4CW7B

Structure of the fap7-rps14 complex in complex with atp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
EKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
total genus 33
structure length 118
sequence length 118
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cw7B00
4JI8K 2VQEK 4DR6K 3J7YP 4DUYK 2UXCK 4LF9K 4DUZK 1N32K 3J81O 4DV7K 1HR0K 4X62K 4JI4K 3OTOK 5LMUK 5LMNK 4X65K 3T1HK 4LF8K 5FLXO 4CVNE 4B3TK 4NXNK 4OX9K 4KHPK 4DR3K 2UUCK 4DV6K 3J7AP 4DR2K 4LF6K 2UXDK 5IT9O 4DR5K 1N34K 2E5LK 2UUBK 4JI1K 2HHHK 4AQYK 4NXMK 2UUAK 4JI6K 4DV5K 1FJGK 4GKKK 4JYAK 4LF7K 4DV2K 2UXBK 2F4VK 4LFCK 1N33K 4LF4K 2VQFK 4JI7K 3JAMO 2UU9K 4YHHK 4JI2K 1HNZK 4DV1K 3J80O 4V19S 4DR1K 4DV3K 1IBLK 1XNQK 5IWAK 1IBMK 1XMQK 4B3RK 4LFBK 1IBKK 4X66K 4LFAK 4DV4K 1XNRK 1HNXK 3T1YK 1J5EK 4DR4K 1I94K 4YY3K 5AJ3K 4DV0K 4B3MK 4B3SK 4JI0K 1HNWK 5LL6Z 4X64K 4K0KK 4JI5K 1N36K 4LF5K 5BR8K 4GKJK 1XMOK 5A2QO 4JV5K 4JI3K 4CW7B 2ZM6K 4DR7K
chains in the Genus database with same CATH superfamily
2F8TA 2Z1IA 4BRNA 2FBTA 1E4GT 1Z25A 1XC3A 4UY8O 5J1EA 3ZSYA 4DR6K 3E66A 2G8VA 3AARA 2YJEA 4E1NA 3T69A 1RILA 4CGHA 2YI1A 2HNDA 2IAJA 1N32K 1M90O 2ASOA 3F2KA 4CF8A 4FVUA 3L2RA 3SAGA 4KAZA 3PIPL 3SV3A 4W5NA 5KPZA 2VWJA 2YHWA 3DMJA 3SNNA 2NRWA 4FZZA 1BA1A 3GE1A 3VA3A 3AV9A 2QXFA 1L3UA 4BQLA 2Q2RA 4C23A 3U4LA 2YHXA 3Q7BA 5DK5A 2E5LK 1NGAA 2BUPA 1VSFA 1WSIA 3IS9A 1RT7A 3P39A 1JLCA 4JI6K 4FLXA 2HVIA 2HMPA 4Y0WA 3VQBA 3H46O 2P9UB 1RDAA 4WF9L 3A5OC 1VSEA 1NU0A 5AQJA 4DTSA 1YF5L 4CE9A 3VETA 5KQ8A 1CXUA 4NLBA 4BWMA 4E3SA 4CF0A 1K8KA 4BRKA 4BGAA 3NVMA 4DB3A 4FJLA 3D2FA 1Q8IA 4LFAK 4BGBA 3SMSA 3NGIA 1XNRK 5JVHL 5JLFA 1TAQA 3JSMA 3LDLA 3K2PA 4DTRA 4A61A 4CJTA 1RFQA 3L2WA 4RW4A 2KFZA 4FCYA 1MWMA 3O1BA 4CJFA 1T03A 3EEQA 5M1NA 5J2QA 5AQMA 3U9ZA 3KLIA 4BDYA 3VERA 2HBKA 4PL7A 3CXCM 2QEXN 4M3UA 1RTHA 4K8ZA 3P38A 1BI4A 3TSPA 2B4JA 3HYFA 4DFKA 4IOXA 4H0YB 4YOTA 1A5WA 2HBLA 1KCFA 3O8MA 4FJNA 3WXMB 1VRUA 4GY2B 1SQKA 2I5JA 2P9PB 2JWLA 3C0BA 1U48A 3MX5A 4M3RA 4LF8K 1KVCA 4ICLA 5AQRA 1KD1O 2KKZA 5BPNA 1WBDA 4NCBA 4KHPK 3EZ5A 1Q81O 1EX4A 3D2EB 2UUCK 1T6DA 3AO1A 3IMXA 3OYNA 1S1XA 5C24A 3CFRA 2PAVA 1F21A 1JLGA 2HHHK 2KLAA 2WFBA 3F9MA 5DM7L 3OYIA 2QWPA 2DFHA 4LSLA 1VK0A 3HSCA 2IIRA 2VGMA 3NCIA 2FLOA 5C2FA 4EZ9A 5AQPA 2A40A 1D5AA 4CHYA 5AZIB 1SKSA 2OPPA 1NJIO 2FC0A 3L2VA 3NF8A 4UQGA 4EFHA 3HZ6A 4JKGA 4KHQA 2F96A 4OPJA 3SUOA 4ILJA 4H5TA 3QEWA 3MX2A 2FSKA 3EN9A 1JLQA 1VQON 3KLHA 2KZZA 1NKCA 4IFYA 3TANA 2AJQA 2HHSA 5M1OA 4N76A 4JRPA 4FWPA 1IKXA 5F0XA 5HOOA 3AA3A 1YTAA 1LCUA 1XMQK 1U45A 4DU3A 3OBWA 4BRLA 4I6MB 4W5OA 1OH6A 3MEGA 4L3QA 3DXMA 4H0TB 5AQNA 4KV8A 4KREA 4FK0A 4HTUA 2FBYA 4KHWA 1U6ZA 5AJ3K 4CZIA 3RRGA 4ISFA 4B08A 3CCQN 3L2QA 3VQ5A 3J7ZO 4CJ7A 3UB5A 1TVRA 5AFUH 4CFCA 2O8EA 4JKHA 3VQDA 2D0BA 3BGRA 4AM6A 3NH0A 2ZM6K 1JLBA 2YKMA 2O8CA 3CM5A 5AQZA 4B9QA 4CF1A 4CJ3A 3M5RA 5FDLA 4I7FA 5M1KA 3CJ1A 3LDOA 4ELVA 1VSKA 4ZHRA 2Z1HA 5J2NA 3OYJA 3SUNA 4M3YA 3P83D 4KTWA 4FPAA 4A57A 3THXA 4F9OA 2E8AA 3SBTA 3L4QA 2P9SA 1SUQA 3WXKA 4DTNA 4NO7A 3ZSZA 2HHXA 4Z4CA 3K5OA 3KTQA 2FBXA 4OPKA 1UAXA 3H3NO 3QDKA 3DJCA 4DSFA 3AO5A 2YHBA 3KWIA 3WXLA 2IDOA 3DWLA 2ASMA 2Y1JA 4CF9A 3DXKA 2P9LA 4MLEA 5EXWA 2XY6A 2QWLA 5GADP 3LALA 4DLGA 4OLAA 4FVMA 1YHQN 2NRHA 4BRIA 4U67L 3OYHA 2WC9A 3THWB 4JS4A 2D5RA 1Z05A 1J5OA 4K41A 4B1UB 4CHZA 4BRMA 4IFVA 3PO5A 1QE1A 1L3VA 3GOIA 5AQFA 4NYNA 3K9KA 3ZLJA 3LANA 1RDUA 4MLHA 3LP2A 5K14A 1HPMA 3OY9A 4FJ7A 2X78A 3SQ2A 1GLEG 2VWBA 1ZBSA 3M8SA 1KQSM 4IEEA 3CYMA 3BEXA 1WSEA 3LWMA 2GUIA 1ZBLA 4CEAA 1YXQA 5FPNA 4JI5K 3HTVA 4DTPA 3VQ8A 1B9DA 4LC9B 3UIQA 2O8BB 4AHTA 3S3OA 3S3NA 1JLAA 2YNIA 3O6WA 4QS8A 4EIAA 4JV5K 4WFBL 4A5BA 3VQ6A 3PSFA 4PHTX 2Q0UA 3C65A 3TR8A 1KVAA 2Q97A 3LDPA 4BRFA 4DMNA 4DSJA 3DLEA 3CQ8A 1LWFA 2P9NB 5HRRA 4XIUA 3C94A 1JKHA 2PYJA 4CEEA 1ATSA 3MAQA 3CCRN 1NGIA 1SS6A 3O9QA 4LD0A 3T19A 4IWVA 3HPOA 4IFEA 3RMAA 3SYZA 4QS7A 4JKBA 4MDAA 4JI4K 1KRPA 5LJWA 4FSVA 3A5MC 4AM7A 4OGCA 1EETA 3OS1A 1NMNA 1RT6A 4FPBA 3L4IA 4CCHA 1YT3A 4IJNA 3SI6A 3J8AA 1Y64A 3HVTA 2A5XA 3QBWA 3K57A 3DOLA 3AO3A 3IAYA 3M8QA 3ZSWA 1VQ4N 3BUZB 3F73A 4KH4A 4XH5A 4A2BA 2XHBA 3E9OA 3NH2A 4FWSA 3CJBA 1UWBA 3DAWA 4ZTJA 3NH1A 2ZJPL 5JICA 4CIEA 1QSYA 4FM1A 2OPSA 4CJ4A 3SBGA 3HI0A 1HNZK 1RDBA 1WB9A 3CMAN 3FR0A 5GAEP 4V19S 3KK3A 2Q0RA 3ZYYX 3BY5A 4DV3K 3VGMA 1S9GA 1QSSA 3PX6A 1RT3A 4C1NK 4B3RK 1WOQA 1BGXT 4YDUC 1W97L 4DFPA 2E6MA 3OYLA 3CC4N 4DV4K 3DOKA 4IJAA 4FM0A 3T1YK 1WN7A 3CCLN 1NGDA 4FW1A 2OCEA 1RBUA 3FGUA 1ZBHA 1WSJA 5LJVA 3K58A 2HBMA 3VEOA 4WYBA 4DU4A 4YNQA 5J2MA 1DEJA 5AQQA 4ISEA 3H45C 1CZ9A 5A2QO 1VSLA 5JMVA 3AAPA 1S1WA 1KFDA 1GLAG 1B9FA 2PFUA 1VSHA 5BN8A 1VAZA 4W5RA 3PV8A 2H3GX 3GL1A 4DSLA 2D0CA 3OJUA 4DUYK 4JKAA 3K9JA 3CCEN 4CIGA 4CJVA 4ZTFA 1A5XA 3N4QA 1Q7YO 3CC7N 1WSHA 3KK2A 3O4WA 3THYB 4DFMA 3CC2N 5AQLA 4PUOA 4KHUA 2ZD1A 2ZF5O 1NGEA 3AVMA 4H4OA 3V9SA 3TSQA 1NGJA 2P51A 4EZ6A 2X6SA 2AA4A 1S22A 4H5VA 5HROA 4A2AA 5KGXA 4ID5A 4I2QA 2UUAK 2V7YA 3ZETB 4CJUA 3TWHA 3VQAA 1W2BM 3HO1A 1U2VB 2ATQA 4AF1A 1K6YA 2QTDA 2O8DA 4H0PA 2E4LA 3E01A 3EE8A 3HP9A 2O8CB 2ZQBA 4QS9A 5AQIA 3HM9A 3PX0A 2IS3A 1KSPA 2HNYA 3JAMO 3LP3A 2YNHA 3VMFB 4DV1K 1HUXA 5M1PA 2P9KA 2VGNA 4H5RA 2QA4N 1EQYA 1D4XA 3SQ1A 1BQNA 4CECA 1TKTA 1HPZA 1NJZA 4WQ5A 4EP4A 1Q9YA 3OVNA 5DM6L 5I42A 1YJ9N 5GAHP 3NVKA 1LW2A 4YY3K 3JYTA 2A42A 1RT4A 2QWNA 4OKEA 3GBTA 4BRHA 3OW2M 4KHSA 2PBDA 1LW0A 3TTCA 3VOVA 1NK9A 4AH9A 1TUUA 4FWMA 4U7BA 3TABA 3KKRA 3KD5E 3RWUA 4FJIA 3G71N 4FZXC 3TTDA 4B9MA 3CPWM 2ZE2A 4AHCA 1L3TA 3ENBA 4CGGA 4PWDA 4KB0A 4A59A 3QERA 4BG9A 3HJFA 5MLCQ 3S3MA 2V51B 2QM1A 3SLCA 4GVEA 3CD6N 3OYKA 1K9MO 4M45A 3RVCA 4PQUA 4GW6A 2BE2A 4BRCA 3OYFA 2NZTA 1NJWA 3UKUA 4QOZB 4KBOA 3OTOK 5BRFA 5LMUK 3RMCA 2E2OA 3VGKA 5FLXO 3V9XA 2JWKA 3CJ9A 3VESA 1J9AA 2FF6A 3EZWA 1HYSA 3HP6A 5KQDA 3QNNA 2FSNA 4DU1A 4CGDA 3VN5A 1WNSA 4JNEA 3BF1A 3A8YA 1UOCA 4F4KA 1DLOA 5C15A 4DV5K 4JD2B 1GLJO 3WT0A 3EE9A 4BVOA 3NMUA 2DFFA 5J2PA 1OVQA 4JKCA 3SJJA 3D45A 4B9UA 3O3GA 3M8RA 3FFIA 2YKNA 4JRQA 4XH1A 4B9NA 1UA1A 3VQCA 1TKDA 2NRXA 4OLBA 4KB1A 1XC9A 3ISNC 5JLHA 4G1QA 5AQGA 3DLHA 4GV3A 1JLFA 1HRHA 4FM2A 1IBLK 3WNFA 4C8KA 3IKMA 3LDNA 1KAZA 1NNEA 3MWTA 1FKOA 4M7YA 3O5BA 3SCXA 4BE0A 4Z4IA 4MQ3A 5M1QA 3N4PA 3PX4A 3VEXA 1HNXK 2OPQA 1KXPA 1RGIA 1DTQA 1U4BA 1NWKA 3NFAA 2RE2A 1BCOA 3ITHA 2EX3A 4PKHA 4X64K 5FRMA 4CK1A 3V9ZA 3I8BA 3LP1A 2KW4A 4DSKA 5BR8K 3EKUA 5ADXA 3ZX0A 4C1NI 4JI8K 1RTDA 1QQMA 5KI6A 4IEIA 4E7JA 4DS5A 3L6QA 3BP8A 2RKIA 3VQ9A 3GDQA 3B6OA 3R1XA 5C12A 4J2EA 2UXCK 2DPNA 3A0IX 1NGBA 1VQ9N 1OH7A 4B1VA 3VQ4A 1BG3A 1ATRA 4F8RA 4BREA 3ALYA 3ZT4A 4B9VA 4N41A 4H03B 3OS0A 4Z4EA 4CEFA 5T7BA 1KLNA 2P9IB 4DR3K 2D0PA 2HBJA 3MCAB 3OYDA 1H1VA 3QICA 3O80A 4LF6K 3GG4A 2GUPA 4Y1DA 3QBXA 2ZJRL 3SAHA 1NG9A 1SL2A 1M1KO 4J2DA 2W42A 1JLEA 3U9DA 4OVLA 4LF7K 3LL3A 4BE2A 1R0AA 4FLYA 4FJ5A 2A1RA 1T6CA 2CGKA 2VG5A 4WQ4A 1YJWN 3RTVA 3HBTA 1RCHA 2IVPA 2CH5A 3HOSA 3IFRA 1T7PA 1TKXA 4RW9A 1XWLA 4E7HA 4OKKA 2ITGA 1HNVA 2OZMA 1TL1A 4A5AA 2D4WA 2XO7A 1YVNA 1B92A 4ELUA 4KHNA 4B1WB 3O3FA 1QTMA 3MEEA 2P5OA 3BF3A 3KIOA 1XQSC 3QO9A 4YOVA 3KK1A 2QI2A 4H5NA 3W3DA 4JEPA 3CFPA 2Y1IA 3TSUA 3ZEUB 1VRTA 3LWLA 3M6GA 5FROA 3CHWA 1RBVA 4O0IA 1GOBA 2W6LA 4JLHA 1X3NA 4DS4A 1NK4A 2VG6A 2VQEK 2QKKA 1C0UA 2A3ZA 4B3OA 4JAXA 1RTIA 3PUFA 3DM2A 3WXIA 3S41A 1C0GA 1X9SA 3RSEB 2I7PA 5AZJB 2VCPA 4DKWA 4JHDB 3ZX2A 4ILHA 3TAQA 2ZJQL 2Q31A 1OH8A 1XHXA 2HHVA 3C6UA 2KTQA 3I33A 3ZX3A 4IBNA 4A62A 4IO9L 3FZHA 1J53A 3HT3A 1YVUA 4MO5A 4DTJA 3CCVN 1NKBA 4B3TK 1FKPA 2RHKA 3PSIA 3WQUA 3WEEA 1BO5O 5IT9O 1N34K 3C6AA 1BQMA 2X6NA 4KHYA 1TYQA 4TSXA 5HRPA 3R8EA 1K73O 3H6EA 5M1FA 2HHTA 5DMRA 4KI4A 1ATNA 4JYAK 4FJJA 3CETA 3NBPA 1VQPN 3ZT0A 1TK0A 1RBSA 4CD1A 1HJOA 1EWRA 3QFUA 4FJ8A 4CHNA 4BQZA 1S5JA 2CGLA 3UKRB 5AQOA 4YOWA 3L2UA 3FZLA 3MK6A 1X9JA 3QIOA 5AR0A 4B1XB 3J80O 5SZTA 4JS5A 4CZEA 3ATUA 4OO1J 4DR1K 2XRIA 3VA0A 4ELTA 1S6PA 4CZLA 4CIFA 1VQ5N 3KWGA 3MN6A 3C7NB 3ATVA 3DYAA 1EKEA 1QVFM 5BREA 1T8EA 1YITN 1IBKK 2GEMA 4E1JA 1VSDA 1NGFA 3V6DA 4MFBA 2NRTA 2QWQA 1BOTO 4DR4K 4WE1A 3UE5A 3LZJA 2O8FA 3ULEA 2NLXA 3AA4A 3EKSA 2G8UA 2YNFA 5KRSA 4DQQA 3FZMA 3QMLA 4GNIA 1JXBA 4LH5A 1WUAA 3CQYA 1XMOK 2OANA 4JI3K 1QVGM 2BANA 4GMJB 4JKEA 4LY7A 5CY4A 4E1MA 1VQKN 5CZ2A 4FZYA 1HR0K 4CFDA 3SAFA 2DFEA 2Q36A 5E41A 3BZKA 3KK7A 4CBXA 3MDQA 4HUFA 4DQRA 4EAHD 1KTQA 2G8KA 1Q9XA 3MWPA 1QHTA 1G99A 2FSJA 3CJ7A 2WBNA 1D9FA 1X1PA 4FJGA 4IOCL 3L3VA 4HUEA 1LOTB 1XI1A 3TARA 1BL3A 1LWCA 5I9EB 4DTUA 4IG0A 3O4NA 1BDGA 3MN9A 5HL7L 4DR2K 3ENHA 3A5LC 2UXDK 2BTFA 4B1ZA 2RPIA 1HJRA 5C42A 1BISA 1RT1A 4AQYK 4NXMK 3NF9A 3AVBA 5EX5A 1P90A 1BHLA 2E20A 3KKSA 3PLAA 1QQCA 1K8KB 2P5GA 3CJAA 4JK7A 4FJMA 3OYCA 3D2FB 4H0XB 1DTTA 3NF7A 3L8BA 2D0AA 5GIOA 4IZ9A 3MXIA 4NCAA 3VF2A 3V1OA 1VQLN 2ASPA 4E89A 4C8MA 3ZSQA 1HNIA 1KC8O 4KI6A 3T3FA 4BR0A 3NGZA 3M3ZA 4LSNA 5KPTA 1C0MA 4Y1CA 2P9UA 4CZFA 4K8XA 2HSTA 2V52B 4CF2A 3AGKA 3V1QA 2G8HA 1SKWA 2P1JA 3MCPA 4CJSA 1N5YA 2YHAA 5C0YA 4DCHA 1BI4B 5KGWA 3HVRA 4B3SK 3SMPA 4O4GA 4I9QA 1QQOA 4O8UA 3M1FA 3TAPA 4BC3A 3KHYA 1REVA 3NDKA 4OJRA 2IGIA 5BRHA 1HYVA 3TAMA 4LF5K 5AQKA 4CEQA 3T7ZA 3H1VX 3V1RA 3CJCA 1HMVA 3O1WA 4H5WA 2QWRA 4DR7K 1BA0A 3VEVA 5LY3A 5EOYA 4BR5A 4JN4A 5SWMA 1Z6RA 3QLHA 4BROA 1NK6A 1I3AA 4IOAL 1YJNN 1FK9A 3C6TA 2UYTA 3E9PA 1OVYA 1GLBG 2XY5A 1SL1A 4L8RB 4E7LA 4JKGB 3LM2A 4NXNK 4AHUA 1VQ7N 3O9SA 3K5NA 4FK4A 4E7KA 4FOEA 3ZT3A 4RW8A 5HP1A 2R7YA 3AVHA 4NCGA 5AQYA 1NGGA 1FJGK 1VSIA 4N56A 1ASUA 2P9PA 1R59O 2EHGA 1MWKA 5F1XA 3CCJN 5HLFA 3EY1A 3G10A 4Z0UA 5D3GA 1A5VA 4KTZA 1TK8A 2F9WA 3DXMB 4BC4A 4B9SA 3D2EA 1IH7A 3KLGA 3VPZA 1RBRA 4JI2K 3BZCA 5CYQA 2QW9A 4CK2A 1BWFO 5H1SQ 1RT2A 3ULDA 1OKJA 1WSGA 2YCHA 4CEZA 5AZIA 3KVGA 4J8FA 1SL0A 2O8EB 3I56N 2ZWHA 5I3UA 4QAGA 4C8LA 4O0JA 2DTUA 3RR8A 1V4TA 2IVNA 4CZKA 1GLCG 3ZSXA 4I2PA 3LZIA 3THXB 4Z94A 1HYZA 4JI0K 5LL6Z 2CH6A 1YTUA 1L3SA 1JCGA 2P9SB 3DLGA 4DQ8A 4BR2A 1T3VA 1Q18A 3NE6A 4I6MA 4GVMA 3PO4A 3MXMA 2D1KA 4FL9A 4KTQA 4M3XA 1QZ6A 1MDUB 1BCMA 3HXMA 1ASVA 4CI6A 3WQTA 4DWIA 1ZBFA 2HF3A 4RTFD 3SUPA 2RN2A 4BR9A 3J7YP 2HHQA 2BH1A 4LF9K 3VTHA 1QZ5A 4CZJA 1C0FA 3ZT2A 2OA8A 3DXKB 2P9LB 4G9ZA 2Q3SA 1D8YA 5LMNK 3OYGA 1C0TA 2HW3A 4DTMA 2OPRA 2XY8A 3P5JA 3OJSA 4OKJA 4BR7A 4BY9C 1KFSA 3CI5A 2G8IA 2UUBK 4JI1K 3KD1E 1VSMA 4BC2A 4J2BA 5JVGL 3W0LA 3V4IA 3IRXA 4DQIA 4FWLA 3ASMA 1NMDA 5CR4A 4CZHA 1RTJA 5GIPA 4NYFA 4DLEA 2KFNA 1OH5A 3THVA 4HUGA 2NRVA 3MXJA 3QNOA 3QEXA 2VYPA 3HM8A 2A6AA 4Q5VA 5AQHA 4FWNA 5EVZA 1N8RO 3TAGA 3CERA 4FLWA 1HX1A 1YUWA 3RRHA 1S72N 3D7EO 4XH4A 3AVNA 4I9LA 4HCCA 3QESA 3LAMA 1IO2A 3THWA 4IDHA 4O5BA 3VEYA 2E1ZA 2E2NA 4DQSA 5E26A 1NJYA 3DRPA 2DY4A 2ZGZA 3NF6A 3OA9A 1HNWK 4CGIA 2WOMA 4BRDA 2PY5A 4F2RA 2NNWA 5KTQA 5AFUA 4CW7B 2GWJA 4Z4HA 2QKBA 3VEZA 3CPEA 1JCEA 5AQVA 2Z1GA 4IDKA 4CERA 3WNHA 1NOYA 1IV0A 4BE1A 1NK0A 1ZBUA 1KVBA 1GOCA 2BDPA 3J81O 3R6MA 3SV4A 1TAUA 4CFAA 4CD3A 5CE3A 4ISGA 4IG3A 1WAJA 2O8BA 5TKWA 3OYMA 3R3LA 4OPAA 4YDUA 1Y97A 3CF5L 3DLLL 3ID8A 4IXCA 1S6QA 4O5FA 3QETA 3F9KA 3OBYA 1TL3A 3HRGA 3J7AP 4KH5A 4WFNL 1VQMN 2KQ2A 2P9NA 1C6VA 4KPYA 3AVJA 4FK2A 4M3ZA 4E7IA 4PA1A 3CCMN 2G8FA 2E6LA 3JXUA 1CZAN 4B9LA 5AQWA 1LAWA 2F4VK 4CK3A 4FLVA 4LF4K 4FOIA 4CESA 4WCEL 2NRRA 2D0OA 4FWRA 1W9HA 3AY9A 1EWQA 4FW2A 4DSEA 3JS6A 3AVGA 4YHHK 2RF2A 3P31A 1DT9A 1NGCA 1IKWA 1BUPA 1CLQA 3B6PA 3BDPA 1KAYA 1IG9A 2E2PA 3LP0A 3TI0A 1QSLA 2IVOA 5BPMA 1J5EK 2HHUA 3VQ7A 3H3OB 4Q0BA 3LDQA 3V81A 3HPGA 4K0KK 2E88A 2FXUA 3V9UA 1WLJA 4CBUA 3WXJA 1SAZA 4CGFA 2W41A 4CJPA 3FLCO 1XUPO 3FE1A 4W5QA 3T1AA 1Q82O 2BGGA 4WFAL 3O9TA 2QWMA 4C8NA 3G6EN 1GLLO 2NUBA 3QEIA 3CQXA 4DUZK 3O9UA 4QCLA 1W7AA 2A41A 1P8ZA 3U6FA 4FWKA 1QQNA 3DLBA 2YX6A 4CJLA 3KLEA 4KRFA 4X65K 2GTDA 2O8DB 3CM6A 4B1YB 4DQPA 4DV6K 1S1UA 4H4MA 5BN9A 3MEDA 2F8SA 4NLCA 1X3MA 3S9HA 2P9KB 3HSTB 1KLMA 1I39A 3MN7A 4O44A 4GKKK 4C8OA 4DV2K 4YFUA 2UXBK 3WUHA 1E3MA 3P4IA 4LFCK 3THYA 2VQFK 3L3UA 4K42A 3NHGA 4DTXA 4B9TA 3O4QA 3K59A 1V4SA 4FWQA 1RNHA 4N47A 4KFBA 4B8AB 5JS1A 4F3OA 4BRQA 1SKRA 3D6RA 5TKYA 1Q86O 2V7ZA 4RW7A 5IWAK 3ZETA 3A2FA 1CZBA 1VQ6N 3B8AX 1U2VA 4E19A 3U3YA 4F3TA 4HHTA 3VQEA 1U04A 4RW6A 4HTLA 4CZGA 1VHXA 2JGUA 2HNZA 3EL2A 1U49A 1I94K 3DRRA 2HB5A 4IO8A 3AAQA 4EP5A 1DGKN 3TPQA 3AGRA 2NRZA 4RG8A 3OHRA 4JKDA 1O13A 1MU2A 4CJQA 1Z26A 3K5MA 2Z1JA 4MO4A 3UKUB 5GINA 5ADXH 2PYLA 2HHWA 1KAXA 1W0HA 5CZ1A 1ZXOA 3SPYA 1QHAA 2GX9A 4MDBA 3QB0A 2F7TA 2IOCA 4DF4A 3D0PA 4JKFA 3WNEA 3PY8A 3WNGA 3G4SN 1SV5A 1ILYA 5C25A 4PKGA 4AHSA 4X62K 4XEIA 1UA0A 1GLDG 3CG7A 1WBBA 4BVPA 4WQ5C 1VQ8N 1ZC6A 5KPRA 2HMIA 4CVNE 2GWKA 2OYQA 3DI6A 3TTFA 4AHVA 4M3TA 3PIOL 4BRAA 3H08A 4PY5A 2OTLN 4H0OA 1JXEA 4BWJA 4EHTA 4CEBA 2X74A 4BDZA 4E0DA 3SQ0A 4BDPA 3LPUA 4M42A 3C95A 2ETJA 3TAFA 4YORA 1NBWA 2E1YA 3DRSA 4CZMA 5HRNA 5HBMA 3C6HA 4BR4A 1T44A 2IC3A 1ZBIA 4CGJA 1D9DA 3VQPA 3SQ4A 3MECA 5FPDA 3CMEN 1ESVA 4YOUA 4CHPA 4K43A 5FPEA 1S1VA 3EO3A 2PZSA 4DG1A 1XNQK 2GV9A 4JD2A 4O55A 3U8XA 2YNGA 3CCUN 1NK5A 3M8PA 4AILC 1IBMK 1IG8A 1C1AA 3VQQA 4YOXA 3SZ2A 1LAVA 4JK9A 4M63C 2W40A 4LFBK 3ENOA 3AVIA 3RR7A 1JL1A 3CFOA 2B6AA 4Z4FA 3IG1A 4GV6A 2G8WA 3L0QA 1WAFA 3LM9A 3VF4A 4BRGA 1G15A 5BRDA 1NJXA 3RMBA 1NKEA 1DKGD 1TGOA 2OZSA 4FJKA 1X9MA 3I0RA 3KZBA 1HQUA 1RT5A 3I8DA 4CJ5A 4CFBA 1ITGA 4BC5A 3KJVA 4FO0A 3Q7CA 3QIPA 2O4IA 2J4RA 1BIZA 4BACA 3QINA 1J6ZA 4JK8A 4FYDA 4RCHA 4PL8A 2HVHA 2QXLA 1HKGA 3AVAA 1NM1A 5AQUA 4DSIA 1NK8A 5KRTA 2GELA 4M41A 1X9WA 1EO1A 4DTOA 1YI2N 2KZMA 2XY7A 1C1BA 3O3HA 1S1TA 2ZGYA 4FJHA 4CBWA 1NLVA 1K8AO 1RBTA 3AVKA 2OTJN 4BRPA 4OGEA 1U47A 4CJRA 1S9EA 3VGLA 1O1WA 3NAEA 3AVCA 3AO2A 3VTIA 4M3WA 4CJWA 1IJJA 3OYEA 4CHQA 4FXDA 3E1YA 3O08A 4YOYA 1N33K 2FBVA 1LV5A 4BG8A 1HKCA 1ASWA 5F2RA 3TAEA 4K25A 3H1QA 4JI7K 2P9IA 5C10A 1EP4A 1ZYQA 2UU9K 1TKZA 1JJ2M 3IUCA 1GOAA 4ILGB 3F5TA 3LPTA 4H8KA 4CJEA 2FF3B 1VSJA 2JLEA 3IDHA 1C1CA 3HOTA 3FFKB 1BIUA 2YHYA 4CHOA 3OS2A 1SZ2A 4X66K 1E4FT 3V9WA 4KH6A 4PKIA 4R5PA 3MN5A 4ID1A 3EYZA 1IKYA 2O4GA 3LAKA 3ZSOA 4N5SA 4B3MK 5FRNA 3HPHA 4FLUA 1RDWX 4FWOA 4DFJA 1NOZA 1HKBA 1XHZA 1LWEA 3QEVA 4FJ9A 2HF4A 5C2DA 5B8HA 3LDSA 4GKJK 3ID6A 3VENA 2QK9A 4WQ4C 5EY4A 4KO0A 4RWTA 2YV0X 3AA2A 2CGJA 3VF6A 3CCSN 1TUYA 3SK3A 3WEEB 3HL8A 3NGYA 4FLTA 4F2SA 3K5LA 3QFPA 5CHIA 3FZFA 3I0SA 4DV7K 1TYQB 2W6KA 4DHYA 4J2AA 3P1GA 3KLFA 3ZEUA 3DLKA 2VG7A 5EU7A 2GBZA 1CXQA 4O8KA 1J54A 2B5JA 3G0ZA 4CEOA 3T1HK 3TU5A 2LSNA 1TK5A 3U3GA 1YAGA 4LH4A 1FW6A 4OX9K 2I7NA 5GAGP 4CEDA 3ZT1A 1T05A 5AQXA 1L5UA 4Z4GA 3AVFA 4DR5K 3RSEA 1MA9B 5AZJA 3SPZA 1VQNN 4JHDA 4HWIA 2WTUA 3AA5X 3O9RA 3E9LA 3OYAA 4M7XA 2AP1A 2Q1NA 2A1SA 5FPMA 3K0SA 2KHOA 3SUQA 1BU6O 4OPHA 3ZSRA 4FLZA 4DF8A 3ZCMA 4AHRA 3SJHA 2EWSA 4EHUA 1NK7A 1TV6A 2O8FB 1EXQA 3ULEB 5CYMA 1RDCA 1JL2A 5BR9A 3FZKA 1WSFA 3VEWA 3AO4A 3AVLA 5JS2A 3DLRA 3QEPA 2QWOA 1HLUA 4H0VB 2HOEA 5HRSA 1RDDA 5ELZA 2E2QA 1NGHA 4B8CA 3RMDA 3R9PA 5AQTA 4KKOA 4HVJA 3UKRA 2F9TA 3CIPA 3HK2A 2WUSA 3G25A 1YIJN 5AQSA 4W5TA 2VWKA 1N6QA 4IKFA 5BPLA 4DV0K 4FJXA 2YJFA 3A5NC 4CJKA 3I55N 4GV9A 3MMVA 4NB4A 1S3XA 1FXXA 2ITMA 1QS4A 3C7NA 4R79A 1IKVA 1N36K 1GLFO 3ZSVA 1HQEA 4HCBA 1JCFA 2WONA 3OYBA 5E84A
chains in the Genus database with same CATH topology
4JI8K 2VQEK 4DR6K 3J7YP 4DUYK 2UXCK 4LF9K 4DUZK 1N32K 3J81O 4DV7K 1HR0K 4X62K 4JI4K 3OTOK 5LMUK 5LMNK 4X65K 3T1HK 4LF8K 5FLXO 4CVNE 4B3TK 4NXNK 4OX9K 4KHPK 4DR3K 2UUCK 4DV6K 3J7AP 4DR2K 4LF6K 2UXDK 5IT9O 4DR5K 1N34K 2E5LK 2UUBK 4JI1K 2HHHK 4AQYK 4NXMK 2UUAK 4JI6K 4DV5K 1FJGK 4GKKK 4JYAK 4LF7K 4DV2K 2UXBK 2F4VK 4LFCK 1N33K 4LF4K 2VQFK 4JI7K 3JAMO 2UU9K 4YHHK 4JI2K 1HNZK 4DV1K 3J80O 4V19S 4DR1K 4DV3K 1IBLK 1XNQK 5IWAK 1IBMK 1XMQK 4B3RK 4LFBK 1IBKK 4X66K 4LFAK 4DV4K 1XNRK 1HNXK 3T1YK 1J5EK 4DR4K 1I94K 4YY3K 5AJ3K 4DV0K 4B3MK 4B3SK 4JI0K 1HNWK 5LL6Z 4X64K 4K0KK 4JI5K 1N36K 4LF5K 5BR8K 4GKJK 1XMOK 5A2QO 4JV5K 4JI3K 4CW7B 2ZM6K 4DR7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 K;  2VQE K;  4DR6 K;  3J7Y P;  4DUY K;  2UXC K;  4LF9 K;  4DUZ K;  1N32 K;  3J81 O;  4DV7 K;  1HR0 K;  4X62 K;  4JI4 K;  3OTO K;  5LMU K;  5LMN K;  4X65 K;  3T1H K;  4LF8 K;  5FLX O;  4CVN E;  4B3T K;  4NXN K;  4OX9 K;  4KHP K;  4DR3 K;  2UUC K;  4DV6 K;  3J7A P;  4DR2 K;  4LF6 K;  2UXD K;  5IT9 O;  4DR5 K;  1N34 K;  2E5L K;  2UUB K;  4JI1 K;  2HHH K;  4AQY K;  4NXM K;  2UUA K;  4JI6 K;  4DV5 K;  1FJG K;  4GKK K;  4JYA K;  4LF7 K;  4DV2 K;  2UXB K;  2F4V K;  4LFC K;  1N33 K;  4LF4 K;  2VQF K;  4JI7 K;  3JAM O;  2UU9 K;  4YHH K;  4JI2 K;  1HNZ K;  4DV1 K;  3J80 O;  4V19 S;  4DR1 K;  4DV3 K;  1IBL K;  1XNQ K;  5IWA K;  1IBM K;  1XMQ K;  4B3R K;  4LFB K;  1IBK K;  4X66 K;  4LFA K;  4DV4 K;  1XNR K;  1HNX K;  3T1Y K;  1J5E K;  4DR4 K;  1I94 K;  4YY3 K;  5AJ3 K;  4DV0 K;  4B3M K;  4B3S K;  4JI0 K;  1HNW K;  5LL6 Z;  4X64 K;  4K0K K;  4JI5 K;  1N36 K;  4LF5 K;  5BR8 K;  4GKJ K;  1XMO K;  5A2Q O;  4JV5 K;  4JI3 K;  4CW7 B;  2ZM6 K;  4DR7 K; 
#chains in the Genus database with same CATH topology
 2F8T A;  2Z1I A;  4BRN A;  2FBT A;  1E4G T;  1Z25 A;  1XC3 A;  4UY8 O;  5J1E A;  3ZSY A;  4DR6 K;  3E66 A;  2G8V A;  3AAR A;  2YJE A;  4E1N A;  3T69 A;  1RIL A;  4CGH A;  2YI1 A;  2HND A;  2IAJ A;  1N32 K;  1M90 O;  2ASO A;  3F2K A;  4CF8 A;  4FVU A;  3L2R A;  3SAG A;  4KAZ A;  3PIP L;  3SV3 A;  4W5N A;  5KPZ A;  2VWJ A;  2YHW A;  3DMJ A;  3SNN A;  2NRW A;  4FZZ A;  1BA1 A;  3GE1 A;  3VA3 A;  3AV9 A;  2QXF A;  1L3U A;  4BQL A;  2Q2R A;  4C23 A;  3U4L A;  2YHX A;  3Q7B A;  5DK5 A;  2E5L K;  1NGA A;  2BUP A;  1VSF A;  1WSI A;  3IS9 A;  1RT7 A;  3P39 A;  1JLC A;  4JI6 K;  4FLX A;  2HVI A;  2HMP A;  4Y0W A;  3VQB A;  3H46 O;  2P9U B;  1RDA A;  4WF9 L;  3A5O C;  1VSE A;  1NU0 A;  5AQJ A;  4DTS A;  1YF5 L;  4CE9 A;  3VET A;  5KQ8 A;  1CXU A;  4NLB A;  4BWM A;  4E3S A;  4CF0 A;  1K8K A;  4BRK A;  4BGA A;  3NVM A;  4DB3 A;  4FJL A;  3D2F A;  1Q8I A;  4LFA K;  4BGB A;  3SMS A;  3NGI A;  1XNR K;  5JVH L;  5JLF A;  1TAQ A;  3JSM A;  3LDL A;  3K2P A;  4DTR A;  4A61 A;  4CJT A;  1RFQ A;  3L2W A;  4RW4 A;  2KFZ A;  4FCY A;  1MWM A;  3O1B A;  4CJF A;  1T03 A;  3EEQ A;  5M1N A;  5J2Q A;  5AQM A;  3U9Z A;  3KLI A;  4BDY A;  3VER A;  2HBK A;  4PL7 A;  3CXC M;  2QEX N;  4M3U A;  1RTH A;  4K8Z A;  3P38 A;  1BI4 A;  3TSP A;  2B4J A;  3HYF A;  4DFK A;  4IOX A;  4H0Y B;  4YOT A;  1A5W A;  2HBL A;  1KCF A;  3O8M A;  4FJN A;  3WXM B;  1VRU A;  4GY2 B;  1SQK A;  2I5J A;  2P9P B;  2JWL A;  3C0B A;  1U48 A;  3MX5 A;  4M3R A;  4LF8 K;  1KVC A;  4ICL A;  5AQR A;  1KD1 O;  2KKZ A;  5BPN A;  1WBD A;  4NCB A;  4KHP K;  3EZ5 A;  1Q81 O;  1EX4 A;  3D2E B;  2UUC K;  1T6D A;  3AO1 A;  3IMX A;  3OYN A;  1S1X A;  5C24 A;  3CFR A;  2PAV A;  1F21 A;  1JLG A;  2HHH K;  2KLA A;  2WFB A;  3F9M A;  5DM7 L;  3OYI A;  2QWP A;  2DFH A;  4LSL A;  1VK0 A;  3HSC A;  2IIR A;  2VGM A;  3NCI A;  2FLO A;  5C2F A;  4EZ9 A;  5AQP A;  2A40 A;  1D5A A;  4CHY A;  5AZI B;  1SKS A;  2OPP A;  1NJI O;  2FC0 A;  3L2V A;  3NF8 A;  4UQG A;  4EFH A;  3HZ6 A;  4JKG A;  4KHQ A;  2F96 A;  4OPJ A;  3SUO A;  4ILJ A;  4H5T A;  3QEW A;  3MX2 A;  2FSK A;  3EN9 A;  1JLQ A;  1VQO N;  3KLH A;  2KZZ A;  1NKC A;  4IFY A;  3TAN A;  2AJQ A;  2HHS A;  5M1O A;  4N76 A;  4JRP A;  4FWP A;  1IKX A;  5F0X A;  5HOO A;  3AA3 A;  1YTA A;  1LCU A;  1XMQ K;  1U45 A;  4DU3 A;  3OBW A;  4BRL A;  4I6M B;  4W5O A;  1OH6 A;  3MEG A;  4L3Q A;  3DXM A;  4H0T B;  5AQN A;  4KV8 A;  4KRE A;  4FK0 A;  4HTU A;  2FBY A;  4KHW A;  1U6Z A;  5AJ3 K;  4CZI A;  3RRG A;  4ISF A;  4B08 A;  3CCQ N;  3L2Q A;  3VQ5 A;  3J7Z O;  4CJ7 A;  3UB5 A;  1TVR A;  5AFU H;  4CFC A;  2O8E A;  4JKH A;  3VQD A;  2D0B A;  3BGR A;  4AM6 A;  3NH0 A;  2ZM6 K;  1JLB A;  2YKM A;  2O8C A;  3CM5 A;  5AQZ A;  4B9Q A;  4CF1 A;  4CJ3 A;  3M5R A;  5FDL A;  4I7F A;  5M1K A;  3CJ1 A;  3LDO A;  4ELV A;  1VSK A;  4ZHR A;  2Z1H A;  5J2N A;  3OYJ A;  3SUN A;  4M3Y A;  3P83 D;  4KTW A;  4FPA A;  4A57 A;  3THX A;  4F9O A;  2E8A A;  3SBT A;  3L4Q A;  2P9S A;  1SUQ A;  3WXK A;  4DTN A;  4NO7 A;  3ZSZ A;  2HHX A;  4Z4C A;  3K5O A;  3KTQ A;  2FBX A;  4OPK A;  1UAX A;  3H3N O;  3QDK A;  3DJC A;  4DSF A;  3AO5 A;  2YHB A;  3KWI A;  3WXL A;  2IDO A;  3DWL A;  2ASM A;  2Y1J A;  4CF9 A;  3DXK A;  2P9L A;  4MLE A;  5EXW A;  2XY6 A;  2QWL A;  5GAD P;  3LAL A;  4DLG A;  4OLA A;  4FVM A;  1YHQ N;  2NRH A;  4BRI A;  4U67 L;  3OYH A;  2WC9 A;  3THW B;  4JS4 A;  2D5R A;  1Z05 A;  1J5O A;  4K41 A;  4B1U B;  4CHZ A;  4BRM A;  4IFV A;  3PO5 A;  1QE1 A;  1L3V A;  3GOI A;  5AQF A;  4NYN A;  3K9K A;  3ZLJ A;  3LAN A;  1RDU A;  4MLH A;  3LP2 A;  5K14 A;  1HPM A;  3OY9 A;  4FJ7 A;  2X78 A;  3SQ2 A;  1GLE G;  2VWB A;  1ZBS A;  3M8S A;  1KQS M;  4IEE A;  3CYM A;  3BEX A;  1WSE A;  3LWM A;  2GUI A;  1ZBL A;  4CEA A;  1YXQ A;  5FPN A;  4JI5 K;  3HTV A;  4DTP A;  3VQ8 A;  1B9D A;  4LC9 B;  3UIQ A;  2O8B B;  4AHT A;  3S3O A;  3S3N A;  1JLA A;  2YNI A;  3O6W A;  4QS8 A;  4EIA A;  4JV5 K;  4WFB L;  4A5B A;  3VQ6 A;  3PSF A;  4PHT X;  2Q0U A;  3C65 A;  3TR8 A;  1KVA A;  2Q97 A;  3LDP A;  4BRF A;  4DMN A;  4DSJ A;  3DLE A;  3CQ8 A;  1LWF A;  2P9N B;  5HRR A;  4XIU A;  3C94 A;  1JKH A;  2PYJ A;  4CEE A;  1ATS A;  3MAQ A;  3CCR N;  1NGI A;  1SS6 A;  3O9Q A;  4LD0 A;  3T19 A;  4IWV A;  3HPO A;  4IFE A;  3RMA A;  3SYZ A;  4QS7 A;  4JKB A;  4MDA A;  4JI4 K;  1KRP A;  5LJW A;  4FSV A;  3A5M C;  4AM7 A;  4OGC A;  1EET A;  3OS1 A;  1NMN A;  1RT6 A;  4FPB A;  3L4I A;  4CCH A;  1YT3 A;  4IJN A;  3SI6 A;  3J8A A;  1Y64 A;  3HVT A;  2A5X A;  3QBW A;  3K57 A;  3DOL A;  3AO3 A;  3IAY A;  3M8Q A;  3ZSW A;  1VQ4 N;  3BUZ B;  3F73 A;  4KH4 A;  4XH5 A;  4A2B A;  2XHB A;  3E9O A;  3NH2 A;  4FWS A;  3CJB A;  1UWB A;  3DAW A;  4ZTJ A;  3NH1 A;  2ZJP L;  5JIC A;  4CIE A;  1QSY A;  4FM1 A;  2OPS A;  4CJ4 A;  3SBG A;  3HI0 A;  1HNZ K;  1RDB A;  1WB9 A;  3CMA N;  3FR0 A;  5GAE P;  4V19 S;  3KK3 A;  2Q0R A;  3ZYY X;  3BY5 A;  4DV3 K;  3VGM A;  1S9G A;  1QSS A;  3PX6 A;  1RT3 A;  4C1N K;  4B3R K;  1WOQ A;  1BGX T;  4YDU C;  1W97 L;  4DFP A;  2E6M A;  3OYL A;  3CC4 N;  4DV4 K;  3DOK A;  4IJA A;  4FM0 A;  3T1Y K;  1WN7 A;  3CCL N;  1NGD A;  4FW1 A;  2OCE A;  1RBU A;  3FGU A;  1ZBH A;  1WSJ A;  5LJV A;  3K58 A;  2HBM A;  3VEO A;  4WYB A;  4DU4 A;  4YNQ A;  5J2M A;  1DEJ A;  5AQQ A;  4ISE A;  3H45 C;  1CZ9 A;  5A2Q O;  1VSL A;  5JMV A;  3AAP A;  1S1W A;  1KFD A;  1GLA G;  1B9F A;  2PFU A;  1VSH A;  5BN8 A;  1VAZ A;  4W5R A;  3PV8 A;  2H3G X;  3GL1 A;  4DSL A;  2D0C A;  3OJU A;  4DUY K;  4JKA A;  3K9J A;  3CCE N;  4CIG A;  4CJV A;  4ZTF A;  1A5X A;  3N4Q A;  1Q7Y O;  3CC7 N;  1WSH A;  3KK2 A;  3O4W A;  3THY B;  4DFM A;  3CC2 N;  5AQL A;  4PUO A;  4KHU A;  2ZD1 A;  2ZF5 O;  1NGE A;  3AVM A;  4H4O A;  3V9S A;  3TSQ A;  1NGJ A;  2P51 A;  4EZ6 A;  2X6S A;  2AA4 A;  1S22 A;  4H5V A;  5HRO A;  4A2A A;  5KGX A;  4ID5 A;  4I2Q A;  2UUA K;  2V7Y A;  3ZET B;  4CJU A;  3TWH A;  3VQA A;  1W2B M;  3HO1 A;  1U2V B;  2ATQ A;  4AF1 A;  1K6Y A;  2QTD A;  2O8D A;  4H0P A;  2E4L A;  3E01 A;  3EE8 A;  3HP9 A;  2O8C B;  2ZQB A;  4QS9 A;  5AQI A;  3HM9 A;  3PX0 A;  2IS3 A;  1KSP A;  2HNY A;  3JAM O;  3LP3 A;  2YNH A;  3VMF B;  4DV1 K;  1HUX A;  5M1P A;  2P9K A;  2VGN A;  4H5R A;  2QA4 N;  1EQY A;  1D4X A;  3SQ1 A;  1BQN A;  4CEC A;  1TKT A;  1HPZ A;  1NJZ A;  4WQ5 A;  4EP4 A;  1Q9Y A;  3OVN A;  5DM6 L;  5I42 A;  1YJ9 N;  5GAH P;  3NVK A;  1LW2 A;  4YY3 K;  3JYT A;  2A42 A;  1RT4 A;  2QWN A;  4OKE A;  3GBT A;  4BRH A;  3OW2 M;  4KHS A;  2PBD A;  1LW0 A;  3TTC A;  3VOV A;  1NK9 A;  4AH9 A;  1TUU A;  4FWM A;  4U7B A;  3TAB A;  3KKR A;  3KD5 E;  3RWU A;  4FJI A;  3G71 N;  4FZX C;  3TTD A;  4B9M A;  3CPW M;  2ZE2 A;  4AHC A;  1L3T A;  3ENB A;  4CGG A;  4PWD A;  4KB0 A;  4A59 A;  3QER A;  4BG9 A;  3HJF A;  5MLC Q;  3S3M A;  2V51 B;  2QM1 A;  3SLC A;  4GVE A;  3CD6 N;  3OYK A;  1K9M O;  4M45 A;  3RVC A;  4PQU A;  4GW6 A;  2BE2 A;  4BRC A;  3OYF A;  2NZT A;  1NJW A;  3UKU A;  4QOZ B;  4KBO A;  3OTO K;  5BRF A;  5LMU K;  3RMC A;  2E2O A;  3VGK A;  5FLX O;  3V9X A;  2JWK A;  3CJ9 A;  3VES A;  1J9A A;  2FF6 A;  3EZW A;  1HYS A;  3HP6 A;  5KQD A;  3QNN A;  2FSN A;  4DU1 A;  4CGD A;  3VN5 A;  1WNS A;  4JNE A;  3BF1 A;  3A8Y A;  1UOC A;  4F4K A;  1DLO A;  5C15 A;  4DV5 K;  4JD2 B;  1GLJ O;  3WT0 A;  3EE9 A;  4BVO A;  3NMU A;  2DFF A;  5J2P A;  1OVQ A;  4JKC A;  3SJJ A;  3D45 A;  4B9U A;  3O3G A;  3M8R A;  3FFI A;  2YKN A;  4JRQ A;  4XH1 A;  4B9N A;  1UA1 A;  3VQC A;  1TKD A;  2NRX A;  4OLB A;  4KB1 A;  1XC9 A;  3ISN C;  5JLH A;  4G1Q A;  5AQG A;  3DLH A;  4GV3 A;  1JLF A;  1HRH A;  4FM2 A;  1IBL K;  3WNF A;  4C8K A;  3IKM A;  3LDN A;  1KAZ A;  1NNE A;  3MWT A;  1FKO A;  4M7Y A;  3O5B A;  3SCX A;  4BE0 A;  4Z4I A;  4MQ3 A;  5M1Q A;  3N4P A;  3PX4 A;  3VEX A;  1HNX K;  2OPQ A;  1KXP A;  1RGI A;  1DTQ A;  1U4B A;  1NWK A;  3NFA A;  2RE2 A;  1BCO A;  3ITH A;  2EX3 A;  4PKH A;  4X64 K;  5FRM A;  4CK1 A;  3V9Z A;  3I8B A;  3LP1 A;  2KW4 A;  4DSK A;  5BR8 K;  3EKU A;  5ADX A;  3ZX0 A;  4C1N I;  4JI8 K;  1RTD A;  1QQM A;  5KI6 A;  4IEI A;  4E7J A;  4DS5 A;  3L6Q A;  3BP8 A;  2RKI A;  3VQ9 A;  3GDQ A;  3B6O A;  3R1X A;  5C12 A;  4J2E A;  2UXC K;  2DPN A;  3A0I X;  1NGB A;  1VQ9 N;  1OH7 A;  4B1V A;  3VQ4 A;  1BG3 A;  1ATR A;  4F8R A;  4BRE A;  3ALY A;  3ZT4 A;  4B9V A;  4N41 A;  4H03 B;  3OS0 A;  4Z4E A;  4CEF A;  5T7B A;  1KLN A;  2P9I B;  4DR3 K;  2D0P A;  2HBJ A;  3MCA B;  3OYD A;  1H1V A;  3QIC A;  3O80 A;  4LF6 K;  3GG4 A;  2GUP A;  4Y1D A;  3QBX A;  2ZJR L;  3SAH A;  1NG9 A;  1SL2 A;  1M1K O;  4J2D A;  2W42 A;  1JLE A;  3U9D A;  4OVL A;  4LF7 K;  3LL3 A;  4BE2 A;  1R0A A;  4FLY A;  4FJ5 A;  2A1R A;  1T6C A;  2CGK A;  2VG5 A;  4WQ4 A;  1YJW N;  3RTV A;  3HBT A;  1RCH A;  2IVP A;  2CH5 A;  3HOS A;  3IFR A;  1T7P A;  1TKX A;  4RW9 A;  1XWL A;  4E7H A;  4OKK A;  2ITG A;  1HNV A;  2OZM A;  1TL1 A;  4A5A A;  2D4W A;  2XO7 A;  1YVN A;  1B92 A;  4ELU A;  4KHN A;  4B1W B;  3O3F A;  1QTM A;  3MEE A;  2P5O A;  3BF3 A;  3KIO A;  1XQS C;  3QO9 A;  4YOV A;  3KK1 A;  2QI2 A;  4H5N A;  3W3D A;  4JEP A;  3CFP A;  2Y1I A;  3TSU A;  3ZEU B;  1VRT A;  3LWL A;  3M6G A;  5FRO A;  3CHW A;  1RBV A;  4O0I A;  1GOB A;  2W6L A;  4JLH A;  1X3N A;  4DS4 A;  1NK4 A;  2VG6 A;  2VQE K;  2QKK A;  1C0U A;  2A3Z A;  4B3O A;  4JAX A;  1RTI A;  3PUF A;  3DM2 A;  3WXI A;  3S41 A;  1C0G A;  1X9S A;  3RSE B;  2I7P A;  5AZJ B;  2VCP A;  4DKW A;  4JHD B;  3ZX2 A;  4ILH A;  3TAQ A;  2ZJQ L;  2Q31 A;  1OH8 A;  1XHX A;  2HHV A;  3C6U A;  2KTQ A;  3I33 A;  3ZX3 A;  4IBN A;  4A62 A;  4IO9 L;  3FZH A;  1J53 A;  3HT3 A;  1YVU A;  4MO5 A;  4DTJ A;  3CCV N;  1NKB A;  4B3T K;  1FKP A;  2RHK A;  3PSI A;  3WQU A;  3WEE A;  1BO5 O;  5IT9 O;  1N34 K;  3C6A A;  1BQM A;  2X6N A;  4KHY A;  1TYQ A;  4TSX A;  5HRP A;  3R8E A;  1K73 O;  3H6E A;  5M1F A;  2HHT A;  5DMR A;  4KI4 A;  1ATN A;  4JYA K;  4FJJ A;  3CET A;  3NBP A;  1VQP N;  3ZT0 A;  1TK0 A;  1RBS A;  4CD1 A;  1HJO A;  1EWR A;  3QFU A;  4FJ8 A;  4CHN A;  4BQZ A;  1S5J A;  2CGL A;  3UKR B;  5AQO A;  4YOW A;  3L2U A;  3FZL A;  3MK6 A;  1X9J A;  3QIO A;  5AR0 A;  4B1X B;  3J80 O;  5SZT A;  4JS5 A;  4CZE A;  3ATU A;  4OO1 J;  4DR1 K;  2XRI A;  3VA0 A;  4ELT A;  1S6P A;  4CZL A;  4CIF A;  1VQ5 N;  3KWG A;  3MN6 A;  3C7N B;  3ATV A;  3DYA A;  1EKE A;  1QVF M;  5BRE A;  1T8E A;  1YIT N;  1IBK K;  2GEM A;  4E1J A;  1VSD A;  1NGF A;  3V6D A;  4MFB A;  2NRT A;  2QWQ A;  1BOT O;  4DR4 K;  4WE1 A;  3UE5 A;  3LZJ A;  2O8F A;  3ULE A;  2NLX A;  3AA4 A;  3EKS A;  2G8U A;  2YNF A;  5KRS A;  4DQQ A;  3FZM A;  3QML A;  4GNI A;  1JXB A;  4LH5 A;  1WUA A;  3CQY A;  1XMO K;  2OAN A;  4JI3 K;  1QVG M;  2BAN A;  4GMJ B;  4JKE A;  4LY7 A;  5CY4 A;  4E1M A;  1VQK N;  5CZ2 A;  4FZY A;  1HR0 K;  4CFD A;  3SAF A;  2DFE A;  2Q36 A;  5E41 A;  3BZK A;  3KK7 A;  4CBX A;  3MDQ A;  4HUF A;  4DQR A;  4EAH D;  1KTQ A;  2G8K A;  1Q9X A;  3MWP A;  1QHT A;  1G99 A;  2FSJ A;  3CJ7 A;  2WBN A;  1D9F A;  1X1P A;  4FJG A;  4IOC L;  3L3V A;  4HUE A;  1LOT B;  1XI1 A;  3TAR A;  1BL3 A;  1LWC A;  5I9E B;  4DTU A;  4IG0 A;  3O4N A;  1BDG A;  3MN9 A;  5HL7 L;  4DR2 K;  3ENH A;  3A5L C;  2UXD K;  2BTF A;  4B1Z A;  2RPI A;  1HJR A;  5C42 A;  1BIS A;  1RT1 A;  4AQY K;  4NXM K;  3NF9 A;  3AVB A;  5EX5 A;  1P90 A;  1BHL A;  2E20 A;  3KKS A;  3PLA A;  1QQC A;  1K8K B;  2P5G A;  3CJA A;  4JK7 A;  4FJM A;  3OYC A;  3D2F B;  4H0X B;  1DTT A;  3NF7 A;  3L8B A;  2D0A A;  5GIO A;  4IZ9 A;  3MXI A;  4NCA A;  3VF2 A;  3V1O A;  1VQL N;  2ASP A;  4E89 A;  4C8M A;  3ZSQ A;  1HNI A;  1KC8 O;  4KI6 A;  3T3F A;  4BR0 A;  3NGZ A;  3M3Z A;  4LSN A;  5KPT A;  1C0M A;  4Y1C A;  2P9U A;  4CZF A;  4K8X A;  2HST A;  2V52 B;  4CF2 A;  3AGK A;  3V1Q A;  2G8H A;  1SKW A;  2P1J A;  3MCP A;  4CJS A;  1N5Y A;  2YHA A;  5C0Y A;  4DCH A;  1BI4 B;  5KGW A;  3HVR A;  4B3S K;  3SMP A;  4O4G A;  4I9Q A;  1QQO A;  4O8U A;  3M1F A;  3TAP A;  4BC3 A;  3KHY A;  1REV A;  3NDK A;  4OJR A;  2IGI A;  5BRH A;  1HYV A;  3TAM A;  4LF5 K;  5AQK A;  4CEQ A;  3T7Z A;  3H1V X;  3V1R A;  3CJC A;  1HMV A;  3O1W A;  4H5W A;  2QWR A;  4DR7 K;  1BA0 A;  3VEV A;  5LY3 A;  5EOY A;  4BR5 A;  4JN4 A;  5SWM A;  1Z6R A;  3QLH A;  4BRO A;  1NK6 A;  1I3A A;  4IOA L;  1YJN N;  1FK9 A;  3C6T A;  2UYT A;  3E9P A;  1OVY A;  1GLB G;  2XY5 A;  1SL1 A;  4L8R B;  4E7L A;  4JKG B;  3LM2 A;  4NXN K;  4AHU A;  1VQ7 N;  3O9S A;  3K5N A;  4FK4 A;  4E7K A;  4FOE A;  3ZT3 A;  4RW8 A;  5HP1 A;  2R7Y A;  3AVH A;  4NCG A;  5AQY A;  1NGG A;  1FJG K;  1VSI A;  4N56 A;  1ASU A;  2P9P A;  1R59 O;  2EHG A;  1MWK A;  5F1X A;  3CCJ N;  5HLF A;  3EY1 A;  3G10 A;  4Z0U A;  5D3G A;  1A5V A;  4KTZ A;  1TK8 A;  2F9W A;  3DXM B;  4BC4 A;  4B9S A;  3D2E A;  1IH7 A;  3KLG A;  3VPZ A;  1RBR A;  4JI2 K;  3BZC A;  5CYQ A;  2QW9 A;  4CK2 A;  1BWF O;  5H1S Q;  1RT2 A;  3ULD A;  1OKJ A;  1WSG A;  2YCH A;  4CEZ A;  5AZI A;  3KVG A;  4J8F A;  1SL0 A;  2O8E B;  3I56 N;  2ZWH A;  5I3U A;  4QAG A;  4C8L A;  4O0J A;  2DTU A;  3RR8 A;  1V4T A;  2IVN A;  4CZK A;  1GLC G;  3ZSX A;  4I2P A;  3LZI A;  3THX B;  4Z94 A;  1HYZ A;  4JI0 K;  5LL6 Z;  2CH6 A;  1YTU A;  1L3S A;  1JCG A;  2P9S B;  3DLG A;  4DQ8 A;  4BR2 A;  1T3V A;  1Q18 A;  3NE6 A;  4I6M A;  4GVM A;  3PO4 A;  3MXM A;  2D1K A;  4FL9 A;  4KTQ A;  4M3X A;  1QZ6 A;  1MDU B;  1BCM A;  3HXM A;  1ASV A;  4CI6 A;  3WQT A;  4DWI A;  1ZBF A;  2HF3 A;  4RTF D;  3SUP A;  2RN2 A;  4BR9 A;  3J7Y P;  2HHQ A;  2BH1 A;  4LF9 K;  3VTH A;  1QZ5 A;  4CZJ A;  1C0F A;  3ZT2 A;  2OA8 A;  3DXK B;  2P9L B;  4G9Z A;  2Q3S A;  1D8Y A;  5LMN K;  3OYG A;  1C0T A;  2HW3 A;  4DTM A;  2OPR A;  2XY8 A;  3P5J A;  3OJS A;  4OKJ A;  4BR7 A;  4BY9 C;  1KFS A;  3CI5 A;  2G8I A;  2UUB K;  4JI1 K;  3KD1 E;  1VSM A;  4BC2 A;  4J2B A;  5JVG L;  3W0L A;  3V4I A;  3IRX A;  4DQI A;  4FWL A;  3ASM A;  1NMD A;  5CR4 A;  4CZH A;  1RTJ A;  5GIP A;  4NYF A;  4DLE A;  2KFN A;  1OH5 A;  3THV A;  4HUG A;  2NRV A;  3MXJ A;  3QNO A;  3QEX A;  2VYP A;  3HM8 A;  2A6A A;  4Q5V A;  5AQH A;  4FWN A;  5EVZ A;  1N8R O;  3TAG A;  3CER A;  4FLW A;  1HX1 A;  1YUW A;  3RRH A;  1S72 N;  3D7E O;  4XH4 A;  3AVN A;  4I9L A;  4HCC A;  3QES A;  3LAM A;  1IO2 A;  3THW A;  4IDH A;  4O5B A;  3VEY A;  2E1Z A;  2E2N A;  4DQS A;  5E26 A;  1NJY A;  3DRP A;  2DY4 A;  2ZGZ A;  3NF6 A;  3OA9 A;  1HNW K;  4CGI A;  2WOM A;  4BRD A;  2PY5 A;  4F2R A;  2NNW A;  5KTQ A;  5AFU A;  4CW7 B;  2GWJ A;  4Z4H A;  2QKB A;  3VEZ A;  3CPE A;  1JCE A;  5AQV A;  2Z1G A;  4IDK A;  4CER A;  3WNH A;  1NOY A;  1IV0 A;  4BE1 A;  1NK0 A;  1ZBU A;  1KVB A;  1GOC A;  2BDP A;  3J81 O;  3R6M A;  3SV4 A;  1TAU A;  4CFA A;  4CD3 A;  5CE3 A;  4ISG A;  4IG3 A;  1WAJ A;  2O8B A;  5TKW A;  3OYM A;  3R3L A;  4OPA A;  4YDU A;  1Y97 A;  3CF5 L;  3DLL L;  3ID8 A;  4IXC A;  1S6Q A;  4O5F A;  3QET A;  3F9K A;  3OBY A;  1TL3 A;  3HRG A;  3J7A P;  4KH5 A;  4WFN L;  1VQM N;  2KQ2 A;  2P9N A;  1C6V A;  4KPY A;  3AVJ A;  4FK2 A;  4M3Z A;  4E7I A;  4PA1 A;  3CCM N;  2G8F A;  2E6L A;  3JXU A;  1CZA N;  4B9L A;  5AQW A;  1LAW A;  2F4V K;  4CK3 A;  4FLV A;  4LF4 K;  4FOI A;  4CES A;  4WCE L;  2NRR A;  2D0O A;  4FWR A;  1W9H A;  3AY9 A;  1EWQ A;  4FW2 A;  4DSE A;  3JS6 A;  3AVG A;  4YHH K;  2RF2 A;  3P31 A;  1DT9 A;  1NGC A;  1IKW A;  1BUP A;  1CLQ A;  3B6P A;  3BDP A;  1KAY A;  1IG9 A;  2E2P A;  3LP0 A;  3TI0 A;  1QSL A;  2IVO A;  5BPM A;  1J5E K;  2HHU A;  3VQ7 A;  3H3O B;  4Q0B A;  3LDQ A;  3V81 A;  3HPG A;  4K0K K;  2E88 A;  2FXU A;  3V9U A;  1WLJ A;  4CBU A;  3WXJ A;  1SAZ A;  4CGF A;  2W41 A;  4CJP A;  3FLC O;  1XUP O;  3FE1 A;  4W5Q A;  3T1A A;  1Q82 O;  2BGG A;  4WFA L;  3O9T A;  2QWM A;  4C8N A;  3G6E N;  1GLL O;  2NUB A;  3QEI A;  3CQX A;  4DUZ K;  3O9U A;  4QCL A;  1W7A A;  2A41 A;  1P8Z A;  3U6F A;  4FWK A;  1QQN A;  3DLB A;  2YX6 A;  4CJL A;  3KLE A;  4KRF A;  4X65 K;  2GTD A;  2O8D B;  3CM6 A;  4B1Y B;  4DQP A;  4DV6 K;  1S1U A;  4H4M A;  5BN9 A;  3MED A;  2F8S A;  4NLC A;  1X3M A;  3S9H A;  2P9K B;  3HST B;  1KLM A;  1I39 A;  3MN7 A;  4O44 A;  4GKK K;  4C8O A;  4DV2 K;  4YFU A;  2UXB K;  3WUH A;  1E3M A;  3P4I A;  4LFC K;  3THY A;  2VQF K;  3L3U A;  4K42 A;  3NHG A;  4DTX A;  4B9T A;  3O4Q A;  3K59 A;  1V4S A;  4FWQ A;  1RNH A;  4N47 A;  4KFB A;  4B8A B;  5JS1 A;  4F3O A;  4BRQ A;  1SKR A;  3D6R A;  5TKY A;  1Q86 O;  2V7Z A;  4RW7 A;  5IWA K;  3ZET A;  3A2F A;  1CZB A;  1VQ6 N;  3B8A X;  1U2V A;  4E19 A;  3U3Y A;  4F3T A;  4HHT A;  3VQE A;  1U04 A;  4RW6 A;  4HTL A;  4CZG A;  1VHX A;  2JGU A;  2HNZ A;  3EL2 A;  1U49 A;  1I94 K;  3DRR A;  2HB5 A;  4IO8 A;  3AAQ A;  4EP5 A;  1DGK N;  3TPQ A;  3AGR A;  2NRZ A;  4RG8 A;  3OHR A;  4JKD A;  1O13 A;  1MU2 A;  4CJQ A;  1Z26 A;  3K5M A;  2Z1J A;  4MO4 A;  3UKU B;  5GIN A;  5ADX H;  2PYL A;  2HHW A;  1KAX A;  1W0H A;  5CZ1 A;  1ZXO A;  3SPY A;  1QHA A;  2GX9 A;  4MDB A;  3QB0 A;  2F7T A;  2IOC A;  4DF4 A;  3D0P A;  4JKF A;  3WNE A;  3PY8 A;  3WNG A;  3G4S N;  1SV5 A;  1ILY A;  5C25 A;  4PKG A;  4AHS A;  4X62 K;  4XEI A;  1UA0 A;  1GLD G;  3CG7 A;  1WBB A;  4BVP A;  4WQ5 C;  1VQ8 N;  1ZC6 A;  5KPR A;  2HMI A;  4CVN E;  2GWK A;  2OYQ A;  3DI6 A;  3TTF A;  4AHV A;  4M3T A;  3PIO L;  4BRA A;  3H08 A;  4PY5 A;  2OTL N;  4H0O A;  1JXE A;  4BWJ A;  4EHT A;  4CEB A;  2X74 A;  4BDZ A;  4E0D A;  3SQ0 A;  4BDP A;  3LPU A;  4M42 A;  3C95 A;  2ETJ A;  3TAF A;  4YOR A;  1NBW A;  2E1Y A;  3DRS A;  4CZM A;  5HRN A;  5HBM A;  3C6H A;  4BR4 A;  1T44 A;  2IC3 A;  1ZBI A;  4CGJ A;  1D9D A;  3VQP A;  3SQ4 A;  3MEC A;  5FPD A;  3CME N;  1ESV A;  4YOU A;  4CHP A;  4K43 A;  5FPE A;  1S1V A;  3EO3 A;  2PZS A;  4DG1 A;  1XNQ K;  2GV9 A;  4JD2 A;  4O55 A;  3U8X A;  2YNG A;  3CCU N;  1NK5 A;  3M8P A;  4AIL C;  1IBM K;  1IG8 A;  1C1A A;  3VQQ A;  4YOX A;  3SZ2 A;  1LAV A;  4JK9 A;  4M63 C;  2W40 A;  4LFB K;  3ENO A;  3AVI A;  3RR7 A;  1JL1 A;  3CFO A;  2B6A A;  4Z4F A;  3IG1 A;  4GV6 A;  2G8W A;  3L0Q A;  1WAF A;  3LM9 A;  3VF4 A;  4BRG A;  1G15 A;  5BRD A;  1NJX A;  3RMB A;  1NKE A;  1DKG D;  1TGO A;  2OZS A;  4FJK A;  1X9M A;  3I0R A;  3KZB A;  1HQU A;  1RT5 A;  3I8D A;  4CJ5 A;  4CFB A;  1ITG A;  4BC5 A;  3KJV A;  4FO0 A;  3Q7C A;  3QIP A;  2O4I A;  2J4R A;  1BIZ A;  4BAC A;  3QIN A;  1J6Z A;  4JK8 A;  4FYD A;  4RCH A;  4PL8 A;  2HVH A;  2QXL A;  1HKG A;  3AVA A;  1NM1 A;  5AQU A;  4DSI A;  1NK8 A;  5KRT A;  2GEL A;  4M41 A;  1X9W A;  1EO1 A;  4DTO A;  1YI2 N;  2KZM A;  2XY7 A;  1C1B A;  3O3H A;  1S1T A;  2ZGY A;  4FJH A;  4CBW A;  1NLV A;  1K8A O;  1RBT A;  3AVK A;  2OTJ N;  4BRP A;  4OGE A;  1U47 A;  4CJR A;  1S9E A;  3VGL A;  1O1W A;  3NAE A;  3AVC A;  3AO2 A;  3VTI A;  4M3W A;  4CJW A;  1IJJ A;  3OYE A;  4CHQ A;  4FXD A;  3E1Y A;  3O08 A;  4YOY A;  1N33 K;  2FBV A;  1LV5 A;  4BG8 A;  1HKC A;  1ASW A;  5F2R A;  3TAE A;  4K25 A;  3H1Q A;  4JI7 K;  2P9I A;  5C10 A;  1EP4 A;  1ZYQ A;  2UU9 K;  1TKZ A;  1JJ2 M;  3IUC A;  1GOA A;  4ILG B;  3F5T A;  3LPT A;  4H8K A;  4CJE A;  2FF3 B;  1VSJ A;  2JLE A;  3IDH A;  1C1C A;  3HOT A;  3FFK B;  1BIU A;  2YHY A;  4CHO A;  3OS2 A;  1SZ2 A;  4X66 K;  1E4F T;  3V9W A;  4KH6 A;  4PKI A;  4R5P A;  3MN5 A;  4ID1 A;  3EYZ A;  1IKY A;  2O4G A;  3LAK A;  3ZSO A;  4N5S A;  4B3M K;  5FRN A;  3HPH A;  4FLU A;  1RDW X;  4FWO A;  4DFJ A;  1NOZ A;  1HKB A;  1XHZ A;  1LWE A;  3QEV A;  4FJ9 A;  2HF4 A;  5C2D A;  5B8H A;  3LDS A;  4GKJ K;  3ID6 A;  3VEN A;  2QK9 A;  4WQ4 C;  5EY4 A;  4KO0 A;  4RWT A;  2YV0 X;  3AA2 A;  2CGJ A;  3VF6 A;  3CCS N;  1TUY A;  3SK3 A;  3WEE B;  3HL8 A;  3NGY A;  4FLT A;  4F2S A;  3K5L A;  3QFP A;  5CHI A;  3FZF A;  3I0S A;  4DV7 K;  1TYQ B;  2W6K A;  4DHY A;  4J2A A;  3P1G A;  3KLF A;  3ZEU A;  3DLK A;  2VG7 A;  5EU7 A;  2GBZ A;  1CXQ A;  4O8K A;  1J54 A;  2B5J A;  3G0Z A;  4CEO A;  3T1H K;  3TU5 A;  2LSN A;  1TK5 A;  3U3G A;  1YAG A;  4LH4 A;  1FW6 A;  4OX9 K;  2I7N A;  5GAG P;  4CED A;  3ZT1 A;  1T05 A;  5AQX A;  1L5U A;  4Z4G A;  3AVF A;  4DR5 K;  3RSE A;  1MA9 B;  5AZJ A;  3SPZ A;  1VQN N;  4JHD A;  4HWI A;  2WTU A;  3AA5 X;  3O9R A;  3E9L A;  3OYA A;  4M7X A;  2AP1 A;  2Q1N A;  2A1S A;  5FPM A;  3K0S A;  2KHO A;  3SUQ A;  1BU6 O;  4OPH A;  3ZSR A;  4FLZ A;  4DF8 A;  3ZCM A;  4AHR A;  3SJH A;  2EWS A;  4EHU A;  1NK7 A;  1TV6 A;  2O8F B;  1EXQ A;  3ULE B;  5CYM A;  1RDC A;  1JL2 A;  5BR9 A;  3FZK A;  1WSF A;  3VEW A;  3AO4 A;  3AVL A;  5JS2 A;  3DLR A;  3QEP A;  2QWO A;  1HLU A;  4H0V B;  2HOE A;  5HRS A;  1RDD A;  5ELZ A;  2E2Q A;  1NGH A;  4B8C A;  3RMD A;  3R9P A;  5AQT A;  4KKO A;  4HVJ A;  3UKR A;  2F9T A;  3CIP A;  3HK2 A;  2WUS A;  3G25 A;  1YIJ N;  5AQS A;  4W5T A;  2VWK A;  1N6Q A;  4IKF A;  5BPL A;  4DV0 K;  4FJX A;  2YJF A;  3A5N C;  4CJK A;  3I55 N;  4GV9 A;  3MMV A;  4NB4 A;  1S3X A;  1FXX A;  2ITM A;  1QS4 A;  3C7N A;  4R79 A;  1IKV A;  1N36 K;  1GLF O;  3ZSV A;  1HQE A;  4HCB A;  1JCF A;  2WON A;  3OYB A;  5E84 A; 
#chains in the Genus database with same CATH homology
 4JI8 K;  2VQE K;  4DR6 K;  3J7Y P;  4DUY K;  2UXC K;  4LF9 K;  4DUZ K;  1N32 K;  3J81 O;  4DV7 K;  1HR0 K;  4X62 K;  4JI4 K;  3OTO K;  5LMU K;  5LMN K;  4X65 K;  3T1H K;  4LF8 K;  5FLX O;  4CVN E;  4B3T K;  4NXN K;  4OX9 K;  4KHP K;  4DR3 K;  2UUC K;  4DV6 K;  3J7A P;  4DR2 K;  4LF6 K;  2UXD K;  5IT9 O;  4DR5 K;  1N34 K;  2E5L K;  2UUB K;  4JI1 K;  2HHH K;  4AQY K;  4NXM K;  2UUA K;  4JI6 K;  4DV5 K;  1FJG K;  4GKK K;  4JYA K;  4LF7 K;  4DV2 K;  2UXB K;  2F4V K;  4LFC K;  1N33 K;  4LF4 K;  2VQF K;  4JI7 K;  3JAM O;  2UU9 K;  4YHH K;  4JI2 K;  1HNZ K;  4DV1 K;  3J80 O;  4V19 S;  4DR1 K;  4DV3 K;  1IBL K;  1XNQ K;  5IWA K;  1IBM K;  1XMQ K;  4B3R K;  4LFB K;  1IBK K;  4X66 K;  4LFA K;  4DV4 K;  1XNR K;  1HNX K;  3T1Y K;  1J5E K;  4DR4 K;  1I94 K;  4YY3 K;  5AJ3 K;  4DV0 K;  4B3M K;  4B3S K;  4JI0 K;  1HNW K;  5LL6 Z;  4X64 K;  4K0K K;  4JI5 K;  1N36 K;  4LF5 K;  5BR8 K;  4GKJ K;  1XMO K;  5A2Q O;  4JV5 K;  4JI3 K;  4CW7 B;  2ZM6 K;  4DR7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...