1BI4A

Catalytic domain of hiv-1 integrase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 42
structure length 142
sequence length 152
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bi4A00
1JKHA 1HMVA 2KTQA 4TSXA 3I8DA 3LP3A 4CGIA 3K5MA 1NK9A 1VK0A 3NF8A 1T7PA 4Y1DA 4G1QA 1B92A 1WSGA 3TAPA 3AVAA 1HQUA 4DTXA 2KFZA 1UA1A 3C95A 5J2NA 1KFSA 1ZYQA 1TL3A 1KSPA 3D45A 3OYAA 4FK4A 4QOZB 1I3AA 2DY4A 3DOKA 1NOYA 1F21A 3TAFA 2RPIA 1RTDA 4I9LA 3NHGA 1VSFA 2ETJA 3EYZA 4W5QA 4IBNA 3HM9A 1LAWA 5HBMA 4OLAA 3TWHA 4AHSA 1S9GA 3CFOA 1KLMA 3DI6A 4CGJA 3QEPA 4L8RB 2IAJA 4AHTA 3DRSA 3L8BA 4J2BA 4IG0A 1ASVA 3AVFA 3OVNA 4CF8A 4R5PA 1TAQA 1LAVA 1ZBFA 2RKIA 4W5RA 3TR8A 5HLFA 1N6QA 2QKBA 4DU1A 1LWFA 3PX6A 3RMAA 3ZT2A 2ZD1A 1KVBA 3PO4A 1JLFA 3OS0A 2OPPA 4B9LA 1S1TA 1U04A 4DFJA 4K8XA 1S5JA 4FJ7A 4Z4FA 4CFAA 1ASWA 1S9EA 1JLCA 4KAZA 5HRRA 2QKKA 3B6PA 1C1AA 1WSIA 1YTAA 4C8LA 1YTUA 4CJFA 1BCMA 1NJXA 5CYQA 1VSKA 5CZ1A 3HPOA 1ZBHA 3IS9A 1Y97A 1QSSA 4CJ3A 4FJ5A 3SJJA 4CJRA 2OZSA 1C0UA 4FK0A 2B6AA 4FZYA 4F3TA 3S3MA 4KREA 1A5VA 1QSLA 1ASUA 3AVJA 4NYFA 4PWDA 4DTNA 1EXQA 3KLEA 3NH2A 2HHWA 3AVBA 2OZMA 3OYCA 4CJEA 5FRNA 1Z26A 4CF9A 4DSFA 3AVLA 1U4BA 3LAMA 4DU4A 4YNQA 5JS1A 3QEWA 4DFPA 4B8CA 1QSYA 5CYMA 4O44A 1KVAA 4Z4CA 4KB1A 3EY1A 3THVA 4KRFA 3QEIA 3LWLA 2YKMA 3OS1A 1WLJA 3KD1E 1EKEA 1K6YA 2P51A 5CY4A 5HRSA 4BDZA 3SPYA 1D8YA 5KTQA 2HNYA 4MQ3A 1C1BA 3LWMA 4FJJA 3OYNA 4F2SA 3AVGA 4CF2A 1EP4A 3L2VA 5FDLA 2QK9A 1CZ9A 4FVMA 1C0TA 2KZZA 3OYGA 1KTQA 4Q0BA 3NFAA 2VWJA 4YFUA 1VSDA 4W5OA 5HP1A 3VQ4A 4KHWA 3HVTA 4CEBA 4LSLA 3RR8A 1QE1A 5K14A 3KK2A 4M3TA 3PX4A 1HNVA 1L3TA 2PYLA 3U3GA 3L2QA 5EU7A 5HRPA 1RTHA 3KK1A 1VSMA 4DQQA 3ASMA 3QLHA 3HP6A 3K57A 4BE1A 4BDPA 3OYHA 4JRPA 4FLYA 4FLUA 4DS5A 3FFIA 3ZT4A 4CJWA 3C94A 3KLIA 1VSLA 5HRNA 3K5NA 1NJYA 1T03A 1SL1A 1NK4A 3LP1A 3HSTB 4C8MA 4FJGA 1RBVA 1RT4A 3AA3A 3NF6A 1JLBA 4I2QA 1VSIA 4M41A 4AH9A 3PX0A 4E3SA 3RR7A 3QERA 4F8RA 4ELUA 1HYVA 3LALA 4KTQA 1DLOA 2G8WA 3TABA 2XHBA 4DSJA 4B9TA 2VG7A 4ID5A 4DLEA 2YHAA 4EP5A 4M3XA 2B5JA 3RRGA 4CEDA 3HO1A 3NH1A 4M3YA 1TAUA 2A1SA 5DMRA 1TK0A 1W0HA 5E41A 2HMIA 4QAGA 3DYAA 2ZE2A 3KD5E 3ZT0A 3QEXA 1UWBA 2YV0X 4MFBA 1CXUA 3O4NA 4CF0A 3NBPA 2KFNA 1IO2A 3LP2A 2Z1HA 1A5XA 3ZSVA 1D9FA 1SL2A 1RTIA 4E7LA 3OYBA 2BE2A 1QS4A 4O55A 4CJ4A 4LY7A 1S1UA 3OYKA 3DLHA 3L2RA 3B6OA 1B9DA 1TVRA 4E7JA 1QHTA 2Z1GA 4DF8A 4KPYA 3F9KA 4CEFA 4DMNA 2DFEA 3T19A 4JS4A 1JLQA 4J2AA 4KTZA 3K5OA 3K2PA 4H4MA 1D9DA 4C8NA 2E6LA 1BISA 4E19A 1NOZA 4CFBA 1SL0A 1CXQA 1L3SA 1Q9YA 1RILA 4FYDA 4PA1A 4FCYA 1NKCA 1TKXA 1S6PA 1L5UA 1UA0A 4DTUA 3AVMA 1QQCA 1TGOA 2XY8A 3DRRA 3NE6A 1HYZA 1S1WA 4CJUA 4ZTJA 1WSEA 4DSKA 4HUEA 1JLGA 3WNFA 4CEOA 2HVIA 1WN7A 2DFFA 3RMDA 1R0AA 4B3OA 4OKJA 2IGIA 3MXJA 5KGWA 1S1VA 3VQ7A 3RTVA 3O3GA 3V81A 1TK8A 3UIQA 3VQDA 3DOLA 4RW4A 3HVRA 1J54A 2GUIA 3L3UA 3M8QA 3LZJA 1JLAA 1T8EA 3AO5A 4FJ9A 3KJVA 5CZ2A 2Z1JA 1BHLA 3SQ2A 4FM0A 1RT5A 1NK5A 1N5YA 2G8UA 2HHXA 4B9VA 2QXFA 1U48A 4OKEA 4DLGA 1EX4A 2I5JA 4FM1A 4B8AB 3MXIA 2GBZA 2AJQA 4FLZA 3ZSYA 4M3WA 3AO1A 5SWMA 4AHVA 4FLWA 2XY5A 4JLHA 4LD0A 3ZT1A 4FLXA 3KLHA 2E4LA 4M3UA 2KQ2A 4CHNA 1U45A 4CK2A 1XI1A 4RG8A 4FJNA 3V1RA 1IKXA 1RBUA 4GVMA 1BIUA 2HNZA 3VQ8A 1RT2A 3VN5A 3BDPA 2IOCA 4HHTA 3CG7A 1G15A 4DQPA 3I0RA 3PUFA 3O3HA 4FZZA 4FLTA 1RNHA 4ELTA 3OYMA 1X9MA 2HNDA 4WE1A 2WOMA 4Z0UA 3JYTA 4UQGA 4N41A 3DLRA 1X9WA 4FK2A 3NF9A 3LPTA 1REVA 4KO0A 4CECA 1JXBA 1RDAA 5KRTA 1YVUA 2VG6A 3AVNA 3QIOA 3LP0A 4H4OA 3DM2A 3MXMA 1ZBIA 2R7YA 4N56A 4KHNA 2Q3SA 3JSMA 3NAEA 4GMJB 4F2RA 3HJFA 3O3FA 3ZSQA 2RN2A 4DTMA 4FZXC 3QO9A 2G8FA 3HXMA 5J1EA 3OYLA 3H08A 4B08A 2FBXA 4LH5A 1NK6A 4E7HA 3WNEA 2B4JA 3V9ZA 4CJSA 1J53A 2D0AA 3AO2A 1LWEA 5FROA 2ZQBA 3PO5A 3ZCMA 1LWCA 3SV3A 3DLGA 4CIGA 4E7IA 2FBTA 3TAMA 2JGUA 4CHPA 4FJHA 3MEEA 1D5AA 4DTJA 1S1XA 3V1OA 2FBYA 1EETA 3CYMA 5C24A 4CIEA 2G8KA 3WNGA 4CJLA 2ITGA 2P5OA 3ZSRA 1RDBA 1WSFA 3VQQA 3K59A 3L2UA 4KI6A 3I0SA 3OYIA 1B9FA 3SI6A 1NK8A 2EX3A 3F73A 4NCBA 4FJKA 4Z4GA 3DMJA 3T3FA 1XHZA 3CM6A 3P1GA 1XC9A 4CIFA 1JL2A 3AO3A 4CJ5A 4CK1A 1FXXA 2DTUA 3QETA 2HHVA 1C0MA 4FW1A 4HUFA 3M8RA 2HB5A 1WAFA 2IS3A 3LANA 3AVIA 3AA5X 4W5TA 5HROA 4O0JA 1BGXT 3KLFA 3VA0A 3LAKA 4AHUA 4JS5A 1YT3A 4NCAA 4CGDA 2OPQA 3SUOA 2FC0A 1GOBA 2BDPA 3SQ4A 2YNGA 1C1CA 4CEAA 2D0CA 3NGIA 3ULDA 3QEVA 1RT7A 1IKYA 4CGHA 4OJRA 3VQ6A 4E89A 2RF2A 3SYZA 4CJTA 2YHBA 2Y1JA 1NKEA 4FJMA 4DTOA 1FKPA 4E1MA 1RTJA 3CFRA 5C42A 4OKKA 1UOCA 2JLEA 3AVKA 3KKSA 4BDYA 4Y1CA 4E0DA 4FJ8A 3IRXA 2P5GA 4AHRA 2VWKA 3MEGA 3HK2A 3SUQA 3SUPA 1RT1A 2O4GA 4N47A 4DSLA 4LH4A 4BACA 2OPRA 3VA3A 4BWMA 3AVCA 4KFBA 4KHUA 4I9QA 2D5RA 1JLEA 4LSNA 4FJIA 3L3VA 1TL1A 4C8OA 3AV9A 3SCXA 1HJRA 2IC3A 3LZIA 3EZ5A 4M3RA 4DFKA 1HRHA 1T05A 4Z4IA 4Z4HA 4ID1A 1J9AA 1RBSA 4DG1A 2PZSA 3RMBA 4OLBA 4W5NA 3P83D 3BGRA 4E7KA 1BI4A 4IFYA 4B9SA 4BE0A 5JS2A 1BQMA 3VQ5A 4HCBA 4Q5VA 4CK3A 3D0PA 3CFPA 3OYFA 4EZ6A 1HQEA 1RDCA 3AVHA 3E01A 3RRHA 1X1PA 3SQ0A 4KB0A 3HPGA 2PY5A 2KZMA 2Z1IA 4OGEA 1BCOA 3QINA 4HTUA 3V4IA 3CM5A 3DRPA 3G10A 1SKSA 3G0ZA 3LPUA 4F4KA 1DTTA 3V1QA 4CHYA 5J2PA 1LV5A 3DLKA 4O0IA 4CESA 1DTQA 1RT3A 2F96A 4CJKA 3CQ8A 2G8VA 3S3NA 4CEZA 3C6UA 2XO7A 1KLNA 4KHYA 1C6VA 3HYFA 3S9HA 1Q9XA 3TARA 4DQIA 1WNSA 2OYQA 2BGGA 1VSEA 2GV9A 2X74A 1TKZA 5FRMA 1RBRA 1ZBUA 2IDOA 4JRQA 4BWJA 1SKRA 4ZTFA 1LW2A 4IDKA 3HL8A 4N5SA 1SUQA 4O4GA 3OYJA 3L2WA 4DTRA 3K58A 2OA8A 4DTSA 4DS4A 2YNHA 2OPSA 3C6TA 4RW7A 4OPJA 1WSHA 3M8SA 1UAXA 5DK5A 4AHCA 3NDKA 3SPZA 1IH7A 1ZBLA 1GOCA 3VQPA 4CHOA 4DU3A 2W42A 4C8KA 3IAYA 3ZSWA 4FM2A 3TANA 3V6DA 1WSJA 4CF1A 1XWLA 4OVLA 4ZHRA 3OYEA 4EP4A 4DQSA 1JXEA 3SQ1A 2O4IA 2LSNA 4E1NA 1GOAA 4B9NA 4H8KA 4CFDA 1I39A 1NK7A 4KI4A 4M45A 1Z25A 4KV8A 4CFCA 1O1WA 4CEQA 4CGGA 3OY9A 3KK3A 3OJSA 4PUOA 4IKFA 3SZ2A 3ZSXA 4KHSA 3RMCA 3TI0A 2YNFA 4CEEA 4KHQA 3MEDA 1MU2A 4CGFA 4NCGA 4N76A 5D3GA 4XIUA 3V9SA 3IG1A 5J2MA 4AILC 1IG9A 4DF4A 3HPHA 1RT6A 3KLGA 2G8HA 4CJPA 1IKVA 2DFHA 2X6NA 1CZBA 3O4QA 3OYDA 4KTWA 4CCHA 1FK9A 1JL1A 3SV4A 3QESA 4RW9A 3ZSZA 1KCFA 5KGXA 4B9UA 4B9MA 4EZ9A 3HT3A 1U47A 2HHSA 3ALYA 4DSEA 3QNNA 5T7BA 4RW8A 1RCHA 4ICLA 3TAEA 3SNNA 1TK5A 5SZTA 1J5OA 1BI4B 1KVCA 3DLBA 2BANA 3RWUA 3QIPA 1BIZA 4HCCA 4FW2A 3TAQA 2Y1IA 1S6QA 3VQCA 1BL3A 4FXDA 1HPZA 1HYSA 4IFVA 3VQBA 4J2EA 1W9HA 3P5JA 4OPKA 3V9XA 2F8TA 3OJUA 2KW4A 3SUNA 4BE2A 4GW6A 5KI6A 3ISNC 4CHQA 4CHZA 4OGCA 1SKWA 1KRPA 1TKDA 1NKBA 3AA4A 3V9UA 3AA2A 3ZT3A 2FBVA 1NJZA 4FJLA 1VSHA 3VQEA 4DWIA 1L3VA 3NGZA 1QTMA 2PYJA 2EHGA 4DFMA 1L3UA 4K8ZA 5C25A 3NH0A 3V9WA 4PQUA 1TKTA 2X78A 3ITHA 4CJQA 5I42A 1ITGA 3MECA 1TV6A 4RW6A 3QNOA 4DSIA 4F3OA 4CJVA 1XHXA 4Z4EA 2HHTA 4IG3A 2VG5A 3AO4A 4M3ZA 2HW3A 2HHQA 1RBTA 3NCIA 2HHUA 2YNIA 1VSJA 4NYNA 3VQ9A 3U6FA 1VRUA 3KIOA 3KKRA 1KFDA 4QCLA 2E6MA 1NJWA 4DQRA 2X6SA 4CERA 1SV5A 4FJXA 2XRIA 1CLQA 1BQNA 3T1AA 2D0BA 4KKOA 4HVJA 4O5BA 3LDSA 4DTPA 1X9SA 2XY7A 2YKNA 2A1RA 3PV8A 5I3UA 3WNHA 2P1JA 5J2QA 3KTQA 4M42A 1WAJA 1Q8IA 4I7FA 3MAQA 3NF7A 3ZSOA 3K5LA 3S3OA 1LW0A 3DLEA 4FLVA 4J2DA 1HNIA 3PY8A 3OS2A 2XY6A 3NGYA 1NK0A 2ATQA 2G8IA 4PY5A 3TAGA 1FKOA 3U3YA 2F8SA 5KRSA 4ELVA 1U49A 1VRTA 1RDDA 1A5WA 1IKWA 3VQAA 3M8PA 3HP9A 2NUBA 2HVHA 2WONA 4HUGA 4I2PA 3A2FA 4CE9A
chains in the Genus database with same CATH superfamily
1JKHA 4LF4K 4JI6K 5AQIA 1R59O 4DV7K 4JKFA 5FPDA 1B92A 1WSGA 3TAPA 1VQKN 1EWQA 3ENOA 4DTXA 3OA9A 3H3OB 5J2NA 3OYAA 1NGEA 5F1XA 2DY4A 4JYAK 3VEYA 4JNEA 3R6MA 4I9LA 3NHGA 4CZEA 3MX5A 3HM9A 4JKAA 5BPMA 3CETA 4CGJA 2IAJA 4LF5K 3NVKA 4BRDA 1C0FA 4B3MK 3OVNA 2A5XA 3CJCA 4CF8A 2RKIA 4W5RA 4JI5K 5HLFA 2O8EA 2ZD1A 4YOWA 2QW9A 1U04A 4DFJA 2HSTA 4B1XB 4CFAA 1ASWA 1GLJO 1JLCA 1YTAA 4C8LA 4CJFA 5LY3A 3CQXA 1NJXA 1BWFO 1Y97A 3L6QA 4FK0A 1OH7A 1GLLO 4PKHA 1ASUA 3AVJA 4I6MB 2RE2A 2E2QA 4Y0WA 4JD2B 3QFPA 2HHWA 5GADP 3OYCA 1HLUA 1P8ZA 4DUZK 1HKBA 1U4BA 4DU4A 3QEWA 4O44A 3CCJN 2YKMA 5CY4A 5HRSA 2HNYA 4MQ3A 4CZIA 3OYNA 4CD1A 3CCLN 3AVGA 4CF2A 1EP4A 3L2VA 1NMDA 4Q0BA 3O9SA 1VSDA 4W5OA 4A5BA 4DR5K 4BRLA 3KK2A 1L3TA 5HRPA 3KK1A 1K73O 3G4SN 4BDPA 3OYHA 3C7NB 1T03A 2AP1A 3A2FA 4FJGA 1RBVA 1RT4A 4AH9A 1QHAA 3CCEN 4BG8A 2VGNA 4B9TA 2VG7A 3C65A 4M3XA 4EP5A 4I6MA 2B5JA 4CEDA 4JD2A 3E66A 4BRGA 3O9RA 1W0HA 5AQWA 4B1UB 4AM7A 3O4NA 1IO2A 3LDOA 1RTIA 3KK7A 4JK8A 3OYKA 3ZYYX 3DLHA 3O6WA 3J7ZO 2HF4A 1TVRA 4MDBA 1QHTA 4DF8A 4CEFA 3EO3A 2DFEA 4O8UA 4J2AA 1WB9A 1D9DA 1BISA 5AQNA 1NOZA 3K9KA 4CFBA 4X64K 3I56N 1SL0A 3CF5L 1E3MA 4FYDA 4PA1A 4FCYA 1N34K 2NRXA 1S6PA 3DXMB 1E4FT 2QWPA 1GLBG 4K42A 1HYZA 1S1WA 3CC4N 3CD6N 3MX2A 4OKJA 3RTVA 1TK8A 3O3GA 3GOIA 1VAZA 3FZFA 3HVRA 2UUAK 3LZJA 3M8QA 4EIAA 1JLAA 4H03B 4K0KK 3E9PA 2Z1JA 3CC2N 1NK5A 2G8UA 2D1KA 5MLCQ 4OKEA 2WFBA 3BZKA 2GBZA 4FLWA 2XY5A 1GLCG 4JLHA 1ZBSA 3ZT1A 1U45A 2NNWA 1XI1A 4RG8A 4FJNA 1IKXA 4GVMA 1BIUA 3EEQA 3VQ8A 3BDPA 5BRHA 4HHTA 3MN6A 2QWQA 2D0PA 3BP8A 1RNHA 3N4QA 1X9MA 4BRMA 3UKUA 2UXBK 3NVMA 4RTFD 1MWMA 5BPLA 4KO0A 4CECA 4DR2K 1ATRA 4DR6K 3MWTA 3DM2A 4H4OA 4N56A 4KHNA 3NAEA 3HJFA 4IEEA 3O3FA 2P9PB 1LOTB 1ESVA 2G8FA 4M7YA 3OYLA 3H08A 3L0QA 3WNEA 4CJSA 3AO2A 5AQPA 5FROA 3PO5A 5JVGL 5IWAK 2JGUA 1D5AA 2QA4N 1BO5O 2FBYA 4BQLA 4KHPK 4KH4A 3WNGA 4CJLA 4IOXA 1JCEA 2ITGA 3SK3A 1K8AO 3NMUA 4NCBA 1B9FA 4Z4GA 4NXMK 3VPZA 1W7AA 3AO3A 2IVOA 2YHXA 3QETA 2HHHK 1J6ZA 4HUFA 3R9PA 3HSCA 3FFKB 4KBOA 3MMVA 1BGXT 4O0JA 3VA0A 3G6EN 2BDPA 3PLAA 3NGIA 2OTJN 2YHYA 2D0CA 3QEVA 4YHHK 1RT7A 3SYZA 2E20A 4FOIA 4FJMA 4E1MA 4BDYA 2PFUA 4E0DA 3FLCO 2ZWHA 3MEGA 3EKUA 3VF2A 4KHUA 3WXLA 2P9NB 4I9QA 1JLEA 2UU9K 4YY3K 5CR4A 5AQVA 2NRVA 4Z4IA 1T05A 1J9AA 1RBSA 2PZSA 1D4XA 4OLBA 3P83D 1W97L 1KC8O 4IFYA 3FZMA 4IZ9A 3CHWA 4U7BA 3VENA 4CK3A 3CFPA 1TUUA 1HQEA 3AVHA 3E01A 1E4GT 3SQ0A 3C0BA 3HPGA 4JI1K 4PL7A 1J5EK 2Z1IA 4CZHA 4HTUA 3G10A 3LPUA 3E9LA 2KKZA 2YI1A 5J2PA 1LV5A 4O0IA 1RT3A 3I8BA 4HTLA 4A5AA 4CEZA 3O1WA 2XO7A 1KLNA 4PKIA 1C6VA 1YF5L 4FPAA 5AQYA 1IG8A 1YJWN 4ZTFA 1LW2A 1SKRA 4BRPA 1NGHA 4O4GA 3OYJA 3L2WA 5LJVA 4BR7A 3K58A 4DTSA 3C6TA 2OPSA 3CERA 2NRHA 3M8SA 5DK5A 4AHCA 1ZBLA 4QS9A 3E9OA 4GKKK 4FM2A 1NLVA 4ZHRA 1XWLA 2O4IA 5LJWA 1I39A 4M45A 4GY2B 4CGGA 1Q7YO 4X65K 4PUOA 4BRFA 5AQTA 3ZSXA 4H5RA 4XH4A 3BF3A 3D2EA 3OW2M 3MEDA 5D3GA 3A8YA 5J2MA 4DF4A 4DR3K 1IKVA 2JWKA 1YUWA 3GG4A 3WXJA 4CZKA 3ZSZA 1KCFA 4B9UA 4B9MA 1U47A 4RW8A 1RCHA 1BI4B 2GWJA 1K9MO 3RWUA 3QICA 3TAQA 3JXUA 3U9ZA 3TTFA 3VF6A 4YOUA 4IFVA 4IO8A 3VQBA 4BRIA 1EWRA 5KPTA 4MLEA 4CHZA 1KRPA 1L3VA 1QTMA 2PYJA 3ITHA 4JKEA 4WF9L 3MECA 1XHXA 4M3ZA 2HHQA 1RBTA 1Q86O 3U6FA 1VRUA 4DB3A 1K8KB 1NJWA 4WFBL 4CERA 2V52B 3Q7CA 4KKOA 4B1WB 4CJ7A 3LDSA 3PV8A 5I3UA 2P9SB 4M42A 1WAJA 3NF7A 1FJGK 4OPAA 2HBLA 4FLVA 4J2DA 3OS2A 3NGYA 3TAGA 5GINA 3U3YA 3SBTA 2VYPA 1H1VA 4WQ5C 4JI8K 2F7TA 2UXCK 3C6HA 2NLXA 1A5WA 3VQAA 3M8PA 4CE9A 1QVFM 1NK9A 4CGIA 3K5MA 1XMOK 4ILGB 4YDUA 4YOYA 1SZ2A 2FLOA 1N36K 3QB0A 1HQUA 2O8BB 4IJNA 1ZYQA 1KSPA 4FK4A 1WUAA 4WQ5A 3DOKA 3BF1A 3WEEA 2ETJA 3EYZA 4W5QA 4NLCA 4BC4A 5HBMA 4OLAA 1BG3A 1S9GA 3CFOA 1KLMA 1S22A 3DI6A 1OVYA 4L8RB 3DRSA 3WXIA 4IG0A 3AVFA 4ISEA 4LF7K 3JAMO 1K8KA 1LAVA 3TR8A 3CCMN 4DU1A 1KVBA 1SS6A 3O5BA 3AGKA 4A2AA 1U6ZA 2OPPA 4B9LA 1DT9A 2P9SA 4Z4FA 1S9EA 5HRRA 2QKKA 1WSIA 1QQNA 3RSEB 1BCMA 1VSKA 2J4RA 3HPOA 3IS9A 3U4LA 4BGAA 1P90A 1C0UA 4FZYA 4KREA 4BG9A 1HNZK 1GLAG 2NZTA 4NYFA 5E84A 4DTNA 4L3QA 1Z26A 1NGJA 1YI2N 3LAMA 5JS1A 2BUPA 2O8BA 4DFPA 4B8CA 3EY1A 2CGJA 4C23A 3THVA 4KRFA 5M1QA 1WLJA 4CZMA 2P51A 2ITMA 1D8YA 4FJJA 3OHRA 4JAXA 4BR9A 4H0XB 2BTFA 4GV6A 2QK9A 1CZ9A 4B1VA 1KTQA 3VEWA 2RHKA 4ILHA 5H1SQ 3U9DA 4WFNL 5M1FA 5M1PA 3A5OC 1HNVA 4JI0K 1RTHA 3QLHA 1BU6O 3K57A 2F9WA 4JRPA 3THYA 2HF3A 4WYBA 3ZT4A 4CJWA 5JICA 1VSLA 3RSEA 1SL1A 5EY4A 3LP1A 3HSTB 5AQKA 4C8MA 5BRFA 4I2QA 1JLBA 4E3SA 1HYVA 3LALA 4KTQA 4DV3K 1DLOA 4BY9C 3ZX0A 3UE5A 2WC9A 3HI0A 2O8CA 4IOAL 2A1SA 5DMRA 2HMIA 4QAGA 2ZE2A 3KD5E 3ZT0A 1CXUA 4CF0A 3NBPA 3CPWM 2KFNA 3LP2A 3FZLA 2Z1HA 3ZSVA 4OPHA 4PL8A 2BE2A 5ADXA 4FWRA 3PSIA 2CH6A 1T6CA 3F9KA 3T19A 4KTZA 3K5OA 3K2PA 4H4MA 2QWNA 3FZKA 2E6LA 1Q82O 1CXQA 3DJCA 4IOCL 3DXKA 1QQCA 1TGOA 1WSEA 1WN7A 1WBBA 2IGIA 5KGWA 2CH5A 3V81A 2WBNA 2PAVA 3UIQA 2GUIA 3HBTA 4FJ9A 3O9TA 3KJVA 4B1ZA 1BHLA 2E8AA 2HHXA 4DLGA 2I5JA 4RWTA 3MDQA 4FLZA 4M3WA 3AO1A 5SWMA 5C2FA 4AHVA 5GIPA 3H46O 4FLXA 4M3UA 2E4LA 1XUPO 3F9MA 1HKGA 3R1XA 2ZF5O 2VQFK 3V1RA 3O8MA 3VOVA 3HRGA 2HNZA 1RT2A 4X66K 2IOCA 4CD3A 4B3RK 1V4SA 1GLFO 2HNDA 3GL1A 4WE1A 2GEMA 4N41A 3DLRA 5C2DA 1X9WA 2ZJPL 1JXBA 1RDAA 5KRTA 5AFUA 1YVUA 2VG6A 5KQ8A 2Q3SA 3TTDA 4CVNE 4GMJB 5BREA 2A40A 3QO9A 4FWKA 4YORA 4E7HA 1NGFA 4C1NK 4DV4K 1LWEA 3ZCMA 3QMLA 2Q1NA 4CIGA 3AAPA 3HOTA 4DTJA 1S1XA 3V1OA 5C24A 1EETA 4LFAK 3H3NO 2GUPA 3ZSRA 1WSFA 3IDHA 5C0YA 3IFRA 4JHDA 1NK8A 3OYIA 3SI6A 4LFBK 2GELA 5KPRA 1N8RO 1XC9A 1JL2A 2DTUA 4CK1A 1VQ5N 2HHVA 4DR1K 3M8RA 1WAFA 3MN9A 3LANA 5HROA 1IBLK 3LAKA 3G25A 3SUOA 2EWSA 2P9LA 4X62K 3Q7BA 5AJ3K 3GBTA 2YNGA 1C1CA 4CEAA 4CGHA 4OJRA 2RF2A 5JMVA 2Y1JA 1DGKN 1RTJA 3KVGA 2V7YA 2JLEA 3AVKA 1HR0K 3O9UA 4FJ8A 4G9ZA 2BH1A 3UB5A 1RT1A 5AFUH 4N47A 4DSLA 4BACA 3UKUB 3HZ6A 3L3VA 2OANA 4O5FA 1VQ6N 3SCXA 3LDPA 4H0VB 4DFKA 1Z05A 4Z4HA 4DG1A 4IO9L 4BR5A 4DR7K 1CZAN 4YOXA 4HCBA 2YJFA 1KAYA 1RDCA 3RRHA 2KZMA 4H5VA 3ZEUB 2P9KB 1SKSA 2E2OA 1BCOA 2Q97A 3CM5A 3DRPA 3T7ZA 1DTTA 3LDLA 1KQSM 1NMNA 1NGDA 1KD1O 3DLKA 5AQMA 1DTQA 2FSKA 2F96A 4A62A 1MA9B 1RGIA 3S9HA 1Q9XA 1WNSA 2OYQA 3VF4A 1YIJN 5GAGP 3LL3A 3P31A 4XH5A 1RBRA 4XEIA 2IDOA 3R3LA 3SJHA 1SUQA 4DTRA 2HOEA 4C1NI 4RW7A 3A0IX 5CHIA 4OPJA 3NDKA 4CZGA 4GV9A 3ZSWA 3TANA 2O8DB 3MN7A 4GV3A 1JXEA 2P9IA 3DWLA 1EQYA 4B3SK 3U8XA 4KI4A 5C15A 4KV8A 2V51B 4CEQA 3OY9A 3KK3A 4KHSA 1ATNA 3TI0A 1XQSC 1QZ5A 3SAGA 4XIUA 3V9SA 1IG9A 3EN9A 3ID6A 2DFHA 2X6NA 2YHWA 3ZEUA 2P9KA 2NRZA 3OYDA 4JI7K 1JCGA 1QQMA 1BA1A 3SV4A 4RW9A 3D7EO 2HHSA 4DSEA 3QNNA 3TAEA 5AQGA 1TK5A 1J5OA 5SZTA 1KVCA 3DLBA 1NG9A 1GLDG 4DKWA 1JJ2M 3P4IA 4ISFA 1HYSA 3MN5A 4OPKA 3MWPA 2KW4A 1YJNN 4CHQA 4OGCA 1TKDA 1SQKA 3ZT3A 5FLXO 1VSHA 3VQEA 3NGZA 2A3ZA 2EHGA 4DFMA 1L3UA 1NGGA 1QQOA 3V9WA 4PQUA 2X78A 2QM1A 2UYTA 3SMSA 4CJQA 5I42A 2O8DA 1TV6A 3QNOA 4F3OA 2HHTA 2VG5A 2FF6A 2HHUA 4H0YB 3VESA 1KFDA 1U2VB 1YVNA 4HVJA 4FWPA 2F9TA 2P1JA 4BGBA 1Q8IA 3MAQA 5AQSA 3O80A 1YJ9N 3DLEA 4AF1A 1XNQK 3PY8A 2G8IA 1FKOA 3CIPA 3IMXA 3HOSA 3D2EB 3ULEA 3SBGA 4BR2A 1RDDA 2IVPA 3H1VX 4HUGA 5JLHA 1HMVA 2KTQA 4TSXA 3LP3A 3VGLA 1VK0A 1T7PA 1OKJA 3ATVA 4Y1DA 2H3GX 3AVAA 4PHTX 2KFZA 1UA1A 3H45C 1TL3A 2AA4A 3N4PA 4RCHA 5TKYA 4QOZB 1N33K 3CJ1A 3TAFA 4KH5A 1YXQA 2ZJQL 3TWHA 5BN8A 3QEPA 4AHTA 2HBKA 4R5PA 1TAQA 1ZBFA 5LL6Z 1HUXA 1U2VA 2ASOA 1LWFA 3PX6A 3RMAA 3THXA 1T3VA 3VGKA 2QI2A 3VEZA 5GIOA 4KAZA 5FPEA 1C1AA 3B6PA 5M1NA 2QWRA 4JN4A 3WXMB 5CYQA 4CJ3A 2OZSA 3WXKA 5AQUA 4MDAA 2YCHA 2B6AA 4BVPA 1EXQA 3NH2A 3AVBA 2OZMA 4CJEA 5FRNA 5C10A 4CF9A 4DSFA 4EFHA 3AVLA 3ZX2A 1QSYA 3AAQA 4Z4CA 4CZFA 4WFAL 3IUCA 4KB1A 3KZBA 4JI3K 3QEIA 2QWLA 3OS1A 3KD1E 5IT9O 1K6YA 4BDZA 5KTQA 3LWMA 2VGMA 4K25A 4F2SA 4BVOA 2KZZA 1VQPN 3W0LA 2P9UA 4FVMA 2VWJA 4WCEL 5HP1A 3AY9A 1XMQK 3VQ4A 4A57A 4KHWA 5BR8K 2QXLA 4CEBA 4LSLA 3THWB 1QE1A 4CI6A 2W41A 3PX4A 3WEEB 2PYLA 5EU7A 3JS6A 1VSMA 3HP6A 4BE1A 3B8AX 1VHXA 2ZM6K 2FSNA 4DS5A 3KLIA 1ZC6A 3TSUA 1NK4A 3J81O 3E1YA 3NF6A 3AA3A 3CJBA 3EE8A 2UUBK 4B1YB 4F8RA 2E1YA 3QERA 3J80O 4DUYK 3ZX3A 2G8WA 3TABA 1ILYA 3MK6A 3NH1A 4M3YA 1TAUA 4JKGB 5E41A 1RFQA 1X3MA 3DYAA 5CE3A 3QEXA 5BN9A 1UWBA 3TSQA 4MFBA 1SAZA 1OH8A 1NWKA 4E7LA 1QS4A 4CJ4A 4DV1K 3L2RA 3B6OA 1B9DA 2Z1GA 3PIPL 4KPYA 3GDQA 4C8NA 5M1OA 3LM2A 1L3SA 1EO1A 5EOYA 1UA0A 2XY8A 3NE6A 3THWA 4DSKA 4ZTJA 3R8EA 2V7ZA 3WNFA 4CEOA 2DFFA 3RMDA 1R0AA 4B3OA 1IJJA 3MXJA 4K41A 3J8AA 2Q0UA 4RW4A 4LF8K 1J54A 1T8EA 3L3UA 3AO5A 1HPMA 4LF9K 4FM0A 2QXFA 1U48A 5C12A 4H5TA 1W2BM 2YJEA 3ZSYA 4GVEA 5KPZA 5ELZA 3KLHA 4JKGA 3THYB 2YX6A 1RBUA 3A5LC 3O1BA 1G15A 3O3HA 2Q0RA 3PUFA 4QS8A 4ELTA 2Q2RA 4JKCA 2O8CB 3LPTA 2NRRA 4CZJA 3CQYA 3MCPA 4A61A 4FVUA 3AVNA 3QIOA 1NJIO 3LP0A 1ZBIA 5EXWA 3JSMA 4F2RA 1YAGA 2RN2A 3ZSQA 4DTMA 5M1KA 5J1EA 4B08A 4DV0K 2E1ZA 3V9ZA 1J53A 3D6RA 2D0AA 4GNIA 2ZQBA 2VCPA 1LWCA 3DLGA 1BA0A 4CHPA 2Q31A 4FJHA 4JKHA 3HM8A 1HX1A 2ZGZA 3CYMA 3TTCA 2QWOA 4CIEA 3DXKB 2G8KA 4BR4A 2P5OA 1RDBA 3VQQA 3K59A 4KI6A 2EX3A 3T3FA 1XHZA 4CIFA 4V19S 4CJ5A 1N32K 1HJOA 2HB5A 3I33A 4DCHA 3AVIA 4JI4K 1YT3A 1I94K 2OPQA 1QZ6A 3M3ZA 2ASMA 4B9SA 3ULDA 3VQ6A 1M1KO 2YHBA 4WQ4C 2QWMA 5C42A 3KKSA 5EX5A 4Y1CA 3IRXA 2W40A 2P5GA 2VWKA 3HK2A 5AQHA 2W6KA 1IV0A 2O4GA 4FWMA 3VA3A 4BWMA 3AVCA 4KFBA 2D5RA 1MDUB 4FJIA 5EVZA 1TL1A 4C8OA 1HJRA 4WQ4A 4LC9B 3K0SA 3LZIA 2UUCK 4PKGA 3EZ5A 4MO4A 4ID1A 3RMBA 3L4QA 1LCUA 4CBWA 4E7KA 4NXNK 3LDNA 4BE0A 5JS2A 3VQ5A 3QDKA 3D0PA 3OTOK 3OYFA 5DM7L 4CBUA 1X1PA 2GTDA 2PY5A 3QINA 4FWQA 3G0ZA 4R79A 5F0XA 2G8VA 4CJKA 4IJAA 4KHYA 4F9OA 3HYFA 5DM6L 4JHDB 3TARA 4DQIA 1TKZA 3O9QA 1Q81O 1ZBUA 3DAWA 4JEPA 4JRQA 4BWJA 2I7NA 4K43A 3K9JA 2YNHA 1WSHA 3SPZA 1UAXA 3P38A 1RDUA 1GOCA 4C8KA 4DU3A 2W42A 2P9LB 3BEXA 4CF1A 4OVLA 3OYEA 1OH6A 2A42A 3SQ1A 3OBYA 2LSNA 2Q36A 4HWIA 4E1NA 2UXDK 5ADXH 4B9NA 2WUSA 3FR0A 4CFDA 1NK7A 1Z25A 4H0PA 1O1WA 3OJSA 4IKFA 1ZXOA 1VQNN 2YNFA 3QBWA 4CEEA 4KHQA 1XC3A 1MU2A 4CGFA 4NCGA 4N76A 3HPHA 1RT6A 3G71N 3KLGA 2G8HA 4CJPA 5LMNK 3CC7N 4FPBA 1TUYA 1CZBA 1NNEA 4CCHA 3OBWA 1JL1A 3QESA 5KGXA 3ALYA 1WOQA 3CCRN 5T7BA 3SNNA 4ICLA 2BANA 3TPQA 1BIZA 1S6QA 1HPZA 4MO5A 4FL9A 3V9XA 4AQYK 2CGKA 3SUNA 2F8TA 4GW6A 5KI6A 3ISNC 4LF6K 1JCFA 2DPNA 3AA4A 3V9UA 3AA2A 2FBVA 3DLLL 1NJZA 4FJLA 1QVGM 3CI5A 5AQLA 5HOOA 3TU5A 4K8ZA 5FPMA 3NH0A 1BDGA 4EAHD 2IVNA 1BOTO 1TKTA 5GAHP 3LDQA 4DV5K 2PBDA 4Z4EA 3KWGA 3W3DA 3NCIA 4BR0A 2YNIA 1VSJA 4IXCA 3VQ9A 4CZLA 2IIRA 3P39A 3KIOA 3KKRA 2E6MA 4BRHA 1SV5A 5AQRA 4M63C 1S72N 5KQDA 1BQNA 3T1AA 2D0BA 4O5BA 3M6GA 4DTPA 2W6LA 2YKNA 4O8KA 4H5WA 3WNHA 3K5LA 3ZSOA 2P9IB 3S41A 2OCEA 1HNIA 3VETA 1NK0A 4PY5A 2ATQA 2VWBA 5KRSA 1U49A 3WT0A 1IKWA 2NUBA 3EE9A 2WONA 1NU0A 1KAXA 3I8DA 2FXUA 3NF8A 4BRAA 4G1QA 1DEJA 4BRKA 3C95A 1KFSA 3D45A 2WTUA 4FWOA 2OTLN 2E88A 1I3AA 1NOYA 1F21A 2RPIA 1RTDA 1VSFA 4IBNA 1LAWA 3ATUA 4AHSA 3CMAN 3F5TA 4DR4K 1NGAA 3C7NA 3SLCA 3L8BA 4J2BA 1ASVA 2QKBA 1KXPA 4DHYA 1N6QA 3VGMA 4FSVA 3ZT2A 3PO4A 1JLFA 3OS0A 1S1TA 4K8XA 1S5JA 4LFCK 4FJ7A 1YTUA 2D0OA 5CZ1A 1ZBHA 1QSSA 4FJ5A 3SJJA 4CJRA 3AGRA 2HBMA 5FPNA 2HMPA 4F3TA 3S3MA 1MWKA 1A5VA 1QSLA 4CBXA 4PWDA 4DV6K 3KLEA 4E1JA 4NLBA 3IKMA 4FO0A 5JVHL 4YNQA 1HKCA 5CYMA 1V4TA 3ULEB 1KVAA 3DXMA 3KWIA 4EHUA 3CJAA 3LWLA 1EKEA 2ASPA 3L4IA 3BY5A 3SPYA 4BC3A 1C1BA 4FOEA 4ILJA 5FDLA 1C0TA 1OVQA 3OYGA 3NFAA 4BC5A 4DV2K 4DQ8A 4YFUA 4J8FA 3VEVA 3HVTA 5AZJB 3J7AP 3RR8A 5K14A 2QEXN 4M3TA 3U3GA 3L2QA 4DQQA 3ASMA 4FLYA 4FLUA 3FFIA 3C94A 5HRNA 3K5NA 1NJYA 1VQ4N 2D4WA 3PX0A 4M41A 1VSIA 3RR7A 4IWVA 4ELUA 4GKJK 3THXB 2XHBA 4DSJA 4H0TB 4ID5A 4DLEA 2YHAA 3QFUA 3RRGA 3VMFB 3T1YK 3HO1A 2A41A 3FZHA 1RDWX 1TK0A 4IEIA 2JWLA 1NGIA 4KH6A 2YV0X 1A5XA 1D9FA 1SL2A 3OYBA 1TYQB 4O55A 2P9PA 4LY7A 1S1UA 2NRWA 4E7JA 3H1QA 4DMNA 4JS4A 1JLQA 5AQZA 5AQOA 3VTHA 4E19A 4BC2A 3WUHA 1Q9YA 1RILA 1NKCA 1TKXA 1L5UA 5AZJA 4DTUA 3AVMA 4A2BA 3DRRA 4CJUA 2E2NA 4HUEA 1JLGA 2ZJRL 2HVIA 4JKBA 3VQ7A 1S1VA 1KAZA 3VQDA 3DOLA 4NB4A 4U67L 2P9UB 2E5LK 4JV5K 3VTIA 1HNXK 3M1FA 5CZ2A 3SQ2A 1RT5A 1N5YA 2NRTA 5GAEP 4B9VA 3BUZB 4BROA 5LMUK 1EX4A 4FM1A 3MXIA 4B8AB 2AJQA 3TSPA 4LD0A 1VQ9N 2KQ2A 4CHNA 1NM1A 3PSFA 4CK2A 1NGBA 3WQTA 3VEOA 3VN5A 1NGCA 3WQUA 3CG7A 4DQPA 2O8FB 3I0RA 1TYQA 3PIOL 4FZZA 4FLTA 4BRNA 1Q18A 3OYMA 3JYTA 4Z0UA 2WOMA 4UQGA 2P9NA 3J7YP 4FK2A 3QBXA 3NF9A 1REVA 4JKDA 3SMPA 3MXMA 4NO7A 1YHQN 2R7YA 3EL2A 3RVCA 3ID8A 4XH1A 5BR9A 4FZXC 3HXMA 2FBXA 2KLAA 4BRCA 3H6EA 4LH5A 1NK6A 4OX9K 2B4JA 3CCUN 5JLFA 3M5RA 4JK9A 5AQFA 3VEXA 1M90O 1Y64A 3SV3A 4E7IA 2FBTA 3TAMA 3CCSN 3MEEA 2CGLA 5I9EB 1YITN 3T1HK 4JK7A 3CMEN 3L2UA 3I0SA 3VERA 3F73A 4FJKA 3DMJA 4YOTA 3CM6A 3CXCM 2I7PA 3P1GA 1VQON 1FXXA 1C0MA 1GLEG 4FW1A 3D2FB 2IS3A 4Z94A 4W5TA 3AA5X 3KLFA 2O8FA 5B8HA 4AHUA 3CJ7A 4JS5A 4NCAA 4CGDA 2FC0A 1GOBA 2E2PA 3SQ4A 3O08A 1WBDA 4BREA 1XNRK 1IKYA 2QTDA 4E89A 4IFEA 4CJTA 3SAHA 1NKEA 4DTOA 1FKPA 3I55N 3CFRA 4OKKA 1UOCA 1OH5A 1VQMN 4AHRA 3SUQA 3SUPA 4IDHA 1O13A 4LH4A 2OPRA 4LSNA 4YDUC 4AM6A 3AV9A 1IBMK 3C6AA 2IC3A 5AQQA 4M3RA 1HRHA 2FSJA 1T44A 1BUPA 4W5NA 5E26A 3BGRA 4MLHA 3ENHA 5AZIB 3FGUA 1BI4A 3CJ9A 1BQMA 1FW6A 5TKWA 4Q5VA 4EZ6A 4KB0A 4OGEA 3F2KA 3V4IA 4F4KA 3BZCA 3V1QA 4CHYA 1S3XA 3D2FA 4JI2K 4CESA 3CQ8A 3S3NA 3C6UA 3T69A 5BPNA 4CW7B 1Z6RA 2BGGA 4UY8O 3EZWA 1VSEA 2GV9A 2X74A 5FRMA 4IDKA 3HL8A 4N5SA 2OA8A 3ZETB 4DS4A 2VQEK 5A2QO 1IH7A 3GE1A 5AR0A 3CCVN 3VQPA 4CHOA 3IAYA 1ATSA 3V6DA 1WSJA 4H0OA 4EP4A 4DQSA 4QS7A 1GOAA 4H8KA 1X3NA 4CFCA 3CPEA 3SZ2A 3RMCA 1HNWK 5AZIA 3O4WA 3UKRB 3IG1A 4AILC 1T6DA 2KHOA 1VQ7N 3O4QA 2HBJA 1NBWA 2GWKA 4KTWA 1FK9A 4A59A 3ENBA 4EZ9A 5AQXA 3HT3A 3AARA 4M7XA 4H5NA 3QIPA 5F2RA 4HCCA 4FW2A 2Y1IA 5AQJA 3VQCA 3MCAB 1BL3A 4FWNA 4FXDA 4J2EA 1W9HA 3P5JA 4FWLA 3CCQN 3OJUA 4B3TK 4BE2A 5HL7L 1SKWA 1NKBA 2FF3B 4YOVA 1G99A 3A5NC 4DWIA 3ZETA 4EHTA 1IBKK 5C25A 1ITGA 4RW6A 4DSIA 4CJVA 4IG3A 3AO4A 2HW3A 3KHYA 3LM9A 4NYNA 1X9JA 3HTVA 2GX9A 4ISGA 1VQLN 2A6AA 4OO1J 3SAFA 4QCLA 4FWSA 4BQZA 2X6SA 5BRDA 4DQRA 4FJXA 2XRIA 1CLQA 1DKGD 2O8EB 3ZLJA 2ZGYA 3UKRA 1X9SA 2XY7A 2A1RA 4B9QA 1VQ8N 5J2QA 1C0GA 3A5MC 3KTQA 4I7FA 3S3OA 1LW0A 2XY6A 3FE1A 2F4VK 2F8SA 4ELVA 1VRTA 3HP9A 4BRQA 2HVHA 4I2PA 3EKSA
chains in the Genus database with same CATH topology
1JKHA 1HMVA 2KTQA 4TSXA 3I8DA 3LP3A 4CGIA 3K5MA 1NK9A 1VK0A 3NF8A 1T7PA 4Y1DA 4G1QA 1B92A 1WSGA 3TAPA 3AVAA 1HQUA 4DTXA 2KFZA 1UA1A 3C95A 5J2NA 1KFSA 1ZYQA 1TL3A 1KSPA 3D45A 3OYAA 4FK4A 4QOZB 1I3AA 2DY4A 3DOKA 1NOYA 1F21A 3TAFA 2RPIA 1RTDA 4I9LA 3NHGA 1VSFA 2ETJA 3EYZA 4W5QA 4IBNA 3HM9A 1LAWA 5HBMA 4OLAA 3TWHA 4AHSA 1S9GA 3CFOA 1KLMA 3DI6A 4CGJA 3QEPA 4L8RB 2IAJA 4AHTA 3DRSA 3L8BA 4J2BA 4IG0A 1ASVA 3AVFA 3OVNA 4CF8A 4R5PA 1TAQA 1LAVA 1ZBFA 2RKIA 4W5RA 3TR8A 5HLFA 1N6QA 2QKBA 4DU1A 1LWFA 3PX6A 3RMAA 3ZT2A 2ZD1A 1KVBA 3PO4A 1JLFA 3OS0A 2OPPA 4B9LA 1S1TA 1U04A 4DFJA 4K8XA 1S5JA 4FJ7A 4Z4FA 4CFAA 1ASWA 1S9EA 1JLCA 4KAZA 5HRRA 2QKKA 3B6PA 1C1AA 1WSIA 1YTAA 4C8LA 1YTUA 4CJFA 1BCMA 1NJXA 5CYQA 1VSKA 5CZ1A 3HPOA 1ZBHA 3IS9A 1Y97A 1QSSA 4CJ3A 4FJ5A 3SJJA 4CJRA 2OZSA 1C0UA 4FK0A 2B6AA 4FZYA 4F3TA 3S3MA 4KREA 1A5VA 1QSLA 1ASUA 3AVJA 4NYFA 4PWDA 4DTNA 1EXQA 3KLEA 3NH2A 2HHWA 3AVBA 2OZMA 3OYCA 4CJEA 5FRNA 1Z26A 4CF9A 4DSFA 3AVLA 1U4BA 3LAMA 4DU4A 4YNQA 5JS1A 3QEWA 4DFPA 4B8CA 1QSYA 5CYMA 4O44A 1KVAA 4Z4CA 4KB1A 3EY1A 3THVA 4KRFA 3QEIA 3LWLA 2YKMA 3OS1A 1WLJA 3KD1E 1EKEA 1K6YA 2P51A 5CY4A 5HRSA 4BDZA 3SPYA 1D8YA 5KTQA 2HNYA 4MQ3A 1C1BA 3LWMA 4FJJA 3OYNA 4F2SA 3AVGA 4CF2A 1EP4A 3L2VA 5FDLA 2QK9A 1CZ9A 4FVMA 1C0TA 2KZZA 3OYGA 1KTQA 4Q0BA 3NFAA 2VWJA 4YFUA 1VSDA 4W5OA 5HP1A 3VQ4A 4KHWA 3HVTA 4CEBA 4LSLA 3RR8A 1QE1A 5K14A 3KK2A 4M3TA 3PX4A 1HNVA 1L3TA 2PYLA 3U3GA 3L2QA 5EU7A 5HRPA 1RTHA 3KK1A 1VSMA 4DQQA 3ASMA 3QLHA 3HP6A 3K57A 4BE1A 4BDPA 3OYHA 4JRPA 4FLYA 4FLUA 4DS5A 3FFIA 3ZT4A 4CJWA 3C94A 3KLIA 1VSLA 5HRNA 3K5NA 1NJYA 1T03A 1SL1A 1NK4A 3LP1A 3HSTB 4C8MA 4FJGA 1RBVA 1RT4A 3AA3A 3NF6A 1JLBA 4I2QA 1VSIA 4M41A 4AH9A 3PX0A 4E3SA 3RR7A 3QERA 4F8RA 4ELUA 1HYVA 3LALA 4KTQA 1DLOA 2G8WA 3TABA 2XHBA 4DSJA 4B9TA 2VG7A 4ID5A 4DLEA 2YHAA 4EP5A 4M3XA 2B5JA 3RRGA 4CEDA 3HO1A 3NH1A 4M3YA 1TAUA 2A1SA 5DMRA 1TK0A 1W0HA 5E41A 2HMIA 4QAGA 3DYAA 2ZE2A 3KD5E 3ZT0A 3QEXA 1UWBA 2YV0X 4MFBA 1CXUA 3O4NA 4CF0A 3NBPA 2KFNA 1IO2A 3LP2A 2Z1HA 1A5XA 3ZSVA 1D9FA 1SL2A 1RTIA 4E7LA 3OYBA 2BE2A 1QS4A 4O55A 4CJ4A 4LY7A 1S1UA 3OYKA 3DLHA 3L2RA 3B6OA 1B9DA 1TVRA 4E7JA 1QHTA 2Z1GA 4DF8A 4KPYA 3F9KA 4CEFA 4DMNA 2DFEA 3T19A 4JS4A 1JLQA 4J2AA 4KTZA 3K5OA 3K2PA 4H4MA 1D9DA 4C8NA 2E6LA 1BISA 4E19A 1NOZA 4CFBA 1SL0A 1CXQA 1L3SA 1Q9YA 1RILA 4FYDA 4PA1A 4FCYA 1NKCA 1TKXA 1S6PA 1L5UA 1UA0A 4DTUA 3AVMA 1QQCA 1TGOA 2XY8A 3DRRA 3NE6A 1HYZA 1S1WA 4CJUA 4ZTJA 1WSEA 4DSKA 4HUEA 1JLGA 3WNFA 4CEOA 2HVIA 1WN7A 2DFFA 3RMDA 1R0AA 4B3OA 4OKJA 2IGIA 3MXJA 5KGWA 1S1VA 3VQ7A 3RTVA 3O3GA 3V81A 1TK8A 3UIQA 3VQDA 3DOLA 4RW4A 3HVRA 1J54A 2GUIA 3L3UA 3M8QA 3LZJA 1JLAA 1T8EA 3AO5A 4FJ9A 3KJVA 5CZ2A 2Z1JA 1BHLA 3SQ2A 4FM0A 1RT5A 1NK5A 1N5YA 2G8UA 2HHXA 4B9VA 2QXFA 1U48A 4OKEA 4DLGA 1EX4A 2I5JA 4FM1A 4B8AB 3MXIA 2GBZA 2AJQA 4FLZA 3ZSYA 4M3WA 3AO1A 5SWMA 4AHVA 4FLWA 2XY5A 4JLHA 4LD0A 3ZT1A 4FLXA 3KLHA 2E4LA 4M3UA 2KQ2A 4CHNA 1U45A 4CK2A 1XI1A 4RG8A 4FJNA 3V1RA 1IKXA 1RBUA 4GVMA 1BIUA 2HNZA 3VQ8A 1RT2A 3VN5A 3BDPA 2IOCA 4HHTA 3CG7A 1G15A 4DQPA 3I0RA 3PUFA 3O3HA 4FZZA 4FLTA 1RNHA 4ELTA 3OYMA 1X9MA 2HNDA 4WE1A 2WOMA 4Z0UA 3JYTA 4UQGA 4N41A 3DLRA 1X9WA 4FK2A 3NF9A 3LPTA 1REVA 4KO0A 4CECA 1JXBA 1RDAA 5KRTA 1YVUA 2VG6A 3AVNA 3QIOA 3LP0A 4H4OA 3DM2A 3MXMA 1ZBIA 2R7YA 4N56A 4KHNA 2Q3SA 3JSMA 3NAEA 4GMJB 4F2RA 3HJFA 3O3FA 3ZSQA 2RN2A 4DTMA 4FZXC 3QO9A 2G8FA 3HXMA 5J1EA 3OYLA 3H08A 4B08A 2FBXA 4LH5A 1NK6A 4E7HA 3WNEA 2B4JA 3V9ZA 4CJSA 1J53A 2D0AA 3AO2A 1LWEA 5FROA 2ZQBA 3PO5A 3ZCMA 1LWCA 3SV3A 3DLGA 4CIGA 4E7IA 2FBTA 3TAMA 2JGUA 4CHPA 4FJHA 3MEEA 1D5AA 4DTJA 1S1XA 3V1OA 2FBYA 1EETA 3CYMA 5C24A 4CIEA 2G8KA 3WNGA 4CJLA 2ITGA 2P5OA 3ZSRA 1RDBA 1WSFA 3VQQA 3K59A 3L2UA 4KI6A 3I0SA 3OYIA 1B9FA 3SI6A 1NK8A 2EX3A 3F73A 4NCBA 4FJKA 4Z4GA 3DMJA 3T3FA 1XHZA 3CM6A 3P1GA 1XC9A 4CIFA 1JL2A 3AO3A 4CJ5A 4CK1A 1FXXA 2DTUA 3QETA 2HHVA 1C0MA 4FW1A 4HUFA 3M8RA 2HB5A 1WAFA 2IS3A 3LANA 3AVIA 3AA5X 4W5TA 5HROA 4O0JA 1BGXT 3KLFA 3VA0A 3LAKA 4AHUA 4JS5A 1YT3A 4NCAA 4CGDA 2OPQA 3SUOA 2FC0A 1GOBA 2BDPA 3SQ4A 2YNGA 1C1CA 4CEAA 2D0CA 3NGIA 3ULDA 3QEVA 1RT7A 1IKYA 4CGHA 4OJRA 3VQ6A 4E89A 2RF2A 3SYZA 4CJTA 2YHBA 2Y1JA 1NKEA 4FJMA 4DTOA 1FKPA 4E1MA 1RTJA 3CFRA 5C42A 4OKKA 1UOCA 2JLEA 3AVKA 3KKSA 4BDYA 4Y1CA 4E0DA 4FJ8A 3IRXA 2P5GA 4AHRA 2VWKA 3MEGA 3HK2A 3SUQA 3SUPA 1RT1A 2O4GA 4N47A 4DSLA 4LH4A 4BACA 2OPRA 3VA3A 4BWMA 3AVCA 4KFBA 4KHUA 4I9QA 2D5RA 1JLEA 4LSNA 4FJIA 3L3VA 1TL1A 4C8OA 3AV9A 3SCXA 1HJRA 2IC3A 3LZIA 3EZ5A 4M3RA 4DFKA 1HRHA 1T05A 4Z4IA 4Z4HA 4ID1A 1J9AA 1RBSA 4DG1A 2PZSA 3RMBA 4OLBA 4W5NA 3P83D 3BGRA 4E7KA 1BI4A 4IFYA 4B9SA 4BE0A 5JS2A 1BQMA 3VQ5A 4HCBA 4Q5VA 4CK3A 3D0PA 3CFPA 3OYFA 4EZ6A 1HQEA 1RDCA 3AVHA 3E01A 3RRHA 1X1PA 3SQ0A 4KB0A 3HPGA 2PY5A 2KZMA 2Z1IA 4OGEA 1BCOA 3QINA 4HTUA 3V4IA 3CM5A 3DRPA 3G10A 1SKSA 3G0ZA 3LPUA 4F4KA 1DTTA 3V1QA 4CHYA 5J2PA 1LV5A 3DLKA 4O0IA 4CESA 1DTQA 1RT3A 2F96A 4CJKA 3CQ8A 2G8VA 3S3NA 4CEZA 3C6UA 2XO7A 1KLNA 4KHYA 1C6VA 3HYFA 3S9HA 1Q9XA 3TARA 4DQIA 1WNSA 2OYQA 2BGGA 1VSEA 2GV9A 2X74A 1TKZA 5FRMA 1RBRA 1ZBUA 2IDOA 4JRQA 4BWJA 1SKRA 4ZTFA 1LW2A 4IDKA 3HL8A 4N5SA 1SUQA 4O4GA 3OYJA 3L2WA 4DTRA 3K58A 2OA8A 4DTSA 4DS4A 2YNHA 2OPSA 3C6TA 4RW7A 4OPJA 1WSHA 3M8SA 1UAXA 5DK5A 4AHCA 3NDKA 3SPZA 1IH7A 1ZBLA 1GOCA 3VQPA 4CHOA 4DU3A 2W42A 4C8KA 3IAYA 3ZSWA 4FM2A 3TANA 3V6DA 1WSJA 4CF1A 1XWLA 4OVLA 4ZHRA 3OYEA 4EP4A 4DQSA 1JXEA 3SQ1A 2O4IA 2LSNA 4E1NA 1GOAA 4B9NA 4H8KA 4CFDA 1I39A 1NK7A 4KI4A 4M45A 1Z25A 4KV8A 4CFCA 1O1WA 4CEQA 4CGGA 3OY9A 3KK3A 3OJSA 4PUOA 4IKFA 3SZ2A 3ZSXA 4KHSA 3RMCA 3TI0A 2YNFA 4CEEA 4KHQA 3MEDA 1MU2A 4CGFA 4NCGA 4N76A 5D3GA 4XIUA 3V9SA 3IG1A 5J2MA 4AILC 1IG9A 4DF4A 3HPHA 1RT6A 3KLGA 2G8HA 4CJPA 1IKVA 2DFHA 2X6NA 1CZBA 3O4QA 3OYDA 4KTWA 4CCHA 1FK9A 1JL1A 3SV4A 3QESA 4RW9A 3ZSZA 1KCFA 5KGXA 4B9UA 4B9MA 4EZ9A 3HT3A 1U47A 2HHSA 3ALYA 4DSEA 3QNNA 5T7BA 4RW8A 1RCHA 4ICLA 3TAEA 3SNNA 1TK5A 5SZTA 1J5OA 1BI4B 1KVCA 3DLBA 2BANA 3RWUA 3QIPA 1BIZA 4HCCA 4FW2A 3TAQA 2Y1IA 1S6QA 3VQCA 1BL3A 4FXDA 1HPZA 1HYSA 4IFVA 3VQBA 4J2EA 1W9HA 3P5JA 4OPKA 3V9XA 2F8TA 3OJUA 2KW4A 3SUNA 4BE2A 4GW6A 5KI6A 3ISNC 4CHQA 4CHZA 4OGCA 1SKWA 1KRPA 1TKDA 1NKBA 3AA4A 3V9UA 3AA2A 3ZT3A 2FBVA 1NJZA 4FJLA 1VSHA 3VQEA 4DWIA 1L3VA 3NGZA 1QTMA 2PYJA 2EHGA 4DFMA 1L3UA 4K8ZA 5C25A 3NH0A 3V9WA 4PQUA 1TKTA 2X78A 3ITHA 4CJQA 5I42A 1ITGA 3MECA 1TV6A 4RW6A 3QNOA 4DSIA 4F3OA 4CJVA 1XHXA 4Z4EA 2HHTA 4IG3A 2VG5A 3AO4A 4M3ZA 2HW3A 2HHQA 1RBTA 3NCIA 2HHUA 2YNIA 1VSJA 4NYNA 3VQ9A 3U6FA 1VRUA 3KIOA 3KKRA 1KFDA 4QCLA 2E6MA 1NJWA 4DQRA 2X6SA 4CERA 1SV5A 4FJXA 2XRIA 1CLQA 1BQNA 3T1AA 2D0BA 4KKOA 4HVJA 4O5BA 3LDSA 4DTPA 1X9SA 2XY7A 2YKNA 2A1RA 3PV8A 5I3UA 3WNHA 2P1JA 5J2QA 3KTQA 4M42A 1WAJA 1Q8IA 4I7FA 3MAQA 3NF7A 3ZSOA 3K5LA 3S3OA 1LW0A 3DLEA 4FLVA 4J2DA 1HNIA 3PY8A 3OS2A 2XY6A 3NGYA 1NK0A 2ATQA 2G8IA 4PY5A 3TAGA 1FKOA 3U3YA 2F8SA 5KRSA 4ELVA 1U49A 1VRTA 1RDDA 1A5WA 1IKWA 3VQAA 3M8PA 3HP9A 2NUBA 2HVHA 2WONA 4HUGA 4I2PA 3A2FA 4CE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKH A;  1HMV A;  2KTQ A;  4TSX A;  3I8D A;  3LP3 A;  4CGI A;  3K5M A;  1NK9 A;  1VK0 A;  3NF8 A;  1T7P A;  4Y1D A;  4G1Q A;  1B92 A;  1WSG A;  3TAP A;  3AVA A;  1HQU A;  4DTX A;  2KFZ A;  1UA1 A;  3C95 A;  5J2N A;  1KFS A;  1ZYQ A;  1TL3 A;  1KSP A;  3D45 A;  3OYA A;  4FK4 A;  4QOZ B;  1I3A A;  2DY4 A;  3DOK A;  1NOY A;  1F21 A;  3TAF A;  2RPI A;  1RTD A;  4I9L A;  3NHG A;  1VSF A;  2ETJ A;  3EYZ A;  4W5Q A;  4IBN A;  3HM9 A;  1LAW A;  5HBM A;  4OLA A;  3TWH A;  4AHS A;  1S9G A;  3CFO A;  1KLM A;  3DI6 A;  4CGJ A;  3QEP A;  4L8R B;  2IAJ A;  4AHT A;  3DRS A;  3L8B A;  4J2B A;  4IG0 A;  1ASV A;  3AVF A;  3OVN A;  4CF8 A;  4R5P A;  1TAQ A;  1LAV A;  1ZBF A;  2RKI A;  4W5R A;  3TR8 A;  5HLF A;  1N6Q A;  2QKB A;  4DU1 A;  1LWF A;  3PX6 A;  3RMA A;  3ZT2 A;  2ZD1 A;  1KVB A;  3PO4 A;  1JLF A;  3OS0 A;  2OPP A;  4B9L A;  1S1T A;  1U04 A;  4DFJ A;  4K8X A;  1S5J A;  4FJ7 A;  4Z4F A;  4CFA A;  1ASW A;  1S9E A;  1JLC A;  4KAZ A;  5HRR A;  2QKK A;  3B6P A;  1C1A A;  1WSI A;  1YTA A;  4C8L A;  1YTU A;  4CJF A;  1BCM A;  1NJX A;  5CYQ A;  1VSK A;  5CZ1 A;  3HPO A;  1ZBH A;  3IS9 A;  1Y97 A;  1QSS A;  4CJ3 A;  4FJ5 A;  3SJJ A;  4CJR A;  2OZS A;  1C0U A;  4FK0 A;  2B6A A;  4FZY A;  4F3T A;  3S3M A;  4KRE A;  1A5V A;  1QSL A;  1ASU A;  3AVJ A;  4NYF A;  4PWD A;  4DTN A;  1EXQ A;  3KLE A;  3NH2 A;  2HHW A;  3AVB A;  2OZM A;  3OYC A;  4CJE A;  5FRN A;  1Z26 A;  4CF9 A;  4DSF A;  3AVL A;  1U4B A;  3LAM A;  4DU4 A;  4YNQ A;  5JS1 A;  3QEW A;  4DFP A;  4B8C A;  1QSY A;  5CYM A;  4O44 A;  1KVA A;  4Z4C A;  4KB1 A;  3EY1 A;  3THV A;  4KRF A;  3QEI A;  3LWL A;  2YKM A;  3OS1 A;  1WLJ A;  3KD1 E;  1EKE A;  1K6Y A;  2P51 A;  5CY4 A;  5HRS A;  4BDZ A;  3SPY A;  1D8Y A;  5KTQ A;  2HNY A;  4MQ3 A;  1C1B A;  3LWM A;  4FJJ A;  3OYN A;  4F2S A;  3AVG A;  4CF2 A;  1EP4 A;  3L2V A;  5FDL A;  2QK9 A;  1CZ9 A;  4FVM A;  1C0T A;  2KZZ A;  3OYG A;  1KTQ A;  4Q0B A;  3NFA A;  2VWJ A;  4YFU A;  1VSD A;  4W5O A;  5HP1 A;  3VQ4 A;  4KHW A;  3HVT A;  4CEB A;  4LSL A;  3RR8 A;  1QE1 A;  5K14 A;  3KK2 A;  4M3T A;  3PX4 A;  1HNV A;  1L3T A;  2PYL A;  3U3G A;  3L2Q A;  5EU7 A;  5HRP A;  1RTH A;  3KK1 A;  1VSM A;  4DQQ A;  3ASM A;  3QLH A;  3HP6 A;  3K57 A;  4BE1 A;  4BDP A;  3OYH A;  4JRP A;  4FLY A;  4FLU A;  4DS5 A;  3FFI A;  3ZT4 A;  4CJW A;  3C94 A;  3KLI A;  1VSL A;  5HRN A;  3K5N A;  1NJY A;  1T03 A;  1SL1 A;  1NK4 A;  3LP1 A;  3HST B;  4C8M A;  4FJG A;  1RBV A;  1RT4 A;  3AA3 A;  3NF6 A;  1JLB A;  4I2Q A;  1VSI A;  4M41 A;  4AH9 A;  3PX0 A;  4E3S A;  3RR7 A;  3QER A;  4F8R A;  4ELU A;  1HYV A;  3LAL A;  4KTQ A;  1DLO A;  2G8W A;  3TAB A;  2XHB A;  4DSJ A;  4B9T A;  2VG7 A;  4ID5 A;  4DLE A;  2YHA A;  4EP5 A;  4M3X A;  2B5J A;  3RRG A;  4CED A;  3HO1 A;  3NH1 A;  4M3Y A;  1TAU A;  2A1S A;  5DMR A;  1TK0 A;  1W0H A;  5E41 A;  2HMI A;  4QAG A;  3DYA A;  2ZE2 A;  3KD5 E;  3ZT0 A;  3QEX A;  1UWB A;  2YV0 X;  4MFB A;  1CXU A;  3O4N A;  4CF0 A;  3NBP A;  2KFN A;  1IO2 A;  3LP2 A;  2Z1H A;  1A5X A;  3ZSV A;  1D9F A;  1SL2 A;  1RTI A;  4E7L A;  3OYB A;  2BE2 A;  1QS4 A;  4O55 A;  4CJ4 A;  4LY7 A;  1S1U A;  3OYK A;  3DLH A;  3L2R A;  3B6O A;  1B9D A;  1TVR A;  4E7J A;  1QHT A;  2Z1G A;  4DF8 A;  4KPY A;  3F9K A;  4CEF A;  4DMN A;  2DFE A;  3T19 A;  4JS4 A;  1JLQ A;  4J2A A;  4KTZ A;  3K5O A;  3K2P A;  4H4M A;  1D9D A;  4C8N A;  2E6L A;  1BIS A;  4E19 A;  1NOZ A;  4CFB A;  1SL0 A;  1CXQ A;  1L3S A;  1Q9Y A;  1RIL A;  4FYD A;  4PA1 A;  4FCY A;  1NKC A;  1TKX A;  1S6P A;  1L5U A;  1UA0 A;  4DTU A;  3AVM A;  1QQC A;  1TGO A;  2XY8 A;  3DRR A;  3NE6 A;  1HYZ A;  1S1W A;  4CJU A;  4ZTJ A;  1WSE A;  4DSK A;  4HUE A;  1JLG A;  3WNF A;  4CEO A;  2HVI A;  1WN7 A;  2DFF A;  3RMD A;  1R0A A;  4B3O A;  4OKJ A;  2IGI A;  3MXJ A;  5KGW A;  1S1V A;  3VQ7 A;  3RTV A;  3O3G A;  3V81 A;  1TK8 A;  3UIQ A;  3VQD A;  3DOL A;  4RW4 A;  3HVR A;  1J54 A;  2GUI A;  3L3U A;  3M8Q A;  3LZJ A;  1JLA A;  1T8E A;  3AO5 A;  4FJ9 A;  3KJV A;  5CZ2 A;  2Z1J A;  1BHL A;  3SQ2 A;  4FM0 A;  1RT5 A;  1NK5 A;  1N5Y A;  2G8U A;  2HHX A;  4B9V A;  2QXF A;  1U48 A;  4OKE A;  4DLG A;  1EX4 A;  2I5J A;  4FM1 A;  4B8A B;  3MXI A;  2GBZ A;  2AJQ A;  4FLZ A;  3ZSY A;  4M3W A;  3AO1 A;  5SWM A;  4AHV A;  4FLW A;  2XY5 A;  4JLH A;  4LD0 A;  3ZT1 A;  4FLX A;  3KLH A;  2E4L A;  4M3U A;  2KQ2 A;  4CHN A;  1U45 A;  4CK2 A;  1XI1 A;  4RG8 A;  4FJN A;  3V1R A;  1IKX A;  1RBU A;  4GVM A;  1BIU A;  2HNZ A;  3VQ8 A;  1RT2 A;  3VN5 A;  3BDP A;  2IOC A;  4HHT A;  3CG7 A;  1G15 A;  4DQP A;  3I0R A;  3PUF A;  3O3H A;  4FZZ A;  4FLT A;  1RNH A;  4ELT A;  3OYM A;  1X9M A;  2HND A;  4WE1 A;  2WOM A;  4Z0U A;  3JYT A;  4UQG A;  4N41 A;  3DLR A;  1X9W A;  4FK2 A;  3NF9 A;  3LPT A;  1REV A;  4KO0 A;  4CEC A;  1JXB A;  1RDA A;  5KRT A;  1YVU A;  2VG6 A;  3AVN A;  3QIO A;  3LP0 A;  4H4O A;  3DM2 A;  3MXM A;  1ZBI A;  2R7Y A;  4N56 A;  4KHN A;  2Q3S A;  3JSM A;  3NAE A;  4GMJ B;  4F2R A;  3HJF A;  3O3F A;  3ZSQ A;  2RN2 A;  4DTM A;  4FZX C;  3QO9 A;  2G8F A;  3HXM A;  5J1E A;  3OYL A;  3H08 A;  4B08 A;  2FBX A;  4LH5 A;  1NK6 A;  4E7H A;  3WNE A;  2B4J A;  3V9Z A;  4CJS A;  1J53 A;  2D0A A;  3AO2 A;  1LWE A;  5FRO A;  2ZQB A;  3PO5 A;  3ZCM A;  1LWC A;  3SV3 A;  3DLG A;  4CIG A;  4E7I A;  2FBT A;  3TAM A;  2JGU A;  4CHP A;  4FJH A;  3MEE A;  1D5A A;  4DTJ A;  1S1X A;  3V1O A;  2FBY A;  1EET A;  3CYM A;  5C24 A;  4CIE A;  2G8K A;  3WNG A;  4CJL A;  2ITG A;  2P5O A;  3ZSR A;  1RDB A;  1WSF A;  3VQQ A;  3K59 A;  3L2U A;  4KI6 A;  3I0S A;  3OYI A;  1B9F A;  3SI6 A;  1NK8 A;  2EX3 A;  3F73 A;  4NCB A;  4FJK A;  4Z4G A;  3DMJ A;  3T3F A;  1XHZ A;  3CM6 A;  3P1G A;  1XC9 A;  4CIF A;  1JL2 A;  3AO3 A;  4CJ5 A;  4CK1 A;  1FXX A;  2DTU A;  3QET A;  2HHV A;  1C0M A;  4FW1 A;  4HUF A;  3M8R A;  2HB5 A;  1WAF A;  2IS3 A;  3LAN A;  3AVI A;  3AA5 X;  4W5T A;  5HRO A;  4O0J A;  1BGX T;  3KLF A;  3VA0 A;  3LAK A;  4AHU A;  4JS5 A;  1YT3 A;  4NCA A;  4CGD A;  2OPQ A;  3SUO A;  2FC0 A;  1GOB A;  2BDP A;  3SQ4 A;  2YNG A;  1C1C A;  4CEA A;  2D0C A;  3NGI A;  3ULD A;  3QEV A;  1RT7 A;  1IKY A;  4CGH A;  4OJR A;  3VQ6 A;  4E89 A;  2RF2 A;  3SYZ A;  4CJT A;  2YHB A;  2Y1J A;  1NKE A;  4FJM A;  4DTO A;  1FKP A;  4E1M A;  1RTJ A;  3CFR A;  5C42 A;  4OKK A;  1UOC A;  2JLE A;  3AVK A;  3KKS A;  4BDY A;  4Y1C A;  4E0D A;  4FJ8 A;  3IRX A;  2P5G A;  4AHR A;  2VWK A;  3MEG A;  3HK2 A;  3SUQ A;  3SUP A;  1RT1 A;  2O4G A;  4N47 A;  4DSL A;  4LH4 A;  4BAC A;  2OPR A;  3VA3 A;  4BWM A;  3AVC A;  4KFB A;  4KHU A;  4I9Q A;  2D5R A;  1JLE A;  4LSN A;  4FJI A;  3L3V A;  1TL1 A;  4C8O A;  3AV9 A;  3SCX A;  1HJR A;  2IC3 A;  3LZI A;  3EZ5 A;  4M3R A;  4DFK A;  1HRH A;  1T05 A;  4Z4I A;  4Z4H A;  4ID1 A;  1J9A A;  1RBS A;  4DG1 A;  2PZS A;  3RMB A;  4OLB A;  4W5N A;  3P83 D;  3BGR A;  4E7K A;  1BI4 A;  4IFY A;  4B9S A;  4BE0 A;  5JS2 A;  1BQM A;  3VQ5 A;  4HCB A;  4Q5V A;  4CK3 A;  3D0P A;  3CFP A;  3OYF A;  4EZ6 A;  1HQE A;  1RDC A;  3AVH A;  3E01 A;  3RRH A;  1X1P A;  3SQ0 A;  4KB0 A;  3HPG A;  2PY5 A;  2KZM A;  2Z1I A;  4OGE A;  1BCO A;  3QIN A;  4HTU A;  3V4I A;  3CM5 A;  3DRP A;  3G10 A;  1SKS A;  3G0Z A;  3LPU A;  4F4K A;  1DTT A;  3V1Q A;  4CHY A;  5J2P A;  1LV5 A;  3DLK A;  4O0I A;  4CES A;  1DTQ A;  1RT3 A;  2F96 A;  4CJK A;  3CQ8 A;  2G8V A;  3S3N A;  4CEZ A;  3C6U A;  2XO7 A;  1KLN A;  4KHY A;  1C6V A;  3HYF A;  3S9H A;  1Q9X A;  3TAR A;  4DQI A;  1WNS A;  2OYQ A;  2BGG A;  1VSE A;  2GV9 A;  2X74 A;  1TKZ A;  5FRM A;  1RBR A;  1ZBU A;  2IDO A;  4JRQ A;  4BWJ A;  1SKR A;  4ZTF A;  1LW2 A;  4IDK A;  3HL8 A;  4N5S A;  1SUQ A;  4O4G A;  3OYJ A;  3L2W A;  4DTR A;  3K58 A;  2OA8 A;  4DTS A;  4DS4 A;  2YNH A;  2OPS A;  3C6T A;  4RW7 A;  4OPJ A;  1WSH A;  3M8S A;  1UAX A;  5DK5 A;  4AHC A;  3NDK A;  3SPZ A;  1IH7 A;  1ZBL A;  1GOC A;  3VQP A;  4CHO A;  4DU3 A;  2W42 A;  4C8K A;  3IAY A;  3ZSW A;  4FM2 A;  3TAN A;  3V6D A;  1WSJ A;  4CF1 A;  1XWL A;  4OVL A;  4ZHR A;  3OYE A;  4EP4 A;  4DQS A;  1JXE A;  3SQ1 A;  2O4I A;  2LSN A;  4E1N A;  1GOA A;  4B9N A;  4H8K A;  4CFD A;  1I39 A;  1NK7 A;  4KI4 A;  4M45 A;  1Z25 A;  4KV8 A;  4CFC A;  1O1W A;  4CEQ A;  4CGG A;  3OY9 A;  3KK3 A;  3OJS A;  4PUO A;  4IKF A;  3SZ2 A;  3ZSX A;  4KHS A;  3RMC A;  3TI0 A;  2YNF A;  4CEE A;  4KHQ A;  3MED A;  1MU2 A;  4CGF A;  4NCG A;  4N76 A;  5D3G A;  4XIU A;  3V9S A;  3IG1 A;  5J2M A;  4AIL C;  1IG9 A;  4DF4 A;  3HPH A;  1RT6 A;  3KLG A;  2G8H A;  4CJP A;  1IKV A;  2DFH A;  2X6N A;  1CZB A;  3O4Q A;  3OYD A;  4KTW A;  4CCH A;  1FK9 A;  1JL1 A;  3SV4 A;  3QES A;  4RW9 A;  3ZSZ A;  1KCF A;  5KGX A;  4B9U A;  4B9M A;  4EZ9 A;  3HT3 A;  1U47 A;  2HHS A;  3ALY A;  4DSE A;  3QNN A;  5T7B A;  4RW8 A;  1RCH A;  4ICL A;  3TAE A;  3SNN A;  1TK5 A;  5SZT A;  1J5O A;  1BI4 B;  1KVC A;  3DLB A;  2BAN A;  3RWU A;  3QIP A;  1BIZ A;  4HCC A;  4FW2 A;  3TAQ A;  2Y1I A;  1S6Q A;  3VQC A;  1BL3 A;  4FXD A;  1HPZ A;  1HYS A;  4IFV A;  3VQB A;  4J2E A;  1W9H A;  3P5J A;  4OPK A;  3V9X A;  2F8T A;  3OJU A;  2KW4 A;  3SUN A;  4BE2 A;  4GW6 A;  5KI6 A;  3ISN C;  4CHQ A;  4CHZ A;  4OGC A;  1SKW A;  1KRP A;  1TKD A;  1NKB A;  3AA4 A;  3V9U A;  3AA2 A;  3ZT3 A;  2FBV A;  1NJZ A;  4FJL A;  1VSH A;  3VQE A;  4DWI A;  1L3V A;  3NGZ A;  1QTM A;  2PYJ A;  2EHG A;  4DFM A;  1L3U A;  4K8Z A;  5C25 A;  3NH0 A;  3V9W A;  4PQU A;  1TKT A;  2X78 A;  3ITH A;  4CJQ A;  5I42 A;  1ITG A;  3MEC A;  1TV6 A;  4RW6 A;  3QNO A;  4DSI A;  4F3O A;  4CJV A;  1XHX A;  4Z4E A;  2HHT A;  4IG3 A;  2VG5 A;  3AO4 A;  4M3Z A;  2HW3 A;  2HHQ A;  1RBT A;  3NCI A;  2HHU A;  2YNI A;  1VSJ A;  4NYN A;  3VQ9 A;  3U6F A;  1VRU A;  3KIO A;  3KKR A;  1KFD A;  4QCL A;  2E6M A;  1NJW A;  4DQR A;  2X6S A;  4CER A;  1SV5 A;  4FJX A;  2XRI A;  1CLQ A;  1BQN A;  3T1A A;  2D0B A;  4KKO A;  4HVJ A;  4O5B A;  3LDS A;  4DTP A;  1X9S A;  2XY7 A;  2YKN A;  2A1R A;  3PV8 A;  5I3U A;  3WNH A;  2P1J A;  5J2Q A;  3KTQ A;  4M42 A;  1WAJ A;  1Q8I A;  4I7F A;  3MAQ A;  3NF7 A;  3ZSO A;  3K5L A;  3S3O A;  1LW0 A;  3DLE A;  4FLV A;  4J2D A;  1HNI A;  3PY8 A;  3OS2 A;  2XY6 A;  3NGY A;  1NK0 A;  2ATQ A;  2G8I A;  4PY5 A;  3TAG A;  1FKO A;  3U3Y A;  2F8S A;  5KRS A;  4ELV A;  1U49 A;  1VRT A;  1RDD A;  1A5W A;  1IKW A;  3VQA A;  3M8P A;  3HP9 A;  2NUB A;  2HVH A;  2WON A;  4HUG A;  4I2P A;  3A2F A;  4CE9 A; 
#chains in the Genus database with same CATH topology
 1JKH A;  4LF4 K;  4JI6 K;  5AQI A;  1R59 O;  4DV7 K;  4JKF A;  5FPD A;  1B92 A;  1WSG A;  3TAP A;  1VQK N;  1EWQ A;  3ENO A;  4DTX A;  3OA9 A;  3H3O B;  5J2N A;  3OYA A;  1NGE A;  5F1X A;  2DY4 A;  4JYA K;  3VEY A;  4JNE A;  3R6M A;  4I9L A;  3NHG A;  4CZE A;  3MX5 A;  3HM9 A;  4JKA A;  5BPM A;  3CET A;  4CGJ A;  2IAJ A;  4LF5 K;  3NVK A;  4BRD A;  1C0F A;  4B3M K;  3OVN A;  2A5X A;  3CJC A;  4CF8 A;  2RKI A;  4W5R A;  4JI5 K;  5HLF A;  2O8E A;  2ZD1 A;  4YOW A;  2QW9 A;  1U04 A;  4DFJ A;  2HST A;  4B1X B;  4CFA A;  1ASW A;  1GLJ O;  1JLC A;  1YTA A;  4C8L A;  4CJF A;  5LY3 A;  3CQX A;  1NJX A;  1BWF O;  1Y97 A;  3L6Q A;  4FK0 A;  1OH7 A;  1GLL O;  4PKH A;  1ASU A;  3AVJ A;  4I6M B;  2RE2 A;  2E2Q A;  4Y0W A;  4JD2 B;  3QFP A;  2HHW A;  5GAD P;  3OYC A;  1HLU A;  1P8Z A;  4DUZ K;  1HKB A;  1U4B A;  4DU4 A;  3QEW A;  4O44 A;  3CCJ N;  2YKM A;  5CY4 A;  5HRS A;  2HNY A;  4MQ3 A;  4CZI A;  3OYN A;  4CD1 A;  3CCL N;  3AVG A;  4CF2 A;  1EP4 A;  3L2V A;  1NMD A;  4Q0B A;  3O9S A;  1VSD A;  4W5O A;  4A5B A;  4DR5 K;  4BRL A;  3KK2 A;  1L3T A;  5HRP A;  3KK1 A;  1K73 O;  3G4S N;  4BDP A;  3OYH A;  3C7N B;  1T03 A;  2AP1 A;  3A2F A;  4FJG A;  1RBV A;  1RT4 A;  4AH9 A;  1QHA A;  3CCE N;  4BG8 A;  2VGN A;  4B9T A;  2VG7 A;  3C65 A;  4M3X A;  4EP5 A;  4I6M A;  2B5J A;  4CED A;  4JD2 A;  3E66 A;  4BRG A;  3O9R A;  1W0H A;  5AQW A;  4B1U B;  4AM7 A;  3O4N A;  1IO2 A;  3LDO A;  1RTI A;  3KK7 A;  4JK8 A;  3OYK A;  3ZYY X;  3DLH A;  3O6W A;  3J7Z O;  2HF4 A;  1TVR A;  4MDB A;  1QHT A;  4DF8 A;  4CEF A;  3EO3 A;  2DFE A;  4O8U A;  4J2A A;  1WB9 A;  1D9D A;  1BIS A;  5AQN A;  1NOZ A;  3K9K A;  4CFB A;  4X64 K;  3I56 N;  1SL0 A;  3CF5 L;  1E3M A;  4FYD A;  4PA1 A;  4FCY A;  1N34 K;  2NRX A;  1S6P A;  3DXM B;  1E4F T;  2QWP A;  1GLB G;  4K42 A;  1HYZ A;  1S1W A;  3CC4 N;  3CD6 N;  3MX2 A;  4OKJ A;  3RTV A;  1TK8 A;  3O3G A;  3GOI A;  1VAZ A;  3FZF A;  3HVR A;  2UUA K;  3LZJ A;  3M8Q A;  4EIA A;  1JLA A;  4H03 B;  4K0K K;  3E9P A;  2Z1J A;  3CC2 N;  1NK5 A;  2G8U A;  2D1K A;  5MLC Q;  4OKE A;  2WFB A;  3BZK A;  2GBZ A;  4FLW A;  2XY5 A;  1GLC G;  4JLH A;  1ZBS A;  3ZT1 A;  1U45 A;  2NNW A;  1XI1 A;  4RG8 A;  4FJN A;  1IKX A;  4GVM A;  1BIU A;  3EEQ A;  3VQ8 A;  3BDP A;  5BRH A;  4HHT A;  3MN6 A;  2QWQ A;  2D0P A;  3BP8 A;  1RNH A;  3N4Q A;  1X9M A;  4BRM A;  3UKU A;  2UXB K;  3NVM A;  4RTF D;  1MWM A;  5BPL A;  4KO0 A;  4CEC A;  4DR2 K;  1ATR A;  4DR6 K;  3MWT A;  3DM2 A;  4H4O A;  4N56 A;  4KHN A;  3NAE A;  3HJF A;  4IEE A;  3O3F A;  2P9P B;  1LOT B;  1ESV A;  2G8F A;  4M7Y A;  3OYL A;  3H08 A;  3L0Q A;  3WNE A;  4CJS A;  3AO2 A;  5AQP A;  5FRO A;  3PO5 A;  5JVG L;  5IWA K;  2JGU A;  1D5A A;  2QA4 N;  1BO5 O;  2FBY A;  4BQL A;  4KHP K;  4KH4 A;  3WNG A;  4CJL A;  4IOX A;  1JCE A;  2ITG A;  3SK3 A;  1K8A O;  3NMU A;  4NCB A;  1B9F A;  4Z4G A;  4NXM K;  3VPZ A;  1W7A A;  3AO3 A;  2IVO A;  2YHX A;  3QET A;  2HHH K;  1J6Z A;  4HUF A;  3R9P A;  3HSC A;  3FFK B;  4KBO A;  3MMV A;  1BGX T;  4O0J A;  3VA0 A;  3G6E N;  2BDP A;  3PLA A;  3NGI A;  2OTJ N;  2YHY A;  2D0C A;  3QEV A;  4YHH K;  1RT7 A;  3SYZ A;  2E20 A;  4FOI A;  4FJM A;  4E1M A;  4BDY A;  2PFU A;  4E0D A;  3FLC O;  2ZWH A;  3MEG A;  3EKU A;  3VF2 A;  4KHU A;  3WXL A;  2P9N B;  4I9Q A;  1JLE A;  2UU9 K;  4YY3 K;  5CR4 A;  5AQV A;  2NRV A;  4Z4I A;  1T05 A;  1J9A A;  1RBS A;  2PZS A;  1D4X A;  4OLB A;  3P83 D;  1W97 L;  1KC8 O;  4IFY A;  3FZM A;  4IZ9 A;  3CHW A;  4U7B A;  3VEN A;  4CK3 A;  3CFP A;  1TUU A;  1HQE A;  3AVH A;  3E01 A;  1E4G T;  3SQ0 A;  3C0B A;  3HPG A;  4JI1 K;  4PL7 A;  1J5E K;  2Z1I A;  4CZH A;  4HTU A;  3G10 A;  3LPU A;  3E9L A;  2KKZ A;  2YI1 A;  5J2P A;  1LV5 A;  4O0I A;  1RT3 A;  3I8B A;  4HTL A;  4A5A A;  4CEZ A;  3O1W A;  2XO7 A;  1KLN A;  4PKI A;  1C6V A;  1YF5 L;  4FPA A;  5AQY A;  1IG8 A;  1YJW N;  4ZTF A;  1LW2 A;  1SKR A;  4BRP A;  1NGH A;  4O4G A;  3OYJ A;  3L2W A;  5LJV A;  4BR7 A;  3K58 A;  4DTS A;  3C6T A;  2OPS A;  3CER A;  2NRH A;  3M8S A;  5DK5 A;  4AHC A;  1ZBL A;  4QS9 A;  3E9O A;  4GKK K;  4FM2 A;  1NLV A;  4ZHR A;  1XWL A;  2O4I A;  5LJW A;  1I39 A;  4M45 A;  4GY2 B;  4CGG A;  1Q7Y O;  4X65 K;  4PUO A;  4BRF A;  5AQT A;  3ZSX A;  4H5R A;  4XH4 A;  3BF3 A;  3D2E A;  3OW2 M;  3MED A;  5D3G A;  3A8Y A;  5J2M A;  4DF4 A;  4DR3 K;  1IKV A;  2JWK A;  1YUW A;  3GG4 A;  3WXJ A;  4CZK A;  3ZSZ A;  1KCF A;  4B9U A;  4B9M A;  1U47 A;  4RW8 A;  1RCH A;  1BI4 B;  2GWJ A;  1K9M O;  3RWU A;  3QIC A;  3TAQ A;  3JXU A;  3U9Z A;  3TTF A;  3VF6 A;  4YOU A;  4IFV A;  4IO8 A;  3VQB A;  4BRI A;  1EWR A;  5KPT A;  4MLE A;  4CHZ A;  1KRP A;  1L3V A;  1QTM A;  2PYJ A;  3ITH A;  4JKE A;  4WF9 L;  3MEC A;  1XHX A;  4M3Z A;  2HHQ A;  1RBT A;  1Q86 O;  3U6F A;  1VRU A;  4DB3 A;  1K8K B;  1NJW A;  4WFB L;  4CER A;  2V52 B;  3Q7C A;  4KKO A;  4B1W B;  4CJ7 A;  3LDS A;  3PV8 A;  5I3U A;  2P9S B;  4M42 A;  1WAJ A;  3NF7 A;  1FJG K;  4OPA A;  2HBL A;  4FLV A;  4J2D A;  3OS2 A;  3NGY A;  3TAG A;  5GIN A;  3U3Y A;  3SBT A;  2VYP A;  1H1V A;  4WQ5 C;  4JI8 K;  2F7T A;  2UXC K;  3C6H A;  2NLX A;  1A5W A;  3VQA A;  3M8P A;  4CE9 A;  1QVF M;  1NK9 A;  4CGI A;  3K5M A;  1XMO K;  4ILG B;  4YDU A;  4YOY A;  1SZ2 A;  2FLO A;  1N36 K;  3QB0 A;  1HQU A;  2O8B B;  4IJN A;  1ZYQ A;  1KSP A;  4FK4 A;  1WUA A;  4WQ5 A;  3DOK A;  3BF1 A;  3WEE A;  2ETJ A;  3EYZ A;  4W5Q A;  4NLC A;  4BC4 A;  5HBM A;  4OLA A;  1BG3 A;  1S9G A;  3CFO A;  1KLM A;  1S22 A;  3DI6 A;  1OVY A;  4L8R B;  3DRS A;  3WXI A;  4IG0 A;  3AVF A;  4ISE A;  4LF7 K;  3JAM O;  1K8K A;  1LAV A;  3TR8 A;  3CCM N;  4DU1 A;  1KVB A;  1SS6 A;  3O5B A;  3AGK A;  4A2A A;  1U6Z A;  2OPP A;  4B9L A;  1DT9 A;  2P9S A;  4Z4F A;  1S9E A;  5HRR A;  2QKK A;  1WSI A;  1QQN A;  3RSE B;  1BCM A;  1VSK A;  2J4R A;  3HPO A;  3IS9 A;  3U4L A;  4BGA A;  1P90 A;  1C0U A;  4FZY A;  4KRE A;  4BG9 A;  1HNZ K;  1GLA G;  2NZT A;  4NYF A;  5E84 A;  4DTN A;  4L3Q A;  1Z26 A;  1NGJ A;  1YI2 N;  3LAM A;  5JS1 A;  2BUP A;  2O8B A;  4DFP A;  4B8C A;  3EY1 A;  2CGJ A;  4C23 A;  3THV A;  4KRF A;  5M1Q A;  1WLJ A;  4CZM A;  2P51 A;  2ITM A;  1D8Y A;  4FJJ A;  3OHR A;  4JAX A;  4BR9 A;  4H0X B;  2BTF A;  4GV6 A;  2QK9 A;  1CZ9 A;  4B1V A;  1KTQ A;  3VEW A;  2RHK A;  4ILH A;  5H1S Q;  3U9D A;  4WFN L;  5M1F A;  5M1P A;  3A5O C;  1HNV A;  4JI0 K;  1RTH A;  3QLH A;  1BU6 O;  3K57 A;  2F9W A;  4JRP A;  3THY A;  2HF3 A;  4WYB A;  3ZT4 A;  4CJW A;  5JIC A;  1VSL A;  3RSE A;  1SL1 A;  5EY4 A;  3LP1 A;  3HST B;  5AQK A;  4C8M A;  5BRF A;  4I2Q A;  1JLB A;  4E3S A;  1HYV A;  3LAL A;  4KTQ A;  4DV3 K;  1DLO A;  4BY9 C;  3ZX0 A;  3UE5 A;  2WC9 A;  3HI0 A;  2O8C A;  4IOA L;  2A1S A;  5DMR A;  2HMI A;  4QAG A;  2ZE2 A;  3KD5 E;  3ZT0 A;  1CXU A;  4CF0 A;  3NBP A;  3CPW M;  2KFN A;  3LP2 A;  3FZL A;  2Z1H A;  3ZSV A;  4OPH A;  4PL8 A;  2BE2 A;  5ADX A;  4FWR A;  3PSI A;  2CH6 A;  1T6C A;  3F9K A;  3T19 A;  4KTZ A;  3K5O A;  3K2P A;  4H4M A;  2QWN A;  3FZK A;  2E6L A;  1Q82 O;  1CXQ A;  3DJC A;  4IOC L;  3DXK A;  1QQC A;  1TGO A;  1WSE A;  1WN7 A;  1WBB A;  2IGI A;  5KGW A;  2CH5 A;  3V81 A;  2WBN A;  2PAV A;  3UIQ A;  2GUI A;  3HBT A;  4FJ9 A;  3O9T A;  3KJV A;  4B1Z A;  1BHL A;  2E8A A;  2HHX A;  4DLG A;  2I5J A;  4RWT A;  3MDQ A;  4FLZ A;  4M3W A;  3AO1 A;  5SWM A;  5C2F A;  4AHV A;  5GIP A;  3H46 O;  4FLX A;  4M3U A;  2E4L A;  1XUP O;  3F9M A;  1HKG A;  3R1X A;  2ZF5 O;  2VQF K;  3V1R A;  3O8M A;  3VOV A;  3HRG A;  2HNZ A;  1RT2 A;  4X66 K;  2IOC A;  4CD3 A;  4B3R K;  1V4S A;  1GLF O;  2HND A;  3GL1 A;  4WE1 A;  2GEM A;  4N41 A;  3DLR A;  5C2D A;  1X9W A;  2ZJP L;  1JXB A;  1RDA A;  5KRT A;  5AFU A;  1YVU A;  2VG6 A;  5KQ8 A;  2Q3S A;  3TTD A;  4CVN E;  4GMJ B;  5BRE A;  2A40 A;  3QO9 A;  4FWK A;  4YOR A;  4E7H A;  1NGF A;  4C1N K;  4DV4 K;  1LWE A;  3ZCM A;  3QML A;  2Q1N A;  4CIG A;  3AAP A;  3HOT A;  4DTJ A;  1S1X A;  3V1O A;  5C24 A;  1EET A;  4LFA K;  3H3N O;  2GUP A;  3ZSR A;  1WSF A;  3IDH A;  5C0Y A;  3IFR A;  4JHD A;  1NK8 A;  3OYI A;  3SI6 A;  4LFB K;  2GEL A;  5KPR A;  1N8R O;  1XC9 A;  1JL2 A;  2DTU A;  4CK1 A;  1VQ5 N;  2HHV A;  4DR1 K;  3M8R A;  1WAF A;  3MN9 A;  3LAN A;  5HRO A;  1IBL K;  3LAK A;  3G25 A;  3SUO A;  2EWS A;  2P9L A;  4X62 K;  3Q7B A;  5AJ3 K;  3GBT A;  2YNG A;  1C1C A;  4CEA A;  4CGH A;  4OJR A;  2RF2 A;  5JMV A;  2Y1J A;  1DGK N;  1RTJ A;  3KVG A;  2V7Y A;  2JLE A;  3AVK A;  1HR0 K;  3O9U A;  4FJ8 A;  4G9Z A;  2BH1 A;  3UB5 A;  1RT1 A;  5AFU H;  4N47 A;  4DSL A;  4BAC A;  3UKU B;  3HZ6 A;  3L3V A;  2OAN A;  4O5F A;  1VQ6 N;  3SCX A;  3LDP A;  4H0V B;  4DFK A;  1Z05 A;  4Z4H A;  4DG1 A;  4IO9 L;  4BR5 A;  4DR7 K;  1CZA N;  4YOX A;  4HCB A;  2YJF A;  1KAY A;  1RDC A;  3RRH A;  2KZM A;  4H5V A;  3ZEU B;  2P9K B;  1SKS A;  2E2O A;  1BCO A;  2Q97 A;  3CM5 A;  3DRP A;  3T7Z A;  1DTT A;  3LDL A;  1KQS M;  1NMN A;  1NGD A;  1KD1 O;  3DLK A;  5AQM A;  1DTQ A;  2FSK A;  2F96 A;  4A62 A;  1MA9 B;  1RGI A;  3S9H A;  1Q9X A;  1WNS A;  2OYQ A;  3VF4 A;  1YIJ N;  5GAG P;  3LL3 A;  3P31 A;  4XH5 A;  1RBR A;  4XEI A;  2IDO A;  3R3L A;  3SJH A;  1SUQ A;  4DTR A;  2HOE A;  4C1N I;  4RW7 A;  3A0I X;  5CHI A;  4OPJ A;  3NDK A;  4CZG A;  4GV9 A;  3ZSW A;  3TAN A;  2O8D B;  3MN7 A;  4GV3 A;  1JXE A;  2P9I A;  3DWL A;  1EQY A;  4B3S K;  3U8X A;  4KI4 A;  5C15 A;  4KV8 A;  2V51 B;  4CEQ A;  3OY9 A;  3KK3 A;  4KHS A;  1ATN A;  3TI0 A;  1XQS C;  1QZ5 A;  3SAG A;  4XIU A;  3V9S A;  1IG9 A;  3EN9 A;  3ID6 A;  2DFH A;  2X6N A;  2YHW A;  3ZEU A;  2P9K A;  2NRZ A;  3OYD A;  4JI7 K;  1JCG A;  1QQM A;  1BA1 A;  3SV4 A;  4RW9 A;  3D7E O;  2HHS A;  4DSE A;  3QNN A;  3TAE A;  5AQG A;  1TK5 A;  1J5O A;  5SZT A;  1KVC A;  3DLB A;  1NG9 A;  1GLD G;  4DKW A;  1JJ2 M;  3P4I A;  4ISF A;  1HYS A;  3MN5 A;  4OPK A;  3MWP A;  2KW4 A;  1YJN N;  4CHQ A;  4OGC A;  1TKD A;  1SQK A;  3ZT3 A;  5FLX O;  1VSH A;  3VQE A;  3NGZ A;  2A3Z A;  2EHG A;  4DFM A;  1L3U A;  1NGG A;  1QQO A;  3V9W A;  4PQU A;  2X78 A;  2QM1 A;  2UYT A;  3SMS A;  4CJQ A;  5I42 A;  2O8D A;  1TV6 A;  3QNO A;  4F3O A;  2HHT A;  2VG5 A;  2FF6 A;  2HHU A;  4H0Y B;  3VES A;  1KFD A;  1U2V B;  1YVN A;  4HVJ A;  4FWP A;  2F9T A;  2P1J A;  4BGB A;  1Q8I A;  3MAQ A;  5AQS A;  3O80 A;  1YJ9 N;  3DLE A;  4AF1 A;  1XNQ K;  3PY8 A;  2G8I A;  1FKO A;  3CIP A;  3IMX A;  3HOS A;  3D2E B;  3ULE A;  3SBG A;  4BR2 A;  1RDD A;  2IVP A;  3H1V X;  4HUG A;  5JLH A;  1HMV A;  2KTQ A;  4TSX A;  3LP3 A;  3VGL A;  1VK0 A;  1T7P A;  1OKJ A;  3ATV A;  4Y1D A;  2H3G X;  3AVA A;  4PHT X;  2KFZ A;  1UA1 A;  3H45 C;  1TL3 A;  2AA4 A;  3N4P A;  4RCH A;  5TKY A;  4QOZ B;  1N33 K;  3CJ1 A;  3TAF A;  4KH5 A;  1YXQ A;  2ZJQ L;  3TWH A;  5BN8 A;  3QEP A;  4AHT A;  2HBK A;  4R5P A;  1TAQ A;  1ZBF A;  5LL6 Z;  1HUX A;  1U2V A;  2ASO A;  1LWF A;  3PX6 A;  3RMA A;  3THX A;  1T3V A;  3VGK A;  2QI2 A;  3VEZ A;  5GIO A;  4KAZ A;  5FPE A;  1C1A A;  3B6P A;  5M1N A;  2QWR A;  4JN4 A;  3WXM B;  5CYQ A;  4CJ3 A;  2OZS A;  3WXK A;  5AQU A;  4MDA A;  2YCH A;  2B6A A;  4BVP A;  1EXQ A;  3NH2 A;  3AVB A;  2OZM A;  4CJE A;  5FRN A;  5C10 A;  4CF9 A;  4DSF A;  4EFH A;  3AVL A;  3ZX2 A;  1QSY A;  3AAQ A;  4Z4C A;  4CZF A;  4WFA L;  3IUC A;  4KB1 A;  3KZB A;  4JI3 K;  3QEI A;  2QWL A;  3OS1 A;  3KD1 E;  5IT9 O;  1K6Y A;  4BDZ A;  5KTQ A;  3LWM A;  2VGM A;  4K25 A;  4F2S A;  4BVO A;  2KZZ A;  1VQP N;  3W0L A;  2P9U A;  4FVM A;  2VWJ A;  4WCE L;  5HP1 A;  3AY9 A;  1XMQ K;  3VQ4 A;  4A57 A;  4KHW A;  5BR8 K;  2QXL A;  4CEB A;  4LSL A;  3THW B;  1QE1 A;  4CI6 A;  2W41 A;  3PX4 A;  3WEE B;  2PYL A;  5EU7 A;  3JS6 A;  1VSM A;  3HP6 A;  4BE1 A;  3B8A X;  1VHX A;  2ZM6 K;  2FSN A;  4DS5 A;  3KLI A;  1ZC6 A;  3TSU A;  1NK4 A;  3J81 O;  3E1Y A;  3NF6 A;  3AA3 A;  3CJB A;  3EE8 A;  2UUB K;  4B1Y B;  4F8R A;  2E1Y A;  3QER A;  3J80 O;  4DUY K;  3ZX3 A;  2G8W A;  3TAB A;  1ILY A;  3MK6 A;  3NH1 A;  4M3Y A;  1TAU A;  4JKG B;  5E41 A;  1RFQ A;  1X3M A;  3DYA A;  5CE3 A;  3QEX A;  5BN9 A;  1UWB A;  3TSQ A;  4MFB A;  1SAZ A;  1OH8 A;  1NWK A;  4E7L A;  1QS4 A;  4CJ4 A;  4DV1 K;  3L2R A;  3B6O A;  1B9D A;  2Z1G A;  3PIP L;  4KPY A;  3GDQ A;  4C8N A;  5M1O A;  3LM2 A;  1L3S A;  1EO1 A;  5EOY A;  1UA0 A;  2XY8 A;  3NE6 A;  3THW A;  4DSK A;  4ZTJ A;  3R8E A;  2V7Z A;  3WNF A;  4CEO A;  2DFF A;  3RMD A;  1R0A A;  4B3O A;  1IJJ A;  3MXJ A;  4K41 A;  3J8A A;  2Q0U A;  4RW4 A;  4LF8 K;  1J54 A;  1T8E A;  3L3U A;  3AO5 A;  1HPM A;  4LF9 K;  4FM0 A;  2QXF A;  1U48 A;  5C12 A;  4H5T A;  1W2B M;  2YJE A;  3ZSY A;  4GVE A;  5KPZ A;  5ELZ A;  3KLH A;  4JKG A;  3THY B;  2YX6 A;  1RBU A;  3A5L C;  3O1B A;  1G15 A;  3O3H A;  2Q0R A;  3PUF A;  4QS8 A;  4ELT A;  2Q2R A;  4JKC A;  2O8C B;  3LPT A;  2NRR A;  4CZJ A;  3CQY A;  3MCP A;  4A61 A;  4FVU A;  3AVN A;  3QIO A;  1NJI O;  3LP0 A;  1ZBI A;  5EXW A;  3JSM A;  4F2R A;  1YAG A;  2RN2 A;  3ZSQ A;  4DTM A;  5M1K A;  5J1E A;  4B08 A;  4DV0 K;  2E1Z A;  3V9Z A;  1J53 A;  3D6R A;  2D0A A;  4GNI A;  2ZQB A;  2VCP A;  1LWC A;  3DLG A;  1BA0 A;  4CHP A;  2Q31 A;  4FJH A;  4JKH A;  3HM8 A;  1HX1 A;  2ZGZ A;  3CYM A;  3TTC A;  2QWO A;  4CIE A;  3DXK B;  2G8K A;  4BR4 A;  2P5O A;  1RDB A;  3VQQ A;  3K59 A;  4KI6 A;  2EX3 A;  3T3F A;  1XHZ A;  4CIF A;  4V19 S;  4CJ5 A;  1N32 K;  1HJO A;  2HB5 A;  3I33 A;  4DCH A;  3AVI A;  4JI4 K;  1YT3 A;  1I94 K;  2OPQ A;  1QZ6 A;  3M3Z A;  2ASM A;  4B9S A;  3ULD A;  3VQ6 A;  1M1K O;  2YHB A;  4WQ4 C;  2QWM A;  5C42 A;  3KKS A;  5EX5 A;  4Y1C A;  3IRX A;  2W40 A;  2P5G A;  2VWK A;  3HK2 A;  5AQH A;  2W6K A;  1IV0 A;  2O4G A;  4FWM A;  3VA3 A;  4BWM A;  3AVC A;  4KFB A;  2D5R A;  1MDU B;  4FJI A;  5EVZ A;  1TL1 A;  4C8O A;  1HJR A;  4WQ4 A;  4LC9 B;  3K0S A;  3LZI A;  2UUC K;  4PKG A;  3EZ5 A;  4MO4 A;  4ID1 A;  3RMB A;  3L4Q A;  1LCU A;  4CBW A;  4E7K A;  4NXN K;  3LDN A;  4BE0 A;  5JS2 A;  3VQ5 A;  3QDK A;  3D0P A;  3OTO K;  3OYF A;  5DM7 L;  4CBU A;  1X1P A;  2GTD A;  2PY5 A;  3QIN A;  4FWQ A;  3G0Z A;  4R79 A;  5F0X A;  2G8V A;  4CJK A;  4IJA A;  4KHY A;  4F9O A;  3HYF A;  5DM6 L;  4JHD B;  3TAR A;  4DQI A;  1TKZ A;  3O9Q A;  1Q81 O;  1ZBU A;  3DAW A;  4JEP A;  4JRQ A;  4BWJ A;  2I7N A;  4K43 A;  3K9J A;  2YNH A;  1WSH A;  3SPZ A;  1UAX A;  3P38 A;  1RDU A;  1GOC A;  4C8K A;  4DU3 A;  2W42 A;  2P9L B;  3BEX A;  4CF1 A;  4OVL A;  3OYE A;  1OH6 A;  2A42 A;  3SQ1 A;  3OBY A;  2LSN A;  2Q36 A;  4HWI A;  4E1N A;  2UXD K;  5ADX H;  4B9N A;  2WUS A;  3FR0 A;  4CFD A;  1NK7 A;  1Z25 A;  4H0P A;  1O1W A;  3OJS A;  4IKF A;  1ZXO A;  1VQN N;  2YNF A;  3QBW A;  4CEE A;  4KHQ A;  1XC3 A;  1MU2 A;  4CGF A;  4NCG A;  4N76 A;  3HPH A;  1RT6 A;  3G71 N;  3KLG A;  2G8H A;  4CJP A;  5LMN K;  3CC7 N;  4FPB A;  1TUY A;  1CZB A;  1NNE A;  4CCH A;  3OBW A;  1JL1 A;  3QES A;  5KGX A;  3ALY A;  1WOQ A;  3CCR N;  5T7B A;  3SNN A;  4ICL A;  2BAN A;  3TPQ A;  1BIZ A;  1S6Q A;  1HPZ A;  4MO5 A;  4FL9 A;  3V9X A;  4AQY K;  2CGK A;  3SUN A;  2F8T A;  4GW6 A;  5KI6 A;  3ISN C;  4LF6 K;  1JCF A;  2DPN A;  3AA4 A;  3V9U A;  3AA2 A;  2FBV A;  3DLL L;  1NJZ A;  4FJL A;  1QVG M;  3CI5 A;  5AQL A;  5HOO A;  3TU5 A;  4K8Z A;  5FPM A;  3NH0 A;  1BDG A;  4EAH D;  2IVN A;  1BOT O;  1TKT A;  5GAH P;  3LDQ A;  4DV5 K;  2PBD A;  4Z4E A;  3KWG A;  3W3D A;  3NCI A;  4BR0 A;  2YNI A;  1VSJ A;  4IXC A;  3VQ9 A;  4CZL A;  2IIR A;  3P39 A;  3KIO A;  3KKR A;  2E6M A;  4BRH A;  1SV5 A;  5AQR A;  4M63 C;  1S72 N;  5KQD A;  1BQN A;  3T1A A;  2D0B A;  4O5B A;  3M6G A;  4DTP A;  2W6L A;  2YKN A;  4O8K A;  4H5W A;  3WNH A;  3K5L A;  3ZSO A;  2P9I B;  3S41 A;  2OCE A;  1HNI A;  3VET A;  1NK0 A;  4PY5 A;  2ATQ A;  2VWB A;  5KRS A;  1U49 A;  3WT0 A;  1IKW A;  2NUB A;  3EE9 A;  2WON A;  1NU0 A;  1KAX A;  3I8D A;  2FXU A;  3NF8 A;  4BRA A;  4G1Q A;  1DEJ A;  4BRK A;  3C95 A;  1KFS A;  3D45 A;  2WTU A;  4FWO A;  2OTL N;  2E88 A;  1I3A A;  1NOY A;  1F21 A;  2RPI A;  1RTD A;  1VSF A;  4IBN A;  1LAW A;  3ATU A;  4AHS A;  3CMA N;  3F5T A;  4DR4 K;  1NGA A;  3C7N A;  3SLC A;  3L8B A;  4J2B A;  1ASV A;  2QKB A;  1KXP A;  4DHY A;  1N6Q A;  3VGM A;  4FSV A;  3ZT2 A;  3PO4 A;  1JLF A;  3OS0 A;  1S1T A;  4K8X A;  1S5J A;  4LFC K;  4FJ7 A;  1YTU A;  2D0O A;  5CZ1 A;  1ZBH A;  1QSS A;  4FJ5 A;  3SJJ A;  4CJR A;  3AGR A;  2HBM A;  5FPN A;  2HMP A;  4F3T A;  3S3M A;  1MWK A;  1A5V A;  1QSL A;  4CBX A;  4PWD A;  4DV6 K;  3KLE A;  4E1J A;  4NLB A;  3IKM A;  4FO0 A;  5JVH L;  4YNQ A;  1HKC A;  5CYM A;  1V4T A;  3ULE B;  1KVA A;  3DXM A;  3KWI A;  4EHU A;  3CJA A;  3LWL A;  1EKE A;  2ASP A;  3L4I A;  3BY5 A;  3SPY A;  4BC3 A;  1C1B A;  4FOE A;  4ILJ A;  5FDL A;  1C0T A;  1OVQ A;  3OYG A;  3NFA A;  4BC5 A;  4DV2 K;  4DQ8 A;  4YFU A;  4J8F A;  3VEV A;  3HVT A;  5AZJ B;  3J7A P;  3RR8 A;  5K14 A;  2QEX N;  4M3T A;  3U3G A;  3L2Q A;  4DQQ A;  3ASM A;  4FLY A;  4FLU A;  3FFI A;  3C94 A;  5HRN A;  3K5N A;  1NJY A;  1VQ4 N;  2D4W A;  3PX0 A;  4M41 A;  1VSI A;  3RR7 A;  4IWV A;  4ELU A;  4GKJ K;  3THX B;  2XHB A;  4DSJ A;  4H0T B;  4ID5 A;  4DLE A;  2YHA A;  3QFU A;  3RRG A;  3VMF B;  3T1Y K;  3HO1 A;  2A41 A;  3FZH A;  1RDW X;  1TK0 A;  4IEI A;  2JWL A;  1NGI A;  4KH6 A;  2YV0 X;  1A5X A;  1D9F A;  1SL2 A;  3OYB A;  1TYQ B;  4O55 A;  2P9P A;  4LY7 A;  1S1U A;  2NRW A;  4E7J A;  3H1Q A;  4DMN A;  4JS4 A;  1JLQ A;  5AQZ A;  5AQO A;  3VTH A;  4E19 A;  4BC2 A;  3WUH A;  1Q9Y A;  1RIL A;  1NKC A;  1TKX A;  1L5U A;  5AZJ A;  4DTU A;  3AVM A;  4A2B A;  3DRR A;  4CJU A;  2E2N A;  4HUE A;  1JLG A;  2ZJR L;  2HVI A;  4JKB A;  3VQ7 A;  1S1V A;  1KAZ A;  3VQD A;  3DOL A;  4NB4 A;  4U67 L;  2P9U B;  2E5L K;  4JV5 K;  3VTI A;  1HNX K;  3M1F A;  5CZ2 A;  3SQ2 A;  1RT5 A;  1N5Y A;  2NRT A;  5GAE P;  4B9V A;  3BUZ B;  4BRO A;  5LMU K;  1EX4 A;  4FM1 A;  3MXI A;  4B8A B;  2AJQ A;  3TSP A;  4LD0 A;  1VQ9 N;  2KQ2 A;  4CHN A;  1NM1 A;  3PSF A;  4CK2 A;  1NGB A;  3WQT A;  3VEO A;  3VN5 A;  1NGC A;  3WQU A;  3CG7 A;  4DQP A;  2O8F B;  3I0R A;  1TYQ A;  3PIO L;  4FZZ A;  4FLT A;  4BRN A;  1Q18 A;  3OYM A;  3JYT A;  4Z0U A;  2WOM A;  4UQG A;  2P9N A;  3J7Y P;  4FK2 A;  3QBX A;  3NF9 A;  1REV A;  4JKD A;  3SMP A;  3MXM A;  4NO7 A;  1YHQ N;  2R7Y A;  3EL2 A;  3RVC A;  3ID8 A;  4XH1 A;  5BR9 A;  4FZX C;  3HXM A;  2FBX A;  2KLA A;  4BRC A;  3H6E A;  4LH5 A;  1NK6 A;  4OX9 K;  2B4J A;  3CCU N;  5JLF A;  3M5R A;  4JK9 A;  5AQF A;  3VEX A;  1M90 O;  1Y64 A;  3SV3 A;  4E7I A;  2FBT A;  3TAM A;  3CCS N;  3MEE A;  2CGL A;  5I9E B;  1YIT N;  3T1H K;  4JK7 A;  3CME N;  3L2U A;  3I0S A;  3VER A;  3F73 A;  4FJK A;  3DMJ A;  4YOT A;  3CM6 A;  3CXC M;  2I7P A;  3P1G A;  1VQO N;  1FXX A;  1C0M A;  1GLE G;  4FW1 A;  3D2F B;  2IS3 A;  4Z94 A;  4W5T A;  3AA5 X;  3KLF A;  2O8F A;  5B8H A;  4AHU A;  3CJ7 A;  4JS5 A;  4NCA A;  4CGD A;  2FC0 A;  1GOB A;  2E2P A;  3SQ4 A;  3O08 A;  1WBD A;  4BRE A;  1XNR K;  1IKY A;  2QTD A;  4E89 A;  4IFE A;  4CJT A;  3SAH A;  1NKE A;  4DTO A;  1FKP A;  3I55 N;  3CFR A;  4OKK A;  1UOC A;  1OH5 A;  1VQM N;  4AHR A;  3SUQ A;  3SUP A;  4IDH A;  1O13 A;  4LH4 A;  2OPR A;  4LSN A;  4YDU C;  4AM6 A;  3AV9 A;  1IBM K;  3C6A A;  2IC3 A;  5AQQ A;  4M3R A;  1HRH A;  2FSJ A;  1T44 A;  1BUP A;  4W5N A;  5E26 A;  3BGR A;  4MLH A;  3ENH A;  5AZI B;  3FGU A;  1BI4 A;  3CJ9 A;  1BQM A;  1FW6 A;  5TKW A;  4Q5V A;  4EZ6 A;  4KB0 A;  4OGE A;  3F2K A;  3V4I A;  4F4K A;  3BZC A;  3V1Q A;  4CHY A;  1S3X A;  3D2F A;  4JI2 K;  4CES A;  3CQ8 A;  3S3N A;  3C6U A;  3T69 A;  5BPN A;  4CW7 B;  1Z6R A;  2BGG A;  4UY8 O;  3EZW A;  1VSE A;  2GV9 A;  2X74 A;  5FRM A;  4IDK A;  3HL8 A;  4N5S A;  2OA8 A;  3ZET B;  4DS4 A;  2VQE K;  5A2Q O;  1IH7 A;  3GE1 A;  5AR0 A;  3CCV N;  3VQP A;  4CHO A;  3IAY A;  1ATS A;  3V6D A;  1WSJ A;  4H0O A;  4EP4 A;  4DQS A;  4QS7 A;  1GOA A;  4H8K A;  1X3N A;  4CFC A;  3CPE A;  3SZ2 A;  3RMC A;  1HNW K;  5AZI A;  3O4W A;  3UKR B;  3IG1 A;  4AIL C;  1T6D A;  2KHO A;  1VQ7 N;  3O4Q A;  2HBJ A;  1NBW A;  2GWK A;  4KTW A;  1FK9 A;  4A59 A;  3ENB A;  4EZ9 A;  5AQX A;  3HT3 A;  3AAR A;  4M7X A;  4H5N A;  3QIP A;  5F2R A;  4HCC A;  4FW2 A;  2Y1I A;  5AQJ A;  3VQC A;  3MCA B;  1BL3 A;  4FWN A;  4FXD A;  4J2E A;  1W9H A;  3P5J A;  4FWL A;  3CCQ N;  3OJU A;  4B3T K;  4BE2 A;  5HL7 L;  1SKW A;  1NKB A;  2FF3 B;  4YOV A;  1G99 A;  3A5N C;  4DWI A;  3ZET A;  4EHT A;  1IBK K;  5C25 A;  1ITG A;  4RW6 A;  4DSI A;  4CJV A;  4IG3 A;  3AO4 A;  2HW3 A;  3KHY A;  3LM9 A;  4NYN A;  1X9J A;  3HTV A;  2GX9 A;  4ISG A;  1VQL N;  2A6A A;  4OO1 J;  3SAF A;  4QCL A;  4FWS A;  4BQZ A;  2X6S A;  5BRD A;  4DQR A;  4FJX A;  2XRI A;  1CLQ A;  1DKG D;  2O8E B;  3ZLJ A;  2ZGY A;  3UKR A;  1X9S A;  2XY7 A;  2A1R A;  4B9Q A;  1VQ8 N;  5J2Q A;  1C0G A;  3A5M C;  3KTQ A;  4I7F A;  3S3O A;  1LW0 A;  2XY6 A;  3FE1 A;  2F4V K;  2F8S A;  4ELV A;  1VRT A;  3HP9 A;  4BRQ A;  2HVH A;  4I2P A;  3EKS A; 
#chains in the Genus database with same CATH homology
 1JKH A;  1HMV A;  2KTQ A;  4TSX A;  3I8D A;  3LP3 A;  4CGI A;  3K5M A;  1NK9 A;  1VK0 A;  3NF8 A;  1T7P A;  4Y1D A;  4G1Q A;  1B92 A;  1WSG A;  3TAP A;  3AVA A;  1HQU A;  4DTX A;  2KFZ A;  1UA1 A;  3C95 A;  5J2N A;  1KFS A;  1ZYQ A;  1TL3 A;  1KSP A;  3D45 A;  3OYA A;  4FK4 A;  4QOZ B;  1I3A A;  2DY4 A;  3DOK A;  1NOY A;  1F21 A;  3TAF A;  2RPI A;  1RTD A;  4I9L A;  3NHG A;  1VSF A;  2ETJ A;  3EYZ A;  4W5Q A;  4IBN A;  3HM9 A;  1LAW A;  5HBM A;  4OLA A;  3TWH A;  4AHS A;  1S9G A;  3CFO A;  1KLM A;  3DI6 A;  4CGJ A;  3QEP A;  4L8R B;  2IAJ A;  4AHT A;  3DRS A;  3L8B A;  4J2B A;  4IG0 A;  1ASV A;  3AVF A;  3OVN A;  4CF8 A;  4R5P A;  1TAQ A;  1LAV A;  1ZBF A;  2RKI A;  4W5R A;  3TR8 A;  5HLF A;  1N6Q A;  2QKB A;  4DU1 A;  1LWF A;  3PX6 A;  3RMA A;  3ZT2 A;  2ZD1 A;  1KVB A;  3PO4 A;  1JLF A;  3OS0 A;  2OPP A;  4B9L A;  1S1T A;  1U04 A;  4DFJ A;  4K8X A;  1S5J A;  4FJ7 A;  4Z4F A;  4CFA A;  1ASW A;  1S9E A;  1JLC A;  4KAZ A;  5HRR A;  2QKK A;  3B6P A;  1C1A A;  1WSI A;  1YTA A;  4C8L A;  1YTU A;  4CJF A;  1BCM A;  1NJX A;  5CYQ A;  1VSK A;  5CZ1 A;  3HPO A;  1ZBH A;  3IS9 A;  1Y97 A;  1QSS A;  4CJ3 A;  4FJ5 A;  3SJJ A;  4CJR A;  2OZS A;  1C0U A;  4FK0 A;  2B6A A;  4FZY A;  4F3T A;  3S3M A;  4KRE A;  1A5V A;  1QSL A;  1ASU A;  3AVJ A;  4NYF A;  4PWD A;  4DTN A;  1EXQ A;  3KLE A;  3NH2 A;  2HHW A;  3AVB A;  2OZM A;  3OYC A;  4CJE A;  5FRN A;  1Z26 A;  4CF9 A;  4DSF A;  3AVL A;  1U4B A;  3LAM A;  4DU4 A;  4YNQ A;  5JS1 A;  3QEW A;  4DFP A;  4B8C A;  1QSY A;  5CYM A;  4O44 A;  1KVA A;  4Z4C A;  4KB1 A;  3EY1 A;  3THV A;  4KRF A;  3QEI A;  3LWL A;  2YKM A;  3OS1 A;  1WLJ A;  3KD1 E;  1EKE A;  1K6Y A;  2P51 A;  5CY4 A;  5HRS A;  4BDZ A;  3SPY A;  1D8Y A;  5KTQ A;  2HNY A;  4MQ3 A;  1C1B A;  3LWM A;  4FJJ A;  3OYN A;  4F2S A;  3AVG A;  4CF2 A;  1EP4 A;  3L2V A;  5FDL A;  2QK9 A;  1CZ9 A;  4FVM A;  1C0T A;  2KZZ A;  3OYG A;  1KTQ A;  4Q0B A;  3NFA A;  2VWJ A;  4YFU A;  1VSD A;  4W5O A;  5HP1 A;  3VQ4 A;  4KHW A;  3HVT A;  4CEB A;  4LSL A;  3RR8 A;  1QE1 A;  5K14 A;  3KK2 A;  4M3T A;  3PX4 A;  1HNV A;  1L3T A;  2PYL A;  3U3G A;  3L2Q A;  5EU7 A;  5HRP A;  1RTH A;  3KK1 A;  1VSM A;  4DQQ A;  3ASM A;  3QLH A;  3HP6 A;  3K57 A;  4BE1 A;  4BDP A;  3OYH A;  4JRP A;  4FLY A;  4FLU A;  4DS5 A;  3FFI A;  3ZT4 A;  4CJW A;  3C94 A;  3KLI A;  1VSL A;  5HRN A;  3K5N A;  1NJY A;  1T03 A;  1SL1 A;  1NK4 A;  3LP1 A;  3HST B;  4C8M A;  4FJG A;  1RBV A;  1RT4 A;  3AA3 A;  3NF6 A;  1JLB A;  4I2Q A;  1VSI A;  4M41 A;  4AH9 A;  3PX0 A;  4E3S A;  3RR7 A;  3QER A;  4F8R A;  4ELU A;  1HYV A;  3LAL A;  4KTQ A;  1DLO A;  2G8W A;  3TAB A;  2XHB A;  4DSJ A;  4B9T A;  2VG7 A;  4ID5 A;  4DLE A;  2YHA A;  4EP5 A;  4M3X A;  2B5J A;  3RRG A;  4CED A;  3HO1 A;  3NH1 A;  4M3Y A;  1TAU A;  2A1S A;  5DMR A;  1TK0 A;  1W0H A;  5E41 A;  2HMI A;  4QAG A;  3DYA A;  2ZE2 A;  3KD5 E;  3ZT0 A;  3QEX A;  1UWB A;  2YV0 X;  4MFB A;  1CXU A;  3O4N A;  4CF0 A;  3NBP A;  2KFN A;  1IO2 A;  3LP2 A;  2Z1H A;  1A5X A;  3ZSV A;  1D9F A;  1SL2 A;  1RTI A;  4E7L A;  3OYB A;  2BE2 A;  1QS4 A;  4O55 A;  4CJ4 A;  4LY7 A;  1S1U A;  3OYK A;  3DLH A;  3L2R A;  3B6O A;  1B9D A;  1TVR A;  4E7J A;  1QHT A;  2Z1G A;  4DF8 A;  4KPY A;  3F9K A;  4CEF A;  4DMN A;  2DFE A;  3T19 A;  4JS4 A;  1JLQ A;  4J2A A;  4KTZ A;  3K5O A;  3K2P A;  4H4M A;  1D9D A;  4C8N A;  2E6L A;  1BIS A;  4E19 A;  1NOZ A;  4CFB A;  1SL0 A;  1CXQ A;  1L3S A;  1Q9Y A;  1RIL A;  4FYD A;  4PA1 A;  4FCY A;  1NKC A;  1TKX A;  1S6P A;  1L5U A;  1UA0 A;  4DTU A;  3AVM A;  1QQC A;  1TGO A;  2XY8 A;  3DRR A;  3NE6 A;  1HYZ A;  1S1W A;  4CJU A;  4ZTJ A;  1WSE A;  4DSK A;  4HUE A;  1JLG A;  3WNF A;  4CEO A;  2HVI A;  1WN7 A;  2DFF A;  3RMD A;  1R0A A;  4B3O A;  4OKJ A;  2IGI A;  3MXJ A;  5KGW A;  1S1V A;  3VQ7 A;  3RTV A;  3O3G A;  3V81 A;  1TK8 A;  3UIQ A;  3VQD A;  3DOL A;  4RW4 A;  3HVR A;  1J54 A;  2GUI A;  3L3U A;  3M8Q A;  3LZJ A;  1JLA A;  1T8E A;  3AO5 A;  4FJ9 A;  3KJV A;  5CZ2 A;  2Z1J A;  1BHL A;  3SQ2 A;  4FM0 A;  1RT5 A;  1NK5 A;  1N5Y A;  2G8U A;  2HHX A;  4B9V A;  2QXF A;  1U48 A;  4OKE A;  4DLG A;  1EX4 A;  2I5J A;  4FM1 A;  4B8A B;  3MXI A;  2GBZ A;  2AJQ A;  4FLZ A;  3ZSY A;  4M3W A;  3AO1 A;  5SWM A;  4AHV A;  4FLW A;  2XY5 A;  4JLH A;  4LD0 A;  3ZT1 A;  4FLX A;  3KLH A;  2E4L A;  4M3U A;  2KQ2 A;  4CHN A;  1U45 A;  4CK2 A;  1XI1 A;  4RG8 A;  4FJN A;  3V1R A;  1IKX A;  1RBU A;  4GVM A;  1BIU A;  2HNZ A;  3VQ8 A;  1RT2 A;  3VN5 A;  3BDP A;  2IOC A;  4HHT A;  3CG7 A;  1G15 A;  4DQP A;  3I0R A;  3PUF A;  3O3H A;  4FZZ A;  4FLT A;  1RNH A;  4ELT A;  3OYM A;  1X9M A;  2HND A;  4WE1 A;  2WOM A;  4Z0U A;  3JYT A;  4UQG A;  4N41 A;  3DLR A;  1X9W A;  4FK2 A;  3NF9 A;  3LPT A;  1REV A;  4KO0 A;  4CEC A;  1JXB A;  1RDA A;  5KRT A;  1YVU A;  2VG6 A;  3AVN A;  3QIO A;  3LP0 A;  4H4O A;  3DM2 A;  3MXM A;  1ZBI A;  2R7Y A;  4N56 A;  4KHN A;  2Q3S A;  3JSM A;  3NAE A;  4GMJ B;  4F2R A;  3HJF A;  3O3F A;  3ZSQ A;  2RN2 A;  4DTM A;  4FZX C;  3QO9 A;  2G8F A;  3HXM A;  5J1E A;  3OYL A;  3H08 A;  4B08 A;  2FBX A;  4LH5 A;  1NK6 A;  4E7H A;  3WNE A;  2B4J A;  3V9Z A;  4CJS A;  1J53 A;  2D0A A;  3AO2 A;  1LWE A;  5FRO A;  2ZQB A;  3PO5 A;  3ZCM A;  1LWC A;  3SV3 A;  3DLG A;  4CIG A;  4E7I A;  2FBT A;  3TAM A;  2JGU A;  4CHP A;  4FJH A;  3MEE A;  1D5A A;  4DTJ A;  1S1X A;  3V1O A;  2FBY A;  1EET A;  3CYM A;  5C24 A;  4CIE A;  2G8K A;  3WNG A;  4CJL A;  2ITG A;  2P5O A;  3ZSR A;  1RDB A;  1WSF A;  3VQQ A;  3K59 A;  3L2U A;  4KI6 A;  3I0S A;  3OYI A;  1B9F A;  3SI6 A;  1NK8 A;  2EX3 A;  3F73 A;  4NCB A;  4FJK A;  4Z4G A;  3DMJ A;  3T3F A;  1XHZ A;  3CM6 A;  3P1G A;  1XC9 A;  4CIF A;  1JL2 A;  3AO3 A;  4CJ5 A;  4CK1 A;  1FXX A;  2DTU A;  3QET A;  2HHV A;  1C0M A;  4FW1 A;  4HUF A;  3M8R A;  2HB5 A;  1WAF A;  2IS3 A;  3LAN A;  3AVI A;  3AA5 X;  4W5T A;  5HRO A;  4O0J A;  1BGX T;  3KLF A;  3VA0 A;  3LAK A;  4AHU A;  4JS5 A;  1YT3 A;  4NCA A;  4CGD A;  2OPQ A;  3SUO A;  2FC0 A;  1GOB A;  2BDP A;  3SQ4 A;  2YNG A;  1C1C A;  4CEA A;  2D0C A;  3NGI A;  3ULD A;  3QEV A;  1RT7 A;  1IKY A;  4CGH A;  4OJR A;  3VQ6 A;  4E89 A;  2RF2 A;  3SYZ A;  4CJT A;  2YHB A;  2Y1J A;  1NKE A;  4FJM A;  4DTO A;  1FKP A;  4E1M A;  1RTJ A;  3CFR A;  5C42 A;  4OKK A;  1UOC A;  2JLE A;  3AVK A;  3KKS A;  4BDY A;  4Y1C A;  4E0D A;  4FJ8 A;  3IRX A;  2P5G A;  4AHR A;  2VWK A;  3MEG A;  3HK2 A;  3SUQ A;  3SUP A;  1RT1 A;  2O4G A;  4N47 A;  4DSL A;  4LH4 A;  4BAC A;  2OPR A;  3VA3 A;  4BWM A;  3AVC A;  4KFB A;  4KHU A;  4I9Q A;  2D5R A;  1JLE A;  4LSN A;  4FJI A;  3L3V A;  1TL1 A;  4C8O A;  3AV9 A;  3SCX A;  1HJR A;  2IC3 A;  3LZI A;  3EZ5 A;  4M3R A;  4DFK A;  1HRH A;  1T05 A;  4Z4I A;  4Z4H A;  4ID1 A;  1J9A A;  1RBS A;  4DG1 A;  2PZS A;  3RMB A;  4OLB A;  4W5N A;  3P83 D;  3BGR A;  4E7K A;  1BI4 A;  4IFY A;  4B9S A;  4BE0 A;  5JS2 A;  1BQM A;  3VQ5 A;  4HCB A;  4Q5V A;  4CK3 A;  3D0P A;  3CFP A;  3OYF A;  4EZ6 A;  1HQE A;  1RDC A;  3AVH A;  3E01 A;  3RRH A;  1X1P A;  3SQ0 A;  4KB0 A;  3HPG A;  2PY5 A;  2KZM A;  2Z1I A;  4OGE A;  1BCO A;  3QIN A;  4HTU A;  3V4I A;  3CM5 A;  3DRP A;  3G10 A;  1SKS A;  3G0Z A;  3LPU A;  4F4K A;  1DTT A;  3V1Q A;  4CHY A;  5J2P A;  1LV5 A;  3DLK A;  4O0I A;  4CES A;  1DTQ A;  1RT3 A;  2F96 A;  4CJK A;  3CQ8 A;  2G8V A;  3S3N A;  4CEZ A;  3C6U A;  2XO7 A;  1KLN A;  4KHY A;  1C6V A;  3HYF A;  3S9H A;  1Q9X A;  3TAR A;  4DQI A;  1WNS A;  2OYQ A;  2BGG A;  1VSE A;  2GV9 A;  2X74 A;  1TKZ A;  5FRM A;  1RBR A;  1ZBU A;  2IDO A;  4JRQ A;  4BWJ A;  1SKR A;  4ZTF A;  1LW2 A;  4IDK A;  3HL8 A;  4N5S A;  1SUQ A;  4O4G A;  3OYJ A;  3L2W A;  4DTR A;  3K58 A;  2OA8 A;  4DTS A;  4DS4 A;  2YNH A;  2OPS A;  3C6T A;  4RW7 A;  4OPJ A;  1WSH A;  3M8S A;  1UAX A;  5DK5 A;  4AHC A;  3NDK A;  3SPZ A;  1IH7 A;  1ZBL A;  1GOC A;  3VQP A;  4CHO A;  4DU3 A;  2W42 A;  4C8K A;  3IAY A;  3ZSW A;  4FM2 A;  3TAN A;  3V6D A;  1WSJ A;  4CF1 A;  1XWL A;  4OVL A;  4ZHR A;  3OYE A;  4EP4 A;  4DQS A;  1JXE A;  3SQ1 A;  2O4I A;  2LSN A;  4E1N A;  1GOA A;  4B9N A;  4H8K A;  4CFD A;  1I39 A;  1NK7 A;  4KI4 A;  4M45 A;  1Z25 A;  4KV8 A;  4CFC A;  1O1W A;  4CEQ A;  4CGG A;  3OY9 A;  3KK3 A;  3OJS A;  4PUO A;  4IKF A;  3SZ2 A;  3ZSX A;  4KHS A;  3RMC A;  3TI0 A;  2YNF A;  4CEE A;  4KHQ A;  3MED A;  1MU2 A;  4CGF A;  4NCG A;  4N76 A;  5D3G A;  4XIU A;  3V9S A;  3IG1 A;  5J2M A;  4AIL C;  1IG9 A;  4DF4 A;  3HPH A;  1RT6 A;  3KLG A;  2G8H A;  4CJP A;  1IKV A;  2DFH A;  2X6N A;  1CZB A;  3O4Q A;  3OYD A;  4KTW A;  4CCH A;  1FK9 A;  1JL1 A;  3SV4 A;  3QES A;  4RW9 A;  3ZSZ A;  1KCF A;  5KGX A;  4B9U A;  4B9M A;  4EZ9 A;  3HT3 A;  1U47 A;  2HHS A;  3ALY A;  4DSE A;  3QNN A;  5T7B A;  4RW8 A;  1RCH A;  4ICL A;  3TAE A;  3SNN A;  1TK5 A;  5SZT A;  1J5O A;  1BI4 B;  1KVC A;  3DLB A;  2BAN A;  3RWU A;  3QIP A;  1BIZ A;  4HCC A;  4FW2 A;  3TAQ A;  2Y1I A;  1S6Q A;  3VQC A;  1BL3 A;  4FXD A;  1HPZ A;  1HYS A;  4IFV A;  3VQB A;  4J2E A;  1W9H A;  3P5J A;  4OPK A;  3V9X A;  2F8T A;  3OJU A;  2KW4 A;  3SUN A;  4BE2 A;  4GW6 A;  5KI6 A;  3ISN C;  4CHQ A;  4CHZ A;  4OGC A;  1SKW A;  1KRP A;  1TKD A;  1NKB A;  3AA4 A;  3V9U A;  3AA2 A;  3ZT3 A;  2FBV A;  1NJZ A;  4FJL A;  1VSH A;  3VQE A;  4DWI A;  1L3V A;  3NGZ A;  1QTM A;  2PYJ A;  2EHG A;  4DFM A;  1L3U A;  4K8Z A;  5C25 A;  3NH0 A;  3V9W A;  4PQU A;  1TKT A;  2X78 A;  3ITH A;  4CJQ A;  5I42 A;  1ITG A;  3MEC A;  1TV6 A;  4RW6 A;  3QNO A;  4DSI A;  4F3O A;  4CJV A;  1XHX A;  4Z4E A;  2HHT A;  4IG3 A;  2VG5 A;  3AO4 A;  4M3Z A;  2HW3 A;  2HHQ A;  1RBT A;  3NCI A;  2HHU A;  2YNI A;  1VSJ A;  4NYN A;  3VQ9 A;  3U6F A;  1VRU A;  3KIO A;  3KKR A;  1KFD A;  4QCL A;  2E6M A;  1NJW A;  4DQR A;  2X6S A;  4CER A;  1SV5 A;  4FJX A;  2XRI A;  1CLQ A;  1BQN A;  3T1A A;  2D0B A;  4KKO A;  4HVJ A;  4O5B A;  3LDS A;  4DTP A;  1X9S A;  2XY7 A;  2YKN A;  2A1R A;  3PV8 A;  5I3U A;  3WNH A;  2P1J A;  5J2Q A;  3KTQ A;  4M42 A;  1WAJ A;  1Q8I A;  4I7F A;  3MAQ A;  3NF7 A;  3ZSO A;  3K5L A;  3S3O A;  1LW0 A;  3DLE A;  4FLV A;  4J2D A;  1HNI A;  3PY8 A;  3OS2 A;  2XY6 A;  3NGY A;  1NK0 A;  2ATQ A;  2G8I A;  4PY5 A;  3TAG A;  1FKO A;  3U3Y A;  2F8S A;  5KRS A;  4ELV A;  1U49 A;  1VRT A;  1RDD A;  1A5W A;  1IKW A;  3VQA A;  3M8P A;  3HP9 A;  2NUB A;  2HVH A;  2WON A;  4HUG A;  4I2P A;  3A2F A;  4CE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...