4CGJA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgjA00
1VSDA 2KW4A 3ISNC 3QIPA 3NH2A 4M3WA 1BQNA 4M3XA 4DTUA 1BI4B 1YVUA 4PUOA 4B3OA 3T19A 4FZZA 1WSGA 4CERA 1HNVA 3TR8A 3V9SA 4DFMA 4DSKA 4FJHA 1RBRA 4FJNA 5CY4A 3MEGA 1TV6A 3ITHA 3DRPA 1S9EA 4CGIA 3QEPA 2G8KA 2QKKA 3SUOA 3RR7A 4B9UA 2HHVA 4JS5A 4FJJA 1QS4A 2OZMA 2HNDA 1U4BA 4OVLA 4CJTA 3DRSA 3LAMA 4ICLA 1SKSA 3ZSVA 1NOZA 3OS1A 1RNHA 4OKKA 3ZSXA 4BDYA 4M41A 1TKXA 4LH4A 4HUFA 4ELVA 2RN2A 2YV0X 5C24A 4CHZA 1WNSA 2IDOA 4AHVA 4KFBA 4DSIA 3AO3A 2A1RA 1L3VA 1FKPA 2IC3A 3JYTA 2IAJA 3LP3A 3I8DA 4AHRA 2YNHA 3KK3A 4KI6A 3TAMA 5D3GA 4B9VA 5FRMA 4N47A 4Z4EA 4CK1A 1REVA 3AVFA 2F8TA 3LPTA 4DTRA 2RF2A 3KTQA 3AVMA 4DWIA 1LAVA 3D45A 3I0SA 1TGOA 4CFCA 3RR8A 3JSMA 3PX6A 3NBPA 1GOCA 1TL3A 4IFYA 4CHQA 3HPOA 4CEAA 2O4IA 4E89A 1LAWA 3VA3A 4FJ7A 3OYFA 2VG6A 4F3TA 3K5NA 3BGRA 3AVNA 4B9LA 4PA1A 2BGGA 2W42A 2OPSA 3PY8A 1EETA 2GUIA 3AA4A 2ZQBA 4CJVA 3B6OA 4N76A 2YKNA 3OY9A 1WSEA 4IG3A 3M8PA 2DFHA 1S1XA 1A5VA 4CJ5A 2BDPA 2DTUA 4HCCA 2HHTA 1FK9A 4B8CA 4NCAA 5KGXA 1HRHA 3P83D 1Z26A 1WLJA 4BACA 2F96A 3ZT4A 3LAKA 4EZ9A 1G15A 4FZYA 1RDAA 1B9DA 3DMJA 5HRRA 1ZBUA 5JS1A 4NYFA 2D5RA 3HPGA 1R0AA 1NKEA 3OYMA 4CEZA 1NK9A 2HVIA 4CJKA 5JS2A 2PYLA 3SQ0A 4DTJA 4BWMA 1RBTA 1HJRA 3RMDA 4DTPA 4Z4CA 3QEVA 1ZBIA 4KHWA 3A2FA 1RT5A 1KTQA 3CYMA 3O4NA 3K5MA 3HJFA 3TAFA 3DLEA 1JLGA 1DLOA 4OKEA 1DTQA 5HP1A 1IKXA 3SV3A 2YKMA 5CZ2A 4M3UA 4F4KA 1EKEA 4Z4IA 3OYNA 1TAUA 4FCYA 2XY5A 4CJUA 4FJ8A 3PUFA 3PO4A 4EP5A 5HBMA 3HYFA 4CECA 3NDKA 3NGYA 2E6MA 4PQUA 4CEQA 4CF9A 4DTXA 1BIZA 1RT7A 1CZBA 3AVCA 3SNNA 2KFZA 3KLFA 2OZSA 3V9XA 1VSIA 4DU4A 4CIEA 1I39A 4TSXA 3ZSRA 3OYCA 4YFUA 2HNZA 3HK2A 3DM2A 4CGHA 4FLUA 4ID5A 1NJZA 2B4JA 2Y1JA 2FBTA 1BQMA 2DY4A 4DU1A 4KKOA 1IKVA 3FFIA 1C0MA 1QSSA 4DLGA 1JLEA 4FW2A 2Z1GA 4CEBA 3QNNA 2I5JA 4FM2A 4N5SA 1K6YA 4FXDA 1KVCA 4C8MA 4R5PA 2YNGA 2DFFA 4CIFA 3HM9A 2ATQA 1A5WA 3OVNA 1Q9YA 4DQIA 2ITGA 1UOCA 1WSHA 1SL2A 3KLEA 1NK8A 1JLAA 3KLIA 1CXQA 4B9NA 4CF1A 2XY6A 3VQEA 1N5YA 1IG9A 1D8YA 4GW6A 4KTWA 4CESA 4CJSA 3O3GA 2FBYA 4IKFA 1YT3A 2KQ2A 3VQ6A 3ZSQA 4DSLA 3AVAA 4B08A 5J1EA 1ASVA 4DSFA 1VK0A 1XWLA 1RTDA 4CGFA 2HB5A 3V1RA 4BDPA 4FJXA 4RW9A 2FBVA 1RBVA 1RT3A 1RTIA 4FJ9A 3NF8A 4KHSA 4DTSA 3TAGA 4FK2A 4Z0UA 3LANA 3LPUA 4CGGA 2KFNA 2GV9A 3SPYA 1QSYA 3NAEA 2P5OA 4H4MA 4FJKA 1VSKA 4I2PA 1WSIA 4AH9A 1HMVA 3VQDA 3QLHA 3KLGA 3AO4A 1SL0A 2X74A 3L2WA 1UWBA 2ZD1A 1RBSA 4GVMA 2R7YA 4OPKA 4FM1A 2OPRA 3LZIA 2XRIA 3AVIA 3ASMA 1W9HA 2ZE2A 2VWJA 4CJRA 4HCBA 2WONA 3RMAA 3MAQA 1GOBA 3NGIA 3IS9A 3T1AA 3TAEA 3V6DA 1TK8A 1JLBA 2BANA 3SQ2A 2VG7A 1DTTA 2X6SA 3LWMA 1QSLA 4ELTA 3KJVA 4DFJA 4C8OA 3VQ7A 2JGUA 4CGJA 3VQAA 1N6QA 4I9QA 2OPPA 2Q3SA 1LV5A 1RTJA 2HMIA 3DOKA 1VSHA 5KRSA 3U6FA 4HUEA 3AA2A 3RMBA 3VQQA 4DG1A 1LWFA 3F73A 3HSTB 5FROA 3QEXA 4FK0A 1HPZA 3S3NA 1ITGA 3TI0A 3AVBA 4E1NA 2RKIA 5CYMA 1U45A 1T05A 3AO5A 3WNFA 3PX0A 3DLBA 4Y1DA 3IAYA 3QESA 3K2PA 3QERA 3OJSA 3KIOA 3HL8A 4FLYA 4C8NA 3LP1A 3AO1A 3LP0A 4DFKA 2HNYA 3ZSWA 1NK4A 1SKRA 3BDPA 3F9KA 4KHQA 2KTQA 1KCFA 1YTAA 3ZT0A 1NJYA 4W5OA 4KO0A 3O3FA 1TK5A 1UAXA 1KSPA 1X1PA 2HVHA 1SUQA 1VRTA 5SWMA 4E0DA 1U48A 1B9FA 2X6NA 4MFBA 3MXMA 4FLZA 3KD5E 1L3SA 3DLGA 5HRNA 3OYEA 4AILC 1U47A 4E7KA 1FKOA 2YHAA 3OYIA 3CQ8A 2B5JA 1WN7A 3KD1E 3VQ5A 1BL3A 5KRTA 2XHBA 4FK4A 1F21A 1LW2A 3DLRA 1BHLA 3VA0A 4E7IA 1YTUA 2X78A 1HNIA 4FJMA 4E3SA 1NOYA 3VQ9A 3AVLA 1D9DA 4F3OA 4M3ZA 4BE1A 3K58A 4DTMA 3SPZA 4OPJA 1ZYQA 2HHSA 5J2PA 3EYZA 1B92A 1KFSA 4HVJA 1S9GA 1BCOA 3NE6A 3MECA 5CYQA 4CK2A 1A5XA 1JXEA 2EX3A 3V9UA 3H08A 2YHBA 4EP4A 1XC9A 4E7LA 4O0JA 3ALYA 3NGZA 1RCHA 2XY8A 4KRFA 3I0RA 1NK0A 2AJQA 3U3YA 3KKRA 3VQPA 1KFDA 3TWHA 3ZT2A 5J2QA 4AHTA 1JLCA 3NF6A 2WOMA 1HYVA 4EZ6A 3L3UA 1XHZA 4W5NA 4NCBA 4IDKA 2QXFA 4AHUA 1RT2A 3V81A 1KRPA 3L3VA 4JS4A 4CCHA 3TAQA 4RW6A 4CHNA 3PV8A 1TL1A 4CEDA 1NKBA 4K8XA 4DQSA 4DSEA 2FBXA 4C8KA 1VSFA 3K5LA 4KB0A 4GMJB 5E41A 4PWDA 1L3TA 1X9MA 5FRNA 1SV5A 3S3OA 3NFAA 4G1QA 4DU3A 1JL2A 3WNEA 4CK3A 4UQGA 1J53A 4CHOA 1NK5A 1BISA 3OYGA 3SV4A 2G8VA 3V9ZA 4B9TA 4KHUA 1Y97A 4CHYA 2P51A 1JXBA 5FDLA 2DFEA 3ZSOA 1KVAA 4BE0A 4M3RA 3TARA 4B9SA 1GOAA 4RG8A 4BE2A 4LSLA 1IKYA 2E6LA 2D0AA 4CJQA 3C95A 2A1SA 4CJLA 3ZT3A 1C1AA 3CG7A 4CJWA 3AA5X 4DF8A 4M45A 1Q9XA 3CM6A 4CFBA 3C94A 4NYNA 4LSNA 3DOLA 5T7BA 3LWLA 4O5BA 3LDSA 4E7JA 3DLHA 3HP6A 3OJUA 1S6QA 1JLFA 4Y1CA 3CFOA 5SZTA 1JLQA 1MU2A 1Z25A 3P5JA 3NHGA 4CGDA 2OA8A 4QOZB 4O44A 2P1JA 3SI6A 4FLVA 3B6PA 1RTHA 2Z1JA 1TVRA 1RT1A 4DMNA 1L3UA 4E19A 4FZXC 3AO2A 4CJ3A 3OYDA 3WNHA 4CF0A 3D0PA 4OKJA 4BWJA 5HLFA 4M42A 3E01A 1BI4A 2HHQA 5C25A 4ZTFA 1TKZA 4FW1A 3OYJA 4DQRA 4OLAA 1QTMA 4NCGA 1LWCA 3ZT1A 3L2UA 3AVKA 4FJIA 1T03A 4JRPA 1X9SA 3PX4A 3ZSZA 2HHXA 4Z4HA 3M8SA 1LW0A 4DQQA 1NKCA 5KGWA 1XHXA 3IG1A 1W0HA 1TKDA 1QE1A 1S1UA 3V1OA 2OYQA 3V9WA 4HUGA 1UA1A 3C6UA 3RWUA 3HVTA 4CIGA 1NK6A 2JLEA 4I7FA 1EP4A 1C0TA 1HQUA 4LH5A 3NH0A 4KAZA 3SZ2A 3MEEA 3ZSYA 3SJJA 1WAFA 1J54A 1EX4A 1BGXT 1VRUA 3CFRA 3CM5A 2PYJA 4CFAA 1D9FA 4FLXA 4ZHRA 4M3YA 3QEWA 1WAJA 4Z4FA 2E4LA 1S1TA 3MXJA 3TANA 3HPHA 1C6VA 4CE9A 1TK0A 5HRSA 2QK9A 1Q8IA 3SUPA 4CJEA 1D5AA 1X9WA 2G8HA 3MEDA 3RRGA 4IBNA 2Z1IA 3QNOA 3QO9A 4KI4A 1ZBFA 2IGIA 3VQ8A 3OYBA 3NCIA 4RW8A 4JRQA 3QETA 1IO2A 1KLNA 4F2RA 1C1CA 4N41A 1ZBHA 3HXMA 3MXIA 2D0CA 4AHCA 4FM0A 4CF8A 1JKHA 4ID1A 4J2BA 4KPYA 2KZZA 4AHSA 3KLHA 2LSNA 3RRHA 4CJ4A 3OYAA 3L2VA 3CFPA 4KHYA 2O4GA 4B8AB 2PZSA 3EY1A 2BE2A 1RBUA 1S6PA 1T7PA 5I3UA 1RT6A 5CZ1A 3LALA 4JLHA 1I3AA 5HRPA 3K5OA 1FXXA 1RDDA 2OPQA 3SUNA 4RW4A 1XI1A 3HO1A 4H8KA 1QHTA 1BIUA 4OGEA 4O0IA 2FC0A 2IS3A 2Z1HA 3AVGA 3U3GA 3OYHA 4FLWA 1WSFA 4I2QA 1T8EA 4E7HA 4DF4A 1SKWA 4DLEA 4IG0A 2HHUA 1RILA 1C0UA 3HP9A 3G0ZA 4KV8A 4MQ3A 4CFDA 4F8RA 3M8RA 3HVRA 3THVA 3LZJA 2HW3A 3VQCA 5J2NA 3G10A 4O55A 3S3MA 3KKSA 4BDZA 4FJGA 3WNGA 4RW7A 1NJXA 4Q5VA 3OS0A 1L5UA 3AVJA 3LP2A 1TAQA 1UA0A 5DK5A 2QKBA 4FYDA 1QQCA 3K59A 4B9MA 3UIQA 3AV9A 1VSMA 3T3FA 5K14A 4CF2A 4ZTJA 4I9LA 2GBZA 3C6TA 4OJRA 3VQ4A 4W5RA 3SUQA 1HQEA 3SYZA 4W5QA 4C8LA 3QIOA 3QEIA 1KVBA 3ZCMA 3RTVA 2YNFA 2G8UA 2KZMA 5C42A 5KI6A 4QAGA 4YNQA 2PY5A 3NF9A 1IKWA 3L8BA 2VWKA 4M3TA 3S9HA 2G8IA 3SQ1A 2XY7A 4KREA 1U49A 3OYLA 4J2EA 4L8RB 4DTNA 4O4GA 3KK2A 3KK1A 3PO5A 3VQBA 1SL1A 1WSJA 3DLKA 3L2RA 2ETJA 5J2MA 2G8WA 4F2SA 4FJ5A 1RT4A 4FJLA 3M8QA 1CZ9A 4DQPA 4CEEA 4FVMA 1TKTA 1VSEA 4CJPA 3DYAA 3O4QA 4KHNA 2G8FA 3V1QA 3VN5A 3OS2A 3EZ5A 4CHPA 2NUBA 4CEFA 1RDCA 3AVHA 4DS4A 5HROA 4W5TA 1NK7A 3AA3A 3TAPA 1HYZA 1S5JA 2P5GA 1CLQA 1EXQA 1HYSA 3K57A 4PY5A 1JL1A 4XIUA 1LWEA 4DFPA 1S1VA 2HHWA 3ULDA 1ZBLA 2EHGA 4J2DA 4DSJA 1U04A 4N56A 2Y1IA 4E1MA 5DMRA 3TABA 3V4IA 3OYKA 4CEOA 1CXUA 4WE1A 3HT3A 4OLBA 2B6AA 1C1BA 1KLMA 4CJFA 4Z4GA 1IH7A 1S1WA 3NH1A 4LD0A 1NJWA 4Q0BA 4ELUA 5I42A 3IRXA 1RDBA 1VSLA 3DI6A 4KTQA 5KTQA 4K8ZA 1ASWA 2IOCA 1J5OA 3SQ4A 4HHTA 5EU7A 4H4OA 3NF7A 4DS5A 4KTZA 2VG5A 4J2AA 4FLTA 3O3HA 4OGCA 2XO7A 4KB1A 1BCMA 1VSJA 2RPIA 4HTUA 3RMCA 4QCLA 3QINA 4IFVA 4LY7A 1O1WA 2YNIA 1ASUA 2D0BA 3L2QA 4DTOA 3P1GA 2F8SA 3DRRA 3SCXA 1J9AA
chains in the Genus database with same CATH superfamily
5LMUK 3ISNC 5M1QA 3QIPA 4JI1K 4M3WA 1BQNA 4B3OA 4PUOA 3CCLN 3T19A 5KQDA 1WSGA 4FJHA 4DSKA 1DKGD 4BR4A 2VWBA 4XH1A 3CJ9A 5CY4A 3SMSA 3ITHA 1S9EA 3RR7A 3TPQA 3VEXA 1N33K 1GLLO 3OS1A 3C6HA 4YOYA 4ELVA 2RN2A 1X9JA 1NGCA 4KFBA 1ZBSA 1L3VA 4MLEA 4KI6A 5FRMA 4N47A 1REVA 3AVFA 4DTRA 2RF2A 1NWKA 2O8BB 1LAVA 1YJ9N 3M5RA 1QZ5A 2P9NB 1GOCA 4IFYA 4CHQA 2FSJA 3K5NA 2NRRA 4B9LA 4DV2K 1QQOA 4PA1A 3PY8A 3QICA 4CJ5A 5CE3A 5BN9A 2DFHA 3J80O 4HCCA 4B8CA 3KVGA 4DR4K 4BACA 4M63C 2V52B 5GAGP 2P9SB 1ZBUA 5C10A 1OVYA 5JS1A 2ASMA 4A57A 2D5RA 3HPGA 4FWOA 3U9ZA 4DTJA 4DV6K 2QWLA 1RBTA 1ZBIA 4KHWA 5AQQA 2NNWA 1DLOA 1IKXA 3SV3A 3WUHA 3OYNA 4Z94A 5HBMA 1YXQA 4DTXA 1VSIA 4CIEA 1XUPO 3ZSRA 4YFUA 2HNZA 1HKBA 1T6CA 4ID5A 4WQ5C 2FBTA 1ATRA 2DY4A 1YAGA 2E5LK 5JMVA 1C0MA 4FM2A 1K6YA 5AQVA 1KVCA 4C8MA 2Q2RA 4R5PA 1VAZA 3GL1A 2VYPA 4CIFA 3KWGA 2ATQA 1Q9YA 4CBUA 3H46O 1JCEA 1O13A 3UKUA 4CJ7A 1NK8A 1MA9B 4A2BA 1EO1A 4NXMK 4B9NA 3VQEA 3WXMB 1D8YA 4CESA 4CJSA 3O3GA 4BC3A 1ASVA 1VK0A 2VQFK 4H03B 4X62K 3UKRA 4OPHA 3VEOA 4CGFA 4BDPA 4RW9A 5FLXO 3NF8A 1IBKK 1IBLK 3LPUA 3ZX3A 3OTOK 4H4MA 3BZCA 4I2PA 4GVEA 4JI6K 4GVMA 2VCPA 4IDHA 5KPZA 2NRTA 4OPKA 2O8EB 2XRIA 3THXB 3SQ2A 1YHQN 2VG7A 3EO3A 2OTLN 3T1HK 3FE1A 2ZGYA 3PSFA 2YHXA 3D2EA 3VQAA 4CGJA 4X66K 1NM1A 1LV5A 1RTJA 3DOKA 3CCMN 1VQLN 2GTDA 3RMBA 5BRFA 4FOIA 4DG1A 1HPZA 3P4IA 1QZ6A 5LL6Z 1NJIO 3T7ZA 5CYMA 4CVNE 4JI7K 1KCFA 4W5OA 1UAXA 1Q82O 1T3VA 3D2FB 3DXKA 3WT0A 4BVPA 1K73O 1B9FA 4R79A 4MO5A 4LF6K 2HSTA 3J7ZO 2FF6A 1L3SA 3VOVA 2UUBK 1FKOA 4O8KA 3CQ8A 4B3TK 3MX2A 4WFBL 3C7NA 2XHBA 1BHLA 3L0QA 3OBYA 1C0GA 4E7IA 1YTUA 4JNEA 2EWSA 3GBTA 4F3OA 4DTMA 4OPAA 4OPJA 2QA4N 4HVJA 1BCOA 1Q86O 5EX5A 5CYQA 1JCGA 3H08A 2YI1A 4E7LA 2E2OA 4O0JA 3NGZA 1E4FT 3U4LA 2QEXN 2XY8A 4IZ9A 4DV4K 3E66A 3I0RA 3KHYA 3U3YA 1XNRK 1KFDA 3QDKA 4BRAA 1JLCA 4DR3K 1HYVA 2WBNA 3ZEUB 3L3UA 4EZ6A 1XHZA 4NCBA 3V81A 3PV8A 4CHNA 1NGJA 1TL1A 2FBXA 3KWIA 4CZGA 3HOSA 2BH1A 3K5LA 4GMJB 5FRNA 3NVMA 4JK8A 4G1QA 4DU3A 1JL2A 2A5XA 3K9JA 4UQGA 2UXBK 1U2VA 1NK5A 3OYGA 4BC2A 1Y97A 3H6EA 3ZSOA 1KVAA 4BE0A 4M3RA 3TARA 1GOAA 2D0AA 3DAWA 5LJVA 3CG7A 3AA5X 4NLBA 1VQON 4JN4A 3A5MC 3MN5A 4EFHA 4NYNA 3LWLA 4O5BA 4E7JA 1KQSM 2E2PA 3OJUA 1JLFA 4Y1CA 3EL2A 4GV9A 3NHGA 2OA8A 4O44A 4FLVA 3B6PA 2Z1JA 1W7AA 1L3UA 3H3OB 4OKJA 5AFUH 3AGRA 4ZTFA 4FW1A 2UUCK 3CERA 4NCGA 4IJNA 3L2UA 1N36K 3B8AX 3E1YA 1T03A 3ZSZA 3EEQA 4H5WA 2HHXA 4JKEA 3MWTA 1QE1A 3C6UA 4CIGA 1NK6A 1EP4A 1BO5O 4BG8A 4KAZA 3SJJA 1EX4A 3FLCO 1X3MA 3CFRA 5AQGA 4CFAA 3QEWA 2A6AA 4Z4FA 2E4LA 3HPHA 5F1XA 2QW9A 4B3RK 5F2RA 3SUPA 1VQ9N 1D5AA 2G8HA 3RRGA 4KI4A 2YHYA 4ILJA 4JRQA 5DM6L 2HBJA 1ZBHA 3O6WA 3D2EB 4GV6A 3HXMA 3O9TA 3CC7N 4FM0A 4CF8A 1JKHA 4ID1A 5EY4A 3VF4A 2KZZA 5HOOA 1OH6A 4AHSA 2P9IB 2LSNA 5KPTA 3RRHA 2OTJN 3L2VA 2O4GA 1RBUA 1TYQA 5I3UA 4JLHA 3CQXA 3K5OA 1FXXA 1RDDA 4JHDA 5FPDA 4RW4A 2GELA 4H8KA 4BRPA 1BIUA 4OGEA 2FC0A 4U67L 1T8EA 3DXKB 2ASPA 1N32K 4DF4A 4CFDA 3ZX0A 3G0ZA 4MQ3A 2HW3A 3M8RA 3VQCA 3HOTA 3G10A 3S3MA 3WNGA 1NBWA 1NJXA 4BY9C 3AVJA 2F9TA 1GLCG 5DK5A 3UIQA 1VSMA 4ZTJA 4I9LA 2GBZA 3MCAB 3SUQA 4RWTA 2YJFA 1HQEA 4DV7K 1LOTB 3QEIA 2YNFA 2UYTA 3NF9A 2G8IA 2XY7A 4KREA 4DTNA 1XC3A 1WSJA 2G8WA 3CHWA 3M8QA 3LDQA 4CJPA 1RFQA 3O4QA 4BRGA 2G8FA 3CJAA 4DS4A 4CHPA 4DCHA 1X3NA 3TAPA 4YDUC 2I7NA 3IFRA 2KKZA 1RGIA 4IEEA 1G99A 3K57A 4ISFA 1S1VA 3OHRA 1XMQK 5AQPA 1U2VB 2Q1NA 4IWVA 3S41A 3AAPA 4E1MA 4JI3K 4DUZK 4CEOA 2IVPA 1C1BA 1KLMA 1S1WA 4LD0A 4ELUA 2QWNA 4YOWA 3L6QA 1VSLA 4BRNA 4KTQA 4CBXA 1J5OA 4YOTA 3SQ4A 4BRLA 5EU7A 1RDWX 2GUPA 3MN6A 2IIRA 3M3ZA 2YHWA 4KB1A 3RMCA 4IFVA 4DR2K 5LY3A 2YNIA 4DTOA 2WFBA 4I6MB 2F8SA 3O08A 1VSDA 2KW4A 3M6GA 3NH2A 3BUZB 5BREA 1W2BM 3CC4N 1HNVA 3H3NO 3CF5L 1YI2N 1RBRA 4FJNA 4WQ4C 4A61A 1HR0K 4CGIA 2G8KA 2QKKA 1NGDA 2HHVA 4JS5A 3G6EN 4FJJA 1QS4A 1U4BA 3LAMA 1SKSA 5ADXH 1HUXA 1RNHA 4JD2B 4BDYA 4HUFA 2YJEA 4H0TB 5C24A 4CHZA 4GNIA 4A59A 4AHVA 3VF6A 2IC3A 4CZHA 3KK3A 4Z4EA 3LPTA 3KTQA 4F9OA 5MLCQ 1HKCA 1TGOA 4CFCA 3RR8A 3HPOA 5AQRA 4CEAA 3VA3A 3H1VX 3OYFA 2VG6A 4F3TA 4AM6A 4JI5K 2BGGA 2HF3A 2OPSA 4B3MK 2D1KA 3AA4A 1T44A 4B9QA 4N76A 3CCUN 5M1NA 3UE5A 1FK9A 1TYQB 1J5EK 4NCAA 3CJCA 1BUPA 3H1QA 4JHDB 3CC2N 4LFAK 1WLJA 3KZBA 3LAKA 4O8UA 1B9DA 2ASOA 4H0OA 4NYFA 1NKEA 3OYMA 4CEZA 1NK9A 3SAGA 2PYLA 4BGBA 4DHYA 1HJRA 3HBTA 3QEVA 3BF1A 3K5MA 3WQUA 4GV3A 3TAFA 5HP1A 4OKEA 1GLEG 4Z4IA 2KHOA 5CZ2A 1Q7YO 1QQNA 3PUFA 4EP5A 2QWRA 3NDKA 4JI0K 3CPWM 2E6MA 3SJHA 4CEQA 1BIZA 4IFEA 3SNNA 3V9XA 4TSXA 2PBDA 2ZJPL 1BQMA 5B8HA 4BRHA 1JLEA 3SBGA 2PFUA 4FW2A 2Z1GA 4K42A 3FGUA 1RDUA 2DFFA 3HM9A 3OVNA 1IV0A 1SL2A 3KLEA 1W97L 4CF1A 4C1NI 4FSVA 3LDNA 3THXA 4KTWA 1YT3A 3WQTA 3MCPA 4DSLA 3AVAA 4DSFA 4WFAL 2Q0UA 2HB5A 3PIOL 4XEIA 4FJXA 2FBVA 1RTIA 3EKUA 3TAGA 3MDQA 4Z0UA 3JAMO 3LANA 2V7YA 4CGGA 4A2AA 3OBWA 3SPYA 2P5OA 1K8KA 3A0IX 2P9UA 2X74A 1UWBA 2ZD1A 3ATUA 4H5VA 2W6LA 2BTFA 3LZIA 3ASMA 2VWJA 2ZE2A 4HCBA 4CZIA 3RMAA 3MAQA 3TAEA 3IS9A 3ENOA 1I94K 3KJVA 4DFJA 4C8OA 2JGUA 1N34K 3NMUA 1MDUB 5KQ8A 1N6QA 1KAZA 3D2FA 4BR2A 3CCEN 4K25A 4X64K 2ZF5O 4HUEA 3VQQA 3F73A 4FWQA 5JVGL 3AVBA 3K9KA 4E1NA 4QS7A 3WNFA 4Y1DA 1EQYA 3CCSN 3QERA 3TSUA 4FLYA 3Q7CA 4C8NA 1ATNA 2QWMA 3AO1A 3LP0A 2GWKA 3ZSWA 4DFKA 1SKRA 3F9KA 1NJYA 2FLOA 4WCEL 2FXUA 3O3FA 1TK5A 1SUQA 1VRTA 5BN8A 3P31A 4E0DA 4QS9A 3MXMA 4IOXA 4L3QA 4FLZA 3KD5E 3P38A 4H0VB 1KD1O 3DLGA 1U47A 4E7KA 3LM2A 3EKSA 2H3GX 4GY2B 1BL3A 1F21A 4JKBA 4K0KK 3DLRA 2X78A 1XMOK 3E9PA 1DT9A 4M3ZA 3ZEUA 2HHSA 3EYZA 1KFSA 1S9GA 3NE6A 3I56N 1Z6RA 4CK2A 2A40A 3V9UA 1XC9A 3ALYA 3SK3A 3F9MA 4PKGA 3QB0A 4Y0WA 4MLHA 1OH8A 3LDOA 4W5NA 4B1VA 2QXFA 1SS6A 3EE9A 3L3VA 3FZKA 3D7EO 2CGKA 1NKBA 3VERA 1TUYA 2IVOA 4AQYK 3MMVA 1VSFA 2NRXA 1SV5A 3S3OA 3CIPA 3WNEA 4CK3A 4JK7A 1J53A 3W3DA 4CHOA 1BISA 2G8VA 2P51A 5FDLA 2Q31A 1SQKA 4IO9L 4BE2A 1IKYA 4PL7A 3O4WA 3DLLL 4ISGA 5AQZA 4CJLA 4LSNA 5AQTA 5T7BA 3LDSA 3DLHA 4EAHD 3H45C 1U6ZA 4BREA 3CFOA 5HL7L 3GDQA 1Z25A 4JKAA 4CGDA 5AQYA 4DMNA 1VQ5N 4E19A 5TKYA 4A62A 3OYDA 3WNHA 4CF0A 3QMLA 5C25A 1TKZA 3OYJA 1LWCA 3ZT1A 4FJIA 3VESA 4Z4HA 3M8SA 1NKCA 4FWPA 5KGWA 3SAFA 3BP8A 3V1OA 4HUGA 3RWUA 3LDLA 4I7FA 1YITN 1C0TA 1HQUA 3JS6A 5GAHP 3SZ2A 1K8KB 3ZSYA 1WAFA 2W6KA 2F9WA 2P9UB 1BGXT 2P9IA 4HTLA 1OH7A 2PYJA 1D9FA 4FLXA 4ZHRA 1WOQA 1C6VA 4DR6K 2UU9K 4CJEA 1X9WA 3U8XA 2IGIA 2W41A 3OYBA 4NXNK 2AP1A 1IO2A 4BRDA 1HX1A 1M1KO 3KLHA 3VEZA 5AQKA 1RT6A 2HBMA 3C0BA 3SUNA 4FWNA 3CJ7A 1QHTA 4O0IA 1C0FA 2HBKA 3AVGA 3RSEB 4JEPA 4I2QA 3THWB 4E7HA 1SKWA 5IT9O 1RILA 1C0UA 2V7ZA 4KV8A 4F8RA 4BQZA 4PKIA 1V4TA 3HVRA 3LZJA 5JVHL 4C1NK 3OS0A 3VF2A 1TAQA 2QKBA 3FZHA 1YIJN 3AY9A 4IOAL 3G4SN 4W5RA 4OX9K 3O9QA 1BG3A 2PAVA 3SYZA 4K41A 4O5FA 3FR0A 4HWIA 3DXMB 3P39A 4FWSA 1YF5L 5KI6A 4YNQA 2YCHA 3GE1A 2VWKA 3TTDA 1NGHA 3SQ1A 1NLVA 3UB5A 3KK2A 3PO5A 1OVQA 3VQBA 1SL1A 4F2SA 4FJLA 2ETJA 3O1BA 1CZ9A 4DQPA 1VSEA 2P9PB 3V1QA 3OS2A 5GIOA 4GKJK 4W5TA 5AFUA 3GOIA 3T69A 3J8AA 2QI2A 1S22A 1HYSA 3N4PA 4PY5A 4BRKA 1LWEA 1HNWK 4DFPA 3E9LA 1ZBLA 2EHGA 3TU5A 1P8ZA 4DSJA 1U04A 3TABA 3CQYA 2Y1IA 2RE2A 3V4IA 1CXUA 4OLBA 2B6AA 4AM7A 4I6MA 1NJWA 5I42A 3D6RA 3DI6A 5KTQA 1ASWA 5AQNA 3A5NC 3W0LA 4X65K 4DS5A 3IMXA 4KTZA 4J2AA 4IO8A 3O3HA 4QCLA 1VSJA 4HTUA 2RPIA 3QINA 1J9AA 3HJFA 4JD2A 2HBLA 2A3ZA 4CERA 3V9SA 3TR8A 4DFMA 4C23A 3MX5A 4LF9K 1TV6A 1VQKN 3CMAN 3DRPA 3QEPA 1LCUA 3WXLA 3VGKA 1J6ZA 2P9KA 1NOZA 3E9OA 3ZSXA 4M41A 4LH4A 3ULEB 1BA1A 2CH6A 2YV0X 1NMDA 4BQLA 4DSIA 1CZAN 3AO3A 1FKPA 1V4SA 3JYTA 3LP3A 3I8DA 4AHRA 2YNHA 4JAXA 3TAMA 4JKHA 4B9VA 1GLJO 2F8TA 2E2QA 5GAEP 5CR4A 4DWIA 3A8YA 3D45A 2Q36A 1GLDG 3JSMA 3NBPA 4MDAA 4NLCA 2O4IA 4E89A 4KH6A 4FJ7A 3BGRA 3G71N 3WXJA 1EETA 2GUIA 2ZQBA 4CJVA 3B6OA 2YKNA 4IG3A 3M8PA 1S1XA 2I7PA 2HHTA 3EN9A 3C65A 5KGXA 3P83D 3BZKA 1NGGA 1RDAA 1FJGK 3R9PA 1HNXK 2HVIA 1TUUA 3HSCA 5EOYA 4BWMA 4DTPA 1IBMK 5C12A 2JWLA 3A2FA 1RT5A 1KTQA 3CYMA 4H5RA 4NB4A 2JWKA 2E8AA 1JLGA 3IKMA 1Q18A 2XY5A 4CJUA 4BRQA 2Q0RA 4GKKK 4CECA 3N4QA 4H5NA 4CF9A 3FZFA 3AVCA 1MWMA 2KFZA 3KLFA 1SZ2A 4DU4A 4BRIA 3OYCA 3DM2A 4FVUA 1NJZA 2B4JA 3CCQN 2O8DB 4DU1A 4KKOA 3CI5A 5BPLA 1NU0A 1GLAG 1IKVA 3FFIA 1QSSA 3QNNA 2I5JA 2YNGA 1A5WA 4LF8K 4DQIA 1UOCA 4YDUA 3KLIA 5BRHA 5ELZA 1N5YA 1IG9A 4GW6A 4YHHK 2KQ2A 3VQ6A 1KAYA 3ZSQA 5AR0A 4B08A 5J1EA 4YOXA 1XWLA 3V1RA 4KHSA 3CXCM 5AZIB 5ADXA 4LFBK 2GV9A 1QSYA 3QBWA 1VSKA 4NO7A 3C6AA 4AH9A 3AO4A 3VEWA 5KPRA 4KHPK 1RBSA 2R7YA 1GLFO 3AVIA 2Q97A 2HF4A 2WONA 3T1AA 3VEYA 3V6DA 1TK8A 1JLBA 4LC9B 4ELTA 3LWMA 4B1WB 2OANA 3THYA 2E1YA 4BRFA 2HMIA 1VSHA 5E26A 5KRSA 3U6FA 3AA2A 5M1OA 2IVNA 4PKHA 3QEXA 4FK0A 3TI0A 3U9DA 2RKIA 3L4IA 2CH5A 2QWPA 1T05A 5H1SQ 3AO5A 3DLBA 3IAYA 4JKCA 3K2PA 3KIOA 3HL8A 5C2DA 4RCHA 3LP1A 5EVZA 4KHQA 3BDPA 1R59O 2P9KB 3ZT0A 1VQ7N 4KO0A 1NGBA 5SWMA 2ZJRL 4MFBA 5AZJA 5HRNA 3O80A 3EZWA 3OYEA 2YHAA 3Q7BA 1WN7A 4IXCA 3KD1E 5KRTA 4FK4A 3ENBA 1LW2A 3VA0A 1YVNA 1BWFO 1HNIA 4FJMA 1NOYA 1NG9A 3VQ9A 3AVLA 1ZYQA 5J2PA 1QVGM 1QHAA 4BR9A 1Y64A 3GG4A 3QBXA 2W40A 1A5XA 1JXEA 2YHBA 4WYBA 2ZJQL 3KKRA 3VQPA 3TWHA 1NGFA 3ZT2A 2UXCK 5J2QA 4AHTA 4WFNL 4AHUA 4JS4A 5A2QO 3TAQA 2VQEK 4CEDA 2VGNA 4K8XA 4DSEA 4C8KA 2QWOA 4KB0A 5E41A 5AQJA 2NRWA 3NFAA 3OA9A 5E84A 4CZMA 4B3SK 1H1VA 1WBBA 4B9TA 3SV4A 3V9ZA 4CHYA 3F2KA 4RG8A 2RHKA 4CJQA 2AA4A 1GLBG 4YOUA 3ZT3A 1C1AA 3J7AP 4CJWA 1OKJA 1Q9XA 4DUYK 4BGAA 3HP6A 1S6QA 3BY5A 1VQ8N 5SZTA 1MU2A 3P5JA 4DB3A 4QOZB 2P1JA 1RTHA 3DWLA 4DV5K 4FZXC 4BWJA 3QFUA 4M42A 3E01A 1BI4A 2HHQA 3K0SA 1VQ6N 4DQRA 4OLAA 3AVKA 4K43A 4JI2K 4JRPA 3PX4A 2O8CB 4DQQA 5EXWA 3AARA 1XHXA 1S72N 3IG1A 1W0HA 1S1UA 3V9WA 1UA1A 1EWRA 2JLEA 4LH5A 1WUAA 4JKDA 3NH0A 5I9EB 4DR1K 3CETA 1VRUA 4JI8K 1NNEA 2HHHK 1WAJA 1S1TA 3TANA 5JLHA 1YUWA 1VQNN 4V19S 4CE9A 1TK0A 5HRSA 2QK9A 1JCFA 1Q8IA 1QQMA 3MEDA 4IBNA 2Z1IA 3QNOA 1ZC6A 1ZBFA 3VQ8A 3QETA 4RW8A 3OW2M 2ITMA 1C1CA 3R8EA 3THYB 3WEEB 5FPEA 3RSEA 5GINA 3THWA 4AHCA 4KPYA 3VPZA 5AQHA 3J81O 4CJ4A 3OYAA 3CFPA 2PZSA 4B8AB 3EY1A 2BE2A 5AJ3K 1S6PA 5C2FA 1K8AO 5CZ1A 3LALA 5AQMA 2OPQA 4CI6A 3VGMA 3R1XA 3ATVA 2IS3A 2Z1HA 3OYHA 4FLWA 5M1KA 1WSFA 2NRVA 3MN7A 4JYAK 3CJ1A 3DXMA 2HHUA 5AZJB 5JLFA 2CGJA 4KH4A 3CMEN 4FJGA 2F7TA 1SAZA 3LP2A 1QQCA 1BOTO 4B9MA 3M1FA 3ZYYX 3PLAA 4CF2A 4OJRA 3VQ4A 2P9PA 4BR7A 3ID6A 3TTCA 3QIOA 1KVBA 3ZCMA 2E20A 4QAGA 2PY5A 4XH4A 3WXKA 4IJAA 3L8BA 4M3TA 3S9HA 3VTHA 2QTDA 1U49A 4J2EA 4U7BA 4CZJA 2NLXA 3DLKA 3L2RA 5J2MA 4FJ5A 1RT4A 4PL8A 1DEJA 4CEEA 1TKTA 3DYAA 2E1ZA 5HROA 4B9SA 4Q0BA 2NUBA 4CEFA 3AVHA 4H0PA 1IJJA 1T6DA 3AA3A 1HYZA 4FWLA 2P5GA 4FWMA 3F5TA 1EXQA 4BC5A 1JL1A 4XIUA 4WQ5A 3ULDA 5BRDA 4J2DA 4LF5K 1KAXA 4N56A 4JKGB 3OYKA 5DM7L 4WE1A 3BEXA 3HT3A 4CJFA 3NH1A 2FF3B 5CHIA 4FL9A 5BR9A 2VG5A 4FLTA 3ENHA 1JJ2M 1VHXA 5AQOA 1BCMA 3QFPA 2XO7A 4QS8A 2O8FB 1O1WA 3L2QA 3P1GA 3SCXA 4EHTA 2P9LA 4B1UB 3ULEA 2NRHA 4M3XA 4DTUA 1BI4B 1YVUA 4DV1K 4FZZA 3BF3A 3MEGA 3CCJN 3SUOA 4PHTX 4B9UA 3FFKB 1NGIA 2OZMA 2HNDA 4OVLA 4CJTA 3ZLJA 3DRSA 4ICLA 3ZSVA 4OKKA 3DJCA 1TKXA 3ID8A 4DKWA 1HNZK 1WNSA 2IDOA 3R6MA 4YY3K 2A1RA 4IEIA 2IAJA 4UY8O 5D3GA 4CK1A 1VQPN 4H5TA 3MN9A 3AVMA 4EHUA 3I0SA 3PX6A 1TL3A 4A5BA 4CZKA 1LAWA 2ZGZA 3TTFA 3HZ6A 5M1PA 3AVNA 2W42A 4BVOA 3J7YP 3OY9A 1WSEA 2DTUA 2BDPA 1A5VA 2A42A 1NGEA 3AAQA 4WF9L 4JV5K 1YJNN 1HRHA 1Z26A 4EZ9A 2F96A 3ZT4A 1KC8O 1G15A 4FZYA 2D0PA 3DMJA 2J4RA 3O9RA 5AQFA 5HRRA 4DR5K 3ZETA 1R0AA 2E88A 3FZLA 4CJKA 5JS2A 3CCRN 3SQ0A 5AQIA 2HMPA 2QXLA 3RMDA 4Z4CA 3R3LA 3VTIA 5LMNK 3O4NA 4DV3K 4E1JA 2O8DA 3DLEA 4M3UA 1DTQA 2YKMA 1HJOA 3SLCA 1EKEA 3T1YK 4F4KA 1TAUA 4FCYA 4FJ8A 3PO4A 3HYFA 3A5OC 5AQLA 3NGYA 3O8MA 4LF4K 4PQUA 1RT7A 1CZBA 4CW7B 4G9ZA 2OZSA 1I39A 3I8BA 3HK2A 3TSPA 4CGHA 4FLUA 1WB9A 1N8RO 1E3MA 2Y1JA 2QM1A 2ZWHA 3MK6A 5AQXA 4DLGA 5BPMA 5LJWA 4CEBA 2OCEA 4N5SA 4FXDA 4FOEA 5AZIA 3I55N 4EIAA 2ITGA 1WSHA 1JLAA 1CXQA 2XY6A 3SMPA 2D4WA 4IKFA 4JKFA 2FBYA 1XQSC 3O1WA 2D0OA 1RTDA 1RBVA 1RT3A 4FJ9A 4DTSA 4FK2A 2KFNA 3NAEA 4FJKA 1WSIA 3UKUB 1HMVA 3VQDA 5JICA 1KXPA 3QLHA 3HTVA 3KLGA 1SL0A 3VEVA 1BA0A 3L2WA 1M90O 2FSKA 4H0YB 3VMFB 4FM1A 4MO4A 2OPRA 1QVFM 1W9HA 4CJRA 1GOBA 3NGIA 3PIPL 1QSLA 2BANA 2BUPA 3AGKA 3HRGA 1DTTA 2X6SA 3UKRB 4A5AA 4BR5A 3VQ7A 1ESVA 4I9QA 4YORA 2OPPA 2Q3SA 2P9LB 3VETA 1K9MO 5M1FA 3MWPA 1LWFA 3HSTB 1VQMN 5FROA 3S3NA 1ITGA 1U45A 3PX0A 2UXDK 3QESA 4CD1A 5C0YA 3IDHA 3OJSA 2GWJA 1S3XA 2HNYA 1NK4A 3CPEA 2KTQA 1YTAA 1KSPA 2HVHA 4B1XB 4B1YB 1X1PA 1U48A 2WTUA 2X6NA 5IWAK 4AILC 3KK7A 3OYIA 2B5JA 5TKWA 3VQ5A 3G25A 4CBWA 1Q81O 4E3SA 1D9DA 4BE1A 3K58A 3SPZA 2QWQA 1B92A 1HPMA 3MECA 2EX3A 1ZXOA 4EP4A 4M7YA 3CJBA 1RCHA 3LL3A 4KRFA 5BR8K 5FPNA 1NK0A 3C7NB 2AJQA 4KBOA 2CGLA 3HI0A 1D4XA 4ILGB 2DPNA 3NF6A 4CD3A 2WOMA 4LF7K 2GX9A 1BU6O 2V51B 4FO0A 1HKGA 4IDKA 1KRPA 1RT2A 4BR0A 4FWKA 4CCHA 3ZETB 4RW6A 2F4VK 4DQSA 2FSNA 4BRMA 3HM8A 4PWDA 4FPAA 1X9MA 1L3TA 3VGLA 4LFCK 4BROA 4KHUA 1JXBA 5FPMA 2DFEA 3FZMA 3O9UA 3WXIA 4LSLA 3RVCA 2E6LA 4CZLA 3IUCA 3C95A 4RTFD 3L4QA 2A1SA 3SAHA 4BRCA 4DF8A 4M45A 2NZTA 3CM6A 4CFBA 3C94A 3DOLA 2O8CA 2VGMA 5C15A 1HLUA 1JLQA 3SI6A 1TVRA 1RT1A 5AQUA 3AO2A 4CJ3A 3D0PA 3JXUA 2GEMA 4ILHA 5HLFA 1BDGA 3CD6N 1E4GT 1QTMA 3CCVN 2YX6A 1X9SA 3EE8A 1FW6A 1LW0A 2HOEA 1TKDA 2OYQA 3WEEA 3HVTA 5AQSA 3MEEA 1J54A 4OO1J 4CZFA 5BPNA 3VENA 3CM5A 4M3YA 3MXJA 4WQ4A 2O8BA 3QO9A 2P9NA 3NCIA 1KLNA 2UUAK 4F2RA 1XNQK 4BC4A 4N41A 5F0XA 4BG9A 3MXIA 2D0CA 4ISEA 4DR7K 3LDPA 4J2BA 3SBTA 2ZM6K 4KHYA 1T7PA 1I3AA 1NGAA 5HRPA 3A5LC 3TSQA 1XI1A 3HO1A 5AQWA 3U3GA 2P9SA 1IG8A 4DLEA 4IG0A 4J8FA 3HP9A 3THVA 4H0XB 3LM9A 5J2NA 4O55A 3KKSA 4BDZA 4RW7A 4Q5VA 1L5UA 3ZX2A 2KLAA 1UA0A 4FYDA 3K59A 3AV9A 3T3FA 1VQ4N 1YJWN 5K14A 3C6TA 4JK9A 4W5QA 4C8LA 2G8UA 2WUSA 3RTVA 2KZMA 2WC9A 5C42A 2NRZA 1IKWA 5GADP 3I33A 1EWQA 1DGKN 3PSIA 3OYLA 4L8RB 2E2NA 4O4GA 3KK1A 4JI4K 4YOVA 2A41A 4FVMA 1MWKA 4JKGA 4DV0K 4AF1A 4KHNA 1WBDA 3EZ5A 3VN5A 1RDCA 1NK7A 4MDBA 1S5JA 1NMNA 1ILYA 4KH5A 1CLQA 1P90A 4B1ZA 2HHWA 3NVKA 4XH5A 1OH5A 3O9SA 5DMRA 2O8FA 4CZEA 4Z4GA 1IH7A 4IOCL 3IRXA 3O5BA 1RDBA 4K8ZA 2IOCA 1Z05A 4HHTA 4H4OA 3NF7A 2O8EA 4M7XA 1ATSA 5GIPA 4FWRA 4DQ8A 4OGCA 4LY7A 1ASUA 2D0BA 4FPBA 3DRRA
chains in the Genus database with same CATH topology
1VSDA 2KW4A 3ISNC 3QIPA 3NH2A 4M3WA 1BQNA 4M3XA 4DTUA 1BI4B 1YVUA 4PUOA 4B3OA 3T19A 4FZZA 1WSGA 4CERA 1HNVA 3TR8A 3V9SA 4DFMA 4DSKA 4FJHA 1RBRA 4FJNA 5CY4A 3MEGA 1TV6A 3ITHA 3DRPA 1S9EA 4CGIA 3QEPA 2G8KA 2QKKA 3SUOA 3RR7A 4B9UA 2HHVA 4JS5A 4FJJA 1QS4A 2OZMA 2HNDA 1U4BA 4OVLA 4CJTA 3DRSA 3LAMA 4ICLA 1SKSA 3ZSVA 1NOZA 3OS1A 1RNHA 4OKKA 3ZSXA 4BDYA 4M41A 1TKXA 4LH4A 4HUFA 4ELVA 2RN2A 2YV0X 5C24A 4CHZA 1WNSA 2IDOA 4AHVA 4KFBA 4DSIA 3AO3A 2A1RA 1L3VA 1FKPA 2IC3A 3JYTA 2IAJA 3LP3A 3I8DA 4AHRA 2YNHA 3KK3A 4KI6A 3TAMA 5D3GA 4B9VA 5FRMA 4N47A 4Z4EA 4CK1A 1REVA 3AVFA 2F8TA 3LPTA 4DTRA 2RF2A 3KTQA 3AVMA 4DWIA 1LAVA 3D45A 3I0SA 1TGOA 4CFCA 3RR8A 3JSMA 3PX6A 3NBPA 1GOCA 1TL3A 4IFYA 4CHQA 3HPOA 4CEAA 2O4IA 4E89A 1LAWA 3VA3A 4FJ7A 3OYFA 2VG6A 4F3TA 3K5NA 3BGRA 3AVNA 4B9LA 4PA1A 2BGGA 2W42A 2OPSA 3PY8A 1EETA 2GUIA 3AA4A 2ZQBA 4CJVA 3B6OA 4N76A 2YKNA 3OY9A 1WSEA 4IG3A 3M8PA 2DFHA 1S1XA 1A5VA 4CJ5A 2BDPA 2DTUA 4HCCA 2HHTA 1FK9A 4B8CA 4NCAA 5KGXA 1HRHA 3P83D 1Z26A 1WLJA 4BACA 2F96A 3ZT4A 3LAKA 4EZ9A 1G15A 4FZYA 1RDAA 1B9DA 3DMJA 5HRRA 1ZBUA 5JS1A 4NYFA 2D5RA 3HPGA 1R0AA 1NKEA 3OYMA 4CEZA 1NK9A 2HVIA 4CJKA 5JS2A 2PYLA 3SQ0A 4DTJA 4BWMA 1RBTA 1HJRA 3RMDA 4DTPA 4Z4CA 3QEVA 1ZBIA 4KHWA 3A2FA 1RT5A 1KTQA 3CYMA 3O4NA 3K5MA 3HJFA 3TAFA 3DLEA 1JLGA 1DLOA 4OKEA 1DTQA 5HP1A 1IKXA 3SV3A 2YKMA 5CZ2A 4M3UA 4F4KA 1EKEA 4Z4IA 3OYNA 1TAUA 4FCYA 2XY5A 4CJUA 4FJ8A 3PUFA 3PO4A 4EP5A 5HBMA 3HYFA 4CECA 3NDKA 3NGYA 2E6MA 4PQUA 4CEQA 4CF9A 4DTXA 1BIZA 1RT7A 1CZBA 3AVCA 3SNNA 2KFZA 3KLFA 2OZSA 3V9XA 1VSIA 4DU4A 4CIEA 1I39A 4TSXA 3ZSRA 3OYCA 4YFUA 2HNZA 3HK2A 3DM2A 4CGHA 4FLUA 4ID5A 1NJZA 2B4JA 2Y1JA 2FBTA 1BQMA 2DY4A 4DU1A 4KKOA 1IKVA 3FFIA 1C0MA 1QSSA 4DLGA 1JLEA 4FW2A 2Z1GA 4CEBA 3QNNA 2I5JA 4FM2A 4N5SA 1K6YA 4FXDA 1KVCA 4C8MA 4R5PA 2YNGA 2DFFA 4CIFA 3HM9A 2ATQA 1A5WA 3OVNA 1Q9YA 4DQIA 2ITGA 1UOCA 1WSHA 1SL2A 3KLEA 1NK8A 1JLAA 3KLIA 1CXQA 4B9NA 4CF1A 2XY6A 3VQEA 1N5YA 1IG9A 1D8YA 4GW6A 4KTWA 4CESA 4CJSA 3O3GA 2FBYA 4IKFA 1YT3A 2KQ2A 3VQ6A 3ZSQA 4DSLA 3AVAA 4B08A 5J1EA 1ASVA 4DSFA 1VK0A 1XWLA 1RTDA 4CGFA 2HB5A 3V1RA 4BDPA 4FJXA 4RW9A 2FBVA 1RBVA 1RT3A 1RTIA 4FJ9A 3NF8A 4KHSA 4DTSA 3TAGA 4FK2A 4Z0UA 3LANA 3LPUA 4CGGA 2KFNA 2GV9A 3SPYA 1QSYA 3NAEA 2P5OA 4H4MA 4FJKA 1VSKA 4I2PA 1WSIA 4AH9A 1HMVA 3VQDA 3QLHA 3KLGA 3AO4A 1SL0A 2X74A 3L2WA 1UWBA 2ZD1A 1RBSA 4GVMA 2R7YA 4OPKA 4FM1A 2OPRA 3LZIA 2XRIA 3AVIA 3ASMA 1W9HA 2ZE2A 2VWJA 4CJRA 4HCBA 2WONA 3RMAA 3MAQA 1GOBA 3NGIA 3IS9A 3T1AA 3TAEA 3V6DA 1TK8A 1JLBA 2BANA 3SQ2A 2VG7A 1DTTA 2X6SA 3LWMA 1QSLA 4ELTA 3KJVA 4DFJA 4C8OA 3VQ7A 2JGUA 4CGJA 3VQAA 1N6QA 4I9QA 2OPPA 2Q3SA 1LV5A 1RTJA 2HMIA 3DOKA 1VSHA 5KRSA 3U6FA 4HUEA 3AA2A 3RMBA 3VQQA 4DG1A 1LWFA 3F73A 3HSTB 5FROA 3QEXA 4FK0A 1HPZA 3S3NA 1ITGA 3TI0A 3AVBA 4E1NA 2RKIA 5CYMA 1U45A 1T05A 3AO5A 3WNFA 3PX0A 3DLBA 4Y1DA 3IAYA 3QESA 3K2PA 3QERA 3OJSA 3KIOA 3HL8A 4FLYA 4C8NA 3LP1A 3AO1A 3LP0A 4DFKA 2HNYA 3ZSWA 1NK4A 1SKRA 3BDPA 3F9KA 4KHQA 2KTQA 1KCFA 1YTAA 3ZT0A 1NJYA 4W5OA 4KO0A 3O3FA 1TK5A 1UAXA 1KSPA 1X1PA 2HVHA 1SUQA 1VRTA 5SWMA 4E0DA 1U48A 1B9FA 2X6NA 4MFBA 3MXMA 4FLZA 3KD5E 1L3SA 3DLGA 5HRNA 3OYEA 4AILC 1U47A 4E7KA 1FKOA 2YHAA 3OYIA 3CQ8A 2B5JA 1WN7A 3KD1E 3VQ5A 1BL3A 5KRTA 2XHBA 4FK4A 1F21A 1LW2A 3DLRA 1BHLA 3VA0A 4E7IA 1YTUA 2X78A 1HNIA 4FJMA 4E3SA 1NOYA 3VQ9A 3AVLA 1D9DA 4F3OA 4M3ZA 4BE1A 3K58A 4DTMA 3SPZA 4OPJA 1ZYQA 2HHSA 5J2PA 3EYZA 1B92A 1KFSA 4HVJA 1S9GA 1BCOA 3NE6A 3MECA 5CYQA 4CK2A 1A5XA 1JXEA 2EX3A 3V9UA 3H08A 2YHBA 4EP4A 1XC9A 4E7LA 4O0JA 3ALYA 3NGZA 1RCHA 2XY8A 4KRFA 3I0RA 1NK0A 2AJQA 3U3YA 3KKRA 3VQPA 1KFDA 3TWHA 3ZT2A 5J2QA 4AHTA 1JLCA 3NF6A 2WOMA 1HYVA 4EZ6A 3L3UA 1XHZA 4W5NA 4NCBA 4IDKA 2QXFA 4AHUA 1RT2A 3V81A 1KRPA 3L3VA 4JS4A 4CCHA 3TAQA 4RW6A 4CHNA 3PV8A 1TL1A 4CEDA 1NKBA 4K8XA 4DQSA 4DSEA 2FBXA 4C8KA 1VSFA 3K5LA 4KB0A 4GMJB 5E41A 4PWDA 1L3TA 1X9MA 5FRNA 1SV5A 3S3OA 3NFAA 4G1QA 4DU3A 1JL2A 3WNEA 4CK3A 4UQGA 1J53A 4CHOA 1NK5A 1BISA 3OYGA 3SV4A 2G8VA 3V9ZA 4B9TA 4KHUA 1Y97A 4CHYA 2P51A 1JXBA 5FDLA 2DFEA 3ZSOA 1KVAA 4BE0A 4M3RA 3TARA 4B9SA 1GOAA 4RG8A 4BE2A 4LSLA 1IKYA 2E6LA 2D0AA 4CJQA 3C95A 2A1SA 4CJLA 3ZT3A 1C1AA 3CG7A 4CJWA 3AA5X 4DF8A 4M45A 1Q9XA 3CM6A 4CFBA 3C94A 4NYNA 4LSNA 3DOLA 5T7BA 3LWLA 4O5BA 3LDSA 4E7JA 3DLHA 3HP6A 3OJUA 1S6QA 1JLFA 4Y1CA 3CFOA 5SZTA 1JLQA 1MU2A 1Z25A 3P5JA 3NHGA 4CGDA 2OA8A 4QOZB 4O44A 2P1JA 3SI6A 4FLVA 3B6PA 1RTHA 2Z1JA 1TVRA 1RT1A 4DMNA 1L3UA 4E19A 4FZXC 3AO2A 4CJ3A 3OYDA 3WNHA 4CF0A 3D0PA 4OKJA 4BWJA 5HLFA 4M42A 3E01A 1BI4A 2HHQA 5C25A 4ZTFA 1TKZA 4FW1A 3OYJA 4DQRA 4OLAA 1QTMA 4NCGA 1LWCA 3ZT1A 3L2UA 3AVKA 4FJIA 1T03A 4JRPA 1X9SA 3PX4A 3ZSZA 2HHXA 4Z4HA 3M8SA 1LW0A 4DQQA 1NKCA 5KGWA 1XHXA 3IG1A 1W0HA 1TKDA 1QE1A 1S1UA 3V1OA 2OYQA 3V9WA 4HUGA 1UA1A 3C6UA 3RWUA 3HVTA 4CIGA 1NK6A 2JLEA 4I7FA 1EP4A 1C0TA 1HQUA 4LH5A 3NH0A 4KAZA 3SZ2A 3MEEA 3ZSYA 3SJJA 1WAFA 1J54A 1EX4A 1BGXT 1VRUA 3CFRA 3CM5A 2PYJA 4CFAA 1D9FA 4FLXA 4ZHRA 4M3YA 3QEWA 1WAJA 4Z4FA 2E4LA 1S1TA 3MXJA 3TANA 3HPHA 1C6VA 4CE9A 1TK0A 5HRSA 2QK9A 1Q8IA 3SUPA 4CJEA 1D5AA 1X9WA 2G8HA 3MEDA 3RRGA 4IBNA 2Z1IA 3QNOA 3QO9A 4KI4A 1ZBFA 2IGIA 3VQ8A 3OYBA 3NCIA 4RW8A 4JRQA 3QETA 1IO2A 1KLNA 4F2RA 1C1CA 4N41A 1ZBHA 3HXMA 3MXIA 2D0CA 4AHCA 4FM0A 4CF8A 1JKHA 4ID1A 4J2BA 4KPYA 2KZZA 4AHSA 3KLHA 2LSNA 3RRHA 4CJ4A 3OYAA 3L2VA 3CFPA 4KHYA 2O4GA 4B8AB 2PZSA 3EY1A 2BE2A 1RBUA 1S6PA 1T7PA 5I3UA 1RT6A 5CZ1A 3LALA 4JLHA 1I3AA 5HRPA 3K5OA 1FXXA 1RDDA 2OPQA 3SUNA 4RW4A 1XI1A 3HO1A 4H8KA 1QHTA 1BIUA 4OGEA 4O0IA 2FC0A 2IS3A 2Z1HA 3AVGA 3U3GA 3OYHA 4FLWA 1WSFA 4I2QA 1T8EA 4E7HA 4DF4A 1SKWA 4DLEA 4IG0A 2HHUA 1RILA 1C0UA 3HP9A 3G0ZA 4KV8A 4MQ3A 4CFDA 4F8RA 3M8RA 3HVRA 3THVA 3LZJA 2HW3A 3VQCA 5J2NA 3G10A 4O55A 3S3MA 3KKSA 4BDZA 4FJGA 3WNGA 4RW7A 1NJXA 4Q5VA 3OS0A 1L5UA 3AVJA 3LP2A 1TAQA 1UA0A 5DK5A 2QKBA 4FYDA 1QQCA 3K59A 4B9MA 3UIQA 3AV9A 1VSMA 3T3FA 5K14A 4CF2A 4ZTJA 4I9LA 2GBZA 3C6TA 4OJRA 3VQ4A 4W5RA 3SUQA 1HQEA 3SYZA 4W5QA 4C8LA 3QIOA 3QEIA 1KVBA 3ZCMA 3RTVA 2YNFA 2G8UA 2KZMA 5C42A 5KI6A 4QAGA 4YNQA 2PY5A 3NF9A 1IKWA 3L8BA 2VWKA 4M3TA 3S9HA 2G8IA 3SQ1A 2XY7A 4KREA 1U49A 3OYLA 4J2EA 4L8RB 4DTNA 4O4GA 3KK2A 3KK1A 3PO5A 3VQBA 1SL1A 1WSJA 3DLKA 3L2RA 2ETJA 5J2MA 2G8WA 4F2SA 4FJ5A 1RT4A 4FJLA 3M8QA 1CZ9A 4DQPA 4CEEA 4FVMA 1TKTA 1VSEA 4CJPA 3DYAA 3O4QA 4KHNA 2G8FA 3V1QA 3VN5A 3OS2A 3EZ5A 4CHPA 2NUBA 4CEFA 1RDCA 3AVHA 4DS4A 5HROA 4W5TA 1NK7A 3AA3A 3TAPA 1HYZA 1S5JA 2P5GA 1CLQA 1EXQA 1HYSA 3K57A 4PY5A 1JL1A 4XIUA 1LWEA 4DFPA 1S1VA 2HHWA 3ULDA 1ZBLA 2EHGA 4J2DA 4DSJA 1U04A 4N56A 2Y1IA 4E1MA 5DMRA 3TABA 3V4IA 3OYKA 4CEOA 1CXUA 4WE1A 3HT3A 4OLBA 2B6AA 1C1BA 1KLMA 4CJFA 4Z4GA 1IH7A 1S1WA 3NH1A 4LD0A 1NJWA 4Q0BA 4ELUA 5I42A 3IRXA 1RDBA 1VSLA 3DI6A 4KTQA 5KTQA 4K8ZA 1ASWA 2IOCA 1J5OA 3SQ4A 4HHTA 5EU7A 4H4OA 3NF7A 4DS5A 4KTZA 2VG5A 4J2AA 4FLTA 3O3HA 4OGCA 2XO7A 4KB1A 1BCMA 1VSJA 2RPIA 4HTUA 3RMCA 4QCLA 3QINA 4IFVA 4LY7A 1O1WA 2YNIA 1ASUA 2D0BA 3L2QA 4DTOA 3P1GA 2F8SA 3DRRA 3SCXA 1J9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSD A;  2KW4 A;  3ISN C;  3QIP A;  3NH2 A;  4M3W A;  1BQN A;  4M3X A;  4DTU A;  1BI4 B;  1YVU A;  4PUO A;  4B3O A;  3T19 A;  4FZZ A;  1WSG A;  4CER A;  1HNV A;  3TR8 A;  3V9S A;  4DFM A;  4DSK A;  4FJH A;  1RBR A;  4FJN A;  5CY4 A;  3MEG A;  1TV6 A;  3ITH A;  3DRP A;  1S9E A;  4CGI A;  3QEP A;  2G8K A;  2QKK A;  3SUO A;  3RR7 A;  4B9U A;  2HHV A;  4JS5 A;  4FJJ A;  1QS4 A;  2OZM A;  2HND A;  1U4B A;  4OVL A;  4CJT A;  3DRS A;  3LAM A;  4ICL A;  1SKS A;  3ZSV A;  1NOZ A;  3OS1 A;  1RNH A;  4OKK A;  3ZSX A;  4BDY A;  4M41 A;  1TKX A;  4LH4 A;  4HUF A;  4ELV A;  2RN2 A;  2YV0 X;  5C24 A;  4CHZ A;  1WNS A;  2IDO A;  4AHV A;  4KFB A;  4DSI A;  3AO3 A;  2A1R A;  1L3V A;  1FKP A;  2IC3 A;  3JYT A;  2IAJ A;  3LP3 A;  3I8D A;  4AHR A;  2YNH A;  3KK3 A;  4KI6 A;  3TAM A;  5D3G A;  4B9V A;  5FRM A;  4N47 A;  4Z4E A;  4CK1 A;  1REV A;  3AVF A;  2F8T A;  3LPT A;  4DTR A;  2RF2 A;  3KTQ A;  3AVM A;  4DWI A;  1LAV A;  3D45 A;  3I0S A;  1TGO A;  4CFC A;  3RR8 A;  3JSM A;  3PX6 A;  3NBP A;  1GOC A;  1TL3 A;  4IFY A;  4CHQ A;  3HPO A;  4CEA A;  2O4I A;  4E89 A;  1LAW A;  3VA3 A;  4FJ7 A;  3OYF A;  2VG6 A;  4F3T A;  3K5N A;  3BGR A;  3AVN A;  4B9L A;  4PA1 A;  2BGG A;  2W42 A;  2OPS A;  3PY8 A;  1EET A;  2GUI A;  3AA4 A;  2ZQB A;  4CJV A;  3B6O A;  4N76 A;  2YKN A;  3OY9 A;  1WSE A;  4IG3 A;  3M8P A;  2DFH A;  1S1X A;  1A5V A;  4CJ5 A;  2BDP A;  2DTU A;  4HCC A;  2HHT A;  1FK9 A;  4B8C A;  4NCA A;  5KGX A;  1HRH A;  3P83 D;  1Z26 A;  1WLJ A;  4BAC A;  2F96 A;  3ZT4 A;  3LAK A;  4EZ9 A;  1G15 A;  4FZY A;  1RDA A;  1B9D A;  3DMJ A;  5HRR A;  1ZBU A;  5JS1 A;  4NYF A;  2D5R A;  3HPG A;  1R0A A;  1NKE A;  3OYM A;  4CEZ A;  1NK9 A;  2HVI A;  4CJK A;  5JS2 A;  2PYL A;  3SQ0 A;  4DTJ A;  4BWM A;  1RBT A;  1HJR A;  3RMD A;  4DTP A;  4Z4C A;  3QEV A;  1ZBI A;  4KHW A;  3A2F A;  1RT5 A;  1KTQ A;  3CYM A;  3O4N A;  3K5M A;  3HJF A;  3TAF A;  3DLE A;  1JLG A;  1DLO A;  4OKE A;  1DTQ A;  5HP1 A;  1IKX A;  3SV3 A;  2YKM A;  5CZ2 A;  4M3U A;  4F4K A;  1EKE A;  4Z4I A;  3OYN A;  1TAU A;  4FCY A;  2XY5 A;  4CJU A;  4FJ8 A;  3PUF A;  3PO4 A;  4EP5 A;  5HBM A;  3HYF A;  4CEC A;  3NDK A;  3NGY A;  2E6M A;  4PQU A;  4CEQ A;  4CF9 A;  4DTX A;  1BIZ A;  1RT7 A;  1CZB A;  3AVC A;  3SNN A;  2KFZ A;  3KLF A;  2OZS A;  3V9X A;  1VSI A;  4DU4 A;  4CIE A;  1I39 A;  4TSX A;  3ZSR A;  3OYC A;  4YFU A;  2HNZ A;  3HK2 A;  3DM2 A;  4CGH A;  4FLU A;  4ID5 A;  1NJZ A;  2B4J A;  2Y1J A;  2FBT A;  1BQM A;  2DY4 A;  4DU1 A;  4KKO A;  1IKV A;  3FFI A;  1C0M A;  1QSS A;  4DLG A;  1JLE A;  4FW2 A;  2Z1G A;  4CEB A;  3QNN A;  2I5J A;  4FM2 A;  4N5S A;  1K6Y A;  4FXD A;  1KVC A;  4C8M A;  4R5P A;  2YNG A;  2DFF A;  4CIF A;  3HM9 A;  2ATQ A;  1A5W A;  3OVN A;  1Q9Y A;  4DQI A;  2ITG A;  1UOC A;  1WSH A;  1SL2 A;  3KLE A;  1NK8 A;  1JLA A;  3KLI A;  1CXQ A;  4B9N A;  4CF1 A;  2XY6 A;  3VQE A;  1N5Y A;  1IG9 A;  1D8Y A;  4GW6 A;  4KTW A;  4CES A;  4CJS A;  3O3G A;  2FBY A;  4IKF A;  1YT3 A;  2KQ2 A;  3VQ6 A;  3ZSQ A;  4DSL A;  3AVA A;  4B08 A;  5J1E A;  1ASV A;  4DSF A;  1VK0 A;  1XWL A;  1RTD A;  4CGF A;  2HB5 A;  3V1R A;  4BDP A;  4FJX A;  4RW9 A;  2FBV A;  1RBV A;  1RT3 A;  1RTI A;  4FJ9 A;  3NF8 A;  4KHS A;  4DTS A;  3TAG A;  4FK2 A;  4Z0U A;  3LAN A;  3LPU A;  4CGG A;  2KFN A;  2GV9 A;  3SPY A;  1QSY A;  3NAE A;  2P5O A;  4H4M A;  4FJK A;  1VSK A;  4I2P A;  1WSI A;  4AH9 A;  1HMV A;  3VQD A;  3QLH A;  3KLG A;  3AO4 A;  1SL0 A;  2X74 A;  3L2W A;  1UWB A;  2ZD1 A;  1RBS A;  4GVM A;  2R7Y A;  4OPK A;  4FM1 A;  2OPR A;  3LZI A;  2XRI A;  3AVI A;  3ASM A;  1W9H A;  2ZE2 A;  2VWJ A;  4CJR A;  4HCB A;  2WON A;  3RMA A;  3MAQ A;  1GOB A;  3NGI A;  3IS9 A;  3T1A A;  3TAE A;  3V6D A;  1TK8 A;  1JLB A;  2BAN A;  3SQ2 A;  2VG7 A;  1DTT A;  2X6S A;  3LWM A;  1QSL A;  4ELT A;  3KJV A;  4DFJ A;  4C8O A;  3VQ7 A;  2JGU A;  4CGJ A;  3VQA A;  1N6Q A;  4I9Q A;  2OPP A;  2Q3S A;  1LV5 A;  1RTJ A;  2HMI A;  3DOK A;  1VSH A;  5KRS A;  3U6F A;  4HUE A;  3AA2 A;  3RMB A;  3VQQ A;  4DG1 A;  1LWF A;  3F73 A;  3HST B;  5FRO A;  3QEX A;  4FK0 A;  1HPZ A;  3S3N A;  1ITG A;  3TI0 A;  3AVB A;  4E1N A;  2RKI A;  5CYM A;  1U45 A;  1T05 A;  3AO5 A;  3WNF A;  3PX0 A;  3DLB A;  4Y1D A;  3IAY A;  3QES A;  3K2P A;  3QER A;  3OJS A;  3KIO A;  3HL8 A;  4FLY A;  4C8N A;  3LP1 A;  3AO1 A;  3LP0 A;  4DFK A;  2HNY A;  3ZSW A;  1NK4 A;  1SKR A;  3BDP A;  3F9K A;  4KHQ A;  2KTQ A;  1KCF A;  1YTA A;  3ZT0 A;  1NJY A;  4W5O A;  4KO0 A;  3O3F A;  1TK5 A;  1UAX A;  1KSP A;  1X1P A;  2HVH A;  1SUQ A;  1VRT A;  5SWM A;  4E0D A;  1U48 A;  1B9F A;  2X6N A;  4MFB A;  3MXM A;  4FLZ A;  3KD5 E;  1L3S A;  3DLG A;  5HRN A;  3OYE A;  4AIL C;  1U47 A;  4E7K A;  1FKO A;  2YHA A;  3OYI A;  3CQ8 A;  2B5J A;  1WN7 A;  3KD1 E;  3VQ5 A;  1BL3 A;  5KRT A;  2XHB A;  4FK4 A;  1F21 A;  1LW2 A;  3DLR A;  1BHL A;  3VA0 A;  4E7I A;  1YTU A;  2X78 A;  1HNI A;  4FJM A;  4E3S A;  1NOY A;  3VQ9 A;  3AVL A;  1D9D A;  4F3O A;  4M3Z A;  4BE1 A;  3K58 A;  4DTM A;  3SPZ A;  4OPJ A;  1ZYQ A;  2HHS A;  5J2P A;  3EYZ A;  1B92 A;  1KFS A;  4HVJ A;  1S9G A;  1BCO A;  3NE6 A;  3MEC A;  5CYQ A;  4CK2 A;  1A5X A;  1JXE A;  2EX3 A;  3V9U A;  3H08 A;  2YHB A;  4EP4 A;  1XC9 A;  4E7L A;  4O0J A;  3ALY A;  3NGZ A;  1RCH A;  2XY8 A;  4KRF A;  3I0R A;  1NK0 A;  2AJQ A;  3U3Y A;  3KKR A;  3VQP A;  1KFD A;  3TWH A;  3ZT2 A;  5J2Q A;  4AHT A;  1JLC A;  3NF6 A;  2WOM A;  1HYV A;  4EZ6 A;  3L3U A;  1XHZ A;  4W5N A;  4NCB A;  4IDK A;  2QXF A;  4AHU A;  1RT2 A;  3V81 A;  1KRP A;  3L3V A;  4JS4 A;  4CCH A;  3TAQ A;  4RW6 A;  4CHN A;  3PV8 A;  1TL1 A;  4CED A;  1NKB A;  4K8X A;  4DQS A;  4DSE A;  2FBX A;  4C8K A;  1VSF A;  3K5L A;  4KB0 A;  4GMJ B;  5E41 A;  4PWD A;  1L3T A;  1X9M A;  5FRN A;  1SV5 A;  3S3O A;  3NFA A;  4G1Q A;  4DU3 A;  1JL2 A;  3WNE A;  4CK3 A;  4UQG A;  1J53 A;  4CHO A;  1NK5 A;  1BIS A;  3OYG A;  3SV4 A;  2G8V A;  3V9Z A;  4B9T A;  4KHU A;  1Y97 A;  4CHY A;  2P51 A;  1JXB A;  5FDL A;  2DFE A;  3ZSO A;  1KVA A;  4BE0 A;  4M3R A;  3TAR A;  4B9S A;  1GOA A;  4RG8 A;  4BE2 A;  4LSL A;  1IKY A;  2E6L A;  2D0A A;  4CJQ A;  3C95 A;  2A1S A;  4CJL A;  3ZT3 A;  1C1A A;  3CG7 A;  4CJW A;  3AA5 X;  4DF8 A;  4M45 A;  1Q9X A;  3CM6 A;  4CFB A;  3C94 A;  4NYN A;  4LSN A;  3DOL A;  5T7B A;  3LWL A;  4O5B A;  3LDS A;  4E7J A;  3DLH A;  3HP6 A;  3OJU A;  1S6Q A;  1JLF A;  4Y1C A;  3CFO A;  5SZT A;  1JLQ A;  1MU2 A;  1Z25 A;  3P5J A;  3NHG A;  4CGD A;  2OA8 A;  4QOZ B;  4O44 A;  2P1J A;  3SI6 A;  4FLV A;  3B6P A;  1RTH A;  2Z1J A;  1TVR A;  1RT1 A;  4DMN A;  1L3U A;  4E19 A;  4FZX C;  3AO2 A;  4CJ3 A;  3OYD A;  3WNH A;  4CF0 A;  3D0P A;  4OKJ A;  4BWJ A;  5HLF A;  4M42 A;  3E01 A;  1BI4 A;  2HHQ A;  5C25 A;  4ZTF A;  1TKZ A;  4FW1 A;  3OYJ A;  4DQR A;  4OLA A;  1QTM A;  4NCG A;  1LWC A;  3ZT1 A;  3L2U A;  3AVK A;  4FJI A;  1T03 A;  4JRP A;  1X9S A;  3PX4 A;  3ZSZ A;  2HHX A;  4Z4H A;  3M8S A;  1LW0 A;  4DQQ A;  1NKC A;  5KGW A;  1XHX A;  3IG1 A;  1W0H A;  1TKD A;  1QE1 A;  1S1U A;  3V1O A;  2OYQ A;  3V9W A;  4HUG A;  1UA1 A;  3C6U A;  3RWU A;  3HVT A;  4CIG A;  1NK6 A;  2JLE A;  4I7F A;  1EP4 A;  1C0T A;  1HQU A;  4LH5 A;  3NH0 A;  4KAZ A;  3SZ2 A;  3MEE A;  3ZSY A;  3SJJ A;  1WAF A;  1J54 A;  1EX4 A;  1BGX T;  1VRU A;  3CFR A;  3CM5 A;  2PYJ A;  4CFA A;  1D9F A;  4FLX A;  4ZHR A;  4M3Y A;  3QEW A;  1WAJ A;  4Z4F A;  2E4L A;  1S1T A;  3MXJ A;  3TAN A;  3HPH A;  1C6V A;  4CE9 A;  1TK0 A;  5HRS A;  2QK9 A;  1Q8I A;  3SUP A;  4CJE A;  1D5A A;  1X9W A;  2G8H A;  3MED A;  3RRG A;  4IBN A;  2Z1I A;  3QNO A;  3QO9 A;  4KI4 A;  1ZBF A;  2IGI A;  3VQ8 A;  3OYB A;  3NCI A;  4RW8 A;  4JRQ A;  3QET A;  1IO2 A;  1KLN A;  4F2R A;  1C1C A;  4N41 A;  1ZBH A;  3HXM A;  3MXI A;  2D0C A;  4AHC A;  4FM0 A;  4CF8 A;  1JKH A;  4ID1 A;  4J2B A;  4KPY A;  2KZZ A;  4AHS A;  3KLH A;  2LSN A;  3RRH A;  4CJ4 A;  3OYA A;  3L2V A;  3CFP A;  4KHY A;  2O4G A;  4B8A B;  2PZS A;  3EY1 A;  2BE2 A;  1RBU A;  1S6P A;  1T7P A;  5I3U A;  1RT6 A;  5CZ1 A;  3LAL A;  4JLH A;  1I3A A;  5HRP A;  3K5O A;  1FXX A;  1RDD A;  2OPQ A;  3SUN A;  4RW4 A;  1XI1 A;  3HO1 A;  4H8K A;  1QHT A;  1BIU A;  4OGE A;  4O0I A;  2FC0 A;  2IS3 A;  2Z1H A;  3AVG A;  3U3G A;  3OYH A;  4FLW A;  1WSF A;  4I2Q A;  1T8E A;  4E7H A;  4DF4 A;  1SKW A;  4DLE A;  4IG0 A;  2HHU A;  1RIL A;  1C0U A;  3HP9 A;  3G0Z A;  4KV8 A;  4MQ3 A;  4CFD A;  4F8R A;  3M8R A;  3HVR A;  3THV A;  3LZJ A;  2HW3 A;  3VQC A;  5J2N A;  3G10 A;  4O55 A;  3S3M A;  3KKS A;  4BDZ A;  4FJG A;  3WNG A;  4RW7 A;  1NJX A;  4Q5V A;  3OS0 A;  1L5U A;  3AVJ A;  3LP2 A;  1TAQ A;  1UA0 A;  5DK5 A;  2QKB A;  4FYD A;  1QQC A;  3K59 A;  4B9M A;  3UIQ A;  3AV9 A;  1VSM A;  3T3F A;  5K14 A;  4CF2 A;  4ZTJ A;  4I9L A;  2GBZ A;  3C6T A;  4OJR A;  3VQ4 A;  4W5R A;  3SUQ A;  1HQE A;  3SYZ A;  4W5Q A;  4C8L A;  3QIO A;  3QEI A;  1KVB A;  3ZCM A;  3RTV A;  2YNF A;  2G8U A;  2KZM A;  5C42 A;  5KI6 A;  4QAG A;  4YNQ A;  2PY5 A;  3NF9 A;  1IKW A;  3L8B A;  2VWK A;  4M3T A;  3S9H A;  2G8I A;  3SQ1 A;  2XY7 A;  4KRE A;  1U49 A;  3OYL A;  4J2E A;  4L8R B;  4DTN A;  4O4G A;  3KK2 A;  3KK1 A;  3PO5 A;  3VQB A;  1SL1 A;  1WSJ A;  3DLK A;  3L2R A;  2ETJ A;  5J2M A;  2G8W A;  4F2S A;  4FJ5 A;  1RT4 A;  4FJL A;  3M8Q A;  1CZ9 A;  4DQP A;  4CEE A;  4FVM A;  1TKT A;  1VSE A;  4CJP A;  3DYA A;  3O4Q A;  4KHN A;  2G8F A;  3V1Q A;  3VN5 A;  3OS2 A;  3EZ5 A;  4CHP A;  2NUB A;  4CEF A;  1RDC A;  3AVH A;  4DS4 A;  5HRO A;  4W5T A;  1NK7 A;  3AA3 A;  3TAP A;  1HYZ A;  1S5J A;  2P5G A;  1CLQ A;  1EXQ A;  1HYS A;  3K57 A;  4PY5 A;  1JL1 A;  4XIU A;  1LWE A;  4DFP A;  1S1V A;  2HHW A;  3ULD A;  1ZBL A;  2EHG A;  4J2D A;  4DSJ A;  1U04 A;  4N56 A;  2Y1I A;  4E1M A;  5DMR A;  3TAB A;  3V4I A;  3OYK A;  4CEO A;  1CXU A;  4WE1 A;  3HT3 A;  4OLB A;  2B6A A;  1C1B A;  1KLM A;  4CJF A;  4Z4G A;  1IH7 A;  1S1W A;  3NH1 A;  4LD0 A;  1NJW A;  4Q0B A;  4ELU A;  5I42 A;  3IRX A;  1RDB A;  1VSL A;  3DI6 A;  4KTQ A;  5KTQ A;  4K8Z A;  1ASW A;  2IOC A;  1J5O A;  3SQ4 A;  4HHT A;  5EU7 A;  4H4O A;  3NF7 A;  4DS5 A;  4KTZ A;  2VG5 A;  4J2A A;  4FLT A;  3O3H A;  4OGC A;  2XO7 A;  4KB1 A;  1BCM A;  1VSJ A;  2RPI A;  4HTU A;  3RMC A;  4QCL A;  3QIN A;  4IFV A;  4LY7 A;  1O1W A;  2YNI A;  1ASU A;  2D0B A;  3L2Q A;  4DTO A;  3P1G A;  2F8S A;  3DRR A;  3SCX A;  1J9A A; 
#chains in the Genus database with same CATH topology
 5LMU K;  3ISN C;  5M1Q A;  3QIP A;  4JI1 K;  4M3W A;  1BQN A;  4B3O A;  4PUO A;  3CCL N;  3T19 A;  5KQD A;  1WSG A;  4FJH A;  4DSK A;  1DKG D;  4BR4 A;  2VWB A;  4XH1 A;  3CJ9 A;  5CY4 A;  3SMS A;  3ITH A;  1S9E A;  3RR7 A;  3TPQ A;  3VEX A;  1N33 K;  1GLL O;  3OS1 A;  3C6H A;  4YOY A;  4ELV A;  2RN2 A;  1X9J A;  1NGC A;  4KFB A;  1ZBS A;  1L3V A;  4MLE A;  4KI6 A;  5FRM A;  4N47 A;  1REV A;  3AVF A;  4DTR A;  2RF2 A;  1NWK A;  2O8B B;  1LAV A;  1YJ9 N;  3M5R A;  1QZ5 A;  2P9N B;  1GOC A;  4IFY A;  4CHQ A;  2FSJ A;  3K5N A;  2NRR A;  4B9L A;  4DV2 K;  1QQO A;  4PA1 A;  3PY8 A;  3QIC A;  4CJ5 A;  5CE3 A;  5BN9 A;  2DFH A;  3J80 O;  4HCC A;  4B8C A;  3KVG A;  4DR4 K;  4BAC A;  4M63 C;  2V52 B;  5GAG P;  2P9S B;  1ZBU A;  5C10 A;  1OVY A;  5JS1 A;  2ASM A;  4A57 A;  2D5R A;  3HPG A;  4FWO A;  3U9Z A;  4DTJ A;  4DV6 K;  2QWL A;  1RBT A;  1ZBI A;  4KHW A;  5AQQ A;  2NNW A;  1DLO A;  1IKX A;  3SV3 A;  3WUH A;  3OYN A;  4Z94 A;  5HBM A;  1YXQ A;  4DTX A;  1VSI A;  4CIE A;  1XUP O;  3ZSR A;  4YFU A;  2HNZ A;  1HKB A;  1T6C A;  4ID5 A;  4WQ5 C;  2FBT A;  1ATR A;  2DY4 A;  1YAG A;  2E5L K;  5JMV A;  1C0M A;  4FM2 A;  1K6Y A;  5AQV A;  1KVC A;  4C8M A;  2Q2R A;  4R5P A;  1VAZ A;  3GL1 A;  2VYP A;  4CIF A;  3KWG A;  2ATQ A;  1Q9Y A;  4CBU A;  3H46 O;  1JCE A;  1O13 A;  3UKU A;  4CJ7 A;  1NK8 A;  1MA9 B;  4A2B A;  1EO1 A;  4NXM K;  4B9N A;  3VQE A;  3WXM B;  1D8Y A;  4CES A;  4CJS A;  3O3G A;  4BC3 A;  1ASV A;  1VK0 A;  2VQF K;  4H03 B;  4X62 K;  3UKR A;  4OPH A;  3VEO A;  4CGF A;  4BDP A;  4RW9 A;  5FLX O;  3NF8 A;  1IBK K;  1IBL K;  3LPU A;  3ZX3 A;  3OTO K;  4H4M A;  3BZC A;  4I2P A;  4GVE A;  4JI6 K;  4GVM A;  2VCP A;  4IDH A;  5KPZ A;  2NRT A;  4OPK A;  2O8E B;  2XRI A;  3THX B;  3SQ2 A;  1YHQ N;  2VG7 A;  3EO3 A;  2OTL N;  3T1H K;  3FE1 A;  2ZGY A;  3PSF A;  2YHX A;  3D2E A;  3VQA A;  4CGJ A;  4X66 K;  1NM1 A;  1LV5 A;  1RTJ A;  3DOK A;  3CCM N;  1VQL N;  2GTD A;  3RMB A;  5BRF A;  4FOI A;  4DG1 A;  1HPZ A;  3P4I A;  1QZ6 A;  5LL6 Z;  1NJI O;  3T7Z A;  5CYM A;  4CVN E;  4JI7 K;  1KCF A;  4W5O A;  1UAX A;  1Q82 O;  1T3V A;  3D2F B;  3DXK A;  3WT0 A;  4BVP A;  1K73 O;  1B9F A;  4R79 A;  4MO5 A;  4LF6 K;  2HST A;  3J7Z O;  2FF6 A;  1L3S A;  3VOV A;  2UUB K;  1FKO A;  4O8K A;  3CQ8 A;  4B3T K;  3MX2 A;  4WFB L;  3C7N A;  2XHB A;  1BHL A;  3L0Q A;  3OBY A;  1C0G A;  4E7I A;  1YTU A;  4JNE A;  2EWS A;  3GBT A;  4F3O A;  4DTM A;  4OPA A;  4OPJ A;  2QA4 N;  4HVJ A;  1BCO A;  1Q86 O;  5EX5 A;  5CYQ A;  1JCG A;  3H08 A;  2YI1 A;  4E7L A;  2E2O A;  4O0J A;  3NGZ A;  1E4F T;  3U4L A;  2QEX N;  2XY8 A;  4IZ9 A;  4DV4 K;  3E66 A;  3I0R A;  3KHY A;  3U3Y A;  1XNR K;  1KFD A;  3QDK A;  4BRA A;  1JLC A;  4DR3 K;  1HYV A;  2WBN A;  3ZEU B;  3L3U A;  4EZ6 A;  1XHZ A;  4NCB A;  3V81 A;  3PV8 A;  4CHN A;  1NGJ A;  1TL1 A;  2FBX A;  3KWI A;  4CZG A;  3HOS A;  2BH1 A;  3K5L A;  4GMJ B;  5FRN A;  3NVM A;  4JK8 A;  4G1Q A;  4DU3 A;  1JL2 A;  2A5X A;  3K9J A;  4UQG A;  2UXB K;  1U2V A;  1NK5 A;  3OYG A;  4BC2 A;  1Y97 A;  3H6E A;  3ZSO A;  1KVA A;  4BE0 A;  4M3R A;  3TAR A;  1GOA A;  2D0A A;  3DAW A;  5LJV A;  3CG7 A;  3AA5 X;  4NLB A;  1VQO N;  4JN4 A;  3A5M C;  3MN5 A;  4EFH A;  4NYN A;  3LWL A;  4O5B A;  4E7J A;  1KQS M;  2E2P A;  3OJU A;  1JLF A;  4Y1C A;  3EL2 A;  4GV9 A;  3NHG A;  2OA8 A;  4O44 A;  4FLV A;  3B6P A;  2Z1J A;  1W7A A;  1L3U A;  3H3O B;  4OKJ A;  5AFU H;  3AGR A;  4ZTF A;  4FW1 A;  2UUC K;  3CER A;  4NCG A;  4IJN A;  3L2U A;  1N36 K;  3B8A X;  3E1Y A;  1T03 A;  3ZSZ A;  3EEQ A;  4H5W A;  2HHX A;  4JKE A;  3MWT A;  1QE1 A;  3C6U A;  4CIG A;  1NK6 A;  1EP4 A;  1BO5 O;  4BG8 A;  4KAZ A;  3SJJ A;  1EX4 A;  3FLC O;  1X3M A;  3CFR A;  5AQG A;  4CFA A;  3QEW A;  2A6A A;  4Z4F A;  2E4L A;  3HPH A;  5F1X A;  2QW9 A;  4B3R K;  5F2R A;  3SUP A;  1VQ9 N;  1D5A A;  2G8H A;  3RRG A;  4KI4 A;  2YHY A;  4ILJ A;  4JRQ A;  5DM6 L;  2HBJ A;  1ZBH A;  3O6W A;  3D2E B;  4GV6 A;  3HXM A;  3O9T A;  3CC7 N;  4FM0 A;  4CF8 A;  1JKH A;  4ID1 A;  5EY4 A;  3VF4 A;  2KZZ A;  5HOO A;  1OH6 A;  4AHS A;  2P9I B;  2LSN A;  5KPT A;  3RRH A;  2OTJ N;  3L2V A;  2O4G A;  1RBU A;  1TYQ A;  5I3U A;  4JLH A;  3CQX A;  3K5O A;  1FXX A;  1RDD A;  4JHD A;  5FPD A;  4RW4 A;  2GEL A;  4H8K A;  4BRP A;  1BIU A;  4OGE A;  2FC0 A;  4U67 L;  1T8E A;  3DXK B;  2ASP A;  1N32 K;  4DF4 A;  4CFD A;  3ZX0 A;  3G0Z A;  4MQ3 A;  2HW3 A;  3M8R A;  3VQC A;  3HOT A;  3G10 A;  3S3M A;  3WNG A;  1NBW A;  1NJX A;  4BY9 C;  3AVJ A;  2F9T A;  1GLC G;  5DK5 A;  3UIQ A;  1VSM A;  4ZTJ A;  4I9L A;  2GBZ A;  3MCA B;  3SUQ A;  4RWT A;  2YJF A;  1HQE A;  4DV7 K;  1LOT B;  3QEI A;  2YNF A;  2UYT A;  3NF9 A;  2G8I A;  2XY7 A;  4KRE A;  4DTN A;  1XC3 A;  1WSJ A;  2G8W A;  3CHW A;  3M8Q A;  3LDQ A;  4CJP A;  1RFQ A;  3O4Q A;  4BRG A;  2G8F A;  3CJA A;  4DS4 A;  4CHP A;  4DCH A;  1X3N A;  3TAP A;  4YDU C;  2I7N A;  3IFR A;  2KKZ A;  1RGI A;  4IEE A;  1G99 A;  3K57 A;  4ISF A;  1S1V A;  3OHR A;  1XMQ K;  5AQP A;  1U2V B;  2Q1N A;  4IWV A;  3S41 A;  3AAP A;  4E1M A;  4JI3 K;  4DUZ K;  4CEO A;  2IVP A;  1C1B A;  1KLM A;  1S1W A;  4LD0 A;  4ELU A;  2QWN A;  4YOW A;  3L6Q A;  1VSL A;  4BRN A;  4KTQ A;  4CBX A;  1J5O A;  4YOT A;  3SQ4 A;  4BRL A;  5EU7 A;  1RDW X;  2GUP A;  3MN6 A;  2IIR A;  3M3Z A;  2YHW A;  4KB1 A;  3RMC A;  4IFV A;  4DR2 K;  5LY3 A;  2YNI A;  4DTO A;  2WFB A;  4I6M B;  2F8S A;  3O08 A;  1VSD A;  2KW4 A;  3M6G A;  3NH2 A;  3BUZ B;  5BRE A;  1W2B M;  3CC4 N;  1HNV A;  3H3N O;  3CF5 L;  1YI2 N;  1RBR A;  4FJN A;  4WQ4 C;  4A61 A;  1HR0 K;  4CGI A;  2G8K A;  2QKK A;  1NGD A;  2HHV A;  4JS5 A;  3G6E N;  4FJJ A;  1QS4 A;  1U4B A;  3LAM A;  1SKS A;  5ADX H;  1HUX A;  1RNH A;  4JD2 B;  4BDY A;  4HUF A;  2YJE A;  4H0T B;  5C24 A;  4CHZ A;  4GNI A;  4A59 A;  4AHV A;  3VF6 A;  2IC3 A;  4CZH A;  3KK3 A;  4Z4E A;  3LPT A;  3KTQ A;  4F9O A;  5MLC Q;  1HKC A;  1TGO A;  4CFC A;  3RR8 A;  3HPO A;  5AQR A;  4CEA A;  3VA3 A;  3H1V X;  3OYF A;  2VG6 A;  4F3T A;  4AM6 A;  4JI5 K;  2BGG A;  2HF3 A;  2OPS A;  4B3M K;  2D1K A;  3AA4 A;  1T44 A;  4B9Q A;  4N76 A;  3CCU N;  5M1N A;  3UE5 A;  1FK9 A;  1TYQ B;  1J5E K;  4NCA A;  3CJC A;  1BUP A;  3H1Q A;  4JHD B;  3CC2 N;  4LFA K;  1WLJ A;  3KZB A;  3LAK A;  4O8U A;  1B9D A;  2ASO A;  4H0O A;  4NYF A;  1NKE A;  3OYM A;  4CEZ A;  1NK9 A;  3SAG A;  2PYL A;  4BGB A;  4DHY A;  1HJR A;  3HBT A;  3QEV A;  3BF1 A;  3K5M A;  3WQU A;  4GV3 A;  3TAF A;  5HP1 A;  4OKE A;  1GLE G;  4Z4I A;  2KHO A;  5CZ2 A;  1Q7Y O;  1QQN A;  3PUF A;  4EP5 A;  2QWR A;  3NDK A;  4JI0 K;  3CPW M;  2E6M A;  3SJH A;  4CEQ A;  1BIZ A;  4IFE A;  3SNN A;  3V9X A;  4TSX A;  2PBD A;  2ZJP L;  1BQM A;  5B8H A;  4BRH A;  1JLE A;  3SBG A;  2PFU A;  4FW2 A;  2Z1G A;  4K42 A;  3FGU A;  1RDU A;  2DFF A;  3HM9 A;  3OVN A;  1IV0 A;  1SL2 A;  3KLE A;  1W97 L;  4CF1 A;  4C1N I;  4FSV A;  3LDN A;  3THX A;  4KTW A;  1YT3 A;  3WQT A;  3MCP A;  4DSL A;  3AVA A;  4DSF A;  4WFA L;  2Q0U A;  2HB5 A;  3PIO L;  4XEI A;  4FJX A;  2FBV A;  1RTI A;  3EKU A;  3TAG A;  3MDQ A;  4Z0U A;  3JAM O;  3LAN A;  2V7Y A;  4CGG A;  4A2A A;  3OBW A;  3SPY A;  2P5O A;  1K8K A;  3A0I X;  2P9U A;  2X74 A;  1UWB A;  2ZD1 A;  3ATU A;  4H5V A;  2W6L A;  2BTF A;  3LZI A;  3ASM A;  2VWJ A;  2ZE2 A;  4HCB A;  4CZI A;  3RMA A;  3MAQ A;  3TAE A;  3IS9 A;  3ENO A;  1I94 K;  3KJV A;  4DFJ A;  4C8O A;  2JGU A;  1N34 K;  3NMU A;  1MDU B;  5KQ8 A;  1N6Q A;  1KAZ A;  3D2F A;  4BR2 A;  3CCE N;  4K25 A;  4X64 K;  2ZF5 O;  4HUE A;  3VQQ A;  3F73 A;  4FWQ A;  5JVG L;  3AVB A;  3K9K A;  4E1N A;  4QS7 A;  3WNF A;  4Y1D A;  1EQY A;  3CCS N;  3QER A;  3TSU A;  4FLY A;  3Q7C A;  4C8N A;  1ATN A;  2QWM A;  3AO1 A;  3LP0 A;  2GWK A;  3ZSW A;  4DFK A;  1SKR A;  3F9K A;  1NJY A;  2FLO A;  4WCE L;  2FXU A;  3O3F A;  1TK5 A;  1SUQ A;  1VRT A;  5BN8 A;  3P31 A;  4E0D A;  4QS9 A;  3MXM A;  4IOX A;  4L3Q A;  4FLZ A;  3KD5 E;  3P38 A;  4H0V B;  1KD1 O;  3DLG A;  1U47 A;  4E7K A;  3LM2 A;  3EKS A;  2H3G X;  4GY2 B;  1BL3 A;  1F21 A;  4JKB A;  4K0K K;  3DLR A;  2X78 A;  1XMO K;  3E9P A;  1DT9 A;  4M3Z A;  3ZEU A;  2HHS A;  3EYZ A;  1KFS A;  1S9G A;  3NE6 A;  3I56 N;  1Z6R A;  4CK2 A;  2A40 A;  3V9U A;  1XC9 A;  3ALY A;  3SK3 A;  3F9M A;  4PKG A;  3QB0 A;  4Y0W A;  4MLH A;  1OH8 A;  3LDO A;  4W5N A;  4B1V A;  2QXF A;  1SS6 A;  3EE9 A;  3L3V A;  3FZK A;  3D7E O;  2CGK A;  1NKB A;  3VER A;  1TUY A;  2IVO A;  4AQY K;  3MMV A;  1VSF A;  2NRX A;  1SV5 A;  3S3O A;  3CIP A;  3WNE A;  4CK3 A;  4JK7 A;  1J53 A;  3W3D A;  4CHO A;  1BIS A;  2G8V A;  2P51 A;  5FDL A;  2Q31 A;  1SQK A;  4IO9 L;  4BE2 A;  1IKY A;  4PL7 A;  3O4W A;  3DLL L;  4ISG A;  5AQZ A;  4CJL A;  4LSN A;  5AQT A;  5T7B A;  3LDS A;  3DLH A;  4EAH D;  3H45 C;  1U6Z A;  4BRE A;  3CFO A;  5HL7 L;  3GDQ A;  1Z25 A;  4JKA A;  4CGD A;  5AQY A;  4DMN A;  1VQ5 N;  4E19 A;  5TKY A;  4A62 A;  3OYD A;  3WNH A;  4CF0 A;  3QML A;  5C25 A;  1TKZ A;  3OYJ A;  1LWC A;  3ZT1 A;  4FJI A;  3VES A;  4Z4H A;  3M8S A;  1NKC A;  4FWP A;  5KGW A;  3SAF A;  3BP8 A;  3V1O A;  4HUG A;  3RWU A;  3LDL A;  4I7F A;  1YIT N;  1C0T A;  1HQU A;  3JS6 A;  5GAH P;  3SZ2 A;  1K8K B;  3ZSY A;  1WAF A;  2W6K A;  2F9W A;  2P9U B;  1BGX T;  2P9I A;  4HTL A;  1OH7 A;  2PYJ A;  1D9F A;  4FLX A;  4ZHR A;  1WOQ A;  1C6V A;  4DR6 K;  2UU9 K;  4CJE A;  1X9W A;  3U8X A;  2IGI A;  2W41 A;  3OYB A;  4NXN K;  2AP1 A;  1IO2 A;  4BRD A;  1HX1 A;  1M1K O;  3KLH A;  3VEZ A;  5AQK A;  1RT6 A;  2HBM A;  3C0B A;  3SUN A;  4FWN A;  3CJ7 A;  1QHT A;  4O0I A;  1C0F A;  2HBK A;  3AVG A;  3RSE B;  4JEP A;  4I2Q A;  3THW B;  4E7H A;  1SKW A;  5IT9 O;  1RIL A;  1C0U A;  2V7Z A;  4KV8 A;  4F8R A;  4BQZ A;  4PKI A;  1V4T A;  3HVR A;  3LZJ A;  5JVH L;  4C1N K;  3OS0 A;  3VF2 A;  1TAQ A;  2QKB A;  3FZH A;  1YIJ N;  3AY9 A;  4IOA L;  3G4S N;  4W5R A;  4OX9 K;  3O9Q A;  1BG3 A;  2PAV A;  3SYZ A;  4K41 A;  4O5F A;  3FR0 A;  4HWI A;  3DXM B;  3P39 A;  4FWS A;  1YF5 L;  5KI6 A;  4YNQ A;  2YCH A;  3GE1 A;  2VWK A;  3TTD A;  1NGH A;  3SQ1 A;  1NLV A;  3UB5 A;  3KK2 A;  3PO5 A;  1OVQ A;  3VQB A;  1SL1 A;  4F2S A;  4FJL A;  2ETJ A;  3O1B A;  1CZ9 A;  4DQP A;  1VSE A;  2P9P B;  3V1Q A;  3OS2 A;  5GIO A;  4GKJ K;  4W5T A;  5AFU A;  3GOI A;  3T69 A;  3J8A A;  2QI2 A;  1S22 A;  1HYS A;  3N4P A;  4PY5 A;  4BRK A;  1LWE A;  1HNW K;  4DFP A;  3E9L A;  1ZBL A;  2EHG A;  3TU5 A;  1P8Z A;  4DSJ A;  1U04 A;  3TAB A;  3CQY A;  2Y1I A;  2RE2 A;  3V4I A;  1CXU A;  4OLB A;  2B6A A;  4AM7 A;  4I6M A;  1NJW A;  5I42 A;  3D6R A;  3DI6 A;  5KTQ A;  1ASW A;  5AQN A;  3A5N C;  3W0L A;  4X65 K;  4DS5 A;  3IMX A;  4KTZ A;  4J2A A;  4IO8 A;  3O3H A;  4QCL A;  1VSJ A;  4HTU A;  2RPI A;  3QIN A;  1J9A A;  3HJF A;  4JD2 A;  2HBL A;  2A3Z A;  4CER A;  3V9S A;  3TR8 A;  4DFM A;  4C23 A;  3MX5 A;  4LF9 K;  1TV6 A;  1VQK N;  3CMA N;  3DRP A;  3QEP A;  1LCU A;  3WXL A;  3VGK A;  1J6Z A;  2P9K A;  1NOZ A;  3E9O A;  3ZSX A;  4M41 A;  4LH4 A;  3ULE B;  1BA1 A;  2CH6 A;  2YV0 X;  1NMD A;  4BQL A;  4DSI A;  1CZA N;  3AO3 A;  1FKP A;  1V4S A;  3JYT A;  3LP3 A;  3I8D A;  4AHR A;  2YNH A;  4JAX A;  3TAM A;  4JKH A;  4B9V A;  1GLJ O;  2F8T A;  2E2Q A;  5GAE P;  5CR4 A;  4DWI A;  3A8Y A;  3D45 A;  2Q36 A;  1GLD G;  3JSM A;  3NBP A;  4MDA A;  4NLC A;  2O4I A;  4E89 A;  4KH6 A;  4FJ7 A;  3BGR A;  3G71 N;  3WXJ A;  1EET A;  2GUI A;  2ZQB A;  4CJV A;  3B6O A;  2YKN A;  4IG3 A;  3M8P A;  1S1X A;  2I7P A;  2HHT A;  3EN9 A;  3C65 A;  5KGX A;  3P83 D;  3BZK A;  1NGG A;  1RDA A;  1FJG K;  3R9P A;  1HNX K;  2HVI A;  1TUU A;  3HSC A;  5EOY A;  4BWM A;  4DTP A;  1IBM K;  5C12 A;  2JWL A;  3A2F A;  1RT5 A;  1KTQ A;  3CYM A;  4H5R A;  4NB4 A;  2JWK A;  2E8A A;  1JLG A;  3IKM A;  1Q18 A;  2XY5 A;  4CJU A;  4BRQ A;  2Q0R A;  4GKK K;  4CEC A;  3N4Q A;  4H5N A;  4CF9 A;  3FZF A;  3AVC A;  1MWM A;  2KFZ A;  3KLF A;  1SZ2 A;  4DU4 A;  4BRI A;  3OYC A;  3DM2 A;  4FVU A;  1NJZ A;  2B4J A;  3CCQ N;  2O8D B;  4DU1 A;  4KKO A;  3CI5 A;  5BPL A;  1NU0 A;  1GLA G;  1IKV A;  3FFI A;  1QSS A;  3QNN A;  2I5J A;  2YNG A;  1A5W A;  4LF8 K;  4DQI A;  1UOC A;  4YDU A;  3KLI A;  5BRH A;  5ELZ A;  1N5Y A;  1IG9 A;  4GW6 A;  4YHH K;  2KQ2 A;  3VQ6 A;  1KAY A;  3ZSQ A;  5AR0 A;  4B08 A;  5J1E A;  4YOX A;  1XWL A;  3V1R A;  4KHS A;  3CXC M;  5AZI B;  5ADX A;  4LFB K;  2GV9 A;  1QSY A;  3QBW A;  1VSK A;  4NO7 A;  3C6A A;  4AH9 A;  3AO4 A;  3VEW A;  5KPR A;  4KHP K;  1RBS A;  2R7Y A;  1GLF O;  3AVI A;  2Q97 A;  2HF4 A;  2WON A;  3T1A A;  3VEY A;  3V6D A;  1TK8 A;  1JLB A;  4LC9 B;  4ELT A;  3LWM A;  4B1W B;  2OAN A;  3THY A;  2E1Y A;  4BRF A;  2HMI A;  1VSH A;  5E26 A;  5KRS A;  3U6F A;  3AA2 A;  5M1O A;  2IVN A;  4PKH A;  3QEX A;  4FK0 A;  3TI0 A;  3U9D A;  2RKI A;  3L4I A;  2CH5 A;  2QWP A;  1T05 A;  5H1S Q;  3AO5 A;  3DLB A;  3IAY A;  4JKC A;  3K2P A;  3KIO A;  3HL8 A;  5C2D A;  4RCH A;  3LP1 A;  5EVZ A;  4KHQ A;  3BDP A;  1R59 O;  2P9K B;  3ZT0 A;  1VQ7 N;  4KO0 A;  1NGB A;  5SWM A;  2ZJR L;  4MFB A;  5AZJ A;  5HRN A;  3O80 A;  3EZW A;  3OYE A;  2YHA A;  3Q7B A;  1WN7 A;  4IXC A;  3KD1 E;  5KRT A;  4FK4 A;  3ENB A;  1LW2 A;  3VA0 A;  1YVN A;  1BWF O;  1HNI A;  4FJM A;  1NOY A;  1NG9 A;  3VQ9 A;  3AVL A;  1ZYQ A;  5J2P A;  1QVG M;  1QHA A;  4BR9 A;  1Y64 A;  3GG4 A;  3QBX A;  2W40 A;  1A5X A;  1JXE A;  2YHB A;  4WYB A;  2ZJQ L;  3KKR A;  3VQP A;  3TWH A;  1NGF A;  3ZT2 A;  2UXC K;  5J2Q A;  4AHT A;  4WFN L;  4AHU A;  4JS4 A;  5A2Q O;  3TAQ A;  2VQE K;  4CED A;  2VGN A;  4K8X A;  4DSE A;  4C8K A;  2QWO A;  4KB0 A;  5E41 A;  5AQJ A;  2NRW A;  3NFA A;  3OA9 A;  5E84 A;  4CZM A;  4B3S K;  1H1V A;  1WBB A;  4B9T A;  3SV4 A;  3V9Z A;  4CHY A;  3F2K A;  4RG8 A;  2RHK A;  4CJQ A;  2AA4 A;  1GLB G;  4YOU A;  3ZT3 A;  1C1A A;  3J7A P;  4CJW A;  1OKJ A;  1Q9X A;  4DUY K;  4BGA A;  3HP6 A;  1S6Q A;  3BY5 A;  1VQ8 N;  5SZT A;  1MU2 A;  3P5J A;  4DB3 A;  4QOZ B;  2P1J A;  1RTH A;  3DWL A;  4DV5 K;  4FZX C;  4BWJ A;  3QFU A;  4M42 A;  3E01 A;  1BI4 A;  2HHQ A;  3K0S A;  1VQ6 N;  4DQR A;  4OLA A;  3AVK A;  4K43 A;  4JI2 K;  4JRP A;  3PX4 A;  2O8C B;  4DQQ A;  5EXW A;  3AAR A;  1XHX A;  1S72 N;  3IG1 A;  1W0H A;  1S1U A;  3V9W A;  1UA1 A;  1EWR A;  2JLE A;  4LH5 A;  1WUA A;  4JKD A;  3NH0 A;  5I9E B;  4DR1 K;  3CET A;  1VRU A;  4JI8 K;  1NNE A;  2HHH K;  1WAJ A;  1S1T A;  3TAN A;  5JLH A;  1YUW A;  1VQN N;  4V19 S;  4CE9 A;  1TK0 A;  5HRS A;  2QK9 A;  1JCF A;  1Q8I A;  1QQM A;  3MED A;  4IBN A;  2Z1I A;  3QNO A;  1ZC6 A;  1ZBF A;  3VQ8 A;  3QET A;  4RW8 A;  3OW2 M;  2ITM A;  1C1C A;  3R8E A;  3THY B;  3WEE B;  5FPE A;  3RSE A;  5GIN A;  3THW A;  4AHC A;  4KPY A;  3VPZ A;  5AQH A;  3J81 O;  4CJ4 A;  3OYA A;  3CFP A;  2PZS A;  4B8A B;  3EY1 A;  2BE2 A;  5AJ3 K;  1S6P A;  5C2F A;  1K8A O;  5CZ1 A;  3LAL A;  5AQM A;  2OPQ A;  4CI6 A;  3VGM A;  3R1X A;  3ATV A;  2IS3 A;  2Z1H A;  3OYH A;  4FLW A;  5M1K A;  1WSF A;  2NRV A;  3MN7 A;  4JYA K;  3CJ1 A;  3DXM A;  2HHU A;  5AZJ B;  5JLF A;  2CGJ A;  4KH4 A;  3CME N;  4FJG A;  2F7T A;  1SAZ A;  3LP2 A;  1QQC A;  1BOT O;  4B9M A;  3M1F A;  3ZYY X;  3PLA A;  4CF2 A;  4OJR A;  3VQ4 A;  2P9P A;  4BR7 A;  3ID6 A;  3TTC A;  3QIO A;  1KVB A;  3ZCM A;  2E20 A;  4QAG A;  2PY5 A;  4XH4 A;  3WXK A;  4IJA A;  3L8B A;  4M3T A;  3S9H A;  3VTH A;  2QTD A;  1U49 A;  4J2E A;  4U7B A;  4CZJ A;  2NLX A;  3DLK A;  3L2R A;  5J2M A;  4FJ5 A;  1RT4 A;  4PL8 A;  1DEJ A;  4CEE A;  1TKT A;  3DYA A;  2E1Z A;  5HRO A;  4B9S A;  4Q0B A;  2NUB A;  4CEF A;  3AVH A;  4H0P A;  1IJJ A;  1T6D A;  3AA3 A;  1HYZ A;  4FWL A;  2P5G A;  4FWM A;  3F5T A;  1EXQ A;  4BC5 A;  1JL1 A;  4XIU A;  4WQ5 A;  3ULD A;  5BRD A;  4J2D A;  4LF5 K;  1KAX A;  4N56 A;  4JKG B;  3OYK A;  5DM7 L;  4WE1 A;  3BEX A;  3HT3 A;  4CJF A;  3NH1 A;  2FF3 B;  5CHI A;  4FL9 A;  5BR9 A;  2VG5 A;  4FLT A;  3ENH A;  1JJ2 M;  1VHX A;  5AQO A;  1BCM A;  3QFP A;  2XO7 A;  4QS8 A;  2O8F B;  1O1W A;  3L2Q A;  3P1G A;  3SCX A;  4EHT A;  2P9L A;  4B1U B;  3ULE A;  2NRH A;  4M3X A;  4DTU A;  1BI4 B;  1YVU A;  4DV1 K;  4FZZ A;  3BF3 A;  3MEG A;  3CCJ N;  3SUO A;  4PHT X;  4B9U A;  3FFK B;  1NGI A;  2OZM A;  2HND A;  4OVL A;  4CJT A;  3ZLJ A;  3DRS A;  4ICL A;  3ZSV A;  4OKK A;  3DJC A;  1TKX A;  3ID8 A;  4DKW A;  1HNZ K;  1WNS A;  2IDO A;  3R6M A;  4YY3 K;  2A1R A;  4IEI A;  2IAJ A;  4UY8 O;  5D3G A;  4CK1 A;  1VQP N;  4H5T A;  3MN9 A;  3AVM A;  4EHU A;  3I0S A;  3PX6 A;  1TL3 A;  4A5B A;  4CZK A;  1LAW A;  2ZGZ A;  3TTF A;  3HZ6 A;  5M1P A;  3AVN A;  2W42 A;  4BVO A;  3J7Y P;  3OY9 A;  1WSE A;  2DTU A;  2BDP A;  1A5V A;  2A42 A;  1NGE A;  3AAQ A;  4WF9 L;  4JV5 K;  1YJN N;  1HRH A;  1Z26 A;  4EZ9 A;  2F96 A;  3ZT4 A;  1KC8 O;  1G15 A;  4FZY A;  2D0P A;  3DMJ A;  2J4R A;  3O9R A;  5AQF A;  5HRR A;  4DR5 K;  3ZET A;  1R0A A;  2E88 A;  3FZL A;  4CJK A;  5JS2 A;  3CCR N;  3SQ0 A;  5AQI A;  2HMP A;  2QXL A;  3RMD A;  4Z4C A;  3R3L A;  3VTI A;  5LMN K;  3O4N A;  4DV3 K;  4E1J A;  2O8D A;  3DLE A;  4M3U A;  1DTQ A;  2YKM A;  1HJO A;  3SLC A;  1EKE A;  3T1Y K;  4F4K A;  1TAU A;  4FCY A;  4FJ8 A;  3PO4 A;  3HYF A;  3A5O C;  5AQL A;  3NGY A;  3O8M A;  4LF4 K;  4PQU A;  1RT7 A;  1CZB A;  4CW7 B;  4G9Z A;  2OZS A;  1I39 A;  3I8B A;  3HK2 A;  3TSP A;  4CGH A;  4FLU A;  1WB9 A;  1N8R O;  1E3M A;  2Y1J A;  2QM1 A;  2ZWH A;  3MK6 A;  5AQX A;  4DLG A;  5BPM A;  5LJW A;  4CEB A;  2OCE A;  4N5S A;  4FXD A;  4FOE A;  5AZI A;  3I55 N;  4EIA A;  2ITG A;  1WSH A;  1JLA A;  1CXQ A;  2XY6 A;  3SMP A;  2D4W A;  4IKF A;  4JKF A;  2FBY A;  1XQS C;  3O1W A;  2D0O A;  1RTD A;  1RBV A;  1RT3 A;  4FJ9 A;  4DTS A;  4FK2 A;  2KFN A;  3NAE A;  4FJK A;  1WSI A;  3UKU B;  1HMV A;  3VQD A;  5JIC A;  1KXP A;  3QLH A;  3HTV A;  3KLG A;  1SL0 A;  3VEV A;  1BA0 A;  3L2W A;  1M90 O;  2FSK A;  4H0Y B;  3VMF B;  4FM1 A;  4MO4 A;  2OPR A;  1QVF M;  1W9H A;  4CJR A;  1GOB A;  3NGI A;  3PIP L;  1QSL A;  2BAN A;  2BUP A;  3AGK A;  3HRG A;  1DTT A;  2X6S A;  3UKR B;  4A5A A;  4BR5 A;  3VQ7 A;  1ESV A;  4I9Q A;  4YOR A;  2OPP A;  2Q3S A;  2P9L B;  3VET A;  1K9M O;  5M1F A;  3MWP A;  1LWF A;  3HST B;  1VQM N;  5FRO A;  3S3N A;  1ITG A;  1U45 A;  3PX0 A;  2UXD K;  3QES A;  4CD1 A;  5C0Y A;  3IDH A;  3OJS A;  2GWJ A;  1S3X A;  2HNY A;  1NK4 A;  3CPE A;  2KTQ A;  1YTA A;  1KSP A;  2HVH A;  4B1X B;  4B1Y B;  1X1P A;  1U48 A;  2WTU A;  2X6N A;  5IWA K;  4AIL C;  3KK7 A;  3OYI A;  2B5J A;  5TKW A;  3VQ5 A;  3G25 A;  4CBW A;  1Q81 O;  4E3S A;  1D9D A;  4BE1 A;  3K58 A;  3SPZ A;  2QWQ A;  1B92 A;  1HPM A;  3MEC A;  2EX3 A;  1ZXO A;  4EP4 A;  4M7Y A;  3CJB A;  1RCH A;  3LL3 A;  4KRF A;  5BR8 K;  5FPN A;  1NK0 A;  3C7N B;  2AJQ A;  4KBO A;  2CGL A;  3HI0 A;  1D4X A;  4ILG B;  2DPN A;  3NF6 A;  4CD3 A;  2WOM A;  4LF7 K;  2GX9 A;  1BU6 O;  2V51 B;  4FO0 A;  1HKG A;  4IDK A;  1KRP A;  1RT2 A;  4BR0 A;  4FWK A;  4CCH A;  3ZET B;  4RW6 A;  2F4V K;  4DQS A;  2FSN A;  4BRM A;  3HM8 A;  4PWD A;  4FPA A;  1X9M A;  1L3T A;  3VGL A;  4LFC K;  4BRO A;  4KHU A;  1JXB A;  5FPM A;  2DFE A;  3FZM A;  3O9U A;  3WXI A;  4LSL A;  3RVC A;  2E6L A;  4CZL A;  3IUC A;  3C95 A;  4RTF D;  3L4Q A;  2A1S A;  3SAH A;  4BRC A;  4DF8 A;  4M45 A;  2NZT A;  3CM6 A;  4CFB A;  3C94 A;  3DOL A;  2O8C A;  2VGM A;  5C15 A;  1HLU A;  1JLQ A;  3SI6 A;  1TVR A;  1RT1 A;  5AQU A;  3AO2 A;  4CJ3 A;  3D0P A;  3JXU A;  2GEM A;  4ILH A;  5HLF A;  1BDG A;  3CD6 N;  1E4G T;  1QTM A;  3CCV N;  2YX6 A;  1X9S A;  3EE8 A;  1FW6 A;  1LW0 A;  2HOE A;  1TKD A;  2OYQ A;  3WEE A;  3HVT A;  5AQS A;  3MEE A;  1J54 A;  4OO1 J;  4CZF A;  5BPN A;  3VEN A;  3CM5 A;  4M3Y A;  3MXJ A;  4WQ4 A;  2O8B A;  3QO9 A;  2P9N A;  3NCI A;  1KLN A;  2UUA K;  4F2R A;  1XNQ K;  4BC4 A;  4N41 A;  5F0X A;  4BG9 A;  3MXI A;  2D0C A;  4ISE A;  4DR7 K;  3LDP A;  4J2B A;  3SBT A;  2ZM6 K;  4KHY A;  1T7P A;  1I3A A;  1NGA A;  5HRP A;  3A5L C;  3TSQ A;  1XI1 A;  3HO1 A;  5AQW A;  3U3G A;  2P9S A;  1IG8 A;  4DLE A;  4IG0 A;  4J8F A;  3HP9 A;  3THV A;  4H0X B;  3LM9 A;  5J2N A;  4O55 A;  3KKS A;  4BDZ A;  4RW7 A;  4Q5V A;  1L5U A;  3ZX2 A;  2KLA A;  1UA0 A;  4FYD A;  3K59 A;  3AV9 A;  3T3F A;  1VQ4 N;  1YJW N;  5K14 A;  3C6T A;  4JK9 A;  4W5Q A;  4C8L A;  2G8U A;  2WUS A;  3RTV A;  2KZM A;  2WC9 A;  5C42 A;  2NRZ A;  1IKW A;  5GAD P;  3I33 A;  1EWQ A;  1DGK N;  3PSI A;  3OYL A;  4L8R B;  2E2N A;  4O4G A;  3KK1 A;  4JI4 K;  4YOV A;  2A41 A;  4FVM A;  1MWK A;  4JKG A;  4DV0 K;  4AF1 A;  4KHN A;  1WBD A;  3EZ5 A;  3VN5 A;  1RDC A;  1NK7 A;  4MDB A;  1S5J A;  1NMN A;  1ILY A;  4KH5 A;  1CLQ A;  1P90 A;  4B1Z A;  2HHW A;  3NVK A;  4XH5 A;  1OH5 A;  3O9S A;  5DMR A;  2O8F A;  4CZE A;  4Z4G A;  1IH7 A;  4IOC L;  3IRX A;  3O5B A;  1RDB A;  4K8Z A;  2IOC A;  1Z05 A;  4HHT A;  4H4O A;  3NF7 A;  2O8E A;  4M7X A;  1ATS A;  5GIP A;  4FWR A;  4DQ8 A;  4OGC A;  4LY7 A;  1ASU A;  2D0B A;  4FPB A;  3DRR A; 
#chains in the Genus database with same CATH homology
 1VSD A;  2KW4 A;  3ISN C;  3QIP A;  3NH2 A;  4M3W A;  1BQN A;  4M3X A;  4DTU A;  1BI4 B;  1YVU A;  4PUO A;  4B3O A;  3T19 A;  4FZZ A;  1WSG A;  4CER A;  1HNV A;  3TR8 A;  3V9S A;  4DFM A;  4DSK A;  4FJH A;  1RBR A;  4FJN A;  5CY4 A;  3MEG A;  1TV6 A;  3ITH A;  3DRP A;  1S9E A;  4CGI A;  3QEP A;  2G8K A;  2QKK A;  3SUO A;  3RR7 A;  4B9U A;  2HHV A;  4JS5 A;  4FJJ A;  1QS4 A;  2OZM A;  2HND A;  1U4B A;  4OVL A;  4CJT A;  3DRS A;  3LAM A;  4ICL A;  1SKS A;  3ZSV A;  1NOZ A;  3OS1 A;  1RNH A;  4OKK A;  3ZSX A;  4BDY A;  4M41 A;  1TKX A;  4LH4 A;  4HUF A;  4ELV A;  2RN2 A;  2YV0 X;  5C24 A;  4CHZ A;  1WNS A;  2IDO A;  4AHV A;  4KFB A;  4DSI A;  3AO3 A;  2A1R A;  1L3V A;  1FKP A;  2IC3 A;  3JYT A;  2IAJ A;  3LP3 A;  3I8D A;  4AHR A;  2YNH A;  3KK3 A;  4KI6 A;  3TAM A;  5D3G A;  4B9V A;  5FRM A;  4N47 A;  4Z4E A;  4CK1 A;  1REV A;  3AVF A;  2F8T A;  3LPT A;  4DTR A;  2RF2 A;  3KTQ A;  3AVM A;  4DWI A;  1LAV A;  3D45 A;  3I0S A;  1TGO A;  4CFC A;  3RR8 A;  3JSM A;  3PX6 A;  3NBP A;  1GOC A;  1TL3 A;  4IFY A;  4CHQ A;  3HPO A;  4CEA A;  2O4I A;  4E89 A;  1LAW A;  3VA3 A;  4FJ7 A;  3OYF A;  2VG6 A;  4F3T A;  3K5N A;  3BGR A;  3AVN A;  4B9L A;  4PA1 A;  2BGG A;  2W42 A;  2OPS A;  3PY8 A;  1EET A;  2GUI A;  3AA4 A;  2ZQB A;  4CJV A;  3B6O A;  4N76 A;  2YKN A;  3OY9 A;  1WSE A;  4IG3 A;  3M8P A;  2DFH A;  1S1X A;  1A5V A;  4CJ5 A;  2BDP A;  2DTU A;  4HCC A;  2HHT A;  1FK9 A;  4B8C A;  4NCA A;  5KGX A;  1HRH A;  3P83 D;  1Z26 A;  1WLJ A;  4BAC A;  2F96 A;  3ZT4 A;  3LAK A;  4EZ9 A;  1G15 A;  4FZY A;  1RDA A;  1B9D A;  3DMJ A;  5HRR A;  1ZBU A;  5JS1 A;  4NYF A;  2D5R A;  3HPG A;  1R0A A;  1NKE A;  3OYM A;  4CEZ A;  1NK9 A;  2HVI A;  4CJK A;  5JS2 A;  2PYL A;  3SQ0 A;  4DTJ A;  4BWM A;  1RBT A;  1HJR A;  3RMD A;  4DTP A;  4Z4C A;  3QEV A;  1ZBI A;  4KHW A;  3A2F A;  1RT5 A;  1KTQ A;  3CYM A;  3O4N A;  3K5M A;  3HJF A;  3TAF A;  3DLE A;  1JLG A;  1DLO A;  4OKE A;  1DTQ A;  5HP1 A;  1IKX A;  3SV3 A;  2YKM A;  5CZ2 A;  4M3U A;  4F4K A;  1EKE A;  4Z4I A;  3OYN A;  1TAU A;  4FCY A;  2XY5 A;  4CJU A;  4FJ8 A;  3PUF A;  3PO4 A;  4EP5 A;  5HBM A;  3HYF A;  4CEC A;  3NDK A;  3NGY A;  2E6M A;  4PQU A;  4CEQ A;  4CF9 A;  4DTX A;  1BIZ A;  1RT7 A;  1CZB A;  3AVC A;  3SNN A;  2KFZ A;  3KLF A;  2OZS A;  3V9X A;  1VSI A;  4DU4 A;  4CIE A;  1I39 A;  4TSX A;  3ZSR A;  3OYC A;  4YFU A;  2HNZ A;  3HK2 A;  3DM2 A;  4CGH A;  4FLU A;  4ID5 A;  1NJZ A;  2B4J A;  2Y1J A;  2FBT A;  1BQM A;  2DY4 A;  4DU1 A;  4KKO A;  1IKV A;  3FFI A;  1C0M A;  1QSS A;  4DLG A;  1JLE A;  4FW2 A;  2Z1G A;  4CEB A;  3QNN A;  2I5J A;  4FM2 A;  4N5S A;  1K6Y A;  4FXD A;  1KVC A;  4C8M A;  4R5P A;  2YNG A;  2DFF A;  4CIF A;  3HM9 A;  2ATQ A;  1A5W A;  3OVN A;  1Q9Y A;  4DQI A;  2ITG A;  1UOC A;  1WSH A;  1SL2 A;  3KLE A;  1NK8 A;  1JLA A;  3KLI A;  1CXQ A;  4B9N A;  4CF1 A;  2XY6 A;  3VQE A;  1N5Y A;  1IG9 A;  1D8Y A;  4GW6 A;  4KTW A;  4CES A;  4CJS A;  3O3G A;  2FBY A;  4IKF A;  1YT3 A;  2KQ2 A;  3VQ6 A;  3ZSQ A;  4DSL A;  3AVA A;  4B08 A;  5J1E A;  1ASV A;  4DSF A;  1VK0 A;  1XWL A;  1RTD A;  4CGF A;  2HB5 A;  3V1R A;  4BDP A;  4FJX A;  4RW9 A;  2FBV A;  1RBV A;  1RT3 A;  1RTI A;  4FJ9 A;  3NF8 A;  4KHS A;  4DTS A;  3TAG A;  4FK2 A;  4Z0U A;  3LAN A;  3LPU A;  4CGG A;  2KFN A;  2GV9 A;  3SPY A;  1QSY A;  3NAE A;  2P5O A;  4H4M A;  4FJK A;  1VSK A;  4I2P A;  1WSI A;  4AH9 A;  1HMV A;  3VQD A;  3QLH A;  3KLG A;  3AO4 A;  1SL0 A;  2X74 A;  3L2W A;  1UWB A;  2ZD1 A;  1RBS A;  4GVM A;  2R7Y A;  4OPK A;  4FM1 A;  2OPR A;  3LZI A;  2XRI A;  3AVI A;  3ASM A;  1W9H A;  2ZE2 A;  2VWJ A;  4CJR A;  4HCB A;  2WON A;  3RMA A;  3MAQ A;  1GOB A;  3NGI A;  3IS9 A;  3T1A A;  3TAE A;  3V6D A;  1TK8 A;  1JLB A;  2BAN A;  3SQ2 A;  2VG7 A;  1DTT A;  2X6S A;  3LWM A;  1QSL A;  4ELT A;  3KJV A;  4DFJ A;  4C8O A;  3VQ7 A;  2JGU A;  4CGJ A;  3VQA A;  1N6Q A;  4I9Q A;  2OPP A;  2Q3S A;  1LV5 A;  1RTJ A;  2HMI A;  3DOK A;  1VSH A;  5KRS A;  3U6F A;  4HUE A;  3AA2 A;  3RMB A;  3VQQ A;  4DG1 A;  1LWF A;  3F73 A;  3HST B;  5FRO A;  3QEX A;  4FK0 A;  1HPZ A;  3S3N A;  1ITG A;  3TI0 A;  3AVB A;  4E1N A;  2RKI A;  5CYM A;  1U45 A;  1T05 A;  3AO5 A;  3WNF A;  3PX0 A;  3DLB A;  4Y1D A;  3IAY A;  3QES A;  3K2P A;  3QER A;  3OJS A;  3KIO A;  3HL8 A;  4FLY A;  4C8N A;  3LP1 A;  3AO1 A;  3LP0 A;  4DFK A;  2HNY A;  3ZSW A;  1NK4 A;  1SKR A;  3BDP A;  3F9K A;  4KHQ A;  2KTQ A;  1KCF A;  1YTA A;  3ZT0 A;  1NJY A;  4W5O A;  4KO0 A;  3O3F A;  1TK5 A;  1UAX A;  1KSP A;  1X1P A;  2HVH A;  1SUQ A;  1VRT A;  5SWM A;  4E0D A;  1U48 A;  1B9F A;  2X6N A;  4MFB A;  3MXM A;  4FLZ A;  3KD5 E;  1L3S A;  3DLG A;  5HRN A;  3OYE A;  4AIL C;  1U47 A;  4E7K A;  1FKO A;  2YHA A;  3OYI A;  3CQ8 A;  2B5J A;  1WN7 A;  3KD1 E;  3VQ5 A;  1BL3 A;  5KRT A;  2XHB A;  4FK4 A;  1F21 A;  1LW2 A;  3DLR A;  1BHL A;  3VA0 A;  4E7I A;  1YTU A;  2X78 A;  1HNI A;  4FJM A;  4E3S A;  1NOY A;  3VQ9 A;  3AVL A;  1D9D A;  4F3O A;  4M3Z A;  4BE1 A;  3K58 A;  4DTM A;  3SPZ A;  4OPJ A;  1ZYQ A;  2HHS A;  5J2P A;  3EYZ A;  1B92 A;  1KFS A;  4HVJ A;  1S9G A;  1BCO A;  3NE6 A;  3MEC A;  5CYQ A;  4CK2 A;  1A5X A;  1JXE A;  2EX3 A;  3V9U A;  3H08 A;  2YHB A;  4EP4 A;  1XC9 A;  4E7L A;  4O0J A;  3ALY A;  3NGZ A;  1RCH A;  2XY8 A;  4KRF A;  3I0R A;  1NK0 A;  2AJQ A;  3U3Y A;  3KKR A;  3VQP A;  1KFD A;  3TWH A;  3ZT2 A;  5J2Q A;  4AHT A;  1JLC A;  3NF6 A;  2WOM A;  1HYV A;  4EZ6 A;  3L3U A;  1XHZ A;  4W5N A;  4NCB A;  4IDK A;  2QXF A;  4AHU A;  1RT2 A;  3V81 A;  1KRP A;  3L3V A;  4JS4 A;  4CCH A;  3TAQ A;  4RW6 A;  4CHN A;  3PV8 A;  1TL1 A;  4CED A;  1NKB A;  4K8X A;  4DQS A;  4DSE A;  2FBX A;  4C8K A;  1VSF A;  3K5L A;  4KB0 A;  4GMJ B;  5E41 A;  4PWD A;  1L3T A;  1X9M A;  5FRN A;  1SV5 A;  3S3O A;  3NFA A;  4G1Q A;  4DU3 A;  1JL2 A;  3WNE A;  4CK3 A;  4UQG A;  1J53 A;  4CHO A;  1NK5 A;  1BIS A;  3OYG A;  3SV4 A;  2G8V A;  3V9Z A;  4B9T A;  4KHU A;  1Y97 A;  4CHY A;  2P51 A;  1JXB A;  5FDL A;  2DFE A;  3ZSO A;  1KVA A;  4BE0 A;  4M3R A;  3TAR A;  4B9S A;  1GOA A;  4RG8 A;  4BE2 A;  4LSL A;  1IKY A;  2E6L A;  2D0A A;  4CJQ A;  3C95 A;  2A1S A;  4CJL A;  3ZT3 A;  1C1A A;  3CG7 A;  4CJW A;  3AA5 X;  4DF8 A;  4M45 A;  1Q9X A;  3CM6 A;  4CFB A;  3C94 A;  4NYN A;  4LSN A;  3DOL A;  5T7B A;  3LWL A;  4O5B A;  3LDS A;  4E7J A;  3DLH A;  3HP6 A;  3OJU A;  1S6Q A;  1JLF A;  4Y1C A;  3CFO A;  5SZT A;  1JLQ A;  1MU2 A;  1Z25 A;  3P5J A;  3NHG A;  4CGD A;  2OA8 A;  4QOZ B;  4O44 A;  2P1J A;  3SI6 A;  4FLV A;  3B6P A;  1RTH A;  2Z1J A;  1TVR A;  1RT1 A;  4DMN A;  1L3U A;  4E19 A;  4FZX C;  3AO2 A;  4CJ3 A;  3OYD A;  3WNH A;  4CF0 A;  3D0P A;  4OKJ A;  4BWJ A;  5HLF A;  4M42 A;  3E01 A;  1BI4 A;  2HHQ A;  5C25 A;  4ZTF A;  1TKZ A;  4FW1 A;  3OYJ A;  4DQR A;  4OLA A;  1QTM A;  4NCG A;  1LWC A;  3ZT1 A;  3L2U A;  3AVK A;  4FJI A;  1T03 A;  4JRP A;  1X9S A;  3PX4 A;  3ZSZ A;  2HHX A;  4Z4H A;  3M8S A;  1LW0 A;  4DQQ A;  1NKC A;  5KGW A;  1XHX A;  3IG1 A;  1W0H A;  1TKD A;  1QE1 A;  1S1U A;  3V1O A;  2OYQ A;  3V9W A;  4HUG A;  1UA1 A;  3C6U A;  3RWU A;  3HVT A;  4CIG A;  1NK6 A;  2JLE A;  4I7F A;  1EP4 A;  1C0T A;  1HQU A;  4LH5 A;  3NH0 A;  4KAZ A;  3SZ2 A;  3MEE A;  3ZSY A;  3SJJ A;  1WAF A;  1J54 A;  1EX4 A;  1BGX T;  1VRU A;  3CFR A;  3CM5 A;  2PYJ A;  4CFA A;  1D9F A;  4FLX A;  4ZHR A;  4M3Y A;  3QEW A;  1WAJ A;  4Z4F A;  2E4L A;  1S1T A;  3MXJ A;  3TAN A;  3HPH A;  1C6V A;  4CE9 A;  1TK0 A;  5HRS A;  2QK9 A;  1Q8I A;  3SUP A;  4CJE A;  1D5A A;  1X9W A;  2G8H A;  3MED A;  3RRG A;  4IBN A;  2Z1I A;  3QNO A;  3QO9 A;  4KI4 A;  1ZBF A;  2IGI A;  3VQ8 A;  3OYB A;  3NCI A;  4RW8 A;  4JRQ A;  3QET A;  1IO2 A;  1KLN A;  4F2R A;  1C1C A;  4N41 A;  1ZBH A;  3HXM A;  3MXI A;  2D0C A;  4AHC A;  4FM0 A;  4CF8 A;  1JKH A;  4ID1 A;  4J2B A;  4KPY A;  2KZZ A;  4AHS A;  3KLH A;  2LSN A;  3RRH A;  4CJ4 A;  3OYA A;  3L2V A;  3CFP A;  4KHY A;  2O4G A;  4B8A B;  2PZS A;  3EY1 A;  2BE2 A;  1RBU A;  1S6P A;  1T7P A;  5I3U A;  1RT6 A;  5CZ1 A;  3LAL A;  4JLH A;  1I3A A;  5HRP A;  3K5O A;  1FXX A;  1RDD A;  2OPQ A;  3SUN A;  4RW4 A;  1XI1 A;  3HO1 A;  4H8K A;  1QHT A;  1BIU A;  4OGE A;  4O0I A;  2FC0 A;  2IS3 A;  2Z1H A;  3AVG A;  3U3G A;  3OYH A;  4FLW A;  1WSF A;  4I2Q A;  1T8E A;  4E7H A;  4DF4 A;  1SKW A;  4DLE A;  4IG0 A;  2HHU A;  1RIL A;  1C0U A;  3HP9 A;  3G0Z A;  4KV8 A;  4MQ3 A;  4CFD A;  4F8R A;  3M8R A;  3HVR A;  3THV A;  3LZJ A;  2HW3 A;  3VQC A;  5J2N A;  3G10 A;  4O55 A;  3S3M A;  3KKS A;  4BDZ A;  4FJG A;  3WNG A;  4RW7 A;  1NJX A;  4Q5V A;  3OS0 A;  1L5U A;  3AVJ A;  3LP2 A;  1TAQ A;  1UA0 A;  5DK5 A;  2QKB A;  4FYD A;  1QQC A;  3K59 A;  4B9M A;  3UIQ A;  3AV9 A;  1VSM A;  3T3F A;  5K14 A;  4CF2 A;  4ZTJ A;  4I9L A;  2GBZ A;  3C6T A;  4OJR A;  3VQ4 A;  4W5R A;  3SUQ A;  1HQE A;  3SYZ A;  4W5Q A;  4C8L A;  3QIO A;  3QEI A;  1KVB A;  3ZCM A;  3RTV A;  2YNF A;  2G8U A;  2KZM A;  5C42 A;  5KI6 A;  4QAG A;  4YNQ A;  2PY5 A;  3NF9 A;  1IKW A;  3L8B A;  2VWK A;  4M3T A;  3S9H A;  2G8I A;  3SQ1 A;  2XY7 A;  4KRE A;  1U49 A;  3OYL A;  4J2E A;  4L8R B;  4DTN A;  4O4G A;  3KK2 A;  3KK1 A;  3PO5 A;  3VQB A;  1SL1 A;  1WSJ A;  3DLK A;  3L2R A;  2ETJ A;  5J2M A;  2G8W A;  4F2S A;  4FJ5 A;  1RT4 A;  4FJL A;  3M8Q A;  1CZ9 A;  4DQP A;  4CEE A;  4FVM A;  1TKT A;  1VSE A;  4CJP A;  3DYA A;  3O4Q A;  4KHN A;  2G8F A;  3V1Q A;  3VN5 A;  3OS2 A;  3EZ5 A;  4CHP A;  2NUB A;  4CEF A;  1RDC A;  3AVH A;  4DS4 A;  5HRO A;  4W5T A;  1NK7 A;  3AA3 A;  3TAP A;  1HYZ A;  1S5J A;  2P5G A;  1CLQ A;  1EXQ A;  1HYS A;  3K57 A;  4PY5 A;  1JL1 A;  4XIU A;  1LWE A;  4DFP A;  1S1V A;  2HHW A;  3ULD A;  1ZBL A;  2EHG A;  4J2D A;  4DSJ A;  1U04 A;  4N56 A;  2Y1I A;  4E1M A;  5DMR A;  3TAB A;  3V4I A;  3OYK A;  4CEO A;  1CXU A;  4WE1 A;  3HT3 A;  4OLB A;  2B6A A;  1C1B A;  1KLM A;  4CJF A;  4Z4G A;  1IH7 A;  1S1W A;  3NH1 A;  4LD0 A;  1NJW A;  4Q0B A;  4ELU A;  5I42 A;  3IRX A;  1RDB A;  1VSL A;  3DI6 A;  4KTQ A;  5KTQ A;  4K8Z A;  1ASW A;  2IOC A;  1J5O A;  3SQ4 A;  4HHT A;  5EU7 A;  4H4O A;  3NF7 A;  4DS5 A;  4KTZ A;  2VG5 A;  4J2A A;  4FLT A;  3O3H A;  4OGC A;  2XO7 A;  4KB1 A;  1BCM A;  1VSJ A;  2RPI A;  4HTU A;  3RMC A;  4QCL A;  3QIN A;  4IFV A;  4LY7 A;  1O1W A;  2YNI A;  1ASU A;  2D0B A;  3L2Q A;  4DTO A;  3P1G A;  2F8S A;  3DRR A;  3SCX A;  1J9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...