1QS4A

Core domain of hiv-1 integrase complexed with mg++ and 1-(5-chloroindol-3-yl)-3-hydroxy-3-(2h-tetrazol-5-yl)-propenone
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
154
structure length
150
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (HIV-1 INTEGRASE (E.C.2.7.7.49))
publication title Structure of the HIV-1 integrase catalytic domain complexed with an inhibitor: a platform for antiviral drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 47
structure length 150
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1qs4A00
2G8VA 3K2PA 3HVTA 3LDSA 4KHYA 4OKKA 4BE1A 1U49A 1BGXT 3CYMA 2DTUA 3OYJA 1TK5A 1D9DA 1ZBIA 3V81A 1QSLA 1JXBA 1WSGA 3OYKA 2YV0X 1TV6A 3DRRA 4GMJB 3RMAA 3RR8A 4FJMA 4KV8A 4DG1A 1JKHA 1IKYA 4FM2A 1JLGA 3ZSRA 2Q3SA 4CHZA 4M3ZA 3K5LA 1FKPA 4DS5A 1JL2A 4BE2A 3M8QA 3TR8A 1SV5A 4F2SA 1Q9XA 3HPHA 3KK3A 3DOLA 3LP0A 1YTAA 3ZSYA 1C0TA 1S5JA 1WN7A 4O0JA 3VQ6A 3K5NA 2G8UA 4BDPA 3C94A 3L3UA 4CJEA 3KLFA 4CFCA 3S3MA 2XO7A 1NK8A 4F2RA 1U47A 3OYMA 3LWMA 5DK5A 3G0ZA 3DLRA 3BDPA 1S1XA 1WSJA 5J2PA 3TAQA 4CHPA 3OYGA 3L2WA 2WONA 3ZSQA 1HYSA 4DTRA 1YVUA 1K6YA 1JLFA 1WSIA 1SKWA 1NJWA 3ZT1A 4Z0UA 3IG1A 4OKJA 4B9TA 2F8TA 1VSHA 4CEFA 3HM9A 4OVLA 2X78A 4GW6A 4Q0BA 4F8RA 1HNVA 3DLGA 5EU7A 4NCAA 1ZBUA 1TAUA 4C8MA 3FFIA 4CFAA 2VWJA 1ZBHA 4Q5VA 1C0MA 4FJNA 1DTTA 1RTJA 3LALA 2HNYA 4OJRA 4Z4CA 1NJZA 4IFYA 4DS4A 2HW3A 4B9NA 1IKVA 1D9FA 1RDDA 4PWDA 3RMCA 2VWKA 4DU4A 4BDZA 3RMDA 1WAFA 4O0IA 3KKRA 1IKWA 3ASMA 3VQAA 4RW4A 3MECA 3OS2A 2G8HA 1BI4A 1D5AA 1LAWA 2YNGA 3NF6A 2KFZA 2IC3A 3I0RA 4FLUA 4OPJA 5CZ1A 1IH7A 4CJUA 3TAEA 3LWLA 3O3HA 2YHBA 3SUPA 3QEVA 3QETA 4Z4IA 3RR7A 2B4JA 3V1QA 1NOYA 4FW1A 4QAGA 3ZT4A 1C0UA 4MQ3A 4OGCA 4N47A 1HJRA 1HPZA 2O4GA 4E1NA 4PUOA 4FJKA 1WNSA 3OYIA 3JSMA 4CEDA 3M8RA 3K57A 3QEIA 3HJFA 3OYDA 1YT3A 3AO2A 1B9FA 3OYHA 3BGRA 3VQ7A 5I42A 1G15A 3NF8A 3QEXA 3SCXA 2VG5A 3HYFA 4E89A 4E3SA 3TABA 2W42A 1JLBA 2OPPA 3WNFA 1RT2A 4CF2A 1GOCA 3UIQA 4M3YA 4PY5A 4I9QA 1TKXA 4R5PA 1BISA 4N41A 4CJQA 3IRXA 3LZIA 3AVFA 2KQ2A 1NK5A 1TK8A 1TKDA 4KI6A 2I5JA 3QIPA 4EP4A 1VSLA 1BIUA 1CXUA 2FBYA 4DQRA 4DQQA 4CJTA 4M3TA 3SUNA 1NK0A 2OZMA 2WOMA 4CJFA 1RTIA 4CEAA 4DF4A 2QXFA 2P5GA 3RTVA 1CLQA 1ASUA 2HHWA 4DTXA 3DLHA 3ALYA 1VSKA 4ICLA 2YNFA 3AVAA 3ZCMA 4CJLA 3MAQA 1ZYQA 4CECA 4W5RA 2KW4A 4LSLA 3CG7A 1VRTA 1BI4B 4CJSA 4FJ5A 1S1WA 4FYDA 3LAKA 1S9EA 1U04A 2X6SA 3OS1A 2VG7A 3LANA 1QSSA 3PX6A 3OJUA 4EZ6A 3HO1A 4DF8A 1C1CA 1GOBA 3V9XA 3KIOA 5DMRA 3AV9A 4DTPA 3U3YA 3QINA 2Z1HA 3ISNC 4OPKA 1UA1A 4CGJA 2GUIA 2A1SA 4IBNA 5T7BA 1CXQA 4WE1A 3VQBA 5SZTA 3KJVA 2OPSA 4DTOA 3ZSOA 2F96A 4CGHA 4DTNA 2DFEA 3WNHA 5KRSA 4DU3A 2IS3A 4LSNA 4EP5A 3EY1A 3TAGA 3O3FA 1VSEA 1BCMA 2EHGA 3TWHA 2JGUA 3LPTA 2LSNA 4KTQA 3VQEA 2D0CA 4FZZA 1Q9YA 1CZBA 3MEDA 4PA1A 2HHXA 1RT7A 5FRNA 5HRNA 3MEEA 2IOCA 3V9UA 2D0AA 1J9AA 4BWJA 2KZMA 1WAJA 1UOCA 4NYNA 2ZD1A 3EZ5A 3L2RA 4W5QA 2HNZA 3KD5E 5E41A 1SL1A 4B9UA 3PO4A 1S6QA 1WSFA 3AVNA 1HRHA 3M8PA 1X9SA 3S9HA 5HRSA 5HLFA 1RBRA 3IS9A 4CJVA 3OYEA 1XHZA 4NYFA 4AHVA 1VSIA 2D5RA 4Y1DA 2Z1IA 4K8ZA 4KHUA 2BGGA 3QEWA 3AO4A 2RKIA 5HRPA 5J2NA 1JXEA 1RNHA 1SL2A 1L3VA 4DSFA 1QSYA 3PO5A 4FJGA 1REVA 4FJXA 3VA0A 3QESA 1TL1A 4YFUA 2FC0A 1NJYA 4DSLA 1R0AA 1KTQA 3O3GA 4DSEA 4IG3A 1HYVA 3K5OA 3PX4A 1ASVA 2BE2A 1XI1A 1JLAA 5FROA 1O1WA 2HVHA 2OYQA 1TKZA 3A2FA 4F3TA 1LW2A 5CYMA 2ATQA 3KTQA 4J2EA 3PV8A 5KGWA 2HMIA 2AJQA 1DTQA 1S1TA 3AA4A 1RBVA 4QCLA 4B8CA 3HP9A 4FW2A 1LWEA 3DI6A 2KZZA 1RILA 1WLJA 4DTMA 4FJLA 5CYQA 4FLVA 3CFOA 1J5OA 4N56A 3H08A 4B9MA 4KTWA 4KHWA 3NH1A 3HK2A 3QEPA 3SNNA 3CM6A 1QE1A 3DLBA 3TI0A 4AHTA 1TAQA 2OPRA 3VQCA 4IG0A 3SQ4A 1QHTA 2G8FA 2YHAA 3AA5X 1RT6A 2OZSA 3QNOA 2OA8A 4FZXC 3QIOA 3I0SA 4O4GA 4AHRA 4W5TA 4EZ9A 3PX0A 3HL8A 2XY8A 4JLHA 1S6PA 4C8NA 3ITHA 2XY7A 4C8LA 5C24A 2QK9A 3ZT3A 2R7YA 2BDPA 1NK6A 4F3OA 4KHSA 3NDKA 4OGEA 3KD1E 3KLEA 4HVJA 3O4NA 5K14A 5C42A 2BANA 1JLQA 4CEQA 3KK2A 4FLYA 4KB1A 4HHTA 4Z4HA 4KFBA 5SWMA 4KTZA 4BDYA 2ZQBA 3T3FA 2QKBA 3OS0A 1TL3A 2X6NA 3L2UA 4Y1CA 3AVKA 1T03A 1NKCA 1KLNA 4DFKA 4KRFA 3OYLA 3SQ2A 2HNDA 2YKMA 1VSFA 1HNIA 4DSJA 4Z4GA 4FZYA 3NCIA 4FVMA 1U48A 4E1MA 5CZ2A 4E7HA 1QTMA 4CJWA 3VQ9A 2Y1JA 1A5VA 4FLZA 4CK3A 1SKSA 4M42A 4M3UA 4B8AB 3AVJA 1C1BA 1KFSA 3V9SA 4AILC 2P1JA 3KLIA 4DU1A 1BHLA 4Z4EA 4TSXA 4JS5A 3OVNA 3ZT2A 4I2QA 3NFAA 4BE0A 3V6DA 4FM1A 4FLXA 2HHUA 4YNQA 3QERA 3E01A 1KVAA 1W9HA 4CJ4A 4M45A 1RBSA 4E0DA 4ZHRA 3NAEA 2FBVA 1LV5A 1YTUA 2PYJA 4FXDA 2E4LA 4DLGA 4AHSA 4HCBA 3VQQA 1W0HA 3RMBA 4FK2A 4CEZA 5KTQA 3SQ0A 1L3SA 3AA2A 3U3GA 3QNNA 4DFPA 4I9LA 3NBPA 4CF9A 3OYFA 1TGOA 4FJJA 2HVIA 1A5WA 1UA0A 1BQMA 5KGXA 2HHVA 3NF7A 1HYZA 3C6UA 3HXMA 3CFPA 3HT3A 4CJKA 4O55A 3ZT0A 4CF8A 3KKSA 3VQDA 2HHTA 1ITGA 4CFBA 3WNEA 4CGDA 3O4QA 3VN5A 4AH9A 3K5MA 4FM0A 5J2QA 3P83D 1BQNA 1Z25A 4CF0A 5HBMA 3SPZA 3V1OA 1L3TA 1VSMA 1C6VA 2O4IA 4GVMA 3LP2A 1KCFA 4N5SA 3T1AA 1IO2A 1RT4A 3DRSA 3AVLA 3AVHA 4BACA 1ASWA 4CJRA 1Y97A 4KB0A 4DTJA 1TKTA 3AA3A 2ETJA 3L2QA 5HRRA 4LH5A 4J2AA 2NUBA 1NK7A 4FJIA 5I3UA 4CJ5A 4DQSA 3TAPA 1RT5A 3DOKA 3SQ1A 2D0BA 2PYLA 3SI6A 5KRTA 1RBTA 1XHXA 4CEEA 4ZTJA 1T7PA 5FRMA 3SV3A 4CERA 2P5OA 4CHNA 4M3RA 4E7KA 1Z26A 3QLHA 3DM2A 4ID1A 3AVGA 1J53A 4CK2A 4E7LA 4C8OA 4LD0A 4KO0A 2YNIA 3ZSZA 4W5OA 4FJ8A 3CQ8A 1UAXA 4NCBA 1S9GA 4RG8A 4XIUA 4HUGA 3AO5A 4FJHA 3NHGA 1RDBA 3JYTA 4RW8A 4E19A 1XWLA 4DQIA 5D3GA 3DLEA 1LWFA 4K8XA 3DLKA 3NGYA 4OKEA 3NGZA 3RWUA 2HB5A 1QQCA 4L8RB 3WNGA 4FJ9A 2XY5A 4ID5A 2IDOA 1BCOA 1HQUA 3CM5A 3F9KA 1RDAA 4FCYA 4FLWA 4DTUA 4ZTFA 4FK0A 3AVBA 3L2VA 1NJXA 2HHSA 3SUOA 1HQEA 4H4OA 3DYAA 4IFVA 1IKXA 1FKOA 1UWBA 4CCHA 4M3XA 3SYZA 3MEGA 3LP1A 4CEOA 4FJ7A 1LWCA 4DTSA 1X9WA 2A1RA 3NH0A 3SV4A 4ELVA 1WSHA 3KK1A 4JS4A 1F21A 1VRUA 4JRQA 3C95A 4KHNA 1S1VA 3SJJA 4M41A 3OJSA 4B9LA 3L8BA 3G10A 4CESA 1HMVA 3VQ8A 3OYBA 4CGGA 1NKBA 1KRPA 4C8KA 1RBUA 4CHOA 3V9WA 1L5UA 2HHQA 3QO9A 3NF9A 5C25A 3THVA 4F4KA 4IKFA 4J2DA 4N76A 1CZ9A 1BIZA 1RTDA 4G1QA 3T19A 3LAMA 3EYZA 2QKKA 1J54A 3HVRA 2IGIA 4MFBA 4KI4A 3OYNA 1D8YA 4DSKA 1EKEA 3V4IA 4HCCA 1RTHA 3ZSXA 1SUQA 3MXMA 2EX3A 4B3OA 5JS1A 1LW0A 1I3AA 1NKEA 1S1UA 3OYAA 4DFMA 1RT3A 1N6QA 2ITGA 1QS4A 1RT1A 1JL1A 2Z1GA 2YKNA 4CHYA 4KAZA 4PQUA 5JS2A 2YNHA 2Z1JA 4ELTA 3B6OA 1A5XA 3CFRA 3TARA 3K58A 3NE6A 4CFDA 4HUFA 3B6PA 4DWIA 1Q8IA 4B08A 2IAJA 3C6TA 3OYCA 3S3NA 4NCGA 4FLTA 1XC9A 4RW6A 3VA3A 4OLAA 4AHCA 4Z4FA 1U45A 3PY8A 4DLEA 4I2PA 1VSDA 1MU2A 2KFNA 4CE9A 3NGIA 3AVMA 2DFFA 4CJ3A 1VSJA 4CK1A 1LAVA 2RPIA 2ZE2A 3SPYA 1I39A 4CGFA 3NH2A 2XRIA 3D45A 3U6FA 3RRHA 2E6MA 2GBZA 5KI6A 2VG6A 4LY7A 4CJPA 4CHQA 4KHQA 2B5JA 2JLEA 5CY4A 1EETA 3MXJA 5FDLA 3L3VA 1ZBFA 1SKRA 1U4BA 3HSTB 2P51A 3RRGA 3ZSWA 4CEBA 5J1EA 1T8EA 4DQPA 4OLBA 1B9DA 1L3UA 4QOZB 3KLHA 3IAYA 3LPUA 3LP3A 1TK0A 1BL3A 1JLEA 2X74A 4H8KA 3HPOA 2PY5A 3KLGA 4M3WA 1IG9A 1NK4A 1RCHA 4RW7A 3P1GA 4JRPA 4HUEA 1EP4A 2OPQA 3VQ4A 3VQPA 4CIEA 4H4MA 1SL0A 4CGIA 4CF1A 1FK9A 1X1PA 5HROA 4LH4A 3MXIA 1KFDA 1EX4A 1N5YA 1RDCA 4RW9A 3TAMA 4O5BA 2GV9A 2F8SA 4KKOA 1ZBLA 4B9SA 3ZSVA 3LZJA 2RF2A 1KLMA 3M8SA 1NK9A 4CIFA 3AO1A 3P5JA 2DFHA 3I8DA 1C1AA 4UQGA 2G8IA 2E6LA 1T05A 4J2BA 1B92A 4DFJA 3TANA 3F73A 4KPYA 4W5NA 3PUFA 1WSEA 4ELUA 2KTQA 2RN2A 3TAFA 4O44A 4E7JA 2XHBA 2FBTA 3VQ5A 3AVIA 4BWMA 3OY9A 3V9ZA 4DSIA 1DLOA 3HPGA 5HP1A 1FXXA 3S3OA 4B9VA 3DRPA 2B6AA 2FBXA 4DMNA 1EXQA 3K59A 1NOZA 2Y1IA 3AO3A 4HTUA 1GOAA 1X9MA 4IDKA 4I7FA 3D0PA 4E7IA 1KVBA 2XY6A 5J2MA 3AVCA 4AHUA 3HP6A 4CIGA 3SZ2A 2G8KA 1TVRA 1KVCA 3SUQA 1VK0A 1JLCA 1KSPA 4FK4A 2PZSA 2G8WA 3ULDA 4KREA 2DY4A 3DMJA 3V1RA
chains in the Genus database with same CATH superfamily
3HVTA 4KHYA 4CZJA 4BE1A 4BR9A 3CYMA 3ENOA 2DTUA 4UY8O 1D9DA 4I6MB 1WSGA 3D6RA 1U2VB 2ITMA 3GG4A 3R6MA 1V4TA 4GVEA 4M3ZA 2Q3SA 3AAQA 3O8MA 3TSPA 1FKPA 4K43A 4KH4A 1C0TA 3S41A 3VQ6A 2YJEA 3FZHA 4MDBA 3NVMA 3WXMB 3OYMA 4H5NA 3DLRA 1S1XA 3GE1A 1K8AO 3HRGA 3CCEN 1Z6RA 2PBDA 3ID6A 3ZSQA 4AQYK 1NJWA 3EE9A 4OVLA 4NLCA 4GW6A 4Q0BA 1NGCA 4F8RA 5EU7A 3HZ6A 3J7YP 2KKZA 2ZJRL 3LM9A 1ZBHA 2WFBA 2A3ZA 3LALA 4Z4CA 4OJRA 3ZX2A 3BY5A 1R59O 5LY3A 1VQ9N 3VEZA 1RDDA 1WAFA 4O0IA 1IKWA 4E1JA 2E88A 3ASMA 3VQAA 4RW4A 4BC3A 1BI4A 4O8UA 2YNGA 5AZJA 3WXJA 2GWKA 1OH6A 4Z4IA 2B4JA 3ZT4A 2NRXA 4JHDA 2WBNA 2O4GA 2A5XA 4B1XB 4H5TA 3M8RA 2CH5A 3HJFA 1WBDA 4JNEA 3JXUA 1G15A 1NGFA 3NF8A 1LCUA 4G9ZA 2I7PA 2UXCK 1JLBA 4CF2A 1GOCA 1TKXA 4DUYK 4N41A 1NGIA 2FF6A 2KQ2A 1TKDA 4EP4A 3EKSA 3AARA 4CJTA 3SUNA 1NK0A 4JKGA 2W6KA 2WOMA 3RVCA 3VETA 4AF1A 1J5EK 1ASUA 3ALYA 1VSKA 3AVAA 1W7AA 4RWTA 2KW4A 3TSQA 5CE3A 5AJ3K 3VGMA 3OS1A 1QSSA 3OJUA 3VEOA 3V9XA 3QINA 3ISNC 2QTDA 5T7BA 4JK9A 1BO5O 4WE1A 5SZTA 2RHKA 4DTOA 2F96A 5KRSA 2IS3A 3EY1A 1BCMA 2YCHA 4KTQA 3VQEA 1CZBA 2YHXA 1RT7A 3CPWM 3MEEA 3A5OC 5GAHP 2ZD1A 3L2RA 4W5QA 5E41A 1SL1A 1XMOK 4DV1K 4B9UA 3AVNA 1X9SA 1XHZA 1IG8A 4AHVA 1VSIA 4K8ZA 2BGGA 2P9UA 3AO4A 5HRPA 1RNHA 2H3GX 4FJGA 5C10A 4BC4A 1NJYA 3A5LC 4DSEA 1Z05A 3K5OA 5TKYA 3PX4A 4CZEA 1T6DA 1HJOA 1TKZA 1LW2A 5CYMA 5KGWA 1DTQA 3C0BA 4QCLA 1RILA 4JKCA 3CFOA 3DXKB 3NH1A 4CZIA 3MMVA 4ILJA 3QEPA 3P31A 2OPRA 3GBTA 1YJWN 4H5WA 5C2FA 3Q7BA 2OZSA 4BRMA 3T1YK 3QNOA 4FZXC 2E2NA 2E2QA 3ZT3A 1NK6A 3NDKA 3KLEA 3O4NA 3THXA 4CEQA 1JLQA 1S72N 4KB1A 1NBWA 4Z4HA 2QKBA 5SWMA 3T3FA 4BDYA 4PKHA 1TL3A 2VWBA 1HUXA 2X6NA 4Y1CA 1I94K 3OYLA 2YKMA 4Z4GA 3U9ZA 5B8HA 4JKAA 5CZ2A 3UKRA 4E7HA 4CJWA 3FZLA 1SAZA 1A5VA 3HSCA 4CK3A 1SKSA 1D4XA 5KPTA 1KFSA 3AVJA 4Z4EA 4TSXA 1HNWK 3NFAA 4FLXA 3BP8A 3E01A 4JI7K 4V19S 2PYJA 3JS6A 1KC8O 4AHSA 1O13A 3VQQA 4FK2A 3SQ0A 1NGGA 3AA2A 5BPNA 4J8FA 3NBPA 3WEEB 3EN9A 4F9OA 5KGXA 1KAYA 3SLCA 4GKJK 3J7AP 4AH9A 4O5FA 3P83D 1BQNA 2P9SB 2CGLA 3V1OA 2P9LA 3CERA 4N5SA 4BACA 3AVHA 4RTFD 4DTJA 1YVNA 2ZGZA 5AQVA 4FJIA 5I3UA 4CJ5A 3THYA 3SQ1A 1RBTA 1XHXA 4CERA 4CHNA 2VCPA 3QLHA 3K9KA 4CK2A 2FLOA 3ZSZA 2YNIA 4FJ8A 3CQ8A 4NCBA 4FJHA 4DQIA 2FSJA 4K8XA 3DLKA 1YUWA 2VQEK 2V7YA 3NGYA 3SBTA 3NGZA 2HB5A 1J6ZA 3WNGA 3LDQA 4FJ9A 3F9KA 1HQUA 1V4SA 4FK0A 2FXUA 2QXLA 3DXMA 4DUZK 4DR3K 2HBKA 3SYZA 3LP1A 4CEOA 1ZC6A 2ZF5O 4YOTA 3WXIA 3KK1A 1HKCA 4JRQA 1E4GT 4KHNA 1S1VA 4BRGA 2D0PA 3OJSA 2VGMA 1KRPA 4CESA 2QWOA 1NKBA 3BF1A 4AM6A 1EO1A 3NF9A 5C25A 4IKFA 4F4KA 4BRFA 3OBYA 2F9WA 3EYZA 3LAMA 3D2FB 1XMQK 5FPDA 1IBKK 2PAVA 1Q86O 1RTHA 1SUQA 5I9EB 2EX3A 3ZETB 1S1UA 3OYAA 2QEXN 3DWLA 3N4QA 3O9TA 1RT1A 5JMVA 3TPQA 1VAZA 3H3NO 3EO3A 2ASOA 2YNHA 2Z1JA 4BC2A 4ELTA 1A5XA 3NE6A 4HTLA 4CFDA 3B6PA 5LJWA 4DWIA 5EVZA 1Q8IA 4JK8A 1NGAA 2D4WA 4RCHA 5AQPA 1JCGA 4OLAA 5AQQA 2KFNA 1VSDA 1MU2A 5M1PA 3CPEA 4CK1A 1LAVA 4L3QA 4CGFA 1GLLO 2XRIA 3FLCO 3O80A 2ZM6K 3U6FA 2GBZA 4LY7A 3KK7A 5CY4A 2OANA 1EETA 1E3MA 2F9TA 4OLBA 1H1VA 2IVOA 3CC7N 3LPUA 1TK0A 4DR4K 1JLEA 1IG9A 1RCHA 1EP4A 2OPQA 4DV6K 5FPNA 3PIPL 4BREA 1S22A 2E2OA 4O5BA 3RSEA 3EEQA 3ZSVA 3M8SA 3VGLA 4XH1A 3AO1A 3P5JA 1C1AA 5LL6Z 2G8IA 2E6LA 2F7TA 3Q7CA 3TANA 4PKGA 4KPYA 4W5NA 4ELUA 4JN4A 4E7JA 3OY9A 5HP1A 1FXXA 3S3OA 4CW7B 1EXQA 3K59A 1NOZA 4HTUA 1C0FA 1X9MA 5BR9A 2XY6A 5J2MA 4OX9K 1QZ5A 1NU0A 1KVCA 4FK4A 3ULDA 1X3MA 3CCMN 3LDSA 1U49A 3TU5A 3MN9A 1ZBIA 3V81A 4JKEA 5IT9O 2YV0X 1JKHA 3ZSRA 4K25A 3K5LA 2O8FB 5GAGP 4X65K 2WUSA 4EFHA 3DOLA 4O8KA 3MX5A 3C94A 2Q0UA 3L3UA 4CJEA 3KLFA 5F1XA 2XO7A 1NK8A 4CZMA 3G0ZA 3BDPA 4JI5K 3TAQA 3KVGA 2WONA 4DTRA 3G71N 4JI3K 1WSIA 2V52B 1SKWA 4Z0UA 2F8TA 5EX5A 3VMFB 3HM9A 1DT9A 2X78A 2EWSA 4DV2K 1HNVA 1ILYA 1TAUA 4FJNA 1OKJA 1RDWX 3AGRA 1NJZA 1ATRA 1VQPN 3CCSN 1D9FA 4PWDA 3RMCA 4BRCA 2W41A 2G8HA 1LAWA 3NF6A 2IC3A 3I0RA 3T7ZA 1IH7A 1U6ZA 2UXDK 1OH7A 2YHBA 4DQ8A 1N32K 3C6AA 3RR7A 3P4IA 4LFCK 4QAGA 4PKIA 4N47A 1HJRA 4E1NA 4FJKA 4FWKA 3FZMA 3SAHA 4CEDA 1YT3A 2P9KB 3BGRA 1BWFO 4XH4A 3VEXA 3ZEUA 2VG5A 4E3SA 3TABA 3SCXA 2O8CA 4JI6K 5GIOA 1BISA 3GL1A 3KHYA 4CJQA 3LZIA 3OTOK 5F2RA 1HPMA 3AVFA 2DPNA 3QIPA 4DQQA 4CJFA 1RTIA 4YOWA 3RTVA 1Q7YO 3DLHA 4CJLA 3ZCMA 2ASPA 2KLAA 4CECA 4W5RA 2QWMA 2X6SA 3PX6A 4DF8A 3AV9A 3VENA 4OPKA 1N34K 4IBNA 2A1SA 5F0XA 1CXQA 2OPSA 1N8RO 2DFEA 4GNIA 4B1ZA 5MLCQ 3TAGA 1VSEA 3QFUA 3TWHA 3LPTA 2BTFA 2UUCK 3FR0A 4FZZA 4PA1A 3M5RA 2NRWA 1N36K 1J9AA 3LM2A 4CZLA 4GV6A 1SZ2A 2HNZA 2NRTA 2Q1NA 2JWLA 3PO4A 4NB4A 1HRHA 5AQUA 3M8PA 5HRSA 1RBRA 3IS9A 3ZETA 4CJVA 3OYEA 2O8EA 4KHUA 2HMPA 2O8BA 2RKIA 1QSYA 5J2NA 1SL2A 3PO5A 4FJXA 1REVA 4CZKA 4ISEA 3UKUB 4DSLA 1VQNN 3O3GA 4IWVA 1OVYA 5M1OA 3BZKA 3ID8A 2OYQA 4BR2A 3CCLN 4H0PA 2HMIA 3EKUA 2AJQA 3UB5A 3NVKA 4FW2A 1LWEA 2CGJA 3IKMA 4FLVA 1J5OA 4B9MA 4KTWA 4KHWA 3DLBA 3TI0A 3DAWA 4IG0A 4H5RA 2I7NA 2YHAA 3AA5X 3F5TA 4LF9K 2OA8A 3A8YA 3AY9A 4W5TA 4O4GA 4AHRA 4DHYA 4B3RK 1P8ZA 4DR5K 1OVQA 3THWB 2XY7A 2QK9A 2BDPA 4KHSA 2DY4A 4FLYA 4HVJA 5C42A 4HHTA 3UE5A 1VQON 3OS0A 4EIAA 4K42A 5AQFA 3AVKA 1BDGA 4KRFA 1YI2N 2HNDA 3VF2A 5CHIA 3W0LA 1GLFO 3NCIA 2P9NB 3M6GA 4FVMA 4E1MA 3WQTA 1XNRK 2Y1JA 1BA1A 4WQ5A 2W40A 4M42A 4FOIA 3L4QA 1BA0A 2QWQA 3KLIA 4AILC 3ZT2A 1NGHA 4I2QA 4B3TK 4BE0A 3V6DA 2BUPA 3CI5A 2HHUA 3QERA 4QS8A 1W9HA 4CJ4A 4M45A 4FXDA 2AP1A 2E4LA 1X3NA 1GLBG 4DLGA 4HCBA 1W0HA 4CEZA 3QNNA 4DFPA 3CJ1A 4X66K 4IEEA 4AM7A 1TGOA 2OTLN 4FJJA 1A5WA 1UA0A 1BQMA 3NF7A 3HTVA 3VEYA 4YOVA 3HT3A 3ZT0A 3KKSA 4DR7K 1ITGA 4CFBA 3C7NA 3O4QA 5J2QA 4WF9L 2P9IB 3SPZA 2O4IA 4GVMA 3WT0A 5AQZA 2YHYA 1RT4A 3AVLA 3MN6A 5GINA 5FPEA 4WFBL 3L2QA 5LMNK 3TAPA 4EAHD 4JD2A 5KRTA 2QWPA 2P5OA 3O08A 4M3RA 2IVNA 1Z26A 4BVPA 3DM2A 1HX1A 3AVGA 3ENHA 3MN5A 4JAXA 4E7LA 4C8OA 4LD0A 4KO0A 4W5OA 1VQ5N 1S9GA 4RG8A 4H0OA 4CI6A 4XIUA 4YY3K 3LDPA 4RW8A 3J7ZO 5D3GA 1QVFM 3DLEA 3FE1A 1T3VA 5ADXA 4OKEA 3L0QA 4L8RB 1QQCA 3SAGA 2IDOA 1BCOA 2E1YA 4FLWA 4DTUA 2P9PA 3DYAA 4IFVA 1IKXA 1FKOA 4LF7K 4M3XA 4DTSA 1X9WA 3NH0A 3SV4A 4WQ5C 1WSHA 3A5NC 3K9JA 3C95A 4YHHK 1YITN 3QDKA 4CGGA 1Q18A 1RBUA 4BGAA 5GAEP 4CZGA 1CZ9A 3HVRA 3WXKA 3O1BA 1VQ8N 3ZSXA 4LF6K 3HM8A 1LW0A 3F2KA 1NKEA 2W6LA 3P39A 1N6QA 2ITGA 1QS4A 1HKGA 5AQSA 1RFQA 1ATNA 4X64K 1C0GA 3O9RA 3IUCA 5HL7L 4B08A 3OYCA 2BH1A 4YOXA 5JLFA 1TUUA 3PY8A 4I2PA 1VSJA 2F4VK 4FWNA 3OHRA 2RPIA 2ZE2A 3NH2A 1MDUB 1NG9A 1K8KA 2B5JA 2JLEA 4JKFA 3CC4N 3TTDA 4DV4K 1U4BA 1BOTO 3HSTB 3RRGA 3ZSWA 5J1EA 4C23A 3IAYA 3CF5L 3CCRN 2PY5A 1BL3A 3HPOA 1Y64A 3KLGA 4RW7A 3P1GA 4I6MA 3CJCA 3VQPA 4CIEA 1U2VA 4H4MA 1SL0A 5HROA 4IO8A 1KFDA 1EX4A 2QWLA 4MLHA 3A0IX 4KKOA 4CD3A 3LZJA 5AQNA 4WQ4A 3CC2N 4J2BA 4DFJA 3F73A 3PUFA 5AZIB 1WBBA 2XHBA 3VQ5A 4BWMA 3HPGA 4B9VA 3ULEB 2A6AA 4A2AA 2FBXA 2HBMA 4BRAA 1GOAA 3O9QA 5M1KA 3CIPA 2O8DB 4CIGA 5AQKA 1KAXA 1HKBA 1VK0A 1JLCA 2G8WA 3D2EB 5EY4A 2G8VA 3K2PA 4OKKA 3R8EA 1WOQA 1NJIO 3DRRA 4CD1A 3RMAA 4M7XA 3O1WA 4FM2A 1JLGA 1VHXA 4CHZA 3EZWA 4A62A 4DS5A 1JL2A 3M8QA 1SV5A 5FLXO 2HOEA 4BRNA 1Q9XA 3HPHA 3KK3A 5C2DA 3ZSYA 1YTAA 3K5NA 1VQ4N 4MLEA 4CFCA 1NGEA 4F2RA 1U47A 5DK5A 4YOYA 2OTJN 4LF8K 4DCHA 5FPMA 4M7YA 5J2PA 3OYGA 1TUYA 2GWJA 1K6YA 5AQHA 1JLFA 3E66A 3IMXA 3ZT1A 4GV9A 5JVGL 4A57A 4B9TA 1WUAA 5BRFA 1YXQA 4EHTA 2HBJA 3DLLL 4C8MA 3FFIA 4IZ9A 4Q5VA 1GLCG 1C0MA 1DTTA 1ESVA 1RTJA 3T69A 5EXWA 4B9NA 1IKVA 2VWKA 3RMDA 4BDZA 2E8AA 4JI4K 4KBOA 3VTHA 1D5AA 1GLAG 5KPZA 1YJ9N 4WQ4C 5CZ1A 1SQKA 4FO0A 3LWLA 4MO4A 2J4RA 3D7EO 1VQMN 3V1QA 3NMUA 4FW1A 3J81O 4OGCA 3LDOA 3WUHA 4PUOA 1WNSA 3OYIA 5AFUH 3K57A 5BR8K 3OYDA 5DM6L 3VQ7A 5I42A 2W42A 3UIQA 4M3YA 4I9QA 3MDQA 2QWNA 3IRXA 3E9LA 4A61A 2I5JA 1VSLA 1BIUA 1CXUA 2FBYA 1DGKN 2UUBK 4M3TA 5KQ8A 5AQRA 2NNWA 3VEVA 3ZX3A 2QXFA 4DF4A 2P5GA 1CLQA 2HHWA 4YORA 3VGKA 3MAQA 3VPZA 4LSLA 2WTUA 1VRTA 1BI4B 4FJ5A 1S1WA 4FYDA 3LAKA 5AZJB 3BEXA 3PSIA 3LANA 4EZ6A 3HO1A 4LFBK 4F3OA 1C1CA 1GOBA 3KIOA 5AQJA 4DTPA 1KLNA 5AQOA 3VQBA 3KJVA 3H1VX 4WYBA 4DTNA 4DU3A 4JKDA 4JHDB 4LSNA 3O3FA 1HNXK 2EHGA 2E2PA 4IDHA 3DXKA 1QQOA 2D0CA 2HHHK 3FZFA 3CXCM 3MEDA 2HHXA 1JCFA 2VYPA 4FPBA 5HRNA 3VOVA 4IOAL 3V9UA 3ZX0A 3EZ5A 3CCJN 3SAFA 3PIOL 4FVUA 2Q0RA 1S6QA 5HLFA 3I55N 4DR6K 1Q81O 4Y1DA 1HR0K 3DJCA 4JKGB 1L3VA 4KH5A 4BG8A 3ENBA 1S3XA 1NNEA 1TL1A 2FC0A 5E84A 1KTQA 1BU6O 1HYVA 3HOTA 2BE2A 1XI1A 5FROA 3H45C 3VEWA 3A2FA 4F3TA 4R79A 3KTQA 3PV8A 3ZLJA 1QHAA 1S1TA 1RBVA 2HBLA 2KZZA 1WLJA 4DTMA 4FJLA 4GY2B 3CM6A 1QE1A 4AHTA 2G8FA 1QHTA 4BR5A 3WEEA 3QIOA 3I0SA 3SBGA 3PX0A 3HL8A 1QVGM 5H1SQ 3LL3A 1IBLK 1S6PA 4C8NA 3ITHA 4H0YB 3E1YA 4OGEA 2HF4A 5K14A 2BANA 3KK2A 4KFBA 2ZQBA 3L2UA 1NKCA 1T03A 3N4PA 2P9SA 4ILHA 4BROA 4DFKA 1VSFA 1HNIA 4FL9A 4DSJA 4FZYA 4BR4A 5HOOA 5IWAK 4CJ7A 3CHWA 5A2QO 1ZBSA 4B8AB 3V9SA 2P1JA 3OA9A 3OVNA 4IJAA 3OW2M 1KVAA 1LV5A 1YTUA 5AQIA 1L3SA 3U3GA 3WXLA 4IO9L 4CF9A 4B1UB 2HVIA 4IOCL 3BZCA 2AA4A 2HHVA 1HYZA 3HXMA 4K41A 4GV3A 4A59A 4CJKA 4CF8A 3THXB 3VQDA 1XC3A 4IOXA 3TSUA 1DEJA 3WNEA 1VQ6N 3VN5A 1IBMK 4FM0A 1Q82O 1FJGK 1RGIA 4CF0A 5HBMA 3G25A 5LJVA 2ASMA 1L3TA 1VSMA 3LP2A 2ZWHA 4H03B 3T1AA 3UKRB 1Y97A 4DV0K 4KB0A 1TKTA 4LH5A 3MX2A 4J2AA 2NUBA 3CQXA 3GDQA 4BY9C 3O6WA 4DQSA 1RT5A 2D0BA 2PYLA 1OH5A 4CEEA 4ZTJA 4JI1K 5BPMA 3D2FA 2OCEA 1J53A 5BN8A 3L6QA 3EL2A 4IJNA 4CZFA 3PLAA 1UAXA 4HUGA 3JYTA 4PL8A 2E1ZA 4NO7A 2XY5A 3KD1E 3CM5A 3IFRA 3SUOA 5DM7L 4H4OA 1UWBA 2GX9A 4LC9B 4BRLA 3MEGA 2P9LB 4FJ7A 1LWCA 2IIRA 2A1RA 2RE2A 3CQYA 4WFNL 1VRUA 4M41A 4BRHA 4DV3K 2QI2A 3G10A 3L8BA 4C8KA 1L5UA 4CHOA 3V9WA 3THYB 1YAGA 3THVA 4J2DA 2FSNA 3CCQN 1RTDA 1BIZA 3JAMO 3T19A 2QKKA 1J54A 4MFBA 4KI4A 3OYNA 1D8YA 4DSKA 4BRKA 3ATUA 3V4IA 5GIPA 4B3OA 2NRZA 1I3AA 1NGDA 4HWIA 2UUAK 3QICA 2Z1GA 4CHYA 4KAZA 4FWPA 4FWLA 3B6OA 3CFRA 4BRDA 3K58A 5AQYA 2HF3A 2CGKA 5AFUA 2IAJA 3C6TA 3CCVN 3DXMB 4NCGA 3S3NA 2GELA 3QBXA 3TTCA 3HBTA 1XC9A 4RW6A 3VA3A 4Z4FA 4DLEA 1M1KO 2Q36A 2YHWA 4BC5A 4CE9A 2DFFA 4CJ3A 1GLJO 1I39A 3U9DA 1DKGD 3FGUA 4WCEL 3RRHA 2VG6A 4OO1J 4CJPA 4CHQA 4KHQA 3FFKB 4BR7A 3EE8A 5FDLA 3L3VA 3CD6N 2Q31A 1SKRA 3QFPA 4QOZB 1T8EA 2QW9A 1L3UA 3KLHA 1XUPO 2NLXA 3CJBA 4H8KA 1NK4A 4HUEA 3VQ4A 3ZYYX 4CGIA 1FK9A 1X1PA 1N5YA 1RDCA 2YI1A 2O8FA 2GV9A 2F8SA 4B9SA 1ZBLA 1NK9A 1KLMA 3LDNA 1T05A 3J80O 1WSEA 1VQLN 4O44A 4U67L 3V9ZA 4XEIA 1VQ7N 3O5BA 4NXNK 3DRPA 3O9UA 1P90A 1NM1A 2Y1IA 3AO3A 1RDUA 1KQSM 4I7FA 3D0PA 1KVBA 1IJJA 2FF3B 3HP6A 3SZ2A 3IDHA 1TVRA 3SUQA 1KSPA 4EHUA 2PZSA 3R9PA 3DMJA 2ZGYA 1BGXT 4H0XB 1SS6A 3OYJA 3M3ZA 1TK5A 3M1FA 4X62K 1QSLA 3QB0A 1WB9A 1JXBA 3OYKA 1NLVA 1TV6A 4GMJB 4NLBA 3E9PA 3RR8A 4KV8A 4DG1A 1YHQN 1IKYA 4KH6A 3RSEB 4BE2A 3TR8A 4FPAA 4JI0K 4JKHA 3KZBA 2E5LK 4F2SA 4QS9A 4JI2K 3LP0A 4BRIA 1S5JA 1WN7A 4O0JA 3W3DA 4BR0A 2G8UA 1FW6A 4BDPA 4ISGA 3S3MA 4FWOA 3OBWA 2V51B 4DR2K 3LWMA 1QZ6A 1WSJA 1K9MO 2P9KA 4CHPA 4FOEA 3L2WA 1N33K 1EQYA 1HYSA 5M1FA 1YVUA 4WFAL 3CMAN 3IG1A 4OKJA 5JLHA 1VSHA 4CEFA 4NCAA 3DLGA 1ZBUA 4CFAA 3B8AX 2VWJA 1ZXOA 2HNYA 3O9SA 4IFYA 4DS4A 5E26A 2HW3A 1E4FT 4BG9A 4JK7A 4B1WB 4DU4A 5AQTA 3KKRA 5KPRA 4MO5A 3OS2A 3MECA 2KFZA 4JEPA 1YF5L 3A5MC 4Z94A 3J8AA 4FLUA 2VQFK 2UU9K 4OPJA 4CJUA 3TAEA 3H1QA 3O3HA 1IV0A 1G99A 4MDAA 3QEVA 3SUPA 3QETA 2NZTA 1NOYA 1C0UA 4NXMK 4MQ3A 1HPZA 3TTFA 5AQWA 4FWMA 5C12A 3JSMA 3QEIA 1W2BM 1JJ2M 3SMSA 4JI8K 3AO2A 1B9FA 3OYHA 1JCEA 3VERA 3QEXA 3H3OB 1MWKA 3HYFA 4E89A 1EWRA 1KD1O 2OPPA 3WNFA 5GADP 1RT2A 4PY5A 4R5PA 3MCAB 2YJFA 1NK5A 2ZJPL 2NRVA 1TK8A 4KI6A 3E9OA 2GEMA 4FWQA 3SK3A 4DQRA 5AR0A 2OZMA 3KWIA 5JVHL 4KHPK 4CEAA 4DTXA 1YIJN 4ICLA 1ZYQA 2YNFA 4DV7K 3UKUA 1XQSC 2Q97A 3CG7A 4CJSA 1S9EA 4ILGB 1U04A 2VG7A 4CVNE 5DMRA 3U3YA 2HHQA 2Z1HA 1UA1A 4CGJA 2GUIA 2YX6A 1QQNA 3ZSOA 4CGHA 3WNHA 4BQZA 4EP5A 3MN7A 2JGUA 2LSNA 2NRHA 3P38A 1Q9YA 4IXCA 5FRNA 3ZEUB 2O8CB 2IOCA 4IFEA 2D0AA 4BWJA 2KZMA 1WAJA 1UOCA 4NYNA 4C1NK 3THWA 3CCUN 3KD5E 1WSFA 4BRQA 3S9HA 2V7ZA 4NYFA 2D5RA 1KXPA 2Z1IA 1KAZA 1NGJA 3QEWA 1JXEA 4DSFA 4BRPA 2JWKA 3VA0A 3QESA 2P9NA 4YFUA 1R0AA 4IG3A 4XH5A 2KHOA 1ASVA 1JLAA 1O1WA 4CBWA 1TYQB 2HVHA 4PHTX 2A40A 2ZJQL 2ATQA 3CJ7A 4J2EA 3AA4A 5AQLA 4B8CA 3HP9A 5BREA 3DI6A 1BG3A 4BGBA 5CYQA 4N56A 3H08A 2HSTA 3HK2A 3CJ9A 4A5AA 3SNNA 1TAQA 3VQCA 5LMUK 1BUPA 3SQ4A 1RT6A 2A41A 3VF4A 4EZ9A 2Q2RA 2XY8A 4JLHA 2QM1A 4C8LA 5C24A 2R7YA 2CH6A 2D0OA 4KTZA 2O8EB 2P9IA 2O8BB 4YDUA 3SQ2A 2E20A 4CZHA 3G4SN 5AQMA 4K0KK 1X9JA 1U48A 1QTMA 3VQ9A 4DV5K 1MA9B 2QWRA 4JV5K 5KQDA 3QMLA 4FLZA 4M3UA 3SJHA 1C1BA 4PL7A 4DU1A 1BHLA 4JS5A 3C65A 2NRRA 4FM1A 4C1NI 5BN9A 4YNQA 4OPAA 1RBSA 4E0DA 3MK6A 3I56N 4ZHRA 3NAEA 2FBVA 3RMBA 3L4IA 5KTQA 4B3MK 4I9LA 4DB3A 1NGBA 3OYFA 1ATSA 1NWKA 3C6UA 3CFPA 5BPLA 4LF4K 4O55A 2HHTA 3LDLA 2WC9A 2D1KA 4CGDA 3K5MA 1Z25A 1C6VA 1VQKN 1KCFA 3PSFA 1IO2A 4BQLA 3DRSA 1XNQK 5AQXA 1ASWA 4H0TB 4CJRA 4DKWA 3AA3A 2ETJA 1HLUA 5HRRA 1NK7A 3C6HA 4LFAK 1LOTB 1QQMA 3U4LA 1OH8A 3DOKA 3WQUA 3SI6A 3R3LA 5M1NA 4B3SK 1T7PA 5FRMA 4JKBA 3SV3A 4U7BA 3CMEN 4E7KA 4IEIA 5BRDA 4ID1A 3H6EA 2UYTA 4OPHA 1CZAN 5ELZA 1NMNA 3AO5A 3NHGA 1RDBA 4E19A 1XWLA 3MCPA 4FWSA 1LWFA 1YJNN 3RWUA 5TKWA 4ID5A 4B1VA 1RDAA 4FCYA 3BUZB 4ZTFA 3AVBA 4YDUC 3L2VA 3C7NB 1NJXA 2HHSA 1HQEA 4CCHA 3CETA 2VGNA 1GLEG 4ELVA 4JS4A 5AQGA 1F21A 5ADXH 3VTIA 3HI0A 3SJJA 2PFUA 4B9LA 4B1YB 4FJMA 1HMVA 3VQ8A 3OYBA 4DR1K 3MWTA 5JICA 4JYAK 4JD2B 3QO9A 4N76A 3AAPA 4M63C 4G1QA 1MWMA 2IGIA 1EWQA 5EOYA 1EKEA 4HCCA 3MXMA 5JS1A 1W97L 1M90O 4CBUA 4DFMA 1RT3A 2P9UB 3T1HK 4QS7A 1JL1A 3H46O 2YKNA 4H0VB 4PQUA 5JS2A 3GOIA 3MWPA 2QA4N 4YOUA 3TARA 4HUFA 3I8BA 4A5BA 3G6EN 5AZIA 4FLTA 2P9PB 4FSVA 4AHCA 3ULEA 1U45A 3NGIA 3AVMA 4H5VA 2GUPA 3SPYA 1NMDA 4LF5K 2FSKA 3D45A 3VF6A 4FWRA 2E6MA 1GLDG 3FZKA 5KI6A 4A2BA 4Y0WA 5C15A 2O8DA 1T6CA 3MXJA 1ZBFA 3D2EA 1K73O 2P51A 3F9MA 4CEBA 4DQPA 1B9DA 3CJAA 3LP3A 4BVOA 2X74A 3SMPA 3AGKA 5M1QA 4M3WA 4JRPA 5BRHA 4CF1A 4LH4A 3MXIA 3U8XA 4RW9A 3TAMA 4B9QA 2GTDA 3R1XA 4ISFA 4GKKK 3QBWA 2RF2A 2UXBK 4CIFA 2DFHA 3I8DA 5CR4A 4UQGA 3K0SA 5C0YA 1B92A 2KTQA 2RN2A 3TAFA 3VESA 2IVPA 2FBTA 3AVIA 3I33A 3HOSA 4DSIA 1DLOA 1T44A 1TYQA 2B6AA 4DMNA 4CBXA 3KWGA 4IDKA 1HNZK 4E7IA 3BF3A 1K8KB 3AVCA 3O4WA 4AHUA 3ATVA 2G8KA 4KREA 3V1RA 2A42A
chains in the Genus database with same CATH topology
2G8VA 3K2PA 3HVTA 3LDSA 4KHYA 4OKKA 4BE1A 1U49A 1BGXT 3CYMA 2DTUA 3OYJA 1TK5A 1D9DA 1ZBIA 3V81A 1QSLA 1JXBA 1WSGA 3OYKA 2YV0X 1TV6A 3DRRA 4GMJB 3RMAA 3RR8A 4FJMA 4KV8A 4DG1A 1JKHA 1IKYA 4FM2A 1JLGA 3ZSRA 2Q3SA 4CHZA 4M3ZA 3K5LA 1FKPA 4DS5A 1JL2A 4BE2A 3M8QA 3TR8A 1SV5A 4F2SA 1Q9XA 3HPHA 3KK3A 3DOLA 3LP0A 1YTAA 3ZSYA 1C0TA 1S5JA 1WN7A 4O0JA 3VQ6A 3K5NA 2G8UA 4BDPA 3C94A 3L3UA 4CJEA 3KLFA 4CFCA 3S3MA 2XO7A 1NK8A 4F2RA 1U47A 3OYMA 3LWMA 5DK5A 3G0ZA 3DLRA 3BDPA 1S1XA 1WSJA 5J2PA 3TAQA 4CHPA 3OYGA 3L2WA 2WONA 3ZSQA 1HYSA 4DTRA 1YVUA 1K6YA 1JLFA 1WSIA 1SKWA 1NJWA 3ZT1A 4Z0UA 3IG1A 4OKJA 4B9TA 2F8TA 1VSHA 4CEFA 3HM9A 4OVLA 2X78A 4GW6A 4Q0BA 4F8RA 1HNVA 3DLGA 5EU7A 4NCAA 1ZBUA 1TAUA 4C8MA 3FFIA 4CFAA 2VWJA 1ZBHA 4Q5VA 1C0MA 4FJNA 1DTTA 1RTJA 3LALA 2HNYA 4OJRA 4Z4CA 1NJZA 4IFYA 4DS4A 2HW3A 4B9NA 1IKVA 1D9FA 1RDDA 4PWDA 3RMCA 2VWKA 4DU4A 4BDZA 3RMDA 1WAFA 4O0IA 3KKRA 1IKWA 3ASMA 3VQAA 4RW4A 3MECA 3OS2A 2G8HA 1BI4A 1D5AA 1LAWA 2YNGA 3NF6A 2KFZA 2IC3A 3I0RA 4FLUA 4OPJA 5CZ1A 1IH7A 4CJUA 3TAEA 3LWLA 3O3HA 2YHBA 3SUPA 3QEVA 3QETA 4Z4IA 3RR7A 2B4JA 3V1QA 1NOYA 4FW1A 4QAGA 3ZT4A 1C0UA 4MQ3A 4OGCA 4N47A 1HJRA 1HPZA 2O4GA 4E1NA 4PUOA 4FJKA 1WNSA 3OYIA 3JSMA 4CEDA 3M8RA 3K57A 3QEIA 3HJFA 3OYDA 1YT3A 3AO2A 1B9FA 3OYHA 3BGRA 3VQ7A 5I42A 1G15A 3NF8A 3QEXA 3SCXA 2VG5A 3HYFA 4E89A 4E3SA 3TABA 2W42A 1JLBA 2OPPA 3WNFA 1RT2A 4CF2A 1GOCA 3UIQA 4M3YA 4PY5A 4I9QA 1TKXA 4R5PA 1BISA 4N41A 4CJQA 3IRXA 3LZIA 3AVFA 2KQ2A 1NK5A 1TK8A 1TKDA 4KI6A 2I5JA 3QIPA 4EP4A 1VSLA 1BIUA 1CXUA 2FBYA 4DQRA 4DQQA 4CJTA 4M3TA 3SUNA 1NK0A 2OZMA 2WOMA 4CJFA 1RTIA 4CEAA 4DF4A 2QXFA 2P5GA 3RTVA 1CLQA 1ASUA 2HHWA 4DTXA 3DLHA 3ALYA 1VSKA 4ICLA 2YNFA 3AVAA 3ZCMA 4CJLA 3MAQA 1ZYQA 4CECA 4W5RA 2KW4A 4LSLA 3CG7A 1VRTA 1BI4B 4CJSA 4FJ5A 1S1WA 4FYDA 3LAKA 1S9EA 1U04A 2X6SA 3OS1A 2VG7A 3LANA 1QSSA 3PX6A 3OJUA 4EZ6A 3HO1A 4DF8A 1C1CA 1GOBA 3V9XA 3KIOA 5DMRA 3AV9A 4DTPA 3U3YA 3QINA 2Z1HA 3ISNC 4OPKA 1UA1A 4CGJA 2GUIA 2A1SA 4IBNA 5T7BA 1CXQA 4WE1A 3VQBA 5SZTA 3KJVA 2OPSA 4DTOA 3ZSOA 2F96A 4CGHA 4DTNA 2DFEA 3WNHA 5KRSA 4DU3A 2IS3A 4LSNA 4EP5A 3EY1A 3TAGA 3O3FA 1VSEA 1BCMA 2EHGA 3TWHA 2JGUA 3LPTA 2LSNA 4KTQA 3VQEA 2D0CA 4FZZA 1Q9YA 1CZBA 3MEDA 4PA1A 2HHXA 1RT7A 5FRNA 5HRNA 3MEEA 2IOCA 3V9UA 2D0AA 1J9AA 4BWJA 2KZMA 1WAJA 1UOCA 4NYNA 2ZD1A 3EZ5A 3L2RA 4W5QA 2HNZA 3KD5E 5E41A 1SL1A 4B9UA 3PO4A 1S6QA 1WSFA 3AVNA 1HRHA 3M8PA 1X9SA 3S9HA 5HRSA 5HLFA 1RBRA 3IS9A 4CJVA 3OYEA 1XHZA 4NYFA 4AHVA 1VSIA 2D5RA 4Y1DA 2Z1IA 4K8ZA 4KHUA 2BGGA 3QEWA 3AO4A 2RKIA 5HRPA 5J2NA 1JXEA 1RNHA 1SL2A 1L3VA 4DSFA 1QSYA 3PO5A 4FJGA 1REVA 4FJXA 3VA0A 3QESA 1TL1A 4YFUA 2FC0A 1NJYA 4DSLA 1R0AA 1KTQA 3O3GA 4DSEA 4IG3A 1HYVA 3K5OA 3PX4A 1ASVA 2BE2A 1XI1A 1JLAA 5FROA 1O1WA 2HVHA 2OYQA 1TKZA 3A2FA 4F3TA 1LW2A 5CYMA 2ATQA 3KTQA 4J2EA 3PV8A 5KGWA 2HMIA 2AJQA 1DTQA 1S1TA 3AA4A 1RBVA 4QCLA 4B8CA 3HP9A 4FW2A 1LWEA 3DI6A 2KZZA 1RILA 1WLJA 4DTMA 4FJLA 5CYQA 4FLVA 3CFOA 1J5OA 4N56A 3H08A 4B9MA 4KTWA 4KHWA 3NH1A 3HK2A 3QEPA 3SNNA 3CM6A 1QE1A 3DLBA 3TI0A 4AHTA 1TAQA 2OPRA 3VQCA 4IG0A 3SQ4A 1QHTA 2G8FA 2YHAA 3AA5X 1RT6A 2OZSA 3QNOA 2OA8A 4FZXC 3QIOA 3I0SA 4O4GA 4AHRA 4W5TA 4EZ9A 3PX0A 3HL8A 2XY8A 4JLHA 1S6PA 4C8NA 3ITHA 2XY7A 4C8LA 5C24A 2QK9A 3ZT3A 2R7YA 2BDPA 1NK6A 4F3OA 4KHSA 3NDKA 4OGEA 3KD1E 3KLEA 4HVJA 3O4NA 5K14A 5C42A 2BANA 1JLQA 4CEQA 3KK2A 4FLYA 4KB1A 4HHTA 4Z4HA 4KFBA 5SWMA 4KTZA 4BDYA 2ZQBA 3T3FA 2QKBA 3OS0A 1TL3A 2X6NA 3L2UA 4Y1CA 3AVKA 1T03A 1NKCA 1KLNA 4DFKA 4KRFA 3OYLA 3SQ2A 2HNDA 2YKMA 1VSFA 1HNIA 4DSJA 4Z4GA 4FZYA 3NCIA 4FVMA 1U48A 4E1MA 5CZ2A 4E7HA 1QTMA 4CJWA 3VQ9A 2Y1JA 1A5VA 4FLZA 4CK3A 1SKSA 4M42A 4M3UA 4B8AB 3AVJA 1C1BA 1KFSA 3V9SA 4AILC 2P1JA 3KLIA 4DU1A 1BHLA 4Z4EA 4TSXA 4JS5A 3OVNA 3ZT2A 4I2QA 3NFAA 4BE0A 3V6DA 4FM1A 4FLXA 2HHUA 4YNQA 3QERA 3E01A 1KVAA 1W9HA 4CJ4A 4M45A 1RBSA 4E0DA 4ZHRA 3NAEA 2FBVA 1LV5A 1YTUA 2PYJA 4FXDA 2E4LA 4DLGA 4AHSA 4HCBA 3VQQA 1W0HA 3RMBA 4FK2A 4CEZA 5KTQA 3SQ0A 1L3SA 3AA2A 3U3GA 3QNNA 4DFPA 4I9LA 3NBPA 4CF9A 3OYFA 1TGOA 4FJJA 2HVIA 1A5WA 1UA0A 1BQMA 5KGXA 2HHVA 3NF7A 1HYZA 3C6UA 3HXMA 3CFPA 3HT3A 4CJKA 4O55A 3ZT0A 4CF8A 3KKSA 3VQDA 2HHTA 1ITGA 4CFBA 3WNEA 4CGDA 3O4QA 3VN5A 4AH9A 3K5MA 4FM0A 5J2QA 3P83D 1BQNA 1Z25A 4CF0A 5HBMA 3SPZA 3V1OA 1L3TA 1VSMA 1C6VA 2O4IA 4GVMA 3LP2A 1KCFA 4N5SA 3T1AA 1IO2A 1RT4A 3DRSA 3AVLA 3AVHA 4BACA 1ASWA 4CJRA 1Y97A 4KB0A 4DTJA 1TKTA 3AA3A 2ETJA 3L2QA 5HRRA 4LH5A 4J2AA 2NUBA 1NK7A 4FJIA 5I3UA 4CJ5A 4DQSA 3TAPA 1RT5A 3DOKA 3SQ1A 2D0BA 2PYLA 3SI6A 5KRTA 1RBTA 1XHXA 4CEEA 4ZTJA 1T7PA 5FRMA 3SV3A 4CERA 2P5OA 4CHNA 4M3RA 4E7KA 1Z26A 3QLHA 3DM2A 4ID1A 3AVGA 1J53A 4CK2A 4E7LA 4C8OA 4LD0A 4KO0A 2YNIA 3ZSZA 4W5OA 4FJ8A 3CQ8A 1UAXA 4NCBA 1S9GA 4RG8A 4XIUA 4HUGA 3AO5A 4FJHA 3NHGA 1RDBA 3JYTA 4RW8A 4E19A 1XWLA 4DQIA 5D3GA 3DLEA 1LWFA 4K8XA 3DLKA 3NGYA 4OKEA 3NGZA 3RWUA 2HB5A 1QQCA 4L8RB 3WNGA 4FJ9A 2XY5A 4ID5A 2IDOA 1BCOA 1HQUA 3CM5A 3F9KA 1RDAA 4FCYA 4FLWA 4DTUA 4ZTFA 4FK0A 3AVBA 3L2VA 1NJXA 2HHSA 3SUOA 1HQEA 4H4OA 3DYAA 4IFVA 1IKXA 1FKOA 1UWBA 4CCHA 4M3XA 3SYZA 3MEGA 3LP1A 4CEOA 4FJ7A 1LWCA 4DTSA 1X9WA 2A1RA 3NH0A 3SV4A 4ELVA 1WSHA 3KK1A 4JS4A 1F21A 1VRUA 4JRQA 3C95A 4KHNA 1S1VA 3SJJA 4M41A 3OJSA 4B9LA 3L8BA 3G10A 4CESA 1HMVA 3VQ8A 3OYBA 4CGGA 1NKBA 1KRPA 4C8KA 1RBUA 4CHOA 3V9WA 1L5UA 2HHQA 3QO9A 3NF9A 5C25A 3THVA 4F4KA 4IKFA 4J2DA 4N76A 1CZ9A 1BIZA 1RTDA 4G1QA 3T19A 3LAMA 3EYZA 2QKKA 1J54A 3HVRA 2IGIA 4MFBA 4KI4A 3OYNA 1D8YA 4DSKA 1EKEA 3V4IA 4HCCA 1RTHA 3ZSXA 1SUQA 3MXMA 2EX3A 4B3OA 5JS1A 1LW0A 1I3AA 1NKEA 1S1UA 3OYAA 4DFMA 1RT3A 1N6QA 2ITGA 1QS4A 1RT1A 1JL1A 2Z1GA 2YKNA 4CHYA 4KAZA 4PQUA 5JS2A 2YNHA 2Z1JA 4ELTA 3B6OA 1A5XA 3CFRA 3TARA 3K58A 3NE6A 4CFDA 4HUFA 3B6PA 4DWIA 1Q8IA 4B08A 2IAJA 3C6TA 3OYCA 3S3NA 4NCGA 4FLTA 1XC9A 4RW6A 3VA3A 4OLAA 4AHCA 4Z4FA 1U45A 3PY8A 4DLEA 4I2PA 1VSDA 1MU2A 2KFNA 4CE9A 3NGIA 3AVMA 2DFFA 4CJ3A 1VSJA 4CK1A 1LAVA 2RPIA 2ZE2A 3SPYA 1I39A 4CGFA 3NH2A 2XRIA 3D45A 3U6FA 3RRHA 2E6MA 2GBZA 5KI6A 2VG6A 4LY7A 4CJPA 4CHQA 4KHQA 2B5JA 2JLEA 5CY4A 1EETA 3MXJA 5FDLA 3L3VA 1ZBFA 1SKRA 1U4BA 3HSTB 2P51A 3RRGA 3ZSWA 4CEBA 5J1EA 1T8EA 4DQPA 4OLBA 1B9DA 1L3UA 4QOZB 3KLHA 3IAYA 3LPUA 3LP3A 1TK0A 1BL3A 1JLEA 2X74A 4H8KA 3HPOA 2PY5A 3KLGA 4M3WA 1IG9A 1NK4A 1RCHA 4RW7A 3P1GA 4JRPA 4HUEA 1EP4A 2OPQA 3VQ4A 3VQPA 4CIEA 4H4MA 1SL0A 4CGIA 4CF1A 1FK9A 1X1PA 5HROA 4LH4A 3MXIA 1KFDA 1EX4A 1N5YA 1RDCA 4RW9A 3TAMA 4O5BA 2GV9A 2F8SA 4KKOA 1ZBLA 4B9SA 3ZSVA 3LZJA 2RF2A 1KLMA 3M8SA 1NK9A 4CIFA 3AO1A 3P5JA 2DFHA 3I8DA 1C1AA 4UQGA 2G8IA 2E6LA 1T05A 4J2BA 1B92A 4DFJA 3TANA 3F73A 4KPYA 4W5NA 3PUFA 1WSEA 4ELUA 2KTQA 2RN2A 3TAFA 4O44A 4E7JA 2XHBA 2FBTA 3VQ5A 3AVIA 4BWMA 3OY9A 3V9ZA 4DSIA 1DLOA 3HPGA 5HP1A 1FXXA 3S3OA 4B9VA 3DRPA 2B6AA 2FBXA 4DMNA 1EXQA 3K59A 1NOZA 2Y1IA 3AO3A 4HTUA 1GOAA 1X9MA 4IDKA 4I7FA 3D0PA 4E7IA 1KVBA 2XY6A 5J2MA 3AVCA 4AHUA 3HP6A 4CIGA 3SZ2A 2G8KA 1TVRA 1KVCA 3SUQA 1VK0A 1JLCA 1KSPA 4FK4A 2PZSA 2G8WA 3ULDA 4KREA 2DY4A 3DMJA 3V1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8V A;  3K2P A;  3HVT A;  3LDS A;  4KHY A;  4OKK A;  4BE1 A;  1U49 A;  1BGX T;  3CYM A;  2DTU A;  3OYJ A;  1TK5 A;  1D9D A;  1ZBI A;  3V81 A;  1QSL A;  1JXB A;  1WSG A;  3OYK A;  2YV0 X;  1TV6 A;  3DRR A;  4GMJ B;  3RMA A;  3RR8 A;  4FJM A;  4KV8 A;  4DG1 A;  1JKH A;  1IKY A;  4FM2 A;  1JLG A;  3ZSR A;  2Q3S A;  4CHZ A;  4M3Z A;  3K5L A;  1FKP A;  4DS5 A;  1JL2 A;  4BE2 A;  3M8Q A;  3TR8 A;  1SV5 A;  4F2S A;  1Q9X A;  3HPH A;  3KK3 A;  3DOL A;  3LP0 A;  1YTA A;  3ZSY A;  1C0T A;  1S5J A;  1WN7 A;  4O0J A;  3VQ6 A;  3K5N A;  2G8U A;  4BDP A;  3C94 A;  3L3U A;  4CJE A;  3KLF A;  4CFC A;  3S3M A;  2XO7 A;  1NK8 A;  4F2R A;  1U47 A;  3OYM A;  3LWM A;  5DK5 A;  3G0Z A;  3DLR A;  3BDP A;  1S1X A;  1WSJ A;  5J2P A;  3TAQ A;  4CHP A;  3OYG A;  3L2W A;  2WON A;  3ZSQ A;  1HYS A;  4DTR A;  1YVU A;  1K6Y A;  1JLF A;  1WSI A;  1SKW A;  1NJW A;  3ZT1 A;  4Z0U A;  3IG1 A;  4OKJ A;  4B9T A;  2F8T A;  1VSH A;  4CEF A;  3HM9 A;  4OVL A;  2X78 A;  4GW6 A;  4Q0B A;  4F8R A;  1HNV A;  3DLG A;  5EU7 A;  4NCA A;  1ZBU A;  1TAU A;  4C8M A;  3FFI A;  4CFA A;  2VWJ A;  1ZBH A;  4Q5V A;  1C0M A;  4FJN A;  1DTT A;  1RTJ A;  3LAL A;  2HNY A;  4OJR A;  4Z4C A;  1NJZ A;  4IFY A;  4DS4 A;  2HW3 A;  4B9N A;  1IKV A;  1D9F A;  1RDD A;  4PWD A;  3RMC A;  2VWK A;  4DU4 A;  4BDZ A;  3RMD A;  1WAF A;  4O0I A;  3KKR A;  1IKW A;  3ASM A;  3VQA A;  4RW4 A;  3MEC A;  3OS2 A;  2G8H A;  1BI4 A;  1D5A A;  1LAW A;  2YNG A;  3NF6 A;  2KFZ A;  2IC3 A;  3I0R A;  4FLU A;  4OPJ A;  5CZ1 A;  1IH7 A;  4CJU A;  3TAE A;  3LWL A;  3O3H A;  2YHB A;  3SUP A;  3QEV A;  3QET A;  4Z4I A;  3RR7 A;  2B4J A;  3V1Q A;  1NOY A;  4FW1 A;  4QAG A;  3ZT4 A;  1C0U A;  4MQ3 A;  4OGC A;  4N47 A;  1HJR A;  1HPZ A;  2O4G A;  4E1N A;  4PUO A;  4FJK A;  1WNS A;  3OYI A;  3JSM A;  4CED A;  3M8R A;  3K57 A;  3QEI A;  3HJF A;  3OYD A;  1YT3 A;  3AO2 A;  1B9F A;  3OYH A;  3BGR A;  3VQ7 A;  5I42 A;  1G15 A;  3NF8 A;  3QEX A;  3SCX A;  2VG5 A;  3HYF A;  4E89 A;  4E3S A;  3TAB A;  2W42 A;  1JLB A;  2OPP A;  3WNF A;  1RT2 A;  4CF2 A;  1GOC A;  3UIQ A;  4M3Y A;  4PY5 A;  4I9Q A;  1TKX A;  4R5P A;  1BIS A;  4N41 A;  4CJQ A;  3IRX A;  3LZI A;  3AVF A;  2KQ2 A;  1NK5 A;  1TK8 A;  1TKD A;  4KI6 A;  2I5J A;  3QIP A;  4EP4 A;  1VSL A;  1BIU A;  1CXU A;  2FBY A;  4DQR A;  4DQQ A;  4CJT A;  4M3T A;  3SUN A;  1NK0 A;  2OZM A;  2WOM A;  4CJF A;  1RTI A;  4CEA A;  4DF4 A;  2QXF A;  2P5G A;  3RTV A;  1CLQ A;  1ASU A;  2HHW A;  4DTX A;  3DLH A;  3ALY A;  1VSK A;  4ICL A;  2YNF A;  3AVA A;  3ZCM A;  4CJL A;  3MAQ A;  1ZYQ A;  4CEC A;  4W5R A;  2KW4 A;  4LSL A;  3CG7 A;  1VRT A;  1BI4 B;  4CJS A;  4FJ5 A;  1S1W A;  4FYD A;  3LAK A;  1S9E A;  1U04 A;  2X6S A;  3OS1 A;  2VG7 A;  3LAN A;  1QSS A;  3PX6 A;  3OJU A;  4EZ6 A;  3HO1 A;  4DF8 A;  1C1C A;  1GOB A;  3V9X A;  3KIO A;  5DMR A;  3AV9 A;  4DTP A;  3U3Y A;  3QIN A;  2Z1H A;  3ISN C;  4OPK A;  1UA1 A;  4CGJ A;  2GUI A;  2A1S A;  4IBN A;  5T7B A;  1CXQ A;  4WE1 A;  3VQB A;  5SZT A;  3KJV A;  2OPS A;  4DTO A;  3ZSO A;  2F96 A;  4CGH A;  4DTN A;  2DFE A;  3WNH A;  5KRS A;  4DU3 A;  2IS3 A;  4LSN A;  4EP5 A;  3EY1 A;  3TAG A;  3O3F A;  1VSE A;  1BCM A;  2EHG A;  3TWH A;  2JGU A;  3LPT A;  2LSN A;  4KTQ A;  3VQE A;  2D0C A;  4FZZ A;  1Q9Y A;  1CZB A;  3MED A;  4PA1 A;  2HHX A;  1RT7 A;  5FRN A;  5HRN A;  3MEE A;  2IOC A;  3V9U A;  2D0A A;  1J9A A;  4BWJ A;  2KZM A;  1WAJ A;  1UOC A;  4NYN A;  2ZD1 A;  3EZ5 A;  3L2R A;  4W5Q A;  2HNZ A;  3KD5 E;  5E41 A;  1SL1 A;  4B9U A;  3PO4 A;  1S6Q A;  1WSF A;  3AVN A;  1HRH A;  3M8P A;  1X9S A;  3S9H A;  5HRS A;  5HLF A;  1RBR A;  3IS9 A;  4CJV A;  3OYE A;  1XHZ A;  4NYF A;  4AHV A;  1VSI A;  2D5R A;  4Y1D A;  2Z1I A;  4K8Z A;  4KHU A;  2BGG A;  3QEW A;  3AO4 A;  2RKI A;  5HRP A;  5J2N A;  1JXE A;  1RNH A;  1SL2 A;  1L3V A;  4DSF A;  1QSY A;  3PO5 A;  4FJG A;  1REV A;  4FJX A;  3VA0 A;  3QES A;  1TL1 A;  4YFU A;  2FC0 A;  1NJY A;  4DSL A;  1R0A A;  1KTQ A;  3O3G A;  4DSE A;  4IG3 A;  1HYV A;  3K5O A;  3PX4 A;  1ASV A;  2BE2 A;  1XI1 A;  1JLA A;  5FRO A;  1O1W A;  2HVH A;  2OYQ A;  1TKZ A;  3A2F A;  4F3T A;  1LW2 A;  5CYM A;  2ATQ A;  3KTQ A;  4J2E A;  3PV8 A;  5KGW A;  2HMI A;  2AJQ A;  1DTQ A;  1S1T A;  3AA4 A;  1RBV A;  4QCL A;  4B8C A;  3HP9 A;  4FW2 A;  1LWE A;  3DI6 A;  2KZZ A;  1RIL A;  1WLJ A;  4DTM A;  4FJL A;  5CYQ A;  4FLV A;  3CFO A;  1J5O A;  4N56 A;  3H08 A;  4B9M A;  4KTW A;  4KHW A;  3NH1 A;  3HK2 A;  3QEP A;  3SNN A;  3CM6 A;  1QE1 A;  3DLB A;  3TI0 A;  4AHT A;  1TAQ A;  2OPR A;  3VQC A;  4IG0 A;  3SQ4 A;  1QHT A;  2G8F A;  2YHA A;  3AA5 X;  1RT6 A;  2OZS A;  3QNO A;  2OA8 A;  4FZX C;  3QIO A;  3I0S A;  4O4G A;  4AHR A;  4W5T A;  4EZ9 A;  3PX0 A;  3HL8 A;  2XY8 A;  4JLH A;  1S6P A;  4C8N A;  3ITH A;  2XY7 A;  4C8L A;  5C24 A;  2QK9 A;  3ZT3 A;  2R7Y A;  2BDP A;  1NK6 A;  4F3O A;  4KHS A;  3NDK A;  4OGE A;  3KD1 E;  3KLE A;  4HVJ A;  3O4N A;  5K14 A;  5C42 A;  2BAN A;  1JLQ A;  4CEQ A;  3KK2 A;  4FLY A;  4KB1 A;  4HHT A;  4Z4H A;  4KFB A;  5SWM A;  4KTZ A;  4BDY A;  2ZQB A;  3T3F A;  2QKB A;  3OS0 A;  1TL3 A;  2X6N A;  3L2U A;  4Y1C A;  3AVK A;  1T03 A;  1NKC A;  1KLN A;  4DFK A;  4KRF A;  3OYL A;  3SQ2 A;  2HND A;  2YKM A;  1VSF A;  1HNI A;  4DSJ A;  4Z4G A;  4FZY A;  3NCI A;  4FVM A;  1U48 A;  4E1M A;  5CZ2 A;  4E7H A;  1QTM A;  4CJW A;  3VQ9 A;  2Y1J A;  1A5V A;  4FLZ A;  4CK3 A;  1SKS A;  4M42 A;  4M3U A;  4B8A B;  3AVJ A;  1C1B A;  1KFS A;  3V9S A;  4AIL C;  2P1J A;  3KLI A;  4DU1 A;  1BHL A;  4Z4E A;  4TSX A;  4JS5 A;  3OVN A;  3ZT2 A;  4I2Q A;  3NFA A;  4BE0 A;  3V6D A;  4FM1 A;  4FLX A;  2HHU A;  4YNQ A;  3QER A;  3E01 A;  1KVA A;  1W9H A;  4CJ4 A;  4M45 A;  1RBS A;  4E0D A;  4ZHR A;  3NAE A;  2FBV A;  1LV5 A;  1YTU A;  2PYJ A;  4FXD A;  2E4L A;  4DLG A;  4AHS A;  4HCB A;  3VQQ A;  1W0H A;  3RMB A;  4FK2 A;  4CEZ A;  5KTQ A;  3SQ0 A;  1L3S A;  3AA2 A;  3U3G A;  3QNN A;  4DFP A;  4I9L A;  3NBP A;  4CF9 A;  3OYF A;  1TGO A;  4FJJ A;  2HVI A;  1A5W A;  1UA0 A;  1BQM A;  5KGX A;  2HHV A;  3NF7 A;  1HYZ A;  3C6U A;  3HXM A;  3CFP A;  3HT3 A;  4CJK A;  4O55 A;  3ZT0 A;  4CF8 A;  3KKS A;  3VQD A;  2HHT A;  1ITG A;  4CFB A;  3WNE A;  4CGD A;  3O4Q A;  3VN5 A;  4AH9 A;  3K5M A;  4FM0 A;  5J2Q A;  3P83 D;  1BQN A;  1Z25 A;  4CF0 A;  5HBM A;  3SPZ A;  3V1O A;  1L3T A;  1VSM A;  1C6V A;  2O4I A;  4GVM A;  3LP2 A;  1KCF A;  4N5S A;  3T1A A;  1IO2 A;  1RT4 A;  3DRS A;  3AVL A;  3AVH A;  4BAC A;  1ASW A;  4CJR A;  1Y97 A;  4KB0 A;  4DTJ A;  1TKT A;  3AA3 A;  2ETJ A;  3L2Q A;  5HRR A;  4LH5 A;  4J2A A;  2NUB A;  1NK7 A;  4FJI A;  5I3U A;  4CJ5 A;  4DQS A;  3TAP A;  1RT5 A;  3DOK A;  3SQ1 A;  2D0B A;  2PYL A;  3SI6 A;  5KRT A;  1RBT A;  1XHX A;  4CEE A;  4ZTJ A;  1T7P A;  5FRM A;  3SV3 A;  4CER A;  2P5O A;  4CHN A;  4M3R A;  4E7K A;  1Z26 A;  3QLH A;  3DM2 A;  4ID1 A;  3AVG A;  1J53 A;  4CK2 A;  4E7L A;  4C8O A;  4LD0 A;  4KO0 A;  2YNI A;  3ZSZ A;  4W5O A;  4FJ8 A;  3CQ8 A;  1UAX A;  4NCB A;  1S9G A;  4RG8 A;  4XIU A;  4HUG A;  3AO5 A;  4FJH A;  3NHG A;  1RDB A;  3JYT A;  4RW8 A;  4E19 A;  1XWL A;  4DQI A;  5D3G A;  3DLE A;  1LWF A;  4K8X A;  3DLK A;  3NGY A;  4OKE A;  3NGZ A;  3RWU A;  2HB5 A;  1QQC A;  4L8R B;  3WNG A;  4FJ9 A;  2XY5 A;  4ID5 A;  2IDO A;  1BCO A;  1HQU A;  3CM5 A;  3F9K A;  1RDA A;  4FCY A;  4FLW A;  4DTU A;  4ZTF A;  4FK0 A;  3AVB A;  3L2V A;  1NJX A;  2HHS A;  3SUO A;  1HQE A;  4H4O A;  3DYA A;  4IFV A;  1IKX A;  1FKO A;  1UWB A;  4CCH A;  4M3X A;  3SYZ A;  3MEG A;  3LP1 A;  4CEO A;  4FJ7 A;  1LWC A;  4DTS A;  1X9W A;  2A1R A;  3NH0 A;  3SV4 A;  4ELV A;  1WSH A;  3KK1 A;  4JS4 A;  1F21 A;  1VRU A;  4JRQ A;  3C95 A;  4KHN A;  1S1V A;  3SJJ A;  4M41 A;  3OJS A;  4B9L A;  3L8B A;  3G10 A;  4CES A;  1HMV A;  3VQ8 A;  3OYB A;  4CGG A;  1NKB A;  1KRP A;  4C8K A;  1RBU A;  4CHO A;  3V9W A;  1L5U A;  2HHQ A;  3QO9 A;  3NF9 A;  5C25 A;  3THV A;  4F4K A;  4IKF A;  4J2D A;  4N76 A;  1CZ9 A;  1BIZ A;  1RTD A;  4G1Q A;  3T19 A;  3LAM A;  3EYZ A;  2QKK A;  1J54 A;  3HVR A;  2IGI A;  4MFB A;  4KI4 A;  3OYN A;  1D8Y A;  4DSK A;  1EKE A;  3V4I A;  4HCC A;  1RTH A;  3ZSX A;  1SUQ A;  3MXM A;  2EX3 A;  4B3O A;  5JS1 A;  1LW0 A;  1I3A A;  1NKE A;  1S1U A;  3OYA A;  4DFM A;  1RT3 A;  1N6Q A;  2ITG A;  1QS4 A;  1RT1 A;  1JL1 A;  2Z1G A;  2YKN A;  4CHY A;  4KAZ A;  4PQU A;  5JS2 A;  2YNH A;  2Z1J A;  4ELT A;  3B6O A;  1A5X A;  3CFR A;  3TAR A;  3K58 A;  3NE6 A;  4CFD A;  4HUF A;  3B6P A;  4DWI A;  1Q8I A;  4B08 A;  2IAJ A;  3C6T A;  3OYC A;  3S3N A;  4NCG A;  4FLT A;  1XC9 A;  4RW6 A;  3VA3 A;  4OLA A;  4AHC A;  4Z4F A;  1U45 A;  3PY8 A;  4DLE A;  4I2P A;  1VSD A;  1MU2 A;  2KFN A;  4CE9 A;  3NGI A;  3AVM A;  2DFF A;  4CJ3 A;  1VSJ A;  4CK1 A;  1LAV A;  2RPI A;  2ZE2 A;  3SPY A;  1I39 A;  4CGF A;  3NH2 A;  2XRI A;  3D45 A;  3U6F A;  3RRH A;  2E6M A;  2GBZ A;  5KI6 A;  2VG6 A;  4LY7 A;  4CJP A;  4CHQ A;  4KHQ A;  2B5J A;  2JLE A;  5CY4 A;  1EET A;  3MXJ A;  5FDL A;  3L3V A;  1ZBF A;  1SKR A;  1U4B A;  3HST B;  2P51 A;  3RRG A;  3ZSW A;  4CEB A;  5J1E A;  1T8E A;  4DQP A;  4OLB A;  1B9D A;  1L3U A;  4QOZ B;  3KLH A;  3IAY A;  3LPU A;  3LP3 A;  1TK0 A;  1BL3 A;  1JLE A;  2X74 A;  4H8K A;  3HPO A;  2PY5 A;  3KLG A;  4M3W A;  1IG9 A;  1NK4 A;  1RCH A;  4RW7 A;  3P1G A;  4JRP A;  4HUE A;  1EP4 A;  2OPQ A;  3VQ4 A;  3VQP A;  4CIE A;  4H4M A;  1SL0 A;  4CGI A;  4CF1 A;  1FK9 A;  1X1P A;  5HRO A;  4LH4 A;  3MXI A;  1KFD A;  1EX4 A;  1N5Y A;  1RDC A;  4RW9 A;  3TAM A;  4O5B A;  2GV9 A;  2F8S A;  4KKO A;  1ZBL A;  4B9S A;  3ZSV A;  3LZJ A;  2RF2 A;  1KLM A;  3M8S A;  1NK9 A;  4CIF A;  3AO1 A;  3P5J A;  2DFH A;  3I8D A;  1C1A A;  4UQG A;  2G8I A;  2E6L A;  1T05 A;  4J2B A;  1B92 A;  4DFJ A;  3TAN A;  3F73 A;  4KPY A;  4W5N A;  3PUF A;  1WSE A;  4ELU A;  2KTQ A;  2RN2 A;  3TAF A;  4O44 A;  4E7J A;  2XHB A;  2FBT A;  3VQ5 A;  3AVI A;  4BWM A;  3OY9 A;  3V9Z A;  4DSI A;  1DLO A;  3HPG A;  5HP1 A;  1FXX A;  3S3O A;  4B9V A;  3DRP A;  2B6A A;  2FBX A;  4DMN A;  1EXQ A;  3K59 A;  1NOZ A;  2Y1I A;  3AO3 A;  4HTU A;  1GOA A;  1X9M A;  4IDK A;  4I7F A;  3D0P A;  4E7I A;  1KVB A;  2XY6 A;  5J2M A;  3AVC A;  4AHU A;  3HP6 A;  4CIG A;  3SZ2 A;  2G8K A;  1TVR A;  1KVC A;  3SUQ A;  1VK0 A;  1JLC A;  1KSP A;  4FK4 A;  2PZS A;  2G8W A;  3ULD A;  4KRE A;  2DY4 A;  3DMJ A;  3V1R A; 
#chains in the Genus database with same CATH topology
 3HVT A;  4KHY A;  4CZJ A;  4BE1 A;  4BR9 A;  3CYM A;  3ENO A;  2DTU A;  4UY8 O;  1D9D A;  4I6M B;  1WSG A;  3D6R A;  1U2V B;  2ITM A;  3GG4 A;  3R6M A;  1V4T A;  4GVE A;  4M3Z A;  2Q3S A;  3AAQ A;  3O8M A;  3TSP A;  1FKP A;  4K43 A;  4KH4 A;  1C0T A;  3S41 A;  3VQ6 A;  2YJE A;  3FZH A;  4MDB A;  3NVM A;  3WXM B;  3OYM A;  4H5N A;  3DLR A;  1S1X A;  3GE1 A;  1K8A O;  3HRG A;  3CCE N;  1Z6R A;  2PBD A;  3ID6 A;  3ZSQ A;  4AQY K;  1NJW A;  3EE9 A;  4OVL A;  4NLC A;  4GW6 A;  4Q0B A;  1NGC A;  4F8R A;  5EU7 A;  3HZ6 A;  3J7Y P;  2KKZ A;  2ZJR L;  3LM9 A;  1ZBH A;  2WFB A;  2A3Z A;  3LAL A;  4Z4C A;  4OJR A;  3ZX2 A;  3BY5 A;  1R59 O;  5LY3 A;  1VQ9 N;  3VEZ A;  1RDD A;  1WAF A;  4O0I A;  1IKW A;  4E1J A;  2E88 A;  3ASM A;  3VQA A;  4RW4 A;  4BC3 A;  1BI4 A;  4O8U A;  2YNG A;  5AZJ A;  3WXJ A;  2GWK A;  1OH6 A;  4Z4I A;  2B4J A;  3ZT4 A;  2NRX A;  4JHD A;  2WBN A;  2O4G A;  2A5X A;  4B1X B;  4H5T A;  3M8R A;  2CH5 A;  3HJF A;  1WBD A;  4JNE A;  3JXU A;  1G15 A;  1NGF A;  3NF8 A;  1LCU A;  4G9Z A;  2I7P A;  2UXC K;  1JLB A;  4CF2 A;  1GOC A;  1TKX A;  4DUY K;  4N41 A;  1NGI A;  2FF6 A;  2KQ2 A;  1TKD A;  4EP4 A;  3EKS A;  3AAR A;  4CJT A;  3SUN A;  1NK0 A;  4JKG A;  2W6K A;  2WOM A;  3RVC A;  3VET A;  4AF1 A;  1J5E K;  1ASU A;  3ALY A;  1VSK A;  3AVA A;  1W7A A;  4RWT A;  2KW4 A;  3TSQ A;  5CE3 A;  5AJ3 K;  3VGM A;  3OS1 A;  1QSS A;  3OJU A;  3VEO A;  3V9X A;  3QIN A;  3ISN C;  2QTD A;  5T7B A;  4JK9 A;  1BO5 O;  4WE1 A;  5SZT A;  2RHK A;  4DTO A;  2F96 A;  5KRS A;  2IS3 A;  3EY1 A;  1BCM A;  2YCH A;  4KTQ A;  3VQE A;  1CZB A;  2YHX A;  1RT7 A;  3CPW M;  3MEE A;  3A5O C;  5GAH P;  2ZD1 A;  3L2R A;  4W5Q A;  5E41 A;  1SL1 A;  1XMO K;  4DV1 K;  4B9U A;  3AVN A;  1X9S A;  1XHZ A;  1IG8 A;  4AHV A;  1VSI A;  4K8Z A;  2BGG A;  2P9U A;  3AO4 A;  5HRP A;  1RNH A;  2H3G X;  4FJG A;  5C10 A;  4BC4 A;  1NJY A;  3A5L C;  4DSE A;  1Z05 A;  3K5O A;  5TKY A;  3PX4 A;  4CZE A;  1T6D A;  1HJO A;  1TKZ A;  1LW2 A;  5CYM A;  5KGW A;  1DTQ A;  3C0B A;  4QCL A;  1RIL A;  4JKC A;  3CFO A;  3DXK B;  3NH1 A;  4CZI A;  3MMV A;  4ILJ A;  3QEP A;  3P31 A;  2OPR A;  3GBT A;  1YJW N;  4H5W A;  5C2F A;  3Q7B A;  2OZS A;  4BRM A;  3T1Y K;  3QNO A;  4FZX C;  2E2N A;  2E2Q A;  3ZT3 A;  1NK6 A;  3NDK A;  3KLE A;  3O4N A;  3THX A;  4CEQ A;  1JLQ A;  1S72 N;  4KB1 A;  1NBW A;  4Z4H A;  2QKB A;  5SWM A;  3T3F A;  4BDY A;  4PKH A;  1TL3 A;  2VWB A;  1HUX A;  2X6N A;  4Y1C A;  1I94 K;  3OYL A;  2YKM A;  4Z4G A;  3U9Z A;  5B8H A;  4JKA A;  5CZ2 A;  3UKR A;  4E7H A;  4CJW A;  3FZL A;  1SAZ A;  1A5V A;  3HSC A;  4CK3 A;  1SKS A;  1D4X A;  5KPT A;  1KFS A;  3AVJ A;  4Z4E A;  4TSX A;  1HNW K;  3NFA A;  4FLX A;  3BP8 A;  3E01 A;  4JI7 K;  4V19 S;  2PYJ A;  3JS6 A;  1KC8 O;  4AHS A;  1O13 A;  3VQQ A;  4FK2 A;  3SQ0 A;  1NGG A;  3AA2 A;  5BPN A;  4J8F A;  3NBP A;  3WEE B;  3EN9 A;  4F9O A;  5KGX A;  1KAY A;  3SLC A;  4GKJ K;  3J7A P;  4AH9 A;  4O5F A;  3P83 D;  1BQN A;  2P9S B;  2CGL A;  3V1O A;  2P9L A;  3CER A;  4N5S A;  4BAC A;  3AVH A;  4RTF D;  4DTJ A;  1YVN A;  2ZGZ A;  5AQV A;  4FJI A;  5I3U A;  4CJ5 A;  3THY A;  3SQ1 A;  1RBT A;  1XHX A;  4CER A;  4CHN A;  2VCP A;  3QLH A;  3K9K A;  4CK2 A;  2FLO A;  3ZSZ A;  2YNI A;  4FJ8 A;  3CQ8 A;  4NCB A;  4FJH A;  4DQI A;  2FSJ A;  4K8X A;  3DLK A;  1YUW A;  2VQE K;  2V7Y A;  3NGY A;  3SBT A;  3NGZ A;  2HB5 A;  1J6Z A;  3WNG A;  3LDQ A;  4FJ9 A;  3F9K A;  1HQU A;  1V4S A;  4FK0 A;  2FXU A;  2QXL A;  3DXM A;  4DUZ K;  4DR3 K;  2HBK A;  3SYZ A;  3LP1 A;  4CEO A;  1ZC6 A;  2ZF5 O;  4YOT A;  3WXI A;  3KK1 A;  1HKC A;  4JRQ A;  1E4G T;  4KHN A;  1S1V A;  4BRG A;  2D0P A;  3OJS A;  2VGM A;  1KRP A;  4CES A;  2QWO A;  1NKB A;  3BF1 A;  4AM6 A;  1EO1 A;  3NF9 A;  5C25 A;  4IKF A;  4F4K A;  4BRF A;  3OBY A;  2F9W A;  3EYZ A;  3LAM A;  3D2F B;  1XMQ K;  5FPD A;  1IBK K;  2PAV A;  1Q86 O;  1RTH A;  1SUQ A;  5I9E B;  2EX3 A;  3ZET B;  1S1U A;  3OYA A;  2QEX N;  3DWL A;  3N4Q A;  3O9T A;  1RT1 A;  5JMV A;  3TPQ A;  1VAZ A;  3H3N O;  3EO3 A;  2ASO A;  2YNH A;  2Z1J A;  4BC2 A;  4ELT A;  1A5X A;  3NE6 A;  4HTL A;  4CFD A;  3B6P A;  5LJW A;  4DWI A;  5EVZ A;  1Q8I A;  4JK8 A;  1NGA A;  2D4W A;  4RCH A;  5AQP A;  1JCG A;  4OLA A;  5AQQ A;  2KFN A;  1VSD A;  1MU2 A;  5M1P A;  3CPE A;  4CK1 A;  1LAV A;  4L3Q A;  4CGF A;  1GLL O;  2XRI A;  3FLC O;  3O80 A;  2ZM6 K;  3U6F A;  2GBZ A;  4LY7 A;  3KK7 A;  5CY4 A;  2OAN A;  1EET A;  1E3M A;  2F9T A;  4OLB A;  1H1V A;  2IVO A;  3CC7 N;  3LPU A;  1TK0 A;  4DR4 K;  1JLE A;  1IG9 A;  1RCH A;  1EP4 A;  2OPQ A;  4DV6 K;  5FPN A;  3PIP L;  4BRE A;  1S22 A;  2E2O A;  4O5B A;  3RSE A;  3EEQ A;  3ZSV A;  3M8S A;  3VGL A;  4XH1 A;  3AO1 A;  3P5J A;  1C1A A;  5LL6 Z;  2G8I A;  2E6L A;  2F7T A;  3Q7C A;  3TAN A;  4PKG A;  4KPY A;  4W5N A;  4ELU A;  4JN4 A;  4E7J A;  3OY9 A;  5HP1 A;  1FXX A;  3S3O A;  4CW7 B;  1EXQ A;  3K59 A;  1NOZ A;  4HTU A;  1C0F A;  1X9M A;  5BR9 A;  2XY6 A;  5J2M A;  4OX9 K;  1QZ5 A;  1NU0 A;  1KVC A;  4FK4 A;  3ULD A;  1X3M A;  3CCM N;  3LDS A;  1U49 A;  3TU5 A;  3MN9 A;  1ZBI A;  3V81 A;  4JKE A;  5IT9 O;  2YV0 X;  1JKH A;  3ZSR A;  4K25 A;  3K5L A;  2O8F B;  5GAG P;  4X65 K;  2WUS A;  4EFH A;  3DOL A;  4O8K A;  3MX5 A;  3C94 A;  2Q0U A;  3L3U A;  4CJE A;  3KLF A;  5F1X A;  2XO7 A;  1NK8 A;  4CZM A;  3G0Z A;  3BDP A;  4JI5 K;  3TAQ A;  3KVG A;  2WON A;  4DTR A;  3G71 N;  4JI3 K;  1WSI A;  2V52 B;  1SKW A;  4Z0U A;  2F8T A;  5EX5 A;  3VMF B;  3HM9 A;  1DT9 A;  2X78 A;  2EWS A;  4DV2 K;  1HNV A;  1ILY A;  1TAU A;  4FJN A;  1OKJ A;  1RDW X;  3AGR A;  1NJZ A;  1ATR A;  1VQP N;  3CCS N;  1D9F A;  4PWD A;  3RMC A;  4BRC A;  2W41 A;  2G8H A;  1LAW A;  3NF6 A;  2IC3 A;  3I0R A;  3T7Z A;  1IH7 A;  1U6Z A;  2UXD K;  1OH7 A;  2YHB A;  4DQ8 A;  1N32 K;  3C6A A;  3RR7 A;  3P4I A;  4LFC K;  4QAG A;  4PKI A;  4N47 A;  1HJR A;  4E1N A;  4FJK A;  4FWK A;  3FZM A;  3SAH A;  4CED A;  1YT3 A;  2P9K B;  3BGR A;  1BWF O;  4XH4 A;  3VEX A;  3ZEU A;  2VG5 A;  4E3S A;  3TAB A;  3SCX A;  2O8C A;  4JI6 K;  5GIO A;  1BIS A;  3GL1 A;  3KHY A;  4CJQ A;  3LZI A;  3OTO K;  5F2R A;  1HPM A;  3AVF A;  2DPN A;  3QIP A;  4DQQ A;  4CJF A;  1RTI A;  4YOW A;  3RTV A;  1Q7Y O;  3DLH A;  4CJL A;  3ZCM A;  2ASP A;  2KLA A;  4CEC A;  4W5R A;  2QWM A;  2X6S A;  3PX6 A;  4DF8 A;  3AV9 A;  3VEN A;  4OPK A;  1N34 K;  4IBN A;  2A1S A;  5F0X A;  1CXQ A;  2OPS A;  1N8R O;  2DFE A;  4GNI A;  4B1Z A;  5MLC Q;  3TAG A;  1VSE A;  3QFU A;  3TWH A;  3LPT A;  2BTF A;  2UUC K;  3FR0 A;  4FZZ A;  4PA1 A;  3M5R A;  2NRW A;  1N36 K;  1J9A A;  3LM2 A;  4CZL A;  4GV6 A;  1SZ2 A;  2HNZ A;  2NRT A;  2Q1N A;  2JWL A;  3PO4 A;  4NB4 A;  1HRH A;  5AQU A;  3M8P A;  5HRS A;  1RBR A;  3IS9 A;  3ZET A;  4CJV A;  3OYE A;  2O8E A;  4KHU A;  2HMP A;  2O8B A;  2RKI A;  1QSY A;  5J2N A;  1SL2 A;  3PO5 A;  4FJX A;  1REV A;  4CZK A;  4ISE A;  3UKU B;  4DSL A;  1VQN N;  3O3G A;  4IWV A;  1OVY A;  5M1O A;  3BZK A;  3ID8 A;  2OYQ A;  4BR2 A;  3CCL N;  4H0P A;  2HMI A;  3EKU A;  2AJQ A;  3UB5 A;  3NVK A;  4FW2 A;  1LWE A;  2CGJ A;  3IKM A;  4FLV A;  1J5O A;  4B9M A;  4KTW A;  4KHW A;  3DLB A;  3TI0 A;  3DAW A;  4IG0 A;  4H5R A;  2I7N A;  2YHA A;  3AA5 X;  3F5T A;  4LF9 K;  2OA8 A;  3A8Y A;  3AY9 A;  4W5T A;  4O4G A;  4AHR A;  4DHY A;  4B3R K;  1P8Z A;  4DR5 K;  1OVQ A;  3THW B;  2XY7 A;  2QK9 A;  2BDP A;  4KHS A;  2DY4 A;  4FLY A;  4HVJ A;  5C42 A;  4HHT A;  3UE5 A;  1VQO N;  3OS0 A;  4EIA A;  4K42 A;  5AQF A;  3AVK A;  1BDG A;  4KRF A;  1YI2 N;  2HND A;  3VF2 A;  5CHI A;  3W0L A;  1GLF O;  3NCI A;  2P9N B;  3M6G A;  4FVM A;  4E1M A;  3WQT A;  1XNR K;  2Y1J A;  1BA1 A;  4WQ5 A;  2W40 A;  4M42 A;  4FOI A;  3L4Q A;  1BA0 A;  2QWQ A;  3KLI A;  4AIL C;  3ZT2 A;  1NGH A;  4I2Q A;  4B3T K;  4BE0 A;  3V6D A;  2BUP A;  3CI5 A;  2HHU A;  3QER A;  4QS8 A;  1W9H A;  4CJ4 A;  4M45 A;  4FXD A;  2AP1 A;  2E4L A;  1X3N A;  1GLB G;  4DLG A;  4HCB A;  1W0H A;  4CEZ A;  3QNN A;  4DFP A;  3CJ1 A;  4X66 K;  4IEE A;  4AM7 A;  1TGO A;  2OTL N;  4FJJ A;  1A5W A;  1UA0 A;  1BQM A;  3NF7 A;  3HTV A;  3VEY A;  4YOV A;  3HT3 A;  3ZT0 A;  3KKS A;  4DR7 K;  1ITG A;  4CFB A;  3C7N A;  3O4Q A;  5J2Q A;  4WF9 L;  2P9I B;  3SPZ A;  2O4I A;  4GVM A;  3WT0 A;  5AQZ A;  2YHY A;  1RT4 A;  3AVL A;  3MN6 A;  5GIN A;  5FPE A;  4WFB L;  3L2Q A;  5LMN K;  3TAP A;  4EAH D;  4JD2 A;  5KRT A;  2QWP A;  2P5O A;  3O08 A;  4M3R A;  2IVN A;  1Z26 A;  4BVP A;  3DM2 A;  1HX1 A;  3AVG A;  3ENH A;  3MN5 A;  4JAX A;  4E7L A;  4C8O A;  4LD0 A;  4KO0 A;  4W5O A;  1VQ5 N;  1S9G A;  4RG8 A;  4H0O A;  4CI6 A;  4XIU A;  4YY3 K;  3LDP A;  4RW8 A;  3J7Z O;  5D3G A;  1QVF M;  3DLE A;  3FE1 A;  1T3V A;  5ADX A;  4OKE A;  3L0Q A;  4L8R B;  1QQC A;  3SAG A;  2IDO A;  1BCO A;  2E1Y A;  4FLW A;  4DTU A;  2P9P A;  3DYA A;  4IFV A;  1IKX A;  1FKO A;  4LF7 K;  4M3X A;  4DTS A;  1X9W A;  3NH0 A;  3SV4 A;  4WQ5 C;  1WSH A;  3A5N C;  3K9J A;  3C95 A;  4YHH K;  1YIT N;  3QDK A;  4CGG A;  1Q18 A;  1RBU A;  4BGA A;  5GAE P;  4CZG A;  1CZ9 A;  3HVR A;  3WXK A;  3O1B A;  1VQ8 N;  3ZSX A;  4LF6 K;  3HM8 A;  1LW0 A;  3F2K A;  1NKE A;  2W6L A;  3P39 A;  1N6Q A;  2ITG A;  1QS4 A;  1HKG A;  5AQS A;  1RFQ A;  1ATN A;  4X64 K;  1C0G A;  3O9R A;  3IUC A;  5HL7 L;  4B08 A;  3OYC A;  2BH1 A;  4YOX A;  5JLF A;  1TUU A;  3PY8 A;  4I2P A;  1VSJ A;  2F4V K;  4FWN A;  3OHR A;  2RPI A;  2ZE2 A;  3NH2 A;  1MDU B;  1NG9 A;  1K8K A;  2B5J A;  2JLE A;  4JKF A;  3CC4 N;  3TTD A;  4DV4 K;  1U4B A;  1BOT O;  3HST B;  3RRG A;  3ZSW A;  5J1E A;  4C23 A;  3IAY A;  3CF5 L;  3CCR N;  2PY5 A;  1BL3 A;  3HPO A;  1Y64 A;  3KLG A;  4RW7 A;  3P1G A;  4I6M A;  3CJC A;  3VQP A;  4CIE A;  1U2V A;  4H4M A;  1SL0 A;  5HRO A;  4IO8 A;  1KFD A;  1EX4 A;  2QWL A;  4MLH A;  3A0I X;  4KKO A;  4CD3 A;  3LZJ A;  5AQN A;  4WQ4 A;  3CC2 N;  4J2B A;  4DFJ A;  3F73 A;  3PUF A;  5AZI B;  1WBB A;  2XHB A;  3VQ5 A;  4BWM A;  3HPG A;  4B9V A;  3ULE B;  2A6A A;  4A2A A;  2FBX A;  2HBM A;  4BRA A;  1GOA A;  3O9Q A;  5M1K A;  3CIP A;  2O8D B;  4CIG A;  5AQK A;  1KAX A;  1HKB A;  1VK0 A;  1JLC A;  2G8W A;  3D2E B;  5EY4 A;  2G8V A;  3K2P A;  4OKK A;  3R8E A;  1WOQ A;  1NJI O;  3DRR A;  4CD1 A;  3RMA A;  4M7X A;  3O1W A;  4FM2 A;  1JLG A;  1VHX A;  4CHZ A;  3EZW A;  4A62 A;  4DS5 A;  1JL2 A;  3M8Q A;  1SV5 A;  5FLX O;  2HOE A;  4BRN A;  1Q9X A;  3HPH A;  3KK3 A;  5C2D A;  3ZSY A;  1YTA A;  3K5N A;  1VQ4 N;  4MLE A;  4CFC A;  1NGE A;  4F2R A;  1U47 A;  5DK5 A;  4YOY A;  2OTJ N;  4LF8 K;  4DCH A;  5FPM A;  4M7Y A;  5J2P A;  3OYG A;  1TUY A;  2GWJ A;  1K6Y A;  5AQH A;  1JLF A;  3E66 A;  3IMX A;  3ZT1 A;  4GV9 A;  5JVG L;  4A57 A;  4B9T A;  1WUA A;  5BRF A;  1YXQ A;  4EHT A;  2HBJ A;  3DLL L;  4C8M A;  3FFI A;  4IZ9 A;  4Q5V A;  1GLC G;  1C0M A;  1DTT A;  1ESV A;  1RTJ A;  3T69 A;  5EXW A;  4B9N A;  1IKV A;  2VWK A;  3RMD A;  4BDZ A;  2E8A A;  4JI4 K;  4KBO A;  3VTH A;  1D5A A;  1GLA G;  5KPZ A;  1YJ9 N;  4WQ4 C;  5CZ1 A;  1SQK A;  4FO0 A;  3LWL A;  4MO4 A;  2J4R A;  3D7E O;  1VQM N;  3V1Q A;  3NMU A;  4FW1 A;  3J81 O;  4OGC A;  3LDO A;  3WUH A;  4PUO A;  1WNS A;  3OYI A;  5AFU H;  3K57 A;  5BR8 K;  3OYD A;  5DM6 L;  3VQ7 A;  5I42 A;  2W42 A;  3UIQ A;  4M3Y A;  4I9Q A;  3MDQ A;  2QWN A;  3IRX A;  3E9L A;  4A61 A;  2I5J A;  1VSL A;  1BIU A;  1CXU A;  2FBY A;  1DGK N;  2UUB K;  4M3T A;  5KQ8 A;  5AQR A;  2NNW A;  3VEV A;  3ZX3 A;  2QXF A;  4DF4 A;  2P5G A;  1CLQ A;  2HHW A;  4YOR A;  3VGK A;  3MAQ A;  3VPZ A;  4LSL A;  2WTU A;  1VRT A;  1BI4 B;  4FJ5 A;  1S1W A;  4FYD A;  3LAK A;  5AZJ B;  3BEX A;  3PSI A;  3LAN A;  4EZ6 A;  3HO1 A;  4LFB K;  4F3O A;  1C1C A;  1GOB A;  3KIO A;  5AQJ A;  4DTP A;  1KLN A;  5AQO A;  3VQB A;  3KJV A;  3H1V X;  4WYB A;  4DTN A;  4DU3 A;  4JKD A;  4JHD B;  4LSN A;  3O3F A;  1HNX K;  2EHG A;  2E2P A;  4IDH A;  3DXK A;  1QQO A;  2D0C A;  2HHH K;  3FZF A;  3CXC M;  3MED A;  2HHX A;  1JCF A;  2VYP A;  4FPB A;  5HRN A;  3VOV A;  4IOA L;  3V9U A;  3ZX0 A;  3EZ5 A;  3CCJ N;  3SAF A;  3PIO L;  4FVU A;  2Q0R A;  1S6Q A;  5HLF A;  3I55 N;  4DR6 K;  1Q81 O;  4Y1D A;  1HR0 K;  3DJC A;  4JKG B;  1L3V A;  4KH5 A;  4BG8 A;  3ENB A;  1S3X A;  1NNE A;  1TL1 A;  2FC0 A;  5E84 A;  1KTQ A;  1BU6 O;  1HYV A;  3HOT A;  2BE2 A;  1XI1 A;  5FRO A;  3H45 C;  3VEW A;  3A2F A;  4F3T A;  4R79 A;  3KTQ A;  3PV8 A;  3ZLJ A;  1QHA A;  1S1T A;  1RBV A;  2HBL A;  2KZZ A;  1WLJ A;  4DTM A;  4FJL A;  4GY2 B;  3CM6 A;  1QE1 A;  4AHT A;  2G8F A;  1QHT A;  4BR5 A;  3WEE A;  3QIO A;  3I0S A;  3SBG A;  3PX0 A;  3HL8 A;  1QVG M;  5H1S Q;  3LL3 A;  1IBL K;  1S6P A;  4C8N A;  3ITH A;  4H0Y B;  3E1Y A;  4OGE A;  2HF4 A;  5K14 A;  2BAN A;  3KK2 A;  4KFB A;  2ZQB A;  3L2U A;  1NKC A;  1T03 A;  3N4P A;  2P9S A;  4ILH A;  4BRO A;  4DFK A;  1VSF A;  1HNI A;  4FL9 A;  4DSJ A;  4FZY A;  4BR4 A;  5HOO A;  5IWA K;  4CJ7 A;  3CHW A;  5A2Q O;  1ZBS A;  4B8A B;  3V9S A;  2P1J A;  3OA9 A;  3OVN A;  4IJA A;  3OW2 M;  1KVA A;  1LV5 A;  1YTU A;  5AQI A;  1L3S A;  3U3G A;  3WXL A;  4IO9 L;  4CF9 A;  4B1U B;  2HVI A;  4IOC L;  3BZC A;  2AA4 A;  2HHV A;  1HYZ A;  3HXM A;  4K41 A;  4GV3 A;  4A59 A;  4CJK A;  4CF8 A;  3THX B;  3VQD A;  1XC3 A;  4IOX A;  3TSU A;  1DEJ A;  3WNE A;  1VQ6 N;  3VN5 A;  1IBM K;  4FM0 A;  1Q82 O;  1FJG K;  1RGI A;  4CF0 A;  5HBM A;  3G25 A;  5LJV A;  2ASM A;  1L3T A;  1VSM A;  3LP2 A;  2ZWH A;  4H03 B;  3T1A A;  3UKR B;  1Y97 A;  4DV0 K;  4KB0 A;  1TKT A;  4LH5 A;  3MX2 A;  4J2A A;  2NUB A;  3CQX A;  3GDQ A;  4BY9 C;  3O6W A;  4DQS A;  1RT5 A;  2D0B A;  2PYL A;  1OH5 A;  4CEE A;  4ZTJ A;  4JI1 K;  5BPM A;  3D2F A;  2OCE A;  1J53 A;  5BN8 A;  3L6Q A;  3EL2 A;  4IJN A;  4CZF A;  3PLA A;  1UAX A;  4HUG A;  3JYT A;  4PL8 A;  2E1Z A;  4NO7 A;  2XY5 A;  3KD1 E;  3CM5 A;  3IFR A;  3SUO A;  5DM7 L;  4H4O A;  1UWB A;  2GX9 A;  4LC9 B;  4BRL A;  3MEG A;  2P9L B;  4FJ7 A;  1LWC A;  2IIR A;  2A1R A;  2RE2 A;  3CQY A;  4WFN L;  1VRU A;  4M41 A;  4BRH A;  4DV3 K;  2QI2 A;  3G10 A;  3L8B A;  4C8K A;  1L5U A;  4CHO A;  3V9W A;  3THY B;  1YAG A;  3THV A;  4J2D A;  2FSN A;  3CCQ N;  1RTD A;  1BIZ A;  3JAM O;  3T19 A;  2QKK A;  1J54 A;  4MFB A;  4KI4 A;  3OYN A;  1D8Y A;  4DSK A;  4BRK A;  3ATU A;  3V4I A;  5GIP A;  4B3O A;  2NRZ A;  1I3A A;  1NGD A;  4HWI A;  2UUA K;  3QIC A;  2Z1G A;  4CHY A;  4KAZ A;  4FWP A;  4FWL A;  3B6O A;  3CFR A;  4BRD A;  3K58 A;  5AQY A;  2HF3 A;  2CGK A;  5AFU A;  2IAJ A;  3C6T A;  3CCV N;  3DXM B;  4NCG A;  3S3N A;  2GEL A;  3QBX A;  3TTC A;  3HBT A;  1XC9 A;  4RW6 A;  3VA3 A;  4Z4F A;  4DLE A;  1M1K O;  2Q36 A;  2YHW A;  4BC5 A;  4CE9 A;  2DFF A;  4CJ3 A;  1GLJ O;  1I39 A;  3U9D A;  1DKG D;  3FGU A;  4WCE L;  3RRH A;  2VG6 A;  4OO1 J;  4CJP A;  4CHQ A;  4KHQ A;  3FFK B;  4BR7 A;  3EE8 A;  5FDL A;  3L3V A;  3CD6 N;  2Q31 A;  1SKR A;  3QFP A;  4QOZ B;  1T8E A;  2QW9 A;  1L3U A;  3KLH A;  1XUP O;  2NLX A;  3CJB A;  4H8K A;  1NK4 A;  4HUE A;  3VQ4 A;  3ZYY X;  4CGI A;  1FK9 A;  1X1P A;  1N5Y A;  1RDC A;  2YI1 A;  2O8F A;  2GV9 A;  2F8S A;  4B9S A;  1ZBL A;  1NK9 A;  1KLM A;  3LDN A;  1T05 A;  3J80 O;  1WSE A;  1VQL N;  4O44 A;  4U67 L;  3V9Z A;  4XEI A;  1VQ7 N;  3O5B A;  4NXN K;  3DRP A;  3O9U A;  1P90 A;  1NM1 A;  2Y1I A;  3AO3 A;  1RDU A;  1KQS M;  4I7F A;  3D0P A;  1KVB A;  1IJJ A;  2FF3 B;  3HP6 A;  3SZ2 A;  3IDH A;  1TVR A;  3SUQ A;  1KSP A;  4EHU A;  2PZS A;  3R9P A;  3DMJ A;  2ZGY A;  1BGX T;  4H0X B;  1SS6 A;  3OYJ A;  3M3Z A;  1TK5 A;  3M1F A;  4X62 K;  1QSL A;  3QB0 A;  1WB9 A;  1JXB A;  3OYK A;  1NLV A;  1TV6 A;  4GMJ B;  4NLB A;  3E9P A;  3RR8 A;  4KV8 A;  4DG1 A;  1YHQ N;  1IKY A;  4KH6 A;  3RSE B;  4BE2 A;  3TR8 A;  4FPA A;  4JI0 K;  4JKH A;  3KZB A;  2E5L K;  4F2S A;  4QS9 A;  4JI2 K;  3LP0 A;  4BRI A;  1S5J A;  1WN7 A;  4O0J A;  3W3D A;  4BR0 A;  2G8U A;  1FW6 A;  4BDP A;  4ISG A;  3S3M A;  4FWO A;  3OBW A;  2V51 B;  4DR2 K;  3LWM A;  1QZ6 A;  1WSJ A;  1K9M O;  2P9K A;  4CHP A;  4FOE A;  3L2W A;  1N33 K;  1EQY A;  1HYS A;  5M1F A;  1YVU A;  4WFA L;  3CMA N;  3IG1 A;  4OKJ A;  5JLH A;  1VSH A;  4CEF A;  4NCA A;  3DLG A;  1ZBU A;  4CFA A;  3B8A X;  2VWJ A;  1ZXO A;  2HNY A;  3O9S A;  4IFY A;  4DS4 A;  5E26 A;  2HW3 A;  1E4F T;  4BG9 A;  4JK7 A;  4B1W B;  4DU4 A;  5AQT A;  3KKR A;  5KPR A;  4MO5 A;  3OS2 A;  3MEC A;  2KFZ A;  4JEP A;  1YF5 L;  3A5M C;  4Z94 A;  3J8A A;  4FLU A;  2VQF K;  2UU9 K;  4OPJ A;  4CJU A;  3TAE A;  3H1Q A;  3O3H A;  1IV0 A;  1G99 A;  4MDA A;  3QEV A;  3SUP A;  3QET A;  2NZT A;  1NOY A;  1C0U A;  4NXM K;  4MQ3 A;  1HPZ A;  3TTF A;  5AQW A;  4FWM A;  5C12 A;  3JSM A;  3QEI A;  1W2B M;  1JJ2 M;  3SMS A;  4JI8 K;  3AO2 A;  1B9F A;  3OYH A;  1JCE A;  3VER A;  3QEX A;  3H3O B;  1MWK A;  3HYF A;  4E89 A;  1EWR A;  1KD1 O;  2OPP A;  3WNF A;  5GAD P;  1RT2 A;  4PY5 A;  4R5P A;  3MCA B;  2YJF A;  1NK5 A;  2ZJP L;  2NRV A;  1TK8 A;  4KI6 A;  3E9O A;  2GEM A;  4FWQ A;  3SK3 A;  4DQR A;  5AR0 A;  2OZM A;  3KWI A;  5JVH L;  4KHP K;  4CEA A;  4DTX A;  1YIJ N;  4ICL A;  1ZYQ A;  2YNF A;  4DV7 K;  3UKU A;  1XQS C;  2Q97 A;  3CG7 A;  4CJS A;  1S9E A;  4ILG B;  1U04 A;  2VG7 A;  4CVN E;  5DMR A;  3U3Y A;  2HHQ A;  2Z1H A;  1UA1 A;  4CGJ A;  2GUI A;  2YX6 A;  1QQN A;  3ZSO A;  4CGH A;  3WNH A;  4BQZ A;  4EP5 A;  3MN7 A;  2JGU A;  2LSN A;  2NRH A;  3P38 A;  1Q9Y A;  4IXC A;  5FRN A;  3ZEU B;  2O8C B;  2IOC A;  4IFE A;  2D0A A;  4BWJ A;  2KZM A;  1WAJ A;  1UOC A;  4NYN A;  4C1N K;  3THW A;  3CCU N;  3KD5 E;  1WSF A;  4BRQ A;  3S9H A;  2V7Z A;  4NYF A;  2D5R A;  1KXP A;  2Z1I A;  1KAZ A;  1NGJ A;  3QEW A;  1JXE A;  4DSF A;  4BRP A;  2JWK A;  3VA0 A;  3QES A;  2P9N A;  4YFU A;  1R0A A;  4IG3 A;  4XH5 A;  2KHO A;  1ASV A;  1JLA A;  1O1W A;  4CBW A;  1TYQ B;  2HVH A;  4PHT X;  2A40 A;  2ZJQ L;  2ATQ A;  3CJ7 A;  4J2E A;  3AA4 A;  5AQL A;  4B8C A;  3HP9 A;  5BRE A;  3DI6 A;  1BG3 A;  4BGB A;  5CYQ A;  4N56 A;  3H08 A;  2HST A;  3HK2 A;  3CJ9 A;  4A5A A;  3SNN A;  1TAQ A;  3VQC A;  5LMU K;  1BUP A;  3SQ4 A;  1RT6 A;  2A41 A;  3VF4 A;  4EZ9 A;  2Q2R A;  2XY8 A;  4JLH A;  2QM1 A;  4C8L A;  5C24 A;  2R7Y A;  2CH6 A;  2D0O A;  4KTZ A;  2O8E B;  2P9I A;  2O8B B;  4YDU A;  3SQ2 A;  2E20 A;  4CZH A;  3G4S N;  5AQM A;  4K0K K;  1X9J A;  1U48 A;  1QTM A;  3VQ9 A;  4DV5 K;  1MA9 B;  2QWR A;  4JV5 K;  5KQD A;  3QML A;  4FLZ A;  4M3U A;  3SJH A;  1C1B A;  4PL7 A;  4DU1 A;  1BHL A;  4JS5 A;  3C65 A;  2NRR A;  4FM1 A;  4C1N I;  5BN9 A;  4YNQ A;  4OPA A;  1RBS A;  4E0D A;  3MK6 A;  3I56 N;  4ZHR A;  3NAE A;  2FBV A;  3RMB A;  3L4I A;  5KTQ A;  4B3M K;  4I9L A;  4DB3 A;  1NGB A;  3OYF A;  1ATS A;  1NWK A;  3C6U A;  3CFP A;  5BPL A;  4LF4 K;  4O55 A;  2HHT A;  3LDL A;  2WC9 A;  2D1K A;  4CGD A;  3K5M A;  1Z25 A;  1C6V A;  1VQK N;  1KCF A;  3PSF A;  1IO2 A;  4BQL A;  3DRS A;  1XNQ K;  5AQX A;  1ASW A;  4H0T B;  4CJR A;  4DKW A;  3AA3 A;  2ETJ A;  1HLU A;  5HRR A;  1NK7 A;  3C6H A;  4LFA K;  1LOT B;  1QQM A;  3U4L A;  1OH8 A;  3DOK A;  3WQU A;  3SI6 A;  3R3L A;  5M1N A;  4B3S K;  1T7P A;  5FRM A;  4JKB A;  3SV3 A;  4U7B A;  3CME N;  4E7K A;  4IEI A;  5BRD A;  4ID1 A;  3H6E A;  2UYT A;  4OPH A;  1CZA N;  5ELZ A;  1NMN A;  3AO5 A;  3NHG A;  1RDB A;  4E19 A;  1XWL A;  3MCP A;  4FWS A;  1LWF A;  1YJN N;  3RWU A;  5TKW A;  4ID5 A;  4B1V A;  1RDA A;  4FCY A;  3BUZ B;  4ZTF A;  3AVB A;  4YDU C;  3L2V A;  3C7N B;  1NJX A;  2HHS A;  1HQE A;  4CCH A;  3CET A;  2VGN A;  1GLE G;  4ELV A;  4JS4 A;  5AQG A;  1F21 A;  5ADX H;  3VTI A;  3HI0 A;  3SJJ A;  2PFU A;  4B9L A;  4B1Y B;  4FJM A;  1HMV A;  3VQ8 A;  3OYB A;  4DR1 K;  3MWT A;  5JIC A;  4JYA K;  4JD2 B;  3QO9 A;  4N76 A;  3AAP A;  4M63 C;  4G1Q A;  1MWM A;  2IGI A;  1EWQ A;  5EOY A;  1EKE A;  4HCC A;  3MXM A;  5JS1 A;  1W97 L;  1M90 O;  4CBU A;  4DFM A;  1RT3 A;  2P9U B;  3T1H K;  4QS7 A;  1JL1 A;  3H46 O;  2YKN A;  4H0V B;  4PQU A;  5JS2 A;  3GOI A;  3MWP A;  2QA4 N;  4YOU A;  3TAR A;  4HUF A;  3I8B A;  4A5B A;  3G6E N;  5AZI A;  4FLT A;  2P9P B;  4FSV A;  4AHC A;  3ULE A;  1U45 A;  3NGI A;  3AVM A;  4H5V A;  2GUP A;  3SPY A;  1NMD A;  4LF5 K;  2FSK A;  3D45 A;  3VF6 A;  4FWR A;  2E6M A;  1GLD G;  3FZK A;  5KI6 A;  4A2B A;  4Y0W A;  5C15 A;  2O8D A;  1T6C A;  3MXJ A;  1ZBF A;  3D2E A;  1K73 O;  2P51 A;  3F9M A;  4CEB A;  4DQP A;  1B9D A;  3CJA A;  3LP3 A;  4BVO A;  2X74 A;  3SMP A;  3AGK A;  5M1Q A;  4M3W A;  4JRP A;  5BRH A;  4CF1 A;  4LH4 A;  3MXI A;  3U8X A;  4RW9 A;  3TAM A;  4B9Q A;  2GTD A;  3R1X A;  4ISF A;  4GKK K;  3QBW A;  2RF2 A;  2UXB K;  4CIF A;  2DFH A;  3I8D A;  5CR4 A;  4UQG A;  3K0S A;  5C0Y A;  1B92 A;  2KTQ A;  2RN2 A;  3TAF A;  3VES A;  2IVP A;  2FBT A;  3AVI A;  3I33 A;  3HOS A;  4DSI A;  1DLO A;  1T44 A;  1TYQ A;  2B6A A;  4DMN A;  4CBX A;  3KWG A;  4IDK A;  1HNZ K;  4E7I A;  3BF3 A;  1K8K B;  3AVC A;  3O4W A;  4AHU A;  3ATV A;  2G8K A;  4KRE A;  3V1R A;  2A42 A; 
#chains in the Genus database with same CATH homology
 2G8V A;  3K2P A;  3HVT A;  3LDS A;  4KHY A;  4OKK A;  4BE1 A;  1U49 A;  1BGX T;  3CYM A;  2DTU A;  3OYJ A;  1TK5 A;  1D9D A;  1ZBI A;  3V81 A;  1QSL A;  1JXB A;  1WSG A;  3OYK A;  2YV0 X;  1TV6 A;  3DRR A;  4GMJ B;  3RMA A;  3RR8 A;  4FJM A;  4KV8 A;  4DG1 A;  1JKH A;  1IKY A;  4FM2 A;  1JLG A;  3ZSR A;  2Q3S A;  4CHZ A;  4M3Z A;  3K5L A;  1FKP A;  4DS5 A;  1JL2 A;  4BE2 A;  3M8Q A;  3TR8 A;  1SV5 A;  4F2S A;  1Q9X A;  3HPH A;  3KK3 A;  3DOL A;  3LP0 A;  1YTA A;  3ZSY A;  1C0T A;  1S5J A;  1WN7 A;  4O0J A;  3VQ6 A;  3K5N A;  2G8U A;  4BDP A;  3C94 A;  3L3U A;  4CJE A;  3KLF A;  4CFC A;  3S3M A;  2XO7 A;  1NK8 A;  4F2R A;  1U47 A;  3OYM A;  3LWM A;  5DK5 A;  3G0Z A;  3DLR A;  3BDP A;  1S1X A;  1WSJ A;  5J2P A;  3TAQ A;  4CHP A;  3OYG A;  3L2W A;  2WON A;  3ZSQ A;  1HYS A;  4DTR A;  1YVU A;  1K6Y A;  1JLF A;  1WSI A;  1SKW A;  1NJW A;  3ZT1 A;  4Z0U A;  3IG1 A;  4OKJ A;  4B9T A;  2F8T A;  1VSH A;  4CEF A;  3HM9 A;  4OVL A;  2X78 A;  4GW6 A;  4Q0B A;  4F8R A;  1HNV A;  3DLG A;  5EU7 A;  4NCA A;  1ZBU A;  1TAU A;  4C8M A;  3FFI A;  4CFA A;  2VWJ A;  1ZBH A;  4Q5V A;  1C0M A;  4FJN A;  1DTT A;  1RTJ A;  3LAL A;  2HNY A;  4OJR A;  4Z4C A;  1NJZ A;  4IFY A;  4DS4 A;  2HW3 A;  4B9N A;  1IKV A;  1D9F A;  1RDD A;  4PWD A;  3RMC A;  2VWK A;  4DU4 A;  4BDZ A;  3RMD A;  1WAF A;  4O0I A;  3KKR A;  1IKW A;  3ASM A;  3VQA A;  4RW4 A;  3MEC A;  3OS2 A;  2G8H A;  1BI4 A;  1D5A A;  1LAW A;  2YNG A;  3NF6 A;  2KFZ A;  2IC3 A;  3I0R A;  4FLU A;  4OPJ A;  5CZ1 A;  1IH7 A;  4CJU A;  3TAE A;  3LWL A;  3O3H A;  2YHB A;  3SUP A;  3QEV A;  3QET A;  4Z4I A;  3RR7 A;  2B4J A;  3V1Q A;  1NOY A;  4FW1 A;  4QAG A;  3ZT4 A;  1C0U A;  4MQ3 A;  4OGC A;  4N47 A;  1HJR A;  1HPZ A;  2O4G A;  4E1N A;  4PUO A;  4FJK A;  1WNS A;  3OYI A;  3JSM A;  4CED A;  3M8R A;  3K57 A;  3QEI A;  3HJF A;  3OYD A;  1YT3 A;  3AO2 A;  1B9F A;  3OYH A;  3BGR A;  3VQ7 A;  5I42 A;  1G15 A;  3NF8 A;  3QEX A;  3SCX A;  2VG5 A;  3HYF A;  4E89 A;  4E3S A;  3TAB A;  2W42 A;  1JLB A;  2OPP A;  3WNF A;  1RT2 A;  4CF2 A;  1GOC A;  3UIQ A;  4M3Y A;  4PY5 A;  4I9Q A;  1TKX A;  4R5P A;  1BIS A;  4N41 A;  4CJQ A;  3IRX A;  3LZI A;  3AVF A;  2KQ2 A;  1NK5 A;  1TK8 A;  1TKD A;  4KI6 A;  2I5J A;  3QIP A;  4EP4 A;  1VSL A;  1BIU A;  1CXU A;  2FBY A;  4DQR A;  4DQQ A;  4CJT A;  4M3T A;  3SUN A;  1NK0 A;  2OZM A;  2WOM A;  4CJF A;  1RTI A;  4CEA A;  4DF4 A;  2QXF A;  2P5G A;  3RTV A;  1CLQ A;  1ASU A;  2HHW A;  4DTX A;  3DLH A;  3ALY A;  1VSK A;  4ICL A;  2YNF A;  3AVA A;  3ZCM A;  4CJL A;  3MAQ A;  1ZYQ A;  4CEC A;  4W5R A;  2KW4 A;  4LSL A;  3CG7 A;  1VRT A;  1BI4 B;  4CJS A;  4FJ5 A;  1S1W A;  4FYD A;  3LAK A;  1S9E A;  1U04 A;  2X6S A;  3OS1 A;  2VG7 A;  3LAN A;  1QSS A;  3PX6 A;  3OJU A;  4EZ6 A;  3HO1 A;  4DF8 A;  1C1C A;  1GOB A;  3V9X A;  3KIO A;  5DMR A;  3AV9 A;  4DTP A;  3U3Y A;  3QIN A;  2Z1H A;  3ISN C;  4OPK A;  1UA1 A;  4CGJ A;  2GUI A;  2A1S A;  4IBN A;  5T7B A;  1CXQ A;  4WE1 A;  3VQB A;  5SZT A;  3KJV A;  2OPS A;  4DTO A;  3ZSO A;  2F96 A;  4CGH A;  4DTN A;  2DFE A;  3WNH A;  5KRS A;  4DU3 A;  2IS3 A;  4LSN A;  4EP5 A;  3EY1 A;  3TAG A;  3O3F A;  1VSE A;  1BCM A;  2EHG A;  3TWH A;  2JGU A;  3LPT A;  2LSN A;  4KTQ A;  3VQE A;  2D0C A;  4FZZ A;  1Q9Y A;  1CZB A;  3MED A;  4PA1 A;  2HHX A;  1RT7 A;  5FRN A;  5HRN A;  3MEE A;  2IOC A;  3V9U A;  2D0A A;  1J9A A;  4BWJ A;  2KZM A;  1WAJ A;  1UOC A;  4NYN A;  2ZD1 A;  3EZ5 A;  3L2R A;  4W5Q A;  2HNZ A;  3KD5 E;  5E41 A;  1SL1 A;  4B9U A;  3PO4 A;  1S6Q A;  1WSF A;  3AVN A;  1HRH A;  3M8P A;  1X9S A;  3S9H A;  5HRS A;  5HLF A;  1RBR A;  3IS9 A;  4CJV A;  3OYE A;  1XHZ A;  4NYF A;  4AHV A;  1VSI A;  2D5R A;  4Y1D A;  2Z1I A;  4K8Z A;  4KHU A;  2BGG A;  3QEW A;  3AO4 A;  2RKI A;  5HRP A;  5J2N A;  1JXE A;  1RNH A;  1SL2 A;  1L3V A;  4DSF A;  1QSY A;  3PO5 A;  4FJG A;  1REV A;  4FJX A;  3VA0 A;  3QES A;  1TL1 A;  4YFU A;  2FC0 A;  1NJY A;  4DSL A;  1R0A A;  1KTQ A;  3O3G A;  4DSE A;  4IG3 A;  1HYV A;  3K5O A;  3PX4 A;  1ASV A;  2BE2 A;  1XI1 A;  1JLA A;  5FRO A;  1O1W A;  2HVH A;  2OYQ A;  1TKZ A;  3A2F A;  4F3T A;  1LW2 A;  5CYM A;  2ATQ A;  3KTQ A;  4J2E A;  3PV8 A;  5KGW A;  2HMI A;  2AJQ A;  1DTQ A;  1S1T A;  3AA4 A;  1RBV A;  4QCL A;  4B8C A;  3HP9 A;  4FW2 A;  1LWE A;  3DI6 A;  2KZZ A;  1RIL A;  1WLJ A;  4DTM A;  4FJL A;  5CYQ A;  4FLV A;  3CFO A;  1J5O A;  4N56 A;  3H08 A;  4B9M A;  4KTW A;  4KHW A;  3NH1 A;  3HK2 A;  3QEP A;  3SNN A;  3CM6 A;  1QE1 A;  3DLB A;  3TI0 A;  4AHT A;  1TAQ A;  2OPR A;  3VQC A;  4IG0 A;  3SQ4 A;  1QHT A;  2G8F A;  2YHA A;  3AA5 X;  1RT6 A;  2OZS A;  3QNO A;  2OA8 A;  4FZX C;  3QIO A;  3I0S A;  4O4G A;  4AHR A;  4W5T A;  4EZ9 A;  3PX0 A;  3HL8 A;  2XY8 A;  4JLH A;  1S6P A;  4C8N A;  3ITH A;  2XY7 A;  4C8L A;  5C24 A;  2QK9 A;  3ZT3 A;  2R7Y A;  2BDP A;  1NK6 A;  4F3O A;  4KHS A;  3NDK A;  4OGE A;  3KD1 E;  3KLE A;  4HVJ A;  3O4N A;  5K14 A;  5C42 A;  2BAN A;  1JLQ A;  4CEQ A;  3KK2 A;  4FLY A;  4KB1 A;  4HHT A;  4Z4H A;  4KFB A;  5SWM A;  4KTZ A;  4BDY A;  2ZQB A;  3T3F A;  2QKB A;  3OS0 A;  1TL3 A;  2X6N A;  3L2U A;  4Y1C A;  3AVK A;  1T03 A;  1NKC A;  1KLN A;  4DFK A;  4KRF A;  3OYL A;  3SQ2 A;  2HND A;  2YKM A;  1VSF A;  1HNI A;  4DSJ A;  4Z4G A;  4FZY A;  3NCI A;  4FVM A;  1U48 A;  4E1M A;  5CZ2 A;  4E7H A;  1QTM A;  4CJW A;  3VQ9 A;  2Y1J A;  1A5V A;  4FLZ A;  4CK3 A;  1SKS A;  4M42 A;  4M3U A;  4B8A B;  3AVJ A;  1C1B A;  1KFS A;  3V9S A;  4AIL C;  2P1J A;  3KLI A;  4DU1 A;  1BHL A;  4Z4E A;  4TSX A;  4JS5 A;  3OVN A;  3ZT2 A;  4I2Q A;  3NFA A;  4BE0 A;  3V6D A;  4FM1 A;  4FLX A;  2HHU A;  4YNQ A;  3QER A;  3E01 A;  1KVA A;  1W9H A;  4CJ4 A;  4M45 A;  1RBS A;  4E0D A;  4ZHR A;  3NAE A;  2FBV A;  1LV5 A;  1YTU A;  2PYJ A;  4FXD A;  2E4L A;  4DLG A;  4AHS A;  4HCB A;  3VQQ A;  1W0H A;  3RMB A;  4FK2 A;  4CEZ A;  5KTQ A;  3SQ0 A;  1L3S A;  3AA2 A;  3U3G A;  3QNN A;  4DFP A;  4I9L A;  3NBP A;  4CF9 A;  3OYF A;  1TGO A;  4FJJ A;  2HVI A;  1A5W A;  1UA0 A;  1BQM A;  5KGX A;  2HHV A;  3NF7 A;  1HYZ A;  3C6U A;  3HXM A;  3CFP A;  3HT3 A;  4CJK A;  4O55 A;  3ZT0 A;  4CF8 A;  3KKS A;  3VQD A;  2HHT A;  1ITG A;  4CFB A;  3WNE A;  4CGD A;  3O4Q A;  3VN5 A;  4AH9 A;  3K5M A;  4FM0 A;  5J2Q A;  3P83 D;  1BQN A;  1Z25 A;  4CF0 A;  5HBM A;  3SPZ A;  3V1O A;  1L3T A;  1VSM A;  1C6V A;  2O4I A;  4GVM A;  3LP2 A;  1KCF A;  4N5S A;  3T1A A;  1IO2 A;  1RT4 A;  3DRS A;  3AVL A;  3AVH A;  4BAC A;  1ASW A;  4CJR A;  1Y97 A;  4KB0 A;  4DTJ A;  1TKT A;  3AA3 A;  2ETJ A;  3L2Q A;  5HRR A;  4LH5 A;  4J2A A;  2NUB A;  1NK7 A;  4FJI A;  5I3U A;  4CJ5 A;  4DQS A;  3TAP A;  1RT5 A;  3DOK A;  3SQ1 A;  2D0B A;  2PYL A;  3SI6 A;  5KRT A;  1RBT A;  1XHX A;  4CEE A;  4ZTJ A;  1T7P A;  5FRM A;  3SV3 A;  4CER A;  2P5O A;  4CHN A;  4M3R A;  4E7K A;  1Z26 A;  3QLH A;  3DM2 A;  4ID1 A;  3AVG A;  1J53 A;  4CK2 A;  4E7L A;  4C8O A;  4LD0 A;  4KO0 A;  2YNI A;  3ZSZ A;  4W5O A;  4FJ8 A;  3CQ8 A;  1UAX A;  4NCB A;  1S9G A;  4RG8 A;  4XIU A;  4HUG A;  3AO5 A;  4FJH A;  3NHG A;  1RDB A;  3JYT A;  4RW8 A;  4E19 A;  1XWL A;  4DQI A;  5D3G A;  3DLE A;  1LWF A;  4K8X A;  3DLK A;  3NGY A;  4OKE A;  3NGZ A;  3RWU A;  2HB5 A;  1QQC A;  4L8R B;  3WNG A;  4FJ9 A;  2XY5 A;  4ID5 A;  2IDO A;  1BCO A;  1HQU A;  3CM5 A;  3F9K A;  1RDA A;  4FCY A;  4FLW A;  4DTU A;  4ZTF A;  4FK0 A;  3AVB A;  3L2V A;  1NJX A;  2HHS A;  3SUO A;  1HQE A;  4H4O A;  3DYA A;  4IFV A;  1IKX A;  1FKO A;  1UWB A;  4CCH A;  4M3X A;  3SYZ A;  3MEG A;  3LP1 A;  4CEO A;  4FJ7 A;  1LWC A;  4DTS A;  1X9W A;  2A1R A;  3NH0 A;  3SV4 A;  4ELV A;  1WSH A;  3KK1 A;  4JS4 A;  1F21 A;  1VRU A;  4JRQ A;  3C95 A;  4KHN A;  1S1V A;  3SJJ A;  4M41 A;  3OJS A;  4B9L A;  3L8B A;  3G10 A;  4CES A;  1HMV A;  3VQ8 A;  3OYB A;  4CGG A;  1NKB A;  1KRP A;  4C8K A;  1RBU A;  4CHO A;  3V9W A;  1L5U A;  2HHQ A;  3QO9 A;  3NF9 A;  5C25 A;  3THV A;  4F4K A;  4IKF A;  4J2D A;  4N76 A;  1CZ9 A;  1BIZ A;  1RTD A;  4G1Q A;  3T19 A;  3LAM A;  3EYZ A;  2QKK A;  1J54 A;  3HVR A;  2IGI A;  4MFB A;  4KI4 A;  3OYN A;  1D8Y A;  4DSK A;  1EKE A;  3V4I A;  4HCC A;  1RTH A;  3ZSX A;  1SUQ A;  3MXM A;  2EX3 A;  4B3O A;  5JS1 A;  1LW0 A;  1I3A A;  1NKE A;  1S1U A;  3OYA A;  4DFM A;  1RT3 A;  1N6Q A;  2ITG A;  1QS4 A;  1RT1 A;  1JL1 A;  2Z1G A;  2YKN A;  4CHY A;  4KAZ A;  4PQU A;  5JS2 A;  2YNH A;  2Z1J A;  4ELT A;  3B6O A;  1A5X A;  3CFR A;  3TAR A;  3K58 A;  3NE6 A;  4CFD A;  4HUF A;  3B6P A;  4DWI A;  1Q8I A;  4B08 A;  2IAJ A;  3C6T A;  3OYC A;  3S3N A;  4NCG A;  4FLT A;  1XC9 A;  4RW6 A;  3VA3 A;  4OLA A;  4AHC A;  4Z4F A;  1U45 A;  3PY8 A;  4DLE A;  4I2P A;  1VSD A;  1MU2 A;  2KFN A;  4CE9 A;  3NGI A;  3AVM A;  2DFF A;  4CJ3 A;  1VSJ A;  4CK1 A;  1LAV A;  2RPI A;  2ZE2 A;  3SPY A;  1I39 A;  4CGF A;  3NH2 A;  2XRI A;  3D45 A;  3U6F A;  3RRH A;  2E6M A;  2GBZ A;  5KI6 A;  2VG6 A;  4LY7 A;  4CJP A;  4CHQ A;  4KHQ A;  2B5J A;  2JLE A;  5CY4 A;  1EET A;  3MXJ A;  5FDL A;  3L3V A;  1ZBF A;  1SKR A;  1U4B A;  3HST B;  2P51 A;  3RRG A;  3ZSW A;  4CEB A;  5J1E A;  1T8E A;  4DQP A;  4OLB A;  1B9D A;  1L3U A;  4QOZ B;  3KLH A;  3IAY A;  3LPU A;  3LP3 A;  1TK0 A;  1BL3 A;  1JLE A;  2X74 A;  4H8K A;  3HPO A;  2PY5 A;  3KLG A;  4M3W A;  1IG9 A;  1NK4 A;  1RCH A;  4RW7 A;  3P1G A;  4JRP A;  4HUE A;  1EP4 A;  2OPQ A;  3VQ4 A;  3VQP A;  4CIE A;  4H4M A;  1SL0 A;  4CGI A;  4CF1 A;  1FK9 A;  1X1P A;  5HRO A;  4LH4 A;  3MXI A;  1KFD A;  1EX4 A;  1N5Y A;  1RDC A;  4RW9 A;  3TAM A;  4O5B A;  2GV9 A;  2F8S A;  4KKO A;  1ZBL A;  4B9S A;  3ZSV A;  3LZJ A;  2RF2 A;  1KLM A;  3M8S A;  1NK9 A;  4CIF A;  3AO1 A;  3P5J A;  2DFH A;  3I8D A;  1C1A A;  4UQG A;  2G8I A;  2E6L A;  1T05 A;  4J2B A;  1B92 A;  4DFJ A;  3TAN A;  3F73 A;  4KPY A;  4W5N A;  3PUF A;  1WSE A;  4ELU A;  2KTQ A;  2RN2 A;  3TAF A;  4O44 A;  4E7J A;  2XHB A;  2FBT A;  3VQ5 A;  3AVI A;  4BWM A;  3OY9 A;  3V9Z A;  4DSI A;  1DLO A;  3HPG A;  5HP1 A;  1FXX A;  3S3O A;  4B9V A;  3DRP A;  2B6A A;  2FBX A;  4DMN A;  1EXQ A;  3K59 A;  1NOZ A;  2Y1I A;  3AO3 A;  4HTU A;  1GOA A;  1X9M A;  4IDK A;  4I7F A;  3D0P A;  4E7I A;  1KVB A;  2XY6 A;  5J2M A;  3AVC A;  4AHU A;  3HP6 A;  4CIG A;  3SZ2 A;  2G8K A;  1TVR A;  1KVC A;  3SUQ A;  1VK0 A;  1JLC A;  1KSP A;  4FK4 A;  2PZS A;  2G8W A;  3ULD A;  4KRE A;  2DY4 A;  3DMJ A;  3V1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...