1BI4A

Catalytic domain of hiv-1 integrase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
molecule keywords INTEGRASE
total genus 42
structure length 142
sequence length 152
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bi4A00
3AVKA 4KHSA 3CFOA 3RMCA 1RCHA 4F3TA 2KZZA 3TI0A 2Y1IA 3OYMA 1RT2A 2IGIA 3VQQA 4RW7A 4O5BA 4DTNA 3SQ2A 3SPZA 4FCYA 2G8FA 4PY5A 3TR8A 3AVGA 3G0ZA 4Q5VA 4AHCA 3E01A 3QERA 3U3YA 3AVAA 3NF7A 4CEFA 3NBPA 1EKEA 2VG5A 2XRIA 4KHQA 4M3ZA 3TARA 1HYSA 1NKCA 1GOCA 3SQ0A 3OYAA 4C8NA 3SCXA 3U6FA 4Z4FA 4DS5A 2HHQA 4DSEA 2ZQBA 1U47A 3CG7A 3HPOA 1RTJA 1VK0A 4BWJA 1RBUA 2P5OA 1IH7A 1IKVA 4IFYA 4OGCA 4FK4A 1JLQA 1RT3A 4FLZA 1U49A 2D0BA 3OYEA 3AVJA 1IO2A 1TKZA 4CJLA 4CIEA 4CK3A 4FZYA 4N76A 4CIFA 3QIPA 1KCFA 1EP4A 2HHWA 3AO5A 4Z4GA 4I2QA 1BHLA 4CK1A 4KRFA 4CEQA 1SKRA 3NF6A 1WLJA 2HB5A 3A2FA 3LP0A 4AHUA 5KRSA 2JGUA 1FKOA 3PX6A 4NCBA 1ZBIA 1WN7A 4F2SA 2F8SA 4GVMA 4BE0A 3SJJA 4JS5A 3T19A 1QSYA 4CJUA 5C42A 5C24A 2P51A 1KLMA 4KAZA 1S5JA 3HP6A 3L2WA 3AA4A 2BDPA 3ZT0A 3QEWA 4HCBA 1HYZA 1JLBA 3KLHA 1BI4A 1RBSA 1BISA 2QK9A 3SYZA 1L3UA 3KJVA 4B9SA 4FK0A 4AH9A 1DLOA 3LPUA 2XY8A 2E6LA 3AVFA 4CFCA 5KTQA 4DTRA 1A5WA 1WNSA 3DLHA 1DTTA 4IKFA 1Z25A 4CE9A 4DG1A 5KGWA 4ELTA 3L2QA 2B6AA 2DTUA 2Q3SA 4Y1DA 3L3VA 4M3TA 4KHYA 1HPZA 2EX3A 3ITHA 4CK2A 4E7IA 3O4QA 2A1RA 4Y1CA 1RDDA 3NF9A 4N5SA 4B9MA 2OZSA 1CZ9A 1IKYA 5J2NA 4KV8A 4IBNA 1QTMA 4E0DA 5J2PA 3AA5X 3HPGA 1NJWA 3DI6A 4DF8A 4LD0A 4RW6A 4FW2A 4IG0A 4M3XA 4B9VA 4KO0A 4ZTFA 3LP2A 3OS2A 3TANA 1SKWA 3D0PA 4JRPA 3M8SA 2XY6A 2KFNA 4MQ3A 1RT6A 3HT3A 3OYKA 3V9SA 4I2PA 1UA1A 1NJYA 2GUIA 3PO4A 4N56A 1Y97A 1RT1A 5SWMA 3BGRA 4CHZA 4CEBA 4NYFA 4OPJA 2EHGA 1IKWA 2F8TA 3V1QA 5DMRA 1NJZA 2FBYA 3ALYA 4KHWA 3QEVA 3LWMA 4KKOA 4OGEA 1NJXA 1EX4A 1HJRA 2YKMA 1KTQA 1FXXA 1BGXT 4I7FA 3HVTA 3DLBA 4HTUA 1CXUA 4HUFA 2KQ2A 1TKDA 3KLGA 4BDPA 4XIUA 3VQPA 3QEPA 4CF9A 1WSJA 3QEIA 1ASWA 4HVJA 3RWUA 2XY5A 1CXQA 4DQRA 1KVAA 1X9MA 1TK8A 4DWIA 1RILA 4B8CA 3L3UA 5JS2A 3LALA 4CGGA 3AVNA 1JLEA 2HVIA 1KFSA 3KD1E 4WE1A 1KVCA 2OPPA 1U4BA 5J2MA 3AO3A 4HUEA 2ZD1A 1VSMA 4H4OA 4CJQA 2PYLA 4I9LA 2W42A 2WOMA 1XI1A 1TK5A 3JSMA 2G8IA 1TV6A 3MECA 4DF4A 3PY8A 3V9XA 4F3OA 4QOZB 4E7KA 1SUQA 3P1GA 3AVMA 1WAJA 5HBMA 3ZSOA 4B8AB 4R5PA 3PV8A 1S9EA 3AO2A 4CEEA 4E7LA 1U48A 4KB1A 5C25A 2KZMA 4RW8A 4J2EA 3HP9A 5CYMA 1VRTA 3G10A 3UIQA 3ZSQA 2RN2A 3V9WA 1JLAA 1TAUA 4CEDA 4FJGA 5CZ1A 3VQAA 1I39A 3QNNA 3RTVA 4B9TA 1TKTA 3TAPA 3VQ8A 3AA3A 2KTQA 2YHAA 3HSTB 2IDOA 2YNHA 2FBXA 4TSXA 3M8QA 1ASVA 1ZBLA 1SL2A 1JLCA 4DSJA 1C1BA 2Z1GA 5SZTA 4FM2A 4FLVA 1D8YA 3KLIA 1C0TA 3AVBA 1L3SA 3BDPA 4C8MA 1J9AA 1C0UA 4Z4HA 3C6UA 3MEGA 4J2BA 4DFPA 2Y1JA 4O4GA 3I0SA 1TGOA 4JLHA 5FRNA 3DOLA 4CF1A 5K14A 3CM5A 3HL8A 4CGHA 1L3VA 1RDCA 3LANA 1WSEA 4DTJA 3S3MA 4FJNA 1YTUA 4ID1A 2HVHA 4FZXC 1S6PA 1UWBA 1XC9A 4KTWA 1FKPA 4AHTA 3OYGA 1YT3A 1ZBFA 2HHTA 3MXMA 2PYJA 1CLQA 1HQEA 3KK3A 4M41A 3OYJA 4FK2A 4DLEA 4FLXA 2QXFA 4DU4A 1X9WA 2IAJA 4O55A 3V6DA 3LZJA 1VSIA 3OJSA 1N5YA 4JS4A 3NGZA 3KK1A 1KLNA 4L8RB 3JYTA 4FJJA 1ZBHA 1S1TA 1B9FA 3QNOA 4ZHRA 5E41A 2HNYA 3CFPA 4KHUA 3HJFA 1LWCA 3SQ1A 1NK6A 4FJ5A 4AHVA 3CYMA 3KLEA 3SZ2A 1EXQA 1WAFA 2AJQA 1T05A 2HNZA 4CHQA 3LP1A 3IS9A 4QAGA 4CHYA 1NK0A 4C8KA 4CJVA 4Q0BA 4OKJA 3ZSRA 2OA8A 1TL1A 4K8ZA 1RBTA 3IG1A 3C95A 4B08A 3THVA 4HUGA 3SUOA 2OYQA 1D9DA 3AVCA 1BQMA 2E4LA 4CF0A 2A1SA 2B4JA 1BL3A 3ZCMA 4M3UA 4FM1A 2NUBA 1UA0A 4M42A 1JLFA 4DSLA 4PUOA 1RBRA 2R7YA 3MEDA 1T03A 5DK5A 3K5OA 3V81A 1JXEA 4H4MA 4DTSA 5J2QA 1C1CA 5CY4A 4CJEA 4EP4A 2ETJA 3P5JA 3LDSA 3PUFA 1A5VA 3MEEA 3VQDA 3WNHA 3DMJA 3LAKA 3F73A 1Z26A 2PY5A 1A5XA 1BQNA 1CZBA 2DFEA 3LWLA 3ZSZA 3LP3A 2G8HA 2QKKA 2RPIA 3ZSVA 3TAMA 4CJ3A 4DU1A 3SUNA 4LSLA 3RMBA 4KB0A 2X74A 2OPSA 3WNFA 3OS1A 3TAGA 1T8EA 1QSLA 4FVMA 1VSHA 2FBTA 4OLAA 1L3TA 4CECA 1BIZA 2YKNA 3NH1A 3MXIA 4DSFA 3ULDA 1VSFA 3ZSWA 4Z4IA 1ITGA 3AO4A 1NKBA 1RDAA 4M3WA 4CJ4A 2HW3A 5KI6A 3L2UA 3O4NA 4DSKA 4DFMA 1O1WA 1C0MA 3KKRA 4B9UA 3ISNC 1Q9YA 1X1PA 4CJTA 4CJKA 3TABA 4ELUA 4HHTA 2GV9A 4DTUA 4DTPA 4KTZA 2G8UA 2YNGA 5FROA 5JS1A 2YHBA 3TWHA 3C94A 3K2PA 1REVA 4Z0UA 4BE2A 4I9QA 4CGJA 1R0AA 4PQUA 4W5OA 4OLBA 4QCLA 4CGDA 4FJXA 3HXMA 2YNIA 3OYHA 2P5GA 2VWJA 3VA0A 4BDYA 2G8WA 2D5RA 3SUPA 3NFAA 4DFKA 1TL3A 3SQ4A 2HMIA 3PX0A 5CZ2A 3TAQA 4CGFA 4N41A 3S3NA 4DQPA 4UQGA 3S9HA 4FLYA 4C8LA 4F4KA 3VQEA 3K59A 5FRMA 4LH4A 1UAXA 3VQ9A 4H8KA 3O3HA 1RTDA 2VWKA 1NOYA 1QSSA 1TVRA 4FYDA 1BCOA 3D45A 4ELVA 1KSPA 4LH5A 1U04A 4ICLA 4CFDA 1HYVA 3DLEA 3DLRA 3LPTA 4O0IA 4BE1A 3SV4A 2RF2A 2YV0X 1NK7A 2HHVA 1S1XA 3LAMA 1SL1A 2XHBA 4F8RA 4DTMA 4E89A 4O44A 4CF2A 4CIGA 2I5JA 2O4GA 1RNHA 3QESA 3AVHA 2BGGA 3DRPA 4F2RA 4E1NA 3B6PA 1DTQA 4CF8A 4EP5A 4LY7A 5KRTA 3RRHA 1LW2A 3HM9A 4E7JA 3RRGA 1UOCA 3ZSYA 3O3GA 3NE6A 1U45A 1XHZA 3OS0A 1XWLA 2GBZA 4M3YA 2ZE2A 3WNEA 1Q8IA 1RT5A 3OYCA 4CHNA 3KIOA 3P83D 4CFBA 2IOCA 2Z1JA 3FFIA 1L5UA 3KK2A 3L2VA 4CFAA 3KKSA 2HHXA 1RT7A 3OYBA 2G8KA 5HP1A 3V4IA 4CGIA 4B9NA 3K5LA 4CJPA 2D0AA 3KTQA 1B9DA 3F9KA 4RG8A 3EY1A 3OY9A 4FM0A 4FLUA 1ZYQA 1GOAA 4W5RA 4FJ8A 1JKHA 4FJMA 4OJRA 1NK5A 2D0CA 1NK9A 4KHNA 1RTIA 2X6NA 4CEAA 1VSDA 3NH0A 2G8VA 3OYDA 1LWFA 4CESA 4CJWA 1SL0A 4GW6A 4CJFA 2IC3A 3QINA 1NKEA 4K8XA 3L2RA 3DYAA 4MFBA 3NHGA 4N47A 3K57A 3SNNA 1TK0A 3HK2A 2DY4A 5HRRA 3ZT3A 3NCIA 1XHXA 5I42A 2WONA 4YFUA 4DQIA 2LSNA 1ASUA 5HRNA 3ZT2A 3OYFA 3DRRA 3QO9A 3QLHA 1VRUA 3M8RA 4BACA 3QETA 1EETA 3V1OA 4OKKA 4C8OA 3T3FA 3VQ4A 3AA2A 3NGYA 2ITGA 3HPHA 3VQ5A 4LSNA 3SI6A 3AVIA 4M45A 4AHSA 4DSIA 3MAQA 4OVLA 3B6OA 4IDKA 3V9ZA 3IAYA 3NF8A 4AILC 4FJLA 3VQCA 2OPQA 3WNGA 2X78A 1LW0A 3RMDA 4NCAA 1JXBA 1K6YA 4EZ6A 3CQ8A 3OVNA 3OJUA 1KVBA 4CEZA 4IG3A 2O4IA 3TAFA 1Q9XA 1S1UA 4B3OA 2OPRA 3DLKA 1HMVA 3VQBA 1JL1A 1GOBA 3EZ5A 1FK9A 1G15A 2DFFA 4DTXA 2IS3A 3RMAA 3KD5E 3SV3A 2HHSA 4PA1A 1RBVA 4FLWA 4FJIA 3S3OA 3DM2A 1QE1A 3DRSA 3L8BA 4B9LA 4OKEA 4AHRA 2XO7A 4KI4A 3SUQA 3VN5A 4FJKA 2KFZA 1IG9A 1RTHA 1VSJA 4ID5A 5HRPA 3CM6A 4J2DA 4DLGA 1J54A 4YNQA 3ZT4A 1NK4A 1X9SA 2VG7A 2PZSA 1LAVA 3QEXA 4NCGA 4W5TA 4W5QA 3NAEA 5EU7A 3HVRA 2KW4A 4CHOA 4CJSA 1S1VA 2Z1HA 4G1QA 4CJ5A 3VA3A 1WSGA 1J53A 1W9HA 1KFDA 4KFBA 5HROA 1N6QA 4OPKA 3DLGA 3K5MA 2BE2A 4FJHA 3SPYA 3MXJA 3VQ6A 3AV9A 3DOKA 3ASMA 1BCMA 1B92A 4E19A 1HNIA 3OYIA 3CFRA 1YVUA 3I8DA 5HRSA 1S9GA 1TAQA 4FLTA 5KGXA 3LZIA 3ZT1A 4FJ7A 4Z4CA 3OYLA 5HLFA 4GMJB 1LV5A 1IKXA 2JLEA 1W0HA 1HQUA 5I3UA 3NDKA 4Z4EA 3I0RA 1WSHA 3HYFA 3K5NA 4PWDA 4CCHA 3RR7A 4RW4A 3KLFA 2YNFA 2ATQA 4E1MA 1T7PA 3IRXA 1TKXA 1JL2A 3RR8A 1HNVA 4DS4A 1D9FA 3K58A 4DQQA 1WSFA 4M3RA 3TAEA 3PX4A 1JLGA 4CHPA 2BANA 2F96A 4ZTJA 4FJ9A 1RDBA 2HNDA 5T7BA 4DFJA 3O3FA 3V9UA 3AVLA 2E6MA 2RKIA 1VSLA 4KTQA 1LAWA 3C6TA 3H08A 5J1EA 4FXDA 3AO1A 3HO1A 4BDZA 4BWMA 3T1AA 3M8PA 1I3AA 3OYNA 4IFVA 1QQCA 1WSIA 2P1JA 3PO5A 4DU3A 4JRQA 1SKSA 4DTOA 4KREA 1F21A 4O0JA 2XY7A 4EZ9A 2X6SA 3QIOA 2VG6A 1VSEA 1J5OA 4CEOA 4DQSA 4W5NA 1S1WA 5FDLA 1QHTA 1QS4A 5CYQA 3U3GA 2Z1IA 3VQ7A 2B5JA 3V1RA 4FW1A 3NH2A 4KPYA 4KI6A 1NK8A 4FZZA 1RT4A 1NOZA 1BIUA 1VSKA 3NGIA 1C6VA 4CJRA 1C1AA 1SV5A 1MU2A 2DFHA 4RW9A 3EYZA 1S6QA 4E3SA 1KRPA 2FBVA 1LWEA 2OZMA 2FC0A 4CERA 1ZBUA 4DMNA 4HCCA 2QKBA 1HRHA 1BI4B 4E7HA 4J2AA 3ZSXA 5D3GA 4NYNA 2HHUA 1YTAA 1D5AA
chains in the Genus database with same CATH superfamily
2VGMA 3VEWA 2KZZA 4JK9A 3VQQA 4CJ7A 4RW7A 2G8FA 1E4FT 3TR8A 4Q5VA 2CGJA 5KPZA 3TARA 4XEIA 3SCXA 4FL9A 4AM6A 2KLAA 4BWJA 4OO1J 2P5OA 1GLCG 3E66A 3ENHA 5E84A 2BTFA 3CHWA 2YHYA 4FWMA 4KH4A 4CK3A 4N76A 1NGGA 5BRHA 1KCFA 4H5RA 3TSUA 2E1ZA 2F7TA 3FZLA 4CK1A 2QW9A 4PKHA 1SKRA 1WLJA 4NCBA 4WFAL 4CI6A 3SJJA 1VQ9N 5C42A 5C24A 3THWB 1YAGA 3AA4A 1E4GT 4LF8K 2JWKA 3A5OC 1BISA 1DLOA 1IJJA 4H03B 5EOYA 2ASMA 4H5WA 3TU5A 3L2QA 2B6AA 1VQ8N 4KHYA 2EX3A 5AQJA 3O4QA 2E2OA 5AZIA 1P90A 3NF9A 2OZSA 4PKGA 1QTMA 3HPGA 3DI6A 3VMFB 4DF8A 1VQNN 5LJVA 4ZTFA 3P31A 2O8BA 2PBDA 4JRPA 1OH7A 3J8AA 3CJ9A 2YHXA 4FPAA 3V9SA 1UA1A 3SBGA 3D2EB 5AQGA 3BGRA 4JKGB 4CZEA 3H45C 4CEBA 4LF4K 4CZFA 1NJZA 2FBYA 3ALYA 4WYBA 3OHRA 1NJXA 1FXXA 4BC5A 5M1QA 4IOXA 4XIUA 3VQPA 4HVJA 4DV4K 3H3NO 1RILA 3OTOK 2O8CB 4B8CA 1C0FA 3LALA 4CGGA 1NJIO 5KPRA 4QS9A 2OPPA 3R6MA 3ZX0A 4K41A 1BU6O 4DV2K 3ID8A 3WQUA 4OPHA 1TK5A 4IDHA 5C2FA 4F3OA 3P1GA 5HBMA 3ZETA 4Z4FA 2P9SA 4RW8A 1S22A 3V9WA 3I55N 1GLAG 4WFBL 3VQAA 1I39A 3C6HA 3RTVA 1NGCA 3TAPA 3SAHA 4JKAA 2FBXA 1ZBLA 1SL2A 4DSJA 1C1BA 3DWLA 3U4LA 4ISFA 2ZJQL 1J9AA 1C0UA 4IXCA 4LFBK 3MEGA 1EO1A 4OX9K 4WQ5C 3BF1A 4LC9B 3CM5A 5M1NA 3OA9A 5AQWA 4CGHA 1L3VA 3T69A 5AQSA 2ITMA 4FZXC 1K73O 2PYJA 5LMNK 3O08A 2IAJA 2VQEK 1KC8O 3R3LA 1ESVA 3NGZA 2YI1A 4XH4A 1KLNA 1YXQA 4LF5K 1ZBHA 1JCEA 1S1TA 2PAVA 2Q31A 3P4IA 4DR4K 3HJFA 1I94K 4FJ5A 4OPAA 3WUHA 1T05A 1RFQA 2HNZA 4CHQA 2CGLA 4Q0BA 3ZSRA 1TL1A 1ATRA 4GKKK 2P9KB 4B08A 3THVA 4HUGA 5FLXO 1D9DA 2UU9K 4BRQA 3ZCMA 2NUBA 4M42A 3EE9A 4DSLA 3CJBA 3FZKA 3K5OA 4B3RK 1JXEA 4DTSA 1SAZA 1C1CA 3CJ7A 3FE1A 1VQLN 2PY5A 3OBYA 2DFEA 2A41A 2D1KA 2QKKA 3ZSVA 4H0TB 3TAMA 4CJ3A 4DU1A 3RMBA 1JCFA 2OPSA 3OS1A 1QSLA 1DGKN 1VSHA 1L3TA 3WEEA 3ZSWA 5KI6A 4DSKA 1M1KO 4DFMA 5F2RA 1S3XA 3WT0A 4H0XB 4KTZA 5JS1A 3C94A 4BE2A 1M90O 1R0AA 4OLBA 2HF3A 4IOAL 4BRIA 4DFKA 3O5BA 3SQ4A 3WXJA 3PX0A 3S3NA 5AQOA 4DR5K 2WC9A 4BRKA 4FSVA 1RTDA 1QSSA 3KK7A 2VWKA 4M7YA 3UKRA 4O5FA 1BCOA 3D45A 1BOTO 2DPNA 4CFDA 4J2BA 4Y0WA 3DLEA 4NXNK 1NK7A 1S1XA 3TSPA 3CCUN 3DXMB 3EZWA 4O44A 5IT9O 4CF2A 4L3QA 4BR7A 2QA4N 4CF8A 4EP5A 4LY7A 5AQHA 4M63C 4BQZA 1UOCA 1J5EK 1XHZA 3G25A 1XWLA 3OS0A 3J7ZO 4CHNA 3P83D 3FFIA 3WXMB 2HHXA 2G8KA 4YY3K 5HP1A 3V4IA 4CGIA 3DLLL 1VQ4N 1P8ZA 2D0AA 1N34K 3F9KA 4RG8A 4FLUA 3R8EA 4W5RA 1JKHA 4BGAA 4X65K 4CEAA 2X6NA 1VSDA 3NH0A 2G8VA 5JMVA 3OYDA 4GY2B 3O9QA 3LDLA 3MN7A 2IC3A 3QINA 1NGBA 3HK2A 2QEXN 2O8FA 3ULEB 2YJFA 3CPWM 3OYFA 3MWPA 3QLHA 3QETA 5C0YA 1NGIA 3M8RA 3K9KA 1EETA 3V1OA 4ISEA 3VQ5A 4LSNA 2OANA 4M45A 4OVLA 4FJLA 4C1NI 1W2BM 3WXLA 1LW0A 5KPTA 4EZ6A 4PKIA 3CQ8A 1XNRK 4CEZA 3K0SA 2OTLN 2Q0UA 1HMVA 3UB5A 1JL1A 3ZLJA 1FK9A 2DFFA 3RMAA 1RBVA 4WQ4A 3DRSA 4BY9C 3GG4A 4CD1A 4FJKA 1RTHA 5TKYA 3EEQA 1NK4A 5AFUA 3QEXA 4NCGA 4W5TA 2KW4A 4G1QA 5HROA 1J53A 4B3SK 1KFDA 1N6QA 3SBTA 3MXJA 3VQ6A 3AV9A 3DOKA 3OYIA 1YVUA 4DV1K 1X9JA 1TAQA 4PL8A 3TTFA 3LZIA 4MDAA 3HOTA 4M7XA 5AR0A 3CF5L 4GMJB 4CVNE 1IKXA 2QWRA 1K8KB 3NDKA 3I0RA 3O1BA 3ATVA 3HYFA 3RR7A 3KLFA 4JV5K 3ENBA 4E1MA 4EIAA 2H3GX 3HTVA 1JL2A 2VYPA 1GLBG 3K58A 4DQQA 4FO0A 4H5VA 4A5AA 4DUYK 3CCMN 4E1JA 2HNDA 5T7BA 3V9UA 3AVLA 1LAWA 4BDZA 1MWMA 3W3DA 3M8PA 1I3AA 3R1XA 2P1JA 1FJGK 4O0JA 2VG6A 1VSEA 5FDLA 1QHTA 3V1RA 4FW1A 1NMDA 2D0PA 1RT4A 1KAZA 1BIUA 1C6VA 2HF4A 4CJRA 4RW9A 1MU2A 3BP8A 4JI2K 3ULEA 3EYZA 2FC0A 4CERA 4FWSA 2OTJN 1MWKA 3ZSXA 1N36K 3U9DA 4NYNA 3RMDA 3AVKA 5AZJA 3OYMA 1RT2A 3VESA 4A2BA 1K8AO 3CCVN 3SPZA 4PY5A 2ZGZA 3AVGA 3UKUB 2F9TA 3G0ZA 1XMQK 3MCPA 5AQMA 4M3ZA 4MO5A 1GOCA 4JKHA 2IVNA 3RSEB 4DSEA 3VEYA 4B9QA 3CG7A 4NXMK 1RBUA 4BRMA 1IKVA 3BEXA 4IFYA 1BWFO 3FLCO 1JLQA 4PHTX 4B1YB 1IO2A 4CJLA 4CIEA 3H1QA 3SJHA 2IIRA 3MCAB 4I2QA 3E9PA 5JLHA 4CEQA 4C23A 1SZ2A 3LP0A 4AHUA 2JGUA 1FKOA 3ZETB 1OH5A 4F2SA 4GVMA 5F1XA 3T19A 5BR8K 4CJUA 2NRTA 2P51A 3HOSA 1S5JA 3HP6A 2BDPA 1GLLO 4H0PA 3ZT0A 3QEWA 4HCBA 1HYZA 1JLBA 2Q1NA 1RBSA 3JAMO 4FK0A 3ZX3A 4DKWA 2E6LA 2W6LA 1WNSA 1N8RO 3DLHA 4CE9A 3O9UA 4DG1A 4ELTA 3QMLA 4WQ5A 2Q3SA 2DTUA 1HPMA 1HPZA 4E7IA 4CK2A 2A1RA 5AQXA 1IG8A 5KQ8A 4N5SA 4CZHA 1CZ9A 4XH5A 3M1FA 4KV8A 4IBNA 4CZKA 4EFHA 2YCHA 4YORA 4JI6K 5J2PA 2I7PA 4RW6A 3D6RA 4A61A 4B9VA 4KO0A 3AGRA 1GLFO 3OS2A 1XMOK 3M8SA 2XY6A 1E3MA 1ZBSA 2CH5A 4HWIA 3OYKA 1NJYA 3W0LA 3PO4A 2GUIA 3WXKA 1RT1A 4NYFA 3PIPL 4IZ9A 2F8TA 3WXIA 3LWMA 4OGEA 1HJRA 4I7FA 4IO9L 2KQ2A 3KLGA 4BDPA 3R9PA 3QEPA 4CF9A 2O8DA 2XY5A 1CXQA 1X9MA 1TK8A 4KH6A 3LDNA 5JS2A 3AVNA 1KFSA 2CGKA 4WE1A 2WUSA 2GELA 4H4OA 1VSMA 2PYLA 4I9LA 2G8IA 2QWMA 3CQXA 4QOZB 4E7KA 1SUQA 5AQZA 3AVMA 1WAJA 1S9EA 2KZMA 2QWPA 2NLXA 5C25A 3HP9A 5CYMA 3THWA 1VRTA 4K43A 3UIQA 2RN2A 5CZ1A 3QNNA 1HKBA 4PL7A 2P9LA 3A5LC 3AA3A 4WFNL 1X3MA 3C7NA 3HSTB 1Z05A 3M8QA 3TSQA 3KLIA 3AVBA 4C8MA 4YOXA 4DFPA 2Y1JA 1OVQA 3I0SA 5M1KA 1WOQA 3MDQA 3A0IX 4BVPA 3GDQA 4CF1A 3HL8A 4DTJA 3RSEA 4ID1A 4DV6K 5A2QO 2HVHA 3TPQA 1UWBA 4KTWA 3OYGA 2P9PB 1ZBFA 3CD6N 3KK3A 3DJCA 3IKMA 4FLXA 1X9WA 3NMUA 3UKRB 1VSIA 1N5YA 3KK1A 4L8RB 3JYTA 4FJJA 5F0XA 4LFAK 3D2EA 4BGBA 2V52B 3SQ1A 3OW2M 2AJQA 5FPDA 4QAGA 4CJVA 4OKJA 1W97L 3MX5A 4CD3A 4CBWA 1YUWA 3J81O 3AVCA 2E4LA 4CF0A 2IVOA 2A1SA 4CBUA 1JLFA 5AZIB 4BRNA 2QI2A 2R7YA 4DV3K 4IJNA 1T03A 5J2QA 3ZX2A 3PUFA 2AA4A 1GLEG 1Z26A 1A5XA 1BQNA 1HNZK 2G8HA 3SUNA 1HR0K 4KB0A 4GKJK 2X74A 3O1WA 5AQVA 4DHYA 1MA9B 2E2QA 5C2DA 1XUPO 4FVMA 1T8EA 2YKNA 3NH1A 4DSFA 3ULDA 1VSFA 4Z4IA 4M3WA 1RDAA 4JHDB 2QTDA 3KKRA 5CHIA 2ZM6K 4CZJA 1X1PA 4DR6K 3KZBA 3AAPA 4JKDA 4DTUA 4GNIA 3F9MA 4JD2B 5FROA 2ZWHA 1IBLK 3K2PA 4B3TK 3EKSA 4CGJA 3HXMA 3BY5A 2P5GA 3BUZB 2G8WA 2D5RA 3SUPA 5AQLA 5AQKA 4IOCL 1OKJA 1X3NA 4I6MB 2HMIA 3CJCA 4BG8A 4UQGA 5AQUA 4C8LA 1R59O 5FRMA 4LF7K 4FYDA 1TVRA 1VQ5N 4LH5A 1U04A 4BE1A 2HHVA 1K9MO 1SL1A 2XHBA 2E20A 3ID6A 2O4GA 1RNHA 1V4SA 4F2RA 2ZJRL 1YJWN 3SMSA 1LW2A 4E7JA 3O3GA 3WNEA 2ZJPL 3KIOA 3GE1A 4CFBA 3H3OB 3L2VA 4AF1A 4B9NA 2F9WA 3A8YA 4DR7K 3CCJN 3OY9A 1GOAA 4FJ8A 4FJMA 4OJRA 1NK5A 1TUUA 1J6ZA 5AQNA 4UY8O 4GW6A 4JI8K 3L2RA 1TK0A 4N47A 3K57A 2P9KA 3VENA 1DEJA 4K42A 4BRAA 4X64K 4YFUA 4DQIA 5GAHP 3PLAA 3THXA 5EVZA 1VRUA 4C8OA 4BR9A 2A42A 3T3FA 3NGYA 2ITGA 3HPHA 3Q7BA 3MAQA 5GIPA 3DXKA 3U9ZA 3LM9A 4FOIA 3TAFA 1Q9XA 3QB0A 1CZAN 1G15A 3BF3A 3SV3A 3CQYA 3PIOL 4FLWA 4FJIA 3J80O 4Z94A 4B1XB 1JJ2M 3SUQA 3I33A 4DR3K 4GV9A 4J2DA 1QVFM 1X9SA 2VG7A 4W5QA 5EU7A 3HVRA 1S1VA 5AQRA 3QICA 4CJ5A 4JKFA 4NLCA 2Q97A 3DLGA 3SAFA 3SPYA 3CERA 4JKBA 3CFRA 1BCMA 1B92A 1HNIA 3C6AA 4JI3K 3VGLA 4WF9L 3ZT1A 4FJ7A 4A59A 1H1VA 4RTFD 5KQDA 2JLEA 1W0HA 2Q2RA 4Z4EA 1WSHA 1NMNA 4PWDA 4RW4A 2YNFA 4MO4A 5AQYA 4HTLA 3MX2A 3UE5A 1TKXA 5FPMA 4XH1A 1WSFA 4M3RA 5JVGL 1N33K 4CW7B 4ZTJA 4FJ9A 1BDGA 1JCGA 3CXCM 3O3FA 4RCHA 2E6MA 4KTQA 4I6MA 5DM6L 4YOTA 4BWMA 3T1AA 1WSIA 1SKSA 4KREA 1F21A 3E1YA 4EZ9A 1HNWK 1J5OA 1YJNN 1QS4A 1QZ6A 3AGKA 4FZZA 4IEEA 1NOZA 1NU0A 1VQON 2NRZA 1C1AA 1SV5A 2DFHA 2FBVA 2QWLA 3N4QA 1KQSM 1BI4B 2HHUA 1YTAA 4CEEA 4Z0UA 3CFOA 3RMCA 4ILGB 2Y1IA 2OCEA 2QWQA 2I7NA 2IGIA 3RVCA 3U8XA 1BG3A 4DTNA 2VWBA 5TKWA 4K25A 1EQYA 1O13A 1ILYA 4AHCA 1OH6A 3QERA 3GL1A 3NF7A 1D4XA 4JK8A 3NBPA 2XRIA 3T1HK 4KHQA 1NKCA 3OYAA 3U6FA 2HHQA 2FSKA 2WFBA 3HPOA 1VK0A 2Q0RA 3NVKA 4OGCA 2A5XA 4AM7A 4FK4A 1TUYA 1RT3A 4FLZA 3AVJA 1TKZA 4FZYA 4CIFA 3QIPA 2HHWA 3AO5A 4KRFA 1N32K 3NF6A 5BN9A 3A2FA 2UUAK 5LY3A 2F8SA 4JS5A 1QSYA 3VEXA 4JKCA 1KLMA 3T7ZA 1G99A 5AZJB 3L2WA 5MLCQ 3KLHA 1BI4A 3D2FA 4GV3A 1NGAA 4J8FA 3SYZA 3KJVA 1L3UA 4B9SA 2GUPA 3AVFA 4CFCA 5KTQA 4IKFA 4YOYA 3D7EO 3PSIA 4M3TA 1Q82O 4QS8A 3HSCA 3KWIA 4JNEA 1IKYA 3THXB 4E0DA 3P38A 3AA5X 4FW2A 4M3XA 3LP2A 3TANA 1SKWA 2A40A 4FWNA 2KFNA 3O9TA 3HT3A 5CE3A 4N56A 1RGIA 4CHZA 4OPJA 1IKWA 3V1QA 5DMRA 2FSJA 2VGNA 3QEVA 1KTQA 2YKMA 3ATUA 2UUCK 1BGXT 3HVTA 2E1YA 4HUFA 1CXUA 5ELZA 5ADXA 3RWUA 1WSJA 2HBJA 3QEIA 4DQRA 3L3UA 2O8EA 2HBMA 1VQKN 2UYTA 3EE8A 3KD1E 1KVCA 3AO3A 2ZD1A 2W42A 2WOMA 1XI1A 3JSMA 1TV6A 3MECA 4DF4A 3EL2A 4BVOA 3ZSOA 4B8AB 4KBOA 3AO2A 4E7LA 2WBNA 3ENOA 4JEPA 1NGJA 1ZC6A 3G10A 1JLAA 4CEDA 4FJGA 3THYA 2O8BB 2NRRA 3VQ8A 1DT9A 2NRWA 5DM7L 4FM2A 2Z1GA 3CJAA 4BC4A 1K8KA 1NLVA 1QQOA 1Q18A 1Q86O 4Z4HA 3C6UA 2V7ZA 4YOUA 1QZ5A 1RDWX 3CIPA 5JLFA 5FRNA 3DOLA 5K14A 2HSTA 1WSEA 1S6PA 1XC9A 5LJWA 4AHTA 4M41A 3ZYYX 4DU4A 1T6CA 2QXFA 3SLCA 4O55A 3V6DA 3LZJA 3G71N 3OJSA 4JS4A 2E8AA 3PSFA 3M6GA 3HI0A 2GTDA 3O9SA 4B1WB 1B9FA 5E41A 4KH5A 5C15A 2HNYA 4KHUA 2W6KA 3CJ1A 3SZ2A 3CYMA 3KLEA 1WAFA 1NBWA 2AP1A 5JICA 2OA8A 4U67L 1RBTA 3IG1A 1T44A 4BG9A 3SUOA 2OYQA 2B4JA 4M3UA 3NVMA 1Y64A 3E9LA 4PUOA 5JVHL 3ZEUA 3MEDA 5DK5A 3V81A 4H4MA 5CY4A 4CJEA 4BC3A 3G6EN 3P5JA 4BRHA 3VQDA 3M3ZA 3F73A 3LWLA 3UKUA 3ZSZA 3LP3A 2RPIA 5HL7L 3I56N 4FWOA 3VETA 3WNFA 4OLAA 4NLBA 3MN5A 5BPNA 4CECA 2NRXA 1ITGA 3AO4A 1YF5L 3EN9A 4CJ4A 1O1WA 1YVNA 1C0MA 3CPEA 3ISNC 3FZFA 4BR2A 1HUXA 4ELUA 4HHTA 1BA1A 4YOVA 3CC7N 4DTPA 2G8UA 4B1UB 1REVA 4JI4K 4CZMA 4QCLA 2W41A 4DB3A 4FJXA 3EO3A 2YNIA 2JWLA 5FPEA 3CI5A 3CCRN 1NM1A 2QM1A 3NFAA 3C65A 1VQPN 3DAWA 5CZ2A 4CGFA 4N41A 1YIJN 4FLYA 1LCUA 3LDPA 4H8KA 1NOYA 4ELVA 3SV4A 3LPTA 1YI2N 4A2AA 4B1VA 2RF2A 2HMPA 3VGMA 3LAMA 1Q7YO 2P9UA 4F8RA 4DTMA 1U6ZA 4E89A 2ZGYA 4CIGA 3QESA 3AVHA 3G4SN 2BGGA 3WQTA 3DRPA 4H5TA 4E1NA 4DV5K 1DTQA 3O80A 4JN4A 2FF6A 3P39A 3HM9A 3RRHA 3NE6A 4M3YA 2GBZA 3HRGA 1Q8IA 3OYCA 4GVEA 5BRFA 2IOCA 2Z1JA 3KK2A 4CFAA 3KKSA 3K9JA 3AY9A 5GAEP 3O8MA 4H0OA 3K5LA 2KHOA 4CJPA 4FVUA 3KTQA 4FPBA 1B9DA 1KAXA 4QS7A 5AQFA 3EY1A 3CCQN 4FM0A 1ATNA 1NK9A 2D0CA 3GOIA 1IV0A 3SAGA 1SS6A 4CESA 1SL0A 3CC4N 4CJFA 1NKEA 3DYAA 4MFBA 3LDQA 2FSNA 2Q36A 3KWGA 2NNWA 5HRRA 3ZT3A 4O8UA 3CMEN 3SK3A 1YHQN 1ASUA 3JXUA 5HRNA 1TYQA 3CC2N 3DRRA 4JI5K 4BACA 4YDUC 1RDUA 2UXCK 4OKKA 5BN8A 5M1PA 3L4QA 3N4PA 3SI6A 4AHSA 3B6OA 3J7YP 3V9ZA 3IAYA 2ZF5O 5H1SQ 3VQCA 2OPQA 3WNGA 1S72N 4A57A 1JXBA 1K6YA 1V4TA 3H1VX 4FWLA 1VHXA 2O4IA 1KVBA 1HKCA 4IG3A 2O8FB 2E2NA 3FZHA 3DLKA 5AJ3K 4DTXA 2RE2A 3QFPA 3S3OA 3DM2A 5BPMA 1C0GA 4AHRA 2XO7A 3FGUA 3VN5A 4MLHA 2KFZA 5GIOA 1J54A 4YNQA 2PZSA 1LAVA 4V19S 2Z1HA 3KVGA 1XC3A 4KFBA 4NB4A 4OPKA 1ATSA 3J7AP 5B8HA 2D4WA 3TTDA 4E19A 3THYB 1S9GA 3HZ6A 5BRDA 4BR4A 4Z4CA 4DV7K 3DXMA 3TTCA 3T1YK 4CCHA 1NGDA 2ATQA 1T7PA 3IRXA 4JI7K 4DS4A 1SQKA 3L4IA 1JLGA 4CHPA 4B3MK 2BANA 2D0OA 4DV0K 4JKGA 3CETA 3S41A 1QHAA 4DFJA 2ASOA 2ASPA 3C6TA 3H08A 4FWKA 3IDHA 2HBLA 3AO1A 2E5LK 4JRQA 4DTOA 5FPNA 2X6SA 3QIOA 4BQLA 4CEOA 3CCSN 4DLEA 5CYQA 3U3GA 2QWOA 2B5JA 1NNEA 4KI6A 2O8CA 2NRHA 3VTHA 1NK8A 2GWJA 1KRPA 2OZMA 1LWEA 4ILHA 1OVYA 4HCCA 3M5RA 2QKBA 1Z6RA 3O9RA 5D3GA 3Q7CA 2KTQA 1D5AA 4KHSA 1RCHA 4F3TA 3TI0A 3OBWA 1WB9A 4O5BA 3SQ2A 4FCYA 1IBMK 2P9SB 3E01A 2A6AA 3AVAA 3U3YA 2E2PA 4CEFA 1EKEA 2VG5A 1KXPA 1HYSA 2YHWA 3SQ0A 4IWVA 4BRCA 4C8NA 3B8AX 3QDKA 4DS5A 2YJEA 2ZQBA 1U47A 1RTJA 1NGFA 2V51B 1IH7A 4DR2K 4IJAA 2GWKA 3MMVA 4F9OA 1U49A 4JHDA 2D0BA 3OYEA 3H6EA 1EP4A 4Z4GA 1BHLA 1T6DA 1TYQB 2P9UB 2HHHK 4BREA 2HB5A 5KRSA 3VEZA 4EAHD 3PX6A 1ZBIA 5BPLA 1WN7A 4BE0A 4CZGA 3IFRA 3LDOA 4KAZA 3VEOA 2GX9A 2P9PA 2QK9A 5BREA 4AH9A 3LPUA 2XY8A 3FZMA 4DTRA 1QVGM 4BRGA 1A5WA 4H5NA 2FF3B 1DTTA 2A3ZA 1Z25A 5KGWA 1QQNA 4Y1DA 3L3VA 5AFUH 5HOOA 1HLUA 3ITHA 3IUCA 4Y1CA 4C1NK 1RDDA 4WQ4C 4B9MA 5J2NA 2W40A 3VPZA 1NJWA 4LD0A 4IG0A 3BZKA 3CCEN 4LFCK 4ISGA 3D0PA 2V7YA 4MQ3A 3AARA 1KD1O 3MN6A 1NGEA 1RT6A 4I2PA 1Y97A 4IEIA 5SWMA 2EHGA 5EXWA 4KKOA 3O4WA 1EX4A 3A5NC 4FOEA 3DLBA 4HTUA 1TKDA 1Q81O 1ASWA 1KVAA 2FXUA 2RHKA 1GLDG 3VF4A 4DWIA 1KAYA 4BRLA 1JLEA 2HVIA 4RWTA 3L0QA 1HX1A 4DR1K 4JI1K 2E88A 5J2MA 4HUEA 4CJQA 2P9IB 2J4RA 3PY8A 2NZTA 4O8KA 3V9XA 4R5PA 3JS6A 3PV8A 5EY4A 3AAQA 5C12A 4KB1A 4J2EA 3FFKB 1U2VB 3ZSQA 4X66K 1TAUA 1W7AA 3VF6A 4B9TA 1TKTA 2YHAA 2IDOA 2YNHA 4TSXA 1ASVA 1JLCA 4FLVA 5SZTA 1D8YA 1C0TA 1L3SA 3BDPA 5EX5A 3ZEUB 3CMAN 4MDBA 4X62K 4O4GA 4JLHA 1TGOA 4A62A 4BROA 1RDCA 3LANA 4AQYK 3S3MA 3VTIA 4FJNA 1YTUA 1FKPA 1YT3A 2VCPA 2HHTA 3MXMA 1CLQA 1HQEA 4FK2A 3OYJA 3WEEB 2BH1A 4U7BA 1T3VA 3QNOA 4ZHRA 2P9IA 3CFPA 4LF6K 1EWRA 1LWCA 1NK6A 4LF9K 4AHVA 1EXQA 3LP1A 3IS9A 3VERA 4CHYA 1NK0A 4C8KA 1GLJO 3LL3A 4K0KK 4K8ZA 3C95A 5AQTA 1BQMA 4IO8A 5CR4A 1BO5O 1BL3A 1HKGA 4BRDA 4FM1A 1UA0A 1EWQA 1RBRA 1QQMA 3EKUA 5LL6Z 4EP4A 4YHHK 2ETJA 3H46O 3LDSA 1U4BA 1A5VA 3MEEA 3WNHA 3DMJA 3LAKA 1CZBA 3HM8A 5M1OA 3A5MC 3GBTA 3HBTA 3KHYA 4LSLA 3L6QA 3TAGA 2FBTA 1WUAA 1BIZA 3MXIA 2HW3A 1NKBA 4NO7A 4BRFA 3L2UA 3O4NA 1ZXOA 3I8BA 3VGKA 4B9UA 3SMPA 1Q9YA 1LOTB 4CJTA 4CJKA 3F5TA 3TABA 2GV9A 1VQMN 4WCEL 5BR9A 2YNGA 2YHBA 3TWHA 4MLEA 1VAZA 4PQUA 4W5OA 1WBBA 4CGDA 3VEVA 3OYHA 5GAGP 2VWJA 3VA0A 3VOVA 4BDYA 2O8DB 2EWSA 1TL3A 2WTUA 3TAQA 2YX6A 3BZCA 3MN9A 3C0BA 4DQPA 3S9HA 4ILJA 4F4KA 3VQEA 3K59A 4LH4A 1UAXA 2GEMA 3VQ9A 3O3HA 4BR5A 1BA0A 1KSPA 4FWRA 4FWQA 4ICLA 1OH8A 1HYVA 4O0IA 3DLRA 4JAXA 2YV0X 5ADXH 4EHTA 1FW6A 3DXKB 2IVPA 2I5JA 4IFEA 1NG9A 5C10A 4YOWA 3B6PA 3QFUA 5GINA 3O6WA 5KRTA 3RRGA 3ZSYA 4JI0K 1U45A 2ZE2A 1RT5A 5IWAK 4H0VB 4BRPA 1L5UA 3QBWA 1RT7A 3OYBA 2CH6A 3QBXA 1XNQK 1VQ7N 3MWTA 3LM2A 1ZYQA 4KHNA 1RTIA 4CZIA 5AQPA 1LWFA 4CJWA 5I9EB 1NWKA 4YDUA 4K8XA 4B1ZA 3NHGA 4DUZK 3SNNA 2DY4A 3NCIA 1XHXA 5I42A 2WONA 5GADP 1IBKK 2PFUA 2LSNA 2O8EB 3ZT2A 1HNXK 3QO9A 5E26A 3IMXA 2F4VK 3VQ4A 3AA2A 3AVIA 4DSIA 4IDKA 1WBDA 3F2KA 3C7NB 3NF8A 4AILC 2UXDK 3MK6A 2X78A 4NCAA 3OVNA 3OJUA 1S1UA 2UXBK 4B3OA 2OPRA 4R79A 3VQBA 4CBXA 4DCHA 3EZ5A 1GOBA 3KD5E 5M1FA 2IS3A 2HHSA 4PA1A 1QE1A 3L8BA 4B9LA 4OKEA 1MDUB 4KI4A 5AQQA 1IG9A 3E9OA 1VSJA 4ID5A 5HRPA 4KHPK 3CM6A 1U2VA 4DLGA 4JKEA 2NRVA 4BC2A 3FR0A 3ZT4A 4BR0A 4JK7A 5AQIA 3NAEA 5LMUK 4CHOA 4CJSA 2P9NA 3VA3A 1WSGA 4DQ8A 1W9HA 3K5MA 2BE2A 4FJHA 1YITN 2BUPA 3ASMA 1BUPA 3I8DA 5HRSA 2P9LB 3VF2A 4FLTA 5KGXA 3OYLA 5HLFA 4JD2A 1LV5A 1DKGD 4EHUA 1HQUA 5I3UA 4H0YB 2HOEA 3D2FB 3K5NA 4G9ZA 2P9NB 4JYAK 1HJOA 3RR8A 1HNVA 1D9FA 3TAEA 3PX4A 4CZLA 2VQFK 2FLOA 2F96A 2QXLA 1RDBA 2RKIA 1VSLA 5J1EA 4FXDA 4FWPA 3HO1A 4GV6A 1YJ9N 3OYNA 4IFVA 1NGHA 1QQCA 3PO5A 2QWNA 4DU3A 4A5BA 2XY7A 2KKZA 2UUBK 4DQSA 4W5NA 2HBKA 1S1WA 1U48A 4I9QA 1VQ6N 3VQ7A 2Z1IA 3NH2A 4KPYA 3CCLN 1XQSC 1VSKA 3NGIA 4E3SA 1S6QA 4DMNA 1ZBUA 1HRHA 4E7HA 4J2AA 4KHWA
chains in the Genus database with same CATH topology
3AVKA 4KHSA 3CFOA 3RMCA 1RCHA 4F3TA 2KZZA 3TI0A 2Y1IA 3OYMA 1RT2A 2IGIA 3VQQA 4RW7A 4O5BA 4DTNA 3SQ2A 3SPZA 4FCYA 2G8FA 4PY5A 3TR8A 3AVGA 3G0ZA 4Q5VA 4AHCA 3E01A 3QERA 3U3YA 3AVAA 3NF7A 4CEFA 3NBPA 1EKEA 2VG5A 2XRIA 4KHQA 4M3ZA 3TARA 1HYSA 1NKCA 1GOCA 3SQ0A 3OYAA 4C8NA 3SCXA 3U6FA 4Z4FA 4DS5A 2HHQA 4DSEA 2ZQBA 1U47A 3CG7A 3HPOA 1RTJA 1VK0A 4BWJA 1RBUA 2P5OA 1IH7A 1IKVA 4IFYA 4OGCA 4FK4A 1JLQA 1RT3A 4FLZA 1U49A 2D0BA 3OYEA 3AVJA 1IO2A 1TKZA 4CJLA 4CIEA 4CK3A 4FZYA 4N76A 4CIFA 3QIPA 1KCFA 1EP4A 2HHWA 3AO5A 4Z4GA 4I2QA 1BHLA 4CK1A 4KRFA 4CEQA 1SKRA 3NF6A 1WLJA 2HB5A 3A2FA 3LP0A 4AHUA 5KRSA 2JGUA 1FKOA 3PX6A 4NCBA 1ZBIA 1WN7A 4F2SA 2F8SA 4GVMA 4BE0A 3SJJA 4JS5A 3T19A 1QSYA 4CJUA 5C42A 5C24A 2P51A 1KLMA 4KAZA 1S5JA 3HP6A 3L2WA 3AA4A 2BDPA 3ZT0A 3QEWA 4HCBA 1HYZA 1JLBA 3KLHA 1BI4A 1RBSA 1BISA 2QK9A 3SYZA 1L3UA 3KJVA 4B9SA 4FK0A 4AH9A 1DLOA 3LPUA 2XY8A 2E6LA 3AVFA 4CFCA 5KTQA 4DTRA 1A5WA 1WNSA 3DLHA 1DTTA 4IKFA 1Z25A 4CE9A 4DG1A 5KGWA 4ELTA 3L2QA 2B6AA 2DTUA 2Q3SA 4Y1DA 3L3VA 4M3TA 4KHYA 1HPZA 2EX3A 3ITHA 4CK2A 4E7IA 3O4QA 2A1RA 4Y1CA 1RDDA 3NF9A 4N5SA 4B9MA 2OZSA 1CZ9A 1IKYA 5J2NA 4KV8A 4IBNA 1QTMA 4E0DA 5J2PA 3AA5X 3HPGA 1NJWA 3DI6A 4DF8A 4LD0A 4RW6A 4FW2A 4IG0A 4M3XA 4B9VA 4KO0A 4ZTFA 3LP2A 3OS2A 3TANA 1SKWA 3D0PA 4JRPA 3M8SA 2XY6A 2KFNA 4MQ3A 1RT6A 3HT3A 3OYKA 3V9SA 4I2PA 1UA1A 1NJYA 2GUIA 3PO4A 4N56A 1Y97A 1RT1A 5SWMA 3BGRA 4CHZA 4CEBA 4NYFA 4OPJA 2EHGA 1IKWA 2F8TA 3V1QA 5DMRA 1NJZA 2FBYA 3ALYA 4KHWA 3QEVA 3LWMA 4KKOA 4OGEA 1NJXA 1EX4A 1HJRA 2YKMA 1KTQA 1FXXA 1BGXT 4I7FA 3HVTA 3DLBA 4HTUA 1CXUA 4HUFA 2KQ2A 1TKDA 3KLGA 4BDPA 4XIUA 3VQPA 3QEPA 4CF9A 1WSJA 3QEIA 1ASWA 4HVJA 3RWUA 2XY5A 1CXQA 4DQRA 1KVAA 1X9MA 1TK8A 4DWIA 1RILA 4B8CA 3L3UA 5JS2A 3LALA 4CGGA 3AVNA 1JLEA 2HVIA 1KFSA 3KD1E 4WE1A 1KVCA 2OPPA 1U4BA 5J2MA 3AO3A 4HUEA 2ZD1A 1VSMA 4H4OA 4CJQA 2PYLA 4I9LA 2W42A 2WOMA 1XI1A 1TK5A 3JSMA 2G8IA 1TV6A 3MECA 4DF4A 3PY8A 3V9XA 4F3OA 4QOZB 4E7KA 1SUQA 3P1GA 3AVMA 1WAJA 5HBMA 3ZSOA 4B8AB 4R5PA 3PV8A 1S9EA 3AO2A 4CEEA 4E7LA 1U48A 4KB1A 5C25A 2KZMA 4RW8A 4J2EA 3HP9A 5CYMA 1VRTA 3G10A 3UIQA 3ZSQA 2RN2A 3V9WA 1JLAA 1TAUA 4CEDA 4FJGA 5CZ1A 3VQAA 1I39A 3QNNA 3RTVA 4B9TA 1TKTA 3TAPA 3VQ8A 3AA3A 2KTQA 2YHAA 3HSTB 2IDOA 2YNHA 2FBXA 4TSXA 3M8QA 1ASVA 1ZBLA 1SL2A 1JLCA 4DSJA 1C1BA 2Z1GA 5SZTA 4FM2A 4FLVA 1D8YA 3KLIA 1C0TA 3AVBA 1L3SA 3BDPA 4C8MA 1J9AA 1C0UA 4Z4HA 3C6UA 3MEGA 4J2BA 4DFPA 2Y1JA 4O4GA 3I0SA 1TGOA 4JLHA 5FRNA 3DOLA 4CF1A 5K14A 3CM5A 3HL8A 4CGHA 1L3VA 1RDCA 3LANA 1WSEA 4DTJA 3S3MA 4FJNA 1YTUA 4ID1A 2HVHA 4FZXC 1S6PA 1UWBA 1XC9A 4KTWA 1FKPA 4AHTA 3OYGA 1YT3A 1ZBFA 2HHTA 3MXMA 2PYJA 1CLQA 1HQEA 3KK3A 4M41A 3OYJA 4FK2A 4DLEA 4FLXA 2QXFA 4DU4A 1X9WA 2IAJA 4O55A 3V6DA 3LZJA 1VSIA 3OJSA 1N5YA 4JS4A 3NGZA 3KK1A 1KLNA 4L8RB 3JYTA 4FJJA 1ZBHA 1S1TA 1B9FA 3QNOA 4ZHRA 5E41A 2HNYA 3CFPA 4KHUA 3HJFA 1LWCA 3SQ1A 1NK6A 4FJ5A 4AHVA 3CYMA 3KLEA 3SZ2A 1EXQA 1WAFA 2AJQA 1T05A 2HNZA 4CHQA 3LP1A 3IS9A 4QAGA 4CHYA 1NK0A 4C8KA 4CJVA 4Q0BA 4OKJA 3ZSRA 2OA8A 1TL1A 4K8ZA 1RBTA 3IG1A 3C95A 4B08A 3THVA 4HUGA 3SUOA 2OYQA 1D9DA 3AVCA 1BQMA 2E4LA 4CF0A 2A1SA 2B4JA 1BL3A 3ZCMA 4M3UA 4FM1A 2NUBA 1UA0A 4M42A 1JLFA 4DSLA 4PUOA 1RBRA 2R7YA 3MEDA 1T03A 5DK5A 3K5OA 3V81A 1JXEA 4H4MA 4DTSA 5J2QA 1C1CA 5CY4A 4CJEA 4EP4A 2ETJA 3P5JA 3LDSA 3PUFA 1A5VA 3MEEA 3VQDA 3WNHA 3DMJA 3LAKA 3F73A 1Z26A 2PY5A 1A5XA 1BQNA 1CZBA 2DFEA 3LWLA 3ZSZA 3LP3A 2G8HA 2QKKA 2RPIA 3ZSVA 3TAMA 4CJ3A 4DU1A 3SUNA 4LSLA 3RMBA 4KB0A 2X74A 2OPSA 3WNFA 3OS1A 3TAGA 1T8EA 1QSLA 4FVMA 1VSHA 2FBTA 4OLAA 1L3TA 4CECA 1BIZA 2YKNA 3NH1A 3MXIA 4DSFA 3ULDA 1VSFA 3ZSWA 4Z4IA 1ITGA 3AO4A 1NKBA 1RDAA 4M3WA 4CJ4A 2HW3A 5KI6A 3L2UA 3O4NA 4DSKA 4DFMA 1O1WA 1C0MA 3KKRA 4B9UA 3ISNC 1Q9YA 1X1PA 4CJTA 4CJKA 3TABA 4ELUA 4HHTA 2GV9A 4DTUA 4DTPA 4KTZA 2G8UA 2YNGA 5FROA 5JS1A 2YHBA 3TWHA 3C94A 3K2PA 1REVA 4Z0UA 4BE2A 4I9QA 4CGJA 1R0AA 4PQUA 4W5OA 4OLBA 4QCLA 4CGDA 4FJXA 3HXMA 2YNIA 3OYHA 2P5GA 2VWJA 3VA0A 4BDYA 2G8WA 2D5RA 3SUPA 3NFAA 4DFKA 1TL3A 3SQ4A 2HMIA 3PX0A 5CZ2A 3TAQA 4CGFA 4N41A 3S3NA 4DQPA 4UQGA 3S9HA 4FLYA 4C8LA 4F4KA 3VQEA 3K59A 5FRMA 4LH4A 1UAXA 3VQ9A 4H8KA 3O3HA 1RTDA 2VWKA 1NOYA 1QSSA 1TVRA 4FYDA 1BCOA 3D45A 4ELVA 1KSPA 4LH5A 1U04A 4ICLA 4CFDA 1HYVA 3DLEA 3DLRA 3LPTA 4O0IA 4BE1A 3SV4A 2RF2A 2YV0X 1NK7A 2HHVA 1S1XA 3LAMA 1SL1A 2XHBA 4F8RA 4DTMA 4E89A 4O44A 4CF2A 4CIGA 2I5JA 2O4GA 1RNHA 3QESA 3AVHA 2BGGA 3DRPA 4F2RA 4E1NA 3B6PA 1DTQA 4CF8A 4EP5A 4LY7A 5KRTA 3RRHA 1LW2A 3HM9A 4E7JA 3RRGA 1UOCA 3ZSYA 3O3GA 3NE6A 1U45A 1XHZA 3OS0A 1XWLA 2GBZA 4M3YA 2ZE2A 3WNEA 1Q8IA 1RT5A 3OYCA 4CHNA 3KIOA 3P83D 4CFBA 2IOCA 2Z1JA 3FFIA 1L5UA 3KK2A 3L2VA 4CFAA 3KKSA 2HHXA 1RT7A 3OYBA 2G8KA 5HP1A 3V4IA 4CGIA 4B9NA 3K5LA 4CJPA 2D0AA 3KTQA 1B9DA 3F9KA 4RG8A 3EY1A 3OY9A 4FM0A 4FLUA 1ZYQA 1GOAA 4W5RA 4FJ8A 1JKHA 4FJMA 4OJRA 1NK5A 2D0CA 1NK9A 4KHNA 1RTIA 2X6NA 4CEAA 1VSDA 3NH0A 2G8VA 3OYDA 1LWFA 4CESA 4CJWA 1SL0A 4GW6A 4CJFA 2IC3A 3QINA 1NKEA 4K8XA 3L2RA 3DYAA 4MFBA 3NHGA 4N47A 3K57A 3SNNA 1TK0A 3HK2A 2DY4A 5HRRA 3ZT3A 3NCIA 1XHXA 5I42A 2WONA 4YFUA 4DQIA 2LSNA 1ASUA 5HRNA 3ZT2A 3OYFA 3DRRA 3QO9A 3QLHA 1VRUA 3M8RA 4BACA 3QETA 1EETA 3V1OA 4OKKA 4C8OA 3T3FA 3VQ4A 3AA2A 3NGYA 2ITGA 3HPHA 3VQ5A 4LSNA 3SI6A 3AVIA 4M45A 4AHSA 4DSIA 3MAQA 4OVLA 3B6OA 4IDKA 3V9ZA 3IAYA 3NF8A 4AILC 4FJLA 3VQCA 2OPQA 3WNGA 2X78A 1LW0A 3RMDA 4NCAA 1JXBA 1K6YA 4EZ6A 3CQ8A 3OVNA 3OJUA 1KVBA 4CEZA 4IG3A 2O4IA 3TAFA 1Q9XA 1S1UA 4B3OA 2OPRA 3DLKA 1HMVA 3VQBA 1JL1A 1GOBA 3EZ5A 1FK9A 1G15A 2DFFA 4DTXA 2IS3A 3RMAA 3KD5E 3SV3A 2HHSA 4PA1A 1RBVA 4FLWA 4FJIA 3S3OA 3DM2A 1QE1A 3DRSA 3L8BA 4B9LA 4OKEA 4AHRA 2XO7A 4KI4A 3SUQA 3VN5A 4FJKA 2KFZA 1IG9A 1RTHA 1VSJA 4ID5A 5HRPA 3CM6A 4J2DA 4DLGA 1J54A 4YNQA 3ZT4A 1NK4A 1X9SA 2VG7A 2PZSA 1LAVA 3QEXA 4NCGA 4W5TA 4W5QA 3NAEA 5EU7A 3HVRA 2KW4A 4CHOA 4CJSA 1S1VA 2Z1HA 4G1QA 4CJ5A 3VA3A 1WSGA 1J53A 1W9HA 1KFDA 4KFBA 5HROA 1N6QA 4OPKA 3DLGA 3K5MA 2BE2A 4FJHA 3SPYA 3MXJA 3VQ6A 3AV9A 3DOKA 3ASMA 1BCMA 1B92A 4E19A 1HNIA 3OYIA 3CFRA 1YVUA 3I8DA 5HRSA 1S9GA 1TAQA 4FLTA 5KGXA 3LZIA 3ZT1A 4FJ7A 4Z4CA 3OYLA 5HLFA 4GMJB 1LV5A 1IKXA 2JLEA 1W0HA 1HQUA 5I3UA 3NDKA 4Z4EA 3I0RA 1WSHA 3HYFA 3K5NA 4PWDA 4CCHA 3RR7A 4RW4A 3KLFA 2YNFA 2ATQA 4E1MA 1T7PA 3IRXA 1TKXA 1JL2A 3RR8A 1HNVA 4DS4A 1D9FA 3K58A 4DQQA 1WSFA 4M3RA 3TAEA 3PX4A 1JLGA 4CHPA 2BANA 2F96A 4ZTJA 4FJ9A 1RDBA 2HNDA 5T7BA 4DFJA 3O3FA 3V9UA 3AVLA 2E6MA 2RKIA 1VSLA 4KTQA 1LAWA 3C6TA 3H08A 5J1EA 4FXDA 3AO1A 3HO1A 4BDZA 4BWMA 3T1AA 3M8PA 1I3AA 3OYNA 4IFVA 1QQCA 1WSIA 2P1JA 3PO5A 4DU3A 4JRQA 1SKSA 4DTOA 4KREA 1F21A 4O0JA 2XY7A 4EZ9A 2X6SA 3QIOA 2VG6A 1VSEA 1J5OA 4CEOA 4DQSA 4W5NA 1S1WA 5FDLA 1QHTA 1QS4A 5CYQA 3U3GA 2Z1IA 3VQ7A 2B5JA 3V1RA 4FW1A 3NH2A 4KPYA 4KI6A 1NK8A 4FZZA 1RT4A 1NOZA 1BIUA 1VSKA 3NGIA 1C6VA 4CJRA 1C1AA 1SV5A 1MU2A 2DFHA 4RW9A 3EYZA 1S6QA 4E3SA 1KRPA 2FBVA 1LWEA 2OZMA 2FC0A 4CERA 1ZBUA 4DMNA 4HCCA 2QKBA 1HRHA 1BI4B 4E7HA 4J2AA 3ZSXA 5D3GA 4NYNA 2HHUA 1YTAA 1D5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVK A;  4KHS A;  3CFO A;  3RMC A;  1RCH A;  4F3T A;  2KZZ A;  3TI0 A;  2Y1I A;  3OYM A;  1RT2 A;  2IGI A;  3VQQ A;  4RW7 A;  4O5B A;  4DTN A;  3SQ2 A;  3SPZ A;  4FCY A;  2G8F A;  4PY5 A;  3TR8 A;  3AVG A;  3G0Z A;  4Q5V A;  4AHC A;  3E01 A;  3QER A;  3U3Y A;  3AVA A;  3NF7 A;  4CEF A;  3NBP A;  1EKE A;  2VG5 A;  2XRI A;  4KHQ A;  4M3Z A;  3TAR A;  1HYS A;  1NKC A;  1GOC A;  3SQ0 A;  3OYA A;  4C8N A;  3SCX A;  3U6F A;  4Z4F A;  4DS5 A;  2HHQ A;  4DSE A;  2ZQB A;  1U47 A;  3CG7 A;  3HPO A;  1RTJ A;  1VK0 A;  4BWJ A;  1RBU A;  2P5O A;  1IH7 A;  1IKV A;  4IFY A;  4OGC A;  4FK4 A;  1JLQ A;  1RT3 A;  4FLZ A;  1U49 A;  2D0B A;  3OYE A;  3AVJ A;  1IO2 A;  1TKZ A;  4CJL A;  4CIE A;  4CK3 A;  4FZY A;  4N76 A;  4CIF A;  3QIP A;  1KCF A;  1EP4 A;  2HHW A;  3AO5 A;  4Z4G A;  4I2Q A;  1BHL A;  4CK1 A;  4KRF A;  4CEQ A;  1SKR A;  3NF6 A;  1WLJ A;  2HB5 A;  3A2F A;  3LP0 A;  4AHU A;  5KRS A;  2JGU A;  1FKO A;  3PX6 A;  4NCB A;  1ZBI A;  1WN7 A;  4F2S A;  2F8S A;  4GVM A;  4BE0 A;  3SJJ A;  4JS5 A;  3T19 A;  1QSY A;  4CJU A;  5C42 A;  5C24 A;  2P51 A;  1KLM A;  4KAZ A;  1S5J A;  3HP6 A;  3L2W A;  3AA4 A;  2BDP A;  3ZT0 A;  3QEW A;  4HCB A;  1HYZ A;  1JLB A;  3KLH A;  1BI4 A;  1RBS A;  1BIS A;  2QK9 A;  3SYZ A;  1L3U A;  3KJV A;  4B9S A;  4FK0 A;  4AH9 A;  1DLO A;  3LPU A;  2XY8 A;  2E6L A;  3AVF A;  4CFC A;  5KTQ A;  4DTR A;  1A5W A;  1WNS A;  3DLH A;  1DTT A;  4IKF A;  1Z25 A;  4CE9 A;  4DG1 A;  5KGW A;  4ELT A;  3L2Q A;  2B6A A;  2DTU A;  2Q3S A;  4Y1D A;  3L3V A;  4M3T A;  4KHY A;  1HPZ A;  2EX3 A;  3ITH A;  4CK2 A;  4E7I A;  3O4Q A;  2A1R A;  4Y1C A;  1RDD A;  3NF9 A;  4N5S A;  4B9M A;  2OZS A;  1CZ9 A;  1IKY A;  5J2N A;  4KV8 A;  4IBN A;  1QTM A;  4E0D A;  5J2P A;  3AA5 X;  3HPG A;  1NJW A;  3DI6 A;  4DF8 A;  4LD0 A;  4RW6 A;  4FW2 A;  4IG0 A;  4M3X A;  4B9V A;  4KO0 A;  4ZTF A;  3LP2 A;  3OS2 A;  3TAN A;  1SKW A;  3D0P A;  4JRP A;  3M8S A;  2XY6 A;  2KFN A;  4MQ3 A;  1RT6 A;  3HT3 A;  3OYK A;  3V9S A;  4I2P A;  1UA1 A;  1NJY A;  2GUI A;  3PO4 A;  4N56 A;  1Y97 A;  1RT1 A;  5SWM A;  3BGR A;  4CHZ A;  4CEB A;  4NYF A;  4OPJ A;  2EHG A;  1IKW A;  2F8T A;  3V1Q A;  5DMR A;  1NJZ A;  2FBY A;  3ALY A;  4KHW A;  3QEV A;  3LWM A;  4KKO A;  4OGE A;  1NJX A;  1EX4 A;  1HJR A;  2YKM A;  1KTQ A;  1FXX A;  1BGX T;  4I7F A;  3HVT A;  3DLB A;  4HTU A;  1CXU A;  4HUF A;  2KQ2 A;  1TKD A;  3KLG A;  4BDP A;  4XIU A;  3VQP A;  3QEP A;  4CF9 A;  1WSJ A;  3QEI A;  1ASW A;  4HVJ A;  3RWU A;  2XY5 A;  1CXQ A;  4DQR A;  1KVA A;  1X9M A;  1TK8 A;  4DWI A;  1RIL A;  4B8C A;  3L3U A;  5JS2 A;  3LAL A;  4CGG A;  3AVN A;  1JLE A;  2HVI A;  1KFS A;  3KD1 E;  4WE1 A;  1KVC A;  2OPP A;  1U4B A;  5J2M A;  3AO3 A;  4HUE A;  2ZD1 A;  1VSM A;  4H4O A;  4CJQ A;  2PYL A;  4I9L A;  2W42 A;  2WOM A;  1XI1 A;  1TK5 A;  3JSM A;  2G8I A;  1TV6 A;  3MEC A;  4DF4 A;  3PY8 A;  3V9X A;  4F3O A;  4QOZ B;  4E7K A;  1SUQ A;  3P1G A;  3AVM A;  1WAJ A;  5HBM A;  3ZSO A;  4B8A B;  4R5P A;  3PV8 A;  1S9E A;  3AO2 A;  4CEE A;  4E7L A;  1U48 A;  4KB1 A;  5C25 A;  2KZM A;  4RW8 A;  4J2E A;  3HP9 A;  5CYM A;  1VRT A;  3G10 A;  3UIQ A;  3ZSQ A;  2RN2 A;  3V9W A;  1JLA A;  1TAU A;  4CED A;  4FJG A;  5CZ1 A;  3VQA A;  1I39 A;  3QNN A;  3RTV A;  4B9T A;  1TKT A;  3TAP A;  3VQ8 A;  3AA3 A;  2KTQ A;  2YHA A;  3HST B;  2IDO A;  2YNH A;  2FBX A;  4TSX A;  3M8Q A;  1ASV A;  1ZBL A;  1SL2 A;  1JLC A;  4DSJ A;  1C1B A;  2Z1G A;  5SZT A;  4FM2 A;  4FLV A;  1D8Y A;  3KLI A;  1C0T A;  3AVB A;  1L3S A;  3BDP A;  4C8M A;  1J9A A;  1C0U A;  4Z4H A;  3C6U A;  3MEG A;  4J2B A;  4DFP A;  2Y1J A;  4O4G A;  3I0S A;  1TGO A;  4JLH A;  5FRN A;  3DOL A;  4CF1 A;  5K14 A;  3CM5 A;  3HL8 A;  4CGH A;  1L3V A;  1RDC A;  3LAN A;  1WSE A;  4DTJ A;  3S3M A;  4FJN A;  1YTU A;  4ID1 A;  2HVH A;  4FZX C;  1S6P A;  1UWB A;  1XC9 A;  4KTW A;  1FKP A;  4AHT A;  3OYG A;  1YT3 A;  1ZBF A;  2HHT A;  3MXM A;  2PYJ A;  1CLQ A;  1HQE A;  3KK3 A;  4M41 A;  3OYJ A;  4FK2 A;  4DLE A;  4FLX A;  2QXF A;  4DU4 A;  1X9W A;  2IAJ A;  4O55 A;  3V6D A;  3LZJ A;  1VSI A;  3OJS A;  1N5Y A;  4JS4 A;  3NGZ A;  3KK1 A;  1KLN A;  4L8R B;  3JYT A;  4FJJ A;  1ZBH A;  1S1T A;  1B9F A;  3QNO A;  4ZHR A;  5E41 A;  2HNY A;  3CFP A;  4KHU A;  3HJF A;  1LWC A;  3SQ1 A;  1NK6 A;  4FJ5 A;  4AHV A;  3CYM A;  3KLE A;  3SZ2 A;  1EXQ A;  1WAF A;  2AJQ A;  1T05 A;  2HNZ A;  4CHQ A;  3LP1 A;  3IS9 A;  4QAG A;  4CHY A;  1NK0 A;  4C8K A;  4CJV A;  4Q0B A;  4OKJ A;  3ZSR A;  2OA8 A;  1TL1 A;  4K8Z A;  1RBT A;  3IG1 A;  3C95 A;  4B08 A;  3THV A;  4HUG A;  3SUO A;  2OYQ A;  1D9D A;  3AVC A;  1BQM A;  2E4L A;  4CF0 A;  2A1S A;  2B4J A;  1BL3 A;  3ZCM A;  4M3U A;  4FM1 A;  2NUB A;  1UA0 A;  4M42 A;  1JLF A;  4DSL A;  4PUO A;  1RBR A;  2R7Y A;  3MED A;  1T03 A;  5DK5 A;  3K5O A;  3V81 A;  1JXE A;  4H4M A;  4DTS A;  5J2Q A;  1C1C A;  5CY4 A;  4CJE A;  4EP4 A;  2ETJ A;  3P5J A;  3LDS A;  3PUF A;  1A5V A;  3MEE A;  3VQD A;  3WNH A;  3DMJ A;  3LAK A;  3F73 A;  1Z26 A;  2PY5 A;  1A5X A;  1BQN A;  1CZB A;  2DFE A;  3LWL A;  3ZSZ A;  3LP3 A;  2G8H A;  2QKK A;  2RPI A;  3ZSV A;  3TAM A;  4CJ3 A;  4DU1 A;  3SUN A;  4LSL A;  3RMB A;  4KB0 A;  2X74 A;  2OPS A;  3WNF A;  3OS1 A;  3TAG A;  1T8E A;  1QSL A;  4FVM A;  1VSH A;  2FBT A;  4OLA A;  1L3T A;  4CEC A;  1BIZ A;  2YKN A;  3NH1 A;  3MXI A;  4DSF A;  3ULD A;  1VSF A;  3ZSW A;  4Z4I A;  1ITG A;  3AO4 A;  1NKB A;  1RDA A;  4M3W A;  4CJ4 A;  2HW3 A;  5KI6 A;  3L2U A;  3O4N A;  4DSK A;  4DFM A;  1O1W A;  1C0M A;  3KKR A;  4B9U A;  3ISN C;  1Q9Y A;  1X1P A;  4CJT A;  4CJK A;  3TAB A;  4ELU A;  4HHT A;  2GV9 A;  4DTU A;  4DTP A;  4KTZ A;  2G8U A;  2YNG A;  5FRO A;  5JS1 A;  2YHB A;  3TWH A;  3C94 A;  3K2P A;  1REV A;  4Z0U A;  4BE2 A;  4I9Q A;  4CGJ A;  1R0A A;  4PQU A;  4W5O A;  4OLB A;  4QCL A;  4CGD A;  4FJX A;  3HXM A;  2YNI A;  3OYH A;  2P5G A;  2VWJ A;  3VA0 A;  4BDY A;  2G8W A;  2D5R A;  3SUP A;  3NFA A;  4DFK A;  1TL3 A;  3SQ4 A;  2HMI A;  3PX0 A;  5CZ2 A;  3TAQ A;  4CGF A;  4N41 A;  3S3N A;  4DQP A;  4UQG A;  3S9H A;  4FLY A;  4C8L A;  4F4K A;  3VQE A;  3K59 A;  5FRM A;  4LH4 A;  1UAX A;  3VQ9 A;  4H8K A;  3O3H A;  1RTD A;  2VWK A;  1NOY A;  1QSS A;  1TVR A;  4FYD A;  1BCO A;  3D45 A;  4ELV A;  1KSP A;  4LH5 A;  1U04 A;  4ICL A;  4CFD A;  1HYV A;  3DLE A;  3DLR A;  3LPT A;  4O0I A;  4BE1 A;  3SV4 A;  2RF2 A;  2YV0 X;  1NK7 A;  2HHV A;  1S1X A;  3LAM A;  1SL1 A;  2XHB A;  4F8R A;  4DTM A;  4E89 A;  4O44 A;  4CF2 A;  4CIG A;  2I5J A;  2O4G A;  1RNH A;  3QES A;  3AVH A;  2BGG A;  3DRP A;  4F2R A;  4E1N A;  3B6P A;  1DTQ A;  4CF8 A;  4EP5 A;  4LY7 A;  5KRT A;  3RRH A;  1LW2 A;  3HM9 A;  4E7J A;  3RRG A;  1UOC A;  3ZSY A;  3O3G A;  3NE6 A;  1U45 A;  1XHZ A;  3OS0 A;  1XWL A;  2GBZ A;  4M3Y A;  2ZE2 A;  3WNE A;  1Q8I A;  1RT5 A;  3OYC A;  4CHN A;  3KIO A;  3P83 D;  4CFB A;  2IOC A;  2Z1J A;  3FFI A;  1L5U A;  3KK2 A;  3L2V A;  4CFA A;  3KKS A;  2HHX A;  1RT7 A;  3OYB A;  2G8K A;  5HP1 A;  3V4I A;  4CGI A;  4B9N A;  3K5L A;  4CJP A;  2D0A A;  3KTQ A;  1B9D A;  3F9K A;  4RG8 A;  3EY1 A;  3OY9 A;  4FM0 A;  4FLU A;  1ZYQ A;  1GOA A;  4W5R A;  4FJ8 A;  1JKH A;  4FJM A;  4OJR A;  1NK5 A;  2D0C A;  1NK9 A;  4KHN A;  1RTI A;  2X6N A;  4CEA A;  1VSD A;  3NH0 A;  2G8V A;  3OYD A;  1LWF A;  4CES A;  4CJW A;  1SL0 A;  4GW6 A;  4CJF A;  2IC3 A;  3QIN A;  1NKE A;  4K8X A;  3L2R A;  3DYA A;  4MFB A;  3NHG A;  4N47 A;  3K57 A;  3SNN A;  1TK0 A;  3HK2 A;  2DY4 A;  5HRR A;  3ZT3 A;  3NCI A;  1XHX A;  5I42 A;  2WON A;  4YFU A;  4DQI A;  2LSN A;  1ASU A;  5HRN A;  3ZT2 A;  3OYF A;  3DRR A;  3QO9 A;  3QLH A;  1VRU A;  3M8R A;  4BAC A;  3QET A;  1EET A;  3V1O A;  4OKK A;  4C8O A;  3T3F A;  3VQ4 A;  3AA2 A;  3NGY A;  2ITG A;  3HPH A;  3VQ5 A;  4LSN A;  3SI6 A;  3AVI A;  4M45 A;  4AHS A;  4DSI A;  3MAQ A;  4OVL A;  3B6O A;  4IDK A;  3V9Z A;  3IAY A;  3NF8 A;  4AIL C;  4FJL A;  3VQC A;  2OPQ A;  3WNG A;  2X78 A;  1LW0 A;  3RMD A;  4NCA A;  1JXB A;  1K6Y A;  4EZ6 A;  3CQ8 A;  3OVN A;  3OJU A;  1KVB A;  4CEZ A;  4IG3 A;  2O4I A;  3TAF A;  1Q9X A;  1S1U A;  4B3O A;  2OPR A;  3DLK A;  1HMV A;  3VQB A;  1JL1 A;  1GOB A;  3EZ5 A;  1FK9 A;  1G15 A;  2DFF A;  4DTX A;  2IS3 A;  3RMA A;  3KD5 E;  3SV3 A;  2HHS A;  4PA1 A;  1RBV A;  4FLW A;  4FJI A;  3S3O A;  3DM2 A;  1QE1 A;  3DRS A;  3L8B A;  4B9L A;  4OKE A;  4AHR A;  2XO7 A;  4KI4 A;  3SUQ A;  3VN5 A;  4FJK A;  2KFZ A;  1IG9 A;  1RTH A;  1VSJ A;  4ID5 A;  5HRP A;  3CM6 A;  4J2D A;  4DLG A;  1J54 A;  4YNQ A;  3ZT4 A;  1NK4 A;  1X9S A;  2VG7 A;  2PZS A;  1LAV A;  3QEX A;  4NCG A;  4W5T A;  4W5Q A;  3NAE A;  5EU7 A;  3HVR A;  2KW4 A;  4CHO A;  4CJS A;  1S1V A;  2Z1H A;  4G1Q A;  4CJ5 A;  3VA3 A;  1WSG A;  1J53 A;  1W9H A;  1KFD A;  4KFB A;  5HRO A;  1N6Q A;  4OPK A;  3DLG A;  3K5M A;  2BE2 A;  4FJH A;  3SPY A;  3MXJ A;  3VQ6 A;  3AV9 A;  3DOK A;  3ASM A;  1BCM A;  1B92 A;  4E19 A;  1HNI A;  3OYI A;  3CFR A;  1YVU A;  3I8D A;  5HRS A;  1S9G A;  1TAQ A;  4FLT A;  5KGX A;  3LZI A;  3ZT1 A;  4FJ7 A;  4Z4C A;  3OYL A;  5HLF A;  4GMJ B;  1LV5 A;  1IKX A;  2JLE A;  1W0H A;  1HQU A;  5I3U A;  3NDK A;  4Z4E A;  3I0R A;  1WSH A;  3HYF A;  3K5N A;  4PWD A;  4CCH A;  3RR7 A;  4RW4 A;  3KLF A;  2YNF A;  2ATQ A;  4E1M A;  1T7P A;  3IRX A;  1TKX A;  1JL2 A;  3RR8 A;  1HNV A;  4DS4 A;  1D9F A;  3K58 A;  4DQQ A;  1WSF A;  4M3R A;  3TAE A;  3PX4 A;  1JLG A;  4CHP A;  2BAN A;  2F96 A;  4ZTJ A;  4FJ9 A;  1RDB A;  2HND A;  5T7B A;  4DFJ A;  3O3F A;  3V9U A;  3AVL A;  2E6M A;  2RKI A;  1VSL A;  4KTQ A;  1LAW A;  3C6T A;  3H08 A;  5J1E A;  4FXD A;  3AO1 A;  3HO1 A;  4BDZ A;  4BWM A;  3T1A A;  3M8P A;  1I3A A;  3OYN A;  4IFV A;  1QQC A;  1WSI A;  2P1J A;  3PO5 A;  4DU3 A;  4JRQ A;  1SKS A;  4DTO A;  4KRE A;  1F21 A;  4O0J A;  2XY7 A;  4EZ9 A;  2X6S A;  3QIO A;  2VG6 A;  1VSE A;  1J5O A;  4CEO A;  4DQS A;  4W5N A;  1S1W A;  5FDL A;  1QHT A;  1QS4 A;  5CYQ A;  3U3G A;  2Z1I A;  3VQ7 A;  2B5J A;  3V1R A;  4FW1 A;  3NH2 A;  4KPY A;  4KI6 A;  1NK8 A;  4FZZ A;  1RT4 A;  1NOZ A;  1BIU A;  1VSK A;  3NGI A;  1C6V A;  4CJR A;  1C1A A;  1SV5 A;  1MU2 A;  2DFH A;  4RW9 A;  3EYZ A;  1S6Q A;  4E3S A;  1KRP A;  2FBV A;  1LWE A;  2OZM A;  2FC0 A;  4CER A;  1ZBU A;  4DMN A;  4HCC A;  2QKB A;  1HRH A;  1BI4 B;  4E7H A;  4J2A A;  3ZSX A;  5D3G A;  4NYN A;  2HHU A;  1YTA A;  1D5A A; 
#chains in the Genus database with same CATH topology
 2VGM A;  3VEW A;  2KZZ A;  4JK9 A;  3VQQ A;  4CJ7 A;  4RW7 A;  2G8F A;  1E4F T;  3TR8 A;  4Q5V A;  2CGJ A;  5KPZ A;  3TAR A;  4XEI A;  3SCX A;  4FL9 A;  4AM6 A;  2KLA A;  4BWJ A;  4OO1 J;  2P5O A;  1GLC G;  3E66 A;  3ENH A;  5E84 A;  2BTF A;  3CHW A;  2YHY A;  4FWM A;  4KH4 A;  4CK3 A;  4N76 A;  1NGG A;  5BRH A;  1KCF A;  4H5R A;  3TSU A;  2E1Z A;  2F7T A;  3FZL A;  4CK1 A;  2QW9 A;  4PKH A;  1SKR A;  1WLJ A;  4NCB A;  4WFA L;  4CI6 A;  3SJJ A;  1VQ9 N;  5C42 A;  5C24 A;  3THW B;  1YAG A;  3AA4 A;  1E4G T;  4LF8 K;  2JWK A;  3A5O C;  1BIS A;  1DLO A;  1IJJ A;  4H03 B;  5EOY A;  2ASM A;  4H5W A;  3TU5 A;  3L2Q A;  2B6A A;  1VQ8 N;  4KHY A;  2EX3 A;  5AQJ A;  3O4Q A;  2E2O A;  5AZI A;  1P90 A;  3NF9 A;  2OZS A;  4PKG A;  1QTM A;  3HPG A;  3DI6 A;  3VMF B;  4DF8 A;  1VQN N;  5LJV A;  4ZTF A;  3P31 A;  2O8B A;  2PBD A;  4JRP A;  1OH7 A;  3J8A A;  3CJ9 A;  2YHX A;  4FPA A;  3V9S A;  1UA1 A;  3SBG A;  3D2E B;  5AQG A;  3BGR A;  4JKG B;  4CZE A;  3H45 C;  4CEB A;  4LF4 K;  4CZF A;  1NJZ A;  2FBY A;  3ALY A;  4WYB A;  3OHR A;  1NJX A;  1FXX A;  4BC5 A;  5M1Q A;  4IOX A;  4XIU A;  3VQP A;  4HVJ A;  4DV4 K;  3H3N O;  1RIL A;  3OTO K;  2O8C B;  4B8C A;  1C0F A;  3LAL A;  4CGG A;  1NJI O;  5KPR A;  4QS9 A;  2OPP A;  3R6M A;  3ZX0 A;  4K41 A;  1BU6 O;  4DV2 K;  3ID8 A;  3WQU A;  4OPH A;  1TK5 A;  4IDH A;  5C2F A;  4F3O A;  3P1G A;  5HBM A;  3ZET A;  4Z4F A;  2P9S A;  4RW8 A;  1S22 A;  3V9W A;  3I55 N;  1GLA G;  4WFB L;  3VQA A;  1I39 A;  3C6H A;  3RTV A;  1NGC A;  3TAP A;  3SAH A;  4JKA A;  2FBX A;  1ZBL A;  1SL2 A;  4DSJ A;  1C1B A;  3DWL A;  3U4L A;  4ISF A;  2ZJQ L;  1J9A A;  1C0U A;  4IXC A;  4LFB K;  3MEG A;  1EO1 A;  4OX9 K;  4WQ5 C;  3BF1 A;  4LC9 B;  3CM5 A;  5M1N A;  3OA9 A;  5AQW A;  4CGH A;  1L3V A;  3T69 A;  5AQS A;  2ITM A;  4FZX C;  1K73 O;  2PYJ A;  5LMN K;  3O08 A;  2IAJ A;  2VQE K;  1KC8 O;  3R3L A;  1ESV A;  3NGZ A;  2YI1 A;  4XH4 A;  1KLN A;  1YXQ A;  4LF5 K;  1ZBH A;  1JCE A;  1S1T A;  2PAV A;  2Q31 A;  3P4I A;  4DR4 K;  3HJF A;  1I94 K;  4FJ5 A;  4OPA A;  3WUH A;  1T05 A;  1RFQ A;  2HNZ A;  4CHQ A;  2CGL A;  4Q0B A;  3ZSR A;  1TL1 A;  1ATR A;  4GKK K;  2P9K B;  4B08 A;  3THV A;  4HUG A;  5FLX O;  1D9D A;  2UU9 K;  4BRQ A;  3ZCM A;  2NUB A;  4M42 A;  3EE9 A;  4DSL A;  3CJB A;  3FZK A;  3K5O A;  4B3R K;  1JXE A;  4DTS A;  1SAZ A;  1C1C A;  3CJ7 A;  3FE1 A;  1VQL N;  2PY5 A;  3OBY A;  2DFE A;  2A41 A;  2D1K A;  2QKK A;  3ZSV A;  4H0T B;  3TAM A;  4CJ3 A;  4DU1 A;  3RMB A;  1JCF A;  2OPS A;  3OS1 A;  1QSL A;  1DGK N;  1VSH A;  1L3T A;  3WEE A;  3ZSW A;  5KI6 A;  4DSK A;  1M1K O;  4DFM A;  5F2R A;  1S3X A;  3WT0 A;  4H0X B;  4KTZ A;  5JS1 A;  3C94 A;  4BE2 A;  1M90 O;  1R0A A;  4OLB A;  2HF3 A;  4IOA L;  4BRI A;  4DFK A;  3O5B A;  3SQ4 A;  3WXJ A;  3PX0 A;  3S3N A;  5AQO A;  4DR5 K;  2WC9 A;  4BRK A;  4FSV A;  1RTD A;  1QSS A;  3KK7 A;  2VWK A;  4M7Y A;  3UKR A;  4O5F A;  1BCO A;  3D45 A;  1BOT O;  2DPN A;  4CFD A;  4J2B A;  4Y0W A;  3DLE A;  4NXN K;  1NK7 A;  1S1X A;  3TSP A;  3CCU N;  3DXM B;  3EZW A;  4O44 A;  5IT9 O;  4CF2 A;  4L3Q A;  4BR7 A;  2QA4 N;  4CF8 A;  4EP5 A;  4LY7 A;  5AQH A;  4M63 C;  4BQZ A;  1UOC A;  1J5E K;  1XHZ A;  3G25 A;  1XWL A;  3OS0 A;  3J7Z O;  4CHN A;  3P83 D;  3FFI A;  3WXM B;  2HHX A;  2G8K A;  4YY3 K;  5HP1 A;  3V4I A;  4CGI A;  3DLL L;  1VQ4 N;  1P8Z A;  2D0A A;  1N34 K;  3F9K A;  4RG8 A;  4FLU A;  3R8E A;  4W5R A;  1JKH A;  4BGA A;  4X65 K;  4CEA A;  2X6N A;  1VSD A;  3NH0 A;  2G8V A;  5JMV A;  3OYD A;  4GY2 B;  3O9Q A;  3LDL A;  3MN7 A;  2IC3 A;  3QIN A;  1NGB A;  3HK2 A;  2QEX N;  2O8F A;  3ULE B;  2YJF A;  3CPW M;  3OYF A;  3MWP A;  3QLH A;  3QET A;  5C0Y A;  1NGI A;  3M8R A;  3K9K A;  1EET A;  3V1O A;  4ISE A;  3VQ5 A;  4LSN A;  2OAN A;  4M45 A;  4OVL A;  4FJL A;  4C1N I;  1W2B M;  3WXL A;  1LW0 A;  5KPT A;  4EZ6 A;  4PKI A;  3CQ8 A;  1XNR K;  4CEZ A;  3K0S A;  2OTL N;  2Q0U A;  1HMV A;  3UB5 A;  1JL1 A;  3ZLJ A;  1FK9 A;  2DFF A;  3RMA A;  1RBV A;  4WQ4 A;  3DRS A;  4BY9 C;  3GG4 A;  4CD1 A;  4FJK A;  1RTH A;  5TKY A;  3EEQ A;  1NK4 A;  5AFU A;  3QEX A;  4NCG A;  4W5T A;  2KW4 A;  4G1Q A;  5HRO A;  1J53 A;  4B3S K;  1KFD A;  1N6Q A;  3SBT A;  3MXJ A;  3VQ6 A;  3AV9 A;  3DOK A;  3OYI A;  1YVU A;  4DV1 K;  1X9J A;  1TAQ A;  4PL8 A;  3TTF A;  3LZI A;  4MDA A;  3HOT A;  4M7X A;  5AR0 A;  3CF5 L;  4GMJ B;  4CVN E;  1IKX A;  2QWR A;  1K8K B;  3NDK A;  3I0R A;  3O1B A;  3ATV A;  3HYF A;  3RR7 A;  3KLF A;  4JV5 K;  3ENB A;  4E1M A;  4EIA A;  2H3G X;  3HTV A;  1JL2 A;  2VYP A;  1GLB G;  3K58 A;  4DQQ A;  4FO0 A;  4H5V A;  4A5A A;  4DUY K;  3CCM N;  4E1J A;  2HND A;  5T7B A;  3V9U A;  3AVL A;  1LAW A;  4BDZ A;  1MWM A;  3W3D A;  3M8P A;  1I3A A;  3R1X A;  2P1J A;  1FJG K;  4O0J A;  2VG6 A;  1VSE A;  5FDL A;  1QHT A;  3V1R A;  4FW1 A;  1NMD A;  2D0P A;  1RT4 A;  1KAZ A;  1BIU A;  1C6V A;  2HF4 A;  4CJR A;  4RW9 A;  1MU2 A;  3BP8 A;  4JI2 K;  3ULE A;  3EYZ A;  2FC0 A;  4CER A;  4FWS A;  2OTJ N;  1MWK A;  3ZSX A;  1N36 K;  3U9D A;  4NYN A;  3RMD A;  3AVK A;  5AZJ A;  3OYM A;  1RT2 A;  3VES A;  4A2B A;  1K8A O;  3CCV N;  3SPZ A;  4PY5 A;  2ZGZ A;  3AVG A;  3UKU B;  2F9T A;  3G0Z A;  1XMQ K;  3MCP A;  5AQM A;  4M3Z A;  4MO5 A;  1GOC A;  4JKH A;  2IVN A;  3RSE B;  4DSE A;  3VEY A;  4B9Q A;  3CG7 A;  4NXM K;  1RBU A;  4BRM A;  1IKV A;  3BEX A;  4IFY A;  1BWF O;  3FLC O;  1JLQ A;  4PHT X;  4B1Y B;  1IO2 A;  4CJL A;  4CIE A;  3H1Q A;  3SJH A;  2IIR A;  3MCA B;  4I2Q A;  3E9P A;  5JLH A;  4CEQ A;  4C23 A;  1SZ2 A;  3LP0 A;  4AHU A;  2JGU A;  1FKO A;  3ZET B;  1OH5 A;  4F2S A;  4GVM A;  5F1X A;  3T19 A;  5BR8 K;  4CJU A;  2NRT A;  2P51 A;  3HOS A;  1S5J A;  3HP6 A;  2BDP A;  1GLL O;  4H0P A;  3ZT0 A;  3QEW A;  4HCB A;  1HYZ A;  1JLB A;  2Q1N A;  1RBS A;  3JAM O;  4FK0 A;  3ZX3 A;  4DKW A;  2E6L A;  2W6L A;  1WNS A;  1N8R O;  3DLH A;  4CE9 A;  3O9U A;  4DG1 A;  4ELT A;  3QML A;  4WQ5 A;  2Q3S A;  2DTU A;  1HPM A;  1HPZ A;  4E7I A;  4CK2 A;  2A1R A;  5AQX A;  1IG8 A;  5KQ8 A;  4N5S A;  4CZH A;  1CZ9 A;  4XH5 A;  3M1F A;  4KV8 A;  4IBN A;  4CZK A;  4EFH A;  2YCH A;  4YOR A;  4JI6 K;  5J2P A;  2I7P A;  4RW6 A;  3D6R A;  4A61 A;  4B9V A;  4KO0 A;  3AGR A;  1GLF O;  3OS2 A;  1XMO K;  3M8S A;  2XY6 A;  1E3M A;  1ZBS A;  2CH5 A;  4HWI A;  3OYK A;  1NJY A;  3W0L A;  3PO4 A;  2GUI A;  3WXK A;  1RT1 A;  4NYF A;  3PIP L;  4IZ9 A;  2F8T A;  3WXI A;  3LWM A;  4OGE A;  1HJR A;  4I7F A;  4IO9 L;  2KQ2 A;  3KLG A;  4BDP A;  3R9P A;  3QEP A;  4CF9 A;  2O8D A;  2XY5 A;  1CXQ A;  1X9M A;  1TK8 A;  4KH6 A;  3LDN A;  5JS2 A;  3AVN A;  1KFS A;  2CGK A;  4WE1 A;  2WUS A;  2GEL A;  4H4O A;  1VSM A;  2PYL A;  4I9L A;  2G8I A;  2QWM A;  3CQX A;  4QOZ B;  4E7K A;  1SUQ A;  5AQZ A;  3AVM A;  1WAJ A;  1S9E A;  2KZM A;  2QWP A;  2NLX A;  5C25 A;  3HP9 A;  5CYM A;  3THW A;  1VRT A;  4K43 A;  3UIQ A;  2RN2 A;  5CZ1 A;  3QNN A;  1HKB A;  4PL7 A;  2P9L A;  3A5L C;  3AA3 A;  4WFN L;  1X3M A;  3C7N A;  3HST B;  1Z05 A;  3M8Q A;  3TSQ A;  3KLI A;  3AVB A;  4C8M A;  4YOX A;  4DFP A;  2Y1J A;  1OVQ A;  3I0S A;  5M1K A;  1WOQ A;  3MDQ A;  3A0I X;  4BVP A;  3GDQ A;  4CF1 A;  3HL8 A;  4DTJ A;  3RSE A;  4ID1 A;  4DV6 K;  5A2Q O;  2HVH A;  3TPQ A;  1UWB A;  4KTW A;  3OYG A;  2P9P B;  1ZBF A;  3CD6 N;  3KK3 A;  3DJC A;  3IKM A;  4FLX A;  1X9W A;  3NMU A;  3UKR B;  1VSI A;  1N5Y A;  3KK1 A;  4L8R B;  3JYT A;  4FJJ A;  5F0X A;  4LFA K;  3D2E A;  4BGB A;  2V52 B;  3SQ1 A;  3OW2 M;  2AJQ A;  5FPD A;  4QAG A;  4CJV A;  4OKJ A;  1W97 L;  3MX5 A;  4CD3 A;  4CBW A;  1YUW A;  3J81 O;  3AVC A;  2E4L A;  4CF0 A;  2IVO A;  2A1S A;  4CBU A;  1JLF A;  5AZI B;  4BRN A;  2QI2 A;  2R7Y A;  4DV3 K;  4IJN A;  1T03 A;  5J2Q A;  3ZX2 A;  3PUF A;  2AA4 A;  1GLE G;  1Z26 A;  1A5X A;  1BQN A;  1HNZ K;  2G8H A;  3SUN A;  1HR0 K;  4KB0 A;  4GKJ K;  2X74 A;  3O1W A;  5AQV A;  4DHY A;  1MA9 B;  2E2Q A;  5C2D A;  1XUP O;  4FVM A;  1T8E A;  2YKN A;  3NH1 A;  4DSF A;  3ULD A;  1VSF A;  4Z4I A;  4M3W A;  1RDA A;  4JHD B;  2QTD A;  3KKR A;  5CHI A;  2ZM6 K;  4CZJ A;  1X1P A;  4DR6 K;  3KZB A;  3AAP A;  4JKD A;  4DTU A;  4GNI A;  3F9M A;  4JD2 B;  5FRO A;  2ZWH A;  1IBL K;  3K2P A;  4B3T K;  3EKS A;  4CGJ A;  3HXM A;  3BY5 A;  2P5G A;  3BUZ B;  2G8W A;  2D5R A;  3SUP A;  5AQL A;  5AQK A;  4IOC L;  1OKJ A;  1X3N A;  4I6M B;  2HMI A;  3CJC A;  4BG8 A;  4UQG A;  5AQU A;  4C8L A;  1R59 O;  5FRM A;  4LF7 K;  4FYD A;  1TVR A;  1VQ5 N;  4LH5 A;  1U04 A;  4BE1 A;  2HHV A;  1K9M O;  1SL1 A;  2XHB A;  2E20 A;  3ID6 A;  2O4G A;  1RNH A;  1V4S A;  4F2R A;  2ZJR L;  1YJW N;  3SMS A;  1LW2 A;  4E7J A;  3O3G A;  3WNE A;  2ZJP L;  3KIO A;  3GE1 A;  4CFB A;  3H3O B;  3L2V A;  4AF1 A;  4B9N A;  2F9W A;  3A8Y A;  4DR7 K;  3CCJ N;  3OY9 A;  1GOA A;  4FJ8 A;  4FJM A;  4OJR A;  1NK5 A;  1TUU A;  1J6Z A;  5AQN A;  4UY8 O;  4GW6 A;  4JI8 K;  3L2R A;  1TK0 A;  4N47 A;  3K57 A;  2P9K A;  3VEN A;  1DEJ A;  4K42 A;  4BRA A;  4X64 K;  4YFU A;  4DQI A;  5GAH P;  3PLA A;  3THX A;  5EVZ A;  1VRU A;  4C8O A;  4BR9 A;  2A42 A;  3T3F A;  3NGY A;  2ITG A;  3HPH A;  3Q7B A;  3MAQ A;  5GIP A;  3DXK A;  3U9Z A;  3LM9 A;  4FOI A;  3TAF A;  1Q9X A;  3QB0 A;  1CZA N;  1G15 A;  3BF3 A;  3SV3 A;  3CQY A;  3PIO L;  4FLW A;  4FJI A;  3J80 O;  4Z94 A;  4B1X B;  1JJ2 M;  3SUQ A;  3I33 A;  4DR3 K;  4GV9 A;  4J2D A;  1QVF M;  1X9S A;  2VG7 A;  4W5Q A;  5EU7 A;  3HVR A;  1S1V A;  5AQR A;  3QIC A;  4CJ5 A;  4JKF A;  4NLC A;  2Q97 A;  3DLG A;  3SAF A;  3SPY A;  3CER A;  4JKB A;  3CFR A;  1BCM A;  1B92 A;  1HNI A;  3C6A A;  4JI3 K;  3VGL A;  4WF9 L;  3ZT1 A;  4FJ7 A;  4A59 A;  1H1V A;  4RTF D;  5KQD A;  2JLE A;  1W0H A;  2Q2R A;  4Z4E A;  1WSH A;  1NMN A;  4PWD A;  4RW4 A;  2YNF A;  4MO4 A;  5AQY A;  4HTL A;  3MX2 A;  3UE5 A;  1TKX A;  5FPM A;  4XH1 A;  1WSF A;  4M3R A;  5JVG L;  1N33 K;  4CW7 B;  4ZTJ A;  4FJ9 A;  1BDG A;  1JCG A;  3CXC M;  3O3F A;  4RCH A;  2E6M A;  4KTQ A;  4I6M A;  5DM6 L;  4YOT A;  4BWM A;  3T1A A;  1WSI A;  1SKS A;  4KRE A;  1F21 A;  3E1Y A;  4EZ9 A;  1HNW K;  1J5O A;  1YJN N;  1QS4 A;  1QZ6 A;  3AGK A;  4FZZ A;  4IEE A;  1NOZ A;  1NU0 A;  1VQO N;  2NRZ A;  1C1A A;  1SV5 A;  2DFH A;  2FBV A;  2QWL A;  3N4Q A;  1KQS M;  1BI4 B;  2HHU A;  1YTA A;  4CEE A;  4Z0U A;  3CFO A;  3RMC A;  4ILG B;  2Y1I A;  2OCE A;  2QWQ A;  2I7N A;  2IGI A;  3RVC A;  3U8X A;  1BG3 A;  4DTN A;  2VWB A;  5TKW A;  4K25 A;  1EQY A;  1O13 A;  1ILY A;  4AHC A;  1OH6 A;  3QER A;  3GL1 A;  3NF7 A;  1D4X A;  4JK8 A;  3NBP A;  2XRI A;  3T1H K;  4KHQ A;  1NKC A;  3OYA A;  3U6F A;  2HHQ A;  2FSK A;  2WFB A;  3HPO A;  1VK0 A;  2Q0R A;  3NVK A;  4OGC A;  2A5X A;  4AM7 A;  4FK4 A;  1TUY A;  1RT3 A;  4FLZ A;  3AVJ A;  1TKZ A;  4FZY A;  4CIF A;  3QIP A;  2HHW A;  3AO5 A;  4KRF A;  1N32 K;  3NF6 A;  5BN9 A;  3A2F A;  2UUA K;  5LY3 A;  2F8S A;  4JS5 A;  1QSY A;  3VEX A;  4JKC A;  1KLM A;  3T7Z A;  1G99 A;  5AZJ B;  3L2W A;  5MLC Q;  3KLH A;  1BI4 A;  3D2F A;  4GV3 A;  1NGA A;  4J8F A;  3SYZ A;  3KJV A;  1L3U A;  4B9S A;  2GUP A;  3AVF A;  4CFC A;  5KTQ A;  4IKF A;  4YOY A;  3D7E O;  3PSI A;  4M3T A;  1Q82 O;  4QS8 A;  3HSC A;  3KWI A;  4JNE A;  1IKY A;  3THX B;  4E0D A;  3P38 A;  3AA5 X;  4FW2 A;  4M3X A;  3LP2 A;  3TAN A;  1SKW A;  2A40 A;  4FWN A;  2KFN A;  3O9T A;  3HT3 A;  5CE3 A;  4N56 A;  1RGI A;  4CHZ A;  4OPJ A;  1IKW A;  3V1Q A;  5DMR A;  2FSJ A;  2VGN A;  3QEV A;  1KTQ A;  2YKM A;  3ATU A;  2UUC K;  1BGX T;  3HVT A;  2E1Y A;  4HUF A;  1CXU A;  5ELZ A;  5ADX A;  3RWU A;  1WSJ A;  2HBJ A;  3QEI A;  4DQR A;  3L3U A;  2O8E A;  2HBM A;  1VQK N;  2UYT A;  3EE8 A;  3KD1 E;  1KVC A;  3AO3 A;  2ZD1 A;  2W42 A;  2WOM A;  1XI1 A;  3JSM A;  1TV6 A;  3MEC A;  4DF4 A;  3EL2 A;  4BVO A;  3ZSO A;  4B8A B;  4KBO A;  3AO2 A;  4E7L A;  2WBN A;  3ENO A;  4JEP A;  1NGJ A;  1ZC6 A;  3G10 A;  1JLA A;  4CED A;  4FJG A;  3THY A;  2O8B B;  2NRR A;  3VQ8 A;  1DT9 A;  2NRW A;  5DM7 L;  4FM2 A;  2Z1G A;  3CJA A;  4BC4 A;  1K8K A;  1NLV A;  1QQO A;  1Q18 A;  1Q86 O;  4Z4H A;  3C6U A;  2V7Z A;  4YOU A;  1QZ5 A;  1RDW X;  3CIP A;  5JLF A;  5FRN A;  3DOL A;  5K14 A;  2HST A;  1WSE A;  1S6P A;  1XC9 A;  5LJW A;  4AHT A;  4M41 A;  3ZYY X;  4DU4 A;  1T6C A;  2QXF A;  3SLC A;  4O55 A;  3V6D A;  3LZJ A;  3G71 N;  3OJS A;  4JS4 A;  2E8A A;  3PSF A;  3M6G A;  3HI0 A;  2GTD A;  3O9S A;  4B1W B;  1B9F A;  5E41 A;  4KH5 A;  5C15 A;  2HNY A;  4KHU A;  2W6K A;  3CJ1 A;  3SZ2 A;  3CYM A;  3KLE A;  1WAF A;  1NBW A;  2AP1 A;  5JIC A;  2OA8 A;  4U67 L;  1RBT A;  3IG1 A;  1T44 A;  4BG9 A;  3SUO A;  2OYQ A;  2B4J A;  4M3U A;  3NVM A;  1Y64 A;  3E9L A;  4PUO A;  5JVH L;  3ZEU A;  3MED A;  5DK5 A;  3V81 A;  4H4M A;  5CY4 A;  4CJE A;  4BC3 A;  3G6E N;  3P5J A;  4BRH A;  3VQD A;  3M3Z A;  3F73 A;  3LWL A;  3UKU A;  3ZSZ A;  3LP3 A;  2RPI A;  5HL7 L;  3I56 N;  4FWO A;  3VET A;  3WNF A;  4OLA A;  4NLB A;  3MN5 A;  5BPN A;  4CEC A;  2NRX A;  1ITG A;  3AO4 A;  1YF5 L;  3EN9 A;  4CJ4 A;  1O1W A;  1YVN A;  1C0M A;  3CPE A;  3ISN C;  3FZF A;  4BR2 A;  1HUX A;  4ELU A;  4HHT A;  1BA1 A;  4YOV A;  3CC7 N;  4DTP A;  2G8U A;  4B1U B;  1REV A;  4JI4 K;  4CZM A;  4QCL A;  2W41 A;  4DB3 A;  4FJX A;  3EO3 A;  2YNI A;  2JWL A;  5FPE A;  3CI5 A;  3CCR N;  1NM1 A;  2QM1 A;  3NFA A;  3C65 A;  1VQP N;  3DAW A;  5CZ2 A;  4CGF A;  4N41 A;  1YIJ N;  4FLY A;  1LCU A;  3LDP A;  4H8K A;  1NOY A;  4ELV A;  3SV4 A;  3LPT A;  1YI2 N;  4A2A A;  4B1V A;  2RF2 A;  2HMP A;  3VGM A;  3LAM A;  1Q7Y O;  2P9U A;  4F8R A;  4DTM A;  1U6Z A;  4E89 A;  2ZGY A;  4CIG A;  3QES A;  3AVH A;  3G4S N;  2BGG A;  3WQT A;  3DRP A;  4H5T A;  4E1N A;  4DV5 K;  1DTQ A;  3O80 A;  4JN4 A;  2FF6 A;  3P39 A;  3HM9 A;  3RRH A;  3NE6 A;  4M3Y A;  2GBZ A;  3HRG A;  1Q8I A;  3OYC A;  4GVE A;  5BRF A;  2IOC A;  2Z1J A;  3KK2 A;  4CFA A;  3KKS A;  3K9J A;  3AY9 A;  5GAE P;  3O8M A;  4H0O A;  3K5L A;  2KHO A;  4CJP A;  4FVU A;  3KTQ A;  4FPB A;  1B9D A;  1KAX A;  4QS7 A;  5AQF A;  3EY1 A;  3CCQ N;  4FM0 A;  1ATN A;  1NK9 A;  2D0C A;  3GOI A;  1IV0 A;  3SAG A;  1SS6 A;  4CES A;  1SL0 A;  3CC4 N;  4CJF A;  1NKE A;  3DYA A;  4MFB A;  3LDQ A;  2FSN A;  2Q36 A;  3KWG A;  2NNW A;  5HRR A;  3ZT3 A;  4O8U A;  3CME N;  3SK3 A;  1YHQ N;  1ASU A;  3JXU A;  5HRN A;  1TYQ A;  3CC2 N;  3DRR A;  4JI5 K;  4BAC A;  4YDU C;  1RDU A;  2UXC K;  4OKK A;  5BN8 A;  5M1P A;  3L4Q A;  3N4P A;  3SI6 A;  4AHS A;  3B6O A;  3J7Y P;  3V9Z A;  3IAY A;  2ZF5 O;  5H1S Q;  3VQC A;  2OPQ A;  3WNG A;  1S72 N;  4A57 A;  1JXB A;  1K6Y A;  1V4T A;  3H1V X;  4FWL A;  1VHX A;  2O4I A;  1KVB A;  1HKC A;  4IG3 A;  2O8F B;  2E2N A;  3FZH A;  3DLK A;  5AJ3 K;  4DTX A;  2RE2 A;  3QFP A;  3S3O A;  3DM2 A;  5BPM A;  1C0G A;  4AHR A;  2XO7 A;  3FGU A;  3VN5 A;  4MLH A;  2KFZ A;  5GIO A;  1J54 A;  4YNQ A;  2PZS A;  1LAV A;  4V19 S;  2Z1H A;  3KVG A;  1XC3 A;  4KFB A;  4NB4 A;  4OPK A;  1ATS A;  3J7A P;  5B8H A;  2D4W A;  3TTD A;  4E19 A;  3THY B;  1S9G A;  3HZ6 A;  5BRD A;  4BR4 A;  4Z4C A;  4DV7 K;  3DXM A;  3TTC A;  3T1Y K;  4CCH A;  1NGD A;  2ATQ A;  1T7P A;  3IRX A;  4JI7 K;  4DS4 A;  1SQK A;  3L4I A;  1JLG A;  4CHP A;  4B3M K;  2BAN A;  2D0O A;  4DV0 K;  4JKG A;  3CET A;  3S41 A;  1QHA A;  4DFJ A;  2ASO A;  2ASP A;  3C6T A;  3H08 A;  4FWK A;  3IDH A;  2HBL A;  3AO1 A;  2E5L K;  4JRQ A;  4DTO A;  5FPN A;  2X6S A;  3QIO A;  4BQL A;  4CEO A;  3CCS N;  4DLE A;  5CYQ A;  3U3G A;  2QWO A;  2B5J A;  1NNE A;  4KI6 A;  2O8C A;  2NRH A;  3VTH A;  1NK8 A;  2GWJ A;  1KRP A;  2OZM A;  1LWE A;  4ILH A;  1OVY A;  4HCC A;  3M5R A;  2QKB A;  1Z6R A;  3O9R A;  5D3G A;  3Q7C A;  2KTQ A;  1D5A A;  4KHS A;  1RCH A;  4F3T A;  3TI0 A;  3OBW A;  1WB9 A;  4O5B A;  3SQ2 A;  4FCY A;  1IBM K;  2P9S B;  3E01 A;  2A6A A;  3AVA A;  3U3Y A;  2E2P A;  4CEF A;  1EKE A;  2VG5 A;  1KXP A;  1HYS A;  2YHW A;  3SQ0 A;  4IWV A;  4BRC A;  4C8N A;  3B8A X;  3QDK A;  4DS5 A;  2YJE A;  2ZQB A;  1U47 A;  1RTJ A;  1NGF A;  2V51 B;  1IH7 A;  4DR2 K;  4IJA A;  2GWK A;  3MMV A;  4F9O A;  1U49 A;  4JHD A;  2D0B A;  3OYE A;  3H6E A;  1EP4 A;  4Z4G A;  1BHL A;  1T6D A;  1TYQ B;  2P9U B;  2HHH K;  4BRE A;  2HB5 A;  5KRS A;  3VEZ A;  4EAH D;  3PX6 A;  1ZBI A;  5BPL A;  1WN7 A;  4BE0 A;  4CZG A;  3IFR A;  3LDO A;  4KAZ A;  3VEO A;  2GX9 A;  2P9P A;  2QK9 A;  5BRE A;  4AH9 A;  3LPU A;  2XY8 A;  3FZM A;  4DTR A;  1QVG M;  4BRG A;  1A5W A;  4H5N A;  2FF3 B;  1DTT A;  2A3Z A;  1Z25 A;  5KGW A;  1QQN A;  4Y1D A;  3L3V A;  5AFU H;  5HOO A;  1HLU A;  3ITH A;  3IUC A;  4Y1C A;  4C1N K;  1RDD A;  4WQ4 C;  4B9M A;  5J2N A;  2W40 A;  3VPZ A;  1NJW A;  4LD0 A;  4IG0 A;  3BZK A;  3CCE N;  4LFC K;  4ISG A;  3D0P A;  2V7Y A;  4MQ3 A;  3AAR A;  1KD1 O;  3MN6 A;  1NGE A;  1RT6 A;  4I2P A;  1Y97 A;  4IEI A;  5SWM A;  2EHG A;  5EXW A;  4KKO A;  3O4W A;  1EX4 A;  3A5N C;  4FOE A;  3DLB A;  4HTU A;  1TKD A;  1Q81 O;  1ASW A;  1KVA A;  2FXU A;  2RHK A;  1GLD G;  3VF4 A;  4DWI A;  1KAY A;  4BRL A;  1JLE A;  2HVI A;  4RWT A;  3L0Q A;  1HX1 A;  4DR1 K;  4JI1 K;  2E88 A;  5J2M A;  4HUE A;  4CJQ A;  2P9I B;  2J4R A;  3PY8 A;  2NZT A;  4O8K A;  3V9X A;  4R5P A;  3JS6 A;  3PV8 A;  5EY4 A;  3AAQ A;  5C12 A;  4KB1 A;  4J2E A;  3FFK B;  1U2V B;  3ZSQ A;  4X66 K;  1TAU A;  1W7A A;  3VF6 A;  4B9T A;  1TKT A;  2YHA A;  2IDO A;  2YNH A;  4TSX A;  1ASV A;  1JLC A;  4FLV A;  5SZT A;  1D8Y A;  1C0T A;  1L3S A;  3BDP A;  5EX5 A;  3ZEU B;  3CMA N;  4MDB A;  4X62 K;  4O4G A;  4JLH A;  1TGO A;  4A62 A;  4BRO A;  1RDC A;  3LAN A;  4AQY K;  3S3M A;  3VTI A;  4FJN A;  1YTU A;  1FKP A;  1YT3 A;  2VCP A;  2HHT A;  3MXM A;  1CLQ A;  1HQE A;  4FK2 A;  3OYJ A;  3WEE B;  2BH1 A;  4U7B A;  1T3V A;  3QNO A;  4ZHR A;  2P9I A;  3CFP A;  4LF6 K;  1EWR A;  1LWC A;  1NK6 A;  4LF9 K;  4AHV A;  1EXQ A;  3LP1 A;  3IS9 A;  3VER A;  4CHY A;  1NK0 A;  4C8K A;  1GLJ O;  3LL3 A;  4K0K K;  4K8Z A;  3C95 A;  5AQT A;  1BQM A;  4IO8 A;  5CR4 A;  1BO5 O;  1BL3 A;  1HKG A;  4BRD A;  4FM1 A;  1UA0 A;  1EWQ A;  1RBR A;  1QQM A;  3EKU A;  5LL6 Z;  4EP4 A;  4YHH K;  2ETJ A;  3H46 O;  3LDS A;  1U4B A;  1A5V A;  3MEE A;  3WNH A;  3DMJ A;  3LAK A;  1CZB A;  3HM8 A;  5M1O A;  3A5M C;  3GBT A;  3HBT A;  3KHY A;  4LSL A;  3L6Q A;  3TAG A;  2FBT A;  1WUA A;  1BIZ A;  3MXI A;  2HW3 A;  1NKB A;  4NO7 A;  4BRF A;  3L2U A;  3O4N A;  1ZXO A;  3I8B A;  3VGK A;  4B9U A;  3SMP A;  1Q9Y A;  1LOT B;  4CJT A;  4CJK A;  3F5T A;  3TAB A;  2GV9 A;  1VQM N;  4WCE L;  5BR9 A;  2YNG A;  2YHB A;  3TWH A;  4MLE A;  1VAZ A;  4PQU A;  4W5O A;  1WBB A;  4CGD A;  3VEV A;  3OYH A;  5GAG P;  2VWJ A;  3VA0 A;  3VOV A;  4BDY A;  2O8D B;  2EWS A;  1TL3 A;  2WTU A;  3TAQ A;  2YX6 A;  3BZC A;  3MN9 A;  3C0B A;  4DQP A;  3S9H A;  4ILJ A;  4F4K A;  3VQE A;  3K59 A;  4LH4 A;  1UAX A;  2GEM A;  3VQ9 A;  3O3H A;  4BR5 A;  1BA0 A;  1KSP A;  4FWR A;  4FWQ A;  4ICL A;  1OH8 A;  1HYV A;  4O0I A;  3DLR A;  4JAX A;  2YV0 X;  5ADX H;  4EHT A;  1FW6 A;  3DXK B;  2IVP A;  2I5J A;  4IFE A;  1NG9 A;  5C10 A;  4YOW A;  3B6P A;  3QFU A;  5GIN A;  3O6W A;  5KRT A;  3RRG A;  3ZSY A;  4JI0 K;  1U45 A;  2ZE2 A;  1RT5 A;  5IWA K;  4H0V B;  4BRP A;  1L5U A;  3QBW A;  1RT7 A;  3OYB A;  2CH6 A;  3QBX A;  1XNQ K;  1VQ7 N;  3MWT A;  3LM2 A;  1ZYQ A;  4KHN A;  1RTI A;  4CZI A;  5AQP A;  1LWF A;  4CJW A;  5I9E B;  1NWK A;  4YDU A;  4K8X A;  4B1Z A;  3NHG A;  4DUZ K;  3SNN A;  2DY4 A;  3NCI A;  1XHX A;  5I42 A;  2WON A;  5GAD P;  1IBK K;  2PFU A;  2LSN A;  2O8E B;  3ZT2 A;  1HNX K;  3QO9 A;  5E26 A;  3IMX A;  2F4V K;  3VQ4 A;  3AA2 A;  3AVI A;  4DSI A;  4IDK A;  1WBD A;  3F2K A;  3C7N B;  3NF8 A;  4AIL C;  2UXD K;  3MK6 A;  2X78 A;  4NCA A;  3OVN A;  3OJU A;  1S1U A;  2UXB K;  4B3O A;  2OPR A;  4R79 A;  3VQB A;  4CBX A;  4DCH A;  3EZ5 A;  1GOB A;  3KD5 E;  5M1F A;  2IS3 A;  2HHS A;  4PA1 A;  1QE1 A;  3L8B A;  4B9L A;  4OKE A;  1MDU B;  4KI4 A;  5AQQ A;  1IG9 A;  3E9O A;  1VSJ A;  4ID5 A;  5HRP A;  4KHP K;  3CM6 A;  1U2V A;  4DLG A;  4JKE A;  2NRV A;  4BC2 A;  3FR0 A;  3ZT4 A;  4BR0 A;  4JK7 A;  5AQI A;  3NAE A;  5LMU K;  4CHO A;  4CJS A;  2P9N A;  3VA3 A;  1WSG A;  4DQ8 A;  1W9H A;  3K5M A;  2BE2 A;  4FJH A;  1YIT N;  2BUP A;  3ASM A;  1BUP A;  3I8D A;  5HRS A;  2P9L B;  3VF2 A;  4FLT A;  5KGX A;  3OYL A;  5HLF A;  4JD2 A;  1LV5 A;  1DKG D;  4EHU A;  1HQU A;  5I3U A;  4H0Y B;  2HOE A;  3D2F B;  3K5N A;  4G9Z A;  2P9N B;  4JYA K;  1HJO A;  3RR8 A;  1HNV A;  1D9F A;  3TAE A;  3PX4 A;  4CZL A;  2VQF K;  2FLO A;  2F96 A;  2QXL A;  1RDB A;  2RKI A;  1VSL A;  5J1E A;  4FXD A;  4FWP A;  3HO1 A;  4GV6 A;  1YJ9 N;  3OYN A;  4IFV A;  1NGH A;  1QQC A;  3PO5 A;  2QWN A;  4DU3 A;  4A5B A;  2XY7 A;  2KKZ A;  2UUB K;  4DQS A;  4W5N A;  2HBK A;  1S1W A;  1U48 A;  4I9Q A;  1VQ6 N;  3VQ7 A;  2Z1I A;  3NH2 A;  4KPY A;  3CCL N;  1XQS C;  1VSK A;  3NGI A;  4E3S A;  1S6Q A;  4DMN A;  1ZBU A;  1HRH A;  4E7H A;  4J2A A;  4KHW A; 
#chains in the Genus database with same CATH homology
 3AVK A;  4KHS A;  3CFO A;  3RMC A;  1RCH A;  4F3T A;  2KZZ A;  3TI0 A;  2Y1I A;  3OYM A;  1RT2 A;  2IGI A;  3VQQ A;  4RW7 A;  4O5B A;  4DTN A;  3SQ2 A;  3SPZ A;  4FCY A;  2G8F A;  4PY5 A;  3TR8 A;  3AVG A;  3G0Z A;  4Q5V A;  4AHC A;  3E01 A;  3QER A;  3U3Y A;  3AVA A;  3NF7 A;  4CEF A;  3NBP A;  1EKE A;  2VG5 A;  2XRI A;  4KHQ A;  4M3Z A;  3TAR A;  1HYS A;  1NKC A;  1GOC A;  3SQ0 A;  3OYA A;  4C8N A;  3SCX A;  3U6F A;  4Z4F A;  4DS5 A;  2HHQ A;  4DSE A;  2ZQB A;  1U47 A;  3CG7 A;  3HPO A;  1RTJ A;  1VK0 A;  4BWJ A;  1RBU A;  2P5O A;  1IH7 A;  1IKV A;  4IFY A;  4OGC A;  4FK4 A;  1JLQ A;  1RT3 A;  4FLZ A;  1U49 A;  2D0B A;  3OYE A;  3AVJ A;  1IO2 A;  1TKZ A;  4CJL A;  4CIE A;  4CK3 A;  4FZY A;  4N76 A;  4CIF A;  3QIP A;  1KCF A;  1EP4 A;  2HHW A;  3AO5 A;  4Z4G A;  4I2Q A;  1BHL A;  4CK1 A;  4KRF A;  4CEQ A;  1SKR A;  3NF6 A;  1WLJ A;  2HB5 A;  3A2F A;  3LP0 A;  4AHU A;  5KRS A;  2JGU A;  1FKO A;  3PX6 A;  4NCB A;  1ZBI A;  1WN7 A;  4F2S A;  2F8S A;  4GVM A;  4BE0 A;  3SJJ A;  4JS5 A;  3T19 A;  1QSY A;  4CJU A;  5C42 A;  5C24 A;  2P51 A;  1KLM A;  4KAZ A;  1S5J A;  3HP6 A;  3L2W A;  3AA4 A;  2BDP A;  3ZT0 A;  3QEW A;  4HCB A;  1HYZ A;  1JLB A;  3KLH A;  1BI4 A;  1RBS A;  1BIS A;  2QK9 A;  3SYZ A;  1L3U A;  3KJV A;  4B9S A;  4FK0 A;  4AH9 A;  1DLO A;  3LPU A;  2XY8 A;  2E6L A;  3AVF A;  4CFC A;  5KTQ A;  4DTR A;  1A5W A;  1WNS A;  3DLH A;  1DTT A;  4IKF A;  1Z25 A;  4CE9 A;  4DG1 A;  5KGW A;  4ELT A;  3L2Q A;  2B6A A;  2DTU A;  2Q3S A;  4Y1D A;  3L3V A;  4M3T A;  4KHY A;  1HPZ A;  2EX3 A;  3ITH A;  4CK2 A;  4E7I A;  3O4Q A;  2A1R A;  4Y1C A;  1RDD A;  3NF9 A;  4N5S A;  4B9M A;  2OZS A;  1CZ9 A;  1IKY A;  5J2N A;  4KV8 A;  4IBN A;  1QTM A;  4E0D A;  5J2P A;  3AA5 X;  3HPG A;  1NJW A;  3DI6 A;  4DF8 A;  4LD0 A;  4RW6 A;  4FW2 A;  4IG0 A;  4M3X A;  4B9V A;  4KO0 A;  4ZTF A;  3LP2 A;  3OS2 A;  3TAN A;  1SKW A;  3D0P A;  4JRP A;  3M8S A;  2XY6 A;  2KFN A;  4MQ3 A;  1RT6 A;  3HT3 A;  3OYK A;  3V9S A;  4I2P A;  1UA1 A;  1NJY A;  2GUI A;  3PO4 A;  4N56 A;  1Y97 A;  1RT1 A;  5SWM A;  3BGR A;  4CHZ A;  4CEB A;  4NYF A;  4OPJ A;  2EHG A;  1IKW A;  2F8T A;  3V1Q A;  5DMR A;  1NJZ A;  2FBY A;  3ALY A;  4KHW A;  3QEV A;  3LWM A;  4KKO A;  4OGE A;  1NJX A;  1EX4 A;  1HJR A;  2YKM A;  1KTQ A;  1FXX A;  1BGX T;  4I7F A;  3HVT A;  3DLB A;  4HTU A;  1CXU A;  4HUF A;  2KQ2 A;  1TKD A;  3KLG A;  4BDP A;  4XIU A;  3VQP A;  3QEP A;  4CF9 A;  1WSJ A;  3QEI A;  1ASW A;  4HVJ A;  3RWU A;  2XY5 A;  1CXQ A;  4DQR A;  1KVA A;  1X9M A;  1TK8 A;  4DWI A;  1RIL A;  4B8C A;  3L3U A;  5JS2 A;  3LAL A;  4CGG A;  3AVN A;  1JLE A;  2HVI A;  1KFS A;  3KD1 E;  4WE1 A;  1KVC A;  2OPP A;  1U4B A;  5J2M A;  3AO3 A;  4HUE A;  2ZD1 A;  1VSM A;  4H4O A;  4CJQ A;  2PYL A;  4I9L A;  2W42 A;  2WOM A;  1XI1 A;  1TK5 A;  3JSM A;  2G8I A;  1TV6 A;  3MEC A;  4DF4 A;  3PY8 A;  3V9X A;  4F3O A;  4QOZ B;  4E7K A;  1SUQ A;  3P1G A;  3AVM A;  1WAJ A;  5HBM A;  3ZSO A;  4B8A B;  4R5P A;  3PV8 A;  1S9E A;  3AO2 A;  4CEE A;  4E7L A;  1U48 A;  4KB1 A;  5C25 A;  2KZM A;  4RW8 A;  4J2E A;  3HP9 A;  5CYM A;  1VRT A;  3G10 A;  3UIQ A;  3ZSQ A;  2RN2 A;  3V9W A;  1JLA A;  1TAU A;  4CED A;  4FJG A;  5CZ1 A;  3VQA A;  1I39 A;  3QNN A;  3RTV A;  4B9T A;  1TKT A;  3TAP A;  3VQ8 A;  3AA3 A;  2KTQ A;  2YHA A;  3HST B;  2IDO A;  2YNH A;  2FBX A;  4TSX A;  3M8Q A;  1ASV A;  1ZBL A;  1SL2 A;  1JLC A;  4DSJ A;  1C1B A;  2Z1G A;  5SZT A;  4FM2 A;  4FLV A;  1D8Y A;  3KLI A;  1C0T A;  3AVB A;  1L3S A;  3BDP A;  4C8M A;  1J9A A;  1C0U A;  4Z4H A;  3C6U A;  3MEG A;  4J2B A;  4DFP A;  2Y1J A;  4O4G A;  3I0S A;  1TGO A;  4JLH A;  5FRN A;  3DOL A;  4CF1 A;  5K14 A;  3CM5 A;  3HL8 A;  4CGH A;  1L3V A;  1RDC A;  3LAN A;  1WSE A;  4DTJ A;  3S3M A;  4FJN A;  1YTU A;  4ID1 A;  2HVH A;  4FZX C;  1S6P A;  1UWB A;  1XC9 A;  4KTW A;  1FKP A;  4AHT A;  3OYG A;  1YT3 A;  1ZBF A;  2HHT A;  3MXM A;  2PYJ A;  1CLQ A;  1HQE A;  3KK3 A;  4M41 A;  3OYJ A;  4FK2 A;  4DLE A;  4FLX A;  2QXF A;  4DU4 A;  1X9W A;  2IAJ A;  4O55 A;  3V6D A;  3LZJ A;  1VSI A;  3OJS A;  1N5Y A;  4JS4 A;  3NGZ A;  3KK1 A;  1KLN A;  4L8R B;  3JYT A;  4FJJ A;  1ZBH A;  1S1T A;  1B9F A;  3QNO A;  4ZHR A;  5E41 A;  2HNY A;  3CFP A;  4KHU A;  3HJF A;  1LWC A;  3SQ1 A;  1NK6 A;  4FJ5 A;  4AHV A;  3CYM A;  3KLE A;  3SZ2 A;  1EXQ A;  1WAF A;  2AJQ A;  1T05 A;  2HNZ A;  4CHQ A;  3LP1 A;  3IS9 A;  4QAG A;  4CHY A;  1NK0 A;  4C8K A;  4CJV A;  4Q0B A;  4OKJ A;  3ZSR A;  2OA8 A;  1TL1 A;  4K8Z A;  1RBT A;  3IG1 A;  3C95 A;  4B08 A;  3THV A;  4HUG A;  3SUO A;  2OYQ A;  1D9D A;  3AVC A;  1BQM A;  2E4L A;  4CF0 A;  2A1S A;  2B4J A;  1BL3 A;  3ZCM A;  4M3U A;  4FM1 A;  2NUB A;  1UA0 A;  4M42 A;  1JLF A;  4DSL A;  4PUO A;  1RBR A;  2R7Y A;  3MED A;  1T03 A;  5DK5 A;  3K5O A;  3V81 A;  1JXE A;  4H4M A;  4DTS A;  5J2Q A;  1C1C A;  5CY4 A;  4CJE A;  4EP4 A;  2ETJ A;  3P5J A;  3LDS A;  3PUF A;  1A5V A;  3MEE A;  3VQD A;  3WNH A;  3DMJ A;  3LAK A;  3F73 A;  1Z26 A;  2PY5 A;  1A5X A;  1BQN A;  1CZB A;  2DFE A;  3LWL A;  3ZSZ A;  3LP3 A;  2G8H A;  2QKK A;  2RPI A;  3ZSV A;  3TAM A;  4CJ3 A;  4DU1 A;  3SUN A;  4LSL A;  3RMB A;  4KB0 A;  2X74 A;  2OPS A;  3WNF A;  3OS1 A;  3TAG A;  1T8E A;  1QSL A;  4FVM A;  1VSH A;  2FBT A;  4OLA A;  1L3T A;  4CEC A;  1BIZ A;  2YKN A;  3NH1 A;  3MXI A;  4DSF A;  3ULD A;  1VSF A;  3ZSW A;  4Z4I A;  1ITG A;  3AO4 A;  1NKB A;  1RDA A;  4M3W A;  4CJ4 A;  2HW3 A;  5KI6 A;  3L2U A;  3O4N A;  4DSK A;  4DFM A;  1O1W A;  1C0M A;  3KKR A;  4B9U A;  3ISN C;  1Q9Y A;  1X1P A;  4CJT A;  4CJK A;  3TAB A;  4ELU A;  4HHT A;  2GV9 A;  4DTU A;  4DTP A;  4KTZ A;  2G8U A;  2YNG A;  5FRO A;  5JS1 A;  2YHB A;  3TWH A;  3C94 A;  3K2P A;  1REV A;  4Z0U A;  4BE2 A;  4I9Q A;  4CGJ A;  1R0A A;  4PQU A;  4W5O A;  4OLB A;  4QCL A;  4CGD A;  4FJX A;  3HXM A;  2YNI A;  3OYH A;  2P5G A;  2VWJ A;  3VA0 A;  4BDY A;  2G8W A;  2D5R A;  3SUP A;  3NFA A;  4DFK A;  1TL3 A;  3SQ4 A;  2HMI A;  3PX0 A;  5CZ2 A;  3TAQ A;  4CGF A;  4N41 A;  3S3N A;  4DQP A;  4UQG A;  3S9H A;  4FLY A;  4C8L A;  4F4K A;  3VQE A;  3K59 A;  5FRM A;  4LH4 A;  1UAX A;  3VQ9 A;  4H8K A;  3O3H A;  1RTD A;  2VWK A;  1NOY A;  1QSS A;  1TVR A;  4FYD A;  1BCO A;  3D45 A;  4ELV A;  1KSP A;  4LH5 A;  1U04 A;  4ICL A;  4CFD A;  1HYV A;  3DLE A;  3DLR A;  3LPT A;  4O0I A;  4BE1 A;  3SV4 A;  2RF2 A;  2YV0 X;  1NK7 A;  2HHV A;  1S1X A;  3LAM A;  1SL1 A;  2XHB A;  4F8R A;  4DTM A;  4E89 A;  4O44 A;  4CF2 A;  4CIG A;  2I5J A;  2O4G A;  1RNH A;  3QES A;  3AVH A;  2BGG A;  3DRP A;  4F2R A;  4E1N A;  3B6P A;  1DTQ A;  4CF8 A;  4EP5 A;  4LY7 A;  5KRT A;  3RRH A;  1LW2 A;  3HM9 A;  4E7J A;  3RRG A;  1UOC A;  3ZSY A;  3O3G A;  3NE6 A;  1U45 A;  1XHZ A;  3OS0 A;  1XWL A;  2GBZ A;  4M3Y A;  2ZE2 A;  3WNE A;  1Q8I A;  1RT5 A;  3OYC A;  4CHN A;  3KIO A;  3P83 D;  4CFB A;  2IOC A;  2Z1J A;  3FFI A;  1L5U A;  3KK2 A;  3L2V A;  4CFA A;  3KKS A;  2HHX A;  1RT7 A;  3OYB A;  2G8K A;  5HP1 A;  3V4I A;  4CGI A;  4B9N A;  3K5L A;  4CJP A;  2D0A A;  3KTQ A;  1B9D A;  3F9K A;  4RG8 A;  3EY1 A;  3OY9 A;  4FM0 A;  4FLU A;  1ZYQ A;  1GOA A;  4W5R A;  4FJ8 A;  1JKH A;  4FJM A;  4OJR A;  1NK5 A;  2D0C A;  1NK9 A;  4KHN A;  1RTI A;  2X6N A;  4CEA A;  1VSD A;  3NH0 A;  2G8V A;  3OYD A;  1LWF A;  4CES A;  4CJW A;  1SL0 A;  4GW6 A;  4CJF A;  2IC3 A;  3QIN A;  1NKE A;  4K8X A;  3L2R A;  3DYA A;  4MFB A;  3NHG A;  4N47 A;  3K57 A;  3SNN A;  1TK0 A;  3HK2 A;  2DY4 A;  5HRR A;  3ZT3 A;  3NCI A;  1XHX A;  5I42 A;  2WON A;  4YFU A;  4DQI A;  2LSN A;  1ASU A;  5HRN A;  3ZT2 A;  3OYF A;  3DRR A;  3QO9 A;  3QLH A;  1VRU A;  3M8R A;  4BAC A;  3QET A;  1EET A;  3V1O A;  4OKK A;  4C8O A;  3T3F A;  3VQ4 A;  3AA2 A;  3NGY A;  2ITG A;  3HPH A;  3VQ5 A;  4LSN A;  3SI6 A;  3AVI A;  4M45 A;  4AHS A;  4DSI A;  3MAQ A;  4OVL A;  3B6O A;  4IDK A;  3V9Z A;  3IAY A;  3NF8 A;  4AIL C;  4FJL A;  3VQC A;  2OPQ A;  3WNG A;  2X78 A;  1LW0 A;  3RMD A;  4NCA A;  1JXB A;  1K6Y A;  4EZ6 A;  3CQ8 A;  3OVN A;  3OJU A;  1KVB A;  4CEZ A;  4IG3 A;  2O4I A;  3TAF A;  1Q9X A;  1S1U A;  4B3O A;  2OPR A;  3DLK A;  1HMV A;  3VQB A;  1JL1 A;  1GOB A;  3EZ5 A;  1FK9 A;  1G15 A;  2DFF A;  4DTX A;  2IS3 A;  3RMA A;  3KD5 E;  3SV3 A;  2HHS A;  4PA1 A;  1RBV A;  4FLW A;  4FJI A;  3S3O A;  3DM2 A;  1QE1 A;  3DRS A;  3L8B A;  4B9L A;  4OKE A;  4AHR A;  2XO7 A;  4KI4 A;  3SUQ A;  3VN5 A;  4FJK A;  2KFZ A;  1IG9 A;  1RTH A;  1VSJ A;  4ID5 A;  5HRP A;  3CM6 A;  4J2D A;  4DLG A;  1J54 A;  4YNQ A;  3ZT4 A;  1NK4 A;  1X9S A;  2VG7 A;  2PZS A;  1LAV A;  3QEX A;  4NCG A;  4W5T A;  4W5Q A;  3NAE A;  5EU7 A;  3HVR A;  2KW4 A;  4CHO A;  4CJS A;  1S1V A;  2Z1H A;  4G1Q A;  4CJ5 A;  3VA3 A;  1WSG A;  1J53 A;  1W9H A;  1KFD A;  4KFB A;  5HRO A;  1N6Q A;  4OPK A;  3DLG A;  3K5M A;  2BE2 A;  4FJH A;  3SPY A;  3MXJ A;  3VQ6 A;  3AV9 A;  3DOK A;  3ASM A;  1BCM A;  1B92 A;  4E19 A;  1HNI A;  3OYI A;  3CFR A;  1YVU A;  3I8D A;  5HRS A;  1S9G A;  1TAQ A;  4FLT A;  5KGX A;  3LZI A;  3ZT1 A;  4FJ7 A;  4Z4C A;  3OYL A;  5HLF A;  4GMJ B;  1LV5 A;  1IKX A;  2JLE A;  1W0H A;  1HQU A;  5I3U A;  3NDK A;  4Z4E A;  3I0R A;  1WSH A;  3HYF A;  3K5N A;  4PWD A;  4CCH A;  3RR7 A;  4RW4 A;  3KLF A;  2YNF A;  2ATQ A;  4E1M A;  1T7P A;  3IRX A;  1TKX A;  1JL2 A;  3RR8 A;  1HNV A;  4DS4 A;  1D9F A;  3K58 A;  4DQQ A;  1WSF A;  4M3R A;  3TAE A;  3PX4 A;  1JLG A;  4CHP A;  2BAN A;  2F96 A;  4ZTJ A;  4FJ9 A;  1RDB A;  2HND A;  5T7B A;  4DFJ A;  3O3F A;  3V9U A;  3AVL A;  2E6M A;  2RKI A;  1VSL A;  4KTQ A;  1LAW A;  3C6T A;  3H08 A;  5J1E A;  4FXD A;  3AO1 A;  3HO1 A;  4BDZ A;  4BWM A;  3T1A A;  3M8P A;  1I3A A;  3OYN A;  4IFV A;  1QQC A;  1WSI A;  2P1J A;  3PO5 A;  4DU3 A;  4JRQ A;  1SKS A;  4DTO A;  4KRE A;  1F21 A;  4O0J A;  2XY7 A;  4EZ9 A;  2X6S A;  3QIO A;  2VG6 A;  1VSE A;  1J5O A;  4CEO A;  4DQS A;  4W5N A;  1S1W A;  5FDL A;  1QHT A;  1QS4 A;  5CYQ A;  3U3G A;  2Z1I A;  3VQ7 A;  2B5J A;  3V1R A;  4FW1 A;  3NH2 A;  4KPY A;  4KI6 A;  1NK8 A;  4FZZ A;  1RT4 A;  1NOZ A;  1BIU A;  1VSK A;  3NGI A;  1C6V A;  4CJR A;  1C1A A;  1SV5 A;  1MU2 A;  2DFH A;  4RW9 A;  3EYZ A;  1S6Q A;  4E3S A;  1KRP A;  2FBV A;  1LWE A;  2OZM A;  2FC0 A;  4CER A;  1ZBU A;  4DMN A;  4HCC A;  2QKB A;  1HRH A;  1BI4 B;  4E7H A;  4J2A A;  3ZSX A;  5D3G A;  4NYN A;  2HHU A;  1YTA A;  1D5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...