4IO9L

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4io9L01
3I56N 1Q86O 3CCLN 5H1SQ 3CXCM 2OTJN 1YIJN 1Q81O 1VQ8N 1KD1O 1VQMN 1W2BM 1K73O 3CCMN 1KC8O 3CCEN 3CD6N 3CC7N 1VQLN 4U67L 1N8RO 2QEXN 1VQNN 3CCSN 1VQ6N 4UY8O 4IO9L 3CCUN 3CPWM 1VQ9N 3CMEN 1Q7YO 4IOAL 5HL7L 1YJ9N 1YJNN 4WCEL 3CC2N 3CCQN 3CCJN 3G71N 5GADP 3OW2M 1VQON 4WFAL 5DM6L 1VQKN 1QVGM 4IOCL 5GAHP 5GAEP 2ZJPL 1VQ7N 4WFBL 1YHQN 5GAGP 1VQPN 1M1KO 3I55N 2ZJRL 1YJWN 3G6EN 1S72N 5DM7L 1Q82O 1OVYA 1VQ5N 2QA4N 3PIOL 1QVFM 4WF9L 3CF5L 1YITN 3CCRN 5JVHL 3G4SN 1K8AO 3DLLL 5MLCQ 2ZJQL 3CC4N 5JVGL 1M90O 1JJ2M 1NJIO 3CCVN 3CMAN 1KQSM 4WFNL 1ILYA 1K9MO 3J7ZO 1YI2N 3PIPL 1VQ4N 2OTLN
chains in the Genus database with same CATH superfamily
1C6VA 1BG3A 3J7AP 4LF5K 4FPAA 3QFUA 3AVFA 3ZSQA 1Q81O 3LP3A 3LP2A 3KKSA 4I7FA 3MAQA 4MO5A 4M3WA 1C1CA 1LWFA 2NRWA 3C94A 3M8RA 2VWJA 3DOLA 3G10A 4FVMA 2O8FB 4JRQA 1NJWA 1CZ9A 3VF4A 3V9ZA 3AVLA 4A2BA 4DUYK 1S6QA 3PX0A 4CD3A 4DTUA 3PV8A 5AR0A 2ZGZA 4FCYA 1VQ6N 2HF4A 2HOEA 3L8BA 4DTPA 4LF7K 3AAQA 2OCEA 1JCFA 2P9UA 1HRHA 4OLBA 4H5TA 3SV3A 4LF9K 3QFPA 1RTJA 3OW2M 1A5XA 1FKPA 3ZT1A 1U6ZA 1KXPA 1W7AA 5CYMA 3DMJA 4DR1K 3TAMA 3K5MA 1YHQN 3CFPA 3HP9A 1HPMA 2F8SA 3VQ6A 4IKFA 1WB9A 3QB0A 1TK0A 3LPUA 3MCPA 1BWFO 1BGXT 2OA8A 1NK0A 1SV5A 1BA0A 4BRHA 1QE1A 1XHZA 4E7KA 2Y1JA 3K5OA 4K42A 1TVRA 2YKNA 5AQPA 1SQKA 4BRIA 2ZJQL 4CBXA 3U3GA 3MEGA 4FWPA 4LF4K 2O8DA 4A59A 4MQ3A 5FPNA 3T3FA 2O8CB 3QIPA 1Z6RA 4A57A 2GELA 3O4WA 3DXMB 2QW9A 3NGYA 2YNIA 4BC5A 5TKWA 1UOCA 4LFBK 2A40A 5KI6A 2HF3A 4E7IA 4JNEA 4X62K 3NAEA 4NXNK 3V9WA 4CK2A 2VCPA 1RTIA 4FZYA 1BISA 4H5WA 2HW3A 2CGKA 4EAHD 2HHQA 5M1NA 3KK1A 3ZX2A 4DQSA 4DUZK 1BDGA 4NLBA 3J80O 3HYFA 4DFKA 1NKEA 4GV3A 2X6NA 4JLHA 4DTJA 4DV6K 2IVNA 5EX5A 2E2QA 3K5LA 1D4XA 1BU6O 4GV6A 1ASUA 4HTLA 2WOMA 3T69A 2P9LB 4E7JA 1GLDG 1GLCG 1LOTB 5C10A 3VESA 3WXMB 4OPJA 4CGDA 4KREA 3K0SA 4DFJA 2UUAK 4H0PA 1HUXA 4WFBL 1VQPN 3TPQA 2PYLA 3ALYA 1NK8A 4BRQA 1Q82O 1WNSA 1TV6A 4KHNA 3O3FA 5C25A 2HNZA 3DLBA 4CEEA 3VGKA 4DSJA 4DV3K 3O1WA 3OJUA 3GE1A 4B1WB 3MCAB 2X74A 4LY7A 3MXIA 1E4GT 1VSEA 5I9EB 1K8KB 3K5NA 5LJWA 4CIEA 4CHNA 1O1WA 5AQIA 3QETA 4KRFA 3DRPA 4H0XB 4B9MA 4BRDA 1NOYA 1U2VB 4C1NI 4OPAA 2E1YA 1NK4A 1NM1A 2E2OA 4AHRA 4JEPA 3VQPA 3J8AA 1YI2N 3VF2A 4CHQA 3AO3A 5BR9A 1VSDA 3MX2A 4E1MA 4M3XA 2QWNA 4DB3A 3AO1A 4AHCA 1IKYA 4YFUA 4BE0A 3D2FB 5JS2A 4CBWA 5AQKA 4F9OA 3N4QA 5J1EA 3L2VA 4OX9K 1XHXA 3UKRB 1C0TA 1Z05A 4YOTA 3QESA 4B9SA 1QZ5A 4DQPA 3LDLA 3WQTA 2H3GX 3LAKA 4Y1DA 1VSJA 3VENA 4UY8O 3MECA 4GMJB 1WSGA 4RW6A 1DTTA 1C1BA 4KBOA 4FW2A 4FJJA 1VQ9N 4IOAL 3AA4A 2ZF5O 4Y1CA 5SZTA 2J4RA 1HPZA 4I6MA 4J2DA 2HHXA 3A5LC 3SQ0A 2WUSA 4FW1A 3NH2A 2BDPA 4CJEA 4WFAL 3AVNA 3ENHA 2P9KB 3TSQA 4GKJK 2GV9A 2O8BB 2YX6A 1NKCA 3ULEB 4NCAA 3NFAA 3IAYA 4Z4CA 1IJJA 4N41A 1GOAA 1G15A 2F96A 1X9SA 1G99A 1IG8A 5AQNA 2BANA 3KWGA 1BO5O 4EHTA 2FLOA 4CZEA 3MDQA 1ZBLA 3OYMA 3RMCA 4CGHA 3V1QA 4HUEA 1D9FA 1IV0A 4H5NA 1TUYA 1YF5L 2ZE2A 1X1PA 3WEEA 2VQFK 3K9JA 4M3ZA 2BUPA 4GV9A 3WXLA 2IAJA 3KK3A 3VMFB 5AFUH 2KFZA 2V51B 2NRTA 3KZBA 4CE9A 5LMNK 1KQSM 1CXUA 4B1YB 3TANA 3H46O 4CEZA 4IEIA 3MXJA 1XC9A 1N34K 1TAQA 3RRHA 1EWRA 4CZIA 1X3NA 3PX4A 1KRPA 4FYDA 1C0GA 4J2EA 4IWVA 2VGMA 3ID6A 4PHTX 4CGJA 3B6PA 4M3TA 4AM7A 2IVPA 4PY5A 3ATVA 4OKJA 3C95A 2ETJA 1NWKA 4CI6A 2NRXA 4ISFA 3AVJA 4RW9A 1WN7A 3TSUA 4M3YA 4EFHA 3DWLA 1UA0A 3TAGA 1OH5A 1Y64A 3PO5A 5M1FA 1NGCA 1U04A 3OYBA 5AZJA 3T1HK 1HNXK 1BOTO 1OKJA 3AGKA 5CZ1A 3V1OA 1YJ9N 1YJNN 3LAMA 4PKHA 4N5SA 1NK7A 1T05A 4CFAA 3AA2A 3G71N 3O4NA 4E7LA 3ENOA 2IVOA 1S1WA 1ZBUA 2OPQA 4JV5K 1HKCA 1WOQA 3U8XA 3T1YK 4FM2A 1EETA 4LF6K 4B8CA 4X65K 1LW2A 4H0OA 1XC3A 2RPIA 3SUQA 3AVKA 1QQNA 3L2UA 1A5VA 4DU4A 5J2QA 5EY4A 3C6UA 3HSTB 3D2EB 2YKMA 5BRFA 1RCHA 5BR8K 3RR7A 3EZWA 3V1RA 2KLAA 4RG8A 2VGNA 3L0QA 3J7YP 4MLEA 2HHVA 1LV5A 3U9ZA 2ZM6K 2PY5A 3EEQA 5LY3A 4FLTA 3ZSVA 5FLXO 4B9TA 1WLJA 5M1OA 4FLYA 1WAFA 1GLAG 1QZ6A 1NJIO 2G8IA 2NRHA 2ZD1A 5IWAK 3EZ5A 4DR6K 3ZLJA 1WSEA 1JLAA 1TK5A 2OPSA 4PUOA 3OTOK 1B9FA 3MWTA 1BI4B 2F8TA 4ILJA 3LPTA 4JD2A 3S3MA 4CBUA 2CGLA 1J54A 4JHDA 1NGGA 3K59A 4BDZA 4BQLA 4E19A 3EY1A 4E7HA 3JSMA 1TKDA 3WT0A 1KCFA 4HCCA 3A8YA 1S5JA 4LSNA 1S9GA 1NU0A 4HVJA 2G8UA 2FSJA 1K73O 2D4WA 1SKRA 1KAZA 2QXLA 1JCEA 2Q0UA 5BRDA 4DCHA 5FRNA 3OJSA 2P5GA 4PQUA 4B08A 4W5OA 1TL3A 3CJ1A 3V9SA 2G8HA 4JKAA 3C6TA 3R3LA 2XY7A 1L3VA 4EZ9A 4FWMA 1NGIA 1NJZA 4QOZB 2A5XA 3AVAA 3CCJN 4DR3K 1H1VA 4RW4A 1VSMA 4JS4A 3R1XA 1W0HA 4BC4A 4DR7K 4FZXC 1VQKN 1VRUA 2W41A 3MN5A 3OY9A 4L8RB 4CGFA 5AQWA 4DKWA 3I8DA 3M3ZA 2Q2RA 5KPTA 4DV4K 3ZCMA 4QS8A 3GOIA 3VQ9A 2WBNA 4FJ5A 4JI0K 1CZBA 1VQ5N 1YVUA 2E6MA 4JN4A 4CJ7A 3OYGA 2A42A 3OS2A 3D6RA 2YI1A 4A61A 4B9UA 4BR2A 1TYQA 2KZZA 4AHVA 2VWKA 4PL8A 3SPYA 3SUOA 4BVOA 3U6FA 1K6YA 4Z4GA 3DLLL 4NO7A 3M8SA 3CC4N 4H03B 3VN5A 4FWQA 1SUQA 3FZHA 4OPHA 1UA1A 4BY9C 3F73A 3CMAN 3F2KA 2IC3A 4TSXA 3VTHA 1QHTA 1R0AA 5HROA 1LAVA 3C65A 3VQEA 2JGUA 4CESA 1NMNA 4JKHA 1VAZA 2QWPA 3AO2A 1TL1A 1UAXA 4CEBA 4QCLA 4LC9B 4C8NA 2FF3B 2E6LA 3L3VA 4AHTA 4KB1A 1MU2A 1FXXA 4F3OA 4NYFA 1T8EA 2IS3A 3GDQA 3ZEUB 2F7TA 3QIOA 4FM0A 4KTQA 2HHHK 2P9LA 2RKIA 4DR5K 3VEVA 2YHWA 3KLEA 5HRNA 3L3UA 1SL1A 1YUWA 1VQLN 4WQ5C 3KK2A 2GUIA 3I0RA 3M1FA 1B92A 3RWUA 3A5NC 4LF8K 3NMUA 1HNVA 3OYFA 3RSEB 5AFUA 4DR2K 4DTSA 4DV1K 2NRVA 1CLQA 3CQYA 4BWJA 1SZ2A 4BQZA 4BVPA 1RT4A 3DLKA 2IIRA 2UUCK 2OPPA 2HVIA 2JWLA 4KB0A 1SKWA 3CCQN 3OHRA 4CHZA 4KO0A 4YOUA 4FOEA 1S6PA 4IOXA 4CJRA 3QDKA 1GLLO 3O08A 1QVGM 4IOCL 4CJQA 1RBRA 4R5PA 2F4VK 4FJLA 1DGKN 3OVNA 2WTUA 4CIGA 2NLXA 1VSKA 3CJ9A 4BDYA 4DS5A 1ZBIA 3FLCO 3SZ2A 4O0JA 1EO1A 2DFHA 3WXKA 3S9HA 3OYNA 2BH1A 3LDPA 3THXA 2FF6A 2YJEA 4WQ4C 4RW7A 1TKTA 5HP1A 1O13A 5AQGA 2ASPA 1RBSA 2VG7A 4Y0WA 5JVHL 4FVUA 4AH9A 4OJRA 4BG8A 3PY8A 3HP6A 1QTMA 3TU5A 1NJYA 4DLGA 3OYHA 2HBLA 4DHYA 4DG1A 1OH7A 3H6EA 1U49A 2BE2A 2P1JA 5HRSA 2FSKA 4CJ5A 3BUZB 3ZX3A 2Y1IA 3D7EO 4BRMA 3QNOA 2UXDK 2A1RA 4J2BA 4K8ZA 5AQXA 2NUBA 3RMBA 3IG1A 4V19S 1NMDA 1NOZA 5GIOA 4BRKA 4H0VB 5KPZA 2XY5A 4Q5VA 3AVIA 3WUHA 1QSLA 1C1AA 2O8CA 2DFFA 4GVMA 3FR0A 5FDLA 1T6CA 4NB4A 2G8WA 4M3UA 1EKEA 4CW7B 2QTDA 2P9SB 4I2PA 4XH5A 4JKEA 4M63C 3SJHA 1IBMK 1DEJA 1RT5A 2RHKA 4CGIA 1RT7A 1N8RO 2P9KA 4YOWA 2QEXN 1RTHA 3O9RA 2I5JA 4B3OA 1JLEA 2Z1HA 5AQHA 4C8KA 3CJAA 4ELVA 1XWLA 4N47A 1S1XA 1Q7YO 3MN7A 4J2AA 4CJVA 4AHUA 4FJNA 3NF8A 5F1XA 5HLFA 3WNHA 4CF8A 2I7NA 4H4MA 4M7YA 5HOOA 1X9JA 3VEYA 3SMPA 1XQSC 3VQ8A 5ADXH 1J9AA 3BZKA 4CFDA 5I3UA 3DXKA 3A2FA 4IXCA 3AVMA 4Z4HA 3VEWA 1ATSA 3A5MC 1OVYA 1KAXA 1W97L 5T7BA 1IKXA 5F2RA 4EHUA 4K41A 1WUAA 3T1AA 4DS4A 1MDUB 4BRGA 5EVZA 4LFCK 3P5JA 4DV2K 4RCHA 3VGLA 4BR7A 2F9WA 3KWIA 2QWOA 3CCRN 3VA3A 4C23A 4CK1A 2EX3A 3EKSA 4NXMK 3SJJA 4DTNA 1HNIA 3VTIA 3LDQA 3MN6A 4BROA 1T03A 4WFNL 1ILYA 4B1ZA 4KHQA 2Q31A 3AA5X 2PAVA 4JKBA 2OTLN 4JKFA 1HKGA 2FBXA 1FKOA 3WNGA 5E26A 5C2FA 1RDAA 1YAGA 1HX1A 3P38A 4FWNA 3TR8A 4DQ8A 2OTJN 1YIJN 2VYPA 5AZIA 1U2VA 4YOVA 1KFDA 3KLFA 3MXMA 5AQFA 1SAZA 2CH6A 3SQ1A 3CM5A 3BZCA 3HVTA 1VK0A 4CJTA 3S3OA 5AQOA 2WC9A 1HR0K 4LFAK 3ZYYX 1CZAN 4U67L 4IFYA 1I3AA 1JLFA 1WAJA 2FXUA 3AVGA 4I2QA 1KAYA 4JI1K 3CI5A 3TAFA 4CZKA 2RN2A 3F5TA 4FWLA 1NGEA 4CK3A 3KKRA 1IBKK 3CC2N 3N4PA 4FJHA 4I9LA 4DR4K 3ZSWA 4CEQA 4DFMA 3IKMA 1HQUA 5TKYA 1HNZK 1VRTA 5GAEP 3OYAA 5BN9A 5B8HA 1NK5A 1LAWA 3KLIA 4JKGB 2P9IB 4I6MB 1R59O 3KK7A 2RF2A 3SK3A 3CQXA 1JXBA 4CEOA 5C12A 4HWIA 1OVQA 3DLRA 4C1NK 1X3MA 3MK6A 5KGWA 3ZT0A 4JD2B 3SMSA 4M42A 3WNEA 2O8EA 3O9SA 3D0PA 3V6DA 4XH4A 3KJVA 3V81A 1SS6A 1E4FT 3G4SN 1K8AO 4HCBA 5MLCQ 2O8FA 2D0AA 2A1SA 3JYTA 4ZTJA 1YVNA 5JLFA 2YV0X 3QINA 4U7BA 4ID1A 2E5LK 2KKZA 2YNGA 5C0YA 3UKUB 2E2PA 4F2RA 3VQCA 1JL2A 1TKZA 1X9WA 2AJQA 1T7PA 5BN8A 1U4BA 4PWDA 3CCLN 1HYZA 3VGMA 5LJVA 4IG3A 3KIOA 3HPHA 4X66K 3UB5A 1MA9B 1ATRA 1KD1O 3WXJA 4YY3K 3E1YA 3THYB 3PX6A 3KD1E 3ZSOA 4KAZA 3NHGA 5C42A 3TAEA 1F21A 3VF6A 3OYEA 4F4KA 4N76A 3I8BA 1ASVA 2ATQA 2ZWHA 4DF4A 2HB5A 3VEZA 1NJXA 2V52B 4B8AB 1P90A 3P83D 3DAWA 4CZLA 4BC3A 3ULDA 4FLXA 1J53A 2HSTA 1W9HA 1RFQA 1RT1A 3RMDA 4BR0A 2D0BA 1KLNA 1RBVA 1S1UA 2WONA 1QQCA 4CF2A 2XY6A 1ZXOA 3HOSA 4BRPA 1U45A 1DTQA 1SL0A 2O8DB 3OYKA 3VOVA 1RGIA 4O5FA 3HPGA 3VQBA 1P8ZA 3KTQA 3CJCA 1D5AA 3DYAA 1VSFA 4PKGA 3DXMA 2W6KA 3RR8A 4G9ZA 2B6AA 3FZFA 4B9NA 4OKEA 3AARA 5F0XA 1EP4A 4B3RK 3QEIA 4KHWA 3OBWA 4PKIA 1N5YA 3HJFA 5DMRA 3BDPA 4CJSA 2FBVA 3WQUA 3HK2A 1I39A 1RILA 4Z4IA 4B9LA 5AQZA 1KVCA 3SBTA 3I0SA 4E1JA 4FWSA 3HOTA 1L3SA 1J5EK 1LWEA 3PSIA 4AF1A 3TTCA 4DSEA 3ZSZA 2HMIA 3PO4A 3PIPL 2KW4A 4F8RA 1VQ4N 4CF0A 3E9LA 3I56N 1Q86O 3O9TA 5EXWA 1QS4A 5HRRA 5C15A 1E3MA 4Z94A 2E88A 3ZETB 3S3NA 2GWJA 4LH4A 3OS1A 4CZJA 4HTUA 4DV7K 1VSHA 2FBYA 1KTQA 1IG9A 5KRSA 1VQMN 3SLCA 3O3HA 3PSFA 3VQ7A 4MO4A 5CR4A 4FOIA 2HHSA 1BI4A 4LSLA 3TTDA 3L6QA 3QMLA 3VEXA 2YHYA 5SWMA 1MWKA 5KQ8A 1KFSA 1JLGA 2P9PB 3THWA 3ENBA 5M1KA 3CMEN 1OH8A 4BGBA 3R8EA 1U48A 3HBTA 3NVKA 2RE2A 2D1KA 3EE8A 5K14A 2GEMA 3LWMA 3C7NA 2UXBK 3P1GA 3SI6A 2QM1A 4KHYA 4O8UA 4BACA 5JS1A 4EP5A 2D5RA 4EIAA 1XNQK 1EQYA 4FJ9A 2NZTA 4BDPA 2Z1IA 2XO7A 1XUPO 3H1VX 3SBGA 4IZ9A 5ELZA 3KLGA 3U3YA 3HZ6A 1EX4A 3IUCA 4KH5A 3O6WA 1IBLK 4BE1A 1VHXA 5GIPA 3C6HA 5KRTA 5GINA 4FK4A 1IO2A 5AQTA 2GX9A 3HVRA 3U4LA 3NF7A 4KTWA 3VEOA 4IG0A 5FPMA 1IH7A 2VG6A 5JVGL 4I9QA 1JJ2M 4OVLA 3BGRA 1B9DA 4PL7A 3ZSXA 4FJ8A 4NLCA 3LALA 1L3TA 1QSSA 4BG9A 2W6LA 4ZHRA 3NH0A 3DRRA 3QBWA 3ZSRA 4EZ6A 1TYQB 3ZT3A 3LZIA 1YTAA 4BRCA 5AQMA 1Q8IA 1KLMA 1RNHA 5JLHA 3CIPA 4CZMA 3CM6A 2Q3SA 4GW6A 3C6AA 4W5NA 4FLVA 3M8QA 4ICLA 2PFUA 3Q7BA 3V9XA 1K8KA 3TAPA 3SAHA 1OH6A 4X64K 1NK6A 3TWHA 4OPKA 1T3VA 1RTDA 4DLEA 4G1QA 3VQDA 3BF3A 4H5VA 1FK9A 3NF6A 3TSPA 3SQ2A 4JYAK 4CEFA 4Z4EA 1X9MA 1ATNA 3SAFA 3GL1A 3LWLA 5HL7L 1HNWK 2LSNA 2A3ZA 4FJ7A 4WCEL 4AQYK 3OYCA 2X78A 4CHYA 4M45A 3NVMA 4MDBA 3LM2A 5GADP 2PYJA 2OANA 1RBTA 1DKGD 2HNDA 2EHGA 2YCHA 4CF1A 1QHAA 4FWRA 4JI6K 3RSEA 3HTVA 1VSIA 1BIUA 4YOXA 4QS7A 4DWIA 5HRPA 4CJPA 4OO1J 3I55N 4IFVA 5DM7L 1IKWA 3SCXA 1NGDA 1RDCA 4JK7A 4KHUA 1NGAA 3HI0A 1HMVA 3AV9A 3QICA 4CECA 1ESVA 4BC2A 2QXFA 1RDUA 1S22A 2YHXA 4FJIA 4IFEA 4FO0A 3NH1A 3UIQA 3OYLA 3K9KA 1S9EA 2HNYA 4WQ5A 4CZGA 1KVAA 4CD1A 3SUNA 3SPZA 3VQ4A 3EYZA 4ISEA 3HM8A 3SQ4A 2A41A 4LH5A 1WSFA 1M90O 3ISNC 1RDWX 4C8MA 3CCVN 1XMQK 3HL8A 2Q97A 4CJ4A 4KH6A 3O8MA 2P9NA 4MFBA 5C2DA 4A62A 5HBMA 4Z4FA 1BQMA 4WQ4A 3DRSA 3ZX0A 4CHOA 5H1SQ 1XMOK 4ELUA 3C0BA 3VETA 4CZFA 1VQ8N 2E1ZA 1C0MA 1W2BM 1L3UA 3MWPA 3BP8A 3WEEB 2HVHA 2UUBK 3T19A 3QEVA 2AP1A 1RDDA 4CJLA 2CGJA 5BPLA 2P5OA 3QNNA 4MLHA 3E66A 4JI3K 4FK2A 1DT9A 3H3OB 3O1BA 1ZBHA 3I33A 1YXQA 2XRIA 5AJ3K 4F2SA 3M6GA 2UU9K 1IKVA 3K57A 3D2EA 4JK8A 3FZMA 3QEXA 4RW8A 1Z26A 4W5QA 3UE5A 4FJXA 3L4IA 1LW0A 1TUUA 2QWQA 3SNNA 1NGJA 2VQEK 3RVCA 4CCHA 2OYQA 3RMAA 4CVNE 5EU7A 2ZJPL 3CFOA 3A5OC 5GAGP 1M1KO 1GOBA 3DOKA 1TKXA 3VERA 1LWCA 5A2QO 3NGIA 2DTUA 4CJ3A 4ZTFA 4WE1A 3QEWA 3HPOA 3LM9A 5KGXA 5AZJB 5JMVA 1RT6A 3LDSA 3AVBA 1JXEA 3CG7A 4JKDA 4CEAA 5KQDA 4LD0A 4IO8A 2JLEA 2GWKA 2G8VA 4KV8A 3CERA 4CFCA 1YITN 4M3RA 2BGGA 3NBPA 3A0IX 1Z25A 2W42A 1Q18A 4KI4A 3LANA 3D45A 3H3NO 4ISGA 1WBDA 4KFBA 3THXB 1BHLA 4A2AA 4NCBA 2QWLA 3L2RA 1BIZA 3O4QA 3OA9A 4DU1A 3SYZA 3LP1A 4CZHA 3S41A 3OBYA 1CXQA 4GY2B 1U47A 3HXMA 4DTMA 3U9DA 3NE6A 3ZT4A 2VG5A 4B1VA 2W40A 4CJUA 1WSJA 4CERA 3TAQA 4H4OA 2ITMA 2E20A 1VSLA 3AGRA 4WYBA 4ILHA 3V4IA 1YTUA 4RTFD 3CCMN 3FFKB 3G0ZA 3CD6N 3QLHA 5CY4A 1JLBA 4OGCA 1HYVA 3P4IA 3CJ7A 1BA1A 3ID8A 3K2PA 2I7PA 4FJMA 3BEXA 3CCSN 3DLHA 1RT3A 1JLCA 4IO9L 4HHTA 3V9UA 4JAXA 3CPWM 4DU3A 4CGGA 4JKCA 1S1TA 4YHHK 1RBUA 4O4GA 3TABA 1BCMA 4CJFA 3O9QA 3K58A 1HJOA 4QAGA 2XHBA 2XY8A 4YOYA 3ULEA 4DSFA 2DPNA 3EE9A 4CJKA 5C24A 5IT9O 2ASOA 2OZSA 1VQON 5AQJA 4CF9A 3FE1A 4B9QA 3AA3A 1JL1A 4H8KA 4JI2K 4DQQA 4O55A 3QERA 3E01A 3G25A 1WBBA 1NBWA 4OLAA 4RWTA 2YJFA 3L2QA 2P9UB 3CFRA 1ZBFA 4BGAA 3GBTA 3T7ZA 1ASWA 3PIOL 3DM2A 3CETA 3IDHA 2E8AA 4IBNA 3SAGA 4DFPA 2NRZA 3ZETA 2B4JA 2O4IA 5AQSA 5AQYA 4JKGA 3LL3A 4HUFA 2KTQA 2Z1GA 2VWBA 4DV5K 3VQQA 4YDUA 5DK5A 3DLGA 4N56A 1JCGA 1FW6A 1EWQA 4B3TK 1N33K 3QO9A 1HQEA 4BR5A 3J7ZO 1K9MO 1A5WA 4IJAA 2O8EB 1V4TA 4ELTA 4B3MK 4W5RA 3UKRA 4QS9A 1BQNA 1WSHA 4K43A 2OPRA 1NNEA 4XEIA 1RT2A 4M41A 2ZQBA 1JKHA 3RRGA 3C7NB 3FFIA 3MX5A 3WXIA 3OYIA 4O5BA 5KPRA 3UKUA 1SL2A 2HHUA 4JI4K 4BRNA 1NGHA 2V7YA 3CC7N 3W3DA 3JXUA 4YNQA 3TARA 4BREA 2HBJA 2Q1NA 5BREA 5CE3A 1GLEG 3R6MA 4DTRA 2GUPA 2R7YA 4C8OA 2D0CA 2FSNA 3P31A 4O8KA 4C8LA 3AVCA 3AVHA 3M5RA 2F9TA 3THVA 1Q9XA 3SV4A 2GTDA 4AILC 3E9OA 4FJKA 3MEEA 1S3XA 2KHOA 5ADXA 4DSIA 4KI6A 2YNHA 2WFBA 4BWMA 3IRXA 3KLHA 3LDNA 4NCGA 4XH1A 3QBXA 4B1UB 4GVEA 3FZKA 3AAPA 3L4QA 2QK9A 4J8FA 5EOYA 5FRMA 3HSCA 2DFEA 5BRHA 3RTVA 3G6EN 3OYJA 2NRRA 3FGUA 4M7XA 3EO3A 2Q0RA 3HRGA 3NDKA 5AQLA 4KHSA 1HLUA 3LDOA 3R9PA 3DJCA 4B9VA 4FL9A 1N36K 3KD5E 3OS0A 4BE2A 3O80A 4JS5A 1QVFM 4E89A 4WF9L 2PZSA 3AY9A 3GG4A 4EP4A 2HHWA 1T6DA 5J2PA 3HM9A 3BY5A 1GLFO 4HUGA 1D8YA 2Z1JA 2ZGYA 4KHPK 4FLWA 1HJRA 3ASMA 4DMNA 2GBZA 1FJGK 3W0LA 3VPZA 4FSVA 4E1NA 4H0YB 3VQAA 3CPEA 4CEDA 2NNWA 2X6SA 2PBDA 3HT3A 3NCIA 2IOCA 4MDAA 4IDKA 1Q9YA 1REVA 2D0OA 4IEEA 4CJWA 4DTXA 4YDUC 4FLZA 4FM1A 4DQRA 5D3GA 4K25A 3CXCM 4F3TA 1SKSA 3CYMA 3JAMO 1TK8A 3CQ8A 1WSIA 2B5JA 3EKUA 2A6AA 5CHIA 3DXKB 4FLUA 3NF9A 4Q0BA 3P39A 1VQNN 2HMPA 3IS9A 3Q7CA 3MEDA 4ID5A 4FWOA 4KKOA 5BPMA 1C0FA 4BR4A 1T44A 3FZLA 3MN9A 3D2FA 4GNIA 3M8PA 1C0UA 4JK9A 5BPNA 4ILGB 1DLOA 3WNFA 1I94K 2OZMA 5LL6Z 1XNRK 3DLEA 1ITGA 3BF1A 5KTQA 2P9SA 4JI5K 1NG9A 1ZBSA 4E0DA 1VQ7N 3ITHA 2ZJRL 1YJWN 1S72N 4DV0K 2QKBA 4CHPA 2ITGA 4O44A 1UWBA 2YHAA 4FZZA 4B3SK 2JWKA 2P9NB 2QI2A 4JI8K 3PUFA 4AM6A 3HO1A 3IFRA 4DF8A 2KZMA 1N6QA 3H08A 1Y97A 4FK0A 2DY4A 3VA0A 2IDOA 5AQRA 3CF5L 4K0KK 1TGOA 5AZIB 1KVBA 2QKKA 5J2MA 5AQUA 3MMVA 2HBMA 1MWMA 3F9MA 4JHDB 1QSYA 1QQOA 3CHWA 1NKBA 2O8BA 3PLAA 3VQ5A 1L5UA 2E4LA 3ZEUA 1JLQA 4FXDA 3NGZA 2ASMA 2Q36A 1D9DA 3LP0A 2AA4A 3QEPA 5AQQA 4UQGA 4PA1A 5I42A 3H1QA 1NLVA 4BRLA 4DQIA 3EN9A 4A5BA 1NGFA 5CYQA 1GLBG 1HKBA 2BTFA 4FWKA 1TAUA 1ZC6A 3L2WA 3B8AX 4JRPA 1BUPA 2G8KA 3ATUA 1KC8O 3CCEN 2KQ2A 2G8FA 4B1XB 2IGIA 3AO5A 2UYTA 2QWRA 1EXQA 4FPBA 3OYDA 4OKKA 5E41A 1S1VA 4CIFA 1J6ZA 4A5AA 4AHSA 4YORA 5LMUK 2YNFA 4IJNA 3KVGA 3CCUN 5FROA 3LZJA 1NK9A 2CH5A 1HYSA 4Z0UA 1KSPA 1J5OA 4W5TA 1LCUA 5AQVA 2FC0A 1GLJO 2E2NA 4H0TB 3EL2A 2P9PA 3THWB 4KTZA 4JI7K 4BR9A 5DM6L 5E84A 1N32K 4XIUA 4DSLA 4KPYA 3ZT2A 5GAHP 1QQMA 5FPEA 1NGBA 3H45C 2O4GA 4H5RA 4L3QA 3JS6A 2FBTA 3TTFA 4K8XA 3DI6A 2V7ZA 1V4SA 1XI1A 5M1QA 3E9PA 2P51A 3KHYA 5M1PA 4OGEA 4NYNA 4O0IA 2QA4N 2HHTA 3F9KA 5JICA 4DTOA 1GOCA 3O9UA 2YHBA 4DSKA 4KH4A 2KFNA 4CFBA 3AO4A 3CJBA 3O3GA 4BRFA 2QWMA 4IDHA 2D0PA 5J2NA 1YT3A 1BCOA 3O5BA 4FJGA 5FPDA 3J81O 4GKKK 4BRAA 3THYA 3IMXA 1ZYQA 3TI0A 5CZ2A 4R79A 3SUPA 1RDBA 2HBKA 3ZSYA 3B6OA 2P9IA 2UXCK 2EWSA 1BL3A 4E3SA
chains in the Genus database with same CATH topology
3U9DA 5BN8A 4ILJA 1BG3A 4JD2A 3CCLN 4B1VA 4FPAA 4CBUA 2CGLA 3QFUA 2W40A 3VGMA 4JHDA 1NGGA 5LJVA 4BQLA 3UB5A 1Q81O 1MA9B 3WT0A 1ATRA 2ITMA 1KD1O 3A8YA 2E20A 4MO5A 3WXJA 3AGRA 4WYBA 4ILHA 2NRWA 3E1YA 2FSJA 1K73O 2D4WA 4RTFD 3CCMN 1KAZA 2QXLA 1JCEA 3FFKB 2Q0UA 3VF4A 3CD6N 5BRDA 4DCHA 3P4IA 4A2BA 3VF6A 3CJ7A 1BA1A 4CD3A 3I8BA 3ID8A 2I7PA 5AR0A 2ZGZA 3CJ1A 3BEXA 3CCSN 1VQ6N 2HF4A 4JKAA 4IO9L 2ZWHA 3R3LA 3VEZA 4JAXA 3CPWM 2HOEA 4JKCA 4FWMA 2V52B 1NGIA 1P90A 3AAQA 1JCFA 3O9QA 2P9UA 1HJOA 3DAWA 2A5XA 4YOYA 4H5TA 3CCJN 3ULEA 4CZLA 1H1VA 2DPNA 3EE9A 3QFPA 4BC3A 2HSTA 3OW2M 3R1XA 1RFQA 2ASOA 4BC4A 1VQON 5AQJA 1U6ZA 3FE1A 4B9QA 4BR0A 1KXPA 1VQKN 2W41A 3MN5A 1ZXOA 5AQWA 5GINA 4BRPA 3HOSA 1YHQN 4DKWA 3G25A 1HPMA 2Q2RA 3M3ZA 3VOVA 5KPTA 1NBWA 1RGIA 4O5FA 1P8ZA 4QS8A 3CJCA 3GOIA 3QB0A 2WBNA 4RWTA 2YJFA 4PKGA 3MCPA 3DXMA 1VQ5N 2P9UB 1BWFO 4BGAA 3GBTA 4JN4A 3T7ZA 4CJ7A 3PIOL 4G9ZA 2A42A 3CETA 1BA0A 3IDHA 4BRHA 3D6RA 2E8AA 2YI1A 4A61A 3FZFA 3SAGA 4BR2A 1TYQA 2NRZA 3AARA 5F0XA 3ZETA 4PL8A 3OBWA 4PKIA 4K42A 4BVOA 5AQSA 5AQYA 3WQUA 5AQPA 4JKGA 3LL3A 1SQKA 3DLLL 4NO7A 4BRIA 2ZJQL 3CC4N 5AQZA 4H03B 3SBTA 4CBXA 4FWQA 4FWPA 3FZHA 4FWSA 4OPHA 4E1JA 2VWBA 3HOTA 4BY9C 4YDUA 4AF1A 3CMAN 3F2KA 4A59A 3VTHA 3TTCA 5FPNA 1JCGA 1Z6RA 3C65A 4A57A 4BR5A 4JKHA 3J7ZO 1K9MO 2GELA 1VAZA 3PIPL 2QWPA 3O4WA 1VQ4N 3DXMB 4IJAA 1V4TA 3E9LA 4LC9B 2QW9A 3I56N 1Q86O 2FF3B 3UKRA 3O9TA 5EXWA 4BC5A 4QS9A 5C15A 4Z94A 5TKWA 2E88A 3ZETB 4K43A 2A40A 2HF3A 2GWJA 4JNEA 4CZJA 3GDQA 4XEIA 2F7TA 3ZEUB 2P9LA 1VQMN 3C7NB 3MX5A 3SLCA 3WXIA 3VEVA 5KPRA 2VCPA 3UKUA 2YHWA 4BRNA 4MO4A 5CR4A 1NGHA 4H5WA 2CGKA 2V7YA 4EAHD 4FOIA 5M1NA 3CC7N 3TTDA 3JXUA 1YUWA 3L6QA 3W3DA 4WQ5C 3ZX2A 1VQLN 3QMLA 3VEXA 3M1FA 2YHYA 4BREA 1BDGA 2HBJA 2Q1NA 5BREA 1MWKA 3A5NC 4NLBA 3NMUA 5KQ8A 5CE3A 3RSEB 1GLEG 5AFUA 4GV3A 2P9PB 3R6MA 2NRVA 3ENBA 5M1KA 2IVNA 3CQYA 2GUPA 4BVPA 1SZ2A 4BGBA 4BQZA 5EX5A 2FSNA 2E2QA 3R8EA 3CMEN 3P31A 3HBTA 4O8KA 3NVKA 2RE2A 1D4XA 2IIRA 2D1KA 1BU6O 4GV6A 3M5RA 3EE8A 4HTLA 2F9TA 3T69A 2JWLA 2P9LB 2GTDA 2GEMA 3CCQN 3OHRA 3C7NA 1GLDG 1GLCG 1LOTB 3E9OA 4YOUA 5C10A 1S3XA 2KHOA 5ADXA 4FOEA 2QM1A 2WFBA 3VESA 4IOXA 4O8UA 3WXMB 3LDNA 3QDKA 1GLLO 3O08A 4XH1A 3QBXA 4EIAA 4IOCL 1QVGM 4B1UB 4GVEA 3FZKA 4H0PA 1HUXA 3AAPA 1EQYA 3L4QA 1DGKN 4J8FA 5EOYA 4WFBL 1VQPN 3HSCA 3TPQA 5BRHA 2NZTA 3G6EN 2NRRA 4BRQA 1Q82O 3FGUA 4M7XA 2NLXA 1XUPO 3H1VX 3SBGA 3CJ9A 4IZ9A 3EO3A 2Q0RA 3FLCO 3HRGA 5ELZA 5AQLA 3HZ6A 1HLUA 3LDOA 3R9PA 1EO1A 3DJCA 3WXKA 3VGKA 2BH1A 3IUCA 3LDPA 3O1WA 4FL9A 4KH5A 3O6WA 3GE1A 4B1WB 3MCAB 3O80A 2FF6A 1QVFM 5GIPA 4WF9L 3C6HA 1E4GT 2YJEA 4WQ4C 5AQTA 3AY9A 2GX9A 3GG4A 5I9EB 3U4LA 1T6DA 1O13A 5AQGA 1GLFO 2ASPA 1K8KB 3VEOA 5FPMA 5LJWA 4Y0WA 5JVHL 2ZGYA 4FVUA 5AQIA 4BG8A 5JVGL 4H0XB 1JJ2M 4BRDA 4PL7A 3TU5A 1U2VB 4NLCA 4C1NI 4OPAA 3W0LA 4BG9A 2HBLA 2E1YA 3VPZA 4DHYA 1NM1A 4FSVA 2E2OA 4H0YB 4JEPA 3J8AA 3H6EA 3QBWA 1YI2N 3CPEA 1TYQB 2NNWA 3VF2A 3BUZB 2PBDA 2FSKA 5AQMA 3ZX3A 4BRCA 3D7EO 4BRMA 5JLHA 3CIPA 4MDAA 4CZMA 5BR9A 5AQXA 3MX2A 4IEEA 2D0OA 2QWNA 4DB3A 4YDUC 3C6AA 4K25A 3CXCM 1NMDA 5GIOA 4BRKA 4H0VB 5KPZA 2PFUA 3Q7BA 3WUHA 3D2FB 1K8KA 4CBWA 3EKUA 5AQKA 3FR0A 1T6CA 4NB4A 2A6AA 3SAHA 4F9OA 3N4QA 2QTDA 2P9SB 5CHIA 4XH5A 1T3VA 4JKEA 4M63C 3SJHA 1DEJA 3UKRB 3DXKB 1Z05A 3BF3A 2RHKA 4YOTA 1N8RO 2P9KA 1QZ5A 4YOWA 4H5VA 3LDLA 3P39A 2QEXN 2H3GX 3TSPA 2HMPA 3O9RA 3WQTA 1VQNN 3Q7CA 3VENA 4UY8O 5AQHA 4FWOA 3CJAA 1ATNA 4KBOA 1VQ9N 3SAFA 3GL1A 5BPMA 1C0FA 4BR4A 1Q7YO 3MN7A 1T44A 4IOAL 2ZF5O 5HL7L 3FZLA 2A3ZA 3MN9A 4WCEL 3D2FA 2J4RA 4GNIA 4JK9A 5BPNA 4I6MA 5F1XA 3NVMA 4ILGB 4MDBA 3A5LC 3LM2A 5GADP 2OANA 1DKGD 2WUSA 2YCHA 2I7NA 4WFAL 1QHAA 4FWRA 4M7YA 3RSEA 5HOOA 3HTVA 1X9JA 3VEYA 3ENHA 4YOXA 3BF1A 4QS7A 2P9SA 3SMPA 1XQSC 5ADXH 1ZBSA 2P9KB 1VQ7N 3TSQA 4OO1J 3I55N 3DXKA 2ZJRL 4IXCA 1YJWN 1S72N 2YX6A 5DM7L 3ULEB 3VEWA 1ATSA 1NGDA 3A5MC 1IJJA 1OVYA 1KAXA 1W97L 4JK7A 5F2RA 2JWKA 4EHUA 1NGAA 2P9NB 2QI2A 3HI0A 3QICA 1G99A 4K41A 1IG8A 1WUAA 5AQNA 4AM6A 1ESVA 3IFRA 3KWGA 4BC2A 1BO5O 1RDUA 1S22A 2YHXA 4EHTA 1MDUB 2FLOA 4CZEA 3MDQA 4BRGA 4IFEA 5EVZA 4FO0A 3K9KA 5AQRA 3CF5L 4RCHA 5AZIB 3VGLA 4BR7A 4WQ5A 2F9WA 4CZGA 4CD1A 4H5NA 1TUYA 1YF5L 3KWIA 2QWOA 3CCRN 5AQUA 3MMVA 2HBMA 4ISEA 4C23A 3HM8A 1MWMA 3WEEA 3F9MA 3K9JA 2A41A 4JHDB 1QQOA 2BUPA 4GV9A 3WXLA 3EKSA 1M90O 3CHWA 3VMFB 5AFUH 3PLAA 1RDWX 3VTIA 2V51B 2NRTA 3LDQA 3CCVN 3KZBA 3ZEUA 3MN6A 4BROA 2Q97A 1KQSM 4WFNL 1ILYA 2ASMA 4KH6A 4B1ZA 3O8MA 2P9NA 4B1YB 2Q36A 2Q31A 3H46O 2PAVA 5C2DA 4IEIA 2AA4A 4JKBA 4A62A 2OTLN 5AQQA 4JKFA 1HKGA 3H1QA 1NLVA 4BRLA 3EN9A 4WQ4A 4A5BA 4CZIA 1NGFA 1X3NA 5E26A 5C2FA 3ZX0A 1YAGA 1HX1A 1GLBG 5H1SQ 1C0GA 1HKBA 4IWVA 2VGMA 3ID6A 3P38A 2BTFA 4FWNA 4DQ8A 3C0BA 3VETA 4CZFA 4FWKA 4PHTX 2VYPA 1YIJN 5AZIA 2OTJN 1U2VA 4YOVA 1VQ8N 2E1ZA 1ZC6A 4AM7A 3B8AX 2IVPA 1W2BM 3ATVA 3MWPA 5AQFA 1SAZA 2CH6A 3BP8A 3WEEB 1BUPA 1NWKA 4CI6A 2NRXA 3ATUA 4ISFA 1KC8O 2AP1A 3CCEN 3TSUA 2CGJA 4B1XB 4EFHA 5BPLA 5AQOA 2WC9A 3DWLA 4MLHA 3E66A 2UYTA 3ZYYX 2QWRA 1CZAN 1DT9A 4U67L 3H3OB 3O1BA 3I33A 1YXQA 4FPBA 3M6GA 2FXUA 1Y64A 5M1FA 1J6ZA 1NGCA 4A5AA 4YORA 1KAYA 3D2EA 3KVGA 4IJNA 3CI5A 4JK8A 3CCUN 3FZMA 5AZJA 2CH5A 4CZKA 1BOTO 1OKJA 3AGKA 3F5TA 4FWLA 1NGEA 1YJ9N 1YJNN 4PKHA 3UE5A 1LCUA 5AQVA 3CC2N 3L4IA 1GLJO 3N4PA 3G71N 1TUUA 3ENOA 2IVOA 2E2NA 4H0TB 3EL2A 2QWQA 2P9PA 3IKMA 1NGJA 1HKCA 1WOQA 5TKYA 4BR9A 5DM6L 5E84A 3U8XA 3RVCA 5GAHP 5GAEP 1QQMA 5FPEA 1NGBA 3H45C 4H5RA 5BN9A 4L3QA 3JS6A 5B8HA 4H0OA 1XC3A 2ZJPL 3A5OC 3TTFA 5GAGP 1QQNA 1M1KO 2V7ZA 3VERA 1V4SA 4JKGB 3E9PA 3KHYA 5M1QA 5M1PA 2P9IB 5EY4A 4I6MB 1R59O 3D2EB 3LM9A 3KK7A 5AZJB 5BRFA 5JMVA 3SK3A 3EZWA 3CQXA 5C12A 2QA4N 5JICA 4HWIA 2KLAA 4JKDA 4C1NK 1X3MA 3MK6A 3O9UA 2VGNA 5KQDA 3L0QA 4IO8A 4KH4A 4MLEA 4JD2B 2GWKA 3SMSA 3CERA 3CJBA 3U9ZA 4BRFA 2QWMA 4IDHA 1YITN 3O9SA 2D0PA 4XH4A 3A0IX 1SS6A 1E4FT 1Q18A 3G4SN 1K8AO 3O5BA 5LY3A 3H3NO 5MLCQ 4ISGA 5FPDA 5M1OA 4BRAA 1GLAG 3IMXA 4A2AA 1QZ6A 2QWLA 1NJIO 1YVNA 5JLFA 4R79A 2NRHA 3OA9A 4U7BA 2HBKA 2KKZA 5C0YA 4CZHA 3S41A 2E2PA 3UKUB 2P9IA 3OBYA 2EWSA 4GY2B 3MWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 N;  1Q86 O;  3CCL N;  5H1S Q;  3CXC M;  2OTJ N;  1YIJ N;  1Q81 O;  1VQ8 N;  1KD1 O;  1VQM N;  1W2B M;  1K73 O;  3CCM N;  1KC8 O;  3CCE N;  3CD6 N;  3CC7 N;  1VQL N;  4U67 L;  1N8R O;  2QEX N;  1VQN N;  3CCS N;  1VQ6 N;  4UY8 O;  4IO9 L;  3CCU N;  3CPW M;  1VQ9 N;  3CME N;  1Q7Y O;  4IOA L;  5HL7 L;  1YJ9 N;  1YJN N;  4WCE L;  3CC2 N;  3CCQ N;  3CCJ N;  3G71 N;  5GAD P;  3OW2 M;  1VQO N;  4WFA L;  5DM6 L;  1VQK N;  1QVG M;  4IOC L;  5GAH P;  5GAE P;  2ZJP L;  1VQ7 N;  4WFB L;  1YHQ N;  5GAG P;  1VQP N;  1M1K O;  3I55 N;  2ZJR L;  1YJW N;  3G6E N;  1S72 N;  5DM7 L;  1Q82 O;  1OVY A;  1VQ5 N;  2QA4 N;  3PIO L;  1QVF M;  4WF9 L;  3CF5 L;  1YIT N;  3CCR N;  5JVH L;  3G4S N;  1K8A O;  3DLL L;  5MLC Q;  2ZJQ L;  3CC4 N;  5JVG L;  1M90 O;  1JJ2 M;  1NJI O;  3CCV N;  3CMA N;  1KQS M;  4WFN L;  1ILY A;  1K9M O;  3J7Z O;  1YI2 N;  3PIP L;  1VQ4 N;  2OTL N; 
#chains in the Genus database with same CATH topology
 1C6V A;  1BG3 A;  3J7A P;  4LF5 K;  4FPA A;  3QFU A;  3AVF A;  3ZSQ A;  1Q81 O;  3LP3 A;  3LP2 A;  3KKS A;  4I7F A;  3MAQ A;  4MO5 A;  4M3W A;  1C1C A;  1LWF A;  2NRW A;  3C94 A;  3M8R A;  2VWJ A;  3DOL A;  3G10 A;  4FVM A;  2O8F B;  4JRQ A;  1NJW A;  1CZ9 A;  3VF4 A;  3V9Z A;  3AVL A;  4A2B A;  4DUY K;  1S6Q A;  3PX0 A;  4CD3 A;  4DTU A;  3PV8 A;  5AR0 A;  2ZGZ A;  4FCY A;  1VQ6 N;  2HF4 A;  2HOE A;  3L8B A;  4DTP A;  4LF7 K;  3AAQ A;  2OCE A;  1JCF A;  2P9U A;  1HRH A;  4OLB A;  4H5T A;  3SV3 A;  4LF9 K;  3QFP A;  1RTJ A;  3OW2 M;  1A5X A;  1FKP A;  3ZT1 A;  1U6Z A;  1KXP A;  1W7A A;  5CYM A;  3DMJ A;  4DR1 K;  3TAM A;  3K5M A;  1YHQ N;  3CFP A;  3HP9 A;  1HPM A;  2F8S A;  3VQ6 A;  4IKF A;  1WB9 A;  3QB0 A;  1TK0 A;  3LPU A;  3MCP A;  1BWF O;  1BGX T;  2OA8 A;  1NK0 A;  1SV5 A;  1BA0 A;  4BRH A;  1QE1 A;  1XHZ A;  4E7K A;  2Y1J A;  3K5O A;  4K42 A;  1TVR A;  2YKN A;  5AQP A;  1SQK A;  4BRI A;  2ZJQ L;  4CBX A;  3U3G A;  3MEG A;  4FWP A;  4LF4 K;  2O8D A;  4A59 A;  4MQ3 A;  5FPN A;  3T3F A;  2O8C B;  3QIP A;  1Z6R A;  4A57 A;  2GEL A;  3O4W A;  3DXM B;  2QW9 A;  3NGY A;  2YNI A;  4BC5 A;  5TKW A;  1UOC A;  4LFB K;  2A40 A;  5KI6 A;  2HF3 A;  4E7I A;  4JNE A;  4X62 K;  3NAE A;  4NXN K;  3V9W A;  4CK2 A;  2VCP A;  1RTI A;  4FZY A;  1BIS A;  4H5W A;  2HW3 A;  2CGK A;  4EAH D;  2HHQ A;  5M1N A;  3KK1 A;  3ZX2 A;  4DQS A;  4DUZ K;  1BDG A;  4NLB A;  3J80 O;  3HYF A;  4DFK A;  1NKE A;  4GV3 A;  2X6N A;  4JLH A;  4DTJ A;  4DV6 K;  2IVN A;  5EX5 A;  2E2Q A;  3K5L A;  1D4X A;  1BU6 O;  4GV6 A;  1ASU A;  4HTL A;  2WOM A;  3T69 A;  2P9L B;  4E7J A;  1GLD G;  1GLC G;  1LOT B;  5C10 A;  3VES A;  3WXM B;  4OPJ A;  4CGD A;  4KRE A;  3K0S A;  4DFJ A;  2UUA K;  4H0P A;  1HUX A;  4WFB L;  1VQP N;  3TPQ A;  2PYL A;  3ALY A;  1NK8 A;  4BRQ A;  1Q82 O;  1WNS A;  1TV6 A;  4KHN A;  3O3F A;  5C25 A;  2HNZ A;  3DLB A;  4CEE A;  3VGK A;  4DSJ A;  4DV3 K;  3O1W A;  3OJU A;  3GE1 A;  4B1W B;  3MCA B;  2X74 A;  4LY7 A;  3MXI A;  1E4G T;  1VSE A;  5I9E B;  1K8K B;  3K5N A;  5LJW A;  4CIE A;  4CHN A;  1O1W A;  5AQI A;  3QET A;  4KRF A;  3DRP A;  4H0X B;  4B9M A;  4BRD A;  1NOY A;  1U2V B;  4C1N I;  4OPA A;  2E1Y A;  1NK4 A;  1NM1 A;  2E2O A;  4AHR A;  4JEP A;  3VQP A;  3J8A A;  1YI2 N;  3VF2 A;  4CHQ A;  3AO3 A;  5BR9 A;  1VSD A;  3MX2 A;  4E1M A;  4M3X A;  2QWN A;  4DB3 A;  3AO1 A;  4AHC A;  1IKY A;  4YFU A;  4BE0 A;  3D2F B;  5JS2 A;  4CBW A;  5AQK A;  4F9O A;  3N4Q A;  5J1E A;  3L2V A;  4OX9 K;  1XHX A;  3UKR B;  1C0T A;  1Z05 A;  4YOT A;  3QES A;  4B9S A;  1QZ5 A;  4DQP A;  3LDL A;  3WQT A;  2H3G X;  3LAK A;  4Y1D A;  1VSJ A;  3VEN A;  4UY8 O;  3MEC A;  4GMJ B;  1WSG A;  4RW6 A;  1DTT A;  1C1B A;  4KBO A;  4FW2 A;  4FJJ A;  1VQ9 N;  4IOA L;  3AA4 A;  2ZF5 O;  4Y1C A;  5SZT A;  2J4R A;  1HPZ A;  4I6M A;  4J2D A;  2HHX A;  3A5L C;  3SQ0 A;  2WUS A;  4FW1 A;  3NH2 A;  2BDP A;  4CJE A;  4WFA L;  3AVN A;  3ENH A;  2P9K B;  3TSQ A;  4GKJ K;  2GV9 A;  2O8B B;  2YX6 A;  1NKC A;  3ULE B;  4NCA A;  3NFA A;  3IAY A;  4Z4C A;  1IJJ A;  4N41 A;  1GOA A;  1G15 A;  2F96 A;  1X9S A;  1G99 A;  1IG8 A;  5AQN A;  2BAN A;  3KWG A;  1BO5 O;  4EHT A;  2FLO A;  4CZE A;  3MDQ A;  1ZBL A;  3OYM A;  3RMC A;  4CGH A;  3V1Q A;  4HUE A;  1D9F A;  1IV0 A;  4H5N A;  1TUY A;  1YF5 L;  2ZE2 A;  1X1P A;  3WEE A;  2VQF K;  3K9J A;  4M3Z A;  2BUP A;  4GV9 A;  3WXL A;  2IAJ A;  3KK3 A;  3VMF B;  5AFU H;  2KFZ A;  2V51 B;  2NRT A;  3KZB A;  4CE9 A;  5LMN K;  1KQS M;  1CXU A;  4B1Y B;  3TAN A;  3H46 O;  4CEZ A;  4IEI A;  3MXJ A;  1XC9 A;  1N34 K;  1TAQ A;  3RRH A;  1EWR A;  4CZI A;  1X3N A;  3PX4 A;  1KRP A;  4FYD A;  1C0G A;  4J2E A;  4IWV A;  2VGM A;  3ID6 A;  4PHT X;  4CGJ A;  3B6P A;  4M3T A;  4AM7 A;  2IVP A;  4PY5 A;  3ATV A;  4OKJ A;  3C95 A;  2ETJ A;  1NWK A;  4CI6 A;  2NRX A;  4ISF A;  3AVJ A;  4RW9 A;  1WN7 A;  3TSU A;  4M3Y A;  4EFH A;  3DWL A;  1UA0 A;  3TAG A;  1OH5 A;  1Y64 A;  3PO5 A;  5M1F A;  1NGC A;  1U04 A;  3OYB A;  5AZJ A;  3T1H K;  1HNX K;  1BOT O;  1OKJ A;  3AGK A;  5CZ1 A;  3V1O A;  1YJ9 N;  1YJN N;  3LAM A;  4PKH A;  4N5S A;  1NK7 A;  1T05 A;  4CFA A;  3AA2 A;  3G71 N;  3O4N A;  4E7L A;  3ENO A;  2IVO A;  1S1W A;  1ZBU A;  2OPQ A;  4JV5 K;  1HKC A;  1WOQ A;  3U8X A;  3T1Y K;  4FM2 A;  1EET A;  4LF6 K;  4B8C A;  4X65 K;  1LW2 A;  4H0O A;  1XC3 A;  2RPI A;  3SUQ A;  3AVK A;  1QQN A;  3L2U A;  1A5V A;  4DU4 A;  5J2Q A;  5EY4 A;  3C6U A;  3HST B;  3D2E B;  2YKM A;  5BRF A;  1RCH A;  5BR8 K;  3RR7 A;  3EZW A;  3V1R A;  2KLA A;  4RG8 A;  2VGN A;  3L0Q A;  3J7Y P;  4MLE A;  2HHV A;  1LV5 A;  3U9Z A;  2ZM6 K;  2PY5 A;  3EEQ A;  5LY3 A;  4FLT A;  3ZSV A;  5FLX O;  4B9T A;  1WLJ A;  5M1O A;  4FLY A;  1WAF A;  1GLA G;  1QZ6 A;  1NJI O;  2G8I A;  2NRH A;  2ZD1 A;  5IWA K;  3EZ5 A;  4DR6 K;  3ZLJ A;  1WSE A;  1JLA A;  1TK5 A;  2OPS A;  4PUO A;  3OTO K;  1B9F A;  3MWT A;  1BI4 B;  2F8T A;  4ILJ A;  3LPT A;  4JD2 A;  3S3M A;  4CBU A;  2CGL A;  1J54 A;  4JHD A;  1NGG A;  3K59 A;  4BDZ A;  4BQL A;  4E19 A;  3EY1 A;  4E7H A;  3JSM A;  1TKD A;  3WT0 A;  1KCF A;  4HCC A;  3A8Y A;  1S5J A;  4LSN A;  1S9G A;  1NU0 A;  4HVJ A;  2G8U A;  2FSJ A;  1K73 O;  2D4W A;  1SKR A;  1KAZ A;  2QXL A;  1JCE A;  2Q0U A;  5BRD A;  4DCH A;  5FRN A;  3OJS A;  2P5G A;  4PQU A;  4B08 A;  4W5O A;  1TL3 A;  3CJ1 A;  3V9S A;  2G8H A;  4JKA A;  3C6T A;  3R3L A;  2XY7 A;  1L3V A;  4EZ9 A;  4FWM A;  1NGI A;  1NJZ A;  4QOZ B;  2A5X A;  3AVA A;  3CCJ N;  4DR3 K;  1H1V A;  4RW4 A;  1VSM A;  4JS4 A;  3R1X A;  1W0H A;  4BC4 A;  4DR7 K;  4FZX C;  1VQK N;  1VRU A;  2W41 A;  3MN5 A;  3OY9 A;  4L8R B;  4CGF A;  5AQW A;  4DKW A;  3I8D A;  3M3Z A;  2Q2R A;  5KPT A;  4DV4 K;  3ZCM A;  4QS8 A;  3GOI A;  3VQ9 A;  2WBN A;  4FJ5 A;  4JI0 K;  1CZB A;  1VQ5 N;  1YVU A;  2E6M A;  4JN4 A;  4CJ7 A;  3OYG A;  2A42 A;  3OS2 A;  3D6R A;  2YI1 A;  4A61 A;  4B9U A;  4BR2 A;  1TYQ A;  2KZZ A;  4AHV A;  2VWK A;  4PL8 A;  3SPY A;  3SUO A;  4BVO A;  3U6F A;  1K6Y A;  4Z4G A;  3DLL L;  4NO7 A;  3M8S A;  3CC4 N;  4H03 B;  3VN5 A;  4FWQ A;  1SUQ A;  3FZH A;  4OPH A;  1UA1 A;  4BY9 C;  3F73 A;  3CMA N;  3F2K A;  2IC3 A;  4TSX A;  3VTH A;  1QHT A;  1R0A A;  5HRO A;  1LAV A;  3C65 A;  3VQE A;  2JGU A;  4CES A;  1NMN A;  4JKH A;  1VAZ A;  2QWP A;  3AO2 A;  1TL1 A;  1UAX A;  4CEB A;  4QCL A;  4LC9 B;  4C8N A;  2FF3 B;  2E6L A;  3L3V A;  4AHT A;  4KB1 A;  1MU2 A;  1FXX A;  4F3O A;  4NYF A;  1T8E A;  2IS3 A;  3GDQ A;  3ZEU B;  2F7T A;  3QIO A;  4FM0 A;  4KTQ A;  2HHH K;  2P9L A;  2RKI A;  4DR5 K;  3VEV A;  2YHW A;  3KLE A;  5HRN A;  3L3U A;  1SL1 A;  1YUW A;  1VQL N;  4WQ5 C;  3KK2 A;  2GUI A;  3I0R A;  3M1F A;  1B92 A;  3RWU A;  3A5N C;  4LF8 K;  3NMU A;  1HNV A;  3OYF A;  3RSE B;  5AFU A;  4DR2 K;  4DTS A;  4DV1 K;  2NRV A;  1CLQ A;  3CQY A;  4BWJ A;  1SZ2 A;  4BQZ A;  4BVP A;  1RT4 A;  3DLK A;  2IIR A;  2UUC K;  2OPP A;  2HVI A;  2JWL A;  4KB0 A;  1SKW A;  3CCQ N;  3OHR A;  4CHZ A;  4KO0 A;  4YOU A;  4FOE A;  1S6P A;  4IOX A;  4CJR A;  3QDK A;  1GLL O;  3O08 A;  1QVG M;  4IOC L;  4CJQ A;  1RBR A;  4R5P A;  2F4V K;  4FJL A;  1DGK N;  3OVN A;  2WTU A;  4CIG A;  2NLX A;  1VSK A;  3CJ9 A;  4BDY A;  4DS5 A;  1ZBI A;  3FLC O;  3SZ2 A;  4O0J A;  1EO1 A;  2DFH A;  3WXK A;  3S9H A;  3OYN A;  2BH1 A;  3LDP A;  3THX A;  2FF6 A;  2YJE A;  4WQ4 C;  4RW7 A;  1TKT A;  5HP1 A;  1O13 A;  5AQG A;  2ASP A;  1RBS A;  2VG7 A;  4Y0W A;  5JVH L;  4FVU A;  4AH9 A;  4OJR A;  4BG8 A;  3PY8 A;  3HP6 A;  1QTM A;  3TU5 A;  1NJY A;  4DLG A;  3OYH A;  2HBL A;  4DHY A;  4DG1 A;  1OH7 A;  3H6E A;  1U49 A;  2BE2 A;  2P1J A;  5HRS A;  2FSK A;  4CJ5 A;  3BUZ B;  3ZX3 A;  2Y1I A;  3D7E O;  4BRM A;  3QNO A;  2UXD K;  2A1R A;  4J2B A;  4K8Z A;  5AQX A;  2NUB A;  3RMB A;  3IG1 A;  4V19 S;  1NMD A;  1NOZ A;  5GIO A;  4BRK A;  4H0V B;  5KPZ A;  2XY5 A;  4Q5V A;  3AVI A;  3WUH A;  1QSL A;  1C1A A;  2O8C A;  2DFF A;  4GVM A;  3FR0 A;  5FDL A;  1T6C A;  4NB4 A;  2G8W A;  4M3U A;  1EKE A;  4CW7 B;  2QTD A;  2P9S B;  4I2P A;  4XH5 A;  4JKE A;  4M63 C;  3SJH A;  1IBM K;  1DEJ A;  1RT5 A;  2RHK A;  4CGI A;  1RT7 A;  1N8R O;  2P9K A;  4YOW A;  2QEX N;  1RTH A;  3O9R A;  2I5J A;  4B3O A;  1JLE A;  2Z1H A;  5AQH A;  4C8K A;  3CJA A;  4ELV A;  1XWL A;  4N47 A;  1S1X A;  1Q7Y O;  3MN7 A;  4J2A A;  4CJV A;  4AHU A;  4FJN A;  3NF8 A;  5F1X A;  5HLF A;  3WNH A;  4CF8 A;  2I7N A;  4H4M A;  4M7Y A;  5HOO A;  1X9J A;  3VEY A;  3SMP A;  1XQS C;  3VQ8 A;  5ADX H;  1J9A A;  3BZK A;  4CFD A;  5I3U A;  3DXK A;  3A2F A;  4IXC A;  3AVM A;  4Z4H A;  3VEW A;  1ATS A;  3A5M C;  1OVY A;  1KAX A;  1W97 L;  5T7B A;  1IKX A;  5F2R A;  4EHU A;  4K41 A;  1WUA A;  3T1A A;  4DS4 A;  1MDU B;  4BRG A;  5EVZ A;  4LFC K;  3P5J A;  4DV2 K;  4RCH A;  3VGL A;  4BR7 A;  2F9W A;  3KWI A;  2QWO A;  3CCR N;  3VA3 A;  4C23 A;  4CK1 A;  2EX3 A;  3EKS A;  4NXM K;  3SJJ A;  4DTN A;  1HNI A;  3VTI A;  3LDQ A;  3MN6 A;  4BRO A;  1T03 A;  4WFN L;  1ILY A;  4B1Z A;  4KHQ A;  2Q31 A;  3AA5 X;  2PAV A;  4JKB A;  2OTL N;  4JKF A;  1HKG A;  2FBX A;  1FKO A;  3WNG A;  5E26 A;  5C2F A;  1RDA A;  1YAG A;  1HX1 A;  3P38 A;  4FWN A;  3TR8 A;  4DQ8 A;  2OTJ N;  1YIJ N;  2VYP A;  5AZI A;  1U2V A;  4YOV A;  1KFD A;  3KLF A;  3MXM A;  5AQF A;  1SAZ A;  2CH6 A;  3SQ1 A;  3CM5 A;  3BZC A;  3HVT A;  1VK0 A;  4CJT A;  3S3O A;  5AQO A;  2WC9 A;  1HR0 K;  4LFA K;  3ZYY X;  1CZA N;  4U67 L;  4IFY A;  1I3A A;  1JLF A;  1WAJ A;  2FXU A;  3AVG A;  4I2Q A;  1KAY A;  4JI1 K;  3CI5 A;  3TAF A;  4CZK A;  2RN2 A;  3F5T A;  4FWL A;  1NGE A;  4CK3 A;  3KKR A;  1IBK K;  3CC2 N;  3N4P A;  4FJH A;  4I9L A;  4DR4 K;  3ZSW A;  4CEQ A;  4DFM A;  3IKM A;  1HQU A;  5TKY A;  1HNZ K;  1VRT A;  5GAE P;  3OYA A;  5BN9 A;  5B8H A;  1NK5 A;  1LAW A;  3KLI A;  4JKG B;  2P9I B;  4I6M B;  1R59 O;  3KK7 A;  2RF2 A;  3SK3 A;  3CQX A;  1JXB A;  4CEO A;  5C12 A;  4HWI A;  1OVQ A;  3DLR A;  4C1N K;  1X3M A;  3MK6 A;  5KGW A;  3ZT0 A;  4JD2 B;  3SMS A;  4M42 A;  3WNE A;  2O8E A;  3O9S A;  3D0P A;  3V6D A;  4XH4 A;  3KJV A;  3V81 A;  1SS6 A;  1E4F T;  3G4S N;  1K8A O;  4HCB A;  5MLC Q;  2O8F A;  2D0A A;  2A1S A;  3JYT A;  4ZTJ A;  1YVN A;  5JLF A;  2YV0 X;  3QIN A;  4U7B A;  4ID1 A;  2E5L K;  2KKZ A;  2YNG A;  5C0Y A;  3UKU B;  2E2P A;  4F2R A;  3VQC A;  1JL2 A;  1TKZ A;  1X9W A;  2AJQ A;  1T7P A;  5BN8 A;  1U4B A;  4PWD A;  3CCL N;  1HYZ A;  3VGM A;  5LJV A;  4IG3 A;  3KIO A;  3HPH A;  4X66 K;  3UB5 A;  1MA9 B;  1ATR A;  1KD1 O;  3WXJ A;  4YY3 K;  3E1Y A;  3THY B;  3PX6 A;  3KD1 E;  3ZSO A;  4KAZ A;  3NHG A;  5C42 A;  3TAE A;  1F21 A;  3VF6 A;  3OYE A;  4F4K A;  4N76 A;  3I8B A;  1ASV A;  2ATQ A;  2ZWH A;  4DF4 A;  2HB5 A;  3VEZ A;  1NJX A;  2V52 B;  4B8A B;  1P90 A;  3P83 D;  3DAW A;  4CZL A;  4BC3 A;  3ULD A;  4FLX A;  1J53 A;  2HST A;  1W9H A;  1RFQ A;  1RT1 A;  3RMD A;  4BR0 A;  2D0B A;  1KLN A;  1RBV A;  1S1U A;  2WON A;  1QQC A;  4CF2 A;  2XY6 A;  1ZXO A;  3HOS A;  4BRP A;  1U45 A;  1DTQ A;  1SL0 A;  2O8D B;  3OYK A;  3VOV A;  1RGI A;  4O5F A;  3HPG A;  3VQB A;  1P8Z A;  3KTQ A;  3CJC A;  1D5A A;  3DYA A;  1VSF A;  4PKG A;  3DXM A;  2W6K A;  3RR8 A;  4G9Z A;  2B6A A;  3FZF A;  4B9N A;  4OKE A;  3AAR A;  5F0X A;  1EP4 A;  4B3R K;  3QEI A;  4KHW A;  3OBW A;  4PKI A;  1N5Y A;  3HJF A;  5DMR A;  3BDP A;  4CJS A;  2FBV A;  3WQU A;  3HK2 A;  1I39 A;  1RIL A;  4Z4I A;  4B9L A;  5AQZ A;  1KVC A;  3SBT A;  3I0S A;  4E1J A;  4FWS A;  3HOT A;  1L3S A;  1J5E K;  1LWE A;  3PSI A;  4AF1 A;  3TTC A;  4DSE A;  3ZSZ A;  2HMI A;  3PO4 A;  3PIP L;  2KW4 A;  4F8R A;  1VQ4 N;  4CF0 A;  3E9L A;  3I56 N;  1Q86 O;  3O9T A;  5EXW A;  1QS4 A;  5HRR A;  5C15 A;  1E3M A;  4Z94 A;  2E88 A;  3ZET B;  3S3N A;  2GWJ A;  4LH4 A;  3OS1 A;  4CZJ A;  4HTU A;  4DV7 K;  1VSH A;  2FBY A;  1KTQ A;  1IG9 A;  5KRS A;  1VQM N;  3SLC A;  3O3H A;  3PSF A;  3VQ7 A;  4MO4 A;  5CR4 A;  4FOI A;  2HHS A;  1BI4 A;  4LSL A;  3TTD A;  3L6Q A;  3QML A;  3VEX A;  2YHY A;  5SWM A;  1MWK A;  5KQ8 A;  1KFS A;  1JLG A;  2P9P B;  3THW A;  3ENB A;  5M1K A;  3CME N;  1OH8 A;  4BGB A;  3R8E A;  1U48 A;  3HBT A;  3NVK A;  2RE2 A;  2D1K A;  3EE8 A;  5K14 A;  2GEM A;  3LWM A;  3C7N A;  2UXB K;  3P1G A;  3SI6 A;  2QM1 A;  4KHY A;  4O8U A;  4BAC A;  5JS1 A;  4EP5 A;  2D5R A;  4EIA A;  1XNQ K;  1EQY A;  4FJ9 A;  2NZT A;  4BDP A;  2Z1I A;  2XO7 A;  1XUP O;  3H1V X;  3SBG A;  4IZ9 A;  5ELZ A;  3KLG A;  3U3Y A;  3HZ6 A;  1EX4 A;  3IUC A;  4KH5 A;  3O6W A;  1IBL K;  4BE1 A;  1VHX A;  5GIP A;  3C6H A;  5KRT A;  5GIN A;  4FK4 A;  1IO2 A;  5AQT A;  2GX9 A;  3HVR A;  3U4L A;  3NF7 A;  4KTW A;  3VEO A;  4IG0 A;  5FPM A;  1IH7 A;  2VG6 A;  5JVG L;  4I9Q A;  1JJ2 M;  4OVL A;  3BGR A;  1B9D A;  4PL7 A;  3ZSX A;  4FJ8 A;  4NLC A;  3LAL A;  1L3T A;  1QSS A;  4BG9 A;  2W6L A;  4ZHR A;  3NH0 A;  3DRR A;  3QBW A;  3ZSR A;  4EZ6 A;  1TYQ B;  3ZT3 A;  3LZI A;  1YTA A;  4BRC A;  5AQM A;  1Q8I A;  1KLM A;  1RNH A;  5JLH A;  3CIP A;  4CZM A;  3CM6 A;  2Q3S A;  4GW6 A;  3C6A A;  4W5N A;  4FLV A;  3M8Q A;  4ICL A;  2PFU A;  3Q7B A;  3V9X A;  1K8K A;  3TAP A;  3SAH A;  1OH6 A;  4X64 K;  1NK6 A;  3TWH A;  4OPK A;  1T3V A;  1RTD A;  4DLE A;  4G1Q A;  3VQD A;  3BF3 A;  4H5V A;  1FK9 A;  3NF6 A;  3TSP A;  3SQ2 A;  4JYA K;  4CEF A;  4Z4E A;  1X9M A;  1ATN A;  3SAF A;  3GL1 A;  3LWL A;  5HL7 L;  1HNW K;  2LSN A;  2A3Z A;  4FJ7 A;  4WCE L;  4AQY K;  3OYC A;  2X78 A;  4CHY A;  4M45 A;  3NVM A;  4MDB A;  3LM2 A;  5GAD P;  2PYJ A;  2OAN A;  1RBT A;  1DKG D;  2HND A;  2EHG A;  2YCH A;  4CF1 A;  1QHA A;  4FWR A;  4JI6 K;  3RSE A;  3HTV A;  1VSI A;  1BIU A;  4YOX A;  4QS7 A;  4DWI A;  5HRP A;  4CJP A;  4OO1 J;  3I55 N;  4IFV A;  5DM7 L;  1IKW A;  3SCX A;  1NGD A;  1RDC A;  4JK7 A;  4KHU A;  1NGA A;  3HI0 A;  1HMV A;  3AV9 A;  3QIC A;  4CEC A;  1ESV A;  4BC2 A;  2QXF A;  1RDU A;  1S22 A;  2YHX A;  4FJI A;  4IFE A;  4FO0 A;  3NH1 A;  3UIQ A;  3OYL A;  3K9K A;  1S9E A;  2HNY A;  4WQ5 A;  4CZG A;  1KVA A;  4CD1 A;  3SUN A;  3SPZ A;  3VQ4 A;  3EYZ A;  4ISE A;  3HM8 A;  3SQ4 A;  2A41 A;  4LH5 A;  1WSF A;  1M90 O;  3ISN C;  1RDW X;  4C8M A;  3CCV N;  1XMQ K;  3HL8 A;  2Q97 A;  4CJ4 A;  4KH6 A;  3O8M A;  2P9N A;  4MFB A;  5C2D A;  4A62 A;  5HBM A;  4Z4F A;  1BQM A;  4WQ4 A;  3DRS A;  3ZX0 A;  4CHO A;  5H1S Q;  1XMO K;  4ELU A;  3C0B A;  3VET A;  4CZF A;  1VQ8 N;  2E1Z A;  1C0M A;  1W2B M;  1L3U A;  3MWP A;  3BP8 A;  3WEE B;  2HVH A;  2UUB K;  3T19 A;  3QEV A;  2AP1 A;  1RDD A;  4CJL A;  2CGJ A;  5BPL A;  2P5O A;  3QNN A;  4MLH A;  3E66 A;  4JI3 K;  4FK2 A;  1DT9 A;  3H3O B;  3O1B A;  1ZBH A;  3I33 A;  1YXQ A;  2XRI A;  5AJ3 K;  4F2S A;  3M6G A;  2UU9 K;  1IKV A;  3K57 A;  3D2E A;  4JK8 A;  3FZM A;  3QEX A;  4RW8 A;  1Z26 A;  4W5Q A;  3UE5 A;  4FJX A;  3L4I A;  1LW0 A;  1TUU A;  2QWQ A;  3SNN A;  1NGJ A;  2VQE K;  3RVC A;  4CCH A;  2OYQ A;  3RMA A;  4CVN E;  5EU7 A;  2ZJP L;  3CFO A;  3A5O C;  5GAG P;  1M1K O;  1GOB A;  3DOK A;  1TKX A;  3VER A;  1LWC A;  5A2Q O;  3NGI A;  2DTU A;  4CJ3 A;  4ZTF A;  4WE1 A;  3QEW A;  3HPO A;  3LM9 A;  5KGX A;  5AZJ B;  5JMV A;  1RT6 A;  3LDS A;  3AVB A;  1JXE A;  3CG7 A;  4JKD A;  4CEA A;  5KQD A;  4LD0 A;  4IO8 A;  2JLE A;  2GWK A;  2G8V A;  4KV8 A;  3CER A;  4CFC A;  1YIT N;  4M3R A;  2BGG A;  3NBP A;  3A0I X;  1Z25 A;  2W42 A;  1Q18 A;  4KI4 A;  3LAN A;  3D45 A;  3H3N O;  4ISG A;  1WBD A;  4KFB A;  3THX B;  1BHL A;  4A2A A;  4NCB A;  2QWL A;  3L2R A;  1BIZ A;  3O4Q A;  3OA9 A;  4DU1 A;  3SYZ A;  3LP1 A;  4CZH A;  3S41 A;  3OBY A;  1CXQ A;  4GY2 B;  1U47 A;  3HXM A;  4DTM A;  3U9D A;  3NE6 A;  3ZT4 A;  2VG5 A;  4B1V A;  2W40 A;  4CJU A;  1WSJ A;  4CER A;  3TAQ A;  4H4O A;  2ITM A;  2E20 A;  1VSL A;  3AGR A;  4WYB A;  4ILH A;  3V4I A;  1YTU A;  4RTF D;  3CCM N;  3FFK B;  3G0Z A;  3CD6 N;  3QLH A;  5CY4 A;  1JLB A;  4OGC A;  1HYV A;  3P4I A;  3CJ7 A;  1BA1 A;  3ID8 A;  3K2P A;  2I7P A;  4FJM A;  3BEX A;  3CCS N;  3DLH A;  1RT3 A;  1JLC A;  4IO9 L;  4HHT A;  3V9U A;  4JAX A;  3CPW M;  4DU3 A;  4CGG A;  4JKC A;  1S1T A;  4YHH K;  1RBU A;  4O4G A;  3TAB A;  1BCM A;  4CJF A;  3O9Q A;  3K58 A;  1HJO A;  4QAG A;  2XHB A;  2XY8 A;  4YOY A;  3ULE A;  4DSF A;  2DPN A;  3EE9 A;  4CJK A;  5C24 A;  5IT9 O;  2ASO A;  2OZS A;  1VQO N;  5AQJ A;  4CF9 A;  3FE1 A;  4B9Q A;  3AA3 A;  1JL1 A;  4H8K A;  4JI2 K;  4DQQ A;  4O55 A;  3QER A;  3E01 A;  3G25 A;  1WBB A;  1NBW A;  4OLA A;  4RWT A;  2YJF A;  3L2Q A;  2P9U B;  3CFR A;  1ZBF A;  4BGA A;  3GBT A;  3T7Z A;  1ASW A;  3PIO L;  3DM2 A;  3CET A;  3IDH A;  2E8A A;  4IBN A;  3SAG A;  4DFP A;  2NRZ A;  3ZET A;  2B4J A;  2O4I A;  5AQS A;  5AQY A;  4JKG A;  3LL3 A;  4HUF A;  2KTQ A;  2Z1G A;  2VWB A;  4DV5 K;  3VQQ A;  4YDU A;  5DK5 A;  3DLG A;  4N56 A;  1JCG A;  1FW6 A;  1EWQ A;  4B3T K;  1N33 K;  3QO9 A;  1HQE A;  4BR5 A;  3J7Z O;  1K9M O;  1A5W A;  4IJA A;  2O8E B;  1V4T A;  4ELT A;  4B3M K;  4W5R A;  3UKR A;  4QS9 A;  1BQN A;  1WSH A;  4K43 A;  2OPR A;  1NNE A;  4XEI A;  1RT2 A;  4M41 A;  2ZQB A;  1JKH A;  3RRG A;  3C7N B;  3FFI A;  3MX5 A;  3WXI A;  3OYI A;  4O5B A;  5KPR A;  3UKU A;  1SL2 A;  2HHU A;  4JI4 K;  4BRN A;  1NGH A;  2V7Y A;  3CC7 N;  3W3D A;  3JXU A;  4YNQ A;  3TAR A;  4BRE A;  2HBJ A;  2Q1N A;  5BRE A;  5CE3 A;  1GLE G;  3R6M A;  4DTR A;  2GUP A;  2R7Y A;  4C8O A;  2D0C A;  2FSN A;  3P31 A;  4O8K A;  4C8L A;  3AVC A;  3AVH A;  3M5R A;  2F9T A;  3THV A;  1Q9X A;  3SV4 A;  2GTD A;  4AIL C;  3E9O A;  4FJK A;  3MEE A;  1S3X A;  2KHO A;  5ADX A;  4DSI A;  4KI6 A;  2YNH A;  2WFB A;  4BWM A;  3IRX A;  3KLH A;  3LDN A;  4NCG A;  4XH1 A;  3QBX A;  4B1U B;  4GVE A;  3FZK A;  3AAP A;  3L4Q A;  2QK9 A;  4J8F A;  5EOY A;  5FRM A;  3HSC A;  2DFE A;  5BRH A;  3RTV A;  3G6E N;  3OYJ A;  2NRR A;  3FGU A;  4M7X A;  3EO3 A;  2Q0R A;  3HRG A;  3NDK A;  5AQL A;  4KHS A;  1HLU A;  3LDO A;  3R9P A;  3DJC A;  4B9V A;  4FL9 A;  1N36 K;  3KD5 E;  3OS0 A;  4BE2 A;  3O80 A;  4JS5 A;  1QVF M;  4E89 A;  4WF9 L;  2PZS A;  3AY9 A;  3GG4 A;  4EP4 A;  2HHW A;  1T6D A;  5J2P A;  3HM9 A;  3BY5 A;  1GLF O;  4HUG A;  1D8Y A;  2Z1J A;  2ZGY A;  4KHP K;  4FLW A;  1HJR A;  3ASM A;  4DMN A;  2GBZ A;  1FJG K;  3W0L A;  3VPZ A;  4FSV A;  4E1N A;  4H0Y B;  3VQA A;  3CPE A;  4CED A;  2NNW A;  2X6S A;  2PBD A;  3HT3 A;  3NCI A;  2IOC A;  4MDA A;  4IDK A;  1Q9Y A;  1REV A;  2D0O A;  4IEE A;  4CJW A;  4DTX A;  4YDU C;  4FLZ A;  4FM1 A;  4DQR A;  5D3G A;  4K25 A;  3CXC M;  4F3T A;  1SKS A;  3CYM A;  3JAM O;  1TK8 A;  3CQ8 A;  1WSI A;  2B5J A;  3EKU A;  2A6A A;  5CHI A;  3DXK B;  4FLU A;  3NF9 A;  4Q0B A;  3P39 A;  1VQN N;  2HMP A;  3IS9 A;  3Q7C A;  3MED A;  4ID5 A;  4FWO A;  4KKO A;  5BPM A;  1C0F A;  4BR4 A;  1T44 A;  3FZL A;  3MN9 A;  3D2F A;  4GNI A;  3M8P A;  1C0U A;  4JK9 A;  5BPN A;  4ILG B;  1DLO A;  3WNF A;  1I94 K;  2OZM A;  5LL6 Z;  1XNR K;  3DLE A;  1ITG A;  3BF1 A;  5KTQ A;  2P9S A;  4JI5 K;  1NG9 A;  1ZBS A;  4E0D A;  1VQ7 N;  3ITH A;  2ZJR L;  1YJW N;  1S72 N;  4DV0 K;  2QKB A;  4CHP A;  2ITG A;  4O44 A;  1UWB A;  2YHA A;  4FZZ A;  4B3S K;  2JWK A;  2P9N B;  2QI2 A;  4JI8 K;  3PUF A;  4AM6 A;  3HO1 A;  3IFR A;  4DF8 A;  2KZM A;  1N6Q A;  3H08 A;  1Y97 A;  4FK0 A;  2DY4 A;  3VA0 A;  2IDO A;  5AQR A;  3CF5 L;  4K0K K;  1TGO A;  5AZI B;  1KVB A;  2QKK A;  5J2M A;  5AQU A;  3MMV A;  2HBM A;  1MWM A;  3F9M A;  4JHD B;  1QSY A;  1QQO A;  3CHW A;  1NKB A;  2O8B A;  3PLA A;  3VQ5 A;  1L5U A;  2E4L A;  3ZEU A;  1JLQ A;  4FXD A;  3NGZ A;  2ASM A;  2Q36 A;  1D9D A;  3LP0 A;  2AA4 A;  3QEP A;  5AQQ A;  4UQG A;  4PA1 A;  5I42 A;  3H1Q A;  1NLV A;  4BRL A;  4DQI A;  3EN9 A;  4A5B A;  1NGF A;  5CYQ A;  1GLB G;  1HKB A;  2BTF A;  4FWK A;  1TAU A;  1ZC6 A;  3L2W A;  3B8A X;  4JRP A;  1BUP A;  2G8K A;  3ATU A;  1KC8 O;  3CCE N;  2KQ2 A;  2G8F A;  4B1X B;  2IGI A;  3AO5 A;  2UYT A;  2QWR A;  1EXQ A;  4FPB A;  3OYD A;  4OKK A;  5E41 A;  1S1V A;  4CIF A;  1J6Z A;  4A5A A;  4AHS A;  4YOR A;  5LMU K;  2YNF A;  4IJN A;  3KVG A;  3CCU N;  5FRO A;  3LZJ A;  1NK9 A;  2CH5 A;  1HYS A;  4Z0U A;  1KSP A;  1J5O A;  4W5T A;  1LCU A;  5AQV A;  2FC0 A;  1GLJ O;  2E2N A;  4H0T B;  3EL2 A;  2P9P A;  3THW B;  4KTZ A;  4JI7 K;  4BR9 A;  5DM6 L;  5E84 A;  1N32 K;  4XIU A;  4DSL A;  4KPY A;  3ZT2 A;  5GAH P;  1QQM A;  5FPE A;  1NGB A;  3H45 C;  2O4G A;  4H5R A;  4L3Q A;  3JS6 A;  2FBT A;  3TTF A;  4K8X A;  3DI6 A;  2V7Z A;  1V4S A;  1XI1 A;  5M1Q A;  3E9P A;  2P51 A;  3KHY A;  5M1P A;  4OGE A;  4NYN A;  4O0I A;  2QA4 N;  2HHT A;  3F9K A;  5JIC A;  4DTO A;  1GOC A;  3O9U A;  2YHB A;  4DSK A;  4KH4 A;  2KFN A;  4CFB A;  3AO4 A;  3CJB A;  3O3G A;  4BRF A;  2QWM A;  4IDH A;  2D0P A;  5J2N A;  1YT3 A;  1BCO A;  3O5B A;  4FJG A;  5FPD A;  3J81 O;  4GKK K;  4BRA A;  3THY A;  3IMX A;  1ZYQ A;  3TI0 A;  5CZ2 A;  4R79 A;  3SUP A;  1RDB A;  2HBK A;  3ZSY A;  3B6O A;  2P9I A;  2UXC K;  2EWS A;  1BL3 A;  4E3S A; 
#chains in the Genus database with same CATH homology
 3U9D A;  5BN8 A;  4ILJ A;  1BG3 A;  4JD2 A;  3CCL N;  4B1V A;  4FPA A;  4CBU A;  2CGL A;  3QFU A;  2W40 A;  3VGM A;  4JHD A;  1NGG A;  5LJV A;  4BQL A;  3UB5 A;  1Q81 O;  1MA9 B;  3WT0 A;  1ATR A;  2ITM A;  1KD1 O;  3A8Y A;  2E20 A;  4MO5 A;  3WXJ A;  3AGR A;  4WYB A;  4ILH A;  2NRW A;  3E1Y A;  2FSJ A;  1K73 O;  2D4W A;  4RTF D;  3CCM N;  1KAZ A;  2QXL A;  1JCE A;  3FFK B;  2Q0U A;  3VF4 A;  3CD6 N;  5BRD A;  4DCH A;  3P4I A;  4A2B A;  3VF6 A;  3CJ7 A;  1BA1 A;  4CD3 A;  3I8B A;  3ID8 A;  2I7P A;  5AR0 A;  2ZGZ A;  3CJ1 A;  3BEX A;  3CCS N;  1VQ6 N;  2HF4 A;  4JKA A;  4IO9 L;  2ZWH A;  3R3L A;  3VEZ A;  4JAX A;  3CPW M;  2HOE A;  4JKC A;  4FWM A;  2V52 B;  1NGI A;  1P90 A;  3AAQ A;  1JCF A;  3O9Q A;  2P9U A;  1HJO A;  3DAW A;  2A5X A;  4YOY A;  4H5T A;  3CCJ N;  3ULE A;  4CZL A;  1H1V A;  2DPN A;  3EE9 A;  3QFP A;  4BC3 A;  2HST A;  3OW2 M;  3R1X A;  1RFQ A;  2ASO A;  4BC4 A;  1VQO N;  5AQJ A;  1U6Z A;  3FE1 A;  4B9Q A;  4BR0 A;  1KXP A;  1VQK N;  2W41 A;  3MN5 A;  1ZXO A;  5AQW A;  5GIN A;  4BRP A;  3HOS A;  1YHQ N;  4DKW A;  3G25 A;  1HPM A;  2Q2R A;  3M3Z A;  3VOV A;  5KPT A;  1NBW A;  1RGI A;  4O5F A;  1P8Z A;  4QS8 A;  3CJC A;  3GOI A;  3QB0 A;  2WBN A;  4RWT A;  2YJF A;  4PKG A;  3MCP A;  3DXM A;  1VQ5 N;  2P9U B;  1BWF O;  4BGA A;  3GBT A;  4JN4 A;  3T7Z A;  4CJ7 A;  3PIO L;  4G9Z A;  2A42 A;  3CET A;  1BA0 A;  3IDH A;  4BRH A;  3D6R A;  2E8A A;  2YI1 A;  4A61 A;  3FZF A;  3SAG A;  4BR2 A;  1TYQ A;  2NRZ A;  3AAR A;  5F0X A;  3ZET A;  4PL8 A;  3OBW A;  4PKI A;  4K42 A;  4BVO A;  5AQS A;  5AQY A;  3WQU A;  5AQP A;  4JKG A;  3LL3 A;  1SQK A;  3DLL L;  4NO7 A;  4BRI A;  2ZJQ L;  3CC4 N;  5AQZ A;  4H03 B;  3SBT A;  4CBX A;  4FWQ A;  4FWP A;  3FZH A;  4FWS A;  4OPH A;  4E1J A;  2VWB A;  3HOT A;  4BY9 C;  4YDU A;  4AF1 A;  3CMA N;  3F2K A;  4A59 A;  3VTH A;  3TTC A;  5FPN A;  1JCG A;  1Z6R A;  3C65 A;  4A57 A;  4BR5 A;  4JKH A;  3J7Z O;  1K9M O;  2GEL A;  1VAZ A;  3PIP L;  2QWP A;  3O4W A;  1VQ4 N;  3DXM B;  4IJA A;  1V4T A;  3E9L A;  4LC9 B;  2QW9 A;  3I56 N;  1Q86 O;  2FF3 B;  3UKR A;  3O9T A;  5EXW A;  4BC5 A;  4QS9 A;  5C15 A;  4Z94 A;  5TKW A;  2E88 A;  3ZET B;  4K43 A;  2A40 A;  2HF3 A;  2GWJ A;  4JNE A;  4CZJ A;  3GDQ A;  4XEI A;  2F7T A;  3ZEU B;  2P9L A;  1VQM N;  3C7N B;  3MX5 A;  3SLC A;  3WXI A;  3VEV A;  5KPR A;  2VCP A;  3UKU A;  2YHW A;  4BRN A;  4MO4 A;  5CR4 A;  1NGH A;  4H5W A;  2CGK A;  2V7Y A;  4EAH D;  4FOI A;  5M1N A;  3CC7 N;  3TTD A;  3JXU A;  1YUW A;  3L6Q A;  3W3D A;  4WQ5 C;  3ZX2 A;  1VQL N;  3QML A;  3VEX A;  3M1F A;  2YHY A;  4BRE A;  1BDG A;  2HBJ A;  2Q1N A;  5BRE A;  1MWK A;  3A5N C;  4NLB A;  3NMU A;  5KQ8 A;  5CE3 A;  3RSE B;  1GLE G;  5AFU A;  4GV3 A;  2P9P B;  3R6M A;  2NRV A;  3ENB A;  5M1K A;  2IVN A;  3CQY A;  2GUP A;  4BVP A;  1SZ2 A;  4BGB A;  4BQZ A;  5EX5 A;  2FSN A;  2E2Q A;  3R8E A;  3CME N;  3P31 A;  3HBT A;  4O8K A;  3NVK A;  2RE2 A;  1D4X A;  2IIR A;  2D1K A;  1BU6 O;  4GV6 A;  3M5R A;  3EE8 A;  4HTL A;  2F9T A;  3T69 A;  2JWL A;  2P9L B;  2GTD A;  2GEM A;  3CCQ N;  3OHR A;  3C7N A;  1GLD G;  1GLC G;  1LOT B;  3E9O A;  4YOU A;  5C10 A;  1S3X A;  2KHO A;  5ADX A;  4FOE A;  2QM1 A;  2WFB A;  3VES A;  4IOX A;  4O8U A;  3WXM B;  3LDN A;  3QDK A;  1GLL O;  3O08 A;  4XH1 A;  3QBX A;  4EIA A;  4IOC L;  1QVG M;  4B1U B;  4GVE A;  3FZK A;  4H0P A;  1HUX A;  3AAP A;  1EQY A;  3L4Q A;  1DGK N;  4J8F A;  5EOY A;  4WFB L;  1VQP N;  3HSC A;  3TPQ A;  5BRH A;  2NZT A;  3G6E N;  2NRR A;  4BRQ A;  1Q82 O;  3FGU A;  4M7X A;  2NLX A;  1XUP O;  3H1V X;  3SBG A;  3CJ9 A;  4IZ9 A;  3EO3 A;  2Q0R A;  3FLC O;  3HRG A;  5ELZ A;  5AQL A;  3HZ6 A;  1HLU A;  3LDO A;  3R9P A;  1EO1 A;  3DJC A;  3WXK A;  3VGK A;  2BH1 A;  3IUC A;  3LDP A;  3O1W A;  4FL9 A;  4KH5 A;  3O6W A;  3GE1 A;  4B1W B;  3MCA B;  3O80 A;  2FF6 A;  1QVF M;  5GIP A;  4WF9 L;  3C6H A;  1E4G T;  2YJE A;  4WQ4 C;  5AQT A;  3AY9 A;  2GX9 A;  3GG4 A;  5I9E B;  3U4L A;  1T6D A;  1O13 A;  5AQG A;  1GLF O;  2ASP A;  1K8K B;  3VEO A;  5FPM A;  5LJW A;  4Y0W A;  5JVH L;  2ZGY A;  4FVU A;  5AQI A;  4BG8 A;  5JVG L;  4H0X B;  1JJ2 M;  4BRD A;  4PL7 A;  3TU5 A;  1U2V B;  4NLC A;  4C1N I;  4OPA A;  3W0L A;  4BG9 A;  2HBL A;  2E1Y A;  3VPZ A;  4DHY A;  1NM1 A;  4FSV A;  2E2O A;  4H0Y B;  4JEP A;  3J8A A;  3H6E A;  3QBW A;  1YI2 N;  3CPE A;  1TYQ B;  2NNW A;  3VF2 A;  3BUZ B;  2PBD A;  2FSK A;  5AQM A;  3ZX3 A;  4BRC A;  3D7E O;  4BRM A;  5JLH A;  3CIP A;  4MDA A;  4CZM A;  5BR9 A;  5AQX A;  3MX2 A;  4IEE A;  2D0O A;  2QWN A;  4DB3 A;  4YDU C;  3C6A A;  4K25 A;  3CXC M;  1NMD A;  5GIO A;  4BRK A;  4H0V B;  5KPZ A;  2PFU A;  3Q7B A;  3WUH A;  3D2F B;  1K8K A;  4CBW A;  3EKU A;  5AQK A;  3FR0 A;  1T6C A;  4NB4 A;  2A6A A;  3SAH A;  4F9O A;  3N4Q A;  2QTD A;  2P9S B;  5CHI A;  4XH5 A;  1T3V A;  4JKE A;  4M63 C;  3SJH A;  1DEJ A;  3UKR B;  3DXK B;  1Z05 A;  3BF3 A;  2RHK A;  4YOT A;  1N8R O;  2P9K A;  1QZ5 A;  4YOW A;  4H5V A;  3LDL A;  3P39 A;  2QEX N;  2H3G X;  3TSP A;  2HMP A;  3O9R A;  3WQT A;  1VQN N;  3Q7C A;  3VEN A;  4UY8 O;  5AQH A;  4FWO A;  3CJA A;  1ATN A;  4KBO A;  1VQ9 N;  3SAF A;  3GL1 A;  5BPM A;  1C0F A;  4BR4 A;  1Q7Y O;  3MN7 A;  1T44 A;  4IOA L;  2ZF5 O;  5HL7 L;  3FZL A;  2A3Z A;  3MN9 A;  4WCE L;  3D2F A;  2J4R A;  4GNI A;  4JK9 A;  5BPN A;  4I6M A;  5F1X A;  3NVM A;  4ILG B;  4MDB A;  3A5L C;  3LM2 A;  5GAD P;  2OAN A;  1DKG D;  2WUS A;  2YCH A;  2I7N A;  4WFA L;  1QHA A;  4FWR A;  4M7Y A;  3RSE A;  5HOO A;  3HTV A;  1X9J A;  3VEY A;  3ENH A;  4YOX A;  3BF1 A;  4QS7 A;  2P9S A;  3SMP A;  1XQS C;  5ADX H;  1ZBS A;  2P9K B;  1VQ7 N;  3TSQ A;  4OO1 J;  3I55 N;  3DXK A;  2ZJR L;  4IXC A;  1YJW N;  1S72 N;  2YX6 A;  5DM7 L;  3ULE B;  3VEW A;  1ATS A;  1NGD A;  3A5M C;  1IJJ A;  1OVY A;  1KAX A;  1W97 L;  4JK7 A;  5F2R A;  2JWK A;  4EHU A;  1NGA A;  2P9N B;  2QI2 A;  3HI0 A;  3QIC A;  1G99 A;  4K41 A;  1IG8 A;  1WUA A;  5AQN A;  4AM6 A;  1ESV A;  3IFR A;  3KWG A;  4BC2 A;  1BO5 O;  1RDU A;  1S22 A;  2YHX A;  4EHT A;  1MDU B;  2FLO A;  4CZE A;  3MDQ A;  4BRG A;  4IFE A;  5EVZ A;  4FO0 A;  3K9K A;  5AQR A;  3CF5 L;  4RCH A;  5AZI B;  3VGL A;  4BR7 A;  4WQ5 A;  2F9W A;  4CZG A;  4CD1 A;  4H5N A;  1TUY A;  1YF5 L;  3KWI A;  2QWO A;  3CCR N;  5AQU A;  3MMV A;  2HBM A;  4ISE A;  4C23 A;  3HM8 A;  1MWM A;  3WEE A;  3F9M A;  3K9J A;  2A41 A;  4JHD B;  1QQO A;  2BUP A;  4GV9 A;  3WXL A;  3EKS A;  1M90 O;  3CHW A;  3VMF B;  5AFU H;  3PLA A;  1RDW X;  3VTI A;  2V51 B;  2NRT A;  3LDQ A;  3CCV N;  3KZB A;  3ZEU A;  3MN6 A;  4BRO A;  2Q97 A;  1KQS M;  4WFN L;  1ILY A;  2ASM A;  4KH6 A;  4B1Z A;  3O8M A;  2P9N A;  4B1Y B;  2Q36 A;  2Q31 A;  3H46 O;  2PAV A;  5C2D A;  4IEI A;  2AA4 A;  4JKB A;  4A62 A;  2OTL N;  5AQQ A;  4JKF A;  1HKG A;  3H1Q A;  1NLV A;  4BRL A;  3EN9 A;  4WQ4 A;  4A5B A;  4CZI A;  1NGF A;  1X3N A;  5E26 A;  5C2F A;  3ZX0 A;  1YAG A;  1HX1 A;  1GLB G;  5H1S Q;  1C0G A;  1HKB A;  4IWV A;  2VGM A;  3ID6 A;  3P38 A;  2BTF A;  4FWN A;  4DQ8 A;  3C0B A;  3VET A;  4CZF A;  4FWK A;  4PHT X;  2VYP A;  1YIJ N;  5AZI A;  2OTJ N;  1U2V A;  4YOV A;  1VQ8 N;  2E1Z A;  1ZC6 A;  4AM7 A;  3B8A X;  2IVP A;  1W2B M;  3ATV A;  3MWP A;  5AQF A;  1SAZ A;  2CH6 A;  3BP8 A;  3WEE B;  1BUP A;  1NWK A;  4CI6 A;  2NRX A;  3ATU A;  4ISF A;  1KC8 O;  2AP1 A;  3CCE N;  3TSU A;  2CGJ A;  4B1X B;  4EFH A;  5BPL A;  5AQO A;  2WC9 A;  3DWL A;  4MLH A;  3E66 A;  2UYT A;  3ZYY X;  2QWR A;  1CZA N;  1DT9 A;  4U67 L;  3H3O B;  3O1B A;  3I33 A;  1YXQ A;  4FPB A;  3M6G A;  2FXU A;  1Y64 A;  5M1F A;  1J6Z A;  1NGC A;  4A5A A;  4YOR A;  1KAY A;  3D2E A;  3KVG A;  4IJN A;  3CI5 A;  4JK8 A;  3CCU N;  3FZM A;  5AZJ A;  2CH5 A;  4CZK A;  1BOT O;  1OKJ A;  3AGK A;  3F5T A;  4FWL A;  1NGE A;  1YJ9 N;  1YJN N;  4PKH A;  3UE5 A;  1LCU A;  5AQV A;  3CC2 N;  3L4I A;  1GLJ O;  3N4P A;  3G71 N;  1TUU A;  3ENO A;  2IVO A;  2E2N A;  4H0T B;  3EL2 A;  2QWQ A;  2P9P A;  3IKM A;  1NGJ A;  1HKC A;  1WOQ A;  5TKY A;  4BR9 A;  5DM6 L;  5E84 A;  3U8X A;  3RVC A;  5GAH P;  5GAE P;  1QQM A;  5FPE A;  1NGB A;  3H45 C;  4H5R A;  5BN9 A;  4L3Q A;  3JS6 A;  5B8H A;  4H0O A;  1XC3 A;  2ZJP L;  3A5O C;  3TTF A;  5GAG P;  1QQN A;  1M1K O;  2V7Z A;  3VER A;  1V4S A;  4JKG B;  3E9P A;  3KHY A;  5M1Q A;  5M1P A;  2P9I B;  5EY4 A;  4I6M B;  1R59 O;  3D2E B;  3LM9 A;  3KK7 A;  5AZJ B;  5BRF A;  5JMV A;  3SK3 A;  3EZW A;  3CQX A;  5C12 A;  2QA4 N;  5JIC A;  4HWI A;  2KLA A;  4JKD A;  4C1N K;  1X3M A;  3MK6 A;  3O9U A;  2VGN A;  5KQD A;  3L0Q A;  4IO8 A;  4KH4 A;  4MLE A;  4JD2 B;  2GWK A;  3SMS A;  3CER A;  3CJB A;  3U9Z A;  4BRF A;  2QWM A;  4IDH A;  1YIT N;  3O9S A;  2D0P A;  4XH4 A;  3A0I X;  1SS6 A;  1E4F T;  1Q18 A;  3G4S N;  1K8A O;  3O5B A;  5LY3 A;  3H3N O;  5MLC Q;  4ISG A;  5FPD A;  5M1O A;  4BRA A;  1GLA G;  3IMX A;  4A2A A;  1QZ6 A;  2QWL A;  1NJI O;  1YVN A;  5JLF A;  4R79 A;  2NRH A;  3OA9 A;  4U7B A;  2HBK A;  2KKZ A;  5C0Y A;  4CZH A;  3S41 A;  2E2P A;  3UKU B;  2P9I A;  3OBY A;  2EWS A;  4GY2 B;  3MWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...