4IO9L

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome/ribosome inhibitor
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4io9L01
1M1KO 5DM6L 1M90O 1KD1O 1Q7YO 1VQ6N 1OVYA 3CD6N 3CCLN 3CMEN 5GAHP 3CC4N 1S72N 4WFNL 2QEXN 3I56N 3CCMN 5GAGP 5MLCQ 3DLLL 1KQSM 5JVHL 1VQ4N 3CPWM 4U67L 1VQ9N 1Q81O 1NJIO 3CC2N 1YI2N 3OW2M 1KC8O 1W2BM 1QVGM 2OTJN 3CCUN 1VQMN 1VQON 3CCRN 3CF5L 5DM7L 4UY8O 1K9MO 4WF9L 2QA4N 1YITN 3G6EN 4WFBL 3PIOL 1Q86O 5JVGL 1YJ9N 3CCSN 4IOCL 1VQLN 3PIPL 4IOAL 1VQPN 1YHQN 1Q82O 1VQNN 3I55N 3CMAN 1VQ5N 1N8RO 5H1SQ 4WCEL 1YJNN 5GADP 3CC7N 1VQKN 4WFAL 1QVFM 1JJ2M 5HL7L 3CCJN 3CCEN 1K73O 1K8AO 1VQ8N 2ZJQL 1YJWN 5GAEP 2ZJPL 1ILYA 3J7ZO 1VQ7N 3CCVN 3G71N 4IO9L 3G4SN 2OTLN 2ZJRL 3CCQN 1YIJN 3CXCM
chains in the Genus database with same CATH superfamily
2NRXA 1ATRA 4B9TA 1FKOA 4N47A 1Q7YO 2YNFA 2PY5A 3MAQA 4EP5A 3WXMB 4PL8A 3SPZA 3E9PA 5T7BA 3BGRA 1NU0A 5AQZA 4PQUA 4FZXC 3ULEB 4FJ5A 4L8RB 4JK8A 3UIQA 3GOIA 4B3OA 2QWRA 3MWPA 4DTXA 3TAQA 1WBBA 4Z4CA 4CHQA 5CYMA 1ZYQA 3VEZA 4M3RA 2LSNA 2KQ2A 2HHXA 4B1UB 5C0YA 3LALA 4DLGA 1S1WA 1WSFA 4JK7A 1RBTA 4WQ4A 2O8BA 4J2BA 1KLMA 1K8KA 1RT7A 3CIPA 4CERA 4IOXA 1YVUA 3PO5A 2D4WA 5M1KA 1VQMN 2ETJA 3DLHA 1LAVA 2VG6A 4OLBA 1J5EK 4B3RK 4Z4GA 1NKCA 4FWMA 4BGBA 3SUQA 3OYBA 5SZTA 2UYTA 4Y1CA 4DV6K 4EZ6A 1BHLA 1RDUA 4JNEA 3A5OC 3AGKA 3SMPA 5AQUA 2F4VK 5K14A 1SKRA 1RDAA 2OPRA 3JXUA 4DFPA 3CPEA 3S3OA 2OCEA 3OYJA 5FLXO 2JWLA 3L3UA 3R1XA 1HKGA 4NYFA 3HPGA 1MU2A 4KHPK 4E7KA 4CE9A 5M1QA 2D0AA 3HM9A 1NGAA 3P83D 4AH9A 1Q9YA 3EKUA 3D6RA 4CEZA 1HYZA 3SMSA 3HT3A 1ILYA 1TK5A 3CCVN 2Y1IA 3M6GA 4CZEA 1I3AA 3SYZA 4PA1A 2QM1A 4BRLA 3CCQN 1TVRA 2DY4A 4MLHA 3DI6A 4BC3A 2CGLA 5DMRA 3KZBA 3AO1A 5B8HA 1VQ6N 4BQZA 3OJUA 1NM1A 3FGUA 4BRDA 3TTFA 1LCUA 2A41A 2O8BB 2IC3A 3TAEA 3E66A 4BVOA 3HP6A 3QEWA 1QSLA 4KAZA 3FR0A 4YDUC 4DTRA 4AM7A 3OY9A 2QXLA 3FFKB 1NOYA 1KQSM 2ZGYA 5CE3A 3QDKA 4YNQA 3KK1A 4CD3A 4DLEA 3AVHA 4KTQA 1VSJA 4DB3A 3R3LA 2CH6A 2HBJA 4IFEA 1JLFA 1ESVA 3BP8A 3CQ8A 2OZMA 3L2UA 5KPRA 4DKWA 3RRHA 2RF2A 4C8KA 1BUPA 1VAZA 3ENHA 4WF9L 1VSKA 1GLLO 1O13A 4FJJA 3TSUA 2NRWA 3PX6A 4A59A 4BRNA 3ZSQA 3AARA 1I94K 3T1HK 4CD1A 3AO4A 1OH7A 1U47A 4JKAA 4I9LA 2HF4A 3KHYA 4YDUA 1LV5A 3V6DA 4OVLA 4CZJA 4QS9A 4LF8K 1E4GT 2O8EB 4CJKA 1WAJA 3MN5A 3CJBA 4B9SA 1T8EA 5H1SQ 3LDPA 2YNIA 1N33K 5GADP 2IVNA 1A5VA 3AA5X 3E01A 4L3QA 3OHRA 3CCEN 2O4GA 1VSLA 1TYQA 4NYNA 4C1NI 3OYEA 2UUAK 4BACA 4DSIA 2W40A 4FWOA 4LF4K 4ELUA 5LMNK 3EYZA 4DF8A 1K6YA 4JKEA 4IO9L 2E88A 1KFSA 4BRAA 1RFQA 2OTLN 4Q5VA 3BZCA 4DV4K 4CHZA 5J2QA 2PYJA 4IEEA 1CLQA 4J2AA 1M90O 4O0IA 2IVOA 4PY5A 4KTWA 3VEYA 3RVCA 3CCLN 4IJAA 2WFBA 5BRDA 1C1CA 3RSEB 4PL7A 4DTOA 2XRIA 1L5UA 4GV6A 5AFUA 1BI4A 3HPOA 2F96A 4BWJA 4CGFA 3GE1A 1SKSA 4EAHD 4HVJA 4M7XA 3EL2A 1RBUA 1VQ9N 1NJIO 3CETA 3K5NA 4BE2A 3O3FA 1JL2A 1I39A 3S9HA 4PKHA 3CJ1A 3OW2M 2WOMA 4E89A 2QKBA 1NGHA 4CBWA 5KPZA 1IBKK 4J8FA 3MX5A 4XH5A 2QA4N 4DQQA 1XHZA 1NK7A 3T69A 2OANA 4CF8A 1IG9A 4B3SK 4CCHA 3VF6A 2OYQA 5JS2A 3ATVA 4ELVA 4PKGA 4A2AA 2O8CA 4O44A 4A2BA 4JS5A 1JXBA 4JAXA 3CYMA 3CMAN 1NJZA 2UXDK 2P9IB 5IT9O 3SAGA 3KLEA 1YTUA 2PZSA 4FLTA 3F9KA 5BRFA 1OH6A 3KLGA 3HL8A 4DFMA 1QVFM 4FLZA 3ZSYA 4CJ4A 1HQEA 5FPDA 4WYBA 2G8HA 4J2EA 4JI3K 1NGDA 4FJ9A 2ASPA 5AQLA 1Z26A 3C6HA 3KWIA 3THWA 2F9WA 1EP4A 4JEPA 2YCHA 5JLFA 5CZ1A 3MXJA 4M3UA 1DGKN 4H8KA 4CEBA 3IG1A 3THYA 2P9UA 2BTFA 4K43A 3OBYA 3QESA 3QB0A 1NGCA 3K2PA 4J2DA 1J6ZA 3ZT4A 4GW6A 4LSLA 1SL0A 1RT1A 3HPHA 3CMEN 2D0BA 2B5JA 3WQUA 2D0CA 4RW4A 1XC3A 1S72N 4H4MA 3K5OA 3CCMN 5BPMA 1S5JA 2OZSA 3EZ5A 4FXDA 1D9FA 5KTQA 3H1QA 5BREA 3UKUB 3I8BA 1BO5O 2F8SA 4CHPA 3V4IA 4NXMK 5KRTA 4BG9A 3L4IA 5M1FA 1GLBG 4B9UA 3UKRA 1QZ6A 1W2BM 4GVEA 4FM2A 4RW7A 4B1WB 5E41A 3QBWA 3WEEA 3SBTA 3V9XA 2KKZA 5CHIA 3CCRN 3CF5L 3I33A 4CEQA 3NDKA 3THWB 4E7HA 4WFBL 4CESA 2ASMA 2YHAA 3PLAA 2P5OA 2HBMA 3ITHA 2RPIA 4OPHA 2P9LA 3SNNA 3UKRB 4ISEA 3VGKA 4CF1A 4JKCA 4IOAL 5AQRA 1F21A 1HNWK 4MDAA 3ISNC 1EX4A 3K57A 4DV0K 1VQ5N 4B3TK 4OKEA 1W97L 3FZHA 4BDPA 1VK0A 4JI8K 4WE1A 4EHTA 4DTUA 3ZSXA 3DRSA 1GLEG 1DT9A 1S3XA 3C95A 1EO1A 1NKEA 1JJ2M 5HL7L 4KV8A 4M45A 3CM6A 3CQXA 4JHDA 1YTAA 4B3MK 4BRPA 2HHQA 4FJMA 4H5WA 4FZYA 3PV8A 4DTMA 4DUYK 4FWKA 4KBOA 3G71N 1C1BA 3S41A 1VSHA 3TR8A 3LZIA 3MEEA 3FZFA 3LDQA 4B08A 5F1XA 4M63C 4KB0A 1W7AA 4O5FA 4ICLA 1KAZA 4DR1K 1KSPA 3IMXA 4DFKA 4JS4A 3MN6A 1IV0A 3TABA 4AHUA 3QBXA 2Z1GA 2UXCK 4E7LA 3MN9A 4IKFA 3SCXA 2E8AA 1WSIA 2NRZA 4FJNA 4KH5A 2WUSA 3I8DA 1NG9A 2YX6A 4HTLA 1D5AA 2ZD1A 3H3NO 3LM2A 1ASVA 2D0PA 4K25A 1RTDA 1HNZK 1JCEA 2YV0X 1G15A 5AQMA 3P1GA 4C1NK 5KGWA 3MK6A 1GLCG 4HWIA 3O9UA 2GUPA 4LH5A 3QEVA 4CJRA 3VN5A 4JD2A 3E1YA 1X3NA 3QFPA 3L8BA 4DS4A 2XY6A 4KB1A 2HMPA 4CFDA 2QW9A 4JKGB 3SQ2A 5DM7L 1T7PA 1U49A 1J9AA 1OH8A 1W9HA 1Q86O 3NF8A 2I7NA 3EEQA 3NF9A 3CCSN 3QMLA 1HPZA 3HZ6A 1NJWA 4Z4HA 1R59O 3PX4A 3V1OA 3DLRA 3KK7A 2YHXA 4RW6A 3J80O 1HLUA 4R79A 1TAQA 3DMJA 1IBLK 4JHDB 1Q82O 3OYCA 2HW3A 4DQIA 4ELTA 4JV5K 4CK1A 2J4RA 4CJLA 3SK3A 3RTVA 1BI4B 3BEXA 1X9WA 4BC4A 4WFAL 3QETA 3IKMA 2QWNA 3D45A 1XUPO 1K8AO 1XQSC 3AA3A 3J81O 2ZE2A 2P9LB 1LWFA 1RT6A 5HRPA 3CJ9A 2RE2A 4YORA 4ZTFA 5EXWA 2HHWA 1BDGA 1EWRA 3P38A 5AQPA 4DR2K 4HTUA 4CZKA 4BROA 4RTFD 4KKOA 4DV3K 1ZC6A 5FRNA 4FWLA 2P1JA 1RT3A 3HO1A 2KW4A 5HRSA 1HNXK 1JLEA 5AZJA 1A5XA 1N34K 4JN4A 3VOVA 4K41A 4DU1A 2IDOA 1B9DA 1XMOK 4YHHK 4FO0A 5BR9A 2A5XA 1CXUA 4XH1A 5HBMA 1BQNA 3LP0A 3K0SA 4Z4IA 2NZTA 2P9KB 3QIPA 3VQ4A 2HHVA 4H4OA 3KKSA 2OPSA 3B6PA 4FJKA 5F0XA 3NAEA 3ZEUB 3IDHA 3PO4A 5BRHA 2DFEA 2KZMA 2OTJN 1RNHA 4Z4EA 1OVQA 3VQBA 5I3UA 1VQON 3ZT0A 2P9NA 1W0HA 3VQAA 2KLAA 4H0XB 4E1JA 3TAGA 1YITN 1L3UA 4BR7A 5JVGL 2PYLA 1KVCA 1ZBLA 3K5LA 2QTDA 4GNIA 4RW8A 3HM8A 4CIEA 4MLEA 5LL6Z 4DHYA 1JLQA 1RGIA 4CFCA 2B4JA 4DV2K 2ASOA 1VQNN 1Y64A 4IO8A 1BOTO 3TPQA 2OPQA 4X66K 4DTJA 1GOCA 4B1VA 2E6LA 5HRNA 4W5QA 4I7FA 1NGFA 4CEEA 1IG8A 1VSIA 5KQ8A 1YJNN 4W5NA 1HNVA 5C2DA 4X62K 3IFRA 1TUYA 3TAMA 3WQTA 4LD0A 1S1TA 3H46O 3DRPA 1GOBA 3QERA 1K73O 1DEJA 5FPEA 4FOIA 3S3NA 4I2PA 5AQKA 4AHRA 1NGJA 4NXNK 3IRXA 3PSFA 1BWFO 2WC9A 4PHTX 2X78A 2O8FB 5CZ2A 3AO2A 3D2FB 4GVMA 2CGJA 3ID6A 3HI0A 4B1XB 3CXCM 3RMBA 2F9TA 4LSNA 4CFAA 2V7YA 1N36K 3RRGA 5HP1A 4JI2K 1TL3A 3DLEA 4FOEA 3ZSWA 3VQEA 3QO9A 4IDHA 3TTDA 2E2QA 3D2EB 3CC4N 4ZHRA 4FWQA 4KI4A 1T6DA 3V9UA 2ZM6K 3AAQA 4CBXA 2F7TA 1BA0A 1SV5A 3CJ7A 4OGCA 2Z1HA 3LPTA 1BA1A 4E7JA 4ILJA 4JKBA 2ITGA 3L6QA 3VEWA 2YNHA 4NLCA 4XIUA 3THYB 4BQLA 4FPBA 2GV9A 2P5GA 1E4FT 2Z1JA 1B9FA 3P5JA 4OGEA 4JKGA 1VSEA 3G6EN 4NCBA 4OPJA 4KI6A 2YNGA 3BUZB 2EX3A 1YF5L 1LW0A 3OYGA 4CVNE 3C6AA 4CJEA 3WT0A 4K8XA 1HPMA 2NRTA 2DTUA 1HNIA 4M42A 4I9QA 1IO2A 1NK4A 4KREA 2YKMA 2GWJA 1EKEA 1SAZA 3MN7A 2QK9A 1Q9XA 5A2QO 2NUBA 2HBLA 3AVNA 4CBUA 4W5RA 2Q1NA 5AZIB 1RDWX 2OPPA 1WUAA 4DQPA 1VQ8N 2ZJQL 3W0LA 5GAEP 3H6EA 2P9PB 3L2WA 1T05A 2V52B 1NK6A 3LDOA 1VQ7N 4FJ8A 3WNGA 4AQYK 3G4SN 3PY8A 4IBNA 2FC0A 3MDQA 2UUBK 3ZCMA 4H5RA 3UE5A 3V1QA 5HOOA 2ZJRL 2A3ZA 1YIJN 1WLJA 1QSSA 2VG5A 4B9VA 4RG8A 3VETA 4DQ8A 2JWKA 1RBRA 3OYNA 2XY5A 4JI0K 3IUCA 5KI6A 3OA9A 4CF9A 4CEOA 4W5OA 4QS7A 2BDPA 1D4XA 1QQCA 3AVFA 3MCPA 3ASMA 3NF6A 3NBPA 3KWGA 3SQ4A 3T19A 3VEOA 5JS1A 4DV5K 2D0OA 4N76A 3HSTB 1UA0A 5KGXA 4FLYA 4YOTA 1RT5A 2QWMA 4CGDA 2VYPA 4BRIA 3EKSA 1VSFA 3ULEA 3O9SA 1CZBA 2Y1JA 1QVGM 4LF7K 3TARA 3CCUN 3DM2A 3KKRA 3J7AP 1NBWA 2R7YA 1YT3A 3D2EA 2YHBA 4FWPA 5LMUK 3VENA 1N6QA 3I0SA 1BIUA 4JKHA 4JLHA 1X9SA 3AA4A 2YHYA 3ZYYX 1TKTA 3U4LA 1TAUA 1KAYA 4AF1A 2HB5A 3SZ2A 2E4LA 4I6MB 5M1PA 5J1EA 3U8XA 3V81A 5KPTA 3O80A 4FW2A 5AQSA 2HNZA 3EZWA 3TAFA 3A8YA 3ZETA 3UKUA 3K9JA 4BR2A 3I55N 1KTQA 3QINA 4JKFA 3NGZA 1ASWA 4HUEA 5AQNA 3LANA 3A5LC 1DLOA 4GMJB 4DTNA 4M3XA 4NCGA 4V19S 2GUIA 2V51B 1WSGA 2HBKA 5C15A 1QE1A 4M3ZA 1YUWA 2NRVA 1HMVA 4LY7A 3GG4A 4JKDA 3M3ZA 3CCJN 3O4WA 1FKPA 4G1QA 4ID5A 1TK0A 1VSDA 1L3SA 3FFIA 1SL1A 3AY9A 1DTTA 2Q97A 5I42A 2HVHA 3EN9A 3KTQA 2GELA 3VF2A 4KPYA 2E20A 3J7ZO 4CGGA 3CERA 5EX5A 1ITGA 3DAWA 4X64K 4O55A 1Z05A 2FLOA 2IAJA 1V4SA 3D2FA 3VA3A 2G8WA 4YOVA 5FPNA 3NE6A 2JLEA 3OYLA 2O8DB 1KCFA 4NCAA 1JLAA 1D8YA 1TV6A 2IS3A 3SAFA 1N5YA 1Q8IA 4OKJA 2P9SB 3ULDA 3WEEB 2O4IA 1ZBIA 2I7PA 2YI1A 3V9WA 3B8AX 1WN7A 4WFNL 4GKJK 1REVA 3TSPA 5GAGP 2I5JA 4DFJA 1WAFA 2Q3SA 1XI1A 3NCIA 5AQOA 4FM1A 3KK2A 1LAWA 4K0KK 4LF9K 3M1FA 4EP4A 2A6AA 3CFRA 4CGHA 3D0PA 2A1SA 3S3MA 1S1XA 3L3VA 3NH0A 2KFNA 4K42A 3AV9A 1WSEA 1U6ZA 1EWQA 4MDBA 4GV9A 1D9DA 1X1PA 1HJOA 2W6LA 2VQFK 1Y97A 1WB9A 2VGNA 2XY8A 4CF0A 3O8MA 1NJYA 4E3SA 2FBYA 3VQCA 4CJ7A 3L2VA 4A61A 3DLBA 3N4QA 1OH5A 4FK4A 2Z1IA 2QXFA 3A5NC 4I2QA 5AQVA 4BRQA 4DR6K 4YOYA 5TKWA 1ZBUA 3AVBA 5J2MA 3KVGA 4QS8A 3RR7A 3AVJA 3AVCA 3THXB 5AQTA 1QSYA 3FZKA 4G9ZA 4OLAA 1N8RO 4IEIA 2HSTA 3VQDA 4JI6K 3ZX3A 5ADXH 3LDLA 5C10A 1TKZA 3NFAA 4MO5A 3UB5A 3LDNA 3V1RA 5F2RA 3ZSRA 1UOCA 4B1YB 3VA0A 2A40A 1JLGA 4OPAA 4CZGA 4M3YA 2VWJA 3AVKA 4ISFA 3GDQA 2E1ZA 4M41A 1BQMA 3MXIA 2A42A 3M8RA 3U3GA 3HBTA 4BR4A 2VWBA 1C6VA 4OJRA 3VPZA 1O1WA 1IKVA 3NF7A 4CJSA 2XY7A 2FBXA 3DJCA 2BANA 2D1KA 1G99A 1VRTA 3JS6A 4FLUA 4LFCK 3EE8A 5JICA 4ILGB 3SBGA 1ZBHA 1KRPA 3M8QA 1IH7A 4FLVA 2IVPA 3KJVA 2KZZA 5BR8K 2QEXN 3BF3A 3SQ1A 2UXBK 4FJXA 4H0VB 2FSKA 3MEGA 5EOYA 4DF4A 3Q7CA 3TU5A 4U67L 3K5MA 3WNEA 2VCPA 3CI5A 1WSHA 2GEMA 3JYTA 2GWKA 4B8AB 4I6MA 4FJ7A 2YJFA 1A5WA 3O6WA 4GV3A 3O3GA 1ZXOA 3KIOA 2KTQA 4N56A 2V7ZA 3M5RA 1KXPA 4BG8A 2UUCK 2P9SA 4B9NA 1HKCA 4PUOA 1C0FA 3PIOL 4BWMA 1S9GA 1V4TA 1NMDA 1C0GA 3T3FA 2RN2A 4BRKA 3VTIA 1YXQA 5BPLA 1JCGA 4Q0BA 1B92A 4IFYA 1EXQA 3EO3A 4FPAA 3RMCA 1S1VA 1H1VA 1MDUB 1JLCA 4YOUA 2DFHA 4IXCA 4WQ5A 2B6AA 3CFPA 3ZEUA 1JCFA 5AJ3K 2G8VA 3DXMB 3OYFA 1JXEA 3JAMO 4BR5A 4CZLA 2KFZA 3SLCA 3HYFA 3FLCO 1YJWN 4QOZB 2NRHA 4ISGA 3QNNA 1XNQK 3HVTA 4N41A 2Q0UA 5J2PA 3VMFB 4XH4A 2RHKA 3R9PA 4EFHA 3LL3A 4C8MA 5LY3A 1U4BA 1NGBA 2IIRA 3O4NA 3OS1A 4FJGA 4JI1K 2GBZA 4BREA 1RTHA 3LP3A 1U2VB 5EY4A 3QEIA 5AQWA 4O8UA 1ZBFA 4CEFA 3O9QA 4O8KA 1NMNA 3T1AA 1NK9A 1MWKA 4DU4A 1HRHA 3C6TA 5C24A 3AAPA 4BDYA 1JL1A 3QEPA 4KO0A 4WQ5C 1T6CA 1C0TA 5IWAK 4OKKA 4B8CA 3IAYA 3I56N 4C23A 4E0DA 2ZQBA 3LP2A 1SKWA 4DSLA 2X6NA 4CEAA 1HYSA 4CIGA 3CPWM 2HHUA 5J2NA 3VERA 5AQGA 4M7YA 1X9JA 4E19A 5C12A 4CHOA 3DWLA 2W6KA 3HSCA 3KLFA 2VWKA 5D3GA 4HCBA 3QEXA 4IG3A 1BG3A 3LDSA 4BVPA 1CZAN 4YOXA 4H5VA 3J7YP 5E26A 4DUZK 3V9ZA 1SZ2A 3NVKA 4XEIA 1S6QA 1J53A 3K58A 1BCMA 3OJSA 4YFUA 3PIPL 2RKIA 3AVAA 1BISA 4CJPA 3ZSOA 4CHNA 1QHTA 4KH6A 4BY9C 3NVMA 1UA1A 3J8AA 1JKHA 1BIZA 4KHNA 5C2FA 2E1YA 4FW1A 3CJCA 1HYVA 2E2PA 5ELZA 4Z0UA 3TANA 4DG1A 3F5TA 2A1RA 4DQRA 2XO7A 2X6SA 1FK9A 4IFVA 5GIPA 1RBSA 1QHAA 4B9QA 4FK0A 4DR5K 3E9LA 5FROA 4F2SA 1NWKA 2FBVA 4DS5A 3ZT2A 1ZBSA 3SV4A 4FJIA 2W41A 3NMUA 3MX2A 1DTQA 4AHVA 4FVUA 4W5TA 4A57A 1S1UA 5DM6L 1BU6O 3NGIA 1LWEA 4QCLA 1J5OA 1RT4A 4H5TA 3H1VX 5AQFA 4CGIA 1E3MA 4DTSA 1IKWA 4IJNA 1XNRK 1JLBA 1RTJA 1J54A 3DOKA 4DSEA 1TYQB 4F3TA 2ZF5O 4FSVA 4C8OA 5BN9A 2BH1A 3E9OA 3O5BA 4R5PA 4CJTA 4HUFA 3ENOA 1Q81O 2GX9A 1NK5A 4C8LA 2G8UA 1TL1A 2HHSA 2BE2A 1KC8O 5AR0A 1S6PA 3DYAA 1NLVA 4A62A 2QWLA 3HTVA 1IBMK 3BF1A 4IG0A 2QWOA 1K9MO 1C0MA 4EZ9A 3MECA 3DOLA 4DR3K 3OYKA 3MCAB 1ATNA 5AQQA 4BE1A 5AFUH 3MWTA 4IOCL 4LF5K 1VQLN 2E2NA 5CY4A 2EHGA 3AVLA 4OX9K 2KHOA 4HUGA 1N32K 3DXKA 3OYIA 2H3GX 4IWVA 4DWIA 3OYAA 1QS4A 4JRPA 3R6MA 2E6MA 1QQNA 1NGIA 4PWDA 1GLFO 5KQDA 3MMVA 2FSNA 1VQKN 4YOWA 4Y0WA 2D5RA 3LPUA 3VQ7A 2YKNA 2AJQA 4IDKA 1HR0K 3I0RA 1NKBA 4PKIA 3U9DA 3C6UA 1QQOA 4OO1J 3L4QA 3O9RA 2O8DA 2PFUA 3VGMA 3AO5A 3SAHA 3HVRA 3PSIA 4CJFA 1VSMA 3IS9A 3WUHA 3OS0A 4FYDA 3W3DA 5KRSA 4DV7K 2PAVA 4F8RA 1HKBA 3KD1E 4AHCA 5AQXA 3H3OB 1KD1O 4NB4A 3KLIA 2YJEA 5EU7A 1VHXA 1X9MA 2P9NB 3CD6N 3O4QA 4BRGA 4Z4FA 4CI6A 3C0BA 3V9SA 4CJVA 3SUOA 4JD2B 3SPYA 3B6OA 2VG7A 1SL2A 2GTDA 4Y1DA 5MLCQ 2G8KA 1T44A 3NGYA 4E1MA 4DSJA 1QZ5A 2AA4A 4JYAK 1LW2A 1WNSA 4BR9A 2O8EA 1T3VA 1VQ4N 4KHWA 1TKXA 3THVA 3ZETB 4O0JA 2FBTA 1IKXA 2ZWHA 5LJWA 4FVMA 1OKJA 4NO7A 1NNEA 4CK3A 4IZ9A 3ZX2A 3H45C 2E5LK 3HJFA 3NH1A 1NJXA 4LH4A 4FZZA 4B9MA 2X74A 4CJQA 4CECA 3P39A 1NGEA 3VQPA 2O8FA 3FZMA 4DR4K 3C7NA 3OTOK 3L2QA 3C65A 3DXMA 3EY1A 1L3VA 3VESA 5HLFA 3ZT3A 4KHQA 1SQKA 4FL9A 4YY3K 4CJ5A 1MWMA 3DRRA 4JRQA 2P9IA 3VQQA 3PUFA 2FF6A 4CHYA 4BE0A 4FWRA 4ID1A 1XHXA 3SI6A 4KRFA 3F73A 1FW6A 2PBDA 1KVBA 1GLAG 4DQSA 2QI2A 5BN8A 3OBWA 4CK2A 1NK8A 4CF2A 4BRCA 3VEXA 4DV1K 1S22A 5C42A 1GLJO 3ALYA 4H0YB 5JLHA 2Q36A 4BRMA 4A5AA 3HOSA 3M8PA 3LAKA 1M1KO 2ATQA 3O1WA 1RDBA 1HX1A 3DLKA 2DPNA 2QKKA 2DFFA 4JK9A 4KHUA 4Z94A 2Q31A 1QTMA 1Z6RA 4H0TB 1GLDG 3RMAA 4DTPA 2G8IA 5JMVA 3OYMA 4A5BA 3CHWA 1KVAA 3ZSZA 3L0QA 4BR0A 1XWLA 4ILHA 2XHBA 2F8TA 4HCCA 1Z25A 3F2KA 3NH2A 4CGJA 4QAGA 1EETA 3RSEA 1YI2N 5AZJB 1IJJA 4H03B 1RTIA 3WNFA 4AHSA 3THXA 4MQ3A 2HOEA 3U6FA 3DXKB 3TAPA 3SQ0A 2HHHK 3G25A 1S9EA 4F4KA 3VTHA 3C94A 4WQ4C 2P51A 2HF3A 3WNHA 3ZSVA 2JGUA 3OYDA 4F3OA 4M3TA 1YJ9N 3JSMA 3AVGA 5M1NA 1U48A 1LWCA 3K9KA 5DK5A 1QQMA 2WTUA 4RW9A 5HRRA 3N4PA 5FDLA 1BGXT 1KLNA 4DSFA 2HNDA 3TWHA 1IKYA 4O4GA 3KLHA 4GY2B 1VRUA 3RWUA 4U7BA 3SJHA 3AGRA 3T7ZA 1C1AA 4CJ3A 4DCHA 4DMNA 1UAXA 3DLGA 1TGOA 1FJGK 1MA9B 5C25A 4MO4A 4F9OA 3WXLA 5TKYA 4FM0A 4MFBA 4F2RA 4ZTJA 3F9MA 3AVMA 3FE1A 3HK2A 4FLWA 3H08A 1NOZA 1RT2A 2P9UB 3VF4A 3P4IA 3TSQA 4RWTA 4GKKK 3AO3A 3K59A 4M3WA 3LM9A 1UWBA 2HVIA 3O08A 3QICA 4AHTA 1TK8A 1HQUA 3HP9A 4CZMA 3D7EO 4RCHA 4X65K 3O3HA 5CR4A 3A0IX 1WOQA 4O5BA 3R8EA 3PX0A 3BDPA 1Q18A 3ATUA 4LFAK 4AILC 1HJRA 4FK2A 3QIOA 3VQ9A 4H5NA 4CJUA 4H0PA 2NRRA 3DLLL 4CEDA 1P90A 2NNWA 1RDCA 5JVHL 2CGKA 2Q0RA 4KFBA 3G10A 4CFBA 4UQGA 1R0AA 4BRFA 4CZFA 3A2FA 4JI7K 1X3MA 3CQYA 5GIOA 4DR7K 3LWMA 2CH5A 4CJWA 5AQHA 4DU3A 1YAGA 5SWMA 4UY8O 1HUXA 1WBDA 3VEVA 5CYQA 3M8SA 1RILA 3RMDA 4N5SA 3U3YA 4K8ZA 4KTZA 2W42A 1RDDA 5HROA 2P9KA 5FPMA 5E84A 1YHQN 1T03A 2Q2RA 2BUPA 2EWSA 2HNYA 1CXQA 3HXMA 1NK0A 3A5MC 3U9ZA 4B9LA 4KHSA 3TI0A 1FXXA 3P31A 1LOTB 5AQYA 4WCEL 3LP1A 3CC7N 3AA2A 1TUUA 3AVIA 2FF3B 3LAMA 4FJLA 5LJVA 3VQ5A 3SUNA 3ID8A 3QFUA 4JI5K 1SUQA 2ZJPL 3SV3A 2G8FA 3HRGA 4EIAA 3ENBA 2AP1A 4E7IA 4NLBA 1GOAA 2VGMA 1P8ZA 2E2OA 1ATSA 2QWQA 5GINA 4CW7B 3CG7A 1K8KB 3RR8A 4TSXA 2BGGA 3T1YK 1OVYA 3OS2A 5GAHP 1L3TA 2ZGZA 3ZX0A 4E1NA 4H0OA 4CZIA 4CIFA 2NLXA 4FJHA 3TTCA 3GBTA 4JI4K 5FRMA 3KK3A 2FSJA 3WXJA 2IGIA 2VQEK 1BCOA 1ASUA 4FLXA 1EQYA 4CZHA 2O8CB 4LF6K 3LZJA 3CC2N 1U04A 3KD5E 1C0UA 4LFBK 4FWSA 4BGAA 1RBVA 1KFDA 1KAXA 5ADXA 1XC9A 3MEDA 1U2VA 3O1BA 4BDZA 3G0ZA 5EVZA 3MXMA 3WXKA 4BC2A 5AQIA 4KHYA 1XMQK 4DSKA 3ZT1A 3C7NB 3L2RA 5BPNA 4C8NA 3SJJA 3EE9A 3LWLA 5AQJA 3OVNA 4FCYA 3CFOA 4AM6A 3VQ6A 3VGLA 3HOTA 4B1ZA 1CZ9A 2QWPA 2WBNA 5AZIA 3Q7BA 4KH4A 1U45A 1VQPN 3BZKA 3NHGA 4FWNA 3SUPA 2FXUA 3ZLJA 2P9PA 4BRHA 2IOCA 3FZLA 3GL1A 4LC9B 1RCHA 2ITMA 5M1OA 3OYHA 2HHTA 3BY5A 1TKDA 4OPKA 4BC5A 4EHUA 2HMIA 1SS6A 3QNOA 2WONA 1YVNA 3CJAA 2YHWA 3QLHA 2OA8A 1NGGA 2UU9K 1DKGD 1WSJA 5I9EB 4HHTA 1BL3A 3CM5A 3WXIA 3O9TA 3VQ8A
chains in the Genus database with same CATH topology
2NRXA 1ATRA 5AQXA 3QBXA 3SAFA 3H3OB 1KD1O 1Q7YO 3MN9A 4NB4A 2P9SB 2YJEA 2E8AA 3WEEB 2NRZA 3WXMB 4PL8A 2P9NB 4KH5A 3CD6N 3E9PA 2WUSA 4BRGA 4CI6A 3C0BA 2I7PA 5AQZA 2YI1A 3B8AX 3ULEB 4JD2B 2YX6A 4HTLA 4JK8A 4WFNL 3LM2A 2GTDA 3H3NO 3TSPA 2D0PA 4K25A 5GAGP 3GOIA 5MLCQ 2QWRA 3MWPA 1T44A 1QZ5A 2AA4A 5AQOA 1JCEA 4BR9A 1T3VA 5AQMA 1VQ4N 3M1FA 2A6AA 3VEZA 4C1NK 3MK6A 4B1UB 5C0YA 3ZETB 4JK7A 1GLCG 4HWIA 2ZWHA 3O9UA 2GUPA 4WQ4A 5LJWA 4K42A 1K8KA 1OKJA 3CIPA 1U6ZA 4NO7A 4IOXA 4JD2A 3E1YA 1X3NA 3QFPA 4MDBA 4GV9A 2HMPA 2D4WA 5M1KA 1VQMN 4IZ9A 3ZX2A 2QW9A 4JKGB 3H45C 1HJOA 5DM7L 4FWMA 4BGBA 2VGNA 1Q86O 2I7NA 2UYTA 3O8MA 3P39A 4CJ7A 1NGEA 1RDUA 3QMLA 3CCSN 4A61A 3HZ6A 3N4QA 3A5OC 4JNEA 1R59O 3AGKA 3SMPA 3FZMA 5AQUA 3KK7A 2YHXA 3C7NA 3A5NC 1HLUA 5AQVA 4BRQA 4R79A 3C65A 4JHDB 3DXMA 1Q82O 3VESA 4YOYA 3JXUA 5TKWA 2J4RA 3KVGA 4QS8A 3CPEA 1SQKA 4FL9A 5AQTA 1MWMA 3FZKA 4G9ZA 1N8RO 3SK3A 2JWLA 4IEIA 2HSTA 3R1XA 3ZX3A 1HKGA 3BEXA 3LDLA 4BC4A 5ADXH 4WFAL 2P9IA 3IKMA 5C10A 2FF6A 4FWRA 4MO5A 2QWNA 3UB5A 1XUPO 3LDNA 5M1QA 5F2RA 2PBDA 1K8AO 4B1YB 2A40A 1NGAA 1GLAG 1XQSC 2QI2A 4OPAA 4CZGA 5BN8A 3EKUA 3OBWA 3D6RA 2P9LB 4ISFA 3GDQA 3SMSA 2E1ZA 3CJ9A 2RE2A 4YORA 1ILYA 3CCVN 5EXWA 1BDGA 2A42A 3M6GA 4CZEA 4BRCA 3VEXA 3HBTA 4BR4A 3P38A 2QM1A 1S22A 5AQPA 2VWBA 4CZKA 1GLJO 3VPZA 4BRLA 3CCQN 4H0YB 4BROA 5JLHA 4MLHA 4RTFD 2Q36A 4BRMA 4A5AA 4BC3A 2CGLA 3HOSA 1ZC6A 4FWLA 1M1KO 3DJCA 3KZBA 2D1KA 3O1WA 1G99A 5B8HA 1HX1A 2DPNA 3JS6A 5AZJA 4JK9A 1VQ6N 4Z94A 2Q31A 4JN4A 3EE8A 3VOVA 1NM1A 1Z6RA 4K41A 4BQZA 5JICA 3FGUA 3MN6A 4H0TB 4ILGB 1GLDG 3SBGA 3TTFA 4BRDA 1LCUA 5JMVA 2IVPA 2A41A 4A5BA 3CHWA 4FO0A 3E66A 4BVOA 2QEXN 3BF3A 5BR9A 3FR0A 4YDUC 2A5XA 3L0QA 4H0VB 4AM7A 4BR0A 2FSKA 5EOYA 2QXLA 3FFKB 4ILHA 4XH1A 3Q7CA 2ZGYA 3F2KA 3TU5A 1KQSM 5CE3A 3QDKA 4U67L 2NZTA 2P9KB 2VCPA 3CI5A 2GEMA 4CD3A 3RSEA 2GWKA 1YI2N 5AZJB 1IJJA 4I6MA 4DB3A 3R3LA 5F0XA 2YJFA 2CH6A 2HBJA 3O6WA 4H03B 3ZEUB 3IDHA 4IFEA 4GV3A 5BRHA 1ZXOA 1ESVA 3BP8A 2OTJN 2HOEA 2V7ZA 4DKWA 5KPRA 3DXKB 3M5RA 1KXPA 4BG8A 1BUPA 2P9SA 3G25A 1VAZA 1HKCA 1VQON 3ENHA 4E1JA 2P9NA 3VTHA 2KLAA 1C0FA 4H0XB 4WF9L 1GLLO 1YITN 4WQ4C 1O13A 4BR7A 2HF3A 3PIOL 3TSUA 2NRWA 5JVGL 1YJ9N 4A59A 1V4TA 4BRNA 2QTDA 1NMDA 4GNIA 5M1NA 1C0GA 3HM8A 3AARA 3K9KA 1QQMA 4MLEA 4CD1A 4DHYA 4BRKA 3VTIA 1YXQA 3N4PA 1RGIA 1JCGA 4JKAA 5BPLA 2HF4A 3KHYA 4YDUA 3EO3A 4FPAA 2ASOA 1VQNN 1Y64A 4CZJA 4IO8A 4QS9A 1BOTO 3TPQA 1H1VA 4GY2B 1MDUB 1E4GT 4B1VA 3SJHA 4U7BA 4YOUA 3MN5A 3CJBA 3AGRA 4IXCA 1NGFA 4WQ5A 3T7ZA 3ZEUA 5H1SQ 1IG8A 3LDPA 5KQ8A 1YJNN 5GADP 1JCFA 4DCHA 2IVNA 5C2DA 3IFRA 3DXMB 1TUYA 1MA9B 3WQTA 4MO4A 4F9OA 3H46O 4L3QA 3OHRA 3WXLA 5TKYA 3CCEN 4BR5A 4CZLA 1K73O 3SLCA 1DEJA 1TYQA 3FLCO 3F9MA 1YJWN 2NRHA 4C1NI 4ISGA 3FE1A 5FPEA 4FOIA 5AQKA 2Q0UA 2W40A 4FWOA 1NGJA 3VMFB 2P9UB 2RHKA 4XH4A 3R9PA 3VF4A 1BWFO 2WC9A 4PHTX 4EFHA 3P4IA 3LL3A 4JKEA 3TSQA 5LY3A 4RWTA 4IO9L 1NGBA 2IIRA 2E88A 3D2FB 3LM9A 1RFQA 4BRAA 2OTLN 2CGJA 3ID6A 3HI0A 3O9TA 4B1XB 4BREA 3O08A 5EY4A 1U2VB 3QICA 3CXCM 4CZMA 2F9TA 3D7EO 2V7YA 4RCHA 5AQWA 4O8UA 5CR4A 4IEEA 3A0IX 1WOQA 3O9QA 4O8KA 3R8EA 1Q18A 1MWKA 1M90O 3ATUA 2IVOA 4FOEA 3VEYA 3RVCA 3AAPA 3CCLN 4IDHA 4IJAA 3TTDA 2E2QA 2WFBA 5BRDA 3D2EB 4PL7A 4WQ5C 1T6CA 3RSEB 3CC4N 4FWQA 4GV6A 5AFUA 3I56N 1T6DA 4C23A 4H5NA 4H0PA 2NRRA 3DLLL 3GE1A 4EAHD 1P90A 3AAQA 4CBXA 2F7TA 2NNWA 4M7XA 5JVHL 3EL2A 1BA0A 3CJ7A 3CPWM 2CGKA 1VQ9N 2Q0RA 1NJIO 3CETA 1BA1A 4ILJA 4JKBA 3L6QA 3VERA 4BRFA 5AQGA 3VEWA 4M7YA 1X9JA 4PKHA 4CZFA 3CJ1A 4NLCA 5C12A 3OW2M 3DWLA 4BQLA 4FPBA 1X3MA 3CQYA 5GIOA 3HSCA 1E4FT 1NGHA 4CBWA 5KPZA 2CH5A 5AQHA 1BG3A 1YAGA 4J8FA 4BVPA 3MX5A 1CZAN 4YOXA 4H5VA 4XH5A 1HUXA 4UY8O 4JKGA 3VEVA 3G6EN 2QA4N 5E26A 3T69A 3BUZB 2OANA 1YF5L 1SZ2A 3NVKA 3C6AA 4XEIA 3WT0A 3VF6A 1HPMA 2NRTA 3ATVA 4PKGA 3PIPL 4A2AA 2P9KA 5FPMA 5E84A 4A2BA 1YHQN 4JAXA 2Q2RA 2BUPA 2EWSA 3CMAN 2P9IB 3A5MC 3U9ZA 2GWJA 4KH6A 3SAGA 1SAZA 3MN7A 3P31A 4BY9C 1VQLN 1LOTB 5AQYA 4WCEL 2HBLA 3NVMA 3J8AA 3CC7N 5BRFA 4CBUA 5C2FA 1QVFM 2Q1NA 2E1YA 1TUUA 1RDWX 5AZIB 2FF3B 1WUAA 3CJCA 5FPDA 4WYBA 2E2PA 5ELZA 1VQ8N 2ZJQL 3W0LA 5GAEP 5LJVA 1NGDA 3H6EA 2ASPA 3F5TA 2P9PB 5AQLA 3ID8A 3QFUA 2V52B 2ZJPL 3C6HA 3LDOA 1VQ7N 3KWIA 5GIPA 1QHAA 3HRGA 4B9QA 3G4SN 2F9WA 4EIAA 3MDQA 3E9LA 4H5RA 3UE5A 5HOOA 4JEPA 1NWKA 2YCHA 2AP1A 3ENBA 2A3ZA 2ZJRL 1ZBSA 1YIJN 4NLBA 5JLFA 2W41A 1DGKN 3NMUA 3MX2A 2VGMA 3VETA 4DQ8A 2JWKA 4FVUA 4A57A 1P8ZA 2E2OA 1ATSA 1BU6O 2BTFA 2P9UA 3IUCA 2QWQA 3OA9A 5DM6L 5GINA 4K43A 3OBYA 3QB0A 1NGCA 1K8KB 1J6ZA 4H5TA 4QS7A 1D4XA 1OVYA 3H1VX 3MCPA 3CMEN 5AQFA 5GAHP 3KWGA 3WQUA 2ZGZA 1XC3A 4IJNA 4H0OA 3VEOA 3ZX0A 4CZIA 1S72N 1TYQB 2D0OA 3CCMN 5BPMA 2NLXA 2ZF5O 4FSVA 3TTCA 3GBTA 5BN9A 2BH1A 3E9OA 4YOTA 3O5BA 2FSJA 3H1QA 5BREA 3UKUB 3WXJA 3I8BA 3ENOA 1BO5O 1EQYA 2QWMA 4CZHA 1Q81O 2GX9A 2VYPA 3CC2N 4BRIA 4BG9A 3EKSA 3L4IA 5M1FA 1GLBG 4FWSA 4BGAA 3ULEA 3O9SA 3UKRA 1KAXA 1QZ6A 5ADXA 1W2BM 4GVEA 1QVGM 5AR0A 1KC8O 3CCUN 4B1WB 1NLVA 1NBWA 1U2VA 2QWLA 3O1BA 3HTVA 3QBWA 3WEEA 4A62A 3BF1A 3D2EA 4FWPA 5EVZA 3SBTA 2KKZA 3WXKA 2QWOA 3VENA 4BC2A 5CHIA 3I33A 5AQIA 3CCRN 3CF5L 1K9MO 3C7NB 5BPNA 4WFBL 4JKHA 3EE9A 2ASMA 5AQJA 3MCAB 3PLAA 1ATNA 2HBMA 2YHYA 3ZYYX 3U4LA 4OPHA 1KAYA 4AF1A 2P9LA 5AQQA 4AM6A 5AFUH 3MWTA 4I6MB 5M1PA 4IOCL 3UKRB 3VGLA 4ISEA 3HOTA 2E2NA 2QWPA 2WBNA 3Q7BA 4KH4A 5AZIA 3U8XA 3VGKA 4JKCA 4B1ZA 3O80A 5KPTA 5AQSA 3EZWA 1VQPN 5AQRA 4IOAL 3A8YA 3ZETA 3UKUA 2KHOA 3K9JA 4FWNA 4MDAA 4BR2A 3DXKA 3I55N 2H3GX 2FXUA 4JKFA 4IWVA 5AQNA 1VQ5N 2P9PA 4BRHA 3R6MA 1W97L 3A5LC 3FZHA 1QQNA 1NGIA 3FZLA 1GLFO 3GL1A 5KQDA 4LC9B 4EHTA 3MMVA 2FSNA 1GLEG 1DT9A 2V51B 2ITMA 1VQKN 5M1OA 1S3XA 2HBKA 4Y0WA 5C15A 4YOWA 1EO1A 1JJ2M 5HL7L 1YUWA 2NRVA 4JKDA 3GG4A 3CQXA 3CCJN 3M3ZA 3O4WA 4JHDA 4BC5A 4EHUA 4BRPA 3AY9A 4H5WA 1SS6A 2Q97A 4PKIA 3U9DA 3EN9A 2GELA 3VF2A 1QQOA 1YVNA 2E20A 3J7ZO 4OO1J 3CERA 3CJAA 2YHWA 3L4QA 4FWKA 3O9RA 4KBOA 3G71N 1NGGA 2PFUA 3VGMA 5EX5A 3S41A 3DAWA 1DKGD 3SAHA 3FZFA 3LDQA 5F1XA 5I9EB 4M63C 1Z05A 2FLOA 1V4SA 3D2FA 4O5FA 3WUHA 1KAZA 5FPNA 4YOVA 3WXIA 3W3DA 3IMXA 2PAVA 1HKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K O;  5DM6 L;  1M90 O;  1KD1 O;  1Q7Y O;  1VQ6 N;  1OVY A;  3CD6 N;  3CCL N;  3CME N;  5GAH P;  3CC4 N;  1S72 N;  4WFN L;  2QEX N;  3I56 N;  3CCM N;  5GAG P;  5MLC Q;  3DLL L;  1KQS M;  5JVH L;  1VQ4 N;  3CPW M;  4U67 L;  1VQ9 N;  1Q81 O;  1NJI O;  3CC2 N;  1YI2 N;  3OW2 M;  1KC8 O;  1W2B M;  1QVG M;  2OTJ N;  3CCU N;  1VQM N;  1VQO N;  3CCR N;  3CF5 L;  5DM7 L;  4UY8 O;  1K9M O;  4WF9 L;  2QA4 N;  1YIT N;  3G6E N;  4WFB L;  3PIO L;  1Q86 O;  5JVG L;  1YJ9 N;  3CCS N;  4IOC L;  1VQL N;  3PIP L;  4IOA L;  1VQP N;  1YHQ N;  1Q82 O;  1VQN N;  3I55 N;  3CMA N;  1VQ5 N;  1N8R O;  5H1S Q;  4WCE L;  1YJN N;  5GAD P;  3CC7 N;  1VQK N;  4WFA L;  1QVF M;  1JJ2 M;  5HL7 L;  3CCJ N;  3CCE N;  1K73 O;  1K8A O;  1VQ8 N;  2ZJQ L;  1YJW N;  5GAE P;  2ZJP L;  1ILY A;  3J7Z O;  1VQ7 N;  3CCV N;  3G71 N;  4IO9 L;  3G4S N;  2OTL N;  2ZJR L;  3CCQ N;  1YIJ N;  3CXC M; 
#chains in the Genus database with same CATH topology
 2NRX A;  1ATR A;  4B9T A;  1FKO A;  4N47 A;  1Q7Y O;  2YNF A;  2PY5 A;  3MAQ A;  4EP5 A;  3WXM B;  4PL8 A;  3SPZ A;  3E9P A;  5T7B A;  3BGR A;  1NU0 A;  5AQZ A;  4PQU A;  4FZX C;  3ULE B;  4FJ5 A;  4L8R B;  4JK8 A;  3UIQ A;  3GOI A;  4B3O A;  2QWR A;  3MWP A;  4DTX A;  3TAQ A;  1WBB A;  4Z4C A;  4CHQ A;  5CYM A;  1ZYQ A;  3VEZ A;  4M3R A;  2LSN A;  2KQ2 A;  2HHX A;  4B1U B;  5C0Y A;  3LAL A;  4DLG A;  1S1W A;  1WSF A;  4JK7 A;  1RBT A;  4WQ4 A;  2O8B A;  4J2B A;  1KLM A;  1K8K A;  1RT7 A;  3CIP A;  4CER A;  4IOX A;  1YVU A;  3PO5 A;  2D4W A;  5M1K A;  1VQM N;  2ETJ A;  3DLH A;  1LAV A;  2VG6 A;  4OLB A;  1J5E K;  4B3R K;  4Z4G A;  1NKC A;  4FWM A;  4BGB A;  3SUQ A;  3OYB A;  5SZT A;  2UYT A;  4Y1C A;  4DV6 K;  4EZ6 A;  1BHL A;  1RDU A;  4JNE A;  3A5O C;  3AGK A;  3SMP A;  5AQU A;  2F4V K;  5K14 A;  1SKR A;  1RDA A;  2OPR A;  3JXU A;  4DFP A;  3CPE A;  3S3O A;  2OCE A;  3OYJ A;  5FLX O;  2JWL A;  3L3U A;  3R1X A;  1HKG A;  4NYF A;  3HPG A;  1MU2 A;  4KHP K;  4E7K A;  4CE9 A;  5M1Q A;  2D0A A;  3HM9 A;  1NGA A;  3P83 D;  4AH9 A;  1Q9Y A;  3EKU A;  3D6R A;  4CEZ A;  1HYZ A;  3SMS A;  3HT3 A;  1ILY A;  1TK5 A;  3CCV N;  2Y1I A;  3M6G A;  4CZE A;  1I3A A;  3SYZ A;  4PA1 A;  2QM1 A;  4BRL A;  3CCQ N;  1TVR A;  2DY4 A;  4MLH A;  3DI6 A;  4BC3 A;  2CGL A;  5DMR A;  3KZB A;  3AO1 A;  5B8H A;  1VQ6 N;  4BQZ A;  3OJU A;  1NM1 A;  3FGU A;  4BRD A;  3TTF A;  1LCU A;  2A41 A;  2O8B B;  2IC3 A;  3TAE A;  3E66 A;  4BVO A;  3HP6 A;  3QEW A;  1QSL A;  4KAZ A;  3FR0 A;  4YDU C;  4DTR A;  4AM7 A;  3OY9 A;  2QXL A;  3FFK B;  1NOY A;  1KQS M;  2ZGY A;  5CE3 A;  3QDK A;  4YNQ A;  3KK1 A;  4CD3 A;  4DLE A;  3AVH A;  4KTQ A;  1VSJ A;  4DB3 A;  3R3L A;  2CH6 A;  2HBJ A;  4IFE A;  1JLF A;  1ESV A;  3BP8 A;  3CQ8 A;  2OZM A;  3L2U A;  5KPR A;  4DKW A;  3RRH A;  2RF2 A;  4C8K A;  1BUP A;  1VAZ A;  3ENH A;  4WF9 L;  1VSK A;  1GLL O;  1O13 A;  4FJJ A;  3TSU A;  2NRW A;  3PX6 A;  4A59 A;  4BRN A;  3ZSQ A;  3AAR A;  1I94 K;  3T1H K;  4CD1 A;  3AO4 A;  1OH7 A;  1U47 A;  4JKA A;  4I9L A;  2HF4 A;  3KHY A;  4YDU A;  1LV5 A;  3V6D A;  4OVL A;  4CZJ A;  4QS9 A;  4LF8 K;  1E4G T;  2O8E B;  4CJK A;  1WAJ A;  3MN5 A;  3CJB A;  4B9S A;  1T8E A;  5H1S Q;  3LDP A;  2YNI A;  1N33 K;  5GAD P;  2IVN A;  1A5V A;  3AA5 X;  3E01 A;  4L3Q A;  3OHR A;  3CCE N;  2O4G A;  1VSL A;  1TYQ A;  4NYN A;  4C1N I;  3OYE A;  2UUA K;  4BAC A;  4DSI A;  2W40 A;  4FWO A;  4LF4 K;  4ELU A;  5LMN K;  3EYZ A;  4DF8 A;  1K6Y A;  4JKE A;  4IO9 L;  2E88 A;  1KFS A;  4BRA A;  1RFQ A;  2OTL N;  4Q5V A;  3BZC A;  4DV4 K;  4CHZ A;  5J2Q A;  2PYJ A;  4IEE A;  1CLQ A;  4J2A A;  1M90 O;  4O0I A;  2IVO A;  4PY5 A;  4KTW A;  3VEY A;  3RVC A;  3CCL N;  4IJA A;  2WFB A;  5BRD A;  1C1C A;  3RSE B;  4PL7 A;  4DTO A;  2XRI A;  1L5U A;  4GV6 A;  5AFU A;  1BI4 A;  3HPO A;  2F96 A;  4BWJ A;  4CGF A;  3GE1 A;  1SKS A;  4EAH D;  4HVJ A;  4M7X A;  3EL2 A;  1RBU A;  1VQ9 N;  1NJI O;  3CET A;  3K5N A;  4BE2 A;  3O3F A;  1JL2 A;  1I39 A;  3S9H A;  4PKH A;  3CJ1 A;  3OW2 M;  2WOM A;  4E89 A;  2QKB A;  1NGH A;  4CBW A;  5KPZ A;  1IBK K;  4J8F A;  3MX5 A;  4XH5 A;  2QA4 N;  4DQQ A;  1XHZ A;  1NK7 A;  3T69 A;  2OAN A;  4CF8 A;  1IG9 A;  4B3S K;  4CCH A;  3VF6 A;  2OYQ A;  5JS2 A;  3ATV A;  4ELV A;  4PKG A;  4A2A A;  2O8C A;  4O44 A;  4A2B A;  4JS5 A;  1JXB A;  4JAX A;  3CYM A;  3CMA N;  1NJZ A;  2UXD K;  2P9I B;  5IT9 O;  3SAG A;  3KLE A;  1YTU A;  2PZS A;  4FLT A;  3F9K A;  5BRF A;  1OH6 A;  3KLG A;  3HL8 A;  4DFM A;  1QVF M;  4FLZ A;  3ZSY A;  4CJ4 A;  1HQE A;  5FPD A;  4WYB A;  2G8H A;  4J2E A;  4JI3 K;  1NGD A;  4FJ9 A;  2ASP A;  5AQL A;  1Z26 A;  3C6H A;  3KWI A;  3THW A;  2F9W A;  1EP4 A;  4JEP A;  2YCH A;  5JLF A;  5CZ1 A;  3MXJ A;  4M3U A;  1DGK N;  4H8K A;  4CEB A;  3IG1 A;  3THY A;  2P9U A;  2BTF A;  4K43 A;  3OBY A;  3QES A;  3QB0 A;  1NGC A;  3K2P A;  4J2D A;  1J6Z A;  3ZT4 A;  4GW6 A;  4LSL A;  1SL0 A;  1RT1 A;  3HPH A;  3CME N;  2D0B A;  2B5J A;  3WQU A;  2D0C A;  4RW4 A;  1XC3 A;  1S72 N;  4H4M A;  3K5O A;  3CCM N;  5BPM A;  1S5J A;  2OZS A;  3EZ5 A;  4FXD A;  1D9F A;  5KTQ A;  3H1Q A;  5BRE A;  3UKU B;  3I8B A;  1BO5 O;  2F8S A;  4CHP A;  3V4I A;  4NXM K;  5KRT A;  4BG9 A;  3L4I A;  5M1F A;  1GLB G;  4B9U A;  3UKR A;  1QZ6 A;  1W2B M;  4GVE A;  4FM2 A;  4RW7 A;  4B1W B;  5E41 A;  3QBW A;  3WEE A;  3SBT A;  3V9X A;  2KKZ A;  5CHI A;  3CCR N;  3CF5 L;  3I33 A;  4CEQ A;  3NDK A;  3THW B;  4E7H A;  4WFB L;  4CES A;  2ASM A;  2YHA A;  3PLA A;  2P5O A;  2HBM A;  3ITH A;  2RPI A;  4OPH A;  2P9L A;  3SNN A;  3UKR B;  4ISE A;  3VGK A;  4CF1 A;  4JKC A;  4IOA L;  5AQR A;  1F21 A;  1HNW K;  4MDA A;  3ISN C;  1EX4 A;  3K57 A;  4DV0 K;  1VQ5 N;  4B3T K;  4OKE A;  1W97 L;  3FZH A;  4BDP A;  1VK0 A;  4JI8 K;  4WE1 A;  4EHT A;  4DTU A;  3ZSX A;  3DRS A;  1GLE G;  1DT9 A;  1S3X A;  3C95 A;  1EO1 A;  1NKE A;  1JJ2 M;  5HL7 L;  4KV8 A;  4M45 A;  3CM6 A;  3CQX A;  4JHD A;  1YTA A;  4B3M K;  4BRP A;  2HHQ A;  4FJM A;  4H5W A;  4FZY A;  3PV8 A;  4DTM A;  4DUY K;  4FWK A;  4KBO A;  3G71 N;  1C1B A;  3S41 A;  1VSH A;  3TR8 A;  3LZI A;  3MEE A;  3FZF A;  3LDQ A;  4B08 A;  5F1X A;  4M63 C;  4KB0 A;  1W7A A;  4O5F A;  4ICL A;  1KAZ A;  4DR1 K;  1KSP A;  3IMX A;  4DFK A;  4JS4 A;  3MN6 A;  1IV0 A;  3TAB A;  4AHU A;  3QBX A;  2Z1G A;  2UXC K;  4E7L A;  3MN9 A;  4IKF A;  3SCX A;  2E8A A;  1WSI A;  2NRZ A;  4FJN A;  4KH5 A;  2WUS A;  3I8D A;  1NG9 A;  2YX6 A;  4HTL A;  1D5A A;  2ZD1 A;  3H3N O;  3LM2 A;  1ASV A;  2D0P A;  4K25 A;  1RTD A;  1HNZ K;  1JCE A;  2YV0 X;  1G15 A;  5AQM A;  3P1G A;  4C1N K;  5KGW A;  3MK6 A;  1GLC G;  4HWI A;  3O9U A;  2GUP A;  4LH5 A;  3QEV A;  4CJR A;  3VN5 A;  4JD2 A;  3E1Y A;  1X3N A;  3QFP A;  3L8B A;  4DS4 A;  2XY6 A;  4KB1 A;  2HMP A;  4CFD A;  2QW9 A;  4JKG B;  3SQ2 A;  5DM7 L;  1T7P A;  1U49 A;  1J9A A;  1OH8 A;  1W9H A;  1Q86 O;  3NF8 A;  2I7N A;  3EEQ A;  3NF9 A;  3CCS N;  3QML A;  1HPZ A;  3HZ6 A;  1NJW A;  4Z4H A;  1R59 O;  3PX4 A;  3V1O A;  3DLR A;  3KK7 A;  2YHX A;  4RW6 A;  3J80 O;  1HLU A;  4R79 A;  1TAQ A;  3DMJ A;  1IBL K;  4JHD B;  1Q82 O;  3OYC A;  2HW3 A;  4DQI A;  4ELT A;  4JV5 K;  4CK1 A;  2J4R A;  4CJL A;  3SK3 A;  3RTV A;  1BI4 B;  3BEX A;  1X9W A;  4BC4 A;  4WFA L;  3QET A;  3IKM A;  2QWN A;  3D45 A;  1XUP O;  1K8A O;  1XQS C;  3AA3 A;  3J81 O;  2ZE2 A;  2P9L B;  1LWF A;  1RT6 A;  5HRP A;  3CJ9 A;  2RE2 A;  4YOR A;  4ZTF A;  5EXW A;  2HHW A;  1BDG A;  1EWR A;  3P38 A;  5AQP A;  4DR2 K;  4HTU A;  4CZK A;  4BRO A;  4RTF D;  4KKO A;  4DV3 K;  1ZC6 A;  5FRN A;  4FWL A;  2P1J A;  1RT3 A;  3HO1 A;  2KW4 A;  5HRS A;  1HNX K;  1JLE A;  5AZJ A;  1A5X A;  1N34 K;  4JN4 A;  3VOV A;  4K41 A;  4DU1 A;  2IDO A;  1B9D A;  1XMO K;  4YHH K;  4FO0 A;  5BR9 A;  2A5X A;  1CXU A;  4XH1 A;  5HBM A;  1BQN A;  3LP0 A;  3K0S A;  4Z4I A;  2NZT A;  2P9K B;  3QIP A;  3VQ4 A;  2HHV A;  4H4O A;  3KKS A;  2OPS A;  3B6P A;  4FJK A;  5F0X A;  3NAE A;  3ZEU B;  3IDH A;  3PO4 A;  5BRH A;  2DFE A;  2KZM A;  2OTJ N;  1RNH A;  4Z4E A;  1OVQ A;  3VQB A;  5I3U A;  1VQO N;  3ZT0 A;  2P9N A;  1W0H A;  3VQA A;  2KLA A;  4H0X B;  4E1J A;  3TAG A;  1YIT N;  1L3U A;  4BR7 A;  5JVG L;  2PYL A;  1KVC A;  1ZBL A;  3K5L A;  2QTD A;  4GNI A;  4RW8 A;  3HM8 A;  4CIE A;  4MLE A;  5LL6 Z;  4DHY A;  1JLQ A;  1RGI A;  4CFC A;  2B4J A;  4DV2 K;  2ASO A;  1VQN N;  1Y64 A;  4IO8 A;  1BOT O;  3TPQ A;  2OPQ A;  4X66 K;  4DTJ A;  1GOC A;  4B1V A;  2E6L A;  5HRN A;  4W5Q A;  4I7F A;  1NGF A;  4CEE A;  1IG8 A;  1VSI A;  5KQ8 A;  1YJN N;  4W5N A;  1HNV A;  5C2D A;  4X62 K;  3IFR A;  1TUY A;  3TAM A;  3WQT A;  4LD0 A;  1S1T A;  3H46 O;  3DRP A;  1GOB A;  3QER A;  1K73 O;  1DEJ A;  5FPE A;  4FOI A;  3S3N A;  4I2P A;  5AQK A;  4AHR A;  1NGJ A;  4NXN K;  3IRX A;  3PSF A;  1BWF O;  2WC9 A;  4PHT X;  2X78 A;  2O8F B;  5CZ2 A;  3AO2 A;  3D2F B;  4GVM A;  2CGJ A;  3ID6 A;  3HI0 A;  4B1X B;  3CXC M;  3RMB A;  2F9T A;  4LSN A;  4CFA A;  2V7Y A;  1N36 K;  3RRG A;  5HP1 A;  4JI2 K;  1TL3 A;  3DLE A;  4FOE A;  3ZSW A;  3VQE A;  3QO9 A;  4IDH A;  3TTD A;  2E2Q A;  3D2E B;  3CC4 N;  4ZHR A;  4FWQ A;  4KI4 A;  1T6D A;  3V9U A;  2ZM6 K;  3AAQ A;  4CBX A;  2F7T A;  1BA0 A;  1SV5 A;  3CJ7 A;  4OGC A;  2Z1H A;  3LPT A;  1BA1 A;  4E7J A;  4ILJ A;  4JKB A;  2ITG A;  3L6Q A;  3VEW A;  2YNH A;  4NLC A;  4XIU A;  3THY B;  4BQL A;  4FPB A;  2GV9 A;  2P5G A;  1E4F T;  2Z1J A;  1B9F A;  3P5J A;  4OGE A;  4JKG A;  1VSE A;  3G6E N;  4NCB A;  4OPJ A;  4KI6 A;  2YNG A;  3BUZ B;  2EX3 A;  1YF5 L;  1LW0 A;  3OYG A;  4CVN E;  3C6A A;  4CJE A;  3WT0 A;  4K8X A;  1HPM A;  2NRT A;  2DTU A;  1HNI A;  4M42 A;  4I9Q A;  1IO2 A;  1NK4 A;  4KRE A;  2YKM A;  2GWJ A;  1EKE A;  1SAZ A;  3MN7 A;  2QK9 A;  1Q9X A;  5A2Q O;  2NUB A;  2HBL A;  3AVN A;  4CBU A;  4W5R A;  2Q1N A;  5AZI B;  1RDW X;  2OPP A;  1WUA A;  4DQP A;  1VQ8 N;  2ZJQ L;  3W0L A;  5GAE P;  3H6E A;  2P9P B;  3L2W A;  1T05 A;  2V52 B;  1NK6 A;  3LDO A;  1VQ7 N;  4FJ8 A;  3WNG A;  4AQY K;  3G4S N;  3PY8 A;  4IBN A;  2FC0 A;  3MDQ A;  2UUB K;  3ZCM A;  4H5R A;  3UE5 A;  3V1Q A;  5HOO A;  2ZJR L;  2A3Z A;  1YIJ N;  1WLJ A;  1QSS A;  2VG5 A;  4B9V A;  4RG8 A;  3VET A;  4DQ8 A;  2JWK A;  1RBR A;  3OYN A;  2XY5 A;  4JI0 K;  3IUC A;  5KI6 A;  3OA9 A;  4CF9 A;  4CEO A;  4W5O A;  4QS7 A;  2BDP A;  1D4X A;  1QQC A;  3AVF A;  3MCP A;  3ASM A;  3NF6 A;  3NBP A;  3KWG A;  3SQ4 A;  3T19 A;  3VEO A;  5JS1 A;  4DV5 K;  2D0O A;  4N76 A;  3HST B;  1UA0 A;  5KGX A;  4FLY A;  4YOT A;  1RT5 A;  2QWM A;  4CGD A;  2VYP A;  4BRI A;  3EKS A;  1VSF A;  3ULE A;  3O9S A;  1CZB A;  2Y1J A;  1QVG M;  4LF7 K;  3TAR A;  3CCU N;  3DM2 A;  3KKR A;  3J7A P;  1NBW A;  2R7Y A;  1YT3 A;  3D2E A;  2YHB A;  4FWP A;  5LMU K;  3VEN A;  1N6Q A;  3I0S A;  1BIU A;  4JKH A;  4JLH A;  1X9S A;  3AA4 A;  2YHY A;  3ZYY X;  1TKT A;  3U4L A;  1TAU A;  1KAY A;  4AF1 A;  2HB5 A;  3SZ2 A;  2E4L A;  4I6M B;  5M1P A;  5J1E A;  3U8X A;  3V81 A;  5KPT A;  3O80 A;  4FW2 A;  5AQS A;  2HNZ A;  3EZW A;  3TAF A;  3A8Y A;  3ZET A;  3UKU A;  3K9J A;  4BR2 A;  3I55 N;  1KTQ A;  3QIN A;  4JKF A;  3NGZ A;  1ASW A;  4HUE A;  5AQN A;  3LAN A;  3A5L C;  1DLO A;  4GMJ B;  4DTN A;  4M3X A;  4NCG A;  4V19 S;  2GUI A;  2V51 B;  1WSG A;  2HBK A;  5C15 A;  1QE1 A;  4M3Z A;  1YUW A;  2NRV A;  1HMV A;  4LY7 A;  3GG4 A;  4JKD A;  3M3Z A;  3CCJ N;  3O4W A;  1FKP A;  4G1Q A;  4ID5 A;  1TK0 A;  1VSD A;  1L3S A;  3FFI A;  1SL1 A;  3AY9 A;  1DTT A;  2Q97 A;  5I42 A;  2HVH A;  3EN9 A;  3KTQ A;  2GEL A;  3VF2 A;  4KPY A;  2E20 A;  3J7Z O;  4CGG A;  3CER A;  5EX5 A;  1ITG A;  3DAW A;  4X64 K;  4O55 A;  1Z05 A;  2FLO A;  2IAJ A;  1V4S A;  3D2F A;  3VA3 A;  2G8W A;  4YOV A;  5FPN A;  3NE6 A;  2JLE A;  3OYL A;  2O8D B;  1KCF A;  4NCA A;  1JLA A;  1D8Y A;  1TV6 A;  2IS3 A;  3SAF A;  1N5Y A;  1Q8I A;  4OKJ A;  2P9S B;  3ULD A;  3WEE B;  2O4I A;  1ZBI A;  2I7P A;  2YI1 A;  3V9W A;  3B8A X;  1WN7 A;  4WFN L;  4GKJ K;  1REV A;  3TSP A;  5GAG P;  2I5J A;  4DFJ A;  1WAF A;  2Q3S A;  1XI1 A;  3NCI A;  5AQO A;  4FM1 A;  3KK2 A;  1LAW A;  4K0K K;  4LF9 K;  3M1F A;  4EP4 A;  2A6A A;  3CFR A;  4CGH A;  3D0P A;  2A1S A;  3S3M A;  1S1X A;  3L3V A;  3NH0 A;  2KFN A;  4K42 A;  3AV9 A;  1WSE A;  1U6Z A;  1EWQ A;  4MDB A;  4GV9 A;  1D9D A;  1X1P A;  1HJO A;  2W6L A;  2VQF K;  1Y97 A;  1WB9 A;  2VGN A;  2XY8 A;  4CF0 A;  3O8M A;  1NJY A;  4E3S A;  2FBY A;  3VQC A;  4CJ7 A;  3L2V A;  4A61 A;  3DLB A;  3N4Q A;  1OH5 A;  4FK4 A;  2Z1I A;  2QXF A;  3A5N C;  4I2Q A;  5AQV A;  4BRQ A;  4DR6 K;  4YOY A;  5TKW A;  1ZBU A;  3AVB A;  5J2M A;  3KVG A;  4QS8 A;  3RR7 A;  3AVJ A;  3AVC A;  3THX B;  5AQT A;  1QSY A;  3FZK A;  4G9Z A;  4OLA A;  1N8R O;  4IEI A;  2HST A;  3VQD A;  4JI6 K;  3ZX3 A;  5ADX H;  3LDL A;  5C10 A;  1TKZ A;  3NFA A;  4MO5 A;  3UB5 A;  3LDN A;  3V1R A;  5F2R A;  3ZSR A;  1UOC A;  4B1Y B;  3VA0 A;  2A40 A;  1JLG A;  4OPA A;  4CZG A;  4M3Y A;  2VWJ A;  3AVK A;  4ISF A;  3GDQ A;  2E1Z A;  4M41 A;  1BQM A;  3MXI A;  2A42 A;  3M8R A;  3U3G A;  3HBT A;  4BR4 A;  2VWB A;  1C6V A;  4OJR A;  3VPZ A;  1O1W A;  1IKV A;  3NF7 A;  4CJS A;  2XY7 A;  2FBX A;  3DJC A;  2BAN A;  2D1K A;  1G99 A;  1VRT A;  3JS6 A;  4FLU A;  4LFC K;  3EE8 A;  5JIC A;  4ILG B;  3SBG A;  1ZBH A;  1KRP A;  3M8Q A;  1IH7 A;  4FLV A;  2IVP A;  3KJV A;  2KZZ A;  5BR8 K;  2QEX N;  3BF3 A;  3SQ1 A;  2UXB K;  4FJX A;  4H0V B;  2FSK A;  3MEG A;  5EOY A;  4DF4 A;  3Q7C A;  3TU5 A;  4U67 L;  3K5M A;  3WNE A;  2VCP A;  3CI5 A;  1WSH A;  2GEM A;  3JYT A;  2GWK A;  4B8A B;  4I6M A;  4FJ7 A;  2YJF A;  1A5W A;  3O6W A;  4GV3 A;  3O3G A;  1ZXO A;  3KIO A;  2KTQ A;  4N56 A;  2V7Z A;  3M5R A;  1KXP A;  4BG8 A;  2UUC K;  2P9S A;  4B9N A;  1HKC A;  4PUO A;  1C0F A;  3PIO L;  4BWM A;  1S9G A;  1V4T A;  1NMD A;  1C0G A;  3T3F A;  2RN2 A;  4BRK A;  3VTI A;  1YXQ A;  5BPL A;  1JCG A;  4Q0B A;  1B92 A;  4IFY A;  1EXQ A;  3EO3 A;  4FPA A;  3RMC A;  1S1V A;  1H1V A;  1MDU B;  1JLC A;  4YOU A;  2DFH A;  4IXC A;  4WQ5 A;  2B6A A;  3CFP A;  3ZEU A;  1JCF A;  5AJ3 K;  2G8V A;  3DXM B;  3OYF A;  1JXE A;  3JAM O;  4BR5 A;  4CZL A;  2KFZ A;  3SLC A;  3HYF A;  3FLC O;  1YJW N;  4QOZ B;  2NRH A;  4ISG A;  3QNN A;  1XNQ K;  3HVT A;  4N41 A;  2Q0U A;  5J2P A;  3VMF B;  4XH4 A;  2RHK A;  3R9P A;  4EFH A;  3LL3 A;  4C8M A;  5LY3 A;  1U4B A;  1NGB A;  2IIR A;  3O4N A;  3OS1 A;  4FJG A;  4JI1 K;  2GBZ A;  4BRE A;  1RTH A;  3LP3 A;  1U2V B;  5EY4 A;  3QEI A;  5AQW A;  4O8U A;  1ZBF A;  4CEF A;  3O9Q A;  4O8K A;  1NMN A;  3T1A A;  1NK9 A;  1MWK A;  4DU4 A;  1HRH A;  3C6T A;  5C24 A;  3AAP A;  4BDY A;  1JL1 A;  3QEP A;  4KO0 A;  4WQ5 C;  1T6C A;  1C0T A;  5IWA K;  4OKK A;  4B8C A;  3IAY A;  3I56 N;  4C23 A;  4E0D A;  2ZQB A;  3LP2 A;  1SKW A;  4DSL A;  2X6N A;  4CEA A;  1HYS A;  4CIG A;  3CPW M;  2HHU A;  5J2N A;  3VER A;  5AQG A;  4M7Y A;  1X9J A;  4E19 A;  5C12 A;  4CHO A;  3DWL A;  2W6K A;  3HSC A;  3KLF A;  2VWK A;  5D3G A;  4HCB A;  3QEX A;  4IG3 A;  1BG3 A;  3LDS A;  4BVP A;  1CZA N;  4YOX A;  4H5V A;  3J7Y P;  5E26 A;  4DUZ K;  3V9Z A;  1SZ2 A;  3NVK A;  4XEI A;  1S6Q A;  1J53 A;  3K58 A;  1BCM A;  3OJS A;  4YFU A;  3PIP L;  2RKI A;  3AVA A;  1BIS A;  4CJP A;  3ZSO A;  4CHN A;  1QHT A;  4KH6 A;  4BY9 C;  3NVM A;  1UA1 A;  3J8A A;  1JKH A;  1BIZ A;  4KHN A;  5C2F A;  2E1Y A;  4FW1 A;  3CJC A;  1HYV A;  2E2P A;  5ELZ A;  4Z0U A;  3TAN A;  4DG1 A;  3F5T A;  2A1R A;  4DQR A;  2XO7 A;  2X6S A;  1FK9 A;  4IFV A;  5GIP A;  1RBS A;  1QHA A;  4B9Q A;  4FK0 A;  4DR5 K;  3E9L A;  5FRO A;  4F2S A;  1NWK A;  2FBV A;  4DS5 A;  3ZT2 A;  1ZBS A;  3SV4 A;  4FJI A;  2W41 A;  3NMU A;  3MX2 A;  1DTQ A;  4AHV A;  4FVU A;  4W5T A;  4A57 A;  1S1U A;  5DM6 L;  1BU6 O;  3NGI A;  1LWE A;  4QCL A;  1J5O A;  1RT4 A;  4H5T A;  3H1V X;  5AQF A;  4CGI A;  1E3M A;  4DTS A;  1IKW A;  4IJN A;  1XNR K;  1JLB A;  1RTJ A;  1J54 A;  3DOK A;  4DSE A;  1TYQ B;  4F3T A;  2ZF5 O;  4FSV A;  4C8O A;  5BN9 A;  2BH1 A;  3E9O A;  3O5B A;  4R5P A;  4CJT A;  4HUF A;  3ENO A;  1Q81 O;  2GX9 A;  1NK5 A;  4C8L A;  2G8U A;  1TL1 A;  2HHS A;  2BE2 A;  1KC8 O;  5AR0 A;  1S6P A;  3DYA A;  1NLV A;  4A62 A;  2QWL A;  3HTV A;  1IBM K;  3BF1 A;  4IG0 A;  2QWO A;  1K9M O;  1C0M A;  4EZ9 A;  3MEC A;  3DOL A;  4DR3 K;  3OYK A;  3MCA B;  1ATN A;  5AQQ A;  4BE1 A;  5AFU H;  3MWT A;  4IOC L;  4LF5 K;  1VQL N;  2E2N A;  5CY4 A;  2EHG A;  3AVL A;  4OX9 K;  2KHO A;  4HUG A;  1N32 K;  3DXK A;  3OYI A;  2H3G X;  4IWV A;  4DWI A;  3OYA A;  1QS4 A;  4JRP A;  3R6M A;  2E6M A;  1QQN A;  1NGI A;  4PWD A;  1GLF O;  5KQD A;  3MMV A;  2FSN A;  1VQK N;  4YOW A;  4Y0W A;  2D5R A;  3LPU A;  3VQ7 A;  2YKN A;  2AJQ A;  4IDK A;  1HR0 K;  3I0R A;  1NKB A;  4PKI A;  3U9D A;  3C6U A;  1QQO A;  4OO1 J;  3L4Q A;  3O9R A;  2O8D A;  2PFU A;  3VGM A;  3AO5 A;  3SAH A;  3HVR A;  3PSI A;  4CJF A;  1VSM A;  3IS9 A;  3WUH A;  3OS0 A;  4FYD A;  3W3D A;  5KRS A;  4DV7 K;  2PAV A;  4F8R A;  1HKB A;  3KD1 E;  4AHC A;  5AQX A;  3H3O B;  1KD1 O;  4NB4 A;  3KLI A;  2YJE A;  5EU7 A;  1VHX A;  1X9M A;  2P9N B;  3CD6 N;  3O4Q A;  4BRG A;  4Z4F A;  4CI6 A;  3C0B A;  3V9S A;  4CJV A;  3SUO A;  4JD2 B;  3SPY A;  3B6O A;  2VG7 A;  1SL2 A;  2GTD A;  4Y1D A;  5MLC Q;  2G8K A;  1T44 A;  3NGY A;  4E1M A;  4DSJ A;  1QZ5 A;  2AA4 A;  4JYA K;  1LW2 A;  1WNS A;  4BR9 A;  2O8E A;  1T3V A;  1VQ4 N;  4KHW A;  1TKX A;  3THV A;  3ZET B;  4O0J A;  2FBT A;  1IKX A;  2ZWH A;  5LJW A;  4FVM A;  1OKJ A;  4NO7 A;  1NNE A;  4CK3 A;  4IZ9 A;  3ZX2 A;  3H45 C;  2E5L K;  3HJF A;  3NH1 A;  1NJX A;  4LH4 A;  4FZZ A;  4B9M A;  2X74 A;  4CJQ A;  4CEC A;  3P39 A;  1NGE A;  3VQP A;  2O8F A;  3FZM A;  4DR4 K;  3C7N A;  3OTO K;  3L2Q A;  3C65 A;  3DXM A;  3EY1 A;  1L3V A;  3VES A;  5HLF A;  3ZT3 A;  4KHQ A;  1SQK A;  4FL9 A;  4YY3 K;  4CJ5 A;  1MWM A;  3DRR A;  4JRQ A;  2P9I A;  3VQQ A;  3PUF A;  2FF6 A;  4CHY A;  4BE0 A;  4FWR A;  4ID1 A;  1XHX A;  3SI6 A;  4KRF A;  3F73 A;  1FW6 A;  2PBD A;  1KVB A;  1GLA G;  4DQS A;  2QI2 A;  5BN8 A;  3OBW A;  4CK2 A;  1NK8 A;  4CF2 A;  4BRC A;  3VEX A;  4DV1 K;  1S22 A;  5C42 A;  1GLJ O;  3ALY A;  4H0Y B;  5JLH A;  2Q36 A;  4BRM A;  4A5A A;  3HOS A;  3M8P A;  3LAK A;  1M1K O;  2ATQ A;  3O1W A;  1RDB A;  1HX1 A;  3DLK A;  2DPN A;  2QKK A;  2DFF A;  4JK9 A;  4KHU A;  4Z94 A;  2Q31 A;  1QTM A;  1Z6R A;  4H0T B;  1GLD G;  3RMA A;  4DTP A;  2G8I A;  5JMV A;  3OYM A;  4A5B A;  3CHW A;  1KVA A;  3ZSZ A;  3L0Q A;  4BR0 A;  1XWL A;  4ILH A;  2XHB A;  2F8T A;  4HCC A;  1Z25 A;  3F2K A;  3NH2 A;  4CGJ A;  4QAG A;  1EET A;  3RSE A;  1YI2 N;  5AZJ B;  1IJJ A;  4H03 B;  1RTI A;  3WNF A;  4AHS A;  3THX A;  4MQ3 A;  2HOE A;  3U6F A;  3DXK B;  3TAP A;  3SQ0 A;  2HHH K;  3G25 A;  1S9E A;  4F4K A;  3VTH A;  3C94 A;  4WQ4 C;  2P51 A;  2HF3 A;  3WNH A;  3ZSV A;  2JGU A;  3OYD A;  4F3O A;  4M3T A;  1YJ9 N;  3JSM A;  3AVG A;  5M1N A;  1U48 A;  1LWC A;  3K9K A;  5DK5 A;  1QQM A;  2WTU A;  4RW9 A;  5HRR A;  3N4P A;  5FDL A;  1BGX T;  1KLN A;  4DSF A;  2HND A;  3TWH A;  1IKY A;  4O4G A;  3KLH A;  4GY2 B;  1VRU A;  3RWU A;  4U7B A;  3SJH A;  3AGR A;  3T7Z A;  1C1A A;  4CJ3 A;  4DCH A;  4DMN A;  1UAX A;  3DLG A;  1TGO A;  1FJG K;  1MA9 B;  5C25 A;  4MO4 A;  4F9O A;  3WXL A;  5TKY A;  4FM0 A;  4MFB A;  4F2R A;  4ZTJ A;  3F9M A;  3AVM A;  3FE1 A;  3HK2 A;  4FLW A;  3H08 A;  1NOZ A;  1RT2 A;  2P9U B;  3VF4 A;  3P4I A;  3TSQ A;  4RWT A;  4GKK K;  3AO3 A;  3K59 A;  4M3W A;  3LM9 A;  1UWB A;  2HVI A;  3O08 A;  3QIC A;  4AHT A;  1TK8 A;  1HQU A;  3HP9 A;  4CZM A;  3D7E O;  4RCH A;  4X65 K;  3O3H A;  5CR4 A;  3A0I X;  1WOQ A;  4O5B A;  3R8E A;  3PX0 A;  3BDP A;  1Q18 A;  3ATU A;  4LFA K;  4AIL C;  1HJR A;  4FK2 A;  3QIO A;  3VQ9 A;  4H5N A;  4CJU A;  4H0P A;  2NRR A;  3DLL L;  4CED A;  1P90 A;  2NNW A;  1RDC A;  5JVH L;  2CGK A;  2Q0R A;  4KFB A;  3G10 A;  4CFB A;  4UQG A;  1R0A A;  4BRF A;  4CZF A;  3A2F A;  4JI7 K;  1X3M A;  3CQY A;  5GIO A;  4DR7 K;  3LWM A;  2CH5 A;  4CJW A;  5AQH A;  4DU3 A;  1YAG A;  5SWM A;  4UY8 O;  1HUX A;  1WBD A;  3VEV A;  5CYQ A;  3M8S A;  1RIL A;  3RMD A;  4N5S A;  3U3Y A;  4K8Z A;  4KTZ A;  2W42 A;  1RDD A;  5HRO A;  2P9K A;  5FPM A;  5E84 A;  1YHQ N;  1T03 A;  2Q2R A;  2BUP A;  2EWS A;  2HNY A;  1CXQ A;  3HXM A;  1NK0 A;  3A5M C;  3U9Z A;  4B9L A;  4KHS A;  3TI0 A;  1FXX A;  3P31 A;  1LOT B;  5AQY A;  4WCE L;  3LP1 A;  3CC7 N;  3AA2 A;  1TUU A;  3AVI A;  2FF3 B;  3LAM A;  4FJL A;  5LJV A;  3VQ5 A;  3SUN A;  3ID8 A;  3QFU A;  4JI5 K;  1SUQ A;  2ZJP L;  3SV3 A;  2G8F A;  3HRG A;  4EIA A;  3ENB A;  2AP1 A;  4E7I A;  4NLB A;  1GOA A;  2VGM A;  1P8Z A;  2E2O A;  1ATS A;  2QWQ A;  5GIN A;  4CW7 B;  3CG7 A;  1K8K B;  3RR8 A;  4TSX A;  2BGG A;  3T1Y K;  1OVY A;  3OS2 A;  5GAH P;  1L3T A;  2ZGZ A;  3ZX0 A;  4E1N A;  4H0O A;  4CZI A;  4CIF A;  2NLX A;  4FJH A;  3TTC A;  3GBT A;  4JI4 K;  5FRM A;  3KK3 A;  2FSJ A;  3WXJ A;  2IGI A;  2VQE K;  1BCO A;  1ASU A;  4FLX A;  1EQY A;  4CZH A;  2O8C B;  4LF6 K;  3LZJ A;  3CC2 N;  1U04 A;  3KD5 E;  1C0U A;  4LFB K;  4FWS A;  4BGA A;  1RBV A;  1KFD A;  1KAX A;  5ADX A;  1XC9 A;  3MED A;  1U2V A;  3O1B A;  4BDZ A;  3G0Z A;  5EVZ A;  3MXM A;  3WXK A;  4BC2 A;  5AQI A;  4KHY A;  1XMQ K;  4DSK A;  3ZT1 A;  3C7N B;  3L2R A;  5BPN A;  4C8N A;  3SJJ A;  3EE9 A;  3LWL A;  5AQJ A;  3OVN A;  4FCY A;  3CFO A;  4AM6 A;  3VQ6 A;  3VGL A;  3HOT A;  4B1Z A;  1CZ9 A;  2QWP A;  2WBN A;  5AZI A;  3Q7B A;  4KH4 A;  1U45 A;  1VQP N;  3BZK A;  3NHG A;  4FWN A;  3SUP A;  2FXU A;  3ZLJ A;  2P9P A;  4BRH A;  2IOC A;  3FZL A;  3GL1 A;  4LC9 B;  1RCH A;  2ITM A;  5M1O A;  3OYH A;  2HHT A;  3BY5 A;  1TKD A;  4OPK A;  4BC5 A;  4EHU A;  2HMI A;  1SS6 A;  3QNO A;  2WON A;  1YVN A;  3CJA A;  2YHW A;  3QLH A;  2OA8 A;  1NGG A;  2UU9 K;  1DKG D;  1WSJ A;  5I9E B;  4HHT A;  1BL3 A;  3CM5 A;  3WXI A;  3O9T A;  3VQ8 A; 
#chains in the Genus database with same CATH homology
 2NRX A;  1ATR A;  5AQX A;  3QBX A;  3SAF A;  3H3O B;  1KD1 O;  1Q7Y O;  3MN9 A;  4NB4 A;  2P9S B;  2YJE A;  2E8A A;  3WEE B;  2NRZ A;  3WXM B;  4PL8 A;  2P9N B;  4KH5 A;  3CD6 N;  3E9P A;  2WUS A;  4BRG A;  4CI6 A;  3C0B A;  2I7P A;  5AQZ A;  2YI1 A;  3B8A X;  3ULE B;  4JD2 B;  2YX6 A;  4HTL A;  4JK8 A;  4WFN L;  3LM2 A;  2GTD A;  3H3N O;  3TSP A;  2D0P A;  4K25 A;  5GAG P;  3GOI A;  5MLC Q;  2QWR A;  3MWP A;  1T44 A;  1QZ5 A;  2AA4 A;  5AQO A;  1JCE A;  4BR9 A;  1T3V A;  5AQM A;  1VQ4 N;  3M1F A;  2A6A A;  3VEZ A;  4C1N K;  3MK6 A;  4B1U B;  5C0Y A;  3ZET B;  4JK7 A;  1GLC G;  4HWI A;  2ZWH A;  3O9U A;  2GUP A;  4WQ4 A;  5LJW A;  4K42 A;  1K8K A;  1OKJ A;  3CIP A;  1U6Z A;  4NO7 A;  4IOX A;  4JD2 A;  3E1Y A;  1X3N A;  3QFP A;  4MDB A;  4GV9 A;  2HMP A;  2D4W A;  5M1K A;  1VQM N;  4IZ9 A;  3ZX2 A;  2QW9 A;  4JKG B;  3H45 C;  1HJO A;  5DM7 L;  4FWM A;  4BGB A;  2VGN A;  1Q86 O;  2I7N A;  2UYT A;  3O8M A;  3P39 A;  4CJ7 A;  1NGE A;  1RDU A;  3QML A;  3CCS N;  4A61 A;  3HZ6 A;  3N4Q A;  3A5O C;  4JNE A;  1R59 O;  3AGK A;  3SMP A;  3FZM A;  5AQU A;  3KK7 A;  2YHX A;  3C7N A;  3A5N C;  1HLU A;  5AQV A;  4BRQ A;  4R79 A;  3C65 A;  4JHD B;  3DXM A;  1Q82 O;  3VES A;  4YOY A;  3JXU A;  5TKW A;  2J4R A;  3KVG A;  4QS8 A;  3CPE A;  1SQK A;  4FL9 A;  5AQT A;  1MWM A;  3FZK A;  4G9Z A;  1N8R O;  3SK3 A;  2JWL A;  4IEI A;  2HST A;  3R1X A;  3ZX3 A;  1HKG A;  3BEX A;  3LDL A;  4BC4 A;  5ADX H;  4WFA L;  2P9I A;  3IKM A;  5C10 A;  2FF6 A;  4FWR A;  4MO5 A;  2QWN A;  3UB5 A;  1XUP O;  3LDN A;  5M1Q A;  5F2R A;  2PBD A;  1K8A O;  4B1Y B;  2A40 A;  1NGA A;  1GLA G;  1XQS C;  2QI2 A;  4OPA A;  4CZG A;  5BN8 A;  3EKU A;  3OBW A;  3D6R A;  2P9L B;  4ISF A;  3GDQ A;  3SMS A;  2E1Z A;  3CJ9 A;  2RE2 A;  4YOR A;  1ILY A;  3CCV N;  5EXW A;  1BDG A;  2A42 A;  3M6G A;  4CZE A;  4BRC A;  3VEX A;  3HBT A;  4BR4 A;  3P38 A;  2QM1 A;  1S22 A;  5AQP A;  2VWB A;  4CZK A;  1GLJ O;  3VPZ A;  4BRL A;  3CCQ N;  4H0Y B;  4BRO A;  5JLH A;  4MLH A;  4RTF D;  2Q36 A;  4BRM A;  4A5A A;  4BC3 A;  2CGL A;  3HOS A;  1ZC6 A;  4FWL A;  1M1K O;  3DJC A;  3KZB A;  2D1K A;  3O1W A;  1G99 A;  5B8H A;  1HX1 A;  2DPN A;  3JS6 A;  5AZJ A;  4JK9 A;  1VQ6 N;  4Z94 A;  2Q31 A;  4JN4 A;  3EE8 A;  3VOV A;  1NM1 A;  1Z6R A;  4K41 A;  4BQZ A;  5JIC A;  3FGU A;  3MN6 A;  4H0T B;  4ILG B;  1GLD G;  3SBG A;  3TTF A;  4BRD A;  1LCU A;  5JMV A;  2IVP A;  2A41 A;  4A5B A;  3CHW A;  4FO0 A;  3E66 A;  4BVO A;  2QEX N;  3BF3 A;  5BR9 A;  3FR0 A;  4YDU C;  2A5X A;  3L0Q A;  4H0V B;  4AM7 A;  4BR0 A;  2FSK A;  5EOY A;  2QXL A;  3FFK B;  4ILH A;  4XH1 A;  3Q7C A;  2ZGY A;  3F2K A;  3TU5 A;  1KQS M;  5CE3 A;  3QDK A;  4U67 L;  2NZT A;  2P9K B;  2VCP A;  3CI5 A;  2GEM A;  4CD3 A;  3RSE A;  2GWK A;  1YI2 N;  5AZJ B;  1IJJ A;  4I6M A;  4DB3 A;  3R3L A;  5F0X A;  2YJF A;  2CH6 A;  2HBJ A;  3O6W A;  4H03 B;  3ZEU B;  3IDH A;  4IFE A;  4GV3 A;  5BRH A;  1ZXO A;  1ESV A;  3BP8 A;  2OTJ N;  2HOE A;  2V7Z A;  4DKW A;  5KPR A;  3DXK B;  3M5R A;  1KXP A;  4BG8 A;  1BUP A;  2P9S A;  3G25 A;  1VAZ A;  1HKC A;  1VQO N;  3ENH A;  4E1J A;  2P9N A;  3VTH A;  2KLA A;  1C0F A;  4H0X B;  4WF9 L;  1GLL O;  1YIT N;  4WQ4 C;  1O13 A;  4BR7 A;  2HF3 A;  3PIO L;  3TSU A;  2NRW A;  5JVG L;  1YJ9 N;  4A59 A;  1V4T A;  4BRN A;  2QTD A;  1NMD A;  4GNI A;  5M1N A;  1C0G A;  3HM8 A;  3AAR A;  3K9K A;  1QQM A;  4MLE A;  4CD1 A;  4DHY A;  4BRK A;  3VTI A;  1YXQ A;  3N4P A;  1RGI A;  1JCG A;  4JKA A;  5BPL A;  2HF4 A;  3KHY A;  4YDU A;  3EO3 A;  4FPA A;  2ASO A;  1VQN N;  1Y64 A;  4CZJ A;  4IO8 A;  4QS9 A;  1BOT O;  3TPQ A;  1H1V A;  4GY2 B;  1MDU B;  1E4G T;  4B1V A;  3SJH A;  4U7B A;  4YOU A;  3MN5 A;  3CJB A;  3AGR A;  4IXC A;  1NGF A;  4WQ5 A;  3T7Z A;  3ZEU A;  5H1S Q;  1IG8 A;  3LDP A;  5KQ8 A;  1YJN N;  5GAD P;  1JCF A;  4DCH A;  2IVN A;  5C2D A;  3IFR A;  3DXM B;  1TUY A;  1MA9 B;  3WQT A;  4MO4 A;  4F9O A;  3H46 O;  4L3Q A;  3OHR A;  3WXL A;  5TKY A;  3CCE N;  4BR5 A;  4CZL A;  1K73 O;  3SLC A;  1DEJ A;  1TYQ A;  3FLC O;  3F9M A;  1YJW N;  2NRH A;  4C1N I;  4ISG A;  3FE1 A;  5FPE A;  4FOI A;  5AQK A;  2Q0U A;  2W40 A;  4FWO A;  1NGJ A;  3VMF B;  2P9U B;  2RHK A;  4XH4 A;  3R9P A;  3VF4 A;  1BWF O;  2WC9 A;  4PHT X;  4EFH A;  3P4I A;  3LL3 A;  4JKE A;  3TSQ A;  5LY3 A;  4RWT A;  4IO9 L;  1NGB A;  2IIR A;  2E88 A;  3D2F B;  3LM9 A;  1RFQ A;  4BRA A;  2OTL N;  2CGJ A;  3ID6 A;  3HI0 A;  3O9T A;  4B1X B;  4BRE A;  3O08 A;  5EY4 A;  1U2V B;  3QIC A;  3CXC M;  4CZM A;  2F9T A;  3D7E O;  2V7Y A;  4RCH A;  5AQW A;  4O8U A;  5CR4 A;  4IEE A;  3A0I X;  1WOQ A;  3O9Q A;  4O8K A;  3R8E A;  1Q18 A;  1MWK A;  1M90 O;  3ATU A;  2IVO A;  4FOE A;  3VEY A;  3RVC A;  3AAP A;  3CCL N;  4IDH A;  4IJA A;  3TTD A;  2E2Q A;  2WFB A;  5BRD A;  3D2E B;  4PL7 A;  4WQ5 C;  1T6C A;  3RSE B;  3CC4 N;  4FWQ A;  4GV6 A;  5AFU A;  3I56 N;  1T6D A;  4C23 A;  4H5N A;  4H0P A;  2NRR A;  3DLL L;  3GE1 A;  4EAH D;  1P90 A;  3AAQ A;  4CBX A;  2F7T A;  2NNW A;  4M7X A;  5JVH L;  3EL2 A;  1BA0 A;  3CJ7 A;  3CPW M;  2CGK A;  1VQ9 N;  2Q0R A;  1NJI O;  3CET A;  1BA1 A;  4ILJ A;  4JKB A;  3L6Q A;  3VER A;  4BRF A;  5AQG A;  3VEW A;  4M7Y A;  1X9J A;  4PKH A;  4CZF A;  3CJ1 A;  4NLC A;  5C12 A;  3OW2 M;  3DWL A;  4BQL A;  4FPB A;  1X3M A;  3CQY A;  5GIO A;  3HSC A;  1E4F T;  1NGH A;  4CBW A;  5KPZ A;  2CH5 A;  5AQH A;  1BG3 A;  1YAG A;  4J8F A;  4BVP A;  3MX5 A;  1CZA N;  4YOX A;  4H5V A;  4XH5 A;  1HUX A;  4UY8 O;  4JKG A;  3VEV A;  3G6E N;  2QA4 N;  5E26 A;  3T69 A;  3BUZ B;  2OAN A;  1YF5 L;  1SZ2 A;  3NVK A;  3C6A A;  4XEI A;  3WT0 A;  3VF6 A;  1HPM A;  2NRT A;  3ATV A;  4PKG A;  3PIP L;  4A2A A;  2P9K A;  5FPM A;  5E84 A;  4A2B A;  1YHQ N;  4JAX A;  2Q2R A;  2BUP A;  2EWS A;  3CMA N;  2P9I B;  3A5M C;  3U9Z A;  2GWJ A;  4KH6 A;  3SAG A;  1SAZ A;  3MN7 A;  3P31 A;  4BY9 C;  1VQL N;  1LOT B;  5AQY A;  4WCE L;  2HBL A;  3NVM A;  3J8A A;  3CC7 N;  5BRF A;  4CBU A;  5C2F A;  1QVF M;  2Q1N A;  2E1Y A;  1TUU A;  1RDW X;  5AZI B;  2FF3 B;  1WUA A;  3CJC A;  5FPD A;  4WYB A;  2E2P A;  5ELZ A;  1VQ8 N;  2ZJQ L;  3W0L A;  5GAE P;  5LJV A;  1NGD A;  3H6E A;  2ASP A;  3F5T A;  2P9P B;  5AQL A;  3ID8 A;  3QFU A;  2V52 B;  2ZJP L;  3C6H A;  3LDO A;  1VQ7 N;  3KWI A;  5GIP A;  1QHA A;  3HRG A;  4B9Q A;  3G4S N;  2F9W A;  4EIA A;  3MDQ A;  3E9L A;  4H5R A;  3UE5 A;  5HOO A;  4JEP A;  1NWK A;  2YCH A;  2AP1 A;  3ENB A;  2A3Z A;  2ZJR L;  1ZBS A;  1YIJ N;  4NLB A;  5JLF A;  2W41 A;  1DGK N;  3NMU A;  3MX2 A;  2VGM A;  3VET A;  4DQ8 A;  2JWK A;  4FVU A;  4A57 A;  1P8Z A;  2E2O A;  1ATS A;  1BU6 O;  2BTF A;  2P9U A;  3IUC A;  2QWQ A;  3OA9 A;  5DM6 L;  5GIN A;  4K43 A;  3OBY A;  3QB0 A;  1NGC A;  1K8K B;  1J6Z A;  4H5T A;  4QS7 A;  1D4X A;  1OVY A;  3H1V X;  3MCP A;  3CME N;  5AQF A;  5GAH P;  3KWG A;  3WQU A;  2ZGZ A;  1XC3 A;  4IJN A;  4H0O A;  3VEO A;  3ZX0 A;  4CZI A;  1S72 N;  1TYQ B;  2D0O A;  3CCM N;  5BPM A;  2NLX A;  2ZF5 O;  4FSV A;  3TTC A;  3GBT A;  5BN9 A;  2BH1 A;  3E9O A;  4YOT A;  3O5B A;  2FSJ A;  3H1Q A;  5BRE A;  3UKU B;  3WXJ A;  3I8B A;  3ENO A;  1BO5 O;  1EQY A;  2QWM A;  4CZH A;  1Q81 O;  2GX9 A;  2VYP A;  3CC2 N;  4BRI A;  4BG9 A;  3EKS A;  3L4I A;  5M1F A;  1GLB G;  4FWS A;  4BGA A;  3ULE A;  3O9S A;  3UKR A;  1KAX A;  1QZ6 A;  5ADX A;  1W2B M;  4GVE A;  1QVG M;  5AR0 A;  1KC8 O;  3CCU N;  4B1W B;  1NLV A;  1NBW A;  1U2V A;  2QWL A;  3O1B A;  3HTV A;  3QBW A;  3WEE A;  4A62 A;  3BF1 A;  3D2E A;  4FWP A;  5EVZ A;  3SBT A;  2KKZ A;  3WXK A;  2QWO A;  3VEN A;  4BC2 A;  5CHI A;  3I33 A;  5AQI A;  3CCR N;  3CF5 L;  1K9M O;  3C7N B;  5BPN A;  4WFB L;  4JKH A;  3EE9 A;  2ASM A;  5AQJ A;  3MCA B;  3PLA A;  1ATN A;  2HBM A;  2YHY A;  3ZYY X;  3U4L A;  4OPH A;  1KAY A;  4AF1 A;  2P9L A;  5AQQ A;  4AM6 A;  5AFU H;  3MWT A;  4I6M B;  5M1P A;  4IOC L;  3UKR B;  3VGL A;  4ISE A;  3HOT A;  2E2N A;  2QWP A;  2WBN A;  3Q7B A;  4KH4 A;  5AZI A;  3U8X A;  3VGK A;  4JKC A;  4B1Z A;  3O80 A;  5KPT A;  5AQS A;  3EZW A;  1VQP N;  5AQR A;  4IOA L;  3A8Y A;  3ZET A;  3UKU A;  2KHO A;  3K9J A;  4FWN A;  4MDA A;  4BR2 A;  3DXK A;  3I55 N;  2H3G X;  2FXU A;  4JKF A;  4IWV A;  5AQN A;  1VQ5 N;  2P9P A;  4BRH A;  3R6M A;  1W97 L;  3A5L C;  3FZH A;  1QQN A;  1NGI A;  3FZL A;  1GLF O;  3GL1 A;  5KQD A;  4LC9 B;  4EHT A;  3MMV A;  2FSN A;  1GLE G;  1DT9 A;  2V51 B;  2ITM A;  1VQK N;  5M1O A;  1S3X A;  2HBK A;  4Y0W A;  5C15 A;  4YOW A;  1EO1 A;  1JJ2 M;  5HL7 L;  1YUW A;  2NRV A;  4JKD A;  3GG4 A;  3CQX A;  3CCJ N;  3M3Z A;  3O4W A;  4JHD A;  4BC5 A;  4EHU A;  4BRP A;  3AY9 A;  4H5W A;  1SS6 A;  2Q97 A;  4PKI A;  3U9D A;  3EN9 A;  2GEL A;  3VF2 A;  1QQO A;  1YVN A;  2E20 A;  3J7Z O;  4OO1 J;  3CER A;  3CJA A;  2YHW A;  3L4Q A;  4FWK A;  3O9R A;  4KBO A;  3G71 N;  1NGG A;  2PFU A;  3VGM A;  5EX5 A;  3S41 A;  3DAW A;  1DKG D;  3SAH A;  3FZF A;  3LDQ A;  5F1X A;  5I9E B;  4M63 C;  1Z05 A;  2FLO A;  1V4S A;  3D2F A;  4O5F A;  3WUH A;  1KAZ A;  5FPN A;  4YOV A;  3WXI A;  3W3D A;  3IMX A;  2PAV A;  1HKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...