1BI4A

Catalytic domain of hiv-1 integrase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 42
structure length 142
sequence length 152
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bi4A00
3JYTA 3E01A 3THVA 3VN5A 2XY6A 3KK3A 3F73A 1Z25A 2IAJA 1WAFA 4FW1A 1TK5A 4FK2A 3RR8A 1J54A 2KZMA 3AVMA 4C8KA 4Z4FA 3L8BA 4BDYA 3VQ9A 4FZXC 1BI4A 1T03A 5CZ2A 3PY8A 4DG1A 2FBYA 4F4KA 2RKIA 3ZT4A 4FZYA 4C8MA 4W5QA 1KRPA 1RDBA 1RT2A 3TI0A 1SKWA 3A2FA 3DLEA 4CJKA 2G8UA 5DK5A 3QEWA 3VQEA 2QKBA 3HJFA 2IS3A 4OKKA 4FLTA 3C95A 4OLBA 1S1UA 2HHTA 3NFAA 3VQ7A 1U47A 1JLGA 2G8FA 1TGOA 4B9TA 3OS1A 1JKHA 3RMAA 1BIZA 3C94A 3CFRA 4IFYA 1RDAA 4CGIA 3NCIA 1IKVA 5HBMA 3DLHA 4FJ8A 2GBZA 4H4OA 4HTUA 5EU7A 2OPQA 5HRNA 4W5TA 4JS5A 1K6YA 2DFHA 3VQ5A 4KI4A 3OJUA 4DFKA 3LP0A 1IKXA 3AVAA 4YFUA 3OYHA 4HUGA 1NJZA 4Z4IA 3QERA 1W0HA 3D0PA 4M3XA 1C1BA 1EKEA 2FBVA 1KFSA 3KD1E 1YTAA 3L3UA 3P1GA 3AVKA 2HMIA 4DTJA 4Z0UA 1BISA 4UQGA 2O4GA 4Y1DA 4KHUA 1C1AA 3CYMA 4CHOA 1RILA 1GOAA 2HHUA 2OA8A 1S1WA 2G8HA 3ZSVA 1NK6A 1SV5A 1ZBHA 1VRTA 2ZQBA 1IO2A 1JLEA 3DYAA 2QXFA 1VSEA 2A1SA 2OPPA 4DTNA 1J53A 2GUIA 3LP3A 4Q5VA 2XHBA 3ZSRA 1S1XA 3KTQA 4CGJA 2YNIA 1X9WA 4M45A 4DU4A 3OYFA 3I8DA 1BI4B 1YT3A 4AILC 3NH0A 4N41A 1D9DA 2HHQA 1DLOA 4Z4HA 1SUQA 2F8SA 3KLHA 1JXBA 2D0CA 2BANA 3HP6A 3V1QA 3DI6A 1B9DA 1QTMA 5E41A 4CJUA 4CERA 4CFAA 4HUFA 4PWDA 4M41A 1HQUA 4JRQA 1LW2A 4CJ5A 4CJ4A 4HUEA 3SCXA 4CE9A 3NH1A 2P5OA 1RBTA 1UWBA 3SQ1A 1DTTA 4GW6A 3PO5A 4FZZA 4CIGA 1A5VA 1QQCA 3PX4A 3K59A 4AHVA 3AA3A 4FJ5A 3T19A 5KI6A 4FW2A 1RTJA 1WAJA 2E6MA 3BGRA 4CJTA 4KHWA 4QCLA 1NKEA 3ZSXA 1QSYA 5CYMA 3ZT2A 4CECA 3TAFA 3TAQA 4W5RA 4KHSA 2DTUA 3K5LA 4CJWA 1KFDA 3HT3A 1LV5A 4FLXA 3AO5A 4AHCA 1X9SA 4ELUA 2VG6A 1RT6A 2P51A 4KO0A 3P83D 5JS2A 5KRSA 3HK2A 1TKXA 3D45A 4EP4A 2KTQA 3V9WA 3SV4A 1T8EA 4FK0A 3RTVA 1NJWA 4AHRA 3TAEA 1WSIA 3HP9A 3VQ4A 2PY5A 4CGDA 2D5RA 3O3HA 1A5XA 4FVMA 3OYNA 3SUQA 1KSPA 4B9MA 4DQPA 1FK9A 4PA1A 1RTHA 2EX3A 1CZBA 1O1WA 3U3GA 4CEQA 3JSMA 3MEEA 3TARA 2RPIA 4B3OA 4E1NA 4OJRA 3LALA 1RBUA 1NK8A 1FKOA 3HPGA 1U45A 4KAZA 4DF8A 1RCHA 4DSFA 3AVLA 2XO7A 3RRHA 4N5SA 4QOZB 1VSKA 3SQ2A 3SPYA 2DFEA 2F96A 4O0IA 5J2MA 5I42A 3WNGA 4DTPA 3BDPA 1KVBA 3OYEA 3VQCA 1Q8IA 3ZSZA 4E0DA 3PX6A 3ASMA 1LW0A 4AH9A 1XI1A 4FJ9A 4IDKA 4I9QA 3IRXA 5SZTA 1T7PA 1WSHA 2G8WA 1S1TA 3RMBA 4O55A 3OYIA 4B9LA 3U3YA 4J2AA 4E7KA 1VSHA 3KLIA 4LY7A 3ZCMA 1Q9YA 2VWKA 1U49A 1KVAA 3AVCA 1U48A 3NDKA 4FXDA 3DOLA 3MEGA 2I5JA 4J2EA 3C6UA 4E7HA 3WNFA 4FM2A 3MECA 4H8KA 4LSLA 4DS5A 1UA1A 4E1MA 1RBRA 3AV9A 4KB0A 5HP1A 3O3GA 1TL3A 5FDLA 1NK9A 1TKTA 3CM5A 3P5JA 5CY4A 3T1AA 1BHLA 1I3AA 3OYJA 3MAQA 1DTQA 1W9HA 4H4MA 1C0UA 3T3FA 3U6FA 1N5YA 5KGWA 4J2DA 3V1RA 1S9GA 4CF2A 3DLGA 2X74A 1NJXA 3QETA 1WNSA 4B9VA 1BCMA 4BE2A 3SUNA 1HPZA 3HO1A 3RMDA 4QAGA 3V9XA 4M3WA 1J5OA 1WLJA 2YNFA 2OZSA 1RTDA 4IG0A 1RTIA 4XIUA 1RT1A 3LWLA 1U4BA 4CESA 3QEXA 3SUPA 4NCBA 3ALYA 1JXEA 2R7YA 4AHUA 4I2QA 3DRRA 2JLEA 3HYFA 4OVLA 4AHSA 4CEOA 1SKRA 3AVHA 3FFIA 4RW6A 3DLKA 4DMNA 3S3OA 1C6VA 4EZ9A 2XY7A 4DSEA 3LP2A 3TANA 4KPYA 4KV8A 4FJJA 1HJRA 3DLBA 4FJGA 2FC0A 1UAXA 1ZBFA 4CFDA 4DQIA 3TWHA 4C8LA 2HNDA 1VSLA 3KLEA 3IS9A 1RDCA 2GV9A 1HNVA 4WE1A 1JLAA 3OYDA 3SQ0A 1IG9A 4CJPA 2F8TA 1Z26A 4KTQA 4FLUA 1C0TA 2D0AA 4Z4CA 3HVRA 4F3OA 3M8SA 2G8IA 1KVCA 1L3TA 2OPRA 4CEBA 3OYBA 3DRSA 4CK1A 4E89A 4YNQA 1REVA 3OYLA 1JLFA 1RT3A 2Z1HA 1VSFA 4I2PA 3S3NA 5HLFA 4N47A 2HNYA 4CIEA 3OS2A 4IBNA 4C8OA 4OKJA 4W5NA 4CJSA 2IC3A 3AA2A 2KW4A 4KHQA 1TAUA 4CHPA 2DY4A 3ZT1A 5DMRA 4L8RB 2YNGA 2KFZA 4O4GA 3SNNA 3AO1A 1WN7A 5KTQA 1XC9A 4FJNA 1HYZA 4DTXA 4DLEA 4DLGA 2Z1JA 4CGFA 3KJVA 1L3UA 3TABA 3VQBA 3DM2A 2PZSA 3IAYA 3WNHA 3OS0A 4CHZA 4KKOA 1CZ9A 4PQUA 4DFJA 3HPOA 2RF2A 1JLQA 1U04A 1QS4A 1ZBLA 2HVIA 1TK0A 2YNHA 4ELTA 3LAKA 4HHTA 3AO2A 1TL1A 1QSSA 2KZZA 4KTZA 4CJLA 4ELVA 3ZSYA 1FXXA 4B8AB 3L3VA 3CQ8A 3QNOA 5J2NA 1TKDA 4DSJA 1JL1A 3LPUA 3MEDA 4RW8A 1D9FA 3V9UA 4OLAA 1UA0A 2WOMA 2HHXA 1BGXT 1QE1A 4ICLA 4O5BA 3V4IA 2XY5A 1QHTA 1IKWA 3V1OA 4CJVA 4DWIA 2B4JA 4CEDA 1IKYA 1BQMA 3HM9A 4LD0A 1KCFA 4DFMA 4FJIA 4Z4EA 3I0RA 4LSNA 5HROA 4DQRA 3LZJA 4B9UA 4EZ6A 3VQDA 3RWUA 3V9SA 3SV3A 2E4LA 1UOCA 3K5OA 3OVNA 4ID1A 3F9KA 4CEAA 1L5UA 3LWMA 4F2RA 2BE2A 4PUOA 1HNIA 2P5GA 4KHYA 2BDPA 4Z4GA 1GOBA 4OPKA 3HPHA 5C42A 3VQAA 4JRPA 1C0MA 3NGZA 3CFOA 2ITGA 3EY1A 1YVUA 1X9MA 1VSDA 2KQ2A 2HHSA 2HW3A 4KI6A 4O0JA 3V6DA 1LWFA 2A1RA 1SL1A 3V81A 4CHYA 4KB1A 1S6QA 3TAPA 3AA4A 4B9SA 4CJEA 3B6PA 1TKZA 4GVMA 5CZ1A 1S9EA 1RT4A 3OYKA 1BIUA 4Q0BA 3NF7A 2O4IA 3K5MA 4NYNA 1XHZA 3NH2A 4FJ7A 3CM6A 4CHQA 3OYCA 5FRMA 3AO4A 3M8PA 2E6LA 3RR7A 1JLBA 2IOCA 1RBVA 3HSTB 1ASVA 4JLHA 3VQPA 4CGHA 4DSKA 4FJXA 4KRFA 3HL8A 1ASWA 1NK4A 3HVTA 4KFBA 2YHAA 3WNEA 1B9FA 5T7BA 4M3ZA 1A5WA 1J9AA 3SYZA 3MXMA 2WONA 4LH5A 1VSJA 2ZD1A 3ZSQA 4KREA 1HYVA 1ZBUA 4HCCA 3AVBA 1LWEA 2IDOA 3DOKA 3DRPA 4M3UA 4F2SA 4CJQA 1HYSA 4K8ZA 3NHGA 1EXQA 1C1CA 1JLCA 4B8CA 3HXMA 2X6SA 1NOYA 4CFCA 2OYQA 3ULDA 1EP4A 3KKSA 4PY5A 2FBTA 4CHNA 1JL2A 3NAEA 2BGGA 1KLNA 3NBPA 3LPTA 4DTSA 3I0SA 2VG5A 3AO3A 3PO4A 3MXJA 3O4QA 2JGUA 1WSJA 3G10A 4FM1A 4E7IA 4FLYA 3RMCA 3UIQA 4K8XA 3G0ZA 1MU2A 2W42A 1VSMA 4FJKA 1EETA 4CEEA 1X1PA 3PV8A 2XY8A 2EHGA 1NJYA 3AA5X 1N6QA 3ZSOA 3KK2A 2QKKA 4B9NA 1NKCA 3NGYA 4KTWA 3SI6A 4MQ3A 2YKMA 3L2RA 4OGCA 3B6OA 2XRIA 3KKRA 3H08A 3AVJA 3PUFA 3SJJA 2HHVA 4I7FA 1WSEA 4C8NA 1F21A 5HRRA 2ZE2A 4RW4A 3NF9A 2YV0X 4CF8A 4E7JA 4FLVA 1LAWA 3VQQA 5C24A 4CJRA 3CFPA 2Z1GA 3O3FA 5HRSA 4CF9A 1NK7A 2FBXA 1TK8A 4IKFA 1HQEA 3LANA 2D0BA 3O4NA 4CEFA 1BL3A 3MXIA 4FLWA 3NGIA 3RRGA 2YKNA 1RBSA 4E19A 5KRTA 3OYMA 1HRHA 2G8VA 1EX4A 1QSLA 3AVNA 4JS4A 1S6PA 4DTUA 5FRNA 3SUOA 4FCYA 2QK9A 3QO9A 4ZHRA 3QIPA 3QLHA 1S5JA 1GOCA 2VG7A 3TAGA 4O44A 3V9ZA 4AHTA 3NF8A 1D8YA 4CJ3A 1TV6A 5HRPA 4DFPA 1XWLA 2X78A 3M8RA 1IH7A 1VK0A 3M8QA 4NCAA 1WSGA 2OPSA 1G15A 1B92A 3TAMA 3VA3A 3L2WA 3VA0A 4DTOA 4NCGA 4M3YA 1XHXA 2IGIA 3NF6A 4G1QA 2NUBA 5K14A 4CK2A 3KIOA 5J2PA 5I3UA 2PYJA 4FJLA 3TR8A 3LAMA 5KGXA 3OJSA 1YTUA 3AVGA 4DQQA 1VSIA 3QEPA 2Q3SA 4FYDA 1KTQA 4HVJA 4Y1CA 4FJHA 4OKEA 2PYLA 4DF4A 3LDSA 4CJFA 1LAVA 3NE6A 4BE0A 3S9HA 2AJQA 4DSIA 3ZSWA 4RG8A 2YHBA 3PX0A 1ASUA 4M42A 5JS1A 3EYZA 1RT7A 3L2UA 3AVFA 4RW9A 4F3TA 2ATQA 3DMJA 3QINA 4CFBA 4FM0A 4FJMA 1FKPA 4F8RA 1LWCA 2ETJA 4DTMA 3QNNA 1SL0A 3K57A 1NOZA 4DU3A 3S3MA 4BWJA 5SWMA 4BE1A 1CXQA 2LSNA 4DSLA 4E3SA 4J2BA 1CXUA 1SL2A 3K58A 3QEIA 5J1EA 3ZT3A 3LP1A 4HCBA 2Z1IA 4DU1A 2RN2A 4R5PA 1L3VA 4FK4A 2HHWA 3SZ2A 1NK0A 3L2VA 4N76A 4ZTFA 4OGEA 3KLFA 5FROA 1RDDA 4RW7A 1KLMA 3ZT0A 1S1VA 4B08A 2Y1IA 1Y97A 1SKSA 1Q9XA 4DS4A 2B6AA 4I9LA 4ID5A 3LZIA 1BQNA 4FLZA 1ITGA 3SQ4A 3C6TA 1D5AA 3QIOA 4CF1A 3KK1A 5J2QA 1RNHA 4W5OA 2VWJA 1RT5A 1L3SA 1ZYQA 4CGGA 1HMVA 4LH4A 4CF0A 3AVIA 3IG1A 3K5NA 1NK5A 3CG7A 4CCHA 5C25A 3KD5E 3EZ5A 4CEZA 1TAQA 4BWMA 4CK3A 2P1JA 4E7LA 2OZMA 3QESA 1T05A 2B5JA 3SPZA 1VRUA 1BCOA 3OYAA 3OYGA 4MFBA 2G8KA 3K2PA 4BDPA 4N56A 3L2QA 3ITHA 5CYQA 4ZTJA 2HVHA 4M3TA 4EP5A 4BDZA 3VQ8A 2HNZA 4TSXA 4OPJA 2HB5A 3VQ6A 1NKBA 3DLRA 4NYFA 3QEVA 1I39A 4DQSA 1CLQA 1TVRA 2X6NA 1ZBIA 4CIFA 3KLGA 3OY9A 4IG3A 1WSFA 4BACA 2Y1JA 1R0AA 5D3GA 4M3RA 4IFVA 4DTRA 4GMJB 2KFNA 3ISNC 2DFFA 4KHNA
chains in the Genus database with same CATH superfamily
2WTUA 4DV2K 1YVNA 2XY6A 1Z25A 5AFUA 5LY3A 1BWFO 3THWB 3P4IA 3GL1A 4C8KA 4BDYA 2P9KB 4Z94A 3ATUA 4DG1A 1Q81O 5IT9O 1RDBA 1SKWA 1VHXA 2HBJA 5BREA 2IS3A 1BA0A 4FLTA 2HHTA 3NFAA 5AQWA 4C1NI 1JLGA 4NLCA 2G8FA 5A2QO 3OS1A 1OH6A 1JKHA 3C94A 1RDAA 1HNXK 3CCVN 2GBZA 1YJNN 5AQKA 3IFRA 4CZIA 4WQ4C 4HWIA 4AQYK 1IKXA 4DV3K 4HUGA 3HOSA 3D0PA 3CJ7A 1C1BA 3JS6A 3L3UA 4FWSA 5ELZA 4Z0UA 2KKZA 1S1WA 1VRTA 2ZQBA 1X3MA 4GKJK 1J53A 2V7ZA 4PKGA 3CMAN 4GV6A 3ZSRA 4MLHA 1S1XA 4CGJA 1X9WA 3HBTA 4YOWA 4DU4A 3MWPA 1IBLK 4BC5A 3V1QA 4BRAA 1QTMA 3FZHA 3F9MA 4PWDA 4CJ5A 2QXLA 2HOEA 1RBTA 1S3XA 5AQGA 4GW6A 3PO5A 4XH4A 4XH1A 3GE1A 4CIGA 1A5VA 3PX4A 3AA3A 4CZHA 4FW2A 4CJTA 4CZEA 3WEEB 1QSYA 2HMPA 1HKGA 1VQPN 1WBBA 3HT3A 4LF5K 3CQXA 2WC9A 4IOXA 5KRSA 3HK2A 1TKXA 4EP4A 3TAEA 1BDGA 4H5WA 2NRVA 1KSPA 3O3HA 4FVMA 2HHHK 3CI5A 2GEMA 3O08A 3D2FA 4JEPA 4PA1A 1CZBA 1O1WA 3PSFA 4BG9A 5I9EB 5JLHA 1FKOA 2XO7A 1VSKA 3BP8A 3SPYA 2E88A 3WNGA 5LMNK 4GVEA 3BDPA 1K8KA 1IBKK 3ZSZA 3PX6A 3ASMA 4V19S 4AH9A 4FJ9A 2JWKA 4IJAA 3ID8A 5JVHL 1GLEG 4J2AA 5BR8K 4E7KA 1KVAA 3DOLA 4JKGA 3C6UA 1GLJO 1VQ5N 1YHQN 1EO1A 1UA1A 4IEEA 3CPWM 4H4MA 1N5YA 2P9IA 3O80A 4CF2A 1WNSA 4DV6K 4B9VA 3SUNA 1HPZA 1J5OA 1E4GT 5GAHP 3QEXA 3WXMB 4JV5K 1KQSM 3CJ9A 1NM1A 4I2QA 3HYFA 4AHSA 4JKDA 1VQKN 3DLKA 2XY7A 2NLXA 1H1VA 1ZBFA 3PSIA 2HNDA 1DT9A 1RDCA 2GV9A 4WE1A 3OYDA 3SQ0A 4DR4K 2YJFA 1Z26A 4KTQA 2G8IA 2D0AA 1TUYA 3W0LA 2PBDA 3OYBA 4YNQA 4B1ZA 2V51B 3E9PA 1JLFA 3A5MC 2F9WA 3OS2A 4CIEA 4JKEA 2Q31A 4JHDA 4CJSA 2IC3A 3AA2A 2KW4A 5DMRA 2YNGA 1LCUA 4O4GA 1WN7A 1HYZA 4DLGA 2Z1JA 3VQBA 3DM2A 2A40A 3IAYA 3VEXA 3EL2A 3E1YA 3U8XA 2RF2A 1U04A 1QS4A 2KZZA 3VF4A 4KTZA 3CQ8A 1T3VA 4BRNA 4DV4K 4ICLA 2ZM6K 1NMDA 1SZ2A 3O9TA 2XY5A 3QFUA 4BR5A 4DWIA 3HM9A 5C2FA 4DQRA 4BQZA 1Q86O 5C12A 5AQMA 3M3ZA 3V9SA 2E4LA 3OVNA 1W7AA 3MN7A 2GELA 1L5UA 3M1FA 2VGMA 2BDPA 3HPHA 5C42A 4DV0K 3VQAA 1XNQK 2NRWA 3CFOA 2ITGA 1X9MA 2HW3A 2YI1A 2A3ZA 4O0JA 3LDOA 1S6QA 3FE1A 3AA4A 3KZBA 4B9SA 4GVMA 1S9EA 4Y0WA 3OYKA 3CJAA 1U2VB 3K5MA 3OBWA 3VF6A 4DR6K 4CHQA 4H5TA 3ZEUA 5FRMA 4BR7A 3M8PA 2E6LA 2P9PA 2YHYA 4JLHA 1G99A 1IV0A 1NK4A 3WNEA 1B9FA 3C6AA 3D2EA 3L4QA 4JI0K 1ZBUA 3G6EN 3DRPA 2WUSA 5AQIA 3VEWA 4K8ZA 2KLAA 3NHGA 3VTIA 3R9PA 2X6SA 1OH8A 1NOYA 5BPNA 3ULDA 1EP4A 3NBPA 3I0SA 1HNWK 3PO4A 3EEQA 4JI6K 4E7IA 3G10A 4FM1A 3UIQA 4JD2B 3G0ZA 1MU2A 2W42A 1N34K 1EETA 3J7AP 2XY8A 2ZJRL 3ZSOA 3KK2A 3H46O 1NKCA 3NGYA 5EXWA 4CZJA 3B6OA 3H08A 4I7FA 1WSEA 4C8NA 4MDBA 2BUPA 3VGMA 1VQ6N 3NF9A 2YV0X 4E7JA 4FWLA 4FLVA 3DXMB 2P9LA 3VQQA 4CJRA 3CFPA 4CBWA 3O3FA 5BRFA 4IKFA 1HQEA 4CEFA 2D0BA 4DUZK 4BY9C 1ZBSA 2YKNA 1RBSA 5KRTA 3M5RA 5C15A 1EX4A 1QSLA 1XQSC 1S6PA 5LMUK 3SUOA 1RFQA 4DB3A 3QBWA 4FWPA 1D8YA 4CJ3A 1TV6A 2QWPA 5LJVA 1XWLA 1IH7A 1VK0A 2E1ZA 4A57A 1WSGA 3OW2M 5M1OA 3VA0A 2IVNA 3F2KA 2PYJA 2I7NA 3TR8A 3PIOL 3OJSA 3FZLA 3BEXA 4BGAA 1NGJA 3CQYA 4FYDA 2FF6A 4Y1CA 3LDSA 1LAVA 3DXKA 2YHBA 1RT7A 4WF9L 2ATQA 3KWGA 3QINA 4FM0A 4F8RA 1LWCA 3QNNA 4LF6K 4DU3A 4BE1A 5SWMA 1CXQA 4IZ9A 2Z1IA 1L3VA 2HHWA 4YOTA 3WXKA 1NK0A 3VGLA 4ZTFA 4OGEA 5FROA 1KLMA 2B6AA 1HUXA 3LZIA 3C6TA 4CF1A 1LOTB 2VWJA 2Q2RA 1L3SA 4CGGA 3K5NA 3CG7A 3EZ5A 1ATRA 1NGEA 4CK3A 4E7LA 2OZMA 1SAZA 4QS7A 3QESA 2B5JA 3OYGA 3OYAA 4BDPA 3K2PA 3SAHA 3L2QA 4CD3A 4BDZA 4AF1A 2HNZA 4OPJA 1NWKA 4NXNK 1NKBA 3QEVA 1I39A 4LFBK 5AQQA 4CIFA 3OY9A 4BACA 1R0AA 4M3RA 4JNEA 2KHOA 3ULEA 4R79A 5AQOA 3E01A 5AZIA 3THVA 3VTHA 2YJEA 4A59A 1TK5A 3RR8A 5BPMA 4Z4FA 4FZXC 3VQ9A 3PY8A 2DPNA 2FBYA 3OA9A 1RT2A 3TI0A 3O1WA 2NNWA 2QKBA 1MWKA 2VYPA 4OKKA 4OLBA 1S1UA 4ISGA 2ZGZA 3VQ7A 2QWOA 4O8KA 2P9SA 1U47A 1TGOA 4B9TA 4O5FA 4IFYA 4CGIA 1IKVA 3THXA 3DLHA 2O8CB 4H4OA 4JKFA 3BUZB 4JKCA 4W5TA 2QM1A 1HJOA 3HM8A 4KI4A 4DFKA 3LP0A 4PKIA 2CGKA 4K25A 4LF4K 4YFUA 1NJZA 4Z4IA 2D0OA 1W0HA 1EKEA 3VEZA 3KD1E 1YTAA 2OANA 3AVKA 4DTJA 4KHUA 1C1AA 3CYMA 2HHUA 2OA8A 3ZSVA 4IOAL 1KAXA 5KPRA 3AGRA 2QXFA 2A1SA 4B1XB 4DTNA 2XHBA 3KTQA 4M45A 2ZWHA 4H5RA 3I8DA 1BI4B 3CXCM 1YT3A 1ATNA 4YOUA 4B9QA 1YXQA 4HTLA 1D9DA 3CF5L 3TSPA 4Z4HA 2QWQA 3GDQA 4FWMA 2QWLA 3KLHA 3EO3A 4YHHK 1B9DA 3H3NO 4CERA 1FW6A 3FZFA 1HQUA 4M41A 4CJ4A 4CZLA 3NH1A 4WCEL 3HOTA 3SQ1A 1DTTA 1K73O 4FZZA 1OKJA 1NGGA 4JKHA 1RTJA 3BGRA 4KHWA 1NKEA 2O8DA 4CECA 3J7ZO 2O8BA 4GV9A 4KHSA 1LV5A 4FLXA 1X9SA 2VG6A 4DV7K 4KO0A 5JS2A 3P83D 3TTFA 4H5VA 1NJWA 1TUUA 3VMFB 1JCFA 3SUQA 4ISFA 4B9MA 1FK9A 2OZSA 3U3GA 3T1HK 1M1KO 1ILYA 2E20A 4KAZA 1U45A 3MDQA 4JI1K 3AAPA 4N5SA 3NMUA 4QOZB 4O0IA 4DTPA 1KVBA 3OYEA 1Q8IA 4E0DA 5KQ8A 5GAEP 4IDKA 1T7PA 3WXJA 5TKWA 3P38A 2D1KA 1VSHA 2VWKA 3AVCA 3NDKA 3MEGA 2I5JA 4J2EA 5JMVA 4BRIA 3BY5A 1NGDA 1VQON 4LSLA 2FF3B 4E1JA 4E1MA 4M63C 4EHTA 1TKTA 2GX9A 3CM5A 5CY4A 4FJKA 1DTQA 1W9HA 2Q1NA 3T3FA 5KGWA 3V1RA 5EY4A 2X74A 3LM9A 3QETA 1XMOK 4JK8A 2YNFA 1RTDA 4IG0A 3Q7BA 4RWTA 2V52B 3SUPA 5AFUH 3AVHA 3FFIA 3CETA 3K0SA 3S3OA 1C6VA 3C6HA 4I6MB 5LL6Z 4DSEA 3LP2A 4KPYA 3DLBA 4FJGA 2FC0A 3VEYA 2F7TA 4X65K 1BUPA 3KLEA 3IS9A 1HNVA 1P90A 3O6WA 4FPBA 5AQSA 4EIAA 4CEBA 4CK1A 3KWIA 1REVA 5BRDA 3LDQA 2Z1HA 5BN9A 1GLFO 2P9PB 4N47A 4H0OA 4W5NA 1VQMN 1GLAG 2UU9K 4KHQA 2O8FA 5AQUA 1XNRK 3ZT1A 4CBUA 2WFBA 4DV1K 5KTQA 2A42A 4DR5K 1XC9A 4DLEA 4CGFA 2FSNA 2NRRA 2J4RA 4CHZA 1CZ9A 4AM6A 3HPOA 3CCLN 3D6RA 2YNHA 3LAKA 1QSSA 4CJLA 3THYA 1XMQK 4ELVA 1FXXA 4B8AB 5J2NA 3R8EA 4JK9A 1JL1A 3MEDA 3V9UA 4OLAA 1UA0A 1OH7A 4DCHA 1S72N 1JCEA 2H3GX 3V4IA 3V1OA 4CEDA 1NBWA 1IKYA 1SQKA 4FJIA 1KCFA 4BGBA 4DFMA 3I0RA 2Q0RA 4C1NK 5AJ3K 3VQDA 2QWNA 4BC3A 3SV3A 1UOCA 4B1UB 4CEAA 3OBYA 2BE2A 1KAZA 1KD1O 2P5GA 4JRPA 3NGZA 2UXBK 4KBOA 3EY1A 3WQTA 3MN6A 1MDUB 2HHSA 2D4WA 5ADXH 3ZETB 4CW7B 1SL1A 1LWFA 4B1VA 4JN4A 4CHYA 3V81A 5CZ1A 1GLBG 3H3OB 1BIUA 4Q0BA 3NF7A 3AO4A 1RBVA 4FJXA 1ASVA 4CGHA 3VQPA 4DSKA 3HVTA 2YHAA 4BR9A 5M1FA 2WONA 4LH5A 1VSJA 4WFNL 4JI5K 3DOKA 4M3UA 4X62K 4CJQA 1HYSA 2FSKA 1EXQA 1C1CA 4KH4A 4B8CA 4PKHA 4CFCA 1IBMK 4PY5A 3KKSA 5BPLA 4IFEA 4CHNA 3NAEA 4KH6A 5AZJA 1KLNA 2VG5A 3AO3A 4ILGB 2JGUA 1HX1A 1NGIA 3RMCA 1RGIA 1J5EK 4LFAK 1VSMA 4CEEA 3PV8A 2EHGA 1N6QA 5E84A 2QKKA 4B9NA 1ZXOA 4KTWA 4MQ3A 2ASOA 4OGCA 3L2RA 4O8UA 1C0GA 2OCEA 3KKRA 3PUFA 1QZ5A 2HHVA 2A6AA 5HRRA 2ZE2A 4RW4A 2D0PA 5AQYA 2Z1GA 2P9NA 1TK8A 2UUAK 5JVGL 3LANA 1BL3A 4NLBA 4K43A 4FLWA 3NGIA 1HRHA 2QTDA 1X3NA 2IVOA 4IXCA 4FCYA 4LF8K 5B8HA 4ZHRA 1S5JA 2E1YA 3CCEN 4DUYK 3V9ZA 5HRPA 5AZIB 3M8RA 2OPSA 1G15A 3VA3A 3L2WA 3FZKA 4NCGA 3H45C 5K14A 4CK2A 5I3UA 1S22A 1T6CA 4FJLA 1YTUA 3CJ1A 5FPEA 1KTQA 4HVJA 2UXDK 4OKEA 4DF4A 4WFBL 3NE6A 1YJ9N 4DHYA 4DSIA 3PX0A 5JS1A 3EYZA 3L2UA 3CC2N 3DMJA 1FKPA 4DKWA 2ETJA 3O9SA 5TKYA 2WBNA 3DWLA 4FO0A 2P9KA 1CXUA 3K58A 3QEIA 3ZT3A 4MO4A 4DU1A 2NZTA 3SZ2A 4CZFA 1O13A 3L2VA 4RW7A 1N32K 4CBXA 4FLZA 1RNHA 4W5OA 4MLEA 1ZYQA 4LH4A 4CF0A 1KC8O 3CMEN 5GIOA 4B3TK 4CCHA 3H6EA 3KD5E 4DR7K 1TAQA 2QWRA 4A2BA 3SPZA 1VRUA 2G8KA 5GADP 4OO1J 5FLXO 3ENBA 3MMVA 4N56A 2HVHA 3RSEB 2W40A 3PIPL 3VQ6A 3DLRA 4AM7A 2X6NA 3VENA 4FWKA 1ZBIA 3J8AA 4IG3A 2KFNA 2Y1JA 3ISNC 2DFFA 1ATSA 2CH5A 2CGJA 4IOCL 3VN5A 4FK2A 4FW1A 3AVMA 2QI2A 1T03A 3HRGA 3QFPA 4F4KA 1OVQA 3QMLA 2RKIA 4C8MA 4W5QA 2Q97A 1KRPA 3A2FA 3LDPA 4XEIA 3CCMN 5DK5A 2Q36A 3QEWA 3HJFA 1NMNA 4FSVA 1QQNA 3D7EO 1BIZA 4YDUA 3NCIA 1P8ZA 5HBMA 5EU7A 2OPQA 1Q7YO 4JS5A 2DFHA 3ENHA 3PLAA 3MCAB 3OJUA 3AVAA 3OYHA 3WEEA 3P39A 3QERA 2FBVA 1KFSA 1BU6O 3P1GA 4BG8A 3J80O 3K9JA 2O4GA 4M7XA 4Y1DA 4CZGA 5DM6L 4IO8A 1YF5L 4CHOA 4UQGA 2G8HA 3VOVA 1NK6A 1SV5A 1M90O 3U4LA 3UKUB 1IO2A 3MN9A 1VSEA 3LDLA 3LP3A 2GUIA 4Q5VA 2YNIA 5HOOA 3CJBA 4CJ7A 3J7YP 3N4QA 4JKBA 4AILC 3NH0A 4N41A 4M7YA 1JXBA 2D0CA 2BANA 3HP6A 1WUAA 3DI6A 5E41A 1W2BM 3CPEA 4CJUA 4IO9L 4HUEA 3SCXA 4YY3K 2P5OA 1UWBA 2UUBK 1BO5O 2UUCK 2EWSA 1Z6RA 1QQCA 4AHVA 3T19A 5KI6A 2E6MA 1WAJA 3P31A 3T69A 3ZSXA 3ZT2A 4ILHA 3TAFA 3TAQA 4W5RA 1VQ8N 2DTUA 3K5LA 4CJWA 1KFDA 4DQ8A 3AO5A 3NVMA 4AHCA 1RT6A 2P51A 5AR0A 2KTQA 3FFKB 3EN9A 3SV4A 3VEVA 3RTVA 1WSIA 2PY5A 4H0TB 4B3SK 2D5RA 3J81O 3TARA 1RTHA 2EX3A 4A62A 4CEQA 4B3OA 4E1NA 4OJRA 3LALA 1RBUA 1NK8A 3HPGA 3BF3A 4DSFA 1NG9A 3AVLA 3RRHA 3SQ2A 2DFEA 2F96A 5J2MA 4ISEA 2GTDA 2O8FB 4I9QA 3IRXA 5SZTA 4BR0A 3KVGA 3RMBA 1HKCA 2P9UA 3OYIA 3KLIA 3ZCMA 1Q9YA 4K42A 1EWRA 1EWQA 4YORA 2FXUA 5IWAK 4B3MK 3WNFA 2ZJQL 4FM2A 3THYB 4H8KA 4OPHA 4BRHA 5M1KA 5HP1A 1TL3A 1NK9A 1HNZK 3O8MA 3P5JA 1Q82O 1FJGK 3BF1A 4GKKK 1C0UA 2FSJA 2PFUA 1YITN 2AP1A 3DLGA 1NJXA 4LF7K 5EOYA 5AQVA 4BE2A 3VETA 3RMDA 2F4VK 4QAGA 3V9XA 4M3WA 5FPNA 1WLJA 1RTIA 1RT1A 3ALYA 3C0BA 1JXEA 3D2FB 5C0YA 1NGBA 2JLEA 4OVLA 3WXIA 4CEOA 4H5NA 4DMNA 4EZ9A 4A2AA 1YI2N 3F5TA 2IIRA 4FJJA 3RVCA 1UAXA 3FR0A 3L4IA 1K8KB 4CFDA 4DQIA 3TWHA 4C8LA 1VSLA 1JLAA 5MLCQ 1IG9A 2F8TA 4CJPA 4C23A 4F3OA 4Z4CA 3M8SA 1KVCA 4MO5A 4E89A 3SMPA 1RT3A 4JKGB 3UE5A 3S3NA 4BRQA 1QVFM 1TAUA 5AQTA 1DEJA 4J8FA 3SNNA 2KFZA 2UYTA 2P9IB 4BRCA 1L3UA 3TABA 1U2VA 1HR0K 2VQFK 2NRXA 3OS0A 4KKOA 1YAGA 5AQFA 4PQUA 1ZBLA 2HVIA 3E9OA 1RDWX 1TK0A 2GWKA 1TL1A 2E2QA 1TKDA 4DSJA 3LPUA 4BQLA 2HHXA 1BGXT 4O5BA 3ZLJA 1HKBA 1IKWA 3KK7A 4CJVA 2B4JA 2CGLA 3UKRA 4LD0A 3VF2A 4A5BA 4Z4EA 4LSNA 4B9UA 4EZ6A 4BRFA 4ID1A 3F9KA 3ZX0A 3LWMA 4PUOA 1HNIA 4KHYA 4Z4GA 2E2OA 2ASPA 1GOBA 4OPKA 3JXUA 1C0MA 3HSCA 2PAVA 4JHDB 1YVUA 4WQ5A 2QWMA 1NGHA 3V6DA 3TAPA 4CJEA 3B6PA 1TKZA 1RT4A 4DV5K 4CI6A 4BRDA 2HBLA 4FWNA 3KHYA 5C2DA 2O4IA 3DXMA 4NYNA 1XHZA 4BVOA 3OYCA 3RR7A 1JLBA 2IOCA 3HSTB 4FWOA 3HL8A 1QQOA 3ZX3A 3B8AX 1A5WA 1J9AA 2F9TA 3SYZA 3MXMA 4KREA 2JWLA 4HCCA 3AVBA 1LWEA 2IDOA 1BG3A 3HZ6A 2QW9A 4F2SA 4FOIA 2HBKA 1JLCA 3GOIA 4K41A 2VWBA 3SAFA 1YJWN 3SMSA 2OYQA 2FBTA 2BGGA 4DTSA 1WBDA 3C7NA 3O4QA 4K8XA 2YCHA 1NJYA 3UB5A 3SI6A 4LC9B 2YKMA 3GBTA 2XRIA 3AVJA 2E2NA 2NRHA 2Q0UA 1F21A 4X64K 5E26A 4CF8A 1LAWA 3MK6A 2NRTA 4B1YB 5HRSA 3ZEUB 2FBXA 5AQJA 3VPZA 2VGNA 4YDUC 5FPMA 3AVNA 4NXMK 3VEOA 3O4WA 3QO9A 5F2RA 5JICA 1GOCA 3D2EB 4O44A 2UXCK 3NF8A 4BR2A 4OX9K 2X78A 4NCAA 4DR1K 1B92A 1NNEA 1HLUA 4M3YA 1XHXA 3N4PA 3NF6A 2NUBA 5J2PA 3AAQA 4BVPA 5KGXA 3LAMA 1XC3A 3HI0A 1TYQA 4DQQA 1VSIA 1NGAA 3QEPA 2Q3SA 3E66A 1HPMA 2W41A 4FJHA 1MA9B 4CJFA 3S9HA 2AJQA 3L6QA 3ZSWA 4M42A 4RW9A 3TTCA 4F3TA 4UY8O 1T6DA 2BTFA 4LFCK 3U9ZA 1SL0A 3K57A 1NOZA 3S3MA 4BWJA 4J2BA 2LSNA 2YX6A 2O8EA 3LP1A 4HCBA 2RN2A 4IWVA 2P9LB 5ADXA 5HL7L 1RDDA 2Y1IA 3ZT0A 1SKSA 1S1VA 4DS4A 4JAXA 3AY9A 5DM7L 3SQ4A 3QIOA 5J2QA 3KK1A 2O8CA 1HMVA 3AVIA 1NK5A 1QHAA 3S41A 4CEZA 4BWMA 3WUHA 4IEIA 1T05A 2GUPA 4MFBA 3LDNA 4BROA 3CCUN 3OTOK 2YHXA 3VQ8A 3ENOA 4TSXA 4IDHA 2HB5A 3LL3A 4NYFA 3E9LA 1CLQA 3DXKB 1WSFA 5D3GA 4DTRA 4U7BA 4GMJB 1VAZA 4CVNE 5AQPA 4YOXA 3JYTA 1VQNN 3A5NC 3CD6N 3KK3A 3F73A 2IAJA 4BRKA 1WAFA 4CZKA 4PL8A 1J54A 4H0PA 2KZMA 3L8BA 1BI4A 5CZ2A 3ZT4A 1JCGA 4FZYA 4EFHA 3I33A 3DJCA 4JI2K 4PHTX 3DLEA 4CJKA 2G8UA 1N33K 3O5BA 3VQEA 4NO7A 4BR4A 3EKSA 2HSTA 3QB0A 3U9DA 3C95A 3MCPA 3RMAA 3AARA 3CFRA 3I55N 4FJ8A 5GIPA 4HTUA 3O9RA 5HRNA 1K6YA 3VQ5A 1NJIO 4KHPK 1MWMA 4CZMA 4FWQA 4QS9A 4M3XA 4YOVA 2CH6A 2HMIA 1BISA 1RILA 1GOAA 1ZBHA 3SAGA 1IJJA 4H0YB 4H0VB 3IKMA 1JLEA 3DYAA 3ULEB 3H1QA 1QQMA 2OPPA 2P9UB 3ID6A 1NLVA 1YIJN 5CE3A 3VESA 4JI4K 3OYFA 5H1SQ 3CHWA 2HHQA 3SJHA 1DLOA 1SUQA 2F8SA 3BZCA 1KXPA 3CCJN 4MDAA 4CFAA 4HUFA 1OH5A 5AQNA 2P9SB 1NGCA 1LW2A 4JRQA 5FPDA 5AQHA 3JAMO 4F9OA 3MWTA 4CE9A 1Z05A 3THXB 3R3LA 3THWA 3K59A 4FJ5A 3H1VX 4H0XB 4BRGA 5JLFA 4QCLA 1K9MO 5CYMA 4XH5A 1VQLN 5M1NA 4ELUA 2W6LA 3D45A 3V9WA 2I7PA 1T8EA 4FK0A 4AHRA 3HP9A 3VQ4A 3IDHA 5AQXA 4CGDA 3OYNA 1JJ2M 1A5XA 4DQPA 3C65A 4GV3A 3O1BA 1ESVA 5KPTA 3JSMA 3DAWA 3MEEA 2RPIA 2ASMA 4I6MA 4DF8A 1RCHA 3MN5A 4GY2B 2HF3A 3SBTA 5I42A 1Q18A 3VQCA 3CCQN 1LW0A 1XI1A 5KPZA 1ZC6A 1WSHA 4DR2K 2G8WA 1S1TA 1C0FA 5BR9A 3TU5A 4O55A 1DGKN 4B9LA 3U3YA 2OTLN 5F1XA 4LY7A 1U49A 3R6MA 3TTDA 1U48A 4BRPA 4FXDA 5CHIA 1GLDG 3MX5A 4WQ5C 2E8AA 5M1PA 4E7HA 2A41A 4WQ4A 2RHKA 3MECA 1QZ6A 4DS5A 5BRHA 1RBRA 3AV9A 4KB0A 1VQ7N 3O3GA 2O8DB 4LF9K 5FDLA 1EQYA 2O8BB 4OPAA 3OYJA 3T1AA 3MAQA 1BHLA 1I3AA 3U6FA 4J2DA 1E3MA 1S9GA 1R59O 3UKRB 1BCMA 3HO1A 3T1YK 4XIUA 1U4BA 3LWLA 4CESA 5AQZA 3CC7N 4NCBA 2R7YA 4AHUA 3DRRA 5GAGP 1SKRA 4EHUA 4K0KK 4YOYA 3NVKA 4RW6A 3TANA 3CIPA 4KV8A 1HJRA 3ZX2A 2ZGYA 4NB4A 4RCHA 1C0TA 3HVRA 4FLUA 4JI8K 4RTFD 1L3TA 2OPRA 3DRSA 3A5LC 1OVYA 3OYLA 1VSFA 4I2PA 5HLFA 2HNYA 3AGKA 3VERA 4IBNA 3SLCA 4C8OA 4OKJA 1CZAN 2VCPA 3ZETA 4CHPA 2DY4A 4L8RB 2OTJN 3A5OC 3AO1A 4FJNA 4BC4A 4DTXA 2FLOA 3KJVA 3A8YA 3G4SN 2PZSA 3WNHA 3VGKA 3I8BA 1WB9A 5KQDA 3EE9A 4DFJA 1Y64A 1IG8A 1JLQA 1E4FT 3CERA 5EVZA 4ELTA 4HHTA 3AO2A 3CJCA 2BH1A 3ZSYA 3L3VA 3QNOA 3C7NB 2ZJPL 1BA1A 4RW8A 1D9FA 2WOMA 1V4SA 1GLCG 1QE1A 3G71N 4DR3K 2ITMA 1QHTA 1K8AO 1BQMA 3LM2A 5HROA 3GG4A 3LZJA 3HTVA 3T7ZA 3RWUA 3K5OA 3K9KA 4F2RA 1T44A 4ILJA 2E5LK 1VSDA 2KQ2A 2A5XA 3ZYYX 4KI6A 2A1RA 2V7YA 4FWRA 4KB1A 1I94K 3L0QA 5LJWA 3QBXA 4A61A 3NH2A 4GNIA 3CM6A 3R1XA 4FJ7A 3EE8A 3I56N 4IJNA 5AQRA 4KRFA 1TYQB 5AQLA 1ASWA 1V4TA 4KFBA 5T7BA 4M3ZA 3G25A 3FZMA 5F0XA 2ZD1A 3ZSQA 4BC2A 1GLLO 2AA4A 1HYVA 2GWJA 4KH5A 2YHWA 4JK7A 1N8RO 4WYBA 3M6GA 3HXMA 4FL9A 3EZWA 3WQUA 4JYAK 1D4XA 3DLLL 2O8EB 1JL2A 3LPTA 3SBGA 1RDUA 3Q7CA 3MXJA 4JI3K 4FVUA 1WSJA 4FLYA 1J6ZA 3W3DA 4L3QA 2QA4N 1X1PA 3BZKA 5M1QA 3AA5X 4WFAL 3A0IX 1SS6A 4CD1A 3IUCA 1VQ9N 3CC4N 3SJJA 3WXLA 3O9QA 4A5AA 1W97L 4BRMA 1N36K 5C24A 4JI7K 5GINA 3QICA 4CF9A 1NK7A 4H03B 3MXIA 3O4NA 3RRGA 1VQ4N 2G8VA 4E19A 3OYMA 2ZF5O 3WT0A 3CCRN 4JS4A 4DTUA 5FRNA 2QK9A 2HF4A 2VQEK 3QIPA 3QLHA 5C10A 2VG7A 3TAGA 4AHTA 4DFPA 4BRLA 3M8QA 3TAMA 3OHRA 4DTOA 2IGIA 3RSEA 4G1QA 3KIOA 2E2PA 3AVGA 3ATVA 5AZJB 3TSQA 3SK3A 2PYLA 4BE0A 2RE2A 4RG8A 1ASUA 3IMXA 4JKAA 3AVFA 4FJMA 4CFBA 5BN8A 4FOEA 4BREA 4DTMA 3EKUA 4DSLA 4E3SA 4B3RK 1SL2A 5J1EA 5EX5A 2IVPA 3QDKA 4FPAA 4EAHD 4R5PA 4FK4A 2NRZA 1U6ZA 2HBMA 4JD2A 2P9NB 4N76A 3CCSN 3KLFA 3FGUA 4B08A 1Q9XA 2QEXN 1Y97A 1BOTO 4I9LA 4ID5A 3TPQA 3TSUA 1BQNA 1X9JA 1ITGA 1XUPO 5CR4A 1D5AA 2W6KA 1RT5A 4U67L 1WOQA 3IG1A 1KAYA 5C25A 1YUWA 2P1JA 1NGFA 1BCOA 3ITHA 5CYQA 4ZTJA 4QS8A 4EP5A 4M3TA 3MX2A 1QVGM 4G9ZA 1NU0A 4DQSA 4PL7A 4X66K 1TVRA 1DKGD 3FLCO 3KLGA 4B1WB 4IFVA 3UKUA 3O9UA 4KHNA
chains in the Genus database with same CATH topology
3JYTA 3E01A 3THVA 3VN5A 2XY6A 3KK3A 3F73A 1Z25A 2IAJA 1WAFA 4FW1A 1TK5A 4FK2A 3RR8A 1J54A 2KZMA 3AVMA 4C8KA 4Z4FA 3L8BA 4BDYA 3VQ9A 4FZXC 1BI4A 1T03A 5CZ2A 3PY8A 4DG1A 2FBYA 4F4KA 2RKIA 3ZT4A 4FZYA 4C8MA 4W5QA 1KRPA 1RDBA 1RT2A 3TI0A 1SKWA 3A2FA 3DLEA 4CJKA 2G8UA 5DK5A 3QEWA 3VQEA 2QKBA 3HJFA 2IS3A 4OKKA 4FLTA 3C95A 4OLBA 1S1UA 2HHTA 3NFAA 3VQ7A 1U47A 1JLGA 2G8FA 1TGOA 4B9TA 3OS1A 1JKHA 3RMAA 1BIZA 3C94A 3CFRA 4IFYA 1RDAA 4CGIA 3NCIA 1IKVA 5HBMA 3DLHA 4FJ8A 2GBZA 4H4OA 4HTUA 5EU7A 2OPQA 5HRNA 4W5TA 4JS5A 1K6YA 2DFHA 3VQ5A 4KI4A 3OJUA 4DFKA 3LP0A 1IKXA 3AVAA 4YFUA 3OYHA 4HUGA 1NJZA 4Z4IA 3QERA 1W0HA 3D0PA 4M3XA 1C1BA 1EKEA 2FBVA 1KFSA 3KD1E 1YTAA 3L3UA 3P1GA 3AVKA 2HMIA 4DTJA 4Z0UA 1BISA 4UQGA 2O4GA 4Y1DA 4KHUA 1C1AA 3CYMA 4CHOA 1RILA 1GOAA 2HHUA 2OA8A 1S1WA 2G8HA 3ZSVA 1NK6A 1SV5A 1ZBHA 1VRTA 2ZQBA 1IO2A 1JLEA 3DYAA 2QXFA 1VSEA 2A1SA 2OPPA 4DTNA 1J53A 2GUIA 3LP3A 4Q5VA 2XHBA 3ZSRA 1S1XA 3KTQA 4CGJA 2YNIA 1X9WA 4M45A 4DU4A 3OYFA 3I8DA 1BI4B 1YT3A 4AILC 3NH0A 4N41A 1D9DA 2HHQA 1DLOA 4Z4HA 1SUQA 2F8SA 3KLHA 1JXBA 2D0CA 2BANA 3HP6A 3V1QA 3DI6A 1B9DA 1QTMA 5E41A 4CJUA 4CERA 4CFAA 4HUFA 4PWDA 4M41A 1HQUA 4JRQA 1LW2A 4CJ5A 4CJ4A 4HUEA 3SCXA 4CE9A 3NH1A 2P5OA 1RBTA 1UWBA 3SQ1A 1DTTA 4GW6A 3PO5A 4FZZA 4CIGA 1A5VA 1QQCA 3PX4A 3K59A 4AHVA 3AA3A 4FJ5A 3T19A 5KI6A 4FW2A 1RTJA 1WAJA 2E6MA 3BGRA 4CJTA 4KHWA 4QCLA 1NKEA 3ZSXA 1QSYA 5CYMA 3ZT2A 4CECA 3TAFA 3TAQA 4W5RA 4KHSA 2DTUA 3K5LA 4CJWA 1KFDA 3HT3A 1LV5A 4FLXA 3AO5A 4AHCA 1X9SA 4ELUA 2VG6A 1RT6A 2P51A 4KO0A 3P83D 5JS2A 5KRSA 3HK2A 1TKXA 3D45A 4EP4A 2KTQA 3V9WA 3SV4A 1T8EA 4FK0A 3RTVA 1NJWA 4AHRA 3TAEA 1WSIA 3HP9A 3VQ4A 2PY5A 4CGDA 2D5RA 3O3HA 1A5XA 4FVMA 3OYNA 3SUQA 1KSPA 4B9MA 4DQPA 1FK9A 4PA1A 1RTHA 2EX3A 1CZBA 1O1WA 3U3GA 4CEQA 3JSMA 3MEEA 3TARA 2RPIA 4B3OA 4E1NA 4OJRA 3LALA 1RBUA 1NK8A 1FKOA 3HPGA 1U45A 4KAZA 4DF8A 1RCHA 4DSFA 3AVLA 2XO7A 3RRHA 4N5SA 4QOZB 1VSKA 3SQ2A 3SPYA 2DFEA 2F96A 4O0IA 5J2MA 5I42A 3WNGA 4DTPA 3BDPA 1KVBA 3OYEA 3VQCA 1Q8IA 3ZSZA 4E0DA 3PX6A 3ASMA 1LW0A 4AH9A 1XI1A 4FJ9A 4IDKA 4I9QA 3IRXA 5SZTA 1T7PA 1WSHA 2G8WA 1S1TA 3RMBA 4O55A 3OYIA 4B9LA 3U3YA 4J2AA 4E7KA 1VSHA 3KLIA 4LY7A 3ZCMA 1Q9YA 2VWKA 1U49A 1KVAA 3AVCA 1U48A 3NDKA 4FXDA 3DOLA 3MEGA 2I5JA 4J2EA 3C6UA 4E7HA 3WNFA 4FM2A 3MECA 4H8KA 4LSLA 4DS5A 1UA1A 4E1MA 1RBRA 3AV9A 4KB0A 5HP1A 3O3GA 1TL3A 5FDLA 1NK9A 1TKTA 3CM5A 3P5JA 5CY4A 3T1AA 1BHLA 1I3AA 3OYJA 3MAQA 1DTQA 1W9HA 4H4MA 1C0UA 3T3FA 3U6FA 1N5YA 5KGWA 4J2DA 3V1RA 1S9GA 4CF2A 3DLGA 2X74A 1NJXA 3QETA 1WNSA 4B9VA 1BCMA 4BE2A 3SUNA 1HPZA 3HO1A 3RMDA 4QAGA 3V9XA 4M3WA 1J5OA 1WLJA 2YNFA 2OZSA 1RTDA 4IG0A 1RTIA 4XIUA 1RT1A 3LWLA 1U4BA 4CESA 3QEXA 3SUPA 4NCBA 3ALYA 1JXEA 2R7YA 4AHUA 4I2QA 3DRRA 2JLEA 3HYFA 4OVLA 4AHSA 4CEOA 1SKRA 3AVHA 3FFIA 4RW6A 3DLKA 4DMNA 3S3OA 1C6VA 4EZ9A 2XY7A 4DSEA 3LP2A 3TANA 4KPYA 4KV8A 4FJJA 1HJRA 3DLBA 4FJGA 2FC0A 1UAXA 1ZBFA 4CFDA 4DQIA 3TWHA 4C8LA 2HNDA 1VSLA 3KLEA 3IS9A 1RDCA 2GV9A 1HNVA 4WE1A 1JLAA 3OYDA 3SQ0A 1IG9A 4CJPA 2F8TA 1Z26A 4KTQA 4FLUA 1C0TA 2D0AA 4Z4CA 3HVRA 4F3OA 3M8SA 2G8IA 1KVCA 1L3TA 2OPRA 4CEBA 3OYBA 3DRSA 4CK1A 4E89A 4YNQA 1REVA 3OYLA 1JLFA 1RT3A 2Z1HA 1VSFA 4I2PA 3S3NA 5HLFA 4N47A 2HNYA 4CIEA 3OS2A 4IBNA 4C8OA 4OKJA 4W5NA 4CJSA 2IC3A 3AA2A 2KW4A 4KHQA 1TAUA 4CHPA 2DY4A 3ZT1A 5DMRA 4L8RB 2YNGA 2KFZA 4O4GA 3SNNA 3AO1A 1WN7A 5KTQA 1XC9A 4FJNA 1HYZA 4DTXA 4DLEA 4DLGA 2Z1JA 4CGFA 3KJVA 1L3UA 3TABA 3VQBA 3DM2A 2PZSA 3IAYA 3WNHA 3OS0A 4CHZA 4KKOA 1CZ9A 4PQUA 4DFJA 3HPOA 2RF2A 1JLQA 1U04A 1QS4A 1ZBLA 2HVIA 1TK0A 2YNHA 4ELTA 3LAKA 4HHTA 3AO2A 1TL1A 1QSSA 2KZZA 4KTZA 4CJLA 4ELVA 3ZSYA 1FXXA 4B8AB 3L3VA 3CQ8A 3QNOA 5J2NA 1TKDA 4DSJA 1JL1A 3LPUA 3MEDA 4RW8A 1D9FA 3V9UA 4OLAA 1UA0A 2WOMA 2HHXA 1BGXT 1QE1A 4ICLA 4O5BA 3V4IA 2XY5A 1QHTA 1IKWA 3V1OA 4CJVA 4DWIA 2B4JA 4CEDA 1IKYA 1BQMA 3HM9A 4LD0A 1KCFA 4DFMA 4FJIA 4Z4EA 3I0RA 4LSNA 5HROA 4DQRA 3LZJA 4B9UA 4EZ6A 3VQDA 3RWUA 3V9SA 3SV3A 2E4LA 1UOCA 3K5OA 3OVNA 4ID1A 3F9KA 4CEAA 1L5UA 3LWMA 4F2RA 2BE2A 4PUOA 1HNIA 2P5GA 4KHYA 2BDPA 4Z4GA 1GOBA 4OPKA 3HPHA 5C42A 3VQAA 4JRPA 1C0MA 3NGZA 3CFOA 2ITGA 3EY1A 1YVUA 1X9MA 1VSDA 2KQ2A 2HHSA 2HW3A 4KI6A 4O0JA 3V6DA 1LWFA 2A1RA 1SL1A 3V81A 4CHYA 4KB1A 1S6QA 3TAPA 3AA4A 4B9SA 4CJEA 3B6PA 1TKZA 4GVMA 5CZ1A 1S9EA 1RT4A 3OYKA 1BIUA 4Q0BA 3NF7A 2O4IA 3K5MA 4NYNA 1XHZA 3NH2A 4FJ7A 3CM6A 4CHQA 3OYCA 5FRMA 3AO4A 3M8PA 2E6LA 3RR7A 1JLBA 2IOCA 1RBVA 3HSTB 1ASVA 4JLHA 3VQPA 4CGHA 4DSKA 4FJXA 4KRFA 3HL8A 1ASWA 1NK4A 3HVTA 4KFBA 2YHAA 3WNEA 1B9FA 5T7BA 4M3ZA 1A5WA 1J9AA 3SYZA 3MXMA 2WONA 4LH5A 1VSJA 2ZD1A 3ZSQA 4KREA 1HYVA 1ZBUA 4HCCA 3AVBA 1LWEA 2IDOA 3DOKA 3DRPA 4M3UA 4F2SA 4CJQA 1HYSA 4K8ZA 3NHGA 1EXQA 1C1CA 1JLCA 4B8CA 3HXMA 2X6SA 1NOYA 4CFCA 2OYQA 3ULDA 1EP4A 3KKSA 4PY5A 2FBTA 4CHNA 1JL2A 3NAEA 2BGGA 1KLNA 3NBPA 3LPTA 4DTSA 3I0SA 2VG5A 3AO3A 3PO4A 3MXJA 3O4QA 2JGUA 1WSJA 3G10A 4FM1A 4E7IA 4FLYA 3RMCA 3UIQA 4K8XA 3G0ZA 1MU2A 2W42A 1VSMA 4FJKA 1EETA 4CEEA 1X1PA 3PV8A 2XY8A 2EHGA 1NJYA 3AA5X 1N6QA 3ZSOA 3KK2A 2QKKA 4B9NA 1NKCA 3NGYA 4KTWA 3SI6A 4MQ3A 2YKMA 3L2RA 4OGCA 3B6OA 2XRIA 3KKRA 3H08A 3AVJA 3PUFA 3SJJA 2HHVA 4I7FA 1WSEA 4C8NA 1F21A 5HRRA 2ZE2A 4RW4A 3NF9A 2YV0X 4CF8A 4E7JA 4FLVA 1LAWA 3VQQA 5C24A 4CJRA 3CFPA 2Z1GA 3O3FA 5HRSA 4CF9A 1NK7A 2FBXA 1TK8A 4IKFA 1HQEA 3LANA 2D0BA 3O4NA 4CEFA 1BL3A 3MXIA 4FLWA 3NGIA 3RRGA 2YKNA 1RBSA 4E19A 5KRTA 3OYMA 1HRHA 2G8VA 1EX4A 1QSLA 3AVNA 4JS4A 1S6PA 4DTUA 5FRNA 3SUOA 4FCYA 2QK9A 3QO9A 4ZHRA 3QIPA 3QLHA 1S5JA 1GOCA 2VG7A 3TAGA 4O44A 3V9ZA 4AHTA 3NF8A 1D8YA 4CJ3A 1TV6A 5HRPA 4DFPA 1XWLA 2X78A 3M8RA 1IH7A 1VK0A 3M8QA 4NCAA 1WSGA 2OPSA 1G15A 1B92A 3TAMA 3VA3A 3L2WA 3VA0A 4DTOA 4NCGA 4M3YA 1XHXA 2IGIA 3NF6A 4G1QA 2NUBA 5K14A 4CK2A 3KIOA 5J2PA 5I3UA 2PYJA 4FJLA 3TR8A 3LAMA 5KGXA 3OJSA 1YTUA 3AVGA 4DQQA 1VSIA 3QEPA 2Q3SA 4FYDA 1KTQA 4HVJA 4Y1CA 4FJHA 4OKEA 2PYLA 4DF4A 3LDSA 4CJFA 1LAVA 3NE6A 4BE0A 3S9HA 2AJQA 4DSIA 3ZSWA 4RG8A 2YHBA 3PX0A 1ASUA 4M42A 5JS1A 3EYZA 1RT7A 3L2UA 3AVFA 4RW9A 4F3TA 2ATQA 3DMJA 3QINA 4CFBA 4FM0A 4FJMA 1FKPA 4F8RA 1LWCA 2ETJA 4DTMA 3QNNA 1SL0A 3K57A 1NOZA 4DU3A 3S3MA 4BWJA 5SWMA 4BE1A 1CXQA 2LSNA 4DSLA 4E3SA 4J2BA 1CXUA 1SL2A 3K58A 3QEIA 5J1EA 3ZT3A 3LP1A 4HCBA 2Z1IA 4DU1A 2RN2A 4R5PA 1L3VA 4FK4A 2HHWA 3SZ2A 1NK0A 3L2VA 4N76A 4ZTFA 4OGEA 3KLFA 5FROA 1RDDA 4RW7A 1KLMA 3ZT0A 1S1VA 4B08A 2Y1IA 1Y97A 1SKSA 1Q9XA 4DS4A 2B6AA 4I9LA 4ID5A 3LZIA 1BQNA 4FLZA 1ITGA 3SQ4A 3C6TA 1D5AA 3QIOA 4CF1A 3KK1A 5J2QA 1RNHA 4W5OA 2VWJA 1RT5A 1L3SA 1ZYQA 4CGGA 1HMVA 4LH4A 4CF0A 3AVIA 3IG1A 3K5NA 1NK5A 3CG7A 4CCHA 5C25A 3KD5E 3EZ5A 4CEZA 1TAQA 4BWMA 4CK3A 2P1JA 4E7LA 2OZMA 3QESA 1T05A 2B5JA 3SPZA 1VRUA 1BCOA 3OYAA 3OYGA 4MFBA 2G8KA 3K2PA 4BDPA 4N56A 3L2QA 3ITHA 5CYQA 4ZTJA 2HVHA 4M3TA 4EP5A 4BDZA 3VQ8A 2HNZA 4TSXA 4OPJA 2HB5A 3VQ6A 1NKBA 3DLRA 4NYFA 3QEVA 1I39A 4DQSA 1CLQA 1TVRA 2X6NA 1ZBIA 4CIFA 3KLGA 3OY9A 4IG3A 1WSFA 4BACA 2Y1JA 1R0AA 5D3GA 4M3RA 4IFVA 4DTRA 4GMJB 2KFNA 3ISNC 2DFFA 4KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYT A;  3E01 A;  3THV A;  3VN5 A;  2XY6 A;  3KK3 A;  3F73 A;  1Z25 A;  2IAJ A;  1WAF A;  4FW1 A;  1TK5 A;  4FK2 A;  3RR8 A;  1J54 A;  2KZM A;  3AVM A;  4C8K A;  4Z4F A;  3L8B A;  4BDY A;  3VQ9 A;  4FZX C;  1BI4 A;  1T03 A;  5CZ2 A;  3PY8 A;  4DG1 A;  2FBY A;  4F4K A;  2RKI A;  3ZT4 A;  4FZY A;  4C8M A;  4W5Q A;  1KRP A;  1RDB A;  1RT2 A;  3TI0 A;  1SKW A;  3A2F A;  3DLE A;  4CJK A;  2G8U A;  5DK5 A;  3QEW A;  3VQE A;  2QKB A;  3HJF A;  2IS3 A;  4OKK A;  4FLT A;  3C95 A;  4OLB A;  1S1U A;  2HHT A;  3NFA A;  3VQ7 A;  1U47 A;  1JLG A;  2G8F A;  1TGO A;  4B9T A;  3OS1 A;  1JKH A;  3RMA A;  1BIZ A;  3C94 A;  3CFR A;  4IFY A;  1RDA A;  4CGI A;  3NCI A;  1IKV A;  5HBM A;  3DLH A;  4FJ8 A;  2GBZ A;  4H4O A;  4HTU A;  5EU7 A;  2OPQ A;  5HRN A;  4W5T A;  4JS5 A;  1K6Y A;  2DFH A;  3VQ5 A;  4KI4 A;  3OJU A;  4DFK A;  3LP0 A;  1IKX A;  3AVA A;  4YFU A;  3OYH A;  4HUG A;  1NJZ A;  4Z4I A;  3QER A;  1W0H A;  3D0P A;  4M3X A;  1C1B A;  1EKE A;  2FBV A;  1KFS A;  3KD1 E;  1YTA A;  3L3U A;  3P1G A;  3AVK A;  2HMI A;  4DTJ A;  4Z0U A;  1BIS A;  4UQG A;  2O4G A;  4Y1D A;  4KHU A;  1C1A A;  3CYM A;  4CHO A;  1RIL A;  1GOA A;  2HHU A;  2OA8 A;  1S1W A;  2G8H A;  3ZSV A;  1NK6 A;  1SV5 A;  1ZBH A;  1VRT A;  2ZQB A;  1IO2 A;  1JLE A;  3DYA A;  2QXF A;  1VSE A;  2A1S A;  2OPP A;  4DTN A;  1J53 A;  2GUI A;  3LP3 A;  4Q5V A;  2XHB A;  3ZSR A;  1S1X A;  3KTQ A;  4CGJ A;  2YNI A;  1X9W A;  4M45 A;  4DU4 A;  3OYF A;  3I8D A;  1BI4 B;  1YT3 A;  4AIL C;  3NH0 A;  4N41 A;  1D9D A;  2HHQ A;  1DLO A;  4Z4H A;  1SUQ A;  2F8S A;  3KLH A;  1JXB A;  2D0C A;  2BAN A;  3HP6 A;  3V1Q A;  3DI6 A;  1B9D A;  1QTM A;  5E41 A;  4CJU A;  4CER A;  4CFA A;  4HUF A;  4PWD A;  4M41 A;  1HQU A;  4JRQ A;  1LW2 A;  4CJ5 A;  4CJ4 A;  4HUE A;  3SCX A;  4CE9 A;  3NH1 A;  2P5O A;  1RBT A;  1UWB A;  3SQ1 A;  1DTT A;  4GW6 A;  3PO5 A;  4FZZ A;  4CIG A;  1A5V A;  1QQC A;  3PX4 A;  3K59 A;  4AHV A;  3AA3 A;  4FJ5 A;  3T19 A;  5KI6 A;  4FW2 A;  1RTJ A;  1WAJ A;  2E6M A;  3BGR A;  4CJT A;  4KHW A;  4QCL A;  1NKE A;  3ZSX A;  1QSY A;  5CYM A;  3ZT2 A;  4CEC A;  3TAF A;  3TAQ A;  4W5R A;  4KHS A;  2DTU A;  3K5L A;  4CJW A;  1KFD A;  3HT3 A;  1LV5 A;  4FLX A;  3AO5 A;  4AHC A;  1X9S A;  4ELU A;  2VG6 A;  1RT6 A;  2P51 A;  4KO0 A;  3P83 D;  5JS2 A;  5KRS A;  3HK2 A;  1TKX A;  3D45 A;  4EP4 A;  2KTQ A;  3V9W A;  3SV4 A;  1T8E A;  4FK0 A;  3RTV A;  1NJW A;  4AHR A;  3TAE A;  1WSI A;  3HP9 A;  3VQ4 A;  2PY5 A;  4CGD A;  2D5R A;  3O3H A;  1A5X A;  4FVM A;  3OYN A;  3SUQ A;  1KSP A;  4B9M A;  4DQP A;  1FK9 A;  4PA1 A;  1RTH A;  2EX3 A;  1CZB A;  1O1W A;  3U3G A;  4CEQ A;  3JSM A;  3MEE A;  3TAR A;  2RPI A;  4B3O A;  4E1N A;  4OJR A;  3LAL A;  1RBU A;  1NK8 A;  1FKO A;  3HPG A;  1U45 A;  4KAZ A;  4DF8 A;  1RCH A;  4DSF A;  3AVL A;  2XO7 A;  3RRH A;  4N5S A;  4QOZ B;  1VSK A;  3SQ2 A;  3SPY A;  2DFE A;  2F96 A;  4O0I A;  5J2M A;  5I42 A;  3WNG A;  4DTP A;  3BDP A;  1KVB A;  3OYE A;  3VQC A;  1Q8I A;  3ZSZ A;  4E0D A;  3PX6 A;  3ASM A;  1LW0 A;  4AH9 A;  1XI1 A;  4FJ9 A;  4IDK A;  4I9Q A;  3IRX A;  5SZT A;  1T7P A;  1WSH A;  2G8W A;  1S1T A;  3RMB A;  4O55 A;  3OYI A;  4B9L A;  3U3Y A;  4J2A A;  4E7K A;  1VSH A;  3KLI A;  4LY7 A;  3ZCM A;  1Q9Y A;  2VWK A;  1U49 A;  1KVA A;  3AVC A;  1U48 A;  3NDK A;  4FXD A;  3DOL A;  3MEG A;  2I5J A;  4J2E A;  3C6U A;  4E7H A;  3WNF A;  4FM2 A;  3MEC A;  4H8K A;  4LSL A;  4DS5 A;  1UA1 A;  4E1M A;  1RBR A;  3AV9 A;  4KB0 A;  5HP1 A;  3O3G A;  1TL3 A;  5FDL A;  1NK9 A;  1TKT A;  3CM5 A;  3P5J A;  5CY4 A;  3T1A A;  1BHL A;  1I3A A;  3OYJ A;  3MAQ A;  1DTQ A;  1W9H A;  4H4M A;  1C0U A;  3T3F A;  3U6F A;  1N5Y A;  5KGW A;  4J2D A;  3V1R A;  1S9G A;  4CF2 A;  3DLG A;  2X74 A;  1NJX A;  3QET A;  1WNS A;  4B9V A;  1BCM A;  4BE2 A;  3SUN A;  1HPZ A;  3HO1 A;  3RMD A;  4QAG A;  3V9X A;  4M3W A;  1J5O A;  1WLJ A;  2YNF A;  2OZS A;  1RTD A;  4IG0 A;  1RTI A;  4XIU A;  1RT1 A;  3LWL A;  1U4B A;  4CES A;  3QEX A;  3SUP A;  4NCB A;  3ALY A;  1JXE A;  2R7Y A;  4AHU A;  4I2Q A;  3DRR A;  2JLE A;  3HYF A;  4OVL A;  4AHS A;  4CEO A;  1SKR A;  3AVH A;  3FFI A;  4RW6 A;  3DLK A;  4DMN A;  3S3O A;  1C6V A;  4EZ9 A;  2XY7 A;  4DSE A;  3LP2 A;  3TAN A;  4KPY A;  4KV8 A;  4FJJ A;  1HJR A;  3DLB A;  4FJG A;  2FC0 A;  1UAX A;  1ZBF A;  4CFD A;  4DQI A;  3TWH A;  4C8L A;  2HND A;  1VSL A;  3KLE A;  3IS9 A;  1RDC A;  2GV9 A;  1HNV A;  4WE1 A;  1JLA A;  3OYD A;  3SQ0 A;  1IG9 A;  4CJP A;  2F8T A;  1Z26 A;  4KTQ A;  4FLU A;  1C0T A;  2D0A A;  4Z4C A;  3HVR A;  4F3O A;  3M8S A;  2G8I A;  1KVC A;  1L3T A;  2OPR A;  4CEB A;  3OYB A;  3DRS A;  4CK1 A;  4E89 A;  4YNQ A;  1REV A;  3OYL A;  1JLF A;  1RT3 A;  2Z1H A;  1VSF A;  4I2P A;  3S3N A;  5HLF A;  4N47 A;  2HNY A;  4CIE A;  3OS2 A;  4IBN A;  4C8O A;  4OKJ A;  4W5N A;  4CJS A;  2IC3 A;  3AA2 A;  2KW4 A;  4KHQ A;  1TAU A;  4CHP A;  2DY4 A;  3ZT1 A;  5DMR A;  4L8R B;  2YNG A;  2KFZ A;  4O4G A;  3SNN A;  3AO1 A;  1WN7 A;  5KTQ A;  1XC9 A;  4FJN A;  1HYZ A;  4DTX A;  4DLE A;  4DLG A;  2Z1J A;  4CGF A;  3KJV A;  1L3U A;  3TAB A;  3VQB A;  3DM2 A;  2PZS A;  3IAY A;  3WNH A;  3OS0 A;  4CHZ A;  4KKO A;  1CZ9 A;  4PQU A;  4DFJ A;  3HPO A;  2RF2 A;  1JLQ A;  1U04 A;  1QS4 A;  1ZBL A;  2HVI A;  1TK0 A;  2YNH A;  4ELT A;  3LAK A;  4HHT A;  3AO2 A;  1TL1 A;  1QSS A;  2KZZ A;  4KTZ A;  4CJL A;  4ELV A;  3ZSY A;  1FXX A;  4B8A B;  3L3V A;  3CQ8 A;  3QNO A;  5J2N A;  1TKD A;  4DSJ A;  1JL1 A;  3LPU A;  3MED A;  4RW8 A;  1D9F A;  3V9U A;  4OLA A;  1UA0 A;  2WOM A;  2HHX A;  1BGX T;  1QE1 A;  4ICL A;  4O5B A;  3V4I A;  2XY5 A;  1QHT A;  1IKW A;  3V1O A;  4CJV A;  4DWI A;  2B4J A;  4CED A;  1IKY A;  1BQM A;  3HM9 A;  4LD0 A;  1KCF A;  4DFM A;  4FJI A;  4Z4E A;  3I0R A;  4LSN A;  5HRO A;  4DQR A;  3LZJ A;  4B9U A;  4EZ6 A;  3VQD A;  3RWU A;  3V9S A;  3SV3 A;  2E4L A;  1UOC A;  3K5O A;  3OVN A;  4ID1 A;  3F9K A;  4CEA A;  1L5U A;  3LWM A;  4F2R A;  2BE2 A;  4PUO A;  1HNI A;  2P5G A;  4KHY A;  2BDP A;  4Z4G A;  1GOB A;  4OPK A;  3HPH A;  5C42 A;  3VQA A;  4JRP A;  1C0M A;  3NGZ A;  3CFO A;  2ITG A;  3EY1 A;  1YVU A;  1X9M A;  1VSD A;  2KQ2 A;  2HHS A;  2HW3 A;  4KI6 A;  4O0J A;  3V6D A;  1LWF A;  2A1R A;  1SL1 A;  3V81 A;  4CHY A;  4KB1 A;  1S6Q A;  3TAP A;  3AA4 A;  4B9S A;  4CJE A;  3B6P A;  1TKZ A;  4GVM A;  5CZ1 A;  1S9E A;  1RT4 A;  3OYK A;  1BIU A;  4Q0B A;  3NF7 A;  2O4I A;  3K5M A;  4NYN A;  1XHZ A;  3NH2 A;  4FJ7 A;  3CM6 A;  4CHQ A;  3OYC A;  5FRM A;  3AO4 A;  3M8P A;  2E6L A;  3RR7 A;  1JLB A;  2IOC A;  1RBV A;  3HST B;  1ASV A;  4JLH A;  3VQP A;  4CGH A;  4DSK A;  4FJX A;  4KRF A;  3HL8 A;  1ASW A;  1NK4 A;  3HVT A;  4KFB A;  2YHA A;  3WNE A;  1B9F A;  5T7B A;  4M3Z A;  1A5W A;  1J9A A;  3SYZ A;  3MXM A;  2WON A;  4LH5 A;  1VSJ A;  2ZD1 A;  3ZSQ A;  4KRE A;  1HYV A;  1ZBU A;  4HCC A;  3AVB A;  1LWE A;  2IDO A;  3DOK A;  3DRP A;  4M3U A;  4F2S A;  4CJQ A;  1HYS A;  4K8Z A;  3NHG A;  1EXQ A;  1C1C A;  1JLC A;  4B8C A;  3HXM A;  2X6S A;  1NOY A;  4CFC A;  2OYQ A;  3ULD A;  1EP4 A;  3KKS A;  4PY5 A;  2FBT A;  4CHN A;  1JL2 A;  3NAE A;  2BGG A;  1KLN A;  3NBP A;  3LPT A;  4DTS A;  3I0S A;  2VG5 A;  3AO3 A;  3PO4 A;  3MXJ A;  3O4Q A;  2JGU A;  1WSJ A;  3G10 A;  4FM1 A;  4E7I A;  4FLY A;  3RMC A;  3UIQ A;  4K8X A;  3G0Z A;  1MU2 A;  2W42 A;  1VSM A;  4FJK A;  1EET A;  4CEE A;  1X1P A;  3PV8 A;  2XY8 A;  2EHG A;  1NJY A;  3AA5 X;  1N6Q A;  3ZSO A;  3KK2 A;  2QKK A;  4B9N A;  1NKC A;  3NGY A;  4KTW A;  3SI6 A;  4MQ3 A;  2YKM A;  3L2R A;  4OGC A;  3B6O A;  2XRI A;  3KKR A;  3H08 A;  3AVJ A;  3PUF A;  3SJJ A;  2HHV A;  4I7F A;  1WSE A;  4C8N A;  1F21 A;  5HRR A;  2ZE2 A;  4RW4 A;  3NF9 A;  2YV0 X;  4CF8 A;  4E7J A;  4FLV A;  1LAW A;  3VQQ A;  5C24 A;  4CJR A;  3CFP A;  2Z1G A;  3O3F A;  5HRS A;  4CF9 A;  1NK7 A;  2FBX A;  1TK8 A;  4IKF A;  1HQE A;  3LAN A;  2D0B A;  3O4N A;  4CEF A;  1BL3 A;  3MXI A;  4FLW A;  3NGI A;  3RRG A;  2YKN A;  1RBS A;  4E19 A;  5KRT A;  3OYM A;  1HRH A;  2G8V A;  1EX4 A;  1QSL A;  3AVN A;  4JS4 A;  1S6P A;  4DTU A;  5FRN A;  3SUO A;  4FCY A;  2QK9 A;  3QO9 A;  4ZHR A;  3QIP A;  3QLH A;  1S5J A;  1GOC A;  2VG7 A;  3TAG A;  4O44 A;  3V9Z A;  4AHT A;  3NF8 A;  1D8Y A;  4CJ3 A;  1TV6 A;  5HRP A;  4DFP A;  1XWL A;  2X78 A;  3M8R A;  1IH7 A;  1VK0 A;  3M8Q A;  4NCA A;  1WSG A;  2OPS A;  1G15 A;  1B92 A;  3TAM A;  3VA3 A;  3L2W A;  3VA0 A;  4DTO A;  4NCG A;  4M3Y A;  1XHX A;  2IGI A;  3NF6 A;  4G1Q A;  2NUB A;  5K14 A;  4CK2 A;  3KIO A;  5J2P A;  5I3U A;  2PYJ A;  4FJL A;  3TR8 A;  3LAM A;  5KGX A;  3OJS A;  1YTU A;  3AVG A;  4DQQ A;  1VSI A;  3QEP A;  2Q3S A;  4FYD A;  1KTQ A;  4HVJ A;  4Y1C A;  4FJH A;  4OKE A;  2PYL A;  4DF4 A;  3LDS A;  4CJF A;  1LAV A;  3NE6 A;  4BE0 A;  3S9H A;  2AJQ A;  4DSI A;  3ZSW A;  4RG8 A;  2YHB A;  3PX0 A;  1ASU A;  4M42 A;  5JS1 A;  3EYZ A;  1RT7 A;  3L2U A;  3AVF A;  4RW9 A;  4F3T A;  2ATQ A;  3DMJ A;  3QIN A;  4CFB A;  4FM0 A;  4FJM A;  1FKP A;  4F8R A;  1LWC A;  2ETJ A;  4DTM A;  3QNN A;  1SL0 A;  3K57 A;  1NOZ A;  4DU3 A;  3S3M A;  4BWJ A;  5SWM A;  4BE1 A;  1CXQ A;  2LSN A;  4DSL A;  4E3S A;  4J2B A;  1CXU A;  1SL2 A;  3K58 A;  3QEI A;  5J1E A;  3ZT3 A;  3LP1 A;  4HCB A;  2Z1I A;  4DU1 A;  2RN2 A;  4R5P A;  1L3V A;  4FK4 A;  2HHW A;  3SZ2 A;  1NK0 A;  3L2V A;  4N76 A;  4ZTF A;  4OGE A;  3KLF A;  5FRO A;  1RDD A;  4RW7 A;  1KLM A;  3ZT0 A;  1S1V A;  4B08 A;  2Y1I A;  1Y97 A;  1SKS A;  1Q9X A;  4DS4 A;  2B6A A;  4I9L A;  4ID5 A;  3LZI A;  1BQN A;  4FLZ A;  1ITG A;  3SQ4 A;  3C6T A;  1D5A A;  3QIO A;  4CF1 A;  3KK1 A;  5J2Q A;  1RNH A;  4W5O A;  2VWJ A;  1RT5 A;  1L3S A;  1ZYQ A;  4CGG A;  1HMV A;  4LH4 A;  4CF0 A;  3AVI A;  3IG1 A;  3K5N A;  1NK5 A;  3CG7 A;  4CCH A;  5C25 A;  3KD5 E;  3EZ5 A;  4CEZ A;  1TAQ A;  4BWM A;  4CK3 A;  2P1J A;  4E7L A;  2OZM A;  3QES A;  1T05 A;  2B5J A;  3SPZ A;  1VRU A;  1BCO A;  3OYA A;  3OYG A;  4MFB A;  2G8K A;  3K2P A;  4BDP A;  4N56 A;  3L2Q A;  3ITH A;  5CYQ A;  4ZTJ A;  2HVH A;  4M3T A;  4EP5 A;  4BDZ A;  3VQ8 A;  2HNZ A;  4TSX A;  4OPJ A;  2HB5 A;  3VQ6 A;  1NKB A;  3DLR A;  4NYF A;  3QEV A;  1I39 A;  4DQS A;  1CLQ A;  1TVR A;  2X6N A;  1ZBI A;  4CIF A;  3KLG A;  3OY9 A;  4IG3 A;  1WSF A;  4BAC A;  2Y1J A;  1R0A A;  5D3G A;  4M3R A;  4IFV A;  4DTR A;  4GMJ B;  2KFN A;  3ISN C;  2DFF A;  4KHN A; 
#chains in the Genus database with same CATH topology
 2WTU A;  4DV2 K;  1YVN A;  2XY6 A;  1Z25 A;  5AFU A;  5LY3 A;  1BWF O;  3THW B;  3P4I A;  3GL1 A;  4C8K A;  4BDY A;  2P9K B;  4Z94 A;  3ATU A;  4DG1 A;  1Q81 O;  5IT9 O;  1RDB A;  1SKW A;  1VHX A;  2HBJ A;  5BRE A;  2IS3 A;  1BA0 A;  4FLT A;  2HHT A;  3NFA A;  5AQW A;  4C1N I;  1JLG A;  4NLC A;  2G8F A;  5A2Q O;  3OS1 A;  1OH6 A;  1JKH A;  3C94 A;  1RDA A;  1HNX K;  3CCV N;  2GBZ A;  1YJN N;  5AQK A;  3IFR A;  4CZI A;  4WQ4 C;  4HWI A;  4AQY K;  1IKX A;  4DV3 K;  4HUG A;  3HOS A;  3D0P A;  3CJ7 A;  1C1B A;  3JS6 A;  3L3U A;  4FWS A;  5ELZ A;  4Z0U A;  2KKZ A;  1S1W A;  1VRT A;  2ZQB A;  1X3M A;  4GKJ K;  1J53 A;  2V7Z A;  4PKG A;  3CMA N;  4GV6 A;  3ZSR A;  4MLH A;  1S1X A;  4CGJ A;  1X9W A;  3HBT A;  4YOW A;  4DU4 A;  3MWP A;  1IBL K;  4BC5 A;  3V1Q A;  4BRA A;  1QTM A;  3FZH A;  3F9M A;  4PWD A;  4CJ5 A;  2QXL A;  2HOE A;  1RBT A;  1S3X A;  5AQG A;  4GW6 A;  3PO5 A;  4XH4 A;  4XH1 A;  3GE1 A;  4CIG A;  1A5V A;  3PX4 A;  3AA3 A;  4CZH A;  4FW2 A;  4CJT A;  4CZE A;  3WEE B;  1QSY A;  2HMP A;  1HKG A;  1VQP N;  1WBB A;  3HT3 A;  4LF5 K;  3CQX A;  2WC9 A;  4IOX A;  5KRS A;  3HK2 A;  1TKX A;  4EP4 A;  3TAE A;  1BDG A;  4H5W A;  2NRV A;  1KSP A;  3O3H A;  4FVM A;  2HHH K;  3CI5 A;  2GEM A;  3O08 A;  3D2F A;  4JEP A;  4PA1 A;  1CZB A;  1O1W A;  3PSF A;  4BG9 A;  5I9E B;  5JLH A;  1FKO A;  2XO7 A;  1VSK A;  3BP8 A;  3SPY A;  2E88 A;  3WNG A;  5LMN K;  4GVE A;  3BDP A;  1K8K A;  1IBK K;  3ZSZ A;  3PX6 A;  3ASM A;  4V19 S;  4AH9 A;  4FJ9 A;  2JWK A;  4IJA A;  3ID8 A;  5JVH L;  1GLE G;  4J2A A;  5BR8 K;  4E7K A;  1KVA A;  3DOL A;  4JKG A;  3C6U A;  1GLJ O;  1VQ5 N;  1YHQ N;  1EO1 A;  1UA1 A;  4IEE A;  3CPW M;  4H4M A;  1N5Y A;  2P9I A;  3O80 A;  4CF2 A;  1WNS A;  4DV6 K;  4B9V A;  3SUN A;  1HPZ A;  1J5O A;  1E4G T;  5GAH P;  3QEX A;  3WXM B;  4JV5 K;  1KQS M;  3CJ9 A;  1NM1 A;  4I2Q A;  3HYF A;  4AHS A;  4JKD A;  1VQK N;  3DLK A;  2XY7 A;  2NLX A;  1H1V A;  1ZBF A;  3PSI A;  2HND A;  1DT9 A;  1RDC A;  2GV9 A;  4WE1 A;  3OYD A;  3SQ0 A;  4DR4 K;  2YJF A;  1Z26 A;  4KTQ A;  2G8I A;  2D0A A;  1TUY A;  3W0L A;  2PBD A;  3OYB A;  4YNQ A;  4B1Z A;  2V51 B;  3E9P A;  1JLF A;  3A5M C;  2F9W A;  3OS2 A;  4CIE A;  4JKE A;  2Q31 A;  4JHD A;  4CJS A;  2IC3 A;  3AA2 A;  2KW4 A;  5DMR A;  2YNG A;  1LCU A;  4O4G A;  1WN7 A;  1HYZ A;  4DLG A;  2Z1J A;  3VQB A;  3DM2 A;  2A40 A;  3IAY A;  3VEX A;  3EL2 A;  3E1Y A;  3U8X A;  2RF2 A;  1U04 A;  1QS4 A;  2KZZ A;  3VF4 A;  4KTZ A;  3CQ8 A;  1T3V A;  4BRN A;  4DV4 K;  4ICL A;  2ZM6 K;  1NMD A;  1SZ2 A;  3O9T A;  2XY5 A;  3QFU A;  4BR5 A;  4DWI A;  3HM9 A;  5C2F A;  4DQR A;  4BQZ A;  1Q86 O;  5C12 A;  5AQM A;  3M3Z A;  3V9S A;  2E4L A;  3OVN A;  1W7A A;  3MN7 A;  2GEL A;  1L5U A;  3M1F A;  2VGM A;  2BDP A;  3HPH A;  5C42 A;  4DV0 K;  3VQA A;  1XNQ K;  2NRW A;  3CFO A;  2ITG A;  1X9M A;  2HW3 A;  2YI1 A;  2A3Z A;  4O0J A;  3LDO A;  1S6Q A;  3FE1 A;  3AA4 A;  3KZB A;  4B9S A;  4GVM A;  1S9E A;  4Y0W A;  3OYK A;  3CJA A;  1U2V B;  3K5M A;  3OBW A;  3VF6 A;  4DR6 K;  4CHQ A;  4H5T A;  3ZEU A;  5FRM A;  4BR7 A;  3M8P A;  2E6L A;  2P9P A;  2YHY A;  4JLH A;  1G99 A;  1IV0 A;  1NK4 A;  3WNE A;  1B9F A;  3C6A A;  3D2E A;  3L4Q A;  4JI0 K;  1ZBU A;  3G6E N;  3DRP A;  2WUS A;  5AQI A;  3VEW A;  4K8Z A;  2KLA A;  3NHG A;  3VTI A;  3R9P A;  2X6S A;  1OH8 A;  1NOY A;  5BPN A;  3ULD A;  1EP4 A;  3NBP A;  3I0S A;  1HNW K;  3PO4 A;  3EEQ A;  4JI6 K;  4E7I A;  3G10 A;  4FM1 A;  3UIQ A;  4JD2 B;  3G0Z A;  1MU2 A;  2W42 A;  1N34 K;  1EET A;  3J7A P;  2XY8 A;  2ZJR L;  3ZSO A;  3KK2 A;  3H46 O;  1NKC A;  3NGY A;  5EXW A;  4CZJ A;  3B6O A;  3H08 A;  4I7F A;  1WSE A;  4C8N A;  4MDB A;  2BUP A;  3VGM A;  1VQ6 N;  3NF9 A;  2YV0 X;  4E7J A;  4FWL A;  4FLV A;  3DXM B;  2P9L A;  3VQQ A;  4CJR A;  3CFP A;  4CBW A;  3O3F A;  5BRF A;  4IKF A;  1HQE A;  4CEF A;  2D0B A;  4DUZ K;  4BY9 C;  1ZBS A;  2YKN A;  1RBS A;  5KRT A;  3M5R A;  5C15 A;  1EX4 A;  1QSL A;  1XQS C;  1S6P A;  5LMU K;  3SUO A;  1RFQ A;  4DB3 A;  3QBW A;  4FWP A;  1D8Y A;  4CJ3 A;  1TV6 A;  2QWP A;  5LJV A;  1XWL A;  1IH7 A;  1VK0 A;  2E1Z A;  4A57 A;  1WSG A;  3OW2 M;  5M1O A;  3VA0 A;  2IVN A;  3F2K A;  2PYJ A;  2I7N A;  3TR8 A;  3PIO L;  3OJS A;  3FZL A;  3BEX A;  4BGA A;  1NGJ A;  3CQY A;  4FYD A;  2FF6 A;  4Y1C A;  3LDS A;  1LAV A;  3DXK A;  2YHB A;  1RT7 A;  4WF9 L;  2ATQ A;  3KWG A;  3QIN A;  4FM0 A;  4F8R A;  1LWC A;  3QNN A;  4LF6 K;  4DU3 A;  4BE1 A;  5SWM A;  1CXQ A;  4IZ9 A;  2Z1I A;  1L3V A;  2HHW A;  4YOT A;  3WXK A;  1NK0 A;  3VGL A;  4ZTF A;  4OGE A;  5FRO A;  1KLM A;  2B6A A;  1HUX A;  3LZI A;  3C6T A;  4CF1 A;  1LOT B;  2VWJ A;  2Q2R A;  1L3S A;  4CGG A;  3K5N A;  3CG7 A;  3EZ5 A;  1ATR A;  1NGE A;  4CK3 A;  4E7L A;  2OZM A;  1SAZ A;  4QS7 A;  3QES A;  2B5J A;  3OYG A;  3OYA A;  4BDP A;  3K2P A;  3SAH A;  3L2Q A;  4CD3 A;  4BDZ A;  4AF1 A;  2HNZ A;  4OPJ A;  1NWK A;  4NXN K;  1NKB A;  3QEV A;  1I39 A;  4LFB K;  5AQQ A;  4CIF A;  3OY9 A;  4BAC A;  1R0A A;  4M3R A;  4JNE A;  2KHO A;  3ULE A;  4R79 A;  5AQO A;  3E01 A;  5AZI A;  3THV A;  3VTH A;  2YJE A;  4A59 A;  1TK5 A;  3RR8 A;  5BPM A;  4Z4F A;  4FZX C;  3VQ9 A;  3PY8 A;  2DPN A;  2FBY A;  3OA9 A;  1RT2 A;  3TI0 A;  3O1W A;  2NNW A;  2QKB A;  1MWK A;  2VYP A;  4OKK A;  4OLB A;  1S1U A;  4ISG A;  2ZGZ A;  3VQ7 A;  2QWO A;  4O8K A;  2P9S A;  1U47 A;  1TGO A;  4B9T A;  4O5F A;  4IFY A;  4CGI A;  1IKV A;  3THX A;  3DLH A;  2O8C B;  4H4O A;  4JKF A;  3BUZ B;  4JKC A;  4W5T A;  2QM1 A;  1HJO A;  3HM8 A;  4KI4 A;  4DFK A;  3LP0 A;  4PKI A;  2CGK A;  4K25 A;  4LF4 K;  4YFU A;  1NJZ A;  4Z4I A;  2D0O A;  1W0H A;  1EKE A;  3VEZ A;  3KD1 E;  1YTA A;  2OAN A;  3AVK A;  4DTJ A;  4KHU A;  1C1A A;  3CYM A;  2HHU A;  2OA8 A;  3ZSV A;  4IOA L;  1KAX A;  5KPR A;  3AGR A;  2QXF A;  2A1S A;  4B1X B;  4DTN A;  2XHB A;  3KTQ A;  4M45 A;  2ZWH A;  4H5R A;  3I8D A;  1BI4 B;  3CXC M;  1YT3 A;  1ATN A;  4YOU A;  4B9Q A;  1YXQ A;  4HTL A;  1D9D A;  3CF5 L;  3TSP A;  4Z4H A;  2QWQ A;  3GDQ A;  4FWM A;  2QWL A;  3KLH A;  3EO3 A;  4YHH K;  1B9D A;  3H3N O;  4CER A;  1FW6 A;  3FZF A;  1HQU A;  4M41 A;  4CJ4 A;  4CZL A;  3NH1 A;  4WCE L;  3HOT A;  3SQ1 A;  1DTT A;  1K73 O;  4FZZ A;  1OKJ A;  1NGG A;  4JKH A;  1RTJ A;  3BGR A;  4KHW A;  1NKE A;  2O8D A;  4CEC A;  3J7Z O;  2O8B A;  4GV9 A;  4KHS A;  1LV5 A;  4FLX A;  1X9S A;  2VG6 A;  4DV7 K;  4KO0 A;  5JS2 A;  3P83 D;  3TTF A;  4H5V A;  1NJW A;  1TUU A;  3VMF B;  1JCF A;  3SUQ A;  4ISF A;  4B9M A;  1FK9 A;  2OZS A;  3U3G A;  3T1H K;  1M1K O;  1ILY A;  2E20 A;  4KAZ A;  1U45 A;  3MDQ A;  4JI1 K;  3AAP A;  4N5S A;  3NMU A;  4QOZ B;  4O0I A;  4DTP A;  1KVB A;  3OYE A;  1Q8I A;  4E0D A;  5KQ8 A;  5GAE P;  4IDK A;  1T7P A;  3WXJ A;  5TKW A;  3P38 A;  2D1K A;  1VSH A;  2VWK A;  3AVC A;  3NDK A;  3MEG A;  2I5J A;  4J2E A;  5JMV A;  4BRI A;  3BY5 A;  1NGD A;  1VQO N;  4LSL A;  2FF3 B;  4E1J A;  4E1M A;  4M63 C;  4EHT A;  1TKT A;  2GX9 A;  3CM5 A;  5CY4 A;  4FJK A;  1DTQ A;  1W9H A;  2Q1N A;  3T3F A;  5KGW A;  3V1R A;  5EY4 A;  2X74 A;  3LM9 A;  3QET A;  1XMO K;  4JK8 A;  2YNF A;  1RTD A;  4IG0 A;  3Q7B A;  4RWT A;  2V52 B;  3SUP A;  5AFU H;  3AVH A;  3FFI A;  3CET A;  3K0S A;  3S3O A;  1C6V A;  3C6H A;  4I6M B;  5LL6 Z;  4DSE A;  3LP2 A;  4KPY A;  3DLB A;  4FJG A;  2FC0 A;  3VEY A;  2F7T A;  4X65 K;  1BUP A;  3KLE A;  3IS9 A;  1HNV A;  1P90 A;  3O6W A;  4FPB A;  5AQS A;  4EIA A;  4CEB A;  4CK1 A;  3KWI A;  1REV A;  5BRD A;  3LDQ A;  2Z1H A;  5BN9 A;  1GLF O;  2P9P B;  4N47 A;  4H0O A;  4W5N A;  1VQM N;  1GLA G;  2UU9 K;  4KHQ A;  2O8F A;  5AQU A;  1XNR K;  3ZT1 A;  4CBU A;  2WFB A;  4DV1 K;  5KTQ A;  2A42 A;  4DR5 K;  1XC9 A;  4DLE A;  4CGF A;  2FSN A;  2NRR A;  2J4R A;  4CHZ A;  1CZ9 A;  4AM6 A;  3HPO A;  3CCL N;  3D6R A;  2YNH A;  3LAK A;  1QSS A;  4CJL A;  3THY A;  1XMQ K;  4ELV A;  1FXX A;  4B8A B;  5J2N A;  3R8E A;  4JK9 A;  1JL1 A;  3MED A;  3V9U A;  4OLA A;  1UA0 A;  1OH7 A;  4DCH A;  1S72 N;  1JCE A;  2H3G X;  3V4I A;  3V1O A;  4CED A;  1NBW A;  1IKY A;  1SQK A;  4FJI A;  1KCF A;  4BGB A;  4DFM A;  3I0R A;  2Q0R A;  4C1N K;  5AJ3 K;  3VQD A;  2QWN A;  4BC3 A;  3SV3 A;  1UOC A;  4B1U B;  4CEA A;  3OBY A;  2BE2 A;  1KAZ A;  1KD1 O;  2P5G A;  4JRP A;  3NGZ A;  2UXB K;  4KBO A;  3EY1 A;  3WQT A;  3MN6 A;  1MDU B;  2HHS A;  2D4W A;  5ADX H;  3ZET B;  4CW7 B;  1SL1 A;  1LWF A;  4B1V A;  4JN4 A;  4CHY A;  3V81 A;  5CZ1 A;  1GLB G;  3H3O B;  1BIU A;  4Q0B A;  3NF7 A;  3AO4 A;  1RBV A;  4FJX A;  1ASV A;  4CGH A;  3VQP A;  4DSK A;  3HVT A;  2YHA A;  4BR9 A;  5M1F A;  2WON A;  4LH5 A;  1VSJ A;  4WFN L;  4JI5 K;  3DOK A;  4M3U A;  4X62 K;  4CJQ A;  1HYS A;  2FSK A;  1EXQ A;  1C1C A;  4KH4 A;  4B8C A;  4PKH A;  4CFC A;  1IBM K;  4PY5 A;  3KKS A;  5BPL A;  4IFE A;  4CHN A;  3NAE A;  4KH6 A;  5AZJ A;  1KLN A;  2VG5 A;  3AO3 A;  4ILG B;  2JGU A;  1HX1 A;  1NGI A;  3RMC A;  1RGI A;  1J5E K;  4LFA K;  1VSM A;  4CEE A;  3PV8 A;  2EHG A;  1N6Q A;  5E84 A;  2QKK A;  4B9N A;  1ZXO A;  4KTW A;  4MQ3 A;  2ASO A;  4OGC A;  3L2R A;  4O8U A;  1C0G A;  2OCE A;  3KKR A;  3PUF A;  1QZ5 A;  2HHV A;  2A6A A;  5HRR A;  2ZE2 A;  4RW4 A;  2D0P A;  5AQY A;  2Z1G A;  2P9N A;  1TK8 A;  2UUA K;  5JVG L;  3LAN A;  1BL3 A;  4NLB A;  4K43 A;  4FLW A;  3NGI A;  1HRH A;  2QTD A;  1X3N A;  2IVO A;  4IXC A;  4FCY A;  4LF8 K;  5B8H A;  4ZHR A;  1S5J A;  2E1Y A;  3CCE N;  4DUY K;  3V9Z A;  5HRP A;  5AZI B;  3M8R A;  2OPS A;  1G15 A;  3VA3 A;  3L2W A;  3FZK A;  4NCG A;  3H45 C;  5K14 A;  4CK2 A;  5I3U A;  1S22 A;  1T6C A;  4FJL A;  1YTU A;  3CJ1 A;  5FPE A;  1KTQ A;  4HVJ A;  2UXD K;  4OKE A;  4DF4 A;  4WFB L;  3NE6 A;  1YJ9 N;  4DHY A;  4DSI A;  3PX0 A;  5JS1 A;  3EYZ A;  3L2U A;  3CC2 N;  3DMJ A;  1FKP A;  4DKW A;  2ETJ A;  3O9S A;  5TKY A;  2WBN A;  3DWL A;  4FO0 A;  2P9K A;  1CXU A;  3K58 A;  3QEI A;  3ZT3 A;  4MO4 A;  4DU1 A;  2NZT A;  3SZ2 A;  4CZF A;  1O13 A;  3L2V A;  4RW7 A;  1N32 K;  4CBX A;  4FLZ A;  1RNH A;  4W5O A;  4MLE A;  1ZYQ A;  4LH4 A;  4CF0 A;  1KC8 O;  3CME N;  5GIO A;  4B3T K;  4CCH A;  3H6E A;  3KD5 E;  4DR7 K;  1TAQ A;  2QWR A;  4A2B A;  3SPZ A;  1VRU A;  2G8K A;  5GAD P;  4OO1 J;  5FLX O;  3ENB A;  3MMV A;  4N56 A;  2HVH A;  3RSE B;  2W40 A;  3PIP L;  3VQ6 A;  3DLR A;  4AM7 A;  2X6N A;  3VEN A;  4FWK A;  1ZBI A;  3J8A A;  4IG3 A;  2KFN A;  2Y1J A;  3ISN C;  2DFF A;  1ATS A;  2CH5 A;  2CGJ A;  4IOC L;  3VN5 A;  4FK2 A;  4FW1 A;  3AVM A;  2QI2 A;  1T03 A;  3HRG A;  3QFP A;  4F4K A;  1OVQ A;  3QML A;  2RKI A;  4C8M A;  4W5Q A;  2Q97 A;  1KRP A;  3A2F A;  3LDP A;  4XEI A;  3CCM N;  5DK5 A;  2Q36 A;  3QEW A;  3HJF A;  1NMN A;  4FSV A;  1QQN A;  3D7E O;  1BIZ A;  4YDU A;  3NCI A;  1P8Z A;  5HBM A;  5EU7 A;  2OPQ A;  1Q7Y O;  4JS5 A;  2DFH A;  3ENH A;  3PLA A;  3MCA B;  3OJU A;  3AVA A;  3OYH A;  3WEE A;  3P39 A;  3QER A;  2FBV A;  1KFS A;  1BU6 O;  3P1G A;  4BG8 A;  3J80 O;  3K9J A;  2O4G A;  4M7X A;  4Y1D A;  4CZG A;  5DM6 L;  4IO8 A;  1YF5 L;  4CHO A;  4UQG A;  2G8H A;  3VOV A;  1NK6 A;  1SV5 A;  1M90 O;  3U4L A;  3UKU B;  1IO2 A;  3MN9 A;  1VSE A;  3LDL A;  3LP3 A;  2GUI A;  4Q5V A;  2YNI A;  5HOO A;  3CJB A;  4CJ7 A;  3J7Y P;  3N4Q A;  4JKB A;  4AIL C;  3NH0 A;  4N41 A;  4M7Y A;  1JXB A;  2D0C A;  2BAN A;  3HP6 A;  1WUA A;  3DI6 A;  5E41 A;  1W2B M;  3CPE A;  4CJU A;  4IO9 L;  4HUE A;  3SCX A;  4YY3 K;  2P5O A;  1UWB A;  2UUB K;  1BO5 O;  2UUC K;  2EWS A;  1Z6R A;  1QQC A;  4AHV A;  3T19 A;  5KI6 A;  2E6M A;  1WAJ A;  3P31 A;  3T69 A;  3ZSX A;  3ZT2 A;  4ILH A;  3TAF A;  3TAQ A;  4W5R A;  1VQ8 N;  2DTU A;  3K5L A;  4CJW A;  1KFD A;  4DQ8 A;  3AO5 A;  3NVM A;  4AHC A;  1RT6 A;  2P51 A;  5AR0 A;  2KTQ A;  3FFK B;  3EN9 A;  3SV4 A;  3VEV A;  3RTV A;  1WSI A;  2PY5 A;  4H0T B;  4B3S K;  2D5R A;  3J81 O;  3TAR A;  1RTH A;  2EX3 A;  4A62 A;  4CEQ A;  4B3O A;  4E1N A;  4OJR A;  3LAL A;  1RBU A;  1NK8 A;  3HPG A;  3BF3 A;  4DSF A;  1NG9 A;  3AVL A;  3RRH A;  3SQ2 A;  2DFE A;  2F96 A;  5J2M A;  4ISE A;  2GTD A;  2O8F B;  4I9Q A;  3IRX A;  5SZT A;  4BR0 A;  3KVG A;  3RMB A;  1HKC A;  2P9U A;  3OYI A;  3KLI A;  3ZCM A;  1Q9Y A;  4K42 A;  1EWR A;  1EWQ A;  4YOR A;  2FXU A;  5IWA K;  4B3M K;  3WNF A;  2ZJQ L;  4FM2 A;  3THY B;  4H8K A;  4OPH A;  4BRH A;  5M1K A;  5HP1 A;  1TL3 A;  1NK9 A;  1HNZ K;  3O8M A;  3P5J A;  1Q82 O;  1FJG K;  3BF1 A;  4GKK K;  1C0U A;  2FSJ A;  2PFU A;  1YIT N;  2AP1 A;  3DLG A;  1NJX A;  4LF7 K;  5EOY A;  5AQV A;  4BE2 A;  3VET A;  3RMD A;  2F4V K;  4QAG A;  3V9X A;  4M3W A;  5FPN A;  1WLJ A;  1RTI A;  1RT1 A;  3ALY A;  3C0B A;  1JXE A;  3D2F B;  5C0Y A;  1NGB A;  2JLE A;  4OVL A;  3WXI A;  4CEO A;  4H5N A;  4DMN A;  4EZ9 A;  4A2A A;  1YI2 N;  3F5T A;  2IIR A;  4FJJ A;  3RVC A;  1UAX A;  3FR0 A;  3L4I A;  1K8K B;  4CFD A;  4DQI A;  3TWH A;  4C8L A;  1VSL A;  1JLA A;  5MLC Q;  1IG9 A;  2F8T A;  4CJP A;  4C23 A;  4F3O A;  4Z4C A;  3M8S A;  1KVC A;  4MO5 A;  4E89 A;  3SMP A;  1RT3 A;  4JKG B;  3UE5 A;  3S3N A;  4BRQ A;  1QVF M;  1TAU A;  5AQT A;  1DEJ A;  4J8F A;  3SNN A;  2KFZ A;  2UYT A;  2P9I B;  4BRC A;  1L3U A;  3TAB A;  1U2V A;  1HR0 K;  2VQF K;  2NRX A;  3OS0 A;  4KKO A;  1YAG A;  5AQF A;  4PQU A;  1ZBL A;  2HVI A;  3E9O A;  1RDW X;  1TK0 A;  2GWK A;  1TL1 A;  2E2Q A;  1TKD A;  4DSJ A;  3LPU A;  4BQL A;  2HHX A;  1BGX T;  4O5B A;  3ZLJ A;  1HKB A;  1IKW A;  3KK7 A;  4CJV A;  2B4J A;  2CGL A;  3UKR A;  4LD0 A;  3VF2 A;  4A5B A;  4Z4E A;  4LSN A;  4B9U A;  4EZ6 A;  4BRF A;  4ID1 A;  3F9K A;  3ZX0 A;  3LWM A;  4PUO A;  1HNI A;  4KHY A;  4Z4G A;  2E2O A;  2ASP A;  1GOB A;  4OPK A;  3JXU A;  1C0M A;  3HSC A;  2PAV A;  4JHD B;  1YVU A;  4WQ5 A;  2QWM A;  1NGH A;  3V6D A;  3TAP A;  4CJE A;  3B6P A;  1TKZ A;  1RT4 A;  4DV5 K;  4CI6 A;  4BRD A;  2HBL A;  4FWN A;  3KHY A;  5C2D A;  2O4I A;  3DXM A;  4NYN A;  1XHZ A;  4BVO A;  3OYC A;  3RR7 A;  1JLB A;  2IOC A;  3HST B;  4FWO A;  3HL8 A;  1QQO A;  3ZX3 A;  3B8A X;  1A5W A;  1J9A A;  2F9T A;  3SYZ A;  3MXM A;  4KRE A;  2JWL A;  4HCC A;  3AVB A;  1LWE A;  2IDO A;  1BG3 A;  3HZ6 A;  2QW9 A;  4F2S A;  4FOI A;  2HBK A;  1JLC A;  3GOI A;  4K41 A;  2VWB A;  3SAF A;  1YJW N;  3SMS A;  2OYQ A;  2FBT A;  2BGG A;  4DTS A;  1WBD A;  3C7N A;  3O4Q A;  4K8X A;  2YCH A;  1NJY A;  3UB5 A;  3SI6 A;  4LC9 B;  2YKM A;  3GBT A;  2XRI A;  3AVJ A;  2E2N A;  2NRH A;  2Q0U A;  1F21 A;  4X64 K;  5E26 A;  4CF8 A;  1LAW A;  3MK6 A;  2NRT A;  4B1Y B;  5HRS A;  3ZEU B;  2FBX A;  5AQJ A;  3VPZ A;  2VGN A;  4YDU C;  5FPM A;  3AVN A;  4NXM K;  3VEO A;  3O4W A;  3QO9 A;  5F2R A;  5JIC A;  1GOC A;  3D2E B;  4O44 A;  2UXC K;  3NF8 A;  4BR2 A;  4OX9 K;  2X78 A;  4NCA A;  4DR1 K;  1B92 A;  1NNE A;  1HLU A;  4M3Y A;  1XHX A;  3N4P A;  3NF6 A;  2NUB A;  5J2P A;  3AAQ A;  4BVP A;  5KGX A;  3LAM A;  1XC3 A;  3HI0 A;  1TYQ A;  4DQQ A;  1VSI A;  1NGA A;  3QEP A;  2Q3S A;  3E66 A;  1HPM A;  2W41 A;  4FJH A;  1MA9 B;  4CJF A;  3S9H A;  2AJQ A;  3L6Q A;  3ZSW A;  4M42 A;  4RW9 A;  3TTC A;  4F3T A;  4UY8 O;  1T6D A;  2BTF A;  4LFC K;  3U9Z A;  1SL0 A;  3K57 A;  1NOZ A;  3S3M A;  4BWJ A;  4J2B A;  2LSN A;  2YX6 A;  2O8E A;  3LP1 A;  4HCB A;  2RN2 A;  4IWV A;  2P9L B;  5ADX A;  5HL7 L;  1RDD A;  2Y1I A;  3ZT0 A;  1SKS A;  1S1V A;  4DS4 A;  4JAX A;  3AY9 A;  5DM7 L;  3SQ4 A;  3QIO A;  5J2Q A;  3KK1 A;  2O8C A;  1HMV A;  3AVI A;  1NK5 A;  1QHA A;  3S41 A;  4CEZ A;  4BWM A;  3WUH A;  4IEI A;  1T05 A;  2GUP A;  4MFB A;  3LDN A;  4BRO A;  3CCU N;  3OTO K;  2YHX A;  3VQ8 A;  3ENO A;  4TSX A;  4IDH A;  2HB5 A;  3LL3 A;  4NYF A;  3E9L A;  1CLQ A;  3DXK B;  1WSF A;  5D3G A;  4DTR A;  4U7B A;  4GMJ B;  1VAZ A;  4CVN E;  5AQP A;  4YOX A;  3JYT A;  1VQN N;  3A5N C;  3CD6 N;  3KK3 A;  3F73 A;  2IAJ A;  4BRK A;  1WAF A;  4CZK A;  4PL8 A;  1J54 A;  4H0P A;  2KZM A;  3L8B A;  1BI4 A;  5CZ2 A;  3ZT4 A;  1JCG A;  4FZY A;  4EFH A;  3I33 A;  3DJC A;  4JI2 K;  4PHT X;  3DLE A;  4CJK A;  2G8U A;  1N33 K;  3O5B A;  3VQE A;  4NO7 A;  4BR4 A;  3EKS A;  2HST A;  3QB0 A;  3U9D A;  3C95 A;  3MCP A;  3RMA A;  3AAR A;  3CFR A;  3I55 N;  4FJ8 A;  5GIP A;  4HTU A;  3O9R A;  5HRN A;  1K6Y A;  3VQ5 A;  1NJI O;  4KHP K;  1MWM A;  4CZM A;  4FWQ A;  4QS9 A;  4M3X A;  4YOV A;  2CH6 A;  2HMI A;  1BIS A;  1RIL A;  1GOA A;  1ZBH A;  3SAG A;  1IJJ A;  4H0Y B;  4H0V B;  3IKM A;  1JLE A;  3DYA A;  3ULE B;  3H1Q A;  1QQM A;  2OPP A;  2P9U B;  3ID6 A;  1NLV A;  1YIJ N;  5CE3 A;  3VES A;  4JI4 K;  3OYF A;  5H1S Q;  3CHW A;  2HHQ A;  3SJH A;  1DLO A;  1SUQ A;  2F8S A;  3BZC A;  1KXP A;  3CCJ N;  4MDA A;  4CFA A;  4HUF A;  1OH5 A;  5AQN A;  2P9S B;  1NGC A;  1LW2 A;  4JRQ A;  5FPD A;  5AQH A;  3JAM O;  4F9O A;  3MWT A;  4CE9 A;  1Z05 A;  3THX B;  3R3L A;  3THW A;  3K59 A;  4FJ5 A;  3H1V X;  4H0X B;  4BRG A;  5JLF A;  4QCL A;  1K9M O;  5CYM A;  4XH5 A;  1VQL N;  5M1N A;  4ELU A;  2W6L A;  3D45 A;  3V9W A;  2I7P A;  1T8E A;  4FK0 A;  4AHR A;  3HP9 A;  3VQ4 A;  3IDH A;  5AQX A;  4CGD A;  3OYN A;  1JJ2 M;  1A5X A;  4DQP A;  3C65 A;  4GV3 A;  3O1B A;  1ESV A;  5KPT A;  3JSM A;  3DAW A;  3MEE A;  2RPI A;  2ASM A;  4I6M A;  4DF8 A;  1RCH A;  3MN5 A;  4GY2 B;  2HF3 A;  3SBT A;  5I42 A;  1Q18 A;  3VQC A;  3CCQ N;  1LW0 A;  1XI1 A;  5KPZ A;  1ZC6 A;  1WSH A;  4DR2 K;  2G8W A;  1S1T A;  1C0F A;  5BR9 A;  3TU5 A;  4O55 A;  1DGK N;  4B9L A;  3U3Y A;  2OTL N;  5F1X A;  4LY7 A;  1U49 A;  3R6M A;  3TTD A;  1U48 A;  4BRP A;  4FXD A;  5CHI A;  1GLD G;  3MX5 A;  4WQ5 C;  2E8A A;  5M1P A;  4E7H A;  2A41 A;  4WQ4 A;  2RHK A;  3MEC A;  1QZ6 A;  4DS5 A;  5BRH A;  1RBR A;  3AV9 A;  4KB0 A;  1VQ7 N;  3O3G A;  2O8D B;  4LF9 K;  5FDL A;  1EQY A;  2O8B B;  4OPA A;  3OYJ A;  3T1A A;  3MAQ A;  1BHL A;  1I3A A;  3U6F A;  4J2D A;  1E3M A;  1S9G A;  1R59 O;  3UKR B;  1BCM A;  3HO1 A;  3T1Y K;  4XIU A;  1U4B A;  3LWL A;  4CES A;  5AQZ A;  3CC7 N;  4NCB A;  2R7Y A;  4AHU A;  3DRR A;  5GAG P;  1SKR A;  4EHU A;  4K0K K;  4YOY A;  3NVK A;  4RW6 A;  3TAN A;  3CIP A;  4KV8 A;  1HJR A;  3ZX2 A;  2ZGY A;  4NB4 A;  4RCH A;  1C0T A;  3HVR A;  4FLU A;  4JI8 K;  4RTF D;  1L3T A;  2OPR A;  3DRS A;  3A5L C;  1OVY A;  3OYL A;  1VSF A;  4I2P A;  5HLF A;  2HNY A;  3AGK A;  3VER A;  4IBN A;  3SLC A;  4C8O A;  4OKJ A;  1CZA N;  2VCP A;  3ZET A;  4CHP A;  2DY4 A;  4L8R B;  2OTJ N;  3A5O C;  3AO1 A;  4FJN A;  4BC4 A;  4DTX A;  2FLO A;  3KJV A;  3A8Y A;  3G4S N;  2PZS A;  3WNH A;  3VGK A;  3I8B A;  1WB9 A;  5KQD A;  3EE9 A;  4DFJ A;  1Y64 A;  1IG8 A;  1JLQ A;  1E4F T;  3CER A;  5EVZ A;  4ELT A;  4HHT A;  3AO2 A;  3CJC A;  2BH1 A;  3ZSY A;  3L3V A;  3QNO A;  3C7N B;  2ZJP L;  1BA1 A;  4RW8 A;  1D9F A;  2WOM A;  1V4S A;  1GLC G;  1QE1 A;  3G71 N;  4DR3 K;  2ITM A;  1QHT A;  1K8A O;  1BQM A;  3LM2 A;  5HRO A;  3GG4 A;  3LZJ A;  3HTV A;  3T7Z A;  3RWU A;  3K5O A;  3K9K A;  4F2R A;  1T44 A;  4ILJ A;  2E5L K;  1VSD A;  2KQ2 A;  2A5X A;  3ZYY X;  4KI6 A;  2A1R A;  2V7Y A;  4FWR A;  4KB1 A;  1I94 K;  3L0Q A;  5LJW A;  3QBX A;  4A61 A;  3NH2 A;  4GNI A;  3CM6 A;  3R1X A;  4FJ7 A;  3EE8 A;  3I56 N;  4IJN A;  5AQR A;  4KRF A;  1TYQ B;  5AQL A;  1ASW A;  1V4T A;  4KFB A;  5T7B A;  4M3Z A;  3G25 A;  3FZM A;  5F0X A;  2ZD1 A;  3ZSQ A;  4BC2 A;  1GLL O;  2AA4 A;  1HYV A;  2GWJ A;  4KH5 A;  2YHW A;  4JK7 A;  1N8R O;  4WYB A;  3M6G A;  3HXM A;  4FL9 A;  3EZW A;  3WQU A;  4JYA K;  1D4X A;  3DLL L;  2O8E B;  1JL2 A;  3LPT A;  3SBG A;  1RDU A;  3Q7C A;  3MXJ A;  4JI3 K;  4FVU A;  1WSJ A;  4FLY A;  1J6Z A;  3W3D A;  4L3Q A;  2QA4 N;  1X1P A;  3BZK A;  5M1Q A;  3AA5 X;  4WFA L;  3A0I X;  1SS6 A;  4CD1 A;  3IUC A;  1VQ9 N;  3CC4 N;  3SJJ A;  3WXL A;  3O9Q A;  4A5A A;  1W97 L;  4BRM A;  1N36 K;  5C24 A;  4JI7 K;  5GIN A;  3QIC A;  4CF9 A;  1NK7 A;  4H03 B;  3MXI A;  3O4N A;  3RRG A;  1VQ4 N;  2G8V A;  4E19 A;  3OYM A;  2ZF5 O;  3WT0 A;  3CCR N;  4JS4 A;  4DTU A;  5FRN A;  2QK9 A;  2HF4 A;  2VQE K;  3QIP A;  3QLH A;  5C10 A;  2VG7 A;  3TAG A;  4AHT A;  4DFP A;  4BRL A;  3M8Q A;  3TAM A;  3OHR A;  4DTO A;  2IGI A;  3RSE A;  4G1Q A;  3KIO A;  2E2P A;  3AVG A;  3ATV A;  5AZJ B;  3TSQ A;  3SK3 A;  2PYL A;  4BE0 A;  2RE2 A;  4RG8 A;  1ASU A;  3IMX A;  4JKA A;  3AVF A;  4FJM A;  4CFB A;  5BN8 A;  4FOE A;  4BRE A;  4DTM A;  3EKU A;  4DSL A;  4E3S A;  4B3R K;  1SL2 A;  5J1E A;  5EX5 A;  2IVP A;  3QDK A;  4FPA A;  4EAH D;  4R5P A;  4FK4 A;  2NRZ A;  1U6Z A;  2HBM A;  4JD2 A;  2P9N B;  4N76 A;  3CCS N;  3KLF A;  3FGU A;  4B08 A;  1Q9X A;  2QEX N;  1Y97 A;  1BOT O;  4I9L A;  4ID5 A;  3TPQ A;  3TSU A;  1BQN A;  1X9J A;  1ITG A;  1XUP O;  5CR4 A;  1D5A A;  2W6K A;  1RT5 A;  4U67 L;  1WOQ A;  3IG1 A;  1KAY A;  5C25 A;  1YUW A;  2P1J A;  1NGF A;  1BCO A;  3ITH A;  5CYQ A;  4ZTJ A;  4QS8 A;  4EP5 A;  4M3T A;  3MX2 A;  1QVG M;  4G9Z A;  1NU0 A;  4DQS A;  4PL7 A;  4X66 K;  1TVR A;  1DKG D;  3FLC O;  3KLG A;  4B1W B;  4IFV A;  3UKU A;  3O9U A;  4KHN A; 
#chains in the Genus database with same CATH homology
 3JYT A;  3E01 A;  3THV A;  3VN5 A;  2XY6 A;  3KK3 A;  3F73 A;  1Z25 A;  2IAJ A;  1WAF A;  4FW1 A;  1TK5 A;  4FK2 A;  3RR8 A;  1J54 A;  2KZM A;  3AVM A;  4C8K A;  4Z4F A;  3L8B A;  4BDY A;  3VQ9 A;  4FZX C;  1BI4 A;  1T03 A;  5CZ2 A;  3PY8 A;  4DG1 A;  2FBY A;  4F4K A;  2RKI A;  3ZT4 A;  4FZY A;  4C8M A;  4W5Q A;  1KRP A;  1RDB A;  1RT2 A;  3TI0 A;  1SKW A;  3A2F A;  3DLE A;  4CJK A;  2G8U A;  5DK5 A;  3QEW A;  3VQE A;  2QKB A;  3HJF A;  2IS3 A;  4OKK A;  4FLT A;  3C95 A;  4OLB A;  1S1U A;  2HHT A;  3NFA A;  3VQ7 A;  1U47 A;  1JLG A;  2G8F A;  1TGO A;  4B9T A;  3OS1 A;  1JKH A;  3RMA A;  1BIZ A;  3C94 A;  3CFR A;  4IFY A;  1RDA A;  4CGI A;  3NCI A;  1IKV A;  5HBM A;  3DLH A;  4FJ8 A;  2GBZ A;  4H4O A;  4HTU A;  5EU7 A;  2OPQ A;  5HRN A;  4W5T A;  4JS5 A;  1K6Y A;  2DFH A;  3VQ5 A;  4KI4 A;  3OJU A;  4DFK A;  3LP0 A;  1IKX A;  3AVA A;  4YFU A;  3OYH A;  4HUG A;  1NJZ A;  4Z4I A;  3QER A;  1W0H A;  3D0P A;  4M3X A;  1C1B A;  1EKE A;  2FBV A;  1KFS A;  3KD1 E;  1YTA A;  3L3U A;  3P1G A;  3AVK A;  2HMI A;  4DTJ A;  4Z0U A;  1BIS A;  4UQG A;  2O4G A;  4Y1D A;  4KHU A;  1C1A A;  3CYM A;  4CHO A;  1RIL A;  1GOA A;  2HHU A;  2OA8 A;  1S1W A;  2G8H A;  3ZSV A;  1NK6 A;  1SV5 A;  1ZBH A;  1VRT A;  2ZQB A;  1IO2 A;  1JLE A;  3DYA A;  2QXF A;  1VSE A;  2A1S A;  2OPP A;  4DTN A;  1J53 A;  2GUI A;  3LP3 A;  4Q5V A;  2XHB A;  3ZSR A;  1S1X A;  3KTQ A;  4CGJ A;  2YNI A;  1X9W A;  4M45 A;  4DU4 A;  3OYF A;  3I8D A;  1BI4 B;  1YT3 A;  4AIL C;  3NH0 A;  4N41 A;  1D9D A;  2HHQ A;  1DLO A;  4Z4H A;  1SUQ A;  2F8S A;  3KLH A;  1JXB A;  2D0C A;  2BAN A;  3HP6 A;  3V1Q A;  3DI6 A;  1B9D A;  1QTM A;  5E41 A;  4CJU A;  4CER A;  4CFA A;  4HUF A;  4PWD A;  4M41 A;  1HQU A;  4JRQ A;  1LW2 A;  4CJ5 A;  4CJ4 A;  4HUE A;  3SCX A;  4CE9 A;  3NH1 A;  2P5O A;  1RBT A;  1UWB A;  3SQ1 A;  1DTT A;  4GW6 A;  3PO5 A;  4FZZ A;  4CIG A;  1A5V A;  1QQC A;  3PX4 A;  3K59 A;  4AHV A;  3AA3 A;  4FJ5 A;  3T19 A;  5KI6 A;  4FW2 A;  1RTJ A;  1WAJ A;  2E6M A;  3BGR A;  4CJT A;  4KHW A;  4QCL A;  1NKE A;  3ZSX A;  1QSY A;  5CYM A;  3ZT2 A;  4CEC A;  3TAF A;  3TAQ A;  4W5R A;  4KHS A;  2DTU A;  3K5L A;  4CJW A;  1KFD A;  3HT3 A;  1LV5 A;  4FLX A;  3AO5 A;  4AHC A;  1X9S A;  4ELU A;  2VG6 A;  1RT6 A;  2P51 A;  4KO0 A;  3P83 D;  5JS2 A;  5KRS A;  3HK2 A;  1TKX A;  3D45 A;  4EP4 A;  2KTQ A;  3V9W A;  3SV4 A;  1T8E A;  4FK0 A;  3RTV A;  1NJW A;  4AHR A;  3TAE A;  1WSI A;  3HP9 A;  3VQ4 A;  2PY5 A;  4CGD A;  2D5R A;  3O3H A;  1A5X A;  4FVM A;  3OYN A;  3SUQ A;  1KSP A;  4B9M A;  4DQP A;  1FK9 A;  4PA1 A;  1RTH A;  2EX3 A;  1CZB A;  1O1W A;  3U3G A;  4CEQ A;  3JSM A;  3MEE A;  3TAR A;  2RPI A;  4B3O A;  4E1N A;  4OJR A;  3LAL A;  1RBU A;  1NK8 A;  1FKO A;  3HPG A;  1U45 A;  4KAZ A;  4DF8 A;  1RCH A;  4DSF A;  3AVL A;  2XO7 A;  3RRH A;  4N5S A;  4QOZ B;  1VSK A;  3SQ2 A;  3SPY A;  2DFE A;  2F96 A;  4O0I A;  5J2M A;  5I42 A;  3WNG A;  4DTP A;  3BDP A;  1KVB A;  3OYE A;  3VQC A;  1Q8I A;  3ZSZ A;  4E0D A;  3PX6 A;  3ASM A;  1LW0 A;  4AH9 A;  1XI1 A;  4FJ9 A;  4IDK A;  4I9Q A;  3IRX A;  5SZT A;  1T7P A;  1WSH A;  2G8W A;  1S1T A;  3RMB A;  4O55 A;  3OYI A;  4B9L A;  3U3Y A;  4J2A A;  4E7K A;  1VSH A;  3KLI A;  4LY7 A;  3ZCM A;  1Q9Y A;  2VWK A;  1U49 A;  1KVA A;  3AVC A;  1U48 A;  3NDK A;  4FXD A;  3DOL A;  3MEG A;  2I5J A;  4J2E A;  3C6U A;  4E7H A;  3WNF A;  4FM2 A;  3MEC A;  4H8K A;  4LSL A;  4DS5 A;  1UA1 A;  4E1M A;  1RBR A;  3AV9 A;  4KB0 A;  5HP1 A;  3O3G A;  1TL3 A;  5FDL A;  1NK9 A;  1TKT A;  3CM5 A;  3P5J A;  5CY4 A;  3T1A A;  1BHL A;  1I3A A;  3OYJ A;  3MAQ A;  1DTQ A;  1W9H A;  4H4M A;  1C0U A;  3T3F A;  3U6F A;  1N5Y A;  5KGW A;  4J2D A;  3V1R A;  1S9G A;  4CF2 A;  3DLG A;  2X74 A;  1NJX A;  3QET A;  1WNS A;  4B9V A;  1BCM A;  4BE2 A;  3SUN A;  1HPZ A;  3HO1 A;  3RMD A;  4QAG A;  3V9X A;  4M3W A;  1J5O A;  1WLJ A;  2YNF A;  2OZS A;  1RTD A;  4IG0 A;  1RTI A;  4XIU A;  1RT1 A;  3LWL A;  1U4B A;  4CES A;  3QEX A;  3SUP A;  4NCB A;  3ALY A;  1JXE A;  2R7Y A;  4AHU A;  4I2Q A;  3DRR A;  2JLE A;  3HYF A;  4OVL A;  4AHS A;  4CEO A;  1SKR A;  3AVH A;  3FFI A;  4RW6 A;  3DLK A;  4DMN A;  3S3O A;  1C6V A;  4EZ9 A;  2XY7 A;  4DSE A;  3LP2 A;  3TAN A;  4KPY A;  4KV8 A;  4FJJ A;  1HJR A;  3DLB A;  4FJG A;  2FC0 A;  1UAX A;  1ZBF A;  4CFD A;  4DQI A;  3TWH A;  4C8L A;  2HND A;  1VSL A;  3KLE A;  3IS9 A;  1RDC A;  2GV9 A;  1HNV A;  4WE1 A;  1JLA A;  3OYD A;  3SQ0 A;  1IG9 A;  4CJP A;  2F8T A;  1Z26 A;  4KTQ A;  4FLU A;  1C0T A;  2D0A A;  4Z4C A;  3HVR A;  4F3O A;  3M8S A;  2G8I A;  1KVC A;  1L3T A;  2OPR A;  4CEB A;  3OYB A;  3DRS A;  4CK1 A;  4E89 A;  4YNQ A;  1REV A;  3OYL A;  1JLF A;  1RT3 A;  2Z1H A;  1VSF A;  4I2P A;  3S3N A;  5HLF A;  4N47 A;  2HNY A;  4CIE A;  3OS2 A;  4IBN A;  4C8O A;  4OKJ A;  4W5N A;  4CJS A;  2IC3 A;  3AA2 A;  2KW4 A;  4KHQ A;  1TAU A;  4CHP A;  2DY4 A;  3ZT1 A;  5DMR A;  4L8R B;  2YNG A;  2KFZ A;  4O4G A;  3SNN A;  3AO1 A;  1WN7 A;  5KTQ A;  1XC9 A;  4FJN A;  1HYZ A;  4DTX A;  4DLE A;  4DLG A;  2Z1J A;  4CGF A;  3KJV A;  1L3U A;  3TAB A;  3VQB A;  3DM2 A;  2PZS A;  3IAY A;  3WNH A;  3OS0 A;  4CHZ A;  4KKO A;  1CZ9 A;  4PQU A;  4DFJ A;  3HPO A;  2RF2 A;  1JLQ A;  1U04 A;  1QS4 A;  1ZBL A;  2HVI A;  1TK0 A;  2YNH A;  4ELT A;  3LAK A;  4HHT A;  3AO2 A;  1TL1 A;  1QSS A;  2KZZ A;  4KTZ A;  4CJL A;  4ELV A;  3ZSY A;  1FXX A;  4B8A B;  3L3V A;  3CQ8 A;  3QNO A;  5J2N A;  1TKD A;  4DSJ A;  1JL1 A;  3LPU A;  3MED A;  4RW8 A;  1D9F A;  3V9U A;  4OLA A;  1UA0 A;  2WOM A;  2HHX A;  1BGX T;  1QE1 A;  4ICL A;  4O5B A;  3V4I A;  2XY5 A;  1QHT A;  1IKW A;  3V1O A;  4CJV A;  4DWI A;  2B4J A;  4CED A;  1IKY A;  1BQM A;  3HM9 A;  4LD0 A;  1KCF A;  4DFM A;  4FJI A;  4Z4E A;  3I0R A;  4LSN A;  5HRO A;  4DQR A;  3LZJ A;  4B9U A;  4EZ6 A;  3VQD A;  3RWU A;  3V9S A;  3SV3 A;  2E4L A;  1UOC A;  3K5O A;  3OVN A;  4ID1 A;  3F9K A;  4CEA A;  1L5U A;  3LWM A;  4F2R A;  2BE2 A;  4PUO A;  1HNI A;  2P5G A;  4KHY A;  2BDP A;  4Z4G A;  1GOB A;  4OPK A;  3HPH A;  5C42 A;  3VQA A;  4JRP A;  1C0M A;  3NGZ A;  3CFO A;  2ITG A;  3EY1 A;  1YVU A;  1X9M A;  1VSD A;  2KQ2 A;  2HHS A;  2HW3 A;  4KI6 A;  4O0J A;  3V6D A;  1LWF A;  2A1R A;  1SL1 A;  3V81 A;  4CHY A;  4KB1 A;  1S6Q A;  3TAP A;  3AA4 A;  4B9S A;  4CJE A;  3B6P A;  1TKZ A;  4GVM A;  5CZ1 A;  1S9E A;  1RT4 A;  3OYK A;  1BIU A;  4Q0B A;  3NF7 A;  2O4I A;  3K5M A;  4NYN A;  1XHZ A;  3NH2 A;  4FJ7 A;  3CM6 A;  4CHQ A;  3OYC A;  5FRM A;  3AO4 A;  3M8P A;  2E6L A;  3RR7 A;  1JLB A;  2IOC A;  1RBV A;  3HST B;  1ASV A;  4JLH A;  3VQP A;  4CGH A;  4DSK A;  4FJX A;  4KRF A;  3HL8 A;  1ASW A;  1NK4 A;  3HVT A;  4KFB A;  2YHA A;  3WNE A;  1B9F A;  5T7B A;  4M3Z A;  1A5W A;  1J9A A;  3SYZ A;  3MXM A;  2WON A;  4LH5 A;  1VSJ A;  2ZD1 A;  3ZSQ A;  4KRE A;  1HYV A;  1ZBU A;  4HCC A;  3AVB A;  1LWE A;  2IDO A;  3DOK A;  3DRP A;  4M3U A;  4F2S A;  4CJQ A;  1HYS A;  4K8Z A;  3NHG A;  1EXQ A;  1C1C A;  1JLC A;  4B8C A;  3HXM A;  2X6S A;  1NOY A;  4CFC A;  2OYQ A;  3ULD A;  1EP4 A;  3KKS A;  4PY5 A;  2FBT A;  4CHN A;  1JL2 A;  3NAE A;  2BGG A;  1KLN A;  3NBP A;  3LPT A;  4DTS A;  3I0S A;  2VG5 A;  3AO3 A;  3PO4 A;  3MXJ A;  3O4Q A;  2JGU A;  1WSJ A;  3G10 A;  4FM1 A;  4E7I A;  4FLY A;  3RMC A;  3UIQ A;  4K8X A;  3G0Z A;  1MU2 A;  2W42 A;  1VSM A;  4FJK A;  1EET A;  4CEE A;  1X1P A;  3PV8 A;  2XY8 A;  2EHG A;  1NJY A;  3AA5 X;  1N6Q A;  3ZSO A;  3KK2 A;  2QKK A;  4B9N A;  1NKC A;  3NGY A;  4KTW A;  3SI6 A;  4MQ3 A;  2YKM A;  3L2R A;  4OGC A;  3B6O A;  2XRI A;  3KKR A;  3H08 A;  3AVJ A;  3PUF A;  3SJJ A;  2HHV A;  4I7F A;  1WSE A;  4C8N A;  1F21 A;  5HRR A;  2ZE2 A;  4RW4 A;  3NF9 A;  2YV0 X;  4CF8 A;  4E7J A;  4FLV A;  1LAW A;  3VQQ A;  5C24 A;  4CJR A;  3CFP A;  2Z1G A;  3O3F A;  5HRS A;  4CF9 A;  1NK7 A;  2FBX A;  1TK8 A;  4IKF A;  1HQE A;  3LAN A;  2D0B A;  3O4N A;  4CEF A;  1BL3 A;  3MXI A;  4FLW A;  3NGI A;  3RRG A;  2YKN A;  1RBS A;  4E19 A;  5KRT A;  3OYM A;  1HRH A;  2G8V A;  1EX4 A;  1QSL A;  3AVN A;  4JS4 A;  1S6P A;  4DTU A;  5FRN A;  3SUO A;  4FCY A;  2QK9 A;  3QO9 A;  4ZHR A;  3QIP A;  3QLH A;  1S5J A;  1GOC A;  2VG7 A;  3TAG A;  4O44 A;  3V9Z A;  4AHT A;  3NF8 A;  1D8Y A;  4CJ3 A;  1TV6 A;  5HRP A;  4DFP A;  1XWL A;  2X78 A;  3M8R A;  1IH7 A;  1VK0 A;  3M8Q A;  4NCA A;  1WSG A;  2OPS A;  1G15 A;  1B92 A;  3TAM A;  3VA3 A;  3L2W A;  3VA0 A;  4DTO A;  4NCG A;  4M3Y A;  1XHX A;  2IGI A;  3NF6 A;  4G1Q A;  2NUB A;  5K14 A;  4CK2 A;  3KIO A;  5J2P A;  5I3U A;  2PYJ A;  4FJL A;  3TR8 A;  3LAM A;  5KGX A;  3OJS A;  1YTU A;  3AVG A;  4DQQ A;  1VSI A;  3QEP A;  2Q3S A;  4FYD A;  1KTQ A;  4HVJ A;  4Y1C A;  4FJH A;  4OKE A;  2PYL A;  4DF4 A;  3LDS A;  4CJF A;  1LAV A;  3NE6 A;  4BE0 A;  3S9H A;  2AJQ A;  4DSI A;  3ZSW A;  4RG8 A;  2YHB A;  3PX0 A;  1ASU A;  4M42 A;  5JS1 A;  3EYZ A;  1RT7 A;  3L2U A;  3AVF A;  4RW9 A;  4F3T A;  2ATQ A;  3DMJ A;  3QIN A;  4CFB A;  4FM0 A;  4FJM A;  1FKP A;  4F8R A;  1LWC A;  2ETJ A;  4DTM A;  3QNN A;  1SL0 A;  3K57 A;  1NOZ A;  4DU3 A;  3S3M A;  4BWJ A;  5SWM A;  4BE1 A;  1CXQ A;  2LSN A;  4DSL A;  4E3S A;  4J2B A;  1CXU A;  1SL2 A;  3K58 A;  3QEI A;  5J1E A;  3ZT3 A;  3LP1 A;  4HCB A;  2Z1I A;  4DU1 A;  2RN2 A;  4R5P A;  1L3V A;  4FK4 A;  2HHW A;  3SZ2 A;  1NK0 A;  3L2V A;  4N76 A;  4ZTF A;  4OGE A;  3KLF A;  5FRO A;  1RDD A;  4RW7 A;  1KLM A;  3ZT0 A;  1S1V A;  4B08 A;  2Y1I A;  1Y97 A;  1SKS A;  1Q9X A;  4DS4 A;  2B6A A;  4I9L A;  4ID5 A;  3LZI A;  1BQN A;  4FLZ A;  1ITG A;  3SQ4 A;  3C6T A;  1D5A A;  3QIO A;  4CF1 A;  3KK1 A;  5J2Q A;  1RNH A;  4W5O A;  2VWJ A;  1RT5 A;  1L3S A;  1ZYQ A;  4CGG A;  1HMV A;  4LH4 A;  4CF0 A;  3AVI A;  3IG1 A;  3K5N A;  1NK5 A;  3CG7 A;  4CCH A;  5C25 A;  3KD5 E;  3EZ5 A;  4CEZ A;  1TAQ A;  4BWM A;  4CK3 A;  2P1J A;  4E7L A;  2OZM A;  3QES A;  1T05 A;  2B5J A;  3SPZ A;  1VRU A;  1BCO A;  3OYA A;  3OYG A;  4MFB A;  2G8K A;  3K2P A;  4BDP A;  4N56 A;  3L2Q A;  3ITH A;  5CYQ A;  4ZTJ A;  2HVH A;  4M3T A;  4EP5 A;  4BDZ A;  3VQ8 A;  2HNZ A;  4TSX A;  4OPJ A;  2HB5 A;  3VQ6 A;  1NKB A;  3DLR A;  4NYF A;  3QEV A;  1I39 A;  4DQS A;  1CLQ A;  1TVR A;  2X6N A;  1ZBI A;  4CIF A;  3KLG A;  3OY9 A;  4IG3 A;  1WSF A;  4BAC A;  2Y1J A;  1R0A A;  5D3G A;  4M3R A;  4IFV A;  4DTR A;  4GMJ B;  2KFN A;  3ISN C;  2DFF A;  4KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...