1QS4A

Core domain of hiv-1 integrase complexed with mg++ and 1-(5-chloroindol-3-yl)-3-hydroxy-3-(2h-tetrazol-5-yl)-propenone
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
154
structure length
150
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the HIV-1 integrase catalytic domain complexed with an inhibitor: a platform for antiviral drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords PROTEIN (HIV-1 INTEGRASE (E.C.2.7.7.49))
total genus 47
structure length 150
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qs4A00
1RBVA 3E01A 4F3TA 4ZHRA 4DTRA 2WOMA 4G1QA 2D0CA 4DSKA 2QKBA 2OPRA 1GOBA 4CEZA 4HHTA 4BE1A 4OGEA 4IDKA 4KTZA 1JXBA 3QESA 1RDAA 3QERA 4B3OA 1TVRA 1A5WA 3LWMA 3AVMA 1KCFA 2W42A 2HHWA 3VQPA 4IFYA 3RMAA 2IOCA 3OYDA 4DTSA 5KTQA 4KHSA 2GV9A 3CQ8A 1JLEA 3AA5X 5CZ1A 4DQQA 4KHYA 1BQNA 3MECA 5FROA 3K5NA 2DFEA 3AVJA 3DOLA 2Q3SA 4DTNA 3KD5E 4FZYA 3C94A 4DFPA 3TAFA 3OJSA 2YHBA 4CESA 3AVLA 1IKWA 4OJRA 2FC0A 1BGXT 1VSHA 3MXJA 3ZSXA 4DQSA 1L3UA 3SQ4A 4K8XA 4DSIA 1WSIA 4E7LA 1BISA 4FCYA 3CM5A 1UOCA 1HYVA 5E41A 4CGHA 1ZBLA 3P1GA 5DMRA 4FJ5A 3PUFA 4DSEA 1EX4A 1G15A 3H08A 3OYGA 1BI4A 1NK8A 1BCMA 1NK5A 4CIFA 4N5SA 4KV8A 4FJ9A 1JLCA 1JL2A 2IC3A 1XC9A 4QCLA 4C8LA 1XI1A 4FVMA 4H8KA 2BANA 2VWKA 1RT6A 4I9LA 4NCBA 2IGIA 3ZSRA 1T7PA 1FXXA 1KLMA 3V1RA 3IG1A 4CF8A 1KSPA 4FW2A 3RR8A 3OYEA 1ZBHA 2QXFA 3SPZA 2B5JA 3NF6A 4YNQA 4FK4A 4W5NA 5J1EA 5J2QA 4AH9A 1XHXA 2HNYA 3CFOA 4FLZA 5C24A 3LDSA 3VQBA 4KTWA 4M3RA 3CG7A 4CFAA 3U3GA 3OJUA 4B9TA 4FLXA 1RTJA 3RWUA 3MXMA 4CCHA 4DQIA 1C0TA 3VA3A 4DG1A 4E7KA 3NF9A 3HM9A 3QEIA 2HHSA 4N76A 4RW4A 1TKDA 1I3AA 4FZZA 3KKRA 3PX6A 1QHTA 4O0JA 5FDLA 2YHAA 2G8FA 2IAJA 4Y1CA 3ASMA 2R7YA 2KW4A 4O0IA 3AO3A 1U48A 4FZXC 2X6NA 2Z1HA 4FLUA 3QIPA 4DTOA 1RBRA 4CGJA 1NKBA 1KVBA 3LZIA 1ASWA 4IG0A 4O44A 3ZT1A 3OYAA 4M3TA 2G8WA 3HVTA 3I8DA 1TAUA 3CM6A 4CGDA 4KRFA 4Q5VA 5J2PA 3RRGA 4CJUA 4B9MA 1HYSA 3L2UA 3NF8A 1W9HA 5HRNA 1LWEA 3SQ0A 2D5RA 4ZTFA 3C6UA 4F2RA 4M3UA 3DLEA 1VSJA 1LAVA 4CJRA 4Z4FA 3VQ9A 3VQQA 3S3MA 4IFVA 1NK0A 2F8TA 4E3SA 3PO5A 1VSEA 1B9DA 3T19A 5KGXA 4CGIA 1JLQA 1TKZA 3HO1A 3A2FA 1L3TA 3ISNC 2A1RA 4CJWA 3ZSYA 4DLGA 4FJLA 5DK5A 4OPKA 3AO5A 4CF0A 2P5OA 4CEDA 3QIOA 4DFKA 1IKVA 4RG8A 1SKWA 1N6QA 3L3VA 1D8YA 3V9ZA 2BE2A 3PX0A 2G8VA 1EETA 2ETJA 2IS3A 3PV8A 4J2DA 1CZBA 1LW0A 3AVNA 3V9XA 4HCCA 5SWMA 5HP1A 1N5YA 4J2BA 4CJLA 3P83D 4M41A 4AHUA 4NCGA 3AO4A 3QETA 4EP4A 1RDBA 3RR7A 4B9UA 4DMNA 2YV0X 1JLFA 1VK0A 3ZT0A 1TL3A 4CE9A 3DLGA 2BDPA 1LV5A 2KFNA 3VN5A 1R0AA 4CJFA 1WN7A 3C6TA 2B6AA 1B9FA 3OYFA 5HLFA 1C0MA 1NJZA 1X9MA 2YNFA 1SV5A 2A1SA 4N47A 4E7JA 2RF2A 4CJEA 3KTQA 4DU1A 3V1QA 5FRMA 1BQMA 4NYFA 1HQUA 3QINA 4KPYA 1S1WA 4FJMA 1UWBA 4DTMA 1NK9A 3SPYA 4DFMA 3V9WA 3AO1A 3SQ1A 4CJVA 2AJQA 2YNGA 4BWMA 4CEFA 4IBNA 1KLNA 1LWFA 4DSLA 2RN2A 2G8IA 2XHBA 4CJ3A 1Z26A 4DTPA 1BIUA 1VSIA 3QLHA 3FFIA 3KLHA 4DFJA 3NGYA 4JS4A 3LANA 1K6YA 1NK6A 1BHLA 4GW6A 2XY7A 3KK3A 4FJ7A 1RDDA 3HPHA 1U45A 1S5JA 4CEAA 2GUIA 2HW3A 1CLQA 3TAPA 4N41A 1U47A 1IH7A 3LPTA 3HYFA 3LP0A 4UQGA 3M8QA 4E0DA 1RT2A 4F3OA 4AHSA 4KHWA 1BCOA 1TKTA 4CJTA 3OYIA 3KLEA 4JS5A 3SNNA 3ZSWA 4KHQA 1HRHA 1GOAA 1WSEA 3TI0A 4KAZA 3AVCA 4RW8A 1NK7A 2IDOA 4B8CA 4B08A 2EHGA 1HJRA 3DLRA 1X9WA 1I39A 5D3GA 4FK0A 2ZE2A 2HHXA 4CJKA 4BE2A 1SL1A 5CY4A 4CFCA 4CHYA 3TAQA 1NJXA 4JRPA 2F96A 2KZZA 4LH4A 1ITGA 3SI6A 1QS4A 4CJ5A 5JS1A 5KRTA 3OYMA 4CHQA 5FRNA 1C6VA 1A5VA 3DLBA 2Y1IA 1LW2A 4DTXA 1W0HA 1DLOA 1F21A 3O3FA 2YNHA 1TV6A 1RBSA 3V81A 4KKOA 3OYNA 3P5JA 4CJQA 3ALYA 3OYKA 3KLFA 4Z4GA 2E6MA 4ZTJA 1LWCA 2KZMA 4FYDA 3NF7A 4QAGA 2Y1JA 4W5OA 3HK2A 4CJSA 3LWLA 4ID5A 3PX4A 5K14A 1BIZA 4LH5A 1L5UA 3BGRA 4HTUA 3THVA 4DTJA 1J9AA 2Z1IA 3OVNA 5HRPA 3KLGA 3G0ZA 3HT3A 1VSMA 1S6QA 3CYMA 2I5JA 3LALA 1KRPA 3QNOA 4KTQA 4CJ4A 4OKJA 4Y1DA 4E7HA 5SZTA 4HUGA 2PYLA 4KI4A 1KVCA 4M3WA 3OS1A 2DY4A 3VQ4A 4BWJA 1NK4A 1REVA 2HVIA 1WSGA 1SL0A 2D0BA 1FKOA 4F2SA 3MEEA 4E89A 1WNSA 2FBXA 4JLHA 1JL1A 1UA1A 1RTDA 4ELVA 1IKXA 1CXUA 4M3XA 4RW9A 3NGIA 4ELUA 4PY5A 3ZSZA 2FBVA 1D5AA 3L2QA 2XRIA 4PQUA 2JGUA 2QK9A 2D0AA 3HXMA 1IG9A 3S3NA 3TAEA 3NE6A 3SUPA 1TK8A 2YKMA 3ULDA 4FLWA 1SKRA 2HMIA 4FK2A 3U6FA 4FLVA 4K8ZA 4HCBA 4FJXA 1B92A 1TKXA 3HPOA 3SCXA 4EZ9A 4OGCA 1IO2A 3DM2A 2JLEA 2OPSA 3SJJA 4LSLA 1RBTA 3HP9A 2DFHA 1HMVA 2BGGA 1YTAA 4C8MA 5J2NA 1J54A 1UAXA 3L3UA 4I2QA 2G8HA 1HNIA 1TGOA 3I0SA 3VQDA 3WNGA 4CHZA 3O4QA 4CF2A 2P1JA 3RMDA 4QOZB 3LPUA 3TARA 3QNNA 2G8UA 1RBUA 2GBZA 3AVFA 4C8OA 1WAJA 4Z4HA 2HNDA 1VSDA 4H4MA 3SUQA 4J2EA 5I42A 1RDCA 2E6LA 2VG5A 3ZSVA 3DRPA 3QO9A 4CK2A 3KK1A 5EU7A 5KI6A 2X6SA 4CERA 4AHRA 3CFRA 1YVUA 1JXEA 3F9KA 3I0RA 4W5QA 1QQCA 3D0PA 3DRRA 3V9SA 1U49A 2F8SA 3AA4A 2VWJA 3TABA 3K5OA 4LY7A 4AHTA 4CF9A 4OKEA 4I9QA 1VSFA 2NUBA 3WNHA 4FLTA 2OA8A 4KO0A 3AA2A 1L3SA 4FJNA 4CEQA 1KFDA 2XY8A 3ZCMA 4CGFA 4DLEA 4CK3A 3MXIA 3DLHA 3OYJA 1KVAA 4WE1A 3ZT4A 4CHPA 1BI4B 3OYBA 1C1AA 1C0UA 2XY6A 2HHUA 2KTQA 1CXQA 1ZBIA 1YT3A 4KHNA 3TWHA 3S3OA 4XIUA 3NAEA 4AILC 4KFBA 3OYLA 4CF1A 4MQ3A 4DQPA 1NOZA 3DLKA 4IKFA 4OVLA 2DTUA 3NCIA 1XHZA 4FJGA 1DTTA 3AVBA 3L8BA 4O5BA 4NYNA 4F4KA 1KFSA 4HUFA 5CZ2A 3U3YA 1QE1A 2VG7A 4DQRA 4J2AA 2X78A 4FM1A 3DYAA 1S1UA 4KHUA 1NOYA 1SL2A 4FJKA 4C8KA 2HHQA 1VRUA 1XWLA 5JS2A 4FXDA 4CHNA 2G8KA 4B9LA 1RNHA 3IAYA 4FJ8A 2RKIA 4L8RB 3V1OA 3SV4A 5KGWA 2HNZA 1A5XA 3EY1A 3SV3A 4DSFA 3KD1E 4M42A 3M8PA 2ZD1A 1RT5A 4FLYA 2KQ2A 2DFFA 3KK2A 3RRHA 1NKCA 4FM2A 1WLJA 4FJIA 4CIEA 3NHGA 1D9DA 3NBPA 3NH0A 5HROA 4I7FA 4CHOA 4E7IA 4B9SA 1EKEA 4OKKA 3DMJA 4O4GA 1JLAA 3MAQA 4PWDA 1ZBUA 3OYCA 4EZ6A 1FKPA 3EYZA 2ZQBA 3VQ8A 3VA0A 1NJYA 3HPGA 2HHVA 4CIGA 5KRSA 2PYJA 3QEVA 2P5GA 1TL1A 3MEGA 3DOKA 4Z0UA 4CEEA 3RMBA 4W5RA 4GMJB 3L2RA 2XO7A 3CFPA 4DSJA 2Z1JA 3ZT2A 1HQEA 5I3UA 3K2PA 4CEBA 4C8NA 1VSKA 3LP2A 3O3GA 3KJVA 2WONA 3K5LA 3V9UA 1FK9A 4PUOA 4KREA 3HSTB 4HUEA 3RTVA 1S6PA 1VRTA 3HL8A 3B6OA 3KLIA 4CFDA 1Q9XA 1HNVA 1WSFA 3LP1A 5T7BA 4N56A 1QSYA 4B9VA 4FJHA 3K5MA 3AA3A 4JRQA 4OLAA 4RW6A 4LD0A 1RCHA 1KTQA 1WAFA 5CYMA 3TR8A 3VQ6A 3KKSA 3AVKA 1S9GA 3ZT3A 1VSLA 4DWIA 4OPJA 3C95A 4CJPA 1JKHA 3M8RA 4BDZA 1Q8IA 5C42A 4CEOA 3SZ2A 3VQAA 1C1BA 4YFUA 1SUQA 1HPZA 5HBMA 3OS2A 4FW1A 1RTIA 1TK5A 2OPQA 3DI6A 4ID1A 2YNIA 3AVHA 4AHCA 3L2WA 2FBYA 3F73A 3V6DA 2EX3A 2VG6A 1CZ9A 4BDPA 4AHVA 4DU4A 3T1AA 4BE0A 3BDPA 1UA0A 2ITGA 3O4NA 4W5TA 4PA1A 4E1MA 1RT1A 3SYZA 2HB5A 1X9SA 2OPPA 3O3HA 2OYQA 4DF8A 4M3YA 2X74A 1ASUA 2P51A 4GVMA 4M45A 1JLBA 3AVGA 1YTUA 1T03A 1TK0A 5CYQA 1RT4A 1QSLA 3QEXA 2ATQA 3HVRA 3VQ7A 3SQ2A 1RTHA 3NH1A 1J53A 4DS5A 4Q0BA 1DTQA 4DF4A 5HRRA 3S9HA 4FJJA 3HJFA 4LSNA 2XY5A 4Z4CA 5C25A 1S1TA 4KI6A 1ASVA 2B4JA 2Z1GA 4E19A 3NH2A 3MEDA 5HRSA 1ZBFA 3RMCA 1TAQA 3WNFA 4CECA 3M8SA 3LAMA 3PY8A 2YKNA 4EP5A 4B8AB 3T3FA 1S9EA 3VQEA 1S1XA 2PZSA 1EXQA 3AV9A 4MFBA 4CK1A 4DTUA 1RT7A 4KB1A 2HVHA 1EP4A 4BACA 1WSJA 1GOCA 3KIOA 1T8EA 4Z4IA 1BL3A 4M3ZA 2PY5A 1Z25A 1S1VA 3OYHA 4I2PA 4ICLA 3TANA 4KB0A 3AVIA 3NFAA 4DU3A 4FM0A 2QKKA 2HHTA 1L3VA 4ELTA 3UIQA 1X1PA 3K57A 3B6PA 3QEPA 4OLBA 3L2VA 3DRSA 3JSMA 3AVAA 3K58A 3LZJA 2FBTA 3VQCA 2E4LA 2OZMA 1Q9YA 3ITHA 3V4IA 4RW7A 1QTMA 1IKYA 4HVJA 1QSSA 4H4OA 1JLGA 4B9NA 4BDYA 2O4GA 4CFBA 2OZSA 3LP3A 3OS0A 2RPIA 1T05A 3ZSOA 3AO2A 4E1NA 3NGZA 3K59A 1RT3A 3LAKA 3IS9A 1HYZA 3G10A 1WSHA 3D45A 3HP6A 1U4BA 1D9FA 2LSNA 3QEWA 1C1CA 3NDKA 1ZYQA 3PO4A 4IG3A 3TAMA 1U04A 1SKSA 1NKEA 2O4IA 1MU2A 3ZSQA 2KFZA 4DS4A 3WNEA 1RILA 1O1WA 1NJWA 4O55A 3TAGA 1LAWA 1Y97A 5J2MA 3JYTA 4NCAA 4Z4EA 3VQ5A 4R5PA 4TSXA 4CGGA 3OY9A 3EZ5A 3SUNA 3IRXA 3SUOA 1J5OA 4F8RA
chains in the Genus database with same CATH superfamily
4JK9A 3A5LC 2A5XA 4ZHRA 2F7TA 3T1HK 4IDHA 3M3ZA 4OGEA 3ZETB 4IDKA 5HL7L 4BRMA 4B3OA 4K0KK 2HBKA 2WC9A 2IOCA 2GV9A 3CQ8A 1JLEA 4DQQA 1NGCA 4DTNA 2Q3SA 3A5NC 4YOWA 4DFPA 3OJSA 4CESA 1VSHA 2Q36A 4JKHA 3ZSXA 3SQ4A 1WSIA 1R59O 4MDAA 1BOTO 3HTVA 4H5RA 5EX5A 3OYGA 1QQOA 3MMVA 5AQLA 4KH4A 1JL2A 2IC3A 4FWMA 1XC9A 4C8LA 1QZ5A 1RT6A 2E2NA 4I9LA 4NCBA 1FXXA 3V1RA 3IG1A 4JHDB 4CW7B 5C0YA 5BN9A 4KTWA 1DT9A 4M3RA 3CG7A 4CFAA 3OJUA 3EKUA 1RTJA 4FWQA 3MXMA 3H46O 5AQJA 3UKRB 4DG1A 4RW4A 1TKDA 4B1VA 3UE5A 2PAVA 3PX6A 3Q7CA 1QHTA 2YHAA 2GTDA 2FF6A 2KW4A 3ENHA 2O8DA 4J8FA 4FZXC 4B1XB 1RBRA 1NWKA 2P9PB 1ASWA 4IG0A 3ZT1A 4R79A 5AQFA 2G8WA 3HRGA 4H5VA 5LY3A 4KRFA 5J2PA 5C2FA 1HYSA 3LDLA 3CPWM 1W9HA 4F2RA 4A59A 4Z4FA 3R1XA 3VQ9A 1P90A 1RFQA 4LF8K 3RSEA 3T19A 2WTUA 5KGXA 1TKZA 1WBDA 1L3TA 3ISNC 4CJWA 3ZSYA 3VMFB 2P5OA 3MDQA 1SKWA 3D7EO 3V9ZA 3PX0A 2G8VA 4J2DA 1CZBA 3AVNA 3J8AA 3TTDA 5HP1A 4MDBA 1YVNA 3P83D 1RDBA 4B9UA 3VF6A 2YV0X 4CE9A 2KFNA 3CJ9A 1LV5A 3VN5A 1R0AA 1WN7A 3C6TA 5C10A 5HLFA 1NJZA 4N47A 1SV5A 2RF2A 4DU1A 1BQMA 3QINA 4WQ5A 1S1WA 4DTMA 1NK9A 3A8YA 3E9OA 1IG8A 3N4QA 2AJQA 4DV2K 4CEFA 4IBNA 4CZJA 4DTPA 1BIUA 3DAWA 4GW6A 2XY7A 1NGGA 2ZJPL 4JKEA 2IVPA 1J5EK 2GUIA 3F2KA 1Q18A 3HYFA 4UQGA 4E0DA 3M8QA 3OHRA 3M6GA 4IZ9A 3ZSWA 1HRHA 1GOAA 4JD2B 3MN6A 1I94K 4B08A 2EHGA 1HJRA 2NRVA 1X9WA 4YOTA 4FK0A 3MCPA 1YJNN 2YHXA 4BE2A 4AF1A 3SI6A 3ZX0A 5KRTA 4WFAL 1A5VA 3DLBA 4OX9K 3H1VX 1F21A 1J6ZA 1TV6A 3BP8A 1BIZA 2ASPA 5K14A 1GLDG 3QBXA 3BGRA 4HTUA 2OTLN 3KLGA 4LFBK 4H0OA 5AJ3K 1VSMA 3CYMA 4IOXA 3SJHA 2H3GX 1IV0A 4BRGA 4M3WA 3O9UA 3QDKA 5LL6Z 4BWJA 4X62K 4BY9C 4FPBA 5AQIA 3R3LA 2HVIA 1WSGA 1Q7YO 2E2QA 4H0YB 4E89A 1OH8A 3G4SN 1QQNA 3U9ZA 3JS6A 4ELUA 2A6AA 1IJJA 1WOQA 2FBVA 3ULEA 4PQUA 2XRIA 2JGUA 2HMPA 1IG9A 5TKYA 5GAHP 4FLWA 4FLVA 3BF3A 2JLEA 1RBTA 2DFHA 1KC8O 3R6MA 4C8MA 2G8HA 3VQDA 2O8EA 3O4QA 3RMDA 4UY8O 5EY4A 4O8KA 1WAJA 1HPMA 2HNDA 4Z4HA 5JVHL 3OBWA 4NO7A 2E6LA 2VG5A 3ZSVA 3DRPA 3KK1A 5EU7A 4EHUA 2X6SA 3I55N 3CFRA 1YJ9N 1JXEA 3I0RA 4M7YA 2PBDA 1KXPA 3DRRA 2F8SA 3K5OA 3CMEN 4I9QA 4OKEA 3TSUA 3HZ6A 3KHYA 1VSFA 4K43A 1GLJO 4FJNA 4CEQA 2XY8A 4CGFA 4DLEA 4DHYA 4CK3A 3MXIA 1C1AA 1CXQA 3S3OA 4AQYK 1NNEA 3OTOK 4CF1A 4MQ3A 1TUUA 4IKFA 1XHZA 3A0IX 1NGHA 5CZ2A 3FE1A 3C65A 4C1NK 3CQYA 3J7ZO 3CPEA 1SL2A 2HHQA 4FWKA 5AQGA 4JKAA 1RNHA 3IAYA 4CZHA 3EO3A 5KGWA 3SV3A 3KD1E 4BVPA 2DFFA 3RRHA 4FJIA 3AGRA 3C6AA 3NH0A 2NRTA 4I7FA 4E7IA 2CGJA 3MAQA 4LF4K 3SLCA 1NJYA 3VA0A 4A5BA 5M1KA 2HHVA 2GWKA 5E26A 4CEEA 3DOKA 3RMBA 3EL2A 1RGIA 3VEVA 3K5LA 4DR6K 1VSKA 4BR7A 3O3GA 4PUOA 2WONA 5FPMA 3RTVA 1N33K 2O8DB 1VRTA 4CFDA 1WSFA 1QSYA 3K5MA 5I9EB 3O1WA 1T6CA 3VQ6A 4OLAA 3TR8A 1WAFA 3HOTA 1HNZK 4YDUA 4DWIA 3IFRA 3VERA 3VQAA 3CD6N 5HBMA 2J4RA 1RTIA 1TK5A 2FBYA 2VG6A 4AHVA 4DU4A 4W5TA 1BA1A 1LCUA 1X9SA 3O3HA 1FW6A 4M3YA 1YXQA 2AP1A 3AVGA 1YTUA 3E1YA 5A2QO 1J53A 4Q0BA 1DTQA 3HJFA 2XY5A 1N8RO 3THYB 1S1TA 4KI6A 3CF5L 1ASVA 3ZEUA 4LF5K 3OW2M 1TAQA 3LAMA 2YKNA 4EP5A 3T3FA 4CZGA 2PZSA 1EXQA 3O5BA 4CK1A 4RCHA 5AR0A 5EVZA 4Z4IA 2I7NA 2PY5A 2A42A 2WBNA 2D0OA 4IFEA 3F5TA 4DV6K 3TSPA 4DU3A 2QKKA 2HHTA 4OLBA 2OZMA 4QS7A 4E1JA 5LJWA 2E4LA 4DR3K 3ITHA 2P9KA 4RW7A 4M63C 4HVJA 3T1YK 1C0GA 3TU5A 4Z94A 4B9NA 2NNWA 3LP3A 3CETA 3D45A 3HP6A 2O8CB 1ZYQA 1CZAN 1X3NA 4JI5K 1SKSA 2D4WA 4XH1A 4JKCA 1RILA 3TAGA 4Z4EA 3VQ5A 3SUNA 1J5OA 3IRXA 4FVUA 3GG4A 3CC4N 1RBVA 4DTRA 2D0CA 4X66K 3C7NB 3QESA 3QERA 3W3DA 1KCFA 3AGKA 3VQPA 5KTQA 3O08A 1Q82O 3KD5E 3C94A 3C6HA 1K8KB 1BISA 5M1FA 4K25A 1GLCG 4GV3A 1HYVA 5FPNA 3CCRN 1VQ7N 3CJBA 4DSEA 3CCVN 1N34K 3H08A 4DQ8A 2D0PA 4PKGA 3VETA 4CIFA 4N5SA 4JI6K 4H0VB 3BY5A 5KQDA 1XI1A 4FVMA 4H8KA 2VWKA 3CJCA 1T7PA 2E20A 1KSPA 3RR8A 3OYEA 1ZBHA 4W5NA 3NF6A 3AAQA 4YNQA 3IDHA 3CCQN 5J1EA 4FK4A 5C24A 4LF6K 3U3GA 4FLXA 4DQIA 4CCHA 2P9PA 2IVOA 3NF9A 3QEIA 5GAGP 1I3AA 4O0JA 4M7XA 5LMNK 2IAJA 4B1UB 2R7YA 1U48A 2X6NA 2Z1HA 4DTOA 3QIPA 4JV5K 2P9IA 4GV9A 3VEZA 4XEIA 4CGDA 2YHYA 2O8FA 5HRNA 1LWEA 5GADP 3C6UA 2IIRA 1VSJA 1VQ6N 3SMPA 1B9DA 1JCEA 3HO1A 2O8FB 5JICA 3O6WA 4WFBL 4DLGA 4FWRA 5DK5A 4OPKA 5M1OA 4CEDA 3BUZB 1D8YA 1BG3A 4RG8A 1N6QA 3GOIA 5DM6L 4LFAK 1EETA 2IS3A 4ISGA 1P8ZA 1N5YA 4CJLA 4M41A 3TTFA 4AHUA 3AO4A 4EP4A 4JYAK 4DMNA 2V52B 2QXLA 3DLGA 2B6AA 1B9FA 3OYFA 2UYTA 1C0MA 2A1SA 4CJ7A 3NMUA 1HQUA 4B3MK 4KPYA 4IOCL 1UWBA 3SPYA 4DFMA 3MN9A 1LWFA 1HR0K 1Z26A 3FFIA 4DFJA 1NGBA 1NK6A 1BHLA 3KK3A 4JD2A 1RDDA 5ADXH 2QWNA 1SQKA 5AZIA 5KPRA 1VQ8N 1ATNA 1CLQA 1U47A 1IH7A 5C2DA 3LP0A 3KZBA 1RT2A 3M1FA 4F3OA 3A5OC 4AHSA 5H1SQ 4CJTA 1TKTA 4CD3A 4JS5A 4KHQA 3AVCA 4RW8A 3OBYA 5MLCQ 3DLRA 5D3GA 2HHXA 4PL8A 4JI2K 3D2FB 2Q97A 4LH4A 5JS1A 4XH5A 4WQ5C 4CHQA 3ZEUB 5FRNA 2E1ZA 2Y1IA 1W0HA 1DLOA 5F1XA 2YNHA 4DV4K 3WXIA 2ZF5O 4W5OA 3AY9A 4CJSA 4ID5A 1L5UA 4DTJA 1J9AA 3OVNA 4B1ZA 3VPZA 3CCUN 4KTQA 4BRAA 4JI3K 4OKJA 4HUGA 4KI4A 1KVCA 3SBTA 3VEWA 3VQ4A 1NK4A 4CZFA 4H5NA 4DV3K 1XC3A 1FKOA 2QW9A 4BRNA 4F2SA 1RTDA 1UA1A 4M3XA 4RW9A 3TTCA 1ZC6A 1O13A 2O8CA 2VGNA 5CHIA 3S3NA 1K8AO 2NRZA 3TAEA 1E4FT 3ULDA 1SKRA 1V4TA 3LM2A 3SCXA 2P9NA 1JJ2M 3DM2A 4LSLA 1HMVA 2BGGA 2VWBA 1UAXA 3L3UA 1HNIA 1TGOA 3I0SA 3WNGA 1IBKK 2P1JA 3QNNA 2QWOA 2GBZA 3SUQA 1VSDA 4H4MA 4FPAA 3HBTA 1RDCA 3QO9A 4CK2A 5M1PA 2ZJQL 3F9KA 1QQCA 3V9SA 3AA4A 3DXMA 2VWJA 3TABA 4LY7A 4CF9A 3LM9A 3TSQA 1XMQK 2NUBA 4IO9L 1T6DA 4FLTA 4WQ4C 3D2FA 1KFDA 2ASMA 3CERA 5KQ8A 4DR1K 3DLHA 3OYJA 4BVOA 4WE1A 3NAEA 4KFBA 1EO1A 2D1KA 3UB5A 4O8UA 1NOZA 4DQPA 2DTUA 3VGKA 3AVBA 3L8BA 2YCHA 4O5BA 4F4KA 3U3YA 5AZIB 1S1UA 4KHUA 1KAXA 2RE2A 5AQMA 2QWMA 5JS2A 2UXDK 4CHNA 2RKIA 4L8RB 3V1OA 3SV4A 2HF4A 4H03B 2HNZA 3EY1A 5AQNA 5AFUA 4CD1A 3M8PA 2ZD1A 4FLYA 2KQ2A 3CCLN 2CH5A 4FWSA 1NKCA 3NHGA 4B9SA 2FLOA 1EKEA 4H5WA 3OYCA 1FKPA 3EYZA 3HPGA 5AZJB 2PYJA 3QEVA 5JVGL 1KD1O 2P5GA 1TL1A 4Z0UA 2AA4A 4EHTA 3PLAA 3L2RA 3CFPA 2Z1JA 3ZT2A 4QS8A 3KJVA 4KREA 2P9UA 4FWLA 4PKIA 2A3ZA 3LP1A 4B9VA 1NLVA 3AA3A 4RW6A 3QFPA 3KKSA 1NU0A 1VSLA 3C95A 1JKHA 4ILHA 3M8RA 1Q8IA 2Q0RA 3SZ2A 1C1BA 3OS2A 3J81O 4FW1A 5AQZA 2YNIA 3AVHA 3L2WA 1CZ9A 2OTJN 4BE0A 4PA1A 1U6ZA 3O9SA 4E1MA 2A40A 1GLBG 1RT1A 3Q7BA 3SYZA 2BUPA 2OYQA 4M45A 1RDUA 4DUYK 3ATVA 4JK7A 3CCSN 5CYQA 1BDGA 3VQ7A 3K0SA 1FJGK 4CVNE 4DF4A 4JK8A 2O8BB 4B3SK 5M1QA 3CIPA 4I6MA 4LSNA 1NBWA 2Z1GA 1K9MO 5JLFA 4FOEA 2ZWHA 3THWA 4CECA 4B8AB 2Q2RA 2GEMA 4DTUA 5AQYA 1GLLO 1EP4A 3U4LA 4FO0A 3KIOA 1EQYA 1OH6A 1BL3A 4M3ZA 3OYHA 4I2PA 1MWMA 3AAPA 3THWB 4DV7K 3O9QA 2E2OA 1L3VA 4ELTA 3B6PA 3QEPA 2O8EB 3DRSA 1Q81O 2W41A 3LZJA 2ASOA 1Q9YA 4JKBA 2PFUA 4H4OA 2VCPA 3K9JA 2O4GA 4GNIA 3ZSOA 3AO2A 3VOVA 3K59A 3T69A 1RT3A 4BC4A 1HYZA 4IJNA 4K41A 2P9SB 1U4BA 4JEPA 1IBMK 1Z05A 2LSNA 3EE8A 1V4SA 3NDKA 5JLHA 5TKWA 2UXCK 2O4IA 4DS4A 5KPTA 4NCAA 4CGGA 3OY9A 3CMAN 4F3TA 4G1QA 4B1YB 2QKBA 2OPRA 1GOBA 4CEZA 4HHTA 4BE1A 1RDAA 2UUAK 2P9SA 1TVRA 2P9LB 4DV0K 4H0TB 2W42A 2HHWA 4IFYA 3RMAA 3OYDA 3GBTA 5AQXA 1VQMN 5AQWA 4X65K 5CZ1A 3MECA 3K5NA 4FZYA 3TAFA 2GUPA 2YHBA 4GY2B 1BUPA 1IKWA 4OJRA 2FXUA 3MXJA 1YAGA 4E7LA 1QVGM 4A2AA 3CM5A 1UOCA 3ZX2A 4FJ5A 3PUFA 3K9KA 1G15A 5JMVA 2F4VK 1BI4A 4KV8A 1JLCA 3E9PA 4DV5K 2IGIA 4IO8A 3ZSRA 4CZLA 4CF8A 5BRFA 4FW2A 4BROA 2QXFA 3SPZA 2B5JA 4OO1J 5B8HA 3PSIA 3G71N 3LDSA 4B9TA 4JKDA 2NRHA 3RWUA 4QS9A 4B9QA 4E7KA 1K73O 4N76A 2QWQA 5BPLA 1SS6A 3J7AP 2G8FA 5IT9O 3ASMA 4O0IA 4BC2A 1T44A 4JHDA 1BU6O 2HSTA 4FL9A 3J80O 1NKBA 1KVBA 1K8KA 4M3TA 3HVTA 3I8DA 1TAUA 2VQFK 4B9MA 3RRGA 4JI0K 4CJUA 3NVKA 1Q86O 3L2UA 2D5RA 3C0BA 2NLXA 1ATRA 4A2BA 3VQQA 4IFVA 2QM1A 3GE1A 4IEEA 5BR8K 2E5LK 1VSEA 3ENOA 4CGIA 1JLQA 3A2FA 3MCAB 3WXKA 4FJLA 4CF0A 3QIOA 4DFKA 1IKVA 1X3MA 3L3VA 4BGBA 2BE2A 3VESA 2F9WA 2ETJA 1LW0A 4HCCA 3V9XA 4J2BA 3O4WA 4BRLA 3ZETA 3HSCA 1JLFA 1VK0A 2QWRA 1TL3A 3O9TA 4KH5A 3ZT0A 2BDPA 2Q31A 5EXWA 4CJFA 3T7ZA 3IMXA 4PKHA 4B3RK 3O80A 2V7YA 3O1BA 4CJEA 3KTQA 2P9KB 1QZ6A 4NYFA 4IXCA 4CZEA 4FOIA 3FZLA 3VEOA 3SQ1A 1NGAA 4CJVA 2YNGA 4DV1K 5FLXO 2GWJA 3QFUA 1KLNA 4DSLA 2G8IA 2XHBA 4B3TK 2W6LA 2WUSA 1VSIA 3QLHA 4JS4A 1K6YA 2V51B 1S5JA 2HW3A 3QBWA 4N41A 3LPTA 1DEJA 2UUCK 4ISEA 4KHWA 1BCOA 3OYIA 1YI2N 1NJIO 3EN9A 1N36K 1WSEA 3H3OB 3UKUA 3TI0A 4KAZA 1VQNN 2IDOA 4LC9B 1I39A 4WFNL 1SL1A 4O5FA 4CFCA 3TAQA 1NJXA 2F96A 1ITGA 3OYMA 2HF3A 2DPNA 4BREA 1LW2A 4DTXA 5FPDA 4F9OA 1RBSA 3V81A 3BF1A 3P5JA 4CJQA 3OYKA 1YIJN 2E6MA 4ZTJA 1LWCA 3HK2A 2W40A 3PX4A 4LH5A 3DXKB 1NM1A 1S3XA 3VTHA 3THVA 2YJFA 3G0ZA 1TUYA 1S6QA 1KRPA 2I5JA 3QNOA 1E3MA 4CJ4A 4E7HA 2PYLA 2NZTA 3OS1A 2DY4A 2QTDA 3WEEB 2VYPA 3QMLA 3H3NO 3MEEA 2FBXA 1JL1A 1OH7A 4BQLA 4PY5A 3FGUA 2YHWA 2QK9A 4BRPA 3HXMA 3F9MA 4RTFD 1TK8A 4FK2A 1VQ5N 2HMIA 4HCBA 4FJXA 1B92A 3HPOA 4EZ9A 1VHXA 3UKUB 3KWGA 4JKFA 1YTAA 2E1YA 5GIPA 5J2NA 2FSNA 4AM6A 4CHZA 4CF2A 2ZGZA 3R9PA 3LPUA 3TARA 1TYQB 2G8UA 2HBMA 3GDQA 3AVFA 4C8OA 4BC5A 2FSKA 4J2EA 3SAHA 4GKJK 5BR9A 4L3QA 5KI6A 2FF3B 4AHRA 5ELZA 1YVUA 4BR0A 1X9JA 5GINA 5AQTA 3PIPL 1BO5O 4GVEA 3VEXA 3WNHA 2OA8A 5ADXA 3AA2A 3IUCA 4YOVA 2HBLA 1MWKA 5GAEP 4JI4K 3WXLA 3CCJN 1KVAA 2YI1A 4CHPA 2HHUA 1W97L 1ZBIA 1VAZA 4KHNA 3WEEA 1NGDA 1VQPN 3CC7N 4OVLA 1HLUA 3MX2A 4NYNA 1KFSA 4J2AA 5AQHA 4DQRA 3LDOA 4FM1A 1NOYA 3WQUA 4FJKA 4C8KA 3DLLL 1VRUA 1XWLA 4FXDA 3UKRA 4FJ8A 3MK6A 3SMSA 2BH1A 4G9ZA 1RT5A 3KK2A 5AQVA 3L0QA 1RDWX 1WLJA 3W0LA 4YOXA 3NBPA 4CHOA 5EOYA 3DMJA 4O4GA 4DKWA 2CGKA 3QICA 1M90O 3VQ8A 4WQ4A 4IEIA 2I7PA 4GMJB 5AQUA 1Z6RA 2XO7A 3V9UA 1XNRK 3I33A 4BG9A 4HUEA 1Q9XA 3JAMO 3HL8A 1HNVA 5T7BA 4N56A 2ZM6K 4Y0WA 4YORA 4JRQA 4X64K 1KTQA 5CYMA 1MA9B 4BR9A 3AVKA 1S9GA 3ZT3A 4V19S 4CJPA 5C42A 4C1NI 4CEOA 5AQPA 2HOEA 3FFKB 3DI6A 3F73A 4AHCA 3V6DA 2QWPA 3MWPA 4BDPA 3T1AA 3BDPA 2ITGA 4LF9K 3G6EN 4BC3A 4KHPK 2HB5A 4DF8A 1NGFA 1ASUA 2P51A 4MLEA 4CZKA 1ZXOA 1RT4A 1HNWK 3QEXA 2ATQA 3HVRA 4H0PA 3G25A 4YOYA 2OANA 2UUBK 3SBGA 2UXBK 2B4JA 4E19A 3MEDA 5HRSA 3I56N 3RMCA 4JI1K 2ZGYA 1BA0A 1U2VB 3WNFA 3M8SA 3CCMN 1VQKN 2ITMA 3M5RA 1HKBA 3VQEA 1S1XA 3AV9A 4MFBA 1RT7A 4KB1A 4LFCK 2HVHA 3WXJA 4BACA 4H0XB 1WSJA 1WB9A 4H5TA 1S1VA 3WT0A 4BRKA 3U9DA 3NFAA 4FM0A 1W7AA 1X1PA 3JSMA 3BZCA 3AVAA 2FBTA 3VQCA 4IOAL 3L4IA 5F0XA 4WYBA 1JLGA 4OPHA 4BDYA 2RPIA 4JI8K 4E1NA 1T3VA 5BN8A 3LAKA 1NMDA 3IS9A 1WSHA 1DGKN 5AQRA 3RVCA 3PO4A 3TAMA 3VGMA 2GX9A 5LJVA 3C7NA 1MU2A 1KAYA 3ZSQA 1N32K 3BZKA 2P9UB 4DCHA 1NJWA 3I8BA 3JYTA 1XMOK 3SUOA 1DKGD 4NLCA 4F8RA 1D4XA 3E01A 2WOMA 4DSKA 1S22A 4U67L 3L6QA 3GL1A 3ID6A 4KTZA 1JXBA 2JWKA 1SZ2A 4BRCA 1A5WA 3LWMA 4B1WB 4MLHA 3AVMA 1Y64A 2YX6A 4DTSA 4KHSA 3AA5X 1BQNA 1LOTB 5FROA 2DFEA 3AVJA 3DOLA 3THXB 2QEXN 1JCFA 5AZJA 1E4GT 3AVLA 2FC0A 1BGXT 1L3UA 4DQSA 4K8XA 1QVFM 1GLAG 3ZX3A 4DSIA 1QQMA 2E8AA 4FCYA 3MWTA 5E41A 4CGHA 4MO5A 3S41A 3P1GA 5DMRA 1ZBLA 1S72N 4I6MB 1EX4A 1VQLN 4NLBA 3D6RA 1NK8A 1BCMA 1NK5A 4FJ9A 4BRFA 4QCLA 2BANA 3MN7A 1KLMA 4HWIA 1M1KO 4DR2K 5J2QA 4AH9A 4EFHA 1XHXA 2HNYA 2YJEA 3CFOA 4FLZA 3P4IA 3VQBA 3ID8A 1HNXK 4JN4A 1HKGA 4KH6A 3D2EB 1C0TA 3VA3A 3HM9A 2HHSA 1NGJA 4FZZA 3KKRA 4KBOA 5FDLA 3CHWA 4Y1CA 3DJCA 3AO3A 4FLUA 3CC2N 4CGJA 3LZIA 3OYAA 4O44A 3CM6A 1VQON 3ZYYX 1BWFO 4A57A 4Q5VA 3H45C 2OCEA 1OVQA 4FWNA 2P9IB 3NF8A 4RWTA 3SQ0A 4ZTFA 4M3UA 3DLEA 4CJRA 1C0FA 1LAVA 4BRIA 2F8TA 3S3MA 1NK0A 5CR4A 2W6KA 1NMNA 4E3SA 1ZBSA 4ILGB 3PO5A 3WQTA 4PL7A 3FZKA 3CI5A 4DR7K 4LF7K 2HHHK 2A1RA 3EZWA 3AO5A 4WCEL 1OKJA 4KHYA 3PV8A 1XNQK 4CZIA 3QB0A 5SWMA 4NCGA 3WUHA 3QETA 3RR7A 4JI7K 4GV6A 1KAZA 3PIOL 1X9MA 2YNFA 4E7JA 1HKCA 4YY3K 3V1QA 5FRMA 1MDUB 4FWPA 3J7YP 4FJMA 4FSVA 1YHQN 4CI6A 3V9WA 3AO1A 4BWMA 1EWRA 2RN2A 4BR2A 4CJ3A 2IVNA 4BR4A 4BG8A 3FZMA 4BR5A 3KLHA 3NGYA 3LANA 4FJ7A 2KKZA 4XH4A 1SAZA 3HPHA 1U45A 4CEAA 2Q0UA 3TAPA 3MN5A 5F2RA 3U8XA 3VF4A 3VENA 3KLEA 3SNNA 2GELA 3EE9A 1NK7A 1IBLK 4B8CA 3JXUA 2ZE2A 4YHHK 4CJKA 4IWVA 5CY4A 4CHYA 1YITN 4JRPA 1ATSA 2KZZA 4CBUA 1U2VA 1QS4A 1OVYA 4CJ5A 3FR0A 1C6VA 3R8EA 5KPZA 2F9TA 3O3FA 3VEYA 4KKOA 3OYNA 3ALYA 2KZMA 3KLFA 4Z4GA 4BRDA 4FYDA 3NF7A 4QAGA 2Y1JA 3LWLA 3CXCM 1QHAA 2Z1IA 5HRPA 3HT3A 3LL3A 3KVGA 1NGEA 3LALA 5AFUH 4Y1DA 5SZTA 4FWOA 4GKKK 4IJAA 2KLAA 1REVA 2BTFA 1SL0A 2D0BA 3EKSA 4A61A 1WNSA 5C15A 4JLHA 4U7BA 1ESVA 4ELVA 1IKXA 1CXUA 4AM7A 3NGIA 3ZSZA 4DUZK 3L2QA 1D5AA 3WXMB 4NXMK 2D0AA 5C12A 5AQSA 3P39A 2HBJA 3NE6A 3SUPA 2YKMA 3U6FA 4K8ZA 3LDQA 1TKXA 3H6EA 4MO4A 4OGCA 5AQOA 1IO2A 2OPSA 3SJJA 3HP9A 3MX5A 1J54A 4I2QA 4BQZA 2QWLA 5IWAK 4QOZB 2JWLA 4NXNK 1HJOA 1YJWN 1RBUA 5BPNA 4A62A 3CQXA 3VGLA 5I42A 2VQEK 4CERA 4BRQA 1VQ9N 4W5QA 2P9NB 3D0PA 1U49A 2E88A 4AHTA 3AARA 3HOSA 1NG9A 3H1QA 1WUAA 4JNEA 5FPEA 4BGAA 1YF5L 4A5AA 3DXKA 4KO0A 2NRRA 3VF2A 1L3SA 5BPMA 3ZCMA 3HM8A 4YOUA 3ZT4A 2ZJRL 1BI4B 2RHKA 3OYBA 1C0UA 2XY6A 2EWSA 2KTQA 1YT3A 1G99A 3TWHA 2NRXA 4XIUA 4AILC 3OYLA 5BREA 3DLKA 3SAFA 3NCIA 4FJGA 1DTTA 3OA9A 5DM7L 4EIAA 3BEXA 3ULEB 4HUFA 1QE1A 2QI2A 2VG7A 2X78A 4YDUC 3DYAA 3DXMB 1KQSM 2FSJA 3TPQA 3IKMA 2G8KA 3EEQA 4B9LA 1HUXA 3LDNA 3D2EA 1A5XA 4DSFA 4M42A 5M1NA 3DWLA 4CBXA 2P9LA 5BRHA 1H1VA 4WF9L 4FM2A 2CH6A 4CIEA 3PSFA 4CZMA 5HROA 1D9DA 2KHOA 4OKKA 1EWQA 1JLAA 4PWDA 1ZBUA 4EZ6A 2ZQBA 3ENBA 3HI0A 5CE3A 4CIGA 5KRSA 4EAHD 3A5MC 1GLFO 3MEGA 4DR5K 4HTLA 1W2BM 3CCEN 4W5RA 3ATUA 4DSJA 5I3UA 1HQEA 4NB4A 4CEBA 3K2PA 4C8NA 3CJ7A 3O9RA 3LP2A 3P31A 2E2PA 1FK9A 3HSTB 1S6PA 3B6OA 3KLIA 5E84A 3RSEB 1HX1A 4FJHA 1XUPO 2A41A 5HOOA 3B8AX 3L4QA 4LD0A 1RCHA 4JKGB 4OPJA 5LMUK 4BDZA 4OPAA 4YFUA 1SUQA 1HPZA 2OPQA 4ID1A 1GLEG 2EX3A 3KWIA 3SK3A 1UA0A 3O4NA 4K42A 3N4PA 1XQSC 3FZFA 3VTIA 5BRDA 2OPPA 4JAXA 2X74A 3LDPA 4GVMA 1JLBA 2O8BA 4PHTX 1NGIA 1T03A 1TK0A 1QSLA 3P38A 3SQ2A 1RTHA 2V7ZA 4JKGA 3NH1A 4DS5A 4CBWA 5HRRA 3S9HA 1ILYA 2NRWA 4FJJA 4DB3A 4Z4CA 5C25A 2CGLA 5AQQA 3NH2A 2WFBA 1ZBFA 4ISFA 4C23A 3PY8A 3THYA 1S9EA 1YUWA 3FLCO 1VQ4N 2QA4N 5AQKA 1T8EA 1GOCA 4BRHA 1Z25A 3TANA 1OH5A 4ICLA 2VGMA 2Q1NA 4KB0A 3AVIA 5GIOA 1TYQA 3O8MA 3K57A 3UIQA 1JCGA 3L2VA 3K58A 4ILJA 3V4IA 1QTMA 1IKYA 3ZLJA 3NVMA 1QSSA 1WBBA 4CFBA 2OZSA 3E9LA 1T05A 3OS0A 4DR4K 3NGZA 3E66A 1D9FA 3G10A 3QEWA 1C1CA 3CJAA 4IG3A 1U04A 1NKEA 3SAGA 2KFZA 3WNEA 1O1WA 3CJ1A 4O55A 1LAWA 1Y97A 5J2MA 3THXA 4R5PA 4TSXA 3EZ5A 3KK7A 2UU9K 3FZHA
chains in the Genus database with same CATH topology
1RBVA 3E01A 4F3TA 4ZHRA 4DTRA 2WOMA 4G1QA 2D0CA 4DSKA 2QKBA 2OPRA 1GOBA 4CEZA 4HHTA 4BE1A 4OGEA 4IDKA 4KTZA 1JXBA 3QESA 1RDAA 3QERA 4B3OA 1TVRA 1A5WA 3LWMA 3AVMA 1KCFA 2W42A 2HHWA 3VQPA 4IFYA 3RMAA 2IOCA 3OYDA 4DTSA 5KTQA 4KHSA 2GV9A 3CQ8A 1JLEA 3AA5X 5CZ1A 4DQQA 4KHYA 1BQNA 3MECA 5FROA 3K5NA 2DFEA 3AVJA 3DOLA 2Q3SA 4DTNA 3KD5E 4FZYA 3C94A 4DFPA 3TAFA 3OJSA 2YHBA 4CESA 3AVLA 1IKWA 4OJRA 2FC0A 1BGXT 1VSHA 3MXJA 3ZSXA 4DQSA 1L3UA 3SQ4A 4K8XA 4DSIA 1WSIA 4E7LA 1BISA 4FCYA 3CM5A 1UOCA 1HYVA 5E41A 4CGHA 1ZBLA 3P1GA 5DMRA 4FJ5A 3PUFA 4DSEA 1EX4A 1G15A 3H08A 3OYGA 1BI4A 1NK8A 1BCMA 1NK5A 4CIFA 4N5SA 4KV8A 4FJ9A 1JLCA 1JL2A 2IC3A 1XC9A 4QCLA 4C8LA 1XI1A 4FVMA 4H8KA 2BANA 2VWKA 1RT6A 4I9LA 4NCBA 2IGIA 3ZSRA 1T7PA 1FXXA 1KLMA 3V1RA 3IG1A 4CF8A 1KSPA 4FW2A 3RR8A 3OYEA 1ZBHA 2QXFA 3SPZA 2B5JA 3NF6A 4YNQA 4FK4A 4W5NA 5J1EA 5J2QA 4AH9A 1XHXA 2HNYA 3CFOA 4FLZA 5C24A 3LDSA 3VQBA 4KTWA 4M3RA 3CG7A 4CFAA 3U3GA 3OJUA 4B9TA 4FLXA 1RTJA 3RWUA 3MXMA 4CCHA 4DQIA 1C0TA 3VA3A 4DG1A 4E7KA 3NF9A 3HM9A 3QEIA 2HHSA 4N76A 4RW4A 1TKDA 1I3AA 4FZZA 3KKRA 3PX6A 1QHTA 4O0JA 5FDLA 2YHAA 2G8FA 2IAJA 4Y1CA 3ASMA 2R7YA 2KW4A 4O0IA 3AO3A 1U48A 4FZXC 2X6NA 2Z1HA 4FLUA 3QIPA 4DTOA 1RBRA 4CGJA 1NKBA 1KVBA 3LZIA 1ASWA 4IG0A 4O44A 3ZT1A 3OYAA 4M3TA 2G8WA 3HVTA 3I8DA 1TAUA 3CM6A 4CGDA 4KRFA 4Q5VA 5J2PA 3RRGA 4CJUA 4B9MA 1HYSA 3L2UA 3NF8A 1W9HA 5HRNA 1LWEA 3SQ0A 2D5RA 4ZTFA 3C6UA 4F2RA 4M3UA 3DLEA 1VSJA 1LAVA 4CJRA 4Z4FA 3VQ9A 3VQQA 3S3MA 4IFVA 1NK0A 2F8TA 4E3SA 3PO5A 1VSEA 1B9DA 3T19A 5KGXA 4CGIA 1JLQA 1TKZA 3HO1A 3A2FA 1L3TA 3ISNC 2A1RA 4CJWA 3ZSYA 4DLGA 4FJLA 5DK5A 4OPKA 3AO5A 4CF0A 2P5OA 4CEDA 3QIOA 4DFKA 1IKVA 4RG8A 1SKWA 1N6QA 3L3VA 1D8YA 3V9ZA 2BE2A 3PX0A 2G8VA 1EETA 2ETJA 2IS3A 3PV8A 4J2DA 1CZBA 1LW0A 3AVNA 3V9XA 4HCCA 5SWMA 5HP1A 1N5YA 4J2BA 4CJLA 3P83D 4M41A 4AHUA 4NCGA 3AO4A 3QETA 4EP4A 1RDBA 3RR7A 4B9UA 4DMNA 2YV0X 1JLFA 1VK0A 3ZT0A 1TL3A 4CE9A 3DLGA 2BDPA 1LV5A 2KFNA 3VN5A 1R0AA 4CJFA 1WN7A 3C6TA 2B6AA 1B9FA 3OYFA 5HLFA 1C0MA 1NJZA 1X9MA 2YNFA 1SV5A 2A1SA 4N47A 4E7JA 2RF2A 4CJEA 3KTQA 4DU1A 3V1QA 5FRMA 1BQMA 4NYFA 1HQUA 3QINA 4KPYA 1S1WA 4FJMA 1UWBA 4DTMA 1NK9A 3SPYA 4DFMA 3V9WA 3AO1A 3SQ1A 4CJVA 2AJQA 2YNGA 4BWMA 4CEFA 4IBNA 1KLNA 1LWFA 4DSLA 2RN2A 2G8IA 2XHBA 4CJ3A 1Z26A 4DTPA 1BIUA 1VSIA 3QLHA 3FFIA 3KLHA 4DFJA 3NGYA 4JS4A 3LANA 1K6YA 1NK6A 1BHLA 4GW6A 2XY7A 3KK3A 4FJ7A 1RDDA 3HPHA 1U45A 1S5JA 4CEAA 2GUIA 2HW3A 1CLQA 3TAPA 4N41A 1U47A 1IH7A 3LPTA 3HYFA 3LP0A 4UQGA 3M8QA 4E0DA 1RT2A 4F3OA 4AHSA 4KHWA 1BCOA 1TKTA 4CJTA 3OYIA 3KLEA 4JS5A 3SNNA 3ZSWA 4KHQA 1HRHA 1GOAA 1WSEA 3TI0A 4KAZA 3AVCA 4RW8A 1NK7A 2IDOA 4B8CA 4B08A 2EHGA 1HJRA 3DLRA 1X9WA 1I39A 5D3GA 4FK0A 2ZE2A 2HHXA 4CJKA 4BE2A 1SL1A 5CY4A 4CFCA 4CHYA 3TAQA 1NJXA 4JRPA 2F96A 2KZZA 4LH4A 1ITGA 3SI6A 1QS4A 4CJ5A 5JS1A 5KRTA 3OYMA 4CHQA 5FRNA 1C6VA 1A5VA 3DLBA 2Y1IA 1LW2A 4DTXA 1W0HA 1DLOA 1F21A 3O3FA 2YNHA 1TV6A 1RBSA 3V81A 4KKOA 3OYNA 3P5JA 4CJQA 3ALYA 3OYKA 3KLFA 4Z4GA 2E6MA 4ZTJA 1LWCA 2KZMA 4FYDA 3NF7A 4QAGA 2Y1JA 4W5OA 3HK2A 4CJSA 3LWLA 4ID5A 3PX4A 5K14A 1BIZA 4LH5A 1L5UA 3BGRA 4HTUA 3THVA 4DTJA 1J9AA 2Z1IA 3OVNA 5HRPA 3KLGA 3G0ZA 3HT3A 1VSMA 1S6QA 3CYMA 2I5JA 3LALA 1KRPA 3QNOA 4KTQA 4CJ4A 4OKJA 4Y1DA 4E7HA 5SZTA 4HUGA 2PYLA 4KI4A 1KVCA 4M3WA 3OS1A 2DY4A 3VQ4A 4BWJA 1NK4A 1REVA 2HVIA 1WSGA 1SL0A 2D0BA 1FKOA 4F2SA 3MEEA 4E89A 1WNSA 2FBXA 4JLHA 1JL1A 1UA1A 1RTDA 4ELVA 1IKXA 1CXUA 4M3XA 4RW9A 3NGIA 4ELUA 4PY5A 3ZSZA 2FBVA 1D5AA 3L2QA 2XRIA 4PQUA 2JGUA 2QK9A 2D0AA 3HXMA 1IG9A 3S3NA 3TAEA 3NE6A 3SUPA 1TK8A 2YKMA 3ULDA 4FLWA 1SKRA 2HMIA 4FK2A 3U6FA 4FLVA 4K8ZA 4HCBA 4FJXA 1B92A 1TKXA 3HPOA 3SCXA 4EZ9A 4OGCA 1IO2A 3DM2A 2JLEA 2OPSA 3SJJA 4LSLA 1RBTA 3HP9A 2DFHA 1HMVA 2BGGA 1YTAA 4C8MA 5J2NA 1J54A 1UAXA 3L3UA 4I2QA 2G8HA 1HNIA 1TGOA 3I0SA 3VQDA 3WNGA 4CHZA 3O4QA 4CF2A 2P1JA 3RMDA 4QOZB 3LPUA 3TARA 3QNNA 2G8UA 1RBUA 2GBZA 3AVFA 4C8OA 1WAJA 4Z4HA 2HNDA 1VSDA 4H4MA 3SUQA 4J2EA 5I42A 1RDCA 2E6LA 2VG5A 3ZSVA 3DRPA 3QO9A 4CK2A 3KK1A 5EU7A 5KI6A 2X6SA 4CERA 4AHRA 3CFRA 1YVUA 1JXEA 3F9KA 3I0RA 4W5QA 1QQCA 3D0PA 3DRRA 3V9SA 1U49A 2F8SA 3AA4A 2VWJA 3TABA 3K5OA 4LY7A 4AHTA 4CF9A 4OKEA 4I9QA 1VSFA 2NUBA 3WNHA 4FLTA 2OA8A 4KO0A 3AA2A 1L3SA 4FJNA 4CEQA 1KFDA 2XY8A 3ZCMA 4CGFA 4DLEA 4CK3A 3MXIA 3DLHA 3OYJA 1KVAA 4WE1A 3ZT4A 4CHPA 1BI4B 3OYBA 1C1AA 1C0UA 2XY6A 2HHUA 2KTQA 1CXQA 1ZBIA 1YT3A 4KHNA 3TWHA 3S3OA 4XIUA 3NAEA 4AILC 4KFBA 3OYLA 4CF1A 4MQ3A 4DQPA 1NOZA 3DLKA 4IKFA 4OVLA 2DTUA 3NCIA 1XHZA 4FJGA 1DTTA 3AVBA 3L8BA 4O5BA 4NYNA 4F4KA 1KFSA 4HUFA 5CZ2A 3U3YA 1QE1A 2VG7A 4DQRA 4J2AA 2X78A 4FM1A 3DYAA 1S1UA 4KHUA 1NOYA 1SL2A 4FJKA 4C8KA 2HHQA 1VRUA 1XWLA 5JS2A 4FXDA 4CHNA 2G8KA 4B9LA 1RNHA 3IAYA 4FJ8A 2RKIA 4L8RB 3V1OA 3SV4A 5KGWA 2HNZA 1A5XA 3EY1A 3SV3A 4DSFA 3KD1E 4M42A 3M8PA 2ZD1A 1RT5A 4FLYA 2KQ2A 2DFFA 3KK2A 3RRHA 1NKCA 4FM2A 1WLJA 4FJIA 4CIEA 3NHGA 1D9DA 3NBPA 3NH0A 5HROA 4I7FA 4CHOA 4E7IA 4B9SA 1EKEA 4OKKA 3DMJA 4O4GA 1JLAA 3MAQA 4PWDA 1ZBUA 3OYCA 4EZ6A 1FKPA 3EYZA 2ZQBA 3VQ8A 3VA0A 1NJYA 3HPGA 2HHVA 4CIGA 5KRSA 2PYJA 3QEVA 2P5GA 1TL1A 3MEGA 3DOKA 4Z0UA 4CEEA 3RMBA 4W5RA 4GMJB 3L2RA 2XO7A 3CFPA 4DSJA 2Z1JA 3ZT2A 1HQEA 5I3UA 3K2PA 4CEBA 4C8NA 1VSKA 3LP2A 3O3GA 3KJVA 2WONA 3K5LA 3V9UA 1FK9A 4PUOA 4KREA 3HSTB 4HUEA 3RTVA 1S6PA 1VRTA 3HL8A 3B6OA 3KLIA 4CFDA 1Q9XA 1HNVA 1WSFA 3LP1A 5T7BA 4N56A 1QSYA 4B9VA 4FJHA 3K5MA 3AA3A 4JRQA 4OLAA 4RW6A 4LD0A 1RCHA 1KTQA 1WAFA 5CYMA 3TR8A 3VQ6A 3KKSA 3AVKA 1S9GA 3ZT3A 1VSLA 4DWIA 4OPJA 3C95A 4CJPA 1JKHA 3M8RA 4BDZA 1Q8IA 5C42A 4CEOA 3SZ2A 3VQAA 1C1BA 4YFUA 1SUQA 1HPZA 5HBMA 3OS2A 4FW1A 1RTIA 1TK5A 2OPQA 3DI6A 4ID1A 2YNIA 3AVHA 4AHCA 3L2WA 2FBYA 3F73A 3V6DA 2EX3A 2VG6A 1CZ9A 4BDPA 4AHVA 4DU4A 3T1AA 4BE0A 3BDPA 1UA0A 2ITGA 3O4NA 4W5TA 4PA1A 4E1MA 1RT1A 3SYZA 2HB5A 1X9SA 2OPPA 3O3HA 2OYQA 4DF8A 4M3YA 2X74A 1ASUA 2P51A 4GVMA 4M45A 1JLBA 3AVGA 1YTUA 1T03A 1TK0A 5CYQA 1RT4A 1QSLA 3QEXA 2ATQA 3HVRA 3VQ7A 3SQ2A 1RTHA 3NH1A 1J53A 4DS5A 4Q0BA 1DTQA 4DF4A 5HRRA 3S9HA 4FJJA 3HJFA 4LSNA 2XY5A 4Z4CA 5C25A 1S1TA 4KI6A 1ASVA 2B4JA 2Z1GA 4E19A 3NH2A 3MEDA 5HRSA 1ZBFA 3RMCA 1TAQA 3WNFA 4CECA 3M8SA 3LAMA 3PY8A 2YKNA 4EP5A 4B8AB 3T3FA 1S9EA 3VQEA 1S1XA 2PZSA 1EXQA 3AV9A 4MFBA 4CK1A 4DTUA 1RT7A 4KB1A 2HVHA 1EP4A 4BACA 1WSJA 1GOCA 3KIOA 1T8EA 4Z4IA 1BL3A 4M3ZA 2PY5A 1Z25A 1S1VA 3OYHA 4I2PA 4ICLA 3TANA 4KB0A 3AVIA 3NFAA 4DU3A 4FM0A 2QKKA 2HHTA 1L3VA 4ELTA 3UIQA 1X1PA 3K57A 3B6PA 3QEPA 4OLBA 3L2VA 3DRSA 3JSMA 3AVAA 3K58A 3LZJA 2FBTA 3VQCA 2E4LA 2OZMA 1Q9YA 3ITHA 3V4IA 4RW7A 1QTMA 1IKYA 4HVJA 1QSSA 4H4OA 1JLGA 4B9NA 4BDYA 2O4GA 4CFBA 2OZSA 3LP3A 3OS0A 2RPIA 1T05A 3ZSOA 3AO2A 4E1NA 3NGZA 3K59A 1RT3A 3LAKA 3IS9A 1HYZA 3G10A 1WSHA 3D45A 3HP6A 1U4BA 1D9FA 2LSNA 3QEWA 1C1CA 3NDKA 1ZYQA 3PO4A 4IG3A 3TAMA 1U04A 1SKSA 1NKEA 2O4IA 1MU2A 3ZSQA 2KFZA 4DS4A 3WNEA 1RILA 1O1WA 1NJWA 4O55A 3TAGA 1LAWA 1Y97A 5J2MA 3JYTA 4NCAA 4Z4EA 3VQ5A 4R5PA 4TSXA 4CGGA 3OY9A 3EZ5A 3SUNA 3IRXA 3SUOA 1J5OA 4F8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RBV A;  3E01 A;  4F3T A;  4ZHR A;  4DTR A;  2WOM A;  4G1Q A;  2D0C A;  4DSK A;  2QKB A;  2OPR A;  1GOB A;  4CEZ A;  4HHT A;  4BE1 A;  4OGE A;  4IDK A;  4KTZ A;  1JXB A;  3QES A;  1RDA A;  3QER A;  4B3O A;  1TVR A;  1A5W A;  3LWM A;  3AVM A;  1KCF A;  2W42 A;  2HHW A;  3VQP A;  4IFY A;  3RMA A;  2IOC A;  3OYD A;  4DTS A;  5KTQ A;  4KHS A;  2GV9 A;  3CQ8 A;  1JLE A;  3AA5 X;  5CZ1 A;  4DQQ A;  4KHY A;  1BQN A;  3MEC A;  5FRO A;  3K5N A;  2DFE A;  3AVJ A;  3DOL A;  2Q3S A;  4DTN A;  3KD5 E;  4FZY A;  3C94 A;  4DFP A;  3TAF A;  3OJS A;  2YHB A;  4CES A;  3AVL A;  1IKW A;  4OJR A;  2FC0 A;  1BGX T;  1VSH A;  3MXJ A;  3ZSX A;  4DQS A;  1L3U A;  3SQ4 A;  4K8X A;  4DSI A;  1WSI A;  4E7L A;  1BIS A;  4FCY A;  3CM5 A;  1UOC A;  1HYV A;  5E41 A;  4CGH A;  1ZBL A;  3P1G A;  5DMR A;  4FJ5 A;  3PUF A;  4DSE A;  1EX4 A;  1G15 A;  3H08 A;  3OYG A;  1BI4 A;  1NK8 A;  1BCM A;  1NK5 A;  4CIF A;  4N5S A;  4KV8 A;  4FJ9 A;  1JLC A;  1JL2 A;  2IC3 A;  1XC9 A;  4QCL A;  4C8L A;  1XI1 A;  4FVM A;  4H8K A;  2BAN A;  2VWK A;  1RT6 A;  4I9L A;  4NCB A;  2IGI A;  3ZSR A;  1T7P A;  1FXX A;  1KLM A;  3V1R A;  3IG1 A;  4CF8 A;  1KSP A;  4FW2 A;  3RR8 A;  3OYE A;  1ZBH A;  2QXF A;  3SPZ A;  2B5J A;  3NF6 A;  4YNQ A;  4FK4 A;  4W5N A;  5J1E A;  5J2Q A;  4AH9 A;  1XHX A;  2HNY A;  3CFO A;  4FLZ A;  5C24 A;  3LDS A;  3VQB A;  4KTW A;  4M3R A;  3CG7 A;  4CFA A;  3U3G A;  3OJU A;  4B9T A;  4FLX A;  1RTJ A;  3RWU A;  3MXM A;  4CCH A;  4DQI A;  1C0T A;  3VA3 A;  4DG1 A;  4E7K A;  3NF9 A;  3HM9 A;  3QEI A;  2HHS A;  4N76 A;  4RW4 A;  1TKD A;  1I3A A;  4FZZ A;  3KKR A;  3PX6 A;  1QHT A;  4O0J A;  5FDL A;  2YHA A;  2G8F A;  2IAJ A;  4Y1C A;  3ASM A;  2R7Y A;  2KW4 A;  4O0I A;  3AO3 A;  1U48 A;  4FZX C;  2X6N A;  2Z1H A;  4FLU A;  3QIP A;  4DTO A;  1RBR A;  4CGJ A;  1NKB A;  1KVB A;  3LZI A;  1ASW A;  4IG0 A;  4O44 A;  3ZT1 A;  3OYA A;  4M3T A;  2G8W A;  3HVT A;  3I8D A;  1TAU A;  3CM6 A;  4CGD A;  4KRF A;  4Q5V A;  5J2P A;  3RRG A;  4CJU A;  4B9M A;  1HYS A;  3L2U A;  3NF8 A;  1W9H A;  5HRN A;  1LWE A;  3SQ0 A;  2D5R A;  4ZTF A;  3C6U A;  4F2R A;  4M3U A;  3DLE A;  1VSJ A;  1LAV A;  4CJR A;  4Z4F A;  3VQ9 A;  3VQQ A;  3S3M A;  4IFV A;  1NK0 A;  2F8T A;  4E3S A;  3PO5 A;  1VSE A;  1B9D A;  3T19 A;  5KGX A;  4CGI A;  1JLQ A;  1TKZ A;  3HO1 A;  3A2F A;  1L3T A;  3ISN C;  2A1R A;  4CJW A;  3ZSY A;  4DLG A;  4FJL A;  5DK5 A;  4OPK A;  3AO5 A;  4CF0 A;  2P5O A;  4CED A;  3QIO A;  4DFK A;  1IKV A;  4RG8 A;  1SKW A;  1N6Q A;  3L3V A;  1D8Y A;  3V9Z A;  2BE2 A;  3PX0 A;  2G8V A;  1EET A;  2ETJ A;  2IS3 A;  3PV8 A;  4J2D A;  1CZB A;  1LW0 A;  3AVN A;  3V9X A;  4HCC A;  5SWM A;  5HP1 A;  1N5Y A;  4J2B A;  4CJL A;  3P83 D;  4M41 A;  4AHU A;  4NCG A;  3AO4 A;  3QET A;  4EP4 A;  1RDB A;  3RR7 A;  4B9U A;  4DMN A;  2YV0 X;  1JLF A;  1VK0 A;  3ZT0 A;  1TL3 A;  4CE9 A;  3DLG A;  2BDP A;  1LV5 A;  2KFN A;  3VN5 A;  1R0A A;  4CJF A;  1WN7 A;  3C6T A;  2B6A A;  1B9F A;  3OYF A;  5HLF A;  1C0M A;  1NJZ A;  1X9M A;  2YNF A;  1SV5 A;  2A1S A;  4N47 A;  4E7J A;  2RF2 A;  4CJE A;  3KTQ A;  4DU1 A;  3V1Q A;  5FRM A;  1BQM A;  4NYF A;  1HQU A;  3QIN A;  4KPY A;  1S1W A;  4FJM A;  1UWB A;  4DTM A;  1NK9 A;  3SPY A;  4DFM A;  3V9W A;  3AO1 A;  3SQ1 A;  4CJV A;  2AJQ A;  2YNG A;  4BWM A;  4CEF A;  4IBN A;  1KLN A;  1LWF A;  4DSL A;  2RN2 A;  2G8I A;  2XHB A;  4CJ3 A;  1Z26 A;  4DTP A;  1BIU A;  1VSI A;  3QLH A;  3FFI A;  3KLH A;  4DFJ A;  3NGY A;  4JS4 A;  3LAN A;  1K6Y A;  1NK6 A;  1BHL A;  4GW6 A;  2XY7 A;  3KK3 A;  4FJ7 A;  1RDD A;  3HPH A;  1U45 A;  1S5J A;  4CEA A;  2GUI A;  2HW3 A;  1CLQ A;  3TAP A;  4N41 A;  1U47 A;  1IH7 A;  3LPT A;  3HYF A;  3LP0 A;  4UQG A;  3M8Q A;  4E0D A;  1RT2 A;  4F3O A;  4AHS A;  4KHW A;  1BCO A;  1TKT A;  4CJT A;  3OYI A;  3KLE A;  4JS5 A;  3SNN A;  3ZSW A;  4KHQ A;  1HRH A;  1GOA A;  1WSE A;  3TI0 A;  4KAZ A;  3AVC A;  4RW8 A;  1NK7 A;  2IDO A;  4B8C A;  4B08 A;  2EHG A;  1HJR A;  3DLR A;  1X9W A;  1I39 A;  5D3G A;  4FK0 A;  2ZE2 A;  2HHX A;  4CJK A;  4BE2 A;  1SL1 A;  5CY4 A;  4CFC A;  4CHY A;  3TAQ A;  1NJX A;  4JRP A;  2F96 A;  2KZZ A;  4LH4 A;  1ITG A;  3SI6 A;  1QS4 A;  4CJ5 A;  5JS1 A;  5KRT A;  3OYM A;  4CHQ A;  5FRN A;  1C6V A;  1A5V A;  3DLB A;  2Y1I A;  1LW2 A;  4DTX A;  1W0H A;  1DLO A;  1F21 A;  3O3F A;  2YNH A;  1TV6 A;  1RBS A;  3V81 A;  4KKO A;  3OYN A;  3P5J A;  4CJQ A;  3ALY A;  3OYK A;  3KLF A;  4Z4G A;  2E6M A;  4ZTJ A;  1LWC A;  2KZM A;  4FYD A;  3NF7 A;  4QAG A;  2Y1J A;  4W5O A;  3HK2 A;  4CJS A;  3LWL A;  4ID5 A;  3PX4 A;  5K14 A;  1BIZ A;  4LH5 A;  1L5U A;  3BGR A;  4HTU A;  3THV A;  4DTJ A;  1J9A A;  2Z1I A;  3OVN A;  5HRP A;  3KLG A;  3G0Z A;  3HT3 A;  1VSM A;  1S6Q A;  3CYM A;  2I5J A;  3LAL A;  1KRP A;  3QNO A;  4KTQ A;  4CJ4 A;  4OKJ A;  4Y1D A;  4E7H A;  5SZT A;  4HUG A;  2PYL A;  4KI4 A;  1KVC A;  4M3W A;  3OS1 A;  2DY4 A;  3VQ4 A;  4BWJ A;  1NK4 A;  1REV A;  2HVI A;  1WSG A;  1SL0 A;  2D0B A;  1FKO A;  4F2S A;  3MEE A;  4E89 A;  1WNS A;  2FBX A;  4JLH A;  1JL1 A;  1UA1 A;  1RTD A;  4ELV A;  1IKX A;  1CXU A;  4M3X A;  4RW9 A;  3NGI A;  4ELU A;  4PY5 A;  3ZSZ A;  2FBV A;  1D5A A;  3L2Q A;  2XRI A;  4PQU A;  2JGU A;  2QK9 A;  2D0A A;  3HXM A;  1IG9 A;  3S3N A;  3TAE A;  3NE6 A;  3SUP A;  1TK8 A;  2YKM A;  3ULD A;  4FLW A;  1SKR A;  2HMI A;  4FK2 A;  3U6F A;  4FLV A;  4K8Z A;  4HCB A;  4FJX A;  1B92 A;  1TKX A;  3HPO A;  3SCX A;  4EZ9 A;  4OGC A;  1IO2 A;  3DM2 A;  2JLE A;  2OPS A;  3SJJ A;  4LSL A;  1RBT A;  3HP9 A;  2DFH A;  1HMV A;  2BGG A;  1YTA A;  4C8M A;  5J2N A;  1J54 A;  1UAX A;  3L3U A;  4I2Q A;  2G8H A;  1HNI A;  1TGO A;  3I0S A;  3VQD A;  3WNG A;  4CHZ A;  3O4Q A;  4CF2 A;  2P1J A;  3RMD A;  4QOZ B;  3LPU A;  3TAR A;  3QNN A;  2G8U A;  1RBU A;  2GBZ A;  3AVF A;  4C8O A;  1WAJ A;  4Z4H A;  2HND A;  1VSD A;  4H4M A;  3SUQ A;  4J2E A;  5I42 A;  1RDC A;  2E6L A;  2VG5 A;  3ZSV A;  3DRP A;  3QO9 A;  4CK2 A;  3KK1 A;  5EU7 A;  5KI6 A;  2X6S A;  4CER A;  4AHR A;  3CFR A;  1YVU A;  1JXE A;  3F9K A;  3I0R A;  4W5Q A;  1QQC A;  3D0P A;  3DRR A;  3V9S A;  1U49 A;  2F8S A;  3AA4 A;  2VWJ A;  3TAB A;  3K5O A;  4LY7 A;  4AHT A;  4CF9 A;  4OKE A;  4I9Q A;  1VSF A;  2NUB A;  3WNH A;  4FLT A;  2OA8 A;  4KO0 A;  3AA2 A;  1L3S A;  4FJN A;  4CEQ A;  1KFD A;  2XY8 A;  3ZCM A;  4CGF A;  4DLE A;  4CK3 A;  3MXI A;  3DLH A;  3OYJ A;  1KVA A;  4WE1 A;  3ZT4 A;  4CHP A;  1BI4 B;  3OYB A;  1C1A A;  1C0U A;  2XY6 A;  2HHU A;  2KTQ A;  1CXQ A;  1ZBI A;  1YT3 A;  4KHN A;  3TWH A;  3S3O A;  4XIU A;  3NAE A;  4AIL C;  4KFB A;  3OYL A;  4CF1 A;  4MQ3 A;  4DQP A;  1NOZ A;  3DLK A;  4IKF A;  4OVL A;  2DTU A;  3NCI A;  1XHZ A;  4FJG A;  1DTT A;  3AVB A;  3L8B A;  4O5B A;  4NYN A;  4F4K A;  1KFS A;  4HUF A;  5CZ2 A;  3U3Y A;  1QE1 A;  2VG7 A;  4DQR A;  4J2A A;  2X78 A;  4FM1 A;  3DYA A;  1S1U A;  4KHU A;  1NOY A;  1SL2 A;  4FJK A;  4C8K A;  2HHQ A;  1VRU A;  1XWL A;  5JS2 A;  4FXD A;  4CHN A;  2G8K A;  4B9L A;  1RNH A;  3IAY A;  4FJ8 A;  2RKI A;  4L8R B;  3V1O A;  3SV4 A;  5KGW A;  2HNZ A;  1A5X A;  3EY1 A;  3SV3 A;  4DSF A;  3KD1 E;  4M42 A;  3M8P A;  2ZD1 A;  1RT5 A;  4FLY A;  2KQ2 A;  2DFF A;  3KK2 A;  3RRH A;  1NKC A;  4FM2 A;  1WLJ A;  4FJI A;  4CIE A;  3NHG A;  1D9D A;  3NBP A;  3NH0 A;  5HRO A;  4I7F A;  4CHO A;  4E7I A;  4B9S A;  1EKE A;  4OKK A;  3DMJ A;  4O4G A;  1JLA A;  3MAQ A;  4PWD A;  1ZBU A;  3OYC A;  4EZ6 A;  1FKP A;  3EYZ A;  2ZQB A;  3VQ8 A;  3VA0 A;  1NJY A;  3HPG A;  2HHV A;  4CIG A;  5KRS A;  2PYJ A;  3QEV A;  2P5G A;  1TL1 A;  3MEG A;  3DOK A;  4Z0U A;  4CEE A;  3RMB A;  4W5R A;  4GMJ B;  3L2R A;  2XO7 A;  3CFP A;  4DSJ A;  2Z1J A;  3ZT2 A;  1HQE A;  5I3U A;  3K2P A;  4CEB A;  4C8N A;  1VSK A;  3LP2 A;  3O3G A;  3KJV A;  2WON A;  3K5L A;  3V9U A;  1FK9 A;  4PUO A;  4KRE A;  3HST B;  4HUE A;  3RTV A;  1S6P A;  1VRT A;  3HL8 A;  3B6O A;  3KLI A;  4CFD A;  1Q9X A;  1HNV A;  1WSF A;  3LP1 A;  5T7B A;  4N56 A;  1QSY A;  4B9V A;  4FJH A;  3K5M A;  3AA3 A;  4JRQ A;  4OLA A;  4RW6 A;  4LD0 A;  1RCH A;  1KTQ A;  1WAF A;  5CYM A;  3TR8 A;  3VQ6 A;  3KKS A;  3AVK A;  1S9G A;  3ZT3 A;  1VSL A;  4DWI A;  4OPJ A;  3C95 A;  4CJP A;  1JKH A;  3M8R A;  4BDZ A;  1Q8I A;  5C42 A;  4CEO A;  3SZ2 A;  3VQA A;  1C1B A;  4YFU A;  1SUQ A;  1HPZ A;  5HBM A;  3OS2 A;  4FW1 A;  1RTI A;  1TK5 A;  2OPQ A;  3DI6 A;  4ID1 A;  2YNI A;  3AVH A;  4AHC A;  3L2W A;  2FBY A;  3F73 A;  3V6D A;  2EX3 A;  2VG6 A;  1CZ9 A;  4BDP A;  4AHV A;  4DU4 A;  3T1A A;  4BE0 A;  3BDP A;  1UA0 A;  2ITG A;  3O4N A;  4W5T A;  4PA1 A;  4E1M A;  1RT1 A;  3SYZ A;  2HB5 A;  1X9S A;  2OPP A;  3O3H A;  2OYQ A;  4DF8 A;  4M3Y A;  2X74 A;  1ASU A;  2P51 A;  4GVM A;  4M45 A;  1JLB A;  3AVG A;  1YTU A;  1T03 A;  1TK0 A;  5CYQ A;  1RT4 A;  1QSL A;  3QEX A;  2ATQ A;  3HVR A;  3VQ7 A;  3SQ2 A;  1RTH A;  3NH1 A;  1J53 A;  4DS5 A;  4Q0B A;  1DTQ A;  4DF4 A;  5HRR A;  3S9H A;  4FJJ A;  3HJF A;  4LSN A;  2XY5 A;  4Z4C A;  5C25 A;  1S1T A;  4KI6 A;  1ASV A;  2B4J A;  2Z1G A;  4E19 A;  3NH2 A;  3MED A;  5HRS A;  1ZBF A;  3RMC A;  1TAQ A;  3WNF A;  4CEC A;  3M8S A;  3LAM A;  3PY8 A;  2YKN A;  4EP5 A;  4B8A B;  3T3F A;  1S9E A;  3VQE A;  1S1X A;  2PZS A;  1EXQ A;  3AV9 A;  4MFB A;  4CK1 A;  4DTU A;  1RT7 A;  4KB1 A;  2HVH A;  1EP4 A;  4BAC A;  1WSJ A;  1GOC A;  3KIO A;  1T8E A;  4Z4I A;  1BL3 A;  4M3Z A;  2PY5 A;  1Z25 A;  1S1V A;  3OYH A;  4I2P A;  4ICL A;  3TAN A;  4KB0 A;  3AVI A;  3NFA A;  4DU3 A;  4FM0 A;  2QKK A;  2HHT A;  1L3V A;  4ELT A;  3UIQ A;  1X1P A;  3K57 A;  3B6P A;  3QEP A;  4OLB A;  3L2V A;  3DRS A;  3JSM A;  3AVA A;  3K58 A;  3LZJ A;  2FBT A;  3VQC A;  2E4L A;  2OZM A;  1Q9Y A;  3ITH A;  3V4I A;  4RW7 A;  1QTM A;  1IKY A;  4HVJ A;  1QSS A;  4H4O A;  1JLG A;  4B9N A;  4BDY A;  2O4G A;  4CFB A;  2OZS A;  3LP3 A;  3OS0 A;  2RPI A;  1T05 A;  3ZSO A;  3AO2 A;  4E1N A;  3NGZ A;  3K59 A;  1RT3 A;  3LAK A;  3IS9 A;  1HYZ A;  3G10 A;  1WSH A;  3D45 A;  3HP6 A;  1U4B A;  1D9F A;  2LSN A;  3QEW A;  1C1C A;  3NDK A;  1ZYQ A;  3PO4 A;  4IG3 A;  3TAM A;  1U04 A;  1SKS A;  1NKE A;  2O4I A;  1MU2 A;  3ZSQ A;  2KFZ A;  4DS4 A;  3WNE A;  1RIL A;  1O1W A;  1NJW A;  4O55 A;  3TAG A;  1LAW A;  1Y97 A;  5J2M A;  3JYT A;  4NCA A;  4Z4E A;  3VQ5 A;  4R5P A;  4TSX A;  4CGG A;  3OY9 A;  3EZ5 A;  3SUN A;  3IRX A;  3SUO A;  1J5O A;  4F8R A; 
#chains in the Genus database with same CATH topology
 4JK9 A;  3A5L C;  2A5X A;  4ZHR A;  2F7T A;  3T1H K;  4IDH A;  3M3Z A;  4OGE A;  3ZET B;  4IDK A;  5HL7 L;  4BRM A;  4B3O A;  4K0K K;  2HBK A;  2WC9 A;  2IOC A;  2GV9 A;  3CQ8 A;  1JLE A;  4DQQ A;  1NGC A;  4DTN A;  2Q3S A;  3A5N C;  4YOW A;  4DFP A;  3OJS A;  4CES A;  1VSH A;  2Q36 A;  4JKH A;  3ZSX A;  3SQ4 A;  1WSI A;  1R59 O;  4MDA A;  1BOT O;  3HTV A;  4H5R A;  5EX5 A;  3OYG A;  1QQO A;  3MMV A;  5AQL A;  4KH4 A;  1JL2 A;  2IC3 A;  4FWM A;  1XC9 A;  4C8L A;  1QZ5 A;  1RT6 A;  2E2N A;  4I9L A;  4NCB A;  1FXX A;  3V1R A;  3IG1 A;  4JHD B;  4CW7 B;  5C0Y A;  5BN9 A;  4KTW A;  1DT9 A;  4M3R A;  3CG7 A;  4CFA A;  3OJU A;  3EKU A;  1RTJ A;  4FWQ A;  3MXM A;  3H46 O;  5AQJ A;  3UKR B;  4DG1 A;  4RW4 A;  1TKD A;  4B1V A;  3UE5 A;  2PAV A;  3PX6 A;  3Q7C A;  1QHT A;  2YHA A;  2GTD A;  2FF6 A;  2KW4 A;  3ENH A;  2O8D A;  4J8F A;  4FZX C;  4B1X B;  1RBR A;  1NWK A;  2P9P B;  1ASW A;  4IG0 A;  3ZT1 A;  4R79 A;  5AQF A;  2G8W A;  3HRG A;  4H5V A;  5LY3 A;  4KRF A;  5J2P A;  5C2F A;  1HYS A;  3LDL A;  3CPW M;  1W9H A;  4F2R A;  4A59 A;  4Z4F A;  3R1X A;  3VQ9 A;  1P90 A;  1RFQ A;  4LF8 K;  3RSE A;  3T19 A;  2WTU A;  5KGX A;  1TKZ A;  1WBD A;  1L3T A;  3ISN C;  4CJW A;  3ZSY A;  3VMF B;  2P5O A;  3MDQ A;  1SKW A;  3D7E O;  3V9Z A;  3PX0 A;  2G8V A;  4J2D A;  1CZB A;  3AVN A;  3J8A A;  3TTD A;  5HP1 A;  4MDB A;  1YVN A;  3P83 D;  1RDB A;  4B9U A;  3VF6 A;  2YV0 X;  4CE9 A;  2KFN A;  3CJ9 A;  1LV5 A;  3VN5 A;  1R0A A;  1WN7 A;  3C6T A;  5C10 A;  5HLF A;  1NJZ A;  4N47 A;  1SV5 A;  2RF2 A;  4DU1 A;  1BQM A;  3QIN A;  4WQ5 A;  1S1W A;  4DTM A;  1NK9 A;  3A8Y A;  3E9O A;  1IG8 A;  3N4Q A;  2AJQ A;  4DV2 K;  4CEF A;  4IBN A;  4CZJ A;  4DTP A;  1BIU A;  3DAW A;  4GW6 A;  2XY7 A;  1NGG A;  2ZJP L;  4JKE A;  2IVP A;  1J5E K;  2GUI A;  3F2K A;  1Q18 A;  3HYF A;  4UQG A;  4E0D A;  3M8Q A;  3OHR A;  3M6G A;  4IZ9 A;  3ZSW A;  1HRH A;  1GOA A;  4JD2 B;  3MN6 A;  1I94 K;  4B08 A;  2EHG A;  1HJR A;  2NRV A;  1X9W A;  4YOT A;  4FK0 A;  3MCP A;  1YJN N;  2YHX A;  4BE2 A;  4AF1 A;  3SI6 A;  3ZX0 A;  5KRT A;  4WFA L;  1A5V A;  3DLB A;  4OX9 K;  3H1V X;  1F21 A;  1J6Z A;  1TV6 A;  3BP8 A;  1BIZ A;  2ASP A;  5K14 A;  1GLD G;  3QBX A;  3BGR A;  4HTU A;  2OTL N;  3KLG A;  4LFB K;  4H0O A;  5AJ3 K;  1VSM A;  3CYM A;  4IOX A;  3SJH A;  2H3G X;  1IV0 A;  4BRG A;  4M3W A;  3O9U A;  3QDK A;  5LL6 Z;  4BWJ A;  4X62 K;  4BY9 C;  4FPB A;  5AQI A;  3R3L A;  2HVI A;  1WSG A;  1Q7Y O;  2E2Q A;  4H0Y B;  4E89 A;  1OH8 A;  3G4S N;  1QQN A;  3U9Z A;  3JS6 A;  4ELU A;  2A6A A;  1IJJ A;  1WOQ A;  2FBV A;  3ULE A;  4PQU A;  2XRI A;  2JGU A;  2HMP A;  1IG9 A;  5TKY A;  5GAH P;  4FLW A;  4FLV A;  3BF3 A;  2JLE A;  1RBT A;  2DFH A;  1KC8 O;  3R6M A;  4C8M A;  2G8H A;  3VQD A;  2O8E A;  3O4Q A;  3RMD A;  4UY8 O;  5EY4 A;  4O8K A;  1WAJ A;  1HPM A;  2HND A;  4Z4H A;  5JVH L;  3OBW A;  4NO7 A;  2E6L A;  2VG5 A;  3ZSV A;  3DRP A;  3KK1 A;  5EU7 A;  4EHU A;  2X6S A;  3I55 N;  3CFR A;  1YJ9 N;  1JXE A;  3I0R A;  4M7Y A;  2PBD A;  1KXP A;  3DRR A;  2F8S A;  3K5O A;  3CME N;  4I9Q A;  4OKE A;  3TSU A;  3HZ6 A;  3KHY A;  1VSF A;  4K43 A;  1GLJ O;  4FJN A;  4CEQ A;  2XY8 A;  4CGF A;  4DLE A;  4DHY A;  4CK3 A;  3MXI A;  1C1A A;  1CXQ A;  3S3O A;  4AQY K;  1NNE A;  3OTO K;  4CF1 A;  4MQ3 A;  1TUU A;  4IKF A;  1XHZ A;  3A0I X;  1NGH A;  5CZ2 A;  3FE1 A;  3C65 A;  4C1N K;  3CQY A;  3J7Z O;  3CPE A;  1SL2 A;  2HHQ A;  4FWK A;  5AQG A;  4JKA A;  1RNH A;  3IAY A;  4CZH A;  3EO3 A;  5KGW A;  3SV3 A;  3KD1 E;  4BVP A;  2DFF A;  3RRH A;  4FJI A;  3AGR A;  3C6A A;  3NH0 A;  2NRT A;  4I7F A;  4E7I A;  2CGJ A;  3MAQ A;  4LF4 K;  3SLC A;  1NJY A;  3VA0 A;  4A5B A;  5M1K A;  2HHV A;  2GWK A;  5E26 A;  4CEE A;  3DOK A;  3RMB A;  3EL2 A;  1RGI A;  3VEV A;  3K5L A;  4DR6 K;  1VSK A;  4BR7 A;  3O3G A;  4PUO A;  2WON A;  5FPM A;  3RTV A;  1N33 K;  2O8D B;  1VRT A;  4CFD A;  1WSF A;  1QSY A;  3K5M A;  5I9E B;  3O1W A;  1T6C A;  3VQ6 A;  4OLA A;  3TR8 A;  1WAF A;  3HOT A;  1HNZ K;  4YDU A;  4DWI A;  3IFR A;  3VER A;  3VQA A;  3CD6 N;  5HBM A;  2J4R A;  1RTI A;  1TK5 A;  2FBY A;  2VG6 A;  4AHV A;  4DU4 A;  4W5T A;  1BA1 A;  1LCU A;  1X9S A;  3O3H A;  1FW6 A;  4M3Y A;  1YXQ A;  2AP1 A;  3AVG A;  1YTU A;  3E1Y A;  5A2Q O;  1J53 A;  4Q0B A;  1DTQ A;  3HJF A;  2XY5 A;  1N8R O;  3THY B;  1S1T A;  4KI6 A;  3CF5 L;  1ASV A;  3ZEU A;  4LF5 K;  3OW2 M;  1TAQ A;  3LAM A;  2YKN A;  4EP5 A;  3T3F A;  4CZG A;  2PZS A;  1EXQ A;  3O5B A;  4CK1 A;  4RCH A;  5AR0 A;  5EVZ A;  4Z4I A;  2I7N A;  2PY5 A;  2A42 A;  2WBN A;  2D0O A;  4IFE A;  3F5T A;  4DV6 K;  3TSP A;  4DU3 A;  2QKK A;  2HHT A;  4OLB A;  2OZM A;  4QS7 A;  4E1J A;  5LJW A;  2E4L A;  4DR3 K;  3ITH A;  2P9K A;  4RW7 A;  4M63 C;  4HVJ A;  3T1Y K;  1C0G A;  3TU5 A;  4Z94 A;  4B9N A;  2NNW A;  3LP3 A;  3CET A;  3D45 A;  3HP6 A;  2O8C B;  1ZYQ A;  1CZA N;  1X3N A;  4JI5 K;  1SKS A;  2D4W A;  4XH1 A;  4JKC A;  1RIL A;  3TAG A;  4Z4E A;  3VQ5 A;  3SUN A;  1J5O A;  3IRX A;  4FVU A;  3GG4 A;  3CC4 N;  1RBV A;  4DTR A;  2D0C A;  4X66 K;  3C7N B;  3QES A;  3QER A;  3W3D A;  1KCF A;  3AGK A;  3VQP A;  5KTQ A;  3O08 A;  1Q82 O;  3KD5 E;  3C94 A;  3C6H A;  1K8K B;  1BIS A;  5M1F A;  4K25 A;  1GLC G;  4GV3 A;  1HYV A;  5FPN A;  3CCR N;  1VQ7 N;  3CJB A;  4DSE A;  3CCV N;  1N34 K;  3H08 A;  4DQ8 A;  2D0P A;  4PKG A;  3VET A;  4CIF A;  4N5S A;  4JI6 K;  4H0V B;  3BY5 A;  5KQD A;  1XI1 A;  4FVM A;  4H8K A;  2VWK A;  3CJC A;  1T7P A;  2E20 A;  1KSP A;  3RR8 A;  3OYE A;  1ZBH A;  4W5N A;  3NF6 A;  3AAQ A;  4YNQ A;  3IDH A;  3CCQ N;  5J1E A;  4FK4 A;  5C24 A;  4LF6 K;  3U3G A;  4FLX A;  4DQI A;  4CCH A;  2P9P A;  2IVO A;  3NF9 A;  3QEI A;  5GAG P;  1I3A A;  4O0J A;  4M7X A;  5LMN K;  2IAJ A;  4B1U B;  2R7Y A;  1U48 A;  2X6N A;  2Z1H A;  4DTO A;  3QIP A;  4JV5 K;  2P9I A;  4GV9 A;  3VEZ A;  4XEI A;  4CGD A;  2YHY A;  2O8F A;  5HRN A;  1LWE A;  5GAD P;  3C6U A;  2IIR A;  1VSJ A;  1VQ6 N;  3SMP A;  1B9D A;  1JCE A;  3HO1 A;  2O8F B;  5JIC A;  3O6W A;  4WFB L;  4DLG A;  4FWR A;  5DK5 A;  4OPK A;  5M1O A;  4CED A;  3BUZ B;  1D8Y A;  1BG3 A;  4RG8 A;  1N6Q A;  3GOI A;  5DM6 L;  4LFA K;  1EET A;  2IS3 A;  4ISG A;  1P8Z A;  1N5Y A;  4CJL A;  4M41 A;  3TTF A;  4AHU A;  3AO4 A;  4EP4 A;  4JYA K;  4DMN A;  2V52 B;  2QXL A;  3DLG A;  2B6A A;  1B9F A;  3OYF A;  2UYT A;  1C0M A;  2A1S A;  4CJ7 A;  3NMU A;  1HQU A;  4B3M K;  4KPY A;  4IOC L;  1UWB A;  3SPY A;  4DFM A;  3MN9 A;  1LWF A;  1HR0 K;  1Z26 A;  3FFI A;  4DFJ A;  1NGB A;  1NK6 A;  1BHL A;  3KK3 A;  4JD2 A;  1RDD A;  5ADX H;  2QWN A;  1SQK A;  5AZI A;  5KPR A;  1VQ8 N;  1ATN A;  1CLQ A;  1U47 A;  1IH7 A;  5C2D A;  3LP0 A;  3KZB A;  1RT2 A;  3M1F A;  4F3O A;  3A5O C;  4AHS A;  5H1S Q;  4CJT A;  1TKT A;  4CD3 A;  4JS5 A;  4KHQ A;  3AVC A;  4RW8 A;  3OBY A;  5MLC Q;  3DLR A;  5D3G A;  2HHX A;  4PL8 A;  4JI2 K;  3D2F B;  2Q97 A;  4LH4 A;  5JS1 A;  4XH5 A;  4WQ5 C;  4CHQ A;  3ZEU B;  5FRN A;  2E1Z A;  2Y1I A;  1W0H A;  1DLO A;  5F1X A;  2YNH A;  4DV4 K;  3WXI A;  2ZF5 O;  4W5O A;  3AY9 A;  4CJS A;  4ID5 A;  1L5U A;  4DTJ A;  1J9A A;  3OVN A;  4B1Z A;  3VPZ A;  3CCU N;  4KTQ A;  4BRA A;  4JI3 K;  4OKJ A;  4HUG A;  4KI4 A;  1KVC A;  3SBT A;  3VEW A;  3VQ4 A;  1NK4 A;  4CZF A;  4H5N A;  4DV3 K;  1XC3 A;  1FKO A;  2QW9 A;  4BRN A;  4F2S A;  1RTD A;  1UA1 A;  4M3X A;  4RW9 A;  3TTC A;  1ZC6 A;  1O13 A;  2O8C A;  2VGN A;  5CHI A;  3S3N A;  1K8A O;  2NRZ A;  3TAE A;  1E4F T;  3ULD A;  1SKR A;  1V4T A;  3LM2 A;  3SCX A;  2P9N A;  1JJ2 M;  3DM2 A;  4LSL A;  1HMV A;  2BGG A;  2VWB A;  1UAX A;  3L3U A;  1HNI A;  1TGO A;  3I0S A;  3WNG A;  1IBK K;  2P1J A;  3QNN A;  2QWO A;  2GBZ A;  3SUQ A;  1VSD A;  4H4M A;  4FPA A;  3HBT A;  1RDC A;  3QO9 A;  4CK2 A;  5M1P A;  2ZJQ L;  3F9K A;  1QQC A;  3V9S A;  3AA4 A;  3DXM A;  2VWJ A;  3TAB A;  4LY7 A;  4CF9 A;  3LM9 A;  3TSQ A;  1XMQ K;  2NUB A;  4IO9 L;  1T6D A;  4FLT A;  4WQ4 C;  3D2F A;  1KFD A;  2ASM A;  3CER A;  5KQ8 A;  4DR1 K;  3DLH A;  3OYJ A;  4BVO A;  4WE1 A;  3NAE A;  4KFB A;  1EO1 A;  2D1K A;  3UB5 A;  4O8U A;  1NOZ A;  4DQP A;  2DTU A;  3VGK A;  3AVB A;  3L8B A;  2YCH A;  4O5B A;  4F4K A;  3U3Y A;  5AZI B;  1S1U A;  4KHU A;  1KAX A;  2RE2 A;  5AQM A;  2QWM A;  5JS2 A;  2UXD K;  4CHN A;  2RKI A;  4L8R B;  3V1O A;  3SV4 A;  2HF4 A;  4H03 B;  2HNZ A;  3EY1 A;  5AQN A;  5AFU A;  4CD1 A;  3M8P A;  2ZD1 A;  4FLY A;  2KQ2 A;  3CCL N;  2CH5 A;  4FWS A;  1NKC A;  3NHG A;  4B9S A;  2FLO A;  1EKE A;  4H5W A;  3OYC A;  1FKP A;  3EYZ A;  3HPG A;  5AZJ B;  2PYJ A;  3QEV A;  5JVG L;  1KD1 O;  2P5G A;  1TL1 A;  4Z0U A;  2AA4 A;  4EHT A;  3PLA A;  3L2R A;  3CFP A;  2Z1J A;  3ZT2 A;  4QS8 A;  3KJV A;  4KRE A;  2P9U A;  4FWL A;  4PKI A;  2A3Z A;  3LP1 A;  4B9V A;  1NLV A;  3AA3 A;  4RW6 A;  3QFP A;  3KKS A;  1NU0 A;  1VSL A;  3C95 A;  1JKH A;  4ILH A;  3M8R A;  1Q8I A;  2Q0R A;  3SZ2 A;  1C1B A;  3OS2 A;  3J81 O;  4FW1 A;  5AQZ A;  2YNI A;  3AVH A;  3L2W A;  1CZ9 A;  2OTJ N;  4BE0 A;  4PA1 A;  1U6Z A;  3O9S A;  4E1M A;  2A40 A;  1GLB G;  1RT1 A;  3Q7B A;  3SYZ A;  2BUP A;  2OYQ A;  4M45 A;  1RDU A;  4DUY K;  3ATV A;  4JK7 A;  3CCS N;  5CYQ A;  1BDG A;  3VQ7 A;  3K0S A;  1FJG K;  4CVN E;  4DF4 A;  4JK8 A;  2O8B B;  4B3S K;  5M1Q A;  3CIP A;  4I6M A;  4LSN A;  1NBW A;  2Z1G A;  1K9M O;  5JLF A;  4FOE A;  2ZWH A;  3THW A;  4CEC A;  4B8A B;  2Q2R A;  2GEM A;  4DTU A;  5AQY A;  1GLL O;  1EP4 A;  3U4L A;  4FO0 A;  3KIO A;  1EQY A;  1OH6 A;  1BL3 A;  4M3Z A;  3OYH A;  4I2P A;  1MWM A;  3AAP A;  3THW B;  4DV7 K;  3O9Q A;  2E2O A;  1L3V A;  4ELT A;  3B6P A;  3QEP A;  2O8E B;  3DRS A;  1Q81 O;  2W41 A;  3LZJ A;  2ASO A;  1Q9Y A;  4JKB A;  2PFU A;  4H4O A;  2VCP A;  3K9J A;  2O4G A;  4GNI A;  3ZSO A;  3AO2 A;  3VOV A;  3K59 A;  3T69 A;  1RT3 A;  4BC4 A;  1HYZ A;  4IJN A;  4K41 A;  2P9S B;  1U4B A;  4JEP A;  1IBM K;  1Z05 A;  2LSN A;  3EE8 A;  1V4S A;  3NDK A;  5JLH A;  5TKW A;  2UXC K;  2O4I A;  4DS4 A;  5KPT A;  4NCA A;  4CGG A;  3OY9 A;  3CMA N;  4F3T A;  4G1Q A;  4B1Y B;  2QKB A;  2OPR A;  1GOB A;  4CEZ A;  4HHT A;  4BE1 A;  1RDA A;  2UUA K;  2P9S A;  1TVR A;  2P9L B;  4DV0 K;  4H0T B;  2W42 A;  2HHW A;  4IFY A;  3RMA A;  3OYD A;  3GBT A;  5AQX A;  1VQM N;  5AQW A;  4X65 K;  5CZ1 A;  3MEC A;  3K5N A;  4FZY A;  3TAF A;  2GUP A;  2YHB A;  4GY2 B;  1BUP A;  1IKW A;  4OJR A;  2FXU A;  3MXJ A;  1YAG A;  4E7L A;  1QVG M;  4A2A A;  3CM5 A;  1UOC A;  3ZX2 A;  4FJ5 A;  3PUF A;  3K9K A;  1G15 A;  5JMV A;  2F4V K;  1BI4 A;  4KV8 A;  1JLC A;  3E9P A;  4DV5 K;  2IGI A;  4IO8 A;  3ZSR A;  4CZL A;  4CF8 A;  5BRF A;  4FW2 A;  4BRO A;  2QXF A;  3SPZ A;  2B5J A;  4OO1 J;  5B8H A;  3PSI A;  3G71 N;  3LDS A;  4B9T A;  4JKD A;  2NRH A;  3RWU A;  4QS9 A;  4B9Q A;  4E7K A;  1K73 O;  4N76 A;  2QWQ A;  5BPL A;  1SS6 A;  3J7A P;  2G8F A;  5IT9 O;  3ASM A;  4O0I A;  4BC2 A;  1T44 A;  4JHD A;  1BU6 O;  2HST A;  4FL9 A;  3J80 O;  1NKB A;  1KVB A;  1K8K A;  4M3T A;  3HVT A;  3I8D A;  1TAU A;  2VQF K;  4B9M A;  3RRG A;  4JI0 K;  4CJU A;  3NVK A;  1Q86 O;  3L2U A;  2D5R A;  3C0B A;  2NLX A;  1ATR A;  4A2B A;  3VQQ A;  4IFV A;  2QM1 A;  3GE1 A;  4IEE A;  5BR8 K;  2E5L K;  1VSE A;  3ENO A;  4CGI A;  1JLQ A;  3A2F A;  3MCA B;  3WXK A;  4FJL A;  4CF0 A;  3QIO A;  4DFK A;  1IKV A;  1X3M A;  3L3V A;  4BGB A;  2BE2 A;  3VES A;  2F9W A;  2ETJ A;  1LW0 A;  4HCC A;  3V9X A;  4J2B A;  3O4W A;  4BRL A;  3ZET A;  3HSC A;  1JLF A;  1VK0 A;  2QWR A;  1TL3 A;  3O9T A;  4KH5 A;  3ZT0 A;  2BDP A;  2Q31 A;  5EXW A;  4CJF A;  3T7Z A;  3IMX A;  4PKH A;  4B3R K;  3O80 A;  2V7Y A;  3O1B A;  4CJE A;  3KTQ A;  2P9K B;  1QZ6 A;  4NYF A;  4IXC A;  4CZE A;  4FOI A;  3FZL A;  3VEO A;  3SQ1 A;  1NGA A;  4CJV A;  2YNG A;  4DV1 K;  5FLX O;  2GWJ A;  3QFU A;  1KLN A;  4DSL A;  2G8I A;  2XHB A;  4B3T K;  2W6L A;  2WUS A;  1VSI A;  3QLH A;  4JS4 A;  1K6Y A;  2V51 B;  1S5J A;  2HW3 A;  3QBW A;  4N41 A;  3LPT A;  1DEJ A;  2UUC K;  4ISE A;  4KHW A;  1BCO A;  3OYI A;  1YI2 N;  1NJI O;  3EN9 A;  1N36 K;  1WSE A;  3H3O B;  3UKU A;  3TI0 A;  4KAZ A;  1VQN N;  2IDO A;  4LC9 B;  1I39 A;  4WFN L;  1SL1 A;  4O5F A;  4CFC A;  3TAQ A;  1NJX A;  2F96 A;  1ITG A;  3OYM A;  2HF3 A;  2DPN A;  4BRE A;  1LW2 A;  4DTX A;  5FPD A;  4F9O A;  1RBS A;  3V81 A;  3BF1 A;  3P5J A;  4CJQ A;  3OYK A;  1YIJ N;  2E6M A;  4ZTJ A;  1LWC A;  3HK2 A;  2W40 A;  3PX4 A;  4LH5 A;  3DXK B;  1NM1 A;  1S3X A;  3VTH A;  3THV A;  2YJF A;  3G0Z A;  1TUY A;  1S6Q A;  1KRP A;  2I5J A;  3QNO A;  1E3M A;  4CJ4 A;  4E7H A;  2PYL A;  2NZT A;  3OS1 A;  2DY4 A;  2QTD A;  3WEE B;  2VYP A;  3QML A;  3H3N O;  3MEE A;  2FBX A;  1JL1 A;  1OH7 A;  4BQL A;  4PY5 A;  3FGU A;  2YHW A;  2QK9 A;  4BRP A;  3HXM A;  3F9M A;  4RTF D;  1TK8 A;  4FK2 A;  1VQ5 N;  2HMI A;  4HCB A;  4FJX A;  1B92 A;  3HPO A;  4EZ9 A;  1VHX A;  3UKU B;  3KWG A;  4JKF A;  1YTA A;  2E1Y A;  5GIP A;  5J2N A;  2FSN A;  4AM6 A;  4CHZ A;  4CF2 A;  2ZGZ A;  3R9P A;  3LPU A;  3TAR A;  1TYQ B;  2G8U A;  2HBM A;  3GDQ A;  3AVF A;  4C8O A;  4BC5 A;  2FSK A;  4J2E A;  3SAH A;  4GKJ K;  5BR9 A;  4L3Q A;  5KI6 A;  2FF3 B;  4AHR A;  5ELZ A;  1YVU A;  4BR0 A;  1X9J A;  5GIN A;  5AQT A;  3PIP L;  1BO5 O;  4GVE A;  3VEX A;  3WNH A;  2OA8 A;  5ADX A;  3AA2 A;  3IUC A;  4YOV A;  2HBL A;  1MWK A;  5GAE P;  4JI4 K;  3WXL A;  3CCJ N;  1KVA A;  2YI1 A;  4CHP A;  2HHU A;  1W97 L;  1ZBI A;  1VAZ A;  4KHN A;  3WEE A;  1NGD A;  1VQP N;  3CC7 N;  4OVL A;  1HLU A;  3MX2 A;  4NYN A;  1KFS A;  4J2A A;  5AQH A;  4DQR A;  3LDO A;  4FM1 A;  1NOY A;  3WQU A;  4FJK A;  4C8K A;  3DLL L;  1VRU A;  1XWL A;  4FXD A;  3UKR A;  4FJ8 A;  3MK6 A;  3SMS A;  2BH1 A;  4G9Z A;  1RT5 A;  3KK2 A;  5AQV A;  3L0Q A;  1RDW X;  1WLJ A;  3W0L A;  4YOX A;  3NBP A;  4CHO A;  5EOY A;  3DMJ A;  4O4G A;  4DKW A;  2CGK A;  3QIC A;  1M90 O;  3VQ8 A;  4WQ4 A;  4IEI A;  2I7P A;  4GMJ B;  5AQU A;  1Z6R A;  2XO7 A;  3V9U A;  1XNR K;  3I33 A;  4BG9 A;  4HUE A;  1Q9X A;  3JAM O;  3HL8 A;  1HNV A;  5T7B A;  4N56 A;  2ZM6 K;  4Y0W A;  4YOR A;  4JRQ A;  4X64 K;  1KTQ A;  5CYM A;  1MA9 B;  4BR9 A;  3AVK A;  1S9G A;  3ZT3 A;  4V19 S;  4CJP A;  5C42 A;  4C1N I;  4CEO A;  5AQP A;  2HOE A;  3FFK B;  3DI6 A;  3F73 A;  4AHC A;  3V6D A;  2QWP A;  3MWP A;  4BDP A;  3T1A A;  3BDP A;  2ITG A;  4LF9 K;  3G6E N;  4BC3 A;  4KHP K;  2HB5 A;  4DF8 A;  1NGF A;  1ASU A;  2P51 A;  4MLE A;  4CZK A;  1ZXO A;  1RT4 A;  1HNW K;  3QEX A;  2ATQ A;  3HVR A;  4H0P A;  3G25 A;  4YOY A;  2OAN A;  2UUB K;  3SBG A;  2UXB K;  2B4J A;  4E19 A;  3MED A;  5HRS A;  3I56 N;  3RMC A;  4JI1 K;  2ZGY A;  1BA0 A;  1U2V B;  3WNF A;  3M8S A;  3CCM N;  1VQK N;  2ITM A;  3M5R A;  1HKB A;  3VQE A;  1S1X A;  3AV9 A;  4MFB A;  1RT7 A;  4KB1 A;  4LFC K;  2HVH A;  3WXJ A;  4BAC A;  4H0X B;  1WSJ A;  1WB9 A;  4H5T A;  1S1V A;  3WT0 A;  4BRK A;  3U9D A;  3NFA A;  4FM0 A;  1W7A A;  1X1P A;  3JSM A;  3BZC A;  3AVA A;  2FBT A;  3VQC A;  4IOA L;  3L4I A;  5F0X A;  4WYB A;  1JLG A;  4OPH A;  4BDY A;  2RPI A;  4JI8 K;  4E1N A;  1T3V A;  5BN8 A;  3LAK A;  1NMD A;  3IS9 A;  1WSH A;  1DGK N;  5AQR A;  3RVC A;  3PO4 A;  3TAM A;  3VGM A;  2GX9 A;  5LJV A;  3C7N A;  1MU2 A;  1KAY A;  3ZSQ A;  1N32 K;  3BZK A;  2P9U B;  4DCH A;  1NJW A;  3I8B A;  3JYT A;  1XMO K;  3SUO A;  1DKG D;  4NLC A;  4F8R A;  1D4X A;  3E01 A;  2WOM A;  4DSK A;  1S22 A;  4U67 L;  3L6Q A;  3GL1 A;  3ID6 A;  4KTZ A;  1JXB A;  2JWK A;  1SZ2 A;  4BRC A;  1A5W A;  3LWM A;  4B1W B;  4MLH A;  3AVM A;  1Y64 A;  2YX6 A;  4DTS A;  4KHS A;  3AA5 X;  1BQN A;  1LOT B;  5FRO A;  2DFE A;  3AVJ A;  3DOL A;  3THX B;  2QEX N;  1JCF A;  5AZJ A;  1E4G T;  3AVL A;  2FC0 A;  1BGX T;  1L3U A;  4DQS A;  4K8X A;  1QVF M;  1GLA G;  3ZX3 A;  4DSI A;  1QQM A;  2E8A A;  4FCY A;  3MWT A;  5E41 A;  4CGH A;  4MO5 A;  3S41 A;  3P1G A;  5DMR A;  1ZBL A;  1S72 N;  4I6M B;  1EX4 A;  1VQL N;  4NLB A;  3D6R A;  1NK8 A;  1BCM A;  1NK5 A;  4FJ9 A;  4BRF A;  4QCL A;  2BAN A;  3MN7 A;  1KLM A;  4HWI A;  1M1K O;  4DR2 K;  5J2Q A;  4AH9 A;  4EFH A;  1XHX A;  2HNY A;  2YJE A;  3CFO A;  4FLZ A;  3P4I A;  3VQB A;  3ID8 A;  1HNX K;  4JN4 A;  1HKG A;  4KH6 A;  3D2E B;  1C0T A;  3VA3 A;  3HM9 A;  2HHS A;  1NGJ A;  4FZZ A;  3KKR A;  4KBO A;  5FDL A;  3CHW A;  4Y1C A;  3DJC A;  3AO3 A;  4FLU A;  3CC2 N;  4CGJ A;  3LZI A;  3OYA A;  4O44 A;  3CM6 A;  1VQO N;  3ZYY X;  1BWF O;  4A57 A;  4Q5V A;  3H45 C;  2OCE A;  1OVQ A;  4FWN A;  2P9I B;  3NF8 A;  4RWT A;  3SQ0 A;  4ZTF A;  4M3U A;  3DLE A;  4CJR A;  1C0F A;  1LAV A;  4BRI A;  2F8T A;  3S3M A;  1NK0 A;  5CR4 A;  2W6K A;  1NMN A;  4E3S A;  1ZBS A;  4ILG B;  3PO5 A;  3WQT A;  4PL7 A;  3FZK A;  3CI5 A;  4DR7 K;  4LF7 K;  2HHH K;  2A1R A;  3EZW A;  3AO5 A;  4WCE L;  1OKJ A;  4KHY A;  3PV8 A;  1XNQ K;  4CZI A;  3QB0 A;  5SWM A;  4NCG A;  3WUH A;  3QET A;  3RR7 A;  4JI7 K;  4GV6 A;  1KAZ A;  3PIO L;  1X9M A;  2YNF A;  4E7J A;  1HKC A;  4YY3 K;  3V1Q A;  5FRM A;  1MDU B;  4FWP A;  3J7Y P;  4FJM A;  4FSV A;  1YHQ N;  4CI6 A;  3V9W A;  3AO1 A;  4BWM A;  1EWR A;  2RN2 A;  4BR2 A;  4CJ3 A;  2IVN A;  4BR4 A;  4BG8 A;  3FZM A;  4BR5 A;  3KLH A;  3NGY A;  3LAN A;  4FJ7 A;  2KKZ A;  4XH4 A;  1SAZ A;  3HPH A;  1U45 A;  4CEA A;  2Q0U A;  3TAP A;  3MN5 A;  5F2R A;  3U8X A;  3VF4 A;  3VEN A;  3KLE A;  3SNN A;  2GEL A;  3EE9 A;  1NK7 A;  1IBL K;  4B8C A;  3JXU A;  2ZE2 A;  4YHH K;  4CJK A;  4IWV A;  5CY4 A;  4CHY A;  1YIT N;  4JRP A;  1ATS A;  2KZZ A;  4CBU A;  1U2V A;  1QS4 A;  1OVY A;  4CJ5 A;  3FR0 A;  1C6V A;  3R8E A;  5KPZ A;  2F9T A;  3O3F A;  3VEY A;  4KKO A;  3OYN A;  3ALY A;  2KZM A;  3KLF A;  4Z4G A;  4BRD A;  4FYD A;  3NF7 A;  4QAG A;  2Y1J A;  3LWL A;  3CXC M;  1QHA A;  2Z1I A;  5HRP A;  3HT3 A;  3LL3 A;  3KVG A;  1NGE A;  3LAL A;  5AFU H;  4Y1D A;  5SZT A;  4FWO A;  4GKK K;  4IJA A;  2KLA A;  1REV A;  2BTF A;  1SL0 A;  2D0B A;  3EKS A;  4A61 A;  1WNS A;  5C15 A;  4JLH A;  4U7B A;  1ESV A;  4ELV A;  1IKX A;  1CXU A;  4AM7 A;  3NGI A;  3ZSZ A;  4DUZ K;  3L2Q A;  1D5A A;  3WXM B;  4NXM K;  2D0A A;  5C12 A;  5AQS A;  3P39 A;  2HBJ A;  3NE6 A;  3SUP A;  2YKM A;  3U6F A;  4K8Z A;  3LDQ A;  1TKX A;  3H6E A;  4MO4 A;  4OGC A;  5AQO A;  1IO2 A;  2OPS A;  3SJJ A;  3HP9 A;  3MX5 A;  1J54 A;  4I2Q A;  4BQZ A;  2QWL A;  5IWA K;  4QOZ B;  2JWL A;  4NXN K;  1HJO A;  1YJW N;  1RBU A;  5BPN A;  4A62 A;  3CQX A;  3VGL A;  5I42 A;  2VQE K;  4CER A;  4BRQ A;  1VQ9 N;  4W5Q A;  2P9N B;  3D0P A;  1U49 A;  2E88 A;  4AHT A;  3AAR A;  3HOS A;  1NG9 A;  3H1Q A;  1WUA A;  4JNE A;  5FPE A;  4BGA A;  1YF5 L;  4A5A A;  3DXK A;  4KO0 A;  2NRR A;  3VF2 A;  1L3S A;  5BPM A;  3ZCM A;  3HM8 A;  4YOU A;  3ZT4 A;  2ZJR L;  1BI4 B;  2RHK A;  3OYB A;  1C0U A;  2XY6 A;  2EWS A;  2KTQ A;  1YT3 A;  1G99 A;  3TWH A;  2NRX A;  4XIU A;  4AIL C;  3OYL A;  5BRE A;  3DLK A;  3SAF A;  3NCI A;  4FJG A;  1DTT A;  3OA9 A;  5DM7 L;  4EIA A;  3BEX A;  3ULE B;  4HUF A;  1QE1 A;  2QI2 A;  2VG7 A;  2X78 A;  4YDU C;  3DYA A;  3DXM B;  1KQS M;  2FSJ A;  3TPQ A;  3IKM A;  2G8K A;  3EEQ A;  4B9L A;  1HUX A;  3LDN A;  3D2E A;  1A5X A;  4DSF A;  4M42 A;  5M1N A;  3DWL A;  4CBX A;  2P9L A;  5BRH A;  1H1V A;  4WF9 L;  4FM2 A;  2CH6 A;  4CIE A;  3PSF A;  4CZM A;  5HRO A;  1D9D A;  2KHO A;  4OKK A;  1EWQ A;  1JLA A;  4PWD A;  1ZBU A;  4EZ6 A;  2ZQB A;  3ENB A;  3HI0 A;  5CE3 A;  4CIG A;  5KRS A;  4EAH D;  3A5M C;  1GLF O;  3MEG A;  4DR5 K;  4HTL A;  1W2B M;  3CCE N;  4W5R A;  3ATU A;  4DSJ A;  5I3U A;  1HQE A;  4NB4 A;  4CEB A;  3K2P A;  4C8N A;  3CJ7 A;  3O9R A;  3LP2 A;  3P31 A;  2E2P A;  1FK9 A;  3HST B;  1S6P A;  3B6O A;  3KLI A;  5E84 A;  3RSE B;  1HX1 A;  4FJH A;  1XUP O;  2A41 A;  5HOO A;  3B8A X;  3L4Q A;  4LD0 A;  1RCH A;  4JKG B;  4OPJ A;  5LMU K;  4BDZ A;  4OPA A;  4YFU A;  1SUQ A;  1HPZ A;  2OPQ A;  4ID1 A;  1GLE G;  2EX3 A;  3KWI A;  3SK3 A;  1UA0 A;  3O4N A;  4K42 A;  3N4P A;  1XQS C;  3FZF A;  3VTI A;  5BRD A;  2OPP A;  4JAX A;  2X74 A;  3LDP A;  4GVM A;  1JLB A;  2O8B A;  4PHT X;  1NGI A;  1T03 A;  1TK0 A;  1QSL A;  3P38 A;  3SQ2 A;  1RTH A;  2V7Z A;  4JKG A;  3NH1 A;  4DS5 A;  4CBW A;  5HRR A;  3S9H A;  1ILY A;  2NRW A;  4FJJ A;  4DB3 A;  4Z4C A;  5C25 A;  2CGL A;  5AQQ A;  3NH2 A;  2WFB A;  1ZBF A;  4ISF A;  4C23 A;  3PY8 A;  3THY A;  1S9E A;  1YUW A;  3FLC O;  1VQ4 N;  2QA4 N;  5AQK A;  1T8E A;  1GOC A;  4BRH A;  1Z25 A;  3TAN A;  1OH5 A;  4ICL A;  2VGM A;  2Q1N A;  4KB0 A;  3AVI A;  5GIO A;  1TYQ A;  3O8M A;  3K57 A;  3UIQ A;  1JCG A;  3L2V A;  3K58 A;  4ILJ A;  3V4I A;  1QTM A;  1IKY A;  3ZLJ A;  3NVM A;  1QSS A;  1WBB A;  4CFB A;  2OZS A;  3E9L A;  1T05 A;  3OS0 A;  4DR4 K;  3NGZ A;  3E66 A;  1D9F A;  3G10 A;  3QEW A;  1C1C A;  3CJA A;  4IG3 A;  1U04 A;  1NKE A;  3SAG A;  2KFZ A;  3WNE A;  1O1W A;  3CJ1 A;  4O55 A;  1LAW A;  1Y97 A;  5J2M A;  3THX A;  4R5P A;  4TSX A;  3EZ5 A;  3KK7 A;  2UU9 K;  3FZH A; 
#chains in the Genus database with same CATH homology
 1RBV A;  3E01 A;  4F3T A;  4ZHR A;  4DTR A;  2WOM A;  4G1Q A;  2D0C A;  4DSK A;  2QKB A;  2OPR A;  1GOB A;  4CEZ A;  4HHT A;  4BE1 A;  4OGE A;  4IDK A;  4KTZ A;  1JXB A;  3QES A;  1RDA A;  3QER A;  4B3O A;  1TVR A;  1A5W A;  3LWM A;  3AVM A;  1KCF A;  2W42 A;  2HHW A;  3VQP A;  4IFY A;  3RMA A;  2IOC A;  3OYD A;  4DTS A;  5KTQ A;  4KHS A;  2GV9 A;  3CQ8 A;  1JLE A;  3AA5 X;  5CZ1 A;  4DQQ A;  4KHY A;  1BQN A;  3MEC A;  5FRO A;  3K5N A;  2DFE A;  3AVJ A;  3DOL A;  2Q3S A;  4DTN A;  3KD5 E;  4FZY A;  3C94 A;  4DFP A;  3TAF A;  3OJS A;  2YHB A;  4CES A;  3AVL A;  1IKW A;  4OJR A;  2FC0 A;  1BGX T;  1VSH A;  3MXJ A;  3ZSX A;  4DQS A;  1L3U A;  3SQ4 A;  4K8X A;  4DSI A;  1WSI A;  4E7L A;  1BIS A;  4FCY A;  3CM5 A;  1UOC A;  1HYV A;  5E41 A;  4CGH A;  1ZBL A;  3P1G A;  5DMR A;  4FJ5 A;  3PUF A;  4DSE A;  1EX4 A;  1G15 A;  3H08 A;  3OYG A;  1BI4 A;  1NK8 A;  1BCM A;  1NK5 A;  4CIF A;  4N5S A;  4KV8 A;  4FJ9 A;  1JLC A;  1JL2 A;  2IC3 A;  1XC9 A;  4QCL A;  4C8L A;  1XI1 A;  4FVM A;  4H8K A;  2BAN A;  2VWK A;  1RT6 A;  4I9L A;  4NCB A;  2IGI A;  3ZSR A;  1T7P A;  1FXX A;  1KLM A;  3V1R A;  3IG1 A;  4CF8 A;  1KSP A;  4FW2 A;  3RR8 A;  3OYE A;  1ZBH A;  2QXF A;  3SPZ A;  2B5J A;  3NF6 A;  4YNQ A;  4FK4 A;  4W5N A;  5J1E A;  5J2Q A;  4AH9 A;  1XHX A;  2HNY A;  3CFO A;  4FLZ A;  5C24 A;  3LDS A;  3VQB A;  4KTW A;  4M3R A;  3CG7 A;  4CFA A;  3U3G A;  3OJU A;  4B9T A;  4FLX A;  1RTJ A;  3RWU A;  3MXM A;  4CCH A;  4DQI A;  1C0T A;  3VA3 A;  4DG1 A;  4E7K A;  3NF9 A;  3HM9 A;  3QEI A;  2HHS A;  4N76 A;  4RW4 A;  1TKD A;  1I3A A;  4FZZ A;  3KKR A;  3PX6 A;  1QHT A;  4O0J A;  5FDL A;  2YHA A;  2G8F A;  2IAJ A;  4Y1C A;  3ASM A;  2R7Y A;  2KW4 A;  4O0I A;  3AO3 A;  1U48 A;  4FZX C;  2X6N A;  2Z1H A;  4FLU A;  3QIP A;  4DTO A;  1RBR A;  4CGJ A;  1NKB A;  1KVB A;  3LZI A;  1ASW A;  4IG0 A;  4O44 A;  3ZT1 A;  3OYA A;  4M3T A;  2G8W A;  3HVT A;  3I8D A;  1TAU A;  3CM6 A;  4CGD A;  4KRF A;  4Q5V A;  5J2P A;  3RRG A;  4CJU A;  4B9M A;  1HYS A;  3L2U A;  3NF8 A;  1W9H A;  5HRN A;  1LWE A;  3SQ0 A;  2D5R A;  4ZTF A;  3C6U A;  4F2R A;  4M3U A;  3DLE A;  1VSJ A;  1LAV A;  4CJR A;  4Z4F A;  3VQ9 A;  3VQQ A;  3S3M A;  4IFV A;  1NK0 A;  2F8T A;  4E3S A;  3PO5 A;  1VSE A;  1B9D A;  3T19 A;  5KGX A;  4CGI A;  1JLQ A;  1TKZ A;  3HO1 A;  3A2F A;  1L3T A;  3ISN C;  2A1R A;  4CJW A;  3ZSY A;  4DLG A;  4FJL A;  5DK5 A;  4OPK A;  3AO5 A;  4CF0 A;  2P5O A;  4CED A;  3QIO A;  4DFK A;  1IKV A;  4RG8 A;  1SKW A;  1N6Q A;  3L3V A;  1D8Y A;  3V9Z A;  2BE2 A;  3PX0 A;  2G8V A;  1EET A;  2ETJ A;  2IS3 A;  3PV8 A;  4J2D A;  1CZB A;  1LW0 A;  3AVN A;  3V9X A;  4HCC A;  5SWM A;  5HP1 A;  1N5Y A;  4J2B A;  4CJL A;  3P83 D;  4M41 A;  4AHU A;  4NCG A;  3AO4 A;  3QET A;  4EP4 A;  1RDB A;  3RR7 A;  4B9U A;  4DMN A;  2YV0 X;  1JLF A;  1VK0 A;  3ZT0 A;  1TL3 A;  4CE9 A;  3DLG A;  2BDP A;  1LV5 A;  2KFN A;  3VN5 A;  1R0A A;  4CJF A;  1WN7 A;  3C6T A;  2B6A A;  1B9F A;  3OYF A;  5HLF A;  1C0M A;  1NJZ A;  1X9M A;  2YNF A;  1SV5 A;  2A1S A;  4N47 A;  4E7J A;  2RF2 A;  4CJE A;  3KTQ A;  4DU1 A;  3V1Q A;  5FRM A;  1BQM A;  4NYF A;  1HQU A;  3QIN A;  4KPY A;  1S1W A;  4FJM A;  1UWB A;  4DTM A;  1NK9 A;  3SPY A;  4DFM A;  3V9W A;  3AO1 A;  3SQ1 A;  4CJV A;  2AJQ A;  2YNG A;  4BWM A;  4CEF A;  4IBN A;  1KLN A;  1LWF A;  4DSL A;  2RN2 A;  2G8I A;  2XHB A;  4CJ3 A;  1Z26 A;  4DTP A;  1BIU A;  1VSI A;  3QLH A;  3FFI A;  3KLH A;  4DFJ A;  3NGY A;  4JS4 A;  3LAN A;  1K6Y A;  1NK6 A;  1BHL A;  4GW6 A;  2XY7 A;  3KK3 A;  4FJ7 A;  1RDD A;  3HPH A;  1U45 A;  1S5J A;  4CEA A;  2GUI A;  2HW3 A;  1CLQ A;  3TAP A;  4N41 A;  1U47 A;  1IH7 A;  3LPT A;  3HYF A;  3LP0 A;  4UQG A;  3M8Q A;  4E0D A;  1RT2 A;  4F3O A;  4AHS A;  4KHW A;  1BCO A;  1TKT A;  4CJT A;  3OYI A;  3KLE A;  4JS5 A;  3SNN A;  3ZSW A;  4KHQ A;  1HRH A;  1GOA A;  1WSE A;  3TI0 A;  4KAZ A;  3AVC A;  4RW8 A;  1NK7 A;  2IDO A;  4B8C A;  4B08 A;  2EHG A;  1HJR A;  3DLR A;  1X9W A;  1I39 A;  5D3G A;  4FK0 A;  2ZE2 A;  2HHX A;  4CJK A;  4BE2 A;  1SL1 A;  5CY4 A;  4CFC A;  4CHY A;  3TAQ A;  1NJX A;  4JRP A;  2F96 A;  2KZZ A;  4LH4 A;  1ITG A;  3SI6 A;  1QS4 A;  4CJ5 A;  5JS1 A;  5KRT A;  3OYM A;  4CHQ A;  5FRN A;  1C6V A;  1A5V A;  3DLB A;  2Y1I A;  1LW2 A;  4DTX A;  1W0H A;  1DLO A;  1F21 A;  3O3F A;  2YNH A;  1TV6 A;  1RBS A;  3V81 A;  4KKO A;  3OYN A;  3P5J A;  4CJQ A;  3ALY A;  3OYK A;  3KLF A;  4Z4G A;  2E6M A;  4ZTJ A;  1LWC A;  2KZM A;  4FYD A;  3NF7 A;  4QAG A;  2Y1J A;  4W5O A;  3HK2 A;  4CJS A;  3LWL A;  4ID5 A;  3PX4 A;  5K14 A;  1BIZ A;  4LH5 A;  1L5U A;  3BGR A;  4HTU A;  3THV A;  4DTJ A;  1J9A A;  2Z1I A;  3OVN A;  5HRP A;  3KLG A;  3G0Z A;  3HT3 A;  1VSM A;  1S6Q A;  3CYM A;  2I5J A;  3LAL A;  1KRP A;  3QNO A;  4KTQ A;  4CJ4 A;  4OKJ A;  4Y1D A;  4E7H A;  5SZT A;  4HUG A;  2PYL A;  4KI4 A;  1KVC A;  4M3W A;  3OS1 A;  2DY4 A;  3VQ4 A;  4BWJ A;  1NK4 A;  1REV A;  2HVI A;  1WSG A;  1SL0 A;  2D0B A;  1FKO A;  4F2S A;  3MEE A;  4E89 A;  1WNS A;  2FBX A;  4JLH A;  1JL1 A;  1UA1 A;  1RTD A;  4ELV A;  1IKX A;  1CXU A;  4M3X A;  4RW9 A;  3NGI A;  4ELU A;  4PY5 A;  3ZSZ A;  2FBV A;  1D5A A;  3L2Q A;  2XRI A;  4PQU A;  2JGU A;  2QK9 A;  2D0A A;  3HXM A;  1IG9 A;  3S3N A;  3TAE A;  3NE6 A;  3SUP A;  1TK8 A;  2YKM A;  3ULD A;  4FLW A;  1SKR A;  2HMI A;  4FK2 A;  3U6F A;  4FLV A;  4K8Z A;  4HCB A;  4FJX A;  1B92 A;  1TKX A;  3HPO A;  3SCX A;  4EZ9 A;  4OGC A;  1IO2 A;  3DM2 A;  2JLE A;  2OPS A;  3SJJ A;  4LSL A;  1RBT A;  3HP9 A;  2DFH A;  1HMV A;  2BGG A;  1YTA A;  4C8M A;  5J2N A;  1J54 A;  1UAX A;  3L3U A;  4I2Q A;  2G8H A;  1HNI A;  1TGO A;  3I0S A;  3VQD A;  3WNG A;  4CHZ A;  3O4Q A;  4CF2 A;  2P1J A;  3RMD A;  4QOZ B;  3LPU A;  3TAR A;  3QNN A;  2G8U A;  1RBU A;  2GBZ A;  3AVF A;  4C8O A;  1WAJ A;  4Z4H A;  2HND A;  1VSD A;  4H4M A;  3SUQ A;  4J2E A;  5I42 A;  1RDC A;  2E6L A;  2VG5 A;  3ZSV A;  3DRP A;  3QO9 A;  4CK2 A;  3KK1 A;  5EU7 A;  5KI6 A;  2X6S A;  4CER A;  4AHR A;  3CFR A;  1YVU A;  1JXE A;  3F9K A;  3I0R A;  4W5Q A;  1QQC A;  3D0P A;  3DRR A;  3V9S A;  1U49 A;  2F8S A;  3AA4 A;  2VWJ A;  3TAB A;  3K5O A;  4LY7 A;  4AHT A;  4CF9 A;  4OKE A;  4I9Q A;  1VSF A;  2NUB A;  3WNH A;  4FLT A;  2OA8 A;  4KO0 A;  3AA2 A;  1L3S A;  4FJN A;  4CEQ A;  1KFD A;  2XY8 A;  3ZCM A;  4CGF A;  4DLE A;  4CK3 A;  3MXI A;  3DLH A;  3OYJ A;  1KVA A;  4WE1 A;  3ZT4 A;  4CHP A;  1BI4 B;  3OYB A;  1C1A A;  1C0U A;  2XY6 A;  2HHU A;  2KTQ A;  1CXQ A;  1ZBI A;  1YT3 A;  4KHN A;  3TWH A;  3S3O A;  4XIU A;  3NAE A;  4AIL C;  4KFB A;  3OYL A;  4CF1 A;  4MQ3 A;  4DQP A;  1NOZ A;  3DLK A;  4IKF A;  4OVL A;  2DTU A;  3NCI A;  1XHZ A;  4FJG A;  1DTT A;  3AVB A;  3L8B A;  4O5B A;  4NYN A;  4F4K A;  1KFS A;  4HUF A;  5CZ2 A;  3U3Y A;  1QE1 A;  2VG7 A;  4DQR A;  4J2A A;  2X78 A;  4FM1 A;  3DYA A;  1S1U A;  4KHU A;  1NOY A;  1SL2 A;  4FJK A;  4C8K A;  2HHQ A;  1VRU A;  1XWL A;  5JS2 A;  4FXD A;  4CHN A;  2G8K A;  4B9L A;  1RNH A;  3IAY A;  4FJ8 A;  2RKI A;  4L8R B;  3V1O A;  3SV4 A;  5KGW A;  2HNZ A;  1A5X A;  3EY1 A;  3SV3 A;  4DSF A;  3KD1 E;  4M42 A;  3M8P A;  2ZD1 A;  1RT5 A;  4FLY A;  2KQ2 A;  2DFF A;  3KK2 A;  3RRH A;  1NKC A;  4FM2 A;  1WLJ A;  4FJI A;  4CIE A;  3NHG A;  1D9D A;  3NBP A;  3NH0 A;  5HRO A;  4I7F A;  4CHO A;  4E7I A;  4B9S A;  1EKE A;  4OKK A;  3DMJ A;  4O4G A;  1JLA A;  3MAQ A;  4PWD A;  1ZBU A;  3OYC A;  4EZ6 A;  1FKP A;  3EYZ A;  2ZQB A;  3VQ8 A;  3VA0 A;  1NJY A;  3HPG A;  2HHV A;  4CIG A;  5KRS A;  2PYJ A;  3QEV A;  2P5G A;  1TL1 A;  3MEG A;  3DOK A;  4Z0U A;  4CEE A;  3RMB A;  4W5R A;  4GMJ B;  3L2R A;  2XO7 A;  3CFP A;  4DSJ A;  2Z1J A;  3ZT2 A;  1HQE A;  5I3U A;  3K2P A;  4CEB A;  4C8N A;  1VSK A;  3LP2 A;  3O3G A;  3KJV A;  2WON A;  3K5L A;  3V9U A;  1FK9 A;  4PUO A;  4KRE A;  3HST B;  4HUE A;  3RTV A;  1S6P A;  1VRT A;  3HL8 A;  3B6O A;  3KLI A;  4CFD A;  1Q9X A;  1HNV A;  1WSF A;  3LP1 A;  5T7B A;  4N56 A;  1QSY A;  4B9V A;  4FJH A;  3K5M A;  3AA3 A;  4JRQ A;  4OLA A;  4RW6 A;  4LD0 A;  1RCH A;  1KTQ A;  1WAF A;  5CYM A;  3TR8 A;  3VQ6 A;  3KKS A;  3AVK A;  1S9G A;  3ZT3 A;  1VSL A;  4DWI A;  4OPJ A;  3C95 A;  4CJP A;  1JKH A;  3M8R A;  4BDZ A;  1Q8I A;  5C42 A;  4CEO A;  3SZ2 A;  3VQA A;  1C1B A;  4YFU A;  1SUQ A;  1HPZ A;  5HBM A;  3OS2 A;  4FW1 A;  1RTI A;  1TK5 A;  2OPQ A;  3DI6 A;  4ID1 A;  2YNI A;  3AVH A;  4AHC A;  3L2W A;  2FBY A;  3F73 A;  3V6D A;  2EX3 A;  2VG6 A;  1CZ9 A;  4BDP A;  4AHV A;  4DU4 A;  3T1A A;  4BE0 A;  3BDP A;  1UA0 A;  2ITG A;  3O4N A;  4W5T A;  4PA1 A;  4E1M A;  1RT1 A;  3SYZ A;  2HB5 A;  1X9S A;  2OPP A;  3O3H A;  2OYQ A;  4DF8 A;  4M3Y A;  2X74 A;  1ASU A;  2P51 A;  4GVM A;  4M45 A;  1JLB A;  3AVG A;  1YTU A;  1T03 A;  1TK0 A;  5CYQ A;  1RT4 A;  1QSL A;  3QEX A;  2ATQ A;  3HVR A;  3VQ7 A;  3SQ2 A;  1RTH A;  3NH1 A;  1J53 A;  4DS5 A;  4Q0B A;  1DTQ A;  4DF4 A;  5HRR A;  3S9H A;  4FJJ A;  3HJF A;  4LSN A;  2XY5 A;  4Z4C A;  5C25 A;  1S1T A;  4KI6 A;  1ASV A;  2B4J A;  2Z1G A;  4E19 A;  3NH2 A;  3MED A;  5HRS A;  1ZBF A;  3RMC A;  1TAQ A;  3WNF A;  4CEC A;  3M8S A;  3LAM A;  3PY8 A;  2YKN A;  4EP5 A;  4B8A B;  3T3F A;  1S9E A;  3VQE A;  1S1X A;  2PZS A;  1EXQ A;  3AV9 A;  4MFB A;  4CK1 A;  4DTU A;  1RT7 A;  4KB1 A;  2HVH A;  1EP4 A;  4BAC A;  1WSJ A;  1GOC A;  3KIO A;  1T8E A;  4Z4I A;  1BL3 A;  4M3Z A;  2PY5 A;  1Z25 A;  1S1V A;  3OYH A;  4I2P A;  4ICL A;  3TAN A;  4KB0 A;  3AVI A;  3NFA A;  4DU3 A;  4FM0 A;  2QKK A;  2HHT A;  1L3V A;  4ELT A;  3UIQ A;  1X1P A;  3K57 A;  3B6P A;  3QEP A;  4OLB A;  3L2V A;  3DRS A;  3JSM A;  3AVA A;  3K58 A;  3LZJ A;  2FBT A;  3VQC A;  2E4L A;  2OZM A;  1Q9Y A;  3ITH A;  3V4I A;  4RW7 A;  1QTM A;  1IKY A;  4HVJ A;  1QSS A;  4H4O A;  1JLG A;  4B9N A;  4BDY A;  2O4G A;  4CFB A;  2OZS A;  3LP3 A;  3OS0 A;  2RPI A;  1T05 A;  3ZSO A;  3AO2 A;  4E1N A;  3NGZ A;  3K59 A;  1RT3 A;  3LAK A;  3IS9 A;  1HYZ A;  3G10 A;  1WSH A;  3D45 A;  3HP6 A;  1U4B A;  1D9F A;  2LSN A;  3QEW A;  1C1C A;  3NDK A;  1ZYQ A;  3PO4 A;  4IG3 A;  3TAM A;  1U04 A;  1SKS A;  1NKE A;  2O4I A;  1MU2 A;  3ZSQ A;  2KFZ A;  4DS4 A;  3WNE A;  1RIL A;  1O1W A;  1NJW A;  4O55 A;  3TAG A;  1LAW A;  1Y97 A;  5J2M A;  3JYT A;  4NCA A;  4Z4E A;  3VQ5 A;  4R5P A;  4TSX A;  4CGG A;  3OY9 A;  3EZ5 A;  3SUN A;  3IRX A;  3SUO A;  1J5O A;  4F8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...