4CGJA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgjA00
4RW4A 4CIGA 4KREA 1XWLA 4NYFA 3ZSZA 4HTUA 4E7KA 4CJKA 3TAGA 1IO2A 1J9AA 3KK3A 1ZBLA 1FKPA 2KW4A 4E1MA 4DS4A 3F9KA 4DFJA 2WONA 2VWKA 2E6LA 4NCGA 4DTOA 4OKJA 3HJFA 1QE1A 1RT6A 1ASVA 1EKEA 5HRSA 4AILC 2PYLA 1RT1A 4KO0A 1VSHA 1F21A 1X9SA 4RW6A 3PO5A 1TL1A 3OYHA 1Q9XA 3TAMA 4K8ZA 4AHCA 4OKEA 1KLMA 2G8VA 3AVMA 1J53A 1B9FA 1LAVA 4XIUA 1KVBA 1TK8A 1TGOA 4FZZA 3IRXA 4I7FA 3AVAA 1UA0A 1TAQA 3OYCA 3P1GA 4N5SA 1D9FA 4CERA 3BDPA 1SL2A 3KLGA 2G8HA 1UOCA 3ASMA 1J54A 3AV9A 3DLRA 1FKOA 3O4QA 4FLZA 1VRTA 4OGEA 1B9DA 2YNHA 3HPOA 1IKYA 1YT3A 3UIQA 1YVUA 4KHYA 2F96A 3I0RA 1DTQA 1D9DA 1S6QA 2ZD1A 1L3VA 3HK2A 1U49A 4RG8A 1L3SA 1LWCA 4PUOA 4ZHRA 4KHSA 2HNZA 4YFUA 1HYZA 2XY6A 3LAKA 2BDPA 1WAFA 4Z0UA 1D5AA 1QQCA 3TWHA 1NKEA 2G8WA 2YNIA 4CJVA 4DG1A 3SUNA 1RTJA 2X6SA 3NBPA 4DLEA 4KI6A 3B6PA 4LSLA 4ID5A 4O4GA 3LZJA 1NK8A 4B9TA 3TANA 4OLBA 2AJQA 2OZMA 3T19A 4W5TA 2ZQBA 2PZSA 4EP4A 1LAWA 5KRSA 3OYDA 3L2WA 1JLGA 1RT4A 2JLEA 1IH7A 3NAEA 3LWMA 4Z4IA 1C1AA 5SZTA 1BI4B 3TR8A 2IDOA 1HJRA 3RR8A 4FK2A 3DLGA 3V4IA 4CJRA 1RTIA 1KRPA 5FRNA 2B4JA 4BWMA 1LWEA 3KKSA 3MEEA 3U6FA 3C6UA 3RMAA 1NK9A 5FDLA 2D0BA 3L3VA 3SQ2A 4LD0A 4E7JA 4KB1A 4FJKA 3DLEA 3HYFA 3SNNA 4BE1A 2FBYA 4IG0A 3HVRA 2KTQA 1BHLA 1I3AA 3VQ8A 3B6OA 4CHQA 2HHVA 4NCBA 3G0ZA 3NHGA 3V9SA 2Z1IA 1X9WA 4C8KA 3KD5E 3OVNA 4PY5A 3EYZA 1JLQA 1GOAA 2IGIA 4FM0A 2WOMA 4DU3A 2P1JA 5HBMA 3QIPA 1QHTA 1RDBA 2YNGA 3ZSOA 5C25A 2G8FA 4CK3A 1NK0A 1KVAA 1HPZA 3LALA 3VN5A 3AO3A 4E19A 3M8RA 4FM2A 4B3OA 1IKVA 3LPUA 3M8SA 5HRNA 4E7IA 3I8DA 1RBTA 4JLHA 4KTWA 3CQ8A 4B8AB 4CF8A 1ASUA 4CJSA 4W5QA 5CY4A 3VQQA 4FK4A 1NJYA 1QSYA 3HPGA 3NGIA 3TARA 1RT7A 4IG3A 4CECA 4FLYA 3SZ2A 4M3TA 3D0PA 3WNHA 2FC0A 3CM6A 5J2PA 3K5OA 4KAZA 1NKCA 2EHGA 4DFPA 3KTQA 4NYNA 1RBUA 5J2QA 3IG1A 3QEXA 2HHQA 3MXIA 1RBSA 3PUFA 3NH0A 4CEDA 3KD1E 4DTMA 2YHAA 1RILA 4ZTFA 3SJJA 3BGRA 3O4NA 4DSEA 4I9LA 1L5UA 1ZYQA 4FJHA 5CZ2A 1C6VA 4FJNA 1X9MA 3LP3A 1T7PA 5HRRA 2A1RA 2Z1GA 3HO1A 1CLQA 3LANA 4DTSA 3OYAA 4E0DA 3D45A 4E89A 3QEIA 2DTUA 4PWDA 4IBNA 1BIUA 4O0JA 4F8RA 2VG6A 1Q8IA 3PX6A 3NF6A 4N47A 4OPKA 1RTDA 1QTMA 1WSFA 1JKHA 3WNEA 1U47A 4BACA 4MFBA 1BGXT 1S9GA 4LSNA 3PY8A 4CEQA 4E7HA 4IFVA 4O55A 3MEDA 4CEOA 4CJLA 4HUFA 4R5PA 4EZ9A 2HHXA 4CFBA 3OJUA 2OYQA 5KGXA 4DU4A 1NK6A 3EZ5A 2G8KA 3U3YA 3CFPA 3U3GA 1C0UA 4E1NA 4KPYA 2HVIA 3HP6A 3NDKA 3MAQA 3ZT1A 4CE9A 5KRTA 4CK2A 2P51A 4G1QA 4CGIA 1EETA 1S1UA 2XHBA 2E6MA 4FJ8A 1VSJA 3DRRA 4KHUA 4CFAA 1NK7A 4CHPA 4KKOA 4OVLA 3PV8A 4ZTJA 3V1RA 3L2QA 3QNNA 4GW6A 5T7BA 3CFRA 4CHZA 4Z4CA 2FBXA 3L2UA 2IAJA 5SWMA 3V9WA 3V81A 4ELVA 4M3XA 1SKRA 4CEEA 4OJRA 4CIFA 1LW2A 3L3UA 3SV4A 4HHTA 3SQ0A 3FFIA 4J2BA 3LP2A 3VA3A 4FXDA 3PX4A 1EP4A 1WSGA 5DK5A 1HNVA 4B9NA 4F4KA 5J2NA 3QESA 1QSLA 3AVIA 4ELUA 2O4IA 1S5JA 1RCHA 3ISNC 1I39A 4CJPA 3DM2A 3NF9A 3JSMA 4KTQA 3LWLA 3HPHA 4I9QA 3H08A 3HT3A 4CJFA 1HRHA 2E4LA 1KFDA 4DQSA 3NH1A 1A5WA 2OPQA 1CXQA 1WNSA 5D3GA 1BQMA 2NUBA 3M8PA 4CF1A 3TAFA 2D0CA 1XHXA 1KFSA 4CEFA 4CGGA 2FBTA 1N6QA 1G15A 3AVKA 4AHVA 2F8TA 4UQGA 3DOKA 4CESA 2Y1JA 2HB5A 3SCXA 3LZIA 3C95A 3O3FA 1K6YA 1TKXA 4KI4A 1WSJA 4TSXA 2DY4A 3VQ9A 4B9LA 1S1XA 4NCAA 1W9HA 4O44A 3S9HA 3RR7A 1BL3A 4H4OA 2XY5A 2KFZA 1ZBHA 1RTHA 1TV6A 3AVFA 1NK5A 1UWBA 1TAUA 2HHUA 4DTJA 1W0HA 3OYJA 4FCYA 2XO7A 1HQUA 2X78A 4M3YA 3CG7A 3CYMA 1DTTA 1VSEA 3AVJA 5FROA 4PQUA 4J2AA 3CFOA 3LAMA 1NOYA 1VSIA 1Z25A 2YNFA 2F8SA 4CGHA 1TVRA 3VQ4A 1NJZA 3L2RA 4DSJA 4ICLA 4GMJB 2YKMA 4B08A 1UAXA 3THVA 3MXMA 4F3OA 3DLKA 3V1QA 2P5OA 1GOCA 4FZXC 4M42A 1N5YA 3OS2A 2YHBA 5C24A 4BE0A 2QXFA 1WAJA 5E41A 4DF4A 2XY7A 4EZ6A 2RKIA 3KKRA 1TK0A 5KGWA 4C8OA 1LW0A 4BE2A 3NFAA 1DLOA 2YV0X 3P83D 2OZSA 4PA1A 1QSSA 3K59A 2PY5A 4F2SA 1VRUA 2HNDA 5CYMA 2QKKA 4IDKA 2EX3A 3AA4A 1L3UA 1IG9A 1L3TA 1JLCA 4I2PA 1T03A 4BDPA 1ZBUA 4H4MA 3VQCA 1RT2A 3A2FA 4DTNA 4Z4GA 3AO4A 4Z4FA 3K58A 3KLEA 3NE6A 4KRFA 2QKBA 4DFMA 2FBVA 3RWUA 4CHYA 4E3SA 4KV8A 4QAGA 2I5JA 3OYFA 2HMIA 2P5GA 4N76A 1SKSA 3VQBA 1KLNA 4M3RA 4DWIA 4FLXA 3ALYA 3AVHA 3V1OA 1BIZA 1S1VA 4K8XA 4AHUA 5KTQA 2G8IA 1EXQA 3HSTB 4CJQA 1S6PA 1A5VA 5HRPA 4DU1A 4FZYA 1ZBIA 3IS9A 3P5JA 3OYKA 4KFBA 3OYNA 4Z4HA 3ZSQA 1NKBA 1IKXA 3VQDA 2ITGA 5CYQA 1VSMA 3K5LA 3HXMA 4HUGA 5J2MA 2Q3SA 2ZE2A 3HVTA 1EX4A 1R0AA 4FYDA 5JS1A 1RDCA 1KTQA 1XC9A 1YTUA 3RMCA 2IC3A 4CJEA 3OS0A 4CEBA 3HP9A 3QO9A 4KTZA 5I42A 1NJXA 4B9VA 4DSLA 3SUOA 1REVA 2OPSA 3T3FA 3DMJA 3PX0A 2OA8A 4HCBA 1JXEA 4L8RB 3G10A 1YTAA 3SQ1A 3ULDA 4CF0A 4CEAA 3ZT3A 2DFFA 1RDDA 1D8YA 4FJGA 1JLFA 4QOZB 5FRMA 2KQ2A 2RN2A 1HMVA 4Y1CA 4LH4A 4DTRA 3AVGA 3TAPA 3L8BA 1QS4A 1ITGA 4Q5VA 3AVCA 1LV5A 4DQPA 1MU2A 4CEZA 4CIEA 3VQPA 4CF9A 4DTUA 4M3WA 3LDSA 2BANA 2HHWA 4CGDA 1WSEA 1LWFA 1RT5A 4BDZA 1KCFA 2OPPA 4JS4A 1Q9YA 4FLWA 1JXBA 4GVMA 1C1CA 4J2DA 3AA3A 3TI0A 3SQ4A 3SPZA 3E01A 3S3OA 4FK0A 1NK4A 2HW3A 1BCOA 3OYLA 5HP1A 4FJIA 3QLHA 2B6AA 4CF2A 3O3HA 1HYSA 1X1PA 3QIOA 3VQEA 2DFEA 4OGCA 3ZT4A 4CFDA 4B9MA 2O4GA 4ELTA 3DI6A 3K2PA 4ID1A 2Z1JA 3OYGA 1WSIA 2G8UA 3IAYA 3OJSA 4CJUA 3RTVA 4JRQA 1XHZA 1SUQA 3AVBA 3NH2A 2LSNA 1JLAA 1SV5A 3TAEA 4IKFA 3C94A 4FW1A 4CGFA 3RMBA 4KB0A 2PYJA 1SKWA 4FJMA 4CJTA 3KIOA 1U48A 1B92A 3SYZA 3ZCMA 1WLJA 4AHSA 3VQ6A 2XRIA 1VSDA 3S3NA 1KVCA 3L2VA 3TAQA 4N41A 2BGGA 5C42A 1Z26A 3SUQA 4M3UA 5K14A 3ZSYA 1CZ9A 3VQAA 4M45A 4CGJA 4BWJA 4OKKA 3DLHA 3OYEA 3ZSVA 1T05A 1XI1A 1TKDA 3KLFA 2KZMA 4CJWA 2A1SA 1JLEA 3RRHA 3RRGA 4B9UA 3AA2A 1BISA 4FLTA 2X6NA 4C8MA 2HHSA 3I0SA 3VQ7A 3ZT2A 4J2EA 4N56A 2IOCA 2GBZA 2YKNA 4HUEA 4FLVA 4OPJA 3TABA 1GOBA 4MQ3A 3AVNA 3K5NA 1S1WA 4DLGA 1TL3A 2B5JA 1C1BA 2GUIA 2RF2A 2VG5A 2XY8A 4DF8A 1NJWA 3KLHA 4CFCA 1ASWA 3DOLA 2Y1IA 4DMNA 4RW8A 4AHTA 3NCIA 2KFNA 1FK9A 2ATQA 3KK2A 2KZZA 1JL2A 3RMDA 2Z1HA 3SPYA 1SL1A 4M41A 4DFKA 3LP1A 2HHTA 3NF8A 3QERA 1ZBFA 3ZT0A 1U45A 2DFHA 3OYMA 1O1WA 4O5BA 4FM1A 4EP5A 3SUPA 4FW2A 4LY7A 3NF7A 1NOZA 3MECA 3QNOA 5HROA 4F2RA 1WSHA 3AO1A 1U04A 5EU7A 1HQEA 4KHWA 2W42A 2QK9A 1BQNA 3V6DA 3ZSWA 4DTXA 1S9EA 2ETJA 4FJXA 4Y1DA 3ITHA 4CK1A 3OYBA 5I3UA 3OS1A 1KSPA 3SV3A 4FJ9A 3AO5A 4KHQA 1RDAA 5J1EA 3KJVA 3MXJA 1T8EA 3MEGA 4Z4EA 2X74A 4DQRA 3AVLA 3O3GA 3EY1A 5HLFA 4C8LA 5KI6A 3LPTA 1CXUA 4F3TA 4CHOA 3KLIA 1BCMA 1HYVA 3DLBA 1U4BA 1RBRA 3ZSXA 1HNIA 1RBVA 2VWJA 4LH5A 1WN7A 3ZSRA 3M8QA 3C6TA 4FJLA 3S3MA 3K5MA 4C8NA 3V9UA 4KHNA 2IS3A 3LP0A 4AHRA 4W5OA 1TK5A 2JGUA 4AH9A 4CHNA 4BDYA 3QEVA 4HVJA 1TKZA 3KK1A 1IKWA 3QINA 1JLBA 3PO4A 1RT3A 1S1TA 3CM5A 3DRSA 4WE1A 3V9ZA 1UA1A 3T1AA 2HVHA 4DSIA 4DSFA 2D5RA 4FJJA 4I2QA 5JS2A 3F73A 3WNFA 3V9XA 3OYIA 4Q0BA 4W5NA 2VG7A 4FLUA 4CJ4A 2OPRA 3WNGA 4CJ3A 3HM9A 1VK0A 3QETA 3JYTA 2BE2A 4O0IA 1CZBA 4CCHA 3VQ5A 2HNYA 3SI6A 4M3ZA 5CZ1A 4RW7A 2R7YA 1FXXA 3OY9A 3NGZA 3K57A 4H8KA 4DSKA 3QEWA 4DTPA 3DRPA 4FJ5A 1RNHA 3HL8A 4OLAA 3AA5X 4IFYA 4B9SA 4DQIA 3QEPA 2D0AA 1C0TA 1VSKA 2RPIA 4CJ5A 4QCLA 3AO2A 4JS5A 1J5OA 3DYAA 4FVMA 4E7LA 4DS5A 1BI4A 4FJ7A 4DQQA 1A5XA 1Y97A 4JRPA 1SL0A 5DMRA 4RW9A 4YNQA 4W5RA 3NGYA 4B8CA 1C0MA 3VA0A 1JL1A 4HCCA 1VSFA 2GV9A 1VSLA 1TKTA
chains in the Genus database with same CATH superfamily
3LDLA 4E7KA 4HTUA 1J9AA 3F2KA 4JK9A 4DFJA 4NCGA 5FPDA 5HRSA 4KH5A 1VSHA 1F21A 3PO5A 4LFCK 4K8ZA 3HOTA 4AHCA 4XIUA 3H1VX 1NGDA 1KVBA 2IVNA 3J7AP 4JI2K 3TPQA 2QA4N 1UOCA 3O9SA 4DCHA 2GX9A 4FLZA 2F7TA 1B9DA 2YNHA 2OTLN 1IKYA 2E8AA 3UIQA 1YVUA 4BQZA 2F96A 1S6QA 1WBBA 4JI0K 2ZD1A 3HK2A 3OBYA 3P4IA 4M63C 1HNWK 3Q7CA 4PKIA 2RHKA 5BR9A 4A62A 3C0BA 2HOEA 1QQCA 4YDUC 1NKEA 4CJVA 4DG1A 3SUNA 5ADXA 4LSLA 4ID5A 3TANA 3CJ9A 3H46O 4W5TA 1QVGM 2PZSA 1LAWA 1TUYA 3CI5A 2E5LK 1C1AA 4MO4A 4YY3K 5GAHP 3TR8A 5AQSA 3DLGA 1U2VB 5KQDA 5FRNA 4CZFA 2FBYA 2YHYA 4IEIA 1ILYA 3VQ8A 3G0ZA 1HKGA 3NHGA 3EE8A 3E66A 2IGIA 4DUYK 4FM0A 2WOMA 5HBMA 3THXB 4CI6A 3L6QA 3SAGA 4B3OA 4E19A 4JI6K 3VPZA 1MWKA 3T7ZA 4CF8A 4W5QA 3SK3A 3VQQA 4X64K 3HPGA 3TARA 1VQMN 4FLYA 3SZ2A 3WNHA 2V52B 1NKCA 4QS8A 1RBUA 5J2QA 1BDGA 5AQOA 1RBSA 3NH0A 3ZYYX 3KD1E 4FWQA 1QQMA 1X9MA 5HRRA 1YAGA 5LJVA 4IO8A 4DTSA 4E0DA 4O0JA 4F8RA 1T3VA 2BTFA 2ITMA 3NF6A 4N47A 1WSFA 4BACA 5AZIA 4B1XB 3CMAN 4BREA 3ZETB 4CJLA 5C2FA 4CFBA 3OJUA 4ILGB 3MCPA 5KGXA 3U3YA 3MX5A 1FJGK 1C0UA 4E1NA 1YITN 3MAQA 2O8CB 1ZC6A 2ZJPL 2UXDK 3BZCA 2P51A 1Q86O 2QW9A 4CGIA 5H1SQ 4FJ8A 1K8AO 2DPNA 4KHUA 2ASMA 4X62K 5JICA 4GW6A 2XY5A 2HHHK 4M3XA 3L2UA 5SWMA 1IBMK 4OJRA 4CIFA 3L3UA 2HBKA 3FFIA 3LP2A 4FXDA 1EP4A 5DK5A 3QESA 1QSLA 4ELUA 2O4IA 1RCHA 3DXKA 1I39A 2CGKA 3ISNC 3DM2A 3M5RA 4CZIA 5BPNA 3HT3A 3CC2N 1KFDA 5AQTA 2A42A 1WNSA 4F9OA 1BQMA 2QWOA 5AQFA 1XHXA 3E1YA 1G15A 2QTDA 4MLHA 3DJCA 2FXUA 2FSKA 3C95A 1K6YA 3K9JA 1EWRA 3ENBA 4AQYK 4BRAA 4H4OA 2KFZA 1ZBHA 1TV6A 3WQTA 4AM6A 5BRFA 1W0HA 2XO7A 5AZIB 3CQXA 3PLAA 4WF9L 3CG7A 3O9TA 1VSEA 3AVJA 1NOYA 1TVRA 4DSJA 4JV5K 2YKMA 3THVA 1UAXA 3K0SA 2QWMA 4BRCA 3DLKA 2P5OA 1GOCA 4FZXC 3GDQA 4JI8K 4CD3A 2YHBA 3KHYA 4BRLA 3BUZB 4EZ6A 2RKIA 2YV0X 4BGAA 2OZSA 4GV3A 5AQJA 3K59A 3AA4A 3O80A 4JNEA 3CIPA 4BDPA 1ZBUA 3VTIA 1RT2A 3A2FA 4Z4GA 5LY3A 3BZKA 3KLEA 3NE6A 4CHYA 4JKHA 2HMIA 3R9PA 4B1UB 4JHDA 4M3RA 3R8EA 3DXKB 5BN9A 3VF2A 4FLXA 3DAWA 4DU1A 3QBWA 4FWPA 2O8FA 5JLHA 2AA4A 3ZSQA 3VQDA 2ITGA 4QS9A 1D4XA 1KTQA 1XC9A 3FFKB 2IC3A 3EL2A 3CJAA 3QO9A 4BVPA 4B9VA 1NJXA 1QQNA 3SUOA 2CH5A 4DR6K 3PX0A 1JXEA 3G10A 4IFEA 3ULDA 2DFFA 1RDDA 1NMDA 5FRMA 2RN2A 3AVGA 3EN9A 3LDOA 3THWA 1YJ9N 1LV5A 1MU2A 1HX1A 2UXBK 3BF1A 3VQPA 4HWIA 2HHWA 4JI3K 1RT5A 4BDZA 1JXBA 3FLCO 3TTCA 4WQ5C 4JKAA 4JK7A 3OYLA 4CJ7A 3QLHA 3QIOA 3VQEA 4OGCA 4B9MA 1XNQK 2O4GA 3K2PA 3OYGA 2Z1JA 3R1XA 4EHTA 2VQFK 3RTVA 1C0FA 1XHZA 4U67L 1SUQA 3E9OA 1YIJN 3J80O 4FSVA 1MA9B 2W40A 5AQRA 4EFHA 2P9IA 3RMBA 3A5MC 1SKWA 3LDPA 4PL8A 4GKKK 3U9DA 3WQUA 1RDWX 1VSDA 4DQ8A 2YJFA 4N41A 4OX9K 4NLBA 4CZJA 3FZFA 1BA1A 3PSIA 4CGJA 4OKKA 2NZTA 2O8FB 3CCEN 3KLFA 1M1KO 4YOTA 4A57A 4CJWA 3UE5A 3RRGA 2X6NA 4LC9B 4C8MA 1LCUA 3VQ7A 3ZX0A 4N56A 2GBZA 2YKNA 4HUEA 1GOBA 1TYQA 4MQ3A 2P9LA 3M3ZA 1OVQA 2PAVA 2RF2A 2VG5A 3L0QA 4DF8A 1NJWA 4CFCA 1ASWA 1VQLN 3DOLA 2NRVA 1FK9A 3KK2A 2NRHA 4BG9A 2E2QA 3T1YK 4M41A 4DFKA 2HHTA 5M1FA 3ZT0A 1MDUB 4FM1A 1O1WA 1NGBA 3THWB 5JLFA 4WQ5A 2GWKA 4F2RA 5EU7A 4B1VA 2W42A 1KQSM 4CBXA 3D2EA 2Q2RA 3C6HA 4ISEA 4Y1DA 5AFUH 3U4LA 4CK1A 3Q7BA 1RDAA 1T6DA 3TSQA 3RSEA 3KJVA 4Z4EA 4DQRA 3O9UA 4F3TA 4CD1A 4A61A 4CHOA 1BCMA 1HYVA 5LMUK 3ZSXA 5BR8K 4LH5A 2GELA 1WN7A 4B1YB 3VEYA 1HKCA 3S3MA 1IV0A 4C8NA 4CZEA 4W5OA 2YX6A 3SJHA 1IKWA 1JLBA 3CM5A 3DRSA 4BRKA 4DV1K 4FJJA 5JS2A 3JYTA 4O0IA 1CZBA 5CZ1A 1FXXA 1NGHA 3OY9A 3NGZA 3K57A 4DSKA 1TYQB 4DTPA 3QEPA 4QCLA 3AO2A 4HTLA 4JS5A 2A41A 3DYAA 4FJ7A 3N4PA 4DQQA 5M1KA 1A5XA 1Y97A 5DMRA 4YNQA 4BR9A 5AQZA 3VA0A 3WUHA 3H3NO 4RW4A 4KREA 4XH5A 3ZSZA 3TAGA 1IO2A 3KK3A 4CZKA 1FKPA 2VWKA 4H0VB 3HJFA 4C1NK 4AILC 1ASVA 1EKEA 2UUBK 3D2EB 3LL3A 4KO0A 1Q9XA 3THYA 3TAMA 3W0LA 3FZLA 1KLMA 2G8VA 1LAVA 3D7EO 2E20A 3RSEB 2O8BA 1TK8A 3MN5A 3QB0A 1UA0A 1TAQA 2ZM6K 3P1GA 4N5SA 2E88A 1D9FA 4CERA 3BDPA 3KLGA 1NMNA 3DLRA 3O4QA 1VRTA 4WYBA 1X9JA 3MMVA 4XH4A 4CZLA 3HPOA 3I0RA 4R79A 2HSTA 4RG8A 1E3MA 2HNZA 1HYZA 4IZ9A 2BDPA 4B3TK 3CETA 1D5AA 3SBTA 2YNIA 3MK6A 4BG8A 2X6SA 1HJOA 4H0TB 3A0IX 3LZJA 4O4GA 5AQMA 3TTDA 4OLBA 2OZMA 3ENHA 2UU9K 4EP4A 2QWPA 5KRSA 3L2WA 4BC3A 1RT4A 4Z4IA 3LWMA 4KH6A 4JKEA 1KRPA 4LFAK 3HTVA 2B4JA 3KKSA 1NK9A 5FDLA 1N34K 3L3VA 3SQ2A 4Z94A 3H3OB 3DLEA 3HYFA 3SNNA 4BE1A 3BEXA 5AQYA 4KBOA 3CCSN 2HHVA 3CMEN 4BR5A 5JMVA 4DB3A 4JKBA 2Z1IA 2F9TA 3FGUA 3EYZA 1JLQA 4DU3A 2P1JA 3K9KA 4B3SK 4O5FA 4CK3A 1HPZA 1YHQN 4FM2A 2O8BB 4JLHA 3CQ8A 1HPMA 5BRHA 3TSUA 1OH8A 5CY4A 4DR7K 5KQ8A 3UKRA 4FK4A 5CE3A 1RT7A 2OANA 4M3TA 1JCGA 2FC0A 3CM6A 3CHWA 3K5OA 4A5AA 3VGKA 1JCEA 3VEZA 1S22A 3LDQA 2HHQA 4CEDA 1R59O 4M7XA 4I9LA 3LP3A 1KAYA 4IOXA 4YOVA 3OYAA 5BPMA 5AFUA 2OCEA 3PSFA 1Q8IA 3FZHA 5AQGA 1RTDA 3WNEA 5EVZA 4MFBA 4LSNA 4E7HA 3MEDA 4CEOA 1XNRK 1BA0A 2BH1A 4R5PA 4EZ9A 1XUPO 5EX5A 3C65A 2VWBA 3GE1A 1YXQA 3SMPA 3EZ5A 1RGIA 2G8KA 3CXCM 4NO7A 3HP6A 2D0PA 3I55N 5KPTA 4G1QA 1S1UA 3KZBA 1VSJA 3DRRA 4DV7K 3JAMO 4FWRA 4KKOA 4CHPA 4A2BA 5TKWA 3AARA 1NM1A 5T7BA 3V81A 4PKHA 1SKRA 4CEEA 4OPAA 2Q0RA 3PX4A 3HBTA 4RWTA 1KAZA 3VEWA 3NF9A 1ZBSA 4NLCA 3H08A 4I9QA 4CJFA 4DQSA 1NLVA 3NH1A 5D3GA 4NB4A 4DR1K 2NUBA 3TAFA 4CF1A 1KFSA 1MWMA 4MLEA 1N6QA 4AHVA 3DOKA 3E9LA 3MX2A 2HB5A 3A8YA 3LZIA 2HF4A 2D0OA 3O3FA 1TKXA 1N8RO 1S1XA 1T44A 1W9HA 3S9HA 3RR7A 1RTHA 3AVFA 1U6ZA 4O8KA 4ISFA 3CYMA 3CJBA 4FWNA 5FROA 4PQUA 4CW7B 2IVOA 2D1KA 2A6AA 4CGHA 3VQ4A 3LDNA 3S41A 4GMJB 4B08A 3MXMA 2F9WA 4JEPA 4M42A 3CF5L 1N5YA 5GADP 3OHRA 3EKUA 2HBLA 3WXJA 5E41A 4BE0A 4DF4A 3DLLL 1TK0A 5KGWA 1NU0A 3NFAA 3CC4N 4F2SA 2HNDA 2QKKA 4IDKA 2EX3A 4FYDA 1IG9A 1RDUA 3VQCA 4DTNA 4OO1J 1X3NA 2I7PA 3AO4A 4KRFA 2WBNA 1CZAN 4IDHA 2I5JA 2P5GA 4IJNA 3R6MA 3VQBA 4BRQA 1BIZA 4UY8O 2UUAK 4AHUA 2G8IA 3CCRN 3HSTB 3IS9A 2FLOA 4B9QA 1NKBA 3G25A 5CYQA 3HXMA 4HUGA 5JS1A 1EX4A 1RDCA 4V19S 1YTUA 3RMCA 3OS0A 4CJEA 3U9ZA 4CEBA 4KTZA 4FOIA 3T3FA 1W7AA 5AQKA 4CZGA 2OA8A 4DV0K 4LFBK 5FPEA 2QM1A 4GVEA 1JLFA 1ITGA 3AVCA 3P39A 4DQPA 4K41A 2P9PA 4CIEA 4CF9A 4DTUA 3LDSA 2BANA 1Q9YA 1KCFA 1VHXA 4J2DA 2HF3A 3AA3A 3LM2A 1C0GA 3SPZA 5FPMA 5AQQA 1NK4A 3O9RA 3T1HK 4YOUA 5M1OA 4FJIA 1DGKN 4CF2A 4WFAL 1XMOK 2F8SA 5AZJA 3AVBA 4JKGA 4JKCA 1EO1A 3TAEA 1E4FT 4FW1A 1LOTB 4KB0A 1JJ2M 3GG4A 4H5NA 4CJTA 4FJMA 1U48A 2GWJA 3ZCMA 1WLJA 2XRIA 3G6EN 4B1ZA 2BGGA 3TAQA 1Z26A 3SUQA 4M3UA 1CZ9A 1E4GT 4M45A 3DLHA 3WXLA 3OYEA 3ZSVA 1JLEA 4B9UA 1BISA 3HSCA 3ZT2A 2YJEA 2I7NA 4JN4A 3K5NA 3AVNA 1S1WA 1C1BA 2GUIA 2Y1IA 4DMNA 3NCIA 2AP1A 2QXLA 3SPYA 3WEEA 2HBJA 4IXCA 4EP5A 1Q7YO 3NF7A 2P9PB 1U04A 1XQSC 3ZSWA 4DR4K 1WOQA 1S9EA 2P9SA 4FJXA 4MDBA 3SV3A 3VOVA 5J1EA 1EQYA 2X74A 3O3GA 3EY1A 3J8AA 5AZJB 1Z6RA 1N36K 4NXMK 1U4BA 3CJ1A 1NJIO 1RBVA 3SBGA 3ZSRA 3L4QA 3M8QA 3CD6N 2KHOA 4YHHK 4KHNA 2IS3A 3LP0A 4AHRA 1TK5A 3ULEA 5AQPA 3KK1A 4BRPA 3LM9A 3PO4A 1S1TA 2VQEK 4WE1A 4L3QA 1UA1A 2HVHA 2D5RA 2VYPA 3EKSA 3UKUA 3WNFA 3V9XA 3OYIA 3EEQA 2VG7A 4FLUA 4CJ4A 3BP8A 3QETA 4CCHA 2BE2A 2ZJRL 5TKYA 3VQ5A 2HNYA 3SI6A 3O6WA 4WCEL 4RW7A 2R7YA 4JI5K 4H8KA 3QEWA 4FJ5A 3AAPA 4OLAA 3HL8A 4BRIA 2D0AA 1C0TA 1VSKA 5B8HA 1FW6A 1J5OA 4FVMA 4DS5A 4JRPA 4RW9A 4OPHA 3WEEB 1JL1A 2GV9A 1VAZA 1J5EK 4H5RA 1XWLA 4NYFA 2CH6A 1ZBLA 4EHUA 1O13A 4E1MA 3F9KA 2WONA 2E6LA 4YORA 4OKJA 4BROA 4A5BA 2QI2A 1X9SA 2P9SB 1SZ2A 1Q18A 4BRDA 1J53A 4A59A 4MDAA 3MN9A 1DEJA 3AVAA 4I7FA 3OYCA 3ZEUA 3CPEA 5M1PA 2G8HA 3OW2M 3ASMA 4JHDB 3PIOL 1FKOA 3ULEB 4KHYA 4ILJA 1D9DA 1DTQA 3VEXA 3QMLA 4EAHD 4QS7A 4FVUA 4H03B 2ZGYA 2KKZA 2V7YA 2FSNA 3QDKA 4FL9A 4ZHRA 4FWMA 4H0PA 3KVGA 1WAFA 2G8WA 4BQLA 3W3DA 3NBPA 4DLEA 3B6PA 4B9TA 3T19A 1HUXA 4ILHA 2JLEA 3NAEA 2IDOA 1HJRA 4LF9K 4CJRA 1RTIA 1VQPN 1V4TA 3RMAA 3C6UA 1YJWN 1DKGD 3EE9A 1YF5L 4LD0A 4E7JA 4KB1A 4FJKA 2CGJA 4IG0A 5C10A 1QZ6A 4H0YB 3HVRA 1BHLA 2UXCK 2O8DA 1Q81O 1I3AA 4CHQA 1Z05A 3V9SA 3UB5A 4C8KA 3KD5E 3OVNA 1GOAA 1VQON 2P9UA 3QBXA 5C25A 1QHTA 2YNGA 2G8FA 3CQYA 3LALA 3H6EA 3M8RA 1IKVA 3M8SA 5HRNA 4E7IA 2P9IB 5AQXA 1RBTA 3I8DA 2RE2A 1IJJA 1KD1O 3ZEUB 4B8AB 1P90A 1ATNA 1ASUA 5GIPA 5AQNA 4K42A 1SAZA 5IT9O 4IG3A 5CHIA 4BC5A 3D0PA 5J2PA 4KAZA 2EHGA 4DFPA 4NYNA 3QEXA 1SS6A 5A2QO 2A40A 3PUFA 4DTMA 2P9LB 3SJJA 3BGRA 3AGKA 3O4NA 4FJHA 4J8FA 5CZ2A 1C6VA 3NVKA 1T7PA 4JI7K 2WUSA 1CLQA 2E2PA 3NVMA 3D45A 4E89A 5CR4A 3CCQN 4BR0A 1ATRA 3QEIA 2DTUA 1BIUA 3VGMA 2VG6A 2W41A 4OPKA 1K8KA 3VEVA 4Y0WA 3TTFA 2HHXA 4DV5K 1NK6A 3CFPA 2O8DB 4KPYA 2HVIA 3NDKA 3ZT1A 4I6MA 1NGJA 4CE9A 5KRTA 1VQ9N 4CK2A 3I33A 3J81O 2XHBA 2E6MA 2E2NA 3CPWM 4BGBA 3SAHA 4CFAA 1NK7A 1KAXA 4OVLA 3PV8A 3O5BA 2CGLA 3L2QA 2ZWHA 3QNNA 3CFRA 4CHZA 4ELVA 2IAJA 4EIAA 3N4QA 5AQHA 1NGIA 3H45C 1LW2A 3SV4A 4J2BA 4GV6A 2QEXN 4BR2A 4F4KA 1WSGA 1HNVA 4B9NA 1S5JA 4GV9A 4KTQA 1WB9A 3LWLA 3HPHA 3VERA 5GINA 1HRHA 1A5WA 2OPQA 1CXQA 1I94K 3MDQA 2D0CA 3FR0A 4CEFA 4CGGA 4FWKA 2FBTA 3D2FA 2F8TA 2YHXA 2NLXA 3O8MA 4LF8K 4H5WA 4KI4A 1WSJA 4TSXA 2DY4A 4GY2B 4B9LA 3CCUN 4NCAA 3QICA 2IIRA 1UWBA 5AR0A 3A5OC 1N33K 2HHUA 1TAUA 3AAQA 1HQUA 2FSJA 1DTTA 3GOIA 4J2AA 3CFOA 2YNFA 1BG3A 1H1VA 4IOAL 4ICLA 3THYB 4I6MB 2HMPA 4BY9C 1VQKN 1NWKA 4DV6K 2V51B 3GL1A 1WAJA 3KKRA 4C8OA 1LW0A 4BE2A 4FPAA 2FF6A 3A5NC 3CERA 4PA1A 1QSSA 1L3UA 1JLCA 4WQ4C 3VENA 3IMXA 4GKJK 5EOYA 3CCJN 2FBVA 3RWUA 2VGMA 3MCAB 3WXIA 4LF6K 4KV8A 4QAGA 3OYFA 1KLNA 3AVHA 3V1OA 3G71N 4K8XA 5KTQA 4FZYA 5HRPA 1S6PA 1A5VA 2WFBA 1ZBIA 3OYKA 3P5JA 3OYNA 3CJ7A 3VMFB 3K5LA 1VSMA 2ZE2A 3D2FB 1HNZK 4PHTX 3CCVN 1GLEG 1HKBA 2NRTA 4C1NI 1HR0K 1P8ZA 3DMJA 3O4WA 4HCBA 2Q31A 1JCFA 4XH1A 4BR7A 4CF0A 3ZT3A 5JVHL 1D8YA 4QOZB 2KQ2A 3G4SN 1HMVA 4Y1CA 3O08A 3TAPA 1HNXK 4Q5VA 3ZX2A 4H0XB 5JVGL 4M3WA 1NGAA 2OPPA 1GLDG 4FLWA 1C1CA 3C7NA 4DKWA 5HOOA 3SQ4A 3E01A 4FK0A 1BCOA 2VGNA 1YUWA 3MWTA 4FO0A 5HP1A 1IG8A 1VQ7N 3O3HA 2DFEA 4CFDA 4ELTA 3DI6A 2G8UA 4WQ4A 3THXA 3OJSA 3UKRB 4CJUA 4JRQA 4FWOA 3NH2A 2LSNA 1JLAA 3ID6A 4K25A 1SV5A 3C94A 4CGFA 4RTFD 4AM7A 3S3NA 3L2VA 5C42A 5K14A 3HZ6A 4FWSA 4BWJA 3HM8A 1T05A 2KZMA 4XEIA 3AA2A 4FLTA 4FPBA 4J2EA 2IOCA 4FLVA 4DV2K 1TL3A 2B5JA 2XY8A 5ELZA 3KLHA 2F4VK 3M6GA 5FLXO 4RW8A 4AHTA 1IBKK 2KZZA 4IOCL 1SL1A 3SAFA 1OVYA 2ZF5O 3LP1A 3NF8A 1ZBFA 1U45A 3OYMA 2Q97A 4K0KK 4LF4K 4WFBL 3ZETA 1WSHA 3AO1A 1HQEA 4KHWA 4C23A 3ID8A 2QK9A 1BQNA 3C7NB 4YOXA 2ETJA 1ATSA 3KWIA 1OH6A 4E1JA 3OYBA 2YHWA 5KPZA 2O8CA 4FJ9A 3AO5A 3RVCA 3SLCA 3MXJA 3MEGA 4KHPK 3AVLA 4C8LA 3LPTA 1CXUA 1NGCA 3KLIA 3DLBA 1RBRA 4JYAK 1HNIA 3C6TA 1YJNN 3J7ZO 1KC8O 3HOSA 1BO5O 3K5MA 4A2AA 2JGUA 4AH9A 3QEVA 3V9ZA 1ESVA 3T1AA 4DSFA 3F73A 4DV4K 4W5NA 1Y64A 4CJ3A 4NXNK 2V7ZA 4YDUA 3HI0A 3A5LC 4M3ZA 1EWQA 2QWLA 3IUCA 3KK7A 1RNHA 3AA5X 4IFYA 4DQIA 2RPIA 4E7LA 1BI4A 4BRGA 2A5XA 1SL0A 4GNIA 3NGYA 4B8CA 1NNEA 1C0MA 4HCCA 1QZ5A 3TI0A 1TKTA 4CIGA 4CJKA 5AQWA 5BN8A 2KW4A 4DS4A 3OBWA 3NMUA 4DTOA 1QE1A 1RT6A 3CCMN 1BUPA 2PYLA 1RT1A 5IWAK 4RW6A 1TL1A 3OYHA 5LL6Z 4OKEA 3AVMA 1B9FA 3E9PA 5M1QA 1TGOA 4FZZA 3IRXA 1SL2A 1J54A 3AV9A 3O1WA 4OGEA 3DXMA 2VCPA 1YT3A 4PKGA 3O9QA 4JAXA 1L3VA 4JKFA 1U49A 1L3SA 1LWCA 1GLFO 4PUOA 3F5TA 4KHSA 2ZGZA 3VESA 4YFUA 2XY6A 3LAKA 3CCLN 3KWGA 4Z0UA 3TWHA 5GIOA 1VQ4N 1Q82O 1RTJA 3ZLJA 1DT9A 5M1NA 4KI6A 2A3ZA 1NK8A 2AJQA 2ZQBA 3I56N 1VQNN 1NGFA 4IWVA 3OYDA 1JLGA 1IH7A 5SZTA 1BI4B 3MWPA 3RR8A 4FK2A 3V4IA 2BUPA 4BWMA 1LWEA 3MEEA 3U6FA 1K73O 2NRWA 5C12A 2D0BA 3ENOA 5AQLA 1G99A 2KTQA 3GBTA 3B6OA 2P9NA 4IEEA 4NCBA 4JD2A 3U8XA 1X9WA 4BRNA 4PY5A 2NRZA 4DR5K 3QIPA 1RDBA 3ZSOA 1NK0A 1KVAA 4JKGB 1QHAA 3VN5A 3AO3A 4X66K 3LPUA 2NRXA 3T69A 2IVPA 4KTWA 2NRRA 4CJSA 1NJYA 3B8AX 1QSYA 3NGIA 3DXMB 4CECA 2E1ZA 3IFRA 4M7YA 1YI2N 3KTQA 2Q0UA 3IG1A 2ZJQL 3QFUA 3O1BA 3MXIA 1WBDA 2QWQA 4CZMA 4IJAA 2YHAA 1RILA 5DM6L 4ZTFA 3BF3A 4DSEA 5AQVA 1L5UA 1ZYQA 3WT0A 3WXMB 4FJNA 5FPNA 2ASOA 2E1YA 2A1RA 2Z1GA 3HO1A 3LANA 1X3MA 1OKJA 4IBNA 3BY5A 5GAEP 3PX6A 1GLJO 2P9KA 1QTMA 5BPLA 1JKHA 1U47A 3PY8A 1BGXT 1S9GA 4CEQA 4IFVA 4O55A 4U7BA 4DHYA 2O8EA 4HUFA 3PIPL 2OYQA 4DU4A 4JI1K 4LF5K 3U3GA 4BC4A 4BC2A 4BRHA 2P9NB 5DM7L 4JD2B 3TU5A 1RFQA 1SQKA 3TSPA 1EETA 4JK8A 4DR2K 3L4IA 4ZTJA 3V1RA 4Z4CA 2FBXA 1NGEA 3V9WA 2QWNA 1K9MO 3VETA 1BOTO 4O8UA 1M90O 1TUUA 4HHTA 3SQ0A 3VA3A 4YOYA 1NGGA 5J2NA 1QQOA 3AVIA 2UYTA 4CJPA 3JSMA 4H5TA 3UKUB 2E4LA 1QVFM 3M8PA 5F0XA 3AVKA 5BRDA 3M1FA 4UQGA 4CESA 3FE1A 2Y1JA 3SCXA 3JXUA 3AY9A 4BR4A 5C0YA 3VQ9A 1V4SA 2GTDA 4O44A 3CC7N 2D4WA 1BL3A 1KXPA 1NK5A 3P31A 2P9KB 3D6RA 4DTJA 3OYJA 4FCYA 3ATUA 4M3YA 2X78A 4FWLA 5BREA 4H5VA 2O8EB 5F1XA 1ZXOA 3LAMA 5LJWA 1VSIA 1Z25A 1NJZA 3L2RA 1VQ8N 4F3OA 1T6CA 3V1QA 5HL7L 3OS2A 2OTJN 2NNWA 2JWKA 5C24A 2QXFA 2XY7A 5GAGP 4G9ZA 1DLOA 3P83D 4CVNE 2PY5A 3OA9A 3IDHA 1VRUA 5CYMA 2KLAA 3MN6A 3ZX3A 4PWDA 1L3TA 4I2PA 1T03A 4H4MA 4Z4FA 3K58A 4WFNL 1NBWA 4DFMA 2QKBA 3AGRA 4E3SA 4CBWA 2GEMA 3VGLA 4N76A 1SKSA 4DWIA 5I9EB 3ALYA 1S1VA 2HBMA 1EXQA 3EO3A 4CJQA 1BWFO 1W2BM 4KFBA 4Z4HA 4CZHA 1IKXA 1OH7A 5J2MA 2Q3SA 3HVTA 1R0AA 3HP9A 5I42A 4DSLA 2YCHA 1REVA 2OPSA 4DUZK 1W97L 3EZWA 4L8RB 2UUCK 1YTAA 3SQ1A 4CEAA 4BRFA 2EWSA 4FJGA 3C6AA 3VEOA 4AF1A 4LH4A 4DTRA 3L8BA 3FZMA 1QS4A 4CEZA 4PL7A 5AJ3K 4CBUA 2P9UB 4CGDA 5ADXH 1WSEA 1LWFA 4JS4A 3VF4A 1BU6O 4GVMA 3S3OA 3DWLA 2HW3A 3J7YP 4B3RK 4MO5A 2B6AA 1HYSA 1X1PA 4BRMA 3ZT4A 3OTOK 1OH5A 4JI4K 3IAYA 4ID1A 1WSIA 4ISGA 5KPRA 4FOEA 4IKFA 3H1QA 2PYJA 3KIOA 1B92A 3SYZA 4AHSA 3VQ6A 5C2DA 1KVCA 3P38A 3ZSYA 4LF7K 4B3MK 3ATVA 3VQAA 2PFUA 3MN7A 5E26A 2J4RA 4IO9L 2WTUA 1XI1A 1TKDA 2Q36A 2A1SA 3RRHA 1IBLK 1J6ZA 5EY4A 4X65K 3I0SA 2HHSA 2H3GX 2E2OA 3QFPA 4OPJA 3TABA 4DLGA 5AQIA 4JKDA 1K8KB 2KFNA 2ATQA 1JL2A 3RMDA 2Z1HA 3IKMA 1GLLO 4K43A 2W6LA 3QERA 2DFHA 4O5BA 4DV3K 3CJCA 3SUPA 4FW2A 4LY7A 1NOZA 5MLCQ 2YI1A 3MECA 3QNOA 5HROA 1XC3A 1WUAA 1VQ6N 1NG9A 3V6DA 1S72N 1YVNA 4DTXA 4DR3K 3ITHA 5I3UA 4H0OA 3OS1A 5E84A 2FF3B 1KSPA 4KHQA 2GUPA 4YOWA 1T8EA 1HLUA 3WXKA 4B1WB 5EXWA 5HLFA 3JS6A 5KI6A 2VWJA 4FJLA 5AQUA 2WC9A 5LMNK 2ASPA 3V9UA 4RCHA 5C15A 4CHNA 4BDYA 4HVJA 1TKZA 3I8BA 2PBDA 3QINA 1S3XA 1RT3A 5F2RA 2JWLA 4DSIA 4I2QA 4Q0BA 2W6KA 1N32K 2OPRA 3WNGA 3HM9A 1VK0A 3F9MA 3R3LA 3FZKA 2QWRA 4BVOA 3HRGA 3DRPA 1GLCG 4B9SA 3VTHA 4CJ5A 1GLBG 3SMSA 1VQ5N 2Q1NA 3VF6A 4KH4A 1GLAG 1U2VA 4W5RA 1XMQK 1VSFA 1VSLA
chains in the Genus database with same CATH topology
4RW4A 4CIGA 4KREA 1XWLA 4NYFA 3ZSZA 4HTUA 4E7KA 4CJKA 3TAGA 1IO2A 1J9AA 3KK3A 1ZBLA 1FKPA 2KW4A 4E1MA 4DS4A 3F9KA 4DFJA 2WONA 2VWKA 2E6LA 4NCGA 4DTOA 4OKJA 3HJFA 1QE1A 1RT6A 1ASVA 1EKEA 5HRSA 4AILC 2PYLA 1RT1A 4KO0A 1VSHA 1F21A 1X9SA 4RW6A 3PO5A 1TL1A 3OYHA 1Q9XA 3TAMA 4K8ZA 4AHCA 4OKEA 1KLMA 2G8VA 3AVMA 1J53A 1B9FA 1LAVA 4XIUA 1KVBA 1TK8A 1TGOA 4FZZA 3IRXA 4I7FA 3AVAA 1UA0A 1TAQA 3OYCA 3P1GA 4N5SA 1D9FA 4CERA 3BDPA 1SL2A 3KLGA 2G8HA 1UOCA 3ASMA 1J54A 3AV9A 3DLRA 1FKOA 3O4QA 4FLZA 1VRTA 4OGEA 1B9DA 2YNHA 3HPOA 1IKYA 1YT3A 3UIQA 1YVUA 4KHYA 2F96A 3I0RA 1DTQA 1D9DA 1S6QA 2ZD1A 1L3VA 3HK2A 1U49A 4RG8A 1L3SA 1LWCA 4PUOA 4ZHRA 4KHSA 2HNZA 4YFUA 1HYZA 2XY6A 3LAKA 2BDPA 1WAFA 4Z0UA 1D5AA 1QQCA 3TWHA 1NKEA 2G8WA 2YNIA 4CJVA 4DG1A 3SUNA 1RTJA 2X6SA 3NBPA 4DLEA 4KI6A 3B6PA 4LSLA 4ID5A 4O4GA 3LZJA 1NK8A 4B9TA 3TANA 4OLBA 2AJQA 2OZMA 3T19A 4W5TA 2ZQBA 2PZSA 4EP4A 1LAWA 5KRSA 3OYDA 3L2WA 1JLGA 1RT4A 2JLEA 1IH7A 3NAEA 3LWMA 4Z4IA 1C1AA 5SZTA 1BI4B 3TR8A 2IDOA 1HJRA 3RR8A 4FK2A 3DLGA 3V4IA 4CJRA 1RTIA 1KRPA 5FRNA 2B4JA 4BWMA 1LWEA 3KKSA 3MEEA 3U6FA 3C6UA 3RMAA 1NK9A 5FDLA 2D0BA 3L3VA 3SQ2A 4LD0A 4E7JA 4KB1A 4FJKA 3DLEA 3HYFA 3SNNA 4BE1A 2FBYA 4IG0A 3HVRA 2KTQA 1BHLA 1I3AA 3VQ8A 3B6OA 4CHQA 2HHVA 4NCBA 3G0ZA 3NHGA 3V9SA 2Z1IA 1X9WA 4C8KA 3KD5E 3OVNA 4PY5A 3EYZA 1JLQA 1GOAA 2IGIA 4FM0A 2WOMA 4DU3A 2P1JA 5HBMA 3QIPA 1QHTA 1RDBA 2YNGA 3ZSOA 5C25A 2G8FA 4CK3A 1NK0A 1KVAA 1HPZA 3LALA 3VN5A 3AO3A 4E19A 3M8RA 4FM2A 4B3OA 1IKVA 3LPUA 3M8SA 5HRNA 4E7IA 3I8DA 1RBTA 4JLHA 4KTWA 3CQ8A 4B8AB 4CF8A 1ASUA 4CJSA 4W5QA 5CY4A 3VQQA 4FK4A 1NJYA 1QSYA 3HPGA 3NGIA 3TARA 1RT7A 4IG3A 4CECA 4FLYA 3SZ2A 4M3TA 3D0PA 3WNHA 2FC0A 3CM6A 5J2PA 3K5OA 4KAZA 1NKCA 2EHGA 4DFPA 3KTQA 4NYNA 1RBUA 5J2QA 3IG1A 3QEXA 2HHQA 3MXIA 1RBSA 3PUFA 3NH0A 4CEDA 3KD1E 4DTMA 2YHAA 1RILA 4ZTFA 3SJJA 3BGRA 3O4NA 4DSEA 4I9LA 1L5UA 1ZYQA 4FJHA 5CZ2A 1C6VA 4FJNA 1X9MA 3LP3A 1T7PA 5HRRA 2A1RA 2Z1GA 3HO1A 1CLQA 3LANA 4DTSA 3OYAA 4E0DA 3D45A 4E89A 3QEIA 2DTUA 4PWDA 4IBNA 1BIUA 4O0JA 4F8RA 2VG6A 1Q8IA 3PX6A 3NF6A 4N47A 4OPKA 1RTDA 1QTMA 1WSFA 1JKHA 3WNEA 1U47A 4BACA 4MFBA 1BGXT 1S9GA 4LSNA 3PY8A 4CEQA 4E7HA 4IFVA 4O55A 3MEDA 4CEOA 4CJLA 4HUFA 4R5PA 4EZ9A 2HHXA 4CFBA 3OJUA 2OYQA 5KGXA 4DU4A 1NK6A 3EZ5A 2G8KA 3U3YA 3CFPA 3U3GA 1C0UA 4E1NA 4KPYA 2HVIA 3HP6A 3NDKA 3MAQA 3ZT1A 4CE9A 5KRTA 4CK2A 2P51A 4G1QA 4CGIA 1EETA 1S1UA 2XHBA 2E6MA 4FJ8A 1VSJA 3DRRA 4KHUA 4CFAA 1NK7A 4CHPA 4KKOA 4OVLA 3PV8A 4ZTJA 3V1RA 3L2QA 3QNNA 4GW6A 5T7BA 3CFRA 4CHZA 4Z4CA 2FBXA 3L2UA 2IAJA 5SWMA 3V9WA 3V81A 4ELVA 4M3XA 1SKRA 4CEEA 4OJRA 4CIFA 1LW2A 3L3UA 3SV4A 4HHTA 3SQ0A 3FFIA 4J2BA 3LP2A 3VA3A 4FXDA 3PX4A 1EP4A 1WSGA 5DK5A 1HNVA 4B9NA 4F4KA 5J2NA 3QESA 1QSLA 3AVIA 4ELUA 2O4IA 1S5JA 1RCHA 3ISNC 1I39A 4CJPA 3DM2A 3NF9A 3JSMA 4KTQA 3LWLA 3HPHA 4I9QA 3H08A 3HT3A 4CJFA 1HRHA 2E4LA 1KFDA 4DQSA 3NH1A 1A5WA 2OPQA 1CXQA 1WNSA 5D3GA 1BQMA 2NUBA 3M8PA 4CF1A 3TAFA 2D0CA 1XHXA 1KFSA 4CEFA 4CGGA 2FBTA 1N6QA 1G15A 3AVKA 4AHVA 2F8TA 4UQGA 3DOKA 4CESA 2Y1JA 2HB5A 3SCXA 3LZIA 3C95A 3O3FA 1K6YA 1TKXA 4KI4A 1WSJA 4TSXA 2DY4A 3VQ9A 4B9LA 1S1XA 4NCAA 1W9HA 4O44A 3S9HA 3RR7A 1BL3A 4H4OA 2XY5A 2KFZA 1ZBHA 1RTHA 1TV6A 3AVFA 1NK5A 1UWBA 1TAUA 2HHUA 4DTJA 1W0HA 3OYJA 4FCYA 2XO7A 1HQUA 2X78A 4M3YA 3CG7A 3CYMA 1DTTA 1VSEA 3AVJA 5FROA 4PQUA 4J2AA 3CFOA 3LAMA 1NOYA 1VSIA 1Z25A 2YNFA 2F8SA 4CGHA 1TVRA 3VQ4A 1NJZA 3L2RA 4DSJA 4ICLA 4GMJB 2YKMA 4B08A 1UAXA 3THVA 3MXMA 4F3OA 3DLKA 3V1QA 2P5OA 1GOCA 4FZXC 4M42A 1N5YA 3OS2A 2YHBA 5C24A 4BE0A 2QXFA 1WAJA 5E41A 4DF4A 2XY7A 4EZ6A 2RKIA 3KKRA 1TK0A 5KGWA 4C8OA 1LW0A 4BE2A 3NFAA 1DLOA 2YV0X 3P83D 2OZSA 4PA1A 1QSSA 3K59A 2PY5A 4F2SA 1VRUA 2HNDA 5CYMA 2QKKA 4IDKA 2EX3A 3AA4A 1L3UA 1IG9A 1L3TA 1JLCA 4I2PA 1T03A 4BDPA 1ZBUA 4H4MA 3VQCA 1RT2A 3A2FA 4DTNA 4Z4GA 3AO4A 4Z4FA 3K58A 3KLEA 3NE6A 4KRFA 2QKBA 4DFMA 2FBVA 3RWUA 4CHYA 4E3SA 4KV8A 4QAGA 2I5JA 3OYFA 2HMIA 2P5GA 4N76A 1SKSA 3VQBA 1KLNA 4M3RA 4DWIA 4FLXA 3ALYA 3AVHA 3V1OA 1BIZA 1S1VA 4K8XA 4AHUA 5KTQA 2G8IA 1EXQA 3HSTB 4CJQA 1S6PA 1A5VA 5HRPA 4DU1A 4FZYA 1ZBIA 3IS9A 3P5JA 3OYKA 4KFBA 3OYNA 4Z4HA 3ZSQA 1NKBA 1IKXA 3VQDA 2ITGA 5CYQA 1VSMA 3K5LA 3HXMA 4HUGA 5J2MA 2Q3SA 2ZE2A 3HVTA 1EX4A 1R0AA 4FYDA 5JS1A 1RDCA 1KTQA 1XC9A 1YTUA 3RMCA 2IC3A 4CJEA 3OS0A 4CEBA 3HP9A 3QO9A 4KTZA 5I42A 1NJXA 4B9VA 4DSLA 3SUOA 1REVA 2OPSA 3T3FA 3DMJA 3PX0A 2OA8A 4HCBA 1JXEA 4L8RB 3G10A 1YTAA 3SQ1A 3ULDA 4CF0A 4CEAA 3ZT3A 2DFFA 1RDDA 1D8YA 4FJGA 1JLFA 4QOZB 5FRMA 2KQ2A 2RN2A 1HMVA 4Y1CA 4LH4A 4DTRA 3AVGA 3TAPA 3L8BA 1QS4A 1ITGA 4Q5VA 3AVCA 1LV5A 4DQPA 1MU2A 4CEZA 4CIEA 3VQPA 4CF9A 4DTUA 4M3WA 3LDSA 2BANA 2HHWA 4CGDA 1WSEA 1LWFA 1RT5A 4BDZA 1KCFA 2OPPA 4JS4A 1Q9YA 4FLWA 1JXBA 4GVMA 1C1CA 4J2DA 3AA3A 3TI0A 3SQ4A 3SPZA 3E01A 3S3OA 4FK0A 1NK4A 2HW3A 1BCOA 3OYLA 5HP1A 4FJIA 3QLHA 2B6AA 4CF2A 3O3HA 1HYSA 1X1PA 3QIOA 3VQEA 2DFEA 4OGCA 3ZT4A 4CFDA 4B9MA 2O4GA 4ELTA 3DI6A 3K2PA 4ID1A 2Z1JA 3OYGA 1WSIA 2G8UA 3IAYA 3OJSA 4CJUA 3RTVA 4JRQA 1XHZA 1SUQA 3AVBA 3NH2A 2LSNA 1JLAA 1SV5A 3TAEA 4IKFA 3C94A 4FW1A 4CGFA 3RMBA 4KB0A 2PYJA 1SKWA 4FJMA 4CJTA 3KIOA 1U48A 1B92A 3SYZA 3ZCMA 1WLJA 4AHSA 3VQ6A 2XRIA 1VSDA 3S3NA 1KVCA 3L2VA 3TAQA 4N41A 2BGGA 5C42A 1Z26A 3SUQA 4M3UA 5K14A 3ZSYA 1CZ9A 3VQAA 4M45A 4CGJA 4BWJA 4OKKA 3DLHA 3OYEA 3ZSVA 1T05A 1XI1A 1TKDA 3KLFA 2KZMA 4CJWA 2A1SA 1JLEA 3RRHA 3RRGA 4B9UA 3AA2A 1BISA 4FLTA 2X6NA 4C8MA 2HHSA 3I0SA 3VQ7A 3ZT2A 4J2EA 4N56A 2IOCA 2GBZA 2YKNA 4HUEA 4FLVA 4OPJA 3TABA 1GOBA 4MQ3A 3AVNA 3K5NA 1S1WA 4DLGA 1TL3A 2B5JA 1C1BA 2GUIA 2RF2A 2VG5A 2XY8A 4DF8A 1NJWA 3KLHA 4CFCA 1ASWA 3DOLA 2Y1IA 4DMNA 4RW8A 4AHTA 3NCIA 2KFNA 1FK9A 2ATQA 3KK2A 2KZZA 1JL2A 3RMDA 2Z1HA 3SPYA 1SL1A 4M41A 4DFKA 3LP1A 2HHTA 3NF8A 3QERA 1ZBFA 3ZT0A 1U45A 2DFHA 3OYMA 1O1WA 4O5BA 4FM1A 4EP5A 3SUPA 4FW2A 4LY7A 3NF7A 1NOZA 3MECA 3QNOA 5HROA 4F2RA 1WSHA 3AO1A 1U04A 5EU7A 1HQEA 4KHWA 2W42A 2QK9A 1BQNA 3V6DA 3ZSWA 4DTXA 1S9EA 2ETJA 4FJXA 4Y1DA 3ITHA 4CK1A 3OYBA 5I3UA 3OS1A 1KSPA 3SV3A 4FJ9A 3AO5A 4KHQA 1RDAA 5J1EA 3KJVA 3MXJA 1T8EA 3MEGA 4Z4EA 2X74A 4DQRA 3AVLA 3O3GA 3EY1A 5HLFA 4C8LA 5KI6A 3LPTA 1CXUA 4F3TA 4CHOA 3KLIA 1BCMA 1HYVA 3DLBA 1U4BA 1RBRA 3ZSXA 1HNIA 1RBVA 2VWJA 4LH5A 1WN7A 3ZSRA 3M8QA 3C6TA 4FJLA 3S3MA 3K5MA 4C8NA 3V9UA 4KHNA 2IS3A 3LP0A 4AHRA 4W5OA 1TK5A 2JGUA 4AH9A 4CHNA 4BDYA 3QEVA 4HVJA 1TKZA 3KK1A 1IKWA 3QINA 1JLBA 3PO4A 1RT3A 1S1TA 3CM5A 3DRSA 4WE1A 3V9ZA 1UA1A 3T1AA 2HVHA 4DSIA 4DSFA 2D5RA 4FJJA 4I2QA 5JS2A 3F73A 3WNFA 3V9XA 3OYIA 4Q0BA 4W5NA 2VG7A 4FLUA 4CJ4A 2OPRA 3WNGA 4CJ3A 3HM9A 1VK0A 3QETA 3JYTA 2BE2A 4O0IA 1CZBA 4CCHA 3VQ5A 2HNYA 3SI6A 4M3ZA 5CZ1A 4RW7A 2R7YA 1FXXA 3OY9A 3NGZA 3K57A 4H8KA 4DSKA 3QEWA 4DTPA 3DRPA 4FJ5A 1RNHA 3HL8A 4OLAA 3AA5X 4IFYA 4B9SA 4DQIA 3QEPA 2D0AA 1C0TA 1VSKA 2RPIA 4CJ5A 4QCLA 3AO2A 4JS5A 1J5OA 3DYAA 4FVMA 4E7LA 4DS5A 1BI4A 4FJ7A 4DQQA 1A5XA 1Y97A 4JRPA 1SL0A 5DMRA 4RW9A 4YNQA 4W5RA 3NGYA 4B8CA 1C0MA 3VA0A 1JL1A 4HCCA 1VSFA 2GV9A 1VSLA 1TKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RW4 A;  4CIG A;  4KRE A;  1XWL A;  4NYF A;  3ZSZ A;  4HTU A;  4E7K A;  4CJK A;  3TAG A;  1IO2 A;  1J9A A;  3KK3 A;  1ZBL A;  1FKP A;  2KW4 A;  4E1M A;  4DS4 A;  3F9K A;  4DFJ A;  2WON A;  2VWK A;  2E6L A;  4NCG A;  4DTO A;  4OKJ A;  3HJF A;  1QE1 A;  1RT6 A;  1ASV A;  1EKE A;  5HRS A;  4AIL C;  2PYL A;  1RT1 A;  4KO0 A;  1VSH A;  1F21 A;  1X9S A;  4RW6 A;  3PO5 A;  1TL1 A;  3OYH A;  1Q9X A;  3TAM A;  4K8Z A;  4AHC A;  4OKE A;  1KLM A;  2G8V A;  3AVM A;  1J53 A;  1B9F A;  1LAV A;  4XIU A;  1KVB A;  1TK8 A;  1TGO A;  4FZZ A;  3IRX A;  4I7F A;  3AVA A;  1UA0 A;  1TAQ A;  3OYC A;  3P1G A;  4N5S A;  1D9F A;  4CER A;  3BDP A;  1SL2 A;  3KLG A;  2G8H A;  1UOC A;  3ASM A;  1J54 A;  3AV9 A;  3DLR A;  1FKO A;  3O4Q A;  4FLZ A;  1VRT A;  4OGE A;  1B9D A;  2YNH A;  3HPO A;  1IKY A;  1YT3 A;  3UIQ A;  1YVU A;  4KHY A;  2F96 A;  3I0R A;  1DTQ A;  1D9D A;  1S6Q A;  2ZD1 A;  1L3V A;  3HK2 A;  1U49 A;  4RG8 A;  1L3S A;  1LWC A;  4PUO A;  4ZHR A;  4KHS A;  2HNZ A;  4YFU A;  1HYZ A;  2XY6 A;  3LAK A;  2BDP A;  1WAF A;  4Z0U A;  1D5A A;  1QQC A;  3TWH A;  1NKE A;  2G8W A;  2YNI A;  4CJV A;  4DG1 A;  3SUN A;  1RTJ A;  2X6S A;  3NBP A;  4DLE A;  4KI6 A;  3B6P A;  4LSL A;  4ID5 A;  4O4G A;  3LZJ A;  1NK8 A;  4B9T A;  3TAN A;  4OLB A;  2AJQ A;  2OZM A;  3T19 A;  4W5T A;  2ZQB A;  2PZS A;  4EP4 A;  1LAW A;  5KRS A;  3OYD A;  3L2W A;  1JLG A;  1RT4 A;  2JLE A;  1IH7 A;  3NAE A;  3LWM A;  4Z4I A;  1C1A A;  5SZT A;  1BI4 B;  3TR8 A;  2IDO A;  1HJR A;  3RR8 A;  4FK2 A;  3DLG A;  3V4I A;  4CJR A;  1RTI A;  1KRP A;  5FRN A;  2B4J A;  4BWM A;  1LWE A;  3KKS A;  3MEE A;  3U6F A;  3C6U A;  3RMA A;  1NK9 A;  5FDL A;  2D0B A;  3L3V A;  3SQ2 A;  4LD0 A;  4E7J A;  4KB1 A;  4FJK A;  3DLE A;  3HYF A;  3SNN A;  4BE1 A;  2FBY A;  4IG0 A;  3HVR A;  2KTQ A;  1BHL A;  1I3A A;  3VQ8 A;  3B6O A;  4CHQ A;  2HHV A;  4NCB A;  3G0Z A;  3NHG A;  3V9S A;  2Z1I A;  1X9W A;  4C8K A;  3KD5 E;  3OVN A;  4PY5 A;  3EYZ A;  1JLQ A;  1GOA A;  2IGI A;  4FM0 A;  2WOM A;  4DU3 A;  2P1J A;  5HBM A;  3QIP A;  1QHT A;  1RDB A;  2YNG A;  3ZSO A;  5C25 A;  2G8F A;  4CK3 A;  1NK0 A;  1KVA A;  1HPZ A;  3LAL A;  3VN5 A;  3AO3 A;  4E19 A;  3M8R A;  4FM2 A;  4B3O A;  1IKV A;  3LPU A;  3M8S A;  5HRN A;  4E7I A;  3I8D A;  1RBT A;  4JLH A;  4KTW A;  3CQ8 A;  4B8A B;  4CF8 A;  1ASU A;  4CJS A;  4W5Q A;  5CY4 A;  3VQQ A;  4FK4 A;  1NJY A;  1QSY A;  3HPG A;  3NGI A;  3TAR A;  1RT7 A;  4IG3 A;  4CEC A;  4FLY A;  3SZ2 A;  4M3T A;  3D0P A;  3WNH A;  2FC0 A;  3CM6 A;  5J2P A;  3K5O A;  4KAZ A;  1NKC A;  2EHG A;  4DFP A;  3KTQ A;  4NYN A;  1RBU A;  5J2Q A;  3IG1 A;  3QEX A;  2HHQ A;  3MXI A;  1RBS A;  3PUF A;  3NH0 A;  4CED A;  3KD1 E;  4DTM A;  2YHA A;  1RIL A;  4ZTF A;  3SJJ A;  3BGR A;  3O4N A;  4DSE A;  4I9L A;  1L5U A;  1ZYQ A;  4FJH A;  5CZ2 A;  1C6V A;  4FJN A;  1X9M A;  3LP3 A;  1T7P A;  5HRR A;  2A1R A;  2Z1G A;  3HO1 A;  1CLQ A;  3LAN A;  4DTS A;  3OYA A;  4E0D A;  3D45 A;  4E89 A;  3QEI A;  2DTU A;  4PWD A;  4IBN A;  1BIU A;  4O0J A;  4F8R A;  2VG6 A;  1Q8I A;  3PX6 A;  3NF6 A;  4N47 A;  4OPK A;  1RTD A;  1QTM A;  1WSF A;  1JKH A;  3WNE A;  1U47 A;  4BAC A;  4MFB A;  1BGX T;  1S9G A;  4LSN A;  3PY8 A;  4CEQ A;  4E7H A;  4IFV A;  4O55 A;  3MED A;  4CEO A;  4CJL A;  4HUF A;  4R5P A;  4EZ9 A;  2HHX A;  4CFB A;  3OJU A;  2OYQ A;  5KGX A;  4DU4 A;  1NK6 A;  3EZ5 A;  2G8K A;  3U3Y A;  3CFP A;  3U3G A;  1C0U A;  4E1N A;  4KPY A;  2HVI A;  3HP6 A;  3NDK A;  3MAQ A;  3ZT1 A;  4CE9 A;  5KRT A;  4CK2 A;  2P51 A;  4G1Q A;  4CGI A;  1EET A;  1S1U A;  2XHB A;  2E6M A;  4FJ8 A;  1VSJ A;  3DRR A;  4KHU A;  4CFA A;  1NK7 A;  4CHP A;  4KKO A;  4OVL A;  3PV8 A;  4ZTJ A;  3V1R A;  3L2Q A;  3QNN A;  4GW6 A;  5T7B A;  3CFR A;  4CHZ A;  4Z4C A;  2FBX A;  3L2U A;  2IAJ A;  5SWM A;  3V9W A;  3V81 A;  4ELV A;  4M3X A;  1SKR A;  4CEE A;  4OJR A;  4CIF A;  1LW2 A;  3L3U A;  3SV4 A;  4HHT A;  3SQ0 A;  3FFI A;  4J2B A;  3LP2 A;  3VA3 A;  4FXD A;  3PX4 A;  1EP4 A;  1WSG A;  5DK5 A;  1HNV A;  4B9N A;  4F4K A;  5J2N A;  3QES A;  1QSL A;  3AVI A;  4ELU A;  2O4I A;  1S5J A;  1RCH A;  3ISN C;  1I39 A;  4CJP A;  3DM2 A;  3NF9 A;  3JSM A;  4KTQ A;  3LWL A;  3HPH A;  4I9Q A;  3H08 A;  3HT3 A;  4CJF A;  1HRH A;  2E4L A;  1KFD A;  4DQS A;  3NH1 A;  1A5W A;  2OPQ A;  1CXQ A;  1WNS A;  5D3G A;  1BQM A;  2NUB A;  3M8P A;  4CF1 A;  3TAF A;  2D0C A;  1XHX A;  1KFS A;  4CEF A;  4CGG A;  2FBT A;  1N6Q A;  1G15 A;  3AVK A;  4AHV A;  2F8T A;  4UQG A;  3DOK A;  4CES A;  2Y1J A;  2HB5 A;  3SCX A;  3LZI A;  3C95 A;  3O3F A;  1K6Y A;  1TKX A;  4KI4 A;  1WSJ A;  4TSX A;  2DY4 A;  3VQ9 A;  4B9L A;  1S1X A;  4NCA A;  1W9H A;  4O44 A;  3S9H A;  3RR7 A;  1BL3 A;  4H4O A;  2XY5 A;  2KFZ A;  1ZBH A;  1RTH A;  1TV6 A;  3AVF A;  1NK5 A;  1UWB A;  1TAU A;  2HHU A;  4DTJ A;  1W0H A;  3OYJ A;  4FCY A;  2XO7 A;  1HQU A;  2X78 A;  4M3Y A;  3CG7 A;  3CYM A;  1DTT A;  1VSE A;  3AVJ A;  5FRO A;  4PQU A;  4J2A A;  3CFO A;  3LAM A;  1NOY A;  1VSI A;  1Z25 A;  2YNF A;  2F8S A;  4CGH A;  1TVR A;  3VQ4 A;  1NJZ A;  3L2R A;  4DSJ A;  4ICL A;  4GMJ B;  2YKM A;  4B08 A;  1UAX A;  3THV A;  3MXM A;  4F3O A;  3DLK A;  3V1Q A;  2P5O A;  1GOC A;  4FZX C;  4M42 A;  1N5Y A;  3OS2 A;  2YHB A;  5C24 A;  4BE0 A;  2QXF A;  1WAJ A;  5E41 A;  4DF4 A;  2XY7 A;  4EZ6 A;  2RKI A;  3KKR A;  1TK0 A;  5KGW A;  4C8O A;  1LW0 A;  4BE2 A;  3NFA A;  1DLO A;  2YV0 X;  3P83 D;  2OZS A;  4PA1 A;  1QSS A;  3K59 A;  2PY5 A;  4F2S A;  1VRU A;  2HND A;  5CYM A;  2QKK A;  4IDK A;  2EX3 A;  3AA4 A;  1L3U A;  1IG9 A;  1L3T A;  1JLC A;  4I2P A;  1T03 A;  4BDP A;  1ZBU A;  4H4M A;  3VQC A;  1RT2 A;  3A2F A;  4DTN A;  4Z4G A;  3AO4 A;  4Z4F A;  3K58 A;  3KLE A;  3NE6 A;  4KRF A;  2QKB A;  4DFM A;  2FBV A;  3RWU A;  4CHY A;  4E3S A;  4KV8 A;  4QAG A;  2I5J A;  3OYF A;  2HMI A;  2P5G A;  4N76 A;  1SKS A;  3VQB A;  1KLN A;  4M3R A;  4DWI A;  4FLX A;  3ALY A;  3AVH A;  3V1O A;  1BIZ A;  1S1V A;  4K8X A;  4AHU A;  5KTQ A;  2G8I A;  1EXQ A;  3HST B;  4CJQ A;  1S6P A;  1A5V A;  5HRP A;  4DU1 A;  4FZY A;  1ZBI A;  3IS9 A;  3P5J A;  3OYK A;  4KFB A;  3OYN A;  4Z4H A;  3ZSQ A;  1NKB A;  1IKX A;  3VQD A;  2ITG A;  5CYQ A;  1VSM A;  3K5L A;  3HXM A;  4HUG A;  5J2M A;  2Q3S A;  2ZE2 A;  3HVT A;  1EX4 A;  1R0A A;  4FYD A;  5JS1 A;  1RDC A;  1KTQ A;  1XC9 A;  1YTU A;  3RMC A;  2IC3 A;  4CJE A;  3OS0 A;  4CEB A;  3HP9 A;  3QO9 A;  4KTZ A;  5I42 A;  1NJX A;  4B9V A;  4DSL A;  3SUO A;  1REV A;  2OPS A;  3T3F A;  3DMJ A;  3PX0 A;  2OA8 A;  4HCB A;  1JXE A;  4L8R B;  3G10 A;  1YTA A;  3SQ1 A;  3ULD A;  4CF0 A;  4CEA A;  3ZT3 A;  2DFF A;  1RDD A;  1D8Y A;  4FJG A;  1JLF A;  4QOZ B;  5FRM A;  2KQ2 A;  2RN2 A;  1HMV A;  4Y1C A;  4LH4 A;  4DTR A;  3AVG A;  3TAP A;  3L8B A;  1QS4 A;  1ITG A;  4Q5V A;  3AVC A;  1LV5 A;  4DQP A;  1MU2 A;  4CEZ A;  4CIE A;  3VQP A;  4CF9 A;  4DTU A;  4M3W A;  3LDS A;  2BAN A;  2HHW A;  4CGD A;  1WSE A;  1LWF A;  1RT5 A;  4BDZ A;  1KCF A;  2OPP A;  4JS4 A;  1Q9Y A;  4FLW A;  1JXB A;  4GVM A;  1C1C A;  4J2D A;  3AA3 A;  3TI0 A;  3SQ4 A;  3SPZ A;  3E01 A;  3S3O A;  4FK0 A;  1NK4 A;  2HW3 A;  1BCO A;  3OYL A;  5HP1 A;  4FJI A;  3QLH A;  2B6A A;  4CF2 A;  3O3H A;  1HYS A;  1X1P A;  3QIO A;  3VQE A;  2DFE A;  4OGC A;  3ZT4 A;  4CFD A;  4B9M A;  2O4G A;  4ELT A;  3DI6 A;  3K2P A;  4ID1 A;  2Z1J A;  3OYG A;  1WSI A;  2G8U A;  3IAY A;  3OJS A;  4CJU A;  3RTV A;  4JRQ A;  1XHZ A;  1SUQ A;  3AVB A;  3NH2 A;  2LSN A;  1JLA A;  1SV5 A;  3TAE A;  4IKF A;  3C94 A;  4FW1 A;  4CGF A;  3RMB A;  4KB0 A;  2PYJ A;  1SKW A;  4FJM A;  4CJT A;  3KIO A;  1U48 A;  1B92 A;  3SYZ A;  3ZCM A;  1WLJ A;  4AHS A;  3VQ6 A;  2XRI A;  1VSD A;  3S3N A;  1KVC A;  3L2V A;  3TAQ A;  4N41 A;  2BGG A;  5C42 A;  1Z26 A;  3SUQ A;  4M3U A;  5K14 A;  3ZSY A;  1CZ9 A;  3VQA A;  4M45 A;  4CGJ A;  4BWJ A;  4OKK A;  3DLH A;  3OYE A;  3ZSV A;  1T05 A;  1XI1 A;  1TKD A;  3KLF A;  2KZM A;  4CJW A;  2A1S A;  1JLE A;  3RRH A;  3RRG A;  4B9U A;  3AA2 A;  1BIS A;  4FLT A;  2X6N A;  4C8M A;  2HHS A;  3I0S A;  3VQ7 A;  3ZT2 A;  4J2E A;  4N56 A;  2IOC A;  2GBZ A;  2YKN A;  4HUE A;  4FLV A;  4OPJ A;  3TAB A;  1GOB A;  4MQ3 A;  3AVN A;  3K5N A;  1S1W A;  4DLG A;  1TL3 A;  2B5J A;  1C1B A;  2GUI A;  2RF2 A;  2VG5 A;  2XY8 A;  4DF8 A;  1NJW A;  3KLH A;  4CFC A;  1ASW A;  3DOL A;  2Y1I A;  4DMN A;  4RW8 A;  4AHT A;  3NCI A;  2KFN A;  1FK9 A;  2ATQ A;  3KK2 A;  2KZZ A;  1JL2 A;  3RMD A;  2Z1H A;  3SPY A;  1SL1 A;  4M41 A;  4DFK A;  3LP1 A;  2HHT A;  3NF8 A;  3QER A;  1ZBF A;  3ZT0 A;  1U45 A;  2DFH A;  3OYM A;  1O1W A;  4O5B A;  4FM1 A;  4EP5 A;  3SUP A;  4FW2 A;  4LY7 A;  3NF7 A;  1NOZ A;  3MEC A;  3QNO A;  5HRO A;  4F2R A;  1WSH A;  3AO1 A;  1U04 A;  5EU7 A;  1HQE A;  4KHW A;  2W42 A;  2QK9 A;  1BQN A;  3V6D A;  3ZSW A;  4DTX A;  1S9E A;  2ETJ A;  4FJX A;  4Y1D A;  3ITH A;  4CK1 A;  3OYB A;  5I3U A;  3OS1 A;  1KSP A;  3SV3 A;  4FJ9 A;  3AO5 A;  4KHQ A;  1RDA A;  5J1E A;  3KJV A;  3MXJ A;  1T8E A;  3MEG A;  4Z4E A;  2X74 A;  4DQR A;  3AVL A;  3O3G A;  3EY1 A;  5HLF A;  4C8L A;  5KI6 A;  3LPT A;  1CXU A;  4F3T A;  4CHO A;  3KLI A;  1BCM A;  1HYV A;  3DLB A;  1U4B A;  1RBR A;  3ZSX A;  1HNI A;  1RBV A;  2VWJ A;  4LH5 A;  1WN7 A;  3ZSR A;  3M8Q A;  3C6T A;  4FJL A;  3S3M A;  3K5M A;  4C8N A;  3V9U A;  4KHN A;  2IS3 A;  3LP0 A;  4AHR A;  4W5O A;  1TK5 A;  2JGU A;  4AH9 A;  4CHN A;  4BDY A;  3QEV A;  4HVJ A;  1TKZ A;  3KK1 A;  1IKW A;  3QIN A;  1JLB A;  3PO4 A;  1RT3 A;  1S1T A;  3CM5 A;  3DRS A;  4WE1 A;  3V9Z A;  1UA1 A;  3T1A A;  2HVH A;  4DSI A;  4DSF A;  2D5R A;  4FJJ A;  4I2Q A;  5JS2 A;  3F73 A;  3WNF A;  3V9X A;  3OYI A;  4Q0B A;  4W5N A;  2VG7 A;  4FLU A;  4CJ4 A;  2OPR A;  3WNG A;  4CJ3 A;  3HM9 A;  1VK0 A;  3QET A;  3JYT A;  2BE2 A;  4O0I A;  1CZB A;  4CCH A;  3VQ5 A;  2HNY A;  3SI6 A;  4M3Z A;  5CZ1 A;  4RW7 A;  2R7Y A;  1FXX A;  3OY9 A;  3NGZ A;  3K57 A;  4H8K A;  4DSK A;  3QEW A;  4DTP A;  3DRP A;  4FJ5 A;  1RNH A;  3HL8 A;  4OLA A;  3AA5 X;  4IFY A;  4B9S A;  4DQI A;  3QEP A;  2D0A A;  1C0T A;  1VSK A;  2RPI A;  4CJ5 A;  4QCL A;  3AO2 A;  4JS5 A;  1J5O A;  3DYA A;  4FVM A;  4E7L A;  4DS5 A;  1BI4 A;  4FJ7 A;  4DQQ A;  1A5X A;  1Y97 A;  4JRP A;  1SL0 A;  5DMR A;  4RW9 A;  4YNQ A;  4W5R A;  3NGY A;  4B8C A;  1C0M A;  3VA0 A;  1JL1 A;  4HCC A;  1VSF A;  2GV9 A;  1VSL A;  1TKT A; 
#chains in the Genus database with same CATH topology
 3LDL A;  4E7K A;  4HTU A;  1J9A A;  3F2K A;  4JK9 A;  4DFJ A;  4NCG A;  5FPD A;  5HRS A;  4KH5 A;  1VSH A;  1F21 A;  3PO5 A;  4LFC K;  4K8Z A;  3HOT A;  4AHC A;  4XIU A;  3H1V X;  1NGD A;  1KVB A;  2IVN A;  3J7A P;  4JI2 K;  3TPQ A;  2QA4 N;  1UOC A;  3O9S A;  4DCH A;  2GX9 A;  4FLZ A;  2F7T A;  1B9D A;  2YNH A;  2OTL N;  1IKY A;  2E8A A;  3UIQ A;  1YVU A;  4BQZ A;  2F96 A;  1S6Q A;  1WBB A;  4JI0 K;  2ZD1 A;  3HK2 A;  3OBY A;  3P4I A;  4M63 C;  1HNW K;  3Q7C A;  4PKI A;  2RHK A;  5BR9 A;  4A62 A;  3C0B A;  2HOE A;  1QQC A;  4YDU C;  1NKE A;  4CJV A;  4DG1 A;  3SUN A;  5ADX A;  4LSL A;  4ID5 A;  3TAN A;  3CJ9 A;  3H46 O;  4W5T A;  1QVG M;  2PZS A;  1LAW A;  1TUY A;  3CI5 A;  2E5L K;  1C1A A;  4MO4 A;  4YY3 K;  5GAH P;  3TR8 A;  5AQS A;  3DLG A;  1U2V B;  5KQD A;  5FRN A;  4CZF A;  2FBY A;  2YHY A;  4IEI A;  1ILY A;  3VQ8 A;  3G0Z A;  1HKG A;  3NHG A;  3EE8 A;  3E66 A;  2IGI A;  4DUY K;  4FM0 A;  2WOM A;  5HBM A;  3THX B;  4CI6 A;  3L6Q A;  3SAG A;  4B3O A;  4E19 A;  4JI6 K;  3VPZ A;  1MWK A;  3T7Z A;  4CF8 A;  4W5Q A;  3SK3 A;  3VQQ A;  4X64 K;  3HPG A;  3TAR A;  1VQM N;  4FLY A;  3SZ2 A;  3WNH A;  2V52 B;  1NKC A;  4QS8 A;  1RBU A;  5J2Q A;  1BDG A;  5AQO A;  1RBS A;  3NH0 A;  3ZYY X;  3KD1 E;  4FWQ A;  1QQM A;  1X9M A;  5HRR A;  1YAG A;  5LJV A;  4IO8 A;  4DTS A;  4E0D A;  4O0J A;  4F8R A;  1T3V A;  2BTF A;  2ITM A;  3NF6 A;  4N47 A;  1WSF A;  4BAC A;  5AZI A;  4B1X B;  3CMA N;  4BRE A;  3ZET B;  4CJL A;  5C2F A;  4CFB A;  3OJU A;  4ILG B;  3MCP A;  5KGX A;  3U3Y A;  3MX5 A;  1FJG K;  1C0U A;  4E1N A;  1YIT N;  3MAQ A;  2O8C B;  1ZC6 A;  2ZJP L;  2UXD K;  3BZC A;  2P51 A;  1Q86 O;  2QW9 A;  4CGI A;  5H1S Q;  4FJ8 A;  1K8A O;  2DPN A;  4KHU A;  2ASM A;  4X62 K;  5JIC A;  4GW6 A;  2XY5 A;  2HHH K;  4M3X A;  3L2U A;  5SWM A;  1IBM K;  4OJR A;  4CIF A;  3L3U A;  2HBK A;  3FFI A;  3LP2 A;  4FXD A;  1EP4 A;  5DK5 A;  3QES A;  1QSL A;  4ELU A;  2O4I A;  1RCH A;  3DXK A;  1I39 A;  2CGK A;  3ISN C;  3DM2 A;  3M5R A;  4CZI A;  5BPN A;  3HT3 A;  3CC2 N;  1KFD A;  5AQT A;  2A42 A;  1WNS A;  4F9O A;  1BQM A;  2QWO A;  5AQF A;  1XHX A;  3E1Y A;  1G15 A;  2QTD A;  4MLH A;  3DJC A;  2FXU A;  2FSK A;  3C95 A;  1K6Y A;  3K9J A;  1EWR A;  3ENB A;  4AQY K;  4BRA A;  4H4O A;  2KFZ A;  1ZBH A;  1TV6 A;  3WQT A;  4AM6 A;  5BRF A;  1W0H A;  2XO7 A;  5AZI B;  3CQX A;  3PLA A;  4WF9 L;  3CG7 A;  3O9T A;  1VSE A;  3AVJ A;  1NOY A;  1TVR A;  4DSJ A;  4JV5 K;  2YKM A;  3THV A;  1UAX A;  3K0S A;  2QWM A;  4BRC A;  3DLK A;  2P5O A;  1GOC A;  4FZX C;  3GDQ A;  4JI8 K;  4CD3 A;  2YHB A;  3KHY A;  4BRL A;  3BUZ B;  4EZ6 A;  2RKI A;  2YV0 X;  4BGA A;  2OZS A;  4GV3 A;  5AQJ A;  3K59 A;  3AA4 A;  3O80 A;  4JNE A;  3CIP A;  4BDP A;  1ZBU A;  3VTI A;  1RT2 A;  3A2F A;  4Z4G A;  5LY3 A;  3BZK A;  3KLE A;  3NE6 A;  4CHY A;  4JKH A;  2HMI A;  3R9P A;  4B1U B;  4JHD A;  4M3R A;  3R8E A;  3DXK B;  5BN9 A;  3VF2 A;  4FLX A;  3DAW A;  4DU1 A;  3QBW A;  4FWP A;  2O8F A;  5JLH A;  2AA4 A;  3ZSQ A;  3VQD A;  2ITG A;  4QS9 A;  1D4X A;  1KTQ A;  1XC9 A;  3FFK B;  2IC3 A;  3EL2 A;  3CJA A;  3QO9 A;  4BVP A;  4B9V A;  1NJX A;  1QQN A;  3SUO A;  2CH5 A;  4DR6 K;  3PX0 A;  1JXE A;  3G10 A;  4IFE A;  3ULD A;  2DFF A;  1RDD A;  1NMD A;  5FRM A;  2RN2 A;  3AVG A;  3EN9 A;  3LDO A;  3THW A;  1YJ9 N;  1LV5 A;  1MU2 A;  1HX1 A;  2UXB K;  3BF1 A;  3VQP A;  4HWI A;  2HHW A;  4JI3 K;  1RT5 A;  4BDZ A;  1JXB A;  3FLC O;  3TTC A;  4WQ5 C;  4JKA A;  4JK7 A;  3OYL A;  4CJ7 A;  3QLH A;  3QIO A;  3VQE A;  4OGC A;  4B9M A;  1XNQ K;  2O4G A;  3K2P A;  3OYG A;  2Z1J A;  3R1X A;  4EHT A;  2VQF K;  3RTV A;  1C0F A;  1XHZ A;  4U67 L;  1SUQ A;  3E9O A;  1YIJ N;  3J80 O;  4FSV A;  1MA9 B;  2W40 A;  5AQR A;  4EFH A;  2P9I A;  3RMB A;  3A5M C;  1SKW A;  3LDP A;  4PL8 A;  4GKK K;  3U9D A;  3WQU A;  1RDW X;  1VSD A;  4DQ8 A;  2YJF A;  4N41 A;  4OX9 K;  4NLB A;  4CZJ A;  3FZF A;  1BA1 A;  3PSI A;  4CGJ A;  4OKK A;  2NZT A;  2O8F B;  3CCE N;  3KLF A;  1M1K O;  4YOT A;  4A57 A;  4CJW A;  3UE5 A;  3RRG A;  2X6N A;  4LC9 B;  4C8M A;  1LCU A;  3VQ7 A;  3ZX0 A;  4N56 A;  2GBZ A;  2YKN A;  4HUE A;  1GOB A;  1TYQ A;  4MQ3 A;  2P9L A;  3M3Z A;  1OVQ A;  2PAV A;  2RF2 A;  2VG5 A;  3L0Q A;  4DF8 A;  1NJW A;  4CFC A;  1ASW A;  1VQL N;  3DOL A;  2NRV A;  1FK9 A;  3KK2 A;  2NRH A;  4BG9 A;  2E2Q A;  3T1Y K;  4M41 A;  4DFK A;  2HHT A;  5M1F A;  3ZT0 A;  1MDU B;  4FM1 A;  1O1W A;  1NGB A;  3THW B;  5JLF A;  4WQ5 A;  2GWK A;  4F2R A;  5EU7 A;  4B1V A;  2W42 A;  1KQS M;  4CBX A;  3D2E A;  2Q2R A;  3C6H A;  4ISE A;  4Y1D A;  5AFU H;  3U4L A;  4CK1 A;  3Q7B A;  1RDA A;  1T6D A;  3TSQ A;  3RSE A;  3KJV A;  4Z4E A;  4DQR A;  3O9U A;  4F3T A;  4CD1 A;  4A61 A;  4CHO A;  1BCM A;  1HYV A;  5LMU K;  3ZSX A;  5BR8 K;  4LH5 A;  2GEL A;  1WN7 A;  4B1Y B;  3VEY A;  1HKC A;  3S3M A;  1IV0 A;  4C8N A;  4CZE A;  4W5O A;  2YX6 A;  3SJH A;  1IKW A;  1JLB A;  3CM5 A;  3DRS A;  4BRK A;  4DV1 K;  4FJJ A;  5JS2 A;  3JYT A;  4O0I A;  1CZB A;  5CZ1 A;  1FXX A;  1NGH A;  3OY9 A;  3NGZ A;  3K57 A;  4DSK A;  1TYQ B;  4DTP A;  3QEP A;  4QCL A;  3AO2 A;  4HTL A;  4JS5 A;  2A41 A;  3DYA A;  4FJ7 A;  3N4P A;  4DQQ A;  5M1K A;  1A5X A;  1Y97 A;  5DMR A;  4YNQ A;  4BR9 A;  5AQZ A;  3VA0 A;  3WUH A;  3H3N O;  4RW4 A;  4KRE A;  4XH5 A;  3ZSZ A;  3TAG A;  1IO2 A;  3KK3 A;  4CZK A;  1FKP A;  2VWK A;  4H0V B;  3HJF A;  4C1N K;  4AIL C;  1ASV A;  1EKE A;  2UUB K;  3D2E B;  3LL3 A;  4KO0 A;  1Q9X A;  3THY A;  3TAM A;  3W0L A;  3FZL A;  1KLM A;  2G8V A;  1LAV A;  3D7E O;  2E20 A;  3RSE B;  2O8B A;  1TK8 A;  3MN5 A;  3QB0 A;  1UA0 A;  1TAQ A;  2ZM6 K;  3P1G A;  4N5S A;  2E88 A;  1D9F A;  4CER A;  3BDP A;  3KLG A;  1NMN A;  3DLR A;  3O4Q A;  1VRT A;  4WYB A;  1X9J A;  3MMV A;  4XH4 A;  4CZL A;  3HPO A;  3I0R A;  4R79 A;  2HST A;  4RG8 A;  1E3M A;  2HNZ A;  1HYZ A;  4IZ9 A;  2BDP A;  4B3T K;  3CET A;  1D5A A;  3SBT A;  2YNI A;  3MK6 A;  4BG8 A;  2X6S A;  1HJO A;  4H0T B;  3A0I X;  3LZJ A;  4O4G A;  5AQM A;  3TTD A;  4OLB A;  2OZM A;  3ENH A;  2UU9 K;  4EP4 A;  2QWP A;  5KRS A;  3L2W A;  4BC3 A;  1RT4 A;  4Z4I A;  3LWM A;  4KH6 A;  4JKE A;  1KRP A;  4LFA K;  3HTV A;  2B4J A;  3KKS A;  1NK9 A;  5FDL A;  1N34 K;  3L3V A;  3SQ2 A;  4Z94 A;  3H3O B;  3DLE A;  3HYF A;  3SNN A;  4BE1 A;  3BEX A;  5AQY A;  4KBO A;  3CCS N;  2HHV A;  3CME N;  4BR5 A;  5JMV A;  4DB3 A;  4JKB A;  2Z1I A;  2F9T A;  3FGU A;  3EYZ A;  1JLQ A;  4DU3 A;  2P1J A;  3K9K A;  4B3S K;  4O5F A;  4CK3 A;  1HPZ A;  1YHQ N;  4FM2 A;  2O8B B;  4JLH A;  3CQ8 A;  1HPM A;  5BRH A;  3TSU A;  1OH8 A;  5CY4 A;  4DR7 K;  5KQ8 A;  3UKR A;  4FK4 A;  5CE3 A;  1RT7 A;  2OAN A;  4M3T A;  1JCG A;  2FC0 A;  3CM6 A;  3CHW A;  3K5O A;  4A5A A;  3VGK A;  1JCE A;  3VEZ A;  1S22 A;  3LDQ A;  2HHQ A;  4CED A;  1R59 O;  4M7X A;  4I9L A;  3LP3 A;  1KAY A;  4IOX A;  4YOV A;  3OYA A;  5BPM A;  5AFU A;  2OCE A;  3PSF A;  1Q8I A;  3FZH A;  5AQG A;  1RTD A;  3WNE A;  5EVZ A;  4MFB A;  4LSN A;  4E7H A;  3MED A;  4CEO A;  1XNR K;  1BA0 A;  2BH1 A;  4R5P A;  4EZ9 A;  1XUP O;  5EX5 A;  3C65 A;  2VWB A;  3GE1 A;  1YXQ A;  3SMP A;  3EZ5 A;  1RGI A;  2G8K A;  3CXC M;  4NO7 A;  3HP6 A;  2D0P A;  3I55 N;  5KPT A;  4G1Q A;  1S1U A;  3KZB A;  1VSJ A;  3DRR A;  4DV7 K;  3JAM O;  4FWR A;  4KKO A;  4CHP A;  4A2B A;  5TKW A;  3AAR A;  1NM1 A;  5T7B A;  3V81 A;  4PKH A;  1SKR A;  4CEE A;  4OPA A;  2Q0R A;  3PX4 A;  3HBT A;  4RWT A;  1KAZ A;  3VEW A;  3NF9 A;  1ZBS A;  4NLC A;  3H08 A;  4I9Q A;  4CJF A;  4DQS A;  1NLV A;  3NH1 A;  5D3G A;  4NB4 A;  4DR1 K;  2NUB A;  3TAF A;  4CF1 A;  1KFS A;  1MWM A;  4MLE A;  1N6Q A;  4AHV A;  3DOK A;  3E9L A;  3MX2 A;  2HB5 A;  3A8Y A;  3LZI A;  2HF4 A;  2D0O A;  3O3F A;  1TKX A;  1N8R O;  1S1X A;  1T44 A;  1W9H A;  3S9H A;  3RR7 A;  1RTH A;  3AVF A;  1U6Z A;  4O8K A;  4ISF A;  3CYM A;  3CJB A;  4FWN A;  5FRO A;  4PQU A;  4CW7 B;  2IVO A;  2D1K A;  2A6A A;  4CGH A;  3VQ4 A;  3LDN A;  3S41 A;  4GMJ B;  4B08 A;  3MXM A;  2F9W A;  4JEP A;  4M42 A;  3CF5 L;  1N5Y A;  5GAD P;  3OHR A;  3EKU A;  2HBL A;  3WXJ A;  5E41 A;  4BE0 A;  4DF4 A;  3DLL L;  1TK0 A;  5KGW A;  1NU0 A;  3NFA A;  3CC4 N;  4F2S A;  2HND A;  2QKK A;  4IDK A;  2EX3 A;  4FYD A;  1IG9 A;  1RDU A;  3VQC A;  4DTN A;  4OO1 J;  1X3N A;  2I7P A;  3AO4 A;  4KRF A;  2WBN A;  1CZA N;  4IDH A;  2I5J A;  2P5G A;  4IJN A;  3R6M A;  3VQB A;  4BRQ A;  1BIZ A;  4UY8 O;  2UUA K;  4AHU A;  2G8I A;  3CCR N;  3HST B;  3IS9 A;  2FLO A;  4B9Q A;  1NKB A;  3G25 A;  5CYQ A;  3HXM A;  4HUG A;  5JS1 A;  1EX4 A;  1RDC A;  4V19 S;  1YTU A;  3RMC A;  3OS0 A;  4CJE A;  3U9Z A;  4CEB A;  4KTZ A;  4FOI A;  3T3F A;  1W7A A;  5AQK A;  4CZG A;  2OA8 A;  4DV0 K;  4LFB K;  5FPE A;  2QM1 A;  4GVE A;  1JLF A;  1ITG A;  3AVC A;  3P39 A;  4DQP A;  4K41 A;  2P9P A;  4CIE A;  4CF9 A;  4DTU A;  3LDS A;  2BAN A;  1Q9Y A;  1KCF A;  1VHX A;  4J2D A;  2HF3 A;  3AA3 A;  3LM2 A;  1C0G A;  3SPZ A;  5FPM A;  5AQQ A;  1NK4 A;  3O9R A;  3T1H K;  4YOU A;  5M1O A;  4FJI A;  1DGK N;  4CF2 A;  4WFA L;  1XMO K;  2F8S A;  5AZJ A;  3AVB A;  4JKG A;  4JKC A;  1EO1 A;  3TAE A;  1E4F T;  4FW1 A;  1LOT B;  4KB0 A;  1JJ2 M;  3GG4 A;  4H5N A;  4CJT A;  4FJM A;  1U48 A;  2GWJ A;  3ZCM A;  1WLJ A;  2XRI A;  3G6E N;  4B1Z A;  2BGG A;  3TAQ A;  1Z26 A;  3SUQ A;  4M3U A;  1CZ9 A;  1E4G T;  4M45 A;  3DLH A;  3WXL A;  3OYE A;  3ZSV A;  1JLE A;  4B9U A;  1BIS A;  3HSC A;  3ZT2 A;  2YJE A;  2I7N A;  4JN4 A;  3K5N A;  3AVN A;  1S1W A;  1C1B A;  2GUI A;  2Y1I A;  4DMN A;  3NCI A;  2AP1 A;  2QXL A;  3SPY A;  3WEE A;  2HBJ A;  4IXC A;  4EP5 A;  1Q7Y O;  3NF7 A;  2P9P B;  1U04 A;  1XQS C;  3ZSW A;  4DR4 K;  1WOQ A;  1S9E A;  2P9S A;  4FJX A;  4MDB A;  3SV3 A;  3VOV A;  5J1E A;  1EQY A;  2X74 A;  3O3G A;  3EY1 A;  3J8A A;  5AZJ B;  1Z6R A;  1N36 K;  4NXM K;  1U4B A;  3CJ1 A;  1NJI O;  1RBV A;  3SBG A;  3ZSR A;  3L4Q A;  3M8Q A;  3CD6 N;  2KHO A;  4YHH K;  4KHN A;  2IS3 A;  3LP0 A;  4AHR A;  1TK5 A;  3ULE A;  5AQP A;  3KK1 A;  4BRP A;  3LM9 A;  3PO4 A;  1S1T A;  2VQE K;  4WE1 A;  4L3Q A;  1UA1 A;  2HVH A;  2D5R A;  2VYP A;  3EKS A;  3UKU A;  3WNF A;  3V9X A;  3OYI A;  3EEQ A;  2VG7 A;  4FLU A;  4CJ4 A;  3BP8 A;  3QET A;  4CCH A;  2BE2 A;  2ZJR L;  5TKY A;  3VQ5 A;  2HNY A;  3SI6 A;  3O6W A;  4WCE L;  4RW7 A;  2R7Y A;  4JI5 K;  4H8K A;  3QEW A;  4FJ5 A;  3AAP A;  4OLA A;  3HL8 A;  4BRI A;  2D0A A;  1C0T A;  1VSK A;  5B8H A;  1FW6 A;  1J5O A;  4FVM A;  4DS5 A;  4JRP A;  4RW9 A;  4OPH A;  3WEE B;  1JL1 A;  2GV9 A;  1VAZ A;  1J5E K;  4H5R A;  1XWL A;  4NYF A;  2CH6 A;  1ZBL A;  4EHU A;  1O13 A;  4E1M A;  3F9K A;  2WON A;  2E6L A;  4YOR A;  4OKJ A;  4BRO A;  4A5B A;  2QI2 A;  1X9S A;  2P9S B;  1SZ2 A;  1Q18 A;  4BRD A;  1J53 A;  4A59 A;  4MDA A;  3MN9 A;  1DEJ A;  3AVA A;  4I7F A;  3OYC A;  3ZEU A;  3CPE A;  5M1P A;  2G8H A;  3OW2 M;  3ASM A;  4JHD B;  3PIO L;  1FKO A;  3ULE B;  4KHY A;  4ILJ A;  1D9D A;  1DTQ A;  3VEX A;  3QML A;  4EAH D;  4QS7 A;  4FVU A;  4H03 B;  2ZGY A;  2KKZ A;  2V7Y A;  2FSN A;  3QDK A;  4FL9 A;  4ZHR A;  4FWM A;  4H0P A;  3KVG A;  1WAF A;  2G8W A;  4BQL A;  3W3D A;  3NBP A;  4DLE A;  3B6P A;  4B9T A;  3T19 A;  1HUX A;  4ILH A;  2JLE A;  3NAE A;  2IDO A;  1HJR A;  4LF9 K;  4CJR A;  1RTI A;  1VQP N;  1V4T A;  3RMA A;  3C6U A;  1YJW N;  1DKG D;  3EE9 A;  1YF5 L;  4LD0 A;  4E7J A;  4KB1 A;  4FJK A;  2CGJ A;  4IG0 A;  5C10 A;  1QZ6 A;  4H0Y B;  3HVR A;  1BHL A;  2UXC K;  2O8D A;  1Q81 O;  1I3A A;  4CHQ A;  1Z05 A;  3V9S A;  3UB5 A;  4C8K A;  3KD5 E;  3OVN A;  1GOA A;  1VQO N;  2P9U A;  3QBX A;  5C25 A;  1QHT A;  2YNG A;  2G8F A;  3CQY A;  3LAL A;  3H6E A;  3M8R A;  1IKV A;  3M8S A;  5HRN A;  4E7I A;  2P9I B;  5AQX A;  1RBT A;  3I8D A;  2RE2 A;  1IJJ A;  1KD1 O;  3ZEU B;  4B8A B;  1P90 A;  1ATN A;  1ASU A;  5GIP A;  5AQN A;  4K42 A;  1SAZ A;  5IT9 O;  4IG3 A;  5CHI A;  4BC5 A;  3D0P A;  5J2P A;  4KAZ A;  2EHG A;  4DFP A;  4NYN A;  3QEX A;  1SS6 A;  5A2Q O;  2A40 A;  3PUF A;  4DTM A;  2P9L B;  3SJJ A;  3BGR A;  3AGK A;  3O4N A;  4FJH A;  4J8F A;  5CZ2 A;  1C6V A;  3NVK A;  1T7P A;  4JI7 K;  2WUS A;  1CLQ A;  2E2P A;  3NVM A;  3D45 A;  4E89 A;  5CR4 A;  3CCQ N;  4BR0 A;  1ATR A;  3QEI A;  2DTU A;  1BIU A;  3VGM A;  2VG6 A;  2W41 A;  4OPK A;  1K8K A;  3VEV A;  4Y0W A;  3TTF A;  2HHX A;  4DV5 K;  1NK6 A;  3CFP A;  2O8D B;  4KPY A;  2HVI A;  3NDK A;  3ZT1 A;  4I6M A;  1NGJ A;  4CE9 A;  5KRT A;  1VQ9 N;  4CK2 A;  3I33 A;  3J81 O;  2XHB A;  2E6M A;  2E2N A;  3CPW M;  4BGB A;  3SAH A;  4CFA A;  1NK7 A;  1KAX A;  4OVL A;  3PV8 A;  3O5B A;  2CGL A;  3L2Q A;  2ZWH A;  3QNN A;  3CFR A;  4CHZ A;  4ELV A;  2IAJ A;  4EIA A;  3N4Q A;  5AQH A;  1NGI A;  3H45 C;  1LW2 A;  3SV4 A;  4J2B A;  4GV6 A;  2QEX N;  4BR2 A;  4F4K A;  1WSG A;  1HNV A;  4B9N A;  1S5J A;  4GV9 A;  4KTQ A;  1WB9 A;  3LWL A;  3HPH A;  3VER A;  5GIN A;  1HRH A;  1A5W A;  2OPQ A;  1CXQ A;  1I94 K;  3MDQ A;  2D0C A;  3FR0 A;  4CEF A;  4CGG A;  4FWK A;  2FBT A;  3D2F A;  2F8T A;  2YHX A;  2NLX A;  3O8M A;  4LF8 K;  4H5W A;  4KI4 A;  1WSJ A;  4TSX A;  2DY4 A;  4GY2 B;  4B9L A;  3CCU N;  4NCA A;  3QIC A;  2IIR A;  1UWB A;  5AR0 A;  3A5O C;  1N33 K;  2HHU A;  1TAU A;  3AAQ A;  1HQU A;  2FSJ A;  1DTT A;  3GOI A;  4J2A A;  3CFO A;  2YNF A;  1BG3 A;  1H1V A;  4IOA L;  4ICL A;  3THY B;  4I6M B;  2HMP A;  4BY9 C;  1VQK N;  1NWK A;  4DV6 K;  2V51 B;  3GL1 A;  1WAJ A;  3KKR A;  4C8O A;  1LW0 A;  4BE2 A;  4FPA A;  2FF6 A;  3A5N C;  3CER A;  4PA1 A;  1QSS A;  1L3U A;  1JLC A;  4WQ4 C;  3VEN A;  3IMX A;  4GKJ K;  5EOY A;  3CCJ N;  2FBV A;  3RWU A;  2VGM A;  3MCA B;  3WXI A;  4LF6 K;  4KV8 A;  4QAG A;  3OYF A;  1KLN A;  3AVH A;  3V1O A;  3G71 N;  4K8X A;  5KTQ A;  4FZY A;  5HRP A;  1S6P A;  1A5V A;  2WFB A;  1ZBI A;  3OYK A;  3P5J A;  3OYN A;  3CJ7 A;  3VMF B;  3K5L A;  1VSM A;  2ZE2 A;  3D2F B;  1HNZ K;  4PHT X;  3CCV N;  1GLE G;  1HKB A;  2NRT A;  4C1N I;  1HR0 K;  1P8Z A;  3DMJ A;  3O4W A;  4HCB A;  2Q31 A;  1JCF A;  4XH1 A;  4BR7 A;  4CF0 A;  3ZT3 A;  5JVH L;  1D8Y A;  4QOZ B;  2KQ2 A;  3G4S N;  1HMV A;  4Y1C A;  3O08 A;  3TAP A;  1HNX K;  4Q5V A;  3ZX2 A;  4H0X B;  5JVG L;  4M3W A;  1NGA A;  2OPP A;  1GLD G;  4FLW A;  1C1C A;  3C7N A;  4DKW A;  5HOO A;  3SQ4 A;  3E01 A;  4FK0 A;  1BCO A;  2VGN A;  1YUW A;  3MWT A;  4FO0 A;  5HP1 A;  1IG8 A;  1VQ7 N;  3O3H A;  2DFE A;  4CFD A;  4ELT A;  3DI6 A;  2G8U A;  4WQ4 A;  3THX A;  3OJS A;  3UKR B;  4CJU A;  4JRQ A;  4FWO A;  3NH2 A;  2LSN A;  1JLA A;  3ID6 A;  4K25 A;  1SV5 A;  3C94 A;  4CGF A;  4RTF D;  4AM7 A;  3S3N A;  3L2V A;  5C42 A;  5K14 A;  3HZ6 A;  4FWS A;  4BWJ A;  3HM8 A;  1T05 A;  2KZM A;  4XEI A;  3AA2 A;  4FLT A;  4FPB A;  4J2E A;  2IOC A;  4FLV A;  4DV2 K;  1TL3 A;  2B5J A;  2XY8 A;  5ELZ A;  3KLH A;  2F4V K;  3M6G A;  5FLX O;  4RW8 A;  4AHT A;  1IBK K;  2KZZ A;  4IOC L;  1SL1 A;  3SAF A;  1OVY A;  2ZF5 O;  3LP1 A;  3NF8 A;  1ZBF A;  1U45 A;  3OYM A;  2Q97 A;  4K0K K;  4LF4 K;  4WFB L;  3ZET A;  1WSH A;  3AO1 A;  1HQE A;  4KHW A;  4C23 A;  3ID8 A;  2QK9 A;  1BQN A;  3C7N B;  4YOX A;  2ETJ A;  1ATS A;  3KWI A;  1OH6 A;  4E1J A;  3OYB A;  2YHW A;  5KPZ A;  2O8C A;  4FJ9 A;  3AO5 A;  3RVC A;  3SLC A;  3MXJ A;  3MEG A;  4KHP K;  3AVL A;  4C8L A;  3LPT A;  1CXU A;  1NGC A;  3KLI A;  3DLB A;  1RBR A;  4JYA K;  1HNI A;  3C6T A;  1YJN N;  3J7Z O;  1KC8 O;  3HOS A;  1BO5 O;  3K5M A;  4A2A A;  2JGU A;  4AH9 A;  3QEV A;  3V9Z A;  1ESV A;  3T1A A;  4DSF A;  3F73 A;  4DV4 K;  4W5N A;  1Y64 A;  4CJ3 A;  4NXN K;  2V7Z A;  4YDU A;  3HI0 A;  3A5L C;  4M3Z A;  1EWQ A;  2QWL A;  3IUC A;  3KK7 A;  1RNH A;  3AA5 X;  4IFY A;  4DQI A;  2RPI A;  4E7L A;  1BI4 A;  4BRG A;  2A5X A;  1SL0 A;  4GNI A;  3NGY A;  4B8C A;  1NNE A;  1C0M A;  4HCC A;  1QZ5 A;  3TI0 A;  1TKT A;  4CIG A;  4CJK A;  5AQW A;  5BN8 A;  2KW4 A;  4DS4 A;  3OBW A;  3NMU A;  4DTO A;  1QE1 A;  1RT6 A;  3CCM N;  1BUP A;  2PYL A;  1RT1 A;  5IWA K;  4RW6 A;  1TL1 A;  3OYH A;  5LL6 Z;  4OKE A;  3AVM A;  1B9F A;  3E9P A;  5M1Q A;  1TGO A;  4FZZ A;  3IRX A;  1SL2 A;  1J54 A;  3AV9 A;  3O1W A;  4OGE A;  3DXM A;  2VCP A;  1YT3 A;  4PKG A;  3O9Q A;  4JAX A;  1L3V A;  4JKF A;  1U49 A;  1L3S A;  1LWC A;  1GLF O;  4PUO A;  3F5T A;  4KHS A;  2ZGZ A;  3VES A;  4YFU A;  2XY6 A;  3LAK A;  3CCL N;  3KWG A;  4Z0U A;  3TWH A;  5GIO A;  1VQ4 N;  1Q82 O;  1RTJ A;  3ZLJ A;  1DT9 A;  5M1N A;  4KI6 A;  2A3Z A;  1NK8 A;  2AJQ A;  2ZQB A;  3I56 N;  1VQN N;  1NGF A;  4IWV A;  3OYD A;  1JLG A;  1IH7 A;  5SZT A;  1BI4 B;  3MWP A;  3RR8 A;  4FK2 A;  3V4I A;  2BUP A;  4BWM A;  1LWE A;  3MEE A;  3U6F A;  1K73 O;  2NRW A;  5C12 A;  2D0B A;  3ENO A;  5AQL A;  1G99 A;  2KTQ A;  3GBT A;  3B6O A;  2P9N A;  4IEE A;  4NCB A;  4JD2 A;  3U8X A;  1X9W A;  4BRN A;  4PY5 A;  2NRZ A;  4DR5 K;  3QIP A;  1RDB A;  3ZSO A;  1NK0 A;  1KVA A;  4JKG B;  1QHA A;  3VN5 A;  3AO3 A;  4X66 K;  3LPU A;  2NRX A;  3T69 A;  2IVP A;  4KTW A;  2NRR A;  4CJS A;  1NJY A;  3B8A X;  1QSY A;  3NGI A;  3DXM B;  4CEC A;  2E1Z A;  3IFR A;  4M7Y A;  1YI2 N;  3KTQ A;  2Q0U A;  3IG1 A;  2ZJQ L;  3QFU A;  3O1B A;  3MXI A;  1WBD A;  2QWQ A;  4CZM A;  4IJA A;  2YHA A;  1RIL A;  5DM6 L;  4ZTF A;  3BF3 A;  4DSE A;  5AQV A;  1L5U A;  1ZYQ A;  3WT0 A;  3WXM B;  4FJN A;  5FPN A;  2ASO A;  2E1Y A;  2A1R A;  2Z1G A;  3HO1 A;  3LAN A;  1X3M A;  1OKJ A;  4IBN A;  3BY5 A;  5GAE P;  3PX6 A;  1GLJ O;  2P9K A;  1QTM A;  5BPL A;  1JKH A;  1U47 A;  3PY8 A;  1BGX T;  1S9G A;  4CEQ A;  4IFV A;  4O55 A;  4U7B A;  4DHY A;  2O8E A;  4HUF A;  3PIP L;  2OYQ A;  4DU4 A;  4JI1 K;  4LF5 K;  3U3G A;  4BC4 A;  4BC2 A;  4BRH A;  2P9N B;  5DM7 L;  4JD2 B;  3TU5 A;  1RFQ A;  1SQK A;  3TSP A;  1EET A;  4JK8 A;  4DR2 K;  3L4I A;  4ZTJ A;  3V1R A;  4Z4C A;  2FBX A;  1NGE A;  3V9W A;  2QWN A;  1K9M O;  3VET A;  1BOT O;  4O8U A;  1M90 O;  1TUU A;  4HHT A;  3SQ0 A;  3VA3 A;  4YOY A;  1NGG A;  5J2N A;  1QQO A;  3AVI A;  2UYT A;  4CJP A;  3JSM A;  4H5T A;  3UKU B;  2E4L A;  1QVF M;  3M8P A;  5F0X A;  3AVK A;  5BRD A;  3M1F A;  4UQG A;  4CES A;  3FE1 A;  2Y1J A;  3SCX A;  3JXU A;  3AY9 A;  4BR4 A;  5C0Y A;  3VQ9 A;  1V4S A;  2GTD A;  4O44 A;  3CC7 N;  2D4W A;  1BL3 A;  1KXP A;  1NK5 A;  3P31 A;  2P9K B;  3D6R A;  4DTJ A;  3OYJ A;  4FCY A;  3ATU A;  4M3Y A;  2X78 A;  4FWL A;  5BRE A;  4H5V A;  2O8E B;  5F1X A;  1ZXO A;  3LAM A;  5LJW A;  1VSI A;  1Z25 A;  1NJZ A;  3L2R A;  1VQ8 N;  4F3O A;  1T6C A;  3V1Q A;  5HL7 L;  3OS2 A;  2OTJ N;  2NNW A;  2JWK A;  5C24 A;  2QXF A;  2XY7 A;  5GAG P;  4G9Z A;  1DLO A;  3P83 D;  4CVN E;  2PY5 A;  3OA9 A;  3IDH A;  1VRU A;  5CYM A;  2KLA A;  3MN6 A;  3ZX3 A;  4PWD A;  1L3T A;  4I2P A;  1T03 A;  4H4M A;  4Z4F A;  3K58 A;  4WFN L;  1NBW A;  4DFM A;  2QKB A;  3AGR A;  4E3S A;  4CBW A;  2GEM A;  3VGL A;  4N76 A;  1SKS A;  4DWI A;  5I9E B;  3ALY A;  1S1V A;  2HBM A;  1EXQ A;  3EO3 A;  4CJQ A;  1BWF O;  1W2B M;  4KFB A;  4Z4H A;  4CZH A;  1IKX A;  1OH7 A;  5J2M A;  2Q3S A;  3HVT A;  1R0A A;  3HP9 A;  5I42 A;  4DSL A;  2YCH A;  1REV A;  2OPS A;  4DUZ K;  1W97 L;  3EZW A;  4L8R B;  2UUC K;  1YTA A;  3SQ1 A;  4CEA A;  4BRF A;  2EWS A;  4FJG A;  3C6A A;  3VEO A;  4AF1 A;  4LH4 A;  4DTR A;  3L8B A;  3FZM A;  1QS4 A;  4CEZ A;  4PL7 A;  5AJ3 K;  4CBU A;  2P9U B;  4CGD A;  5ADX H;  1WSE A;  1LWF A;  4JS4 A;  3VF4 A;  1BU6 O;  4GVM A;  3S3O A;  3DWL A;  2HW3 A;  3J7Y P;  4B3R K;  4MO5 A;  2B6A A;  1HYS A;  1X1P A;  4BRM A;  3ZT4 A;  3OTO K;  1OH5 A;  4JI4 K;  3IAY A;  4ID1 A;  1WSI A;  4ISG A;  5KPR A;  4FOE A;  4IKF A;  3H1Q A;  2PYJ A;  3KIO A;  1B92 A;  3SYZ A;  4AHS A;  3VQ6 A;  5C2D A;  1KVC A;  3P38 A;  3ZSY A;  4LF7 K;  4B3M K;  3ATV A;  3VQA A;  2PFU A;  3MN7 A;  5E26 A;  2J4R A;  4IO9 L;  2WTU A;  1XI1 A;  1TKD A;  2Q36 A;  2A1S A;  3RRH A;  1IBL K;  1J6Z A;  5EY4 A;  4X65 K;  3I0S A;  2HHS A;  2H3G X;  2E2O A;  3QFP A;  4OPJ A;  3TAB A;  4DLG A;  5AQI A;  4JKD A;  1K8K B;  2KFN A;  2ATQ A;  1JL2 A;  3RMD A;  2Z1H A;  3IKM A;  1GLL O;  4K43 A;  2W6L A;  3QER A;  2DFH A;  4O5B A;  4DV3 K;  3CJC A;  3SUP A;  4FW2 A;  4LY7 A;  1NOZ A;  5MLC Q;  2YI1 A;  3MEC A;  3QNO A;  5HRO A;  1XC3 A;  1WUA A;  1VQ6 N;  1NG9 A;  3V6D A;  1S72 N;  1YVN A;  4DTX A;  4DR3 K;  3ITH A;  5I3U A;  4H0O A;  3OS1 A;  5E84 A;  2FF3 B;  1KSP A;  4KHQ A;  2GUP A;  4YOW A;  1T8E A;  1HLU A;  3WXK A;  4B1W B;  5EXW A;  5HLF A;  3JS6 A;  5KI6 A;  2VWJ A;  4FJL A;  5AQU A;  2WC9 A;  5LMN K;  2ASP A;  3V9U A;  4RCH A;  5C15 A;  4CHN A;  4BDY A;  4HVJ A;  1TKZ A;  3I8B A;  2PBD A;  3QIN A;  1S3X A;  1RT3 A;  5F2R A;  2JWL A;  4DSI A;  4I2Q A;  4Q0B A;  2W6K A;  1N32 K;  2OPR A;  3WNG A;  3HM9 A;  1VK0 A;  3F9M A;  3R3L A;  3FZK A;  2QWR A;  4BVO A;  3HRG A;  3DRP A;  1GLC G;  4B9S A;  3VTH A;  4CJ5 A;  1GLB G;  3SMS A;  1VQ5 N;  2Q1N A;  3VF6 A;  4KH4 A;  1GLA G;  1U2V A;  4W5R A;  1XMQ K;  1VSF A;  1VSL A; 
#chains in the Genus database with same CATH homology
 4RW4 A;  4CIG A;  4KRE A;  1XWL A;  4NYF A;  3ZSZ A;  4HTU A;  4E7K A;  4CJK A;  3TAG A;  1IO2 A;  1J9A A;  3KK3 A;  1ZBL A;  1FKP A;  2KW4 A;  4E1M A;  4DS4 A;  3F9K A;  4DFJ A;  2WON A;  2VWK A;  2E6L A;  4NCG A;  4DTO A;  4OKJ A;  3HJF A;  1QE1 A;  1RT6 A;  1ASV A;  1EKE A;  5HRS A;  4AIL C;  2PYL A;  1RT1 A;  4KO0 A;  1VSH A;  1F21 A;  1X9S A;  4RW6 A;  3PO5 A;  1TL1 A;  3OYH A;  1Q9X A;  3TAM A;  4K8Z A;  4AHC A;  4OKE A;  1KLM A;  2G8V A;  3AVM A;  1J53 A;  1B9F A;  1LAV A;  4XIU A;  1KVB A;  1TK8 A;  1TGO A;  4FZZ A;  3IRX A;  4I7F A;  3AVA A;  1UA0 A;  1TAQ A;  3OYC A;  3P1G A;  4N5S A;  1D9F A;  4CER A;  3BDP A;  1SL2 A;  3KLG A;  2G8H A;  1UOC A;  3ASM A;  1J54 A;  3AV9 A;  3DLR A;  1FKO A;  3O4Q A;  4FLZ A;  1VRT A;  4OGE A;  1B9D A;  2YNH A;  3HPO A;  1IKY A;  1YT3 A;  3UIQ A;  1YVU A;  4KHY A;  2F96 A;  3I0R A;  1DTQ A;  1D9D A;  1S6Q A;  2ZD1 A;  1L3V A;  3HK2 A;  1U49 A;  4RG8 A;  1L3S A;  1LWC A;  4PUO A;  4ZHR A;  4KHS A;  2HNZ A;  4YFU A;  1HYZ A;  2XY6 A;  3LAK A;  2BDP A;  1WAF A;  4Z0U A;  1D5A A;  1QQC A;  3TWH A;  1NKE A;  2G8W A;  2YNI A;  4CJV A;  4DG1 A;  3SUN A;  1RTJ A;  2X6S A;  3NBP A;  4DLE A;  4KI6 A;  3B6P A;  4LSL A;  4ID5 A;  4O4G A;  3LZJ A;  1NK8 A;  4B9T A;  3TAN A;  4OLB A;  2AJQ A;  2OZM A;  3T19 A;  4W5T A;  2ZQB A;  2PZS A;  4EP4 A;  1LAW A;  5KRS A;  3OYD A;  3L2W A;  1JLG A;  1RT4 A;  2JLE A;  1IH7 A;  3NAE A;  3LWM A;  4Z4I A;  1C1A A;  5SZT A;  1BI4 B;  3TR8 A;  2IDO A;  1HJR A;  3RR8 A;  4FK2 A;  3DLG A;  3V4I A;  4CJR A;  1RTI A;  1KRP A;  5FRN A;  2B4J A;  4BWM A;  1LWE A;  3KKS A;  3MEE A;  3U6F A;  3C6U A;  3RMA A;  1NK9 A;  5FDL A;  2D0B A;  3L3V A;  3SQ2 A;  4LD0 A;  4E7J A;  4KB1 A;  4FJK A;  3DLE A;  3HYF A;  3SNN A;  4BE1 A;  2FBY A;  4IG0 A;  3HVR A;  2KTQ A;  1BHL A;  1I3A A;  3VQ8 A;  3B6O A;  4CHQ A;  2HHV A;  4NCB A;  3G0Z A;  3NHG A;  3V9S A;  2Z1I A;  1X9W A;  4C8K A;  3KD5 E;  3OVN A;  4PY5 A;  3EYZ A;  1JLQ A;  1GOA A;  2IGI A;  4FM0 A;  2WOM A;  4DU3 A;  2P1J A;  5HBM A;  3QIP A;  1QHT A;  1RDB A;  2YNG A;  3ZSO A;  5C25 A;  2G8F A;  4CK3 A;  1NK0 A;  1KVA A;  1HPZ A;  3LAL A;  3VN5 A;  3AO3 A;  4E19 A;  3M8R A;  4FM2 A;  4B3O A;  1IKV A;  3LPU A;  3M8S A;  5HRN A;  4E7I A;  3I8D A;  1RBT A;  4JLH A;  4KTW A;  3CQ8 A;  4B8A B;  4CF8 A;  1ASU A;  4CJS A;  4W5Q A;  5CY4 A;  3VQQ A;  4FK4 A;  1NJY A;  1QSY A;  3HPG A;  3NGI A;  3TAR A;  1RT7 A;  4IG3 A;  4CEC A;  4FLY A;  3SZ2 A;  4M3T A;  3D0P A;  3WNH A;  2FC0 A;  3CM6 A;  5J2P A;  3K5O A;  4KAZ A;  1NKC A;  2EHG A;  4DFP A;  3KTQ A;  4NYN A;  1RBU A;  5J2Q A;  3IG1 A;  3QEX A;  2HHQ A;  3MXI A;  1RBS A;  3PUF A;  3NH0 A;  4CED A;  3KD1 E;  4DTM A;  2YHA A;  1RIL A;  4ZTF A;  3SJJ A;  3BGR A;  3O4N A;  4DSE A;  4I9L A;  1L5U A;  1ZYQ A;  4FJH A;  5CZ2 A;  1C6V A;  4FJN A;  1X9M A;  3LP3 A;  1T7P A;  5HRR A;  2A1R A;  2Z1G A;  3HO1 A;  1CLQ A;  3LAN A;  4DTS A;  3OYA A;  4E0D A;  3D45 A;  4E89 A;  3QEI A;  2DTU A;  4PWD A;  4IBN A;  1BIU A;  4O0J A;  4F8R A;  2VG6 A;  1Q8I A;  3PX6 A;  3NF6 A;  4N47 A;  4OPK A;  1RTD A;  1QTM A;  1WSF A;  1JKH A;  3WNE A;  1U47 A;  4BAC A;  4MFB A;  1BGX T;  1S9G A;  4LSN A;  3PY8 A;  4CEQ A;  4E7H A;  4IFV A;  4O55 A;  3MED A;  4CEO A;  4CJL A;  4HUF A;  4R5P A;  4EZ9 A;  2HHX A;  4CFB A;  3OJU A;  2OYQ A;  5KGX A;  4DU4 A;  1NK6 A;  3EZ5 A;  2G8K A;  3U3Y A;  3CFP A;  3U3G A;  1C0U A;  4E1N A;  4KPY A;  2HVI A;  3HP6 A;  3NDK A;  3MAQ A;  3ZT1 A;  4CE9 A;  5KRT A;  4CK2 A;  2P51 A;  4G1Q A;  4CGI A;  1EET A;  1S1U A;  2XHB A;  2E6M A;  4FJ8 A;  1VSJ A;  3DRR A;  4KHU A;  4CFA A;  1NK7 A;  4CHP A;  4KKO A;  4OVL A;  3PV8 A;  4ZTJ A;  3V1R A;  3L2Q A;  3QNN A;  4GW6 A;  5T7B A;  3CFR A;  4CHZ A;  4Z4C A;  2FBX A;  3L2U A;  2IAJ A;  5SWM A;  3V9W A;  3V81 A;  4ELV A;  4M3X A;  1SKR A;  4CEE A;  4OJR A;  4CIF A;  1LW2 A;  3L3U A;  3SV4 A;  4HHT A;  3SQ0 A;  3FFI A;  4J2B A;  3LP2 A;  3VA3 A;  4FXD A;  3PX4 A;  1EP4 A;  1WSG A;  5DK5 A;  1HNV A;  4B9N A;  4F4K A;  5J2N A;  3QES A;  1QSL A;  3AVI A;  4ELU A;  2O4I A;  1S5J A;  1RCH A;  3ISN C;  1I39 A;  4CJP A;  3DM2 A;  3NF9 A;  3JSM A;  4KTQ A;  3LWL A;  3HPH A;  4I9Q A;  3H08 A;  3HT3 A;  4CJF A;  1HRH A;  2E4L A;  1KFD A;  4DQS A;  3NH1 A;  1A5W A;  2OPQ A;  1CXQ A;  1WNS A;  5D3G A;  1BQM A;  2NUB A;  3M8P A;  4CF1 A;  3TAF A;  2D0C A;  1XHX A;  1KFS A;  4CEF A;  4CGG A;  2FBT A;  1N6Q A;  1G15 A;  3AVK A;  4AHV A;  2F8T A;  4UQG A;  3DOK A;  4CES A;  2Y1J A;  2HB5 A;  3SCX A;  3LZI A;  3C95 A;  3O3F A;  1K6Y A;  1TKX A;  4KI4 A;  1WSJ A;  4TSX A;  2DY4 A;  3VQ9 A;  4B9L A;  1S1X A;  4NCA A;  1W9H A;  4O44 A;  3S9H A;  3RR7 A;  1BL3 A;  4H4O A;  2XY5 A;  2KFZ A;  1ZBH A;  1RTH A;  1TV6 A;  3AVF A;  1NK5 A;  1UWB A;  1TAU A;  2HHU A;  4DTJ A;  1W0H A;  3OYJ A;  4FCY A;  2XO7 A;  1HQU A;  2X78 A;  4M3Y A;  3CG7 A;  3CYM A;  1DTT A;  1VSE A;  3AVJ A;  5FRO A;  4PQU A;  4J2A A;  3CFO A;  3LAM A;  1NOY A;  1VSI A;  1Z25 A;  2YNF A;  2F8S A;  4CGH A;  1TVR A;  3VQ4 A;  1NJZ A;  3L2R A;  4DSJ A;  4ICL A;  4GMJ B;  2YKM A;  4B08 A;  1UAX A;  3THV A;  3MXM A;  4F3O A;  3DLK A;  3V1Q A;  2P5O A;  1GOC A;  4FZX C;  4M42 A;  1N5Y A;  3OS2 A;  2YHB A;  5C24 A;  4BE0 A;  2QXF A;  1WAJ A;  5E41 A;  4DF4 A;  2XY7 A;  4EZ6 A;  2RKI A;  3KKR A;  1TK0 A;  5KGW A;  4C8O A;  1LW0 A;  4BE2 A;  3NFA A;  1DLO A;  2YV0 X;  3P83 D;  2OZS A;  4PA1 A;  1QSS A;  3K59 A;  2PY5 A;  4F2S A;  1VRU A;  2HND A;  5CYM A;  2QKK A;  4IDK A;  2EX3 A;  3AA4 A;  1L3U A;  1IG9 A;  1L3T A;  1JLC A;  4I2P A;  1T03 A;  4BDP A;  1ZBU A;  4H4M A;  3VQC A;  1RT2 A;  3A2F A;  4DTN A;  4Z4G A;  3AO4 A;  4Z4F A;  3K58 A;  3KLE A;  3NE6 A;  4KRF A;  2QKB A;  4DFM A;  2FBV A;  3RWU A;  4CHY A;  4E3S A;  4KV8 A;  4QAG A;  2I5J A;  3OYF A;  2HMI A;  2P5G A;  4N76 A;  1SKS A;  3VQB A;  1KLN A;  4M3R A;  4DWI A;  4FLX A;  3ALY A;  3AVH A;  3V1O A;  1BIZ A;  1S1V A;  4K8X A;  4AHU A;  5KTQ A;  2G8I A;  1EXQ A;  3HST B;  4CJQ A;  1S6P A;  1A5V A;  5HRP A;  4DU1 A;  4FZY A;  1ZBI A;  3IS9 A;  3P5J A;  3OYK A;  4KFB A;  3OYN A;  4Z4H A;  3ZSQ A;  1NKB A;  1IKX A;  3VQD A;  2ITG A;  5CYQ A;  1VSM A;  3K5L A;  3HXM A;  4HUG A;  5J2M A;  2Q3S A;  2ZE2 A;  3HVT A;  1EX4 A;  1R0A A;  4FYD A;  5JS1 A;  1RDC A;  1KTQ A;  1XC9 A;  1YTU A;  3RMC A;  2IC3 A;  4CJE A;  3OS0 A;  4CEB A;  3HP9 A;  3QO9 A;  4KTZ A;  5I42 A;  1NJX A;  4B9V A;  4DSL A;  3SUO A;  1REV A;  2OPS A;  3T3F A;  3DMJ A;  3PX0 A;  2OA8 A;  4HCB A;  1JXE A;  4L8R B;  3G10 A;  1YTA A;  3SQ1 A;  3ULD A;  4CF0 A;  4CEA A;  3ZT3 A;  2DFF A;  1RDD A;  1D8Y A;  4FJG A;  1JLF A;  4QOZ B;  5FRM A;  2KQ2 A;  2RN2 A;  1HMV A;  4Y1C A;  4LH4 A;  4DTR A;  3AVG A;  3TAP A;  3L8B A;  1QS4 A;  1ITG A;  4Q5V A;  3AVC A;  1LV5 A;  4DQP A;  1MU2 A;  4CEZ A;  4CIE A;  3VQP A;  4CF9 A;  4DTU A;  4M3W A;  3LDS A;  2BAN A;  2HHW A;  4CGD A;  1WSE A;  1LWF A;  1RT5 A;  4BDZ A;  1KCF A;  2OPP A;  4JS4 A;  1Q9Y A;  4FLW A;  1JXB A;  4GVM A;  1C1C A;  4J2D A;  3AA3 A;  3TI0 A;  3SQ4 A;  3SPZ A;  3E01 A;  3S3O A;  4FK0 A;  1NK4 A;  2HW3 A;  1BCO A;  3OYL A;  5HP1 A;  4FJI A;  3QLH A;  2B6A A;  4CF2 A;  3O3H A;  1HYS A;  1X1P A;  3QIO A;  3VQE A;  2DFE A;  4OGC A;  3ZT4 A;  4CFD A;  4B9M A;  2O4G A;  4ELT A;  3DI6 A;  3K2P A;  4ID1 A;  2Z1J A;  3OYG A;  1WSI A;  2G8U A;  3IAY A;  3OJS A;  4CJU A;  3RTV A;  4JRQ A;  1XHZ A;  1SUQ A;  3AVB A;  3NH2 A;  2LSN A;  1JLA A;  1SV5 A;  3TAE A;  4IKF A;  3C94 A;  4FW1 A;  4CGF A;  3RMB A;  4KB0 A;  2PYJ A;  1SKW A;  4FJM A;  4CJT A;  3KIO A;  1U48 A;  1B92 A;  3SYZ A;  3ZCM A;  1WLJ A;  4AHS A;  3VQ6 A;  2XRI A;  1VSD A;  3S3N A;  1KVC A;  3L2V A;  3TAQ A;  4N41 A;  2BGG A;  5C42 A;  1Z26 A;  3SUQ A;  4M3U A;  5K14 A;  3ZSY A;  1CZ9 A;  3VQA A;  4M45 A;  4CGJ A;  4BWJ A;  4OKK A;  3DLH A;  3OYE A;  3ZSV A;  1T05 A;  1XI1 A;  1TKD A;  3KLF A;  2KZM A;  4CJW A;  2A1S A;  1JLE A;  3RRH A;  3RRG A;  4B9U A;  3AA2 A;  1BIS A;  4FLT A;  2X6N A;  4C8M A;  2HHS A;  3I0S A;  3VQ7 A;  3ZT2 A;  4J2E A;  4N56 A;  2IOC A;  2GBZ A;  2YKN A;  4HUE A;  4FLV A;  4OPJ A;  3TAB A;  1GOB A;  4MQ3 A;  3AVN A;  3K5N A;  1S1W A;  4DLG A;  1TL3 A;  2B5J A;  1C1B A;  2GUI A;  2RF2 A;  2VG5 A;  2XY8 A;  4DF8 A;  1NJW A;  3KLH A;  4CFC A;  1ASW A;  3DOL A;  2Y1I A;  4DMN A;  4RW8 A;  4AHT A;  3NCI A;  2KFN A;  1FK9 A;  2ATQ A;  3KK2 A;  2KZZ A;  1JL2 A;  3RMD A;  2Z1H A;  3SPY A;  1SL1 A;  4M41 A;  4DFK A;  3LP1 A;  2HHT A;  3NF8 A;  3QER A;  1ZBF A;  3ZT0 A;  1U45 A;  2DFH A;  3OYM A;  1O1W A;  4O5B A;  4FM1 A;  4EP5 A;  3SUP A;  4FW2 A;  4LY7 A;  3NF7 A;  1NOZ A;  3MEC A;  3QNO A;  5HRO A;  4F2R A;  1WSH A;  3AO1 A;  1U04 A;  5EU7 A;  1HQE A;  4KHW A;  2W42 A;  2QK9 A;  1BQN A;  3V6D A;  3ZSW A;  4DTX A;  1S9E A;  2ETJ A;  4FJX A;  4Y1D A;  3ITH A;  4CK1 A;  3OYB A;  5I3U A;  3OS1 A;  1KSP A;  3SV3 A;  4FJ9 A;  3AO5 A;  4KHQ A;  1RDA A;  5J1E A;  3KJV A;  3MXJ A;  1T8E A;  3MEG A;  4Z4E A;  2X74 A;  4DQR A;  3AVL A;  3O3G A;  3EY1 A;  5HLF A;  4C8L A;  5KI6 A;  3LPT A;  1CXU A;  4F3T A;  4CHO A;  3KLI A;  1BCM A;  1HYV A;  3DLB A;  1U4B A;  1RBR A;  3ZSX A;  1HNI A;  1RBV A;  2VWJ A;  4LH5 A;  1WN7 A;  3ZSR A;  3M8Q A;  3C6T A;  4FJL A;  3S3M A;  3K5M A;  4C8N A;  3V9U A;  4KHN A;  2IS3 A;  3LP0 A;  4AHR A;  4W5O A;  1TK5 A;  2JGU A;  4AH9 A;  4CHN A;  4BDY A;  3QEV A;  4HVJ A;  1TKZ A;  3KK1 A;  1IKW A;  3QIN A;  1JLB A;  3PO4 A;  1RT3 A;  1S1T A;  3CM5 A;  3DRS A;  4WE1 A;  3V9Z A;  1UA1 A;  3T1A A;  2HVH A;  4DSI A;  4DSF A;  2D5R A;  4FJJ A;  4I2Q A;  5JS2 A;  3F73 A;  3WNF A;  3V9X A;  3OYI A;  4Q0B A;  4W5N A;  2VG7 A;  4FLU A;  4CJ4 A;  2OPR A;  3WNG A;  4CJ3 A;  3HM9 A;  1VK0 A;  3QET A;  3JYT A;  2BE2 A;  4O0I A;  1CZB A;  4CCH A;  3VQ5 A;  2HNY A;  3SI6 A;  4M3Z A;  5CZ1 A;  4RW7 A;  2R7Y A;  1FXX A;  3OY9 A;  3NGZ A;  3K57 A;  4H8K A;  4DSK A;  3QEW A;  4DTP A;  3DRP A;  4FJ5 A;  1RNH A;  3HL8 A;  4OLA A;  3AA5 X;  4IFY A;  4B9S A;  4DQI A;  3QEP A;  2D0A A;  1C0T A;  1VSK A;  2RPI A;  4CJ5 A;  4QCL A;  3AO2 A;  4JS5 A;  1J5O A;  3DYA A;  4FVM A;  4E7L A;  4DS5 A;  1BI4 A;  4FJ7 A;  4DQQ A;  1A5X A;  1Y97 A;  4JRP A;  1SL0 A;  5DMR A;  4RW9 A;  4YNQ A;  4W5R A;  3NGY A;  4B8C A;  1C0M A;  3VA0 A;  1JL1 A;  4HCC A;  1VSF A;  2GV9 A;  1VSL A;  1TKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...