4CGJA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgjA00
3OYBA 4DFJA 4F3OA 3T1AA 4ICLA 2KZMA 1HYSA 4DFKA 3VQ7A 4IBNA 3RTVA 4CF9A 4FCYA 3THVA 1U4BA 2OPQA 3NFAA 1SUQA 3P5JA 3L3UA 3HT3A 4RW6A 4BE1A 1NKBA 3KLHA 4CK2A 3CQ8A 4L8RB 3E01A 3B6PA 1DTTA 4HVJA 2HHSA 3HJFA 3CM5A 4CFCA 2QKKA 1RILA 1QQCA 1EXQA 1RT7A 4CF0A 2IOCA 4CJUA 1J53A 1X1PA 3CG7A 3O3FA 2YKMA 4J2AA 4CIGA 3O3HA 4FW1A 5FRMA 5E41A 5I42A 3SI6A 4ELTA 1SKWA 3AO4A 1WSGA 4KHSA 1Q8IA 3HXMA 1LAVA 3AVMA 3HPGA 3G10A 3MEEA 3ZT0A 3SJJA 1WSEA 3KKSA 4DSJA 1N5YA 4HCCA 3K5MA 4ID5A 2X74A 2EX3A 2E6LA 4Q5VA 4DS5A 2FBVA 4OGEA 3TAFA 2D5RA 1VRUA 1NK4A 4CJKA 2RPIA 2HHTA 1C1BA 4NCBA 4M3XA 3OJSA 1IO2A 1XC9A 1NJWA 1TGOA 1BL3A 5KTQA 2F8SA 1ZBFA 3K57A 5J1EA 4FLXA 4KB0A 3V9XA 4KHYA 4BDZA 4DTSA 5SZTA 4N76A 2O4IA 3K58A 4H4OA 1RDBA 2Q3SA 3WNFA 5CY4A 3OYEA 3OVNA 3DRRA 3AVCA 4M3TA 1RBUA 3CFOA 5DK5A 3OYGA 3LP2A 1YT3A 3LP0A 1TL1A 2YKNA 3K5OA 1RTDA 4C8LA 1JLBA 4CE9A 2YV0X 2VWKA 4CHYA 3RMBA 3L2QA 5J2PA 3L2WA 2Z1IA 4FVMA 4Y1CA 4OPJA 1SL1A 4LY7A 3SCXA 4B9UA 2HNYA 2P5GA 4FJGA 1BI4A 1QSYA 1B92A 1T7PA 4B3OA 3A2FA 4CEBA 4PY5A 1GOBA 3ZSOA 2F8TA 1X9MA 3KLEA 3KK3A 4KV8A 4N56A 3TR8A 3ZT2A 4DLGA 4KHWA 1RT3A 4O0IA 1JXBA 4FLYA 3LANA 2I5JA 1CZBA 4CFDA 4KKOA 3OS1A 4E19A 4B8CA 1XWLA 1ZBHA 5FDLA 4E89A 1XHZA 3PX0A 4I2QA 2HHXA 4CJFA 4DQIA 3V9UA 5J2MA 1C0TA 2ZD1A 1JLAA 2XY7A 1SL0A 1C0UA 1KLMA 1GOCA 4Y1DA 2B5JA 5JS2A 1BCMA 1VSJA 4ELUA 3V1OA 4HCBA 1L3UA 4AHSA 3PV8A 2VG6A 3AA4A 1W0HA 3EZ5A 4W5RA 4I2PA 4DU1A 1T05A 1UA1A 4MFBA 1IKYA 1WSJA 3HL8A 1NK6A 4DQPA 3ZSZA 1F21A 4Z4HA 3SUPA 2PYJA 3ZCMA 4NCGA 3WNHA 3HP6A 1FK9A 1LWFA 4HTUA 3SUOA 3OYHA 3HYFA 2ATQA 1LWCA 4BACA 2YNHA 2OYQA 1LW0A 4DTUA 1S1VA 4FJKA 3OYAA 4FLUA 3CYMA 1FKOA 1VSFA 2NUBA 1TAUA 2BANA 1TL3A 4TSXA 4E7KA 4FLWA 4DFPA 4O55A 2JLEA 1WSIA 1JXEA 2GUIA 2R7YA 4I9QA 2B4JA 4CEFA 3MXJA 3V9SA 2IDOA 3ZSXA 1C6VA 3LALA 1U48A 1B9DA 4M3UA 3OYKA 3IAYA 4FLZA 1BQNA 2IAJA 3M8PA 1TK5A 4FJJA 2PZSA 3T19A 3AVJA 3LWLA 3MXIA 3S3NA 4AHCA 2HW3A 1VK0A 5HRRA 5C42A 4BDYA 4QOZB 3VN5A 4ZTFA 3DRSA 4W5TA 3K5LA 2OPSA 3DYAA 4OGCA 4CEOA 3SNNA 3MXMA 1JL2A 4C8KA 4I9LA 1TKZA 1EX4A 2HNZA 3QEXA 5SWMA 3TAPA 3K2PA 5KGXA 4Z4IA 4EP4A 3QIPA 3NH1A 4CJ5A 1JLFA 4JRPA 3KK2A 4PA1A 3TAMA 4FLVA 1NJZA 5CYMA 4CHNA 3CM6A 1Y97A 1HYZA 1U47A 1HQUA 3V9WA 4CJ3A 4DTJA 5T7BA 3F73A 3HP9A 1MU2A 1U49A 1NJYA 4E3SA 4M3WA 3C6TA 1TK8A 4KI6A 3ZT1A 3NGZA 4DQQA 4H4MA 3RR8A 2YNIA 3OS2A 4FXDA 3NF7A 4J2DA 3HO1A 4C8OA 2KFNA 3AVBA 3OYNA 4ZHRA 2FBYA 2QXFA 3QIOA 1YVUA 3QNNA 3ITHA 4JLHA 4CGDA 4E1MA 3QNOA 2XY5A 3ZSVA 2P51A 3NH2A 3ULDA 4FJNA 1O1WA 2IGIA 3MECA 5K14A 3OY9A 4J2EA 4DTMA 4YFUA 5CZ2A 3NGIA 4DU4A 1QE1A 4I7FA 5DMRA 3OJUA 1S9GA 4B9NA 4FJ7A 4CGHA 1S1XA 4CFBA 4B9MA 1BCOA 1SV5A 1VSEA 3AVKA 3EYZA 1XI1A 2E6MA 1HRHA 2Y1IA 4O4GA 1KFDA 1S9EA 3AVIA 1TAQA 2P1JA 3VQBA 4OVLA 3NAEA 1X9SA 2G8FA 3DLBA 1RBRA 1WAJA 3LPUA 1JLCA 3L8BA 4FLTA 4CJQA 4O44A 4KO0A 4KTQA 4M45A 1TKDA 4M3RA 2OZSA 1UOCA 4LD0A 4CF1A 1KLNA 4PQUA 1RT1A 3P1GA 3WNGA 1JLEA 1LV5A 4AHTA 3HK2A 2KFZA 3O4NA 3OYDA 3HVTA 4DQSA 5J2NA 1Z25A 3LZJA 4C8NA 2DFEA 3V1QA 4E7HA 3I0RA 3AV9A 3IRXA 1CXUA 4RW9A 3IS9A 2A1SA 3HVRA 1U04A 1NK7A 4F4KA 1ZBUA 4CJVA 4DU3A 3K59A 4Z4GA 3VQCA 2D0CA 1RCHA 3O4QA 4NCAA 4OLBA 4RW4A 2Z1HA 1HNVA 3LP3A 2G8UA 2XHBA 3DLHA 4FZYA 5D3GA 4FYDA 3NF8A 3PUFA 3M8SA 5CZ1A 1IKWA 4AHRA 4DTXA 4ZTJA 4FJXA 4CK1A 2BDPA 3DMJA 1HMVA 1LWEA 3NF9A 3KTQA 2DFFA 3LP1A 3QINA 3V81A 3QEWA 3KK1A 1JLQA 2ETJA 2X6NA 3LDSA 1BISA 4N41A 1C1AA 1NK8A 2G8WA 3M8RA 3NDKA 4QCLA 2GBZA 3LAMA 4FJMA 5JS1A 1C0MA 3AVHA 4W5NA 3AVFA 2HNDA 1TK0A 2DY4A 4QAGA 1IKVA 4BWMA 3OYMA 5HP1A 3AO2A 4M3ZA 3MEGA 1K6YA 2WONA 1RTHA 2AJQA 3F9KA 1EKEA 3OYFA 4N47A 1RBVA 1RTIA 1LAWA 3VQPA 3LZIA 1CXQA 2RKIA 5HRPA 3SZ2A 2XY6A 3SV4A 3CFPA 1VRTA 4CHPA 4CJTA 2X78A 1REVA 1NOYA 1W9HA 1J54A 4MQ3A 4CEQA 4DF4A 4FK2A 4CGJA 5CYQA 4B9TA 4CHQA 4CEAA 3SQ2A 4JS5A 4B9LA 3TAGA 2HHQA 4DSEA 3AVLA 4W5QA 2B6AA 2PYLA 1RT2A 3QEVA 1KVCA 3NHGA 4CK3A 1TVRA 3HM9A 4KHQA 1KFSA 4DG1A 4CCHA 1T03A 2D0AA 4B9VA 1KCFA 4HUFA 2BE2A 3P83D 1ZBLA 2OZMA 3AA2A 4FW2A 4LSLA 5HLFA 4FJLA 4KTWA 2Z1JA 4FJ8A 4CGFA 1FXXA 1RBSA 3UIQA 4KFBA 4M41A 4CEZA 3AO3A 4GW6A 5C25A 1WNSA 3RMAA 3PO4A 3SPZA 4F3TA 3NGYA 1S1UA 4BWJA 4CERA 4W5OA 3S9HA 1RDDA 3TWHA 3T3FA 4FJHA 3KD1E 1CZ9A 1UA0A 2YHAA 1I3AA 2OPRA 3C94A 1S1WA 3K5NA 4UQGA 3AVNA 4B8AB 4Z4FA 3TARA 3QEIA 4CIFA 1L5UA 1D5AA 4KTZA 1KTQA 1G15A 1HYVA 4E7LA 2RN2A 4WE1A 2VWJA 1IG9A 1D9FA 4IG3A 1KSPA 4BDPA 4KAZA 1BIUA 3OYJA 5FRNA 1JL1A 4DWIA 2O4GA 4DSLA 4EP5A 4B9SA 2LSNA 5KI6A 4CJ4A 3S3OA 1NK5A 2G8KA 4LH4A 1VSHA 1Z26A 4LH5A 4E7IA 2YHBA 4BE0A 4CEEA 3MAQA 3AO1A 3KLGA 1NK9A 1TKXA 2DFHA 3DLEA 3VA3A 1QHTA 2HVHA 4HUGA 1L3TA 4Z4CA 4YNQA 4AILC 3DOLA 3H08A 3D0PA 1I39A 1QSSA 3KLIA 4CHOA 4FJIA 3LWMA 4HUEA 1QSLA 4CECA 4DQRA 1T8EA 4FK4A 1IKXA 1BHLA 4N5SA 3BDPA 1HJRA 4Z0UA 3NE6A 3QEPA 1RNHA 1S5JA 4B08A 4ID1A 1UWBA 1VSKA 3C95A 4LSNA 5J2QA 4RW7A 3L2RA 3VQ8A 1RTJA 3JSMA 2FBTA 1BGXT 4K8ZA 3NH0A 1L3SA 1B9FA 3OYIA 1TV6A 1RBTA 3D45A 3QO9A 2VG7A 4IFVA 3SUNA 1BI4B 2KTQA 2FBXA 3NBPA 1S1TA 3C6UA 3ASMA 3LAKA 3ZT4A 2QKBA 2HVIA 4KPYA 2HHWA 4O5BA 4Z4EA 3NF6A 4CESA 4CFAA 1RT6A 2PY5A 2GV9A 4M42A 1A5XA 4M3YA 1SL2A 3SPYA 4IG0A 2HHUA 3AA5X 5HRSA 1ITGA 3SYZA 3OYLA 3DM2A 1ASUA 4EZ9A 3SQ4A 3KKRA 5KRTA 3O3GA 3ZSQA 1GOAA 1S6QA 3VQDA 1U45A 4CJRA 1N6QA 4IKFA 4G1QA 4XIUA 1Q9XA 2KZZA 3I0SA 3AA3A 3QLHA 1YTAA 3PX4A 1DTQA 1LW2A 4O0JA 4CJLA 3TAEA 3TI0A 4F2SA 3U3GA 4GVMA 4FM1A 3CFRA 3VQ4A 4F2RA 4DSIA 3M8QA 4NYNA 4K8XA 2QK9A 4CJWA 1NKCA 5KGWA 4RW8A 2RF2A 4BE2A 4DLEA 4C8MA 1EETA 2A1RA 2P5OA 1WSFA 2HB5A 4EZ6A 1NOZA 4OPKA 3KLFA 3RWUA 2Y1JA 2ZE2A 1CLQA 2VG5A 3V9ZA 4H8KA 2XRIA 1X9WA 1BQMA 1J9AA 1VSLA 2JGUA 3VQ9A 4AHUA 1ZBIA 4DTNA 4FM2A 4FZXC 3QETA 4PUOA 3DLGA 1Q9YA 1ZYQA 4E0DA 4AH9A 2X6SA 4KI4A 2HHVA 3L3VA 3TAQA 2ITGA 4IFYA 1ASWA 3JYTA 4E1NA 4FJ9A 2ZQBA 1SKSA 5C24A 3RMCA 2FC0A 4AHVA 4CF2A 3DI6A 1RT5A 3DLKA 4CJEA 3KIOA 5EU7A 2YNFA 3RRHA 3QERA 4DFMA 4KRFA 5HROA 4DSFA 1WAFA 3VQ5A 4DS4A 4ELVA 4KREA 3OS0A 1VSMA 2W42A 1FKPA 3VQEA 5KRSA 3OYCA 1KVAA 3PX6A 3TABA 3RRGA 1S6PA 4CJPA 3RR7A 1C1CA 4FZZA 4NYFA 3ISNC 4J2BA 3SQ0A 4RG8A 3V1RA 1ASVA 3B6OA 4OLAA 3LPTA 2F96A 4OKKA 1JKHA 4DTOA 1YTUA 2YNGA 3AO5A 2KQ2A 3QESA 4PWDA 3AVGA 1XHXA 3IG1A 3DOKA 1HQEA 5HBMA 2G8IA 4CIEA 3VQ6A 3MEDA 3ALYA 3ZSYA 3U6FA 4OKEA 4GMJB 2IS3A 3NCIA 3FFIA 2E4LA 5I3UA 1J5OA 4DSKA 3BGRA 3SV3A 3V6DA 4DF8A 4KHUA 3I8DA 1NKEA 4JS4A 2DTUA 1QTMA 4DTRA 3DLRA 1UAXA 4CGIA 3HPOA 3WNEA 1VSDA 4CHZA 3VQQA 2XO7A 3V4IA 1NJXA 3SUQA 1KRPA 3ZT3A 3KD5E 4KB1A 2D0BA 3SQ1A 4KHNA 1DLOA 1A5VA 3ZSWA 2WOMA 4OKJA 1L3VA 2G8VA 3PY8A 4JRQA 2G8HA 2OA8A 1WLJA 4IDKA 1KVBA 1R0AA 1D8YA 1EP4A 1WN7A 3HSTB 3ZSRA 5HRNA 1SKRA 4OJRA 3PO5A 1RT4A 1D9DA 1QS4A 1VSIA 4DMNA 1BIZA 3L2VA 4Q0BA 3G0ZA 3DRPA 3HPHA 4CJSA 2KW4A 4F8RA 1A5WA 1IH7A 3L2UA 4DTPA 1RDAA 1HPZA 2OPPA 2IC3A 3VQAA 4CEDA 1TKTA 3AVAA 3TANA 2HMIA 4FJ5A 4FK0A 3U3YA 2Z1GA 3EY1A 4HHTA 4CF8A 4FM0A 3VA0A 4R5PA 3KJVA 2BGGA 5FROA 4CGGA 1WSHA 1NK0A 1JLGA 4E7JA 2XY8A 1HNIA 3S3MA 3RMDA 2EHGA 1RDCA
chains in the Genus database with same CATH superfamily
4F3OA 3CETA 4XH4A 4FWKA 4MO4A 1GLJO 3PIOL 2GEMA 4CF9A 3THVA 4JI3K 4O8UA 3TTDA 3TU5A 2HHSA 3CM5A 3CIPA 1EXQA 4CF0A 1J53A 1RDUA 2E1YA 1NGAA 3SI6A 3MN9A 4ELTA 1SKWA 3AO4A 1WSGA 4KHSA 3AVMA 3MEEA 3G10A 3ZT0A 1E4FT 3SJJA 5HOOA 2JWKA 4A2AA 2X74A 3O08A 2FBVA 4OGEA 2WC9A 2QI2A 4MO5A 1NK4A 1BO5O 4M3XA 3OJSA 1IO2A 1XC9A 1FW6A 4IJAA 2AP1A 4KHYA 1HNXK 4N76A 1MA9B 1RDBA 2FSJA 4M3TA 1ESVA 4A59A 3A5MC 3WXJA 3K5OA 4CE9A 3L2QA 3WXMB 4BRIA 3TSUA 3LM2A 2NRWA 1GOBA 3D7EO 1DEJA 1X9MA 3Q7BA 3KK3A 4KV8A 2W41A 3BUZB 5M1FA 5IT9O 1JXBA 2I5JA 4B8CA 4FWOA 1XHZA 3ZEUB 1XMQK 4DQIA 2HHXA 1E3MA 3VGKA 3V9UA 2XY7A 1HLUA 1SL0A 1KLMA 1S3XA 1VSJA 3V1OA 4HCBA 1L3UA 4BRCA 4AHSA 1SAZA 4A5BA 3EZ5A 1T05A 1NK6A 1WSJA 3VEWA 5LY3A 2QWPA 1HR0K 4PKIA 4NCGA 2D0PA 3HP6A 1FK9A 3HYFA 2ATQA 1LWCA 3E9LA 5KQDA 4DTUA 2VQEK 1NM1A 2QEXN 3T69A 3CYMA 1TL3A 4FLWA 2JLEA 4JHDA 2GUIA 1WBBA 3VTHA 1KXPA 3W3DA 3C6HA 1C6VA 1U48A 4U7BA 2NRXA 4FWQA 4IZ9A 3IAYA 3AVJA 3LWLA 1GLFO 5DM7L 1NMDA 3CJ9A 3VN5A 2V51B 3DRSA 4W5TA 2OPSA 4CEOA 1JL2A 4KH4A 1YF5L 3DXKB 5KGXA 1NGJA 3OHRA 4Z4IA 4EP4A 4CJ5A 1J5EK 1NJZA 3TAMA 4CHNA 4H0TB 3BF3A 3LDQA 5JLFA 3PSFA 5T7BA 1MU2A 1NJYA 3VF2A 2AA4A 3MX2A 4E3SA 4X64K 3C6TA 4KI6A 4H4MA 3CCRN 4BC5A 2QW9A 3NF7A 3HO1A 3AVBA 3ENOA 3I55N 1YVUA 5FPMA 4CGDA 3QNNA 2XY5A 4DV5K 4YHHK 2P51A 3NH2A 1O1WA 3MECA 4PKHA 5K14A 4DTMA 4YFUA 5CZ2A 5M1QA 4CGHA 4A5AA 4B9MA 1BCOA 5C12A 1VSEA 3AVIA 4DKWA 5AZIB 1JLCA 2YHYA 4JKAA 2VGMA 1KD1O 1BOTO 2P9LB 1TKDA 2OZSA 4JEPA 1C0FA 4LD0A 2KFZA 5I9EB 1HNWK 4H5WA 5AQKA 3LZJA 2DFEA 4E7HA 4BR9A 3CJ1A 1CXUA 1GLAG 4F4KA 4CJVA 4DU3A 3K59A 4Z4GA 1RCHA 4NCAA 3D2FB 2G8UA 2XHBA 3DLHA 3NF8A 1IKWA 3DMJA 3J8AA 3KTQA 3CCMN 3QINA 4N41A 1BISA 3WXKA 1NK8A 2G8WA 3M8RA 2O8FA 2O8DB 2P9PB 3HOTA 4GV9A 2DY4A 3VPZA 3WQUA 3AO2A 4FWRA 1K6YA 3LDLA 3OYFA 4BR2A 4IFEA 1CXQA 2V7YA 3O9SA 4JK9A 3CFPA 4LF7K 1REVA 4BG9A 4CHQA 4JS5A 4B9LA 3KWGA 4DSEA 3AVLA 1EWRA 5AQTA 1KVCA 2QWLA 4KHQA 4DG1A 2WTUA 4ILHA 3CC7N 4B9VA 4HUFA 2BE2A 3P83D 3C6AA 3EE8A 4FW2A 3G71N 5HLFA 4BR5A 4CVNE 1QHAA 1FXXA 1O13A 1RBSA 4KFBA 3UIQA 2VYPA 4BRGA 5H1SQ 3RMAA 4MLHA 3NGYA 4CERA 3S9HA 3HI0A 3TWHA 5AQWA 4FJHA 2QWQA 1CZ9A 1I3AA 3C94A 2GELA 3K5NA 1KAXA 4UQGA 4B3MK 4CIFA 4HWIA 1L5UA 4WF9L 4KTZA 3J81O 1G15A 4PHTX 2RN2A 5DM6L 5C2DA 2VWJA 4KAZA 1BIUA 3OYJA 1JL1A 4EP5A 1HX1A 2LSNA 5KI6A 3S3OA 4NXNK 3R1XA 4CD3A 2QTDA 1VSHA 3E1YA 4BE0A 1YJWN 4C1NI 4LFBK 4HUGA 1L3TA 4Z4CA 4DV7K 2HBKA 3H08A 1QSSA 3MCPA 4XH5A 5EY4A 3LWMA 1T8EA 4FK4A 3BDPA 4Z0UA 4DUZK 5F1XA 1RNHA 2FF6A 4ID1A 4YY3K 5J2QA 5KPZA 4NXMK 5LMNK 1BGXT 1L3SA 3C0BA 2UXDK 3QO9A 1X3MA 3SUNA 4IFVA 1GLBG 1BI4B 5BPLA 2KTQA 2W6LA 2FBXA 1RGIA 3LAKA 2QKBA 3A5NC 4Z4EA 3NF6A 2PY5A 1RT6A 2GV9A 3VMFB 4M42A 4LF4K 2QWMA 4FWSA 4BGBA 4DV1K 3SPYA 4IG0A 3OYLA 2HHHK 3EZWA 3O5BA 3ZSQA 4BR0A 3VF6A 2P9KA 2KZZA 2O8BA 3AA3A 2GTDA 4CJLA 3TAEA 3OBYA 3M6GA 4GVMA 4PL8A 5AR0A 3ULEA 3GBTA 4CJWA 1NKCA 2W6KA 5KGWA 4DLEA 2RF2A 2P5OA 1NOZA 3KLFA 2Y1JA 2VG5A 1IV0A 1ZBIA 4DTNA 3QETA 1ZYQA 4AH9A 1ASWA 3JYTA 4E1NA 2E1ZA 3T1YK 5C24A 1YUWA 4CF2A 1WOQA 3DI6A 3EN9A 2CGKA 3DLKA 5AQYA 3RRHA 2YX6A 3CF5L 1VSMA 2W42A 3TABA 1KVAA 2ZGYA 3RR7A 4FZZA 4JHDB 3C65A 4JI4K 4GKKK 1M1KO 3J7YP 3MN5A 1YTUA 5AQSA 5AQHA 1YAGA 3QFUA 3QESA 4PWDA 1VQ7N 5BPNA 3VQ6A 3U6FA 4OKEA 4GMJB 4DF8A 2UUBK 3MK6A 4JK7A 4JS4A 3KWIA 4CD1A 1GLCG 4DV2K 3HPOA 3WNEA 3MCAB 3VQQA 3SUQA 3ZT3A 5BPMA 3KZBA 3ZSWA 4OKJA 4JRQA 3RSEA 1D8YA 2BH1A 3OW2M 1WN7A 1SKRA 3PO5A 1D9DA 4B1ZA 3GDQA 3DRPA 5BN8A 3HPHA 1A5WA 3IDHA 1IH7A 3L2UA 4GVEA 1HPZA 2IC3A 1KAZA 3VQAA 4H5NA 2Z1GA 3O1BA 5AZJA 3FE1A 5AQIA 3SV3A 3VA3A 2A3ZA 3T1AA 2KZMA 1HYSA 4NB4A 4DFKA 1IBMK 3VQ7A 4IBNA 4FCYA 4CZFA 3P5JA 1NKBA 3KLHA 3CQ8A 3E01A 3GL1A 3IUCA 3B6PA 5AQJA 3SAFA 3HJFA 3D2FA 4DB3A 2QKKA 4CJUA 3HTVA 3CG7A 3O3FA 5JVGL 4CIGA 3O3HA 3VESA 2ZJQL 2Q0RA 3F5TA 3TSQA 4K41A 3KKSA 2P9NB 4ID5A 3I8BA 3HSCA 5EOYA 1VRUA 4FSVA 4CJKA 3SLCA 5AQOA 4NCBA 3ZETB 1W7AA 1BL3A 2F8SA 3K57A 4FLXA 3A0IX 2O4IA 4DHYA 3SK3A 3OYEA 3OVNA 3K0SA 3CFOA 1YT3A 3LP0A 4C8LA 1U2VB 1JLBA 1N34K 4JK8A 3RMBA 3SAHA 1SL1A 4JNEA 2P5GA 4FJGA 1QSYA 4OPAA 5TKWA 4YOTA 3WQTA 4N56A 3R9PA 3TR8A 4DLGA 1NJIO 1V4TA 4CBXA 4CZGA 4JI6K 3LANA 5AQXA 3PX0A 1KC8O 4JKFA 4H0YB 1C0TA 2OCEA 4BVPA 3JXUA 4AM6A 1NGCA 3VGLA 4QS8A 1GOCA 2B5JA 5JS2A 1BCMA 3BY5A 3PV8A 3AA4A 2CGLA 3N4PA 4I2PA 4MFBA 1IKYA 3HL8A 1KQSM 4IWVA 4Z4HA 3SUPA 3JS6A 4NLCA 3OYHA 1NGBA 1SQKA 2YNHA 2O8DA 4FLUA 4CZJA 1FKOA 1VSFA 2NUBA 1VQON 2BANA 4TSXA 2NRZA 1TAUA 1YI2N 1N36K 4B3SK 1YIJN 4O55A 2R7YA 1BA1A 2B4JA 3VETA 3MXJA 4WQ4C 5AZJB 2DPNA 3DJCA 1B9DA 3OYKA 4FLZA 3M8PA 2IAJA 2PZSA 3O8MA 3S3NA 3ZX0A 4AHCA 2HW3A 1IG8A 5C0YA 4BC3A 4C1NK 2P9UB 3UKRA 4LF6K 2YCHA 1W2BM 3DYAA 4BRLA 4CBUA 3MXMA 5LJWA 3FZMA 4I9LA 4C8KA 1TKZA 1ATSA 3TAPA 3K2PA 2NNWA 3CPEA 3HOSA 1JCGA 4PA1A 3VEZA 3M3ZA 3CM6A 1Y97A 3MN7A 3RVCA 2A40A 1HQUA 3F73A 1X3NA 2F7TA 1VQ4N 3ZT1A 3NGZA 4DQQA 2YNIA 4FXDA 1Q86O 4J2DA 3AAPA 3UKRB 4JKHA 3QIOA 3ITHA 4JLHA 3QNOA 4X66K 3U4LA 2KHOA 4JI2K 2P9PA 3ULDA 1N32K 3OA9A 4PL7A 3OY9A 4J2EA 1QE1A 3OJUA 4FJ7A 5BN9A 4QS9A 1X9SA 1TAQA 2P1JA 2G8FA 1XNRK 3LPUA 3CERA 2YJEA 4GNIA 4KO0A 4M45A 2W40A 3M1FA 4M3RA 5AQFA 4PQUA 3WNGA 3P1GA 3HK2A 1BUPA 3O80A 1XUPO 3V1QA 3I0RA 3AV9A 4YOUA 3LDNA 4RW9A 3HVRA 4G9ZA 1ZBUA 4DR4K 3O4QA 2Z1HA 2ZGZA 5TKYA 4FZYA 4FYDA 4BR7A 3PUFA 4AHRA 1HPMA 1EQYA 4IO8A 4WQ5C 2O8CA 3LP1A 3V81A 3J80O 3KK1A 1JLQA 4BRKA 2Q2RA 3LAMA 5JS1A 1C0MA 3AVHA 2HNDA 5HP1A 1Z05A 2HF4A 3MEGA 3F9KA 1RBVA 1RTIA 1LAWA 1ATNA 3VQPA 1QVGM 3LZIA 2XY6A 3SZ2A 3SV4A 4CHPA 2X78A 1W9HA 3MN6A 1P90A 1NGIA 3LDOA 3MDQA 2HHQA 2B6AA 2PYLA 3QEVA 3NHGA 4DR2K 2QWNA 4QS7A 3UE5A 2D0AA 1K8KB 1ZBLA 3VEVA 5E26A 5BR8K 4FJLA 4KTWA 2CGJA 2Z1JA 3LDPA 1RDDA 2YHWA 2YHAA 2NLXA 1HUXA 5AQRA 3AVNA 4B8AB 4JI1K 1KTQA 4BQLA 2UXCK 1D9FA 4IG3A 3AGRA 5M1PA 4DWIA 3CCLN 4DSLA 4ILGB 4CJ4A 1NK5A 3DXMB 1Z26A 5FLXO 4E7IA 3KLGA 1NK9A 2DFHA 4JKBA 4NLBA 1I39A 4CHOA 4CZEA 5AQLA 4FJIA 3RSEB 4HUEA 4CECA 4BR4A 1TYQA 1BHLA 1HJRA 2UYTA 3QEPA 3WUHA 4B08A 3C95A 2FBTA 5KPTA 4K8ZA 3OYIA 3D45A 3VF4A 2V7ZA 5BRHA 2HHWA 3R6MA 4O5BA 2UXBK 4CFAA 1OH8A 2HF3A 4Y0WA 4DCHA 4WQ5A 4YORA 2HMPA 1SL2A 2ITMA 3AA5X 1ITGA 3SYZA 5GIPA 3EEQA 4FO0A 5LMUK 3O3GA 4CZKA 4K0KK 3VQDA 4CJRA 4G1QA 2IIRA 3QLHA 1NG9A 1NLVA 3PX4A 3U3GA 4EHTA 4FM1A 3CFRA 5JICA 4YDUA 3L4QA 4EIAA 4C8MA 2A1RA 1WSFA 2HB5A 4OPKA 1XNQK 2XRIA 5M1NA 2ASOA 4FM2A 4CBWA 5AQZA 1Q9YA 1Z6RA 4KI4A 3L3VA 3TAQA 3HBTA 4IFYA 4DV6K 3RMCA 2FC0A 2IVPA 1NBWA 5EU7A 3FZHA 4DFMA 4DSFA 1WAFA 4DS4A 3QMLA 1HKGA 4WYBA 3VQEA 5KRSA 5C15A 2ZM6K 3RRGA 4NYFA 4J2BA 3B6OA 4OKKA 1JKHA 4DTOA 3AVGA 2GX9A 2P9SB 5HBMA 2G8IA 3R3LA 4CIEA 1YJ9N 1QVFM 2H3GX 2ASPA 2YJFA 4B1XB 3FFIA 2E4LA 5I3UA 4CZHA 3BGRA 3V6DA 4B9QA 3H3OB 1NKEA 5A2QO 2DTUA 5EXWA 4DTRA 1UAXA 1YVNA 2XO7A 4YOXA 4KB1A 3KD5E 3O6WA 1DLOA 4CZMA 3T1HK 2Q97A 2FF3B 3Q7CA 5HRNA 3HSTB 4OJRA 4KBOA 2HSTA 4A62A 2P9SA 3G0ZA 4JI8K 3O1WA 3E9OA 4BRQA 4DTPA 4AQYK 1XMOK 4H5VA 3CCUN 4BRDA 3EE9A 4FJ5A 4HHTA 3VA0A 4R5PA 3KJVA 2BGGA 1WSHA 1ZC6A 2XY8A 4H8KA 1HNIA 3SBTA 1U2VA 1RDCA 3ZETA 4BGAA 4DFJA 3ID6A 4OX9K 3WXIA 2P9IB 4ICLA 5EX5A 4DV0K 1VQLN 2NRHA 2OPQA 3NFAA 1YJNN 1SUQA 3L3UA 4BE1A 4L8RB 1HJOA 1DTTA 2E2OA 4H0VB 2D4WA 1RILA 1RT7A 2IOCA 1X1PA 5FRMA 5ADXH 5E41A 1LAVA 3HPGA 3PIPL 1WSEA 4DSJA 3SAGA 4Q5VA 2GWJA 3CJAA 3QB0A 5LJVA 3D2EA 1TGOA 2OANA 4BC4A 4B3TK 5KTQA 4LF9K 1ZBFA 4KB0A 5J1EA 1NGHA 3V9XA 4BDZA 5SZTA 4LF5K 4H4OA 2Q3SA 3WNFA 1RBUA 5DK5A 3LP2A 1T3VA 4JI7K 1RTDA 2VWKA 4CHYA 3O9QA 5J2PA 3L2WA 3O9UA 4FVMA 4OPJA 3HM8A 4B3OA 3A2FA 4CEBA 3ZSOA 1QQOA 3KLEA 1DT9A 2P9LA 3ZT2A 4KHWA 3TSPA 4J8FA 3ATUA 1VAZA 2WFBA 4CFDA 1CZBA 4C23A 4KKOA 1XWLA 3SBGA 2F9TA 4E89A 4LFCK 3CJBA 4I2QA 4CJFA 1G99A 4B1WB 3NMUA 5F2RA 5J2MA 3CI5A 2ZD1A 3C7NA 1OH5A 4X65K 1C0UA 4OO1J 4Y1DA 2A41A 3ID8A 4RCHA 3H45C 1W0HA 4DU1A 4W5RA 4JD2B 5KPRA 1F21A 2PYJA 3CHWA 3ZCMA 3WNHA 3SUOA 1GLLO 1WUAA 1NNEA 2OYQA 3ATVA 2NZTA 3ZX2A 4FVUA 1S1VA 3OYAA 3DXMA 3FLCO 2O8EB 3H1QA 3OTOK 1JXEA 4BVOA 4I9QA 4CEFA 3U9DA 5GAGP 5F0XA 3LALA 4M3UA 5GIOA 4FJJA 1BQNA 3MXIA 1YXQA 2HOEA 5C42A 5AFUA 4OGCA 5AJ3K 3SNNA 4IOAL 1MDUB 2E20A 1TUUA 1EX4A 2HNZA 3QEXA 2GWKA 1N8RO 5CR4A 4JRPA 4JKGB 4M7XA 4FLVA 3ZYYX 3A8YA 3WT0A 1U47A 4JV5K 2J4RA 1U49A 3VTIA 1BU6O 4M3WA 1VHXA 1OKJA 2Q1NA 4H5TA 4WFNL 3E66A 4WQ4A 3RR8A 3OS2A 2ZWHA 2GUPA 2KFNA 2V52B 3OYNA 2QXFA 2WBNA 2VQFK 1SS6A 2O8FB 3ZSVA 4FJNA 2IGIA 3D6RA 1QZ6A 4B9NA 1S9GA 4CFBA 1SV5A 2HBJA 1Q81O 2KKZA 2Y1IA 4MDBA 1OVQA 4O4GA 3NAEA 3DLBA 4JI5K 1RBRA 1T6DA 1WAJA 2FXUA 3FFKB 3L8BA 4KTQA 3DXKA 3PSIA 1UOCA 4CF1A 3K9KA 1LV5A 4AHTA 3OYDA 3HVTA 5J2NA 5GAHP 1Z25A 4C8NA 4JD2A 2ZJPL 1P8ZA 2A1SA 1H1VA 1U04A 3IS9A 2FSNA 1NK7A 2IVNA 2Q0UA 3VQCA 4UY8O 1VQ5N 4RW4A 1HNVA 5D3GA 1GLDG 3M8SA 5CZ1A 3DAWA 5M1KA 1HMVA 1QZ5A 2DFFA 1HKCA 3VEXA 3QEWA 3LDSA 2ETJA 3NDKA 3W0LA 1WB9A 4W5NA 1TK0A 4H0PA 4JKCA 4QAGA 3OYMA 4M3ZA 3M5RA 3THYB 3BEXA 5CHIA 3CQYA 5GINA 2RHKA 2RKIA 5HRPA 4JYAK 5AQNA 4CJTA 3WEEB 1NGDA 1NOYA 1J54A 4CEQA 4CGJA 5CYQA 2OTLN 1NWKA 4H0XB 4DR3K 4I6MB 3SQ2A 1R59O 2E8AA 1RT2A 4CK3A 4FL9A 2O8CB 2Q36A 1KFSA 4M7YA 3GG4A 1T03A 2UUCK 4FJ8A 2E2NA 1T6CA 3EKUA 3ENBA 4M41A 5C25A 3AO3A 1WNSA 3SPZA 1D4XA 1S1UA 4BWJA 1VQ9N 3KD1E 4IJNA 1UA0A 2OPRA 1S1WA 3G25A 3CD6N 1D5AA 4GV6A 1HYVA 4IEEA 4E7LA 2BUPA 4BDPA 4BRHA 1YITN 4B1YB 4B9SA 2G8KA 1MWKA 1NGGA 2NRRA 2QWOA 1E4GT 4LH5A 2O8BB 2I7NA 2YHBA 4CEEA 3DLEA 4AILC 3DOLA 3D0PA 1QSLA 4DQRA 4N5SA 4LC9B 2UU9K 5M1OA 4YOYA 3FZKA 1UWBA 4RW7A 4O8KA 3VQ8A 3NH0A 5CE3A 1B9FA 3CCSN 3ZLJA 1RBTA 4ISFA 2VG7A 4WCEL 1NMNA 1S1TA 3C6UA 4FPAA 3QBXA 2E2QA 1A5XA 4M3YA 1JCEA 5HRSA 4EHUA 4DR1K 3IFRA 3THWA 3DM2A 1ASUA 3CPWM 3SQ4A 3KKRA 5KRTA 3H6EA 4H03B 2YHXA 3P31A 1GOAA 1U45A 1N6QA 1Q9XA 4XIUA 3MWTA 3A5OC 1YTAA 2YI1A 1LW2A 4O0JA 4BG8A 3TI0A 3O4WA 3VQ4A 4DSIA 3M8QA 4NYNA 4K8XA 2QK9A 4CZIA 3P38A 3HZ6A 1EETA 3RWUA 1BWFO 4EZ6A 3V9ZA 3SMPA 1X9WA 1J9AA 2P9NA 3VQ9A 1ZBSA 3QICA 4FZXC 4PUOA 2HHVA 3DLGA 3MX5A 3CXCM 3GE1A 2ITGA 4DV4K 1XC3A 4CW7B 4X62K 1SKSA 4JI0K 2VCPA 4ISGA 4AHVA 1JJ2M 4CJEA 4HTLA 3QERA 4KRFA 3J7AP 4ELVA 4KREA 4MLEA 3MMVA 3B8AX 4EAHD 3EKSA 3ISNC 4RG8A 1ASVA 4OLAA 4DQ8A 3F9MA 2YNGA 4DR6K 3HRGA 2KQ2A 4B1VA 1XHXA 3CMEN 3DOKA 1HQEA 5KQ8A 3MEDA 1Y64A 3SMSA 3ZSYA 2IS3A 3NCIA 4DSKA 2EWSA 4IOXA 1QTMA 3DLRA 4CGIA 4H5RA 1KRPA 3H3NO 2D0BA 3SQ1A 4KH6A 3U8XA 2WOMA 4AF1A 2G8VA 2G8HA 1DGKN 1WLJA 1KVBA 4IDKA 1R0AA 4BRPA 2E5LK 4E1JA 1BA0A 1QS4A 1VSIA 1BIZA 3BP8A 3UKUA 1T44A 2KW4A 5HL7L 4F8RA 3QFPA 4B3RK 4BRNA 1RDAA 2ZF5O 3TANA 1TKTA 3AVAA 3H46O 1WBDA 4FK0A 3NVKA 3EY1A 2F4VK 4CGGA 1NK0A 4E7JA 3L6QA 2D5RA 4DR5K 2FLOA 2EHGA 3OYBA 3NVMA 5AQQA 3RTVA 1U4BA 2RE2A 3HT3A 2P9KB 4RW6A 2UUAK 4CK2A 4HVJA 4CFCA 1XQSC 4F9OA 3UKUB 1C0GA 1QQCA 2YKMA 4J2AA 4FW1A 3FGUA 5I42A 1VQKN 1Q8IA 3HXMA 4DUYK 1VQNN 1HKBA 1N5YA 5EVZA 3QBWA 1RFQA 3K5MA 4HCCA 2EX3A 2E6LA 1KAYA 4DS5A 4FWPA 4JKDA 3CCVN 3TAFA 2RPIA 5AQMA 4YOWA 2HHTA 1C1BA 2P9IA 1NJWA 4FOIA 3VENA 1LCUA 4DTSA 3K58A 4EFHA 5CY4A 3WEEA 3DRRA 3AVCA 1Q18A 1IBLK 5AQPA 3OYGA 1TL1A 2YKNA 4NO7A 4DR7K 2YV0X 1VQMN 1SZ2A 4B9UA 2Z1IA 4Y1CA 4LY7A 3SCXA 2HNYA 3QDKA 1BI4A 1T7PA 1B92A 4PY5A 2F8TA 3ENHA 1ILYA 3R8EA 5LL6Z 4CJ7A 3CCJN 4IOCL 1RT3A 4O0IA 1BDGA 4FLYA 4GV3A 4U67L 3OS1A 4E19A 1NGEA 1VQ6N 1ZBHA 3L0QA 5FDLA 3D2EB 2A42A 4A57A 3GOIA 4FWLA 2BTFA 3EO3A 1JLAA 3JAMO 3CC4N 1DKGD 1ZXOA 4ELUA 3LL3A 3THXB 2VG6A 4JKGA 1UA1A 3DWLA 4DQPA 1EO1A 3ZSZA 5BRDA 1VQPN 4JN4A 1LWFA 4K42A 4HTUA 2HBLA 4BACA 1LW0A 4FJKA 4E7KA 5C10A 4DFPA 1WSIA 3ZEUA 2VWBA 4ILJA 3V9SA 2IDOA 3LM9A 3ZSXA 1NGFA 4FOEA 2FSKA 1TK5A 2IVOA 5GADP 3T19A 4XH1A 1X9JA 1VK0A 4PKGA 5HRRA 4FPBA 4BDYA 4QOZB 4ZTFA 2E88A 3K5LA 4BRFA 4LF8K 4IEIA 3FZFA 1CZAN 1QQNA 4KH5A 3OBWA 3TTCA 5SWMA 4BREA 3QIPA 3NH1A 1JLFA 3KK2A 2QXLA 5CYMA 4O5FA 1HYZA 3E9PA 3V9WA 4CJ3A 5AZIA 4DTJA 3HP9A 3J7ZO 1TK8A 2O8EA 3SJHA 1OH7A 2KLAA 4XEIA 1Q82O 4C8OA 1GLEG 2P9UA 4ZHRA 2FBYA 4E1MA 1OH6A 4K43A 3CMAN 3FR0A 2E2PA 3BZKA 1OVYA 3EL2A 4DU4A 3NGIA 4I7FA 5DMRA 4M63C 4A61A 1S1XA 3ZX3A 3EYZA 3AVKA 4E0DA 1XI1A 2E6MA 1HRHA 4JKEA 1KFDA 1S9EA 3VQBA 4GY2B 4OVLA 2QM1A 4KHPK 4FLTA 4CJQA 4O44A 3A5LC 3VOVA 3P4IA 1KLNA 4GKJK 1RT1A 1JLEA 1QQMA 3O4NA 4B1UB 4DQSA 3G6EN 2WUSA 3IRXA 3CCQN 3AY9A 3C7NB 2D0CA 3VEOA 4OLBA 4OPHA 3LP3A 1FJGK 5AQGA 3BF1A 4ZTJA 4DTXA 1W97L 4FJXA 4CK1A 2BDPA 1LWEA 2JWLA 3NF9A 2HVIA 2X6NA 4DV3K 1C1AA 5FPNA 5AQUA 4QCLA 4BRAA 2GBZA 4FJMA 3AVFA 3TPQA 1IKVA 4BWMA 1RTHA 1V4SA 2WONA 1EKEA 2AJQA 4N47A 3CC2N 1J6ZA 1RDWX 1VRTA 4AM7A 1S72N 4DF4A 4MQ3A 4FK2A 5E84A 2QA4N 4B9TA 4CEAA 3AGKA 4CI6A 3AAQA 3TAGA 2CH5A 4W5QA 3FZLA 1TVRA 3HM9A 3CJ7A 4CCHA 1KCFA 4IDHA 2OZMA 3AA2A 1Q7YO 4LSLA 4CGFA 2ASMA 4CEZA 2VGNA 4GW6A 1K8AO 3PO4A 3I33A 4F3TA 1S22A 4W5OA 3T3FA 1N33K 3PLAA 4FWNA 4Z4FA 3TARA 3QEIA 1HNZK 1LOTB 1EWQA 2NRTA 3I56N 4WE1A 5JMVA 1IG9A 1KSPA 4BY9C 2OTJN 5FRNA 3H1VX 2O4GA 2PFUA 1K8KA 4LH4A 4I6MA 2PBDA 3MAQA 3AO1A 1TKXA 1QHTA 2HVHA 2D0OA 4YNQA 4BC2A 3KLIA 5ELZA 1I94K 2QWRA 3S41A 1IKXA 1MWMA 5JVHL 5GAEP 3NE6A 1JCFA 3KVGA 1S5JA 5BRFA 1VSKA 2F9WA 4LSNA 4Z94A 2Q31A 4ISEA 3L2RA 1RTJA 3JSMA 3DLLL 1TV6A 4LFAK 4BRMA 3NBPA 4BROA 3ASMA 3ZT4A 3T7ZA 4KPYA 4FWMA 4CESA 4A2BA 3KHYA 4BQZA 1M90O 1NU0A 4WFAL 2ZJRL 3THYA 2HHUA 2PAVA 4EZ9A 5ADXA 3CQXA 3G4SN 1S6QA 4IKFA 3I0SA 5C2FA 1VQ8N 1DTQA 1U6ZA 4F2SA 4YOVA 4WFBL 3UB5A 4F2RA 4RW8A 3L4IA 4BE2A 3CCEN 3IMXA 1CLQA 2ZE2A 3BZCA 1BQMA 1VSLA 2JGUA 4AHUA 3KK7A 4IO9L 3WXLA 4CZLA 1YHQN 2D1KA 2X6SA 4FJ9A 2ZQBA 3AARA 1RT5A 3KIOA 4RTFD 2YNFA 1K9MO 5FPDA 5HROA 3VQ5A 2HBMA 5BR9A 3OS0A 1FKPA 3PX6A 3U9ZA 3OYCA 3O9TA 1S6PA 4CJPA 1C1CA 1BG3A 3P39A 5BREA 3CJCA 3SQ0A 3V1RA 4IXCA 3LPTA 2F96A 3AO5A 5FPEA 3IG1A 3TTFA 5AFUH 4RWTA 3ALYA 2A5XA 4JAXA 1J5OA 4KHUA 3I8DA 4H0OA 4V19S 1IBKK 1VSDA 4CHZA 3V4IA 2NRVA 1NJXA 4KHNA 1IJJA 3THXA 5IWAK 3VGMA 4R79A 1A5VA 3N4QA 1L3VA 3PY8A 5JLHA 3VEYA 2OA8A 1EP4A 1TYQB 3ZSRA 1RT4A 5B8HA 3MWPA 2CH6A 1TUYA 4DMNA 4Q0BA 3L2VA 3VERA 3O9RA 1K73O 4CJSA 2I7PA 5AQVA 4MDAA 2OPPA 3THWB 4L3QA 1ATRA 4YDUC 3IKMA 4CEDA 2HMIA 3K9JA 2A6AA 3U3YA 5MLCQ 4CF8A 4FM0A 5FROA 1JLGA 3F2KA 4K25A 3S3MA 3RMDA 3ULEB
chains in the Genus database with same CATH topology
3OYBA 4DFJA 4F3OA 3T1AA 4ICLA 2KZMA 1HYSA 4DFKA 3VQ7A 4IBNA 3RTVA 4CF9A 4FCYA 3THVA 1U4BA 2OPQA 3NFAA 1SUQA 3P5JA 3L3UA 3HT3A 4RW6A 4BE1A 1NKBA 3KLHA 4CK2A 3CQ8A 4L8RB 3E01A 3B6PA 1DTTA 4HVJA 2HHSA 3HJFA 3CM5A 4CFCA 2QKKA 1RILA 1QQCA 1EXQA 1RT7A 4CF0A 2IOCA 4CJUA 1J53A 1X1PA 3CG7A 3O3FA 2YKMA 4J2AA 4CIGA 3O3HA 4FW1A 5FRMA 5E41A 5I42A 3SI6A 4ELTA 1SKWA 3AO4A 1WSGA 4KHSA 1Q8IA 3HXMA 1LAVA 3AVMA 3HPGA 3G10A 3MEEA 3ZT0A 3SJJA 1WSEA 3KKSA 4DSJA 1N5YA 4HCCA 3K5MA 4ID5A 2X74A 2EX3A 2E6LA 4Q5VA 4DS5A 2FBVA 4OGEA 3TAFA 2D5RA 1VRUA 1NK4A 4CJKA 2RPIA 2HHTA 1C1BA 4NCBA 4M3XA 3OJSA 1IO2A 1XC9A 1NJWA 1TGOA 1BL3A 5KTQA 2F8SA 1ZBFA 3K57A 5J1EA 4FLXA 4KB0A 3V9XA 4KHYA 4BDZA 4DTSA 5SZTA 4N76A 2O4IA 3K58A 4H4OA 1RDBA 2Q3SA 3WNFA 5CY4A 3OYEA 3OVNA 3DRRA 3AVCA 4M3TA 1RBUA 3CFOA 5DK5A 3OYGA 3LP2A 1YT3A 3LP0A 1TL1A 2YKNA 3K5OA 1RTDA 4C8LA 1JLBA 4CE9A 2YV0X 2VWKA 4CHYA 3RMBA 3L2QA 5J2PA 3L2WA 2Z1IA 4FVMA 4Y1CA 4OPJA 1SL1A 4LY7A 3SCXA 4B9UA 2HNYA 2P5GA 4FJGA 1BI4A 1QSYA 1B92A 1T7PA 4B3OA 3A2FA 4CEBA 4PY5A 1GOBA 3ZSOA 2F8TA 1X9MA 3KLEA 3KK3A 4KV8A 4N56A 3TR8A 3ZT2A 4DLGA 4KHWA 1RT3A 4O0IA 1JXBA 4FLYA 3LANA 2I5JA 1CZBA 4CFDA 4KKOA 3OS1A 4E19A 4B8CA 1XWLA 1ZBHA 5FDLA 4E89A 1XHZA 3PX0A 4I2QA 2HHXA 4CJFA 4DQIA 3V9UA 5J2MA 1C0TA 2ZD1A 1JLAA 2XY7A 1SL0A 1C0UA 1KLMA 1GOCA 4Y1DA 2B5JA 5JS2A 1BCMA 1VSJA 4ELUA 3V1OA 4HCBA 1L3UA 4AHSA 3PV8A 2VG6A 3AA4A 1W0HA 3EZ5A 4W5RA 4I2PA 4DU1A 1T05A 1UA1A 4MFBA 1IKYA 1WSJA 3HL8A 1NK6A 4DQPA 3ZSZA 1F21A 4Z4HA 3SUPA 2PYJA 3ZCMA 4NCGA 3WNHA 3HP6A 1FK9A 1LWFA 4HTUA 3SUOA 3OYHA 3HYFA 2ATQA 1LWCA 4BACA 2YNHA 2OYQA 1LW0A 4DTUA 1S1VA 4FJKA 3OYAA 4FLUA 3CYMA 1FKOA 1VSFA 2NUBA 1TAUA 2BANA 1TL3A 4TSXA 4E7KA 4FLWA 4DFPA 4O55A 2JLEA 1WSIA 1JXEA 2GUIA 2R7YA 4I9QA 2B4JA 4CEFA 3MXJA 3V9SA 2IDOA 3ZSXA 1C6VA 3LALA 1U48A 1B9DA 4M3UA 3OYKA 3IAYA 4FLZA 1BQNA 2IAJA 3M8PA 1TK5A 4FJJA 2PZSA 3T19A 3AVJA 3LWLA 3MXIA 3S3NA 4AHCA 2HW3A 1VK0A 5HRRA 5C42A 4BDYA 4QOZB 3VN5A 4ZTFA 3DRSA 4W5TA 3K5LA 2OPSA 3DYAA 4OGCA 4CEOA 3SNNA 3MXMA 1JL2A 4C8KA 4I9LA 1TKZA 1EX4A 2HNZA 3QEXA 5SWMA 3TAPA 3K2PA 5KGXA 4Z4IA 4EP4A 3QIPA 3NH1A 4CJ5A 1JLFA 4JRPA 3KK2A 4PA1A 3TAMA 4FLVA 1NJZA 5CYMA 4CHNA 3CM6A 1Y97A 1HYZA 1U47A 1HQUA 3V9WA 4CJ3A 4DTJA 5T7BA 3F73A 3HP9A 1MU2A 1U49A 1NJYA 4E3SA 4M3WA 3C6TA 1TK8A 4KI6A 3ZT1A 3NGZA 4DQQA 4H4MA 3RR8A 2YNIA 3OS2A 4FXDA 3NF7A 4J2DA 3HO1A 4C8OA 2KFNA 3AVBA 3OYNA 4ZHRA 2FBYA 2QXFA 3QIOA 1YVUA 3QNNA 3ITHA 4JLHA 4CGDA 4E1MA 3QNOA 2XY5A 3ZSVA 2P51A 3NH2A 3ULDA 4FJNA 1O1WA 2IGIA 3MECA 5K14A 3OY9A 4J2EA 4DTMA 4YFUA 5CZ2A 3NGIA 4DU4A 1QE1A 4I7FA 5DMRA 3OJUA 1S9GA 4B9NA 4FJ7A 4CGHA 1S1XA 4CFBA 4B9MA 1BCOA 1SV5A 1VSEA 3AVKA 3EYZA 1XI1A 2E6MA 1HRHA 2Y1IA 4O4GA 1KFDA 1S9EA 3AVIA 1TAQA 2P1JA 3VQBA 4OVLA 3NAEA 1X9SA 2G8FA 3DLBA 1RBRA 1WAJA 3LPUA 1JLCA 3L8BA 4FLTA 4CJQA 4O44A 4KO0A 4KTQA 4M45A 1TKDA 4M3RA 2OZSA 1UOCA 4LD0A 4CF1A 1KLNA 4PQUA 1RT1A 3P1GA 3WNGA 1JLEA 1LV5A 4AHTA 3HK2A 2KFZA 3O4NA 3OYDA 3HVTA 4DQSA 5J2NA 1Z25A 3LZJA 4C8NA 2DFEA 3V1QA 4E7HA 3I0RA 3AV9A 3IRXA 1CXUA 4RW9A 3IS9A 2A1SA 3HVRA 1U04A 1NK7A 4F4KA 1ZBUA 4CJVA 4DU3A 3K59A 4Z4GA 3VQCA 2D0CA 1RCHA 3O4QA 4NCAA 4OLBA 4RW4A 2Z1HA 1HNVA 3LP3A 2G8UA 2XHBA 3DLHA 4FZYA 5D3GA 4FYDA 3NF8A 3PUFA 3M8SA 5CZ1A 1IKWA 4AHRA 4DTXA 4ZTJA 4FJXA 4CK1A 2BDPA 3DMJA 1HMVA 1LWEA 3NF9A 3KTQA 2DFFA 3LP1A 3QINA 3V81A 3QEWA 3KK1A 1JLQA 2ETJA 2X6NA 3LDSA 1BISA 4N41A 1C1AA 1NK8A 2G8WA 3M8RA 3NDKA 4QCLA 2GBZA 3LAMA 4FJMA 5JS1A 1C0MA 3AVHA 4W5NA 3AVFA 2HNDA 1TK0A 2DY4A 4QAGA 1IKVA 4BWMA 3OYMA 5HP1A 3AO2A 4M3ZA 3MEGA 1K6YA 2WONA 1RTHA 2AJQA 3F9KA 1EKEA 3OYFA 4N47A 1RBVA 1RTIA 1LAWA 3VQPA 3LZIA 1CXQA 2RKIA 5HRPA 3SZ2A 2XY6A 3SV4A 3CFPA 1VRTA 4CHPA 4CJTA 2X78A 1REVA 1NOYA 1W9HA 1J54A 4MQ3A 4CEQA 4DF4A 4FK2A 4CGJA 5CYQA 4B9TA 4CHQA 4CEAA 3SQ2A 4JS5A 4B9LA 3TAGA 2HHQA 4DSEA 3AVLA 4W5QA 2B6AA 2PYLA 1RT2A 3QEVA 1KVCA 3NHGA 4CK3A 1TVRA 3HM9A 4KHQA 1KFSA 4DG1A 4CCHA 1T03A 2D0AA 4B9VA 1KCFA 4HUFA 2BE2A 3P83D 1ZBLA 2OZMA 3AA2A 4FW2A 4LSLA 5HLFA 4FJLA 4KTWA 2Z1JA 4FJ8A 4CGFA 1FXXA 1RBSA 3UIQA 4KFBA 4M41A 4CEZA 3AO3A 4GW6A 5C25A 1WNSA 3RMAA 3PO4A 3SPZA 4F3TA 3NGYA 1S1UA 4BWJA 4CERA 4W5OA 3S9HA 1RDDA 3TWHA 3T3FA 4FJHA 3KD1E 1CZ9A 1UA0A 2YHAA 1I3AA 2OPRA 3C94A 1S1WA 3K5NA 4UQGA 3AVNA 4B8AB 4Z4FA 3TARA 3QEIA 4CIFA 1L5UA 1D5AA 4KTZA 1KTQA 1G15A 1HYVA 4E7LA 2RN2A 4WE1A 2VWJA 1IG9A 1D9FA 4IG3A 1KSPA 4BDPA 4KAZA 1BIUA 3OYJA 5FRNA 1JL1A 4DWIA 2O4GA 4DSLA 4EP5A 4B9SA 2LSNA 5KI6A 4CJ4A 3S3OA 1NK5A 2G8KA 4LH4A 1VSHA 1Z26A 4LH5A 4E7IA 2YHBA 4BE0A 4CEEA 3MAQA 3AO1A 3KLGA 1NK9A 1TKXA 2DFHA 3DLEA 3VA3A 1QHTA 2HVHA 4HUGA 1L3TA 4Z4CA 4YNQA 4AILC 3DOLA 3H08A 3D0PA 1I39A 1QSSA 3KLIA 4CHOA 4FJIA 3LWMA 4HUEA 1QSLA 4CECA 4DQRA 1T8EA 4FK4A 1IKXA 1BHLA 4N5SA 3BDPA 1HJRA 4Z0UA 3NE6A 3QEPA 1RNHA 1S5JA 4B08A 4ID1A 1UWBA 1VSKA 3C95A 4LSNA 5J2QA 4RW7A 3L2RA 3VQ8A 1RTJA 3JSMA 2FBTA 1BGXT 4K8ZA 3NH0A 1L3SA 1B9FA 3OYIA 1TV6A 1RBTA 3D45A 3QO9A 2VG7A 4IFVA 3SUNA 1BI4B 2KTQA 2FBXA 3NBPA 1S1TA 3C6UA 3ASMA 3LAKA 3ZT4A 2QKBA 2HVIA 4KPYA 2HHWA 4O5BA 4Z4EA 3NF6A 4CESA 4CFAA 1RT6A 2PY5A 2GV9A 4M42A 1A5XA 4M3YA 1SL2A 3SPYA 4IG0A 2HHUA 3AA5X 5HRSA 1ITGA 3SYZA 3OYLA 3DM2A 1ASUA 4EZ9A 3SQ4A 3KKRA 5KRTA 3O3GA 3ZSQA 1GOAA 1S6QA 3VQDA 1U45A 4CJRA 1N6QA 4IKFA 4G1QA 4XIUA 1Q9XA 2KZZA 3I0SA 3AA3A 3QLHA 1YTAA 3PX4A 1DTQA 1LW2A 4O0JA 4CJLA 3TAEA 3TI0A 4F2SA 3U3GA 4GVMA 4FM1A 3CFRA 3VQ4A 4F2RA 4DSIA 3M8QA 4NYNA 4K8XA 2QK9A 4CJWA 1NKCA 5KGWA 4RW8A 2RF2A 4BE2A 4DLEA 4C8MA 1EETA 2A1RA 2P5OA 1WSFA 2HB5A 4EZ6A 1NOZA 4OPKA 3KLFA 3RWUA 2Y1JA 2ZE2A 1CLQA 2VG5A 3V9ZA 4H8KA 2XRIA 1X9WA 1BQMA 1J9AA 1VSLA 2JGUA 3VQ9A 4AHUA 1ZBIA 4DTNA 4FM2A 4FZXC 3QETA 4PUOA 3DLGA 1Q9YA 1ZYQA 4E0DA 4AH9A 2X6SA 4KI4A 2HHVA 3L3VA 3TAQA 2ITGA 4IFYA 1ASWA 3JYTA 4E1NA 4FJ9A 2ZQBA 1SKSA 5C24A 3RMCA 2FC0A 4AHVA 4CF2A 3DI6A 1RT5A 3DLKA 4CJEA 3KIOA 5EU7A 2YNFA 3RRHA 3QERA 4DFMA 4KRFA 5HROA 4DSFA 1WAFA 3VQ5A 4DS4A 4ELVA 4KREA 3OS0A 1VSMA 2W42A 1FKPA 3VQEA 5KRSA 3OYCA 1KVAA 3PX6A 3TABA 3RRGA 1S6PA 4CJPA 3RR7A 1C1CA 4FZZA 4NYFA 3ISNC 4J2BA 3SQ0A 4RG8A 3V1RA 1ASVA 3B6OA 4OLAA 3LPTA 2F96A 4OKKA 1JKHA 4DTOA 1YTUA 2YNGA 3AO5A 2KQ2A 3QESA 4PWDA 3AVGA 1XHXA 3IG1A 3DOKA 1HQEA 5HBMA 2G8IA 4CIEA 3VQ6A 3MEDA 3ALYA 3ZSYA 3U6FA 4OKEA 4GMJB 2IS3A 3NCIA 3FFIA 2E4LA 5I3UA 1J5OA 4DSKA 3BGRA 3SV3A 3V6DA 4DF8A 4KHUA 3I8DA 1NKEA 4JS4A 2DTUA 1QTMA 4DTRA 3DLRA 1UAXA 4CGIA 3HPOA 3WNEA 1VSDA 4CHZA 3VQQA 2XO7A 3V4IA 1NJXA 3SUQA 1KRPA 3ZT3A 3KD5E 4KB1A 2D0BA 3SQ1A 4KHNA 1DLOA 1A5VA 3ZSWA 2WOMA 4OKJA 1L3VA 2G8VA 3PY8A 4JRQA 2G8HA 2OA8A 1WLJA 4IDKA 1KVBA 1R0AA 1D8YA 1EP4A 1WN7A 3HSTB 3ZSRA 5HRNA 1SKRA 4OJRA 3PO5A 1RT4A 1D9DA 1QS4A 1VSIA 4DMNA 1BIZA 3L2VA 4Q0BA 3G0ZA 3DRPA 3HPHA 4CJSA 2KW4A 4F8RA 1A5WA 1IH7A 3L2UA 4DTPA 1RDAA 1HPZA 2OPPA 2IC3A 3VQAA 4CEDA 1TKTA 3AVAA 3TANA 2HMIA 4FJ5A 4FK0A 3U3YA 2Z1GA 3EY1A 4HHTA 4CF8A 4FM0A 3VA0A 4R5PA 3KJVA 2BGGA 5FROA 4CGGA 1WSHA 1NK0A 1JLGA 4E7JA 2XY8A 1HNIA 3S3MA 3RMDA 2EHGA 1RDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYB A;  4DFJ A;  4F3O A;  3T1A A;  4ICL A;  2KZM A;  1HYS A;  4DFK A;  3VQ7 A;  4IBN A;  3RTV A;  4CF9 A;  4FCY A;  3THV A;  1U4B A;  2OPQ A;  3NFA A;  1SUQ A;  3P5J A;  3L3U A;  3HT3 A;  4RW6 A;  4BE1 A;  1NKB A;  3KLH A;  4CK2 A;  3CQ8 A;  4L8R B;  3E01 A;  3B6P A;  1DTT A;  4HVJ A;  2HHS A;  3HJF A;  3CM5 A;  4CFC A;  2QKK A;  1RIL A;  1QQC A;  1EXQ A;  1RT7 A;  4CF0 A;  2IOC A;  4CJU A;  1J53 A;  1X1P A;  3CG7 A;  3O3F A;  2YKM A;  4J2A A;  4CIG A;  3O3H A;  4FW1 A;  5FRM A;  5E41 A;  5I42 A;  3SI6 A;  4ELT A;  1SKW A;  3AO4 A;  1WSG A;  4KHS A;  1Q8I A;  3HXM A;  1LAV A;  3AVM A;  3HPG A;  3G10 A;  3MEE A;  3ZT0 A;  3SJJ A;  1WSE A;  3KKS A;  4DSJ A;  1N5Y A;  4HCC A;  3K5M A;  4ID5 A;  2X74 A;  2EX3 A;  2E6L A;  4Q5V A;  4DS5 A;  2FBV A;  4OGE A;  3TAF A;  2D5R A;  1VRU A;  1NK4 A;  4CJK A;  2RPI A;  2HHT A;  1C1B A;  4NCB A;  4M3X A;  3OJS A;  1IO2 A;  1XC9 A;  1NJW A;  1TGO A;  1BL3 A;  5KTQ A;  2F8S A;  1ZBF A;  3K57 A;  5J1E A;  4FLX A;  4KB0 A;  3V9X A;  4KHY A;  4BDZ A;  4DTS A;  5SZT A;  4N76 A;  2O4I A;  3K58 A;  4H4O A;  1RDB A;  2Q3S A;  3WNF A;  5CY4 A;  3OYE A;  3OVN A;  3DRR A;  3AVC A;  4M3T A;  1RBU A;  3CFO A;  5DK5 A;  3OYG A;  3LP2 A;  1YT3 A;  3LP0 A;  1TL1 A;  2YKN A;  3K5O A;  1RTD A;  4C8L A;  1JLB A;  4CE9 A;  2YV0 X;  2VWK A;  4CHY A;  3RMB A;  3L2Q A;  5J2P A;  3L2W A;  2Z1I A;  4FVM A;  4Y1C A;  4OPJ A;  1SL1 A;  4LY7 A;  3SCX A;  4B9U A;  2HNY A;  2P5G A;  4FJG A;  1BI4 A;  1QSY A;  1B92 A;  1T7P A;  4B3O A;  3A2F A;  4CEB A;  4PY5 A;  1GOB A;  3ZSO A;  2F8T A;  1X9M A;  3KLE A;  3KK3 A;  4KV8 A;  4N56 A;  3TR8 A;  3ZT2 A;  4DLG A;  4KHW A;  1RT3 A;  4O0I A;  1JXB A;  4FLY A;  3LAN A;  2I5J A;  1CZB A;  4CFD A;  4KKO A;  3OS1 A;  4E19 A;  4B8C A;  1XWL A;  1ZBH A;  5FDL A;  4E89 A;  1XHZ A;  3PX0 A;  4I2Q A;  2HHX A;  4CJF A;  4DQI A;  3V9U A;  5J2M A;  1C0T A;  2ZD1 A;  1JLA A;  2XY7 A;  1SL0 A;  1C0U A;  1KLM A;  1GOC A;  4Y1D A;  2B5J A;  5JS2 A;  1BCM A;  1VSJ A;  4ELU A;  3V1O A;  4HCB A;  1L3U A;  4AHS A;  3PV8 A;  2VG6 A;  3AA4 A;  1W0H A;  3EZ5 A;  4W5R A;  4I2P A;  4DU1 A;  1T05 A;  1UA1 A;  4MFB A;  1IKY A;  1WSJ A;  3HL8 A;  1NK6 A;  4DQP A;  3ZSZ A;  1F21 A;  4Z4H A;  3SUP A;  2PYJ A;  3ZCM A;  4NCG A;  3WNH A;  3HP6 A;  1FK9 A;  1LWF A;  4HTU A;  3SUO A;  3OYH A;  3HYF A;  2ATQ A;  1LWC A;  4BAC A;  2YNH A;  2OYQ A;  1LW0 A;  4DTU A;  1S1V A;  4FJK A;  3OYA A;  4FLU A;  3CYM A;  1FKO A;  1VSF A;  2NUB A;  1TAU A;  2BAN A;  1TL3 A;  4TSX A;  4E7K A;  4FLW A;  4DFP A;  4O55 A;  2JLE A;  1WSI A;  1JXE A;  2GUI A;  2R7Y A;  4I9Q A;  2B4J A;  4CEF A;  3MXJ A;  3V9S A;  2IDO A;  3ZSX A;  1C6V A;  3LAL A;  1U48 A;  1B9D A;  4M3U A;  3OYK A;  3IAY A;  4FLZ A;  1BQN A;  2IAJ A;  3M8P A;  1TK5 A;  4FJJ A;  2PZS A;  3T19 A;  3AVJ A;  3LWL A;  3MXI A;  3S3N A;  4AHC A;  2HW3 A;  1VK0 A;  5HRR A;  5C42 A;  4BDY A;  4QOZ B;  3VN5 A;  4ZTF A;  3DRS A;  4W5T A;  3K5L A;  2OPS A;  3DYA A;  4OGC A;  4CEO A;  3SNN A;  3MXM A;  1JL2 A;  4C8K A;  4I9L A;  1TKZ A;  1EX4 A;  2HNZ A;  3QEX A;  5SWM A;  3TAP A;  3K2P A;  5KGX A;  4Z4I A;  4EP4 A;  3QIP A;  3NH1 A;  4CJ5 A;  1JLF A;  4JRP A;  3KK2 A;  4PA1 A;  3TAM A;  4FLV A;  1NJZ A;  5CYM A;  4CHN A;  3CM6 A;  1Y97 A;  1HYZ A;  1U47 A;  1HQU A;  3V9W A;  4CJ3 A;  4DTJ A;  5T7B A;  3F73 A;  3HP9 A;  1MU2 A;  1U49 A;  1NJY A;  4E3S A;  4M3W A;  3C6T A;  1TK8 A;  4KI6 A;  3ZT1 A;  3NGZ A;  4DQQ A;  4H4M A;  3RR8 A;  2YNI A;  3OS2 A;  4FXD A;  3NF7 A;  4J2D A;  3HO1 A;  4C8O A;  2KFN A;  3AVB A;  3OYN A;  4ZHR A;  2FBY A;  2QXF A;  3QIO A;  1YVU A;  3QNN A;  3ITH A;  4JLH A;  4CGD A;  4E1M A;  3QNO A;  2XY5 A;  3ZSV A;  2P51 A;  3NH2 A;  3ULD A;  4FJN A;  1O1W A;  2IGI A;  3MEC A;  5K14 A;  3OY9 A;  4J2E A;  4DTM A;  4YFU A;  5CZ2 A;  3NGI A;  4DU4 A;  1QE1 A;  4I7F A;  5DMR A;  3OJU A;  1S9G A;  4B9N A;  4FJ7 A;  4CGH A;  1S1X A;  4CFB A;  4B9M A;  1BCO A;  1SV5 A;  1VSE A;  3AVK A;  3EYZ A;  1XI1 A;  2E6M A;  1HRH A;  2Y1I A;  4O4G A;  1KFD A;  1S9E A;  3AVI A;  1TAQ A;  2P1J A;  3VQB A;  4OVL A;  3NAE A;  1X9S A;  2G8F A;  3DLB A;  1RBR A;  1WAJ A;  3LPU A;  1JLC A;  3L8B A;  4FLT A;  4CJQ A;  4O44 A;  4KO0 A;  4KTQ A;  4M45 A;  1TKD A;  4M3R A;  2OZS A;  1UOC A;  4LD0 A;  4CF1 A;  1KLN A;  4PQU A;  1RT1 A;  3P1G A;  3WNG A;  1JLE A;  1LV5 A;  4AHT A;  3HK2 A;  2KFZ A;  3O4N A;  3OYD A;  3HVT A;  4DQS A;  5J2N A;  1Z25 A;  3LZJ A;  4C8N A;  2DFE A;  3V1Q A;  4E7H A;  3I0R A;  3AV9 A;  3IRX A;  1CXU A;  4RW9 A;  3IS9 A;  2A1S A;  3HVR A;  1U04 A;  1NK7 A;  4F4K A;  1ZBU A;  4CJV A;  4DU3 A;  3K59 A;  4Z4G A;  3VQC A;  2D0C A;  1RCH A;  3O4Q A;  4NCA A;  4OLB A;  4RW4 A;  2Z1H A;  1HNV A;  3LP3 A;  2G8U A;  2XHB A;  3DLH A;  4FZY A;  5D3G A;  4FYD A;  3NF8 A;  3PUF A;  3M8S A;  5CZ1 A;  1IKW A;  4AHR A;  4DTX A;  4ZTJ A;  4FJX A;  4CK1 A;  2BDP A;  3DMJ A;  1HMV A;  1LWE A;  3NF9 A;  3KTQ A;  2DFF A;  3LP1 A;  3QIN A;  3V81 A;  3QEW A;  3KK1 A;  1JLQ A;  2ETJ A;  2X6N A;  3LDS A;  1BIS A;  4N41 A;  1C1A A;  1NK8 A;  2G8W A;  3M8R A;  3NDK A;  4QCL A;  2GBZ A;  3LAM A;  4FJM A;  5JS1 A;  1C0M A;  3AVH A;  4W5N A;  3AVF A;  2HND A;  1TK0 A;  2DY4 A;  4QAG A;  1IKV A;  4BWM A;  3OYM A;  5HP1 A;  3AO2 A;  4M3Z A;  3MEG A;  1K6Y A;  2WON A;  1RTH A;  2AJQ A;  3F9K A;  1EKE A;  3OYF A;  4N47 A;  1RBV A;  1RTI A;  1LAW A;  3VQP A;  3LZI A;  1CXQ A;  2RKI A;  5HRP A;  3SZ2 A;  2XY6 A;  3SV4 A;  3CFP A;  1VRT A;  4CHP A;  4CJT A;  2X78 A;  1REV A;  1NOY A;  1W9H A;  1J54 A;  4MQ3 A;  4CEQ A;  4DF4 A;  4FK2 A;  4CGJ A;  5CYQ A;  4B9T A;  4CHQ A;  4CEA A;  3SQ2 A;  4JS5 A;  4B9L A;  3TAG A;  2HHQ A;  4DSE A;  3AVL A;  4W5Q A;  2B6A A;  2PYL A;  1RT2 A;  3QEV A;  1KVC A;  3NHG A;  4CK3 A;  1TVR A;  3HM9 A;  4KHQ A;  1KFS A;  4DG1 A;  4CCH A;  1T03 A;  2D0A A;  4B9V A;  1KCF A;  4HUF A;  2BE2 A;  3P83 D;  1ZBL A;  2OZM A;  3AA2 A;  4FW2 A;  4LSL A;  5HLF A;  4FJL A;  4KTW A;  2Z1J A;  4FJ8 A;  4CGF A;  1FXX A;  1RBS A;  3UIQ A;  4KFB A;  4M41 A;  4CEZ A;  3AO3 A;  4GW6 A;  5C25 A;  1WNS A;  3RMA A;  3PO4 A;  3SPZ A;  4F3T A;  3NGY A;  1S1U A;  4BWJ A;  4CER A;  4W5O A;  3S9H A;  1RDD A;  3TWH A;  3T3F A;  4FJH A;  3KD1 E;  1CZ9 A;  1UA0 A;  2YHA A;  1I3A A;  2OPR A;  3C94 A;  1S1W A;  3K5N A;  4UQG A;  3AVN A;  4B8A B;  4Z4F A;  3TAR A;  3QEI A;  4CIF A;  1L5U A;  1D5A A;  4KTZ A;  1KTQ A;  1G15 A;  1HYV A;  4E7L A;  2RN2 A;  4WE1 A;  2VWJ A;  1IG9 A;  1D9F A;  4IG3 A;  1KSP A;  4BDP A;  4KAZ A;  1BIU A;  3OYJ A;  5FRN A;  1JL1 A;  4DWI A;  2O4G A;  4DSL A;  4EP5 A;  4B9S A;  2LSN A;  5KI6 A;  4CJ4 A;  3S3O A;  1NK5 A;  2G8K A;  4LH4 A;  1VSH A;  1Z26 A;  4LH5 A;  4E7I A;  2YHB A;  4BE0 A;  4CEE A;  3MAQ A;  3AO1 A;  3KLG A;  1NK9 A;  1TKX A;  2DFH A;  3DLE A;  3VA3 A;  1QHT A;  2HVH A;  4HUG A;  1L3T A;  4Z4C A;  4YNQ A;  4AIL C;  3DOL A;  3H08 A;  3D0P A;  1I39 A;  1QSS A;  3KLI A;  4CHO A;  4FJI A;  3LWM A;  4HUE A;  1QSL A;  4CEC A;  4DQR A;  1T8E A;  4FK4 A;  1IKX A;  1BHL A;  4N5S A;  3BDP A;  1HJR A;  4Z0U A;  3NE6 A;  3QEP A;  1RNH A;  1S5J A;  4B08 A;  4ID1 A;  1UWB A;  1VSK A;  3C95 A;  4LSN A;  5J2Q A;  4RW7 A;  3L2R A;  3VQ8 A;  1RTJ A;  3JSM A;  2FBT A;  1BGX T;  4K8Z A;  3NH0 A;  1L3S A;  1B9F A;  3OYI A;  1TV6 A;  1RBT A;  3D45 A;  3QO9 A;  2VG7 A;  4IFV A;  3SUN A;  1BI4 B;  2KTQ A;  2FBX A;  3NBP A;  1S1T A;  3C6U A;  3ASM A;  3LAK A;  3ZT4 A;  2QKB A;  2HVI A;  4KPY A;  2HHW A;  4O5B A;  4Z4E A;  3NF6 A;  4CES A;  4CFA A;  1RT6 A;  2PY5 A;  2GV9 A;  4M42 A;  1A5X A;  4M3Y A;  1SL2 A;  3SPY A;  4IG0 A;  2HHU A;  3AA5 X;  5HRS A;  1ITG A;  3SYZ A;  3OYL A;  3DM2 A;  1ASU A;  4EZ9 A;  3SQ4 A;  3KKR A;  5KRT A;  3O3G A;  3ZSQ A;  1GOA A;  1S6Q A;  3VQD A;  1U45 A;  4CJR A;  1N6Q A;  4IKF A;  4G1Q A;  4XIU A;  1Q9X A;  2KZZ A;  3I0S A;  3AA3 A;  3QLH A;  1YTA A;  3PX4 A;  1DTQ A;  1LW2 A;  4O0J A;  4CJL A;  3TAE A;  3TI0 A;  4F2S A;  3U3G A;  4GVM A;  4FM1 A;  3CFR A;  3VQ4 A;  4F2R A;  4DSI A;  3M8Q A;  4NYN A;  4K8X A;  2QK9 A;  4CJW A;  1NKC A;  5KGW A;  4RW8 A;  2RF2 A;  4BE2 A;  4DLE A;  4C8M A;  1EET A;  2A1R A;  2P5O A;  1WSF A;  2HB5 A;  4EZ6 A;  1NOZ A;  4OPK A;  3KLF A;  3RWU A;  2Y1J A;  2ZE2 A;  1CLQ A;  2VG5 A;  3V9Z A;  4H8K A;  2XRI A;  1X9W A;  1BQM A;  1J9A A;  1VSL A;  2JGU A;  3VQ9 A;  4AHU A;  1ZBI A;  4DTN A;  4FM2 A;  4FZX C;  3QET A;  4PUO A;  3DLG A;  1Q9Y A;  1ZYQ A;  4E0D A;  4AH9 A;  2X6S A;  4KI4 A;  2HHV A;  3L3V A;  3TAQ A;  2ITG A;  4IFY A;  1ASW A;  3JYT A;  4E1N A;  4FJ9 A;  2ZQB A;  1SKS A;  5C24 A;  3RMC A;  2FC0 A;  4AHV A;  4CF2 A;  3DI6 A;  1RT5 A;  3DLK A;  4CJE A;  3KIO A;  5EU7 A;  2YNF A;  3RRH A;  3QER A;  4DFM A;  4KRF A;  5HRO A;  4DSF A;  1WAF A;  3VQ5 A;  4DS4 A;  4ELV A;  4KRE A;  3OS0 A;  1VSM A;  2W42 A;  1FKP A;  3VQE A;  5KRS A;  3OYC A;  1KVA A;  3PX6 A;  3TAB A;  3RRG A;  1S6P A;  4CJP A;  3RR7 A;  1C1C A;  4FZZ A;  4NYF A;  3ISN C;  4J2B A;  3SQ0 A;  4RG8 A;  3V1R A;  1ASV A;  3B6O A;  4OLA A;  3LPT A;  2F96 A;  4OKK A;  1JKH A;  4DTO A;  1YTU A;  2YNG A;  3AO5 A;  2KQ2 A;  3QES A;  4PWD A;  3AVG A;  1XHX A;  3IG1 A;  3DOK A;  1HQE A;  5HBM A;  2G8I A;  4CIE A;  3VQ6 A;  3MED A;  3ALY A;  3ZSY A;  3U6F A;  4OKE A;  4GMJ B;  2IS3 A;  3NCI A;  3FFI A;  2E4L A;  5I3U A;  1J5O A;  4DSK A;  3BGR A;  3SV3 A;  3V6D A;  4DF8 A;  4KHU A;  3I8D A;  1NKE A;  4JS4 A;  2DTU A;  1QTM A;  4DTR A;  3DLR A;  1UAX A;  4CGI A;  3HPO A;  3WNE A;  1VSD A;  4CHZ A;  3VQQ A;  2XO7 A;  3V4I A;  1NJX A;  3SUQ A;  1KRP A;  3ZT3 A;  3KD5 E;  4KB1 A;  2D0B A;  3SQ1 A;  4KHN A;  1DLO A;  1A5V A;  3ZSW A;  2WOM A;  4OKJ A;  1L3V A;  2G8V A;  3PY8 A;  4JRQ A;  2G8H A;  2OA8 A;  1WLJ A;  4IDK A;  1KVB A;  1R0A A;  1D8Y A;  1EP4 A;  1WN7 A;  3HST B;  3ZSR A;  5HRN A;  1SKR A;  4OJR A;  3PO5 A;  1RT4 A;  1D9D A;  1QS4 A;  1VSI A;  4DMN A;  1BIZ A;  3L2V A;  4Q0B A;  3G0Z A;  3DRP A;  3HPH A;  4CJS A;  2KW4 A;  4F8R A;  1A5W A;  1IH7 A;  3L2U A;  4DTP A;  1RDA A;  1HPZ A;  2OPP A;  2IC3 A;  3VQA A;  4CED A;  1TKT A;  3AVA A;  3TAN A;  2HMI A;  4FJ5 A;  4FK0 A;  3U3Y A;  2Z1G A;  3EY1 A;  4HHT A;  4CF8 A;  4FM0 A;  3VA0 A;  4R5P A;  3KJV A;  2BGG A;  5FRO A;  4CGG A;  1WSH A;  1NK0 A;  1JLG A;  4E7J A;  2XY8 A;  1HNI A;  3S3M A;  3RMD A;  2EHG A;  1RDC A; 
#chains in the Genus database with same CATH topology
 4F3O A;  3CET A;  4XH4 A;  4FWK A;  4MO4 A;  1GLJ O;  3PIO L;  2GEM A;  4CF9 A;  3THV A;  4JI3 K;  4O8U A;  3TTD A;  3TU5 A;  2HHS A;  3CM5 A;  3CIP A;  1EXQ A;  4CF0 A;  1J53 A;  1RDU A;  2E1Y A;  1NGA A;  3SI6 A;  3MN9 A;  4ELT A;  1SKW A;  3AO4 A;  1WSG A;  4KHS A;  3AVM A;  3MEE A;  3G10 A;  3ZT0 A;  1E4F T;  3SJJ A;  5HOO A;  2JWK A;  4A2A A;  2X74 A;  3O08 A;  2FBV A;  4OGE A;  2WC9 A;  2QI2 A;  4MO5 A;  1NK4 A;  1BO5 O;  4M3X A;  3OJS A;  1IO2 A;  1XC9 A;  1FW6 A;  4IJA A;  2AP1 A;  4KHY A;  1HNX K;  4N76 A;  1MA9 B;  1RDB A;  2FSJ A;  4M3T A;  1ESV A;  4A59 A;  3A5M C;  3WXJ A;  3K5O A;  4CE9 A;  3L2Q A;  3WXM B;  4BRI A;  3TSU A;  3LM2 A;  2NRW A;  1GOB A;  3D7E O;  1DEJ A;  1X9M A;  3Q7B A;  3KK3 A;  4KV8 A;  2W41 A;  3BUZ B;  5M1F A;  5IT9 O;  1JXB A;  2I5J A;  4B8C A;  4FWO A;  1XHZ A;  3ZEU B;  1XMQ K;  4DQI A;  2HHX A;  1E3M A;  3VGK A;  3V9U A;  2XY7 A;  1HLU A;  1SL0 A;  1KLM A;  1S3X A;  1VSJ A;  3V1O A;  4HCB A;  1L3U A;  4BRC A;  4AHS A;  1SAZ A;  4A5B A;  3EZ5 A;  1T05 A;  1NK6 A;  1WSJ A;  3VEW A;  5LY3 A;  2QWP A;  1HR0 K;  4PKI A;  4NCG A;  2D0P A;  3HP6 A;  1FK9 A;  3HYF A;  2ATQ A;  1LWC A;  3E9L A;  5KQD A;  4DTU A;  2VQE K;  1NM1 A;  2QEX N;  3T69 A;  3CYM A;  1TL3 A;  4FLW A;  2JLE A;  4JHD A;  2GUI A;  1WBB A;  3VTH A;  1KXP A;  3W3D A;  3C6H A;  1C6V A;  1U48 A;  4U7B A;  2NRX A;  4FWQ A;  4IZ9 A;  3IAY A;  3AVJ A;  3LWL A;  1GLF O;  5DM7 L;  1NMD A;  3CJ9 A;  3VN5 A;  2V51 B;  3DRS A;  4W5T A;  2OPS A;  4CEO A;  1JL2 A;  4KH4 A;  1YF5 L;  3DXK B;  5KGX A;  1NGJ A;  3OHR A;  4Z4I A;  4EP4 A;  4CJ5 A;  1J5E K;  1NJZ A;  3TAM A;  4CHN A;  4H0T B;  3BF3 A;  3LDQ A;  5JLF A;  3PSF A;  5T7B A;  1MU2 A;  1NJY A;  3VF2 A;  2AA4 A;  3MX2 A;  4E3S A;  4X64 K;  3C6T A;  4KI6 A;  4H4M A;  3CCR N;  4BC5 A;  2QW9 A;  3NF7 A;  3HO1 A;  3AVB A;  3ENO A;  3I55 N;  1YVU A;  5FPM A;  4CGD A;  3QNN A;  2XY5 A;  4DV5 K;  4YHH K;  2P51 A;  3NH2 A;  1O1W A;  3MEC A;  4PKH A;  5K14 A;  4DTM A;  4YFU A;  5CZ2 A;  5M1Q A;  4CGH A;  4A5A A;  4B9M A;  1BCO A;  5C12 A;  1VSE A;  3AVI A;  4DKW A;  5AZI B;  1JLC A;  2YHY A;  4JKA A;  2VGM A;  1KD1 O;  1BOT O;  2P9L B;  1TKD A;  2OZS A;  4JEP A;  1C0F A;  4LD0 A;  2KFZ A;  5I9E B;  1HNW K;  4H5W A;  5AQK A;  3LZJ A;  2DFE A;  4E7H A;  4BR9 A;  3CJ1 A;  1CXU A;  1GLA G;  4F4K A;  4CJV A;  4DU3 A;  3K59 A;  4Z4G A;  1RCH A;  4NCA A;  3D2F B;  2G8U A;  2XHB A;  3DLH A;  3NF8 A;  1IKW A;  3DMJ A;  3J8A A;  3KTQ A;  3CCM N;  3QIN A;  4N41 A;  1BIS A;  3WXK A;  1NK8 A;  2G8W A;  3M8R A;  2O8F A;  2O8D B;  2P9P B;  3HOT A;  4GV9 A;  2DY4 A;  3VPZ A;  3WQU A;  3AO2 A;  4FWR A;  1K6Y A;  3LDL A;  3OYF A;  4BR2 A;  4IFE A;  1CXQ A;  2V7Y A;  3O9S A;  4JK9 A;  3CFP A;  4LF7 K;  1REV A;  4BG9 A;  4CHQ A;  4JS5 A;  4B9L A;  3KWG A;  4DSE A;  3AVL A;  1EWR A;  5AQT A;  1KVC A;  2QWL A;  4KHQ A;  4DG1 A;  2WTU A;  4ILH A;  3CC7 N;  4B9V A;  4HUF A;  2BE2 A;  3P83 D;  3C6A A;  3EE8 A;  4FW2 A;  3G71 N;  5HLF A;  4BR5 A;  4CVN E;  1QHA A;  1FXX A;  1O13 A;  1RBS A;  4KFB A;  3UIQ A;  2VYP A;  4BRG A;  5H1S Q;  3RMA A;  4MLH A;  3NGY A;  4CER A;  3S9H A;  3HI0 A;  3TWH A;  5AQW A;  4FJH A;  2QWQ A;  1CZ9 A;  1I3A A;  3C94 A;  2GEL A;  3K5N A;  1KAX A;  4UQG A;  4B3M K;  4CIF A;  4HWI A;  1L5U A;  4WF9 L;  4KTZ A;  3J81 O;  1G15 A;  4PHT X;  2RN2 A;  5DM6 L;  5C2D A;  2VWJ A;  4KAZ A;  1BIU A;  3OYJ A;  1JL1 A;  4EP5 A;  1HX1 A;  2LSN A;  5KI6 A;  3S3O A;  4NXN K;  3R1X A;  4CD3 A;  2QTD A;  1VSH A;  3E1Y A;  4BE0 A;  1YJW N;  4C1N I;  4LFB K;  4HUG A;  1L3T A;  4Z4C A;  4DV7 K;  2HBK A;  3H08 A;  1QSS A;  3MCP A;  4XH5 A;  5EY4 A;  3LWM A;  1T8E A;  4FK4 A;  3BDP A;  4Z0U A;  4DUZ K;  5F1X A;  1RNH A;  2FF6 A;  4ID1 A;  4YY3 K;  5J2Q A;  5KPZ A;  4NXM K;  5LMN K;  1BGX T;  1L3S A;  3C0B A;  2UXD K;  3QO9 A;  1X3M A;  3SUN A;  4IFV A;  1GLB G;  1BI4 B;  5BPL A;  2KTQ A;  2W6L A;  2FBX A;  1RGI A;  3LAK A;  2QKB A;  3A5N C;  4Z4E A;  3NF6 A;  2PY5 A;  1RT6 A;  2GV9 A;  3VMF B;  4M42 A;  4LF4 K;  2QWM A;  4FWS A;  4BGB A;  4DV1 K;  3SPY A;  4IG0 A;  3OYL A;  2HHH K;  3EZW A;  3O5B A;  3ZSQ A;  4BR0 A;  3VF6 A;  2P9K A;  2KZZ A;  2O8B A;  3AA3 A;  2GTD A;  4CJL A;  3TAE A;  3OBY A;  3M6G A;  4GVM A;  4PL8 A;  5AR0 A;  3ULE A;  3GBT A;  4CJW A;  1NKC A;  2W6K A;  5KGW A;  4DLE A;  2RF2 A;  2P5O A;  1NOZ A;  3KLF A;  2Y1J A;  2VG5 A;  1IV0 A;  1ZBI A;  4DTN A;  3QET A;  1ZYQ A;  4AH9 A;  1ASW A;  3JYT A;  4E1N A;  2E1Z A;  3T1Y K;  5C24 A;  1YUW A;  4CF2 A;  1WOQ A;  3DI6 A;  3EN9 A;  2CGK A;  3DLK A;  5AQY A;  3RRH A;  2YX6 A;  3CF5 L;  1VSM A;  2W42 A;  3TAB A;  1KVA A;  2ZGY A;  3RR7 A;  4FZZ A;  4JHD B;  3C65 A;  4JI4 K;  4GKK K;  1M1K O;  3J7Y P;  3MN5 A;  1YTU A;  5AQS A;  5AQH A;  1YAG A;  3QFU A;  3QES A;  4PWD A;  1VQ7 N;  5BPN A;  3VQ6 A;  3U6F A;  4OKE A;  4GMJ B;  4DF8 A;  2UUB K;  3MK6 A;  4JK7 A;  4JS4 A;  3KWI A;  4CD1 A;  1GLC G;  4DV2 K;  3HPO A;  3WNE A;  3MCA B;  3VQQ A;  3SUQ A;  3ZT3 A;  5BPM A;  3KZB A;  3ZSW A;  4OKJ A;  4JRQ A;  3RSE A;  1D8Y A;  2BH1 A;  3OW2 M;  1WN7 A;  1SKR A;  3PO5 A;  1D9D A;  4B1Z A;  3GDQ A;  3DRP A;  5BN8 A;  3HPH A;  1A5W A;  3IDH A;  1IH7 A;  3L2U A;  4GVE A;  1HPZ A;  2IC3 A;  1KAZ A;  3VQA A;  4H5N A;  2Z1G A;  3O1B A;  5AZJ A;  3FE1 A;  5AQI A;  3SV3 A;  3VA3 A;  2A3Z A;  3T1A A;  2KZM A;  1HYS A;  4NB4 A;  4DFK A;  1IBM K;  3VQ7 A;  4IBN A;  4FCY A;  4CZF A;  3P5J A;  1NKB A;  3KLH A;  3CQ8 A;  3E01 A;  3GL1 A;  3IUC A;  3B6P A;  5AQJ A;  3SAF A;  3HJF A;  3D2F A;  4DB3 A;  2QKK A;  4CJU A;  3HTV A;  3CG7 A;  3O3F A;  5JVG L;  4CIG A;  3O3H A;  3VES A;  2ZJQ L;  2Q0R A;  3F5T A;  3TSQ A;  4K41 A;  3KKS A;  2P9N B;  4ID5 A;  3I8B A;  3HSC A;  5EOY A;  1VRU A;  4FSV A;  4CJK A;  3SLC A;  5AQO A;  4NCB A;  3ZET B;  1W7A A;  1BL3 A;  2F8S A;  3K57 A;  4FLX A;  3A0I X;  2O4I A;  4DHY A;  3SK3 A;  3OYE A;  3OVN A;  3K0S A;  3CFO A;  1YT3 A;  3LP0 A;  4C8L A;  1U2V B;  1JLB A;  1N34 K;  4JK8 A;  3RMB A;  3SAH A;  1SL1 A;  4JNE A;  2P5G A;  4FJG A;  1QSY A;  4OPA A;  5TKW A;  4YOT A;  3WQT A;  4N56 A;  3R9P A;  3TR8 A;  4DLG A;  1NJI O;  1V4T A;  4CBX A;  4CZG A;  4JI6 K;  3LAN A;  5AQX A;  3PX0 A;  1KC8 O;  4JKF A;  4H0Y B;  1C0T A;  2OCE A;  4BVP A;  3JXU A;  4AM6 A;  1NGC A;  3VGL A;  4QS8 A;  1GOC A;  2B5J A;  5JS2 A;  1BCM A;  3BY5 A;  3PV8 A;  3AA4 A;  2CGL A;  3N4P A;  4I2P A;  4MFB A;  1IKY A;  3HL8 A;  1KQS M;  4IWV A;  4Z4H A;  3SUP A;  3JS6 A;  4NLC A;  3OYH A;  1NGB A;  1SQK A;  2YNH A;  2O8D A;  4FLU A;  4CZJ A;  1FKO A;  1VSF A;  2NUB A;  1VQO N;  2BAN A;  4TSX A;  2NRZ A;  1TAU A;  1YI2 N;  1N36 K;  4B3S K;  1YIJ N;  4O55 A;  2R7Y A;  1BA1 A;  2B4J A;  3VET A;  3MXJ A;  4WQ4 C;  5AZJ B;  2DPN A;  3DJC A;  1B9D A;  3OYK A;  4FLZ A;  3M8P A;  2IAJ A;  2PZS A;  3O8M A;  3S3N A;  3ZX0 A;  4AHC A;  2HW3 A;  1IG8 A;  5C0Y A;  4BC3 A;  4C1N K;  2P9U B;  3UKR A;  4LF6 K;  2YCH A;  1W2B M;  3DYA A;  4BRL A;  4CBU A;  3MXM A;  5LJW A;  3FZM A;  4I9L A;  4C8K A;  1TKZ A;  1ATS A;  3TAP A;  3K2P A;  2NNW A;  3CPE A;  3HOS A;  1JCG A;  4PA1 A;  3VEZ A;  3M3Z A;  3CM6 A;  1Y97 A;  3MN7 A;  3RVC A;  2A40 A;  1HQU A;  3F73 A;  1X3N A;  2F7T A;  1VQ4 N;  3ZT1 A;  3NGZ A;  4DQQ A;  2YNI A;  4FXD A;  1Q86 O;  4J2D A;  3AAP A;  3UKR B;  4JKH A;  3QIO A;  3ITH A;  4JLH A;  3QNO A;  4X66 K;  3U4L A;  2KHO A;  4JI2 K;  2P9P A;  3ULD A;  1N32 K;  3OA9 A;  4PL7 A;  3OY9 A;  4J2E A;  1QE1 A;  3OJU A;  4FJ7 A;  5BN9 A;  4QS9 A;  1X9S A;  1TAQ A;  2P1J A;  2G8F A;  1XNR K;  3LPU A;  3CER A;  2YJE A;  4GNI A;  4KO0 A;  4M45 A;  2W40 A;  3M1F A;  4M3R A;  5AQF A;  4PQU A;  3WNG A;  3P1G A;  3HK2 A;  1BUP A;  3O80 A;  1XUP O;  3V1Q A;  3I0R A;  3AV9 A;  4YOU A;  3LDN A;  4RW9 A;  3HVR A;  4G9Z A;  1ZBU A;  4DR4 K;  3O4Q A;  2Z1H A;  2ZGZ A;  5TKY A;  4FZY A;  4FYD A;  4BR7 A;  3PUF A;  4AHR A;  1HPM A;  1EQY A;  4IO8 A;  4WQ5 C;  2O8C A;  3LP1 A;  3V81 A;  3J80 O;  3KK1 A;  1JLQ A;  4BRK A;  2Q2R A;  3LAM A;  5JS1 A;  1C0M A;  3AVH A;  2HND A;  5HP1 A;  1Z05 A;  2HF4 A;  3MEG A;  3F9K A;  1RBV A;  1RTI A;  1LAW A;  1ATN A;  3VQP A;  1QVG M;  3LZI A;  2XY6 A;  3SZ2 A;  3SV4 A;  4CHP A;  2X78 A;  1W9H A;  3MN6 A;  1P90 A;  1NGI A;  3LDO A;  3MDQ A;  2HHQ A;  2B6A A;  2PYL A;  3QEV A;  3NHG A;  4DR2 K;  2QWN A;  4QS7 A;  3UE5 A;  2D0A A;  1K8K B;  1ZBL A;  3VEV A;  5E26 A;  5BR8 K;  4FJL A;  4KTW A;  2CGJ A;  2Z1J A;  3LDP A;  1RDD A;  2YHW A;  2YHA A;  2NLX A;  1HUX A;  5AQR A;  3AVN A;  4B8A B;  4JI1 K;  1KTQ A;  4BQL A;  2UXC K;  1D9F A;  4IG3 A;  3AGR A;  5M1P A;  4DWI A;  3CCL N;  4DSL A;  4ILG B;  4CJ4 A;  1NK5 A;  3DXM B;  1Z26 A;  5FLX O;  4E7I A;  3KLG A;  1NK9 A;  2DFH A;  4JKB A;  4NLB A;  1I39 A;  4CHO A;  4CZE A;  5AQL A;  4FJI A;  3RSE B;  4HUE A;  4CEC A;  4BR4 A;  1TYQ A;  1BHL A;  1HJR A;  2UYT A;  3QEP A;  3WUH A;  4B08 A;  3C95 A;  2FBT A;  5KPT A;  4K8Z A;  3OYI A;  3D45 A;  3VF4 A;  2V7Z A;  5BRH A;  2HHW A;  3R6M A;  4O5B A;  2UXB K;  4CFA A;  1OH8 A;  2HF3 A;  4Y0W A;  4DCH A;  4WQ5 A;  4YOR A;  2HMP A;  1SL2 A;  2ITM A;  3AA5 X;  1ITG A;  3SYZ A;  5GIP A;  3EEQ A;  4FO0 A;  5LMU K;  3O3G A;  4CZK A;  4K0K K;  3VQD A;  4CJR A;  4G1Q A;  2IIR A;  3QLH A;  1NG9 A;  1NLV A;  3PX4 A;  3U3G A;  4EHT A;  4FM1 A;  3CFR A;  5JIC A;  4YDU A;  3L4Q A;  4EIA A;  4C8M A;  2A1R A;  1WSF A;  2HB5 A;  4OPK A;  1XNQ K;  2XRI A;  5M1N A;  2ASO A;  4FM2 A;  4CBW A;  5AQZ A;  1Q9Y A;  1Z6R A;  4KI4 A;  3L3V A;  3TAQ A;  3HBT A;  4IFY A;  4DV6 K;  3RMC A;  2FC0 A;  2IVP A;  1NBW A;  5EU7 A;  3FZH A;  4DFM A;  4DSF A;  1WAF A;  4DS4 A;  3QML A;  1HKG A;  4WYB A;  3VQE A;  5KRS A;  5C15 A;  2ZM6 K;  3RRG A;  4NYF A;  4J2B A;  3B6O A;  4OKK A;  1JKH A;  4DTO A;  3AVG A;  2GX9 A;  2P9S B;  5HBM A;  2G8I A;  3R3L A;  4CIE A;  1YJ9 N;  1QVF M;  2H3G X;  2ASP A;  2YJF A;  4B1X B;  3FFI A;  2E4L A;  5I3U A;  4CZH A;  3BGR A;  3V6D A;  4B9Q A;  3H3O B;  1NKE A;  5A2Q O;  2DTU A;  5EXW A;  4DTR A;  1UAX A;  1YVN A;  2XO7 A;  4YOX A;  4KB1 A;  3KD5 E;  3O6W A;  1DLO A;  4CZM A;  3T1H K;  2Q97 A;  2FF3 B;  3Q7C A;  5HRN A;  3HST B;  4OJR A;  4KBO A;  2HST A;  4A62 A;  2P9S A;  3G0Z A;  4JI8 K;  3O1W A;  3E9O A;  4BRQ A;  4DTP A;  4AQY K;  1XMO K;  4H5V A;  3CCU N;  4BRD A;  3EE9 A;  4FJ5 A;  4HHT A;  3VA0 A;  4R5P A;  3KJV A;  2BGG A;  1WSH A;  1ZC6 A;  2XY8 A;  4H8K A;  1HNI A;  3SBT A;  1U2V A;  1RDC A;  3ZET A;  4BGA A;  4DFJ A;  3ID6 A;  4OX9 K;  3WXI A;  2P9I B;  4ICL A;  5EX5 A;  4DV0 K;  1VQL N;  2NRH A;  2OPQ A;  3NFA A;  1YJN N;  1SUQ A;  3L3U A;  4BE1 A;  4L8R B;  1HJO A;  1DTT A;  2E2O A;  4H0V B;  2D4W A;  1RIL A;  1RT7 A;  2IOC A;  1X1P A;  5FRM A;  5ADX H;  5E41 A;  1LAV A;  3HPG A;  3PIP L;  1WSE A;  4DSJ A;  3SAG A;  4Q5V A;  2GWJ A;  3CJA A;  3QB0 A;  5LJV A;  3D2E A;  1TGO A;  2OAN A;  4BC4 A;  4B3T K;  5KTQ A;  4LF9 K;  1ZBF A;  4KB0 A;  5J1E A;  1NGH A;  3V9X A;  4BDZ A;  5SZT A;  4LF5 K;  4H4O A;  2Q3S A;  3WNF A;  1RBU A;  5DK5 A;  3LP2 A;  1T3V A;  4JI7 K;  1RTD A;  2VWK A;  4CHY A;  3O9Q A;  5J2P A;  3L2W A;  3O9U A;  4FVM A;  4OPJ A;  3HM8 A;  4B3O A;  3A2F A;  4CEB A;  3ZSO A;  1QQO A;  3KLE A;  1DT9 A;  2P9L A;  3ZT2 A;  4KHW A;  3TSP A;  4J8F A;  3ATU A;  1VAZ A;  2WFB A;  4CFD A;  1CZB A;  4C23 A;  4KKO A;  1XWL A;  3SBG A;  2F9T A;  4E89 A;  4LFC K;  3CJB A;  4I2Q A;  4CJF A;  1G99 A;  4B1W B;  3NMU A;  5F2R A;  5J2M A;  3CI5 A;  2ZD1 A;  3C7N A;  1OH5 A;  4X65 K;  1C0U A;  4OO1 J;  4Y1D A;  2A41 A;  3ID8 A;  4RCH A;  3H45 C;  1W0H A;  4DU1 A;  4W5R A;  4JD2 B;  5KPR A;  1F21 A;  2PYJ A;  3CHW A;  3ZCM A;  3WNH A;  3SUO A;  1GLL O;  1WUA A;  1NNE A;  2OYQ A;  3ATV A;  2NZT A;  3ZX2 A;  4FVU A;  1S1V A;  3OYA A;  3DXM A;  3FLC O;  2O8E B;  3H1Q A;  3OTO K;  1JXE A;  4BVO A;  4I9Q A;  4CEF A;  3U9D A;  5GAG P;  5F0X A;  3LAL A;  4M3U A;  5GIO A;  4FJJ A;  1BQN A;  3MXI A;  1YXQ A;  2HOE A;  5C42 A;  5AFU A;  4OGC A;  5AJ3 K;  3SNN A;  4IOA L;  1MDU B;  2E20 A;  1TUU A;  1EX4 A;  2HNZ A;  3QEX A;  2GWK A;  1N8R O;  5CR4 A;  4JRP A;  4JKG B;  4M7X A;  4FLV A;  3ZYY X;  3A8Y A;  3WT0 A;  1U47 A;  4JV5 K;  2J4R A;  1U49 A;  3VTI A;  1BU6 O;  4M3W A;  1VHX A;  1OKJ A;  2Q1N A;  4H5T A;  4WFN L;  3E66 A;  4WQ4 A;  3RR8 A;  3OS2 A;  2ZWH A;  2GUP A;  2KFN A;  2V52 B;  3OYN A;  2QXF A;  2WBN A;  2VQF K;  1SS6 A;  2O8F B;  3ZSV A;  4FJN A;  2IGI A;  3D6R A;  1QZ6 A;  4B9N A;  1S9G A;  4CFB A;  1SV5 A;  2HBJ A;  1Q81 O;  2KKZ A;  2Y1I A;  4MDB A;  1OVQ A;  4O4G A;  3NAE A;  3DLB A;  4JI5 K;  1RBR A;  1T6D A;  1WAJ A;  2FXU A;  3FFK B;  3L8B A;  4KTQ A;  3DXK A;  3PSI A;  1UOC A;  4CF1 A;  3K9K A;  1LV5 A;  4AHT A;  3OYD A;  3HVT A;  5J2N A;  5GAH P;  1Z25 A;  4C8N A;  4JD2 A;  2ZJP L;  1P8Z A;  2A1S A;  1H1V A;  1U04 A;  3IS9 A;  2FSN A;  1NK7 A;  2IVN A;  2Q0U A;  3VQC A;  4UY8 O;  1VQ5 N;  4RW4 A;  1HNV A;  5D3G A;  1GLD G;  3M8S A;  5CZ1 A;  3DAW A;  5M1K A;  1HMV A;  1QZ5 A;  2DFF A;  1HKC A;  3VEX A;  3QEW A;  3LDS A;  2ETJ A;  3NDK A;  3W0L A;  1WB9 A;  4W5N A;  1TK0 A;  4H0P A;  4JKC A;  4QAG A;  3OYM A;  4M3Z A;  3M5R A;  3THY B;  3BEX A;  5CHI A;  3CQY A;  5GIN A;  2RHK A;  2RKI A;  5HRP A;  4JYA K;  5AQN A;  4CJT A;  3WEE B;  1NGD A;  1NOY A;  1J54 A;  4CEQ A;  4CGJ A;  5CYQ A;  2OTL N;  1NWK A;  4H0X B;  4DR3 K;  4I6M B;  3SQ2 A;  1R59 O;  2E8A A;  1RT2 A;  4CK3 A;  4FL9 A;  2O8C B;  2Q36 A;  1KFS A;  4M7Y A;  3GG4 A;  1T03 A;  2UUC K;  4FJ8 A;  2E2N A;  1T6C A;  3EKU A;  3ENB A;  4M41 A;  5C25 A;  3AO3 A;  1WNS A;  3SPZ A;  1D4X A;  1S1U A;  4BWJ A;  1VQ9 N;  3KD1 E;  4IJN A;  1UA0 A;  2OPR A;  1S1W A;  3G25 A;  3CD6 N;  1D5A A;  4GV6 A;  1HYV A;  4IEE A;  4E7L A;  2BUP A;  4BDP A;  4BRH A;  1YIT N;  4B1Y B;  4B9S A;  2G8K A;  1MWK A;  1NGG A;  2NRR A;  2QWO A;  1E4G T;  4LH5 A;  2O8B B;  2I7N A;  2YHB A;  4CEE A;  3DLE A;  4AIL C;  3DOL A;  3D0P A;  1QSL A;  4DQR A;  4N5S A;  4LC9 B;  2UU9 K;  5M1O A;  4YOY A;  3FZK A;  1UWB A;  4RW7 A;  4O8K A;  3VQ8 A;  3NH0 A;  5CE3 A;  1B9F A;  3CCS N;  3ZLJ A;  1RBT A;  4ISF A;  2VG7 A;  4WCE L;  1NMN A;  1S1T A;  3C6U A;  4FPA A;  3QBX A;  2E2Q A;  1A5X A;  4M3Y A;  1JCE A;  5HRS A;  4EHU A;  4DR1 K;  3IFR A;  3THW A;  3DM2 A;  1ASU A;  3CPW M;  3SQ4 A;  3KKR A;  5KRT A;  3H6E A;  4H03 B;  2YHX A;  3P31 A;  1GOA A;  1U45 A;  1N6Q A;  1Q9X A;  4XIU A;  3MWT A;  3A5O C;  1YTA A;  2YI1 A;  1LW2 A;  4O0J A;  4BG8 A;  3TI0 A;  3O4W A;  3VQ4 A;  4DSI A;  3M8Q A;  4NYN A;  4K8X A;  2QK9 A;  4CZI A;  3P38 A;  3HZ6 A;  1EET A;  3RWU A;  1BWF O;  4EZ6 A;  3V9Z A;  3SMP A;  1X9W A;  1J9A A;  2P9N A;  3VQ9 A;  1ZBS A;  3QIC A;  4FZX C;  4PUO A;  2HHV A;  3DLG A;  3MX5 A;  3CXC M;  3GE1 A;  2ITG A;  4DV4 K;  1XC3 A;  4CW7 B;  4X62 K;  1SKS A;  4JI0 K;  2VCP A;  4ISG A;  4AHV A;  1JJ2 M;  4CJE A;  4HTL A;  3QER A;  4KRF A;  3J7A P;  4ELV A;  4KRE A;  4MLE A;  3MMV A;  3B8A X;  4EAH D;  3EKS A;  3ISN C;  4RG8 A;  1ASV A;  4OLA A;  4DQ8 A;  3F9M A;  2YNG A;  4DR6 K;  3HRG A;  2KQ2 A;  4B1V A;  1XHX A;  3CME N;  3DOK A;  1HQE A;  5KQ8 A;  3MED A;  1Y64 A;  3SMS A;  3ZSY A;  2IS3 A;  3NCI A;  4DSK A;  2EWS A;  4IOX A;  1QTM A;  3DLR A;  4CGI A;  4H5R A;  1KRP A;  3H3N O;  2D0B A;  3SQ1 A;  4KH6 A;  3U8X A;  2WOM A;  4AF1 A;  2G8V A;  2G8H A;  1DGK N;  1WLJ A;  1KVB A;  4IDK A;  1R0A A;  4BRP A;  2E5L K;  4E1J A;  1BA0 A;  1QS4 A;  1VSI A;  1BIZ A;  3BP8 A;  3UKU A;  1T44 A;  2KW4 A;  5HL7 L;  4F8R A;  3QFP A;  4B3R K;  4BRN A;  1RDA A;  2ZF5 O;  3TAN A;  1TKT A;  3AVA A;  3H46 O;  1WBD A;  4FK0 A;  3NVK A;  3EY1 A;  2F4V K;  4CGG A;  1NK0 A;  4E7J A;  3L6Q A;  2D5R A;  4DR5 K;  2FLO A;  2EHG A;  3OYB A;  3NVM A;  5AQQ A;  3RTV A;  1U4B A;  2RE2 A;  3HT3 A;  2P9K B;  4RW6 A;  2UUA K;  4CK2 A;  4HVJ A;  4CFC A;  1XQS C;  4F9O A;  3UKU B;  1C0G A;  1QQC A;  2YKM A;  4J2A A;  4FW1 A;  3FGU A;  5I42 A;  1VQK N;  1Q8I A;  3HXM A;  4DUY K;  1VQN N;  1HKB A;  1N5Y A;  5EVZ A;  3QBW A;  1RFQ A;  3K5M A;  4HCC A;  2EX3 A;  2E6L A;  1KAY A;  4DS5 A;  4FWP A;  4JKD A;  3CCV N;  3TAF A;  2RPI A;  5AQM A;  4YOW A;  2HHT A;  1C1B A;  2P9I A;  1NJW A;  4FOI A;  3VEN A;  1LCU A;  4DTS A;  3K58 A;  4EFH A;  5CY4 A;  3WEE A;  3DRR A;  3AVC A;  1Q18 A;  1IBL K;  5AQP A;  3OYG A;  1TL1 A;  2YKN A;  4NO7 A;  4DR7 K;  2YV0 X;  1VQM N;  1SZ2 A;  4B9U A;  2Z1I A;  4Y1C A;  4LY7 A;  3SCX A;  2HNY A;  3QDK A;  1BI4 A;  1T7P A;  1B92 A;  4PY5 A;  2F8T A;  3ENH A;  1ILY A;  3R8E A;  5LL6 Z;  4CJ7 A;  3CCJ N;  4IOC L;  1RT3 A;  4O0I A;  1BDG A;  4FLY A;  4GV3 A;  4U67 L;  3OS1 A;  4E19 A;  1NGE A;  1VQ6 N;  1ZBH A;  3L0Q A;  5FDL A;  3D2E B;  2A42 A;  4A57 A;  3GOI A;  4FWL A;  2BTF A;  3EO3 A;  1JLA A;  3JAM O;  3CC4 N;  1DKG D;  1ZXO A;  4ELU A;  3LL3 A;  3THX B;  2VG6 A;  4JKG A;  1UA1 A;  3DWL A;  4DQP A;  1EO1 A;  3ZSZ A;  5BRD A;  1VQP N;  4JN4 A;  1LWF A;  4K42 A;  4HTU A;  2HBL A;  4BAC A;  1LW0 A;  4FJK A;  4E7K A;  5C10 A;  4DFP A;  1WSI A;  3ZEU A;  2VWB A;  4ILJ A;  3V9S A;  2IDO A;  3LM9 A;  3ZSX A;  1NGF A;  4FOE A;  2FSK A;  1TK5 A;  2IVO A;  5GAD P;  3T19 A;  4XH1 A;  1X9J A;  1VK0 A;  4PKG A;  5HRR A;  4FPB A;  4BDY A;  4QOZ B;  4ZTF A;  2E88 A;  3K5L A;  4BRF A;  4LF8 K;  4IEI A;  3FZF A;  1CZA N;  1QQN A;  4KH5 A;  3OBW A;  3TTC A;  5SWM A;  4BRE A;  3QIP A;  3NH1 A;  1JLF A;  3KK2 A;  2QXL A;  5CYM A;  4O5F A;  1HYZ A;  3E9P A;  3V9W A;  4CJ3 A;  5AZI A;  4DTJ A;  3HP9 A;  3J7Z O;  1TK8 A;  2O8E A;  3SJH A;  1OH7 A;  2KLA A;  4XEI A;  1Q82 O;  4C8O A;  1GLE G;  2P9U A;  4ZHR A;  2FBY A;  4E1M A;  1OH6 A;  4K43 A;  3CMA N;  3FR0 A;  2E2P A;  3BZK A;  1OVY A;  3EL2 A;  4DU4 A;  3NGI A;  4I7F A;  5DMR A;  4M63 C;  4A61 A;  1S1X A;  3ZX3 A;  3EYZ A;  3AVK A;  4E0D A;  1XI1 A;  2E6M A;  1HRH A;  4JKE A;  1KFD A;  1S9E A;  3VQB A;  4GY2 B;  4OVL A;  2QM1 A;  4KHP K;  4FLT A;  4CJQ A;  4O44 A;  3A5L C;  3VOV A;  3P4I A;  1KLN A;  4GKJ K;  1RT1 A;  1JLE A;  1QQM A;  3O4N A;  4B1U B;  4DQS A;  3G6E N;  2WUS A;  3IRX A;  3CCQ N;  3AY9 A;  3C7N B;  2D0C A;  3VEO A;  4OLB A;  4OPH A;  3LP3 A;  1FJG K;  5AQG A;  3BF1 A;  4ZTJ A;  4DTX A;  1W97 L;  4FJX A;  4CK1 A;  2BDP A;  1LWE A;  2JWL A;  3NF9 A;  2HVI A;  2X6N A;  4DV3 K;  1C1A A;  5FPN A;  5AQU A;  4QCL A;  4BRA A;  2GBZ A;  4FJM A;  3AVF A;  3TPQ A;  1IKV A;  4BWM A;  1RTH A;  1V4S A;  2WON A;  1EKE A;  2AJQ A;  4N47 A;  3CC2 N;  1J6Z A;  1RDW X;  1VRT A;  4AM7 A;  1S72 N;  4DF4 A;  4MQ3 A;  4FK2 A;  5E84 A;  2QA4 N;  4B9T A;  4CEA A;  3AGK A;  4CI6 A;  3AAQ A;  3TAG A;  2CH5 A;  4W5Q A;  3FZL A;  1TVR A;  3HM9 A;  3CJ7 A;  4CCH A;  1KCF A;  4IDH A;  2OZM A;  3AA2 A;  1Q7Y O;  4LSL A;  4CGF A;  2ASM A;  4CEZ A;  2VGN A;  4GW6 A;  1K8A O;  3PO4 A;  3I33 A;  4F3T A;  1S22 A;  4W5O A;  3T3F A;  1N33 K;  3PLA A;  4FWN A;  4Z4F A;  3TAR A;  3QEI A;  1HNZ K;  1LOT B;  1EWQ A;  2NRT A;  3I56 N;  4WE1 A;  5JMV A;  1IG9 A;  1KSP A;  4BY9 C;  2OTJ N;  5FRN A;  3H1V X;  2O4G A;  2PFU A;  1K8K A;  4LH4 A;  4I6M A;  2PBD A;  3MAQ A;  3AO1 A;  1TKX A;  1QHT A;  2HVH A;  2D0O A;  4YNQ A;  4BC2 A;  3KLI A;  5ELZ A;  1I94 K;  2QWR A;  3S41 A;  1IKX A;  1MWM A;  5JVH L;  5GAE P;  3NE6 A;  1JCF A;  3KVG A;  1S5J A;  5BRF A;  1VSK A;  2F9W A;  4LSN A;  4Z94 A;  2Q31 A;  4ISE A;  3L2R A;  1RTJ A;  3JSM A;  3DLL L;  1TV6 A;  4LFA K;  4BRM A;  3NBP A;  4BRO A;  3ASM A;  3ZT4 A;  3T7Z A;  4KPY A;  4FWM A;  4CES A;  4A2B A;  3KHY A;  4BQZ A;  1M90 O;  1NU0 A;  4WFA L;  2ZJR L;  3THY A;  2HHU A;  2PAV A;  4EZ9 A;  5ADX A;  3CQX A;  3G4S N;  1S6Q A;  4IKF A;  3I0S A;  5C2F A;  1VQ8 N;  1DTQ A;  1U6Z A;  4F2S A;  4YOV A;  4WFB L;  3UB5 A;  4F2R A;  4RW8 A;  3L4I A;  4BE2 A;  3CCE N;  3IMX A;  1CLQ A;  2ZE2 A;  3BZC A;  1BQM A;  1VSL A;  2JGU A;  4AHU A;  3KK7 A;  4IO9 L;  3WXL A;  4CZL A;  1YHQ N;  2D1K A;  2X6S A;  4FJ9 A;  2ZQB A;  3AAR A;  1RT5 A;  3KIO A;  4RTF D;  2YNF A;  1K9M O;  5FPD A;  5HRO A;  3VQ5 A;  2HBM A;  5BR9 A;  3OS0 A;  1FKP A;  3PX6 A;  3U9Z A;  3OYC A;  3O9T A;  1S6P A;  4CJP A;  1C1C A;  1BG3 A;  3P39 A;  5BRE A;  3CJC A;  3SQ0 A;  3V1R A;  4IXC A;  3LPT A;  2F96 A;  3AO5 A;  5FPE A;  3IG1 A;  3TTF A;  5AFU H;  4RWT A;  3ALY A;  2A5X A;  4JAX A;  1J5O A;  4KHU A;  3I8D A;  4H0O A;  4V19 S;  1IBK K;  1VSD A;  4CHZ A;  3V4I A;  2NRV A;  1NJX A;  4KHN A;  1IJJ A;  3THX A;  5IWA K;  3VGM A;  4R79 A;  1A5V A;  3N4Q A;  1L3V A;  3PY8 A;  5JLH A;  3VEY A;  2OA8 A;  1EP4 A;  1TYQ B;  3ZSR A;  1RT4 A;  5B8H A;  3MWP A;  2CH6 A;  1TUY A;  4DMN A;  4Q0B A;  3L2V A;  3VER A;  3O9R A;  1K73 O;  4CJS A;  2I7P A;  5AQV A;  4MDA A;  2OPP A;  3THW B;  4L3Q A;  1ATR A;  4YDU C;  3IKM A;  4CED A;  2HMI A;  3K9J A;  2A6A A;  3U3Y A;  5MLC Q;  4CF8 A;  4FM0 A;  5FRO A;  1JLG A;  3F2K A;  4K25 A;  3S3M A;  3RMD A;  3ULE B; 
#chains in the Genus database with same CATH homology
 3OYB A;  4DFJ A;  4F3O A;  3T1A A;  4ICL A;  2KZM A;  1HYS A;  4DFK A;  3VQ7 A;  4IBN A;  3RTV A;  4CF9 A;  4FCY A;  3THV A;  1U4B A;  2OPQ A;  3NFA A;  1SUQ A;  3P5J A;  3L3U A;  3HT3 A;  4RW6 A;  4BE1 A;  1NKB A;  3KLH A;  4CK2 A;  3CQ8 A;  4L8R B;  3E01 A;  3B6P A;  1DTT A;  4HVJ A;  2HHS A;  3HJF A;  3CM5 A;  4CFC A;  2QKK A;  1RIL A;  1QQC A;  1EXQ A;  1RT7 A;  4CF0 A;  2IOC A;  4CJU A;  1J53 A;  1X1P A;  3CG7 A;  3O3F A;  2YKM A;  4J2A A;  4CIG A;  3O3H A;  4FW1 A;  5FRM A;  5E41 A;  5I42 A;  3SI6 A;  4ELT A;  1SKW A;  3AO4 A;  1WSG A;  4KHS A;  1Q8I A;  3HXM A;  1LAV A;  3AVM A;  3HPG A;  3G10 A;  3MEE A;  3ZT0 A;  3SJJ A;  1WSE A;  3KKS A;  4DSJ A;  1N5Y A;  4HCC A;  3K5M A;  4ID5 A;  2X74 A;  2EX3 A;  2E6L A;  4Q5V A;  4DS5 A;  2FBV A;  4OGE A;  3TAF A;  2D5R A;  1VRU A;  1NK4 A;  4CJK A;  2RPI A;  2HHT A;  1C1B A;  4NCB A;  4M3X A;  3OJS A;  1IO2 A;  1XC9 A;  1NJW A;  1TGO A;  1BL3 A;  5KTQ A;  2F8S A;  1ZBF A;  3K57 A;  5J1E A;  4FLX A;  4KB0 A;  3V9X A;  4KHY A;  4BDZ A;  4DTS A;  5SZT A;  4N76 A;  2O4I A;  3K58 A;  4H4O A;  1RDB A;  2Q3S A;  3WNF A;  5CY4 A;  3OYE A;  3OVN A;  3DRR A;  3AVC A;  4M3T A;  1RBU A;  3CFO A;  5DK5 A;  3OYG A;  3LP2 A;  1YT3 A;  3LP0 A;  1TL1 A;  2YKN A;  3K5O A;  1RTD A;  4C8L A;  1JLB A;  4CE9 A;  2YV0 X;  2VWK A;  4CHY A;  3RMB A;  3L2Q A;  5J2P A;  3L2W A;  2Z1I A;  4FVM A;  4Y1C A;  4OPJ A;  1SL1 A;  4LY7 A;  3SCX A;  4B9U A;  2HNY A;  2P5G A;  4FJG A;  1BI4 A;  1QSY A;  1B92 A;  1T7P A;  4B3O A;  3A2F A;  4CEB A;  4PY5 A;  1GOB A;  3ZSO A;  2F8T A;  1X9M A;  3KLE A;  3KK3 A;  4KV8 A;  4N56 A;  3TR8 A;  3ZT2 A;  4DLG A;  4KHW A;  1RT3 A;  4O0I A;  1JXB A;  4FLY A;  3LAN A;  2I5J A;  1CZB A;  4CFD A;  4KKO A;  3OS1 A;  4E19 A;  4B8C A;  1XWL A;  1ZBH A;  5FDL A;  4E89 A;  1XHZ A;  3PX0 A;  4I2Q A;  2HHX A;  4CJF A;  4DQI A;  3V9U A;  5J2M A;  1C0T A;  2ZD1 A;  1JLA A;  2XY7 A;  1SL0 A;  1C0U A;  1KLM A;  1GOC A;  4Y1D A;  2B5J A;  5JS2 A;  1BCM A;  1VSJ A;  4ELU A;  3V1O A;  4HCB A;  1L3U A;  4AHS A;  3PV8 A;  2VG6 A;  3AA4 A;  1W0H A;  3EZ5 A;  4W5R A;  4I2P A;  4DU1 A;  1T05 A;  1UA1 A;  4MFB A;  1IKY A;  1WSJ A;  3HL8 A;  1NK6 A;  4DQP A;  3ZSZ A;  1F21 A;  4Z4H A;  3SUP A;  2PYJ A;  3ZCM A;  4NCG A;  3WNH A;  3HP6 A;  1FK9 A;  1LWF A;  4HTU A;  3SUO A;  3OYH A;  3HYF A;  2ATQ A;  1LWC A;  4BAC A;  2YNH A;  2OYQ A;  1LW0 A;  4DTU A;  1S1V A;  4FJK A;  3OYA A;  4FLU A;  3CYM A;  1FKO A;  1VSF A;  2NUB A;  1TAU A;  2BAN A;  1TL3 A;  4TSX A;  4E7K A;  4FLW A;  4DFP A;  4O55 A;  2JLE A;  1WSI A;  1JXE A;  2GUI A;  2R7Y A;  4I9Q A;  2B4J A;  4CEF A;  3MXJ A;  3V9S A;  2IDO A;  3ZSX A;  1C6V A;  3LAL A;  1U48 A;  1B9D A;  4M3U A;  3OYK A;  3IAY A;  4FLZ A;  1BQN A;  2IAJ A;  3M8P A;  1TK5 A;  4FJJ A;  2PZS A;  3T19 A;  3AVJ A;  3LWL A;  3MXI A;  3S3N A;  4AHC A;  2HW3 A;  1VK0 A;  5HRR A;  5C42 A;  4BDY A;  4QOZ B;  3VN5 A;  4ZTF A;  3DRS A;  4W5T A;  3K5L A;  2OPS A;  3DYA A;  4OGC A;  4CEO A;  3SNN A;  3MXM A;  1JL2 A;  4C8K A;  4I9L A;  1TKZ A;  1EX4 A;  2HNZ A;  3QEX A;  5SWM A;  3TAP A;  3K2P A;  5KGX A;  4Z4I A;  4EP4 A;  3QIP A;  3NH1 A;  4CJ5 A;  1JLF A;  4JRP A;  3KK2 A;  4PA1 A;  3TAM A;  4FLV A;  1NJZ A;  5CYM A;  4CHN A;  3CM6 A;  1Y97 A;  1HYZ A;  1U47 A;  1HQU A;  3V9W A;  4CJ3 A;  4DTJ A;  5T7B A;  3F73 A;  3HP9 A;  1MU2 A;  1U49 A;  1NJY A;  4E3S A;  4M3W A;  3C6T A;  1TK8 A;  4KI6 A;  3ZT1 A;  3NGZ A;  4DQQ A;  4H4M A;  3RR8 A;  2YNI A;  3OS2 A;  4FXD A;  3NF7 A;  4J2D A;  3HO1 A;  4C8O A;  2KFN A;  3AVB A;  3OYN A;  4ZHR A;  2FBY A;  2QXF A;  3QIO A;  1YVU A;  3QNN A;  3ITH A;  4JLH A;  4CGD A;  4E1M A;  3QNO A;  2XY5 A;  3ZSV A;  2P51 A;  3NH2 A;  3ULD A;  4FJN A;  1O1W A;  2IGI A;  3MEC A;  5K14 A;  3OY9 A;  4J2E A;  4DTM A;  4YFU A;  5CZ2 A;  3NGI A;  4DU4 A;  1QE1 A;  4I7F A;  5DMR A;  3OJU A;  1S9G A;  4B9N A;  4FJ7 A;  4CGH A;  1S1X A;  4CFB A;  4B9M A;  1BCO A;  1SV5 A;  1VSE A;  3AVK A;  3EYZ A;  1XI1 A;  2E6M A;  1HRH A;  2Y1I A;  4O4G A;  1KFD A;  1S9E A;  3AVI A;  1TAQ A;  2P1J A;  3VQB A;  4OVL A;  3NAE A;  1X9S A;  2G8F A;  3DLB A;  1RBR A;  1WAJ A;  3LPU A;  1JLC A;  3L8B A;  4FLT A;  4CJQ A;  4O44 A;  4KO0 A;  4KTQ A;  4M45 A;  1TKD A;  4M3R A;  2OZS A;  1UOC A;  4LD0 A;  4CF1 A;  1KLN A;  4PQU A;  1RT1 A;  3P1G A;  3WNG A;  1JLE A;  1LV5 A;  4AHT A;  3HK2 A;  2KFZ A;  3O4N A;  3OYD A;  3HVT A;  4DQS A;  5J2N A;  1Z25 A;  3LZJ A;  4C8N A;  2DFE A;  3V1Q A;  4E7H A;  3I0R A;  3AV9 A;  3IRX A;  1CXU A;  4RW9 A;  3IS9 A;  2A1S A;  3HVR A;  1U04 A;  1NK7 A;  4F4K A;  1ZBU A;  4CJV A;  4DU3 A;  3K59 A;  4Z4G A;  3VQC A;  2D0C A;  1RCH A;  3O4Q A;  4NCA A;  4OLB A;  4RW4 A;  2Z1H A;  1HNV A;  3LP3 A;  2G8U A;  2XHB A;  3DLH A;  4FZY A;  5D3G A;  4FYD A;  3NF8 A;  3PUF A;  3M8S A;  5CZ1 A;  1IKW A;  4AHR A;  4DTX A;  4ZTJ A;  4FJX A;  4CK1 A;  2BDP A;  3DMJ A;  1HMV A;  1LWE A;  3NF9 A;  3KTQ A;  2DFF A;  3LP1 A;  3QIN A;  3V81 A;  3QEW A;  3KK1 A;  1JLQ A;  2ETJ A;  2X6N A;  3LDS A;  1BIS A;  4N41 A;  1C1A A;  1NK8 A;  2G8W A;  3M8R A;  3NDK A;  4QCL A;  2GBZ A;  3LAM A;  4FJM A;  5JS1 A;  1C0M A;  3AVH A;  4W5N A;  3AVF A;  2HND A;  1TK0 A;  2DY4 A;  4QAG A;  1IKV A;  4BWM A;  3OYM A;  5HP1 A;  3AO2 A;  4M3Z A;  3MEG A;  1K6Y A;  2WON A;  1RTH A;  2AJQ A;  3F9K A;  1EKE A;  3OYF A;  4N47 A;  1RBV A;  1RTI A;  1LAW A;  3VQP A;  3LZI A;  1CXQ A;  2RKI A;  5HRP A;  3SZ2 A;  2XY6 A;  3SV4 A;  3CFP A;  1VRT A;  4CHP A;  4CJT A;  2X78 A;  1REV A;  1NOY A;  1W9H A;  1J54 A;  4MQ3 A;  4CEQ A;  4DF4 A;  4FK2 A;  4CGJ A;  5CYQ A;  4B9T A;  4CHQ A;  4CEA A;  3SQ2 A;  4JS5 A;  4B9L A;  3TAG A;  2HHQ A;  4DSE A;  3AVL A;  4W5Q A;  2B6A A;  2PYL A;  1RT2 A;  3QEV A;  1KVC A;  3NHG A;  4CK3 A;  1TVR A;  3HM9 A;  4KHQ A;  1KFS A;  4DG1 A;  4CCH A;  1T03 A;  2D0A A;  4B9V A;  1KCF A;  4HUF A;  2BE2 A;  3P83 D;  1ZBL A;  2OZM A;  3AA2 A;  4FW2 A;  4LSL A;  5HLF A;  4FJL A;  4KTW A;  2Z1J A;  4FJ8 A;  4CGF A;  1FXX A;  1RBS A;  3UIQ A;  4KFB A;  4M41 A;  4CEZ A;  3AO3 A;  4GW6 A;  5C25 A;  1WNS A;  3RMA A;  3PO4 A;  3SPZ A;  4F3T A;  3NGY A;  1S1U A;  4BWJ A;  4CER A;  4W5O A;  3S9H A;  1RDD A;  3TWH A;  3T3F A;  4FJH A;  3KD1 E;  1CZ9 A;  1UA0 A;  2YHA A;  1I3A A;  2OPR A;  3C94 A;  1S1W A;  3K5N A;  4UQG A;  3AVN A;  4B8A B;  4Z4F A;  3TAR A;  3QEI A;  4CIF A;  1L5U A;  1D5A A;  4KTZ A;  1KTQ A;  1G15 A;  1HYV A;  4E7L A;  2RN2 A;  4WE1 A;  2VWJ A;  1IG9 A;  1D9F A;  4IG3 A;  1KSP A;  4BDP A;  4KAZ A;  1BIU A;  3OYJ A;  5FRN A;  1JL1 A;  4DWI A;  2O4G A;  4DSL A;  4EP5 A;  4B9S A;  2LSN A;  5KI6 A;  4CJ4 A;  3S3O A;  1NK5 A;  2G8K A;  4LH4 A;  1VSH A;  1Z26 A;  4LH5 A;  4E7I A;  2YHB A;  4BE0 A;  4CEE A;  3MAQ A;  3AO1 A;  3KLG A;  1NK9 A;  1TKX A;  2DFH A;  3DLE A;  3VA3 A;  1QHT A;  2HVH A;  4HUG A;  1L3T A;  4Z4C A;  4YNQ A;  4AIL C;  3DOL A;  3H08 A;  3D0P A;  1I39 A;  1QSS A;  3KLI A;  4CHO A;  4FJI A;  3LWM A;  4HUE A;  1QSL A;  4CEC A;  4DQR A;  1T8E A;  4FK4 A;  1IKX A;  1BHL A;  4N5S A;  3BDP A;  1HJR A;  4Z0U A;  3NE6 A;  3QEP A;  1RNH A;  1S5J A;  4B08 A;  4ID1 A;  1UWB A;  1VSK A;  3C95 A;  4LSN A;  5J2Q A;  4RW7 A;  3L2R A;  3VQ8 A;  1RTJ A;  3JSM A;  2FBT A;  1BGX T;  4K8Z A;  3NH0 A;  1L3S A;  1B9F A;  3OYI A;  1TV6 A;  1RBT A;  3D45 A;  3QO9 A;  2VG7 A;  4IFV A;  3SUN A;  1BI4 B;  2KTQ A;  2FBX A;  3NBP A;  1S1T A;  3C6U A;  3ASM A;  3LAK A;  3ZT4 A;  2QKB A;  2HVI A;  4KPY A;  2HHW A;  4O5B A;  4Z4E A;  3NF6 A;  4CES A;  4CFA A;  1RT6 A;  2PY5 A;  2GV9 A;  4M42 A;  1A5X A;  4M3Y A;  1SL2 A;  3SPY A;  4IG0 A;  2HHU A;  3AA5 X;  5HRS A;  1ITG A;  3SYZ A;  3OYL A;  3DM2 A;  1ASU A;  4EZ9 A;  3SQ4 A;  3KKR A;  5KRT A;  3O3G A;  3ZSQ A;  1GOA A;  1S6Q A;  3VQD A;  1U45 A;  4CJR A;  1N6Q A;  4IKF A;  4G1Q A;  4XIU A;  1Q9X A;  2KZZ A;  3I0S A;  3AA3 A;  3QLH A;  1YTA A;  3PX4 A;  1DTQ A;  1LW2 A;  4O0J A;  4CJL A;  3TAE A;  3TI0 A;  4F2S A;  3U3G A;  4GVM A;  4FM1 A;  3CFR A;  3VQ4 A;  4F2R A;  4DSI A;  3M8Q A;  4NYN A;  4K8X A;  2QK9 A;  4CJW A;  1NKC A;  5KGW A;  4RW8 A;  2RF2 A;  4BE2 A;  4DLE A;  4C8M A;  1EET A;  2A1R A;  2P5O A;  1WSF A;  2HB5 A;  4EZ6 A;  1NOZ A;  4OPK A;  3KLF A;  3RWU A;  2Y1J A;  2ZE2 A;  1CLQ A;  2VG5 A;  3V9Z A;  4H8K A;  2XRI A;  1X9W A;  1BQM A;  1J9A A;  1VSL A;  2JGU A;  3VQ9 A;  4AHU A;  1ZBI A;  4DTN A;  4FM2 A;  4FZX C;  3QET A;  4PUO A;  3DLG A;  1Q9Y A;  1ZYQ A;  4E0D A;  4AH9 A;  2X6S A;  4KI4 A;  2HHV A;  3L3V A;  3TAQ A;  2ITG A;  4IFY A;  1ASW A;  3JYT A;  4E1N A;  4FJ9 A;  2ZQB A;  1SKS A;  5C24 A;  3RMC A;  2FC0 A;  4AHV A;  4CF2 A;  3DI6 A;  1RT5 A;  3DLK A;  4CJE A;  3KIO A;  5EU7 A;  2YNF A;  3RRH A;  3QER A;  4DFM A;  4KRF A;  5HRO A;  4DSF A;  1WAF A;  3VQ5 A;  4DS4 A;  4ELV A;  4KRE A;  3OS0 A;  1VSM A;  2W42 A;  1FKP A;  3VQE A;  5KRS A;  3OYC A;  1KVA A;  3PX6 A;  3TAB A;  3RRG A;  1S6P A;  4CJP A;  3RR7 A;  1C1C A;  4FZZ A;  4NYF A;  3ISN C;  4J2B A;  3SQ0 A;  4RG8 A;  3V1R A;  1ASV A;  3B6O A;  4OLA A;  3LPT A;  2F96 A;  4OKK A;  1JKH A;  4DTO A;  1YTU A;  2YNG A;  3AO5 A;  2KQ2 A;  3QES A;  4PWD A;  3AVG A;  1XHX A;  3IG1 A;  3DOK A;  1HQE A;  5HBM A;  2G8I A;  4CIE A;  3VQ6 A;  3MED A;  3ALY A;  3ZSY A;  3U6F A;  4OKE A;  4GMJ B;  2IS3 A;  3NCI A;  3FFI A;  2E4L A;  5I3U A;  1J5O A;  4DSK A;  3BGR A;  3SV3 A;  3V6D A;  4DF8 A;  4KHU A;  3I8D A;  1NKE A;  4JS4 A;  2DTU A;  1QTM A;  4DTR A;  3DLR A;  1UAX A;  4CGI A;  3HPO A;  3WNE A;  1VSD A;  4CHZ A;  3VQQ A;  2XO7 A;  3V4I A;  1NJX A;  3SUQ A;  1KRP A;  3ZT3 A;  3KD5 E;  4KB1 A;  2D0B A;  3SQ1 A;  4KHN A;  1DLO A;  1A5V A;  3ZSW A;  2WOM A;  4OKJ A;  1L3V A;  2G8V A;  3PY8 A;  4JRQ A;  2G8H A;  2OA8 A;  1WLJ A;  4IDK A;  1KVB A;  1R0A A;  1D8Y A;  1EP4 A;  1WN7 A;  3HST B;  3ZSR A;  5HRN A;  1SKR A;  4OJR A;  3PO5 A;  1RT4 A;  1D9D A;  1QS4 A;  1VSI A;  4DMN A;  1BIZ A;  3L2V A;  4Q0B A;  3G0Z A;  3DRP A;  3HPH A;  4CJS A;  2KW4 A;  4F8R A;  1A5W A;  1IH7 A;  3L2U A;  4DTP A;  1RDA A;  1HPZ A;  2OPP A;  2IC3 A;  3VQA A;  4CED A;  1TKT A;  3AVA A;  3TAN A;  2HMI A;  4FJ5 A;  4FK0 A;  3U3Y A;  2Z1G A;  3EY1 A;  4HHT A;  4CF8 A;  4FM0 A;  3VA0 A;  4R5P A;  3KJV A;  2BGG A;  5FRO A;  4CGG A;  1WSH A;  1NK0 A;  1JLG A;  4E7J A;  2XY8 A;  1HNI A;  3S3M A;  3RMD A;  2EHG A;  1RDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...