1QS4A

Core domain of hiv-1 integrase complexed with mg++ and 1-(5-chloroindol-3-yl)-3-hydroxy-3-(2h-tetrazol-5-yl)-propenone
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
154
structure length
150
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HIV-1 INTEGRASE (E.C.2.7.7.49))
publication title Structure of the HIV-1 integrase catalytic domain complexed with an inhibitor: a platform for antiviral drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 47
structure length 150
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qs4A00
1KLMA 1ZBFA 3CG7A 3MEGA 3AVNA 4CJ3A 3OJSA 4I7FA 2X74A 3NH0A 1NK9A 3RTVA 1GOAA 1B92A 1SV5A 1QSSA 3K5LA 3SQ0A 1JL2A 2XY7A 1JXBA 1Q9YA 1CXQA 1BHLA 2HNDA 4B8AB 1K6YA 4YNQA 4FM0A 1J53A 2WONA 3P5JA 4KHUA 4HVJA 4CIFA 4DFMA 3EYZA 3SQ2A 2P5GA 4E7HA 1VSEA 2FBTA 3L2WA 3V9SA 4QCLA 2G8FA 2Y1JA 3KKRA 4LY7A 3ZCMA 3IS9A 4CESA 3SUNA 4KHQA 3V9WA 4IFVA 1TK0A 1FXXA 3NBPA 3QINA 4KI4A 4NYNA 4Q0BA 1HMVA 1X9WA 1LAVA 2HHXA 3OYAA 3LP0A 1RDAA 3QNOA 4CE9A 4AH9A 4CGGA 4JRQA 3KD5E 4CHOA 3OJUA 5K14A 3NHGA 4O55A 5KRTA 4FJ5A 1BCOA 1WAJA 2D0BA 3ULDA 1DLOA 4LD0A 4FLWA 1R0AA 4PQUA 1XHXA 2FC0A 3VQPA 4EZ6A 4E7KA 1FKOA 3ZSQA 1KCFA 1C6VA 2X78A 3AVHA 3AO1A 5CZ2A 2XY8A 4CF1A 3PX0A 1NK5A 3G10A 4ELUA 1WSGA 3QEVA 2NUBA 1HPZA 3SZ2A 4E3SA 3KLEA 1S9GA 1KLNA 4E89A 4B9LA 5T7BA 3O3FA 1A5WA 1NK6A 2JLEA 1JLBA 2EHGA 4Y1CA 4CJ5A 2ZD1A 4E1NA 3NAEA 3HO1A 3MAQA 3OYMA 3SUPA 1RDDA 4DQIA 2HMIA 1BI4B 1EKEA 2ATQA 5C25A 3PX4A 3THVA 5SZTA 2DY4A 1MU2A 3DLHA 1Y97A 3AVBA 1RT2A 2P1JA 4OKKA 4RW4A 4Z4EA 1KVBA 2B4JA 3TWHA 4DQRA 3SI6A 3RR8A 3AVGA 4DSKA 4Y1DA 1JKHA 3VQEA 4CJUA 4DTMA 1ASUA 5I3UA 3KTQA 2Q3SA 2YHBA 1RCHA 3DLRA 3KK3A 3CYMA 1O1WA 2E6LA 2HVIA 3KJVA 4BDZA 4O5BA 4N41A 2EX3A 3OYNA 2YNHA 3D0PA 2XY5A 4CHQA 5EU7A 3G0ZA 1RBSA 2IGIA 4R5PA 1UA0A 1TK8A 2KFNA 1UWBA 4FVMA 4KV8A 4C8NA 2D5RA 4JS5A 3OY9A 4DLEA 3NGYA 3DI6A 3KLFA 3NF9A 3RWUA 4H4OA 3SYZA 5HLFA 2YNFA 2GUIA 1XC9A 1D9FA 1C0TA 3HPGA 2QXFA 4CJRA 4J2EA 3U6FA 4FZXC 3ZT3A 4H4MA 2Z1HA 4I2PA 1WSJA 4FJNA 3HYFA 3V1RA 4PUOA 4DTNA 3TAQA 2FBYA 2AJQA 4HUEA 4M41A 3AA3A 3LP2A 3K5MA 4OKEA 4CFBA 4FCYA 3K5NA 1S1UA 4BWMA 4NCBA 1VSJA 3QETA 3QEXA 3ZSVA 5HRRA 1NOZA 3P83D 2X6NA 4J2AA 4IFYA 4CK1A 1Q9XA 4AHTA 2VWKA 2VG7A 1HYVA 4PA1A 3I0RA 4FM1A 1Z26A 3HJFA 3I8DA 4C8KA 3BDPA 3L3UA 4FJMA 4E7LA 2R7YA 1J5OA 1RTJA 3ZT4A 5SWMA 4HUGA 4DS5A 3WNHA 3TAPA 3MECA 1SKWA 2A1RA 1JLQA 4KTZA 4BDYA 4M3UA 4CEAA 4OKJA 3OYDA 3PV8A 3WNFA 3DRRA 2W42A 4DTOA 3QIPA 2HB5A 4KTWA 4OPKA 3NF8A 4WE1A 1S6QA 3MEDA 3M8QA 2YV0X 3IAYA 3NCIA 1RNHA 3DM2A 3LP3A 5FRNA 4BE0A 3OS0A 4ZHRA 2LSNA 3VQAA 4IKFA 4M42A 4BWJA 4FJGA 4PY5A 1EETA 2OA8A 4FW2A 3TI0A 2ETJA 4FJHA 1NKBA 2OZSA 4ZTJA 3OVNA 4N5SA 4ELVA 3I0SA 2FBVA 3V9ZA 3OS2A 4M45A 3SUQA 1ZBHA 4B9NA 1YTUA 1UA1A 2KFZA 3QEWA 4KO0A 3VQ7A 1X9MA 4CK3A 4DF8A 4E7IA 1CLQA 3L3VA 1QQCA 3EY1A 3AVFA 4M3WA 4O44A 4FLZA 3LWLA 3V1OA 1L3SA 3A2FA 1NJWA 3TARA 4G1QA 1HYSA 3VQ4A 3L2QA 1FK9A 2VWJA 1LWEA 2RF2A 4AHCA 2QKKA 2YKMA 4OLAA 3OYGA 2YHAA 3OYHA 1JLAA 3TAFA 4FZYA 4NCAA 4FM2A 3LP1A 1LWCA 4CGIA 3ZSZA 4F2RA 5I42A 4DLGA 3PO5A 3LALA 3LZIA 4BE2A 1QSLA 3HSTB 3KD1E 4FJIA 3SJJA 4GVMA 3V6DA 2ZE2A 1TAQA 1TGOA 4DQPA 1J54A 4KREA 1RTHA 1D8YA 3NFAA 1VSMA 4CK2A 3CM6A 1HQEA 3ZSYA 3L2RA 3RMDA 4RW6A 4W5RA 1GOBA 3SQ4A 4DWIA 3VQ5A 4CGJA 1ZYQA 5KGWA 5JS2A 2VG5A 1CZ9A 2WOMA 1NKCA 4O0IA 2G8KA 2A1SA 4GW6A 5KGXA 5J2MA 4BDPA 4KHSA 3P1GA 3OYIA 5C42A 1ZBLA 4KHWA 1WSHA 4OPJA 5HRPA 4CF8A 4LSLA 3AO2A 3ZT1A 4W5NA 4DFJA 1REVA 1VSHA 2GV9A 3ZSXA 4HTUA 1XHZA 1WLJA 2HNYA 3JYTA 1SL0A 3H08A 3NGIA 1JL1A 1TV6A 1HRHA 3NE6A 4LSNA 4FXDA 4FK4A 4CCHA 1TAUA 3S3NA 4DF4A 4MQ3A 1S1VA 1JLGA 3ITHA 3SQ1A 3AA2A 2KZMA 2HHQA 1RBRA 3V81A 1LV5A 3NH1A 3S9HA 4KHYA 4AHVA 1TL3A 3O4QA 1SUQA 2YNIA 2XHBA 3VA0A 5J2NA 2G8HA 4C8OA 3RRGA 2E4LA 1RBVA 1WN7A 3U3GA 3EZ5A 3AVAA 5FROA 4BACA 2XRIA 4CGHA 3U3YA 4QAGA 4FYDA 4CJWA 4AHRA 4CJEA 4ID5A 1VSKA 1VRTA 4CJLA 1KVAA 3AVIA 3ZSWA 1SL2A 3K2PA 4DSJA 3VQ9A 4M3RA 5DK5A 3F73A 4E1MA 4E19A 2ITGA 4JRPA 4F2SA 2KW4A 4CJSA 1NJXA 4W5TA 4FLTA 1YTAA 2QKBA 1BISA 3DOKA 1LW2A 3VQ8A 1VSDA 4CJVA 1TL1A 3OYEA 1RT1A 1RTDA 3S3MA 4EP4A 2IOCA 1HNVA 1WSEA 5C24A 3OYJA 1YT3A 3V9UA 1KFSA 2PYLA 4I9LA 1NK7A 3KK2A 4FLVA 4CHYA 3K5OA 1X9SA 5JS1A 3TAEA 4FK0A 1EXQA 4B9MA 4I9QA 4L8RB 4DG1A 3VA3A 4DSFA 1EP4A 1TVRA 3AVMA 3OYCA 3QESA 1L5UA 3RR7A 4B3OA 3KLGA 4FJXA 5FRMA 3V9XA 2HHUA 3PUFA 4N47A 3V1QA 3OYLA 4JS4A 2DTUA 1C0MA 3AO5A 4CJ4A 2OYQA 1QSYA 1BI4A 4Z4CA 1KRPA 4FJ7A 4FJ9A 5HBMA 2G8IA 4GMJB 4KFBA 3CFPA 3RMCA 1N6QA 4I2QA 3WNGA 4FJJA 1DTQA 4Q5VA 2PZSA 1KTQA 3HL8A 4H8KA 1CXUA 2D0AA 1J9AA 3PX6A 4FJKA 4DFPA 4HCCA 1TKZA 3M8RA 3C6TA 3L2VA 2HW3A 3HPHA 3TR8A 1S5JA 4CGDA 5HRSA 1S1TA 1GOCA 1NK0A 3CQ8A 4PWDA 2P5OA 2G8UA 5KI6A 1TK5A 4CF0A 3K57A 1HQUA 4E7JA 4FLXA 4CF2A 1VSFA 2KQ2A 1IKWA 3HP9A 3TAGA 3TAMA 4DTSA 1WSFA 4HUFA 1WNSA 2IDOA 3SUOA 1JLFA 3SV3A 1LWFA 5CYMA 4FW1A 1I3AA 2IC3A 2VG6A 3QEIA 1ASWA 3DRSA 3QIOA 3VN5A 3ZT0A 3PY8A 1NKEA 3HT3A 4B08A 3VQ6A 1RT4A 1T8EA 3HXMA 3SPZA 3D45A 4KB1A 2KTQA 3FFIA 1D5AA 1XWLA 3IRXA 3SPYA 4DSLA 4CJPA 3QO9A 2BE2A 4OGEA 2RN2A 4CFDA 4DQQA 4DU4A 2BDPA 3HK2A 3DMJA 1QE1A 2RPIA 1B9FA 4DTJA 1QS4A 4NYFA 1U49A 4EZ9A 1ASVA 3VQDA 4K8ZA 2DFHA 1SKRA 1VK0A 4F3OA 3AVJA 3DLBA 4CEQA 2OPQA 2IS3A 3LDSA 1U4BA 1IG9A 2OZMA 1ZBUA 3DOLA 1QTMA 1IH7A 3ASMA 3OS1A 3IG1A 4DFKA 4KRFA 3DLEA 4AILC 4N56A 4E0DA 4M3XA 1RDBA 3L8BA 4J2DA 4DTUA 4AHUA 1D9DA 4AHSA 3KIOA 2OPSA 3ZSRA 3MXMA 1HNIA 4KKOA 3LZJA 4KI6A 4W5OA 4KHNA 1EX4A 3AA4A 4B8CA 1RT7A 1HJRA 3CM5A 1N5YA 2XY6A 2PY5A 1JLCA 4CFCA 1C1AA 1RT6A 1S6PA 2E6MA 1S1WA 4OJRA 1IKYA 3WNEA 3HPOA 4B9UA 1G15A 1LW0A 1DTTA 4CFAA 5J2QA 3QERA 3SNNA 3UIQA 4NCGA 4M3YA 3RMAA 1RILA 4C8MA 2DFFA 4LH4A 2PYJA 3SCXA 4CEBA 4OLBA 2I5JA 4M3TA 4ZTFA 1SKSA 2Z1GA 1BGXT 4KAZA 4W5QA 2HVHA 3K58A 1L3TA 4M3ZA 3VQCA 2F8TA 3LPTA 3KLIA 4CECA 3O4NA 3L2UA 3CFRA 2KZZA 5DMRA 1XI1A 3PO4A 3B6PA 1WSIA 1L3UA 3KK1A 4TSXA 2X6SA 2OPPA 4HCBA 1Z25A 2B6AA 4CEEA 4CEZA 1CZBA 3M8PA 3MXIA 4FJ8A 5CY4A 3RMBA 4ID1A 1S9EA 4B9SA 3DYAA 5HROA 1U47A 4RG8A 4KB0A 1RDCA 4IG0A 3T1AA 5J2PA 1B9DA 2HHWA 2IAJA 3ALYA 4F8RA 1BIUA 1SL1A 4KTQA 2DFEA 3NF6A 4CHPA 3NGZA 4DSEA 4ELTA 1T03A 1S1XA 3ZT2A 1NK4A 3VQBA 2O4IA 4DU1A 1NJZA 4CGFA 1BQNA 5CZ1A 1BL3A 1BIZA 1TKDA 1BQMA 2XO7A 4Z4HA 3S3OA 1VSLA 3NH2A 3HM9A 4DTXA 1KFDA 4CHNA 1TKXA 5KRSA 3MXJA 1T05A 3HVTA 4QOZB 2HNZA 3O3GA 1KVCA 3E01A 1F21A 3DLGA 1C1CA 4C8LA 1HYZA 1VSIA 1YVUA 4DQSA 1UAXA 3LAMA 1C0UA 5HP1A 4Z4GA 4N76A 1RBUA 1U04A 5HRNA 3DRPA 3AO4A 1T7PA 4DTPA 3RRHA 3T3FA 3LPUA 4DMNA 1U45A 4F4KA 2HHSA 3AV9A 4LH5A 4CEFA 3TABA 1U48A 1TKTA 4IBNA 2BGGA 4YFUA 4Z0UA 2HHVA 4OVLA 3C95A 3O3HA 3TANA 3AO3A 4RW7A 4DU3A 1WAFA 4CJTA 3OYBA 3QLHA 4O0JA 2FBXA 3OYFA 2OPRA 2ZQBA 3LANA 4ICLA 1A5VA 1NK8A 1W9HA 4FK2A 3NDKA 4CJQA 1L3VA 4CIGA 2QK9A 3DLKA 3OYKA 1X1PA 4B9VA 4DSIA 3ZSOA 2G8WA 3M8SA 3QEPA 3LWMA 4DS4A 1ITGA 4JLHA 4CIEA 1IKXA 1JLEA 4BE1A 2B5JA 3F9KA 2Z1JA 4IG3A 4FJLA 4FLUA 3CFOA 2RKIA 5D3GA 3HVRA 5E41A 2F8SA 4UQGA 1KSPA 5FDLA 4HHTA 4DTRA 1Q8IA 4CHZA 1NJYA 3AVKA 5KTQA 4B9TA 3C6UA 1I39A 2P51A 1BCMA 4MFBA 1RT5A 1IKVA 1FKPA 1RT3A 3B6OA 3KKSA 5J1EA 1ZBIA 4IDKA 3JSMA 2G8VA 1IO2A 2YNGA 3LAKA 1RTIA 1UOCA 2O4GA 4RW8A 2JGUA 3C94A 5CYQA 4CERA 1NOYA 1QHTA 3BGRA 4RW9A 3VQQA 1C1BA 3KLHA 4KPYA 3K59A 4CEOA 4CF9A 4XIUA 3MEEA 2D0CA 3AVLA 4F3TA 3SV4A 2F96A 4FZZA 3T19A 1JXEA 2BANA 3NF7A 3AVCA 4CEDA 1RBTA 2Y1IA 2GBZA 4O4GA 4FLYA 2HHTA 3V4IA 4CJFA 3QNNA 1W0HA 2YKNA 3AA5X 3ISNC 4OGCA 4K8XA 1LAWA 4J2BA 4Z4IA 4EP5A 3HP6A 4Z4FA 4CJKA 2Z1IA 1A5XA 1VRUA
chains in the Genus database with same CATH superfamily
5LMUK 3AVNA 3CJ9A 4I7FA 1B92A 2D4WA 3THYB 1VQMN 2GX9A 3K5LA 3SQ0A 1Q9YA 4K25A 4YNQA 1W97L 2WONA 4KHUA 1H1VA 3SQ2A 3EE8A 4E7HA 2QWPA 2FBTA 4QCLA 2Y1JA 2UUAK 4CW7B 1WB9A 4JI5K 3F9MA 4NYNA 1NGAA 4MO5A 3O9UA 3OYAA 3QNOA 1RDAA 3QICA 4CGGA 4L3QA 4ISGA 4CHOA 5KRTA 4CJ7A 3ATVA 1DLOA 2A42A 2WFBA 3SK3A 4YY3K 2FC0A 4EZ6A 1FKOA 5AZIA 1C6VA 3AVHA 4DR2K 4DR6K 2E5LK 1WSGA 3QEVA 2NUBA 1JCFA 2IVPA 2Q0UA 3O3FA 5C0YA 1NK6A 2JLEA 1TYQB 5EOYA 5A2QO 2KLAA 3HO1A 3J80O 2HF4A 2ZJRL 2RE2A 2HMIA 2NLXA 2ATQA 2DY4A 3THVA 5AQNA 1MU2A 3PIPL 3DLHA 1Y97A 2P1JA 4DQRA 4H0OA 3AVGA 1JKHA 4CJUA 4DTMA 1ASUA 2ASOA 5I3UA 3KTQA 4JI3K 2NRHA 5C12A 5AFUH 2P9SA 2HVIA 4AQYK 2YNHA 3D0PA 2O8EA 2QWQA 2ZGZA 5AQVA 4CZJA 3IMXA 4C8NA 1DEJA 4DR3K 3H1VX 3NF9A 4BRMA 4H4OA 1N33K 5HLFA 3VTIA 2GUIA 3CCLN 5EX5A 2GUPA 4B1XB 3IDHA 3U6FA 3ZT3A 1WSJA 3T1YK 4DV1K 3V1RA 2W6LA 3LP2A 2YCHA 4H0TB 4FCYA 3QETA 2QWMA 4OPAA 1NMDA 4H0XB 4IEEA 4B1UB 3O1BA 4AM6A 2HF3A 4PA1A 3I0RA 4C8KA 4FJMA 3ZX2A 4MLEA 2R7YA 3ZT4A 3OW2M 3BP8A 4M3UA 3WEEA 3DRRA 4J8FA 5BR9A 2YHXA 3OS0A 4ZHRA 2HHHK 3VQAA 3K9JA 1Q7YO 2OA8A 4JKGA 2OZSA 4XEIA 3OS2A 1YTUA 3QEWA 1RDWX 1QZ5A 4CK3A 4DF8A 4A5AA 2QWRA 5M1OA 4LF8K 4M3WA 4FLZA 3LWLA 3V1OA 2FF6A 4G1QA 1HYSA 4BR7A 1FK9A 1X3MA 4RTFD 4FWQA 4FZYA 2YHAA 3OYHA 3WXMB 4CGIA 5I42A 3LALA 4BE2A 1QSLA 4GVMA 1VQPN 5JLFA 1D8YA 4BC4A 3NFAA 1W2BM 1HQEA 3C65A 3ZSYA 3L2RA 3O80A 1GOBA 3SQ4A 4DWIA 3VQ5A 3VERA 1ZYQA 5KGWA 5JS2A 2VG5A 1CZ9A 3O8MA 1NKCA 3VF2A 4GW6A 5J2MA 1EWQA 5C42A 3KZBA 4W5NA 3ZT1A 1XHZA 1REVA 1VSHA 2PBDA 4HTUA 3KWGA 1SL0A 3JYTA 3H08A 1N36K 3BY5A 2HBMA 4FXDA 4FK4A 4DF4A 2QWOA 3ITHA 2HHQA 3V81A 3GE1A 3M6GA 1LV5A 3A5NC 4AHVA 3O4QA 1SUQA 3VA0A 4C8OA 1RBVA 1WN7A 3EZ5A 4DR1K 4B1WB 5FROA 4BACA 4CGHA 4QAGA 3J81O 4B1YB 4CJKA 3G25A 3MWTA 5AQGA 2VQFK 3VEYA 3D2FB 3CMEN 4FLTA 1BISA 3DOKA 5HL7L 1BA0A 3CQXA 3G6EN 1QQNA 1RT1A 5GINA 4JNEA 1WSEA 4JK9A 1OH7A 5F2RA 4FWPA 5JS1A 3K5OA 1X9SA 3TAEA 4FK0A 1EXQA 3Q7BA 2UXDK 4L8RB 4A57A 2CGLA 1RFQA 2GTDA 3QESA 3VF6A 2A6AA 4C1NI 4N47A 2DTUA 3AO5A 1NGCA 2OYQA 2E2OA 1BI4A 3QBXA 3R3LA 4Z4CA 4FJ7A 4FJ9A 3RMCA 1N6QA 1I94K 2D1KA 1CXUA 5AQYA 3WUHA 3M8RA 3C6TA 3ZETA 2KHOA 3BUZB 3TR8A 1T44A 4HTLA 4LFCK 2O8CB 3CQ8A 2P5OA 2G8UA 5KI6A 1TK5A 4CF0A 3CCQN 1HQUA 2HBJA 3M3ZA 3TAGA 1YVNA 2QEXN 4HUFA 2IDOA 4JEPA 2JWKA 5AQUA 4H0YB 5CYMA 4FW1A 3DRSA 4BC3A 1RGIA 3LL3A 1RT4A 5AQRA 5TKYA 3HXMA 3SPZA 1ATSA 3QO9A 4DQQA 2RN2A 2RPIA 1OH5A 4B3TK 5C15A 3QFUA 1ASVA 4K8ZA 2DFHA 1SKRA 3MN9A 3VF4A 3PSIA 1D4XA 4DR5K 2IS3A 3LDSA 1U4BA 1IG9A 5AZIB 1ZBUA 1YUWA 2YHWA 3DOLA 5BRFA 1QTMA 4AILC 5C2FA 3UKUA 4YOVA 4N56A 4AHUA 3ZEUA 3FR0A 4AHSA 3B8AX 1D9DA 3MXMA 3LZJA 2DPNA 4W5OA 1KAYA 3I8BA 3CM5A 1C1AA 1RT6A 1S6PA 4JKEA 3WNEA 3QERA 1FW6A 1T6CA 3IKMA 4NCGA 1GLAG 2P9UA 3CI5A 4C8MA 1YJ9N 2P9SB 1BGXT 4W5QA 2O8EB 4M3ZA 4IOXA 3VQCA 2KZZA 4IWVA 3CFRA 4O5FA 3CC2N 3B6PA 4FPAA 3FGUA 1IJJA 3TSQA 4CEEA 4CEZA 2UYTA 3MXIA 1S9EA 4DV7K 2ZWHA 4RG8A 1OKJA 3T1AA 5J2PA 1B9DA 4JKCA 2WBNA 1SL1A 4ELTA 1T03A 2P9NA 1NK4A 2YHYA 3VQBA 3O08A 2V7ZA 2IVOA 1SAZA 4DU1A 1NJZA 5FPNA 1BIZA 3CJBA 1BQMA 4XH5A 1Q86O 4Z4HA 4DTXA 2A41A 2BH1A 5AQLA 3O3GA 1KVCA 3FZFA 4XH4A 3DLGA 4QS8A 1LCUA 1C0UA 4N76A 3AO4A 3WEEB 4YOYA 2IIRA 4JN4A 3AO3A 4RW7A 3QLHA 2ZQBA 3LANA 3T69A 4JKGB 3NDKA 4CJQA 1L3VA 3G71N 1X1PA 3AY9A 3ZSOA 3M8SA 2G8WA 2FSKA 4DS4A 2BUPA 4A5BA 4WF9L 3F9KA 2Z1JA 5AJ3K 3CFOA 4IXCA 2RKIA 3ID8A 3U4LA 3P38A 2F8SA 2PFUA 1KSPA 4HHTA 4FWSA 2QTDA 1NJYA 3AVKA 3KKSA 1IKVA 2GWKA 4IDKA 4A2AA 4JK7A 5KPTA 3VPZA 2O4GA 4IOCL 2JGUA 5CYQA 4CERA 1QHAA 3VQQA 1C1BA 4CF9A 1BWFO 2E2NA 3UE5A 3HTVA 4F3TA 3SV4A 3VEXA 4NB4A 3FE1A 2Q31A 3NF7A 1RBTA 3UKRA 4FOIA 1BDGA 2E88A 4EP5A 2ZJQL 3THXA 2WC9A 2Z1IA 3A8YA 1KLMA 5AFUA 1ZBFA 1ZC6A 3MEGA 4CJ3A 3O9SA 3OJSA 3NH0A 1GOAA 4PL7A 1QSSA 1V4TA 1JL2A 2PAVA 1BHLA 2HNDA 1MDUB 3P5JA 4HVJA 3EYZA 3SAFA 3V9SA 2G8FA 4LY7A 3IS9A 3SUNA 1KAZA 4IFVA 2FF3B 3NBPA 4EHTA 1HKGA 4Q0BA 1HMVA 3WXJA 2NRTA 5ADXA 1LAVA 2H3GX 3IFRA 4FWOA 4GV6A 3KD5E 3GOIA 3OJUA 3NHGA 4O55A 3ULDA 4LD0A 4FLWA 1R0AA 4PQUA 4U67L 4E7KA 3VEWA 1KCFA 3AO1A 4H5RA 4ELUA 4E89A 4B9LA 1NG9A 3VGMA 1JLBA 2EHGA 4Y1CA 4CJ5A 1XMQK 3NAEA 3MAQA 1RDDA 1MWKA 1NGBA 1BI4B 1KXPA 1YIJN 2EWSA 3PX4A 1X3NA 5AQIA 1SS6A 5EVZA 2ZGYA 4DSKA 1GLJO 3ZETB 1VQLN 3DLRA 4H03B 3CYMA 2E6LA 4PKGA 1ATNA 2CH6A 4O5BA 4BDZA 3M1FA 3CC7N 2IGIA 1UA0A 1TK8A 3DWLA 1X9JA 3OY9A 3NGYA 3DI6A 1NGIA 3SYZA 1XC9A 1D9FA 1C0TA 1IG8A 1G99A 2QXFA 3K9KA 4CJRA 4J2EA 4H5TA 4H4MA 2Z1HA 3OA9A 4I2PA 5M1KA 3HYFA 4A61A 4PUOA 4DTNA 3TAQA 2AJQA 4M41A 3WXKA 3SMSA 4OKEA 4CFBA 4BQZA 1VQ7N 3CCRN 1VSJA 3NMUA 5HRRA 3P83D 4J2AA 4IFYA 4FPBA 2VG7A 3HJFA 1Z26A 3BDPA 1HLUA 4E7LA 1J5OA 4HUGA 3U9ZA 3TAPA 1E4GT 2Q36A 3MECA 1JLQA 5AQFA 2A1RA 3HBTA 3UKUB 4B9QA 3PV8A 3WNFA 4BREA 2W42A 3ZEUB 4FL9A 3SAHA 4X65K 2QI2A 4AM7A 3IAYA 5AQWA 5FRNA 3I56N 3A5OC 4M42A 1EETA 4DR7K 4ZTJA 4N5SA 3I0SA 3V9ZA 3SUQA 1HX1A 2P9UB 1ZBHA 4WCEL 2KFZA 3MX5A 4E7IA 4PKIA 1NJIO 1QQCA 3CD6N 3EY1A 3AVFA 1L3SA 1NJWA 3TARA 1HNXK 1YHQN 4KH4A 4LF4K 4AHCA 3E9OA 4F9OA 2Q2RA 1JLAA 4NCAA 4B1ZA 3LP1A 1Q81O 3ENBA 3V6DA 3C6AA 1TGOA 4DQPA 4BR9A 2P9NB 2QWNA 4CK2A 4FSVA 5BRHA 4W5RA 1V4SA 3PSFA 3I55N 4O0IA 5B8HA 1R59O 5KGXA 5IWAK 1P8ZA 4JI4K 4B3RK 3WT0A 1GLDG 4YORA 1HRHA 3NE6A 4LSNA 3A5MC 3FZKA 1TAUA 4YOUA 4MQ3A 1JLGA 3AAQA 2VCPA 4DV4K 3S9HA 1TL3A 2XHBA 1BOTO 2G8HA 3RRGA 3U3GA 1M1KO 3O9TA 2XRIA 3U3YA 1Y64A 5I9EB 4ID5A 1VSKA 4CJLA 2ASMA 3K2PA 3VQ9A 3F73A 2OANA 4CJSA 2QKBA 3DXMB 1EWRA 3VQ8A 4CJVA 3VGKA 3S3MA 3D2EB 5EXWA 2IOCA 3OYJA 1KFSA 2PYLA 4I9LA 4ILGB 4I9QA 4YDUA 2AA4A 3VA3A 3SBTA 2V7YA 3W0LA 4FJXA 5FRMA 2ZM6K 1C0MA 1VQ5N 3ID6A 2G8IA 1J6ZA 3MWPA 3EKUA 1DTQA 3P4IA 4Q5VA 2I7NA 1KTQA 4H8KA 2PZSA 3CIPA 3PX6A 1KD1O 3UKRB 3ATUA 2HW3A 3L2VA 3L6QA 1XUPO 1NK0A 3THXB 3K57A 4AF1A 4Z94A 2OCEA 2HBKA 4FLXA 2KQ2A 1IKWA 3HP9A 1WSFA 3TPQA 3SV3A 1LOTB 5F0XA 4NLBA 3QEIA 3QIOA 3ZT0A 3PY8A 4B08A 4LF6K 1N34K 3FFIA 1D5AA 3SPYA 4DSLA 2VGNA 4CFDA 3J7YP 5GAEP 4DU4A 4ISEA 2BDPA 3HK2A 3DMJA 4BQLA 4EZ9A 1QS4A 4YOXA 1GLEG 1VK0A 4GV3A 3AVJA 4EHUA 4RCHA 4CEQA 4C23A 1BO5O 4LF9K 3OS1A 2D0PA 3IG1A 4JI7K 3DLEA 4M63C 4M3XA 2QW9A 2A40A 3ZSRA 4KI6A 1QVFM 1O13A 4KHNA 4CBXA 1EX4A 1RT7A 1HPMA 1J5EK 2CGJA 4FVUA 4FJ8A 3HPOA 4JKBA 1G15A 1XNQK 3SNNA 3A5LC 4DV5K 5JVHL 4JHDA 2DFFA 4CVNE 1NMNA 4K0KK 4WQ5A 4NXMK 4M3TA 2FLOA 3RSEA 4KAZA 5KPRA 2HVHA 3QMLA 1L3TA 3VEZA 4CECA 3PO4A 1L3UA 3R6MA 3KK1A 4TSXA 2OPPA 2QXLA 3R1XA 4HCBA 2B6AA 1GLBG 3LDOA 1CZBA 1NM1A 3RMBA 1C0FA 5BPNA 5HROA 1U47A 4KB0A 4LF7K 1U2VA 2VWBA 2IAJA 4KTQA 2DFEA 4CHPA 3NGZA 4IFEA 4ILJA 4DSEA 1S1XA 3ZT2A 4CZHA 3UB5A 2O4IA 1BL3A 1VSLA 4GVEA 1YXQA 1C1CA 4C8LA 1VSIA 1UAXA 4B3SK 5HP1A 4Z4GA 1OH6A 5HRNA 3LDNA 5BRDA 1T7PA 3T3FA 2HHSA 1BG3A 3LPUA 1U45A 4LH5A 4CEFA 3TABA 4IO8A 1KAXA 1U48A 4IBNA 2BTFA 3QDKA 4Z0UA 2HHVA 1TUUA 1NGDA 3TANA 5EY4A 2IVNA 1A5VA 1NK8A 1W9HA 4YHHK 4A2BA 2E2QA 3G4SN 2QK9A 3MX2A 4DSIA 4BVPA 3CPEA 1JLEA 1C0GA 2WUSA 3MMVA 3N4PA 5D3GA 3HVRA 3ULEA 2YJFA 4CZIA 5FDLA 4DTRA 1Q8IA 3WXLA 3LDQA 4B9TA 1I39A 3HRGA 1RT5A 3W3DA 5J1EA 3VGLA 3P39A 4G9ZA 1UOCA 4DCHA 5AZJA 3C94A 5LJWA 1QHTA 3BGRA 4RW9A 3JS6A 3K59A 2Q0RA 3WQUA 3BZCA 3T19A 1JXEA 4KH5A 4WQ5C 3PIOL 2Y1IA 3V4IA 4CJFA 4K8XA 3ISNC 4Z4IA 1YJNN 4DB3A 1VRUA 3CG7A 2X74A 2HMPA 4LF5K 2F9WA 3C6HA 1JXBA 1K6YA 4IJNA 3L0QA 4CIFA 3T1HK 4K43A 4WQ4A 2P5GA 3L2WA 3O1WA 3KKRA 2ZJPL 2KKZA 4KI4A 3GG4A 4BR5A 3LP0A 2HOEA 4CE9A 4AH9A 5K14A 4FJ5A 3LM2A 1BCOA 2D0BA 3VESA 3VQPA 2E8AA 2X78A 4CF1A 1W7AA 5CZ2A 2XY8A 3PX0A 3G10A 3GL1A 1HPZA 3SZ2A 3KLEA 1S9GA 3CCMN 2ZD1A 3OYMA 3SUPA 4DQIA 4BGAA 1EKEA 4X64K 5C25A 5SZTA 3IUCA 4Z4EA 1KVBA 2B4JA 5FPMA 3TWHA 3RR8A 2YX6A 2J4RA 3VQEA 4LC9B 4A59A 1RCHA 3THWA 1MA9B 3KJVA 4N41A 3QB0A 1ILYA 2EX3A 3OYNA 2XY5A 4CHQA 5EU7A 4KBOA 4K42A 3K0SA 1RBSA 4R5PA 3HOTA 1E4FT 2KFNA 3J7ZO 2YNFA 5IT9O 3HPGA 5C2DA 5C10A 4OPHA 4FJNA 3H45C 3AA3A 3K5MA 4H5WA 4JKHA 3TTFA 1S1UA 4BWMA 4NCBA 3QEXA 3DXMA 1NOZA 3EEQA 2X6NA 3TSPA 4CK1A 1Z05A 4RWTA 3D2EA 3CHWA 4DV0K 2NRZA 4A62A 4DHYA 5DM7L 4JKAA 4R79A 1RTJA 4EFHA 5SWMA 3CCVN 1SKWA 3OBWA 4YOTA 5JICA 4BRFA 4KTZA 4OKJA 3OYDA 3QIPA 4DUZK 4QS7A 2HB5A 4OPKA 4WE1A 1S6QA 3MEDA 3M8QA 1IBMK 3NCIA 1RNHA 3LP3A 4BE0A 4BWJA 4FJGA 4FW2A 2ETJA 1NKBA 2FBVA 4JHDB 1UA1A 4H0VB 1JCGA 4KO0A 1XQSC 5H1SQ 1CLQA 3O5BA 4CZLA 5AQJA 3RSEB 2F7TA 3BF3A 3SBGA 4CD3A 4NO7A 4O8KA 3A2FA 2W40A 3L2QA 2O8FA 2YJEA 4IOAL 2W6KA 2RF2A 1YJWN 4JI0K 2QKKA 2YKMA 4OLAA 3TAFA 4FM2A 1LWCA 5DM6L 4DLGA 3PO5A 1U2VB 3HSTB 5LY3A 3SJJA 1VQNN 2Q97A 2ZE2A 4PL8A 1TAQA 2FSJA 4KREA 1RTHA 4NXNK 1GLFO 3AGRA 3P1GA 1ZBLA 1QQMA 1WSHA 4CF8A 1HJOA 4DFJA 3ZSXA 3D6RA 1WLJA 2HNYA 3CJCA 5CHIA 3NGIA 1JL1A 1TV6A 1ZXOA 3FFKB 3MN7A 4CCHA 3DXKB 3S3NA 3SQ1A 4LFBK 2KZMA 2F9TA 5LL6Z 3NH1A 4BRNA 4JD2A 2YNIA 5J2NA 5TKWA 2E4LA 3AVAA 3P31A 4FYDA 4FO0A 4CJWA 3WQTA 4BRIA 1ATRA 4CJEA 1KVAA 1SQKA 3AVIA 3ZSWA 1SL2A 5DK5A 2ZF5O 5JMVA 4JRPA 4JAXA 5LJVA 4F2SA 2FXUA 3ULEB 3OYEA 2HSTA 4EP4A 1YT3A 2NRXA 4FLVA 4CHYA 5GADP 4B9MA 4DG1A 3AVMA 1L5UA 2HHUA 4KH6A 3NVMA 3OYLA 4JS4A 4HWIA 5AZJB 4BRQA 4CJ4A 5F1XA 1QSYA 3EZWA 3HM8A 3LM9A 1KRPA 1DGKN 5HBMA 1K8AO 4KFBA 3CFPA 4FWMA 4I2QA 3S41A 3WNGA 2NRRA 4FJKA 3MCPA 1VQ8N 2NNWA 4CBUA 4FWLA 3MK6A 3MN5A 1WUAA 3HPHA 1S5JA 5HRSA 1S1TA 4PWDA 1YAGA 4BR0A 4C1NK 4DV6K 1VSFA 1YF5L 4DTSA 5AQOA 1LWFA 3FZLA 1I3AA 2VG6A 4DQ8A 1ASWA 3QFPA 4CBWA 3Q7CA 3VQ6A 1T8EA 3CJAA 3EN9A 4KB1A 1XWLA 3IRXA 4CJPA 4OGEA 2BE2A 3CMAN 4K41A 4DTJA 5JLHA 1B9FA 1U49A 5HOOA 2QWLA 3OHRA 1BA1A 1HKCA 4BRGA 4B1VA 4F3OA 3KK7A 3DLBA 3AARA 2OZMA 3ZYYX 4X66K 1IH7A 5FPEA 3CETA 2NRVA 4DUYK 4E0DA 1RDBA 2HBLA 4J2DA 4DTUA 3ZX0A 2OPSA 2O8BA 1HNIA 3F5TA 1KC8O 4B8CA 1N5YA 3BF1A 1JLCA 4B9UA 1IKYA 3FZHA 1LW0A 1DTTA 3EL2A 3RMAA 4OO1J 1RILA 4I6MA 3SCXA 2UXCK 4OLBA 1NWKA 3T7ZA 3THWB 2I5JA 3A0IX 3VMFB 2F8TA 1QZ6A 3LPTA 5M1QA 3J7AP 5DMRA 1XI1A 4BR4A 1WSIA 2GWJA 2X6SA 3TTCA 3C7NA 4CZMA 5CY4A 2AP1A 3JAMO 3DYAA 1RDCA 4IG0A 1OVYA 3ALYA 4F8RA 1BIUA 4UY8O 3NF6A 3MCAB 4JI1K 2YI1A 3CPWM 1TKDA 5CZ1A 1VQKN 2XO7A 3ZLJA 2E1YA 4QOZB 1NNEA 5KRSA 1T05A 1TKXA 2HNZA 1F21A 1Q82O 1HUXA 1HYZA 4DQSA 2RHKA 3LAMA 1U04A 2E2PA 3RRHA 4DMNA 1S22A 4OVLA 5FPDA 4CZGA 2V51B 3O3HA 3TU5A 4BVOA 4CJTA 3OYBA 2FBXA 3OYFA 4PHTX 4QS9A 2OTJN 4WYBA 2NRWA 1FJGK 3ZX3A 1QVGM 3O9RA 1OVQA 4CIGA 4B9VA 3F2KA 2P9LA 3N4QA 5ADXH 4BG9A 4BE1A 1GLCG 4H5VA 4B3MK 4UQGA 4CI6A 5BPLA 1JCEA 3I33A 2O8FB 3GBTA 5KTQA 2VQEK 1FKPA 1ZBIA 1T3VA 2A3ZA 3OBYA 3JSMA 4XH1A 1XMOK 2YNGA 3LAKA 2W41A 3VENA 4BC5A 1NOYA 4JI2K 3KLHA 4KPYA 4CEOA 4XIUA 3DAWA 2ASPA 4FZZA 4E1JA 3AVCA 2GBZA 4O4GA 1E3MA 3QNNA 1NBWA 2YKNA 4J2BA 1LAWA 3E66A 4Z4FA 4ILHA 2I7PA 1NK9A 1MWMA 3CXCM 3RTVA 3ENOA 1SV5A 2XY7A 1EO1A 1CXQA 4B8AB 4FM0A 4MDAA 1J53A 5KPZA 4DFMA 1VSEA 4JD2B 4MLHA 3ZCMA 1HKBA 3CJ1A 4BRLA 3EE9A 4CESA 1VQ4N 4KHQA 3V9WA 5KQ8A 1TK0A 1FXXA 3QINA 3H3OB 4IO9L 1X9WA 2HHXA 4JRQA 1WAJA 1NGFA 4YDUC 4BG8A 1XHXA 3HI0A 5AQMA 1KQSM 3SJHA 3ZSQA 2P9PA 1NK5A 4FWNA 1WBDA 4E3SA 1HNZK 1KLNA 2GELA 4O8UA 5E84A 5T7BA 1A5WA 2P9KB 4U7BA 1NGJA 1K8KA 4E1NA 2E1ZA 4LFAK 4BROA 4YOWA 3CCUN 3KHYA 3AVBA 1RT2A 4RW4A 4OKKA 4BGBA 1N32K 3R8EA 3SI6A 4Y1DA 2UUCK 5AR0A 3CCJN 1U6ZA 2Q3SA 2YHBA 4EIAA 1BUPA 3KK3A 1O1WA 4V19S 3DXKA 4DV2K 1T6DA 2V52B 4BRKA 3G0ZA 1UWBA 4FVMA 4KV8A 4DLEA 2D5RA 4JS5A 3KLFA 2UU9K 3RWUA 3TTDA 1K73O 4BRDA 4GKKK 4FZXC 2FBYA 4HUEA 2O8DA 5BPMA 1XC3A 3K5NA 3H46O 3ZSVA 4JI6K 1NLVA 3VEOA 1Q9XA 5AQSA 4AHTA 2VWKA 1HYVA 3VETA 4JKFA 4FM1A 3I8DA 1RDUA 3L3UA 4DS5A 3WNHA 3VOVA 1NGEA 4BRHA 4BDYA 4CEAA 3E9LA 3U9DA 1NU0A 4DTOA 1S3XA 1M90O 4KTWA 2O8BB 3NF8A 3DLLL 2YV0X 4JK8A 3SAGA 1NGHA 1WOQA 3DM2A 5AQXA 2LSNA 4IKFA 4PY5A 3TI0A 4JYAK 4JV5K 4FJHA 3EO3A 3OVNA 4ELVA 4M45A 5JVGL 4B9NA 4I6MB 3VQ7A 1X9MA 1WBBA 4GV9A 3L3VA 5CR4A 2Q1NA 4O44A 3DJCA 4BRPA 4WFNL 1IV0A 2P9IA 3VQ4A 3FLCO 5AQHA 2GEMA 4WFBL 2VYPA 2VWJA 1LWEA 4ISFA 3C7NB 3OYGA 4FWKA 3KWIA 3ZSZA 4F2RA 4FJIA 3LZIA 1XNRK 3KD1E 1QQOA 1K9MO 1J54A 5GIOA 1VSMA 5GAHP 3CM6A 2QM1A 3RMDA 4FWRA 4RW6A 4CGJA 1VAZA 2WOMA 2G8KA 2A1SA 4BDPA 4KHSA 4KHWA 3OYIA 4OPJA 5HRPA 4LSLA 3AO2A 3C0BA 3QBWA 2GV9A 5MLCQ 4IDHA 3AAPA 2D0OA 5AQPA 3THYA 1VQ9N 4BRAA 3CC4N 1VHXA 1HNWK 1S1VA 3AA2A 1RBRA 1TUYA 1JJ2M 5BN9A 4KHYA 4BR2A 5GIPA 3CQYA 5AQKA 1Z6RA 2QA4N 4AHRA 3R9PA 1VRTA 4FOEA 2P9LB 3M5RA 4DSJA 4M3RA 4E1MA 4E19A 2ITGA 2KW4A 1NJXA 4W5TA 1YTAA 3HSCA 3E1YA 3H6EA 1LW2A 1VSDA 1TL1A 1RTDA 2E20A 3CF5L 3V9UA 1HNVA 5C24A 3H3NO 1NK7A 3KK2A 4DSFA 4DV3K 1EP4A 1TVRA 2KTQA 3OYCA 3RR7A 4B3OA 1TYQA 5AQTA 3KLGA 3V9XA 3PUFA 2OTLN 3V1QA 1N8RO 3O4WA 4BC2A 4GMJB 4FJJA 3HL8A 2D0AA 3BZKA 1J9AA 4DFPA 4HCCA 4DKWA 3MDQA 1TKZA 3LDLA 4CGDA 1GOCA 1YITN 1BU6O 2FSNA 3CJ7A 4WQ4C 4E7JA 2F4VK 1VQON 2UUBK 4CF2A 4IJAA 5ELZA 1ZBSA 3TAMA 3SUOA 1WNSA 1JLFA 2ITMA 2IC3A 4CD1A 3JXUA 3VN5A 3D7EO 1NKEA 3HT3A 3FZMA 1S72N 3VTHA 3PLAA 3D45A 2UXBK 1SZ2A 1QE1A 4NYFA 5KQDA 5AQZA 3VEVA 3O6WA 3EKSA 3VQDA 3TSUA 4X62K 3AGKA 1IBLK 3SLCA 2OPQA 2P9PB 4GY2B 3ASMA 4DFKA 4KRFA 3CERA 3L8BA 5FLXO 4GKJK 1K8KB 3KIOA 1CZAN 4KKOA 1GLLO 5M1PA 3AA4A 3HZ6A 1HJRA 2NZTA 2XY6A 5BN8A 1EQYA 2PY5A 4CFCA 5M1FA 2E6MA 4H0PA 4OJRA 1S1WA 5J2QA 4CFAA 1DT9A 3UIQA 4PKHA 4M3YA 4LH4A 4CZFA 2PYJA 4CEBA 3J8AA 4OX9K 4ZTFA 1SKSA 2Z1GA 3K58A 2JWLA 3OTOK 3KLIA 3L2UA 3O4NA 3ENHA 1Q18A 3LDPA 5E26A 1IBKK 1Z25A 3M8PA 3CCEN 1OH8A 4ID1A 4B9SA 1P90A 1NGGA 2HHWA 4IZ9A 4WFAL 3L4IA 2O8DB 2VGMA 5GAGP 3CCSN 4CGFA 1BQNA 5AQQA 3S3OA 3NH2A 3HM9A 1KFDA 4CHNA 2CGKA 4CZKA 3MXJA 3HVTA 4GNIA 3E01A 3E9PA 1YVUA 4IEIA 5BREA 2P9KA 3HOSA 1RBUA 1VQ6N 4NLCA 3DRPA 4DR4K 3SMPA 4DTPA 4F4KA 2CH5A 3AV9A 4KHPK 4JI8K 3MN6A 1TKTA 2BGGA 4YFUA 3C95A 4DU3A 1WAFA 4O0JA 5BR8K 2OPRA 4ICLA 4FK2A 3L4QA 1HR0K 3KVGA 3DLKA 3OYKA 3U8XA 3QEPA 3LWMA 4MDBA 4CZEA 1ITGA 4JLHA 4CIEA 1IKXA 1ESVA 3D2FA 4IG3A 2B5JA 4FJLA 4FLUA 3H1QA 1DKGD 5E41A 4BRCA 2P9IB 5M1NA 4CHZA 4H5NA 2A5XA 3C6UA 4MFBA 2P51A 1BCMA 3B6OA 1RT3A 4BY9C 3O9QA 2G8VA 1IO2A 5CE3A 4M7XA 1YI2N 1RTIA 2WTUA 5LMNK 4MO4A 4RW8A 3NVKA 3MEEA 3WXIA 2D0CA 3AVLA 3GDQA 2F96A 4Y0WA 2BANA 4CEDA 2HHTA 4M7YA 4FLYA 1W0HA 3AA5X 4JKDA 4OGCA 3RVCA 2O8CA 3HP6A 4EAHD 1A5XA 3BEXA
chains in the Genus database with same CATH topology
1KLMA 1ZBFA 3CG7A 3MEGA 3AVNA 4CJ3A 3OJSA 4I7FA 2X74A 3NH0A 1NK9A 3RTVA 1GOAA 1B92A 1SV5A 1QSSA 3K5LA 3SQ0A 1JL2A 2XY7A 1JXBA 1Q9YA 1CXQA 1BHLA 2HNDA 4B8AB 1K6YA 4YNQA 4FM0A 1J53A 2WONA 3P5JA 4KHUA 4HVJA 4CIFA 4DFMA 3EYZA 3SQ2A 2P5GA 4E7HA 1VSEA 2FBTA 3L2WA 3V9SA 4QCLA 2G8FA 2Y1JA 3KKRA 4LY7A 3ZCMA 3IS9A 4CESA 3SUNA 4KHQA 3V9WA 4IFVA 1TK0A 1FXXA 3NBPA 3QINA 4KI4A 4NYNA 4Q0BA 1HMVA 1X9WA 1LAVA 2HHXA 3OYAA 3LP0A 1RDAA 3QNOA 4CE9A 4AH9A 4CGGA 4JRQA 3KD5E 4CHOA 3OJUA 5K14A 3NHGA 4O55A 5KRTA 4FJ5A 1BCOA 1WAJA 2D0BA 3ULDA 1DLOA 4LD0A 4FLWA 1R0AA 4PQUA 1XHXA 2FC0A 3VQPA 4EZ6A 4E7KA 1FKOA 3ZSQA 1KCFA 1C6VA 2X78A 3AVHA 3AO1A 5CZ2A 2XY8A 4CF1A 3PX0A 1NK5A 3G10A 4ELUA 1WSGA 3QEVA 2NUBA 1HPZA 3SZ2A 4E3SA 3KLEA 1S9GA 1KLNA 4E89A 4B9LA 5T7BA 3O3FA 1A5WA 1NK6A 2JLEA 1JLBA 2EHGA 4Y1CA 4CJ5A 2ZD1A 4E1NA 3NAEA 3HO1A 3MAQA 3OYMA 3SUPA 1RDDA 4DQIA 2HMIA 1BI4B 1EKEA 2ATQA 5C25A 3PX4A 3THVA 5SZTA 2DY4A 1MU2A 3DLHA 1Y97A 3AVBA 1RT2A 2P1JA 4OKKA 4RW4A 4Z4EA 1KVBA 2B4JA 3TWHA 4DQRA 3SI6A 3RR8A 3AVGA 4DSKA 4Y1DA 1JKHA 3VQEA 4CJUA 4DTMA 1ASUA 5I3UA 3KTQA 2Q3SA 2YHBA 1RCHA 3DLRA 3KK3A 3CYMA 1O1WA 2E6LA 2HVIA 3KJVA 4BDZA 4O5BA 4N41A 2EX3A 3OYNA 2YNHA 3D0PA 2XY5A 4CHQA 5EU7A 3G0ZA 1RBSA 2IGIA 4R5PA 1UA0A 1TK8A 2KFNA 1UWBA 4FVMA 4KV8A 4C8NA 2D5RA 4JS5A 3OY9A 4DLEA 3NGYA 3DI6A 3KLFA 3NF9A 3RWUA 4H4OA 3SYZA 5HLFA 2YNFA 2GUIA 1XC9A 1D9FA 1C0TA 3HPGA 2QXFA 4CJRA 4J2EA 3U6FA 4FZXC 3ZT3A 4H4MA 2Z1HA 4I2PA 1WSJA 4FJNA 3HYFA 3V1RA 4PUOA 4DTNA 3TAQA 2FBYA 2AJQA 4HUEA 4M41A 3AA3A 3LP2A 3K5MA 4OKEA 4CFBA 4FCYA 3K5NA 1S1UA 4BWMA 4NCBA 1VSJA 3QETA 3QEXA 3ZSVA 5HRRA 1NOZA 3P83D 2X6NA 4J2AA 4IFYA 4CK1A 1Q9XA 4AHTA 2VWKA 2VG7A 1HYVA 4PA1A 3I0RA 4FM1A 1Z26A 3HJFA 3I8DA 4C8KA 3BDPA 3L3UA 4FJMA 4E7LA 2R7YA 1J5OA 1RTJA 3ZT4A 5SWMA 4HUGA 4DS5A 3WNHA 3TAPA 3MECA 1SKWA 2A1RA 1JLQA 4KTZA 4BDYA 4M3UA 4CEAA 4OKJA 3OYDA 3PV8A 3WNFA 3DRRA 2W42A 4DTOA 3QIPA 2HB5A 4KTWA 4OPKA 3NF8A 4WE1A 1S6QA 3MEDA 3M8QA 2YV0X 3IAYA 3NCIA 1RNHA 3DM2A 3LP3A 5FRNA 4BE0A 3OS0A 4ZHRA 2LSNA 3VQAA 4IKFA 4M42A 4BWJA 4FJGA 4PY5A 1EETA 2OA8A 4FW2A 3TI0A 2ETJA 4FJHA 1NKBA 2OZSA 4ZTJA 3OVNA 4N5SA 4ELVA 3I0SA 2FBVA 3V9ZA 3OS2A 4M45A 3SUQA 1ZBHA 4B9NA 1YTUA 1UA1A 2KFZA 3QEWA 4KO0A 3VQ7A 1X9MA 4CK3A 4DF8A 4E7IA 1CLQA 3L3VA 1QQCA 3EY1A 3AVFA 4M3WA 4O44A 4FLZA 3LWLA 3V1OA 1L3SA 3A2FA 1NJWA 3TARA 4G1QA 1HYSA 3VQ4A 3L2QA 1FK9A 2VWJA 1LWEA 2RF2A 4AHCA 2QKKA 2YKMA 4OLAA 3OYGA 2YHAA 3OYHA 1JLAA 3TAFA 4FZYA 4NCAA 4FM2A 3LP1A 1LWCA 4CGIA 3ZSZA 4F2RA 5I42A 4DLGA 3PO5A 3LALA 3LZIA 4BE2A 1QSLA 3HSTB 3KD1E 4FJIA 3SJJA 4GVMA 3V6DA 2ZE2A 1TAQA 1TGOA 4DQPA 1J54A 4KREA 1RTHA 1D8YA 3NFAA 1VSMA 4CK2A 3CM6A 1HQEA 3ZSYA 3L2RA 3RMDA 4RW6A 4W5RA 1GOBA 3SQ4A 4DWIA 3VQ5A 4CGJA 1ZYQA 5KGWA 5JS2A 2VG5A 1CZ9A 2WOMA 1NKCA 4O0IA 2G8KA 2A1SA 4GW6A 5KGXA 5J2MA 4BDPA 4KHSA 3P1GA 3OYIA 5C42A 1ZBLA 4KHWA 1WSHA 4OPJA 5HRPA 4CF8A 4LSLA 3AO2A 3ZT1A 4W5NA 4DFJA 1REVA 1VSHA 2GV9A 3ZSXA 4HTUA 1XHZA 1WLJA 2HNYA 3JYTA 1SL0A 3H08A 3NGIA 1JL1A 1TV6A 1HRHA 3NE6A 4LSNA 4FXDA 4FK4A 4CCHA 1TAUA 3S3NA 4DF4A 4MQ3A 1S1VA 1JLGA 3ITHA 3SQ1A 3AA2A 2KZMA 2HHQA 1RBRA 3V81A 1LV5A 3NH1A 3S9HA 4KHYA 4AHVA 1TL3A 3O4QA 1SUQA 2YNIA 2XHBA 3VA0A 5J2NA 2G8HA 4C8OA 3RRGA 2E4LA 1RBVA 1WN7A 3U3GA 3EZ5A 3AVAA 5FROA 4BACA 2XRIA 4CGHA 3U3YA 4QAGA 4FYDA 4CJWA 4AHRA 4CJEA 4ID5A 1VSKA 1VRTA 4CJLA 1KVAA 3AVIA 3ZSWA 1SL2A 3K2PA 4DSJA 3VQ9A 4M3RA 5DK5A 3F73A 4E1MA 4E19A 2ITGA 4JRPA 4F2SA 2KW4A 4CJSA 1NJXA 4W5TA 4FLTA 1YTAA 2QKBA 1BISA 3DOKA 1LW2A 3VQ8A 1VSDA 4CJVA 1TL1A 3OYEA 1RT1A 1RTDA 3S3MA 4EP4A 2IOCA 1HNVA 1WSEA 5C24A 3OYJA 1YT3A 3V9UA 1KFSA 2PYLA 4I9LA 1NK7A 3KK2A 4FLVA 4CHYA 3K5OA 1X9SA 5JS1A 3TAEA 4FK0A 1EXQA 4B9MA 4I9QA 4L8RB 4DG1A 3VA3A 4DSFA 1EP4A 1TVRA 3AVMA 3OYCA 3QESA 1L5UA 3RR7A 4B3OA 3KLGA 4FJXA 5FRMA 3V9XA 2HHUA 3PUFA 4N47A 3V1QA 3OYLA 4JS4A 2DTUA 1C0MA 3AO5A 4CJ4A 2OYQA 1QSYA 1BI4A 4Z4CA 1KRPA 4FJ7A 4FJ9A 5HBMA 2G8IA 4GMJB 4KFBA 3CFPA 3RMCA 1N6QA 4I2QA 3WNGA 4FJJA 1DTQA 4Q5VA 2PZSA 1KTQA 3HL8A 4H8KA 1CXUA 2D0AA 1J9AA 3PX6A 4FJKA 4DFPA 4HCCA 1TKZA 3M8RA 3C6TA 3L2VA 2HW3A 3HPHA 3TR8A 1S5JA 4CGDA 5HRSA 1S1TA 1GOCA 1NK0A 3CQ8A 4PWDA 2P5OA 2G8UA 5KI6A 1TK5A 4CF0A 3K57A 1HQUA 4E7JA 4FLXA 4CF2A 1VSFA 2KQ2A 1IKWA 3HP9A 3TAGA 3TAMA 4DTSA 1WSFA 4HUFA 1WNSA 2IDOA 3SUOA 1JLFA 3SV3A 1LWFA 5CYMA 4FW1A 1I3AA 2IC3A 2VG6A 3QEIA 1ASWA 3DRSA 3QIOA 3VN5A 3ZT0A 3PY8A 1NKEA 3HT3A 4B08A 3VQ6A 1RT4A 1T8EA 3HXMA 3SPZA 3D45A 4KB1A 2KTQA 3FFIA 1D5AA 1XWLA 3IRXA 3SPYA 4DSLA 4CJPA 3QO9A 2BE2A 4OGEA 2RN2A 4CFDA 4DQQA 4DU4A 2BDPA 3HK2A 3DMJA 1QE1A 2RPIA 1B9FA 4DTJA 1QS4A 4NYFA 1U49A 4EZ9A 1ASVA 3VQDA 4K8ZA 2DFHA 1SKRA 1VK0A 4F3OA 3AVJA 3DLBA 4CEQA 2OPQA 2IS3A 3LDSA 1U4BA 1IG9A 2OZMA 1ZBUA 3DOLA 1QTMA 1IH7A 3ASMA 3OS1A 3IG1A 4DFKA 4KRFA 3DLEA 4AILC 4N56A 4E0DA 4M3XA 1RDBA 3L8BA 4J2DA 4DTUA 4AHUA 1D9DA 4AHSA 3KIOA 2OPSA 3ZSRA 3MXMA 1HNIA 4KKOA 3LZJA 4KI6A 4W5OA 4KHNA 1EX4A 3AA4A 4B8CA 1RT7A 1HJRA 3CM5A 1N5YA 2XY6A 2PY5A 1JLCA 4CFCA 1C1AA 1RT6A 1S6PA 2E6MA 1S1WA 4OJRA 1IKYA 3WNEA 3HPOA 4B9UA 1G15A 1LW0A 1DTTA 4CFAA 5J2QA 3QERA 3SNNA 3UIQA 4NCGA 4M3YA 3RMAA 1RILA 4C8MA 2DFFA 4LH4A 2PYJA 3SCXA 4CEBA 4OLBA 2I5JA 4M3TA 4ZTFA 1SKSA 2Z1GA 1BGXT 4KAZA 4W5QA 2HVHA 3K58A 1L3TA 4M3ZA 3VQCA 2F8TA 3LPTA 3KLIA 4CECA 3O4NA 3L2UA 3CFRA 2KZZA 5DMRA 1XI1A 3PO4A 3B6PA 1WSIA 1L3UA 3KK1A 4TSXA 2X6SA 2OPPA 4HCBA 1Z25A 2B6AA 4CEEA 4CEZA 1CZBA 3M8PA 3MXIA 4FJ8A 5CY4A 3RMBA 4ID1A 1S9EA 4B9SA 3DYAA 5HROA 1U47A 4RG8A 4KB0A 1RDCA 4IG0A 3T1AA 5J2PA 1B9DA 2HHWA 2IAJA 3ALYA 4F8RA 1BIUA 1SL1A 4KTQA 2DFEA 3NF6A 4CHPA 3NGZA 4DSEA 4ELTA 1T03A 1S1XA 3ZT2A 1NK4A 3VQBA 2O4IA 4DU1A 1NJZA 4CGFA 1BQNA 5CZ1A 1BL3A 1BIZA 1TKDA 1BQMA 2XO7A 4Z4HA 3S3OA 1VSLA 3NH2A 3HM9A 4DTXA 1KFDA 4CHNA 1TKXA 5KRSA 3MXJA 1T05A 3HVTA 4QOZB 2HNZA 3O3GA 1KVCA 3E01A 1F21A 3DLGA 1C1CA 4C8LA 1HYZA 1VSIA 1YVUA 4DQSA 1UAXA 3LAMA 1C0UA 5HP1A 4Z4GA 4N76A 1RBUA 1U04A 5HRNA 3DRPA 3AO4A 1T7PA 4DTPA 3RRHA 3T3FA 3LPUA 4DMNA 1U45A 4F4KA 2HHSA 3AV9A 4LH5A 4CEFA 3TABA 1U48A 1TKTA 4IBNA 2BGGA 4YFUA 4Z0UA 2HHVA 4OVLA 3C95A 3O3HA 3TANA 3AO3A 4RW7A 4DU3A 1WAFA 4CJTA 3OYBA 3QLHA 4O0JA 2FBXA 3OYFA 2OPRA 2ZQBA 3LANA 4ICLA 1A5VA 1NK8A 1W9HA 4FK2A 3NDKA 4CJQA 1L3VA 4CIGA 2QK9A 3DLKA 3OYKA 1X1PA 4B9VA 4DSIA 3ZSOA 2G8WA 3M8SA 3QEPA 3LWMA 4DS4A 1ITGA 4JLHA 4CIEA 1IKXA 1JLEA 4BE1A 2B5JA 3F9KA 2Z1JA 4IG3A 4FJLA 4FLUA 3CFOA 2RKIA 5D3GA 3HVRA 5E41A 2F8SA 4UQGA 1KSPA 5FDLA 4HHTA 4DTRA 1Q8IA 4CHZA 1NJYA 3AVKA 5KTQA 4B9TA 3C6UA 1I39A 2P51A 1BCMA 4MFBA 1RT5A 1IKVA 1FKPA 1RT3A 3B6OA 3KKSA 5J1EA 1ZBIA 4IDKA 3JSMA 2G8VA 1IO2A 2YNGA 3LAKA 1RTIA 1UOCA 2O4GA 4RW8A 2JGUA 3C94A 5CYQA 4CERA 1NOYA 1QHTA 3BGRA 4RW9A 3VQQA 1C1BA 3KLHA 4KPYA 3K59A 4CEOA 4CF9A 4XIUA 3MEEA 2D0CA 3AVLA 4F3TA 3SV4A 2F96A 4FZZA 3T19A 1JXEA 2BANA 3NF7A 3AVCA 4CEDA 1RBTA 2Y1IA 2GBZA 4O4GA 4FLYA 2HHTA 3V4IA 4CJFA 3QNNA 1W0HA 2YKNA 3AA5X 3ISNC 4OGCA 4K8XA 1LAWA 4J2BA 4Z4IA 4EP5A 3HP6A 4Z4FA 4CJKA 2Z1IA 1A5XA 1VRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KLM A;  1ZBF A;  3CG7 A;  3MEG A;  3AVN A;  4CJ3 A;  3OJS A;  4I7F A;  2X74 A;  3NH0 A;  1NK9 A;  3RTV A;  1GOA A;  1B92 A;  1SV5 A;  1QSS A;  3K5L A;  3SQ0 A;  1JL2 A;  2XY7 A;  1JXB A;  1Q9Y A;  1CXQ A;  1BHL A;  2HND A;  4B8A B;  1K6Y A;  4YNQ A;  4FM0 A;  1J53 A;  2WON A;  3P5J A;  4KHU A;  4HVJ A;  4CIF A;  4DFM A;  3EYZ A;  3SQ2 A;  2P5G A;  4E7H A;  1VSE A;  2FBT A;  3L2W A;  3V9S A;  4QCL A;  2G8F A;  2Y1J A;  3KKR A;  4LY7 A;  3ZCM A;  3IS9 A;  4CES A;  3SUN A;  4KHQ A;  3V9W A;  4IFV A;  1TK0 A;  1FXX A;  3NBP A;  3QIN A;  4KI4 A;  4NYN A;  4Q0B A;  1HMV A;  1X9W A;  1LAV A;  2HHX A;  3OYA A;  3LP0 A;  1RDA A;  3QNO A;  4CE9 A;  4AH9 A;  4CGG A;  4JRQ A;  3KD5 E;  4CHO A;  3OJU A;  5K14 A;  3NHG A;  4O55 A;  5KRT A;  4FJ5 A;  1BCO A;  1WAJ A;  2D0B A;  3ULD A;  1DLO A;  4LD0 A;  4FLW A;  1R0A A;  4PQU A;  1XHX A;  2FC0 A;  3VQP A;  4EZ6 A;  4E7K A;  1FKO A;  3ZSQ A;  1KCF A;  1C6V A;  2X78 A;  3AVH A;  3AO1 A;  5CZ2 A;  2XY8 A;  4CF1 A;  3PX0 A;  1NK5 A;  3G10 A;  4ELU A;  1WSG A;  3QEV A;  2NUB A;  1HPZ A;  3SZ2 A;  4E3S A;  3KLE A;  1S9G A;  1KLN A;  4E89 A;  4B9L A;  5T7B A;  3O3F A;  1A5W A;  1NK6 A;  2JLE A;  1JLB A;  2EHG A;  4Y1C A;  4CJ5 A;  2ZD1 A;  4E1N A;  3NAE A;  3HO1 A;  3MAQ A;  3OYM A;  3SUP A;  1RDD A;  4DQI A;  2HMI A;  1BI4 B;  1EKE A;  2ATQ A;  5C25 A;  3PX4 A;  3THV A;  5SZT A;  2DY4 A;  1MU2 A;  3DLH A;  1Y97 A;  3AVB A;  1RT2 A;  2P1J A;  4OKK A;  4RW4 A;  4Z4E A;  1KVB A;  2B4J A;  3TWH A;  4DQR A;  3SI6 A;  3RR8 A;  3AVG A;  4DSK A;  4Y1D A;  1JKH A;  3VQE A;  4CJU A;  4DTM A;  1ASU A;  5I3U A;  3KTQ A;  2Q3S A;  2YHB A;  1RCH A;  3DLR A;  3KK3 A;  3CYM A;  1O1W A;  2E6L A;  2HVI A;  3KJV A;  4BDZ A;  4O5B A;  4N41 A;  2EX3 A;  3OYN A;  2YNH A;  3D0P A;  2XY5 A;  4CHQ A;  5EU7 A;  3G0Z A;  1RBS A;  2IGI A;  4R5P A;  1UA0 A;  1TK8 A;  2KFN A;  1UWB A;  4FVM A;  4KV8 A;  4C8N A;  2D5R A;  4JS5 A;  3OY9 A;  4DLE A;  3NGY A;  3DI6 A;  3KLF A;  3NF9 A;  3RWU A;  4H4O A;  3SYZ A;  5HLF A;  2YNF A;  2GUI A;  1XC9 A;  1D9F A;  1C0T A;  3HPG A;  2QXF A;  4CJR A;  4J2E A;  3U6F A;  4FZX C;  3ZT3 A;  4H4M A;  2Z1H A;  4I2P A;  1WSJ A;  4FJN A;  3HYF A;  3V1R A;  4PUO A;  4DTN A;  3TAQ A;  2FBY A;  2AJQ A;  4HUE A;  4M41 A;  3AA3 A;  3LP2 A;  3K5M A;  4OKE A;  4CFB A;  4FCY A;  3K5N A;  1S1U A;  4BWM A;  4NCB A;  1VSJ A;  3QET A;  3QEX A;  3ZSV A;  5HRR A;  1NOZ A;  3P83 D;  2X6N A;  4J2A A;  4IFY A;  4CK1 A;  1Q9X A;  4AHT A;  2VWK A;  2VG7 A;  1HYV A;  4PA1 A;  3I0R A;  4FM1 A;  1Z26 A;  3HJF A;  3I8D A;  4C8K A;  3BDP A;  3L3U A;  4FJM A;  4E7L A;  2R7Y A;  1J5O A;  1RTJ A;  3ZT4 A;  5SWM A;  4HUG A;  4DS5 A;  3WNH A;  3TAP A;  3MEC A;  1SKW A;  2A1R A;  1JLQ A;  4KTZ A;  4BDY A;  4M3U A;  4CEA A;  4OKJ A;  3OYD A;  3PV8 A;  3WNF A;  3DRR A;  2W42 A;  4DTO A;  3QIP A;  2HB5 A;  4KTW A;  4OPK A;  3NF8 A;  4WE1 A;  1S6Q A;  3MED A;  3M8Q A;  2YV0 X;  3IAY A;  3NCI A;  1RNH A;  3DM2 A;  3LP3 A;  5FRN A;  4BE0 A;  3OS0 A;  4ZHR A;  2LSN A;  3VQA A;  4IKF A;  4M42 A;  4BWJ A;  4FJG A;  4PY5 A;  1EET A;  2OA8 A;  4FW2 A;  3TI0 A;  2ETJ A;  4FJH A;  1NKB A;  2OZS A;  4ZTJ A;  3OVN A;  4N5S A;  4ELV A;  3I0S A;  2FBV A;  3V9Z A;  3OS2 A;  4M45 A;  3SUQ A;  1ZBH A;  4B9N A;  1YTU A;  1UA1 A;  2KFZ A;  3QEW A;  4KO0 A;  3VQ7 A;  1X9M A;  4CK3 A;  4DF8 A;  4E7I A;  1CLQ A;  3L3V A;  1QQC A;  3EY1 A;  3AVF A;  4M3W A;  4O44 A;  4FLZ A;  3LWL A;  3V1O A;  1L3S A;  3A2F A;  1NJW A;  3TAR A;  4G1Q A;  1HYS A;  3VQ4 A;  3L2Q A;  1FK9 A;  2VWJ A;  1LWE A;  2RF2 A;  4AHC A;  2QKK A;  2YKM A;  4OLA A;  3OYG A;  2YHA A;  3OYH A;  1JLA A;  3TAF A;  4FZY A;  4NCA A;  4FM2 A;  3LP1 A;  1LWC A;  4CGI A;  3ZSZ A;  4F2R A;  5I42 A;  4DLG A;  3PO5 A;  3LAL A;  3LZI A;  4BE2 A;  1QSL A;  3HST B;  3KD1 E;  4FJI A;  3SJJ A;  4GVM A;  3V6D A;  2ZE2 A;  1TAQ A;  1TGO A;  4DQP A;  1J54 A;  4KRE A;  1RTH A;  1D8Y A;  3NFA A;  1VSM A;  4CK2 A;  3CM6 A;  1HQE A;  3ZSY A;  3L2R A;  3RMD A;  4RW6 A;  4W5R A;  1GOB A;  3SQ4 A;  4DWI A;  3VQ5 A;  4CGJ A;  1ZYQ A;  5KGW A;  5JS2 A;  2VG5 A;  1CZ9 A;  2WOM A;  1NKC A;  4O0I A;  2G8K A;  2A1S A;  4GW6 A;  5KGX A;  5J2M A;  4BDP A;  4KHS A;  3P1G A;  3OYI A;  5C42 A;  1ZBL A;  4KHW A;  1WSH A;  4OPJ A;  5HRP A;  4CF8 A;  4LSL A;  3AO2 A;  3ZT1 A;  4W5N A;  4DFJ A;  1REV A;  1VSH A;  2GV9 A;  3ZSX A;  4HTU A;  1XHZ A;  1WLJ A;  2HNY A;  3JYT A;  1SL0 A;  3H08 A;  3NGI A;  1JL1 A;  1TV6 A;  1HRH A;  3NE6 A;  4LSN A;  4FXD A;  4FK4 A;  4CCH A;  1TAU A;  3S3N A;  4DF4 A;  4MQ3 A;  1S1V A;  1JLG A;  3ITH A;  3SQ1 A;  3AA2 A;  2KZM A;  2HHQ A;  1RBR A;  3V81 A;  1LV5 A;  3NH1 A;  3S9H A;  4KHY A;  4AHV A;  1TL3 A;  3O4Q A;  1SUQ A;  2YNI A;  2XHB A;  3VA0 A;  5J2N A;  2G8H A;  4C8O A;  3RRG A;  2E4L A;  1RBV A;  1WN7 A;  3U3G A;  3EZ5 A;  3AVA A;  5FRO A;  4BAC A;  2XRI A;  4CGH A;  3U3Y A;  4QAG A;  4FYD A;  4CJW A;  4AHR A;  4CJE A;  4ID5 A;  1VSK A;  1VRT A;  4CJL A;  1KVA A;  3AVI A;  3ZSW A;  1SL2 A;  3K2P A;  4DSJ A;  3VQ9 A;  4M3R A;  5DK5 A;  3F73 A;  4E1M A;  4E19 A;  2ITG A;  4JRP A;  4F2S A;  2KW4 A;  4CJS A;  1NJX A;  4W5T A;  4FLT A;  1YTA A;  2QKB A;  1BIS A;  3DOK A;  1LW2 A;  3VQ8 A;  1VSD A;  4CJV A;  1TL1 A;  3OYE A;  1RT1 A;  1RTD A;  3S3M A;  4EP4 A;  2IOC A;  1HNV A;  1WSE A;  5C24 A;  3OYJ A;  1YT3 A;  3V9U A;  1KFS A;  2PYL A;  4I9L A;  1NK7 A;  3KK2 A;  4FLV A;  4CHY A;  3K5O A;  1X9S A;  5JS1 A;  3TAE A;  4FK0 A;  1EXQ A;  4B9M A;  4I9Q A;  4L8R B;  4DG1 A;  3VA3 A;  4DSF A;  1EP4 A;  1TVR A;  3AVM A;  3OYC A;  3QES A;  1L5U A;  3RR7 A;  4B3O A;  3KLG A;  4FJX A;  5FRM A;  3V9X A;  2HHU A;  3PUF A;  4N47 A;  3V1Q A;  3OYL A;  4JS4 A;  2DTU A;  1C0M A;  3AO5 A;  4CJ4 A;  2OYQ A;  1QSY A;  1BI4 A;  4Z4C A;  1KRP A;  4FJ7 A;  4FJ9 A;  5HBM A;  2G8I A;  4GMJ B;  4KFB A;  3CFP A;  3RMC A;  1N6Q A;  4I2Q A;  3WNG A;  4FJJ A;  1DTQ A;  4Q5V A;  2PZS A;  1KTQ A;  3HL8 A;  4H8K A;  1CXU A;  2D0A A;  1J9A A;  3PX6 A;  4FJK A;  4DFP A;  4HCC A;  1TKZ A;  3M8R A;  3C6T A;  3L2V A;  2HW3 A;  3HPH A;  3TR8 A;  1S5J A;  4CGD A;  5HRS A;  1S1T A;  1GOC A;  1NK0 A;  3CQ8 A;  4PWD A;  2P5O A;  2G8U A;  5KI6 A;  1TK5 A;  4CF0 A;  3K57 A;  1HQU A;  4E7J A;  4FLX A;  4CF2 A;  1VSF A;  2KQ2 A;  1IKW A;  3HP9 A;  3TAG A;  3TAM A;  4DTS A;  1WSF A;  4HUF A;  1WNS A;  2IDO A;  3SUO A;  1JLF A;  3SV3 A;  1LWF A;  5CYM A;  4FW1 A;  1I3A A;  2IC3 A;  2VG6 A;  3QEI A;  1ASW A;  3DRS A;  3QIO A;  3VN5 A;  3ZT0 A;  3PY8 A;  1NKE A;  3HT3 A;  4B08 A;  3VQ6 A;  1RT4 A;  1T8E A;  3HXM A;  3SPZ A;  3D45 A;  4KB1 A;  2KTQ A;  3FFI A;  1D5A A;  1XWL A;  3IRX A;  3SPY A;  4DSL A;  4CJP A;  3QO9 A;  2BE2 A;  4OGE A;  2RN2 A;  4CFD A;  4DQQ A;  4DU4 A;  2BDP A;  3HK2 A;  3DMJ A;  1QE1 A;  2RPI A;  1B9F A;  4DTJ A;  1QS4 A;  4NYF A;  1U49 A;  4EZ9 A;  1ASV A;  3VQD A;  4K8Z A;  2DFH A;  1SKR A;  1VK0 A;  4F3O A;  3AVJ A;  3DLB A;  4CEQ A;  2OPQ A;  2IS3 A;  3LDS A;  1U4B A;  1IG9 A;  2OZM A;  1ZBU A;  3DOL A;  1QTM A;  1IH7 A;  3ASM A;  3OS1 A;  3IG1 A;  4DFK A;  4KRF A;  3DLE A;  4AIL C;  4N56 A;  4E0D A;  4M3X A;  1RDB A;  3L8B A;  4J2D A;  4DTU A;  4AHU A;  1D9D A;  4AHS A;  3KIO A;  2OPS A;  3ZSR A;  3MXM A;  1HNI A;  4KKO A;  3LZJ A;  4KI6 A;  4W5O A;  4KHN A;  1EX4 A;  3AA4 A;  4B8C A;  1RT7 A;  1HJR A;  3CM5 A;  1N5Y A;  2XY6 A;  2PY5 A;  1JLC A;  4CFC A;  1C1A A;  1RT6 A;  1S6P A;  2E6M A;  1S1W A;  4OJR A;  1IKY A;  3WNE A;  3HPO A;  4B9U A;  1G15 A;  1LW0 A;  1DTT A;  4CFA A;  5J2Q A;  3QER A;  3SNN A;  3UIQ A;  4NCG A;  4M3Y A;  3RMA A;  1RIL A;  4C8M A;  2DFF A;  4LH4 A;  2PYJ A;  3SCX A;  4CEB A;  4OLB A;  2I5J A;  4M3T A;  4ZTF A;  1SKS A;  2Z1G A;  1BGX T;  4KAZ A;  4W5Q A;  2HVH A;  3K58 A;  1L3T A;  4M3Z A;  3VQC A;  2F8T A;  3LPT A;  3KLI A;  4CEC A;  3O4N A;  3L2U A;  3CFR A;  2KZZ A;  5DMR A;  1XI1 A;  3PO4 A;  3B6P A;  1WSI A;  1L3U A;  3KK1 A;  4TSX A;  2X6S A;  2OPP A;  4HCB A;  1Z25 A;  2B6A A;  4CEE A;  4CEZ A;  1CZB A;  3M8P A;  3MXI A;  4FJ8 A;  5CY4 A;  3RMB A;  4ID1 A;  1S9E A;  4B9S A;  3DYA A;  5HRO A;  1U47 A;  4RG8 A;  4KB0 A;  1RDC A;  4IG0 A;  3T1A A;  5J2P A;  1B9D A;  2HHW A;  2IAJ A;  3ALY A;  4F8R A;  1BIU A;  1SL1 A;  4KTQ A;  2DFE A;  3NF6 A;  4CHP A;  3NGZ A;  4DSE A;  4ELT A;  1T03 A;  1S1X A;  3ZT2 A;  1NK4 A;  3VQB A;  2O4I A;  4DU1 A;  1NJZ A;  4CGF A;  1BQN A;  5CZ1 A;  1BL3 A;  1BIZ A;  1TKD A;  1BQM A;  2XO7 A;  4Z4H A;  3S3O A;  1VSL A;  3NH2 A;  3HM9 A;  4DTX A;  1KFD A;  4CHN A;  1TKX A;  5KRS A;  3MXJ A;  1T05 A;  3HVT A;  4QOZ B;  2HNZ A;  3O3G A;  1KVC A;  3E01 A;  1F21 A;  3DLG A;  1C1C A;  4C8L A;  1HYZ A;  1VSI A;  1YVU A;  4DQS A;  1UAX A;  3LAM A;  1C0U A;  5HP1 A;  4Z4G A;  4N76 A;  1RBU A;  1U04 A;  5HRN A;  3DRP A;  3AO4 A;  1T7P A;  4DTP A;  3RRH A;  3T3F A;  3LPU A;  4DMN A;  1U45 A;  4F4K A;  2HHS A;  3AV9 A;  4LH5 A;  4CEF A;  3TAB A;  1U48 A;  1TKT A;  4IBN A;  2BGG A;  4YFU A;  4Z0U A;  2HHV A;  4OVL A;  3C95 A;  3O3H A;  3TAN A;  3AO3 A;  4RW7 A;  4DU3 A;  1WAF A;  4CJT A;  3OYB A;  3QLH A;  4O0J A;  2FBX A;  3OYF A;  2OPR A;  2ZQB A;  3LAN A;  4ICL A;  1A5V A;  1NK8 A;  1W9H A;  4FK2 A;  3NDK A;  4CJQ A;  1L3V A;  4CIG A;  2QK9 A;  3DLK A;  3OYK A;  1X1P A;  4B9V A;  4DSI A;  3ZSO A;  2G8W A;  3M8S A;  3QEP A;  3LWM A;  4DS4 A;  1ITG A;  4JLH A;  4CIE A;  1IKX A;  1JLE A;  4BE1 A;  2B5J A;  3F9K A;  2Z1J A;  4IG3 A;  4FJL A;  4FLU A;  3CFO A;  2RKI A;  5D3G A;  3HVR A;  5E41 A;  2F8S A;  4UQG A;  1KSP A;  5FDL A;  4HHT A;  4DTR A;  1Q8I A;  4CHZ A;  1NJY A;  3AVK A;  5KTQ A;  4B9T A;  3C6U A;  1I39 A;  2P51 A;  1BCM A;  4MFB A;  1RT5 A;  1IKV A;  1FKP A;  1RT3 A;  3B6O A;  3KKS A;  5J1E A;  1ZBI A;  4IDK A;  3JSM A;  2G8V A;  1IO2 A;  2YNG A;  3LAK A;  1RTI A;  1UOC A;  2O4G A;  4RW8 A;  2JGU A;  3C94 A;  5CYQ A;  4CER A;  1NOY A;  1QHT A;  3BGR A;  4RW9 A;  3VQQ A;  1C1B A;  3KLH A;  4KPY A;  3K59 A;  4CEO A;  4CF9 A;  4XIU A;  3MEE A;  2D0C A;  3AVL A;  4F3T A;  3SV4 A;  2F96 A;  4FZZ A;  3T19 A;  1JXE A;  2BAN A;  3NF7 A;  3AVC A;  4CED A;  1RBT A;  2Y1I A;  2GBZ A;  4O4G A;  4FLY A;  2HHT A;  3V4I A;  4CJF A;  3QNN A;  1W0H A;  2YKN A;  3AA5 X;  3ISN C;  4OGC A;  4K8X A;  1LAW A;  4J2B A;  4Z4I A;  4EP5 A;  3HP6 A;  4Z4F A;  4CJK A;  2Z1I A;  1A5X A;  1VRU A; 
#chains in the Genus database with same CATH topology
 5LMU K;  3AVN A;  3CJ9 A;  4I7F A;  1B92 A;  2D4W A;  3THY B;  1VQM N;  2GX9 A;  3K5L A;  3SQ0 A;  1Q9Y A;  4K25 A;  4YNQ A;  1W97 L;  2WON A;  4KHU A;  1H1V A;  3SQ2 A;  3EE8 A;  4E7H A;  2QWP A;  2FBT A;  4QCL A;  2Y1J A;  2UUA K;  4CW7 B;  1WB9 A;  4JI5 K;  3F9M A;  4NYN A;  1NGA A;  4MO5 A;  3O9U A;  3OYA A;  3QNO A;  1RDA A;  3QIC A;  4CGG A;  4L3Q A;  4ISG A;  4CHO A;  5KRT A;  4CJ7 A;  3ATV A;  1DLO A;  2A42 A;  2WFB A;  3SK3 A;  4YY3 K;  2FC0 A;  4EZ6 A;  1FKO A;  5AZI A;  1C6V A;  3AVH A;  4DR2 K;  4DR6 K;  2E5L K;  1WSG A;  3QEV A;  2NUB A;  1JCF A;  2IVP A;  2Q0U A;  3O3F A;  5C0Y A;  1NK6 A;  2JLE A;  1TYQ B;  5EOY A;  5A2Q O;  2KLA A;  3HO1 A;  3J80 O;  2HF4 A;  2ZJR L;  2RE2 A;  2HMI A;  2NLX A;  2ATQ A;  2DY4 A;  3THV A;  5AQN A;  1MU2 A;  3PIP L;  3DLH A;  1Y97 A;  2P1J A;  4DQR A;  4H0O A;  3AVG A;  1JKH A;  4CJU A;  4DTM A;  1ASU A;  2ASO A;  5I3U A;  3KTQ A;  4JI3 K;  2NRH A;  5C12 A;  5AFU H;  2P9S A;  2HVI A;  4AQY K;  2YNH A;  3D0P A;  2O8E A;  2QWQ A;  2ZGZ A;  5AQV A;  4CZJ A;  3IMX A;  4C8N A;  1DEJ A;  4DR3 K;  3H1V X;  3NF9 A;  4BRM A;  4H4O A;  1N33 K;  5HLF A;  3VTI A;  2GUI A;  3CCL N;  5EX5 A;  2GUP A;  4B1X B;  3IDH A;  3U6F A;  3ZT3 A;  1WSJ A;  3T1Y K;  4DV1 K;  3V1R A;  2W6L A;  3LP2 A;  2YCH A;  4H0T B;  4FCY A;  3QET A;  2QWM A;  4OPA A;  1NMD A;  4H0X B;  4IEE A;  4B1U B;  3O1B A;  4AM6 A;  2HF3 A;  4PA1 A;  3I0R A;  4C8K A;  4FJM A;  3ZX2 A;  4MLE A;  2R7Y A;  3ZT4 A;  3OW2 M;  3BP8 A;  4M3U A;  3WEE A;  3DRR A;  4J8F A;  5BR9 A;  2YHX A;  3OS0 A;  4ZHR A;  2HHH K;  3VQA A;  3K9J A;  1Q7Y O;  2OA8 A;  4JKG A;  2OZS A;  4XEI A;  3OS2 A;  1YTU A;  3QEW A;  1RDW X;  1QZ5 A;  4CK3 A;  4DF8 A;  4A5A A;  2QWR A;  5M1O A;  4LF8 K;  4M3W A;  4FLZ A;  3LWL A;  3V1O A;  2FF6 A;  4G1Q A;  1HYS A;  4BR7 A;  1FK9 A;  1X3M A;  4RTF D;  4FWQ A;  4FZY A;  2YHA A;  3OYH A;  3WXM B;  4CGI A;  5I42 A;  3LAL A;  4BE2 A;  1QSL A;  4GVM A;  1VQP N;  5JLF A;  1D8Y A;  4BC4 A;  3NFA A;  1W2B M;  1HQE A;  3C65 A;  3ZSY A;  3L2R A;  3O80 A;  1GOB A;  3SQ4 A;  4DWI A;  3VQ5 A;  3VER A;  1ZYQ A;  5KGW A;  5JS2 A;  2VG5 A;  1CZ9 A;  3O8M A;  1NKC A;  3VF2 A;  4GW6 A;  5J2M A;  1EWQ A;  5C42 A;  3KZB A;  4W5N A;  3ZT1 A;  1XHZ A;  1REV A;  1VSH A;  2PBD A;  4HTU A;  3KWG A;  1SL0 A;  3JYT A;  3H08 A;  1N36 K;  3BY5 A;  2HBM A;  4FXD A;  4FK4 A;  4DF4 A;  2QWO A;  3ITH A;  2HHQ A;  3V81 A;  3GE1 A;  3M6G A;  1LV5 A;  3A5N C;  4AHV A;  3O4Q A;  1SUQ A;  3VA0 A;  4C8O A;  1RBV A;  1WN7 A;  3EZ5 A;  4DR1 K;  4B1W B;  5FRO A;  4BAC A;  4CGH A;  4QAG A;  3J81 O;  4B1Y B;  4CJK A;  3G25 A;  3MWT A;  5AQG A;  2VQF K;  3VEY A;  3D2F B;  3CME N;  4FLT A;  1BIS A;  3DOK A;  5HL7 L;  1BA0 A;  3CQX A;  3G6E N;  1QQN A;  1RT1 A;  5GIN A;  4JNE A;  1WSE A;  4JK9 A;  1OH7 A;  5F2R A;  4FWP A;  5JS1 A;  3K5O A;  1X9S A;  3TAE A;  4FK0 A;  1EXQ A;  3Q7B A;  2UXD K;  4L8R B;  4A57 A;  2CGL A;  1RFQ A;  2GTD A;  3QES A;  3VF6 A;  2A6A A;  4C1N I;  4N47 A;  2DTU A;  3AO5 A;  1NGC A;  2OYQ A;  2E2O A;  1BI4 A;  3QBX A;  3R3L A;  4Z4C A;  4FJ7 A;  4FJ9 A;  3RMC A;  1N6Q A;  1I94 K;  2D1K A;  1CXU A;  5AQY A;  3WUH A;  3M8R A;  3C6T A;  3ZET A;  2KHO A;  3BUZ B;  3TR8 A;  1T44 A;  4HTL A;  4LFC K;  2O8C B;  3CQ8 A;  2P5O A;  2G8U A;  5KI6 A;  1TK5 A;  4CF0 A;  3CCQ N;  1HQU A;  2HBJ A;  3M3Z A;  3TAG A;  1YVN A;  2QEX N;  4HUF A;  2IDO A;  4JEP A;  2JWK A;  5AQU A;  4H0Y B;  5CYM A;  4FW1 A;  3DRS A;  4BC3 A;  1RGI A;  3LL3 A;  1RT4 A;  5AQR A;  5TKY A;  3HXM A;  3SPZ A;  1ATS A;  3QO9 A;  4DQQ A;  2RN2 A;  2RPI A;  1OH5 A;  4B3T K;  5C15 A;  3QFU A;  1ASV A;  4K8Z A;  2DFH A;  1SKR A;  3MN9 A;  3VF4 A;  3PSI A;  1D4X A;  4DR5 K;  2IS3 A;  3LDS A;  1U4B A;  1IG9 A;  5AZI B;  1ZBU A;  1YUW A;  2YHW A;  3DOL A;  5BRF A;  1QTM A;  4AIL C;  5C2F A;  3UKU A;  4YOV A;  4N56 A;  4AHU A;  3ZEU A;  3FR0 A;  4AHS A;  3B8A X;  1D9D A;  3MXM A;  3LZJ A;  2DPN A;  4W5O A;  1KAY A;  3I8B A;  3CM5 A;  1C1A A;  1RT6 A;  1S6P A;  4JKE A;  3WNE A;  3QER A;  1FW6 A;  1T6C A;  3IKM A;  4NCG A;  1GLA G;  2P9U A;  3CI5 A;  4C8M A;  1YJ9 N;  2P9S B;  1BGX T;  4W5Q A;  2O8E B;  4M3Z A;  4IOX A;  3VQC A;  2KZZ A;  4IWV A;  3CFR A;  4O5F A;  3CC2 N;  3B6P A;  4FPA A;  3FGU A;  1IJJ A;  3TSQ A;  4CEE A;  4CEZ A;  2UYT A;  3MXI A;  1S9E A;  4DV7 K;  2ZWH A;  4RG8 A;  1OKJ A;  3T1A A;  5J2P A;  1B9D A;  4JKC A;  2WBN A;  1SL1 A;  4ELT A;  1T03 A;  2P9N A;  1NK4 A;  2YHY A;  3VQB A;  3O08 A;  2V7Z A;  2IVO A;  1SAZ A;  4DU1 A;  1NJZ A;  5FPN A;  1BIZ A;  3CJB A;  1BQM A;  4XH5 A;  1Q86 O;  4Z4H A;  4DTX A;  2A41 A;  2BH1 A;  5AQL A;  3O3G A;  1KVC A;  3FZF A;  4XH4 A;  3DLG A;  4QS8 A;  1LCU A;  1C0U A;  4N76 A;  3AO4 A;  3WEE B;  4YOY A;  2IIR A;  4JN4 A;  3AO3 A;  4RW7 A;  3QLH A;  2ZQB A;  3LAN A;  3T69 A;  4JKG B;  3NDK A;  4CJQ A;  1L3V A;  3G71 N;  1X1P A;  3AY9 A;  3ZSO A;  3M8S A;  2G8W A;  2FSK A;  4DS4 A;  2BUP A;  4A5B A;  4WF9 L;  3F9K A;  2Z1J A;  5AJ3 K;  3CFO A;  4IXC A;  2RKI A;  3ID8 A;  3U4L A;  3P38 A;  2F8S A;  2PFU A;  1KSP A;  4HHT A;  4FWS A;  2QTD A;  1NJY A;  3AVK A;  3KKS A;  1IKV A;  2GWK A;  4IDK A;  4A2A A;  4JK7 A;  5KPT A;  3VPZ A;  2O4G A;  4IOC L;  2JGU A;  5CYQ A;  4CER A;  1QHA A;  3VQQ A;  1C1B A;  4CF9 A;  1BWF O;  2E2N A;  3UE5 A;  3HTV A;  4F3T A;  3SV4 A;  3VEX A;  4NB4 A;  3FE1 A;  2Q31 A;  3NF7 A;  1RBT A;  3UKR A;  4FOI A;  1BDG A;  2E88 A;  4EP5 A;  2ZJQ L;  3THX A;  2WC9 A;  2Z1I A;  3A8Y A;  1KLM A;  5AFU A;  1ZBF A;  1ZC6 A;  3MEG A;  4CJ3 A;  3O9S A;  3OJS A;  3NH0 A;  1GOA A;  4PL7 A;  1QSS A;  1V4T A;  1JL2 A;  2PAV A;  1BHL A;  2HND A;  1MDU B;  3P5J A;  4HVJ A;  3EYZ A;  3SAF A;  3V9S A;  2G8F A;  4LY7 A;  3IS9 A;  3SUN A;  1KAZ A;  4IFV A;  2FF3 B;  3NBP A;  4EHT A;  1HKG A;  4Q0B A;  1HMV A;  3WXJ A;  2NRT A;  5ADX A;  1LAV A;  2H3G X;  3IFR A;  4FWO A;  4GV6 A;  3KD5 E;  3GOI A;  3OJU A;  3NHG A;  4O55 A;  3ULD A;  4LD0 A;  4FLW A;  1R0A A;  4PQU A;  4U67 L;  4E7K A;  3VEW A;  1KCF A;  3AO1 A;  4H5R A;  4ELU A;  4E89 A;  4B9L A;  1NG9 A;  3VGM A;  1JLB A;  2EHG A;  4Y1C A;  4CJ5 A;  1XMQ K;  3NAE A;  3MAQ A;  1RDD A;  1MWK A;  1NGB A;  1BI4 B;  1KXP A;  1YIJ N;  2EWS A;  3PX4 A;  1X3N A;  5AQI A;  1SS6 A;  5EVZ A;  2ZGY A;  4DSK A;  1GLJ O;  3ZET B;  1VQL N;  3DLR A;  4H03 B;  3CYM A;  2E6L A;  4PKG A;  1ATN A;  2CH6 A;  4O5B A;  4BDZ A;  3M1F A;  3CC7 N;  2IGI A;  1UA0 A;  1TK8 A;  3DWL A;  1X9J A;  3OY9 A;  3NGY A;  3DI6 A;  1NGI A;  3SYZ A;  1XC9 A;  1D9F A;  1C0T A;  1IG8 A;  1G99 A;  2QXF A;  3K9K A;  4CJR A;  4J2E A;  4H5T A;  4H4M A;  2Z1H A;  3OA9 A;  4I2P A;  5M1K A;  3HYF A;  4A61 A;  4PUO A;  4DTN A;  3TAQ A;  2AJQ A;  4M41 A;  3WXK A;  3SMS A;  4OKE A;  4CFB A;  4BQZ A;  1VQ7 N;  3CCR N;  1VSJ A;  3NMU A;  5HRR A;  3P83 D;  4J2A A;  4IFY A;  4FPB A;  2VG7 A;  3HJF A;  1Z26 A;  3BDP A;  1HLU A;  4E7L A;  1J5O A;  4HUG A;  3U9Z A;  3TAP A;  1E4G T;  2Q36 A;  3MEC A;  1JLQ A;  5AQF A;  2A1R A;  3HBT A;  3UKU B;  4B9Q A;  3PV8 A;  3WNF A;  4BRE A;  2W42 A;  3ZEU B;  4FL9 A;  3SAH A;  4X65 K;  2QI2 A;  4AM7 A;  3IAY A;  5AQW A;  5FRN A;  3I56 N;  3A5O C;  4M42 A;  1EET A;  4DR7 K;  4ZTJ A;  4N5S A;  3I0S A;  3V9Z A;  3SUQ A;  1HX1 A;  2P9U B;  1ZBH A;  4WCE L;  2KFZ A;  3MX5 A;  4E7I A;  4PKI A;  1NJI O;  1QQC A;  3CD6 N;  3EY1 A;  3AVF A;  1L3S A;  1NJW A;  3TAR A;  1HNX K;  1YHQ N;  4KH4 A;  4LF4 K;  4AHC A;  3E9O A;  4F9O A;  2Q2R A;  1JLA A;  4NCA A;  4B1Z A;  3LP1 A;  1Q81 O;  3ENB A;  3V6D A;  3C6A A;  1TGO A;  4DQP A;  4BR9 A;  2P9N B;  2QWN A;  4CK2 A;  4FSV A;  5BRH A;  4W5R A;  1V4S A;  3PSF A;  3I55 N;  4O0I A;  5B8H A;  1R59 O;  5KGX A;  5IWA K;  1P8Z A;  4JI4 K;  4B3R K;  3WT0 A;  1GLD G;  4YOR A;  1HRH A;  3NE6 A;  4LSN A;  3A5M C;  3FZK A;  1TAU A;  4YOU A;  4MQ3 A;  1JLG A;  3AAQ A;  2VCP A;  4DV4 K;  3S9H A;  1TL3 A;  2XHB A;  1BOT O;  2G8H A;  3RRG A;  3U3G A;  1M1K O;  3O9T A;  2XRI A;  3U3Y A;  1Y64 A;  5I9E B;  4ID5 A;  1VSK A;  4CJL A;  2ASM A;  3K2P A;  3VQ9 A;  3F73 A;  2OAN A;  4CJS A;  2QKB A;  3DXM B;  1EWR A;  3VQ8 A;  4CJV A;  3VGK A;  3S3M A;  3D2E B;  5EXW A;  2IOC A;  3OYJ A;  1KFS A;  2PYL A;  4I9L A;  4ILG B;  4I9Q A;  4YDU A;  2AA4 A;  3VA3 A;  3SBT A;  2V7Y A;  3W0L A;  4FJX A;  5FRM A;  2ZM6 K;  1C0M A;  1VQ5 N;  3ID6 A;  2G8I A;  1J6Z A;  3MWP A;  3EKU A;  1DTQ A;  3P4I A;  4Q5V A;  2I7N A;  1KTQ A;  4H8K A;  2PZS A;  3CIP A;  3PX6 A;  1KD1 O;  3UKR B;  3ATU A;  2HW3 A;  3L2V A;  3L6Q A;  1XUP O;  1NK0 A;  3THX B;  3K57 A;  4AF1 A;  4Z94 A;  2OCE A;  2HBK A;  4FLX A;  2KQ2 A;  1IKW A;  3HP9 A;  1WSF A;  3TPQ A;  3SV3 A;  1LOT B;  5F0X A;  4NLB A;  3QEI A;  3QIO A;  3ZT0 A;  3PY8 A;  4B08 A;  4LF6 K;  1N34 K;  3FFI A;  1D5A A;  3SPY A;  4DSL A;  2VGN A;  4CFD A;  3J7Y P;  5GAE P;  4DU4 A;  4ISE A;  2BDP A;  3HK2 A;  3DMJ A;  4BQL A;  4EZ9 A;  1QS4 A;  4YOX A;  1GLE G;  1VK0 A;  4GV3 A;  3AVJ A;  4EHU A;  4RCH A;  4CEQ A;  4C23 A;  1BO5 O;  4LF9 K;  3OS1 A;  2D0P A;  3IG1 A;  4JI7 K;  3DLE A;  4M63 C;  4M3X A;  2QW9 A;  2A40 A;  3ZSR A;  4KI6 A;  1QVF M;  1O13 A;  4KHN A;  4CBX A;  1EX4 A;  1RT7 A;  1HPM A;  1J5E K;  2CGJ A;  4FVU A;  4FJ8 A;  3HPO A;  4JKB A;  1G15 A;  1XNQ K;  3SNN A;  3A5L C;  4DV5 K;  5JVH L;  4JHD A;  2DFF A;  4CVN E;  1NMN A;  4K0K K;  4WQ5 A;  4NXM K;  4M3T A;  2FLO A;  3RSE A;  4KAZ A;  5KPR A;  2HVH A;  3QML A;  1L3T A;  3VEZ A;  4CEC A;  3PO4 A;  1L3U A;  3R6M A;  3KK1 A;  4TSX A;  2OPP A;  2QXL A;  3R1X A;  4HCB A;  2B6A A;  1GLB G;  3LDO A;  1CZB A;  1NM1 A;  3RMB A;  1C0F A;  5BPN A;  5HRO A;  1U47 A;  4KB0 A;  4LF7 K;  1U2V A;  2VWB A;  2IAJ A;  4KTQ A;  2DFE A;  4CHP A;  3NGZ A;  4IFE A;  4ILJ A;  4DSE A;  1S1X A;  3ZT2 A;  4CZH A;  3UB5 A;  2O4I A;  1BL3 A;  1VSL A;  4GVE A;  1YXQ A;  1C1C A;  4C8L A;  1VSI A;  1UAX A;  4B3S K;  5HP1 A;  4Z4G A;  1OH6 A;  5HRN A;  3LDN A;  5BRD A;  1T7P A;  3T3F A;  2HHS A;  1BG3 A;  3LPU A;  1U45 A;  4LH5 A;  4CEF A;  3TAB A;  4IO8 A;  1KAX A;  1U48 A;  4IBN A;  2BTF A;  3QDK A;  4Z0U A;  2HHV A;  1TUU A;  1NGD A;  3TAN A;  5EY4 A;  2IVN A;  1A5V A;  1NK8 A;  1W9H A;  4YHH K;  4A2B A;  2E2Q A;  3G4S N;  2QK9 A;  3MX2 A;  4DSI A;  4BVP A;  3CPE A;  1JLE A;  1C0G A;  2WUS A;  3MMV A;  3N4P A;  5D3G A;  3HVR A;  3ULE A;  2YJF A;  4CZI A;  5FDL A;  4DTR A;  1Q8I A;  3WXL A;  3LDQ A;  4B9T A;  1I39 A;  3HRG A;  1RT5 A;  3W3D A;  5J1E A;  3VGL A;  3P39 A;  4G9Z A;  1UOC A;  4DCH A;  5AZJ A;  3C94 A;  5LJW A;  1QHT A;  3BGR A;  4RW9 A;  3JS6 A;  3K59 A;  2Q0R A;  3WQU A;  3BZC A;  3T19 A;  1JXE A;  4KH5 A;  4WQ5 C;  3PIO L;  2Y1I A;  3V4I A;  4CJF A;  4K8X A;  3ISN C;  4Z4I A;  1YJN N;  4DB3 A;  1VRU A;  3CG7 A;  2X74 A;  2HMP A;  4LF5 K;  2F9W A;  3C6H A;  1JXB A;  1K6Y A;  4IJN A;  3L0Q A;  4CIF A;  3T1H K;  4K43 A;  4WQ4 A;  2P5G A;  3L2W A;  3O1W A;  3KKR A;  2ZJP L;  2KKZ A;  4KI4 A;  3GG4 A;  4BR5 A;  3LP0 A;  2HOE A;  4CE9 A;  4AH9 A;  5K14 A;  4FJ5 A;  3LM2 A;  1BCO A;  2D0B A;  3VES A;  3VQP A;  2E8A A;  2X78 A;  4CF1 A;  1W7A A;  5CZ2 A;  2XY8 A;  3PX0 A;  3G10 A;  3GL1 A;  1HPZ A;  3SZ2 A;  3KLE A;  1S9G A;  3CCM N;  2ZD1 A;  3OYM A;  3SUP A;  4DQI A;  4BGA A;  1EKE A;  4X64 K;  5C25 A;  5SZT A;  3IUC A;  4Z4E A;  1KVB A;  2B4J A;  5FPM A;  3TWH A;  3RR8 A;  2YX6 A;  2J4R A;  3VQE A;  4LC9 B;  4A59 A;  1RCH A;  3THW A;  1MA9 B;  3KJV A;  4N41 A;  3QB0 A;  1ILY A;  2EX3 A;  3OYN A;  2XY5 A;  4CHQ A;  5EU7 A;  4KBO A;  4K42 A;  3K0S A;  1RBS A;  4R5P A;  3HOT A;  1E4F T;  2KFN A;  3J7Z O;  2YNF A;  5IT9 O;  3HPG A;  5C2D A;  5C10 A;  4OPH A;  4FJN A;  3H45 C;  3AA3 A;  3K5M A;  4H5W A;  4JKH A;  3TTF A;  1S1U A;  4BWM A;  4NCB A;  3QEX A;  3DXM A;  1NOZ A;  3EEQ A;  2X6N A;  3TSP A;  4CK1 A;  1Z05 A;  4RWT A;  3D2E A;  3CHW A;  4DV0 K;  2NRZ A;  4A62 A;  4DHY A;  5DM7 L;  4JKA A;  4R79 A;  1RTJ A;  4EFH A;  5SWM A;  3CCV N;  1SKW A;  3OBW A;  4YOT A;  5JIC A;  4BRF A;  4KTZ A;  4OKJ A;  3OYD A;  3QIP A;  4DUZ K;  4QS7 A;  2HB5 A;  4OPK A;  4WE1 A;  1S6Q A;  3MED A;  3M8Q A;  1IBM K;  3NCI A;  1RNH A;  3LP3 A;  4BE0 A;  4BWJ A;  4FJG A;  4FW2 A;  2ETJ A;  1NKB A;  2FBV A;  4JHD B;  1UA1 A;  4H0V B;  1JCG A;  4KO0 A;  1XQS C;  5H1S Q;  1CLQ A;  3O5B A;  4CZL A;  5AQJ A;  3RSE B;  2F7T A;  3BF3 A;  3SBG A;  4CD3 A;  4NO7 A;  4O8K A;  3A2F A;  2W40 A;  3L2Q A;  2O8F A;  2YJE A;  4IOA L;  2W6K A;  2RF2 A;  1YJW N;  4JI0 K;  2QKK A;  2YKM A;  4OLA A;  3TAF A;  4FM2 A;  1LWC A;  5DM6 L;  4DLG A;  3PO5 A;  1U2V B;  3HST B;  5LY3 A;  3SJJ A;  1VQN N;  2Q97 A;  2ZE2 A;  4PL8 A;  1TAQ A;  2FSJ A;  4KRE A;  1RTH A;  4NXN K;  1GLF O;  3AGR A;  3P1G A;  1ZBL A;  1QQM A;  1WSH A;  4CF8 A;  1HJO A;  4DFJ A;  3ZSX A;  3D6R A;  1WLJ A;  2HNY A;  3CJC A;  5CHI A;  3NGI A;  1JL1 A;  1TV6 A;  1ZXO A;  3FFK B;  3MN7 A;  4CCH A;  3DXK B;  3S3N A;  3SQ1 A;  4LFB K;  2KZM A;  2F9T A;  5LL6 Z;  3NH1 A;  4BRN A;  4JD2 A;  2YNI A;  5J2N A;  5TKW A;  2E4L A;  3AVA A;  3P31 A;  4FYD A;  4FO0 A;  4CJW A;  3WQT A;  4BRI A;  1ATR A;  4CJE A;  1KVA A;  1SQK A;  3AVI A;  3ZSW A;  1SL2 A;  5DK5 A;  2ZF5 O;  5JMV A;  4JRP A;  4JAX A;  5LJV A;  4F2S A;  2FXU A;  3ULE B;  3OYE A;  2HST A;  4EP4 A;  1YT3 A;  2NRX A;  4FLV A;  4CHY A;  5GAD P;  4B9M A;  4DG1 A;  3AVM A;  1L5U A;  2HHU A;  4KH6 A;  3NVM A;  3OYL A;  4JS4 A;  4HWI A;  5AZJ B;  4BRQ A;  4CJ4 A;  5F1X A;  1QSY A;  3EZW A;  3HM8 A;  3LM9 A;  1KRP A;  1DGK N;  5HBM A;  1K8A O;  4KFB A;  3CFP A;  4FWM A;  4I2Q A;  3S41 A;  3WNG A;  2NRR A;  4FJK A;  3MCP A;  1VQ8 N;  2NNW A;  4CBU A;  4FWL A;  3MK6 A;  3MN5 A;  1WUA A;  3HPH A;  1S5J A;  5HRS A;  1S1T A;  4PWD A;  1YAG A;  4BR0 A;  4C1N K;  4DV6 K;  1VSF A;  1YF5 L;  4DTS A;  5AQO A;  1LWF A;  3FZL A;  1I3A A;  2VG6 A;  4DQ8 A;  1ASW A;  3QFP A;  4CBW A;  3Q7C A;  3VQ6 A;  1T8E A;  3CJA A;  3EN9 A;  4KB1 A;  1XWL A;  3IRX A;  4CJP A;  4OGE A;  2BE2 A;  3CMA N;  4K41 A;  4DTJ A;  5JLH A;  1B9F A;  1U49 A;  5HOO A;  2QWL A;  3OHR A;  1BA1 A;  1HKC A;  4BRG A;  4B1V A;  4F3O A;  3KK7 A;  3DLB A;  3AAR A;  2OZM A;  3ZYY X;  4X66 K;  1IH7 A;  5FPE A;  3CET A;  2NRV A;  4DUY K;  4E0D A;  1RDB A;  2HBL A;  4J2D A;  4DTU A;  3ZX0 A;  2OPS A;  2O8B A;  1HNI A;  3F5T A;  1KC8 O;  4B8C A;  1N5Y A;  3BF1 A;  1JLC A;  4B9U A;  1IKY A;  3FZH A;  1LW0 A;  1DTT A;  3EL2 A;  3RMA A;  4OO1 J;  1RIL A;  4I6M A;  3SCX A;  2UXC K;  4OLB A;  1NWK A;  3T7Z A;  3THW B;  2I5J A;  3A0I X;  3VMF B;  2F8T A;  1QZ6 A;  3LPT A;  5M1Q A;  3J7A P;  5DMR A;  1XI1 A;  4BR4 A;  1WSI A;  2GWJ A;  2X6S A;  3TTC A;  3C7N A;  4CZM A;  5CY4 A;  2AP1 A;  3JAM O;  3DYA A;  1RDC A;  4IG0 A;  1OVY A;  3ALY A;  4F8R A;  1BIU A;  4UY8 O;  3NF6 A;  3MCA B;  4JI1 K;  2YI1 A;  3CPW M;  1TKD A;  5CZ1 A;  1VQK N;  2XO7 A;  3ZLJ A;  2E1Y A;  4QOZ B;  1NNE A;  5KRS A;  1T05 A;  1TKX A;  2HNZ A;  1F21 A;  1Q82 O;  1HUX A;  1HYZ A;  4DQS A;  2RHK A;  3LAM A;  1U04 A;  2E2P A;  3RRH A;  4DMN A;  1S22 A;  4OVL A;  5FPD A;  4CZG A;  2V51 B;  3O3H A;  3TU5 A;  4BVO A;  4CJT A;  3OYB A;  2FBX A;  3OYF A;  4PHT X;  4QS9 A;  2OTJ N;  4WYB A;  2NRW A;  1FJG K;  3ZX3 A;  1QVG M;  3O9R A;  1OVQ A;  4CIG A;  4B9V A;  3F2K A;  2P9L A;  3N4Q A;  5ADX H;  4BG9 A;  4BE1 A;  1GLC G;  4H5V A;  4B3M K;  4UQG A;  4CI6 A;  5BPL A;  1JCE A;  3I33 A;  2O8F B;  3GBT A;  5KTQ A;  2VQE K;  1FKP A;  1ZBI A;  1T3V A;  2A3Z A;  3OBY A;  3JSM A;  4XH1 A;  1XMO K;  2YNG A;  3LAK A;  2W41 A;  3VEN A;  4BC5 A;  1NOY A;  4JI2 K;  3KLH A;  4KPY A;  4CEO A;  4XIU A;  3DAW A;  2ASP A;  4FZZ A;  4E1J A;  3AVC A;  2GBZ A;  4O4G A;  1E3M A;  3QNN A;  1NBW A;  2YKN A;  4J2B A;  1LAW A;  3E66 A;  4Z4F A;  4ILH A;  2I7P A;  1NK9 A;  1MWM A;  3CXC M;  3RTV A;  3ENO A;  1SV5 A;  2XY7 A;  1EO1 A;  1CXQ A;  4B8A B;  4FM0 A;  4MDA A;  1J53 A;  5KPZ A;  4DFM A;  1VSE A;  4JD2 B;  4MLH A;  3ZCM A;  1HKB A;  3CJ1 A;  4BRL A;  3EE9 A;  4CES A;  1VQ4 N;  4KHQ A;  3V9W A;  5KQ8 A;  1TK0 A;  1FXX A;  3QIN A;  3H3O B;  4IO9 L;  1X9W A;  2HHX A;  4JRQ A;  1WAJ A;  1NGF A;  4YDU C;  4BG8 A;  1XHX A;  3HI0 A;  5AQM A;  1KQS M;  3SJH A;  3ZSQ A;  2P9P A;  1NK5 A;  4FWN A;  1WBD A;  4E3S A;  1HNZ K;  1KLN A;  2GEL A;  4O8U A;  5E84 A;  5T7B A;  1A5W A;  2P9K B;  4U7B A;  1NGJ A;  1K8K A;  4E1N A;  2E1Z A;  4LFA K;  4BRO A;  4YOW A;  3CCU N;  3KHY A;  3AVB A;  1RT2 A;  4RW4 A;  4OKK A;  4BGB A;  1N32 K;  3R8E A;  3SI6 A;  4Y1D A;  2UUC K;  5AR0 A;  3CCJ N;  1U6Z A;  2Q3S A;  2YHB A;  4EIA A;  1BUP A;  3KK3 A;  1O1W A;  4V19 S;  3DXK A;  4DV2 K;  1T6D A;  2V52 B;  4BRK A;  3G0Z A;  1UWB A;  4FVM A;  4KV8 A;  4DLE A;  2D5R A;  4JS5 A;  3KLF A;  2UU9 K;  3RWU A;  3TTD A;  1K73 O;  4BRD A;  4GKK K;  4FZX C;  2FBY A;  4HUE A;  2O8D A;  5BPM A;  1XC3 A;  3K5N A;  3H46 O;  3ZSV A;  4JI6 K;  1NLV A;  3VEO A;  1Q9X A;  5AQS A;  4AHT A;  2VWK A;  1HYV A;  3VET A;  4JKF A;  4FM1 A;  3I8D A;  1RDU A;  3L3U A;  4DS5 A;  3WNH A;  3VOV A;  1NGE A;  4BRH A;  4BDY A;  4CEA A;  3E9L A;  3U9D A;  1NU0 A;  4DTO A;  1S3X A;  1M90 O;  4KTW A;  2O8B B;  3NF8 A;  3DLL L;  2YV0 X;  4JK8 A;  3SAG A;  1NGH A;  1WOQ A;  3DM2 A;  5AQX A;  2LSN A;  4IKF A;  4PY5 A;  3TI0 A;  4JYA K;  4JV5 K;  4FJH A;  3EO3 A;  3OVN A;  4ELV A;  4M45 A;  5JVG L;  4B9N A;  4I6M B;  3VQ7 A;  1X9M A;  1WBB A;  4GV9 A;  3L3V A;  5CR4 A;  2Q1N A;  4O44 A;  3DJC A;  4BRP A;  4WFN L;  1IV0 A;  2P9I A;  3VQ4 A;  3FLC O;  5AQH A;  2GEM A;  4WFB L;  2VYP A;  2VWJ A;  1LWE A;  4ISF A;  3C7N B;  3OYG A;  4FWK A;  3KWI A;  3ZSZ A;  4F2R A;  4FJI A;  3LZI A;  1XNR K;  3KD1 E;  1QQO A;  1K9M O;  1J54 A;  5GIO A;  1VSM A;  5GAH P;  3CM6 A;  2QM1 A;  3RMD A;  4FWR A;  4RW6 A;  4CGJ A;  1VAZ A;  2WOM A;  2G8K A;  2A1S A;  4BDP A;  4KHS A;  4KHW A;  3OYI A;  4OPJ A;  5HRP A;  4LSL A;  3AO2 A;  3C0B A;  3QBW A;  2GV9 A;  5MLC Q;  4IDH A;  3AAP A;  2D0O A;  5AQP A;  3THY A;  1VQ9 N;  4BRA A;  3CC4 N;  1VHX A;  1HNW K;  1S1V A;  3AA2 A;  1RBR A;  1TUY A;  1JJ2 M;  5BN9 A;  4KHY A;  4BR2 A;  5GIP A;  3CQY A;  5AQK A;  1Z6R A;  2QA4 N;  4AHR A;  3R9P A;  1VRT A;  4FOE A;  2P9L B;  3M5R A;  4DSJ A;  4M3R A;  4E1M A;  4E19 A;  2ITG A;  2KW4 A;  1NJX A;  4W5T A;  1YTA A;  3HSC A;  3E1Y A;  3H6E A;  1LW2 A;  1VSD A;  1TL1 A;  1RTD A;  2E20 A;  3CF5 L;  3V9U A;  1HNV A;  5C24 A;  3H3N O;  1NK7 A;  3KK2 A;  4DSF A;  4DV3 K;  1EP4 A;  1TVR A;  2KTQ A;  3OYC A;  3RR7 A;  4B3O A;  1TYQ A;  5AQT A;  3KLG A;  3V9X A;  3PUF A;  2OTL N;  3V1Q A;  1N8R O;  3O4W A;  4BC2 A;  4GMJ B;  4FJJ A;  3HL8 A;  2D0A A;  3BZK A;  1J9A A;  4DFP A;  4HCC A;  4DKW A;  3MDQ A;  1TKZ A;  3LDL A;  4CGD A;  1GOC A;  1YIT N;  1BU6 O;  2FSN A;  3CJ7 A;  4WQ4 C;  4E7J A;  2F4V K;  1VQO N;  2UUB K;  4CF2 A;  4IJA A;  5ELZ A;  1ZBS A;  3TAM A;  3SUO A;  1WNS A;  1JLF A;  2ITM A;  2IC3 A;  4CD1 A;  3JXU A;  3VN5 A;  3D7E O;  1NKE A;  3HT3 A;  3FZM A;  1S72 N;  3VTH A;  3PLA A;  3D45 A;  2UXB K;  1SZ2 A;  1QE1 A;  4NYF A;  5KQD A;  5AQZ A;  3VEV A;  3O6W A;  3EKS A;  3VQD A;  3TSU A;  4X62 K;  3AGK A;  1IBL K;  3SLC A;  2OPQ A;  2P9P B;  4GY2 B;  3ASM A;  4DFK A;  4KRF A;  3CER A;  3L8B A;  5FLX O;  4GKJ K;  1K8K B;  3KIO A;  1CZA N;  4KKO A;  1GLL O;  5M1P A;  3AA4 A;  3HZ6 A;  1HJR A;  2NZT A;  2XY6 A;  5BN8 A;  1EQY A;  2PY5 A;  4CFC A;  5M1F A;  2E6M A;  4H0P A;  4OJR A;  1S1W A;  5J2Q A;  4CFA A;  1DT9 A;  3UIQ A;  4PKH A;  4M3Y A;  4LH4 A;  4CZF A;  2PYJ A;  4CEB A;  3J8A A;  4OX9 K;  4ZTF A;  1SKS A;  2Z1G A;  3K58 A;  2JWL A;  3OTO K;  3KLI A;  3L2U A;  3O4N A;  3ENH A;  1Q18 A;  3LDP A;  5E26 A;  1IBK K;  1Z25 A;  3M8P A;  3CCE N;  1OH8 A;  4ID1 A;  4B9S A;  1P90 A;  1NGG A;  2HHW A;  4IZ9 A;  4WFA L;  3L4I A;  2O8D B;  2VGM A;  5GAG P;  3CCS N;  4CGF A;  1BQN A;  5AQQ A;  3S3O A;  3NH2 A;  3HM9 A;  1KFD A;  4CHN A;  2CGK A;  4CZK A;  3MXJ A;  3HVT A;  4GNI A;  3E01 A;  3E9P A;  1YVU A;  4IEI A;  5BRE A;  2P9K A;  3HOS A;  1RBU A;  1VQ6 N;  4NLC A;  3DRP A;  4DR4 K;  3SMP A;  4DTP A;  4F4K A;  2CH5 A;  3AV9 A;  4KHP K;  4JI8 K;  3MN6 A;  1TKT A;  2BGG A;  4YFU A;  3C95 A;  4DU3 A;  1WAF A;  4O0J A;  5BR8 K;  2OPR A;  4ICL A;  4FK2 A;  3L4Q A;  1HR0 K;  3KVG A;  3DLK A;  3OYK A;  3U8X A;  3QEP A;  3LWM A;  4MDB A;  4CZE A;  1ITG A;  4JLH A;  4CIE A;  1IKX A;  1ESV A;  3D2F A;  4IG3 A;  2B5J A;  4FJL A;  4FLU A;  3H1Q A;  1DKG D;  5E41 A;  4BRC A;  2P9I B;  5M1N A;  4CHZ A;  4H5N A;  2A5X A;  3C6U A;  4MFB A;  2P51 A;  1BCM A;  3B6O A;  1RT3 A;  4BY9 C;  3O9Q A;  2G8V A;  1IO2 A;  5CE3 A;  4M7X A;  1YI2 N;  1RTI A;  2WTU A;  5LMN K;  4MO4 A;  4RW8 A;  3NVK A;  3MEE A;  3WXI A;  2D0C A;  3AVL A;  3GDQ A;  2F96 A;  4Y0W A;  2BAN A;  4CED A;  2HHT A;  4M7Y A;  4FLY A;  1W0H A;  3AA5 X;  4JKD A;  4OGC A;  3RVC A;  2O8C A;  3HP6 A;  4EAH D;  1A5X A;  3BEX A; 
#chains in the Genus database with same CATH homology
 1KLM A;  1ZBF A;  3CG7 A;  3MEG A;  3AVN A;  4CJ3 A;  3OJS A;  4I7F A;  2X74 A;  3NH0 A;  1NK9 A;  3RTV A;  1GOA A;  1B92 A;  1SV5 A;  1QSS A;  3K5L A;  3SQ0 A;  1JL2 A;  2XY7 A;  1JXB A;  1Q9Y A;  1CXQ A;  1BHL A;  2HND A;  4B8A B;  1K6Y A;  4YNQ A;  4FM0 A;  1J53 A;  2WON A;  3P5J A;  4KHU A;  4HVJ A;  4CIF A;  4DFM A;  3EYZ A;  3SQ2 A;  2P5G A;  4E7H A;  1VSE A;  2FBT A;  3L2W A;  3V9S A;  4QCL A;  2G8F A;  2Y1J A;  3KKR A;  4LY7 A;  3ZCM A;  3IS9 A;  4CES A;  3SUN A;  4KHQ A;  3V9W A;  4IFV A;  1TK0 A;  1FXX A;  3NBP A;  3QIN A;  4KI4 A;  4NYN A;  4Q0B A;  1HMV A;  1X9W A;  1LAV A;  2HHX A;  3OYA A;  3LP0 A;  1RDA A;  3QNO A;  4CE9 A;  4AH9 A;  4CGG A;  4JRQ A;  3KD5 E;  4CHO A;  3OJU A;  5K14 A;  3NHG A;  4O55 A;  5KRT A;  4FJ5 A;  1BCO A;  1WAJ A;  2D0B A;  3ULD A;  1DLO A;  4LD0 A;  4FLW A;  1R0A A;  4PQU A;  1XHX A;  2FC0 A;  3VQP A;  4EZ6 A;  4E7K A;  1FKO A;  3ZSQ A;  1KCF A;  1C6V A;  2X78 A;  3AVH A;  3AO1 A;  5CZ2 A;  2XY8 A;  4CF1 A;  3PX0 A;  1NK5 A;  3G10 A;  4ELU A;  1WSG A;  3QEV A;  2NUB A;  1HPZ A;  3SZ2 A;  4E3S A;  3KLE A;  1S9G A;  1KLN A;  4E89 A;  4B9L A;  5T7B A;  3O3F A;  1A5W A;  1NK6 A;  2JLE A;  1JLB A;  2EHG A;  4Y1C A;  4CJ5 A;  2ZD1 A;  4E1N A;  3NAE A;  3HO1 A;  3MAQ A;  3OYM A;  3SUP A;  1RDD A;  4DQI A;  2HMI A;  1BI4 B;  1EKE A;  2ATQ A;  5C25 A;  3PX4 A;  3THV A;  5SZT A;  2DY4 A;  1MU2 A;  3DLH A;  1Y97 A;  3AVB A;  1RT2 A;  2P1J A;  4OKK A;  4RW4 A;  4Z4E A;  1KVB A;  2B4J A;  3TWH A;  4DQR A;  3SI6 A;  3RR8 A;  3AVG A;  4DSK A;  4Y1D A;  1JKH A;  3VQE A;  4CJU A;  4DTM A;  1ASU A;  5I3U A;  3KTQ A;  2Q3S A;  2YHB A;  1RCH A;  3DLR A;  3KK3 A;  3CYM A;  1O1W A;  2E6L A;  2HVI A;  3KJV A;  4BDZ A;  4O5B A;  4N41 A;  2EX3 A;  3OYN A;  2YNH A;  3D0P A;  2XY5 A;  4CHQ A;  5EU7 A;  3G0Z A;  1RBS A;  2IGI A;  4R5P A;  1UA0 A;  1TK8 A;  2KFN A;  1UWB A;  4FVM A;  4KV8 A;  4C8N A;  2D5R A;  4JS5 A;  3OY9 A;  4DLE A;  3NGY A;  3DI6 A;  3KLF A;  3NF9 A;  3RWU A;  4H4O A;  3SYZ A;  5HLF A;  2YNF A;  2GUI A;  1XC9 A;  1D9F A;  1C0T A;  3HPG A;  2QXF A;  4CJR A;  4J2E A;  3U6F A;  4FZX C;  3ZT3 A;  4H4M A;  2Z1H A;  4I2P A;  1WSJ A;  4FJN A;  3HYF A;  3V1R A;  4PUO A;  4DTN A;  3TAQ A;  2FBY A;  2AJQ A;  4HUE A;  4M41 A;  3AA3 A;  3LP2 A;  3K5M A;  4OKE A;  4CFB A;  4FCY A;  3K5N A;  1S1U A;  4BWM A;  4NCB A;  1VSJ A;  3QET A;  3QEX A;  3ZSV A;  5HRR A;  1NOZ A;  3P83 D;  2X6N A;  4J2A A;  4IFY A;  4CK1 A;  1Q9X A;  4AHT A;  2VWK A;  2VG7 A;  1HYV A;  4PA1 A;  3I0R A;  4FM1 A;  1Z26 A;  3HJF A;  3I8D A;  4C8K A;  3BDP A;  3L3U A;  4FJM A;  4E7L A;  2R7Y A;  1J5O A;  1RTJ A;  3ZT4 A;  5SWM A;  4HUG A;  4DS5 A;  3WNH A;  3TAP A;  3MEC A;  1SKW A;  2A1R A;  1JLQ A;  4KTZ A;  4BDY A;  4M3U A;  4CEA A;  4OKJ A;  3OYD A;  3PV8 A;  3WNF A;  3DRR A;  2W42 A;  4DTO A;  3QIP A;  2HB5 A;  4KTW A;  4OPK A;  3NF8 A;  4WE1 A;  1S6Q A;  3MED A;  3M8Q A;  2YV0 X;  3IAY A;  3NCI A;  1RNH A;  3DM2 A;  3LP3 A;  5FRN A;  4BE0 A;  3OS0 A;  4ZHR A;  2LSN A;  3VQA A;  4IKF A;  4M42 A;  4BWJ A;  4FJG A;  4PY5 A;  1EET A;  2OA8 A;  4FW2 A;  3TI0 A;  2ETJ A;  4FJH A;  1NKB A;  2OZS A;  4ZTJ A;  3OVN A;  4N5S A;  4ELV A;  3I0S A;  2FBV A;  3V9Z A;  3OS2 A;  4M45 A;  3SUQ A;  1ZBH A;  4B9N A;  1YTU A;  1UA1 A;  2KFZ A;  3QEW A;  4KO0 A;  3VQ7 A;  1X9M A;  4CK3 A;  4DF8 A;  4E7I A;  1CLQ A;  3L3V A;  1QQC A;  3EY1 A;  3AVF A;  4M3W A;  4O44 A;  4FLZ A;  3LWL A;  3V1O A;  1L3S A;  3A2F A;  1NJW A;  3TAR A;  4G1Q A;  1HYS A;  3VQ4 A;  3L2Q A;  1FK9 A;  2VWJ A;  1LWE A;  2RF2 A;  4AHC A;  2QKK A;  2YKM A;  4OLA A;  3OYG A;  2YHA A;  3OYH A;  1JLA A;  3TAF A;  4FZY A;  4NCA A;  4FM2 A;  3LP1 A;  1LWC A;  4CGI A;  3ZSZ A;  4F2R A;  5I42 A;  4DLG A;  3PO5 A;  3LAL A;  3LZI A;  4BE2 A;  1QSL A;  3HST B;  3KD1 E;  4FJI A;  3SJJ A;  4GVM A;  3V6D A;  2ZE2 A;  1TAQ A;  1TGO A;  4DQP A;  1J54 A;  4KRE A;  1RTH A;  1D8Y A;  3NFA A;  1VSM A;  4CK2 A;  3CM6 A;  1HQE A;  3ZSY A;  3L2R A;  3RMD A;  4RW6 A;  4W5R A;  1GOB A;  3SQ4 A;  4DWI A;  3VQ5 A;  4CGJ A;  1ZYQ A;  5KGW A;  5JS2 A;  2VG5 A;  1CZ9 A;  2WOM A;  1NKC A;  4O0I A;  2G8K A;  2A1S A;  4GW6 A;  5KGX A;  5J2M A;  4BDP A;  4KHS A;  3P1G A;  3OYI A;  5C42 A;  1ZBL A;  4KHW A;  1WSH A;  4OPJ A;  5HRP A;  4CF8 A;  4LSL A;  3AO2 A;  3ZT1 A;  4W5N A;  4DFJ A;  1REV A;  1VSH A;  2GV9 A;  3ZSX A;  4HTU A;  1XHZ A;  1WLJ A;  2HNY A;  3JYT A;  1SL0 A;  3H08 A;  3NGI A;  1JL1 A;  1TV6 A;  1HRH A;  3NE6 A;  4LSN A;  4FXD A;  4FK4 A;  4CCH A;  1TAU A;  3S3N A;  4DF4 A;  4MQ3 A;  1S1V A;  1JLG A;  3ITH A;  3SQ1 A;  3AA2 A;  2KZM A;  2HHQ A;  1RBR A;  3V81 A;  1LV5 A;  3NH1 A;  3S9H A;  4KHY A;  4AHV A;  1TL3 A;  3O4Q A;  1SUQ A;  2YNI A;  2XHB A;  3VA0 A;  5J2N A;  2G8H A;  4C8O A;  3RRG A;  2E4L A;  1RBV A;  1WN7 A;  3U3G A;  3EZ5 A;  3AVA A;  5FRO A;  4BAC A;  2XRI A;  4CGH A;  3U3Y A;  4QAG A;  4FYD A;  4CJW A;  4AHR A;  4CJE A;  4ID5 A;  1VSK A;  1VRT A;  4CJL A;  1KVA A;  3AVI A;  3ZSW A;  1SL2 A;  3K2P A;  4DSJ A;  3VQ9 A;  4M3R A;  5DK5 A;  3F73 A;  4E1M A;  4E19 A;  2ITG A;  4JRP A;  4F2S A;  2KW4 A;  4CJS A;  1NJX A;  4W5T A;  4FLT A;  1YTA A;  2QKB A;  1BIS A;  3DOK A;  1LW2 A;  3VQ8 A;  1VSD A;  4CJV A;  1TL1 A;  3OYE A;  1RT1 A;  1RTD A;  3S3M A;  4EP4 A;  2IOC A;  1HNV A;  1WSE A;  5C24 A;  3OYJ A;  1YT3 A;  3V9U A;  1KFS A;  2PYL A;  4I9L A;  1NK7 A;  3KK2 A;  4FLV A;  4CHY A;  3K5O A;  1X9S A;  5JS1 A;  3TAE A;  4FK0 A;  1EXQ A;  4B9M A;  4I9Q A;  4L8R B;  4DG1 A;  3VA3 A;  4DSF A;  1EP4 A;  1TVR A;  3AVM A;  3OYC A;  3QES A;  1L5U A;  3RR7 A;  4B3O A;  3KLG A;  4FJX A;  5FRM A;  3V9X A;  2HHU A;  3PUF A;  4N47 A;  3V1Q A;  3OYL A;  4JS4 A;  2DTU A;  1C0M A;  3AO5 A;  4CJ4 A;  2OYQ A;  1QSY A;  1BI4 A;  4Z4C A;  1KRP A;  4FJ7 A;  4FJ9 A;  5HBM A;  2G8I A;  4GMJ B;  4KFB A;  3CFP A;  3RMC A;  1N6Q A;  4I2Q A;  3WNG A;  4FJJ A;  1DTQ A;  4Q5V A;  2PZS A;  1KTQ A;  3HL8 A;  4H8K A;  1CXU A;  2D0A A;  1J9A A;  3PX6 A;  4FJK A;  4DFP A;  4HCC A;  1TKZ A;  3M8R A;  3C6T A;  3L2V A;  2HW3 A;  3HPH A;  3TR8 A;  1S5J A;  4CGD A;  5HRS A;  1S1T A;  1GOC A;  1NK0 A;  3CQ8 A;  4PWD A;  2P5O A;  2G8U A;  5KI6 A;  1TK5 A;  4CF0 A;  3K57 A;  1HQU A;  4E7J A;  4FLX A;  4CF2 A;  1VSF A;  2KQ2 A;  1IKW A;  3HP9 A;  3TAG A;  3TAM A;  4DTS A;  1WSF A;  4HUF A;  1WNS A;  2IDO A;  3SUO A;  1JLF A;  3SV3 A;  1LWF A;  5CYM A;  4FW1 A;  1I3A A;  2IC3 A;  2VG6 A;  3QEI A;  1ASW A;  3DRS A;  3QIO A;  3VN5 A;  3ZT0 A;  3PY8 A;  1NKE A;  3HT3 A;  4B08 A;  3VQ6 A;  1RT4 A;  1T8E A;  3HXM A;  3SPZ A;  3D45 A;  4KB1 A;  2KTQ A;  3FFI A;  1D5A A;  1XWL A;  3IRX A;  3SPY A;  4DSL A;  4CJP A;  3QO9 A;  2BE2 A;  4OGE A;  2RN2 A;  4CFD A;  4DQQ A;  4DU4 A;  2BDP A;  3HK2 A;  3DMJ A;  1QE1 A;  2RPI A;  1B9F A;  4DTJ A;  1QS4 A;  4NYF A;  1U49 A;  4EZ9 A;  1ASV A;  3VQD A;  4K8Z A;  2DFH A;  1SKR A;  1VK0 A;  4F3O A;  3AVJ A;  3DLB A;  4CEQ A;  2OPQ A;  2IS3 A;  3LDS A;  1U4B A;  1IG9 A;  2OZM A;  1ZBU A;  3DOL A;  1QTM A;  1IH7 A;  3ASM A;  3OS1 A;  3IG1 A;  4DFK A;  4KRF A;  3DLE A;  4AIL C;  4N56 A;  4E0D A;  4M3X A;  1RDB A;  3L8B A;  4J2D A;  4DTU A;  4AHU A;  1D9D A;  4AHS A;  3KIO A;  2OPS A;  3ZSR A;  3MXM A;  1HNI A;  4KKO A;  3LZJ A;  4KI6 A;  4W5O A;  4KHN A;  1EX4 A;  3AA4 A;  4B8C A;  1RT7 A;  1HJR A;  3CM5 A;  1N5Y A;  2XY6 A;  2PY5 A;  1JLC A;  4CFC A;  1C1A A;  1RT6 A;  1S6P A;  2E6M A;  1S1W A;  4OJR A;  1IKY A;  3WNE A;  3HPO A;  4B9U A;  1G15 A;  1LW0 A;  1DTT A;  4CFA A;  5J2Q A;  3QER A;  3SNN A;  3UIQ A;  4NCG A;  4M3Y A;  3RMA A;  1RIL A;  4C8M A;  2DFF A;  4LH4 A;  2PYJ A;  3SCX A;  4CEB A;  4OLB A;  2I5J A;  4M3T A;  4ZTF A;  1SKS A;  2Z1G A;  1BGX T;  4KAZ A;  4W5Q A;  2HVH A;  3K58 A;  1L3T A;  4M3Z A;  3VQC A;  2F8T A;  3LPT A;  3KLI A;  4CEC A;  3O4N A;  3L2U A;  3CFR A;  2KZZ A;  5DMR A;  1XI1 A;  3PO4 A;  3B6P A;  1WSI A;  1L3U A;  3KK1 A;  4TSX A;  2X6S A;  2OPP A;  4HCB A;  1Z25 A;  2B6A A;  4CEE A;  4CEZ A;  1CZB A;  3M8P A;  3MXI A;  4FJ8 A;  5CY4 A;  3RMB A;  4ID1 A;  1S9E A;  4B9S A;  3DYA A;  5HRO A;  1U47 A;  4RG8 A;  4KB0 A;  1RDC A;  4IG0 A;  3T1A A;  5J2P A;  1B9D A;  2HHW A;  2IAJ A;  3ALY A;  4F8R A;  1BIU A;  1SL1 A;  4KTQ A;  2DFE A;  3NF6 A;  4CHP A;  3NGZ A;  4DSE A;  4ELT A;  1T03 A;  1S1X A;  3ZT2 A;  1NK4 A;  3VQB A;  2O4I A;  4DU1 A;  1NJZ A;  4CGF A;  1BQN A;  5CZ1 A;  1BL3 A;  1BIZ A;  1TKD A;  1BQM A;  2XO7 A;  4Z4H A;  3S3O A;  1VSL A;  3NH2 A;  3HM9 A;  4DTX A;  1KFD A;  4CHN A;  1TKX A;  5KRS A;  3MXJ A;  1T05 A;  3HVT A;  4QOZ B;  2HNZ A;  3O3G A;  1KVC A;  3E01 A;  1F21 A;  3DLG A;  1C1C A;  4C8L A;  1HYZ A;  1VSI A;  1YVU A;  4DQS A;  1UAX A;  3LAM A;  1C0U A;  5HP1 A;  4Z4G A;  4N76 A;  1RBU A;  1U04 A;  5HRN A;  3DRP A;  3AO4 A;  1T7P A;  4DTP A;  3RRH A;  3T3F A;  3LPU A;  4DMN A;  1U45 A;  4F4K A;  2HHS A;  3AV9 A;  4LH5 A;  4CEF A;  3TAB A;  1U48 A;  1TKT A;  4IBN A;  2BGG A;  4YFU A;  4Z0U A;  2HHV A;  4OVL A;  3C95 A;  3O3H A;  3TAN A;  3AO3 A;  4RW7 A;  4DU3 A;  1WAF A;  4CJT A;  3OYB A;  3QLH A;  4O0J A;  2FBX A;  3OYF A;  2OPR A;  2ZQB A;  3LAN A;  4ICL A;  1A5V A;  1NK8 A;  1W9H A;  4FK2 A;  3NDK A;  4CJQ A;  1L3V A;  4CIG A;  2QK9 A;  3DLK A;  3OYK A;  1X1P A;  4B9V A;  4DSI A;  3ZSO A;  2G8W A;  3M8S A;  3QEP A;  3LWM A;  4DS4 A;  1ITG A;  4JLH A;  4CIE A;  1IKX A;  1JLE A;  4BE1 A;  2B5J A;  3F9K A;  2Z1J A;  4IG3 A;  4FJL A;  4FLU A;  3CFO A;  2RKI A;  5D3G A;  3HVR A;  5E41 A;  2F8S A;  4UQG A;  1KSP A;  5FDL A;  4HHT A;  4DTR A;  1Q8I A;  4CHZ A;  1NJY A;  3AVK A;  5KTQ A;  4B9T A;  3C6U A;  1I39 A;  2P51 A;  1BCM A;  4MFB A;  1RT5 A;  1IKV A;  1FKP A;  1RT3 A;  3B6O A;  3KKS A;  5J1E A;  1ZBI A;  4IDK A;  3JSM A;  2G8V A;  1IO2 A;  2YNG A;  3LAK A;  1RTI A;  1UOC A;  2O4G A;  4RW8 A;  2JGU A;  3C94 A;  5CYQ A;  4CER A;  1NOY A;  1QHT A;  3BGR A;  4RW9 A;  3VQQ A;  1C1B A;  3KLH A;  4KPY A;  3K59 A;  4CEO A;  4CF9 A;  4XIU A;  3MEE A;  2D0C A;  3AVL A;  4F3T A;  3SV4 A;  2F96 A;  4FZZ A;  3T19 A;  1JXE A;  2BAN A;  3NF7 A;  3AVC A;  4CED A;  1RBT A;  2Y1I A;  2GBZ A;  4O4G A;  4FLY A;  2HHT A;  3V4I A;  4CJF A;  3QNN A;  1W0H A;  2YKN A;  3AA5 X;  3ISN C;  4OGC A;  4K8X A;  1LAW A;  4J2B A;  4Z4I A;  4EP5 A;  3HP6 A;  4Z4F A;  4CJK A;  2Z1I A;  1A5X A;  1VRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...