2P51A

Crystal structure of the s. pombe pop2p deadenylation subunit
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
255
Chain Sequence
SQISPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPCC18.06c protein
publication title The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase, gene regulation
total genus 89
structure length 255
sequence length 255
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2p51A00
4NCGA 4MQ3A 5HRRA 1JL2A 2FBVA 2YHBA 2OPSA 1C0TA 4JS5A 4AHUA 4DQSA 5CYMA 4E3SA 3V6DA 1NOYA 4N5SA 3L8BA 1EKEA 4KAZA 3L2VA 3C95A 4NCBA 3PO4A 4O0JA 4RW6A 2G8FA 3SQ0A 4FJLA 3KTQA 4FM0A 1DTQA 3K5NA 4CJVA 4I9QA 4FXDA 1X1PA 1UWBA 4DF8A 3HJFA 4B3OA 5HRPA 3S3MA 1YTUA 3OYMA 4M3TA 4KB1A 4E0DA 1A5VA 3LP3A 1RT5A 3OYBA 2EX3A 3AVFA 4CCHA 4DU3A 1JKHA 4BWMA 3RR7A 4RW7A 1CXQA 3AA2A 3OYNA 1GOCA 3U6FA 1NK4A 1TAQA 3HO1A 5JS1A 4CE9A 2HHTA 4DQPA 3D45A 5EU7A 1EETA 1NK7A 3T1AA 4FLWA 2QKBA 1T7PA 2BGGA 4N47A 1RBSA 4DLEA 1D5AA 4DTPA 4DF4A 1SKSA 4FJ8A 3V1RA 3VQ5A 1HNVA 2OZMA 2Z1GA 3MEGA 2X6NA 5KRSA 2ZE2A 4CEAA 3TWHA 3ZSRA 2JGUA 4KRFA 2BANA 4FLYA 4Z4FA 4GW6A 4FCYA 4OGCA 4CIGA 4BWJA 4NYFA 1RT2A 3LZJA 1SL0A 3IG1A 3TAQA 4IDKA 1UOCA 3OYAA 4E7JA 3NHGA 2Y1JA 3SUQA 1JL1A 1Q8IA 5CY4A 1BIZA 4CJQA 1T05A 1RBVA 4IKFA 1J53A 3NGZA 4KHYA 3RMBA 1L3UA 4AH9A 3DRSA 1IKWA 4F3OA 1L3SA 4IBNA 3KJVA 1GOBA 3TAEA 3VQ4A 1U49A 4FJNA 4FYDA 4WE1A 3K5OA 1U45A 1NK0A 3A2FA 3ZT4A 4CESA 4FM2A 1KRPA 1VSDA 3O4QA 1LWFA 2GBZA 2ITGA 2F96A 5KRTA 5D3GA 5J2NA 4FLXA 4QCLA 1BQMA 3ZCMA 4CEQA 3S9HA 1REVA 1TK0A 5SWMA 1NJZA 4FJXA 1B92A 4CHNA 3IS9A 1FKPA 1W0HA 4IG3A 4OGEA 2XY6A 1CLQA 4XIUA 2YNFA 4W5OA 1LAVA 4ZHRA 1KVBA 4CJSA 3D0PA 4W5NA 4Z4IA 1LWCA 2FBTA 1BI4A 3NH1A 4FW2A 3TI0A 2B4JA 1FKOA 3LPTA 5KI6A 3VQ9A 1S5JA 4JRQA 1LW2A 3ZSZA 1Y97A 3RMCA 3HVRA 2D5RA 1X9SA 1NK5A 2IGIA 4Z0UA 3LWLA 4J2EA 1G15A 1GOAA 1RT4A 3SNNA 1D9DA 2KW4A 1NJXA 4N41A 2OZSA 3IRXA 4BDYA 1VRTA 1X9MA 3LANA 3TAMA 3OYIA 4W5RA 3M8RA 1Z25A 4H8KA 1RTDA 2VWJA 3HPGA 2G8KA 1QTMA 3IAYA 3AVHA 2O4GA 4RW4A 1RTIA 4CEBA 3LPUA 4AHTA 3RMDA 2BE2A 1KTQA 3K5LA 4QOZB 2VG6A 4LSNA 1L3TA 3OVNA 4GVMA 4CGFA 4O55A 3V1OA 4CHOA 4CK1A 3ZT2A 1VRUA 4CFAA 3SYZA 4LH4A 3MXIA 2XRIA 4DTRA 3AVAA 2NUBA 4CGDA 1N5YA 1WNSA 1BHLA 2YNGA 4O4GA 3TR8A 3DOKA 4DG1A 2KFNA 1TKXA 3C6TA 3AVBA 3UIQA 4KTWA 1IG9A 3MECA 3NF6A 2HHSA 3TABA 4ID1A 4FJ7A 1RT3A 1JLAA 4KV8A 4CGGA 1U04A 4HUFA 1KLNA 4C8OA 3DRPA 1CZBA 3HVTA 4FVMA 4O44A 4DTSA 4DFPA 1Z26A 3M8QA 4Y1CA 1UA1A 1QSYA 2E4LA 4GMJB 4H4MA 3AO3A 4N76A 2HHXA 4K8XA 5K14A 1HQEA 4KI6A 2RF2A 2XHBA 3PX6A 3KKRA 4M3ZA 4CEZA 4FZXC 4PUOA 1ZBHA 2F8TA 2LSNA 4YFUA 3K58A 3SV3A 2HHUA 4B9SA 5HLFA 1QE1A 1BISA 4E7IA 3O4NA 1C0UA 4DSLA 4DWIA 3AVJA 3WNEA 2IS3A 1JLBA 3DLGA 1VSFA 3ZSXA 4FJIA 2OPRA 5JS2A 1TKDA 3L2RA 4DSEA 3CM6A 3ZSVA 4B08A 3DI6A 1QQCA 3LP2A 2AJQA 3V9UA 1S1VA 3KK3A 4BDZA 2KZZA 2OYQA 3NGYA 2WOMA 1KVCA 4IG0A 4BACA 3B6OA 3ZSYA 2G8IA 4J2DA 3VQBA 1HYZA 1BIUA 4C8KA 3QEWA 5HROA 4ELVA 3VQPA 1XHXA 4KHUA 4CECA 3AO1A 3QETA 4B9MA 4TSXA 2HMIA 5C25A 5CZ2A 3RMAA 3SJJA 1D8YA 4B9TA 1I39A 2YV0X 4KHNA 3DLEA 3AA4A 1SL1A 3HT3A 4I7FA 1WSHA 3QO9A 4CHZA 2G8WA 1HMVA 2RKIA 4CEFA 2KFZA 3AVGA 1NOZA 2RN2A 4CHQA 3K5MA 1BI4B 3DM2A 3CFRA 4ELUA 4EZ6A 4EP4A 2EHGA 4RW9A 3ZT1A 3ULDA 4DTJA 2P5OA 1VSJA 1K6YA 3LP0A 3DYAA 4ID5A 3OYJA 4CJ4A 3P1GA 3DLKA 2DFHA 1S9EA 4Q0BA 5SZTA 2X6SA 4QAGA 3NFAA 4CGHA 1WAFA 4CJUA 3LP1A 3MAQA 1S1TA 3K57A 4FLZA 4Z4GA 3VQ7A 3QESA 3AVMA 3WNFA 4BE2A 3SQ4A 3L2QA 4AHVA 1D9FA 3RTVA 3RR8A 3AA5X 1QSLA 1HNIA 2GV9A 4KFBA 4CFDA 2HNYA 3LWMA 3QEIA 5FROA 1C1BA 1VSIA 4G1QA 3TARA 5FRNA 4FZZA 1VSLA 3DMJA 3OS0A 3QEXA 1CZ9A 1T8EA 1Q9XA 2D0CA 3AVKA 5DK5A 3VN5A 2IAJA 4EP5A 3P5JA 3E01A 2VG5A 2QKKA 4L8RB 3LALA 1KLMA 3QINA 3DLRA 3AVLA 4M3YA 4LY7A 4LD0A 1HJRA 3OYCA 3OYKA 1KFSA 3WNHA 4CEDA 1NK6A 5C24A 3OS2A 4JS4A 4DS5A 1ZBIA 3L2UA 2O4IA 3PUFA 4DU4A 1YVUA 2XY8A 1J9AA 3AO4A 2Z1HA 2D0AA 1RBRA 3HM9A 1TGOA 1HPZA 2X74A 1QHTA 3ISNC 3AV9A 1RBUA 1RTJA 4CIEA 4HTUA 4C8LA 3PY8A 4ZTFA 1RDCA 1ZBFA 4BE0A 3OY9A 3AO5A 3CYMA 4PQUA 4CJKA 2JLEA 1TKZA 2YNHA 3P83D 3KLIA 4MFBA 3LZIA 4OKEA 1XI1A 3JYTA 1J5OA 4K8ZA 4KI4A 2HB5A 4FLUA 1BL3A 3V9SA 4DSKA 2XO7A 4BE1A 1B9FA 4O5BA 3MXMA 2DFEA 3L2WA 3OS1A 3BGRA 5J2QA 4OKKA 3L3VA 1LV5A 3SV4A 1O1WA 4M3UA 2YKNA 4F3TA 1ZBUA 5HBMA 1ASVA 3QNOA 4CF8A 1VSEA 1WSGA 4E1MA 3VA3A 4ICLA 2YNIA 3PV8A 4PY5A 4CJ5A 3QEVA 1C0MA 3ZSOA 4DFJA 3O3FA 3OJUA 1CXUA 4FK2A 3MXJA 3OYHA 3NGIA 2OA8A 2HW3A 3C94A 4B8CA 3NH2A 2E6LA 3LAKA 4DQIA 4F8RA 3L3UA 4DU1A 3HP6A 4CJPA 4M42A 1HQUA 3I0SA 1C1CA 3DLBA 4CIFA 5HRSA 4KTQA 2FBYA 3OYDA 4ELTA 4DTMA 2G8VA 1SUQA 3CG7A 1FXXA 4CJRA 1C1AA 1R0AA 4KTZA 1I3AA 2GUIA 3K59A 2B5JA 5J2PA 4CF9A 1U4BA 1TK8A 1WSEA 3NAEA 4I2QA 1KSPA 4W5QA 2R7YA 4M3RA 3OJSA 1JLGA 1NJWA 5CZ1A 5T7BA 1F21A 4DTOA 3SUNA 2HNZA 5KGXA 1WAJA 4M3XA 1RCHA 4DLGA 4FLVA 5E41A 1W9HA 1RT7A 4IFYA 4CJWA 4HVJA 4JRPA 3SUOA 2PZSA 3SPYA 4B9VA 1TV6A 3RWUA 4I9LA 1KFDA 5FDLA 3EZ5A 2HHWA 4UQGA 5CYQA 1LAWA 3AO2A 3AVNA 5DMRA 3QLHA 4Z4HA 3HK2A 4CJTA 2W42A 4E7LA 4HCCA 1BCOA 4OLBA 4CF0A 4Z4EA 4CERA 1XWLA 3F73A 4B9NA 1FK9A 1IO2A 1U47A 2IOCA 3RRGA 3KLEA 2WONA 3VQAA 3AVCA 2A1RA 4Z4CA 4YNQA 3I8DA 3G0ZA 3H08A 3VQDA 4HHTA 3DRRA 5I42A 3HSTB 3ZSWA 4B8AB 4ZTJA 3O3HA 3B6PA 4CK2A 3T19A 4CFCA 2G8UA 3SUPA 2HVIA 2OPQA 3VQ8A 3JSMA 3SPZA 4C8MA 3M8SA 3O3GA 1S1UA 2ETJA 3HP9A 3VQ6A 3NBPA 1N6QA 3VQCA 4DSIA 4W5TA 3KKSA 2FBXA 3RRHA 2B6AA 1JXEA 3KD5E 1S1XA 2KQ2A 1ASWA 1LW0A 2HHVA 3U3YA 3S3NA 4OLAA 2QXFA 1NKBA 1ZBLA 1TVRA 4FZYA 1BGXT 2HNDA 1RBTA 3CFOA 3NF7A 3V9XA 3QNNA 4OJRA 2XY7A 1XHZA 1BCMA 1SL2A 3SZ2A 1KVAA 1YTAA 3VQEA 4FJGA 1VSKA 2YKMA 2BDPA 1SKWA 4EZ9A 4E7KA 3CM5A 3HPHA 4IFVA 2OPPA 1UA0A 4B9UA 3V1QA 1WSJA 2F8SA 3SCXA 2DTUA 3NCIA 1B9DA 2G8HA 2IC3A 4FW1A 4PWDA 3ITHA 1S6QA 3ZT3A 3CQ8A 3V81A 4CJLA 3PX0A 1DTTA 4Q5VA 4CGIA 2PY5A 2RPIA 4CJ3A 3MEDA 1TL3A 1JLFA 2P1JA 4LH5A 4DQQA 1KCFA 1EXQA 4CJFA 2PYLA 4E1NA 1XC9A 2PYJA 3HXMA 4RW8A 2HVHA 1WSFA 1IKVA 4KO0A 3WNGA 4CFBA 3DOLA 1VK0A 1HYVA 5C42A 2A1SA 3OYFA 1YT3A 1WLJA 3SQ2A 2VG7A 4DS4A 4AHSA 3KK2A 4F4KA 4DFKA 1NJYA 3NDKA 4E19A 3T3FA 3QEPA 1TK5A 3SQ1A 1MU2A 2Z1JA 4DQRA 2P51A 4DSJA 4NYNA 1A5XA 1NK9A 4FJ5A 1JXBA 2X78A 1VSMA 3OYGA 4DTXA 3C6UA 2E6MA 2I5JA 1RNHA 4OPKA 3AVIA 4HUGA 3KD1E 4KREA 3S3OA 5I3UA 1ITGA 4Y1DA 3KLGA 1TL1A 1TKTA 3KLHA 2VWKA 4R5PA 3V4IA 4FK4A 2Z1IA 2HHQA 2DY4A 5J2MA 4JLHA 4DFMA 2FC0A 1NKEA 3FFIA 3V9ZA 4DSFA 3KK1A 1EP4A 3VQQA 4CJEA 4CHYA 2D0BA 2ATQA 1S6PA 3NF8A 4M41A 4CF1A 1SKRA 1RDBA 4CK3A 3HL8A 3KLFA 1RILA 3TAFA 4DTNA 4FJHA 3MEEA 4OPJA 3DLHA 3QERA 4PA1A 3ASMA 4HCBA 1U48A 3F9KA 3G10A 1A5WA 3CFPA 2Q3SA 1WN7A 4F2RA 3I0RA 4CHPA 3TAGA 3OYEA 1HRHA 4AHRA 3NH0A 3VA0A 4O0IA 2ZQBA 1ZYQA 2Y1IA 5HP1A 3AA3A 1UAXA 4FM1A 3QIOA 5KGWA 2KZMA 3KIOA 5FRMA 1LWEA 4E7HA 4KB0A 3PO5A 3NF9A 1RTHA 2ZD1A 2QK9A 1WSIA 3K2PA 4FK0A 4AHCA 3SI6A 3HPOA 1J54A 3LAMA 3U3GA 1NK8A 1SV5A 1VSHA 1QS4A 4M3WA 1S1WA 3HYFA 4M45A 4CEOA 3NE6A 1X9WA 4J2BA 4E89A 4FLTA 3V9WA 1IH7A 3TAPA 3TANA 4CF2A 1DLOA 1TAUA 4KPYA 2KTQA 1QSSA 4HUEA 3BDPA 4RG8A 4LSLA 4DTUA 4I2PA 3M8PA 3EYZA 1C6VA 1T03A 2P5GA 4KHSA 1RT6A 5J1EA 4KHWA 5KTQA 5HRNA 1JLQA 3ZSQA 3OYLA 1RDDA 3LDSA 1HYSA 1RDAA 1IKXA 1EX4A 2IDOA 4CEEA 1BQNA 3ALYA 4B9LA 4FJKA 1S9GA 3ZT0A 4F2SA 1RT1A 4KHQA 1L3VA 2XY5A 1ASUA 1JLCA 3EY1A 1L5UA 3PX4A 4BDPA 4NCAA 2DFFA 4OKJA 2YHAA 3QIPA 4J2AA 4FJ9A 4C8NA 4DMNA 3THVA 4KKOA 1JLEA 4N56A 1IKYA 1Q9YA 4FJJA 4FJMA 4CGJA 4OVLA 4AILC 4H4OA 1NKCA
chains in the Genus database with same CATH superfamily
4MLHA 1RGIA 4LF6K 3FZMA 1C0TA 5CYMA 3WEEB 1NOYA 4QS9A 1EKEA 3PO4A 4BRFA 3K5NA 4I9QA 1WUAA 1UWBA 2QWNA 4JK8A 4DF8A 5C12A 3THYA 4B3OA 3S3MA 1YTUA 3KZBA 3OYMA 1XUPO 3LP3A 2ZGYA 3OYBA 4GV6A 3IDHA 1SS6A 1BDGA 1NK4A 1Z05A 4BRGA 2ZJRL 5JS1A 4CE9A 3D45A 1T7PA 2BGGA 1FJGK 2V7YA 4FJ8A 1M90O 2OZMA 5KRSA 2X6NA 2FF3B 2ZE2A 3BZCA 3M3ZA 5KQ8A 3O9SA 3TWHA 3ZSRA 4GV9A 3O4WA 1RT2A 1XQSC 1SL0A 4CZGA 1UOCA 3SUQA 4FO0A 1ZYQA 3EEQA 4A59A 1NMDA 2HBMA 4KHYA 4CZFA 1L3UA 3DRSA 3TAEA 1GOBA 2P9LA 1U6ZA 1VSDA 1LWFA 2GBZA 5M1KA 2ITGA 5D3GA 3A5OC 4CEQA 1REVA 4FJXA 3H1VX 2KLAA 4OGEA 2XY6A 4JI7K 5C15A 2CGLA 5F0XA 3CC4N 1LAVA 4CJSA 1YXQA 3NH1A 1EWRA 3TI0A 3VQ9A 1S5JA 4JRQA 1NK5A 3MWTA 2IGIA 1OH8A 1G15A 1GOAA 5AJ3K 4OPAA 2E2OA 3VEOA 1V4SA 3Q7CA 5AFUA 2VQFK 1X9MA 3TAMA 3M8RA 1Z25A 2GELA 2CH6A 3HPGA 3IAYA 2KZMA 1RTIA 4CEBA 3LPUA 3OW2M 3R1XA 3PLAA 3MCAB 4O55A 4CFAA 3E9PA 4LH4A 1IG8A 4DUYK 3MXIA 4BQLA 5HL7L 4DTRA 4H5RA 1WNSA 1BHLA 1YJWN 3DOKA 5GINA 4B3RK 3C6TA 3UIQA 4H0TB 2Q1NA 4JAXA 4ID1A 1GLDG 4C8OA 1CZBA 2D0PA 3SJHA 5CR4A 2O8CA 2VYPA 4Y1CA 3MMVA 2P9PA 3NMUA 3BUZB 3CCJN 1HQEA 4WCEL 4M3ZA 4JI4K 3VGLA 2P9NA 4BGBA 2LSNA 3K58A 5AQJA 2HF4A 1QZ6A 1C0UA 4LF5K 3WNEA 3AGRA 3VOVA 4FJIA 2OPRA 4B1ZA 5FPDA 4DSEA 3C0BA 4B08A 5GAEP 1ATRA 3V9UA 2KZZA 1R59O 3C6HA 4J2DA 3VQBA 3D2EA 5EOYA 3CJBA 2YCHA 4GKKK 1XHXA 4KHUA 4CECA 2BH1A 3QETA 3PIPL 4TSXA 3ZETB 5BPLA 4KHNA 5GAHP 4BC2A 3EE8A 3DLEA 3AA4A 3HT3A 5AQOA 2RKIA 5CE3A 1BI4B 5MLCQ 4ELUA 3H1QA 4EP4A 2EHGA 4RW9A 3ZT1A 1VSJA 1NGIA 2HMPA 3BY5A 1D4XA 2ZJQL 2DFHA 5SZTA 4DR1K 4QAGA 3NFAA 1NM1A 3WXKA 3MAQA 4B1XB 4BE2A 1D9FA 4RTFD 4KFBA 2ASPA 1TUUA 1C1BA 1VSIA 4G1QA 3TARA 3DMJA 5DK5A 1DKGD 2YHYA 3P5JA 1QZ5A 3M1FA 3DLRA 3AVLA 4LY7A 4LD0A 1HJRA 2FSJA 4JKGB 1TYQA 4DU4A 1YVUA 2XY8A 2D0AA 3CCEN 4V19S 2I7NA 1Q7YO 3ENHA 3TSQA 5JICA 4ZTFA 1RDCA 4MO4A 3H46O 2JLEA 1M1KO 4DR6K 1XI1A 1JCGA 2HB5A 1BL3A 4BE1A 3VGKA 3CXCM 1VQKN 3L2WA 2D4WA 5AQWA 3BGRA 3D6RA 5J2QA 4OKKA 4BR2A 4DR4K 2YKNA 4OX9K 1ZBUA 3CCQN 2JWKA 1VSEA 1WSGA 2BUPA 2KHOA 4E1MA 1VHXA 2YNIA 3PV8A 3T1HK 3BF1A 3TSPA 4CJ5A 3QEVA 4DFJA 3O3FA 3ZLJA 4ISEA 3NH2A 4M42A 4CIFA 3OHRA 4YHHK 2WFBA 2FBYA 4ELTA 4DTMA 2G8VA 1YITN 3CG7A 3THWB 1R0AA 4KTZA 1I3AA 1TK8A 1L5UA 2B5JA 1HR0K 1WSEA 3NAEA 2W6LA 3HSCA 2HNZA 4O5FA 3SAGA 3J7AP 1SKWA 2FSNA 4FLVA 1D8YA 4CJWA 1RT7A 4IFYA 4BROA 4I9LA 5CYQA 3AO2A 2NZTA 3DXMA 1XNQK 4HCCA 2W42A 4E7LA 5F2RA 1X3MA 1XWLA 4B9NA 1FK9A 4A5BA 3KLEA 3AVCA 4A5AA 3E66A 3H08A 3UKRB 3DRRA 1ZC6A 4B8AB 3B6PA 3OBYA 3T19A 2G8UA 1YJ9N 2A42A 4BRPA 3HP9A 4BRDA 3W0LA 2Q0RA 3VQCA 2UUCK 4DCHA 1JXEA 1LW0A 3CETA 1I94K 1NKBA 4JKEA 4FZYA 1GLEG 2HNDA 1RBTA 1WBBA 3NF7A 3Q7BA 3DLLL 4FJGA 4E7KA 2OPPA 1B9DA 1GLJO 4BGAA 4BQZA 2Q36A 3CHWA 1LOTB 4CJLA 5AQLA 4Q5VA 4CGIA 2PY5A 4DQQA 4OPHA 1KCFA 1MWKA 1EXQA 4CJFA 3MN5A 4E1NA 1XC9A 2PYJA 2HVHA 1WSFA 3WNGA 4CFBA 3HI0A 2IVNA 3SQ2A 2VG7A 3D7EO 4F4KA 3PSIA 3QEPA 2Z1JA 4DQRA 2P51A 4DSJA 2PAVA 3KD1E 5I3UA 3KLHA 1E4GT 2VWKA 2HHQA 3M6GA 2Z1IA 2DY4A 4DFMA 3CCMN 4I6MA 2A6AA 2QWMA 2D0BA 4BC4A 4CF1A 4CK3A 3HL8A 3TAFA 3DLHA 3L4QA 3QERA 2GUPA 5BR8K 4IEIA 1N33K 3VF6A 3NH0A 3ZX0A 1DT9A 4A62A 2ASOA 1UAXA 4FM1A 5EX5A 2E20A 1RTHA 2QK9A 4XH5A 1WSIA 3K2PA 3SI6A 4A61A 4PKIA 3LAMA 5E26A 3G71N 4M3WA 4LF9K 4CEOA 1QVFM 5AQRA 4E89A 1K9MO 3TAPA 1JCEA 4CF2A 3CMAN 4KPYA 2QI2A 3BDPA 4LSLA 3EYZA 1C6VA 4KH5A 1RT6A 5HRNA 3OYLA 1HYSA 5TKWA 1Q86O 1KC8O 4CEEA 1BQNA 3IUCA 1BOTO 1L3VA 1SAZA 4K25A 5AZJA 4BDPA 5GIOA 2DFFA 4FJ9A 3THVA 4FJMA 4PHTX 4CGJA 3FLCO 4EFHA 1O13A 4DV0K 1NKCA 1HKBA 4MQ3A 2OPSA 3K9JA 4AHUA 4E3SA 2QXLA 1NGAA 4N5SA 3L8BA 3C95A 2A40A 1E3MA 3SQ0A 1DGKN 3KTQA 4FM0A 1DTQA 2WTUA 1NGJA 4AM6A 3HJFA 5M1PA 4JKCA 4M3TA 3UKUB 4KB1A 4E0DA 2EX3A 2UXBK 4RW7A 1K8KA 3HO1A 3O1WA 4BRHA 3DXKA 2HHTA 1K8AO 2W6KA 4DQPA 4GVEA 3T1AA 2QKBA 1D5AA 3RSEA 3O80A 4KRFA 1S22A 4FLYA 4GW6A 4FCYA 2O8BA 4YORA 3IG1A 1N36K 4KHPK 4E7JA 4BRKA 1JL1A 4YOYA 1T05A 1RBVA 4IKFA 5LJWA 1IKWA 1L3SA 4IBNA 3KJVA 4FJNA 1QQNA 2HBKA 4JHDA 3VEYA 3K5OA 1U45A 1T3VA 3L6QA 1NK0A 3A2FA 3ZT4A 3O4QA 3CF5L 4FLXA 3KWGA 1BQMA 1TK0A 3CPWM 5C2DA 4IWVA 3IS9A 5KQDA 4IG3A 4JI6K 3LL3A 4C1NI 4W5OA 5EVZA 4ZHRA 1KVBA 3D0PA 4W5NA 2FBTA 2P9SB 1J5EK 1BUPA 3SMSA 3LPTA 3RMCA 1HX1A 4CZIA 1KAYA 2D5RA 1GLLO 1RT4A 3SNNA 3H45C 4BDYA 4NB4A 3LANA 4BRIA 4H8KA 3EL2A 4RW4A 3RMDA 3K5LA 4LSNA 3ZEUB 3V1OA 3ZT2A 5BPNA 3SYZA 2XRIA 4DR3K 4CGDA 2JWLA 1U2VB 2YNGA 4DG1A 4CBWA 4KTWA 1IG9A 3MECA 2HHSA 3AAQA 3C65A 1RT3A 1JLAA 1S3XA 4CGGA 5ELZA 3DRPA 3HVTA 3MX5A 4FVMA 5AQYA 1KAZA 1YIJN 4DTSA 4DV6K 1Z26A 4CVNE 1Q81O 4GMJB 3ULEA 2IVPA 3S41A 2I7PA 2RF2A 2XHBA 3PX6A 4WQ4C 3MN6A 2F8TA 4HWIA 4YFUA 3SV3A 4WQ5C 2GWJA 4HTLA 3O4NA 2UXCK 2IS3A 4C23A 2F9WA 4KBOA 5M1FA 3FGUA 1TKDA 3ZYYX 4RCHA 1NGCA 3DI6A 2D1KA 1QQCA 3C7NA 1S1VA 4BDZA 2OYQA 1KVCA 2P9LB 3H6EA 3ZSYA 2G8IA 4C8KA 2YJEA 2D0OA 4ELVA 5DM6L 4B9MA 2E1YA 3LDPA 2HMIA 5C25A 4IOAL 4FWKA 3G4SN 4CEFA 2KFZA 3DM2A 3TTCA 5IT9O 3VENA 3ULDA 4DTJA 2P5OA 2UUBK 3OYJA 1XC3A 3O8MA 4CJ4A 3P1GA 3O9TA 4H5TA 4IO8A 1BA0A 4CGHA 1X9JA 5TKYA 2J4RA 1EQYA 3WNFA 3FZKA 3L2QA 3RR8A 3VF4A 1HNIA 4X64K 3QEIA 3J7ZO 5FROA 3CCLN 5FRNA 3CPEA 3OS0A 1T8EA 2D0CA 3VN5A 2IAJA 1NG9A 2P9UA 3E01A 1NGHA 2VG5A 3LALA 1NK6A 2O8FA 3OS2A 2O4IA 3PUFA 3BF3A 2P9KA 2E5LK 1T44A 1J9AA 3AO4A 2Z1HA 2O8CB 1HKGA 3MN9A 2GTDA 2NLXA 5BPMA 4BE0A 3AO5A 2NNWA 4B1VA 4MFBA 3LZIA 4DSKA 4ILJA 3MXMA 3VGMA 2DFEA 1IBMK 1RFQA 3L3VA 3SV4A 4M3UA 4JI8K 4F3TA 5HBMA 1XMOK 4JKHA 1N34K 4FK2A 1CXUA 3KVGA 2OA8A 3OYHA 4FWOA 1T6DA 3C94A 1QQOA 2O8DA 1NMNA 4DU1A 3HP6A 4CJPA 3QFUA 1HQUA 5GAGP 1VQ5N 3QFPA 3VEXA 3WXJA 4YOVA 3OYDA 4NO7A 4WFAL 1FXXA 4CJRA 5J2PA 1U4BA 4CF9A 2CGJA 4FWMA 1JLGA 1NJWA 5T7BA 1IV0A 4DTOA 3HM8A 4K41A 2PZSA 1W9HA 4L3QA 1TV6A 4DR2K 1LAWA 2VWBA 3HRGA 4CJTA 1S72N 1SQKA 1BCOA 3D2FB 3DWLA 4AQYK 1U47A 5AR0A 3K9KA 2HBLA 1VAZA 5LL6Z 3O9UA 4YNQA 4ZTJA 4CK2A 4H5VA 1VQPN 5JLHA 3A5LC 4DHYA 3SPZA 3M8SA 5BR9A 3NBPA 1N6QA 4JKFA 1HNWK 3CC7N 4FPBA 4W5TA 3KKSA 3RRHA 3U3YA 3S3NA 4OLAA 2QXFA 5C0YA 1BGXT 4O8UA 2XY7A 3QNNA 3IKMA 5AQPA 1YTAA 4X62K 2QWRA 3VPZA 5BREA 3CM5A 5AQHA 2F8SA 1UA0A 1HUXA 3V1QA 2DTUA 3NCIA 1BO5O 4FW1A 4PWDA 3ZT3A 4JI5K 5E84A 1DTTA 2RPIA 3MEDA 1TL3A 3ID8A 3F2KA 2AA4A 3TTDA 2PYLA 3JXUA 1KQSM 5C42A 2V7ZA 5M1QA 3KK2A 1X3NA 1NGBA 3JS6A 4NYNA 1A5XA 1NK9A 4FJ5A 1VSMA 3OYGA 2A3ZA 3C6UA 1IJJA 2E6MA 2I5JA 5ADXH 5JVGL 4LFBK 1ITGA 3O1BA 3KLGA 3V4IA 1TKTA 3PIOL 4R5PA 3ZETA 4WFBL 2FC0A 1NKEA 3FFIA 5JVHL 5M1NA 5AQMA 5JMVA 2NRXA 3DXMB 4U7BA 2NRHA 3MDQA 3G10A 1U48A 3NVKA 4F2RA 3I0RA 2NRVA 3TAGA 3CC2N 5FPMA 2F7TA 4O0IA 2ZQBA 3QIOA 5KGWA 2E88A 3KIOA 4KB0A 5EY4A 3ATVA 3FZLA 2GX9A 3HPOA 3J81O 1VSHA 3CJ9A 1S1WA 3HYFA 4BRAA 4BREA 1X9WA 5FLXO 5GADP 1IH7A 4CZLA 4LFCK 4HUEA 3IFRA 2Q0UA 4GKJK 3EN9A 2F4VK 4KHSA 5AQTA 1MA9B 1VQNN 5KTQA 1JLQA 4JD2B 1RDAA 1EX4A 4YDUA 4XH4A 3SMPA 4F2SA 1RT1A 4KHQA 4ISGA 2XY5A 1ASUA 1JLCA 4H5NA 1C0FA 1MWMA 4G9ZA 4OKJA 2HHHK 3BZKA 3QIPA 4H0XB 4B1WB 2Q2RA 2P9IA 1IKYA 4U67L 1TK5A 4PL8A 4MDBA 1JL2A 3V6DA 4KAZA 4H0VB 3PSFA 5AQNA 3L2VA 3GDQA 4RW6A 2G8FA 1OKJA 4GY2B 3EO3A 4M7XA 3CI5A 2CGKA 1NJIO 5HRPA 4ISFA 1A5VA 3AVFA 4CCHA 1P90A 3RR7A 1CXQA 3AA2A 3OYNA 1GOCA 3U6FA 4JYAK 2YX6A 4JI1K 5EU7A 1NK7A 4IO9L 1YAGA 1RBSA 2OCEA 1SKSA 3V1RA 3VQ5A 1HNVA 3MEGA 4B1YB 3A8YA 5LY3A 4CEAA 3RVCA 2BANA 3IMXA 4OGCA 4BWJA 1NGEA 3MK6A 4NYFA 3VEZA 4PL7A 1IBLK 4JK9A 4IDKA 3ATUA 3FR0A 3GL1A 1LCUA 2Y1JA 1Q8IA 3U9ZA 2NRTA 3RMBA 4AH9A 4Y0WA 1U49A 3VQ4A 4FYDA 1NGDA 4WE1A 2E8AA 3VEWA 4FM2A 4DV2K 3VERA 5KRTA 5J2NA 3EZWA 3S9HA 4QCLA 2QWOA 1NJZA 3VTIA 4CHNA 4PKGA 1W0HA 1JJ2M 4XIUA 4Z4IA 1LWCA 4FW2A 4BR0A 1FKOA 4A2AA 3WT0A 1LW2A 3HVRA 1V4TA 3B8AX 1X9SA 4Z0UA 3LWLA 4J2EA 3THXA 1D9DA 2KW4A 1NJXA 3IRXA 1VRTA 5AQKA 5DM7L 3OYIA 4W5RA 5AZJB 5ADXA 1RTDA 4IOXA 2G8KA 4CZEA 5GIPA 4AHTA 1KTQA 4H03B 1L3TA 3OVNA 4CGFA 2FXUA 4CHOA 3J80O 4CK1A 1VRUA 1OH6A 5LMNK 1GLBG 3AVAA 3HOTA 4DV7K 3TR8A 3AVBA 4CZHA 3NF6A 3MCPA 2WC9A 1ZBSA 4HUFA 4KV8A 1BG3A 1U04A 4KH4A 4K0KK 1Q18A 3P39A 4DFPA 4QS7A 3L4IA 1QSYA 3AO3A 4EHTA 3ENBA 3J7YP 2HHXA 4BR4A 4EHUA 5K14A 3DXKB 4LFAK 3KKRA 4FZXC 1ZBHA 5KPTA 3RSEB 3MX2A 2HHUA 2UXDK 5HLFA 1QE1A 1BISA 4E7IA 4DSLA 3CMEN 4DWIA 3AVJA 3G6EN 1JLBA 1YI2N 3ZSXA 3WXLA 2QA4N 1YUWA 4JKBA 4IEEA 3CM6A 3ZSVA 4BG8A 2WBNA 2AJQA 3SLCA 3KK3A 3T1YK 3NGYA 4IG0A 4JHDB 3B6OA 1HYZA 1BIUA 4BRMA 3VQPA 3GG4A 3AO1A 5CZ2A 3RMAA 3SJJA 1I39A 2YV0X 1SL1A 1WSHA 4CHZA 4BY9C 2G8WA 3CD6N 3K5MA 5BRHA 4GV3A 2FF6A 3E9OA 4DKWA 3DYAA 4WQ4A 1S9EA 4Q0BA 4YOTA 1WAFA 4CJUA 3LP1A 5AZIB 3K57A 4FLZA 4Z4GA 4M63C 3QESA 2PBDA 3AVMA 3G25A 2QEXN 4E1JA 3RTVA 1QSLA 4ILHA 3R9PA 2HNYA 4FZZA 3QEXA 3R3LA 1Q9XA 3AVKA 4EP5A 2RE2A 3KK7A 4L8RB 4C1NK 1KLMA 3UB5A 4M3YA 3OYKA 4UY8O 3WNHA 5C24A 3SBTA 1ZBIA 4JS4A 3L2UA 1RBRA 3HM9A 4BRCA 1HPZA 1NLVA 3ISNC 3ULEB 4CIEA 1RBUA 4C8LA 2QW9A 3ID6A 3PY8A 1WB9A 4CJKA 1TKZA 2YNHA 1EWQA 4OKEA 1J5OA 3UKUA 4K8ZA 3U4LA 4FLUA 1QHAA 2XO7A 4H0OA 4JKAA 1MDUB 4KH6A 4DUZK 1O1WA 3FE1A 3QNOA 1ASVA 3VA3A 4ICLA 2O8EA 1NGGA 2HF3A 4JI0K 4PY5A 1C0MA 2OTLN 3MXJA 3NGIA 3N4QA 3E9LA 2E6LA 4BC5A 3THYB 1VQ6N 1YVNA 4DQIA 4K42A 3I0SA 3DLBA 1NWKA 5A2QO 3A5NC 1SUQA 1C1AA 2GUIA 3QBWA 5HOOA 3SBGA 1GLAG 4W5QA 5CHIA 2R7YA 4CJ7A 5AQSA 1F21A 5KGXA 1WAJA 4IOCL 1RCHA 4DLGA 3I8BA 5E41A 2QWLA 4BRNA 4B9VA 3I33A 3SUOA 3RWUA 5FDLA 3EZ5A 5AQFA 4UQGA 1XMQK 3AVNA 2OANA 3HK2A 4BG9A 4DV5K 4CF0A 3BP8A 1YHQN 4WF9L 1H1VA 2IOCA 3VQAA 2A1RA 1JCFA 3ZX2A 3I8DA 3G0ZA 3VQDA 4HHTA 4JEPA 4FOIA 4BRQA 3O3HA 3SUPA 1ATSA 2HVIA 2OPQA 3VQ8A 2O8FB 2H3GX 1OH5A 3ZEUA 3O3GA 1S1UA 2ETJA 3CJAA 3VQ6A 2ZF5O 1K73O 1J6ZA 2W41A 4DSIA 1ATNA 1U2VA 3CQYA 4JK7A 2FBXA 3KD5E 1S1XA 1YF5L 2KQ2A 1ZBLA 1OVYA 2GWKA 4OJRA 1BCMA 3VTHA 4M7YA 2VCPA 5AQGA 2BDPA 5IWAK 2IVOA 4IFVA 4B9UA 1WSJA 3SCXA 3ITHA 3CIPA 3CQ8A 3PX0A 2ZM6K 1Q82O 3HBTA 4CJ3A 4CD3A 1JLFA 5I9EB 4LH5A 2UU9K 4DR5K 2QWPA 4JI2K 1N32K 5H1SQ 5BN8A 3K0SA 4RWTA 2UYTA 4RW8A 2YJFA 2O8DB 1IKVA 5M1OA 4KO0A 3U8XA 3OYFA 3WEEA 1NGFA 4AHSA 2P9PB 3ENOA 4E19A 1WOQA 3SQ1A 1TUYA 1JXBA 2X78A 1QVGM 4OPKA 3AVIA 4BR5A 4HUGA 2P9NB 3S3OA 2IIRA 4Y1DA 4BVOA 4FK4A 5J2MA 1ESVA 4DSFA 3KK1A 3LDLA 4YY3K 4CJEA 3NF8A 5C10A 4BVPA 4DTNA 3HZ6A 2V51B 3ASMA 4HCBA 3F9KA 2FSKA 3H3OB 1A5WA 3CFPA 4IFEA 3OYEA 3VA0A 4YOWA 3D2EB 2Y1IA 3AA3A 4NLCA 5KPRA 4OO1J 1LWEA 3PO5A 4NXNK 3NF9A 2ZD1A 3O6WA 4DV1K 4FK0A 4AHCA 1J54A 3U3GA 1NK8A 1SV5A 4FWRA 3CCSN 1W7AA 3V9WA 1DLOA 1TAUA 2KTQA 5KPZA 4DTUA 3EKUA 4R79A 2NRZA 1T03A 4DB3A 2P5GA 5J1EA 4JNEA 3LDNA 2IDOA 4H0PA 3ALYA 4B9LA 1RDWX 2YHXA 3NVMA 3EY1A 3PX4A 4NCAA 1KXPA 2YHAA 4A57A 5AQQA 4DMNA 4KKOA 4N56A 1QQMA 3QMLA 1TYQB 4OVLA 2YI1A 4NCGA 5HRRA 2YHBA 2FBVA 4DQSA 4JS5A 1GLFO 4NCBA 4O0JA 2UUAK 4FJLA 4B3MK 4CJVA 4FXDA 1X1PA 4X65K 3WXMB 1RT5A 3EKSA 2Q31A 1JKHA 4BWMA 4DU3A 1TAQA 3O9QA 1EETA 4FLWA 3A0IX 4N47A 4DLEA 4DTPA 4DF4A 2Z1GA 4K43A 1BWFO 3LM2A 2JGUA 4Z4FA 4CIGA 5BRFA 3LZJA 3TAQA 1NBWA 3OYAA 3NHGA 5CY4A 5AQVA 1BIZA 4CJQA 5FPEA 1HJOA 1J53A 3NGZA 3QB0A 3D2FA 2KKZA 4F3OA 3P31A 4FWPA 4CESA 1KRPA 4AF1A 1KAXA 3BEXA 2F96A 1Y64A 3ZCMA 5SWMA 1B92A 4WYBA 1FKPA 1CLQA 4MLEA 2YNFA 5EXWA 2ZGZA 4O8KA 1BI4A 4J8FA 2B4JA 5KI6A 3ZSZA 1Y97A 3FZHA 3CJ1A 3I56N 4JKDA 1G99A 3WQTA 3L0QA 4N41A 4IXCA 1SZ2A 2Q97A 2OZSA 1IBKK 4XEIA 2VWJA 1QTMA 3AVHA 2O4GA 4B9TA 3TU5A 2BE2A 5LMUK 1HPMA 4QOZB 2P9IB 2VG6A 3QICA 4YOUA 2DPNA 4GVMA 2E2PA 1GLCG 2E2NA 1N5YA 2NUBA 4O4GA 2KFNA 4FOEA 1TKXA 3TABA 4JKGA 4FJ7A 3R8EA 1KLNA 1BA1A 3LM9A 4O44A 3AY9A 3A5MC 3M8QA 1UA1A 3OBWA 2E4LA 2VGMA 4H4MA 1HLUA 4N76A 2HSTA 4K8XA 4KI6A 4IJNA 4Z94A 4CEZA 4PUOA 4CBXA 4AM7A 4B9SA 3SAFA 2QWQA 3QDKA 3DLGA 4A2BA 1VSFA 3VEVA 5JS2A 3T7ZA 3L2RA 3UE5A 1YJNN 3M5RA 3LP2A 3DAWA 4DV3K 3MWPA 1VQLN 2WOMA 4BACA 1BU6O 3VMFB 5FPNA 4DQ8A 2WUSA 1C0GA 3QEWA 5HROA 3HTVA 3J8AA 4B3TK 4LF7K 4IZ9A 4FWQA 3JAMO 4I6MB 4I7FA 3QO9A 4JV5K 4DV4K 3VESA 1HMVA 3F5TA 3THWA 2QTDA 3AVGA 1NOZA 2GEMA 2RN2A 4CHQA 3CFRA 4EZ6A 4NLBA 1K6YA 3LP0A 4ID5A 5LJVA 5F1XA 3THXB 3DLKA 1XNRK 3GBTA 2X6SA 1S1TA 4CZMA 4LF4K 3VQ7A 4CZJA 3SQ4A 4JI3K 4JD2A 4AHVA 1Z6RA 2FLOA 3AA5X 3GOIA 2GV9A 4CFDA 3LWMA 3SK3A 1VSLA 4Z4EA 1NNEA 1CZ9A 2QKKA 3UKRA 4EIAA 4IJAA 3QINA 3TTFA 4YOXA 3CCRN 1P8ZA 3OYCA 1OH7A 1KFSA 4CEDA 3WXIA 4DS5A 3TSUA 4JN4A 4CI6A 4CW7B 3QBXA 3CJCA 4FWSA 3O9RA 3TPQA 1TGOA 2X74A 1QHTA 3AV9A 1RTJA 4HTUA 1VQ8N 1ZBFA 3OY9A 3F9MA 3CYMA 4BR9A 3WUHA 4PQUA 3MN7A 3P83D 2NRRA 3KLIA 3JYTA 3FFKB 3P38A 4KI4A 3V9SA 4H5WA 3R6MA 1B9FA 4O5BA 3OS1A 3CJ7A 1LV5A 3U9DA 4YDUC 2YHWA 4CF8A 4XH1A 2ASMA 3W3DA 2E2QA 3ZSOA 2CH5A 3OJUA 2HW3A 1RDUA 4B8CA 3O5BA 3LAKA 1W2BM 2V52B 4F8RA 3L3UA 1VQ7N 5AQXA 1C1CA 5HRSA 4KTQA 1K8KB 4H0YB 3KWIA 2HBJA 3K59A 4B9QA 2QM1A 4I2QA 5B8HA 1KSPA 4M3RA 3OJSA 5CZ1A 1VQON 3SUNA 4GNIA 1N8RO 4M3XA 4JRPA 1T6CA 4HVJA 2O8BB 3SPYA 3OTOK 2ZWHA 1KFDA 2HHWA 4B1UB 5DMRA 3QLHA 4Z4HA 4F9OA 3VF2A 2A41A 4OLBA 4CERA 3F73A 1IO2A 2E1ZA 3RRGA 4NXMK 2WONA 4FWLA 4Z4CA 4FL9A 1ZXOA 3AARA 5I42A 3GE1A 3HSTB 3ZSWA 4FWNA 4CFCA 3O08A 4BR7A 4X66K 1DEJA 3JSMA 3VETA 4C8MA 2PFUA 3OA9A 2ZJPL 1ILYA 5AQZA 3H3NO 2B6AA 3DJCA 2HHVA 1ASWA 1TVRA 4WQ5A 3CFOA 3V9XA 1XHZA 1SL2A 3ZX3A 4PKHA 3SZ2A 1KVAA 3VQEA 1VSKA 2YKMA 1HKCA 4EZ9A 3HPHA 3CCVN 2G8HA 4QS8A 2IC3A 1S6QA 3KHYA 3V81A 4CBUA 4CD1A 3P4IA 1WBDA 2O8EB 2P1JA 4ILGB 2HOEA 3HXMA 2AP1A 2ITMA 1E4FT 3DOLA 1VK0A 1HYVA 2A1SA 2W40A 1YT3A 1WLJA 1CZAN 2EWSA 4DS4A 4DFKA 1NJYA 3NDKA 3T3FA 1MU2A 3WQUA 3AAPA 5AFUH 4EAHD 2VQEK 4DR7K 4DTXA 4BRLA 1RNHA 4KREA 1NU0A 2VGNA 4LF8K 4MDAA 1TL1A 3E1YA 4JLHA 4IDHA 3V9ZA 4BC3A 1EP4A 2RHKA 3VQQA 3SAHA 2BTFA 4CHYA 1OVQA 1FW6A 2ATQA 1S6PA 2OTJN 3LDOA 4M41A 1SKRA 1RDBA 3KLFA 1RILA 4WFNL 4FSVA 3FZFA 4FJHA 3MEEA 4OPJA 4PA1A 3C7NB 1HNZK 1HNXK 1VQ4N 2Q3SA 1WN7A 4CHPA 3I55N 1HRHA 4AHRA 5AZIA 3LDQA 3CCUN 3HOSA 5BN9A 5AQUA 5HP1A 1VQMN 5FRMA 4E7HA 4FPAA 1VQ9N 1W97L 3AGKA 4B3SK 3CQXA 4LC9B 1QS4A 4M45A 3NE6A 4J2BA 2A5XA 4FLTA 4CZKA 3TANA 1QSSA 5C2FA 1EO1A 4RG8A 5AQIA 4I2PA 3M8PA 3CERA 2P9SA 5JLFA 3LDSA 4KHWA 3ZSQA 4FVUA 1RDDA 3C6AA 1IKXA 5BRDA 4FJKA 1S9GA 3ZT0A 2NRWA 3EE9A 2P9UB 1KD1O 3N4PA 4J2AA 2F9TA 4C8NA 4MO5A 1JLEA 4FJJA 1Q9YA 4AILC 4H4OA 3T69A 2P9KB
chains in the Genus database with same CATH topology
4NCGA 4MQ3A 5HRRA 1JL2A 2FBVA 2YHBA 2OPSA 1C0TA 4JS5A 4AHUA 4DQSA 5CYMA 4E3SA 3V6DA 1NOYA 4N5SA 3L8BA 1EKEA 4KAZA 3L2VA 3C95A 4NCBA 3PO4A 4O0JA 4RW6A 2G8FA 3SQ0A 4FJLA 3KTQA 4FM0A 1DTQA 3K5NA 4CJVA 4I9QA 4FXDA 1X1PA 1UWBA 4DF8A 3HJFA 4B3OA 5HRPA 3S3MA 1YTUA 3OYMA 4M3TA 4KB1A 4E0DA 1A5VA 3LP3A 1RT5A 3OYBA 2EX3A 3AVFA 4CCHA 4DU3A 1JKHA 4BWMA 3RR7A 4RW7A 1CXQA 3AA2A 3OYNA 1GOCA 3U6FA 1NK4A 1TAQA 3HO1A 5JS1A 4CE9A 2HHTA 4DQPA 3D45A 5EU7A 1EETA 1NK7A 3T1AA 4FLWA 2QKBA 1T7PA 2BGGA 4N47A 1RBSA 4DLEA 1D5AA 4DTPA 4DF4A 1SKSA 4FJ8A 3V1RA 3VQ5A 1HNVA 2OZMA 2Z1GA 3MEGA 2X6NA 5KRSA 2ZE2A 4CEAA 3TWHA 3ZSRA 2JGUA 4KRFA 2BANA 4FLYA 4Z4FA 4GW6A 4FCYA 4OGCA 4CIGA 4BWJA 4NYFA 1RT2A 3LZJA 1SL0A 3IG1A 3TAQA 4IDKA 1UOCA 3OYAA 4E7JA 3NHGA 2Y1JA 3SUQA 1JL1A 1Q8IA 5CY4A 1BIZA 4CJQA 1T05A 1RBVA 4IKFA 1J53A 3NGZA 4KHYA 3RMBA 1L3UA 4AH9A 3DRSA 1IKWA 4F3OA 1L3SA 4IBNA 3KJVA 1GOBA 3TAEA 3VQ4A 1U49A 4FJNA 4FYDA 4WE1A 3K5OA 1U45A 1NK0A 3A2FA 3ZT4A 4CESA 4FM2A 1KRPA 1VSDA 3O4QA 1LWFA 2GBZA 2ITGA 2F96A 5KRTA 5D3GA 5J2NA 4FLXA 4QCLA 1BQMA 3ZCMA 4CEQA 3S9HA 1REVA 1TK0A 5SWMA 1NJZA 4FJXA 1B92A 4CHNA 3IS9A 1FKPA 1W0HA 4IG3A 4OGEA 2XY6A 1CLQA 4XIUA 2YNFA 4W5OA 1LAVA 4ZHRA 1KVBA 4CJSA 3D0PA 4W5NA 4Z4IA 1LWCA 2FBTA 1BI4A 3NH1A 4FW2A 3TI0A 2B4JA 1FKOA 3LPTA 5KI6A 3VQ9A 1S5JA 4JRQA 1LW2A 3ZSZA 1Y97A 3RMCA 3HVRA 2D5RA 1X9SA 1NK5A 2IGIA 4Z0UA 3LWLA 4J2EA 1G15A 1GOAA 1RT4A 3SNNA 1D9DA 2KW4A 1NJXA 4N41A 2OZSA 3IRXA 4BDYA 1VRTA 1X9MA 3LANA 3TAMA 3OYIA 4W5RA 3M8RA 1Z25A 4H8KA 1RTDA 2VWJA 3HPGA 2G8KA 1QTMA 3IAYA 3AVHA 2O4GA 4RW4A 1RTIA 4CEBA 3LPUA 4AHTA 3RMDA 2BE2A 1KTQA 3K5LA 4QOZB 2VG6A 4LSNA 1L3TA 3OVNA 4GVMA 4CGFA 4O55A 3V1OA 4CHOA 4CK1A 3ZT2A 1VRUA 4CFAA 3SYZA 4LH4A 3MXIA 2XRIA 4DTRA 3AVAA 2NUBA 4CGDA 1N5YA 1WNSA 1BHLA 2YNGA 4O4GA 3TR8A 3DOKA 4DG1A 2KFNA 1TKXA 3C6TA 3AVBA 3UIQA 4KTWA 1IG9A 3MECA 3NF6A 2HHSA 3TABA 4ID1A 4FJ7A 1RT3A 1JLAA 4KV8A 4CGGA 1U04A 4HUFA 1KLNA 4C8OA 3DRPA 1CZBA 3HVTA 4FVMA 4O44A 4DTSA 4DFPA 1Z26A 3M8QA 4Y1CA 1UA1A 1QSYA 2E4LA 4GMJB 4H4MA 3AO3A 4N76A 2HHXA 4K8XA 5K14A 1HQEA 4KI6A 2RF2A 2XHBA 3PX6A 3KKRA 4M3ZA 4CEZA 4FZXC 4PUOA 1ZBHA 2F8TA 2LSNA 4YFUA 3K58A 3SV3A 2HHUA 4B9SA 5HLFA 1QE1A 1BISA 4E7IA 3O4NA 1C0UA 4DSLA 4DWIA 3AVJA 3WNEA 2IS3A 1JLBA 3DLGA 1VSFA 3ZSXA 4FJIA 2OPRA 5JS2A 1TKDA 3L2RA 4DSEA 3CM6A 3ZSVA 4B08A 3DI6A 1QQCA 3LP2A 2AJQA 3V9UA 1S1VA 3KK3A 4BDZA 2KZZA 2OYQA 3NGYA 2WOMA 1KVCA 4IG0A 4BACA 3B6OA 3ZSYA 2G8IA 4J2DA 3VQBA 1HYZA 1BIUA 4C8KA 3QEWA 5HROA 4ELVA 3VQPA 1XHXA 4KHUA 4CECA 3AO1A 3QETA 4B9MA 4TSXA 2HMIA 5C25A 5CZ2A 3RMAA 3SJJA 1D8YA 4B9TA 1I39A 2YV0X 4KHNA 3DLEA 3AA4A 1SL1A 3HT3A 4I7FA 1WSHA 3QO9A 4CHZA 2G8WA 1HMVA 2RKIA 4CEFA 2KFZA 3AVGA 1NOZA 2RN2A 4CHQA 3K5MA 1BI4B 3DM2A 3CFRA 4ELUA 4EZ6A 4EP4A 2EHGA 4RW9A 3ZT1A 3ULDA 4DTJA 2P5OA 1VSJA 1K6YA 3LP0A 3DYAA 4ID5A 3OYJA 4CJ4A 3P1GA 3DLKA 2DFHA 1S9EA 4Q0BA 5SZTA 2X6SA 4QAGA 3NFAA 4CGHA 1WAFA 4CJUA 3LP1A 3MAQA 1S1TA 3K57A 4FLZA 4Z4GA 3VQ7A 3QESA 3AVMA 3WNFA 4BE2A 3SQ4A 3L2QA 4AHVA 1D9FA 3RTVA 3RR8A 3AA5X 1QSLA 1HNIA 2GV9A 4KFBA 4CFDA 2HNYA 3LWMA 3QEIA 5FROA 1C1BA 1VSIA 4G1QA 3TARA 5FRNA 4FZZA 1VSLA 3DMJA 3OS0A 3QEXA 1CZ9A 1T8EA 1Q9XA 2D0CA 3AVKA 5DK5A 3VN5A 2IAJA 4EP5A 3P5JA 3E01A 2VG5A 2QKKA 4L8RB 3LALA 1KLMA 3QINA 3DLRA 3AVLA 4M3YA 4LY7A 4LD0A 1HJRA 3OYCA 3OYKA 1KFSA 3WNHA 4CEDA 1NK6A 5C24A 3OS2A 4JS4A 4DS5A 1ZBIA 3L2UA 2O4IA 3PUFA 4DU4A 1YVUA 2XY8A 1J9AA 3AO4A 2Z1HA 2D0AA 1RBRA 3HM9A 1TGOA 1HPZA 2X74A 1QHTA 3ISNC 3AV9A 1RBUA 1RTJA 4CIEA 4HTUA 4C8LA 3PY8A 4ZTFA 1RDCA 1ZBFA 4BE0A 3OY9A 3AO5A 3CYMA 4PQUA 4CJKA 2JLEA 1TKZA 2YNHA 3P83D 3KLIA 4MFBA 3LZIA 4OKEA 1XI1A 3JYTA 1J5OA 4K8ZA 4KI4A 2HB5A 4FLUA 1BL3A 3V9SA 4DSKA 2XO7A 4BE1A 1B9FA 4O5BA 3MXMA 2DFEA 3L2WA 3OS1A 3BGRA 5J2QA 4OKKA 3L3VA 1LV5A 3SV4A 1O1WA 4M3UA 2YKNA 4F3TA 1ZBUA 5HBMA 1ASVA 3QNOA 4CF8A 1VSEA 1WSGA 4E1MA 3VA3A 4ICLA 2YNIA 3PV8A 4PY5A 4CJ5A 3QEVA 1C0MA 3ZSOA 4DFJA 3O3FA 3OJUA 1CXUA 4FK2A 3MXJA 3OYHA 3NGIA 2OA8A 2HW3A 3C94A 4B8CA 3NH2A 2E6LA 3LAKA 4DQIA 4F8RA 3L3UA 4DU1A 3HP6A 4CJPA 4M42A 1HQUA 3I0SA 1C1CA 3DLBA 4CIFA 5HRSA 4KTQA 2FBYA 3OYDA 4ELTA 4DTMA 2G8VA 1SUQA 3CG7A 1FXXA 4CJRA 1C1AA 1R0AA 4KTZA 1I3AA 2GUIA 3K59A 2B5JA 5J2PA 4CF9A 1U4BA 1TK8A 1WSEA 3NAEA 4I2QA 1KSPA 4W5QA 2R7YA 4M3RA 3OJSA 1JLGA 1NJWA 5CZ1A 5T7BA 1F21A 4DTOA 3SUNA 2HNZA 5KGXA 1WAJA 4M3XA 1RCHA 4DLGA 4FLVA 5E41A 1W9HA 1RT7A 4IFYA 4CJWA 4HVJA 4JRPA 3SUOA 2PZSA 3SPYA 4B9VA 1TV6A 3RWUA 4I9LA 1KFDA 5FDLA 3EZ5A 2HHWA 4UQGA 5CYQA 1LAWA 3AO2A 3AVNA 5DMRA 3QLHA 4Z4HA 3HK2A 4CJTA 2W42A 4E7LA 4HCCA 1BCOA 4OLBA 4CF0A 4Z4EA 4CERA 1XWLA 3F73A 4B9NA 1FK9A 1IO2A 1U47A 2IOCA 3RRGA 3KLEA 2WONA 3VQAA 3AVCA 2A1RA 4Z4CA 4YNQA 3I8DA 3G0ZA 3H08A 3VQDA 4HHTA 3DRRA 5I42A 3HSTB 3ZSWA 4B8AB 4ZTJA 3O3HA 3B6PA 4CK2A 3T19A 4CFCA 2G8UA 3SUPA 2HVIA 2OPQA 3VQ8A 3JSMA 3SPZA 4C8MA 3M8SA 3O3GA 1S1UA 2ETJA 3HP9A 3VQ6A 3NBPA 1N6QA 3VQCA 4DSIA 4W5TA 3KKSA 2FBXA 3RRHA 2B6AA 1JXEA 3KD5E 1S1XA 2KQ2A 1ASWA 1LW0A 2HHVA 3U3YA 3S3NA 4OLAA 2QXFA 1NKBA 1ZBLA 1TVRA 4FZYA 1BGXT 2HNDA 1RBTA 3CFOA 3NF7A 3V9XA 3QNNA 4OJRA 2XY7A 1XHZA 1BCMA 1SL2A 3SZ2A 1KVAA 1YTAA 3VQEA 4FJGA 1VSKA 2YKMA 2BDPA 1SKWA 4EZ9A 4E7KA 3CM5A 3HPHA 4IFVA 2OPPA 1UA0A 4B9UA 3V1QA 1WSJA 2F8SA 3SCXA 2DTUA 3NCIA 1B9DA 2G8HA 2IC3A 4FW1A 4PWDA 3ITHA 1S6QA 3ZT3A 3CQ8A 3V81A 4CJLA 3PX0A 1DTTA 4Q5VA 4CGIA 2PY5A 2RPIA 4CJ3A 3MEDA 1TL3A 1JLFA 2P1JA 4LH5A 4DQQA 1KCFA 1EXQA 4CJFA 2PYLA 4E1NA 1XC9A 2PYJA 3HXMA 4RW8A 2HVHA 1WSFA 1IKVA 4KO0A 3WNGA 4CFBA 3DOLA 1VK0A 1HYVA 5C42A 2A1SA 3OYFA 1YT3A 1WLJA 3SQ2A 2VG7A 4DS4A 4AHSA 3KK2A 4F4KA 4DFKA 1NJYA 3NDKA 4E19A 3T3FA 3QEPA 1TK5A 3SQ1A 1MU2A 2Z1JA 4DQRA 2P51A 4DSJA 4NYNA 1A5XA 1NK9A 4FJ5A 1JXBA 2X78A 1VSMA 3OYGA 4DTXA 3C6UA 2E6MA 2I5JA 1RNHA 4OPKA 3AVIA 4HUGA 3KD1E 4KREA 3S3OA 5I3UA 1ITGA 4Y1DA 3KLGA 1TL1A 1TKTA 3KLHA 2VWKA 4R5PA 3V4IA 4FK4A 2Z1IA 2HHQA 2DY4A 5J2MA 4JLHA 4DFMA 2FC0A 1NKEA 3FFIA 3V9ZA 4DSFA 3KK1A 1EP4A 3VQQA 4CJEA 4CHYA 2D0BA 2ATQA 1S6PA 3NF8A 4M41A 4CF1A 1SKRA 1RDBA 4CK3A 3HL8A 3KLFA 1RILA 3TAFA 4DTNA 4FJHA 3MEEA 4OPJA 3DLHA 3QERA 4PA1A 3ASMA 4HCBA 1U48A 3F9KA 3G10A 1A5WA 3CFPA 2Q3SA 1WN7A 4F2RA 3I0RA 4CHPA 3TAGA 3OYEA 1HRHA 4AHRA 3NH0A 3VA0A 4O0IA 2ZQBA 1ZYQA 2Y1IA 5HP1A 3AA3A 1UAXA 4FM1A 3QIOA 5KGWA 2KZMA 3KIOA 5FRMA 1LWEA 4E7HA 4KB0A 3PO5A 3NF9A 1RTHA 2ZD1A 2QK9A 1WSIA 3K2PA 4FK0A 4AHCA 3SI6A 3HPOA 1J54A 3LAMA 3U3GA 1NK8A 1SV5A 1VSHA 1QS4A 4M3WA 1S1WA 3HYFA 4M45A 4CEOA 3NE6A 1X9WA 4J2BA 4E89A 4FLTA 3V9WA 1IH7A 3TAPA 3TANA 4CF2A 1DLOA 1TAUA 4KPYA 2KTQA 1QSSA 4HUEA 3BDPA 4RG8A 4LSLA 4DTUA 4I2PA 3M8PA 3EYZA 1C6VA 1T03A 2P5GA 4KHSA 1RT6A 5J1EA 4KHWA 5KTQA 5HRNA 1JLQA 3ZSQA 3OYLA 1RDDA 3LDSA 1HYSA 1RDAA 1IKXA 1EX4A 2IDOA 4CEEA 1BQNA 3ALYA 4B9LA 4FJKA 1S9GA 3ZT0A 4F2SA 1RT1A 4KHQA 1L3VA 2XY5A 1ASUA 1JLCA 3EY1A 1L5UA 3PX4A 4BDPA 4NCAA 2DFFA 4OKJA 2YHAA 3QIPA 4J2AA 4FJ9A 4C8NA 4DMNA 3THVA 4KKOA 1JLEA 4N56A 1IKYA 1Q9YA 4FJJA 4FJMA 4CGJA 4OVLA 4AILC 4H4OA 1NKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCG A;  4MQ3 A;  5HRR A;  1JL2 A;  2FBV A;  2YHB A;  2OPS A;  1C0T A;  4JS5 A;  4AHU A;  4DQS A;  5CYM A;  4E3S A;  3V6D A;  1NOY A;  4N5S A;  3L8B A;  1EKE A;  4KAZ A;  3L2V A;  3C95 A;  4NCB A;  3PO4 A;  4O0J A;  4RW6 A;  2G8F A;  3SQ0 A;  4FJL A;  3KTQ A;  4FM0 A;  1DTQ A;  3K5N A;  4CJV A;  4I9Q A;  4FXD A;  1X1P A;  1UWB A;  4DF8 A;  3HJF A;  4B3O A;  5HRP A;  3S3M A;  1YTU A;  3OYM A;  4M3T A;  4KB1 A;  4E0D A;  1A5V A;  3LP3 A;  1RT5 A;  3OYB A;  2EX3 A;  3AVF A;  4CCH A;  4DU3 A;  1JKH A;  4BWM A;  3RR7 A;  4RW7 A;  1CXQ A;  3AA2 A;  3OYN A;  1GOC A;  3U6F A;  1NK4 A;  1TAQ A;  3HO1 A;  5JS1 A;  4CE9 A;  2HHT A;  4DQP A;  3D45 A;  5EU7 A;  1EET A;  1NK7 A;  3T1A A;  4FLW A;  2QKB A;  1T7P A;  2BGG A;  4N47 A;  1RBS A;  4DLE A;  1D5A A;  4DTP A;  4DF4 A;  1SKS A;  4FJ8 A;  3V1R A;  3VQ5 A;  1HNV A;  2OZM A;  2Z1G A;  3MEG A;  2X6N A;  5KRS A;  2ZE2 A;  4CEA A;  3TWH A;  3ZSR A;  2JGU A;  4KRF A;  2BAN A;  4FLY A;  4Z4F A;  4GW6 A;  4FCY A;  4OGC A;  4CIG A;  4BWJ A;  4NYF A;  1RT2 A;  3LZJ A;  1SL0 A;  3IG1 A;  3TAQ A;  4IDK A;  1UOC A;  3OYA A;  4E7J A;  3NHG A;  2Y1J A;  3SUQ A;  1JL1 A;  1Q8I A;  5CY4 A;  1BIZ A;  4CJQ A;  1T05 A;  1RBV A;  4IKF A;  1J53 A;  3NGZ A;  4KHY A;  3RMB A;  1L3U A;  4AH9 A;  3DRS A;  1IKW A;  4F3O A;  1L3S A;  4IBN A;  3KJV A;  1GOB A;  3TAE A;  3VQ4 A;  1U49 A;  4FJN A;  4FYD A;  4WE1 A;  3K5O A;  1U45 A;  1NK0 A;  3A2F A;  3ZT4 A;  4CES A;  4FM2 A;  1KRP A;  1VSD A;  3O4Q A;  1LWF A;  2GBZ A;  2ITG A;  2F96 A;  5KRT A;  5D3G A;  5J2N A;  4FLX A;  4QCL A;  1BQM A;  3ZCM A;  4CEQ A;  3S9H A;  1REV A;  1TK0 A;  5SWM A;  1NJZ A;  4FJX A;  1B92 A;  4CHN A;  3IS9 A;  1FKP A;  1W0H A;  4IG3 A;  4OGE A;  2XY6 A;  1CLQ A;  4XIU A;  2YNF A;  4W5O A;  1LAV A;  4ZHR A;  1KVB A;  4CJS A;  3D0P A;  4W5N A;  4Z4I A;  1LWC A;  2FBT A;  1BI4 A;  3NH1 A;  4FW2 A;  3TI0 A;  2B4J A;  1FKO A;  3LPT A;  5KI6 A;  3VQ9 A;  1S5J A;  4JRQ A;  1LW2 A;  3ZSZ A;  1Y97 A;  3RMC A;  3HVR A;  2D5R A;  1X9S A;  1NK5 A;  2IGI A;  4Z0U A;  3LWL A;  4J2E A;  1G15 A;  1GOA A;  1RT4 A;  3SNN A;  1D9D A;  2KW4 A;  1NJX A;  4N41 A;  2OZS A;  3IRX A;  4BDY A;  1VRT A;  1X9M A;  3LAN A;  3TAM A;  3OYI A;  4W5R A;  3M8R A;  1Z25 A;  4H8K A;  1RTD A;  2VWJ A;  3HPG A;  2G8K A;  1QTM A;  3IAY A;  3AVH A;  2O4G A;  4RW4 A;  1RTI A;  4CEB A;  3LPU A;  4AHT A;  3RMD A;  2BE2 A;  1KTQ A;  3K5L A;  4QOZ B;  2VG6 A;  4LSN A;  1L3T A;  3OVN A;  4GVM A;  4CGF A;  4O55 A;  3V1O A;  4CHO A;  4CK1 A;  3ZT2 A;  1VRU A;  4CFA A;  3SYZ A;  4LH4 A;  3MXI A;  2XRI A;  4DTR A;  3AVA A;  2NUB A;  4CGD A;  1N5Y A;  1WNS A;  1BHL A;  2YNG A;  4O4G A;  3TR8 A;  3DOK A;  4DG1 A;  2KFN A;  1TKX A;  3C6T A;  3AVB A;  3UIQ A;  4KTW A;  1IG9 A;  3MEC A;  3NF6 A;  2HHS A;  3TAB A;  4ID1 A;  4FJ7 A;  1RT3 A;  1JLA A;  4KV8 A;  4CGG A;  1U04 A;  4HUF A;  1KLN A;  4C8O A;  3DRP A;  1CZB A;  3HVT A;  4FVM A;  4O44 A;  4DTS A;  4DFP A;  1Z26 A;  3M8Q A;  4Y1C A;  1UA1 A;  1QSY A;  2E4L A;  4GMJ B;  4H4M A;  3AO3 A;  4N76 A;  2HHX A;  4K8X A;  5K14 A;  1HQE A;  4KI6 A;  2RF2 A;  2XHB A;  3PX6 A;  3KKR A;  4M3Z A;  4CEZ A;  4FZX C;  4PUO A;  1ZBH A;  2F8T A;  2LSN A;  4YFU A;  3K58 A;  3SV3 A;  2HHU A;  4B9S A;  5HLF A;  1QE1 A;  1BIS A;  4E7I A;  3O4N A;  1C0U A;  4DSL A;  4DWI A;  3AVJ A;  3WNE A;  2IS3 A;  1JLB A;  3DLG A;  1VSF A;  3ZSX A;  4FJI A;  2OPR A;  5JS2 A;  1TKD A;  3L2R A;  4DSE A;  3CM6 A;  3ZSV A;  4B08 A;  3DI6 A;  1QQC A;  3LP2 A;  2AJQ A;  3V9U A;  1S1V A;  3KK3 A;  4BDZ A;  2KZZ A;  2OYQ A;  3NGY A;  2WOM A;  1KVC A;  4IG0 A;  4BAC A;  3B6O A;  3ZSY A;  2G8I A;  4J2D A;  3VQB A;  1HYZ A;  1BIU A;  4C8K A;  3QEW A;  5HRO A;  4ELV A;  3VQP A;  1XHX A;  4KHU A;  4CEC A;  3AO1 A;  3QET A;  4B9M A;  4TSX A;  2HMI A;  5C25 A;  5CZ2 A;  3RMA A;  3SJJ A;  1D8Y A;  4B9T A;  1I39 A;  2YV0 X;  4KHN A;  3DLE A;  3AA4 A;  1SL1 A;  3HT3 A;  4I7F A;  1WSH A;  3QO9 A;  4CHZ A;  2G8W A;  1HMV A;  2RKI A;  4CEF A;  2KFZ A;  3AVG A;  1NOZ A;  2RN2 A;  4CHQ A;  3K5M A;  1BI4 B;  3DM2 A;  3CFR A;  4ELU A;  4EZ6 A;  4EP4 A;  2EHG A;  4RW9 A;  3ZT1 A;  3ULD A;  4DTJ A;  2P5O A;  1VSJ A;  1K6Y A;  3LP0 A;  3DYA A;  4ID5 A;  3OYJ A;  4CJ4 A;  3P1G A;  3DLK A;  2DFH A;  1S9E A;  4Q0B A;  5SZT A;  2X6S A;  4QAG A;  3NFA A;  4CGH A;  1WAF A;  4CJU A;  3LP1 A;  3MAQ A;  1S1T A;  3K57 A;  4FLZ A;  4Z4G A;  3VQ7 A;  3QES A;  3AVM A;  3WNF A;  4BE2 A;  3SQ4 A;  3L2Q A;  4AHV A;  1D9F A;  3RTV A;  3RR8 A;  3AA5 X;  1QSL A;  1HNI A;  2GV9 A;  4KFB A;  4CFD A;  2HNY A;  3LWM A;  3QEI A;  5FRO A;  1C1B A;  1VSI A;  4G1Q A;  3TAR A;  5FRN A;  4FZZ A;  1VSL A;  3DMJ A;  3OS0 A;  3QEX A;  1CZ9 A;  1T8E A;  1Q9X A;  2D0C A;  3AVK A;  5DK5 A;  3VN5 A;  2IAJ A;  4EP5 A;  3P5J A;  3E01 A;  2VG5 A;  2QKK A;  4L8R B;  3LAL A;  1KLM A;  3QIN A;  3DLR A;  3AVL A;  4M3Y A;  4LY7 A;  4LD0 A;  1HJR A;  3OYC A;  3OYK A;  1KFS A;  3WNH A;  4CED A;  1NK6 A;  5C24 A;  3OS2 A;  4JS4 A;  4DS5 A;  1ZBI A;  3L2U A;  2O4I A;  3PUF A;  4DU4 A;  1YVU A;  2XY8 A;  1J9A A;  3AO4 A;  2Z1H A;  2D0A A;  1RBR A;  3HM9 A;  1TGO A;  1HPZ A;  2X74 A;  1QHT A;  3ISN C;  3AV9 A;  1RBU A;  1RTJ A;  4CIE A;  4HTU A;  4C8L A;  3PY8 A;  4ZTF A;  1RDC A;  1ZBF A;  4BE0 A;  3OY9 A;  3AO5 A;  3CYM A;  4PQU A;  4CJK A;  2JLE A;  1TKZ A;  2YNH A;  3P83 D;  3KLI A;  4MFB A;  3LZI A;  4OKE A;  1XI1 A;  3JYT A;  1J5O A;  4K8Z A;  4KI4 A;  2HB5 A;  4FLU A;  1BL3 A;  3V9S A;  4DSK A;  2XO7 A;  4BE1 A;  1B9F A;  4O5B A;  3MXM A;  2DFE A;  3L2W A;  3OS1 A;  3BGR A;  5J2Q A;  4OKK A;  3L3V A;  1LV5 A;  3SV4 A;  1O1W A;  4M3U A;  2YKN A;  4F3T A;  1ZBU A;  5HBM A;  1ASV A;  3QNO A;  4CF8 A;  1VSE A;  1WSG A;  4E1M A;  3VA3 A;  4ICL A;  2YNI A;  3PV8 A;  4PY5 A;  4CJ5 A;  3QEV A;  1C0M A;  3ZSO A;  4DFJ A;  3O3F A;  3OJU A;  1CXU A;  4FK2 A;  3MXJ A;  3OYH A;  3NGI A;  2OA8 A;  2HW3 A;  3C94 A;  4B8C A;  3NH2 A;  2E6L A;  3LAK A;  4DQI A;  4F8R A;  3L3U A;  4DU1 A;  3HP6 A;  4CJP A;  4M42 A;  1HQU A;  3I0S A;  1C1C A;  3DLB A;  4CIF A;  5HRS A;  4KTQ A;  2FBY A;  3OYD A;  4ELT A;  4DTM A;  2G8V A;  1SUQ A;  3CG7 A;  1FXX A;  4CJR A;  1C1A A;  1R0A A;  4KTZ A;  1I3A A;  2GUI A;  3K59 A;  2B5J A;  5J2P A;  4CF9 A;  1U4B A;  1TK8 A;  1WSE A;  3NAE A;  4I2Q A;  1KSP A;  4W5Q A;  2R7Y A;  4M3R A;  3OJS A;  1JLG A;  1NJW A;  5CZ1 A;  5T7B A;  1F21 A;  4DTO A;  3SUN A;  2HNZ A;  5KGX A;  1WAJ A;  4M3X A;  1RCH A;  4DLG A;  4FLV A;  5E41 A;  1W9H A;  1RT7 A;  4IFY A;  4CJW A;  4HVJ A;  4JRP A;  3SUO A;  2PZS A;  3SPY A;  4B9V A;  1TV6 A;  3RWU A;  4I9L A;  1KFD A;  5FDL A;  3EZ5 A;  2HHW A;  4UQG A;  5CYQ A;  1LAW A;  3AO2 A;  3AVN A;  5DMR A;  3QLH A;  4Z4H A;  3HK2 A;  4CJT A;  2W42 A;  4E7L A;  4HCC A;  1BCO A;  4OLB A;  4CF0 A;  4Z4E A;  4CER A;  1XWL A;  3F73 A;  4B9N A;  1FK9 A;  1IO2 A;  1U47 A;  2IOC A;  3RRG A;  3KLE A;  2WON A;  3VQA A;  3AVC A;  2A1R A;  4Z4C A;  4YNQ A;  3I8D A;  3G0Z A;  3H08 A;  3VQD A;  4HHT A;  3DRR A;  5I42 A;  3HST B;  3ZSW A;  4B8A B;  4ZTJ A;  3O3H A;  3B6P A;  4CK2 A;  3T19 A;  4CFC A;  2G8U A;  3SUP A;  2HVI A;  2OPQ A;  3VQ8 A;  3JSM A;  3SPZ A;  4C8M A;  3M8S A;  3O3G A;  1S1U A;  2ETJ A;  3HP9 A;  3VQ6 A;  3NBP A;  1N6Q A;  3VQC A;  4DSI A;  4W5T A;  3KKS A;  2FBX A;  3RRH A;  2B6A A;  1JXE A;  3KD5 E;  1S1X A;  2KQ2 A;  1ASW A;  1LW0 A;  2HHV A;  3U3Y A;  3S3N A;  4OLA A;  2QXF A;  1NKB A;  1ZBL A;  1TVR A;  4FZY A;  1BGX T;  2HND A;  1RBT A;  3CFO A;  3NF7 A;  3V9X A;  3QNN A;  4OJR A;  2XY7 A;  1XHZ A;  1BCM A;  1SL2 A;  3SZ2 A;  1KVA A;  1YTA A;  3VQE A;  4FJG A;  1VSK A;  2YKM A;  2BDP A;  1SKW A;  4EZ9 A;  4E7K A;  3CM5 A;  3HPH A;  4IFV A;  2OPP A;  1UA0 A;  4B9U A;  3V1Q A;  1WSJ A;  2F8S A;  3SCX A;  2DTU A;  3NCI A;  1B9D A;  2G8H A;  2IC3 A;  4FW1 A;  4PWD A;  3ITH A;  1S6Q A;  3ZT3 A;  3CQ8 A;  3V81 A;  4CJL A;  3PX0 A;  1DTT A;  4Q5V A;  4CGI A;  2PY5 A;  2RPI A;  4CJ3 A;  3MED A;  1TL3 A;  1JLF A;  2P1J A;  4LH5 A;  4DQQ A;  1KCF A;  1EXQ A;  4CJF A;  2PYL A;  4E1N A;  1XC9 A;  2PYJ A;  3HXM A;  4RW8 A;  2HVH A;  1WSF A;  1IKV A;  4KO0 A;  3WNG A;  4CFB A;  3DOL A;  1VK0 A;  1HYV A;  5C42 A;  2A1S A;  3OYF A;  1YT3 A;  1WLJ A;  3SQ2 A;  2VG7 A;  4DS4 A;  4AHS A;  3KK2 A;  4F4K A;  4DFK A;  1NJY A;  3NDK A;  4E19 A;  3T3F A;  3QEP A;  1TK5 A;  3SQ1 A;  1MU2 A;  2Z1J A;  4DQR A;  2P51 A;  4DSJ A;  4NYN A;  1A5X A;  1NK9 A;  4FJ5 A;  1JXB A;  2X78 A;  1VSM A;  3OYG A;  4DTX A;  3C6U A;  2E6M A;  2I5J A;  1RNH A;  4OPK A;  3AVI A;  4HUG A;  3KD1 E;  4KRE A;  3S3O A;  5I3U A;  1ITG A;  4Y1D A;  3KLG A;  1TL1 A;  1TKT A;  3KLH A;  2VWK A;  4R5P A;  3V4I A;  4FK4 A;  2Z1I A;  2HHQ A;  2DY4 A;  5J2M A;  4JLH A;  4DFM A;  2FC0 A;  1NKE A;  3FFI A;  3V9Z A;  4DSF A;  3KK1 A;  1EP4 A;  3VQQ A;  4CJE A;  4CHY A;  2D0B A;  2ATQ A;  1S6P A;  3NF8 A;  4M41 A;  4CF1 A;  1SKR A;  1RDB A;  4CK3 A;  3HL8 A;  3KLF A;  1RIL A;  3TAF A;  4DTN A;  4FJH A;  3MEE A;  4OPJ A;  3DLH A;  3QER A;  4PA1 A;  3ASM A;  4HCB A;  1U48 A;  3F9K A;  3G10 A;  1A5W A;  3CFP A;  2Q3S A;  1WN7 A;  4F2R A;  3I0R A;  4CHP A;  3TAG A;  3OYE A;  1HRH A;  4AHR A;  3NH0 A;  3VA0 A;  4O0I A;  2ZQB A;  1ZYQ A;  2Y1I A;  5HP1 A;  3AA3 A;  1UAX A;  4FM1 A;  3QIO A;  5KGW A;  2KZM A;  3KIO A;  5FRM A;  1LWE A;  4E7H A;  4KB0 A;  3PO5 A;  3NF9 A;  1RTH A;  2ZD1 A;  2QK9 A;  1WSI A;  3K2P A;  4FK0 A;  4AHC A;  3SI6 A;  3HPO A;  1J54 A;  3LAM A;  3U3G A;  1NK8 A;  1SV5 A;  1VSH A;  1QS4 A;  4M3W A;  1S1W A;  3HYF A;  4M45 A;  4CEO A;  3NE6 A;  1X9W A;  4J2B A;  4E89 A;  4FLT A;  3V9W A;  1IH7 A;  3TAP A;  3TAN A;  4CF2 A;  1DLO A;  1TAU A;  4KPY A;  2KTQ A;  1QSS A;  4HUE A;  3BDP A;  4RG8 A;  4LSL A;  4DTU A;  4I2P A;  3M8P A;  3EYZ A;  1C6V A;  1T03 A;  2P5G A;  4KHS A;  1RT6 A;  5J1E A;  4KHW A;  5KTQ A;  5HRN A;  1JLQ A;  3ZSQ A;  3OYL A;  1RDD A;  3LDS A;  1HYS A;  1RDA A;  1IKX A;  1EX4 A;  2IDO A;  4CEE A;  1BQN A;  3ALY A;  4B9L A;  4FJK A;  1S9G A;  3ZT0 A;  4F2S A;  1RT1 A;  4KHQ A;  1L3V A;  2XY5 A;  1ASU A;  1JLC A;  3EY1 A;  1L5U A;  3PX4 A;  4BDP A;  4NCA A;  2DFF A;  4OKJ A;  2YHA A;  3QIP A;  4J2A A;  4FJ9 A;  4C8N A;  4DMN A;  3THV A;  4KKO A;  1JLE A;  4N56 A;  1IKY A;  1Q9Y A;  4FJJ A;  4FJM A;  4CGJ A;  4OVL A;  4AIL C;  4H4O A;  1NKC A; 
#chains in the Genus database with same CATH topology
 4MLH A;  1RGI A;  4LF6 K;  3FZM A;  1C0T A;  5CYM A;  3WEE B;  1NOY A;  4QS9 A;  1EKE A;  3PO4 A;  4BRF A;  3K5N A;  4I9Q A;  1WUA A;  1UWB A;  2QWN A;  4JK8 A;  4DF8 A;  5C12 A;  3THY A;  4B3O A;  3S3M A;  1YTU A;  3KZB A;  3OYM A;  1XUP O;  3LP3 A;  2ZGY A;  3OYB A;  4GV6 A;  3IDH A;  1SS6 A;  1BDG A;  1NK4 A;  1Z05 A;  4BRG A;  2ZJR L;  5JS1 A;  4CE9 A;  3D45 A;  1T7P A;  2BGG A;  1FJG K;  2V7Y A;  4FJ8 A;  1M90 O;  2OZM A;  5KRS A;  2X6N A;  2FF3 B;  2ZE2 A;  3BZC A;  3M3Z A;  5KQ8 A;  3O9S A;  3TWH A;  3ZSR A;  4GV9 A;  3O4W A;  1RT2 A;  1XQS C;  1SL0 A;  4CZG A;  1UOC A;  3SUQ A;  4FO0 A;  1ZYQ A;  3EEQ A;  4A59 A;  1NMD A;  2HBM A;  4KHY A;  4CZF A;  1L3U A;  3DRS A;  3TAE A;  1GOB A;  2P9L A;  1U6Z A;  1VSD A;  1LWF A;  2GBZ A;  5M1K A;  2ITG A;  5D3G A;  3A5O C;  4CEQ A;  1REV A;  4FJX A;  3H1V X;  2KLA A;  4OGE A;  2XY6 A;  4JI7 K;  5C15 A;  2CGL A;  5F0X A;  3CC4 N;  1LAV A;  4CJS A;  1YXQ A;  3NH1 A;  1EWR A;  3TI0 A;  3VQ9 A;  1S5J A;  4JRQ A;  1NK5 A;  3MWT A;  2IGI A;  1OH8 A;  1G15 A;  1GOA A;  5AJ3 K;  4OPA A;  2E2O A;  3VEO A;  1V4S A;  3Q7C A;  5AFU A;  2VQF K;  1X9M A;  3TAM A;  3M8R A;  1Z25 A;  2GEL A;  2CH6 A;  3HPG A;  3IAY A;  2KZM A;  1RTI A;  4CEB A;  3LPU A;  3OW2 M;  3R1X A;  3PLA A;  3MCA B;  4O55 A;  4CFA A;  3E9P A;  4LH4 A;  1IG8 A;  4DUY K;  3MXI A;  4BQL A;  5HL7 L;  4DTR A;  4H5R A;  1WNS A;  1BHL A;  1YJW N;  3DOK A;  5GIN A;  4B3R K;  3C6T A;  3UIQ A;  4H0T B;  2Q1N A;  4JAX A;  4ID1 A;  1GLD G;  4C8O A;  1CZB A;  2D0P A;  3SJH A;  5CR4 A;  2O8C A;  2VYP A;  4Y1C A;  3MMV A;  2P9P A;  3NMU A;  3BUZ B;  3CCJ N;  1HQE A;  4WCE L;  4M3Z A;  4JI4 K;  3VGL A;  2P9N A;  4BGB A;  2LSN A;  3K58 A;  5AQJ A;  2HF4 A;  1QZ6 A;  1C0U A;  4LF5 K;  3WNE A;  3AGR A;  3VOV A;  4FJI A;  2OPR A;  4B1Z A;  5FPD A;  4DSE A;  3C0B A;  4B08 A;  5GAE P;  1ATR A;  3V9U A;  2KZZ A;  1R59 O;  3C6H A;  4J2D A;  3VQB A;  3D2E A;  5EOY A;  3CJB A;  2YCH A;  4GKK K;  1XHX A;  4KHU A;  4CEC A;  2BH1 A;  3QET A;  3PIP L;  4TSX A;  3ZET B;  5BPL A;  4KHN A;  5GAH P;  4BC2 A;  3EE8 A;  3DLE A;  3AA4 A;  3HT3 A;  5AQO A;  2RKI A;  5CE3 A;  1BI4 B;  5MLC Q;  4ELU A;  3H1Q A;  4EP4 A;  2EHG A;  4RW9 A;  3ZT1 A;  1VSJ A;  1NGI A;  2HMP A;  3BY5 A;  1D4X A;  2ZJQ L;  2DFH A;  5SZT A;  4DR1 K;  4QAG A;  3NFA A;  1NM1 A;  3WXK A;  3MAQ A;  4B1X B;  4BE2 A;  1D9F A;  4RTF D;  4KFB A;  2ASP A;  1TUU A;  1C1B A;  1VSI A;  4G1Q A;  3TAR A;  3DMJ A;  5DK5 A;  1DKG D;  2YHY A;  3P5J A;  1QZ5 A;  3M1F A;  3DLR A;  3AVL A;  4LY7 A;  4LD0 A;  1HJR A;  2FSJ A;  4JKG B;  1TYQ A;  4DU4 A;  1YVU A;  2XY8 A;  2D0A A;  3CCE N;  4V19 S;  2I7N A;  1Q7Y O;  3ENH A;  3TSQ A;  5JIC A;  4ZTF A;  1RDC A;  4MO4 A;  3H46 O;  2JLE A;  1M1K O;  4DR6 K;  1XI1 A;  1JCG A;  2HB5 A;  1BL3 A;  4BE1 A;  3VGK A;  3CXC M;  1VQK N;  3L2W A;  2D4W A;  5AQW A;  3BGR A;  3D6R A;  5J2Q A;  4OKK A;  4BR2 A;  4DR4 K;  2YKN A;  4OX9 K;  1ZBU A;  3CCQ N;  2JWK A;  1VSE A;  1WSG A;  2BUP A;  2KHO A;  4E1M A;  1VHX A;  2YNI A;  3PV8 A;  3T1H K;  3BF1 A;  3TSP A;  4CJ5 A;  3QEV A;  4DFJ A;  3O3F A;  3ZLJ A;  4ISE A;  3NH2 A;  4M42 A;  4CIF A;  3OHR A;  4YHH K;  2WFB A;  2FBY A;  4ELT A;  4DTM A;  2G8V A;  1YIT N;  3CG7 A;  3THW B;  1R0A A;  4KTZ A;  1I3A A;  1TK8 A;  1L5U A;  2B5J A;  1HR0 K;  1WSE A;  3NAE A;  2W6L A;  3HSC A;  2HNZ A;  4O5F A;  3SAG A;  3J7A P;  1SKW A;  2FSN A;  4FLV A;  1D8Y A;  4CJW A;  1RT7 A;  4IFY A;  4BRO A;  4I9L A;  5CYQ A;  3AO2 A;  2NZT A;  3DXM A;  1XNQ K;  4HCC A;  2W42 A;  4E7L A;  5F2R A;  1X3M A;  1XWL A;  4B9N A;  1FK9 A;  4A5B A;  3KLE A;  3AVC A;  4A5A A;  3E66 A;  3H08 A;  3UKR B;  3DRR A;  1ZC6 A;  4B8A B;  3B6P A;  3OBY A;  3T19 A;  2G8U A;  1YJ9 N;  2A42 A;  4BRP A;  3HP9 A;  4BRD A;  3W0L A;  2Q0R A;  3VQC A;  2UUC K;  4DCH A;  1JXE A;  1LW0 A;  3CET A;  1I94 K;  1NKB A;  4JKE A;  4FZY A;  1GLE G;  2HND A;  1RBT A;  1WBB A;  3NF7 A;  3Q7B A;  3DLL L;  4FJG A;  4E7K A;  2OPP A;  1B9D A;  1GLJ O;  4BGA A;  4BQZ A;  2Q36 A;  3CHW A;  1LOT B;  4CJL A;  5AQL A;  4Q5V A;  4CGI A;  2PY5 A;  4DQQ A;  4OPH A;  1KCF A;  1MWK A;  1EXQ A;  4CJF A;  3MN5 A;  4E1N A;  1XC9 A;  2PYJ A;  2HVH A;  1WSF A;  3WNG A;  4CFB A;  3HI0 A;  2IVN A;  3SQ2 A;  2VG7 A;  3D7E O;  4F4K A;  3PSI A;  3QEP A;  2Z1J A;  4DQR A;  2P51 A;  4DSJ A;  2PAV A;  3KD1 E;  5I3U A;  3KLH A;  1E4G T;  2VWK A;  2HHQ A;  3M6G A;  2Z1I A;  2DY4 A;  4DFM A;  3CCM N;  4I6M A;  2A6A A;  2QWM A;  2D0B A;  4BC4 A;  4CF1 A;  4CK3 A;  3HL8 A;  3TAF A;  3DLH A;  3L4Q A;  3QER A;  2GUP A;  5BR8 K;  4IEI A;  1N33 K;  3VF6 A;  3NH0 A;  3ZX0 A;  1DT9 A;  4A62 A;  2ASO A;  1UAX A;  4FM1 A;  5EX5 A;  2E20 A;  1RTH A;  2QK9 A;  4XH5 A;  1WSI A;  3K2P A;  3SI6 A;  4A61 A;  4PKI A;  3LAM A;  5E26 A;  3G71 N;  4M3W A;  4LF9 K;  4CEO A;  1QVF M;  5AQR A;  4E89 A;  1K9M O;  3TAP A;  1JCE A;  4CF2 A;  3CMA N;  4KPY A;  2QI2 A;  3BDP A;  4LSL A;  3EYZ A;  1C6V A;  4KH5 A;  1RT6 A;  5HRN A;  3OYL A;  1HYS A;  5TKW A;  1Q86 O;  1KC8 O;  4CEE A;  1BQN A;  3IUC A;  1BOT O;  1L3V A;  1SAZ A;  4K25 A;  5AZJ A;  4BDP A;  5GIO A;  2DFF A;  4FJ9 A;  3THV A;  4FJM A;  4PHT X;  4CGJ A;  3FLC O;  4EFH A;  1O13 A;  4DV0 K;  1NKC A;  1HKB A;  4MQ3 A;  2OPS A;  3K9J A;  4AHU A;  4E3S A;  2QXL A;  1NGA A;  4N5S A;  3L8B A;  3C95 A;  2A40 A;  1E3M A;  3SQ0 A;  1DGK N;  3KTQ A;  4FM0 A;  1DTQ A;  2WTU A;  1NGJ A;  4AM6 A;  3HJF A;  5M1P A;  4JKC A;  4M3T A;  3UKU B;  4KB1 A;  4E0D A;  2EX3 A;  2UXB K;  4RW7 A;  1K8K A;  3HO1 A;  3O1W A;  4BRH A;  3DXK A;  2HHT A;  1K8A O;  2W6K A;  4DQP A;  4GVE A;  3T1A A;  2QKB A;  1D5A A;  3RSE A;  3O80 A;  4KRF A;  1S22 A;  4FLY A;  4GW6 A;  4FCY A;  2O8B A;  4YOR A;  3IG1 A;  1N36 K;  4KHP K;  4E7J A;  4BRK A;  1JL1 A;  4YOY A;  1T05 A;  1RBV A;  4IKF A;  5LJW A;  1IKW A;  1L3S A;  4IBN A;  3KJV A;  4FJN A;  1QQN A;  2HBK A;  4JHD A;  3VEY A;  3K5O A;  1U45 A;  1T3V A;  3L6Q A;  1NK0 A;  3A2F A;  3ZT4 A;  3O4Q A;  3CF5 L;  4FLX A;  3KWG A;  1BQM A;  1TK0 A;  3CPW M;  5C2D A;  4IWV A;  3IS9 A;  5KQD A;  4IG3 A;  4JI6 K;  3LL3 A;  4C1N I;  4W5O A;  5EVZ A;  4ZHR A;  1KVB A;  3D0P A;  4W5N A;  2FBT A;  2P9S B;  1J5E K;  1BUP A;  3SMS A;  3LPT A;  3RMC A;  1HX1 A;  4CZI A;  1KAY A;  2D5R A;  1GLL O;  1RT4 A;  3SNN A;  3H45 C;  4BDY A;  4NB4 A;  3LAN A;  4BRI A;  4H8K A;  3EL2 A;  4RW4 A;  3RMD A;  3K5L A;  4LSN A;  3ZEU B;  3V1O A;  3ZT2 A;  5BPN A;  3SYZ A;  2XRI A;  4DR3 K;  4CGD A;  2JWL A;  1U2V B;  2YNG A;  4DG1 A;  4CBW A;  4KTW A;  1IG9 A;  3MEC A;  2HHS A;  3AAQ A;  3C65 A;  1RT3 A;  1JLA A;  1S3X A;  4CGG A;  5ELZ A;  3DRP A;  3HVT A;  3MX5 A;  4FVM A;  5AQY A;  1KAZ A;  1YIJ N;  4DTS A;  4DV6 K;  1Z26 A;  4CVN E;  1Q81 O;  4GMJ B;  3ULE A;  2IVP A;  3S41 A;  2I7P A;  2RF2 A;  2XHB A;  3PX6 A;  4WQ4 C;  3MN6 A;  2F8T A;  4HWI A;  4YFU A;  3SV3 A;  4WQ5 C;  2GWJ A;  4HTL A;  3O4N A;  2UXC K;  2IS3 A;  4C23 A;  2F9W A;  4KBO A;  5M1F A;  3FGU A;  1TKD A;  3ZYY X;  4RCH A;  1NGC A;  3DI6 A;  2D1K A;  1QQC A;  3C7N A;  1S1V A;  4BDZ A;  2OYQ A;  1KVC A;  2P9L B;  3H6E A;  3ZSY A;  2G8I A;  4C8K A;  2YJE A;  2D0O A;  4ELV A;  5DM6 L;  4B9M A;  2E1Y A;  3LDP A;  2HMI A;  5C25 A;  4IOA L;  4FWK A;  3G4S N;  4CEF A;  2KFZ A;  3DM2 A;  3TTC A;  5IT9 O;  3VEN A;  3ULD A;  4DTJ A;  2P5O A;  2UUB K;  3OYJ A;  1XC3 A;  3O8M A;  4CJ4 A;  3P1G A;  3O9T A;  4H5T A;  4IO8 A;  1BA0 A;  4CGH A;  1X9J A;  5TKY A;  2J4R A;  1EQY A;  3WNF A;  3FZK A;  3L2Q A;  3RR8 A;  3VF4 A;  1HNI A;  4X64 K;  3QEI A;  3J7Z O;  5FRO A;  3CCL N;  5FRN A;  3CPE A;  3OS0 A;  1T8E A;  2D0C A;  3VN5 A;  2IAJ A;  1NG9 A;  2P9U A;  3E01 A;  1NGH A;  2VG5 A;  3LAL A;  1NK6 A;  2O8F A;  3OS2 A;  2O4I A;  3PUF A;  3BF3 A;  2P9K A;  2E5L K;  1T44 A;  1J9A A;  3AO4 A;  2Z1H A;  2O8C B;  1HKG A;  3MN9 A;  2GTD A;  2NLX A;  5BPM A;  4BE0 A;  3AO5 A;  2NNW A;  4B1V A;  4MFB A;  3LZI A;  4DSK A;  4ILJ A;  3MXM A;  3VGM A;  2DFE A;  1IBM K;  1RFQ A;  3L3V A;  3SV4 A;  4M3U A;  4JI8 K;  4F3T A;  5HBM A;  1XMO K;  4JKH A;  1N34 K;  4FK2 A;  1CXU A;  3KVG A;  2OA8 A;  3OYH A;  4FWO A;  1T6D A;  3C94 A;  1QQO A;  2O8D A;  1NMN A;  4DU1 A;  3HP6 A;  4CJP A;  3QFU A;  1HQU A;  5GAG P;  1VQ5 N;  3QFP A;  3VEX A;  3WXJ A;  4YOV A;  3OYD A;  4NO7 A;  4WFA L;  1FXX A;  4CJR A;  5J2P A;  1U4B A;  4CF9 A;  2CGJ A;  4FWM A;  1JLG A;  1NJW A;  5T7B A;  1IV0 A;  4DTO A;  3HM8 A;  4K41 A;  2PZS A;  1W9H A;  4L3Q A;  1TV6 A;  4DR2 K;  1LAW A;  2VWB A;  3HRG A;  4CJT A;  1S72 N;  1SQK A;  1BCO A;  3D2F B;  3DWL A;  4AQY K;  1U47 A;  5AR0 A;  3K9K A;  2HBL A;  1VAZ A;  5LL6 Z;  3O9U A;  4YNQ A;  4ZTJ A;  4CK2 A;  4H5V A;  1VQP N;  5JLH A;  3A5L C;  4DHY A;  3SPZ A;  3M8S A;  5BR9 A;  3NBP A;  1N6Q A;  4JKF A;  1HNW K;  3CC7 N;  4FPB A;  4W5T A;  3KKS A;  3RRH A;  3U3Y A;  3S3N A;  4OLA A;  2QXF A;  5C0Y A;  1BGX T;  4O8U A;  2XY7 A;  3QNN A;  3IKM A;  5AQP A;  1YTA A;  4X62 K;  2QWR A;  3VPZ A;  5BRE A;  3CM5 A;  5AQH A;  2F8S A;  1UA0 A;  1HUX A;  3V1Q A;  2DTU A;  3NCI A;  1BO5 O;  4FW1 A;  4PWD A;  3ZT3 A;  4JI5 K;  5E84 A;  1DTT A;  2RPI A;  3MED A;  1TL3 A;  3ID8 A;  3F2K A;  2AA4 A;  3TTD A;  2PYL A;  3JXU A;  1KQS M;  5C42 A;  2V7Z A;  5M1Q A;  3KK2 A;  1X3N A;  1NGB A;  3JS6 A;  4NYN A;  1A5X A;  1NK9 A;  4FJ5 A;  1VSM A;  3OYG A;  2A3Z A;  3C6U A;  1IJJ A;  2E6M A;  2I5J A;  5ADX H;  5JVG L;  4LFB K;  1ITG A;  3O1B A;  3KLG A;  3V4I A;  1TKT A;  3PIO L;  4R5P A;  3ZET A;  4WFB L;  2FC0 A;  1NKE A;  3FFI A;  5JVH L;  5M1N A;  5AQM A;  5JMV A;  2NRX A;  3DXM B;  4U7B A;  2NRH A;  3MDQ A;  3G10 A;  1U48 A;  3NVK A;  4F2R A;  3I0R A;  2NRV A;  3TAG A;  3CC2 N;  5FPM A;  2F7T A;  4O0I A;  2ZQB A;  3QIO A;  5KGW A;  2E88 A;  3KIO A;  4KB0 A;  5EY4 A;  3ATV A;  3FZL A;  2GX9 A;  3HPO A;  3J81 O;  1VSH A;  3CJ9 A;  1S1W A;  3HYF A;  4BRA A;  4BRE A;  1X9W A;  5FLX O;  5GAD P;  1IH7 A;  4CZL A;  4LFC K;  4HUE A;  3IFR A;  2Q0U A;  4GKJ K;  3EN9 A;  2F4V K;  4KHS A;  5AQT A;  1MA9 B;  1VQN N;  5KTQ A;  1JLQ A;  4JD2 B;  1RDA A;  1EX4 A;  4YDU A;  4XH4 A;  3SMP A;  4F2S A;  1RT1 A;  4KHQ A;  4ISG A;  2XY5 A;  1ASU A;  1JLC A;  4H5N A;  1C0F A;  1MWM A;  4G9Z A;  4OKJ A;  2HHH K;  3BZK A;  3QIP A;  4H0X B;  4B1W B;  2Q2R A;  2P9I A;  1IKY A;  4U67 L;  1TK5 A;  4PL8 A;  4MDB A;  1JL2 A;  3V6D A;  4KAZ A;  4H0V B;  3PSF A;  5AQN A;  3L2V A;  3GDQ A;  4RW6 A;  2G8F A;  1OKJ A;  4GY2 B;  3EO3 A;  4M7X A;  3CI5 A;  2CGK A;  1NJI O;  5HRP A;  4ISF A;  1A5V A;  3AVF A;  4CCH A;  1P90 A;  3RR7 A;  1CXQ A;  3AA2 A;  3OYN A;  1GOC A;  3U6F A;  4JYA K;  2YX6 A;  4JI1 K;  5EU7 A;  1NK7 A;  4IO9 L;  1YAG A;  1RBS A;  2OCE A;  1SKS A;  3V1R A;  3VQ5 A;  1HNV A;  3MEG A;  4B1Y B;  3A8Y A;  5LY3 A;  4CEA A;  3RVC A;  2BAN A;  3IMX A;  4OGC A;  4BWJ A;  1NGE A;  3MK6 A;  4NYF A;  3VEZ A;  4PL7 A;  1IBL K;  4JK9 A;  4IDK A;  3ATU A;  3FR0 A;  3GL1 A;  1LCU A;  2Y1J A;  1Q8I A;  3U9Z A;  2NRT A;  3RMB A;  4AH9 A;  4Y0W A;  1U49 A;  3VQ4 A;  4FYD A;  1NGD A;  4WE1 A;  2E8A A;  3VEW A;  4FM2 A;  4DV2 K;  3VER A;  5KRT A;  5J2N A;  3EZW A;  3S9H A;  4QCL A;  2QWO A;  1NJZ A;  3VTI A;  4CHN A;  4PKG A;  1W0H A;  1JJ2 M;  4XIU A;  4Z4I A;  1LWC A;  4FW2 A;  4BR0 A;  1FKO A;  4A2A A;  3WT0 A;  1LW2 A;  3HVR A;  1V4T A;  3B8A X;  1X9S A;  4Z0U A;  3LWL A;  4J2E A;  3THX A;  1D9D A;  2KW4 A;  1NJX A;  3IRX A;  1VRT A;  5AQK A;  5DM7 L;  3OYI A;  4W5R A;  5AZJ B;  5ADX A;  1RTD A;  4IOX A;  2G8K A;  4CZE A;  5GIP A;  4AHT A;  1KTQ A;  4H03 B;  1L3T A;  3OVN A;  4CGF A;  2FXU A;  4CHO A;  3J80 O;  4CK1 A;  1VRU A;  1OH6 A;  5LMN K;  1GLB G;  3AVA A;  3HOT A;  4DV7 K;  3TR8 A;  3AVB A;  4CZH A;  3NF6 A;  3MCP A;  2WC9 A;  1ZBS A;  4HUF A;  4KV8 A;  1BG3 A;  1U04 A;  4KH4 A;  4K0K K;  1Q18 A;  3P39 A;  4DFP A;  4QS7 A;  3L4I A;  1QSY A;  3AO3 A;  4EHT A;  3ENB A;  3J7Y P;  2HHX A;  4BR4 A;  4EHU A;  5K14 A;  3DXK B;  4LFA K;  3KKR A;  4FZX C;  1ZBH A;  5KPT A;  3RSE B;  3MX2 A;  2HHU A;  2UXD K;  5HLF A;  1QE1 A;  1BIS A;  4E7I A;  4DSL A;  3CME N;  4DWI A;  3AVJ A;  3G6E N;  1JLB A;  1YI2 N;  3ZSX A;  3WXL A;  2QA4 N;  1YUW A;  4JKB A;  4IEE A;  3CM6 A;  3ZSV A;  4BG8 A;  2WBN A;  2AJQ A;  3SLC A;  3KK3 A;  3T1Y K;  3NGY A;  4IG0 A;  4JHD B;  3B6O A;  1HYZ A;  1BIU A;  4BRM A;  3VQP A;  3GG4 A;  3AO1 A;  5CZ2 A;  3RMA A;  3SJJ A;  1I39 A;  2YV0 X;  1SL1 A;  1WSH A;  4CHZ A;  4BY9 C;  2G8W A;  3CD6 N;  3K5M A;  5BRH A;  4GV3 A;  2FF6 A;  3E9O A;  4DKW A;  3DYA A;  4WQ4 A;  1S9E A;  4Q0B A;  4YOT A;  1WAF A;  4CJU A;  3LP1 A;  5AZI B;  3K57 A;  4FLZ A;  4Z4G A;  4M63 C;  3QES A;  2PBD A;  3AVM A;  3G25 A;  2QEX N;  4E1J A;  3RTV A;  1QSL A;  4ILH A;  3R9P A;  2HNY A;  4FZZ A;  3QEX A;  3R3L A;  1Q9X A;  3AVK A;  4EP5 A;  2RE2 A;  3KK7 A;  4L8R B;  4C1N K;  1KLM A;  3UB5 A;  4M3Y A;  3OYK A;  4UY8 O;  3WNH A;  5C24 A;  3SBT A;  1ZBI A;  4JS4 A;  3L2U A;  1RBR A;  3HM9 A;  4BRC A;  1HPZ A;  1NLV A;  3ISN C;  3ULE B;  4CIE A;  1RBU A;  4C8L A;  2QW9 A;  3ID6 A;  3PY8 A;  1WB9 A;  4CJK A;  1TKZ A;  2YNH A;  1EWQ A;  4OKE A;  1J5O A;  3UKU A;  4K8Z A;  3U4L A;  4FLU A;  1QHA A;  2XO7 A;  4H0O A;  4JKA A;  1MDU B;  4KH6 A;  4DUZ K;  1O1W A;  3FE1 A;  3QNO A;  1ASV A;  3VA3 A;  4ICL A;  2O8E A;  1NGG A;  2HF3 A;  4JI0 K;  4PY5 A;  1C0M A;  2OTL N;  3MXJ A;  3NGI A;  3N4Q A;  3E9L A;  2E6L A;  4BC5 A;  3THY B;  1VQ6 N;  1YVN A;  4DQI A;  4K42 A;  3I0S A;  3DLB A;  1NWK A;  5A2Q O;  3A5N C;  1SUQ A;  1C1A A;  2GUI A;  3QBW A;  5HOO A;  3SBG A;  1GLA G;  4W5Q A;  5CHI A;  2R7Y A;  4CJ7 A;  5AQS A;  1F21 A;  5KGX A;  1WAJ A;  4IOC L;  1RCH A;  4DLG A;  3I8B A;  5E41 A;  2QWL A;  4BRN A;  4B9V A;  3I33 A;  3SUO A;  3RWU A;  5FDL A;  3EZ5 A;  5AQF A;  4UQG A;  1XMQ K;  3AVN A;  2OAN A;  3HK2 A;  4BG9 A;  4DV5 K;  4CF0 A;  3BP8 A;  1YHQ N;  4WF9 L;  1H1V A;  2IOC A;  3VQA A;  2A1R A;  1JCF A;  3ZX2 A;  3I8D A;  3G0Z A;  3VQD A;  4HHT A;  4JEP A;  4FOI A;  4BRQ A;  3O3H A;  3SUP A;  1ATS A;  2HVI A;  2OPQ A;  3VQ8 A;  2O8F B;  2H3G X;  1OH5 A;  3ZEU A;  3O3G A;  1S1U A;  2ETJ A;  3CJA A;  3VQ6 A;  2ZF5 O;  1K73 O;  1J6Z A;  2W41 A;  4DSI A;  1ATN A;  1U2V A;  3CQY A;  4JK7 A;  2FBX A;  3KD5 E;  1S1X A;  1YF5 L;  2KQ2 A;  1ZBL A;  1OVY A;  2GWK A;  4OJR A;  1BCM A;  3VTH A;  4M7Y A;  2VCP A;  5AQG A;  2BDP A;  5IWA K;  2IVO A;  4IFV A;  4B9U A;  1WSJ A;  3SCX A;  3ITH A;  3CIP A;  3CQ8 A;  3PX0 A;  2ZM6 K;  1Q82 O;  3HBT A;  4CJ3 A;  4CD3 A;  1JLF A;  5I9E B;  4LH5 A;  2UU9 K;  4DR5 K;  2QWP A;  4JI2 K;  1N32 K;  5H1S Q;  5BN8 A;  3K0S A;  4RWT A;  2UYT A;  4RW8 A;  2YJF A;  2O8D B;  1IKV A;  5M1O A;  4KO0 A;  3U8X A;  3OYF A;  3WEE A;  1NGF A;  4AHS A;  2P9P B;  3ENO A;  4E19 A;  1WOQ A;  3SQ1 A;  1TUY A;  1JXB A;  2X78 A;  1QVG M;  4OPK A;  3AVI A;  4BR5 A;  4HUG A;  2P9N B;  3S3O A;  2IIR A;  4Y1D A;  4BVO A;  4FK4 A;  5J2M A;  1ESV A;  4DSF A;  3KK1 A;  3LDL A;  4YY3 K;  4CJE A;  3NF8 A;  5C10 A;  4BVP A;  4DTN A;  3HZ6 A;  2V51 B;  3ASM A;  4HCB A;  3F9K A;  2FSK A;  3H3O B;  1A5W A;  3CFP A;  4IFE A;  3OYE A;  3VA0 A;  4YOW A;  3D2E B;  2Y1I A;  3AA3 A;  4NLC A;  5KPR A;  4OO1 J;  1LWE A;  3PO5 A;  4NXN K;  3NF9 A;  2ZD1 A;  3O6W A;  4DV1 K;  4FK0 A;  4AHC A;  1J54 A;  3U3G A;  1NK8 A;  1SV5 A;  4FWR A;  3CCS N;  1W7A A;  3V9W A;  1DLO A;  1TAU A;  2KTQ A;  5KPZ A;  4DTU A;  3EKU A;  4R79 A;  2NRZ A;  1T03 A;  4DB3 A;  2P5G A;  5J1E A;  4JNE A;  3LDN A;  2IDO A;  4H0P A;  3ALY A;  4B9L A;  1RDW X;  2YHX A;  3NVM A;  3EY1 A;  3PX4 A;  4NCA A;  1KXP A;  2YHA A;  4A57 A;  5AQQ A;  4DMN A;  4KKO A;  4N56 A;  1QQM A;  3QML A;  1TYQ B;  4OVL A;  2YI1 A;  4NCG A;  5HRR A;  2YHB A;  2FBV A;  4DQS A;  4JS5 A;  1GLF O;  4NCB A;  4O0J A;  2UUA K;  4FJL A;  4B3M K;  4CJV A;  4FXD A;  1X1P A;  4X65 K;  3WXM B;  1RT5 A;  3EKS A;  2Q31 A;  1JKH A;  4BWM A;  4DU3 A;  1TAQ A;  3O9Q A;  1EET A;  4FLW A;  3A0I X;  4N47 A;  4DLE A;  4DTP A;  4DF4 A;  2Z1G A;  4K43 A;  1BWF O;  3LM2 A;  2JGU A;  4Z4F A;  4CIG A;  5BRF A;  3LZJ A;  3TAQ A;  1NBW A;  3OYA A;  3NHG A;  5CY4 A;  5AQV A;  1BIZ A;  4CJQ A;  5FPE A;  1HJO A;  1J53 A;  3NGZ A;  3QB0 A;  3D2F A;  2KKZ A;  4F3O A;  3P31 A;  4FWP A;  4CES A;  1KRP A;  4AF1 A;  1KAX A;  3BEX A;  2F96 A;  1Y64 A;  3ZCM A;  5SWM A;  1B92 A;  4WYB A;  1FKP A;  1CLQ A;  4MLE A;  2YNF A;  5EXW A;  2ZGZ A;  4O8K A;  1BI4 A;  4J8F A;  2B4J A;  5KI6 A;  3ZSZ A;  1Y97 A;  3FZH A;  3CJ1 A;  3I56 N;  4JKD A;  1G99 A;  3WQT A;  3L0Q A;  4N41 A;  4IXC A;  1SZ2 A;  2Q97 A;  2OZS A;  1IBK K;  4XEI A;  2VWJ A;  1QTM A;  3AVH A;  2O4G A;  4B9T A;  3TU5 A;  2BE2 A;  5LMU K;  1HPM A;  4QOZ B;  2P9I B;  2VG6 A;  3QIC A;  4YOU A;  2DPN A;  4GVM A;  2E2P A;  1GLC G;  2E2N A;  1N5Y A;  2NUB A;  4O4G A;  2KFN A;  4FOE A;  1TKX A;  3TAB A;  4JKG A;  4FJ7 A;  3R8E A;  1KLN A;  1BA1 A;  3LM9 A;  4O44 A;  3AY9 A;  3A5M C;  3M8Q A;  1UA1 A;  3OBW A;  2E4L A;  2VGM A;  4H4M A;  1HLU A;  4N76 A;  2HST A;  4K8X A;  4KI6 A;  4IJN A;  4Z94 A;  4CEZ A;  4PUO A;  4CBX A;  4AM7 A;  4B9S A;  3SAF A;  2QWQ A;  3QDK A;  3DLG A;  4A2B A;  1VSF A;  3VEV A;  5JS2 A;  3T7Z A;  3L2R A;  3UE5 A;  1YJN N;  3M5R A;  3LP2 A;  3DAW A;  4DV3 K;  3MWP A;  1VQL N;  2WOM A;  4BAC A;  1BU6 O;  3VMF B;  5FPN A;  4DQ8 A;  2WUS A;  1C0G A;  3QEW A;  5HRO A;  3HTV A;  3J8A A;  4B3T K;  4LF7 K;  4IZ9 A;  4FWQ A;  3JAM O;  4I6M B;  4I7F A;  3QO9 A;  4JV5 K;  4DV4 K;  3VES A;  1HMV A;  3F5T A;  3THW A;  2QTD A;  3AVG A;  1NOZ A;  2GEM A;  2RN2 A;  4CHQ A;  3CFR A;  4EZ6 A;  4NLB A;  1K6Y A;  3LP0 A;  4ID5 A;  5LJV A;  5F1X A;  3THX B;  3DLK A;  1XNR K;  3GBT A;  2X6S A;  1S1T A;  4CZM A;  4LF4 K;  3VQ7 A;  4CZJ A;  3SQ4 A;  4JI3 K;  4JD2 A;  4AHV A;  1Z6R A;  2FLO A;  3AA5 X;  3GOI A;  2GV9 A;  4CFD A;  3LWM A;  3SK3 A;  1VSL A;  4Z4E A;  1NNE A;  1CZ9 A;  2QKK A;  3UKR A;  4EIA A;  4IJA A;  3QIN A;  3TTF A;  4YOX A;  3CCR N;  1P8Z A;  3OYC A;  1OH7 A;  1KFS A;  4CED A;  3WXI A;  4DS5 A;  3TSU A;  4JN4 A;  4CI6 A;  4CW7 B;  3QBX A;  3CJC A;  4FWS A;  3O9R A;  3TPQ A;  1TGO A;  2X74 A;  1QHT A;  3AV9 A;  1RTJ A;  4HTU A;  1VQ8 N;  1ZBF A;  3OY9 A;  3F9M A;  3CYM A;  4BR9 A;  3WUH A;  4PQU A;  3MN7 A;  3P83 D;  2NRR A;  3KLI A;  3JYT A;  3FFK B;  3P38 A;  4KI4 A;  3V9S A;  4H5W A;  3R6M A;  1B9F A;  4O5B A;  3OS1 A;  3CJ7 A;  1LV5 A;  3U9D A;  4YDU C;  2YHW A;  4CF8 A;  4XH1 A;  2ASM A;  3W3D A;  2E2Q A;  3ZSO A;  2CH5 A;  3OJU A;  2HW3 A;  1RDU A;  4B8C A;  3O5B A;  3LAK A;  1W2B M;  2V52 B;  4F8R A;  3L3U A;  1VQ7 N;  5AQX A;  1C1C A;  5HRS A;  4KTQ A;  1K8K B;  4H0Y B;  3KWI A;  2HBJ A;  3K59 A;  4B9Q A;  2QM1 A;  4I2Q A;  5B8H A;  1KSP A;  4M3R A;  3OJS A;  5CZ1 A;  1VQO N;  3SUN A;  4GNI A;  1N8R O;  4M3X A;  4JRP A;  1T6C A;  4HVJ A;  2O8B B;  3SPY A;  3OTO K;  2ZWH A;  1KFD A;  2HHW A;  4B1U B;  5DMR A;  3QLH A;  4Z4H A;  4F9O A;  3VF2 A;  2A41 A;  4OLB A;  4CER A;  3F73 A;  1IO2 A;  2E1Z A;  3RRG A;  4NXM K;  2WON A;  4FWL A;  4Z4C A;  4FL9 A;  1ZXO A;  3AAR A;  5I42 A;  3GE1 A;  3HST B;  3ZSW A;  4FWN A;  4CFC A;  3O08 A;  4BR7 A;  4X66 K;  1DEJ A;  3JSM A;  3VET A;  4C8M A;  2PFU A;  3OA9 A;  2ZJP L;  1ILY A;  5AQZ A;  3H3N O;  2B6A A;  3DJC A;  2HHV A;  1ASW A;  1TVR A;  4WQ5 A;  3CFO A;  3V9X A;  1XHZ A;  1SL2 A;  3ZX3 A;  4PKH A;  3SZ2 A;  1KVA A;  3VQE A;  1VSK A;  2YKM A;  1HKC A;  4EZ9 A;  3HPH A;  3CCV N;  2G8H A;  4QS8 A;  2IC3 A;  1S6Q A;  3KHY A;  3V81 A;  4CBU A;  4CD1 A;  3P4I A;  1WBD A;  2O8E B;  2P1J A;  4ILG B;  2HOE A;  3HXM A;  2AP1 A;  2ITM A;  1E4F T;  3DOL A;  1VK0 A;  1HYV A;  2A1S A;  2W40 A;  1YT3 A;  1WLJ A;  1CZA N;  2EWS A;  4DS4 A;  4DFK A;  1NJY A;  3NDK A;  3T3F A;  1MU2 A;  3WQU A;  3AAP A;  5AFU H;  4EAH D;  2VQE K;  4DR7 K;  4DTX A;  4BRL A;  1RNH A;  4KRE A;  1NU0 A;  2VGN A;  4LF8 K;  4MDA A;  1TL1 A;  3E1Y A;  4JLH A;  4IDH A;  3V9Z A;  4BC3 A;  1EP4 A;  2RHK A;  3VQQ A;  3SAH A;  2BTF A;  4CHY A;  1OVQ A;  1FW6 A;  2ATQ A;  1S6P A;  2OTJ N;  3LDO A;  4M41 A;  1SKR A;  1RDB A;  3KLF A;  1RIL A;  4WFN L;  4FSV A;  3FZF A;  4FJH A;  3MEE A;  4OPJ A;  4PA1 A;  3C7N B;  1HNZ K;  1HNX K;  1VQ4 N;  2Q3S A;  1WN7 A;  4CHP A;  3I55 N;  1HRH A;  4AHR A;  5AZI A;  3LDQ A;  3CCU N;  3HOS A;  5BN9 A;  5AQU A;  5HP1 A;  1VQM N;  5FRM A;  4E7H A;  4FPA A;  1VQ9 N;  1W97 L;  3AGK A;  4B3S K;  3CQX A;  4LC9 B;  1QS4 A;  4M45 A;  3NE6 A;  4J2B A;  2A5X A;  4FLT A;  4CZK A;  3TAN A;  1QSS A;  5C2F A;  1EO1 A;  4RG8 A;  5AQI A;  4I2P A;  3M8P A;  3CER A;  2P9S A;  5JLF A;  3LDS A;  4KHW A;  3ZSQ A;  4FVU A;  1RDD A;  3C6A A;  1IKX A;  5BRD A;  4FJK A;  1S9G A;  3ZT0 A;  2NRW A;  3EE9 A;  2P9U B;  1KD1 O;  3N4P A;  4J2A A;  2F9T A;  4C8N A;  4MO5 A;  1JLE A;  4FJJ A;  1Q9Y A;  4AIL C;  4H4O A;  3T69 A;  2P9K B; 
#chains in the Genus database with same CATH homology
 4NCG A;  4MQ3 A;  5HRR A;  1JL2 A;  2FBV A;  2YHB A;  2OPS A;  1C0T A;  4JS5 A;  4AHU A;  4DQS A;  5CYM A;  4E3S A;  3V6D A;  1NOY A;  4N5S A;  3L8B A;  1EKE A;  4KAZ A;  3L2V A;  3C95 A;  4NCB A;  3PO4 A;  4O0J A;  4RW6 A;  2G8F A;  3SQ0 A;  4FJL A;  3KTQ A;  4FM0 A;  1DTQ A;  3K5N A;  4CJV A;  4I9Q A;  4FXD A;  1X1P A;  1UWB A;  4DF8 A;  3HJF A;  4B3O A;  5HRP A;  3S3M A;  1YTU A;  3OYM A;  4M3T A;  4KB1 A;  4E0D A;  1A5V A;  3LP3 A;  1RT5 A;  3OYB A;  2EX3 A;  3AVF A;  4CCH A;  4DU3 A;  1JKH A;  4BWM A;  3RR7 A;  4RW7 A;  1CXQ A;  3AA2 A;  3OYN A;  1GOC A;  3U6F A;  1NK4 A;  1TAQ A;  3HO1 A;  5JS1 A;  4CE9 A;  2HHT A;  4DQP A;  3D45 A;  5EU7 A;  1EET A;  1NK7 A;  3T1A A;  4FLW A;  2QKB A;  1T7P A;  2BGG A;  4N47 A;  1RBS A;  4DLE A;  1D5A A;  4DTP A;  4DF4 A;  1SKS A;  4FJ8 A;  3V1R A;  3VQ5 A;  1HNV A;  2OZM A;  2Z1G A;  3MEG A;  2X6N A;  5KRS A;  2ZE2 A;  4CEA A;  3TWH A;  3ZSR A;  2JGU A;  4KRF A;  2BAN A;  4FLY A;  4Z4F A;  4GW6 A;  4FCY A;  4OGC A;  4CIG A;  4BWJ A;  4NYF A;  1RT2 A;  3LZJ A;  1SL0 A;  3IG1 A;  3TAQ A;  4IDK A;  1UOC A;  3OYA A;  4E7J A;  3NHG A;  2Y1J A;  3SUQ A;  1JL1 A;  1Q8I A;  5CY4 A;  1BIZ A;  4CJQ A;  1T05 A;  1RBV A;  4IKF A;  1J53 A;  3NGZ A;  4KHY A;  3RMB A;  1L3U A;  4AH9 A;  3DRS A;  1IKW A;  4F3O A;  1L3S A;  4IBN A;  3KJV A;  1GOB A;  3TAE A;  3VQ4 A;  1U49 A;  4FJN A;  4FYD A;  4WE1 A;  3K5O A;  1U45 A;  1NK0 A;  3A2F A;  3ZT4 A;  4CES A;  4FM2 A;  1KRP A;  1VSD A;  3O4Q A;  1LWF A;  2GBZ A;  2ITG A;  2F96 A;  5KRT A;  5D3G A;  5J2N A;  4FLX A;  4QCL A;  1BQM A;  3ZCM A;  4CEQ A;  3S9H A;  1REV A;  1TK0 A;  5SWM A;  1NJZ A;  4FJX A;  1B92 A;  4CHN A;  3IS9 A;  1FKP A;  1W0H A;  4IG3 A;  4OGE A;  2XY6 A;  1CLQ A;  4XIU A;  2YNF A;  4W5O A;  1LAV A;  4ZHR A;  1KVB A;  4CJS A;  3D0P A;  4W5N A;  4Z4I A;  1LWC A;  2FBT A;  1BI4 A;  3NH1 A;  4FW2 A;  3TI0 A;  2B4J A;  1FKO A;  3LPT A;  5KI6 A;  3VQ9 A;  1S5J A;  4JRQ A;  1LW2 A;  3ZSZ A;  1Y97 A;  3RMC A;  3HVR A;  2D5R A;  1X9S A;  1NK5 A;  2IGI A;  4Z0U A;  3LWL A;  4J2E A;  1G15 A;  1GOA A;  1RT4 A;  3SNN A;  1D9D A;  2KW4 A;  1NJX A;  4N41 A;  2OZS A;  3IRX A;  4BDY A;  1VRT A;  1X9M A;  3LAN A;  3TAM A;  3OYI A;  4W5R A;  3M8R A;  1Z25 A;  4H8K A;  1RTD A;  2VWJ A;  3HPG A;  2G8K A;  1QTM A;  3IAY A;  3AVH A;  2O4G A;  4RW4 A;  1RTI A;  4CEB A;  3LPU A;  4AHT A;  3RMD A;  2BE2 A;  1KTQ A;  3K5L A;  4QOZ B;  2VG6 A;  4LSN A;  1L3T A;  3OVN A;  4GVM A;  4CGF A;  4O55 A;  3V1O A;  4CHO A;  4CK1 A;  3ZT2 A;  1VRU A;  4CFA A;  3SYZ A;  4LH4 A;  3MXI A;  2XRI A;  4DTR A;  3AVA A;  2NUB A;  4CGD A;  1N5Y A;  1WNS A;  1BHL A;  2YNG A;  4O4G A;  3TR8 A;  3DOK A;  4DG1 A;  2KFN A;  1TKX A;  3C6T A;  3AVB A;  3UIQ A;  4KTW A;  1IG9 A;  3MEC A;  3NF6 A;  2HHS A;  3TAB A;  4ID1 A;  4FJ7 A;  1RT3 A;  1JLA A;  4KV8 A;  4CGG A;  1U04 A;  4HUF A;  1KLN A;  4C8O A;  3DRP A;  1CZB A;  3HVT A;  4FVM A;  4O44 A;  4DTS A;  4DFP A;  1Z26 A;  3M8Q A;  4Y1C A;  1UA1 A;  1QSY A;  2E4L A;  4GMJ B;  4H4M A;  3AO3 A;  4N76 A;  2HHX A;  4K8X A;  5K14 A;  1HQE A;  4KI6 A;  2RF2 A;  2XHB A;  3PX6 A;  3KKR A;  4M3Z A;  4CEZ A;  4FZX C;  4PUO A;  1ZBH A;  2F8T A;  2LSN A;  4YFU A;  3K58 A;  3SV3 A;  2HHU A;  4B9S A;  5HLF A;  1QE1 A;  1BIS A;  4E7I A;  3O4N A;  1C0U A;  4DSL A;  4DWI A;  3AVJ A;  3WNE A;  2IS3 A;  1JLB A;  3DLG A;  1VSF A;  3ZSX A;  4FJI A;  2OPR A;  5JS2 A;  1TKD A;  3L2R A;  4DSE A;  3CM6 A;  3ZSV A;  4B08 A;  3DI6 A;  1QQC A;  3LP2 A;  2AJQ A;  3V9U A;  1S1V A;  3KK3 A;  4BDZ A;  2KZZ A;  2OYQ A;  3NGY A;  2WOM A;  1KVC A;  4IG0 A;  4BAC A;  3B6O A;  3ZSY A;  2G8I A;  4J2D A;  3VQB A;  1HYZ A;  1BIU A;  4C8K A;  3QEW A;  5HRO A;  4ELV A;  3VQP A;  1XHX A;  4KHU A;  4CEC A;  3AO1 A;  3QET A;  4B9M A;  4TSX A;  2HMI A;  5C25 A;  5CZ2 A;  3RMA A;  3SJJ A;  1D8Y A;  4B9T A;  1I39 A;  2YV0 X;  4KHN A;  3DLE A;  3AA4 A;  1SL1 A;  3HT3 A;  4I7F A;  1WSH A;  3QO9 A;  4CHZ A;  2G8W A;  1HMV A;  2RKI A;  4CEF A;  2KFZ A;  3AVG A;  1NOZ A;  2RN2 A;  4CHQ A;  3K5M A;  1BI4 B;  3DM2 A;  3CFR A;  4ELU A;  4EZ6 A;  4EP4 A;  2EHG A;  4RW9 A;  3ZT1 A;  3ULD A;  4DTJ A;  2P5O A;  1VSJ A;  1K6Y A;  3LP0 A;  3DYA A;  4ID5 A;  3OYJ A;  4CJ4 A;  3P1G A;  3DLK A;  2DFH A;  1S9E A;  4Q0B A;  5SZT A;  2X6S A;  4QAG A;  3NFA A;  4CGH A;  1WAF A;  4CJU A;  3LP1 A;  3MAQ A;  1S1T A;  3K57 A;  4FLZ A;  4Z4G A;  3VQ7 A;  3QES A;  3AVM A;  3WNF A;  4BE2 A;  3SQ4 A;  3L2Q A;  4AHV A;  1D9F A;  3RTV A;  3RR8 A;  3AA5 X;  1QSL A;  1HNI A;  2GV9 A;  4KFB A;  4CFD A;  2HNY A;  3LWM A;  3QEI A;  5FRO A;  1C1B A;  1VSI A;  4G1Q A;  3TAR A;  5FRN A;  4FZZ A;  1VSL A;  3DMJ A;  3OS0 A;  3QEX A;  1CZ9 A;  1T8E A;  1Q9X A;  2D0C A;  3AVK A;  5DK5 A;  3VN5 A;  2IAJ A;  4EP5 A;  3P5J A;  3E01 A;  2VG5 A;  2QKK A;  4L8R B;  3LAL A;  1KLM A;  3QIN A;  3DLR A;  3AVL A;  4M3Y A;  4LY7 A;  4LD0 A;  1HJR A;  3OYC A;  3OYK A;  1KFS A;  3WNH A;  4CED A;  1NK6 A;  5C24 A;  3OS2 A;  4JS4 A;  4DS5 A;  1ZBI A;  3L2U A;  2O4I A;  3PUF A;  4DU4 A;  1YVU A;  2XY8 A;  1J9A A;  3AO4 A;  2Z1H A;  2D0A A;  1RBR A;  3HM9 A;  1TGO A;  1HPZ A;  2X74 A;  1QHT A;  3ISN C;  3AV9 A;  1RBU A;  1RTJ A;  4CIE A;  4HTU A;  4C8L A;  3PY8 A;  4ZTF A;  1RDC A;  1ZBF A;  4BE0 A;  3OY9 A;  3AO5 A;  3CYM A;  4PQU A;  4CJK A;  2JLE A;  1TKZ A;  2YNH A;  3P83 D;  3KLI A;  4MFB A;  3LZI A;  4OKE A;  1XI1 A;  3JYT A;  1J5O A;  4K8Z A;  4KI4 A;  2HB5 A;  4FLU A;  1BL3 A;  3V9S A;  4DSK A;  2XO7 A;  4BE1 A;  1B9F A;  4O5B A;  3MXM A;  2DFE A;  3L2W A;  3OS1 A;  3BGR A;  5J2Q A;  4OKK A;  3L3V A;  1LV5 A;  3SV4 A;  1O1W A;  4M3U A;  2YKN A;  4F3T A;  1ZBU A;  5HBM A;  1ASV A;  3QNO A;  4CF8 A;  1VSE A;  1WSG A;  4E1M A;  3VA3 A;  4ICL A;  2YNI A;  3PV8 A;  4PY5 A;  4CJ5 A;  3QEV A;  1C0M A;  3ZSO A;  4DFJ A;  3O3F A;  3OJU A;  1CXU A;  4FK2 A;  3MXJ A;  3OYH A;  3NGI A;  2OA8 A;  2HW3 A;  3C94 A;  4B8C A;  3NH2 A;  2E6L A;  3LAK A;  4DQI A;  4F8R A;  3L3U A;  4DU1 A;  3HP6 A;  4CJP A;  4M42 A;  1HQU A;  3I0S A;  1C1C A;  3DLB A;  4CIF A;  5HRS A;  4KTQ A;  2FBY A;  3OYD A;  4ELT A;  4DTM A;  2G8V A;  1SUQ A;  3CG7 A;  1FXX A;  4CJR A;  1C1A A;  1R0A A;  4KTZ A;  1I3A A;  2GUI A;  3K59 A;  2B5J A;  5J2P A;  4CF9 A;  1U4B A;  1TK8 A;  1WSE A;  3NAE A;  4I2Q A;  1KSP A;  4W5Q A;  2R7Y A;  4M3R A;  3OJS A;  1JLG A;  1NJW A;  5CZ1 A;  5T7B A;  1F21 A;  4DTO A;  3SUN A;  2HNZ A;  5KGX A;  1WAJ A;  4M3X A;  1RCH A;  4DLG A;  4FLV A;  5E41 A;  1W9H A;  1RT7 A;  4IFY A;  4CJW A;  4HVJ A;  4JRP A;  3SUO A;  2PZS A;  3SPY A;  4B9V A;  1TV6 A;  3RWU A;  4I9L A;  1KFD A;  5FDL A;  3EZ5 A;  2HHW A;  4UQG A;  5CYQ A;  1LAW A;  3AO2 A;  3AVN A;  5DMR A;  3QLH A;  4Z4H A;  3HK2 A;  4CJT A;  2W42 A;  4E7L A;  4HCC A;  1BCO A;  4OLB A;  4CF0 A;  4Z4E A;  4CER A;  1XWL A;  3F73 A;  4B9N A;  1FK9 A;  1IO2 A;  1U47 A;  2IOC A;  3RRG A;  3KLE A;  2WON A;  3VQA A;  3AVC A;  2A1R A;  4Z4C A;  4YNQ A;  3I8D A;  3G0Z A;  3H08 A;  3VQD A;  4HHT A;  3DRR A;  5I42 A;  3HST B;  3ZSW A;  4B8A B;  4ZTJ A;  3O3H A;  3B6P A;  4CK2 A;  3T19 A;  4CFC A;  2G8U A;  3SUP A;  2HVI A;  2OPQ A;  3VQ8 A;  3JSM A;  3SPZ A;  4C8M A;  3M8S A;  3O3G A;  1S1U A;  2ETJ A;  3HP9 A;  3VQ6 A;  3NBP A;  1N6Q A;  3VQC A;  4DSI A;  4W5T A;  3KKS A;  2FBX A;  3RRH A;  2B6A A;  1JXE A;  3KD5 E;  1S1X A;  2KQ2 A;  1ASW A;  1LW0 A;  2HHV A;  3U3Y A;  3S3N A;  4OLA A;  2QXF A;  1NKB A;  1ZBL A;  1TVR A;  4FZY A;  1BGX T;  2HND A;  1RBT A;  3CFO A;  3NF7 A;  3V9X A;  3QNN A;  4OJR A;  2XY7 A;  1XHZ A;  1BCM A;  1SL2 A;  3SZ2 A;  1KVA A;  1YTA A;  3VQE A;  4FJG A;  1VSK A;  2YKM A;  2BDP A;  1SKW A;  4EZ9 A;  4E7K A;  3CM5 A;  3HPH A;  4IFV A;  2OPP A;  1UA0 A;  4B9U A;  3V1Q A;  1WSJ A;  2F8S A;  3SCX A;  2DTU A;  3NCI A;  1B9D A;  2G8H A;  2IC3 A;  4FW1 A;  4PWD A;  3ITH A;  1S6Q A;  3ZT3 A;  3CQ8 A;  3V81 A;  4CJL A;  3PX0 A;  1DTT A;  4Q5V A;  4CGI A;  2PY5 A;  2RPI A;  4CJ3 A;  3MED A;  1TL3 A;  1JLF A;  2P1J A;  4LH5 A;  4DQQ A;  1KCF A;  1EXQ A;  4CJF A;  2PYL A;  4E1N A;  1XC9 A;  2PYJ A;  3HXM A;  4RW8 A;  2HVH A;  1WSF A;  1IKV A;  4KO0 A;  3WNG A;  4CFB A;  3DOL A;  1VK0 A;  1HYV A;  5C42 A;  2A1S A;  3OYF A;  1YT3 A;  1WLJ A;  3SQ2 A;  2VG7 A;  4DS4 A;  4AHS A;  3KK2 A;  4F4K A;  4DFK A;  1NJY A;  3NDK A;  4E19 A;  3T3F A;  3QEP A;  1TK5 A;  3SQ1 A;  1MU2 A;  2Z1J A;  4DQR A;  2P51 A;  4DSJ A;  4NYN A;  1A5X A;  1NK9 A;  4FJ5 A;  1JXB A;  2X78 A;  1VSM A;  3OYG A;  4DTX A;  3C6U A;  2E6M A;  2I5J A;  1RNH A;  4OPK A;  3AVI A;  4HUG A;  3KD1 E;  4KRE A;  3S3O A;  5I3U A;  1ITG A;  4Y1D A;  3KLG A;  1TL1 A;  1TKT A;  3KLH A;  2VWK A;  4R5P A;  3V4I A;  4FK4 A;  2Z1I A;  2HHQ A;  2DY4 A;  5J2M A;  4JLH A;  4DFM A;  2FC0 A;  1NKE A;  3FFI A;  3V9Z A;  4DSF A;  3KK1 A;  1EP4 A;  3VQQ A;  4CJE A;  4CHY A;  2D0B A;  2ATQ A;  1S6P A;  3NF8 A;  4M41 A;  4CF1 A;  1SKR A;  1RDB A;  4CK3 A;  3HL8 A;  3KLF A;  1RIL A;  3TAF A;  4DTN A;  4FJH A;  3MEE A;  4OPJ A;  3DLH A;  3QER A;  4PA1 A;  3ASM A;  4HCB A;  1U48 A;  3F9K A;  3G10 A;  1A5W A;  3CFP A;  2Q3S A;  1WN7 A;  4F2R A;  3I0R A;  4CHP A;  3TAG A;  3OYE A;  1HRH A;  4AHR A;  3NH0 A;  3VA0 A;  4O0I A;  2ZQB A;  1ZYQ A;  2Y1I A;  5HP1 A;  3AA3 A;  1UAX A;  4FM1 A;  3QIO A;  5KGW A;  2KZM A;  3KIO A;  5FRM A;  1LWE A;  4E7H A;  4KB0 A;  3PO5 A;  3NF9 A;  1RTH A;  2ZD1 A;  2QK9 A;  1WSI A;  3K2P A;  4FK0 A;  4AHC A;  3SI6 A;  3HPO A;  1J54 A;  3LAM A;  3U3G A;  1NK8 A;  1SV5 A;  1VSH A;  1QS4 A;  4M3W A;  1S1W A;  3HYF A;  4M45 A;  4CEO A;  3NE6 A;  1X9W A;  4J2B A;  4E89 A;  4FLT A;  3V9W A;  1IH7 A;  3TAP A;  3TAN A;  4CF2 A;  1DLO A;  1TAU A;  4KPY A;  2KTQ A;  1QSS A;  4HUE A;  3BDP A;  4RG8 A;  4LSL A;  4DTU A;  4I2P A;  3M8P A;  3EYZ A;  1C6V A;  1T03 A;  2P5G A;  4KHS A;  1RT6 A;  5J1E A;  4KHW A;  5KTQ A;  5HRN A;  1JLQ A;  3ZSQ A;  3OYL A;  1RDD A;  3LDS A;  1HYS A;  1RDA A;  1IKX A;  1EX4 A;  2IDO A;  4CEE A;  1BQN A;  3ALY A;  4B9L A;  4FJK A;  1S9G A;  3ZT0 A;  4F2S A;  1RT1 A;  4KHQ A;  1L3V A;  2XY5 A;  1ASU A;  1JLC A;  3EY1 A;  1L5U A;  3PX4 A;  4BDP A;  4NCA A;  2DFF A;  4OKJ A;  2YHA A;  3QIP A;  4J2A A;  4FJ9 A;  4C8N A;  4DMN A;  3THV A;  4KKO A;  1JLE A;  4N56 A;  1IKY A;  1Q9Y A;  4FJJ A;  4FJM A;  4CGJ A;  4OVL A;  4AIL C;  4H4O A;  1NKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...