1S1VA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
539
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 145
structure length 533
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1vA05
4TQSA 2FLNA 3OJUA 2UVWA 1TV6A 3M8QB 1T7PA 3L2WA 4FLWA 2OPPB 4FCYA 4F2SA 2VG6A 3PW5A 1S0NA 3NE6A 4ED8A 3TAFA 2Z1HA 5DG9A 4DSLA 3V9UA 4MKBA 4ZHRA 5KG5A 2J6UA 2IM2A 3PX6A 4DL6A 2Z1JA 1GX6A 1RT5B 2FVSA 1RTDA 5KFEA 3SFUA 4WYWA 1IO2A 3GQCA 3PW7A 2OPSB 3KHRA 3ITHB 2P1JA 2DFEA 4YR2A 3H4DA 1EXQA 1D0EA 4J9MA 2B4JA 4RNOA 1RT2A 4ECSA 4TYAA 2HW3A 3TABA 4F50A 1JLCA 1LWCA 3OYJA 2F8SA 5J2MA 4KPYA 5JUMA 4ELVA 3VN5A 4O3RA 3V9XA 1K1QA 3NKYA 2ETJA 3QIPB 4RNHA 4TN2A 4K8XA 1W0HA 2FBYA 2W7PA 3C6TB 4CERA 2IMWP 1C2PA 4EBDA 5C24A 3CO9A 2W8LA 3IN5A 1RA6A 4URSA 4M45A 3DLGA 1S10A 1JKHB 2BE2A 4J9SA 3PR4A 2W9CA 2I1RA 1U4BA 1B9FA 2DTUA 2DY4A 3I0SA 1EETA 2AGQA 3VQQA 3DRRA 2VA3A 1BI4B 4YP3A 4XIUA 1ZBUA 4CGDA 2IGIA 2A1RA 3OS2A 2XHBA 2UVVA 3KK2A 1S4FA 3AO4A 1C0TA 4B8CA 1F21A 5HRSA 3HP6A 1HARA 3DOLA 5J2PB 1RTIB 3CJ5A 2IC3B 3PHEA 3OHAA 4O3OA 3MXIA 1RT4A 3RMBA 1J9AA 1HNIB 5KRSA 1MU2A 4KV8A 5KFGA 2YKNA 1RT7B 4CEOA 1TL3B 3C6UB 4G3IA 3SQ2A 1C1BA 1XI1A 4F4KA 3TAPA 2A1SA 2I5JA 4JS5A 4FLYA 1B92A 2XY8A 3ZSWA 4F4ZA 1WSHA 3K59A 1CXQA 4CGFA 1KRPA 4BWJA 3NAHA 1D5AA 2E6MA 2ZQBA 2HVHA 1O1WA 1RILA 2D0BA 1SKRA 2QKKA 2WONA 1Z4UA 4IKAA 4NYFA 4E7IA 4OPJA 5DQGA 3FFIB 1W9HA 3QESA 3RMAA 2Q3SA 1HYSA 4WE1A 2JC1A 3L2VA 2D3UA 1X9SA 2HWIA 2KZMA 4H8KA 3VQ5A 4TQRA 2Z1IA 4KHYA 3FQKA 4I2QA 1L3TA 5HRRA 3OJSA 4DF4A 4DSEA 1LW0B 1BQMB 4B9SA 1RT3A 1FKPB 3F73A 3BQ2A 3O4NA 5KT5A 1JLFA 4E7HA 2WB4A 2BANA 1HMVA 2EX3A 1RDBA 1YVUA 3CQ8A 2X74A 3PX0A 4ZP7A 2YNGB 1S1TA 3LP1B 3DM2A 2BQUA 3N6MA 4WFYA 3QGHA 4L8RB 3H2LA 1J5OB 3E01B 4Z4HA 4CJRA 4TXSA 4ZMMA 5EWGA 4K4ZA 4FVMA 2G8WA 4H54A 4IH5A 4ICLB 2W9BB 3MEGA 3ASMA 1IKYA 2FLPA 1LWEB 1UOCA 4LSLA 1REVA 4CJPA 3OHBA 1NHVA 2YNHB 1DTQB 1S6PA 4CGJA 1IKVA 4LY7A 2XO7A 4H4OB 2YHBA 1HYVA 4B9TA 4DQSA 4KKOA 2WOMA 4WFXA 2CKWA 3HL8A 3HT3A 3NCIA 4O3PA 1RTHB 2RF2A 5CYQB 3TI0A 4ID5A 2IOCA 5KT2A 3GV7B 4IG0A 4NRTA 5CYMA 3OYMA 1S1UB 4O5BA 1KTQA 5KRTA 4KI4A 3V6HA 1EKEA 3ISND 4CHPA 1S9EA 2W8KA 4FLTA 4DFJA 4AHVA 4CIEA 4R5PA 4DWIA 1VSLA 3V6JA 4DFKA 5KFTA 3M8QA 4IRCA 4KI6A 3KK1B 1TP7A 2OPPA 3NF8A 5JS1A 3MECB 1BQNB 2HMIB 2D0CA 4CJEA 1D9DA 5KFQA 1B9DA 3NF9A 4CEFA 2BRKA 2AU0A 1SL0A 2G8VA 5DLGA 3AVBA 3IRXA 3MR3A 3KHGA 4LD0A 1S1XB 3AA2A 4QWEA 5KFBA 1RT5A 1RBUA 3OYIA 3LPTA 3T3FA 1L3SA 2OPSA 1ZBLA 4KTWA 3ITHA 1FKOB 4ZP6A 3EPIA 1JL2A 5FROA 3BJYA 4O0IA 4RW8B 4AHCA 3DRSA 3FSIA 3N6LA 3GIIA 4BACA 3H5SA 1KVBA 2FBTA 4CJ4A 2UVUA 2FVCA 2QE5A 4PY5A 3QIPA 4KHRA 1U48A 5D3GB 1T3NA 4DLEA 3KLEB 4DTMA 3C6TA 4B9VA 3VQCA 5DQHA 3DLBA 1HRHA 4WXWA 3PW4A 3MEEB 4ECRA 1JKHA 4O3NA 1TVRA 4J2EA 2HAIA 1NK5A 1FK9A 4BE1A 1LAVA 4DFPA 1HQEB 4DSJA 2RN2A 2OZMA 5KFRA 1I39A 1BI4A 3GIKA 4QOZB 2C2DA 1KHWA 4CEAA 2WK4A 5FRMA 4PUOB 1WSIA 4FZZA 1UWBB 2R2SA 4I9QA 3KLFB 3QZ7A 1RDDA 4JUZA 4O44B 1HJRA 4Y2AA 1RTIA 5C5JA 4W5RA 2IAJB 2IC3A 4CEDA 3QIDA 1WLJA 3PW0A 5I3UB 2KZZA 2O4IA 1LAWA 1RT7A 4MIBA 1TL3A 3C6UA 4KB0A 4DU1A 4NRUA 3LANA 4ZPAA 1KLMA 5FRNA 4E7KA 1S49A 3VQEA 4DTRA 3GV8B 2IJNA 5FDLB 4CJWA 3AA4A 1JXLA 2V4QA 3PY8A 3G86A 4NLOA 1BISA 2OYQA 3FFIA 5DGBA 4CHNA 2EC0A 1VSJA 4FS1A 4FJGA 1T05B 4IQXA 4KTZA 4NCGB 5KFUA 1NKBA 3OS1A 3S9HA 1QUVA 1S9GB 4ECWA 4CJSA 4KB1A 4QW9A 3DYAB 3CDEA 1LW0A 1BQMA 1S97A 3I0RB 1FKPA 3PZPA 3KK3A 2Y1JA 5L1IA 2JGUA 2P51A 4J9RA 3ZT1A 1TK8A 3LALA 2DPIA 1SKSA 3ZSXA 3LDSA 4JV1A 4JLHA 2GBZA 3RMDA 2YNGA 4K4VA 3LP1A 3NHGA 4EZ9A 3JYTB 4E1NA 4M94A 4CK1A 1J5OA 3OLAA 2R2TA 4CEQA 2OH2A 4KSEB 1GOBA 3SUNA 3ZSOA 4ICLA 2W9BA 2BQRA 5J1EB 4OL8A 4AHUA 1C1CB 3GIMA 1VRUA 1T03B 2YNHA 2IS3A 1DTQA 2PY5A 3LP0A 3FQLA 4KHSA 3CWJA 1Z26A 4H4OA 4DQQA 5DMRA 4FK2A 3LAMA 3RB3A 4U6PA 3D0PA 2HHQA 1OS5A 3ZSVA 5T7BA 1RTHA 1BCOA 5CYQA 4K4XA 2XCPA 2GV9A 1N4LA 2Z1GA 3DLKB 2D5RA 4TLRA 4QCLA 3GILA 4B08A 5EWEA 2R7YA 3PO5A 2F96A 2VG7A 4TSXA 3OYGA 4FZXC 1S1UA 5DLFA 2E9ZA 3V9WA 3QEXA 3O4QA 3ZT4A 3DOKB 3JSMB 3HHKA 3VQAA 2IDOA 1DTTB 1NKCA 4HUFA 3RMCA 1JIHA 3QO9B 3HK2A 1EP4B 4N56A 3Q8SB 2D0AA 1TAQA 3AO5A 4IOBA 3EY1A 2QXFA 1BQNA 2OPQB 4IKFA 3KLHB 4DG1B 1BGXT 4ZTFA 3P5JA 5CY4A 2UVRA 4FLXA 4KREA 3OS0A 3P83D 3VQBA 5KI6A 4Q8FA 3OL9A 4F8RA 1S1XA 4CJTA 2ILYA 3V1RA 2IM1A 5DK5A 1ZTWA 4O4RA 4F2RA 4KHMA 2G8KA 1FKOA 3UIQA 1TGOA 3AVLA 4N47A 4RW8A 1CSJA 1QS4A 4DMNA 3RB6A 4FW1A 3HYFA 3DI6B 4MK9A 3L8BA 5L9XA 3BREA 4QWDA 3DMJB 3M9MB 4CHQA 3NBPB 5D3GA 4TY9A 3KLEA 1S9FA 1SKWA 3QEIA 4EYHB 2W7OA 3SQ0A 4I7FB 3TQ1A 2XY7A 4YFUA 4M41A 2PYLA 3TANA 3CJ2A 3MEEA 2WRMA 4GC7A 3LP2B 3RBEA 3O3HA 2GIQA 1JLGA 3IG1B 5KFJA 3GYNA 1HQEA 3HM9A 5F9NA 1QSLA 1I3AA 2YNFB 1ZETA 4PUOA 4MFBB 4CJFA 1QSYA 1HQUB 1UWBA 3KLFA 1A5WA 4CEZA 2XCAA 4O44A 5KT7A 3NMAA 2KFZA 1RYSA 3G10A 3B6PA 4DQIA 3OVNA 3BQ0A 2HHWA 2IAJA 3LP3A 2G8FA 3RAQA 4MK7A 1X1PA 1TKDA 4FXDA 1FXXA 4AH9A 5I3UA 2DFFA 3NF7A 3ICLA 3C95A 3IS9B 1R0AB 2C28A 5J2NB 2D3ZA 4Q8EA 4DTXA 3PO4A 4C8OA 1WNSA 1XR6A 4EO6A 4QW8A 5KT4A 1RBTA 1KSPA 5HRPA 1X9WA 4J2AA 2KW4A 3KOAA 3SFGA 1N6QB 2VWJA 5KFWA 1SH3A 3L3UA 4DSFA 3MR2A 4R8UB 3T5JA 3M8SA 4FS2A 3QYYA 4KBIA 1U47A 4DQPA 2B43A 4FYDA 2VG5B 3V9SA 3KIOA 3WNHA 4IDKA 4XO0A 4DLGA 3ISNC 1T05A 4NLUA 4CJKA 4LH5A 4RW6B 1S0OA 4CK3A 1TKTB 2R8IA 2FC0A 1S9GA 4H4MB 2VWKA 2DFHA 3OYAA 3PVXA 1RT1A 4QAGA 3VQSA 3TAMB 3I0RA 3G6XA 4Y1CA 4JS4A 4CIFA 4CHOA 3CFPA 1LWFB 1SUQB 2FJVA 4RW9B 3LWMA 2ZE2B 4J9PA 1TK0A 1Z25A 3OL8A 4IH6A 4PWDB 5KG0A 3K5NA 4CFCA 4K4WA 1UA0A 1VSFA 3JYTA 3KJVB 1Q9YA 5HROB 4JV2A 1LW2A 2OPRB 5J1EA 3SUQA 1XWLA 1C1CA 4FJHA 3QIOA 5EDWA 1WNEA 3T19A 1T03A 4N41A 3MFIA 3AVNA 3D28A 4LQ9A 2QV6A 1JLBB 3PJXA 4Q0BB 1JXBA 4UQGA 4M3WA 4FZYA 4AHTA 1NK7A 2CJQA 1RBSA 1GOAA 4W5OA 3V6DB 4ZPBA 3RR7A 5C25B 4LSNB 3U3GA 3DLKA 3AVCA 2IBKA 3CM6A 1SL1A 3H5XA 3NGZA 4HYKA 3OYEA 4O4GB 3M8PB 1RAJA 3BGRB 1RCHA 4CJ3A 3RAXA 1XC9A 1DLOB 3NFAA 3OSNA 3VQ7A 1ASVA 3DOKA 3NDKA 3JSMA 3T5HA 4FJJA 2P5GA 3MR5A 3EPGA 1DTTA 4GW6A 4NYZA 4ECUA 4HCBA 3QO9A 2ILZA 1NJXA 1EP4A 1U49A 4EEYA 4ID1A 4DL3A 4Y1DA 4KFBA 2OPQA 3SZ2A 4IFYB 3G6YA 3HVTB 4DEZA 3PJWA 1TKZA 3M9OB 4CJQA 3HVRA 1S1VB 3MFHA 4N76A 2W9AA 5EUHA 1N56A 4LQ3A 4I9LA 2XY5A 1J54A 4CGHA 3TWHA 4M42A 1RT6B 4HUEA 1KHVA 3CDWA 4ZP9A 1BCMA 5DGAA 4EBCA 3AVHA 5CZ2A 4KB7A 4ZVGA 3OYLA 3UPFA 1A5XA 4DF8A 3DI6A 1XR7A 4CGGA 1RTJB 3V6KA 3KHHA 1TV6B 4KTQA 4Z4GA 4XPEA 3DMJA 3CFRA 4ZPDA 3KLVA 5L1JA 3ZT0A 4E0DA 3NBPA 2QK9A 5F8IA 4BE2A 3H5YA 4Y34A 4I7FA 4I2PB 5KFNA 4DTSA 4O3SA 1VSHA 4B3OB 4ZHRB 4ELTA 4NLSA 1YVFA 3CFOA 3LP2A 5L1KA 5KT6A 1LV5A 4M3TA 4DS4A 5KFXA 4ZTJA 4WYLA 3IG1A 3OSPA 1NJYA 2XGPA 3AO2A 5KG4A 4FW2A 1VSMA 3EYZA 4DU3A 3L2UA 2ASJA 4CESA 3AVAA 2O4GA 2J6SA 3ZT2A 3VQ8A 4MFBA 4M3ZA 1HQUA 4E89A 5K14B 4FJ9A 1JLCB 2E4LA 1QQCA 3V4IB 3CJ0A 2GUIA 4BE0A 4Z4FA 4DL4A 4K4TA 1NK0A 3SI8A 1D9FA 1VSIA 2YNIB 3QNOA 3N6NA 3L2QA 5E41A 1NOYA 3HVWA 3IS9A 5J2PA 1R0AA 5J2NA 2HHTA 1G15A 1NK6A 4FM0A 3SJJA 2AJQA 4Z4EA 3CG7A 1HNIA 4J9OA 4FJNA 4KE5A 1TK5A 5HLFB 3OYHA 4BDPA 1I6JA 3I0SB 3H5UA 1N6QA 3O3FA 3SNNA 1ZBIA 2R8JA 3UQSA 2IA6A 4CF8A 3TAEA 3U6FA 1SH2A 2F8TA 1K1SA 1C0UB 4JV0A 1QHTA 4E7JA 1NNDA 1NKEA 4ED0A 2AGPA 3A2FA 2BDPA 4DTJA 3HPOA 4YQWA 4KO0B 4RW6A 4FBUA 3SPZA 3CVKA 1TKTA 3VQPA 2C2EA 3HVAA 4H4MA 5KFPA 3DLEB 3TAMA 4PA1A 2FLLA 4M3RA 1LWFA 1SUQA 1U09A 4IFVB 4RW9A 4GMJB 2ZE2A 3SV3A 3SCXA 1JX4A 3AVKA 4J9QA 2ASDA 2GC8A 4PWDA 3RB0A 4J2DA 2HHSA 5SZTA 4K4SA 3IAYA 5HBMB 3MAQA 3KJVA 4LH4A 5HROA 4DS5A 2R8HA 3THVA 4FJLA 3DRPB 2OPRA 5F8HA 3ZT3A 2JEFA 4EBEA 4J9NA 4ECYA 4MKAA 3HJFA 5KGWA 4YNQA 4DL2A 1W25A 4ZVEA 3E01A 4E19A 1WAFA 1JLBA 2V0NA 4Q0BA 4CIGA 5KFVA 5F8LA 5KFDA 4NLDA 4OKEA 4O3QA 4ECTA 2YV0X 3ZCMA 1X9MA 1LWEA 4CCHA 3GIJA 1C6VA 4CF0A 3V6DA 3T5LA 4DL7A 3AVGA 4NZ0A 5I42B 4LSNA 4K4UA 3ZSQA 4KHUA 4BWMA 5KFHA 4FM1A 5C42B 4O4GA 3M8PA 5KFCA 3BGRA 1NHUA 4TYBA 1BHLA 1S1TB 1DLOA 4FBTA 5F8JA 1Q8IA 3K5MA 4K50A 4KRFA 4ECZA 5F8NA 1ITGA 3HKWA 3MEGB 4DSIA 5F8MA 2KFNA 3H59A 1YT3A 2E9RX 2X6SA 1VSDA 1QE1B 2IM3A 3I5CA 4WXOA 3CIZA 3F9KA 4E7LA 1IKWB 4FJ8A 4IFYA 3HVTA 3L2RA 5T14A 4KKOB 3BR9A 3NGYA 3KK1A 3P1GA 3K58A 4NLVA 1S1VA 4DTPA 3MECA 4IR1A 2E9TA 4NLWA 4HVJA 3KLIB 3MEDB 2HMIA 3S3OA 3CJ3A 4CFBA 4QWBA 4RW4B 3UR0A 4BDZA 4YR3A 2HNZB 3D5MA 1RT6A 1TKXB 3UDLA 4WZQA 1RDAA 3RRGA 2LSNA 2ZD1B 4OKJA 4FJ5A 4TY8B 1XHXA 2UUTA 4R5PB 3QEWA 5J2QB 2V9WA 1RTJA 4EZ6A 5KGXA 2XGQA 2IM0A 2BR0A 3RR8A 1JLQB 4Z0UA 2X78A 3KNAA 2X6NA 3LPUA 3ZSYA 3K57A 5SWMA 4I2PA 2WCXA 2JLEA 4ZPCA 3QNNA 4DTUA 4B3OA 3D45A 5DG8A 3IRXB 4NLRA 4Y3CA 1L3UA 1BIUA 4EP4A 3KLGB 3LZJA 1TL1B 3OYCA 2XY6A 1KVAA 4F3OA 1CLQA 4Z4CA 3RRHA 2QKBA 2BQ3A 4CJ5A 2B6AB 4NLTA 4CEEA 2V4RA 4F4YA 1QTMA 3VQ6A 1NOZA 2WHOA 4OGEA 2FJWA 1S1WB 4M95A 3DRSB 4IRDA 4ZP8A 2Y1IA 1HPZB 3LAKA 5K14A 1WN7A 3G6VA 3VQDA 4W5TA 3V81B 4RW7B 1TAUA 3ALYA 3V4IA 3H4BA 3QLHB 4Q5VA 5HRNA 1IKXB 3TARA 1N5YB 3QGGA 2YNIA 3QETA 4MQ3A 2HHXA 1ZBHA 4FLUA 4G1QB 2G8UA 3KMSA 1S6QB 4DTNA 4OLBA 4Q43A 3WNEA 3AO3A 2HHVA 1NK9A 4F4WA 5KFYA 1TVRB 1ASWA 3DLRA 3PUFA 3T1AA 1FK9B 5HLFA 2O5DA 2XWYA 4RNFA 3BSNA 3SI6A 4GC6A 5KFLA 4URQU 4KAZA 1QAJA 3G0ZA 1C0UA 5FDLA 4N5SA 4FM2A 3AV9A 3IGNA 3TAGA 1YTUA 2AGOA 4AHRA 4OLAA 3OL7A 4OKKA 3KKRA 4FK4A 4KO0A 3PW2A 3HSTB 2D7SA 3H40A 2XRIA 3HPHA 1VSEA 2G8IA 2PYJA 2ITGA 3ULDA 3M8RA 2B5JB 2YHAA 3DLEA 3MXJA 3SUOA 2ASLA 3PV8A 3NGDA 1JLAB 4EO8A 3AVFA 2FJXA 1RA7A 4RUAA 4NCGA 2P5OA 3CJ4A 1KLMB 3OYNA 4IFVA 2ATQA 3I8DA 4HKQA 1WSEA 4KHWA 1HNVB 3DYAA 1QAIA 1SV5B 1BL3A 3SQ4A 4K4YA 4HCCA 4U7CA 3VQ9A 3TAQA 4URGA 3ZSZA 4OVLA 5HBMA 5CZ1A 2E6LA 4R0EA 4RNMA 1WAJA 3DRPA 3AA3A 4J2BA 3OYKA 2KQ2A 4FLZA 4DFMA 3Q8RB 4M3YA 2XI2A 2C22A 2R2UA 4M3UA 3TVKA 2RKIB 4ED1A 1C1AA 3NAEA 4RU9A 3IGVA 5HP1B 2FVQA 3TR8A 1XR5A 1WSGA 5KG7A 2AQ4A 3OY9A 4CECA 4JRQA 1S48A 4AHSA 2XI3A 1RDCA 4EYIB 4QPXA 2RDJA 4CF9A 3WNFA 3LZIA 5I42A 4FLVA 3KK3B 1A5VA 3MF5A 1EX4A 5C42A 2FVPA 1T94A 3SYZA 1VRTB 5KFIA 3S3NA 3BDPA 2DPJA 2HB5A 4CHYA 1WSJA 3BSAA 2HNYB 4B9LA 3I5BA 4Q44A 2RPIA 1K6YA 4CFDA 3E51A 5KFOA 1VRUB 5KG2A 1WSFA 1KCFA 4CF1A 4O0JA 3EZ5A 4Z4IA 3LP0B 4ED7A 4YR0A 3AVIA 1QE1A 4PQUB 4Y2CA 3RWUA 1IH7A 3OYBA 1RBVA 3CYMA 1IKWA 1ZBFA 1N48A 4RUCA 3NH0A 5EWFA 3AO1A 4M3XA 4WZMA 4K8ZA 3AVMA 1MMLA 3KLIA 3MEDA 4EP5A 1CZBA 4ECQA 3NL0A 1S5JA 4CK2A 2YKMB 3SPYA 3KLHA 4DG1A 4ED2A 4J9LA 4RW4A 2VG7B 2RDIA 5KG6A 2ZKUA 3CDUA 1ZTTA 4DTOA 2HNZA 4W5QA 2HNDB 1TKXA 2WTFA 4ZVFA 3O3GA 4NYNA 4F3TA 4GVMA 3QERA 4ED3A 4IBNA 2G8HA 2ZD1A 2R8GA 1JLEB 3V1QA 4TY8A 1VSKA 5KFAA 3FRZA 4ED6A 3KD1E 5J2QA 4JRPA 2HWHA 2R2RA 4DSKA 4WFZA 1JLQA 4IG3B 1QSSA 3VQ4A 3S3MA 4RNNA 3VA0A 1NK8A 3H08A 1HYZA 3SV4A 2VG6B 4W5NA 5KFKA 3HXMA 4CJLA 1RNHA 1GX5A 3KLGA 1TL1A 5F8GA 4RZRA 2B6AA 4HTUA 2FBVA 3K2PA 4CJUA 1ZYQA 5EU7A 3NH2A 2HVIA 1RTDB 1S1WA 3DDKA 4KHNA 4CHZA 2KTQA 2J6TA 4YMEA 3MR6A 1HPZA 4NLYA 5KT3A 3DLHA 4CFAA 4NCAA 2UUWA 3C94A 3V81A 4RW7A 5KFFA 4OJRA 2YNFA 3H98A 3BSCA 3QLHA 3CM5A 4DQRA 1IKXA 1N5YA 4KAIA 4B9NA 1BIZA 3OYFA 2OA8A 1RT2B 3U3YA 1LWCB 4G1QA 4FJXA 5J2MB 1S6QA 1KLNA 3NH1A 3I5AA 1JXEA 2OZSA 3Q8QB 4NLPA 4DL5A 1JLGB 3L3VA 3KHLA 5C24B 4E1MA 3AVJA 4X2BA 1D8YA 4MIAA 2FVRA 5L1LA 1RYRA 2JEGA 3B6OA 3NGIA 4FJKA 3DLGB 2JC0A 2BE2B 3QEVA 4F4XA 2W9CB 3QZ8A 2AX0A 3FDSA 4NLXA 2FBXA 3RB4A 1IG9A 1EETB 4CF2A 4CEBA 3DRRB 4R8UA 3MXMA 4MK8A 3K5OA 1CXUA 4NCBA 3KK2B 4CE9A 3QGIA 1JL1A 1C0TB 3BSOA 2B5JA 1YTAA 3K5LA 2VG5A 5KFMA 3DOLB 2AWZA 2W42A 1JLAA 3NF6A 4QWAA 3QINA 4B9MA 2AX1A 1RT4B 2BRLA 2JEJA 2R8KA 2EHGA 2BGGA 2D41A 4CJVA 1MU2B 4Q45A 4FK0A 4QWCA 3OLBA 1HNVA 4KV8B 2YKNB 1SV5A 5F9LA 2ATLA 4O55A 4NLQA 1C1BB 4ECXA 4C8NA 3V9ZA 3VA3A 2I5JB 1J53A 3MTKA 3PX4A 5JXSA 4BDYA 4IDKB 1Y97A 4FJIA 3KD5E 4IR9A 2RKIA 2PZSA 2HHUA 2GIRA 2WONB 1NJZA 1NK4A 4HHTA 5HP1A 3HO1A 1IM4A 3GV5B 4C8KA 1RT1B 4WE1B 1HYSB 1KFDA 3KMQA 1L5UA 4C8LA 3RTVA 1UAXA 1CZ9A 1T8EA 3HP9A 4I2QB 5KTQA 3SUPA 2JEIA 3QEPA 1XHZA 3PR5B 4RG8A 1VRTA 1RT3B 1D1UA 5C25A 1S0MA 4OPKA 4OGCA 3ZSRA 4IH7A 1L3VA 2ALZA 1JLFB 4NLGA 2IJFA 3SQ1A 3V1OA 3EZUA 2BANB 2HNYA 1LW2B 4C8MA 1HMVB 3LWLA 3NAIA 3HPGA 1U04A 3DM2B 5KFZA 3BQ1A 4AILC 5KG3A 4PQUA 1ASUA 4HUGA 3KKSA 5JS2A 4ZVHA 1UA1A 1IKYB 4B9UA 4LSLB 1REVB 3T5KA 4IRKA 3OYDA 2NUBA 4B8AB 1RDRA 1S6PB 1RBRA 5KG1A 1IKVB 3KTQA 2XC9A 5DQIA 4FJ7A 2YKMA 2WOMB 1Q9XA 1SH0A 2HNDA 2RF2B 1KFSA 3Q8PB 4CGIA 3M9NB 3WNGA 1TQLA 5KFSA 4ID5B 2VA2A 1JLEA 4J9KA 2C2RA 1C0MA 1GOCA 4DU4A 4E3SA 1VK0A 4IG0B 5DG7A 5CYMB 4KHQA 3OL6A 3RBDA 1SL2A 3AA5X 4XPCA 1NJWA 1KVCA 2F8EX 4IG3A 1S9EB 4KFBB 4ECVA 4ELUA 1U45A 4MH8A 4FJMA 1TKZB
chains in the Genus database with same CATH superfamily
4TQSA 2ACMA 1T7PA 3L2WA 3G6EN 2UXDF 3NMRA 2DGVA 1TL7A 5K8OA 4USWA 5A2QO 3PIPL 5DG9A 2VFUA 2RU3A 3O5TB 2J6UA 4JD2A 2IM2A 2Z1JA 4P7TA 3HBTA 2Q0RA 4YDUC 2W24A 1XMOF 4OZJA 4IYQA 3QAEA 3PW7A 2ZUGA 1NJIT 4QJVA 4YB5A 3PDNA 3A13A 3O1BA 3R1XA 1EXQA 4YOWA 2VKZG 2BUNA 2VB6A 1KVIA 4BRPA 2V8VA 1U1MA 2X3DA 3MWTA 1Q78A 3ULEA 4F50A 2B8QA 2NZ4A 2KI2A 4KPYA 3V9XA 1K1QA 2XQCA 3BBCA 4ENOA 2ETJA 3QIPB 4RNHA 3TRGA 4K8XA 1RAAB 2FBYA 4DL0C 4LFBJ 3HI0A 4EUVA 2IMWP 2DGUA 4EBDA 4PL8A 2QG9B 3CO9A 3LGHA 1RBAA 3F5TA 1UZDA 3DLGA 3DKDA 3PR4A 2W9CA 1T3VA 5DZ7A 4KH6A 3I0SA 1FJCA 3MPWA 5JMNA 5IS2A 5B0AA 4XIUA 3UVJA 2GJIA 3CQXA 4IEEA 1ZBUA 4NXMF 3ILJA 2YY3A 3OS2A 2XHBA 2UVVA 2WB1D 4DR2K 1O13A 4B8CA 5HRSA 1V3ZA 2J0QD 2EFNA 2IC3B 2HBZB 2LA4A 3UN3A 4DR3F 1J9AA 1YHQN 5A2QU 3FMBA 5BPNA 3MM9B 2GQQA 2YKNA 2GX8A 1RAFB 2A18A 4F4KA 3TAPA 4DR1F 4JS5A 1FD8A 2GFFA 2E66A 1T9YA 4P71A 5CQGA 3K0SA 1NPKA 4NWBA 3D2WA 1QQNA 1RILA 5D0EA 5GAHP 1UKUA 1Z4UA 2UXDK 1U2VB 4FDFA 1HYSA 2JC1A 3A12A 3VAGA 2LVWA 4QIWD 2HWIA 3A3OB 4TQRA 3THWB 2GHWA 2BJEA 2D9OA 3FQKA 4LF1A 1L3TA 3OJSA 3VEZA 4DSEA 1LW0B 3VETA 4ZJQA 1RT3A 3CJSA 3G8SA 2XNRA 5DZ6A 1XMOK 4P10A 1R0BG 2D3OR 1JLFA 1E6YA 3J7YI 4CZMA 3UNYA 4DV2J 4ATNA 1DQ8A 4PG6A 1HMVA 3IWXA 1YVUA 3DFEA 1JNRB 2EVZA 2YNGB 3CIMA 1OH5A 2BQUA 3SMSA 4WFYA 5FPEA 1J5OB 3F56A 4MTPA 3E01B 4QIEA 4ZMMA 5EWGA 4K4ZA 4IH5A 2HPUA 2W9BB 2HHHJ 2HFUA 3ASMA 1LWEB 4AXJA 1DTQB 1ZA2B 2DHSA 3TW0A 4CGJA 1IKVA 2XLKA 4LY7A 2RILA 4H4OB 2FGOA 2J7WA 1HYVA 5HMYA 4UY8T 4WFXA 3HL8A 1IBMJ 3HT3A 2D69A 3NCIA 1RTHB 2YI1A 2FUG9 2FC8A 3MMAB 1RAIB 1R8PA 3JB9k 3O9SA 1PYTA 2O8CA 3H7HB 1Z2LA 1I5OB 1HD0A 1AYEA 4NXMK 1S1UB 2QM1A 2J8SA 3KXDA 4UOFA 1RLCL 1EKEA 1YXQA 4NZ6A 2W8KA 1E6VA 4R5PA 4DWIA 1HKGA 2YWWA 3UDCA 4LFCJ 2EFOA 2HMIB 2QN6B 2MZJA 4I4BA 1EB0A 1D9DA 3LDLA 2OCEA 1B9DA 4M1KA 3R5DA 4CTAA 4P6QA 1FVSA 2BM1A 5DLGA 3EUNA 5KFBA 3H6EA 1RT5A 1FJGJ 4YUDA 2YX1A 2HS3A 2MZRA 5C10A 1BA0A 1L3SA 2OPSA 1JL2A 2O8BB 4RW8B 1Q81O 2VIHA 3CD0A 5MLCQ 4CO1A 2QA4G 1Y10A 2UVUA 2FVCA 3S7RA 1XNRJ 2FD2A 4YDDB 2YBVA 3TX0A 1NDCA 1U48A 4NI2B 2QEXN 3FMWA 3GE1A 5BR9A 1HRHA 3JTNA 3OA9A 4IUFA 4WXWA 3PW4A 3FR0A 4DR4J 3Q22A 4O3NA 4ECRA 1TVRA 1UPPA 4K59A 1IQTA 1LAVA 3MWPA 4QPTA 4DFPA 1HQEB 1SJ1A 4DSJA 5KFRA 4ED4A 3M2RA 1Q8KA 1KHWA 1SAZA 4CEAA 4OZ3A 3N4PA 2Z2LA 4JNEA 1RDDA 4FXVA 2ZBIA 2CH5A 4M5DB 4LC9B 1P1LA 2GWKA 2PGCA 2IAJB 1WG4A 2DD8S 4CEDA 1LFWA 3PW0A 1WC5A 1NNEA 2KZZA 4HI2A 1HBNB 4MIBA 1TL3A 3ZZZA 1RSCA 4DU1A 1SS6A 3AJDA 3GV8B 2XZDB 1FI4A 3LO3A 1JXLA 1YBTA 1UVKA 2V4QA 3BPSP 2OI2A 4DHVA 3HRGA 5M2PA 1YDLA 2CPEA 4RWTA 2EK6A 3FFIA 4FF1A 2YPYA 3NMUA 5DGBA 4CHNA 2LXUA 2EC0A 3C14A 1RWUA 1T05B 5D4PA 4IQXA 5M2RA 2Q43A 4NCGB 3S9HA 2O8DB 2HIYA 3JSYA 4JV5F 4CJSA 3VQTA 4LSZB 4DX7A 1RWXB 3KJNB 1NPRA 4CD1A 1FXRA 3BEXA 2JGUA 3JXUA 3OXLA 3M3ZA 2EI5A 2RUGA 3LDSA 4JLHA 2GBZA 2VBWA 3LP1A 3CCVS 3JYTB 2XMAA 1WKKA 3OLAA 2OLWA 3SAGA 3SUNA 4KBOA 3GL1A 2BQRA 5J1EB 4OL8A 2VDHA 2AHOB 2HGMA 1UW4A 1RWKB 3WHIA 1T03B 4CZLA 2IS3A 3FQLA 1MSWD 4NZ7A 1Z26A 1OQ3A 1CS4A 5DMRA 3LAMA 4GVEA 4V19S 4GVLA 2HHQA 3W65A 1R89A 1IWAA 1BCOA 4K4XA 4JKBA 3TEGA 1N4LA 1VQ9N 2Z1GA 3DLKB 1LK5A 4QCLA 2E20A 3NWRA 2CUYA 2ZZMA 2R7YA 3G96A 5JMVA 2F96A 4TSXA 3EKSA 4C2MA 4X84A 1HWJA 3V9WA 4OYPA 3JSMB 2J7UA 1F9EB 2MYFA 1NKCA 5AXKA 1Y00A 3CPWR 5F0WA 2GEMA 1JIHA 3QO9B 3HK2A 4P2XA 4QR1A 1WJ9A 2IDLA 4XAKA 1M5SA 2DITA 3Q8SB 1TAQA 3KUHA 1BQNA 2OPQB 4MYUA 4IKFA 3C15B 4DG1B 1ZS6A 3UCGA 2UVRA 2CPIA 3DGPB 1LWXA 4KREA 1X8DA 4ZCLA 2GIFA 2V8GA 3OL9A 4K5RA 4ILJA 2OSRA 3CD5A 4FNIA 3CJKA 2ILYA 2CQHA 1PBAA 4G65A 2IM1A 2R7UA 1OMSA 1WG1A 1Y3KA 4AYBD 2M52A 3M30A 4P2MA 3DI6B 2ADBA 4MK9A 4IDHA 2H54B 4YN3B 5L9XA 5B0GA 4QWDA 4JV5K 4OO1J 3OTOK 3O3LA 2DPNA 2W7OA 3SQ0A 5DS7A 1UVMA 1GLFO 3HF5A 2BJ8A 4YFUA 1QAXA 4M41A 3TANA 2GA7A 4BRKA 5K20B 2FTRA 3CJ2A 3MEEA 1YLXA 3UN5A 1EWQA 3E66A 3TJAA 3CO0P 2YWGA 3IG1B 3BH7B 4R0JA 5KFJA 4KGKA 3HM9A 2CJAA 1UFLA 4U8YA 5G4DA 5DM6L 1ZETA 1Y4ZB 3IR6B 4Q2MA 4CJFA 1U26A 1UWBA 3GU0A 2WVBA 2CZ9A 1A5WA 4CEZA 5LSOA 4A61A 1RYSA 1BMQB 4Y2IA 3G10A 3BZKA 2CNLB 3FSXA 1M90O 3LP3A 4MK7A 1DKGD 4FXDA 2ZBQA 4U95A 4DUYJ 2VF3A 3ICLA 3C95A 2PFFB 3IS9B 4FWQA 1N0VC 4JI1F 3PO4A 4LR8A 3QSIA 2L3MA 3CDAA 1XR6A 1KP6A 4JI6F 4QW8A 2MKHA 2MKIA 1X9WA 3AAQA 3KOAA 3SFGA 2VWJA 1SH3A 3LF0A 3DU5A 3DLLQ 3CJ8A 4USMA 2RQMA 1QM9A 4CRJA 3DXKB 1RLDA 4KBIA 3CGIA 2K1RB 3WNHA 4IDKA 4DLGA 5GAGI 2PMZD 4CJKA 1IR0A 2DH7A 4LH5A 4HLBA 4DBQA 1S5ZA 2FHOB 2R8IA 4AD6A 1S9GA 2VWKA 1CULB 5ETTA 3HOSA 4DV7F 1SJ4P 4Y1CA 3WEEA 4CIFA 1NGBA 4CHOA 4CLYA 3CFPA 4RO0A 5LT5A 1SUQB 2FJVA 4A62A 3LWMA 2WAQD 3TR5A 3MDQA 3L95X 3POTB 1N33J 4AQYF 3I6PA 3UD5A 3OW2M 4K4WA 1UA0A 5HQLA 4J7CA 5HROB 2XYHB 1C1CA 3BBBA 2FY1A 4A2AA 4N41A 2J7KA 1T9TA 2GJFA 2I0XA 1PCAA 4QU7A 4UQGA 4CZEA 2YX6A 1VK8A 4AHTA 2CJQA 1RBSA 1W97L 3V6DB 2YH0A 3W5ZA 5C25B 4J8FA 4LSNB 2IBKA 4CLSA 1SL1A 3NGZA 1HNWJ 4HYKA 2ZH6A 2M2BA 2K8GA 1RCHA 4WKRA 4YOTA 3M6WA 1WHYA 3T5HA 4NOHA 2KHDA 1M5KC 2RS8A 1EQ0A 1FEEA 1S7IA 4HCBA 1NJXA 1EP4A 1I3OB 5AQFA 2BOAA 1CG2A 4WYBA 2FJEB 4KFBA 4JI1K 4DV0K 1TKZA 4KH0B 4TNOA 3M9OB 4JI6K 3GSIA 4DUZF 5AZIB 3F44A 3EN9A 4A5AA 1U1NA 1N56A 4I9LA 4NO7A 2L48A 1BDGA 3TWHA 2FHMA 1RT6B 5BRDA 4HUEA 1Q86T 1KHVA 3CDWA 3Q0AA 2WVCA 1EKSA 1HHSA 4KJIA 2PA3A 4J5OA 1WOQA 2KXFA 1Y64A 3PLAA 1K73T 2Y0SD 5ETRA 2VD3A 4JOUA 3FLCO 3ZZ0A 2HQFA 1A6LA 4DV7K 1JB0C 4Y34A 4HL9A 2QMUB 3T1HF 5KFNA 3QPIA 2UXCF 2GHVC 4DTSA 4O3SA 4WF9L 3BGLA 4CLUA 2HK2A 3DDNA 3JS6A 4NLSA 4JD2B 4AQYK 2KVQE 3CFOA 2DNLA 5L1KA 2IVOA 2VH7A 4A8FA 5KFXA 1VQ5N 1X4CA 2XGPA 5KG4A 2K3KA 3RU0A 4CESA 1VQKN 3VQ8A 4MFBA 2A6AA 1HQUA 3NLCA 2QJ3A 4I56A 5K14B 3UDEA 2GVDA 4C8YA 3THYA 3V4IB 4BE0A 4Z4FA 4DL4A 3RRKA 1VSIA 3QNOA 3PIOL 3N6NA 2GAHC 3PNIA 3L2QA 1NOYA 3ZNJ1 5J2PA 1NH7A 5J2NA 2EG2A 4LRCA 1YVNA 4KHPF 1F5CA 1G15A 2AJQA 3E9OA 1XBWA 4J9OA 4DHYA 1CJTA 3QATA 2H3EB 3OYHA 3I0SB 3H5UA 4M7XA 3MM5B 4OYZA 2QL9B 1FNOA 1WHWA 4CF8A 2IA6A 2JWLA 3TAEA 3SCIE 2NSBA 2DGOA 1K1SA 4JV0A 5IXUA 3DXBA 3QWUA 1UMJA 3R5CA 2E5LF 1U0HA 1UWAA 4DTJA 2C42A 4YQWA 4RW6A 1DBDA 3CVKA 3DGVA 4WPAA 4DUZK 5H9EK 3CB4A 2OMLA 3VESA 2V2KA 5C2GA 4PA1A 2VV5A 2W25A 2V9KA 4ZCMA 3GJQB 4RW9A 4GMJB 3IXQA 3SV3A 2FZKB 1JX4A 3AVKA 3LL3A 4JI8F 2ZHAA 4RUBA 4WFNQ 2HHSA 5HBMB 3MAQA 4LH4A 5LJ5Y 4DS5A 3DRPB 3BN7A 2JEFA 2QA1A 3AT1B 4EBEA 4H5VA 4GMKA 2ZJRQ 4ECYA 5BN8A 3M2UA 1CJVA 3P96A 5CYJA 4ZVEA 4E19A 3A5NC 3T1HK 4BR2A 2V0NA 2I38A 4OX8A 2UXCK 5KFDA 4NLDA 5C2DA 1Q16B 3ZCMA 2JFDA 1RP5A 3ADAC 5LSLA 1N52B 3K5PA 1HNZF 1XK8A 3DC2A 4DL7A 3SJHA 1WBDA 2D9PA 4K4UA 1E6YB 1FRJA 5HSPA 3SBTA 3SAHA 2DVIA 3BGRA 1NHUA 4TYBA 4BREA 3K7RA 1DLOA 5F8JA 2G0CA 4HTJA 2FSKA 5E3QA 2XHWA 4WCEL 4M63A 1Y7PA 4DSIA 5CH7B 4JI4J 3UWTA 2PI4A 3J8AA 3O8MA 1N88A 4LF5J 1YT3A 2E9RX 2X6SA 3EEQA 2IM3A 4G1IA 3F9KA 4FF3A 1IKWB 3MCOA 1S79A 3L2RA 4KHPK 1IQZA 4B1WB 2F9DA 5T14A 1UCNA 4M7YA 3X1LB 3KK1A 4RTFD 4NLVA 4EU0A 9ATCB 1S1VA 4OPAA 3MECA 1RCOB 2WW8A 4NLWA 4JI3J 3TUIC 1Z2ZA 4RW4B 3D5MA 2W2MP 3QFWA 1TKXB 4YB1P 2M4MA 4WZQA 2PSZA 2XSJA 4WU3A 3NNCA 2LSNA 2VQFJ 1YJNS 1WD6A 4R5PB 2XGQA 2IM0A 3VPZA 2BR0A 2OIHA 1KOOA 3KFWX 4DPXA 4BC5A 4DR7J 2VPZB 2WVDA 1UJ4A 2C2OB 4ZPCA 3QNNA 2RDDA 1CJKB 4JI8K 2W7AA 2VFSA 3B4DA 1X3MA 2Q2RA 3HFVA 1MROB 3KLGB 2Q3PA 1TL1B 3MM7B 1UVNA 1PJ7A 1DARA 3AFGA 2FJDB 1P9YA 5D0GA 2BH1A 4CEEA 5GADI 3VQ6A 1NOZA 3A0IX 2FJWA 1S1WB 2OFGX 4N7TA 5E26A 1K9MT 4CH1A 5IM0B 1KVKA 2Y1IA 1EARA 3P4UB 2DNHA 1IJEB 1WN7A 1SBRA 3G6VA 3VQDA 4RW7B 3ALYA 2PAVA 4E98A 4LREA 1GLCG 3L0QA 3TARA 1BLUA 4L74A 1BOTO 1HNZK 1H6KX 2YNIA 3QETA 3QAUA 4CNYA 3AH6A 2CQ3A 5LL6d 4BQLA 4JI0J 2F1FA 2GAGC 2ZM6J 2V4JB 3CJQA 2HHVA 1IUJA 1NK9A 1TVRB 2ZNZA 5J1NA 1Q18A 3PUFA 3T1AA 4EHUA 2HVEA 2XWYA 4G9ZA 4BRNA 1WF0A 3P49B 3SI6A 3QT5A 4U67Q 4KAZA 4BRHA 2DTJA 1B0TA 1N36K 2RS2A 1XNQJ 5IV3A 5HI7A 3W5XA 2NNWA 3ENHA 4FPIA 3ID6A 3TNVA 4AHRA 1YJ9S 4OKKA 4X4QA 4AL7A 1R8BA 4F0MA 5LMUF 2G8IA 2MZQA 1IJFB 4ETXA 2ITGA 1R6VA 2E1AA 2L41A 3FZMA 3MOZA 3SUOA 4RU2A 3BO2A 4EO8A 3AVFA 1RA7A 3CJ4A 3PXGa 3VZIA 3CDBA 4IFVA 3N4WA 2DGTA 3AA9A 2J9DE 1NSAA 2Q97A 5B08A 3WXKA 3SQ4A 3TAQA 3JQKA 2XMMA 3ZSZA 2RRNA 3Q8UA 1VQLN 5CZ1A 2E6LA 3ID8A 1NZ8A 1NGAA 1U1RA 4J2BA 2I7PA 4M3YA 3AY0A 5LY3A 2CPHA 2R2UA 2AKWB 1FRXA 4ED1A 1C1AA 2CQ0A 2CG8A 1T3OA 2FVQA 2PC6A 2PDAA 5KG7A 2LU1A 3BS9A 4JKEA 2AQ4A 3MCPA 3OTCA 4K43A 4C4WA 3GTYX 1RDCA 2HHPA 1MA9B 5TKWA 2BVZA 4C3MA 1RBOB 3Q89A 5D77A 2NQPA 1EX4A 3EM1A 2B8PA 2J0WA 5C42A 3ZO7A 3SYZA 1VRTB 3M6XA 4H03B 3BDPA 3MDFA 4WK1A 3CF5L 4CHYA 2ZWPA 2HNYB 1S22A 2RHKA 3VHQA 4XH1A 3ELHA 2RPIA 2FYXA 4CFDA 2RQ4A 5KG2A 2CPZA 4DV5F 1JMTA 4Y2CA 4OI1A 1IH7A 4QYZJ 2UV8G 4N8OA 4A8YA 3CCSN 1U8WA 2FSNA 4M3XA 4Y65A 2R7WA 5A0YA 2YHYA 2YCHA 2CJYB 3MEDA 4DI6A 3PTWA 2OP5A 1T6DA 1T95A 5JJBA 4BG9A 3UD4P 2ZKUA 2HZVA 2Q79A 5GAEU 2R7SA 3O3GA 3V5RA 3D7EO 4F3TA 2AF6A 4ED3A 4K25A 4PKGA 2G8HA 3V1QA 3KD1E 1FERA 5LMUK 5ETVA 5IWAJ 4CLFA 4PQAA 4DSKA 2ZVIA 1JLQA 5AJ3F 3OR1A 4NEYA 2EBEA 4K8RA 4ZN3A 3MMCB 3TYTA 1HYZA 3WIVA 1OPZA 1WC0A 3HXMA 5EXWA 3WBZA 2Q36A 1BQXA 1GX5A 2VZ9A 2PFUA 1OVYA 3CCLS 3K2PA 1ZYQA 5E2QA 1NU0A 4A8XA 2V2VA 4DV1F 4KHNA 4CHZA 4K0KJ 3SDEB 5KT3A 1RU2A 2H48B 2EG1A 3UCUP 4NCAA 1DQ9A 5CXTA 3V81A 5KFFA 4OJRA 3H98A 4MIWA 3R5AA 3BEGB 1IKXA 1SI9A 1N5YA 3OYFA 2EC2A 1Q1KA 3H3OB 2P8IA 2MSSA 3U3YA 4WFBQ 4XTTA 5J2MB 1KLNA 2V52B 4OX9F 3VGSA 3NH1A 4FOIA 1AT1B 1VQ7S 4UT4A 3D2EB 4OQJA 3L3VA 2HEKA 4ZLJA 2HBMA 1D8YA 2FVRA 1QVFM 2QMXA 3U27A 2JC0A 3QEVA 3NY0A 5D0HA 4DV5K 2VBXA 2AX0A 1WF2A 5BYQA 1FE4A 2CPDA 3DRRB 3CC2N 1HQ2A 4Y6IA 1F5AA 3M32A 3F0NA 3KK2B 2R7TA 4CE9A 2H5IB 3QGIA 3MI7X 1YTAA 3K5LA 5KFMA 3O9RA 2VC1A 2W42A 4QWAA 2ZUAA 3QINA 2DGQA 3QBXA 2JEJA 2R8KA 3VMFB 3JAMO 2BGGA 4JKGA 2G0IA 4CJVA 2M8DB 4HH1A 4B3TJ 4QWCA 2CXEA 1HNVA 3UO0A 4GVBB 2ZC4A 1Q7YO 2F4VK 3C7NB 5I9EB 4L3QA 1E4FT 5J1PA 3VA3A 2I5JB 5C0YA 2E1YA 1FHTA 1J53A 5AJ3K 3D2FB 4IDKB 2X3GA 4FJIA 1M1KO 3M1VB 2RKIA 3B8HA 4F36A 4HHTA 2O67A 5HP1A 4LRDA 2W2QP 4X66J 3G6ES 2IVNA 3GV5B 4IJAA 1L5UA 4C8LA 4QR2A 1UAXA 4OPHA 3EJMA 5KTQA 3N01A 2XYGB 4RG8A 2EBGA 1D1UA 3BF3A 4IH7A 4V19J 3EXCX 2ALZA 4DV1K 2NRXA 4NLGA 1TMJA 1KNZA 2BANB 5DDOC 4GKKF 5GMDA 2KHOA 3O9UA 3HPGA 3SQGA 4F67A 3MD3A 2MMYA 2E1PA 5KFZA 3QJJA 3AY9A 5FJ4A 4JKFA 3CNQP 1IKYB 1TTHB 4P74A 4OX9K 2WVFA 2HK3A 4LSLB 1REVB 4IRKA 3ILOA 4I1TA 3J81O 3CC7N 4OJHA 3KTQA 2DR6A 2XC9A 3JAMU 4FJ7A 2YKMA 2MKJA 1K47A 2XB2D 4RWWA 2RRAA 3EE9A 3BR8A 2WOMB 1SH0A 2GGPA 3WNGA 4A57A 3IM8A 2ERRA 2Y8YA 4PG5A 4P75A 4AM7A 3CMEN 4J9KA 2C2RA 1C0MA 3ZTPA 1UZHA 1JJHA 3PEHA 3OL6A 3RBDA 1AW0A 1V4TA 3AA5X 1LXJA 4XPCA 1NJWA 1KVCA 5L46A 4IG3A 3PIPQ 4CH0S 3OVBA 4KFBB 2GO8A 2P9NB 2F3JA 4KGZB 4MH8A 3QWPA 1TKZB 3PM9A 2FLNA 2CAJA 3OJUA 2OPPB 2ROGA 4F2SA 1FWLA 3NVKA 1S0NA 3NE6A 4OMFG 1YRXA 5IT4A 3TAFA 5LSRA 2BA9A 3MN7A 1ZXOA 2Z1HA 3UE5A 4HH0A 2XO6A 2NXEA 5B7WA 5KG5A 3H45C 4IEIA 3RW6A 1GX6A 1M90T 3FZ2A 1RTDA 3J7YU 1IO2A 5D8HB 3W8GA 3FK4A 5LMNJ 4WIQA 3OFHA 4YR2A 2RHSB 1PSDA 2MKKA 1JLCA 1FX4A 3O1WA 4H0OA 3OYJA 2F8SA 2CJXB 5JUMA 1KOHA 2GX9A 3J81U 3IAM9 3NKYA 1DEJA 2ZGYA 1VQNN 1QD1A 1W0HA 4ZVUB 3TEHB 5A8RB 2W7PA 3C6TB 2AP1A 1F2HA 2W8LA 4X4PA 4GKKK 1RA6A 2LCWA 1VGYA 3ULHA 4LFAF 2UU9F 1FWPA 1MN7A 4OYBA 2QT7A 2DY4A 4BR4A 3C2PA 2LQJA 1A7GE 3VQQA 1FX2A 1BI4B 1J6ZA 3IDHA 4CGDA 2GMHA 1MN9A 3H42A 1S4FA 1C0TA 1NJIO 3HP6A 4CO4A 1G3OA 3I32A 5J2PB 1RTIB 3EVOA 3C16A 1HBMA 4Q7AA 4O3OA 4WBFA 2CH6A 1RT4A 5AQRA 2VWBA 2U1AA 4WQ5A 3BKTA 4BR0A 1MWMA 4KV8A 1RT7B 3NGSA 3NXZA 2MZ1A 2ZH4A 3C6UB 5ETMA 1M1GA 5B0BA 4NE9C 1HIYA 1CEZA 2Y1LB 5HJXA 1XI1A 3VF6A 1RDWX 3VR1A 2W2OP 3N28A 2A1SA 3T41A 3Q7CA 1ZC6A 4FLYA 2DCUB 4I6WA 2XMWA 4ILLA 1RWVB 2RD5C 3W1YC 2Y9HA 4BWJA 3OR2A 1O1WA 2DNKA 2IRXA 1V4SA 2QKKA 4IKAA 3SBMA 5CAAA 4YHHF 3AAPA 2XMTA 3THPA 2R7QA 4CZHA 4WE1A 4UF4A 3L2VA 2KZMA 3VQ5A 2Z1IA 1VJQA 3FZKA 4I2QA 2Z0GA 5HRRA 3MD1A 1BQMB 2QTDA 3CUNA 2QI2A 1FKPB 3F73A 5AXMA 3R6LB 3EX7B 3CQ8A 3GCWP 2Q6BA 3AOAA 4X4RA 4ZP7A 3M2UB 3DM2A 3QGHA 4L8RB 3VCDA 3H2LA 4E1JA 4Z4HA 3KZBA 2FGCA 1RUSA 2V67A 4TXSA 2G8WA 5M1NA 4K2XA 4ICLB 2C3YA 1YIJN 3OT9A 1HFEL 3M2VA 3MAHA 1UOCA 2DXFA 1NGHA 1NHVA 2YNHB 2AP6A 3DXMB 1S6PA 1NZAA 1RFQA 2YHBA 3AD9C 4LFAK 4JK9A 4KKOA 2UU9K 1K8KA 3O9TA 2IIHA 1GLJO 4ILRA 5CYQB 1FA0A 4ZJLA 4RCHA 5LXYA 4BHQA 4ID5A 2IOCA 4TLQA 3O6WA 3KWGA 2ZJPL 1BA1A 2P9IA 2DBBA 3P31A 4NRTA 2IVFB 3G82A 2OEKA 2X51A 4O5BA 1KTQA 4N77A 5BR8J 2V50A 4NXNF 3C65A 1YJ7A 1F60B 2UXBF 4CHPA 4FLTA 1LK7A 3SCJE 3V6JA 5KFTA 2HBRB 4IOAL 3KK1B 2IBOA 2E7VA 4C6AA 2DHAA 3MECB 4OX6A 2CIMA 5LXRA 1TELA 3I8BA 4DV2F 3E9PA 3GFXA 3HFZB 2AU0A 3FGVA 3IRXA 2KVIA 3MR3A 5JVHQ 4LIRA 1NH8A 1RBUA 5CD4H 4DV4F 3T3FA 3LPTA 3OYIA 4X65F 1R8AA 2ZH3A 1TYQB 5EX0A 2Y3YA 4YHHK 2HHHF 3VZHA 3I55N 3EPIA 2A10A 4AHCA 3DRSA 3FSIA 1DY3A 2F65A 3N6LA 1ZOTA 3GIIA 1C0FA 4BACA 3H5SA 4AL6A 1SB6A 1QHAA 3MN9A 4CZGA 3QIPA 5D3GB 4DLEA 3KLEB 1KTVA 3A4TA 1IBMF 4I69A 5DQHA 4YY3F 4ZIWA 1HD1A 1GNKA 1V3RA 2V8DA 3UI3A 3GFYA 4X4SA 1NK5A 1GMUA 4DX5A 3C6HA 1I39A 2EFQA 3GIKA 4Y0WA 4QOZB 3M7VA 5JVGQ 2WK4A 4O23A 2CNOB 4PUOB 3QGPA 1WSIA 1QLNA 2ALYB 2LXFA 5E5NA 2Q1NA 4GV9A 3KLFB 4CZKA 2HQCA 2KJWA 2P5VA 3HX9A 2YHXA 2C1EB 3EKUA 4Y2AA 2CVIA 3JXOA 2HZCA 5C5JA 3KG0A 2VDIA 2IC3A 4EAHD 5CCMA 5LJ3Y 2J9DA 2MLZA 3S41A 3IFRA 5HL7L 2BBEA 2LLZA 2O4IA 1RHUB 1HW9A 2ZITA 3MM9A 1LAWA 1NGGA 5AQUA 1QDUB 2VJVA 5AFUH 4LBIA 3LPYA 3MM6B 4QS7A 4DTRA 4DR2J 4DPUA 2OD6A 3GONA 4NXNK 2OUGA 2DJWA 3OTEA 2KT5A 2UXBK 2JNJA 3JS9A 1A0OB 2CDQA 4NLOA 4O8UA 2H4YB 4ISEA 3AGRA 1VSJA 1U2VA 4GO7X 1YK9A 4FJGA 4DPWA 4M5LA 4KTZA 2WC9A 3THWA 3D1QA 1NKBA 3OS1A 2DNOA 4ECWA 3HULA 4MDAA 4D3GA 4DR4F 3CDEA 2LKZA 1LW0A 3CCMN 1TU0B 2M3DA 4DV4K 1ZM4A 4PPDA 4X65K 3HZ6A 1TK8A 1TUGB 1SKSA 2UXDJ 3DOMB 2HHHK 1SIWB 4JV1A 2YPZA 1YJRA 2YNGA 3H1VX 3J7A1 5GINA 2H3GX 4E1NA 1ULRA 1J5OA 2MY7A 2OH2A 1ZPVA 2MEWA 2W9BA 1N0UA 1DAXA 1OSDA 5HQ8A 1XMOJ 4PR6A 4C8ZA 1RHRB 1DTQA 4CBWA 1H7WA 4KHSA 3U4LA 3CWJA 4A47A 4YY3K 4H4OA 3IRWP 2NRHA 2EWSA 4FK2A 3B78A 1VIOA 3DU6A 1NUEA 3QT8A 5T7BA 1RTHA 2XCPA 2XBPA 4TLRA 3MMAA 1AA1B 2BX6A 5EWEA 4M5JA 3PO5A 2VG7A 2VONA 3OYGA 1S1UA 5DLFA 3QEXA 2XM3A 3O4QA 3ZT4A 2RT3A 1KAYA 3QFPA 3VGMA 3R5BA 2IDOA 1HKBA 3HSZA 2UUCF 3RMCA 1BXNA 2FZCB 5U47A 2KLAA 4F3MA 1JJ2M 4IOBA 3EY1A 2QWNA 1X7VA 5GAGU 2BW7A 4NL5A 1KQGB 4NXMJ 4ZTFA 3I9ZA 3D6TB 4WP9A 2DT9A 1O5JA 3VQBA 5KI6A 1QZ6A 4CJTA 1TUWA 1OH7A 5SUHA 2H4WB 1ZTWA 4F2RA 1YAGA 4FKXA 1GLBG 2O8BA 4QIVA 3AVLA 4RW8A 2IVYA 1CSJA 2VBZA 4FW1A 3QFUA 3HYFA 4AE5A 1KAXA 3RW7A 5G0RA 3CJ1A 5ETOA 1UTAA 3P39A 3P3DA 1LFPA 3NBPB 3KG4A 4NI2A 3QEIA 2E5IA 1MMDA 2PYLA 1AB8A 2WRMA 4GC7A 5LL6Z 3LDPA 1VC5A 3LP2B 2VGMA 4JN4A 4LMZA 4WQ4C 1HQEA 2BXJA 3OBWA 4BRFA 4RBVA 4ZA1A 5F9NA 3WQTA 1I3AA 2E29A 4TU8A 1FDBA 3G71S 1P1TA 2XCAA 3H3NO 5KT7A 3UR3C 4M5DA 4JP8A 1C4CA 3OVNA 1EHWA 1IJJA 2IAJA 3GE9A 2X7IA 2LA6A 3MMBB 2R42A 4EK2A 4AH9A 3GFHA 2DFFA 3J80Y 1HBNA 2QLJB 3G8TA 1VQ4N 2RU9A 4E2FB 2D3ZA 4Q8EA 4C8OA 3SXLA 3AAWB 3EMTA 1RBTA 1FRIA 1KSPA 5HRPA 4DPOA 3H2VE 3HCXA 5A8KB 2DB1A 1N6QB 5KFWA 3L3UA 4Z2XA 3M8SA 3T5JA 3O08A 2NXJA 2UUCK 4KGXB 2V2ZA 5KAKA 4WTOB 3E9LA 5A6PA 4Z37A 2AJFE 1WC1A 1WF1A 4RBTA 3CD6S 3KIOA 2RRBA 3N9UC 1T05A 4NLUA 5K8NA 3GFZA 1ZAXA 1UAWA 4CK3A 4OYXA 1TKTB 2FC0A 2O8DA 4JKGB 4H4MB 2Z57B 4BGBA 2DFHA 1RT1A 4DV3F 3G6XA 2QYGA 4M5KA 1EQMA 3J7ZT 4FYVB 2ZE2B 2LYVA 1TK0A 3OL8A 1FD2A 1OY8A 3K5NA 4CFCA 1VSFA 2ZBCA 3P5BP 2VJUA 3KUEA 3JYTA 4PXCA 1S72S 4GO5X 4U7BA 4NB4A 3W63A 2HURA 4OHXA 2OPRB 3EGWB 4XDDA 5J1EA 1XWLA 2RSQA 2DRDA 2M9KA 1DHMA 2FHJA 2CQ4A 1VBZA 3T19A 1T03A 3KJFB 3AVNA 1HHQA 4M5GA 3D28A 2QV6A 4XK8C 3PJXA 4Q0BB 3UKUB 2M70A 3J80O 2P9EA 4FZYA 1XMQF 1MNEA 1RQ0A 3RR7A 3FBCA 3ZX2A 3DLKA 3AVCA 1U8SA 4U7UD 3OYEA 4UY85 4O4GB 4BCAA 2ZZTA 2XG8A 1VQKS 2VOOA 4MO5A 3LA0A 3QRQA 2A0FB 4CVNE 3OSNA 3VQ7A 1ASVA 3NDKA 3JSMA 5B8HA 2P5GA 3FEXB 1HI1A 3PG9A 2L9NA 2DXEA 1B7YB 2H51B 2MQMA 3QO9A 1GTEA 2ILZA 2ZH9A 1U49A 2HLUA 4DL3A 2OPQA 4IFYB 3PJWA 1Q5YA 3MX5A 4YDUA 4WU2A 5GAEP 3HVRA 1YBUA 4TVAB 1KQFB 1N33F 1LNQA 2G2ZA 2ZEJA 3OW2R 4N76A 3EE3A 3D0IE 5EUHA 3HDSA 4LQ3A 2WFBA 5DM7Q 3D6HB 3DLJA 1Y11A 4ZP9A 1CZAN 3W9IA 2G1HA 2F9TA 1BG3A 1A5XA 1MLAA 3DI6A 2AD9A 2MSTA 3MCSA 3V6KA 4JKHA 5AR0A 4Z4GA 1P8ZA 1K8AT 3CFRA 3ZT0A 2QK9A 3J80U 3ZYYX 4DV3K 4BE2A 4V1Ak 1VRQC 4BLGA 4GKJF 1VSHA 4B3OB 2K7KA 3PKMA 3FRYA 4RJVA 1LV5A 2V7ZA 1CQNA 4ZCIA 4ZTJA 4WYLA 3IG1A 1CC8A 2BJ9A 2VFTA 1RTZA 4Y00A 3EYZA 4JV5J 5E84A 3L2UA 3OTOJ 1RABB 1AZSB 3ZT2A 2J6SA 1I94F 4DR6F 3CE8A 3ATUA 3FZHA 2JVOA 1XQSC 3R3TA 5JLFA 1N5TA 4FJ9A 5F0UA 1JLCB 3N0VA 4FWSA 4MMOA 2GUIA 2RJZA 1XMQK 1H0HB 3LQVA 4K4TA 1NK0A 1D9FA 5HK4A 3MCMA 2ZHOA 5FIIA 2BOPA 3IS9A 1WSVA 4FYYB 1GFWB 4LBHA 1NK6A 3L4QA 4C1NI 1YJTA 1M1KT 2EFPA 2YQ3A 4FJNA 5HLFB 2ROPA 4BDPA 3SCKE 1EO1A 2G9OA 2Z56B 2NSCA 2XWXA 3DXKA 1UVLA 3TA0A 3W2VA 1HI0P 1H2VZ 2V63A 2QL5B 1QHTA 1NNDA 1NKEA 2OFHX 2AJ4A 2LQ5A 2K1RA 3A2FA 4CLPA 4RKUC 2CWKA 4FBUA 2KN4A 3VQPA 2GV1A 1CULA 2DHGA 3GG1A 3S01A 2Y0BB 3CPWM 4M3RA 2OSQA 1SUQA 4JI5F 3VEOA 3SCXA 2NS1B 2YTCA 2WSFC 1HWLA 3AOCA 5H9FJ 4AF1A 3TA1A 5HROA 1YRTA 5FD1A 1GXUA 4BGAA 3W8PA 1H1VA 4FJLA 5GADU 4LVNP 1OVQA 3HJFA 4PG4A 4CT9A 2IRUA 4DL2A 2AV5A 1W25A 4GKJK 4KC5A 2KYZA 4PKIA 5F8LA 4PWUA 2BJ1A 1PKUA 2KO1A 5D78A 4CCHA 3GIJA 3V6DA 5I42B 4WCEQ 4LSNA 4DZDA 3CXCR 3ZSQA 2OMOA 3Q83A 1NDLA 2NZCA 5KFHA 3AD8C 4AL5A 2AIRB 5KFCA 4RPFA 1RHJB 1AFJA 1KQKA 1I94K 4DR6K 4FBTA 3WQPA 2VHGA 1Q8IA 3K5MA 3TJ9A 4LT6A 4DV6F 2KU7A 3MHYA 4KRFA 1ITGA 3HKWA 3M2VB 3TPQA 3I31A 4EI2A 1FCAA 5F8MA 4BROA 1QE1B 2HKEA 4WXOA 3CIZA 4YDXA 4FJ8A 4BVOA 2MJNA 4JAXA 4KKOB 3BR9A 4E8UA 1GTHA 3VEVA 3K58A 2IFXA 1ATRA 4DCOB 5AZIA 4IR1A 2E9TA 3NCQA 2BJDA 3MPUB 4CFBA 5AQTA 3UR0A 5DDPC 2HGNA 2HNZB 1RT6A 3UDLA 2LQBA 2F9JA 3VF4A 4DUTA 4UUWA 1IWGA 4JI1J 4TY8B 4DV0J 2UUTA 4TU7A 4W92B 2K3IA 5J2QB 3SIPB 4JI6J 2PIIA 4C11A 4BR9A 1RGVA 2HRYA 3CCVN 3RR8A 4Z0UA 1N5VA 2X6NA 3K57A 1SQGA 5SWMA 2JLEA 4JI5K 2MJUA 1T9XA 2BKPA 3G2XA 2DNQA 5T41A 3IRXB 1KWMA 2DR9A 2V51B 3J7YP 1J5EF 4ZPWR 3LZJA 3OYCA 1VQLS 1OQ6A 3RG6A 4F3OA 2O8FB 4Z4CA 3EGVA 3JSBA 3WIUA 2V4RA 1QTMA 4DV7J 1SC3B 2YKAA 1EKRA 4FPRA 3DRSB 1NBEB 4PABA 5F41A 3R9PA 3NS5A 1QY7A 2B7CB 4YORA 2C2ZB 3WXLA 3ZZTA 5K14A 2P9PA 4ZVPB 3MUMP 4AQYJ 1OWXA 1X5SA 1TAUA 5B0FA 3V4IA 5BYSA 2OEJA 5IT9Y 3CD7A 2KL8A 2WW4A 3VEXA 4MQ3A 1NM2A 2A42A 2QL7B 3KMSA 4OLBA 4KIAA 1SQFA 3AO3A 2NXUA 5KFYA 1ASWA 3F2KA 1Q82T 4H0XB 3CI5A 2DH9A 2ZHBA 2O5DA 1U1PA 1RGIA 4DX6A 3MM5A 4DV6K 3QSYB 1S59A 1OY9A 3HZGA 2DNNA 4B1VA 2AJ1A 4N5SA 1SIZA 2QLXA 2N82B 5GVQA 4FM2A 3AV9A 3K8WA 2W6KA 3DWLA 3M4XA 3OL7A 4F04B 2DNPA 2GNKA 3C66A 3KKRA 3PW2A 2D7SA 2XRIA 1K9MO 3Q2SC 2P9CA 1T9UA 3W64A 2PYJA 4LF7K 1EQYA 2B5JB 1B99A 4H5RA 1KKHA 4QQBA 4JHDB 3CCRS 2ASLA 1JLAB 2NPIA 2FJXA 3HZEA 5AXLA 4L73A 4YOUA 4CYUB 3KNGA 3FBEA 3I8DA 4HKQA 1WTFA 2HF4A 3DYAA 1SV5B 4HCCA 2B4OA 5HBMA 3HHLB 1XC3A 1VBXA 1YZ7A 2RE1A 3BH6B 4RNMA 3DRPA 3W9JA 2P9LB 4DUZJ 5H9EJ 2BTFA 3Q8RB 2MHEA 1RADB 2XI2A 2C22A 3T7ZA 2ITMA 4M3UA 5IT9O 3TVKA 1FVQA 4L3NA 3D1OA 3UW1A 4BRCA 1OH6A 2ZWHA 2AEFA 4LRFA 1PILA 2DRBA 3OY9A 4CECA 4JRQA 4I67A 4AHSA 3B82A 2XI3A 1RWMB 4ZDNA 1J5EK 4CF9A 1A5VA 2ROEA 1YRUA 4WK3A 1VBKA 3W7BA 1QVGR 2FVPA 2PA8D 3SSQA 2W41A 4FF2A 4QR0A 5KFIA 4ID8A 5ETNA 3T1HJ 2A5XA 5M1FA 1RACB 2UXCJ 1WWHA 3C3LA 2CQDA 1NPPA 2NRZA 2W4PA 3S1TA 1X4FA 1K6YA 3E51A 5KFOA 3KG1A 1R8CA 5HMXA 1KCFA 3EE8A 4IWVA 3K2YA 3EZ5A 1GMWA 3AVIA 3O44A 1FFWB 4PQUB 3RWUA 2Z8QA 1W26A 1RBVA 4OX7A 1IKWA 3PYGA 1ZBFA 1N48A 4RUCA 3E2EA 4HACB 1YQHA 2Z4PA 4LF4F 3CEDA 2RH3A 3BGFA 4K8ZA 1SVDA 5I3QA 2GW8A 2CA9A 3ZEUB 1NDPA 1QAYA 4ECQA 3NL0A 3KLHA 1KAZA 4RW4A 2VG7B 3PRBA 2RDIA 1ZTTA 4DTOA 4W5QA 2HNDB 1TKXA 4ZVFA 2PE8A 4YB6A 1GLDG 4W98A 4CO3A 1N32F 3QERA 1B3TA 3L4BC 2R8GA 1JLEB 4KHPJ 1VSKA 5KFAA 4LR9A 3ET6B 2Z2MA 2D0OA 4DR3K 4JRPA 4P73A 2HWHA 5IT9U 2R2RA 3M5RA 4A46A 4YOEA 3VAIA 3T1YF 4H0VB 3VQ4A 3VA0A 1NK8A 4PWWA 3PACA 1V5VA 4DR1K 1CJKA 2VG6B 3F9MA 3NRBA 1CJUB 1SPBP 4CJLA 2ZH5A 1MROA 2DKOB 3KLGA 1TL1A 4PPZA 3MM7A 3VERA 4HTUA 4EGLA 4ETZA 2RQCA 1X4GA 4DCHA 2NUUG 1FE0A 1S1WA 3DDKA 2KTQA 5IM0A 5C2CA 4C48A 4JI8J 2UUWA 3AXKA 5G0RB 4RW7A 2YNFA 3GYXB 3O80A 1IVZA 4KAIA 2NUHA 2WSEC 3U1LA 2MZSA 3I87A 1RT2B 2DO4A 1H38A 1L3KA 1LWCB 5M2UA 4CBUA 3BO4A 4AT1B 2V4JA 1QUPA 2L9WA 3PFEA 2OZSA 3Q8QB 2QLWA 4NLPA 3TTFA 4FVUA 2E88A 3ZZOA 5C24B 3R7BB 1JJ4A 4MIAA 4OHVA 3B6OA 4FJKA 4O5FA 2BE2B 3R27A 1HNZJ 2Q1LA 4NLXA 3TU5A 1EETB 4CF2A 2LMIA 2JVRA 3MXMA 2VL1A 5A6WA 2O1PA 2N3LA 2D3O1 1HI8A 4U96A 4LF4K 1EWRA 4NCBA 3PRDA 3BSOA 3ZZUA 2VG5A 3DOLB 1JJCB 4OJ3A 3ENBA 3NF6A 1N36J 1F2GA 3QNWB 2DNRA 1ZH5A 1GXTA 2EHGA 2D41A 1MU2B 1N32K 2FB0A 2IIRA 5AQQA 3A8EA 3CMES 2ATLA 1C1BB 3W9HA 4KGMA 5BPMA 3N5BA 3VGLA 1NDKA 3GWCA 3AHPA 3RAMA 3TUZC 2WSCC 3PX4A 3T1YK 1PAUB 4WQ5C 2GQCA 2HHUA 2PZSA 2GIRA 4HHHA 2WONB 1NJZA 4BRQA 1NK4A 4MLHA 3HO1A 1VHIA 5B09A 4C8KA 1RT1B 3EDQB 4WFNL 4WFAQ 5HVFA 3RTVA 3HP9A 1WC6A 3SUPA 1T9VA 2PMWA 3QBCA 1QVFR 4FWLA 3QEPA 2IDEA 3PR5B 5M1KA 2MQPA 1VRTA 2YH1A 3UKRA 2ZJRL 1FW6A 3ZZRA 3NNAA 3SQ1A 3V1OA 3GB0A 2HNYA 2HRUA 4C8MA 4CZIA 1FFGB 2P2CB 5C15A 3IWLA 2MY8A 5D6GA 1VHXA 4AILC 1UVJA 5KG3A 1PYOB 3NEKA 1ITPA 4BG8A 1ZBTA 1ASUA 4HUGA 3KKSA 2CNNB 3E8OA 1UA1A 2WUSA 5HAOA 4B9UA 1Z05A 1NMNA 2NCKL 1VQNS 3OYDA 4LVOP 1RDRA 5EOYA 2OTLN 4PL7A 3QFHA 4OZ0A 4G6VB 1TZ0A 1S99A 1TL5A 2HQIA 1Q9XA 5D15A 3LH2S 2RF2B 4Y28C 2GVZB 4ED5A 4CGIA 1WC3A 1F0XA 1RU1A 2IA0A 4MLEA 5KFSA 3KYLA 4I68A 4M8LA 4DU4A 2FXUA 1VK0A 3DHWC 4IG0B 3ZTSA 5CYMB 1XUPO 4KHQA 1SL2A 4LBPA 1V6HA 5GAGP 2BABA 4CT8A 3ZETB 1S9EB 1G2EA 4QU6A 4CZFA 2E5GA 4OI2A 2HRTA 1YITS 1U45A 3MMCA 1C4AA 1TV6A 3M8QB 2IYGA 1N34F 4FCYA 3PW5A 2CPJA 4JYAF 1U2FA 2A2CA 3LOUA 5AQYA 4XH4A 5LMUJ 5AXNA 4HT5A 4MKBA 4IZ9A 1YBAA 1CQMA 2COLA 3PX6A 2HQ3A 4DL6A 2I7NA 2FVSA 3OTDA 3SFUA 1T02A 5C12A 1IV0A 3SDEA 3KHYA 1DURA 2IMOA 5K9FA 2MPUA 3KHRA 3ITHB 3TVYA 2P1JA 1Q79A 2H9ZA 4J9MA 3Q24A 1MW7A 4TYAA 2HW3A 4AXIA 1FJ7A 3TUJC 5J2MA 4ELVA 1Y5IB 4O3RA 4GV3A 1SCJB 3NVMA 1KONA 1VQ8N 2CQGA 2W2NP 3EXYA 1QZ5A 3D2EA 4CERA 4BC9A 3LUYA 1C2PA 2FHJD 4BRAA 2KJVA 2BMBA 3S8SA 3IN5A 2FC9A 3L7PA 4FWNA 2Q31A 4M45A 3U9DA 1JKHB 1VJWA 4J9SA 1U1KA 4ZPTR 1NSQA 4CLWA 2I1RA 1B9FA 2DTUA 1NGJA 1O0PA 2CDRB 1R6YA 2W4DA 3DRRA 5DO2A 2ZF5O 4YP3A 1X5PA 3NS7B 4WJBA 8ATCB 2A1RA 3MXHP 5LOQA 3KK2A 2W2PP 3AO4A 4B3SF 4LF8F 4H5TA 1YJNN 4H0TB 2RMLA 3TZXA 4U67L 3PHEA 3MXIA 4DV5J 3RMBA 2BKOA 1RAHB 3QB0A 1WKJA 2APOA 2NRTA 2A2DA 3EGNA 1HNXF 3BF4A 4GVBA 1F5BA 3AXMA 4J9UE 5KFGA 3KUGA 4G3IA 4X4UA 1SJRA 4H4KA 3C7NA 1IBLF 1VIXA 2JLGA 2ZOMA 1APSA 3NCPA 4CP5A 4JI2F 4P72A 2I5JA 1B92A 3W2VB 2XY8A 4P7VA 5L39A 4X64F 3OFGA 1CXQA 3D2FA 1KRPA 3C0BA 1WOSA 4A2BA 3M1VA 3PFOA 4RBUA 4OPJA 3IBCB 1N34K 3FGUA 3RMAA 3OBIA 5LM7E 4USUA 2XEXA 2F4VJ 2Q3SA 4O8KA 2D3UA 1X9SA 4JYAK 4IOCQ 4H8KA 5KOXA 3RVCA 4KHYA 1WTBA 2UUAF 5AJ3J 2E2QA 3H8YA 5F1XA 4LF9F 3BZCA 4B9SA 3BQ2A 4K2JA 1SC1B 2WB4A 2BANA 2EX3A 1RDBA 2X74A 4GNIA 1RDUA 2VBYA 2ZC3A 1V3SA 4CJRA 4BC2A 1IKYA 3I33A 4LSLA 3BBFA 2NZTA 1REVA 3RGIA 3R5JB 3VV2B 2J76E 4DV1J 5AQZA 1QQMA 2VQEF 2XO7A 3AB2B 2ZJPQ 2P6SA 2VGNA 1YJ9N 2OGUA 3THXB 1HR0F 5M1OA 2WOMA 1G4CA 3WQUA 3O4WA 3VVUA 4X4TA 1LEOA 3ONQA 2DISA 4OX9J 5KT2A 3GV7B 3RYLA 3OYMA 2ACYA 3IA0A 2NYHA 4YB7A 4B3SK 4LF8K 5KRTA 3Q86A 3V6HA 4ZKAA 1KD1O 3HFKA 2P9NA 3HHDA 4DFJA 4AHVA 4CIEA 1HJOA 3H2UB 2EPIA 1VSLA 4IRCA 4KI6A 2QX0A 2OPPA 3NF8A 1HNXK 4CD3A 4B3RF 1D3WA 3OUYB 1QTNB 4CZJA 3CCJS 1RBLA 2D0CA 4CJEA 1IBLK 2GO9A 5KFQA 3B8AX 4CEFA 2BRKA 3B54A 5BN9A 4JI2K 5FLXO 2VKRA 1SL0A 2G8VA 3AVBA 1ROFA 4LD0A 1S1XB 4CZCA 4X64K 4PXBA 1JQGA 3M6UA 4C11B 1ZBLA 2HBKA 5BRFA 1Y5NB 1FKOB 3BGOP 4ZP6A 5FROA 2QWOA 2LXIA 2AJ2A 3HHNB 1VK3A 2MGZB 3KWMA 3FCWA 1LQ9A 2FBTA 3R7SB 2D4WA 4B3MF 2UUAK 2VPYB 4PY5A 1NGEA 4KHRA 1BWFO 1T3NA 4LF9K 4DTMA 5A8RA 3AODA 3C6TA 3GPAA 4B9VA 3CCMS 2P9UA 3I4HX 3IWNC 3VQCA 3DLBA 5BXIA 3BO3A 1S77D 3MM8A 1Q53A 2UZAA 1PC4A 4J2EA 2HAIA 1ZM3A 1FK9A 3Q8VA 4BE1A 2P9PB 1BI4A 4WFBL 1RWWB 1TFWA 2C2DA 2P9GA 1U25A 5FRMA 5B0EA 4FZZA 4I9QA 3QZ7A 4ES3A 4JUZA 4FP9A 4O44B 2W4CA 4GKKJ 1HJRA 2VQEK 2B4PA 3J7AN 3IM9A 4LF6F 1RTIA 1OO0B 2GZOA 1VYAA 3HJVA 4NA1A 1HR0K 5CCLA 5I3PA 5I3UB 1I1GA 1Y5LB 5C7PA 1RT7A 3S6EA 1ZPWX 3C6UA 5FLXU 4HHUA 4KB0A 2MKYA 4NRUA 2R4FA 1KLMA 3NG8A 4E7KA 4LJMA 3NGTA 4ER8A 2WZ1A 4GRSA 2CJBA 1KQSR 4CJWA 4USJC 1RKJA 4B1UB 3FE1A 3PY8A 2IY5B 4ISGA 3WT0A 4IXCA 1R8HA 2R7RA 1BISA 3CCLN 3UNGC 4B3RK 3A1YG 2V94A 3TSUA 3M8YA 1MWQA 3FZLA 3E3XA 5HVGA 2ZH7A 2F7VA 1NHKL 4QW9A 3DYAB 2RE2A 1B0VA 3W5YA 1BQMA 1S97A 4CJ7A 3I0RB 3OBYA 1FDDA 1FKPA 3PZPA 3DHXA 3KK3A 2Y1JA 5L1IA 4FWMA 2C2NA 2VFVA 2HBJA 1WI6A 1VQ7N 1IR2A 2DPIA 5GADP 3ZSXA 1FRLA 3G87A 4K4VA 2N7YA 3NHGA 1VS3A 4CEQA 4KSEB 5ETSA 3ZSOA 3N4QA 4ICLA 4B3MK 2A40A 2JX2A 2V8HA 1RE1B 2B9YA 3GIMA 1VRUA 3IUCA 3CCTA 4GY2B 3R8EA 1P90A 2YNHA 3DXMA 2PY5A 3LP0A 1VISA 2JFKA 4DCPB 3HSCA 4DQQA 4DR5F 4EIAA 1F9HA 2JWNA 1WSRA 3CJTA 3RB3A 1YF5L 1OS5A 4B1XB 3L3CA 3CPEA 1F9FA 4CO5A 5CYQA 2GV9A 2D5RA 3EZOA 2K06A 4B08A 1ZBSA 4ZCKA 1FO1A 3P4IA 1T11A 3K0JA 4OJ1A 4F9OA 3DOKB 3HHKA 3VQAA 4LFAJ 4LF6K 1DTTB 2J0XA 2UU9J 4HUFA 3OD2A 1CBKA 1T0TV 4JEPA 3AO5A 2VODA 4ZJOA 1VQ4S 3KLHB 1BGXT 1ACMB 3P5JA 4UQTA 1XTZA 4FLXA 3P83D 2XS5A 5E0OA 2V34A 4MKYA 1Z1ZA 3P8BB 1PIEA 1VC0A 3V1RA 3VEYA 2E5LK 2B9EA 2CADA 1TYQA 3LDNA 4O4RA 5CHIA 2DY9A 4KHMA 4BR5A 3AD7C 2G8KA 3LDOA 1TGOA 1ESVA 3GR0A 1HUXA 1NGIA 4NA3A 1QS4A 4DMNA 2Y1RI 3RB6A 3LPEA 1YUWA 4ES1A 1P8GA 1VQPS 4X4OA 3DMJB 3M9MB 3VF0B 1ZA1B 1PC5A 5D3GA 3KLEA 4EYHB 3U02A 4CDIA 5H1SV 1VQMS 4I7FB 3TQ1A 4FYXB 4I64A 1CC7A 4YHHJ 3LTOA 4A59A 4K42A 5BREA 3RBEA 3O3HA 2GIQA 1JLGA 3FSYA 2QA4S 1R0CB 3GYNA 5GIPA 3W62A 2HZAA 4U7UK 4NYPA 1YTYA 4LR7A 1HWKA 1G7CB 1QSLA 3EGZA 2YNFB 4PUOA 1H74A 1PO6A 5CR4A 3KLFA 1JJ2R 4KPCA 4WTYA 1NGFA 1ZZNA 2KFZA 4DN9A 4DR5K 3B6PA 4DQIA 4C23A 2MXYA 1X1PA 3TSQA 4OYOA 1E4GT 3O6QA 3NF7A 1R0AB 1GMWD 2E1CA 5AE1A 3MM6A 1WNSA 2NLWA 3MMJA 4J2AA 4RR5A 1EIYB 1RI7A 5ELZA 1NEEA 3TJ8A 2E7XA 3MPVA 3IR5B 2FF3B 3D66A 1NXIA 5AQMA 3OVSA 1U47A 2O66A 5HMWA 4DQPA 2B43A 4FYDA 2VG5B 5LJVA 3V9SA 1U1LA 4XO0A 3SCLE 4ZVRB 1ATNA 4NXNJ 1X4BA 4C3KA 2ZDPA 2UXBJ 1GQEA 1HBOB 2AZ1A 4Y2MA 4QAGA 3TAMB 4JS4A 1VHFA 2V2QA 3HLUA 1LWFB 5E33A 3U9ZA 5M1PA 2D74B 1Z25A 4IH6A 5GIOA 1CLFA 4PWDB 6FD1A 3DOMA 2M88A 5TKYA 1RXOB 3KJVB 4JV2A 5EX5A 5IT0A 3CC4N 4FJHA 5EN1A 5EDWA 4DV4J 3SLCA 3MFIA 4X65J 4FKYA 1JK9B 4ZK7M 1JLBB 4CM0A 1JXBA 4QZVB 4NA2A 2KYXA 2LQ9A 4ZPBA 2VYPA 3FZFA 3UKRB 5FPDA 1SC4B 3FC9A 1YX2A 2QIFA 3M8PB 2ZH1A 1SC6A 4CJ3A 3MN5A 3RAXA 1XC9A 2OTJS 3NFAA 1WB9A 3J7ZO 4YY3J 1K44A 2XMUA 3MR5A 4GW6A 4NYZA 2DY1A 2O01C 4ECUA 3HSGA 1W2BR 5HN0A 4EEYA 1IM6A 1OKJA 4ID1A 3SBGA 3GCXP 4Y1DA 5AQJA 4L76A 3HVTB 4NYOA 1RZMA 4WIIA 4L3KA 3TA2A 2CQIA 1H98A 5KPRA 4ISFA 3PRVA 2CPYA 2W9AA 2KXNB 2D1KA 2XY5A 1J54A 3ENAA 4CGHA 3VENA 2BE7D 2QWQA 1NU4A 1BCMA 5DGAA 5I4MA 2G2OA 1ATSA 3AVHA 2OELA 4D3HA 3BPDA 4KB7A 2F5GA 3OYLA 1NLKL 2KKHA 4DF8A 5FPNA 1RTJB 5GAHI 3KHHA 1TV6B 2WTUA 1T6CA 4ZPDA 3KLVA 5L1JA 2PT0A 3NBPA 5JVHL 5F8IA 4XH5A 2J0SD 3H5YA 3IKMA 2YJEA 4I2PB 3SSSA 4WP3A 2VU5A 3JAMY 3MWBA 1DQAA 2M7SA 1PJ6A 3D68A 2M8HA 1HLUA 4QBUA 2KB2A 3EO3A 3EWGA 1B7FA 3LP2A 5KT6A 4M3TA 1OSCA 4DS4A 2QLBB 1UFWA 3OSPA 1NJYA 1T9WA 3ZTQA 2MLXA 1VSMA 1RWNB 4DU3A 2ASJA 1R43A 2O4GA 4OI0A 4FWPA 5AQNA 4M3ZA 2CWXA 3BYRA 2ZJQQ 4F0KA 4ZOSA 4B1ZA 3P6YC 4A8MP 3GOIA 2WBMA 5GMKa 2E4LA 3GG0A 2VFRA 3K17A 9RUBA 4ANCA 3MMBA 3SI8A 2JZ5A 2YKOA 2OHDA 1KR4A 1MMNA 4BRIA 1K8AO 2YWKA 2NLXA 2HBYB 3SK3A 5JVGL 1WKLA 3SJJA 4Z4EA 1HNIA 4KE5A 1TK5A 5A8KA 3HHEA 2E2PA 2UYTA 1N6QA 3G25A 3PJ9A 1ZBIA 3CCUS 2R8JA 3U6FA 1SH2A 2ASMA 1YWXA 3AJ1A 1C0UB 1VC6A 3AQOA 4E7JA 4ED0A 2B9XA 2MQQA 4H5NA 4KT0C 4KO0B 4FF4A 1X3NA 2ASYA 7AT1B 2DR7A 1A9NB 1TKTA 3J81Y 2QXLA 2C2EA 4H4MA 5KFPA 3DLE