1BI4A

Catalytic domain of hiv-1 integrase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
molecule keywords INTEGRASE
total genus 42
structure length 142
sequence length 152
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bi4A00
3SCXA 2RKIA 1BI4B 2KQ2A 3KKSA 3HVRA 3L2UA 4JS4A 4CJUA 3QIOA 4PQUA 4CF0A 3A2FA 3G10A 4KKOA 4J2EA 1IKVA 4CEEA 1RTIA 3ZSWA 3C94A 4Y1CA 4CJ3A 5CZ1A 3OYHA 3AA3A 3AO1A 4FM2A 4AILC 1C6VA 3QLHA 3VQEA 1IO2A 1REVA 2DFHA 1UOCA 4N41A 4G1QA 1HNIA 4CJWA 3K57A 1CXUA 4DSKA 4F3TA 1WSGA 1NJWA 3LDSA 3AVKA 1J9AA 4CGJA 1U45A 1HYZA 4CF1A 3L2VA 1SKRA 4FLVA 3F73A 1JXBA 1UA0A 2QKKA 2Z1JA 3AA4A 1RDDA 4FLUA 3HPOA 1QTMA 1S1UA 2PYLA 3L3VA 3KLGA 3PY8A 5FDLA 3ZT0A 2OPQA 4YNQA 3KK3A 2ZD1A 1RTDA 3AO4A 3L8BA 3IAYA 3M8RA 2G8IA 3CYMA 4CFAA 3S3NA 4OLAA 1R0AA 2WONA 1S1VA 4YFUA 3SUNA 1W0HA 1RCHA 1VSIA 2G8HA 1ZBFA 4W5OA 5C42A 4HTUA 3K2PA 2B4JA 4B9TA 4CHZA 1LWCA 4KHQA 4CEFA 4HVJA 4BDZA 3IS9A 2XY5A 3SQ4A 1D5AA 3KIOA 4CEZA 1SKSA 4W5NA 5HRSA 4CEAA 2P1JA 4TSXA 4DSFA 5J2NA 3V6DA 1X9SA 4KI6A 1NOZA 4FJ7A 1WAJA 2BANA 3NDKA 4E7IA 4BE2A 3TAMA 1ZBLA 1Z25A 4KI4A 3HXMA 2AJQA 4DTSA 4FJ5A 3V1RA 4ID1A 2HHXA 1B92A 1GOCA 2FBVA 3ZT4A 3OYCA 3L2RA 5DMRA 4GW6A 5SZTA 4KO0A 4I9LA 1JKHA 1DTQA 3LP1A 3OVNA 3DOLA 4B8CA 3EY1A 1ASUA 5K14A 3I8DA 2F96A 3BDPA 4FZXC 1IKXA 1HJRA 3OYGA 1XHZA 2KTQA 2HB5A 3QINA 3L2QA 5HBMA 4CJVA 4DQSA 3QEIA 3CQ8A 1BHLA 2OZMA 1W9HA 4KHUA 3DRRA 1C1CA 1X9WA 1HQUA 3TAQA 2F8TA 3MECA 2EX3A 4CGIA 2G8FA 4M3XA 4QAGA 3OYLA 2BDPA 3I0RA 4AHRA 1C0UA 4DQQA 3SJJA 3CM6A 4CF2A 4E7LA 4Y1DA 2Q3SA 3ZSVA 3KTQA 3V81A 4CK2A 1TVRA 3T19A 1WSJA 4HCBA 4CF9A 1B9DA 1BL3A 3HK2A 1X1PA 4JS5A 3V9ZA 3V9WA 1TK0A 3AVNA 4CGGA 4CGDA 4WE1A 3NGIA 1L3VA 4OJRA 4IG3A 1FKOA 3QNNA 3AVFA 2YNGA 4IDKA 3CFRA 4DQPA 3AVJA 3NBPA 5DK5A 1BIZA 3DLBA 3MXIA 4Z4GA 3NFAA 1BI4A 4FLYA 3SPYA 3ASMA 2XY6A 5I42A 4CJPA 1XHXA 3ZSRA 1TK8A 3OYNA 1CLQA 3LAMA 4DQRA 2A1RA 3MEEA 3PX0A 1QSYA 3LWLA 3NCIA 3G0ZA 2EHGA 4PUOA 4DTRA 4FW2A 1VSHA 4DSJA 4N76A 3RR8A 4KHWA 3LWMA 4C8OA 4FK0A 3WNHA 3DM2A 1NK6A 3TR8A 3ZSYA 3B6PA 3KD5E 2KZMA 2I5JA 1XI1A 5C25A 3AVBA 4FW1A 4AHUA 4CJ4A 4DTXA 4CE9A 5EU7A 2LSNA 4CK1A 3V9UA 2HHVA 3O3FA 4FLXA 1TL3A 1BISA 4O4GA 4M3RA 5KTQA 1RBUA 4B9LA 1L3SA 3ZCMA 3OYIA 2B6AA 5HRRA 2KFZA 4NCGA 3JSMA 3NF6A 4LY7A 5KI6A 3PX4A 1VSKA 5HP1A 2P51A 4KTZA 3O4NA 3OYFA 4M41A 3P83D 4NYFA 4RW4A 2ZQBA 3EYZA 3KK2A 1S9GA 4H4MA 4FJMA 3P5JA 3U3GA 2HHTA 2FBYA 1NK4A 3AVLA 4B8AB 2GUIA 1WSHA 5CY4A 1HYVA 3PUFA 4R5PA 4KAZA 1RT6A 3AVGA 4AHCA 4H4OA 4Z0UA 3VA0A 1KLNA 4L8RB 3FFIA 5KGXA 3HSTB 4O0IA 3OS1A 2Z1IA 5J2PA 1LAWA 4KB1A 3LZJA 4M42A 3QIPA 3AVHA 4E19A 1J54A 1RNHA 4CGFA 3ZT1A 2YKNA 4OKJA 2JLEA 3V9SA 3VQAA 2XY7A 1HMVA 4CJFA 1TGOA 1U48A 3QESA 4B9SA 1VSEA 4CCHA 2O4IA 4I2QA 2X78A 3M8PA 4BWMA 4Z4CA 1QQCA 3OS0A 1QSSA 3SZ2A 3U3YA 3CG7A 1EP4A 2X6NA 3AVMA 3ZT3A 4KTWA 3SNNA 2O4GA 1RBTA 4CIEA 3SV3A 2KZZA 2IDOA 1Q8IA 4OGCA 3T1AA 1NK5A 1J5OA 1ZBHA 4AH9A 1LWEA 4CHOA 4EZ6A 3TARA 3LZIA 4Z4EA 2D0CA 1S6PA 4KTQA 1BQMA 3O4QA 4GMJB 3WNGA 2D0BA 4FLTA 1U47A 1KRPA 4F3OA 2BE2A 4CFCA 1KVBA 1NJXA 1RT1A 2Y1JA 4I2PA 4I7FA 3V9XA 1KCFA 4GVMA 3AO5A 1RBSA 2Z1GA 3PX6A 4PA1A 1NK0A 2G8UA 4Z4HA 3KLEA 4CJTA 3C6UA 4FJJA 3DYAA 3DLKA 4FLZA 1MU2A 4N47A 3VQPA 1J53A 3TI0A 2YNIA 4MFBA 4NYNA 4LSLA 2B5JA 1A5WA 4C8NA 3VQQA 4CK3A 2QKBA 2HNYA 2HHQA 4E7JA 3HYFA 4FK2A 3DRSA 3OY9A 1S1TA 1F21A 1JLGA 2XY8A 3TAFA 4J2AA 4M3WA 4FM1A 3MEGA 4OVLA 1A5XA 2GV9A 2W42A 3K59A 1S9EA 2IC3A 4DF4A 1SV5A 1YTAA 1RDCA 2YV0X 1KLMA 4J2DA 5CYQA 4ZHRA 3V4IA 4IFYA 4PWDA 1T03A 1IKWA 1GOBA 5HRPA 2HHSA 4C8KA 5J2QA 4B9MA 4DU1A 4KFBA 1S5JA 1I3AA 1NOYA 1CZ9A 4JRPA 4FJ8A 2FBTA 4JLHA 4O0JA 4DTPA 5KRSA 1WSIA 4DG1A 4KHYA 1UWBA 4QOZB 1B9FA 3JYTA 1KVCA 4DWIA 4CJLA 1C1AA 2A1SA 3M8QA 1VSDA 3DI6A 3V1OA 1SKWA 2PYJA 4B08A 3HO1A 2GBZA 1L3TA 4FJ9A 2DY4A 2D0AA 3HJFA 3L2WA 4FK4A 1TAQA 1S1WA 2JGUA 1FK9A 4OLBA 3WNEA 4DS5A 1ZBUA 4ELVA 4J2BA 1KFDA 2HNZA 3VQ5A 3S3OA 1N5YA 1IKYA 4CEOA 4KREA 1TKXA 4IFVA 2OA8A 1A5VA 3QNOA 3OYJA 1K6YA 3CFOA 4O44A 4RW7A 2PY5A 4ICLA 5KRTA 3VQ4A 2P5GA 3HP9A 4ID5A 1VSFA 4HUEA 1VRUA 4FJKA 3CFPA 3ZSOA 1NJYA 3VQ7A 5HRNA 3EZ5A 1X9MA 4FYDA 3VQ8A 1RDBA 1RILA 1Z26A 2HNDA 3IRXA 3TABA 4FXDA 1VSLA 4AHVA 4OKKA 4B9UA 4RG8A 4W5QA 1SL2A 4HCCA 3DLRA 3DLGA 3KLHA 2YHAA 3RMCA 4DQIA 4CESA 4BE1A 4ELTA 4CHPA 1RDAA 1JL1A 2HMIA 2QK9A 4F2RA 3KJVA 5C24A 4E7KA 2KW4A 4FCYA 3SUPA 1LWFA 3M8SA 2HVHA 1TKTA 3AVCA 1ZBIA 3MEDA 2DTUA 3LAKA 4W5RA 4E0DA 4ZTFA 1ASVA 4FJXA 4CHNA 1JLAA 1ASWA 3VQ6A 3PO4A 1VRTA 4BE0A 3U6FA 3OYKA 3S9HA 1I39A 1HRHA 1DLOA 4CJQA 4QCLA 1SUQA 3TWHA 5HLFA 4NCBA 1BQNA 2P5OA 4MQ3A 1EETA 1RTHA 3OYAA 3OYEA 1FKPA 1FXXA 3HPHA 4CGHA 1L5UA 3DLHA 1LV5A 3HL8A 2VWKA 3B6OA 4CECA 4CIFA 1G15A 3NH2A 4DFMA 3AO3A 2RF2A 3D45A 3AA2A 3I0SA 4FZYA 4B9VA 4DFJA 4CERA 3VN5A 4E1NA 3TANA 2G8KA 4M3UA 4IG0A 4IKFA 3NGZA 1NK8A 2KFNA 1EX4A 3QEWA 2FBXA 3D0PA 4C8LA 3QO9A 4M3ZA 3NH0A 4EZ9A 3NH1A 4OKEA 4KB0A 1XC9A 2XRIA 3DLEA 1NKBA 1JLBA 3RMBA 4DU3A 4ZTJA 3S3MA 4E1MA 5KGWA 1GOAA 4DSEA 1SL1A 1KFSA 2XHBA 1QS4A 1IG9A 2VG6A 4BWJA 1JLFA 3TAEA 3AVIA 4LSNA 3NHGA 4Q5VA 3QEPA 4RW9A 1D8YA 1RT4A 1ZYQA 2OPRA 3KKRA 1C0MA 4B9NA 2ETJA 1WSFA 4Q0BA 1DTTA 3VQDA 3OYDA 4FJNA 4N5SA 4DU4A 4O5BA 4DLGA 3AA5X 1CXQA 1D9FA 4OPJA 3KK1A 4CJRA 4CFDA 3RMAA 1WN7A 3NF7A 5HROA 4CFBA 1RBVA 1CZBA 3O3GA 5I3UA 3QERA 2XO7A 2E6LA 4DSLA 1BCOA 1VSMA 3AVAA 2YNFA 1WAFA 2IOCA 3VQCA 3P1GA 1RT3A 4LD0A 4CJKA 2IGIA 3K5NA 4CJ5A 4E89A 4DF8A 1U04A 3C6TA 3QETA 4KHNA 1RTJA 2RN2A 3HT3A 1JL2A 1LW2A 2HHWA 3NF8A 1TV6A 2VWJA 2IS3A 4DTUA 3KLIA 1S6QA 3NE6A 4DTJA 3KD1E 2Y1IA 4CF8A 4DS4A 3OS2A 1EKEA 1D9DA 4ELUA 4B3OA 3BGRA 4EP5A 4W5TA 4FM0A 4O55A 4CEDA 2PZSA 1TKZA 3AV9A 2OYQA 3HPGA 2G8VA 2NUBA 3MXJA 4OGEA 3OJSA 2G8WA 3LPUA 3RWUA 2OPPA 3O3HA 2VG5A 1RT7A 4FLWA 4CIGA 4E3SA 3NGYA 1L3UA 3K5MA 1HNVA 2ITGA 3SPZA 4Z4IA 2X6SA 4CHQA 2IAJA 3QEXA 3MXMA 1Q9XA 1U49A 3RRHA 1Y97A 4K8ZA 2HHUA 1RT2A 4CEBA 3VA3A 4F2SA 1WSEA 1UAXA 1LW0A 1WLJA 3DRPA 3IG1A 3LALA 2Z1HA 3THVA 3RR7A 4CJEA 3SQ2A 4F8RA 5JS1A 3RRGA 2D5RA 2F8SA 1YT3A 4FZZA 2ATQA 3LP0A 1BCMA 4M3TA 3SQ1A 2DFEA 4OPKA 2HVIA 1S1XA 4Z4FA 1C0TA 2E4LA 2R7YA 3VQ9A 3ITHA 1O1WA 3TAGA 3K5OA 1XWLA 3ZT2A 4F4KA 4KRFA 1QHTA 1HYSA 1JLQA 3H08A 3ISNC 4JRQA 4CHYA 3E01A 3HP6A 1TAUA 2DFFA 4E7HA 1QE1A 4AHSA 2X74A 3K5LA 3TAPA 1RT5A 1T05A 1TKDA 4DSIA 5J1EA 3VQBA 1T7PA 4H8KA 1KTQA 2WOMA 4C8MA 3OYMA 3HVTA 3OYBA 4I9QA 2BGGA 4FJLA 1YVUA 4KPYA 3SV4A 1NK9A 1EXQA 1C1BA 4BACA 3SI6A 1NKEA 2OZSA 4IBNA 4XIUA 4HHTA 3SYZA 3MAQA 5D3GA 5FRMA 4FJGA 3NAEA 3WNFA 1Q9YA 1IH7A 3SQ0A 3UIQA 4K8XA 4UQGA 3ZSZA 3OJUA 2RPIA 4CJSA 1HQEA 5JS2A 4BDYA 4DFKA 1N6QA 4DTOA 3SUQA 3QEVA 1BIUA 4DMNA 3K58A 4KHSA 4AHTA 3LP2A 1LAVA 2OPSA 1BGXT 3LANA 5J2MA 2YNHA 1JLCA 3RTVA 4BDPA 2E6MA 1ITGA 1RBRA 3F9KA 3KLFA 4NCAA 4HUGA 1QSLA 3DOKA 5T7BA 5CZ2A 3PO5A 1TL1A 4DTMA 2YHBA 4N56A 1TK5A 1UA1A 3V1QA 4M45A 2ZE2A 3ULDA 4KV8A 2FC0A 5CYMA 4RW8A 1JLEA 3AO2A 3C95A 4DFPA 3DMJA 4DTNA 3RMDA 1NJZA 4M3YA 5FROA 1YTUA 1NK7A 3PV8A 4DLEA 3LP3A 1WNSA 3L3UA 1VSJA 4HUFA 1U4BA 1HPZA 5FRNA 4FVMA 3CM5A 1KVAA 4LH4A 4CEQA 1SL0A 4EP4A 2HW3A 4RW6A 3ZSXA 3NF9A 3LPTA 5SWMA 1VK0A 3ZSQA 3ALYA 5E41A 3T3FA 1JXEA 1KSPA 4LH5A 1T8EA 4FJIA 2QXFA 3SUOA 1NKCA 3HM9A 4PY5A 4FJHA 2YKMA 2VG7A
chains in the Genus database with same CATH superfamily
1BI4B 2KQ2A 3HVRA 3L2UA 4JS4A 4PQUA 4CF0A 3CCQN 4BVOA 2IVPA 1RTIA 3C94A 4Y1CA 3CCVN 1GLCG 1LCUA 5LJVA 3W3DA 4FM2A 2H3GX 1QQMA 5HOOA 1REVA 4CJWA 1WSGA 1QVGM 2E2NA 4JKCA 1U45A 4GY2B 3D6RA 3EKSA 4CF1A 1SKRA 4RTFD 3AA4A 1S1UA 5JLHA 3KLGA 4ISFA 3CC2N 5FDLA 4YNQA 3PY8A 1RTDA 2G8IA 4DR2K 4CFAA 4OLAA 1R0AA 1S1VA 3SUNA 4W5OA 5C42A 3K2PA 4B9TA 4CEFA 4K42A 4W5NA 5HRSA 4TSXA 1NOZA 1WAJA 4HTLA 4E7IA 3THXB 4KI4A 3HXMA 2AJQA 3V1RA 1GOCA 2FBVA 3OYCA 3L2RA 1EWRA 1GLBG 3L4IA 3ATVA 5CR4A 3LP1A 3OVNA 3DOLA 2ZGZA 4BRHA 1NBWA 1ASUA 4FZXC 2F96A 1BO5O 2CH6A 2F9TA 3SAFA 2HB5A 3QINA 3QEIA 5HBMA 1YJNN 1X9WA 3J7AP 4CGIA 4M3XA 4B9QA 4AHRA 3HBTA 4DQQA 2BTFA 1N32K 5GAEP 3IMXA 4BR4A 1NNEA 3N4QA 3V81A 5AQFA 4HCBA 4CF9A 1BL3A 4LF4K 1IG8A 4EZ6A 1FJGK 4WE1A 4OJRA 3QNNA 5C10A 1NGFA 3VENA 3CFRA 3AVJA 5DK5A 5HL7L 4BROA 4IZ9A 1V4TA 5I42A 3ZEUA 1XHXA 3ZSRA 3KWIA 1CLQA 4ILHA 3TSQA 1QSYA 3LWLA 3VGMA 4PUOA 1VSHA 4DSJA 4CBUA 4FWQA 3E1YA 4FK0A 2WBNA 5FPNA 3ZSYA 1XI1A 4FW1A 3QFPA 4IOCL 4AQYK 2LSNA 5F2RA 3O3FA 4FLXA 2A41A 4IEIA 3BF1A 4O4GA 4A61A 4BRGA 4B9LA 2KFZA 4B1VA 2Q2RA 5HP1A 3CJ7A 2P51A 3O4NA 4K25A 1KAXA 3P83D 4RW4A 2ZQBA 5AQRA 4H4MA 4FJMA 1P8ZA 2HHTA 1EO1A 1IV0A 3AVLA 5A2QO 2GUIA 1WSHA 4FWRA 3HOTA 5CY4A 4CZMA 4KAZA 3LM2A 1KLNA 2A3ZA 2ZF5O 3HSTB 2Z1IA 1LAWA 3D2EB 4WYBA 4BR5A 1I94K 5AQMA 2YKNA 4OKJA 5KPZA 4DR3K 2XY7A 3CCUN 1J6ZA 1U48A 4B9SA 2O4IA 1YVNA 4BWMA 4WQ5C 3RSEA 1QQCA 5F0XA 3OS0A 4DUYK 2X6NA 3AAQA 4CIEA 2KZZA 1Q8IA 3T1AA 1ZBHA 3LZIA 5AQQA 4IDHA 2BE2A 4CFCA 1RT1A 1Q81O 2Y1JA 2GTDA 3R8EA 3AARA 3CC7N 1VQ9N 1ESVA 1RBSA 5AQJA 2NRTA 3KLEA 3EKUA 4FJJA 3G25A 4N47A 3D2FB 3GG4A 2ASPA 1J53A 4OPAA 2ZWHA 4BC5A 5KQ8A 2B5JA 1A5WA 3VQQA 5BR8K 3K9JA 1HNWK 4G9ZA 1S1TA 4M3WA 1NGGA 1IJJA 1JCFA 4FL9A 1S9EA 3EL2A 5IWAK 3A5NC 1K8AO 3FGUA 4GV3A 3V4IA 4ZHRA 4IFYA 2HHSA 5HRPA 3O1WA 3BF3A 5J2QA 4C8KA 4XH4A 1CZ9A 2PAVA 4FWMA 2FBTA 4QS9A 4JLHA 4O0JA 4DTPA 4DG1A 3VEYA 4CZGA 1B9FA 2ZJPL 3DXKB 2A1SA 3M8QA 1VSDA 3CJAA 1L3TA 2BH1A 2P9KA 1S1WA 2CGJA 4DS5A 1ZBUA 1HX1A 3S3OA 2RHKA 2QWLA 4O8UA 3OYJA 1K6YA 2PY5A 2P5GA 3T69A 3HP9A 1HNXK 3H45C 5JMVA 2HNDA 4FXDA 3UE5A 4AHVA 5AQKA 1SL2A 3C7NB 3DLRA 4L3QA 3KLHA 3RMCA 2D4WA 1M90O 1KXPA 1RDAA 3DXMB 4CHPA 5C24A 3CPEA 3F2KA 3O8MA 3CJ9A 1TKTA 1ZBIA 3LAKA 4CVNE 4ZTFA 1ASVA 3S9HA 1C0FA 1HRHA 3J80O 1DLOA 4CJQA 4B1UB 1BQNA 4YOWA 1X3NA 1EETA 3NVMA 3LDQA 5BREA 3OYEA 2P9SB 1L5UA 3B6OA 2NRVA 2AP1A 3F9MA 1XNQK 4B9VA 2WC9A 1BOTO 1J5EK 4M3UA 4IG0A 4IKFA 3NGZA 1NK8A 3D0PA 3QO9A 2Q0RA 3QFUA 3NH1A 4KB0A 1O13A 5AQIA 1XC3A 4DU3A 1Q86O 1GOAA 1KFSA 1IG9A 4JKAA 4BWJA 1JLFA 3TAEA 4PL8A 2OPRA 1C0MA 1WSFA 1DTTA 3VQDA 4FJNA 3P4IA 4DLGA 1D9FA 3KK1A 1WN7A 1RBVA 1CZBA 2XO7A 4DSLA 1BCOA 3FZMA 1K8KB 2IGIA 4CJ5A 1U04A 1RTJA 2UUAK 3HT3A 1LW2A 3G6EN 3WT0A 2VWJA 1EWQA 2IS3A 1D4XA 3ZX0A 3O4WA 3S41A 3KD1E 4EHTA 4XEIA 4CF8A 1EKEA 1XQSC 4FM0A 2OYQA 4O55A 4CEDA 3AGRA 2O8DA 4LFAK 4J8FA 1SZ2A 1RT7A 4FLWA 3QB0A 4GKKK 1L3UA 3K5MA 2ITGA 3HM8A 2IAJA 3DJCA 1WSEA 3THVA 1HUXA 3LALA 3IG1A 3SQ2A 2NRHA 3RRGA 2F8SA 4DHYA 1YT3A 4YDUC 4FSVA 1BCMA 1JJ2M 4OPKA 1S1XA 2UU9K 4OPHA 4F4KA 4DR7K 1XWLA 3UKRB 3ISNC 4CHYA 3E01A 4A57A 3R3LA 1RT5A 4DSIA 3A8YA 1T7PA 3WQTA 1KTQA 2WOMA 3OYMA 1RFQA 3HVTA 3H3NO 3TPQA 4BRPA 5C0YA 1NK9A 1HLUA 3VEWA 3BY5A 4RWTA 1NKEA 2OZSA 3A5OC 4JEPA 3MAQA 4JAXA 4BRMA 5C12A 3SQ0A 3FLCO 1NU0A 3C6AA 3O9TA 4FWSA 5ELZA 5EX5A 3R1XA 1S3XA 4KBOA 1K8KA 1QSLA 3DOKA 5CZ2A 3ULEB 2YHBA 4N56A 3ATUA 3BZKA 4M45A 2ZE2A 5AJ3K 1JLEA 1SQKA 1NJZA 5FROA 3CERA 3CMAN 1NK7A 1U4BA 1WNSA 4HUFA 4FWKA 3CM5A 1KVAA 3C6HA 4FWLA 3ENBA 4DR5K 1U2VA 1VK0A 4A2AA 2P9NA 1OKJA 4FJIA 3ENHA 5TKWA 2VGNA 3CI5A 3M3ZA 1NGAA 2YKMA 1Y64A 3CCLN 2RKIA 1RDUA 3M5RA 5JVGL 1BUPA 3ZSWA 3MN9A 4H0OA 2CGLA 2OTJN 3PSFA 1DKGD 2YHXA 4JI7K 3AA3A 2E1ZA 1NGJA 1IO2A 1E4GT 2DFHA 4O5FA 1BA0A 5KPTA 4F3TA 1J9AA 1HYZA 3T1YK 1RDDA 2QI2A 4FLUA 1QTMA 2UYTA 4I6MA 3B8AX 3L3VA 3WEEB 3L8BA 5AQSA 3ZYYX 2WONA 1RCHA 1VSIA 1ZBFA 3I55N 2B4JA 4CHZA 1LWCA 4X66K 2XY5A 1K9MO 3SQ4A 4CEZA 1SKSA 4CEAA 5GIOA 4KI6A 1VHXA 4FJ7A 1S72N 2IIRA 4NLCA 4BE2A 1VQ7N 1ZBLA 4OX9K 4QS7A 2ASOA 3VTIA 2V51B 4FJ5A 3SBGA 4GW6A 5SZTA 3SK3A 3EY1A 2NRXA 5JVHL 2ZJQL 1IKXA 1BDGA 1HJRA 3OYGA 5ADXH 3L2QA 4H0YB 1BHLA 2OZMA 2OANA 3DRRA 1C1CA 2F8TA 2VQFK 1N33K 2O8CB 2BDPA 3CETA 3CD6N 1VQKN 1NGEA 3I8BA 4EFHA 3U4LA 1VQNN 3ZSVA 4M7XA 3KTQA 2KHOA 1ZBSA 3T19A 1WSJA 4I6MB 4JS5A 3CPWM 2DPNA 3L6QA 1YIJN 5FPEA 1XMOK 4IDKA 3KHYA 3NBPA 3ID8A 5I9EB 3MXIA 4Z4GA 1DGKN 2Q0UA 3ASMA 2XY6A 1TK8A 1GLFO 4H5NA 4JI8K 3PX0A 1RGIA 4H5RA 4PKGA 4DTRA 2HF3A 4N76A 3VETA 4JKFA 3WEEA 3RR8A 3LWMA 4C8OA 1NK6A 3KD5E 3BP8A 4AHUA 5BRHA 4UY8O 4CE9A 4H03B 2F9WA 5GIPA 4JD2A 1RBUA 3J7YP 3ZCMA 5HRRA 3NF6A 2O8FA 4NYFA 2WTUA 4BY9C 3TU5A 3GL1A 3U3GA 1LOTB 4M7YA 3A5LC 3QBXA 4DCHA 4R5PA 3AVGA 4K43A 3VA0A 2VGMA 4L8RB 3FFIA 4JKGA 3LZJA 1TYQA 3AVHA 3MN6A 3ZT1A 4NO7A 2P9PB 1TGOA 4CCHA 3QESA 1VSEA 2X78A 4JKGB 3U3YA 3CG7A 3ZT3A 1HKCA 4YOTA 4H0PA 2Q31A 3SV3A 4LFBK 2IDOA 5EY4A 1NK5A 4BRKA 3TARA 1OVQA 1S6PA 4NB4A 3O4QA 4FLTA 1U47A 1KRPA 2D0BA 4F3OA 1KVBA 1NJXA 3D2EA 5BPMA 1OH6A 5AZIA 3TTFA 3C65A 3ID6A 4LF5K 4Y0WA 4CJTA 3DLKA 4LFCK 4FLZA 1MU2A 2KKZA 2ITMA 4LSLA 3VEOA 4XH1A 5E26A 2HHQA 4DQ8A 4PL7A 4FK2A 4J2AA 2XY8A 1X9JA 4LF9K 3JS6A 3MEGA 4JI1K 2P9NB 3EZWA 2A42A 4ISGA 1ATNA 1KLMA 4J2DA 1P90A 5M1NA 4LF7K 5LL6Z 2I7PA 5M1KA 4B9MA 1S5JA 1I3AA 1NM1A 3WXLA 5KRSA 3IFRA 4PKHA 2GUPA 3FR0A 4QOZB 2J4RA 4IWVA 5AR0A 3JYTA 4DWIA 4CJLA 1SKWA 3DI6A 2D0PA 1TYQB 2HBJA 2DY4A 1TAQA 3U9ZA 3DXMA 2JGUA 4OLBA 3LDNA 3WNEA 2HNZA 1IKYA 1VQ6N 5AQYA 4JK8A 4ICLA 5KRTA 3VQ4A 4FO0A 4BC4A 5AQLA 3E9PA 4JV5K 1VSFA 1VRUA 3CFPA 1K73O 5HRNA 3VQ8A 1RILA 1Z26A 2JWLA 1VSLA 4OKKA 1T3VA 3R6MA 4RG8A 1NGIA 4W5QA 5AQZA 1BU6O 3EN9A 2YHAA 3KZBA 4BE1A 4OO1J 2QK9A 5C2DA 4FVUA 3ZEUB 4MLEA 3M8SA 2HVHA 3AVCA 3MEDA 1XNRK 4W5RA 1YITN 2HBKA 3PO4A 4BE0A 3CCEN 3SBTA 3THYB 2FF6A 3QMLA 1SUQA 4MQ3A 1FXXA 4CECA 3HL8A 3AO3A 2RF2A 3D45A 2JWKA 4CZLA 2FSKA 3VN5A 4E1NA 3TANA 4A2BA 2G8KA 2EWSA 3NVKA 4EZ9A 3FZHA 4OKEA 3CCJN 1HPMA 3O9RA 2P9UA 2VG6A 2O8DB 5AQXA 1RT4A 2A40A 2E1YA 5GAHP 3KKRA 3WUHA 2E2QA 1IBMK 4B3RK 3WQUA 4DV5K 4B1YB 4N5SA 1KAYA 3DLLL 4OPJA 4IXCA 3RMAA 3NF7A 3QERA 4CZKA 5BN8A 3O80A 2YNFA 1WAFA 3P1GA 3H6EA 4E89A 4DF8A 1R59O 3QETA 5GAGP 2RN2A 1TV6A 2WFBA 4DTUA 2Y1IA 4DS4A 3OS2A 4B3OA 4M63C 3HPGA 2G8VA 1JCEA 4BRCA 4H5TA 4AF1A 3LPUA 2VG5A 4CIGA 3NGYA 3H46O 3FFKB 1Q9XA 1U49A 1UAXA 1WLJA 2Z1HA 4CJEA 4F8RA 2D5RA 3OBWA 3T7ZA 5FLXO 3W0LA 3LP0A 4JI0K 4M3TA 2DFEA 1N34K 3K5OA 1QHTA 4JRQA 3H08A 2UXDK 3HP6A 2DFFA 1QE1A 4AHSA 4AM6A 3TAPA 1TKDA 5J1EA 4X64K 5AQWA 2O8BB 1YVUA 3VERA 2E20A 1EXQA 3UB5A 4B3MK 4XIUA 3SYZA 5D3GA 5LMNK 1Q9YA 3Q7BA 4IJAA 3J7ZO 4DR6K 2RPIA 5BN9A 5C15A 1HQEA 3P39A 1BA1A 3HI0A 4DTOA 3QEVA 3SJHA 1BIUA 4DMNA 1LAVA 2UUCK 1JLCA 3HRGA 3WXMB 1ITGA 1RBRA 3KLFA 3K0SA 2PBDA 3PO5A 3K9KA 1TK5A 1QZ5A 3MX5A 2WUSA 3HSCA 4H0VB 5CYMA 4RW8A 3AO2A 3C95A 4DTNA 3RMDA 1NGDA 3E9LA 1E3MA 3MDQA 2V7YA 4YOVA 2RE2A 4CI6A 1SL0A 3ZSXA 2E2PA 3LPTA 3NF9A 5AQPA 4YDUA 3ALYA 1JXEA 2P9LB 4YOUA 3LDOA 2QXFA 3KK7A 1NKCA 2OCEA 4FJHA 4B3SK 2P9IB 4CJUA 3QIOA 2YHYA 3A2FA 3G10A 3IKMA 1IKVA 4CEEA 1EQYA 4CZHA 2QTDA 3E66A 4MDBA 4BGBA 1NGCA 3AO1A 4AILC 3IDHA 2A5XA 1MDUB 1BG3A 3IUCA 1UOCA 4N41A 4G1QA 1HNIA 3K57A 1CXUA 4DR1K 1QQOA 4BG9A 3AVKA 2QA4N 1IBLK 4CBXA 2P9SA 3L2VA 4FLVA 3F73A 1JXBA 1UA0A 2PYLA 3VPZA 3VF4A 3NMUA 1YXQA 2HBMA 3ZT0A 3IAYA 3M8RA 1TUUA 3CYMA 5JICA 3S3NA 3DAWA 4YFUA 1W0HA 4GV9A 4JNEA 3EO3A 3MMVA 4R79A 3G4SN 3KIOA 4FOIA 5AFUA 5J2NA 4CD1A 3V6DA 3NDKA 4WQ4C 3VESA 5EOYA 3TAMA 3VEXA 1Z25A 3DWLA 4DTSA 1RDWX 2OTLN 4ID1A 4BG8A 3ZT4A 5DMRA 4KO0A 4I9LA 3VTHA 1JKHA 2E8AA 3TTCA 3EE9A 5K14A 4WFNL 4DQSA 1W9HA 4KHUA 1HQUA 3MECA 2EX3A 2YCHA 3OYLA 4PHTX 1C0UA 2YHWA 3CM6A 2PFUA 4Y1DA 4CK2A 4X62K 1B9DA 1GLJO 1X1PA 1OH7A 3QDKA 3V9WA 4CD3A 1U6ZA 4IG3A 3RVCA 1FKOA 3AVFA 2VWBA 2O8FB 4F9OA 4DQPA 3NFAA 4IO8A 2W6LA 4DV4K 4DQRA 2A1RA 4LC9B 3MN7A 3G0ZA 3NCIA 2EHGA 1MA9B 4BRLA 3LDPA 5AZJB 4H5VA 4BC3A 3WNHA 3VF6A 1FW6A 3TR8A 3B6PA 2KZMA 4DTXA 4CJ4A 5EU7A 4B1ZA 4CK1A 3V9UA 3CC4N 4FWNA 5KTQA 4A62A 3OYIA 1L3SA 2B6AA 4FWOA 4YOXA 1M1KO 4BRAA 3PX4A 3CJ1A 4KTZA 3OYFA 3OBYA 1S9GA 2FBYA 1DEJA 4B8AB 4BRNA 2FF3B 2QWOA 3KVGA 1HYVA 4V19S 1E4FT 3LL3A 3PUFA 1VQMN 4YOYA 3O1BA 4AHCA 5GINA 5KGXA 4O0IA 5J2PA 3RSEB 4IJNA 3GE1A 4E19A 1RNHA 2QWPA 4JHDB 2P9KB 2JLEA 1Q7YO 3VQAA 1HMVA 5DM7L 5ADXA 3OHRA 3LDLA 1ILYA 3M8PA 2YJEA 1MWMA 1EP4A 2O4GA 1RBTA 3CQXA 4JYAK 1Z6RA 3DXKA 4AH9A 4DV3K 1HJOA 1BQMA 4JD2B 3WNGA 2ZGYA 4I2PA 4I7FA 4GVMA 3MK6A 3AO5A 2Z1GA 3PX6A 4PA1A 1NK0A 2G8UA 2VQEK 3C6UA 2V7ZA 3DYAA 2GELA 3AY9A 3VQPA 4JI3K 1WUAA 4BGAA 4NYNA 4BRQA 2QKBA 2HNYA 2Q1NA 3OY9A 1JLGA 2HMPA 4FM1A 1A5XA 4JK7A 4DF4A 2W40A 1YUWA 2HHHK 1YTAA 1RDCA 3M6GA 5CYQA 2YJFA 3M1FA 3CJBA 5M1FA 1IKWA 4DV6K 2YI1A 4DU1A 5TKYA 1NOYA 5BRFA 5LMUK 1VQLN 4FJ8A 4IOAL 3O9SA 3VOVA 1WSIA 1UWBA 1H1VA 5E84A 1NGHA 2NZTA 3QBWA 2PYJA 4ILGB 3HO1A 4B08A 2GBZA 4FJ9A 4IFEA 5AZIB 3CCSN 3L2WA 5AQGA 4JN4A 3OW2M 4KH4A 4CJ7A 3VQ5A 1N5YA 4KREA 1A5VA 3QNOA 2GEMA 3CFOA 4O44A 2GWKA 4RW7A 5KQDA 3P38A 3ENOA 1HKGA 4ID5A 3P31A 3ZSOA 5BPLA 3VQ7A 1RDBA 3IRXA 3L0QA 5KPRA 4B9UA 3CCMN 4CBWA 3DLGA 4ELTA 4CESA 1JL1A 4JI6K 3KJVA 1GLEG 4CZFA 4BVPA 1T6DA 3VGLA 2I7NA 4BQLA 4FCYA 3SUPA 1LWFA 3VEZA 2DTUA 1GLLO 4EAHD 1QQNA 4E0DA 1JLAA 1ASWA 3VQ6A 1VRTA 3U6FA 3OYKA 4WQ5A 4NCBA 2P5OA 1RTHA 1FKPA 2VWKA 4CIFA 4NXMK 1G15A 2HSTA 2UXBK 4FZYA 4CERA 4H0TB 3WXJA 3QEWA 4K0KK 2FBXA 1TUYA 4M3ZA 3JAMO 5IT9O 1WBBA 2QEXN 2XRIA 4JI5K 3DLEA 1NKBA 3JXUA 3RMBA 4ZTJA 4EIAA 4E1MA 4DSEA 3S3MA 3TTDA 2XHBA 1QS4A 4X65K 3NHGA 4LSNA 4Q5VA 3QEPA 4B9NA 3PIOL 2ETJA 4Q0BA 2W6KA 4B1XB 4DU4A 3AA5X 1KD1O 3L4QA 4CJRA 4CFDA 2GX9A 4CFBA 1ZXOA 4GKJK 1DT9A 2E6LA 2VYPA 1VSMA 3N4PA 4QS8A 1RT3A 4DV2K 4CJKA 3THXA 3C6TA 4O8KA 4KHNA 1OH5A 1JL2A 2HHWA 4YY3K 4IOXA 2E5LK 4DKWA 4DTJA 4EHUA 5H1SQ 1D9DA 4EP5A 1TKZA 2NUBA 3OJSA 2OPPA 3O3HA 3T1HK 4E3SA 3FZLA 4Z4IA 3FZFA 5C2FA 2X6SA 4CHQA 3QEXA 3MXMA 3SAGA 3CF5L 1RT2A 3VA3A 1SAZA 4F2SA 3DRPA 3WXIA 1W2BM 3MCAB 3WXKA 2ATQA 4PKIA 4MLHA 2BUPA 2CGKA 2E4LA 3VQ9A 3ITHA 1HYSA 2O8CA 1TAUA 2NNWA 2YX6A 1T05A 3SMPA 2X74A 2FLOA 1X3MA 4H8KA 4I9QA 2BGGA 4FJLA 1C1BA 1ATSA 4IBNA 4HHTA 1SS6A 4FJGA 3WNFA 3UIQA 1IH7A 4CJSA 4FPBA 4BDYA 4DFKA 2A6AA 3SUQA 3K58A 4U7BA 4KHSA 4BRIA 2OPSA 4FWPA 1BGXT 3LANA 3ULEA 1OVYA 3ZX2A 2E6MA 4NCAA 4AM7A 1NMDA 1IBKK 3VEVA 1TL1A 1UA1A 3GDQA 3MX2A 1NGBA 2FC0A 4E1JA 4M3YA 3DMJA 3PV8A 1W97L 1HPZA 1VQ4N 4FVMA 5FRNA 4LH4A 4CEQA 4NXNK 3FE1A 4EP4A 3BEXA 1T44A 3O9QA 1NWKA 1VQ8N 1KSPA 3O08A 3SUOA 2IVNA 4CZJA 3HM9A 4PY5A 2VG7A 3SCXA 3KKSA 2ZM6K 4KKOA 5EVZA 5F1XA 4J2EA 3H3OB 4BQZA 5B8HA 4CJ3A 5CZ1A 1YF5L 5AQTA 3OYHA 4BR0A 1C6VA 3QLHA 3VQEA 4DSKA 1NJWA 3LDSA 4CGJA 4JI2K 5LJWA 4NLBA 2QKKA 4BR7A 2Z1JA 3HPOA 1Q18A 3KWGA 3KK3A 2OPQA 2ZD1A 3AO4A 4C23A 2HBLA 2G8HA 4HTUA 4H5WA 4BC2A 4KHQA 4HVJA 3MWPA 4BDZA 3IS9A 3O5BA 1D5AA 2P1JA 4DSFA 1X9SA 2BANA 4GV6A 3F5TA 2NRRA 3PIPL 3CIPA 3BZCA 2QWRA 2HHXA 1B92A 1KC8O 5AQVA 1DTQA 2CH5A 4B8CA 3I8DA 3BDPA 1ZC6A 1XHZA 2KTQA 4CJVA 1WBDA 3CQ8A 3FZKA 3CXCM 2QWNA 3TAQA 2G8FA 4QAGA 1G99A 3ZETA 3I0RA 5M1OA 1NG9A 2QWQA 4XH5A 3SJJA 4CF2A 4E7LA 3CQYA 2Q3SA 3OA9A 3THWB 1TVRA 1KAZA 3ZX3A 3HK2A 3V9ZA 1TK0A 3AVNA 2HF4A 4CGGA 4CGDA 3NGIA 1L3VA 1C0GA 2YNGA 4C1NK 4B1WB 1BIZA 3DLBA 1BI4A 4FLYA 3SPYA 1HR0K 4CJPA 1N8RO 3OYNA 1VAZA 3LAMA 1XMQK 3MEEA 5FPMA 5BPNA 3C0BA 1GLDG 4FW2A 3J8AA 4KHWA 1U2VB 3UKUB 4FOEA 3DM2A 2I5JA 5C25A 3AVBA 2V52B 2HHVA 1YI2N 1TL3A 1BISA 4LF6K 3EE8A 4M3RA 4DV0K 1ATRA 2VCPA 4NCGA 4JKEA 3JSMA 4LY7A 5KI6A 4IEEA 1VSKA 4MDAA 1XUPO 4M41A 3HTVA 3EYZA 3KK2A 5AFUH 2ASMA 3VF2A 3P5JA 3R9PA 1NK4A 2QWMA 3HOSA 4MO4A 3I33A 1RT6A 3PLAA 4H4OA 4Z0UA 4B3TK 4M42A 3OS1A 3HJFA 4JKDA 4KB1A 3QIPA 1J54A 4CZEA 4ILJA 4CGFA 3D7EO 3V9SA 1KQSM 4WCEL 4WFAL 4CJFA 3ZLJA 4H0XB 4I2QA 4Z4CA 1QSSA 5DM6L 3SZ2A 3AVMA 3SNNA 4KTWA 3EEQA 4OGCA 1J5OA 1LWEA 2P9PA 2E2OA 4CHOA 3UKUA 1NJIO 2FXUA 4Z4EA 2D0CA 2O8BA 5AQNA 4KTQA 4GMJB 4JKHA 5JLFA 4HWIA 1V4SA 1VQ5N 3V9XA 1KCFA 4CZIA 3SLCA 1YAGA 5AQHA 4BREA 4Z4HA 2O8EB 4DUZK 1QZ6A 3TI0A 2YNIA 3QICA 4K41A 4MFBA 4C8NA 4CK3A 4A5AA 4E7JA 3HYFA 3DRSA 3TAFA 1F21A 4OVLA 2GV9A 3UKRA 4DB3A 1Z05A 3O9UA 2W42A 3K59A 2IC3A 5CE3A 1SV5A 2YV0X 4PWDA 4CW7B 1T03A 1GOBA 4KFBA 4JRPA 1N36K 3CHWA 3THYA 4BRFA 3C7NA 4KHYA 4U67L 2NRWA 3HZ6A 2ZJRL 5GADP 1KVCA 1C1AA 1JCGA 3V1OA 5M1QA 3OTOK 2D1KA 2D0AA 1WB9A 2KLAA 4FK4A 1FK9A 1NMNA 4ELVA 4J2BA 1KFDA 4CEOA 1TKXA 4IFVA 3CMEN 2OA8A 3J81O 4HUEA 4FJKA 1NLVA 4IO9L 1NJYA 1X9MA 2QXLA 3EZ5A 4FYDA 2QM1A 2Q36A 3TABA 3H1QA 4HCCA 4DQIA 2HMIA 4F2RA 4JK9A 1CZAN 3O6WA 1QHAA 3GBTA 4E7KA 2O8EA 2KW4A 4DV1K 1BWFO 3SAHA 3VGKA 4FJXA 4CHNA 5AZJA 3MCPA 4WFBL 1I39A 4QCLA 5HLFA 3TWHA 1GLAG 2QW9A 3E9OA 4KHPK 3OYAA 4BR9A 3HPHA 4CGHA 2IVOA 3DLHA 1LV5A 3MWTA 3NH2A 2Q97A 2P9UB 3MN5A 4DFMA 3I0SA 3AA2A 4DFJA 2KFNA 3H1VX 2NLXA 3THWA 1EX4A 4C8LA 3NH0A 4MO5A 3GOIA 1XC9A 4A59A 1JLBA 5FPDA 1OH8A 2NRZA 5KGWA 4YORA 1SL1A 4BR2A 4KH5A 3AVIA 3CCRN 1D8YA 4RW9A 1MWKA 1ZYQA 4KH6A 3OYDA 4O5BA 4ISEA 1CXQA 3BUZB 5HROA 5I3UA 3O3GA 4JKBA 4JHDA 5BR9A 3AVAA 2IOCA 3VQCA 4LD0A 3K5NA 3U8XA 3ZETB 3NF8A 4C1NI 3KLIA 1S6QA 3Q7CA 3NE6A 3PSIA 4ELUA 3BGRA 3AAPA 4W5TA 2PZSA 2FSJA 3AV9A 3MXJA 4DR4K 2UXCK 2D0OA 4GVEA 4OGEA 3SMSA 2G8WA 3TSUA 3RWUA 3A5MC 1HNZK 3D2FA 1T6CA 1HNVA 3SPZA 1YHQN 2P9LA 2HHUA 4FPAA 1Y97A 2FSNA 3U9DA 3RRHA 4K8ZA 4CEBA 5AQOA 1LW0A 5EXWA 3RR7A 4DV7K 1VQON 5JS1A 1HKBA 2P9IA 4FZZA 3SQ1A 2HVIA 4Z4FA 4GNIA 1C0TA 4WF9L 2R7YA 3TAGA 5AQUA 1O1WA 4KRFA 3ZT2A 1JLQA 4Z94A 1VQPN 2W41A 4E7HA 3K5LA 4BRDA 5MLCQ 3VQBA 4C8MA 3OYBA 4WQ4A 3SV4A 4KPYA 3LM9A 4BACA 3SI6A 5FRMA 5BRDA 4YHHK 4A5BA 3NAEA 5M1PA 4K8XA 4LF8K 2F7TA 4UQGA 2AA4A 3ZSZA 3OJUA 2UUBK 3G71N 5JS2A 3CJCA 1YJ9N 1N6QA 3A0IX 1Q82O 4AHTA 3LP2A 5J2MA 1QVFM 2YNHA 1S22A 3RTVA 4BDPA 3F9KA 2F4VK 5CHIA 4HUGA 2E88A 5T7BA 3VMFB 4DTMA 3V1QA 4JI4K 2HOEA 4RCHA 3ULDA 5LY3A 4KV8A 4DFPA 1YTUA 1WOQA 4DLEA 3LP3A 3L3UA 1VSJA 3I56N 2HW3A 3AGKA 4RW6A 5SWMA 5E41A 3ZSQA 3T3FA 3TSPA 4LH5A 1T8EA 1W7AA 1YJWN 2GWJA
chains in the Genus database with same CATH topology
3SCXA 2RKIA 1BI4B 2KQ2A 3KKSA 3HVRA 3L2UA 4JS4A 4CJUA 3QIOA 4PQUA 4CF0A 3A2FA 3G10A 4KKOA 4J2EA 1IKVA 4CEEA 1RTIA 3ZSWA 3C94A 4Y1CA 4CJ3A 5CZ1A 3OYHA 3AA3A 3AO1A 4FM2A 4AILC 1C6VA 3QLHA 3VQEA 1IO2A 1REVA 2DFHA 1UOCA 4N41A 4G1QA 1HNIA 4CJWA 3K57A 1CXUA 4DSKA 4F3TA 1WSGA 1NJWA 3LDSA 3AVKA 1J9AA 4CGJA 1U45A 1HYZA 4CF1A 3L2VA 1SKRA 4FLVA 3F73A 1JXBA 1UA0A 2QKKA 2Z1JA 3AA4A 1RDDA 4FLUA 3HPOA 1QTMA 1S1UA 2PYLA 3L3VA 3KLGA 3PY8A 5FDLA 3ZT0A 2OPQA 4YNQA 3KK3A 2ZD1A 1RTDA 3AO4A 3L8BA 3IAYA 3M8RA 2G8IA 3CYMA 4CFAA 3S3NA 4OLAA 1R0AA 2WONA 1S1VA 4YFUA 3SUNA 1W0HA 1RCHA 1VSIA 2G8HA 1ZBFA 4W5OA 5C42A 4HTUA 3K2PA 2B4JA 4B9TA 4CHZA 1LWCA 4KHQA 4CEFA 4HVJA 4BDZA 3IS9A 2XY5A 3SQ4A 1D5AA 3KIOA 4CEZA 1SKSA 4W5NA 5HRSA 4CEAA 2P1JA 4TSXA 4DSFA 5J2NA 3V6DA 1X9SA 4KI6A 1NOZA 4FJ7A 1WAJA 2BANA 3NDKA 4E7IA 4BE2A 3TAMA 1ZBLA 1Z25A 4KI4A 3HXMA 2AJQA 4DTSA 4FJ5A 3V1RA 4ID1A 2HHXA 1B92A 1GOCA 2FBVA 3ZT4A 3OYCA 3L2RA 5DMRA 4GW6A 5SZTA 4KO0A 4I9LA 1JKHA 1DTQA 3LP1A 3OVNA 3DOLA 4B8CA 3EY1A 1ASUA 5K14A 3I8DA 2F96A 3BDPA 4FZXC 1IKXA 1HJRA 3OYGA 1XHZA 2KTQA 2HB5A 3QINA 3L2QA 5HBMA 4CJVA 4DQSA 3QEIA 3CQ8A 1BHLA 2OZMA 1W9HA 4KHUA 3DRRA 1C1CA 1X9WA 1HQUA 3TAQA 2F8TA 3MECA 2EX3A 4CGIA 2G8FA 4M3XA 4QAGA 3OYLA 2BDPA 3I0RA 4AHRA 1C0UA 4DQQA 3SJJA 3CM6A 4CF2A 4E7LA 4Y1DA 2Q3SA 3ZSVA 3KTQA 3V81A 4CK2A 1TVRA 3T19A 1WSJA 4HCBA 4CF9A 1B9DA 1BL3A 3HK2A 1X1PA 4JS5A 3V9ZA 3V9WA 1TK0A 3AVNA 4CGGA 4CGDA 4WE1A 3NGIA 1L3VA 4OJRA 4IG3A 1FKOA 3QNNA 3AVFA 2YNGA 4IDKA 3CFRA 4DQPA 3AVJA 3NBPA 5DK5A 1BIZA 3DLBA 3MXIA 4Z4GA 3NFAA 1BI4A 4FLYA 3SPYA 3ASMA 2XY6A 5I42A 4CJPA 1XHXA 3ZSRA 1TK8A 3OYNA 1CLQA 3LAMA 4DQRA 2A1RA 3MEEA 3PX0A 1QSYA 3LWLA 3NCIA 3G0ZA 2EHGA 4PUOA 4DTRA 4FW2A 1VSHA 4DSJA 4N76A 3RR8A 4KHWA 3LWMA 4C8OA 4FK0A 3WNHA 3DM2A 1NK6A 3TR8A 3ZSYA 3B6PA 3KD5E 2KZMA 2I5JA 1XI1A 5C25A 3AVBA 4FW1A 4AHUA 4CJ4A 4DTXA 4CE9A 5EU7A 2LSNA 4CK1A 3V9UA 2HHVA 3O3FA 4FLXA 1TL3A 1BISA 4O4GA 4M3RA 5KTQA 1RBUA 4B9LA 1L3SA 3ZCMA 3OYIA 2B6AA 5HRRA 2KFZA 4NCGA 3JSMA 3NF6A 4LY7A 5KI6A 3PX4A 1VSKA 5HP1A 2P51A 4KTZA 3O4NA 3OYFA 4M41A 3P83D 4NYFA 4RW4A 2ZQBA 3EYZA 3KK2A 1S9GA 4H4MA 4FJMA 3P5JA 3U3GA 2HHTA 2FBYA 1NK4A 3AVLA 4B8AB 2GUIA 1WSHA 5CY4A 1HYVA 3PUFA 4R5PA 4KAZA 1RT6A 3AVGA 4AHCA 4H4OA 4Z0UA 3VA0A 1KLNA 4L8RB 3FFIA 5KGXA 3HSTB 4O0IA 3OS1A 2Z1IA 5J2PA 1LAWA 4KB1A 3LZJA 4M42A 3QIPA 3AVHA 4E19A 1J54A 1RNHA 4CGFA 3ZT1A 2YKNA 4OKJA 2JLEA 3V9SA 3VQAA 2XY7A 1HMVA 4CJFA 1TGOA 1U48A 3QESA 4B9SA 1VSEA 4CCHA 2O4IA 4I2QA 2X78A 3M8PA 4BWMA 4Z4CA 1QQCA 3OS0A 1QSSA 3SZ2A 3U3YA 3CG7A 1EP4A 2X6NA 3AVMA 3ZT3A 4KTWA 3SNNA 2O4GA 1RBTA 4CIEA 3SV3A 2KZZA 2IDOA 1Q8IA 4OGCA 3T1AA 1NK5A 1J5OA 1ZBHA 4AH9A 1LWEA 4CHOA 4EZ6A 3TARA 3LZIA 4Z4EA 2D0CA 1S6PA 4KTQA 1BQMA 3O4QA 4GMJB 3WNGA 2D0BA 4FLTA 1U47A 1KRPA 4F3OA 2BE2A 4CFCA 1KVBA 1NJXA 1RT1A 2Y1JA 4I2PA 4I7FA 3V9XA 1KCFA 4GVMA 3AO5A 1RBSA 2Z1GA 3PX6A 4PA1A 1NK0A 2G8UA 4Z4HA 3KLEA 4CJTA 3C6UA 4FJJA 3DYAA 3DLKA 4FLZA 1MU2A 4N47A 3VQPA 1J53A 3TI0A 2YNIA 4MFBA 4NYNA 4LSLA 2B5JA 1A5WA 4C8NA 3VQQA 4CK3A 2QKBA 2HNYA 2HHQA 4E7JA 3HYFA 4FK2A 3DRSA 3OY9A 1S1TA 1F21A 1JLGA 2XY8A 3TAFA 4J2AA 4M3WA 4FM1A 3MEGA 4OVLA 1A5XA 2GV9A 2W42A 3K59A 1S9EA 2IC3A 4DF4A 1SV5A 1YTAA 1RDCA 2YV0X 1KLMA 4J2DA 5CYQA 4ZHRA 3V4IA 4IFYA 4PWDA 1T03A 1IKWA 1GOBA 5HRPA 2HHSA 4C8KA 5J2QA 4B9MA 4DU1A 4KFBA 1S5JA 1I3AA 1NOYA 1CZ9A 4JRPA 4FJ8A 2FBTA 4JLHA 4O0JA 4DTPA 5KRSA 1WSIA 4DG1A 4KHYA 1UWBA 4QOZB 1B9FA 3JYTA 1KVCA 4DWIA 4CJLA 1C1AA 2A1SA 3M8QA 1VSDA 3DI6A 3V1OA 1SKWA 2PYJA 4B08A 3HO1A 2GBZA 1L3TA 4FJ9A 2DY4A 2D0AA 3HJFA 3L2WA 4FK4A 1TAQA 1S1WA 2JGUA 1FK9A 4OLBA 3WNEA 4DS5A 1ZBUA 4ELVA 4J2BA 1KFDA 2HNZA 3VQ5A 3S3OA 1N5YA 1IKYA 4CEOA 4KREA 1TKXA 4IFVA 2OA8A 1A5VA 3QNOA 3OYJA 1K6YA 3CFOA 4O44A 4RW7A 2PY5A 4ICLA 5KRTA 3VQ4A 2P5GA 3HP9A 4ID5A 1VSFA 4HUEA 1VRUA 4FJKA 3CFPA 3ZSOA 1NJYA 3VQ7A 5HRNA 3EZ5A 1X9MA 4FYDA 3VQ8A 1RDBA 1RILA 1Z26A 2HNDA 3IRXA 3TABA 4FXDA 1VSLA 4AHVA 4OKKA 4B9UA 4RG8A 4W5QA 1SL2A 4HCCA 3DLRA 3DLGA 3KLHA 2YHAA 3RMCA 4DQIA 4CESA 4BE1A 4ELTA 4CHPA 1RDAA 1JL1A 2HMIA 2QK9A 4F2RA 3KJVA 5C24A 4E7KA 2KW4A 4FCYA 3SUPA 1LWFA 3M8SA 2HVHA 1TKTA 3AVCA 1ZBIA 3MEDA 2DTUA 3LAKA 4W5RA 4E0DA 4ZTFA 1ASVA 4FJXA 4CHNA 1JLAA 1ASWA 3VQ6A 3PO4A 1VRTA 4BE0A 3U6FA 3OYKA 3S9HA 1I39A 1HRHA 1DLOA 4CJQA 4QCLA 1SUQA 3TWHA 5HLFA 4NCBA 1BQNA 2P5OA 4MQ3A 1EETA 1RTHA 3OYAA 3OYEA 1FKPA 1FXXA 3HPHA 4CGHA 1L5UA 3DLHA 1LV5A 3HL8A 2VWKA 3B6OA 4CECA 4CIFA 1G15A 3NH2A 4DFMA 3AO3A 2RF2A 3D45A 3AA2A 3I0SA 4FZYA 4B9VA 4DFJA 4CERA 3VN5A 4E1NA 3TANA 2G8KA 4M3UA 4IG0A 4IKFA 3NGZA 1NK8A 2KFNA 1EX4A 3QEWA 2FBXA 3D0PA 4C8LA 3QO9A 4M3ZA 3NH0A 4EZ9A 3NH1A 4OKEA 4KB0A 1XC9A 2XRIA 3DLEA 1NKBA 1JLBA 3RMBA 4DU3A 4ZTJA 3S3MA 4E1MA 5KGWA 1GOAA 4DSEA 1SL1A 1KFSA 2XHBA 1QS4A 1IG9A 2VG6A 4BWJA 1JLFA 3TAEA 3AVIA 4LSNA 3NHGA 4Q5VA 3QEPA 4RW9A 1D8YA 1RT4A 1ZYQA 2OPRA 3KKRA 1C0MA 4B9NA 2ETJA 1WSFA 4Q0BA 1DTTA 3VQDA 3OYDA 4FJNA 4N5SA 4DU4A 4O5BA 4DLGA 3AA5X 1CXQA 1D9FA 4OPJA 3KK1A 4CJRA 4CFDA 3RMAA 1WN7A 3NF7A 5HROA 4CFBA 1RBVA 1CZBA 3O3GA 5I3UA 3QERA 2XO7A 2E6LA 4DSLA 1BCOA 1VSMA 3AVAA 2YNFA 1WAFA 2IOCA 3VQCA 3P1GA 1RT3A 4LD0A 4CJKA 2IGIA 3K5NA 4CJ5A 4E89A 4DF8A 1U04A 3C6TA 3QETA 4KHNA 1RTJA 2RN2A 3HT3A 1JL2A 1LW2A 2HHWA 3NF8A 1TV6A 2VWJA 2IS3A 4DTUA 3KLIA 1S6QA 3NE6A 4DTJA 3KD1E 2Y1IA 4CF8A 4DS4A 3OS2A 1EKEA 1D9DA 4ELUA 4B3OA 3BGRA 4EP5A 4W5TA 4FM0A 4O55A 4CEDA 2PZSA 1TKZA 3AV9A 2OYQA 3HPGA 2G8VA 2NUBA 3MXJA 4OGEA 3OJSA 2G8WA 3LPUA 3RWUA 2OPPA 3O3HA 2VG5A 1RT7A 4FLWA 4CIGA 4E3SA 3NGYA 1L3UA 3K5MA 1HNVA 2ITGA 3SPZA 4Z4IA 2X6SA 4CHQA 2IAJA 3QEXA 3MXMA 1Q9XA 1U49A 3RRHA 1Y97A 4K8ZA 2HHUA 1RT2A 4CEBA 3VA3A 4F2SA 1WSEA 1UAXA 1LW0A 1WLJA 3DRPA 3IG1A 3LALA 2Z1HA 3THVA 3RR7A 4CJEA 3SQ2A 4F8RA 5JS1A 3RRGA 2D5RA 2F8SA 1YT3A 4FZZA 2ATQA 3LP0A 1BCMA 4M3TA 3SQ1A 2DFEA 4OPKA 2HVIA 1S1XA 4Z4FA 1C0TA 2E4LA 2R7YA 3VQ9A 3ITHA 1O1WA 3TAGA 3K5OA 1XWLA 3ZT2A 4F4KA 4KRFA 1QHTA 1HYSA 1JLQA 3H08A 3ISNC 4JRQA 4CHYA 3E01A 3HP6A 1TAUA 2DFFA 4E7HA 1QE1A 4AHSA 2X74A 3K5LA 3TAPA 1RT5A 1T05A 1TKDA 4DSIA 5J1EA 3VQBA 1T7PA 4H8KA 1KTQA 2WOMA 4C8MA 3OYMA 3HVTA 3OYBA 4I9QA 2BGGA 4FJLA 1YVUA 4KPYA 3SV4A 1NK9A 1EXQA 1C1BA 4BACA 3SI6A 1NKEA 2OZSA 4IBNA 4XIUA 4HHTA 3SYZA 3MAQA 5D3GA 5FRMA 4FJGA 3NAEA 3WNFA 1Q9YA 1IH7A 3SQ0A 3UIQA 4K8XA 4UQGA 3ZSZA 3OJUA 2RPIA 4CJSA 1HQEA 5JS2A 4BDYA 4DFKA 1N6QA 4DTOA 3SUQA 3QEVA 1BIUA 4DMNA 3K58A 4KHSA 4AHTA 3LP2A 1LAVA 2OPSA 1BGXT 3LANA 5J2MA 2YNHA 1JLCA 3RTVA 4BDPA 2E6MA 1ITGA 1RBRA 3F9KA 3KLFA 4NCAA 4HUGA 1QSLA 3DOKA 5T7BA 5CZ2A 3PO5A 1TL1A 4DTMA 2YHBA 4N56A 1TK5A 1UA1A 3V1QA 4M45A 2ZE2A 3ULDA 4KV8A 2FC0A 5CYMA 4RW8A 1JLEA 3AO2A 3C95A 4DFPA 3DMJA 4DTNA 3RMDA 1NJZA 4M3YA 5FROA 1YTUA 1NK7A 3PV8A 4DLEA 3LP3A 1WNSA 3L3UA 1VSJA 4HUFA 1U4BA 1HPZA 5FRNA 4FVMA 3CM5A 1KVAA 4LH4A 4CEQA 1SL0A 4EP4A 2HW3A 4RW6A 3ZSXA 3NF9A 3LPTA 5SWMA 1VK0A 3ZSQA 3ALYA 5E41A 3T3FA 1JXEA 1KSPA 4LH5A 1T8EA 4FJIA 2QXFA 3SUOA 1NKCA 3HM9A 4PY5A 4FJHA 2YKMA 2VG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SCX A;  2RKI A;  1BI4 B;  2KQ2 A;  3KKS A;  3HVR A;  3L2U A;  4JS4 A;  4CJU A;  3QIO A;  4PQU A;  4CF0 A;  3A2F A;  3G10 A;  4KKO A;  4J2E A;  1IKV A;  4CEE A;  1RTI A;  3ZSW A;  3C94 A;  4Y1C A;  4CJ3 A;  5CZ1 A;  3OYH A;  3AA3 A;  3AO1 A;  4FM2 A;  4AIL C;  1C6V A;  3QLH A;  3VQE A;  1IO2 A;  1REV A;  2DFH A;  1UOC A;  4N41 A;  4G1Q A;  1HNI A;  4CJW A;  3K57 A;  1CXU A;  4DSK A;  4F3T A;  1WSG A;  1NJW A;  3LDS A;  3AVK A;  1J9A A;  4CGJ A;  1U45 A;  1HYZ A;  4CF1 A;  3L2V A;  1SKR A;  4FLV A;  3F73 A;  1JXB A;  1UA0 A;  2QKK A;  2Z1J A;  3AA4 A;  1RDD A;  4FLU A;  3HPO A;  1QTM A;  1S1U A;  2PYL A;  3L3V A;  3KLG A;  3PY8 A;  5FDL A;  3ZT0 A;  2OPQ A;  4YNQ A;  3KK3 A;  2ZD1 A;  1RTD A;  3AO4 A;  3L8B A;  3IAY A;  3M8R A;  2G8I A;  3CYM A;  4CFA A;  3S3N A;  4OLA A;  1R0A A;  2WON A;  1S1V A;  4YFU A;  3SUN A;  1W0H A;  1RCH A;  1VSI A;  2G8H A;  1ZBF A;  4W5O A;  5C42 A;  4HTU A;  3K2P A;  2B4J A;  4B9T A;  4CHZ A;  1LWC A;  4KHQ A;  4CEF A;  4HVJ A;  4BDZ A;  3IS9 A;  2XY5 A;  3SQ4 A;  1D5A A;  3KIO A;  4CEZ A;  1SKS A;  4W5N A;  5HRS A;  4CEA A;  2P1J A;  4TSX A;  4DSF A;  5J2N A;  3V6D A;  1X9S A;  4KI6 A;  1NOZ A;  4FJ7 A;  1WAJ A;  2BAN A;  3NDK A;  4E7I A;  4BE2 A;  3TAM A;  1ZBL A;  1Z25 A;  4KI4 A;  3HXM A;  2AJQ A;  4DTS A;  4FJ5 A;  3V1R A;  4ID1 A;  2HHX A;  1B92 A;  1GOC A;  2FBV A;  3ZT4 A;  3OYC A;  3L2R A;  5DMR A;  4GW6 A;  5SZT A;  4KO0 A;  4I9L A;  1JKH A;  1DTQ A;  3LP1 A;  3OVN A;  3DOL A;  4B8C A;  3EY1 A;  1ASU A;  5K14 A;  3I8D A;  2F96 A;  3BDP A;  4FZX C;  1IKX A;  1HJR A;  3OYG A;  1XHZ A;  2KTQ A;  2HB5 A;  3QIN A;  3L2Q A;  5HBM A;  4CJV A;  4DQS A;  3QEI A;  3CQ8 A;  1BHL A;  2OZM A;  1W9H A;  4KHU A;  3DRR A;  1C1C A;  1X9W A;  1HQU A;  3TAQ A;  2F8T A;  3MEC A;  2EX3 A;  4CGI A;  2G8F A;  4M3X A;  4QAG A;  3OYL A;  2BDP A;  3I0R A;  4AHR A;  1C0U A;  4DQQ A;  3SJJ A;  3CM6 A;  4CF2 A;  4E7L A;  4Y1D A;  2Q3S A;  3ZSV A;  3KTQ A;  3V81 A;  4CK2 A;  1TVR A;  3T19 A;  1WSJ A;  4HCB A;  4CF9 A;  1B9D A;  1BL3 A;  3HK2 A;  1X1P A;  4JS5 A;  3V9Z A;  3V9W A;  1TK0 A;  3AVN A;  4CGG A;  4CGD A;  4WE1 A;  3NGI A;  1L3V A;  4OJR A;  4IG3 A;  1FKO A;  3QNN A;  3AVF A;  2YNG A;  4IDK A;  3CFR A;  4DQP A;  3AVJ A;  3NBP A;  5DK5 A;  1BIZ A;  3DLB A;  3MXI A;  4Z4G A;  3NFA A;  1BI4 A;  4FLY A;  3SPY A;  3ASM A;  2XY6 A;  5I42 A;  4CJP A;  1XHX A;  3ZSR A;  1TK8 A;  3OYN A;  1CLQ A;  3LAM A;  4DQR A;  2A1R A;  3MEE A;  3PX0 A;  1QSY A;  3LWL A;  3NCI A;  3G0Z A;  2EHG A;  4PUO A;  4DTR A;  4FW2 A;  1VSH A;  4DSJ A;  4N76 A;  3RR8 A;  4KHW A;  3LWM A;  4C8O A;  4FK0 A;  3WNH A;  3DM2 A;  1NK6 A;  3TR8 A;  3ZSY A;  3B6P A;  3KD5 E;  2KZM A;  2I5J A;  1XI1 A;  5C25 A;  3AVB A;  4FW1 A;  4AHU A;  4CJ4 A;  4DTX A;  4CE9 A;  5EU7 A;  2LSN A;  4CK1 A;  3V9U A;  2HHV A;  3O3F A;  4FLX A;  1TL3 A;  1BIS A;  4O4G A;  4M3R A;  5KTQ A;  1RBU A;  4B9L A;  1L3S A;  3ZCM A;  3OYI A;  2B6A A;  5HRR A;  2KFZ A;  4NCG A;  3JSM A;  3NF6 A;  4LY7 A;  5KI6 A;  3PX4 A;  1VSK A;  5HP1 A;  2P51 A;  4KTZ A;  3O4N A;  3OYF A;  4M41 A;  3P83 D;  4NYF A;  4RW4 A;  2ZQB A;  3EYZ A;  3KK2 A;  1S9G A;  4H4M A;  4FJM A;  3P5J A;  3U3G A;  2HHT A;  2FBY A;  1NK4 A;  3AVL A;  4B8A B;  2GUI A;  1WSH A;  5CY4 A;  1HYV A;  3PUF A;  4R5P A;  4KAZ A;  1RT6 A;  3AVG A;  4AHC A;  4H4O A;  4Z0U A;  3VA0 A;  1KLN A;  4L8R B;  3FFI A;  5KGX A;  3HST B;  4O0I A;  3OS1 A;  2Z1I A;  5J2P A;  1LAW A;  4KB1 A;  3LZJ A;  4M42 A;  3QIP A;  3AVH A;  4E19 A;  1J54 A;  1RNH A;  4CGF A;  3ZT1 A;  2YKN A;  4OKJ A;  2JLE A;  3V9S A;  3VQA A;  2XY7 A;  1HMV A;  4CJF A;  1TGO A;  1U48 A;  3QES A;  4B9S A;  1VSE A;  4CCH A;  2O4I A;  4I2Q A;  2X78 A;  3M8P A;  4BWM A;  4Z4C A;  1QQC A;  3OS0 A;  1QSS A;  3SZ2 A;  3U3Y A;  3CG7 A;  1EP4 A;  2X6N A;  3AVM A;  3ZT3 A;  4KTW A;  3SNN A;  2O4G A;  1RBT A;  4CIE A;  3SV3 A;  2KZZ A;  2IDO A;  1Q8I A;  4OGC A;  3T1A A;  1NK5 A;  1J5O A;  1ZBH A;  4AH9 A;  1LWE A;  4CHO A;  4EZ6 A;  3TAR A;  3LZI A;  4Z4E A;  2D0C A;  1S6P A;  4KTQ A;  1BQM A;  3O4Q A;  4GMJ B;  3WNG A;  2D0B A;  4FLT A;  1U47 A;  1KRP A;  4F3O A;  2BE2 A;  4CFC A;  1KVB A;  1NJX A;  1RT1 A;  2Y1J A;  4I2P A;  4I7F A;  3V9X A;  1KCF A;  4GVM A;  3AO5 A;  1RBS A;  2Z1G A;  3PX6 A;  4PA1 A;  1NK0 A;  2G8U A;  4Z4H A;  3KLE A;  4CJT A;  3C6U A;  4FJJ A;  3DYA A;  3DLK A;  4FLZ A;  1MU2 A;  4N47 A;  3VQP A;  1J53 A;  3TI0 A;  2YNI A;  4MFB A;  4NYN A;  4LSL A;  2B5J A;  1A5W A;  4C8N A;  3VQQ A;  4CK3 A;  2QKB A;  2HNY A;  2HHQ A;  4E7J A;  3HYF A;  4FK2 A;  3DRS A;  3OY9 A;  1S1T A;  1F21 A;  1JLG A;  2XY8 A;  3TAF A;  4J2A A;  4M3W A;  4FM1 A;  3MEG A;  4OVL A;  1A5X A;  2GV9 A;  2W42 A;  3K59 A;  1S9E A;  2IC3 A;  4DF4 A;  1SV5 A;  1YTA A;  1RDC A;  2YV0 X;  1KLM A;  4J2D A;  5CYQ A;  4ZHR A;  3V4I A;  4IFY A;  4PWD A;  1T03 A;  1IKW A;  1GOB A;  5HRP A;  2HHS A;  4C8K A;  5J2Q A;  4B9M A;  4DU1 A;  4KFB A;  1S5J A;  1I3A A;  1NOY A;  1CZ9 A;  4JRP A;  4FJ8 A;  2FBT A;  4JLH A;  4O0J A;  4DTP A;  5KRS A;  1WSI A;  4DG1 A;  4KHY A;  1UWB A;  4QOZ B;  1B9F A;  3JYT A;  1KVC A;  4DWI A;  4CJL A;  1C1A A;  2A1S A;  3M8Q A;  1VSD A;  3DI6 A;  3V1O A;  1SKW A;  2PYJ A;  4B08 A;  3HO1 A;  2GBZ A;  1L3T A;  4FJ9 A;  2DY4 A;  2D0A A;  3HJF A;  3L2W A;  4FK4 A;  1TAQ A;  1S1W A;  2JGU A;  1FK9 A;  4OLB A;  3WNE A;  4DS5 A;  1ZBU A;  4ELV A;  4J2B A;  1KFD A;  2HNZ A;  3VQ5 A;  3S3O A;  1N5Y A;  1IKY A;  4CEO A;  4KRE A;  1TKX A;  4IFV A;  2OA8 A;  1A5V A;  3QNO A;  3OYJ A;  1K6Y A;  3CFO A;  4O44 A;  4RW7 A;  2PY5 A;  4ICL A;  5KRT A;  3VQ4 A;  2P5G A;  3HP9 A;  4ID5 A;  1VSF A;  4HUE A;  1VRU A;  4FJK A;  3CFP A;  3ZSO A;  1NJY A;  3VQ7 A;  5HRN A;  3EZ5 A;  1X9M A;  4FYD A;  3VQ8 A;  1RDB A;  1RIL A;  1Z26 A;  2HND A;  3IRX A;  3TAB A;  4FXD A;  1VSL A;  4AHV A;  4OKK A;  4B9U A;  4RG8 A;  4W5Q A;  1SL2 A;  4HCC A;  3DLR A;  3DLG A;  3KLH A;  2YHA A;  3RMC A;  4DQI A;  4CES A;  4BE1 A;  4ELT A;  4CHP A;  1RDA A;  1JL1 A;  2HMI A;  2QK9 A;  4F2R A;  3KJV A;  5C24 A;  4E7K A;  2KW4 A;  4FCY A;  3SUP A;  1LWF A;  3M8S A;  2HVH A;  1TKT A;  3AVC A;  1ZBI A;  3MED A;  2DTU A;  3LAK A;  4W5R A;  4E0D A;  4ZTF A;  1ASV A;  4FJX A;  4CHN A;  1JLA A;  1ASW A;  3VQ6 A;  3PO4 A;  1VRT A;  4BE0 A;  3U6F A;  3OYK A;  3S9H A;  1I39 A;  1HRH A;  1DLO A;  4CJQ A;  4QCL A;  1SUQ A;  3TWH A;  5HLF A;  4NCB A;  1BQN A;  2P5O A;  4MQ3 A;  1EET A;  1RTH A;  3OYA A;  3OYE A;  1FKP A;  1FXX A;  3HPH A;  4CGH A;  1L5U A;  3DLH A;  1LV5 A;  3HL8 A;  2VWK A;  3B6O A;  4CEC A;  4CIF A;  1G15 A;  3NH2 A;  4DFM A;  3AO3 A;  2RF2 A;  3D45 A;  3AA2 A;  3I0S A;  4FZY A;  4B9V A;  4DFJ A;  4CER A;  3VN5 A;  4E1N A;  3TAN A;  2G8K A;  4M3U A;  4IG0 A;  4IKF A;  3NGZ A;  1NK8 A;  2KFN A;  1EX4 A;  3QEW A;  2FBX A;  3D0P A;  4C8L A;  3QO9 A;  4M3Z A;  3NH0 A;  4EZ9 A;  3NH1 A;  4OKE A;  4KB0 A;  1XC9 A;  2XRI A;  3DLE A;  1NKB A;  1JLB A;  3RMB A;  4DU3 A;  4ZTJ A;  3S3M A;  4E1M A;  5KGW A;  1GOA A;  4DSE A;  1SL1 A;  1KFS A;  2XHB A;  1QS4 A;  1IG9 A;  2VG6 A;  4BWJ A;  1JLF A;  3TAE A;  3AVI A;  4LSN A;  3NHG A;  4Q5V A;  3QEP A;  4RW9 A;  1D8Y A;  1RT4 A;  1ZYQ A;  2OPR A;  3KKR A;  1C0M A;  4B9N A;  2ETJ A;  1WSF A;  4Q0B A;  1DTT A;  3VQD A;  3OYD A;  4FJN A;  4N5S A;  4DU4 A;  4O5B A;  4DLG A;  3AA5 X;  1CXQ A;  1D9F A;  4OPJ A;  3KK1 A;  4CJR A;  4CFD A;  3RMA A;  1WN7 A;  3NF7 A;  5HRO A;  4CFB A;  1RBV A;  1CZB A;  3O3G A;  5I3U A;  3QER A;  2XO7 A;  2E6L A;  4DSL A;  1BCO A;  1VSM A;  3AVA A;  2YNF A;  1WAF A;  2IOC A;  3VQC A;  3P1G A;  1RT3 A;  4LD0 A;  4CJK A;  2IGI A;  3K5N A;  4CJ5 A;  4E89 A;  4DF8 A;  1U04 A;  3C6T A;  3QET A;  4KHN A;  1RTJ A;  2RN2 A;  3HT3 A;  1JL2 A;  1LW2 A;  2HHW A;  3NF8 A;  1TV6 A;  2VWJ A;  2IS3 A;  4DTU A;  3KLI A;  1S6Q A;  3NE6 A;  4DTJ A;  3KD1 E;  2Y1I A;  4CF8 A;  4DS4 A;  3OS2 A;  1EKE A;  1D9D A;  4ELU A;  4B3O A;  3BGR A;  4EP5 A;  4W5T A;  4FM0 A;  4O55 A;  4CED A;  2PZS A;  1TKZ A;  3AV9 A;  2OYQ A;  3HPG A;  2G8V A;  2NUB A;  3MXJ A;  4OGE A;  3OJS A;  2G8W A;  3LPU A;  3RWU A;  2OPP A;  3O3H A;  2VG5 A;  1RT7 A;  4FLW A;  4CIG A;  4E3S A;  3NGY A;  1L3U A;  3K5M A;  1HNV A;  2ITG A;  3SPZ A;  4Z4I A;  2X6S A;  4CHQ A;  2IAJ A;  3QEX A;  3MXM A;  1Q9X A;  1U49 A;  3RRH A;  1Y97 A;  4K8Z A;  2HHU A;  1RT2 A;  4CEB A;  3VA3 A;  4F2S A;  1WSE A;  1UAX A;  1LW0 A;  1WLJ A;  3DRP A;  3IG1 A;  3LAL A;  2Z1H A;  3THV A;  3RR7 A;  4CJE A;  3SQ2 A;  4F8R A;  5JS1 A;  3RRG A;  2D5R A;  2F8S A;  1YT3 A;  4FZZ A;  2ATQ A;  3LP0 A;  1BCM A;  4M3T A;  3SQ1 A;  2DFE A;  4OPK A;  2HVI A;  1S1X A;  4Z4F A;  1C0T A;  2E4L A;  2R7Y A;  3VQ9 A;  3ITH A;  1O1W A;  3TAG A;  3K5O A;  1XWL A;  3ZT2 A;  4F4K A;  4KRF A;  1QHT A;  1HYS A;  1JLQ A;  3H08 A;  3ISN C;  4JRQ A;  4CHY A;  3E01 A;  3HP6 A;  1TAU A;  2DFF A;  4E7H A;  1QE1 A;  4AHS A;  2X74 A;  3K5L A;  3TAP A;  1RT5 A;  1T05 A;  1TKD A;  4DSI A;  5J1E A;  3VQB A;  1T7P A;  4H8K A;  1KTQ A;  2WOM A;  4C8M A;  3OYM A;  3HVT A;  3OYB A;  4I9Q A;  2BGG A;  4FJL A;  1YVU A;  4KPY A;  3SV4 A;  1NK9 A;  1EXQ A;  1C1B A;  4BAC A;  3SI6 A;  1NKE A;  2OZS A;  4IBN A;  4XIU A;  4HHT A;  3SYZ A;  3MAQ A;  5D3G A;  5FRM A;  4FJG A;  3NAE A;  3WNF A;  1Q9Y A;  1IH7 A;  3SQ0 A;  3UIQ A;  4K8X A;  4UQG A;  3ZSZ A;  3OJU A;  2RPI A;  4CJS A;  1HQE A;  5JS2 A;  4BDY A;  4DFK A;  1N6Q A;  4DTO A;  3SUQ A;  3QEV A;  1BIU A;  4DMN A;  3K58 A;  4KHS A;  4AHT A;  3LP2 A;  1LAV A;  2OPS A;  1BGX T;  3LAN A;  5J2M A;  2YNH A;  1JLC A;  3RTV A;  4BDP A;  2E6M A;  1ITG A;  1RBR A;  3F9K A;  3KLF A;  4NCA A;  4HUG A;  1QSL A;  3DOK A;  5T7B A;  5CZ2 A;  3PO5 A;  1TL1 A;  4DTM A;  2YHB A;  4N56 A;  1TK5 A;  1UA1 A;  3V1Q A;  4M45 A;  2ZE2 A;  3ULD A;  4KV8 A;  2FC0 A;  5CYM A;  4RW8 A;  1JLE A;  3AO2 A;  3C95 A;  4DFP A;  3DMJ A;  4DTN A;  3RMD A;  1NJZ A;  4M3Y A;  5FRO A;  1YTU A;  1NK7 A;  3PV8 A;  4DLE A;  3LP3 A;  1WNS A;  3L3U A;  1VSJ A;  4HUF A;  1U4B A;  1HPZ A;  5FRN A;  4FVM A;  3CM5 A;  1KVA A;  4LH4 A;  4CEQ A;  1SL0 A;  4EP4 A;  2HW3 A;  4RW6 A;  3ZSX A;  3NF9 A;  3LPT A;  5SWM A;  1VK0 A;  3ZSQ A;  3ALY A;  5E41 A;  3T3F A;  1JXE A;  1KSP A;  4LH5 A;  1T8E A;  4FJI A;  2QXF A;  3SUO A;  1NKC A;  3HM9 A;  4PY5 A;  4FJH A;  2YKM A;  2VG7 A; 
#chains in the Genus database with same CATH topology
 1BI4 B;  2KQ2 A;  3HVR A;  3L2U A;  4JS4 A;  4PQU A;  4CF0 A;  3CCQ N;  4BVO A;  2IVP A;  1RTI A;  3C94 A;  4Y1C A;  3CCV N;  1GLC G;  1LCU A;  5LJV A;  3W3D A;  4FM2 A;  2H3G X;  1QQM A;  5HOO A;  1REV A;  4CJW A;  1WSG A;  1QVG M;  2E2N A;  4JKC A;  1U45 A;  4GY2 B;  3D6R A;  3EKS A;  4CF1 A;  1SKR A;  4RTF D;  3AA4 A;  1S1U A;  5JLH A;  3KLG A;  4ISF A;  3CC2 N;  5FDL A;  4YNQ A;  3PY8 A;  1RTD A;  2G8I A;  4DR2 K;  4CFA A;  4OLA A;  1R0A A;  1S1V A;  3SUN A;  4W5O A;  5C42 A;  3K2P A;  4B9T A;  4CEF A;  4K42 A;  4W5N A;  5HRS A;  4TSX A;  1NOZ A;  1WAJ A;  4HTL A;  4E7I A;  3THX B;  4KI4 A;  3HXM A;  2AJQ A;  3V1R A;  1GOC A;  2FBV A;  3OYC A;  3L2R A;  1EWR A;  1GLB G;  3L4I A;  3ATV A;  5CR4 A;  3LP1 A;  3OVN A;  3DOL A;  2ZGZ A;  4BRH A;  1NBW A;  1ASU A;  4FZX C;  2F96 A;  1BO5 O;  2CH6 A;  2F9T A;  3SAF A;  2HB5 A;  3QIN A;  3QEI A;  5HBM A;  1YJN N;  1X9W A;  3J7A P;  4CGI A;  4M3X A;  4B9Q A;  4AHR A;  3HBT A;  4DQQ A;  2BTF A;  1N32 K;  5GAE P;  3IMX A;  4BR4 A;  1NNE A;  3N4Q A;  3V81 A;  5AQF A;  4HCB A;  4CF9 A;  1BL3 A;  4LF4 K;  1IG8 A;  4EZ6 A;  1FJG K;  4WE1 A;  4OJR A;  3QNN A;  5C10 A;  1NGF A;  3VEN A;  3CFR A;  3AVJ A;  5DK5 A;  5HL7 L;  4BRO A;  4IZ9 A;  1V4T A;  5I42 A;  3ZEU A;  1XHX A;  3ZSR A;  3KWI A;  1CLQ A;  4ILH A;  3TSQ A;  1QSY A;  3LWL A;  3VGM A;  4PUO A;  1VSH A;  4DSJ A;  4CBU A;  4FWQ A;  3E1Y A;  4FK0 A;  2WBN A;  5FPN A;  3ZSY A;  1XI1 A;  4FW1 A;  3QFP A;  4IOC L;  4AQY K;  2LSN A;  5F2R A;  3O3F A;  4FLX A;  2A41 A;  4IEI A;  3BF1 A;  4O4G A;  4A61 A;  4BRG A;  4B9L A;  2KFZ A;  4B1V A;  2Q2R A;  5HP1 A;  3CJ7 A;  2P51 A;  3O4N A;  4K25 A;  1KAX A;  3P83 D;  4RW4 A;  2ZQB A;  5AQR A;  4H4M A;  4FJM A;  1P8Z A;  2HHT A;  1EO1 A;  1IV0 A;  3AVL A;  5A2Q O;  2GUI A;  1WSH A;  4FWR A;  3HOT A;  5CY4 A;  4CZM A;  4KAZ A;  3LM2 A;  1KLN A;  2A3Z A;  2ZF5 O;  3HST B;  2Z1I A;  1LAW A;  3D2E B;  4WYB A;  4BR5 A;  1I94 K;  5AQM A;  2YKN A;  4OKJ A;  5KPZ A;  4DR3 K;  2XY7 A;  3CCU N;  1J6Z A;  1U48 A;  4B9S A;  2O4I A;  1YVN A;  4BWM A;  4WQ5 C;  3RSE A;  1QQC A;  5F0X A;  3OS0 A;  4DUY K;  2X6N A;  3AAQ A;  4CIE A;  2KZZ A;  1Q8I A;  3T1A A;  1ZBH A;  3LZI A;  5AQQ A;  4IDH A;  2BE2 A;  4CFC A;  1RT1 A;  1Q81 O;  2Y1J A;  2GTD A;  3R8E A;  3AAR A;  3CC7 N;  1VQ9 N;  1ESV A;  1RBS A;  5AQJ A;  2NRT A;  3KLE A;  3EKU A;  4FJJ A;  3G25 A;  4N47 A;  3D2F B;  3GG4 A;  2ASP A;  1J53 A;  4OPA A;  2ZWH A;  4BC5 A;  5KQ8 A;  2B5J A;  1A5W A;  3VQQ A;  5BR8 K;  3K9J A;  1HNW K;  4G9Z A;  1S1T A;  4M3W A;  1NGG A;  1IJJ A;  1JCF A;  4FL9 A;  1S9E A;  3EL2 A;  5IWA K;  3A5N C;  1K8A O;  3FGU A;  4GV3 A;  3V4I A;  4ZHR A;  4IFY A;  2HHS A;  5HRP A;  3O1W A;  3BF3 A;  5J2Q A;  4C8K A;  4XH4 A;  1CZ9 A;  2PAV A;  4FWM A;  2FBT A;  4QS9 A;  4JLH A;  4O0J A;  4DTP A;  4DG1 A;  3VEY A;  4CZG A;  1B9F A;  2ZJP L;  3DXK B;  2A1S A;  3M8Q A;  1VSD A;  3CJA A;  1L3T A;  2BH1 A;  2P9K A;  1S1W A;  2CGJ A;  4DS5 A;  1ZBU A;  1HX1 A;  3S3O A;  2RHK A;  2QWL A;  4O8U A;  3OYJ A;  1K6Y A;  2PY5 A;  2P5G A;  3T69 A;  3HP9 A;  1HNX K;  3H45 C;  5JMV A;  2HND A;  4FXD A;  3UE5 A;  4AHV A;  5AQK A;  1SL2 A;  3C7N B;  3DLR A;  4L3Q A;  3KLH A;  3RMC A;  2D4W A;  1M90 O;  1KXP A;  1RDA A;  3DXM B;  4CHP A;  5C24 A;  3CPE A;  3F2K A;  3O8M A;  3CJ9 A;  1TKT A;  1ZBI A;  3LAK A;  4CVN E;  4ZTF A;  1ASV A;  3S9H A;  1C0F A;  1HRH A;  3J80 O;  1DLO A;  4CJQ A;  4B1U B;  1BQN A;  4YOW A;  1X3N A;  1EET A;  3NVM A;  3LDQ A;  5BRE A;  3OYE A;  2P9S B;  1L5U A;  3B6O A;  2NRV A;  2AP1 A;  3F9M A;  1XNQ K;  4B9V A;  2WC9 A;  1BOT O;  1J5E K;  4M3U A;  4IG0 A;  4IKF A;  3NGZ A;  1NK8 A;  3D0P A;  3QO9 A;  2Q0R A;  3QFU A;  3NH1 A;  4KB0 A;  1O13 A;  5AQI A;  1XC3 A;  4DU3 A;  1Q86 O;  1GOA A;  1KFS A;  1IG9 A;  4JKA A;  4BWJ A;  1JLF A;  3TAE A;  4PL8 A;  2OPR A;  1C0M A;  1WSF A;  1DTT A;  3VQD A;  4FJN A;  3P4I A;  4DLG A;  1D9F A;  3KK1 A;  1WN7 A;  1RBV A;  1CZB A;  2XO7 A;  4DSL A;  1BCO A;  3FZM A;  1K8K B;  2IGI A;  4CJ5 A;  1U04 A;  1RTJ A;  2UUA K;  3HT3 A;  1LW2 A;  3G6E N;  3WT0 A;  2VWJ A;  1EWQ A;  2IS3 A;  1D4X A;  3ZX0 A;  3O4W A;  3S41 A;  3KD1 E;  4EHT A;  4XEI A;  4CF8 A;  1EKE A;  1XQS C;  4FM0 A;  2OYQ A;  4O55 A;  4CED A;  3AGR A;  2O8D A;  4LFA K;  4J8F A;  1SZ2 A;  1RT7 A;  4FLW A;  3QB0 A;  4GKK K;  1L3U A;  3K5M A;  2ITG A;  3HM8 A;  2IAJ A;  3DJC A;  1WSE A;  3THV A;  1HUX A;  3LAL A;  3IG1 A;  3SQ2 A;  2NRH A;  3RRG A;  2F8S A;  4DHY A;  1YT3 A;  4YDU C;  4FSV A;  1BCM A;  1JJ2 M;  4OPK A;  1S1X A;  2UU9 K;  4OPH A;  4F4K A;  4DR7 K;  1XWL A;  3UKR B;  3ISN C;  4CHY A;  3E01 A;  4A57 A;  3R3L A;  1RT5 A;  4DSI A;  3A8Y A;  1T7P A;  3WQT A;  1KTQ A;  2WOM A;  3OYM A;  1RFQ A;  3HVT A;  3H3N O;  3TPQ A;  4BRP A;  5C0Y A;  1NK9 A;  1HLU A;  3VEW A;  3BY5 A;  4RWT A;  1NKE A;  2OZS A;  3A5O C;  4JEP A;  3MAQ A;  4JAX A;  4BRM A;  5C12 A;  3SQ0 A;  3FLC O;  1NU0 A;  3C6A A;  3O9T A;  4FWS A;  5ELZ A;  5EX5 A;  3R1X A;  1S3X A;  4KBO A;  1K8K A;  1QSL A;  3DOK A;  5CZ2 A;  3ULE B;  2YHB A;  4N56 A;  3ATU A;  3BZK A;  4M45 A;  2ZE2 A;  5AJ3 K;  1JLE A;  1SQK A;  1NJZ A;  5FRO A;  3CER A;  3CMA N;  1NK7 A;  1U4B A;  1WNS A;  4HUF A;  4FWK A;  3CM5 A;  1KVA A;  3C6H A;  4FWL A;  3ENB A;  4DR5 K;  1U2V A;  1VK0 A;  4A2A A;  2P9N A;  1OKJ A;  4FJI A;  3ENH A;  5TKW A;  2VGN A;  3CI5 A;  3M3Z A;  1NGA A;  2YKM A;  1Y64 A;  3CCL N;  2RKI A;  1RDU A;  3M5R A;  5JVG L;  1BUP A;  3ZSW A;  3MN9 A;  4H0O A;  2CGL A;  2OTJ N;  3PSF A;  1DKG D;  2YHX A;  4JI7 K;  3AA3 A;  2E1Z A;  1NGJ A;  1IO2 A;  1E4G T;  2DFH A;  4O5F A;  1BA0 A;  5KPT A;  4F3T A;  1J9A A;  1HYZ A;  3T1Y K;  1RDD A;  2QI2 A;  4FLU A;  1QTM A;  2UYT A;  4I6M A;  3B8A X;  3L3V A;  3WEE B;  3L8B A;  5AQS A;  3ZYY X;  2WON A;  1RCH A;  1VSI A;  1ZBF A;  3I55 N;  2B4J A;  4CHZ A;  1LWC A;  4X66 K;  2XY5 A;  1K9M O;  3SQ4 A;  4CEZ A;  1SKS A;  4CEA A;  5GIO A;  4KI6 A;  1VHX A;  4FJ7 A;  1S72 N;  2IIR A;  4NLC A;  4BE2 A;  1VQ7 N;  1ZBL A;  4OX9 K;  4QS7 A;  2ASO A;  3VTI A;  2V51 B;  4FJ5 A;  3SBG A;  4GW6 A;  5SZT A;  3SK3 A;  3EY1 A;  2NRX A;  5JVH L;  2ZJQ L;  1IKX A;  1BDG A;  1HJR A;  3OYG A;  5ADX H;  3L2Q A;  4H0Y B;  1BHL A;  2OZM A;  2OAN A;  3DRR A;  1C1C A;  2F8T A;  2VQF K;  1N33 K;  2O8C B;  2BDP A;  3CET A;  3CD6 N;  1VQK N;  1NGE A;  3I8B A;  4EFH A;  3U4L A;  1VQN N;  3ZSV A;  4M7X A;  3KTQ A;  2KHO A;  1ZBS A;  3T19 A;  1WSJ A;  4I6M B;  4JS5 A;  3CPW M;  2DPN A;  3L6Q A;  1YIJ N;  5FPE A;  1XMO K;  4IDK A;  3KHY A;  3NBP A;  3ID8 A;  5I9E B;  3MXI A;  4Z4G A;  1DGK N;  2Q0U A;  3ASM A;  2XY6 A;  1TK8 A;  1GLF O;  4H5N A;  4JI8 K;  3PX0 A;  1RGI A;  4H5R A;  4PKG A;  4DTR A;  2HF3 A;  4N76 A;  3VET A;  4JKF A;  3WEE A;  3RR8 A;  3LWM A;  4C8O A;  1NK6 A;  3KD5 E;  3BP8 A;  4AHU A;  5BRH A;  4UY8 O;  4CE9 A;  4H03 B;  2F9W A;  5GIP A;  4JD2 A;  1RBU A;  3J7Y P;  3ZCM A;  5HRR A;  3NF6 A;  2O8F A;  4NYF A;  2WTU A;  4BY9 C;  3TU5 A;  3GL1 A;  3U3G A;  1LOT B;  4M7Y A;  3A5L C;  3QBX A;  4DCH A;  4R5P A;  3AVG A;  4K43 A;  3VA0 A;  2VGM A;  4L8R B;  3FFI A;  4JKG A;  3LZJ A;  1TYQ A;  3AVH A;  3MN6 A;  3ZT1 A;  4NO7 A;  2P9P B;  1TGO A;  4CCH A;  3QES A;  1VSE A;  2X78 A;  4JKG B;  3U3Y A;  3CG7 A;  3ZT3 A;  1HKC A;  4YOT A;  4H0P A;  2Q31 A;  3SV3 A;  4LFB K;  2IDO A;  5EY4 A;  1NK5 A;  4BRK A;  3TAR A;  1OVQ A;  1S6P A;  4NB4 A;  3O4Q A;  4FLT A;  1U47 A;  1KRP A;  2D0B A;  4F3O A;  1KVB A;  1NJX A;  3D2E A;  5BPM A;  1OH6 A;  5AZI A;  3TTF A;  3C65 A;  3ID6 A;  4LF5 K;  4Y0W A;  4CJT A;  3DLK A;  4LFC K;  4FLZ A;  1MU2 A;  2KKZ A;  2ITM A;  4LSL A;  3VEO A;  4XH1 A;  5E26 A;  2HHQ A;  4DQ8 A;  4PL7 A;  4FK2 A;  4J2A A;  2XY8 A;  1X9J A;  4LF9 K;  3JS6 A;  3MEG A;  4JI1 K;  2P9N B;  3EZW A;  2A42 A;  4ISG A;  1ATN A;  1KLM A;  4J2D A;  1P90 A;  5M1N A;  4LF7 K;  5LL6 Z;  2I7P A;  5M1K A;  4B9M A;  1S5J A;  1I3A A;  1NM1 A;  3WXL A;  5KRS A;  3IFR A;  4PKH A;  2GUP A;  3FR0 A;  4QOZ B;  2J4R A;  4IWV A;  5AR0 A;  3JYT A;  4DWI A;  4CJL A;  1SKW A;  3DI6 A;  2D0P A;  1TYQ B;  2HBJ A;  2DY4 A;  1TAQ A;  3U9Z A;  3DXM A;  2JGU A;  4OLB A;  3LDN A;  3WNE A;  2HNZ A;  1IKY A;  1VQ6 N;  5AQY A;  4JK8 A;  4ICL A;  5KRT A;  3VQ4 A;  4FO0 A;  4BC4 A;  5AQL A;  3E9P A;  4JV5 K;  1VSF A;  1VRU A;  3CFP A;  1K73 O;  5HRN A;  3VQ8 A;  1RIL A;  1Z26 A;  2JWL A;  1VSL A;  4OKK A;  1T3V A;  3R6M A;  4RG8 A;  1NGI A;  4W5Q A;  5AQZ A;  1BU6 O;  3EN9 A;  2YHA A;  3KZB A;  4BE1 A;  4OO1 J;  2QK9 A;  5C2D A;  4FVU A;  3ZEU B;  4MLE A;  3M8S A;  2HVH A;  3AVC A;  3MED A;  1XNR K;  4W5R A;  1YIT N;  2HBK A;  3PO4 A;  4BE0 A;  3CCE N;  3SBT A;  3THY B;  2FF6 A;  3QML A;  1SUQ A;  4MQ3 A;  1FXX A;  4CEC A;  3HL8 A;  3AO3 A;  2RF2 A;  3D45 A;  2JWK A;  4CZL A;  2FSK A;  3VN5 A;  4E1N A;  3TAN A;  4A2B A;  2G8K A;  2EWS A;  3NVK A;  4EZ9 A;  3FZH A;  4OKE A;  3CCJ N;  1HPM A;  3O9R A;  2P9U A;  2VG6 A;  2O8D B;  5AQX A;  1RT4 A;  2A40 A;  2E1Y A;  5GAH P;  3KKR A;  3WUH A;  2E2Q A;  1IBM K;  4B3R K;  3WQU A;  4DV5 K;  4B1Y B;  4N5S A;  1KAY A;  3DLL L;  4OPJ A;  4IXC A;  3RMA A;  3NF7 A;  3QER A;  4CZK A;  5BN8 A;  3O80 A;  2YNF A;  1WAF A;  3P1G A;  3H6E A;  4E89 A;  4DF8 A;  1R59 O;  3QET A;  5GAG P;  2RN2 A;  1TV6 A;  2WFB A;  4DTU A;  2Y1I A;  4DS4 A;  3OS2 A;  4B3O A;  4M63 C;  3HPG A;  2G8V A;  1JCE A;  4BRC A;  4H5T A;  4AF1 A;  3LPU A;  2VG5 A;  4CIG A;  3NGY A;  3H46 O;  3FFK B;  1Q9X A;  1U49 A;  1UAX A;  1WLJ A;  2Z1H A;  4CJE A;  4F8R A;  2D5R A;  3OBW A;  3T7Z A;  5FLX O;  3W0L A;  3LP0 A;  4JI0 K;  4M3T A;  2DFE A;  1N34 K;  3K5O A;  1QHT A;  4JRQ A;  3H08 A;  2UXD K;  3HP6 A;  2DFF A;  1QE1 A;  4AHS A;  4AM6 A;  3TAP A;  1TKD A;  5J1E A;  4X64 K;  5AQW A;  2O8B B;  1YVU A;  3VER A;  2E20 A;  1EXQ A;  3UB5 A;  4B3M K;  4XIU A;  3SYZ A;  5D3G A;  5LMN K;  1Q9Y A;  3Q7B A;  4IJA A;  3J7Z O;  4DR6 K;  2RPI A;  5BN9 A;  5C15 A;  1HQE A;  3P39 A;  1BA1 A;  3HI0 A;  4DTO A;  3QEV A;  3SJH A;  1BIU A;  4DMN A;  1LAV A;  2UUC K;  1JLC A;  3HRG A;  3WXM B;  1ITG A;  1RBR A;  3KLF A;  3K0S A;  2PBD A;  3PO5 A;  3K9K A;  1TK5 A;  1QZ5 A;  3MX5 A;  2WUS A;  3HSC A;  4H0V B;  5CYM A;  4RW8 A;  3AO2 A;  3C95 A;  4DTN A;  3RMD A;  1NGD A;  3E9L A;  1E3M A;  3MDQ A;  2V7Y A;  4YOV A;  2RE2 A;  4CI6 A;  1SL0 A;  3ZSX A;  2E2P A;  3LPT A;  3NF9 A;  5AQP A;  4YDU A;  3ALY A;  1JXE A;  2P9L B;  4YOU A;  3LDO A;  2QXF A;  3KK7 A;  1NKC A;  2OCE A;  4FJH A;  4B3S K;  2P9I B;  4CJU A;  3QIO A;  2YHY A;  3A2F A;  3G10 A;  3IKM A;  1IKV A;  4CEE A;  1EQY A;  4CZH A;  2QTD A;  3E66 A;  4MDB A;  4BGB A;  1NGC A;  3AO1 A;  4AIL C;  3IDH A;  2A5X A;  1MDU B;  1BG3 A;  3IUC A;  1UOC A;  4N41 A;  4G1Q A;  1HNI A;  3K57 A;  1CXU A;  4DR1 K;  1QQO A;  4BG9 A;  3AVK A;  2QA4 N;  1IBL K;  4CBX A;  2P9S A;  3L2V A;  4FLV A;  3F73 A;  1JXB A;  1UA0 A;  2PYL A;  3VPZ A;  3VF4 A;  3NMU A;  1YXQ A;  2HBM A;  3ZT0 A;  3IAY A;  3M8R A;  1TUU A;  3CYM A;  5JIC A;  3S3N A;  3DAW A;  4YFU A;  1W0H A;  4GV9 A;  4JNE A;  3EO3 A;  3MMV A;  4R79 A;  3G4S N;  3KIO A;  4FOI A;  5AFU A;  5J2N A;  4CD1 A;  3V6D A;  3NDK A;  4WQ4 C;  3VES A;  5EOY A;  3TAM A;  3VEX A;  1Z25 A;  3DWL A;  4DTS A;  1RDW X;  2OTL N;  4ID1 A;  4BG8 A;  3ZT4 A;  5DMR A;  4KO0 A;  4I9L A;  3VTH A;  1JKH A;  2E8A A;  3TTC A;  3EE9 A;  5K14 A;  4WFN L;  4DQS A;  1W9H A;  4KHU A;  1HQU A;  3MEC A;  2EX3 A;  2YCH A;  3OYL A;  4PHT X;  1C0U A;  2YHW A;  3CM6 A;  2PFU A;  4Y1D A;  4CK2 A;  4X62 K;  1B9D A;  1GLJ O;  1X1P A;  1OH7 A;  3QDK A;  3V9W A;  4CD3 A;  1U6Z A;  4IG3 A;  3RVC A;  1FKO A;  3AVF A;  2VWB A;  2O8F B;  4F9O A;  4DQP A;  3NFA A;  4IO8 A;  2W6L A;  4DV4 K;  4DQR A;  2A1R A;  4LC9 B;  3MN7 A;  3G0Z A;  3NCI A;  2EHG A;  1MA9 B;  4BRL A;  3LDP A;  5AZJ B;  4H5V A;  4BC3 A;  3WNH A;  3VF6 A;  1FW6 A;  3TR8 A;  3B6P A;  2KZM A;  4DTX A;  4CJ4 A;  5EU7 A;  4B1Z A;  4CK1 A;  3V9U A;  3CC4 N;  4FWN A;  5KTQ A;  4A62 A;  3OYI A;  1L3S A;  2B6A A;  4FWO A;  4YOX A;  1M1K O;  4BRA A;  3PX4 A;  3CJ1 A;  4KTZ A;  3OYF A;  3OBY A;  1S9G A;  2FBY A;  1DEJ A;  4B8A B;  4BRN A;  2FF3 B;  2QWO A;  3KVG A;  1HYV A;  4V19 S;  1E4F T;  3LL3 A;  3PUF A;  1VQM N;  4YOY A;  3O1B A;  4AHC A;  5GIN A;  5KGX A;  4O0I A;  5J2P A;  3RSE B;  4IJN A;  3GE1 A;  4E19 A;  1RNH A;  2QWP A;  4JHD B;  2P9K B;  2JLE A;  1Q7Y O;  3VQA A;  1HMV A;  5DM7 L;  5ADX A;  3OHR A;  3LDL A;  1ILY A;  3M8P A;  2YJE A;  1MWM A;  1EP4 A;  2O4G A;  1RBT A;  3CQX A;  4JYA K;  1Z6R A;  3DXK A;  4AH9 A;  4DV3 K;  1HJO A;  1BQM A;  4JD2 B;  3WNG A;  2ZGY A;  4I2P A;  4I7F A;  4GVM A;  3MK6 A;  3AO5 A;  2Z1G A;  3PX6 A;  4PA1 A;  1NK0 A;  2G8U A;  2VQE K;  3C6U A;  2V7Z A;  3DYA A;  2GEL A;  3AY9 A;  3VQP A;  4JI3 K;  1WUA A;  4BGA A;  4NYN A;  4BRQ A;  2QKB A;  2HNY A;  2Q1N A;  3OY9 A;  1JLG A;  2HMP A;  4FM1 A;  1A5X A;  4JK7 A;  4DF4 A;  2W40 A;  1YUW A;  2HHH K;  1YTA A;  1RDC A;  3M6G A;  5CYQ A;  2YJF A;  3M1F A;  3CJB A;  5M1F A;  1IKW A;  4DV6 K;  2YI1 A;  4DU1 A;  5TKY A;  1NOY A;  5BRF A;  5LMU K;  1VQL N;  4FJ8 A;  4IOA L;  3O9S A;  3VOV A;  1WSI A;  1UWB A;  1H1V A;  5E84 A;  1NGH A;  2NZT A;  3QBW A;  2PYJ A;  4ILG B;  3HO1 A;  4B08 A;  2GBZ A;  4FJ9 A;  4IFE A;  5AZI B;  3CCS N;  3L2W A;  5AQG A;  4JN4 A;  3OW2 M;  4KH4 A;  4CJ7 A;  3VQ5 A;  1N5Y A;  4KRE A;  1A5V A;  3QNO A;  2GEM A;  3CFO A;  4O44 A;  2GWK A;  4RW7 A;  5KQD A;  3P38 A;  3ENO A;  1HKG A;  4ID5 A;  3P31 A;  3ZSO A;  5BPL A;  3VQ7 A;  1RDB A;  3IRX A;  3L0Q A;  5KPR A;  4B9U A;  3CCM N;  4CBW A;  3DLG A;  4ELT A;  4CES A;  1JL1 A;  4JI6 K;  3KJV A;  1GLE G;  4CZF A;  4BVP A;  1T6D A;  3VGL A;  2I7N A;  4BQL A;  4FCY A;  3SUP A;  1LWF A;  3VEZ A;  2DTU A;  1GLL O;  4EAH D;  1QQN A;  4E0D A;  1JLA A;  1ASW A;  3VQ6 A;  1VRT A;  3U6F A;  3OYK A;  4WQ5 A;  4NCB A;  2P5O A;  1RTH A;  1FKP A;  2VWK A;  4CIF A;  4NXM K;  1G15 A;  2HST A;  2UXB K;  4FZY A;  4CER A;  4H0T B;  3WXJ A;  3QEW A;  4K0K K;  2FBX A;  1TUY A;  4M3Z A;  3JAM O;  5IT9 O;  1WBB A;  2QEX N;  2XRI A;  4JI5 K;  3DLE A;  1NKB A;  3JXU A;  3RMB A;  4ZTJ A;  4EIA A;  4E1M A;  4DSE A;  3S3M A;  3TTD A;  2XHB A;  1QS4 A;  4X65 K;  3NHG A;  4LSN A;  4Q5V A;  3QEP A;  4B9N A;  3PIO L;  2ETJ A;  4Q0B A;  2W6K A;  4B1X B;  4DU4 A;  3AA5 X;  1KD1 O;  3L4Q A;  4CJR A;  4CFD A;  2GX9 A;  4CFB A;  1ZXO A;  4GKJ K;  1DT9 A;  2E6L A;  2VYP A;  1VSM A;  3N4P A;  4QS8 A;  1RT3 A;  4DV2 K;  4CJK A;  3THX A;  3C6T A;  4O8K A;  4KHN A;  1OH5 A;  1JL2 A;  2HHW A;  4YY3 K;  4IOX A;  2E5L K;  4DKW A;  4DTJ A;  4EHU A;  5H1S Q;  1D9D A;  4EP5 A;  1TKZ A;  2NUB A;  3OJS A;  2OPP A;  3O3H A;  3T1H K;  4E3S A;  3FZL A;  4Z4I A;  3FZF A;  5C2F A;  2X6S A;  4CHQ A;  3QEX A;  3MXM A;  3SAG A;  3CF5 L;  1RT2 A;  3VA3 A;  1SAZ A;  4F2S A;  3DRP A;  3WXI A;  1W2B M;  3MCA B;  3WXK A;  2ATQ A;  4PKI A;  4MLH A;  2BUP A;  2CGK A;  2E4L A;  3VQ9 A;  3ITH A;  1HYS A;  2O8C A;  1TAU A;  2NNW A;  2YX6 A;  1T05 A;  3SMP A;  2X74 A;  2FLO A;  1X3M A;  4H8K A;  4I9Q A;  2BGG A;  4FJL A;  1C1B A;  1ATS A;  4IBN A;  4HHT A;  1SS6 A;  4FJG A;  3WNF A;  3UIQ A;  1IH7 A;  4CJS A;  4FPB A;  4BDY A;  4DFK A;  2A6A A;  3SUQ A;  3K58 A;  4U7B A;  4KHS A;  4BRI A;  2OPS A;  4FWP A;  1BGX T;  3LAN A;  3ULE A;  1OVY A;  3ZX2 A;  2E6M A;  4NCA A;  4AM7 A;  1NMD A;  1IBK K;  3VEV A;  1TL1 A;  1UA1 A;  3GDQ A;  3MX2 A;  1NGB A;  2FC0 A;  4E1J A;  4M3Y A;  3DMJ A;  3PV8 A;  1W97 L;  1HPZ A;  1VQ4 N;  4FVM A;  5FRN A;  4LH4 A;  4CEQ A;  4NXN K;  3FE1 A;  4EP4 A;  3BEX A;  1T44 A;  3O9Q A;  1NWK A;  1VQ8 N;  1KSP A;  3O08 A;  3SUO A;  2IVN A;  4CZJ A;  3HM9 A;  4PY5 A;  2VG7 A;  3SCX A;  3KKS A;  2ZM6 K;  4KKO A;  5EVZ A;  5F1X A;  4J2E A;  3H3O B;  4BQZ A;  5B8H A;  4CJ3 A;  5CZ1 A;  1YF5 L;  5AQT A;  3OYH A;  4BR0 A;  1C6V A;  3QLH A;  3VQE A;  4DSK A;  1NJW A;  3LDS A;  4CGJ A;  4JI2 K;  5LJW A;  4NLB A;  2QKK A;  4BR7 A;  2Z1J A;  3HPO A;  1Q18 A;  3KWG A;  3KK3 A;  2OPQ A;  2ZD1 A;  3AO4 A;  4C23 A;  2HBL A;  2G8H A;  4HTU A;  4H5W A;  4BC2 A;  4KHQ A;  4HVJ A;  3MWP A;  4BDZ A;  3IS9 A;  3O5B A;  1D5A A;  2P1J A;  4DSF A;  1X9S A;  2BAN A;  4GV6 A;  3F5T A;  2NRR A;  3PIP L;  3CIP A;  3BZC A;  2QWR A;  2HHX A;  1B92 A;  1KC8 O;  5AQV A;  1DTQ A;  2CH5 A;  4B8C A;  3I8D A;  3BDP A;  1ZC6 A;  1XHZ A;  2KTQ A;  4CJV A;  1WBD A;  3CQ8 A;  3FZK A;  3CXC M;  2QWN A;  3TAQ A;  2G8F A;  4QAG A;  1G99 A;  3ZET A;  3I0R A;  5M1O A;  1NG9 A;  2QWQ A;  4XH5 A;  3SJJ A;  4CF2 A;  4E7L A;  3CQY A;  2Q3S A;  3OA9 A;  3THW B;  1TVR A;  1KAZ A;  3ZX3 A;  3HK2 A;  3V9Z A;  1TK0 A;  3AVN A;  2HF4 A;  4CGG A;  4CGD A;  3NGI A;  1L3V A;  1C0G A;  2YNG A;  4C1N K;  4B1W B;  1BIZ A;  3DLB A;  1BI4 A;  4FLY A;  3SPY A;  1HR0 K;  4CJP A;  1N8R O;  3OYN A;  1VAZ A;  3LAM A;  1XMQ K;  3MEE A;  5FPM A;  5BPN A;  3C0B A;  1GLD G;  4FW2 A;  3J8A A;  4KHW A;  1U2V B;  3UKU B;  4FOE A;  3DM2 A;  2I5J A;  5C25 A;  3AVB A;  2V52 B;  2HHV A;  1YI2 N;  1TL3 A;  1BIS A;  4LF6 K;  3EE8 A;  4M3R A;  4DV0 K;  1ATR A;  2VCP A;  4NCG A;  4JKE A;  3JSM A;  4LY7 A;  5KI6 A;  4IEE A;  1VSK A;  4MDA A;  1XUP O;  4M41 A;  3HTV A;  3EYZ A;  3KK2 A;  5AFU H;  2ASM A;  3VF2 A;  3P5J A;  3R9P A;  1NK4 A;  2QWM A;  3HOS A;  4MO4 A;  3I33 A;  1RT6 A;  3PLA A;  4H4O A;  4Z0U A;  4B3T K;  4M42 A;  3OS1 A;  3HJF A;  4JKD A;  4KB1 A;  3QIP A;  1J54 A;  4CZE A;  4ILJ A;  4CGF A;  3D7E O;  3V9S A;  1KQS M;  4WCE L;  4WFA L;  4CJF A;  3ZLJ A;  4H0X B;  4I2Q A;  4Z4C A;  1QSS A;  5DM6 L;  3SZ2 A;  3AVM A;  3SNN A;  4KTW A;  3EEQ A;  4OGC A;  1J5O A;  1LWE A;  2P9P A;  2E2O A;  4CHO A;  3UKU A;  1NJI O;  2FXU A;  4Z4E A;  2D0C A;  2O8B A;  5AQN A;  4KTQ A;  4GMJ B;  4JKH A;  5JLF A;  4HWI A;  1V4S A;  1VQ5 N;  3V9X A;  1KCF A;  4CZI A;  3SLC A;  1YAG A;  5AQH A;  4BRE A;  4Z4H A;  2O8E B;  4DUZ K;  1QZ6 A;  3TI0 A;  2YNI A;  3QIC A;  4K41 A;  4MFB A;  4C8N A;  4CK3 A;  4A5A A;  4E7J A;  3HYF A;  3DRS A;  3TAF A;  1F21 A;  4OVL A;  2GV9 A;  3UKR A;  4DB3 A;  1Z05 A;  3O9U A;  2W42 A;  3K59 A;  2IC3 A;  5CE3 A;  1SV5 A;  2YV0 X;  4PWD A;  4CW7 B;  1T03 A;  1GOB A;  4KFB A;  4JRP A;  1N36 K;  3CHW A;  3THY A;  4BRF A;  3C7N A;  4KHY A;  4U67 L;  2NRW A;  3HZ6 A;  2ZJR L;  5GAD P;  1KVC A;  1C1A A;  1JCG A;  3V1O A;  5M1Q A;  3OTO K;  2D1K A;  2D0A A;  1WB9 A;  2KLA A;  4FK4 A;  1FK9 A;  1NMN A;  4ELV A;  4J2B A;  1KFD A;  4CEO A;  1TKX A;  4IFV A;  3CME N;  2OA8 A;  3J81 O;  4HUE A;  4FJK A;  1NLV A;  4IO9 L;  1NJY A;  1X9M A;  2QXL A;  3EZ5 A;  4FYD A;  2QM1 A;  2Q36 A;  3TAB A;  3H1Q A;  4HCC A;  4DQI A;  2HMI A;  4F2R A;  4JK9 A;  1CZA N;  3O6W A;  1QHA A;  3GBT A;  4E7K A;  2O8E A;  2KW4 A;  4DV1 K;  1BWF O;  3SAH A;  3VGK A;  4FJX A;  4CHN A;  5AZJ A;  3MCP A;  4WFB L;  1I39 A;  4QCL A;  5HLF A;  3TWH A;  1GLA G;  2QW9 A;  3E9O A;  4KHP K;  3OYA A;  4BR9 A;  3HPH A;  4CGH A;  2IVO A;  3DLH A;  1LV5 A;  3MWT A;  3NH2 A;  2Q97 A;  2P9U B;  3MN5 A;  4DFM A;  3I0S A;  3AA2 A;  4DFJ A;  2KFN A;  3H1V X;  2NLX A;  3THW A;  1EX4 A;  4C8L A;  3NH0 A;  4MO5 A;  3GOI A;  1XC9 A;  4A59 A;  1JLB A;  5FPD A;  1OH8 A;  2NRZ A;  5KGW A;  4YOR A;  1SL1 A;  4BR2 A;  4KH5 A;  3AVI A;  3CCR N;  1D8Y A;  4RW9 A;  1MWK A;  1ZYQ A;  4KH6 A;  3OYD A;  4O5B A;  4ISE A;  1CXQ A;  3BUZ B;  5HRO A;  5I3U A;  3O3G A;  4JKB A;  4JHD A;  5BR9 A;  3AVA A;  2IOC A;  3VQC A;  4LD0 A;  3K5N A;  3U8X A;  3ZET B;  3NF8 A;  4C1N I;  3KLI A;  1S6Q A;  3Q7C A;  3NE6 A;  3PSI A;  4ELU A;  3BGR A;  3AAP A;  4W5T A;  2PZS A;  2FSJ A;  3AV9 A;  3MXJ A;  4DR4 K;  2UXC K;  2D0O A;  4GVE A;  4OGE A;  3SMS A;  2G8W A;  3TSU A;  3RWU A;  3A5M C;  1HNZ K;  3D2F A;  1T6C A;  1HNV A;  3SPZ A;  1YHQ N;  2P9L A;  2HHU A;  4FPA A;  1Y97 A;  2FSN A;  3U9D A;  3RRH A;  4K8Z A;  4CEB A;  5AQO A;  1LW0 A;  5EXW A;  3RR7 A;  4DV7 K;  1VQO N;  5JS1 A;  1HKB A;  2P9I A;  4FZZ A;  3SQ1 A;  2HVI A;  4Z4F A;  4GNI A;  1C0T A;  4WF9 L;  2R7Y A;  3TAG A;  5AQU A;  1O1W A;  4KRF A;  3ZT2 A;  1JLQ A;  4Z94 A;  1VQP N;  2W41 A;  4E7H A;  3K5L A;  4BRD A;  5MLC Q;  3VQB A;  4C8M A;  3OYB A;  4WQ4 A;  3SV4 A;  4KPY A;  3LM9 A;  4BAC A;  3SI6 A;  5FRM A;  5BRD A;  4YHH K;  4A5B A;  3NAE A;  5M1P A;  4K8X A;  4LF8 K;  2F7T A;  4UQG A;  2AA4 A;  3ZSZ A;  3OJU A;  2UUB K;  3G71 N;  5JS2 A;  3CJC A;  1YJ9 N;  1N6Q A;  3A0I X;  1Q82 O;  4AHT A;  3LP2 A;  5J2M A;  1QVF M;  2YNH A;  1S22 A;  3RTV A;  4BDP A;  3F9K A;  2F4V K;  5CHI A;  4HUG A;  2E88 A;  5T7B A;  3VMF B;  4DTM A;  3V1Q A;  4JI4 K;  2HOE A;  4RCH A;  3ULD A;  5LY3 A;  4KV8 A;  4DFP A;  1YTU A;  1WOQ A;  4DLE A;  3LP3 A;  3L3U A;  1VSJ A;  3I56 N;  2HW3 A;  3AGK A;  4RW6 A;  5SWM A;  5E41 A;  3ZSQ A;  3T3F A;  3TSP A;  4LH5 A;  1T8E A;  1W7A A;  1YJW N;  2GWJ A; 
#chains in the Genus database with same CATH homology
 3SCX A;  2RKI A;  1BI4 B;  2KQ2 A;  3KKS A;  3HVR A;  3L2U A;  4JS4 A;  4CJU A;  3QIO A;  4PQU A;  4CF0 A;  3A2F A;  3G10 A;  4KKO A;  4J2E A;  1IKV A;  4CEE A;  1RTI A;  3ZSW A;  3C94 A;  4Y1C A;  4CJ3 A;  5CZ1 A;  3OYH A;  3AA3 A;  3AO1 A;  4FM2 A;  4AIL C;  1C6V A;  3QLH A;  3VQE A;  1IO2 A;  1REV A;  2DFH A;  1UOC A;  4N41 A;  4G1Q A;  1HNI A;  4CJW A;  3K57 A;  1CXU A;  4DSK A;  4F3T A;  1WSG A;  1NJW A;  3LDS A;  3AVK A;  1J9A A;  4CGJ A;  1U45 A;  1HYZ A;  4CF1 A;  3L2V A;  1SKR A;  4FLV A;  3F73 A;  1JXB A;  1UA0 A;  2QKK A;  2Z1J A;  3AA4 A;  1RDD A;  4FLU A;  3HPO A;  1QTM A;  1S1U A;  2PYL A;  3L3V A;  3KLG A;  3PY8 A;  5FDL A;  3ZT0 A;  2OPQ A;  4YNQ A;  3KK3 A;  2ZD1 A;  1RTD A;  3AO4 A;  3L8B A;  3IAY A;  3M8R A;  2G8I A;  3CYM A;  4CFA A;  3S3N A;  4OLA A;  1R0A A;  2WON A;  1S1V A;  4YFU A;  3SUN A;  1W0H A;  1RCH A;  1VSI A;  2G8H A;  1ZBF A;  4W5O A;  5C42 A;  4HTU A;  3K2P A;  2B4J A;  4B9T A;  4CHZ A;  1LWC A;  4KHQ A;  4CEF A;  4HVJ A;  4BDZ A;  3IS9 A;  2XY5 A;  3SQ4 A;  1D5A A;  3KIO A;  4CEZ A;  1SKS A;  4W5N A;  5HRS A;  4CEA A;  2P1J A;  4TSX A;  4DSF A;  5J2N A;  3V6D A;  1X9S A;  4KI6 A;  1NOZ A;  4FJ7 A;  1WAJ A;  2BAN A;  3NDK A;  4E7I A;  4BE2 A;  3TAM A;  1ZBL A;  1Z25 A;  4KI4 A;  3HXM A;  2AJQ A;  4DTS A;  4FJ5 A;  3V1R A;  4ID1 A;  2HHX A;  1B92 A;  1GOC A;  2FBV A;  3ZT4 A;  3OYC A;  3L2R A;  5DMR A;  4GW6 A;  5SZT A;  4KO0 A;  4I9L A;  1JKH A;  1DTQ A;  3LP1 A;  3OVN A;  3DOL A;  4B8C A;  3EY1 A;  1ASU A;  5K14 A;  3I8D A;  2F96 A;  3BDP A;  4FZX C;  1IKX A;  1HJR A;  3OYG A;  1XHZ A;  2KTQ A;  2HB5 A;  3QIN A;  3L2Q A;  5HBM A;  4CJV A;  4DQS A;  3QEI A;  3CQ8 A;  1BHL A;  2OZM A;  1W9H A;  4KHU A;  3DRR A;  1C1C A;  1X9W A;  1HQU A;  3TAQ A;  2F8T A;  3MEC A;  2EX3 A;  4CGI A;  2G8F A;  4M3X A;  4QAG A;  3OYL A;  2BDP A;  3I0R A;  4AHR A;  1C0U A;  4DQQ A;  3SJJ A;  3CM6 A;  4CF2 A;  4E7L A;  4Y1D A;  2Q3S A;  3ZSV A;  3KTQ A;  3V81 A;  4CK2 A;  1TVR A;  3T19 A;  1WSJ A;  4HCB A;  4CF9 A;  1B9D A;  1BL3 A;  3HK2 A;  1X1P A;  4JS5 A;  3V9Z A;  3V9W A;  1TK0 A;  3AVN A;  4CGG A;  4CGD A;  4WE1 A;  3NGI A;  1L3V A;  4OJR A;  4IG3 A;  1FKO A;  3QNN A;  3AVF A;  2YNG A;  4IDK A;  3CFR A;  4DQP A;  3AVJ A;  3NBP A;  5DK5 A;  1BIZ A;  3DLB A;  3MXI A;  4Z4G A;  3NFA A;  1BI4 A;  4FLY A;  3SPY A;  3ASM A;  2XY6 A;  5I42 A;  4CJP A;  1XHX A;  3ZSR A;  1TK8 A;  3OYN A;  1CLQ A;  3LAM A;  4DQR A;  2A1R A;  3MEE A;  3PX0 A;  1QSY A;  3LWL A;  3NCI A;  3G0Z A;  2EHG A;  4PUO A;  4DTR A;  4FW2 A;  1VSH A;  4DSJ A;  4N76 A;  3RR8 A;  4KHW A;  3LWM A;  4C8O A;  4FK0 A;  3WNH A;  3DM2 A;  1NK6 A;  3TR8 A;  3ZSY A;  3B6P A;  3KD5 E;  2KZM A;  2I5J A;  1XI1 A;  5C25 A;  3AVB A;  4FW1 A;  4AHU A;  4CJ4 A;  4DTX A;  4CE9 A;  5EU7 A;  2LSN A;  4CK1 A;  3V9U A;  2HHV A;  3O3F A;  4FLX A;  1TL3 A;  1BIS A;  4O4G A;  4M3R A;  5KTQ A;  1RBU A;  4B9L A;  1L3S A;  3ZCM A;  3OYI A;  2B6A A;  5HRR A;  2KFZ A;  4NCG A;  3JSM A;  3NF6 A;  4LY7 A;  5KI6 A;  3PX4 A;  1VSK A;  5HP1 A;  2P51 A;  4KTZ A;  3O4N A;  3OYF A;  4M41 A;  3P83 D;  4NYF A;  4RW4 A;  2ZQB A;  3EYZ A;  3KK2 A;  1S9G A;  4H4M A;  4FJM A;  3P5J A;  3U3G A;  2HHT A;  2FBY A;  1NK4 A;  3AVL A;  4B8A B;  2GUI A;  1WSH A;  5CY4 A;  1HYV A;  3PUF A;  4R5P A;  4KAZ A;  1RT6 A;  3AVG A;  4AHC A;  4H4O A;  4Z0U A;  3VA0 A;  1KLN A;  4L8R B;  3FFI A;  5KGX A;  3HST B;  4O0I A;  3OS1 A;  2Z1I A;  5J2P A;  1LAW A;  4KB1 A;  3LZJ A;  4M42 A;  3QIP A;  3AVH A;  4E19 A;  1J54 A;  1RNH A;  4CGF A;  3ZT1 A;  2YKN A;  4OKJ A;  2JLE A;  3V9S A;  3VQA A;  2XY7 A;  1HMV A;  4CJF A;  1TGO A;  1U48 A;  3QES A;  4B9S A;  1VSE A;  4CCH A;  2O4I A;  4I2Q A;  2X78 A;  3M8P A;  4BWM A;  4Z4C A;  1QQC A;  3OS0 A;  1QSS A;  3SZ2 A;  3U3Y A;  3CG7 A;  1EP4 A;  2X6N A;  3AVM A;  3ZT3 A;  4KTW A;  3SNN A;  2O4G A;  1RBT A;  4CIE A;  3SV3 A;  2KZZ A;  2IDO A;  1Q8I A;  4OGC A;  3T1A A;  1NK5 A;  1J5O A;  1ZBH A;  4AH9 A;  1LWE A;  4CHO A;  4EZ6 A;  3TAR A;  3LZI A;  4Z4E A;  2D0C A;  1S6P A;  4KTQ A;  1BQM A;  3O4Q A;  4GMJ B;  3WNG A;  2D0B A;  4FLT A;  1U47 A;  1KRP A;  4F3O A;  2BE2 A;  4CFC A;  1KVB A;  1NJX A;  1RT1 A;  2Y1J A;  4I2P A;  4I7F A;  3V9X A;  1KCF A;  4GVM A;  3AO5 A;  1RBS A;  2Z1G A;  3PX6 A;  4PA1 A;  1NK0 A;  2G8U A;  4Z4H A;  3KLE A;  4CJT A;  3C6U A;  4FJJ A;  3DYA A;  3DLK A;  4FLZ A;  1MU2 A;  4N47 A;  3VQP A;  1J53 A;  3TI0 A;  2YNI A;  4MFB A;  4NYN A;  4LSL A;  2B5J A;  1A5W A;  4C8N A;  3VQQ A;  4CK3 A;  2QKB A;  2HNY A;  2HHQ A;  4E7J A;  3HYF A;  4FK2 A;  3DRS A;  3OY9 A;  1S1T A;  1F21 A;  1JLG A;  2XY8 A;  3TAF A;  4J2A A;  4M3W A;  4FM1 A;  3MEG A;  4OVL A;  1A5X A;  2GV9 A;  2W42 A;  3K59 A;  1S9E A;  2IC3 A;  4DF4 A;  1SV5 A;  1YTA A;  1RDC A;  2YV0 X;  1KLM A;  4J2D A;  5CYQ A;  4ZHR A;  3V4I A;  4IFY A;  4PWD A;  1T03 A;  1IKW A;  1GOB A;  5HRP A;  2HHS A;  4C8K A;  5J2Q A;  4B9M A;  4DU1 A;  4KFB A;  1S5J A;  1I3A A;  1NOY A;  1CZ9 A;  4JRP A;  4FJ8 A;  2FBT A;  4JLH A;  4O0J A;  4DTP A;  5KRS A;  1WSI A;  4DG1 A;  4KHY A;  1UWB A;  4QOZ B;  1B9F A;  3JYT A;  1KVC A;  4DWI A;  4CJL A;  1C1A A;  2A1S A;  3M8Q A;  1VSD A;  3DI6 A;  3V1O A;  1SKW A;  2PYJ A;  4B08 A;  3HO1 A;  2GBZ A;  1L3T A;  4FJ9 A;  2DY4 A;  2D0A A;  3HJF A;  3L2W A;  4FK4 A;  1TAQ A;  1S1W A;  2JGU A;  1FK9 A;  4OLB A;  3WNE A;  4DS5 A;  1ZBU A;  4ELV A;  4J2B A;  1KFD A;  2HNZ A;  3VQ5 A;  3S3O A;  1N5Y A;  1IKY A;  4CEO A;  4KRE A;  1TKX A;  4IFV A;  2OA8 A;  1A5V A;  3QNO A;  3OYJ A;  1K6Y A;  3CFO A;  4O44 A;  4RW7 A;  2PY5 A;  4ICL A;  5KRT A;  3VQ4 A;  2P5G A;  3HP9 A;  4ID5 A;  1VSF A;  4HUE A;  1VRU A;  4FJK A;  3CFP A;  3ZSO A;  1NJY A;  3VQ7 A;  5HRN A;  3EZ5 A;  1X9M A;  4FYD A;  3VQ8 A;  1RDB A;  1RIL A;  1Z26 A;  2HND A;  3IRX A;  3TAB A;  4FXD A;  1VSL A;  4AHV A;  4OKK A;  4B9U A;  4RG8 A;  4W5Q A;  1SL2 A;  4HCC A;  3DLR A;  3DLG A;  3KLH A;  2YHA A;  3RMC A;  4DQI A;  4CES A;  4BE1 A;  4ELT A;  4CHP A;  1RDA A;  1JL1 A;  2HMI A;  2QK9 A;  4F2R A;  3KJV A;  5C24 A;  4E7K A;  2KW4 A;  4FCY A;  3SUP A;  1LWF A;  3M8S A;  2HVH A;  1TKT A;  3AVC A;  1ZBI A;  3MED A;  2DTU A;  3LAK A;  4W5R A;  4E0D A;  4ZTF A;  1ASV A;  4FJX A;  4CHN A;  1JLA A;  1ASW A;  3VQ6 A;  3PO4 A;  1VRT A;  4BE0 A;  3U6F A;  3OYK A;  3S9H A;  1I39 A;  1HRH A;  1DLO A;  4CJQ A;  4QCL A;  1SUQ A;  3TWH A;  5HLF A;  4NCB A;  1BQN A;  2P5O A;  4MQ3 A;  1EET A;  1RTH A;  3OYA A;  3OYE A;  1FKP A;  1FXX A;  3HPH A;  4CGH A;  1L5U A;  3DLH A;  1LV5 A;  3HL8 A;  2VWK A;  3B6O A;  4CEC A;  4CIF A;  1G15 A;  3NH2 A;  4DFM A;  3AO3 A;  2RF2 A;  3D45 A;  3AA2 A;  3I0S A;  4FZY A;  4B9V A;  4DFJ A;  4CER A;  3VN5 A;  4E1N A;  3TAN A;  2G8K A;  4M3U A;  4IG0 A;  4IKF A;  3NGZ A;  1NK8 A;  2KFN A;  1EX4 A;  3QEW A;  2FBX A;  3D0P A;  4C8L A;  3QO9 A;  4M3Z A;  3NH0 A;  4EZ9 A;  3NH1 A;  4OKE A;  4KB0 A;  1XC9 A;  2XRI A;  3DLE A;  1NKB A;  1JLB A;  3RMB A;  4DU3 A;  4ZTJ A;  3S3M A;  4E1M A;  5KGW A;  1GOA A;  4DSE A;  1SL1 A;  1KFS A;  2XHB A;  1QS4 A;  1IG9 A;  2VG6 A;  4BWJ A;  1JLF A;  3TAE A;  3AVI A;  4LSN A;  3NHG A;  4Q5V A;  3QEP A;  4RW9 A;  1D8Y A;  1RT4 A;  1ZYQ A;  2OPR A;  3KKR A;  1C0M A;  4B9N A;  2ETJ A;  1WSF A;  4Q0B A;  1DTT A;  3VQD A;  3OYD A;  4FJN A;  4N5S A;  4DU4 A;  4O5B A;  4DLG A;  3AA5 X;  1CXQ A;  1D9F A;  4OPJ A;  3KK1 A;  4CJR A;  4CFD A;  3RMA A;  1WN7 A;  3NF7 A;  5HRO A;  4CFB A;  1RBV A;  1CZB A;  3O3G A;  5I3U A;  3QER A;  2XO7 A;  2E6L A;  4DSL A;  1BCO A;  1VSM A;  3AVA A;  2YNF A;  1WAF A;  2IOC A;  3VQC A;  3P1G A;  1RT3 A;  4LD0 A;  4CJK A;  2IGI A;  3K5N A;  4CJ5 A;  4E89 A;  4DF8 A;  1U04 A;  3C6T A;  3QET A;  4KHN A;  1RTJ A;  2RN2 A;  3HT3 A;  1JL2 A;  1LW2 A;  2HHW A;  3NF8 A;  1TV6 A;  2VWJ A;  2IS3 A;  4DTU A;  3KLI A;  1S6Q A;  3NE6 A;  4DTJ A;  3KD1 E;  2Y1I A;  4CF8 A;  4DS4 A;  3OS2 A;  1EKE A;  1D9D A;  4ELU A;  4B3O A;  3BGR A;  4EP5 A;  4W5T A;  4FM0 A;  4O55 A;  4CED A;  2PZS A;  1TKZ A;  3AV9 A;  2OYQ A;  3HPG A;  2G8V A;  2NUB A;  3MXJ A;  4OGE A;  3OJS A;  2G8W A;  3LPU A;  3RWU A;  2OPP A;  3O3H A;  2VG5 A;  1RT7 A;  4FLW A;  4CIG A;  4E3S A;  3NGY A;  1L3U A;  3K5M A;  1HNV A;  2ITG A;  3SPZ A;  4Z4I A;  2X6S A;  4CHQ A;  2IAJ A;  3QEX A;  3MXM A;  1Q9X A;  1U49 A;  3RRH A;  1Y97 A;  4K8Z A;  2HHU A;  1RT2 A;  4CEB A;  3VA3 A;  4F2S A;  1WSE A;  1UAX A;  1LW0 A;  1WLJ A;  3DRP A;  3IG1 A;  3LAL A;  2Z1H A;  3THV A;  3RR7 A;  4CJE A;  3SQ2 A;  4F8R A;  5JS1 A;  3RRG A;  2D5R A;  2F8S A;  1YT3 A;  4FZZ A;  2ATQ A;  3LP0 A;  1BCM A;  4M3T A;  3SQ1 A;  2DFE A;  4OPK A;  2HVI A;  1S1X A;  4Z4F A;  1C0T A;  2E4L A;  2R7Y A;  3VQ9 A;  3ITH A;  1O1W A;  3TAG A;  3K5O A;  1XWL A;  3ZT2 A;  4F4K A;  4KRF A;  1QHT A;  1HYS A;  1JLQ A;  3H08 A;  3ISN C;  4JRQ A;  4CHY A;  3E01 A;  3HP6 A;  1TAU A;  2DFF A;  4E7H A;  1QE1 A;  4AHS A;  2X74 A;  3K5L A;  3TAP A;  1RT5 A;  1T05 A;  1TKD A;  4DSI A;  5J1E A;  3VQB A;  1T7P A;  4H8K A;  1KTQ A;  2WOM A;  4C8M A;  3OYM A;  3HVT A;  3OYB A;  4I9Q A;  2BGG A;  4FJL A;  1YVU A;  4KPY A;  3SV4 A;  1NK9 A;  1EXQ A;  1C1B A;  4BAC A;  3SI6 A;  1NKE A;  2OZS A;  4IBN A;  4XIU A;  4HHT A;  3SYZ A;  3MAQ A;  5D3G A;  5FRM A;  4FJG A;  3NAE A;  3WNF A;  1Q9Y A;  1IH7 A;  3SQ0 A;  3UIQ A;  4K8X A;  4UQG A;  3ZSZ A;  3OJU A;  2RPI A;  4CJS A;  1HQE A;  5JS2 A;  4BDY A;  4DFK A;  1N6Q A;  4DTO A;  3SUQ A;  3QEV A;  1BIU A;  4DMN A;  3K58 A;  4KHS A;  4AHT A;  3LP2 A;  1LAV A;  2OPS A;  1BGX T;  3LAN A;  5J2M A;  2YNH A;  1JLC A;  3RTV A;  4BDP A;  2E6M A;  1ITG A;  1RBR A;  3F9K A;  3KLF A;  4NCA A;  4HUG A;  1QSL A;  3DOK A;  5T7B A;  5CZ2 A;  3PO5 A;  1TL1 A;  4DTM A;  2YHB A;  4N56 A;  1TK5 A;  1UA1 A;  3V1Q A;  4M45 A;  2ZE2 A;  3ULD A;  4KV8 A;  2FC0 A;  5CYM A;  4RW8 A;  1JLE A;  3AO2 A;  3C95 A;  4DFP A;  3DMJ A;  4DTN A;  3RMD A;  1NJZ A;  4M3Y A;  5FRO A;  1YTU A;  1NK7 A;  3PV8 A;  4DLE A;  3LP3 A;  1WNS A;  3L3U A;  1VSJ A;  4HUF A;  1U4B A;  1HPZ A;  5FRN A;  4FVM A;  3CM5 A;  1KVA A;  4LH4 A;  4CEQ A;  1SL0 A;  4EP4 A;  2HW3 A;  4RW6 A;  3ZSX A;  3NF9 A;  3LPT A;  5SWM A;  1VK0 A;  3ZSQ A;  3ALY A;  5E41 A;  3T3F A;  1JXE A;  1KSP A;  4LH5 A;  1T8E A;  4FJI A;  2QXF A;  3SUO A;  1NKC A;  3HM9 A;  4PY5 A;  4FJH A;  2YKM A;  2VG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...