4IO9L

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4io9L01
3CCQN 4IOAL 3CCSN 1QVGM 1KD1O 1YHQN 1QVFM 2OTJN 3G71N 1Q86O 1KC8O 5GAEP 3CMAN 3CCLN 3CCVN 5GAGP 5HL7L 1W2BM 1S72N 3G6EN 2ZJPL 2ZJQL 5JVGL 3CC4N 4WFNL 5DM7L 1YJNN 1M90O 2QEXN 4WF9L 1M1KO 1YJ9N 1VQ7N 4WFBL 1VQNN 3CCEN 3G4SN 1NJIO 3CD6N 4IOCL 1Q7YO 2ZJRL 3CCMN 1VQON 3CF5L 3CCUN 4U67L 3CC2N 3PIOL 1K73O 4UY8O 5H1SQ 1YIJN 4IO9L 3J7ZO 1VQMN 3CXCM 1Q82O 5GADP 2QA4N 4WFAL 3OW2M 1JJ2M 3CCRN 3CPWM 1Q81O 1VQPN 5MLCQ 3DLLL 1VQ8N 1VQ5N 1K9MO 3I55N 1VQ4N 5DM6L 1OVYA 1YJWN 1K8AO 1YI2N 1YITN 4WCEL 3CC7N 3PIPL 3I56N 5GAHP 5JVHL 1VQ9N 3CCJN 1KQSM 2OTLN 3CMEN 1VQ6N 1N8RO 1ILYA 1VQLN 1VQKN
chains in the Genus database with same CATH superfamily
3C6UA 4DTJA 2W6LA 4M7XA 4OGCA 2WONA 4A62A 3SJHA 1Z05A 1D9FA 1TYQA 4QAGA 3U8XA 4BE1A 1J5OA 3GL1A 1C0MA 4FJ8A 1BDGA 3VQCA 4XH5A 3VF4A 1D9DA 3LZJA 4C1NI 3FZLA 2A1SA 3DLGA 4FL9A 2GUIA 4GV6A 2F96A 3FFKB 2YHBA 5HL7L 4E1JA 4MDAA 4M7YA 5DM7L 4DTXA 1BOTO 3RSEA 1R0AA 3DRSA 3JYTA 1YJ9N 5J1EA 1SKRA 3ZT3A 4FJXA 1TKTA 4FJIA 2O8CA 5F1XA 4EP5A 1BCOA 1X3NA 3HJFA 2ZJRL 2E1ZA 4NCBA 3QLHA 3B6PA 1OH5A 2W40A 1CXQA 3M6GA 1DT9A 4QS7A 4FLYA 1QZ5A 1W0HA 3BUZB 2WC9A 1O13A 4DR7K 4CZMA 1SZ2A 1OVQA 5AFUA 4KHWA 1HNXK 4FJMA 3AVAA 3I8DA 3H1QA 2Q3SA 1TL3A 1EWQA 1J9AA 2QKKA 4W5TA 3KK3A 3MXIA 3KTQA 3LP3A 2Z1GA 1N32K 2O4IA 1NGJA 3OHRA 5BREA 1IV0A 4CFBA 2HBLA 1WSFA 4F8RA 1VQPN 4DQPA 4CJWA 1RDDA 4KTZA 3C6TA 1ASWA 3O6WA 4Q0BA 3TSUA 4DFJA 4DTMA 3MN6A 4B3TK 1NWKA 3VQ8A 3O3HA 1U47A 4GW6A 2VQEK 4CHPA 3HRGA 3G0ZA 3VQ5A 3SPYA 1IBKK 4CFDA 2HSTA 1KFSA 3NMUA 3O9TA 4PKHA 3BZKA 1B92A 4LFCK 1J5EK 2X6SA 2YKMA 3EO3A 3PLAA 3VGKA 4BREA 3CQYA 2HVHA 3IDHA 4C8MA 4F3OA 2HHXA 3CCVN 4FZZA 1Z26A 3KK7A 4DWIA 1EWRA 4BC2A 3SMPA 4EZ9A 3K58A 1YVUA 3CPEA 2Q0UA 1HUXA 4DQRA 2AA4A 4WYBA 3SAFA 2UXBK 1YF5L 2B5JA 2FBXA 5C25A 4GY2B 4FPAA 3T1HK 3UE5A 3A5MC 1VQ7N 3SJJA 1NK7A 3CCEN 2PBDA 2P9PA 5AQQA 3J8AA 4JI3K 3UKRB 1NG9A 2V51B 4CZGA 3SUOA 4BWJA 5CY4A 4KTWA 5KPTA 3O8MA 4N41A 1J54A 3AGKA 3T7ZA 4EHUA 3CC2N 3TAMA 1S9GA 3KLIA 3QINA 4M42A 3WT0A 2DPNA 1SS6A 5BR9A 1CZBA 4BE2A 4IFEA 1DTQA 3QNOA 1YUWA 3WXIA 2HHVA 4CIFA 3T69A 3S41A 2VWJA 1RT5A 1H1VA 2IOCA 3DXMB 4CJKA 1RDBA 2BUPA 1QQOA 3HVTA 3MMVA 3P38A 2NNWA 1S1WA 2X6NA 4JKFA 2YI1A 1VSDA 4M3TA 1VQ5N 3CYMA 2CH5A 4KI4A 3D7EO 3BEXA 4YOTA 1VQ4N 3KKSA 5GIPA 4FCYA 4HUGA 1YJWN 3BZCA 5JS1A 4FXDA 3VQQA 2OZMA 3AO4A 3SCXA 1EETA 3PSIA 4ID1A 1ILYA 1N8RO 2O8BA 1MWKA 3T3FA 2ASPA 2A6AA 3AVNA 3CG7A 3VTIA 4DFMA 1NKEA 2O8FB 2IC3A 2YNIA 1ZBFA 1Q86O 4H0VB 1KC8O 2YCHA 2UUCK 4AQYK 4EP4A 4CF2A 4BVPA 2O8DA 1BIZA 3ULEB 4I2PA 3OS0A 3SYZA 3S3NA 2ZJPL 2ZJQL 2OPSA 3CC4N 4Z4IA 4GKKK 1SL0A 2ETJA 5CHIA 4X62K 2WUSA 4JAXA 3DJCA 1TAUA 4CBXA 3IAYA 4JHDB 4ICLA 4NLBA 1GLLO 5LMNK 3TAFA 1NMDA 2QWMA 3M8SA 4FK2A 1GLBG 3SK3A 3K9JA 1X9MA 1TKZA 5BPMA 3CF5L 2G8WA 5AQIA 2DFFA 3ZETB 4CJSA 1OH8A 2O4GA 2FBYA 1TYQB 1C0UA 3G25A 3FR0A 3WQTA 3NH1A 1YTUA 5AQKA 3UKUA 5ADXH 4JI4K 2IVPA 4MQ3A 4CJLA 3TI0A 2D0OA 2IS3A 3H3NO 2V52B 4FLZA 1UA0A 1KFDA 1BU6O 3K5MA 4FPBA 1NNEA 3CQXA 2HHTA 4GV3A 1JXBA 1U04A 1FK9A 3QFPA 3QIPA 3OA9A 4M3XA 1G15A 2FF3B 4OPJA 4CGJA 4MO5A 1NOZA 4CESA 3LDQA 2O8DB 4JI8K 2ASMA 4H5NA 1XC9A 1FJGK 3I56N 2JWLA 4I9QA 3VEOA 3KLFA 3AO2A 3FZHA 5E84A 2YHXA 2E20A 2HMPA 4IG0A 3FE1A 4LH5A 4RG8A 3KHYA 2P9NB 1HRHA 4G1QA 1JLCA 3ZETA 5C24A 2BDPA 2QI2A 1U49A 3THWA 3CMAN 4IG3A 2P9NA 1NGGA 3B6OA 3EKUA 3THYB 5AQVA 1RTHA 4DV2K 2VGMA 3WNHA 3P4IA 5JVGL 4WFNL 4DSFA 4YDUA 5BR8K 3T19A 4E7JA 3W3DA 5JLFA 5TKWA 1BG3A 4CFAA 3S3MA 1RTDA 3I0RA 4CZHA 2Z1IA 4BC4A 3EE8A 1V4TA 3U9DA 2E5LK 3CD6N 4FVMA 1XNRK 2FBVA 1MU2A 4BDZA 1QSLA 3CIPA 3NH0A 3ULDA 4WQ4C 2UUBK 3C6AA 3HI0A 5AQLA 4CE9A 1N6QA 1TV6A 4ILHA 1EKEA 1W97L 1YXQA 1GLAG 4HWIA 4I6MA 1O1WA 2FSKA 1ZBHA 2QWQA 4U7BA 5F2RA 4IO9L 4CEZA 4I7FA 4BRMA 4HUFA 3SBTA 1HKBA 3MX5A 1KVCA 1SV5A 3NE6A 4K43A 3A5NC 2P9UA 4CIGA 3BY5A 3LP2A 4BR5A 5HP1A 5SZTA 4X66K 3SQ0A 1JJ2M 2A41A 2PAVA 3TSPA 1XMOK 1FKOA 3SQ2A 1HR0K 3QBWA 3DLLL 1UAXA 3WNEA 1BQMA 3EKSA 1EQYA 1WN7A 3I55N 4KPYA 3VA0A 4CCHA 2G8HA 1UWBA 3SNNA 2UU9K 5GAHP 4AHTA 1NK0A 5KQ8A 4IO8A 1ZBUA 3HL8A 2XY5A 1MA9B 4KKOA 1BQNA 3NGZA 5EX5A 4GV9A 4CZJA 3UIQA 3VQ6A 1HYSA 1Y97A 3V1RA 1WB9A 1BWFO 1VRTA 4BQZA 4HVJA 3HT3A 4YOVA 4DU1A 2ZWHA 2HMIA 1ZBSA 3VQ4A 4WQ4A 3QERA 1XI1A 4R5PA 4BROA 4JI2K 4W5QA 1U2VA 1RTJA 4FM0A 2QXFA 4FWSA 4L3QA 4WQ5C 1ZBLA 1HKCA 4KHSA 1K6YA 5EU7A 1JLFA 1NJIO 2QWOA 1U2VB 2FF6A 4B3MK 4BRHA 3QIOA 3L3UA 4IXCA 3L2UA 4BRAA 1CXUA 4CEFA 1VQON 4DTUA 4IJAA 4YOUA 5M1OA 2P5GA 4KTQA 2XY8A 4NLCA 1KAYA 3QB0A 4H5WA 3ZSVA 2E6MA 3ZSWA 3DLBA 3TANA 4AHRA 3C0BA 4H0XB 3CJAA 2G8KA 4IFYA 4IZ9A 4BRKA 4FJHA 4KH6A 1JCFA 3CXCM 1ATSA 2RKIA 4B08A 4JKBA 3EZWA 1A5XA 4XIUA 1RBTA 3O4NA 4NYNA 2O8EB 2IGIA 5AZIB 3HXMA 4JKGA 1WLJA 1C1AA 3AAPA 4PKIA 4LH4A 1T03A 1DLOA 2VYPA 5DK5A 5AQUA 4E7KA 1ZYQA 1OH6A 3JXUA 4PHTX 2Q1NA 1GLDG 4A5BA 2G8FA 1MWMA 3DOLA 4QCLA 4DTNA 3EN9A 1WSHA 3U6FA 3P5JA 3SZ2A 3ASMA 3DXKA 4DQIA 5DM6L 3DMJA 4BR2A 3K5LA 1NK8A 1XC3A 1JXEA 3TR8A 4W5OA 3QETA 2PYJA 1VSIA 2KZZA 5T7BA 3AA4A 5BPNA 3I8BA 1BO5O 3K9KA 3TAEA 3QNNA 2UXDK 5AQTA 1VQKN 3LALA 2P9SB 1BA0A 5KTQA 4YOYA 4K8XA 2Q36A 2QW9A 1RT1A 4O0JA 3R8EA 3L2WA 3OS2A 3DLEA 1QTMA 1QQCA 3AO5A 5AZJB 3THWB 3Q7CA 2KW4A 1NU0A 3P31A 3QEPA 1KRPA 3TTDA 3SV3A 3IG1A 4DR2K 1S3XA 3AO1A 4O44A 4E1MA 2YHYA 4DMNA 4C23A 2HOEA 3WXLA 4LF7K 4FJLA 3MWPA 5E41A 3OS1A 1J6ZA 3P39A 3SLCA 3G4SN 4CW7B 5FLXO 3ZSZA 2JWKA 3THVA 4QOZB 1IKVA 5J2QA 1X9JA 4O55A 3QBXA 3CCUN 5I9EB 4FZXC 3K5NA 3WNGA 3V4IA 1BI4B 2RPIA 3V6DA 4B9LA 3KZBA 4TSXA 1YTAA 3C6HA 5KI6A 4ELTA 4JI7K 3KWGA 2PYLA 4B9VA 4CK2A 4IBNA 2IVOA 3HYFA 1Q82O 3GE1A 1Q9YA 1WAJA 3KIOA 1UA1A 2D0PA 5GADP 1KXPA 5KPZA 4FYDA 4BC3A 5A2QO 2O8BB 3BGRA 1JL1A 2E2PA 3VESA 4J2EA 4Y0WA 2NZTA 4DHYA 1RTIA 4E1NA 1JCGA 4AILC 3O3FA 3SMSA 4CZIA 4LF6K 1Q81O 4KHPK 2E4LA 4H4MA 4KFBA 3HM8A 2PFUA 2FLOA 2VWBA 3P1GA 4M3ZA 1CZAN 1ZXOA 4CK3A 3VEVA 4N5SA 1D8YA 4JEPA 4PWDA 4DU4A 1NJWA 3BF3A 2OTLN 1RILA 4JKCA 3MCAB 2QTDA 4IDHA 4X65K 4PA1A 4CEBA 1KD1O 1EX4A 4IDKA 4DR1K 1LOTB 5CZ2A 1QQNA 2QKBA 3VEWA 3CCLN 3AVMA 4DV3K 2P9LA 4JK9A 4F4KA 2BGGA 5LY3A 5GAGP 4KBOA 1EO1A 3ZYYX 3MX2A 4RTFD 4RW7A 3VTHA 3G6EN 4B1YB 3KLHA 4AHUA 1Q18A 1TL1A 4BE0A 3V1QA 2IAJA 1A5WA 3MCPA 2KLAA 5I42A 5CYQA 3LDSA 4OLAA 1ITGA 4KB0A 2XY7A 4HUEA 5AQZA 4CK1A 1ATNA 4CF9A 3CI5A 3ZSRA 1L3TA 2PY5A 3HVRA 1Z6RA 2Q31A 4BR7A 4BRDA 4ZTJA 4ILGB 1TVRA 3LPTA 4IFVA 1XHXA 2KHOA 4CJVA 4CFCA 1HQEA 4H8KA 1VRUA 2ITMA 3UKUB 3KWIA 3MEDA 2CH6A 5GIOA 1B9FA 5TKYA 3NVMA 1RT3A 1VQ8N 3DXKB 1VHXA 3IS9A 1NGIA 3EYZA 2E6LA 3LWLA 4M3UA 3AGRA 1YI2N 2VWKA 4CZFA 4WCEL 1XNQK 3L8BA 2PZSA 2DTUA 1IKXA 5KGWA 2OZSA 3ZX3A 3VF2A 4O8KA 3AVKA 4IKFA 4YNQA 4YORA 4FK0A 1NGBA 4DV4K 1XQSC 4CVNE 5ELZA 1DTTA 3MXMA 1G99A 2QWRA 3HM9A 4DFPA 5M1PA 3IRXA 4CGFA 4CF0A 2HNYA 3EZ5A 3V1OA 4ZTFA 3RRHA 5J2NA 3RWUA 4FWPA 2HBMA 4KH5A 3KD5E 3OYLA 4W5RA 3JSMA 1XMQK 3IMXA 3TSQA 5HRNA 2HHQA 2FBTA 4LF5K 4CJEA 4FSVA 4CZEA 4FWNA 4DS5A 4DLEA 2P9IB 2F9TA 2G8VA 4QS9A 3NDKA 3UKRA 1M90O 4JNEA 4JS4A 2D0BA 1BUPA 2YNHA 3LL3A 3HSCA 3ZSXA 3L2VA 3WXJA 1NGCA 3T1AA 4Z94A 1HQUA 2HB5A 1ZBIA 2GUPA 4B1WB 1T05A 3R9PA 3SUPA 1BHLA 2XY6A 3JAMO 3TWHA 2ZGZA 4YFUA 3ULEA 2WBNA 3AVLA 1IO2A 4DF4A 2F7TA 3DXMA 5AQMA 4BR9A 1HMVA 3ZSYA 4CHZA 1R59O 1CLQA 4DCHA 5JICA 3NCIA 2F4VK 2OPQA 4BY9C 4KRFA 4AM6A 4B9SA 5BRFA 4DSLA 4KREA 4ISGA 3LAKA 4B1XB 3L0QA 1K8KA 4M3RA 1RBUA 3BP8A 4LF4K 4E3SA 3O3GA 3OW2M 1TK5A 4JI5K 3KK1A 3NHGA 1U45A 1T7PA 4E89A 1RT4A 1S1XA 1GLFO 1TKXA 3T1YK 1JLEA 1WSGA 3AA3A 4CJ3A 4B9UA 1E4GT 3O9QA 5AQHA 2YHWA 2HHUA 4JHDA 2NRVA 2GWJA 4FJ9A 1WSIA 4BRNA 3A5LC 1EXQA 4NO7A 4CEQA 2LSNA 2EWSA 2AJQA 2D0CA 1YAGA 4BRLA 5LJVA 2DFHA 4DKWA 1QVFM 2X78A 4B8AB 2A3ZA 4J2BA 3V9ZA 3OYHA 4DTOA 5GAEP 4DS4A 1TK0A 1KAZA 3PX4A 3F73A 3EE9A 3F5TA 1FW6A 4KB1A 4CECA 2HNDA 5KGXA 2VG7A 3ZCMA 3CJBA 3OJUA 3C7NA 4OPKA 4FOIA 4NCGA 1KTQA 1RDAA 4IWVA 1QHAA 1E4FT 2Q0RA 3A5OC 3LPUA 3SUNA 3ATUA 1P8ZA 2E8AA 4CZLA 4FJ5A 4OKKA 1I39A 3AVJA 3N4PA 1RBSA 4FJKA 1WUAA 2E2OA 2NLXA 2HHWA 3ZEUB 1W7AA 3NAEA 4DV6K 3AV9A 2QWLA 3K0SA 4GMJB 3SUQA 2BANA 4M41A 3MDQA 4OGEA 5ADXA 4LC9B 2UYTA 3PIOL 1K73O 3KJVA 3QO9A 1NK6A 5H1SQ 2P5OA 5FPEA 3E9OA 4PL8A 1VK0A 1YIJN 3J7ZO 1VQMN 5FPMA 3GDQA 4XH4A 4K41A 4CF1A 3OTOK 4JRQA 5AZIA 4J2AA 2YKNA 3PX0A 4B9MA 4ID5A 2B6AA 4XH1A 3CERA 4JK7A 1NGDA 4I6MB 1NK4A 4B3OA 5HLFA 3ZSQA 4A57A 4DSIA 4DUZK 3GOIA 4MLHA 5F0XA 3TAGA 1WBDA 4GKJK 5C0YA 3SQ4A 1D4XA 3CC7N 5C12A 5JVHL 2W41A 5AQRA 3OJSA 4DTPA 2CGKA 3VOVA 2I7PA 3THXA 3K57A 1SUQA 3FGUA 3AY9A 3HSTB 1QZ6A 3DM2A 2YNFA 4IOAL 3ISNC 2OA8A 3TTCA 5AQJA 4NYFA 5FDLA 3W0LA 2OTJN 4CGGA 3CJ7A 4IEIA 2BH1A 4J2DA 2I5JA 4BDYA 1BIUA 3OYJA 4O8UA 3D2FB 3NGYA 4MFBA 3LDLA 3PO5A 3M3ZA 1W2BM 3RRGA 2Z1HA 3IFRA 1DEJA 4BGAA 3KVGA 4IEEA 3I0SA 5CYMA 3QICA 1I3AA 2QEXN 1TGOA 2KTQA 3K59A 4FLUA 4MLEA 4OX9K 5AQNA 4AF1A 4LF9K 3AA2A 3L4IA 2ZQBA 2OYQA 3E01A 1S1UA 4OPHA 2QK9A 2A5XA 3ITHA 4CEEA 4IOCL 4FK4A 3CCMN 3PY8A 5C2FA 3CFPA 4ELUA 1IH7A 3DWLA 1DKGD 4LY7A 1VSEA 1Z25A 1VSFA 3QMLA 3MXJA 4EIAA 1MDUB 4M3WA 2QXLA 4MO4A 4AHSA 2HNZA 3QDKA 3CM6A 4DTSA 4LSNA 4O5BA 5C10A 1X3MA 2VG5A 3A8YA 3O08A 4RCHA 4H0TB 4EHTA 2A1RA 3VETA 5AQGA 4WFAL 4BRQA 3D0PA 1QS4A 2P9SA 4C8OA 2W42A 4JD2B 5AQYA 1NK9A 4PQUA 4CEAA 4CHOA 3CQ8A 4JI1K 3ZEUA 4C8NA 1I94K 2D0AA 4DF8A 1T6CA 3VQPA 5BRDA 4JKDA 1RT6A 1S5JA 3C95A 3PIPL 1HYZA 1JLQA 1LWFA 2J4RA 3DYAA 1Q8IA 3OY9A 3FFIA 4DV1K 4RWTA 2DFEA 3J80O 1KQSM 4L8RB 1VQ6N 2E2QA 4Y1DA 4FO0A 1RT2A 1IKWA 3LP0A 4B1VA 5LL6Z 3VQ7A 4M63C 3JS6A 3AAQA 4CBWA 4LFBK 1IBLK 3A2FA 3PSFA 2ZD1A 2FXUA 3TTFA 3KLGA 3WQUA 1C0TA 3G71N 3S9HA 3B8AX 5FRNA 2A42A 3GG4A 3PX6A 4JI0K 4V19S 1LW0A 4CJRA 3OYNA 4CHNA 5LJWA 2Z1JA 3MWTA 3ZX0A 4CJ4A 4NXMK 1GLEG 2O8FA 4E7HA 4BR0A 1HJOA 3WXMB 4WF9L 1VAZA 2ZM6K 1JLGA 4K0KK 1SQKA 4KHUA 5JLHA 4E19A 2UXCK 5KRTA 3VQBA 1RDWX 5HRSA 5EXWA 4GVEA 1Q7YO 2P51A 2UUAK 1WSJA 4UQGA 4F2RA 1NGFA 5IT9O 1XUPO 1S1VA 1BGXT 3RTVA 2NRTA 4X64K 1LW2A 3EL2A 3ZT4A 1HJRA 5HOOA 3R6MA 3OYGA 2RN2A 4CZKA 1WOQA 4LSLA 4JRPA 3E9PA 3LDPA 3VENA 3FZKA 3KD1E 1Y64A 5EVZA 1VSKA 4RW4A 4OO1J 3H45C 2HBKA 5KPRA 1NJYA 1RNHA 1SL1A 3N4QA 3NF8A 3K5OA 4YOXA 1UOCA 3U9ZA 3SAGA 4JLHA 1VSLA 3L2RA 4OKEA 3OYDA 1BI4A 2RHKA 1C1BA 3NF6A 4H03B 4JKEA 1K9MO 3FZFA 1WSEA 4DQQA 5K14A 4DV0K 4M3YA 1K8AO 3C7NB 2YHAA 5M1FA 4H0PA 2G8IA 1Q9XA 5IWAK 5AQFA 2XO7A 3O4WA 2F8SA 4FJGA 2FSJA 2NRWA 4HCCA 2QWPA 2VG6A 1ASUA 1TK8A 4PY5A 4AHVA 4DTRA 1OH7A 4JK8A 1QHTA 5EOYA 1HNZK 3HK2A 3VEZA 4DSKA 3DLRA 1GLCG 2JLEA 2ATQA 4WE1A 4H5VA 3H1VX 1RCHA 4BQLA 4FWKA 4BRPA 4BG9A 1SKWA 4CJFA 1RBVA 3S3OA 3HPGA 2KKZA 3TABA 2XRIA 1QE1A 1NJZA 3VEXA 4RW9A 3HOSA 2P9PB 1GOCA 3ZT1A 3CJCA 5M1QA 3LDOA 4WFBL 3AVCA 1N36K 4R79A 3RMDA 3IKMA 1NOYA 1X9WA 4H4OA 1IJJA 5FPDA 2GEMA 4A2BA 4Z4EA 3BF1A 2BE2A 3UB5A 4I2QA 2B4JA 3AARA 2RE2A 1IBMK 3AVIA 2G8UA 1ATRA 3HPOA 3ZLJA 5FPNA 5SWMA 1FKPA 4CJTA 2KQ2A 3DAWA 1V4SA 4DSJA 3HPHA 4JYAK 4JKAA 3ID6A 1LWEA 4BRCA 4CBUA 4CGDA 2OPRA 4FZYA 1KVBA 1HNVA 2WTUA 4NXNK 1XWLA 4FW1A 2IDOA 2JGUA 4C1NK 4FWMA 4H0OA 4M45A 1T6DA 4AHCA 5MLCQ 3PO4A 2Y1IA 4JI6K 2ZF5O 5AQSA 1BL3A 4NB4A 1BA1A 1HLUA 2P9IA 4FM1A 3QEWA 5AQPA 4ISFA 1SAZA 4RW8A 3MEEA 3AVBA 4FVUA 4O4GA 2OCEA 2EX3A 1U6ZA 3CCQN 4GVMA 4B1UB 1L3UA 4OJRA 3LANA 3HP6A 4PL7A 4CF8A 4F3TA 4GNIA 4BRIA 1RFQA 4H5RA 3CETA 3RMCA 4DR6K 3H3OB 1VSMA 4ILJA 4A2AA 3LAMA 3QFUA 4PKGA 1HNIA 5J2PA 4FJ7A 4DFKA 3AVGA 5I3UA 4BVOA 1NMNA 1KAXA 3FLCO 4LF8K 1HNWK 1T3VA 1D5AA 2CGJA 4FWQA 4WQ5A 2ASOA 1M1KO 4W5NA 4A5AA 2Q97A 4JN4A 1N5YA 2EHGA 3O1WA 5FRMA 3HBTA 2YV0X 4PUOA 3NFAA 4BC5A 4HCBA 3U3GA 3KKRA 1HX1A 2X74A 4YHHK 3ALYA 4CHYA 5GINA 1NBWA 1TUYA 5LMUK 3VQDA 1YVNA 3NF9A 4ZHRA 4Z4HA 4OPAA 3J7AP 4CD1A 3LZIA 3F9KA 4QS8A 5FROA 5E26A 2E88A 5HRRA 3ATVA 3M8PA 1RGIA 3TPQA 3RR8A 1QQMA 1NM1A 4CGHA 4DUYK 4K42A 1BISA 3M8RA 2BTFA 2QA4N 3HO1A 3F2KA 3L3VA 4BWMA 3DOKA 1ESVA 3MK6A 1S6PA 3VQ9A 3CPWM 2FC0A 2RF2A 2P9KB 4BACA 3C94A 3VF6A 4H5TA 5HROA 5C15A 4BRFA 5KQDA 4CEDA 1L3SA 2F8TA 1T44A 1U4BA 2ZE2A 2HHSA 1NGAA 4ISEA 2ITGA 3WXKA 4B8CA 3J81O 2GTDA 3TAPA 3H6EA 3OYEA 1VQ9N 4N56A 1VSHA 1IKYA 2A40A 3NBPA 4JKHA 3OVNA 5D3GA 3RR7A 1LAWA 4BDPA 4FOEA 3LM2A 4K25A 4FM2A 4H0YB 1QVGM 2QWNA 4CHQA 5C2DA 4CERA 3O4QA 3L4QA 4ELVA 2D4WA 1GOAA 3HOTA 3V9XA 4CJUA 1CZ9A 4DB3A 3AVFA 2GBZA 4FWRA 3I33A 4Z4GA 4JV5K 1A5VA 3E9LA 3MEGA 4LD0A 4EAHD 1TAQA 1N33K 1KLMA 2NRZA 2HF4A 3VEYA 1WBBA 4FJNA 4CJQA 3OYIA 3HZ6A 3VN5A 2GELA 2D5RA 3ZSOA 2KFNA 3ZX2A 4CEOA 3AA5X 3OBYA 2WFBA 4Z0UA 3F9MA 1S9EA 1S22A 3EEQA 5M1NA 4FW2A 3LDNA 3NVKA 1ASVA 1LCUA 3H46O 4YDUC 4DR4K 4B9QA 5BPLA 4IOXA 3ZT0A 1JCEA 4RW6A 2NRXA 3L2QA 1T8EA 3E1YA 4FWOA 3OYFA 4DQ8A 4HHTA 1WAFA 3SAHA 4U67L 3QEVA 2P9LB 1RDCA 2VQFK 5AFUH 1SL2A 4A59A 4DV5K 3V9WA 1K8KB 4UY8O 2P9UB 3CHWA 3O5BA 2W6KA 3VGMA 5B8HA 2V7YA 4DLGA 4CGIA 1NGHA 4BG8A 1JLAA 3D2EA 3L6QA 3DRRA 4FJJA 2YNGA 4YOWA 3DLHA 1E3MA 2Q2RA 5J2MA 3MN9A 5BN9A 3OYCA 3VPZA 2Y1JA 3QESA 2YJEA 2DY4A 3VERA 4HTLA 5JS2A 3CCRN 3U3YA 2V7ZA 3LP1A 3U4LA 2XHBA 1NK5A 3VGLA 4CI6A 1LAVA 3PUFA 3V81A 1OKJA 4BR4A 3E66A 2NRHA 2IVNA 5DMRA 3RMBA 2NUBA 3LWMA 2I7NA 1IG8A 1OVYA 4YY3K 4B9NA 4EFHA 1YITN 1LV5A 2FSNA 1FXXA 3MAQA 4G9ZA 2KFZA 3R3LA 3RMAA 2YX6A 3CMEN 4OKJA 5AJ3K 3G10A 4XEIA 5HRPA 1DGKN 2ZGYA 1C0FA 3VQAA 2VGNA 3RVCA 5JMVA 1YHQN 3K2PA 3O9RA 3DRPA 2O8EA 4CJ5A 4KV8A 3ENHA 3VQEA 3TARA 1WNSA 5HBMA 4AM7A 4KI6A 1GOBA 1NLVA 3BDPA 4B3SK 4B1ZA 4J8FA 1VSJA 2GX9A 1XHZA 1L5UA 2D1KA 5EY4A 3QEIA 4I9LA 1JKHA 5BRHA 3GBTA 3AO3A 4FLTA 1U48A 2CGLA 4LFAK 2P1JA 2NRRA 1SKSA 4DQSA 3M8QA 4F2SA 1TUUA 1L3VA 1IG9A 3H08A 4AH9A 1HKGA 4FLWA 3QEXA 3THYA 1C1CA 3O1BA 2QM1A 3OBWA 3SI6A 2HVIA 2AP1A 4MDBA 3SQ1A 1EP4A 3ZT2A 3WEEA 4A61A 5AZJA 1C0GA 3Q7BA 3NF7A 3D2EB 2KZMA 3TAQA 1B9DA 3DI6A 4KHQA 1REVA 3WEEB 3D45A 3MN5A 4NCAA 5AR0A 1NKCA 3O9SA 3CM5A 4FLXA 3WNFA 3ENOA 2E1YA 3O9UA 3DLKA 1GLJO 2WOMA 3LM9A 3VMFB 1ZC6A 4CD3A 3SBGA 1W9HA 1BCMA 1KCFA 3MN7A 4FLVA 4E7LA 2HF3A 2VCPA 3PV8A 1HPMA 4B9TA 2H3GX 4E7IA 3CJ1A 5AQWA 3CFOA 5AQXA 3RSEB 3VA3A 3NGIA 1N34K 3EY1A 1F21A 4K8ZA 3M1FA 4IJNA 3IUCA 3R1XA 2GV9A 2P9KA 3KLEA 3D6RA 1S6QA 1VQLN 1NJXA 2GWKA 4FWLA 2E2NA 3CCSN 4B3RK 5KRSA 3THXB 1RDUA 4DSEA 4DV7K 1QSSA 1JL2A 3OYKA 1YT3A 4KO0A 1RBRA 1KVAA 4N76A 2YJFA 2HBJA 1S72N 4DR5K 3M5RA 3FZMA 5M1KA 1YJNN 4EZ6A 4JD2A 4CJ7A 2R7YA 1RT7A 4DG1A 4KHNA 3OYBA 4Q5VA 4KAZA 4KHYA 1VQNN 2OPPA 4O5FA 4JS5A 2OANA 4O0IA 3NH2A 3V9UA 3C65A 5AQOA 1JLBA 4HTUA 2IIRA 1J53A 3MECA 2HHHK 3OYMA 3J7YP 1HPZA 3D2FA 4F9OA 1X1PA 1LWCA 1HYVA 3O80A 4C8KA 4Y1CA 3CFRA 4C8LA 1KSPA 4KH4A 1NKBA 4BRGA 1KLNA 2F9WA 3ENBA 5CR4A 1NGEA 2O8CB 3HTVA 4N47A 4DU3A 4DR3K 3V9SA 4Z4FA 4BGBA 5CE3A 1QSYA 4CJPA 5BN8A 3A0IX 1TKDA 1C6VA 4CIEA 3ID8A 1X9SA 3SPZA 3KK2A 1S1TA 3OYAA 2HW3A 3SV4A 5C42A 4E0DA 3AVHA 4Z4CA 4OVLA 3CCJN 3TU5A 5CZ1A 4OLBA 4JKGB 3HP9A 3CJ9A 3WUHA 1P90A 3P83D
chains in the Genus database with same CATH topology
1U6ZA 4GV9A 4M7XA 4CZJA 3CCQN 4A62A 1YAGA 4BRLA 5LJVA 3SJHA 4DKWA 1Z05A 4B1UB 1TYQA 1QVFM 2A3ZA 3U8XA 4PL7A 1BWFO 3GL1A 4GNIA 1BDGA 5GAEP 4BRIA 1RFQA 1KAZA 4XH5A 4H5RA 3CETA 3VF4A 4BQZA 3H3OB 4YOVA 4C1NI 3EE9A 3FZLA 4FL9A 3F5TA 4ILJA 4A2AA 3QFUA 4GV6A 2ZWHA 3FFKB 4PKGA 5HL7L 1ZBSA 4E1JA 4MDAA 4WQ4A 4M7YA 3CJBA 5DM7L 3C7NA 1BOTO 3RSEA 4BROA 4FOIA 4BVOA 1U2VA 1KAXA 3FLCO 1QHAA 1E4FT 2Q0RA 3A5OC 4IWVA 1T3VA 4FWSA 4L3QA 2CGJA 4WQ5C 4FWQA 3ATUA 4WQ5A 2ASOA 1HKCA 1YJ9N 1M1KO 4A5AA 1P8ZA 2E8AA 2Q97A 4JN4A 4CZLA 5F1XA 3O1WA 1NJIO 2QWOA 1X3NA 3N4PA 1U2VB 3HBTA 2FF6A 1WUAA 2E2OA 2NLXA 2ZJRL 3ZEUB 4BRHA 2E1ZA 4IXCA 4BC5A 4BRAA 1HX1A 1VQON 2W40A 2QWLA 5GINA 1NBWA 3M6GA 4IJAA 1DT9A 4QS7A 4YOUA 5M1OA 4NLCA 1KAYA 1YVNA 3MDQA 5ADXA 1QZ5A 3QB0A 4H5WA 4LC9B 4OPAA 2UYTA 3BUZB 4CD1A 3PIOL 1K73O 2WC9A 1O13A 4CZMA 1SZ2A 3C0BA 4H0XB 5H1SQ 3CJAA 5AFUA 5FPEA 3E9OA 4PL8A 4QS8A 1YIJN 3J7ZO 4IZ9A 5E26A 2E88A 4BRKA 3H1QA 3ATVA 4KH6A 1VQMN 5FPMA 3GDQA 1JCFA 1RGIA 4K41A 4XH4A 1ATSA 3TPQA 1QQMA 3CXCM 1NM1A 3EZWA 4JKBA 5AZIA 4K42A 5AZIB 2BTFA 4JKGA 2QA4N 3F2KA 3AAPA 4PKIA 4XH1A 1ESVA 1NGJA 3CERA 3MK6A 1NGDA 3OHRA 2VYPA 4I6MB 4JK7A 5BREA 5AQUA 3JXUA 2HBLA 4PHTX 2Q1NA 3CPWM 1GLDG 4A5BA 1VQPN 2P9KB 4A57A 1MWMA 3VF6A 3GOIA 4MLHA 4H5TA 5F0XA 3EN9A 5C15A 3DXKA 4BRFA 3O6WA 5DM6L 5KQDA 4BR2A 3TSUA 1XC3A 1T44A 3MN6A 5C0YA 1NGAA 1D4XA 4ISEA 3WXKA 3CC7N 1NWKA 5C12A 5BPNA 2GTDA 3H6EA 5JVHL 2W41A 3I8BA 5AQRA 1VQ9N 2CGKA 3VOVA 1BO5O 2I7PA 3K9KA 3HRGA 2A40A 4JKHA 3FGUA 3AY9A 5AQTA 2HSTA 3LM2A 4FOEA 1VQKN 4K25A 3NMUA 3O9TA 1QZ6A 2P9SB 1BA0A 4PKHA 4H0YB 4IOAL 3TTCA 5AQJA 1QVGM 3W0LA 4YOYA 2QWNA 3EO3A 2OTJN 2Q36A 3PLAA 2QW9A 3VGKA 5C2DA 4BREA 3CQYA 3CJ7A 4IEIA 3L4QA 3IDHA 3R8EA 2BH1A 2D4WA 3HOTA 3CCVN 5AZJB 4DB3A 3KK7A 4FWRA 4O8UA 3I33A 3Q7CA 3D2FB 3E9LA 3P31A 3LDLA 4BC2A 3SMPA 3TTDA 3M3ZA 4EAHD 1W2BM 3CPEA 3IFRA 1DEJA 1HUXA 2NRZA 2HF4A 2AA4A 2Q0UA 3VEYA 3KVGA 4WYBA 1S3XA 3HZ6A 2GELA 4BGAA 4IEEA 1YF5L 3SAFA 3ZX2A 3QICA 4GY2B 4FPAA 2QEXN 3OBYA 2WFBA 3F9MA 2YHYA 3UE5A 1S22A 4C23A 5M1NA 2HOEA 4MLEA 3A5MC 5AQNA 3WXLA 1VQ7N 4AF1A 3LDNA 3NVKA 3MWPA 3L4IA 1LCUA 3H46O 3CCEN 1J6ZA 4YDUC 3P39A 3SLCA 3G4SN 4OPHA 2A5XA 2PBDA 2P9PA 4B9QA 5AQQA 5BPLA 3J8AA 4IOXA 4IOCL 1JCEA 3UKRB 3CCMN 2NRXA 2JWKA 2V51B 4CZGA 5C2FA 5KPTA 3E1YA 3O8MA 3DWLA 4FWOA 4DQ8A 1DKGD 1X9JA 4EHUA 3AGKA 3QBXA 3T7ZA 3SAHA 4U67L 5I9EB 3CCUN 3CC2N 3QMLA 2P9LB 5AFUH 4A59A 3KZBA 4EIAA 1K8KB 1MDUB 4UY8O 2P9UB 3C6HA 3CHWA 2QXLA 3O5BA 4MO4A 3VGMA 3WT0A 5B8HA 3QDKA 2DPNA 1SS6A 2V7YA 3KWGA 5BR9A 5C10A 1X3MA 1NGHA 3A8YA 3O08A 4IFEA 4BG8A 1YUWA 3D2EA 3L6QA 2IVOA 3WXIA 4RCHA 4YOWA 3GE1A 1Q82O 3T69A 3S41A 2Q2RA 3MN9A 2D0PA 5GADP 1KXPA 5KPZA 1H1VA 4H0TB 3DXMB 5BN9A 4BC3A 3VPZA 4EHTA 2E2PA 3VESA 2BUPA 1QQOA 3VETA 5AQGA 2YJEA 4WFAL 4BRQA 3MMVA 2NZTA 4Y0WA 3VERA 4DHYA 2P9SA 4HTLA 3P38A 1JCGA 2NNWA 2V7ZA 3CCRN 4JD2B 5AQYA 3U4LA 3SMSA 3VGLA 4CI6A 4CZIA 1Q81O 1OKJA 4JKFA 4BR4A 2YI1A 3E66A 3ZEUA 2NRHA 2IVNA 1VQ5N 2CH5A 1T6CA 3HM8A 3D7EO 3BEXA 2PFUA 2FLOA 4YOTA 5BRDA 4JKDA 2I7NA 1IG8A 1OVYA 1VQ4N 2VWBA 5GIPA 4EFHA 1CZAN 1ZXOA 1YJWN 1YITN 3VEVA 2FSNA 3PIPL 2J4RA 4JEPA 4G9ZA 3BF3A 3R3LA 4RWTA 1KQSM 2OTLN 2YX6A 3CMEN 1VQ6N 1N8RO 1ILYA 4XEIA 2E2QA 4FO0A 1DGKN 1MWKA 4JKCA 2ZGYA 4B1VA 2ASPA 2A6AA 1C0FA 3MCAB 2QTDA 4M63C 3JS6A 2VGNA 3AAQA 4IDHA 3RVCA 3VTIA 4CBWA 5JMVA 1KD1O 1YHQN 3O9RA 2FXUA 3TTFA 3WQUA 1LOTB 3G71N 1QQNA 3B8AX 3ENHA 4H0VB 3VEWA 1Q86O 2YCHA 1KC8O 2A42A 3GG4A 3CCLN 5LJWA 2P9LA 3MWTA 4JK9A 1NLVA 3ZX0A 4AM7A 5LY3A 4B1ZA 5GAGP 4BVPA 4J8FA 4KBOA 2GX9A 1EO1A 1GLEG 3ZYYX 2D1KA 5EY4A 3MX2A 4RTFD 3ULEB 3VTHA 3G6EN 2ZJPL 2ZJQL 5BRHA 3CC4N 3GBTA 4BR0A 1HJOA 2CGLA 4B1YB 3WXMB 2NRRA 4WF9L 1VAZA 5CHIA 1SQKA 2WUSA 4JAXA 1TUUA 5JLHA 3DJCA 1Q18A 4CBXA 4JHDB 1HKGA 1GLLO 4NLBA 1RDWX 5EXWA 1NMDA 2QWMA 4GVEA 1Q7YO 3MCPA 1GLBG 2KLAA 3O1BA 2QM1A 3OBWA 3SK3A 1NGFA 3K9JA 1XUPO 2AP1A 5BPMA 4MDBA 3CF5L 3WEEA 2NRTA 5AQIA 3EL2A 5AQZA 4A61A 1ATNA 3ZETB 5AZJA 5HOOA 1C0GA 3Q7BA 3R6MA 3CI5A 1TYQB 3D2EB 4CZKA 3G25A 3FR0A 1WOQA 1Z6RA 2Q31A 3WQTA 3WEEB 4BR7A 3MN5A 5AQKA 3UKUA 5AR0A 5ADXH 3E9PA 3LDPA 3O9SA 3FZKA 3VENA 1Y64A 2IVPA 4BRDA 5EVZA 4OO1J 3H45C 3ENOA 2E1YA 2HBKA 5KPRA 2D0OA 3O9UA 3H3NO 1GLJO 4ILGB 2V52B 3N4QA 1BU6O 4YOXA 3LM9A 2KHOA 3VMFB 4FPBA 3CQXA 4GV3A 2ITMA 1ZC6A 3UKUB 3U9ZA 3KWIA 3SAGA 4CD3A 3SBGA 3QFPA 2CH6A 5GIOA 3OA9A 5TKYA 3NVMA 2FF3B 3MN7A 2RHKA 2HF3A 4JKEA 4H03B 1VQ8N 2VCPA 1HPMA 3DXKB 4MO5A 2H3GX 1K9MO 3FZFA 3CJ1A 3LDQA 5AQWA 1NGIA 2ASMA 5AQXA 3AGRA 3RSEB 4H5NA 1K8AO 1YI2N 3C7NB 4CZFA 4WCEL 5M1FA 4H0PA 3I56N 2JWLA 5AQFA 3M1FA 3O4WA 4IJNA 3VEOA 2FSJA 3ZX3A 3IUCA 3VF2A 3R1XA 2P9KA 3FZHA 5E84A 4O8KA 2YHXA 2NRWA 3D6RA 2E20A 4YORA 1VQLN 2HMPA 3FE1A 2GWKA 1NGBA 4FWLA 3KHYA 1XQSC 2E2NA 2QWPA 5ELZA 3CCSN 1G99A 2P9NB 2QWRA 4JK8A 3ZETA 5M1PA 5EOYA 2QI2A 1RDUA 3VEZA 1GLCG 3CMAN 4H5VA 3H1VX 4BQLA 4FWPA 2HBMA 2P9NA 1NGGA 4KH5A 4FWKA 4BRPA 3IMXA 3TSQA 3EKUA 4BG9A 2YJFA 5AQVA 2HBJA 4FSVA 1S72N 2VGMA 3M5RA 3P4IA 3FZMA 4CZEA 2KKZA 4FWNA 5M1KA 4WFNL 5JVGL 1YJNN 4YDUA 3VEXA 2P9IB 2F9TA 4QS9A 3UKRA 3W3DA 5JLFA 2P9PB 3HOSA 1M90O 4JD2A 4JNEA 4CJ7A 1BUPA 5TKWA 1BG3A 3LL3A 3CJCA 5M1QA 3HSCA 3LDOA 4WFBL 4R79A 4CZHA 4O5FA 3WXJA 1VQNN 3IKMA 2OANA 1NGCA 1IJJA 3EE8A 4BC4A 1V4TA 3U9DA 5FPDA 3C65A 5AQOA 2GEMA 4A2BA 3CD6N 4Z94A 3BF1A 2IIRA 3CIPA 3UB5A 2GUPA 4B1WB 3AARA 3R9PA 2RE2A 4WQ4C 2ZGZA 3C6AA 3HI0A 5AQLA 3ULEA 3D2FA 2WBNA 4F9OA 4ILHA 1W97L 1ATRA 1YXQA 2F7TA 3DXMA 1GLAG 5AQMA 5FPNA 4BR9A 4HWIA 4I6MA 3DAWA 2FSKA 2QWQA 3O80A 5F2RA 4U7BA 4IO9L 1V4SA 1R59O 4BRMA 4DCHA 5JICA 3SBTA 1HKBA 4BY9C 3MX5A 4JKAA 4AM6A 5BRFA 3ID6A 4ISGA 4K43A 3A5NC 3L0QA 2P9UA 4B1XB 1K8KA 4KH4A 4BRCA 4CBUA 3BP8A 4BRGA 4BR5A 3OW2M 2F9WA 1JJ2M 3ENBA 2A41A 4C1NK 4FWMA 1GLFO 4H0OA 2PAVA 5CR4A 3TSPA 1NGEA 1T6DA 3QBWA 5MLCQ 3DLLL 3HTVA 2ZF5O 5AQSA 3EKSA 1E4GT 1EQYA 4BGBA 5CE3A 3I55N 3O9QA 3A0IX 5AQHA 4NB4A 5BN8A 1BA1A 1HLUA 2YHWA 3ID8A 4JHDA 2P9IA 2NRVA 5AQPA 4ISFA 2GWJA 4BRNA 5GAHP 3A5LC 1SAZA 5KQ8A 4IO8A 3CCJN 3TU5A 4FVUA 4NO7A 1MA9B 4JKGB 3CJ9A 3WUHA 1P90A 2EWSA 1TUYA 5EX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ N;  4IOA L;  3CCS N;  1QVG M;  1KD1 O;  1YHQ N;  1QVF M;  2OTJ N;  3G71 N;  1Q86 O;  1KC8 O;  5GAE P;  3CMA N;  3CCL N;  3CCV N;  5GAG P;  5HL7 L;  1W2B M;  1S72 N;  3G6E N;  2ZJP L;  2ZJQ L;  5JVG L;  3CC4 N;  4WFN L;  5DM7 L;  1YJN N;  1M90 O;  2QEX N;  4WF9 L;  1M1K O;  1YJ9 N;  1VQ7 N;  4WFB L;  1VQN N;  3CCE N;  3G4S N;  1NJI O;  3CD6 N;  4IOC L;  1Q7Y O;  2ZJR L;  3CCM N;  1VQO N;  3CF5 L;  3CCU N;  4U67 L;  3CC2 N;  3PIO L;  1K73 O;  4UY8 O;  5H1S Q;  1YIJ N;  4IO9 L;  3J7Z O;  1VQM N;  3CXC M;  1Q82 O;  5GAD P;  2QA4 N;  4WFA L;  3OW2 M;  1JJ2 M;  3CCR N;  3CPW M;  1Q81 O;  1VQP N;  5MLC Q;  3DLL L;  1VQ8 N;  1VQ5 N;  1K9M O;  3I55 N;  1VQ4 N;  5DM6 L;  1OVY A;  1YJW N;  1K8A O;  1YI2 N;  1YIT N;  4WCE L;  3CC7 N;  3PIP L;  3I56 N;  5GAH P;  5JVH L;  1VQ9 N;  3CCJ N;  1KQS M;  2OTL N;  3CME N;  1VQ6 N;  1N8R O;  1ILY A;  1VQL N;  1VQK N; 
#chains in the Genus database with same CATH topology
 3C6U A;  4DTJ A;  2W6L A;  4M7X A;  4OGC A;  2WON A;  4A62 A;  3SJH A;  1Z05 A;  1D9F A;  1TYQ A;  4QAG A;  3U8X A;  4BE1 A;  1J5O A;  3GL1 A;  1C0M A;  4FJ8 A;  1BDG A;  3VQC A;  4XH5 A;  3VF4 A;  1D9D A;  3LZJ A;  4C1N I;  3FZL A;  2A1S A;  3DLG A;  4FL9 A;  2GUI A;  4GV6 A;  2F96 A;  3FFK B;  2YHB A;  5HL7 L;  4E1J A;  4MDA A;  4M7Y A;  5DM7 L;  4DTX A;  1BOT O;  3RSE A;  1R0A A;  3DRS A;  3JYT A;  1YJ9 N;  5J1E A;  1SKR A;  3ZT3 A;  4FJX A;  1TKT A;  4FJI A;  2O8C A;  5F1X A;  4EP5 A;  1BCO A;  1X3N A;  3HJF A;  2ZJR L;  2E1Z A;  4NCB A;  3QLH A;  3B6P A;  1OH5 A;  2W40 A;  1CXQ A;  3M6G A;  1DT9 A;  4QS7 A;  4FLY A;  1QZ5 A;  1W0H A;  3BUZ B;  2WC9 A;  1O13 A;  4DR7 K;  4CZM A;  1SZ2 A;  1OVQ A;  5AFU A;  4KHW A;  1HNX K;  4FJM A;  3AVA A;  3I8D A;  3H1Q A;  2Q3S A;  1TL3 A;  1EWQ A;  1J9A A;  2QKK A;  4W5T A;  3KK3 A;  3MXI A;  3KTQ A;  3LP3 A;  2Z1G A;  1N32 K;  2O4I A;  1NGJ A;  3OHR A;  5BRE A;  1IV0 A;  4CFB A;  2HBL A;  1WSF A;  4F8R A;  1VQP N;  4DQP A;  4CJW A;  1RDD A;  4KTZ A;  3C6T A;  1ASW A;  3O6W A;  4Q0B A;  3TSU A;  4DFJ A;  4DTM A;  3MN6 A;  4B3T K;  1NWK A;  3VQ8 A;  3O3H A;  1U47 A;  4GW6 A;  2VQE K;  4CHP A;  3HRG A;  3G0Z A;  3VQ5 A;  3SPY A;  1IBK K;  4CFD A;  2HST A;  1KFS A;  3NMU A;  3O9T A;  4PKH A;  3BZK A;  1B92 A;  4LFC K;  1J5E K;  2X6S A;  2YKM A;  3EO3 A;  3PLA A;  3VGK A;  4BRE A;  3CQY A;  2HVH A;  3IDH A;  4C8M A;  4F3O A;  2HHX A;  3CCV N;  4FZZ A;  1Z26 A;  3KK7 A;  4DWI A;  1EWR A;  4BC2 A;  3SMP A;  4EZ9 A;  3K58 A;  1YVU A;  3CPE A;  2Q0U A;  1HUX A;  4DQR A;  2AA4 A;  4WYB A;  3SAF A;  2UXB K;  1YF5 L;  2B5J A;  2FBX A;  5C25 A;  4GY2 B;  4FPA A;  3T1H K;  3UE5 A;  3A5M C;  1VQ7 N;  3SJJ A;  1NK7 A;  3CCE N;  2PBD A;  2P9P A;  5AQQ A;  3J8A A;  4JI3 K;  3UKR B;  1NG9 A;  2V51 B;  4CZG A;  3SUO A;  4BWJ A;  5CY4 A;  4KTW A;  5KPT A;  3O8M A;  4N41 A;  1J54 A;  3AGK A;  3T7Z A;  4EHU A;  3CC2 N;  3TAM A;  1S9G A;  3KLI A;  3QIN A;  4M42 A;  3WT0 A;  2DPN A;  1SS6 A;  5BR9 A;  1CZB A;  4BE2 A;  4IFE A;  1DTQ A;  3QNO A;  1YUW A;  3WXI A;  2HHV A;  4CIF A;  3T69 A;  3S41 A;  2VWJ A;  1RT5 A;  1H1V A;  2IOC A;  3DXM B;  4CJK A;  1RDB A;  2BUP A;  1QQO A;  3HVT A;  3MMV A;  3P38 A;  2NNW A;  1S1W A;  2X6N A;  4JKF A;  2YI1 A;  1VSD A;  4M3T A;  1VQ5 N;  3CYM A;  2CH5 A;  4KI4 A;  3D7E O;  3BEX A;  4YOT A;  1VQ4 N;  3KKS A;  5GIP A;  4FCY A;  4HUG A;  1YJW N;  3BZC A;  5JS1 A;  4FXD A;  3VQQ A;  2OZM A;  3AO4 A;  3SCX A;  1EET A;  3PSI A;  4ID1 A;  1ILY A;  1N8R O;  2O8B A;  1MWK A;  3T3F A;  2ASP A;  2A6A A;  3AVN A;  3CG7 A;  3VTI A;  4DFM A;  1NKE A;  2O8F B;  2IC3 A;  2YNI A;  1ZBF A;  1Q86 O;  4H0V B;  1KC8 O;  2YCH A;  2UUC K;  4AQY K;  4EP4 A;  4CF2 A;  4BVP A;  2O8D A;  1BIZ A;  3ULE B;  4I2P A;  3OS0 A;  3SYZ A;  3S3N A;  2ZJP L;  2ZJQ L;  2OPS A;  3CC4 N;  4Z4I A;  4GKK K;  1SL0 A;  2ETJ A;  5CHI A;  4X62 K;  2WUS A;  4JAX A;  3DJC A;  1TAU A;  4CBX A;  3IAY A;  4JHD B;  4ICL A;  4NLB A;  1GLL O;  5LMN K;  3TAF A;  1NMD A;  2QWM A;  3M8S A;  4FK2 A;  1GLB G;  3SK3 A;  3K9J A;  1X9M A;  1TKZ A;  5BPM A;  3CF5 L;  2G8W A;  5AQI A;  2DFF A;  3ZET B;  4CJS A;  1OH8 A;  2O4G A;  2FBY A;  1TYQ B;  1C0U A;  3G25 A;  3FR0 A;  3WQT A;  3NH1 A;  1YTU A;  5AQK A;  3UKU A;  5ADX H;  4JI4 K;  2IVP A;  4MQ3 A;  4CJL A;  3TI0 A;  2D0O A;  2IS3 A;  3H3N O;  2V52 B;  4FLZ A;  1UA0 A;  1KFD A;  1BU6 O;  3K5M A;  4FPB A;  1NNE A;  3CQX A;  2HHT A;  4GV3 A;  1JXB A;  1U04 A;  1FK9 A;  3QFP A;  3QIP A;  3OA9 A;  4M3X A;  1G15 A;  2FF3 B;  4OPJ A;  4CGJ A;  4MO5 A;  1NOZ A;  4CES A;  3LDQ A;  2O8D B;  4JI8 K;  2ASM A;  4H5N A;  1XC9 A;  1FJG K;  3I56 N;  2JWL A;  4I9Q A;  3VEO A;  3KLF A;  3AO2 A;  3FZH A;  5E84 A;  2YHX A;  2E20 A;  2HMP A;  4IG0 A;  3FE1 A;  4LH5 A;  4RG8 A;  3KHY A;  2P9N B;  1HRH A;  4G1Q A;  1JLC A;  3ZET A;  5C24 A;  2BDP A;  2QI2 A;  1U49 A;  3THW A;  3CMA N;  4IG3 A;  2P9N A;  1NGG A;  3B6O A;  3EKU A;  3THY B;  5AQV A;  1RTH A;  4DV2 K;  2VGM A;  3WNH A;  3P4I A;  5JVG L;  4WFN L;  4DSF A;  4YDU A;  5BR8 K;  3T19 A;  4E7J A;  3W3D A;  5JLF A;  5TKW A;  1BG3 A;  4CFA A;  3S3M A;  1RTD A;  3I0R A;  4CZH A;  2Z1I A;  4BC4 A;  3EE8 A;  1V4T A;  3U9D A;  2E5L K;  3CD6 N;  4FVM A;  1XNR K;  2FBV A;  1MU2 A;  4BDZ A;  1QSL A;  3CIP A;  3NH0 A;  3ULD A;  4WQ4 C;  2UUB K;  3C6A A;  3HI0 A;  5AQL A;  4CE9 A;  1N6Q A;  1TV6 A;  4ILH A;  1EKE A;  1W97 L;  1YXQ A;  1GLA G;  4HWI A;  4I6M A;  1O1W A;  2FSK A;  1ZBH A;  2QWQ A;  4U7B A;  5F2R A;  4IO9 L;  4CEZ A;  4I7F A;  4BRM A;  4HUF A;  3SBT A;  1HKB A;  3MX5 A;  1KVC A;  1SV5 A;  3NE6 A;  4K43 A;  3A5N C;  2P9U A;  4CIG A;  3BY5 A;  3LP2 A;  4BR5 A;  5HP1 A;  5SZT A;  4X66 K;  3SQ0 A;  1JJ2 M;  2A41 A;  2PAV A;  3TSP A;  1XMO K;  1FKO A;  3SQ2 A;  1HR0 K;  3QBW A;  3DLL L;  1UAX A;  3WNE A;  1BQM A;  3EKS A;  1EQY A;  1WN7 A;  3I55 N;  4KPY A;  3VA0 A;  4CCH A;  2G8H A;  1UWB A;  3SNN A;  2UU9 K;  5GAH P;  4AHT A;  1NK0 A;  5KQ8 A;  4IO8 A;  1ZBU A;  3HL8 A;  2XY5 A;  1MA9 B;  4KKO A;  1BQN A;  3NGZ A;  5EX5 A;  4GV9 A;  4CZJ A;  3UIQ A;  3VQ6 A;  1HYS A;  1Y97 A;  3V1R A;  1WB9 A;  1BWF O;  1VRT A;  4BQZ A;  4HVJ A;  3HT3 A;  4YOV A;  4DU1 A;  2ZWH A;  2HMI A;  1ZBS A;  3VQ4 A;  4WQ4 A;  3QER A;  1XI1 A;  4R5P A;  4BRO A;  4JI2 K;  4W5Q A;  1U2V A;  1RTJ A;  4FM0 A;  2QXF A;  4FWS A;  4L3Q A;  4WQ5 C;  1ZBL A;  1HKC A;  4KHS A;  1K6Y A;  5EU7 A;  1JLF A;  1NJI O;  2QWO A;  1U2V B;  2FF6 A;  4B3M K;  4BRH A;  3QIO A;  3L3U A;  4IXC A;  3L2U A;  4BRA A;  1CXU A;  4CEF A;  1VQO N;  4DTU A;  4IJA A;  4YOU A;  5M1O A;  2P5G A;  4KTQ A;  2XY8 A;  4NLC A;  1KAY A;  3QB0 A;  4H5W A;  3ZSV A;  2E6M A;  3ZSW A;  3DLB A;  3TAN A;  4AHR A;  3C0B A;  4H0X B;  3CJA A;  2G8K A;  4IFY A;  4IZ9 A;  4BRK A;  4FJH A;  4KH6 A;  1JCF A;  3CXC M;  1ATS A;  2RKI A;  4B08 A;  4JKB A;  3EZW A;  1A5X A;  4XIU A;  1RBT A;  3O4N A;  4NYN A;  2O8E B;  2IGI A;  5AZI B;  3HXM A;  4JKG A;  1WLJ A;  1C1A A;  3AAP A;  4PKI A;  4LH4 A;  1T03 A;  1DLO A;  2VYP A;  5DK5 A;  5AQU A;  4E7K A;  1ZYQ A;  1OH6 A;  3JXU A;  4PHT X;  2Q1N A;  1GLD G;  4A5B A;  2G8F A;  1MWM A;  3DOL A;  4QCL A;  4DTN A;  3EN9 A;  1WSH A;  3U6F A;  3P5J A;  3SZ2 A;  3ASM A;  3DXK A;  4DQI A;  5DM6 L;  3DMJ A;  4BR2 A;  3K5L A;  1NK8 A;  1XC3 A;  1JXE A;  3TR8 A;  4W5O A;  3QET A;  2PYJ A;  1VSI A;  2KZZ A;  5T7B A;  3AA4 A;  5BPN A;  3I8B A;  1BO5 O;  3K9K A;  3TAE A;  3QNN A;  2UXD K;  5AQT A;  1VQK N;  3LAL A;  2P9S B;  1BA0 A;  5KTQ A;  4YOY A;  4K8X A;  2Q36 A;  2QW9 A;  1RT1 A;  4O0J A;  3R8E A;  3L2W A;  3OS2 A;  3DLE A;  1QTM A;  1QQC A;  3AO5 A;  5AZJ B;  3THW B;  3Q7C A;  2KW4 A;  1NU0 A;  3P31 A;  3QEP A;  1KRP A;  3TTD A;  3SV3 A;  3IG1 A;  4DR2 K;  1S3X A;  3AO1 A;  4O44 A;  4E1M A;  2YHY A;  4DMN A;  4C23 A;  2HOE A;  3WXL A;  4LF7 K;  4FJL A;  3MWP A;  5E41 A;  3OS1 A;  1J6Z A;  3P39 A;  3SLC A;  3G4S N;  4CW7 B;  5FLX O;  3ZSZ A;  2JWK A;  3THV A;  4QOZ B;  1IKV A;  5J2Q A;  1X9J A;  4O55 A;  3QBX A;  3CCU N;  5I9E B;  4FZX C;  3K5N A;  3WNG A;  3V4I A;  1BI4 B;  2RPI A;  3V6D A;  4B9L A;  3KZB A;  4TSX A;  1YTA A;  3C6H A;  5KI6 A;  4ELT A;  4JI7 K;  3KWG A;  2PYL A;  4B9V A;  4CK2 A;  4IBN A;  2IVO A;  3HYF A;  1Q82 O;  3GE1 A;  1Q9Y A;  1WAJ A;  3KIO A;  1UA1 A;  2D0P A;  5GAD P;  1KXP A;  5KPZ A;  4FYD A;  4BC3 A;  5A2Q O;  2O8B B;  3BGR A;  1JL1 A;  2E2P A;  3VES A;  4J2E A;  4Y0W A;  2NZT A;  4DHY A;  1RTI A;  4E1N A;  1JCG A;  4AIL C;  3O3F A;  3SMS A;  4CZI A;  4LF6 K;  1Q81 O;  4KHP K;  2E4L A;  4H4M A;  4KFB A;  3HM8 A;  2PFU A;  2FLO A;  2VWB A;  3P1G A;  4M3Z A;  1CZA N;  1ZXO A;  4CK3 A;  3VEV A;  4N5S A;  1D8Y A;  4JEP A;  4PWD A;  4DU4 A;  1NJW A;  3BF3 A;  2OTL N;  1RIL A;  4JKC A;  3MCA B;  2QTD A;  4IDH A;  4X65 K;  4PA1 A;  4CEB A;  1KD1 O;  1EX4 A;  4IDK A;  4DR1 K;  1LOT B;  5CZ2 A;  1QQN A;  2QKB A;  3VEW A;  3CCL N;  3AVM A;  4DV3 K;  2P9L A;  4JK9 A;  4F4K A;  2BGG A;  5LY3 A;  5GAG P;  4KBO A;  1EO1 A;  3ZYY X;  3MX2 A;  4RTF D;  4RW7 A;  3VTH A;  3G6E N;  4B1Y B;  3KLH A;  4AHU A;  1Q18 A;  1TL1 A;  4BE0 A;  3V1Q A;  2IAJ A;  1A5W A;  3MCP A;  2KLA A;  5I42 A;  5CYQ A;  3LDS A;  4OLA A;  1ITG A;  4KB0 A;  2XY7 A;  4HUE A;  5AQZ A;  4CK1 A;  1ATN A;  4CF9 A;  3CI5 A;  3ZSR A;  1L3T A;  2PY5 A;  3HVR A;  1Z6R A;  2Q31 A;  4BR7 A;  4BRD A;  4ZTJ A;  4ILG B;  1TVR A;  3LPT A;  4IFV A;  1XHX A;  2KHO A;  4CJV A;  4CFC A;  1HQE A;  4H8K A;  1VRU A;  2ITM A;  3UKU B;  3KWI A;  3MED A;  2CH6 A;  5GIO A;  1B9F A;  5TKY A;  3NVM A;  1RT3 A;  1VQ8 N;  3DXK B;  1VHX A;  3IS9 A;  1NGI A;  3EYZ A;  2E6L A;  3LWL A;  4M3U A;  3AGR A;  1YI2 N;  2VWK A;  4CZF A;  4WCE L;  1XNQ K;  3L8B A;  2PZS A;  2DTU A;  1IKX A;  5KGW A;  2OZS A;  3ZX3 A;  3VF2 A;  4O8K A;  3AVK A;  4IKF A;  4YNQ A;  4YOR A;  4FK0 A;  1NGB A;  4DV4 K;  1XQS C;  4CVN E;  5ELZ A;  1DTT A;  3MXM A;  1G99 A;  2QWR A;  3HM9 A;  4DFP A;  5M1P A;  3IRX A;  4CGF A;  4CF0 A;  2HNY A;  3EZ5 A;  3V1O A;  4ZTF A;  3RRH A;  5J2N A;  3RWU A;  4FWP A;  2HBM A;  4KH5 A;  3KD5 E;  3OYL A;  4W5R A;  3JSM A;  1XMQ K;  3IMX A;  3TSQ A;  5HRN A;  2HHQ A;  2FBT A;  4LF5 K;  4CJE A;  4FSV A;  4CZE A;  4FWN A;  4DS5 A;  4DLE A;  2P9I B;  2F9T A;  2G8V A;  4QS9 A;  3NDK A;  3UKR A;  1M90 O;  4JNE A;  4JS4 A;  2D0B A;  1BUP A;  2YNH A;  3LL3 A;  3HSC A;  3ZSX A;  3L2V A;  3WXJ A;  1NGC A;  3T1A A;  4Z94 A;  1HQU A;  2HB5 A;  1ZBI A;  2GUP A;  4B1W B;  1T05 A;  3R9P A;  3SUP A;  1BHL A;  2XY6 A;  3JAM O;  3TWH A;  2ZGZ A;  4YFU A;  3ULE A;  2WBN A;  3AVL A;  1IO2 A;  4DF4 A;  2F7T A;  3DXM A;  5AQM A;  4BR9 A;  1HMV A;  3ZSY A;  4CHZ A;  1R59 O;  1CLQ A;  4DCH A;  5JIC A;  3NCI A;  2F4V K;  2OPQ A;  4BY9 C;  4KRF A;  4AM6 A;  4B9S A;  5BRF A;  4DSL A;  4KRE A;  4ISG A;  3LAK A;  4B1X B;  3L0Q A;  1K8K A;  4M3R A;  1RBU A;  3BP8 A;  4LF4 K;  4E3S A;  3O3G A;  3OW2 M;  1TK5 A;  4JI5 K;  3KK1 A;  3NHG A;  1U45 A;  1T7P A;  4E89 A;  1RT4 A;  1S1X A;  1GLF O;  1TKX A;  3T1Y K;  1JLE A;  1WSG A;  3AA3 A;  4CJ3 A;  4B9U A;  1E4G T;  3O9Q A;  5AQH A;  2YHW A;  2HHU A;  4JHD A;  2NRV A;  2GWJ A;  4FJ9 A;  1WSI A;  4BRN A;  3A5L C;  1EXQ A;  4NO7 A;  4CEQ A;  2LSN A;  2EWS A;  2AJQ A;  2D0C A;  1YAG A;  4BRL A;  5LJV A;  2DFH A;  4DKW A;  1QVF M;  2X78 A;  4B8A B;  2A3Z A;  4J2B A;  3V9Z A;  3OYH A;  4DTO A;  5GAE P;  4DS4 A;  1TK0 A;  1KAZ A;  3PX4 A;  3F73 A;  3EE9 A;  3F5T A;  1FW6 A;  4KB1 A;  4CEC A;  2HND A;  5KGX A;  2VG7 A;  3ZCM A;  3CJB A;  3OJU A;  3C7N A;  4OPK A;  4FOI A;  4NCG A;  1KTQ A;  1RDA A;  4IWV A;  1QHA A;  1E4F T;  2Q0R A;  3A5O C;  3LPU A;  3SUN A;  3ATU A;  1P8Z A;  2E8A A;  4CZL A;  4FJ5 A;  4OKK A;  1I39 A;  3AVJ A;  3N4P A;  1RBS A;  4FJK A;  1WUA A;  2E2O A;  2NLX A;  2HHW A;  3ZEU B;  1W7A A;  3NAE A;  4DV6 K;  3AV9 A;  2QWL A;  3K0S A;  4GMJ B;  3SUQ A;  2BAN A;  4M41 A;  3MDQ A;  4OGE A;  5ADX A;  4LC9 B;  2UYT A;  3PIO L;  1K73 O;  3KJV A;  3QO9 A;  1NK6 A;  5H1S Q;  2P5O A;  5FPE A;  3E9O A;  4PL8 A;  1VK0 A;  1YIJ N;  3J7Z O;  1VQM N;  5FPM A;  3GDQ A;  4XH4 A;  4K41 A;  4CF1 A;  3OTO K;  4JRQ A;  5AZI A;  4J2A A;  2YKN A;  3PX0 A;  4B9M A;  4ID5 A;  2B6A A;  4XH1 A;  3CER A;  4JK7 A;  1NGD A;  4I6M B;  1NK4 A;  4B3O A;  5HLF A;  3ZSQ A;  4A57 A;  4DSI A;  4DUZ K;  3GOI A;  4MLH A;  5F0X A;  3TAG A;  1WBD A;  4GKJ K;  5C0Y A;  3SQ4 A;  1D4X A;  3CC7 N;  5C12 A;  5JVH L;  2W41 A;  5AQR A;  3OJS A;  4DTP A;  2CGK A;  3VOV A;  2I7P A;  3THX A;  3K57 A;  1SUQ A;  3FGU A;  3AY9 A;  3HST B;  1QZ6 A;  3DM2 A;  2YNF A;  4IOA L;  3ISN C;  2OA8 A;  3TTC A;  5AQJ A;  4NYF A;  5FDL A;  3W0L A;  2OTJ N;  4CGG A;  3CJ7 A;  4IEI A;  2BH1 A;  4J2D A;  2I5J A;  4BDY A;  1BIU A;  3OYJ A;  4O8U A;  3D2F B;  3NGY A;  4MFB A;  3LDL A;  3PO5 A;  3M3Z A;  1W2B M;  3RRG A;  2Z1H A;  3IFR A;  1DEJ A;  4BGA A;  3KVG A;  4IEE A;  3I0S A;  5CYM A;  3QIC A;  1I3A A;  2QEX N;  1TGO A;  2KTQ A;  3K59 A;  4FLU A;  4MLE A;  4OX9 K;  5AQN A;  4AF1 A;  4LF9 K;  3AA2 A;  3L4I A;  2ZQB A;  2OYQ A;  3E01 A;  1S1U A;  4OPH A;  2QK9 A;  2A5X A;  3ITH A;  4CEE A;  4IOC L;  4FK4 A;  3CCM N;  3PY8 A;  5C2F A;  3CFP A;  4ELU A;  1IH7 A;  3DWL A;  1DKG D;  4LY7 A;  1VSE A;  1Z25 A;  1VSF A;  3QML A;  3MXJ A;  4EIA A;  1MDU B;  4M3W A;  2QXL A;  4MO4 A;  4AHS A;  2HNZ A;  3QDK A;  3CM6 A;  4DTS A;  4LSN A;  4O5B A;  5C10 A;  1X3M A;  2VG5 A;  3A8Y A;  3O08 A;  4RCH A;  4H0T B;  4EHT A;  2A1R A;  3VET A;  5AQG A;  4WFA L;  4BRQ A;  3D0P A;  1QS4 A;  2P9S A;  4C8O A;  2W42 A;  4JD2 B;  5AQY A;  1NK9 A;  4PQU A;  4CEA A;  4CHO A;  3CQ8 A;  4JI1 K;  3ZEU A;  4C8N A;  1I94 K;  2D0A A;  4DF8 A;  1T6C A;  3VQP A;  5BRD A;  4JKD A;  1RT6 A;  1S5J A;  3C95 A;  3PIP L;  1HYZ A;  1JLQ A;  1LWF A;  2J4R A;  3DYA A;  1Q8I A;  3OY9 A;  3FFI A;  4DV1 K;  4RWT A;  2DFE A;  3J80 O;  1KQS M;  4L8R B;  1VQ6 N;  2E2Q A;  4Y1D A;  4FO0 A;  1RT2 A;  1IKW A;  3LP0 A;  4B1V A;  5LL6 Z;  3VQ7 A;  4M63 C;  3JS6 A;  3AAQ A;  4CBW A;  4LFB K;  1IBL K;  3A2F A;  3PSF A;  2ZD1 A;  2FXU A;  3TTF A;  3KLG A;  3WQU A;  1C0T A;  3G71 N;  3S9H A;  3B8A X;  5FRN A;  2A42 A;  3GG4 A;  3PX6 A;  4JI0 K;  4V19 S;  1LW0 A;  4CJR A;  3OYN A;  4CHN A;  5LJW A;  2Z1J A;  3MWT A;  3ZX0 A;  4CJ4 A;  4NXM K;  1GLE G;  2O8F A;  4E7H A;  4BR0 A;  1HJO A;  3WXM B;  4WF9 L;  1VAZ A;  2ZM6 K;  1JLG A;  4K0K K;  1SQK A;  4KHU A;  5JLH A;  4E19 A;  2UXC K;  5KRT A;  3VQB A;  1RDW X;  5HRS A;  5EXW A;  4GVE A;  1Q7Y O;  2P51 A;  2UUA K;  1WSJ A;  4UQG A;  4F2R A;  1NGF A;  5IT9 O;  1XUP O;  1S1V A;  1BGX T;  3RTV A;  2NRT A;  4X64 K;  1LW2 A;  3EL2 A;  3ZT4 A;  1HJR A;  5HOO A;  3R6M A;  3OYG A;  2RN2 A;  4CZK A;  1WOQ A;  4LSL A;  4JRP A;  3E9P A;  3LDP A;  3VEN A;  3FZK A;  3KD1 E;  1Y64 A;  5EVZ A;  1VSK A;  4RW4 A;  4OO1 J;  3H45 C;  2HBK A;  5KPR A;  1NJY A;  1RNH A;  1SL1 A;  3N4Q A;  3NF8 A;  3K5O A;  4YOX A;  1UOC A;  3U9Z A;  3SAG A;  4JLH A;  1VSL A;  3L2R A;  4OKE A;  3OYD A;  1BI4 A;  2RHK A;  1C1B A;  3NF6 A;  4H03 B;  4JKE A;  1K9M O;  3FZF A;  1WSE A;  4DQQ A;  5K14 A;  4DV0 K;  4M3Y A;  1K8A O;  3C7N B;  2YHA A;  5M1F A;  4H0P A;  2G8I A;  1Q9X A;  5IWA K;  5AQF A;  2XO7 A;  3O4W A;  2F8S A;  4FJG A;  2FSJ A;  2NRW A;  4HCC A;  2QWP A;  2VG6 A;  1ASU A;  1TK8 A;  4PY5 A;  4AHV A;  4DTR A;  1OH7 A;  4JK8 A;  1QHT A;  5EOY A;  1HNZ K;  3HK2 A;  3VEZ A;  4DSK A;  3DLR A;  1GLC G;  2JLE A;  2ATQ A;  4WE1 A;  4H5V A;  3H1V X;  1RCH A;  4BQL A;  4FWK A;  4BRP A;  4BG9 A;  1SKW A;  4CJF A;  1RBV A;  3S3O A;  3HPG A;  2KKZ A;  3TAB A;  2XRI A;  1QE1 A;  1NJZ A;  3VEX A;  4RW9 A;  3HOS A;  2P9P B;  1GOC A;  3ZT1 A;  3CJC A;  5M1Q A;  3LDO A;  4WFB L;  3AVC A;  1N36 K;  4R79 A;  3RMD A;  3IKM A;  1NOY A;  1X9W A;  4H4O A;  1IJJ A;  5FPD A;  2GEM A;  4A2B A;  4Z4E A;  3BF1 A;  2BE2 A;  3UB5 A;  4I2Q A;  2B4J A;  3AAR A;  2RE2 A;  1IBM K;  3AVI A;  2G8U A;  1ATR A;  3HPO A;  3ZLJ A;  5FPN A;  5SWM A;  1FKP A;  4CJT A;  2KQ2 A;  3DAW A;  1V4S A;  4DSJ A;  3HPH A;  4JYA K;  4JKA A;  3ID6 A;  1LWE A;  4BRC A;  4CBU A;  4CGD A;  2OPR A;  4FZY A;  1KVB A;  1HNV A;  2WTU A;  4NXN K;  1XWL A;  4FW1 A;  2IDO A;  2JGU A;  4C1N K;  4FWM A;  4H0O A;  4M45 A;  1T6D A;  4AHC A;  5MLC Q;  3PO4 A;  2Y1I A;  4JI6 K;  2ZF5 O;  5AQS A;  1BL3 A;  4NB4 A;  1BA1 A;  1HLU A;  2P9I A;  4FM1 A;  3QEW A;  5AQP A;  4ISF A;  1SAZ A;  4RW8 A;  3MEE A;  3AVB A;  4FVU A;  4O4G A;  2OCE A;  2EX3 A;  1U6Z A;  3CCQ N;  4GVM A;  4B1U B;  1L3U A;  4OJR A;  3LAN A;  3HP6 A;  4PL7 A;  4CF8 A;  4F3T A;  4GNI A;  4BRI A;  1RFQ A;  4H5R A;  3CET A;  3RMC A;  4DR6 K;  3H3O B;  1VSM A;  4ILJ A;  4A2A A;  3LAM A;  3QFU A;  4PKG A;  1HNI A;  5J2P A;  4FJ7 A;  4DFK A;  3AVG A;  5I3U A;  4BVO A;  1NMN A;  1KAX A;  3FLC O;  4LF8 K;  1HNW K;  1T3V A;  1D5A A;  2CGJ A;  4FWQ A;  4WQ5 A;  2ASO A;  1M1K O;  4W5N A;  4A5A A;  2Q97 A;  4JN4 A;  1N5Y A;  2EHG A;  3O1W A;  5FRM A;  3HBT A;  2YV0 X;  4PUO A;  3NFA A;  4BC5 A;  4HCB A;  3U3G A;  3KKR A;  1HX1 A;  2X74 A;  4YHH K;  3ALY A;  4CHY A;  5GIN A;  1NBW A;  1TUY A;  5LMU K;  3VQD A;  1YVN A;  3NF9 A;  4ZHR A;  4Z4H A;  4OPA A;  3J7A P;  4CD1 A;  3LZI A;  3F9K A;  4QS8 A;  5FRO A;  5E26 A;  2E88 A;  5HRR A;  3ATV A;  3M8P A;  1RGI A;  3TPQ A;  3RR8 A;  1QQM A;  1NM1 A;  4CGH A;  4DUY K;  4K42 A;  1BIS A;  3M8R A;  2BTF A;  2QA4 N;  3HO1 A;  3F2K A;  3L3V A;  4BWM A;  3DOK A;  1ESV A;  3MK6 A;  1S6P A;  3VQ9 A;  3CPW M;  2FC0 A;  2RF2 A;  2P9K B;  4BAC A;  3C94 A;  3VF6 A;  4H5T A;  5HRO A;  5C15 A;  4BRF A;  5KQD A;  4CED A;  1L3S A;  2F8T A;  1T44 A;  1U4B A;  2ZE2 A;  2HHS A;  1NGA A;  4ISE A;  2ITG A;  3WXK A;  4B8C A;  3J81 O;  2GTD A;  3TAP A;  3H6E A;  3OYE A;  1VQ9 N;  4N56 A;  1VSH A;  1IKY A;  2A40 A;  3NBP A;  4JKH A;  3OVN A;  5D3G A;  3RR7 A;  1LAW A;  4BDP A;  4FOE A;  3LM2 A;  4K25 A;  4FM2 A;  4H0Y B;  1QVG M;  2QWN A;  4CHQ A;  5C2D A;  4CER A;  3O4Q A;  3L4Q A;  4ELV A;  2D4W A;  1GOA A;  3HOT A;  3V9X A;  4CJU A;  1CZ9 A;  4DB3 A;  3AVF A;  2GBZ A;  4FWR A;  3I33 A;  4Z4G A;  4JV5 K;  1A5V A;  3E9L A;  3MEG A;  4LD0 A;  4EAH D;  1TAQ A;  1N33 K;  1KLM A;  2NRZ A;  2HF4 A;  3VEY A;  1WBB A;  4FJN A;  4CJQ A;  3OYI A;  3HZ6 A;  3VN5 A;  2GEL A;  2D5R A;  3ZSO A;  2KFN A;  3ZX2 A;  4CEO A;  3AA5 X;  3OBY A;  2WFB A;  4Z0U A;  3F9M A;  1S9E A;  1S22 A;  3EEQ A;  5M1N A;  4FW2 A;  3LDN A;  3NVK A;  1ASV A;  1LCU A;  3H46 O;  4YDU C;  4DR4 K;  4B9Q A;  5BPL A;  4IOX A;  3ZT0 A;  1JCE A;  4RW6 A;  2NRX A;  3L2Q A;  1T8E A;  3E1Y A;  4FWO A;  3OYF A;  4DQ8 A;  4HHT A;  1WAF A;  3SAH A;  4U67 L;  3QEV A;  2P9L B;  1RDC A;  2VQF K;  5AFU H;  1SL2 A;  4A59 A;  4DV5 K;  3V9W A;  1K8K B;  4UY8 O;  2P9U B;  3CHW A;  3O5B A;  2W6K A;  3VGM A;  5B8H A;  2V7Y A;  4DLG A;  4CGI A;  1NGH A;  4BG8 A;  1JLA A;  3D2E A;  3L6Q A;  3DRR A;  4FJJ A;  2YNG A;  4YOW A;  3DLH A;  1E3M A;  2Q2R A;  5J2M A;  3MN9 A;  5BN9 A;  3OYC A;  3VPZ A;  2Y1J A;  3QES A;  2YJE A;  2DY4 A;  3VER A;  4HTL A;  5JS2 A;  3CCR N;  3U3Y A;  2V7Z A;  3LP1 A;  3U4L A;  2XHB A;  1NK5 A;  3VGL A;  4CI6 A;  1LAV A;  3PUF A;  3V81 A;  1OKJ A;  4BR4 A;  3E66 A;  2NRH A;  2IVN A;  5DMR A;  3RMB A;  2NUB A;  3LWM A;  2I7N A;  1IG8 A;  1OVY A;  4YY3 K;  4B9N A;  4EFH A;  1YIT N;  1LV5 A;  2FSN A;  1FXX A;  3MAQ A;  4G9Z A;  2KFZ A;  3R3L A;  3RMA A;  2YX6 A;  3CME N;  4OKJ A;  5AJ3 K;  3G10 A;  4XEI A;  5HRP A;  1DGK N;  2ZGY A;  1C0F A;  3VQA A;  2VGN A;  3RVC A;  5JMV A;  1YHQ N;  3K2P A;  3O9R A;  3DRP A;  2O8E A;  4CJ5 A;  4KV8 A;  3ENH A;  3VQE A;  3TAR A;  1WNS A;  5HBM A;  4AM7 A;  4KI6 A;  1GOB A;  1NLV A;  3BDP A;  4B3S K;  4B1Z A;  4J8F A;  1VSJ A;  2GX9 A;  1XHZ A;  1L5U A;  2D1K A;  5EY4 A;  3QEI A;  4I9L A;  1JKH A;  5BRH A;  3GBT A;  3AO3 A;  4FLT A;  1U48 A;  2CGL A;  4LFA K;  2P1J A;  2NRR A;  1SKS A;  4DQS A;  3M8Q A;  4F2S A;  1TUU A;  1L3V A;  1IG9 A;  3H08 A;  4AH9 A;  1HKG A;  4FLW A;  3QEX A;  3THY A;  1C1C A;  3O1B A;  2QM1 A;  3OBW A;  3SI6 A;  2HVI A;  2AP1 A;  4MDB A;  3SQ1 A;  1EP4 A;  3ZT2 A;  3WEE A;  4A61 A;  5AZJ A;  1C0G A;  3Q7B A;  3NF7 A;  3D2E B;  2KZM A;  3TAQ A;  1B9D A;  3DI6 A;  4KHQ A;  1REV A;  3WEE B;  3D45 A;  3MN5 A;  4NCA A;  5AR0 A;  1NKC A;  3O9S A;  3CM5 A;  4FLX A;  3WNF A;  3ENO A;  2E1Y A;  3O9U A;  3DLK A;  1GLJ O;  2WOM A;  3LM9 A;  3VMF B;  1ZC6 A;  4CD3 A;  3SBG A;  1W9H A;  1BCM A;  1KCF A;  3MN7 A;  4FLV A;  4E7L A;  2HF3 A;  2VCP A;  3PV8 A;  1HPM A;  4B9T A;  2H3G X;  4E7I A;  3CJ1 A;  5AQW A;  3CFO A;  5AQX A;  3RSE B;  3VA3 A;  3NGI A;  1N34 K;  3EY1 A;  1F21 A;  4K8Z A;  3M1F A;  4IJN A;  3IUC A;  3R1X A;  2GV9 A;  2P9K A;  3KLE A;  3D6R A;  1S6Q A;  1VQL N;  1NJX A;  2GWK A;  4FWL A;  2E2N A;  3CCS N;  4B3R K;  5KRS A;  3THX B;  1RDU A;  4DSE A;  4DV7 K;  1QSS A;  1JL2 A;  3OYK A;  1YT3 A;  4KO0 A;  1RBR A;  1KVA A;  4N76 A;  2YJF A;  2HBJ A;  1S72 N;  4DR5 K;  3M5R A;  3FZM A;  5M1K A;  1YJN N;  4EZ6 A;  4JD2 A;  4CJ7 A;  2R7Y A;  1RT7 A;  4DG1 A;  4KHN A;  3OYB A;  4Q5V A;  4KAZ A;  4KHY A;  1VQN N;  2OPP A;  4O5F A;  4JS5 A;  2OAN A;  4O0I A;  3NH2 A;  3V9U A;  3C65 A;  5AQO A;  1JLB A;  4HTU A;  2IIR A;  1J53 A;  3MEC A;  2HHH K;  3OYM A;  3J7Y P;  1HPZ A;  3D2F A;  4F9O A;  1X1P A;  1LWC A;  1HYV A;  3O80 A;  4C8K A;  4Y1C A;  3CFR A;  4C8L A;  1KSP A;  4KH4 A;  1NKB A;  4BRG A;  1KLN A;  2F9W A;  3ENB A;  5CR4 A;  1NGE A;  2O8C B;  3HTV A;  4N47 A;  4DU3 A;  4DR3 K;  3V9S A;  4Z4F A;  4BGB A;  5CE3 A;  1QSY A;  4CJP A;  5BN8 A;  3A0I X;  1TKD A;  1C6V A;  4CIE A;  3ID8 A;  1X9S A;  3SPZ A;  3KK2 A;  1S1T A;  3OYA A;  2HW3 A;  3SV4 A;  5C42 A;  4E0D A;  3AVH A;  4Z4C A;  4OVL A;  3CCJ N;  3TU5 A;  5CZ1 A;  4OLB A;  4JKG B;  3HP9 A;  3CJ9 A;  3WUH A;  1P90 A;  3P83 D; 
#chains in the Genus database with same CATH homology
 1U6Z A;  4GV9 A;  4M7X A;  4CZJ A;  3CCQ N;  4A62 A;  1YAG A;  4BRL A;  5LJV A;  3SJH A;  4DKW A;  1Z05 A;  4B1U B;  1TYQ A;  1QVF M;  2A3Z A;  3U8X A;  4PL7 A;  1BWF O;  3GL1 A;  4GNI A;  1BDG A;  5GAE P;  4BRI A;  1RFQ A;  1KAZ A;  4XH5 A;  4H5R A;  3CET A;  3VF4 A;  4BQZ A;  3H3O B;  4YOV A;  4C1N I;  3EE9 A;  3FZL A;  4FL9 A;  3F5T A;  4ILJ A;  4A2A A;  3QFU A;  4GV6 A;  2ZWH A;  3FFK B;  4PKG A;  5HL7 L;  1ZBS A;  4E1J A;  4MDA A;  4WQ4 A;  4M7Y A;  3CJB A;  5DM7 L;  3C7N A;  1BOT O;  3RSE A;  4BRO A;  4FOI A;  4BVO A;  1U2V A;  1KAX A;  3FLC O;  1QHA A;  1E4F T;  2Q0R A;  3A5O C;  4IWV A;  1T3V A;  4FWS A;  4L3Q A;  2CGJ A;  4WQ5 C;  4FWQ A;  3ATU A;  4WQ5 A;  2ASO A;  1HKC A;  1YJ9 N;  1M1K O;  4A5A A;  1P8Z A;  2E8A A;  2Q97 A;  4JN4 A;  4CZL A;  5F1X A;  3O1W A;  1NJI O;  2QWO A;  1X3N A;  3N4P A;  1U2V B;  3HBT A;  2FF6 A;  1WUA A;  2E2O A;  2NLX A;  2ZJR L;  3ZEU B;  4BRH A;  2E1Z A;  4IXC A;  4BC5 A;  4BRA A;  1HX1 A;  1VQO N;  2W40 A;  2QWL A;  5GIN A;  1NBW A;  3M6G A;  4IJA A;  1DT9 A;  4QS7 A;  4YOU A;  5M1O A;  4NLC A;  1KAY A;  1YVN A;  3MDQ A;  5ADX A;  1QZ5 A;  3QB0 A;  4H5W A;  4LC9 B;  4OPA A;  2UYT A;  3BUZ B;  4CD1 A;  3PIO L;  1K73 O;  2WC9 A;  1O13 A;  4CZM A;  1SZ2 A;  3C0B A;  4H0X B;  5H1S Q;  3CJA A;  5AFU A;  5FPE A;  3E9O A;  4PL8 A;  4QS8 A;  1YIJ N;  3J7Z O;  4IZ9 A;  5E26 A;  2E88 A;  4BRK A;  3H1Q A;  3ATV A;  4KH6 A;  1VQM N;  5FPM A;  3GDQ A;  1JCF A;  1RGI A;  4K41 A;  4XH4 A;  1ATS A;  3TPQ A;  1QQM A;  3CXC M;  1NM1 A;  3EZW A;  4JKB A;  5AZI A;  4K42 A;  5AZI B;  2BTF A;  4JKG A;  2QA4 N;  3F2K A;  3AAP A;  4PKI A;  4XH1 A;  1ESV A;  1NGJ A;  3CER A;  3MK6 A;  1NGD A;  3OHR A;  2VYP A;  4I6M B;  4JK7 A;  5BRE A;  5AQU A;  3JXU A;  2HBL A;  4PHT X;  2Q1N A;  3CPW M;  1GLD G;  4A5B A;  1VQP N;  2P9K B;  4A57 A;  1MWM A;  3VF6 A;  3GOI A;  4MLH A;  4H5T A;  5F0X A;  3EN9 A;  5C15 A;  3DXK A;  4BRF A;  3O6W A;  5DM6 L;  5KQD A;  4BR2 A;  3TSU A;  1XC3 A;  1T44 A;  3MN6 A;  5C0Y A;  1NGA A;  1D4X A;  4ISE A;  3WXK A;  3CC7 N;  1NWK A;  5C12 A;  5BPN A;  2GTD A;  3H6E A;  5JVH L;  2W41 A;  3I8B A;  5AQR A;  1VQ9 N;  2CGK A;  3VOV A;  1BO5 O;  2I7P A;  3K9K A;  3HRG A;  2A40 A;  4JKH A;  3FGU A;  3AY9 A;  5AQT A;  2HST A;  3LM2 A;  4FOE A;  1VQK N;  4K25 A;  3NMU A;  3O9T A;  1QZ6 A;  2P9S B;  1BA0 A;  4PKH A;  4H0Y B;  4IOA L;  3TTC A;  5AQJ A;  1QVG M;  3W0L A;  4YOY A;  2QWN A;  3EO3 A;  2OTJ N;  2Q36 A;  3PLA A;  2QW9 A;  3VGK A;  5C2D A;  4BRE A;  3CQY A;  3CJ7 A;  4IEI A;  3L4Q A;  3IDH A;  3R8E A;  2BH1 A;  2D4W A;  3HOT A;  3CCV N;  5AZJ B;  4DB3 A;  3KK7 A;  4FWR A;  4O8U A;  3I33 A;  3Q7C A;  3D2F B;  3E9L A;  3P31 A;  3LDL A;  4BC2 A;  3SMP A;  3TTD A;  3M3Z A;  4EAH D;  1W2B M;  3CPE A;  3IFR A;  1DEJ A;  1HUX A;  2NRZ A;  2HF4 A;  2AA4 A;  2Q0U A;  3VEY A;  3KVG A;  4WYB A;  1S3X A;  3HZ6 A;  2GEL A;  4BGA A;  4IEE A;  1YF5 L;  3SAF A;  3ZX2 A;  3QIC A;  4GY2 B;  4FPA A;  2QEX N;  3OBY A;  2WFB A;  3F9M A;  2YHY A;  3UE5 A;  1S22 A;  4C23 A;  5M1N A;  2HOE A;  4MLE A;  3A5M C;  5AQN A;  3WXL A;  1VQ7 N;  4AF1 A;  3LDN A;  3NVK A;  3MWP A;  3L4I A;  1LCU A;  3H46 O;  3CCE N;  1J6Z A;  4YDU C;  3P39 A;  3SLC A;  3G4S N;  4OPH A;  2A5X A;  2PBD A;  2P9P A;  4B9Q A;  5AQQ A;  5BPL A;  3J8A A;  4IOX A;  4IOC L;  1JCE A;  3UKR B;  3CCM N;  2NRX A;  2JWK A;  2V51 B;  4CZG A;  5C2F A;  5KPT A;  3E1Y A;  3O8M A;  3DWL A;  4FWO A;  4DQ8 A;  1DKG D;  1X9J A;  4EHU A;  3AGK A;  3QBX A;  3T7Z A;  3SAH A;  4U67 L;  5I9E B;  3CCU N;  3CC2 N;  3QML A;  2P9L B;  5AFU H;  4A59 A;  3KZB A;  4EIA A;  1K8K B;  1MDU B;  4UY8 O;  2P9U B;  3C6H A;  3CHW A;  2QXL A;  3O5B A;  4MO4 A;  3VGM A;  3WT0 A;  5B8H A;  3QDK A;  2DPN A;  1SS6 A;  2V7Y A;  3KWG A;  5BR9 A;  5C10 A;  1X3M A;  1NGH A;  3A8Y A;  3O08 A;  4IFE A;  4BG8 A;  1YUW A;  3D2E A;  3L6Q A;  2IVO A;  3WXI A;  4RCH A;  4YOW A;  3GE1 A;  1Q82 O;  3T69 A;  3S41 A;  2Q2R A;  3MN9 A;  2D0P A;  5GAD P;  1KXP A;  5KPZ A;  1H1V A;  4H0T B;  3DXM B;  5BN9 A;  4BC3 A;  3VPZ A;  4EHT A;  2E2P A;  3VES A;  2BUP A;  1QQO A;  3VET A;  5AQG A;  2YJE A;  4WFA L;  4BRQ A;  3MMV A;  2NZT A;  4Y0W A;  3VER A;  4DHY A;  2P9S A;  4HTL A;  3P38 A;  1JCG A;  2NNW A;  2V7Z A;  3CCR N;  4JD2 B;  5AQY A;  3U4L A;  3SMS A;  3VGL A;  4CI6 A;  4CZI A;  1Q81 O;  1OKJ A;  4JKF A;  4BR4 A;  2YI1 A;  3E66 A;  3ZEU A;  2NRH A;  2IVN A;  1VQ5 N;  2CH5 A;  1T6C A;  3HM8 A;  3D7E O;  3BEX A;  2PFU A;  2FLO A;  4YOT A;  5BRD A;  4JKD A;  2I7N A;  1IG8 A;  1OVY A;  1VQ4 N;  2VWB A;  5GIP A;  4EFH A;  1CZA N;  1ZXO A;  1YJW N;  1YIT N;  3VEV A;  2FSN A;  3PIP L;  2J4R A;  4JEP A;  4G9Z A;  3BF3 A;  3R3L A;  4RWT A;  1KQS M;  2OTL N;  2YX6 A;  3CME N;  1VQ6 N;  1N8R O;  1ILY A;  4XEI A;  2E2Q A;  4FO0 A;  1DGK N;  1MWK A;  4JKC A;  2ZGY A;  4B1V A;  2ASP A;  2A6A A;  1C0F A;  3MCA B;  2QTD A;  4M63 C;  3JS6 A;  2VGN A;  3AAQ A;  4IDH A;  3RVC A;  3VTI A;  4CBW A;  5JMV A;  1KD1 O;  1YHQ N;  3O9R A;  2FXU A;  3TTF A;  3WQU A;  1LOT B;  3G71 N;  1QQN A;  3B8A X;  3ENH A;  4H0V B;  3VEW A;  1Q86 O;  2YCH A;  1KC8 O;  2A42 A;  3GG4 A;  3CCL N;  5LJW A;  2P9L A;  3MWT A;  4JK9 A;  1NLV A;  3ZX0 A;  4AM7 A;  5LY3 A;  4B1Z A;  5GAG P;  4BVP A;  4J8F A;  4KBO A;  2GX9 A;  1EO1 A;  1GLE G;  3ZYY X;  2D1K A;  5EY4 A;  3MX2 A;  4RTF D;  3ULE B;  3VTH A;  3G6E N;  2ZJP L;  2ZJQ L;  5BRH A;  3CC4 N;  3GBT A;  4BR0 A;  1HJO A;  2CGL A;  4B1Y B;  3WXM B;  2NRR A;  4WF9 L;  1VAZ A;  5CHI A;  1SQK A;  2WUS A;  4JAX A;  1TUU A;  5JLH A;  3DJC A;  1Q18 A;  4CBX A;  4JHD B;  1HKG A;  1GLL O;  4NLB A;  1RDW X;  5EXW A;  1NMD A;  2QWM A;  4GVE A;  1Q7Y O;  3MCP A;  1GLB G;  2KLA A;  3O1B A;  2QM1 A;  3OBW A;  3SK3 A;  1NGF A;  3K9J A;  1XUP O;  2AP1 A;  5BPM A;  4MDB A;  3CF5 L;  3WEE A;  2NRT A;  5AQI A;  3EL2 A;  5AQZ A;  4A61 A;  1ATN A;  3ZET B;  5AZJ A;  5HOO A;  1C0G A;  3Q7B A;  3R6M A;  3CI5 A;  1TYQ B;  3D2E B;  4CZK A;  3G25 A;  3FR0 A;  1WOQ A;  1Z6R A;  2Q31 A;  3WQT A;  3WEE B;  4BR7 A;  3MN5 A;  5AQK A;  3UKU A;  5AR0 A;  5ADX H;  3E9P A;  3LDP A;  3O9S A;  3FZK A;  3VEN A;  1Y64 A;  2IVP A;  4BRD A;  5EVZ A;  4OO1 J;  3H45 C;  3ENO A;  2E1Y A;  2HBK A;  5KPR A;  2D0O A;  3O9U A;  3H3N O;  1GLJ O;  4ILG B;  2V52 B;  3N4Q A;  1BU6 O;  4YOX A;  3LM9 A;  2KHO A;  3VMF B;  4FPB A;  3CQX A;  4GV3 A;  2ITM A;  1ZC6 A;  3UKU B;  3U9Z A;  3KWI A;  3SAG A;  4CD3 A;  3SBG A;  3QFP A;  2CH6 A;  5GIO A;  3OA9 A;  5TKY A;  3NVM A;  2FF3 B;  3MN7 A;  2RHK A;  2HF3 A;  4JKE A;  4H03 B;  1VQ8 N;  2VCP A;  1HPM A;  3DXK B;  4MO5 A;  2H3G X;  1K9M O;  3FZF A;  3CJ1 A;  3LDQ A;  5AQW A;  1NGI A;  2ASM A;  5AQX A;  3AGR A;  3RSE B;  4H5N A;  1K8A O;  1YI2 N;  3C7N B;  4CZF A;  4WCE L;  5M1F A;  4H0P A;  3I56 N;  2JWL A;  5AQF A;  3M1F A;  3O4W A;  4IJN A;  3VEO A;  2FSJ A;  3ZX3 A;  3IUC A;  3VF2 A;  3R1X A;  2P9K A;  3FZH A;  5E84 A;  4O8K A;  2YHX A;  2NRW A;  3D6R A;  2E20 A;  4YOR A;  1VQL N;  2HMP A;  3FE1 A;  2GWK A;  1NGB A;  4FWL A;  3KHY A;  1XQS C;  2E2N A;  2QWP A;  5ELZ A;  3CCS N;  1G99 A;  2P9N B;  2QWR A;  4JK8 A;  3ZET A;  5M1P A;  5EOY A;  2QI2 A;  1RDU A;  3VEZ A;  1GLC G;  3CMA N;  4H5V A;  3H1V X;  4BQL A;  4FWP A;  2HBM A;  2P9N A;  1NGG A;  4KH5 A;  4FWK A;  4BRP A;  3IMX A;  3TSQ A;  3EKU A;  4BG9 A;  2YJF A;  5AQV A;  2HBJ A;  4FSV A;  1S72 N;  2VGM A;  3M5R A;  3P4I A;  3FZM A;  4CZE A;  2KKZ A;  4FWN A;  5M1K A;  4WFN L;  5JVG L;  1YJN N;  4YDU A;  3VEX A;  2P9I B;  2F9T A;  4QS9 A;  3UKR A;  3W3D A;  5JLF A;  2P9P B;  3HOS A;  1M90 O;  4JD2 A;  4JNE A;  4CJ7 A;  1BUP A;  5TKW A;  1BG3 A;  3LL3 A;  3CJC A;  5M1Q A;  3HSC A;  3LDO A;  4WFB L;  4R79 A;  4CZH A;  4O5F A;  3WXJ A;  1VQN N;  3IKM A;  2OAN A;  1NGC A;  1IJJ A;  3EE8 A;  4BC4 A;  1V4T A;  3U9D A;  5FPD A;  3C65 A;  5AQO A;  2GEM A;  4A2B A;  3CD6 N;  4Z94 A;  3BF1 A;  2IIR A;  3CIP A;  3UB5 A;  2GUP A;  4B1W B;  3AAR A;  3R9P A;  2RE2 A;  4WQ4 C;  2ZGZ A;  3C6A A;  3HI0 A;  5AQL A;  3ULE A;  3D2F A;  2WBN A;  4F9O A;  4ILH A;  1W97 L;  1ATR A;  1YXQ A;  2F7T A;  3DXM A;  1GLA G;  5AQM A;  5FPN A;  4BR9 A;  4HWI A;  4I6M A;  3DAW A;  2FSK A;  2QWQ A;  3O80 A;  5F2R A;  4U7B A;  4IO9 L;  1V4S A;  1R59 O;  4BRM A;  4DCH A;  5JIC A;  3SBT A;  1HKB A;  4BY9 C;  3MX5 A;  4JKA A;  4AM6 A;  5BRF A;  3ID6 A;  4ISG A;  4K43 A;  3A5N C;  3L0Q A;  2P9U A;  4B1X B;  1K8K A;  4KH4 A;  4BRC A;  4CBU A;  3BP8 A;  4BRG A;  4BR5 A;  3OW2 M;  2F9W A;  1JJ2 M;  3ENB A;  2A41 A;  4C1N K;  4FWM A;  1GLF O;  4H0O A;  2PAV A;  5CR4 A;  3TSP A;  1NGE A;  1T6D A;  3QBW A;  5MLC Q;  3DLL L;  3HTV A;  2ZF5 O;  5AQS A;  3EKS A;  1E4G T;  1EQY A;  4BGB A;  5CE3 A;  3I55 N;  3O9Q A;  3A0I X;  5AQH A;  4NB4 A;  5BN8 A;  1BA1 A;  1HLU A;  2YHW A;  3ID8 A;  4JHD A;  2P9I A;  2NRV A;  5AQP A;  4ISF A;  2GWJ A;  4BRN A;  5GAH P;  3A5L C;  1SAZ A;  5KQ8 A;  4IO8 A;  3CCJ N;  3TU5 A;  4FVU A;  4NO7 A;  1MA9 B;  4JKG B;  3CJ9 A;  3WUH A;  1P90 A;  2EWS A;  1TUY A;  5EX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...