3LANA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-butyl pyrimidinedione non-nucleoside inhibitor
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 160
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lanA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lanA05
5L1JA 5KG0A 1F21A 1NOZA 4YR2A 4CJKA 2YNIA 1JLGA 4CK2A 4CJLA 3D45A 4FXDA 4OL8A 2J6UA 3MEGB 1S6PB 2XY7A 3UIQA 1Z25A 5F8HA 4NCAA 1OS5A 1NJZA 3AVKA 3BSNA 2OH2A 3BSCA 4FJGA 2ZD1B 3IG1B 1T03A 5KFGA 1S97A 1NJWA 4G1QB 5KFTA 2W8LA 1J54A 1SH3A 4FCYA 3DRRB 3H5UA 3I5AA 3RB3A 1D0EA 5F8JA 3V4IA 2UVRA 2G8HA 4MK7A 4N41A 3L3UA 3NF7A 3LANA 3HKWA 4QOZB 2FJWA 3DRSA 5KG4A 5F8LA 3V9UA 1Z4UA 2CKWA 3PR4A 4J9LA 5EWFA 1NOYA 5J2MB 4NYFA 1LW2A 5C42B 5KRSA 4DG1A 2W7PA 4DTXA 1W0HA 3L2VA 4CEEA 3O4NA 2HW3A 3KLGA 4F4XA 2FBXA 4ED8A 3LPTA 3MR3A 1S9EB 2C2RA 2KQ2A 3AA2A 4M3UA 1NHVA 4KHWA 1JLCB 3V1QA 3V81B 4RNMA 4ECZA 4DFMA 2BQUA 5HRSA 3I0SA 5KI6A 5C25B 2HHVA 4C8LA 1T05A 4Z0UA 4CF1A 4DQPA 3OYNA 3H08A 2A1SA 3KLVA 5J2NA 4KTZA 1KTQA 2BQRA 3LP0A 1RAJA 4W5TA 3RB4A 3B6PA 4PUOA 5DG8A 3SYZA 1EXQA 1KFDA 1ZETA 2FBVA 3EY1A 4DLGA 1U49A 3CVKA 4Z4GA 5JXSA 2VA2A 4OLAA 2YKMA 1DTTA 3VQCA 3MFIA 4ICLB 3SUNA 3NF6A 5DG7A 1HRHA 1ZBFA 5KFAA 2HAIA 1QHTA 2YNHA 3RR7A 4R8UA 3OL6A 4IG0A 4EP5A 3MR6A 4WFZA 2RN2A 2FLNA 3SI8A 1SKRA 1HQEB 4KKOA 3PO5A 1NJYA 4WXOA 3DOKB 1RBTA 1S6PA 3ICLA 2E9RX 1N56A 3OS2A 1NK8A 2IJNA 3VQ8A 3H2LA 2UUTA 4KI6A 1WSHA 3TAFA 4TQSA 3GYNA 4G1QA 3HVAA 4Y3CA 3DMJB 3K2PA 4ZMMA 4B8CA 3ULDA 1NK4A 1C0TA 3L2UA 4ED3A 1FKOB 3HK2A 1RYRA 3OYCA 3CFOA 4RNFA 4K8ZA 4Q5VA 4M45A 1RILA 4B3OA 2HHWA 5JS1A 1KHWA 2OPQB 4O4GB 1BIUA 3K58A 1S48A 4CJWA 3AO2A 5J2MA 4GMJB 1L5UA 3I5BA 1YT3A 5KG1A 3FFIA 3DLRA 3DM2A 5KT4A 4IRCA 5C24A 1KHVA 4ZTJA 2DPJA 3HVWA 5E41A 2BANA 4YR0A 3P1GA 1S0NA 3CJ3A 4JV2A 1SL2A 4WFYA 5KFYA 1KCFA 3VQDA 4N5SA 1C1CA 4FJLA 4CCHA 3HM9A 2UUWA 4M94A 3QLHB 4DTMA 1CXQA 2J6TA 4DTJA 1U45A 3KK3A 3PX4A 4CHYA 1HQUB 1FKPB 1IKVA 3HXMA 1IKWA 4QWBA 1CZBA 4PA1A 4O0JA 2R8GA 5T14A 4CGHA 1NK0A 2FVQA 4E7JA 2OPPA 3KLHB 2D7SA 2BE2A 2QXFA 2ZE2A 4ICLA 3BQ2A 3KHGA 4DSEA 3M8QB 2XC9A 5EUHA 3AVCA 5L1IA 4JRQA 3QETA 4DFKA 2OPSA 4FBUA 4CE9A 3OYIA 3NDKA 2G8IA 2FVPA 3V6DB 5KFBA 4PY5A 4K4XA 4CHOA 4FK0A 3LWMA 1O1WA 4NLTA 2OZSA 2XRIA 4ED7A 1HMVA 3SQ1A 2Z1IA 5J1EB 2JLEA 3K5LA 4N76A 2KZZA 4AHTA 3DOLA 1TKZB 4WXWA 4OKEA 4MIBA 3LAMA 4IQXA 3EZUA 2VG7B 3UQSA 3LPUA 4CEAA 4Z4EA 3K5MA 3TI0A 3DRPA 1SH2A 3G0ZA 4KV8A 4KE5A 3ZT3A 2IC3A 4K4WA 1QAIA 3OYBA 1FKOA 3PO4A 5FDLB 2RKIB 3N6MA 2QE5A 3M9OB 1HYVA 3DI6A 5CZ2A 4XPEA 4F2RA 2OPQA 4O4GA 4I2QA 3TWHA 3HPGA 4FLTA 4DL6A 2OYQA 1VRTB 1IKXB 4J9KA 4Q8FA 2WOMB 4CGJA 1RNHA 1R0AB 4DSFA 1I3AA 1UOCA 2W7OA 1TKTA 3MXIA 2E9TA 4CEZA 5KFLA 4KFBA 4KSEB 5KFEA 4B9NA 3KK2B 3S9HA 1J5OA 3VQ9A 1SKWA 4FZZA 4TXSA 4ECWA 5KFNA 5KFWA 4ZP9A 4CJPA 2G8WA 1K1QA 4FVMA 3IS9B 3G6VA 2DFHA 4DTPA 5C5JA 2LSNA 4DSJA 5KFFA 4NLSA 3ZT4A 2ALZA 4K4UA 3SQ4A 1C2PA 3G86A 2HNYA 3AVIA 4ECYA 3QZ8A 4CJ5A 4ED0A 3HPHA 1S9GA 4BWMA 2DY4A 2OZMA 3HP9A 2R8JA 3L3VA 3ZT1A 4FYDA 1TK5A 1RTDB 2G8FA 1LWEB 2BR0A 5L9XA 4LSLA 5JS2A 3M8QA 3HPOA 4Z4FA 1ZBLA 1RT6B 1NK9A 4RW4A 3WNEA 4EEYA 5F8GA 4WYLA 4CFCA 5KG3A 3IRXB 1QE1B 3CYMA 5I42B 1RDCA 5KFSA 3QZ7A 2GV9A 3TAQA 4NZ0A 1RT7A 1RT2B 4KB0A 1K6YA 3KOAA 4FLZA 1BQMA 3MEEB 3L2RA 1TKZA 2QKBA 4B9UA 4CK1A 1VRUA 4AHCA 2C28A 1VSLA 2KW4A 3NAIA 4O55A 3OYLA 1LWCB 4FJJA 3D28A 4J9PA 4KO0B 4DTOA 4OGEA 3KLIA 2YV0X 4J9NA 4RW8B 1BI4B 2RKIA 4I2PA 4DFPA 3HVTB 3DLHA 4Q8EA 1FK9B 3RTVA 1LW0A 1BIZA 3LZJA 3HYFA 4M3WA 1IKXA 2WOMA 4CJ4A 5KT7A 3EZ5A 3QNNA 3MAQA 4CJ3A 1SH0A 1LAVA 3KK2A 2IM0A 1ZBIA 3U3YA 2AX1A 3E51A 1RT4A 5HBMB 4LSNB 1TKDA 1EETB 4CESA 4K4SA 4Q44A 1VSJA 2JEGA 1KLMB 4BACA 4WE1B 3KMQA 3NGYA 4W5RA 4TN2A 1ZTTA 4J2BA 4FK2A 1VSIA 3T5KA 4E7HA 3LALA 3NF9A 3KLFB 5F8MA 4TYAA 1QSLA 3AVFA 3VQ5A 1TV6B 4ZVHA 2HVHA 3Q8QB 2DTUA 2F8TA 5DGBA 4CEQA 1EP4B 3D0PA 3GV7B 1LAWA 2IM1A 2JEFA 4CF0A 3KLEA 4EBCA 1L3SA 3BGRB 1RT5A 4YNQA 2UVUA 1DLOB 3RB0A 3IRXA 3NBPA 1QE1A 4ZPAA 3JSMA 5KG5A 1T3NA 1TVRB 3QEWA 1RCHA 1RDDA 3DYAA 1RBRA 3UDLA 3TABA 4BE2A 1S1XB 1JLAB 3PVXA 1N6QB 1TKXB 5CYMB 3LP1A 1YTAA 4Y34A 1MU2B 2R2SA 5KFQA 4O0IA 2YNGB 4AILC 5KG7A 1BQNB 1WN7A 4UQGA 2ITGA 4CECA 5J2PB 3KD5E 4QPXA 3VA0A 4NCBA 4J2DA 2I1RA 1RTIB 4IFVB 1L3TA 4CJVA 3MR2A 3KHRA 1B92A 4EBEA 3L2QA 3AA3A 5KRTA 5KFJA 2HWIA 5KFCA 1HYSA 4OLBA 3FQKA 4ZHRA 3MECB 4CJUA 3KIOA 4RU9A 3QGIA 4MIAA 4FLYA 4FLXA 1N5YB 2R8KA 4E7LA 3SPZA 4ZP7A 2W8KA 1JL2A 3I0RB 1QSSA 3ITHB 1JXEA 1G15A 3OJUA 4GC6A 4TLRA 4YFUA 4LSNA 5HROA 1Y97A 3CG7A 1KLMA 2PYJA 3PJWA 3T5LA 4G3IA 2JEJA 3VQ6A 4M41A 3KKRA 5HRNA 4Z4CA 3KLFA 4RW6B 2IGIA 1C0UA 3BQ1A 1JLEB 3G6YA 4KB1A 3H5YA 4EO6A 4JRPA 4IR9A 4FW1A 4FM0A 1TV6A 1D9FA 4CEOA 4IFYB 3TAMA 2W9CB 5FRNA 1C0MA 5EWEA 2YNFB 2WHOA 1UWBA 2G8KA 1XR6A 4EZ9A 1NKCA 1TL1B 4AHUA 5KFMA 2QV6A 1S1TA 4MFBB 3JYTA 4Y2CA 4JS5A 3SZ2A 3SUOA 4KAZA 3ISND 4B9TA 3VQQA 2VWJA 3RRGA 4NLGA 3RBDA 1JLAA 3QEXA 2V0NA 5CYMA 4TY8B 2D0CA 1EX4A 4M3XA 3OYAA 1BQNA 1CXUA 2O4GA 5HRPA 1HPZA 3LP2B 4K8XA 1RT1A 1Q9XA 1RTJB 4C8NA 1JKHB 1ASUA 1W9HA 3AA5X 2IAJB 1RTIA 3TARA 3AVHA 5EU7A 4HHTA 1RTHB 3QO9B 4IFVA 4ZTFA 3NGZA 3RMAA 3O3HA 2VG6B 4CHQA 4FJKA 3DLGB 2R8HA 4NLVA 3AO3A 1HNVB 1N48A 2C22A 3MEDA 4I7FA 1C1BB 3TQ1A 4ZVGA 2ATLA 4ZVEA 2KZMA 2WB4A 3PW0A 3SCXA 4KB7A 3IN5A 4JV0A 1D1UA 3S3MA 4PWDB 4I9LA 3IAYA 4KHUA 1VK0A 1L3VA 4XIUA 2PZSA 1QSYA 3RAXA 1TL3B 4IRDA 3ITHA 1ZBHA 2IDOA 1XHXA 1JIHA 3K5OA 3MEGA 3HSTB 1TP7A 4J9MA 4NLQA 2OPRB 4EO8A 4DU4A 3PUFA 3U3GA 3PHEA 4KTWA 2ZD1A 3AVJA 4NYZA 1J9AA 2XGPA 1CZ9A 1SV5B 2BGGA 3IG1A 1CSJA 3CFRA 4YMEA 4IBNA 5KT2A 4Q0BB 3DRRA 4RW6A 3QIOA 1JLEA 4HCBA 2AU0A 4LH5A 4FS2A 4LH4A 3OS1A 2ASJA 1JX4A 2W9CA 4DTSA 1S0MA 3TAEA 4Y2AA 1YTUA 4RNOA 3K5NA 4ID1A 4K4TA 2UVVA 3OYHA 4XPCA 3KJVB 5C42A 4ED6A 1TL1A 3FQLA 5KFIA 2O4IA 3T3FA 1S9EA 2QKKA 3AV9A 2FJXA 3H5SA 1JLCA 3C6UB 3BR9A 4O3PA 3DDKA 3V81A 4E7IA 2X6SA 1WAFA 1C6VA 2BDPA 4ECRA 3MFHA 1S1VB 3KHHA 3PV8A 5C25A 4DF8A 4DQIA 4NLDA 4X2BA 1XR7A 3OS0A 4FJHA 5DK5A 3LP2A 2XHBA 4E7KA 1JKHA 1QQCA 3RAQA 4NCGB 5K14B 3THVA 3ZSYA 5KFDA 2VG6A 3ASMA 1WSEA 3CJ0A 3CJ2A 3T5HA 2IS3A 4AHSA 1NHUA 1EKEA 3NAHA 1XWLA 2XCPA 2D0BA 2XCAA 2B6AB 2RF2B 3ZCMA 1I39A 2VG5B 3ZT2A 1HQEA 1TL3A 3QGHA 3BSOA 2FLPA 2BRKA 1UA1A 3NMAA 3DOKA 3V9WA 1JLBB 3KK1B 3NCIA 2HNDB 4CGIA 3M9MB 1RBVA 5KT6A 4U6PA 1IO2A 2AGPA 5KFHA 4JV1A 4CJSA 1SL0A 4KAIA 3OSNA 4DS5A 4RW9B 1A5VA 4Q0BA 3DMJA 2JEIA 1WLJA 3CDEA 3SJJA 3QNOA 2IM3A 2HHQA 4H4OB 1W25A 2ILZA 5KFOA 5DQHA 2F8EX 1S1UB 3NFAA 4JLHA 1IG9A 4URQU 4IKFA 3KD1E 4IG3B 2HVIA 2X74A 1HNIB 4YP3A 3KJVA 4CEFA 2G8UA 5KFPA 3OSPA 3OYGA 1JLFB 3DLKB 3DLEB 2RDJA 4DL7A 3OHBA 2R2RA 3RWUA 3V6HA 3C6UA 5KGXA 2D3UA 3SNNA 5SWMA 4B9LA 1RBSA 5CY4A 1S1VA 4KPYA 1MMLA 4ECVA 1NKEA 3NGIA 3QLHA 4M3TA 1U4BA 1S49A 4CJRA 1HQUA 1FKPA 1S1WB 2YKNB 3GV5B 2X6NA 5K14A 4FZYA 1JLQB 4Y1CA 5KFKA 1Z26A 3KLHA 3VQEA 4H4MB 4MH8A 4AHVA 4B8AB 2R2TA 4E1MA 4CIFA 5J2QB 3M9NB 4F2SA 2P5GA 3OYJA 2FLLA 2J6SA 3V6DA 2HHXA 4CHZA 1Q9YA 5KT3A 4CHNA 5HP1B 4LY7A 3IGVA 5J1EA 4RUCA 5L1KA 4B9SA 1IKYB 1N4LA 1WSIA 4H8KA 4PQUB 4Z4IA 3RMCA 4FJXA 3C6TB 1T94A 2HNDA 5EWGA 2VG7A 4CIEA 3PW4A 1SL1A 2FC0A 4OVLA 3RRHA 2KFNA 3ZSQA 3GIIA 3WNFA 3LAKA 2WRMA 4HUGA 4O3NA 4RW7B 4NRUA 3RMDA 3QIPB 3H40A 3M8SA 1BCMA 1WAJA 4H4OA 5FDLA 1TQLA 4FBTA 2Z1HA 1LWFB 1VSKA 3ZT0A 2CJQA 4JS4A 1S1UA 2FBYA 4ZPCA 3O3GA 3BREA 2AWZA 4KHMA 1VSDA 4Q45A 2ASLA 1KRPA 1HNIA 1VRTA 3TR8A 4QCLA 1GX5A 1R0AA 1ASWA 5JUMA 2JC0A 4Z4HA 1QTMA 1NK5A 5F9NA 2XY6A 4GVMA 3CDUA 4DL4A 3I5CA 5HLFB 4XO0A 1DTQB 1C1AA 4FM1A 4W5NA 3OYKA 2DFEA 4FLUA 2HB5A 3IS9A 4KHQA 2FVRA 4CFDA 3C94A 3E01B 2ETJA 3SUQA 4K4YA 3V6JA 3LWLA 1LV5A 2XY5A 4AHRA 3NL0A 1JLGB 2Q3SA 4B08A 5KFVA 3SUPA 3PW5A 3HJFA 1JLQA 3AA4A 3VQBA 3CIZA 2P5OA 1RTDA 4ELVA 4JUZA 3SPYA 2PYLA 1LWEA 4FJ8A 1T03B 5KTQA 5J2QA 1BCOA 3P83D 3QEIA 4GC7A 3OJSA 1RT6A 3QERA 3H4DA 2A1RA 3UR0A 3CM6A 4CF2A 1FXXA 4FJNA 3AVNA 2R8IA 1CLQA 5I42A 2RPIA 3NE6A 3V4IB 5HRRA 3FRZA 1BL3A 4MQ3A 1RT2A 1HYZA 4CFBA 1XC9A 3DRSB 4DQRA 3MEEA 4NLYA 1GOCA 1LW2B 4IR1A 1HARA 3NGDA 2GBZA 3V9SA 4DQQA 4CF8A 4DEZA 1LWCA 4CEDA 4KHSA 4MK8A 3KLGB 4KO0A 3QYYA 4CF9A 3MF5A 1S4FA 2BQ3A 5DGAA 3P5JA 4RW8A 3ISNC 3CDWA 3S3NA 4J9OA 4RNNA 4QW8A 3OY9A 1GOBA 4OKJA 1BI4A 2GIQA 2FJVA 3PX6A 4CJTA 3HVTA 4E3SA 5KFXA 3I0SB 3I8DA 1FK9A 3HT3A 4DTUA 4FJIA 4BDPA 1T05B 4IRKA 3VA3A 1VSMA 4DU1A 5J2NB 1RA7A 4IH5A 3BSAA 4DQSA 2E4LA 4HTUA 2EX3A 1REVB 1B9FA 3N6NA 3Q8RB 1X1PA 2Y1JA 1ZTWA 2YKMB 1DTTB 4DU3A 4M42A 4C8OA 1NK7A 2IBKA 1UA0A 3HVRA 1DTQA 2YHAA 4ECXA 1KVAA 1VSEA 5HBMA 3O4QA 1EETA 1S10A 2YNHB 1J53A 4ZP6A 2XI3A 2WTFA 4DSLA 4WE1A 4KHNA 2E6MA 2R7YA 1ZYQA 1QAJA 3PW2A 4KKOB 3LZIA 5DG9A 1TGOA 2JGUA 3TAPA 3FDSA 2WONB 2D0AA 4NLWA 3V6KA 2HHUA 4TY9A 4MKAA 4RUAA 3D5MA 4M95A 4CIGA 2Z1JA 2KTQA 3PJXA 2ZKUA 4Y1DA 1EP4A 4N47A 2ILYA 3TVKA 3PZPA 4E19A 3SQ0A 3BGRA 2O5DA 3MTKA 4F3OA 1C0TB 4ECSA 3SV4A 1DLOA 3CQ8A 1S5JA 1BHLA 4B9MA 1TVRA 4B3OB 4J9SA 4CEBA 5F8NA 3VQ4A 4ECTA 2KFZA 5CYQB 1S1XA 4R5PB 4QWEA 4DTNA 1N6QA 1BGXT 4QWAA 1TKXA 5KT5A 3PY8A 3M8PB 3FFIB 1MU2A 3ZSRA 3NKYA 3DM2B 3CFPA 2XO7A 4CGDA 5C24B 2YNGA 4J9QA 1XHZA 4EZ6A 4F3TA 5J2PA 2BANB 2RDIA 4TYBA 1YVFA 3OVNA 4FJ5A 2Y1IA 1ZBUA 3AO4A 4M3RA 2VA3A 3PX0A 3AVAA 1C1CB 3G6XA 3CWJA 1RBUA 1A5XA 3SV3A 2E9ZA 2GC8A 3KK3B 3AVBA 4IOBA 1S9FA 3QEVA 3MECA 1IKVB 4NLUA 1IKWB 2G8VA 2OA8A 4RZRA 4C8KA 4I9QA 4O3QA 1N5YA 3ZSXA 5KFUA 4EP4A 1REVA 1SUQB 2VWKA 2W42A 3T19A 1S0OA 4ELTA 3I0RA 2OPPB 4H54A 5EDWA 3LDSA 5CZ1A 2BE2B 2ZE2B 1WSGA 4FJMA 3KMSA 4J9RA 4FLWA 2OPSB 4HKQA 4QWCA 3EPIA 2DPIA 1U04A 4DTRA 4HUFA 3G10A 3ZSZA 3MR5A 4QWDA 3AO5A 1HMVB 4IH7A 3OLAA 4DSKA 3QEPA 3DOLB 2AX0A 2WONA 2D41A 2C2DA 3T1AA 3CJ5A 2F96A 5D3GB 4IFYA 2IMWP 1X9SA 1D5AA 1SKSA 4B9VA 2YNFA 1L3UA 3VQ7A 2FVSA 3GIJA 3DRPB 4KV8B 4K50A 5L1LA 2IC3B 5F8IA 4BE1A 4O3OA 5KFRA 4MFBA 3SFGA 4F8RA 4KRFA 3DI6B 1NK6A 1NJXA 4DL3A 2V9WA 4I2QB 5CYQA 4R5PA 2HMIB 3LP3A 4KI4A 5DQIA 4CJEA 3M8PA 4TY8A 4U7CA 3OYMA 1JXBA 4LD0A 1TKTB 2XWYA 4FS1A 3RR8A 4NLOA 4KFBB 3H5XA 4CK3A 2PY5A 1XR5A 4TQRA 1J5OB 1RTJA 4ED1A 2AJQA 3NH2A 1U09A 2IAJA 3VQSA 1TAUA 3QO9A 1RTHA 4Q43A 2ZQBA 4EBDA 2WK4A 3CO9A 2D3ZA 1KLNA 1WSFA 2EC0A 3DLGA 1K1SA 1RA6A 3UPFA 4YR3A 1HNVA 2IA6A 4EYIB 4K4ZA 2GUIA 2R2UA 2HNYB 1C1BA 4RG8A 4OPKA 3GILA 1S9GB 4F4ZA 4E1NA 4J2AA 4WFXA 4PWDA 4F4YA 4E89A 4ECQA 1SUQA 1RDRA 1T7PA 3A2FA 2JC1A 4LSLB 4BWJA 3SI6A 1ITGA 4HCCA 4ID5B 4KBIA 2OPRA 4CHPA 1RT3B 5DQGA 4RW4B 2P51A 4E0DA 4L8RB 3HP6A 4NLRA 3GIKA 2YHBA 4CGFA 1SV5A 4J2EA 3N6LA 4ZVFA 2QK9A 1ASVA 1RT7B 4QAGA 1BQMB 4HVJA 2V4RA 4HYKA 1B9DA 4OJRA 3HL8A 1VRUB 3PW7A 4DMNA 5D3GA 3OL9A 1KSPA 4KREA 3TAGA 1NKBA 4ECUA 3M8RA 3NHGA 1D9DA 3F9KA 5KFZA 3AO1A 3RB6A 4F4KA 4URGA 4O3SA 3V9ZA 1U47A 4URSA 4FZXC 3KLIB 4QW9A 3ALYA 3BQ0A 3OYEA 1RYSA 1D8YA 4GW6A 2HNZB 3OHAA 3KNAA 3EPGA 3L2WA 2Z1GA 1U48A 4I2PB 1NNDA 1QS4A 2ASDA 1KVCA 4OPJA 1TK8A 2XI2A 1LW0B 4KHRA 3VN5A 2HMIA 1WNSA 3CM5A 3NF8A 3RBEA 4IKAA 3EYZA 3MXJA 5I3UB 4MK9A 4NRTA 3PR5B 2WCXA 1RDAA 2GIRA 3H59A 3RMBA 3IGNA 4NCGA 1RT4B 4C8MA 4W5OA 2B5JB 4W5QA 4CGGA 1TAQA 1QUVA 3V1RA 5SZTA 4LQ3A 2EHGA 3OYFA 3VQPA 4R0EA 1TK0A 3ZSVA 1S6QB 5F9LA 4BDYA 2B4JA 3SQ2A 2B6AA 2UVWA 1T8EA 3TANA 2RF2A 4CJFA 4F50A 4WYWA 3F73A 4DL5A 1KFSA 2VG5A 2ATQA 3HHKA 4AH9A 4DWIA 4M3YA 4DS4A 2AQ4A 1I6JA 3OLBA 1VSFA 1HJRA 3BDPA 2IOCA 1JLBA 4ID5A 3KK1A 1RT3A 3KLEB 4FM2A 4OGCA 1RT5B 4HUEA 3MXMA 1WSJA 4K4VA 3FSIA 3NBPB 2IM2A 5T7BA 3JSMB 2HHSA 4DL2A 3VQAA 5KG6A 4WZQA 2W9AA 4O44B 1GX6A 3T5JA 4RW9A 1VSHA 4NLXA 3DYAB 4ED2A 2P1JA 4FLVA 3CJ4A 3AVLA 3LP1B 1XI1A 1BISA 1RDBA 2XY8A 1KVBA 5DLFA 2W9BB 2I5JB 3SFUA 3Q8PB 4FJ7A 4BDZA 3HO1A 2E6LA 4TSXA 4IG3A 2FVCA 4O5BA 1A5WA 4FW2A 5KGWA 2HNZA 1Q8IA 4CJQA 1JLFA 2C2EA 2X78A 3K59A 1UAXA 3DLKA 3QGGA 3DLEA 3QESA 3V9XA 4IDKB 3WNHA 4YQWA 4CFAA 4ZPBA 4DSIA 4NLPA 3O3FA 1HYSB 3BJYA 4ZHRB 4FJ9A 3H4BA 5I3UA 4KHYA 2F8SA 3B6OA 1JXLA 2YNIB 3S3OA 4LQ9A 1JL1A 2XGQA 1S1WA 2YKNA 4DLEA 4ZP8A 2B5JA 2NUBA 5HROB 5DLGA 3AVGA 5DMRA 3Q8SB 1WNEA 1YVUA 4DFJA 2B43A 4H4MA 3OL7A 4F4WA 3KTQA 1S6QA 3ZSWA 5FROA 4EYHB 2D5RA 3OYDA 1C0UB 4O3RA 4ZPDA 3OL8A 2V4QA 1X9MA 5HP1A 3DLBA 2HHTA 3C95A 3TAMB 4CERA 4KTQA 1IKYA 2IJFA 4PQUA 3GV8B 1UWBB 3C6TA 1GOAA 4N56A 2FBTA 4NYNA 3WNGA 3KKSA 3NAEA 4DG1B 3ZSOA 4FK4A 3NH0A 3V1OA 1S1TB 3JYTB 3QINA 4O44A 4RW7A 4MKBA 3H98A 2AGQA 4IH6A 3QIPA 3NH1A 4ELUA 3AVMA 4M3ZA 1LWFA 1IM4A 2HWHA 2W9BA 2I5JA 2AGOA 1HPZB 1RT1B 3LP0B 3GIMA 5FRMA 4DF4A 1X9WA 4BE0A 4PUOB 3L8BA 3KHLA 3U6FA 4O4RA 2BRLA 4WZMA 4IDKA 3QIDA 5HLFA 2DFFA 3K57A 4OKKA 3MEDB 4I7FB 3GQCA 4R8UB 4RNHA 4IG0B 5KG2A 1IH7A 3E01A
chains in the Genus database with same CATH superfamily
5KG0A 4ZJQA 1UEKA 2V69A 1JLGA 3VGMA 4HTJA 1H0HB 5H9FK 4OL8A 4FPBA 4R79A 4OMFG 3T6BA 4DV4F 1Q86O 1NJZA 2FSJA 1LEOA 3ENAA 2OH2A 4FJGA 2ZD1B 1IBLK 1PSDA 3CC2S 4OZ1A 4DZ6A 3VGSA 2RILA 1D0EA 2EI5A 4MLEA 3TEGA 1VQ4S 5BRDA 1Q8KA 3V4IA 4UUXA 1URRA 2PAVA 4MK7A 1U1OA 3L3UA 3EE3A 2FJWA 3DRSA 5KG4A 5F8LA 2CKWA 4J9LA 1N52B 1NUEA 1RE1B 1N32F 2XSJA 3CB4A 4NYFA 3RSEB 5C42B 2W7PA 3CCLS 4JI4J 4DR2K 3RBZA 4CEEA 3Q2TC 1W2BR 2V94A 2HW3A 4F4XA 3LPTA 2U1AA 5E33A 3MR3A 1RISA 1NHVA 1F60B 3S7RA 1JLCB 2LQBA 4Y2KA 3D2EB 3I87A 4DFMA 1SJ3P 2UZAA 2R7WA 5LL6d 5C25B 4DQPA 2BEFA 4RLEA 5HVFA 3OYNA 4GKKF 1WOPA 3KLVA 4KTZA 4PG5A 3D54A 4YN3B 2E5IA 2IMOA 2CJBA 1IQZA 3CVKA 3KJNB 4JOUA 2DITA 4FWSA 3CMEN 3UCGA 2BBEA 2YKMA 3DWLA 1DTTA 5J1NA 1VBKA 3MFIA 4ICLB 3SUNA 1HRHA 4C1NI 2MGZA 2DTJA 2YNHA 4QIFA 4A61A 2K06A 4R8UA 4ZVQB 3MM7B 4EP5A 4NASA 2RN2A 3R2DJ 2Y1RI 3N28A 5A2QY 3O2IA 1SKRA 2UXBK 2VKZG 1HQEB 3EO3A 4KKOA 4H0YB 1NJYA 4L76A 1JB0C 4WXOA 5AE3A 1S6PA 3Q86A 2DHXA 1CJVA 3FZBA 2BH1A 3H2LA 2ZC3A 2HQIA 5HATA 1CLFA 4DV1K 1P8GA 2CZVC 4B3TK 3GYNA 1VIXA 3PRBA 5BR8K 1MWZA 4DR6J 2B51A 3IUCA 3FZLA 4ZVTB 2PIIA 3L2UA 3AOCA 1FKOB 2AW0A 1RYRA 5D4NA 3CFOA 4RNFA 5GVQA 3WIUA 3W7BA 2HHWA 3KUHA 2V5HG 3QRRA 1W97L 2IPOB 2XQCA 3HI9A 3JQMA 3CQYA 1L5UA 3I5BA 3CIMA 3FFIA 3T1HJ 1YRXA 4IRCA 1KHVA 4ZTJA 4TU7A 4AM6A 1PJ7A 2KI2A 1B4SA 2BANA 3V4MA 1SL2A 1I51B 2V7ZA 1KCFA 3MMVA 2F40A 3MPWA 4N5SA 2F1FA 2CA9A 4FJLA 3HM9A 3WEEA 1RHRB 4M94A 4DTMA 3PJ9A 2DY1A 1U45A 5DDRC 2Q79A 1K8AT 1HQUB 1HIYA 2DCUB 1LNQA 4QWBA 1KAYA 2GO8A 4I64A 4OYIA 5T14A 1CQNA 3B54A 2FVQA 3KK7A 1F2GA 2QXFA 4KH0B 5EUHA 3AVCA 4DFKA 2L9WA 4JI2F 2G8IA 2GMLA 2QSFA 5AZIA 2NRVA 3LWMA 2XRIA 2WVEA 1T44A 1YXQA 3JB9k 4DL0C 4X4OA 2KZZA 3DOLA 1HHQA 3HHLA 3WHIA 1FRLA 3ID6A 3G8QA 4OKEA 4NO7A 3KVGA 2HZAA 3K9JA 2VOOA 3QSYB 2GAHC 2HBQB 4HHHA 3LPUA 5AE1A 2NSBA 2C2MB 2H5IB 3ZT3A 2IC3A 1QAIA 3OYBA 2P9NB 5CABA 2DNHA 3H42A 2Q1LA 2CG8A 2LXUA 2RKIB 3N6MA 3M9OB 1P6TA 4DUZF 3D6FB 1NU0A 5CZ2A 1JK9B 4Q7AA 1URNA 1NM1A 3J80O 4I2QA 1H3DA 2OYQA 1P9YA 4DPOA 1VRTB 4DV7F 3UE5A 4CTAA 3VEZA 1KP6A 1R0AB 3UW1A 1UOCA 2AJ1A 1N33J 2RRNA 3PEHA 1J5OA 4FZZA 2QL7B 2VICA 2J8SA 1GXLA 4ECWA 5JICA 2NLWA 4EIAA 4FVMA 2DFHA 2GGPB 4DTPA 2CIMA 4A8SA 4DR3J 2LSNA 1DARA 1VQMS 1OSDA 5GIOA 4NLSA 3ZT4A 3SQ4A 3R6LB 1C2PA 3G86A 3MTJA 2WVCA 4UOCA 4I4BA 2R8JA 3L3VA 1N0VC 4FYDA 3OR1B 4HHUA 2BR0A 1F0XA 2BE9B 2ZKTA 3Q22A 4WYLA 5KG3A 3BZKA 2UP1A 3VENA 5I42B 1QJHA 1RBAA 5KFSA 1RDCA 4ISFA 1I1GA 1IM6A 3TAQA 4NZ0A 4LF7F 4BRGA 4KB0A 4UY8O 3MEEB 2B3TB 4JK9A 1TKZA 3PFOA 2QKBA 4B9UA 5BRFA 3M3ZA 1AT1B 1KQKA 4AHCA 3VVUA 4JN4A 3TPQA 4OJGA 2VDIA 4DR4J 4J9PA 2CPYA 3KLIA 1HD1A 2YKAA 2LQ5A 5CD4A 4I6AA 2PFDA 1P1LA 1BI4B 2DK2A 2CZ4A 4I2PA 3HVTB 2ZH5A 5C7PA 4XAKA 3TP2A 4F36A 1WOOA 1NMNA 1JWWA 4NL5A 3AHPA 2ASYA 1VJWA 4PRFA 4C7QA 1VQ6N 1ZBIA 3ZZRA 1R31A 5HBMB 3X1LB 2CPDA 2HZCA 1TKDA 3FLCO 1VQON 4BACA 1ZTTA 2Y0BB 3JAMO 1V6HA 2OI2A 1M90O 3CJTA 3FEXB 1HNXK 2NPIA 3MMAA 5F8MA 2Y3YA 1HR0J 4YDXA 4YOUA 4LF6J 4IYQA 2LU1A 1HKGA 5K8OA 3VQ5A 4W90B 3O44A 2HVHA 3Q8QB 4FOEA 3D0PA 1LAWA 2JEFA 1XC3A 3CMQA 3HTVA 3I55N 4KGMA 1QQNA 3CC4N 1T3NA 1RCHA 1Q5VA 2ADBA 1NM2A 3DLLQ 6FDRA 1VQ7S 1S1XB 1U02A 5LMUK 1JLAB 1N6QB 1PC5A 3T69A 1WSRA 3W8GA 2IVMA 2X1GA 2KU7A 3JS6A 4UQGA 4CECA 3KD5E 3VA0A 4NCBA 4X62K 4IO8A 1BUPA 2HBZB 4CJVA 3MMBA 3L2QA 3BBCA 3THWA 1UPMB 1H74A 1WEXA 2LQJA 5M1FA 1XMQF 1BWFO 4NPOA 3PFEA 3M2VA 3CMES 4NA3A 1HYSA 3MECB 4CJUA 2R8KA 1D8ZA 4E7LA 2W8KA 1WHVA 1JL2A 2P9PA 3A4TA 1QSSA 4WJBA 1JXEA 1G15A 3KG1A 4H4KA 1Y0HA 3IR7B 4YFUA 3LGHA 3THYB 1C4CA 1XNRF 1U2RA 2F4FA 4QU7A 2JEJA 2P8IA 4LFAJ 3BBBA 3KKRA 1BD6A 2IA0A 3EDQB 3KLFA 3UKRA 4DR1K 1MMNA 4BGAA 4J90A 3H5YA 2ERRA 4UOHA 1HBMB 3E3XA 3CD7A 3WC0A 2CQ2A 1DKGD 2QO3A 1VYAA 2YNFB 4GVLA 1OQ6A 1S57A 1RSCA 1UWBA 2QV6A 3HHLC 3Q0AA 4H5NA 2E1YA 2C2KB 3HOTA 3L7PA 4IDHA 3FK4A 3MMCB 3VQQA 2VWJA 3M1VB 2OTLN 2XLKA 3HSZA 4UW2A 3QEXA 2V0NA 4KJIA 4UY85 4F3MA 3QSIA 2VQEK 5A8RA 3M2UB 2DGQA 3OYAA 3K5PA 3MD3A 4I56A 1RT1A 1GLFO 2LFVA 1OYEA 3L7OA 2YTCA 1TFWA 1K8KB 1U26A 4HHTA 4IFEA 3NGZA 2Z58B 3RMAA 2E44A 2VG6B 3MCAB 3K17A 2FHJA 3L9ZA 2C2NA 3QWPA 3TZXA 2R8HA 4QYZJ 5D4LA 1HNVB 3MEKA 4FWLA 2DD8S 2VD3A 5F0UA 2KZMA 3SCXA 1NDLA 4KR0B 3LOUA 1X4BA 5LSOA 2HHHK 1TL3B 3ITHA 4LF1A 4DV5J 2IDOA 4ZLLA 1JIHA 1XHXA 3K5OA 3MEGA 3HSTB 5E3PA 2G2OA 1TP7A 2HIQA 1YJVA 1J9AA 5KPRA 2B4UA 4JKGB 1X0FA 2J0SD 4YMEA 4LMZA 4IBNA 4GV6A 3HSGA 3OTOF 2HG4A 2ZBCA 2R7OA 5IT9O 4HCBA 1S77D 2LLZA 2W4PA 5B0CA 1VQKS 2W01A 4LH4A 1JX4A 2O8DA 2HGLA 4LF8J 3NP5A 3R97A 3OYHA 4WIIA 3BKTA 3NGSA 1TL1A 3EXCX 3OFFA 3T3FA 5KQ8A 3U1NA 3P31A 3C6UB 4O3PA 1NGCA 2ASOA 4X65J 1S1VB 3GFXA 2KXHA 1UP1A 3OS0A 2AJ2A 4DR5F 4FF2A 1HBOB 1HNZK 2UXCF 3N4WA 1QQCA 1R7IA 4MKYA 2ZBPA 3IBWA 4WKRA 3ASMA 2EFGA 5T7LB 4CYUA 4QIWD 3DGPA 3QMQA 4B3MF 2HFUA 4P7VA 1J6ZA 3SXLA 1EQMA 1Q7YT 4M8LA 1FI4A 2QA2A 3C15A 2VG5B 4CLWA 2HQDA 2FLPA 3J81O 2K1RA 1ATSA 3DOKA 2A18A 4L3KA 3AQOA 3ENBA 2U2FA 4U6PA 1V3SA 2CQ4A 2YPZA 2AGPA 5KFHA 3AA9A 3FSXA 4OYZA 4KAIA 2I2YA 3SBGA 2X1BA 2HBMA 5HMYA 3SJJA 2IM3A 6FD1A 2HKEA 2IVYA 5L8RC 4KH4A 3LGMA 4QPTA 4URQU 3KD1E 3CJBA 1HNIB 4P2FA 3KJVA 3THTA 3KYLA 2Q97A 4CEFA 3GMGA 3QNWB 4RUHA 3OSPA 2QSWA 3CETA 3RAMA 2IIHA 1B0TA 2RDJA 5A8WB 4DL7A 3C65A 4CZMA 4PL7A 2AZ1A 3V6HA 5KGXA 2D3UA 2QN6B 2Z0GA 2XYHB 5SWMA 3TO8A 1VQ6S 5CY4A 5A8KB 4M7XA 1NKEA 3K8WA 1PC4A 1O5JA 1Y64A 3NGIA 3QLHA 1YRUA 3SDEA 1U4BA 1VQOS 4OZJA 1FKPA 1S1WB 2YKNB 3GV5B 3PEJA 2A40A 4FZYA 3K89A 1O8BA 4PXDA 4B02A 3ILLA 4M5GA 3BN4A 1WBBA 1FJEB 4AHVA 1S0VA 4Y2MA 5CHIA 2FZKB 2P5GA 1SQEA 3QT8A 4NI2B 3JS9A 3D6TB 3CJ8A 3R3LA 2E2NA 2HIYA 4CHNA 1U1PA 4JI4K 4A5AA 3A8EA 4LY7A 1WF1A 4JYAF 3U1LA 5CXTA 3O1LA 1WF0A 2K3KA 2QGFB 3FZHA 4XEIA 3I55S 1WSIA 1WELA 1IBKJ 3RMCA 4FJXA 1T94A 1TFYA 3QRPA 2ZDOA 2BZ2A 2KFNA 1YQHA 3ZSQA 4EI2A 1ZH5A 2WRMA 2V4JB 3ET6A 2ZJPQ 4RW7B 4A8XA 3H40A 2HFOA 1WAJA 5FDLA 4GV9A 3B8HA 4YDUA 1SB6A 3ZETA 4F02A 1GFWB 1KQGB 5ADXA 1WC5A 3Q8UA 1KRPA 1NGDA 4QCLA 2Y8WA 2HWTA 5JUMA 2JC0A 2ZZNA 5CD4H 2A3JA 4CO5A 1WHYA 3UE2A 4DL4A 3CMAN 2XS5A 2J0QD 1U1KA 3CPEA 5CCLA 2DFEA 3DJCA 4EFHA 2V6AA 3E01B 3CD0A 4AHRA 2QYCA 3NL0A 1JLGB 4HH0A 1WORA 2CQ0A 4DR6K 3T9ZA 3CIZA 4ELVA 3EGNA 4JUZA 1MROA 2ZDPA 3AJ1A 3WIVA 2OCEA 2NRXA 1QY7A 4WP3A 1EQ0A 4LF5F 3LTOA 5J2QA 4C0OC 4GC7A 3CCRN 4ISEA 1FEHA 1RAAB 2J9CA 1O0PA 1ZA1B 3UR0A 1HHTP 2DXDA 1LFPA 1RAOA 1LOTB 1FXXA 4FJNA 2G9OA 2RPIA 2ZBRA 3V4IB 4O8KA 1TYQA 3T1HK 1ZAXA 3G71S 3GG4A 3BGOP 5H1SV 5F3TA 3DRSB 1WC6A 4CO3A 4U95A 3SMSA 5D4PA 5D6GA 2XSJB 1FT8A 2M4MA 1HL6A 3GE1A 2DNZA 4DV0F 2OTLS 3QYYA 4AE5A 3O1BA 2BQ3A 2OEJA 4JAXA 4K0KJ 4ZJOA 4RW8A 2Q43A 3S3NA 4J9OA 4OKJA 4E3SA 5KFXA 5LL6Z 1WWHA 4FOIA 2DH8A 5ELZA 3MN5A 2NCKL 1NB2A 4C3KA 4IH5A 3M8ZA 5CZVA 4WKYA 2HF3A 3K7RA 3N6NA 1X1PA 2YKMB 4U9RA 1DTTB 3D1HA 3I31A 4ZVUB 2CNLB 2NPFA 4IXCA 2YNHB 1J53A 4ZP6A 2XI3A 3B4DA 2VF3A 4WE1A 4KHNA 4AFFA 2HK3A 1ZYQA 3EX7B 4KKOB 4E8UA 1QVGM 3TAPA 2SXLA 2D0AA 2Z2YB 4J7CA 3FBBA 1MWQA 2F63A 4RBUA 4BR9A 4X66K 1EP4A 2E29A 2LQ9A 3VAFA 2ILYA 1MWKA 2Z4PA 3F56A 2D4WA 2O5DA 4WFNL 4F3OA 1DLOA 5IWAJ 2FJDB 1S5JA 4B9MA 4ATNA 3VV2B 3PRDA 2C3PA 1ESVA 5F8NA 1OQ3A 3VQ4A 1EARA 2P9LA 2R7VA 2RRAA 4DTNA 4QWAA 1TUWA 1MN9A 3M8PB 3FFIB 2FJAB 4CO2A 3NKYA 5GMEA 1YJ7A 2M5YA 2YNGA 4JV5J 1XHZA 2E2PA 3O9TA 1RXOB 2BANB 5EX3A 4LT6A 5I3PA 4MLHA 2DR7A 4FVCA 2Y1IA 1ZBUA 1QVFR 3PX0A 1QZ6A 5M2RA 1RBUA 3WUHA 2XWXA 3FR0A 4U8VA 2OMOA 4ZJLA 4NLUA 3T41A 5HVGA 2OA8A 2JLGA 4I9QA 4NE9C 1SUQB 3CC7N 1FWLA 4ELTA 2OIHA 3LDPA 4NWBA 5EDWA 4EWTA 1SZ2A 1WSGA 1BMQB 2ZM6F 4FLWA 2D0OA 3EPIA 1NPPA 3ZX0A 2GAGC 4X4PA 5AZIB 4HUFA 3G10A 3ZSZA 3GFYA 3J7YP 3R2CJ 3CJ1A 4IH7A 3OLAA 4DR4K 2H9ZA 3W2WA 1X4AA 3BY5A 2ZH1A 3DOLB 2C2DA 3BZQA 5DDQC 3H1QA 3HX9A 1U0HB 2F96A 4J9VA 4IFYA 2FVSA 1AXQA 1NDPA 2F4VJ 4K50A 5L1LA 2IC3B 4CNZA 3L3CA 3VESA 4BE1A 4CBUA 3QAEA 2FPHX 2XMWA 2MZJA 3FKBA 1NWKA 4DL3A 2CQIA 4I2QB 4C9DA 1OVYA 5CYQA 2HMIB 3LP3A 4KI4A 2JX2A 4RWXA 4ZIVA 3BR8A 4TY8A 2GTDA 2NR0A 4JI1F 4U7CA 4P75A 4ZVPB 4NXMK 3QFPA 1HLUA 2W7AA 3RR8A 4LBIA 1J5OB 3MPDA 4LF9J 1U09A 4QR2A 3VQSA 4L73A 4EBDA 2D3ZA 4USHA 3PLAA 5LMNJ 1YF5L 2EC0A 4BVPA 4YR3A 4BLGA 4EYIB 2UXDK 4BRNA 2JLFA 5AJ3K 3GWCA 4RG8A 5LMUF 4OPKA 5JVHQ 4J2AA 4WFXA 1Q4RA 4E89A 2HRUA 1RDRA 1S22A 2X51A 4OZ5A 1N34J 1RU2A 4BWJA 1JJ2R 1F6TA 3O9QA 1JJCB 4ZVRB 4HCCA 4KBIA 3UNGC 1Y5IB 3I6PA 1XIQA 4X62F 3VF4A 3TEHB 3GIKA 2Y8YA 1SV5A 4J2EA 2RSQA 4ZVFA 3BM7A 5HJXA 1JQGA 2YHYA 2G4BA 3HL8A 1FEEA 3UFCX 4NOHA 4DMNA 4X84A 3TAGA 4ECUA 5KFZA 4URGA 3V9ZA 1DJ0A 3KLIB 4QW9A 3BQ0A 3CJQA 5K5MA 1FXLA 1QM9A 3KNAA 3EPGA 2Z1GA 4I2PB 3M6VA 4OJHA 2JNJA 2FSKA 1KS2A 1QS4A 4OI2A 1M5SA 3QQCD 1GLBG 4OPJA 3MCPA 1WI8A 4CI0B 1ZBSA 2KB2A 2Q1NA 4JKEA 4TU8A 1WNSA 4DR1F 2BJ3A 3EUNA 1Z05A 2CGJA 4IKAA 2ZHOA 3CMAS 1FNMA 4C3LA 4M5DA 4WF9L 4Q2MA 3CCSS 2BM1A 2QEXN 4BRCA 2APOA 5B7WA 3LW5C 4OJ3A 1RDAA 4ZIWA 4BR7A 1GMUA 4YB6A 3EZWA 5LJ5Y 1HKCA 2J9DA 4NCGA 1MWMA 3QATA 3JXOA 5BYRA 1QUVA 5D4OA 1VBYA 2G13A 4JI0K 4WCEL 4R0EA 2ASPA 2OSRA 5F9LA 2UVWA 2NUUG 3H3OB 1RLCL 1T8EA 3MMAB 1OY8A 4LF4J 2RF2A 4F50A 2VQEF 3W60A 3F73A 3CCRS 3H45C 3ZZPA 1OYDA 3ONQA 4OZNA 2G2ZA 3TA2A 4AH9A 2HF4A 1PGZA 2AQ4A 2FTRA 3DLJA 2IOCA 5D0RA 1KOOA 4FM2A 4LVOP 1IR0A 2CAJA 3CD6N 3U9ZA 3BUZB 2W41A 4DL2A 3VQAA 4WZQA 2Y9HA 2YJFA 3T5JA 1E6YA 1VOMA 4NLXA 3GR0A 4BRHA 1U8WA 3R5GA 2UUAJ 1T9YA 3CJ4A 4O8UA 2W9BB 2I5JB 1UKUA 1YBAA 2HHHF 5E84A 3MD1A 4PR6A 5JMNA 3GP9A 1A5WA 4K5SA 3LO3A 4ZCKA 4NB4A 1KQFB 3SBTA 4C8YA 1NRKA 3HD2A 1JLFA 3DLKA 1UAXA 2DO4A 3MMBB 3R5AA 3CJAA 3THWB 3F41A 4IDKB 4YQWA 4ZPBA 4DV5K 3O3FA 1HYSB 4ZCMA 3G87A 2X1AA 4KHPJ 1JXLA 3TNVA 4DV6J 2LA6A 4YORA 3S3OA 5RUBA 3SQOP 5CYJA 3GLJA 2XGQA 2XB2D 2M0GB 4DLEA 2B5JA 5FLXY 4OFZA 4CO0A 3FGUA 5DLGA 1ATRA 3T1YJ 3Q8SB 2RH3A 2B43A 1I3OB 3NNHA 4NYPA 4F4WA 1VBXA 3DFEA 2OD4A 3UKRB 3M32A 4JI6J 2AYEA 3O08A 3R7SB 3C95A 1VQNN 1S72S 4KTQA 3DU5A 3I56S 4CLSA 2W2QP 5BXIA 1HNZF 2IJFA 4LFCJ 3HF5A 2F9WA 1UWBB 5LOQA 3KKSA 2AF6A 3J81j 3UCUP 4DHVA 3I4HX 4X65K 3WBZA 4PYAA 1EB0A 3BV8A 4ED4A 2DGWA 3QINA 4YUDA 4O44A 2KVQE 1KVIA 5LY3A 1ICEB 2CQGA 3QIPA 1SC1B 1LWFA 1IM4A 2HWHA 3R5BA 2DNNA 2KYXA 5A8RB 4DUYF 4N8OA 2GJFA 1F9HA 4QJVA 1BHNA 1MW7A 1YK9A 1AUSL 1RT1B 3P5TL 2RMLA 4BE0A 1CS4B 2YJEA 2ITMA 4O4RA 4G1PA 1WHXA 2MKSA 2FHKA 2XMUA 4ANEA 2E2OA 3R5CA 3K57A 2ZH2A 3CC7S 2JWNA 1YX2A 1HI1A 4NXNJ 2R7UA 4ITSA 4KBOA 1F21A 1NOZA 2J9EA 4OHYA 4CK2A 4UF4A 2J6UA 3MEGB 1FF2A 3AT1B 3UIQA 1NPKA 2ZOGA 1GAOA 3NCPA 1HA1A 5L38A 3O5BA 2CG4A 2XBPA 1T03A 3MGJA 4CQ1A 4DU7A 5KFGA 2HRYA 3GZ7A 4FCYA 2RU3A 3RB3A 2Z2ZA 4OPAA 5F8JA 4JK8A 5AQSA 5AQIA 2JWKA 2A5XA 4QS7A 3NF7A 4LRBA 2O8DB 3HKWA 2OO4A 3V9UA 4FWKA 1Z4UA 3PR4A 4KH1B 5J2MB 4B1YB 3R7BB 4DG1A 1Y10A 1W0HA 3KLGA 1TUGB 2ZEJA 4ED8A 3RG6A 3MPVA 3AA2A 3OTCA 3QPIA 1CJUA 3OV7A 3J80Y 2VKRA 4CT9A 2MHEA 1N5TA 2V67A 4RNMA 1X8DA 2X3GA 2UU9K 2DJWA 3QBCA 4JI4F 4C8LA 2ACYA 3IBFB 5EVZA 2MZRA 2ZH4A 3B6PA 4PUOA 1F9EB 5DG8A 1EXQA 4R0JA 1KFDA 2EFOA 5JXSA 2VA2A 1X5TA 3TA1A 3NF6A 5DG7A 4A59A 5GAHU 4CVNE 2F8MA 1VQ9S 1QHTA 1FNOA 2HVZA 2VIHA 3OL6A 3MR6A 1NAQA 4WFZA 1KOHA 4V19X 4F3QA 1IG8A 5E5NA 2WC9A 4LFBK 3OBYA 2RE2A 4CBWA 2P9IA 3PO5A 2K1RB 3DOKB 4BRFA 4RWTA 1VJQA 2E9RX 2O8EB 1ZPWX 2MQOA 1N56A 3OS2A 1GMWD 2IJNA 4WQ5C 2UUTA 3NGRA 1NZ8A 4TQSA 3Q23A 5B0AA 3HCXA 3K2PA 4B8CA 1C0TA 4WCEQ 2L9DA 4K8ZA 4M45A 4B3OA 1RHMB 3IR5B 4O4GB 1SAZA 5AXLA 2I7PA 4DXLA 2BOPA 4DV2J 4QYRA 4CLKA 3JTNA 3OXLA 4DR6F 3LDQA 2CJXB 2KM8B 4PKHA 3DLRA 2JL9A 4A62A 2DPJA 5E41A 2DXFA 2QWLA 1WG4A 2MJUA 1S0NA 3CJ3A 2CH6A 3D2EA 4WFYA 2F7TA 4BQZA 5KFYA 3SSSA 3UDEA 4K8RA 2K8GA 3T1HF 2CQHA 3VEYA 1UJ5A 4RX6A 3QLHB 2J6TA 3SDEB 4PAAA 3VZHA 4L6V3 3B4MA 2CPHA 1FKPB 1IKVA 3HXMA 1IKWA 4PA1A 4IO1A 1CZBA 3IAS9 4IJNA 4O0JA 2R8GA 4UY8T 1NK0A 2C3OA 1B0PA 1XBWA 2ZHBA 2D7SA 3JAMY 4ICLA 5CH7B 4DSEA 3TX0A 1MDUB 4FBUA 2KJVA 1EKSA 2OUGA 1SVDA 4PY5A 4K4XA 4JNEA 1N5SA 4FK0A 4A2AA 1O1WA 4ED7A 3FNNA 3VGKA 3K5LA 2CQPA 3KFWX 4AHTA 2WAQD 2G0IA 3LAMA 3EZUA 1H73A 4OI1A 3TJ9A 3DXBA 2WBMA 4USKA 4GKJK 4P2SA 5IC6B 4CNYA 4CEAA 4I69A 3ET6B 4YOTA 1G1XA 1M0SA 4KE5A 4M5MA 4U8YA 1NLKL 4HTLA 4ZVOB 4OZ2A 1VHIA 1FKOA 5FDLB 1HUXA 1IBLJ 3ZETB 4F25A 1HYVA 4E2FB 2IDLA 2UV8G 2A1BA 2XMTA 4HDHA 3AH6A 4XPEA 4F2RA 4JHDA 2I38A 3TWHA 3HPGA 4FLTA 1XUPO 2GHVC 3OTDA 1IKXB 4Q8FA 4CH0S 1FX4A 4V1Ak 2WOMB 4CGJA 5DM7Q 4DSFA 5E3AA 2W7OA 1TKTA 3AD8C 4CEZA 1V9OA 5KFLA 1IXKA 4KSEB 5KFEA 5G4DA 4B9NA 3S9HA 4B17A 3VQ9A 5GINA 2Z30B 2QFJA 3D7SB 4DR2J 3CCQN 4USTA 3OW2R 2G8WA 1K1QA 4FKXA 1X4EA 4DSJA 5KFFA 3HOSA 3GIRA 1N33F 2AJ4A 3O80A 2XZTB 4ECYA 4KH6A 5TKWA 1S9GA 1M1GA 1GTHA 3FGVA 1WC3A 4Z7CA 3ZT1A 1FFSB 1TK5A 3WT0A 2BUNA 2HZVA 4LSLA 4DR3F 4Z4FA 3HPOA 2OEKA 1NK9A 3AXMA 1VQNS 1BWEA 1Y9OA 3IRXB 1RP5A 3CYMA 3ENWA 2GV9A 1TYQB 5EX5A 4CD1A 1R59O 2A6MA 1OIAA 1K6YA 3KOAA 4OPHA 4CP5A 2QA4N 1BQMA 3HLUA 1ITPA 3M6WA 5CE3A 3VEOA 4CK1A 1VRUA 2MQNA 2B56A 3NAIA 2M8DB 2UXBJ 3HRGA 4PYDA 4DMZA 3HFZB 4CZHA 4FJJA 1Q7YO 1X7VA 4OGEA 3HHNB 2YV0X 4RW8B 4DCPB 1R8AA 4DV1J 2RKIA 1KEKA 4O23A 2O67A 4B3TJ 5BR8J 3E9OA 3RTVA 1P8ZA 3ENOA 1LW0A 1BIZA 3LZJA 1T9VA 3HI0A 2H51B 4DR4F 4FNHA 3HYFA 3A5MC 1WI6A 3TZZA 5KT7A 1Q8LA 3EZ5A 1BXNA 2R42A 2VASA 2XYGB 2E5LK 3CPWR 3H6EA 2NXUA 4EUVA 1YHQN 3U3YA 2RQMA 1NXIA 2NRTA 3TOQA 3TWZA 4LSNB 2QL5B 4CESA 2EK6A 4K4SA 4USWA 1WDDA 1V5VA 1VSJA 2GGPA 3RW6A 4WE1B 3KMQA 3SMPA 3EICA 2E8AA 4TN2A 4BHQA 4W98A 1FNXH 4J2BA 4FK2A 1VSIA 2E1AA 3AFGA 2YXLA 1KQSR 4YOXA 5HL7L 1FXDA 2XNRA 3JSRA 3DDNA 3FCHA 4TYAA 5KPZA 1FA0A 4ZVHA 2F8TA 4CEQA 1Z2LA 1EP4B 4IO9Q 3KLEA 1X4DA 1OO0B 4EBCA 1L3SA 1DLOB 1VQ8N 2CDRB 4ZPAA 1HR0F 5ETMA 4LF6F 3JSYA 2DR5A 5MLCV 1U24A 3UN5A 5M1KA 4LR9A 3P96A 1RBRA 3TABA 2P9LB 3IFRA 5G0RA 2GELA 1YTAA 2AP6A 1D09B 2D74B 3EXYA 2ZOMA 2DGTA 4O0IA 2YNGB 5AXNA 4AILC 3LPEA 3H7HB 5LMNK 1OH8A 3AQPA 2E66A 1V4SA 2PC6A 4J2DA 2PI5A 3BP8A 3JQJA 1L3TA 3MR2A 4CZLA 3H1VX 4HL9A 3KHRA 1B92A 3U9DA 1AUDA 3QBWA 2MY7A 2M3DA 5KFJA 3FQKA 4ZHRA 2C42A 2EG1A 4AM7A 4CLTA 4RU9A 3QGIA 2CYYA 1B7FA 3MR7A 2F3JA 1GLLO 4X64K 2NRWA 3FEZA 2BTFA 2X3DA 4H5VA 3SBMA 4LBHA 5HROA 4DDFA 5LXRA 5HN0A 5I4MA 3MI7X 1SIWB 4JKBA 3PJWA 4G3IA 3VQ6A 2J0XA 5HRNA 3QT5A 3HULA 4PCQA 4RW6B 1C0UA 3BQ1A 3HDSA 1SC3B 1CJTA 4KB1A 3RYLA 2DHHA 3D0HE 4EO6A 4JRPA 3P45B 4NZ6A 4FW1A 3AB2B 3BGFA 2E2QA 4BC3A 4PWUA 4CEOA 4IFYB 2W9CB 1C0MA 2MZ1A 5EWEA 3M5RA 3EE8A 1FFGB 4NZ7A 5IQQA 1PYSB 4LFAF 2G8KA 1TMMA 1XR6A 4GNIA 1Q8BA 1NKCA 4AHUA 3M6XA 5IT9U 4Y2CA 4JS5A 3SZ2A 4QQBA 3SUOA 5DZ6A 2YVSA 1VLYA 4JI5J 1JLAA 1YJWS 4TY8B 1DHMA 4MIWA 2V2ZA 1UVIA 3NOGA 2WW8A 4M3XA 4CT8A 3MAAA 1CXUA 5DS7A 5KQDA 3LP2B 1O6XA 4K8XA 1M5OC 2MEWA 1TUYA 1JKHB 4DX8H 1ASUA 1YITN 5EU7A 3ISZA 3O3HA 5A6PA 3FMBA 3UCZP 2P9CA 2C22A 4I7FA 2ATLA 4ZVGA 3TA0A 2BV3A 5HSPA 2CRLA 1N88A 3ZX3A 5HMXA 4KB7A 1D1UA 2JSXA 4DB3A 4PHTX 1VK0A 3OVAA 2DY9A 2R7QA 4CZFA 1UTAA 4EHUA 4P9SA 3RAXA 4OYWA 1ZBHA 4HH1A 2DNMA 3CDBA 4J9MA 2ZF5O 2ZITA 2AJ0A 4NYZA 1SV5B 2BGGA 3IG1A 5AQQA 3BF1A 1FWKA 3FBEA 3BS9A 1QDUB 4Q0BB 2JHEA 4DV5F 3FMWA 3J81U 2AP1A 3ULEA 3NXZA 1HBMA 3OS1A 3BH7B 2DR6A 1HNXJ 3F0NA 3O6WA 2KL8A 3EGZA 1U7LA 2WB1D 4Y2AA 1E4GT 4ID1A 2UVVA 1OPIA 5B8HA 4XPCA 2FHOB 4PPZA 4UQTA 4ED6A 2HRTA 2FY8A 1X3MA 3OQ2A 3BGLA 1U2CA 3GPAA 2BVZA 2O4IA 3POTA 3MMCA 2A42A 2FJXA 1I5OB 1H2VZ 4ETZA 3BR9A 3M1VA 4LF8F 4DV6K 3DDKA 3V81A 1UWAA 2X6SA 4ECRA 2ROEA 3PV8A 5M2UA 5D78A 2VBYA 4DF8A 4M5DB 3M2UA 5C2GA 1XR7A 5GADU 3CCQS 1KR4A 2MQQA 4OX9J 2XHBA 2YKQA 3SQGA 3RAQA 4NCGB 3ATVA 1OWXA 1K9MO 5GAEU 5MLCQ 2QWMA 3THVA 4X65F 1Q0NA 3LH2S 2VG6A 3KWMA 1WSEA 4YB5A 4JI6K 2GWJA 3G82A 4AHSA 3FRYA 1QUPA 2OSQA 3NAHA 1XWLA 2XCAA 4CZKA 5GAHI 1KAZA 2RF2B 4ETXA 3ZCMA 3SSQA 3VAIA 2XMMA 1UVKA 1TL3A 3QGHA 2GFFA 2AA4A 4P71A 3NMAA 5TKYA 2Y0SD 3V9WA 3NMRA 4ES3A 3IR6B 2HNDB 4O0NA 4Z94A 5KT6A 4FYXB 2QA4S 1SPBP 1XQIA 1CULB 2J7UA 1SL0A 4ILMA 4DS5A 4DR7K 1FJGJ 1A5VA 4OLPA 3DMJA 1NGFA 2JEIA 5C10A 3CDEA 1WF2A 2D3O1 4H4OB 1W25A 5DQHA 1PBUA 1SJQA 5HL7Q 1S1UB 3BO3A 4IKFA 2V2QA 2DGSA 2HSTA 2E5GA 4YP3A 1XQSC 3N79A 2G8UA 2MDAA 3GJTB 1OH6A 1JLFB 3ZXWA 2CFXA 1YIJN 3DLKB 2VQFK 2JZ5A 1N8RT 3OHBA 2CJYB 4BR5A 5ETSA 3C6UA 3U8XA 1KVKA 5B0EA 4UOFA 4J37A 2EBGA 1S1VA 1SQFA 3HHDA 4Z7YA 2O1PA 4IEIA 3A1YG 3J7A1 2VUGA 2R3VA 4H0OA 3PDNA 3ZZUA 3U02A 2HK2A 2LDYA 5A2QO 4MH8A 4B8AB 4CIFA 3W64A 5AE2A 4F2SA 3UN3A 5IQ6A 3DNCA 2FLLA 5AQZA 2PE8A 3V6DA 1FTCA 1I94K 4BQLA 2HHXA 1YJNN 5FIIA 3NRBA 1LQ9A 4RUCA 2XHWA 1VQ8S 1GLAG 2XS7A 3RGIA 4X4VA 1SL1A 4U96A 1VQPN 4HUGA 3VTHA 2QLJB 4DQ8A 4NRUA 3RMDA 3QIPB 2KT3A 5HMWA 3EMTA 1TQLA 1IBKF 1LWFB 2XZDB 4C0HA 1SJFA 5ETLA 3NGTA 4G6VB 3MCMA 2ASLA 1HNIA 1VS3A 4NLBA 3ENQA 1ASWA 1M5PC 4Z4HA 2AV5A 1QTMA 1NK5A 3QJJA 5D0GA 3M8WA 2HEKA 4M5IA 1DTQB 2HBKA 3W2VA 3OYKA 5DDPC 3MOZA 2WW4A 2HB5A 3IS9A 3MN6A 1HX1A 3C94A 4O5FA 2KVIA 2ETJA 3SUQA 4DPTA 3ENHA 3LWLA 3PXGa 5L9NA 3O9SA 4KY3A 2Q6CA 2AYMA 2VL1A 5KFVA 3PW5A 3AA4A 1YJRA 1KXPA 2CH5A 1RTDA 4F9OA 5LJ3Y 1LWEA 2NYHA 1G6BA 4FJ8A 2BMBA 1T03B 5KTQA 1MLAA 4KIAA 3P83D 5KPTA 3OJSA 4A8OA 4Y0FA 2YX6A 2A1RA 2B9YA 3TTDA 3CM6A 4NI2A 3Q24A 4DV2K 3AVNA 1CLQA 2QC3A 4BRAA 3EJMA 4MQ3A 3B6BA 2XULA 1RT2A 1HYZA 4CFBA 2R7SA 4C2MA 2IVFB 2QYGA 3V9SA 3UD4P 2OANA 3JTPA 4DEZA 1LWCA 4KHSA 4BRKA 3KLGB 4KO0A 4CF9A 3MF5A 5LJVA 6AT1B 3TVZA 4FKYA 1TTHB 1FE0A 3C6HA 2IYIA 3CDWA 5AQNA 4MO4A 1ZXOA 2W2MP 4GV3A 3HZGA 2GIQA 4CJTA 3MOJB 2NZTA 3IBCB 3I8DA 3HT3A 4KGKA 4BDPA 1YITS 1GLDG 3MMJA 2V34A 4DU1A 2CPJA 3U7JA 5IV4A 2GX9A 3BPDA 4USVA 4K0KF 3BSAA 1KC8O 4GMKA 4A48A 2KDOA 4HTUA 2V50A 1REVB 3RZAA 4DU3A 1U1MA 4LC9B 1UZHA 4C8OA 2IBKA 2DNKA 3AXKA 3T9NA 1GMVA 4FWRA 1PKUA 1RB0A 2E6MA 2GJ2A 3R5DA 1WOQA 2R7YA 1QAJA 4LRAA 2P9IB 2AIRB 1WUUA 3LZIA 2GW8A 1TGOA 5B0GA 3CD5A 4ZK7M 2WONB 1T9WA 3WQPA 1RAIB 2DRBA 4MKAA 1IN0A 3EVOA 2HFVA 2YKPA 3PZPA 2QRRA 3VAJA 1R0CB 4E19A 3SQ0A 3BGRA 2DCLA 3CCUN 1C0TB 4ECSA 3P39A 3SV4A 1GTEA 1SKUB 2CPEA 2DNOA 1N5QA 1VQLN 2GMJA 2IIRA 3HSDA 4B3OB 3PIPL 1PAUB 5FD1A 2KFZA 1EKRA 4R5PB 4IEEA 1RHQB 3PY8A 2PEHA 1MU2A 3ZSRA 3MCOA 5IWAF 4V19J 4J9QA 4EZ6A 3EGWB 2G1HA 1RWUA 4JI7K 3O9RA 2RDIA 2HVEA 2HS3A 4TYBA 1T3VA 3OVNA 4OV6A 2Y1LB 1FJCA 3KUEA 3G6XA 3CWJA 4DPWA 1A5XA 2XZWA 1C0FA 4JV5F 1S9FA 5HQMA 2EC2A 1IKVB 3UWTA 1IKWB 4C8KA 5LSLA 4O3QA 2W6KA 1ZM9A 2HOEA 2VZ9A 4H54A 2PMHA 4Y2IA 3LDSA 5CZ1A 3ILIA 1RWWB 3HZEA 2MKJA 4NA2A 3KMSA 4QWCA 2DPIA 5K8PA 4ZPWR 3FSYA 3MPUB 4QWDA 1UVJA 5AXMA 3AO5A 4BGBA 4DSKA 1XNQJ 1BO5O 2W40A 1R6YA 1RKIA 2RUGA 3PSFA 5K9FA 3BKFA 3T1AA 3CJ5A 4C8ZA 4K43A 1YSJA 2FXUA 5D3GB 4ZDNA 2A2DA 1RTZA 2KH9A 2IMWP 1D5AA 4ILGB 2DIUA 1RJJA 2ZBQA 3HHLD 1WKLA 5GAGU 5KFRA 1R6VA 3VAGA 2ATCB 4F8RA 3N9UC 5KAKA 1IWGA 1EAYC 1NJXA 4JHDB 4YY3J 1YIJS 2ZH6A 2F4VF 3M8PA 4ID8A 2MSTA 3R27A 4E98A 2O3DA 1B0VA 1TKTB 2YX7A 2XWYA 4NLOA 3H5XA 4QU6A 1KAXA 2R7XA 1RTJA 2AJQA 2WBRA 3KWGA 1SC4B 2IAJA 1WHWA 2QIFA 1TAUA 3QO9A 1RTHA 2ZQBA 5IM0A 4WFBL 2CZ9A 1KLNA 1WSFA 2NZCA 1K0TA 2IDEA 1EHWA 5KOXA 1S5ZA 2IA6A 3IM9A 2GUIA 2YBVA 1C1BA 5ETPA 3D0IE 1NHKL 3UD5A 4OIXA 4OI3A 1S9GB 4LF9F 4PWDA 2KRRA 4I6MA 1SUQA 1YI2N 2VCPA 1T7PA 4C11B 3D1OA 5C2CA 4YOEA 4LSLB 4AXIA 5LMNF 1KN6A 1OVQA 3SI6A 3MAHA 2VDHA 1ITGA 4ID5B 2OPRA 1RT3B 5DQGA 4E0DA 3ZTOA 4L8RB 3MN9A 5IOLA 1P27B 2YHBA 3LDNA 4IOAL 2IVNA 2QK9A 3C7NA 2OAUA 1K73T 1N34F 2EW9A 4QAGA 1BQMB 3DCAA 4HVJA 2V4RA 4USJC 3N4QA 1VRUB 1VQPS 3PW7A 3O8WA 1U0HA 3OL9A 5BN9A 4IWVA 3G96A 2M8HA 5BREA 1CC8A 4CZIA 1FO1A 2L48A 3SIPB 2MQLA 3A13A 3O5TB 2BOAA 5E3RA 4A2BA 4O3SA 1U47A 3AAPA 3OYEA 3ILJA 2CADA 4DU8A 3A5OC 3J8AA 4GW6A 4DV4K 3OHAA 3GCXP 4X66J 1IUJA 3FCWA 1HBNA 4CH1A 2LXIA 1KVCA 3CXCM 3LGNA 1LW0B 1S12A 4RBTA 2HMIA 1WEZA 2MY8A 1F5BA 2QXLA 5I3UB 1RWPB 3IFEA 1KVJA 4NRTA 5BPLA 2ZZMA 5GADI 2WCXA 1FE4A 5AQOA 3CIPA 4C8MA 4S0MA 4W5QA 1TAQA 5GAEI 5SZTA 5AFUH 2EHGA 3OYFA 3IDHA 2F8HA 3DDIA 1FRMA 1EQYA 1S6QB 2B4JA 2NXJA 1NGIA 2RQ4A 4MYTA 4IOCQ 3NNAA 3TANA 4CJFA 2AEMA 4MKVA 4YOYA 1KFSA 2AKWB 4M3YA 4DS4A 2NRRA 4GKKK 2XMVA 1VSFA 3KK1A 3CJ9A 3KLEB 5JJBA 4JI5K 1RCOB 1WSJA 2HLTA 4K4VA 4LF4F 4IJAA 5T7BA 2NXNA 2VFRA 5B0DA 2W9AA 4RW9A 4GO5X 2GVDA 1CEZA 3D68A 2BJ9A 4LRCA 5G0RB 4FLVA 2H5JB 5HQLA 3Q8PB 4FJ7A 3HO1A 3ZNJ1 1MWYA 4IG3A 2FVCA 3I96A 3ZC4A 3TSQA 3D2FA 4O5BA 2C2EA 2UUAF 3UNYA 3DLEA 4KQZA 2N7YA 4WK3A 3V9XA 3KDOA 4J9UE 3OTBA 4CFAA 1B64A 4H0VB 4DSIA 2NNWA 4ZHRB 4ZN3A 3H4BA 3PIPQ 3VAHA 1DRZA 4KHYA 2F8SA 4BC5A 1S76D 2YNIB 1HWIA 3W5YA 4B9QA 2VV5A 2QW9A 3SK3A 1IBMJ 4NXMJ 5HROB 2C2ZB 3AVGA 2EFPA 5DMRA 3C14A 1T3OA 4USIA 1RQ0A 2LVWA 4H4MA 1RADB 2I7NA 3I8BA 4KHPF 4YEAA 4WPAA 4DV6F 1C0UB 1BWVA 1CJTB 2Q6BA 4ZPDA 4BC4A 3CERA 3T1YF 4M5LA 3CCUS 2HHTA 2QLXA 3M30B 2CJKA 1LK7A 2UXDJ 5AJ3J 4CERA 1WC1A 3W3SA 3VERA 1IKYA 4PQUA 1R8CA 4WWSA 4C98A 4AUKA 4FK4A 3D67A 4DUTA 1JJHA 1IJJA 5I3QA 4JI6F 1ZZNA 3TUZC 4DBQA 3BDEA 3NCQA 4RR5A 2ZFHA 2RU9A 2AGQA 4ER8A 4JI2K 4OX9K 3NH1A 4LFCF 3AVMA 4M3ZA 2W9BA 2I5JA 3TTFA 2QWOA 3P6YC 3MM8B 2OLWA 3MAAB 5JLHA 1Q18A 1H6KX 3CTRA 3LP0B 3KHLA 3CJCA 5AQWA 3CNQP 3U6FA 3BGUA 4J8FA 2P9GA 1TL5A 4WZMA 4IDKA 4OX6A 2OFGX 4M5HA 3IXQA 4OKKA 3L7UA 4I7FB 2O8FA 2UYTA 3S8SA 4IG0B 5KG2A 2AD9A 1OY9A 2FHJD 4CJKA 4ED5A 4FXDA 1NDCA 4QR0A 2BACA 5F8HA 4DV7K 4NCAA 1LXNA 1FJGK 3AVKA 3BSNA 1NGAA 3BSCA 2EFVA 2P9KA 4NXNF 3IG1B 1FX2A 1UVMA 1S97A 1NJWA 4G1QB 5KFTA 1XJWB 2W8LA 1J54A 1SH3A 1V5IB 5BR9A 2B7CB 3I5AA 2WSFC 4JI0J 3ULEB 1HKAA 4P74A 2UVRA 2G8HA 2QWRA 4N41A 4CI6A 5FPMA 3EKSA 3LANA 1ZZFA 3TUJC 1UETA 3ILOA 3MPYA 2C3UA 3MXHP 1NOYA 1LW2A 5KRSA 1NG9A 3L2VA 3UN2A 3W61A 3O4NA 4UOGA 3POTB 4J5OA 2FBXA 2KQ2A 2ZJRL 4KHWA 4YDDB 3V1QA 1SXLA 3SMZA 3V81B 1JXVA 4ECZA 1QVGR 4OHXA 4PPDA 3I0SA 2MYFA 5KI6A 1T9TA 4MMOA 1Q81T 4CF1A 4LF7K 3PYDA 1KTQA 1NGJA 3RB4A 3SQGB 1CS4A 4DLGA 4I68A 2LU2A 4RO0A 4OZ3A 2JVRA 2W2NP 3G82B 4P72A 5MAOA 1WG5A 4OLOA 1TU0B 5DDOC 1OJ4A 1RKJA 1ZBFA 5AQJA 4UZBA 3RR7A 3R5JB 2FHMA 2VBZA 3VGLA 1RBOB 2EK1A 3M8YA 2FLNA 3SI8A 4ANCA 1RWOB 1R8HA 3ICLA 4H0XB 2PA3A 2Q3PA 4WBFA 3CC2N 1IJEB 4AQYJ 2Q66A 4KI6A 3TAFA 2CPZA 1UL3A 3OBWA 3DMJB 1NK4A 2HBLA 1U2FA 4ED3A 2B0GA 1S79A 4Q5VA 3IWNC 2EKNA 5JS1A 1OSCA 4CD3A 2M88A 2OPQB 3C46A 1S48A 4CJWA 5J2MA 4GMJB 2P9SA 5ETTA 4DN0A 5KG1A 3RVCA 2CQBA 3NVMA 4A57A 5KT4A 4BVOA 4YOVA 3N4PA 5GIPA 3HVWA 2K7KA 4ZLNA 4YR0A 3P1GA 1NSQA 2P9UA 4DV2F 1AB8A 3VQDA 1C1CA 4CCHA 2UUWA 2Q0UA 1CXQA 3KK3A 3PX4A 5AQYA 5BPNA 4CLUA 3P38A 1Y11A 3NGKA 1WJ9A 2RJZA 5HJYA 2BE2A 2ZE2A 4LR8A 4M5NA 4Y28C 3KHGA 3M8QB 3L09A 2XC9A 2OPSA 4Q2LA 1HFEL 3GCWP 3V6DB 2DBBA 5KFBA 1X0PA 1BA0A 4CHOA 2GUPA 1GT8A 1SJ1A 3UO0A 1HMVA 3SQ1A 2Z1IA 2CDQA 3OW2M 2H48B 3KXDA 4DPYA 2MB0B 2O8EA 2XSFA 4MIBA 4ZA1A 4IQXA 2MJNA 2V2VA 5AQPA 4FF1A 3M7VA 3CF5L 2G0CA 4Z4EA 3K5MA 1C0GA 4JEPA 1CC7A 3TI0A 3DRPA 4LIWA 4CWBA 3G0ZA 2RNEA 4K4WA 4ILLA 1FRJA 5GAGI 1VI7A 2QE5A 1HKBA 3DI6A 1B7YB 4PXEA 4QS9A 4FP9A 3MX2A 4O4GA 3ATUA 1N36J 4DL6A 1H72C 2ZUGA 3NS5A 2DIVA 4B3RJ 1RNHA 3CCTA 1I3AA 1IBLF 4ILHA 2DHSA 5BRHA 1YZ6A 4KFBA 2A2CA 2JFKA 2CGKA 3KK2B 3OPKA 1SKWA 1UPPA 2Q31A 5AT1B 4TXSA 1HQ2A 3W2VB 5KFWA 2KO1A 4RL1A 4ZP9A 4FL9A 1WOSA 4CJPA 2MZTA 3IS9B 3DXKB 5C5JA 2DGUA 4K4UA 3G25A 1YJ9N 3KHYA 2CXEA 2HNYA 2ASMA 1VRQC 2H4YB 3HPHA 3NS6A 4LSZB 4CO1A 2UU9J 1BC6A 4G65A 4DR2F 3PYFA 3P4UB 1RTDB 4D3GA 1LWEB 1RACB 2Z57B 5L9XA 4PABA 3R1LA 5JS2A 2PD1A 1RDUA 2DO0A 1AYEA 1ZBLA 3WXKA 3W9JA 4RW4A 3CPWM 4F0MA 2RQCA 4H4KC 2P6SA 1QE1B 2KKZA 3FFKB 3QZ7A 1NGEA 3G2XA 2LECA 1RT2B 5ETKA 3T7ZA 3A3OB 2RUSA 1PO6A 3CC4S 3L2RA 1YZ7A 1PIEA 2VC0A 4LFBJ 1PYOB 1VSLA 1DURA 2KW4A 3WX4A 4DZDA 4O55A 3VETA 2E7WA 3OYLA 1REGX 1LWCB 2QG9B 4KO0B 4P6QA 2OTJN 2YKOA 4J9NA 1TL7A 2XHCA 3SLCA 1CJKA 1CVJA 3HJVA 4DFPA 3DLHA 3AD9C 2UXBF 3AODA 3HKZD 2HAFA 3TTCA 2JVOA 3CULA 3OTOK 1IKXA 1J5EJ 2WOMA 4I1TA 3T6JA 2RHKA 1DT9A 2C2OB 4DV1F 1SH0A 1LAVA 3V2UC 1FDAA 1U0SA 4OZLA 4B3TF 2IM0A 5BR8F 1RT4A 2AMCB 3D4JA 4DCJB 1X31C 1XNQK 4PG4A 4YB1P 4Q44A 2NRZA 4OX8A 1KLMB 4OYXA 4W5RA 4QR1A 3R8YA 3P3DA 5EN1A 2N3LA 5FPEA 2N4CA 3NS7B 4ES1A 1N8RO 4A8MP 4ZITA 2MQMA 3DOMB 2EG2A 3AVFA 5L46A 4BRDA 1TV6B 3CE8A 4XH5A 5H9EJ 1CQMA 2IM1A 4CF0A 2UXCK 4OI4A 4I6YA 3BGRB 1RT5A 4YNQA 2UVUA 4YY3K 2JH3A 4HWIA 3RB0A 3IRXA 2Z56B 3NBPA 3LPYA 3KZBA 1ZM3A 5KG5A 3QEWA 1DAXA 2KHCA 3UDLA 4B3MK 4BE2A 2HQGA 2QMWA 2AEFA 2YQ3A 5CYMB 3LP1A 1MU2B 2EFQA 1HPMA 5KG7A 1BQNB 1WN7A 2PEBA 2ITGA 2F9JA 3W66A 1AA1B 1X3NA 4QPXA 1RTIB 4GKJJ 2HVDA 1PJ6A 2B4VA 4IFVB 3ENVA 3O4WA 3QJPA 3DXSX 4EBEA 1G3OA 4X4QA 1XK8A 5KRTA 4U67L 2VB6A 2HWIA 4D3HA 4OLBA 3EN9A 3FC9A 2IHR1 4MIAA 4GVEA 4YB7A 1RABB 4ENOA 2G0JA 2FF6A 5IC4B 4FPIA 1UJ6A 4GC6A 4KC5A 2JJ4D 1G4CA 5ITHA 4LSNA 4K2XA 5BPMA 2O66A 1Y97A 3CG7A 3WC2A 5AR0A 1WC4A 1YRTA 2L3MA 4F04B 1E4FT 2GHWA 4AF1A 1QD1A 2CGLA 2IGIA 3QBXA 1JLEB 1U6BA 2MKKA 4RUBA 3MDFA 2JDJA 1T11A 1OMSA 5THWA 4BRQA 4FM0A 2IVOA 3TAMA 5FRNA 3IAM9 3ETMA 3ZZTA 2WHOA 3MUTP 4EZ9A 2W1BA 4H5WA 3FZMA 1X4HA 3NLCA 1VQ7N 3GTYX 3CJSA 4XDDA 4OHZA 3JYTA 1XERA 3A5NC 7FDRA 1RWVB 1K9MT 4KAZA 3ISND 2QM1A 4B9TA 3Q7CA 3RRGA 4NLGA 3FVYA 3PKMA 1VCTA 2E7XA 3BH6B 3PACA 3RW7A 2QL9B 1N5VA 2PO4A 4PG6A 2QX0A 2EWHA 2MLYA 3CJKA 2D0CA 1G99A 3H20A 4JYAK 3EEQA 1Q9XA 1RTJB 1R0BG 2FB0A 4JI5F 2KRBA 4KH5A 1W9HA 3AA5X 2IAJB 1YGYA 3CF5Q 3TARA 5HVHA 1RTHB 3QO9B 4BBYA 5IM0B 1BE4A 3S01A 3MUMP 2PI4A 2NSCA 3BBFA 4NLVA 2QLWA 2KM8C 3AO3A 3GJSB 1N48A 1HBUB 1VISA 3MEDA 3TQ1A 1C1BB 2VHGA 1T6DA 5FLXO 2WB4A 3DLLL 3IN5A 3S3MA 4PWDB 4FWPA 3VVTA 5CR4A 4KHUA 2PN6A 5CZXA 4I6MB 1L3VA 3HBTA 2WUSA 2E1CA 1QSYA 3ETOA 2EEYA 5J1PA 1M1KO 5IS2A 4NLQA 2OPRB 2V9KA 4K2JA 4EFAC 5B0FA 2DEJA 5LT5A 2M70A 3PHEA 2E5LJ 2BJ8A 2BA9A 2MQPA 2XGPA 4B3SJ 2ZGZA 5HI7A 4AD6A 3JQKA 4FN5A 2BW7A 1R8BA 3C7NB 1HWLA 1YAGA 1UW4A 5KT2A 5E2QA 3DAWA 3DRRA 4RW6A 3VOVA 3QJLA 4A5BA 1B70B 3H0PA 2FF3B 2AU0A 1RAEB 3CCMN 2GQCA 4FS2A 1RLDA 2WVFA 2W9CA 3N0VA 4WFAL 4L74A 1S0MA 2AYBA 4RNOA 3K5NA 1ZA2B 1NU4A 3TW0A 5CHCB 4K4TA 1U1NA 5KFIA 1CBKA 1VC6A 4OHVA 4JK7A 1HBNB 1S9EA 4LF5K 3AV9A 2KXNB 1PBAA 1TZ0A 1VLOA 4QIVA 2LA4A 3H5SA 4KYZA 2HFSA 1HNXF 2BDPA 2J8AA 3LF0A 1IBMK 4A4JA 3KHHA 1IQTA 1SBRA 3EDRB 1QTNB 4DQIA 4NLDA 4X2BA 4FJHA 5AQVA 2WVBA 4YDUC 3LP2A 4H0PA 1FXRA 2N4DA 1JKHA 2JWLA 5K14B 4I0WA 3QDKA 2YWWA 1DFDA 5H1SQ 1RAFB 1YJ9S 3ZSYA 2XM3A 9ATCB 2B8PA 3CJ0A 3CJ2A 3T5HA 4DV0K 2ZVSA 1X4GA 4OV1A 2XCPA 3THPA 2D0BA 3VCDA 4MJKA 4OX9F 2F5GA 4C48A 1NSAA 4CZCA 1XMOJ 3MCSA 4U7UD 3IMXA 1I39A 4BRPA 1HWKA 1UA1A 4MAKA 3CCZA 3IM8A 5A2QU 3KK1B 1SI9A 4CGIA 3M9MB 1RBVA 1IO2A 4X64J 2NXEA 2LCWA 1KTVA 3ZZOA 4CJSA 4F67A 5IT0A 1D9AA 4HLBA 3BN7A 2G1DA 1VQKN 4RW9B 4Q0BA 2GVDB 2MKIA 1XN9A 3QNOA 1Q78A 2MKCA 2HHQA 2OTJS 4H03B 5KFOA 2F8EX 2DR8A 3WZ0A 2ROPA 4HDGA 2PDAA 3NFAA 2BW2A 4JLHA 4DPXA 4IG3B 3OBIA 2HVIA 5GAHP 2X74A 3D2FB 1FJGF 1Y3KA 1SJ4P 2LEBA 3DLEB 4LBPA 2AZ3A 1KWMA 2F7VA 4QIGA 3UKUA 4B9LA 5ETVA 4KPYA 1MMLA 2E1MC 4ECVA 2YQ0A 2CVIA 2YY3A 2RS2A 1MMDA 4M3TA 1S49A 4CJRA 4XH1A 3LM2A 1KDNA 1JLQB 3US5A 2E1PA 5KFKA 3C14B 1U2VA 1Z26A 2OHDA 3SCLE 3KLHA 3VQEA 3GB0A 4H4MB 4U7UK 2R2TA 2K2PA 4E1MA 3M9NB 4CW7B 2PFUA 3OYJA 4QS8A 2J6SA 3ZX2A 2ZWHA 5DO2A 4P73A 2ZJQL 4U67Q 4NEYA 4JKCA 4ZLJA 5J1EA 1QQOA 1WSVA 1BU6O 3D6HB 2GHPA 1IKYB 2ALYB 3VAKA 4H8KA 4PQUB 4Z4IA 4CLFA 2WSCC 2HNDA 5EWGA 3E8OA 2VG7A 1F1BB 4CIEA 4LREA 1GK8A 3A3PB 2FC0A 1LKZA 1CULA 5A76A 3GIIA 4ES2A 1KC8T 1G7CB 4GY2B 2ZM6K 4A8KA 3SCIE 1NCLA 4H4OA 2ZH7A 1GEHA 3ZEUA 1ILYA 3ZT0A 2CJQA 1S1UA 4CH7A 2FBYA 4ZPCA 2N3OA 3O3GA 3BREA 1FDBA 2AWZA 1UAWA 4KHMA 4Q45A 1DEJA 1RHJB 2AHOB 3GSDA 3TR8A 2VONA 5JVGL 2ZBIA 1GQEA 1K73O 2A41A 4DV3J 5F9NA 1FRHA 2YH1A 4GVMA 1H38A 2OJ3A 4HTIA 3SAHA 3VQTA 4WFNQ 1ZPVA 3FUYA 4XO0A 3PTWA 1C1AA 4FM1A 3D7EO 4Z2XA 3JTOA 2O8FB 5ADXH 4KHQA 1JNZB 4AQYK 3V6JA 2RT3A 1LV5A 3IC1A 3KNGA 4C6AA 3NOCA 5F41A 1MG7A 3MDQA 3RRKA 4KRWA 1YKWA 5CA5A 3VQBA 4JI1K 2P5OA 4JI8J 3J7AP 3SPYA 2P9KB 4OYPA 3IP0A 1BLUA 2NYIA<