4CGJA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgjA00
2WOMA 4BE2A 3ALYA 4CFBA 3SPZA 1U4BA 1KFSA 4O5BA 3NDKA 4G1QA 4FJLA 4Z4GA 4J2BA 2YNGA 4CJ4A 2X78A 4IFYA 3SUPA 3HP6A 4KRFA 4ID5A 3DM2A 2HHWA 2GV9A 2G8IA 3V81A 1VSKA 2JGUA 3TABA 3ISNC 5HRPA 3CFRA 3ZSWA 4NYFA 1TVRA 2OPPA 2D5RA 3ZSRA 4WE1A 3TWHA 4RG8A 4Q0BA 1J9AA 5C24A 2JLEA 3LWLA 5HROA 3L2UA 1S1UA 2G8HA 4AHRA 4KI4A 4CGDA 2F8TA 2QK9A 3T1AA 1Y97A 4EP5A 4CF0A 2P1JA 3AO2A 4YFUA 3LP2A 5J2QA 5KGWA 2OZSA 1WN7A 2R7YA 1NOZA 3K5NA 4OPJA 1X9SA 3AA2A 4CERA 3RMDA 2X74A 3LAKA 4CE9A 3NCIA 1NK5A 1Z25A 2KZMA 4CFDA 2HHSA 4BDYA 1RBRA 1WSIA 3AO3A 3OYIA 4E7JA 4DFMA 3SPYA 3S3OA 1WAJA 1FKOA 4FJMA 1RTIA 4O0JA 4F2SA 4FLWA 4Y1CA 1W9HA 4HUEA 1RDAA 4M3TA 4W5NA 4FXDA 3DLBA 1X9WA 2VG5A 2DFEA 1HNVA 4GVMA 1WSFA 3TAEA 1NJXA 5KRSA 4CEFA 5JS2A 3QEIA 3ZT2A 1ITGA 1DTQA 3KK1A 1T8EA 1C1BA 2IGIA 3L3VA 1A5VA 2KQ2A 3AO5A 4DQRA 3IS9A 1GOBA 2D0BA 4OJRA 4OKEA 3M8SA 4B9NA 3CYMA 1JLBA 2B4JA 3DRSA 1SKWA 2KTQA 4CJLA 4GW6A 4FLXA 4CJUA 3QERA 1JLQA 4ICLA 4NCBA 4DU3A 4OGEA 3K58A 3VQ8A 1L5UA 1JL2A 2YKNA 4DLEA 1TAUA 2P5GA 2HHVA 1D5AA 2Z1JA 1BHLA 1XWLA 1CXUA 3NF7A 3AA5X 3U3GA 4HHTA 3SCXA 3LANA 1Z26A 4I2QA 1HQEA 3K57A 5I42A 1VRTA 1T7PA 1T03A 4EP4A 2G8FA 3SUNA 4DTRA 3VQBA 3SI6A 2E4LA 3ITHA 1HNIA 3RMAA 1TKTA 3TAPA 3L2QA 1L3TA 3PX4A 3O4QA 2A1SA 3A2FA 3PO5A 1QQCA 3ZSXA 3WNHA 3AVGA 4CEEA 1ZBFA 2W42A 1KLMA 5J2PA 4CF1A 1JXEA 3MEGA 1RTHA 4FLUA 3QESA 4AILC 3SUQA 1TK5A 1C0UA 1HJRA 1K6YA 3QNOA 3U6FA 1B9DA 4FW1A 4ELVA 3DLKA 2HHXA 2YNIA 3NH2A 3C95A 4LH5A 2OPSA 3DLRA 1TGOA 1WLJA 4B9TA 4ELUA 3DYAA 2OYQA 4TSXA 4IFVA 4Y1DA 3KD5E 4FJ9A 3HO1A 3AVIA 4BACA 4CJEA 4FLZA 3DI6A 2YHBA 4DTJA 4FK2A 3OYEA 4CHQA 3VN5A 2D0AA 1D8YA 1XC9A 3V1OA 1LWFA 2XY6A 4OKKA 1NK7A 3I0SA 4CEDA 1RT3A 1O1WA 2XY5A 4AHTA 3DRPA 3OYBA 3JSMA 1RDCA 2OPQA 4KO0A 3ZCMA 4DTXA 4KHWA 1SV5A 3ZSOA 4DU1A 4CK2A 3NHGA 3V9SA 1L3UA 3NBPA 3M8QA 3SQ2A 1F21A 4DTUA 4CK1A 3LPUA 4DFKA 3MXIA 1LV5A 3OJSA 1NK9A 3DLGA 1RT5A 2XHBA 4FLYA 1IG9A 1I39A 4DSEA 1NJZA 4Z0UA 3SV4A 5HLFA 2Y1IA 4IBNA 4CK3A 4H8KA 3HL8A 3VQ7A 1JXBA 1RILA 4O55A 4E7LA 3HXMA 1MU2A 3EY1A 1ZBLA 4F2RA 5KRTA 2PYLA 1G15A 4FYDA 5KTQA 1LWCA 3VA3A 4KTQA 3G10A 4BWMA 1GOAA 3TAMA 2Z1HA 3QNNA 3V1RA 3B6PA 4CIGA 3TANA 2DFFA 4CIFA 1TKDA 4DMNA 4CJRA 4IG3A 3QIOA 3LP3A 4W5OA 3V9XA 3F9KA 5K14A 1NKBA 1S9EA 4KB1A 4AHCA 1BI4B 5FROA 3QO9A 1T05A 1QE1A 5C25A 3IAYA 3MXJA 3CM5A 2PY5A 4K8ZA 3HPGA 1ZBUA 1BGXT 1BI4A 1SL1A 3S3NA 3VQDA 4BDPA 1SUQA 4CJ3A 2IOCA 3THVA 4F4KA 3OS0A 5FRMA 1TKZA 4JS5A 1RDDA 3RRGA 1KVBA 1UA1A 1B92A 3VQAA 2FBTA 3L2RA 4FJ7A 1BQMA 4AHSA 4DLGA 3V9ZA 4FZYA 2YKMA 4DQQA 3OVNA 1CZ9A 3DMJA 1Q9XA 2IC3A 3D45A 1RBUA 3NF9A 2PZSA 2HNZA 2NUBA 2E6LA 4BWJA 4JS4A 1KTQA 4BE0A 1NK6A 4KHUA 3KLEA 4PWDA 1HRHA 5EU7A 1GOCA 3O3FA 3KLHA 4FJKA 2QKBA 4CHNA 4CHPA 4M3UA 1EKEA 2F8SA 4Z4IA 4OLAA 4Z4HA 1LAVA 4AHUA 4I9QA 1C0TA 2ZE2A 1C0MA 2WONA 2X6SA 4W5RA 3SNNA 4PUOA 3AVBA 5D3GA 2OPRA 3ZT1A 5CY4A 2HW3A 3RR7A 4CEAA 1FXXA 4FLVA 4LSLA 3HJFA 4HCCA 4F3TA 3QETA 1KRPA 3PX0A 4CJTA 1CXQA 4BDZA 5HRRA 1I3AA 2XY7A 3TI0A 1NKEA 2BE2A 3CFOA 2BGGA 1UOCA 3P5JA 4W5TA 1RT2A 3KK2A 3KLGA 4CJVA 4E0DA 1J5OA 1BQNA 3OYJA 4FCYA 1J53A 1RT7A 1XI1A 3HK2A 3NF8A 1EX4A 2KW4A 2Q3SA 3P1GA 4JRPA 4DWIA 3S9HA 3KJVA 1VSEA 1DLOA 4CJWA 2XRIA 3VQ5A 1IKWA 1WNSA 4LH4A 4RW4A 4JLHA 3RRHA 4DTNA 3JYTA 1TKXA 2DY4A 4KKOA 5HBMA 4KHNA 1U04A 1X1PA 1WSHA 2VG6A 3ASMA 3QEXA 3BGRA 3OYNA 3HM9A 3V4IA 1NJWA 4E19A 1ZBIA 4FW2A 4DSFA 4CGJA 3B6OA 1L3VA 1A5WA 1KFDA 4O0IA 3TAFA 2G8VA 3OYLA 2HVIA 1VSDA 2HMIA 2ZD1A 3ZSQA 3NFAA 3KK3A 4BE1A 1N5YA 1HMVA 4CGGA 3LWMA 3WNEA 1EP4A 1FK9A 4B9MA 3OYAA 3HVRA 4PQUA 4B9LA 4OKJA 4RW8A 3VQ4A 1RCHA 1VSJA 3QINA 1HYVA 4I2PA 5DK5A 3VQPA 2YNFA 3D0PA 4HUFA 1QSYA 1BL3A 3MEDA 4DS4A 1X9MA 4LD0A 4M3XA 4IKFA 4DTOA 1HYZA 3SZ2A 1FKPA 3L3UA 1C6VA 2HVHA 1BISA 3LPTA 1U49A 3KD1E 1YTUA 3NGYA 1S1XA 4R5PA 4GMJB 1ZYQA 2HHQA 1RNHA 4KPYA 4FVMA 3AVAA 4FK4A 2VWJA 2HNYA 2EHGA 4DQPA 3TAQA 3AVJA 3ZSVA 1EETA 3SQ4A 5CYQA 3OYDA 4ZTJA 1BIUA 1J54A 1WAFA 4CJKA 3VA0A 4KTZA 5SZTA 3OJUA 3MXMA 4EZ6A 3L8BA 1RT4A 1S9GA 3RMBA 4OLBA 4ID1A 1QHTA 4DFPA 1LW0A 4JRQA 2P5OA 3WNFA 3NH1A 4K8XA 1KSPA 3PX6A 4HTUA 4FZZA 3MAQA 4FJNA 4FJJA 1N6QA 4LY7A 4E89A 3KLFA 3PUFA 3KKSA 4KFBA 4CJ5A 1JLCA 3K5MA 4KHYA 3MECA 3KKRA 2ETJA 1WSJA 3VQQA 3LZIA 1KVAA 4ZTFA 4FJIA 2GUIA 3QLHA 4DF4A 3OYCA 3U3YA 1NJYA 4B8AB 4QAGA 1NK8A 3MEEA 4N56A 2RF2A 3SQ0A 3QEWA 1VSMA 3WNGA 3AV9A 2OA8A 4MFBA 3L2VA 1CLQA 2GBZA 4FJXA 4FJGA 4DQSA 1QSLA 3ZT3A 1IKYA 3RR8A 3NAEA 1S1VA 4UQGA 3ZT0A 4KB0A 1TV6A 1IH7A 3HP9A 4J2EA 4KAZA 1ASVA 1S6PA 1U47A 4KHQA 2F96A 4YNQA 1Q9YA 2XY8A 2ATQA 3K5OA 1D9FA 4CJSA 1RBSA 1QS4A 2BANA 3I8DA 3PY8A 1VSFA 5FDLA 4Z4FA 4Q5VA 3H08A 4ELTA 3AVHA 3T19A 4B8CA 3K2PA 3F73A 4Z4CA 1XHXA 2O4IA 4KI6A 1SL2A 3P83D 3TR8A 2Z1GA 3KLIA 4AH9A 3HT3A 3DLHA 3O3HA 4N5SA 4DG1A 5HRNA 1LAWA 3TARA 4CHZA 4F8RA 2DFHA 3HSTB 3M8PA 4DS5A 4M3ZA 2E6MA 4H4MA 2FBVA 3AA3A 3ZSYA 5FRNA 3ZT4A 2AJQA 2HNDA 2QXFA 4XIUA 3LP1A 3AVCA 3OY9A 4E1NA 3E01A 2FBYA 2IS3A 3OS2A 4FJ8A 1TL3A 4E1MA 1L3SA 5HRSA 3OYKA 5JS1A 1S6QA 1BCOA 2B6AA 3NF6A 1W0HA 4ZHRA 4FLTA 1ASUA 1JLFA 2A1RA 2B5JA 1Q8IA 2D0CA 2RPIA 3I0RA 3NH0A 5KI6A 3O3GA 3LZJA 4CEBA 4L8RB 3K5LA 3O4NA 4AHVA 2EX3A 1JKHA 3AVNA 4CEOA 4CFAA 4FJHA 1VSHA 1ZBHA 3DLEA 2FC0A 3SUOA 1D9DA 2HHTA 3IRXA 4CGIA 4W5QA 4DTMA 1NK0A 1QTMA 2HB5A 3SQ1A 5T7BA 3SV3A 5CYMA 4CESA 3UIQA 3NGIA 3RTVA 4DFJA 1IKXA 4B9SA 2FBXA 1RT6A 1RTJA 3AA4A 3T3FA 2X6NA 2G8WA 4J2AA 4KHSA 4C8LA 2KFZA 1S5JA 1YTAA 4M3WA 2I5JA 1SKSA 1LW2A 3K59A 3CM6A 4CJFA 2ZQBA 4KTWA 4CGHA 5CZ1A 4CCHA 3G0ZA 4FK0A 4DSIA 4C8KA 4M42A 5SWMA 3AVKA 1SKRA 1YVUA 1REVA 5J2MA 2Z1IA 3V9WA 3RWUA 4PY5A 1U48A 4O4GA 4CJQA 4DQIA 4IDKA 4NCAA 3OYGA 3DOLA 4CECA 4DTSA 2BDPA 2OZMA 4FJ5A 4B9VA 4CGFA 4KREA 1IO2A 2KFNA 1JLAA 3AVLA 3LAMA 2IAJA 4HCBA 4I7FA 1LWEA 4CEQA 5C42A 3ZSZA 3V6DA 4FZXC 4RW6A 3CQ8A 1KVCA 3CG7A 2G8UA 4QOZB 1KLNA 4B9UA 1BIZA 5CZ2A 1S1TA 2YV0X 3KIOA 4FM2A 2YHAA 4DF8A 1RBVA 2VWKA 4RW7A 3S3MA 4E7HA 1CZBA 4CHOA 1C1AA 3HYFA 3IG1A 4NCGA 4E7KA 1EXQA 2ITGA 1VSIA 1JL1A 1TL1A 3V1QA 3OS1A 1A5XA 3LP0A 1ASWA 1RBTA 4CF8A 4CIEA 2QKKA 4DSJA 1VSLA 3DRRA 3VQ9A 4QCLA 4FM1A 3PV8A 4HVJA 4RW9A 1JLGA 1VK0A 1BCMA 3AO1A 3LALA 3AVFA 3AVMA 3VQ6A 4CF9A 3C94A 4CEZA 4Z4EA 3C6TA 3L2WA 1WSGA 4I9LA 1IKVA 1WSEA 3C6UA 3QEVA 1RTDA 2G8KA 5DMRA 2XO7A 3HPHA 4H4OA 4PA1A 1UA0A 5KGXA 2IDOA 3QIPA 4DU4A 3DOKA 4J2DA 3PO4A 1UWBA 5J2NA 1C1CA 4DTPA 1KCFA 4M3RA 1NK4A 1HYSA 4OVLA 3SJJA 4B08A 3EYZA 5I3UA 5E41A 3M8RA 1DTTA 3HVTA 2RKIA 1S1WA 3OYHA 1RT1A 2P51A 4DSLA 3NE6A 4C8NA 4DSKA 1YT3A 1HQUA 3ULDA 4C8OA 4M41A 2O4GA 3CFPA 2HHUA 1VRUA 2YNHA 4N47A 1XHZA 4CFCA 4NYNA 1RDBA 2RN2A 3KTQA 1JLEA 4E3SA 4KV8A 5HP1A 2VG7A 3OYMA 3OYFA 1QSSA 4OGCA 1TAQA 4O44A 4CHYA 3HPOA 4OPKA 3EZ5A 2PYJA 4N76A 3BDPA 4CF2A 1UAXA 4CJPA 4F3OA 3V9UA 3QEPA 4LSNA 2Y1JA 2DTUA 3AO4A 4E7IA 1R0AA 3SYZA 3TAGA 4N41A 4M45A 1TK8A 3RMCA 4IG0A 4EZ9A 1HPZA 3FFIA 1SL0A 1B9FA 4MQ3A 3LDSA 4FM0A 2KZZA 1U45A 3VQCA 2LSNA 1NOYA 4M3YA 4HUGA 4C8MA 3VQEA 3NGZA 5J1EA 4B3OA 1NKCA 1TK0A
chains in the Genus database with same CATH superfamily
2HF3A 2Q0RA 3SPZA 5JVHL 4H0XB 3NDKA 2A6AA 4G1QA 4CJ4A 3LDPA 2X78A 4LFBK 3TU5A 2G8IA 1VSKA 4JI7K 5HRPA 2YX6A 4NYFA 3EEQA 1TVRA 2D5RA 5KQ8A 1X3NA 4PKHA 2JLEA 5C12A 2QK9A 3T1AA 4CF0A 4OPHA 5AJ3K 3AO2A 5MLCQ 5J2QA 5AQIA 2I7PA 2R7YA 3E9PA 3LAKA 2GELA 2FF6A 3NCIA 3TSUA 3K9KA 4WCEL 1RBRA 4YHHK 4F2SA 4BRPA 4HUEA 4W5NA 3H6EA 5M1OA 1NJXA 2RE2A 4GY2B 5GAEP 3WXKA 5JS2A 3QEIA 3ZT2A 3G6EN 1DTQA 2P9IA 5AZIB 3KK1A 1C1BA 2IGIA 4ILHA 5IWAK 3OBWA 3AO5A 3SAHA 2D0BA 1JLBA 5AQFA 1GLEG 3DRSA 4CZKA 4CJUA 4NCBA 3JXUA 1GLDG 1TAUA 3AARA 1TUUA 1D5AA 3H1QA 1CXUA 3NF7A 3O8MA 3R8EA 3FZHA 4PL8A 5I42A 2Q1NA 1T7PA 4DTRA 3R9PA 3VQBA 3RMAA 1TKTA 3PX4A 3O4QA 4B3MK 3WNHA 2HOEA 3MEGA 4AILC 3QNOA 3U6FA 3GDQA 4LF5K 1B9DA 3DLKA 3NH2A 3M3ZA 3C95A 4LH5A 5AQZA 1JCEA 4CVNE 3DYAA 4IFVA 4BVOA 4A2BA 1G99A 2YHBA 4CHQA 3VN5A 2NRRA 3VEXA 3V1OA 3SLCA 1O1WA 2FLOA 4AHTA 4BRLA 5F2RA 4KO0A 4KHWA 1SV5A 1VAZA 4DUYK 3SQ2A 1F21A 5M1FA 4DTUA 4DFKA 1HNXK 3I8BA 3O08A 1NK9A 3FGUA 4XH5A 2P9KA 4Z0UA 5HLFA 2Y1IA 3H46O 4CK3A 1XNRK 3GOIA 4H8KA 3VQ7A 4FYDA 3CJ1A 4KTQA 4BWMA 3T1YK 4HWIA 3V1RA 3B6PA 4FWPA 4CJRA 3LP3A 3V9XA 1NKBA 4KB1A 4AHCA 1BI4B 5FROA 3MN6A 3IAYA 4DR3K 3CM5A 1BGXT 3A0IX 4LC9B 3S3NA 1SUQA 4CJ3A 3CPWM 1B92A 2P9SB 3VQAA 4FJ7A 4DQQA 4BR4A 2IC3A 3D45A 3NF9A 2PZSA 4JS4A 2NUBA 4BRKA 5GINA 4JEPA 4BR2A 1GOCA 2QKBA 3A5NC 2WFBA 4OLAA 3AAQA 4I9QA 3QDKA 1T3VA 2WONA 2X6SA 2OPRA 3ZT1A 3T7ZA 5AQOA 4F3TA 4HCCA 3QETA 3ZYYX 1I3AA 1NKEA 3RSEB 2UYTA 3Q7BA 2BGGA 1UOCA 4W5TA 3KK2A 3KLGA 2FSJA 3BUZB 1JCFA 3KHYA 3CJ9A 3NF8A 3CCJN 4JRPA 3P1GA 2FSKA 4H03B 4DWIA 1VSEA 1DLOA 2XRIA 3J7ZO 1J5EK 2QEXN 3CJCA 1WSHA 3OYNA 3V4IA 2D0PA 4E19A 4DR5K 4CGJA 1KFDA 1I94K 3THXA 4NLCA 1N5YA 3ZSQA 3ZETA 4BE1A 3LWMA 1EP4A 1FK9A 3P4IA 4DCHA 1X3MA 4BRMA 3CERA 3D2EB 1RCHA 1VSJA 1XNQK 4K43A 4HUFA 5AQLA 4DS4A 1X9MA 4M3XA 2P9LB 1HYZA 4IOXA 1FKPA 5E84A 2VQEK 1BISA 3LPTA 2E5LK 5TKWA 1S1XA 2HHQA 4H0YB 3FZFA 1N36K 4FVMA 4FK4A 1Q82O 1KAZA 5AQYA 3TAQA 3SQ4A 5CYQA 3OYDA 1VHXA 3MXMA 5FPNA 5EXWA 1S9GA 4OLBA 2HBMA 1LW0A 4JI4K 1QQNA 3SJHA 3U9ZA 3KLFA 4OO1J 3MECA 1E4FT 1KVAA 4DV7K 4DF4A 1S22A 1NK8A 1YI2N 2D0OA 3SBTA 4H5WA 2OA8A 4MFBA 4MDBA 4YOWA 2OANA 3HP9A 4J2EA 4KAZA 2NRHA 3QICA 4YNQA 2XY8A 2UXCK 1SAZA 1RBSA 1QS4A 3DLLL 5GAGP 5JICA 4WYBA 3AVHA 3K2PA 4Z4CA 3O9SA 1VQ4N 3TR8A 3HT3A 5AQTA 3TARA 4CHZA 3HSTB 4M3ZA 4F9OA 4MO4A 3UKRA 5KPTA 3ZT4A 3D2FA 3E01A 2QWPA 3VF2A 3MN9A 4G9ZA 5JS1A 1S6QA 1BCOA 1W0HA 4BRHA 3O1WA 2P5OA 3HRGA 2RPIA 4O8KA 1ZC6A 3NH0A 3H3OB 2EX3A 3AVNA 3WEEA 4FPAA 4FJHA 1ZBHA 3DLEA 2HHTA 3MX2A 5HL7L 4W5QA 4CGIA 1QTMA 3DXMA 4CBWA 3SQ1A 3NGIA 1K9MO 1YAGA 4GKKK 4JI6K 2G8WA 4C8LA 3BZKA 3K59A 2ZQBA 4KTWA 4CCHA 5CZ1A 1NGHA 3G0ZA 3K0SA 5SWMA 1ATSA 1SKRA 4K41A 2Z1IA 3EO3A 4PY5A 4CJQA 3ID6A 3OYGA 5F0XA 3DWLA 3UKUB 3LAMA 4HCBA 1LWEA 1NGAA 3T69A 5C42A 3ZSZA 4RW6A 3CQ8A 3CG7A 4BG8A 5CZ2A 4FM2A 2YV0X 2VWKA 4RW7A 1CZBA 3MWTA 4E7KA 3IG1A 1P8ZA 1EWRA 1RBTA 4CF8A 4CIEA 3VGMA 3EKUA 3PV8A 1JLGA 5GAHP 4Z4EA 3C94A 4JYAK 1NG9A 1WSGA 4I9LA 1IKVA 1WSEA 5DMRA 3VGLA 3HPHA 1HUXA 4IOAL 2IDOA 3DOKA 4J2DA 1UWBA 1TYQB 1NK4A 4OVLA 3EYZA 5CE3A 2NNWA 2W6KA 4YY3K 4C8NA 4XH4A 1YT3A 4A59A 1T6DA 3KTQA 4E3SA 4KV8A 3W0LA 2VWBA 2VGNA 5M1PA 3BDPA 5JMVA 4FWMA 4F3OA 3QEPA 2Y1JA 4E7IA 1HX1A 1NGJA 3SYZA 3B8AX 3TAGA 3CC7N 1VQON 1XUPO 2DPNA 5AZJA 1B9FA 4FM0A 1NOYA 3MDQA 4M3YA 1LOTB 4DV5K 4GNIA 3C65A 4QS9A 5IT9O 3VQEA 5J1EA 3FZMA 1U4BA 3O9TA 4Z4GA 2YNGA 4BREA 2FSNA 3SUPA 4IFYA 4KRFA 5CHIA 2HHWA 3V81A 4FWRA 4GV6A 3CFRA 4JKFA 4J8FA 3ZSRA 1J9AA 3L2UA 1NGDA 4KI4A 3LP2A 4DV6K 3T1HK 2OZSA 4EIAA 3K5NA 4WFNL 2QM1A 1NK5A 4YDUC 2ZJPL 4CFDA 4BDYA 3D6RA 3HI0A 3MCPA 3OYIA 4E7JA 3S3OA 3ULEA 4FLWA 4Y1CA 1SZ2A 1W9HA 1RDAA 4M3TA 1X9WA 2FXUA 1BDGA 5TKYA 1HNVA 2QTDA 2P9IB 2OCEA 4H5RA 4A62A 1NMDA 3SAGA 3VEYA 1T8EA 3R3LA 1A5VA 2F4VK 3IS9A 1GOBA 4OJRA 4OKEA 4CW7B 3GBTA 3THWA 3KWIA 5EX5A 1FJGK 4CJLA 4FLXA 4DU3A 3K58A 3PLAA 3FE1A 2HHVA 4HTLA 2Z1JA 3VESA 2W41A 3TPQA 3EKSA 3LDQA 1VRTA 4O5FA 2BTFA 4EP4A 1T03A 2G8FA 3ITHA 1L3TA 5FPEA 3A2FA 1QQCA 2E1ZA 4CEEA 1NNEA 1QVFM 1YVNA 3DJCA 5J2PA 1XMQK 4U67L 1E3MA 1C0UA 1HJRA 2YNIA 1QZ6A 4ELUA 2V7YA 1OH7A 4CJEA 3CIPA 3DI6A 2ZJRL 4DTJA 4U7BA 1D8YA 1RGIA 4C23A 1XC3A 2XY6A 1NK7A 3I0SA 4CEDA 1RT3A 2O8FB 1RDCA 4DTXA 3ZSOA 3DAWA 5FPDA 1L3UA 5BRHA 2P9KB 2D4WA 4CK1A 3LPUA 4FWKA 1RT5A 2XHBA 3KVGA 4FLYA 4DSEA 4IXCA 3SV4A 4IBNA 2O8BA 3HL8A 4BRAA 1RILA 4O55A 4XEIA 4E7LA 1ZBLA 5BN9A 5KRTA 2PYLA 1LWCA 3G10A 1GOAA 1BO5O 3O9QA 4RCHA 4EHUA 5KQDA 1NGBA 1M90O 4CIGA 2DFFA 2E8AA 3JAMO 1TKDA 1EQYA 1HR0K 5AQGA 5K14A 3ATVA 3QO9A 3WXMB 4NO7A 4K8ZA 2PY5A 4LF4K 1SL1A 3CQYA 1WOQA 3BEXA 2IOCA 3QFUA 2AA4A 3H1VX 1O13A 1IV0A 4DLGA 3V9ZA 4FZYA 2A5XA 2YKMA 3OVNA 4DR2K 1CZ9A 3DMJA 5E26A 2E6LA 4KHUA 3KLEA 4PWDA 3O3FA 5EU7A 2F8SA 2NRWA 5BR9A 3PSFA 2ZE2A 3SNNA 5BN8A 1JJ2M 3AVBA 1QHAA 1ILYA 4FLVA 4LSLA 2UXBK 5DM6L 3A8YA 3MN7A 3TI0A 3CFOA 4FL9A 4B3SK 4BGAA 3TTFA 4E0DA 4B9QA 1ATNA 5LMNK 4FCYA 1J53A 1EX4A 2Q3SA 4WQ4A 3R6MA 1HKGA 2HBLA 4JHDA 1RDUA 2A42A 4RW4A 2DY4A 3JYTA 4KKOA 5C15A 1X1PA 3THXB 4DV4K 3BGRA 3ZETB 1NJWA 3MN5A 1T44A 3B6OA 1L3VA 4DV3K 1WB9A 2HVIA 1VSDA 3NFAA 4OPAA 4B9MA 4B9LA 1NLVA 3VQ4A 4I2PA 1HYVA 4LF7K 4QS8A 3OBYA 4IKFA 3SZ2A 1KAXA 3U8XA 3KD1E 1OVQA 1BUPA 1ZYQA 4KPYA 2WBNA 4JKDA 3KK7A 2HNYA 2EHGA 4BR9A 3WXIA 3AVJA 2YI1A 1J54A 3CQXA 4KTZA 5ADXA 4Y0WA 3L8BA 1RT4A 4B1VA 2OTLN 4JKCA 4JRQA 4K8XA 1KSPA 3LDOA 4BY9C 5GIOA 4CZMA 4HTUA 3PX6A 1HNWK 2F9WA 4FZZA 2O8FA 4CZJA 4DB3A 4FJNA 4YOTA 1JLCA 5AQMA 4KHYA 3KKRA 2ETJA 1WSJA 3LZIA 3KWGA 3OYCA 4B8AB 3MEEA 2RF2A 4H5NA 2NZTA 5AQKA 3FLCO 5ELZA 2Q36A 3WT0A 2GBZA 3AGRA 4FJXA 3CC2N 2HMPA 3BZCA 2F7TA 3AGKA 3RR8A 1S1VA 4B3TK 3ZT0A 4KHPK 1TV6A 1M1KO 4LF6K 2ATQA 3K5OA 5DM7L 1D9FA 3C6AA 3PY8A 2UU9K 2E2QA 3H08A 4MLEA 1HKCA 3T19A 4B1XB 4B8CA 3F73A 2PBDA 3UKRB 3ZX3A 2Z1GA 3DLHA 3O3HA 4N5SA 5HRNA 2DFHA 3M8PA 3QB0A 3LDLA 2E6MA 5B8HA 3D2FB 1YITN 3AVCA 5AQVA 3OY9A 1EWQA 4IOCL 2FBYA 3OS2A 1RDWX 1TL3A 4I6MA 4IJAA 4BRCA 5HRSA 2I7NA 3I55N 1EO1A 2B6AA 3WEEB 4DV1K 1ASUA 1JLFA 1Q8IA 2D0CA 4L8RB 1YJ9N 2VCPA 3DXMB 4AHVA 4YOXA 3A5OC 3LDNA 1CZAN 3W3DA 1GLJO 3IRXA 4DTMA 1BA1A 4YORA 1VQPN 4IO8A 3SV3A 5CYMA 3UIQA 5BREA 1RTJA 2KKZA 3S41A 4J2AA 2O8DA 1LW2A 1Q86O 3CM6A 3ZEUA 1XMOK 1IG8A 4C8KA 4M42A 3C7NA 3VENA 5AFUA 2ZM6K 1REVA 3AY9A 5J2MA 4ISGA 4NCAA 3DOLA 4FJ5A 3J8AA 4EFHA 4B9VA 1IO2A 1JLAA 2Q97A 3AVLA 4I7FA 4CEQA 4FZXC 3CPEA 1KVCA 2G8UA 1KLNA 1BIZA 3D7EO 4NCGA 3HYFA 1YJNN 1HPMA 2ITGA 1J6ZA 3K9JA 3OS1A 1A5XA 3LP0A 3FZKA 3DRRA 5FLXO 3VQ9A 4RWTA 4QCLA 4HVJA 4BG9A 1VK0A 3AO1A 1DEJA 5AQUA 3VQ6A 1BWFO 4X64K 2O8CA 3C6TA 3L2WA 4BQLA 3IMXA 4PA1A 5KGXA 4DU4A 2ITMA 3PO4A 4CZLA 1KCFA 1HYSA 5E41A 4DSLA 4CBXA 2O4GA 4FWOA 1VRUA 1K73O 1XHZA 4NYNA 1RDBA 4JI2K 2VG7A 3NVKA 2PYJA 4N76A 4CZGA 2GEMA 2VGMA 4CF2A 1UAXA 5AZJB 2DTUA 3AO4A 2ASOA 1TK8A 4IG0A 3FFIA 4MQ3A 3LDSA 1U45A 3VQCA 4JKGA 3MK6A 2IVPA 5M1KA 4B3OA 1NKCA 2P9UA 2Q0UA 4CBUA 4BE2A 1NU0A 3QFPA 4AQYK 4FJLA 1GLAG 2VQFK 4K42A 3ZX0A 3BP8A 3HP6A 3EZWA 3DM2A 4ID5A 5GIPA 1KC8O 5EVZA 3ZSWA 1ATRA 5AQHA 2OPPA 4WE1A 3QBXA 4BR7A 5HROA 2F8TA 1Y97A 4GVEA 5EY4A 4YFUA 4DR1K 5M1QA 1WN7A 1NOZA 4OPJA 3RMDA 4CERA 1OH6A 2X74A 1Z25A 2F9TA 2CGKA 3TSPA 3ULEB 5JLFA 2HHSA 3AO3A 4DFMA 4FWNA 1WAJA 1RTIA 5BRFA 3AAPA 4CI6A 1N33K 2DFEA 4FOIA 4GVMA 3THYA 1WSFA 4B1WB 3TAEA 1VQLN 2UUCK 2E2PA 4JKEA 1NGEA 3L3VA 3THWB 3ZLJA 5AQQA 2P9PA 4DQRA 2ZF5O 4KH6A 3VEWA 5ADXH 3CYMA 2QWMA 1SKWA 2P9NA 4GW6A 3QERA 1JLQA 3J7YP 3CMEN 3DXKA 2YKNA 4DLEA 1XWLA 3L6QA 4BC3A 3AA5X 3U3GA 4HHTA 3SCXA 1HQEA 3K57A 3TAPA 2A1SA 3ZSXA 3AVGA 2V51B 1ZBFA 2W42A 4JNEA 3HOSA 4CF1A 3QESA 1RTHA 1TK5A 4RTFD 2E20A 1K6YA 1MA9B 1VQ9N 4ELVA 2HHXA 5I9EB 2OPSA 1WBBA 4B9TA 4K0KK 4FOEA 4BRNA 4FK2A 1XC9A 1LWFA 1U2VA 3DRPA 3OYBA 3ZCMA 1VQ8N 4DU1A 4JI1K 3NHGA 3V9SA 3NBPA 1LV5A 2QWQA 3OJSA 2O8BB 3DLGA 3CHWA 4IDHA 1NJZA 1KXPA 3FFKB 1JXBA 3H3NO 3HXMA 1MU2A 4F2RA 1G15A 2IVOA 5KTQA 3PIPL 1DGKN 3TANA 2GWJA 3HM8A 2E1YA 4CIFA 5AR0A 3QIOA 3F9KA 3CCSN 1MWMA 1T05A 1QE1A 5C25A 4BC2A 1DT9A 3MXJA 1NWKA 1ZBUA 2KHOA 3VQDA 2PFUA 3THVA 1GLFO 1TKZA 4JI5K 4JS5A 4CZFA 3RRGA 1KVBA 5AQWA 5C0YA 2FBTA 3L2RA 4FSVA 1BQMA 1DKGD 3O6WA 4AHSA 3CJ7A 2HNZA 3VTIA 4BWJA 4BE0A 4CHNA 3O9RA 4CHPA 4M3UA 1EKEA 4Z4HA 1C0TA 1C0MA 4X62K 4W5RA 5AQPA 1IBMK 4PUOA 5D3GA 4BRGA 2HW3A 3VMFB 4CEAA 2GX9A 5A2QO 1BA0A 1FXXA 3TTDA 1KRPA 4CJTA 4BDZA 1RT2A 4CJVA 3WQTA 2E2NA 4DR7K 4JHDB 2KW4A 3S9HA 3KJVA 4LFAK 1WNSA 3P39A 2VYPA 4JLHA 1ESVA 3RRHA 5HBMA 1U04A 2VG6A 3ASMA 3QEXA 4DHYA 1ZBIA 4DSFA 4IEEA 2A3ZA 3TAFA 2G8VA 2NRXA 3OYLA 3F2KA 2HMIA 1VQKN 1HMVA 4CGGA 3WNEA 3I56N 3HVRA 4PQUA 1VQ6N 4OKJA 3QINA 2YNFA 1BL3A 3MEDA 4IZ9A 4DTOA 3L3UA 1C6VA 2HVHA 1U49A 1YTUA 3BF3A 4R5PA 4GMJB 3VF4A 4JI3K 3AVAA 3VOVA 1VQ7N 1KD1O 4KBOA 3ZSVA 1EETA 4WQ4C 4DR4K 1WAFA 5SZTA 4A5AA 5BRDA 1H1VA 3RMBA 4ID1A 4DFPA 3WNFA 3NH1A 2CH5A 2QWLA 3PIOL 4E89A 3KKSA 4CJ5A 1N34K 2NRVA 3VQQA 1QVGM 3G71N 4ZTFA 4FJIA 2QWNA 3E9LA 1T6CA 2ZWHA 3G4SN 3SQ0A 3WNGA 2V7ZA 3AV9A 4JD2B 1Z05A 5LJVA 1CLQA 5LJWA 4FJGA 4DQSA 1QSLA 3CCVN 2A40A 3ZT3A 3P38A 3NAEA 4KB0A 3MCAB 1ASVA 1U47A 4KHQA 4H0VB 4GV3A 1Q9YA 4JK9A 3LM9A 4CJSA 4CJ7A 3GL1A 4Z4FA 3EE9A 3MX5A 4BC5A 4FVUA 3M6GA 3TSQA 2O4IA 1SL2A 3L4IA 1BU6O 3P83D 4AH9A 3KLIA 1LAWA 3CCMN 4BR0A 2FBVA 5FRNA 3WXJA 2AJQA 4I6MB 3NMUA 3OHRA 2QWRA 1L3SA 3OYKA 1NMNA 2HF4A 4NB4A 3FR0A 4ZHRA 4FLTA 1V4SA 2B5JA 3CC4N 4CEBA 5BPNA 2WTUA 1HJOA 3K5LA 2V52B 1VSHA 1K8KA 2FC0A 1D9DA 3CCQN 2O8DB 4CESA 5BPLA 3ZEUB 3RTVA 1IKXA 4DFJA 4B9SA 3AA4A 3M1FA 3T3FA 2KFZA 3C7NB 1YTAA 4M3WA 2I5JA 4C1NK 3F9MA 4CJFA 1C0GA 2W40A 4CGHA 3AVKA 4ISEA 4LF9K 3V9WA 2IVNA 4O4GA 2J4RA 4DQIA 2WC9A 3L4QA 2CGJA 4CECA 3J80O 2QI2A 4KREA 2O8EA 3HSCA 3QBWA 1VQMN 4LFCK 2IAJA 4FWQA 3MMVA 3HBTA 4JK8A 2Q31A 4IEIA 3SBGA 4B9UA 3G25A 4EHTA 1S1TA 4DF8A 3S3MA 3VEVA 4CHOA 1IBLK 1C1AA 3I33A 1EXQA 1VSIA 1TL1A 4JKHA 3V1QA 1ASWA 2O8CB 1VSLA 1GLCG 2E88A 4RW9A 1BCMA 4CEZA 3AVFA 3C6UA 3QEVA 2NRTA 2XO7A 4H4OA 1HKBA 4NXMK 3LL3A 4JI0K 1SQKA 1C1CA 4DTPA 4Z94A 4M3RA 3SJJA 4B08A 5I3UA 3ENHA 4CZHA 3M8RA 1D4XA 5F1XA 3OYHA 4BQZA 3NE6A 4MLHA 1HQUA 3CFPA 2HHUA 2YNHA 3N4QA 4N47A 4CFCA 2BH1A 2W6LA 2RN2A 1JLEA 2HBJA 4PKIA 3OYMA 1TAQA 4CHYA 3VEZA 3HPOA 3V9UA 2A41A 1R0AA 4JD2A 1S3XA 4JKGB 4N41A 2H3GX 4M45A 3RMCA 1HPZA 1U6ZA 3MWPA 3VPZA 2P9UB 4C8MA 1LCUA 4FPBA 3C6HA 1TK0A 2WOMA 2ZGZA 3ALYA 4CFBA 2ASPA 1KFSA 4O5BA 4NLBA 4J2BA 3EL2A 2GV9A 4DKWA 2JGUA 1S72N 3TABA 3ISNC 3SK3A 3IDHA 3TWHA 4RG8A 4Q0BA 5C24A 3LWLA 4CZEA 1S1UA 2G8HA 4AHRA 4CGDA 4EP5A 4JN4A 2P1JA 3QMLA 5KGWA 2EWSA 3WUHA 1X9SA 1WUAA 3AA2A 4CE9A 3CCEN 1Q81O 3VETA 2UXDK 2KZMA 1ZXOA 2YJEA 1WSIA 3SPYA 4B1UB 1FKOA 4KH4A 5FPMA 4FJMA 3GG4A 4O0JA 5AQSA 3THYB 3J81O 3CJAA 4FXDA 1Q18A 3DLBA 2VG5A 4EAHD 5KRSA 4CEFA 4WQ5C 4ISFA 1NM1A 2P9PB 5AQXA 3CF5L 1W7AA 4OX9K 1ITGA 1OVYA 5KPZA 1BOTO 3CXCM 4X65K 2KQ2A 1ZBSA 2FF3B 3O80A 2P9NB 4FO0A 4WFAL 3H45C 4B9NA 1NGGA 5AZIA 3M8SA 2B4JA 3DXKB 2KTQA 1Z6RA 4DR6K 2WUSA 3ID8A 2YJFA 4ICLA 4OGEA 2KLAA 3VQ8A 3R1XA 1YHQN 1JL2A 1L5UA 5AQJA 3F5TA 2P5GA 1BHLA 3VF6A 4LF8K 1N8RO 3LANA 1Z26A 4I2QA 3CCLN 3M5RA 3VGKA 1NGIA 3SUNA 3SI6A 2E4LA 1HNIA 3L2QA 4JKAA 3PO5A 3LM2A 1MDUB 3FZLA 1KLMA 1JXEA 4FLUA 3SUQA 3CJBA 3VTHA 4FW1A 4YOYA 1GLLO 3CCRN 4H5TA 2YHWA 3DLRA 1TGOA 1WLJA 2OYQA 4TSXA 4BVPA 2GTDA 4Y1DA 3KD5E 4FJ9A 4UY8O 3HO1A 3J7AP 3AVIA 4BACA 1Q7YO 4FLZA 1U2VB 3OYEA 4JAXA 2D0AA 2NLXA 2YHXA 1YUWA 4OKKA 4WF9L 2ZJQL 3HOTA 2XY5A 4IWVA 3JSMA 1P90A 1NJIO 4BRDA 2OPQA 3VERA 4C1NI 4CK2A 4IJNA 3C0BA 3M8QA 3MXIA 4M63C 4BC4A 3BF1A 4M7XA 1IG9A 1I39A 3ZX2A 4K25A 3ENOA 4H0PA 3EY1A 5KPRA 3VA3A 4BRIA 3TAMA 2Z1HA 3QNNA 1YXQA 4JV5K 2HSTA 4AF1A 4DMNA 4JKBA 4IG3A 2PAVA 4W5OA 4WQ5A 3IUCA 1S9EA 1BG3A 5JVGL 1KAYA 3IFRA 3HPGA 1QQMA 1BI4A 4L3QA 3ENBA 4BDPA 3CCUN 4F4KA 3OS0A 5FRMA 4B1ZA 1RDDA 2AP1A 1UA1A 4BR5A 3CI5A 4E1JA 1NBWA 2GWKA 1Q9XA 1KQSM 1RBUA 2P9SA 1NK6A 4DUZK 1KTQA 2HBKA 1HNZK 1HRHA 4FJKA 3KLHA 4Z4IA 1LAVA 2Q2RA 3EE8A 2D1KA 4AHUA 2QWOA 3U9DA 5CY4A 3RR7A 1QQOA 3HJFA 3PX0A 1CXQA 1W97L 2CGLA 5HRRA 2XY7A 2BE2A 3P5JA 1J5OA 1BQNA 3OYJA 3RSEA 1XI1A 1RT7A 3HK2A 1IBKK 4CJWA 5CR4A 2RHKA 3VQ5A 1IKWA 3NVMA 4MDAA 4O8UA 3OA9A 4LH4A 5BPMA 4DTNA 1TKXA 4KHNA 2NRZA 4PL7A 4ILGB 3HM9A 4FW2A 4ILJA 1A5WA 4DV2K 4O0IA 3HTVA 3VEOA 1OKJA 2ZD1A 3KK3A 3O5BA 3OYAA 2YCHA 4RW8A 5DK5A 3VQPA 3D0PA 1QSYA 4LD0A 3D2EA 2ZGYA 1FW6A 1GLBG 3NGYA 2P9LA 1JCGA 4JK7A 1RNHA 4FWLA 4B1YB 2VWJA 4DQPA 1C0FA 4H0OA 1YJWN 2QXLA 4JI8K 3WQUA 4ZTJA 1BIUA 3VA0A 4CJKA 1IJJA 3OJUA 4EZ6A 1QHTA 3O9UA 3WXLA 4BRQA 3MAQA 4CD1A 3E9OA 3GE1A 3EN9A 4FJJA 1R59O 4LY7A 2ASMA 4X66K 3UE5A 1N6QA 3PUFA 4KFBA 3K5MA 1YIJN 2GUIA 3QLHA 3U3YA 4GKJK 1NJYA 4QAGA 4FWSA 4GV9A 4N56A 5JLHA 3QEWA 1VSMA 1RFQA 3RVCA 3CETA 3SAFA 3L2VA 4DQ8A 3CD6N 3PSIA 1IKYA 3OW2M 4UQGA 1IH7A 4BRFA 1V4TA 1S6PA 2F96A 3HZ6A 1W2BM 3ATUA 3E1YA 1WBDA 1VQNN 3IKMA 4AM6A 4B3RK 2BANA 3I8DA 1VSFA 5LMUK 5FDLA 4Q5VA 4ELTA 3E66A 3O1BA 4IFEA 1XHXA 4KI6A 2UUAK 1Y64A 5AFUH 5C2DA 4A5BA 2JWLA 4BROA 4DG1A 4F8RA 4DS5A 4H4MA 3ZSYA 3AA3A 2HNDA 2QXFA 1TUYA 5HOOA 4XIUA 3LP1A 4H5VA 5M1NA 3KZBA 4E1NA 2QA4N 2IS3A 4FJ8A 4E1MA 4IO9L 4M7YA 3TTCA 5AQNA 3NF6A 2E2OA 5EOYA 1N32K 2QW9A 2CH6A 2A1RA 4A61A 2GUPA 3I0RA 3LZJA 1K8KB 3O3GA 5KI6A 5H1SQ 3O4NA 4YOUA 1JKHA 4CEOA 5C10A 4CFAA 2UUBK 3SUOA 1NK0A 4PKGA 2HB5A 4AM7A 5T7BA 3CMAN 5GADP 2FBXA 1RT6A 4KHSA 1HLUA 2X6NA 1S5JA 2HHHK 1SKSA 1K8AO 1OH8A 4FK0A 4DSIA 2IIRA 1YVUA 2O8EB 3RWUA 1U48A 5BR8K 4IDKA 3P31A 2OZMA 2BDPA 4DTSA 4KH5A 4CGFA 2KFNA 3UB5A 3V6DA 3U4LA 4QOZB 3UKUA 3JS6A 3A5MC 3KIOA 2YHAA 5C2FA 1RBVA 3A5LC 3L0QA 4E7HA 2YHYA 1OH5A 4BGBA 4DV0K 1JL1A 4MO5A 4DSJA 3SMPA 2QKKA 4FM1A 1VQ5N 5LL6Z 3LALA 1NGCA 3AVMA 4CF9A 1RTDA 2G8KA 2JWKA 1XQSC 1UA0A 5AQRA 3QIPA 5J2NA 4NXNK 3OTOK 4V19S 3SMSA 1DTTA 3HVTA 2RKIA 4A57A 1S1WA 1RT1A 2P51A 1TYQA 4DSKA 3ULDA 4C8OA 4M41A 1NGFA 4CZIA 3BY5A 1MWKA 1YF5L 4PHTX 4XH1A 4WFBL 2OTJN 2BUPA 5LY3A 5HP1A 3OYFA 1QSSA 4OGCA 1QZ5A 4O44A 4OPKA 3EZ5A 4R79A 1E4GT 4CJPA 3O4WA 4H0TB 4LSNA 4YDUA 4EZ9A 1SL0A 2KZZA 1SS6A 4CD3A 1X9JA 2LSNA 3N4PA 4YOVA 4A2AA 4HUGA 3Q7CA 3NGZA 4QS7A
chains in the Genus database with same CATH topology
2WOMA 4BE2A 3ALYA 4CFBA 3SPZA 1U4BA 1KFSA 4O5BA 3NDKA 4G1QA 4FJLA 4Z4GA 4J2BA 2YNGA 4CJ4A 2X78A 4IFYA 3SUPA 3HP6A 4KRFA 4ID5A 3DM2A 2HHWA 2GV9A 2G8IA 3V81A 1VSKA 2JGUA 3TABA 3ISNC 5HRPA 3CFRA 3ZSWA 4NYFA 1TVRA 2OPPA 2D5RA 3ZSRA 4WE1A 3TWHA 4RG8A 4Q0BA 1J9AA 5C24A 2JLEA 3LWLA 5HROA 3L2UA 1S1UA 2G8HA 4AHRA 4KI4A 4CGDA 2F8TA 2QK9A 3T1AA 1Y97A 4EP5A 4CF0A 2P1JA 3AO2A 4YFUA 3LP2A 5J2QA 5KGWA 2OZSA 1WN7A 2R7YA 1NOZA 3K5NA 4OPJA 1X9SA 3AA2A 4CERA 3RMDA 2X74A 3LAKA 4CE9A 3NCIA 1NK5A 1Z25A 2KZMA 4CFDA 2HHSA 4BDYA 1RBRA 1WSIA 3AO3A 3OYIA 4E7JA 4DFMA 3SPYA 3S3OA 1WAJA 1FKOA 4FJMA 1RTIA 4O0JA 4F2SA 4FLWA 4Y1CA 1W9HA 4HUEA 1RDAA 4M3TA 4W5NA 4FXDA 3DLBA 1X9WA 2VG5A 2DFEA 1HNVA 4GVMA 1WSFA 3TAEA 1NJXA 5KRSA 4CEFA 5JS2A 3QEIA 3ZT2A 1ITGA 1DTQA 3KK1A 1T8EA 1C1BA 2IGIA 3L3VA 1A5VA 2KQ2A 3AO5A 4DQRA 3IS9A 1GOBA 2D0BA 4OJRA 4OKEA 3M8SA 4B9NA 3CYMA 1JLBA 2B4JA 3DRSA 1SKWA 2KTQA 4CJLA 4GW6A 4FLXA 4CJUA 3QERA 1JLQA 4ICLA 4NCBA 4DU3A 4OGEA 3K58A 3VQ8A 1L5UA 1JL2A 2YKNA 4DLEA 1TAUA 2P5GA 2HHVA 1D5AA 2Z1JA 1BHLA 1XWLA 1CXUA 3NF7A 3AA5X 3U3GA 4HHTA 3SCXA 3LANA 1Z26A 4I2QA 1HQEA 3K57A 5I42A 1VRTA 1T7PA 1T03A 4EP4A 2G8FA 3SUNA 4DTRA 3VQBA 3SI6A 2E4LA 3ITHA 1HNIA 3RMAA 1TKTA 3TAPA 3L2QA 1L3TA 3PX4A 3O4QA 2A1SA 3A2FA 3PO5A 1QQCA 3ZSXA 3WNHA 3AVGA 4CEEA 1ZBFA 2W42A 1KLMA 5J2PA 4CF1A 1JXEA 3MEGA 1RTHA 4FLUA 3QESA 4AILC 3SUQA 1TK5A 1C0UA 1HJRA 1K6YA 3QNOA 3U6FA 1B9DA 4FW1A 4ELVA 3DLKA 2HHXA 2YNIA 3NH2A 3C95A 4LH5A 2OPSA 3DLRA 1TGOA 1WLJA 4B9TA 4ELUA 3DYAA 2OYQA 4TSXA 4IFVA 4Y1DA 3KD5E 4FJ9A 3HO1A 3AVIA 4BACA 4CJEA 4FLZA 3DI6A 2YHBA 4DTJA 4FK2A 3OYEA 4CHQA 3VN5A 2D0AA 1D8YA 1XC9A 3V1OA 1LWFA 2XY6A 4OKKA 1NK7A 3I0SA 4CEDA 1RT3A 1O1WA 2XY5A 4AHTA 3DRPA 3OYBA 3JSMA 1RDCA 2OPQA 4KO0A 3ZCMA 4DTXA 4KHWA 1SV5A 3ZSOA 4DU1A 4CK2A 3NHGA 3V9SA 1L3UA 3NBPA 3M8QA 3SQ2A 1F21A 4DTUA 4CK1A 3LPUA 4DFKA 3MXIA 1LV5A 3OJSA 1NK9A 3DLGA 1RT5A 2XHBA 4FLYA 1IG9A 1I39A 4DSEA 1NJZA 4Z0UA 3SV4A 5HLFA 2Y1IA 4IBNA 4CK3A 4H8KA 3HL8A 3VQ7A 1JXBA 1RILA 4O55A 4E7LA 3HXMA 1MU2A 3EY1A 1ZBLA 4F2RA 5KRTA 2PYLA 1G15A 4FYDA 5KTQA 1LWCA 3VA3A 4KTQA 3G10A 4BWMA 1GOAA 3TAMA 2Z1HA 3QNNA 3V1RA 3B6PA 4CIGA 3TANA 2DFFA 4CIFA 1TKDA 4DMNA 4CJRA 4IG3A 3QIOA 3LP3A 4W5OA 3V9XA 3F9KA 5K14A 1NKBA 1S9EA 4KB1A 4AHCA 1BI4B 5FROA 3QO9A 1T05A 1QE1A 5C25A 3IAYA 3MXJA 3CM5A 2PY5A 4K8ZA 3HPGA 1ZBUA 1BGXT 1BI4A 1SL1A 3S3NA 3VQDA 4BDPA 1SUQA 4CJ3A 2IOCA 3THVA 4F4KA 3OS0A 5FRMA 1TKZA 4JS5A 1RDDA 3RRGA 1KVBA 1UA1A 1B92A 3VQAA 2FBTA 3L2RA 4FJ7A 1BQMA 4AHSA 4DLGA 3V9ZA 4FZYA 2YKMA 4DQQA 3OVNA 1CZ9A 3DMJA 1Q9XA 2IC3A 3D45A 1RBUA 3NF9A 2PZSA 2HNZA 2NUBA 2E6LA 4BWJA 4JS4A 1KTQA 4BE0A 1NK6A 4KHUA 3KLEA 4PWDA 1HRHA 5EU7A 1GOCA 3O3FA 3KLHA 4FJKA 2QKBA 4CHNA 4CHPA 4M3UA 1EKEA 2F8SA 4Z4IA 4OLAA 4Z4HA 1LAVA 4AHUA 4I9QA 1C0TA 2ZE2A 1C0MA 2WONA 2X6SA 4W5RA 3SNNA 4PUOA 3AVBA 5D3GA 2OPRA 3ZT1A 5CY4A 2HW3A 3RR7A 4CEAA 1FXXA 4FLVA 4LSLA 3HJFA 4HCCA 4F3TA 3QETA 1KRPA 3PX0A 4CJTA 1CXQA 4BDZA 5HRRA 1I3AA 2XY7A 3TI0A 1NKEA 2BE2A 3CFOA 2BGGA 1UOCA 3P5JA 4W5TA 1RT2A 3KK2A 3KLGA 4CJVA 4E0DA 1J5OA 1BQNA 3OYJA 4FCYA 1J53A 1RT7A 1XI1A 3HK2A 3NF8A 1EX4A 2KW4A 2Q3SA 3P1GA 4JRPA 4DWIA 3S9HA 3KJVA 1VSEA 1DLOA 4CJWA 2XRIA 3VQ5A 1IKWA 1WNSA 4LH4A 4RW4A 4JLHA 3RRHA 4DTNA 3JYTA 1TKXA 2DY4A 4KKOA 5HBMA 4KHNA 1U04A 1X1PA 1WSHA 2VG6A 3ASMA 3QEXA 3BGRA 3OYNA 3HM9A 3V4IA 1NJWA 4E19A 1ZBIA 4FW2A 4DSFA 4CGJA 3B6OA 1L3VA 1A5WA 1KFDA 4O0IA 3TAFA 2G8VA 3OYLA 2HVIA 1VSDA 2HMIA 2ZD1A 3ZSQA 3NFAA 3KK3A 4BE1A 1N5YA 1HMVA 4CGGA 3LWMA 3WNEA 1EP4A 1FK9A 4B9MA 3OYAA 3HVRA 4PQUA 4B9LA 4OKJA 4RW8A 3VQ4A 1RCHA 1VSJA 3QINA 1HYVA 4I2PA 5DK5A 3VQPA 2YNFA 3D0PA 4HUFA 1QSYA 1BL3A 3MEDA 4DS4A 1X9MA 4LD0A 4M3XA 4IKFA 4DTOA 1HYZA 3SZ2A 1FKPA 3L3UA 1C6VA 2HVHA 1BISA 3LPTA 1U49A 3KD1E 1YTUA 3NGYA 1S1XA 4R5PA 4GMJB 1ZYQA 2HHQA 1RNHA 4KPYA 4FVMA 3AVAA 4FK4A 2VWJA 2HNYA 2EHGA 4DQPA 3TAQA 3AVJA 3ZSVA 1EETA 3SQ4A 5CYQA 3OYDA 4ZTJA 1BIUA 1J54A 1WAFA 4CJKA 3VA0A 4KTZA 5SZTA 3OJUA 3MXMA 4EZ6A 3L8BA 1RT4A 1S9GA 3RMBA 4OLBA 4ID1A 1QHTA 4DFPA 1LW0A 4JRQA 2P5OA 3WNFA 3NH1A 4K8XA 1KSPA 3PX6A 4HTUA 4FZZA 3MAQA 4FJNA 4FJJA 1N6QA 4LY7A 4E89A 3KLFA 3PUFA 3KKSA 4KFBA 4CJ5A 1JLCA 3K5MA 4KHYA 3MECA 3KKRA 2ETJA 1WSJA 3VQQA 3LZIA 1KVAA 4ZTFA 4FJIA 2GUIA 3QLHA 4DF4A 3OYCA 3U3YA 1NJYA 4B8AB 4QAGA 1NK8A 3MEEA 4N56A 2RF2A 3SQ0A 3QEWA 1VSMA 3WNGA 3AV9A 2OA8A 4MFBA 3L2VA 1CLQA 2GBZA 4FJXA 4FJGA 4DQSA 1QSLA 3ZT3A 1IKYA 3RR8A 3NAEA 1S1VA 4UQGA 3ZT0A 4KB0A 1TV6A 1IH7A 3HP9A 4J2EA 4KAZA 1ASVA 1S6PA 1U47A 4KHQA 2F96A 4YNQA 1Q9YA 2XY8A 2ATQA 3K5OA 1D9FA 4CJSA 1RBSA 1QS4A 2BANA 3I8DA 3PY8A 1VSFA 5FDLA 4Z4FA 4Q5VA 3H08A 4ELTA 3AVHA 3T19A 4B8CA 3K2PA 3F73A 4Z4CA 1XHXA 2O4IA 4KI6A 1SL2A 3P83D 3TR8A 2Z1GA 3KLIA 4AH9A 3HT3A 3DLHA 3O3HA 4N5SA 4DG1A 5HRNA 1LAWA 3TARA 4CHZA 4F8RA 2DFHA 3HSTB 3M8PA 4DS5A 4M3ZA 2E6MA 4H4MA 2FBVA 3AA3A 3ZSYA 5FRNA 3ZT4A 2AJQA 2HNDA 2QXFA 4XIUA 3LP1A 3AVCA 3OY9A 4E1NA 3E01A 2FBYA 2IS3A 3OS2A 4FJ8A 1TL3A 4E1MA 1L3SA 5HRSA 3OYKA 5JS1A 1S6QA 1BCOA 2B6AA 3NF6A 1W0HA 4ZHRA 4FLTA 1ASUA 1JLFA 2A1RA 2B5JA 1Q8IA 2D0CA 2RPIA 3I0RA 3NH0A 5KI6A 3O3GA 3LZJA 4CEBA 4L8RB 3K5LA 3O4NA 4AHVA 2EX3A 1JKHA 3AVNA 4CEOA 4CFAA 4FJHA 1VSHA 1ZBHA 3DLEA 2FC0A 3SUOA 1D9DA 2HHTA 3IRXA 4CGIA 4W5QA 4DTMA 1NK0A 1QTMA 2HB5A 3SQ1A 5T7BA 3SV3A 5CYMA 4CESA 3UIQA 3NGIA 3RTVA 4DFJA 1IKXA 4B9SA 2FBXA 1RT6A 1RTJA 3AA4A 3T3FA 2X6NA 2G8WA 4J2AA 4KHSA 4C8LA 2KFZA 1S5JA 1YTAA 4M3WA 2I5JA 1SKSA 1LW2A 3K59A 3CM6A 4CJFA 2ZQBA 4KTWA 4CGHA 5CZ1A 4CCHA 3G0ZA 4FK0A 4DSIA 4C8KA 4M42A 5SWMA 3AVKA 1SKRA 1YVUA 1REVA 5J2MA 2Z1IA 3V9WA 3RWUA 4PY5A 1U48A 4O4GA 4CJQA 4DQIA 4IDKA 4NCAA 3OYGA 3DOLA 4CECA 4DTSA 2BDPA 2OZMA 4FJ5A 4B9VA 4CGFA 4KREA 1IO2A 2KFNA 1JLAA 3AVLA 3LAMA 2IAJA 4HCBA 4I7FA 1LWEA 4CEQA 5C42A 3ZSZA 3V6DA 4FZXC 4RW6A 3CQ8A 1KVCA 3CG7A 2G8UA 4QOZB 1KLNA 4B9UA 1BIZA 5CZ2A 1S1TA 2YV0X 3KIOA 4FM2A 2YHAA 4DF8A 1RBVA 2VWKA 4RW7A 3S3MA 4E7HA 1CZBA 4CHOA 1C1AA 3HYFA 3IG1A 4NCGA 4E7KA 1EXQA 2ITGA 1VSIA 1JL1A 1TL1A 3V1QA 3OS1A 1A5XA 3LP0A 1ASWA 1RBTA 4CF8A 4CIEA 2QKKA 4DSJA 1VSLA 3DRRA 3VQ9A 4QCLA 4FM1A 3PV8A 4HVJA 4RW9A 1JLGA 1VK0A 1BCMA 3AO1A 3LALA 3AVFA 3AVMA 3VQ6A 4CF9A 3C94A 4CEZA 4Z4EA 3C6TA 3L2WA 1WSGA 4I9LA 1IKVA 1WSEA 3C6UA 3QEVA 1RTDA 2G8KA 5DMRA 2XO7A 3HPHA 4H4OA 4PA1A 1UA0A 5KGXA 2IDOA 3QIPA 4DU4A 3DOKA 4J2DA 3PO4A 1UWBA 5J2NA 1C1CA 4DTPA 1KCFA 4M3RA 1NK4A 1HYSA 4OVLA 3SJJA 4B08A 3EYZA 5I3UA 5E41A 3M8RA 1DTTA 3HVTA 2RKIA 1S1WA 3OYHA 1RT1A 2P51A 4DSLA 3NE6A 4C8NA 4DSKA 1YT3A 1HQUA 3ULDA 4C8OA 4M41A 2O4GA 3CFPA 2HHUA 1VRUA 2YNHA 4N47A 1XHZA 4CFCA 4NYNA 1RDBA 2RN2A 3KTQA 1JLEA 4E3SA 4KV8A 5HP1A 2VG7A 3OYMA 3OYFA 1QSSA 4OGCA 1TAQA 4O44A 4CHYA 3HPOA 4OPKA 3EZ5A 2PYJA 4N76A 3BDPA 4CF2A 1UAXA 4CJPA 4F3OA 3V9UA 3QEPA 4LSNA 2Y1JA 2DTUA 3AO4A 4E7IA 1R0AA 3SYZA 3TAGA 4N41A 4M45A 1TK8A 3RMCA 4IG0A 4EZ9A 1HPZA 3FFIA 1SL0A 1B9FA 4MQ3A 3LDSA 4FM0A 2KZZA 1U45A 3VQCA 2LSNA 1NOYA 4M3YA 4HUGA 4C8MA 3VQEA 3NGZA 5J1EA 4B3OA 1NKCA 1TK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOM A;  4BE2 A;  3ALY A;  4CFB A;  3SPZ A;  1U4B A;  1KFS A;  4O5B A;  3NDK A;  4G1Q A;  4FJL A;  4Z4G A;  4J2B A;  2YNG A;  4CJ4 A;  2X78 A;  4IFY A;  3SUP A;  3HP6 A;  4KRF A;  4ID5 A;  3DM2 A;  2HHW A;  2GV9 A;  2G8I A;  3V81 A;  1VSK A;  2JGU A;  3TAB A;  3ISN C;  5HRP A;  3CFR A;  3ZSW A;  4NYF A;  1TVR A;  2OPP A;  2D5R A;  3ZSR A;  4WE1 A;  3TWH A;  4RG8 A;  4Q0B A;  1J9A A;  5C24 A;  2JLE A;  3LWL A;  5HRO A;  3L2U A;  1S1U A;  2G8H A;  4AHR A;  4KI4 A;  4CGD A;  2F8T A;  2QK9 A;  3T1A A;  1Y97 A;  4EP5 A;  4CF0 A;  2P1J A;  3AO2 A;  4YFU A;  3LP2 A;  5J2Q A;  5KGW A;  2OZS A;  1WN7 A;  2R7Y A;  1NOZ A;  3K5N A;  4OPJ A;  1X9S A;  3AA2 A;  4CER A;  3RMD A;  2X74 A;  3LAK A;  4CE9 A;  3NCI A;  1NK5 A;  1Z25 A;  2KZM A;  4CFD A;  2HHS A;  4BDY A;  1RBR A;  1WSI A;  3AO3 A;  3OYI A;  4E7J A;  4DFM A;  3SPY A;  3S3O A;  1WAJ A;  1FKO A;  4FJM A;  1RTI A;  4O0J A;  4F2S A;  4FLW A;  4Y1C A;  1W9H A;  4HUE A;  1RDA A;  4M3T A;  4W5N A;  4FXD A;  3DLB A;  1X9W A;  2VG5 A;  2DFE A;  1HNV A;  4GVM A;  1WSF A;  3TAE A;  1NJX A;  5KRS A;  4CEF A;  5JS2 A;  3QEI A;  3ZT2 A;  1ITG A;  1DTQ A;  3KK1 A;  1T8E A;  1C1B A;  2IGI A;  3L3V A;  1A5V A;  2KQ2 A;  3AO5 A;  4DQR A;  3IS9 A;  1GOB A;  2D0B A;  4OJR A;  4OKE A;  3M8S A;  4B9N A;  3CYM A;  1JLB A;  2B4J A;  3DRS A;  1SKW A;  2KTQ A;  4CJL A;  4GW6 A;  4FLX A;  4CJU A;  3QER A;  1JLQ A;  4ICL A;  4NCB A;  4DU3 A;  4OGE A;  3K58 A;  3VQ8 A;  1L5U A;  1JL2 A;  2YKN A;  4DLE A;  1TAU A;  2P5G A;  2HHV A;  1D5A A;  2Z1J A;  1BHL A;  1XWL A;  1CXU A;  3NF7 A;  3AA5 X;  3U3G A;  4HHT A;  3SCX A;  3LAN A;  1Z26 A;  4I2Q A;  1HQE A;  3K57 A;  5I42 A;  1VRT A;  1T7P A;  1T03 A;  4EP4 A;  2G8F A;  3SUN A;  4DTR A;  3VQB A;  3SI6 A;  2E4L A;  3ITH A;  1HNI A;  3RMA A;  1TKT A;  3TAP A;  3L2Q A;  1L3T A;  3PX4 A;  3O4Q A;  2A1S A;  3A2F A;  3PO5 A;  1QQC A;  3ZSX A;  3WNH A;  3AVG A;  4CEE A;  1ZBF A;  2W42 A;  1KLM A;  5J2P A;  4CF1 A;  1JXE A;  3MEG A;  1RTH A;  4FLU A;  3QES A;  4AIL C;  3SUQ A;  1TK5 A;  1C0U A;  1HJR A;  1K6Y A;  3QNO A;  3U6F A;  1B9D A;  4FW1 A;  4ELV A;  3DLK A;  2HHX A;  2YNI A;  3NH2 A;  3C95 A;  4LH5 A;  2OPS A;  3DLR A;  1TGO A;  1WLJ A;  4B9T A;  4ELU A;  3DYA A;  2OYQ A;  4TSX A;  4IFV A;  4Y1D A;  3KD5 E;  4FJ9 A;  3HO1 A;  3AVI A;  4BAC A;  4CJE A;  4FLZ A;  3DI6 A;  2YHB A;  4DTJ A;  4FK2 A;  3OYE A;  4CHQ A;  3VN5 A;  2D0A A;  1D8Y A;  1XC9 A;  3V1O A;  1LWF A;  2XY6 A;  4OKK A;  1NK7 A;  3I0S A;  4CED A;  1RT3 A;  1O1W A;  2XY5 A;  4AHT A;  3DRP A;  3OYB A;  3JSM A;  1RDC A;  2OPQ A;  4KO0 A;  3ZCM A;  4DTX A;  4KHW A;  1SV5 A;  3ZSO A;  4DU1 A;  4CK2 A;  3NHG A;  3V9S A;  1L3U A;  3NBP A;  3M8Q A;  3SQ2 A;  1F21 A;  4DTU A;  4CK1 A;  3LPU A;  4DFK A;  3MXI A;  1LV5 A;  3OJS A;  1NK9 A;  3DLG A;  1RT5 A;  2XHB A;  4FLY A;  1IG9 A;  1I39 A;  4DSE A;  1NJZ A;  4Z0U A;  3SV4 A;  5HLF A;  2Y1I A;  4IBN A;  4CK3 A;  4H8K A;  3HL8 A;  3VQ7 A;  1JXB A;  1RIL A;  4O55 A;  4E7L A;  3HXM A;  1MU2 A;  3EY1 A;  1ZBL A;  4F2R A;  5KRT A;  2PYL A;  1G15 A;  4FYD A;  5KTQ A;  1LWC A;  3VA3 A;  4KTQ A;  3G10 A;  4BWM A;  1GOA A;  3TAM A;  2Z1H A;  3QNN A;  3V1R A;  3B6P A;  4CIG A;  3TAN A;  2DFF A;  4CIF A;  1TKD A;  4DMN A;  4CJR A;  4IG3 A;  3QIO A;  3LP3 A;  4W5O A;  3V9X A;  3F9K A;  5K14 A;  1NKB A;  1S9E A;  4KB1 A;  4AHC A;  1BI4 B;  5FRO A;  3QO9 A;  1T05 A;  1QE1 A;  5C25 A;  3IAY A;  3MXJ A;  3CM5 A;  2PY5 A;  4K8Z A;  3HPG A;  1ZBU A;  1BGX T;  1BI4 A;  1SL1 A;  3S3N A;  3VQD A;  4BDP A;  1SUQ A;  4CJ3 A;  2IOC A;  3THV A;  4F4K A;  3OS0 A;  5FRM A;  1TKZ A;  4JS5 A;  1RDD A;  3RRG A;  1KVB A;  1UA1 A;  1B92 A;  3VQA A;  2FBT A;  3L2R A;  4FJ7 A;  1BQM A;  4AHS A;  4DLG A;  3V9Z A;  4FZY A;  2YKM A;  4DQQ A;  3OVN A;  1CZ9 A;  3DMJ A;  1Q9X A;  2IC3 A;  3D45 A;  1RBU A;  3NF9 A;  2PZS A;  2HNZ A;  2NUB A;  2E6L A;  4BWJ A;  4JS4 A;  1KTQ A;  4BE0 A;  1NK6 A;  4KHU A;  3KLE A;  4PWD A;  1HRH A;  5EU7 A;  1GOC A;  3O3F A;  3KLH A;  4FJK A;  2QKB A;  4CHN A;  4CHP A;  4M3U A;  1EKE A;  2F8S A;  4Z4I A;  4OLA A;  4Z4H A;  1LAV A;  4AHU A;  4I9Q A;  1C0T A;  2ZE2 A;  1C0M A;  2WON A;  2X6S A;  4W5R A;  3SNN A;  4PUO A;  3AVB A;  5D3G A;  2OPR A;  3ZT1 A;  5CY4 A;  2HW3 A;  3RR7 A;  4CEA A;  1FXX A;  4FLV A;  4LSL A;  3HJF A;  4HCC A;  4F3T A;  3QET A;  1KRP A;  3PX0 A;  4CJT A;  1CXQ A;  4BDZ A;  5HRR A;  1I3A A;  2XY7 A;  3TI0 A;  1NKE A;  2BE2 A;  3CFO A;  2BGG A;  1UOC A;  3P5J A;  4W5T A;  1RT2 A;  3KK2 A;  3KLG A;  4CJV A;  4E0D A;  1J5O A;  1BQN A;  3OYJ A;  4FCY A;  1J53 A;  1RT7 A;  1XI1 A;  3HK2 A;  3NF8 A;  1EX4 A;  2KW4 A;  2Q3S A;  3P1G A;  4JRP A;  4DWI A;  3S9H A;  3KJV A;  1VSE A;  1DLO A;  4CJW A;  2XRI A;  3VQ5 A;  1IKW A;  1WNS A;  4LH4 A;  4RW4 A;  4JLH A;  3RRH A;  4DTN A;  3JYT A;  1TKX A;  2DY4 A;  4KKO A;  5HBM A;  4KHN A;  1U04 A;  1X1P A;  1WSH A;  2VG6 A;  3ASM A;  3QEX A;  3BGR A;  3OYN A;  3HM9 A;  3V4I A;  1NJW A;  4E19 A;  1ZBI A;  4FW2 A;  4DSF A;  4CGJ A;  3B6O A;  1L3V A;  1A5W A;  1KFD A;  4O0I A;  3TAF A;  2G8V A;  3OYL A;  2HVI A;  1VSD A;  2HMI A;  2ZD1 A;  3ZSQ A;  3NFA A;  3KK3 A;  4BE1 A;  1N5Y A;  1HMV A;  4CGG A;  3LWM A;  3WNE A;  1EP4 A;  1FK9 A;  4B9M A;  3OYA A;  3HVR A;  4PQU A;  4B9L A;  4OKJ A;  4RW8 A;  3VQ4 A;  1RCH A;  1VSJ A;  3QIN A;  1HYV A;  4I2P A;  5DK5 A;  3VQP A;  2YNF A;  3D0P A;  4HUF A;  1QSY A;  1BL3 A;  3MED A;  4DS4 A;  1X9M A;  4LD0 A;  4M3X A;  4IKF A;  4DTO A;  1HYZ A;  3SZ2 A;  1FKP A;  3L3U A;  1C6V A;  2HVH A;  1BIS A;  3LPT A;  1U49 A;  3KD1 E;  1YTU A;  3NGY A;  1S1X A;  4R5P A;  4GMJ B;  1ZYQ A;  2HHQ A;  1RNH A;  4KPY A;  4FVM A;  3AVA A;  4FK4 A;  2VWJ A;  2HNY A;  2EHG A;  4DQP A;  3TAQ A;  3AVJ A;  3ZSV A;  1EET A;  3SQ4 A;  5CYQ A;  3OYD A;  4ZTJ A;  1BIU A;  1J54 A;  1WAF A;  4CJK A;  3VA0 A;  4KTZ A;  5SZT A;  3OJU A;  3MXM A;  4EZ6 A;  3L8B A;  1RT4 A;  1S9G A;  3RMB A;  4OLB A;  4ID1 A;  1QHT A;  4DFP A;  1LW0 A;  4JRQ A;  2P5O A;  3WNF A;  3NH1 A;  4K8X A;  1KSP A;  3PX6 A;  4HTU A;  4FZZ A;  3MAQ A;  4FJN A;  4FJJ A;  1N6Q A;  4LY7 A;  4E89 A;  3KLF A;  3PUF A;  3KKS A;  4KFB A;  4CJ5 A;  1JLC A;  3K5M A;  4KHY A;  3MEC A;  3KKR A;  2ETJ A;  1WSJ A;  3VQQ A;  3LZI A;  1KVA A;  4ZTF A;  4FJI A;  2GUI A;  3QLH A;  4DF4 A;  3OYC A;  3U3Y A;  1NJY A;  4B8A B;  4QAG A;  1NK8 A;  3MEE A;  4N56 A;  2RF2 A;  3SQ0 A;  3QEW A;  1VSM A;  3WNG A;  3AV9 A;  2OA8 A;  4MFB A;  3L2V A;  1CLQ A;  2GBZ A;  4FJX A;  4FJG A;  4DQS A;  1QSL A;  3ZT3 A;  1IKY A;  3RR8 A;  3NAE A;  1S1V A;  4UQG A;  3ZT0 A;  4KB0 A;  1TV6 A;  1IH7 A;  3HP9 A;  4J2E A;  4KAZ A;  1ASV A;  1S6P A;  1U47 A;  4KHQ A;  2F96 A;  4YNQ A;  1Q9Y A;  2XY8 A;  2ATQ A;  3K5O A;  1D9F A;  4CJS A;  1RBS A;  1QS4 A;  2BAN A;  3I8D A;  3PY8 A;  1VSF A;  5FDL A;  4Z4F A;  4Q5V A;  3H08 A;  4ELT A;  3AVH A;  3T19 A;  4B8C A;  3K2P A;  3F73 A;  4Z4C A;  1XHX A;  2O4I A;  4KI6 A;  1SL2 A;  3P83 D;  3TR8 A;  2Z1G A;  3KLI A;  4AH9 A;  3HT3 A;  3DLH A;  3O3H A;  4N5S A;  4DG1 A;  5HRN A;  1LAW A;  3TAR A;  4CHZ A;  4F8R A;  2DFH A;  3HST B;  3M8P A;  4DS5 A;  4M3Z A;  2E6M A;  4H4M A;  2FBV A;  3AA3 A;  3ZSY A;  5FRN A;  3ZT4 A;  2AJQ A;  2HND A;  2QXF A;  4XIU A;  3LP1 A;  3AVC A;  3OY9 A;  4E1N A;  3E01 A;  2FBY A;  2IS3 A;  3OS2 A;  4FJ8 A;  1TL3 A;  4E1M A;  1L3S A;  5HRS A;  3OYK A;  5JS1 A;  1S6Q A;  1BCO A;  2B6A A;  3NF6 A;  1W0H A;  4ZHR A;  4FLT A;  1ASU A;  1JLF A;  2A1R A;  2B5J A;  1Q8I A;  2D0C A;  2RPI A;  3I0R A;  3NH0 A;  5KI6 A;  3O3G A;  3LZJ A;  4CEB A;  4L8R B;  3K5L A;  3O4N A;  4AHV A;  2EX3 A;  1JKH A;  3AVN A;  4CEO A;  4CFA A;  4FJH A;  1VSH A;  1ZBH A;  3DLE A;  2FC0 A;  3SUO A;  1D9D A;  2HHT A;  3IRX A;  4CGI A;  4W5Q A;  4DTM A;  1NK0 A;  1QTM A;  2HB5 A;  3SQ1 A;  5T7B A;  3SV3 A;  5CYM A;  4CES A;  3UIQ A;  3NGI A;  3RTV A;  4DFJ A;  1IKX A;  4B9S A;  2FBX A;  1RT6 A;  1RTJ A;  3AA4 A;  3T3F A;  2X6N A;  2G8W A;  4J2A A;  4KHS A;  4C8L A;  2KFZ A;  1S5J A;  1YTA A;  4M3W A;  2I5J A;  1SKS A;  1LW2 A;  3K59 A;  3CM6 A;  4CJF A;  2ZQB A;  4KTW A;  4CGH A;  5CZ1 A;  4CCH A;  3G0Z A;  4FK0 A;  4DSI A;  4C8K A;  4M42 A;  5SWM A;  3AVK A;  1SKR A;  1YVU A;  1REV A;  5J2M A;  2Z1I A;  3V9W A;  3RWU A;  4PY5 A;  1U48 A;  4O4G A;  4CJQ A;  4DQI A;  4IDK A;  4NCA A;  3OYG A;  3DOL A;  4CEC A;  4DTS A;  2BDP A;  2OZM A;  4FJ5 A;  4B9V A;  4CGF A;  4KRE A;  1IO2 A;  2KFN A;  1JLA A;  3AVL A;  3LAM A;  2IAJ A;  4HCB A;  4I7F A;  1LWE A;  4CEQ A;  5C42 A;  3ZSZ A;  3V6D A;  4FZX C;  4RW6 A;  3CQ8 A;  1KVC A;  3CG7 A;  2G8U A;  4QOZ B;  1KLN A;  4B9U A;  1BIZ A;  5CZ2 A;  1S1T A;  2YV0 X;  3KIO A;  4FM2 A;  2YHA A;  4DF8 A;  1RBV A;  2VWK A;  4RW7 A;  3S3M A;  4E7H A;  1CZB A;  4CHO A;  1C1A A;  3HYF A;  3IG1 A;  4NCG A;  4E7K A;  1EXQ A;  2ITG A;  1VSI A;  1JL1 A;  1TL1 A;  3V1Q A;  3OS1 A;  1A5X A;  3LP0 A;  1ASW A;  1RBT A;  4CF8 A;  4CIE A;  2QKK A;  4DSJ A;  1VSL A;  3DRR A;  3VQ9 A;  4QCL A;  4FM1 A;  3PV8 A;  4HVJ A;  4RW9 A;  1JLG A;  1VK0 A;  1BCM A;  3AO1 A;  3LAL A;  3AVF A;  3AVM A;  3VQ6 A;  4CF9 A;  3C94 A;  4CEZ A;  4Z4E A;  3C6T A;  3L2W A;  1WSG A;  4I9L A;  1IKV A;  1WSE A;  3C6U A;  3QEV A;  1RTD A;  2G8K A;  5DMR A;  2XO7 A;  3HPH A;  4H4O A;  4PA1 A;  1UA0 A;  5KGX A;  2IDO A;  3QIP A;  4DU4 A;  3DOK A;  4J2D A;  3PO4 A;  1UWB A;  5J2N A;  1C1C A;  4DTP A;  1KCF A;  4M3R A;  1NK4 A;  1HYS A;  4OVL A;  3SJJ A;  4B08 A;  3EYZ A;  5I3U A;  5E41 A;  3M8R A;  1DTT A;  3HVT A;  2RKI A;  1S1W A;  3OYH A;  1RT1 A;  2P51 A;  4DSL A;  3NE6 A;  4C8N A;  4DSK A;  1YT3 A;  1HQU A;  3ULD A;  4C8O A;  4M41 A;  2O4G A;  3CFP A;  2HHU A;  1VRU A;  2YNH A;  4N47 A;  1XHZ A;  4CFC A;  4NYN A;  1RDB A;  2RN2 A;  3KTQ A;  1JLE A;  4E3S A;  4KV8 A;  5HP1 A;  2VG7 A;  3OYM A;  3OYF A;  1QSS A;  4OGC A;  1TAQ A;  4O44 A;  4CHY A;  3HPO A;  4OPK A;  3EZ5 A;  2PYJ A;  4N76 A;  3BDP A;  4CF2 A;  1UAX A;  4CJP A;  4F3O A;  3V9U A;  3QEP A;  4LSN A;  2Y1J A;  2DTU A;  3AO4 A;  4E7I A;  1R0A A;  3SYZ A;  3TAG A;  4N41 A;  4M45 A;  1TK8 A;  3RMC A;  4IG0 A;  4EZ9 A;  1HPZ A;  3FFI A;  1SL0 A;  1B9F A;  4MQ3 A;  3LDS A;  4FM0 A;  2KZZ A;  1U45 A;  3VQC A;  2LSN A;  1NOY A;  4M3Y A;  4HUG A;  4C8M A;  3VQE A;  3NGZ A;  5J1E A;  4B3O A;  1NKC A;  1TK0 A; 
#chains in the Genus database with same CATH topology
 2HF3 A;  2Q0R A;  3SPZ A;  5JVH L;  4H0X B;  3NDK A;  2A6A A;  4G1Q A;  4CJ4 A;  3LDP A;  2X78 A;  4LFB K;  3TU5 A;  2G8I A;  1VSK A;  4JI7 K;  5HRP A;  2YX6 A;  4NYF A;  3EEQ A;  1TVR A;  2D5R A;  5KQ8 A;  1X3N A;  4PKH A;  2JLE A;  5C12 A;  2QK9 A;  3T1A A;  4CF0 A;  4OPH A;  5AJ3 K;  3AO2 A;  5MLC Q;  5J2Q A;  5AQI A;  2I7P A;  2R7Y A;  3E9P A;  3LAK A;  2GEL A;  2FF6 A;  3NCI A;  3TSU A;  3K9K A;  4WCE L;  1RBR A;  4YHH K;  4F2S A;  4BRP A;  4HUE A;  4W5N A;  3H6E A;  5M1O A;  1NJX A;  2RE2 A;  4GY2 B;  5GAE P;  3WXK A;  5JS2 A;  3QEI A;  3ZT2 A;  3G6E N;  1DTQ A;  2P9I A;  5AZI B;  3KK1 A;  1C1B A;  2IGI A;  4ILH A;  5IWA K;  3OBW A;  3AO5 A;  3SAH A;  2D0B A;  1JLB A;  5AQF A;  1GLE G;  3DRS A;  4CZK A;  4CJU A;  4NCB A;  3JXU A;  1GLD G;  1TAU A;  3AAR A;  1TUU A;  1D5A A;  3H1Q A;  1CXU A;  3NF7 A;  3O8M A;  3R8E A;  3FZH A;  4PL8 A;  5I42 A;  2Q1N A;  1T7P A;  4DTR A;  3R9P A;  3VQB A;  3RMA A;  1TKT A;  3PX4 A;  3O4Q A;  4B3M K;  3WNH A;  2HOE A;  3MEG A;  4AIL C;  3QNO A;  3U6F A;  3GDQ A;  4LF5 K;  1B9D A;  3DLK A;  3NH2 A;  3M3Z A;  3C95 A;  4LH5 A;  5AQZ A;  1JCE A;  4CVN E;  3DYA A;  4IFV A;  4BVO A;  4A2B A;  1G99 A;  2YHB A;  4CHQ A;  3VN5 A;  2NRR A;  3VEX A;  3V1O A;  3SLC A;  1O1W A;  2FLO A;  4AHT A;  4BRL A;  5F2R A;  4KO0 A;  4KHW A;  1SV5 A;  1VAZ A;  4DUY K;  3SQ2 A;  1F21 A;  5M1F A;  4DTU A;  4DFK A;  1HNX K;  3I8B A;  3O08 A;  1NK9 A;  3FGU A;  4XH5 A;  2P9K A;  4Z0U A;  5HLF A;  2Y1I A;  3H46 O;  4CK3 A;  1XNR K;  3GOI A;  4H8K A;  3VQ7 A;  4FYD A;  3CJ1 A;  4KTQ A;  4BWM A;  3T1Y K;  4HWI A;  3V1R A;  3B6P A;  4FWP A;  4CJR A;  3LP3 A;  3V9X A;  1NKB A;  4KB1 A;  4AHC A;  1BI4 B;  5FRO A;  3MN6 A;  3IAY A;  4DR3 K;  3CM5 A;  1BGX T;  3A0I X;  4LC9 B;  3S3N A;  1SUQ A;  4CJ3 A;  3CPW M;  1B92 A;  2P9S B;  3VQA A;  4FJ7 A;  4DQQ A;  4BR4 A;  2IC3 A;  3D45 A;  3NF9 A;  2PZS A;  4JS4 A;  2NUB A;  4BRK A;  5GIN A;  4JEP A;  4BR2 A;  1GOC A;  2QKB A;  3A5N C;  2WFB A;  4OLA A;  3AAQ A;  4I9Q A;  3QDK A;  1T3V A;  2WON A;  2X6S A;  2OPR A;  3ZT1 A;  3T7Z A;  5AQO A;  4F3T A;  4HCC A;  3QET A;  3ZYY X;  1I3A A;  1NKE A;  3RSE B;  2UYT A;  3Q7B A;  2BGG A;  1UOC A;  4W5T A;  3KK2 A;  3KLG A;  2FSJ A;  3BUZ B;  1JCF A;  3KHY A;  3CJ9 A;  3NF8 A;  3CCJ N;  4JRP A;  3P1G A;  2FSK A;  4H03 B;  4DWI A;  1VSE A;  1DLO A;  2XRI A;  3J7Z O;  1J5E K;  2QEX N;  3CJC A;  1WSH A;  3OYN A;  3V4I A;  2D0P A;  4E19 A;  4DR5 K;  4CGJ A;  1KFD A;  1I94 K;  3THX A;  4NLC A;  1N5Y A;  3ZSQ A;  3ZET A;  4BE1 A;  3LWM A;  1EP4 A;  1FK9 A;  3P4I A;  4DCH A;  1X3M A;  4BRM A;  3CER A;  3D2E B;  1RCH A;  1VSJ A;  1XNQ K;  4K43 A;  4HUF A;  5AQL A;  4DS4 A;  1X9M A;  4M3X A;  2P9L B;  1HYZ A;  4IOX A;  1FKP A;  5E84 A;  2VQE K;  1BIS A;  3LPT A;  2E5L K;  5TKW A;  1S1X A;  2HHQ A;  4H0Y B;  3FZF A;  1N36 K;  4FVM A;  4FK4 A;  1Q82 O;  1KAZ A;  5AQY A;  3TAQ A;  3SQ4 A;  5CYQ A;  3OYD A;  1VHX A;  3MXM A;  5FPN A;  5EXW A;  1S9G A;  4OLB A;  2HBM A;  1LW0 A;  4JI4 K;  1QQN A;  3SJH A;  3U9Z A;  3KLF A;  4OO1 J;  3MEC A;  1E4F T;  1KVA A;  4DV7 K;  4DF4 A;  1S22 A;  1NK8 A;  1YI2 N;  2D0O A;  3SBT A;  4H5W A;  2OA8 A;  4MFB A;  4MDB A;  4YOW A;  2OAN A;  3HP9 A;  4J2E A;  4KAZ A;  2NRH A;  3QIC A;  4YNQ A;  2XY8 A;  2UXC K;  1SAZ A;  1RBS A;  1QS4 A;  3DLL L;  5GAG P;  5JIC A;  4WYB A;  3AVH A;  3K2P A;  4Z4C A;  3O9S A;  1VQ4 N;  3TR8 A;  3HT3 A;  5AQT A;  3TAR A;  4CHZ A;  3HST B;  4M3Z A;  4F9O A;  4MO4 A;  3UKR A;  5KPT A;  3ZT4 A;  3D2F A;  3E01 A;  2QWP A;  3VF2 A;  3MN9 A;  4G9Z A;  5JS1 A;  1S6Q A;  1BCO A;  1W0H A;  4BRH A;  3O1W A;  2P5O A;  3HRG A;  2RPI A;  4O8K A;  1ZC6 A;  3NH0 A;  3H3O B;  2EX3 A;  3AVN A;  3WEE A;  4FPA A;  4FJH A;  1ZBH A;  3DLE A;  2HHT A;  3MX2 A;  5HL7 L;  4W5Q A;  4CGI A;  1QTM A;  3DXM A;  4CBW A;  3SQ1 A;  3NGI A;  1K9M O;  1YAG A;  4GKK K;  4JI6 K;  2G8W A;  4C8L A;  3BZK A;  3K59 A;  2ZQB A;  4KTW A;  4CCH A;  5CZ1 A;  1NGH A;  3G0Z A;  3K0S A;  5SWM A;  1ATS A;  1SKR A;  4K41 A;  2Z1I A;  3EO3 A;  4PY5 A;  4CJQ A;  3ID6 A;  3OYG A;  5F0X A;  3DWL A;  3UKU B;  3LAM A;  4HCB A;  1LWE A;  1NGA A;  3T69 A;  5C42 A;  3ZSZ A;  4RW6 A;  3CQ8 A;  3CG7 A;  4BG8 A;  5CZ2 A;  4FM2 A;  2YV0 X;  2VWK A;  4RW7 A;  1CZB A;  3MWT A;  4E7K A;  3IG1 A;  1P8Z A;  1EWR A;  1RBT A;  4CF8 A;  4CIE A;  3VGM A;  3EKU A;  3PV8 A;  1JLG A;  5GAH P;  4Z4E A;  3C94 A;  4JYA K;  1NG9 A;  1WSG A;  4I9L A;  1IKV A;  1WSE A;  5DMR A;  3VGL A;  3HPH A;  1HUX A;  4IOA L;  2IDO A;  3DOK A;  4J2D A;  1UWB A;  1TYQ B;  1NK4 A;  4OVL A;  3EYZ A;  5CE3 A;  2NNW A;  2W6K A;  4YY3 K;  4C8N A;  4XH4 A;  1YT3 A;  4A59 A;  1T6D A;  3KTQ A;  4E3S A;  4KV8 A;  3W0L A;  2VWB A;  2VGN A;  5M1P A;  3BDP A;  5JMV A;  4FWM A;  4F3O A;  3QEP A;  2Y1J A;  4E7I A;  1HX1 A;  1NGJ A;  3SYZ A;  3B8A X;  3TAG A;  3CC7 N;  1VQO N;  1XUP O;  2DPN A;  5AZJ A;  1B9F A;  4FM0 A;  1NOY A;  3MDQ A;  4M3Y A;  1LOT B;  4DV5 K;  4GNI A;  3C65 A;  4QS9 A;  5IT9 O;  3VQE A;  5J1E A;  3FZM A;  1U4B A;  3O9T A;  4Z4G A;  2YNG A;  4BRE A;  2FSN A;  3SUP A;  4IFY A;  4KRF A;  5CHI A;  2HHW A;  3V81 A;  4FWR A;  4GV6 A;  3CFR A;  4JKF A;  4J8F A;  3ZSR A;  1J9A A;  3L2U A;  1NGD A;  4KI4 A;  3LP2 A;  4DV6 K;  3T1H K;  2OZS A;  4EIA A;  3K5N A;  4WFN L;  2QM1 A;  1NK5 A;  4YDU C;  2ZJP L;  4CFD A;  4BDY A;  3D6R A;  3HI0 A;  3MCP A;  3OYI A;  4E7J A;  3S3O A;  3ULE A;  4FLW A;  4Y1C A;  1SZ2 A;  1W9H A;  1RDA A;  4M3T A;  1X9W A;  2FXU A;  1BDG A;  5TKY A;  1HNV A;  2QTD A;  2P9I B;  2OCE A;  4H5R A;  4A62 A;  1NMD A;  3SAG A;  3VEY A;  1T8E A;  3R3L A;  1A5V A;  2F4V K;  3IS9 A;  1GOB A;  4OJR A;  4OKE A;  4CW7 B;  3GBT A;  3THW A;  3KWI A;  5EX5 A;  1FJG K;  4CJL A;  4FLX A;  4DU3 A;  3K58 A;  3PLA A;  3FE1 A;  2HHV A;  4HTL A;  2Z1J A;  3VES A;  2W41 A;  3TPQ A;  3EKS A;  3LDQ A;  1VRT A;  4O5F A;  2BTF A;  4EP4 A;  1T03 A;  2G8F A;  3ITH A;  1L3T A;  5FPE A;  3A2F A;  1QQC A;  2E1Z A;  4CEE A;  1NNE A;  1QVF M;  1YVN A;  3DJC A;  5J2P A;  1XMQ K;  4U67 L;  1E3M A;  1C0U A;  1HJR A;  2YNI A;  1QZ6 A;  4ELU A;  2V7Y A;  1OH7 A;  4CJE A;  3CIP A;  3DI6 A;  2ZJR L;  4DTJ A;  4U7B A;  1D8Y A;  1RGI A;  4C23 A;  1XC3 A;  2XY6 A;  1NK7 A;  3I0S A;  4CED A;  1RT3 A;  2O8F B;  1RDC A;  4DTX A;  3ZSO A;  3DAW A;  5FPD A;  1L3U A;  5BRH A;  2P9K B;  2D4W A;  4CK1 A;  3LPU A;  4FWK A;  1RT5 A;  2XHB A;  3KVG A;  4FLY A;  4DSE A;  4IXC A;  3SV4 A;  4IBN A;  2O8B A;  3HL8 A;  4BRA A;  1RIL A;  4O55 A;  4XEI A;  4E7L A;  1ZBL A;  5BN9 A;  5KRT A;  2PYL A;  1LWC A;  3G10 A;  1GOA A;  1BO5 O;  3O9Q A;  4RCH A;  4EHU A;  5KQD A;  1NGB A;  1M90 O;  4CIG A;  2DFF A;  2E8A A;  3JAM O;  1TKD A;  1EQY A;  1HR0 K;  5AQG A;  5K14 A;  3ATV A;  3QO9 A;  3WXM B;  4NO7 A;  4K8Z A;  2PY5 A;  4LF4 K;  1SL1 A;  3CQY A;  1WOQ A;  3BEX A;  2IOC A;  3QFU A;  2AA4 A;  3H1V X;  1O13 A;  1IV0 A;  4DLG A;  3V9Z A;  4FZY A;  2A5X A;  2YKM A;  3OVN A;  4DR2 K;  1CZ9 A;  3DMJ A;  5E26 A;  2E6L A;  4KHU A;  3KLE A;  4PWD A;  3O3F A;  5EU7 A;  2F8S A;  2NRW A;  5BR9 A;  3PSF A;  2ZE2 A;  3SNN A;  5BN8 A;  1JJ2 M;  3AVB A;  1QHA A;  1ILY A;  4FLV A;  4LSL A;  2UXB K;  5DM6 L;  3A8Y A;  3MN7 A;  3TI0 A;  3CFO A;  4FL9 A;  4B3S K;  4BGA A;  3TTF A;  4E0D A;  4B9Q A;  1ATN A;  5LMN K;  4FCY A;  1J53 A;  1EX4 A;  2Q3S A;  4WQ4 A;  3R6M A;  1HKG A;  2HBL A;  4JHD A;  1RDU A;  2A42 A;  4RW4 A;  2DY4 A;  3JYT A;  4KKO A;  5C15 A;  1X1P A;  3THX B;  4DV4 K;  3BGR A;  3ZET B;  1NJW A;  3MN5 A;  1T44 A;  3B6O A;  1L3V A;  4DV3 K;  1WB9 A;  2HVI A;  1VSD A;  3NFA A;  4OPA A;  4B9M A;  4B9L A;  1NLV A;  3VQ4 A;  4I2P A;  1HYV A;  4LF7 K;  4QS8 A;  3OBY A;  4IKF A;  3SZ2 A;  1KAX A;  3U8X A;  3KD1 E;  1OVQ A;  1BUP A;  1ZYQ A;  4KPY A;  2WBN A;  4JKD A;  3KK7 A;  2HNY A;  2EHG A;  4BR9 A;  3WXI A;  3AVJ A;  2YI1 A;  1J54 A;  3CQX A;  4KTZ A;  5ADX A;  4Y0W A;  3L8B A;  1RT4 A;  4B1V A;  2OTL N;  4JKC A;  4JRQ A;  4K8X A;  1KSP A;  3LDO A;  4BY9 C;  5GIO A;  4CZM A;  4HTU A;  3PX6 A;  1HNW K;  2F9W A;  4FZZ A;  2O8F A;  4CZJ A;  4DB3 A;  4FJN A;  4YOT A;  1JLC A;  5AQM A;  4KHY A;  3KKR A;  2ETJ A;  1WSJ A;  3LZI A;  3KWG A;  3OYC A;  4B8A B;  3MEE A;  2RF2 A;  4H5N A;  2NZT A;  5AQK A;  3FLC O;  5ELZ A;  2Q36 A;  3WT0 A;  2GBZ A;  3AGR A;  4FJX A;  3CC2 N;  2HMP A;  3BZC A;  2F7T A;  3AGK A;  3RR8 A;  1S1V A;  4B3T K;  3ZT0 A;  4KHP K;  1TV6 A;  1M1K O;  4LF6 K;  2ATQ A;  3K5O A;  5DM7 L;  1D9F A;  3C6A A;  3PY8 A;  2UU9 K;  2E2Q A;  3H08 A;  4MLE A;  1HKC A;  3T19 A;  4B1X B;  4B8C A;  3F73 A;  2PBD A;  3UKR B;  3ZX3 A;  2Z1G A;  3DLH A;  3O3H A;  4N5S A;  5HRN A;  2DFH A;  3M8P A;  3QB0 A;  3LDL A;  2E6M A;  5B8H A;  3D2F B;  1YIT N;  3AVC A;  5AQV A;  3OY9 A;  1EWQ A;  4IOC L;  2FBY A;  3OS2 A;  1RDW X;  1TL3 A;  4I6M A;  4IJA A;  4BRC A;  5HRS A;  2I7N A;  3I55 N;  1EO1 A;  2B6A A;  3WEE B;  4DV1 K;  1ASU A;  1JLF A;  1Q8I A;  2D0C A;  4L8R B;  1YJ9 N;  2VCP A;  3DXM B;  4AHV A;  4YOX A;  3A5O C;  3LDN A;  1CZA N;  3W3D A;  1GLJ O;  3IRX A;  4DTM A;  1BA1 A;  4YOR A;  1VQP N;  4IO8 A;  3SV3 A;  5CYM A;  3UIQ A;  5BRE A;  1RTJ A;  2KKZ A;  3S41 A;  4J2A A;  2O8D A;  1LW2 A;  1Q86 O;  3CM6 A;  3ZEU A;  1XMO K;  1IG8 A;  4C8K A;  4M42 A;  3C7N A;  3VEN A;  5AFU A;  2ZM6 K;  1REV A;  3AY9 A;  5J2M A;  4ISG A;  4NCA A;  3DOL A;  4FJ5 A;  3J8A A;  4EFH A;  4B9V A;  1IO2 A;  1JLA A;  2Q97 A;  3AVL A;  4I7F A;  4CEQ A;  4FZX C;  3CPE A;  1KVC A;  2G8U A;  1KLN A;  1BIZ A;  3D7E O;  4NCG A;  3HYF A;  1YJN N;  1HPM A;  2ITG A;  1J6Z A;  3K9J A;  3OS1 A;  1A5X A;  3LP0 A;  3FZK A;  3DRR A;  5FLX O;  3VQ9 A;  4RWT A;  4QCL A;  4HVJ A;  4BG9 A;  1VK0 A;  3AO1 A;  1DEJ A;  5AQU A;  3VQ6 A;  1BWF O;  4X64 K;  2O8C A;  3C6T A;  3L2W A;  4BQL A;  3IMX A;  4PA1 A;  5KGX A;  4DU4 A;  2ITM A;  3PO4 A;  4CZL A;  1KCF A;  1HYS A;  5E41 A;  4DSL A;  4CBX A;  2O4G A;  4FWO A;  1VRU A;  1K73 O;  1XHZ A;  4NYN A;  1RDB A;  4JI2 K;  2VG7 A;  3NVK A;  2PYJ A;  4N76 A;  4CZG A;  2GEM A;  2VGM A;  4CF2 A;  1UAX A;  5AZJ B;  2DTU A;  3AO4 A;  2ASO A;  1TK8 A;  4IG0 A;  3FFI A;  4MQ3 A;  3LDS A;  1U45 A;  3VQC A;  4JKG A;  3MK6 A;  2IVP A;  5M1K A;  4B3O A;  1NKC A;  2P9U A;  2Q0U A;  4CBU A;  4BE2 A;  1NU0 A;  3QFP A;  4AQY K;  4FJL A;  1GLA G;  2VQF K;  4K42 A;  3ZX0 A;  3BP8 A;  3HP6 A;  3EZW A;  3DM2 A;  4ID5 A;  5GIP A;  1KC8 O;  5EVZ A;  3ZSW A;  1ATR A;  5AQH A;  2OPP A;  4WE1 A;  3QBX A;  4BR7 A;  5HRO A;  2F8T A;  1Y97 A;  4GVE A;  5EY4 A;  4YFU A;  4DR1 K;  5M1Q A;  1WN7 A;  1NOZ A;  4OPJ A;  3RMD A;  4CER A;  1OH6 A;  2X74 A;  1Z25 A;  2F9T A;  2CGK A;  3TSP A;  3ULE B;  5JLF A;  2HHS A;  3AO3 A;  4DFM A;  4FWN A;  1WAJ A;  1RTI A;  5BRF A;  3AAP A;  4CI6 A;  1N33 K;  2DFE A;  4FOI A;  4GVM A;  3THY A;  1WSF A;  4B1W B;  3TAE A;  1VQL N;  2UUC K;  2E2P A;  4JKE A;  1NGE A;  3L3V A;  3THW B;  3ZLJ A;  5AQQ A;  2P9P A;  4DQR A;  2ZF5 O;  4KH6 A;  3VEW A;  5ADX H;  3CYM A;  2QWM A;  1SKW A;  2P9N A;  4GW6 A;  3QER A;  1JLQ A;  3J7Y P;  3CME N;  3DXK A;  2YKN A;  4DLE A;  1XWL A;  3L6Q A;  4BC3 A;  3AA5 X;  3U3G A;  4HHT A;  3SCX A;  1HQE A;  3K57 A;  3TAP A;  2A1S A;  3ZSX A;  3AVG A;  2V51 B;  1ZBF A;  2W42 A;  4JNE A;  3HOS A;  4CF1 A;  3QES A;  1RTH A;  1TK5 A;  4RTF D;  2E20 A;  1K6Y A;  1MA9 B;  1VQ9 N;  4ELV A;  2HHX A;  5I9E B;  2OPS A;  1WBB A;  4B9T A;  4K0K K;  4FOE A;  4BRN A;  4FK2 A;  1XC9 A;  1LWF A;  1U2V A;  3DRP A;  3OYB A;  3ZCM A;  1VQ8 N;  4DU1 A;  4JI1 K;  3NHG A;  3V9S A;  3NBP A;  1LV5 A;  2QWQ A;  3OJS A;  2O8B B;  3DLG A;  3CHW A;  4IDH A;  1NJZ A;  1KXP A;  3FFK B;  1JXB A;  3H3N O;  3HXM A;  1MU2 A;  4F2R A;  1G15 A;  2IVO A;  5KTQ A;  3PIP L;  1DGK N;  3TAN A;  2GWJ A;  3HM8 A;  2E1Y A;  4CIF A;  5AR0 A;  3QIO A;  3F9K A;  3CCS N;  1MWM A;  1T05 A;  1QE1 A;  5C25 A;  4BC2 A;  1DT9 A;  3MXJ A;  1NWK A;  1ZBU A;  2KHO A;  3VQD A;  2PFU A;  3THV A;  1GLF O;  1TKZ A;  4JI5 K;  4JS5 A;  4CZF A;  3RRG A;  1KVB A;  5AQW A;  5C0Y A;  2FBT A;  3L2R A;  4FSV A;  1BQM A;  1DKG D;  3O6W A;  4AHS A;  3CJ7 A;  2HNZ A;  3VTI A;  4BWJ A;  4BE0 A;  4CHN A;  3O9R A;  4CHP A;  4M3U A;  1EKE A;  4Z4H A;  1C0T A;  1C0M A;  4X62 K;  4W5R A;  5AQP A;  1IBM K;  4PUO A;  5D3G A;  4BRG A;  2HW3 A;  3VMF B;  4CEA A;  2GX9 A;  5A2Q O;  1BA0 A;  1FXX A;  3TTD A;  1KRP A;  4CJT A;  4BDZ A;  1RT2 A;  4CJV A;  3WQT A;  2E2N A;  4DR7 K;  4JHD B;  2KW4 A;  3S9H A;  3KJV A;  4LFA K;  1WNS A;  3P39 A;  2VYP A;  4JLH A;  1ESV A;  3RRH A;  5HBM A;  1U04 A;  2VG6 A;  3ASM A;  3QEX A;  4DHY A;  1ZBI A;  4DSF A;  4IEE A;  2A3Z A;  3TAF A;  2G8V A;  2NRX A;  3OYL A;  3F2K A;  2HMI A;  1VQK N;  1HMV A;  4CGG A;  3WNE A;  3I56 N;  3HVR A;  4PQU A;  1VQ6 N;  4OKJ A;  3QIN A;  2YNF A;  1BL3 A;  3MED A;  4IZ9 A;  4DTO A;  3L3U A;  1C6V A;  2HVH A;  1U49 A;  1YTU A;  3BF3 A;  4R5P A;  4GMJ B;  3VF4 A;  4JI3 K;  3AVA A;  3VOV A;  1VQ7 N;  1KD1 O;  4KBO A;  3ZSV A;  1EET A;  4WQ4 C;  4DR4 K;  1WAF A;  5SZT A;  4A5A A;  5BRD A;  1H1V A;  3RMB A;  4ID1 A;  4DFP A;  3WNF A;  3NH1 A;  2CH5 A;  2QWL A;  3PIO L;  4E89 A;  3KKS A;  4CJ5 A;  1N34 K;  2NRV A;  3VQQ A;  1QVG M;  3G71 N;  4ZTF A;  4FJI A;  2QWN A;  3E9L A;  1T6C A;  2ZWH A;  3G4S N;  3SQ0 A;  3WNG A;  2V7Z A;  3AV9 A;  4JD2 B;  1Z05 A;  5LJV A;  1CLQ A;  5LJW A;  4FJG A;  4DQS A;  1QSL A;  3CCV N;  2A40 A;  3ZT3 A;  3P38 A;  3NAE A;  4KB0 A;  3MCA B;  1ASV A;  1U47 A;  4KHQ A;  4H0V B;  4GV3 A;  1Q9Y A;  4JK9 A;  3LM9 A;  4CJS A;  4CJ7 A;  3GL1 A;  4Z4F A;  3EE9 A;  3MX5 A;  4BC5 A;  4FVU A;  3M6G A;  3TSQ A;  2O4I A;  1SL2 A;  3L4I A;  1BU6 O;  3P83 D;  4AH9 A;  3KLI A;  1LAW A;  3CCM N;  4BR0 A;  2FBV A;  5FRN A;  3WXJ A;  2AJQ A;  4I6M B;  3NMU A;  3OHR A;  2QWR A;  1L3S A;  3OYK A;  1NMN A;  2HF4 A;  4NB4 A;  3FR0 A;  4ZHR A;  4FLT A;  1V4S A;  2B5J A;  3CC4 N;  4CEB A;  5BPN A;  2WTU A;  1HJO A;  3K5L A;  2V52 B;  1VSH A;  1K8K A;  2FC0 A;  1D9D A;  3CCQ N;  2O8D B;  4CES A;  5BPL A;  3ZEU B;  3RTV A;  1IKX A;  4DFJ A;  4B9S A;  3AA4 A;  3M1F A;  3T3F A;  2KFZ A;  3C7N B;  1YTA A;  4M3W A;  2I5J A;  4C1N K;  3F9M A;  4CJF A;  1C0G A;  2W40 A;  4CGH A;  3AVK A;  4ISE A;  4LF9 K;  3V9W A;  2IVN A;  4O4G A;  2J4R A;  4DQI A;  2WC9 A;  3L4Q A;  2CGJ A;  4CEC A;  3J80 O;  2QI2 A;  4KRE A;  2O8E A;  3HSC A;  3QBW A;  1VQM N;  4LFC K;  2IAJ A;  4FWQ A;  3MMV A;  3HBT A;  4JK8 A;  2Q31 A;  4IEI A;  3SBG A;  4B9U A;  3G25 A;  4EHT A;  1S1T A;  4DF8 A;  3S3M A;  3VEV A;  4CHO A;  1IBL K;  1C1A A;  3I33 A;  1EXQ A;  1VSI A;  1TL1 A;  4JKH A;  3V1Q A;  1ASW A;  2O8C B;  1VSL A;  1GLC G;  2E88 A;  4RW9 A;  1BCM A;  4CEZ A;  3AVF A;  3C6U A;  3QEV A;  2NRT A;  2XO7 A;  4H4O A;  1HKB A;  4NXM K;  3LL3 A;  4JI0 K;  1SQK A;  1C1C A;  4DTP A;  4Z94 A;  4M3R A;  3SJJ A;  4B08 A;  5I3U A;  3ENH A;  4CZH A;  3M8R A;  1D4X A;  5F1X A;  3OYH A;  4BQZ A;  3NE6 A;  4MLH A;  1HQU A;  3CFP A;  2HHU A;  2YNH A;  3N4Q A;  4N47 A;  4CFC A;  2BH1 A;  2W6L A;  2RN2 A;  1JLE A;  2HBJ A;  4PKI A;  3OYM A;  1TAQ A;  4CHY A;  3VEZ A;  3HPO A;  3V9U A;  2A41 A;  1R0A A;  4JD2 A;  1S3X A;  4JKG B;  4N41 A;  2H3G X;  4M45 A;  3RMC A;  1HPZ A;  1U6Z A;  3MWP A;  3VPZ A;  2P9U B;  4C8M A;  1LCU A;  4FPB A;  3C6H A;  1TK0 A;  2WOM A;  2ZGZ A;  3ALY A;  4CFB A;  2ASP A;  1KFS A;  4O5B A;  4NLB A;  4J2B A;  3EL2 A;  2GV9 A;  4DKW A;  2JGU A;  1S72 N;  3TAB A;  3ISN C;  3SK3 A;  3IDH A;  3TWH A;  4RG8 A;  4Q0B A;  5C24 A;  3LWL A;  4CZE A;  1S1U A;  2G8H A;  4AHR A;  4CGD A;  4EP5 A;  4JN4 A;  2P1J A;  3QML A;  5KGW A;  2EWS A;  3WUH A;  1X9S A;  1WUA A;  3AA2 A;  4CE9 A;  3CCE N;  1Q81 O;  3VET A;  2UXD K;  2KZM A;  1ZXO A;  2YJE A;  1WSI A;  3SPY A;  4B1U B;  1FKO A;  4KH4 A;  5FPM A;  4FJM A;  3GG4 A;  4O0J A;  5AQS A;  3THY B;  3J81 O;  3CJA A;  4FXD A;  1Q18 A;  3DLB A;  2VG5 A;  4EAH D;  5KRS A;  4CEF A;  4WQ5 C;  4ISF A;  1NM1 A;  2P9P B;  5AQX A;  3CF5 L;  1W7A A;  4OX9 K;  1ITG A;  1OVY A;  5KPZ A;  1BOT O;  3CXC M;  4X65 K;  2KQ2 A;  1ZBS A;  2FF3 B;  3O80 A;  2P9N B;  4FO0 A;  4WFA L;  3H45 C;  4B9N A;  1NGG A;  5AZI A;  3M8S A;  2B4J A;  3DXK B;  2KTQ A;  1Z6R A;  4DR6 K;  2WUS A;  3ID8 A;  2YJF A;  4ICL A;  4OGE A;  2KLA A;  3VQ8 A;  3R1X A;  1YHQ N;  1JL2 A;  1L5U A;  5AQJ A;  3F5T A;  2P5G A;  1BHL A;  3VF6 A;  4LF8 K;  1N8R O;  3LAN A;  1Z26 A;  4I2Q A;  3CCL N;  3M5R A;  3VGK A;  1NGI A;  3SUN A;  3SI6 A;  2E4L A;  1HNI A;  3L2Q A;  4JKA A;  3PO5 A;  3LM2 A;  1MDU B;  3FZL A;  1KLM A;  1JXE A;  4FLU A;  3SUQ A;  3CJB A;  3VTH A;  4FW1 A;  4YOY A;  1GLL O;  3CCR N;  4H5T A;  2YHW A;  3DLR A;  1TGO A;  1WLJ A;  2OYQ A;  4TSX A;  4BVP A;  2GTD A;  4Y1D A;  3KD5 E;  4FJ9 A;  4UY8 O;  3HO1 A;  3J7A P;  3AVI A;  4BAC A;  1Q7Y O;  4FLZ A;  1U2V B;  3OYE A;  4JAX A;  2D0A A;  2NLX A;  2YHX A;  1YUW A;  4OKK A;  4WF9 L;  2ZJQ L;  3HOT A;  2XY5 A;  4IWV A;  3JSM A;  1P90 A;  1NJI O;  4BRD A;  2OPQ A;  3VER A;  4C1N I;  4CK2 A;  4IJN A;  3C0B A;  3M8Q A;  3MXI A;  4M63 C;  4BC4 A;  3BF1 A;  4M7X A;  1IG9 A;  1I39 A;  3ZX2 A;  4K25 A;  3ENO A;  4H0P A;  3EY1 A;  5KPR A;  3VA3 A;  4BRI A;  3TAM A;  2Z1H A;  3QNN A;  1YXQ A;  4JV5 K;  2HST A;  4AF1 A;  4DMN A;  4JKB A;  4IG3 A;  2PAV A;  4W5O A;  4WQ5 A;  3IUC A;  1S9E A;  1BG3 A;  5JVG L;  1KAY A;  3IFR A;  3HPG A;  1QQM A;  1BI4 A;  4L3Q A;  3ENB A;  4BDP A;  3CCU N;  4F4K A;  3OS0 A;  5FRM A;  4B1Z A;  1RDD A;  2AP1 A;  1UA1 A;  4BR5 A;  3CI5 A;  4E1J A;  1NBW A;  2GWK A;  1Q9X A;  1KQS M;  1RBU A;  2P9S A;  1NK6 A;  4DUZ K;  1KTQ A;  2HBK A;  1HNZ K;  1HRH A;  4FJK A;  3KLH A;  4Z4I A;  1LAV A;  2Q2R A;  3EE8 A;  2D1K A;  4AHU A;  2QWO A;  3U9D A;  5CY4 A;  3RR7 A;  1QQO A;  3HJF A;  3PX0 A;  1CXQ A;  1W97 L;  2CGL A;  5HRR A;  2XY7 A;  2BE2 A;  3P5J A;  1J5O A;  1BQN A;  3OYJ A;  3RSE A;  1XI1 A;  1RT7 A;  3HK2 A;  1IBK K;  4CJW A;  5CR4 A;  2RHK A;  3VQ5 A;  1IKW A;  3NVM A;  4MDA A;  4O8U A;  3OA9 A;  4LH4 A;  5BPM A;  4DTN A;  1TKX A;  4KHN A;  2NRZ A;  4PL7 A;  4ILG B;  3HM9 A;  4FW2 A;  4ILJ A;  1A5W A;  4DV2 K;  4O0I A;  3HTV A;  3VEO A;  1OKJ A;  2ZD1 A;  3KK3 A;  3O5B A;  3OYA A;  2YCH A;  4RW8 A;  5DK5 A;  3VQP A;  3D0P A;  1QSY A;  4LD0 A;  3D2E A;  2ZGY A;  1FW6 A;  1GLB G;  3NGY A;  2P9L A;  1JCG A;  4JK7 A;  1RNH A;  4FWL A;  4B1Y B;  2VWJ A;  4DQP A;  1C0F A;  4H0O A;  1YJW N;  2QXL A;  4JI8 K;  3WQU A;  4ZTJ A;  1BIU A;  3VA0 A;  4CJK A;  1IJJ A;  3OJU A;  4EZ6 A;  1QHT A;  3O9U A;  3WXL A;  4BRQ A;  3MAQ A;  4CD1 A;  3E9O A;  3GE1 A;  3EN9 A;  4FJJ A;  1R59 O;  4LY7 A;  2ASM A;  4X66 K;  3UE5 A;  1N6Q A;  3PUF A;  4KFB A;  3K5M A;  1YIJ N;  2GUI A;  3QLH A;  3U3Y A;  4GKJ K;  1NJY A;  4QAG A;  4FWS A;  4GV9 A;  4N56 A;  5JLH A;  3QEW A;  1VSM A;  1RFQ A;  3RVC A;  3CET A;  3SAF A;  3L2V A;  4DQ8 A;  3CD6 N;  3PSI A;  1IKY A;  3OW2 M;  4UQG A;  1IH7 A;  4BRF A;  1V4T A;  1S6P A;  2F96 A;  3HZ6 A;  1W2B M;  3ATU A;  3E1Y A;  1WBD A;  1VQN N;  3IKM A;  4AM6 A;  4B3R K;  2BAN A;  3I8D A;  1VSF A;  5LMU K;  5FDL A;  4Q5V A;  4ELT A;  3E66 A;  3O1B A;  4IFE A;  1XHX A;  4KI6 A;  2UUA K;  1Y64 A;  5AFU H;  5C2D A;  4A5B A;  2JWL A;  4BRO A;  4DG1 A;  4F8R A;  4DS5 A;  4H4M A;  3ZSY A;  3AA3 A;  2HND A;  2QXF A;  1TUY A;  5HOO A;  4XIU A;  3LP1 A;  4H5V A;  5M1N A;  3KZB A;  4E1N A;  2QA4 N;  2IS3 A;  4FJ8 A;  4E1M A;  4IO9 L;  4M7Y A;  3TTC A;  5AQN A;  3NF6 A;  2E2O A;  5EOY A;  1N32 K;  2QW9 A;  2CH6 A;  2A1R A;  4A61 A;  2GUP A;  3I0R A;  3LZJ A;  1K8K B;  3O3G A;  5KI6 A;  5H1S Q;  3O4N A;  4YOU A;  1JKH A;  4CEO A;  5C10 A;  4CFA A;  2UUB K;  3SUO A;  1NK0 A;  4PKG A;  2HB5 A;  4AM7 A;  5T7B A;  3CMA N;  5GAD P;  2FBX A;  1RT6 A;  4KHS A;  1HLU A;  2X6N A;  1S5J A;  2HHH K;  1SKS A;  1K8A O;  1OH8 A;  4FK0 A;  4DSI A;  2IIR A;  1YVU A;  2O8E B;  3RWU A;  1U48 A;  5BR8 K;  4IDK A;  3P31 A;  2OZM A;  2BDP A;  4DTS A;  4KH5 A;  4CGF A;  2KFN A;  3UB5 A;  3V6D A;  3U4L A;  4QOZ B;  3UKU A;  3JS6 A;  3A5M C;  3KIO A;  2YHA A;  5C2F A;  1RBV A;  3A5L C;  3L0Q A;  4E7H A;  2YHY A;  1OH5 A;  4BGB A;  4DV0 K;  1JL1 A;  4MO5 A;  4DSJ A;  3SMP A;  2QKK A;  4FM1 A;  1VQ5 N;  5LL6 Z;  3LAL A;  1NGC A;  3AVM A;  4CF9 A;  1RTD A;  2G8K A;  2JWK A;  1XQS C;  1UA0 A;  5AQR A;  3QIP A;  5J2N A;  4NXN K;  3OTO K;  4V19 S;  3SMS A;  1DTT A;  3HVT A;  2RKI A;  4A57 A;  1S1W A;  1RT1 A;  2P51 A;  1TYQ A;  4DSK A;  3ULD A;  4C8O A;  4M41 A;  1NGF A;  4CZI A;  3BY5 A;  1MWK A;  1YF5 L;  4PHT X;  4XH1 A;  4WFB L;  2OTJ N;  2BUP A;  5LY3 A;  5HP1 A;  3OYF A;  1QSS A;  4OGC A;  1QZ5 A;  4O44 A;  4OPK A;  3EZ5 A;  4R79 A;  1E4G T;  4CJP A;  3O4W A;  4H0T B;  4LSN A;  4YDU A;  4EZ9 A;  1SL0 A;  2KZZ A;  1SS6 A;  4CD3 A;  1X9J A;  2LSN A;  3N4P A;  4YOV A;  4A2A A;  4HUG A;  3Q7C A;  3NGZ A;  4QS7 A; 
#chains in the Genus database with same CATH homology
 2WOM A;  4BE2 A;  3ALY A;  4CFB A;  3SPZ A;  1U4B A;  1KFS A;  4O5B A;  3NDK A;  4G1Q A;  4FJL A;  4Z4G A;  4J2B A;  2YNG A;  4CJ4 A;  2X78 A;  4IFY A;  3SUP A;  3HP6 A;  4KRF A;  4ID5 A;  3DM2 A;  2HHW A;  2GV9 A;  2G8I A;  3V81 A;  1VSK A;  2JGU A;  3TAB A;  3ISN C;  5HRP A;  3CFR A;  3ZSW A;  4NYF A;  1TVR A;  2OPP A;  2D5R A;  3ZSR A;  4WE1 A;  3TWH A;  4RG8 A;  4Q0B A;  1J9A A;  5C24 A;  2JLE A;  3LWL A;  5HRO A;  3L2U A;  1S1U A;  2G8H A;  4AHR A;  4KI4 A;  4CGD A;  2F8T A;  2QK9 A;  3T1A A;  1Y97 A;  4EP5 A;  4CF0 A;  2P1J A;  3AO2 A;  4YFU A;  3LP2 A;  5J2Q A;  5KGW A;  2OZS A;  1WN7 A;  2R7Y A;  1NOZ A;  3K5N A;  4OPJ A;  1X9S A;  3AA2 A;  4CER A;  3RMD A;  2X74 A;  3LAK A;  4CE9 A;  3NCI A;  1NK5 A;  1Z25 A;  2KZM A;  4CFD A;  2HHS A;  4BDY A;  1RBR A;  1WSI A;  3AO3 A;  3OYI A;  4E7J A;  4DFM A;  3SPY A;  3S3O A;  1WAJ A;  1FKO A;  4FJM A;  1RTI A;  4O0J A;  4F2S A;  4FLW A;  4Y1C A;  1W9H A;  4HUE A;  1RDA A;  4M3T A;  4W5N A;  4FXD A;  3DLB A;  1X9W A;  2VG5 A;  2DFE A;  1HNV A;  4GVM A;  1WSF A;  3TAE A;  1NJX A;  5KRS A;  4CEF A;  5JS2 A;  3QEI A;  3ZT2 A;  1ITG A;  1DTQ A;  3KK1 A;  1T8E A;  1C1B A;  2IGI A;  3L3V A;  1A5V A;  2KQ2 A;  3AO5 A;  4DQR A;  3IS9 A;  1GOB A;  2D0B A;  4OJR A;  4OKE A;  3M8S A;  4B9N A;  3CYM A;  1JLB A;  2B4J A;  3DRS A;  1SKW A;  2KTQ A;  4CJL A;  4GW6 A;  4FLX A;  4CJU A;  3QER A;  1JLQ A;  4ICL A;  4NCB A;  4DU3 A;  4OGE A;  3K58 A;  3VQ8 A;  1L5U A;  1JL2 A;  2YKN A;  4DLE A;  1TAU A;  2P5G A;  2HHV A;  1D5A A;  2Z1J A;  1BHL A;  1XWL A;  1CXU A;  3NF7 A;  3AA5 X;  3U3G A;  4HHT A;  3SCX A;  3LAN A;  1Z26 A;  4I2Q A;  1HQE A;  3K57 A;  5I42 A;  1VRT A;  1T7P A;  1T03 A;  4EP4 A;  2G8F A;  3SUN A;  4DTR A;  3VQB A;  3SI6 A;  2E4L A;  3ITH A;  1HNI A;  3RMA A;  1TKT A;  3TAP A;  3L2Q A;  1L3T A;  3PX4 A;  3O4Q A;  2A1S A;  3A2F A;  3PO5 A;  1QQC A;  3ZSX A;  3WNH A;  3AVG A;  4CEE A;  1ZBF A;  2W42 A;  1KLM A;  5J2P A;  4CF1 A;  1JXE A;  3MEG A;  1RTH A;  4FLU A;  3QES A;  4AIL C;  3SUQ A;  1TK5 A;  1C0U A;  1HJR A;  1K6Y A;  3QNO A;  3U6F A;  1B9D A;  4FW1 A;  4ELV A;  3DLK A;  2HHX A;  2YNI A;  3NH2 A;  3C95 A;  4LH5 A;  2OPS A;  3DLR A;  1TGO A;  1WLJ A;  4B9T A;  4ELU A;  3DYA A;  2OYQ A;  4TSX A;  4IFV A;  4Y1D A;  3KD5 E;  4FJ9 A;  3HO1 A;  3AVI A;  4BAC A;  4CJE A;  4FLZ A;  3DI6 A;  2YHB A;  4DTJ A;  4FK2 A;  3OYE A;  4CHQ A;  3VN5 A;  2D0A A;  1D8Y A;  1XC9 A;  3V1O A;  1LWF A;  2XY6 A;  4OKK A;  1NK7 A;  3I0S A;  4CED A;  1RT3 A;  1O1W A;  2XY5 A;  4AHT A;  3DRP A;  3OYB A;  3JSM A;  1RDC A;  2OPQ A;  4KO0 A;  3ZCM A;  4DTX A;  4KHW A;  1SV5 A;  3ZSO A;  4DU1 A;  4CK2 A;  3NHG A;  3V9S A;  1L3U A;  3NBP A;  3M8Q A;  3SQ2 A;  1F21 A;  4DTU A;  4CK1 A;  3LPU A;  4DFK A;  3MXI A;  1LV5 A;  3OJS A;  1NK9 A;  3DLG A;  1RT5 A;  2XHB A;  4FLY A;  1IG9 A;  1I39 A;  4DSE A;  1NJZ A;  4Z0U A;  3SV4 A;  5HLF A;  2Y1I A;  4IBN A;  4CK3 A;  4H8K A;  3HL8 A;  3VQ7 A;  1JXB A;  1RIL A;  4O55 A;  4E7L A;  3HXM A;  1MU2 A;  3EY1 A;  1ZBL A;  4F2R A;  5KRT A;  2PYL A;  1G15 A;  4FYD A;  5KTQ A;  1LWC A;  3VA3 A;  4KTQ A;  3G10 A;  4BWM A;  1GOA A;  3TAM A;  2Z1H A;  3QNN A;  3V1R A;  3B6P A;  4CIG A;  3TAN A;  2DFF A;  4CIF A;  1TKD A;  4DMN A;  4CJR A;  4IG3 A;  3QIO A;  3LP3 A;  4W5O A;  3V9X A;  3F9K A;  5K14 A;  1NKB A;  1S9E A;  4KB1 A;  4AHC A;  1BI4 B;  5FRO A;  3QO9 A;  1T05 A;  1QE1 A;  5C25 A;  3IAY A;  3MXJ A;  3CM5 A;  2PY5 A;  4K8Z A;  3HPG A;  1ZBU A;  1BGX T;  1BI4 A;  1SL1 A;  3S3N A;  3VQD A;  4BDP A;  1SUQ A;  4CJ3 A;  2IOC A;  3THV A;  4F4K A;  3OS0 A;  5FRM A;  1TKZ A;  4JS5 A;  1RDD A;  3RRG A;  1KVB A;  1UA1 A;  1B92 A;  3VQA A;  2FBT A;  3L2R A;  4FJ7 A;  1BQM A;  4AHS A;  4DLG A;  3V9Z A;  4FZY A;  2YKM A;  4DQQ A;  3OVN A;  1CZ9 A;  3DMJ A;  1Q9X A;  2IC3 A;  3D45 A;  1RBU A;  3NF9 A;  2PZS A;  2HNZ A;  2NUB A;  2E6L A;  4BWJ A;  4JS4 A;  1KTQ A;  4BE0 A;  1NK6 A;  4KHU A;  3KLE A;  4PWD A;  1HRH A;  5EU7 A;  1GOC A;  3O3F A;  3KLH A;  4FJK A;  2QKB A;  4CHN A;  4CHP A;  4M3U A;  1EKE A;  2F8S A;  4Z4I A;  4OLA A;  4Z4H A;  1LAV A;  4AHU A;  4I9Q A;  1C0T A;  2ZE2 A;  1C0M A;  2WON A;  2X6S A;  4W5R A;  3SNN A;  4PUO A;  3AVB A;  5D3G A;  2OPR A;  3ZT1 A;  5CY4 A;  2HW3 A;  3RR7 A;  4CEA A;  1FXX A;  4FLV A;  4LSL A;  3HJF A;  4HCC A;  4F3T A;  3QET A;  1KRP A;  3PX0 A;  4CJT A;  1CXQ A;  4BDZ A;  5HRR A;  1I3A A;  2XY7 A;  3TI0 A;  1NKE A;  2BE2 A;  3CFO A;  2BGG A;  1UOC A;  3P5J A;  4W5T A;  1RT2 A;  3KK2 A;  3KLG A;  4CJV A;  4E0D A;  1J5O A;  1BQN A;  3OYJ A;  4FCY A;  1J53 A;  1RT7 A;  1XI1 A;  3HK2 A;  3NF8 A;  1EX4 A;  2KW4 A;  2Q3S A;  3P1G A;  4JRP A;  4DWI A;  3S9H A;  3KJV A;  1VSE A;  1DLO A;  4CJW A;  2XRI A;  3VQ5 A;  1IKW A;  1WNS A;  4LH4 A;  4RW4 A;  4JLH A;  3RRH A;  4DTN A;  3JYT A;  1TKX A;  2DY4 A;  4KKO A;  5HBM A;  4KHN A;  1U04 A;  1X1P A;  1WSH A;  2VG6 A;  3ASM A;  3QEX A;  3BGR A;  3OYN A;  3HM9 A;  3V4I A;  1NJW A;  4E19 A;  1ZBI A;  4FW2 A;  4DSF A;  4CGJ A;  3B6O A;  1L3V A;  1A5W A;  1KFD A;  4O0I A;  3TAF A;  2G8V A;  3OYL A;  2HVI A;  1VSD A;  2HMI A;  2ZD1 A;  3ZSQ A;  3NFA A;  3KK3 A;  4BE1 A;  1N5Y A;  1HMV A;  4CGG A;  3LWM A;  3WNE A;  1EP4 A;  1FK9 A;  4B9M A;  3OYA A;  3HVR A;  4PQU A;  4B9L A;  4OKJ A;  4RW8 A;  3VQ4 A;  1RCH A;  1VSJ A;  3QIN A;  1HYV A;  4I2P A;  5DK5 A;  3VQP A;  2YNF A;  3D0P A;  4HUF A;  1QSY A;  1BL3 A;  3MED A;  4DS4 A;  1X9M A;  4LD0 A;  4M3X A;  4IKF A;  4DTO A;  1HYZ A;  3SZ2 A;  1FKP A;  3L3U A;  1C6V A;  2HVH A;  1BIS A;  3LPT A;  1U49 A;  3KD1 E;  1YTU A;  3NGY A;  1S1X A;  4R5P A;  4GMJ B;  1ZYQ A;  2HHQ A;  1RNH A;  4KPY A;  4FVM A;  3AVA A;  4FK4 A;  2VWJ A;  2HNY A;  2EHG A;  4DQP A;  3TAQ A;  3AVJ A;  3ZSV A;  1EET A;  3SQ4 A;  5CYQ A;  3OYD A;  4ZTJ A;  1BIU A;  1J54 A;  1WAF A;  4CJK A;  3VA0 A;  4KTZ A;  5SZT A;  3OJU A;  3MXM A;  4EZ6 A;  3L8B A;  1RT4 A;  1S9G A;  3RMB A;  4OLB A;  4ID1 A;  1QHT A;  4DFP A;  1LW0 A;  4JRQ A;  2P5O A;  3WNF A;  3NH1 A;  4K8X A;  1KSP A;  3PX6 A;  4HTU A;  4FZZ A;  3MAQ A;  4FJN A;  4FJJ A;  1N6Q A;  4LY7 A;  4E89 A;  3KLF A;  3PUF A;  3KKS A;  4KFB A;  4CJ5 A;  1JLC A;  3K5M A;  4KHY A;  3MEC A;  3KKR A;  2ETJ A;  1WSJ A;  3VQQ A;  3LZI A;  1KVA A;  4ZTF A;  4FJI A;  2GUI A;  3QLH A;  4DF4 A;  3OYC A;  3U3Y A;  1NJY A;  4B8A B;  4QAG A;  1NK8 A;  3MEE A;  4N56 A;  2RF2 A;  3SQ0 A;  3QEW A;  1VSM A;  3WNG A;  3AV9 A;  2OA8 A;  4MFB A;  3L2V A;  1CLQ A;  2GBZ A;  4FJX A;  4FJG A;  4DQS A;  1QSL A;  3ZT3 A;  1IKY A;  3RR8 A;  3NAE A;  1S1V A;  4UQG A;  3ZT0 A;  4KB0 A;  1TV6 A;  1IH7 A;  3HP9 A;  4J2E A;  4KAZ A;  1ASV A;  1S6P A;  1U47 A;  4KHQ A;  2F96 A;  4YNQ A;  1Q9Y A;  2XY8 A;  2ATQ A;  3K5O A;  1D9F A;  4CJS A;  1RBS A;  1QS4 A;  2BAN A;  3I8D A;  3PY8 A;  1VSF A;  5FDL A;  4Z4F A;  4Q5V A;  3H08 A;  4ELT A;  3AVH A;  3T19 A;  4B8C A;  3K2P A;  3F73 A;  4Z4C A;  1XHX A;  2O4I A;  4KI6 A;  1SL2 A;  3P83 D;  3TR8 A;  2Z1G A;  3KLI A;  4AH9 A;  3HT3 A;  3DLH A;  3O3H A;  4N5S A;  4DG1 A;  5HRN A;  1LAW A;  3TAR A;  4CHZ A;  4F8R A;  2DFH A;  3HST B;  3M8P A;  4DS5 A;  4M3Z A;  2E6M A;  4H4M A;  2FBV A;  3AA3 A;  3ZSY A;  5FRN A;  3ZT4 A;  2AJQ A;  2HND A;  2QXF A;  4XIU A;  3LP1 A;  3AVC A;  3OY9 A;  4E1N A;  3E01 A;  2FBY A;  2IS3 A;  3OS2 A;  4FJ8 A;  1TL3 A;  4E1M A;  1L3S A;  5HRS A;  3OYK A;  5JS1 A;  1S6Q A;  1BCO A;  2B6A A;  3NF6 A;  1W0H A;  4ZHR A;  4FLT A;  1ASU A;  1JLF A;  2A1R A;  2B5J A;  1Q8I A;  2D0C A;  2RPI A;  3I0R A;  3NH0 A;  5KI6 A;  3O3G A;  3LZJ A;  4CEB A;  4L8R B;  3K5L A;  3O4N A;  4AHV A;  2EX3 A;  1JKH A;  3AVN A;  4CEO A;  4CFA A;  4FJH A;  1VSH A;  1ZBH A;  3DLE A;  2FC0 A;  3SUO A;  1D9D A;  2HHT A;  3IRX A;  4CGI A;  4W5Q A;  4DTM A;  1NK0 A;  1QTM A;  2HB5 A;  3SQ1 A;  5T7B A;  3SV3 A;  5CYM A;  4CES A;  3UIQ A;  3NGI A;  3RTV A;  4DFJ A;  1IKX A;  4B9S A;  2FBX A;  1RT6 A;  1RTJ A;  3AA4 A;  3T3F A;  2X6N A;  2G8W A;  4J2A A;  4KHS A;  4C8L A;  2KFZ A;  1S5J A;  1YTA A;  4M3W A;  2I5J A;  1SKS A;  1LW2 A;  3K59 A;  3CM6 A;  4CJF A;  2ZQB A;  4KTW A;  4CGH A;  5CZ1 A;  4CCH A;  3G0Z A;  4FK0 A;  4DSI A;  4C8K A;  4M42 A;  5SWM A;  3AVK A;  1SKR A;  1YVU A;  1REV A;  5J2M A;  2Z1I A;  3V9W A;  3RWU A;  4PY5 A;  1U48 A;  4O4G A;  4CJQ A;  4DQI A;  4IDK A;  4NCA A;  3OYG A;  3DOL A;  4CEC A;  4DTS A;  2BDP A;  2OZM A;  4FJ5 A;  4B9V A;  4CGF A;  4KRE A;  1IO2 A;  2KFN A;  1JLA A;  3AVL A;  3LAM A;  2IAJ A;  4HCB A;  4I7F A;  1LWE A;  4CEQ A;  5C42 A;  3ZSZ A;  3V6D A;  4FZX C;  4RW6 A;  3CQ8 A;  1KVC A;  3CG7 A;  2G8U A;  4QOZ B;  1KLN A;  4B9U A;  1BIZ A;  5CZ2 A;  1S1T A;  2YV0 X;  3KIO A;  4FM2 A;  2YHA A;  4DF8 A;  1RBV A;  2VWK A;  4RW7 A;  3S3M A;  4E7H A;  1CZB A;  4CHO A;  1C1A A;  3HYF A;  3IG1 A;  4NCG A;  4E7K A;  1EXQ A;  2ITG A;  1VSI A;  1JL1 A;  1TL1 A;  3V1Q A;  3OS1 A;  1A5X A;  3LP0 A;  1ASW A;  1RBT A;  4CF8 A;  4CIE A;  2QKK A;  4DSJ A;  1VSL A;  3DRR A;  3VQ9 A;  4QCL A;  4FM1 A;  3PV8 A;  4HVJ A;  4RW9 A;  1JLG A;  1VK0 A;  1BCM A;  3AO1 A;  3LAL A;  3AVF A;  3AVM A;  3VQ6 A;  4CF9 A;  3C94 A;  4CEZ A;  4Z4E A;  3C6T A;  3L2W A;  1WSG A;  4I9L A;  1IKV A;  1WSE A;  3C6U A;  3QEV A;  1RTD A;  2G8K A;  5DMR A;  2XO7 A;  3HPH A;  4H4O A;  4PA1 A;  1UA0 A;  5KGX A;  2IDO A;  3QIP A;  4DU4 A;  3DOK A;  4J2D A;  3PO4 A;  1UWB A;  5J2N A;  1C1C A;  4DTP A;  1KCF A;  4M3R A;  1NK4 A;  1HYS A;  4OVL A;  3SJJ A;  4B08 A;  3EYZ A;  5I3U A;  5E41 A;  3M8R A;  1DTT A;  3HVT A;  2RKI A;  1S1W A;  3OYH A;  1RT1 A;  2P51 A;  4DSL A;  3NE6 A;  4C8N A;  4DSK A;  1YT3 A;  1HQU A;  3ULD A;  4C8O A;  4M41 A;  2O4G A;  3CFP A;  2HHU A;  1VRU A;  2YNH A;  4N47 A;  1XHZ A;  4CFC A;  4NYN A;  1RDB A;  2RN2 A;  3KTQ A;  1JLE A;  4E3S A;  4KV8 A;  5HP1 A;  2VG7 A;  3OYM A;  3OYF A;  1QSS A;  4OGC A;  1TAQ A;  4O44 A;  4CHY A;  3HPO A;  4OPK A;  3EZ5 A;  2PYJ A;  4N76 A;  3BDP A;  4CF2 A;  1UAX A;  4CJP A;  4F3O A;  3V9U A;  3QEP A;  4LSN A;  2Y1J A;  2DTU A;  3AO4 A;  4E7I A;  1R0A A;  3SYZ A;  3TAG A;  4N41 A;  4M45 A;  1TK8 A;  3RMC A;  4IG0 A;  4EZ9 A;  1HPZ A;  3FFI A;  1SL0 A;  1B9F A;  4MQ3 A;  3LDS A;  4FM0 A;  2KZZ A;  1U45 A;  3VQC A;  2LSN A;  1NOY A;  4M3Y A;  4HUG A;  4C8M A;  3VQE A;  3NGZ A;  5J1E A;  4B3O A;  1NKC A;  1TK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...