4IO9L

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4io9L01
3PIOL 5DM6L 1Q81O 3DLLL 1W2BM 1YJWN 3OW2M 1VQON 5MLCQ 3CPWM 1KD1O 3CD6N 3CCQN 4U67L 1N8RO 1M1KO 3CCMN 1NJIO 1K73O 1Q7YO 1VQMN 1QVFM 1Q82O 2ZJQL 1VQ4N 3CCVN 1KQSM 5HL7L 3J7ZO 5GADP 5JVHL 4IOCL 3CCSN 4WF9L 1YI2N 1YJNN 1VQLN 4WFNL 5JVGL 3CC2N 3CMAN 3G6EN 5H1SQ 4WCEL 3CCRN 1VQNN 3I56N 1YHQN 1VQ6N 1K8AO 4UY8O 5DM7L 1Q86O 3I55N 1VQPN 3CF5L 3CXCM 1KC8O 1M90O 3CCEN 3CCLN 4IOAL 5GAGP 3G4SN 1ILYA 1VQKN 5GAEP 4WFBL 2QEXN 1QVGM 1YITN 5GAHP 1K9MO 2ZJRL 3CMEN 4IO9L 1OVYA 1VQ7N 2OTLN 1YIJN 2ZJPL 3G71N 3CCJN 1S72N 3PIPL 1JJ2M 3CC7N 1VQ5N 1VQ8N 1VQ9N 1YJ9N 2QA4N 3CCUN 3CC4N 4WFAL 2OTJN
chains in the Genus database with same CATH superfamily
5DM6L 1Z05A 4JNEA 1IBLK 2YNGA 4IFEA 4I7FA 4CJ5A 3C6HA 1ZBLA 4DQIA 1KRPA 1W2BM 1VK0A 2FSJA 3AVJA 4PA1A 3LWMA 3NCIA 1RTDA 2QKBA 1RDBA 1L5UA 2I7NA 2DFFA 3OYDA 3C94A 2DFHA 3GDQA 4CI6A 3AVIA 1E3MA 3FR0A 5BR8K 3H08A 1KFSA 1S1UA 3KWGA 2HNZA 3P4IA 3CJ7A 2KW4A 4CFAA 4DV4K 3MXJA 3CCVN 1KQSM 2IVOA 3QINA 5FPDA 3NGZA 4BRQA 5HL7L 4CGIA 2UXDK 3CI5A 2E2QA 4IOCL 1WAJA 4CJPA 3H3OB 2OA8A 1U04A 1X3NA 3THYB 3WEEB 1GLEG 1RILA 3AA3A 1FK9A 5EY4A 2HVIA 5C25A 1KVAA 3OBWA 4JS5A 1HUXA 2YHAA 2GV9A 4BRCA 5C42A 1HNVA 3DAWA 4CK2A 1RTHA 1UWBA 2AP1A 4HCCA 3I55N 2YHBA 1VQPN 3VGKA 3SPZA 4FWOA 5J2PA 3CCEN 4CFCA 1ILYA 4JKFA 3TTFA 1D9DA 4B1YB 3AVLA 4KFBA 2ZF5O 4B1XB 1VSLA 3UIQA 3ULEB 1IO2A 4PHTX 3SAHA 3KLFA 4EZ9A 1V4TA 2E1YA 4BRPA 4O5BA 2BTFA 4CEAA 3SUQA 4QS7A 4KHUA 3M8PA 4IO9L 3SQ0A 1EWRA 3ZX3A 4DS4A 3VTIA 1NKBA 1Q9YA 1C0MA 3K59A 4FWRA 1TKXA 4ISEA 1CZBA 4ELTA 5LMUK 4BGAA 3DOLA 3ULDA 1XHXA 4CHQA 4Z4GA 1FJGK 4DU1A 3F9MA 3A5LC 4DFMA 4M63C 3UKRA 4GNIA 4M3XA 2Y1JA 4IG0A 5EXWA 1N34K 3OJSA 4JI7K 3ZSQA 1HJRA 2Q36A 4JHDB 1GLFO 3IS9A 1ZBHA 3LDOA 1NKCA 2HHXA 4YOYA 1T3VA 3O4NA 3VEVA 1B9DA 1BO5O 4CBUA 3AAQA 2FSNA 4KI4A 1J54A 2YNHA 3LAKA 3VQ7A 1NM1A 3CQYA 3DXKA 5K14A 4EFHA 3HVRA 3KJVA 4OGEA 2YHXA 5GADP 3RR7A 1JCEA 3MEDA 3KTQA 1T6CA 3K57A 1BOTO 1BIZA 3WNFA 1HLUA 1NNEA 3SJJA 5TKYA 4YFUA 4CHPA 1UA1A 4AHCA 1VQNN 4HWIA 3O3GA 1HNIA 4NYFA 1EETA 1VQ6N 3FZHA 3O9QA 2PYJA 1JL1A 3KLEA 4BE1A 4IBNA 1C0GA 3V9ZA 5HRSA 3U9ZA 4W5RA 3L2VA 3O5BA 4E7LA 4KAZA 1ATNA 4BRKA 2OYQA 1BG3A 5BN9A 3T7ZA 3BZCA 2VG5A 4O5FA 2IAJA 4OLBA 4FM0A 3FLCO 4I9QA 3DYAA 3CCJN 1RBUA 4JK9A 3MCPA 5GIOA 3CC7N 1VQ5N 5CZ1A 2E8AA 1HNWK 3VQ5A 3IUCA 1L3VA 2IVPA 1BHLA 3EO3A 4PWDA 4NLCA 1N33K 4MLHA 4DV3K 1TKDA 3A5MC 4OLAA 4O44A 4H5WA 2O8BB 3U6FA 3DXMA 3PIOL 2P9PA 5AQGA 3FGUA 4YNQA 2GWJA 2H3GX 3L2UA 1HPZA 3ZSZA 4ID5A 2ZWHA 1KAYA 5JLHA 2PYLA 1RDUA 1BWFO 3AAPA 2JGUA 2LSNA 3HBTA 1YXQA 1KLNA 3QNNA 2Z1HA 4CEDA 4IFYA 3BGRA 3CPWM 3VN5A 5JLFA 4CZEA 4FJGA 3NF7A 3ZX0A 1XMQK 1N36K 2HF3A 1Y97A 4DV5K 1T8EA 1JXBA 3HYFA 1S1WA 1GOBA 5KQDA 4C1NI 2Q1NA 5GIPA 3KIOA 3CCSN 5BPMA 3MX5A 1EX4A 1SL2A 4BC2A 4GKJK 4KRFA 4M7YA 1HNZK 4BR4A 1WSGA 4HUEA 1N5YA 3THYA 4NCAA 3WEEA 2J4RA 3HSCA 4FWSA 3NGIA 2A40A 2WFBA 4RTFD 4KTZA 2CGKA 3ISNC 1HYZA 4HTUA 3LM2A 1K8AO 3L3VA 4KV8A 2Q2RA 3ENBA 3G0ZA 3CJAA 4XEIA 3O1BA 1DT9A 4KHPK 4DTMA 3SK3A 4IDHA 4DSJA 5CY4A 4YDUC 5AQTA 4CJKA 4E7JA 3CFPA 4EIAA 3PSIA 3R3LA 4DR4K 3ULEA 3WNEA 4LH4A 4YORA 2OTLN 3O4WA 4DTUA 3TANA 2A3ZA 3QEIA 4CJSA 2DPNA 3OA9A 4ISFA 1MWMA 5AFUA 2QWLA 2NLXA 1FW6A 2V52B 3LM9A 2QM1A 2G8KA 1QTMA 1T6DA 2ITMA 5FLXO 1WN7A 1VHXA 3NH2A 3OYCA 4MO4A 4CGFA 1TL1A 2ITGA 2QTDA 3OW2M 4FJIA 3H1QA 3TAFA 1KD1O 2QWPA 1VSDA 2E88A 4JHDA 2A5XA 3E01A 3EKSA 4CJ4A 3IAYA 3QIPA 1M1KO 3KWIA 1WAFA 3VQEA 1RDWX 3VPZA 3HPGA 3ZSRA 1VQMN 4Q0BA 3P83D 4BY9C 2ZQBA 4PL8A 1JXEA 1RTIA 2F9WA 3O3FA 4B1VA 5BR9A 3DWLA 3AA5X 1T03A 4IEEA 3O9RA 4FXDA 2ETJA 5FRNA 4O0JA 3FFKB 3EZ5A 1VQLN 2YJEA 4DTRA 4FOEA 4BRIA 4K8XA 2YKMA 1IJJA 4ID1A 2NRHA 5AQRA 3O9UA 3O6WA 3V6DA 5AQZA 4CZFA 4H4OA 3HTVA 1EXQA 4HVJA 3LDPA 3I56N 4K8ZA 4CJ3A 2OPQA 5AQXA 3I33A 4UY8O 4PKGA 4HTLA 3QEVA 1ITGA 3ZT1A 3CJ9A 2XO7A 5M1FA 1D9FA 4DSLA 1WUAA 4BQLA 1NGJA 3KHYA 4L8RB 1SUQA 3EL2A 3SBGA 4AM7A 1NGDA 4LY7A 4FJKA 2YHYA 4LFCK 4BQZA 4CJRA 3SV4A 5AQQA 1A5WA 3EY1A 2KFNA 2E2OA 4IFVA 3EZWA 3D2EB 3HK2A 4LD0A 4H03B 5AR0A 4DQPA 3AVBA 1J5OA 4KHQA 4DV1K 4ILHA 1T44A 1ZBSA 4E0DA 2D0AA 4MDBA 3PIPL 3VQDA 3K58A 2O8FB 3GOIA 1DEJA 3SI6A 2HVHA 4A62A 2QA4N 2ATQA 5KPZA 3SJHA 1IKXA 2O8DB 3QETA 1NLVA 1VAZA 1BQMA 3TU5A 1LAVA 1E4FT 2HHQA 3CQ8A 4DF8A 1U2VB 5AQUA 2O8BA 1NWKA 3GE1A 1N6QA 3VEXA 2G8VA 4EP4A 3SNNA 3CFOA 3DRSA 1VRUA 2HBLA 3MCAB 4FJMA 4I9LA 3LWLA 4GV3A 1UA0A 1E4GT 1L3SA 1D5AA 1KSPA 4JN4A 3AVFA 2BANA 4X66K 1RCHA 4OKEA 2XRIA 1TVRA 4XIUA 2HHHK 4FJ9A 1Q7YO 4PQUA 2CH5A 3DRPA 3PO5A 1SS6A 3VOVA 4H5VA 3HVTA 1S5JA 3OYJA 5B8HA 1QZ5A 1OH6A 4B9SA 1RT7A 3AA2A 2P9UB 3DJCA 1QSYA 3KKSA 3O3HA 2YJFA 3O9TA 3WQTA 4ZTFA 4C8LA 3A5OC 4NXMK 3VESA 4JI3K 1NK4A 4YHHK 4IKFA 4BG8A 4CIGA 3VF2A 3D2FB 1U4BA 3L4QA 4CJWA 4NCBA 2WONA 4FW1A 1P8ZA 1QZ6A 4F8RA 3M1FA 2OZMA 1NBWA 5AZIB 4DQRA 1HYVA 1UAXA 3CJCA 4ICLA 3TAMA 3VQ4A 4EHTA 5AQHA 3L2RA 3RSEB 2E6LA 2GTDA 3LZIA 1NKEA 3HI0A 4KH6A 3CG7A 3CETA 1C0FA 1XMOK 2WC9A 3SPYA 5IWAK 1OVYA 3TAGA 2P5OA 4H5RA 4FPBA 2X6SA 4B9TA 4C8NA 1JLQA 3W3DA 4CECA 4M45A 4Z94A 3K2PA 3WXJA 2QWRA 3SYZA 4NCGA 4AH9A 4JI8K 5E26A 1NG9A 4BC3A 1TV6A 1RT6A 4EP5A 4JKEA 2I5JA 2PBDA 3ENHA 3C6UA 1TL3A 4B1UB 3BY5A 5F0XA 3ENOA 1WLJA 4DSEA 3CD6N 5AQWA 1VRTA 4CJFA 3TTDA 3DRRA 5I3UA 1GOCA 1U48A 4IOXA 3WXMB 2P9PB 4WQ5A 2GUIA 4CJEA 1VSIA 4HUFA 3DLHA 1SKSA 4JAXA 5KGWA 3JXUA 1T05A 3CJBA 1DLOA 3RR8A 4JKBA 3K5MA 4M3RA 3LP1A 1QHAA 4OGCA 3SQ4A 1YJNN 1X1PA 3L2WA 1MWKA 2IGIA 1R0AA 2BH1A 2XY8A 2E4LA 4A2BA 5JS2A 4CIEA 3ZSVA 4N76A 3T3FA 1KXPA 2BDPA 4JKAA 3IRXA 5KGXA 3CFRA 4CERA 1BA1A 3R6MA 1YHQN 1N32K 4C8MA 4DV2K 4DV7K 1NK0A 3ZT3A 4KPYA 4JEPA 3ZSXA 4B9QA 4DV6K 3S9HA 4J2BA 1C0UA 4CJ7A 1C6VA 2QWOA 2HW3A 4ILGB 5E41A 1S9GA 4JKCA 2KTQA 3NF9A 2YX6A 3EEQA 5F1XA 4OKKA 1YAGA 3D2EA 5AQOA 2E6MA 5AQLA 2UUAK 2KKZA 3D6RA 5EX5A 3U3YA 2YCHA 2UXCK 2GWKA 1NGIA 2O8FA 2CGJA 4DTXA 4H5NA 2FF3B 3HRGA 4BR2A 3L8BA 5AQJA 3O4QA 3AGRA 3QFUA 1HPMA 4BRAA 3VA0A 4A59A 2O8DA 4BRGA 5KTQA 2HNYA 4BR9A 3HZ6A 1LAWA 2RKIA 3F5TA 1Q81O 1KCFA 1U2VA 1BISA 4CHOA 1KVBA 4O8KA 4FWKA 4GVMA 4CGGA 4I6MB 4M3WA 3Q7BA 2HOEA 2GELA 2QKKA 1EKEA 5AQSA 3T19A 1QS4A 3E9OA 3VQ9A 4JS4A 4GKKK 1QVFM 2PZSA 3E1YA 1VQ4N 1O13A 3DLBA 5M1QA 3ZT2A 4Y1DA 3AV9A 5J2NA 5KI6A 4WQ4A 3T1AA 5AQKA 3NFAA 1X9WA 3TWHA 3AO3A 3OYNA 4E7KA 4JD2B 2G8FA 4WFNL 4AHTA 3DLGA 3ZYYX 2P9UA 4FLZA 1MA9B 3MDQA 3LPUA 1RTJA 4B9UA 4DSKA 2YHWA 1T7PA 1ZBFA 4FLUA 1RT3A 4M3UA 2D0OA 3KD5E 5J1EA 2E2PA 4FJ5A 4E19A 1MDUB 2RPIA 4JV5K 2P1JA 3D2FA 4DSIA 1ZYQA 2Y1IA 5FROA 3E66A 4BRLA 1GLCG 1RBSA 4FVUA 4CJQA 5FPMA 3AVGA 3AGKA 3KKRA 3JS6A 5AZIA 3LP2A 2HHVA 4B9MA 2HMIA 2HHUA 3DOKA 5AQYA 3TABA 4OX9K 3QIOA 3DMJA 3RSEA 2VG7A 3N4PA 4EHUA 2Q0RA 1WSIA 2E5LK 3OYAA 4M7XA 4QAGA 4FCYA 2DTUA 4CGJA 3WXIA 3V1RA 2NRTA 4QS8A 3NF8A 1VQ9N 3CPEA 2O8CB 3MWTA 3VQCA 3MXIA 5ADXA 4HUGA 2Z1JA 4BVOA 1FXXA 1KFDA 3SMSA 2D4WA 3LALA 3QLHA 4CEEA 3JAMO 3OS0A 3M8SA 2F4VK 3S41A 1RGIA 1ESVA 1XNQK 4B9NA 2QWNA 5M1PA 4FJXA 2XY6A 2HBJA 4AQYK 4FO0A 1U6ZA 3HOSA 4E89A 1C1CA 2ASPA 3P38A 3AVNA 3WNGA 3W0LA 3ZT0A 3LP3A 4KBOA 1TYQB 2EHGA 4HCBA 1NJIO 5AQMA 5C24A 3MMVA 4OPKA 4BRDA 1TK0A 2P9IB 2NRRA 4K42A 2RF2A 1BCOA 1WSEA 2RN2A 2R7YA 2B4JA 4O55A 4LH5A 5JVHL 4TSXA 4WF9L 4CHYA 4DV0K 4BRHA 1YTUA 3EE8A 2KZMA 5E84A 5C15A 5AQPA 3RMDA 1D4XA 5I42A 3MX2A 2OPSA 4GVEA 3KK7A 1BIUA 1IBMK 4Z4HA 4GMJB 2FBTA 3ATUA 3ZETB 1V4SA 3DM2A 2V51B 3K9KA 4FLYA 3TI0A 5KRSA 4FJ7A 1C0TA 3DLKA 4KKOA 4CD1A 1M90O 3KK3A 2YV0X 4IDKA 5LJVA 1BCMA 1YUWA 4CHNA 4ZTJA 1HX1A 3RWUA 3HJFA 3QICA 1XWLA 4IJNA 5JMVA 3J81O 4DTNA 4E3SA 3SUOA 1J9AA 1RFQA 3OYKA 3OS1A 4XH4A 3CMEN 4DUZK 3NVMA 3HM9A 1NU0A 1RDAA 4N41A 5BRDA 4BACA 4C1NK 4EZ6A 3MEEA 2GUPA 3PX6A 5HOOA 5BN8A 1B92A 4N5SA 4LF4K 4KH4A 1BDGA 2E2NA 1GLDG 2RHKA 3ID8A 3SUNA 3IFRA 4DTSA 3MEGA 1KTQA 3M8RA 4FWQA 4M3YA 3J7YP 1Y64A 2RE2A 4K41A 2NRZA 3EE9A 2OCEA 2ZM6K 3KVGA 4JI1K 4BGBA 2FBXA 3RRHA 3QEWA 3MWPA 4I6MA 2WOMA 4FW2A 4DR7K 4DUYK 5C0YA 1K73O 4JYAK 3TR8A 2HHWA 2BE2A 4W5NA 3O8MA 2P9KB 5HLFA 2KFZA 1A5XA 3ID6A 3LL3A 3NMUA 1TUUA 2JWLA 5HRPA 2XHBA 1EWQA 4CZMA 3NH0A 1S22A 2O4IA 4JD2A 4BDYA 1GOAA 1W97L 4K43A 4CJLA 3NDKA 3AO1A 3BF3A 4MDAA 4OPJA 5KPTA 4R5PA 5KRTA 4M41A 5AQFA 3MN7A 3O1WA 5HP1A 2E20A 3VEOA 4W5OA 3BP8A 1Q18A 2UU9K 4FZZA 1EO1A 3G4SN 5BPNA 4I2QA 2VGNA 2VG6A 1XI1A 1DGKN 4LSNA 1YITN 3CERA 2FBVA 4CFDA 1OKJA 2W42A 2ZD1A 3FZFA 5HROA 1TKZA 5CHIA 3HSTB 1VSJA 1OVQA 4PUOA 4PKIA 3ZX2A 5T7BA 1S72N 4G9ZA 4DFKA 3JSMA 4DQ8A 4B3TK 4J2EA 1W0HA 4PY5A 1ZC6A 2BUPA 3VF4A 4LF9K 3FE1A 1QQNA 4CEBA 5JS1A 3VGLA 3CC4N 3PV8A 2O8CA 3P5JA 3QO9A 1H1VA 4KTQA 1ASUA 3CJ1A 1WSFA 1LWEA 1CLQA 4DSFA 3DLLL 3ZEUA 3M3ZA 5CYQA 3U3GA 4YOWA 3PO4A 1VQON 2X74A 3R1XA 1RBTA 1LWFA 3OHRA 3T1YK 1IG8A 5AZJB 3VQPA 1NJYA 3O9SA 2F8TA 1I3AA 2YNFA 4XH1A 4F2SA 4ILJA 4Z4CA 1HJOA 3CYMA 1XC9A 3QB0A 4N56A 1TYQA 3JYTA 1GLJO 2YNIA 4FJHA 2P9NB 4PL7A 2VWBA 2P9IA 3BZKA 4FK4A 3PY8A 4JKGB 2QK9A 3NVKA 1BI4B 3V9SA 3SUPA 1A5VA 4DFPA 3I0SA 2Q31A 3SAGA 4G1QA 4JI4K 1GLLO 2KHOA 3CIPA 2AA4A 3H1VX 3MN9A 1NGCA 1RT4A 4O8UA 5CYMA 4CZLA 3NAEA 4IXCA 3KLGA 3CCRN 2I7PA 4K25A 4LF5K 3M5RA 2JLEA 1GLBG 5FRMA 4QCLA 4LSLA 3C65A 1LCUA 3C6TA 4JRPA 4Z4EA 3ZETA 3SV3A 1QQOA 3HPHA 3KK2A 1NK8A 4MFBA 4E7IA 1S6QA 4BWJA 3IDHA 2JWKA 5M1OA 4IWVA 3VQ6A 1K9MO 3TSQA 4DHYA 2PFUA 3GG4A 3NBPA 1VQ7N 4FLVA 1JKHA 4W5TA 4CBWA 1JLFA 4Y0WA 2A42A 1REVA 2W40A 4NO7A 1JLGA 4KTWA 4NLBA 3TAQA 1K6YA 1SL1A 4DR6K 3THXB 3S3OA 3DI6A 5BRHA 1SV5A 2W41A 4CIFA 3KLIA 3HXMA 2G8UA 4B08A 3ALYA 4DTJA 4F3TA 4CZIA 4DMNA 3VEZA 2HHSA 2IC3A 3G25A 2UYTA 2VWJA 1Z26A 3VA3A 1NK5A 1I39A 1ATRA 1BA0A 1HKBA 1JL2A 1QHTA 3Q7CA 3V9WA 1RT5A 2O4GA 2HHTA 3R8EA 3K5NA 3BDPA 3ZSYA 4M3TA 3ZCMA 3VQ8A 3SQ2A 4YOVA 4H0PA 3LDNA 2GEMA 4B3RK 4KO0A 1TK5A 1HRHA 2X6NA 3HPOA 1Z6RA 4BE0A 4ZHRA 2D1KA 3MN6A 1WSJA 2P9KA 4X62K 4F4KA 4BC4A 3QEPA 1G15A 3G10A 1ASVA 4OVLA 1I94K 4XH5A 3A2FA 3DLEA 1Z25A 1NMNA 5C10A 5H1SQ 1WOQA 2GX9A 4FZXC 3BF1A 4FYDA 2Q0UA 4GW6A 1SKRA 2BGGA 4DG1A 3AO4A 4E1MA 4E1NA 3P39A 4DKWA 1Q86O 4L3QA 3D0PA 4BE2A 3AVMA 1HQEA 4JKDA 3CF5L 3ASMA 3CHWA 1B9FA 1S1TA 3OTOK 1S9EA 4ELVA 4CF0A 1CZ9A 2P9SB 2UXBK 5LMNK 3TAPA 1NK7A 1NGGA 5SZTA 4CEQA 3THWB 3MXMA 3VGMA 1W9HA 3QBWA 2DFEA 2KQ2A 4NXNK 3AARA 5EU7A 3VQBA 3OYIA 4CF1A 4MO5A 4CJUA 4C23A 1NMDA 3ZT4A 1DKGD 1QE1A 3I8DA 3M6GA 4FLXA 2PAVA 5C12A 4E7HA 3J80O 1NOYA 1NK6A 1LV5A 4OJRA 3N4QA 5FPEA 5C2DA 3OYMA 3EKUA 4WFAL 5AFUH 1S3XA 4M42A 5CR4A 1TGOA 2Q97A 4RW8A 1ATSA 2VCPA 2NZTA 4W5QA 4FK0A 2IIRA 5EOYA 4DQQA 4B9LA 3FZLA 4CEZA 4RW6A 4QOZB 5A2QO 4JI6K 3AVCA 5MLCQ 3CM5A 3RTVA 1IBKK 4MQ3A 3RMBA 1C1BA 2D0BA 1RT1A 2HSTA 3GBTA 4FWNA 4IEIA 1C1AA 5SWMA 2XY5A 2ZE2A 4U67L 1N8RO 5AZJA 1DTQA 3C6AA 1J53A 4BRFA 3BUZB 2O8EB 5TKWA 5AJ3K 1Q82O 5DMRA 3C7NB 1BU6O 4RW7A 3J7ZO 2D0CA 2IDOA 4O0IA 3F73A 2P9NA 4DLGA 3L2QA 3SQ1A 3SMPA 4JKGA 3WT0A 2IS3A 3NGYA 1BI4A 3PX4A 5JVGL 3OYLA 4BRMA 1X9SA 4J8FA 3LDLA 2ZGYA 1X9JA 4B1ZA 1WB9A 1OH8A 3F2KA 4H4MA 3QERA 4WCEL 1ZBIA 4KREA 1CXUA 1IH7A 2ASMA 4JRQA 2KZZA 1LWCA 4DFJA 4RG8A 4CZGA 4B1WB 4Z4IA 3V9UA 3KLHA 3UKUB 4DTOA 3RMAA 2D0PA 3MN5A 1HR0K 1NJWA 5GAGP 4B3OA 4LF7K 3OS2A 5BRFA 1VQKN 3C95A 4F2RA 1NK9A 2OANA 5GAEP 4JI2K 4JK7A 3FZKA 1QQMA 2F7TA 5CE3A 3NE6A 1YVNA 3RMCA 4CJVA 4YY3K 3G71N 1QSSA 4FZYA 2PY5A 4DR5K 4CZJA 5HBMA 1SAZA 1YJ9N 1EP4A 4DF4A 4DB3A 2A6AA 3ITHA 3L6QA 3HP9A 3SBTA 2HBKA 3CCUN 3B6PA 4RWTA 4DR1K 3THXA 3OVNA 1HKCA 3H3NO 4AM6A 4Z4FA 3V81A 3AY9A 4FK2A 3RRGA 5KQ8A 4ELUA 1ZBUA 1MU2A 4FLWA 4B3SK 4F3OA 4FWMA 3PX0A 3LDSA 3UE5A 3NF6A 4JKHA 4CCHA 4CBXA 3CQXA 4GV9A 4BWMA 1HNXK 2OZSA 3VEYA 1P90A 3OY9A 3IMXA 3TSUA 3ZEUB 2VYPA 4H0VB 2KLAA 3T69A 4BREA 1U45A 4BDZA 2QXLA 2FBYA 4NYNA 5LL6Z 4IO8A 5AQIA 2NRVA 1NOZA 4A61A 3ZSOA 4YOUA 4BROA 5LY3A 3OBYA 3M8QA 1S1VA 4UQGA 1J5EK 1JLAA 5ELZA 2G8WA 4KHNA 3MK6A 3V9XA 4AILC 2V7YA 3V1QA 3OYGA 3E9LA 1IG9A 2VWKA 3QESA 2A41A 3SZ2A 3QMLA 1GLAG 1QQCA 1RNHA 4CGDA 4OKJA 1KC8O 3A5NC 4FJJA 4RW4A 3CCLN 3S3NA 2P5GA 5EVZA 4EAHD 1SQKA 1WNSA 4C8KA 2IOCA 3VMFB 4CJTA 4WFBL 2W6LA 2QEXN 1DTTA 2P9SA 4IZ9A 4AHRA 5GINA 3GL1A 1NGAA 3TPQA 4OPAA 5D3GA 3THVA 3THWA 3P31A 3PLAA 1YIJN 3OJUA 2FC0A 4CFBA 3HP6A 2Q3SA 3L0QA 3HL8A 1NGEA 1TUYA 1O1WA 3D7EO 4DCHA 5IT9O 4KH5A 4CEFA 4YOTA 1QSLA 1K8KB 4A2AA 1BUPA 4WE1A 5BREA 5C2FA 3EN9A 4A5AA 4AHVA 3ZLJA 1RBRA 3H6EA 2FSKA 1SZ2A 4K0KK 3F9KA 4FPAA 3LZJA 5J2MA 3FFIA 4I2PA 4J2AA 3DLRA 3WNHA 1D8YA 3KK1A 3CCMN 3QNOA 1HQUA 4FVMA 4Y1CA 4U7BA 3FZMA 2ZJQL 4V19S 3VERA 1UOCA 4AHSA 2O8EA 2QW9A 4Z0UA 1S1XA 3C7NA 3ATVA 3UB5A 1TK8A 2P9LB 4H0TB 5DK5A 4DS5A 3A0IX 4CVNE 3PUFA 4WYBA 4FM2A 1NJXA 4JI0K 3G6EN 4CGHA 2WUSA 4X65K 3QBXA 1F21A 3QFPA 2V7ZA 4YOXA 3WXKA 1RBVA 1ZXOA 3AO2A 1XHZA 3TAEA 4RCHA 1TKTA 2A1RA 4FWLA 1JLBA 3MECA 3R9PA 3VEWA 5DM7L 2CH6A 4BDPA 4CE9A 4GY2B 2CGLA 1Q8IA 5F2RA 5HRNA 3UKUA 4CF2A 3H46O 5FDLA 2Z1GA 1BL3A 1L3UA 4CK3A 3NH1A 4JLHA 4B3MK 1RDDA 1XQSC 3O80A 4IG3A 3V1OA 4RW9A 1QVGM 1IKVA 3J7AP 2ZGZA 3L4IA 1HYSA 1IKWA 4BC5A 3U9DA 3P1GA 3AVAA 2ASOA 3IKMA 4JK8A 2UUCK 2ZJRL 1JLEA 4BRNA 2FF6A 3HO1A 4PKHA 3TTCA 2ZJPL 4DLEA 4H0YB 4FJLA 2VQEK 4CK1A 4KHWA 3S3MA 1J6ZA 3AA4A 4B9VA 2AJQA 5FPNA 3MAQA 2X78A 4FM1A 4C8OA 4R79A 3NHGA 4A57A 2OTJN 3VQAA 3AO5A 4FJNA 3BEXA 2NNWA 4WQ5C 4CHZA 4N47A 3U8XA 3O08A 2F8SA 3V4IA 4BG9A 4FLTA 2HNDA 5CZ2A 4KI6A 3QEXA 2OPPA 1R59O 3CCQN 5AQVA 5J2QA 1JCGA 4Q5VA 2HF4A 2QI2A 3AVHA 2OPRA 1VSHA 4ISGA 1U47A 3HT3A 1S6PA 2QWQA 3OYHA 2NUBA 3RVCA 3ZSWA 2GBZA 3OYEA 4KHSA 3VETA 1YF5L 2UUBK 4OPHA 3WXLA 1U49A 1YI2N 3LANA 3I0RA 3OYBA 3K0SA 3CM6A 3SLCA 3CC2N 4NB4A 1ASWA 3WQUA 4E1JA 1XC3A 3B6OA 3K9JA 1TAUA 1YTAA 4DR2K 1VSFA 2HBMA 4CD3A 4MLEA 4DQSA 4CESA 1OH5A 1WBBA 2E1ZA 2FLOA 4FL9A 3C0BA 1NGBA 1Q9XA 3LPTA 3KD1E 1EQYA 3I8BA 3PSFA 4CZKA 1FKPA 3A8YA 2A1SA 1WSHA 5M1NA 3K5LA 2Z1IA 2EWSA 4IOAL 1KVCA 1VSKA 5LJWA 5I9EB 4LC9B 2YKNA 1TAQA 2WTUA 1CXQA 4H5TA 1RDCA 4DR3K 1LW2A 2QXFA 3HM8A 1IKYA 1NGFA 4O4GA 4LF8K 3HOTA 3WUHA 1WBDA 3L3UA 1FKOA 2F96A 4BR5A 4FJ8A 1JLCA 1G99A 1JJ2M 4HHTA 1CZAN 3J8AA 3B8AX 5AQNA 3TSPA 4AF1A 1VQ8N 4LFBK 4CZHA 2DY4A 4BR7A 4X64K 3D45A 5ADXH 5JICA 3UKRB 3OYFA 4LFAK 3EYZA 2B6AA 4FWPA 2XY7A 2F9TA 1IV0A 1HKGA 4LF6K 4AHUA 2NRWA 3LP0A 1YJWN 1YT3A 4GV6A 1K8KA 2EX3A 1KAXA 2G8HA 1LW0A 4YDUA 2P51A 4WQ4C 4BVPA 2VGMA 3H45C 1KLMA 5M1KA 3K5OA 3DXKB 1HMVA 1VSEA 1VSMA 4OO1J 2NRXA 2W6KA 3LDQA 3T1HK 3IG1A 4DU3A 2HB5A 1NGHA 1X3MA 3U4LA 5BPLA 1KAZA 3AVKA 4DTPA 4A5BA 4H0OA 1NJZA 4B8AB 3VTHA 4KB1A 1YVUA 1SL0A 3VENA 3CMAN 2P9LA 3SAFA 1XUPO 1X9MA 4CW7B 1BQNA 4F9OA 1JCFA 2WBNA 4CF9A 5HRRA 3VF6A 2QWMA 4DWIA 1RT2A 2IVNA 3CXCM 4H0XB 2B5JA 3KZBA 4H8KA 4B8CA 4JI5K 4CF8A 2D5RA 4IJAA 3VQQA 3TARA 1L3TA 2YI1A 5GAHP 3LAMA 4FOIA 3E9PA 2HMPA 4QS9A 5KPRA 1LOTB 4KB0A 4KHYA 2G8IA 4DU4A 1SKWA 2VQFK 2FXUA 3SCXA 4M3ZA 3QDKA 4BR0A 1W7AA 4J2DA 1XNRK 3DXMB 4FSVA 1OH7A 4CEOA 1BGXT
chains in the Genus database with same CATH topology
3H3NO 4AM6A 5DM6L 1U2VB 3AY9A 5AQUA 4FWQA 1NWKA 1Z05A 4JNEA 4IFEA 1Y64A 3GE1A 3C6HA 2RE2A 3VEXA 4K41A 5KQ8A 2NRZA 3EE9A 1W2BM 2FSJA 3KVGA 4FWMA 2HBLA 3MCAB 3UE5A 2I7NA 4GV3A 1E4GT 4JKHA 4BGBA 3GDQA 4CI6A 4JN4A 3MWPA 4CBXA 4I6MA 3FR0A 3CQXA 4GV9A 5C0YA 3KWGA 1K73O 3P4IA 3CJ7A 1Q7YO 3VEYA 1P90A 3IMXA 2CH5A 3TSUA 3ZEUB 2VYPA 4H0VB 1SS6A 2KLAA 3T69A 3O8MA 4BREA 3CCVN 2IVOA 2P9KB 1KQSM 3VOVA 5FPDA 4BRQA 2QXLA 5HL7L 4H5VA 3CI5A 2E2QA 4IO8A 5B8HA 4IOCL 3ID6A 1QZ5A 3LL3A 5AQIA 2NRVA 3NMUA 1TUUA 2JWLA 2P9UB 3DJCA 3H3OB 1X3NA 4A61A 4CZMA 3WEEB 4YOUA 4BROA 5LY3A 1GLEG 2YJFA 1S22A 3OBYA 4JD2A 5EY4A 1W97L 4K43A 3O9TA 3WQTA 3OBWA 3A5OC 3VESA 1HUXA 3BF3A 4MDAA 5ELZA 3MK6A 4BG8A 2V7YA 4BRCA 5KPTA 3DAWA 5AQFA 3VF2A 3E9LA 3D2FB 3MN7A 2AP1A 3L4QA 3O1WA 2A41A 3I55N 2E20A 1VQPN 3QMLA 3VEOA 3VGKA 1GLAG 4FWOA 1P8ZA 1QZ6A 1KC8O 3A5NC 3BP8A 3M1FA 1Q18A 3CCEN 3CCLN 1NBWA 5AZIB 1EO1A 3G4SN 5EVZA 4EAHD 1ILYA 4JKFA 1SQKA 3CJCA 3TTFA 4B1YB 5BPNA 2ZF5O 3VMFB 5AQHA 4B1XB 4EHTA 4WFBL 2QEXN 2VGNA 3RSEB 1DGKN 1YITN 2GTDA 2P9SA 3ULEB 3CERA 4IZ9A 4PHTX 3SAHA 5GINA 3HI0A 3GL1A 1OKJA 1NGAA 4KH6A 3TPQA 3CETA 1V4TA 2E1YA 3FZFA 4OPAA 1C0FA 4BRPA 2BTFA 2WC9A 5CHIA 4QS7A 3P31A 4IO9L 1OVYA 3PLAA 1YIJN 3ZX3A 4PKIA 3ZX2A 1S72N 4G9ZA 4H5RA 4FPBA 3VTIA 4DQ8A 3W3DA 4Z94A 1ZC6A 2BUPA 3VF4A 3L0QA 3FE1A 1NGEA 1TUYA 1QQNA 3WXJA 4FWRA 4ISEA 3VGLA 3D7EO 2QWRA 3CC4N 4DCHA 4BGAA 4KH5A 1H1VA 5E26A 4YOTA 3F9MA 3A5LC 3CJ1A 4M63C 3UKRA 4GNIA 4BC3A 5EXWA 3DLLL 4JKEA 3ZEUA 3M3ZA 1K8KB 4A2AA 1BUPA 5BREA 5C2FA 2PBDA 3ENHA 4YOWA 3EN9A 1VQON 4A5AA 2Q36A 4B1UB 3H6EA 3R1XA 4JHDB 2FSKA 5F0XA 3ENOA 1GLFO 1SZ2A 3OHRA 1IG8A 4FPAA 5AZJB 5AQWA 3CD6N 3LDOA 3TTDA 3O9SA 4IOXA 3WXMB 2P9PB 4YOYA 1T3VA 4WQ5A 4XH1A 3VEVA 1BO5O 4CBUA 4ILJA 3AAQA 2FSNA 3CCMN 1HJOA 3QB0A 4U7BA 1TYQA 1NM1A 4JAXA 3FZMA 3JXUA 3CQYA 3CJBA 3VERA 2ZJQL 1GLJO 3DXKA 4JKBA 2P9NB 4EFHA 2VWBA 2P9IA 4PL7A 2QW9A 1QHAA 4JKGB 3NVKA 5GADP 2YHXA 3C7NA 3ATVA 3UB5A 1JCEA 1YJNN 2P9LB 1MWKA 1T6CA 4H0TB 2Q31A 3SAGA 3A0IX 1GLLO 1BOTO 2KHOA 2BH1A 3CIPA 2AA4A 3H1VX 4WYBA 3MN9A 1NGCA 4O8UA 3G6EN 2WUSA 4A2BA 1HLUA 3QBXA 3QFPA 2V7ZA 4YOXA 3WXKA 4CZLA 1ZXOA 5TKYA 1KXPA 4IXCA 3CCRN 4JKAA 4RCHA 2I7PA 4K25A 3M5RA 4HWIA 1VQNN 4FWLA 1GLBG 1BA1A 3C65A 3R6MA 1YHQN 1VQ6N 3FZHA 3O9QA 3R9PA 3VEWA 1LCUA 5DM7L 2CH6A 3ZETA 1C0GA 4JEPA 4B9QA 4GY2B 1QQOA 2CGLA 5F2RA 3U9ZA 3UKUA 3H46O 4CJ7A 3O5BA 2QWOA 1ATNA 4BRKA 1BG3A 1XQSC 3O80A 4ILGB 5BN9A 1QVGM 3IDHA 2JWKA 2ZGZA 3L4IA 4IWVA 5M1OA 3T7ZA 4JKCA 4BC5A 3U9DA 2YX6A 1K9MO 4O5FA 5F1XA 2ASOA 3IKMA 4JK8A 3FLCO 3TSQA 4DHYA 2PFUA 3GG4A 2ZJRL 1YAGA 3D2EA 4BRNA 2FF6A 5AQOA 1VQ7N 4PKHA 3TTCA 5AQLA 4CBWA 2ZJPL 3CCJN 4JK9A 3MCPA 4Y0WA 4H0YB 2A42A 2KKZA 3D6RA 5EX5A 5GIOA 3CC7N 2W40A 4NO7A 1VQ5N 4NLBA 2E8AA 2YCHA 2GWKA 3IUCA 1NGIA 2IVPA 3EO3A 2CGJA 1J6ZA 2FF3B 3HRGA 4H5NA 4NLCA 4BR2A 5BRHA 5AQJA 4MLHA 2W41A 5FPNA 3A5MC 3AGRA 3QFUA 4H5WA 1HPMA 4BRAA 3DXMA 4R79A 4A57A 3PIOL 2P9PA 5AQGA 3FGUA 2OTJN 3BEXA 4A59A 4BRGA 2NNWA 2GWJA 4WQ5C 3HZ6A 4BR9A 2H3GX 3F5TA 1Q81O 2ZWHA 1KAYA 5JLHA 4CZIA 1U2VA 3U8XA 3VEZA 1RDUA 3O08A 1BWFO 3AAPA 3HBTA 1YXQA 3G25A 2UYTA 4BG9A 4O8KA 4FWKA 1ATRA 1BA0A 1HKBA 3Q7CA 4I6MB 3CPWM 3Q7BA 2HOEA 2GELA 1R59O 5JLFA 3CCQN 4CZEA 5AQVA 5AQSA 3E9OA 1JCGA 3R8EA 3ZX0A 2HF3A 2HF4A 2QI2A 4ISGA 4YOVA 4H0PA 3LDNA 1QVFM 2GEMA 3E1YA 2QWQA 1O13A 3RVCA 1VQ4N 5M1QA 1Z6RA 5KQDA 4C1NI 3VETA 1YF5L 2Q1NA 5GIPA 2D1KA 3MN6A 4OPHA 2P9KA 4WQ4A 3WXLA 3MX5A 5AQKA 5BPMA 4BC4A 3CCSN 1YI2N 4BC2A 4JD2B 4WFNL 4XH5A 3SLCA 3CC2N 4NB4A 4M7YA 3WQUA 3ZYYX 2P9UA 1XC3A 4BR4A 3K9JA 4E1JA 1MA9B 3MDQA 3WEEA 2J4RA 5C10A 5H1SQ 1WOQA 3HSCA 2GX9A 2HBMA 2YHWA 4FWSA 4MLEA 4CD3A 2A40A 3BF1A 2WFBA 4RTFD 2CGKA 2Q0UA 2E1ZA 2D0OA 2FLOA 3C0BA 1NGBA 4FL9A 2E2PA 3P39A 1MDUB 3LM2A 4DKWA 1K8AO 1EQYA 3I8BA 4L3QA 1Q86O 3D2FA 2Q2RA 4CZKA 4JKDA 3ENBA 3A8YA 3CF5L 3CHWA 3CJAA 5M1NA 2EWSA 4XEIA 3O1BA 4IOAL 1DT9A 3E66A 4BRLA 1GLCG 4FVUA 5LJWA 5I9EB 4LC9B 5FPMA 3SK3A 3AGKA 2P9SB 4IDHA 3JS6A 5AZIA 5AQTA 4YDUC 4H5TA 1NGGA 4EIAA 3HM8A 5AQYA 3RSEA 4EHUA 3N4PA 3VGMA 2Q0RA 3QBWA 1NGFA 3R3LA 3ULEA 3AARA 4M7XA 3HOTA 3WUHA 4MO5A 4YORA 4BR5A 1NMDA 4C23A 2OTLN 1G99A 1DKGD 3O4WA 1JJ2M 3WXIA 1CZAN 3J8AA 2A3ZA 3B8AX 3M6GA 2NRTA 4QS8A 2PAVA 5AQNA 3TSPA 4AF1A 5C12A 1VQ8N 1VQ9N 3CPEA 3MWTA 3N4QA 2DPNA 5FPEA 3OA9A 4CZHA 4BR7A 5C2DA 5ADXH 5ADXA 4ISFA 5JICA 3EKUA 1MWMA 4WFAL 3UKRB 5AFUA 2QWLA 2NLXA 5AFUH 1S3XA 4BVOA 2V52B 2D4WA 5CR4A 3SMSA 3LM9A 2QM1A 4FWPA 2Q97A 3S41A 2F9TA 1ATSA 2VCPA 2NZTA 1HKGA 1RGIA 1T6DA 1ESVA 2IIRA 5EOYA 2ITMA 3FZLA 2QWNA 5M1PA 4MO4A 2NRWA 1YJWN 3OW2M 2QTDA 5MLCQ 4GV6A 1K8KA 2HBJA 3H1QA 1KAXA 1U6ZA 2QWPA 4FO0A 3HOSA 2HSTA 1KD1O 4YDUA 2E88A 4JHDA 3GBTA 2A5XA 4FWNA 4IEIA 4WQ4C 4BVPA 2ASPA 2VGMA 3P38A 3H45C 4U67L 1N8RO 3EKSA 5AZJA 1M1KO 3W0LA 4KBOA 5M1KA 1TYQB 3KWIA 3C6AA 1NJIO 5AQMA 4BRFA 3BUZB 3DXKB 1RDWX 3MMVA 3VPZA 5TKWA 1VQMN 4BRDA 2P9IB 1Q82O 2NRRA 4K42A 4BY9C 4OO1J 2NRXA 3C7NB 4PL8A 1BU6O 3LDQA 2F9WA 3J7ZO 1NGHA 4B1VA 1X3MA 3U4LA 5BPLA 1KAZA 3DWLA 5BR9A 4IEEA 5JVHL 3O9RA 4WF9L 2P9NA 4A5BA 4H0OA 3SMPA 3FFKB 4JKGA 3WT0A 4BRHA 3VTHA 1VQLN 2YJEA 5JVGL 4FOEA 4BRMA 4J8FA 3LDLA 4BRIA 2ZGYA 3VENA 1X9JA 3CMAN 2P9LA 4B1ZA 1IJJA 3EE8A 2NRHA 5AQRA 3F2KA 5E84A 5C15A 3SAFA 5AQPA 3O9UA 3O6WA 4WCEL 1D4XA 1XUPO 5AQZA 4CZFA 3MX2A 4GVEA 3HTVA 3LDPA 3KK7A 3I56N 2ASMA 4F9OA 1JCFA 2WBNA 3ATUA 5AQXA 3I33A 3VF6A 3ZETB 4CZGA 4UY8O 1V4SA 4B1WB 2QWMA 4PKGA 4HTLA 2V51B 3K9KA 3UKUB 2D0PA 2IVNA 3MN5A 3CXCM 3CJ9A 4H0XB 5M1FA 4CD1A 1M90O 1WUAA 5GAGP 5LJVA 3KZBA 1NGJA 3KHYA 4BQLA 5BRFA 1YUWA 3EL2A 3SBGA 4AM7A 1VQKN 2OANA 1HX1A 1NGDA 4JK7A 3FZKA 3QICA 2YHYA 5GAEP 4IJNA 4BQZA 5JMVA 4IJAA 5AQQA 1QQMA 2E2OA 2F7TA 3EZWA 5CE3A 2YI1A 1RFQA 3D2EB 5GAHP 4FOIA 1YVNA 4H03B 3E9PA 2HMPA 5AR0A 4QS9A 4XH4A 5KPRA 3CMEN 1LOTB 3NVMA 4ILHA 1T44A 3G71N 1ZBSA 4MDBA 3PIPL 5BRDA 3GOIA 1DEJA 2FXUA 4C1NK 3QDKA 4BR0A 4CZJA 2GUPA 4A62A 5HOOA 1SAZA 5BN8A 1YJ9N 3DXMB 2QA4N 4FSVA 4KH4A 1BDGA 4DB3A 5KPZA 2A6AA 3SJHA 2E2NA 3L6QA 3SBTA 3CCUN 2HBKA 1NLVA 1GLDG 4RWTA 1VAZA 2RHKA 3ID8A 3IFRA 3TU5A 1HKCA 1E4FT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO L;  5DM6 L;  1Q81 O;  3DLL L;  1W2B M;  1YJW N;  3OW2 M;  1VQO N;  5MLC Q;  3CPW M;  1KD1 O;  3CD6 N;  3CCQ N;  4U67 L;  1N8R O;  1M1K O;  3CCM N;  1NJI O;  1K73 O;  1Q7Y O;  1VQM N;  1QVF M;  1Q82 O;  2ZJQ L;  1VQ4 N;  3CCV N;  1KQS M;  5HL7 L;  3J7Z O;  5GAD P;  5JVH L;  4IOC L;  3CCS N;  4WF9 L;  1YI2 N;  1YJN N;  1VQL N;  4WFN L;  5JVG L;  3CC2 N;  3CMA N;  3G6E N;  5H1S Q;  4WCE L;  3CCR N;  1VQN N;  3I56 N;  1YHQ N;  1VQ6 N;  1K8A O;  4UY8 O;  5DM7 L;  1Q86 O;  3I55 N;  1VQP N;  3CF5 L;  3CXC M;  1KC8 O;  1M90 O;  3CCE N;  3CCL N;  4IOA L;  5GAG P;  3G4S N;  1ILY A;  1VQK N;  5GAE P;  4WFB L;  2QEX N;  1QVG M;  1YIT N;  5GAH P;  1K9M O;  2ZJR L;  3CME N;  4IO9 L;  1OVY A;  1VQ7 N;  2OTL N;  1YIJ N;  2ZJP L;  3G71 N;  3CCJ N;  1S72 N;  3PIP L;  1JJ2 M;  3CC7 N;  1VQ5 N;  1VQ8 N;  1VQ9 N;  1YJ9 N;  2QA4 N;  3CCU N;  3CC4 N;  4WFA L;  2OTJ N; 
#chains in the Genus database with same CATH topology
 5DM6 L;  1Z05 A;  4JNE A;  1IBL K;  2YNG A;  4IFE A;  4I7F A;  4CJ5 A;  3C6H A;  1ZBL A;  4DQI A;  1KRP A;  1W2B M;  1VK0 A;  2FSJ A;  3AVJ A;  4PA1 A;  3LWM A;  3NCI A;  1RTD A;  2QKB A;  1RDB A;  1L5U A;  2I7N A;  2DFF A;  3OYD A;  3C94 A;  2DFH A;  3GDQ A;  4CI6 A;  3AVI A;  1E3M A;  3FR0 A;  5BR8 K;  3H08 A;  1KFS A;  1S1U A;  3KWG A;  2HNZ A;  3P4I A;  3CJ7 A;  2KW4 A;  4CFA A;  4DV4 K;  3MXJ A;  3CCV N;  1KQS M;  2IVO A;  3QIN A;  5FPD A;  3NGZ A;  4BRQ A;  5HL7 L;  4CGI A;  2UXD K;  3CI5 A;  2E2Q A;  4IOC L;  1WAJ A;  4CJP A;  3H3O B;  2OA8 A;  1U04 A;  1X3N A;  3THY B;  3WEE B;  1GLE G;  1RIL A;  3AA3 A;  1FK9 A;  5EY4 A;  2HVI A;  5C25 A;  1KVA A;  3OBW A;  4JS5 A;  1HUX A;  2YHA A;  2GV9 A;  4BRC A;  5C42 A;  1HNV A;  3DAW A;  4CK2 A;  1RTH A;  1UWB A;  2AP1 A;  4HCC A;  3I55 N;  2YHB A;  1VQP N;  3VGK A;  3SPZ A;  4FWO A;  5J2P A;  3CCE N;  4CFC A;  1ILY A;  4JKF A;  3TTF A;  1D9D A;  4B1Y B;  3AVL A;  4KFB A;  2ZF5 O;  4B1X B;  1VSL A;  3UIQ A;  3ULE B;  1IO2 A;  4PHT X;  3SAH A;  3KLF A;  4EZ9 A;  1V4T A;  2E1Y A;  4BRP A;  4O5B A;  2BTF A;  4CEA A;  3SUQ A;  4QS7 A;  4KHU A;  3M8P A;  4IO9 L;  3SQ0 A;  1EWR A;  3ZX3 A;  4DS4 A;  3VTI A;  1NKB A;  1Q9Y A;  1C0M A;  3K59 A;  4FWR A;  1TKX A;  4ISE A;  1CZB A;  4ELT A;  5LMU K;  4BGA A;  3DOL A;  3ULD A;  1XHX A;  4CHQ A;  4Z4G A;  1FJG K;  4DU1 A;  3F9M A;  3A5L C;  4DFM A;  4M63 C;  3UKR A;  4GNI A;  4M3X A;  2Y1J A;  4IG0 A;  5EXW A;  1N34 K;  3OJS A;  4JI7 K;  3ZSQ A;  1HJR A;  2Q36 A;  4JHD B;  1GLF O;  3IS9 A;  1ZBH A;  3LDO A;  1NKC A;  2HHX A;  4YOY A;  1T3V A;  3O4N A;  3VEV A;  1B9D A;  1BO5 O;  4CBU A;  3AAQ A;  2FSN A;  4KI4 A;  1J54 A;  2YNH A;  3LAK A;  3VQ7 A;  1NM1 A;  3CQY A;  3DXK A;  5K14 A;  4EFH A;  3HVR A;  3KJV A;  4OGE A;  2YHX A;  5GAD P;  3RR7 A;  1JCE A;  3MED A;  3KTQ A;  1T6C A;  3K57 A;  1BOT O;  1BIZ A;  3WNF A;  1HLU A;  1NNE A;  3SJJ A;  5TKY A;  4YFU A;  4CHP A;  1UA1 A;  4AHC A;  1VQN N;  4HWI A;  3O3G A;  1HNI A;  4NYF A;  1EET A;  1VQ6 N;  3FZH A;  3O9Q A;  2PYJ A;  1JL1 A;  3KLE A;  4BE1 A;  4IBN A;  1C0G A;  3V9Z A;  5HRS A;  3U9Z A;  4W5R A;  3L2V A;  3O5B A;  4E7L A;  4KAZ A;  1ATN A;  4BRK A;  2OYQ A;  1BG3 A;  5BN9 A;  3T7Z A;  3BZC A;  2VG5 A;  4O5F A;  2IAJ A;  4OLB A;  4FM0 A;  3FLC O;  4I9Q A;  3DYA A;  3CCJ N;  1RBU A;  4JK9 A;  3MCP A;  5GIO A;  3CC7 N;  1VQ5 N;  5CZ1 A;  2E8A A;  1HNW K;  3VQ5 A;  3IUC A;  1L3V A;  2IVP A;  1BHL A;  3EO3 A;  4PWD A;  4NLC A;  1N33 K;  4MLH A;  4DV3 K;  1TKD A;  3A5M C;  4OLA A;  4O44 A;  4H5W A;  2O8B B;  3U6F A;  3DXM A;  3PIO L;  2P9P A;  5AQG A;  3FGU A;  4YNQ A;  2GWJ A;  2H3G X;  3L2U A;  1HPZ A;  3ZSZ A;  4ID5 A;  2ZWH A;  1KAY A;  5JLH A;  2PYL A;  1RDU A;  1BWF O;  3AAP A;  2JGU A;  2LSN A;  3HBT A;  1YXQ A;  1KLN A;  3QNN A;  2Z1H A;  4CED A;  4IFY A;  3BGR A;  3CPW M;  3VN5 A;  5JLF A;  4CZE A;  4FJG A;  3NF7 A;  3ZX0 A;  1XMQ K;  1N36 K;  2HF3 A;  1Y97 A;  4DV5 K;  1T8E A;  1JXB A;  3HYF A;  1S1W A;  1GOB A;  5KQD A;  4C1N I;  2Q1N A;  5GIP A;  3KIO A;  3CCS N;  5BPM A;  3MX5 A;  1EX4 A;  1SL2 A;  4BC2 A;  4GKJ K;  4KRF A;  4M7Y A;  1HNZ K;  4BR4 A;  1WSG A;  4HUE A;  1N5Y A;  3THY A;  4NCA A;  3WEE A;  2J4R A;  3HSC A;  4FWS A;  3NGI A;  2A40 A;  2WFB A;  4RTF D;  4KTZ A;  2CGK A;  3ISN C;  1HYZ A;  4HTU A;  3LM2 A;  1K8A O;  3L3V A;  4KV8 A;  2Q2R A;  3ENB A;  3G0Z A;  3CJA A;  4XEI A;  3O1B A;  1DT9 A;  4KHP K;  4DTM A;  3SK3 A;  4IDH A;  4DSJ A;  5CY4 A;  4YDU C;  5AQT A;  4CJK A;  4E7J A;  3CFP A;  4EIA A;  3PSI A;  3R3L A;  4DR4 K;  3ULE A;  3WNE A;  4LH4 A;  4YOR A;  2OTL N;  3O4W A;  4DTU A;  3TAN A;  2A3Z A;  3QEI A;  4CJS A;  2DPN A;  3OA9 A;  4ISF A;  1MWM A;  5AFU A;  2QWL A;  2NLX A;  1FW6 A;  2V52 B;  3LM9 A;  2QM1 A;  2G8K A;  1QTM A;  1T6D A;  2ITM A;  5FLX O;  1WN7 A;  1VHX A;  3NH2 A;  3OYC A;  4MO4 A;  4CGF A;  1TL1 A;  2ITG A;  2QTD A;  3OW2 M;  4FJI A;  3H1Q A;  3TAF A;  1KD1 O;  2QWP A;  1VSD A;  2E88 A;  4JHD A;  2A5X A;  3E01 A;  3EKS A;  4CJ4 A;  3IAY A;  3QIP A;  1M1K O;  3KWI A;  1WAF A;  3VQE A;  1RDW X;  3VPZ A;  3HPG A;  3ZSR A;  1VQM N;  4Q0B A;  3P83 D;  4BY9 C;  2ZQB A;  4PL8 A;  1JXE A;  1RTI A;  2F9W A;  3O3F A;  4B1V A;  5BR9 A;  3DWL A;  3AA5 X;  1T03 A;  4IEE A;  3O9R A;  4FXD A;  2ETJ A;  5FRN A;  4O0J A;  3FFK B;  3EZ5 A;  1VQL N;  2YJE A;  4DTR A;  4FOE A;  4BRI A;  4K8X A;  2YKM A;  1IJJ A;  4ID1 A;  2NRH A;  5AQR A;  3O9U A;  3O6W A;  3V6D A;  5AQZ A;  4CZF A;  4H4O A;  3HTV A;  1EXQ A;  4HVJ A;  3LDP A;  3I56 N;  4K8Z A;  4CJ3 A;  2OPQ A;  5AQX A;  3I33 A;  4UY8 O;  4PKG A;  4HTL A;  3QEV A;  1ITG A;  3ZT1 A;  3CJ9 A;  2XO7 A;  5M1F A;  1D9F A;  4DSL A;  1WUA A;  4BQL A;  1NGJ A;  3KHY A;  4L8R B;  1SUQ A;  3EL2 A;  3SBG A;  4AM7 A;  1NGD A;  4LY7 A;  4FJK A;  2YHY A;  4LFC K;  4BQZ A;  4CJR A;  3SV4 A;  5AQQ A;  1A5W A;  3EY1 A;  2KFN A;  2E2O A;  4IFV A;  3EZW A;  3D2E B;  3HK2 A;  4LD0 A;  4H03 B;  5AR0 A;  4DQP A;  3AVB A;  1J5O A;  4KHQ A;  4DV1 K;  4ILH A;  1T44 A;  1ZBS A;  4E0D A;  2D0A A;  4MDB A;  3PIP L;  3VQD A;  3K58 A;  2O8F B;  3GOI A;  1DEJ A;  3SI6 A;  2HVH A;  4A62 A;  2QA4 N;  2ATQ A;  5KPZ A;  3SJH A;  1IKX A;  2O8D B;  3QET A;  1NLV A;  1VAZ A;  1BQM A;  3TU5 A;  1LAV A;  1E4F T;  2HHQ A;  3CQ8 A;  4DF8 A;  1U2V B;  5AQU A;  2O8B A;  1NWK A;  3GE1 A;  1N6Q A;  3VEX A;  2G8V A;  4EP4 A;  3SNN A;  3CFO A;  3DRS A;  1VRU A;  2HBL A;  3MCA B;  4FJM A;  4I9L A;  3LWL A;  4GV3 A;  1UA0 A;  1E4G T;  1L3S A;  1D5A A;  1KSP A;  4JN4 A;  3AVF A;  2BAN A;  4X66 K;  1RCH A;  4OKE A;  2XRI A;  1TVR A;  4XIU A;  2HHH K;  4FJ9 A;  1Q7Y O;  4PQU A;  2CH5 A;  3DRP A;  3PO5 A;  1SS6 A;  3VOV A;  4H5V A;  3HVT A;  1S5J A;  3OYJ A;  5B8H A;  1QZ5 A;  1OH6 A;  4B9S A;  1RT7 A;  3AA2 A;  2P9U B;  3DJC A;  1QSY A;  3KKS A;  3O3H A;  2YJF A;  3O9T A;  3WQT A;  4ZTF A;  4C8L A;  3A5O C;  4NXM K;  3VES A;  4JI3 K;  1NK4 A;  4YHH K;  4IKF A;  4BG8 A;  4CIG A;  3VF2 A;  3D2F B;  1U4B A;  3L4Q A;  4CJW A;  4NCB A;  2WON A;  4FW1 A;  1P8Z A;  1QZ6 A;  4F8R A;  3M1F A;  2OZM A;  1NBW A;  5AZI B;  4DQR A;  1HYV A;  1UAX A;  3CJC A;  4ICL A;  3TAM A;  3VQ4 A;  4EHT A;  5AQH A;  3L2R A;  3RSE B;  2E6L A;  2GTD A;  3LZI A;  1NKE A;  3HI0 A;  4KH6 A;  3CG7 A;  3CET A;  1C0F A;  1XMO K;  2WC9 A;  3SPY A;  5IWA K;  1OVY A;  3TAG A;  2P5O A;  4H5R A;  4FPB A;  2X6S A;  4B9T A;  4C8N A;  1JLQ A;  3W3D A;  4CEC A;  4M45 A;  4Z94 A;  3K2P A;  3WXJ A;  2QWR A;  3SYZ A;  4NCG A;  4AH9 A;  4JI8 K;  5E26 A;  1NG9 A;  4BC3 A;  1TV6 A;  1RT6 A;  4EP5 A;  4JKE A;  2I5J A;  2PBD A;  3ENH A;  3C6U A;  1TL3 A;  4B1U B;  3BY5 A;  5F0X A;  3ENO A;  1WLJ A;  4DSE A;  3CD6 N;  5AQW A;  1VRT A;  4CJF A;  3TTD A;  3DRR A;  5I3U A;  1GOC A;  1U48 A;  4IOX A;  3WXM B;  2P9P B;  4WQ5 A;  2GUI A;  4CJE A;  1VSI A;  4HUF A;  3DLH A;  1SKS A;  4JAX A;  5KGW A;  3JXU A;  1T05 A;  3CJB A;  1DLO A;  3RR8 A;  4JKB A;  3K5M A;  4M3R A;  3LP1 A;  1QHA A;  4OGC A;  3SQ4 A;  1YJN N;  1X1P A;  3L2W A;  1MWK A;  2IGI A;  1R0A A;  2BH1 A;  2XY8 A;  2E4L A;  4A2B A;  5JS2 A;  4CIE A;  3ZSV A;  4N76 A;  3T3F A;  1KXP A;  2BDP A;  4JKA A;  3IRX A;  5KGX A;  3CFR A;  4CER A;  1BA1 A;  3R6M A;  1YHQ N;  1N32 K;  4C8M A;  4DV2 K;  4DV7 K;  1NK0 A;  3ZT3 A;  4KPY A;  4JEP A;  3ZSX A;  4B9Q A;  4DV6 K;  3S9H A;  4J2B A;  1C0U A;  4CJ7 A;  1C6V A;  2QWO A;  2HW3 A;  4ILG B;  5E41 A;  1S9G A;  4JKC A;  2KTQ A;  3NF9 A;  2YX6 A;  3EEQ A;  5F1X A;  4OKK A;  1YAG A;  3D2E A;  5AQO A;  2E6M A;  5AQL A;  2UUA K;  2KKZ A;  3D6R A;  5EX5 A;  3U3Y A;  2YCH A;  2UXC K;  2GWK A;  1NGI A;  2O8F A;  2CGJ A;  4DTX A;  4H5N A;  2FF3 B;  3HRG A;  4BR2 A;  3L8B A;  5AQJ A;  3O4Q A;  3AGR A;  3QFU A;  1HPM A;  4BRA A;  3VA0 A;  4A59 A;  2O8D A;  4BRG A;  5KTQ A;  2HNY A;  4BR9 A;  3HZ6 A;  1LAW A;  2RKI A;  3F5T A;  1Q81 O;  1KCF A;  1U2V A;  1BIS A;  4CHO A;  1KVB A;  4O8K A;  4FWK A;  4GVM A;  4CGG A;  4I6M B;  4M3W A;  3Q7B A;  2HOE A;  2GEL A;  2QKK A;  1EKE A;  5AQS A;  3T19 A;  1QS4 A;  3E9O A;  3VQ9 A;  4JS4 A;  4GKK K;  1QVF M;  2PZS A;  3E1Y A;  1VQ4 N;  1O13 A;  3DLB A;  5M1Q A;  3ZT2 A;  4Y1D A;  3AV9 A;  5J2N A;  5KI6 A;  4WQ4 A;  3T1A A;  5AQK A;  3NFA A;  1X9W A;  3TWH A;  3AO3 A;  3OYN A;  4E7K A;  4JD2 B;  2G8F A;  4WFN L;  4AHT A;  3DLG A;  3ZYY X;  2P9U A;  4FLZ A;  1MA9 B;  3MDQ A;  3LPU A;  1RTJ A;  4B9U A;  4DSK A;  2YHW A;  1T7P A;  1ZBF A;  4FLU A;  1RT3 A;  4M3U A;  2D0O A;  3KD5 E;  5J1E A;  2E2P A;  4FJ5 A;  4E19 A;  1MDU B;  2RPI A;  4JV5 K;  2P1J A;  3D2F A;  4DSI A;  1ZYQ A;  2Y1I A;  5FRO A;  3E66 A;  4BRL A;  1GLC G;  1RBS A;  4FVU A;  4CJQ A;  5FPM A;  3AVG A;  3AGK A;  3KKR A;  3JS6 A;  5AZI A;  3LP2 A;  2HHV A;  4B9M A;  2HMI A;  2HHU A;  3DOK A;  5AQY A;  3TAB A;  4OX9 K;  3QIO A;  3DMJ A;  3RSE A;  2VG7 A;  3N4P A;  4EHU A;  2Q0R A;  1WSI A;  2E5L K;  3OYA A;  4M7X A;  4QAG A;  4FCY A;  2DTU A;  4CGJ A;  3WXI A;  3V1R A;  2NRT A;  4QS8 A;  3NF8 A;  1VQ9 N;  3CPE A;  2O8C B;  3MWT A;  3VQC A;  3MXI A;  5ADX A;  4HUG A;  2Z1J A;  4BVO A;  1FXX A;  1KFD A;  3SMS A;  2D4W A;  3LAL A;  3QLH A;  4CEE A;  3JAM O;  3OS0 A;  3M8S A;  2F4V K;  3S41 A;  1RGI A;  1ESV A;  1XNQ K;  4B9N A;  2QWN A;  5M1P A;  4FJX A;  2XY6 A;  2HBJ A;  4AQY K;  4FO0 A;  1U6Z A;  3HOS A;  4E89 A;  1C1C A;  2ASP A;  3P38 A;  3AVN A;  3WNG A;  3W0L A;  3ZT0 A;  3LP3 A;  4KBO A;  1TYQ B;  2EHG A;  4HCB A;  1NJI O;  5AQM A;  5C24 A;  3MMV A;  4OPK A;  4BRD A;  1TK0 A;  2P9I B;  2NRR A;  4K42 A;  2RF2 A;  1BCO A;  1WSE A;  2RN2 A;  2R7Y A;  2B4J A;  4O55 A;  4LH5 A;  5JVH L;  4TSX A;  4WF9 L;  4CHY A;  4DV0 K;  4BRH A;  1YTU A;  3EE8 A;  2KZM A;  5E84 A;  5C15 A;  5AQP A;  3RMD A;  1D4X A;  5I42 A;  3MX2 A;  2OPS A;  4GVE A;  3KK7 A;  1BIU A;  1IBM K;  4Z4H A;  4GMJ B;  2FBT A;  3ATU A;  3ZET B;  1V4S A;  3DM2 A;  2V51 B;  3K9K A;  4FLY A;  3TI0 A;  5KRS A;  4FJ7 A;  1C0T A;  3DLK A;  4KKO A;  4CD1 A;  1M90 O;  3KK3 A;  2YV0 X;  4IDK A;  5LJV A;  1BCM A;  1YUW A;  4CHN A;  4ZTJ A;  1HX1 A;  3RWU A;  3HJF A;  3QIC A;  1XWL A;  4IJN A;  5JMV A;  3J81 O;  4DTN A;  4E3S A;  3SUO A;  1J9A A;  1RFQ A;  3OYK A;  3OS1 A;  4XH4 A;  3CME N;  4DUZ K;  3NVM A;  3HM9 A;  1NU0 A;  1RDA A;  4N41 A;  5BRD A;  4BAC A;  4C1N K;  4EZ6 A;  3MEE A;  2GUP A;  3PX6 A;  5HOO A;  5BN8 A;  1B92 A;  4N5S A;  4LF4 K;  4KH4 A;  1BDG A;  2E2N A;  1GLD G;  2RHK A;  3ID8 A;  3SUN A;  3IFR A;  4DTS A;  3MEG A;  1KTQ A;  3M8R A;  4FWQ A;  4M3Y A;  3J7Y P;  1Y64 A;  2RE2 A;  4K41 A;  2NRZ A;  3EE9 A;  2OCE A;  2ZM6 K;  3KVG A;  4JI1 K;  4BGB A;  2FBX A;  3RRH A;  3QEW A;  3MWP A;  4I6M A;  2WOM A;  4FW2 A;  4DR7 K;  4DUY K;  5C0Y A;  1K73 O;  4JYA K;  3TR8 A;  2HHW A;  2BE2 A;  4W5N A;  3O8M A;  2P9K B;  5HLF A;  2KFZ A;  1A5X A;  3ID6 A;  3LL3 A;  3NMU A;  1TUU A;  2JWL A;  5HRP A;  2XHB A;  1EWQ A;  4CZM A;  3NH0 A;  1S22 A;  2O4I A;  4JD2 A;  4BDY A;  1GOA A;  1W97 L;  4K43 A;  4CJL A;  3NDK A;  3AO1 A;  3BF3 A;  4MDA A;  4OPJ A;  5KPT A;  4R5P A;  5KRT A;  4M41 A;  5AQF A;  3MN7 A;  3O1W A;  5HP1 A;  2E20 A;  3VEO A;  4W5O A;  3BP8 A;  1Q18 A;  2UU9 K;  4FZZ A;  1EO1 A;  3G4S N;  5BPN A;  4I2Q A;  2VGN A;  2VG6 A;  1XI1 A;  1DGK N;  4LSN A;  1YIT N;  3CER A;  2FBV A;  4CFD A;  1OKJ A;  2W42 A;  2ZD1 A;  3FZF A;  5HRO A;  1TKZ A;  5CHI A;  3HST B;  1VSJ A;  1OVQ A;  4PUO A;  4PKI A;  3ZX2 A;  5T7B A;  1S72 N;  4G9Z A;  4DFK A;  3JSM A;  4DQ8 A;  4B3T K;  4J2E A;  1W0H A;  4PY5 A;  1ZC6 A;  2BUP A;  3VF4 A;  4LF9 K;  3FE1 A;  1QQN A;  4CEB A;  5JS1 A;  3VGL A;  3CC4 N;  3PV8 A;  2O8C A;  3P5J A;  3QO9 A;  1H1V A;  4KTQ A;  1ASU A;  3CJ1 A;  1WSF A;  1LWE A;  1CLQ A;  4DSF A;  3DLL L;  3ZEU A;  3M3Z A;  5CYQ A;  3U3G A;  4YOW A;  3PO4 A;  1VQO N;  2X74 A;  3R1X A;  1RBT A;  1LWF A;  3OHR A;  3T1Y K;  1IG8 A;  5AZJ B;  3VQP A;  1NJY A;  3O9S A;  2F8T A;  1I3A A;  2YNF A;  4XH1 A;  4F2S A;  4ILJ A;  4Z4C A;  1HJO A;  3CYM A;  1XC9 A;  3QB0 A;  4N56 A;  1TYQ A;  3JYT A;  1GLJ O;  2YNI A;  4FJH A;  2P9N B;  4PL7 A;  2VWB A;  2P9I A;  3BZK A;  4FK4 A;  3PY8 A;  4JKG B;  2QK9 A;  3NVK A;  1BI4 B;  3V9S A;  3SUP A;  1A5V A;  4DFP A;  3I0S A;  2Q31 A;  3SAG A;  4G1Q A;  4JI4 K;  1GLL O;  2KHO A;  3CIP A;  2AA4 A;  3H1V X;  3MN9 A;  1NGC A;  1RT4 A;  4O8U A;  5CYM A;  4CZL A;  3NAE A;  4IXC A;  3KLG A;  3CCR N;  2I7P A;  4K25 A;  4LF5 K;  3M5R A;  2JLE A;  1GLB G;  5FRM A;  4QCL A;  4LSL A;  3C65 A;  1LCU A;  3C6T A;  4JRP A;  4Z4E A;  3ZET A;  3SV3 A;  1QQO A;  3HPH A;  3KK2 A;  1NK8 A;  4MFB A;  4E7I A;  1S6Q A;  4BWJ A;  3IDH A;  2JWK A;  5M1O A;  4IWV A;  3VQ6 A;  1K9M O;  3TSQ A;  4DHY A;  2PFU A;  3GG4 A;  3NBP A;  1VQ7 N;  4FLV A;  1JKH A;  4W5T A;  4CBW A;  1JLF A;  4Y0W A;  2A42 A;  1REV A;  2W40 A;  4NO7 A;  1JLG A;  4KTW A;  4NLB A;  3TAQ A;  1K6Y A;  1SL1 A;  4DR6 K;  3THX B;  3S3O A;  3DI6 A;  5BRH A;  1SV5 A;  2W41 A;  4CIF A;  3KLI A;  3HXM A;  2G8U A;  4B08 A;  3ALY A;  4DTJ A;  4F3T A;  4CZI A;  4DMN A;  3VEZ A;  2HHS A;  2IC3 A;  3G25 A;  2UYT A;  2VWJ A;  1Z26 A;  3VA3 A;  1NK5 A;  1I39 A;  1ATR A;  1BA0 A;  1HKB A;  1JL2 A;  1QHT A;  3Q7C A;  3V9W A;  1RT5 A;  2O4G A;  2HHT A;  3R8E A;  3K5N A;  3BDP A;  3ZSY A;  4M3T A;  3ZCM A;  3VQ8 A;  3SQ2 A;  4YOV A;  4H0P A;  3LDN A;  2GEM A;  4B3R K;  4KO0 A;  1TK5 A;  1HRH A;  2X6N A;  3HPO A;  1Z6R A;  4BE0 A;  4ZHR A;  2D1K A;  3MN6 A;  1WSJ A;  2P9K A;  4X62 K;  4F4K A;  4BC4 A;  3QEP A;  1G15 A;  3G10 A;  1ASV A;  4OVL A;  1I94 K;  4XH5 A;  3A2F A;  3DLE A;  1Z25 A;  1NMN A;  5C10 A;  5H1S Q;  1WOQ A;  2GX9 A;  4FZX C;  3BF1 A;  4FYD A;  2Q0U A;  4GW6 A;  1SKR A;  2BGG A;  4DG1 A;  3AO4 A;  4E1M A;  4E1N A;  3P39 A;  4DKW A;  1Q86 O;  4L3Q A;  3D0P A;  4BE2 A;  3AVM A;  1HQE A;  4JKD A;  3CF5 L;  3ASM A;  3CHW A;  1B9F A;  1S1T A;  3OTO K;  1S9E A;  4ELV A;  4CF0 A;  1CZ9 A;  2P9S B;  2UXB K;  5LMN K;  3TAP A;  1NK7 A;  1NGG A;  5SZT A;  4CEQ A;  3THW B;  3MXM A;  3VGM A;  1W9H A;  3QBW A;  2DFE A;  2KQ2 A;  4NXN K;  3AAR A;  5EU7 A;  3VQB A;  3OYI A;  4CF1 A;  4MO5 A;  4CJU A;  4C23 A;  1NMD A;  3ZT4 A;  1DKG D;  1QE1 A;  3I8D A;  3M6G A;  4FLX A;  2PAV A;  5C12 A;  4E7H A;  3J80 O;  1NOY A;  1NK6 A;  1LV5 A;  4OJR A;  3N4Q A;  5FPE A;  5C2D A;  3OYM A;  3EKU A;  4WFA L;  5AFU H;  1S3X A;  4M42 A;  5CR4 A;  1TGO A;  2Q97 A;  4RW8 A;  1ATS A;  2VCP A;  2NZT A;  4W5Q A;  4FK0 A;  2IIR A;  5EOY A;  4DQQ A;  4B9L A;  3FZL A;  4CEZ A;  4RW6 A;  4QOZ B;  5A2Q O;  4JI6 K;  3AVC A;  5MLC Q;  3CM5 A;  3RTV A;  1IBK K;  4MQ3 A;  3RMB A;  1C1B A;  2D0B A;  1RT1 A;  2HST A;  3GBT A;  4FWN A;  4IEI A;  1C1A A;  5SWM A;  2XY5 A;  2ZE2 A;  4U67 L;  1N8R O;  5AZJ A;  1DTQ A;  3C6A A;  1J53 A;  4BRF A;  3BUZ B;  2O8E B;  5TKW A;  5AJ3 K;  1Q82 O;  5DMR A;  3C7N B;  1BU6 O;  4RW7 A;  3J7Z O;  2D0C A;  2IDO A;  4O0I A;  3F73 A;  2P9N A;  4DLG A;  3L2Q A;  3SQ1 A;  3SMP A;  4JKG A;  3WT0 A;  2IS3 A;  3NGY A;  1BI4 A;  3PX4 A;  5JVG L;  3OYL A;  4BRM A;  1X9S A;  4J8F A;  3LDL A;  2ZGY A;  1X9J A;  4B1Z A;  1WB9 A;  1OH8 A;  3F2K A;  4H4M A;  3QER A;  4WCE L;  1ZBI A;  4KRE A;  1CXU A;  1IH7 A;  2ASM A;  4JRQ A;  2KZZ A;  1LWC A;  4DFJ A;  4RG8 A;  4CZG A;  4B1W B;  4Z4I A;  3V9U A;  3KLH A;  3UKU B;  4DTO A;  3RMA A;  2D0P A;  3MN5 A;  1HR0 K;  1NJW A;  5GAG P;  4B3O A;  4LF7 K;  3OS2 A;  5BRF A;  1VQK N;  3C95 A;  4F2R A;  1NK9 A;  2OAN A;  5GAE P;  4JI2 K;  4JK7 A;  3FZK A;  1QQM A;  2F7T A;  5CE3 A;  3NE6 A;  1YVN A;  3RMC A;  4CJV A;  4YY3 K;  3G71 N;  1QSS A;  4FZY A;  2PY5 A;  4DR5 K;  4CZJ A;  5HBM A;  1SAZ A;  1YJ9 N;  1EP4 A;  4DF4 A;  4DB3 A;  2A6A A;  3ITH A;  3L6Q A;  3HP9 A;  3SBT A;  2HBK A;  3CCU N;  3B6P A;  4RWT A;  4DR1 K;  3THX A;  3OVN A;  1HKC A;  3H3N O;  4AM6 A;  4Z4F A;  3V81 A;  3AY9 A;  4FK2 A;  3RRG A;  5KQ8 A;  4ELU A;  1ZBU A;  1MU2 A;  4FLW A;  4B3S K;  4F3O A;  4FWM A;  3PX0 A;  3LDS A;  3UE5 A;  3NF6 A;  4JKH A;  4CCH A;  4CBX A;  3CQX A;  4GV9 A;  4BWM A;  1HNX K;  2OZS A;  3VEY A;  1P90 A;  3OY9 A;  3IMX A;  3TSU A;  3ZEU B;  2VYP A;  4H0V B;  2KLA A;  3T69 A;  4BRE A;  1U45 A;  4BDZ A;  2QXL A;  2FBY A;  4NYN A;  5LL6 Z;  4IO8 A;  5AQI A;  2NRV A;  1NOZ A;  4A61 A;  3ZSO A;  4YOU A;  4BRO A;  5LY3 A;  3OBY A;  3M8Q A;  1S1V A;  4UQG A;  1J5E K;  1JLA A;  5ELZ A;  2G8W A;  4KHN A;  3MK6 A;  3V9X A;  4AIL C;  2V7Y A;  3V1Q A;  3OYG A;  3E9L A;  1IG9 A;  2VWK A;  3QES A;  2A41 A;  3SZ2 A;  3QML A;  1GLA G;  1QQC A;  1RNH A;  4CGD A;  4OKJ A;  1KC8 O;  3A5N C;  4FJJ A;  4RW4 A;  3CCL N;  3S3N A;  2P5G A;  5EVZ A;  4EAH D;  1SQK A;  1WNS A;  4C8K A;  2IOC A;  3VMF B;  4CJT A;  4WFB L;  2W6L A;  2QEX N;  1DTT A;  2P9S A;  4IZ9 A;  4AHR A;  5GIN A;  3GL1 A;  1NGA A;  3TPQ A;  4OPA A;  5D3G A;  3THV A;  3THW A;  3P31 A;  3PLA A;  1YIJ N;  3OJU A;  2FC0 A;  4CFB A;  3HP6 A;  2Q3S A;  3L0Q A;  3HL8 A;  1NGE A;  1TUY A;  1O1W A;  3D7E O;  4DCH A;  5IT9 O;  4KH5 A;  4CEF A;  4YOT A;  1QSL A;  1K8K B;  4A2A A;  1BUP A;  4WE1 A;  5BRE A;  5C2F A;  3EN9 A;  4A5A A;  4AHV A;  3ZLJ A;  1RBR A;  3H6E A;  2FSK A;  1SZ2 A;  4K0K K;  3F9K A;  4FPA A;  3LZJ A;  5J2M A;  3FFI A;  4I2P A;  4J2A A;  3DLR A;  3WNH A;  1D8Y A;  3KK1 A;  3CCM N;  3QNO A;  1HQU A;  4FVM A;  4Y1C A;  4U7B A;  3FZM A;  2ZJQ L;  4V19 S;  3VER A;  1UOC A;  4AHS A;  2O8E A;  2QW9 A;  4Z0U A;  1S1X A;  3C7N A;  3ATV A;  3UB5 A;  1TK8 A;  2P9L B;  4H0T B;  5DK5 A;  4DS5 A;  3A0I X;  4CVN E;  3PUF A;  4WYB A;  4FM2 A;  1NJX A;  4JI0 K;  3G6E N;  4CGH A;  2WUS A;  4X65 K;  3QBX A;  1F21 A;  3QFP A;  2V7Z A;  4YOX A;  3WXK A;  1RBV A;  1ZXO A;  3AO2 A;  1XHZ A;  3TAE A;  4RCH A;  1TKT A;  2A1R A;  4FWL A;  1JLB A;  3MEC A;  3R9P A;  3VEW A;  5DM7 L;  2CH6 A;  4BDP A;  4CE9 A;  4GY2 B;  2CGL A;  1Q8I A;  5F2R A;  5HRN A;  3UKU A;  4CF2 A;  3H46 O;  5FDL A;  2Z1G A;  1BL3 A;  1L3U A;  4CK3 A;  3NH1 A;  4JLH A;  4B3M K;  1RDD A;  1XQS C;  3O80 A;  4IG3 A;  3V1O A;  4RW9 A;  1QVG M;  1IKV A;  3J7A P;  2ZGZ A;  3L4I A;  1HYS A;  1IKW A;  4BC5 A;  3U9D A;  3P1G A;  3AVA A;  2ASO A;  3IKM A;  4JK8 A;  2UUC K;  2ZJR L;  1JLE A;  4BRN A;  2FF6 A;  3HO1 A;  4PKH A;  3TTC A;  2ZJP L;  4DLE A;  4H0Y B;  4FJL A;  2VQE K;  4CK1 A;  4KHW A;  3S3M A;  1J6Z A;  3AA4 A;  4B9V A;  2AJQ A;  5FPN A;  3MAQ A;  2X78 A;  4FM1 A;  4C8O A;  4R79 A;  3NHG A;  4A57 A;  2OTJ N;  3VQA A;  3AO5 A;  4FJN A;  3BEX A;  2NNW A;  4WQ5 C;  4CHZ A;  4N47 A;  3U8X A;  3O08 A;  2F8S A;  3V4I A;  4BG9 A;  4FLT A;  2HND A;  5CZ2 A;  4KI6 A;  3QEX A;  2OPP A;  1R59 O;  3CCQ N;  5AQV A;  5J2Q A;  1JCG A;  4Q5V A;  2HF4 A;  2QI2 A;  3AVH A;  2OPR A;  1VSH A;  4ISG A;  1U47 A;  3HT3 A;  1S6P A;  2QWQ A;  3OYH A;  2NUB A;  3RVC A;  3ZSW A;  2GBZ A;  3OYE A;  4KHS A;  3VET A;  1YF5 L;  2UUB K;  4OPH A;  3WXL A;  1U49 A;  1YI2 N;  3LAN A;  3I0R A;  3OYB A;  3K0S A;  3CM6 A;  3SLC A;  3CC2 N;  4NB4 A;  1ASW A;  3WQU A;  4E1J A;  1XC3 A;  3B6O A;  3K9J A;  1TAU A;  1YTA A;  4DR2 K;  1VSF A;  2HBM A;  4CD3 A;  4MLE A;  4DQS A;  4CES A;  1OH5 A;  1WBB A;  2E1Z A;  2FLO A;  4FL9 A;  3C0B A;  1NGB A;  1Q9X A;  3LPT A;  3KD1 E;  1EQY A;  3I8B A;  3PSF A;  4CZK A;  1FKP A;  3A8Y A;  2A1S A;  1WSH A;  5M1N A;  3K5L A;  2Z1I A;  2EWS A;  4IOA L;  1KVC A;  1VSK A;  5LJW A;  5I9E B;  4LC9 B;  2YKN A;  1TAQ A;  2WTU A;  1CXQ A;  4H5T A;  1RDC A;  4DR3 K;  1LW2 A;  2QXF A;  3HM8 A;  1IKY A;  1NGF A;  4O4G A;  4LF8 K;  3HOT A;  3WUH A;  1WBD A;  3L3U A;  1FKO A;  2F96 A;  4BR5 A;  4FJ8 A;  1JLC A;  1G99 A;  1JJ2 M;  4HHT A;  1CZA N;  3J8A A;  3B8A X;  5AQN A;  3TSP A;  4AF1 A;  1VQ8 N;  4LFB K;  4CZH A;  2DY4 A;  4BR7 A;  4X64 K;  3D45 A;  5ADX H;  5JIC A;  3UKR B;  3OYF A;  4LFA K;  3EYZ A;  2B6A A;  4FWP A;  2XY7 A;  2F9T A;  1IV0 A;  1HKG A;  4LF6 K;  4AHU A;  2NRW A;  3LP0 A;  1YJW N;  1YT3 A;  4GV6 A;  1K8K A;  2EX3 A;  1KAX A;  2G8H A;  1LW0 A;  4YDU A;  2P51 A;  4WQ4 C;  4BVP A;  2VGM A;  3H45 C;  1KLM A;  5M1K A;  3K5O A;  3DXK B;  1HMV A;  1VSE A;  1VSM A;  4OO1 J;  2NRX A;  2W6K A;  3LDQ A;  3T1H K;  3IG1 A;  4DU3 A;  2HB5 A;  1NGH A;  1X3M A;  3U4L A;  5BPL A;  1KAZ A;  3AVK A;  4DTP A;  4A5B A;  4H0O A;  1NJZ A;  4B8A B;  3VTH A;  4KB1 A;  1YVU A;  1SL0 A;  3VEN A;  3CMA N;  2P9L A;  3SAF A;  1XUP O;  1X9M A;  4CW7 B;  1BQN A;  4F9O A;  1JCF A;  2WBN A;  4CF9 A;  5HRR A;  3VF6 A;  2QWM A;  4DWI A;  1RT2 A;  2IVN A;  3CXC M;  4H0X B;  2B5J A;  3KZB A;  4H8K A;  4B8C A;  4JI5 K;  4CF8 A;  2D5R A;  4IJA A;  3VQQ A;  3TAR A;  1L3T A;  2YI1 A;  5GAH P;  3LAM A;  4FOI A;  3E9P A;  2HMP A;  4QS9 A;  5KPR A;  1LOT B;  4KB0 A;  4KHY A;  2G8I A;  4DU4 A;  1SKW A;  2VQF K;  2FXU A;  3SCX A;  4M3Z A;  3QDK A;  4BR0 A;  1W7A A;  4J2D A;  1XNR K;  3DXM B;  4FSV A;  1OH7 A;  4CEO A;  1BGX T; 
#chains in the Genus database with same CATH homology
 3H3N O;  4AM6 A;  5DM6 L;  1U2V B;  3AY9 A;  5AQU A;  4FWQ A;  1NWK A;  1Z05 A;  4JNE A;  4IFE A;  1Y64 A;  3GE1 A;  3C6H A;  2RE2 A;  3VEX A;  4K41 A;  5KQ8 A;  2NRZ A;  3EE9 A;  1W2B M;  2FSJ A;  3KVG A;  4FWM A;  2HBL A;  3MCA B;  3UE5 A;  2I7N A;  4GV3 A;  1E4G T;  4JKH A;  4BGB A;  3GDQ A;  4CI6 A;  4JN4 A;  3MWP A;  4CBX A;  4I6M A;  3FR0 A;  3CQX A;  4GV9 A;  5C0Y A;  3KWG A;  1K73 O;  3P4I A;  3CJ7 A;  1Q7Y O;  3VEY A;  1P90 A;  3IMX A;  2CH5 A;  3TSU A;  3ZEU B;  2VYP A;  4H0V B;  1SS6 A;  2KLA A;  3T69 A;  3O8M A;  4BRE A;  3CCV N;  2IVO A;  2P9K B;  1KQS M;  3VOV A;  5FPD A;  4BRQ A;  2QXL A;  5HL7 L;  4H5V A;  3CI5 A;  2E2Q A;  4IO8 A;  5B8H A;  4IOC L;  3ID6 A;  1QZ5 A;  3LL3 A;  5AQI A;  2NRV A;  3NMU A;  1TUU A;  2JWL A;  2P9U B;  3DJC A;  3H3O B;  1X3N A;  4A61 A;  4CZM A;  3WEE B;  4YOU A;  4BRO A;  5LY3 A;  1GLE G;  2YJF A;  1S22 A;  3OBY A;  4JD2 A;  5EY4 A;  1W97 L;  4K43 A;  3O9T A;  3WQT A;  3OBW A;  3A5O C;  3VES A;  1HUX A;  3BF3 A;  4MDA A;  5ELZ A;  3MK6 A;  4BG8 A;  2V7Y A;  4BRC A;  5KPT A;  3DAW A;  5AQF A;  3VF2 A;  3E9L A;  3D2F B;  3MN7 A;  2AP1 A;  3L4Q A;  3O1W A;  2A41 A;  3I55 N;  2E20 A;  1VQP N;  3QML A;  3VEO A;  3VGK A;  1GLA G;  4FWO A;  1P8Z A;  1QZ6 A;  1KC8 O;  3A5N C;  3BP8 A;  3M1F A;  1Q18 A;  3CCE N;  3CCL N;  1NBW A;  5AZI B;  1EO1 A;  3G4S N;  5EVZ A;  4EAH D;  1ILY A;  4JKF A;  1SQK A;  3CJC A;  3TTF A;  4B1Y B;  5BPN A;  2ZF5 O;  3VMF B;  5AQH A;  4B1X B;  4EHT A;  4WFB L;  2QEX N;  2VGN A;  3RSE B;  1DGK N;  1YIT N;  2GTD A;  2P9S A;  3ULE B;  3CER A;  4IZ9 A;  4PHT X;  3SAH A;  5GIN A;  3HI0 A;  3GL1 A;  1OKJ A;  1NGA A;  4KH6 A;  3TPQ A;  3CET A;  1V4T A;  2E1Y A;  3FZF A;  4OPA A;  1C0F A;  4BRP A;  2BTF A;  2WC9 A;  5CHI A;  4QS7 A;  3P31 A;  4IO9 L;  1OVY A;  3PLA A;  1YIJ N;  3ZX3 A;  4PKI A;  3ZX2 A;  1S72 N;  4G9Z A;  4H5R A;  4FPB A;  3VTI A;  4DQ8 A;  3W3D A;  4Z94 A;  1ZC6 A;  2BUP A;  3VF4 A;  3L0Q A;  3FE1 A;  1NGE A;  1TUY A;  1QQN A;  3WXJ A;  4FWR A;  4ISE A;  3VGL A;  3D7E O;  2QWR A;  3CC4 N;  4DCH A;  4BGA A;  4KH5 A;  1H1V A;  5E26 A;  4YOT A;  3F9M A;  3A5L C;  3CJ1 A;  4M63 C;  3UKR A;  4GNI A;  4BC3 A;  5EXW A;  3DLL L;  4JKE A;  3ZEU A;  3M3Z A;  1K8K B;  4A2A A;  1BUP A;  5BRE A;  5C2F A;  2PBD A;  3ENH A;  4YOW A;  3EN9 A;  1VQO N;  4A5A A;  2Q36 A;  4B1U B;  3H6E A;  3R1X A;  4JHD B;  2FSK A;  5F0X A;  3ENO A;  1GLF O;  1SZ2 A;  3OHR A;  1IG8 A;  4FPA A;  5AZJ B;  5AQW A;  3CD6 N;  3LDO A;  3TTD A;  3O9S A;  4IOX A;  3WXM B;  2P9P B;  4YOY A;  1T3V A;  4WQ5 A;  4XH1 A;  3VEV A;  1BO5 O;  4CBU A;  4ILJ A;  3AAQ A;  2FSN A;  3CCM N;  1HJO A;  3QB0 A;  4U7B A;  1TYQ A;  1NM1 A;  4JAX A;  3FZM A;  3JXU A;  3CQY A;  3CJB A;  3VER A;  2ZJQ L;  1GLJ O;  3DXK A;  4JKB A;  2P9N B;  4EFH A;  2VWB A;  2P9I A;  4PL7 A;  2QW9 A;  1QHA A;  4JKG B;  3NVK A;  5GAD P;  2YHX A;  3C7N A;  3ATV A;  3UB5 A;  1JCE A;  1YJN N;  2P9L B;  1MWK A;  1T6C A;  4H0T B;  2Q31 A;  3SAG A;  3A0I X;  1GLL O;  1BOT O;  2KHO A;  2BH1 A;  3CIP A;  2AA4 A;  3H1V X;  4WYB A;  3MN9 A;  1NGC A;  4O8U A;  3G6E N;  2WUS A;  4A2B A;  1HLU A;  3QBX A;  3QFP A;  2V7Z A;  4YOX A;  3WXK A;  4CZL A;  1ZXO A;  5TKY A;  1KXP A;  4IXC A;  3CCR N;  4JKA A;  4RCH A;  2I7P A;  4K25 A;  3M5R A;  4HWI A;  1VQN N;  4FWL A;  1GLB G;  1BA1 A;  3C65 A;  3R6M A;  1YHQ N;  1VQ6 N;  3FZH A;  3O9Q A;  3R9P A;  3VEW A;  1LCU A;  5DM7 L;  2CH6 A;  3ZET A;  1C0G A;  4JEP A;  4B9Q A;  4GY2 B;  1QQO A;  2CGL A;  5F2R A;  3U9Z A;  3UKU A;  3H46 O;  4CJ7 A;  3O5B A;  2QWO A;  1ATN A;  4BRK A;  1BG3 A;  1XQS C;  3O80 A;  4ILG B;  5BN9 A;  1QVG M;  3IDH A;  2JWK A;  2ZGZ A;  3L4I A;  4IWV A;  5M1O A;  3T7Z A;  4JKC A;  4BC5 A;  3U9D A;  2YX6 A;  1K9M O;  4O5F A;  5F1X A;  2ASO A;  3IKM A;  4JK8 A;  3FLC O;  3TSQ A;  4DHY A;  2PFU A;  3GG4 A;  2ZJR L;  1YAG A;  3D2E A;  4BRN A;  2FF6 A;  5AQO A;  1VQ7 N;  4PKH A;  3TTC A;  5AQL A;  4CBW A;  2ZJP L;  3CCJ N;  4JK9 A;  3MCP A;  4Y0W A;  4H0Y B;  2A42 A;  2KKZ A;  3D6R A;  5EX5 A;  5GIO A;  3CC7 N;  2W40 A;  4NO7 A;  1VQ5 N;  4NLB A;  2E8A A;  2YCH A;  2GWK A;  3IUC A;  1NGI A;  2IVP A;  3EO3 A;  2CGJ A;  1J6Z A;  2FF3 B;  3HRG A;  4H5N A;  4NLC A;  4BR2 A;  5BRH A;  5AQJ A;  4MLH A;  2W41 A;  5FPN A;  3A5M C;  3AGR A;  3QFU A;  4H5W A;  1HPM A;  4BRA A;  3DXM A;  4R79 A;  4A57 A;  3PIO L;  2P9P A;  5AQG A;  3FGU A;  2OTJ N;  3BEX A;  4A59 A;  4BRG A;  2NNW A;  2GWJ A;  4WQ5 C;  3HZ6 A;  4BR9 A;  2H3G X;  3F5T A;  1Q81 O;  2ZWH A;  1KAY A;  5JLH A;  4CZI A;  1U2V A;  3U8X A;  3VEZ A;  1RDU A;  3O08 A;  1BWF O;  3AAP A;  3HBT A;  1YXQ A;  3G25 A;  2UYT A;  4BG9 A;  4O8K A;  4FWK A;  1ATR A;  1BA0 A;  1HKB A;  3Q7C A;  4I6M B;  3CPW M;  3Q7B A;  2HOE A;  2GEL A;  1R59 O;  5JLF A;  3CCQ N;  4CZE A;  5AQV A;  5AQS A;  3E9O A;  1JCG A;  3R8E A;  3ZX0 A;  2HF3 A;  2HF4 A;  2QI2 A;  4ISG A;  4YOV A;  4H0P A;  3LDN A;  1QVF M;  2GEM A;  3E1Y A;  2QWQ A;  1O13 A;  3RVC A;  1VQ4 N;  5M1Q A;  1Z6R A;  5KQD A;  4C1N I;  3VET A;  1YF5 L;  2Q1N A;  5GIP A;  2D1K A;  3MN6 A;  4OPH A;  2P9K A;  4WQ4 A;  3WXL A;  3MX5 A;  5AQK A;  5BPM A;  4BC4 A;  3CCS N;  1YI2 N;  4BC2 A;  4JD2 B;  4WFN L;  4XH5 A;  3SLC A;  3CC2 N;  4NB4 A;  4M7Y A;  3WQU A;  3ZYY X;  2P9U A;  1XC3 A;  4BR4 A;  3K9J A;  4E1J A;  1MA9 B;  3MDQ A;  3WEE A;  2J4R A;  5C10 A;  5H1S Q;  1WOQ A;  3HSC A;  2GX9 A;  2HBM A;  2YHW A;  4FWS A;  4MLE A;  4CD3 A;  2A40 A;  3BF1 A;  2WFB A;  4RTF D;  2CGK A;  2Q0U A;  2E1Z A;  2D0O A;  2FLO A;  3C0B A;  1NGB A;  4FL9 A;  2E2P A;  3P39 A;  1MDU B;  3LM2 A;  4DKW A;  1K8A O;  1EQY A;  3I8B A;  4L3Q A;  1Q86 O;  3D2F A;  2Q2R A;  4CZK A;  4JKD A;  3ENB A;  3A8Y A;  3CF5 L;  3CHW A;  3CJA A;  5M1N A;  2EWS A;  4XEI A;  3O1B A;  4IOA L;  1DT9 A;  3E66 A;  4BRL A;  1GLC G;  4FVU A;  5LJW A;  5I9E B;  4LC9 B;  5FPM A;  3SK3 A;  3AGK A;  2P9S B;  4IDH A;  3JS6 A;  5AZI A;  5AQT A;  4YDU C;  4H5T A;  1NGG A;  4EIA A;  3HM8 A;  5AQY A;  3RSE A;  4EHU A;  3N4P A;  3VGM A;  2Q0R A;  3QBW A;  1NGF A;  3R3L A;  3ULE A;  3AAR A;  4M7X A;  3HOT A;  3WUH A;  4MO5 A;  4YOR A;  4BR5 A;  1NMD A;  4C23 A;  2OTL N;  1G99 A;  1DKG D;  3O4W A;  1JJ2 M;  3WXI A;  1CZA N;  3J8A A;  2A3Z A;  3B8A X;  3M6G A;  2NRT A;  4QS8 A;  2PAV A;  5AQN A;  3TSP A;  4AF1 A;  5C12 A;  1VQ8 N;  1VQ9 N;  3CPE A;  3MWT A;  3N4Q A;  2DPN A;  5FPE A;  3OA9 A;  4CZH A;  4BR7 A;  5C2D A;  5ADX H;  5ADX A;  4ISF A;  5JIC A;  3EKU A;  1MWM A;  4WFA L;  3UKR B;  5AFU A;  2QWL A;  2NLX A;  5AFU H;  1S3X A;  4BVO A;  2V52 B;  2D4W A;  5CR4 A;  3SMS A;  3LM9 A;  2QM1 A;  4FWP A;  2Q97 A;  3S41 A;  2F9T A;  1ATS A;  2VCP A;  2NZT A;  1HKG A;  1RGI A;  1T6D A;  1ESV A;  2IIR A;  5EOY A;  2ITM A;  3FZL A;  2QWN A;  5M1P A;  4MO4 A;  2NRW A;  1YJW N;  3OW2 M;  2QTD A;  5MLC Q;  4GV6 A;  1K8K A;  2HBJ A;  3H1Q A;  1KAX A;  1U6Z A;  2QWP A;  4FO0 A;  3HOS A;  2HST A;  1KD1 O;  4YDU A;  2E88 A;  4JHD A;  3GBT A;  2A5X A;  4FWN A;  4IEI A;  4WQ4 C;  4BVP A;  2ASP A;  2VGM A;  3P38 A;  3H45 C;  4U67 L;  1N8R O;  3EKS A;  5AZJ A;  1M1K O;  3W0L A;  4KBO A;  5M1K A;  1TYQ B;  3KWI A;  3C6A A;  1NJI O;  5AQM A;  4BRF A;  3BUZ B;  3DXK B;  1RDW X;  3MMV A;  3VPZ A;  5TKW A;  1VQM N;  4BRD A;  2P9I B;  1Q82 O;  2NRR A;  4K42 A;  4BY9 C;  4OO1 J;  2NRX A;  3C7N B;  4PL8 A;  1BU6 O;  3LDQ A;  2F9W A;  3J7Z O;  1NGH A;  4B1V A;  1X3M A;  3U4L A;  5BPL A;  1KAZ A;  3DWL A;  5BR9 A;  4IEE A;  5JVH L;  3O9R A;  4WF9 L;  2P9N A;  4A5B A;  4H0O A;  3SMP A;  3FFK B;  4JKG A;  3WT0 A;  4BRH A;  3VTH A;  1VQL N;  2YJE A;  5JVG L;  4FOE A;  4BRM A;  4J8F A;  3LDL A;  4BRI A;  2ZGY A;  3VEN A;  1X9J A;  3CMA N;  2P9L A;  4B1Z A;  1IJJ A;  3EE8 A;  2NRH A;  5AQR A;  3F2K A;  5E84 A;  5C15 A;  3SAF A;  5AQP A;  3O9U A;  3O6W A;  4WCE L;  1D4X A;  1XUP O;  5AQZ A;  4CZF A;  3MX2 A;  4GVE A;  3HTV A;  3LDP A;  3KK7 A;  3I56 N;  2ASM A;  4F9O A;  1JCF A;  2WBN A;  3ATU A;  5AQX A;  3I33 A;  3VF6 A;  3ZET B;  4CZG A;  4UY8 O;  1V4S A;  4B1W B;  2QWM A;  4PKG A;  4HTL A;  2V51 B;  3K9K A;  3UKU B;  2D0P A;  2IVN A;  3MN5 A;  3CXC M;  3CJ9 A;  4H0X B;  5M1F A;  4CD1 A;  1M90 O;  1WUA A;  5GAG P;  5LJV A;  3KZB A;  1NGJ A;  3KHY A;  4BQL A;  5BRF A;  1YUW A;  3EL2 A;  3SBG A;  4AM7 A;  1VQK N;  2OAN A;  1HX1 A;  1NGD A;  4JK7 A;  3FZK A;  3QIC A;  2YHY A;  5GAE P;  4IJN A;  4BQZ A;  5JMV A;  4IJA A;  5AQQ A;  1QQM A;  2E2O A;  2F7T A;  3EZW A;  5CE3 A;  2YI1 A;  1RFQ A;  3D2E B;  5GAH P;  4FOI A;  1YVN A;  4H03 B;  3E9P A;  2HMP A;  5AR0 A;  4QS9 A;  4XH4 A;  5KPR A;  3CME N;  1LOT B;  3NVM A;  4ILH A;  1T44 A;  3G71 N;  1ZBS A;  4MDB A;  3PIP L;  5BRD A;  3GOI A;  1DEJ A;  2FXU A;  4C1N K;  3QDK A;  4BR0 A;  4CZJ A;  2GUP A;  4A62 A;  5HOO A;  1SAZ A;  5BN8 A;  1YJ9 N;  3DXM B;  2QA4 N;  4FSV A;  4KH4 A;  1BDG A;  4DB3 A;  5KPZ A;  2A6A A;  3SJH A;  2E2N A;  3L6Q A;  3SBT A;  3CCU N;  2HBK A;  1NLV A;  1GLD G;  4RWT A;  1VAZ A;  2RHK A;  3ID8 A;  3IFR A;  3TU5 A;  1HKC A;  1E4F T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...