2P51A

Crystal structure of the s. pombe pop2p deadenylation subunit
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
255
Chain Sequence
SQISPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPCC18.06c protein
publication title The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase, gene regulation
total genus 89
structure length 255
sequence length 255
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p51A00
4FK2A 3CYMA 1Q8IA 2JGUA 5KTQA 1LAWA 3VQ7A 1LAVA 3EZ5A 4B9MA 3TAQA 3OYBA 1A5WA 4KI6A 4F3OA 4CK3A 3ZT4A 3SUQA 1S9EA 1I39A 4CJ3A 3TAGA 4ELVA 1BL3A 1KLNA 1JLAA 1Y97A 3G10A 4PA1A 4ELTA 4B3OA 3V1QA 3SNNA 3QIPA 3NAEA 1ZBUA 3VQ4A 5HRSA 1RBSA 4H4MA 4FXDA 1BCMA 1CZ9A 1BGXT 2YKNA 1U49A 3VQ5A 1RTHA 5FRMA 5E41A 4CK1A 4Z4HA 4KHUA 1RBUA 2YNHA 4W5TA 3S3NA 4W5RA 4JRPA 4FZZA 1ZBFA 4CHYA 1SKSA 3KTQA 3WNGA 4CFBA 4IKFA 2P51A 1TV6A 1ITGA 2WONA 3ASMA 1BQMA 2GUIA 3OYCA 3QESA 4FJ5A 3NF7A 3AO4A 2XY6A 3MXMA 4FM0A 2AJQA 3AVJA 3KK3A 1QE1A 2DFHA 2ZQBA 3L3VA 4M3YA 4N56A 3AVCA 1VSFA 4BWJA 1T8EA 4W5OA 3NH0A 1Z26A 3AVFA 2BDPA 4FYDA 1VSHA 2HMIA 5FRNA 1NK9A 2EHGA 3OS0A 3E01A 1NJWA 4CEOA 4CFAA 4Q0BA 4CEFA 3V4IA 5SZTA 4AHRA 2B4JA 3IG1A 4NYFA 3VN5A 4CJWA 3HPOA 3NGIA 2XRIA 4DU1A 4M3ZA 4BE1A 5HP1A 3TANA 3SQ2A 4N5SA 3OYEA 4J2BA 1EP4A 2PZSA 4DSKA 1LWCA 3RRHA 3O3HA 4IFYA 3L2QA 3SUPA 3SJJA 3V9ZA 1SL2A 2YNFA 4C8KA 2IGIA 4CJQA 2HNYA 4E7IA 3SPYA 1SV5A 3KLEA 5KGWA 4E1NA 1KFSA 2Z1JA 4DQRA 3AVKA 3HK2A 4ELUA 4ZHRA 4RW6A 3KLIA 3MEGA 4OGEA 3OYKA 1L3SA 1HJRA 4CHOA 3D45A 1SKRA 3HM9A 3KIOA 4C8MA 3VQEA 2HNZA 1J5OA 3C95A 4KO0A 2PYJA 2YV0X 1NJYA 3HVTA 2KFZA 4CEDA 2FC0A 3OYLA 4FJKA 4DTRA 1QSSA 1VRUA 2X6SA 4K8XA 1S9GA 3O3FA 4FJXA 1L3VA 1I3AA 1TKDA 4RW4A 2KTQA 1RBRA 1SUQA 4KPYA 2FBXA 4CGHA 1WNSA 3VQPA 2IDOA 3AVBA 2WOMA 3RR7A 4E7KA 2RKIA 4RW7A 4B08A 4DMNA 4QOZB 4Z0UA 4NCBA 4NCGA 3AVLA 1KVAA 3L8BA 4LY7A 3QERA 2OZMA 2HHUA 1EX4A 3LP3A 3QINA 4I2PA 4E7LA 3V9WA 1IKXA 2IC3A 2KFNA 4YFUA 1NK4A 4FK4A 2KZMA 3VQQA 5D3GA 5J1EA 2JLEA 4FK0A 1J53A 3HSTB 3CG7A 4MQ3A 4OJRA 1L3TA 2F96A 4M45A 4DTNA 1A5VA 4R5PA 5FDLA 1FK9A 3MECA 4GVMA 4EP5A 4CF9A 5HRNA 1TGOA 3RMAA 1ZYQA 1WLJA 4CGFA 1TK0A 5DK5A 3WNFA 3PO4A 3KKSA 1L3UA 4IFVA 2B5JA 4N76A 2A1SA 4RG8A 1WSEA 2Z1HA 3C6UA 3DOKA 4DG1A 3NH1A 4BACA 3HPGA 3V9XA 2Z1GA 1NKBA 1RTJA 1K6YA 3OYGA 3VQCA 4NYNA 4CJUA 1JL1A 3AO2A 4PUOA 3DRRA 4O0JA 2KW4A 4DU3A 3SZ2A 2P5OA 2HVHA 1SL1A 2G8UA 4FJHA 3NHGA 3B6PA 4B8CA 3OS1A 3HL8A 1D8YA 3K57A 1B9DA 4Z4GA 5JS1A 1T05A 1BIZA 4OKJA 4CJEA 3RRGA 2QXFA 1RCHA 4W5NA 2Q3SA 5J2QA 3VA3A 1X1PA 2YKMA 4DTMA 4F3TA 1HYZA 4I9QA 4FM2A 4F8RA 2D0BA 4FJIA 4OLBA 2F8TA 3THVA 1QS4A 2D0CA 3QEXA 3TR8A 1HMVA 2ZE2A 4ICLA 4M41A 4EZ6A 1EETA 1CZBA 1YTAA 3S3MA 3UIQA 3OJUA 2G8HA 1LV5A 1QQCA 4I9LA 3NF6A 4IG3A 4IG0A 2ITGA 1UOCA 2HB5A 4HCCA 1VSDA 2XY8A 3NDKA 3T3FA 3TI0A 4CF2A 4N47A 1ZBLA 4XIUA 4KHQA 3ZSXA 4UQGA 3NGZA 1X9SA 2XY7A 4FLVA 3AA2A 1ASUA 3NBPA 3ZT1A 1KVBA 3LWMA 5J2NA 4CF1A 3PY8A 1FXXA 1NK7A 4FJJA 3DLRA 4CFCA 4OVLA 3ALYA 5K14A 4HUGA 4DQSA 2FBTA 2RPIA 4CHPA 4FLXA 4M3WA 3I0SA 2HHWA 1JXBA 4N41A 2XO7A 3AVHA 3EYZA 3C94A 1JLGA 4YNQA 4M3TA 4G1QA 4K8ZA 4AHCA 4CGJA 4L8RB 3L2WA 4CIGA 3QIOA 5EU7A 1C6VA 2HHQA 4I2QA 3TWHA 3KLFA 1RT4A 5HRRA 3V6DA 1HQUA 4M42A 2OPQA 3T1AA 2W42A 1NJXA 1YTUA 3HYFA 2OA8A 3V1OA 3ZSRA 1S5JA 1RBVA 3OYFA 3KD5E 1G15A 3NGYA 3ZCMA 4CJ5A 3K59A 1NK0A 1C0UA 1UWBA 2E6MA 3VQ8A 4CEZA 3SI6A 4AH9A 4DQPA 1WN7A 4DF4A 1MU2A 4B9UA 1JL2A 3NCIA 4OPJA 2G8VA 1KRPA 4FJ7A 1BI4A 1XHZA 1TL3A 3G0ZA 1IKYA 1FKPA 1KVCA 1TAQA 2X6NA 4B9LA 3V9SA 3TAFA 4EZ9A 1RT7A 1U04A 2HHSA 4DU4A 2IAJA 5JS2A 1T7PA 4DQIA 4E1MA 3QLHA 4KREA 5KGXA 1ZBIA 4CEQA 1TKXA 1J9AA 4KTZA 1QHTA 1D9FA 3RMCA 1XWLA 1REVA 4IDKA 2ZD1A 4M3RA 1QTMA 1HPZA 4JRQA 2G8WA 4E19A 1HRHA 2O4GA 3LALA 1HNVA 2OPSA 2X74A 1RDBA 4E7JA 1RT5A 3SUNA 4O0IA 3CQ8A 1HQEA 2VWKA 1GOBA 1IO2A 2BE2A 4OLAA 5KI6A 4F4KA 2G8KA 4KHYA 1BHLA 4QAGA 3H08A 4KHSA 3SPZA 4E0DA 4RW9A 1S1VA 3V81A 2HHXA 4DF8A 3VA0A 2HVIA 3IS9A 3DRPA 4KKOA 4CCHA 4DSLA 3CFRA 3QEIA 4O5BA 3S9HA 1SKWA 4CE9A 4F2RA 1VSMA 1F21A 1YVUA 3ZT3A 1DTQA 3QO9A 4LSLA 4CFDA 3QETA 3M8SA 2DTUA 4IBNA 4HCBA 1RT6A 3ZSYA 4B9TA 4E7HA 4O55A 2FBYA 2B6AA 3DRSA 3AA5X 4B9SA 2HHTA 2IOCA 1GOAA 2BANA 4CHZA 4DSEA 2A1RA 1QSYA 3LAKA 1VSKA 4CF8A 3FFIA 4DSIA 4KHWA 1KSPA 4KI4A 4NCAA 1NOZA 4KTWA 3F73A 4FCYA 2GV9A 4FJMA 1WSJA 1KCFA 5KRSA 1IKWA 3SQ4A 3LP1A 4HUEA 1U47A 3ULDA 3OYIA 2NUBA 1FKOA 2F8SA 4CEBA 1RDDA 1S1WA 4BWMA 1UAXA 4CJLA 1TK5A 3LPUA 3O3GA 3KKRA 5I42A 1A5XA 5CYMA 4FLYA 4Z4IA 5SWMA 3T19A 3WNHA 3OYMA 4DTUA 3DYAA 3HP6A 3SUOA 3ZSVA 4FLWA 3OJSA 3DLEA 1CXUA 4E3SA 3PV8A 4CEAA 2R7YA 4ID5A 1RTIA 3BGRA 4FJ8A 3VQ6A 4KTQA 4JLHA 3P1GA 3RTVA 4B9VA 3AVAA 5DMRA 2RF2A 3AO1A 2I5JA 3K5OA 1BIUA 1U4BA 1X9MA 3HXMA 4O44A 4DLEA 4GW6A 4KFBA 4DLGA 3OYAA 3LZIA 3KLHA 1RT1A 1TKTA 2XY5A 1N6QA 3PO5A 4CHNA 2OYQA 4KRFA 4CHQA 1HYSA 3MXIA 2VG7A 1J54A 3HT3A 5KRTA 4DS5A 1TL1A 1C1AA 2OPRA 2LSNA 1BQNA 3SQ0A 3LP2A 1B9FA 1U45A 4B8AB 4FJNA 4AILC 1U48A 4RW8A 3LAMA 1LWEA 4MFBA 3PUFA 1W9HA 4FZYA 4LSNA 1XC9A 3DLKA 4OKKA 1KFDA 3ZSZA 1NJZA 4KB0A 4CEEA 3AVNA 4HTUA 3MEDA 2G8FA 4FJGA 4QCLA 4JS5A 4CJFA 1IH7A 3KJVA 3AVGA 1D9DA 4EP4A 4CJRA 3VQBA 4CJSA 3DLBA 2P5GA 4CIEA 3ZT2A 2IS3A 3ZSWA 4KHNA 1DTTA 1C1BA 3S3OA 3RWUA 3OYDA 1S1UA 3TARA 1RDAA 3QNNA 1XHXA 4J2EA 3AO5A 3BDPA 1X9WA 4AHSA 1RBTA 3DMJA 3SV3A 1Q9XA 1S6PA 1UA1A 1EKEA 4DFPA 4HVJA 3HP9A 3U3GA 4DSJA 4DWIA 2E4LA 2QK9A 5C42A 4FJLA 1L5UA 1TK8A 4BDYA 2XHBA 3D0PA 4FLTA 1VRTA 3A2FA 1JLBA 4GMJB 3L2RA 5C25A 2DY4A 1SL0A 3V9UA 1NKCA 1YT3A 3O4NA 3AV9A 3LANA 4CIFA 4HUFA 1RTDA 1JLFA 1TKZA 3C6TA 3K5NA 4FLZA 4KAZA 2Z1IA 4OKEA 3L2VA 1VSJA 3PX6A 4TSXA 3NFAA 3NF8A 3P83D 4M3XA 1Z25A 1ASVA 3AA4A 5CYQA 4BE2A 1WSFA 3HJFA 2HW3A 4FW1A 1TVRA 3K2PA 3OYJA 1JLQA 3ISNC 1KTQA 4OPKA 3L3UA 3HVRA 3LP0A 4DTOA 5J2PA 3ZSQA 3K5MA 3LWLA 3AVMA 1ZBHA 2FBVA 2YNGA 3O4QA 3I0RA 3MEEA 4JS4A 3I8DA 4CJ4A 1C0TA 3M8PA 2E6LA 3SYZA 3U6FA 4LD0A 3CM5A 4DTSA 3AO3A 2P1JA 1RILA 3IAYA 1WAFA 3DM2A 1D5AA 3JYTA 3SCXA 2QKKA 4Z4EA 4CGIA 3V1RA 2YHBA 4WE1A 4CK2A 2Y1IA 4ZTJA 1CXQA 4H4OA 4AHVA 1NK5A 4CJTA 1IG9A 2ETJA 3AVIA 1JXEA 2VG5A 3CM6A 3WNEA 1HYVA 4C8NA 2ATQA 3KK2A 4DS4A 3QNOA 5HBMA 5C24A 1XI1A 2PYLA 2DFFA 5FROA 4AHUA 3ZSOA 4DTJA 3OY9A 2OZSA 1VK0A 3DLGA 2KQ2A 3TAMA 4DTXA 1RDCA 4ID1A 4FJ9A 3AA3A 2KZZA 1VSEA 1W0HA 3OS2A 4PQUA 3RR8A 1Q9YA 4FLUA 3LPTA 1BISA 1JLCA 3ZT0A 2HHVA 1JLEA 4Q5VA 4DSFA 3TAEA 1KLMA 3VQ9A 1WSGA 4H8KA 4CF0A 3EY1A 3L2UA 1RT3A 3K58A 2HNDA 1WSIA 2YHAA 4DQQA 4C8LA 3LZJA 3RMBA 1ASWA 2D5RA 1GOCA 3CFOA 4Z4FA 1WSHA 1TAUA 1S1XA 3DLHA 4KB1A 3DOLA 3K5LA 3PX0A 2VG6A 2X78A 4Y1CA 4FM1A 2G8IA 4FZXC 3VQDA 2OPPA 1NK6A 3OYHA 3MAQA 1RNHA 4J2AA 3SV4A 1NOYA 3KK1A 3NF9A 4CERA 4W5QA 4DFMA 4B9NA 3HPHA 3QEPA 1QSLA 1LW2A 3IRXA 1NK8A 3M8QA 4FVMA 1VSLA 4BDPA 1IKVA 2RN2A 1S1TA 3DI6A 4J2DA 1B92A 3P5JA 4CECA 1EXQA 1JKHA 3U3YA 5HROA 1RT2A 4Z4CA 3RMDA 2O4IA 4FW2A 1S6QA 4CGDA 3PX4A 4PWDA 4OGCA 3MXJA 3B6OA 3OVNA 1WAJA 4HHTA 5J2MA 4KV8A 4Y1DA 2PY5A 4PY5A 1O1WA 2YNIA 4I7FA 4CJPA 4E89A 5HLFA 3HO1A 1C0MA 2EX3A 4LH5A 3ITHA 5CZ2A 4LH4A 5T7BA 5CY4A 4DFJA 3QEVA 3LDSA 3TAPA 4CJVA 3QEWA 1BCOA 1LWFA 2VWJA 1BI4B 3M8RA 4C8OA 1HNIA 3KLGA 2BGGA 5CZ1A 1R0AA 2DFEA 4BDZA 4DFKA 4ZTFA 3F9KA 1T03A 1CLQA 2GBZA 4F2SA 1UA0A 1C1CA 4AHTA 4CESA 4CJKA 3VQAA 2D0AA 4O4GA 4CGGA 3SQ1A 1NKEA 3OYNA 4BE0A 5I3UA 3KD1E 3TABA 1LW0A 2QKBA 1N5YA 3CFPA 2Y1JA 4M3UA 1DLOA 3NH2A 3JSMA 3NE6A 4DTPA 5HRPA 1VSIA
chains in the Genus database with same CATH superfamily
4BR0A 1ATNA 2JGUA 3TTFA 4BRMA 3L4IA 4AM6A 1LAVA 3EZ5A 2UXDK 1I39A 4CJ3A 3TAGA 2HF3A 2I7NA 3SNNA 3FR0A 5AQWA 1ZBUA 4BQLA 2YKNA 2A6AA 3VQ5A 5FRMA 4KHUA 5BRDA 2P9KB 4BR2A 4CHYA 1OH7A 3KTQA 4IKFA 2ZJRL 2WONA 2WTUA 3AO4A 1BU6O 4FM0A 3AVJA 4M3YA 2DFHA 4N56A 3AVCA 1V4TA 3AARA 3OS0A 4HWIA 4ISGA 3BZKA 5SZTA 4AHRA 4M7YA 2B4JA 4CJWA 3L0QA 2XRIA 4BE1A 3G71N 4N5SA 2PZSA 1LWCA 3RRHA 3O3HA 3KWGA 3V9ZA 5BPMA 4CJQA 4E7IA 4E1NA 5DM7L 4ELUA 2O8EA 3KLIA 1NBWA 3OYKA 1L3SA 3DWLA 1MA9B 2HBLA 1X9JA 3D45A 3KIOA 4C8MA 4WFBL 2HNZA 4H5RA 3C95A 2PYJA 2FC0A 1KAZA 3OYLA 4BC5A 2UUAK 2A3ZA 1S9GA 1L3VA 2KTQA 4V19S 4C1NI 2IDOA 1SS6A 3NVKA 4MO4A 2WOMA 1XNRK 2RKIA 4LFBK 4B08A 5IWAK 3UKRA 4BRDA 3QERA 2P9IB 3LP3A 3QINA 3ZX2A 4I2PA 4E7LA 3V9WA 1K8KA 4JKDA 4RTFD 5JVHL 4OO1J 3BY5A 5CR4A 3HSTB 3WEEB 1Q82O 2D4WA 2RHKA 3QBWA 3T69A 1A5VA 1FK9A 4GVMA 3MCPA 5HRNA 5DK5A 3PO4A 3KKSA 1C0GA 3KZBA 4CBXA 3CPEA 3CI5A 1RTJA 5JVGL 3QBXA 4CZIA 1JL1A 3DRRA 3A5LC 4PKHA 4EIAA 1NG9A 2NRTA 4FJHA 3NHGA 5JS1A 3J7ZO 3K57A 1B9DA 1BIZA 4OKJA 2QXFA 4PHTX 2EWSA 1X1PA 1Y64A 4JI2K 4DTMA 4I9QA 4F8RA 2D0BA 5M1OA 1QS4A 3UIQA 1CZBA 1JCGA 4DKWA 1QQCA 3NF6A 3OW2M 2HB5A 3AGRA 1VSDA 3NDKA 3T3FA 4CF2A 1ZBLA 5AQSA 3UKUB 4EAHD 3DXKA 2GWKA 1TUYA 3I8BA 3NBPA 3LWMA 3O08A 2FSJA 4OVLA 5BRHA 2FBTA 2RPIA 2HHWA 3VEYA 1JXBA 4PL7A 3C94A 4DV3K 4H03B 1JLGA 4M3TA 4FWPA 4G1QA 1BG3A 4AHCA 4JHDB 3QIOA 3TTCA 2HHQA 2P9UB 4M42A 1RT4A 2OPQA 3I33A 1NJXA 1YTUA 2OA8A 2HBJA 1NK0A 4CJ5A 1UWBA 1WN7A 1YIJN 2IVOA 1BI4A 3A5MC 1XHZA 3T7ZA 2UU9K 4X64K 4EZ9A 2IAJA 4B1ZA 3MMVA 1GLFO 3QLHA 4YOWA 1TKXA 1J9AA 2E2PA 3VEZA 3U9DA 3O6WA 4I6MB 4E19A 3LALA 2X74A 5M1QA 1RDBA 3SUNA 1QHAA 4O0IA 2VWKA 3GDQA 3M6GA 5GIPA 1GOBA 2BE2A 4DCHA 4MO5A 1BHLA 3H08A 5GAHP 2E1YA 3SPZA 1MWMA 4LF5K 5GAEP 3B8AX 4FWLA 4FL9A 2HVIA 3IS9A 4KKOA 4O5BA 4F2RA 1VSMA 4GKJK 3M8SA 4L3QA 1HX1A 3C6HA 3DRSA 4B9SA 2HHTA 4JK9A 1GOAA 2BANA 1QQMA 2W6LA 4DSIA 4BGAA 4KHWA 4KTWA 1IKWA 3SQ4A 1NGGA 1TUUA 1U47A 2F8SA 1UAXA 4CJLA 3LPUA 3HSCA 3O3GA 4LF6K 5SWMA 3EO3A 3O1WA 3HP6A 3AAPA 4FLWA 1OH5A 4B1UB 2ZF5O 3BGRA 4H5WA 4FJ8A 3FZLA 3VQ6A 1ATRA 3RTVA 4B9VA 3AVAA 5DMRA 2RF2A 1X9MA 3PIOL 3HXMA 4KFBA 3LZIA 4KHPK 3KLHA 1RT1A 1TKTA 2XY5A 4KRFA 4CHNA 1HYSA 3KHYA 1XQSC 2OPRA 5AZJB 1VQ5N 5BRFA 4BRCA 1B9FA 4B8AB 3PUFA 4B1WB 3IUCA 4IO8A 1NJZA 4KB0A 3E66A 3MEDA 1IV0A 4QCLA 3KJVA 1YUWA 3AVGA 4JKAA 2E20A 3VGKA 3N4QA 4CZJA 3ZSWA 2BUPA 3QNNA 3QFUA 3AO5A 1GLAG 2OTLN 4IOCL 1S6PA 1Q9XA 1UA1A 1EKEA 4HVJA 3M3ZA 5C42A 1TK8A 4G9ZA 1DT9A 2HMPA 2W6KA 4GMJB 2QM1A 5M1FA 3CC4N 3CQXA 1YI2N 3LANA 1VAZA 1CZAN 4BY9C 1JLFA 4BRLA 1VSJA 4M3XA 1Z25A 3HJFA 4BE2A 3OYJA 1KTQA 3CJAA 3L3UA 2ASMA 3HVRA 4DTOA 1WBDA 4WQ4C 3I0RA 3I8DA 1C0TA 3M8PA 2DPNA 4DTSA 3AO3A 1J6ZA 1HNZK 1D5AA 3JYTA 2QKKA 4Z4EA 4CGIA 2YHBA 4WE1A 5TKYA 4CK2A 4H4OA 4FO0A 4CW7B 3VF2A 2V51B 1JXEA 4FPBA 1T05A 2ATQA 2PYLA 3OY9A 1VK0A 3DLGA 4FJ9A 4CZHA 3OS2A 2VQFK 3VTIA 2W41A 1BISA 3ZT0A 2VWBA 3VQ9A 2YCHA 4GVEA 5F2RA 2FLOA 5EXWA 5AQPA 1ASWA 3CFOA 1S22A 1VQON 1TAUA 1HPMA 3K5LA 1W2BM 3R8EA 4FZXC 3O9QA 3LDNA 2GTDA 4KH4A 4J2AA 3NF9A 5EX5A 5M1KA 3JS6A 3VGLA 1GLCG 4CZEA 4BDPA 1IKVA 4JKBA 1GLDG 1S1TA 3DI6A 3QMLA 1EXQA 2I7PA 3U3YA 3VEVA 5HROA 1RT2A 3RMDA 4FW2A 4CGDA 4OGCA 3B6OA 3HO1A 5HLFA 4DR5K 2E5LK 5T7BA 1Z05A 1VQ7N 1R0AA 4DFKA 2QWMA 2IVNA 3VQAA 2D0AA 4H5VA 2BH1A 3SQ1A 3TABA 3WXIA 3NMUA 4BC3A 3ZETB 3ZEUA 3EL2A 4CI6A 5AQQA 1VSIA 3CYMA 1VQPN 5AQGA 4AF1A 1LAWA 2QI2A 3VQ7A 4YDUA 2HHHK 1VQ8N 2YJEA 4LF8K 3CCSN 1S9EA 1OVYA 4CVNE 4OX9K 2D1KA 1Y97A 4J8FA 1NJIO 3QIPA 3ATUA 1HNWK 4H4MA 3G6EN 2P9LB 4JKCA 1BCMA 4FXDA 1CZ9A 1E4FT 1RTHA 2YNHA 3S3NA 4W5RA 1ZBFA 1SKSA 3WNGA 2A41A 1TV6A 3ASMA 2GUIA 3CPWM 2P9SA 2ZQBA 4BWJA 3A5NC 1VQ4N 1C0FA 3SAHA 1VSHA 2HMIA 5FRNA 1NK9A 2EHGA 3CJ7A 3E01A 4CEOA 4CFAA 4CEFA 4BG9A 3IG1A 3MDQA 3LDOA 4M3ZA 1KAXA 5HP1A 4FWRA 2GELA 3SQ2A 4FSVA 3OYEA 3L2QA 3OBWA 1YHQN 4C8KA 1GLJO 2OTJN 2IGIA 5E84A 4KBOA 3SPYA 1SV5A 2Z1JA 4DQRA 3AVKA 3J80O 2F9WA 3A8YA 5AQUA 1HNXK 5AZIA 4M7XA 1J5OA 2YV0X 2KFZA 2YX6A 4CEDA 4PKGA 4FJKA 3VEWA 1VRUA 4FJXA 3A0IX 4JKGB 4JI4K 2WFBA 1HUXA 2NLXA 1RDWX 5FPMA 4JI3K 4AQYK 1X3NA 3WUHA 3BF1A 3RR7A 4RW7A 2P9KA 1JCFA 4Z0UA 2HHUA 4LY7A 2OZMA 1EX4A 2ASOA 3IDHA 1IKXA 1NU0A 3VQQA 5J1EA 3SBGA 4OJRA 1M1KO 3ENBA 3J7YP 1EWRA 1ZXOA 5FDLA 1YAGA 3MECA 4EP5A 2NRZA 1GLLO 3RMAA 3SBTA 1TK0A 1VQMN 1NGHA 3MN5A 1WOQA 4N76A 2A1SA 4DR2K 3EN9A 3NH1A 2Z1HA 2YJFA 3C6UA 3DOKA 3IKMA 4DG1A 1NKBA 3H45C 1K6YA 3OYGA 4FPAA 1RGIA 4NYNA 5EY4A 3AO2A 4CJUA 5ADXA 4PUOA 5ELZA 2Q1NA 3WQTA 1SL1A 3OS1A 3HL8A 1D8YA 5FPEA 3WQUA 2Q0RA 1RCHA 3C7NB 4H5TA 2E2NA 2F7TA 2GUPA 5AQNA 3FLCO 4DUZK 3THVA 3EEQA 5GINA 3FFKB 2OCEA 3JXUA 3TSUA 1HMVA 1NGDA 2PBDA 1YTAA 1P8ZA 4I9LA 3SK3A 4WFAL 1UOCA 4HCCA 3IFRA 1MWKA 2FSKA 3F5TA 4N47A 2O8FB 2YHYA 4UQGA 3NGZA 2XY7A 4B1XB 3EKSA 5AQXA 1ASUA 1KVBA 4A2AA 5J2NA 3MX2A 3D2EB 1VQNN 1FW6A 1FXXA 4CFCA 2P9IA 4PL8A 4M3WA 1GLEG 3HBTA 3I0SA 2QWRA 3FE1A 4CGJA 2VQEK 4MDBA 3V6DA 2FF6A 1HQUA 2A40A 1T6CA 3V1OA 3ZSRA 5C2FA 1S5JA 5IT9O 1RBVA 3KD5E 1G15A 3K59A 3SI6A 1XMQK 2E6MA 4ISFA 3CD6N 1MU2A 1JL2A 4JD2B 4FJ7A 2VYPA 2X6NA 3TAFA 4ILGB 5C12A 4YOTA 1W7AA 5JS2A 4JNEA 4E1MA 3CF5L 3R3LA 5KGXA 1N36K 4CEQA 4XH1A 3Q7BA 1D9FA 3RMCA 5GAGP 2ZD1A 4JRQA 3HM8A 1HNVA 4IJNA 1HQEA 4F4KA 3WXJA 4E0DA 2HHXA 1JCEA 3QEIA 4HTLA 2O8DA 1DTQA 3QO9A 4GNIA 1RT6A 4B9TA 4BRAA 2FBYA 4CBUA 1NLVA 3FZMA 1QSYA 1EQYA 2QWPA 1VSKA 4KI4A 4FJMA 3F73A 1WSJA 5AQYA 4A61A 1DGKN 3LP1A 4HUEA 3GE1A 4XH5A 3D2FA 4FLYA 4Z4IA 3OYMA 4DTUA 3DYAA 3SUOA 3MCAB 3ZSVA 1V4SA 3H1QA 4FVUA 5F1XA 1N34K 5AFUA 2I5JA 3THYA 2P9NA 4A2BA 3S41A 3TSPA 3DXMA 3MWTA 3PO5A 4CHQA 1J54A 4I6MA 2IIRA 3LP2A 1U45A 5AQFA 4FJNA 3CCQN 1U48A 4X62K 3LAMA 1OKJA 4FZYA 2YHXA 4X65K 2E8AA 3DLKA 4OKKA 3VETA 1XC9A 3AVNA 1SZ2A 5A2QO 4JS5A 2Q0UA 2O8EB 3DLBA 4KHNA 3QB0A 1DTTA 1C1BA 3OTOK 1E3MA 1I94K 3TARA 3BDPA 4AHSA 3F2KA 3SV3A 2ASPA 5AR0A 3HP9A 3U3GA 2QK9A 1L5UA 4JN4A 4CZMA 4DV6K 2WC9A 2NRRA 4JK8A 2DY4A 3V9UA 1NKCA 2CGKA 3O4NA 4GY2B 3UKRB 1TKZA 4BG8A 4FLZA 3L2VA 1FJGK 3PX6A 3WXKA 1K8KB 1G99A 1ASVA 5CYQA 3THXB 3M1FA 2ITMA 1ZBHA 3HRGA 4JKFA 5ADXH 4YY3K 5LMNK 4K25A 3SYZA 1NNEA 3VOVA 2D0PA 3DM2A 2Y1IA 1SAZA 3MN6A 2Q2RA 4BRGA 2VG5A 1U2VB 3CM6A 3KK7A 4BRQA 4DS4A 4X66K 1NGEA 5FROA 4BRHA 2O8CA 3E9OA 4DTXA 4DV2K 2PAVA 4ID1A 3AA3A 2KZZA 1VSEA 1LOTB 3RR8A 1TYQA 4FLUA 2AP1A 4U67L 4YOXA 1KLMA 1LCUA 4O8KA 4CF0A 4DV7K 3CCRN 1WSIA 2YHAA 3LZJA 3VEOA 1K8AO 1GOCA 2CGJA 4JI1K 4Z4FA 1WSHA 4JV5K 3DLHA 3L6QA 2VG6A 3R1XA 2BTFA 3MAQA 4H0VB 1ZBSA 4CERA 4DFMA 4JKHA 3QEPA 3C0BA 1NK8A 3M8QA 4FVMA 2QWNA 2RN2A 1WBBA 4J2DA 4BR4A 4Z4CA 4BVPA 5J2MA 5LL6Z 4PY5A 3P39A 4LH5A 3W3DA 3O4WA 5C0YA 1BCOA 1HLUA 3SMPA 2VWJA 1BI4B 1HNIA 2DFEA 3ZX0A 2GBZA 4F2SA 4AHTA 4CESA 3E9PA 5GIOA 4CGGA 2Y1JA 4DV4K 5HRPA 4AM7A 4CEBA 3MK6A 2FXUA 5KQDA 2WBNA 4B9MA 3OYBA 1IBLK 4B3SK 3E1YA 4F3OA 3SUQA 2V7YA 1BL3A 1JLAA 4B3OA 3V1QA 4OPHA 3VQ4A 1RBSA 3M5RA 2QEXN 5BPNA 1BGXT 1X3MA 1U49A 5E41A 4CK1A 4Z4HA 1RBUA 4W5TA 4BC2A 3BF3A 1ITGA 3OYCA 3QESA 4FJ5A 2O8BB 2XY6A 2AJQA 3O9TA 2NZTA 3KK3A 4FWOA 3L3VA 1VSFA 3CCEN 4W5OA 4A62A 1Z26A 3AVFA 3O9UA 2BDPA 5BPLA 4DR6K 2CGLA 4IOAL 3V4IA 3SMSA 4DU1A 2F4VK 3TANA 3VTHA 4DSKA 3SUPA 3SJJA 1NM1A 2YNFA 3CCUN 3F9MA 4BREA 4CZGA 2HNYA 3KLEA 3HK2A 5KPRA 2KLAA 3MEGA 3AGKA 1HJRA 1SKRA 3VQEA 3WXMB 4B1VA 4KO0A 1QQNA 1NJYA 2D0OA 2P9PA 4DTRA 3ZYYX 1QSSA 2X6SA 1I3AA 4RW4A 1RBRA 1YVNA 4CZKA 3PLAA 1N33K 3AVBA 3CIPA 4A5BA 4NCGA 3AVLA 4K42A 4NLBA 3L8BA 1BA0A 2IC3A 4FK4A 1NK4A 3K9KA 2KZMA 2WUSA 5D3GA 3DLLL 2JLEA 4WQ5A 1J53A 4MQ3A 1XUPO 1EWQA 2F96A 3HZ6A 4R5PA 1NGBA 1HKGA 2VGNA 3GBTA 4FOEA 1ZYQA 1WLJA 4CGFA 4DR4K 3R6MA 4C1NK 3WNFA 3QICA 5MLCQ 4IFVA 2B5JA 5HL7L 4RG8A 3CJBA 3V9XA 2Z1GA 3UB5A 1YXQA 4O0JA 3RSEA 2KW4A 4DU3A 3SZ2A 4IO9L 2HVHA 3B6PA 1HKBA 4B8CA 1HR0K 4BGBA 2ZM6K 4XH4A 2Q3SA 5J2QA 4LF4K 2YKMA 4FM2A 5KPZA 2F8TA 2CH5A 3H46O 3TR8A 5M1NA 1EETA 3S3MA 3OJUA 5LJVA 4ILJA 1LV5A 4WFNL 3LM9A 2KKZA 2ITGA 4R79A 5AQLA 2W40A 4XIUA 3RVCA 4KHQA 1E4GT 4FLVA 3AA2A 1KD1O 3ZT1A 3OBYA 1KC8O 4H5NA 4FWNA 4DV5K 3DLRA 4Y0WA 2UUBK 4CHPA 5AJ3K 3G25A 3EE9A 5JLFA 2XO7A 1Q18A 5EOYA 4L8RB 3L2WA 4CIGA 3CC2N 3TWHA 5HRRA 3ZLJA 3T1AA 2W42A 4B3MK 1ATSA 3HYFA 4IOXA 3OYFA 3NGYA 4RCHA 4DQPA 1C0UA 3VQ8A 4CEZA 5DM6L 4AH9A 4DF4A 4B9UA 3NCIA 2G8VA 1KRPA 4DB3A 3P38A 1SQKA 4RWTA 1TL3A 3G0ZA 1IKYA 4B9LA 1XNQK 1N32K 1H1VA 1U04A 2HHSA 4DQIA 1W97L 1ZBIA 3C7NA 4KTZA 3CJ1A 5KPTA 1QHTA 4IDKA 4M3RA 1QTMA 1HPZA 1HRHA 4NXMK 2OPSA 2A42A 4E7JA 1KQSM 1BO5O 4OPAA 3UE5A 4OLAA 5KI6A 2G8KA 4QAGA 2O8FA 5B8HA 4RW9A 4DF8A 5C15A 4CBWA 4CCHA 3CFRA 3S9HA 1SKWA 3ZT3A 2DTUA 4YDUC 3AAQA 4IBNA 3ZEUB 3ZSYA 4E7HA 4O55A 3AA5X 2IOCA 4B3TK 4DSEA 4CHZA 4FWKA 2A1RA 1IJJA 4CF8A 3FFIA 1K73O 1KSPA 4NCAA 4FCYA 2QWLA 3OYIA 1FKOA 3WT0A 4E1JA 1S1WA 1YITN 4IJAA 1TK5A 3KKRA 2E2QA 5I42A 5E26A 1A5XA 3WNHA 1VQKN 2OANA 4WF9L 1CXUA 4C23A 5JICA 3PV8A 1RTIA 4H0PA 3CHWA 4CZLA 4GV6A 4KTQA 5AQVA 3P1GA 4FWQA 4XEIA 1VQ9N 3W0LA 3K5OA 1BIUA 1BA1A 4M63C 1U4BA 3U9ZA 3ATVA 4DLGA 3J81O 2VG7A 3HT3A 4DS5A 1TL1A 1C1AA 2LSNA 1BQNA 3SQ0A 4RW8A 3O9RA 1LWEA 3CCMN 3T1HK 1W9HA 4LSNA 2Q36A 3ZSZA 4MLEA 4CEEA 4HTUA 2G8FA 3TPQA 3LDPA 1KXPA 3H6EA 2ZGZA 3VQBA 4CJSA 2ZJPL 4CIEA 2IS3A 3OYDA 1S1UA 1RDAA 4YOVA 1XHXA 4J2EA 3MN7A 1RBTA 3DMJA 3EE8A 4DFPA 4DSJA 4B1YB 3NVMA 3WEEA 2PFUA 4BDYA 2QW9A 3O8MA 3D0PA 4FLTA 3CCVN 4BRNA 1YT3A 4K41A 4CIFA 3THWB 4MDAA 2J4RA 3DJCA 3DAWA 2Z1IA 4OKEA 3T1YK 3NF8A 3EZWA 1WSFA 3VMFB 1EO1A 4QS7A 5AQHA 3GL1A 3ZSQA 3AVMA 2FBVA 3O4QA 3SJHA 1WB9A 3MEEA 4YOYA 4CJ4A 4BC4A 3ID8A 3U6FA 4LD0A 3CM5A 3TU5A 2KHOA 1BUPA 1RILA 2P1JA 3IAYA 1WAFA 3BUZB 4IEIA 5AQZA 1CXQA 4AHVA 2ETJA 4C8NA 3ULEB 3UKUA 5AQIA 5HBMA 5AQJA 5C24A 3I56N 1XI1A 2DFFA 4BVOA 3ZSOA 5BR8K 4DTJA 2UUCK 4FWSA 3TAMA 1Q7YO 1NMNA 4B3RK 1W0HA 3OA9A 4PQUA 3QFPA 4DSFA 3TAEA 1WSGA 3L2UA 4JHDA 2HNDA 4DQQA 4C8LA 3H3OB 2D5RA 2P9UA 2YI1A 1N8RO 1S1XA 4KB1A 5JLHA 4Y1CA 2X78A 4EHTA 3VESA 1ILYA 5F0XA 3BEXA 2NRHA 1NK6A 3OYHA 4JEPA 4DQ8A 3HOTA 3KK1A 4W5QA 3TSQA 4B9NA 3FZHA 3HPHA 4NB4A 1ZC6A 1LW2A 3P4IA 3IRXA 3CMEN 3THXA 1OH8A 2ZWHA 5AQTA 1BOTO 1QZ6A 3P5JA 4CECA 4FOIA 4BRFA 2O4IA 1S6QA 1WUAA 4PWDA 3MXJA 3OVNA 4HHTA 2JWLA 3SAFA 4KV8A 4Y1DA 1S72N 3LDLA 1O1WA 4CJPA 1C0MA 2EX3A 3ITHA 3O80A 4EHUA 4LH4A 4DFJA 5CY4A 5C2DA 3QEVA 3TAPA 3ZX3A 3QEWA 2QWQA 3KLGA 5CZ1A 1U2VA 4BR7A 3F9KA 1CLQA 1UA0A 3FZFA 1S3XA 3VF4A 4CJKA 4O4GA 1J5EK 3OYNA 4BE0A 2QKBA 3CFPA 4M3UA 4F9OA 2ZJQL 3JSMA 3NE6A 4DTPA 5FPNA 4FK2A 1Q8IA 3PIPL 2JWKA 5KTQA 2GEMA 1GLBG 4DV0K 4DV1K 3TAQA 1A5WA 5KQ8A 4KI6A 4CK3A 3ZT4A 5BR9A 5EVZA 4ELVA 5HOOA 1KLNA 3G10A 4ELTA 4PA1A 3NAEA 2VGMA 5HRSA 1K9MO 4LF7K 4DR3K 3ENHA 2O8DB 4FZZA 5AQMA 4O5FA 3J8AA 4JRPA 4GV9A 1HKCA 2CH6A 4CFBA 2P51A 1BQMA 2VCPA 2UYTA 3NF7A 3MXMA 1QE1A 1T8EA 3NH0A 4FYDA 5AQKA 3D2FB 1NJWA 4Q0BA 1R59O 4UY8O 3O1BA 1VQLN 4NYFA 3FZKA 3VN5A 4JI7K 5AZJA 5AQOA 3HPOA 3NGIA 1M90O 4J2BA 3TTDA 1EP4A 4IEEA 4IFYA 1O13A 1T3VA 4CD3A 1SL2A 1NWKA 3VEXA 3J7AP 3THYB 5KGWA 1KFSA 4DR1K 3H1VX 2P9NB 4ZHRA 4RW6A 3MX5A 1T44A 3WXLA 1KAYA 4OGEA 3DXMB 1NGJA 4CHOA 3HM9A 5LJWA 3HVTA 3ENOA 5AQRA 4K8XA 3O3FA 1TKDA 2UXBK 1SUQA 2E88A 3DXKB 4KPYA 2FBXA 4CGHA 4PKIA 3PSFA 1WNSA 3LDQA 3VQPA 4A5AA 4FWMA 2FF3B 4BROA 4E7KA 1NGIA 3VGMA 4DMNA 4QOZB 4NCBA 1KVAA 4YORA 2KFNA 3KVGA 4YFUA 3QDKA 2O8BA 3CCLN 4FK0A 1Q81O 1IBMK 3CG7A 2NRXA 3VF6A 1L3TA 4BRPA 1NGCA 4M45A 4DTNA 1T6DA 1P90A 4CF9A 1TGOA 5TKWA 4DHYA 5FPDA 1L3UA 3H3NO 1WSEA 4BACA 4WQ4A 4A57A 1VHXA 3HPGA 5H1SQ 3VQCA 3IMXA 1OVQA 1QZ5A 2P5OA 2G8UA 3SLCA 4Z4GA 4CJEA 3RRGA 3C65A 4W5NA 3VA3A 3CC7N 4F3TA 1HYZA 4FJIA 4OLBA 2HF4A 2D0CA 3QEXA 3JAMO 2GX9A 3CJ9A 2ZE2A 4ICLA 4M41A 4EZ6A 1NMDA 3CMAN 2G8HA 4IG3A 4IG0A 3ID6A 2XY8A 3TI0A 3CETA 1YJWN 2IVPA 4K43A 3ZSXA 1X9SA 2O8CB 3A5OC 3U8XA 3AY9A 4CF1A 1ESVA 3PY8A 1NK7A 4FJJA 3ALYA 5K14A 4HUGA 4DQSA 4FLXA 1TYQB 1YJ9N 4N41A 3EYZA 3AVHA 4YNQA 4K8ZA 4YHHK 2AA4A 5EU7A 1C6VA 4I2QA 3KLFA 4DR7K 4IWVA 5BREA 1MDUB 1XMOK 4JKEA 5CHIA 3CCJN 3ZCMA 5AFUH 4A59A 4JI6K 3FGUA 4OPJA 2E2OA 1KVCA 1FKPA 1TAQA 3V9SA 4BRKA 1RT7A 2H3GX 4DU4A 4QS9A 1T7PA 4KREA 3HOSA 5LMUK 1XWLA 1REVA 3ZETA 1Z6RA 2G8WA 2O4GA 1BDGA 1RT5A 3CQ8A 3GOIA 1IO2A 4KHYA 4KHSA 2RE2A 3L4QA 3EKUA 1S1VA 3LL3A 3V81A 3VA0A 1QQOA 2P9LA 3BZCA 3DRPA 4DSLA 4CE9A 1F21A 1YVUA 1U6ZA 3G4SN 4LSLA 4CFDA 3QETA 4HCBA 2B6AA 3PSIA 4IZ9A 1RFQA 3GG4A 3LAKA 4BR9A 1NOZA 4BRIA 2GV9A 1KCFA 5KRSA 2UXCK 3ULDA 2NUBA 2HSTA 1NGAA 1RDDA 3Q7CA 4BWMA 1VQ6N 5CYMA 3T19A 4NXNK 3OHRA 3OJSA 3DLEA 2QA4N 4E3SA 2HBMA 1JJ2M 2ZGYA 1Q86O 4CEAA 2R7YA 4ID5A 3VERA 1IBKK 4JLHA 1DEJA 3AO1A 2E1ZA 4O44A 4GW6A 3OYAA 4JI8K 1N6QA 2OYQA 3MXIA 5KRTA 5LY3A 4JYAK 1HJOA 4LFAK 4AILC 4GKKK 4MFBA 4DUYK 2NNWA 1KFDA 4FJGA 5GADP 4JKGA 4CJFA 1IH7A 1OH6A 4CZFA 1D9DA 5I9EB 3CXCM 4EP4A 4CJRA 4EFHA 4GV3A 4JI5K 4JK7A 2P5GA 5M1PA 3ZT2A 3S3OA 3RWUA 1X9WA 4NLCA 2NRVA 2P9PB 4DWIA 2E4LA 4FJLA 4WYBA 1BWFO 2XHBA 1VRTA 3LM2A 1XC3A 3A2FA 1JLBA 3L2RA 5C25A 1SL0A 2V7ZA 4IFEA 1QVGM 1QVFM 2FSNA 3AV9A 3HI0A 3O5BA 4WQ5C 3D7EO 4HUFA 1RTDA 3I55N 3C6TA 3KWIA 3K5NA 4KAZA 3BP8A 4TSXA 3NFAA 4YOUA 3P83D 3AA4A 2HW3A 4JAXA 4FW1A 1TVRA 3K2PA 2QXLA 1JLQA 3ISNC 3K9JA 5J2PA 4OPKA 5FLXO 3LP0A 3K5MA 3LWLA 2YNGA 4JS4A 2F9TA 2E6LA 1D4XA 3K0SA 2QTDA 1RDUA 3N4PA 3SCXA 5CE3A 3V1RA 1NK5A 4KH5A 4ZTJA 2HOEA 4CJTA 1IG9A 2NRWA 4H0YB 3AVIA 3RSEB 3WNEA 3KK2A 1HYVA 3QNOA 4AHUA 3O9SA 4QS8A 2OZSA 2KQ2A 3HTVA 2Q97A 1RDCA 5BN9A 3D6RA 3D2EA 4LFCK 4H0TB 4H0OA 1Q9YA 5C10A 4LF9K 3CQYA 3LPTA 1JLCA 2HHVA 1JLEA 4Q5VA 2V52B 3EY1A 4H8KA 4JI0K 1RT3A 4CJ7A 3K58A 3VPZA 3RMBA 3DOLA 4K0KK 3PX0A 2G8IA 4ISEA 4NO7A 4FM1A 1NGFA 3VQDA 2OPPA 1RNHA 4U7BA 3SV4A 3THWA 1YJNN 1NOYA 4WCEL 2QWOA 4JD2A 3CJCA 1QSLA 2A5XA 3CERA 1VSLA 4KH6A 1B92A 4CD1A 4IXCA 2P9SB 1JKHA 3R9PA 4O8UA 3E9LA 4H0XB 4B9QA 3PX4A 1WAJA 1DKGD 2PY5A 2YNIA 4I7FA 4E89A 4IDHA 3MN9A 5CZ2A 2Q31A 3LDSA 2YHWA 4BR5A 4CJVA 4LC9B 2HBKA 1LWFA 2GWJA 1IG8A 3M8RA 4C8OA 2BGGA 4BDZA 1YF5L 4ZTFA 3ULEA 1T03A 3VENA 5BN8A 1C1CA 4BQZA 3SAGA 4Z94A 4ILHA 1NKEA 5I3UA 3KD1E 3MWPA 1LW0A 5JMVA 3P31A 1N5YA 4MLHA 1DLOA 3NH2A 4DLEA 5AZIB 3U4LA 3C6AA
chains in the Genus database with same CATH topology
4FK2A 3CYMA 1Q8IA 2JGUA 5KTQA 1LAWA 3VQ7A 1LAVA 3EZ5A 4B9MA 3TAQA 3OYBA 1A5WA 4KI6A 4F3OA 4CK3A 3ZT4A 3SUQA 1S9EA 1I39A 4CJ3A 3TAGA 4ELVA 1BL3A 1KLNA 1JLAA 1Y97A 3G10A 4PA1A 4ELTA 4B3OA 3V1QA 3SNNA 3QIPA 3NAEA 1ZBUA 3VQ4A 5HRSA 1RBSA 4H4MA 4FXDA 1BCMA 1CZ9A 1BGXT 2YKNA 1U49A 3VQ5A 1RTHA 5FRMA 5E41A 4CK1A 4Z4HA 4KHUA 1RBUA 2YNHA 4W5TA 3S3NA 4W5RA 4JRPA 4FZZA 1ZBFA 4CHYA 1SKSA 3KTQA 3WNGA 4CFBA 4IKFA 2P51A 1TV6A 1ITGA 2WONA 3ASMA 1BQMA 2GUIA 3OYCA 3QESA 4FJ5A 3NF7A 3AO4A 2XY6A 3MXMA 4FM0A 2AJQA 3AVJA 3KK3A 1QE1A 2DFHA 2ZQBA 3L3VA 4M3YA 4N56A 3AVCA 1VSFA 4BWJA 1T8EA 4W5OA 3NH0A 1Z26A 3AVFA 2BDPA 4FYDA 1VSHA 2HMIA 5FRNA 1NK9A 2EHGA 3OS0A 3E01A 1NJWA 4CEOA 4CFAA 4Q0BA 4CEFA 3V4IA 5SZTA 4AHRA 2B4JA 3IG1A 4NYFA 3VN5A 4CJWA 3HPOA 3NGIA 2XRIA 4DU1A 4M3ZA 4BE1A 5HP1A 3TANA 3SQ2A 4N5SA 3OYEA 4J2BA 1EP4A 2PZSA 4DSKA 1LWCA 3RRHA 3O3HA 4IFYA 3L2QA 3SUPA 3SJJA 3V9ZA 1SL2A 2YNFA 4C8KA 2IGIA 4CJQA 2HNYA 4E7IA 3SPYA 1SV5A 3KLEA 5KGWA 4E1NA 1KFSA 2Z1JA 4DQRA 3AVKA 3HK2A 4ELUA 4ZHRA 4RW6A 3KLIA 3MEGA 4OGEA 3OYKA 1L3SA 1HJRA 4CHOA 3D45A 1SKRA 3HM9A 3KIOA 4C8MA 3VQEA 2HNZA 1J5OA 3C95A 4KO0A 2PYJA 2YV0X 1NJYA 3HVTA 2KFZA 4CEDA 2FC0A 3OYLA 4FJKA 4DTRA 1QSSA 1VRUA 2X6SA 4K8XA 1S9GA 3O3FA 4FJXA 1L3VA 1I3AA 1TKDA 4RW4A 2KTQA 1RBRA 1SUQA 4KPYA 2FBXA 4CGHA 1WNSA 3VQPA 2IDOA 3AVBA 2WOMA 3RR7A 4E7KA 2RKIA 4RW7A 4B08A 4DMNA 4QOZB 4Z0UA 4NCBA 4NCGA 3AVLA 1KVAA 3L8BA 4LY7A 3QERA 2OZMA 2HHUA 1EX4A 3LP3A 3QINA 4I2PA 4E7LA 3V9WA 1IKXA 2IC3A 2KFNA 4YFUA 1NK4A 4FK4A 2KZMA 3VQQA 5D3GA 5J1EA 2JLEA 4FK0A 1J53A 3HSTB 3CG7A 4MQ3A 4OJRA 1L3TA 2F96A 4M45A 4DTNA 1A5VA 4R5PA 5FDLA 1FK9A 3MECA 4GVMA 4EP5A 4CF9A 5HRNA 1TGOA 3RMAA 1ZYQA 1WLJA 4CGFA 1TK0A 5DK5A 3WNFA 3PO4A 3KKSA 1L3UA 4IFVA 2B5JA 4N76A 2A1SA 4RG8A 1WSEA 2Z1HA 3C6UA 3DOKA 4DG1A 3NH1A 4BACA 3HPGA 3V9XA 2Z1GA 1NKBA 1RTJA 1K6YA 3OYGA 3VQCA 4NYNA 4CJUA 1JL1A 3AO2A 4PUOA 3DRRA 4O0JA 2KW4A 4DU3A 3SZ2A 2P5OA 2HVHA 1SL1A 2G8UA 4FJHA 3NHGA 3B6PA 4B8CA 3OS1A 3HL8A 1D8YA 3K57A 1B9DA 4Z4GA 5JS1A 1T05A 1BIZA 4OKJA 4CJEA 3RRGA 2QXFA 1RCHA 4W5NA 2Q3SA 5J2QA 3VA3A 1X1PA 2YKMA 4DTMA 4F3TA 1HYZA 4I9QA 4FM2A 4F8RA 2D0BA 4FJIA 4OLBA 2F8TA 3THVA 1QS4A 2D0CA 3QEXA 3TR8A 1HMVA 2ZE2A 4ICLA 4M41A 4EZ6A 1EETA 1CZBA 1YTAA 3S3MA 3UIQA 3OJUA 2G8HA 1LV5A 1QQCA 4I9LA 3NF6A 4IG3A 4IG0A 2ITGA 1UOCA 2HB5A 4HCCA 1VSDA 2XY8A 3NDKA 3T3FA 3TI0A 4CF2A 4N47A 1ZBLA 4XIUA 4KHQA 3ZSXA 4UQGA 3NGZA 1X9SA 2XY7A 4FLVA 3AA2A 1ASUA 3NBPA 3ZT1A 1KVBA 3LWMA 5J2NA 4CF1A 3PY8A 1FXXA 1NK7A 4FJJA 3DLRA 4CFCA 4OVLA 3ALYA 5K14A 4HUGA 4DQSA 2FBTA 2RPIA 4CHPA 4FLXA 4M3WA 3I0SA 2HHWA 1JXBA 4N41A 2XO7A 3AVHA 3EYZA 3C94A 1JLGA 4YNQA 4M3TA 4G1QA 4K8ZA 4AHCA 4CGJA 4L8RB 3L2WA 4CIGA 3QIOA 5EU7A 1C6VA 2HHQA 4I2QA 3TWHA 3KLFA 1RT4A 5HRRA 3V6DA 1HQUA 4M42A 2OPQA 3T1AA 2W42A 1NJXA 1YTUA 3HYFA 2OA8A 3V1OA 3ZSRA 1S5JA 1RBVA 3OYFA 3KD5E 1G15A 3NGYA 3ZCMA 4CJ5A 3K59A 1NK0A 1C0UA 1UWBA 2E6MA 3VQ8A 4CEZA 3SI6A 4AH9A 4DQPA 1WN7A 4DF4A 1MU2A 4B9UA 1JL2A 3NCIA 4OPJA 2G8VA 1KRPA 4FJ7A 1BI4A 1XHZA 1TL3A 3G0ZA 1IKYA 1FKPA 1KVCA 1TAQA 2X6NA 4B9LA 3V9SA 3TAFA 4EZ9A 1RT7A 1U04A 2HHSA 4DU4A 2IAJA 5JS2A 1T7PA 4DQIA 4E1MA 3QLHA 4KREA 5KGXA 1ZBIA 4CEQA 1TKXA 1J9AA 4KTZA 1QHTA 1D9FA 3RMCA 1XWLA 1REVA 4IDKA 2ZD1A 4M3RA 1QTMA 1HPZA 4JRQA 2G8WA 4E19A 1HRHA 2O4GA 3LALA 1HNVA 2OPSA 2X74A 1RDBA 4E7JA 1RT5A 3SUNA 4O0IA 3CQ8A 1HQEA 2VWKA 1GOBA 1IO2A 2BE2A 4OLAA 5KI6A 4F4KA 2G8KA 4KHYA 1BHLA 4QAGA 3H08A 4KHSA 3SPZA 4E0DA 4RW9A 1S1VA 3V81A 2HHXA 4DF8A 3VA0A 2HVIA 3IS9A 3DRPA 4KKOA 4CCHA 4DSLA 3CFRA 3QEIA 4O5BA 3S9HA 1SKWA 4CE9A 4F2RA 1VSMA 1F21A 1YVUA 3ZT3A 1DTQA 3QO9A 4LSLA 4CFDA 3QETA 3M8SA 2DTUA 4IBNA 4HCBA 1RT6A 3ZSYA 4B9TA 4E7HA 4O55A 2FBYA 2B6AA 3DRSA 3AA5X 4B9SA 2HHTA 2IOCA 1GOAA 2BANA 4CHZA 4DSEA 2A1RA 1QSYA 3LAKA 1VSKA 4CF8A 3FFIA 4DSIA 4KHWA 1KSPA 4KI4A 4NCAA 1NOZA 4KTWA 3F73A 4FCYA 2GV9A 4FJMA 1WSJA 1KCFA 5KRSA 1IKWA 3SQ4A 3LP1A 4HUEA 1U47A 3ULDA 3OYIA 2NUBA 1FKOA 2F8SA 4CEBA 1RDDA 1S1WA 4BWMA 1UAXA 4CJLA 1TK5A 3LPUA 3O3GA 3KKRA 5I42A 1A5XA 5CYMA 4FLYA 4Z4IA 5SWMA 3T19A 3WNHA 3OYMA 4DTUA 3DYAA 3HP6A 3SUOA 3ZSVA 4FLWA 3OJSA 3DLEA 1CXUA 4E3SA 3PV8A 4CEAA 2R7YA 4ID5A 1RTIA 3BGRA 4FJ8A 3VQ6A 4KTQA 4JLHA 3P1GA 3RTVA 4B9VA 3AVAA 5DMRA 2RF2A 3AO1A 2I5JA 3K5OA 1BIUA 1U4BA 1X9MA 3HXMA 4O44A 4DLEA 4GW6A 4KFBA 4DLGA 3OYAA 3LZIA 3KLHA 1RT1A 1TKTA 2XY5A 1N6QA 3PO5A 4CHNA 2OYQA 4KRFA 4CHQA 1HYSA 3MXIA 2VG7A 1J54A 3HT3A 5KRTA 4DS5A 1TL1A 1C1AA 2OPRA 2LSNA 1BQNA 3SQ0A 3LP2A 1B9FA 1U45A 4B8AB 4FJNA 4AILC 1U48A 4RW8A 3LAMA 1LWEA 4MFBA 3PUFA 1W9HA 4FZYA 4LSNA 1XC9A 3DLKA 4OKKA 1KFDA 3ZSZA 1NJZA 4KB0A 4CEEA 3AVNA 4HTUA 3MEDA 2G8FA 4FJGA 4QCLA 4JS5A 4CJFA 1IH7A 3KJVA 3AVGA 1D9DA 4EP4A 4CJRA 3VQBA 4CJSA 3DLBA 2P5GA 4CIEA 3ZT2A 2IS3A 3ZSWA 4KHNA 1DTTA 1C1BA 3S3OA 3RWUA 3OYDA 1S1UA 3TARA 1RDAA 3QNNA 1XHXA 4J2EA 3AO5A 3BDPA 1X9WA 4AHSA 1RBTA 3DMJA 3SV3A 1Q9XA 1S6PA 1UA1A 1EKEA 4DFPA 4HVJA 3HP9A 3U3GA 4DSJA 4DWIA 2E4LA 2QK9A 5C42A 4FJLA 1L5UA 1TK8A 4BDYA 2XHBA 3D0PA 4FLTA 1VRTA 3A2FA 1JLBA 4GMJB 3L2RA 5C25A 2DY4A 1SL0A 3V9UA 1NKCA 1YT3A 3O4NA 3AV9A 3LANA 4CIFA 4HUFA 1RTDA 1JLFA 1TKZA 3C6TA 3K5NA 4FLZA 4KAZA 2Z1IA 4OKEA 3L2VA 1VSJA 3PX6A 4TSXA 3NFAA 3NF8A 3P83D 4M3XA 1Z25A 1ASVA 3AA4A 5CYQA 4BE2A 1WSFA 3HJFA 2HW3A 4FW1A 1TVRA 3K2PA 3OYJA 1JLQA 3ISNC 1KTQA 4OPKA 3L3UA 3HVRA 3LP0A 4DTOA 5J2PA 3ZSQA 3K5MA 3LWLA 3AVMA 1ZBHA 2FBVA 2YNGA 3O4QA 3I0RA 3MEEA 4JS4A 3I8DA 4CJ4A 1C0TA 3M8PA 2E6LA 3SYZA 3U6FA 4LD0A 3CM5A 4DTSA 3AO3A 2P1JA 1RILA 3IAYA 1WAFA 3DM2A 1D5AA 3JYTA 3SCXA 2QKKA 4Z4EA 4CGIA 3V1RA 2YHBA 4WE1A 4CK2A 2Y1IA 4ZTJA 1CXQA 4H4OA 4AHVA 1NK5A 4CJTA 1IG9A 2ETJA 3AVIA 1JXEA 2VG5A 3CM6A 3WNEA 1HYVA 4C8NA 2ATQA 3KK2A 4DS4A 3QNOA 5HBMA 5C24A 1XI1A 2PYLA 2DFFA 5FROA 4AHUA 3ZSOA 4DTJA 3OY9A 2OZSA 1VK0A 3DLGA 2KQ2A 3TAMA 4DTXA 1RDCA 4ID1A 4FJ9A 3AA3A 2KZZA 1VSEA 1W0HA 3OS2A 4PQUA 3RR8A 1Q9YA 4FLUA 3LPTA 1BISA 1JLCA 3ZT0A 2HHVA 1JLEA 4Q5VA 4DSFA 3TAEA 1KLMA 3VQ9A 1WSGA 4H8KA 4CF0A 3EY1A 3L2UA 1RT3A 3K58A 2HNDA 1WSIA 2YHAA 4DQQA 4C8LA 3LZJA 3RMBA 1ASWA 2D5RA 1GOCA 3CFOA 4Z4FA 1WSHA 1TAUA 1S1XA 3DLHA 4KB1A 3DOLA 3K5LA 3PX0A 2VG6A 2X78A 4Y1CA 4FM1A 2G8IA 4FZXC 3VQDA 2OPPA 1NK6A 3OYHA 3MAQA 1RNHA 4J2AA 3SV4A 1NOYA 3KK1A 3NF9A 4CERA 4W5QA 4DFMA 4B9NA 3HPHA 3QEPA 1QSLA 1LW2A 3IRXA 1NK8A 3M8QA 4FVMA 1VSLA 4BDPA 1IKVA 2RN2A 1S1TA 3DI6A 4J2DA 1B92A 3P5JA 4CECA 1EXQA 1JKHA 3U3YA 5HROA 1RT2A 4Z4CA 3RMDA 2O4IA 4FW2A 1S6QA 4CGDA 3PX4A 4PWDA 4OGCA 3MXJA 3B6OA 3OVNA 1WAJA 4HHTA 5J2MA 4KV8A 4Y1DA 2PY5A 4PY5A 1O1WA 2YNIA 4I7FA 4CJPA 4E89A 5HLFA 3HO1A 1C0MA 2EX3A 4LH5A 3ITHA 5CZ2A 4LH4A 5T7BA 5CY4A 4DFJA 3QEVA 3LDSA 3TAPA 4CJVA 3QEWA 1BCOA 1LWFA 2VWJA 1BI4B 3M8RA 4C8OA 1HNIA 3KLGA 2BGGA 5CZ1A 1R0AA 2DFEA 4BDZA 4DFKA 4ZTFA 3F9KA 1T03A 1CLQA 2GBZA 4F2SA 1UA0A 1C1CA 4AHTA 4CESA 4CJKA 3VQAA 2D0AA 4O4GA 4CGGA 3SQ1A 1NKEA 3OYNA 4BE0A 5I3UA 3KD1E 3TABA 1LW0A 2QKBA 1N5YA 3CFPA 2Y1JA 4M3UA 1DLOA 3NH2A 3JSMA 3NE6A 4DTPA 5HRPA 1VSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK2 A;  3CYM A;  1Q8I A;  2JGU A;  5KTQ A;  1LAW A;  3VQ7 A;  1LAV A;  3EZ5 A;  4B9M A;  3TAQ A;  3OYB A;  1A5W A;  4KI6 A;  4F3O A;  4CK3 A;  3ZT4 A;  3SUQ A;  1S9E A;  1I39 A;  4CJ3 A;  3TAG A;  4ELV A;  1BL3 A;  1KLN A;  1JLA A;  1Y97 A;  3G10 A;  4PA1 A;  4ELT A;  4B3O A;  3V1Q A;  3SNN A;  3QIP A;  3NAE A;  1ZBU A;  3VQ4 A;  5HRS A;  1RBS A;  4H4M A;  4FXD A;  1BCM A;  1CZ9 A;  1BGX T;  2YKN A;  1U49 A;  3VQ5 A;  1RTH A;  5FRM A;  5E41 A;  4CK1 A;  4Z4H A;  4KHU A;  1RBU A;  2YNH A;  4W5T A;  3S3N A;  4W5R A;  4JRP A;  4FZZ A;  1ZBF A;  4CHY A;  1SKS A;  3KTQ A;  3WNG A;  4CFB A;  4IKF A;  2P51 A;  1TV6 A;  1ITG A;  2WON A;  3ASM A;  1BQM A;  2GUI A;  3OYC A;  3QES A;  4FJ5 A;  3NF7 A;  3AO4 A;  2XY6 A;  3MXM A;  4FM0 A;  2AJQ A;  3AVJ A;  3KK3 A;  1QE1 A;  2DFH A;  2ZQB A;  3L3V A;  4M3Y A;  4N56 A;  3AVC A;  1VSF A;  4BWJ A;  1T8E A;  4W5O A;  3NH0 A;  1Z26 A;  3AVF A;  2BDP A;  4FYD A;  1VSH A;  2HMI A;  5FRN A;  1NK9 A;  2EHG A;  3OS0 A;  3E01 A;  1NJW A;  4CEO A;  4CFA A;  4Q0B A;  4CEF A;  3V4I A;  5SZT A;  4AHR A;  2B4J A;  3IG1 A;  4NYF A;  3VN5 A;  4CJW A;  3HPO A;  3NGI A;  2XRI A;  4DU1 A;  4M3Z A;  4BE1 A;  5HP1 A;  3TAN A;  3SQ2 A;  4N5S A;  3OYE A;  4J2B A;  1EP4 A;  2PZS A;  4DSK A;  1LWC A;  3RRH A;  3O3H A;  4IFY A;  3L2Q A;  3SUP A;  3SJJ A;  3V9Z A;  1SL2 A;  2YNF A;  4C8K A;  2IGI A;  4CJQ A;  2HNY A;  4E7I A;  3SPY A;  1SV5 A;  3KLE A;  5KGW A;  4E1N A;  1KFS A;  2Z1J A;  4DQR A;  3AVK A;  3HK2 A;  4ELU A;  4ZHR A;  4RW6 A;  3KLI A;  3MEG A;  4OGE A;  3OYK A;  1L3S A;  1HJR A;  4CHO A;  3D45 A;  1SKR A;  3HM9 A;  3KIO A;  4C8M A;  3VQE A;  2HNZ A;  1J5O A;  3C95 A;  4KO0 A;  2PYJ A;  2YV0 X;  1NJY A;  3HVT A;  2KFZ A;  4CED A;  2FC0 A;  3OYL A;  4FJK A;  4DTR A;  1QSS A;  1VRU A;  2X6S A;  4K8X A;  1S9G A;  3O3F A;  4FJX A;  1L3V A;  1I3A A;  1TKD A;  4RW4 A;  2KTQ A;  1RBR A;  1SUQ A;  4KPY A;  2FBX A;  4CGH A;  1WNS A;  3VQP A;  2IDO A;  3AVB A;  2WOM A;  3RR7 A;  4E7K A;  2RKI A;  4RW7 A;  4B08 A;  4DMN A;  4QOZ B;  4Z0U A;  4NCB A;  4NCG A;  3AVL A;  1KVA A;  3L8B A;  4LY7 A;  3QER A;  2OZM A;  2HHU A;  1EX4 A;  3LP3 A;  3QIN A;  4I2P A;  4E7L A;  3V9W A;  1IKX A;  2IC3 A;  2KFN A;  4YFU A;  1NK4 A;  4FK4 A;  2KZM A;  3VQQ A;  5D3G A;  5J1E A;  2JLE A;  4FK0 A;  1J53 A;  3HST B;  3CG7 A;  4MQ3 A;  4OJR A;  1L3T A;  2F96 A;  4M45 A;  4DTN A;  1A5V A;  4R5P A;  5FDL A;  1FK9 A;  3MEC A;  4GVM A;  4EP5 A;  4CF9 A;  5HRN A;  1TGO A;  3RMA A;  1ZYQ A;  1WLJ A;  4CGF A;  1TK0 A;  5DK5 A;  3WNF A;  3PO4 A;  3KKS A;  1L3U A;  4IFV A;  2B5J A;  4N76 A;  2A1S A;  4RG8 A;  1WSE A;  2Z1H A;  3C6U A;  3DOK A;  4DG1 A;  3NH1 A;  4BAC A;  3HPG A;  3V9X A;  2Z1G A;  1NKB A;  1RTJ A;  1K6Y A;  3OYG A;  3VQC A;  4NYN A;  4CJU A;  1JL1 A;  3AO2 A;  4PUO A;  3DRR A;  4O0J A;  2KW4 A;  4DU3 A;  3SZ2 A;  2P5O A;  2HVH A;  1SL1 A;  2G8U A;  4FJH A;  3NHG A;  3B6P A;  4B8C A;  3OS1 A;  3HL8 A;  1D8Y A;  3K57 A;  1B9D A;  4Z4G A;  5JS1 A;  1T05 A;  1BIZ A;  4OKJ A;  4CJE A;  3RRG A;  2QXF A;  1RCH A;  4W5N A;  2Q3S A;  5J2Q A;  3VA3 A;  1X1P A;  2YKM A;  4DTM A;  4F3T A;  1HYZ A;  4I9Q A;  4FM2 A;  4F8R A;  2D0B A;  4FJI A;  4OLB A;  2F8T A;  3THV A;  1QS4 A;  2D0C A;  3QEX A;  3TR8 A;  1HMV A;  2ZE2 A;  4ICL A;  4M41 A;  4EZ6 A;  1EET A;  1CZB A;  1YTA A;  3S3M A;  3UIQ A;  3OJU A;  2G8H A;  1LV5 A;  1QQC A;  4I9L A;  3NF6 A;  4IG3 A;  4IG0 A;  2ITG A;  1UOC A;  2HB5 A;  4HCC A;  1VSD A;  2XY8 A;  3NDK A;  3T3F A;  3TI0 A;  4CF2 A;  4N47 A;  1ZBL A;  4XIU A;  4KHQ A;  3ZSX A;  4UQG A;  3NGZ A;  1X9S A;  2XY7 A;  4FLV A;  3AA2 A;  1ASU A;  3NBP A;  3ZT1 A;  1KVB A;  3LWM A;  5J2N A;  4CF1 A;  3PY8 A;  1FXX A;  1NK7 A;  4FJJ A;  3DLR A;  4CFC A;  4OVL A;  3ALY A;  5K14 A;  4HUG A;  4DQS A;  2FBT A;  2RPI A;  4CHP A;  4FLX A;  4M3W A;  3I0S A;  2HHW A;  1JXB A;  4N41 A;  2XO7 A;  3AVH A;  3EYZ A;  3C94 A;  1JLG A;  4YNQ A;  4M3T A;  4G1Q A;  4K8Z A;  4AHC A;  4CGJ A;  4L8R B;  3L2W A;  4CIG A;  3QIO A;  5EU7 A;  1C6V A;  2HHQ A;  4I2Q A;  3TWH A;  3KLF A;  1RT4 A;  5HRR A;  3V6D A;  1HQU A;  4M42 A;  2OPQ A;  3T1A A;  2W42 A;  1NJX A;  1YTU A;  3HYF A;  2OA8 A;  3V1O A;  3ZSR A;  1S5J A;  1RBV A;  3OYF A;  3KD5 E;  1G15 A;  3NGY A;  3ZCM A;  4CJ5 A;  3K59 A;  1NK0 A;  1C0U A;  1UWB A;  2E6M A;  3VQ8 A;  4CEZ A;  3SI6 A;  4AH9 A;  4DQP A;  1WN7 A;  4DF4 A;  1MU2 A;  4B9U A;  1JL2 A;  3NCI A;  4OPJ A;  2G8V A;  1KRP A;  4FJ7 A;  1BI4 A;  1XHZ A;  1TL3 A;  3G0Z A;  1IKY A;  1FKP A;  1KVC A;  1TAQ A;  2X6N A;  4B9L A;  3V9S A;  3TAF A;  4EZ9 A;  1RT7 A;  1U04 A;  2HHS A;  4DU4 A;  2IAJ A;  5JS2 A;  1T7P A;  4DQI A;  4E1M A;  3QLH A;  4KRE A;  5KGX A;  1ZBI A;  4CEQ A;  1TKX A;  1J9A A;  4KTZ A;  1QHT A;  1D9F A;  3RMC A;  1XWL A;  1REV A;  4IDK A;  2ZD1 A;  4M3R A;  1QTM A;  1HPZ A;  4JRQ A;  2G8W A;  4E19 A;  1HRH A;  2O4G A;  3LAL A;  1HNV A;  2OPS A;  2X74 A;  1RDB A;  4E7J A;  1RT5 A;  3SUN A;  4O0I A;  3CQ8 A;  1HQE A;  2VWK A;  1GOB A;  1IO2 A;  2BE2 A;  4OLA A;  5KI6 A;  4F4K A;  2G8K A;  4KHY A;  1BHL A;  4QAG A;  3H08 A;  4KHS A;  3SPZ A;  4E0D A;  4RW9 A;  1S1V A;  3V81 A;  2HHX A;  4DF8 A;  3VA0 A;  2HVI A;  3IS9 A;  3DRP A;  4KKO A;  4CCH A;  4DSL A;  3CFR A;  3QEI A;  4O5B A;  3S9H A;  1SKW A;  4CE9 A;  4F2R A;  1VSM A;  1F21 A;  1YVU A;  3ZT3 A;  1DTQ A;  3QO9 A;  4LSL A;  4CFD A;  3QET A;  3M8S A;  2DTU A;  4IBN A;  4HCB A;  1RT6 A;  3ZSY A;  4B9T A;  4E7H A;  4O55 A;  2FBY A;  2B6A A;  3DRS A;  3AA5 X;  4B9S A;  2HHT A;  2IOC A;  1GOA A;  2BAN A;  4CHZ A;  4DSE A;  2A1R A;  1QSY A;  3LAK A;  1VSK A;  4CF8 A;  3FFI A;  4DSI A;  4KHW A;  1KSP A;  4KI4 A;  4NCA A;  1NOZ A;  4KTW A;  3F73 A;  4FCY A;  2GV9 A;  4FJM A;  1WSJ A;  1KCF A;  5KRS A;  1IKW A;  3SQ4 A;  3LP1 A;  4HUE A;  1U47 A;  3ULD A;  3OYI A;  2NUB A;  1FKO A;  2F8S A;  4CEB A;  1RDD A;  1S1W A;  4BWM A;  1UAX A;  4CJL A;  1TK5 A;  3LPU A;  3O3G A;  3KKR A;  5I42 A;  1A5X A;  5CYM A;  4FLY A;  4Z4I A;  5SWM A;  3T19 A;  3WNH A;  3OYM A;  4DTU A;  3DYA A;  3HP6 A;  3SUO A;  3ZSV A;  4FLW A;  3OJS A;  3DLE A;  1CXU A;  4E3S A;  3PV8 A;  4CEA A;  2R7Y A;  4ID5 A;  1RTI A;  3BGR A;  4FJ8 A;  3VQ6 A;  4KTQ A;  4JLH A;  3P1G A;  3RTV A;  4B9V A;  3AVA A;  5DMR A;  2RF2 A;  3AO1 A;  2I5J A;  3K5O A;  1BIU A;  1U4B A;  1X9M A;  3HXM A;  4O44 A;  4DLE A;  4GW6 A;  4KFB A;  4DLG A;  3OYA A;  3LZI A;  3KLH A;  1RT1 A;  1TKT A;  2XY5 A;  1N6Q A;  3PO5 A;  4CHN A;  2OYQ A;  4KRF A;  4CHQ A;  1HYS A;  3MXI A;  2VG7 A;  1J54 A;  3HT3 A;  5KRT A;  4DS5 A;  1TL1 A;  1C1A A;  2OPR A;  2LSN A;  1BQN A;  3SQ0 A;  3LP2 A;  1B9F A;  1U45 A;  4B8A B;  4FJN A;  4AIL C;  1U48 A;  4RW8 A;  3LAM A;  1LWE A;  4MFB A;  3PUF A;  1W9H A;  4FZY A;  4LSN A;  1XC9 A;  3DLK A;  4OKK A;  1KFD A;  3ZSZ A;  1NJZ A;  4KB0 A;  4CEE A;  3AVN A;  4HTU A;  3MED A;  2G8F A;  4FJG A;  4QCL A;  4JS5 A;  4CJF A;  1IH7 A;  3KJV A;  3AVG A;  1D9D A;  4EP4 A;  4CJR A;  3VQB A;  4CJS A;  3DLB A;  2P5G A;  4CIE A;  3ZT2 A;  2IS3 A;  3ZSW A;  4KHN A;  1DTT A;  1C1B A;  3S3O A;  3RWU A;  3OYD A;  1S1U A;  3TAR A;  1RDA A;  3QNN A;  1XHX A;  4J2E A;  3AO5 A;  3BDP A;  1X9W A;  4AHS A;  1RBT A;  3DMJ A;  3SV3 A;  1Q9X A;  1S6P A;  1UA1 A;  1EKE A;  4DFP A;  4HVJ A;  3HP9 A;  3U3G A;  4DSJ A;  4DWI A;  2E4L A;  2QK9 A;  5C42 A;  4FJL A;  1L5U A;  1TK8 A;  4BDY A;  2XHB A;  3D0P A;  4FLT A;  1VRT A;  3A2F A;  1JLB A;  4GMJ B;  3L2R A;  5C25 A;  2DY4 A;  1SL0 A;  3V9U A;  1NKC A;  1YT3 A;  3O4N A;  3AV9 A;  3LAN A;  4CIF A;  4HUF A;  1RTD A;  1JLF A;  1TKZ A;  3C6T A;  3K5N A;  4FLZ A;  4KAZ A;  2Z1I A;  4OKE A;  3L2V A;  1VSJ A;  3PX6 A;  4TSX A;  3NFA A;  3NF8 A;  3P83 D;  4M3X A;  1Z25 A;  1ASV A;  3AA4 A;  5CYQ A;  4BE2 A;  1WSF A;  3HJF A;  2HW3 A;  4FW1 A;  1TVR A;  3K2P A;  3OYJ A;  1JLQ A;  3ISN C;  1KTQ A;  4OPK A;  3L3U A;  3HVR A;  3LP0 A;  4DTO A;  5J2P A;  3ZSQ A;  3K5M A;  3LWL A;  3AVM A;  1ZBH A;  2FBV A;  2YNG A;  3O4Q A;  3I0R A;  3MEE A;  4JS4 A;  3I8D A;  4CJ4 A;  1C0T A;  3M8P A;  2E6L A;  3SYZ A;  3U6F A;  4LD0 A;  3CM5 A;  4DTS A;  3AO3 A;  2P1J A;  1RIL A;  3IAY A;  1WAF A;  3DM2 A;  1D5A A;  3JYT A;  3SCX A;  2QKK A;  4Z4E A;  4CGI A;  3V1R A;  2YHB A;  4WE1 A;  4CK2 A;  2Y1I A;  4ZTJ A;  1CXQ A;  4H4O A;  4AHV A;  1NK5 A;  4CJT A;  1IG9 A;  2ETJ A;  3AVI A;  1JXE A;  2VG5 A;  3CM6 A;  3WNE A;  1HYV A;  4C8N A;  2ATQ A;  3KK2 A;  4DS4 A;  3QNO A;  5HBM A;  5C24 A;  1XI1 A;  2PYL A;  2DFF A;  5FRO A;  4AHU A;  3ZSO A;  4DTJ A;  3OY9 A;  2OZS A;  1VK0 A;  3DLG A;  2KQ2 A;  3TAM A;  4DTX A;  1RDC A;  4ID1 A;  4FJ9 A;  3AA3 A;  2KZZ A;  1VSE A;  1W0H A;  3OS2 A;  4PQU A;  3RR8 A;  1Q9Y A;  4FLU A;  3LPT A;  1BIS A;  1JLC A;  3ZT0 A;  2HHV A;  1JLE A;  4Q5V A;  4DSF A;  3TAE A;  1KLM A;  3VQ9 A;  1WSG A;  4H8K A;  4CF0 A;  3EY1 A;  3L2U A;  1RT3 A;  3K58 A;  2HND A;  1WSI A;  2YHA A;  4DQQ A;  4C8L A;  3LZJ A;  3RMB A;  1ASW A;  2D5R A;  1GOC A;  3CFO A;  4Z4F A;  1WSH A;  1TAU A;  1S1X A;  3DLH A;  4KB1 A;  3DOL A;  3K5L A;  3PX0 A;  2VG6 A;  2X78 A;  4Y1C A;  4FM1 A;  2G8I A;  4FZX C;  3VQD A;  2OPP A;  1NK6 A;  3OYH A;  3MAQ A;  1RNH A;  4J2A A;  3SV4 A;  1NOY A;  3KK1 A;  3NF9 A;  4CER A;  4W5Q A;  4DFM A;  4B9N A;  3HPH A;  3QEP A;  1QSL A;  1LW2 A;  3IRX A;  1NK8 A;  3M8Q A;  4FVM A;  1VSL A;  4BDP A;  1IKV A;  2RN2 A;  1S1T A;  3DI6 A;  4J2D A;  1B92 A;  3P5J A;  4CEC A;  1EXQ A;  1JKH A;  3U3Y A;  5HRO A;  1RT2 A;  4Z4C A;  3RMD A;  2O4I A;  4FW2 A;  1S6Q A;  4CGD A;  3PX4 A;  4PWD A;  4OGC A;  3MXJ A;  3B6O A;  3OVN A;  1WAJ A;  4HHT A;  5J2M A;  4KV8 A;  4Y1D A;  2PY5 A;  4PY5 A;  1O1W A;  2YNI A;  4I7F A;  4CJP A;  4E89 A;  5HLF A;  3HO1 A;  1C0M A;  2EX3 A;  4LH5 A;  3ITH A;  5CZ2 A;  4LH4 A;  5T7B A;  5CY4 A;  4DFJ A;  3QEV A;  3LDS A;  3TAP A;  4CJV A;  3QEW A;  1BCO A;  1LWF A;  2VWJ A;  1BI4 B;  3M8R A;  4C8O A;  1HNI A;  3KLG A;  2BGG A;  5CZ1 A;  1R0A A;  2DFE A;  4BDZ A;  4DFK A;  4ZTF A;  3F9K A;  1T03 A;  1CLQ A;  2GBZ A;  4F2S A;  1UA0 A;  1C1C A;  4AHT A;  4CES A;  4CJK A;  3VQA A;  2D0A A;  4O4G A;  4CGG A;  3SQ1 A;  1NKE A;  3OYN A;  4BE0 A;  5I3U A;  3KD1 E;  3TAB A;  1LW0 A;  2QKB A;  1N5Y A;  3CFP A;  2Y1J A;  4M3U A;  1DLO A;  3NH2 A;  3JSM A;  3NE6 A;  4DTP A;  5HRP A;  1VSI A; 
#chains in the Genus database with same CATH topology
 4BR0 A;  1ATN A;  2JGU A;  3TTF A;  4BRM A;  3L4I A;  4AM6 A;  1LAV A;  3EZ5 A;  2UXD K;  1I39 A;  4CJ3 A;  3TAG A;  2HF3 A;  2I7N A;  3SNN A;  3FR0 A;  5AQW A;  1ZBU A;  4BQL A;  2YKN A;  2A6A A;  3VQ5 A;  5FRM A;  4KHU A;  5BRD A;  2P9K B;  4BR2 A;  4CHY A;  1OH7 A;  3KTQ A;  4IKF A;  2ZJR L;  2WON A;  2WTU A;  3AO4 A;  1BU6 O;  4FM0 A;  3AVJ A;  4M3Y A;  2DFH A;  4N56 A;  3AVC A;  1V4T A;  3AAR A;  3OS0 A;  4HWI A;  4ISG A;  3BZK A;  5SZT A;  4AHR A;  4M7Y A;  2B4J A;  4CJW A;  3L0Q A;  2XRI A;  4BE1 A;  3G71 N;  4N5S A;  2PZS A;  1LWC A;  3RRH A;  3O3H A;  3KWG A;  3V9Z A;  5BPM A;  4CJQ A;  4E7I A;  4E1N A;  5DM7 L;  4ELU A;  2O8E A;  3KLI A;  1NBW A;  3OYK A;  1L3S A;  3DWL A;  1MA9 B;  2HBL A;  1X9J A;  3D45 A;  3KIO A;  4C8M A;  4WFB L;  2HNZ A;  4H5R A;  3C95 A;  2PYJ A;  2FC0 A;  1KAZ A;  3OYL A;  4BC5 A;  2UUA K;  2A3Z A;  1S9G A;  1L3V A;  2KTQ A;  4V19 S;  4C1N I;  2IDO A;  1SS6 A;  3NVK A;  4MO4 A;  2WOM A;  1XNR K;  2RKI A;  4LFB K;  4B08 A;  5IWA K;  3UKR A;  4BRD A;  3QER A;  2P9I B;  3LP3 A;  3QIN A;  3ZX2 A;  4I2P A;  4E7L A;  3V9W A;  1K8K A;  4JKD A;  4RTF D;  5JVH L;  4OO1 J;  3BY5 A;  5CR4 A;  3HST B;  3WEE B;  1Q82 O;  2D4W A;  2RHK A;  3QBW A;  3T69 A;  1A5V A;  1FK9 A;  4GVM A;  3MCP A;  5HRN A;  5DK5 A;  3PO4 A;  3KKS A;  1C0G A;  3KZB A;  4CBX A;  3CPE A;  3CI5 A;  1RTJ A;  5JVG L;  3QBX A;  4CZI A;  1JL1 A;  3DRR A;  3A5L C;  4PKH A;  4EIA A;  1NG9 A;  2NRT A;  4FJH A;  3NHG A;  5JS1 A;  3J7Z O;  3K57 A;  1B9D A;  1BIZ A;  4OKJ A;  2QXF A;  4PHT X;  2EWS A;  1X1P A;  1Y64 A;  4JI2 K;  4DTM A;  4I9Q A;  4F8R A;  2D0B A;  5M1O A;  1QS4 A;  3UIQ A;  1CZB A;  1JCG A;  4DKW A;  1QQC A;  3NF6 A;  3OW2 M;  2HB5 A;  3AGR A;  1VSD A;  3NDK A;  3T3F A;  4CF2 A;  1ZBL A;  5AQS A;  3UKU B;  4EAH D;  3DXK A;  2GWK A;  1TUY A;  3I8B A;  3NBP A;  3LWM A;  3O08 A;  2FSJ A;  4OVL A;  5BRH A;  2FBT A;  2RPI A;  2HHW A;  3VEY A;  1JXB A;  4PL7 A;  3C94 A;  4DV3 K;  4H03 B;  1JLG A;  4M3T A;  4FWP A;  4G1Q A;  1BG3 A;  4AHC A;  4JHD B;  3QIO A;  3TTC A;  2HHQ A;  2P9U B;  4M42 A;  1RT4 A;  2OPQ A;  3I33 A;  1NJX A;  1YTU A;  2OA8 A;  2HBJ A;  1NK0 A;  4CJ5 A;  1UWB A;  1WN7 A;  1YIJ N;  2IVO A;  1BI4 A;  3A5M C;  1XHZ A;  3T7Z A;  2UU9 K;  4X64 K;  4EZ9 A;  2IAJ A;  4B1Z A;  3MMV A;  1GLF O;  3QLH A;  4YOW A;  1TKX A;  1J9A A;  2E2P A;  3VEZ A;  3U9D A;  3O6W A;  4I6M B;  4E19 A;  3LAL A;  2X74 A;  5M1Q A;  1RDB A;  3SUN A;  1QHA A;  4O0I A;  2VWK A;  3GDQ A;  3M6G A;  5GIP A;  1GOB A;  2BE2 A;  4DCH A;  4MO5 A;  1BHL A;  3H08 A;  5GAH P;  2E1Y A;  3SPZ A;  1MWM A;  4LF5 K;  5GAE P;  3B8A X;  4FWL A;  4FL9 A;  2HVI A;  3IS9 A;  4KKO A;  4O5B A;  4F2R A;  1VSM A;  4GKJ K;  3M8S A;  4L3Q A;  1HX1 A;  3C6H A;  3DRS A;  4B9S A;  2HHT A;  4JK9 A;  1GOA A;  2BAN A;  1QQM A;  2W6L A;  4DSI A;  4BGA A;  4KHW A;  4KTW A;  1IKW A;  3SQ4 A;  1NGG A;  1TUU A;  1U47 A;  2F8S A;  1UAX A;  4CJL A;  3LPU A;  3HSC A;  3O3G A;  4LF6 K;  5SWM A;  3EO3 A;  3O1W A;  3HP6 A;  3AAP A;  4FLW A;  1OH5 A;  4B1U B;  2ZF5 O;  3BGR A;  4H5W A;  4FJ8 A;  3FZL A;  3VQ6 A;  1ATR A;  3RTV A;  4B9V A;  3AVA A;  5DMR A;  2RF2 A;  1X9M A;  3PIO L;  3HXM A;  4KFB A;  3LZI A;  4KHP K;  3KLH A;  1RT1 A;  1TKT A;  2XY5 A;  4KRF A;  4CHN A;  1HYS A;  3KHY A;  1XQS C;  2OPR A;  5AZJ B;  1VQ5 N;  5BRF A;  4BRC A;  1B9F A;  4B8A B;  3PUF A;  4B1W B;  3IUC A;  4IO8 A;  1NJZ A;  4KB0 A;  3E66 A;  3MED A;  1IV0 A;  4QCL A;  3KJV A;  1YUW A;  3AVG A;  4JKA A;  2E20 A;  3VGK A;  3N4Q A;  4CZJ A;  3ZSW A;  2BUP A;  3QNN A;  3QFU A;  3AO5 A;  1GLA G;  2OTL N;  4IOC L;  1S6P A;  1Q9X A;  1UA1 A;  1EKE A;  4HVJ A;  3M3Z A;  5C42 A;  1TK8 A;  4G9Z A;  1DT9 A;  2HMP A;  2W6K A;  4GMJ B;  2QM1 A;  5M1F A;  3CC4 N;  3CQX A;  1YI2 N;  3LAN A;  1VAZ A;  1CZA N;  4BY9 C;  1JLF A;  4BRL A;  1VSJ A;  4M3X A;  1Z25 A;  3HJF A;  4BE2 A;  3OYJ A;  1KTQ A;  3CJA A;  3L3U A;  2ASM A;  3HVR A;  4DTO A;  1WBD A;  4WQ4 C;  3I0R A;  3I8D A;  1C0T A;  3M8P A;  2DPN A;  4DTS A;  3AO3 A;  1J6Z A;  1HNZ K;  1D5A A;  3JYT A;  2QKK A;  4Z4E A;  4CGI A;  2YHB A;  4WE1 A;  5TKY A;  4CK2 A;  4H4O A;  4FO0 A;  4CW7 B;  3VF2 A;  2V51 B;  1JXE A;  4FPB A;  1T05 A;  2ATQ A;  2PYL A;  3OY9 A;  1VK0 A;  3DLG A;  4FJ9 A;  4CZH A;  3OS2 A;  2VQF K;  3VTI A;  2W41 A;  1BIS A;  3ZT0 A;  2VWB A;  3VQ9 A;  2YCH A;  4GVE A;  5F2R A;  2FLO A;  5EXW A;  5AQP A;  1ASW A;  3CFO A;  1S22 A;  1VQO N;  1TAU A;  1HPM A;  3K5L A;  1W2B M;  3R8E A;  4FZX C;  3O9Q A;  3LDN A;  2GTD A;  4KH4 A;  4J2A A;  3NF9 A;  5EX5 A;  5M1K A;  3JS6 A;  3VGL A;  1GLC G;  4CZE A;  4BDP A;  1IKV A;  4JKB A;  1GLD G;  1S1T A;  3DI6 A;  3QML A;  1EXQ A;  2I7P A;  3U3Y A;  3VEV A;  5HRO A;  1RT2 A;  3RMD A;  4FW2 A;  4CGD A;  4OGC A;  3B6O A;  3HO1 A;  5HLF A;  4DR5 K;  2E5L K;  5T7B A;  1Z05 A;  1VQ7 N;  1R0A A;  4DFK A;  2QWM A;  2IVN A;  3VQA A;  2D0A A;  4H5V A;  2BH1 A;  3SQ1 A;  3TAB A;  3WXI A;  3NMU A;  4BC3 A;  3ZET B;  3ZEU A;  3EL2 A;  4CI6 A;  5AQQ A;  1VSI A;  3CYM A;  1VQP N;  5AQG A;  4AF1 A;  1LAW A;  2QI2 A;  3VQ7 A;  4YDU A;  2HHH K;  1VQ8 N;  2YJE A;  4LF8 K;  3CCS N;  1S9E A;  1OVY A;  4CVN E;  4OX9 K;  2D1K A;  1Y97 A;  4J8F A;  1NJI O;  3QIP A;  3ATU A;  1HNW K;  4H4M A;  3G6E N;  2P9L B;  4JKC A;  1BCM A;  4FXD A;  1CZ9 A;  1E4F T;  1RTH A;  2YNH A;  3S3N A;  4W5R A;  1ZBF A;  1SKS A;  3WNG A;  2A41 A;  1TV6 A;  3ASM A;  2GUI A;  3CPW M;  2P9S A;  2ZQB A;  4BWJ A;  3A5N C;  1VQ4 N;  1C0F A;  3SAH A;  1VSH A;  2HMI A;  5FRN A;  1NK9 A;  2EHG A;  3CJ7 A;  3E01 A;  4CEO A;  4CFA A;  4CEF A;  4BG9 A;  3IG1 A;  3MDQ A;  3LDO A;  4M3Z A;  1KAX A;  5HP1 A;  4FWR A;  2GEL A;  3SQ2 A;  4FSV A;  3OYE A;  3L2Q A;  3OBW A;  1YHQ N;  4C8K A;  1GLJ O;  2OTJ N;  2IGI A;  5E84 A;  4KBO A;  3SPY A;  1SV5 A;  2Z1J A;  4DQR A;  3AVK A;  3J80 O;  2F9W A;  3A8Y A;  5AQU A;  1HNX K;  5AZI A;  4M7X A;  1J5O A;  2YV0 X;  2KFZ A;  2YX6 A;  4CED A;  4PKG A;  4FJK A;  3VEW A;  1VRU A;  4FJX A;  3A0I X;  4JKG B;  4JI4 K;  2WFB A;  1HUX A;  2NLX A;  1RDW X;  5FPM A;  4JI3 K;  4AQY K;  1X3N A;  3WUH A;  3BF1 A;  3RR7 A;  4RW7 A;  2P9K A;  1JCF A;  4Z0U A;  2HHU A;  4LY7 A;  2OZM A;  1EX4 A;  2ASO A;  3IDH A;  1IKX A;  1NU0 A;  3VQQ A;  5J1E A;  3SBG A;  4OJR A;  1M1K O;  3ENB A;  3J7Y P;  1EWR A;  1ZXO A;  5FDL A;  1YAG A;  3MEC A;  4EP5 A;  2NRZ A;  1GLL O;  3RMA A;  3SBT A;  1TK0 A;  1VQM N;  1NGH A;  3MN5 A;  1WOQ A;  4N76 A;  2A1S A;  4DR2 K;  3EN9 A;  3NH1 A;  2Z1H A;  2YJF A;  3C6U A;  3DOK A;  3IKM A;  4DG1 A;  1NKB A;  3H45 C;  1K6Y A;  3OYG A;  4FPA A;  1RGI A;  4NYN A;  5EY4 A;  3AO2 A;  4CJU A;  5ADX A;  4PUO A;  5ELZ A;  2Q1N A;  3WQT A;  1SL1 A;  3OS1 A;  3HL8 A;  1D8Y A;  5FPE A;  3WQU A;  2Q0R A;  1RCH A;  3C7N B;  4H5T A;  2E2N A;  2F7T A;  2GUP A;  5AQN A;  3FLC O;  4DUZ K;  3THV A;  3EEQ A;  5GIN A;  3FFK B;  2OCE A;  3JXU A;  3TSU A;  1HMV A;  1NGD A;  2PBD A;  1YTA A;  1P8Z A;  4I9L A;  3SK3 A;  4WFA L;  1UOC A;  4HCC A;  3IFR A;  1MWK A;  2FSK A;  3F5T A;  4N47 A;  2O8F B;  2YHY A;  4UQG A;  3NGZ A;  2XY7 A;  4B1X B;  3EKS A;  5AQX A;  1ASU A;  1KVB A;  4A2A A;  5J2N A;  3MX2 A;  3D2E B;  1VQN N;  1FW6 A;  1FXX A;  4CFC A;  2P9I A;  4PL8 A;  4M3W A;  1GLE G;  3HBT A;  3I0S A;  2QWR A;  3FE1 A;  4CGJ A;  2VQE K;  4MDB A;  3V6D A;  2FF6 A;  1HQU A;  2A40 A;  1T6C A;  3V1O A;  3ZSR A;  5C2F A;  1S5J A;  5IT9 O;  1RBV A;  3KD5 E;  1G15 A;  3K59 A;  3SI6 A;  1XMQ K;  2E6M A;  4ISF A;  3CD6 N;  1MU2 A;  1JL2 A;  4JD2 B;  4FJ7 A;  2VYP A;  2X6N A;  3TAF A;  4ILG B;  5C12 A;  4YOT A;  1W7A A;  5JS2 A;  4JNE A;  4E1M A;  3CF5 L;  3R3L A;  5KGX A;  1N36 K;  4CEQ A;  4XH1 A;  3Q7B A;  1D9F A;  3RMC A;  5GAG P;  2ZD1 A;  4JRQ A;  3HM8 A;  1HNV A;  4IJN A;  1HQE A;  4F4K A;  3WXJ A;  4E0D A;  2HHX A;  1JCE A;  3QEI A;  4HTL A;  2O8D A;  1DTQ A;  3QO9 A;  4GNI A;  1RT6 A;  4B9T A;  4BRA A;  2FBY A;  4CBU A;  1NLV A;  3FZM A;  1QSY A;  1EQY A;  2QWP A;  1VSK A;  4KI4 A;  4FJM A;  3F73 A;  1WSJ A;  5AQY A;  4A61 A;  1DGK N;  3LP1 A;  4HUE A;  3GE1 A;  4XH5 A;  3D2F A;  4FLY A;  4Z4I A;  3OYM A;  4DTU A;  3DYA A;  3SUO A;  3MCA B;  3ZSV A;  1V4S A;  3H1Q A;  4FVU A;  5F1X A;  1N34 K;  5AFU A;  2I5J A;  3THY A;  2P9N A;  4A2B A;  3S41 A;  3TSP A;  3DXM A;  3MWT A;  3PO5 A;  4CHQ A;  1J54 A;  4I6M A;  2IIR A;  3LP2 A;  1U45 A;  5AQF A;  4FJN A;  3CCQ N;  1U48 A;  4X62 K;  3LAM A;  1OKJ A;  4FZY A;  2YHX A;  4X65 K;  2E8A A;  3DLK A;  4OKK A;  3VET A;  1XC9 A;  3AVN A;  1SZ2 A;  5A2Q O;  4JS5 A;  2Q0U A;  2O8E B;  3DLB A;  4KHN A;  3QB0 A;  1DTT A;  1C1B A;  3OTO K;  1E3M A;  1I94 K;  3TAR A;  3BDP A;  4AHS A;  3F2K A;  3SV3 A;  2ASP A;  5AR0 A;  3HP9 A;  3U3G A;  2QK9 A;  1L5U A;  4JN4 A;  4CZM A;  4DV6 K;  2WC9 A;  2NRR A;  4JK8 A;  2DY4 A;  3V9U A;  1NKC A;  2CGK A;  3O4N A;  4GY2 B;  3UKR B;  1TKZ A;  4BG8 A;  4FLZ A;  3L2V A;  1FJG K;  3PX6 A;  3WXK A;  1K8K B;  1G99 A;  1ASV A;  5CYQ A;  3THX B;  3M1F A;  2ITM A;  1ZBH A;  3HRG A;  4JKF A;  5ADX H;  4YY3 K;  5LMN K;  4K25 A;  3SYZ A;  1NNE A;  3VOV A;  2D0P A;  3DM2 A;  2Y1I A;  1SAZ A;  3MN6 A;  2Q2R A;  4BRG A;  2VG5 A;  1U2V B;  3CM6 A;  3KK7 A;  4BRQ A;  4DS4 A;  4X66 K;  1NGE A;  5FRO A;  4BRH A;  2O8C A;  3E9O A;  4DTX A;  4DV2 K;  2PAV A;  4ID1 A;  3AA3 A;  2KZZ A;  1VSE A;  1LOT B;  3RR8 A;  1TYQ A;  4FLU A;  2AP1 A;  4U67 L;  4YOX A;  1KLM A;  1LCU A;  4O8K A;  4CF0 A;  4DV7 K;  3CCR N;  1WSI A;  2YHA A;  3LZJ A;  3VEO A;  1K8A O;  1GOC A;  2CGJ A;  4JI1 K;  4Z4F A;  1WSH A;  4JV5 K;  3DLH A;  3L6Q A;  2VG6 A;  3R1X A;  2BTF A;  3MAQ A;  4H0V B;  1ZBS A;  4CER A;  4DFM A;  4JKH A;  3QEP A;  3C0B A;  1NK8 A;  3M8Q A;  4FVM A;  2QWN A;  2RN2 A;  1WBB A;  4J2D A;  4BR4 A;  4Z4C A;  4BVP A;  5J2M A;  5LL6 Z;  4PY5 A;  3P39 A;  4LH5 A;  3W3D A;  3O4W A;  5C0Y A;  1BCO A;  1HLU A;  3SMP A;  2VWJ A;  1BI4 B;  1HNI A;  2DFE A;  3ZX0 A;  2GBZ A;  4F2S A;  4AHT A;  4CES A;  3E9P A;  5GIO A;  4CGG A;  2Y1J A;  4DV4 K;  5HRP A;  4AM7 A;  4CEB A;  3MK6 A;  2FXU A;  5KQD A;  2WBN A;  4B9M A;  3OYB A;  1IBL K;  4B3S K;  3E1Y A;  4F3O A;  3SUQ A;  2V7Y A;  1BL3 A;  1JLA A;  4B3O A;  3V1Q A;  4OPH A;  3VQ4 A;  1RBS A;  3M5R A;  2QEX N;  5BPN A;  1BGX T;  1X3M A;  1U49 A;  5E41 A;  4CK1 A;  4Z4H A;  1RBU A;  4W5T A;  4BC2 A;  3BF3 A;  1ITG A;  3OYC A;  3QES A;  4FJ5 A;  2O8B B;  2XY6 A;  2AJQ A;  3O9T A;  2NZT A;  3KK3 A;  4FWO A;  3L3V A;  1VSF A;  3CCE N;  4W5O A;  4A62 A;  1Z26 A;  3AVF A;  3O9U A;  2BDP A;  5BPL A;  4DR6 K;  2CGL A;  4IOA L;  3V4I A;  3SMS A;  4DU1 A;  2F4V K;  3TAN A;  3VTH A;  4DSK A;  3SUP A;  3SJJ A;  1NM1 A;  2YNF A;  3CCU N;  3F9M A;  4BRE A;  4CZG A;  2HNY A;  3KLE A;  3HK2 A;  5KPR A;  2KLA A;  3MEG A;  3AGK A;  1HJR A;  1SKR A;  3VQE A;  3WXM B;  4B1V A;  4KO0 A;  1QQN A;  1NJY A;  2D0O A;  2P9P A;  4DTR A;  3ZYY X;  1QSS A;  2X6S A;  1I3A A;  4RW4 A;  1RBR A;  1YVN A;  4CZK A;  3PLA A;  1N33 K;  3AVB A;  3CIP A;  4A5B A;  4NCG A;  3AVL A;  4K42 A;  4NLB A;  3L8B A;  1BA0 A;  2IC3 A;  4FK4 A;  1NK4 A;  3K9K A;  2KZM A;  2WUS A;  5D3G A;  3DLL L;  2JLE A;  4WQ5 A;  1J53 A;  4MQ3 A;  1XUP O;  1EWQ A;  2F96 A;  3HZ6 A;  4R5P A;  1NGB A;  1HKG A;  2VGN A;  3GBT A;  4FOE A;  1ZYQ A;  1WLJ A;  4CGF A;  4DR4 K;  3R6M A;  4C1N K;  3WNF A;  3QIC A;  5MLC Q;  4IFV A;  2B5J A;  5HL7 L;  4RG8 A;  3CJB A;  3V9X A;  2Z1G A;  3UB5 A;  1YXQ A;  4O0J A;  3RSE A;  2KW4 A;  4DU3 A;  3SZ2 A;  4IO9 L;  2HVH A;  3B6P A;  1HKB A;  4B8C A;  1HR0 K;  4BGB A;  2ZM6 K;  4XH4 A;  2Q3S A;  5J2Q A;  4LF4 K;  2YKM A;  4FM2 A;  5KPZ A;  2F8T A;  2CH5 A;  3H46 O;  3TR8 A;  5M1N A;  1EET A;  3S3M A;  3OJU A;  5LJV A;  4ILJ A;  1LV5 A;  4WFN L;  3LM9 A;  2KKZ A;  2ITG A;  4R79 A;  5AQL A;  2W40 A;  4XIU A;  3RVC A;  4KHQ A;  1E4G T;  4FLV A;  3AA2 A;  1KD1 O;  3ZT1 A;  3OBY A;  1KC8 O;  4H5N A;  4FWN A;  4DV5 K;  3DLR A;  4Y0W A;  2UUB K;  4CHP A;  5AJ3 K;  3G25 A;  3EE9 A;  5JLF A;  2XO7 A;  1Q18 A;  5EOY A;  4L8R B;  3L2W A;  4CIG A;  3CC2 N;  3TWH A;  5HRR A;  3ZLJ A;  3T1A A;  2W42 A;  4B3M K;  1ATS A;  3HYF A;  4IOX A;  3OYF A;  3NGY A;  4RCH A;  4DQP A;  1C0U A;  3VQ8 A;  4CEZ A;  5DM6 L;  4AH9 A;  4DF4 A;  4B9U A;  3NCI A;  2G8V A;  1KRP A;  4DB3 A;  3P38 A;  1SQK A;  4RWT A;  1TL3 A;  3G0Z A;  1IKY A;  4B9L A;  1XNQ K;  1N32 K;  1H1V A;  1U04 A;  2HHS A;  4DQI A;  1W97 L;  1ZBI A;  3C7N A;  4KTZ A;  3CJ1 A;  5KPT A;  1QHT A;  4IDK A;  4M3R A;  1QTM A;  1HPZ A;  1HRH A;  4NXM K;  2OPS A;  2A42 A;  4E7J A;  1KQS M;  1BO5 O;  4OPA A;  3UE5 A;  4OLA A;  5KI6 A;  2G8K A;  4QAG A;  2O8F A;  5B8H A;  4RW9 A;  4DF8 A;  5C15 A;  4CBW A;  4CCH A;  3CFR A;  3S9H A;  1SKW A;  3ZT3 A;  2DTU A;  4YDU C;  3AAQ A;  4IBN A;  3ZEU B;  3ZSY A;  4E7H A;  4O55 A;  3AA5 X;  2IOC A;  4B3T K;  4DSE A;  4CHZ A;  4FWK A;  2A1R A;  1IJJ A;  4CF8 A;  3FFI A;  1K73 O;  1KSP A;  4NCA A;  4FCY A;  2QWL A;  3OYI A;  1FKO A;  3WT0 A;  4E1J A;  1S1W A;  1YIT N;  4IJA A;  1TK5 A;  3KKR A;  2E2Q A;  5I42 A;  5E26 A;  1A5X A;  3WNH A;  1VQK N;  2OAN A;  4WF9 L;  1CXU A;  4C23 A;  5JIC A;  3PV8 A;  1RTI A;  4H0P A;  3CHW A;  4CZL A;  4GV6 A;  4KTQ A;  5AQV A;  3P1G A;  4FWQ A;  4XEI A;  1VQ9 N;  3W0L A;  3K5O A;  1BIU A;  1BA1 A;  4M63 C;  1U4B A;  3U9Z A;  3ATV A;  4DLG A;  3J81 O;  2VG7 A;  3HT3 A;  4DS5 A;  1TL1 A;  1C1A A;  2LSN A;  1BQN A;  3SQ0 A;  4RW8 A;  3O9R A;  1LWE A;  3CCM N;  3T1H K;  1W9H A;  4LSN A;  2Q36 A;  3ZSZ A;  4MLE A;  4CEE A;  4HTU A;  2G8F A;  3TPQ A;  3LDP A;  1KXP A;  3H6E A;  2ZGZ A;  3VQB A;  4CJS A;  2ZJP L;  4CIE A;  2IS3 A;  3OYD A;  1S1U A;  1RDA A;  4YOV A;  1XHX A;  4J2E A;  3MN7 A;  1RBT A;  3DMJ A;  3EE8 A;  4DFP A;  4DSJ A;  4B1Y B;  3NVM A;  3WEE A;  2PFU A;  4BDY A;  2QW9 A;  3O8M A;  3D0P A;  4FLT A;  3CCV N;  4BRN A;  1YT3 A;  4K41 A;  4CIF A;  3THW B;  4MDA A;  2J4R A;  3DJC A;  3DAW A;  2Z1I A;  4OKE A;  3T1Y K;  3NF8 A;  3EZW A;  1WSF A;  3VMF B;  1EO1 A;  4QS7 A;  5AQH A;  3GL1 A;  3ZSQ A;  3AVM A;  2FBV A;  3O4Q A;  3SJH A;  1WB9 A;  3MEE A;  4YOY A;  4CJ4 A;  4BC4 A;  3ID8 A;  3U6F A;  4LD0 A;  3CM5 A;  3TU5 A;  2KHO A;  1BUP A;  1RIL A;  2P1J A;  3IAY A;  1WAF A;  3BUZ B;  4IEI A;  5AQZ A;  1CXQ A;  4AHV A;  2ETJ A;  4C8N A;  3ULE B;  3UKU A;  5AQI A;  5HBM A;  5AQJ A;  5C24 A;  3I56 N;  1XI1 A;  2DFF A;  4BVO A;  3ZSO A;  5BR8 K;  4DTJ A;  2UUC K;  4FWS A;  3TAM A;  1Q7Y O;  1NMN A;  4B3R K;  1W0H A;  3OA9 A;  4PQU A;  3QFP A;  4DSF A;  3TAE A;  1WSG A;  3L2U A;  4JHD A;  2HND A;  4DQQ A;  4C8L A;  3H3O B;  2D5R A;  2P9U A;  2YI1 A;  1N8R O;  1S1X A;  4KB1 A;  5JLH A;  4Y1C A;  2X78 A;  4EHT A;  3VES A;  1ILY A;  5F0X A;  3BEX A;  2NRH A;  1NK6 A;  3OYH A;  4JEP A;  4DQ8 A;  3HOT A;  3KK1 A;  4W5Q A;  3TSQ A;  4B9N A;  3FZH A;  3HPH A;  4NB4 A;  1ZC6 A;  1LW2 A;  3P4I A;  3IRX A;  3CME N;  3THX A;  1OH8 A;  2ZWH A;  5AQT A;  1BOT O;  1QZ6 A;  3P5J A;  4CEC A;  4FOI A;  4BRF A;  2O4I A;  1S6Q A;  1WUA A;  4PWD A;  3MXJ A;  3OVN A;  4HHT A;  2JWL A;  3SAF A;  4KV8 A;  4Y1D A;  1S72 N;  3LDL A;  1O1W A;  4CJP A;  1C0M A;  2EX3 A;  3ITH A;  3O80 A;  4EHU A;  4LH4 A;  4DFJ A;  5CY4 A;  5C2D A;  3QEV A;  3TAP A;  3ZX3 A;  3QEW A;  2QWQ A;  3KLG A;  5CZ1 A;  1U2V A;  4BR7 A;  3F9K A;  1CLQ A;  1UA0 A;  3FZF A;  1S3X A;  3VF4 A;  4CJK A;  4O4G A;  1J5E K;  3OYN A;  4BE0 A;  2QKB A;  3CFP A;  4M3U A;  4F9O A;  2ZJQ L;  3JSM A;  3NE6 A;  4DTP A;  5FPN A;  4FK2 A;  1Q8I A;  3PIP L;  2JWK A;  5KTQ A;  2GEM A;  1GLB G;  4DV0 K;  4DV1 K;  3TAQ A;  1A5W A;  5KQ8 A;  4KI6 A;  4CK3 A;  3ZT4 A;  5BR9 A;  5EVZ A;  4ELV A;  5HOO A;  1KLN A;  3G10 A;  4ELT A;  4PA1 A;  3NAE A;  2VGM A;  5HRS A;  1K9M O;  4LF7 K;  4DR3 K;  3ENH A;  2O8D B;  4FZZ A;  5AQM A;  4O5F A;  3J8A A;  4JRP A;  4GV9 A;  1HKC A;  2CH6 A;  4CFB A;  2P51 A;  1BQM A;  2VCP A;  2UYT A;  3NF7 A;  3MXM A;  1QE1 A;  1T8E A;  3NH0 A;  4FYD A;  5AQK A;  3D2F B;  1NJW A;  4Q0B A;  1R59 O;  4UY8 O;  3O1B A;  1VQL N;  4NYF A;  3FZK A;  3VN5 A;  4JI7 K;  5AZJ A;  5AQO A;  3HPO A;  3NGI A;  1M90 O;  4J2B A;  3TTD A;  1EP4 A;  4IEE A;  4IFY A;  1O13 A;  1T3V A;  4CD3 A;  1SL2 A;  1NWK A;  3VEX A;  3J7A P;  3THY B;  5KGW A;  1KFS A;  4DR1 K;  3H1V X;  2P9N B;  4ZHR A;  4RW6 A;  3MX5 A;  1T44 A;  3WXL A;  1KAY A;  4OGE A;  3DXM B;  1NGJ A;  4CHO A;  3HM9 A;  5LJW A;  3HVT A;  3ENO A;  5AQR A;  4K8X A;  3O3F A;  1TKD A;  2UXB K;  1SUQ A;  2E88 A;  3DXK B;  4KPY A;  2FBX A;  4CGH A;  4PKI A;  3PSF A;  1WNS A;  3LDQ A;  3VQP A;  4A5A A;  4FWM A;  2FF3 B;  4BRO A;  4E7K A;  1NGI A;  3VGM A;  4DMN A;  4QOZ B;  4NCB A;  1KVA A;  4YOR A;  2KFN A;  3KVG A;  4YFU A;  3QDK A;  2O8B A;  3CCL N;  4FK0 A;  1Q81 O;  1IBM K;  3CG7 A;  2NRX A;  3VF6 A;  1L3T A;  4BRP A;  1NGC A;  4M45 A;  4DTN A;  1T6D A;  1P90 A;  4CF9 A;  1TGO A;  5TKW A;  4DHY A;  5FPD A;  1L3U A;  3H3N O;  1WSE A;  4BAC A;  4WQ4 A;  4A57 A;  1VHX A;  3HPG A;  5H1S Q;  3VQC A;  3IMX A;  1OVQ A;  1QZ5 A;  2P5O A;  2G8U A;  3SLC A;  4Z4G A;  4CJE A;  3RRG A;  3C65 A;  4W5N A;  3VA3 A;  3CC7 N;  4F3T A;  1HYZ A;  4FJI A;  4OLB A;  2HF4 A;  2D0C A;  3QEX A;  3JAM O;  2GX9 A;  3CJ9 A;  2ZE2 A;  4ICL A;  4M41 A;  4EZ6 A;  1NMD A;  3CMA N;  2G8H A;  4IG3 A;  4IG0 A;  3ID6 A;  2XY8 A;  3TI0 A;  3CET A;  1YJW N;  2IVP A;  4K43 A;  3ZSX A;  1X9S A;  2O8C B;  3A5O C;  3U8X A;  3AY9 A;  4CF1 A;  1ESV A;  3PY8 A;  1NK7 A;  4FJJ A;  3ALY A;  5K14 A;  4HUG A;  4DQS A;  4FLX A;  1TYQ B;  1YJ9 N;  4N41 A;  3EYZ A;  3AVH A;  4YNQ A;  4K8Z A;  4YHH K;  2AA4 A;  5EU7 A;  1C6V A;  4I2Q A;  3KLF A;  4DR7 K;  4IWV A;  5BRE A;  1MDU B;  1XMO K;  4JKE A;  5CHI A;  3CCJ N;  3ZCM A;  5AFU H;  4A59 A;  4JI6 K;  3FGU A;  4OPJ A;  2E2O A;  1KVC A;  1FKP A;  1TAQ A;  3V9S A;  4BRK A;  1RT7 A;  2H3G X;  4DU4 A;  4QS9 A;  1T7P A;  4KRE A;  3HOS A;  5LMU K;  1XWL A;  1REV A;  3ZET A;  1Z6R A;  2G8W A;  2O4G A;  1BDG A;  1RT5 A;  3CQ8 A;  3GOI A;  1IO2 A;  4KHY A;  4KHS A;  2RE2 A;  3L4Q A;  3EKU A;  1S1V A;  3LL3 A;  3V81 A;  3VA0 A;  1QQO A;  2P9L A;  3BZC A;  3DRP A;  4DSL A;  4CE9 A;  1F21 A;  1YVU A;  1U6Z A;  3G4S N;  4LSL A;  4CFD A;  3QET A;  4HCB A;  2B6A A;  3PSI A;  4IZ9 A;  1RFQ A;  3GG4 A;  3LAK A;  4BR9 A;  1NOZ A;  4BRI A;  2GV9 A;  1KCF A;  5KRS A;  2UXC K;  3ULD A;  2NUB A;  2HST A;  1NGA A;  1RDD A;  3Q7C A;  4BWM A;  1VQ6 N;  5CYM A;  3T19 A;  4NXN K;  3OHR A;  3OJS A;  3DLE A;  2QA4 N;  4E3S A;  2HBM A;  1JJ2 M;  2ZGY A;  1Q86 O;  4CEA A;  2R7Y A;  4ID5 A;  3VER A;  1IBK K;  4JLH A;  1DEJ A;  3AO1 A;  2E1Z A;  4O44 A;  4GW6 A;  3OYA A;  4JI8 K;  1N6Q A;  2OYQ A;  3MXI A;  5KRT A;  5LY3 A;  4JYA K;  1HJO A;  4LFA K;  4AIL C;  4GKK K;  4MFB A;  4DUY K;  2NNW A;  1KFD A;  4FJG A;  5GAD P;  4JKG A;  4CJF A;  1IH7 A;  1OH6 A;  4CZF A;  1D9D A;  5I9E B;  3CXC M;  4EP4 A;  4CJR A;  4EFH A;  4GV3 A;  4JI5 K;  4JK7 A;  2P5G A;  5M1P A;  3ZT2 A;  3S3O A;  3RWU A;  1X9W A;  4NLC A;  2NRV A;  2P9P B;  4DWI A;  2E4L A;  4FJL A;  4WYB A;  1BWF O;  2XHB A;  1VRT A;  3LM2 A;  1XC3 A;  3A2F A;  1JLB A;  3L2R A;  5C25 A;  1SL0 A;  2V7Z A;  4IFE A;  1QVG M;  1QVF M;  2FSN A;  3AV9 A;  3HI0 A;  3O5B A;  4WQ5 C;  3D7E O;  4HUF A;  1RTD A;  3I55 N;  3C6T A;  3KWI A;  3K5N A;  4KAZ A;  3BP8 A;  4TSX A;  3NFA A;  4YOU A;  3P83 D;  3AA4 A;  2HW3 A;  4JAX A;  4FW1 A;  1TVR A;  3K2P A;  2QXL A;  1JLQ A;  3ISN C;  3K9J A;  5J2P A;  4OPK A;  5FLX O;  3LP0 A;  3K5M A;  3LWL A;  2YNG A;  4JS4 A;  2F9T A;  2E6L A;  1D4X A;  3K0S A;  2QTD A;  1RDU A;  3N4P A;  3SCX A;  5CE3 A;  3V1R A;  1NK5 A;  4KH5 A;  4ZTJ A;  2HOE A;  4CJT A;  1IG9 A;  2NRW A;  4H0Y B;  3AVI A;  3RSE B;  3WNE A;  3KK2 A;  1HYV A;  3QNO A;  4AHU A;  3O9S A;  4QS8 A;  2OZS A;  2KQ2 A;  3HTV A;  2Q97 A;  1RDC A;  5BN9 A;  3D6R A;  3D2E A;  4LFC K;  4H0T B;  4H0O A;  1Q9Y A;  5C10 A;  4LF9 K;  3CQY A;  3LPT A;  1JLC A;  2HHV A;  1JLE A;  4Q5V A;  2V52 B;  3EY1 A;  4H8K A;  4JI0 K;  1RT3 A;  4CJ7 A;  3K58 A;  3VPZ A;  3RMB A;  3DOL A;  4K0K K;  3PX0 A;  2G8I A;  4ISE A;  4NO7 A;  4FM1 A;  1NGF A;  3VQD A;  2OPP A;  1RNH A;  4U7B A;  3SV4 A;  3THW A;  1YJN N;  1NOY A;  4WCE L;  2QWO A;  4JD2 A;  3CJC A;  1QSL A;  2A5X A;  3CER A;  1VSL A;  4KH6 A;  1B92 A;  4CD1 A;  4IXC A;  2P9S B;  1JKH A;  3R9P A;  4O8U A;  3E9L A;  4H0X B;  4B9Q A;  3PX4 A;  1WAJ A;  1DKG D;  2PY5 A;  2YNI A;  4I7F A;  4E89 A;  4IDH A;  3MN9 A;  5CZ2 A;  2Q31 A;  3LDS A;  2YHW A;  4BR5 A;  4CJV A;  4LC9 B;  2HBK A;  1LWF A;  2GWJ A;  1IG8 A;  3M8R A;  4C8O A;  2BGG A;  4BDZ A;  1YF5 L;  4ZTF A;  3ULE A;  1T03 A;  3VEN A;  5BN8 A;  1C1C A;  4BQZ A;  3SAG A;  4Z94 A;  4ILH A;  1NKE A;  5I3U A;  3KD1 E;  3MWP A;  1LW0 A;  5JMV A;  3P31 A;  1N5Y A;  4MLH A;  1DLO A;  3NH2 A;  4DLE A;  5AZI B;  3U4L A;  3C6A A; 
#chains in the Genus database with same CATH homology
 4FK2 A;  3CYM A;  1Q8I A;  2JGU A;  5KTQ A;  1LAW A;  3VQ7 A;  1LAV A;  3EZ5 A;  4B9M A;  3TAQ A;  3OYB A;  1A5W A;  4KI6 A;  4F3O A;  4CK3 A;  3ZT4 A;  3SUQ A;  1S9E A;  1I39 A;  4CJ3 A;  3TAG A;  4ELV A;  1BL3 A;  1KLN A;  1JLA A;  1Y97 A;  3G10 A;  4PA1 A;  4ELT A;  4B3O A;  3V1Q A;  3SNN A;  3QIP A;  3NAE A;  1ZBU A;  3VQ4 A;  5HRS A;  1RBS A;  4H4M A;  4FXD A;  1BCM A;  1CZ9 A;  1BGX T;  2YKN A;  1U49 A;  3VQ5 A;  1RTH A;  5FRM A;  5E41 A;  4CK1 A;  4Z4H A;  4KHU A;  1RBU A;  2YNH A;  4W5T A;  3S3N A;  4W5R A;  4JRP A;  4FZZ A;  1ZBF A;  4CHY A;  1SKS A;  3KTQ A;  3WNG A;  4CFB A;  4IKF A;  2P51 A;  1TV6 A;  1ITG A;  2WON A;  3ASM A;  1BQM A;  2GUI A;  3OYC A;  3QES A;  4FJ5 A;  3NF7 A;  3AO4 A;  2XY6 A;  3MXM A;  4FM0 A;  2AJQ A;  3AVJ A;  3KK3 A;  1QE1 A;  2DFH A;  2ZQB A;  3L3V A;  4M3Y A;  4N56 A;  3AVC A;  1VSF A;  4BWJ A;  1T8E A;  4W5O A;  3NH0 A;  1Z26 A;  3AVF A;  2BDP A;  4FYD A;  1VSH A;  2HMI A;  5FRN A;  1NK9 A;  2EHG A;  3OS0 A;  3E01 A;  1NJW A;  4CEO A;  4CFA A;  4Q0B A;  4CEF A;  3V4I A;  5SZT A;  4AHR A;  2B4J A;  3IG1 A;  4NYF A;  3VN5 A;  4CJW A;  3HPO A;  3NGI A;  2XRI A;  4DU1 A;  4M3Z A;  4BE1 A;  5HP1 A;  3TAN A;  3SQ2 A;  4N5S A;  3OYE A;  4J2B A;  1EP4 A;  2PZS A;  4DSK A;  1LWC A;  3RRH A;  3O3H A;  4IFY A;  3L2Q A;  3SUP A;  3SJJ A;  3V9Z A;  1SL2 A;  2YNF A;  4C8K A;  2IGI A;  4CJQ A;  2HNY A;  4E7I A;  3SPY A;  1SV5 A;  3KLE A;  5KGW A;  4E1N A;  1KFS A;  2Z1J A;  4DQR A;  3AVK A;  3HK2 A;  4ELU A;  4ZHR A;  4RW6 A;  3KLI A;  3MEG A;  4OGE A;  3OYK A;  1L3S A;  1HJR A;  4CHO A;  3D45 A;  1SKR A;  3HM9 A;  3KIO A;  4C8M A;  3VQE A;  2HNZ A;  1J5O A;  3C95 A;  4KO0 A;  2PYJ A;  2YV0 X;  1NJY A;  3HVT A;  2KFZ A;  4CED A;  2FC0 A;  3OYL A;  4FJK A;  4DTR A;  1QSS A;  1VRU A;  2X6S A;  4K8X A;  1S9G A;  3O3F A;  4FJX A;  1L3V A;  1I3A A;  1TKD A;  4RW4 A;  2KTQ A;  1RBR A;  1SUQ A;  4KPY A;  2FBX A;  4CGH A;  1WNS A;  3VQP A;  2IDO A;  3AVB A;  2WOM A;  3RR7 A;  4E7K A;  2RKI A;  4RW7 A;  4B08 A;  4DMN A;  4QOZ B;  4Z0U A;  4NCB A;  4NCG A;  3AVL A;  1KVA A;  3L8B A;  4LY7 A;  3QER A;  2OZM A;  2HHU A;  1EX4 A;  3LP3 A;  3QIN A;  4I2P A;  4E7L A;  3V9W A;  1IKX A;  2IC3 A;  2KFN A;  4YFU A;  1NK4 A;  4FK4 A;  2KZM A;  3VQQ A;  5D3G A;  5J1E A;  2JLE A;  4FK0 A;  1J53 A;  3HST B;  3CG7 A;  4MQ3 A;  4OJR A;  1L3T A;  2F96 A;  4M45 A;  4DTN A;  1A5V A;  4R5P A;  5FDL A;  1FK9 A;  3MEC A;  4GVM A;  4EP5 A;  4CF9 A;  5HRN A;  1TGO A;  3RMA A;  1ZYQ A;  1WLJ A;  4CGF A;  1TK0 A;  5DK5 A;  3WNF A;  3PO4 A;  3KKS A;  1L3U A;  4IFV A;  2B5J A;  4N76 A;  2A1S A;  4RG8 A;  1WSE A;  2Z1H A;  3C6U A;  3DOK A;  4DG1 A;  3NH1 A;  4BAC A;  3HPG A;  3V9X A;  2Z1G A;  1NKB A;  1RTJ A;  1K6Y A;  3OYG A;  3VQC A;  4NYN A;  4CJU A;  1JL1 A;  3AO2 A;  4PUO A;  3DRR A;  4O0J A;  2KW4 A;  4DU3 A;  3SZ2 A;  2P5O A;  2HVH A;  1SL1 A;  2G8U A;  4FJH A;  3NHG A;  3B6P A;  4B8C A;  3OS1 A;  3HL8 A;  1D8Y A;  3K57 A;  1B9D A;  4Z4G A;  5JS1 A;  1T05 A;  1BIZ A;  4OKJ A;  4CJE A;  3RRG A;  2QXF A;  1RCH A;  4W5N A;  2Q3S A;  5J2Q A;  3VA3 A;  1X1P A;  2YKM A;  4DTM A;  4F3T A;  1HYZ A;  4I9Q A;  4FM2 A;  4F8R A;  2D0B A;  4FJI A;  4OLB A;  2F8T A;  3THV A;  1QS4 A;  2D0C A;  3QEX A;  3TR8 A;  1HMV A;  2ZE2 A;  4ICL A;  4M41 A;  4EZ6 A;  1EET A;  1CZB A;  1YTA A;  3S3M A;  3UIQ A;  3OJU A;  2G8H A;  1LV5 A;  1QQC A;  4I9L A;  3NF6 A;  4IG3 A;  4IG0 A;  2ITG A;  1UOC A;  2HB5 A;  4HCC A;  1VSD A;  2XY8 A;  3NDK A;  3T3F A;  3TI0 A;  4CF2 A;  4N47 A;  1ZBL A;  4XIU A;  4KHQ A;  3ZSX A;  4UQG A;  3NGZ A;  1X9S A;  2XY7 A;  4FLV A;  3AA2 A;  1ASU A;  3NBP A;  3ZT1 A;  1KVB A;  3LWM A;  5J2N A;  4CF1 A;  3PY8 A;  1FXX A;  1NK7 A;  4FJJ A;  3DLR A;  4CFC A;  4OVL A;  3ALY A;  5K14 A;  4HUG A;  4DQS A;  2FBT A;  2RPI A;  4CHP A;  4FLX A;  4M3W A;  3I0S A;  2HHW A;  1JXB A;  4N41 A;  2XO7 A;  3AVH A;  3EYZ A;  3C94 A;  1JLG A;  4YNQ A;  4M3T A;  4G1Q A;  4K8Z A;  4AHC A;  4CGJ A;  4L8R B;  3L2W A;  4CIG A;  3QIO A;  5EU7 A;  1C6V A;  2HHQ A;  4I2Q A;  3TWH A;  3KLF A;  1RT4 A;  5HRR A;  3V6D A;  1HQU A;  4M42 A;  2OPQ A;  3T1A A;  2W42 A;  1NJX A;  1YTU A;  3HYF A;  2OA8 A;  3V1O A;  3ZSR A;  1S5J A;  1RBV A;  3OYF A;  3KD5 E;  1G15 A;  3NGY A;  3ZCM A;  4CJ5 A;  3K59 A;  1NK0 A;  1C0U A;  1UWB A;  2E6M A;  3VQ8 A;  4CEZ A;  3SI6 A;  4AH9 A;  4DQP A;  1WN7 A;  4DF4 A;  1MU2 A;  4B9U A;  1JL2 A;  3NCI A;  4OPJ A;  2G8V A;  1KRP A;  4FJ7 A;  1BI4 A;  1XHZ A;  1TL3 A;  3G0Z A;  1IKY A;  1FKP A;  1KVC A;  1TAQ A;  2X6N A;  4B9L A;  3V9S A;  3TAF A;  4EZ9 A;  1RT7 A;  1U04 A;  2HHS A;  4DU4 A;  2IAJ A;  5JS2 A;  1T7P A;  4DQI A;  4E1M A;  3QLH A;  4KRE A;  5KGX A;  1ZBI A;  4CEQ A;  1TKX A;  1J9A A;  4KTZ A;  1QHT A;  1D9F A;  3RMC A;  1XWL A;  1REV A;  4IDK A;  2ZD1 A;  4M3R A;  1QTM A;  1HPZ A;  4JRQ A;  2G8W A;  4E19 A;  1HRH A;  2O4G A;  3LAL A;  1HNV A;  2OPS A;  2X74 A;  1RDB A;  4E7J A;  1RT5 A;  3SUN A;  4O0I A;  3CQ8 A;  1HQE A;  2VWK A;  1GOB A;  1IO2 A;  2BE2 A;  4OLA A;  5KI6 A;  4F4K A;  2G8K A;  4KHY A;  1BHL A;  4QAG A;  3H08 A;  4KHS A;  3SPZ A;  4E0D A;  4RW9 A;  1S1V A;  3V81 A;  2HHX A;  4DF8 A;  3VA0 A;  2HVI A;  3IS9 A;  3DRP A;  4KKO A;  4CCH A;  4DSL A;  3CFR A;  3QEI A;  4O5B A;  3S9H A;  1SKW A;  4CE9 A;  4F2R A;  1VSM A;  1F21 A;  1YVU A;  3ZT3 A;  1DTQ A;  3QO9 A;  4LSL A;  4CFD A;  3QET A;  3M8S A;  2DTU A;  4IBN A;  4HCB A;  1RT6 A;  3ZSY A;  4B9T A;  4E7H A;  4O55 A;  2FBY A;  2B6A A;  3DRS A;  3AA5 X;  4B9S A;  2HHT A;  2IOC A;  1GOA A;  2BAN A;  4CHZ A;  4DSE A;  2A1R A;  1QSY A;  3LAK A;  1VSK A;  4CF8 A;  3FFI A;  4DSI A;  4KHW A;  1KSP A;  4KI4 A;  4NCA A;  1NOZ A;  4KTW A;  3F73 A;  4FCY A;  2GV9 A;  4FJM A;  1WSJ A;  1KCF A;  5KRS A;  1IKW A;  3SQ4 A;  3LP1 A;  4HUE A;  1U47 A;  3ULD A;  3OYI A;  2NUB A;  1FKO A;  2F8S A;  4CEB A;  1RDD A;  1S1W A;  4BWM A;  1UAX A;  4CJL A;  1TK5 A;  3LPU A;  3O3G A;  3KKR A;  5I42 A;  1A5X A;  5CYM A;  4FLY A;  4Z4I A;  5SWM A;  3T19 A;  3WNH A;  3OYM A;  4DTU A;  3DYA A;  3HP6 A;  3SUO A;  3ZSV A;  4FLW A;  3OJS A;  3DLE A;  1CXU A;  4E3S A;  3PV8 A;  4CEA A;  2R7Y A;  4ID5 A;  1RTI A;  3BGR A;  4FJ8 A;  3VQ6 A;  4KTQ A;  4JLH A;  3P1G A;  3RTV A;  4B9V A;  3AVA A;  5DMR A;  2RF2 A;  3AO1 A;  2I5J A;  3K5O A;  1BIU A;  1U4B A;  1X9M A;  3HXM A;  4O44 A;  4DLE A;  4GW6 A;  4KFB A;  4DLG A;  3OYA A;  3LZI A;  3KLH A;  1RT1 A;  1TKT A;  2XY5 A;  1N6Q A;  3PO5 A;  4CHN A;  2OYQ A;  4KRF A;  4CHQ A;  1HYS A;  3MXI A;  2VG7 A;  1J54 A;  3HT3 A;  5KRT A;  4DS5 A;  1TL1 A;  1C1A A;  2OPR A;  2LSN A;  1BQN A;  3SQ0 A;  3LP2 A;  1B9F A;  1U45 A;  4B8A B;  4FJN A;  4AIL C;  1U48 A;  4RW8 A;  3LAM A;  1LWE A;  4MFB A;  3PUF A;  1W9H A;  4FZY A;  4LSN A;  1XC9 A;  3DLK A;  4OKK A;  1KFD A;  3ZSZ A;  1NJZ A;  4KB0 A;  4CEE A;  3AVN A;  4HTU A;  3MED A;  2G8F A;  4FJG A;  4QCL A;  4JS5 A;  4CJF A;  1IH7 A;  3KJV A;  3AVG A;  1D9D A;  4EP4 A;  4CJR A;  3VQB A;  4CJS A;  3DLB A;  2P5G A;  4CIE A;  3ZT2 A;  2IS3 A;  3ZSW A;  4KHN A;  1DTT A;  1C1B A;  3S3O A;  3RWU A;  3OYD A;  1S1U A;  3TAR A;  1RDA A;  3QNN A;  1XHX A;  4J2E A;  3AO5 A;  3BDP A;  1X9W A;  4AHS A;  1RBT A;  3DMJ A;  3SV3 A;  1Q9X A;  1S6P A;  1UA1 A;  1EKE A;  4DFP A;  4HVJ A;  3HP9 A;  3U3G A;  4DSJ A;  4DWI A;  2E4L A;  2QK9 A;  5C42 A;  4FJL A;  1L5U A;  1TK8 A;  4BDY A;  2XHB A;  3D0P A;  4FLT A;  1VRT A;  3A2F A;  1JLB A;  4GMJ B;  3L2R A;  5C25 A;  2DY4 A;  1SL0 A;  3V9U A;  1NKC A;  1YT3 A;  3O4N A;  3AV9 A;  3LAN A;  4CIF A;  4HUF A;  1RTD A;  1JLF A;  1TKZ A;  3C6T A;  3K5N A;  4FLZ A;  4KAZ A;  2Z1I A;  4OKE A;  3L2V A;  1VSJ A;  3PX6 A;  4TSX A;  3NFA A;  3NF8 A;  3P83 D;  4M3X A;  1Z25 A;  1ASV A;  3AA4 A;  5CYQ A;  4BE2 A;  1WSF A;  3HJF A;  2HW3 A;  4FW1 A;  1TVR A;  3K2P A;  3OYJ A;  1JLQ A;  3ISN C;  1KTQ A;  4OPK A;  3L3U A;  3HVR A;  3LP0 A;  4DTO A;  5J2P A;  3ZSQ A;  3K5M A;  3LWL A;  3AVM A;  1ZBH A;  2FBV A;  2YNG A;  3O4Q A;  3I0R A;  3MEE A;  4JS4 A;  3I8D A;  4CJ4 A;  1C0T A;  3M8P A;  2E6L A;  3SYZ A;  3U6F A;  4LD0 A;  3CM5 A;  4DTS A;  3AO3 A;  2P1J A;  1RIL A;  3IAY A;  1WAF A;  3DM2 A;  1D5A A;  3JYT A;  3SCX A;  2QKK A;  4Z4E A;  4CGI A;  3V1R A;  2YHB A;  4WE1 A;  4CK2 A;  2Y1I A;  4ZTJ A;  1CXQ A;  4H4O A;  4AHV A;  1NK5 A;  4CJT A;  1IG9 A;  2ETJ A;  3AVI A;  1JXE A;  2VG5 A;  3CM6 A;  3WNE A;  1HYV A;  4C8N A;  2ATQ A;  3KK2 A;  4DS4 A;  3QNO A;  5HBM A;  5C24 A;  1XI1 A;  2PYL A;  2DFF A;  5FRO A;  4AHU A;  3ZSO A;  4DTJ A;  3OY9 A;  2OZS A;  1VK0 A;  3DLG A;  2KQ2 A;  3TAM A;  4DTX A;  1RDC A;  4ID1 A;  4FJ9 A;  3AA3 A;  2KZZ A;  1VSE A;  1W0H A;  3OS2 A;  4PQU A;  3RR8 A;  1Q9Y A;  4FLU A;  3LPT A;  1BIS A;  1JLC A;  3ZT0 A;  2HHV A;  1JLE A;  4Q5V A;  4DSF A;  3TAE A;  1KLM A;  3VQ9 A;  1WSG A;  4H8K A;  4CF0 A;  3EY1 A;  3L2U A;  1RT3 A;  3K58 A;  2HND A;  1WSI A;  2YHA A;  4DQQ A;  4C8L A;  3LZJ A;  3RMB A;  1ASW A;  2D5R A;  1GOC A;  3CFO A;  4Z4F A;  1WSH A;  1TAU A;  1S1X A;  3DLH A;  4KB1 A;  3DOL A;  3K5L A;  3PX0 A;  2VG6 A;  2X78 A;  4Y1C A;  4FM1 A;  2G8I A;  4FZX C;  3VQD A;  2OPP A;  1NK6 A;  3OYH A;  3MAQ A;  1RNH A;  4J2A A;  3SV4 A;  1NOY A;  3KK1 A;  3NF9 A;  4CER A;  4W5Q A;  4DFM A;  4B9N A;  3HPH A;  3QEP A;  1QSL A;  1LW2 A;  3IRX A;  1NK8 A;  3M8Q A;  4FVM A;  1VSL A;  4BDP A;  1IKV A;  2RN2 A;  1S1T A;  3DI6 A;  4J2D A;  1B92 A;  3P5J A;  4CEC A;  1EXQ A;  1JKH A;  3U3Y A;  5HRO A;  1RT2 A;  4Z4C A;  3RMD A;  2O4I A;  4FW2 A;  1S6Q A;  4CGD A;  3PX4 A;  4PWD A;  4OGC A;  3MXJ A;  3B6O A;  3OVN A;  1WAJ A;  4HHT A;  5J2M A;  4KV8 A;  4Y1D A;  2PY5 A;  4PY5 A;  1O1W A;  2YNI A;  4I7F A;  4CJP A;  4E89 A;  5HLF A;  3HO1 A;  1C0M A;  2EX3 A;  4LH5 A;  3ITH A;  5CZ2 A;  4LH4 A;  5T7B A;  5CY4 A;  4DFJ A;  3QEV A;  3LDS A;  3TAP A;  4CJV A;  3QEW A;  1BCO A;  1LWF A;  2VWJ A;  1BI4 B;  3M8R A;  4C8O A;  1HNI A;  3KLG A;  2BGG A;  5CZ1 A;  1R0A A;  2DFE A;  4BDZ A;  4DFK A;  4ZTF A;  3F9K A;  1T03 A;  1CLQ A;  2GBZ A;  4F2S A;  1UA0 A;  1C1C A;  4AHT A;  4CES A;  4CJK A;  3VQA A;  2D0A A;  4O4G A;  4CGG A;  3SQ1 A;  1NKE A;  3OYN A;  4BE0 A;  5I3U A;  3KD1 E;  3TAB A;  1LW0 A;  2QKB A;  1N5Y A;  3CFP A;  2Y1J A;  4M3U A;  1DLO A;  3NH2 A;  3JSM A;  3NE6 A;  4DTP A;  5HRP A;  1VSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...