1QS4A

Core domain of hiv-1 integrase complexed with mg++ and 1-(5-chloroindol-3-yl)-3-hydroxy-3-(2h-tetrazol-5-yl)-propenone
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
154
structure length
150
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HIV-1 INTEGRASE (E.C.2.7.7.49))
publication title Structure of the HIV-1 integrase catalytic domain complexed with an inhibitor: a platform for antiviral drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 47
structure length 150
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qs4A00
2HHSA 3AO4A 4FM1A 2XY7A 4DSJA 4DU3A 2OPPA 5EU7A 4JS5A 2G8UA 4QOZB 4B9UA 1EKEA 1RDDA 1YT3A 3DLGA 4FJHA 4CJLA 1XWLA 4CK3A 4W5RA 3MECA 1SL2A 3LPUA 1HMVA 3HT3A 3L2QA 2I5JA 4I9LA 2YKMA 4DLGA 3CM6A 3AVNA 5KGWA 3NF8A 3NFAA 4K8XA 1GOBA 5FROA 3M8PA 5CZ1A 1HNVA 4UQGA 4CGIA 4DF8A 1EX4A 3B6OA 1RT2A 4DTMA 3ZSWA 1RBRA 3SUOA 5JS1A 4DWIA 1D9DA 1K6YA 1RCHA 4BWMA 4FZXC 4LD0A 4N56A 3VA0A 3V9XA 4F3OA 2YHAA 3HPGA 4H8KA 1JL2A 3OVNA 1HQUA 4AHTA 1ZBLA 3O3GA 2KFZA 4CGGA 5SWMA 3KLGA 3KJVA 3QEVA 1TKZA 3NCIA 3CFPA 1BISA 4B9MA 3KK3A 3QNOA 4DFJA 2VG5A 1BI4A 4FJ7A 4KHSA 1JLGA 1ZBFA 3HVRA 4ELUA 3DMJA 4AH9A 3CG7A 4CEQA 2HHVA 2IAJA 2IOCA 3V1QA 3QERA 4CERA 4Q5VA 4E7HA 2VWKA 1U47A 3QEXA 3TAEA 1DTTA 3MXJA 4CEFA 1HNIA 4CEAA 1S1UA 1RTHA 3PY8A 4MFBA 2QKKA 4FJXA 2HHQA 4C8NA 2EX3A 2XHBA 4HCCA 1CXUA 5I3UA 1RDBA 1VSDA 1JL1A 3FFIA 1KLNA 2HMIA 1WAJA 3QEPA 5HRSA 3SUQA 4W5OA 2BE2A 3LP2A 1BCMA 3MEEA 3V1RA 2X78A 2BDPA 1QSSA 2RPIA 1B92A 4FLZA 5FRNA 2G8KA 4KKOA 4RW9A 4B9NA 4FXDA 4DSFA 4AHCA 3LANA 1QSYA 4OGEA 3QNNA 4ELVA 1WLJA 1WSGA 2RF2A 3P83D 4CF2A 3G0ZA 2W42A 4DTPA 3NE6A 3AVMA 1N5YA 4OLBA 3LPTA 3NGYA 2HNZA 3HPOA 1A5XA 4Y1DA 4N5SA 4H4MA 3V9UA 3O3FA 2P51A 3ZSXA 4TSXA 4C8MA 5E41A 2YHBA 3S3OA 4XIUA 4CFDA 3NH2A 4M41A 3MXMA 2X6NA 4I7FA 5C42A 2O4GA 4FM0A 4NCAA 3E01A 3QETA 2YNIA 4IDKA 4J2EA 2ZD1A 4ICLA 1N6QA 2E4LA 4E0DA 4OKKA 5DMRA 1KVBA 3T19A 3C95A 4O55A 3K58A 3RRHA 4FK4A 3OS0A 5FRMA 4ZTJA 1VSMA 3ISNC 2WOMA 3C6UA 5HRNA 3OY9A 1ASUA 1TL1A 3CFOA 4BDYA 4CJUA 3RTVA 2F8SA 2X74A 3SQ0A 4CEEA 1RBVA 4CFAA 3AO2A 3HM9A 3VQ9A 5D3GA 4KB1A 4BDPA 4CJEA 3VQEA 4YNQA 1XI1A 1RTJA 3K57A 3DOLA 4O0JA 4HUEA 3F9KA 3KLIA 1JXEA 4M45A 1IKWA 3ASMA 4M3UA 1Y97A 3JYTA 3OYCA 1B9DA 2GUIA 4BE0A 1S1TA 1Z25A 4CFBA 1DTQA 3OYJA 4ZHRA 1SV5A 2YKNA 3SZ2A 1YVUA 3HJFA 2OYQA 3TAMA 4IFYA 3AV9A 4CIEA 3OYIA 2P1JA 1C0TA 1QHTA 4ID5A 1VSIA 3ZSZA 3V9WA 3AVHA 2YNHA 1HYZA 1L3UA 2FBXA 4CHNA 3CFRA 1IKYA 3PV8A 4CHQA 3ZCMA 3IAYA 1BQNA 4KHQA 3HK2A 2KFNA 3S3NA 1SKSA 4FW1A 3CQ8A 2FBVA 4O0IA 3OYNA 3DOKA 4KTZA 4O5BA 1T7PA 4B9VA 4FJIA 5HRRA 4KREA 2QXFA 1TKDA 3RMAA 3AO3A 1FK9A 1KLMA 3L2UA 3OYGA 3M8QA 1VK0A 5J2QA 4CF8A 1NKCA 4PWDA 2HNDA 3AVKA 1LW2A 1RT3A 2D0AA 3L3VA 3NF6A 3ZT1A 4NCBA 4J2AA 1QSLA 1JLEA 3D0PA 2X6SA 4CCHA 1QE1A 3NBPA 1VRUA 4FJJA 1X9SA 4CJVA 3HVTA 4FLUA 3V4IA 1LWCA 1NJZA 3C94A 1O1WA 3SYZA 1JLAA 1CLQA 2BANA 2HHXA 1S1WA 4DLEA 3BDPA 1SUQA 4O44A 4CFCA 2QK9A 4WE1A 2G8HA 3OYHA 1NOZA 4LY7A 4FJGA 3AA2A 4CJKA 3PX4A 3TAPA 1EXQA 3L2WA 3ZT4A 1FXXA 3LAMA 3OYLA 4H4OA 4IFVA 1I3AA 5CYMA 3B6PA 4E7KA 3TARA 3IRXA 3DLHA 4KO0A 3KLEA 4M3YA 4AHSA 1J53A 4KAZA 4KPYA 4B3OA 4HUGA 4DQQA 4NYNA 1IKXA 2E6MA 3ULDA 3RR8A 5K14A 4Q0BA 3V1OA 2IC3A 2KQ2A 2Z1GA 2HVIA 4CGHA 2F8TA 3KK1A 1JLCA 3DM2A 1Q9XA 4B8AB 5CY4A 4IBNA 3K5NA 1VSKA 4G1QA 4HTUA 2OZSA 1X9WA 4DTXA 4CEDA 4LH5A 2IGIA 2G8IA 3KLFA 3QEIA 3TAGA 4B9SA 5HBMA 4EP5A 4FJ5A 4C8OA 3CM5A 1VSFA 4Z0UA 4EZ6A 2ATQA 1RT7A 1TK5A 2JLEA 1KCFA 4CESA 3HP6A 3O4QA 4J2DA 3HL8A 5T7BA 1U4BA 4J2BA 1Z26A 1ZBHA 1UOCA 1W9HA 4HUFA 3HXMA 3O4NA 3SUPA 1G15A 3VQDA 3QIPA 3EYZA 2JGUA 4Z4EA 3G10A 4E7LA 3WNFA 3SV3A 4CJTA 4DTUA 1ZBIA 3MEDA 2ITGA 4KTWA 4HVJA 4R5PA 5FDLA 1BQMA 1FKOA 3SCXA 1XC9A 4E7JA 2G8VA 2WONA 2VG6A 1Q8IA 1BIZA 1RTIA 3U6FA 4W5QA 3CYMA 2KTQA 4E7IA 1LAWA 1T05A 4M3XA 4W5NA 4FZYA 1NK9A 1J54A 1IG9A 1QTMA 3PO4A 3HP9A 3SPYA 4E1MA 3NH1A 3LDSA 2A1RA 2BGGA 4DFPA 2PYJA 4CGFA 3DYAA 4FLYA 4RG8A 3ZT3A 1RBSA 4DMNA 2FC0A 2XY5A 4FM2A 4EZ9A 3VA3A 1S1XA 1U48A 1WSFA 1JLFA 3ZT2A 4OLAA 2IS3A 1LAVA 3OYBA 3ALYA 3AVFA 3V81A 3OYEA 1JLBA 4CGJA 1C0UA 3HO1A 4FW2A 2OA8A 2VWJA 4QCLA 3ITHA 3SPZA 1QQCA 3VQ8A 4CJ5A 4KB0A 2D0BA 4KHNA 3AVAA 1C1CA 1RT4A 3KKSA 3AVIA 3AA3A 1EETA 3ZSOA 4HHTA 2HHTA 4N41A 1TL3A 1NKBA 4C8KA 1BI4B 3RRGA 3AVLA 4KHYA 1UWBA 3PUFA 3K5LA 1TV6A 3TR8A 4BACA 3P1GA 3PO5A 3SQ4A 3KKRA 1WSIA 3MXIA 4B9TA 5DK5A 1X1PA 2HW3A 2OPQA 3AVJA 3QLHA 4FLWA 4I2QA 3VQ4A 3VQ7A 4DTRA 4B8CA 4OPJA 4CGDA 3HPHA 3TAFA 3KLHA 2YV0X 1ZBUA 3OYAA 4NYFA 4ELTA 4DU1A 1IH7A 1GOAA 1TKTA 4RW6A 4CJQA 4DTNA 4DSEA 3SUNA 4JRPA 3M8RA 3VQCA 4FCYA 1KVAA 3VQPA 3O3HA 4E89A 1RT5A 4ID1A 3K5MA 1C1AA 3T1AA 3TAQA 4IKFA 2IDOA 1S9EA 1J5OA 1REVA 5JS2A 3KIOA 4AHRA 4FJ8A 4CEOA 4Z4CA 4IG3A 3OYFA 3ZT0A 3LWMA 3U3GA 4LH4A 1T8EA 4M3WA 4OJRA 2PYLA 4RW8A 1VSJA 2GBZA 2XRIA 4CJ3A 3DRSA 3AVCA 5C25A 1C0MA 1UAXA 2Y1JA 1CZ9A 1W0HA 3AO1A 1NKEA 2DTUA 3THVA 3LALA 3QINA 4E3SA 1QS4A 4OKEA 4CHOA 3IS9A 5KRSA 3SV4A 3ZSYA 4FLVA 1S9GA 4N76A 3OYMA 1BL3A 5HRPA 3LP0A 1UA0A 1VSHA 3WNHA 4DTJA 1SKWA 2FBYA 4FLXA 1CXQA 1LV5A 2G8WA 3WNEA 3LP3A 1EP4A 4OKJA 3VQBA 4CIFA 3LAKA 1TAQA 5J2MA 4CHYA 4HCBA 2D5RA 4RW4A 1NK8A 2Y1IA 3S3MA 1LW0A 4CECA 5I42A 3U3YA 3RR7A 1NK0A 4JRQA 1ZYQA 2B6AA 2XY6A 3VQ6A 4O4GA 3AA5X 3VQ5A 3MAQA 3RMDA 1RT6A 1HQEA 2EHGA 2ZE2A 2KW4A 3OYKA 4JS4A 2OZMA 4KFBA 3T3FA 2YNFA 3DLBA 3MEGA 2D0CA 3TABA 4CF0A 1D9FA 3A2FA 5KI6A 3NF9A 2HB5A 4DS4A 5HP1A 4Z4FA 5HROA 3K5OA 1KFSA 4RW7A 3SNNA 4PUOA 4DSLA 1RBUA 4DQPA 1GOCA 1SKRA 4CHZA 3VQQA 2R7YA 4KRFA 1NK5A 3TWHA 4M42A 2XY8A 1NJXA 3KD1E 4NCGA 5C24A 3KK2A 3SJJA 1HJRA 3I0SA 4MQ3A 3I0RA 3AO5A 3C6TA 1UA1A 3V6DA 5HLFA 4ZTFA 4KI4A 1RDAA 2O4IA 4W5TA 1RT1A 5CZ2A 4CHPA 3PX0A 1SL1A 4CF1A 1XHXA 2GV9A 3SI6A 4DQIA 3M8SA 4M3RA 3V9ZA 1L5UA 3OS2A 1NK4A 4DQRA 4C8LA 2ZQBA 4DFKA 5J2NA 2RN2A 4FVMA 1RBTA 2B4JA 4F3TA 4DSIA 2ETJA 2YNGA 3LWLA 1KRPA 3AA4A 4BE2A 4PY5A 3EZ5A 1S6PA 4KHUA 3TI0A 1JKHA 3ZSRA 3NGZA 4CE9A 1L3TA 2OPSA 4FK2A 4FLTA 1WN7A 3RMCA 4K8ZA 2KZMA 3I8DA 1DLOA 1HRHA 4KV8A 1A5WA 1B9FA 1RDCA 1WAFA 5CYQA 4AHUA 4E1NA 2G8FA 4Z4IA 1TKXA 3KD5E 2A1SA 1ASVA 4CJRA 4FJ9A 3NHGA 4BE1A 2QKBA 1KFDA 2P5GA 4DTSA 4F2RA 2DFHA 3P5JA 3NDKA 4FJNA 1U04A 3NH0A 3RWUA 4L8RB 2Z1HA 4N47A 4JLHA 1TGOA 1LWEA 1RILA 4AHVA 4M3TA 3DRPA 4I2PA 3H08A 3UIQA 2Z1IA 1BHLA 4BWJA 4Y1CA 3LZIA 4CEZA 4FJMA 2DFFA 3V9SA 4DTOA 1HYVA 3KTQA 4OGCA 4CIGA 4CJFA 4CJ4A 5J1EA 1IKVA 1BGXT 2PZSA 5KTQA 1I39A 3DI6A 4CK2A 4CJSA 2XO7A 2HHWA 3QEWA 1WSJA 4CJWA 1D8YA 4DU4A 3D45A 2KZZA 2FBTA 4PA1A 1F21A 4FJKA 1S6QA 2Z1JA 4IG0A 4F2SA 4LSNA 4E19A 1XHZA 4FJLA 4FYDA 4KTQA 3DLEA 3HSTB 4Z4HA 3RMBA 4DF4A 1WSHA 5J2PA 1KTQA 3WNGA 2B5JA 5KRTA 4DG1A 3AVBA 3HYFA 1NK7A 4Z4GA 1NK6A 4DFMA 1HYSA 3VQAA 1J9AA 2OPRA 2VG7A 1U49A 1S1VA 3IG1A 3S9HA 3L8BA 1TK0A 2DFEA 4OPKA 1U45A 1ITGA 1CZBA 1BIUA 4F4KA 1KSPA 3VN5A 3QESA 1S5JA 3NAEA 1SL0A 3OYDA 3QO9A 4OVLA 4F8RA 3NGIA 1FKPA 2Q3SA 3ZSQA 1NJWA 3EY1A 4DS5A 4PQUA 1NOYA 2F96A 4CJPA 1T03A 2P5OA 3LP1A 3OS1A 4M3ZA 5SZTA 1YTUA 4CF9A 3OJSA 2HHUA 4GVMA 1IO2A 1L3SA 4EP4A 4AILC 3DRRA 2HNYA 5KGXA 1JXBA 4B08A 2AJQA 1MU2A 2PY5A 3ZSVA 1C6VA 4BDZA 1NJYA 1HPZA 1TK8A 1ASWA 1D5AA 1X9MA 3NF7A 1L3VA 1Q9YA 1RTDA 4DQSA 3DLRA 2LSNA 3BGRA 4CK1A 1RNHA 4KHWA 2NUBA 4GW6A 1VSEA 1TVRA 4QAGA 3JSMA 1BCOA 3K59A 1JLQA 3SQ2A 3QIOA 4FK0A 1WNSA 4LSLA 3F73A 2HVHA 1WSEA 2DY4A 4FZZA 4GMJB 1A5VA 1C1BA 4YFUA 3OJUA 4CEBA 1VRTA 3L2VA 1YTAA 3LZJA 3PX6A 1KVCA 1R0AA 1VSLA 4B9LA 3TANA 2E6LA 3AVGA 3SQ1A 4KI6A 3L2RA 1LWFA 3DLKA 3K2PA 3L3UA 4DSKA 1TAUA 4I9QA 2RKIA
chains in the Genus database with same CATH superfamily
2F7TA 3O5BA 4DR3K 2XY7A 1P8ZA 2OPPA 3MWPA 1IBKK 5AQMA 4JI7K 3ZYYX 2QI2A 4CBWA 1GOBA 5AJ3K 3LDPA 4JD2A 4DTMA 4DWIA 1K6YA 4LFAK 4LD0A 3V9XA 4F3OA 2D0PA 3CFPA 1BISA 4B9MA 3CQYA 2QWRA 1JLGA 3IMXA 4ELUA 3THWA 3DMJA 4CEQA 3JAMO 1U47A 3TAEA 1YJ9N 2P9LB 3ENHA 4MFBA 5JVGL 1CXUA 1VSDA 2HMIA 5HRSA 2BDPA 2BE2A 4A62A 2VQEK 3E9PA 4FLZA 2W40A 4KKOA 2OANA 4C1NK 1E4FT 4JKAA 3NE6A 5AQSA 3LPTA 3NGYA 2HNZA 3HPOA 3V9UA 4OPHA 3LL3A 4C8MA 2YHBA 1MWMA 3S3OA 3MXMA 4I7FA 2O4GA 4NCAA 5AQJA 1MDUB 4E0DA 3T19A 3C95A 3RRHA 1N34K 1VSMA 5TKYA 4FWOA 4BDYA 2RHKA 1VHXA 4QS8A 3SQ0A 1CZAN 4CEEA 1IJJA 2HBLA 4BRNA 3ZETA 1WUAA 4CJEA 5EVZA 3VEOA 4O5FA 4O0JA 4V19S 1IKWA 2NRZA 3ASMA 4M3UA 4WQ5A 5AZJA 3CCEN 1S1TA 5BRHA 5AQWA 1DTQA 3OYJA 5AQTA 2V51B 3TAMA 1WB9A 3AV9A 5AQZA 3OYIA 1X3NA 2ASPA 1V4SA 3CQXA 3THXB 4A5BA 3ZCMA 1SKSA 5FPEA 4FW1A 2FBVA 3OYNA 1T7PA 4O5BA 1EWQA 1QHAA 2QXFA 4X65K 1FK9A 3L2UA 1VK0A 1W7AA 5BPLA 3L3VA 4CD3A 1LW2A 1RT3A 3OA9A 4J2AA 1QSLA 3D0PA 3GG4A 1X9SA 3SMPA 5AQGA 3AGKA 3VF4A 4FLUA 1LWCA 3CHWA 3FZLA 1SUQA 4H0TB 4O44A 4CFCA 2QK9A 1HLUA 3AA2A 3PX4A 1EXQA 4IFVA 5CYMA 2UXCK 3KLEA 4KPYA 4FWPA 2QWNA 5KQDA 3RR8A 3V1OA 2IC3A 3KK1A 3ZX0A 3E9OA 4B1YB 3CC7N 3K5NA 4IBNA 4OPAA 3VEZA 4GNIA 4DTXA 3QEIA 3TAGA 3JXUA 2P9SB 4YHHK 4JI0K 2FSKA 2KLAA 3BF1A 1TK5A 3FR0A 3O4QA 1XUPO 5AQUA 4J2DA 2FXUA 1UOCA 3D6RA 3SLCA 3SUPA 3O8MA 2JGUA 2D1KA 4Z4EA 3MEDA 2ITGA 4DV5K 5FDLA 1BQMA 1XC9A 2PFUA 1RTIA 2I7PA 3QB0A 4B3SK 2YJEA 2KTQA 4M3XA 4FZYA 1U2VB 5BR9A 2IVPA 4A5AA 4FLYA 3R8EA 2PBDA 2FC0A 5CR4A 4FM2A 3T7ZA 1JLFA 5BPMA 3AVFA 1JLBA 4CGJA 3HO1A 1JCFA 1NGHA 3VGKA 3ITHA 3SPZA 2QM1A 4BC2A 4CJ5A 4KB0A 4KHNA 3O1BA 4DKWA 1HKGA 2HHTA 3EKSA 4NLBA 4N41A 1BI4B 3RRGA 3AVLA 3G71N 4BGAA 4JNEA 2A5XA 3SQ4A 4B9TA 3VEXA 1QQOA 3VF2A 2HW3A 4FLWA 4I2QA 3VQ4A 3T1YK 4B8CA 3KZBA 2YHXA 1HX1A 3OYAA 4FWRA 4DHYA 1IH7A 4CJQA 1TKTA 4DTNA 3U9ZA 4A57A 4DSEA 5AQYA 3SUNA 1HR0K 4FCYA 2E1ZA 5GIPA 3VQPA 4E89A 3K5MA 4ID1A 1LOTB 4BQZA 2IDOA 3FFKB 1REVA 3LDQA 4IFEA 5FLXO 3ZT0A 4LH4A 3J7YP 1VSJA 3G25A 4IOAL 2DTUA 4BR9A 3R9PA 4A59A 1VQ7N 3SV4A 4BRGA 4GKKK 1BL3A 3WNHA 1SKWA 1MWKA 1TAQA 4CHYA 3PSIA 2Y1IA 5I42A 3RR7A 1NK0A 1ZYQA 4IDHA 3CMEN 3RMDA 2O8EB 1HQEA 2NNWA 2ZE2A 4JS4A 4KFBA 3T3FA 1OH6A 2D0CA 5KI6A 4JI5K 3NF9A 5GAHP 4PUOA 3SNNA 1GOCA 2R7YA 4H0VB 1X9JA 1VQ9N 3VF6A 3D2FB 2HBMA 3BY5A 4NCGA 1HJRA 3AO5A 3V6DA 1J5EK 1WBDA 1NU0A 3A8YA 1QZ6A 5CZ2A 4CHPA 3I8BA 3PX0A 4CF1A 2GV9A 3V9ZA 1NK4A 3BZCA 5J2NA 4F3TA 4DSIA 1NNEA 1KRPA 4BE2A 3H3NO 3ZX3A 3TSPA 3ZSRA 1OKJA 3NGZA 1L3TA 2OPSA 4FK2A 1RDWX 3UB5A 1HRHA 1WAFA 4E1NA 2G8FA 4WFAL 4Z4IA 3ID8A 5ELZA 3QDKA 1T44A 3A5NC 1ASVA 5LL6Z 4FJ9A 2QKBA 4BE1A 1KFDA 2P5GA 4DTSA 4KBOA 4FJNA 5F1XA 3NH0A 3MN9A 3RWUA 4JD2B 3DJCA 4CZMA 3DAWA 3RSEA 4M3TA 3TTCA 3DRPA 2Z1IA 1BHLA 2DFFA 3V9SA 5AQKA 4CJSA 2XO7A 5LJVA 3QEWA 1JCEA 2VGMA 5EY4A 3LM2A 3THWB 3HSTB 3VEWA 3PIOL 5J2PA 3SJHA 1NG9A 2CGLA 2VWBA 5KRTA 4DG1A 3HYFA 4DV6K 4Z4GA 2ZGZA 1RDUA 3VQAA 3KVGA 1TK0A 1ITGA 3VERA 1KSPA 3QESA 4H0PA 3NAEA 3CPWM 3CPEA 3OYDA 3QO9A 4OVLA 2Q3SA 4AF1A 1QVGM 2HSTA 3ZSQA 4DS5A 3DXMA 4CJPA 2OTJN 4JK9A 5SZTA 3MN6A 1VQNN 4CF9A 1L3SA 5AQFA 2Q0RA 2HNYA 3ZSVA 4BDZA 1TK8A 1L3VA 1RTDA 5M1KA 2P9PB 2LSNA 4CI6A 2E2OA 2NUBA 2A41A 4GW6A 1VSEA 1TVRA 2Q1NA 4NB4A 1JLQA 1Z05A 4BRFA 1WBBA 1WSEA 3WT0A 4FZZA 1C1BA 1KAYA 1YTAA 5GIOA 5AQOA 4O8UA 3D7EO 2VQFK 1J6ZA 3ZETB 4G9ZA 4XH4A 3K2PA 3L3UA 5A2QO 4DSKA 3CC4N 3L6QA 3AO4A 3L4IA 4FM1A 3L4QA 4QOZB 4DU3A 4JS5A 4U7BA 4B9UA 1EKEA 1RDDA 4FJHA 4IOCL 1XWLA 4CK3A 5AZJB 4W5RA 2UXDK 1SL2A 1GLCG 2I5JA 2YKMA 2AP1A 4C23A 3MN5A 2O8FA 4DR7K 2FLOA 5BRDA 3ZSWA 3SUOA 3OBYA 5E84A 4BWMA 4N56A 2Q31A 5EXWA 4H8KA 1JL2A 3OVNA 1HQUA 2ASOA 3BEXA 3O3GA 2KFZA 5SWMA 5KPZA 3QNOA 4H5VA 1BI4A 4FJ7A 5F2RA 3TSQA 2HHHK 1HNWK 4A2AA 3HVRA 3EEQA 4AH9A 2ITMA 2NRWA 4E7HA 5AQVA 3F2KA 3MXJA 2Q2RA 2QKKA 4C8NA 2XHBA 4HCCA 2ZF5O 5JICA 4GV9A 1RDBA 3DLLL 5LMNK 1NGJA 1XC3A 4W5OA 1BCMA 3MEEA 2X78A 3WUHA 4WQ4C 5FRNA 4RW9A 4B9NA 4FXDA 4DSFA 3O1WA 3LANA 1QSYA 4ELVA 2RF2A 3G0ZA 4N5SA 3O3FA 2P51A 1OVYA 2E88A 3ZSXA 3AY9A 2P9IA 1TUYA 4KHPK 3JS6A 4XIUA 5BRFA 2X6NA 4HWIA 4PL8A 4K0KK 4IDKA 4EFHA 4J2EA 1N6QA 5DMRA 1KVBA 4ISFA 3SAGA 2GTDA 5HRNA 3CFOA 1TL1A 3RTVA 2X74A 4IEIA 1W2BM 1RBVA 1SZ2A 3CD6N 5MLCQ 3HM9A 4CZJA 2HF3A 4BDPA 4IEEA 3F9KA 1C0GA 4DR4K 4NO7A 3WXIA 5CE3A 1B9DA 2RE2A 2GUIA 4BE0A 1RFQA 1HNXK 1ZC6A 3FZMA 3HJFA 4CIEA 1VSIA 3ZSZA 3R3LA 4KH6A 2FBXA 4CHNA 4DV4K 3VOVA 2JWLA 4KHQA 4CHQA 3HK2A 1YUWA 1BQNA 2KFNA 2IVNA 4GKJK 3EL2A 3CQ8A 4O0IA 4B9VA 4FJIA 4KREA 3J80O 2FSJA 1BG3A 1KLMA 3CC2N 3OYGA 5I9EB 5J2QA 1NKCA 1K73O 2D0AA 1JLEA 2QWMA 2X6SA 5AQIA 1QE1A 1NJIO 4CCHA 4CJVA 1MA9B 1N33K 3MCAB 1NJZA 5HOOA 4WYBA 3E66A 3M1FA 2D0OA 1DKGD 5AFUA 4WE1A 4LY7A 4CJKA 3ZT4A 3LAMA 3OYLA 3B6PA 4M3YA 3IRXA 4KO0A 3ULDA 5K14A 3IUCA 2KQ2A 3DM2A 5CY4A 4JKCA 1VSKA 4G1QA 4HTUA 2UXBK 2CH6A 4BRQA 2E2PA 4LH5A 3CCLN 2G8IA 4FWNA 4BQLA 3AAQA 4FJ5A 3A5MC 3TSUA 1KD1O 3SAFA 2ZJQL 3PIPL 4EZ6A 2ATQA 1GLDG 2JLEA 1KCFA 5M1PA 4CESA 1YXQA 3HP6A 3RVCA 3HL8A 4J2BA 1Z26A 4HUFA 1W9HA 3SV3A 4CJTA 4M7YA 4HVJA 4YOVA 1FJGK 1SS6A 1BIZA 3U6FA 4JKEA 4CZHA 5FPDA 3UKRA 3MK6A 1J54A 4H5RA 2W6KA 3HP9A 4FWKA 4E1MA 2UUAK 4Z94A 4M7XA 3DYAA 4RG8A 3ZT3A 1RBSA 4DMNA 1U48A 1BU6O 1S1XA 4OLAA 3ZT2A 4RCHA 3WQTA 3O9UA 5C2FA 4GV6A 3V81A 3OYEA 3UKUA 4JI8K 4FW2A 2VWJA 3TU5A 2ZM6K 1QQCA 4L3QA 2P9PA 1X3MA 3VGMA 4LF5K 1RT4A 3AVIA 4DB3A 3AA3A 1EETA 1XQSC 4HHTA 3DXKA 4KHYA 1RGIA 3GOIA 1TV6A 3P1GA 3PO5A 3KKRA 1WSIA 4A2BA 3MXIA 5DK5A 2OPQA 3QLHA 4C8KA 3VQ7A 1IBLK 2UU9K 3TAFA 1ZBUA 3CMAN 3CJ1A 4ELTA 2VYPA 4JRPA 3VQCA 1KVAA 3RSEB 3O4WA 1C1AA 4YOYA 4IKFA 2WTUA 1S9EA 5AZIA 3VMFB 3KIOA 4Z4CA 2YCHA 3IFRA 4JKGA 1T8EA 3ZEUB 4OJRA 2PYLA 3DRSA 1C0MA 1CZ9A 3F5TA 3QINA 1HPMA 3HRGA 3A5LC 3OYMA 4WCEL 1UA0A 4JN4A 4BR7A 3WNEA 2CGJA 3CJBA 2VCPA 3OBWA 4OKJA 5J2MA 4B1WB 4RW4A 1LW0A 1NGEA 4BG8A 3U3YA 2B6AA 2XY6A 2D4WA 2NRRA 3AA5X 3H1QA 2KW4A 3WXJA 3TABA 2FSNA 5IT9O 4CF0A 3DXMB 1Q81O 3K5OA 1KFSA 3TPQA 4BROA 4RW7A 4DSLA 4CJ7A 3VQQA 4HTLA 3FZHA 3TWHA 2XY8A 2ZJRL 3CJ7A 3KK2A 4B3TK 3I0RA 3C6TA 4B3RK 5LJWA 3ZX2A 4ZTFA 2O4IA 2YHWA 4H0YB 4CZGA 4A61A 3SI6A 2A42A 4DFKA 3KK7A 4FVMA 2YNGA 4CBXA 1D4XA 2EWSA 1WN7A 3J8AA 3E9LA 2QW9A 1A5WA 3BUZB 3KD5E 4JAXA 2A1SA 3O9TA 3VEYA 4CJRA 3NHGA 2O8FB 2P9KA 2DFHA 3NDKA 4BY9C 3EZWA 4L8RB 4N47A 4JLHA 1JCGA 4B1UB 3H08A 4H5TA 2JWKA 4X62K 4DTOA 5AQPA 2ZWHA 4CIGA 5J1EA 2PZSA 1HJOA 5KTQA 1I39A 4CK2A 4CJWA 3IKMA 3D2EA 4JI1K 2FBTA 4PA1A 4F2SA 4IJNA 1XHZA 5KQ8A 4Z4HA 2CGKA 2NZTA 4DF4A 3RMBA 1KTQA 4PKIA 5JMVA 1H1VA 3NMUA 1NK7A 1NK6A 4BR5A 4DFMA 1HYSA 1U49A 1S1VA 3IG1A 1VQMN 2DFEA 5JLFA 3EKUA 1SL0A 3P31A 3VTIA 3BF3A 1FKPA 4CW7B 4JKBA 2NRVA 4BRIA 3LP1A 2DPNA 4WQ5C 2P9IB 3OJSA 1ATSA 4GVMA 1VQ8N 3WEEA 4BR4A 5KGXA 1JXBA 4B08A 1C6VA 3CCMN 3ATUA 1HKCA 4FL9A 1BA0A 4DQSA 4J8FA 3DLRA 1RNHA 3EE8A 4BGBA 4QAGA 1GLJO 4LC9B 3VPZA 2DY4A 4YFUA 3OJUA 4JV5K 1R0AA 2YX6A 3I33A 1P90A 3L2RA 4PKGA 3VETA 2IIRA 3BZKA 4DSJA 3CCQN 3C6HA 1YT3A 3O9QA 1WOQA 5IWAK 3MECA 1T3VA 1KC8O 3J81O 3HT3A 2P9UA 4BG9A 3AARA 1N36K 4DLGA 3BP8A 3AVNA 3CM6A 5KGWA 3NFAA 3N4PA 5FROA 3M8PA 5CZ1A 1HNVA 3CCUN 4CGIA 4DF8A 1EX4A 3B6OA 2BTFA 4FSVA 1QVFM 5JS1A 2BUPA 1RCHA 5KPTA 4MO5A 3VEVA 5ADXA 3KJVA 1NGGA 3QEVA 2E5LK 4FPBA 3R6MA 3H1VX 4DFJA 2VG5A 4CBUA 1ZBFA 1ATNA 1M90O 3LM9A 2HHVA 3V1QA 1BO5O 3QERA 4CERA 4AM6A 4Q5VA 2VWKA 2E8AA 1VQ6N 4DR2K 3QEXA 4DR5K 1DTTA 3WXMB 4CEFA 1HNIA 4CEAA 1S1UA 1RTHA 3PY8A 4FJXA 5I3UA 3FFIA 5F0XA 1WAJA 1K9MO 3LP2A 4FWQA 3V1RA 3CJCA 1QSSA 2RPIA 1B92A 4GV3A 4RTFD 4IOXA 2Q0UA 4AHCA 4CZLA 4OGEA 5E26A 3P83D 2W42A 4CF2A 1N5YA 4OLBA 3ZEUA 4H4MA 1YITN 3W3DA 5C0YA 3CI5A 5E41A 5C42A 4FM0A 3QFPA 1IG8A 2ZD1A 4ICLA 4OKKA 3O08A 3QBWA 5M1NA 4ISGA 4O55A 3K58A 4FK4A 3OS0A 4ZTJA 5DM6L 2WOMA 3KTQA 2QWOA 2F8SA 3UKRB 4CJUA 2FF6A 1IV0A 2YJFA 3AO2A 4UY8O 5D3GA 1O13A 4KB1A 4YNQA 1XI1A 3CIPA 3K57A 4LF8K 3DOLA 5BR8K 4CVNE 3UKUB 3KLIA 3H3OB 2A3ZA 5C15A 3OYCA 1Z25A 3W0LA 1DEJA 4ZHRA 1SV5A 3SZ2A 2OYQA 4YOTA 3C7NB 3DXKB 1QHTA 3V9WA 4B9QA 1L3UA 3O9RA 3CFRA 1IKYA 3PV8A 3S3NA 4WFBL 3DOKA 4KTZA 3SAHA 5HRRA 1TKDA 5EOYA 2HNDA 4EHUA 3NF6A 4NCBA 3NBPA 1KAZA 1VRUA 4FJJA 5AZIB 4BRKA 3HVTA 4RWTA 3V4IA 2V52B 3C94A 1O1WA 3B8AX 5FPMA 1CLQA 2BANA 4DLEA 4JKGB 4BC3A 2QXLA 4Y0WA 5JLHA 2G8HA 5C2DA 3L2WA 2NRXA 4JI4K 4GVEA 4AHSA 4KAZA 2J4RA 4B3OA 2E6MA 1YHQN 1XNQK 2W41A 4K42A 2F8TA 1JLCA 3I55N 4BC4A 2OCEA 4XH1A 1X9WA 1VQLN 4B9SA 4EP5A 4M63C 1VSFA 2NRTA 1RT7A 3MMVA 5AFUH 5GINA 1U4BA 3O4NA 1VAZA 3QIPA 3WNFA 1ZBIA 4I6MB 4KTWA 2G8VA 1VQKN 4E7JA 2WONA 2VG6A 2E1YA 4CZIA 2O8CB 1SAZA 3CYMA 4JK8A 4E7IA 1LAWA 1NK9A 1IG9A 2F9WA 1BUPA 3LDSA 2PYJA 4DUZK 3VTHA 1KAXA 3KHYA 3J7ZO 4EZ9A 4FVUA 2UUBK 2IS3A 1LAVA 3ALYA 3C65A 4DR1K 3P38A 3SMSA 3K9KA 3LDNA 4YOUA 2P9NB 1EO1A 2D0BA 3AVAA 3KKSA 1BDGA 3ZSOA 5BN8A 3A5OC 3PUFA 2A40A 3K5LA 4BACA 3TR8A 1NMDA 1X1PA 3AVJA 4DTRA 4OPJA 4CGDA 3HPHA 3CERA 2F4VK 2P9KB 1SQKA 4DU1A 3CJAA 4RW6A 4ILHA 1HUXA 4OO1J 3O3HA 1RT5A 3HBTA 5AQLA 3T1AA 3FGUA 5JS2A 4AHRA 2HF4A 4CEOA 3THYA 3OYFA 2FF3B 3D2EB 4RW8A 2GBZA 2XRIA 4CJ3A 5C25A 1UAXA 2Y1JA 3ULEA 3AO1A 1W0HA 4E3SA 1QS4A 3Q7CA 4OKEA 4CHOA 4BR2A 3GL1A 5KRSA 2HMPA 3ZSYA 4KH4A 5M1QA 1S9GA 4N76A 3LP0A 1VSHA 4O8KA 3EE9A 2FBYA 4FLXA 1CXQA 3O9SA 4FOEA 1LV5A 2G8WA 2OTLN 3LP3A 4CIFA 3LAKA 1NK8A 4CECA 5C10A 3H45C 4JI3K 4JRQA 4O4GA 3VQ5A 3MAQA 4JI6K 2EHGA 3OYKA 2ASMA 3H46O 3DLBA 4OX9K 1D9FA 3A2FA 4PHTX 2HB5A 5HP1A 4Z4FA 4EAHD 4DQPA 4FPAA 3WEEB 4MLEA 3CJ9A 1NJXA 5GAEP 5C24A 3MCPA 3MWTA 3SJJA 5BN9A 3I0SA 4MQ3A 3T69A 3OW2M 1Q82O 1UA1A 3UE5A 4KI4A 1N32K 4YY3K 4W5TA 5M1FA 3KWIA 1SL1A 1NWKA 4DQIA 3O80A 1L5UA 3OS2A 1ZBSA 4C8LA 4YOWA 4FWMA 2RN2A 4YDUC 2ETJA 2UUCK 1BOTO 3AA4A 3EZ5A 4KHUA 3TI0A 5KPRA 1JKHA 3P39A 4CE9A 4FLTA 5CYQA 4KV8A 4AHUA 5BREA 4MDBA 2GEMA 1TKXA 1ATRA 1U6ZA 2P9UB 2CH5A 4ILGB 3QFUA 3OTOK 3HTVA 4H03B 3P5JA 1U04A 3QBXA 1K8KA 1TGOA 1LWEA 1RILA 4F9OA 4Y1CA 1HYVA 3HOSA 4OGCA 4CJFA 1BGXT 1Q18A 3MX5A 4DV2K 3M5RA 3C7NA 4DU4A 4NXNK 1ZXOA 2GWJA 4B1VA 1LCUA 2YHYA 3K9JA 3O6WA 2Z1JA 4FJKA 4E19A 4FJLA 4KTQA 3DLEA 1WSHA 2NLXA 2QEXN 4DQ8A 1I94K 1J9AA 2VG7A 3L8BA 4F4KA 4OPKA 1U45A 4EHTA 1DGKN 1XMOK 4F8RA 1S3XA 3GBTA 3NGIA 2ZJPL 2QWQA 3AAPA 3CCSN 1YJWN 3EY1A 4PQUA 3LDOA 2P5OA 1T03A 3OS1A 1YTUA 2QWPA 2HHUA 1IO2A 2AJQA 1MU2A 2PY5A 1NJYA 1ASWA 3OHRA 1HKBA 4JHDA 1X9MA 1Q9YA 1S22A 3HZ6A 4H5WA 3SBTA 1XNRK 3K59A 3QIOA 4X64K 4FK0A 1R59O 3F73A 2HVHA 4GMJB 1A5VA 3L2VA 3PX6A 1VSLA 4B9LA 5GAGP 2HBKA 3DLKA 1TAUA 4CGGA 5AQQA 4I6MA 2RKIA 4X66K 2HHSA 5EU7A 2G8UA 2O8CA 3L0QA 3DLGA 4CJLA 4WFNL 3J7AP 3LPUA 1HMVA 3L2QA 4I9LA 4BR0A 3A0IX 3NF8A 4K8XA 4LF4K 2Q36A 4UQGA 2YI1A 3GDQA 1RT2A 4BRDA 1RBRA 1ILYA 3QICA 4H0OA 1D9DA 3NVKA 1YF5L 4FZXC 3VA0A 2ZGYA 2YHAA 2P9NA 3HPGA 4AHTA 1ZBLA 5M1OA 3KLGA 1TKZA 4BRCA 3NCIA 4CD1A 4JI2K 3KK3A 4LF7K 5LY3A 4DV7K 2I7NA 1VQPN 4KHSA 1TYQB 4DR6K 3CG7A 2IAJA 2IOCA 1QQMA 1EQYA 2Q97A 4B1XB 4YOXA 1FW6A 5FPNA 1E3MA 2HHQA 2EX3A 1KXPA 1JL1A 1KLNA 3QEPA 4H0XB 1YI2N 5ADXH 3SUQA 4IXCA 2G8KA 3QNNA 3PLAA 1WLJA 1WSGA 3FLCO 4MLHA 4DTPA 2BH1A 3AVMA 4BVPA 1T6CA 3C0BA 2VGNA 4BRMA 1A5XA 4Y1DA 3H6EA 4TSXA 2O8DA 4CFDA 3NH2A 4M41A 1DT9A 2E20A 3E01A 3QETA 2YNIA 1M1KO 2E4LA 3VESA 1NGIA 4IZ9A 4JKFA 2V7YA 4FO0A 5FRMA 4IO9L 3ISNC 3C6UA 3OY9A 1ASUA 2W6LA 1YVNA 4CFAA 3VQ9A 4NLCA 2E2NA 3VQEA 4PKHA 1RTJA 1VQ4N 4BC5A 4HUEA 2NRHA 4DV3K 1JXEA 4M45A 1Y97A 3JYTA 3S41A 2WBNA 4QS9A 2E2QA 4CFBA 1OH5A 2YKNA 1YVUA 1YJNN 4E1JA 2GWKA 4IFYA 2P1JA 1C0TA 4ID5A 2QWLA 3AVHA 2YNHA 4JK7A 1HYZA 1Y64A 3IAYA 3K0SA 4CZKA 4BREA 1VQON 5AQNA 5AQRA 3RMAA 3AO3A 2WFBA 1NBWA 3M8QA 4CF8A 3HSCA 4PWDA 3AVKA 3ZT1A 2QA4N 1NGBA 2V7ZA 2O8BB 3M6GA 1BA1A 3CXCM 1NGFA 3DWLA 3U8XA 3SYZA 1JLAA 3E1YA 3THYB 2HHXA 1S1WA 1KQSM 3BDPA 1E4GT 2P9LA 1Q86O 3FE1A 3OYHA 1NOZA 4FJGA 1Z6RA 3CETA 3TAPA 3ULEB 1S72N 1FXXA 5LMUK 3N4QA 4H4OA 4E7KA 1I3AA 3DLHA 3TARA 4K43A 1J53A 4HUGA 4DQQA 4NYNA 1IKXA 4Q0BA 3U4LA 2HVIA 2Z1GA 3IDHA 4CGHA 4LFCK 1Q9XA 4B8AB 1K8AO 2OZSA 1NGCA 4CEDA 2IGIA 3WQUA 3KLFA 3C6AA 5HBMA 1YIJN 4C8OA 3CM5A 1W97L 4BVOA 4Z0UA 5C12A 4BRPA 1NGDA 4PL7A 2GELA 4IWVA 4NXMK 5T7BA 5BPNA 1ZBHA 3HXMA 1G15A 3VQDA 3EYZA 1GLAG 3G10A 4E7LA 4DTUA 3CCJN 3SCXA 4R5PA 1FKOA 4IO8A 1Q8IA 4W5QA 1NM1A 1T05A 4W5NA 4EIAA 1QTMA 4JEPA 3PO4A 3SPYA 3NH1A 2A1RA 2BGGA 4H5NA 4DFPA 4CGFA 5EX5A 3FZFA 4WQ4A 2XY5A 3VA3A 1WSFA 4DV1K 1N8RO 5AQXA 3OYBA 1C0UA 4QCLA 2OA8A 3R1XA 4CZEA 2AA4A 4U67L 3VQ8A 3ENBA 1C1CA 3QMLA 1TL3A 1NKBA 3LDLA 4B3MK 1OVQA 1UWBA 3THXA 5H1SQ 3KLHA 2YV0X 4NYFA 1GOAA 1K8KB 3M8RA 3G6EN 3TTDA 3TAQA 2IVOA 1J5OA 5B8HA 4FJ8A 3CF5L 4IG3A 1G99A 4K41A 3LWMA 3U3GA 2UYTA 4M3WA 3AGRA 3MX2A 1T6DA 3AVCA 1NKEA 4FWSA 3THVA 3LALA 1TUUA 3WXKA 4C1NI 1GLLO 3IS9A 5CHIA 4FLVA 1NGAA 5HRPA 4JKHA 3FZKA 4DTJA 3ZLJA 1EP4A 3VQBA 3NVMA 4HCBA 2D5RA 1QQNA 3S3MA 2P9SA 1TYQA 3CCVN 1QZ5A 3VQ6A 1RT6A 2OZMA 3VGLA 1XMQK 3HI0A 2YNFA 3MEGA 5AQHA 4DS4A 5HROA 1RBUA 1SKRA 4CHZA 4KRFA 1NK5A 4M42A 4MO4A 3KD1E 4JHDB 1U2VA 2H3GX 4FOIA 4JKDA 5HL7L 3HOTA 5HLFA 4XEIA 1RDAA 1NLVA 1RT1A 2A6AA 3EO3A 4ISEA 3TTFA 1XHXA 3M8SA 4M3RA 4LF9K 4WF9L 3EN9A 4DQRA 4AM7A 2ZQBA 1RBTA 2B4JA 3SBGA 4DCHA 3LWLA 4PY5A 1S6PA 1C0FA 4R79A 3RMCA 4K8ZA 2KZMA 3I8DA 1DLOA 2KKZA 3KWGA 1RDCA 1B9FA 4YDUA 4ILJA 3PSFA 3MN7A 5AR0A 4LFBK 3T1HK 4IJAA 2QTDA 3G4SN 1BWFO 3ATVA 3ID6A 4F2RA 3GE1A 2PAVA 2WUSA 2Z1HA 1Q7YO 3M3ZA 1JJ2M 4QS7A 4AHVA 4I2PA 2HBJA 3UIQA 4JYAK 4BWJA 3LZIA 4CEZA 4FJMA 4CZFA 4CJ4A 4MDAA 1IKVA 1V4TA 1HNZK 3DI6A 2HHWA 1OH8A 2F9TA 1WSJA 1D8YA 3D45A 2GX9A 2KZZA 3VENA 3P4IA 1F21A 3CCRN 1S6QA 4KH5A 4IG0A 5DM7L 5JVHL 3HM8A 4LSNA 5TKWA 1VQ5N 4FYDA 4BRHA 4XH5A 3ENOA 4FWLA 3WNGA 4K25A 2B5JA 1NMNA 3AVBA 3U9DA 3WXLA 2OPRA 3S9HA 1CZBA 1BIUA 3VN5A 4BRAA 1S5JA 1GLBG 2O8BA 1OH7A 2O8EA 1EWRA 1NJWA 4BRLA 1NOYA 2F96A 1ESVA 4M3ZA 1GLFO 3MDQA 2O8DB 4EP4A 4AILC 3DRRA 4GY2B 2GUPA 3D2FA 1HPZA 1D5AA 4LF6K 3NF7A 1IBMK 4AQYK 4YORA 3BGRA 4CK1A 4KHWA 3JSMA 1BCOA 3SQ2A 5GADP 4DV0K 1WNSA 4LSLA 4DUYK 3Q7BA 1YAGA 4CEBA 1VRTA 3LZJA 1KVCA 3F9MA 3SK3A 4B1ZA 3TANA 2E6LA 3AVGA 3SQ1A 4KI6A 1LWFA 3I56N 1GLEG 2HOEA 4I9QA 2KHOA 2WC9A
chains in the Genus database with same CATH topology
2HHSA 3AO4A 4FM1A 2XY7A 4DSJA 4DU3A 2OPPA 5EU7A 4JS5A 2G8UA 4QOZB 4B9UA 1EKEA 1RDDA 1YT3A 3DLGA 4FJHA 4CJLA 1XWLA 4CK3A 4W5RA 3MECA 1SL2A 3LPUA 1HMVA 3HT3A 3L2QA 2I5JA 4I9LA 2YKMA 4DLGA 3CM6A 3AVNA 5KGWA 3NF8A 3NFAA 4K8XA 1GOBA 5FROA 3M8PA 5CZ1A 1HNVA 4UQGA 4CGIA 4DF8A 1EX4A 3B6OA 1RT2A 4DTMA 3ZSWA 1RBRA 3SUOA 5JS1A 4DWIA 1D9DA 1K6YA 1RCHA 4BWMA 4FZXC 4LD0A 4N56A 3VA0A 3V9XA 4F3OA 2YHAA 3HPGA 4H8KA 1JL2A 3OVNA 1HQUA 4AHTA 1ZBLA 3O3GA 2KFZA 4CGGA 5SWMA 3KLGA 3KJVA 3QEVA 1TKZA 3NCIA 3CFPA 1BISA 4B9MA 3KK3A 3QNOA 4DFJA 2VG5A 1BI4A 4FJ7A 4KHSA 1JLGA 1ZBFA 3HVRA 4ELUA 3DMJA 4AH9A 3CG7A 4CEQA 2HHVA 2IAJA 2IOCA 3V1QA 3QERA 4CERA 4Q5VA 4E7HA 2VWKA 1U47A 3QEXA 3TAEA 1DTTA 3MXJA 4CEFA 1HNIA 4CEAA 1S1UA 1RTHA 3PY8A 4MFBA 2QKKA 4FJXA 2HHQA 4C8NA 2EX3A 2XHBA 4HCCA 1CXUA 5I3UA 1RDBA 1VSDA 1JL1A 3FFIA 1KLNA 2HMIA 1WAJA 3QEPA 5HRSA 3SUQA 4W5OA 2BE2A 3LP2A 1BCMA 3MEEA 3V1RA 2X78A 2BDPA 1QSSA 2RPIA 1B92A 4FLZA 5FRNA 2G8KA 4KKOA 4RW9A 4B9NA 4FXDA 4DSFA 4AHCA 3LANA 1QSYA 4OGEA 3QNNA 4ELVA 1WLJA 1WSGA 2RF2A 3P83D 4CF2A 3G0ZA 2W42A 4DTPA 3NE6A 3AVMA 1N5YA 4OLBA 3LPTA 3NGYA 2HNZA 3HPOA 1A5XA 4Y1DA 4N5SA 4H4MA 3V9UA 3O3FA 2P51A 3ZSXA 4TSXA 4C8MA 5E41A 2YHBA 3S3OA 4XIUA 4CFDA 3NH2A 4M41A 3MXMA 2X6NA 4I7FA 5C42A 2O4GA 4FM0A 4NCAA 3E01A 3QETA 2YNIA 4IDKA 4J2EA 2ZD1A 4ICLA 1N6QA 2E4LA 4E0DA 4OKKA 5DMRA 1KVBA 3T19A 3C95A 4O55A 3K58A 3RRHA 4FK4A 3OS0A 5FRMA 4ZTJA 1VSMA 3ISNC 2WOMA 3C6UA 5HRNA 3OY9A 1ASUA 1TL1A 3CFOA 4BDYA 4CJUA 3RTVA 2F8SA 2X74A 3SQ0A 4CEEA 1RBVA 4CFAA 3AO2A 3HM9A 3VQ9A 5D3GA 4KB1A 4BDPA 4CJEA 3VQEA 4YNQA 1XI1A 1RTJA 3K57A 3DOLA 4O0JA 4HUEA 3F9KA 3KLIA 1JXEA 4M45A 1IKWA 3ASMA 4M3UA 1Y97A 3JYTA 3OYCA 1B9DA 2GUIA 4BE0A 1S1TA 1Z25A 4CFBA 1DTQA 3OYJA 4ZHRA 1SV5A 2YKNA 3SZ2A 1YVUA 3HJFA 2OYQA 3TAMA 4IFYA 3AV9A 4CIEA 3OYIA 2P1JA 1C0TA 1QHTA 4ID5A 1VSIA 3ZSZA 3V9WA 3AVHA 2YNHA 1HYZA 1L3UA 2FBXA 4CHNA 3CFRA 1IKYA 3PV8A 4CHQA 3ZCMA 3IAYA 1BQNA 4KHQA 3HK2A 2KFNA 3S3NA 1SKSA 4FW1A 3CQ8A 2FBVA 4O0IA 3OYNA 3DOKA 4KTZA 4O5BA 1T7PA 4B9VA 4FJIA 5HRRA 4KREA 2QXFA 1TKDA 3RMAA 3AO3A 1FK9A 1KLMA 3L2UA 3OYGA 3M8QA 1VK0A 5J2QA 4CF8A 1NKCA 4PWDA 2HNDA 3AVKA 1LW2A 1RT3A 2D0AA 3L3VA 3NF6A 3ZT1A 4NCBA 4J2AA 1QSLA 1JLEA 3D0PA 2X6SA 4CCHA 1QE1A 3NBPA 1VRUA 4FJJA 1X9SA 4CJVA 3HVTA 4FLUA 3V4IA 1LWCA 1NJZA 3C94A 1O1WA 3SYZA 1JLAA 1CLQA 2BANA 2HHXA 1S1WA 4DLEA 3BDPA 1SUQA 4O44A 4CFCA 2QK9A 4WE1A 2G8HA 3OYHA 1NOZA 4LY7A 4FJGA 3AA2A 4CJKA 3PX4A 3TAPA 1EXQA 3L2WA 3ZT4A 1FXXA 3LAMA 3OYLA 4H4OA 4IFVA 1I3AA 5CYMA 3B6PA 4E7KA 3TARA 3IRXA 3DLHA 4KO0A 3KLEA 4M3YA 4AHSA 1J53A 4KAZA 4KPYA 4B3OA 4HUGA 4DQQA 4NYNA 1IKXA 2E6MA 3ULDA 3RR8A 5K14A 4Q0BA 3V1OA 2IC3A 2KQ2A 2Z1GA 2HVIA 4CGHA 2F8TA 3KK1A 1JLCA 3DM2A 1Q9XA 4B8AB 5CY4A 4IBNA 3K5NA 1VSKA 4G1QA 4HTUA 2OZSA 1X9WA 4DTXA 4CEDA 4LH5A 2IGIA 2G8IA 3KLFA 3QEIA 3TAGA 4B9SA 5HBMA 4EP5A 4FJ5A 4C8OA 3CM5A 1VSFA 4Z0UA 4EZ6A 2ATQA 1RT7A 1TK5A 2JLEA 1KCFA 4CESA 3HP6A 3O4QA 4J2DA 3HL8A 5T7BA 1U4BA 4J2BA 1Z26A 1ZBHA 1UOCA 1W9HA 4HUFA 3HXMA 3O4NA 3SUPA 1G15A 3VQDA 3QIPA 3EYZA 2JGUA 4Z4EA 3G10A 4E7LA 3WNFA 3SV3A 4CJTA 4DTUA 1ZBIA 3MEDA 2ITGA 4KTWA 4HVJA 4R5PA 5FDLA 1BQMA 1FKOA 3SCXA 1XC9A 4E7JA 2G8VA 2WONA 2VG6A 1Q8IA 1BIZA 1RTIA 3U6FA 4W5QA 3CYMA 2KTQA 4E7IA 1LAWA 1T05A 4M3XA 4W5NA 4FZYA 1NK9A 1J54A 1IG9A 1QTMA 3PO4A 3HP9A 3SPYA 4E1MA 3NH1A 3LDSA 2A1RA 2BGGA 4DFPA 2PYJA 4CGFA 3DYAA 4FLYA 4RG8A 3ZT3A 1RBSA 4DMNA 2FC0A 2XY5A 4FM2A 4EZ9A 3VA3A 1S1XA 1U48A 1WSFA 1JLFA 3ZT2A 4OLAA 2IS3A 1LAVA 3OYBA 3ALYA 3AVFA 3V81A 3OYEA 1JLBA 4CGJA 1C0UA 3HO1A 4FW2A 2OA8A 2VWJA 4QCLA 3ITHA 3SPZA 1QQCA 3VQ8A 4CJ5A 4KB0A 2D0BA 4KHNA 3AVAA 1C1CA 1RT4A 3KKSA 3AVIA 3AA3A 1EETA 3ZSOA 4HHTA 2HHTA 4N41A 1TL3A 1NKBA 4C8KA 1BI4B 3RRGA 3AVLA 4KHYA 1UWBA 3PUFA 3K5LA 1TV6A 3TR8A 4BACA 3P1GA 3PO5A 3SQ4A 3KKRA 1WSIA 3MXIA 4B9TA 5DK5A 1X1PA 2HW3A 2OPQA 3AVJA 3QLHA 4FLWA 4I2QA 3VQ4A 3VQ7A 4DTRA 4B8CA 4OPJA 4CGDA 3HPHA 3TAFA 3KLHA 2YV0X 1ZBUA 3OYAA 4NYFA 4ELTA 4DU1A 1IH7A 1GOAA 1TKTA 4RW6A 4CJQA 4DTNA 4DSEA 3SUNA 4JRPA 3M8RA 3VQCA 4FCYA 1KVAA 3VQPA 3O3HA 4E89A 1RT5A 4ID1A 3K5MA 1C1AA 3T1AA 3TAQA 4IKFA 2IDOA 1S9EA 1J5OA 1REVA 5JS2A 3KIOA 4AHRA 4FJ8A 4CEOA 4Z4CA 4IG3A 3OYFA 3ZT0A 3LWMA 3U3GA 4LH4A 1T8EA 4M3WA 4OJRA 2PYLA 4RW8A 1VSJA 2GBZA 2XRIA 4CJ3A 3DRSA 3AVCA 5C25A 1C0MA 1UAXA 2Y1JA 1CZ9A 1W0HA 3AO1A 1NKEA 2DTUA 3THVA 3LALA 3QINA 4E3SA 1QS4A 4OKEA 4CHOA 3IS9A 5KRSA 3SV4A 3ZSYA 4FLVA 1S9GA 4N76A 3OYMA 1BL3A 5HRPA 3LP0A 1UA0A 1VSHA 3WNHA 4DTJA 1SKWA 2FBYA 4FLXA 1CXQA 1LV5A 2G8WA 3WNEA 3LP3A 1EP4A 4OKJA 3VQBA 4CIFA 3LAKA 1TAQA 5J2MA 4CHYA 4HCBA 2D5RA 4RW4A 1NK8A 2Y1IA 3S3MA 1LW0A 4CECA 5I42A 3U3YA 3RR7A 1NK0A 4JRQA 1ZYQA 2B6AA 2XY6A 3VQ6A 4O4GA 3AA5X 3VQ5A 3MAQA 3RMDA 1RT6A 1HQEA 2EHGA 2ZE2A 2KW4A 3OYKA 4JS4A 2OZMA 4KFBA 3T3FA 2YNFA 3DLBA 3MEGA 2D0CA 3TABA 4CF0A 1D9FA 3A2FA 5KI6A 3NF9A 2HB5A 4DS4A 5HP1A 4Z4FA 5HROA 3K5OA 1KFSA 4RW7A 3SNNA 4PUOA 4DSLA 1RBUA 4DQPA 1GOCA 1SKRA 4CHZA 3VQQA 2R7YA 4KRFA 1NK5A 3TWHA 4M42A 2XY8A 1NJXA 3KD1E 4NCGA 5C24A 3KK2A 3SJJA 1HJRA 3I0SA 4MQ3A 3I0RA 3AO5A 3C6TA 1UA1A 3V6DA 5HLFA 4ZTFA 4KI4A 1RDAA 2O4IA 4W5TA 1RT1A 5CZ2A 4CHPA 3PX0A 1SL1A 4CF1A 1XHXA 2GV9A 3SI6A 4DQIA 3M8SA 4M3RA 3V9ZA 1L5UA 3OS2A 1NK4A 4DQRA 4C8LA 2ZQBA 4DFKA 5J2NA 2RN2A 4FVMA 1RBTA 2B4JA 4F3TA 4DSIA 2ETJA 2YNGA 3LWLA 1KRPA 3AA4A 4BE2A 4PY5A 3EZ5A 1S6PA 4KHUA 3TI0A 1JKHA 3ZSRA 3NGZA 4CE9A 1L3TA 2OPSA 4FK2A 4FLTA 1WN7A 3RMCA 4K8ZA 2KZMA 3I8DA 1DLOA 1HRHA 4KV8A 1A5WA 1B9FA 1RDCA 1WAFA 5CYQA 4AHUA 4E1NA 2G8FA 4Z4IA 1TKXA 3KD5E 2A1SA 1ASVA 4CJRA 4FJ9A 3NHGA 4BE1A 2QKBA 1KFDA 2P5GA 4DTSA 4F2RA 2DFHA 3P5JA 3NDKA 4FJNA 1U04A 3NH0A 3RWUA 4L8RB 2Z1HA 4N47A 4JLHA 1TGOA 1LWEA 1RILA 4AHVA 4M3TA 3DRPA 4I2PA 3H08A 3UIQA 2Z1IA 1BHLA 4BWJA 4Y1CA 3LZIA 4CEZA 4FJMA 2DFFA 3V9SA 4DTOA 1HYVA 3KTQA 4OGCA 4CIGA 4CJFA 4CJ4A 5J1EA 1IKVA 1BGXT 2PZSA 5KTQA 1I39A 3DI6A 4CK2A 4CJSA 2XO7A 2HHWA 3QEWA 1WSJA 4CJWA 1D8YA 4DU4A 3D45A 2KZZA 2FBTA 4PA1A 1F21A 4FJKA 1S6QA 2Z1JA 4IG0A 4F2SA 4LSNA 4E19A 1XHZA 4FJLA 4FYDA 4KTQA 3DLEA 3HSTB 4Z4HA 3RMBA 4DF4A 1WSHA 5J2PA 1KTQA 3WNGA 2B5JA 5KRTA 4DG1A 3AVBA 3HYFA 1NK7A 4Z4GA 1NK6A 4DFMA 1HYSA 3VQAA 1J9AA 2OPRA 2VG7A 1U49A 1S1VA 3IG1A 3S9HA 3L8BA 1TK0A 2DFEA 4OPKA 1U45A 1ITGA 1CZBA 1BIUA 4F4KA 1KSPA 3VN5A 3QESA 1S5JA 3NAEA 1SL0A 3OYDA 3QO9A 4OVLA 4F8RA 3NGIA 1FKPA 2Q3SA 3ZSQA 1NJWA 3EY1A 4DS5A 4PQUA 1NOYA 2F96A 4CJPA 1T03A 2P5OA 3LP1A 3OS1A 4M3ZA 5SZTA 1YTUA 4CF9A 3OJSA 2HHUA 4GVMA 1IO2A 1L3SA 4EP4A 4AILC 3DRRA 2HNYA 5KGXA 1JXBA 4B08A 2AJQA 1MU2A 2PY5A 3ZSVA 1C6VA 4BDZA 1NJYA 1HPZA 1TK8A 1ASWA 1D5AA 1X9MA 3NF7A 1L3VA 1Q9YA 1RTDA 4DQSA 3DLRA 2LSNA 3BGRA 4CK1A 1RNHA 4KHWA 2NUBA 4GW6A 1VSEA 1TVRA 4QAGA 3JSMA 1BCOA 3K59A 1JLQA 3SQ2A 3QIOA 4FK0A 1WNSA 4LSLA 3F73A 2HVHA 1WSEA 2DY4A 4FZZA 4GMJB 1A5VA 1C1BA 4YFUA 3OJUA 4CEBA 1VRTA 3L2VA 1YTAA 3LZJA 3PX6A 1KVCA 1R0AA 1VSLA 4B9LA 3TANA 2E6LA 3AVGA 3SQ1A 4KI6A 3L2RA 1LWFA 3DLKA 3K2PA 3L3UA 4DSKA 1TAUA 4I9QA 2RKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHS A;  3AO4 A;  4FM1 A;  2XY7 A;  4DSJ A;  4DU3 A;  2OPP A;  5EU7 A;  4JS5 A;  2G8U A;  4QOZ B;  4B9U A;  1EKE A;  1RDD A;  1YT3 A;  3DLG A;  4FJH A;  4CJL A;  1XWL A;  4CK3 A;  4W5R A;  3MEC A;  1SL2 A;  3LPU A;  1HMV A;  3HT3 A;  3L2Q A;  2I5J A;  4I9L A;  2YKM A;  4DLG A;  3CM6 A;  3AVN A;  5KGW A;  3NF8 A;  3NFA A;  4K8X A;  1GOB A;  5FRO A;  3M8P A;  5CZ1 A;  1HNV A;  4UQG A;  4CGI A;  4DF8 A;  1EX4 A;  3B6O A;  1RT2 A;  4DTM A;  3ZSW A;  1RBR A;  3SUO A;  5JS1 A;  4DWI A;  1D9D A;  1K6Y A;  1RCH A;  4BWM A;  4FZX C;  4LD0 A;  4N56 A;  3VA0 A;  3V9X A;  4F3O A;  2YHA A;  3HPG A;  4H8K A;  1JL2 A;  3OVN A;  1HQU A;  4AHT A;  1ZBL A;  3O3G A;  2KFZ A;  4CGG A;  5SWM A;  3KLG A;  3KJV A;  3QEV A;  1TKZ A;  3NCI A;  3CFP A;  1BIS A;  4B9M A;  3KK3 A;  3QNO A;  4DFJ A;  2VG5 A;  1BI4 A;  4FJ7 A;  4KHS A;  1JLG A;  1ZBF A;  3HVR A;  4ELU A;  3DMJ A;  4AH9 A;  3CG7 A;  4CEQ A;  2HHV A;  2IAJ A;  2IOC A;  3V1Q A;  3QER A;  4CER A;  4Q5V A;  4E7H A;  2VWK A;  1U47 A;  3QEX A;  3TAE A;  1DTT A;  3MXJ A;  4CEF A;  1HNI A;  4CEA A;  1S1U A;  1RTH A;  3PY8 A;  4MFB A;  2QKK A;  4FJX A;  2HHQ A;  4C8N A;  2EX3 A;  2XHB A;  4HCC A;  1CXU A;  5I3U A;  1RDB A;  1VSD A;  1JL1 A;  3FFI A;  1KLN A;  2HMI A;  1WAJ A;  3QEP A;  5HRS A;  3SUQ A;  4W5O A;  2BE2 A;  3LP2 A;  1BCM A;  3MEE A;  3V1R A;  2X78 A;  2BDP A;  1QSS A;  2RPI A;  1B92 A;  4FLZ A;  5FRN A;  2G8K A;  4KKO A;  4RW9 A;  4B9N A;  4FXD A;  4DSF A;  4AHC A;  3LAN A;  1QSY A;  4OGE A;  3QNN A;  4ELV A;  1WLJ A;  1WSG A;  2RF2 A;  3P83 D;  4CF2 A;  3G0Z A;  2W42 A;  4DTP A;  3NE6 A;  3AVM A;  1N5Y A;  4OLB A;  3LPT A;  3NGY A;  2HNZ A;  3HPO A;  1A5X A;  4Y1D A;  4N5S A;  4H4M A;  3V9U A;  3O3F A;  2P51 A;  3ZSX A;  4TSX A;  4C8M A;  5E41 A;  2YHB A;  3S3O A;  4XIU A;  4CFD A;  3NH2 A;  4M41 A;  3MXM A;  2X6N A;  4I7F A;  5C42 A;  2O4G A;  4FM0 A;  4NCA A;  3E01 A;  3QET A;  2YNI A;  4IDK A;  4J2E A;  2ZD1 A;  4ICL A;  1N6Q A;  2E4L A;  4E0D A;  4OKK A;  5DMR A;  1KVB A;  3T19 A;  3C95 A;  4O55 A;  3K58 A;  3RRH A;  4FK4 A;  3OS0 A;  5FRM A;  4ZTJ A;  1VSM A;  3ISN C;  2WOM A;  3C6U A;  5HRN A;  3OY9 A;  1ASU A;  1TL1 A;  3CFO A;  4BDY A;  4CJU A;  3RTV A;  2F8S A;  2X74 A;  3SQ0 A;  4CEE A;  1RBV A;  4CFA A;  3AO2 A;  3HM9 A;  3VQ9 A;  5D3G A;  4KB1 A;  4BDP A;  4CJE A;  3VQE A;  4YNQ A;  1XI1 A;  1RTJ A;  3K57 A;  3DOL A;  4O0J A;  4HUE A;  3F9K A;  3KLI A;  1JXE A;  4M45 A;  1IKW A;  3ASM A;  4M3U A;  1Y97 A;  3JYT A;  3OYC A;  1B9D A;  2GUI A;  4BE0 A;  1S1T A;  1Z25 A;  4CFB A;  1DTQ A;  3OYJ A;  4ZHR A;  1SV5 A;  2YKN A;  3SZ2 A;  1YVU A;  3HJF A;  2OYQ A;  3TAM A;  4IFY A;  3AV9 A;  4CIE A;  3OYI A;  2P1J A;  1C0T A;  1QHT A;  4ID5 A;  1VSI A;  3ZSZ A;  3V9W A;  3AVH A;  2YNH A;  1HYZ A;  1L3U A;  2FBX A;  4CHN A;  3CFR A;  1IKY A;  3PV8 A;  4CHQ A;  3ZCM A;  3IAY A;  1BQN A;  4KHQ A;  3HK2 A;  2KFN A;  3S3N A;  1SKS A;  4FW1 A;  3CQ8 A;  2FBV A;  4O0I A;  3OYN A;  3DOK A;  4KTZ A;  4O5B A;  1T7P A;  4B9V A;  4FJI A;  5HRR A;  4KRE A;  2QXF A;  1TKD A;  3RMA A;  3AO3 A;  1FK9 A;  1KLM A;  3L2U A;  3OYG A;  3M8Q A;  1VK0 A;  5J2Q A;  4CF8 A;  1NKC A;  4PWD A;  2HND A;  3AVK A;  1LW2 A;  1RT3 A;  2D0A A;  3L3V A;  3NF6 A;  3ZT1 A;  4NCB A;  4J2A A;  1QSL A;  1JLE A;  3D0P A;  2X6S A;  4CCH A;  1QE1 A;  3NBP A;  1VRU A;  4FJJ A;  1X9S A;  4CJV A;  3HVT A;  4FLU A;  3V4I A;  1LWC A;  1NJZ A;  3C94 A;  1O1W A;  3SYZ A;  1JLA A;  1CLQ A;  2BAN A;  2HHX A;  1S1W A;  4DLE A;  3BDP A;  1SUQ A;  4O44 A;  4CFC A;  2QK9 A;  4WE1 A;  2G8H A;  3OYH A;  1NOZ A;  4LY7 A;  4FJG A;  3AA2 A;  4CJK A;  3PX4 A;  3TAP A;  1EXQ A;  3L2W A;  3ZT4 A;  1FXX A;  3LAM A;  3OYL A;  4H4O A;  4IFV A;  1I3A A;  5CYM A;  3B6P A;  4E7K A;  3TAR A;  3IRX A;  3DLH A;  4KO0 A;  3KLE A;  4M3Y A;  4AHS A;  1J53 A;  4KAZ A;  4KPY A;  4B3O A;  4HUG A;  4DQQ A;  4NYN A;  1IKX A;  2E6M A;  3ULD A;  3RR8 A;  5K14 A;  4Q0B A;  3V1O A;  2IC3 A;  2KQ2 A;  2Z1G A;  2HVI A;  4CGH A;  2F8T A;  3KK1 A;  1JLC A;  3DM2 A;  1Q9X A;  4B8A B;  5CY4 A;  4IBN A;  3K5N A;  1VSK A;  4G1Q A;  4HTU A;  2OZS A;  1X9W A;  4DTX A;  4CED A;  4LH5 A;  2IGI A;  2G8I A;  3KLF A;  3QEI A;  3TAG A;  4B9S A;  5HBM A;  4EP5 A;  4FJ5 A;  4C8O A;  3CM5 A;  1VSF A;  4Z0U A;  4EZ6 A;  2ATQ A;  1RT7 A;  1TK5 A;  2JLE A;  1KCF A;  4CES A;  3HP6 A;  3O4Q A;  4J2D A;  3HL8 A;  5T7B A;  1U4B A;  4J2B A;  1Z26 A;  1ZBH A;  1UOC A;  1W9H A;  4HUF A;  3HXM A;  3O4N A;  3SUP A;  1G15 A;  3VQD A;  3QIP A;  3EYZ A;  2JGU A;  4Z4E A;  3G10 A;  4E7L A;  3WNF A;  3SV3 A;  4CJT A;  4DTU A;  1ZBI A;  3MED A;  2ITG A;  4KTW A;  4HVJ A;  4R5P A;  5FDL A;  1BQM A;  1FKO A;  3SCX A;  1XC9 A;  4E7J A;  2G8V A;  2WON A;  2VG6 A;  1Q8I A;  1BIZ A;  1RTI A;  3U6F A;  4W5Q A;  3CYM A;  2KTQ A;  4E7I A;  1LAW A;  1T05 A;  4M3X A;  4W5N A;  4FZY A;  1NK9 A;  1J54 A;  1IG9 A;  1QTM A;  3PO4 A;  3HP9 A;  3SPY A;  4E1M A;  3NH1 A;  3LDS A;  2A1R A;  2BGG A;  4DFP A;  2PYJ A;  4CGF A;  3DYA A;  4FLY A;  4RG8 A;  3ZT3 A;  1RBS A;  4DMN A;  2FC0 A;  2XY5 A;  4FM2 A;  4EZ9 A;  3VA3 A;  1S1X A;  1U48 A;  1WSF A;  1JLF A;  3ZT2 A;  4OLA A;  2IS3 A;  1LAV A;  3OYB A;  3ALY A;  3AVF A;  3V81 A;  3OYE A;  1JLB A;  4CGJ A;  1C0U A;  3HO1 A;  4FW2 A;  2OA8 A;  2VWJ A;  4QCL A;  3ITH A;  3SPZ A;  1QQC A;  3VQ8 A;  4CJ5 A;  4KB0 A;  2D0B A;  4KHN A;  3AVA A;  1C1C A;  1RT4 A;  3KKS A;  3AVI A;  3AA3 A;  1EET A;  3ZSO A;  4HHT A;  2HHT A;  4N41 A;  1TL3 A;  1NKB A;  4C8K A;  1BI4 B;  3RRG A;  3AVL A;  4KHY A;  1UWB A;  3PUF A;  3K5L A;  1TV6 A;  3TR8 A;  4BAC A;  3P1G A;  3PO5 A;  3SQ4 A;  3KKR A;  1WSI A;  3MXI A;  4B9T A;  5DK5 A;  1X1P A;  2HW3 A;  2OPQ A;  3AVJ A;  3QLH A;  4FLW A;  4I2Q A;  3VQ4 A;  3VQ7 A;  4DTR A;  4B8C A;  4OPJ A;  4CGD A;  3HPH A;  3TAF A;  3KLH A;  2YV0 X;  1ZBU A;  3OYA A;  4NYF A;  4ELT A;  4DU1 A;  1IH7 A;  1GOA A;  1TKT A;  4RW6 A;  4CJQ A;  4DTN A;  4DSE A;  3SUN A;  4JRP A;  3M8R A;  3VQC A;  4FCY A;  1KVA A;  3VQP A;  3O3H A;  4E89 A;  1RT5 A;  4ID1 A;  3K5M A;  1C1A A;  3T1A A;  3TAQ A;  4IKF A;  2IDO A;  1S9E A;  1J5O A;  1REV A;  5JS2 A;  3KIO A;  4AHR A;  4FJ8 A;  4CEO A;  4Z4C A;  4IG3 A;  3OYF A;  3ZT0 A;  3LWM A;  3U3G A;  4LH4 A;  1T8E A;  4M3W A;  4OJR A;  2PYL A;  4RW8 A;  1VSJ A;  2GBZ A;  2XRI A;  4CJ3 A;  3DRS A;  3AVC A;  5C25 A;  1C0M A;  1UAX A;  2Y1J A;  1CZ9 A;  1W0H A;  3AO1 A;  1NKE A;  2DTU A;  3THV A;  3LAL A;  3QIN A;  4E3S A;  1QS4 A;  4OKE A;  4CHO A;  3IS9 A;  5KRS A;  3SV4 A;  3ZSY A;  4FLV A;  1S9G A;  4N76 A;  3OYM A;  1BL3 A;  5HRP A;  3LP0 A;  1UA0 A;  1VSH A;  3WNH A;  4DTJ A;  1SKW A;  2FBY A;  4FLX A;  1CXQ A;  1LV5 A;  2G8W A;  3WNE A;  3LP3 A;  1EP4 A;  4OKJ A;  3VQB A;  4CIF A;  3LAK A;  1TAQ A;  5J2M A;  4CHY A;  4HCB A;  2D5R A;  4RW4 A;  1NK8 A;  2Y1I A;  3S3M A;  1LW0 A;  4CEC A;  5I42 A;  3U3Y A;  3RR7 A;  1NK0 A;  4JRQ A;  1ZYQ A;  2B6A A;  2XY6 A;  3VQ6 A;  4O4G A;  3AA5 X;  3VQ5 A;  3MAQ A;  3RMD A;  1RT6 A;  1HQE A;  2EHG A;  2ZE2 A;  2KW4 A;  3OYK A;  4JS4 A;  2OZM A;  4KFB A;  3T3F A;  2YNF A;  3DLB A;  3MEG A;  2D0C A;  3TAB A;  4CF0 A;  1D9F A;  3A2F A;  5KI6 A;  3NF9 A;  2HB5 A;  4DS4 A;  5HP1 A;  4Z4F A;  5HRO A;  3K5O A;  1KFS A;  4RW7 A;  3SNN A;  4PUO A;  4DSL A;  1RBU A;  4DQP A;  1GOC A;  1SKR A;  4CHZ A;  3VQQ A;  2R7Y A;  4KRF A;  1NK5 A;  3TWH A;  4M42 A;  2XY8 A;  1NJX A;  3KD1 E;  4NCG A;  5C24 A;  3KK2 A;  3SJJ A;  1HJR A;  3I0S A;  4MQ3 A;  3I0R A;  3AO5 A;  3C6T A;  1UA1 A;  3V6D A;  5HLF A;  4ZTF A;  4KI4 A;  1RDA A;  2O4I A;  4W5T A;  1RT1 A;  5CZ2 A;  4CHP A;  3PX0 A;  1SL1 A;  4CF1 A;  1XHX A;  2GV9 A;  3SI6 A;  4DQI A;  3M8S A;  4M3R A;  3V9Z A;  1L5U A;  3OS2 A;  1NK4 A;  4DQR A;  4C8L A;  2ZQB A;  4DFK A;  5J2N A;  2RN2 A;  4FVM A;  1RBT A;  2B4J A;  4F3T A;  4DSI A;  2ETJ A;  2YNG A;  3LWL A;  1KRP A;  3AA4 A;  4BE2 A;  4PY5 A;  3EZ5 A;  1S6P A;  4KHU A;  3TI0 A;  1JKH A;  3ZSR A;  3NGZ A;  4CE9 A;  1L3T A;  2OPS A;  4FK2 A;  4FLT A;  1WN7 A;  3RMC A;  4K8Z A;  2KZM A;  3I8D A;  1DLO A;  1HRH A;  4KV8 A;  1A5W A;  1B9F A;  1RDC A;  1WAF A;  5CYQ A;  4AHU A;  4E1N A;  2G8F A;  4Z4I A;  1TKX A;  3KD5 E;  2A1S A;  1ASV A;  4CJR A;  4FJ9 A;  3NHG A;  4BE1 A;  2QKB A;  1KFD A;  2P5G A;  4DTS A;  4F2R A;  2DFH A;  3P5J A;  3NDK A;  4FJN A;  1U04 A;  3NH0 A;  3RWU A;  4L8R B;  2Z1H A;  4N47 A;  4JLH A;  1TGO A;  1LWE A;  1RIL A;  4AHV A;  4M3T A;  3DRP A;  4I2P A;  3H08 A;  3UIQ A;  2Z1I A;  1BHL A;  4BWJ A;  4Y1C A;  3LZI A;  4CEZ A;  4FJM A;  2DFF A;  3V9S A;  4DTO A;  1HYV A;  3KTQ A;  4OGC A;  4CIG A;  4CJF A;  4CJ4 A;  5J1E A;  1IKV A;  1BGX T;  2PZS A;  5KTQ A;  1I39 A;  3DI6 A;  4CK2 A;  4CJS A;  2XO7 A;  2HHW A;  3QEW A;  1WSJ A;  4CJW A;  1D8Y A;  4DU4 A;  3D45 A;  2KZZ A;  2FBT A;  4PA1 A;  1F21 A;  4FJK A;  1S6Q A;  2Z1J A;  4IG0 A;  4F2S A;  4LSN A;  4E19 A;  1XHZ A;  4FJL A;  4FYD A;  4KTQ A;  3DLE A;  3HST B;  4Z4H A;  3RMB A;  4DF4 A;  1WSH A;  5J2P A;  1KTQ A;  3WNG A;  2B5J A;  5KRT A;  4DG1 A;  3AVB A;  3HYF A;  1NK7 A;  4Z4G A;  1NK6 A;  4DFM A;  1HYS A;  3VQA A;  1J9A A;  2OPR A;  2VG7 A;  1U49 A;  1S1V A;  3IG1 A;  3S9H A;  3L8B A;  1TK0 A;  2DFE A;  4OPK A;  1U45 A;  1ITG A;  1CZB A;  1BIU A;  4F4K A;  1KSP A;  3VN5 A;  3QES A;  1S5J A;  3NAE A;  1SL0 A;  3OYD A;  3QO9 A;  4OVL A;  4F8R A;  3NGI A;  1FKP A;  2Q3S A;  3ZSQ A;  1NJW A;  3EY1 A;  4DS5 A;  4PQU A;  1NOY A;  2F96 A;  4CJP A;  1T03 A;  2P5O A;  3LP1 A;  3OS1 A;  4M3Z A;  5SZT A;  1YTU A;  4CF9 A;  3OJS A;  2HHU A;  4GVM A;  1IO2 A;  1L3S A;  4EP4 A;  4AIL C;  3DRR A;  2HNY A;  5KGX A;  1JXB A;  4B08 A;  2AJQ A;  1MU2 A;  2PY5 A;  3ZSV A;  1C6V A;  4BDZ A;  1NJY A;  1HPZ A;  1TK8 A;  1ASW A;  1D5A A;  1X9M A;  3NF7 A;  1L3V A;  1Q9Y A;  1RTD A;  4DQS A;  3DLR A;  2LSN A;  3BGR A;  4CK1 A;  1RNH A;  4KHW A;  2NUB A;  4GW6 A;  1VSE A;  1TVR A;  4QAG A;  3JSM A;  1BCO A;  3K59 A;  1JLQ A;  3SQ2 A;  3QIO A;  4FK0 A;  1WNS A;  4LSL A;  3F73 A;  2HVH A;  1WSE A;  2DY4 A;  4FZZ A;  4GMJ B;  1A5V A;  1C1B A;  4YFU A;  3OJU A;  4CEB A;  1VRT A;  3L2V A;  1YTA A;  3LZJ A;  3PX6 A;  1KVC A;  1R0A A;  1VSL A;  4B9L A;  3TAN A;  2E6L A;  3AVG A;  3SQ1 A;  4KI6 A;  3L2R A;  1LWF A;  3DLK A;  3K2P A;  3L3U A;  4DSK A;  1TAU A;  4I9Q A;  2RKI A; 
#chains in the Genus database with same CATH topology
 2F7T A;  3O5B A;  4DR3 K;  2XY7 A;  1P8Z A;  2OPP A;  3MWP A;  1IBK K;  5AQM A;  4JI7 K;  3ZYY X;  2QI2 A;  4CBW A;  1GOB A;  5AJ3 K;  3LDP A;  4JD2 A;  4DTM A;  4DWI A;  1K6Y A;  4LFA K;  4LD0 A;  3V9X A;  4F3O A;  2D0P A;  3CFP A;  1BIS A;  4B9M A;  3CQY A;  2QWR A;  1JLG A;  3IMX A;  4ELU A;  3THW A;  3DMJ A;  4CEQ A;  3JAM O;  1U47 A;  3TAE A;  1YJ9 N;  2P9L B;  3ENH A;  4MFB A;  5JVG L;  1CXU A;  1VSD A;  2HMI A;  5HRS A;  2BDP A;  2BE2 A;  4A62 A;  2VQE K;  3E9P A;  4FLZ A;  2W40 A;  4KKO A;  2OAN A;  4C1N K;  1E4F T;  4JKA A;  3NE6 A;  5AQS A;  3LPT A;  3NGY A;  2HNZ A;  3HPO A;  3V9U A;  4OPH A;  3LL3 A;  4C8M A;  2YHB A;  1MWM A;  3S3O A;  3MXM A;  4I7F A;  2O4G A;  4NCA A;  5AQJ A;  1MDU B;  4E0D A;  3T19 A;  3C95 A;  3RRH A;  1N34 K;  1VSM A;  5TKY A;  4FWO A;  4BDY A;  2RHK A;  1VHX A;  4QS8 A;  3SQ0 A;  1CZA N;  4CEE A;  1IJJ A;  2HBL A;  4BRN A;  3ZET A;  1WUA A;  4CJE A;  5EVZ A;  3VEO A;  4O5F A;  4O0J A;  4V19 S;  1IKW A;  2NRZ A;  3ASM A;  4M3U A;  4WQ5 A;  5AZJ A;  3CCE N;  1S1T A;  5BRH A;  5AQW A;  1DTQ A;  3OYJ A;  5AQT A;  2V51 B;  3TAM A;  1WB9 A;  3AV9 A;  5AQZ A;  3OYI A;  1X3N A;  2ASP A;  1V4S A;  3CQX A;  3THX B;  4A5B A;  3ZCM A;  1SKS A;  5FPE A;  4FW1 A;  2FBV A;  3OYN A;  1T7P A;  4O5B A;  1EWQ A;  1QHA A;  2QXF A;  4X65 K;  1FK9 A;  3L2U A;  1VK0 A;  1W7A A;  5BPL A;  3L3V A;  4CD3 A;  1LW2 A;  1RT3 A;  3OA9 A;  4J2A A;  1QSL A;  3D0P A;  3GG4 A;  1X9S A;  3SMP A;  5AQG A;  3AGK A;  3VF4 A;  4FLU A;  1LWC A;  3CHW A;  3FZL A;  1SUQ A;  4H0T B;  4O44 A;  4CFC A;  2QK9 A;  1HLU A;  3AA2 A;  3PX4 A;  1EXQ A;  4IFV A;  5CYM A;  2UXC K;  3KLE A;  4KPY A;  4FWP A;  2QWN A;  5KQD A;  3RR8 A;  3V1O A;  2IC3 A;  3KK1 A;  3ZX0 A;  3E9O A;  4B1Y B;  3CC7 N;  3K5N A;  4IBN A;  4OPA A;  3VEZ A;  4GNI A;  4DTX A;  3QEI A;  3TAG A;  3JXU A;  2P9S B;  4YHH K;  4JI0 K;  2FSK A;  2KLA A;  3BF1 A;  1TK5 A;  3FR0 A;  3O4Q A;  1XUP O;  5AQU A;  4J2D A;  2FXU A;  1UOC A;  3D6R A;  3SLC A;  3SUP A;  3O8M A;  2JGU A;  2D1K A;  4Z4E A;  3MED A;  2ITG A;  4DV5 K;  5FDL A;  1BQM A;  1XC9 A;  2PFU A;  1RTI A;  2I7P A;  3QB0 A;  4B3S K;  2YJE A;  2KTQ A;  4M3X A;  4FZY A;  1U2V B;  5BR9 A;  2IVP A;  4A5A A;  4FLY A;  3R8E A;  2PBD A;  2FC0 A;  5CR4 A;  4FM2 A;  3T7Z A;  1JLF A;  5BPM A;  3AVF A;  1JLB A;  4CGJ A;  3HO1 A;  1JCF A;  1NGH A;  3VGK A;  3ITH A;  3SPZ A;  2QM1 A;  4BC2 A;  4CJ5 A;  4KB0 A;  4KHN A;  3O1B A;  4DKW A;  1HKG A;  2HHT A;  3EKS A;  4NLB A;  4N41 A;  1BI4 B;  3RRG A;  3AVL A;  3G71 N;  4BGA A;  4JNE A;  2A5X A;  3SQ4 A;  4B9T A;  3VEX A;  1QQO A;  3VF2 A;  2HW3 A;  4FLW A;  4I2Q A;  3VQ4 A;  3T1Y K;  4B8C A;  3KZB A;  2YHX A;  1HX1 A;  3OYA A;  4FWR A;  4DHY A;  1IH7 A;  4CJQ A;  1TKT A;  4DTN A;  3U9Z A;  4A57 A;  4DSE A;  5AQY A;  3SUN A;  1HR0 K;  4FCY A;  2E1Z A;  5GIP A;  3VQP A;  4E89 A;  3K5M A;  4ID1 A;  1LOT B;  4BQZ A;  2IDO A;  3FFK B;  1REV A;  3LDQ A;  4IFE A;  5FLX O;  3ZT0 A;  4LH4 A;  3J7Y P;  1VSJ A;  3G25 A;  4IOA L;  2DTU A;  4BR9 A;  3R9P A;  4A59 A;  1VQ7 N;  3SV4 A;  4BRG A;  4GKK K;  1BL3 A;  3WNH A;  1SKW A;  1MWK A;  1TAQ A;  4CHY A;  3PSI A;  2Y1I A;  5I42 A;  3RR7 A;  1NK0 A;  1ZYQ A;  4IDH A;  3CME N;  3RMD A;  2O8E B;  1HQE A;  2NNW A;  2ZE2 A;  4JS4 A;  4KFB A;  3T3F A;  1OH6 A;  2D0C A;  5KI6 A;  4JI5 K;  3NF9 A;  5GAH P;  4PUO A;  3SNN A;  1GOC A;  2R7Y A;  4H0V B;  1X9J A;  1VQ9 N;  3VF6 A;  3D2F B;  2HBM A;  3BY5 A;  4NCG A;  1HJR A;  3AO5 A;  3V6D A;  1J5E K;  1WBD A;  1NU0 A;  3A8Y A;  1QZ6 A;  5CZ2 A;  4CHP A;  3I8B A;  3PX0 A;  4CF1 A;  2GV9 A;  3V9Z A;  1NK4 A;  3BZC A;  5J2N A;  4F3T A;  4DSI A;  1NNE A;  1KRP A;  4BE2 A;  3H3N O;  3ZX3 A;  3TSP A;  3ZSR A;  1OKJ A;  3NGZ A;  1L3T A;  2OPS A;  4FK2 A;  1RDW X;  3UB5 A;  1HRH A;  1WAF A;  4E1N A;  2G8F A;  4WFA L;  4Z4I A;  3ID8 A;  5ELZ A;  3QDK A;  1T44 A;  3A5N C;  1ASV A;  5LL6 Z;  4FJ9 A;  2QKB A;  4BE1 A;  1KFD A;  2P5G A;  4DTS A;  4KBO A;  4FJN A;  5F1X A;  3NH0 A;  3MN9 A;  3RWU A;  4JD2 B;  3DJC A;  4CZM A;  3DAW A;  3RSE A;  4M3T A;  3TTC A;  3DRP A;  2Z1I A;  1BHL A;  2DFF A;  3V9S A;  5AQK A;  4CJS A;  2XO7 A;  5LJV A;  3QEW A;  1JCE A;  2VGM A;  5EY4 A;  3LM2 A;  3THW B;  3HST B;  3VEW A;  3PIO L;  5J2P A;  3SJH A;  1NG9 A;  2CGL A;  2VWB A;  5KRT A;  4DG1 A;  3HYF A;  4DV6 K;  4Z4G A;  2ZGZ A;  1RDU A;  3VQA A;  3KVG A;  1TK0 A;  1ITG A;  3VER A;  1KSP A;  3QES A;  4H0P A;  3NAE A;  3CPW M;  3CPE A;  3OYD A;  3QO9 A;  4OVL A;  2Q3S A;  4AF1 A;  1QVG M;  2HST A;  3ZSQ A;  4DS5 A;  3DXM A;  4CJP A;  2OTJ N;  4JK9 A;  5SZT A;  3MN6 A;  1VQN N;  4CF9 A;  1L3S A;  5AQF A;  2Q0R A;  2HNY A;  3ZSV A;  4BDZ A;  1TK8 A;  1L3V A;  1RTD A;  5M1K A;  2P9P B;  2LSN A;  4CI6 A;  2E2O A;  2NUB A;  2A41 A;  4GW6 A;  1VSE A;  1TVR A;  2Q1N A;  4NB4 A;  1JLQ A;  1Z05 A;  4BRF A;  1WBB A;  1WSE A;  3WT0 A;  4FZZ A;  1C1B A;  1KAY A;  1YTA A;  5GIO A;  5AQO A;  4O8U A;  3D7E O;  2VQF K;  1J6Z A;  3ZET B;  4G9Z A;  4XH4 A;  3K2P A;  3L3U A;  5A2Q O;  4DSK A;  3CC4 N;  3L6Q A;  3AO4 A;  3L4I A;  4FM1 A;  3L4Q A;  4QOZ B;  4DU3 A;  4JS5 A;  4U7B A;  4B9U A;  1EKE A;  1RDD A;  4FJH A;  4IOC L;  1XWL A;  4CK3 A;  5AZJ B;  4W5R A;  2UXD K;  1SL2 A;  1GLC G;  2I5J A;  2YKM A;  2AP1 A;  4C23 A;  3MN5 A;  2O8F A;  4DR7 K;  2FLO A;  5BRD A;  3ZSW A;  3SUO A;  3OBY A;  5E84 A;  4BWM A;  4N56 A;  2Q31 A;  5EXW A;  4H8K A;  1JL2 A;  3OVN A;  1HQU A;  2ASO A;  3BEX A;  3O3G A;  2KFZ A;  5SWM A;  5KPZ A;  3QNO A;  4H5V A;  1BI4 A;  4FJ7 A;  5F2R A;  3TSQ A;  2HHH K;  1HNW K;  4A2A A;  3HVR A;  3EEQ A;  4AH9 A;  2ITM A;  2NRW A;  4E7H A;  5AQV A;  3F2K A;  3MXJ A;  2Q2R A;  2QKK A;  4C8N A;  2XHB A;  4HCC A;  2ZF5 O;  5JIC A;  4GV9 A;  1RDB A;  3DLL L;  5LMN K;  1NGJ A;  1XC3 A;  4W5O A;  1BCM A;  3MEE A;  2X78 A;  3WUH A;  4WQ4 C;  5FRN A;  4RW9 A;  4B9N A;  4FXD A;  4DSF A;  3O1W A;  3LAN A;  1QSY A;  4ELV A;  2RF2 A;  3G0Z A;  4N5S A;  3O3F A;  2P51 A;  1OVY A;  2E88 A;  3ZSX A;  3AY9 A;  2P9I A;  1TUY A;  4KHP K;  3JS6 A;  4XIU A;  5BRF A;  2X6N A;  4HWI A;  4PL8 A;  4K0K K;  4IDK A;  4EFH A;  4J2E A;  1N6Q A;  5DMR A;  1KVB A;  4ISF A;  3SAG A;  2GTD A;  5HRN A;  3CFO A;  1TL1 A;  3RTV A;  2X74 A;  4IEI A;  1W2B M;  1RBV A;  1SZ2 A;  3CD6 N;  5MLC Q;  3HM9 A;  4CZJ A;  2HF3 A;  4BDP A;  4IEE A;  3F9K A;  1C0G A;  4DR4 K;  4NO7 A;  3WXI A;  5CE3 A;  1B9D A;  2RE2 A;  2GUI A;  4BE0 A;  1RFQ A;  1HNX K;  1ZC6 A;  3FZM A;  3HJF A;  4CIE A;  1VSI A;  3ZSZ A;  3R3L A;  4KH6 A;  2FBX A;  4CHN A;  4DV4 K;  3VOV A;  2JWL A;  4KHQ A;  4CHQ A;  3HK2 A;  1YUW A;  1BQN A;  2KFN A;  2IVN A;  4GKJ K;  3EL2 A;  3CQ8 A;  4O0I A;  4B9V A;  4FJI A;  4KRE A;  3J80 O;  2FSJ A;  1BG3 A;  1KLM A;  3CC2 N;  3OYG A;  5I9E B;  5J2Q A;  1NKC A;  1K73 O;  2D0A A;  1JLE A;  2QWM A;  2X6S A;  5AQI A;  1QE1 A;  1NJI O;  4CCH A;  4CJV A;  1MA9 B;  1N33 K;  3MCA B;  1NJZ A;  5HOO A;  4WYB A;  3E66 A;  3M1F A;  2D0O A;  1DKG D;  5AFU A;  4WE1 A;  4LY7 A;  4CJK A;  3ZT4 A;  3LAM A;  3OYL A;  3B6P A;  4M3Y A;  3IRX A;  4KO0 A;  3ULD A;  5K14 A;  3IUC A;  2KQ2 A;  3DM2 A;  5CY4 A;  4JKC A;  1VSK A;  4G1Q A;  4HTU A;  2UXB K;  2CH6 A;  4BRQ A;  2E2P A;  4LH5 A;  3CCL N;  2G8I A;  4FWN A;  4BQL A;  3AAQ A;  4FJ5 A;  3A5M C;  3TSU A;  1KD1 O;  3SAF A;  2ZJQ L;  3PIP L;  4EZ6 A;  2ATQ A;  1GLD G;  2JLE A;  1KCF A;  5M1P A;  4CES A;  1YXQ A;  3HP6 A;  3RVC A;  3HL8 A;  4J2B A;  1Z26 A;  4HUF A;  1W9H A;  3SV3 A;  4CJT A;  4M7Y A;  4HVJ A;  4YOV A;  1FJG K;  1SS6 A;  1BIZ A;  3U6F A;  4JKE A;  4CZH A;  5FPD A;  3UKR A;  3MK6 A;  1J54 A;  4H5R A;  2W6K A;  3HP9 A;  4FWK A;  4E1M A;  2UUA K;  4Z94 A;  4M7X A;  3DYA A;  4RG8 A;  3ZT3 A;  1RBS A;  4DMN A;  1U48 A;  1BU6 O;  1S1X A;  4OLA A;  3ZT2 A;  4RCH A;  3WQT A;  3O9U A;  5C2F A;  4GV6 A;  3V81 A;  3OYE A;  3UKU A;  4JI8 K;  4FW2 A;  2VWJ A;  3TU5 A;  2ZM6 K;  1QQC A;  4L3Q A;  2P9P A;  1X3M A;  3VGM A;  4LF5 K;  1RT4 A;  3AVI A;  4DB3 A;  3AA3 A;  1EET A;  1XQS C;  4HHT A;  3DXK A;  4KHY A;  1RGI A;  3GOI A;  1TV6 A;  3P1G A;  3PO5 A;  3KKR A;  1WSI A;  4A2B A;  3MXI A;  5DK5 A;  2OPQ A;  3QLH A;  4C8K A;  3VQ7 A;  1IBL K;  2UU9 K;  3TAF A;  1ZBU A;  3CMA N;  3CJ1 A;  4ELT A;  2VYP A;  4JRP A;  3VQC A;  1KVA A;  3RSE B;  3O4W A;  1C1A A;  4YOY A;  4IKF A;  2WTU A;  1S9E A;  5AZI A;  3VMF B;  3KIO A;  4Z4C A;  2YCH A;  3IFR A;  4JKG A;  1T8E A;  3ZEU B;  4OJR A;  2PYL A;  3DRS A;  1C0M A;  1CZ9 A;  3F5T A;  3QIN A;  1HPM A;  3HRG A;  3A5L C;  3OYM A;  4WCE L;  1UA0 A;  4JN4 A;  4BR7 A;  3WNE A;  2CGJ A;  3CJB A;  2VCP A;  3OBW A;  4OKJ A;  5J2M A;  4B1W B;  4RW4 A;  1LW0 A;  1NGE A;  4BG8 A;  3U3Y A;  2B6A A;  2XY6 A;  2D4W A;  2NRR A;  3AA5 X;  3H1Q A;  2KW4 A;  3WXJ A;  3TAB A;  2FSN A;  5IT9 O;  4CF0 A;  3DXM B;  1Q81 O;  3K5O A;  1KFS A;  3TPQ A;  4BRO A;  4RW7 A;  4DSL A;  4CJ7 A;  3VQQ A;  4HTL A;  3FZH A;  3TWH A;  2XY8 A;  2ZJR L;  3CJ7 A;  3KK2 A;  4B3T K;  3I0R A;  3C6T A;  4B3R K;  5LJW A;  3ZX2 A;  4ZTF A;  2O4I A;  2YHW A;  4H0Y B;  4CZG A;  4A61 A;  3SI6 A;  2A42 A;  4DFK A;  3KK7 A;  4FVM A;  2YNG A;  4CBX A;  1D4X A;  2EWS A;  1WN7 A;  3J8A A;  3E9L A;  2QW9 A;  1A5W A;  3BUZ B;  3KD5 E;  4JAX A;  2A1S A;  3O9T A;  3VEY A;  4CJR A;  3NHG A;  2O8F B;  2P9K A;  2DFH A;  3NDK A;  4BY9 C;  3EZW A;  4L8R B;  4N47 A;  4JLH A;  1JCG A;  4B1U B;  3H08 A;  4H5T A;  2JWK A;  4X62 K;  4DTO A;  5AQP A;  2ZWH A;  4CIG A;  5J1E A;  2PZS A;  1HJO A;  5KTQ A;  1I39 A;  4CK2 A;  4CJW A;  3IKM A;  3D2E A;  4JI1 K;  2FBT A;  4PA1 A;  4F2S A;  4IJN A;  1XHZ A;  5KQ8 A;  4Z4H A;  2CGK A;  2NZT A;  4DF4 A;  3RMB A;  1KTQ A;  4PKI A;  5JMV A;  1H1V A;  3NMU A;  1NK7 A;  1NK6 A;  4BR5 A;  4DFM A;  1HYS A;  1U49 A;  1S1V A;  3IG1 A;  1VQM N;  2DFE A;  5JLF A;  3EKU A;  1SL0 A;  3P31 A;  3VTI A;  3BF3 A;  1FKP A;  4CW7 B;  4JKB A;  2NRV A;  4BRI A;  3LP1 A;  2DPN A;  4WQ5 C;  2P9I B;  3OJS A;  1ATS A;  4GVM A;  1VQ8 N;  3WEE A;  4BR4 A;  5KGX A;  1JXB A;  4B08 A;  1C6V A;  3CCM N;  3ATU A;  1HKC A;  4FL9 A;  1BA0 A;  4DQS A;  4J8F A;  3DLR A;  1RNH A;  3EE8 A;  4BGB A;  4QAG A;  1GLJ O;  4LC9 B;  3VPZ A;  2DY4 A;  4YFU A;  3OJU A;  4JV5 K;  1R0A A;  2YX6 A;  3I33 A;  1P90 A;  3L2R A;  4PKG A;  3VET A;  2IIR A;  3BZK A;  4DSJ A;  3CCQ N;  3C6H A;  1YT3 A;  3O9Q A;  1WOQ A;  5IWA K;  3MEC A;  1T3V A;  1KC8 O;  3J81 O;  3HT3 A;  2P9U A;  4BG9 A;  3AAR A;  1N36 K;  4DLG A;  3BP8 A;  3AVN A;  3CM6 A;  5KGW A;  3NFA A;  3N4P A;  5FRO A;  3M8P A;  5CZ1 A;  1HNV A;  3CCU N;  4CGI A;  4DF8 A;  1EX4 A;  3B6O A;  2BTF A;  4FSV A;  1QVF M;  5JS1 A;  2BUP A;  1RCH A;  5KPT A;  4MO5 A;  3VEV A;  5ADX A;  3KJV A;  1NGG A;  3QEV A;  2E5L K;  4FPB A;  3R6M A;  3H1V X;  4DFJ A;  2VG5 A;  4CBU A;  1ZBF A;  1ATN A;  1M90 O;  3LM9 A;  2HHV A;  3V1Q A;  1BO5 O;  3QER A;  4CER A;  4AM6 A;  4Q5V A;  2VWK A;  2E8A A;  1VQ6 N;  4DR2 K;  3QEX A;  4DR5 K;  1DTT A;  3WXM B;  4CEF A;  1HNI A;  4CEA A;  1S1U A;  1RTH A;  3PY8 A;  4FJX A;  5I3U A;  3FFI A;  5F0X A;  1WAJ A;  1K9M O;  3LP2 A;  4FWQ A;  3V1R A;  3CJC A;  1QSS A;  2RPI A;  1B92 A;  4GV3 A;  4RTF D;  4IOX A;  2Q0U A;  4AHC A;  4CZL A;  4OGE A;  5E26 A;  3P83 D;  2W42 A;  4CF2 A;  1N5Y A;  4OLB A;  3ZEU A;  4H4M A;  1YIT N;  3W3D A;  5C0Y A;  3CI5 A;  5E41 A;  5C42 A;  4FM0 A;  3QFP A;  1IG8 A;  2ZD1 A;  4ICL A;  4OKK A;  3O08 A;  3QBW A;  5M1N A;  4ISG A;  4O55 A;  3K58 A;  4FK4 A;  3OS0 A;  4ZTJ A;  5DM6 L;  2WOM A;  3KTQ A;  2QWO A;  2F8S A;  3UKR B;  4CJU A;  2FF6 A;  1IV0 A;  2YJF A;  3AO2 A;  4UY8 O;  5D3G A;  1O13 A;  4KB1 A;  4YNQ A;  1XI1 A;  3CIP A;  3K57 A;  4LF8 K;  3DOL A;  5BR8 K;  4CVN E;  3UKU B;  3KLI A;  3H3O B;  2A3Z A;  5C15 A;  3OYC A;  1Z25 A;  3W0L A;  1DEJ A;  4ZHR A;  1SV5 A;  3SZ2 A;  2OYQ A;  4YOT A;  3C7N B;  3DXK B;  1QHT A;  3V9W A;  4B9Q A;  1L3U A;  3O9R A;  3CFR A;  1IKY A;  3PV8 A;  3S3N A;  4WFB L;  3DOK A;  4KTZ A;  3SAH A;  5HRR A;  1TKD A;  5EOY A;  2HND A;  4EHU A;  3NF6 A;  4NCB A;  3NBP A;  1KAZ A;  1VRU A;  4FJJ A;  5AZI B;  4BRK A;  3HVT A;  4RWT A;  3V4I A;  2V52 B;  3C94 A;  1O1W A;  3B8A X;  5FPM A;  1CLQ A;  2BAN A;  4DLE A;  4JKG B;  4BC3 A;  2QXL A;  4Y0W A;  5JLH A;  2G8H A;  5C2D A;  3L2W A;  2NRX A;  4JI4 K;  4GVE A;  4AHS A;  4KAZ A;  2J4R A;  4B3O A;  2E6M A;  1YHQ N;  1XNQ K;  2W41 A;  4K42 A;  2F8T A;  1JLC A;  3I55 N;  4BC4 A;  2OCE A;  4XH1 A;  1X9W A;  1VQL N;  4B9S A;  4EP5 A;  4M63 C;  1VSF A;  2NRT A;  1RT7 A;  3MMV A;  5AFU H;  5GIN A;  1U4B A;  3O4N A;  1VAZ A;  3QIP A;  3WNF A;  1ZBI A;  4I6M B;  4KTW A;  2G8V A;  1VQK N;  4E7J A;  2WON A;  2VG6 A;  2E1Y A;  4CZI A;  2O8C B;  1SAZ A;  3CYM A;  4JK8 A;  4E7I A;  1LAW A;  1NK9 A;  1IG9 A;  2F9W A;  1BUP A;  3LDS A;  2PYJ A;  4DUZ K;  3VTH A;  1KAX A;  3KHY A;  3J7Z O;  4EZ9 A;  4FVU A;  2UUB K;  2IS3 A;  1LAV A;  3ALY A;  3C65 A;  4DR1 K;  3P38 A;  3SMS A;  3K9K A;  3LDN A;  4YOU A;  2P9N B;  1EO1 A;  2D0B A;  3AVA A;  3KKS A;  1BDG A;  3ZSO A;  5BN8 A;  3A5O C;  3PUF A;  2A40 A;  3K5L A;  4BAC A;  3TR8 A;  1NMD A;  1X1P A;  3AVJ A;  4DTR A;  4OPJ A;  4CGD A;  3HPH A;  3CER A;  2F4V K;  2P9K B;  1SQK A;  4DU1 A;  3CJA A;  4RW6 A;  4ILH A;  1HUX A;  4OO1 J;  3O3H A;  1RT5 A;  3HBT A;  5AQL A;  3T1A A;  3FGU A;  5JS2 A;  4AHR A;  2HF4 A;  4CEO A;  3THY A;  3OYF A;  2FF3 B;  3D2E B;  4RW8 A;  2GBZ A;  2XRI A;  4CJ3 A;  5C25 A;  1UAX A;  2Y1J A;  3ULE A;  3AO1 A;  1W0H A;  4E3S A;  1QS4 A;  3Q7C A;  4OKE A;  4CHO A;  4BR2 A;  3GL1 A;  5KRS A;  2HMP A;  3ZSY A;  4KH4 A;  5M1Q A;  1S9G A;  4N76 A;  3LP0 A;  1VSH A;  4O8K A;  3EE9 A;  2FBY A;  4FLX A;  1CXQ A;  3O9S A;  4FOE A;  1LV5 A;  2G8W A;  2OTL N;  3LP3 A;  4CIF A;  3LAK A;  1NK8 A;  4CEC A;  5C10 A;  3H45 C;  4JI3 K;  4JRQ A;  4O4G A;  3VQ5 A;  3MAQ A;  4JI6 K;  2EHG A;  3OYK A;  2ASM A;  3H46 O;  3DLB A;  4OX9 K;  1D9F A;  3A2F A;  4PHT X;  2HB5 A;  5HP1 A;  4Z4F A;  4EAH D;  4DQP A;  4FPA A;  3WEE B;  4MLE A;  3CJ9 A;  1NJX A;  5GAE P;  5C24 A;  3MCP A;  3MWT A;  3SJJ A;  5BN9 A;  3I0S A;  4MQ3 A;  3T69 A;  3OW2 M;  1Q82 O;  1UA1 A;  3UE5 A;  4KI4 A;  1N32 K;  4YY3 K;  4W5T A;  5M1F A;  3KWI A;  1SL1 A;  1NWK A;  4DQI A;  3O80 A;  1L5U A;  3OS2 A;  1ZBS A;  4C8L A;  4YOW A;  4FWM A;  2RN2 A;  4YDU C;  2ETJ A;  2UUC K;  1BOT O;  3AA4 A;  3EZ5 A;  4KHU A;  3TI0 A;  5KPR A;  1JKH A;  3P39 A;  4CE9 A;  4FLT A;  5CYQ A;  4KV8 A;  4AHU A;  5BRE A;  4MDB A;  2GEM A;  1TKX A;  1ATR A;  1U6Z A;  2P9U B;  2CH5 A;  4ILG B;  3QFU A;  3OTO K;  3HTV A;  4H03 B;  3P5J A;  1U04 A;  3QBX A;  1K8K A;  1TGO A;  1LWE A;  1RIL A;  4F9O A;  4Y1C A;  1HYV A;  3HOS A;  4OGC A;  4CJF A;  1BGX T;  1Q18 A;  3MX5 A;  4DV2 K;  3M5R A;  3C7N A;  4DU4 A;  4NXN K;  1ZXO A;  2GWJ A;  4B1V A;  1LCU A;  2YHY A;  3K9J A;  3O6W A;  2Z1J A;  4FJK A;  4E19 A;  4FJL A;  4KTQ A;  3DLE A;  1WSH A;  2NLX A;  2QEX N;  4DQ8 A;  1I94 K;  1J9A A;  2VG7 A;  3L8B A;  4F4K A;  4OPK A;  1U45 A;  4EHT A;  1DGK N;  1XMO K;  4F8R A;  1S3X A;  3GBT A;  3NGI A;  2ZJP L;  2QWQ A;  3AAP A;  3CCS N;  1YJW N;  3EY1 A;  4PQU A;  3LDO A;  2P5O A;  1T03 A;  3OS1 A;  1YTU A;  2QWP A;  2HHU A;  1IO2 A;  2AJQ A;  1MU2 A;  2PY5 A;  1NJY A;  1ASW A;  3OHR A;  1HKB A;  4JHD A;  1X9M A;  1Q9Y A;  1S22 A;  3HZ6 A;  4H5W A;  3SBT A;  1XNR K;  3K59 A;  3QIO A;  4X64 K;  4FK0 A;  1R59 O;  3F73 A;  2HVH A;  4GMJ B;  1A5V A;  3L2V A;  3PX6 A;  1VSL A;  4B9L A;  5GAG P;  2HBK A;  3DLK A;  1TAU A;  4CGG A;  5AQQ A;  4I6M A;  2RKI A;  4X66 K;  2HHS A;  5EU7 A;  2G8U A;  2O8C A;  3L0Q A;  3DLG A;  4CJL A;  4WFN L;  3J7A P;  3LPU A;  1HMV A;  3L2Q A;  4I9L A;  4BR0 A;  3A0I X;  3NF8 A;  4K8X A;  4LF4 K;  2Q36 A;  4UQG A;  2YI1 A;  3GDQ A;  1RT2 A;  4BRD A;  1RBR A;  1ILY A;  3QIC A;  4H0O A;  1D9D A;  3NVK A;  1YF5 L;  4FZX C;  3VA0 A;  2ZGY A;  2YHA A;  2P9N A;  3HPG A;  4AHT A;  1ZBL A;  5M1O A;  3KLG A;  1TKZ A;  4BRC A;  3NCI A;  4CD1 A;  4JI2 K;  3KK3 A;  4LF7 K;  5LY3 A;  4DV7 K;  2I7N A;  1VQP N;  4KHS A;  1TYQ B;  4DR6 K;  3CG7 A;  2IAJ A;  2IOC A;  1QQM A;  1EQY A;  2Q97 A;  4B1X B;  4YOX A;  1FW6 A;  5FPN A;  1E3M A;  2HHQ A;  2EX3 A;  1KXP A;  1JL1 A;  1KLN A;  3QEP A;  4H0X B;  1YI2 N;  5ADX H;  3SUQ A;  4IXC A;  2G8K A;  3QNN A;  3PLA A;  1WLJ A;  1WSG A;  3FLC O;  4MLH A;  4DTP A;  2BH1 A;  3AVM A;  4BVP A;  1T6C A;  3C0B A;  2VGN A;  4BRM A;  1A5X A;  4Y1D A;  3H6E A;  4TSX A;  2O8D A;  4CFD A;  3NH2 A;  4M41 A;  1DT9 A;  2E20 A;  3E01 A;  3QET A;  2YNI A;  1M1K O;  2E4L A;  3VES A;  1NGI A;  4IZ9 A;  4JKF A;  2V7Y A;  4FO0 A;  5FRM A;  4IO9 L;  3ISN C;  3C6U A;  3OY9 A;  1ASU A;  2W6L A;  1YVN A;  4CFA A;  3VQ9 A;  4NLC A;  2E2N A;  3VQE A;  4PKH A;  1RTJ A;  1VQ4 N;  4BC5 A;  4HUE A;  2NRH A;  4DV3 K;  1JXE A;  4M45 A;  1Y97 A;  3JYT A;  3S41 A;  2WBN A;  4QS9 A;  2E2Q A;  4CFB A;  1OH5 A;  2YKN A;  1YVU A;  1YJN N;  4E1J A;  2GWK A;  4IFY A;  2P1J A;  1C0T A;  4ID5 A;  2QWL A;  3AVH A;  2YNH A;  4JK7 A;  1HYZ A;  1Y64 A;  3IAY A;  3K0S A;  4CZK A;  4BRE A;  1VQO N;  5AQN A;  5AQR A;  3RMA A;  3AO3 A;  2WFB A;  1NBW A;  3M8Q A;  4CF8 A;  3HSC A;  4PWD A;  3AVK A;  3ZT1 A;  2QA4 N;  1NGB A;  2V7Z A;  2O8B B;  3M6G A;  1BA1 A;  3CXC M;  1NGF A;  3DWL A;  3U8X A;  3SYZ A;  1JLA A;  3E1Y A;  3THY B;  2HHX A;  1S1W A;  1KQS M;  3BDP A;  1E4G T;  2P9L A;  1Q86 O;  3FE1 A;  3OYH A;  1NOZ A;  4FJG A;  1Z6R A;  3CET A;  3TAP A;  3ULE B;  1S72 N;  1FXX A;  5LMU K;  3N4Q A;  4H4O A;  4E7K A;  1I3A A;  3DLH A;  3TAR A;  4K43 A;  1J53 A;  4HUG A;  4DQQ A;  4NYN A;  1IKX A;  4Q0B A;  3U4L A;  2HVI A;  2Z1G A;  3IDH A;  4CGH A;  4LFC K;  1Q9X A;  4B8A B;  1K8A O;  2OZS A;  1NGC A;  4CED A;  2IGI A;  3WQU A;  3KLF A;  3C6A A;  5HBM A;  1YIJ N;  4C8O A;  3CM5 A;  1W97 L;  4BVO A;  4Z0U A;  5C12 A;  4BRP A;  1NGD A;  4PL7 A;  2GEL A;  4IWV A;  4NXM K;  5T7B A;  5BPN A;  1ZBH A;  3HXM A;  1G15 A;  3VQD A;  3EYZ A;  1GLA G;  3G10 A;  4E7L A;  4DTU A;  3CCJ N;  3SCX A;  4R5P A;  1FKO A;  4IO8 A;  1Q8I A;  4W5Q A;  1NM1 A;  1T05 A;  4W5N A;  4EIA A;  1QTM A;  4JEP A;  3PO4 A;  3SPY A;  3NH1 A;  2A1R A;  2BGG A;  4H5N A;  4DFP A;  4CGF A;  5EX5 A;  3FZF A;  4WQ4 A;  2XY5 A;  3VA3 A;  1WSF A;  4DV1 K;  1N8R O;  5AQX A;  3OYB A;  1C0U A;  4QCL A;  2OA8 A;  3R1X A;  4CZE A;  2AA4 A;  4U67 L;  3VQ8 A;  3ENB A;  1C1C A;  3QML A;  1TL3 A;  1NKB A;  3LDL A;  4B3M K;  1OVQ A;  1UWB A;  3THX A;  5H1S Q;  3KLH A;  2YV0 X;  4NYF A;  1GOA A;  1K8K B;  3M8R A;  3G6E N;  3TTD A;  3TAQ A;  2IVO A;  1J5O A;  5B8H A;  4FJ8 A;  3CF5 L;  4IG3 A;  1G99 A;  4K41 A;  3LWM A;  3U3G A;  2UYT A;  4M3W A;  3AGR A;  3MX2 A;  1T6D A;  3AVC A;  1NKE A;  4FWS A;  3THV A;  3LAL A;  1TUU A;  3WXK A;  4C1N I;  1GLL O;  3IS9 A;  5CHI A;  4FLV A;  1NGA A;  5HRP A;  4JKH A;  3FZK A;  4DTJ A;  3ZLJ A;  1EP4 A;  3VQB A;  3NVM A;  4HCB A;  2D5R A;  1QQN A;  3S3M A;  2P9S A;  1TYQ A;  3CCV N;  1QZ5 A;  3VQ6 A;  1RT6 A;  2OZM A;  3VGL A;  1XMQ K;  3HI0 A;  2YNF A;  3MEG A;  5AQH A;  4DS4 A;  5HRO A;  1RBU A;  1SKR A;  4CHZ A;  4KRF A;  1NK5 A;  4M42 A;  4MO4 A;  3KD1 E;  4JHD B;  1U2V A;  2H3G X;  4FOI A;  4JKD A;  5HL7 L;  3HOT A;  5HLF A;  4XEI A;  1RDA A;  1NLV A;  1RT1 A;  2A6A A;  3EO3 A;  4ISE A;  3TTF A;  1XHX A;  3M8S A;  4M3R A;  4LF9 K;  4WF9 L;  3EN9 A;  4DQR A;  4AM7 A;  2ZQB A;  1RBT A;  2B4J A;  3SBG A;  4DCH A;  3LWL A;  4PY5 A;  1S6P A;  1C0F A;  4R79 A;  3RMC A;  4K8Z A;  2KZM A;  3I8D A;  1DLO A;  2KKZ A;  3KWG A;  1RDC A;  1B9F A;  4YDU A;  4ILJ A;  3PSF A;  3MN7 A;  5AR0 A;  4LFB K;  3T1H K;  4IJA A;  2QTD A;  3G4S N;  1BWF O;  3ATV A;  3ID6 A;  4F2R A;  3GE1 A;  2PAV A;  2WUS A;  2Z1H A;  1Q7Y O;  3M3Z A;  1JJ2 M;  4QS7 A;  4AHV A;  4I2P A;  2HBJ A;  3UIQ A;  4JYA K;  4BWJ A;  3LZI A;  4CEZ A;  4FJM A;  4CZF A;  4CJ4 A;  4MDA A;  1IKV A;  1V4T A;  1HNZ K;  3DI6 A;  2HHW A;  1OH8 A;  2F9T A;  1WSJ A;  1D8Y A;  3D45 A;  2GX9 A;  2KZZ A;  3VEN A;  3P4I A;  1F21 A;  3CCR N;  1S6Q A;  4KH5 A;  4IG0 A;  5DM7 L;  5JVH L;  3HM8 A;  4LSN A;  5TKW A;  1VQ5 N;  4FYD A;  4BRH A;  4XH5 A;  3ENO A;  4FWL A;  3WNG A;  4K25 A;  2B5J A;  1NMN A;  3AVB A;  3U9D A;  3WXL A;  2OPR A;  3S9H A;  1CZB A;  1BIU A;  3VN5 A;  4BRA A;  1S5J A;  1GLB G;  2O8B A;  1OH7 A;  2O8E A;  1EWR A;  1NJW A;  4BRL A;  1NOY A;  2F96 A;  1ESV A;  4M3Z A;  1GLF O;  3MDQ A;  2O8D B;  4EP4 A;  4AIL C;  3DRR A;  4GY2 B;  2GUP A;  3D2F A;  1HPZ A;  1D5A A;  4LF6 K;  3NF7 A;  1IBM K;  4AQY K;  4YOR A;  3BGR A;  4CK1 A;  4KHW A;  3JSM A;  1BCO A;  3SQ2 A;  5GAD P;  4DV0 K;  1WNS A;  4LSL A;  4DUY K;  3Q7B A;  1YAG A;  4CEB A;  1VRT A;  3LZJ A;  1KVC A;  3F9M A;  3SK3 A;  4B1Z A;  3TAN A;  2E6L A;  3AVG A;  3SQ1 A;  4KI6 A;  1LWF A;  3I56 N;  1GLE G;  2HOE A;  4I9Q A;  2KHO A;  2WC9 A; 
#chains in the Genus database with same CATH homology
 2HHS A;  3AO4 A;  4FM1 A;  2XY7 A;  4DSJ A;  4DU3 A;  2OPP A;  5EU7 A;  4JS5 A;  2G8U A;  4QOZ B;  4B9U A;  1EKE A;  1RDD A;  1YT3 A;  3DLG A;  4FJH A;  4CJL A;  1XWL A;  4CK3 A;  4W5R A;  3MEC A;  1SL2 A;  3LPU A;  1HMV A;  3HT3 A;  3L2Q A;  2I5J A;  4I9L A;  2YKM A;  4DLG A;  3CM6 A;  3AVN A;  5KGW A;  3NF8 A;  3NFA A;  4K8X A;  1GOB A;  5FRO A;  3M8P A;  5CZ1 A;  1HNV A;  4UQG A;  4CGI A;  4DF8 A;  1EX4 A;  3B6O A;  1RT2 A;  4DTM A;  3ZSW A;  1RBR A;  3SUO A;  5JS1 A;  4DWI A;  1D9D A;  1K6Y A;  1RCH A;  4BWM A;  4FZX C;  4LD0 A;  4N56 A;  3VA0 A;  3V9X A;  4F3O A;  2YHA A;  3HPG A;  4H8K A;  1JL2 A;  3OVN A;  1HQU A;  4AHT A;  1ZBL A;  3O3G A;  2KFZ A;  4CGG A;  5SWM A;  3KLG A;  3KJV A;  3QEV A;  1TKZ A;  3NCI A;  3CFP A;  1BIS A;  4B9M A;  3KK3 A;  3QNO A;  4DFJ A;  2VG5 A;  1BI4 A;  4FJ7 A;  4KHS A;  1JLG A;  1ZBF A;  3HVR A;  4ELU A;  3DMJ A;  4AH9 A;  3CG7 A;  4CEQ A;  2HHV A;  2IAJ A;  2IOC A;  3V1Q A;  3QER A;  4CER A;  4Q5V A;  4E7H A;  2VWK A;  1U47 A;  3QEX A;  3TAE A;  1DTT A;  3MXJ A;  4CEF A;  1HNI A;  4CEA A;  1S1U A;  1RTH A;  3PY8 A;  4MFB A;  2QKK A;  4FJX A;  2HHQ A;  4C8N A;  2EX3 A;  2XHB A;  4HCC A;  1CXU A;  5I3U A;  1RDB A;  1VSD A;  1JL1 A;  3FFI A;  1KLN A;  2HMI A;  1WAJ A;  3QEP A;  5HRS A;  3SUQ A;  4W5O A;  2BE2 A;  3LP2 A;  1BCM A;  3MEE A;  3V1R A;  2X78 A;  2BDP A;  1QSS A;  2RPI A;  1B92 A;  4FLZ A;  5FRN A;  2G8K A;  4KKO A;  4RW9 A;  4B9N A;  4FXD A;  4DSF A;  4AHC A;  3LAN A;  1QSY A;  4OGE A;  3QNN A;  4ELV A;  1WLJ A;  1WSG A;  2RF2 A;  3P83 D;  4CF2 A;  3G0Z A;  2W42 A;  4DTP A;  3NE6 A;  3AVM A;  1N5Y A;  4OLB A;  3LPT A;  3NGY A;  2HNZ A;  3HPO A;  1A5X A;  4Y1D A;  4N5S A;  4H4M A;  3V9U A;  3O3F A;  2P51 A;  3ZSX A;  4TSX A;  4C8M A;  5E41 A;  2YHB A;  3S3O A;  4XIU A;  4CFD A;  3NH2 A;  4M41 A;  3MXM A;  2X6N A;  4I7F A;  5C42 A;  2O4G A;  4FM0 A;  4NCA A;  3E01 A;  3QET A;  2YNI A;  4IDK A;  4J2E A;  2ZD1 A;  4ICL A;  1N6Q A;  2E4L A;  4E0D A;  4OKK A;  5DMR A;  1KVB A;  3T19 A;  3C95 A;  4O55 A;  3K58 A;  3RRH A;  4FK4 A;  3OS0 A;  5FRM A;  4ZTJ A;  1VSM A;  3ISN C;  2WOM A;  3C6U A;  5HRN A;  3OY9 A;  1ASU A;  1TL1 A;  3CFO A;  4BDY A;  4CJU A;  3RTV A;  2F8S A;  2X74 A;  3SQ0 A;  4CEE A;  1RBV A;  4CFA A;  3AO2 A;  3HM9 A;  3VQ9 A;  5D3G A;  4KB1 A;  4BDP A;  4CJE A;  3VQE A;  4YNQ A;  1XI1 A;  1RTJ A;  3K57 A;  3DOL A;  4O0J A;  4HUE A;  3F9K A;  3KLI A;  1JXE A;  4M45 A;  1IKW A;  3ASM A;  4M3U A;  1Y97 A;  3JYT A;  3OYC A;  1B9D A;  2GUI A;  4BE0 A;  1S1T A;  1Z25 A;  4CFB A;  1DTQ A;  3OYJ A;  4ZHR A;  1SV5 A;  2YKN A;  3SZ2 A;  1YVU A;  3HJF A;  2OYQ A;  3TAM A;  4IFY A;  3AV9 A;  4CIE A;  3OYI A;  2P1J A;  1C0T A;  1QHT A;  4ID5 A;  1VSI A;  3ZSZ A;  3V9W A;  3AVH A;  2YNH A;  1HYZ A;  1L3U A;  2FBX A;  4CHN A;  3CFR A;  1IKY A;  3PV8 A;  4CHQ A;  3ZCM A;  3IAY A;  1BQN A;  4KHQ A;  3HK2 A;  2KFN A;  3S3N A;  1SKS A;  4FW1 A;  3CQ8 A;  2FBV A;  4O0I A;  3OYN A;  3DOK A;  4KTZ A;  4O5B A;  1T7P A;  4B9V A;  4FJI A;  5HRR A;  4KRE A;  2QXF A;  1TKD A;  3RMA A;  3AO3 A;  1FK9 A;  1KLM A;  3L2U A;  3OYG A;  3M8Q A;  1VK0 A;  5J2Q A;  4CF8 A;  1NKC A;  4PWD A;  2HND A;  3AVK A;  1LW2 A;  1RT3 A;  2D0A A;  3L3V A;  3NF6 A;  3ZT1 A;  4NCB A;  4J2A A;  1QSL A;  1JLE A;  3D0P A;  2X6S A;  4CCH A;  1QE1 A;  3NBP A;  1VRU A;  4FJJ A;  1X9S A;  4CJV A;  3HVT A;  4FLU A;  3V4I A;  1LWC A;  1NJZ A;  3C94 A;  1O1W A;  3SYZ A;  1JLA A;  1CLQ A;  2BAN A;  2HHX A;  1S1W A;  4DLE A;  3BDP A;  1SUQ A;  4O44 A;  4CFC A;  2QK9 A;  4WE1 A;  2G8H A;  3OYH A;  1NOZ A;  4LY7 A;  4FJG A;  3AA2 A;  4CJK A;  3PX4 A;  3TAP A;  1EXQ A;  3L2W A;  3ZT4 A;  1FXX A;  3LAM A;  3OYL A;  4H4O A;  4IFV A;  1I3A A;  5CYM A;  3B6P A;  4E7K A;  3TAR A;  3IRX A;  3DLH A;  4KO0 A;  3KLE A;  4M3Y A;  4AHS A;  1J53 A;  4KAZ A;  4KPY A;  4B3O A;  4HUG A;  4DQQ A;  4NYN A;  1IKX A;  2E6M A;  3ULD A;  3RR8 A;  5K14 A;  4Q0B A;  3V1O A;  2IC3 A;  2KQ2 A;  2Z1G A;  2HVI A;  4CGH A;  2F8T A;  3KK1 A;  1JLC A;  3DM2 A;  1Q9X A;  4B8A B;  5CY4 A;  4IBN A;  3K5N A;  1VSK A;  4G1Q A;  4HTU A;  2OZS A;  1X9W A;  4DTX A;  4CED A;  4LH5 A;  2IGI A;  2G8I A;  3KLF A;  3QEI A;  3TAG A;  4B9S A;  5HBM A;  4EP5 A;  4FJ5 A;  4C8O A;  3CM5 A;  1VSF A;  4Z0U A;  4EZ6 A;  2ATQ A;  1RT7 A;  1TK5 A;  2JLE A;  1KCF A;  4CES A;  3HP6 A;  3O4Q A;  4J2D A;  3HL8 A;  5T7B A;  1U4B A;  4J2B A;  1Z26 A;  1ZBH A;  1UOC A;  1W9H A;  4HUF A;  3HXM A;  3O4N A;  3SUP A;  1G15 A;  3VQD A;  3QIP A;  3EYZ A;  2JGU A;  4Z4E A;  3G10 A;  4E7L A;  3WNF A;  3SV3 A;  4CJT A;  4DTU A;  1ZBI A;  3MED A;  2ITG A;  4KTW A;  4HVJ A;  4R5P A;  5FDL A;  1BQM A;  1FKO A;  3SCX A;  1XC9 A;  4E7J A;  2G8V A;  2WON A;  2VG6 A;  1Q8I A;  1BIZ A;  1RTI A;  3U6F A;  4W5Q A;  3CYM A;  2KTQ A;  4E7I A;  1LAW A;  1T05 A;  4M3X A;  4W5N A;  4FZY A;  1NK9 A;  1J54 A;  1IG9 A;  1QTM A;  3PO4 A;  3HP9 A;  3SPY A;  4E1M A;  3NH1 A;  3LDS A;  2A1R A;  2BGG A;  4DFP A;  2PYJ A;  4CGF A;  3DYA A;  4FLY A;  4RG8 A;  3ZT3 A;  1RBS A;  4DMN A;  2FC0 A;  2XY5 A;  4FM2 A;  4EZ9 A;  3VA3 A;  1S1X A;  1U48 A;  1WSF A;  1JLF A;  3ZT2 A;  4OLA A;  2IS3 A;  1LAV A;  3OYB A;  3ALY A;  3AVF A;  3V81 A;  3OYE A;  1JLB A;  4CGJ A;  1C0U A;  3HO1 A;  4FW2 A;  2OA8 A;  2VWJ A;  4QCL A;  3ITH A;  3SPZ A;  1QQC A;  3VQ8 A;  4CJ5 A;  4KB0 A;  2D0B A;  4KHN A;  3AVA A;  1C1C A;  1RT4 A;  3KKS A;  3AVI A;  3AA3 A;  1EET A;  3ZSO A;  4HHT A;  2HHT A;  4N41 A;  1TL3 A;  1NKB A;  4C8K A;  1BI4 B;  3RRG A;  3AVL A;  4KHY A;  1UWB A;  3PUF A;  3K5L A;  1TV6 A;  3TR8 A;  4BAC A;  3P1G A;  3PO5 A;  3SQ4 A;  3KKR A;  1WSI A;  3MXI A;  4B9T A;  5DK5 A;  1X1P A;  2HW3 A;  2OPQ A;  3AVJ A;  3QLH A;  4FLW A;  4I2Q A;  3VQ4 A;  3VQ7 A;  4DTR A;  4B8C A;  4OPJ A;  4CGD A;  3HPH A;  3TAF A;  3KLH A;  2YV0 X;  1ZBU A;  3OYA A;  4NYF A;  4ELT A;  4DU1 A;  1IH7 A;  1GOA A;  1TKT A;  4RW6 A;  4CJQ A;  4DTN A;  4DSE A;  3SUN A;  4JRP A;  3M8R A;  3VQC A;  4FCY A;  1KVA A;  3VQP A;  3O3H A;  4E89 A;  1RT5 A;  4ID1 A;  3K5M A;  1C1A A;  3T1A A;  3TAQ A;  4IKF A;  2IDO A;  1S9E A;  1J5O A;  1REV A;  5JS2 A;  3KIO A;  4AHR A;  4FJ8 A;  4CEO A;  4Z4C A;  4IG3 A;  3OYF A;  3ZT0 A;  3LWM A;  3U3G A;  4LH4 A;  1T8E A;  4M3W A;  4OJR A;  2PYL A;  4RW8 A;  1VSJ A;  2GBZ A;  2XRI A;  4CJ3 A;  3DRS A;  3AVC A;  5C25 A;  1C0M A;  1UAX A;  2Y1J A;  1CZ9 A;  1W0H A;  3AO1 A;  1NKE A;  2DTU A;  3THV A;  3LAL A;  3QIN A;  4E3S A;  1QS4 A;  4OKE A;  4CHO A;  3IS9 A;  5KRS A;  3SV4 A;  3ZSY A;  4FLV A;  1S9G A;  4N76 A;  3OYM A;  1BL3 A;  5HRP A;  3LP0 A;  1UA0 A;  1VSH A;  3WNH A;  4DTJ A;  1SKW A;  2FBY A;  4FLX A;  1CXQ A;  1LV5 A;  2G8W A;  3WNE A;  3LP3 A;  1EP4 A;  4OKJ A;  3VQB A;  4CIF A;  3LAK A;  1TAQ A;  5J2M A;  4CHY A;  4HCB A;  2D5R A;  4RW4 A;  1NK8 A;  2Y1I A;  3S3M A;  1LW0 A;  4CEC A;  5I42 A;  3U3Y A;  3RR7 A;  1NK0 A;  4JRQ A;  1ZYQ A;  2B6A A;  2XY6 A;  3VQ6 A;  4O4G A;  3AA5 X;  3VQ5 A;  3MAQ A;  3RMD A;  1RT6 A;  1HQE A;  2EHG A;  2ZE2 A;  2KW4 A;  3OYK A;  4JS4 A;  2OZM A;  4KFB A;  3T3F A;  2YNF A;  3DLB A;  3MEG A;  2D0C A;  3TAB A;  4CF0 A;  1D9F A;  3A2F A;  5KI6 A;  3NF9 A;  2HB5 A;  4DS4 A;  5HP1 A;  4Z4F A;  5HRO A;  3K5O A;  1KFS A;  4RW7 A;  3SNN A;  4PUO A;  4DSL A;  1RBU A;  4DQP A;  1GOC A;  1SKR A;  4CHZ A;  3VQQ A;  2R7Y A;  4KRF A;  1NK5 A;  3TWH A;  4M42 A;  2XY8 A;  1NJX A;  3KD1 E;  4NCG A;  5C24 A;  3KK2 A;  3SJJ A;  1HJR A;  3I0S A;  4MQ3 A;  3I0R A;  3AO5 A;  3C6T A;  1UA1 A;  3V6D A;  5HLF A;  4ZTF A;  4KI4 A;  1RDA A;  2O4I A;  4W5T A;  1RT1 A;  5CZ2 A;  4CHP A;  3PX0 A;  1SL1 A;  4CF1 A;  1XHX A;  2GV9 A;  3SI6 A;  4DQI A;  3M8S A;  4M3R A;  3V9Z A;  1L5U A;  3OS2 A;  1NK4 A;  4DQR A;  4C8L A;  2ZQB A;  4DFK A;  5J2N A;  2RN2 A;  4FVM A;  1RBT A;  2B4J A;  4F3T A;  4DSI A;  2ETJ A;  2YNG A;  3LWL A;  1KRP A;  3AA4 A;  4BE2 A;  4PY5 A;  3EZ5 A;  1S6P A;  4KHU A;  3TI0 A;  1JKH A;  3ZSR A;  3NGZ A;  4CE9 A;  1L3T A;  2OPS A;  4FK2 A;  4FLT A;  1WN7 A;  3RMC A;  4K8Z A;  2KZM A;  3I8D A;  1DLO A;  1HRH A;  4KV8 A;  1A5W A;  1B9F A;  1RDC A;  1WAF A;  5CYQ A;  4AHU A;  4E1N A;  2G8F A;  4Z4I A;  1TKX A;  3KD5 E;  2A1S A;  1ASV A;  4CJR A;  4FJ9 A;  3NHG A;  4BE1 A;  2QKB A;  1KFD A;  2P5G A;  4DTS A;  4F2R A;  2DFH A;  3P5J A;  3NDK A;  4FJN A;  1U04 A;  3NH0 A;  3RWU A;  4L8R B;  2Z1H A;  4N47 A;  4JLH A;  1TGO A;  1LWE A;  1RIL A;  4AHV A;  4M3T A;  3DRP A;  4I2P A;  3H08 A;  3UIQ A;  2Z1I A;  1BHL A;  4BWJ A;  4Y1C A;  3LZI A;  4CEZ A;  4FJM A;  2DFF A;  3V9S A;  4DTO A;  1HYV A;  3KTQ A;  4OGC A;  4CIG A;  4CJF A;  4CJ4 A;  5J1E A;  1IKV A;  1BGX T;  2PZS A;  5KTQ A;  1I39 A;  3DI6 A;  4CK2 A;  4CJS A;  2XO7 A;  2HHW A;  3QEW A;  1WSJ A;  4CJW A;  1D8Y A;  4DU4 A;  3D45 A;  2KZZ A;  2FBT A;  4PA1 A;  1F21 A;  4FJK A;  1S6Q A;  2Z1J A;  4IG0 A;  4F2S A;  4LSN A;  4E19 A;  1XHZ A;  4FJL A;  4FYD A;  4KTQ A;  3DLE A;  3HST B;  4Z4H A;  3RMB A;  4DF4 A;  1WSH A;  5J2P A;  1KTQ A;  3WNG A;  2B5J A;  5KRT A;  4DG1 A;  3AVB A;  3HYF A;  1NK7 A;  4Z4G A;  1NK6 A;  4DFM A;  1HYS A;  3VQA A;  1J9A A;  2OPR A;  2VG7 A;  1U49 A;  1S1V A;  3IG1 A;  3S9H A;  3L8B A;  1TK0 A;  2DFE A;  4OPK A;  1U45 A;  1ITG A;  1CZB A;  1BIU A;  4F4K A;  1KSP A;  3VN5 A;  3QES A;  1S5J A;  3NAE A;  1SL0 A;  3OYD A;  3QO9 A;  4OVL A;  4F8R A;  3NGI A;  1FKP A;  2Q3S A;  3ZSQ A;  1NJW A;  3EY1 A;  4DS5 A;  4PQU A;  1NOY A;  2F96 A;  4CJP A;  1T03 A;  2P5O A;  3LP1 A;  3OS1 A;  4M3Z A;  5SZT A;  1YTU A;  4CF9 A;  3OJS A;  2HHU A;  4GVM A;  1IO2 A;  1L3S A;  4EP4 A;  4AIL C;  3DRR A;  2HNY A;  5KGX A;  1JXB A;  4B08 A;  2AJQ A;  1MU2 A;  2PY5 A;  3ZSV A;  1C6V A;  4BDZ A;  1NJY A;  1HPZ A;  1TK8 A;  1ASW A;  1D5A A;  1X9M A;  3NF7 A;  1L3V A;  1Q9Y A;  1RTD A;  4DQS A;  3DLR A;  2LSN A;  3BGR A;  4CK1 A;  1RNH A;  4KHW A;  2NUB A;  4GW6 A;  1VSE A;  1TVR A;  4QAG A;  3JSM A;  1BCO A;  3K59 A;  1JLQ A;  3SQ2 A;  3QIO A;  4FK0 A;  1WNS A;  4LSL A;  3F73 A;  2HVH A;  1WSE A;  2DY4 A;  4FZZ A;  4GMJ B;  1A5V A;  1C1B A;  4YFU A;  3OJU A;  4CEB A;  1VRT A;  3L2V A;  1YTA A;  3LZJ A;  3PX6 A;  1KVC A;  1R0A A;  1VSL A;  4B9L A;  3TAN A;  2E6L A;  3AVG A;  3SQ1 A;  4KI6 A;  3L2R A;  1LWF A;  3DLK A;  3K2P A;  3L3U A;  4DSK A;  1TAU A;  4I9Q A;  2RKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...