3LANA

Crystal structure of hiv-1 reverse transcriptase in complex with n1-butyl pyrimidinedione non-nucleoside inhibitor
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N1-Alkyl pyrimidinediones as non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords HIV Reverse transcriptase
total genus 160
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lanA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lanA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lanA05
4O44B 3RBDA 5J1EA 4Z4HA 4FBUA 1I3AA 2D3ZA 1NJWA 5FDLB 2WTFA 2AGQA 3ZT3A 1KCFA 5KRTA 4ECQA 2QE5A 2IBKA 1B92A 4O3PA 4J9KA 1HQUB 1KVAA 4FJ5A 1U09A 3EZ5A 4B9SA 4KHUA 3CJ2A 3DLRA 4E7IA 4K8ZA 5KT3A 3SI8A 2WONB 3JSMB 3OYAA 3I0RA 4FLZA 3PO4A 1J5OB 3KK2A 5KT6A 1T7PA 3OLAA 4QW9A 5L1LA 5KFPA 3M8PA 3T5HA 4RNMA 3DLKB 3CIZA 1S9FA 3ZSXA 2RF2A 2OYQA 1C0TA 1SH2A 1VSFA 4WE1B 3V1OA 1K6YA 4CF0A 4QPXA 3IGVA 2W8LA 4O0IA 1IO2A 2XCPA 3GQCA 2IMWP 2DFHA 4DLEA 4NCGB 3HO1A 1RCHA 1IKWB 4DL7A 4B9VA 4ECZA 3HPOA 5KFVA 4URSA 3DI6A 4CJEA 4J2DA 3MEEB 1KVCA 2I5JB 1DTQB 1JLGA 3OL7A 3PR4A 1QTMA 3MR6A 1EETB 4RNHA 1N4LA 4DFJA 3FFIA 4O44A 3UR0A 4CGDA 5KFSA 4CF9A 3QNNA 4CK2A 1W0HA 4ZP6A 2XY6A 2ETJA 1RA7A 3KLEA 4HKQA 3CJ5A 3PJXA 2FLNA 3DDKA 2XHBA 4WE1A 4RNOA 1TGOA 4R5PB 3OSNA 3IG1B 4F50A 2D5RA 3HHKA 4NLYA 4GC6A 4CFBA 1N5YA 4EBEA 4CGGA 4DU3A 1CSJA 5L1KA 4Z4FA 4J9RA 1BGXT 4PUOA 3RMCA 1L5UA 4DQRA 4NLSA 2AGPA 4DSLA 5CYMA 3LZJA 1IM4A 1TL3B 2XRIA 1NK0A 2XI3A 5HLFB 2JEGA 4J9MA 4W5NA 2Y1IA 4FJMA 4FJGA 2D0AA 4CIFA 5F8MA 1LWFB 4BDPA 3T19A 5CYMB 3OYEA 1C2PA 2ASDA 1TL1A 3IRXA 1VRUB 4ZHRA 4IRKA 1GX5A 3TAPA 2ZD1B 5HROB 3A2FA 1J53A 3VQ8A 3S3MA 3DM2B 1NKCA 1YVUA 4NZ0A 2UVVA 4Q8EA 2DY4A 2FVCA 4DTOA 1TAQA 1EX4A 2RN2A 1VSDA 3ZSRA 1ZBUA 1XWLA 1C0UB 4KRFA 2R2TA 4FM2A 3F73A 3DYAB 1DTTB 4HUFA 3HVTB 1NK6A 5F9NA 1QSLA 3TQ1A 2R8KA 4RU9A 3NGYA 1JLAB 3F9KA 3LPUA 5HRPA 2RKIB 1B9FA 4OKKA 2WHOA 4OGCA 3V9UA 1RT3B 3FQLA 3H98A 2I5JA 1LWFA 4Q8FA 3I0SA 4OLAA 5J2NB 4E1NA 4CJSA 4DL4A 2OPQA 3PW4A 1JXLA 4WZQA 2JLEA 3HYFA 1S0MA 4CGHA 5J2MA 2DFFA 3DLEA 4FLVA 3QZ7A 5KFQA 1SKRA 5F9LA 3VQBA 4JLHA 1ZBIA 3P5JA 3DOKB 4ED8A 4W5QA 3THVA 5EU7A 4DG1A 5I3UA 1L3SA 4FLXA 4FJ9A 5KFUA 3VQCA 4B08A 1S1XB 2FVSA 3G6VA 1DLOB 2XI2A 3TAQA 4K8XA 3FQKA 2Y1JA 1BHLA 4HTUA 4IH7A 4X2BA 1UA0A 2QK9A 4W5RA 5C25B 3AA2A 2PYLA 1S1WA 3IS9A 4CFDA 1UOCA 3UQSA 2KFNA 2WOMB 3PW0A 5HRSA 1BQMA 2BE2B 5C25A 4MKBA 1T8EA 4EO8A 3MECB 3H59A 3I5CA 3RBEA 3O4NA 2B5JB 1HARA 1RYRA 3RWUA 3V81B 1BI4A 4KO0A 1T03B 3OLBA 3V6HA 2XCAA 1TVRB 2D3UA 1JXBA 4IR9A 3SCXA 1T05A 3RB3A 3WNFA 4RNNA 5EUHA 2F8SA 5KG1A 4FJHA 3HK2A 2YNIA 2B4JA 1Y97A 4E7KA 4IOBA 1LWEB 3OYCA 2X78A 2B6AA 2C22A 3SJJA 5C42A 3M9NB 2EC0A 2Q3SA 4CF8A 4CERA 4AHSA 1WAJA 2B43A 1DTQA 2WCXA 4WXWA 3MEEA 2HHSA 1BQMB 2BE2A 5KRSA 4HVJA 4KB0A 1BL3A 3HVTA 1TK8A 3LP3A 4ECYA 3VQ7A 1JKHB 1U45A 4O4RA 1KVBA 1HMVA 1FK9A 4YMEA 4ECRA 4N5SA 1RTIB 3AO2A 4CJKA 1X9MA 4KV8B 4WYLA 1ZBLA 2JEIA 3ZSZA 3KD5E 4RNFA 4RUCA 4B9UA 4OKEA 3Q8SB 2ATLA 4NLUA 4ED3A 4PY5A 1LAVA 2KZZA 2YKMB 3RR8A 1LWCA 3QO9A 2BRKA 1XHZA 1XR5A 3LP0B 3ISNC 2VG5A 1VRUA 5JS1A 2YKNB 1S9EB 1VSJA 1S97A 4QWBA 3ZSVA 1RTDA 2ASJA 1LWCB 5KFRA 4Y2CA 1CZBA 2ILYA 3U6FA 4Z4CA 3TAEA 4JV1A 5KT7A 3MR3A 2JGUA 4DSFA 4CJUA 4FZZA 3LP1B 2WONA 3JSMA 1SKWA 1JLCB 3D28A 1QSYA 3TVKA 3QEIA 2G8FA 2PZSA 3SYZA 4WFYA 5CZ1A 4DF4A 4C8KA 1UWBB 1CZ9A 1HYSA 4TY9A 2FBTA 2RPIA 2UVUA 3KLGA 4IKAA 1D9DA 5KT4A 3C94A 4TSXA 3NH2A 1ASWA 4CEFA 4ED1A 4NLRA 4AHTA 3BGRB 4WFXA 1IKWA 5C24A 4N76A 3PHEA 2J6SA 2ITGA 4NLTA 1HYVA 3DLGA 4ZTFA 2HHVA 4M3RA 2G8WA 3SUPA 2V4QA 3CDWA 5JXSA 2HMIA 4AHVA 1NKEA 1TAUA 3PV8A 4YNQA 3M8RA 4M41A 3ZT4A 4KAZA 2HB5A 4DSKA 1D9FA 4QW8A 3ITHB 1A5WA 1KTQA 4JV0A 4F4XA 3RR7A 2YNIB 1XC9A 4TXSA 3LZIA 5T14A 1SV5B 3DYAA 4FJIA 4F4YA 4R8UB 2WRMA 3E01B 1C6VA 3KLVA 4Q45A 4TQSA 5KFXA 2UVWA 4ED6A 4ECXA 4TLRA 4ED0A 1C0MA 3HM9A 4KHSA 3AO1A 3N6NA 3RAXA 1UAXA 5F8JA 1ZETA 2KQ2A 4M3ZA 3VQ4A 2HNDB 4I9QA 2FBYA 3O3HA 4CHYA 5J2MB 1UA1A 3SUQA 5L1JA 4LH5A 4ZVFA 2HNYB 3NGZA 3V4IB 2P5OA 4J2AA 3PZPA 4E0DA 3ITHA 3MEDB 1BIUA 1IKYA 1SUQB 3QERA 3ZSYA 1W9HA 1EXQA 2PY5A 5KFMA 4O3NA 3RRHA 4K4WA 3HPHA 4ELTA 4CJ3A 5J2PB 1L3UA 3NAIA 3V4IA 4KHYA 1WSJA 2BANA 2HNZB 5DQGA 3H4BA 4ECVA 1RT5B 2R8GA 3V1RA 1C0UA 5KG2A 3VA3A 2VG6B 4FJJA 5FRMA 3H5SA 1HPZA 4RW8B 1D1UA 5KT2A 3RMDA 5EWEA 1U49A 4GVMA 4O3QA 1RT1B 3E51A 2FLPA 4FBTA 3AVNA 4KTWA 4AHUA 3OYIA 5KFIA 4L8RB 3ISND 4H54A 2W7OA 3MECA 4CE9A 4K4TA 4Q44A 3RTVA 3QEWA 1Q9YA 3L2VA 1D0EA 2WOMA 3IN5A 4ZVEA 1NK9A 4ELUA 2IAJA 4R0EA 4C8OA 4RW6B 3I5AA 2HNYA 1EKEA 4NLQA 2GIQA 3RRGA 3CQ8A 5DK5A 3AVGA 1WN7A 4XO0A 3HVWA 3LWMA 4RW7B 3DOLA 3AVHA 3LP2A 1N6QA 2R8JA 2AWZA 2X6NA 4FS1A 5CYQA 3NF7A 4DG1B 5I3UB 5HP1B 1JL2A 3VQ5A 2YNFA 4YR0A 4DL3A 4DTPA 3TANA 1WNSA 4RG8A 4J9SA 4LQ9A 3CJ3A 3KLFB 3G6XA 2R2UA 3AVBA 4I2QA 5DG9A 2KTQA 1WSIA 3I8DA 4KB1A 4CJRA 3KK1B 2ZE2B 1G15A 4K4XA 2HHTA 4WYWA 2Z1HA 4B8CA 4H4MA 3VN5A 2UUTA 5D3GB 3BSAA 4AHCA 2NUBA 1WAFA 3AVMA 4FW1A 2J6UA 2IGIA 3BQ1A 3GIMA 1JLFA 3NKYA 5EDWA 2BR0A 3NBPA 1S10A 1IKVA 4ECUA 1HYZA 4ID5B 1C0TB 3SUOA 4KO0B 4MKAA 3QIPB 1UWBA 1Z4UA 1TV6A 4QWEA 2XY7A 4E7LA 3KK2B 3IGNA 1QE1B 4U6PA 4F3OA 4NLDA 3N6MA 4Q0BB 3K57A 3MXJA 5F8HA 4IFVA 4CECA 2C2DA 4YR3A 1VSEA 3T5KA 2OH2A 4KREA 1S1WB 3IS9B 3K5MA 2E6MA 3NF6A 4KHMA 3ASMA 3OYLA 4F3TA 2HWIA 4KHQA 5DLFA 4G1QA 4PQUA 3OYNA 1VSMA 4FLYA 3SPYA 4BE2A 4KI6A 2IAJB 4BWJA 1L3VA 1S48A 4E7HA 1RAJA 5DG7A 1I39A 4ZPBA 2YNFB 1W25A 2HVHA 3KMSA 3ZSOA 1RT6B 1S0OA 2IC3B 3C6UA 3NGIA 2OPPA 3CYMA 1RBTA 4AH9A 1N5YB 4DTJA 2AX0A 3O4QA 4EBCA 1I6JA 4CEQA 5HROA 4YR2A 3NMAA 3VQDA 4F8RA 4FM0A 1S6QB 4Y1DA 4CIEA 2E9TA 3WNHA 3OS1A 3G86A 1BQNA 4IR1A 1JXEA 2V9WA 3NL0A 4DTUA 3ZCMA 3KTQA 4K4ZA 5SZTA 4JS5A 1T03A 3KK3B 1YTUA 4CJQA 4KE5A 1HQUA 3TABA 4ZPCA 2F8TA 3KLHA 4FXDA 3VQ6A 1IKVB 3OYKA 3AVIA 1S9EA 3GV5B 3V9XA 1SUQA 3KIOA 2D7SA 3QGHA 3VQPA 4XIUA 1JLAA 1LW2A 2P1JA 3L3VA 4IFYB 4IH6A 3BSNA 3CM5A 3KLIA 1IG9A 4KSEB 2X6SA 2HVIA 4Y3CA 4MK9A 2IDOA 5KFYA 3OVNA 3H5YA 1KHVA 3V6DB 1WSGA 1NNDA 5EWFA 2E9RX 4HCCA 1BI4B 1QAIA 4I7FA 1NKBA 1REVB 5F8IA 3CJ4A 4J9LA 2R2SA 3SFUA 3HKWA 3PR5B 4URQU 2D41A 2XY5A 3NCIA 1WSFA 3EPGA 2X74A 4TYBA 3QIPA 4B3OB 2VA2A 1RTDB 3G6YA 3DRSA 4NYZA 3I5BA 4Y34A 3KKSA 2AX1A 4OKJA 3KMQA 3GIJA 4GMJB 3OYHA 1KLNA 4NCAA 4B9MA 3G10A 1ZBHA 1D5AA 3KOAA 5KFFA 3CDUA 4URGA 4ZTJA 4DWIA 4B3OA 3PJWA 1RA6A 2YKMA 4KHRA 1RT1A 4NLOA 1RT4B 2FVRA 2OPQB 4Q5VA 2C28A 1HNIA 1RTJA 4Q0BA 5K14A 3L3UA 5KFGA 2WK4A 1BQNB 2FJWA 1D8YA 4EEYA 3AVLA 1N56A 3LAKA 4YQWA 2HNZA 3V9SA 3QNOA 4I7FB 4CHNA 3KD1E 4KV8A 4HYKA 2VG7B 2E9ZA 3SUNA 3CVKA 1RTIA 2KW4A 1RNHA 1RT2B 2D0BA 4O3RA 3DMJB 3NF8A 1U04A 4ZPDA 2DTUA 1RT6A 3S3OA 2XGQA 3KLEB 4Q43A 3B6OA 2IA6A 3GYNA 3QIOA 1JLBB 1TKXA 4BE1A 2O4IA 5KGXA 1C1BB 1FXXA 4CEZA 5J2NA 3PW7A 3LWLA 1F21A 3NFAA 4QCLA 1KFSA 3TARA 3H40A 2J6TA 4F4ZA 3K58A 2O5DA 3K5LA 3BQ0A 2P51A 4IH5A 2D0CA 3KK3A 4C8LA 5I42A 5T7BA 4FZXC 4EP4A 4Z0UA 3LDSA 3PX6A 1JLQB 2AJQA 2R2RA 1MMLA 1NK5A 1VSKA 3GIKA 1WSEA 4C8MA 4FK0A 4FCYA 4PUOB 4LSLA 2HNDA 3WNEA 3DOKA 1HNIB 4K4VA 4I2PB 1S4FA 3SQ0A 3QLHB 4O4GB 1RDBA 2G8HA 4AILC 4MIBA 3CO9A 3IG1A 4KPYA 1HMVB 3GV7B 4ZP7A 4CF1A 2QV6A 4ECWA 3MF5A 1U47A 4Z4EA 1CLQA 3KLIB 1LV5A 4O3OA 2ILZA 1LW0B 2BQUA 4Z4IA 5KFWA 3ZSWA 4RW6A 4HCBA 3U3GA 3BGRA 4NRUA 4ZP9A 1NJYA 4DS5A 4FJLA 3T3FA 3OL8A 5HRNA 2ZE2A 2UVRA 5J1EB 1IKYB 3OYMA 4CFCA 1HJRA 1LW0A 2Z1GA 4NCGA 4N41A 2W9CB 3PY8A 4CJLA 4TY8B 4M3WA 2OPSA 3VQAA 1RBRA 3RB0A 4IKFA 4O3SA 4ICLB 4O4GA 3H5UA 1TK0A 3M8PB 3RB6A 4GC7A 3MEGA 2B5JA 1TKTA 3LPTA 1J5OA 4K4UA 3C6UB 4DU4A 3ULDA 3HSTB 4IG0B 4EO6A 2HWHA 2V0NA 4DFPA 1KFDA 3VQQA 4JRPA 3DRPA 1RDRA 3AO3A 3DLHA 3NHGA 2VWKA 3BSOA 3OY9A 5KFHA 3NH1A 2BGGA 1VSHA 4DL6A 4IG0A 2HMIB 3HJFA 3UIQA 1KHWA 3T1AA 2VA3A 3AO5A 4W5OA 4CCHA 5FRNA 4KAIA 2RDJA 4NLWA 2O4GA 3PVXA 5CZ2A 3CM6A 3SV3A 4B9NA 2W7PA 1O1WA 2XC9A 4FW2A 3O3GA 4XPEA 1RT7B 4ID5A 2AU0A 3JYTB 3DOLB 4ZVHA 2IM3A 1S5JA 1JLGB 5KI6A 2G8UA 2ZQBA 3K5NA 3MEDA 1WNEA 1S1VA 2FVPA 5HLFA 4DTXA 1RYSA 5C24B 4DL5A 4UQGA 3KHGA 3QEXA 1IKXB 4EP5A 3OJSA 1RT3A 1NK7A 4KFBA 1TVRA 1RDCA 2A1RA 1KLMA 4B8AB 1NK4A 4K4SA 1FKPB 3KLGB 4CHPA 4PWDA 2C2EA 3KHRA 1HYSB 4IQXA 3L8BA 1QQCA 4I2PA 1ZYQA 2YNGA 4RW8A 3HL8A 4TY8A 1SL0A 1IKXA 3D0PA 4KI4A 1RDDA 4U7CA 2XWYA 3CFOA 4WXOA 4EZ6A 4J2BA 3QETA 2ZD1A 4KKOA 5KG6A 3MAQA 1S9GA 3ZT1A 3M8QB 2JC1A 3NH0A 5KG0A 5KFEA 4CGFA 3OYJA 2UUWA 5KFKA 4CHZA 3DRSB 3V9WA 2YNHA 3SNNA 4PA1A 3P83D 1MU2B 1T94A 3PW5A 2HHWA 3RMAA 4NRTA 3SI6A 4CHQA 3EY1A 5KGWA 2JEFA 1S6PB 5DQIA 4FLUA 1S9GB 1U4BA 2RF2B 5C42B 1XR6A 1YTAA 3SV4A 1RTHB 4CJ5A 1NJZA 2FLLA 3QLHA 1FKOB 1IH7A 4BDYA 3UPFA 2W8KA 4R5PA 1ZBFA 1KLMB 2HHXA 1U48A 1HPZB 3QEPA 4KTZA 3LP1A 3AA4A 4I9LA 2AQ4A 3QGGA 1LAWA 1SV5A 3DRRB 3GIIA 2JEJA 4CEEA 4NLGA 5I42B 1ITGA 4WZMA 1FKOA 2YV0X 3G0ZA 1LW2B 1SKSA 4FK4A 3OYDA 2OPRA 3CDEA 4JV2A 1XR7A 1EETA 3DLEB 4KBIA 3DI6B 2V4RA 3KLHB 4WFZA 1C1BA 1S1TA 3AVJA 3KLFA 1MU2A 4ICLA 4MQ3A 1LWEA 5HBMB 5KG5A 4N47A 4QOZB 3V9ZA 3NAHA 5KFOA 4E7JA 4FJ7A 3NAEA 1X9WA 1RT5A 3K2PA 3PUFA 5DMRA 2G8IA 1Q8IA 2G8KA 1JLEB 2FJVA 2FVQA 1TK5A 1TQLA 1S1XA 5KFAA 3D45A 2IM0A 4IFVB 4B9LA 4C8NA 4DS4A 3M9OB 4DTSA 5KG7A 4H4OB 2XGPA 4MH8A 1RTJB 4R8UA 1JX4A 5HRRA 2IOCA 1TKZB 1RT4A 3C6TB 3CWJA 2FC0A 4ID1A 2HHQA 3NF9A 4G1QB 5KFJA 3P1GA 2AGOA 3IAYA 1YVFA 4O55A 1HQEA 2YKNA 2IM2A 1K1QA 1C1CA 4DTRA 2E6LA 4IRDA 3V6KA 4GW6A 1Z25A 4CGJA 3C6TA 2ALZA 3OL9A 1SL1A 3N6LA 5CY4A 2I1RA 4H4MB 1KSPA 2GUIA 4CJTA 3OSPA 5L1IA 4LSNB 4CJPA 4MFBA 4CJ4A 1RT7A 4JRQA 1NK8A 5J2PA 3CJ0A 4ZP8A 3OYGA 1RTHA 1DTTA 3ALYA 4M42A 3BJYA 4ED7A 4NYNA 4FJXA 4FS2A 2OPPB 1JLCA 4K4YA 4F2RA 1S6PA 3T5JA 3ZT2A 2BDPA 3GV8B 5KFNA 1N48A 4CEOA 3GILA 3SQ4A 3QEVA 3QZ8A 1NHVA 2GBZA 3L2QA 3PX4A 1HRHA 2Z1IA 5KFCA 3VQEA 3QESA 4OVLA 2BQRA 2R7YA 4FJNA 4M3TA 2E4LA 4E19A 2IS3A 4B9TA 2CJQA 4M3XA 1L3TA 1R0AB 4O5BA 4OJRA 3QO9B 4MIAA 3BQ2A 4RW9B 2YHBA 4DTMA 2FBXA 4DQQA 4CESA 4M95A 3OL6A 1NOYA 1SL2A 2BQ3A 4LD0A 1VK0A 4CJFA 1ZTWA 3B6PA 4LQ3A 4Y1CA 5F8LA 2CKWA 1Z26A 3HPGA 3WNGA 1SH3A 3QYYA 4RW9A 3OS2A 3CFRA 1JLEA 4KB7A 3EPIA 3V6DA 4F4KA 3LP2B 1C1CB 4BACA 4FJ8A 1VRTB 1HQEB 4LH4A 1JLFB 2EHGA 4ZMMA 4IRCA 3Q8PB 2BANB 2QKKA 2WB4A 3MXIA 4ECTA 2XO7A 4M45A 3V6JA 2PYJA 3MFHA 4DSEA 4CF2A 1XHXA 4IG3A 5FDLA 3VQ9A 1S0NA 5SWMA 1REVA 3AA5X 3CFPA 4DQIA 2RKIA 4J9PA 5KG4A 4HUEA 4ZPAA 1QS4A 1EP4B 3D5MA 3BREA 3H2LA 3CG7A 1JKHA 4TQRA 4E1MA 3DMJA 3AO4A 5K14B 3KNAA 4CEAA 2FJXA 4DSIA 3FSIA 3L2UA 2W42A 5KFLA 3EYZA 2W9AA 4DSJA 5JUMA 1Q9XA 3FFIB 1OS5A 2BRLA 3MXMA 2OZSA 1BIZA 5KFZA 4AHRA 4CJVA 4JUZA 3TAMB 4DF8A 4BWMA 1A5VA 3E01A 3HVAA 4H8KA 2ATQA 1S49A 3AA3A 5KG3A 1GOCA 3TAFA 3TR8A 4FM1A 3NE6A 4M94A 5JS2A 1BCMA 3OS0A 3VQSA 4DFMA 5F8NA 3KHHA 4CK3A 4CFAA 1GX6A 4HUGA 3AVCA 3M8QA 4DLGA 3QIDA 1C1AA 4IBNA 4FVMA 4RW4B 4RUAA 3T5LA 2OZMA 3TAGA 3DLKA 4CEBA 2ASLA 4ELVA 4KHWA 3PO5A 2P5GA 4Z4GA 4J9OA 3H08A 4LSLB 2KFZA 4DU1A 2OPSB 2HW3A 1QE1A 4ED2A 3OYBA 1WLJA 3M9MB 4CJWA 1RT2A 1VSIA 1WSHA 3NGDA 1HNVB 5KFDA 4RW4A 1N6QB 4DFKA 1S1TB 4MFBB 3Q8QB 4IDKB 4LSNA 4BDZA 1S1UB 3EZUA 4FK2A 2OPRB 3OYFA 3MR2A 4QWAA 4M3UA 3DRPB 4NLPA 2DPJA 1RBSA 1BISA 2XY8A 2IJFA 3O3FA 3PW2A 3DRRA 2LSNA 3OHBA 3V1QA 3HT3A 2W9BA 3KK1A 4IDKA 3SQ1A 1VRTA 1S6QA 2GV9A 3MEGB 2YNGB 2VG5B 4FLTA 2B6AB 4NLXA 4CIGA 2VG7A 2HAIA 1A5XA 1SH0A 2DFEA 4DL2A 3SQ2A 3NDKA 1T05B 4NLVA 4W5TA 4KFBB 2F8EX 1KRPA 5HP1A 1VSLA 3I0RB 4DTNA 2W9CA 5L9XA 5CYQB 2DPIA 3ZT0A 4O0JA 5EWGA 2IM1A 3QGIA 2EX3A 4QAGA 3RAQA 2GC8A 3ZSQA 2VWJA 1ASUA 3KJVA 1ZTTA 4EYHB 4K50A 3AVAA 2A1SA 1S1UA 4RW7A 4EYIB 4ZHRB 2IC3A 3LP0A 4KKOB 3ICLA 1DLOA 3FRZA 4IFYA 2OA8A 3RMBA 4PQUB 4EBDA 4FJKA 1TKZA 1T3NA 3H5XA 1RDAA 4F4WA 3SZ2A 3AVKA 3LANA 4ECSA 1QUVA 1QSSA 1TP7A 1GOAA 3RB4A 4DQPA 4OPKA 3HP6A 4CGIA 2GIRA 3DLBA 1CXUA 1FKPA 4OLBA 5DGBA 2YHAA 2HHUA 4LY7A 2FBVA 2R8HA 4Y2AA 4BE0A 1EP4A 1JLQA 4DEZA 4J9NA 1TV6B 5DQHA 5HBMA 3H4DA 3VA0A 2Z1JA 4RZRA 1B9DA 3TAMA 5DLGA 3L2WA 3NBPB 4N56A 4KHNA 1QAJA 4IG3B 2W9BB 1TKTB 4TYAA 2QXFA 3HP9A 3JYTA 3DLGB 3S3NA 1J54A 4J2EA 5DG8A 5KT5A 1JLBA 1TKXB 1JIHA 4OL8A 4CK1A 5J2QA 2YNHB 5KTQA 3LALA 3I0SB 3KKRA 4TN2A 2VG6A 3M8SA 3FDSA 1XI1A 2JC0A 4E89A 4H4OA 4I2QB 3AV9A 2F96A 5E41A 1CXQA 3KJVB 3V81A 3DM2A 4DQSA 4M3YA 1RBUA 4EZ9A 4NYFA 5C5JA 1X9SA 1FK9B 3UDLA 4QWCA 1NHUA 1TL1B 3IRXB 2ZKUA 4ZVGA 3TWHA 2QKBA 3MFIA 3HVRA 1NOZA 4NCBA 2KZMA 5DGAA 4CHOA 3SPZA 1YT3A 1RBVA 4HHTA 3BDPA 2RDIA 1TL3A 3OJUA 1RILA 3K5OA 4CEDA 3PX0A 4FLWA 4G3IA 4OGEA 4YFUA 1JL1A 2R8IA 3BSCA 3MR5A 5F8GA 3MTKA 3HXMA 3U3YA 3L2RA 2IJNA 1S1VB 3Q8RB 2C2RA 4FZYA 3S9HA 4MK7A 4E3SA 1K1SA 3QINA 3OHAA 4XPCA 3K59A 4YP3A 4J9QA 4JS4A 3TI0A 4FYDA 3AVFA 1HNVA 4KTQA 4PWDB 1BCOA 1R0AA 3KHLA 4F2SA 3LAMA 5KFBA 1NJXA 1GOBA 1QHTA 1X1PA 1TKDA 1J9AA 4QWDA 2G8VA 5J2QB 5D3GA 3C95A 5FROA 4MK8A 1ASVA 3SFGA 3BR9A 5KFTA 4OPJA 4DMNA
chains in the Genus database with same CATH superfamily
2FGOA 2D3ZA 4FF2A 3VAHA 2N7YA 5GAEI 4ECQA 5KPTA 2B8QA 4P75A 4QU7A 2F40A 2Y0SD 4O3PA 2VFUA 4FJ5A 3M6XA 4AM6A 5AQSA 3AD9C 2EK6A 2QA4S 3M6GA 5AQFA 3NGSA 4CVNE 1S59A 4B9SA 4KHUA 4IJAA 1BC6A 2MKKA 2BJDA 4E7IA 4K8ZA 3SI8A 3VEWA 3DXMB 1TZ0A 1UTAA 4FLZA 5B0AA 2E1RA 3OLAA 4QW9A 4D3HA 1VQ9N 3T5HA 3LUYA 5IT9U 1S9FA 3ILLA 1C0TA 4DR6J 2EEYA 4RR5A 4WE1B 5D4LA 4DXLA 1T9TA 2VODA 2DPNA 4ZPTR 1WF2A 4PL8A 1NXIA 1IO2A 2V5HG 1Q18A 2WSCC 1HA1A 3AH6A 1XQIA 4FNIA 1OVYA 3VENA 5AE3A 5A0YA 3D68A 3SAFA 3MEEB 1DTQB 5AQRA 1JLGA 2VDHA 1N4LA 3FFIA 2DISA 4USVA 3UR0A 3QNNA 2P5VA 2XY6A 1GLDG 1RA7A 3KLEA 4X4PA 2QLXA 2CJAA 4H4KA 3L0QA 3UVJA 3DDKA 4ID8A 4JI2J 3UW1A 2P9SA 2C3YA 2F9TA 3G25A 4Z94A 1ZAVA 4LT6A 4CFBA 4I6AA 4OZ1A 4EK2A 1N5YA 3A8KA 4NXMJ 1Y64A 1YJWS 2ZNYA 2O3DA 1BGXT 4PUOA 1X7VA 3UNGC 1L5UA 2P9PA 1VQKS 2CQHA 1IM4A 3Q22A 2O1PA 5HLFB 2EWSA 2Y1IA 4PXDA 3VGTA 3HZ6A 4CIFA 1U8WA 3A8JA 5I3QA 3MUVP 1R8HA 3OYEA 1C2PA 2ASDA 3IRXA 3DKDA 2Z2YB 4DV2J 4AQYJ 1CULA 2UUCF 2DH7A 2K8GA 4L3KA 5HROB 4CD3A 1IXKA 1GLLO 4PKHA 3VQ8A 3S3MA 4PXEA 3GG1A 1K8KA 1YVUA 5E84A 2UVVA 3IBWA 1C4AA 3TOQA 3RW6A 3P31A 4BR5A 4KRFA 2R2TA 2N4DA 4NXNK 5F0UA 1E4FT 1DTTB 3MN6A 4PG5A 2Q1LA 1NK6A 2R8KA 3F9KA 4OGCA 4OYMA 3FQLA 3VGUA 4Q8FA 3I0SA 4ANCA 3DC2A 4CJSA 2B9WA 3MWTA 2AEFA 4BVPA 9RUBA 3HYFA 4CGHA 1RUSA 4C1NK 4ZVQB 4FLVA 3QZ7A 5KFQA 4WFNQ 1T95A 4WU2A 2Q6CA 1RCXB 3PIOQ 4JV5J 3LW5C 4X4UA 1OKJA 2ZH5A 3A8EA 4FLXA 4N7TA 2ZVSA 4FJ9A 2HS4A 1M5PC 1F9EB 1S1XB 4DR6F 5BN9A 3MD3A 3G6VA 1DLOB 3TAQA 4CH0S 5FPEA 1EAYC 1FE0A 2G2ZA 3Q7BA 1N5VA 1UA0A 3KFWX 3AA2A 3CPWM 3GU0A 5AQPA 2ITMA 2R7XA 3CD0A 2VV5A 1BY9A 4LREA 5CYJA 2FY1A 4FWNA 2KFNA 5HRSA 3MDFA 3AAWB 4JI5K 3MECB 4OJ3A 4KJIA 2JWKA 3O4NA 4CO2A 4OPAA 1NAQA 1IBMJ 3UN2A 1BI4A 4KO0A 1T03B 3OLBA 2XCAA 1I94J 5F41A 4JYAF 1TVRB 2D3UA 2C2ZB 5BPMA 2G0CA 3P5TL 3H2VE 3VF4A 4C9DA 4RNNA 4ZIVA 4KH5A 2F8SA 4FJHA 4IOBA 3HSDA 3OYCA 3CCSS 3SJJA 3W2WB 5IQ6A 2EC0A 4CF8A 3THPA 4LFAJ 3WDOA 4QBUA 1DTQA 2DR8A 3A5LC 2BE2A 2XULA 5HO4A 2DD8S 4LBIA 2CQIA 1H73A 4WCEQ 3I87A 3MMAB 1E3MA 3PCOB 3VTIA 3VQ7A 1UJ5A 4NYPA 3TO8A 4O4RA 1KVBA 2XYGB 4N5SA 2OFHX 1DAXA 1YK9A 2V69A 4DX6A 1P6TA 4CJKA 5AQMA 1TTHB 5T7LA 2JEIA 5L46A 3IC1A 2W1BA 2NXJA 7AT1B 3AARA 1N33K 1KN6A 2NR0A 2ATLA 5AQKA 2WSEC 4WKRA 4H4KC 4EU0A 3D1HA 5AQYA 3EDRB 2YKMB 4CW7B 1M1HA 4WFAQ 1FX2A 1KXPA 1VQ8S 2GJIA 3ISNC 2GQCA 4OQJA 4KH1B 1FJ7A 3VCDA 4E98A 3W9HA 1VSJA 2AYGA 1S97A 4CO4A 5KFRA 3W2WA 5BR8J 1CZBA 2ILYA 4Z4CA 1NSQA 4P2SA 5KT7A 3MR3A 1EX8A 2BOAA 2VPYB 3LP1B 2WONA 2D9OA 1SKWA 3D28A 2G8FA 1NDKA 1C0FA 3VALA 2ZBRA 4DF4A 4X62J 3G87A 1UWBB 5A2QO 4TY9A 3UI3A 4A4JA 3CQXA 3R6MA 4DV7K 4F0HA 3BH6B 5KT4A 4TSXA 4EIAA 3G2XA 3CC2S 3QWPA 5DDRC 4WCEL 4LIWA 3THYA 4ED4A 4WFXA 3SMPA 4N76A 3PEHA 4NLTA 2HBJA 2UXDJ 1UVLA 2QRRA 3SUPA 2V4QA 3CDWA 1YITN 3BDEA 3MURP 1TAUA 1NMNA 3EXCX 3AGRA 3EO3A 1D9FA 3ITHB 3A8YA 3EE3A 4OO1J 3I6PA 4TVAB 2MQNA 4Y0WA 2WRMA 3E01B 1C6VA 1RWVB 4TQSA 4ED6A 2BXJA 4J7CA 2NRVA 1ATNA 2J76E 1U0HB 2AYMA 2VIHA 1M1GA 4KHSA 1ZM3A 2BA9A 1KP6A 3RAXA 1UAXA 1F5CA 5F8JA 4FWPA 2KQ2A 2OCEA 1HX1A 3EVWA 5BPNA 3O3HA 2JFKA 5J2MB 1UA1A 4CHYA 4X66K 4DR5K 4ZVFA 2APOA 3MM6B 2P5OA 3ULEA 4E0DA 2CQ0A 4Y2IA 2GZOA 2BJ9A 2R7RA 3DXKA 4YHHJ 1W9HA 3Q2TC 3HPHA 3LM2A 4X64J 5J2PB 1X4DA 1L3UA 5JLHA 2EK1A 2HQFA 4DDFA 4ECVA 4DV5K 4JKGA 4X84A 3V1RA 3H5SA 5K8MA 5G0RB 5KT2A 3U8XA 5HL7L 4O3QA 1RT1B 3E51A 2FLPA 4FBTA 4K59A 3R2CJ 3P49B 1YKWA 3TA0A 1U0HA 2W7OA 2LEAA 3HF5A 4LFBK 5DDOC 1K9MT 3RTVA 5KAKA 2X1AA 3M2VB 4ZVEA 2Q3PA 3FK4A 2GVDA 2F4VK 4C8OA 3I5AA 4N8OA 3TZYA 4NLQA 5B0CA 2OELA 2P9GA 4BS2A 1KVIA 2LLZA 5FPDA 3AVGA 3HVWA 3LWMA 4KRWA 3DOLA 3AVHA 3LP2A 4AT1B 4MKVA 1NMEB 5K8OA 2GGPA 3VEYA 5A8KB 2AWZA 2OD4A 3CIMA 3ETOA 3VQ5A 4OHVA 4DL3A 3TANA 4YY3F 1WNSA 2YWEA 2P2CB 3ATVA 3RAMA 3CJ3A 3KLFB 2R2UA 3AVBA 4KB1A 3MR7A 2EBGA 2E5LF 3KK1B 3GIRA 4CQ1A 1RQ0A 4H4MA 2PEBA 2I2YA 2FPHX 5D3GB 2NUBA 3AVMA 2A2CA 3CCVN 2OMOA 2NYIA 2J6UA 5AR0A 3BQ1A 3GIMA 1Q82O 2BUNA 5EDWA 2BR0A 1HYZA 2MQMA 5IXUA 2ZUAA 3SUOA 4KO0B 2BW2A 3MCMA 4BRKA 1TV6A 4AXJA 4QWEA 1X4HA 5B0FA 4IWVA 1QE1B 3L3CA 3QATA 1NB7A 1HWLA 3N6MA 5LL6Z 1T9VA 1FDNA 1UEKA 2WZ1A 2DHGA 1P90A 3WT0A 2OH2A 2FJAB 1S1WB 2A6MA 4JI7K 5A6WA 5AZJB 1KVKA 1FEHA 3ASMA 4F3TA 1SB6A 2DXDA 3T1YK 2QA4N 3JAMU 5DLFA 2MZQA 1U25A 2KT3A 3MMAA 3M8ZA 1VSMA 2IAJB 3VWSA 1S48A 5JVGQ 1I39A 2YNFB 4USTA 1W25A 2HVHA 3KMSA 3SQGB 2IC3B 3WX8A 4DBQA 3NGIA 2OPPA 3AAPA 4AH9A 4A8KA 3WC0A 2FZCB 4J91A 2YWWA 1G6BA 1NNEA 2A2DA 5HROA 2W40A 3D67A 4F8RA 4Y1DA 3UCUP 4CIEA 1RI7A 3W65A 3I55N 1JXEA 1RHMB 5SZTA 3JTNA 1YTUA 1HI0P 1HQUA 3TABA 5B09A 4ZPCA 2H4WB 2MB0B 3FBEA 3V2UC 4V19S 4FXDA 2L9DA 4AYBD 1IKVB 5ITHA 4HH0A 2QTWA 3TJ8A 2V4JA 1SS6A 1CBKA 1WHVA 2RNEA 4FF4A 1B64A 1JLAA 2FHJD 4ZKAA 3BSNA 2DY9A 4CLPA 3PACA 4E8UA 1NGEA 2HVIA 4Y3CA 2KYZA 2YY3A 4DCJB 4PCQA 4EFAC 3V6DB 4HCCA 2E9RX 4JI6F 3K17A 5F8IA 3HLUA 3SFUA 1VQMN 1WSVA 1U2RA 1GLCG 3CJRA 2PBDA 3SAHA 3HKWA 4B3RK 2X1BA 5F3ZA 1NUEA 1QD1A 5CCLA 1R27B 1WSFA 4J9VA 4A62A 1RTDB 4NYZA 2LU1A 1ZM9A 1VQ5N 2P8IA 3KMQA 3GIJA 4GMJB 2DCUB 1WTBA 4B9MA 5CD4A 2NRHA 1D5AA 2FJDB 3G10A 1E6YB 5KFFA 2D1CA 3PJWA 3HOTA 2OPQB 4Q5VA 2C28A 1D9AA 3U9DA 4Q0BA 1J5EJ 4JI0J 2ROEA 2WK4A 2F65A 3O1BA 5BJRA 1QQNA 3AVLA 1N56A 2F8HA 2HNZA 2JHEA 4BHQA 2ZHAA 3SMSA 1RTIA 2BKNA 5G0RA 3N28A 1RHJB 4BLGA 1U04A 2KG0A 3HULA 5AJ3F 1RT6A 4WK1A 3HI9A 1RAAB 1VQPS 1TKXA 3D6MB 5GVQA 5BPLA 1C1BB 3S41A 2UXCJ 1FXXA 2EBEA 4QCLA 3TARA 3I55S 3H40A 1AUDA 2QWOA 3K5LA 3CJ9A 4BRGA 2FSNA 1FJEB 5IOLA 3KK3A 2ASOA 2CADA 3LDSA 1JLQB 3NMUA 1MMLA 2QEXS 1HBOB 3G8QA 3I8BA 4L73A 3R7SB 1YXQA 1FWLA 1WSEA 4C8MA 4FCYA 1SJ4P 2HNDA 1SQEA 4K4VA 5M2PA 3KJQB 4HDGA 1OH8A 1NSAA 3FUYA 1VQ6S 1GEHA 3CO9A 1VBKA 4GO5X 3GV7B 4KGVB 4HH1A 4ZP7A 1BG3A 4JI1K 3MF5A 2NXUA 1U47A 4P10A 1CLQA 3KLIB 4O3OA 1KAZA 4CZEA 4Y2MA 4ZLPA 1WBDA 3U3GA 3FZ2A 4RTFD 2RQKA 4DS5A 5AQUA 3J7YP 3G96A 4M5IA 3TSQA 2ZNZA 5HRNA 2PI5A 2ZE2A 3M32B 3U1MA 2UVRA 4WTYA 3D9BA 2MEWA 3R7NB 1CPZA 4CFCA 3M8WA 1S72S 4K0KJ 3HHLA 4FOIA 1HJRA 2QM1A 1Q0NA 4NCGA 2QEXN 3PY8A 1W97L 5K8PA 2RE2A 4JYAK 4KHPK 2JWNA 1AFJA 2NXEA 4P7VA 4Y2KA 4IKFA 1UVNA 2LVWA 1IWAA 3MMBB 5I9EB 1NPKA 3RB6A 3MEGA 2B5JA 3LPTA 3KWGA 3HSTB 4LF6F 3CHWA 2V0NA 4DFPA 1HKGA 2VWKA 3BSOA 5KFHA 3NH1A 2E1YA 2IRUA 2HMPA 5AZJA 1IUJA 3HJFA 3DU5A 1FWPA 3OR1A 4GVLA 2VA3A 1OJ4A 2LA4A 4CBWA 4H5RA 4CCHA 2DRAA 2R7QA 3S1TA 4NLWA 2RDJA 4F3MA 4JI5J 3H6EA 4LF6K 4CM0A 4CLTA 3PVXA 1Q8KA 3NNAA 1O1WA 2XC9A 2JJ4D 3O3GA 2CQ2A 2E1AA 4BR2A 1FRMA 5AJ3J 1DKGD 5A8WB 2IM3A 2QGFB 3LH2S 5KI6A 3HSZA 3K5NA 2AZ1A 1RYSA 3KHGA 2GWJA 2O67A 3W63A 3LOUA 1V3ZA 4KFBA 2IRYA 3GTYX 3CXCM 4RBUA 3QAUA 4K4SA 3D4JA 4MO4A 2C2EA 1VJQA 3C19A 2HBKA 1HYSB 2MJNA 2IJRA 3VAGA 1QQCA 5AQLA 2YNGA 2QYCA 4TY8A 1SL0A 1AFIA 3ZETB 4KI4A 3TRGA 1D09B 2E2PA 3CFOA 1BXNA 2P9IA 4WXOA 3UE2A 4CRJA 3GZ7A 4TU7A 2XSJB 5KG6A 2D69A 1IJEB 2XWXA 5KG0A 1HW8A 3P6YC 3O5BA 1OPIA 3SNNA 3DDIA 1MU2B 1XMOF 2HHWA 5DZ6A 5BYQA 1R8BA 3EY1A 1YHQS 4B3RJ 5JVHQ 5DQIA 3LGNA 2AMCB 5HATA 1S9GB 1XEZA 2RF2B 5C42B 4K0KF 5H9FK 3OVSA 2HFZA 4CJ5A 1N0UA 3UPFA 3UB5A 2CZ4A 5E26A 4R5PA 1U48A 1OYDA 2MLXA 3LP1A 2AQ4A 3JXUA 3CCMN 1LAWA 4CEEA 2BEFA 3EGWB 4WKYA 5I42B 2DNGA 2VQEF 3LDQA 1FKOA 1PIEA 4FK4A 1X4CA 2FSKA 1IBLK 2VGMA 2CQ4A 3DLEB 4PHTX 2KXHA 5AXKA 5A0YB 3AB2B 4WFZA 1C1BA 3MTJA 5IZHA 5KG5A 3V9ZA 4FJ7A 2BM0A 3PNIA 5ETSA 5M1FA 5DMRA 4WWSA 3US5A 2YVSA 5LSLA 2G8KA 1JLEB 2QL7B 3DOMB 1KOOA 1VI7A 1TQLA 4BG8A 4I4BA 2IM0A 2P9IB 3N4QA 5HVFA 2O8FA 4B9LA 4C8NA 4ZCKA 2WB1D 1UAWA 3P96A 5HRRA 2IOCA 2K7KA 2POKA 1RT4A 3C6TB 4ID1A 2BOPA 2HHQA 2C3UA 3IR5B 4WPAA 4DV4K 3P1GA 1OY6A 1T9WA 2CJXB 2BJ8A 1K1QA 1HWUA 2E6LA 1FERA 4IRDA 4OI0A 3LDLA 1R6YA 1ZPWX 2EI5A 2DNOA 1DT9A 4CGJA 4H4MB 2CPHA 3OSPA 2DK2A 4UY8T 3FBBA 2DH9A 4LSNB 2CG4A 4A61A 1RT7A 4JK8A 1RAEB 3CJ0A 1NJIT 4LFCJ 3VEVA 4A8OA 4YOXA 1RTHA 1DTTA 3AFGA 4FJXA 4F2RA 1S6PA 2PFUA 2UXBJ 2BDPA 1LFWA 5KFNA 2PD1A 1HNZJ 1YRXA 5AXMA 4IFEA 3SQ4A 5L39A 1V4SA 4CD1A 4MLEA 1LNQA 5GADI 2AEMA 1HRHA 2Z1IA 3HSGA 2Z57B 4LF4F 3MGJA 1PILA 2E4LA 2MGZB 2AJ1A 2RUGA 3WIUA 2DGTA 1F6TA 5EY4A 2NUHA 2W4DA 4M95A 4M5HA 3QT6A 2B8PA 3IM8A 4LBHA 2ADCA 3WNGA 1SH3A 1X4GA 3QJPA 3CFRA 3EPIA 1JJ2R 3V6DA 3MOZA 3DGPA 4FJ8A 3I56S 2RHKA 2CAJA 2FGCA 3IMQJ 5IT9Y 3FJ2A 4IRCA 1XERA 3QPIA 1VQ7S 3LTOA 2V63A 3UFCX 2XMUA 4UW2A 5A6PA 2BABA 5KOWA 3HSJA 4IG3A 3K9JA 5FDLA 2E88A 4UY8O 4X4VA 2JFDA 3M3ZA 3EWGA 3H1QA 2YQ0A 4DV6K 5IFMA 3BREA 1S76D 2QLWA 1XNRJ 3DMJA 3AO4A 1Q81O 1P1TA 1UVJA 3RU0A 2M0GB 1MNEA 1S7IA 3M1VB 2WVEA 2J7WA 1SJQA 1OO0B 5JUMA 3FFIB 1OS5A 4BGBA 2OZSA 2DGXA 4AHRA 3I56N 4UUXA 4I67A 3NEKA 6FD1A 3HVAA 3HHLD 4H8KA 2ATQA 3FZHA 3AA3A 4PABA 3CERA 2GQQA 4M94A 5JS2A 1K9MO 2OMLA 3VQSA 4DFMA 3IMXA 1RDUA 2JNJA 4CK3A 3LDNA 4NLBA 4DLGA 3QIDA 1C1AA 2H5JB 2HYIB 4RW4B 2KL8A 3C66A 2IVMA 3TAGA 4DV7F 1AA1B 4CEBA 2ASLA 3A5OC 4J9OA 3H08A 4IQMA 2HW3A 1TUGB 3LDOA 2K1RA 2CZ9A 1J6ZA 3SCKE 2PMHA 4OJHA 1K8KB 4K2JA 1RT2A 3BBBA 3DRYA 3UR3C 3NGDA 2K7JA 1N6QB 3Q2SC 2CQ1A 2LYVA 1DZ5A 3CCJS 3K5PA 2YH0A 2LQ9A 5BRDA 1WSRA 2OPRB 1UZHA 4QWAA 4M3UA 3DRPB 2XY8A 1IQZA 4LF8F 3UKUB 4I1TA 4LF4J 4LFAF 3V1QA 2V68A 3M2UA 3KK1A 4IDKA 1VRTA 2GV9A 2VG5B 1WC0A 2AJ0A 2M88A 2VFRA 4OJ1A 2CVEA 2O8BB 2VUGA 5A2QY 2HAIA 4X65K 1SH0A 4DL2A 1T05B 4NLVA 2Q1NA 5HP1A 4DTNA 5CYQB 2DPIA 4LF9F 4O0JA 3IA0A 3QGIA 2EX3A 4CI6A 4QAGA 5B8HA 3RAQA 2GC8A 1WC6A 2MYFA 1ASUA 1GTHA 1UVMA 4EYHB 1I1GA 2A1SA 1S1UA 1VQPN 4DN0A 2AIRB 4ZHRB 3LP0A 5CAAA 2F9JA 1DLOA 2WBMA 3BY5A 1U1KA 2O01C 3RMBA 4PQUB 4EBDA 1OH7A 1RDAA 3OVAA 3JSRA 1FT8A 1GOAA 2UV8G 2XLJA 3GPAA 4OPKA 4IJNA 1WOOA 4CGIA 2GIRA 4DR2J 1JJCB 1Z2LA 4GKKJ 1ZH5A 2HBQB 2DGSA 3UVJB 2WBRA 2FBVA 5DDPC 4BE0A 4X62F 2ADBA 1H2TZ 3VA0A 1UZDA 2Z1JA 4BRQA 4NXMF 1HR0F 2DNKA 2CH5A 2HVEA 2W7AA 4OFZA 3TAMA 3L2WA 3CJKA 3MX5A 3A3PB 4KHNA 5GAGI 4IG3B 2DXFA 4TYAA 2VGNA 2QXFA 3MDQA 3F44A 3RVCA 3AAQA 5JLFA 2Q79A 5T41A 5KT5A 1JLBA 1JIHA 4CZKA 4LSZB 2YNHB 1X8DA 3I0SB 2VG6A 4LIRA 4S0MA 2GVZB 3VGKA 3VZIA 4I2QB 4DV7J 5EXWA 3AV9A 1T6CA 1CXQA 3RJMB 1FVQA 2WSFC 3CCVS 5HJXA 2W6KA 2HHHK 4M3YA 4EZ9A 2AEJA 4USUA 4R25A 3K9KA 2HF3A 2OAUA 4K5RA 4ZVGA 1HHSA 3TWHA 1U2VA 2QKBA 3HVRA 4BRIA 4HHTA 1HUXA 4WFBQ 1TL3A 3MOJB 1PYTA 3OJUA 1RILA 3GE9A 4OGEA 2HF4A 3NOGA 4OX8A 2JZ5A 1WHWA 2R8IA 3VV2B 3MR5A 2D0PA 2DO4A 3NCQA 4LF8J 3HXMA 2B9XA 3U3YA 3FMBA 1GFWB 2NRZA 3P3DA 2IJNA 3LM9A 3TZZA 4DHVA 4HT5A 1UEVA 1K1SA 1N36J 5B0DA 5DRKA 4DR4J 2CYYA 4YHHF 5D15A 3K59A 1S3XA 3EJMA 2OIHA 4KTQA 4NA2A 3CMES 3FCVA 4JI4F 4HL9A 4F2SA 3LAMA 5AQTA 3AA8A 1BMQB 1WG5A 2DRBA 1Q79A 3O8WA 3A5NC 3NRBA 7FDRA 1YBUA 4BREA 1YZ7A 1W7WA 2HBYB 2HZCA 2E20A 3FC9A 4FXWA 4OPJA 4DMNA 4O44B 1E6YA 5CHIA 5FDLB 6AT1B 1KCFA 3WXMB 5KRTA 2IIHA 3M2RB 1NB2A 1B92A 4EI2A 2X7IA 4CZGA 3EE8A 3L7PA 1HQUB 5GAEU 3MMCB 1Y11A 1Q86O 2G2OA 4OX9J 1U09A 1RU1A 5KT3A 2WONB 1VQON 2OTLN 3D2FB 1J5OB 3VQTA 3C16A 1T7PA 2QSWA 5L1LA 4USJC 2D9PA 3M1VA 3DLKB 4FWQA 2RF2A 5IWAK 3A1YG 2GNKA 1VSFA 1K6YA 2G1HA 4QPXA 3FNNA 3IGVA 2W8LA 4O0IA 1U26A 4KYZA 2Q36A 4D3GA 3HO1A 2PMWA 1RCHA 4G1IA 2E1CA 5GMDA 2QWQA 3DI6A 1T9UA 3FBFA 4L6V3 1KVCA 3OFHA 3TTDA 3WHIA 1QTMA 1WELA 5A8WA 3RW7A 3MR6A 2PC6A 5GAHP 4O44A 4ZLNA 3CT9A 4CF9A 3NCPA 4ZP6A 3O9TA 3H3OB 3WEEB 3T1HF 1QVGM 4DMZA 4HKQA 2QSFA 3CJ5A 4NEYA 2YCHA 3AOCA 1EQMA 1HWKA 2XHBA 4R5PB 3OSNA 5CZVA 4XEIA 4PPDA 4F50A 2GMHA 1TYQB 3HHKA 4GC6A 3J80Y 4CGGA 2BJ1A 1CSJA 5E7OB 2BE9B 5L1KA 4JAXA 3RMCA 4NLSA 4UOFA 3OHRA 3MCOA 4F67A 5CYMA 3TVZA 1KS2A 1FXRA 1B4SA 4X4QA 3ZNJ1 2XI3A 2JEGA 1MLAA 4FJMA 2FC9A 2LXUA 3OBIA 2D0AA 3J81Y 4BDPA 1HNXF 5CYMB 2Z8QA 2UUAF 1VRUB 5EHHA 4OJGA 3TAPA 4TKTA 2QZ8A 4F3QA 2ZD1B 2C1EB 1RWUA 1HWJA 4I69A 2DR9A 2O8FB 4CBXA 1MMNA 1NKCA 1E6VB 2VDIA 2KVQE 2V7YA 4ZVPB 3D1QA 2J8SA 1SJ3P 2RN2A 3ZTPA 4J9UE 1ZBUA 4ZCMA 1C0UB 5ETPA 2OKQA 2KLAA 5T7LB 4CLYA 4HUFA 4U95A 3RSEB 1ZOTA 4HACB 1QSLA 4M5NA 4ISGA 3VGMA 2RKIB 3BBFA 4LUBA 4OKKA 2RRNA 3I9V9 5AXLA 4I64A 3V9UA 4CH7A 1IQTA 1RT3B 5AQQA 3O9SA 1LWFA 4OI1A 1UETA 3LGHA 4DUZK 4DL4A 3EZWA 3QFWA 1JXLA 4WZQA 1ATRA 2A3JA 1Y5IB 3AB4B 4KGKA 2DFFA 3DLEA 3CJKB 4LVOP 1QJHA 2B4PA 3IM9A 5F9LA 2AV5A 1UL3A 3T41A 1TL7B 1MN7A 1RAIB 4JP8A 3SLCA 1PAUB 4ZVTB 2DNQA 3FRYA 4CLZA 4B08A 4JI6J 1YJ9S 3HD1A 3WX4A 2XI2A 3CCSN 1H98A 2X3GA 1MWQA 3NS5A 1BHLA 2CNKB 3D54A 2YXLA 2QK9A 4W5RA 1YJUA 1YI2S 2PYLA 3LQVA 5DS7A 2KT5A 3R5AA 1O8BA 4PRFA 1RDWX 4USWA 1NEEA 2YH1A 2FSJA 2BE2B 2DCLA 3I5CA 3CC7N 3W60A 2I8EA 2KO1A 4XH4A 4FWRA 3V81B 3T1HJ 3CD6S 2MY8A 2IYIA 4JI0F 4CBUA 2ZBPA 3SCXA 2ROPA 1VIOA 4B3SK 3T6JA 3WEEA 1KQKA 1X0PA 2FB0A 2YNIA 1VQ8N 1RBAA 4E7KA 1LWEB 2YQ3A 3NP5A 1FWKA 2B6AA 1KVJA 4CERA 1ZM2A 2WCXA 4DPTA 4WXWA 1PJ5A 3R97A 2HHSA 3CGIA 4HVJA 2WAQD 3S7RA 4KB0A 4GKJK 2DR5A 4LF1A 4CYUB 1P8GA 1FJGJ 1TFYA 3CPEA 2UUAJ 3ULHA 4F04B 3SIPB 3PYFA 1GTEA 1O51A 3IKMA 2YI1A 2CH6A 2BE7D 4FWSA 1PJ7A 2DITA 5F1XA 4LF7J 5AE1A 2A10A 3TJ9A 1Q5VA 3C16B 4BC9A 3KD5E 2XG8A 4B9UA 2AKWB 1PKUA 4OKEA 1UFLA 4NLUA 1CJUA 2J9DA 1U1PA 5IM0A 1K73T 2OEJA 2LXIA 2HRTA 1NGJA 5ETKA 1LWCA 3QO9A 1MWMA 2Z58B 3FCHA 1Q82T 1XHZA 2XMVA 3LP0B 2C3MA 2QC3A 3WXJA 3M2RA 1VRUA 1VHIA 2YKNB 2MKYA 5JS1A 1FEEA 1F5BA 3AOBA 3C65A 3GLJA 1LWCB 1SXLA 2P6SA 2MHNA 2HZVA 1OQ6A 3GWCA 3QGPA 4FWLA 2EKYA 4LRFA 1JLCB 2MKIA 3TVKA 5KOXA 3FMWA 2PZSA 3H90A 4Q2MA 1X5TA 1CJKA 2VFVA 3MMVA 3ZEUB 1D9DA 4AFFA 3DLJA 5LSRA 1KTVA 3ENBA 5LL6d 2I6WA 3FLCO 5KPZA 4ED1A 3BGRB 3E2EA 2J6SA 5LJWA 3R5DA 2ITGA 1HYVA 3WIVA 3DLGA 4ZTFA 2E5GA 4NZ6A 4YDUA 4P52A 4UY85 2ZDPA 3H8YA 3OPKA 4MTPA 2UXCK 2UUBK 4DSKA 3TTFA 4QW8A 4OI4A 4JV0A 2M8DB 3IAS9 2J8AA 1XC9A 4V19X 2XNRA 2F8MA 3LZIA 5T14A 3DYAA 4FJIA 3TUJC 2B56A 1HKBA 2D1KA 3BZCA 4QPTA 3KLVA 1S0VA 4Q45A 5KFXA 3H3NO 3POTB 1T02A 1VC5A 1N32K 4JI5F 1SCJB 3CJBA 4I9QA 2FBYA 1NDLA 4JHDA 3EZOA 4ETXA 2B4UA 2W6LA 3B82A 1N34J 4WK3A 2BZ2A 5L1JA 4H0OA 3FBCA 3SJHA 5DZ7A 4FKXA 4LH5A 3V4IB 1TUUA 4FPIA 3EL2A 2RB7A 3VVUA 4X65J 1ATSA 2IDLA 3QERA 4LF7K 1UEUA 3ZSYA 2AZ3A 3MXHP 1EXQA 3ISZA 3NCRA 3J7YI 5KFMA 4CZIA 4K4WA 3DXBA 4ELTA 4CJ3A 4BBYA 2JSXA 2V67A 4LF4K 4KHYA 5EX0A 3MM8A 4CP5A 5DQGA 2V6AA 2RIJA 2R8GA 3W61A 1C0UA 5KG2A 1T9YA 3VA3A 4ZS6A 1RISA 5FRMA 4RW8B 2HSEB 4LF7F 3RMDA 1MMDA 1U49A 4EGLA 1VQLN 2QWMA 3QBXA 4DX7A 5BR9A 3SQOP 4AHUA 4L8RB 1RHUB 3CEDA 2WVFA 1FXDA 3JQMA 3MECA 3BO3A 3QEWA 4QZVB 2WOMA 3TU5A 1E4GT 3UKUA 1M5VC 2CG8A 1I3OB 1FRXA 4R0EA 2P9LA 2VQFK 1YBAA 2HNYA 4FL9A 2G4BA 1AYEA 2HS3A 2MMYA 2XS2A 3CQ8A 4AE5A 1R31A 1G1XA 4WFBL 4FDFA 4U96A 2KI2A 3MPYA 3HHEA 4H0TB 5E5NA 2L08A 4NASA 1SJRA 2V94A 4WIIA 1NLVA 4O5FA 3HFZB 4FS1A 1GLFO 1S6UA 5CYQA 3NGRA 1G7CB 3TQEA 4YR0A 2FTRA 4RG8A 4YB7A 4J9SA 2XZWA 3MEKA 3R3TA 2MKCA 2VKRA 4EMDA 5DG9A 1NH8A 4CJRA 2BW7A 1N5TA 1G15A 4ZITA 4K4XA 2Z1HA 2YX7A 2E7WA 2PGCA 2UUTA 5HMWA 3BSAA 3CC4S 1WAFA 4B1WB 3QRQA 3L6QA 2IGIA 2HHHJ 1YJ9N 5GAGU 1S10A 4ECUA 1X4FA 3ZC4A 1N32J 4KGXB 3P5BP 1C0TB 2GIFA 5E3QA 4G6VB 2CNOB 3OUYA 1B0VA 1X4EA 3IBFB 4FYVB 3M2UB 1X9JA 1KWMA 4NLDA 3GJRB 2KG1A 2E2OA 4Q0BB 5CE3A 3OVBA 3K57A 4HTIA 4NA1A 4U7UK 4IFVA 1YRUA 2ASYA 4YR3A 2KM8B 3IS9B 4MKYA 2QA1A 4ILHA 5TKYA 2ZGZA 3NF6A 4KHMA 3OYLA 1MSWD 3N4PA 1HNWJ 3DGVA 1GLEG 3OYNA 4BRAA 4BE2A 4ER8A 1RAJA 4X65F 5DG7A 3ZSOA 3C6UA 4DV1J 1I5OB 1A6LA 1JQGA 4YORA 4DUYK 1N5YB 2CA9A 4DTJA 2LP4A 2AX0A 3R3LA 3O4QA 1I6JA 1S77D 3NMAA 3VQDA 4L76A 4CLKA 4FM0A 3DLLL 5H1SQ 1XJWB 4ISEA 3H25A 3C6HA 1BQNA 4IR1A 2KDOA 3NL0A 3OUYB 2OUGA 3KTQA 1Z2ZA 4LF5J 4CJQA 1FJCA 2F8TA 3DCAA 4IEIA 1TL4A 4H5TA 4U67L 2QMWA 2OTLS 5IT9O 2H5IB 5EX3A 2NLWA 3VQPA 4RO0A 3HHLC 2B3TB 2P1JA 3L3VA 1U7LA 3W5ZA 3PSIA 4I6YA 3CM5A 3KLIA 5MAOA 3VF0B 4MK9A 5LXYA 1SI9A 5KFYA 2IDOA 2QFIA 1DRZA 3H5YA 4FWKA 1W2IA 4QJVA 3KVGA 1NNDA 5EWFA 1B7FA 1QAIA 3O3LA 2ZGYA 1NKBA 3CJ4A 3CCEN 2NRRA 3QT7A 1J27A 4PXBA 3PR5B 4URQU 2PIIA 2CQGA 2D41A 2XY5A 3NCIA 2X74A 4ZCLA 3G6YA 4Y34A 1SAZA 3KKSA 1W2BR 4E1JA 4OKJA 1Y7PA 1IG8A 5GAHU 3OYHA 2XMKA 4DV4J 1N8RT 1X5SA 5SUHA 4URGA 3C2PA 5C2GA 3O44A 1H38A 3W2VB 3VAFA 4KHRA 1RT1A 1QVFR 3UO0A 1M1KO 2FVRA 1Q86T 1NGHA 4MDBA 4DUYF 1RE1B 1TUVA 4EEYA 1RJJA 1FKAF 3FZKA 1CLFA 1S7HA 2R42A 3KD1E 4KV8A 4X66F 2VG7B 2RVJA 2QL5B 1JWWA 2KW4A 4A8MP 1RT2B 4LR7A 4DKWA 3NF8A 1NGCA 4C3LA 2GAGC 3J7A1 2O8EB 2Y0BB 2GAHC 3JB9k 2W2PP 4W90B 3QIOA 4XH5A 1RLDA 2MQLA 3IFRA 5HOOA 3R1LA 3LWLA 3NFAA 1KFSA 3UDVA 4KY3A 4F4ZA 1T3VA 4DR3F 3BQ0A 1FF2A 2RAQA 2P51A 3BGOP 4FZXC 2HKEA 4ZK7M 4JKAA 2AJQA 1IBCB 4B3RF 1Q7YO 2M2BA 1X5OA 3KNGA 3GIKA 2DY1A 4AQYF 4FK0A 4LSLA 3G6EN 2DGOA 3WNEA 2GFFA 1S4FA 3QLHB 2ZC3A 2M8HA 4NYOA 3KDNA 4FPBA 1TR0A 4KPYA 1HMVB 4MO5A 1NG9A 2QV6A 5C2CA 4ATNA 5FPNA 5JJBA 2HOEA 2PA3A 3BN4A 2VQEJ 4B9QA 1LW0B 4RW6A 1DHMA 3GCWP 1R0CB 1IR0A 2HLUA 4HCBA 2VASA 1X3NA 1CJUB 4ZP9A 5CA5A 3T3FA 1YBTA 1FDBA 3OL8A 1ACMB 3MM9A 5JMVA 3VZHA 3QFUA 1VQOS 1KQGB 3Q83A 3R1HA 3OYMA 1EZZB 4W4MA 3ZZZA 1W26A 1KD1T 4N41A 2W9CB 3NS7B 2UYTA 4JI0K 2L41A 4M3WA 1T44A 2HPUA 4PG7A 2FD2A 2ZVIA 3ZEUA 2QMUB 3TJAA 4JV5F 4O4GA 3H5UA 3M8PB 1TKTA 3ZXWA 2V8DA 3K8VA 4JI6K 4B1XB 2HVZA 3DRPA 5THWA 3A8IA 3CMEN 3DLHA 3OY9A 2VQFF 3HHDA 2BGGA 3P8BB 1VSHA 2HBMA 1SJ1A 3ILIA 5ETRA 3IAM9 2NRTA 2BUPA 1UVKA 2IHR1 4BG9A 2JDJA 3IUCA 5E3CA 3TR5A 1XMQJ 2OEMA 4DUYJ 4W5OA 5FRNA 2V2KA 4KAIA 3CJ7A 4ZDNA 2W4PA 3SV3A 2GJFA 5KPRA 3E9OA 1F3VA 1IBMF 2HWTA 2E1MC 4WJBA 4QYZK 4ID5A 3DOLB 3I4HX 2ZHOA 2VBWA 1HNZF 5B0GA 1HBMB 4W98A 3G8TA 4J5OA 2IRXA 5HLFA 1HR0J 4UQGA 3ETMA 2RRBA 2O8EA 2EFGA 3A13A 1WKJA 5D0GA 4EP5A 4KIAA 3EVOA 1GLBG 4H5NA 2CFXA 4C11B 1RT3A 1NK7A 3VF2A 2B4OA 2F1FA 4BRNA 1ZA2B 3HOSA 4RUHA 4C3MA 3R5GA 1ZYQA 4DV0K 3CCLN 3MN9A 5EOYA 2VBXA 4RW8A 3LPEA 2GS8A 3DFEA 2YWGA 2V9KA 3CCUS 2FXUA 2EKNA 3FGUA 2GX8A 2EFVA 1RDDA 4RX6A 2XWYA 1VCTA 4J2BA 2DKOB 4KR0B 1K47A 5IV4A 3ZT1A 2J0QD 3M8QB 2CQPA 5KFEA 2H9ZA 1LK5A 3OYJA 3QT5A 3N79A 3RBZA 3GP9A 2V50A 2YHXA 3FGVA 3UDCA 4I68A 4BY9C 3RMAA 5D0HA 4CHQA 2VB6A 5KGWA 4AUKA 4MT1A 3CD7A 1U4BA 3O9UA 5BR8F 3SV4A 1NJZA 1KR4A 5CZXA 1IH7A 3QLHA 2FLLA 4BDYA 3R8EA 2W8KA 1RWOB 4JI7F 2XEXA 1N36F 2HHXA 2MJUA 3KG4A 1AXQA 5GAEP 3QEPA 5C2DA 4KTZA 2YHWA 1SV5A 3EX7B 2AYEA 2VONA 3QRPA 2OFGX 4NO7A 2HRYA 4WZMA 2G9OA 4FVCA 3UKRA 1RWNB 2CXEA 1XR7A 1GMVA 4WU3A 1MG7A 2IFXA 4QR0A 3T1HK 1PG5B 4XDCA 1VDHA 3DI6B 2R7WA 2V4RA 2ZJRQ 2KU7A 3AVJA 2IY5B 2ACYA 1MU2A 4ICLA 2GHWA 3NGTA 3AQOA 2CGLA 1LWEA 2UXDF 5HBMB 5LY3A 4XAKA 3NAHA 2E1PA 2K3KA 3TTCA 2ZF5O 2ZJPQ 4ILLA 3GJQB 1QHAA 1RT5A 3JQJA 4FZVA 4OZJA 3CJ1A 1S4EA 3K2PA 1Q8IA 2FJVA 1CS4A 2OGUA 2Q0RA 4C0BA 4DS4A 3J80O 4JI2K 2ZFHA 3M9OB 3DXKB 3NGUA 2XGPA 4YOYA 4L3QA 4LJMA 4MH8A 4R8UA 3QBWA 2N82B 2A6AA 4G1QB 4IUFA 3J7ZO 4NX9A 2ZKTA 3IAYA 2IM2A 5LJ5Y 3OT9A 1C1CA 5J1PA 1U2CA 3FE1A 1WDTA 3TX0A 1NRKA 4GW6A 3ZTQA 1FNMA 3N6LA 2P9SB 5CY4A 2F9WA 2GUIA 1U2VB 4GV6A 2F4VJ 3THWB 3ZZ0A 2E2QA 4PYAA 3THXA 2GHPA 5ADXH 2EXUA 2FZGB 4MAKA 1RHQB 2QMXA 4MFBA 1OPZA 5MLCV 3CC2N 4JRQA 5J2PA 4CTAA 2Q66A 4ZP8A 4QR1A 1GLAG 4ED7A 1WTFA 2OPPB 1GT8A 1JLCA 3C7NB 4NPOA 3SXLA 5LJ3Y 4FPAA 4QOTA 6FDRA 1VOMA 3GILA 1NHVA 2A42A 2GBZA 2NRWA 4DR1J 3VQEA 2ZH6A 3QESA 4OVLA 3C7NA 4H0VB 3KWIA 2PFFB 2DXEA 5AQHA 2LEBA 2BVZA 4B9TA 1ITPA 4F7VA 2CJQA 1L3TA 4O5BA 1WKKA 2FQQB 3BYRA 4BRCA 2ZM6J 2P9LB 4DQQA 4CESA 3OL6A 5LMNK 3F56A 1SL2A 1VK0A 3MAHA 3B6BA 4Z2XA 2CKWA 1RFQA 4OLOA 4DR2F 1CC8A 3HPGA 4RW9A 1RWXB 2EC2A 4DPOA 1JNRB 3I4PA 2EHGA 2IIRA 2HK3A 3Q8PB 3ID8A 1VQ4N 2WB4A 4BRFA 1AUSL 2XYPB 2O8DB 4OZ5A 1WEYA 5I4MA 1XQSC 5FLXY 3V6JA 4M45A 3MFHA 5ELZA 2ZHBA 4USMA 4CF2A 4DUZF 5HSPA 1LKZA 3JSBA 1H3DA 2ZJQL 2ZH1A 2YJEA 3CFPA 2RKIA 4J9PA 1WC5A 2GELA 3CCWA 1I51B 4QYZJ 5JVHL 4HUEA 5D0RA 1VQ5S 1GNKA 3H2LA 3CG7A 1PGZA 1T3OA 1WG4A 2ROGA 1JKHA 1R8AA 4TQRA 2CQ3A 3FR0A 4CEAA 4R79A 2FJBB 1DEJA 3FSIA 3EYZA 1HKAA 1VQ4S 3NWRA 1VR6A 5IWAJ 1NPRA 4JUZA 3BKTA 4B1VA 1FRHA 3E01A 2DNMA 3A5MC 5L9NA 4FM1A 3W3DA 1BCMA 4DL0C 2ZWHA 2HBZB 3KHHA 5GMKa 3PDNA 2OANA 1AROP 5C2FA 5JICA 4ETZA 2CVIA 2DHSA 4FVMA 4O8KA 1PJ6A 4RUAA 2NZ4A 5E2QA 5GAHI 4ELVA 2F4VF 1F9HA 3HDSA 1H72C 2P9NA 4Z4GA 2NPFA 4LSLB 4YOEA 1QVFM 4DU1A 1PSDA 1X4BA 1NM2A 1Y5LB 2V8VA 3WUHA 2IVYA 3MN5A 1WSHA 3VEOA 4RW4A 2FJEB 1IBMK 2NUUG 1BDGA 4DFKA 1S1TB 4IOAQ 4MFBB 2IBOA 1VHXA 1YHQN 3EZUA 5D4PA 3MR2A 3UKRB 5M2UA 5L38A 4IDHA 2DPJA 3W7BA 4BC5A 3JXOA 3C0BA 3MD1A 4U7BA 2LSNA 1F0XA 3G6ES 2DBBA 3GDQA 2QJ3A 1S6QA 1RGIA 4JV5K 3CCMS 1U6FA 2B6AB 4K41A 4OX9F 1RB0A 2HIYA 3PKMA 4CTAB 4CIGA 2DHAA 1FJGF 3EICA 2VFSA 3NDKA 1KRPA 4ILRA 3I0RB 4NMXA 2W9CA 1IM6A 5L9XA 3X3UA 4F36A 1XNRK 2Z2LA 1LXNA 4ITSA 1PC5A 3F5TA 1RWPB 2IVPA 3ZSQA 1N54B 3KJVA 3A3OB 2F4FA 3AVAA 2H54B 3HFKA 3TEGA 2QT7A 3QBCA 1WOSA 2GX9A 3Q8UA 2LQ8A 4IFYA 5M1OA 1C4CA 2XMWA 4FJKA 1DBDA 1T9XA 1WUAA 3AVKA 1MN9A 3LANA 4ECSA 2JX2A 3RB4A 4DQPA 5HMXA 3K8WA 2V52B 2W2MP 1EWQA 1VHFA 3KXDA 5A76A 1CXUA 4MJKA 1J5EF 1BA0A 2RHSB 3JAMY 2C2MB 4Y2AA 1TMJA 4L75A 4J9NA 1TV6B 2Q43A 5DQHA 3H4DA 4USKA 3W66A 2CDQA 3MN7A 2GUPA 1B9DA 4NB4A 1FRJA 1JCFA 2WUSA 3NBPB 3W62A 1TKTB 2W2OP 4A57A 3TPQA 4J2EA 1TKXB 4OL8A 5J2QA 1HNXJ 3T7ZA 3KKRA 1VQ7N 3M8SA 3EKSA 1RABB 1XI1A 3EXYA 2GA7A 4JOUA 3V81A 1F5AA 1YIJN 2PDAA 3UDLA 4DR7J 1NHUA 3IRXB 4ES3A 3OR2B 1KDNA 3CJQA 1NOZA 4OYBA 2KZMA 2XMMA 2CWXA 2DNPA 4CHOA 2B51A 2QLFB 3QQCD 1FFWB 4OYPA 3PX0A 4CEDA 4FLWA 1N34F 4G3IA 2F7TA 2EW9A 2E5JA 1ICEB 1AB8A 2MSTA 3BSCA 4NE9C 5F8GA 3MMBA 1Q95G 3SK3A 4GKJJ 4MK7A 5ETLA 1XBWA 2P9PB 3OHAA 4XPCA 4YP3A 4J9QA 4JS4A 2QI2A 2AF6A 2J0SD 5AQJA 3BZKA 3TW0A 4YOTA 1BCOA 3MI7X 2MZRA 3WXIA 3J7AP 1GOBA 2MQ8A 4ZPWR 2VOPA 3QDKA 3C95A 3SFGA 4DV5J 4JKHA 3RBDA 3N5BA 4FBUA 1NJWA 2FUG9 1NWKA 2IBKA 2K3IA 1S12A 2VKZG 2Q0UA 1KVAA 3CO0P 1VBXA 1F1BB 3KHYA 1NM1A 2F5GA 3DLRA 1WDDA 2PAVA 1X31C 2E1ZA 2W2QP 3I0RA 3PO4A 1H74A 1EWRA 3OFFA 2NNWA 5KFPA 3OD2A 3M8PA 4LF8K 4RNMA 3GFZA 4ZCIA 1JXVA 1FFGB 1ZBTA 4GVBB 3OTOF 3FZBA 4I6WA 2MGZA 4YDDB 4CF0A 2OSQA 3ET6B 4MIWA 4CLWA 2XCPA 2IMWP 4DLEA 4DPWA 4NCGB 1RBLA 1B99A 4B9VA 4NZ7A 1BHNA 2R3VA 4CJEA 2V4JB 5FPMA 2I5JB 3DRXA 4WP8A 3OL7A 3RYLA 3Q0AA 4RNHA 4DFJA 4OX6A 4RKUC 3CETA 1RU2A 4NXMK 3BPDA 2R7UA 4CGDA 1Q8BA 5KFSA 2V2VA 3A4TA 1K8AO 5K5MA 5HANA 3ENAA 3CULA 1N36K 4DJBA 2Q6BA 3N0VA 2PFDA 4DV3J 2D5RA 2QN6B 4NLYA 2H1YA 1UPMB 3CIPA 3L4IA 5C7PA 4DU3A 3CDBA 3Q8YA 4Z4FA 4J9RA 2VJVA 4H5VA 4FWMA 4DQRA 2GCFA 4DSLA 3LZJA 1TL3B 5K9FA 4J90A 2XRIA 3QWUA 1R89A 4J9MA 4RPFA 3CSKA 4DX5A 2ZBQA 3PRVA 5F8MA 1LWFB 2AJ2A 3M2VA 1QAXA 1TL1A 1ZM4A 4IRKA 2LQBA 1GX5A 4WP3A 1IBLJ 5AZIB 3OTCA 3A2FA 1J53A 3ZZUA 1U1MA 2HLTA 1S72N 3H20A 4NZ0A 2Q97A 4Q8EA 3GSIA 2DY4A 1EX4A 3KG0A 3ZSRA 1XWLA 2MQPA 2OJ3A 3F73A 4BC4A 3DYAB 5AQIA 2ZC4A 3HVTB 4KGMA 5F9NA 4M5KA 1WI6A 3TQ1A 1FD8A 4LF2A 1I94K 1JLAB 2U2FA 1YSJA 3LPUA 1B9FA 1EIYB 2HQIA 4C6AA 2KVIA 3H98A 3W9IA 2I5JA 4HTJA 4UOHA 1FO1A 2ZBIA 5E3AA 4DV5F 1ZC6A 1YG0A 3SSQA 2JLEA 4ZOSA 2XLKA 2P9EA 3ZETA 3L7OA 1HNZK 3GE1A 4HDHA 4Y65A 3D6FB 3GBTA 4QS9A 1TFWA 2DIUA 4Y6IA 1HBUA 3HJVA 1SKRA 1CQMA 3KZBA 1XK8A 3P45B 3VQBA 4JLHA 2YKQA 3P5JA 4W5QA 1HR0K 4C11A 5EU7A 2ALYB 5I3UA 1L3SA 1URRA 5ETTA 2YX6A 3VQCA 4ED5A 2EG2A 2KN4A 4K42A 3UE5A 4PKGA 1CS4B 1K8AT 2HIQA 2FY8A 3W9JA 4K8XA 3FQKA 2Y1JA 1MDUB 1PC4A 4HTUA 4X2BA 2G2YA 3RBXA 1KNZA 5C25B 3KK7A 2ZOFA 3F41A 1S1WA 4CFDA 1UOCA 3VETA 1YJTA 3UD3P 1IV0A 2DTJA 3GJSB 3BGFA 2WOMB 5C25A 4MKBA 2M9KA 1DQ9A 2B5JB 3CE8A 2L9WA 1RYRA 2CJYB 2VPZB 2E29A 3U1NA 5LSOA 4UOGA 1T05A 3RB3A 5EUHA 1M5OC 5KG1A 4EFHA 2X78A 1G99A 2C22A 3M9NB 4QYRA 2Q3SA 4HLBA 3TP2A 4AHSA 1X5PA 1KAXA 1WAJA 3W1YC 2DEJA 3CJCA 2UXBF 2V2QA 1FTRA 1BQMB 5GADP 3R9LA 4FXVA 3UNYA 1G3OA 1WOPA 2KKZA 2LQJA 2PE8A 3LP3A 4ECYA 4MYTA 4AL7A 1JKHB 2BACA 4B1YB 1U45A 4PKIA 1IN0A 1WD6A 8ATCB 4YMEA 4ECRA 5CABA 2DGVA 3CXCR 1X9MA 4OHWA 4KV8B 4WYLA 1ELOA 1EQYA 1HI8A 1NBEB 3L9ZA 5AZIA 3O8MA 4OI6A 3G71N 3VPZA 2YTCA 1BUPA 2CPFA 4PY5A 2KZZA 3BF3A 3ENHA 3RR8A 3D7SB 1LXJA 1XR5A 3MCSA 2VG5A 1R0BG 4GNIA 3K0SA 3RG6A 3MCPA 3D1OA 4ES2A 1RTDA 2ASJA 5HQMA 5F0WA 1TYQA 3TAEA 3R2DJ 4JV1A 1VQ6N 1UP1A 3JSMA 1QSYA 4XK8C 3FEXB 3QEIA 3M6WA 3FZFA 3UCZP 1HYSA 1BD6A 4B17A 4J37A 2XB2D 2RPIA 1IWGA 2RMLA 4N77A 3C94A 3NH2A 1Y00A 2QIFA 1XNRF 1VQ9S 3U9ZA 2ZH3A 1ASWA 1OY9A 4CEFA 1YX2A 4NLRA 4AHTA 5C24A 3PHEA 2GGPB 5FIIA 2A40A 2RUSA 1JCEA 1NKEA 2HMIA 4O0NA 3C6AA 4QQBA 3PV8A 3M8RA 4NA3A 4WP9A 3ZT4A 4L3NA 1KTQA 3O6QA 1YJNN 3IO1A 2YNIB 3UWTA 5C12A 4TXSA 1HBNA 4QU6A 2B9YA 4F4YA 2DRDA 4DV1F 3PSFA 2VZ9A 1LOUA 2UVWA 3J81j 1WEZA 4ECXA 1AZSB 3MWBA 4TLRA 4ED0A 1XMQF 1HBNB 2EFPA 3AO1A 1B70B 1WJ9A 3SMZA 4CDIA 2Z0GA 3VQ4A 2HNDB 1CG2A 2GVZA 4WF9L 3BN7A 2H51B 3CTRA 3SCLE 2XMAA 1WI8A 4LF5F 3C15B 4BRPA 2HNYB 2MKSA 4J2AA 3PZPA 4V1Ak 1BIUA 1IKYA 5LMUK 1YDLA 1VC6A 3P38A 2J4RA 4EHUA 4O3NA 3RRHA 3UCGA 2X3DA 3ULEB 2R9LA 1FRKA 2BANA 3AD8C 5HMZA 1VBYA 2VG6B 4KC5A 1Z1ZA 5AXNA 2FC8A 2KRRA 2XO6A 1UW9A 2NREA 2FYXA 3R6GB 3AVNA 5KFIA 3HRGA 3OYIA 1X0FA 4H54A 2Z30B 1AZSA 2W25A 5IT0A 2N4CA 3CCJN 4CE9A 4K4TA 1M0SA 3D3CJ 2P9KB 1D0EA 2DGUA 2QLBB 3IN5A 4LF9J 3BM7A 1NK9A 2CNNB 2IAJA 4PG8A 2BBEA 2VBYA 4RW6B 1CJTB 1EKEA 3KWMA 4BC7A 2GIQA 3CW2C 3RRGA 4H0YB 5C10A 4DR6K 4XO0A 5DETA 3TUPA 3CD5A 1N6QA 4IOXA 3DAWA 3PG9A 3ELHA 2X6NA 3NF7A 5I3UB 1JL2A 2YNFA 2BTFA 2PI4A 1TL7A 4X66J 2OTJN 4F0MA 1WHYA 4AM7A 3MMCA 4LQ9A 1U24A 2ZZNA 3CJTA 1XNQF 4GKKF 4JI3K 1RWWB 3M30B 1Q53A 4JI7J 1WSIA 3GL1A 2ZE2B 3B8HA 1ZAXA 5HVGA 4OZ2A 1QZ5A 4WYWA 3CMQA 2QO3A 3VN5A 4JI3F 1HKCA 2P9KA 4FW1A 2IYGA 5HN0A 3NBPA 1IKVA 2J9DE 4LRAA 4QS7A 3DGPB 4ID5B 2N3OA 4QIVA 3CC4N 4CNZA 3BUZB 3L4BC 4MKAA 3QIPB 2DNZA 3VEXA 3O9QA 1FNXH 3EUNA 2L48A 2XLIA 3KK2B 2UU9F 3U1LA 3IGNA 5HJYA 2ASPA 1RK8A 4CECA 2XM3A 2C2DA 4A8WA 3QJJA 1VSEA 3T5KA 4TLQA 2JWLA 4IXCA 4ERDA 1M90T 4EHTA 3K5MA 4DV2K 3CCRN 1FVSA 5D8HB 4P73A 2HWIA 3IR6B 2A1BA 1RAGB 4CZMA 2OSRA 4ES1A 2DNLA 3CCRS 2GVDB 4M5GA 4BWJA 2MSSA 1G4CA 1L3VA 4E7HA 4N8NA 4ZPBA 5CH7B 3SCIE 1S0OA 3CYMA 2P9UB 2EFOA 3TUIC 3CCES 5HVHA 4CEQA 4ZLLA 3BR8A 1OQ3A 1XNQK 1WG1A 2DNYA 2HK2A 4ZVRB 3M4XA 4DTUA 4K4ZA 3O9RA 1T03A 3KK3B 1EO1A 3NVMA 5BN8A 1VMBA 3OYKA 3AVIA 2W4CA 1SUQA 4ANDA 4E2FB 3KIOA 4BC3A 3QGHA 5LMUJ 4XIUA 4AL6A 4BGAA 4I6MA 4M63C 2NZTA 1IBKF 4KSEB 2X6SA 1IJFB 5BRHA 3LL3A 1KHVA 4P7TA 1WSGA 1QTNB 4ISFA 4I7FA 3R5JB 3OXFA 1REVB 1FFSB 4J9LA 2R2SA 4RUBA 4CZHA 4HHUA 5BYRA 1HBOA 4P2XA 2C2NA 1NGFA 3UN3A 3MUTP 1WACA 5A8KA 1CJTA 5KQ8A 4YOWA 2GEMA 1HJOA 2AX1A 1KLNA 2GMLA 3MHYA 3KOAA 3PYGA 3CDUA 5DO2A 1RA6A 5GADU 2MKHA 2YKMA 4NLCA 9ATCB 4PQAA 3JTOA 3AJDA 1HNIA 2HZAA 2DGWA 4JD2A 4DUZJ 1PBAA 2FJWA 1D8YA 3DXMA 3NVKA 2BJ3A 1VFJA 3LAKA 4JNEA 1P8ZA 4DCOB 1HHTP 3B78A 4Y28C 2E9ZA 2M3DA 3CVKA 4FPRA 4Q7AA 2I7PA 4DV1K 2D0BA 3DMJB 1RHKB 2FZKB 2COLA 2L9NA 2XGQA 2HBLA 2XMTA 3THWA 3KLEB 4Q43A 4U7UD 3GYNA 1VQYA 3UN5A 3ZX3A 4PYDA 3GYGA 4CEZA 1F21A 3MCNA 3N01A 2YWFA 2J6TA 3PIPQ 2O5DA 3TUZC 2YWKA 4IH5A 3W0LA 4EP4A 4Z0UA 3PX6A 2AW0A 3H1VX 1JK9B 2R2RA 1VSKA 5LJVA 1TUWA 4PUOB 2JOQA 3MX2A 4LC9B 2U1AA 1HNIB 2NXNA 4O4GB 1B7YB 3OR1B 1KQFB 3TA1A 1FXLA 1SC6A 1EHWA 4AILC 2P9UA 3IG1A 1K0TA 2HVDA 4CF1A 4ECWA 4ILMA 4FN5A 4Z4EA 1LV5A 2A18A 2ILZA 4DHYA 2JVOA 2BQUA 4Z4IA 1S99A 3VMFB 3BGRA 4NRUA 4FJLA 1X4AA 1F2HA 4DN9A 1GMUA 1V5VA 5RUBA 1WHXA 5J1EB 3P4IA 1IKYB 4IO8A 3CJAA 2C2OB 4HR2A 1IBKJ 1LW0A 2Z1GA 1DY3A 3MCAB 4ZPVR 1IR1A 3DLLQ 4TY8B 5CR4A 4A47A 1UJ6A 2CPXA 3SBGA 1FJGK 4JKFA 3RB0A 3D3BJ 2LU2A 4O3SA 3LO3A 1HWIA 3IRWP 2LMIA 3RGIA 4GC7A 4CLLA 4OYXA 1J5OA 4K4UA 3C6UB 4UT4A 4DU4A 2E2NA 3ULDA 4M5DA 3DHWC 4IG0B 2QA2A 1H7WA 3VQQA 3AO3A 2QX0A 3LA0A 4DL6A 4IG0A 4WBFA 4K2XA 4UTGA 3FSXA 2DYAA 4A8FA 1JCGA 2HMIB 2FF3B 2FDNA 3UIQA 1KHWA 3GJTB 3T1AA 3AO5A 3OBYA 1URNA 1S79A 5EGYA 2O4GA 3PJ9A 4NWBA 4M63A 3B4DA 2AJ4A 4KHPJ 1HQ2A 4B9NA 4DPXA 2W7PA 3IXQA 3A12A 4CYUA 2HBRB 1U1NA 4FW2A 2DHXA 1F9FA 1EB0A 2QLJB 1RT7B 3LDPA 2AU0A 2DH8A 3JYTB 2DEIA 4C98A 4DUTA 2QWNA 4ZVHA 4DQ8A 1JLGB 5U47A 5M1QA 1Q1KA 2HFNA 3E9LA 1RAOA 2G8UA 2ZQBA