4CW7B

Structure of the fap7-rps14 complex in complex with atp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
EKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
total genus 33
structure length 118
sequence length 118
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cw7B00
3T1HK 4LFBK 4JI0K 4AQYK 1IBKK 1XMOK 1N36K 1N32K 4DV2K 3T1YK 4DV1K 4JI5K 4DR3K 4X62K 4DV4K 4LF9K 4NXNK 1HNZK 4DR7K 5LMUK 4YY3K 5FLXO 2UXCK 4DR1K 2UXDK 4JI7K 2HHHK 5AJ3K 4CW7B 2E5LK 2VQFK 4JI1K 1IBLK 1XNQK 4DR2K 4DR4K 4X64K 4DR5K 4LF4K 1N33K 5IWAK 4DV5K 4LF5K 4DR6K 2UUCK 3J7AP 1HR0K 1HNWK 4X66K 3J81O 4LF7K 4DV3K 5BR8K 5LL6Z 1FJGK 3JAMO 4LFAK 2ZM6K 5A2QO 4X65K 4CVNE 4DUZK 2VQEK 4LF6K 5LMNK 4DV7K 1N34K 4B3SK 4JYAK 5IT9O 4LFCK 4JI2K 4LF8K 2F4VK 4NXMK 1IBMK 2UUBK 4DV6K 1HNXK 2UUAK 4B3RK 1XMQK 4B3MK 2UXBK 3J80O 4JI3K 4JI6K 2UU9K 4V19S 4K0KK 4KHPK 4B3TK 1J5EK 1XNRK 3OTOK 4JI8K 4YHHK 4GKJK 4JI4K 4DUYK 4JV5K 3J7YP 4DV0K 4OX9K 4GKKK 1I94K
chains in the Genus database with same CATH superfamily
3G4SN 2HMIA 4FM0A 1T8EA 1TUUA 2QA4N 1RT7A 3PX0A 4DR3K 4DS5A 4DFMA 1IG8A 4KRFA 1NGBA 3RMBA 4EHTA 4FSVA 1C6VA 1ATNA 3ENOA 2Y1IA 2HOEA 1QQCA 1NBWA 2P1JA 1J5OA 3GBTA 3DLRA 2YHWA 1NK5A 1KLMA 3AVAA 4CHPA 1VSIA 3CJ9A 5AJ3K 1TL1A 2VG6A 4HHTA 4FPAA 1UAXA 1D4XA 3I0RA 4FVMA 4JKBA 3LL3A 2BDPA 3F2KA 2VGNA 4CBUA 1QTMA 3HJFA 1VK0A 4M41A 1JLFA 3O9UA 4MO5A 2O8DA 1K8KA 2A40A 1QQNA 3I33A 5CE3A 1RBUA 4CEDA 3DOKA 5I9EB 3F9MA 5M1OA 2F7TA 2D0OA 3OYCA 4C8OA 4MQ3A 3OYIA 1DKGD 1NKBA 3AVBA 1RDDA 3VQCA 4CJQA 3MN5A 4AH9A 4DSKA 5BPLA 2GWKA 4H0PA 3VQAA 1TAUA 3CCSN 2IGIA 3WXJA 3O6WA 4Z94A 1T6CA 4BE0A 3AGRA 3SCXA 5SWMA 3LP2A 2A5XA 4K8ZA 4CEOA 1IH7A 1JCGA 3H3OB 4CCHA 2Q1NA 4L3QA 1NG9A 4N5SA 1YIJN 3E01A 4DTRA 4CEAA 3MX5A 3FR0A 5BN8A 1NK6A 1WSHA 3I8DA 1KFDA 4O8KA 3T3FA 2BANA 3JYTA 3M8QA 3FLCO 3BDPA 4YHHK 3THYA 3ZEUB 1GOBA 3QEWA 1VSKA 4JHDA 4ILHA 5TKYA 4BDYA 3AA2A 1BDGA 4PA1A 3SPZA 3L2WA 1RTIA 1RILA 3WQUA 1NKCA 4NLCA 4H4MA 2IIRA 3OYNA 4IDHA 3QERA 2DFEA 1I39A 3KKSA 4B1XB 1WLJA 3AVCA 3VEWA 1W7AA 2KQ2A 4AM6A 4CJUA 2A3ZA 3O08A 3QLHA 5KI6A 4L8RB 4CJLA 5C15A 3AAQA 2HB5A 3CM5A 2R7YA 4LH4A 1BISA 3OS0A 4BRIA 1TYQB 2EWSA 3CCVN 2P9SA 3VMFB 4IO9L 4GV6A 2IVNA 2NUBA 3O5BA 3FFIA 5C12A 4J2AA 4AHSA 3U8XA 4DQRA 4BY9C 3NGYA 3Q7BA 2AJQA 4YFUA 3O4NA 4ZTFA 1E4GT 3DYAA 2YNGA 4YDUA 3RTVA 4HVJA 2P5GA 2HNDA 4J8FA 3DXMB 1QE1A 2P51A 1C0FA 4F4KA 3BEXA 3NVKA 5CYMA 1VQ6N 1BI4B 3SV4A 4FWLA 1HPZA 5A2QO 2WOMA 4X65K 4G9ZA 1TKTA 3AVGA 4B3SK 4EFHA 1Q9YA 2G8HA 3QMLA 1VHXA 4LF8K 3NH1A 3QDKA 4CHNA 4BWMA 1D9DA 2PYJA 3OVNA 3C6HA 4H0YB 3TWHA 2W42A 4G1QA 5EXWA 5FPDA 3K5LA 1NGCA 3MN9A 4DS4A 4DFKA 1WN7A 1WSJA 2RKIA 3AO3A 1KCFA 4I2QA 3R1XA 4V19S 1QS4A 4CZLA 4YORA 4B3TK 2NZTA 4KI6A 2AP1A 1HYSA 4DKWA 3U3GA 2P5OA 4CZEA 4B08A 3OYGA 4CJ7A 1YVNA 4A62A 2X6NA 4FJGA 4DV0K 3TSPA 3CJ1A 1ASVA 1JCFA 4CFBA 4C8KA 5AZIA 4EP5A 2V52B 3EE8A 4CF9A 1CZ9A 4CESA 3TAEA 3ZSVA 3CETA 3EKSA 3VQ7A 3HTVA 1J53A 5J2MA 1HRHA 4DFPA 1P90A 1BCOA 3OYAA 2J4RA 4U7BA 5KPRA 5AQLA 3IFRA 4B1UB 3FGUA 2UXDK 3MX2A 4JAXA 4NYFA 4KI4A 5AQPA 3BZKA 4ID1A 3UKRB 1GLLO 4WFNL 3ZLJA 3H3NO 4RWTA 1S5JA 2BUPA 4DR5K 4CK1A 1RBSA 1WUAA 3OYJA 3THXA 4DTUA 1YAGA 5HOOA 3IMXA 1N8RO 1ZBSA 4CF2A 1DGKN 4AHTA 2G8KA 4DU4A 1VSEA 4Y0WA 1KAXA 2HMPA 3CI5A 2GX9A 4QS7A 2FBYA 4A2BA 1HYVA 2OANA 4OKJA 4IG3A 3CHWA 2Q36A 4YNQA 3WXLA 3WNEA 5GAEP 5HROA 3T7ZA 3LP3A 1HLUA 2CGKA 4CVNE 4DUZK 4CZFA 2B6AA 2KLAA 2NNWA 1V4SA 3QBWA 4LFCK 4OKKA 2RF2A 4JI2K 1QSSA 2F4VK 3LDOA 1LAWA 1KC8O 1RNHA 4CFAA 3ENHA 4KFBA 3SQ0A 3TTDA 2QWMA 4GNIA 3VENA 4J2BA 1WSGA 5JVHL 3HZ6A 1DEJA 3VGKA 2ZJPL 3KJVA 3SAGA 3SQ1A 1WSEA 5J1EA 1VQKN 4LSLA 5HL7L 3PY8A 4OPHA 4YOXA 5C24A 1EX4A 3H08A 3V4IA 1WSFA 1YI2N 2GTDA 4ID5A 2YNIA 3CC7N 1XMOK 2FBTA 4ZHRA 5LJWA 4B9NA 2IVOA 2E6LA 4O55A 5AFUH 1Q86O 5GAHP 4XEIA 1NK9A 3NDKA 2YHBA 1WB9A 3LM9A 1Q81O 1BOTO 4M42A 4NCAA 3N4PA 4A59A 4FK4A 1RTHA 3GE1A 1EO1A 4B1WB 3IUCA 2HHHK 1BCMA 1S9GA 3LDQA 3CM6A 3HP9A 3WQTA 4IWVA 4KBOA 5JICA 1G99A 4JKFA 3QFPA 1GLFO 3THWA 4MLHA 3NVMA 3V1OA 4LF4K 3CFOA 1C1BA 3KIOA 3FZKA 3L6QA 4ELUA 1ZYQA 4ISEA 2RPIA 3HPOA 3MK6A 4OPKA 4BE1A 2E2QA 2OPPA 5GIOA 4CZKA 2O8CB 3R3LA 3LWLA 5CZ1A 4RW4A 3M3ZA 5BR8K 2BH1A 3DLEA 3QEXA 1FJGK 3V1RA 3DLLL 1GLDG 4LFAK 4YOWA 1I3AA 4R5PA 2O8FA 1OVQA 4JKGA 2VQEK 1B9DA 3OJUA 1U49A 3CC2N 4DV7K 1QVFM 4JYAK 4Y1CA 1TVRA 2PAVA 3AVLA 3PIOL 3CMEN 4RTFD 2UUBK 4BRAA 1HNXK 2UUAK 3CFPA 4B3MK 3C65A 1BG3A 4EP4A 2UXBK 3C6UA 1Z6RA 1JL1A 3RRHA 5HRNA 5JS1A 4FYDA 1DLOA 3OYMA 5F2RA 3V81A 1BIZA 3VQ8A 1HNVA 1ATRA 4H5WA 3VPZA 2NRHA 4BRFA 3NF9A 2GUIA 3EKUA 1X3MA 4JI4K 5C42A 5LJVA 1XHZA 2QWNA 1SKSA 3RRGA 3LPTA 3OY9A 2W6KA 1NGHA 4M45A 4C8MA 1D5AA 2G8FA 1RT1A 4GKKK 4R79A 1EP4A 1I94K 3KLEA 5BRHA 4CD1A 3THVA 4CF8A 1T03A 4OPAA 3ZSRA 3U6FA 1GLCG 3C94A 3CCUN 4I9LA 5GINA 5K14A 4FWMA 1NK8A 2VG5A 2OA8A 4J2EA 1W2BM 3H1VX 1BUPA 4E7IA 4CF1A 4O5BA 1HNZK 1VSLA 4A5BA 2X74A 2H3GX 4JK7A 3NF6A 5LY3A 4FL9A 4H8KA 5AFUA 3PO4A 5AQVA 1U2VB 2NLXA 1S1TA 2VQFK 1IBLK 4FJIA 3MXJA 1JLBA 1XNQK 5J2NA 2GWJA 2F8TA 3LANA 5AQYA 4PUOA 3F5TA 4CJRA 2XY6A 5EU7A 1X1PA 4DTNA 3AV9A 3VQQA 4LSNA 2QWOA 2DFHA 4FZZA 1HR0K 3PIPL 5FRMA 5GADP 3G71N 4BRQA 2ITMA 3MCAB 3ID8A 2KZZA 3PUFA 4IJNA 4BRNA 3CC4N 4OGEA 3LDPA 4OVLA 4O4GA 3TTFA 4BRMA 1Q9XA 4FK2A 2KW4A 1QQOA 3MWPA 2V51B 3SBTA 4FLXA 4O0IA 5KQDA 3M8RA 4EZ6A 1U48A 4RW7A 1NGIA 4BR0A 1ZXOA 4CEQA 3U9ZA 3ZSXA 1XWLA 2PY5A 1TL3A 3OW2M 1FK9A 3HYFA 4JI3K 3V1QA 2Z1HA 4FLTA 2YCHA 1ILYA 4GVEA 4CGFA 3E9PA 3DLBA 4B8AB 3PSFA 3NHGA 4PKIA 1CZAN 4H0VB 4E1NA 4O0JA 2A42A 3OA9A 3EO3A 1YJWN 3M8PA 3VQ4A 3IKMA 2QW9A 3GG4A 1Z05A 1ZBFA 1RT5A 3D2FB 5AZJA 3VN5A 4BACA 3CIPA 4Z4IA 1EWQA 2YKNA 4KPYA 4OLBA 1IBKK 3ATVA 4H5TA 4FWKA 3DXMA 1C0TA 4PQUA 5C2FA 3CF5L 2HF3A 3FFKB 1NNEA 3SQ2A 1HPMA 4LY7A 4JKAA 4BRDA 2E8AA 3BY5A 2A6AA 4FWNA 4PHTX 4FLUA 3ZX0A 4B9SA 1J9AA 2KFNA 4IO8A 2WUSA 4CE9A 3VQ9A 1YJNN 3F9KA 1EQYA 5EY4A 2P9PA 3L2QA 4MLEA 3SZ2A 3HOSA 4FLYA 3A2FA 3KHYA 1U04A 3S3MA 1CLQA 3WT0A 1LV5A 5AQJA 4DLGA 4IJAA 4UY8O 4CF0A 3VQBA 4CFCA 1XHXA 1SV5A 3W0LA 4FZYA 2ASOA 3O9TA 5D3GA 4DG1A 3SJJA 3DLKA 4DSJA 1XC9A 3LM2A 4A61A 2VWJA 5BPMA 2P9LB 4DQSA 4WCEL 4I6MA 4RW9A 3AA5X 4W5OA 5FRNA 5KRTA 1K73O 1JLAA 4BVOA 4FJHA 2ZWHA 1UA1A 3ZSWA 3JXUA 4WQ5C 4BR2A 3C6TA 4CHZA 1KAYA 1UOCA 4CIEA 1J6ZA 3A8YA 3NF7A 3VA3A 2VWKA 3CJAA 4FO0A 1VQ5N 4A57A 4Z0UA 4BR9A 2WC9A 1VRTA 4XH5A 4NCGA 4E89A 2NRZA 1JCEA 1K8AO 4E7JA 5GAGP 3H46O 2NRXA 4YOVA 3DXKB 4OX9K 3C0BA 2P9IB 3HRGA 4RG8A 4JKDA 2DY4A 4FJXA 1VQ4N 3CQYA 1T05A 2LSNA 1F21A 3QEPA 4FLWA 3BUZB 3OYFA 4RW8A 1VSFA 4DR7K 5DMRA 1RCHA 4KTWA 5AQOA 2XO7A 3ZT3A 4M3TA 2YJFA 3DMJA 3TAQA 4Q5VA 4F3TA 5KRSA 1EETA 2HHWA 1IKVA 1TK0A 3MN7A 3G10A 1Q18A 5MLCQ 2QEXN 4X64K 1WNSA 5JMVA 4DMNA 4CGHA 2ATQA 2P9NA 5AQRA 3AA4A 3VF6A 2I5JA 5ADXA 3BP8A 3O9QA 3VTHA 3AO5A 1K9MO 4M7YA 3DRPA 1LW0A 1VSJA 4YOUA 3J81O 3VESA 4BC2A 4DV3K 4FWQA 3C7NB 1S1XA 4OKEA 4DSIA 4CJVA 4WYBA 1S72N 4LH5A 3ULEA 4BRPA 3E9OA 4OJRA 3EZWA 4AHUA 3HK2A 4FXDA 2VYPA 4FOIA 5M1KA 2F9WA 2I7PA 4IEIA 4DF8A 3T1AA 5IT9O 2HBKA 5AQGA 1NGGA 1BA0A 2JWKA 3QETA 3EN9A 3L4QA 1NMDA 4CFDA 3D0PA 3VERA 2HHSA 2KHOA 1SZ2A 1XMQK 1WAFA 4CI6A 4FPBA 3ENBA 4CZGA 3MXIA 3PX6A 3SUNA 1SL1A 4E19A 1JLEA 3TR8A 3WEEB 3KK7A 4BE2A 3WNHA 3BZCA 1IG9A 1RT2A 1VQNN 1WAJA 1IJJA 2V7ZA 1JLGA 1X9JA 4DUYK 5F1XA 4B9MA 4IBNA 3V6DA 3RMDA 3B8AX 4DU3A 4KH5A 1NGDA 1C0MA 1RT3A 1NLVA 1A5WA 1REVA 2ZE2A 3DAWA 3LALA 4ELVA 4IFVA 5AQIA 4JI0K 4FW1A 3LAMA 1N36K 4DWIA 1MA9B 4OLAA 2YHXA 2O8BA 4MDBA 3A5MC 3SBGA 4DV1K 1N6QA 4UQGA 2Q0RA 2RHKA 5M1FA 4BGBA 4IZ9A 2WONA 2QXLA 4DV4K 5JLHA 1NGJA 2OTLN 2XY7A 4NO7A 3OS1A 3MDQA 1NU0A 3DWLA 3MAQA 3FZMA 2GV9A 3P31A 2NRTA 1M1KO 1KRPA 4LC9B 4JI1K 2E2NA 4NYNA 3ZX2A 3QIOA 1VAZA 3O3GA 3O4WA 4DR4K 3VQPA 3RR8A 2P9KA 4E7KA 3UKUA 1A5XA 4KHQA 2P9UA 1ESVA 2QWRA 4O8UA 5AQKA 3U9DA 3PO5A 4M3ZA 1RBVA 2GEMA 2IDOA 2QTDA 1NM1A 4BRCA 4XH4A 3HP6A 1BGXT 4CK3A 4K41A 1H1VA 2O8DB 1TUYA 1TV6A 4EZ9A 4NLBA 1NK7A 4JD2A 3SYZA 1KVCA 1HUXA 4PY5A 4W5TA 2E88A 2CH6A 4AHCA 3AO1A 3AVMA 4KHUA 3HVRA 5FPMA 1Y97A 3CFRA 3D45A 3DM2A 3R9PA 3DRRA 3NMUA 1GLJO 3SNNA 4IFEA 2D4WA 2Q2RA 2NRRA 4DV6K 4B3RK 4BRGA 4KKOA 5C2DA 3VQDA 4XIUA 3VOVA 2KTQA 3PSIA 3ULDA 4K0KK 1LW2A 3KLHA 4BR5A 4CEEA 3HPGA 1LWCA 4IEEA 4O5FA 4KHYA 1QZ6A 3TTCA 3GDQA 1KFSA 4JRPA 1IO2A 1YTUA 4M3UA 3ZT1A 2Z1IA 4PL8A 1FKPA 1TKXA 3T1HK 5SZTA 1CZBA 3THYB 1T7PA 3IDHA 3SUQA 4JHDB 3ZT0A 4CJEA 1ATSA 3QIPA 4LF9K 3BF1A 4B1ZA 3EEQA 2FBVA 4YY3K 4HUFA 4QCLA 4GV9A 2KFZA 1VSDA 1DTQA 4BDZA 4CW7B 3CQ8A 4B9QA 4FK0A 2XRIA 5E26A 3D2EB 1HNIA 2FC0A 3CPWM 3O3HA 1RT4A 1VQ7N 3FZHA 4FVUA 2O8EA 3RSEA 3W3DA 3TAMA 2P9SB 1QHTA 4YDUC 3CQXA 1VQMN 2F96A 1KTQA 2WFBA 3ISNC 1LAVA 3ZETA 4BC4A 1RFQA 4E1JA 4DU1A 5JS2A 3SK3A 4DQPA 1DT9A 4BROA 5LL6Z 2GBZA 4DTJA 1ZC6A 3K5OA 3LPUA 3T19A 4EHUA 4FZXC 3LDSA 3CCLN 2DTUA 2RN2A 3O9RA 4HUGA 1YVUA 3I55N 4WE1A 3NE6A 3G25A 4WQ4A 4BR7A 4JKHA 4CECA 3F73A 2XHBA 3CJCA 1U6ZA 2OZSA 4DTPA 3O1WA 4AHRA 5AQNA 1JKHA 3UE5A 1BA1A 4FJ9A 1HQEA 3PX4A 3NH2A 2NRWA 4B8CA 3P5JA 3VQEA 3AO4A 3KK1A 2IC3A 3K9JA 2Z1JA 2KZMA 4LD0A 3VETA 2RE2A 4CIFA 2X6SA 2WTUA 3QBXA 1VSMA 4Z4CA 2ZF5O 3SI6A 4M3YA 3LZJA 2JLEA 4DV2K 2ASPA 3VQ5A 2FSKA 4DQ8A 3AY9A 4EIAA 4BC5A 3P83D 5AZIB 1NGFA 2P9LA 4FWPA 4GVMA 3AVJA 4CBWA 1SL0A 2YX6A 4BRKA 1W97L 2HSTA 4F2SA 4M3WA 4AHVA 3V9UA 4JRQA 1D8YA 1WOQA 4FJ5A 1G15A 3FZLA 1VSHA 2OPSA 4W5RA 3SAFA 2YV0X 1LCUA 3VEZA 4H5RA 1HMVA 4CZIA 2PFUA 2HHXA 1T3VA 3NGIA 3AVNA 4BQLA 3NH0A 3TAGA 4FWOA 4ZTJA 3HL8A 5HRRA 4ISFA 4C8NA 1WBDA 4DTOA 3CJ7A 2BE2A 3THXB 1WBBA 4ELTA 4GW6A 4AM7A 1MWMA 3V9WA 3JAMO 1C0UA 1IKXA 3N4QA 4CEFA 3CCQN 3O80A 3M8SA 4B9VA 1NJYA 5KGXA 2E6MA 1T6DA 1TKZA 2W40A 1XUPO 2E1YA 2XY5A 4ILJA 4CEBA 5HP1A 3K0SA 4KB1A 4CJWA 2V7YA 4CJPA 3CCRN 5AQFA 3ZEUA 3DLHA 4M7XA 4XH1A 1GOCA 1LWFA 4KB0A 2IOCA 5AQHA 4A2AA 2YI1A 3I0SA 5C0YA 3P38A 1NJIO 3SJHA 1J5EK 4DSFA 2B5JA 1XNRK 1MDUB 1NJWA 4GKJK 3VA0A 4KH4A 3TABA 4HCCA 4CGGA 3MECA 1ASWA 5I3UA 4FCYA 4JKCA 1Z25A 2PBDA 1HKBA 2FLOA 3FZFA 1XI1A 3OYBA 2Y1JA 3DLGA 4CJSA 5AQWA 1J54A 4I2PA 3S3NA 1N32K 5BPNA 3IAYA 1V4TA 1ZBUA 4O44A 3QO9A 4KHSA 4QOZB 3BF3A 1TYQA 3QESA 1L3TA 1KQSM 3OHRA 4BREA 3HT3A 2HNZA 4CHOA 3P1GA 3RMCA 3A5OC 2FF6A 2JWLA 4JI7K 1OH6A 4E3SA 3WUHA 4JS5A 1NOYA 1SS6A 2VCPA 3KKRA 4AILC 1S1VA 3RR7A 4DCHA 3V9XA 4FJLA 3MMVA 5ELZA 5BN9A 4DV5K 4CJFA 1YITN 4N47A 1TAQA 3AVIA 1BI4A 2F8SA 1BQNA 3A0IX 4IOXA 5EX5A 1NK0A 5HLFA 4N56A 1YT3A 2AA4A 5EVZA 3THWB 1SUQA 3D7EO 5KPTA 4C1NK 5FDLA 1QSYA 2IVPA 5ADXH 1YF5L 2OPRA 3ALYA 3HPHA 1RDWX 4Y1DA 3H45C 2ZJQL 5JLFA 4AF1A 3ITHA 3S41A 1RTDA 4F8RA 1BO5O 3K5NA 3AVHA 1QVGM 5DK5A 1IBMK 1L3UA 4PL7A 3NGZA 4DB3A 1L3SA 3RWUA 4JKGB 2D0AA 1MWKA 4C23A 4NB4A 3SV3A 5TKWA 3K57A 2HHVA 4MFBA 1Q82O 4ILGB 1QQMA 4KHPK 3NF8A 4B9LA 3L4IA 2F9TA 4JI8K 4KHWA 4MO4A 2QKBA 4JEPA 5H1SQ 3KTQA 2W41A 3KWGA 1VQLN 2ZQBA 3MEEA 4PWDA 3A5NC 2FXUA 3TARA 2FSJA 4B9TA 2HHTA 3CCJN 5CYQA 5M1QA 1D9FA 2OTJN 4BGAA 3CCEN 3UKRA 4I7FA 4N41A 5KGWA 3SUOA 2EHGA 2ZD1A 5J2PA 1IKWA 4K25A 3E66A 3HVTA 4CGJA 4OPJA 3ZX3A 4CJTA 2HF4A 3NCIA 4Z4GA 1R59O 3AO2A 3NFAA 3QB0A 1GLBG 3OYHA 3QNNA 5HBMA 1RDBA 4ICLA 1KSPA 4LF5K 4CJ5A 1O13A 1SKWA 2CH5A 3J7AP 2X78A 3H6EA 3K9KA 5BREA 3E1YA 4DSLA 1TK5A 1B9FA 3CJBA 1S6QA 4H0XB 4BRHA 3SAHA 5HRSA 3MEGA 3VEXA 3J8AA 1X9WA 3QEVA 4H0OA 4LF6K 5LMNK 1TKDA 4DTXA 1ASUA 2DPNA 2HBMA 3MCPA 1WSIA 2D0PA 3U3YA 5E84A 3J80O 3ASMA 2A41A 4CGIA 3ATUA 4PKGA 1L5UA 2G8UA 1OH8A 1GLAG 4B1YB 1GLEG 1NJZA 3QICA 3D2EA 1BHLA 3B6PA 1SAZA 3T69A 2WBNA 4H0TB 4OGCA 1JJ2M 3LP1A 1KVBA 1E4FT 1OH7A 2VWBA 2A1RA 4JK9A 3P39A 3VQ6A 5AQQA 5M1PA 2G8VA 3WXKA 1BQMA 3C95A 3CYMA 4DFJA 4DF4A 5AQZA 1YHQN 3V9ZA 3K2PA 5AZJB 5DM7L 3DJCA 3KD1E 5T7BA 2QWQA 3PLAA 3HXMA 1NMNA 1KXPA 4H5VA 3O9SA 4DR1K 4CJ3A 3HBTA 3HM8A 4IG0A 4FJKA 3OYDA 5CR4A 1W9HA 1EXQA 2E5LK 2Q0UA 1SKRA 1S6PA 4GMJB 3L2VA 1NWKA 3HSCA 2O8CA 2D1KA 4RCHA 4CK2A 3OS2A 4FM1A 1YTAA 4FLZA 1NOZA 2Q31A 1FXXA 2YJEA 3OBWA 4CZJA 4K8XA 4MDAA 3VGLA 4F2RA 3IRXA 3L2UA 2ZGYA 4BWJA 3ZT4A 3TAPA 4WFAL 1HNWK 2W6LA 2QKKA 4HTLA 2P9PB 3L2RA 4FOEA 3ZT2A 2CGLA 3IS9A 1C0GA 3JS6A 2E4LA 3KK2A 2D0CA 3VEOA 1S1WA 1X3NA 4U67L 1N34K 4IKFA 2HVIA 3Q7CA 3QINA 5I42A 3V9SA 1Z26A 1BIUA 4DSEA 2YHYA 3ZSQA 2VG7A 2A1SA 1E3MA 4I6MB 3QFUA 5AQUA 4FJ8A 5BR9A 3KLFA 2CGJA 4DQQA 1K8KB 4FJJA 1Y64A 4KTZA 2BGGA 2OCEA 3MEDA 1NKEA 1BU6O 5FPNA 3H1QA 2G8WA 1XC3A 4JV5K 3UB5A 1BWFO 3HM9A 4H4OA 3RMAA 5KQ8A 5AQMA 1O1WA 4HWIA 5C25A 3M1FA 1S3XA 3S9HA 4C8LA 3KD5E 4LFBK 2QWPA 2Q97A 4DQIA 4E0DA 4N76A 3CG7A 1JL2A 1U2VA 3WNGA 1ZBIA 3LDNA 3D6RA 4F9OA 1R0AA 3NAEA 4FJNA 1MU2A 4FW2A 1ZBHA 2PZSA 3MXMA 3OJSA 3LWMA 2ZJRL 3CMAN 2G8IA 1KAZA 1BL3A 3U4LA 3EL2A 2OYQA 4ISGA 4H5NA 1RDAA 3PV8A 4CJ4A 3GL1A 3G6EN 3OBYA 2IS3A 2Z1GA 2QXFA 5KTQA 5FPEA 4X66K 1UA0A 1HKCA 5E41A 5FROA 3I56N 3G0ZA 2P9NB 4Z4EA 1VRUA 1ITGA 4RW6A 2UYTA 1NJXA 4FJ7A 2ITGA 2Q3SA 1C1CA 4WFBL 2FF3B 1RBTA 4KV8A 3GOIA 5EOYA 3WXMB 3QEIA 5DM6L 2VGMA 3M5RA 5CZ2A 3ZYYX 4BC3A 4QS8A 3ULEB 4Z4FA 4QS9A 1OH5A 5AQXA 1ZBLA 3O8MA 4B9UA 3L3VA 3L0QA 4B1VA 1HKGA 1K6YA 4GY2B 2YNHA 3AVFA 3B6OA 2E2PA 3AAPA 4KH6A 3D2FA 4YOTA 3O3FA 4YOYA 1KVAA 4BQZA 5KPZA 1RDUA 3SMPA 5AQTA 3CCMN 3K58A 1TK8A 4Q0BA 3LAKA 5B8HA 1VQ8N 3CERA 4JLHA 2HHQA 3OYEA 5AR0A 4HUEA 3K59A 2KKZA 2HVHA 3ZSZA 1RT6A 2PYLA 4M63C 5CHIA 4HCBA 1JXEA 3TSQA 3M6GA 4X62K 1YXQA 4NXNK 2DFFA 3HI0A 1GOAA 1CXUA 4CGDA 2O8BB 3TU5A 3CPEA 3FE1A 1OVYA 1HJRA 4DLEA 2FBXA 4FWSA 3TSUA 4B3OA 3LZIA 3LP0A 1N33K 2QM1A 5IWAK 3HO1A 1SQKA 2I7NA 3EZ5A 3R8EA 3SMSA 1T44A 1HX1A 4DR6K 2UUCK 1VQON 3O4QA 4CIGA 1Q7YO 4LF7K 2P9KB 5C10A 3ID6A 3HOTA 4E7HA 4Z4HA 4FWRA 1N5YA 3UKUB 4M3XA 4IFYA 4W5NA 2P9UB 1KLNA 1RGIA 3OYLA 4CZMA 4DTSA 2BTFA 4C1NI 4H03B 1JLQA 4DTMA 1TGOA 5CY4A 3JSMA 4W5QA 1S1UA 3VEVA 4A5AA 3CXCM 3TAFA 3AARA 4F3OA 3DRSA 2E20A 4BG8A 5GIPA 3KLIA 1NK4A 1QHAA 2HNYA 1FKOA 3A5LC 1B92A 3HSTB 4JD2B 3AVKA 1VQ9N 3KVGA 1XQSC 4IOAL 2B4JA 2NRVA 4WQ5A 5JVGL 4GV3A 2GELA 3WXIA 1YUWA 2UU9K 2YHAA 4JS4A 3TANA 3DXKA 1SL2A 3SPYA 2HW3A 4J2DA 2P9IA 4KHNA 1LWEA 4JN4A 2HBLA 5F0XA 4DHYA 3OYKA 3DI6A 3VGMA 1NGEA 1YJ9N 4IDKA 3BGRA 4K42A 1L3VA 2OPQA 4EAHD 3MWTA 1HYZA 3L8BA 2D0BA 2OZMA 4OO1J 4IXCA 4QAGA 4PKHA 4AQYK 1VQPN 2HBJA 4JK8A 1JXBA 3T1YK 4CHYA 3TPQA 1LOTB 4JI5K 1CXQA 2QI2A 1QSLA 3KLGA 1U4BA 4K43A 2E2OA 2EX3A 1RBRA 3SLCA 3EY1A 1U45A 5LMUK 3VF2A 3L3UA 1FW6A 4CHQA 1RDCA 1KD1O 3KWIA 5FLXO 2UXCK 2IAJA 5BRFA 4CD3A 3UIQA 3TI0A 1NGAA 1X9MA 4CBXA 4CJKA 1C1AA 1X9SA 4BRLA 4FJMA 1W0HA 3DOLA 4DR2K 3VTIA 4E7LA 5J2QA 1P8ZA 4KAZA 3C7NA 1EWRA 4KTQA 3S3OA 3KZBA 1JLCA 1U47A 3RVCA 2HHUA 3P4IA 3WNFA 4HTUA 3AA3A 4CZHA 3QNOA 3IG1A 3O1BA 4BDPA 5HRPA 3ZSYA 5BRDA 3SUPA 3CD6N 3E9LA 3NBPA 3RSEB 2QWLA 3ZCMA 3MN6A 2O8EB 1DTTA 3I8BA 3SQ4A 1HJOA 4JKEA 3R6MA 4IOCL 3C6AA 4M3RA 2ZM6K 1EKEA 1IV0A 2ZGZA 4FM2A 3ZETB 2O4GA 5AQSA 4TSXA 4E1MA 3EYZA 2D5RA 4WQ4C 3WEEA 1IKYA 2ETJA 1S22A 1HQUA 4NXMK 3J7ZO 1OKJA 4WF9L 2ASMA 1Q8IA 4JNEA 2JGUA 2YNFA 2O4IA 4JI6K 3ZSOA 3EE9A 3KK3A 4KREA 4FLVA 4NCBA 2FSNA 4I9QA 2QK9A 3K5MA 3VF4A 3OTOK 5M1NA 3VEYA 4CEZA 2E1ZA 1UWBA 3LDLA 1A5VA 3J7YP 2GUPA 2XY8A 4BVPA 4BR4A 4CERA 1S9EA 1QZ5A 4KO0A 4BG9A 3AGKA 1RTJA 1M90O 2O8FB 2YKMA
chains in the Genus database with same CATH topology
3T1HK 4LFBK 4JI0K 4AQYK 1IBKK 1XMOK 1N36K 1N32K 4DV2K 3T1YK 4DV1K 4JI5K 4DR3K 4X62K 4DV4K 4LF9K 4NXNK 1HNZK 4DR7K 5LMUK 4YY3K 5FLXO 2UXCK 4DR1K 2UXDK 4JI7K 2HHHK 5AJ3K 4CW7B 2E5LK 2VQFK 4JI1K 1IBLK 1XNQK 4DR2K 4DR4K 4X64K 4DR5K 4LF4K 1N33K 5IWAK 4DV5K 4LF5K 4DR6K 2UUCK 3J7AP 1HR0K 1HNWK 4X66K 3J81O 4LF7K 4DV3K 5BR8K 5LL6Z 1FJGK 3JAMO 4LFAK 2ZM6K 5A2QO 4X65K 4CVNE 4DUZK 2VQEK 4LF6K 5LMNK 4DV7K 1N34K 4B3SK 4JYAK 5IT9O 4LFCK 4JI2K 4LF8K 2F4VK 4NXMK 1IBMK 2UUBK 4DV6K 1HNXK 2UUAK 4B3RK 1XMQK 4B3MK 2UXBK 3J80O 4JI3K 4JI6K 2UU9K 4V19S 4K0KK 4KHPK 4B3TK 1J5EK 1XNRK 3OTOK 4JI8K 4YHHK 4GKJK 4JI4K 4DUYK 4JV5K 3J7YP 4DV0K 4OX9K 4GKKK 1I94K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H K;  4LFB K;  4JI0 K;  4AQY K;  1IBK K;  1XMO K;  1N36 K;  1N32 K;  4DV2 K;  3T1Y K;  4DV1 K;  4JI5 K;  4DR3 K;  4X62 K;  4DV4 K;  4LF9 K;  4NXN K;  1HNZ K;  4DR7 K;  5LMU K;  4YY3 K;  5FLX O;  2UXC K;  4DR1 K;  2UXD K;  4JI7 K;  2HHH K;  5AJ3 K;  4CW7 B;  2E5L K;  2VQF K;  4JI1 K;  1IBL K;  1XNQ K;  4DR2 K;  4DR4 K;  4X64 K;  4DR5 K;  4LF4 K;  1N33 K;  5IWA K;  4DV5 K;  4LF5 K;  4DR6 K;  2UUC K;  3J7A P;  1HR0 K;  1HNW K;  4X66 K;  3J81 O;  4LF7 K;  4DV3 K;  5BR8 K;  5LL6 Z;  1FJG K;  3JAM O;  4LFA K;  2ZM6 K;  5A2Q O;  4X65 K;  4CVN E;  4DUZ K;  2VQE K;  4LF6 K;  5LMN K;  4DV7 K;  1N34 K;  4B3S K;  4JYA K;  5IT9 O;  4LFC K;  4JI2 K;  4LF8 K;  2F4V K;  4NXM K;  1IBM K;  2UUB K;  4DV6 K;  1HNX K;  2UUA K;  4B3R K;  1XMQ K;  4B3M K;  2UXB K;  3J80 O;  4JI3 K;  4JI6 K;  2UU9 K;  4V19 S;  4K0K K;  4KHP K;  4B3T K;  1J5E K;  1XNR K;  3OTO K;  4JI8 K;  4YHH K;  4GKJ K;  4JI4 K;  4DUY K;  4JV5 K;  3J7Y P;  4DV0 K;  4OX9 K;  4GKK K;  1I94 K; 
#chains in the Genus database with same CATH topology
 3G4S N;  2HMI A;  4FM0 A;  1T8E A;  1TUU A;  2QA4 N;  1RT7 A;  3PX0 A;  4DR3 K;  4DS5 A;  4DFM A;  1IG8 A;  4KRF A;  1NGB A;  3RMB A;  4EHT A;  4FSV A;  1C6V A;  1ATN A;  3ENO A;  2Y1I A;  2HOE A;  1QQC A;  1NBW A;  2P1J A;  1J5O A;  3GBT A;  3DLR A;  2YHW A;  1NK5 A;  1KLM A;  3AVA A;  4CHP A;  1VSI A;  3CJ9 A;  5AJ3 K;  1TL1 A;  2VG6 A;  4HHT A;  4FPA A;  1UAX A;  1D4X A;  3I0R A;  4FVM A;  4JKB A;  3LL3 A;  2BDP A;  3F2K A;  2VGN A;  4CBU A;  1QTM A;  3HJF A;  1VK0 A;  4M41 A;  1JLF A;  3O9U A;  4MO5 A;  2O8D A;  1K8K A;  2A40 A;  1QQN A;  3I33 A;  5CE3 A;  1RBU A;  4CED A;  3DOK A;  5I9E B;  3F9M A;  5M1O A;  2F7T A;  2D0O A;  3OYC A;  4C8O A;  4MQ3 A;  3OYI A;  1DKG D;  1NKB A;  3AVB A;  1RDD A;  3VQC A;  4CJQ A;  3MN5 A;  4AH9 A;  4DSK A;  5BPL A;  2GWK A;  4H0P A;  3VQA A;  1TAU A;  3CCS N;  2IGI A;  3WXJ A;  3O6W A;  4Z94 A;  1T6C A;  4BE0 A;  3AGR A;  3SCX A;  5SWM A;  3LP2 A;  2A5X A;  4K8Z A;  4CEO A;  1IH7 A;  1JCG A;  3H3O B;  4CCH A;  2Q1N A;  4L3Q A;  1NG9 A;  4N5S A;  1YIJ N;  3E01 A;  4DTR A;  4CEA A;  3MX5 A;  3FR0 A;  5BN8 A;  1NK6 A;  1WSH A;  3I8D A;  1KFD A;  4O8K A;  3T3F A;  2BAN A;  3JYT A;  3M8Q A;  3FLC O;  3BDP A;  4YHH K;  3THY A;  3ZEU B;  1GOB A;  3QEW A;  1VSK A;  4JHD A;  4ILH A;  5TKY A;  4BDY A;  3AA2 A;  1BDG A;  4PA1 A;  3SPZ A;  3L2W A;  1RTI A;  1RIL A;  3WQU A;  1NKC A;  4NLC A;  4H4M A;  2IIR A;  3OYN A;  4IDH A;  3QER A;  2DFE A;  1I39 A;  3KKS A;  4B1X B;  1WLJ A;  3AVC A;  3VEW A;  1W7A A;  2KQ2 A;  4AM6 A;  4CJU A;  2A3Z A;  3O08 A;  3QLH A;  5KI6 A;  4L8R B;  4CJL A;  5C15 A;  3AAQ A;  2HB5 A;  3CM5 A;  2R7Y A;  4LH4 A;  1BIS A;  3OS0 A;  4BRI A;  1TYQ B;  2EWS A;  3CCV N;  2P9S A;  3VMF B;  4IO9 L;  4GV6 A;  2IVN A;  2NUB A;  3O5B A;  3FFI A;  5C12 A;  4J2A A;  4AHS A;  3U8X A;  4DQR A;  4BY9 C;  3NGY A;  3Q7B A;  2AJQ A;  4YFU A;  3O4N A;  4ZTF A;  1E4G T;  3DYA A;  2YNG A;  4YDU A;  3RTV A;  4HVJ A;  2P5G A;  2HND A;  4J8F A;  3DXM B;  1QE1 A;  2P51 A;  1C0F A;  4F4K A;  3BEX A;  3NVK A;  5CYM A;  1VQ6 N;  1BI4 B;  3SV4 A;  4FWL A;  1HPZ A;  5A2Q O;  2WOM A;  4X65 K;  4G9Z A;  1TKT A;  3AVG A;  4B3S K;  4EFH A;  1Q9Y A;  2G8H A;  3QML A;  1VHX A;  4LF8 K;  3NH1 A;  3QDK A;  4CHN A;  4BWM A;  1D9D A;  2PYJ A;  3OVN A;  3C6H A;  4H0Y B;  3TWH A;  2W42 A;  4G1Q A;  5EXW A;  5FPD A;  3K5L A;  1NGC A;  3MN9 A;  4DS4 A;  4DFK A;  1WN7 A;  1WSJ A;  2RKI A;  3AO3 A;  1KCF A;  4I2Q A;  3R1X A;  4V19 S;  1QS4 A;  4CZL A;  4YOR A;  4B3T K;  2NZT A;  4KI6 A;  2AP1 A;  1HYS A;  4DKW A;  3U3G A;  2P5O A;  4CZE A;  4B08 A;  3OYG A;  4CJ7 A;  1YVN A;  4A62 A;  2X6N A;  4FJG A;  4DV0 K;  3TSP A;  3CJ1 A;  1ASV A;  1JCF A;  4CFB A;  4C8K A;  5AZI A;  4EP5 A;  2V52 B;  3EE8 A;  4CF9 A;  1CZ9 A;  4CES A;  3TAE A;  3ZSV A;  3CET A;  3EKS A;  3VQ7 A;  3HTV A;  1J53 A;  5J2M A;  1HRH A;  4DFP A;  1P90 A;  1BCO A;  3OYA A;  2J4R A;  4U7B A;  5KPR A;  5AQL A;  3IFR A;  4B1U B;  3FGU A;  2UXD K;  3MX2 A;  4JAX A;  4NYF A;  4KI4 A;  5AQP A;  3BZK A;  4ID1 A;  3UKR B;  1GLL O;  4WFN L;  3ZLJ A;  3H3N O;  4RWT A;  1S5J A;  2BUP A;  4DR5 K;  4CK1 A;  1RBS A;  1WUA A;  3OYJ A;  3THX A;  4DTU A;  1YAG A;  5HOO A;  3IMX A;  1N8R O;  1ZBS A;  4CF2 A;  1DGK N;  4AHT A;  2G8K A;  4DU4 A;  1VSE A;  4Y0W A;  1KAX A;  2HMP A;  3CI5 A;  2GX9 A;  4QS7 A;  2FBY A;  4A2B A;  1HYV A;  2OAN A;  4OKJ A;  4IG3 A;  3CHW A;  2Q36 A;  4YNQ A;  3WXL A;  3WNE A;  5GAE P;  5HRO A;  3T7Z A;  3LP3 A;  1HLU A;  2CGK A;  4CVN E;  4DUZ K;  4CZF A;  2B6A A;  2KLA A;  2NNW A;  1V4S A;  3QBW A;  4LFC K;  4OKK A;  2RF2 A;  4JI2 K;  1QSS A;  2F4V K;  3LDO A;  1LAW A;  1KC8 O;  1RNH A;  4CFA A;  3ENH A;  4KFB A;  3SQ0 A;  3TTD A;  2QWM A;  4GNI A;  3VEN A;  4J2B A;  1WSG A;  5JVH L;  3HZ6 A;  1DEJ A;  3VGK A;  2ZJP L;  3KJV A;  3SAG A;  3SQ1 A;  1WSE A;  5J1E A;  1VQK N;  4LSL A;  5HL7 L;  3PY8 A;  4OPH A;  4YOX A;  5C24 A;  1EX4 A;  3H08 A;  3V4I A;  1WSF A;  1YI2 N;  2GTD A;  4ID5 A;  2YNI A;  3CC7 N;  1XMO K;  2FBT A;  4ZHR A;  5LJW A;  4B9N A;  2IVO A;  2E6L A;  4O55 A;  5AFU H;  1Q86 O;  5GAH P;  4XEI A;  1NK9 A;  3NDK A;  2YHB A;  1WB9 A;  3LM9 A;  1Q81 O;  1BOT O;  4M42 A;  4NCA A;  3N4P A;  4A59 A;  4FK4 A;  1RTH A;  3GE1 A;  1EO1 A;  4B1W B;  3IUC A;  2HHH K;  1BCM A;  1S9G A;  3LDQ A;  3CM6 A;  3HP9 A;  3WQT A;  4IWV A;  4KBO A;  5JIC A;  1G99 A;  4JKF A;  3QFP A;  1GLF O;  3THW A;  4MLH A;  3NVM A;  3V1O A;  4LF4 K;  3CFO A;  1C1B A;  3KIO A;  3FZK A;  3L6Q A;  4ELU A;  1ZYQ A;  4ISE A;  2RPI A;  3HPO A;  3MK6 A;  4OPK A;  4BE1 A;  2E2Q A;  2OPP A;  5GIO A;  4CZK A;  2O8C B;  3R3L A;  3LWL A;  5CZ1 A;  4RW4 A;  3M3Z A;  5BR8 K;  2BH1 A;  3DLE A;  3QEX A;  1FJG K;  3V1R A;  3DLL L;  1GLD G;  4LFA K;  4YOW A;  1I3A A;  4R5P A;  2O8F A;  1OVQ A;  4JKG A;  2VQE K;  1B9D A;  3OJU A;  1U49 A;  3CC2 N;  4DV7 K;  1QVF M;  4JYA K;  4Y1C A;  1TVR A;  2PAV A;  3AVL A;  3PIO L;  3CME N;  4RTF D;  2UUB K;  4BRA A;  1HNX K;  2UUA K;  3CFP A;  4B3M K;  3C65 A;  1BG3 A;  4EP4 A;  2UXB K;  3C6U A;  1Z6R A;  1JL1 A;  3RRH A;  5HRN A;  5JS1 A;  4FYD A;  1DLO A;  3OYM A;  5F2R A;  3V81 A;  1BIZ A;  3VQ8 A;  1HNV A;  1ATR A;  4H5W A;  3VPZ A;  2NRH A;  4BRF A;  3NF9 A;  2GUI A;  3EKU A;  1X3M A;  4JI4 K;  5C42 A;  5LJV A;  1XHZ A;  2QWN A;  1SKS A;  3RRG A;  3LPT A;  3OY9 A;  2W6K A;  1NGH A;  4M45 A;  4C8M A;  1D5A A;  2G8F A;  1RT1 A;  4GKK K;  4R79 A;  1EP4 A;  1I94 K;  3KLE A;  5BRH A;  4CD1 A;  3THV A;  4CF8 A;  1T03 A;  4OPA A;  3ZSR A;  3U6F A;  1GLC G;  3C94 A;  3CCU N;  4I9L A;  5GIN A;  5K14 A;  4FWM A;  1NK8 A;  2VG5 A;  2OA8 A;  4J2E A;  1W2B M;  3H1V X;  1BUP A;  4E7I A;  4CF1 A;  4O5B A;  1HNZ K;  1VSL A;  4A5B A;  2X74 A;  2H3G X;  4JK7 A;  3NF6 A;  5LY3 A;  4FL9 A;  4H8K A;  5AFU A;  3PO4 A;  5AQV A;  1U2V B;  2NLX A;  1S1T A;  2VQF K;  1IBL K;  4FJI A;  3MXJ A;  1JLB A;  1XNQ K;  5J2N A;  2GWJ A;  2F8T A;  3LAN A;  5AQY A;  4PUO A;  3F5T A;  4CJR A;  2XY6 A;  5EU7 A;  1X1P A;  4DTN A;  3AV9 A;  3VQQ A;  4LSN A;  2QWO A;  2DFH A;  4FZZ A;  1HR0 K;  3PIP L;  5FRM A;  5GAD P;  3G71 N;  4BRQ A;  2ITM A;  3MCA B;  3ID8 A;  2KZZ A;  3PUF A;  4IJN A;  4BRN A;  3CC4 N;  4OGE A;  3LDP A;  4OVL A;  4O4G A;  3TTF A;  4BRM A;  1Q9X A;  4FK2 A;  2KW4 A;  1QQO A;  3MWP A;  2V51 B;  3SBT A;  4FLX A;  4O0I A;  5KQD A;  3M8R A;  4EZ6 A;  1U48 A;  4RW7 A;  1NGI A;  4BR0 A;  1ZXO A;  4CEQ A;  3U9Z A;  3ZSX A;  1XWL A;  2PY5 A;  1TL3 A;  3OW2 M;  1FK9 A;  3HYF A;  4JI3 K;  3V1Q A;  2Z1H A;  4FLT A;  2YCH A;  1ILY A;  4GVE A;  4CGF A;  3E9P A;  3DLB A;  4B8A B;  3PSF A;  3NHG A;  4PKI A;  1CZA N;  4H0V B;  4E1N A;  4O0J A;  2A42 A;  3OA9 A;  3EO3 A;  1YJW N;  3M8P A;  3VQ4 A;  3IKM A;  2QW9 A;  3GG4 A;  1Z05 A;  1ZBF A;  1RT5 A;  3D2F B;  5AZJ A;  3VN5 A;  4BAC A;  3CIP A;  4Z4I A;  1EWQ A;  2YKN A;  4KPY A;  4OLB A;  1IBK K;  3ATV A;  4H5T A;  4FWK A;  3DXM A;  1C0T A;  4PQU A;  5C2F A;  3CF5 L;  2HF3 A;  3FFK B;  1NNE A;  3SQ2 A;  1HPM A;  4LY7 A;  4JKA A;  4BRD A;  2E8A A;  3BY5 A;  2A6A A;  4FWN A;  4PHT X;  4FLU A;  3ZX0 A;  4B9S A;  1J9A A;  2KFN A;  4IO8 A;  2WUS A;  4CE9 A;  3VQ9 A;  1YJN N;  3F9K A;  1EQY A;  5EY4 A;  2P9P A;  3L2Q A;  4MLE A;  3SZ2 A;  3HOS A;  4FLY A;  3A2F A;  3KHY A;  1U04 A;  3S3M A;  1CLQ A;  3WT0 A;  1LV5 A;  5AQJ A;  4DLG A;  4IJA A;  4UY8 O;  4CF0 A;  3VQB A;  4CFC A;  1XHX A;  1SV5 A;  3W0L A;  4FZY A;  2ASO A;  3O9T A;  5D3G A;  4DG1 A;  3SJJ A;  3DLK A;  4DSJ A;  1XC9 A;  3LM2 A;  4A61 A;  2VWJ A;  5BPM A;  2P9L B;  4DQS A;  4WCE L;  4I6M A;  4RW9 A;  3AA5 X;  4W5O A;  5FRN A;  5KRT A;  1K73 O;  1JLA A;  4BVO A;  4FJH A;  2ZWH A;  1UA1 A;  3ZSW A;  3JXU A;  4WQ5 C;  4BR2 A;  3C6T A;  4CHZ A;  1KAY A;  1UOC A;  4CIE A;  1J6Z A;  3A8Y A;  3NF7 A;  3VA3 A;  2VWK A;  3CJA A;  4FO0 A;  1VQ5 N;  4A57 A;  4Z0U A;  4BR9 A;  2WC9 A;  1VRT A;  4XH5 A;  4NCG A;  4E89 A;  2NRZ A;  1JCE A;  1K8A O;  4E7J A;  5GAG P;  3H46 O;  2NRX A;  4YOV A;  3DXK B;  4OX9 K;  3C0B A;  2P9I B;  3HRG A;  4RG8 A;  4JKD A;  2DY4 A;  4FJX A;  1VQ4 N;  3CQY A;  1T05 A;  2LSN A;  1F21 A;  3QEP A;  4FLW A;  3BUZ B;  3OYF A;  4RW8 A;  1VSF A;  4DR7 K;  5DMR A;  1RCH A;  4KTW A;  5AQO A;  2XO7 A;  3ZT3 A;  4M3T A;  2YJF A;  3DMJ A;  3TAQ A;  4Q5V A;  4F3T A;  5KRS A;  1EET A;  2HHW A;  1IKV A;  1TK0 A;  3MN7 A;  3G10 A;  1Q18 A;  5MLC Q;  2QEX N;  4X64 K;  1WNS A;  5JMV A;  4DMN A;  4CGH A;  2ATQ A;  2P9N A;  5AQR A;  3AA4 A;  3VF6 A;  2I5J A;  5ADX A;  3BP8 A;  3O9Q A;  3VTH A;  3AO5 A;  1K9M O;  4M7Y A;  3DRP A;  1LW0 A;  1VSJ A;  4YOU A;  3J81 O;  3VES A;  4BC2 A;  4DV3 K;  4FWQ A;  3C7N B;  1S1X A;  4OKE A;  4DSI A;  4CJV A;  4WYB A;  1S72 N;  4LH5 A;  3ULE A;  4BRP A;  3E9O A;  4OJR A;  3EZW A;  4AHU A;  3HK2 A;  4FXD A;  2VYP A;  4FOI A;  5M1K A;  2F9W A;  2I7P A;  4IEI A;  4DF8 A;  3T1A A;  5IT9 O;  2HBK A;  5AQG A;  1NGG A;  1BA0 A;  2JWK A;  3QET A;  3EN9 A;  3L4Q A;  1NMD A;  4CFD A;  3D0P A;  3VER A;  2HHS A;  2KHO A;  1SZ2 A;  1XMQ K;  1WAF A;  4CI6 A;  4FPB A;  3ENB A;  4CZG A;  3MXI A;  3PX6 A;  3SUN A;  1SL1 A;  4E19 A;  1JLE A;  3TR8 A;  3WEE B;  3KK7 A;  4BE2 A;  3WNH A;  3BZC A;  1IG9 A;  1RT2 A;  1VQN N;  1WAJ A;  1IJJ A;  2V7Z A;  1JLG A;  1X9J A;  4DUY K;  5F1X A;  4B9M A;  4IBN A;  3V6D A;  3RMD A;  3B8A X;  4DU3 A;  4KH5 A;  1NGD A;  1C0M A;  1RT3 A;  1NLV A;  1A5W A;  1REV A;  2ZE2 A;  3DAW A;  3LAL A;  4ELV A;  4IFV A;  5AQI A;  4JI0 K;  4FW1 A;  3LAM A;  1N36 K;  4DWI A;  1MA9 B;  4OLA A;  2YHX A;  2O8B A;  4MDB A;  3A5M C;  3SBG A;  4DV1 K;  1N6Q A;  4UQG A;  2Q0R A;  2RHK A;  5M1F A;  4BGB A;  4IZ9 A;  2WON A;  2QXL A;  4DV4 K;  5JLH A;  1NGJ A;  2OTL N;  2XY7 A;  4NO7 A;  3OS1 A;  3MDQ A;  1NU0 A;  3DWL A;  3MAQ A;  3FZM A;  2GV9 A;  3P31 A;  2NRT A;  1M1K O;  1KRP A;  4LC9 B;  4JI1 K;  2E2N A;  4NYN A;  3ZX2 A;  3QIO A;  1VAZ A;  3O3G A;  3O4W A;  4DR4 K;  3VQP A;  3RR8 A;  2P9K A;  4E7K A;  3UKU A;  1A5X A;  4KHQ A;  2P9U A;  1ESV A;  2QWR A;  4O8U A;  5AQK A;  3U9D A;  3PO5 A;  4M3Z A;  1RBV A;  2GEM A;  2IDO A;  2QTD A;  1NM1 A;  4BRC A;  4XH4 A;  3HP6 A;  1BGX T;  4CK3 A;  4K41 A;  1H1V A;  2O8D B;  1TUY A;  1TV6 A;  4EZ9 A;  4NLB A;  1NK7 A;  4JD2 A;  3SYZ A;  1KVC A;  1HUX A;  4PY5 A;  4W5T A;  2E88 A;  2CH6 A;  4AHC A;  3AO1 A;  3AVM A;  4KHU A;  3HVR A;  5FPM A;  1Y97 A;  3CFR A;  3D45 A;  3DM2 A;  3R9P A;  3DRR A;  3NMU A;  1GLJ O;  3SNN A;  4IFE A;  2D4W A;  2Q2R A;  2NRR A;  4DV6 K;  4B3R K;  4BRG A;  4KKO A;  5C2D A;  3VQD A;  4XIU A;  3VOV A;  2KTQ A;  3PSI A;  3ULD A;  4K0K K;  1LW2 A;  3KLH A;  4BR5 A;  4CEE A;  3HPG A;  1LWC A;  4IEE A;  4O5F A;  4KHY A;  1QZ6 A;  3TTC A;  3GDQ A;  1KFS A;  4JRP A;  1IO2 A;  1YTU A;  4M3U A;  3ZT1 A;  2Z1I A;  4PL8 A;  1FKP A;  1TKX A;  3T1H K;  5SZT A;  1CZB A;  3THY B;  1T7P A;  3IDH A;  3SUQ A;  4JHD B;  3ZT0 A;  4CJE A;  1ATS A;  3QIP A;  4LF9 K;  3BF1 A;  4B1Z A;  3EEQ A;  2FBV A;  4YY3 K;  4HUF A;  4QCL A;  4GV9 A;  2KFZ A;  1VSD A;  1DTQ A;  4BDZ A;  4CW7 B;  3CQ8 A;  4B9Q A;  4FK0 A;  2XRI A;  5E26 A;  3D2E B;  1HNI A;  2FC0 A;  3CPW M;  3O3H A;  1RT4 A;  1VQ7 N;  3FZH A;  4FVU A;  2O8E A;  3RSE A;  3W3D A;  3TAM A;  2P9S B;  1QHT A;  4YDU C;  3CQX A;  1VQM N;  2F96 A;  1KTQ A;  2WFB A;  3ISN C;  1LAV A;  3ZET A;  4BC4 A;  1RFQ A;  4E1J A;  4DU1 A;  5JS2 A;  3SK3 A;  4DQP A;  1DT9 A;  4BRO A;  5LL6 Z;  2GBZ A;  4DTJ A;  1ZC6 A;  3K5O A;  3LPU A;  3T19 A;  4EHU A;  4FZX C;  3LDS A;  3CCL N;  2DTU A;  2RN2 A;  3O9R A;  4HUG A;  1YVU A;  3I55 N;  4WE1 A;  3NE6 A;  3G25 A;  4WQ4 A;  4BR7 A;  4JKH A;  4CEC A;  3F73 A;  2XHB A;  3CJC A;  1U6Z A;  2OZS A;  4DTP A;  3O1W A;  4AHR A;  5AQN A;  1JKH A;  3UE5 A;  1BA1 A;  4FJ9 A;  1HQE A;  3PX4 A;  3NH2 A;  2NRW A;  4B8C A;  3P5J A;  3VQE A;  3AO4 A;  3KK1 A;  2IC3 A;  3K9J A;  2Z1J A;  2KZM A;  4LD0 A;  3VET A;  2RE2 A;  4CIF A;  2X6S A;  2WTU A;  3QBX A;  1VSM A;  4Z4C A;  2ZF5 O;  3SI6 A;  4M3Y A;  3LZJ A;  2JLE A;  4DV2 K;  2ASP A;  3VQ5 A;  2FSK A;  4DQ8 A;  3AY9 A;  4EIA A;  4BC5 A;  3P83 D;  5AZI B;  1NGF A;  2P9L A;  4FWP A;  4GVM A;  3AVJ A;  4CBW A;  1SL0 A;  2YX6 A;  4BRK A;  1W97 L;  2HST A;  4F2S A;  4M3W A;  4AHV A;  3V9U A;  4JRQ A;  1D8Y A;  1WOQ A;  4FJ5 A;  1G15 A;  3FZL A;  1VSH A;  2OPS A;  4W5R A;  3SAF A;  2YV0 X;  1LCU A;  3VEZ A;  4H5R A;  1HMV A;  4CZI A;  2PFU A;  2HHX A;  1T3V A;  3NGI A;  3AVN A;  4BQL A;  3NH0 A;  3TAG A;  4FWO A;  4ZTJ A;  3HL8 A;  5HRR A;  4ISF A;  4C8N A;  1WBD A;  4DTO A;  3CJ7 A;  2BE2 A;  3THX B;  1WBB A;  4ELT A;  4GW6 A;  4AM7 A;  1MWM A;  3V9W A;  3JAM O;  1C0U A;  1IKX A;  3N4Q A;  4CEF A;  3CCQ N;  3O80 A;  3M8S A;  4B9V A;  1NJY A;  5KGX A;  2E6M A;  1T6D A;  1TKZ A;  2W40 A;  1XUP O;  2E1Y A;  2XY5 A;  4ILJ A;  4CEB A;  5HP1 A;  3K0S A;  4KB1 A;  4CJW A;  2V7Y A;  4CJP A;  3CCR N;  5AQF A;  3ZEU A;  3DLH A;  4M7X A;  4XH1 A;  1GOC A;  1LWF A;  4KB0 A;  2IOC A;  5AQH A;  4A2A A;  2YI1 A;  3I0S A;  5C0Y A;  3P38 A;  1NJI O;  3SJH A;  1J5E K;  4DSF A;  2B5J A;  1XNR K;  1MDU B;  1NJW A;  4GKJ K;  3VA0 A;  4KH4 A;  3TAB A;  4HCC A;  4CGG A;  3MEC A;  1ASW A;  5I3U A;  4FCY A;  4JKC A;  1Z25 A;  2PBD A;  1HKB A;  2FLO A;  3FZF A;  1XI1 A;  3OYB A;  2Y1J A;  3DLG A;  4CJS A;  5AQW A;  1J54 A;  4I2P A;  3S3N A;  1N32 K;  5BPN A;  3IAY A;  1V4T A;  1ZBU A;  4O44 A;  3QO9 A;  4KHS A;  4QOZ B;  3BF3 A;  1TYQ A;  3QES A;  1L3T A;  1KQS M;  3OHR A;  4BRE A;  3HT3 A;  2HNZ A;  4CHO A;  3P1G A;  3RMC A;  3A5O C;  2FF6 A;  2JWL A;  4JI7 K;  1OH6 A;  4E3S A;  3WUH A;  4JS5 A;  1NOY A;  1SS6 A;  2VCP A;  3KKR A;  4AIL C;  1S1V A;  3RR7 A;  4DCH A;  3V9X A;  4FJL A;  3MMV A;  5ELZ A;  5BN9 A;  4DV5 K;  4CJF A;  1YIT N;  4N47 A;  1TAQ A;  3AVI A;  1BI4 A;  2F8S A;  1BQN A;  3A0I X;  4IOX A;  5EX5 A;  1NK0 A;  5HLF A;  4N56 A;  1YT3 A;  2AA4 A;  5EVZ A;  3THW B;  1SUQ A;  3D7E O;  5KPT A;  4C1N K;  5FDL A;  1QSY A;  2IVP A;  5ADX H;  1YF5 L;  2OPR A;  3ALY A;  3HPH A;  1RDW X;  4Y1D A;  3H45 C;  2ZJQ L;  5JLF A;  4AF1 A;  3ITH A;  3S41 A;  1RTD A;  4F8R A;  1BO5 O;  3K5N A;  3AVH A;  1QVG M;  5DK5 A;  1IBM K;  1L3U A;  4PL7 A;  3NGZ A;  4DB3 A;  1L3S A;  3RWU A;  4JKG B;  2D0A A;  1MWK A;  4C23 A;  4NB4 A;  3SV3 A;  5TKW A;  3K57 A;  2HHV A;  4MFB A;  1Q82 O;  4ILG B;  1QQM A;  4KHP K;  3NF8 A;  4B9L A;  3L4I A;  2F9T A;  4JI8 K;  4KHW A;  4MO4 A;  2QKB A;  4JEP A;  5H1S Q;  3KTQ A;  2W41 A;  3KWG A;  1VQL N;  2ZQB A;  3MEE A;  4PWD A;  3A5N C;  2FXU A;  3TAR A;  2FSJ A;  4B9T A;  2HHT A;  3CCJ N;  5CYQ A;  5M1Q A;  1D9F A;  2OTJ N;  4BGA A;  3CCE N;  3UKR A;  4I7F A;  4N41 A;  5KGW A;  3SUO A;  2EHG A;  2ZD1 A;  5J2P A;  1IKW A;  4K25 A;  3E66 A;  3HVT A;  4CGJ A;  4OPJ A;  3ZX3 A;  4CJT A;  2HF4 A;  3NCI A;  4Z4G A;  1R59 O;  3AO2 A;  3NFA A;  3QB0 A;  1GLB G;  3OYH A;  3QNN A;  5HBM A;  1RDB A;  4ICL A;  1KSP A;  4LF5 K;  4CJ5 A;  1O13 A;  1SKW A;  2CH5 A;  3J7A P;  2X78 A;  3H6E A;  3K9K A;  5BRE A;  3E1Y A;  4DSL A;  1TK5 A;  1B9F A;  3CJB A;  1S6Q A;  4H0X B;  4BRH A;  3SAH A;  5HRS A;  3MEG A;  3VEX A;  3J8A A;  1X9W A;  3QEV A;  4H0O A;  4LF6 K;  5LMN K;  1TKD A;  4DTX A;  1ASU A;  2DPN A;  2HBM A;  3MCP A;  1WSI A;  2D0P A;  3U3Y A;  5E84 A;  3J80 O;  3ASM A;  2A41 A;  4CGI A;  3ATU A;  4PKG A;  1L5U A;  2G8U A;  1OH8 A;  1GLA G;  4B1Y B;  1GLE G;  1NJZ A;  3QIC A;  3D2E A;  1BHL A;  3B6P A;  1SAZ A;  3T69 A;  2WBN A;  4H0T B;  4OGC A;  1JJ2 M;  3LP1 A;  1KVB A;  1E4F T;  1OH7 A;  2VWB A;  2A1R A;  4JK9 A;  3P39 A;  3VQ6 A;  5AQQ A;  5M1P A;  2G8V A;  3WXK A;  1BQM A;  3C95 A;  3CYM A;  4DFJ A;  4DF4 A;  5AQZ A;  1YHQ N;  3V9Z A;  3K2P A;  5AZJ B;  5DM7 L;  3DJC A;  3KD1 E;  5T7B A;  2QWQ A;  3PLA A;  3HXM A;  1NMN A;  1KXP A;  4H5V A;  3O9S A;  4DR1 K;  4CJ3 A;  3HBT A;  3HM8 A;  4IG0 A;  4FJK A;  3OYD A;  5CR4 A;  1W9H A;  1EXQ A;  2E5L K;  2Q0U A;  1SKR A;  1S6P A;  4GMJ B;  3L2V A;  1NWK A;  3HSC A;  2O8C A;  2D1K A;  4RCH A;  4CK2 A;  3OS2 A;  4FM1 A;  1YTA A;  4FLZ A;  1NOZ A;  2Q31 A;  1FXX A;  2YJE A;  3OBW A;  4CZJ A;  4K8X A;  4MDA A;  3VGL A;  4F2R A;  3IRX A;  3L2U A;  2ZGY A;  4BWJ A;  3ZT4 A;  3TAP A;  4WFA L;  1HNW K;  2W6L A;  2QKK A;  4HTL A;  2P9P B;  3L2R A;  4FOE A;  3ZT2 A;  2CGL A;  3IS9 A;  1C0G A;  3JS6 A;  2E4L A;  3KK2 A;  2D0C A;  3VEO A;  1S1W A;  1X3N A;  4U67 L;  1N34 K;  4IKF A;  2HVI A;  3Q7C A;  3QIN A;  5I42 A;  3V9S A;  1Z26 A;  1BIU A;  4DSE A;  2YHY A;  3ZSQ A;  2VG7 A;  2A1S A;  1E3M A;  4I6M B;  3QFU A;  5AQU A;  4FJ8 A;  5BR9 A;  3KLF A;  2CGJ A;  4DQQ A;  1K8K B;  4FJJ A;  1Y64 A;  4KTZ A;  2BGG A;  2OCE A;  3MED A;  1NKE A;  1BU6 O;  5FPN A;  3H1Q A;  2G8W A;  1XC3 A;  4JV5 K;  3UB5 A;  1BWF O;  3HM9 A;  4H4O A;  3RMA A;  5KQ8 A;  5AQM A;  1O1W A;  4HWI A;  5C25 A;  3M1F A;  1S3X A;  3S9H A;  4C8L A;  3KD5 E;  4LFB K;  2QWP A;  2Q97 A;  4DQI A;  4E0D A;  4N76 A;  3CG7 A;  1JL2 A;  1U2V A;  3WNG A;  1ZBI A;  3LDN A;  3D6R A;  4F9O A;  1R0A A;  3NAE A;  4FJN A;  1MU2 A;  4FW2 A;  1ZBH A;  2PZS A;  3MXM A;  3OJS A;  3LWM A;  2ZJR L;  3CMA N;  2G8I A;  1KAZ A;  1BL3 A;  3U4L A;  3EL2 A;  2OYQ A;  4ISG A;  4H5N A;  1RDA A;  3PV8 A;  4CJ4 A;  3GL1 A;  3G6E N;  3OBY A;  2IS3 A;  2Z1G A;  2QXF A;  5KTQ A;  5FPE A;  4X66 K;  1UA0 A;  1HKC A;  5E41 A;  5FRO A;  3I56 N;  3G0Z A;  2P9N B;  4Z4E A;  1VRU A;  1ITG A;  4RW6 A;  2UYT A;  1NJX A;  4FJ7 A;  2ITG A;  2Q3S A;  1C1C A;  4WFB L;  2FF3 B;  1RBT A;  4KV8 A;  3GOI A;  5EOY A;  3WXM B;  3QEI A;  5DM6 L;  2VGM A;  3M5R A;  5CZ2 A;  3ZYY X;  4BC3 A;  4QS8 A;  3ULE B;  4Z4F A;  4QS9 A;  1OH5 A;  5AQX A;  1ZBL A;  3O8M A;  4B9U A;  3L3V A;  3L0Q A;  4B1V A;  1HKG A;  1K6Y A;  4GY2 B;  2YNH A;  3AVF A;  3B6O A;  2E2P A;  3AAP A;  4KH6 A;  3D2F A;  4YOT A;  3O3F A;  4YOY A;  1KVA A;  4BQZ A;  5KPZ A;  1RDU A;  3SMP A;  5AQT A;  3CCM N;  3K58 A;  1TK8 A;  4Q0B A;  3LAK A;  5B8H A;  1VQ8 N;  3CER A;  4JLH A;  2HHQ A;  3OYE A;  5AR0 A;  4HUE A;  3K59 A;  2KKZ A;  2HVH A;  3ZSZ A;  1RT6 A;  2PYL A;  4M63 C;  5CHI A;  4HCB A;  1JXE A;  3TSQ A;  3M6G A;  4X62 K;  1YXQ A;  4NXN K;  2DFF A;  3HI0 A;  1GOA A;  1CXU A;  4CGD A;  2O8B B;  3TU5 A;  3CPE A;  3FE1 A;  1OVY A;  1HJR A;  4DLE A;  2FBX A;  4FWS A;  3TSU A;  4B3O A;  3LZI A;  3LP0 A;  1N33 K;  2QM1 A;  5IWA K;  3HO1 A;  1SQK A;  2I7N A;  3EZ5 A;  3R8E A;  3SMS A;  1T44 A;  1HX1 A;  4DR6 K;  2UUC K;  1VQO N;  3O4Q A;  4CIG A;  1Q7Y O;  4LF7 K;  2P9K B;  5C10 A;  3ID6 A;  3HOT A;  4E7H A;  4Z4H A;  4FWR A;  1N5Y A;  3UKU B;  4M3X A;  4IFY A;  4W5N A;  2P9U B;  1KLN A;  1RGI A;  3OYL A;  4CZM A;  4DTS A;  2BTF A;  4C1N I;  4H03 B;  1JLQ A;  4DTM A;  1TGO A;  5CY4 A;  3JSM A;  4W5Q A;  1S1U A;  3VEV A;  4A5A A;  3CXC M;  3TAF A;  3AAR A;  4F3O A;  3DRS A;  2E20 A;  4BG8 A;  5GIP A;  3KLI A;  1NK4 A;  1QHA A;  2HNY A;  1FKO A;  3A5L C;  1B92 A;  3HST B;  4JD2 B;  3AVK A;  1VQ9 N;  3KVG A;  1XQS C;  4IOA L;  2B4J A;  2NRV A;  4WQ5 A;  5JVG L;  4GV3 A;  2GEL A;  3WXI A;  1YUW A;  2UU9 K;  2YHA A;  4JS4 A;  3TAN A;  3DXK A;  1SL2 A;  3SPY A;  2HW3 A;  4J2D A;  2P9I A;  4KHN A;  1LWE A;  4JN4 A;  2HBL A;  5F0X A;  4DHY A;  3OYK A;  3DI6 A;  3VGM A;  1NGE A;  1YJ9 N;  4IDK A;  3BGR A;  4K42 A;  1L3V A;  2OPQ A;  4EAH D;  3MWT A;  1HYZ A;  3L8B A;  2D0B A;  2OZM A;  4OO1 J;  4IXC A;  4QAG A;  4PKH A;  4AQY K;  1VQP N;  2HBJ A;  4JK8 A;  1JXB A;  3T1Y K;  4CHY A;  3TPQ A;  1LOT B;  4JI5 K;  1CXQ A;  2QI2 A;  1QSL A;  3KLG A;  1U4B A;  4K43 A;  2E2O A;  2EX3 A;  1RBR A;  3SLC A;  3EY1 A;  1U45 A;  5LMU K;  3VF2 A;  3L3U A;  1FW6 A;  4CHQ A;  1RDC A;  1KD1 O;  3KWI A;  5FLX O;  2UXC K;  2IAJ A;  5BRF A;  4CD3 A;  3UIQ A;  3TI0 A;  1NGA A;  1X9M A;  4CBX A;  4CJK A;  1C1A A;  1X9S A;  4BRL A;  4FJM A;  1W0H A;  3DOL A;  4DR2 K;  3VTI A;  4E7L A;  5J2Q A;  1P8Z A;  4KAZ A;  3C7N A;  1EWR A;  4KTQ A;  3S3O A;  3KZB A;  1JLC A;  1U47 A;  3RVC A;  2HHU A;  3P4I A;  3WNF A;  4HTU A;  3AA3 A;  4CZH A;  3QNO A;  3IG1 A;  3O1B A;  4BDP A;  5HRP A;  3ZSY A;  5BRD A;  3SUP A;  3CD6 N;  3E9L A;  3NBP A;  3RSE B;  2QWL A;  3ZCM A;  3MN6 A;  2O8E B;  1DTT A;  3I8B A;  3SQ4 A;  1HJO A;  4JKE A;  3R6M A;  4IOC L;  3C6A A;  4M3R A;  2ZM6 K;  1EKE A;  1IV0 A;  2ZGZ A;  4FM2 A;  3ZET B;  2O4G A;  5AQS A;  4TSX A;  4E1M A;  3EYZ A;  2D5R A;  4WQ4 C;  3WEE A;  1IKY A;  2ETJ A;  1S22 A;  1HQU A;  4NXM K;  3J7Z O;  1OKJ A;  4WF9 L;  2ASM A;  1Q8I A;  4JNE A;  2JGU A;  2YNF A;  2O4I A;  4JI6 K;  3ZSO A;  3EE9 A;  3KK3 A;  4KRE A;  4FLV A;  4NCB A;  2FSN A;  4I9Q A;  2QK9 A;  3K5M A;  3VF4 A;  3OTO K;  5M1N A;  3VEY A;  4CEZ A;  2E1Z A;  1UWB A;  3LDL A;  1A5V A;  3J7Y P;  2GUP A;  2XY8 A;  4BVP A;  4BR4 A;  4CER A;  1S9E A;  1QZ5 A;  4KO0 A;  4BG9 A;  3AGK A;  1RTJ A;  1M90 O;  2O8F B;  2YKM A; 
#chains in the Genus database with same CATH homology
 3T1H K;  4LFB K;  4JI0 K;  4AQY K;  1IBK K;  1XMO K;  1N36 K;  1N32 K;  4DV2 K;  3T1Y K;  4DV1 K;  4JI5 K;  4DR3 K;  4X62 K;  4DV4 K;  4LF9 K;  4NXN K;  1HNZ K;  4DR7 K;  5LMU K;  4YY3 K;  5FLX O;  2UXC K;  4DR1 K;  2UXD K;  4JI7 K;  2HHH K;  5AJ3 K;  4CW7 B;  2E5L K;  2VQF K;  4JI1 K;  1IBL K;  1XNQ K;  4DR2 K;  4DR4 K;  4X64 K;  4DR5 K;  4LF4 K;  1N33 K;  5IWA K;  4DV5 K;  4LF5 K;  4DR6 K;  2UUC K;  3J7A P;  1HR0 K;  1HNW K;  4X66 K;  3J81 O;  4LF7 K;  4DV3 K;  5BR8 K;  5LL6 Z;  1FJG K;  3JAM O;  4LFA K;  2ZM6 K;  5A2Q O;  4X65 K;  4CVN E;  4DUZ K;  2VQE K;  4LF6 K;  5LMN K;  4DV7 K;  1N34 K;  4B3S K;  4JYA K;  5IT9 O;  4LFC K;  4JI2 K;  4LF8 K;  2F4V K;  4NXM K;  1IBM K;  2UUB K;  4DV6 K;  1HNX K;  2UUA K;  4B3R K;  1XMQ K;  4B3M K;  2UXB K;  3J80 O;  4JI3 K;  4JI6 K;  2UU9 K;  4V19 S;  4K0K K;  4KHP K;  4B3T K;  1J5E K;  1XNR K;  3OTO K;  4JI8 K;  4YHH K;  4GKJ K;  4JI4 K;  4DUY K;  4JV5 K;  3J7Y P;  4DV0 K;  4OX9 K;  4GKK K;  1I94 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...