1S1VA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
539
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 145
structure length 533
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1vA05
3OYBA 1LW0B 1VRUA 2B43A 1GOBA 4PY5A 2QK9A 3HPGA 2GIRA 1ZBHA 5HLFB 2O4IA 4DL4A 4AHCA 4I7FB 5KFNA 3VQ6A 3VQSA 4RW4B 4EO6A 4F4YA 5DG7A 2F96A 2IM3A 3AVLA 3CYMA 2PY5A 1XR5A 5F8IA 2Z1JA 3OYHA 4JV1A 2OPPA 4ED7A 3VQ9A 1RT6B 3HSTB 1SH0A 3KK2A 2KW4A 3HVAA 1C1CA 4CJTA 1T8EA 2YHAA 4FJGA 3HP9A 1TKZB 3NF9A 5C24A 1NHUA 1S1XA 4J2DA 4NLSA 2DFEA 4FJLA 4O44A 2D0CA 3KLIB 3M8PA 4ED6A 5KFYA 2C2RA 2BRLA 4DSFA 3DDKA 3AVJA 4N56A 4URSA 1FKPB 3DM2A 1VRUB 3QYYA 1KHVA 2XHBA 1FK9B 2GV9A 3V9ZA 4K4VA 1EETB 2WONA 4I7FA 1Z4UA 3ULDA 3VQ5A 4BWMA 2JGUA 4ZHRA 3GYNA 3AVBA 1S97A 4RW6B 5KT4A 4CEEA 3D0PA 4H54A 4U7CA 2FLLA 4GMJB 4J9NA 4RU9A 4J2AA 4J9SA 5KFQA 5DMRA 1A5WA 4FJ7A 2JC1A 3AA4A 4KFBA 2D3ZA 1WSEA 3OYLA 4Y2CA 4OL8A 4FZYA 3IGVA 4Q5VA 2FJXA 1B92A 4AHSA 5KRSA 4DU3A 3LZJA 3I5BA 4BDZA 3DLBA 4QWBA 3PR4A 2AGQA 4WZQA 3TAMA 4QOZB 4W5NA 4E7JA 3OYCA 4PUOA 3TVKA 3NH1A 4J9RA 4FJ5A 3WNHA 1N48A 4OPKA 1WSFA 4OGCA 1ASWA 3M8QA 3CJ4A 4DQSA 1NKCA 2ZQBA 1IKXA 2ASLA 5C25A 4MK7A 2RF2B 4NLWA 3AVIA 2BRKA 5KGWA 1RDRA 4OJRA 4CE9A 3QNNA 2HWHA 4O0JA 4K4XA 2FVPA 4RW8B 5EUHA 1S1VB 5KT3A 1RTJA 1F21A 1LWFA 1C1BB 5KG2A 4NYZA 4TY9A 3NGDA 4CF8A 3OLAA 3EZUA 2XGQA 3MFIA 2HHTA 4KFBB 2E9TA 3KTQA 1S1WA 4K4ZA 5KFXA 3KLVA 3O4NA 4LSLB 3DOLB 1X1PA 2ZE2B 1TL3B 4I9QA 3FRZA 3ZSZA 1LWCA 4DL6A 4MFBB 3V1QA 5DLFA 2V0NA 2HAIA 3RTVA 3HJFA 4Q43A 4NRUA 4J2BA 4LD0A 5I3UA 3LAMA 4WXOA 3UQSA 1JLBB 4H4MA 3M8QB 4ECYA 2ATQA 4RNHA 2LSNA 3GV8B 2UVRA 4ZVHA 2RF2A 4XPEA 1JLEB 3KLHA 3V6KA 4JS4A 3OS0A 3K59A 4F4XA 4G1QA 1LWEA 1S6PA 1RTHA 4YR0A 1NK7A 5KFDA 4KB0A 3GIMA 2Z1HA 1VSHA 4FJMA 1BQMA 1FKOA 2W9AA 4B3OA 2R8JA 2Z1IA 1D9DA 1D8YA 4ID5A 3OSPA 3MXIA 2IC3B 3TAPA 1NK5A 3NF6A 5DK5A 2UVUA 1VSLA 1N4LA 4PWDA 3DOLA 4HTUA 2E6MA 2FBXA 1UWBB 3K5NA 1TL3A 4NYNA 4FLUA 1REVA 4IG0A 1ZBFA 1IKYA 4NLUA 3OYGA 4QWDA 4AILC 3ICLA 1RYRA 3U6FA 4F3OA 2PZSA 5I3UB 3IS9B 2BQRA 1CSJA 4G3IA 5KFMA 4CJ4A 3LALA 1BCMA 1RBTA 4DQPA 4E1NA 2KZMA 4TY8A 3DRPB 3RMDA 3FQKA 4ELVA 3S9HA 1WNSA 3QEVA 1WSIA 3V81A 4F4ZA 4FJ8A 4OGEA 1VSJA 3OYEA 4IBNA 4H4OB 4DG1A 4W5OA 3LP1A 3Q8QB 4CFAA 3HVRA 2KTQA 4GC7A 3FFIA 4CK2A 2GUIA 4DFMA 4M3XA 2FLNA 1W0HA 1D1UA 3LP2A 3L3VA 1T03A 3I8DA 1S6QA 3PJXA 1HPZB 3T5KA 4IFVA 5DLGA 3CWJA 1SL2A 1S1TA 1IG9A 5FDLB 1RT7A 1C0TB 3DI6A 1YVUA 5KFLA 4URGA 4KHRA 2QV6A 3OVNA 3C6UB 3QIPA 3NAHA 3RBDA 1IKYB 4O4RA 4C8KA 2W8LA 1NJZA 1Q8IA 4FZZA 1TQLA 2KZZA 2B5JA 4KHMA 3M9OB 2GC8A 4RUAA 3LPTA 1WSHA 4FM0A 2V4QA 2HNYB 3VQBA 1KRPA 4IFYA 3OL9A 1RCHA 4DLGA 1JLCB 4QWCA 3OY9A 4B08A 3AVKA 2R2UA 1JLAA 2HVHA 4ECVA 3LP1B 3H08A 1SKWA 3D28A 4TSXA 3EYZA 2WOMA 4IDKA 4CGIA 1JLGB 1S6QB 3PUFA 4OVLA 1B9FA 3NH2A 4O0IA 2HHXA 1S1TB 3RRHA 3VQQA 3ITHB 4OPJA 3E01A 1QE1B 2XCPA 4CFCA 4CJKA 3O3HA 1KFSA 2DY4A 1EP4B 1NK6A 3KMQA 3MR3A 4HCCA 4DTRA 2HNZB 1XC9A 5E41A 2OPSA 1QQCA 3NDKA 5KG5A 2ASDA 4ECSA 4QWEA 3QGIA 3GV5B 1VRTB 5KFGA 1T7PA 2HNDA 3QLHB 5DG9A 3OJUA 1TVRB 1N6QB 3KK1B 4K4WA 2AWZA 4DLEA 2XY7A 4XIUA 2AX0A 4ECRA 1C6VA 2FVCA 4ECXA 4B9UA 3G6YA 4Y2AA 2V9WA 3QNOA 4FZXC 1J5OB 3HL8A 5EWGA 3CJ5A 4BDPA 4URQU 3Q8SB 2C2DA 1RDAA 4KHUA 1IKVB 5KG1A 2R2RA 4E19A 4E7KA 3BQ0A 2UVWA 4R8UA 4OKJA 3V4IA 3UIQA 2E9ZA 3PW2A 1TKTA 2YNFA 2HMIB 1BQNA 3CG7A 3DLEB 5J2NA 4FJNA 1KTQA 3OYJA 5J2MB 4DWIA 3OLBA 2HHQA 2O5DA 5JS1A 2IAJA 3DRSA 4WE1A 3H4DA 4TYAA 4FW2A 3SI8A 3QETA 4ELUA 2W9CA 4O55A 3ZT4A 4RW9B 1U48A 3VQ4A 2C2EA 2DFHA 2G8IA 1D0EA 4DL5A 3LAKA 4DEZA 2IJNA 4CGFA 3ZCMA 3BR9A 4RNMA 3OSNA 4O5BA 1J5OA 4Q0BA 4RW4A 1S0MA 3P83D 1IO2A 5L1JA 4B8AB 4CJEA 3DLKA 4ZPAA 3NFAA 3KLGA 5EDWA 1CXUA 3N6MA 1VSKA 4KPYA 3NKYA 1NK0A 5KFEA 4WYLA 1EX4A 4KAZA 3V4IB 4UQGA 5KG0A 3DLRA 4EZ9A 1RT2B 1S9FA 1SKRA 4KSEB 1UAXA 2JLEA 3D5MA 1C1AA 4NLPA 4NLOA 2XY6A 2R7YA 2XY8A 4H8KA 2EHGA 3SQ4A 4O44B 3ZSWA 2YKNA 3ZT2A 3T1AA 3M9NB 1HNIA 5J2PB 3OHBA 3KKSA 3HVTA 3IN5A 3NMAA 1RBUA 1DLOA 3TANA 1I6JA 4W5QA 2A1RA 5FROA 3CFOA 3PY8A 1HQEB 1YTAA 1SUQB 1S0OA 3OJSA 3OYFA 4FJXA 2VA2A 3KIOA 1S1XB 3VQDA 1FXXA 1CXQA 3TABA 3QZ7A 4KTZA 4ECUA 4NYFA 3M8PB 1UA0A 4N47A 2IJFA 2DPIA 4NLGA 2YNIB 2ILZA 3AA2A 3M8RA 4HUGA 1JLFA 2D41A 1FK9A 1ZTTA 1IKWB 2RKIA 3SPZA 3B6PA 3MECA 4F2SA 3MTKA 1TK5A 2F8TA 3LP3A 3SQ0A 1HYSA 5CYQA 3P1GA 1HNIB 3HT3A 3H98A 1RDBA 3OYIA 2VWJA 1WAFA 4R5PA 3B6OA 3HVTB 1NJXA 4YQWA 4F4KA 2YHBA 2FJVA 1RTIB 2XRIA 4RNFA 2Y1IA 1QS4A 3H5UA 2XC9A 3EPGA 4CJVA 1HQEA 4F50A 3NH0A 2W7PA 4FXDA 1K1SA 1R0AB 2XGPA 4DTMA 1BI4A 3RR7A 2BQUA 3BQ1A 4CEDA 3TAMB 1I39A 4DL7A 4EYHB 2JEJA 2X6SA 3SCXA 3LP0A 5DQHA 1LW2B 3DRRA 3V1OA 1WNEA 1S49A 2GBZA 2YNIA 1DTQA 5K14B 3JSMB 4TLRA 4CEQA 2XWYA 2R8KA 1IKWA 3PX0A 1WAJA 1IKXB 3AO4A 2XCAA 3RWUA 3OYKA 1VSIA 2HHSA 3AO5A 5C25B 4CESA 2IM2A 3KJVB 4RG8A 4MKAA 2J6UA 2D7SA 3K2PA 3DYAA 2W8KA 4KREA 4DQRA 3MEEB 4FVMA 1L3SA 3SI6A 4F8RA 4JV2A 1D9FA 2BQ3A 1C1BA 3SFUA 5J1EB 4DFPA 3E51A 4AHRA 2BDPA 1RBRA 4LSNA 1VSMA 1HMVB 4M3RA 1S1WB 1D5AA 4O3QA 4IKAA 1G15A 5KT6A 2ZE2A 2FLPA 4DF4A 3F9KA 1LWCB 4MK9A 3QGHA 1WSJA 4EP4A 3PW7A 1S1UA 3V9SA 4DF8A 3TARA 4ECTA 3PO4A 1JLQA 4CHZA 5KFKA 3L3UA 5KFFA 3D45A 1JLBA 3PW4A 3CIZA 4CK3A 4KE5A 4HKQA 3DLHA 4K8XA 1RA7A 4DSLA 1HJRA 4EZ6A 2EX3A 1EXQA 3H4BA 4ELTA 1JKHB 4G1QB 3OS1A 4CEAA 4DMNA 4FS1A 3FDSA 1S9EB 2IBKA 2OZSA 4NLDA 1RT3A 1FKOB 4ID5B 3IG1B 4FJHA 3KLFB 1NKBA 1KVBA 1ZBLA 3NGIA 3M8SA 3A2FA 4PWDB 2HVIA 3SJJA 3RMAA 3HP6A 1LAWA 4KKOA 4O4GA 1TL1A 1QAJA 1YT3A 4TQRA 3PW0A 4IG0B 2JEIA 3CDEA 3V6JA 3LP2B 2W9BB 5F8LA 4AH9A 1JL1A 3L2UA 4J9PA 3NGYA 5KFWA 5DGAA 3EZ5A 4F3TA 4DFJA 1SH3A 3MXMA 1QSYA 2HHUA 4EYIB 3AVCA 2QE5A 3KLEB 4DS4A 1HQUB 4ECWA 3OYDA 3LANA 4H4OA 1S9GB 5CYMB 1L5UA 4U6PA 3TAQA 2Q3SA 4IH5A 3HK2A 5L1KA 3KLFA 3H5YA 2QKKA 4CJFA 4O3OA 4ZP7A 3JYTB 5HRSA 3VQ7A 4QW9A 2BR0A 3KD5E 2AQ4A 2G8VA 4E3SA 3C6UA 5KG4A 4CJQA 1BL3A 2KFZA 2W9BA 3H59A 3DMJA 1HYVA 3OS2A 3VA3A 4KHYA 3TAFA 3QEIA 2OPQB 3ISNC 3S3NA 4CEOA 1CZBA 4CIEA 3T5LA 2ZKUA 3VQPA 3PO5A 2J6SA 3I5AA 3WNEA 1TV6A 4TYBA 2HNZA 4XPCA 3SV4A 1WN7A 3K5OA 1JLAB 1X9SA 2IOCA 1T05A 4B8CA 4HCBA 5HROB 5HP1A 4KHNA 3RMBA 1QTMA 3FSIA 4CJSA 3G86A 3GIIA 4CGGA 2BANA 3BJYA 3KNAA 2B4JA 1HARA 3THVA 3I0SA 2G8UA 1MMLA 4M41A 4CK1A 4AHUA 3SZ2A 3RRGA 4Z4HA 3L8BA 1EP4A 5T7BA 1KLMA 3RB6A 1LW0A 4E0DA 4YR3A 3VQAA 1NJWA 1B9DA 4ID1A 1GOCA 1ASVA 4N41A 3PX6A 1SV5A 3BDPA 4K50A 1XWLA 1BIUA 5I42A 3I5CA 1VK0A 3QLHA 3OYAA 1VSEA 2YKMA 5KTQA 4HVJA 4I2PB 4DSKA 3QO9B 4WFXA 2HHWA 5FRMA 5F8HA 4DS5A 2WRMA 2HWIA 1ITGA 4EO8A 1TKXA 4RNOA 4E7IA 3MF5A 1TK0A 3I0SB 1RT5B 3NHGA 4BWJA 4ZVEA 4EBCA 2CKWA 3G0ZA 3SQ2A 3ZT3A 1KLMB 4RUCA 1K6YA 3DLGB 1ZTWA 4KO0A 4KBIA 4Z4GA 5F8MA 5DGBA 4XO0A 3SNNA 1SL1A 3PJWA 3PX4A 4PQUB 2ALZA 1YTUA 5KFCA 2OYQA 2ITGA 3TAGA 3ZSRA 4DSIA 5J2MA 3V6HA 4I2QB 2FBTA 1KHWA 4IRKA 3KLGB 4M95A 4KTWA 4BDYA 3V9UA 4CJPA 4DU1A 4FK4A 4BE0A 1KSPA 4MH8A 4LQ3A 4RW9A 3GILA 4I2PA 1RT2A 5KRTA 3KLIA 3QO9A 3IGNA 4C8MA 2Y1JA 2G8KA 2O4GA 4ED8A 5KFUA 4Y1DA 4NLRA 2G8WA 3ISND 4NRTA 5FRNA 1C2PA 2G8HA 4FM2A 1TKXB 3GIJA 3K58A 1EETA 1RT1B 2YKNB 4LH5A 4YP3A 4PUOB 3BSNA 1XHZA 2HW3A 4RW6A 5CZ1A 2X74A 3DLGA 1RBVA 3CDUA 1Q9YA 4KO0B 4TXSA 1U04A 4ECQA 3RAQA 1JX4A 4ECZA 4Y1CA 4IR1A 4PQUA 4DTJA 3H5XA 5KFPA 2I5JA 4ZPBA 5KFVA 1TK8A 4KV8A 4NLYA 3AO2A 4NCGB 1S1VA 1RTDA 4CJUA 4DTUA 3MEDB 4JS5A 2R8HA 4WYWA 4EP5A 2OPRB 4B9LA 4E7LA 1TKDA 1ASUA 4LSLA 3BQ2A 4M3ZA 3AVMA 1MU2B 2ZD1A 2HHVA 3TWHA 2UVVA 1JIHA 5L1LA 3HPHA 3KHGA 3GIKA 4KB1A 4KAIA 2R8GA 1S48A 4H4MB 4RW8A 2KFNA 4CFBA 4CIGA 1JXEA 4WFZA 3UPFA 2FBVA 2RDJA 2GIQA 3KD1E 2IM0A 4RW7B 2I5JB 4K4YA 3EY1A 5KFJA 5F8NA 4GVMA 3SFGA 1IM4A 1HNVA 4KHQA 3NE6A 4FLTA 1JLFB 3RBEA 2JEGA 5CY4A 1BI4B 2AGOA 5KFHA 4J9MA 5F8JA 4MQ3A 3C94A 1VSDA 3SV3A 4BE2A 1ZBIA 2OPRA 2C22A 3DRRB 3M9MB 4ED1A 3L2RA 3KMSA 3RB0A 4CFDA 1REVB 3QIOA 1JLEA 3KLHB 1ZYQA 1CLQA 1NK4A 1LWEB 4CHNA 4DL2A 4CECA 1RTHB 3MEEA 2D5RA 5J2QA 3H40A 1SL0A 4B3OB 2F8EX 4M94A 3NL0A 4LSNB 3S3MA 2IC3A 1ZETA 3ZSOA 4QCLA 1NKEA 3LP0B 4ED0A 1LW2A 5KFAA 3CDWA 3MAQA 4RW7A 3CJ3A 3UR0A 3SUOA 1DTQB 5K14A 3JSMA 1HNVB 4M3YA 1DTTB 1UOCA 4B9VA 2YV0X 3IS9A 1LAVA 4IH6A 4ZTFA 3ZSXA 4DTSA 4IOBA 4IQXA 2BE2B 5EU7A 3ZSQA 3KHHA 1S5JA 4IG3B 1A5XA 1TAQA 1RT4A 3TAEA 3QESA 3MR2A 5KFZA 4Q44A 4I9LA 4MKBA 2W42A 4DG1B 4KTQA 3K57A 4BACA 5J2QB 4CEBA 2KQ2A 4DU4A 2P5OA 1KVAA 3GV7B 4W5TA 4OKEA 3IG1A 5SZTA 3OHAA 1HPZA 5KFIA 2HB5A 2FBYA 2X78A 3O3FA 3NAEA 5KGXA 3DI6B 3L2VA 3PV8A 4M3WA 2AX1A 4F2RA 4ZP9A 2VG6A 3KKRA 3FQLA 1JLGA 4BE1A 4Y3CA 1RILA 1QSLA 1N5YB 1RDCA 2XY5A 3I0RB 3P5JA 4ED2A 2P51A 4RZRA 3E01B 4FLWA 2BE2A 4DSJA 2VG5A 4CJLA 4CJ5A 4K4UA 4W5RA 4QWAA 3RMCA 1RT4B 2FJWA 4JV0A 1HYZA 5KFBA 2YNGB 1RAJA 4ZP6A 1S9GA 5CYMA 3ZSVA 2BGGA 2UUWA 4OLAA 4KKOB 1VRTA 4QW8A 3G6XA 1J9AA 1T94A 4IDKB 2CJQA 3PR5B 2IS3A 3TQ1A 2HNDB 2VWKA 4LH4A 1QAIA 4J9OA 3KHRA 3QZ8A 3RAXA 1KVCA 4CF2A 4CIFA 4B9NA 4NCBA 1LV5A 5L1IA 1ZBUA 4NLTA 3KLEA 4CHPA 3TI0A 1TGOA 3K5LA 4AHTA 2NUBA 2WCXA 1NOZA 3CFRA 2OPQA 2OA8A 4MIAA 4K4TA 1BIZA 4L8RB 3MXJA 4EBEA 4FLZA 2W7OA 5KFTA 4JRQA 1Z25A 1TV6B 3BSCA 1N6QA 1WLJA 4WZMA 3V6DB 3F73A 2OPPB 4KRFA 1BQNB 3MFHA 3NF8A 3KK2B 2F8SA 2XO7A 4N76A 1BCOA 4IRCA 3DMJB 4NZ0A 4PA1A 3DRSB 5JS2A 1T3NA 5C24B 2J6TA 1GX6A 4R0EA 3CM5A 3AO1A 4TN2A 5KFOA 3G10A 3BREA 3ALYA 1JL2A 3T5JA 3HHKA 1YVFA 1FKPA 3DM2B 3CJ2A 2R8IA 2JC0A 3EPIA 4R8UB 1QSSA 1RT6A 3H5SA 2ETJA 2DPJA 4Q0BB 4YMEA 1SV5B 4Z4EA 3PZPA 4FK0A 3CO9A 4RNNA 4J9KA 4ZPDA 4IRDA 4J9QA 2D0AA 2D0BA 2FC0A 5I42B 3CFPA 1W25A 4FJJA 1K1QA 4IR9A 3TR8A 1SKSA 2AJQA 1C0UA 3HM9A 2ASJA 2YKMB 4N5SA 2W9CB 3V6DA 1QHTA 3VQEA 4CGHA 1U4BA 3L2WA 4E1MA 4CF9A 1GX5A 4FLVA 5DQIA 2AGPA 4JUZA 1BISA 3QERA 1OS5A 1A5VA 4ZTJA 4M45A 1VSFA 3U3GA 2VA3A 4CHYA 3AA3A 3SYZA 2WONB 3RB3A 1W9HA 4NCAA 1RT5A 1KFDA 4ZHRB 4DQQA 1NJYA 4GW6A 4LY7A 4FJIA 3DLKB 3V1RA 3OYNA 2ILYA 1DLOB 3K5MA 2WHOA 4CJWA 5KFRA 1BGXT 3ASMA 3UDLA 4ZPCA 4CERA 4FM1A 4FBTA 4M3UA 4FS2A 3VQ8A 1SUQA 4DFKA 2Z1GA 1TAUA 3NF7A 1C0UB 1LWFB 1L3TA 3QGGA 4JRPA 4O3SA 1RDDA 3Q8PB 4KB7A 2PYLA 5CZ2A 4HYKA 1RA6A 5J2PA 3DOKB 4EEYA 3RR8A 4CHQA 2IA6A 4MFBA 2UUTA 4ZVGA 4E89A 3MECB 4DL3A 5KFSA 4C8NA 1HYSB 4IKFA 4AHVA 4FJKA 2FVSA 2R2TA 3RB4A 4IH7A 3H2LA 4HHTA 3KHLA 4I2QA 3BGRA 4ICLB 4OLBA 4R5PB 3PHEA 1RTJB 3NAIA 2B6AA 1NK8A 4QPXA 1U49A 1U47A 3AVNA 1RTIA 1Z26A 4QAGA 4DSEA 3LWMA 3AO3A 5F9NA 5HRNA 4KHWA 1X9MA 4K8ZA 4NCGA 3LZIA 1R0AA 4F4WA 2E6LA 1BQMB 1RTDB 2RKIB 2WTFA 2QKBA 1RT1A 1L3UA 4ED3A 4ZP8A 2VG7A 5CYQB 5KG7A 4M3TA 4K4SA 3DOKA 4CHOA 4CF1A 4FLYA 1UWBA 1MU2A 2ZD1B 4TQSA 1S0NA 5HBMA 2C28A 2IGIA 2RDIA 4CGJA 3KJVA 5KI6A 2QXFA 2ATLA 1S6PB 1J53A 5HRRA 3BGRB 4ICLA 4Q8EA 4KV8B 4O3RA 3ZSYA 4O3PA 1XHXA 3V9XA 2X6NA 3CQ8A 3DRPA 1UA1A 2B6AB 4ZVFA 5EWEA 5J1EA 1S4FA 4C8LA 3MEDA 5C42A 1HMVA 3AA5X 4KI4A 3PVXA 4CJRA 4B9SA 1I3AA 1XI1A 3S3OA 1O1WA 2XI3A 4YFUA 3QINA 2XI2A 1S1UB 2DTUA 4NLVA 4DTXA 4IFVB 5KT2A 3WNFA 2VG7B 1RYSA 1NNDA 4B9TA 5FDLA 3DYAB 1EKEA 3ZT0A 2E9RX 5SWMA 4J2EA 2PYJA 3SUPA 2I1RA 4TY8B 3CVKA 2YNHB 5HBMB 3NGZA 3V81B 3L2QA 4FJ9A 3NBPB 4FLXA 1JKHA 5T14A 4E7HA 3N6NA 1C0MA 3AVHA 4KI6A 2A1SA 2P5GA 3FFIB 1XR6A 1S9EA 2HNYA 4IFYB 1T03B 1BHLA 4FYDA 3HYFA 4Z4FA 4J9LA 1JLQB 5C42B 5KT7A 3O3GA 1RT7B 1C0TA 1TP7A 4CF0A 3C6TA 5JXSA 4M42A 4WXWA 3OL7A 3T19A 3QIPB 5L9XA 5DQGA 5F8GA 1JXBA 5KT5A 3MR5A 2R2SA 3KK3B 2FVRA 2B5JB 2P1JA 3ITHA 4HUEA 4JLHA 3T5HA 3HO1A 4OKKA 3AVAA 4CGDA 4CJ3A 5DG8A 2FVQA 3HXMA 1RT3B 4MK8A 2YNHA 2IDOA 1JLCA 4DTNA 4DTPA 3ZT1A 3QEWA 3C95A 3QIDA 3NBPA 2DFFA 4Z4IA 1GOAA 3GQCA 5HRPA 2G8FA 3N6LA 3V9WA 2OZMA 4NLXA 2WOMB 1SH2A 1TL1B 4O4GB 1DTTA 1J54A 3MEGB 3QEPA 3HPOA 4FK2A 1TVRA 4Y34A 4C8OA 5D3GB 3O4QA 3QEXA 4DQIA 3SPYA 3C6TB 3HVWA 1QE1A 1JXLA 3IRXA 1CZ9A 2OH2A 2JEFA 1XR7A 2VG6B 3Q8RB 4B9MA 2RPIA 2EC0A 4IG3A 3VA0A 4EBDA 3KK3A 4Q45A 2OPSB 1HQUA 3T3FA 2D3UA 3AVFA 4CCHA 1QUVA 4X2BA 2VG5B 1IKVA 3MR6A 1Y97A 1NHVA 1IH7A 2V4RA 3LWLA 1U09A 3JYTA 3KK1A 3LDSA 3CJ0A 4Q8FA 2IM1A 5C5JA 2AU0A 5EWFA 3DLEA 5J2NB 2WB4A 3SUQA 5JUMA 2IMWP 3SQ1A 3MEGA 2IAJB 1N5YA 3HKWA 3I0RA 5HLFA 3CM6A 4FW1A 5D3GA 4DTOA 3IAYA 4MIBA 1X9WA 3IRXB 3OL6A 4WFYA 3OL8A 3G6VA 4KHSA 3KOAA 4HUFA 3AVGA 3VQCA 3NCIA 5KG3A 3VN5A 3WNGA 4GC6A 3BSOA 2YNGA 1RNHA 1KLNA 3OYMA 1TKTB 2YNFB 2HMIA 1RBSA 1T05B 1L3VA 2RN2A 5HP1B 5HROA 1WSGA 1C1CB 3PW5A 2WK4A 4CEFA 3SUNA 3U3YA 1NOYA 4FCYA 4NLQA 4Z0UA 1TKZA 4WE1B 3BSAA 2E4LA 2BANB 4FBUA 3LPUA 4Z4CA 4O3NA 1KCFA 4CEZA 4ZMMA 4LQ9A 3AV9A 4YNQA 5KG6A 1S10A 5F9LA 1NK9A 1Q9XA 4YR2A 1N56A 1HRHA 1U45A
chains in the Genus database with same CATH superfamily
3OW2M 3OYBA 2B43A 3HPGA 1KAYA 4DX5A 1NH7A 3R27A 4F4YA 5K8MA 2AJ2A 2OO4A 4ZS6A 1WOQA 2PY5A 2Z1JA 3OYHA 4IO1A 5A2QY 3N4PA 3DWLA 2QTWA 1WHVA 2UXCJ 3W9JA 3OD2A 1RT6B 2GJIA 3KJNB 3HSTB 3UW1A 1C1CA 2GWKA 2RJZA 4L6V3 2NZTA 4FYYB 3TZXA 2YHAA 1S99A 2NQPA 3NF9A 1YHQN 4ZVPB 2YHYA 5HJYA 2XYPB 3CF5L 5HMXA 5AE2A 2DFEA 2GELA 1EWRA 4RUBA 3HHLA 5D0HA 3B4DA 3DDKA 4DV3F 2XHWA 1FKPB 4QYZK 3QYYA 2F5GA 1UVKA 1EETB 4FOIA 4EIAA 2WONA 1HD0A 2QRRA 3I31A 4BWMA 4ZHRA 3AVBA 3J80O 4RW6B 3VVUA 5KT4A 2WB1D 4U7CA 4GMJB 1XUPO 3R5AA 3HFZB 5ETMA 5AZIA 2F4VK 3V4MA 4J2AA 4J9SA 2JJ4D 3QWUA 2HBRB 4K0KF 4KFBA 1R27B 4OL8A 3W5ZA 4Q5VA 2EBEA 1FCAA 5DETA 1UEKA 2HBJA 3I55S 4ZIVA 2AGQA 4WZQA 5LJWA 4W5NA 1RHMB 3TVKA 4A59A 3HHLB 4J9RA 4QIEA 1N48A 1FRJA 2OIHA 3HHDA 4OGCA 4F67A 2ZBRA 1VQNS 4JHDB 3CJ4A 2LA6A 4RUHA 1K44A 4BCAA 2ZQBA 4OZ2A 3H46O 5LSOA 4OHYA 3AVIA 1PG5B 3UN2A 1GXTA 1FE0A 4HHUA 4K4XA 3WQUA 4BRNA 5EUHA 1S1VB 5KT3A 3LGHA 1F21A 5KG2A 3NGDA 4TY9A 4KFBB 4GVBA 3C7NB 4K4ZA 5KFXA 2NNWA 5LM7E 1UKUA 2R7XA 2ERRA 4JYAK 4OZ5A 3WXMB 1RE1B 4KYZA 2DRAA 5HL7Q 2E1RA 2UUAF 2V0NA 2HAIA 1K0TA 1RU1A 3HSJA 4ANEA 2VYPA 5T7LA 1JLBB 2MKCA 1YX2A 4YB5A 4BROA 1RWNB 4RNHA 2LSNA 3U4LA 2ZJRL 1OH8A 4P2XA 5IWAF 1JLEB 1JWWA 4NO7A 4F4XA 2OMOA 1X4GA 1A0OB 1B3TA 1X5OA 1S6PA 4IUFA 4DR5J 5KFDA 4KB0A 4M5JA 1VSHA 4B3OA 4I64A 2R8JA 2F4FA 1D8YA 4DJBA 2CPFA 2AYMA 1VIXA 2QA1A 1SBRA 4PWDA 2DNNA 5B08A 2Q36A 2CGLA 4BRQA 3D66A 4KQZA 3OYGA 2IPOB 3ICLA 1CJKA 3U6FA 3H8YA 4F3OA 1FFWB 1CSJA 4RJVA 4FL9A 2YJEA 2OTJS 1E4GT 4CJ4A 4M5GA 2Z56B 4E1NA 3M8WA 3DRPB 3FQKA 2E2PA 1TR0A 1WNSA 2CG8A 4HTLA 5D4NA 1WSIA 4BG8A 1YGYA 1HNXK 4FJ8A 4OGEA 3M8ZA 3QBXA 1KAZA 3BO4A 2VUGA 4OZ0A 3BF4A 2GUIA 4FZVA 1LOTB 3IR7B 3LP2A 1T03A 2VDIA 1S6QA 3UD4P 4IFVA 5DLGA 4DR7K 4DR6F 1RCOB 1C0TB 1YVUA 2V7ZA 1WJ9A 3KG0A 3VF0B 4UZCA 3CCMN 1SC4B 4KHRA 3ETMA 3C6UB 2AEFA 4O4RA 3RBDA 3NGUA 3OR2A 3MURP 2BE9B 3T69A 3QBCA 2B5JA 5AJ3J 5CR4A 1CJTA 4RUAA 1WSHA 1NUEA 1HBNB 2DNMA 4B1UB 3VQBA 1GFWB 3OTOF 3TJ8A 3CCVN 1FVQA 4QWCA 7FD1A 2WC9A 4PWWA 3AXKA 2ZFHA 3R2DJ 5BRDA 3H08A 5F0XA 2G2ZA 3QBWA 3EYZA 2AJ1A 1KQSM 1JLGB 1S6QB 1N36F 4F4AA 3PUFA 4OVLA 1B9FA 3R7NB 2ZHBA 2HHHF 4OPJA 3THYB 1TL7A 2J7KA 2E20A 3C16B 1OMSA 3M30B 1EP4B 4G65A 2NYIA 4AL5A 4N8NA 2A40A 4DTRA 1OO0B 2H51B 5E41A 1XC9A 1QQCA 3NDKA 5LSRA 2ASDA 4JK9A 3JAMU 4RLEA 1T7PA 3EXCX 1SJQA 2UUBK 3QLHB 4DPTA 3Q86A 3OJUA 4BGAA 4ITSA 3FBFA 2A3ZA 4M63A 4XIUA 4ECXA 2QC3A 2YPZA 1NSPA 3FMWA 1S57A 3QNOA 2LYVA 4FZXC 1GLBG 5EWGA 2WZ1A 3CJ5A 1GMWD 4BDPA 4IOCL 3Q8SB 1O5JA 3G25A 5KG1A 3ZZ0A 1T9XA 5BN9A 2DGXA 1X5TA 3GONA 2MZSA 1H6KX 4LRDA 3EZWA 1EO1A 4ZJLA 4P73A 3PW2A 2YNFA 2HMIB 3D1OA 3DLEB 4FJNA 4EHUA 4U8YA 2DT9A 2MLXA 3LPEA 2HHQA 5JS1A 2D4WA 4WE1A 1MWQA 2VBZA 1YRXA 4ELUA 5DZ7A 4WFNQ 2LQ8A 4XTTA 3VQ4A 2DFHA 1SC6A 1D0EA 1XNRK 2H4YB 2VHGA 2G0CA 4GMKA 2P2CB 1F0XA 3LDNA 2I38A 4RNMA 3H1QA 1HKCA 1J5OA 1XTZA 1ESVA 1S0MA 3CMQA 4WQ5C 4OX6A 1B70B 5GAEI 5A2QO 5I3PA 3WT0A 1D8ZA 1CXUA 1VSKA 3JTPA 3R5GA 3TVZA 5KFEA 4WYLA 3R8EA 3V4IB 4UQGA 3I82A 3S7RA 2V50A 4EZ9A 3H20A 2VBXA 1SKRA 4C8ZA 1RGVA 3D5MA 4NLPA 3ZTRA 2KXFA 4HR2A 4NLOA 2GA7A 2VZ9A 1DJ0A 1UJ4A 3N4WA 4H8KA 2BJ7A 3AA9A 3SQ4A 3OA9A 4WCEL 3JSRA 2IVFB 2JWLA 2HS4A 3EGZA 1LK7A 1HLUA 3R6LB 3DU6A 2FGOA 4PG8A 2LA4A 1VOMA 1JCFA 4BBYA 3TANA 1ZPWX 4TVAB 4PG5A 2OD4A 4A47A 3A5LC 1FJGF 4HLBA 3LGMA 2V2VA 3CFOA 3PY8A 2PEHA 3OYFA 4FJXA 4CZLA 1VQ9S 3BP8A 3RUBL 3VQDA 3VGTA 1FXXA 1UJ6A 3TOQA 3QZ7A 1VC0A 2B51A 2KHOA 2DIUA 3QJPA 4ECUA 2J0QD 4NYFA 4A5BA 2LQBA 4N47A 2YNIB 1V9OA 1YITS 2G0IA 4HUGA 3DDIA 1JLFA 1NSQA 1FK9A 3VF6A 1K8KB 3I9ZA 3O6QA 2FSKA 2EFOA 3MECA 4F2SA 2W4CA 3SQ0A 2BJEA 3P1GA 3O8MA 5B0AA 3E66A 4R5PA 4YN3B 2HF3A 1NDLA 2NLWA 1S72S 2L41A 2YHBA 2IVNA 1RTIB 2XRIA 2Y1IA 2ABYA 3DLLQ 1H3DA 2W7PA 2IRYA 3UNYA 4FXDA 3O5TB 1BI4A 3HHEA 5ADXA 3I6PA 4DV2K 4DL7A 2FHOB 3QDKA 5IZHA 2X6SA 4XDCA 3LP0A 1LW2B 1PJ6A 1S49A 3ZTPA 2GBZA 2YNIA 5K14B 2E88A 3HZ6A 1KVJA 2XCAA 3OYKA 3AGRA 3UKRA 4LJMA 2DR9A 1KWMA 2KRBA 5LMNK 2AP6A 3O5BA 2J6UA 3K2PA 3DYAA 3I56S 3MEEB 1GK8A 1VK8A 1PJ7A 4X66F 4JD2B 4AHRA 4OYMA 4LSNA 2YWGA 1VSMA 4P71A 2QM1A 5G0RB 1IJJA 3CCSS 4IKAA 3T6JA 5KT6A 2ZE2A 1PILA 3TEHB 1WSJA 1IR0A 1S1UA 3VGUA 2ZJQQ 2Q0RA 2DHGA 2K3IA 4CBWA 2PO4A 4CHZA 1DGKN 2MY7A 4DXLA 3L3UA 5BPLA 3PTWA 1Q0NA 3D45A 1JLBA 3PW4A 1F3FA 3CC7N 4DR4K 1Y3KA 1NGGA 1R0BG 3H4BA 4DUYK 4OI3A 4WQ5A 1XMQK 4CEAA 3P4UB 3P39A 4V19X 4DMNA 2DK2A 3VEOA 2OZSA 1RT3A 2YH0A 3IG1B 4DR4F 5HVHA 5LSLA 4PRFA 5AXKA 4F02A 1EZZB 4JK8A 5E7OB 2OFGX 4C23A 1NO8A 4AD6A 1YT3A 1QAJA 4WK1A 1X31C 3CDEA 1CULB 3V6JA 2ZGYA 4J9PA 4DPWA 1CJKB 4KPCA 3VGLA 3N5BA 4RTFD 4OIXA 1O0PA 3G6EN 2VFUA 5EY4A 3NCRA 4FOEA 3AVCA 2QE5A 4LF2A 1QTNB 3KLEB 2RAQA 5GADP 1GTHA 4YOXA 1GLEG 1S9GB 1L5UA 3W65A 1RDUA 5G4DA 3W5XA 2CJKA 2QSFA 2E7VA 3M3ZA 2Q3SA 4IH5A 1ILYA 3H5YA 3P8BB 4BRLA 3S8SA 3VQ7A 4MAKA 1KN6A 1VISA 3W64A 2BR0A 3J81O 3HHLD 4DV0F 2G8VA 1RWMB 3JSBA 1C4AA 3C6UA 3H59A 3JB9k 3K0JA 3VA3A 4CRJA 2FF3B 1CJTB 2OPQB 3Q89A 2HBLA 3C14A 3T5LA 4ZPWR 3PO5A 1KTVA 1H2UX 3TVYA 3WNEA 1TV6A 3K5OA 5A0YB 5IT9U 2PD1A 4HCBA 4PCQA 5HP1A 4M5KA 3MOJB 5AE1A 4DB3A 5LJVA 4AQYJ 3MPVA 4CGGA 2MYFA 5CD4H 2RVJA 1HJOA 2M2BA 4FXWA 1X4BA 4ZCLA 3ENOA 1MMLA 4M41A 2F4VF 4CK1A 1FRXA 1KNZA 4A4JA 1LXNA 3HZEA 1RBAA 4FPAA 1KLMA 4E0DA 1BA1A 3CI5A 5LMUJ 2MGZB 2CVEA 3M1VA 1SV5A 2C2NA 3F44A 3MGJA 4K50A 2BOAA 2RRBA 5I42A 3I5CA 2GFFA 4CBXA 1FESA 2J9CA 3QLHA 3VF4A 4OZLA 4X65J 1UP1A 5KTQA 4JI2J 4DSKA 2HHWA 3D68A 3MTJA 5F8HA 4PPDA 2WRMA 1VQPS 4KH5A 4CM2A 2FD2A 4E7IA 4ZDNA 3MF5A 1RWXB 4ANCA 2MKIA 3CHWA 2O3DA 1RT5B 5EXWA 2YY3A 2E7XA 3E3XA 2P9UA 1VQ8N 1CQMA 2HGMA 1X5SA 1KLMB 3ZEUB 2FY1A 1ZTWA 2P6SA 5DGBA 2XG8A 3SNNA 4JI3J 3CF5Q 2CPJA 2GVZA 4PQUB 1YTUA 1QLNA 4DV1K 3Q8YA 4EFHA 4DSIA 4E98A 4IZ9A 3KLGB 4K43A 4BDYA 1F2GA 4CJPA 1YJNN 2EEYA 1P8GA 4LQ3A 5FPEA 3GIRA 1TUWA 3KLIA 2O66A 3IGNA 3Q23A 4Q7AA 4O8UA 1NEEA 4Y1DA 3M8YA 4DV3K 1H0HB 5H9FJ 5DS7A 4ILGB 1EETA 2QI2A 5KQ8A 3QRQA 3WIVA 1DARA 4B9QA 3W2WA 4RW6A 5CZ1A 3AOBA 3MM7B 3ZEUA 1LXJA 1T02A 1RBVA 3PM9A 5A8WB 1Y11A 2CZ4A 1U04A 4B3MF 4ECZA 4Y1CA 1HNZK 4IR1A 4PQUA 1UCNA 1GXUA 2QO3A 4DZ6A 4WTYA 3H5XA 2I5JA 4GKJJ 1HLWA 2YJFA 1ZM4A 4NCGB 1F9EB 4LT6A 2MEWA 4P6QA 2RH3A 4GY2B 3MEDB 1UZDA 4B9LA 4C7QA 4E7LA 1TKDA 5IQQA 1NG9A 2Q43A 3BQ2A 4M3ZA 2B9WA 3ZZOA 3SAHA 3TSUA 4XAKA 3HPHA 4FVUA 3KHGA 3ZZPA 3CNQP 3A8JA 1HI8A 1S48A 3D0GE 3LDPA 1X60A 3HSZA 3OVBA 4WP9A 2PMHA 2CZVC 4DR5F 4NASA 3D2WA 4CIGA 3UPFA 2Y9HA 1TU0B 2RDJA 2JOQA 3T1YJ 2GIQA 2HEKA 4GVBB 2IM0A 2I5JB 3CCEN 4FWOA 3KG4A 1IM4A 1HNVA 1JLFB 3K8WA 1K47A 2AGOA 5KFHA 4J9MA 3C94A 1VQ5S 3FSYA 3NOCA 2W6LA 1ZBIA 2O8BA 4UQTA 4LF9J 1FWLA 2LEAA 2V4JA 1SQGA 3LL3A 1JLEA 4BC7A 1CLQA 4X62K 4ISGA 1OJ4A 2GAHC 4CECA 1RTHB 3MN6A 1T95A 4TLQA 4B3SF 1YZ7A 3AA8A 4LF9F 4BC5A 4B3OB 1U2VB 4UF4A 2EG2A 1NXIA 4JI5F 3ILJA 2LU2A 2HRTA 3S3MA 3MMBA 2IC3A 1ZETA 3LP0B 4ED0A 1LW2A 5KFAA 3UR0A 1NDCA 3OTDA 3SUOA 2P9IB 2HBKA 5K14A 3DHXA 4M3YA 2DKOB 4F3MA 3ILLA 4B9VA 2F65A 2VQEF 2C3YA 1NGJA 4YORA 2ZOFA 3IWXA 1BWVA 2KO1A 5DM7L 3MCNA 2YTCA 4X62J 1TAQA 2GQCA 2UXBF 1A5XA 1FW6A 3MDQA 4JD2A 3R7SB 1HNWK 3MR2A 4USHA 5KFZA 4Q2LA 4OYOA 2DXFA 2W2QP 4DG1B 4KTQA 1MA9B 2O8CA 4DU4A 4C3MA 1ZH5A 1ATSA 1KVAA 1NSKL 4OKEA 2KDOA 2W6KA 3BEGB 3DKDA 1HPZA 5GIPA 2K1RA 4LF8K 3DI6B 3L2VA 2MXYA 4F9OA 2M52A 2DITA 4C1NK 2Z58B 4F2RA 4OV6A 4ZP9A 3MM5B 2VCPA 4ZVSB 2CDRB 2OEKA 1YJ9S 1RILA 1QSLA 2NLXA 4DX7A 2XY5A 3CD6N 3T1HJ 4JI2K 5MAOA 4DSJA 4CJLA 3V5RA 3H6EA 5CHCB 1RT4B 1WTFA 3VGSA 3VTHA 3MUMP 5A76A 5CYMA 2CH6A 4Y2IA 2LXIA 1J9AA 1VRTA 1HWKA 3PR5B 2CQBA 5EN1A 3CW2C 1ZM9A 2RT3A 4J9OA 4TKTA 3TZYA 4EU0A 1VQ6S 4DV5F 2NXEA 5HATA 4QS9A 4NLTA 3JXOA 2Q3PA 2CAJA 2NUBA 3FZBA 1V4SA 2YKOA 2OA8A 3UD5A 4A8KA 2FSNA 1NGIA 1WOPA 3AARA 4M5LA 2UV8G 1CJVA 3L0QA 3BBBA 2WAQD 5H9FK 2Y1RI 2K06A 1BQNB 1AT1B 3KK2B 4HL9A 4IOAQ 4PEOA 2CQ4A 4N76A 1YUWA 3QB0A 3DMJB 2Z30B 4PA1A 3DRSB 1T3NA 3U27A 4WQ4C 1GX6A 3IDHA 4PKIA 3VGMA 4OMFG 3ZYYX 3E8OA 3EKSA 4FWKA 3T5JA 1IWAA 1PYTA 4FWRA 2KVIA 2HVZA 3ZX3A 3JXUA 3DM2B 2XBPA 1VYAA 2JC0A 2OI2A 4OI6A 3EPIA 4R8UB 1QSSA 3KWMA 4CT8A 2PT0A 4LR8A 4Q0BB 3HCXA 4YMEA 3ATVA 4J9KA 4ZPDA 2VQEK 3GFYA 1W25A 2LKZA 1W2IA 4A2BA 1C0UA 2YKMB 4IFEA 1ZM3A 1QHTA 2R7QA 4JBCA 2XSFA 5AQXA 5DQIA 2AGPA 3TQEA 3ZX2A 3QERA 2MY8A 4A48A 3IBWA 4DL0C 2YX7A 2VA3A 2F9DA 2AIRB 2M4MA 3M1VB 4NCAA 4QYZJ 2EKYA 3OYNA 5HVFA 1FFGB 3MN5A 3DOMB 5IV4A 4CJWA 5FPMA 1XMBA 2AJFE 4ZPCA 4NX9A 4FBTA 4XK8C 3NVMA 4WFBQ 3VQ8A 4ES1A 2GVDA 2BXJA 2RQKA 3Q8PB 3QRRA 3EDQB 2MKKA 4HYKA 1KBRA 2MB0B 2KXHA 2GNKA 1EB0A 3RR8A 3SLCA 5BR9A 5J1NA 4U7BA 5U47A 1GEHA 1BOTO 3PXGa 5HMZA 4E89A 3DXKB 5K8PA 3SSQA 2ASYA 2M0GB 2WVCA 4IKFA 3RB4A 1ELOA 3KHLA 3P3DA 3L4BC 4QYRA 3PHEA 4Z37A 1RTJB 1HWUA 1U49A 1U47A 4ZITA 1WF1A 1Z26A 3CJRA 3AO3A 3QT6A 1K8AT 4RBUA 4K8ZA 5JLHA 1X0PA 1RTDB 3THWA 3ZXWA 2WTFA 2QLWA 4MO4A 1L3UA 3EMTA 2VH7A 2GMHA 2VBWA 4QIFA 2E5JA 3O08A 4FLYA 1UWBA 5HBMA 3MHYA 3LOUA 2C28A 4V19J 3KJVA 5KI6A 3TUPA 1J6ZA 2R7RA 3V9XA 2X6NA 2V8VA 3DRPA 2FF6A 5J1EA 4JKHA 3MEDA 2KXNB 5AQIA 1HMVA 2QL9B 2ZF5O 4M5HA 3AA5X 2LECA 4ZJOA 3FUYA 3HULA 4L75A 1KC8T 3TX8A 1O1WA 2QMXA 4H0OA 2VQFF 3CPWM 2AA4A 3TZWA 5ETNA 4IFVB 3VEXA 1WSVA 5B0EA 1RYSA 2L9WA 2ROPA 5HANA 2FHJD 2HHPA 1P90A 3KVGA 4BR2A 3ZT0A 5SWMA 4B1WB 3T41A 5AZJB 3SUPA 4TY8B 4LF7F 4WFAL 2YNHB 2UUCF 5HBMB 2C3PA 4DZDA 3NGZA 3HOTA 3QT7A 2AYEA 1JKHA 3FBEA 3PEJA 1X3NA 2GHPA 1NDPA 1YG0A 4IFYB 4LF1A 3CJKA 1BHLA 4GO7X 4OYXA 3MAAB 1Q5YA 3O3GA 2J9EA 1RT7B 4CF0A 4HDHA 1WC1A 4WXWA 5L46A 1NU0A 3PYEA 1ZC6A 4PXEA 2BVZA 3KK3B 2FVRA 2D3OR 3J7ZT 1N52B 3FBCA 1MW7A 3AVAA 1M5OC 2WBRA 2NXJA 5D4LA 3HXMA 1TFWA 3ZT1A 3QIDA 2DFFA 4CDIA 2ZKTA 2G8FA 3R1LA 3DC2A 4DX6A 2BH1A 1D9AA 2DNLA 4O4GB 3QEPA 5JVGL 4FK2A 5AQVA 2DNKA 1APSA 3PKYA 4LF4F 1NDKA 4B3SJ 3BZKA 3C6TB 3GU0A 1DEJA 9ATCB 2KKHA 5GAGI 4B9MA 2WSCC 5AQRA 1YJWN 3QFWA 2GO8A 1V5IB 2KN4A 4FNIA 2GTDA 2OPSB 5B0FA 5EX3A 3AVFA 4WIIA 4CCHA 3EXYA 2NXUA 3CD5A 2J4RA 3P6YC 4EWTA 2XS5A 2MMYA 2UXCK 1NHVA 3IO1A 4K2XA 1FJCA 1IH7A 2IM1A 2QLFB 2AU0A 1NH8A 4DV0K 3KJQB 4DMZA 2QGFB 1PYSB 1SC3B 4GO5X 1JJ2M 1T9VA 3I0RA 5HLFA 4DTOA 2LFVA 3IAYA 3WUHA 2P9NB 1WD6A 3C14B 3OL6A 2AEMA 2KM8C 3R7BB 3HDSA 3AVGA 3WIUA 5KG3A 3VN5A 4GC6A 1U02A 1RNHA 4K0KK 5I3QA 1KLNA 3HSGA 3OYMA 1QM9A 3TA2A 1TKTB 1RBSA 1YWXA 1S4EA 1KDNA 3BPSP 5HP1B 2VKZG 3AY0A 1Y4ZB 2QFIA 1IJFB 4ZCIA 3SUNA 2ZEJA 2XZDB 4NLQA 1TKZA 1HFEL 3BSAA 5HMYA 4Z94A 2DD8S 4ZMMA 3AV9A 4BR9A 5DJBA 1HIYA 3RU0A 4YR2A 2EFPA 1NK0A 3D6TB 1LW0B 1GOBA 4PY5A 2QK9A 2E5IA 1RABB 4NXMF 2GIRA 1CEZA 2ZGZA 5HLFB 4RBTA 5KFNA 2HBZB 3R8YA 4RW4B 1ZZFA 4DV6K 8RUCA 5DG7A 2MZRA 5DZ6A 1YJUA 2E1PA 1U24A 2G0JA 2IYGA 4JAXA 3R3TA 2HMPA 5AQPA 3KK2A 2KW4A 2JFDA 3HVAA 3FZHA 4CJTA 5IXUA 4OQJA 5B0DA 4FJGA 1PSDA 3HP9A 1TKZB 4RU2A 3RW6A 2B4OA 5C24A 1NHUA 1WSRA 4DHYA 2J0WA 3RAMA 1F9HA 4JKCA 4FJLA 4O44A 3U9ZA 2DR5A 3IA0A 4DCHA 3IWLA 2BRLA 4OZ1A 3FCWA 4IJAA 3AVJA 4N56A 5SUHA 3DM2A 2R7VA 5EX5A 3BBCA 4BS2A 1KHVA 1FK9B 4QIVA 3JQKA 2ZBIA 3R1HA 3VQ5A 3UNGC 4KC5A 2JGUA 1U1MA 4H54A 2YH1A 4XH1A 2DXDA 4CO3A 4RU9A 2VIHA 3TYTA 3VOVA 1A5WA 4LFCK 2NRTA 2HRUA 3A8YA 1XMOK 4FWSA 4FZYA 3IGVA 2ZNZA 5KRSA 3I5BA 1M90O 4ES3A 4B3RJ 1SKUB 3PR4A 4QOZB 3TAMA 3HFKA 3OYCA 2Z2MA 1VDHA 4FJ5A 3UVJB 3WNHA 4OPKA 1WSFA 2JVRA 2ZH1A 3M8QA 4IEIA 1TL5A 2B9EA 3H7HB 3G8QA 4NLWA 2BRKA 4P2MA 3GFXA 3QNNA 2QLBB 3AODA 4ES2A 3IM9A 3L7OA 4MKYA 2QA4S 4KH0B 2GAGC 4NE9C 3MFIA 2VGNA 5AQKA 2BKOA 1XNRF 4IJNA 4WFBL 2JSXA 1U7LA 2ZE2B 1TL3B 3FRZA 4DOZA 3ZSZA 3IUCA 4DL6A 4WF9Q 5DLFA 3RTVA 2HIYA 2UU9K 2GGPA 4J2BA 4K42A 5I3UA 2XMTA 4WXOA 2J7WA 4LFAK 4H4MA 1CC7A 1F5AA 2B3TB 3FBBA 2UVRA 5HQLA 4ZVHA 4XPEA 4JS4A 1HNZJ 3OS0A 2QLJB 3UWTA 3K59A 3GE9A 2AT1B 4R25A 4YR0A 3J7Z5 1N36K 2Z1IA 3THWB 1SAZA 4V19S 2NXCA 5AQUA 3OSPA 1WF2A 3FR0A 2BM1A 2ITMA 3UR3C 2ZC3A 3TAPA 1NK5A 5DK5A 1YJWS 1RLDA 5D0RA 1UWBB 1TL3A 5GIOA 4FLUA 2CPYA 1ZBFA 1IKYA 1RJJA 1SQKA 2KB2A 2AYGA 2I7PA 3W2VB 2M3DA 5KFMA 2X51A 2YX4A 1BCMA 2FLOA 4B3SK 4HWIA 2KZMA 3KJFB 2H54B 1G1XA 3RMDA 3S9HA 3JQJA 2ADCA 3CT9A 3V81A 1U25A 1AA1B 4IBNA 3EUNA 3D6HB 4B3TK 4M1KA 3VALA 4CFAA 3FFIA 2DH7A 4BR0A 1W0HA 1HNXJ 3GZ7A 3L3VA 4H0XB 3HSCA 1FTRA 2OGUA 3T5KA 4JN4A 3C0BA 2NR0A 5IOLA 1S1TA 1IG9A 1X4HA 1RHKB 3D2EA 1NGFA 5H1SV 1Q4RA 2QV6A 1RAGB 4NEZA 3ZFVA 3OVNA 1WC5A 3ZC4A 3NAHA 4IEEA 2W8LA 3GYXB 3W2VA 1NJZA 3P4IA 1TELA 4KHMA 3ZZTA 4KJIA 3WBZA 1QD1A 1RADB 3SSRA 2DGUA 1EKSA 2V4QA 5EVZA 1GLFO 2HNYB 1KRPA 4IFYA 4Y0WA 1VBYA 5FLXY 1VQKN 4CLZA 1T3VA 1YJ7A 4C8YA 3OY9A 4CZIA 2O8FB 1BY9A 2XLIA 3SEOA 1FF2A 3EDRB 2WOMA 4WU3A 4JI8K 2E5HA 2DGQA 4CGIA 3MD3A 3THXA 3PIPQ 3NH2A 4O0IA 4LVNP 4C9DA 4B3TF 3I8BA 3N5FA 3ZTQA 3ITHB 4BC2A 5BYQA 4M7YA 1QE1B 1KD1T 5AQLA 3W60A 1FT8A 1KFSA 4CZJA 3O3HA 3FK4A 3KMQA 1K0VA 2GQ2A 4HCCA 2HNZB 4RR5A 2EVZA 4EUVA 3K5PA 1RU2A 2ZHAA 3QGIA 4FXVA 5KFGA 3PDNA 3C6HA 2D74B 3GSIA 4JV5K 4FDFA 3KK1B 5BYRA 2EBGA 5KPTA 2AWZA 3PFOA 2CUYA 2ZDOA 4DLEA 2FB0A 2XY7A 3WXKA 3D1QA 3UFCX 2AX0A 4F7VA 3CMES 1C6VA 2FVCA 3IMQJ 2HFZA 1R7IA 4YOUA 4YHHK 2CJYB 4NB4A 4Y2AA 3PLAA 2P9PB 3CETA 1VQKS 2V52B 2C2DA 2IVPA 3W61A 4E19A 5GAGU 3GE1A 2UVWA 1UFWA 4OKJA 3W7BA 3UN5A 3HRGA 4OLOA 1BQNA 1NU4A 2Y0BB 2HQCA 1KTQA 4USJC 3OYJA 3TRGA 3ENQA 4TNOA 3DRSA 3IR6B 3R9PA 3QRPA 2Y1LB 2YWWA 4RW9B 1U48A 2G8IA 4DL5A 2GO9A 4E2FB 1G6BA 3LAKA 4DEZA 2BABA 1Q7LB 5JMVA 4CGFA 3ZCMA 3BR9A 3AB4B 1NMNA 2UU9J 2I9SA 4OZNA 4AM7A 1BHNA 3P83D 4JKDA 2D1CA 3NNHA 1Y9OA 1NBWA 3JS9A 3AQPA 2DEIA 4ZPAA 3EL2A 3NFAA 5LMUK 4P9SA 5CYJA 3OPKA 4B3TJ 3CMEN 1EX4A 4KAZA 1NGDA 3NOGA 4LC9B 4H0PA 1N5QA 5ETTA 3I87A 2XY6A 3KZBA 3J8AA 3G71N 2OMLA 2MKSA 2XY8A 1EQMA 2ALYB 3ZSWA 2YKNA 2DNOA 4K8RA 4KY3A 3MPDA 3UB5A 1HNIA 3CCLN 3OHBA 1YDLA 4LSZB 1TUGB 2Z2YB 5E3CA 4R79A 3IN5A 3NMAA 2UXBK 1DLOA 2DO4A 1I6JA 4W5QA 1N33K 2V5HG 1Q8KA 2MSSA 4NXNF 5GVQA 2A1RA 5A8RA 3SCKE 3LUYA 1TYQB 2EKNA 1NPRA 3A4TA 1S1XB 4H5NA 1CXQA 2QWNA 5GAEP 4UTGA 2EFNA 4RCHA 3HI9A 4X64K 2OEJA 4ER8A 2V2ZA 1UA0A 3CIMA 2YPYA 2DPIA 2MKHA 3CJAA 2ILZA 1HBUA 3QMLA 1T3OA 3AA2A 1R89A 2E1ZA 2D41A 2G2YA 2RKIA 2UXDF 3MM9A 2ZH9A 3DXKA 1TK5A 2F8TA 3LP3A 5CH7B 4NA1A 1HNIB 3OYIA 1H38A 2VWJA 2IA0A 1VJWA 1J5EK 1K73T 1AZSB 3OQ2A 4K0KJ 4A61A 3CC2N 2G1HA 2F9JA 1QY7A 3NWRA 2FTRA 2XC9A 4ILRA 4F50A 3GG1A 1RQ0A 1S12A 1GXLA 1K1SA 2GWJA 1QZ6A 2XGPA 4Q2MA 4B3RF 4LFAJ 3CCLS 3F2KA 2W25A 1VHXA 2VFRA 2NRHA 4MYTA 3TAMB 3HX9A 2ZH4A 1PGZA 1FEEA 3SCXA 2KHDA 3DRRA 1UFLA 3CCRN 2NSBA 2R3VA 4UOCA 2R8KA 1HNZF 3RWUA 5AXMA 2VFTA 3BO3A 1VSIA 2HQGA 4OZJA 3AO5A 1FFSB 5C25B 1BXNA 3VERA 1V4TA 3MMAA 4USUA 1Z6RA 3FEXB 3BYRA 2NRZA 2W8KA 3A0IX 3EGVA 1L3SA 5IQ6A 2WVBA 4ZLLA 3THTA 4JV2A 1D9FA 1C1BA 5IC6B 4KGXB 3E51A 2ZZTA 1T6DA 4BLGA 2BDPA 2HSTA 1FDNA 3BGFA 3KUHA 5DM7Q 2CJAA 3M32A 1ATNA 2YKAA 1HWIA 1G15A 3G4SS 2XSJA 2FLPA 3F9KA 2KM8B 4MK9A 3QGHA 4J5OA 4AXIA 1T44A 3QICA 1Q7YT 3AD7C 1N33J 3CC2S 4KE5A 4HKQA 1IQZA 5DRKA 4A8MP 4UUWA 3CC4N 4NI2A 1RA7A 4GKKF 2EX3A 3H90A 2ROGA 3OS1A 3GB0A 3MN7A 3FDSA 4A8OA 1S9EB 2NS1B 2IBKA 4H03B 3P38A 1FKOB 4J7CA 3AJ2A 2F1FA 4FJHA 3KLFB 4N8OA 2GMJA 2ZM6K 2HQ3A 1KVBA 3MAAA 3N28A 4EGLA 3NGIA 1AFJA 3A2FA 3NG8A 3Q22A 3K89A 1IBKJ 1TL1A 3PW0A 4IG0B 4FF2A 2DB1A 2W9BB 2OTJN 3L2UA 2XO6A 2ZUGA 2DYAA 5KFWA 5DGAA 1LKZA 4RKUC 3NGYA 4DR7F 3TW0A 4ZCMA 2RB7A 1NJIO 5HOOA 4F3TA 5ELZA 4MDBA 1P9YA 4EYIB 2CDQA 3U1LA 4O5FA 4LF5K 5AQQA 1I51B 2QEXS 3LANA 5HK4A 2F9TA 2VPYB 4X4UA 1NMDA 2GW8A 2X1BA 1KOHA 3HZGA 2E2OA 3TNVA 2VPZB 1P8ZA 2QKKA 3JYTB 2R7UA 3H25A 3L09A 3N79A 2QX0A 3L3CA 5LMUF 1RWWB 3N0VA 3CJ9A 2KFZA 2W9BA 4PZVA 3DMJA 3Q24A 4BG9A 4NZ7A 2CZ9A 4YY3J 4DKWA 2MQQA 1TL7B 4CEOA 4LIRA 3KNGA 3MDFA 3AAWB 2J0SD 4IOAL 4BRPA 4NXNK 4TYBA 3SV4A 2BM0A 5I4MA 1O6XA 1WN7A 3I4PA 3MWPA 3SJHA 1VQPN 2BJ3A 4ZLNA 1T05A 1RFQA 3MCAB 5BR8K 1RKJA 1FHTA 4CJSA 1ROFA 3G86A 5CHIA 3U8XA 1MMDA 2BANA 4YY3F 2J5AA 3KNAA 1HARA 2IVMA 3THVA 1Q95G 4LRFA 4UUXA 2RRAA 3DU5A 4CLSA 1PAEX 2HK2A 5A6PA 2IJRA 5T7BA 2YI1A 4YR3A 2I2YA 3R6MA 2JFKA 1NJWA 1DT9A 3PX6A 2E2NA 2OLWA 2HS3A 2AHOB 3OYAA 3DCAA 1FVSA 1R31A 3CJCA 1VLYA 1KVKA 3DXSX 2FQQB 1FD8A 3I4HX 4MTPA 5HVGA 2UP1A 3A3PB 4OPHA 1TK0A 1S6OA 2MZJA 1VHFA 4DR7J 3CULA 3CUNA 4ZVEA 4CZKA 1CPZA 5CZXA 4RUCA 3DLGB 3F5TA 2COLA 2MZQA 3NS7B 4P72A 4KBIA 2NPFA 5F8MA 3PJWA 2ALZA 2Q6BA 5KFCA 4DV3J 3US5A 3TAGA 3UCUP 2Z57B 2VOPA 3TUJC 4DR2F 4RL1A 4RO0A 4KTWA 3V9UA 4BE0A 4MH8A 3DGPB 4RW9A 3GILA 1RT2A 2HAFA 2G8KA 2DNQA 4ED8A 5KFUA 2GMLA 4CYUB 3MAHA 4WTOB 1VQ7S 4NRTA 3W0LA 5FRNA 3JS6A 4FM2A 1NCLA 1ZOTA 4DR1K 4FPBA 3SMSA 2QYGA 4LH5A 4YP3A 4PUOB 2CQ2A 4PYAA 4J37A 3TPQA 1NZ8A 4MLHA 3GG0A 3DLGA 2CA9A 3CDUA 2OFHX 2OTLS 1U0SA 1OY6A 1FNOA 1U2FA 5IC4B 3F56A 1FTCA 5KFPA 4ZPBA 1RGIA 2O8DA 2VL1A 1W2BM 3GCWP 1H74A 3ET6B 2D3O1 1MWMA 4CJUA 2CFXA 3BPDA 2QSWA 2R8HA 2PFFB 4BRMA 4WYWA 2OPRB 2W41A 1XNQF 4J91A 1ASUA 3QQCD 4U67Q 4LSLA 2MKYA 3AVMA 2ZD1A 2HHVA 3EVWA 5JVHQ 3TWHA 3GIKA 2ZJRQ 4FF3A 2HLTA 2R8GA 1WBDA 1YAGA 2IRXA 2J9DA 4XH4A 2OAUA 3M4XA 2OSRA 1T9WA 2FBVA 2VU5A 2P9SB 2AW0A 1SI9A 2VQFJ 4RW7B 3T9NA 4K4YA 1G7CB 3EY1A 5KFJA 2MSTA 3SFGA 3A5NC 4FLTA 2RU9A 3ET6A 1BI4B 5CY4A 3LO3A 4AQYF 3GP9A 2VDHA 3SV3A 5K8NA 2OPRA 4USMA 2C22A 2YKPA 2V8PA 3M9MB 1NGHA 5B0GA 3KMSA 4Y0FA 2DCUB 2PBDA 3RB0A 3TTDA 2HZVA 1REVB 4LFBF 3BN4A 3FZKA 4X4QA 3W62A 3QIOA 4R0JA 4WQ4A 2IFXA 3ZNUA 1NK4A 2DRBA 5L38A 4CHNA 4DL2A 3ETOA 3MEEA 2D5RA 3MI7X 1EIYB 3H0PA 1M0SA 1VQSA 3LA0A 4LF6J 1T9YA 1ICEB 1NKEA 4CZFA 4DV5K 4RW7A 2RD5C 3U7JA 3UKUA 2AJ4A 1W7WA 1HNVB 5AQNA 5CAAA 4OX9K 3ELHA 3M05A 2GS8A 1YXQA 1LAVA 4IH6A 3PFEA 3GCXP 4H5TA 2HRYA 4DTSA 2O01C 3O9TA 4CD3A 3MM8B 1S5JA 2DGTA 2E2QA 1FRLA 5AR0A 2HIQA 4Q44A 3HHLC 3C46A 3K57A 4LRAA 3W66A 2KQ2A 2W2MP 4W5TA 3H2VE 3IG1A 4RWTA 2CADA 1JJ2R 1X4FA 4X64F 2FBYA 2X78A 3O3FA 1M90T 1X8DA 3NAEA 2UU9F 2E1MC 3IP0A 4M3WA 3ZTOA 1IBKK 2Q1NA 4IO9Q 2VG6A 1YHQS 3KKRA 3FQLA 4Y3CA 4USVA 1M5HA 3MCMA 1N5YB 4LFCF 1ZBTA 4OV1A 3I0RB 3P5JA 2P51A 2Q66A 3BDEA 4FLWA 1X7VA 4CJ5A 2B8QA 3HTVA 4K4UA 3PJ9A 4CP5A 4C48A 4QWAA 3RMCA 3J81U 4JV0A 1JJCB 3J81j 1RAJA 2IY5B 1N8RO 2UUWA 1H98A 4KKOB 2O8CB 3CQXA 3EGNA 2HNDB 2XTJP 2DHAA 2VWKA 4LH4A 3QZ8A 2POKA 3RAXA 1KVCA 3KDNA 4CF2A 4BVPA 4PXCA 2V51B 2A10A 4GKKK 2QZ8A 5IT9O 4PAAA 1HHQA 1DFDA 2HYIB 4AHTA 2ZITA 1IBMF 2CWXA 1RB0A 4AL6A 5GAEU 4K4TA 1A7GE 3Q8UA 5LXRA 4JRQA 1SJ4P 2UUBJ 5F1XA 1Z25A 3BSCA 2C1EB 1WLJA 2OPPB 4DV7F 3CJBA 2WSEC 1XNQJ 5M1FA 4UOGA 4PABA 2XO7A 1BCOA 5C24B 3K0SA 3QSIA 3PYFA 4TN2A 2CXEA 3HHKA 4LF5F 3B8HA 3BB5A 3IR5B 2K7KA 2V69A 4GKJK 2RHSB 4HHHA 3MCSA 1RT6A 4LBIA 2ETJA 1XMQF 1IBLK 3PZPA 3VCDA 5ETKA 1FRIA 3MUTP 3CO9A 4C4WA 2D0AA 3TTFA 2D0BA 2FC0A 2VD3A 4NEYA 5I42B 1VLOA 4KT0C 1JJHA 4FJJA 1K1QA 4OHZA 3MCOA 4IR9A 1SKSA 2ASJA 3MZIA 4WIQA 2BE7D 2XMMA 3D4JA 3VQEA 4YOTA 3LDQA 4WCEQ 3P5BP 1GTEA 3MPWA 4ZVOB 4CGHA 2WSFC 1BISA 3GJQB 4N77A 2XZWA 3IAS9 4ZKAA 3KDOA 3AA3A 5ETVA 3R5JB 3AQOA 1FX4A 4QOTA 3R9LA 3R5CA 1FJGJ 2UYTA 1B99A 2JZ5A 3OTBA 2XS7A 2JNJA 4BGBA 2WHOA 4OFZA 3X1LB 1NGCA 3ASMA 4A46A 2C2KB 2DR6A 4JI7K 4M3UA 4FS2A 2M9KA 3CCUS 1SUQA 2XMUA 5B09A 3EVOA 2V34A 2SXLA 3NF7A 1C0UB 1L3TA 2B4UA 1RDDA 3FMBA 2NRRA 2XMJA 2PYLA 3G4SN 1UWAA 4DBQA 2UUTA 4ZVGA 4DL3A 5C15A 1X4AA 1VBXA 4YB7A 3TUZC 3OBWA 1HYSB 1I94J 4IH7A 4HHTA 2C2MB 1D3WA 1TYQA 4I2QA 3BGRA 1HKAA 3P31A 3QFHA 3EE3A 3FEYB 5AFUH 2PN6A 4ETXA 4UY85 3NAIA 4CI0B 1ZA2B 2B6AA 1NK8A 3BV8A 2ZJQL 1HWJA 3M2UA 1JCEA 3VAHA 2D1KA 4JEPA 4NMXA 4LF4K 3LWMA 4KBOA 5HRNA 4JYAF 1X9MA 4NCGA 2JH3A 2QIFA 2GVDB 2E6LA 2RKIB 4ILMA 4A8YA 3AY9A 2VG7A 3UE5A 1HQ2A 4K4SA 3FVYA 2CYYA 2UXDJ 4CF1A 3FGUA 1MU2A 4WFAQ 3BF3A 4F04B 5FLXU 1KD1O 4TQSA 1YI2S 1S6UA 3O44A 1BG3A 2H65B 2IGIA 4CGJA 3NMUA 1MWYA 3DHWC 1J53A 1HBMB 4M63C 3OFEA 1C0FA 4O3PA 2OJ3A 5FJ4A 3GMGA 3VTIA 2QWOA 1UA1A 3SIPB 5AQSA 4M5DB 3GJRB 1NB7A 3M5RA 1E6YB 3GPAA 1NZAA 3M6UA 1I3AA 1XI1A 2DNYA 3Q83A 3OBIA 3EWGA 2XI3A 4YFUA 3NCQA 2XI2A 2DTUA 1VBZA 1OIAA 1OYEA 5HO4A 3DYAB 1EKEA 2Y8YA 3HBTA 3N4QA 1PKUA 1U2CA 3MCPA 1Z05A 1RI7A 3CCWA 2KYZA 2PMZD 3RBXA 2GJ2A 3A1YG 2P9SA 5T14A 4JI4F 5HJXA 1HBMA 4KI6A 2P5GA 1D09B 1XQSC 2XSJB 2APOA 4ILLA 5D78A 1FRMA 2HNYA 2CPEA 1T03B 3HYFA 4Z4FA 5M2RA 4QIWD 5K5MA 4LF8F 2HFNA 4J9LA 3FKBA 5KT7A 1W2BR 1C0TA 1DQ9A 4KH1B 1IUJA 2HQIA 4JI3K 1VQLS 3J80U 3A3OB 3QPIA 4ZA1A 2A41A 4EMDA 3T19A 3QIPB 5DQGA 3O2IA 3MR5A 2R2SA 1X9JA 5M1OA 2PFUA 2V8GA 2P1JA 3ITHA 2CQ3A 2UV8A 4QS7A 2KG1A 5DG8A 2CQ1A 1RT3B 2YNHA 2AD9A 2CGJA 2IDOA 4DTNA 3LDOA 5IWAJ 1M5VC 4NXMK 1SZ2A 4Z4IA 3GQCA 5HRPA 1O8BA 2Z0GA 3N6LA 3EO3A 3V9WA 2U1AA 4L73A 2MLYA 4KGKA 1NLVA 3VAGA 4I6MA 4AXJA 4Y6IA 3HPOA 2BW2A 5D3GB 4U7UD 4DQIA 4DR5K 3SPYA 3HVWA 3VEZA 2KT2A 2FZCB 2QT7A 2JEFA 3Q8RB 1I94K 3MM5A 3M30A 1JK9B 2EC0A 4UY8O 4EBDA 1UEUA 3KK3A 1FX2A 2D0PA 1MWKA 1URNA 4X4OA 1VCTA 1QUVA 3CCSN 4X2BA 1VQ4N 1IKVA 2NYHA 1WACA 1EHWA 3BZQA 1U09A 5L8RC 3JYTA 3LDSA 1OQ6A 2CNKB 4NYPA 2B8PA 5IFMA 3ATUA 5EWFA 1D4XA 1V3SA 2ASPA 2WB4A 3DXMA 3SUQA 3H2UB 5JUMA 3CD6S 3HJVA 2PAVA 4I6MB 1VFJA 4YUDA 3OVAA 1N5YA 3WZ0A 4FW1A 5C2DA 3QT8A 5ETPA 4MIBA 2OP5A 4WFYA 1CS4B 3OL8A 4KHSA 1XERA 3W9IA 1VQMS 1V3ZA 2CIMA 3VQCA 3NCIA 2HGNA 3SMZA 3GR0A 3JTNA 4FKYA 1PBAA 2OEMA 2M5YA 4KRWA 1EAYC 4DPOA 2BJ1A 2WK4A 4GRSA 3ZZRA 2BOPA 3ISZA 3U3YA 1SQFA 1NOYA 1RHRB 1N32J 2RSQA 4KGVB 2MZ1A 1REGX 1XK8A 2IYIA 1KCFA 5CZVA 5DDRC 4LQ9A 4HDGA 1W7AA 5KG6A 1S10A 2ASMA 1Q81O 2VC0A 1EARA 1N56A 1U45A 2GHVC 2PSZA 1VRUA 1NGEA 2ZOGA 1GMVA 1ZAXA 4DL4A 4I7FB 4KH4A 4BHQA 2ZH3A 2QG9B 4CTAA 2WTUA 4IDHA 4DR3K 3CCJN 2F96A 3R1XA 3CDAA 2IM3A 2RQCA 3CYMA 3VZIA 1Q82O 4CNYA 2QWPA 1W26A 4JV1A 2ZH2A 5M1PA 2OPPA 4ED7A 4ALZA 4NOHA 5D15A 3O3LA 4CZGA 1SH0A 4OPAA 4ENOA 3FSXA 2OCEA 5A8RB 1V5VA 5GADU 2K7JA 1S1XA 4GV6A 3RVCA 2NZCA 2RHKA 2D0CA 1VQMN 3ULEA 3C2PA 4FF1A 5KFYA 2C2RA 4DSFA 1HBUB 2HBQB 1VRUB 4L74A 2XHBA 2GV9A 3V9ZA 2ZWHA 4K4VA 1Y3JA 4O0NA 3H3NO 4I7FA 4K59A 4PKHA 3GYNA 1S97A 2Q31A 2A3JA 4CEEA 1BWEA 4CH7A 4GKJF 3VV2B 3D67A 3Q7BA 5KFQA 4Y2MA 4FJ7A 2JC1A 3AA4A 3AB2B 4I6YA 3M2VA 3OYLA 4Y2CA 1NM1A 4CYUA 1B92A 4AHSA 2F7TA 4DU3A 3LZJA 5M2UA 3DLBA 1K8KA 4QWBA 3A5MC 5CABA 1WG5A 3CCJS 1P1TA 2J7UA 4MLEA 4A57A 1WDTA 3J81Y 5AFUA 3POTB 1ASWA 1WEYA 2UXCF 4DQSA 1NKCA 3MR7A 2CPHA 4I68A 1QQOA 5BRHA 3BO2A 5C25A 5KGWA 1UAWA 1AROP 1RDRA 3E9OA 3KWIA 4DV1F 3G6ES 4CE9A 1FD2A 1TZ0A 1VS3A 4HEA9 3AGKA 2HWHA 4RW8B 1RWKB 1RTJA 1LWFA 4WPAA 2RILA 1C1BB 4CF8A 1RZMA 3OLAA 2XGQA 2HHTA 2E9TA 3KTQA 2GZOA 2MPUA 2NZ4A 2XLKA 3KLVA 3O4NA 4LSLB 3DOLB 1VQ8S 2P9LB 3AH6A 2PGCA 3RG6A 1LWCA 4MFBB 5KQDA 3S41A 4ETZA 4NRUA 2UZAA 1Q5VA 5JMNA 4B1VA 1MNEA 5E3RA 2BZ2A 3ENVA 3SCJE 2DGOA 3M8QB 4ECYA 3EE9A 2ATQA 3R5BA 3UCZP 2H1YA 1FDDA 1Y7PA 2ZWPA 2DNHA 4ERDA 3M2UB 3KLHA 2DHXA 3GFZA 5G0RA 3CDBA 4G1QA 3OFFA 1LWEA 2W4PA 2YBVA 1CVJA 1NK7A 3C6AA 3R5DA 3GIMA 1ZAVA 2Z1HA 2XMAA 1BQMA 1FKOA 2W9AA 1D9DA 1LQ9A 3MXIA 1Z2ZA 1BDGA 2FJBB 4H5RA 2O8BB 5HQ8A 1N4LA 4LRCA 3DOLA 2FBXA 2QXLA 2N82B 4H5WA 1REVA 1HKBA 2V4JB 4IG0A 2I7NA 2QMWA 2KG0A 4NLUA 4USTA 4QWDA 2GGPB 1VK3A 4AILC 4G6VB 1RYRA 3JSYA 2PZSA 5I3UB 3IS9B 1QVGM 4L3NA 5C2CA 3CCQN 3AFGA 4X62F 2VPXB 3BGLA 4DQPA 1RBTA 4BC9A 3MXHP 4FYWB 1YK9A 5AJ3K 3QEVA 1RWVB 2HBMA 3SQOP 3NCPA 4F4ZA 5D8HB 1N34K 1VSJA 3OYEA 4MKVA 1Q78A 3D54A 1OYDA 1XIQA 3UKUB 3O1WA 3LP1A 1AXQA 3C66A 2XYGB 4LBPA 2X1FA 3Q8QB 4I0WA 3HVRA 2NREA 4GC7A 1QHAA 2KTQA 4CK2A 2G13A 4M3XA 2VODA 1D1UA 3I8DA 2QYCA 2ZWOA 4D3HA 3CWJA 1SL2A 5KFLA 2RE2A 1QZ5A 4MJKA 3AXMA 1WHXA 3TWZA 1IKYB 1UPMB 3IMXA 1XNRJ 3VETA 1Q8IA 4FZZA 1TQLA 3AJDA 1OWXA 2KZZA 3M9OB 1NNEA 2GC8A 1PC4A 3LPTA 2J0XA 3SXLA 3OL9A 1NPKA 3PRVA 1JLCB 4KH6A 2R2UA 2DY1A 1JLAA 2HVHA 4ECVA 3NNAA 1SKWA 2CPZA 3D28A 4TSXA 4IDKA 1NGAA 1UL3A 4OHVA 2UXBJ 4WWSA 5ETSA 4YDUC 2KFYA 3O8WA 4DPUA 1S1TB 4AF1A 3VQQA 3CD0A 2ZUAA 2XB2D 5MLCV 2XCPA 4CFCA 4CJKA 3SMPA 2ZM6F 5A2QU 1XC3A 2QN6B 3MR3A 4X4VA 1SS6A 1PBUA 1WC4A 5A0YA 2CQDA 4ECSA 2ASOA 4OYAA 1RACB 3E1YA 1VRTB 1VQ7N 8ATCB 2ZH7A 2HNDA 3SK3A 3CCMS 5DG9A 3D7EO 4CLPA 4NA3A 1YRTA 3O4WA 3RZAA 2CVIA 2VOOA 4K25A 4ECRA 2GIFA 2MJNA 3AHPA 1OSDA 4DV5J 4B9UA 3G6YA 2VBYA 2ACYA 2V63A 1X4EA 1TMJA 4HACB 3SBMA 1E3MA 3HL8A 3MMVA 3AT1B 3LF0A 4URQU 5AE3A 4ED5A 4ILHA 1IKVB 2JVOA 4KHUA 3MM6A 4GKKJ 4E7KA 8AT1B 4K2JA 3W3SA 3CPEA 3UIQA 2C3MA 1TKTA 3CG7A 5HI7A 2CQIA 5J2MB 4DR6K 3KG1A 1CJUA 3D3BJ 2IAJA 3H4DA 1WTBA 5ITHA 4AUKA 1U1QA 3QETA 4JI8J 3ZT4A 1SIZA 2YWEA 1F6TA 5KAKA 1JNRB 4NXMJ 1YQHA 1S7HA 1QQMA 5AXNA 2C2EA 2LQJA 1T0TV 2IJNA 3T7ZA 1WKLA 4O5BA 1VQ5N 4M8LA 3GDQA 3OR1B 4Q0BA 3QGPA 1HPMA 1K73O 1IO2A 5L1JA 4B8AB 2ZH8A 4CJEA 3DLKA 1KOOA 4H4KC 1Q1KA 5BYSA 3ENWA 3N6MA 4KPYA 3CD7A 3O9RA 2RIJA 1S9FA 1JCGA 4M5MA 1VQ6N 1C1AA 2IDLA 3F0NA 2YXLA 4LF7J 2R7YA 4JKGB 2VQFK 1RWOB 1HL6A 1N0VC 4EK2A 4O44B 3D1HA 1BWFO 5TKWA 3M9NB 5J2PB 1F3VA 3RSEB 3KKSA 3Q8VA 1MN9A 1RBUA 5A8WA 4WFNL 2H3EB 4CZHA 2QWRA 3VQTA 3IFRA 1T9TA 3BKTA 1YTAA 1SUQB 1S0OA 1PC5A 4W4MA 3PCOB 2XLJA 4L72B 5KPZA 1GQEA 4PG4A 5BPMA 1WOOA 3ULEB 5E84A 1GMWA 4DU7A 2IJFA 4NLGA 1RAAB 3TSQA 1RXOB 3VHQA 5DDQC 2H9ZA 4X65K 5E3PA 3SPZA 3MTKA 2R4FA 4LF5J 2E8AA 1HYSA 2C42A 3H98A 5LXYA 1RBLA 1WAFA 3ZZUA 1NJXA 4JYAJ 4YQWA 4HVZA 3E9LA 4Y28C 2LU1A 4RNFA 3VESA 5FLXO 2W7AA 5FPNA 3L7UA 3H5UA 3KHYA 4CJVA 1RDWX 3NH0A 3J7YU 4DUTA 2UUBF 4OYZA 1QDUB 3RR7A 5K9FA 3BQ1A 4BY9C 4EYHB 3M1FA 3EKUA 5I9EB 1N8RT 1IBMJ 1WNEA 2BKPA 4P2FA 3GWCA 3POTA 4G1IA 2ATCB 1YBUA 3CJSA 4TLRA 1YTYA 3EZOA 4C3KA 4CEQA 2XWYA 1WAJA 1IKXB 5H1SQ 1S59A 4CESA 1X5PA 2IM2A 1FO1A 2FY8A 3HI0A 3KJVB 4MKAA 1DURA 1ATRA 3PEHA 4DQRA 4FVMA 5A6WA 2BQ3A 3SFUA 1CLFA 5J1EB 5JVGQ 1RBRA 1M1KT 1DRZA 1HMVB 1S1WB 1D5AA 2WVFA 1RUSA 2WW8A 3OTCA 3CPWR 4YOEA 5M2PA 1LWCB 2DNRA 3TR5A 3V9SA 3TARA 4ECTA 3PO4A 4GVLA 3OHRA 4DR4J 5KFKA 4LMZA 1AB8A 7AT1B 1XMOJ 5HN0A 5H9EK 3CIZA 4CK3A 4PQAA 2R7WA 3DLHA 4K8XA 4M7XA 1XBWA 1QVFR 1EXQA 1S22A 4ELTA 3MMAB 1JNZB 1JKHB 4G1QB 2K2PA 2O67A 4MT1A 1DQAA 5DM6Q 2VASA 2H48B 1UPPA 3TA1A 1RK8A 3EGWB 1K9MT 3OW2R 5AQOA 2H5IB 3CJKB 3QSYB 4AM6A 3ADAC 1ZBLA 3S6EA 4PPZA 4JI3F 3M8SA 3M32B 2NPIA 3RMAA 3HP6A 1LAWA 4KKOA 3QFUA 4TQRA 3R2CJ 2D69A 1J5EF 3LP2B 2A6AA 2PIIA 3FLCO 2FHMA 3DAWA 1IXKA 2XWXA 1SH3A 3KWGA 3MXMA 3O1BA 3NY0A 2HHUA 2NUUG 3NMRA 1OH7A 2E44A 3OR2B 1HQUB 3OYDA 4B1ZA 4H4OA 5CYMB 2E5LK 3IWNC 5DM6L 2ZVSA 1GLJO 3PG9A 5EHHA 1VQYA 5L1KA 3KLFA 1FRKA 4J9UE 4O3OA 3F9MA 1RAHB 2KKZA 3MUVP 3VEVA 4EHTA 4NWBA 4E3SA 1SC1B 1VC6A 2N3LA 5FIIA 5KG4A 1HYVA 3WQTA 5E33A 4Y00A 3DRYA 1NM2A 3BEXA 3QEIA 3ISNC 1IR1A 3TEGA 3K17A 4CT9A 3CCUN 5K20B 2J6SA 2VONA 1N34J 1YKWA 3P45B 1VC5A 3AAPA 4CW7B 1JLAB 3M6XA 5BREA 4B8CA 2Q97A 5HROB 3RMBA 2P9GA 2XNQA 1QTMA 3I9V9 3MEKA 2QLXA 2AMCB 1OY8A 3BJYA 4CQ1A 2B4JA 2G8UA 4UY8T 2PFDA 3HM8A 2RS8A 4MDAA 4AHUA 5HQMA 4Z4HA 1HBOA 3L8BA 4JI2F 3RB6A 3PRDA 1S79A 2MHEA 2YQ0A 2BYCA 3T1YK 4ZK7M 3QJJA 1TMMA 4C0BA 3D7SB 2P9PA 3O1LA 1RAFB 5M1QA 1VQNN 3BKFA 5ETQA 1KQGB 1VK0A 2YKMA 4HVJA 2DH8A 4I2PB 1VI7A 4WFXA 5FRMA 2B56A 3E2EA 2Q79A 1HKGA 1HI0P 3FE1A 3EVMA 2I8EA 4XDDA 1ITGA 3VEYA 1TKXA 4RNOA 3EM1A 5H9EJ 1IQTA 4PYDA 5E5NA 2RUGA 2QTDA 2HGLA 1UVIA 3LGNA 4BWJA 4EBCA 2CKWA 5GAGP 3SQ2A 2YWKA 2HSEB 2YWFA 1K6YA 3L95X 4DUYF 4Z4GA 4W90B 3LQVA 5A8KA 2GUPA 4GVEA 1HNWF 4QQBA 4AQYK 2KJWA 3PX4A 4RX6A 2ITGA 4JI7J 5J2MA 3V6HA 4I2QB 1GAOA 1O13A 1KHWA 4IRKA 4JI5J 1FXRA 3CJTA 4FWLA 3HD2A 1ZBSA 4FK4A 1KSPA 4W98A 3A8EA 2FSJA 2FPHX 4C8MA 2Y1JA 4LF6K 1B0TA 4NLRA 3QAUA 3ISND 2DISA 3M6VA 2E5LF 2G8HA 3A5OC 4DUZJ 3O9QA 3OR1A 4UW2A 3BSNA 4P2SA 2HW3A 1B0PA 2R7SA 1WORA 5ETRA 2PA3A 3CB4A 3G87A 3A3NB 1Z2LA 2ACMA 5BPNA 2KHCA 5A8KB 3RAQA 1JX4A 2AV5A 2QJ3A 1WF0A 4X66J 3GBTA 1KP6A 2HVEA 2ZBPA 2X7IA 3D3CJ 3TTCA 4NLYA 1FDBA 5C10A 3WXIA 2QW9A 1S1VA 2FUG9 4CLTA 4B1XB 4B3MK 1UMJA 4DTUA 5C0YA 3MN9A 2YHXA 3KYLA 3C7NA 2FIUA 3RW7A 1E6VA 3FZ2A 4WK3A 1JIHA 1VGYA 2B9XA 4KB1A 1WKJA 2R7TA 2YWHA 3MD1A 4RW8A 4CZMA 2KFNA