4CGJA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cgjA00
4CJKA 4CJRA 1C1CA 1S1TA 1TVRA 2IC3A 3JSMA 4E89A 2HW3A 3DOLA 3LAKA 4EP4A 3DMJA 3LP2A 1UA1A 1EX4A 2A1SA 2Q3SA 5HROA 4AH9A 3K5LA 1L3UA 2VG6A 4JS5A 2IDOA 1S6PA 2PYJA 3QEVA 1RDBA 3AO4A 1U4BA 4IFVA 2G8VA 4HTUA 4FZZA 2DFHA 4JLHA 4E1MA 3HT3A 3V9ZA 3AVKA 4CHPA 3PO4A 4KHWA 3AVBA 2YNGA 3VA0A 4O55A 3TAFA 1VSEA 3HP6A 4DSLA 3NFAA 3P83D 1BQMA 3M8RA 5C25A 3NAEA 4CJ4A 4OKKA 3D0PA 1UOCA 5C24A 2VWJA 4OLAA 2FBTA 1HJRA 3KTQA 4N41A 4DF8A 3VQ5A 3C6TA 2G8KA 4ID5A 1JXEA 3P5JA 1U04A 2FBYA 1Z26A 3KKSA 4I9LA 3VQ7A 3LWMA 4B9UA 3MXJA 1RT4A 5HRNA 3QLHA 4E7JA 2KFZA 4E19A 5HRPA 5DK5A 4FM0A 1HQEA 5EU7A 2O4IA 2IAJA 1B9DA 4Z4HA 4ZHRA 1Q9XA 2FC0A 4LY7A 3LWLA 2DFEA 1WLJA 3G10A 3EZ5A 3OYNA 1D8YA 1JKHA 3SZ2A 4KAZA 3OS1A 1NJZA 3IG1A 3T3FA 4C8MA 3LP3A 4O0IA 4KB1A 1JL2A 1Q8IA 1NOZA 4CHZA 4KI6A 3AVHA 3VQ9A 2KTQA 3CFOA 1IKWA 4DU3A 1RBTA 4NCBA 2VG7A 4N56A 4F3OA 1C1BA 4KI4A 3RR7A 4CHOA 4L8RB 4DSFA 4AHRA 1TV6A 4FVMA 3KK2A 3NGZA 5HRRA 3OYGA 4E7IA 3BDPA 2ITGA 1KVAA 1LWCA 3ZT4A 1LV5A 2YHAA 4B9SA 3ZT0A 2B4JA 4E3SA 3TR8A 3VQEA 4G1QA 1ASWA 3U6FA 3VQ4A 1JXBA 1T05A 3AVFA 2IGIA 2OA8A 2KW4A 2OYQA 3KKRA 4DMNA 1JLGA 1CLQA 2DTUA 1A5XA 1TKZA 1C1AA 4LSLA 3U3YA 4J2DA 3U3GA 2YKMA 1HRHA 1LW2A 1KSPA 4M3TA 4CEFA 4BDPA 3QIOA 2XO7A 2HHUA 1ASUA 3FFIA 2Y1JA 2KFNA 2OPRA 1QSYA 3AVNA 4IG3A 5FDLA 1SKSA 3L2VA 5KGWA 4CFAA 3RR8A 1RTDA 3SUNA 1YT3A 4ELTA 4CESA 3QNNA 4FJXA 3SV4A 4BDZA 1EKEA 1RBRA 1RCHA 3DLKA 5DMRA 4CJWA 1HQUA 1JLFA 4BE1A 2HNZA 1IH7A 3ZT3A 4KHUA 1QS4A 3SUOA 3OYFA 3HPOA 4Y1CA 3AVMA 1WAFA 3WNHA 2Z1GA 3LP0A 1RDCA 1N5YA 3CFRA 4BWMA 4QCLA 2OPSA 3AO1A 1KTQA 1UAXA 4W5OA 3OYCA 3TWHA 3NGYA 1QSLA 4KTQA 2XY8A 3L3UA 4W5QA 1WSGA 3K59A 1VSIA 1S1XA 3PX4A 1WSHA 4OKJA 2HVIA 3OYHA 3K58A 3ZT2A 4E7HA 2XHBA 2G8IA 4CF9A 1JLQA 4CEEA 1REVA 3MEGA 1IG9A 3ULDA 3ASMA 4DTRA 5CY4A 4O44A 3TANA 2YV0X 2E4LA 2ATQA 3O3GA 3AA4A 4EZ6A 3PY8A 2HNDA 4CJPA 3AO3A 3MECA 3ISNC 3SV3A 1BISA 4NCGA 4OLBA 1WSEA 3OJSA 4OPJA 1Q9YA 5HP1A 1EETA 1VSDA 1FKPA 4E7LA 1S9EA 3BGRA 1TL1A 1C6VA 1S1WA 4CE9A 4ZTJA 1D9DA 4DSJA 4F8RA 1C0UA 4CEDA 3NDKA 4F2RA 4CF0A 4FZYA 2WONA 3NF8A 1JLCA 2X74A 4AHTA 2P5GA 3AO2A 3QIPA 4FYDA 4HUGA 3I0RA 3KLFA 3NCIA 4FLWA 2GV9A 3L2QA 4FJ5A 3ZSRA 1KVBA 3CM5A 4IFYA 4CHNA 3AVJA 4KO0A 3JYTA 3WNGA 4DU4A 1CZ9A 1HNIA 3IS9A 4I7FA 4CIFA 2NUBA 3KIOA 3NBPA 4DQQA 4OGEA 3OYDA 4F2SA 3M8SA 1YTUA 4YFUA 3SQ0A 3HSTB 3OYLA 3KLHA 1NK9A 4JRPA 1X9SA 3VQQA 4LD0A 5HLFA 1U49A 4CJ3A 1SKRA 4M41A 1QHTA 1Y97A 3VQAA 4DTJA 1SV5A 3M8QA 3MEEA 2JLEA 1S5JA 4C8NA 3AVCA 1SL2A 2F8SA 1RTIA 3RMBA 2HHQA 1U47A 3OYMA 3IAYA 4F4KA 4CF8A 5KRSA 3OYKA 1I3AA 3LALA 1TAQA 2QK9A 3OVNA 2HMIA 2HHWA 5FRMA 2OPPA 2DY4A 4FLUA 2D0AA 2P1JA 5KGXA 3AA5X 2XY5A 4FJ9A 3LP1A 2Z1IA 3EYZA 3CM6A 3H08A 3O4QA 4RW7A 1CXUA 1Z25A 2ETJA 4CEQA 4CGJA 4CEZA 2LSNA 1TK0A 4PWDA 1IKXA 2X6NA 4HVJA 1NK6A 4IDKA 3O3FA 3ZSYA 4GMJB 1F21A 1T03A 4B3OA 4W5RA 4R5PA 3HK2A 4CERA 1GOBA 2XRIA 4KHSA 3SUPA 1JL1A 1UWBA 4B8AB 2QKKA 4J2AA 1GOCA 3PV8A 1O1WA 1KLMA 4CFCA 4ZTFA 3AO5A 4FJHA 2KZZA 4ICLA 2XY7A 1TKTA 1ZBIA 4B9TA 3SQ4A 3V9WA 5CYQA 3QEPA 4AHCA 3PX0A 3HM9A 1ZBFA 1BI4B 1RTHA 3TAPA 3SPZA 4CJ5A 4FJNA 1RT7A 3DLEA 4CGGA 4NCAA 4DQRA 5K14A 4FK4A 3VQ6A 3L2RA 4KHYA 1QTMA 1KCFA 3WNFA 1A5VA 2BANA 5CZ2A 4CJQA 3RWUA 1BI4A 4CIGA 4B9VA 4Z4FA 2HHXA 1QQCA 1LAVA 4DTMA 4DTNA 4FJJA 4FJMA 5I3UA 4FZXC 3ZCMA 3NH1A 2O4GA 3DLBA 4FJLA 4RG8A 3S3NA 1EP4A 5FRNA 3HJFA 3HO1A 3DRSA 1EXQA 3DOKA 3O4NA 1XHZA 3ZT1A 2FBVA 3TAEA 4LSNA 5KI6A 3KJVA 3ZSVA 4HUFA 1XWLA 4EZ9A 1WN7A 3HL8A 4BE0A 2G8WA 3LDSA 4Q0BA 4IG0A 4ELVA 4M3ZA 2JGUA 3T19A 3DYAA 1FXXA 2F8TA 2KZMA 3IRXA 1S1UA 2GUIA 4AHUA 4KPYA 4MQ3A 4CF1A 3OS0A 1TL3A 3CYMA 4DSKA 4H4MA 3TAMA 1VSMA 1L3TA 4J2EA 1JLAA 1WSJA 1X9WA 4DTOA 2A1RA 1RBSA 3QESA 1BGXT 1QE1A 1NJYA 4DWIA 2HB5A 4DF4A 4DTPA 1D5AA 3KLIA 3NH0A 5CYMA 1DTTA 1RT3A 2YNHA 3I0SA 3O3HA 4B9NA 4HCCA 2X78A 2HHVA 1RILA 4RW6A 4RW9A 1TK8A 2OZSA 2OZMA 4FLTA 1U45A 1WSFA 1SKWA 3AVAA 1XC9A 4M3XA 1W0HA 4KHNA 4HUEA 2I5JA 4PY5A 3QNOA 3F73A 3PX6A 4M45A 4PUOA 3HYFA 4QAGA 4DSEA 1RBVA 1ZBUA 4CK1A 4Z4EA 4B8CA 1LWFA 3HXMA 4DFKA 5E41A 3V1OA 4MFBA 3D45A 4CJVA 2YKNA 2PY5A 4CCHA 1NKEA 1RDAA 4CIEA 3SJJA 4JS4A 4CHYA 3RMDA 2QKBA 3DI6A 4CEAA 4O4GA 4W5NA 1L3VA 1BL3A 5J2MA 3QEIA 5JS2A 1BHLA 4CEOA 4W5TA 4FM2A 1HYZA 1KFSA 3DRRA 3C95A 4Z4CA 3SI6A 4I2PA 4UQGA 3OYIA 2RF2A 4FLVA 1VRTA 1WAJA 1DTQA 3AV9A 3T1AA 3S3MA 4IKFA 1BCOA 4DS4A 3QINA 3QERA 1KLNA 3K57A 2Z1JA 4C8OA 3OY9A 2BE2A 2FBXA 4CJLA 4FCYA 3TABA 1X1PA 3RRGA 4CJSA 3V9UA 1RT2A 1X9MA 4E0DA 4FXDA 4HCBA 4GW6A 3V1RA 3VQBA 1D9FA 4CGFA 2WOMA 3DM2A 4CFBA 5J1EA 3ZSZA 4N47A 3NE6A 3NH2A 2G8FA 1HYVA 4KV8A 1ITGA 5HBMA 2QXFA 3PUFA 3SNNA 1T8EA 4CF2A 3ZSWA 3V4IA 1NJXA 1BQNA 4E1NA 3RTVA 4BACA 3CFPA 4AHSA 4WE1A 3NF7A 1J9AA 2Z1HA 4CK2A 1UA0A 4DTXA 1RT5A 4M3YA 4CJTA 4M42A 3LPTA 3UIQA 4K8XA 4AILC 4O5BA 3B6PA 4AHVA 3LZIA 2RN2A 1FKOA 3KD5E 1R0AA 3VN5A 5I42A 1L3SA 3K5OA 4H8KA 4RW4A 4DFJA 1BIZA 3HVTA 4DQPA 1LAWA 4M3UA 4KKOA 4OPKA 4FK0A 2ZE2A 4FJIA 1WNSA 2E6LA 5KRTA 3L8BA 2KQ2A 4M3RA 3SUQA 1J5OA 4B9LA 4JRQA 1BIUA 2DFFA 3ZSXA 2B5JA 4DLEA 4FJ8A 1SUQA 3NGIA 3RMCA 4CJFA 3HVRA 4DQSA 4XIUA 1S6QA 4OKEA 1ZBHA 2D5RA 3S9HA 5FROA 3MEDA 1WSIA 2ZQBA 2E6MA 3OYJA 3SPYA 5SWMA 4Z4IA 3HPGA 3DLHA 3CQ8A 2X6SA 1KVCA 1S1VA 4LH4A 2HVHA 3RMAA 1IO2A 2VWKA 2EX3A 4HHTA 3V9SA 3PO5A 3NHGA 1HPZA 4J2BA 4GVMA 3THVA 3TAQA 3KLGA 1VSKA 4DU1A 1KFDA 4DG1A 4FW1A 4DTSA 3MXMA 4CJEA 3KLEA 1ASVA 4CGDA 5KTQA 3E01A 3V81A 3AVIA 4DFMA 1RDDA 4Z0UA 3KK1A 3I8DA 3B6OA 1JLEA 5HRSA 3K5MA 1ZYQA 1SL0A 4C8KA 3VA3A 2HHTA 4ID1A 1NK8A 1T7PA 3F9KA 1XI1A 3SQ2A 1YTAA 1NK5A 4RW8A 4QOZB 3HP9A 2PYLA 4DLGA 4H4OA 3TI0A 4DSIA 3G0ZA 1HMVA 3SCXA 4KREA 3P1GA 3DLRA 3LZJA 1VSHA 1W9HA 1S9GA 3AA2A 3NF9A 4DFPA 4CK3A 2D0CA 3QEWA 3L3VA 4IBNA 2YNIA 4OGCA 1L5UA 3ZSOA 3QETA 3M8PA 4EP5A 3OYEA 4DTUA 4FK2A 1RT1A 3RRHA 3VQPA 3AVLA 3TARA 4TSXA 3V1QA 4FJGA 3DLGA 5J2PA 1NK0A 4B9MA 4KB0A 2YNFA 2BGGA 1B9FA 4FJ7A 4M3WA 4LH5A 4BDYA 4Q5VA 2IS3A 3K5NA 2HHSA 1VSLA 1RT6A 1TKXA 3VQCA 2IOCA 4FLYA 1IKVA 4K8ZA 2RKIA 4OVLA 4CECA 3VQ8A 1I39A 1RNHA 3SYZA 3S3OA 3MAQA 5CZ1A 3A2FA 4E7KA 5J2NA 4Z4GA 2AJQA 1GOAA 1NKCA 4KFBA 4KHQA 2P5OA 1SL1A 1TKDA 1RTJA 3C6UA 3AVGA 3L2UA 5D3GA 2YHBA 1C0TA 4CFDA 1J54A 1K6YA 3ALYA 2ZD1A 3OJUA 1YVUA 4N5SA 3CG7A 1TAUA 1J53A 3EY1A 2OPQA 4BWJA 1LWEA 2XY6A 3MXIA 4I9QA 4FJKA 1FK9A 3QEXA 1HNVA 1DLOA 4I2QA 5JS1A 2EHGA 1C0MA 1VSFA 3LANA 2BDPA 4NYFA 1QSSA 3VQDA 3KD1E 1N6QA 2RPIA 2W42A 2R7YA 2D0BA 3AA3A 1VRUA 4BE2A 1CXQA 3C94A 3HPHA 4KRFA 4N76A 2G8UA 1RBUA 5J2QA 1VK0A 4F3TA 4YNQA 3SQ1A 4CGHA 3V9XA 3OS2A 4PQUA 5T7BA 1JLBA 2B6AA 1TK5A 1XHXA 3QO9A 5SZTA 4O0JA 3K2PA 1TGOA 4CHQA 2F96A 4B08A 3ITHA 4C8LA 4CGIA 1B92A 5C42A 1LW0A 3OYAA 4CJUA 4DQIA 2GBZA 1BCMA 1HYSA 4ELUA 2P51A 3NF6A 4FLXA 1A5WA 3TAGA 2Y1IA 3KK3A 1NK7A 1NJWA 4FW2A 4KTZA 2HNYA 4OJRA 3DRPA 4Y1DA 4KTWA 1U48A 1G15A 4NYNA 1NOYA 3LPUA 2G8HA 2PZSA 3V6DA 4FLZA 3LAMA 4PA1A 4DS5A 1KRPA 3ZSQA 3L2WA 3OYBA 1NK4A 1ZBLA 1VSJA 2VG5A 1IKYA 1MU2A 1CZBA 4FM1A 3WNEA 1NKBA 4CEBA
chains in the Genus database with same CATH superfamily
3CCRN 2IC3A 4E89A 1EX4A 2W40A 2YCHA 2IDOA 1S6PA 5BRDA 4NXMK 2DFHA 1S22A 4JLHA 3AVKA 4CHPA 1VSEA 1T6CA 3NFAA 3P83D 3BY5A 3HOSA 4I6MB 3NAEA 4MO5A 4BC4A 3THYB 2VWJA 2V7YA 1VQ8N 4FPAA 3UKUB 2P9LB 3VQ7A 3ID6A 4BG8A 4B9UA 1RT4A 1VQ9N 5AQJA 4NLBA 4DCHA 4MO4A 2IAJA 2GX9A 3LWLA 2DFEA 4FWPA 5FPEA 1JKHA 3SZ2A 1VQKN 3CJAA 1XMOK 3LM9A 4O0IA 2VWBA 1Q8IA 3MCPA 4CHZA 3VQ9A 3CFOA 4FVUA 4KI4A 1Z6RA 4DSFA 4AHRA 1ESVA 2YI1A 4X65K 3T69A 4CBXA 3NGZA 3WXJA 5HRRA 3GE1A 1KVAA 1LWCA 2O8BB 5CE3A 3M5RA 5AFUA 2YHAA 4E1JA 3ZT0A 3U6FA 3VQ4A 1T05A 2OA8A 4DMNA 4OPHA 2DTUA 3U3YA 3U3GA 2QWLA 2YKMA 4LF4K 1LW2A 2HHUA 1ASUA 4WCEL 2OPRA 3AVNA 4IG3A 1SKSA 4DV5K 4CZMA 1RTDA 3WEEB 2Q2RA 1YT3A 3BUZB 4ELTA 3E1YA 3CPWM 2NRZA 1EKEA 3BF3A 2O8CB 1QS4A 2QWQA 5JICA 5AQPA 3CFRA 1K8AO 4JKAA 3DXMB 2HOEA 2ZJQL 3K59A 3AY9A 2KLAA 3K58A 2AA4A 3ZETA 2VQEK 1JCEA 5BR8K 3CC4N 2ATQA 3O3GA 4R79A 3PY8A 3NVKA 3MECA 3ISNC 3I8BA 1WSEA 3OJSA 5HP1A 1S9EA 5FPMA 1C6VA 1S1WA 4CE9A 1C0UA 3NDKA 4DV0K 3AO2A 4JKHA 2WFBA 1IBLK 1KVBA 3AVJA 5AQZA 4JYAK 1CZ9A 4I7FA 3QDKA 5AZIB 1VAZA 1YVNA 2Q0RA 3OYLA 4F9OA 4AQYK 5EVZA 1X9SA 1U49A 2JWKA 3AAQA 4M41A 3MEEA 2JLEA 2NRVA 4C8NA 4JK7A 1RTIA 3RMBA 4IJAA 4F4KA 4ILJA 2HMIA 1N8RO 5FRMA 3CF5L 3AA5X 2P9SB 3CM6A 3G4SN 4H0OA 2ETJA 4CEZA 5BN9A 4X62K 3O3FA 5DM6L 4WQ4C 4GMJB 3ZEUA 4B3OA 2IVPA 4CERA 3SUPA 1UWBA 4DR2K 5C2DA 2QKKA 1O1WA 1KLMA 3WEEA 5BRHA 1MA9B 3AO5A 2KZZA 1OVQA 1TKTA 1ZBIA 2IVOA 4B9TA 3V9WA 4AHCA 1T6DA 1WBBA 4H5VA 1YHQN 3MX2A 3A8YA 1NGCA 3VEXA 2F4VK 1NMNA 4KHYA 4CJQA 1LAVA 4JK9A 4FJJA 2BUPA 2VGMA 3MK6A 4FJLA 3ID8A 3HJFA 4YOTA 3O4NA 2ASOA 2O8FB 1NJIO 3PSIA 4LSNA 4CZHA 1NBWA 1ZXOA 4HUFA 3L4IA 2P9LA 2E2QA 4DV3K 2JGUA 3T19A 1Y64A 5M1KA 2W6KA 4MQ3A 3VTHA 3D2EB 3TAMA 1JLAA 1HPMA 3TSPA 1N34K 3ULEA 1NJYA 4IOCL 4DF4A 1D5AA 3KLIA 1V4TA 3NH0A 1DTTA 1RT3A 2YNHA 4K42A 1X3MA 1YAGA 4CW7B 4HCCA 2X78A 1XC3A 2HHVA 4RW6A 2OZSA 3T7ZA 5E84A 5AFUH 3R3LA 5TKYA 5JLHA 1SKWA 3AVAA 3TPQA 4BROA 2E8AA 2I5JA 2O8BA 4DSEA 3VF6A 3C6AA 4JI8K 1BG3A 4MFBA 3D45A 3V1OA 4CJVA 2A42A 2QKBA 3DI6A 5J2MA 1BHLA 4CEOA 4BRHA 4IDHA 3C95A 4JI6K 3AV9A 3T1AA 1QQOA 3QINA 2Z1JA 4C8OA 1X1PA 3RRGA 4E0DA 5KQDA 3EKSA 3VQBA 5DM7L 4CGFA 2WOMA 3CJBA 5J1EA 4PKGA 3SJHA 4N47A 3NE6A 1K73O 3H1QA 4JNEA 3ZSWA 5C2FA 4CF2A 3CFPA 4AHSA 4GV3A 4BR0A 4DTXA 1RT5A 4CJTA 4M42A 3UIQA 4BREA 1SAZA 4AHVA 3VN5A 5I42A 1L3SA 4RW4A 2HBJA 4M3UA 3CCSN 3ZX2A 3I56N 2UXBK 4CZIA 1QHAA 4B9LA 3VTIA 3ZSXA 2B5JA 1IBKK 5BR9A 3RMCA 1GLBG 2O8DA 4LF8K 1S6QA 3M1FA 1ZBHA 3VGLA 4DV7K 4YOYA 2P9IA 3OYJA 5SWMA 4Z4IA 3CCLN 2EX3A 4HHTA 3V9SA 1GLCG 3AGKA 3GL1A 3J8AA 3MXMA 3KLEA 3SAHA 3E01A 1T3VA 3AVIA 4DV1K 3V81A 4Z0UA 1ZYQA 1JLEA 4C8KA 4H5WA 3U4LA 1I94K 1YTAA 1NK5A 1OVYA 1DKGD 3LDLA 2QWMA 3VF2A 1VHXA 3KK7A 4K43A 3TI0A 1KAYA 2F9TA 1HMVA 3I55N 4BRQA 2D0OA 3AA2A 4X64K 4OGCA 1L5UA 3A5LC 4IO8A 3M8PA 4EP5A 4O8KA 3AVLA 3DAWA 1QQNA 4FJ7A 4LH5A 4BDYA 2HHSA 2IS3A 3AARA 1VSLA 1RT6A 3SMSA 1XQSC 2RKIA 4JI1K 1BA1A 3S3OA 1QVGM 1NKCA 4KFBA 5HL7L 4KHQA 4A59A 4QS7A 2YHBA 1J54A 3ALYA 4N5SA 3R6MA 3F5TA 4BWJA 1LWEA 3MXIA 4I9QA 4FJKA 1GLFO 2QI2A 3QEXA 1C0MA 2CGKA 4UY8O 3QFPA 1VRUA 5LL6Z 4YOWA 3IMXA 2O8FA 3L4QA 1CXQA 4PKIA 4BE2A 4KRFA 4N76A 2A40A 1G99A 1VK0A 4YNQA 3V9XA 4JKDA 1TK5A 3QO9A 3H3NO 3O9TA 5JVHL 3HI0A 1TGOA 1OKJA 2F96A 3T1YK 4C8LA 3DLLL 4DHYA 5C42A 5F2RA 4LFBK 2YHXA 1HYSA 3NF6A 1A5WA 1NJWA 4RCHA 4KTWA 4NYNA 1NOYA 5AQTA 4GV6A 3V6DA 3LAMA 4QS9A 2ZGYA 3VENA 3OYBA 1IKYA 4FWSA 3Q7BA 4CJRA 1U6ZA 1C1CA 1S1TA 4JN4A 3JSMA 2HW3A 4JI2K 4A2BA 5HROA 2Q3SA 2VG6A 1ATNA 3QEVA 4J8FA 4HTUA 2RHKA 4E1MA 4KHWA 2YNGA 1TYQA 1ZBSA 3K0SA 5C25A 4CJ4A 4OKKA 3WUHA 4CZKA 3D0PA 3MN6A 1UOCA 4OLAA 1QQMA 3KTQA 2UYTA 5HOOA 3KKSA 3VF4A 3THXB 3QLHA 3DJCA 3LL3A 4E7JA 4E19A 5EU7A 1OH5A 3G10A 3OYNA 4BRFA 3OS1A 3IG1A 3T3FA 4C8MA 4KB1A 4KI6A 4NCBA 4DU3A 3O8MA 2VG7A 1Q86O 2UUBK 3RR7A 4CHOA 3HZ6A 3P38A 4FVMA 3OYGA 3BDPA 4OO1J 3ZT4A 3TR8A 3VQEA 1ASWA 5F1XA 1JXBA 2NRWA 1TKZA 1VQ5N 2GUPA 3QIOA 2Y1JA 5C12A 1R59O 5FDLA 3L2VA 3RR8A 1C0GA 5F0XA 2OTLN 4AM7A 1RBRA 1HQUA 3P4IA 1GLEG 3ZT3A 4YDUA 4BG9A 5JVGL 3QBXA 3OYFA 2BH1A 3HPOA 3AVMA 1WAFA 1N5YA 2OPSA 1KTQA 3E9OA 3OYCA 4KTQA 1WSGA 1EO1A 1HKBA 1S1XA 1WSHA 3FLCO 3OYHA 1KD1O 3ZT2A 4E7HA 4CF9A 4CEEA 2IIRA 3MEGA 3ASMA 1LOTB 1FJGK 2HNDA 4BR4A 3MDQA 1BISA 1YITN 3NMUA 3FZMA 4OPJA 4IOXA 4JD2A 3BGRA 1U2VB 4ZTJA 2Q1NA 4DSJA 1Z05A 1NG9A 2WONA 1CZAN 2P9UA 3QIPA 4HUGA 4H5NA 4FLWA 3C0BA 1SZ2A 2NRXA 1BWFO 4IFYA 3JYTA 4DR5K 2D4WA 3IS9A 4CIFA 3NBPA 3M8SA 4YFUA 3FZKA 3HSTB 1NK9A 4JRPA 5HLFA 4LD0A 2E2PA 4DTJA 3M8QA 1EQYA 3AVCA 2F8SA 4YHHK 2HHQA 1U47A 5KRSA 3HOTA 2W41A 2HF3A 1I3AA 3LALA 4C1NI 2DY4A 3ZEUB 5KGXA 3CJ9A 4FJ9A 3LP1A 2Z1IA 1BUPA 3EO3A 4RW7A 1Z25A 4CEQA 4CGJA 3THWA 2E5LK 4PWDA 2X6NA 1NK6A 4IDKA 3ZSYA 1T03A 3O08A 4W5RA 2NRHA 4DR1K 3O9QA 3VMFB 3ZX0A 1GOCA 3KWIA 3PV8A 5TKWA 5EOYA 4ZTFA 2BTFA 3VEWA 2XY7A 2QW9A 5CYQA 5LMUK 3PX0A 3HM9A 3QICA 3EZWA 3EE8A 1RT7A 4FJNA 3RSEA 2CGLA 5GAGP 4K25A 4DKWA 3VQ6A 2ITMA 3CMAN 3KWGA 3P39A 1QQCA 4DV2K 1RDWX 3ZCMA 4YOVA 3NH1A 2O4GA 1HNZK 3DLBA 5FRNA 1NGAA 4BC5A 1TUUA 5KI6A 3CJCA 1J6ZA 1XWLA 1WN7A 3PIPL 1HJOA 3LDSA 4BE0A 4M3ZA 3BP8A 3CIPA 2KZMA 3IRXA 2GUIA 4AHUA 4A2AA 1TL3A 1QZ6A 3CYMA 4J2EA 1L3TA 4YOXA 4FWMA 4DTOA 1VQON 3E9PA 4DTPA 4BR2A 3I0SA 3A0IX 5A2QO 4B9NA 4BR5A 1RILA 5ADXH 1U45A 2OANA 5C0YA 4CI6A 2GEMA 4FL9A 2O8EB 1XC9A 4FO0A 1W0HA 2NRTA 4HUEA 3F73A 4M45A 4PUOA 4NXNK 2NNWA 4WQ4A 4B8CA 5E41A 2PY5A 1RDAA 3FR0A 4CHYA 4MLHA 4O4GA 1BL3A 1ZC6A 1KAZA 5JS2A 4BGAA 1KFSA 3J81O 1HYZA 3DRRA 4JAXA 1YJWN 4UQGA 2RF2A 1IG8A 1U2VA 4FLVA 2QEXN 1VRTA 4U7BA 4IKFA 2BE2A 2FBXA 5EY4A 1TUYA 4O8UA 3VETA 1RT2A 3V9UA 4FXDA 1YJ9N 4HCBA 3DM2A 1P8ZA 3IFRA 3UKUA 3NH2A 4KV8A 4DB3A 1BQNA 3RTVA 4Z94A 4BRGA 4WE1A 1UA0A 4MLEA 2I7PA 3CHWA 2V7ZA 2VQFK 4K8XA 4FOIA 3LZIA 1FKOA 2YHYA 1R0AA 4DV6K 5AQFA 2NRRA 3KVGA 4DFJA 1RGIA 3HVTA 4OPKA 3AAPA 2O8DB 1WNSA 3L8BA 3R1XA 2KQ2A 3SUQA 3J7AP 4NB4A 3H46O 4CJFA 4DQSA 5FPDA 5LJWA 4BRDA 2D5RA 3QB0A 5FROA 4XH4A 1YF5L 2E6MA 4B3RK 3WXKA 3C65A 3EKUA 3LM2A 1IO2A 3O80A 2VWKA 3JXUA 3NHGA 4J2BA 3KLGA 3M3ZA 5B8HA 4FW1A 2GELA 4CGDA 5BPLA 3IUCA 5HRSA 4ID1A 2Q36A 3SQ2A 4QOZB 3HP9A 5C10A 4DLGA 5AQWA 3SCXA 3DLRA 1HR0K 4DFPA 4CK3A 4DV4K 3QEWA 3L3VA 2QXLA 3ZSOA 3QETA 4FK2A 1EWRA 1WBDA 4FJGA 3DLGA 1NNEA 5J2PA 1NK0A 3O6WA 4B1WB 4M3WA 4QS8A 4Q5VA 3K5NA 3PIOL 5CR4A 1IKVA 4K8ZA 4CECA 3VQ8A 1RNHA 3MAQA 5CZ1A 4E7KA 5J2NA 4Z4GA 2YJEA 2AJQA 1GOAA 4H0TB 2P5OA 3FFKB 4G9ZA 4CFDA 1K6YA 1YVUA 1TAUA 1J53A 2OPQA 4A62A 1XUPO 1FK9A 3QMLA 1HNVA 1NMDA 4I2QA 5JS1A 2ASMA 3C6HA 1VSFA 4NYFA 1QSSA 1HKCA 1N6QA 3THXA 2R7YA 3AA3A 2HBMA 2WTUA 3CQYA 4CGHA 1XNQK 3OS2A 4PQUA 1JLBA 3I33A 4WFBL 5AR0A 5SZTA 3H3OB 1HNXK 3LDNA 3VESA 4CJUA 1NGEA 4DQIA 3O1WA 4H0PA 3TAGA 3UKRA 1VQLN 3KK3A 4KTZA 3TU5A 2HNYA 1GLJO 1U48A 2PZSA 2G8HA 4OX9K 3LPUA 3MMVA 4FLZA 4PA1A 1KRPA 3ZSQA 2VG5A 4DUZK 3VERA 1CZBA 3J80O 4U67L 3LAKA 4EP4A 1E4GT 2A1SA 4NLCA 4AH9A 3K5LA 2WUSA 1RDUA 4JS5A 1JJ2M 4I6MA 2G8VA 2P9KB 4FZZA 3VEYA 1WB9A 1IV0A 4XH1A 3HT3A 3V9ZA 3PO4A 3AVBA 4CZJA 3VA0A 4O55A 3TAFA 3HP6A 3M8RA 3SAGA 1NU0A 1N33K 2FBTA 5LY3A 4N41A 3VQ5A 5M1NA 4ID5A 1JXEA 1U04A 2FBYA 1VQ4N 4B3SK 3MXJA 5HRNA 4IEEA 2KFZA 2O4IA 4FM0A 1HQEA 4ZHRA 1Q9XA 2FC0A 2H3GX 4LY7A 1WLJA 1D8YA 3EZ5A 2ZWHA 1JL2A 3J7YP 3O1BA 2UUCK 3AVHA 1IKWA 1RBTA 4F3OA 5GADP 4FWNA 2VCPA 4L8RB 2QWRA 4FWRA 1NLVA 3CMEN 1LV5A 1KAXA 4B9SA 4JI4K 4E3SA 1LCUA 3AVFA 2OYQA 4IXCA 4LSLA 3IKMA 1P90A 1QZ5A 5AQIA 4BRMA 3B8AX 4CEFA 4FPBA 2XO7A 1OH7A 4CFAA 4EHTA 5C15A 3ZX3A 4CESA 3QNNA 3QBWA 4FJXA 3SBTA 5AQKA 3FE1A 5EXWA 5DMRA 1JLFA 4BE1A 3ENOA 1KQSM 4KHUA 3J7ZO 3SUOA 3E66A 1V4SA 1YXQA 2HBLA 3HBTA 3WNHA 3FZHA 5M1OA 3LP0A 1RDCA 4FWKA 3SLCA 4GKKK 4QCLA 4W5OA 2D1KA 3TWHA 1QSLA 2XY8A 3L3UA 4W5QA 1VSIA 1VQ6N 3O9SA 4OKJA 4YORA 2G8IA 1JLQA 3WXMB 4A5AA 1REVA 3ULDA 1MWKA 4O44A 2YV0X 2E4LA 2J4RA 4CJPA 1DGKN 5AQVA 3SV3A 4NCGA 2A41A 1Q9YA 1VSDA 1FKPA 1D9DA 4F8RA 4F2RA 4DR6K 4CF0A 4FZYA 3NF8A 4WF9L 4AHTA 5LJVA 1Q18A 3AGRA 3KLFA 3CM5A 2ZF5O 3WNGA 4DU4A 2ZJPL 2Q0UA 2NUBA 3KIOA 1HLUA 2A3ZA 5GIOA 4FWOA 1SKRA 4CD3A 1Q82O 1QHTA 1Y97A 4MDBA 3VQAA 3CXCM 4WFAL 1S5JA 3E9LA 3H1VX 3BEXA 4XH5A 3LDOA 3IAYA 4CF8A 3OYKA 4JKCA 2QK9A 4IJNA 3OVNA 2HHWA 2OPPA 2FXUA 2P1JA 4M7YA 3RVCA 3EYZA 3H08A 5FLXO 4YY3K 4HTLA 4ISFA 1VQPN 4HVJA 4XEIA 2CH5A 1OH8A 4R5PA 2QA4N 2XRIA 2HHHK 4J2AA 4CFCA 2RE2A 2QWPA 4ICLA 4BY9C 4M63C 3QEPA 4BRIA 4DR3K 1ZBFA 2FSJA 4KHPK 3WT0A 4B1UB 3DLEA 4BRNA 4CGGA 5AQRA 4NCAA 2FLOA 4DQRA 4BRKA 1VQ7N 1KCFA 3QFUA 2BANA 4H0VB 4JKGA 5CZ2A 3WNFA 1BI4A 4CIGA 4B9VA 2HHXA 4DTMA 4DTNA 5I3UA 4FZXC 1XMQK 3P31A 4RG8A 1EP4A 4EHUA 3HO1A 3DOKA 3DRSA 1XHZA 4FWQA 2FBVA 1WUAA 3EL2A 3KJVA 4EZ9A 4BRCA 4ELVA 2FF3B 4EAHD 1E3MA 1YUWA 1NGHA 1VSMA 2YHWA 1WSJA 2A1RA 1VQMN 3CC2N 1BGXT 1QE1A 3WQUA 4DWIA 1DT9A 1BA0A 4B1VA 1TK8A 4FLTA 1WSFA 2A5XA 1SQKA 2UUAK 4JI0K 3VGMA 1RBVA 1ZBUA 3UB5A 5AJ3K 4Z4EA 3HXMA 1LWFA 4DFKA 2UXCK 2FSNA 5I9EB 2YKNA 1NGDA 3SJJA 4CIEA 4JS4A 2P9NA 4CEAA 3C7NA 3UE5A 3QEIA 3MN9A 4W5TA 4JD2B 4Z4CA 2P9KA 4I2PA 3OYIA 4ILHA 2AP1A 3S3MA 1DTQA 5E26A 2V52B 4WQ5A 4B1ZA 4DS4A 3QERA 1KLNA 3K57A 5MLCQ 5JMVA 3TABA 2VYPA 2NLXA 4FCYA 4CJSA 3S41A 3HTVA 4CZGA 4GW6A 4DR7K 4CFBA 3PSFA 1BO5O 2V51B 2UXDK 3WQTA 1D4XA 1C0FA 5HBMA 1NJXA 4BACA 2F7TA 2QWOA 4KH5A 1J9AA 4B3TK 4M3YA 1W7AA 3LPTA 1N36K 4GKJK 4O5BA 1VQNN 3B6PA 3TTDA 2RN2A 3KD5E 3K5OA 2EWSA 1BIZA 4DQPA 4KKOA 4KBOA 5KRTA 2QM1A 4M3RA 4JRQA 2DFFA 4FJ8A 5BPNA 1BOTO 1SUQA 3NGIA 2E20A 3HVRA 3CI5A 4XIUA 1K9MO 4WYBA 2ZQBA 1BDGA 3HPGA 2HVHA 1S1VA 4JHDA 3RMAA 3U9ZA 1W97L 2VGNA 3PO5A 3TAQA 1VSKA 3GOIA 4BC2A 4DG1A 4DTSA 4CJEA 1ASVA 1OH6A 4DQ8A 5AQHA 3I8DA 3B6OA 1NGFA 3K5MA 1SL0A 3VA3A 2I7NA 1YI2N 1T7PA 3VEVA 4PKHA 1N32K 3VEOA 3SK3A 1ILYA 4RW8A 5EX5A 1Q7YO 4WFNL 4H4OA 4DSIA 3G0ZA 3G71N 3NVMA 3HSCA 1JCFA 1VSHA 1S9GA 1W9HA 3D6RA 4IBNA 4DTUA 3RRHA 3TARA 3V1QA 1ATSA 4KB0A 3EEQA 2BGGA 4CZLA 1B9FA 3W3DA 5LMNK 3LDPA 3VQCA 2IOCA 4OVLA 3A5NC 1I39A 2P9IB 2E1YA 3MX5A 3SYZA 3PLAA 4C1NK 1SL1A 3AVGA 5D3GA 1C0TA 3OJUA 3A5MC 2QWNA 5GAEP 2XY6A 2P9UB 1W2BM 1DLOA 1M1KO 3LANA 4KH6A 2BDPA 3ATVA 4BRLA 3KD1E 2RPIA 2D0BA 1KXPA 2G8UA 1RBUA 5J2QA 1S72N 4F3TA 3SQ1A 5T7BA 1IBMK 1SS6A 5IT9O 4O0JA 3K2PA 4CHQA 4B08A 3ITHA 3ULEB 4CGIA 3OYAA 1FW6A 2GBZA 5ELZA 4ELUA 4FLXA 4LF9K 4FW2A 4GNIA 4OJRA 4BRAA 5BPMA 3G6EN 2O8CA 3VOVA 1NWKA 4DS5A 5AQQA 3FGUA 3L2WA 1ZBLA 1VSJA 2KKZA 1M90O 1MU2A 4FM1A 4RWTA 4CEBA 4CJKA 4IO9L 1TVRA 3HM8A 4IFEA 3DOLA 3DMJA 3LP2A 1UA1A 1L3UA 3CCQN 2Q31A 4CJ7A 2PYJA 3R8EA 1RDBA 3AO4A 1U4BA 4IFVA 4B9QA 1K8KA 2GTDA 4DSLA 1BQMA 3BF1A 4DR4K 3U9DA 4IEIA 5C24A 3CETA 4CZFA 1HJRA 4DF8A 3TSQA 2G8KA 3C6TA 4M7XA 3P5JA 1Z26A 4I9LA 3LWMA 4LFAK 3D2FB 5HRPA 1WOQA 2P9PA 5DK5A 1B9DA 4Z4HA 3DXKB 3OW2M 5M1FA 4KAZA 5AQGA 1NJZA 2OCEA 3TSUA 3LP3A 3CCMN 1MWMA 1NOZA 3KZBA 4GY2B 2KTQA 4N56A 1C1BA 1TV6A 3KK2A 2ASPA 4E7IA 2ITGA 3M6GA 5ADXA 2B4JA 2O8EA 4G1QA 2JWLA 4JEPA 2W6LA 2IGIA 2KW4A 3KKRA 1CLQA 1JLGA 1A5XA 2E2OA 1C1AA 4J2DA 2ZM6K 4JKEA 1HRHA 4JHDB 4O5FA 1KSPA 1TYQB 4M3TA 4BDPA 2PBDA 3FFIA 2KFNA 3OBYA 1QSYA 5KGWA 3JS6A 4EFHA 3SUNA 3SV4A 4BDZA 1RCHA 3DLKA 3D2EA 4CJWA 4LF6K 2CH6A 2HNZA 1IH7A 1X9JA 1H1VA 4AF1A 3K9JA 4BR7A 1X3NA 4Y1CA 2ZJRL 2Q97A 2Z1GA 5AQYA 4BWMA 3L0QA 3AO1A 2GWJA 1UAXA 5KQ8A 3NGYA 1YIJN 3PX4A 2HVIA 4BVOA 3MWPA 2XHBA 1IG9A 2PFUA 4DTRA 5CY4A 3TANA 3CC7N 4CBUA 3AA4A 4EZ6A 3AO3A 4LFCK 5H1SQ 4OLBA 1EETA 1IJJA 4LF5K 1GLLO 4E7LA 1TL1A 1GLAG 4JV5K 3CCVN 4CEDA 1HX1A 1JLCA 2X74A 2P5GA 4JKBA 4FYDA 3I0RA 3NCIA 2F9WA 3VEZA 2GV9A 3L2QA 1DEJA 4JKFA 3ZSRA 4CHNA 4FJ5A 4KO0A 3N4QA 4PL7A 1QVFM 1HNIA 4H0XB 4F2SA 4DQQA 4OGEA 3OYDA 3Q7CA 1YTUA 3SQ0A 3KLHA 2PAVA 1MDUB 3VQQA 1RFQA 4CJ3A 4BR9A 5AZJA 1SV5A 3OTOK 1SL2A 2A6AA 4Y0WA 5AQNA 4BRPA 3N4PA 3K9KA 3O4WA 3OYMA 3FZLA 3DXMA 4HWIA 1TAQA 4A5BA 4FLUA 2D0AA 2XY5A 3MCAB 3O4QA 3BZCA 1CXUA 4K41A 3CCEN 4IOAL 3TTCA 2LSNA 4CBWA 1TK0A 1IKXA 3OA9A 5AQMA 2HSTA 4JI7K 1F21A 3GDQA 4H5TA 3HK2A 4JK8A 3O9RA 1GOBA 3DXKA 4BQLA 3CCUN 4KHSA 1JL1A 4B8AB 3THWB 4FJHA 1E4FT 3RSEB 4BQZA 3SQ4A 1BI4B 1RTHA 3TAPA 3SPZA 4CJ5A 4ISGA 3GBTA 5K14A 4GVEA 4FK4A 3L2RA 1QTMA 3RWUA 1A5VA 5GAHP 2YX6A 3THYA 3C7NB 4Z4FA 3CCJN 1NGBA 3W0LA 2WC9A 4X66K 2CGJA 3EN9A 3S3NA 4RTFD 3R9PA 3KHYA 1EXQA 3MN5A 4MDAA 3ZT1A 3TAEA 3F2KA 1YJNN 3ZSVA 4BVPA 1J5EK 3HL8A 2G8WA 4Q0BA 4IG0A 1KC8O 3SAFA 3DYAA 1FXXA 2P9SA 2F8TA 3VGKA 4CZEA 1HUXA 2P9PB 1S1UA 4KH4A 2HF4A 2KHOA 4A61A 4KPYA 4CF1A 3OS0A 4DSKA 4JI5K 4H4MA 3O9UA 1X9WA 1RBSA 3QESA 2HB5A 5CYMA 5GINA 3O3HA 4RW9A 3UKRB 2OZMA 4BC3A 2IVNA 3ENBA 4EIAA 2UU9K 4M3XA 4KHNA 1NM1A 4PY5A 3QNOA 3PX6A 2FF6A 3HYFA 4QAGA 2QTDA 4CK1A 4CCHA 1NKEA 3RMDA 4CVNE 3ZLJA 2HMPA 4W5NA 1L3VA 2GWKA 3WXLA 4FM2A 4IZ9A 3SI6A 5AQLA 1WAJA 4OPAA 5GIPA 4NO7A 1BCOA 5CHIA 3DWLA 3OY9A 3CJ7A 4CJLA 5BREA 3WXIA 1XNRK 3IDHA 1X9MA 3A5OC 3V1RA 3CPEA 4FOEA 1D9FA 4C23A 3CJ1A 3MN7A 3ZSZA 4CD1A 4AM6A 2G8FA 1HYVA 1ITGA 2QXFA 3PUFA 2E2NA 3SNNA 1T8EA 3V4IA 4E1NA 3D7EO 3NF7A 2Z1HA 4L3QA 4CK2A 3CERA 2HBKA 4AILC 4JI3K 1JCGA 4H8KA 1LAWA 4FK0A 2ZE2A 4FJIA 2E6LA 4ISEA 1J5OA 3H6EA 4YOUA 1BIUA 4DLEA 4B1YB 4V19S 4A57A 3CD6N 4PL8A 3SBGA 4OKEA 4H03B 3S9HA 3MEDA 1WSIA 1T44A 2E88A 3SPYA 3VPZA 3FZFA 4IWVA 5KPZA 4FWLA 3DLHA 3BZKA 2X6SA 1KVCA 4LH4A 4B1XB 3CQ8A 4H0YB 5BRFA 1EWQA 1HPZA 1NGGA 1HNWK 4GVMA 4FSVA 3THVA 4PHTX 4DU1A 1KFDA 5AZIA 2OTJN 5KPRA 5KTQA 4DFMA 1RDDA 3KK1A 5AZJB 2ZGZA 2HHTA 1NGJA 1BU6O 3CQXA 1NK8A 3LDQA 1ATRA 3F9KA 5AQXA 2FSKA 1XI1A 1GLDG 2WBNA 4LC9B 2PYLA 3MWTA 4WQ5C 1S3XA 4KREA 3P1GA 2E1ZA 3LZJA 5M1PA 3NF9A 2D0CA 3JAMO 2YNIA 5AQSA 1NGIA 5M1QA 4GV9A 3TTFA 3OYEA 1RT1A 3VQPA 4TSXA 1HKGA 1O13A 5FPNA 4B9MA 2YNFA 4YDUC 4DUYK 4B3MK 2YJFA 4JKGB 2NZTA 1TKXA 4FLYA 2DPNA 5IWAK 4K0KK 3EE9A 4H5RA 3A2FA 3O5BA 3ATUA 1TKDA 1RTJA 3C6UA 3L2UA 2ZD1A 3CG7A 3EY1A 3F9MA 3GG4A 3T1HK 2EHGA 1K8KB 3VQDA 3SMPA 3D2FA 2W42A 2P9NB 3C94A 3HPHA 3G25A 4BGBA 2B6AA 1XHXA 3L6QA 3ZETB 2D0PA 3HRGA 1Q81O 3U8XA 3H45C 1B92A 1LW0A 3OHRA 1BCMA 4LF7K 3ZYYX 2P51A 1NK7A 2Y1IA 4ILGB 3DRPA 4Y1DA 5AQUA 3OBWA 1G15A 5KPTA 5BN8A 5AQOA 3ENHA 1NK4A 4FJMA 3WNEA 1NKBA 5JLFA
chains in the Genus database with same CATH topology
4CJKA 4CJRA 1C1CA 1S1TA 1TVRA 2IC3A 3JSMA 4E89A 2HW3A 3DOLA 3LAKA 4EP4A 3DMJA 3LP2A 1UA1A 1EX4A 2A1SA 2Q3SA 5HROA 4AH9A 3K5LA 1L3UA 2VG6A 4JS5A 2IDOA 1S6PA 2PYJA 3QEVA 1RDBA 3AO4A 1U4BA 4IFVA 2G8VA 4HTUA 4FZZA 2DFHA 4JLHA 4E1MA 3HT3A 3V9ZA 3AVKA 4CHPA 3PO4A 4KHWA 3AVBA 2YNGA 3VA0A 4O55A 3TAFA 1VSEA 3HP6A 4DSLA 3NFAA 3P83D 1BQMA 3M8RA 5C25A 3NAEA 4CJ4A 4OKKA 3D0PA 1UOCA 5C24A 2VWJA 4OLAA 2FBTA 1HJRA 3KTQA 4N41A 4DF8A 3VQ5A 3C6TA 2G8KA 4ID5A 1JXEA 3P5JA 1U04A 2FBYA 1Z26A 3KKSA 4I9LA 3VQ7A 3LWMA 4B9UA 3MXJA 1RT4A 5HRNA 3QLHA 4E7JA 2KFZA 4E19A 5HRPA 5DK5A 4FM0A 1HQEA 5EU7A 2O4IA 2IAJA 1B9DA 4Z4HA 4ZHRA 1Q9XA 2FC0A 4LY7A 3LWLA 2DFEA 1WLJA 3G10A 3EZ5A 3OYNA 1D8YA 1JKHA 3SZ2A 4KAZA 3OS1A 1NJZA 3IG1A 3T3FA 4C8MA 3LP3A 4O0IA 4KB1A 1JL2A 1Q8IA 1NOZA 4CHZA 4KI6A 3AVHA 3VQ9A 2KTQA 3CFOA 1IKWA 4DU3A 1RBTA 4NCBA 2VG7A 4N56A 4F3OA 1C1BA 4KI4A 3RR7A 4CHOA 4L8RB 4DSFA 4AHRA 1TV6A 4FVMA 3KK2A 3NGZA 5HRRA 3OYGA 4E7IA 3BDPA 2ITGA 1KVAA 1LWCA 3ZT4A 1LV5A 2YHAA 4B9SA 3ZT0A 2B4JA 4E3SA 3TR8A 3VQEA 4G1QA 1ASWA 3U6FA 3VQ4A 1JXBA 1T05A 3AVFA 2IGIA 2OA8A 2KW4A 2OYQA 3KKRA 4DMNA 1JLGA 1CLQA 2DTUA 1A5XA 1TKZA 1C1AA 4LSLA 3U3YA 4J2DA 3U3GA 2YKMA 1HRHA 1LW2A 1KSPA 4M3TA 4CEFA 4BDPA 3QIOA 2XO7A 2HHUA 1ASUA 3FFIA 2Y1JA 2KFNA 2OPRA 1QSYA 3AVNA 4IG3A 5FDLA 1SKSA 3L2VA 5KGWA 4CFAA 3RR8A 1RTDA 3SUNA 1YT3A 4ELTA 4CESA 3QNNA 4FJXA 3SV4A 4BDZA 1EKEA 1RBRA 1RCHA 3DLKA 5DMRA 4CJWA 1HQUA 1JLFA 4BE1A 2HNZA 1IH7A 3ZT3A 4KHUA 1QS4A 3SUOA 3OYFA 3HPOA 4Y1CA 3AVMA 1WAFA 3WNHA 2Z1GA 3LP0A 1RDCA 1N5YA 3CFRA 4BWMA 4QCLA 2OPSA 3AO1A 1KTQA 1UAXA 4W5OA 3OYCA 3TWHA 3NGYA 1QSLA 4KTQA 2XY8A 3L3UA 4W5QA 1WSGA 3K59A 1VSIA 1S1XA 3PX4A 1WSHA 4OKJA 2HVIA 3OYHA 3K58A 3ZT2A 4E7HA 2XHBA 2G8IA 4CF9A 1JLQA 4CEEA 1REVA 3MEGA 1IG9A 3ULDA 3ASMA 4DTRA 5CY4A 4O44A 3TANA 2YV0X 2E4LA 2ATQA 3O3GA 3AA4A 4EZ6A 3PY8A 2HNDA 4CJPA 3AO3A 3MECA 3ISNC 3SV3A 1BISA 4NCGA 4OLBA 1WSEA 3OJSA 4OPJA 1Q9YA 5HP1A 1EETA 1VSDA 1FKPA 4E7LA 1S9EA 3BGRA 1TL1A 1C6VA 1S1WA 4CE9A 4ZTJA 1D9DA 4DSJA 4F8RA 1C0UA 4CEDA 3NDKA 4F2RA 4CF0A 4FZYA 2WONA 3NF8A 1JLCA 2X74A 4AHTA 2P5GA 3AO2A 3QIPA 4FYDA 4HUGA 3I0RA 3KLFA 3NCIA 4FLWA 2GV9A 3L2QA 4FJ5A 3ZSRA 1KVBA 3CM5A 4IFYA 4CHNA 3AVJA 4KO0A 3JYTA 3WNGA 4DU4A 1CZ9A 1HNIA 3IS9A 4I7FA 4CIFA 2NUBA 3KIOA 3NBPA 4DQQA 4OGEA 3OYDA 4F2SA 3M8SA 1YTUA 4YFUA 3SQ0A 3HSTB 3OYLA 3KLHA 1NK9A 4JRPA 1X9SA 3VQQA 4LD0A 5HLFA 1U49A 4CJ3A 1SKRA 4M41A 1QHTA 1Y97A 3VQAA 4DTJA 1SV5A 3M8QA 3MEEA 2JLEA 1S5JA 4C8NA 3AVCA 1SL2A 2F8SA 1RTIA 3RMBA 2HHQA 1U47A 3OYMA 3IAYA 4F4KA 4CF8A 5KRSA 3OYKA 1I3AA 3LALA 1TAQA 2QK9A 3OVNA 2HMIA 2HHWA 5FRMA 2OPPA 2DY4A 4FLUA 2D0AA 2P1JA 5KGXA 3AA5X 2XY5A 4FJ9A 3LP1A 2Z1IA 3EYZA 3CM6A 3H08A 3O4QA 4RW7A 1CXUA 1Z25A 2ETJA 4CEQA 4CGJA 4CEZA 2LSNA 1TK0A 4PWDA 1IKXA 2X6NA 4HVJA 1NK6A 4IDKA 3O3FA 3ZSYA 4GMJB 1F21A 1T03A 4B3OA 4W5RA 4R5PA 3HK2A 4CERA 1GOBA 2XRIA 4KHSA 3SUPA 1JL1A 1UWBA 4B8AB 2QKKA 4J2AA 1GOCA 3PV8A 1O1WA 1KLMA 4CFCA 4ZTFA 3AO5A 4FJHA 2KZZA 4ICLA 2XY7A 1TKTA 1ZBIA 4B9TA 3SQ4A 3V9WA 5CYQA 3QEPA 4AHCA 3PX0A 3HM9A 1ZBFA 1BI4B 1RTHA 3TAPA 3SPZA 4CJ5A 4FJNA 1RT7A 3DLEA 4CGGA 4NCAA 4DQRA 5K14A 4FK4A 3VQ6A 3L2RA 4KHYA 1QTMA 1KCFA 3WNFA 1A5VA 2BANA 5CZ2A 4CJQA 3RWUA 1BI4A 4CIGA 4B9VA 4Z4FA 2HHXA 1QQCA 1LAVA 4DTMA 4DTNA 4FJJA 4FJMA 5I3UA 4FZXC 3ZCMA 3NH1A 2O4GA 3DLBA 4FJLA 4RG8A 3S3NA 1EP4A 5FRNA 3HJFA 3HO1A 3DRSA 1EXQA 3DOKA 3O4NA 1XHZA 3ZT1A 2FBVA 3TAEA 4LSNA 5KI6A 3KJVA 3ZSVA 4HUFA 1XWLA 4EZ9A 1WN7A 3HL8A 4BE0A 2G8WA 3LDSA 4Q0BA 4IG0A 4ELVA 4M3ZA 2JGUA 3T19A 3DYAA 1FXXA 2F8TA 2KZMA 3IRXA 1S1UA 2GUIA 4AHUA 4KPYA 4MQ3A 4CF1A 3OS0A 1TL3A 3CYMA 4DSKA 4H4MA 3TAMA 1VSMA 1L3TA 4J2EA 1JLAA 1WSJA 1X9WA 4DTOA 2A1RA 1RBSA 3QESA 1BGXT 1QE1A 1NJYA 4DWIA 2HB5A 4DF4A 4DTPA 1D5AA 3KLIA 3NH0A 5CYMA 1DTTA 1RT3A 2YNHA 3I0SA 3O3HA 4B9NA 4HCCA 2X78A 2HHVA 1RILA 4RW6A 4RW9A 1TK8A 2OZSA 2OZMA 4FLTA 1U45A 1WSFA 1SKWA 3AVAA 1XC9A 4M3XA 1W0HA 4KHNA 4HUEA 2I5JA 4PY5A 3QNOA 3F73A 3PX6A 4M45A 4PUOA 3HYFA 4QAGA 4DSEA 1RBVA 1ZBUA 4CK1A 4Z4EA 4B8CA 1LWFA 3HXMA 4DFKA 5E41A 3V1OA 4MFBA 3D45A 4CJVA 2YKNA 2PY5A 4CCHA 1NKEA 1RDAA 4CIEA 3SJJA 4JS4A 4CHYA 3RMDA 2QKBA 3DI6A 4CEAA 4O4GA 4W5NA 1L3VA 1BL3A 5J2MA 3QEIA 5JS2A 1BHLA 4CEOA 4W5TA 4FM2A 1HYZA 1KFSA 3DRRA 3C95A 4Z4CA 3SI6A 4I2PA 4UQGA 3OYIA 2RF2A 4FLVA 1VRTA 1WAJA 1DTQA 3AV9A 3T1AA 3S3MA 4IKFA 1BCOA 4DS4A 3QINA 3QERA 1KLNA 3K57A 2Z1JA 4C8OA 3OY9A 2BE2A 2FBXA 4CJLA 4FCYA 3TABA 1X1PA 3RRGA 4CJSA 3V9UA 1RT2A 1X9MA 4E0DA 4FXDA 4HCBA 4GW6A 3V1RA 3VQBA 1D9FA 4CGFA 2WOMA 3DM2A 4CFBA 5J1EA 3ZSZA 4N47A 3NE6A 3NH2A 2G8FA 1HYVA 4KV8A 1ITGA 5HBMA 2QXFA 3PUFA 3SNNA 1T8EA 4CF2A 3ZSWA 3V4IA 1NJXA 1BQNA 4E1NA 3RTVA 4BACA 3CFPA 4AHSA 4WE1A 3NF7A 1J9AA 2Z1HA 4CK2A 1UA0A 4DTXA 1RT5A 4M3YA 4CJTA 4M42A 3LPTA 3UIQA 4K8XA 4AILC 4O5BA 3B6PA 4AHVA 3LZIA 2RN2A 1FKOA 3KD5E 1R0AA 3VN5A 5I42A 1L3SA 3K5OA 4H8KA 4RW4A 4DFJA 1BIZA 3HVTA 4DQPA 1LAWA 4M3UA 4KKOA 4OPKA 4FK0A 2ZE2A 4FJIA 1WNSA 2E6LA 5KRTA 3L8BA 2KQ2A 4M3RA 3SUQA 1J5OA 4B9LA 4JRQA 1BIUA 2DFFA 3ZSXA 2B5JA 4DLEA 4FJ8A 1SUQA 3NGIA 3RMCA 4CJFA 3HVRA 4DQSA 4XIUA 1S6QA 4OKEA 1ZBHA 2D5RA 3S9HA 5FROA 3MEDA 1WSIA 2ZQBA 2E6MA 3OYJA 3SPYA 5SWMA 4Z4IA 3HPGA 3DLHA 3CQ8A 2X6SA 1KVCA 1S1VA 4LH4A 2HVHA 3RMAA 1IO2A 2VWKA 2EX3A 4HHTA 3V9SA 3PO5A 3NHGA 1HPZA 4J2BA 4GVMA 3THVA 3TAQA 3KLGA 1VSKA 4DU1A 1KFDA 4DG1A 4FW1A 4DTSA 3MXMA 4CJEA 3KLEA 1ASVA 4CGDA 5KTQA 3E01A 3V81A 3AVIA 4DFMA 1RDDA 4Z0UA 3KK1A 3I8DA 3B6OA 1JLEA 5HRSA 3K5MA 1ZYQA 1SL0A 4C8KA 3VA3A 2HHTA 4ID1A 1NK8A 1T7PA 3F9KA 1XI1A 3SQ2A 1YTAA 1NK5A 4RW8A 4QOZB 3HP9A 2PYLA 4DLGA 4H4OA 3TI0A 4DSIA 3G0ZA 1HMVA 3SCXA 4KREA 3P1GA 3DLRA 3LZJA 1VSHA 1W9HA 1S9GA 3AA2A 3NF9A 4DFPA 4CK3A 2D0CA 3QEWA 3L3VA 4IBNA 2YNIA 4OGCA 1L5UA 3ZSOA 3QETA 3M8PA 4EP5A 3OYEA 4DTUA 4FK2A 1RT1A 3RRHA 3VQPA 3AVLA 3TARA 4TSXA 3V1QA 4FJGA 3DLGA 5J2PA 1NK0A 4B9MA 4KB0A 2YNFA 2BGGA 1B9FA 4FJ7A 4M3WA 4LH5A 4BDYA 4Q5VA 2IS3A 3K5NA 2HHSA 1VSLA 1RT6A 1TKXA 3VQCA 2IOCA 4FLYA 1IKVA 4K8ZA 2RKIA 4OVLA 4CECA 3VQ8A 1I39A 1RNHA 3SYZA 3S3OA 3MAQA 5CZ1A 3A2FA 4E7KA 5J2NA 4Z4GA 2AJQA 1GOAA 1NKCA 4KFBA 4KHQA 2P5OA 1SL1A 1TKDA 1RTJA 3C6UA 3AVGA 3L2UA 5D3GA 2YHBA 1C0TA 4CFDA 1J54A 1K6YA 3ALYA 2ZD1A 3OJUA 1YVUA 4N5SA 3CG7A 1TAUA 1J53A 3EY1A 2OPQA 4BWJA 1LWEA 2XY6A 3MXIA 4I9QA 4FJKA 1FK9A 3QEXA 1HNVA 1DLOA 4I2QA 5JS1A 2EHGA 1C0MA 1VSFA 3LANA 2BDPA 4NYFA 1QSSA 3VQDA 3KD1E 1N6QA 2RPIA 2W42A 2R7YA 2D0BA 3AA3A 1VRUA 4BE2A 1CXQA 3C94A 3HPHA 4KRFA 4N76A 2G8UA 1RBUA 5J2QA 1VK0A 4F3TA 4YNQA 3SQ1A 4CGHA 3V9XA 3OS2A 4PQUA 5T7BA 1JLBA 2B6AA 1TK5A 1XHXA 3QO9A 5SZTA 4O0JA 3K2PA 1TGOA 4CHQA 2F96A 4B08A 3ITHA 4C8LA 4CGIA 1B92A 5C42A 1LW0A 3OYAA 4CJUA 4DQIA 2GBZA 1BCMA 1HYSA 4ELUA 2P51A 3NF6A 4FLXA 1A5WA 3TAGA 2Y1IA 3KK3A 1NK7A 1NJWA 4FW2A 4KTZA 2HNYA 4OJRA 3DRPA 4Y1DA 4KTWA 1U48A 1G15A 4NYNA 1NOYA 3LPUA 2G8HA 2PZSA 3V6DA 4FLZA 3LAMA 4PA1A 4DS5A 1KRPA 3ZSQA 3L2WA 3OYBA 1NK4A 1ZBLA 1VSJA 2VG5A 1IKYA 1MU2A 1CZBA 4FM1A 3WNEA 1NKBA 4CEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJK A;  4CJR A;  1C1C A;  1S1T A;  1TVR A;  2IC3 A;  3JSM A;  4E89 A;  2HW3 A;  3DOL A;  3LAK A;  4EP4 A;  3DMJ A;  3LP2 A;  1UA1 A;  1EX4 A;  2A1S A;  2Q3S A;  5HRO A;  4AH9 A;  3K5L A;  1L3U A;  2VG6 A;  4JS5 A;  2IDO A;  1S6P A;  2PYJ A;  3QEV A;  1RDB A;  3AO4 A;  1U4B A;  4IFV A;  2G8V A;  4HTU A;  4FZZ A;  2DFH A;  4JLH A;  4E1M A;  3HT3 A;  3V9Z A;  3AVK A;  4CHP A;  3PO4 A;  4KHW A;  3AVB A;  2YNG A;  3VA0 A;  4O55 A;  3TAF A;  1VSE A;  3HP6 A;  4DSL A;  3NFA A;  3P83 D;  1BQM A;  3M8R A;  5C25 A;  3NAE A;  4CJ4 A;  4OKK A;  3D0P A;  1UOC A;  5C24 A;  2VWJ A;  4OLA A;  2FBT A;  1HJR A;  3KTQ A;  4N41 A;  4DF8 A;  3VQ5 A;  3C6T A;  2G8K A;  4ID5 A;  1JXE A;  3P5J A;  1U04 A;  2FBY A;  1Z26 A;  3KKS A;  4I9L A;  3VQ7 A;  3LWM A;  4B9U A;  3MXJ A;  1RT4 A;  5HRN A;  3QLH A;  4E7J A;  2KFZ A;  4E19 A;  5HRP A;  5DK5 A;  4FM0 A;  1HQE A;  5EU7 A;  2O4I A;  2IAJ A;  1B9D A;  4Z4H A;  4ZHR A;  1Q9X A;  2FC0 A;  4LY7 A;  3LWL A;  2DFE A;  1WLJ A;  3G10 A;  3EZ5 A;  3OYN A;  1D8Y A;  1JKH A;  3SZ2 A;  4KAZ A;  3OS1 A;  1NJZ A;  3IG1 A;  3T3F A;  4C8M A;  3LP3 A;  4O0I A;  4KB1 A;  1JL2 A;  1Q8I A;  1NOZ A;  4CHZ A;  4KI6 A;  3AVH A;  3VQ9 A;  2KTQ A;  3CFO A;  1IKW A;  4DU3 A;  1RBT A;  4NCB A;  2VG7 A;  4N56 A;  4F3O A;  1C1B A;  4KI4 A;  3RR7 A;  4CHO A;  4L8R B;  4DSF A;  4AHR A;  1TV6 A;  4FVM A;  3KK2 A;  3NGZ A;  5HRR A;  3OYG A;  4E7I A;  3BDP A;  2ITG A;  1KVA A;  1LWC A;  3ZT4 A;  1LV5 A;  2YHA A;  4B9S A;  3ZT0 A;  2B4J A;  4E3S A;  3TR8 A;  3VQE A;  4G1Q A;  1ASW A;  3U6F A;  3VQ4 A;  1JXB A;  1T05 A;  3AVF A;  2IGI A;  2OA8 A;  2KW4 A;  2OYQ A;  3KKR A;  4DMN A;  1JLG A;  1CLQ A;  2DTU A;  1A5X A;  1TKZ A;  1C1A A;  4LSL A;  3U3Y A;  4J2D A;  3U3G A;  2YKM A;  1HRH A;  1LW2 A;  1KSP A;  4M3T A;  4CEF A;  4BDP A;  3QIO A;  2XO7 A;  2HHU A;  1ASU A;  3FFI A;  2Y1J A;  2KFN A;  2OPR A;  1QSY A;  3AVN A;  4IG3 A;  5FDL A;  1SKS A;  3L2V A;  5KGW A;  4CFA A;  3RR8 A;  1RTD A;  3SUN A;  1YT3 A;  4ELT A;  4CES A;  3QNN A;  4FJX A;  3SV4 A;  4BDZ A;  1EKE A;  1RBR A;  1RCH A;  3DLK A;  5DMR A;  4CJW A;  1HQU A;  1JLF A;  4BE1 A;  2HNZ A;  1IH7 A;  3ZT3 A;  4KHU A;  1QS4 A;  3SUO A;  3OYF A;  3HPO A;  4Y1C A;  3AVM A;  1WAF A;  3WNH A;  2Z1G A;  3LP0 A;  1RDC A;  1N5Y A;  3CFR A;  4BWM A;  4QCL A;  2OPS A;  3AO1 A;  1KTQ A;  1UAX A;  4W5O A;  3OYC A;  3TWH A;  3NGY A;  1QSL A;  4KTQ A;  2XY8 A;  3L3U A;  4W5Q A;  1WSG A;  3K59 A;  1VSI A;  1S1X A;  3PX4 A;  1WSH A;  4OKJ A;  2HVI A;  3OYH A;  3K58 A;  3ZT2 A;  4E7H A;  2XHB A;  2G8I A;  4CF9 A;  1JLQ A;  4CEE A;  1REV A;  3MEG A;  1IG9 A;  3ULD A;  3ASM A;  4DTR A;  5CY4 A;  4O44 A;  3TAN A;  2YV0 X;  2E4L A;  2ATQ A;  3O3G A;  3AA4 A;  4EZ6 A;  3PY8 A;  2HND A;  4CJP A;  3AO3 A;  3MEC A;  3ISN C;  3SV3 A;  1BIS A;  4NCG A;  4OLB A;  1WSE A;  3OJS A;  4OPJ A;  1Q9Y A;  5HP1 A;  1EET A;  1VSD A;  1FKP A;  4E7L A;  1S9E A;  3BGR A;  1TL1 A;  1C6V A;  1S1W A;  4CE9 A;  4ZTJ A;  1D9D A;  4DSJ A;  4F8R A;  1C0U A;  4CED A;  3NDK A;  4F2R A;  4CF0 A;  4FZY A;  2WON A;  3NF8 A;  1JLC A;  2X74 A;  4AHT A;  2P5G A;  3AO2 A;  3QIP A;  4FYD A;  4HUG A;  3I0R A;  3KLF A;  3NCI A;  4FLW A;  2GV9 A;  3L2Q A;  4FJ5 A;  3ZSR A;  1KVB A;  3CM5 A;  4IFY A;  4CHN A;  3AVJ A;  4KO0 A;  3JYT A;  3WNG A;  4DU4 A;  1CZ9 A;  1HNI A;  3IS9 A;  4I7F A;  4CIF A;  2NUB A;  3KIO A;  3NBP A;  4DQQ A;  4OGE A;  3OYD A;  4F2S A;  3M8S A;  1YTU A;  4YFU A;  3SQ0 A;  3HST B;  3OYL A;  3KLH A;  1NK9 A;  4JRP A;  1X9S A;  3VQQ A;  4LD0 A;  5HLF A;  1U49 A;  4CJ3 A;  1SKR A;  4M41 A;  1QHT A;  1Y97 A;  3VQA A;  4DTJ A;  1SV5 A;  3M8Q A;  3MEE A;  2JLE A;  1S5J A;  4C8N A;  3AVC A;  1SL2 A;  2F8S A;  1RTI A;  3RMB A;  2HHQ A;  1U47 A;  3OYM A;  3IAY A;  4F4K A;  4CF8 A;  5KRS A;  3OYK A;  1I3A A;  3LAL A;  1TAQ A;  2QK9 A;  3OVN A;  2HMI A;  2HHW A;  5FRM A;  2OPP A;  2DY4 A;  4FLU A;  2D0A A;  2P1J A;  5KGX A;  3AA5 X;  2XY5 A;  4FJ9 A;  3LP1 A;  2Z1I A;  3EYZ A;  3CM6 A;  3H08 A;  3O4Q A;  4RW7 A;  1CXU A;  1Z25 A;  2ETJ A;  4CEQ A;  4CGJ A;  4CEZ A;  2LSN A;  1TK0 A;  4PWD A;  1IKX A;  2X6N A;  4HVJ A;  1NK6 A;  4IDK A;  3O3F A;  3ZSY A;  4GMJ B;  1F21 A;  1T03 A;  4B3O A;  4W5R A;  4R5P A;  3HK2 A;  4CER A;  1GOB A;  2XRI A;  4KHS A;  3SUP A;  1JL1 A;  1UWB A;  4B8A B;  2QKK A;  4J2A A;  1GOC A;  3PV8 A;  1O1W A;  1KLM A;  4CFC A;  4ZTF A;  3AO5 A;  4FJH A;  2KZZ A;  4ICL A;  2XY7 A;  1TKT A;  1ZBI A;  4B9T A;  3SQ4 A;  3V9W A;  5CYQ A;  3QEP A;  4AHC A;  3PX0 A;  3HM9 A;  1ZBF A;  1BI4 B;  1RTH A;  3TAP A;  3SPZ A;  4CJ5 A;  4FJN A;  1RT7 A;  3DLE A;  4CGG A;  4NCA A;  4DQR A;  5K14 A;  4FK4 A;  3VQ6 A;  3L2R A;  4KHY A;  1QTM A;  1KCF A;  3WNF A;  1A5V A;  2BAN A;  5CZ2 A;  4CJQ A;  3RWU A;  1BI4 A;  4CIG A;  4B9V A;  4Z4F A;  2HHX A;  1QQC A;  1LAV A;  4DTM A;  4DTN A;  4FJJ A;  4FJM A;  5I3U A;  4FZX C;  3ZCM A;  3NH1 A;  2O4G A;  3DLB A;  4FJL A;  4RG8 A;  3S3N A;  1EP4 A;  5FRN A;  3HJF A;  3HO1 A;  3DRS A;  1EXQ A;  3DOK A;  3O4N A;  1XHZ A;  3ZT1 A;  2FBV A;  3TAE A;  4LSN A;  5KI6 A;  3KJV A;  3ZSV A;  4HUF A;  1XWL A;  4EZ9 A;  1WN7 A;  3HL8 A;  4BE0 A;  2G8W A;  3LDS A;  4Q0B A;  4IG0 A;  4ELV A;  4M3Z A;  2JGU A;  3T19 A;  3DYA A;  1FXX A;  2F8T A;  2KZM A;  3IRX A;  1S1U A;  2GUI A;  4AHU A;  4KPY A;  4MQ3 A;  4CF1 A;  3OS0 A;  1TL3 A;  3CYM A;  4DSK A;  4H4M A;  3TAM A;  1VSM A;  1L3T A;  4J2E A;  1JLA A;  1WSJ A;  1X9W A;  4DTO A;  2A1R A;  1RBS A;  3QES A;  1BGX T;  1QE1 A;  1NJY A;  4DWI A;  2HB5 A;  4DF4 A;  4DTP A;  1D5A A;  3KLI A;  3NH0 A;  5CYM A;  1DTT A;  1RT3 A;  2YNH A;  3I0S A;  3O3H A;  4B9N A;  4HCC A;  2X78 A;  2HHV A;  1RIL A;  4RW6 A;  4RW9 A;  1TK8 A;  2OZS A;  2OZM A;  4FLT A;  1U45 A;  1WSF A;  1SKW A;  3AVA A;  1XC9 A;  4M3X A;  1W0H A;  4KHN A;  4HUE A;  2I5J A;  4PY5 A;  3QNO A;  3F73 A;  3PX6 A;  4M45 A;  4PUO A;  3HYF A;  4QAG A;  4DSE A;  1RBV A;  1ZBU A;  4CK1 A;  4Z4E A;  4B8C A;  1LWF A;  3HXM A;  4DFK A;  5E41 A;  3V1O A;  4MFB A;  3D45 A;  4CJV A;  2YKN A;  2PY5 A;  4CCH A;  1NKE A;  1RDA A;  4CIE A;  3SJJ A;  4JS4 A;  4CHY A;  3RMD A;  2QKB A;  3DI6 A;  4CEA A;  4O4G A;  4W5N A;  1L3V A;  1BL3 A;  5J2M A;  3QEI A;  5JS2 A;  1BHL A;  4CEO A;  4W5T A;  4FM2 A;  1HYZ A;  1KFS A;  3DRR A;  3C95 A;  4Z4C A;  3SI6 A;  4I2P A;  4UQG A;  3OYI A;  2RF2 A;  4FLV A;  1VRT A;  1WAJ A;  1DTQ A;  3AV9 A;  3T1A A;  3S3M A;  4IKF A;  1BCO A;  4DS4 A;  3QIN A;  3QER A;  1KLN A;  3K57 A;  2Z1J A;  4C8O A;  3OY9 A;  2BE2 A;  2FBX A;  4CJL A;  4FCY A;  3TAB A;  1X1P A;  3RRG A;  4CJS A;  3V9U A;  1RT2 A;  1X9M A;  4E0D A;  4FXD A;  4HCB A;  4GW6 A;  3V1R A;  3VQB A;  1D9F A;  4CGF A;  2WOM A;  3DM2 A;  4CFB A;  5J1E A;  3ZSZ A;  4N47 A;  3NE6 A;  3NH2 A;  2G8F A;  1HYV A;  4KV8 A;  1ITG A;  5HBM A;  2QXF A;  3PUF A;  3SNN A;  1T8E A;  4CF2 A;  3ZSW A;  3V4I A;  1NJX A;  1BQN A;  4E1N A;  3RTV A;  4BAC A;  3CFP A;  4AHS A;  4WE1 A;  3NF7 A;  1J9A A;  2Z1H A;  4CK2 A;  1UA0 A;  4DTX A;  1RT5 A;  4M3Y A;  4CJT A;  4M42 A;  3LPT A;  3UIQ A;  4K8X A;  4AIL C;  4O5B A;  3B6P A;  4AHV A;  3LZI A;  2RN2 A;  1FKO A;  3KD5 E;  1R0A A;  3VN5 A;  5I42 A;  1L3S A;  3K5O A;  4H8K A;  4RW4 A;  4DFJ A;  1BIZ A;  3HVT A;  4DQP A;  1LAW A;  4M3U A;  4KKO A;  4OPK A;  4FK0 A;  2ZE2 A;  4FJI A;  1WNS A;  2E6L A;  5KRT A;  3L8B A;  2KQ2 A;  4M3R A;  3SUQ A;  1J5O A;  4B9L A;  4JRQ A;  1BIU A;  2DFF A;  3ZSX A;  2B5J A;  4DLE A;  4FJ8 A;  1SUQ A;  3NGI A;  3RMC A;  4CJF A;  3HVR A;  4DQS A;  4XIU A;  1S6Q A;  4OKE A;  1ZBH A;  2D5R A;  3S9H A;  5FRO A;  3MED A;  1WSI A;  2ZQB A;  2E6M A;  3OYJ A;  3SPY A;  5SWM A;  4Z4I A;  3HPG A;  3DLH A;  3CQ8 A;  2X6S A;  1KVC A;  1S1V A;  4LH4 A;  2HVH A;  3RMA A;  1IO2 A;  2VWK A;  2EX3 A;  4HHT A;  3V9S A;  3PO5 A;  3NHG A;  1HPZ A;  4J2B A;  4GVM A;  3THV A;  3TAQ A;  3KLG A;  1VSK A;  4DU1 A;  1KFD A;  4DG1 A;  4FW1 A;  4DTS A;  3MXM A;  4CJE A;  3KLE A;  1ASV A;  4CGD A;  5KTQ A;  3E01 A;  3V81 A;  3AVI A;  4DFM A;  1RDD A;  4Z0U A;  3KK1 A;  3I8D A;  3B6O A;  1JLE A;  5HRS A;  3K5M A;  1ZYQ A;  1SL0 A;  4C8K A;  3VA3 A;  2HHT A;  4ID1 A;  1NK8 A;  1T7P A;  3F9K A;  1XI1 A;  3SQ2 A;  1YTA A;  1NK5 A;  4RW8 A;  4QOZ B;  3HP9 A;  2PYL A;  4DLG A;  4H4O A;  3TI0 A;  4DSI A;  3G0Z A;  1HMV A;  3SCX A;  4KRE A;  3P1G A;  3DLR A;  3LZJ A;  1VSH A;  1W9H A;  1S9G A;  3AA2 A;  3NF9 A;  4DFP A;  4CK3 A;  2D0C A;  3QEW A;  3L3V A;  4IBN A;  2YNI A;  4OGC A;  1L5U A;  3ZSO A;  3QET A;  3M8P A;  4EP5 A;  3OYE A;  4DTU A;  4FK2 A;  1RT1 A;  3RRH A;  3VQP A;  3AVL A;  3TAR A;  4TSX A;  3V1Q A;  4FJG A;  3DLG A;  5J2P A;  1NK0 A;  4B9M A;  4KB0 A;  2YNF A;  2BGG A;  1B9F A;  4FJ7 A;  4M3W A;  4LH5 A;  4BDY A;  4Q5V A;  2IS3 A;  3K5N A;  2HHS A;  1VSL A;  1RT6 A;  1TKX A;  3VQC A;  2IOC A;  4FLY A;  1IKV A;  4K8Z A;  2RKI A;  4OVL A;  4CEC A;  3VQ8 A;  1I39 A;  1RNH A;  3SYZ A;  3S3O A;  3MAQ A;  5CZ1 A;  3A2F A;  4E7K A;  5J2N A;  4Z4G A;  2AJQ A;  1GOA A;  1NKC A;  4KFB A;  4KHQ A;  2P5O A;  1SL1 A;  1TKD A;  1RTJ A;  3C6U A;  3AVG A;  3L2U A;  5D3G A;  2YHB A;  1C0T A;  4CFD A;  1J54 A;  1K6Y A;  3ALY A;  2ZD1 A;  3OJU A;  1YVU A;  4N5S A;  3CG7 A;  1TAU A;  1J53 A;  3EY1 A;  2OPQ A;  4BWJ A;  1LWE A;  2XY6 A;  3MXI A;  4I9Q A;  4FJK A;  1FK9 A;  3QEX A;  1HNV A;  1DLO A;  4I2Q A;  5JS1 A;  2EHG A;  1C0M A;  1VSF A;  3LAN A;  2BDP A;  4NYF A;  1QSS A;  3VQD A;  3KD1 E;  1N6Q A;  2RPI A;  2W42 A;  2R7Y A;  2D0B A;  3AA3 A;  1VRU A;  4BE2 A;  1CXQ A;  3C94 A;  3HPH A;  4KRF A;  4N76 A;  2G8U A;  1RBU A;  5J2Q A;  1VK0 A;  4F3T A;  4YNQ A;  3SQ1 A;  4CGH A;  3V9X A;  3OS2 A;  4PQU A;  5T7B A;  1JLB A;  2B6A A;  1TK5 A;  1XHX A;  3QO9 A;  5SZT A;  4O0J A;  3K2P A;  1TGO A;  4CHQ A;  2F96 A;  4B08 A;  3ITH A;  4C8L A;  4CGI A;  1B92 A;  5C42 A;  1LW0 A;  3OYA A;  4CJU A;  4DQI A;  2GBZ A;  1BCM A;  1HYS A;  4ELU A;  2P51 A;  3NF6 A;  4FLX A;  1A5W A;  3TAG A;  2Y1I A;  3KK3 A;  1NK7 A;  1NJW A;  4FW2 A;  4KTZ A;  2HNY A;  4OJR A;  3DRP A;  4Y1D A;  4KTW A;  1U48 A;  1G15 A;  4NYN A;  1NOY A;  3LPU A;  2G8H A;  2PZS A;  3V6D A;  4FLZ A;  3LAM A;  4PA1 A;  4DS5 A;  1KRP A;  3ZSQ A;  3L2W A;  3OYB A;  1NK4 A;  1ZBL A;  1VSJ A;  2VG5 A;  1IKY A;  1MU2 A;  1CZB A;  4FM1 A;  3WNE A;  1NKB A;  4CEB A; 
#chains in the Genus database with same CATH topology
 3CCR N;  2IC3 A;  4E89 A;  1EX4 A;  2W40 A;  2YCH A;  2IDO A;  1S6P A;  5BRD A;  4NXM K;  2DFH A;  1S22 A;  4JLH A;  3AVK A;  4CHP A;  1VSE A;  1T6C A;  3NFA A;  3P83 D;  3BY5 A;  3HOS A;  4I6M B;  3NAE A;  4MO5 A;  4BC4 A;  3THY B;  2VWJ A;  2V7Y A;  1VQ8 N;  4FPA A;  3UKU B;  2P9L B;  3VQ7 A;  3ID6 A;  4BG8 A;  4B9U A;  1RT4 A;  1VQ9 N;  5AQJ A;  4NLB A;  4DCH A;  4MO4 A;  2IAJ A;  2GX9 A;  3LWL A;  2DFE A;  4FWP A;  5FPE A;  1JKH A;  3SZ2 A;  1VQK N;  3CJA A;  1XMO K;  3LM9 A;  4O0I A;  2VWB A;  1Q8I A;  3MCP A;  4CHZ A;  3VQ9 A;  3CFO A;  4FVU A;  4KI4 A;  1Z6R A;  4DSF A;  4AHR A;  1ESV A;  2YI1 A;  4X65 K;  3T69 A;  4CBX A;  3NGZ A;  3WXJ A;  5HRR A;  3GE1 A;  1KVA A;  1LWC A;  2O8B B;  5CE3 A;  3M5R A;  5AFU A;  2YHA A;  4E1J A;  3ZT0 A;  3U6F A;  3VQ4 A;  1T05 A;  2OA8 A;  4DMN A;  4OPH A;  2DTU A;  3U3Y A;  3U3G A;  2QWL A;  2YKM A;  4LF4 K;  1LW2 A;  2HHU A;  1ASU A;  4WCE L;  2OPR A;  3AVN A;  4IG3 A;  1SKS A;  4DV5 K;  4CZM A;  1RTD A;  3WEE B;  2Q2R A;  1YT3 A;  3BUZ B;  4ELT A;  3E1Y A;  3CPW M;  2NRZ A;  1EKE A;  3BF3 A;  2O8C B;  1QS4 A;  2QWQ A;  5JIC A;  5AQP A;  3CFR A;  1K8A O;  4JKA A;  3DXM B;  2HOE A;  2ZJQ L;  3K59 A;  3AY9 A;  2KLA A;  3K58 A;  2AA4 A;  3ZET A;  2VQE K;  1JCE A;  5BR8 K;  3CC4 N;  2ATQ A;  3O3G A;  4R79 A;  3PY8 A;  3NVK A;  3MEC A;  3ISN C;  3I8B A;  1WSE A;  3OJS A;  5HP1 A;  1S9E A;  5FPM A;  1C6V A;  1S1W A;  4CE9 A;  1C0U A;  3NDK A;  4DV0 K;  3AO2 A;  4JKH A;  2WFB A;  1IBL K;  1KVB A;  3AVJ A;  5AQZ A;  4JYA K;  1CZ9 A;  4I7F A;  3QDK A;  5AZI B;  1VAZ A;  1YVN A;  2Q0R A;  3OYL A;  4F9O A;  4AQY K;  5EVZ A;  1X9S A;  1U49 A;  2JWK A;  3AAQ A;  4M41 A;  3MEE A;  2JLE A;  2NRV A;  4C8N A;  4JK7 A;  1RTI A;  3RMB A;  4IJA A;  4F4K A;  4ILJ A;  2HMI A;  1N8R O;  5FRM A;  3CF5 L;  3AA5 X;  2P9S B;  3CM6 A;  3G4S N;  4H0O A;  2ETJ A;  4CEZ A;  5BN9 A;  4X62 K;  3O3F A;  5DM6 L;  4WQ4 C;  4GMJ B;  3ZEU A;  4B3O A;  2IVP A;  4CER A;  3SUP A;  1UWB A;  4DR2 K;  5C2D A;  2QKK A;  1O1W A;  1KLM A;  3WEE A;  5BRH A;  1MA9 B;  3AO5 A;  2KZZ A;  1OVQ A;  1TKT A;  1ZBI A;  2IVO A;  4B9T A;  3V9W A;  4AHC A;  1T6D A;  1WBB A;  4H5V A;  1YHQ N;  3MX2 A;  3A8Y A;  1NGC A;  3VEX A;  2F4V K;  1NMN A;  4KHY A;  4CJQ A;  1LAV A;  4JK9 A;  4FJJ A;  2BUP A;  2VGM A;  3MK6 A;  4FJL A;  3ID8 A;  3HJF A;  4YOT A;  3O4N A;  2ASO A;  2O8F B;  1NJI O;  3PSI A;  4LSN A;  4CZH A;  1NBW A;  1ZXO A;  4HUF A;  3L4I A;  2P9L A;  2E2Q A;  4DV3 K;  2JGU A;  3T19 A;  1Y64 A;  5M1K A;  2W6K A;  4MQ3 A;  3VTH A;  3D2E B;  3TAM A;  1JLA A;  1HPM A;  3TSP A;  1N34 K;  3ULE A;  1NJY A;  4IOC L;  4DF4 A;  1D5A A;  3KLI A;  1V4T A;  3NH0 A;  1DTT A;  1RT3 A;  2YNH A;  4K42 A;  1X3M A;  1YAG A;  4CW7 B;  4HCC A;  2X78 A;  1XC3 A;  2HHV A;  4RW6 A;  2OZS A;  3T7Z A;  5E84 A;  5AFU H;  3R3L A;  5TKY A;  5JLH A;  1SKW A;  3AVA A;  3TPQ A;  4BRO A;  2E8A A;  2I5J A;  2O8B A;  4DSE A;  3VF6 A;  3C6A A;  4JI8 K;  1BG3 A;  4MFB A;  3D45 A;  3V1O A;  4CJV A;  2A42 A;  2QKB A;  3DI6 A;  5J2M A;  1BHL A;  4CEO A;  4BRH A;  4IDH A;  3C95 A;  4JI6 K;  3AV9 A;  3T1A A;  1QQO A;  3QIN A;  2Z1J A;  4C8O A;  1X1P A;  3RRG A;  4E0D A;  5KQD A;  3EKS A;  3VQB A;  5DM7 L;  4CGF A;  2WOM A;  3CJB A;  5J1E A;  4PKG A;  3SJH A;  4N47 A;  3NE6 A;  1K73 O;  3H1Q A;  4JNE A;  3ZSW A;  5C2F A;  4CF2 A;  3CFP A;  4AHS A;  4GV3 A;  4BR0 A;  4DTX A;  1RT5 A;  4CJT A;  4M42 A;  3UIQ A;  4BRE A;  1SAZ A;  4AHV A;  3VN5 A;  5I42 A;  1L3S A;  4RW4 A;  2HBJ A;  4M3U A;  3CCS N;  3ZX2 A;  3I56 N;  2UXB K;  4CZI A;  1QHA A;  4B9L A;  3VTI A;  3ZSX A;  2B5J A;  1IBK K;  5BR9 A;  3RMC A;  1GLB G;  2O8D A;  4LF8 K;  1S6Q A;  3M1F A;  1ZBH A;  3VGL A;  4DV7 K;  4YOY A;  2P9I A;  3OYJ A;  5SWM A;  4Z4I A;  3CCL N;  2EX3 A;  4HHT A;  3V9S A;  1GLC G;  3AGK A;  3GL1 A;  3J8A A;  3MXM A;  3KLE A;  3SAH A;  3E01 A;  1T3V A;  3AVI A;  4DV1 K;  3V81 A;  4Z0U A;  1ZYQ A;  1JLE A;  4C8K A;  4H5W A;  3U4L A;  1I94 K;  1YTA A;  1NK5 A;  1OVY A;  1DKG D;  3LDL A;  2QWM A;  3VF2 A;  1VHX A;  3KK7 A;  4K43 A;  3TI0 A;  1KAY A;  2F9T A;  1HMV A;  3I55 N;  4BRQ A;  2D0O A;  3AA2 A;  4X64 K;  4OGC A;  1L5U A;  3A5L C;  4IO8 A;  3M8P A;  4EP5 A;  4O8K A;  3AVL A;  3DAW A;  1QQN A;  4FJ7 A;  4LH5 A;  4BDY A;  2HHS A;  2IS3 A;  3AAR A;  1VSL A;  1RT6 A;  3SMS A;  1XQS C;  2RKI A;  4JI1 K;  1BA1 A;  3S3O A;  1QVG M;  1NKC A;  4KFB A;  5HL7 L;  4KHQ A;  4A59 A;  4QS7 A;  2YHB A;  1J54 A;  3ALY A;  4N5S A;  3R6M A;  3F5T A;  4BWJ A;  1LWE A;  3MXI A;  4I9Q A;  4FJK A;  1GLF O;  2QI2 A;  3QEX A;  1C0M A;  2CGK A;  4UY8 O;  3QFP A;  1VRU A;  5LL6 Z;  4YOW A;  3IMX A;  2O8F A;  3L4Q A;  1CXQ A;  4PKI A;  4BE2 A;  4KRF A;  4N76 A;  2A40 A;  1G99 A;  1VK0 A;  4YNQ A;  3V9X A;  4JKD A;  1TK5 A;  3QO9 A;  3H3N O;  3O9T A;  5JVH L;  3HI0 A;  1TGO A;  1OKJ A;  2F96 A;  3T1Y K;  4C8L A;  3DLL L;  4DHY A;  5C42 A;  5F2R A;  4LFB K;  2YHX A;  1HYS A;  3NF6 A;  1A5W A;  1NJW A;  4RCH A;  4KTW A;  4NYN A;  1NOY A;  5AQT A;  4GV6 A;  3V6D A;  3LAM A;  4QS9 A;  2ZGY A;  3VEN A;  3OYB A;  1IKY A;  4FWS A;  3Q7B A;  4CJR A;  1U6Z A;  1C1C A;  1S1T A;  4JN4 A;  3JSM A;  2HW3 A;  4JI2 K;  4A2B A;  5HRO A;  2Q3S A;  2VG6 A;  1ATN A;  3QEV A;  4J8F A;  4HTU A;  2RHK A;  4E1M A;  4KHW A;  2YNG A;  1TYQ A;  1ZBS A;  3K0S A;  5C25 A;  4CJ4 A;  4OKK A;  3WUH A;  4CZK A;  3D0P A;  3MN6 A;  1UOC A;  4OLA A;  1QQM A;  3KTQ A;  2UYT A;  5HOO A;  3KKS A;  3VF4 A;  3THX B;  3QLH A;  3DJC A;  3LL3 A;  4E7J A;  4E19 A;  5EU7 A;  1OH5 A;  3G10 A;  3OYN A;  4BRF A;  3OS1 A;  3IG1 A;  3T3F A;  4C8M A;  4KB1 A;  4KI6 A;  4NCB A;  4DU3 A;  3O8M A;  2VG7 A;  1Q86 O;  2UUB K;  3RR7 A;  4CHO A;  3HZ6 A;  3P38 A;  4FVM A;  3OYG A;  3BDP A;  4OO1 J;  3ZT4 A;  3TR8 A;  3VQE A;  1ASW A;  5F1X A;  1JXB A;  2NRW A;  1TKZ A;  1VQ5 N;  2GUP A;  3QIO A;  2Y1J A;  5C12 A;  1R59 O;  5FDL A;  3L2V A;  3RR8 A;  1C0G A;  5F0X A;  2OTL N;  4AM7 A;  1RBR A;  1HQU A;  3P4I A;  1GLE G;  3ZT3 A;  4YDU A;  4BG9 A;  5JVG L;  3QBX A;  3OYF A;  2BH1 A;  3HPO A;  3AVM A;  1WAF A;  1N5Y A;  2OPS A;  1KTQ A;  3E9O A;  3OYC A;  4KTQ A;  1WSG A;  1EO1 A;  1HKB A;  1S1X A;  1WSH A;  3FLC O;  3OYH A;  1KD1 O;  3ZT2 A;  4E7H A;  4CF9 A;  4CEE A;  2IIR A;  3MEG A;  3ASM A;  1LOT B;  1FJG K;  2HND A;  4BR4 A;  3MDQ A;  1BIS A;  1YIT N;  3NMU A;  3FZM A;  4OPJ A;  4IOX A;  4JD2 A;  3BGR A;  1U2V B;  4ZTJ A;  2Q1N A;  4DSJ A;  1Z05 A;  1NG9 A;  2WON A;  1CZA N;  2P9U A;  3QIP A;  4HUG A;  4H5N A;  4FLW A;  3C0B A;  1SZ2 A;  2NRX A;  1BWF O;  4IFY A;  3JYT A;  4DR5 K;  2D4W A;  3IS9 A;  4CIF A;  3NBP A;  3M8S A;  4YFU A;  3FZK A;  3HST B;  1NK9 A;  4JRP A;  5HLF A;  4LD0 A;  2E2P A;  4DTJ A;  3M8Q A;  1EQY A;  3AVC A;  2F8S A;  4YHH K;  2HHQ A;  1U47 A;  5KRS A;  3HOT A;  2W41 A;  2HF3 A;  1I3A A;  3LAL A;  4C1N I;  2DY4 A;  3ZEU B;  5KGX A;  3CJ9 A;  4FJ9 A;  3LP1 A;  2Z1I A;  1BUP A;  3EO3 A;  4RW7 A;  1Z25 A;  4CEQ A;  4CGJ A;  3THW A;  2E5L K;  4PWD A;  2X6N A;  1NK6 A;  4IDK A;  3ZSY A;  1T03 A;  3O08 A;  4W5R A;  2NRH A;  4DR1 K;  3O9Q A;  3VMF B;  3ZX0 A;  1GOC A;  3KWI A;  3PV8 A;  5TKW A;  5EOY A;  4ZTF A;  2BTF A;  3VEW A;  2XY7 A;  2QW9 A;  5CYQ A;  5LMU K;  3PX0 A;  3HM9 A;  3QIC A;  3EZW A;  3EE8 A;  1RT7 A;  4FJN A;  3RSE A;  2CGL A;  5GAG P;  4K25 A;  4DKW A;  3VQ6 A;  2ITM A;  3CMA N;  3KWG A;  3P39 A;  1QQC A;  4DV2 K;  1RDW X;  3ZCM A;  4YOV A;  3NH1 A;  2O4G A;  1HNZ K;  3DLB A;  5FRN A;  1NGA A;  4BC5 A;  1TUU A;  5KI6 A;  3CJC A;  1J6Z A;  1XWL A;  1WN7 A;  3PIP L;  1HJO A;  3LDS A;  4BE0 A;  4M3Z A;  3BP8 A;  3CIP A;  2KZM A;  3IRX A;  2GUI A;  4AHU A;  4A2A A;  1TL3 A;  1QZ6 A;  3CYM A;  4J2E A;  1L3T A;  4YOX A;  4FWM A;  4DTO A;  1VQO N;  3E9P A;  4DTP A;  4BR2 A;  3I0S A;  3A0I X;  5A2Q O;  4B9N A;  4BR5 A;  1RIL A;  5ADX H;  1U45 A;  2OAN A;  5C0Y A;  4CI6 A;  2GEM A;  4FL9 A;  2O8E B;  1XC9 A;  4FO0 A;  1W0H A;  2NRT A;  4HUE A;  3F73 A;  4M45 A;  4PUO A;  4NXN K;  2NNW A;  4WQ4 A;  4B8C A;  5E41 A;  2PY5 A;  1RDA A;  3FR0 A;  4CHY A;  4MLH A;  4O4G A;  1BL3 A;  1ZC6 A;  1KAZ A;  5JS2 A;  4BGA A;  1KFS A;  3J81 O;  1HYZ A;  3DRR A;  4JAX A;  1YJW N;  4UQG A;  2RF2 A;  1IG8 A;  1U2V A;  4FLV A;  2QEX N;  1VRT A;  4U7B A;  4IKF A;  2BE2 A;  2FBX A;  5EY4 A;  1TUY A;  4O8U A;  3VET A;  1RT2 A;  3V9U A;  4FXD A;  1YJ9 N;  4HCB A;  3DM2 A;  1P8Z A;  3IFR A;  3UKU A;  3NH2 A;  4KV8 A;  4DB3 A;  1BQN A;  3RTV A;  4Z94 A;  4BRG A;  4WE1 A;  1UA0 A;  4MLE A;  2I7P A;  3CHW A;  2V7Z A;  2VQF K;  4K8X A;  4FOI A;  3LZI A;  1FKO A;  2YHY A;  1R0A A;  4DV6 K;  5AQF A;  2NRR A;  3KVG A;  4DFJ A;  1RGI A;  3HVT A;  4OPK A;  3AAP A;  2O8D B;  1WNS A;  3L8B A;  3R1X A;  2KQ2 A;  3SUQ A;  3J7A P;  4NB4 A;  3H46 O;  4CJF A;  4DQS A;  5FPD A;  5LJW A;  4BRD A;  2D5R A;  3QB0 A;  5FRO A;  4XH4 A;  1YF5 L;  2E6M A;  4B3R K;  3WXK A;  3C65 A;  3EKU A;  3LM2 A;  1IO2 A;  3O80 A;  2VWK A;  3JXU A;  3NHG A;  4J2B A;  3KLG A;  3M3Z A;  5B8H A;  4FW1 A;  2GEL A;  4CGD A;  5BPL A;  3IUC A;  5HRS A;  4ID1 A;  2Q36 A;  3SQ2 A;  4QOZ B;  3HP9 A;  5C10 A;  4DLG A;  5AQW A;  3SCX A;  3DLR A;  1HR0 K;  4DFP A;  4CK3 A;  4DV4 K;  3QEW A;  3L3V A;  2QXL A;  3ZSO A;  3QET A;  4FK2 A;  1EWR A;  1WBD A;  4FJG A;  3DLG A;  1NNE A;  5J2P A;  1NK0 A;  3O6W A;  4B1W B;  4M3W A;  4QS8 A;  4Q5V A;  3K5N A;  3PIO L;  5CR4 A;  1IKV A;  4K8Z A;  4CEC A;  3VQ8 A;  1RNH A;  3MAQ A;  5CZ1 A;  4E7K A;  5J2N A;  4Z4G A;  2YJE A;  2AJQ A;  1GOA A;  4H0T B;  2P5O A;  3FFK B;  4G9Z A;  4CFD A;  1K6Y A;  1YVU A;  1TAU A;  1J53 A;  2OPQ A;  4A62 A;  1XUP O;  1FK9 A;  3QML A;  1HNV A;  1NMD A;  4I2Q A;  5JS1 A;  2ASM A;  3C6H A;  1VSF A;  4NYF A;  1QSS A;  1HKC A;  1N6Q A;  3THX A;  2R7Y A;  3AA3 A;  2HBM A;  2WTU A;  3CQY A;  4CGH A;  1XNQ K;  3OS2 A;  4PQU A;  1JLB A;  3I33 A;  4WFB L;  5AR0 A;  5SZT A;  3H3O B;  1HNX K;  3LDN A;  3VES A;  4CJU A;  1NGE A;  4DQI A;  3O1W A;  4H0P A;  3TAG A;  3UKR A;  1VQL N;  3KK3 A;  4KTZ A;  3TU5 A;  2HNY A;  1GLJ O;  1U48 A;  2PZS A;  2G8H A;  4OX9 K;  3LPU A;  3MMV A;  4FLZ A;  4PA1 A;  1KRP A;  3ZSQ A;  2VG5 A;  4DUZ K;  3VER A;  1CZB A;  3J80 O;  4U67 L;  3LAK A;  4EP4 A;  1E4G T;  2A1S A;  4NLC A;  4AH9 A;  3K5L A;  2WUS A;  1RDU A;  4JS5 A;  1JJ2 M;  4I6M A;  2G8V A;  2P9K B;  4FZZ A;  3VEY A;  1WB9 A;  1IV0 A;  4XH1 A;  3HT3 A;  3V9Z A;  3PO4 A;  3AVB A;  4CZJ A;  3VA0 A;  4O55 A;  3TAF A;  3HP6 A;  3M8R A;  3SAG A;  1NU0 A;  1N33 K;  2FBT A;  5LY3 A;  4N41 A;  3VQ5 A;  5M1N A;  4ID5 A;  1JXE A;  1U04 A;  2FBY A;  1VQ4 N;  4B3S K;  3MXJ A;  5HRN A;  4IEE A;  2KFZ A;  2O4I A;  4FM0 A;  1HQE A;  4ZHR A;  1Q9X A;  2FC0 A;  2H3G X;  4LY7 A;  1WLJ A;  1D8Y A;  3EZ5 A;  2ZWH A;  1JL2 A;  3J7Y P;  3O1B A;  2UUC K;  3AVH A;  1IKW A;  1RBT A;  4F3O A;  5GAD P;  4FWN A;  2VCP A;  4L8R B;  2QWR A;  4FWR A;  1NLV A;  3CME N;  1LV5 A;  1KAX A;  4B9S A;  4JI4 K;  4E3S A;  1LCU A;  3AVF A;  2OYQ A;  4IXC A;  4LSL A;  3IKM A;  1P90 A;  1QZ5 A;  5AQI A;  4BRM A;  3B8A X;  4CEF A;  4FPB A;  2XO7 A;  1OH7 A;  4CFA A;  4EHT A;  5C15 A;  3ZX3 A;  4CES A;  3QNN A;  3QBW A;  4FJX A;  3SBT A;  5AQK A;  3FE1 A;  5EXW A;  5DMR A;  1JLF A;  4BE1 A;  3ENO A;  1KQS M;  4KHU A;  3J7Z O;  3SUO A;  3E66 A;  1V4S A;  1YXQ A;  2HBL A;  3HBT A;  3WNH A;  3FZH A;  5M1O A;  3LP0 A;  1RDC A;  4FWK A;  3SLC A;  4GKK K;  4QCL A;  4W5O A;  2D1K A;  3TWH A;  1QSL A;  2XY8 A;  3L3U A;  4W5Q A;  1VSI A;  1VQ6 N;  3O9S A;  4OKJ A;  4YOR A;  2G8I A;  1JLQ A;  3WXM B;  4A5A A;  1REV A;  3ULD A;  1MWK A;  4O44 A;  2YV0 X;  2E4L A;  2J4R A;  4CJP A;  1DGK N;  5AQV A;  3SV3 A;  4NCG A;  2A41 A;  1Q9Y A;  1VSD A;  1FKP A;  1D9D A;  4F8R A;  4F2R A;  4DR6 K;  4CF0 A;  4FZY A;  3NF8 A;  4WF9 L;  4AHT A;  5LJV A;  1Q18 A;  3AGR A;  3KLF A;  3CM5 A;  2ZF5 O;  3WNG A;  4DU4 A;  2ZJP L;  2Q0U A;  2NUB A;  3KIO A;  1HLU A;  2A3Z A;  5GIO A;  4FWO A;  1SKR A;  4CD3 A;  1Q82 O;  1QHT A;  1Y97 A;  4MDB A;  3VQA A;  3CXC M;  4WFA L;  1S5J A;  3E9L A;  3H1V X;  3BEX A;  4XH5 A;  3LDO A;  3IAY A;  4CF8 A;  3OYK A;  4JKC A;  2QK9 A;  4IJN A;  3OVN A;  2HHW A;  2OPP A;  2FXU A;  2P1J A;  4M7Y A;  3RVC A;  3EYZ A;  3H08 A;  5FLX O;  4YY3 K;  4HTL A;  4ISF A;  1VQP N;  4HVJ A;  4XEI A;  2CH5 A;  1OH8 A;  4R5P A;  2QA4 N;  2XRI A;  2HHH K;  4J2A A;  4CFC A;  2RE2 A;  2QWP A;  4ICL A;  4BY9 C;  4M63 C;  3QEP A;  4BRI A;  4DR3 K;  1ZBF A;  2FSJ A;  4KHP K;  3WT0 A;  4B1U B;  3DLE A;  4BRN A;  4CGG A;  5AQR A;  4NCA A;  2FLO A;  4DQR A;  4BRK A;  1VQ7 N;  1KCF A;  3QFU A;  2BAN A;  4H0V B;  4JKG A;  5CZ2 A;  3WNF A;  1BI4 A;  4CIG A;  4B9V A;  2HHX A;  4DTM A;  4DTN A;  5I3U A;  4FZX C;  1XMQ K;  3P31 A;  4RG8 A;  1EP4 A;  4EHU A;  3HO1 A;  3DOK A;  3DRS A;  1XHZ A;  4FWQ A;  2FBV A;  1WUA A;  3EL2 A;  3KJV A;  4EZ9 A;  4BRC A;  4ELV A;  2FF3 B;  4EAH D;  1E3M A;  1YUW A;  1NGH A;  1VSM A;  2YHW A;  1WSJ A;  2A1R A;  1VQM N;  3CC2 N;  1BGX T;  1QE1 A;  3WQU A;  4DWI A;  1DT9 A;  1BA0 A;  4B1V A;  1TK8 A;  4FLT A;  1WSF A;  2A5X A;  1SQK A;  2UUA K;  4JI0 K;  3VGM A;  1RBV A;  1ZBU A;  3UB5 A;  5AJ3 K;  4Z4E A;  3HXM A;  1LWF A;  4DFK A;  2UXC K;  2FSN A;  5I9E B;  2YKN A;  1NGD A;  3SJJ A;  4CIE A;  4JS4 A;  2P9N A;  4CEA A;  3C7N A;  3UE5 A;  3QEI A;  3MN9 A;  4W5T A;  4JD2 B;  4Z4C A;  2P9K A;  4I2P A;  3OYI A;  4ILH A;  2AP1 A;  3S3M A;  1DTQ A;  5E26 A;  2V52 B;  4WQ5 A;  4B1Z A;  4DS4 A;  3QER A;  1KLN A;  3K57 A;  5MLC Q;  5JMV A;  3TAB A;  2VYP A;  2NLX A;  4FCY A;  4CJS A;  3S41 A;  3HTV A;  4CZG A;  4GW6 A;  4DR7 K;  4CFB A;  3PSF A;  1BO5 O;  2V51 B;  2UXD K;  3WQT A;  1D4X A;  1C0F A;  5HBM A;  1NJX A;  4BAC A;  2F7T A;  2QWO A;  4KH5 A;  1J9A A;  4B3T K;  4M3Y A;  1W7A A;  3LPT A;  1N36 K;  4GKJ K;  4O5B A;  1VQN N;  3B6P A;  3TTD A;  2RN2 A;  3KD5 E;  3K5O A;  2EWS A;  1BIZ A;  4DQP A;  4KKO A;  4KBO A;  5KRT A;  2QM1 A;  4M3R A;  4JRQ A;  2DFF A;  4FJ8 A;  5BPN A;  1BOT O;  1SUQ A;  3NGI A;  2E20 A;  3HVR A;  3CI5 A;  4XIU A;  1K9M O;  4WYB A;  2ZQB A;  1BDG A;  3HPG A;  2HVH A;  1S1V A;  4JHD A;  3RMA A;  3U9Z A;  1W97 L;  2VGN A;  3PO5 A;  3TAQ A;  1VSK A;  3GOI A;  4BC2 A;  4DG1 A;  4DTS A;  4CJE A;  1ASV A;  1OH6 A;  4DQ8 A;  5AQH A;  3I8D A;  3B6O A;  1NGF A;  3K5M A;  1SL0 A;  3VA3 A;  2I7N A;  1YI2 N;  1T7P A;  3VEV A;  4PKH A;  1N32 K;  3VEO A;  3SK3 A;  1ILY A;  4RW8 A;  5EX5 A;  1Q7Y O;  4WFN L;  4H4O A;  4DSI A;  3G0Z A;  3G71 N;  3NVM A;  3HSC A;  1JCF A;  1VSH A;  1S9G A;  1W9H A;  3D6R A;  4IBN A;  4DTU A;  3RRH A;  3TAR A;  3V1Q A;  1ATS A;  4KB0 A;  3EEQ A;  2BGG A;  4CZL A;  1B9F A;  3W3D A;  5LMN K;  3LDP A;  3VQC A;  2IOC A;  4OVL A;  3A5N C;  1I39 A;  2P9I B;  2E1Y A;  3MX5 A;  3SYZ A;  3PLA A;  4C1N K;  1SL1 A;  3AVG A;  5D3G A;  1C0T A;  3OJU A;  3A5M C;  2QWN A;  5GAE P;  2XY6 A;  2P9U B;  1W2B M;  1DLO A;  1M1K O;  3LAN A;  4KH6 A;  2BDP A;  3ATV A;  4BRL A;  3KD1 E;  2RPI A;  2D0B A;  1KXP A;  2G8U A;  1RBU A;  5J2Q A;  1S72 N;  4F3T A;  3SQ1 A;  5T7B A;  1IBM K;  1SS6 A;  5IT9 O;  4O0J A;  3K2P A;  4CHQ A;  4B08 A;  3ITH A;  3ULE B;  4CGI A;  3OYA A;  1FW6 A;  2GBZ A;  5ELZ A;  4ELU A;  4FLX A;  4LF9 K;  4FW2 A;  4GNI A;  4OJR A;  4BRA A;  5BPM A;  3G6E N;  2O8C A;  3VOV A;  1NWK A;  4DS5 A;  5AQQ A;  3FGU A;  3L2W A;  1ZBL A;  1VSJ A;  2KKZ A;  1M90 O;  1MU2 A;  4FM1 A;  4RWT A;  4CEB A;  4CJK A;  4IO9 L;  1TVR A;  3HM8 A;  4IFE A;  3DOL A;  3DMJ A;  3LP2 A;  1UA1 A;  1L3U A;  3CCQ N;  2Q31 A;  4CJ7 A;  2PYJ A;  3R8E A;  1RDB A;  3AO4 A;  1U4B A;  4IFV A;  4B9Q A;  1K8K A;  2GTD A;  4DSL A;  1BQM A;  3BF1 A;  4DR4 K;  3U9D A;  4IEI A;  5C24 A;  3CET A;  4CZF A;  1HJR A;  4DF8 A;  3TSQ A;  2G8K A;  3C6T A;  4M7X A;  3P5J A;  1Z26 A;  4I9L A;  3LWM A;  4LFA K;  3D2F B;  5HRP A;  1WOQ A;  2P9P A;  5DK5 A;  1B9D A;  4Z4H A;  3DXK B;  3OW2 M;  5M1F A;  4KAZ A;  5AQG A;  1NJZ A;  2OCE A;  3TSU A;  3LP3 A;  3CCM N;  1MWM A;  1NOZ A;  3KZB A;  4GY2 B;  2KTQ A;  4N56 A;  1C1B A;  1TV6 A;  3KK2 A;  2ASP A;  4E7I A;  2ITG A;  3M6G A;  5ADX A;  2B4J A;  2O8E A;  4G1Q A;  2JWL A;  4JEP A;  2W6L A;  2IGI A;  2KW4 A;  3KKR A;  1CLQ A;  1JLG A;  1A5X A;  2E2O A;  1C1A A;  4J2D A;  2ZM6 K;  4JKE A;  1HRH A;  4JHD B;  4O5F A;  1KSP A;  1TYQ B;  4M3T A;  4BDP A;  2PBD A;  3FFI A;  2KFN A;  3OBY A;  1QSY A;  5KGW A;  3JS6 A;  4EFH A;  3SUN A;  3SV4 A;  4BDZ A;  1RCH A;  3DLK A;  3D2E A;  4CJW A;  4LF6 K;  2CH6 A;  2HNZ A;  1IH7 A;  1X9J A;  1H1V A;  4AF1 A;  3K9J A;  4BR7 A;  1X3N A;  4Y1C A;  2ZJR L;  2Q97 A;  2Z1G A;  5AQY A;  4BWM A;  3L0Q A;  3AO1 A;  2GWJ A;  1UAX A;  5KQ8 A;  3NGY A;  1YIJ N;  3PX4 A;  2HVI A;  4BVO A;  3MWP A;  2XHB A;  1IG9 A;  2PFU A;  4DTR A;  5CY4 A;  3TAN A;  3CC7 N;  4CBU A;  3AA4 A;  4EZ6 A;  3AO3 A;  4LFC K;  5H1S Q;  4OLB A;  1EET A;  1IJJ A;  4LF5 K;  1GLL O;  4E7L A;  1TL1 A;  1GLA G;  4JV5 K;  3CCV N;  4CED A;  1HX1 A;  1JLC A;  2X74 A;  2P5G A;  4JKB A;  4FYD A;  3I0R A;  3NCI A;  2F9W A;  3VEZ A;  2GV9 A;  3L2Q A;  1DEJ A;  4JKF A;  3ZSR A;  4CHN A;  4FJ5 A;  4KO0 A;  3N4Q A;  4PL7 A;  1QVF M;  1HNI A;  4H0X B;  4F2S A;  4DQQ A;  4OGE A;  3OYD A;  3Q7C A;  1YTU A;  3SQ0 A;  3KLH A;  2PAV A;  1MDU B;  3VQQ A;  1RFQ A;  4CJ3 A;  4BR9 A;  5AZJ A;  1SV5 A;  3OTO K;  1SL2 A;  2A6A A;  4Y0W A;  5AQN A;  4BRP A;  3N4P A;  3K9K A;  3O4W A;  3OYM A;  3FZL A;  3DXM A;  4HWI A;  1TAQ A;  4A5B A;  4FLU A;  2D0A A;  2XY5 A;  3MCA B;  3O4Q A;  3BZC A;  1CXU A;  4K41 A;  3CCE N;  4IOA L;  3TTC A;  2LSN A;  4CBW A;  1TK0 A;  1IKX A;  3OA9 A;  5AQM A;  2HST A;  4JI7 K;  1F21 A;  3GDQ A;  4H5T A;  3HK2 A;  4JK8 A;  3O9R A;  1GOB A;  3DXK A;  4BQL A;  3CCU N;  4KHS A;  1JL1 A;  4B8A B;  3THW B;  4FJH A;  1E4F T;  3RSE B;  4BQZ A;  3SQ4 A;  1BI4 B;  1RTH A;  3TAP A;  3SPZ A;  4CJ5 A;  4ISG A;  3GBT A;  5K14 A;  4GVE A;  4FK4 A;  3L2R A;  1QTM A;  3RWU A;  1A5V A;  5GAH P;  2YX6 A;  3THY A;  3C7N B;  4Z4F A;  3CCJ N;  1NGB A;  3W0L A;  2WC9 A;  4X66 K;  2CGJ A;  3EN9 A;  3S3N A;  4RTF D;  3R9P A;  3KHY A;  1EXQ A;  3MN5 A;  4MDA A;  3ZT1 A;  3TAE A;  3F2K A;  1YJN N;  3ZSV A;  4BVP A;  1J5E K;  3HL8 A;  2G8W A;  4Q0B A;  4IG0 A;  1KC8 O;  3SAF A;  3DYA A;  1FXX A;  2P9S A;  2F8T A;  3VGK A;  4CZE A;  1HUX A;  2P9P B;  1S1U A;  4KH4 A;  2HF4 A;  2KHO A;  4A61 A;  4KPY A;  4CF1 A;  3OS0 A;  4DSK A;  4JI5 K;  4H4M A;  3O9U A;  1X9W A;  1RBS A;  3QES A;  2HB5 A;  5CYM A;  5GIN A;  3O3H A;  4RW9 A;  3UKR B;  2OZM A;  4BC3 A;  2IVN A;  3ENB A;  4EIA A;  2UU9 K;  4M3X A;  4KHN A;  1NM1 A;  4PY5 A;  3QNO A;  3PX6 A;  2FF6 A;  3HYF A;  4QAG A;  2QTD A;  4CK1 A;  4CCH A;  1NKE A;  3RMD A;  4CVN E;  3ZLJ A;  2HMP A;  4W5N A;  1L3V A;  2GWK A;  3WXL A;  4FM2 A;  4IZ9 A;  3SI6 A;  5AQL A;  1WAJ A;  4OPA A;  5GIP A;  4NO7 A;  1BCO A;  5CHI A;  3DWL A;  3OY9 A;  3CJ7 A;  4CJL A;  5BRE A;  3WXI A;  1XNR K;  3IDH A;  1X9M A;  3A5O C;  3V1R A;  3CPE A;  4FOE A;  1D9F A;  4C23 A;  3CJ1 A;  3MN7 A;  3ZSZ A;  4CD1 A;  4AM6 A;  2G8F A;  1HYV A;  1ITG A;  2QXF A;  3PUF A;  2E2N A;  3SNN A;  1T8E A;  3V4I A;  4E1N A;  3D7E O;  3NF7 A;  2Z1H A;  4L3Q A;  4CK2 A;  3CER A;  2HBK A;  4AIL C;  4JI3 K;  1JCG A;  4H8K A;  1LAW A;  4FK0 A;  2ZE2 A;  4FJI A;  2E6L A;  4ISE A;  1J5O A;  3H6E A;  4YOU A;  1BIU A;  4DLE A;  4B1Y B;  4V19 S;  4A57 A;  3CD6 N;  4PL8 A;  3SBG A;  4OKE A;  4H03 B;  3S9H A;  3MED A;  1WSI A;  1T44 A;  2E88 A;  3SPY A;  3VPZ A;  3FZF A;  4IWV A;  5KPZ A;  4FWL A;  3DLH A;  3BZK A;  2X6S A;  1KVC A;  4LH4 A;  4B1X B;  3CQ8 A;  4H0Y B;  5BRF A;  1EWQ A;  1HPZ A;  1NGG A;  1HNW K;  4GVM A;  4FSV A;  3THV A;  4PHT X;  4DU1 A;  1KFD A;  5AZI A;  2OTJ N;  5KPR A;  5KTQ A;  4DFM A;  1RDD A;  3KK1 A;  5AZJ B;  2ZGZ A;  2HHT A;  1NGJ A;  1BU6 O;  3CQX A;  1NK8 A;  3LDQ A;  1ATR A;  3F9K A;  5AQX A;  2FSK A;  1XI1 A;  1GLD G;  2WBN A;  4LC9 B;  2PYL A;  3MWT A;  4WQ5 C;  1S3X A;  4KRE A;  3P1G A;  2E1Z A;  3LZJ A;  5M1P A;  3NF9 A;  2D0C A;  3JAM O;  2YNI A;  5AQS A;  1NGI A;  5M1Q A;  4GV9 A;  3TTF A;  3OYE A;  1RT1 A;  3VQP A;  4TSX A;  1HKG A;  1O13 A;  5FPN A;  4B9M A;  2YNF A;  4YDU C;  4DUY K;  4B3M K;  2YJF A;  4JKG B;  2NZT A;  1TKX A;  4FLY A;  2DPN A;  5IWA K;  4K0K K;  3EE9 A;  4H5R A;  3A2F A;  3O5B A;  3ATU A;  1TKD A;  1RTJ A;  3C6U A;  3L2U A;  2ZD1 A;  3CG7 A;  3EY1 A;  3F9M A;  3GG4 A;  3T1H K;  2EHG A;  1K8K B;  3VQD A;  3SMP A;  3D2F A;  2W42 A;  2P9N B;  3C94 A;  3HPH A;  3G25 A;  4BGB A;  2B6A A;  1XHX A;  3L6Q A;  3ZET B;  2D0P A;  3HRG A;  1Q81 O;  3U8X A;  3H45 C;  1B92 A;  1LW0 A;  3OHR A;  1BCM A;  4LF7 K;  3ZYY X;  2P51 A;  1NK7 A;  2Y1I A;  4ILG B;  3DRP A;  4Y1D A;  5AQU A;  3OBW A;  1G15 A;  5KPT A;  5BN8 A;  5AQO A;  3ENH A;  1NK4 A;  4FJM A;  3WNE A;  1NKB A;  5JLF A; 
#chains in the Genus database with same CATH homology
 4CJK A;  4CJR A;  1C1C A;  1S1T A;  1TVR A;  2IC3 A;  3JSM A;  4E89 A;  2HW3 A;  3DOL A;  3LAK A;  4EP4 A;  3DMJ A;  3LP2 A;  1UA1 A;  1EX4 A;  2A1S A;  2Q3S A;  5HRO A;  4AH9 A;  3K5L A;  1L3U A;  2VG6 A;  4JS5 A;  2IDO A;  1S6P A;  2PYJ A;  3QEV A;  1RDB A;  3AO4 A;  1U4B A;  4IFV A;  2G8V A;  4HTU A;  4FZZ A;  2DFH A;  4JLH A;  4E1M A;  3HT3 A;  3V9Z A;  3AVK A;  4CHP A;  3PO4 A;  4KHW A;  3AVB A;  2YNG A;  3VA0 A;  4O55 A;  3TAF A;  1VSE A;  3HP6 A;  4DSL A;  3NFA A;  3P83 D;  1BQM A;  3M8R A;  5C25 A;  3NAE A;  4CJ4 A;  4OKK A;  3D0P A;  1UOC A;  5C24 A;  2VWJ A;  4OLA A;  2FBT A;  1HJR A;  3KTQ A;  4N41 A;  4DF8 A;  3VQ5 A;  3C6T A;  2G8K A;  4ID5 A;  1JXE A;  3P5J A;  1U04 A;  2FBY A;  1Z26 A;  3KKS A;  4I9L A;  3VQ7 A;  3LWM A;  4B9U A;  3MXJ A;  1RT4 A;  5HRN A;  3QLH A;  4E7J A;  2KFZ A;  4E19 A;  5HRP A;  5DK5 A;  4FM0 A;  1HQE A;  5EU7 A;  2O4I A;  2IAJ A;  1B9D A;  4Z4H A;  4ZHR A;  1Q9X A;  2FC0 A;  4LY7 A;  3LWL A;  2DFE A;  1WLJ A;  3G10 A;  3EZ5 A;  3OYN A;  1D8Y A;  1JKH A;  3SZ2 A;  4KAZ A;  3OS1 A;  1NJZ A;  3IG1 A;  3T3F A;  4C8M A;  3LP3 A;  4O0I A;  4KB1 A;  1JL2 A;  1Q8I A;  1NOZ A;  4CHZ A;  4KI6 A;  3AVH A;  3VQ9 A;  2KTQ A;  3CFO A;  1IKW A;  4DU3 A;  1RBT A;  4NCB A;  2VG7 A;  4N56 A;  4F3O A;  1C1B A;  4KI4 A;  3RR7 A;  4CHO A;  4L8R B;  4DSF A;  4AHR A;  1TV6 A;  4FVM A;  3KK2 A;  3NGZ A;  5HRR A;  3OYG A;  4E7I A;  3BDP A;  2ITG A;  1KVA A;  1LWC A;  3ZT4 A;  1LV5 A;  2YHA A;  4B9S A;  3ZT0 A;  2B4J A;  4E3S A;  3TR8 A;  3VQE A;  4G1Q A;  1ASW A;  3U6F A;  3VQ4 A;  1JXB A;  1T05 A;  3AVF A;  2IGI A;  2OA8 A;  2KW4 A;  2OYQ A;  3KKR A;  4DMN A;  1JLG A;  1CLQ A;  2DTU A;  1A5X A;  1TKZ A;  1C1A A;  4LSL A;  3U3Y A;  4J2D A;  3U3G A;  2YKM A;  1HRH A;  1LW2 A;  1KSP A;  4M3T A;  4CEF A;  4BDP A;  3QIO A;  2XO7 A;  2HHU A;  1ASU A;  3FFI A;  2Y1J A;  2KFN A;  2OPR A;  1QSY A;  3AVN A;  4IG3 A;  5FDL A;  1SKS A;  3L2V A;  5KGW A;  4CFA A;  3RR8 A;  1RTD A;  3SUN A;  1YT3 A;  4ELT A;  4CES A;  3QNN A;  4FJX A;  3SV4 A;  4BDZ A;  1EKE A;  1RBR A;  1RCH A;  3DLK A;  5DMR A;  4CJW A;  1HQU A;  1JLF A;  4BE1 A;  2HNZ A;  1IH7 A;  3ZT3 A;  4KHU A;  1QS4 A;  3SUO A;  3OYF A;  3HPO A;  4Y1C A;  3AVM A;  1WAF A;  3WNH A;  2Z1G A;  3LP0 A;  1RDC A;  1N5Y A;  3CFR A;  4BWM A;  4QCL A;  2OPS A;  3AO1 A;  1KTQ A;  1UAX A;  4W5O A;  3OYC A;  3TWH A;  3NGY A;  1QSL A;  4KTQ A;  2XY8 A;  3L3U A;  4W5Q A;  1WSG A;  3K59 A;  1VSI A;  1S1X A;  3PX4 A;  1WSH A;  4OKJ A;  2HVI A;  3OYH A;  3K58 A;  3ZT2 A;  4E7H A;  2XHB A;  2G8I A;  4CF9 A;  1JLQ A;  4CEE A;  1REV A;  3MEG A;  1IG9 A;  3ULD A;  3ASM A;  4DTR A;  5CY4 A;  4O44 A;  3TAN A;  2YV0 X;  2E4L A;  2ATQ A;  3O3G A;  3AA4 A;  4EZ6 A;  3PY8 A;  2HND A;  4CJP A;  3AO3 A;  3MEC A;  3ISN C;  3SV3 A;  1BIS A;  4NCG A;  4OLB A;  1WSE A;  3OJS A;  4OPJ A;  1Q9Y A;  5HP1 A;  1EET A;  1VSD A;  1FKP A;  4E7L A;  1S9E A;  3BGR A;  1TL1 A;  1C6V A;  1S1W A;  4CE9 A;  4ZTJ A;  1D9D A;  4DSJ A;  4F8R A;  1C0U A;  4CED A;  3NDK A;  4F2R A;  4CF0 A;  4FZY A;  2WON A;  3NF8 A;  1JLC A;  2X74 A;  4AHT A;  2P5G A;  3AO2 A;  3QIP A;  4FYD A;  4HUG A;  3I0R A;  3KLF A;  3NCI A;  4FLW A;  2GV9 A;  3L2Q A;  4FJ5 A;  3ZSR A;  1KVB A;  3CM5 A;  4IFY A;  4CHN A;  3AVJ A;  4KO0 A;  3JYT A;  3WNG A;  4DU4 A;  1CZ9 A;  1HNI A;  3IS9 A;  4I7F A;  4CIF A;  2NUB A;  3KIO A;  3NBP A;  4DQQ A;  4OGE A;  3OYD A;  4F2S A;  3M8S A;  1YTU A;  4YFU A;  3SQ0 A;  3HST B;  3OYL A;  3KLH A;  1NK9 A;  4JRP A;  1X9S A;  3VQQ A;  4LD0 A;  5HLF A;  1U49 A;  4CJ3 A;  1SKR A;  4M41 A;  1QHT A;  1Y97 A;  3VQA A;  4DTJ A;  1SV5 A;  3M8Q A;  3MEE A;  2JLE A;  1S5J A;  4C8N A;  3AVC A;  1SL2 A;  2F8S A;  1RTI A;  3RMB A;  2HHQ A;  1U47 A;  3OYM A;  3IAY A;  4F4K A;  4CF8 A;  5KRS A;  3OYK A;  1I3A A;  3LAL A;  1TAQ A;  2QK9 A;  3OVN A;  2HMI A;  2HHW A;  5FRM A;  2OPP A;  2DY4 A;  4FLU A;  2D0A A;  2P1J A;  5KGX A;  3AA5 X;  2XY5 A;  4FJ9 A;  3LP1 A;  2Z1I A;  3EYZ A;  3CM6 A;  3H08 A;  3O4Q A;  4RW7 A;  1CXU A;  1Z25 A;  2ETJ A;  4CEQ A;  4CGJ A;  4CEZ A;  2LSN A;  1TK0 A;  4PWD A;  1IKX A;  2X6N A;  4HVJ A;  1NK6 A;  4IDK A;  3O3F A;  3ZSY A;  4GMJ B;  1F21 A;  1T03 A;  4B3O A;  4W5R A;  4R5P A;  3HK2 A;  4CER A;  1GOB A;  2XRI A;  4KHS A;  3SUP A;  1JL1 A;  1UWB A;  4B8A B;  2QKK A;  4J2A A;  1GOC A;  3PV8 A;  1O1W A;  1KLM A;  4CFC A;  4ZTF A;  3AO5 A;  4FJH A;  2KZZ A;  4ICL A;  2XY7 A;  1TKT A;  1ZBI A;  4B9T A;  3SQ4 A;  3V9W A;  5CYQ A;  3QEP A;  4AHC A;  3PX0 A;  3HM9 A;  1ZBF A;  1BI4 B;  1RTH A;  3TAP A;  3SPZ A;  4CJ5 A;  4FJN A;  1RT7 A;  3DLE A;  4CGG A;  4NCA A;  4DQR A;  5K14 A;  4FK4 A;  3VQ6 A;  3L2R A;  4KHY A;  1QTM A;  1KCF A;  3WNF A;  1A5V A;  2BAN A;  5CZ2 A;  4CJQ A;  3RWU A;  1BI4 A;  4CIG A;  4B9V A;  4Z4F A;  2HHX A;  1QQC A;  1LAV A;  4DTM A;  4DTN A;  4FJJ A;  4FJM A;  5I3U A;  4FZX C;  3ZCM A;  3NH1 A;  2O4G A;  3DLB A;  4FJL A;  4RG8 A;  3S3N A;  1EP4 A;  5FRN A;  3HJF A;  3HO1 A;  3DRS A;  1EXQ A;  3DOK A;  3O4N A;  1XHZ A;  3ZT1 A;  2FBV A;  3TAE A;  4LSN A;  5KI6 A;  3KJV A;  3ZSV A;  4HUF A;  1XWL A;  4EZ9 A;  1WN7 A;  3HL8 A;  4BE0 A;  2G8W A;  3LDS A;  4Q0B A;  4IG0 A;  4ELV A;  4M3Z A;  2JGU A;  3T19 A;  3DYA A;  1FXX A;  2F8T A;  2KZM A;  3IRX A;  1S1U A;  2GUI A;  4AHU A;  4KPY A;  4MQ3 A;  4CF1 A;  3OS0 A;  1TL3 A;  3CYM A;  4DSK A;  4H4M A;  3TAM A;  1VSM A;  1L3T A;  4J2E A;  1JLA A;  1WSJ A;  1X9W A;  4DTO A;  2A1R A;  1RBS A;  3QES A;  1BGX T;  1QE1 A;  1NJY A;  4DWI A;  2HB5 A;  4DF4 A;  4DTP A;  1D5A A;  3KLI A;  3NH0 A;  5CYM A;  1DTT A;  1RT3 A;  2YNH A;  3I0S A;  3O3H A;  4B9N A;  4HCC A;  2X78 A;  2HHV A;  1RIL A;  4RW6 A;  4RW9 A;  1TK8 A;  2OZS A;  2OZM A;  4FLT A;  1U45 A;  1WSF A;  1SKW A;  3AVA A;  1XC9 A;  4M3X A;  1W0H A;  4KHN A;  4HUE A;  2I5J A;  4PY5 A;  3QNO A;  3F73 A;  3PX6 A;  4M45 A;  4PUO A;  3HYF A;  4QAG A;  4DSE A;  1RBV A;  1ZBU A;  4CK1 A;  4Z4E A;  4B8C A;  1LWF A;  3HXM A;  4DFK A;  5E41 A;  3V1O A;  4MFB A;  3D45 A;  4CJV A;  2YKN A;  2PY5 A;  4CCH A;  1NKE A;  1RDA A;  4CIE A;  3SJJ A;  4JS4 A;  4CHY A;  3RMD A;  2QKB A;  3DI6 A;  4CEA A;  4O4G A;  4W5N A;  1L3V A;  1BL3 A;  5J2M A;  3QEI A;  5JS2 A;  1BHL A;  4CEO A;  4W5T A;  4FM2 A;  1HYZ A;  1KFS A;  3DRR A;  3C95 A;  4Z4C A;  3SI6 A;  4I2P A;  4UQG A;  3OYI A;  2RF2 A;  4FLV A;  1VRT A;  1WAJ A;  1DTQ A;  3AV9 A;  3T1A A;  3S3M A;  4IKF A;  1BCO A;  4DS4 A;  3QIN A;  3QER A;  1KLN A;  3K57 A;  2Z1J A;  4C8O A;  3OY9 A;  2BE2 A;  2FBX A;  4CJL A;  4FCY A;  3TAB A;  1X1P A;  3RRG A;  4CJS A;  3V9U A;  1RT2 A;  1X9M A;  4E0D A;  4FXD A;  4HCB A;  4GW6 A;  3V1R A;  3VQB A;  1D9F A;  4CGF A;  2WOM A;  3DM2 A;  4CFB A;  5J1E A;  3ZSZ A;  4N47 A;  3NE6 A;  3NH2 A;  2G8F A;  1HYV A;  4KV8 A;  1ITG A;  5HBM A;  2QXF A;  3PUF A;  3SNN A;  1T8E A;  4CF2 A;  3ZSW A;  3V4I A;  1NJX A;  1BQN A;  4E1N A;  3RTV A;  4BAC A;  3CFP A;  4AHS A;  4WE1 A;  3NF7 A;  1J9A A;  2Z1H A;  4CK2 A;  1UA0 A;  4DTX A;  1RT5 A;  4M3Y A;  4CJT A;  4M42 A;  3LPT A;  3UIQ A;  4K8X A;  4AIL C;  4O5B A;  3B6P A;  4AHV A;  3LZI A;  2RN2 A;  1FKO A;  3KD5 E;  1R0A A;  3VN5 A;  5I42 A;  1L3S A;  3K5O A;  4H8K A;  4RW4 A;  4DFJ A;  1BIZ A;  3HVT A;  4DQP A;  1LAW A;  4M3U A;  4KKO A;  4OPK A;  4FK0 A;  2ZE2 A;  4FJI A;  1WNS A;  2E6L A;  5KRT A;  3L8B A;  2KQ2 A;  4M3R A;  3SUQ A;  1J5O A;  4B9L A;  4JRQ A;  1BIU A;  2DFF A;  3ZSX A;  2B5J A;  4DLE A;  4FJ8 A;  1SUQ A;  3NGI A;  3RMC A;  4CJF A;  3HVR A;  4DQS A;  4XIU A;  1S6Q A;  4OKE A;  1ZBH A;  2D5R A;  3S9H A;  5FRO A;  3MED A;  1WSI A;  2ZQB A;  2E6M A;  3OYJ A;  3SPY A;  5SWM A;  4Z4I A;  3HPG A;  3DLH A;  3CQ8 A;  2X6S A;  1KVC A;  1S1V A;  4LH4 A;  2HVH A;  3RMA A;  1IO2 A;  2VWK A;  2EX3 A;  4HHT A;  3V9S A;  3PO5 A;  3NHG A;  1HPZ A;  4J2B A;  4GVM A;  3THV A;  3TAQ A;  3KLG A;  1VSK A;  4DU1 A;  1KFD A;  4DG1 A;  4FW1 A;  4DTS A;  3MXM A;  4CJE A;  3KLE A;  1ASV A;  4CGD A;  5KTQ A;  3E01 A;  3V81 A;  3AVI A;  4DFM A;  1RDD A;  4Z0U A;  3KK1 A;  3I8D A;  3B6O A;  1JLE A;  5HRS A;  3K5M A;  1ZYQ A;  1SL0 A;  4C8K A;  3VA3 A;  2HHT A;  4ID1 A;  1NK8 A;  1T7P A;  3F9K A;  1XI1 A;  3SQ2 A;  1YTA A;  1NK5 A;  4RW8 A;  4QOZ B;  3HP9 A;  2PYL A;  4DLG A;  4H4O A;  3TI0 A;  4DSI A;  3G0Z A;  1HMV A;  3SCX A;  4KRE A;  3P1G A;  3DLR A;  3LZJ A;  1VSH A;  1W9H A;  1S9G A;  3AA2 A;  3NF9 A;  4DFP A;  4CK3 A;  2D0C A;  3QEW A;  3L3V A;  4IBN A;  2YNI A;  4OGC A;  1L5U A;  3ZSO A;  3QET A;  3M8P A;  4EP5 A;  3OYE A;  4DTU A;  4FK2 A;  1RT1 A;  3RRH A;  3VQP A;  3AVL A;  3TAR A;  4TSX A;  3V1Q A;  4FJG A;  3DLG A;  5J2P A;  1NK0 A;  4B9M A;  4KB0 A;  2YNF A;  2BGG A;  1B9F A;  4FJ7 A;  4M3W A;  4LH5 A;  4BDY A;  4Q5V A;  2IS3 A;  3K5N A;  2HHS A;  1VSL A;  1RT6 A;  1TKX A;  3VQC A;  2IOC A;  4FLY A;  1IKV A;  4K8Z A;  2RKI A;  4OVL A;  4CEC A;  3VQ8 A;  1I39 A;  1RNH A;  3SYZ A;  3S3O A;  3MAQ A;  5CZ1 A;  3A2F A;  4E7K A;  5J2N A;  4Z4G A;  2AJQ A;  1GOA A;  1NKC A;  4KFB A;  4KHQ A;  2P5O A;  1SL1 A;  1TKD A;  1RTJ A;  3C6U A;  3AVG A;  3L2U A;  5D3G A;  2YHB A;  1C0T A;  4CFD A;  1J54 A;  1K6Y A;  3ALY A;  2ZD1 A;  3OJU A;  1YVU A;  4N5S A;  3CG7 A;  1TAU A;  1J53 A;  3EY1 A;  2OPQ A;  4BWJ A;  1LWE A;  2XY6 A;  3MXI A;  4I9Q A;  4FJK A;  1FK9 A;  3QEX A;  1HNV A;  1DLO A;  4I2Q A;  5JS1 A;  2EHG A;  1C0M A;  1VSF A;  3LAN A;  2BDP A;  4NYF A;  1QSS A;  3VQD A;  3KD1 E;  1N6Q A;  2RPI A;  2W42 A;  2R7Y A;  2D0B A;  3AA3 A;  1VRU A;  4BE2 A;  1CXQ A;  3C94 A;  3HPH A;  4KRF A;  4N76 A;  2G8U A;  1RBU A;  5J2Q A;  1VK0 A;  4F3T A;  4YNQ A;  3SQ1 A;  4CGH A;  3V9X A;  3OS2 A;  4PQU A;  5T7B A;  1JLB A;  2B6A A;  1TK5 A;  1XHX A;  3QO9 A;  5SZT A;  4O0J A;  3K2P A;  1TGO A;  4CHQ A;  2F96 A;  4B08 A;  3ITH A;  4C8L A;  4CGI A;  1B92 A;  5C42 A;  1LW0 A;  3OYA A;  4CJU A;  4DQI A;  2GBZ A;  1BCM A;  1HYS A;  4ELU A;  2P51 A;  3NF6 A;  4FLX A;  1A5W A;  3TAG A;  2Y1I A;  3KK3 A;  1NK7 A;  1NJW A;  4FW2 A;  4KTZ A;  2HNY A;  4OJR A;  3DRP A;  4Y1D A;  4KTW A;  1U48 A;  1G15 A;  4NYN A;  1NOY A;  3LPU A;  2G8H A;  2PZS A;  3V6D A;  4FLZ A;  3LAM A;  4PA1 A;  4DS5 A;  1KRP A;  3ZSQ A;  3L2W A;  3OYB A;  1NK4 A;  1ZBL A;  1VSJ A;  2VG5 A;  1IKY A;  1MU2 A;  1CZB A;  4FM1 A;  3WNE A;  1NKB A;  4CEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...