWN 4E0DA 3CJCA 4FPIA 3J7YP 4GKKF 2QTWA 5A2QU 5A8KA 2P9LA 2UUCK 1RCHA 3M6WA 3QSIA 1JL1A 1SV5A 3L4IA 5GIOA 4ZJQA 4W5OA 4USWA 5JICA 5EHHA 3UN3A 2C2OB 2CDRB 4YS2A 2IC3B 5GMEA 2GVZA 3ULDA 3AD9C 4N5SA 3I56N 4CE9A 4LF1A 1RU2A 2F65A 1YK9A 4F4KA 1CJTA 2Q0RA 1SKSA 4DN0A 2CZVC 5HOOA 3OYMA 2OEKA 4DV6F 3MAAA 2Q43A 1CC8A 2IOCA 4OYZA 3ZNUA 3BY5A 1BIZA 4JI8K 3DLGA 3U1MA 1Q5VA 1IKWB 4RKUC 3D1QA 2FJDB 2HQCA 2D0OA 1UFLA 2E6LA 2B9YA 2KZZA 3WEEB 3THYA 5LMUF 5A8RA 4DUYK 3QJLA 1XIQA 3NNCA 3KHHA 4TYBA 3P4IA 1FWKA 4DTUA 3HM8A 3IRWP 4NA2A 1NDPA 2HFVA 4L74A 2IGIA 2XSJA 5EWEA 4CLZA 4NCBA 2OTLN 2M0GB 1XR5A 4AQYK 4JRPA 4DTNA 3LP0A 1IG9A 3C6HA 4F36A 2AA4A 2C2EA 1VOMA 2MB0B 3RAMA 4QR0A 2ASJA 1CG2A 2W2QP 5BPMA 5BRDA 2JRSA 4OO1J 3PM9A 3QO9B 4KKOA 1HBMB 3EEQA 3K2YA 3HVWA 5G0RA 3G71S 1ATRA 4U67Q 1S9GB 1RWNB 3A8YA 2PC6A 4UZCA 2FJWA 3AVGA 4A57A 1IWGA 1G1XA 4CM0A 5JS2A 3LA0A 1YDLA 1HI8A 4NLOA 4X4TA 1S6UA 3BREA 2FYXA 4OYOA 2JVRA 3HD1A 4Q8FA 3BS9A 3D7EO 2BQ3A 1C0FA 1ZBUA 5KFNA 3UCUP 2LSNA 2J0QD 4BRLA 2DTUA 4AD6A 1BGXT 3SSQA 4X65K 3KJVB 2DFHA 3J80Y 4OZJA 4K42A 3VESA 3N28A 1MDUB 4I2QA 2XQCA 1I3AA 3HHLA 3MPVA 2UVUA 1FVQA 1HRHA 4ZVTB 4OJ1A 1U48A 4I6YA 1K8KA 4V19X 4NB4A 3K0JA 2LEPA 4AE5A 4JAXA 2MPUA 4A46A 4J9NA 4IXCA 4B3RJ 4NXNJ 2O4IA 3CJ1A 1IBLF 2RQCA 4QJVA 3M8RA 4Z7YA 1UTAA 3MCMA 4YEAA 5HANA 4K43A 3AY9A 4C23A 2M2BA 2QLFB 2K1RB 3M8QA 1F2HA 3Q8RB 3BGLA 2V8HA 5ETNA 4XK8C 5AQLA 1BWVA 4LMZA 2NXUA 1BDGA 1K73T 3BGFA 2BTFA 4DI6A 1TVRA 5E84A 1QHTA 1D4XA 2DNRA 5C2DA 2WVCA 3S3MA 4ZS6A 2O8FB 1U4BA 1QM9A 4X64F 4NLYA 3PIPL 4FZYA 3GIRA 3PJ9A 1KLMB 3MUVP 2UZAA 2V52B 4NO7A 4RL1A 3QDKA 2FB0A 3O5BA 1N6QA 2QWNA 3F2KA 1ZS6A 4TSXA 2YNHA 2AJFE 2JHEA 3PFEA 4QBUA 3OVSA 3AGKA 3LANA 3VV2B 4JI0K 3A5LC 1LV5A 2AYGA 1J5OB 4CTAB 3DYAA 3VQDA 4BG8A 4U96A 1TYQA 1XWLA 4WQ5A 1WSIA 4HCCA 4DUTA 4K5SA 2DGVA 5HMZA 1OY6A 3WNHA 1JLAA 1WNSA 4IDKB 4WQ5C 4DJBA 2A6AA 3RWUA 2GCFA 4JNEA 1VQON 2JOQA 5AQTA 4BWMA 4YDXA 5KFMA 2AF6A 4L3NA 1IN0A 3IXQA 4OX6A 3CMAS 1S7HA 2ZGYA 3M6XA 2W9BB 3RBXA 3QGHA 4U67L 2ILYA 4M5DB 4K4SA 2QA4N 4UOHA 2F7VA 1Z25A 2FLNA 3GBTA 2KG1A 2ZE2B 1S5JA 1N0VC 2FHJA 4F9OA 1PBUA 2IJNA 2H3EB 1Y5NB 1RTDB 4PQUB 4KI4A 3LZJA 4O3NA 3B6OA 4NA1A 4HDHA 3LW5C 1HI1A 1K47A 1FNMA 2G0JA 3NGSA 3VENA 5CE3A 4CFAA 3BSOA 4OX9F 3RMCA 2CKWA 3U8XA 3CC2N 1DZ5A 4FLXA 3NMAA 1N34J 1T03A 3OYCA 3TJAA 1S79A 5KFKA 2N7CA 2V8GA 2UUCF 1EX8A 1DTTB 3GFZA 4FLZA 4B3TF 1C0TB 2B8PA 4PG7A 4H0YB 4M42A 5C25B 2D3ZA 5JLHA 3BGRA 1ASUA 5THWA 5KG3A 1F5BA 5T14A 5GAGI 1R43A 4KAZA 2CAJA 2OCEA 4P75A 4JI6F 4PEOA 1Y9OA 2AJ4A 5L1JA 2DKOB 4E2FB 2RDIA 1NB7A 4A8XA 1N56A 3FBEA 2WHOA 1NNEA 2J9EA 1LAVA 1J5EK 1FWPA 2XMUA 3UCZP 2ZWPA 4HLBA 4RNHA 1RT7B 2Q3SA 1QQCA 2E7XA 4I67A 3VEOA 4YFUA 1X9MA 4KQZA 2VONA 3TUJC 4DSLA 2I38A 3EXCX 1J5EJ 3NS5A 3C15B 1VSMA 1TV6A 3BKUA 4PG4A 2ZOGA 4KI6A 4WK1A 3CCUN 4GV6A 2RHKA 1VBZA 5HROA 4DU4A 4G1QB 3U7JA 4JI5F 4PRFA 1C2PA 2J5AA 4NLCA 4UUXA 2FHKA 5GMKa 1GOBA 4RWXA 2QWPA 4BROA 2DPNA 1YBTA 5IM0A 3ZSZA 1FX2A 3A13A 3AVHA 3J7YU 2NUUG 3GJQB 3UFCX 1NHKL 2W40A 2J9DA 2G0IA 3Q0AA 2VPWB 5EX0A 4FJLA 3M8PB 3T69A 2AEFA 1RKJA 3QFPA 5FRMA 4Y2MA 3HP9A 4EBDA 2O8BA 3LOUA 4WTYA 2VWJA 1L3KA 5C24A 4K2JA 3CCMS 1BG3A 3BPDA 2DHAA 4X84A 1B92A 3HSTB 5DMRA 3MN7A 4AL6A 2EFPA 4L75A 2I0XA 3MPYA 3W65A 1GLJO 4YOUA 4EZ9A 3G4SS 2EWSA 5FIIA 2IIRA 3ZSVA 5HL7L 4FLTA 4DMNA 4O44B 1X5SA 3ENWA 3AB4B 3LUYA 2VQEK 2OTJS 4O23A 3E01A 5KFOA 1D5AA 2M52A 1ZXOA 1JWWA 1S1WA 1IR0A 5AZIB 3WXMB 4DDFA 3BBCA 6FD1A 5EWGA 1VQ7S 2A18A 3W2VA 2ADCA 3V81B 1ILYA 2NYIA 4CEQA 2AEJA 2B0GA 5D8HB 1IQZA 2EK6A 1N5QA 3P4UB 3UDEA 4C7QA 2D9OA 5KT2A 2MQNA 3PIOQ 5AQOA 3SSSA 1HQUB 1Q7YT 4X4VA 3I4HX 4OKEA 6AT1B 2VYPA 1YI2N 2YY3A 4TQRA 4LREA 2KJVA 4BC7A 4JI5K 1FDNA 2OPSA 3C8YA 3ASMA 5F8JA 1OH5A 5KPRA 2V8PA 2MHEA 3QATA 3CDEA 1VQMS 3KDOA 2CG4A 3FGVA 2HWIA 2NZTA 3GJRB 2QE5A 3A3OB 3O6WA 2HGNA 2CJKA 4P7VA 2X6NA 1X0PA 1NK4A 3PNIA 1U2CA 2CQ3A 2CNNB 2VQFF 3QWUA 4USTA 1AA1B 2FHOB 1EARA 4OYXA 2HQFA 3MAHA 4OJRA 2ZJPL 2E5GA 4MO5A 3QRQA 1TUGB 3LQVA 3J7Z5 1HBUB 1QDUB 4IEEA 3TZZA 3DRPB 2I9SA 3G96A 1K73O 1KQSM 4OI6A 3CJRA 1NRKA 4LF6F 4DV4F 2ZZMA 2Y0BB 2I7NA 1NK9A 4LRCA 2DTJA 4A8MP 2ZJRQ 4YR3A 4JV5F 3AV9A 3DHXA 2G8IA 2CA9A 4DF4A 3CPEA 1UPMB 5M2RA 2W8LA 2H4YB 4K4ZA 1N33J 3O1BA 2DRDA 5AQJA 2R7SA 1N0UA 1HR0J 4CZJA 3QLHA 4JV0A 1SJ3P 5DZ6A 4Y6IA 4K5RA 2KL8A 2HG4A 2KQ2A 1X7VA 4F0HA 4NZ0A 5DM7Q 1GX6A 1LXNA 2NSBA 1Q8BA 4IUFA 1D8ZA 4ATNA 3FCVA 3QZ7A 2WCXA 3T19A 4NXMK 4NXNK 4DCJB 3OS2A 4HDGA 1VSDA 4OYAA 3P8BB 2ZNZA 2Z2MA 2AGPA 4ZVQB 1VRUB 4ICLA 1NPRA 4LC9B 3LP0B 3WC2A 1RWWB 1T9WA 2AEMA 3QGGA 3OR2B 3J81Y 4GNIA 5AQYA 4ELTA 2M70A 4DR3J 1F0XA 3PKMA 1RP5A 2V68A 4B08A 3UKRA 4UY8T 2GIFA 1D9FA 3J7ZO 1S9EA 1LWFA 1CSJA 2P9UA 3W5XA 2HQIA 2O66A 4G1IA 2R2TA 4JEPA 1U6ZA 2KYZA 5IXUA 5AJ3K 1JXVA 1ICEB 1ZM4A 2BH1A 5FLXU 1U1PA 4DFPA 3MXIA 2ADBA 1KHWA 4FW1A 1I94K 2ZOFA 5D3GB 2CPFA 4IWVA 4G1PA 3H5YA 4L6V3 3TQEA 3QFUA 3TUZC 3FZMA 1EQYA 3SCLE 3OTOF 1B9DA 5IT9O 1FWLA 5CD4A 1HJOA 2XULA 3PY8A 4B9MA 4F0KA 1IKXB 1YGYA 5CYQA 1KBRA 1GK8A 4BDZA 1LWCA 4Z7CA 3K5NA 2IM2A 1HYVA 2GHVC 2WOMB 1HNXK 3K8VA 4CK1A 1BQNB 4KY3A 3M2RB 3W3DA 3I6PA 2KN4A 2XLIA 3VOVA 1VC5A 2JWLA 1T9VA 3CB4A 3HI9A 5KFUA 1X9WA 5CHIA 1GX5A 4CF0A 1NCLA 3DN9A 4DCOB 4KH0B 4DV1F 3S3NA 1B64A 2YH0A 1Q8KA 5BRHA 2CVIA 2QEXS 4Y1DA 5D0EA 1JLGA 4YMEA 3MFHA 4YHHK 1BHLA 4XIUA 2F7TA 4PYDA 2HFOA 3KWIA 3C16A 2OFHX 4GO7X 4DR7K 4LD0A 3S6EA 1IBLJ 1CS4A 4BRGA 4C8KA 4B3RF 1FD8A 2JSXA 3F41A 3CIZA 3PHEA 4A2AA 1IBLK 4HHTA 4URSA 2KZMA 1NJIT 1EIYB 4LH5A 4PWUA 4B1XB 2HFSA 2WW4A 2MHNA 1U24A 1MNEA 4ZCMA 3TYTA 4C3MA 1JLFA 1JNZB 2YNHB 4CEOA 2ZKTA 4M5MA 3AA3A 1HBNB 4WFNQ 4OLOA 1UWBA 2P8IA 2QG9B 2VWKA 4J2DA 1U1QA 4DPUA 4ZLNA 1J5OA 2L08A 1BUXA 3HZEA 4ECSA 3OBYA 5HK4A 3MM8B 3DLRA 3I82A 4ER8A 4N47A 4P72A 3KK2B 1J2VA 4NXMF 2UVWA 2QI2A 4WE1B 4IJAA 4FSVA 2FHMA 4YB6A 4DSFA 4FVCA 2J0SD 1CBKA 2KHDA 3W8GA 3BB5A 2HKEA 1F5CA 2CVEA 3M2VA 3ILIA 1U04A 3OY9A 2VBXA 2CGKA 2YWKA 1PKUA 1NK6A 3R5CA 4QWBA 1NMNA 2EKNA 2WVFA 2GUPA 4V19J 4WK3A 5GAHI 1IBMK 1VK3A 3R2CJ 1T6DA 3THVA 1GLBG 3UN2A 2Q36A 2ZF5O 2W9CB 1RHRB 3H90A 4YP3A 2O1PA 2NRVA 2DEJA 4P7TA 1RFQA 1QQMA 2N3LA 1HW9A 4NOHA 2AJ0A 4JRQA 3RB3A 4B3MJ 3U9DA 2A0FB 1DTQB 5ELZA 3V4IB 1XEZA 3JSBA 3DXMA 2V9WA 4AM6A 4UY85 2HSEB 3LL3A 3VQPA 3NS7B 2IRYA 2HEKA 4M3XA 2VG5A 3M1VB 2C42A 2X74A 2FSKA 3T1AA 2ASMA 1ZOTA 2ZD1A 3TARA 3SCJE 3KMSA 3L8BA 5AQFA 1UEUA 4B9LA 3QB0A 3T6JA 1YX2A 2DRBA 3NBPA 4P6QA 3MN6A 4QW9A 4DG1B 1IJEB 4DFKA 3ENHA 4U7BA 1OVYA 1WB9A 2ETJA 3AVJA 2OH2A 3KJFB 2Z2ZA 3GQCA 3OSPA 2BM1A 1KAXA 2HNZB 2ZITA 3KD5E 4C8ZA 2G9OA 4F4WA 3NGKA 1HWKA 1GMVA 4FJ5A 2RB7A 2XZTB 2LYVA 3KK3A 2PE8A 1BI4A 4OYBA 4E98A 1N8RO 1YJRA 4UOGA 3HTVA 1YBAA 2NYHA 3N9UC 4DHYA 3ZZYA 2VD3A 4F2RA 2YKPA 2C3MA 5D4PA 1WG5A 4LF7J 4X64K 4DMZA 1K9MO 3FBBA 3I0SA 3KHLA 1ATSA 3FSXA 3M30B 4AFFA 1LQ9A 3VGKA 1RT1A 1UVNA 1DRZA 3HHEA 1U2VB 3PRDA 3WBZA 2ZH7A 4CVNE 4YDDB 4CESA 4W92B 2MZ1A 1DQ9A 3WUHA 3MM5B 2IS3A 4RPFA 3O1LA 2FPHX 4DR3F 5HP1A 4CCHA 1JLQA 2C3YA 3DXSX 3AO4A 1KAZA 1RB0A 3BGUA 3M8PA 4EO8A 3H40A 2BABA 3DRYA 4R5PB 4CH1A 1DTTA 3LPTA 1JLEB 3NKYA 1R6YA 4O4GA 3MN5A 4TLRA 3QEIA 1RHUB 4CJKA 1S1VA 3BR8A 1IQTA 2V8VA 3TA0A 4J9SA 1HR0K 3PLAA 1WSGA 5AQIA 4XPEA 2DH9A 2IHR1 1PGZA 4ILMA 1VQ4N 4J91A 2HQ3A 3ONQA 3HBTA 4X62F 2JL9A 4CZEA 5F1XA 2OUGA 3BZQA 1R8PA 4A47A 2VPYB 4FOEA 3UKUA 5GINA 2QSFA 3NGYA 1OPZA 4EYHB 3KYLA 4KV8B 4HVZA 2HBQB 2Y1JA 3BN4A 4JB8B 3W2VB 3LM9A 1H2TZ 3WDOA 3VQ9A 4JI3F 2HK3A 2R8HA 1FK9A 2VIHA 2OPQB 3G4SN 3MUMP 3K2PA 3LDSA 5C0YA 2G2YA 5EY4A 5B0GA 4CEZA 4CF9A 1KC8O 3TR5A 3HVRA 2IBKA 4QS7A 3P38A 1MWYA 3QETA 4IO8A 1T9UA 2XS5A 3HD2A 2K3KA 3OYFA 1HX1A 2G1DA 3TU5A 1T05A 2DNLA 3QIDA 3HRGA 2LA4A 3T3FA 2ZH5A 4RNMA 4IRKA 1FXRA 3RBZA 4IOAQ 1QAXA 1IJFB 1S6OA 4K4VA 5BN8A 4TY9A 4ZPWR 3R9LA 2YNGB 4NE9C 4CHNA 4USHA 2CGJA 4A48A 1VGYA 3L0QA 2JX2A 3ZTSA 1AUSL 2MQOA 5KOXA 4DS4A 3O5TB 2J9CA 4KHRA 4LF8F 3I9ZA 3DWLA 1LOUA 2KKHA 5F3TA 2CJYB 4ZPBA 1HD1A 3KK7A 2QRRA 3OL9A 2HBRB 1C0UB 1RWVB 1I94F 4OQJA 1GLDG 1M5KC 5F3ZA 1VQPS 2R7QA 1LFWA 3B4DA 3Q22A 5TKWA 4I9QA 1HJRA 1X3NA 2RF2A 4PQAA 5E2QA 4FWSA 1S59A 2QL7B 4IQMA 4QYZK 3LGNA 5KFQA 3UDVA 2AX1A 2YJFA 4CNZA 1ZH5A 2F4VK 1SQEA 4OLAA 4WXWA 4X4QA 3RU0A 5J2QB 4M41A 2E2OA 3Q8UA 4CGGA 4QAGA 3S01A 1Q78A 3CJ4A 1L5UA 3O44A 1QSLA 2CQHA 1P8GA 3W63A 1FKOA 4UUWA 4GKJF 1PC4A 3CVKA 3D0HE 3TANA 3C7NA 3U1NA 3OR2A 3R2DJ 4DV2J 3KLGA 2FBYA 4MKYA 1NKBA 1FJGJ 2G8WA 2UXBK 4G3IA 3TA2A 3AY0A 4NLRA 1JXBA 4KGMA 4DR5K 5AXKA 4AH9A 2BJ1A 5LJ3Y 2FZGB 2DNYA 3GL1A 4ED8A 1T6CA 4BRMA 4BRNA 4A62A 4J9LA 1ZPVA 4QIGA 2XCAA 2FSJA 3G6EN 1SI9A 1N5VA 2XWYA 1HIYA 1RWUA 4R8UB 3HHLB 4X4PA 3QSYB 1QAIA 5ETMA 1E6VB 4YR2A 1U6FA 4ZN1A 2HNDB 4XAKA 3CYMA 4ZJLA 4A5BA 3DFEA 1LXJA 5BREA 3FK4A 4W5NA 2V7YA 2PDAA 1WKJA 2JVOA 1SL1A 3PYEA 2FY1A 1X4HA 2AGOA 2YNIA 2J9DE 2ZNYA 3ZTPA 5GAEI 1U25A 5E3PA 3M8QB 2V2KA 1NPKA 4CD3A 2R2RA 1ZTTA 2CPZA 3DHWC 3C3LA 1ZAWA 2P6TA 3FBCA 3ZZUA 4ID5B 1FEHA 4IG3A 4QIWD 5LMNK 2BEFA 2GS8A 4RW6B 3JTPA 4LBHA 4FVMA 5KAKA 2E5JA 2F4VF 2MMYA 1P8ZA 4FPRA 4OKJA 2R7XA 2BV3A 1N32K 3V6KA 3RTVA 3OLAA 4QYRA 1NGHA 4ZIWA 2ILZA 1VSFA 4GKJK 2BKOA 2XM3A 2E44A 1KVIA 2ABYA 1M5OC 1TFYA 5AFUA 4NI2B 1S9EB 2DPIA 3WXLA 2MLXA 3H25A 2HIQA 5M1QA 2E1RA 4M8LA 1TK5A 1RDWX 4O3OA 2HQGA 2LKZA 4LF8K 3IMQJ 3BPSP 1M1HA 1TELA 4PG6A 5KFEA 1SKWA 4Z37A 1TL7B 2PD1A 3HHLD 3BSAA 3D9BA 2DHHA 2PT0A 2P5GA 4DTRA 1NG9A 3N0VA 2VODA 1CVJA 5H9FK 4IH7A 1JLFB 2XYGB 3G0ZA 4LFAF 4O3RA 4JI7J 4Z94A 4GRSA 4EBEA 4CJ7A 1SB6A 1OYEA 1T9YA 4OYWA 2HHHK 3J80O 4BGAA 4FJIA 2RU9A 3VCDA 3R8YA 4FF1A 1WUUA 5TKYA 3OTOK 1Y97A 1KNZA 1RISA 2ZVSA 3GV5B 1JCGA 2E1AA 2XZWA 1BQNA 2CPHA 3NEKA 4PUOA 3R7NB 5KFXA 2HVIA 2LQ8A 3TJ9A 4FKYA 2RQ4A 4LF9F 3TAGA 4DR4K 1SVDA 2EK1A 4CGIA 2KU7A 3QZ8A 1H38A 4P74A 2WFBA 3A0IX 1V6HA 2R3VA 4PZVA 4CHYA 1C1CB 1IBCB 1MG7A 1IWAA 3MAAB 4RWTA 3IR5B 3CHWA 4JLHA 1HLUA 3BO2A 4LFAJ 1V3ZA 1RT5B 3VEZA 2HS0A 3MCSA 4AM7A 4FF2A 3R7SB 4M7YA 3T1YK 2C2RA 1UAXA 4TQSA 4PWDB 3BGRB 3OPKA 4QQBA 4EMDA 5ADZA 1N52B 4CK2A 4XO0A 1RGIA 1NZ8A 3PR5B 2P9IB 1Y5IB 4N7TA 1QZ6A 4QWAA 2PI4A 3QEPA 1TYQB 3H08A 3G8QA 2UUWA 3AAQA 2KM8C 4CHZA 1RHMB 2F8SA 2V8DA 2EFVA 3AB2B 1Y7PA 1B9FA 2AX0A 3CJAA 2ALZA 4IDKA 1Q95G 3QBXA 4MT1A 2R42A 3L3UA 4F25A 1RWXB 2B4UA 2NSCA 3AA2A 2HHHF 3MM8A 5E3RA 3EDRB 4IRDA 1VRTA 4MYTA 3GDQA 4QPXA 4MH8A 2JNJA 4PHTX 4W5TA 5ETVA 3LDOA 4ECYA 4NZ7A 4OX9K 3OUYA 1R89A 1Q4RA 1PYSB 4JV2A 4KPCA 3BKTA 4CBUA 3QERA 4MK7A 4BRIA 1N5YB 1S6QB 4ID1A 4HI2A 5KQ8A 1W26A 4GKKK 2YKOA 1ACMB 4EZ6A 3DMJA 5ETOA 2OFGX 1JX4A 1RDUA 3NCPA 5LMUJ 3BGOP 4DU1A 1E6YB 1T03B 1WLJA 3MEDB 3MK6A 3D54A 3J81U 1S1TB 2BE9B 3DLLQ 3Q7CA 3K5LA 1V9OA 3UDCA 5SUHA 2BW2A 2R7VA 3OW2M 1K8AO 3R27A 4QCLA 1U1OA 2K8GA 4DUZJ 2UXBF 4CEBA 2MLYA 3IS9B 3VF6A 1OIAA 2YKQA 3D6MB 4FJHA 3PEHA 2ZH3A 3NP5A 1GOAA 1RU1A 3W3SA 1N4LA 3R5JB 4WP9A 4DQQA 3ZC4A 2Z1HA 1XJWB 4PABA 3WQTA 3VQ6A 4RBTA 4BWJA 4O4GB 4BRCA 5E0OA 5KT4A 4E7IA 2A41A 1R8CA 1U09A 4WP8A 2YWGA 3M4XA 4OPAA 4Z4CA 4JK8A 3N4QA 3Q8PB 5GMDA 3MMBB 3OYKA 3O6QA 3MX2A 3HT3A 5D77A 1NB2A 4P2FA 3D45A 4GKJJ 4C8LA 3HK2A 2HVHA 3ZCMA 4DX6A 2ZUGA 3LP2A 4C97A 2AHOB 1W2BR 3H3NO 1LK5A 1JIHA 5AE3A 4ETXA 2NUBA 4OGEA 2HRUA 2FD2A 4C11A 4ED4A 3P39A 4CFCA 4ZJOA 1X3MA 2W4DA 3VGSA 1VCTA 1S1UA 2CWKA 4IO1A 2V4RA 4EIAA 3DM2A 2DO0A 1P6TA 4C4WA 5D4OA 5A8WA 3MWTA 2B51A 4KHPJ 3ZT2A 4NEZA 3MFIA 1C0MA 3BUZB 4ECUA 1IBMJ 5KG7A 4JKGB 1ZYQA 1ATNA 1YKWA 2CJBA 1RT4B 3T5HA 1TU0B 2OLWA 3V6JA 3FCHA 4ZCLA 4H54A 3Q89A 1O6XA 4Q5VA 3MF5A 3PV8A 3BH6B 1HQ2A 2WB4A 2MSSA 3VAFA 1U1RA 2IFXA 3E3XA 1TFWA 4KBIA 1R8BA 3HHNB 4G9ZA 1JXLA 3SI6A 4EP4A 1VDHA 1F1BB 3OL8A 2D74B 1H98A 3C6AA 1HNVB 4HTIA 4LSLB 3RVCA 1DARA 4DTSA 4DV7J 1SJ1A 2Y8YA 1TKTB 2OSQA 1Z4UA 3ILLA 4M3WA 1MROB 1KD1O 1RTDA 1TK8A 4IYQA 2OEMA 3O2IA 5AT1B 2QTDA 1BA1A 4EYIB 1KVCA 3CMEN 5GADI 3R7BB 2ZJQL 4B3TJ 2VU5A 1N5SA 2ZBQA 2UU9F 4MYUA 1VQ9S 2NREA 3SCIE 3DRSB 2MY7A 1RHKB 1M0SA 3WNFA 4NLDA 2ZWHA 4WQ4A 3PIPQ 2L3MA 3K7RA 2NPFA 1DJ0A 2RF2B 3QINA 1WSVA 4ED5A 2FF6A 4WJBA 5I42A 1NOZA 1RDBA 1EX4A 3V6DA 4KHWA 3ENBA 2BRKA 1YI2S 4Q43A 1GMWD 1FRKA 1PJ6A 1R3NA 1S4FA 1ZAXA 4RU2A 3OS1A 3CJ3A 4USKA 4K50A 3VGUA 1SZ2A 3F5TA 1H73A 2G8KA 2RH3A 3VVTA 3KHYA 1EP4B 1RDCA 5IV4A 2F4FA 3VHQA 2QV6A 4LR9A 4FWLA 1SL2A 1XMOJ 1OYDA 5F8MA 4ILGB 1FT8A 4DCHA 4FXDA 5KFJA 2GQCA 3TSUA 2X1AA 2WRMA 4ZP9A 2RD5C 4AXIA 1WI6A 4GMKA 3VQTA 2LCWA 1WF1A 4YHHJ 3SBMA 3CCTA 3VEVA 1AW0A 4LY7A 1LWCB 4NEYA 4V19S 5LOQA 4L8RB 4NMLA 1CQNA 5CH7B 4X65J 3O80A 1BU6O 5JMNA 3M2RA 2Q1NA 3GIKA 2ZDOA 2FJVA 1RDDA 4LFBJ 4NLXA 3FFIB 3L7OA 1RZMA 2OJ3A 4LRAA 2RRNA 4KH4A 4BLGA 3R97A 5AQUA 1G15A 3L2UA 4DV2F 4DQPA 2LQJA 2QW9A 1HHQA 2YNIB 4K25A 3D6HB 2E2PA 1HPZB 2Q6CA 5C10A 4BRHA 3MOJB 3H1QA 4EAHD 1JLGB 3KTQA 4LF6K 3NRBA 1B3TA 4ZVHA 1SIWB 3BR9A 4U6PA 3JAMO 2O8DB 2IA0A 1YUWA 3NG8A 5ETLA 2J7WA 2GTDA 2VG7B 1HNIB 1UJ5A 5KT3A 2VFRA 1YIJN 2P9NA 4A61A 3VQ5A 1X4BA 2O8CB 4KB0A 4A8FA 3JXUA 1D9AA 3P5TL 3NWRA 1EKSA 5IS2A 4M45A 4JN4A 4M3UA 5KFYA 1P9YA 3JQKA 4M3ZA 3T9NA 1S7IA 2GV1A 4MKBA 1Q5YA 3SJHA 3FZLA 2OGUA 3IUCA 3ZX0A 2MZSA 1LWXA 5LSRA 5DDQC 3ALYA 1IKXA 4ZMMA 3IMXA 3SUNA 3V2UC 1FW6A 2HK2A 3PW7A 4BC2A 2OA8A 1JLBA 4X66F 3VEXA 1NOYA 1IKVB 3EZOA 2GQ2A 5IFMA 3SV4A 4N8OA 4GVEA 3M2UB 3P5JA 3OHRA 1JLCB 3LO3A 4WF9L 3N5FA 5CD4H 2DCUB 3M2VB 3KK1B 3MMAB 4J9PA 2XB2D 1UW4A 2GA7A 2P9PA 3NGIA 3L2RA 3NF9A 2E9ZA 3AO2A 1HBUA 4B02A 3FCWA 4FO0A 4LRBA 2YWFA 3BP8A 5HVFA 2BANA 4OI1A 4HTUA 2ATQA 1FD2A 1VQ7N 3TAMB 2C2MB 3SYZA 2B5JB 2NXEA 2N4CA 5D4LA 2MQLA 3D3BJ 4ETZA 3T1YJ 4GMJB 3CCJS 1HR0F 3N6NA 4UY8O 3LP1A 3BO3A 2VG5B 1SC6A 1RBOB 3C14A 1WN7A 5DRKA 1RT5A 3K9JA 4YB5A 3SFUA 2M4MA 2ZJQQ 3S9HA 4CZHA 4CJVA 1F9FA 1QUVA 1TUVA 4AHUA 1FFWB 2W9AA 1TAQA 2DGQA 2NXNA 5AQNA 1U02A 1RTJB 2DY9A 1WAFA 4KPYA 2ASPA 2VFSA 5BJRA 5HI7A 3TABA 1GTEA 2IMOA 1RT3A 1X4AA 4F0MA 2AV5A 5KT7A 2EW9A 2NLXA 3CUNA 3OXGA 2B4JA 1HKAA 4CEEA 4CZKA 3FSYA 1SUQB 4QU7A 4KFBB 1NDKA 2GJFA 1KSPA 1MWZA 2HOEA 4LQ9A 4Y00A 4LFCF 3Q8SB 3DOLB 1L3UA 3N6MA 3AHPA 1GLLO 4YOYA 3QIPA 3MMCA 3MR3A 3B6PA 3RW6A 1TQLA 1VRTB 1YITS 3J81O 4WU3A 1SH0A 4DLEA 3SUOA 3HXMA 2G8VA 3E66A 2OZMA 3W9IA 3IBFB 1URNA 4GW6A 3TWZA 5DGAA 5D3GA 1UPPA 5SWMA 1KFDA 2W9CA 3GZ7A 2UV8A 1S0MA 1U1KA 5AQVA 4JP8A 4KIAA 3AFGA 4ISFA 4DX7A 4DQ8A 3CCQS 2AZ3A 1U0HB 4BRKA 1XQSC 2M8DB 3DMJB 5HRSA 3ATVA 3KD1E 3PRVA 1N36J 4WCEL 3O9UA 2VH7A 4UW2A 3D6RA 4J9VA 2DH7A 2CQ4A 4OMFG 4IKAA 4H0XB 3CD6N 3O3HA 9RUBA 2B3TB 2DNQA 4RX6A 2RHSB 3NAIA 2H4WB 8AT1B 2XS2A 4OI4A 4QPTA 5AZJA 2VWBA 2HFZA 4DTXA 4B1UB 2QLWA 3M8ZA 3GFYA 2F9TA 1MWQA 4KH6A 1S49A 4KH5A 1KQSR 3NBPB 4YY3K 1Y00A 2F5GA 1BWEA