2P51A

Crystal structure of the s. pombe pop2p deadenylation subunit
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
255
Chain Sequence
SQISPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, gene regulation
molecule keywords SPCC18.06c protein
publication title The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 89
structure length 255
sequence length 255
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p51A00
4IBNA 1A5WA 4F3TA 3SNNA 1JKHA 4CJFA 5KGXA 4I9QA 3IS9A 3QNNA 1T03A 3CG7A 4F2RA 4Q0BA 4DSFA 1Q8IA 4FXDA 4OLBA 4ID1A 4CERA 4N76A 1VK0A 2IS3A 1D9DA 2G8WA 2OZSA 1CXQA 3VQ4A 1NOZA 3TARA 4FJGA 3LAMA 4OGEA 3SUPA 3M8RA 1T7PA 3CM5A 3TWHA 3HL8A 4RW9A 3AVMA 4IKFA 1SKRA 2P5GA 3PO4A 2D0BA 3IRXA 4FW2A 3HXMA 1L3VA 1ZBUA 4CJ4A 2PYJA 3AO4A 1WSHA 4IFYA 4BDZA 3V9SA 1RT3A 2Z1HA 3SQ2A 1KSPA 3QEXA 3NH0A 3RR8A 3K5OA 3QLHA 4Y1CA 2EX3A 1ZBLA 3HVTA 3AVCA 3AO5A 4KHUA 1J54A 4BACA 2PY5A 4RG8A 4E7IA 1BCMA 3QESA 3V4IA 1HQEA 3TAFA 3DLGA 3ULDA 4DQQA 1BHLA 4DTMA 3IAYA 2HHTA 1RBTA 1NJWA 4DSIA 3B6PA 3O3GA 3MEEA 5EU7A 1T05A 1C1AA 5FROA 3WNFA 4JRPA 2A1SA 4KHWA 1SUQA 2RF2A 4JRQA 2X74A 3TAQA 4GVMA 3VQ6A 4AHVA 4CGGA 1S1VA 4OJRA 3NH1A 4CF8A 4CJ5A 1DLOA 5KI6A 3LPTA 4M3RA 4CJRA 1TKTA 1L3UA 1QTMA 2QKKA 1LW0A 2HHSA 5I42A 3ITHA 2PYLA 3OS1A 3S3NA 3NH2A 4KRFA 1I39A 3OYHA 3EZ5A 4DF8A 5HLFA 3L2WA 2HMIA 1YT3A 4M3XA 4M3UA 2QK9A 3T1AA 4Z4EA 3M8PA 1HNIA 4O4GA 1VSJA 4CJVA 1U45A 3SPYA 1NK7A 2KZMA 3RR7A 3KLHA 4N5SA 3L2RA 1TGOA 4DLEA 4FM0A 1MU2A 3NGZA 4KKOA 2HHWA 4CHQA 1LW2A 4FK4A 5J2MA 4K8ZA 3AVKA 4DTSA 1EXQA 2RPIA 4M3YA 4HUFA 4CGJA 3JYTA 3G10A 5J2QA 3ZT3A 1HMVA 1YVUA 4E1MA 4YNQA 4O0IA 2XO7A 4Z0UA 5HRSA 3KTQA 2XY6A 1NK8A 3EY1A 3AA4A 1XHXA 4OKJA 1BIZA 5DMRA 4KI6A 3U6FA 4M3TA 3SV4A 4CHYA 1VSKA 2RN2A 2Z1GA 4QAGA 4HVJA 1LWFA 5J1EA 4JS5A 3RMDA 1UWBA 3QINA 3M8SA 4DQIA 1I3AA 3AO3A 3OYLA 3NE6A 4J2AA 4ID5A 1QQCA 2HHQA 3OYFA 4E1NA 4DMNA 3VQDA 4B9TA 4E7LA 1NK0A 4W5NA 2DY4A 1EETA 2VWKA 3LP0A 3U3YA 4PQUA 5SZTA 4DQRA 1VSLA 4PY5A 1S6QA 5CYQA 3V6DA 1D9FA 1DTQA 2IDOA 3CFRA 4CE9A 2G8KA 4DTUA 3O3FA 3VQBA 1N6QA 3IG1A 1S9EA 4CHNA 1U04A 4CF1A 3RMBA 1FKOA 3F9KA 4RW7A 2VG7A 2B4JA 4CJTA 1GOCA 4C8OA 1VSEA 3SQ4A 2YNIA 1Z25A 4LSNA 1KVCA 1JLAA 3ISNC 1ZBFA 5D3GA 2A1RA 4HCCA 3V9ZA 1LAVA 4FJ9A 3KKRA 4BDPA 1IKWA 4FJ8A 2G8FA 4CGFA 4DTOA 3KJVA 3VQAA 3NF7A 4CK2A 4CEZA 1IKXA 1BQNA 3TAPA 1U47A 3MXIA 3PO5A 2FBVA 1RT5A 3OJUA 3TI0A 1KCFA 4DTXA 4CGHA 4CJKA 4M3ZA 2X78A 1QSYA 4CJ3A 2D0CA 3QEVA 5FRMA 4ELVA 1SL2A 3NFAA 1RDBA 1NJYA 4YFUA 4DTPA 4B9VA 3RWUA 1VRTA 4AH9A 1SKSA 4TSXA 5HROA 3LZIA 3KLIA 3H08A 4O55A 4CFDA 3CFOA 3V81A 1T8EA 5HBMA 1NK9A 3S3OA 4KHQA 1QHTA 4CGDA 4I2QA 3AVJA 3DM2A 4HHTA 5JS1A 4QOZB 3NCIA 4M41A 3OS2A 3PX4A 3FFIA 3O3HA 3L3UA 4EP5A 3L8BA 2E6MA 2Z1JA 1S1TA 3LAKA 4DLGA 1L3SA 4ZTJA 4CIEA 3CQ8A 3L3VA 3K59A 1RT6A 5KGWA 3K5NA 3K58A 3OYDA 3TAEA 1RDDA 3AVNA 3TR8A 4N56A 2XY5A 1WAFA 1C1CA 1TK8A 3HPOA 1HQUA 4H4MA 1J9AA 3TAMA 1JLFA 2HNYA 4E7KA 1F21A 2P5OA 1D8YA 2PZSA 4C8NA 2QXFA 4Z4FA 4KREA 3PV8A 3DLEA 3HPGA 3AVLA 4FJ5A 5CYMA 2JLEA 1KTQA 3VQQA 4UQGA 1RBVA 3AV9A 2YKNA 3AVFA 1SV5A 1W0HA 4FJMA 1CZBA 2P1JA 3F73A 4DSLA 2KFNA 2RKIA 4E19A 2FBXA 3AVIA 4KFBA 1S6PA 3NGYA 1JLCA 3ZT4A 2XHBA 2Z1IA 5C25A 4FLTA 3LANA 4W5TA 4J2DA 3I0SA 4FLYA 4E7JA 3KLFA 4DQPA 1K6YA 4W5QA 2P51A 2Q3SA 1YTUA 3DMJA 4KAZA 1U49A 4EZ6A 3O4NA 4E7HA 4FJXA 2VWJA 4EP4A 4NCBA 3TABA 4CEBA 2HW3A 1ITGA 4LY7A 4DQSA 3DRRA 1ZBIA 3KIOA 5FRNA 1L5UA 2KFZA 1HYVA 3LWMA 3P83D 4CECA 4FLVA 2JGUA 3SPZA 4F4KA 4J2EA 4OLAA 2EHGA 3AVGA 5CZ2A 3SCXA 4KPYA 1NK6A 4L8RB 4Z4GA 3TAGA 5HP1A 4B9SA 3AVBA 3DRPA 3V1QA 2G8VA 1TKXA 3RRGA 4PA1A 1BGXT 3OVNA 2XY7A 3ZT2A 4FVMA 3OJSA 4H8KA 2GV9A 4IG0A 4O44A 2E6LA 1JLBA 1WAJA 4CF2A 3OYCA 3DI6A 5CY4A 1BI4A 1UOCA 3ZSZA 3EYZA 3SYZA 1WSFA 1HYZA 2OA8A 4C8LA 4F2SA 4DSEA 5HRNA 4ELTA 4CHZA 3HK2A 4FCYA 2HHXA 1TVRA 3T19A 4CJSA 3DYAA 3OYJA 1RNHA 4CK1A 4XIUA 3UIQA 2YHBA 2B5JA 4DFKA 3MXJA 1CXUA 4CFAA 1QSLA 2ZE2A 3SQ1A 3ZSQA 3LP2A 3CYMA 4ICLA 3P5JA 1HRHA 3O4QA 3I8DA 3NHGA 3P1GA 3SUQA 2XY8A 2BE2A 4DFPA 3KLEA 2BGGA 2FBTA 3RMAA 3LP1A 4Q5VA 3E01A 1QE1A 3VA3A 1KFSA 4DWIA 4E0DA 2KTQA 4FJHA 1RDCA 4FJIA 4F8RA 3QIOA 4ZHRA 2GUIA 4IG3A 3RMCA 3VQ9A 3VQ8A 4B08A 3DLRA 4NYFA 4AHUA 1O1WA 1NKEA 4KB0A 1EX4A 2OPPA 1CZ9A 3DLBA 3PX6A 4BDYA 4FYDA 1JL2A 2IAJA 4CGIA 5I3UA 1U48A 4CEDA 4EZ9A 1KVBA 4F3OA 2QKBA 3ZSVA 3LDSA 4KHSA 3NGIA 4ELUA 3G0ZA 2Y1IA 3ZSXA 4N47A 4FZXC 3L2QA 3ASMA 3S3MA 1BCOA 3WNGA 4CEQA 3VQCA 3OS0A 4DTNA 3KK3A 4OVLA 4RW4A 5J2PA 5KRTA 3A2FA 2Y1JA 4J2BA 1WSGA 4AHSA 3ZSRA 4OKKA 4DF4A 1RT2A 4CJPA 1JLEA 2DFFA 3K57A 4FLWA 1RTHA 1TKDA 4FK0A 4G1QA 1XHZA 2XRIA 1GOAA 3K5MA 3HO1A 2ZQBA 5HRRA 3SQ0A 1C0UA 3AVAA 4CFCA 4GW6A 3ZSYA 1RBRA 3K2PA 4IDKA 1A5XA 1GOBA 4DG1A 1TK0A 2O4GA 1B92A 1A5VA 2DFHA 1RBUA 1S1XA 2LSNA 1KVAA 3AO2A 2DTUA 4FLUA 1LV5A 3V9XA 1RCHA 1RTJA 3V9WA 4KTWA 3MAQA 4W5RA 3ZT0A 3NF6A 4AHTA 4LH4A 1JXBA 3V9UA 1X9MA 1HNVA 4PUOA 2R7YA 3C6TA 4B9LA 4KTZA 3VN5A 4K8XA 5KTQA 3AA5X 4I2PA 1DTTA 5KRSA 3BDPA 1IH7A 1LAWA 1WSJA 4B8CA 4FJJA 1ZBHA 3HM9A 3LP3A 2GBZA 4E3SA 3D45A 1KRPA 3T3FA 3S9HA 1JXEA 1JL1A 3CM6A 4KHYA 2YV0X 3SUNA 2OPRA 4FJ7A 4NCAA 4M3WA 5E41A 4BWMA 3SV3A 4HUGA 1RT1A 2HHUA 3LPUA 3OYEA 3PX0A 3QEIA 3RRHA 1YTAA 1S1WA 4LD0A 2OPQA 1UA0A 4CEOA 1HPZA 1UAXA 4M45A 1C0MA 2G8UA 4FJNA 1C6VA 4CIGA 4CESA 1XI1A 3QERA 1RTIA 3AA3A 2HNZA 4O0JA 3L2UA 4DU4A 1LWEA 1C1BA 4B9UA 1WLJA 4KHNA 3C6UA 4CIFA 1TAQA 4DFJA 4M42A 1S5JA 1JLGA 2FBYA 3DRSA 4OGCA 5K14A 4HUEA 2OZMA 2WOMA 3I0RA 4LH5A 3JSMA 4CJLA 4I7FA 3MECA 4MFBA 5C24A 3THVA 4OPKA 1X1PA 1BL3A 1X9WA 4R5PA 3OYIA 2YNHA 3NDKA 3HYFA 4BE1A 2E4LA 4DU3A 4CCHA 2FC0A 2X6NA 3DLHA 2KZZA 3ZT1A 2ZD1A 1N5YA 3MEDA 2DFEA 4I9LA 1S9GA 1TL3A 4AILC 2YKMA 3NF8A 1UA1A 4FZZA 1RDAA 1VSIA 3LALA 3NBPA 4KO0A 3VQ7A 4CHOA 4HTUA 2ETJA 3ZSWA 4JS4A 2D0AA 1BQMA 1RBSA 2X6SA 3DOKA 3VA0A 4FW1A 1SL0A 1FXXA 2HNDA 5FDLA 5J2NA 3KKSA 4NYNA 4B9NA 1VSDA 3WNHA 1JLQA 3V1RA 2F8TA 3NF9A 4BE0A 1R0AA 4Z4CA 3OY9A 3D0PA 1FK9A 1RTDA 1IKVA 3NAEA 3ZCMA 3QEWA 1TV6A 4GMJB 1W9HA 4Z4IA 3KK1A 4DS4A 2VG6A 4CJWA 3OYGA 3RTVA 4DSJA 3K5LA 1BI4B 1EKEA 2I5JA 3B6OA 5T7BA 3KD1E 4KTQA 4ZTFA 4AHRA 3OYBA 1WN7A 5CZ1A 3SJJA 1J5OA 4FK2A 3PUFA 2IOCA 4C8MA 1BIUA 2YNFA 2F8SA 3OYKA 5C42A 3BGRA 3U3GA 4FM1A 1VSFA 1ASVA 3HSTB 3SUOA 3AVHA 1IG9A 1REVA 1VSMA 1S1UA 4Z4HA 1BISA 1C0TA 1B9FA 1ASWA 3HP9A 4JLHA 4B3OA 3QNOA 1NJXA 1IO2A 4CEAA 1HYSA 2BDPA 4CJEA 2WONA 1RT4A 4O5BA 1WSEA 2HB5A 4FJLA 1ZYQA 4QCLA 3MXMA 3PY8A 4FM2A 2ATQA 3V1OA 1RT7A 4DS5A 4BWJA 2HVIA 2OYQA 2IGIA 2HVHA 4FLXA 5SWMA 4MQ3A 2OPSA 4CK3A 3TANA 3SI6A 1TAUA 1WNSA 3C95A 4KV8A 4RW6A 4CEEA 3C94A 2VG5A 4RW8A 1CLQA 3LWLA 3HP6A 1SKWA 1HJRA 3KD5E 1LWCA 4BE2A 3ALYA 4DTJA 4FZYA 1ASUA 1NKBA 2YNGA 3SZ2A 1NKCA 1Q9XA 2ITGA 1X9SA 4OKEA 2W42A 1VRUA 4CJUA 1XC9A 1KFDA 1J53A 1NOYA 3DLKA 4CF0A 3AA2A 3MEGA 5DK5A 5JS2A 3L2VA 3HJFA 5HRPA 1Z26A 3KLGA 4DTRA 4LSLA 3ZSOA 1TK5A 3VQEA 1L3TA 4CHPA 4Y1DA 3VQPA 2BANA 3QETA 4HCBA 4AHCA 1TL1A 3LZJA 2B6AA 1KLNA 1WSIA 3AO1A 4CEFA 3OYNA 4WE1A 4KB1A 4N41A 1B9DA 1RILA 1SL1A 2KW4A 4OPJA 1Y97A 4B8AB 3QO9A 1VSHA 2YHAA 1G15A 1XWLA 3OYMA 2G8HA 4NCGA 1IKYA 4C8KA 4FJKA 2G8IA 1NK5A 1QS4A 2NUBA 4B9MA 3KK2A 3CFPA 2IC3A 2O4IA 4FLZA 4KI4A 4CJQA 1FKPA 4H4OA 1NJZA 4DSKA 4CF9A 2KQ2A 2D5RA 4DU1A 4DFMA 2F96A 3QEPA 1TKZA 1EP4A 4IFVA 1QSSA 3HPHA 2HHVA 4E89A 3HT3A 3OYAA 1U4BA 4CFBA 1Q9YA 3WNEA 1KLMA 4W5OA 1D5AA 1NK4A 3VQ5A 4PWDA 3M8QA 3DOLA 2AJQA 3QIPA 3HVRA
chains in the Genus database with same CATH superfamily
4IEIA 4F3TA 3MX2A 2P9UA 1D4XA 4GKKK 3TTDA 3D6RA 4ID1A 1QQOA 4KH4A 4CI6A 4B1UB 1D9DA 1CXQA 2NRXA 4H5TA 3CM5A 3HL8A 1K8AO 4IKFA 3AVMA 3PO4A 3HXMA 4YOYA 1NGFA 1ZBUA 3SLCA 3V9SA 3SQ2A 3M6GA 3NH0A 5GIOA 4I6MB 3LDOA 1X3NA 2E20A 4BREA 4BACA 2PY5A 3QESA 4CZFA 2P9IA 2HHTA 4DSIA 1EQYA 4JRPA 3JS6A 2A1SA 3A5LC 2X74A 2P9PA 4GVMA 4FWQA 1NGBA 4JI2K 3SAHA 3O80A 1TKTA 3LL3A 1Q7YO 2HHSA 3ITHA 4PKGA 1I39A 3EZ5A 2VCPA 4Z4EA 1NK7A 3FZLA 3WXMB 1VHXA 4K25A 4BY9C 4FM0A 4KKOA 3CMEN 5M1NA 4FK4A 3AVKA 4M3YA 3ZT3A 4DQ8A 3CCQN 1NK8A 5FPEA 5AQVA 5LJVA 4CCHA 4JS5A 4CZIA 1LWFA 4IFEA 1Q81O 1J6ZA 3NE6A 4ILHA 5BN8A 4BRAA 2HHQA 3OYFA 3VQDA 4BRLA 4BRPA 2VWKA 2W41A 3LP0A 3DJCA 5AZJB 1DTQA 3R9PA 2GX9A 4DTUA 4WFAL 3VQBA 1S9EA 1K8KB 4CF1A 4FWRA 4CJTA 1KXPA 3U9DA 2YNIA 2VYPA 4BC2A 3V9ZA 2QI2A 4FJ9A 3KKRA 1U2VB 3EE9A 4FJ8A 2F9TA 4BROA 4CGFA 4DTOA 3VQAA 1IKXA 3TAPA 4GV9A 4M3ZA 3EO3A 3NVKA 3QEVA 3O1WA 4ELVA 3NFAA 3F2KA 5HOOA 3RWUA 4JHDB 2QWOA 3H08A 3IMXA 3V81A 1HNWK 4I2QA 1SAZA 3AVJA 5JS1A 3VENA 3FFIA 1C0FA 3N4QA 2QM1A 3O9SA 3LAKA 4DLGA 1OH7A 3CQ8A 3K5NA 4IO9L 5BRDA 3OYDA 1BDGA 1TK8A 1NMDA 3BF3A 1J9AA 1WUAA 2I7NA 2PZSA 4FO0A 2QXFA 3ZETB 3PV8A 4YOUA 3HPGA 3D2FB 2JLEA 1T3VA 4BR9A 4R79A 4E19A 3NGYA 2E2OA 2Z1IA 4QS8A 4FLTA 2GEMA 1ZC6A 2Q3SA 3O4NA 2HW3A 3GBTA 3DRRA 3MX5A 4CECA 4FLVA 2JGUA 4J2EA 1NGAA 2EHGA 5CZ2A 3SCXA 4L8RB 1NK6A 3BUZB 5HP1A 3CQYA 2O8DB 4LF5K 1ATSA 3FZKA 3ZT2A 4X66K 4FVMA 5AQOA 1WAJA 3B8AX 4BRKA 5AQUA 4C8LA 4DSEA 4H0XB 2UXCK 2P9LA 3HK2A 2HHXA 5BRFA 3HBTA 1P90A 3ZSQA 3MCAB 3LP2A 3VTIA 2NNWA 3QBXA 1QQNA 3D7EO 3P1GA 5AQPA 3SUQA 2XY8A 3KLEA 4KHPK 2FBTA 4H5RA 4XH1A 1BU6O 3TTFA 1KFSA 5CHIA 4DV5K 1RDCA 3VETA 4IG3A 1YXQA 1DKGD 3VQ9A 4NYFA 3O1BA 1NKEA 5AR0A 3RSEB 2O8FB 5AFUH 3DLBA 3C6HA 4B1WB 2QWNA 3P38A 5I3UA 1U48A 1KVBA 4F3OA 4JNEA 2A5XA 2AA4A 3LDSA 4JKGB 4DV4K 2IIRA 3A0IX 5FPMA 1YF5L 2FF6A 4A57A 1MDUB 4BG9A 1BCOA 1J5EK 4CEQA 3KK3A 4BVPA 4OVLA 4RW4A 3IKMA 4AHSA 5B8HA 1TKDA 4CJPA 2DFFA 3CC4N 3G71N 2CGKA 1VQMN 3HO1A 3AVAA 3VOVA 4CFCA 4RCHA 1RBRA 3A5MC 1GOBA 3FR0A 4JV5K 2W40A 2GTDA 2DFHA 4BQZA 1V4SA 2LSNA 1KVAA 3AO2A 3MAQA 1NGCA 3ZT0A 4PUOA 4AQYK 4B9LA 5LJWA 3AA5X 3C7NA 4I2PA 1WSJA 4FJJA 4E3SA 3LP3A 4U67L 1NWKA 3T3FA 3S9HA 1JXEA 4KHYA 4AM7A 4B1VA 3BP8A 4BWMA 4H03B 4H0PA 2HHUA 3OYEA 4IOAL 4LD0A 1UA0A 2P9NB 4B3MK 2G8UA 1C6VA 5AQWA 1RTIA 4DU4A 4KHNA 4BRIA 2CH5A 4PHTX 3THWA 4HUEA 2WOMA 2HF4A 3I0RA 3JSMA 1JCGA 4I7FA 4OPKA 1X1PA 4YDUC 5C2FA 3OYIA 2E4LA 3THYA 5KQ8A 4DU3A 4DR4K 3DLHA 4HWIA 1N5YA 2DFEA 2ZWHA 4I9LA 1TL3A 4GNIA 2ZGYA 3VQ7A 4BGBA 4FWNA 2D0AA 2X6SA 1E3MA 3MK6A 2Q0RA 2HNDA 3KKSA 2KKZA 3KVGA 3NF9A 4U7BA 3K0SA 4BE0A 3D0PA 1FK9A 3R1XA 3PIPL 4FWSA 1RTDA 4GMJB 4Z4IA 3KK1A 3CERA 4C1NK 4BRQA 3OYGA 1BI4B 4XH4A 3KD1E 3AY9A 5KPRA 3CQXA 3OYBA 1FW6A 1J5OA 3T1HK 4C8MA 4X62K 5AQFA 2E5LK 4BC4A 1HKBA 5IT9O 1ASVA 3SUOA 1REVA 3SBTA 1S1UA 4OPAA 4B3OA 3QNOA 1HYSA 3L0QA 2BDPA 3CIPA 3UKUA 4O5BA 1WSEA 4DR6K 4QCLA 3MXMA 3PY8A 5LY3A 2A3ZA 3E1YA 2UU9K 2OPSA 2IVOA 4JK7A 4OPHA 3LWLA 1SKWA 1DT9A 4FOEA 3FZFA 2FSJA 4BE2A 4DTJA 1NGGA 2YHXA 3E9OA 1ASUA 1Q82O 1Q9XA 4NB4A 1NKCA 2ITGA 1X9SA 1NG9A 3SMSA 1J53A 4CF0A 3MEGA 1NLVA 4DTRA 4LSLA 5BR9A 5M1QA 3AAPA 2BANA 5GINA 1TL1A 4BR5A 4DV1K 1XC3A 1WSIA 1MWMA 4DB3A 3O08A 1SL1A 2OANA 4B8AB 2YHAA 1XWLA 3VMFB 2YHYA 2VQFK 4WYBA 4BRCA 4DUZK 5C0YA 1BOTO 2G8IA 3I56N 1YUWA 2BH1A 1QS4A 3KK2A 1YJWN 4JKEA 3LM2A 1IBKK 4CJQA 1FKPA 2F96A 4DV0K 4WFBL 3HPHA 4W5OA 3J7ZO 4H0YB 2FSKA 4BR2A 3MCPA 4I9QA 3IS9A 1TYQA 1T03A 2FSNA 3ID6A 2OTJN 1OVYA 1Q8IA 2P9UB 3E9LA 4N76A 4KH5A 3OA9A 3WQTA 1NBWA 2G8WA 5GADP 2OZSA 4V19S 1BA0A 4FJGA 3LAMA 5AJ3K 3SUPA 5F0XA 3M8RA 1T7PA 5AQGA 3J7AP 1SKRA 2P5GA 1VQ6N 3IRXA 4MO4A 1YITN 4M7XA 4BDZA 2ASMA 4B1ZA 5ELZA 3NVMA 1GLCG 3QEXA 1NU0A 4JKBA 4MDAA 2Q2RA 4Y1CA 2RE2A 3HVTA 3AVCA 1J54A 4RG8A 4E7IA 3V4IA 1HQEA 2HSTA 3DLGA 4DQQA 5EY4A 2VWBA 1RBTA 1NJWA 4B3SK 4LC9B 4A62A 1SUQA 4M3UA 4KH6A 4CF8A 4O8KA 4DV2K 4CJRA 2P9PB 1N8RO 1QTMA 1LW0A 5I42A 3NH2A 3OYHA 2HMIA 5HLFA 3L2WA 3T69A 4M3XA 3H1QA 4O4GA 1U45A 1VSJA 3E66A 3CCJN 1I94K 3RR7A 4N5SA 3L2RA 1TGOA 4DLEA 2E2NA 4YOXA 2HHWA 4CHQA 1ZBSA 4IOCL 1EXQA 2RPIA 1N36K 4LF9K 4BR4A 4E1MA 3WEEA 4B9QA 2XY6A 3EY1A 5DMRA 1XHXA 4M3TA 3SV4A 1VSKA 2RN2A 4QAGA 3ZEUA 3M8SA 1I3AA 3KHYA 5BR8K 4ID5A 3KWGA 4E1NA 4W5NA 1EETA 1XQSC 4JYAK 4DQRA 4PY5A 1N32K 3V6DA 3HOSA 3ZX3A 1D9FA 2G8KA 3O3FA 2EWSA 1Z6RA 3RMBA 1FKOA 2UUCK 1GOCA 4RTFD 1JLAA 3ISNC 2NRRA 1LAVA 1IKWA 2ZF5O 3VGMA 3NF7A 4CK2A 1N34K 3CI5A 3MXIA 2WBNA 3PO5A 1RT5A 3OJUA 4IJNA 1HPMA 1KCFA 4DTXA 4CGHA 2X78A 2Q0UA 2Q97A 1JCFA 4CVNE 4AH9A 4GV3A 3KLIA 4CFDA 3CFOA 5HBMA 4IDHA 4H5NA 4DUYK 4QOZB 4JD2B 3NCIA 3OS2A 3UE5A 4WQ4A 1VQKN 3THXA 2YJEA 2Z1JA 4PKHA 3VEVA 1L3SA 4ZTJA 3L3VA 3K59A 4EFHA 4JI8K 3AVNA 4N56A 1WAFA 1C1CA 5M1OA 1JJ2M 4H4MA 3TAMA 1F21A 4YHHK 2P5OA 4BR7A 4C8NA 4KREA 3GG4A 1V4TA 5CYMA 2QWPA 2W6LA 4UQGA 4YDUA 2PAVA 1M90O 1VQPN 2P1JA 2KFNA 4JI6K 3AVIA 1RFQA 1S6PA 3OBYA 3AGRA 2P9KA 4GY2B 5C25A 4E7JA 3DXKA 3KLFA 3LDQA 4KAZA 2A42A 5BN9A 3KIOA 1HYVA 3P83D 4KPYA 3TAGA 4B9SA 4M63C 3V1QA 3CC2N 4K43A 3RRGA 4H0OA 2O8BB 4PA1A 3C0BA 3OVNA 1QZ6A 3W0LA 1K73O 2GV9A 2E6LA 4CF2A 1BUPA 3SYZA 3DLLL 5HRNA 3HTVA 2F4VK 1TVRA 4CJSA 4CK1A 4XIUA 4MLEA 5MLCQ 3UIQA 2B5JA 3H3OB 1CXUA 4CFAA 2ZE2A 3SQ1A 3O4QA 5LL6Z 4ISEA 2WUSA 3NHGA 3IFRA 3OHRA 2BE2A 2H3GX 5AQSA 3JAMO 3E01A 1QE1A 4DWIA 4E0DA 3UKRA 3ULEA 4DR2K 3EE8A 2Q36A 3DLRA 4LFAK 4FYDA 1JL2A 2IAJA 4EZ9A 4M7YA 1HJOA 1CZAN 2UUAK 3NGIA 4ELUA 4B3RK 3G0ZA 2Y1IA 4LF8K 4FZXC 3S3MA 1NGHA 3VEYA 3CMAN 1TUUA 4BQLA 3ZSRA 4DF4A 1RT2A 4FK0A 4FLWA 3DXMA 3VEWA 1XHZA 2XRIA 3EEQA 2A40A 1Y64A 5AQQA 1T6DA 4XH5A 3GOIA 2O4GA 1HNZK 3VF2A 1RBUA 1S1XA 3K9KA 4X64K 3V9XA 3G25A 1RCHA 4FL9A 3NF6A 2D1KA 1JXBA 2YCHA 4A5AA 4KTZA 4PL8A 3P4IA 4H5WA 5KTQA 5KRSA 1DTTA 4CZHA 3BDPA 1IH7A 4B8CA 1HKCA 2UUBK 3D45A 3C7NB 3OW2M 5F1XA 1JL1A 2YV0X 5AFUA 3QMLA 3LPUA 3RRHA 1YTAA 2OPQA 4CEOA 3M3ZA 1UAXA 4M45A 4FJNA 3MWPA 1XI1A 3ZX0A 5M1FA 3C6UA 2E8AA 1TAQA 4CIFA 1VQ9N 2AP1A 3U8XA 4M42A 1T6CA 1W7AA 4IJAA 3TTCA 4QS9A 3DRSA 5K14A 4MFBA 4CZLA 3THVA 1GLJO 3HYFA 2Q1NA 2I7PA 5TKWA 1NGDA 2KZZA 3P31A 3ZT1A 4MDBA 1S9GA 4AILC 2YKMA 1SS6A 4FZZA 5AQRA 3LALA 3NBPA 4CHOA 4HTUA 5JICA 3DOKA 3VA0A 4FW1A 1KAZA 5FDLA 3DAWA 3WNHA 1JLQA 5JMVA 3OY9A 4CW7B 4JI0K 3PSFA 3NAEA 4JAXA 1W9HA 4CJWA 3BF1A 3EL2A 2KHOA 2I5JA 3B6OA 5T7BA 4ZTFA 3AARA 5CZ1A 1BIUA 2YI1A 3OYKA 4FM1A 1VSFA 3HSTB 1IG9A 3AVHA 2YHWA 4O5FA 1VSMA 3Q7CA 1C0TA 1B9FA 3GE1A 5AQNA 5AQHA 2WONA 2HB5A 3ENOA 4BWJA 3UKUB 3U4LA 4MQ3A 4B1YB 1HR0K 4OO1J 1TAUA 3C95A 1ATNA 2VG5A 3HP6A 5GAEP 2CGLA 4CBWA 1LWCA 1MA9B 1NKBA 2YNGA 3SZ2A 2WTUA 1VRUA 3O9RA 1KFDA 3AA2A 5DK5A 3L2VA 3HJFA 5HRPA 1Z26A 4QS7A 1VQ8N 3KLGA 3ZSOA 1TK5A 4CHPA 1Q86O 4Y1DA 3VQPA 2V7ZA 3EN9A 4DV7K 4AHCA 3HRGA 3LZJA 1KLNA 4N41A 3AO1A 4WE1A 1RILA 1U2VA 3OYMA 1G15A 2G8HA 3ENHA 3ZX2A 4B1XB 4C8KA 3TSQA 1NGEA 1NK5A 2NUBA 3CFPA 2BTFA 1M1KO 2IC3A 3D2EB 2HMPA 3QEPA 1EP4A 4JHDA 2ZM6K 2HBJA 3G4SN 4JKCA 1Q9YA 4CFBA 1W97L 1ZXOA 4PWDA 1IBLK 2VWJA 2W6KA 4WQ4C 4IBNA 3QIPA 2HF3A 1A5WA 4CZEA 1DGKN 1W2BM 4CJFA 3CG7A 4F2RA 4Q0BA 4DSFA 3L4IA 1TYQB 3ATUA 4JN4A 4CERA 2BUPA 1VK0A 3J81O 3VQ4A 4DV3K 1NOZA 4OGEA 3ZETA 3TWHA 2D0BA 3NMUA 2PYJA 1WSHA 4IFYA 4NLCA 1RT3A 2Z1HA 1HNXK 1KSPA 2JWLA 3K5OA 3QLHA 2EX3A 1ZBLA 4KHUA 3TAFA 1BCMA 3IAYA 3ULDA 2QXLA 3SJHA 4JI1K 3BZCA 3B6PA 3R3LA 3MEEA 2O8CB 5EU7A 4KHWA 3VQ6A 4AHVA 1S1VA 3CCEN 4CJ5A 1IG8A 3CJAA 3LPTA 4M3RA 4AF1A 2QKKA 4DR3K 2PYLA 5AQJA 2E2QA 3O9QA 4KRFA 1NJIO 2QK9A 1YT3A 3J7YP 2ZJPL 1HNIA 4CJVA 2KZMA 3A8YA 3SPYA 4JKAA 4F9OA 3L6QA 3NGZA 1LW2A 3WQUA 4K8ZA 1YI2N 3H46O 4DTSA 5EXWA 2QWMA 3Q7BA 3JYTA 5J2QA 3LDPA 2XO7A 3KTQA 1XUPO 3CHWA 3AA4A 4OKJA 4CD1A 4NXMK 3SK3A 1VQ4N 4LF4K 1Q18A 4WCEL 4HVJA 3QINA 4DQIA 4J2AA 1QQCA 2D0PA 4DMNA 1OVQA 2DY4A 2VQEK 2O8FA 1YAGA 3RSEA 5AQZA 1S6QA 4DR5K 1LCUA 2IDOA 3C6AA 3QBWA 3CFRA 1VQ7N 1N6QA 3C65A 3WXKA 1GLAG 3CD6N 4RW7A 4C8OA 2B4JA 1VSEA 1Z25A 4LSNA 1KVCA 2UXDK 5D3GA 4CBXA 1HX1A 2E1ZA 4PL7A 2FXUA 2G8FA 3VF6A 5I9EB 1VQNN 3J80O 1U47A 4BR0A 5BPMA 4CJKA 1QSYA 2D0CA 5FRMA 3KK7A 2FF3B 1SKSA 4H5VA 4TSXA 4LF7K 5HROA 4Y0WA 2HBMA 2PFUA 1QHTA 3GL1A 4CGDA 1VAZA 4M41A 1S72N 3L3UA 4EP5A 2E1YA 3L8BA 4DV6K 4K0KK 3F9MA 1VQ5N 1RDDA 4CZKA 1HQUA 1JLFA 4E7KA 3I33A 1ATRA 4Z4FA 2P9NA 2ZGZA 5JLFA 4CZJA 3KZBA 2YKNA 3JXUA 3AVFA 1W0HA 1CZBA 4NXNK 3MWTA 3F73A 4DSLA 4KFBA 3ZT4A 4IEEA 3LANA 4YORA 3I0SA 1IJJA 3BZKA 4EAHD 1K6YA 4W5QA 2P51A 4DQPA 1YTUA 1U49A 4NCBA 4E7HA 1WOQA 4LY7A 2P9IB 2GWJA 4DQSA 1ZBIA 4AM6A 1L5UA 2KFZA 2V51B 4OLAA 2WC9A 4Z4GA 3QB0A 2HHHK 3O5BA 3AVBA 4FSVA 1R59O 4H0VB 2G8VA 4HTLA 1TKXA 1BGXT 1OH8A 5E26A 4IG0A 4O44A 4ISGA 4JK9A 4X65K 3OYCA 3DI6A 5CY4A 1BI4A 1UOCA 3ZSZA 1WSFA 1HYZA 4F2SA 4IXCA 4ELTA 5C10A 4FCYA 5AZIA 3T19A 3DYAA 1RNHA 3VF4A 5BRHA 5FPDA 4IOXA 3P5JA 4PKIA 3I8DA 4WQ5A 3TPQA 2BGGA 3WUHA 3TSPA 4Q5VA 3VA3A 4FJHA 4A5BA 4F8RA 3QIOA 4FJIA 3UKRB 3ULEB 1O1WA 1CZ9A 4BDYA 2V7YA 4CEDA 3HSCA 2O8EA 3FFKB 1RGIA 2NRHA 3ZSXA 4N47A 3ASMA 5EVZA 3OS0A 4BRGA 5KRTA 4YOWA 4OKKA 1JLEA 4CD3A 1RTHA 1HLUA 4K42A 2QTDA 3K5MA 3MN9A 3A5NC 3SQ0A 3ID8A 1C0UA 4GW6A 1MWKA 3ZSYA 2IVNA 2F7TA 1A5XA 1TK0A 3QFUA 5KPTA 5BREA 1A5VA 3K9JA 3G6EN 3PSIA 4FLUA 1LV5A 3CCSN 1GLLO 3FZMA 4W5RA 4AHTA 4LH4A 3CETA 1HNVA 3LM9A 2R7YA 2ASOA 3C6TA 3EZWA 1LAWA 1ZBHA 2GBZA 1RDWX 1KRPA 5EX5A 3T7ZA 3SUNA 2OPRA 4FJ7A 4NCAA 4M3WA 4JI3K 4BVOA 1RT1A 5KPZA 1G99A 3PX0A 1OKJA 1BA1A 1NGIA 1BO5O 3I8BA 3HI0A 5TKYA 4CESA 3O9TA 3AA3A 2QWRA 2HNZA 3CJCA 1LWEA 1C1BA 1TUYA 4CZMA 5CE3A 4B9UA 2P9SA 2Q31A 4ISFA 1S5JA 1JLGA 3VGLA 2D4WA 4OGCA 2OZMA 3MECA 5M1PA 5C24A 4BC3A 1BL3A 4R5PA 3LDLA 3NDKA 2CH6A 4FPAA 2X6NA 5LMUK 3MN6A 1H1VA 3PIOL 2E88A 3VGKA 2ETJA 3ZSWA 1BQMA 1SL0A 1FXXA 5J2NA 3GDQA 4B9NA 1VSDA 5JVGL 4BRHA 2NZTA 3V1RA 2F8TA 1R0AA 4Z4CA 3ATVA 4EHUA 4FWMA 3ZCMA 3WXJA 4G9ZA 2VG6A 2DPNA 4BC5A 3J8AA 3HM8A 4KTQA 4AHRA 2P9LB 1WN7A 3VEXA 5JLHA 3PUFA 3SAGA 2ZJQL 2YNFA 2F8SA 5C42A 5BPNA 4Z4HA 4YY3K 3F5TA 4JLHA 3SAFA 1IO2A 4CEAA 2QA4N 4JKHA 5M1KA 1RT4A 2ATQA 2VGMA 1RT7A 4DS5A 2OYQA 2IGIA 4FLXA 3CJ9A 5SWMA 3CPWM 2JWKA 2NRTA 3TANA 1WNSA 2QEXN 3C94A 4RW8A 5BPLA 1HJRA 3H45C 4JK8A 3KD5E 4UY8O 1QVGM 1IV0A 2W42A 1XC9A 1NOYA 5AQYA 4J8FA 3H1VX 3VEZA 3CF5L 1OH5A 3VQEA 1X3MA 2ZJRL 3QETA 4HCBA 1KAXA 2B6AA 4CEFA 2E2PA 4KB1A 4OPJA 3LDNA 3QO9A 1DEJA 3HOTA 4NCGA 4Z94A 1IKYA 1QZ5A 4MO5A 4YOTA 4FJKA 1IBMK 4IO8A 4LFCK 2O4IA 4FLZA 4KI4A 1FJGK 2RHKA 2KLAA 1NJZA 4DSKA 3CCUN 4DU1A 2KQ2A 3DWLA 1TKZA 4IFVA 1QSSA 1E4FT 1VQLN 2HHVA 4E89A 1U4BA 1HKGA 4RWTA 3OYAA 1D5AA 4NLBA 3SBGA 4JD2A 3M8QA 2AJQA 3HVRA 3SNNA 1JKHA 5KGXA 3QNNA 3QDKA 3IUCA 3VERA 4FXDA 4OLBA 3SMPA 4E1JA 3FGUA 2IS3A 3TARA 2WFBA 4A2BA 3THWB 4RW9A 2FLOA 2NRZA 3WT0A 3FZHA 4FW2A 1L3VA 2IVPA 4CJ4A 3AO4A 3MMVA 4IZ9A 3THYB 4I6MA 2QWLA 3H6EA 3RR8A 3AO5A 1YJ9N 4FWPA 1BHLA 4DTMA 3O3GA 1T05A 4A61A 1C1AA 5FROA 3WNFA 2RF2A 5EOYA 4JRQA 3TAQA 4IWVA 4CGGA 4OJRA 3NH1A 4WF9L 1DLOA 5KI6A 2O8BA 1L3UA 1KD1O 4FWKA 2HBKA 1XMOK 3O8MA 3CCRN 3OS1A 3S3NA 1NMNA 4DF8A 5HL7L 3T1AA 3M8PA 3E9PA 1T44A 3ZLJA 3KLHA 2VGNA 4C23A 1GLBG 5GAGP 4GKJK 1MU2A 2GWKA 4LFBK 5J2MA 5H1SQ 1NGJA 4HUFA 1KC8O 4CGJA 3ENBA 3G10A 1HMVA 1YVUA 2OCEA 2ASPA 4YNQA 1EO1A 4O0IA 4WQ5C 4XEIA 4Z0UA 5HRSA 2NRVA 1YIJN 1BIZA 4KI6A 3U6FA 2GUPA 1X9JA 4CHYA 5J1EA 2Z1GA 3RMDA 1UWBA 3AO3A 3OYLA 3QICA 4B9TA 5AZJA 4E7LA 1NK0A 3U3YA 3MDQA 4PQUA 3EKUA 5SZTA 1VSLA 5CYQA 3W3DA 1SQKA 1KQSM 4CE9A 1K8KA 4KBOA 3H3NO 3IG1A 4CHNA 1U04A 4DR1K 2F9WA 3AGKA 1K9MO 3F9KA 2OTLN 2VG7A 4CBUA 4C1NI 3SQ4A 1S22A 4A2AA 5GAHP 1ZBFA 4YOVA 2A1RA 4HCCA 4BDPA 3KWIA 3FLCO 3KJVA 1S3XA 3U9ZA 4CEZA 1BQNA 2FBVA 3TI0A 1YVNA 3L4QA 4CJ3A 1SL2A 1RDBA 1NJYA 2V52B 4YFUA 4DTPA 4B9VA 1VRTA 4NO7A 1KAYA 3LZIA 1HUXA 4O55A 1T8EA 3VTHA 1NK9A 3S3OA 4KHQA 3DM2A 4HHTA 3PX4A 2D0OA 4CJ7A 3O3HA 2E6MA 4FPBA 1S1TA 1WBBA 2YJFA 4CIEA 1RT6A 3WXIA 5KGWA 2UYTA 3K58A 3TAEA 3TR8A 5CR4A 2XY5A 3HPOA 3N4PA 4ILJA 2HNYA 3D2FA 1D8YA 3UB5A 3DLEA 3AVLA 4FJ5A 3R8EA 1KTQA 3VQQA 1RBVA 1C0GA 1BG3A 3AV9A 4ILGB 1SZ2A 1SV5A 5JVHL 3I55N 4FJMA 2HBLA 5DM7L 2RKIA 2FBXA 2XHBA 1JLCA 1WBDA 3S41A 2YX6A 4J2DA 4A59A 4W5TA 1O13A 4FLYA 3DMJA 4FJXA 4EZ6A 4EP4A 3TABA 4CEBA 1ITGA 5FRNA 4FVUA 3LWMA 4F4KA 2J4RA 3SPZA 3VEOA 2O8DA 3AVGA 4CZGA 3DRPA 4BRNA 3CXCM 5A2QO 2HOEA 2XY7A 3O6WA 3IDHA 3OJSA 4H8KA 1JLBA 1Z05A 3EYZA 2NLXA 3OBWA 1JCEA 2OA8A 4CHZA 3OTOK 2A41A 5AQKA 3OYJA 5AQXA 2YHBA 5AQIA 4DFKA 3MXJA 5AZIB 3R6MA 1QSLA 3CYMA 4ICLA 1HRHA 3WEEB 4DFPA 3CJ1A 3RMAA 5DM6L 3LP1A 1XNQK 3ZEUB 2KTQA 4DCHA 4FWLA 4ZHRA 2GUIA 3RMCA 3VQ8A 1EWRA 4B08A 3VESA 4AHUA 4KB0A 1YJNN 1EX4A 2OPPA 3PX6A 4JKGA 4CGIA 4EHTA 3MN7A 1XMQK 2QKBA 3ZSVA 4KHSA 5AQMA 1QQMA 2O8EB 1U6ZA 5IWAK 3L2QA 3WNGA 3VQCA 4DTNA 5J2PA 3A2FA 3HZ6A 2Y1JA 4J2BA 1WSGA 1XNRK 3K57A 1BWFO 4G1QA 3M5RA 2QWQA 1GOAA 2ZQBA 5FPNA 4H0TB 5HRRA 4BRDA 3K2PA 4OX9K 1E4GT 4IDKA 4DG1A 1B92A 4JI7K 1GLEG 1NM1A 3D2EA 2DTUA 1RTJA 3V9WA 4KTWA 5ADXA 4GV6A 3V9UA 1X9MA 1QHAA 4K8XA 3VN5A 2PBDA 4L3QA 3THXB 1RDUA 3HM9A 4WFNL 3CM6A 4JI5K 4DR7K 5E41A 4B3TK 5C15A 5F2RA 3SV3A 4HUGA 3P39A 3QEIA 1S1WA 1HPZA 5LMNK 1C0MA 3PLAA 4CIGA 3QERA 4FOIA 4O0JA 3L2UA 3CCVN 4BGAA 1WLJA 4DFJA 4JKDA 1N33K 2FBYA 5GIPA 2P9SB 4LH5A 3TU5A 4CJLA 4FWOA 1P8ZA 2P9KB 2QW9A 3ZYYX 4K41A 3O4WA 1X9WA 4BE1A 2YNHA 4DHYA 3A5OC 3DXKB 2FC0A 3MN5A 3QFPA 3O9UA 2ZD1A 3MEDA 3NF8A 1UA1A 1RDAA 1VSIA 4KO0A 4EIAA 4JS4A 1RBSA 1LOTB 4NYNA 5C2DA 2O8CA 1WB9A 3CCLN 4JI4K 4BG8A 1IKVA 3QEWA 1TV6A 1YHQN 4GVEA 4DS4A 3RTVA 4DSJA 3RVCA 3K5LA 1EKEA 3VPZA 3SJJA 4FK2A 2IOCA 4LF6K 3BGRA 3U3GA 3CJBA 1BISA 3HP9A 1ASWA 1NJXA 5ADXH 3CC7N 3TSUA 3AAQA 4CJEA 4FJLA 1ZYQA 5AQLA 2UXBK 4FM2A 3V1OA 3BY5A 4JEPA 3WXLA 2HVIA 3FE1A 1OH6A 2HVHA 4CK3A 2A6AA 3SI6A 4RW6A 4KV8A 1CLQA 4CEEA 5E84A 5C12A 1EWQA 4FZYA 3ALYA 5KQDA 4JKFA 4OKEA 1QVFM 1VQON 5AQTA 4CJUA 2CGJA 3DLKA 2GELA 5JS2A 4BRFA 1L3TA 3DXMB 4DKWA 3OYNA 1B9DA 2KW4A 1Y97A 3EKSA 1VSHA 3CCMN 2NRWA 1ILYA 3CPEA 4O8UA 1NNEA 4B9MA 1GLDG 3CJ7A 3BEXA 1GLFO 4BRMA 4H4OA 3M1FA 4CF9A 2D5RA 4DFMA 4MLHA 3HT3A 3WNEA 1KLMA 5FLXO 3T1YK 2ITMA 1NK4A 3VQ5A 3DOLA 1ESVA
chains in the Genus database with same CATH topology
4IBNA 1A5WA 4F3TA 3SNNA 1JKHA 4CJFA 5KGXA 4I9QA 3IS9A 3QNNA 1T03A 3CG7A 4F2RA 4Q0BA 4DSFA 1Q8IA 4FXDA 4OLBA 4ID1A 4CERA 4N76A 1VK0A 2IS3A 1D9DA 2G8WA 2OZSA 1CXQA 3VQ4A 1NOZA 3TARA 4FJGA 3LAMA 4OGEA 3SUPA 3M8RA 1T7PA 3CM5A 3TWHA 3HL8A 4RW9A 3AVMA 4IKFA 1SKRA 2P5GA 3PO4A 2D0BA 3IRXA 4FW2A 3HXMA 1L3VA 1ZBUA 4CJ4A 2PYJA 3AO4A 1WSHA 4IFYA 4BDZA 3V9SA 1RT3A 2Z1HA 3SQ2A 1KSPA 3QEXA 3NH0A 3RR8A 3K5OA 3QLHA 4Y1CA 2EX3A 1ZBLA 3HVTA 3AVCA 3AO5A 4KHUA 1J54A 4BACA 2PY5A 4RG8A 4E7IA 1BCMA 3QESA 3V4IA 1HQEA 3TAFA 3DLGA 3ULDA 4DQQA 1BHLA 4DTMA 3IAYA 2HHTA 1RBTA 1NJWA 4DSIA 3B6PA 3O3GA 3MEEA 5EU7A 1T05A 1C1AA 5FROA 3WNFA 4JRPA 2A1SA 4KHWA 1SUQA 2RF2A 4JRQA 2X74A 3TAQA 4GVMA 3VQ6A 4AHVA 4CGGA 1S1VA 4OJRA 3NH1A 4CF8A 4CJ5A 1DLOA 5KI6A 3LPTA 4M3RA 4CJRA 1TKTA 1L3UA 1QTMA 2QKKA 1LW0A 2HHSA 5I42A 3ITHA 2PYLA 3OS1A 3S3NA 3NH2A 4KRFA 1I39A 3OYHA 3EZ5A 4DF8A 5HLFA 3L2WA 2HMIA 1YT3A 4M3XA 4M3UA 2QK9A 3T1AA 4Z4EA 3M8PA 1HNIA 4O4GA 1VSJA 4CJVA 1U45A 3SPYA 1NK7A 2KZMA 3RR7A 3KLHA 4N5SA 3L2RA 1TGOA 4DLEA 4FM0A 1MU2A 3NGZA 4KKOA 2HHWA 4CHQA 1LW2A 4FK4A 5J2MA 4K8ZA 3AVKA 4DTSA 1EXQA 2RPIA 4M3YA 4HUFA 4CGJA 3JYTA 3G10A 5J2QA 3ZT3A 1HMVA 1YVUA 4E1MA 4YNQA 4O0IA 2XO7A 4Z0UA 5HRSA 3KTQA 2XY6A 1NK8A 3EY1A 3AA4A 1XHXA 4OKJA 1BIZA 5DMRA 4KI6A 3U6FA 4M3TA 3SV4A 4CHYA 1VSKA 2RN2A 2Z1GA 4QAGA 4HVJA 1LWFA 5J1EA 4JS5A 3RMDA 1UWBA 3QINA 3M8SA 4DQIA 1I3AA 3AO3A 3OYLA 3NE6A 4J2AA 4ID5A 1QQCA 2HHQA 3OYFA 4E1NA 4DMNA 3VQDA 4B9TA 4E7LA 1NK0A 4W5NA 2DY4A 1EETA 2VWKA 3LP0A 3U3YA 4PQUA 5SZTA 4DQRA 1VSLA 4PY5A 1S6QA 5CYQA 3V6DA 1D9FA 1DTQA 2IDOA 3CFRA 4CE9A 2G8KA 4DTUA 3O3FA 3VQBA 1N6QA 3IG1A 1S9EA 4CHNA 1U04A 4CF1A 3RMBA 1FKOA 3F9KA 4RW7A 2VG7A 2B4JA 4CJTA 1GOCA 4C8OA 1VSEA 3SQ4A 2YNIA 1Z25A 4LSNA 1KVCA 1JLAA 3ISNC 1ZBFA 5D3GA 2A1RA 4HCCA 3V9ZA 1LAVA 4FJ9A 3KKRA 4BDPA 1IKWA 4FJ8A 2G8FA 4CGFA 4DTOA 3KJVA 3VQAA 3NF7A 4CK2A 4CEZA 1IKXA 1BQNA 3TAPA 1U47A 3MXIA 3PO5A 2FBVA 1RT5A 3OJUA 3TI0A 1KCFA 4DTXA 4CGHA 4CJKA 4M3ZA 2X78A 1QSYA 4CJ3A 2D0CA 3QEVA 5FRMA 4ELVA 1SL2A 3NFAA 1RDBA 1NJYA 4YFUA 4DTPA 4B9VA 3RWUA 1VRTA 4AH9A 1SKSA 4TSXA 5HROA 3LZIA 3KLIA 3H08A 4O55A 4CFDA 3CFOA 3V81A 1T8EA 5HBMA 1NK9A 3S3OA 4KHQA 1QHTA 4CGDA 4I2QA 3AVJA 3DM2A 4HHTA 5JS1A 4QOZB 3NCIA 4M41A 3OS2A 3PX4A 3FFIA 3O3HA 3L3UA 4EP5A 3L8BA 2E6MA 2Z1JA 1S1TA 3LAKA 4DLGA 1L3SA 4ZTJA 4CIEA 3CQ8A 3L3VA 3K59A 1RT6A 5KGWA 3K5NA 3K58A 3OYDA 3TAEA 1RDDA 3AVNA 3TR8A 4N56A 2XY5A 1WAFA 1C1CA 1TK8A 3HPOA 1HQUA 4H4MA 1J9AA 3TAMA 1JLFA 2HNYA 4E7KA 1F21A 2P5OA 1D8YA 2PZSA 4C8NA 2QXFA 4Z4FA 4KREA 3PV8A 3DLEA 3HPGA 3AVLA 4FJ5A 5CYMA 2JLEA 1KTQA 3VQQA 4UQGA 1RBVA 3AV9A 2YKNA 3AVFA 1SV5A 1W0HA 4FJMA 1CZBA 2P1JA 3F73A 4DSLA 2KFNA 2RKIA 4E19A 2FBXA 3AVIA 4KFBA 1S6PA 3NGYA 1JLCA 3ZT4A 2XHBA 2Z1IA 5C25A 4FLTA 3LANA 4W5TA 4J2DA 3I0SA 4FLYA 4E7JA 3KLFA 4DQPA 1K6YA 4W5QA 2P51A 2Q3SA 1YTUA 3DMJA 4KAZA 1U49A 4EZ6A 3O4NA 4E7HA 4FJXA 2VWJA 4EP4A 4NCBA 3TABA 4CEBA 2HW3A 1ITGA 4LY7A 4DQSA 3DRRA 1ZBIA 3KIOA 5FRNA 1L5UA 2KFZA 1HYVA 3LWMA 3P83D 4CECA 4FLVA 2JGUA 3SPZA 4F4KA 4J2EA 4OLAA 2EHGA 3AVGA 5CZ2A 3SCXA 4KPYA 1NK6A 4L8RB 4Z4GA 3TAGA 5HP1A 4B9SA 3AVBA 3DRPA 3V1QA 2G8VA 1TKXA 3RRGA 4PA1A 1BGXT 3OVNA 2XY7A 3ZT2A 4FVMA 3OJSA 4H8KA 2GV9A 4IG0A 4O44A 2E6LA 1JLBA 1WAJA 4CF2A 3OYCA 3DI6A 5CY4A 1BI4A 1UOCA 3ZSZA 3EYZA 3SYZA 1WSFA 1HYZA 2OA8A 4C8LA 4F2SA 4DSEA 5HRNA 4ELTA 4CHZA 3HK2A 4FCYA 2HHXA 1TVRA 3T19A 4CJSA 3DYAA 3OYJA 1RNHA 4CK1A 4XIUA 3UIQA 2YHBA 2B5JA 4DFKA 3MXJA 1CXUA 4CFAA 1QSLA 2ZE2A 3SQ1A 3ZSQA 3LP2A 3CYMA 4ICLA 3P5JA 1HRHA 3O4QA 3I8DA 3NHGA 3P1GA 3SUQA 2XY8A 2BE2A 4DFPA 3KLEA 2BGGA 2FBTA 3RMAA 3LP1A 4Q5VA 3E01A 1QE1A 3VA3A 1KFSA 4DWIA 4E0DA 2KTQA 4FJHA 1RDCA 4FJIA 4F8RA 3QIOA 4ZHRA 2GUIA 4IG3A 3RMCA 3VQ9A 3VQ8A 4B08A 3DLRA 4NYFA 4AHUA 1O1WA 1NKEA 4KB0A 1EX4A 2OPPA 1CZ9A 3DLBA 3PX6A 4BDYA 4FYDA 1JL2A 2IAJA 4CGIA 5I3UA 1U48A 4CEDA 4EZ9A 1KVBA 4F3OA 2QKBA 3ZSVA 3LDSA 4KHSA 3NGIA 4ELUA 3G0ZA 2Y1IA 3ZSXA 4N47A 4FZXC 3L2QA 3ASMA 3S3MA 1BCOA 3WNGA 4CEQA 3VQCA 3OS0A 4DTNA 3KK3A 4OVLA 4RW4A 5J2PA 5KRTA 3A2FA 2Y1JA 4J2BA 1WSGA 4AHSA 3ZSRA 4OKKA 4DF4A 1RT2A 4CJPA 1JLEA 2DFFA 3K57A 4FLWA 1RTHA 1TKDA 4FK0A 4G1QA 1XHZA 2XRIA 1GOAA 3K5MA 3HO1A 2ZQBA 5HRRA 3SQ0A 1C0UA 3AVAA 4CFCA 4GW6A 3ZSYA 1RBRA 3K2PA 4IDKA 1A5XA 1GOBA 4DG1A 1TK0A 2O4GA 1B92A 1A5VA 2DFHA 1RBUA 1S1XA 2LSNA 1KVAA 3AO2A 2DTUA 4FLUA 1LV5A 3V9XA 1RCHA 1RTJA 3V9WA 4KTWA 3MAQA 4W5RA 3ZT0A 3NF6A 4AHTA 4LH4A 1JXBA 3V9UA 1X9MA 1HNVA 4PUOA 2R7YA 3C6TA 4B9LA 4KTZA 3VN5A 4K8XA 5KTQA 3AA5X 4I2PA 1DTTA 5KRSA 3BDPA 1IH7A 1LAWA 1WSJA 4B8CA 4FJJA 1ZBHA 3HM9A 3LP3A 2GBZA 4E3SA 3D45A 1KRPA 3T3FA 3S9HA 1JXEA 1JL1A 3CM6A 4KHYA 2YV0X 3SUNA 2OPRA 4FJ7A 4NCAA 4M3WA 5E41A 4BWMA 3SV3A 4HUGA 1RT1A 2HHUA 3LPUA 3OYEA 3PX0A 3QEIA 3RRHA 1YTAA 1S1WA 4LD0A 2OPQA 1UA0A 4CEOA 1HPZA 1UAXA 4M45A 1C0MA 2G8UA 4FJNA 1C6VA 4CIGA 4CESA 1XI1A 3QERA 1RTIA 3AA3A 2HNZA 4O0JA 3L2UA 4DU4A 1LWEA 1C1BA 4B9UA 1WLJA 4KHNA 3C6UA 4CIFA 1TAQA 4DFJA 4M42A 1S5JA 1JLGA 2FBYA 3DRSA 4OGCA 5K14A 4HUEA 2OZMA 2WOMA 3I0RA 4LH5A 3JSMA 4CJLA 4I7FA 3MECA 4MFBA 5C24A 3THVA 4OPKA 1X1PA 1BL3A 1X9WA 4R5PA 3OYIA 2YNHA 3NDKA 3HYFA 4BE1A 2E4LA 4DU3A 4CCHA 2FC0A 2X6NA 3DLHA 2KZZA 3ZT1A 2ZD1A 1N5YA 3MEDA 2DFEA 4I9LA 1S9GA 1TL3A 4AILC 2YKMA 3NF8A 1UA1A 4FZZA 1RDAA 1VSIA 3LALA 3NBPA 4KO0A 3VQ7A 4CHOA 4HTUA 2ETJA 3ZSWA 4JS4A 2D0AA 1BQMA 1RBSA 2X6SA 3DOKA 3VA0A 4FW1A 1SL0A 1FXXA 2HNDA 5FDLA 5J2NA 3KKSA 4NYNA 4B9NA 1VSDA 3WNHA 1JLQA 3V1RA 2F8TA 3NF9A 4BE0A 1R0AA 4Z4CA 3OY9A 3D0PA 1FK9A 1RTDA 1IKVA 3NAEA 3ZCMA 3QEWA 1TV6A 4GMJB 1W9HA 4Z4IA 3KK1A 4DS4A 2VG6A 4CJWA 3OYGA 3RTVA 4DSJA 3K5LA 1BI4B 1EKEA 2I5JA 3B6OA 5T7BA 3KD1E 4KTQA 4ZTFA 4AHRA 3OYBA 1WN7A 5CZ1A 3SJJA 1J5OA 4FK2A 3PUFA 2IOCA 4C8MA 1BIUA 2YNFA 2F8SA 3OYKA 5C42A 3BGRA 3U3GA 4FM1A 1VSFA 1ASVA 3HSTB 3SUOA 3AVHA 1IG9A 1REVA 1VSMA 1S1UA 4Z4HA 1BISA 1C0TA 1B9FA 1ASWA 3HP9A 4JLHA 4B3OA 3QNOA 1NJXA 1IO2A 4CEAA 1HYSA 2BDPA 4CJEA 2WONA 1RT4A 4O5BA 1WSEA 2HB5A 4FJLA 1ZYQA 4QCLA 3MXMA 3PY8A 4FM2A 2ATQA 3V1OA 1RT7A 4DS5A 4BWJA 2HVIA 2OYQA 2IGIA 2HVHA 4FLXA 5SWMA 4MQ3A 2OPSA 4CK3A 3TANA 3SI6A 1TAUA 1WNSA 3C95A 4KV8A 4RW6A 4CEEA 3C94A 2VG5A 4RW8A 1CLQA 3LWLA 3HP6A 1SKWA 1HJRA 3KD5E 1LWCA 4BE2A 3ALYA 4DTJA 4FZYA 1ASUA 1NKBA 2YNGA 3SZ2A 1NKCA 1Q9XA 2ITGA 1X9SA 4OKEA 2W42A 1VRUA 4CJUA 1XC9A 1KFDA 1J53A 1NOYA 3DLKA 4CF0A 3AA2A 3MEGA 5DK5A 5JS2A 3L2VA 3HJFA 5HRPA 1Z26A 3KLGA 4DTRA 4LSLA 3ZSOA 1TK5A 3VQEA 1L3TA 4CHPA 4Y1DA 3VQPA 2BANA 3QETA 4HCBA 4AHCA 1TL1A 3LZJA 2B6AA 1KLNA 1WSIA 3AO1A 4CEFA 3OYNA 4WE1A 4KB1A 4N41A 1B9DA 1RILA 1SL1A 2KW4A 4OPJA 1Y97A 4B8AB 3QO9A 1VSHA 2YHAA 1G15A 1XWLA 3OYMA 2G8HA 4NCGA 1IKYA 4C8KA 4FJKA 2G8IA 1NK5A 1QS4A 2NUBA 4B9MA 3KK2A 3CFPA 2IC3A 2O4IA 4FLZA 4KI4A 4CJQA 1FKPA 4H4OA 1NJZA 4DSKA 4CF9A 2KQ2A 2D5RA 4DU1A 4DFMA 2F96A 3QEPA 1TKZA 1EP4A 4IFVA 1QSSA 3HPHA 2HHVA 4E89A 3HT3A 3OYAA 1U4BA 4CFBA 1Q9YA 3WNEA 1KLMA 4W5OA 1D5AA 1NK4A 3VQ5A 4PWDA 3M8QA 3DOLA 2AJQA 3QIPA 3HVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBN A;  1A5W A;  4F3T A;  3SNN A;  1JKH A;  4CJF A;  5KGX A;  4I9Q A;  3IS9 A;  3QNN A;  1T03 A;  3CG7 A;  4F2R A;  4Q0B A;  4DSF A;  1Q8I A;  4FXD A;  4OLB A;  4ID1 A;  4CER A;  4N76 A;  1VK0 A;  2IS3 A;  1D9D A;  2G8W A;  2OZS A;  1CXQ A;  3VQ4 A;  1NOZ A;  3TAR A;  4FJG A;  3LAM A;  4OGE A;  3SUP A;  3M8R A;  1T7P A;  3CM5 A;  3TWH A;  3HL8 A;  4RW9 A;  3AVM A;  4IKF A;  1SKR A;  2P5G A;  3PO4 A;  2D0B A;  3IRX A;  4FW2 A;  3HXM A;  1L3V A;  1ZBU A;  4CJ4 A;  2PYJ A;  3AO4 A;  1WSH A;  4IFY A;  4BDZ A;  3V9S A;  1RT3 A;  2Z1H A;  3SQ2 A;  1KSP A;  3QEX A;  3NH0 A;  3RR8 A;  3K5O A;  3QLH A;  4Y1C A;  2EX3 A;  1ZBL A;  3HVT A;  3AVC A;  3AO5 A;  4KHU A;  1J54 A;  4BAC A;  2PY5 A;  4RG8 A;  4E7I A;  1BCM A;  3QES A;  3V4I A;  1HQE A;  3TAF A;  3DLG A;  3ULD A;  4DQQ A;  1BHL A;  4DTM A;  3IAY A;  2HHT A;  1RBT A;  1NJW A;  4DSI A;  3B6P A;  3O3G A;  3MEE A;  5EU7 A;  1T05 A;  1C1A A;  5FRO A;  3WNF A;  4JRP A;  2A1S A;  4KHW A;  1SUQ A;  2RF2 A;  4JRQ A;  2X74 A;  3TAQ A;  4GVM A;  3VQ6 A;  4AHV A;  4CGG A;  1S1V A;  4OJR A;  3NH1 A;  4CF8 A;  4CJ5 A;  1DLO A;  5KI6 A;  3LPT A;  4M3R A;  4CJR A;  1TKT A;  1L3U A;  1QTM A;  2QKK A;  1LW0 A;  2HHS A;  5I42 A;  3ITH A;  2PYL A;  3OS1 A;  3S3N A;  3NH2 A;  4KRF A;  1I39 A;  3OYH A;  3EZ5 A;  4DF8 A;  5HLF A;  3L2W A;  2HMI A;  1YT3 A;  4M3X A;  4M3U A;  2QK9 A;  3T1A A;  4Z4E A;  3M8P A;  1HNI A;  4O4G A;  1VSJ A;  4CJV A;  1U45 A;  3SPY A;  1NK7 A;  2KZM A;  3RR7 A;  3KLH A;  4N5S A;  3L2R A;  1TGO A;  4DLE A;  4FM0 A;  1MU2 A;  3NGZ A;  4KKO A;  2HHW A;  4CHQ A;  1LW2 A;  4FK4 A;  5J2M A;  4K8Z A;  3AVK A;  4DTS A;  1EXQ A;  2RPI A;  4M3Y A;  4HUF A;  4CGJ A;  3JYT A;  3G10 A;  5J2Q A;  3ZT3 A;  1HMV A;  1YVU A;  4E1M A;  4YNQ A;  4O0I A;  2XO7 A;  4Z0U A;  5HRS A;  3KTQ A;  2XY6 A;  1NK8 A;  3EY1 A;  3AA4 A;  1XHX A;  4OKJ A;  1BIZ A;  5DMR A;  4KI6 A;  3U6F A;  4M3T A;  3SV4 A;  4CHY A;  1VSK A;  2RN2 A;  2Z1G A;  4QAG A;  4HVJ A;  1LWF A;  5J1E A;  4JS5 A;  3RMD A;  1UWB A;  3QIN A;  3M8S A;  4DQI A;  1I3A A;  3AO3 A;  3OYL A;  3NE6 A;  4J2A A;  4ID5 A;  1QQC A;  2HHQ A;  3OYF A;  4E1N A;  4DMN A;  3VQD A;  4B9T A;  4E7L A;  1NK0 A;  4W5N A;  2DY4 A;  1EET A;  2VWK A;  3LP0 A;  3U3Y A;  4PQU A;  5SZT A;  4DQR A;  1VSL A;  4PY5 A;  1S6Q A;  5CYQ A;  3V6D A;  1D9F A;  1DTQ A;  2IDO A;  3CFR A;  4CE9 A;  2G8K A;  4DTU A;  3O3F A;  3VQB A;  1N6Q A;  3IG1 A;  1S9E A;  4CHN A;  1U04 A;  4CF1 A;  3RMB A;  1FKO A;  3F9K A;  4RW7 A;  2VG7 A;  2B4J A;  4CJT A;  1GOC A;  4C8O A;  1VSE A;  3SQ4 A;  2YNI A;  1Z25 A;  4LSN A;  1KVC A;  1JLA A;  3ISN C;  1ZBF A;  5D3G A;  2A1R A;  4HCC A;  3V9Z A;  1LAV A;  4FJ9 A;  3KKR A;  4BDP A;  1IKW A;  4FJ8 A;  2G8F A;  4CGF A;  4DTO A;  3KJV A;  3VQA A;  3NF7 A;  4CK2 A;  4CEZ A;  1IKX A;  1BQN A;  3TAP A;  1U47 A;  3MXI A;  3PO5 A;  2FBV A;  1RT5 A;  3OJU A;  3TI0 A;  1KCF A;  4DTX A;  4CGH A;  4CJK A;  4M3Z A;  2X78 A;  1QSY A;  4CJ3 A;  2D0C A;  3QEV A;  5FRM A;  4ELV A;  1SL2 A;  3NFA A;  1RDB A;  1NJY A;  4YFU A;  4DTP A;  4B9V A;  3RWU A;  1VRT A;  4AH9 A;  1SKS A;  4TSX A;  5HRO A;  3LZI A;  3KLI A;  3H08 A;  4O55 A;  4CFD A;  3CFO A;  3V81 A;  1T8E A;  5HBM A;  1NK9 A;  3S3O A;  4KHQ A;  1QHT A;  4CGD A;  4I2Q A;  3AVJ A;  3DM2 A;  4HHT A;  5JS1 A;  4QOZ B;  3NCI A;  4M41 A;  3OS2 A;  3PX4 A;  3FFI A;  3O3H A;  3L3U A;  4EP5 A;  3L8B A;  2E6M A;  2Z1J A;  1S1T A;  3LAK A;  4DLG A;  1L3S A;  4ZTJ A;  4CIE A;  3CQ8 A;  3L3V A;  3K59 A;  1RT6 A;  5KGW A;  3K5N A;  3K58 A;  3OYD A;  3TAE A;  1RDD A;  3AVN A;  3TR8 A;  4N56 A;  2XY5 A;  1WAF A;  1C1C A;  1TK8 A;  3HPO A;  1HQU A;  4H4M A;  1J9A A;  3TAM A;  1JLF A;  2HNY A;  4E7K A;  1F21 A;  2P5O A;  1D8Y A;  2PZS A;  4C8N A;  2QXF A;  4Z4F A;  4KRE A;  3PV8 A;  3DLE A;  3HPG A;  3AVL A;  4FJ5 A;  5CYM A;  2JLE A;  1KTQ A;  3VQQ A;  4UQG A;  1RBV A;  3AV9 A;  2YKN A;  3AVF A;  1SV5 A;  1W0H A;  4FJM A;  1CZB A;  2P1J A;  3F73 A;  4DSL A;  2KFN A;  2RKI A;  4E19 A;  2FBX A;  3AVI A;  4KFB A;  1S6P A;  3NGY A;  1JLC A;  3ZT4 A;  2XHB A;  2Z1I A;  5C25 A;  4FLT A;  3LAN A;  4W5T A;  4J2D A;  3I0S A;  4FLY A;  4E7J A;  3KLF A;  4DQP A;  1K6Y A;  4W5Q A;  2P51 A;  2Q3S A;  1YTU A;  3DMJ A;  4KAZ A;  1U49 A;  4EZ6 A;  3O4N A;  4E7H A;  4FJX A;  2VWJ A;  4EP4 A;  4NCB A;  3TAB A;  4CEB A;  2HW3 A;  1ITG A;  4LY7 A;  4DQS A;  3DRR A;  1ZBI A;  3KIO A;  5FRN A;  1L5U A;  2KFZ A;  1HYV A;  3LWM A;  3P83 D;  4CEC A;  4FLV A;  2JGU A;  3SPZ A;  4F4K A;  4J2E A;  4OLA A;  2EHG A;  3AVG A;  5CZ2 A;  3SCX A;  4KPY A;  1NK6 A;  4L8R B;  4Z4G A;  3TAG A;  5HP1 A;  4B9S A;  3AVB A;  3DRP A;  3V1Q A;  2G8V A;  1TKX A;  3RRG A;  4PA1 A;  1BGX T;  3OVN A;  2XY7 A;  3ZT2 A;  4FVM A;  3OJS A;  4H8K A;  2GV9 A;  4IG0 A;  4O44 A;  2E6L A;  1JLB A;  1WAJ A;  4CF2 A;  3OYC A;  3DI6 A;  5CY4 A;  1BI4 A;  1UOC A;  3ZSZ A;  3EYZ A;  3SYZ A;  1WSF A;  1HYZ A;  2OA8 A;  4C8L A;  4F2S A;  4DSE A;  5HRN A;  4ELT A;  4CHZ A;  3HK2 A;  4FCY A;  2HHX A;  1TVR A;  3T19 A;  4CJS A;  3DYA A;  3OYJ A;  1RNH A;  4CK1 A;  4XIU A;  3UIQ A;  2YHB A;  2B5J A;  4DFK A;  3MXJ A;  1CXU A;  4CFA A;  1QSL A;  2ZE2 A;  3SQ1 A;  3ZSQ A;  3LP2 A;  3CYM A;  4ICL A;  3P5J A;  1HRH A;  3O4Q A;  3I8D A;  3NHG A;  3P1G A;  3SUQ A;  2XY8 A;  2BE2 A;  4DFP A;  3KLE A;  2BGG A;  2FBT A;  3RMA A;  3LP1 A;  4Q5V A;  3E01 A;  1QE1 A;  3VA3 A;  1KFS A;  4DWI A;  4E0D A;  2KTQ A;  4FJH A;  1RDC A;  4FJI A;  4F8R A;  3QIO A;  4ZHR A;  2GUI A;  4IG3 A;  3RMC A;  3VQ9 A;  3VQ8 A;  4B08 A;  3DLR A;  4NYF A;  4AHU A;  1O1W A;  1NKE A;  4KB0 A;  1EX4 A;  2OPP A;  1CZ9 A;  3DLB A;  3PX6 A;  4BDY A;  4FYD A;  1JL2 A;  2IAJ A;  4CGI A;  5I3U A;  1U48 A;  4CED A;  4EZ9 A;  1KVB A;  4F3O A;  2QKB A;  3ZSV A;  3LDS A;  4KHS A;  3NGI A;  4ELU A;  3G0Z A;  2Y1I A;  3ZSX A;  4N47 A;  4FZX C;  3L2Q A;  3ASM A;  3S3M A;  1BCO A;  3WNG A;  4CEQ A;  3VQC A;  3OS0 A;  4DTN A;  3KK3 A;  4OVL A;  4RW4 A;  5J2P A;  5KRT A;  3A2F A;  2Y1J A;  4J2B A;  1WSG A;  4AHS A;  3ZSR A;  4OKK A;  4DF4 A;  1RT2 A;  4CJP A;  1JLE A;  2DFF A;  3K57 A;  4FLW A;  1RTH A;  1TKD A;  4FK0 A;  4G1Q A;  1XHZ A;  2XRI A;  1GOA A;  3K5M A;  3HO1 A;  2ZQB A;  5HRR A;  3SQ0 A;  1C0U A;  3AVA A;  4CFC A;  4GW6 A;  3ZSY A;  1RBR A;  3K2P A;  4IDK A;  1A5X A;  1GOB A;  4DG1 A;  1TK0 A;  2O4G A;  1B92 A;  1A5V A;  2DFH A;  1RBU A;  1S1X A;  2LSN A;  1KVA A;  3AO2 A;  2DTU A;  4FLU A;  1LV5 A;  3V9X A;  1RCH A;  1RTJ A;  3V9W A;  4KTW A;  3MAQ A;  4W5R A;  3ZT0 A;  3NF6 A;  4AHT A;  4LH4 A;  1JXB A;  3V9U A;  1X9M A;  1HNV A;  4PUO A;  2R7Y A;  3C6T A;  4B9L A;  4KTZ A;  3VN5 A;  4K8X A;  5KTQ A;  3AA5 X;  4I2P A;  1DTT A;  5KRS A;  3BDP A;  1IH7 A;  1LAW A;  1WSJ A;  4B8C A;  4FJJ A;  1ZBH A;  3HM9 A;  3LP3 A;  2GBZ A;  4E3S A;  3D45 A;  1KRP A;  3T3F A;  3S9H A;  1JXE A;  1JL1 A;  3CM6 A;  4KHY A;  2YV0 X;  3SUN A;  2OPR A;  4FJ7 A;  4NCA A;  4M3W A;  5E41 A;  4BWM A;  3SV3 A;  4HUG A;  1RT1 A;  2HHU A;  3LPU A;  3OYE A;  3PX0 A;  3QEI A;  3RRH A;  1YTA A;  1S1W A;  4LD0 A;  2OPQ A;  1UA0 A;  4CEO A;  1HPZ A;  1UAX A;  4M45 A;  1C0M A;  2G8U A;  4FJN A;  1C6V A;  4CIG A;  4CES A;  1XI1 A;  3QER A;  1RTI A;  3AA3 A;  2HNZ A;  4O0J A;  3L2U A;  4DU4 A;  1LWE A;  1C1B A;  4B9U A;  1WLJ A;  4KHN A;  3C6U A;  4CIF A;  1TAQ A;  4DFJ A;  4M42 A;  1S5J A;  1JLG A;  2FBY A;  3DRS A;  4OGC A;  5K14 A;  4HUE A;  2OZM A;  2WOM A;  3I0R A;  4LH5 A;  3JSM A;  4CJL A;  4I7F A;  3MEC A;  4MFB A;  5C24 A;  3THV A;  4OPK A;  1X1P A;  1BL3 A;  1X9W A;  4R5P A;  3OYI A;  2YNH A;  3NDK A;  3HYF A;  4BE1 A;  2E4L A;  4DU3 A;  4CCH A;  2FC0 A;  2X6N A;  3DLH A;  2KZZ A;  3ZT1 A;  2ZD1 A;  1N5Y A;  3MED A;  2DFE A;  4I9L A;  1S9G A;  1TL3 A;  4AIL C;  2YKM A;  3NF8 A;  1UA1 A;  4FZZ A;  1RDA A;  1VSI A;  3LAL A;  3NBP A;  4KO0 A;  3VQ7 A;  4CHO A;  4HTU A;  2ETJ A;  3ZSW A;  4JS4 A;  2D0A A;  1BQM A;  1RBS A;  2X6S A;  3DOK A;  3VA0 A;  4FW1 A;  1SL0 A;  1FXX A;  2HND A;  5FDL A;  5J2N A;  3KKS A;  4NYN A;  4B9N A;  1VSD A;  3WNH A;  1JLQ A;  3V1R A;  2F8T A;  3NF9 A;  4BE0 A;  1R0A A;  4Z4C A;  3OY9 A;  3D0P A;  1FK9 A;  1RTD A;  1IKV A;  3NAE A;  3ZCM A;  3QEW A;  1TV6 A;  4GMJ B;  1W9H A;  4Z4I A;  3KK1 A;  4DS4 A;  2VG6 A;  4CJW A;  3OYG A;  3RTV A;  4DSJ A;  3K5L A;  1BI4 B;  1EKE A;  2I5J A;  3B6O A;  5T7B A;  3KD1 E;  4KTQ A;  4ZTF A;  4AHR A;  3OYB A;  1WN7 A;  5CZ1 A;  3SJJ A;  1J5O A;  4FK2 A;  3PUF A;  2IOC A;  4C8M A;  1BIU A;  2YNF A;  2F8S A;  3OYK A;  5C42 A;  3BGR A;  3U3G A;  4FM1 A;  1VSF A;  1ASV A;  3HST B;  3SUO A;  3AVH A;  1IG9 A;  1REV A;  1VSM A;  1S1U A;  4Z4H A;  1BIS A;  1C0T A;  1B9F A;  1ASW A;  3HP9 A;  4JLH A;  4B3O A;  3QNO A;  1NJX A;  1IO2 A;  4CEA A;  1HYS A;  2BDP A;  4CJE A;  2WON A;  1RT4 A;  4O5B A;  1WSE A;  2HB5 A;  4FJL A;  1ZYQ A;  4QCL A;  3MXM A;  3PY8 A;  4FM2 A;  2ATQ A;  3V1O A;  1RT7 A;  4DS5 A;  4BWJ A;  2HVI A;  2OYQ A;  2IGI A;  2HVH A;  4FLX A;  5SWM A;  4MQ3 A;  2OPS A;  4CK3 A;  3TAN A;  3SI6 A;  1TAU A;  1WNS A;  3C95 A;  4KV8 A;  4RW6 A;  4CEE A;  3C94 A;  2VG5 A;  4RW8 A;  1CLQ A;  3LWL A;  3HP6 A;  1SKW A;  1HJR A;  3KD5 E;  1LWC A;  4BE2 A;  3ALY A;  4DTJ A;  4FZY A;  1ASU A;  1NKB A;  2YNG A;  3SZ2 A;  1NKC A;  1Q9X A;  2ITG A;  1X9S A;  4OKE A;  2W42 A;  1VRU A;  4CJU A;  1XC9 A;  1KFD A;  1J53 A;  1NOY A;  3DLK A;  4CF0 A;  3AA2 A;  3MEG A;  5DK5 A;  5JS2 A;  3L2V A;  3HJF A;  5HRP A;  1Z26 A;  3KLG A;  4DTR A;  4LSL A;  3ZSO A;  1TK5 A;  3VQE A;  1L3T A;  4CHP A;  4Y1D A;  3VQP A;  2BAN A;  3QET A;  4HCB A;  4AHC A;  1TL1 A;  3LZJ A;  2B6A A;  1KLN A;  1WSI A;  3AO1 A;  4CEF A;  3OYN A;  4WE1 A;  4KB1 A;  4N41 A;  1B9D A;  1RIL A;  1SL1 A;  2KW4 A;  4OPJ A;  1Y97 A;  4B8A B;  3QO9 A;  1VSH A;  2YHA A;  1G15 A;  1XWL A;  3OYM A;  2G8H A;  4NCG A;  1IKY A;  4C8K A;  4FJK A;  2G8I A;  1NK5 A;  1QS4 A;  2NUB A;  4B9M A;  3KK2 A;  3CFP A;  2IC3 A;  2O4I A;  4FLZ A;  4KI4 A;  4CJQ A;  1FKP A;  4H4O A;  1NJZ A;  4DSK A;  4CF9 A;  2KQ2 A;  2D5R A;  4DU1 A;  4DFM A;  2F96 A;  3QEP A;  1TKZ A;  1EP4 A;  4IFV A;  1QSS A;  3HPH A;  2HHV A;  4E89 A;  3HT3 A;  3OYA A;  1U4B A;  4CFB A;  1Q9Y A;  3WNE A;  1KLM A;  4W5O A;  1D5A A;  1NK4 A;  3VQ5 A;  4PWD A;  3M8Q A;  3DOL A;  2AJQ A;  3QIP A;  3HVR A; 
#chains in the Genus database with same CATH topology
 4IEI A;  4F3T A;  3MX2 A;  2P9U A;  1D4X A;  4GKK K;  3TTD A;  3D6R A;  4ID1 A;  1QQO A;  4KH4 A;  4CI6 A;  4B1U B;  1D9D A;  1CXQ A;  2NRX A;  4H5T A;  3CM5 A;  3HL8 A;  1K8A O;  4IKF A;  3AVM A;  3PO4 A;  3HXM A;  4YOY A;  1NGF A;  1ZBU A;  3SLC A;  3V9S A;  3SQ2 A;  3M6G A;  3NH0 A;  5GIO A;  4I6M B;  3LDO A;  1X3N A;  2E20 A;  4BRE A;  4BAC A;  2PY5 A;  3QES A;  4CZF A;  2P9I A;  2HHT A;  4DSI A;  1EQY A;  4JRP A;  3JS6 A;  2A1S A;  3A5L C;  2X74 A;  2P9P A;  4GVM A;  4FWQ A;  1NGB A;  4JI2 K;  3SAH A;  3O80 A;  1TKT A;  3LL3 A;  1Q7Y O;  2HHS A;  3ITH A;  4PKG A;  1I39 A;  3EZ5 A;  2VCP A;  4Z4E A;  1NK7 A;  3FZL A;  3WXM B;  1VHX A;  4K25 A;  4BY9 C;  4FM0 A;  4KKO A;  3CME N;  5M1N A;  4FK4 A;  3AVK A;  4M3Y A;  3ZT3 A;  4DQ8 A;  3CCQ N;  1NK8 A;  5FPE A;  5AQV A;  5LJV A;  4CCH A;  4JS5 A;  4CZI A;  1LWF A;  4IFE A;  1Q81 O;  1J6Z A;  3NE6 A;  4ILH A;  5BN8 A;  4BRA A;  2HHQ A;  3OYF A;  3VQD A;  4BRL A;  4BRP A;  2VWK A;  2W41 A;  3LP0 A;  3DJC A;  5AZJ B;  1DTQ A;  3R9P A;  2GX9 A;  4DTU A;  4WFA L;  3VQB A;  1S9E A;  1K8K B;  4CF1 A;  4FWR A;  4CJT A;  1KXP A;  3U9D A;  2YNI A;  2VYP A;  4BC2 A;  3V9Z A;  2QI2 A;  4FJ9 A;  3KKR A;  1U2V B;  3EE9 A;  4FJ8 A;  2F9T A;  4BRO A;  4CGF A;  4DTO A;  3VQA A;  1IKX A;  3TAP A;  4GV9 A;  4M3Z A;  3EO3 A;  3NVK A;  3QEV A;  3O1W A;  4ELV A;  3NFA A;  3F2K A;  5HOO A;  3RWU A;  4JHD B;  2QWO A;  3H08 A;  3IMX A;  3V81 A;  1HNW K;  4I2Q A;  1SAZ A;  3AVJ A;  5JS1 A;  3VEN A;  3FFI A;  1C0F A;  3N4Q A;  2QM1 A;  3O9S A;  3LAK A;  4DLG A;  1OH7 A;  3CQ8 A;  3K5N A;  4IO9 L;  5BRD A;  3OYD A;  1BDG A;  1TK8 A;  1NMD A;  3BF3 A;  1J9A A;  1WUA A;  2I7N A;  2PZS A;  4FO0 A;  2QXF A;  3ZET B;  3PV8 A;  4YOU A;  3HPG A;  3D2F B;  2JLE A;  1T3V A;  4BR9 A;  4R79 A;  4E19 A;  3NGY A;  2E2O A;  2Z1I A;  4QS8 A;  4FLT A;  2GEM A;  1ZC6 A;  2Q3S A;  3O4N A;  2HW3 A;  3GBT A;  3DRR A;  3MX5 A;  4CEC A;  4FLV A;  2JGU A;  4J2E A;  1NGA A;  2EHG A;  5CZ2 A;  3SCX A;  4L8R B;  1NK6 A;  3BUZ B;  5HP1 A;  3CQY A;  2O8D B;  4LF5 K;  1ATS A;  3FZK A;  3ZT2 A;  4X66 K;  4FVM A;  5AQO A;  1WAJ A;  3B8A X;  4BRK A;  5AQU A;  4C8L A;  4DSE A;  4H0X B;  2UXC K;  2P9L A;  3HK2 A;  2HHX A;  5BRF A;  3HBT A;  1P90 A;  3ZSQ A;  3MCA B;  3LP2 A;  3VTI A;  2NNW A;  3QBX A;  1QQN A;  3D7E O;  3P1G A;  5AQP A;  3SUQ A;  2XY8 A;  3KLE A;  4KHP K;  2FBT A;  4H5R A;  4XH1 A;  1BU6 O;  3TTF A;  1KFS A;  5CHI A;  4DV5 K;  1RDC A;  3VET A;  4IG3 A;  1YXQ A;  1DKG D;  3VQ9 A;  4NYF A;  3O1B A;  1NKE A;  5AR0 A;  3RSE B;  2O8F B;  5AFU H;  3DLB A;  3C6H A;  4B1W B;  2QWN A;  3P38 A;  5I3U A;  1U48 A;  1KVB A;  4F3O A;  4JNE A;  2A5X A;  2AA4 A;  3LDS A;  4JKG B;  4DV4 K;  2IIR A;  3A0I X;  5FPM A;  1YF5 L;  2FF6 A;  4A57 A;  1MDU B;  4BG9 A;  1BCO A;  1J5E K;  4CEQ A;  3KK3 A;  4BVP A;  4OVL A;  4RW4 A;  3IKM A;  4AHS A;  5B8H A;  1TKD A;  4CJP A;  2DFF A;  3CC4 N;  3G71 N;  2CGK A;  1VQM N;  3HO1 A;  3AVA A;  3VOV A;  4CFC A;  4RCH A;  1RBR A;  3A5M C;  1GOB A;  3FR0 A;  4JV5 K;  2W40 A;  2GTD A;  2DFH A;  4BQZ A;  1V4S A;  2LSN A;  1KVA A;  3AO2 A;  3MAQ A;  1NGC A;  3ZT0 A;  4PUO A;  4AQY K;  4B9L A;  5LJW A;  3AA5 X;  3C7N A;  4I2P A;  1WSJ A;  4FJJ A;  4E3S A;  3LP3 A;  4U67 L;  1NWK A;  3T3F A;  3S9H A;  1JXE A;  4KHY A;  4AM7 A;  4B1V A;  3BP8 A;  4BWM A;  4H03 B;  4H0P A;  2HHU A;  3OYE A;  4IOA L;  4LD0 A;  1UA0 A;  2P9N B;  4B3M K;  2G8U A;  1C6V A;  5AQW A;  1RTI A;  4DU4 A;  4KHN A;  4BRI A;  2CH5 A;  4PHT X;  3THW A;  4HUE A;  2WOM A;  2HF4 A;  3I0R A;  3JSM A;  1JCG A;  4I7F A;  4OPK A;  1X1P A;  4YDU C;  5C2F A;  3OYI A;  2E4L A;  3THY A;  5KQ8 A;  4DU3 A;  4DR4 K;  3DLH A;  4HWI A;  1N5Y A;  2DFE A;  2ZWH A;  4I9L A;  1TL3 A;  4GNI A;  2ZGY A;  3VQ7 A;  4BGB A;  4FWN A;  2D0A A;  2X6S A;  1E3M A;  3MK6 A;  2Q0R A;  2HND A;  3KKS A;  2KKZ A;  3KVG A;  3NF9 A;  4U7B A;  3K0S A;  4BE0 A;  3D0P A;  1FK9 A;  3R1X A;  3PIP L;  4FWS A;  1RTD A;  4GMJ B;  4Z4I A;  3KK1 A;  3CER A;  4C1N K;  4BRQ A;  3OYG A;  1BI4 B;  4XH4 A;  3KD1 E;  3AY9 A;  5KPR A;  3CQX A;  3OYB A;  1FW6 A;  1J5O A;  3T1H K;  4C8M A;  4X62 K;  5AQF A;  2E5L K;  4BC4 A;  1HKB A;  5IT9 O;  1ASV A;  3SUO A;  1REV A;  3SBT A;  1S1U A;  4OPA A;  4B3O A;  3QNO A;  1HYS A;  3L0Q A;  2BDP A;  3CIP A;  3UKU A;  4O5B A;  1WSE A;  4DR6 K;  4QCL A;  3MXM A;  3PY8 A;  5LY3 A;  2A3Z A;  3E1Y A;  2UU9 K;  2OPS A;  2IVO A;  4JK7 A;  4OPH A;  3LWL A;  1SKW A;  1DT9 A;  4FOE A;  3FZF A;  2FSJ A;  4BE2 A;  4DTJ A;  1NGG A;  2YHX A;  3E9O A;  1ASU A;  1Q82 O;  1Q9X A;  4NB4 A;  1NKC A;  2ITG A;  1X9S A;  1NG9 A;  3SMS A;  1J53 A;  4CF0 A;  3MEG A;  1NLV A;  4DTR A;  4LSL A;  5BR9 A;  5M1Q A;  3AAP A;  2BAN A;  5GIN A;  1TL1 A;  4BR5 A;  4DV1 K;  1XC3 A;  1WSI A;  1MWM A;  4DB3 A;  3O08 A;  1SL1 A;  2OAN A;  4B8A B;  2YHA A;  1XWL A;  3VMF B;  2YHY A;  2VQF K;  4WYB A;  4BRC A;  4DUZ K;  5C0Y A;  1BOT O;  2G8I A;  3I56 N;  1YUW A;  2BH1 A;  1QS4 A;  3KK2 A;  1YJW N;  4JKE A;  3LM2 A;  1IBK K;  4CJQ A;  1FKP A;  2F96 A;  4DV0 K;  4WFB L;  3HPH A;  4W5O A;  3J7Z O;  4H0Y B;  2FSK A;  4BR2 A;  3MCP A;  4I9Q A;  3IS9 A;  1TYQ A;  1T03 A;  2FSN A;  3ID6 A;  2OTJ N;  1OVY A;  1Q8I A;  2P9U B;  3E9L A;  4N76 A;  4KH5 A;  3OA9 A;  3WQT A;  1NBW A;  2G8W A;  5GAD P;  2OZS A;  4V19 S;  1BA0 A;  4FJG A;  3LAM A;  5AJ3 K;  3SUP A;  5F0X A;  3M8R A;  1T7P A;  5AQG A;  3J7A P;  1SKR A;  2P5G A;  1VQ6 N;  3IRX A;  4MO4 A;  1YIT N;  4M7X A;  4BDZ A;  2ASM A;  4B1Z A;  5ELZ A;  3NVM A;  1GLC G;  3QEX A;  1NU0 A;  4JKB A;  4MDA A;  2Q2R A;  4Y1C A;  2RE2 A;  3HVT A;  3AVC A;  1J54 A;  4RG8 A;  4E7I A;  3V4I A;  1HQE A;  2HST A;  3DLG A;  4DQQ A;  5EY4 A;  2VWB A;  1RBT A;  1NJW A;  4B3S K;  4LC9 B;  4A62 A;  1SUQ A;  4M3U A;  4KH6 A;  4CF8 A;  4O8K A;  4DV2 K;  4CJR A;  2P9P B;  1N8R O;  1QTM A;  1LW0 A;  5I42 A;  3NH2 A;  3OYH A;  2HMI A;  5HLF A;  3L2W A;  3T69 A;  4M3X A;  3H1Q A;  4O4G A;  1U45 A;  1VSJ A;  3E66 A;  3CCJ N;  1I94 K;  3RR7 A;  4N5S A;  3L2R A;  1TGO A;  4DLE A;  2E2N A;  4YOX A;  2HHW A;  4CHQ A;  1ZBS A;  4IOC L;  1EXQ A;  2RPI A;  1N36 K;  4LF9 K;  4BR4 A;  4E1M A;  3WEE A;  4B9Q A;  2XY6 A;  3EY1 A;  5DMR A;  1XHX A;  4M3T A;  3SV4 A;  1VSK A;  2RN2 A;  4QAG A;  3ZEU A;  3M8S A;  1I3A A;  3KHY A;  5BR8 K;  4ID5 A;  3KWG A;  4E1N A;  4W5N A;  1EET A;  1XQS C;  4JYA K;  4DQR A;  4PY5 A;  1N32 K;  3V6D A;  3HOS A;  3ZX3 A;  1D9F A;  2G8K A;  3O3F A;  2EWS A;  1Z6R A;  3RMB A;  1FKO A;  2UUC K;  1GOC A;  4RTF D;  1JLA A;  3ISN C;  2NRR A;  1LAV A;  1IKW A;  2ZF5 O;  3VGM A;  3NF7 A;  4CK2 A;  1N34 K;  3CI5 A;  3MXI A;  2WBN A;  3PO5 A;  1RT5 A;  3OJU A;  4IJN A;  1HPM A;  1KCF A;  4DTX A;  4CGH A;  2X78 A;  2Q0U A;  2Q97 A;  1JCF A;  4CVN E;  4AH9 A;  4GV3 A;  3KLI A;  4CFD A;  3CFO A;  5HBM A;  4IDH A;  4H5N A;  4DUY K;  4QOZ B;  4JD2 B;  3NCI A;  3OS2 A;  3UE5 A;  4WQ4 A;  1VQK N;  3THX A;  2YJE A;  2Z1J A;  4PKH A;  3VEV A;  1L3S A;  4ZTJ A;  3L3V A;  3K59 A;  4EFH A;  4JI8 K;  3AVN A;  4N56 A;  1WAF A;  1C1C A;  5M1O A;  1JJ2 M;  4H4M A;  3TAM A;  1F21 A;  4YHH K;  2P5O A;  4BR7 A;  4C8N A;  4KRE A;  3GG4 A;  1V4T A;  5CYM A;  2QWP A;  2W6L A;  4UQG A;  4YDU A;  2PAV A;  1M90 O;  1VQP N;  2P1J A;  2KFN A;  4JI6 K;  3AVI A;  1RFQ A;  1S6P A;  3OBY A;  3AGR A;  2P9K A;  4GY2 B;  5C25 A;  4E7J A;  3DXK A;  3KLF A;  3LDQ A;  4KAZ A;  2A42 A;  5BN9 A;  3KIO A;  1HYV A;  3P83 D;  4KPY A;  3TAG A;  4B9S A;  4M63 C;  3V1Q A;  3CC2 N;  4K43 A;  3RRG A;  4H0O A;  2O8B B;  4PA1 A;  3C0B A;  3OVN A;  1QZ6 A;  3W0L A;  1K73 O;  2GV9 A;  2E6L A;  4CF2 A;  1BUP A;  3SYZ A;  3DLL L;  5HRN A;  3HTV A;  2F4V K;  1TVR A;  4CJS A;  4CK1 A;  4XIU A;  4MLE A;  5MLC Q;  3UIQ A;  2B5J A;  3H3O B;  1CXU A;  4CFA A;  2ZE2 A;  3SQ1 A;  3O4Q A;  5LL6 Z;  4ISE A;  2WUS A;  3NHG A;  3IFR A;  3OHR A;  2BE2 A;  2H3G X;  5AQS A;  3JAM O;  3E01 A;  1QE1 A;  4DWI A;  4E0D A;  3UKR A;  3ULE A;  4DR2 K;  3EE8 A;  2Q36 A;  3DLR A;  4LFA K;  4FYD A;  1JL2 A;  2IAJ A;  4EZ9 A;  4M7Y A;  1HJO A;  1CZA N;  2UUA K;  3NGI A;  4ELU A;  4B3R K;  3G0Z A;  2Y1I A;  4LF8 K;  4FZX C;  3S3M A;  1NGH A;  3VEY A;  3CMA N;  1TUU A;  4BQL A;  3ZSR A;  4DF4 A;  1RT2 A;  4FK0 A;  4FLW A;  3DXM A;  3VEW A;  1XHZ A;  2XRI A;  3EEQ A;  2A40 A;  1Y64 A;  5AQQ A;  1T6D A;  4XH5 A;  3GOI A;  2O4G A;  1HNZ K;  3VF2 A;  1RBU A;  1S1X A;  3K9K A;  4X64 K;  3V9X A;  3G25 A;  1RCH A;  4FL9 A;  3NF6 A;  2D1K A;  1JXB A;  2YCH A;  4A5A A;  4KTZ A;  4PL8 A;  3P4I A;  4H5W A;  5KTQ A;  5KRS A;  1DTT A;  4CZH A;  3BDP A;  1IH7 A;  4B8C A;  1HKC A;  2UUB K;  3D45 A;  3C7N B;  3OW2 M;  5F1X A;  1JL1 A;  2YV0 X;  5AFU A;  3QML A;  3LPU A;  3RRH A;  1YTA A;  2OPQ A;  4CEO A;  3M3Z A;  1UAX A;  4M45 A;  4FJN A;  3MWP A;  1XI1 A;  3ZX0 A;  5M1F A;  3C6U A;  2E8A A;  1TAQ A;  4CIF A;  1VQ9 N;  2AP1 A;  3U8X A;  4M42 A;  1T6C A;  1W7A A;  4IJA A;  3TTC A;  4QS9 A;  3DRS A;  5K14 A;  4MFB A;  4CZL A;  3THV A;  1GLJ O;  3HYF A;  2Q1N A;  2I7P A;  5TKW A;  1NGD A;  2KZZ A;  3P31 A;  3ZT1 A;  4MDB A;  1S9G A;  4AIL C;  2YKM A;  1SS6 A;  4FZZ A;  5AQR A;  3LAL A;  3NBP A;  4CHO A;  4HTU A;  5JIC A;  3DOK A;  3VA0 A;  4FW1 A;  1KAZ A;  5FDL A;  3DAW A;  3WNH A;  1JLQ A;  5JMV A;  3OY9 A;  4CW7 B;  4JI0 K;  3PSF A;  3NAE A;  4JAX A;  1W9H A;  4CJW A;  3BF1 A;  3EL2 A;  2KHO A;  2I5J A;  3B6O A;  5T7B A;  4ZTF A;  3AAR A;  5CZ1 A;  1BIU A;  2YI1 A;  3OYK A;  4FM1 A;  1VSF A;  3HST B;  1IG9 A;  3AVH A;  2YHW A;  4O5F A;  1VSM A;  3Q7C A;  1C0T A;  1B9F A;  3GE1 A;  5AQN A;  5AQH A;  2WON A;  2HB5 A;  3ENO A;  4BWJ A;  3UKU B;  3U4L A;  4MQ3 A;  4B1Y B;  1HR0 K;  4OO1 J;  1TAU A;  3C95 A;  1ATN A;  2VG5 A;  3HP6 A;  5GAE P;  2CGL A;  4CBW A;  1LWC A;  1MA9 B;  1NKB A;  2YNG A;  3SZ2 A;  2WTU A;  1VRU A;  3O9R A;  1KFD A;  3AA2 A;  5DK5 A;  3L2V A;  3HJF A;  5HRP A;  1Z26 A;  4QS7 A;  1VQ8 N;  3KLG A;  3ZSO A;  1TK5 A;  4CHP A;  1Q86 O;  4Y1D A;  3VQP A;  2V7Z A;  3EN9 A;  4DV7 K;  4AHC A;  3HRG A;  3LZJ A;  1KLN A;  4N41 A;  3AO1 A;  4WE1 A;  1RIL A;  1U2V A;  3OYM A;  1G15 A;  2G8H A;  3ENH A;  3ZX2 A;  4B1X B;  4C8K A;  3TSQ A;  1NGE A;  1NK5 A;  2NUB A;  3CFP A;  2BTF A;  1M1K O;  2IC3 A;  3D2E B;  2HMP A;  3QEP A;  1EP4 A;  4JHD A;  2ZM6 K;  2HBJ A;  3G4S N;  4JKC A;  1Q9Y A;  4CFB A;  1W97 L;  1ZXO A;  4PWD A;  1IBL K;  2VWJ A;  2W6K A;  4WQ4 C;  4IBN A;  3QIP A;  2HF3 A;  1A5W A;  4CZE A;  1DGK N;  1W2B M;  4CJF A;  3CG7 A;  4F2R A;  4Q0B A;  4DSF A;  3L4I A;  1TYQ B;  3ATU A;  4JN4 A;  4CER A;  2BUP A;  1VK0 A;  3J81 O;  3VQ4 A;  4DV3 K;  1NOZ A;  4OGE A;  3ZET A;  3TWH A;  2D0B A;  3NMU A;  2PYJ A;  1WSH A;  4IFY A;  4NLC A;  1RT3 A;  2Z1H A;  1HNX K;  1KSP A;  2JWL A;  3K5O A;  3QLH A;  2EX3 A;  1ZBL A;  4KHU A;  3TAF A;  1BCM A;  3IAY A;  3ULD A;  2QXL A;  3SJH A;  4JI1 K;  3BZC A;  3B6P A;  3R3L A;  3MEE A;  2O8C B;  5EU7 A;  4KHW A;  3VQ6 A;  4AHV A;  1S1V A;  3CCE N;  4CJ5 A;  1IG8 A;  3CJA A;  3LPT A;  4M3R A;  4AF1 A;  2QKK A;  4DR3 K;  2PYL A;  5AQJ A;  2E2Q A;  3O9Q A;  4KRF A;  1NJI O;  2QK9 A;  1YT3 A;  3J7Y P;  2ZJP L;  1HNI A;  4CJV A;  2KZM A;  3A8Y A;  3SPY A;  4JKA A;  4F9O A;  3L6Q A;  3NGZ A;  1LW2 A;  3WQU A;  4K8Z A;  1YI2 N;  3H46 O;  4DTS A;  5EXW A;  2QWM A;  3Q7B A;  3JYT A;  5J2Q A;  3LDP A;  2XO7 A;  3KTQ A;  1XUP O;  3CHW A;  3AA4 A;  4OKJ A;  4CD1 A;  4NXM K;  3SK3 A;  1VQ4 N;  4LF4 K;  1Q18 A;  4WCE L;  4HVJ A;  3QIN A;  4DQI A;  4J2A A;  1QQC A;  2D0P A;  4DMN A;  1OVQ A;  2DY4 A;  2VQE K;  2O8F A;  1YAG A;  3RSE A;  5AQZ A;  1S6Q A;  4DR5 K;  1LCU A;  2IDO A;  3C6A A;  3QBW A;  3CFR A;  1VQ7 N;  1N6Q A;  3C65 A;  3WXK A;  1GLA G;  3CD6 N;  4RW7 A;  4C8O A;  2B4J A;  1VSE A;  1Z25 A;  4LSN A;  1KVC A;  2UXD K;  5D3G A;  4CBX A;  1HX1 A;  2E1Z A;  4PL7 A;  2FXU A;  2G8F A;  3VF6 A;  5I9E B;  1VQN N;  3J80 O;  1U47 A;  4BR0 A;  5BPM A;  4CJK A;  1QSY A;  2D0C A;  5FRM A;  3KK7 A;  2FF3 B;  1SKS A;  4H5V A;  4TSX A;  4LF7 K;  5HRO A;  4Y0W A;  2HBM A;  2PFU A;  1QHT A;  3GL1 A;  4CGD A;  1VAZ A;  4M41 A;  1S72 N;  3L3U A;  4EP5 A;  2E1Y A;  3L8B A;  4DV6 K;  4K0K K;  3F9M A;  1VQ5 N;  1RDD A;  4CZK A;  1HQU A;  1JLF A;  4E7K A;  3I33 A;  1ATR A;  4Z4F A;  2P9N A;  2ZGZ A;  5JLF A;  4CZJ A;  3KZB A;  2YKN A;  3JXU A;  3AVF A;  1W0H A;  1CZB A;  4NXN K;  3MWT A;  3F73 A;  4DSL A;  4KFB A;  3ZT4 A;  4IEE A;  3LAN A;  4YOR A;  3I0S A;  1IJJ A;  3BZK A;  4EAH D;  1K6Y A;  4W5Q A;  2P51 A;  4DQP A;  1YTU A;  1U49 A;  4NCB A;  4E7H A;  1WOQ A;  4LY7 A;  2P9I B;  2GWJ A;  4DQS A;  1ZBI A;  4AM6 A;  1L5U A;  2KFZ A;  2V51 B;  4OLA A;  2WC9 A;  4Z4G A;  3QB0 A;  2HHH K;  3O5B A;  3AVB A;  4FSV A;  1R59 O;  4H0V B;  2G8V A;  4HTL A;  1TKX A;  1BGX T;  1OH8 A;  5E26 A;  4IG0 A;  4O44 A;  4ISG A;  4JK9 A;  4X65 K;  3OYC A;  3DI6 A;  5CY4 A;  1BI4 A;  1UOC A;  3ZSZ A;  1WSF A;  1HYZ A;  4F2S A;  4IXC A;  4ELT A;  5C10 A;  4FCY A;  5AZI A;  3T19 A;  3DYA A;  1RNH A;  3VF4 A;  5BRH A;  5FPD A;  4IOX A;  3P5J A;  4PKI A;  3I8D A;  4WQ5 A;  3TPQ A;  2BGG A;  3WUH A;  3TSP A;  4Q5V A;  3VA3 A;  4FJH A;  4A5B A;  4F8R A;  3QIO A;  4FJI A;  3UKR B;  3ULE B;  1O1W A;  1CZ9 A;  4BDY A;  2V7Y A;  4CED A;  3HSC A;  2O8E A;  3FFK B;  1RGI A;  2NRH A;  3ZSX A;  4N47 A;  3ASM A;  5EVZ A;  3OS0 A;  4BRG A;  5KRT A;  4YOW A;  4OKK A;  1JLE A;  4CD3 A;  1RTH A;  1HLU A;  4K42 A;  2QTD A;  3K5M A;  3MN9 A;  3A5N C;  3SQ0 A;  3ID8 A;  1C0U A;  4GW6 A;  1MWK A;  3ZSY A;  2IVN A;  2F7T A;  1A5X A;  1TK0 A;  3QFU A;  5KPT A;  5BRE A;  1A5V A;  3K9J A;  3G6E N;  3PSI A;  4FLU A;  1LV5 A;  3CCS N;  1GLL O;  3FZM A;  4W5R A;  4AHT A;  4LH4 A;  3CET A;  1HNV A;  3LM9 A;  2R7Y A;  2ASO A;  3C6T A;  3EZW A;  1LAW A;  1ZBH A;  2GBZ A;  1RDW X;  1KRP A;  5EX5 A;  3T7Z A;  3SUN A;  2OPR A;  4FJ7 A;  4NCA A;  4M3W A;  4JI3 K;  4BVO A;  1RT1 A;  5KPZ A;  1G99 A;  3PX0 A;  1OKJ A;  1BA1 A;  1NGI A;  1BO5 O;  3I8B A;  3HI0 A;  5TKY A;  4CES A;  3O9T A;  3AA3 A;  2QWR A;  2HNZ A;  3CJC A;  1LWE A;  1C1B A;  1TUY A;  4CZM A;  5CE3 A;  4B9U A;  2P9S A;  2Q31 A;  4ISF A;  1S5J A;  1JLG A;  3VGL A;  2D4W A;  4OGC A;  2OZM A;  3MEC A;  5M1P A;  5C24 A;  4BC3 A;  1BL3 A;  4R5P A;  3LDL A;  3NDK A;  2CH6 A;  4FPA A;  2X6N A;  5LMU K;  3MN6 A;  1H1V A;  3PIO L;  2E88 A;  3VGK A;  2ETJ A;  3ZSW A;  1BQM A;  1SL0 A;  1FXX A;  5J2N A;  3GDQ A;  4B9N A;  1VSD A;  5JVG L;  4BRH A;  2NZT A;  3V1R A;  2F8T A;  1R0A A;  4Z4C A;  3ATV A;  4EHU A;  4FWM A;  3ZCM A;  3WXJ A;  4G9Z A;  2VG6 A;  2DPN A;  4BC5 A;  3J8A A;  3HM8 A;  4KTQ A;  4AHR A;  2P9L B;  1WN7 A;  3VEX A;  5JLH A;  3PUF A;  3SAG A;  2ZJQ L;  2YNF A;  2F8S A;  5C42 A;  5BPN A;  4Z4H A;  4YY3 K;  3F5T A;  4JLH A;  3SAF A;  1IO2 A;  4CEA A;  2QA4 N;  4JKH A;  5M1K A;  1RT4 A;  2ATQ A;  2VGM A;  1RT7 A;  4DS5 A;  2OYQ A;  2IGI A;  4FLX A;  3CJ9 A;  5SWM A;  3CPW M;  2JWK A;  2NRT A;  3TAN A;  1WNS A;  2QEX N;  3C94 A;  4RW8 A;  5BPL A;  1HJR A;  3H45 C;  4JK8 A;  3KD5 E;  4UY8 O;  1QVG M;  1IV0 A;  2W42 A;  1XC9 A;  1NOY A;  5AQY A;  4J8F A;  3H1V X;  3VEZ A;  3CF5 L;  1OH5 A;  3VQE A;  1X3M A;  2ZJR L;  3QET A;  4HCB A;  1KAX A;  2B6A A;  4CEF A;  2E2P A;  4KB1 A;  4OPJ A;  3LDN A;  3QO9 A;  1DEJ A;  3HOT A;  4NCG A;  4Z94 A;  1IKY A;  1QZ5 A;  4MO5 A;  4YOT A;  4FJK A;  1IBM K;  4IO8 A;  4LFC K;  2O4I A;  4FLZ A;  4KI4 A;  1FJG K;  2RHK A;  2KLA A;  1NJZ A;  4DSK A;  3CCU N;  4DU1 A;  2KQ2 A;  3DWL A;  1TKZ A;  4IFV A;  1QSS A;  1E4F T;  1VQL N;  2HHV A;  4E89 A;  1U4B A;  1HKG A;  4RWT A;  3OYA A;  1D5A A;  4NLB A;  3SBG A;  4JD2 A;  3M8Q A;  2AJQ A;  3HVR A;  3SNN A;  1JKH A;  5KGX A;  3QNN A;  3QDK A;  3IUC A;  3VER A;  4FXD A;  4OLB A;  3SMP A;  4E1J A;  3FGU A;  2IS3 A;  3TAR A;  2WFB A;  4A2B A;  3THW B;  4RW9 A;  2FLO A;  2NRZ A;  3WT0 A;  3FZH A;  4FW2 A;  1L3V A;  2IVP A;  4CJ4 A;  3AO4 A;  3MMV A;  4IZ9 A;  3THY B;  4I6M A;  2QWL A;  3H6E A;  3RR8 A;  3AO5 A;  1YJ9 N;  4FWP A;  1BHL A;  4DTM A;  3O3G A;  1T05 A;  4A61 A;  1C1A A;  5FRO A;  3WNF A;  2RF2 A;  5EOY A;  4JRQ A;  3TAQ A;  4IWV A;  4CGG A;  4OJR A;  3NH1 A;  4WF9 L;  1DLO A;  5KI6 A;  2O8B A;  1L3U A;  1KD1 O;  4FWK A;  2HBK A;  1XMO K;  3O8M A;  3CCR N;  3OS1 A;  3S3N A;  1NMN A;  4DF8 A;  5HL7 L;  3T1A A;  3M8P A;  3E9P A;  1T44 A;  3ZLJ A;  3KLH A;  2VGN A;  4C23 A;  1GLB G;  5GAG P;  4GKJ K;  1MU2 A;  2GWK A;  4LFB K;  5J2M A;  5H1S Q;  1NGJ A;  4HUF A;  1KC8 O;  4CGJ A;  3ENB A;  3G10 A;  1HMV A;  1YVU A;  2OCE A;  2ASP A;  4YNQ A;  1EO1 A;  4O0I A;  4WQ5 C;  4XEI A;  4Z0U A;  5HRS A;  2NRV A;  1YIJ N;  1BIZ A;  4KI6 A;  3U6F A;  2GUP A;  1X9J A;  4CHY A;  5J1E A;  2Z1G A;  3RMD A;  1UWB A;  3AO3 A;  3OYL A;  3QIC A;  4B9T A;  5AZJ A;  4E7L A;  1NK0 A;  3U3Y A;  3MDQ A;  4PQU A;  3EKU A;  5SZT A;  1VSL A;  5CYQ A;  3W3D A;  1SQK A;  1KQS M;  4CE9 A;  1K8K A;  4KBO A;  3H3N O;  3IG1 A;  4CHN A;  1U04 A;  4DR1 K;  2F9W A;  3AGK A;  1K9M O;  3F9K A;  2OTL N;  2VG7 A;  4CBU A;  4C1N I;  3SQ4 A;  1S22 A;  4A2A A;  5GAH P;  1ZBF A;  4YOV A;  2A1R A;  4HCC A;  4BDP A;  3KWI A;  3FLC O;  3KJV A;  1S3X A;  3U9Z A;  4CEZ A;  1BQN A;  2FBV A;  3TI0 A;  1YVN A;  3L4Q A;  4CJ3 A;  1SL2 A;  1RDB A;  1NJY A;  2V52 B;  4YFU A;  4DTP A;  4B9V A;  1VRT A;  4NO7 A;  1KAY A;  3LZI A;  1HUX A;  4O55 A;  1T8E A;  3VTH A;  1NK9 A;  3S3O A;  4KHQ A;  3DM2 A;  4HHT A;  3PX4 A;  2D0O A;  4CJ7 A;  3O3H A;  2E6M A;  4FPB A;  1S1T A;  1WBB A;  2YJF A;  4CIE A;  1RT6 A;  3WXI A;  5KGW A;  2UYT A;  3K58 A;  3TAE A;  3TR8 A;  5CR4 A;  2XY5 A;  3HPO A;  3N4P A;  4ILJ A;  2HNY A;  3D2F A;  1D8Y A;  3UB5 A;  3DLE A;  3AVL A;  4FJ5 A;  3R8E A;  1KTQ A;  3VQQ A;  1RBV A;  1C0G A;  1BG3 A;  3AV9 A;  4ILG B;  1SZ2 A;  1SV5 A;  5JVH L;  3I55 N;  4FJM A;  2HBL A;  5DM7 L;  2RKI A;  2FBX A;  2XHB A;  1JLC A;  1WBD A;  3S41 A;  2YX6 A;  4J2D A;  4A59 A;  4W5T A;  1O13 A;  4FLY A;  3DMJ A;  4FJX A;  4EZ6 A;  4EP4 A;  3TAB A;  4CEB A;  1ITG A;  5FRN A;  4FVU A;  3LWM A;  4F4K A;  2J4R A;  3SPZ A;  3VEO A;  2O8D A;  3AVG A;  4CZG A;  3DRP A;  4BRN A;  3CXC M;  5A2Q O;  2HOE A;  2XY7 A;  3O6W A;  3IDH A;  3OJS A;  4H8K A;  1JLB A;  1Z05 A;  3EYZ A;  2NLX A;  3OBW A;  1JCE A;  2OA8 A;  4CHZ A;  3OTO K;  2A41 A;  5AQK A;  3OYJ A;  5AQX A;  2YHB A;  5AQI A;  4DFK A;  3MXJ A;  5AZI B;  3R6M A;  1QSL A;  3CYM A;  4ICL A;  1HRH A;  3WEE B;  4DFP A;  3CJ1 A;  3RMA A;  5DM6 L;  3LP1 A;  1XNQ K;  3ZEU B;  2KTQ A;  4DCH A;  4FWL A;  4ZHR A;  2GUI A;  3RMC A;  3VQ8 A;  1EWR A;  4B08 A;  3VES A;  4AHU A;  4KB0 A;  1YJN N;  1EX4 A;  2OPP A;  3PX6 A;  4JKG A;  4CGI A;  4EHT A;  3MN7 A;  1XMQ K;  2QKB A;  3ZSV A;  4KHS A;  5AQM A;  1QQM A;  2O8E B;  1U6Z A;  5IWA K;  3L2Q A;  3WNG A;  3VQC A;  4DTN A;  5J2P A;  3A2F A;  3HZ6 A;  2Y1J A;  4J2B A;  1WSG A;  1XNR K;  3K57 A;  1BWF O;  4G1Q A;  3M5R A;  2QWQ A;  1GOA A;  2ZQB A;  5FPN A;  4H0T B;  5HRR A;  4BRD A;  3K2P A;  4OX9 K;  1E4G T;  4IDK A;  4DG1 A;  1B92 A;  4JI7 K;  1GLE G;  1NM1 A;  3D2E A;  2DTU A;  1RTJ A;  3V9W A;  4KTW A;  5ADX A;  4GV6 A;  3V9U A;  1X9M A;  1QHA A;  4K8X A;  3VN5 A;  2PBD A;  4L3Q A;  3THX B;  1RDU A;  3HM9 A;  4WFN L;  3CM6 A;  4JI5 K;  4DR7 K;  5E41 A;  4B3T K;  5C15 A;  5F2R A;  3SV3 A;  4HUG A;  3P39 A;  3QEI A;  1S1W A;  1HPZ A;  5LMN K;  1C0M A;  3PLA A;  4CIG A;  3QER A;  4FOI A;  4O0J A;  3L2U A;  3CCV N;  4BGA A;  1WLJ A;  4DFJ A;  4JKD A;  1N33 K;  2FBY A;  5GIP A;  2P9S B;  4LH5 A;  3TU5 A;  4CJL A;  4FWO A;  1P8Z A;  2P9K B;  2QW9 A;  3ZYY X;  4K41 A;  3O4W A;  1X9W A;  4BE1 A;  2YNH A;  4DHY A;  3A5O C;  3DXK B;  2FC0 A;  3MN5 A;  3QFP A;  3O9U A;  2ZD1 A;  3MED A;  3NF8 A;  1UA1 A;  1RDA A;  1VSI A;  4KO0 A;  4EIA A;  4JS4 A;  1RBS A;  1LOT B;  4NYN A;  5C2D A;  2O8C A;  1WB9 A;  3CCL N;  4JI4 K;  4BG8 A;  1IKV A;  3QEW A;  1TV6 A;  1YHQ N;  4GVE A;  4DS4 A;  3RTV A;  4DSJ A;  3RVC A;  3K5L A;  1EKE A;  3VPZ A;  3SJJ A;  4FK2 A;  2IOC A;  4LF6 K;  3BGR A;  3U3G A;  3CJB A;  1BIS A;  3HP9 A;  1ASW A;  1NJX A;  5ADX H;  3CC7 N;  3TSU A;  3AAQ A;  4CJE A;  4FJL A;  1ZYQ A;  5AQL A;  2UXB K;  4FM2 A;  3V1O A;  3BY5 A;  4JEP A;  3WXL A;  2HVI A;  3FE1 A;  1OH6 A;  2HVH A;  4CK3 A;  2A6A A;  3SI6 A;  4RW6 A;  4KV8 A;  1CLQ A;  4CEE A;  5E84 A;  5C12 A;  1EWQ A;  4FZY A;  3ALY A;  5KQD A;  4JKF A;  4OKE A;  1QVF M;  1VQO N;  5AQT A;  4CJU A;  2CGJ A;  3DLK A;  2GEL A;  5JS2 A;  4BRF A;  1L3T A;  3DXM B;  4DKW A;  3OYN A;  1B9D A;  2KW4 A;  1Y97 A;  3EKS A;  1VSH A;  3CCM N;  2NRW A;  1ILY A;  3CPE A;  4O8U A;  1NNE A;  4B9M A;  1GLD G;  3CJ7 A;  3BEX A;  1GLF O;  4BRM A;  4H4O A;  3M1F A;  4CF9 A;  2D5R A;  4DFM A;  4MLH A;  3HT3 A;  3WNE A;  1KLM A;  5FLX O;  3T1Y K;  2ITM A;  1NK4 A;  3VQ5 A;  3DOL A;  1ESV A; 
#chains in the Genus database with same CATH homology
 4IBN A;  1A5W A;  4F3T A;  3SNN A;  1JKH A;  4CJF A;  5KGX A;  4I9Q A;  3IS9 A;  3QNN A;  1T03 A;  3CG7 A;  4F2R A;  4Q0B A;  4DSF A;  1Q8I A;  4FXD A;  4OLB A;  4ID1 A;  4CER A;  4N76 A;  1VK0 A;  2IS3 A;  1D9D A;  2G8W A;  2OZS A;  1CXQ A;  3VQ4 A;  1NOZ A;  3TAR A;  4FJG A;  3LAM A;  4OGE A;  3SUP A;  3M8R A;  1T7P A;  3CM5 A;  3TWH A;  3HL8 A;  4RW9 A;  3AVM A;  4IKF A;  1SKR A;  2P5G A;  3PO4 A;  2D0B A;  3IRX A;  4FW2 A;  3HXM A;  1L3V A;  1ZBU A;  4CJ4 A;  2PYJ A;  3AO4 A;  1WSH A;  4IFY A;  4BDZ A;  3V9S A;  1RT3 A;  2Z1H A;  3SQ2 A;  1KSP A;  3QEX A;  3NH0 A;  3RR8 A;  3K5O A;  3QLH A;  4Y1C A;  2EX3 A;  1ZBL A;  3HVT A;  3AVC A;  3AO5 A;  4KHU A;  1J54 A;  4BAC A;  2PY5 A;  4RG8 A;  4E7I A;  1BCM A;  3QES A;  3V4I A;  1HQE A;  3TAF A;  3DLG A;  3ULD A;  4DQQ A;  1BHL A;  4DTM A;  3IAY A;  2HHT A;  1RBT A;  1NJW A;  4DSI A;  3B6P A;  3O3G A;  3MEE A;  5EU7 A;  1T05 A;  1C1A A;  5FRO A;  3WNF A;  4JRP A;  2A1S A;  4KHW A;  1SUQ A;  2RF2 A;  4JRQ A;  2X74 A;  3TAQ A;  4GVM A;  3VQ6 A;  4AHV A;  4CGG A;  1S1V A;  4OJR A;  3NH1 A;  4CF8 A;  4CJ5 A;  1DLO A;  5KI6 A;  3LPT A;  4M3R A;  4CJR A;  1TKT A;  1L3U A;  1QTM A;  2QKK A;  1LW0 A;  2HHS A;  5I42 A;  3ITH A;  2PYL A;  3OS1 A;  3S3N A;  3NH2 A;  4KRF A;  1I39 A;  3OYH A;  3EZ5 A;  4DF8 A;  5HLF A;  3L2W A;  2HMI A;  1YT3 A;  4M3X A;  4M3U A;  2QK9 A;  3T1A A;  4Z4E A;  3M8P A;  1HNI A;  4O4G A;  1VSJ A;  4CJV A;  1U45 A;  3SPY A;  1NK7 A;  2KZM A;  3RR7 A;  3KLH A;  4N5S A;  3L2R A;  1TGO A;  4DLE A;  4FM0 A;  1MU2 A;  3NGZ A;  4KKO A;  2HHW A;  4CHQ A;  1LW2 A;  4FK4 A;  5J2M A;  4K8Z A;  3AVK A;  4DTS A;  1EXQ A;  2RPI A;  4M3Y A;  4HUF A;  4CGJ A;  3JYT A;  3G10 A;  5J2Q A;  3ZT3 A;  1HMV A;  1YVU A;  4E1M A;  4YNQ A;  4O0I A;  2XO7 A;  4Z0U A;  5HRS A;  3KTQ A;  2XY6 A;  1NK8 A;  3EY1 A;  3AA4 A;  1XHX A;  4OKJ A;  1BIZ A;  5DMR A;  4KI6 A;  3U6F A;  4M3T A;  3SV4 A;  4CHY A;  1VSK A;  2RN2 A;  2Z1G A;  4QAG A;  4HVJ A;  1LWF A;  5J1E A;  4JS5 A;  3RMD A;  1UWB A;  3QIN A;  3M8S A;  4DQI A;  1I3A A;  3AO3 A;  3OYL A;  3NE6 A;  4J2A A;  4ID5 A;  1QQC A;  2HHQ A;  3OYF A;  4E1N A;  4DMN A;  3VQD A;  4B9T A;  4E7L A;  1NK0 A;  4W5N A;  2DY4 A;  1EET A;  2VWK A;  3LP0 A;  3U3Y A;  4PQU A;  5SZT A;  4DQR A;  1VSL A;  4PY5 A;  1S6Q A;  5CYQ A;  3V6D A;  1D9F A;  1DTQ A;  2IDO A;  3CFR A;  4CE9 A;  2G8K A;  4DTU A;  3O3F A;  3VQB A;  1N6Q A;  3IG1 A;  1S9E A;  4CHN A;  1U04 A;  4CF1 A;  3RMB A;  1FKO A;  3F9K A;  4RW7 A;  2VG7 A;  2B4J A;  4CJT A;  1GOC A;  4C8O A;  1VSE A;  3SQ4 A;  2YNI A;  1Z25 A;  4LSN A;  1KVC A;  1JLA A;  3ISN C;  1ZBF A;  5D3G A;  2A1R A;  4HCC A;  3V9Z A;  1LAV A;  4FJ9 A;  3KKR A;  4BDP A;  1IKW A;  4FJ8 A;  2G8F A;  4CGF A;  4DTO A;  3KJV A;  3VQA A;  3NF7 A;  4CK2 A;  4CEZ A;  1IKX A;  1BQN A;  3TAP A;  1U47 A;  3MXI A;  3PO5 A;  2FBV A;  1RT5 A;  3OJU A;  3TI0 A;  1KCF A;  4DTX A;  4CGH A;  4CJK A;  4M3Z A;  2X78 A;  1QSY A;  4CJ3 A;  2D0C A;  3QEV A;  5FRM A;  4ELV A;  1SL2 A;  3NFA A;  1RDB A;  1NJY A;  4YFU A;  4DTP A;  4B9V A;  3RWU A;  1VRT A;  4AH9 A;  1SKS A;  4TSX A;  5HRO A;  3LZI A;  3KLI A;  3H08 A;  4O55 A;  4CFD A;  3CFO A;  3V81 A;  1T8E A;  5HBM A;  1NK9 A;  3S3O A;  4KHQ A;  1QHT A;  4CGD A;  4I2Q A;  3AVJ A;  3DM2 A;  4HHT A;  5JS1 A;  4QOZ B;  3NCI A;  4M41 A;  3OS2 A;  3PX4 A;  3FFI A;  3O3H A;  3L3U A;  4EP5 A;  3L8B A;  2E6M A;  2Z1J A;  1S1T A;  3LAK A;  4DLG A;  1L3S A;  4ZTJ A;  4CIE A;  3CQ8 A;  3L3V A;  3K59 A;  1RT6 A;  5KGW A;  3K5N A;  3K58 A;  3OYD A;  3TAE A;  1RDD A;  3AVN A;  3TR8 A;  4N56 A;  2XY5 A;  1WAF A;  1C1C A;  1TK8 A;  3HPO A;  1HQU A;  4H4M A;  1J9A A;  3TAM A;  1JLF A;  2HNY A;  4E7K A;  1F21 A;  2P5O A;  1D8Y A;  2PZS A;  4C8N A;  2QXF A;  4Z4F A;  4KRE A;  3PV8 A;  3DLE A;  3HPG A;  3AVL A;  4FJ5 A;  5CYM A;  2JLE A;  1KTQ A;  3VQQ A;  4UQG A;  1RBV A;  3AV9 A;  2YKN A;  3AVF A;  1SV5 A;  1W0H A;  4FJM A;  1CZB A;  2P1J A;  3F73 A;  4DSL A;  2KFN A;  2RKI A;  4E19 A;  2FBX A;  3AVI A;  4KFB A;  1S6P A;  3NGY A;  1JLC A;  3ZT4 A;  2XHB A;  2Z1I A;  5C25 A;  4FLT A;  3LAN A;  4W5T A;  4J2D A;  3I0S A;  4FLY A;  4E7J A;  3KLF A;  4DQP A;  1K6Y A;  4W5Q A;  2P51 A;  2Q3S A;  1YTU A;  3DMJ A;  4KAZ A;  1U49 A;  4EZ6 A;  3O4N A;  4E7H A;  4FJX A;  2VWJ A;  4EP4 A;  4NCB A;  3TAB A;  4CEB A;  2HW3 A;  1ITG A;  4LY7 A;  4DQS A;  3DRR A;  1ZBI A;  3KIO A;  5FRN A;  1L5U A;  2KFZ A;  1HYV A;  3LWM A;  3P83 D;  4CEC A;  4FLV A;  2JGU A;  3SPZ A;  4F4K A;  4J2E A;  4OLA A;  2EHG A;  3AVG A;  5CZ2 A;  3SCX A;  4KPY A;  1NK6 A;  4L8R B;  4Z4G A;  3TAG A;  5HP1 A;  4B9S A;  3AVB A;  3DRP A;  3V1Q A;  2G8V A;  1TKX A;  3RRG A;  4PA1 A;  1BGX T;  3OVN A;  2XY7 A;  3ZT2 A;  4FVM A;  3OJS A;  4H8K A;  2GV9 A;  4IG0 A;  4O44 A;  2E6L A;  1JLB A;  1WAJ A;  4CF2 A;  3OYC A;  3DI6 A;  5CY4 A;  1BI4 A;  1UOC A;  3ZSZ A;  3EYZ A;  3SYZ A;  1WSF A;  1HYZ A;  2OA8 A;  4C8L A;  4F2S A;  4DSE A;  5HRN A;  4ELT A;  4CHZ A;  3HK2 A;  4FCY A;  2HHX A;  1TVR A;  3T19 A;  4CJS A;  3DYA A;  3OYJ A;  1RNH A;  4CK1 A;  4XIU A;  3UIQ A;  2YHB A;  2B5J A;  4DFK A;  3MXJ A;  1CXU A;  4CFA A;  1QSL A;  2ZE2 A;  3SQ1 A;  3ZSQ A;  3LP2 A;  3CYM A;  4ICL A;  3P5J A;  1HRH A;  3O4Q A;  3I8D A;  3NHG A;  3P1G A;  3SUQ A;  2XY8 A;  2BE2 A;  4DFP A;  3KLE A;  2BGG A;  2FBT A;  3RMA A;  3LP1 A;  4Q5V A;  3E01 A;  1QE1 A;  3VA3 A;  1KFS A;  4DWI A;  4E0D A;  2KTQ A;  4FJH A;  1RDC A;  4FJI A;  4F8R A;  3QIO A;  4ZHR A;  2GUI A;  4IG3 A;  3RMC A;  3VQ9 A;  3VQ8 A;  4B08 A;  3DLR A;  4NYF A;  4AHU A;  1O1W A;  1NKE A;  4KB0 A;  1EX4 A;  2OPP A;  1CZ9 A;  3DLB A;  3PX6 A;  4BDY A;  4FYD A;  1JL2 A;  2IAJ A;  4CGI A;  5I3U A;  1U48 A;  4CED A;  4EZ9 A;  1KVB A;  4F3O A;  2QKB A;  3ZSV A;  3LDS A;  4KHS A;  3NGI A;  4ELU A;  3G0Z A;  2Y1I A;  3ZSX A;  4N47 A;  4FZX C;  3L2Q A;  3ASM A;  3S3M A;  1BCO A;  3WNG A;  4CEQ A;  3VQC A;  3OS0 A;  4DTN A;  3KK3 A;  4OVL A;  4RW4 A;  5J2P A;  5KRT A;  3A2F A;  2Y1J A;  4J2B A;  1WSG A;  4AHS A;  3ZSR A;  4OKK A;  4DF4 A;  1RT2 A;  4CJP A;  1JLE A;  2DFF A;  3K57 A;  4FLW A;  1RTH A;  1TKD A;  4FK0 A;  4G1Q A;  1XHZ A;  2XRI A;  1GOA A;  3K5M A;  3HO1 A;  2ZQB A;  5HRR A;  3SQ0 A;  1C0U A;  3AVA A;  4CFC A;  4GW6 A;  3ZSY A;  1RBR A;  3K2P A;  4IDK A;  1A5X A;  1GOB A;  4DG1 A;  1TK0 A;  2O4G A;  1B92 A;  1A5V A;  2DFH A;  1RBU A;  1S1X A;  2LSN A;  1KVA A;  3AO2 A;  2DTU A;  4FLU A;  1LV5 A;  3V9X A;  1RCH A;  1RTJ A;  3V9W A;  4KTW A;  3MAQ A;  4W5R A;  3ZT0 A;  3NF6 A;  4AHT A;  4LH4 A;  1JXB A;  3V9U A;  1X9M A;  1HNV A;  4PUO A;  2R7Y A;  3C6T A;  4B9L A;  4KTZ A;  3VN5 A;  4K8X A;  5KTQ A;  3AA5 X;  4I2P A;  1DTT A;  5KRS A;  3BDP A;  1IH7 A;  1LAW A;  1WSJ A;  4B8C A;  4FJJ A;  1ZBH A;  3HM9 A;  3LP3 A;  2GBZ A;  4E3S A;  3D45 A;  1KRP A;  3T3F A;  3S9H A;  1JXE A;  1JL1 A;  3CM6 A;  4KHY A;  2YV0 X;  3SUN A;  2OPR A;  4FJ7 A;  4NCA A;  4M3W A;  5E41 A;  4BWM A;  3SV3 A;  4HUG A;  1RT1 A;  2HHU A;  3LPU A;  3OYE A;  3PX0 A;  3QEI A;  3RRH A;  1YTA A;  1S1W A;  4LD0 A;  2OPQ A;  1UA0 A;  4CEO A;  1HPZ A;  1UAX A;  4M45 A;  1C0M A;  2G8U A;  4FJN A;  1C6V A;  4CIG A;  4CES A;  1XI1 A;  3QER A;  1RTI A;  3AA3 A;  2HNZ A;  4O0J A;  3L2U A;  4DU4 A;  1LWE A;  1C1B A;  4B9U A;  1WLJ A;  4KHN A;  3C6U A;  4CIF A;  1TAQ A;  4DFJ A;  4M42 A;  1S5J A;  1JLG A;  2FBY A;  3DRS A;  4OGC A;  5K14 A;  4HUE A;  2OZM A;  2WOM A;  3I0R A;  4LH5 A;  3JSM A;  4CJL A;  4I7F A;  3MEC A;  4MFB A;  5C24 A;  3THV A;  4OPK A;  1X1P A;  1BL3 A;  1X9W A;  4R5P A;  3OYI A;  2YNH A;  3NDK A;  3HYF A;  4BE1 A;  2E4L A;  4DU3 A;  4CCH A;  2FC0 A;  2X6N A;  3DLH A;  2KZZ A;  3ZT1 A;  2ZD1 A;  1N5Y A;  3MED A;  2DFE A;  4I9L A;  1S9G A;  1TL3 A;  4AIL C;  2YKM A;  3NF8 A;  1UA1 A;  4FZZ A;  1RDA A;  1VSI A;  3LAL A;  3NBP A;  4KO0 A;  3VQ7 A;  4CHO A;  4HTU A;  2ETJ A;  3ZSW A;  4JS4 A;  2D0A A;  1BQM A;  1RBS A;  2X6S A;  3DOK A;  3VA0 A;  4FW1 A;  1SL0 A;  1FXX A;  2HND A;  5FDL A;  5J2N A;  3KKS A;  4NYN A;  4B9N A;  1VSD A;  3WNH A;  1JLQ A;  3V1R A;  2F8T A;  3NF9 A;  4BE0 A;  1R0A A;  4Z4C A;  3OY9 A;  3D0P A;  1FK9 A;  1RTD A;  1IKV A;  3NAE A;  3ZCM A;  3QEW A;  1TV6 A;  4GMJ B;  1W9H A;  4Z4I A;  3KK1 A;  4DS4 A;  2VG6 A;  4CJW A;  3OYG A;  3RTV A;  4DSJ A;  3K5L A;  1BI4 B;  1EKE A;  2I5J A;  3B6O A;  5T7B A;  3KD1 E;  4KTQ A;  4ZTF A;  4AHR A;  3OYB A;  1WN7 A;  5CZ1 A;  3SJJ A;  1J5O A;  4FK2 A;  3PUF A;  2IOC A;  4C8M A;  1BIU A;  2YNF A;  2F8S A;  3OYK A;  5C42 A;  3BGR A;  3U3G A;  4FM1 A;  1VSF A;  1ASV A;  3HST B;  3SUO A;  3AVH A;  1IG9 A;  1REV A;  1VSM A;  1S1U A;  4Z4H A;  1BIS A;  1C0T A;  1B9F A;  1ASW A;  3HP9 A;  4JLH A;  4B3O A;  3QNO A;  1NJX A;  1IO2 A;  4CEA A;  1HYS A;  2BDP A;  4CJE A;  2WON A;  1RT4 A;  4O5B A;  1WSE A;  2HB5 A;  4FJL A;  1ZYQ A;  4QCL A;  3MXM A;  3PY8 A;  4FM2 A;  2ATQ A;  3V1O A;  1RT7 A;  4DS5 A;  4BWJ A;  2HVI A;  2OYQ A;  2IGI A;  2HVH A;  4FLX A;  5SWM A;  4MQ3 A;  2OPS A;  4CK3 A;  3TAN A;  3SI6 A;  1TAU A;  1WNS A;  3C95 A;  4KV8 A;  4RW6 A;  4CEE A;  3C94 A;  2VG5 A;  4RW8 A;  1CLQ A;  3LWL A;  3HP6 A;  1SKW A;  1HJR A;  3KD5 E;  1LWC A;  4BE2 A;  3ALY A;  4DTJ A;  4FZY A;  1ASU A;  1NKB A;  2YNG A;  3SZ2 A;  1NKC A;  1Q9X A;  2ITG A;  1X9S A;  4OKE A;  2W42 A;  1VRU A;  4CJU A;  1XC9 A;  1KFD A;  1J53 A;  1NOY A;  3DLK A;  4CF0 A;  3AA2 A;  3MEG A;  5DK5 A;  5JS2 A;  3L2V A;  3HJF A;  5HRP A;  1Z26 A;  3KLG A;  4DTR A;  4LSL A;  3ZSO A;  1TK5 A;  3VQE A;  1L3T A;  4CHP A;  4Y1D A;  3VQP A;  2BAN A;  3QET A;  4HCB A;  4AHC A;  1TL1 A;  3LZJ A;  2B6A A;  1KLN A;  1WSI A;  3AO1 A;  4CEF A;  3OYN A;  4WE1 A;  4KB1 A;  4N41 A;  1B9D A;  1RIL A;  1SL1 A;  2KW4 A;  4OPJ A;  1Y97 A;  4B8A B;  3QO9 A;  1VSH A;  2YHA A;  1G15 A;  1XWL A;  3OYM A;  2G8H A;  4NCG A;  1IKY A;  4C8K A;  4FJK A;  2G8I A;  1NK5 A;  1QS4 A;  2NUB A;  4B9M A;  3KK2 A;  3CFP A;  2IC3 A;  2O4I A;  4FLZ A;  4KI4 A;  4CJQ A;  1FKP A;  4H4O A;  1NJZ A;  4DSK A;  4CF9 A;  2KQ2 A;  2D5R A;  4DU1 A;  4DFM A;  2F96 A;  3QEP A;  1TKZ A;  1EP4 A;  4IFV A;  1QSS A;  3HPH A;  2HHV A;  4E89 A;  3HT3 A;  3OYA A;  1U4B A;  4CFB A;  1Q9Y A;  3WNE A;  1KLM A;  4W5O A;  1D5A A;  1NK4 A;  3VQ5 A;  4PWD A;  3M8Q A;  3DOL A;  2AJQ A;  3QIP A;  3HVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...