3LANA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-butyl pyrimidinedione non-nucleoside inhibitor
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 160
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lanA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lanA05
1JLEA 2VG5B 3KTQA 3GV5B 1S6PB 1DLOB 4R0EA 5KG3A 3MEGB 1U04A 1RA6A 1LWFA 2FLLA 3L2RA 3KLIB 2ATQA 2XGQA 2EX3A 4CFAA 3F73A 1K6YA 4O3RA 1KTQA 4ECZA 4CGFA 1RT1B 4I2PA 3SNNA 2XCPA 3DRPB 5J2PA 3PX4A 1C0TA 1HYZA 2OPSA 1X9WA 4EYIB 2OYQA 3CDWA 3CWJA 4QWAA 2HWHA 5L1KA 1RBTA 3AVHA 2O4IA 3OS2A 2D0BA 3VQCA 1JX4A 1JIHA 4YMEA 4TY8B 1F21A 3AA3A 3I5CA 1LW2A 4O3SA 1BQNA 3KK2B 3NHGA 1VSIA 1J54A 4M41A 1S97A 5DK5A 4HHTA 1XR5A 1HRHA 1HNVA 1FKPB 4DL4A 2F8SA 1RTHA 5K14A 3QIPB 4RW7B 5C24B 3OJUA 3I5BA 4Z4IA 1N48A 5L9XA 2D0AA 2QXFA 3GYNA 1GOAA 3DLEB 2FBYA 5KFYA 3QIPA 4RW7A 3AA5X 1RDRA 4DSFA 2B4JA 4M45A 1FK9A 3QLHB 3DLEA 4EBEA 4JRQA 3NE6A 4IKFA 4CGGA 4EP4A 2YKMA 2ZE2B 4G1QB 4FW1A 2G8IA 1SL1A 4B9MA 3H5UA 4M3YA 1N56A 3ITHB 3MF5A 2P1JA 2KFNA 1LWEB 1S1WB 4DTRA 4DSEA 4PY5A 4I7FA 4AHRA 4DTJA 2F96A 3MEDB 4IOBA 4CFCA 3Q8QB 1XHXA 2FC0A 4CGJA 3P5JA 4OGEA 3KD1E 2AJQA 4CJEA 1KVCA 1JL1A 4AHUA 2V4RA 3SYZA 5F8HA 3B6OA 3KLFA 4M42A 5KFEA 5I3UB 4N76A 4LD0A 3QYYA 3T5KA 2XGPA 4ZTJA 2Z1IA 4O44A 3UR0A 1YT3A 2DFFA 1S0MA 3S3NA 2B43A 1U09A 4EBDA 3O3GA 4RG8A 3ZT4A 3LP3A 2D5RA 4FS2A 1HJRA 5HRPA 3AA4A 1Q9XA 2FLPA 5KG0A 3HVAA 2QE5A 3OL6A 3HPHA 4FW2A 3PX0A 2ILYA 3K58A 4CF1A 4ELVA 1HYVA 4GMJB 3OY9A 4F4WA 1Z26A 2YNHB 1NKCA 2WHOA 2FJWA 4ECTA 2WOMB 1Q8IA 1QHTA 2BQUA 4CIGA 4E19A 2XI3A 2FVCA 3RMDA 1IKVA 1T05B 1QQCA 1T03A 3OYHA 1IG9A 4RNHA 3T1AA 1S9FA 1TL3A 3OJSA 1IM4A 3DRSA 4EYHB 2OPQB 4CIEA 2KTQA 3KMQA 4J2DA 2Y1IA 3RWUA 5L1JA 2EC0A 4C8NA 4O5BA 1JLFB 5DG9A 1VSMA 3PV8A 4OKEA 1C0MA 1CZ9A 3E51A 4Q0BA 1LAWA 2R2RA 4KV8A 3RBDA 3S3OA 3HJFA 1C1AA 3TAMB 4NCAA 4GW6A 4TY8A 2IGIA 4CHYA 3AVIA 1RA7A 4JS4A 4MIAA 2KZZA 4TLRA 1HMVA 4ZP7A 2YNIB 1NJXA 3ULDA 1RDBA 4FLUA 3DLKA 5EWFA 2DPJA 3HHKA 3TQ1A 5KFQA 1GOCA 1NKBA 1JLFA 1O1WA 4DTNA 4LSNB 3V1OA 3QNOA 5EWGA 2HNDA 1RT2B 5HROB 1S49A 4AH9A 5FDLB 2UVVA 4CFBA 5L1LA 4BE1A 3NAHA 4IFVB 4DTOA 3RMBA 3TAMA 1B9FA 3RB0A 5F8IA 4CJWA 3HP6A 1UA0A 3NGDA 1IO2A 4CK1A 4J9PA 4FM2A 3PR5B 4BACA 3PJWA 1JLBA 2KW4A 3JSMA 4TYBA 3QEIA 2OA8A 4QW9A 3OYGA 4G3IA 3AV9A 1DTQA 4LSNA 2E6LA 2HMIA 2IM3A 2JEJA 1KVBA 2HNDB 2Z1HA 2JLEA 4WYLA 1OS5A 3ZSVA 4I2PB 1JLEB 4W5QA 2B6AB 4AILC 1TKZB 4Z4HA 3VQ4A 5KG5A 3VQEA 5F8MA 1RT7B 2HMIB 4AHVA 1KLMA 1T05A 4F4YA 2OZMA 4NLSA 3NBPA 4O4GA 4URGA 5C42A 4ECSA 2YNFB 1B9DA 2GV9A 5J2QB 1S9EA 2ZQBA 3BJYA 4ECVA 3KK2A 1BIUA 3CDUA 3QGIA 4JV1A 1L3VA 2X74A 3G86A 4DEZA 1IKVB 4E3SA 3KKRA 5KFKA 1RYRA 4F50A 4MK9A 1EX4A 4R8UB 3T3FA 2FVQA 4QAGA 4CERA 3MR6A 4CF2A 3NAIA 4BWJA 4HUFA 1NHVA 4JRPA 4OLAA 4IH5A 2YKNA 3SPZA 4JUZA 4ZPBA 4EEYA 5F8NA 1UA1A 3O3HA 3VQ9A 4OKKA 3NFAA 4DTXA 3BSNA 4NLOA 3CFOA 1EETB 1KFSA 4KB7A 1ASWA 3LZIA 2UUTA 3TAFA 1U4BA 2DY4A 4FLWA 4FJXA 3MR3A 1ASVA 4RNFA 2JEFA 1EETA 4B3OB 4DU1A 2ZE2A 3O4NA 2WONA 3V81B 4KE5A 5KFCA 2IS3A 4IH6A 4Y2AA 2AQ4A 2KFZA 4OVLA 2D3ZA 1HPZB 2XCAA 2O5DA 1C1CB 3QLHA 4IFVA 1RTDB 4IKAA 1KLNA 4IH7A 1IKXB 3O3FA 3H08A 4DLGA 3TAGA 4M3TA 4ZPAA 3NCIA 1C1CA 3SQ4A 1RT6A 3SFGA 3MFHA 1JLAA 1TVRB 4B08A 1TV6A 5KFNA 3QETA 4GC7A 1WN7A 3G6VA 1ZBUA 3H5YA 4B9NA 4FZZA 4DG1A 3ICLA 1NK8A 2JEGA 3NDKA 3C6UB 2WCXA 3H40A 4IDKA 1LWCA 3CDEA 4ELUA 4F4XA 3CJ2A 1IH7A 3KJVA 2G8HA 3V4IB 1DTQB 4M94A 2BR0A 2YNIA 5F8GA 1LWCB 1ZBLA 5C42B 3WNGA 2ETJA 4E1MA 1BI4A 3HYFA 3C6TA 4CJRA 2AGPA 3NAEA 4WZMA 3PHEA 4KI4A 4XPEA 4FLZA 4DSLA 4E7KA 4MH8A 4AHSA 5KFAA 2ASJA 2B5JB 1Z25A 4ECXA 4RUCA 2C2EA 3PW7A 3C6TB 4IRDA 4BDZA 4ECWA 4KAIA 3H59A 3IRXA 4DQSA 1TKTA 3G10A 1NHUA 3AVAA 3OYKA 3SUQA 1RILA 3OL8A 3SI6A 1VK0A 1JLBB 3HVTA 3H5SA 2HVHA 1C0TB 4IFYB 4RZRA 3QEWA 5JXSA 1L5UA 2V4QA 1C1BB 3NKYA 4B9VA 1RDDA 1HQUA 4FBUA 4CF9A 2HHUA 4CJSA 3KLHB 3DRRA 1K1QA 3CJ5A 4DL7A 4LH4A 3OSPA 3M8QB 1CLQA 3VQ5A 1IKYB 3FQLA 4DMNA 4HCBA 1CZBA 1W25A 1I3AA 2E4LA 3K5LA 2HHXA 2KQ2A 2GBZA 1SH3A 2UVRA 4ZTFA 1DTTB 4J2EA 2G8UA 2C2DA 3G6XA 1BQMA 2R2TA 3QNNA 4J9LA 3V9UA 5FROA 1BL3A 3HVRA 1RTJB 3CQ8A 3IGNA 2HHWA 3K59A 1CXUA 4CHZA 2C2RA 3EZ5A 2CJQA 5T7BA 5J2PB 4NYNA 1SKRA 4J2BA 1D0EA 1WSEA 1HMVB 4KTZA 1UAXA 2HNYA 1VSJA 1ASUA 1A5WA 4KFBA 1BGXT 3EYZA 2PZSA 4ZHRB 1JLCB 4FJ9A 3V4IA 2IJFA 4G1QA 3V6KA 4NCBA 1X1PA 3HP9A 3DOKA 2IMWP 3KLGB 2QK9A 4EBCA 4FJGA 4ED8A 4MQ3A 2RN2A 5HRSA 3OYFA 1EXQA 4CE9A 5KG4A 1A5XA 4WE1B 3AA2A 1NK7A 2HHQA 4Y3CA 3LPTA 2XC9A 3DLGB 1BCMA 1W9HA 2IM1A 4K4YA 4TN2A 2FVSA 4WFXA 5D3GB 4XIUA 1J53A 2BQRA 3FFIB 2IA6A 1JLCA 1VRUB 5L1IA 1TQLA 1RT5A 2NUBA 3N6NA 2OPPA 1NJZA 4H4OB 5DMRA 1JLAB 1DLOA 1GX6A 1NKEA 4DQQA 3THVA 5SZTA 4IBNA 2D3UA 4CJVA 3DYAA 4M3RA 3V9SA 2G8VA 4DSIA 2BQ3A 4K4XA 2IOCA 3L2VA 4Q43A 4WXOA 5DQIA 1S6PA 3TAQA 4DQRA 3ZSYA 3RB4A 1VRUA 4WFZA 4DQPA 4IFYA 2IM0A 4KTQA 1C6VA 2XWYA 1L3SA 3SQ1A 3CYMA 1Q9YA 2RPIA 1T03B 3PW5A 3KK3B 1TKDA 4O3OA 1S4FA 4EP5A 4L8RB 2R2SA 3ZSQA 4EO8A 1D9FA 2WB4A 1ZETA 3WNEA 3MAQA 2WOMA 4U6PA 3NGYA 4ICLB 4FJ8A 2RDIA 1MU2B 3G6YA 4W5TA 2Q3SA 4O3PA 5KFVA 3Q8SB 2FJXA 1HQEB 4TQRA 2ZD1A 1IKWA 2HHTA 4DTSA 4FLVA 2VA3A 2UVWA 3WNFA 4Z4GA 3QZ8A 2G8FA 4KBIA 5DLGA 3UIQA 3ZSRA 4KREA 4CEZA 2WTFA 3VA0A 2IC3B 4FJKA 5KG7A 2DTUA 2G8WA 1BIZA 4ID5B 2GIRA 3AVNA 1TKXB 1HNIA 4YNQA 5DQGA 3KD5E 5KRTA 4FJLA 3RRGA 3KLHA 4K4ZA 5KRSA 4DG1B 3SZ2A 4ID5A 4NLUA 4QWEA 1J9AA 3QGGA 4JLHA 4WXWA 1RBUA 2FBXA 5FDLA 3KHHA 1KFDA 2PYLA 3KMSA 2PY5A 3ZT3A 4YQWA 3TAEA 4ED0A 3V9XA 3LALA 3AVLA 3E01A 3ZT1A 3GV8B 3Q8PB 1BQNB 2RF2A 1REVA 3SV4A 3KLEB 3QERA 4RW9A 1RBSA 3AVBA 2W8LA 5JS2A 3HSTB 5CZ1A 4R5PB 3QEPA 3QO9A 3GV7B 1VSLA 1WSHA 5JUMA 4QWBA 4MK8A 4M3XA 3DYAB 4PA1A 2B5JA 2OZSA 3DLBA 1HPZA 1RT4A 3LAMA 3PZPA 1SL2A 4RNOA 3V9ZA 2HNZA 1TL1A 1BI4B 4CEDA 4I2QA 2ITGA 5KFIA 4O44B 1S1UB 1RT4B 2IM2A 3MXIA 3KLGA 3KIOA 3MEGA 1TV6B 4HTUA 4NLYA 4K4TA 3MTKA 2AX1A 3O4QA 4K4WA 1WLJA 3JYTA 1KLMB 3DLGA 3EPGA 1XHZA 2VG5A 2VG6A 3TANA 4CJKA 3QEXA 4FJ5A 1S9GB 2AGOA 3GIIA 3SCXA 4QCLA 4EZ9A 1NK4A 4E89A 4K4VA 4IQXA 3H98A 4JV0A 3DRRB 4PUOB 4ZP8A 3DRSB 4NYFA 3M8RA 4W5OA 4NLGA 3UQSA 3BREA 5HRRA 1SV5A 3DM2A 3AVCA 4RW4B 1RT3A 3I0RB 4J9MA 4W5RA 4ZVFA 4TSXA 5KG1A 5C24A 4H8KA 1RBRA 2P5OA 3QIOA 1SV5B 4FS1A 5KT4A 1Z4UA 2VWJA 3BQ1A 2BANB 3ISNC 3BR9A 4KHRA 4O0IA 1ITGA 2XY8A 1ZTTA 4BWMA 4ICLA 3RTVA 3T5LA 3KK1A 3K5OA 2IAJA 2E9RX 1JL2A 3RMCA 3DLHA 3OL9A 1WNEA 1YVFA 1JLQB 4NCGA 2ZKUA 2BRKA 3K2PA 1XR6A 4KRFA 3IN5A 1SH0A 1TVRA 1X9SA 4FK2A 3D0PA 3QO9B 3BQ2A 3BSCA 5KT7A 4CHOA 3AO2A 1BQMB 3SUPA 3DDKA 4Y1DA 1I39A 3KK1B 3AO3A 5JS1A 4FM1A 2QKBA 3PUFA 4B3OA 1RAJA 1UOCA 5DQHA 3S9HA 2A1SA 4AHCA 2AX0A 3NH2A 4N56A 3NGIA 4I7FB 3AVFA 4CEQA 3KLFB 1CXQA 5J1EA 4Z0UA 4Q8EA 3CFRA 3HL8A 4CEAA 2OPRA 4I9QA 4K4UA 3B6PA 2BGGA 3E01B 3VQQA 1D8YA 2X6NA 3U6FA 4ZVEA 1EP4B 4IG0A 2J6UA 3L2WA 4OL8A 2I5JB 3V1QA 3GILA 1T8EA 4FM0A 2XY5A 4QOZB 3KNAA 4KAZA 3TR8A 4NLVA 5DGBA 4CJ5A 3ZSWA 3SV3A 4IR1A 3NGZA 3KK3A 4Y34A 1D9DA 3H5XA 3QINA 4CF8A 3ZSOA 4BDYA 5HLFB 1TK5A 2FBVA 4CK3A 4CCHA 2YKNB 2CKWA 4O55A 3MR2A 4QW8A 4Y1CA 5KG6A 2YV0X 4OJRA 2ATLA 3L2UA 4KHQA 4CJ3A 4FJJA 2W9BA 3VQ8A 3TARA 4NRUA 1U47A 4R8UA 2VG7B 3VA3A 5J2NA 5CYMB 1IKYA 3LDSA 3HPGA 4CJPA 3PO5A 2D41A 3OYCA 3OYJA 2D0CA 2QV6A 2JC0A 3V6DB 3LP1B 4ZPCA 2VG6B 4E1NA 1XWLA 1BISA 4FVMA 3OYEA 1R0AB 4TYAA 1TGOA 4DFPA 4FK0A 5J2MA 1NJWA 1YVUA 3AO1A 1VRTB 4N47A 5FRNA 3V6DA 3DI6A 4KHUA 4NZ0A 1CSJA 4IG3B 4IR9A 2VA2A 3DOLB 4BDPA 4DFMA 5J2NB 2WONB 3V81A 1N6QB 4WFYA 4Z4EA 3OHBA 2YHBA 1X9MA 4KO0B 1QUVA 4PQUA 4OGCA 4FJNA 3HT3A 1QSYA 1LAVA 1MU2A 3OYDA 3ZCMA 1VRTA 1NK0A 3BDPA 3V9WA 1BHLA 2W7OA 3L3UA 3A2FA 1IKXA 4OKJA 1S10A 4K50A 3LZJA 3QESA 3SPYA 3PO4A 3RAXA 5CY4A 3NH1A 4E7HA 5HP1A 5T14A 1C0UB 3HM9A 2DFHA 1LWEA 3SQ0A 2YNGB 1QAJA 3PW0A 1RT5B 4KO0A 2F8TA 2OPPB 1WSFA 1RCHA 2W8KA 3RR8A 2W9CA 4KKOB 3QIDA 3ITHA 4CGIA 5KFGA 4CJQA 1QE1A 2RKIA 2HHSA 3OS0A 3NL0A 4H4MA 4YR2A 4X2BA 4CJFA 4EO6A 1QTMA 4HYKA 2P51A 5I42B 4Q5VA 4AHTA 5KFMA 4UQGA 4FJIA 2OH2A 5KFUA 1S9GA 2YNGA 4DF4A 2A1RA 3IAYA 1WSJA 3LPUA 4KHYA 4KSEB 1ZBFA 2Z1GA 2R8IA 3M8PB 3ALYA 4F2RA 4MKBA 3FQKA 3OYBA 2R8KA 1UWBB 4CJ4A 4KHWA 3PW2A 5K14B 3K5MA 4B9LA 4ED7A 1T7PA 3IRXB 3OLAA 1SKWA 2UUWA 4ZP6A 1N4LA 4XPCA 4EZ6A 3HXMA 1RT1A 4MFBA 3DRPA 4E0DA 1SKSA 4LY7A 3HVTB 3V6JA 2ZD1B 4PWDB 5KT6A 5KFFA 4FLYA 4KHMA 2JEIA 4KTWA 5KFSA 5F8JA 4DF8A 1T3NA 1S6QB 2BANA 3N6MA 1LV5A 2J6SA 3IG1A 1YTUA 4LSLB 3CG7A 1UWBA 1U45A 1TL3B 1N6QA 3G0ZA 3M8QA 4NLWA 4J9NA 1ZYQA 3H4BA 4DL3A 3IG1B 5KTQA 3LAKA 3FRZA 1S1VB 3KLVA 2UVUA 1S1XA 5EDWA 1TK8A 4DFKA 3BSAA 3T5JA 4PQUB 3GIKA 2XI2A 3QZ7A 4H54A 4ED2A 4ZHRA 1NNDA 2J6TA 4RW6B 3MXJA 4F3TA 2W9AA 1Y97A 4RW8B 4KB0A 3OSNA 4RNMA 4LH5A 2AWZA 3CJ3A 1RTDA 1C0UA 3LP0B 3CO9A 1KRPA 4WZQA 3KHRA 4K8XA 3EY1A 4ID1A 4NLPA 1RDCA 1QE1B 4FXDA 4N5SA 3NF6A 4URQU 3I0SB 3MECA 1FK9B 2P5GA 4DQIA 1JKHA 2W9CB 5SWMA 4J2AA 4ELTA 2IC3A 3EZUA 2FBTA 2OPRB 1JXBA 4WE1A 3F9KA 2R2UA 3LP2B 1VSHA 4DU4A 4RW8A 3OYAA 4F4KA 2WK4A 2LSNA 3L3VA 1TP7A 4M3WA 4ECQA 2JGUA 2FJVA 2XY7A 1JXLA 3AVMA 5KT3A 4I2QB 3LP2A 1T94A 4NCGB 2Z1JA 3UDLA 1S1TA 2RDJA 3OHAA 4DTMA 4LQ3A 4C8KA 2ILZA 2FLNA 3FDSA 5DGAA 4CJTA 1RBVA 2FVPA 5F8LA 3VQDA 3CVKA 1TKTB 1BCOA 2W7PA 1S6QA 2XO7A 4O4GB 3V6HA 3KOAA 4ECUA 4HKQA 4OPKA 2W9BB 5F9LA 5KFOA 3RB3A 2VG7A 1S48A 4RU9A 4CIFA 4KB1A 3ZT2A 3MXMA 5KFXA 3DMJB 2RKIB 2GIQA 5C5JA 1MMLA 1VSDA 4RW4A 3ZSXA 3MEEB 1QSLA 1RTIB 2YNFA 3BQ0A 3AVGA 3NMAA 4ZPDA 2BDPA 1LWFB 3K57A 4JV2A 5CYMA 3KLIA 1C2PA 3T5HA 2HB5A 3M8PA 3N6LA 3NF8A 1NK6A 2E9TA 5CYQA 2I5JA 3LP1A 3DMJA 4JS5A 5KGWA 5EU7A 2OPQA 4N41A 4BE2A 5KFWA 1L3UA 1FKPA 4Z4FA 5DG7A 3ISND 1ZBHA 1VSEA 4PWDA 4F3OA 1NK9A 4RW6A 2G8KA 3HPOA 2V9WA 4E7LA 1LW2B 2KZMA 1TKXA 3M9NB 3FSIA 3LWLA 3M9OB 3MECB 1KCFA 4KV8B 2HAIA 2F8EX 1VSKA 3GIJA 2DFEA 5CYQB 4NLRA 3LP0A 1S0OA 1I6JA 4QPXA 3VQPA 1TAUA 2E6MA 3KLEA 3AO4A 3SUOA 5KT5A 4NLDA 3U3YA 5EWEA 3I0SA 4RUAA 2VWKA 3C94A 1NOZA 3P1GA 2ASLA 4CJLA 5I3UA 4XO0A 1SL0A 3C95A 3L2QA 3QEVA 3WNHA 3C6UA 3IS9A 4FZYA 4CJUA 3BSOA 3VQAA 1NJYA 5I42A 2HNZB 1KSPA 1A5VA 2R7YA 1XC9A 3CFPA 4I9LA 4FZXC 1HNIB 3T19A 3MEDA 4H4OA 1G15A 4FBTA 1NOYA 4CF0A 4HVJA 3SUNA 3IGVA 4Q44A 1S1WA 2EHGA 5KFPA 3JYTB 3HK2A 3SI8A 3RR7A 3QGHA 4Q45A 4B9UA 1RTIA 1U49A 1TK0A 4ED3A 4E7JA 3MR5A 4HCCA 4NLQA 3Q8RB 3AVJA 4CHNA 4CGHA 3NF7A 3BGRB 1J5OB 4Q8FA 3TWHA 4B9TA 2HVIA 5EUHA 1U48A 4K4SA 1HNVB 1S0NA 1TAQA 2Y1JA 3RRHA 1TKZA 3L8BA 3DLRA 1KHWA 3D28A 1LW0B 4MKAA 3NH0A 3PR4A 3OYMA 3PW4A 3D45A 4RNNA 2IDOA 4FYDA 5KFBA 3OS1A 1HQEA 2I1RA 4HUEA 2WRMA 1L3TA 2R8JA 4TXSA 1R0AA 5C25B 1SH2A 2C28A 4ZVHA 4CK2A 1C1BA 3VQ6A 1RT3B 3LWMA 2BRLA 4NLXA 5KG2A 3AO5A 4DTUA 3M9MB 1QAIA 1IKWB 3TI0A 3TAPA 1WAJA 3PY8A 3OLBA 4DFJA 2O4GA 4OPJA 4YFUA 4CHPA 2X6SA 1S5JA 4C8OA 2X78A 3I8DA 1DTTA 3OYLA 4C8LA 3KJVB 4MIBA 4O4RA 3DOLA 4DSKA 3D5MA 4CESA 4DS4A 4CHQA 4E7IA 1RTJA 4J9QA 2V0NA 4U7CA 1JXEA 2GC8A 5KFTA 2IAJB 3GQCA 4LSLA 3RAQA 1RTHB 3SJJA 4PUOA 4LQ9A 4ZMMA 1HYSB 5HBMB 4O3NA 4M3UA 4FCYA 5DLFA 4KHNA 1ZTWA 3IS9B 4CEOA 4O3QA 3DLKB 3EPIA 5KFDA 2B6AA 2AGQA 3I0RA 4FK4A 3CJ4A 4CFDA 4KFBB 2PYJA 1B92A 1GX5A 5HBMA 1GOBA 1XR7A 1WSIA 2W42A 1S1TB 4FJHA 4RW9B 1RNHA 1RYSA 1JLGB 1D5AA 2BE2B 3ASMA 4J9OA 2IJNA 2FVRA 4TQSA 5KFLA 4J9SA 3AVKA 1TL1B 3FFIA 4IG3A 5KFRA 3KKSA 5DG8A 1EP4A 3MFIA 4CEEA 4DWIA 1JLGA 4HUGA 1KVAA 3SQ2A 1D1UA 4ECYA 2E9ZA 1FXXA 3H4DA 2DPIA 4C8MA 1VSFA 3H2LA 3VQ7A 3BGRA 1J5OA 4NLTA 5E41A 3OYNA 2R8GA 3MEEA 4CEFA 1EKEA 4FLTA 5HP1B 1W0HA 4ECRA 4GC6A 4ZVGA 5KFJA 1RDAA 3VQSA 4IRCA 5C25A 3CIZA 4B8CA 4GVMA 1RT7A 1LW0A 3RB6A 1WNSA 3VN5A 2XHBA 2AU0A 3NBPB 4IRKA 4B9SA 4B8AB 3OYIA 4FJ7A 3CJ0A 1S9EB 3OL7A 2R8HA 2ASDA 3P83D 4J9KA 5KT2A 2HW3A 4DL6A 1NK5A 1HQUB 3TABA 4M3ZA 2YNHA 4NYZA 1XI1A 1S1XB 4W5NA 4M95A 2XY6A 4K8ZA 1K1SA 4DS5A 3VQBA 4DL5A 1WSGA 4KPYA 2HWIA 4CEBA 4Z4CA 3DM2B 3OVNA 2HHVA 1N5YA 3LANA 4QWDA 4KHSA 1QSSA 3TVKA 4YR3A 2IBKA 2YHAA 4YR0A 2OPSB 3HKWA 1RT2A 5HROA 5J2MB 3RMAA 3CM5A 3UPFA 4MFBB 4BE0A 4DU3A 1N5YB 5KGXA 3RBEA 5HLFA 3HVWA 1JLQA 3KHLA 4ED6A 2ALZA 4QWCA 4CGDA 2BE2A 1JKHB 5F9NA 3PX6A 2JC1A 4J9RA 2GUIA 1FKOA 3JSMB 3K5NA 4F4ZA 1REVB 1ZBIA 3DOKB 4URSA 4TY9A 4Q0BB 4DSJA 4ZP9A 4F2SA 1FKOB 4OLBA 2HNYB 1SUQA 4R5PA 2C22A 4YP3A 4F8RA 1S1VA 3GIMA 3ZSZA 4FLXA 5KFZA 4Y2CA 1QS4A 4DTPA 4H4MB 5KI6A 3ZT0A 2RF2B 3SFUA 1RT6B 3S3MA 5D3GA 4KKOA 2D7SA 3I5AA 1SUQB 1KHVA 5CZ2A 3U3GA 3DI6B 1HARA 5J2QA 2YKMB 2QKKA 5HRNA 1HYSA 4O0JA 3PVXA 4FJMA 4IDKB 3CM6A 4CECA 4KI6A 5J1EB 5FRMA 3NF9A 3PJXA 4DL2A 4ED1A 3HO1A 3V1RA 5KFHA 2XRIA 1WAFA 1YTAA 4NRTA 4MK7A 4DLEA 4WYWA 3M8SA 1S1UA 4IG0B 3KHGA
chains in the Genus database with same CATH superfamily
1JLEA 1TU0B 2E2QA 3D7SB 3KTQA 1S6PB 5BYQA 3MEGB 1HPMA 1CG2A 3D2WA 2FLLA 2DR5A 3FZHA 3KLIB 4HT5A 2LYVA 3FNNA 3D3CJ 3P38A 3AAWB 4JV5F 1RT1B 5CCLA 3SNNA 3DRPB 3PX4A 4JKHA 3VTIA 3PSIA 3IRWP 1VQ4N 2CJXB 2HWHA 3TVZA 2RQCA 4P7TA 2D0BA 5GAHI 4YMEA 1F21A 4FWNA 2QMUB 3BBBA 3CJRA 2YWWA 1FDDA 1EQYA 2QMWA 1BQNA 3KK2B 3VTHA 2CFXA 5DK5A 4DR2F 1OH8A 4HHTA 1XR5A 2F8SA 4OJ1A 1VQOS 5K14A 4RW7B 1AZSA 4EI2A 3OJUA 2VQEK 4GVLA 4LF1A 3DLEB 2QO3A 4WYBA 4B3MK 4RW7A 3CCLS 1GLFO 9ATCB 3AA5X 2NYHA 2YVSA 5B08A 3M1FA 4EBEA 2AZ3A 4IKFA 1JJ4A 4CGGA 3BDEA 2YKMA 3WXJA 1JK9B 4KT0C 2G8IA 2VPYB 2OLWA 1IQZA 3TUPA 4IFEA 3MF5A 2P1JA 2VL1A 4QJVA 1M1HA 8ATCB 2FHJD 2YX1A 2GHWA 2IVYA 1ZA2B 2L9WA 3MPYA 4DSEA 4DTJA 4IOBA 2K7JA 1B4SA 3CCTA 4BC2A 4LF9J 4WF9Q 4J90A 4CW7B 1QVGM 1OWXA 3KD1E 5E26A 4DPTA 2XMWA 4TVAB 4AHUA 2RB7A 4M42A 1HHSA 1RWUA 1IVZA 5EY4A 4LD0A 4ZKAA 5DM6L 2O8CA 3QSIA 3ZZUA 1BWFO 2Z1IA 2HGNA 1VHIA 1YT3A 2DFFA 2A18A 1S0MA 2B43A 1U09A 3ZT4A 1N5SA 3BZKA 2HFZA 4USHA 2AZ1A 4FS2A 2H3EB 5HRPA 3AD8C 4LF6K 2FLPA 5KG0A 3JSBA 2V94A 3CCQS 3HVAA 2FB0A 3MWPA 2QE5A 3OL6A 3HPHA 4USUA 2NLWA 1IBMK 3OY9A 2XZTB 3KNGA 2UZAA 4J9VA 4CZIA 4KH1B 2ZZMA 4K8RA 4JI6K 2BQUA 4KR0B 4E19A 4TKTA 2C3YA 2HLTA 4FO0A 1T03A 2RSQA 3JSRA 3OYHA 3PSFA 1O0PA 4DV3J 5AQJA 2Z30B 1U2VA 1U0HB 2HSTA 1KR4A 2OPQB 3RWUA 4F0MA 4C8NA 3QAUA 2I8EA 4AXJA 4USMA 2ZBQA 4K59A 1UW4A 4OYBA 5KAKA 4OZ2A 4G1PA 4OKEA 5H9FJ 4OHXA 2HYIB 3E51A 4Q0BA 1KD1O 3S3OA 3HJFA 1C1AA 3OTOJ 4NCAA 4GW6A 2ZOFA 3G71S 1DZ5A 2IGIA 3AVIA 4OZNA 1RA7A 3LA0A 3UKRB 5BXIA 4ZCKA 1I51B 4ETZA 4TLRA 1WI6A 2YNIB 4BC3A 4FYVB 1TL5A 1RDBA 4FLUA 1Y9OA 3DLKA 5B0FA 5EWFA 4NZ7A 2XSJB 3HHKA 1GOCA 1OY6A 1SS6A 1FTCA 2F3JA 4KHPF 5CABA 2HNDA 4IWVA 4ZIVA 1T3OA 5L1LA 3NAHA 3RMBA 4EU0A 5HN0A 3Q86A 1WD6A 2LXFA 1KWMA 5JJBA 3W62A 2B9XA 3OXLA 2HPUA 2CWKA 4BACA 3PJWA 4LBPA 2KW4A 4TYBA 4OX9J 3A5MC 1HBUA 4QW9A 3CD6S 1HD1A 3OYGA 4G3IA 1ZPVA 2E6LA 4LSNA 1LOUA 2VWBA 2JEJA 3TX0A 2JLEA 1GMVA 3HOTA 1OS5A 4W5QA 1AA1B 1XNQK 4AILC 3ULEB 2QWMA 2XMKA 3DLJA 3WEEA 1HR0K 1S4EA 2BM0A 4DV5K 3ILIA 4O4GA 3OTCA 4URGA 4OZ5A 3L3CA 3OTOK 4FDFA 2W2NP 2GV9A 4DR3F 4ECVA 3KK2A 3A12A 4ILRA 5FIIA 4DEZA 4E3SA 3KKRA 1B0PA 1FXRA 4MK9A 4IQMA 1EX4A 3T3FA 5AQGA 1VQMN 4PEOA 1JCGA 4CERA 4CF2A 3B4DA 1Y3KA 1NHVA 3DWLA 4F4AA 3SPZA 2G2ZA 2YKAA 4JUZA 4ZPBA 5F8NA 3O3HA 4PR6A 1OPZA 4RUHA 3MX2A 1FRXA 1ASWA 2DNGA 2NR0A 1U2RA 3AARA 2UUTA 1U4BA 3FEYB 2DY4A 3C14A 5IT9Y 4BHQA 3MR3A 4RNFA 3G96A 1SI9A 3PIPQ 4DU1A 5EX5A 1OMSA 2D69A 2R7QA 4OIXA 2AQ4A 4OVLA 1PJ6A 1C1CB 4DV2J 4Y2IA 2ZOMA 1RTDB 4IKAA 1IKXB 2AEMA 4DX5A 2PAVA 3H08A 3O1BA 3AY9A 5HVGA 3J7A1 4M3TA 1R7IA 1IBLK 3SQ4A 4DUZK 1K8AT 1JLAA 1JJCB 2CADA 2QFIA 3QETA 3D6RA 3QFUA 3H5YA 4B9NA 3SCJE 3OBYA 4ATNA 4GNIA 3H40A 2PA8D 2FLOA 3H3OB 4P2SA 3MCAB 3H0PA 5E7OB 1IH7A 3D0GE 2F8MA 2H54B 4B3RF 1HHTP 1GLLO 4M94A 2WB1D 2P9SB 3M1VB 3NAEA 3HFVA 1MWMA 2VBXA 4DSLA 2U2FA 4WBFA 4ILMA 2B5JB 1NDKA 2V50A 3CNQP 3CCUN 4ECWA 4KAIA 2HIYA 3M05A 4P6QA 4DQSA 1NLVA 1YHQN 2V4JA 2NRZA 2V7ZA 3AVAA 1MMDA 3VGSA 5D6GA 1VK0A 2F7VA 3HVTA 2HVHA 1VI7A 2E1PA 4FZVA 3JS9A 4IFYB 4RZRA 5AE2A 3NKYA 3OUYB 3CCMN 1RDDA 1HQUA 4FBUA 2F40A 2NZ4A 1XMOF 1K9MT 1I94J 2JFDA 5BRHA 4CJSA 1EIYB 3BR8A 4JI2K 4L75A 4DMNA 4HCBA 1W25A 4PYDA 1AT1B 3K5LA 1R0BG 1I3AA 2E4LA 2QN6B 2QA4G 2JH3A 4J2EA 4OZ3A 3K8WA 2C2DA 3NS7B 2E44A 5LL6d 1BQMA 4FPRA 1A9NB 5FROA 3V9UA 3GJRB 3R7SB 5A2QO 2CDQA 5BREA 4CHZA 2BMBA 1YRUA 2IDEA 2EG1A 1D0EA 1WSEA 3AT1B 4CNYA 4NEZA 2QIFA 3OTDA 2RHSB 5HK4A 1UAXA 2FJBB 5F0WA 3TVYA 4ILLA 1MWKA 3V4MA 4CTAB 1GNKA 1N5TA 3DOKA 5MAOA 3ZZZA 1FJEB 4WE1B 4NO7A 4F02A 1N33J 2HHQA 3SAGA 4Y3CA 3LM9A 3BBFA 1BCMA 3GFZA 2WW4A 3KUHA 2C2MB 2B4UA 1JNRB 4WFXA 5HMZA 4UQTA 4XIUA 1JLCA 2F8HA 1X3MA 2CPJA 3C7NB 4BRGA 5E3CA 1RT5A 3MN9A 5AXMA 4FWLA 1YRTA 4CLFA 4ZLPA 1X8DA 3M2UA 2E2PA 4FPIA 4CJVA 3DYAA 4CH1A 2BQ3A 2IOCA 4JI3K 4PHTX 4Q43A 3GG0A 3M6VA 1I1GA 4CQ1A 1S6PA 3C6HA 3TAQA 4DQRA 3ZSYA 2MGZB 4YDUC 4DDFA 4IFYA 2IM0A 1N5VA 1WELA 4B1YB 1FRKA 3OTOF 4OX7A 1L3SA 3I4HX 2E1MC 1OSDA 2PO4A 4DR5K 1AFJA 4O3OA 5H9FK 4DPWA 3UCUP 3MAQA 2UUAK 2WOMA 3DHXA 4C6AA 5IWAK 3VF6A 2DHGA 1MU2B 1VQ9N 5DETA 2FJXA 3U4LA 1XIQA 1IR2A 1SJRA 4ID8A 5AQPA 4JB8B 3P5BP 4AQYF 2XZDB 2HHTA 4IOCQ 2QWLA 4DTSA 2PMZD 2UVWA 3P8BB 3WNFA 2EBGA 2G8FA 2AJ2A 2KN4A 2LEAA 4KBIA 3ZSRA 2WTFA 4BRLA 5KG7A 2MZQA 5DDQC 1RCXB 1RHJB 2OUGA 4CH0S 2GIRA 4Y28C 4OHZA 2FY1A 4YNQA 5DQGA 3KD5E 1YF5L 3M32A 3G71N 2MKSA 3PYDA 2H4YB 3HLUA 4BGBA 2BV3A 4NLUA 3SZ2A 4C4WA 1RBUA 2FBXA 5FDLA 2PYLA 3KMSA 2PY5A 3ZT3A 2CQGA 3D9BA 4KBOA 4ZJLA 1RWKB 3GV8B 2P9EA 3QERA 5JS2A 3HHNB 1V5IB 3JAMO 6FD1A 2B4PA 2GO8A 3QO9A 5JVGL 4M3XA 1HI0P 2OZSA 4MLEA 4WQ5A 1HPZA 1DQAA 3LAMA 2OMOA 5CCMA 1PCAA 4OQJA 4BRQA 2E5GA 6FDRA 4I2QA 3ATUA 1SC6A 5KFIA 4O44B 1RWNB 2DH8A 3KLGA 3IP0A 4MO4A 3HZEA 1OYDA 4A46A 3WT0A 2RE1A 3ZZTA 3TEHB 1VIOA 4K4TA 3MTKA 1F3VA 2DEIA 4K4WA 1WLJA 1JMTA 1MN9A 3OTEA 1XHZA 1E6VA 2P6TA 4OPHA 1Q81T 4AE5A 4WK3A 4CJKA 2BW7A 3MMJA 3G9CA 1Z6RA 4RPFA 4X64K 3UO0A 3GIIA 3SCXA 4BRKA 1CULB 2NLXA 3LO3A 1H2VZ 4IQXA 3CJKA 1CEZA 2VGNA 4ZVOB 5D8HB 3TUZC 4PUOB 2HBYB 4X4TA 1W97L 4GRSA 1K8AO 3AAQA 2CQ0A 3I0RB 1KQSM 3F41A 3I9V9 5C24A 4J8FA 2V2ZA 2Q36A 1Z4UA 2ASOA 2NPFA 4KHRA 1UJ6A 3IM8A 2HQDA 4B3RJ 4BROA 3QFWA 4HTIA 4ICLA 3K5OA 2BW2A 2FTRA 2FUG9 1NSQA 2MMYA 3I9ZA 3S7RA 2P6SA 3RMCA 3OL9A 4XH1A 3O9SA 3MMBB 4DR6J 4NCGA 3PRDA 4WFNL 1GLBG 1XQIA 4K2JA 4WQ4C 3QO9B 4BC4A 4CHOA 1BWVA 1F9EB 1BQMB 1IQTA 3DDKA 1U0SA 3MUVP 1I39A 3AO3A 4DBQA 5J1NA 3OT9A 1V9OA 5JS1A 5AXKA 4BG8A 3R1HA 4OYPA 4DUTA 1RAJA 3QATA 3UB5A 2HVZA 4AHCA 4A48A 5L9NA 2AJ1A 1GLAG 3EE9A 4MMOA 1Y0HA 3H1VX 1PBAA 1TUVA 3WXIA 4CEQA 4M1KA 4FOEA 3KLFB 2AD9A 2KJVA 3AA8A 2IDLA 2WSFC 3KFWX 3RZAA 1VCTA 2G13A 4MYTA 4K4UA 2BGGA 4RO0A 4BY9C 4BC7A 5EX3A 4RJVA 3A3NB 3D1OA 2IVFB 4IG0A 2J6UA 2ZVIA 2DNLA 3ENVA 1X60A 3V1QA 3UWTA 3GILA 1PJ7A 4QOZB 2QTDA 2R4FA 2Y8WA 4NLVA 2V68A 2PEHA 4ZCLA 4ZOSA 3CMES 4IR1A 4X4UA 3KK3A 1FE0A 1D9DA 3IR7B 1HW8A 2LU1A 2FBVA 4CK3A 5FPNA 2BXJA 1Q7YO 2F9TA 3AGRA 3HSGA 2W9BA 1YJNN 3BEXA 2I0XA 4ZVSB 5MLCV 2MZSA 1JJHA 5C7PA 3JTOA 1U26A 4OJ3A 1HL6A 4K43A 2BUNA 2QV6A 3LP1B 1BISA 4FVMA 4OI3A 1X5SA 4DUYK 4DFPA 5J2MA 5BR9A 2QL7B 1YVUA 2DT9A 1VRTB 2ZJPL 1KAZA 1VQLS 2MDAA 4IG3B 1K0VA 4ZK7M 2WONB 5A8KB 4HH0A 1X9MA 4PQUA 3A3OB 3TYTA 4FJNA 2VU5A 2G1DA 3DN9A 3IR6B 3OYDA 1VRTA 5IT9O 1XMQF 1NK0A 3SSQA 3TPQA 1T9WA 4K50A 5LSLA 3RAXA 4LIWA 1RISA 1N34F 2GJ2A 2RIJA 3CE8A 3HM9A 2HS0A 3UNGC 5IT0A 3VGMA 3BKFA 5G0RB 2YNGB 2OP5A 3T1YF 4AL5A 1ACMB 3CHWA 1QHAA 3EUNA 1SXLA 1VQNN 4X62J 4KKOB 3QIDA 1W26A 1WHWA 5KFGA 2C2OB 4FP9A 1AXQA 4CZJA 4PG7A 2CVIA 1QE1A 2RKIA 3NL0A 4ZCIA 4H4MA 1W7AA 1FD2A 3MHYA 4EO6A 1VBZA 4C3MA 1SCJB 1PSDA 2OH2A 5KFUA 4NXNK 3LPUA 3S1TA 2VOPA 2IIRA 2R8IA 3MM9B 3GJSB 2R8KA 1UWBB 4ZPVR 3CERA 1Q0NA 3PW2A 5K14B 3K5MA 4B9LA 1T7PA 2DNOA 4MIWA 1SKWA 4JYAF 4ZP6A 2AMCB 3WIUA 1KP6A 2GWKA 4MFBA 1GXTA 4E0DA 2W1BA 1SKSA 1R59O 4ED4A 4LY7A 3V6JA 1PGZA 2ZD1B 5E84A 4DXLA 3CJBA 4MTPA 3ZEUB 2QSWA 3ENHA 1KQGB 3L95X 3I31A 4KIAA 5M1QA 3IG1A 1YTUA 4LSLB 5A8KA 2V8PA 4GVEA 3D6FB 3G0ZA 3TSUA 3OHRA 4B02A 3IG1B 1KOHA 3LAKA 1S1VB 4I6AA 4DHYA 4JHDB 5A8RB 3U1LA 3MMBA 4EGLA 3VEWA 2GS8A 2HHHF 2O8EB 4PPZA 4ZHRA 3MXJA 2CNNB 3OFFA 4P72A 3VHQA 4QR0A 2W9AA 3JS6A 4RW8B 3OSNA 4M7YA 2XLKA 1RKIA 3M30A 2AWZA 2YH0A 2RHQB 2M5YA 3EY1A 1RDCA 1S99A 3I0SB 2P5GA 1FK9B 3CDAA 1JKHA 1XNRF 2P9UA 3W61A 1O5JA 4WE1A 1U8SA 2R2UA 1J6ZA 3M2VA 3LP2B 4I1TA 4JI6J 4F4KA 3OYAA 1VC0A 1TP7A 2C42A 3FC9A 3FZMA 2XY7A 3H2UB 3AVMA 4R25A 3MOZA 2HFNA 3LP2A 1T94A 2OANA 5K8PA 1G7CB 4DTMA 1F9FA 3UVJB 3CCSS 4C8KA 2LA6A 2YHYA 3L6QA 5DGAA 2FLNA 3GTYX 4HI2A 4BGAA 3HZ6A 2KRBA 2CIMA 2YX7A 2NUHA 5FD1A 3IBCB 3L09A 2VG7A 2VBZA 3E3XA 2KVIA 5CAAA 2GAGC 3D1HA 4JV5J 2ZH8A 2RRNA 3MM8A 3EGNA 3D6TB 4EHTA 1VSDA 2RJZA 5ETNA 4ZPDA 1WTFA 5A8RA 5GADU 3KLIA 1C2PA 3QRRA 3T5HA 2VDIA 2P9PB 3O2IA 3NF8A 3ZX3A 1S59A 1FD8A 1HWKA 2BACA 1SJQA 3HI9A 2V2KA 4YEAA 3B82A 3GCXP 4A2BA 3C0BA 3BO3A 5KGWA 3C66A 1VQMS 2ZM6J 4OPAA 4BE2A 4BLGA 3VF0B 2KHCA 3ISND 1ZBHA 2GO9A 3IAM9 4L74A 2G8KA 1F5BA 1W7WA 1LW2B 2VFTA 1UFKA 4JI3J 2KZMA 3FSIA 3LWLA 1EWRA 2PFUA 1AUSL 4HR2A 3GIJA 3M32B 2DFEA 3JQJA 2F65A 3LP0A 3MZIA 4QPXA 4C3LA 3D67A 3KLEA 3SUOA 5KT5A 1GH8A 2MQQA 3LM2A 5EWEA 4RUAA 1NOZA 1Z1ZA 2ASLA 5I3UA 2QFJA 4XO0A 3C95A 3ILOA 4B3RK 4C0BA 3QEVA 1Q8LA 5D0HA 4DPYA 2D4WA 3OR1B 3ET6B 1JNZB 5AZIB 3GLJA 1QUPA 3PCOB 4QU6A 2E2NA 4UY8T 1RTZA 1YJRA 2CQ2A 4I9LA 1KDNA 4OX9K 2B7BB 1G15A 3OR1A 3SUNA 1HIYA 4WFBL 5ETKA 1Y64A 4Z37A 4YY3J 2E5JA 4RWTA 4XDDA 2EHGA 5KFPA 3R5JB 3RR7A 4Q45A 4HHHA 1RTIA 4NXNF 1S72S 1F9HA 3Q8RB 4CHNA 1AUDA 5JLFA 4W98A 4CZGA 4LFCJ 4K4SA 1HNVB 5C2FA 2Y1JA 2QWPA 4CO2A 3T1HF 3MXHP 4JI2F 3SMPA 3L8BA 4OYOA 1KHWA 3D28A 3P3DA 5T41A 2CPIA 3MCMA 2QA1A 1MW7A 3PW4A 3H25A 4DR4K 4X64J 3D45A 3VAKA 2IDOA 4FYDA 2DXFA 5I3PA 3OS1A 2D0PA 2I1RA 2O01C 3U7JA 1WI8A 3P4UB 1L3TA 1R0AA 4MJKA 4DOZA 3CCRN 3CMQA 3QT6A 3TSQA 1WOOA 3O9UA 3LWMA 2NYIA 3HHLD 2BRLA 4NLXA 2W7AA 1XNRJ 4ISFA 2F1FA 1WAJA 3FUYA 4I64A 4C8OA 2PE8A 1NDPA 4I56A 2QYCA 4MIBA 2X3GA 1BU6O 3DOLA 4IXCA 3D5MA 4DS4A 4CESA 4E7IA 2RS8A 3POTA 2OFGX 1JXEA 2GC8A 5KFTA 2IAJB 4LSLA 4LRCA 4CO1A 3RAQA 1WBDA 3SJJA 1FT8A 4PKDB 4ZMMA 5E3QA 4O3NA 3UDVA 4M3UA 3CXCM 1T9YA 2AYEA 2Z2LA 1ZTWA 2AP6A 2FZCB 1B92A 2PYJA 2ZJQQ 4WP9A 3IFEA 4BREA 1XR7A 3TUJC 2W42A 1BE4A 3W2WB 4KPCA 1RNHA 1RYSA 1D5AA 2IJNA 3CJAA 2YWEA 1AROP 1UW9A 3AY0A 5I9EB 2EI5A 2J4RA 2VUGA 1JLGA 5J1PA 3SQ2A 2JL9A 4DJBA 1NSPA 3HFKA 4C8MA 1VSFA 3LDOA 3W3DA 4NLTA 2LFVA 4JI7K 2R8GA 3CCJN 3DGPA 4ZVGA 1KKHA 3VQSA 1T6DA 4I69A 1RT7A 3VN5A 4B1VA 2AU0A 3NBPB 1CULA 4Z7CA 4IRKA 4B9SA 4JKFA 4TU8A 4B8AB 1PG5B 2P9KB 1S9EB 1MA9B 2R7RA 5GAGU 4DL6A 4CLUA 1NK5A 1B7FA 4W4MA 4NYZA 4RTFD 3GU0A 1XI1A 2DITA 4QQBA 2ZF5O 1GTHA 1JWWA 4H5VA 2EFQA 4K8ZA 5B7WA 3NCRA 3FE1A 1OO0B 2WBRA 3IKMA 1R6YA 1FRJA 1WSRA 1QSSA 4EUVA 5C2CA 3HKWA 5HROA 4RX6A 4MDAA 5J2MB 2GHVC 3FBCA 1CQNA 4GV9A 4MFBB 3QJJA 1BDGA 1RBOB 2CJBA 1JLQA 2FHKA 5JVGQ 2YCHA 3N28A 2HOEA 1X4DA 1VQLN 2Y0BB 3JAMU 2JC1A 4J9RA 3J7ZO 2P9IB 2GUIA 1K47A 3DC2A 1BWEA 2JLFA 3VR1A 1WWHA 3EM1A 2YHWA 1G3OA 1REVB 1KONA 5EHHA 4URSA 4TY9A 5CR4A 2V51B 1FKOB 2DJWA 1LOTB 3G82B 3ZSZA 2FQQB 3GBTA 1RUSA 3TA0A 1QS4A 3DRXA 4RWXA 2RF2B 3QRPA 2Q43A 3VZHA 3CC2N 5D3GA 5CH7B 4KKOA 3I5AA 4LFAJ 2CQPA 2UUCJ 5J2QA 3G8QA 4CO5A 3IWLA 2YH1A 4DR1J 2FSJA 4BRPA 4Y65A 2XM3A 4FJMA 4R79A 4IO9Q 2VBYA 1UVIA 4A2AA 2C2NA 4JKGB 4DL2A 4C0HA 1XNQF 2R7WA 3E8OA 4WYWA 4IG0B 3T9ZA 4E2FB 2VG5B 1N32F 5KG3A 2JWNA 4LF4F 1WBBA 4B3TF 1U04A 1LWFA 3IFRA 2O8CB 4NPOA 2PI5A 4WCEQ 2VGMA 2DH9A 1RB0A 1Q86T 1KTQA 3AOAA 4ECZA 2R7OA 4ZN3A 4X65J 5DDOC 2XCPA 2M4MA 1C0TA 4QOTA 2QWNA 1N5QA 4C2MA 1X9WA 2DRAA 4EYIB 4C8ZA 2QLWA 3CJ1A 4BRIA 4QWAA 5L1KA 1RBTA 2C3MA 2O4IA 3MD1A 3OFGA 1HUXA 2HZCA 4TY8B 5D0GA 2NZTA 4JI4K 2V69A 3CDBA 3NGUA 4YUDA 4M41A 4DR6F 1RWMB 3J81j 1HRHA 3IAS9 4LREA 2MQLA 3F0NA 4DL4A 1W2BM 2DGWA 5ADZA 4Z4IA 4M8LA 2QEXS 1GOAA 1M1KO 1UFWA 2FBYA 3MCNA 5KFYA 2Z56B 1XERA 3OD2A 3O8MA 1RK8A 1RDRA 3H45C 4M45A 2QC3A 3QLHB 1S6OA 2EFGA 4CZFA 3M6WA 2RILA 5G0RA 2ZKTA 4G1QB 3H5UA 3MUTP 4LF5F 2LDIA 3ITHB 2HK3A 3D54A 1S77D 2Q79A 4GVBA 1LWEB 1HBMA 2BKOA 1CJKB 2F96A 3MEDB 2LP4A 4O5FA 3CIMA 3EGZA 1TUGB 1M0SA 2FC0A 3P5JA 2V6AA 2C1EB 3LDQA 1FWLA 1KVCA 3US5A 1PBUA 5KOXA 2QWQA 2GQQA 3QWPA 1ZBSA 3A8IA 3OVBA 4LBHA 5I3UB 1VQ9S 1NB2A 4C0OC 3O80A 4AYBD 3MN6A 2NRTA 2XGPA 4LIRA 4ZTJA 2O8FB 2HRTA 5BR8J 3MMAB 1MDUB 3O4WA 3S3NA 2GA7A 3I56S 2CQBA 1OH6A 4NB4A 1HJRA 1CJTA 1WHXA 3QAEA 2W4PA 1NJIT 3GG1A 3WQTA 2CPEA 2A2DA 3T6JA 1HYVA 1TL4A 2YNHB 4M5NA 1CLFA 4ECTA 1HD0A 3TJ8A 1U0HA 1QQCA 4RNHA 1S9FA 3OJSA 3DRSA 4LRDA 1BMQB 2QXLA 4RU2A 3ZTQA 3OUYA 2KTQA 3KMQA 4J2DA 3H3NO 3IR5B 2YY3A 2OO4A 1X7VA 2CNOB 2HQFA 4DV1F 1JLFB 3EKSA 4L3QA 4O5BA 4J5OA 1PYSB 2DKOB 1VSMA 5FPMA 1CZ9A 1VQSA 1LAWA 3KXDA 3RBDA 1VQKN 2KDOA 1FEHA 3TAMB 2LEPA 3IMQJ 1R31A 3GPAA 1RAOA 3EZOA 3L7PA 4MIAA 3MCSA 1C4AA 1HMVA 4DMZA 3ULDA 1LK5A 1MG7A 3GE9A 1BUXA 2CGLA 1CJVA 5EOYA 6AT1B 1B3TA 3TQ1A 1DRZA 1GMUA 4LF4J 1K8KB 4LSNB 3V1OA 3QNOA 5EWGA 1OSCA 5HROB 1S49A 4ER8A 2UVVA 4KH0B 3HZGA 4BE1A 3SSRA 3DDIA 2KL8A 5AZIA 2KU7A 4UTGA 3HFZB 1B9FA 3RB0A 4WQ4A 3R9PA 5F8IA 4GKJK 2MJNA 4RWWA 2FGOA 4CJWA 1RLDA 3HP6A 2PDAA 3UVJA 4HTLA 4FM2A 1HBNA 1RHRB 1JLBA 1S7IA 4U7UK 2L41A 2CZVC 3D6HB 4DCJB 3QEIA 5AE1A 2MQMA 4YS2A 3CXCR 1IJFB 1TKZB 4DUZJ 3QFHA 5AFUA 1JB0C 4OX8A 1KLMA 3CC2S 2OZMA 2N4DA 5EX0A 2JZ5A 2J0WA 1W2BR 3O9QA 1U1KA 5J2QB 4M5KA 2ZQBA 2CDRB 1EO1A 2V2QA 3QGIA 2EKYA 5DM7Q 3AJ1A 3W66A 1X0PA 1RYRA 3NOCA 2C2KB 2FVQA 3NAIA 3QJPA 4AQYJ 2KXHA 3ZETA 3MMVA 2YKNA 4EEYA 3VERA 2Q0RA 1IBLF 3ZXWA 1R8BA 4OKKA 2ZJQL 4LF9K 3CFOA 4PWUA 1KFSA 5LY3A 1YBAA 2Z8QA 1F1BB 4KB7A 3LZIA 2A41A 3BZQA 4ISGA 3RUBL 2VPZB 1EETA 4DI6A 4B3OB 2OTJN 2P9LB 3O4NA 4H0PA 3V81B 1IG8A 4F67A 2KFZA 2D3ZA 2KT2A 4Y2KA 5GAEU 2KG0A 1X4HA 3O3FA 4OI4A 1YITS 2BJEA 3TAGA 5E3RA 5KQ8A 3NY0A 2WFBA 2P8IA 1IXKA 4J9UE 2DBBA 1RT6A 2GQ2A 2QL5B 4H5RA 2W41A 1TV6A 5KFNA 3X3UA 4C3KA 3BGUA 5FLXY 1QZ5A 1WORA 4OYZA 4IDKA 1UZDA 3HD1A 3N01A 1LWCA 5K5MA 5TKWA 1OPIA 1G2EA 3CJ2A 1NUEA 3NWGA 5D4OA 5AT1B 2YNIA 1LWCB 1ZBLA 2RU9A 3NCPA 2ETJA 3CJ9A 1VMBA 3C6TA 2GJFA 1KN6A 4BRMA 3AJDA 3CC7N 2X7IA 4KI4A 1YDLA 2IYIA 4FLZA 4E7KA 4MH8A 4CO0A 2ASJA 1Z25A 1CS4B 3OBIA 4OX9F 3C6TB 4KGVB 2F7TA 3F44A 3LGHA 3H59A 2XNQA 2CGJA 3IRXA 2HIQA 3CCQN 2RHKA 1TKTA 3VEVA 3G10A 1YLXA 1E6VB 3OYKA 3OL8A 3SI6A 3WBZA 4HHUA 5A6PA 1R27B 1MROB 3LOUA 3WXMB 4M7XA 1C1BB 1SIWB 1P9YA 3W5YA 4JP8A 4B9VA 3W0LA 4JAXA 4CF9A 1HQ2A 2P5VA 1RAEB 4DL7A 1FDAA 2E5HA 1VAZA 5HSPA 3M8QB 1CLQA 3ID6A 3FQLA 2HHXA 2KQ2A 2MY8A 2UVRA 3TZXA 3BYPA 1DTTB 3OV7A 2UUBJ 3G6XA 1NGDA 2A1BA 4CNZA 2HEKA 3DFEA 1Y11A 3TA2A 3HVRA 1VC5A 3G8SA 4BR5A 1UP1A 2YHXA 2PC6A 5FLXO 5J2PB 4WFBQ 5C0YA 4KTZA 3A8KA 5IS2A 5HL7Q 4NA1A 2CA9A 1FX2A 2HNYA 1U2FA 3EDQB 4LVNP 2OFHX 2PZSA 2PN6A 3CJ8A 2ZJRL 2IJFA 3V6KA 3QBCA 4NCBA 1X5PA 5F0XA 1RBLA 2DRBA 2QK9A 3WHIA 4U67Q 4EBCA 4ED8A 2IFXA 4MQ3A 2RN2A 5HRSA 4FYYB 3OYFA 1VQNS 1MNEA 3AA2A 3KJQB 3SBTA 3Q7CA 2J8SA 2XC9A 3DLGB 2KB2A 1M5PC 5A6WA 4C97A 3P5TL 3PNIA 4TN2A 5MLCQ 1QVGR 4NASA 1J53A 2BQRA 2IA6A 3ZZYA 3P39A 2V4JB 3J7ZT 3BUZB 2NUBA 4B1XB 2RRBA 1LK7A 1U1QA 2E8AA 1NJZA 1JLAB 2RUGA 3AJ2A 4DQQA 3TTDA 3CW2C 1U1PA 3THVA 4CIOA 2YKOA 2HHHK 4OI2A 5GIOA 3DJCA 2BJ9A 1V3ZA 3MM5A 3I56N 2I9SA 1DQ8A 5LMNK 2KXNB 4OO1J 1TZ0A 4DQPA 1MROA 4GKKJ 2A6OA 5GAEP 2LMIA 4UZBA 1C6VA 2VQFF 3R3LA 1U25A 3U02A 3CYMA 1Q9YA 4FVCA 2ZNZA 2R2SA 4XK8C 4EO8A 2D3OR 1ZETA 4CI0B 1NZ8A 3WXLA 3WNEA 2Q1NA 4U6PA 2CPDA 3C46A 4HWIA 4KH6A 3UE2A 4FJ8A 3HF5A 2Q3SA 5THWA 2UUCK 5AJ3F 1HQEB 3MCPA 2XB2D 5AZJB 4H03B 4CZMA 4OZ1A 4FLVA 2VF3A 2VA3A 4CBWA 4CO4A 4Z4GA 3DOMA 3QQCD 1D3WA 1Y3JA 3N4QA 3TTCA 1S22A 4NL5A 1BIZA 1RWWB 1I3OB 1RHKB 3WZ0A 3K17A 5KRTA 4FJLA 4DR2J 1WF2A 1YK9A 1RFQA 3BKTA 5DS7A 2RDDA 1FESA 5KRSA 3CCWA 2L3MA 1ATNA 4WXWA 3PRVA 1F2HA 3AOBA 1YJ7A 4YQWA 2WAQD 3MDFA 3TAEA 4TU7A 1N34K 2M9KA 3Q8PB 2J9CA 1REVA 2DHXA 1X4FA 4X4RA 3EE8A 3CCUS 1HLWA 3CJ7A 3HSTB 3QEPA 3G82A 2E5IA 3DYAB 2IHR1 1EQMA 4PA1A 4KRWA 1SL2A 1JQGA 5T7LB 1N33F 1BI4B 3R2CJ 2Q2RA 2XYHB 1P90A 2WW8A 4QYZK 2K3KA 1RT4B 2GCFA 3CO0P 3KG0A 3MXIA 3KIOA 4OX6A 1FRMA 3MEGA 3W1YC 3VENA 1TV6B 3VGKA 2KG1A 4A8YA 3CCVN 3R6LB 2UUBF 4NLYA 3D7EO 2QL9B 3EPGA 1P9QC 2K3IA 2VG5A 1XC3A 4DCOB 3J7AP 4P75A 3TANA 2K7KA 2VHGA 2DR9A 2IVMA 3O9TA 3WC0A 2AGOA 2P2CB 3MM9A 4K4VA 1ATSA 1IBMJ 3QB0A 4IEIA 3H98A 4JV0A 3DRRB 1SAZA 3SCLE 4B3TK 4ZP8A 1VIXA 3H20A 4NYFA 3QFPA 3BREA 1VQ5N 3ZTOA 3DM2A 4C23A 4PRFA 4JK8A 1YKWA 1WDDA 2DXEA 4TSXA 5KG1A 3GYGA 1YGYA 5BPLA 2ZM6F 4CZHA 2VWJA 1VDHA 3NNCA 3BR9A 4JNEA 5SUHA 4O0IA 5HVHA 2XY8A 1NWKA 3O1WA 1WF0A 1ZTTA 5GMDA 2A40A 4BVOA 3T41A 2WVBA 5IFMA 3T5LA 3KK1A 4L73A 2E9RX 1JL2A 4A8XA 3DLHA 4JHDA 4KGXB 2BRKA 4KRFA 1QQOA 5AQWA 3RU0A 4NEYA 2Y0SD 4DKWA 1SH0A 2IVOA 5AQFA 1TVRA 4FK2A 3D0PA 2XNRA 3BSCA 1XNRK 2IRUA 2IYGA 1Q4RA 3SUPA 4MKYA 3C3LA 1OKJA 4PZVA 3EEQA 3PFEA 5HI7A 3PUFA 4QIEA 4B3OA 2IY5B 5AXLA 2DNHA 2FXUA 5IWAJ 3Q7BA 2B8PA 1HNXK 4JI8F 4J91A 1OY9A 3K7RA 2YWKA 3NGIA 5ETPA 5FJ4A 1CXQA 5J1EA 2DGTA 3ENAA 4Q8EA 1YJVA 4I9QA 3B6PA 4BR2A 1FRHA 4K0KF 3U6FA 5F41A 2ZHAA 4ALZA 3AFGA 5IT9U 2NSCA 5ELZA 2XY5A 4NLBA 1XK8A 4FXVA 1VQ6N 2ZH9A 3SCKE 3TR8A 3O5TB 1YSJA 2JHEA 3CF5Q 3ZSWA 3M8ZA 3SV3A 4JI4F 3NGZA 2FJAB 2KYXA 1EWQA 1A0OB 4DR6K 2N7YA 1GLEG 4P7VA 2CKWA 4XAKA 4Y1CA 2YV0X 5H9EJ 2ATLA 3RW6A 4CJ3A 3I55N 1NSAA 2OD6A 2QX0A 4FJJA 5I4MA 1XMQK 2VG7B 3V5RA 2CH6A 2QWOA 2E1YA 5AJ3K 3BN4A 4AL7A 3HPGA 3PO5A 3JTNA 4JI1F 2O8BB 3M8YA 4ZPCA 2VG6B 1WKJA 2B56A 3A0IX 4FK0A 3B4MA 4X4PA 3OW2R 2Y3YA 4N47A 5FRNA 4USTA 4NZ0A 3TP2A 2ZH4A 2DTJA 4H0TB 1HHQA 1VGYA 4WFYA 2QM1A 4Z4EA 3OHBA 2YHBA 2OSRA 3FCWA 2UXBJ 4OGCA 2BYCA 3GSIA 3I87A 1QSYA 1MU2A 3ZCMA 2V5HG 4Z7YA 4JK9A 1BHLA 2HURA 2E1CA 3L3UA 1IKXA 3A2FA 4OKJA 4DCPB 3SJHA 4HI1A 5D77A 3QESA 3PO4A 3C2PA 2K2PA 2EEYA 2JLGA 4MKVA 2A6AA 4F7VA 1LWEA 2D1CA 1QAJA 3PW0A 1QVFR 1FEEA 2F8TA 2MSTA 1IWGA 2OPPB 2PBDA 2OEJA 1RCHA 2W8KA 3RR8A 2P9UB 4DX6A 3I32A 2HHSA 2XWXA 1FI4A 4MYUA 3J81O 3KYLA 1WEZA 5A0YA 5I42B 3W64A 4YOXA 4FJIA 4LF2A 3K0JA 3WEEB 3ZLJA 5IC6B 1HNZF 2LXUA 1WSJA 3IAYA 2J9DE 4ZS6A 2Z1GA 4JKAA 2KM8B 4MKBA 3RRKA 4A8WA 4FWSA 4CJ4A 2R9LA 4QS7A 4K5RA 3GMGA 3RBZA 3OLAA 1KS2A 4PG6A 2L9DA 2J7UA 1N4LA 4XPCA 3HXMA 1T9TA 4QZVB 4KGMA 5DDRC 3HVTB 3ENWA 4PWDB 5KT6A 1FHTA 4KTWA 2AP1A 3ZETB 4YOYA 5F3ZA 4AD6A 4DF8A 3MM6A 3W9HA 4ZITA 1K0TA 1BC6A 5IM0A 3PJ9A 2QI2A 4DV1K 3KK7A 1WC1A 5M1FA 1U45A 2ZBCA 4BR4A 4FSVA 2EBEA 4J9NA 4B1ZA 4PWWA 3JAMY 1ZC6A 5KTQA 2KH9A 3KLVA 2UVUA 1FJ7A 3U9ZA 1FX4A 2ACYA 1HNWK 5CA5A 2XG8A 3T5JA 1X5TA 2CG8A 2XI2A 2Q66A 4H54A 4ERDA 1NNDA 3W2VA 5LSOA 3P49B 4RW6B 2DEJA 1Y97A 3HCXA 1ZOTA 4WIIA 1ZM4A 1FFSB 3K9KA 3CJ3A 4IYQA 1C0UA 3LP0B 3CO9A 5K8OA 1QE1B 3R9LA 2APOA 4N5SA 4LF7F 2MSSA 1TELA 2LU2A 3NF6A 2OKQA 2NRHA 2OD4A 4GY2B 2ZC3A 4ZCMA 4J2AA 3WX8A 3EZUA 1X4BA 3F9KA 1N34J 3H6EA 1U1MA 4B1UB 1VSHA 1FERA 4WP3A 2ROEA 2LSNA 4FYWB 1UVMA 2JGUA 1WEXA 2MKHA 4I6WA 3SIPB 1KOOA 5JMNA 1RAHB 2FDNA 2I6WA 2H65B 4I2QB 2W6KA 1SZ2A 3PHTA 4NCGB 8RUCA 3CPEA 2BJDA 2RDJA 2VPWB 1RQ0A 2XS2A 3K0SA 1YI2N 2ILZA 3FDSA 3GIRA 1RSCA 5D4NA 3HX9A 4I68A 4LF8F 4CLPA 4CD3A 3AXMA 4ZVRB 1BCOA 2XO7A 4QR1A 4O8KA 2RE2A 5KFOA 3O3LA 3RB3A 1S48A 4FPAA 4RU9A 4LR7A 2D1KA 3ZO7A 4NOHA 2DY9A 2DHHA 3ZSXA 4RW4A 1QSLA 2RUSA 3BQ0A 2YNFA 3AVGA 8AT1B 2WUSA 3NMAA 1VYAA 2Z4PA 1LWFB 1ESVA 3K57A 1N36K 1T44A 2CQHA 2MEWA 3M8PA 1S76D 1FRIA 3ENQA 5CYQA 2KO1A 2XSJA 2AYGA 3A8JA 1DGKN 2P9KA 3UN3A 2DGOA 2VJUA 4JS5A 4FNIA 5JLHA 2DGXA 3FBEA 4Z4FA 1KBRA 4OHWA 1YJ9S 5DG7A 2GUPA 1VSEA 3BN7A 1NK9A 4RW6A 4GO5X 3HPOA 2AKWB 1VQ7S 1YAGA 3M9NB 3M9OB 4KV8B 1CJKA 2N7CA 1VSKA 4A57A 3R1LA 4CYUA 1S0OA 1I6JA 3F56A 2Y1RI 2E6MA 2R42A 2HWTA 2QTWA 3AO4A 1SJ1A 3U3YA 3ZTPA 3C94A 4LF6F 4CJLA 3QSYB 4K42A 1SL0A 1G4CA 4RBTA 1FXLA 2O1PA 3Q2SC 4FZYA 2W2PP 4QYRA 1NGAA 5I42A 4JI6F 2HNZB 1Q82O 1O8BA 1RDUA 4AL6A 2R7YA 3CFPA 2NRWA 4FWRA 3G8TA 4FZXC 2OEMA 3T19A 4B3SJ 3KWGA 4NMLA 4OZJA 3A5NC 5ETVA 2ASPA 3SI8A 3QGHA 3MTJA 4KC5A 4BRDA 4HLBA 2M52A 1U49A 2ZZNA 4ED3A 3FVYA 3MR5A 4HCCA 2PMWA 4NLQA 3OXFA 3AVJA 2GNKA 4X4OA 3PRBA 4Q8FA 3TWHA 4FYXB 2BZ2A 4B9TA 1TAQA 2ZFHA 1SKUB 4F04B 1E4FT 3DLRA 1LW0B 2XS7A 2KT3A 3NH0A 2HMPA 3PR4A 4ES1A 3OYMA 2CWXA 4RNNA 4YDXA 3EE3A 1UWAA 3W3SA 2R8JA 4TXSA 2BJ7A 3HDSA 5C25B 1IUJA 1GTEA 5BYRA 1H72C 3OFHA 2UXDJ 1LFWA 4LF7J 2J0XA 3J81Y 4L76A 3VQ6A 2ZUGA 5KG2A 2BKPA 3HHLA 5AZJA 1VRQC 3M9MB 4JI5J 2YKPA 3CMEN 3SLCA 2KT5A 2X6SA 1S5JA 2X78A 4CYUB 3KJNB 4P74A 5ETMA 4A59A 1F3FA 4BR0A 4AM6A 4XTTA 2G4BA 4CHQA 2ZWHA 4ILJA 2N4CA 2V0NA 4U7CA 2DD8S 5B0BA 2V9KA 5B09A 3GQCA 2VC1A 1RTHB 2O66A 4DV5F 2W2MP 4B3MJ 5EXWA 1HYSB 5DLFA 3R5AA 4KHNA 1ZM9A 2LEBA 2RNEA 1GXUA 2CYYA 2ZH2A 2LECA 2CG4A 3CJ4A 2W2OP 3BEGB 2V52B 4NA2A 3GYXB 2M7SA 1WSIA 5L39A 2RQMA 2VCPA 1JLGB 5F0UA 1U6FA 4TQSA 2FVRA 2GX8A 5KFLA 4J9SA 3AVKA 3GZ7A 1CJVB 4LUBA 2EFNA 2Q1LA 5KFRA 2BE7D 4IO1A 5AQOA 1EP4A 4CZCA 2FJDB 4CEEA 4DWIA 1GMWA 1IBKJ 2D3O1 3BPSP 3EZWA 3UW1A 1JJ2R 2F4VJ 2VQFK 3R6GB 5E41A 2B7CB 3VOVA 1RE1B 4CEFA 1EKEA 5CHCB 4IOXA 3BS9A 5KFJA 1U7LA 1TFWA 3NNAA 4GVMA 1LW0A 1BY9A 1FNMA 3RB6A 1WNSA 3I4PA 4J37A 4P73A 2MQNA 3OYIA 4CM0A 4FJ7A 4LF6J 3ULEA 3OL7A 1TTHB 3P83D 3I96A 1Q7YT 2YX4A 2VFSA 4M3ZA 5ETTA 3NRBA 2ADCA 5F2RA 2YNHA 1HJOA 3ILLA 1UVJA 2XY6A 4IOAQ 4BR7A 1SQGA 4DS5A 2GMJA 4KPYA 2X1AA 3DM2B 1BHNA 3OVNA 1XJWB 2Z58B 2YWGA 2HHVA 3LANA 4QWDA 4ILGB 4KHSA 4YR3A 4YR0A 5GAHP 2NPIA 4IDHA 3RMAA 3OPKA 3AB4B 4PKIA 2ACMA 4DU3A 3D4JA 5KGXA 2DK2A 4FN5A 2PFDA 3KHLA 1MWQA 2JNJA 1XMOJ 2K8GA 2ALZA 3QDKA 4QWCA 2MKYA 3THWA 4QBUA 1FKOA 4M5DA 1Q95G 1A7GE 3JSMB 1WUUA 1YJUA 5GMKa 3S6EA 1CBKA 5A2QY 3ZZOA 3MK6A 3K8VA 3A13A 4Q2MA 2VOOA 1RI7A 3I33A 3SAFA 4ZP9A 4OLBA 3HJVA 1SUQA 4CLWA 3R6MA 4F8RA 1F2GA 4LF4K 3GIMA 5AE3A 5AQLA 4FLXA 5KFZA 1RCOB 3UR3C 4ZA1A 1RT6B 4OYIA 4NXMK 3S3MA 1SUQB 4C48A 3DI6B 4CLTA 1WG1A 2UUBK 1FJGJ 5GADI 4DCHA 2QKKA 2J7KA 5HRNA 5B8HA 4O0JA 3PVXA 4IDKB 2EC2A 3CM6A 1ROFA 5J1EB 3NF9A 4DR7K 3PJXA 1NZAA 3V1RA 4DU8A 1YTAA 2EG2A 2HAFA 4NRTA 3BZCA 4MK7A 3W9JA 4ZVTB 4LFBJ 3KHGA 2VONA 2GEMA 5FPEA 4DR2K 3GV5B 1DLOB 4R0EA 2CQIA 4JI0F 1WDTA 2XO6A 1K73T 4ED5A 3L2RA 4WK1A 2XGQA 3NGKA 2EX3A 3ZEUA 1BUPA 4CFAA 3F73A 2OHDA 4K0KK 1K6YA 4WU2A 2VJVA 2YPZA 4CGFA 2HZVA 4LR8A 5J2PA 3EVMA 2H5IB 3J7YP 1NLKL 3IBFB 4DV5J 4B3MF 3CDWA 5IQ6A 2V63A 3DXKB 3OS2A 5ADXA 1JX4A 1JIHA 4Z2XA 1Z2ZA 3VALA 3DGPB 1GT8A 3AA3A 3JSYA 1HKBA 5BR8K 4QR2A 2MQPA 1W2IA 3NHGA 3BV8A 4LF9F 2JDJA 3HD2A 3R8EA 1HNVA 2D74B 1FKPB 3FMWA 1RTHA 3IC1A 1IR0A 1VQ5S 5E33A 2UU9K 4AFFA 4B3SF 4A8SA 1N48A 5L9XA 5B0DA 2QXFA 3WQUA 3EJMA 3VWSA 3GYNA 3ONQA 3U27A 1I94F 1C0GA 1MN7A 3DGVA 3ZX0A 3ILJA 3M4XA 4WFAL 2Z2MA 4DSFA 3HULA 2Q97A 5LMNF 1SQEA 4DPOA 2DVIA 1FK9A 1BLUA 2JX2A 5K8NA 3NE6A 3X1LB 1DARA 1HKGA 4EP4A 2ZE2B 2FD2A 5CZXA 2F5GA 2HBJA 4K25A 1VLYA 3HSDA 1N56A 2MKIA 3ET6A 4DV4F 2XSFA 1S1WB 1HNZJ 4DTRA 1Q86O 2DXDA 1WUAA 4DV3F 4PY5A 1GXLA 2O8FA 4I7FA 3OTBA 4AHRA 1E4GT 4JKDA 4X66F 1ZM3A 2VFVA 4Y00A 3C6AA 3OR2B 2DYAA 3Q8QB 1XHXA 3PEJA 4CGJA 4JBCA 4OGEA 2VB6A 2AJQA 4CJEA 1JL1A 4C8YA 1LNQA 4I6MB 2V4RA 2V2VA 4TLQA 5F8HA 3EVOA 3B6OA 4NYPA 4N76A 3PYEA 5M1OA 1VC6A 2B4OA 3T5KA 1ICEB 2D0OA 4O44A 4WU3A 1DHMA 1FFWB 4EBDA 1HNXJ 2MXYA 3O3GA 4RG8A 2D5RA 3LP3A 1UVNA 2ZH7A 2HFVA 1N32J 1NG9A 1H74A 4FW2A 4B3TJ 2J7WA 3L0QA 4BS2A 2L08A 3MAAA 3WX4A 3K58A 4CF1A 2SXLA 2WHOA 4PG4A 3WDOA 3FLCO 2FJWA 3SEOA 3EKUA 2WOMB 1Q8IA 1QHTA 1M90T 1EZZB 2DHAA 3P45B 2XI3A 3MN7A 2FVCA 3BH6B 3RMDA 4N77A 3H46O 2KXFA 1QTNB 3Q89A 2V34A 2W4CA 3U1NA 3VEYA 1IG9A 3FCVA 3T1AA 1IM4A 3HHLC 2NZCA 4PL8A 1VHFA 5D4LA 2LQ8A 2IVPA 5L1JA 2EC0A 5DO2A 1CC8A 1F5CA 4CLZA 5DG9A 2KVQE 4I4BA 5HVFA 4ZDNA 1C0MA 2CGKA 2R2RA 5D4PA 5C2GA 4KV8A 1IN0A 1U1LA 5B0GA 2XEXA 2GV1A 4TY8A 2L9NA 5E5NA 4CHYA 1QY7A 4E98A 3QJLA 4JS4A 1NDCA 4ZP7A 2X1FA 1NJXA 2E88A 1SVDA 5AQUA 2FZGB 2E7WA 3EGVA 3NWRA 1M5HA 1NKBA 4D3GA 1IBKK 1H7WA 1R8CA 4DTNA 5ITHA 1KD1T 2WVDA 2WVEA 2EFOA 2HBRB 4DU7A 3W2WA 3GOIA 5FDLB 2NRRA 1WOPA 4USVA 1NPKA 2UXBK 4K2XA 3IWNC 1UA0A 1IBCB 3NGDA 1IO2A 4CK1A 4QU7A 2R7UA 4Y6IA 3FBFA 1KEKA 1K73O 3E1YA 3DDNA 3SBMA 1CJUA 2IM3A 1R43A 1WJ9A 2Z1HA 4M5JA 1OYEA 3ZSVA 2BEFA 3O6WA 2B6AB 3R5BA 1N0VC 4IJAA 3R8YA 1RT7B 2HMIB 3QT8A 3VQTA 1XUPO 4F4YA 4NLSA 1QQMA 2B9EA 5C42A 1YBUA 4ECSA 3L4IA 1TL7B 1B9DA 3VVUA 2ZGYA 1S9EA 5GAGI 1BIUA 4JV1A 1L3VA 2X74A 3G86A 4LF8K 1IKVB 3W8PA 3QT7A 5LMNJ 5AJ3J 1SB6A 1HNWF 4CLSA 3FEZA 3TW0A 4JI2J 4BWJA 4HUFA 1NBEB 3SMZA 4IH5A 4M63A 3PXGa 1UA1A 4PKHA 3NFAA 4OYWA 2WSEC 4GO7X 4DTXA 4NLOA 1EETB 3IDHA 3SAHA 2JVOA 4PPDA 2NSBA 3Q8YA 3TAFA 1BD6A 1N36F 5KPTA 4FJXA 2LDYA 3SK3A 3AQOA 1SQFA 4K7QA 4X66J 3ZZPA 4DR3K 2ZE2A 2AEJA 4KE5A 1I94K 4Y2AA 3GFXA 4A47A 5M1PA 4AUKA 1NHKL 2O5DA 3DXKA 4UT4A 5JVHQ 3W7BA 4X4QA 1KLNA 4IH7A 2GJIA 2BJ1A 4DLGA 3O08A 4WTYA 3J80Y 4C11A 3BM7A 4ZPAA 3J7YI 3SFGA 3MFHA 4J7CA 4B08A 4EWTA 4GC7A 3G6VA 1LCUA 2ASYA 1YITN 3DXSX 4FZZA 4DG1A 1NK8A 2JEGA 4ZVUB 1GFWB 3C6UB 3AAPA 3SDEB 1UPMB 5DJBA 3FZBA 3MM7B 5IQQA 1M5OC 5GIPA 1J2VA 3CDEA 2BKNA 2CNLB 2GVDA 1YQHA 2MPUA 4DV3K 3EXCX 5AQXA 1X9JA 3U8XA 2G8HA 3KJVA 3V4IB 3FR0A 1DTQB 5LOQA 2POKA 1HX1A 5F8GA 3GR1A 3EO3A 2M0GB 1U1RA 1YHQS 3WNGA 3CCEN 4E1MA 1BI4A 3HYFA 4CJRA 3CQYA 1WOSA 3PHEA 2RAQA 3D0IE 5KFAA 4DUZF 4YY3F 4ECXA 2C2EA 3VPZA 3PW7A 1G6BA 1BA1A 1RGVA 3T1YJ 4IRDA 1QJHA 4BDZA 3BP8A 4PQAA 2YXLA 5HOOA 3G4SS 2DNMA 1T6CA 1NHUA 3N5BA 2WVCA 1JLBB 5K20B 4V19S 5KPZA 2PEBA 1NJIO 3H90A 3AH6A 2CQ1A 4X62F 2LVWA 4EK2A 3HHDA 3KLHB 1K1QA 4WF9L 1OH7A 1YTYA 2MTLA 3OSPA 1HWLA 1IKYB 2NQPA 2GMHA 4XH5A 2GBZA 2DNPA 4ZTFA 5AQVA 1RLCL 2GFFA 4YHHK 5GAEI 1U6BA 2QLBB 5F3TA 2YJEA 2MHEA 2QGFB 2ZH3A 4J9LA 1BL3A 1VQYA 3K59A 2YQ3A 1CXUA 4F36A 1HNZK 2C2RA 3TEGA 5T7BA 3RW7A 4W90B 3MDQA 4NYNA 1SKRA 3UKRA 3SDEA 2FHMA 4FF3A 1V6HA 1VR6A 1OIAA 1BGXT 1JLCB 4FJ9A 3V4IA 2HRYA 4DZDA 1PC5A 1VBKA 3PACA 5GAGP 1X1PA 4C7QA 3KLGB 3LH2S 1IBKF 2HGLA 1FO1A 5KG4A 1A5XA 4CE9A 5LMUK 3VEXA 1QDUB 3D0HE 1NK7A 4FOIA 3IM9A 3CCVS 1W9HA 3TJ9A 3ENOA 1XMQJ 5D3GB 4ILHA 2GQCA 4Q2LA 4USJC 2WVFA 1HNWJ 5ETQA 3N6NA 4LRFA 2YWHA 3MM5B 4H4OB 2UYTA 1GX6A 3JB9k 1OVYA 5C10A 2MZ1A 2UUCF 5BYSA 5SZTA 4IBNA 2D3UA 5LJ3Y 4M5GA 1JCFA 4GKKK 3V9SA 1E6YB 4G6VB 4K4XA 3L2VA 3PIPL 3ZX2A 4OV6A 4UUWA 1VQ6S 2O8DA 1VRUA 4GV3A 5I3QA 1S0VA 3U9DA 1NM2A 3SQ1A 3A3PB 5AXNA 1WC3A 1T03B 3KK3B 4BC9A 1TKDA 4EP5A 1S4FA 4L8RB 4B9QA 1SBRA 2NXEA 3D3BJ 3Q0AA 1D9FA 2WB4A 2NS1B 1B99A 1X3NA 1DFDA 1D09B 3G6YA 3D1QA 4O3PA 4A5BA 5KFVA 4TQRA 1ZBTA 1N52B 2ZD1A 2DRDA 3CD5A 2ZBRA 3JXUA 1XMBA 3D2EA 4JYAJ 2QW9A 4Q7AA 1G99A 2HLUA 3FJ2A 3QZ8A 1VK3A 3BGFA 2NRXA 4FJKA 2DTUA 2G8WA 4AM7A 1T11A 1TKXB 3AVNA 1YZ7A 4F3QA 4M5DB 1PC4A 2CQ4A 3EL2A 3CQXA 1Y10A 4DG1B 4ID5A 1FDNA 4JLHA 3KHHA 2IMOA 4ED0A 3NGRA 4AQYK 3LALA 2EWHA 2E7XA 3W2VB 1YI2S 1T0TV 3E01A 3CJTA 3ZT1A 2RF2A 3LF0A 4XDCA 1RBSA 3AVBA 2ATCB 4ANCA 3BBCA 5CZ1A 4R5PB 1WSHA 1SJ4P 3DNCA 5EGYA 4QWBA 1OQ3A 4MK8A 2BTFA 2B3TB 1RT4A 1EARA 2ZH1A 3IA0A 3PZPA 3MPVA 2ZHBA 4CEDA 2EXUA 4C11B 2CPYA 1KQSR 3Q83A 1DY3A 1VOMA 2E7VA 1O6XA 3G25A 1RACB 1GAOA 4NXMF 2BBEA 1P8ZA 4WPAA 3L7UA 3WC2A 1Q7LB 5HJXA 3JYTA 2HK2A 5LT5A 4H5TA 3C15B 2F4VK 3QEXA 2AA4A 4TNOA 2ZJRQ 1NBWA 4ZVPB 3AHPA 2RQKA 4EZ9A 1NK4A 3AGKA 4E89A 1FA0A 1WEYA 2BVZA 3MI7X 4OYAA 3DRSB 1NGCA 1FKAF 3MMCB 4W5OA 4UY85 4DR1K 3UQSA 5HRRA 4W92B 5HANA 3AVCA 2Z57B 1J27A 2DO0A 2FC9A 4W5RA 4DN9A 1T9VA 2ZZTA 3BF3A 4H8KA 2UP1A 3QIOA 1HI1A 2NXNA 1ZXOA 4DQ8A 1F5AA 2FY8A 4E1JA 1ITGA 3BF1A 5CZVA 1ZM2A 2R7TA 4X64F 1RZMA 5E2QA 2W24A 2DGQA 2ZH5A 4XH4A 3A4TA 4U9RA 1WNEA 3FZFA 3AA9A 2ZKUA 2KFYA 4G1IA 2E1AA 1KVIA 1VLOA 3UCZP 2G9OA 3GG4A 1APSA 4LF7K 1X9SA 5T7LA 3FEXB 3BQ2A 7FD1A 1ZH5A 3AO2A 1UVKA 3J7Z5 5HL7L 1R6VA 4Y1DA 5BN9A 4I6YA 4FF4A 4FM1A 4FKXA 2L48A 4N7TA 1DKGD 1P8GA 3ZZ0A 3UD4P 4CLKA 1YBTA 1UOCA 2EK6A 4I7FB 3AVFA 3TSPA 4JI0K 5M2RA 4DZ6A 1NCLA 1PYOB 4Z0UA 3CFRA 4CEAA 5BRFA 4H5WA 1O51A 3PEHA 4QIGA 1D8YA 2X6NA 4FF2A 3QNWB 3WIVA 1CS4A 2RQ4A 3L2WA 2I5JB 1P1TA 1T8EA 4FM0A 1S72N 4DV7J 1Q8BA 3KNAA 3RG6A 1N0UA 3O1LA 1N54B 4FF1A 1F60B 1E3MA 1AB8A 2LQJA 2ZWOA 3CT9A 1CVJA 2HBMA 3MAAB 3ZFVA 3J81U 3VEOA 3Q22A 4Y34A 2H9ZA 3D68A 3MGJA 3W60A 2DR6A 3ZSOA 4BDYA 2PIIA 1WTBA 1IV0A 3MR2A 4QW8A 5KPRA 1KVJA 5KG6A 1P1LA 1HBOB 4OJRA 3GCWP 4KHQA 2R7SA 3VQ8A 2NCKL 3CC7S 2C3OA 4NRUA 1DURA 4LFCF 4CJPA 2GMLA 5A8WA 3OYCA 2LKZA 3ZZRA 2D0CA 2JC0A 3V6DB 5E3AA 1D9AA 2CQCA 3OYEA 1R0AB 3RSEA 1TGOA 3KWMA 4X4SA 4JEPA 3CD0A 1DAXA 1BA0A 4K5SA 4P9SA 3V6DA 3UDEA 3LDPA 3H8YA 3DI6A 4KHUA 1KXPA 1CSJA 2E29A 4PL7A 2FPHX 4AF1A 4IR9A 2VA2A 3DOLB 4BDPA 1X5OA 5J2NB 3V81A 3OBWA 2K1RA 4EFAC 3HT3A 4DR5J 5BPNA 1YXQA 1LAVA