4CW7B

Structure of the fap7-rps14 complex in complex with atp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
EKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
total genus 33
structure length 118
sequence length 118
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cw7B00
5LL6Z 1HNZK 4JV5K 1HNWK 4DUZK 3J80O 1N36K 4LF4K 5AJ3K 5LMNK 2E5LK 2UUCK 4JI5K 2ZM6K 1XMQK 4JI1K 2VQFK 4JI4K 4NXNK 3JAMO 4LFCK 1HNXK 1XMOK 1IBLK 1XNRK 1N32K 3OTOK 4JI0K 4B3RK 4JI7K 4GKJK 2UUBK 4B3TK 4DV3K 5IWAK 4DR3K 4JI3K 4LF7K 4LF8K 4B3SK 1FJGK 2F4VK 5IT9O 4DV1K 4LF5K 4LFBK 4DR2K 4DR6K 1N34K 4DR4K 4X62K 2UUAK 4X66K 2VQEK 5FLXO 4DV4K 1I94K 4JYAK 4B3MK 1J5EK 4DV2K 3T1HK 4LF9K 1N33K 4NXMK 4OX9K 2UU9K 5LMUK 4AQYK 1XNQK 1IBKK 4CVNE 4DR7K 4DUYK 4DV6K 4JI2K 4GKKK 4K0KK 5BR8K 1HR0K 3J7YP 4LF6K 4JI6K 4V19S 4X65K 4DR5K 4YY3K 4YHHK 4JI8K 4KHPK 2HHHK 4LFAK 4X64K 2UXDK 4DV5K 2UXCK 4CW7B 3T1YK 4DV0K 5A2QO 2UXBK 3J81O 3J7AP 4DR1K 4DV7K 1IBMK
chains in the Genus database with same CATH superfamily
4N41A 4CEFA 1BQNA 1C1AA 5HL7L 4PUOA 4CF9A 4JK7A 4BRPA 2DTUA 5CHIA 5AJ3K 3O4QA 4EZ9A 4K43A 1JL2A 4FJLA 5BN9A 4FM2A 4HUFA 1IKWA 4E19A 4PKGA 4M41A 5HROA 1HPMA 4CZMA 5AZJA 4OVLA 4JK9A 4FJJA 2A40A 1C0GA 1WBDA 3DLGA 3L6QA 3TAMA 4Z0UA 1J53A 3WNGA 4BQZA 1D8YA 2AA4A 5FPEA 3CCEN 4B3TK 3ZCMA 3QFPA 2HF4A 3RWUA 3MWTA 4CK2A 2QWOA 2W40A 3MXMA 4A61A 1TYQB 3TAEA 4GVEA 4MDBA 2P9NB 3WT0A 5J2NA 1VSFA 1NNEA 1VQMN 2A42A 3OYNA 4R5PA 3T7ZA 1K8AO 1TKTA 4O4GA 1CLQA 2P9PB 4DTNA 3LL3A 4FWMA 1KD1O 2P9UA 3VESA 4LF9K 1N33K 4B1VA 2G8VA 5FPDA 1U48A 2RHKA 3A5OC 2IDOA 3KWGA 4IG0A 3MEEA 4KTWA 4BR7A 2O8BB 1C6VA 1X3NA 2O8EB 1NGDA 3LM2A 2Q36A 4QOZB 2E6LA 3M8PA 3BP8A 3DXMA 3UKUB 2EHGA 4Z4EA 3DLRA 1MU2A 3V1OA 4YY3K 5GAEP 4YHHK 4JN4A 1DLOA 2NRVA 3MX5A 4FLXA 4M3WA 1Z05A 4FJHA 3NMUA 5AQNA 4GW6A 4HCBA 1SL2A 4IFVA 4B1YB 4BY9C 4BRKA 4IDHA 3DMJA 3E9OA 4BGAA 3QINA 1HNWK 3S41A 1YJNN 3SQ1A 1VRTA 4FWNA 3ULEA 3C0BA 1KAXA 2A3ZA 2E1ZA 2IS3A 4B9TA 2QK9A 3SI6A 3V9ZA 4RW9A 1N5YA 3K9JA 1V4TA 1EO1A 4JKGA 3NCIA 4LFCK 3D2EB 1KLMA 1IG8A 1UAXA 3FZHA 5JVGL 4M3XA 2OTJN 2J4RA 1TAUA 1TKZA 4LSNA 4DSEA 4KHNA 2HHWA 2JWKA 1S1TA 4WFAL 4JRQA 5BPMA 4N47A 4L3QA 3ID6A 4JKCA 3EL2A 1WAJA 4CEQA 4YOXA 4DV3K 3CFRA 4CFAA 2FBXA 3ID8A 3OBYA 4OKJA 2ETJA 4CJRA 3S9HA 1BWFO 2QW9A 3O9RA 3UE5A 1VSMA 3HK2A 3HI0A 4HCCA 3LDLA 4H0OA 2QWNA 2NRWA 2Z1GA 3CM6A 3LDOA 4DV4K 4B3MK 4KHUA 3PO4A 4BQLA 5M1PA 1J5EK 4BWJA 5JLHA 2HVIA 3IDHA 4OO1J 2OCEA 2YKNA 4F8RA 2AP1A 1X3MA 3OBWA 4OX9K 1MWKA 2XY7A 1YJWN 5M1QA 5EOYA 1U4BA 4FJNA 3ZETA 1GOAA 5CZ1A 1TGOA 5JLFA 3L3VA 4HVJA 4NLCA 3FZLA 3IFRA 5BR8K 4I6MB 3QNNA 3CJ7A 2G8KA 4BR9A 1W97L 4HUGA 2KLAA 4NB4A 3AAPA 3CG7A 3BF3A 3KWIA 3T3FA 2DFEA 4CF1A 4KO0A 3U8XA 1RDDA 2PZSA 5KQ8A 5FRNA 4H0YB 3QICA 2NRTA 4KB0A 3ATUA 4BR2A 5LY3A 4CEAA 1K73O 1VQKN 3JYTA 4EIAA 2NLXA 3F9KA 4JV5K 4ILJA 3OYKA 3V9WA 2GWJA 3DI6A 2NNWA 2BE2A 2F9WA 3LPUA 2EWSA 4FJ5A 1REVA 1NBWA 2HOEA 1J54A 3HP6A 4A2BA 1JCGA 1VHXA 1ASWA 3VA0A 4GVMA 1YVUA 3SBTA 5ADXA 3HOTA 4B3RK 4DQ8A 3HXMA 2G8IA 2GELA 1TVRA 2X74A 2O8DA 5AQOA 4GKJK 3VN5A 3OYGA 3B6PA 5GIOA 4J8FA 2YHYA 5J1EA 4DR3K 1BG3A 3O3HA 3VEOA 4CHNA 2Q3SA 3CJ9A 2E2PA 4O0JA 4E7JA 4CFCA 1VSKA 5T7BA 4GV6A 3LAMA 4QS7A 1D5AA 4B3OA 4OGCA 3DM2A 2XO7A 4FPBA 3HVRA 2Z1IA 3U9ZA 4DV2K 1OH6A 2CGJA 4W5TA 2YKMA 1NGGA 5D3GA 4J2AA 3OS2A 1JLFA 3RR7A 2D1KA 2YHWA 3ZSRA 2HMIA 2YJFA 2RF2A 1U47A 1T3VA 3L2QA 3AVAA 3V6DA 3CMEN 1ZXOA 3THXB 1F21A 3V1RA 4IOCL 4CD1A 3HSCA 3VQ5A 4CI6A 1LW2A 4H0PA 1RTDA 4DU4A 3SPZA 2A1SA 4CJQA 1RBTA 2FBVA 2I5JA 4CK1A 3O9QA 3HPOA 3FE1A 3SUQA 4AHRA 3OS1A 4N76A 3A2FA 2V7ZA 5KPTA 4DV5K 3T1YK 1KQSM 2BGGA 3GBTA 3VTHA 2GEMA 1RGIA 1VAZA 2Q0RA 3O80A 3CC2N 4BREA 1KLNA 2A41A 1GLJO 3NH2A 1N36K 4FJMA 5LMNK 2F9TA 4JI5K 3K5LA 4A57A 1ZBUA 4MQ3A 4Z4IA 3HRGA 4CZIA 4JI1K 3QLHA 4HTUA 1KXPA 1NJZA 5J2PA 4O8KA 3W3DA 2P9NA 4CHOA 2WTUA 3G10A 1T8EA 3LDSA 1JCFA 3DOLA 1SKWA 3HO1A 3G0ZA 3H1VX 2P9PA 4OKKA 1KSPA 3DJCA 1EX4A 3VEVA 4KI6A 3EKUA 2DPNA 5AQPA 4CF2A 3K9KA 3AVBA 3MN6A 3D6RA 4BC3A 2HNYA 1BCOA 2O8BA 4DV1K 4JKHA 2O8EA 1OH5A 5K14A 4DF4A 4WYBA 3UKUA 1VQ9N 3M6GA 3HYFA 3UKRB 3GL1A 1VSHA 2NZTA 4EHTA 3O9UA 4JAXA 5C0YA 3VQPA 3L3UA 4I9QA 3SJJA 1QSSA 3LP0A 3E9LA 1RTHA 1TUUA 1D9FA 4F3OA 3TAQA 1RBUA 2D0AA 4YOWA 3SYZA 1SS6A 1YAGA 1IBKK 4RW6A 4CEBA 3RVCA 4DLGA 3VQ6A 3ZSXA 3H1QA 3K5MA 4L8RB 1GOCA 3EZWA 4GKKK 2QWMA 2V51B 5MLCQ 5F2RA 1KVAA 4CGGA 3RMBA 4NYFA 2YHBA 3FFIA 3KK2A 2D4WA 3AGRA 3SUOA 1N6QA 1ZBFA 3Q7CA 3V9UA 1JLQA 4KTQA 4FO0A 5E41A 1S1VA 1LV5A 5AFUH 1K6YA 4FXDA 3D2EA 3PLAA 1NK9A 5C24A 3N4PA 3V81A 2FF6A 2YI1A 4CE9A 2E4LA 4W5OA 3AO1A 4OLAA 2KFNA 2HHTA 4JKDA 4CJPA 4DLEA 1NJXA 3MN9A 1TUYA 2P9LB 4FJ8A 5KGXA 2G8FA 2UUCK 3GE1A 5BPNA 3KJVA 1VQ5N 2XHBA 4U67L 2VQFK 1M90O 3AA3A 3AO5A 3R1XA 3OYCA 4B9VA 3A5LC 3F73A 2JWLA 1XWLA 4ILHA 3OW2M 1QHTA 3AAQA 3CPEA 4MDAA 4BE1A 1LW0A 4CERA 2ASPA 3MEGA 3PSIA 3ZYYX 2WUSA 3MN7A 3BY5A 3AVHA 4FWKA 1WSFA 2E2OA 4IJNA 4FSVA 3GG4A 4M3YA 3C95A 1NJWA 1I3AA 1YTUA 4I6MA 3R6MA 3D45A 2VGNA 4PA1A 3O3FA 1BO5O 2ASMA 2XY8A 2QI2A 3WXKA 1QE1A 2XRIA 1JLEA 5AQMA 3T1HK 4I2PA 2OZSA 2XY6A 1IH7A 2P51A 2OPPA 1S5JA 4GY2B 3OYLA 1VSDA 4FOEA 4CGDA 3VOVA 3I56N 4DR7K 2QKBA 3ZX2A 2HW3A 4DF8A 3R8EA 3NF7A 3SCXA 2YNFA 1YHQN 3OJSA 1RBVA 2HNZA 4BACA 1U2VB 2GUIA 4JI6K 2HHVA 5AQZA 4BRDA 4KFBA 2HHHK 5AQLA 3SQ4A 2OTLN 4BRQA 3I0SA 2W42A 3MCAB 1EXQA 4M3TA 4M7XA 3O8MA 3WNEA 2VWBA 4RW8A 2GV9A 3V1QA 4Z4GA 3KLFA 5LL6Z 3LM9A 3K59A 3UIQA 1NGJA 4ELTA 2HB5A 3M5RA 1HUXA 5FROA 3THVA 1NGEA 1S22A 4M42A 3ZEUB 1DT9A 4ISFA 3VF4A 2QM1A 4NXNK 2RN2A 3B6OA 4CJFA 1NKCA 1NK7A 1BUPA 1NK4A 4CZKA 4JS4A 4DTXA 2HBJA 4GV9A 3OTOK 4CHQA 2HHQA 1ZBSA 1U6ZA 2P9SB 1RT4A 1B9DA 2O8CB 4OPAA 5HRNA 5JVHL 3ENOA 1SKSA 4LC9B 3OJUA 3C7NB 3JXUA 3AO3A 3BEXA 4LF7K 2VGMA 3L4IA 2HBMA 5AQTA 4B3SK 3QEWA 3CF5L 5IT9O 4ZTJA 4LF5K 4GNIA 3THXA 2GWKA 4FJKA 1CZAN 4X62K 3CJCA 1KAYA 4H5WA 1HKBA 3P83D 2NUBA 5KI6A 3O1WA 2OPSA 3M3ZA 3MXIA 5KRTA 1RDUA 1ATSA 4IJAA 1W7AA 1WB9A 1DEJA 2VG7A 3TI0A 4U7BA 1VQ4N 3A0IX 1IKYA 4FM1A 3H3NO 3IUCA 3EEQA 3VEWA 4CIGA 4WFBL 3J8AA 1T7PA 3G25A 1KFDA 3NBPA 1WLJA 3SLCA 4AM7A 4DU1A 4BRGA 1S72N 4LFAK 3KLEA 1P8ZA 3ZSQA 4E0DA 2O8FB 1NK5A 3VGKA 4CESA 3BDPA 4O5FA 1RILA 2A6AA 3ZSVA 1Q7YO 4C8OA 2UXDK 3CCJN 3I33A 4C8NA 3MCPA 4ISGA 5A2QO 4C23A 3PX4A 4N56A 4Q5VA 5C15A 4O44A 5AQFA 4ELUA 3EE8A 4FLZA 5CYQA 3J80O 1VQLN 3ZT3A 5EY4A 4NYNA 1HJRA 4HUEA 3QB0A 3LDQA 2A1RA 5GAGP 4CJUA 3SV3A 1RTJA 4JI4K 1GLLO 3JAMO 3Q7BA 3RTVA 4CJLA 4QCLA 3UKRA 4EHUA 1YVNA 3TSQA 3VENA 4DU3A 4H5NA 4A59A 4XH1A 3QFUA 2WFBA 4MFBA 4YORA 1ATRA 1KAZA 4CF8A 3I55N 2BDPA 3O6WA 3SK3A 5EU7A 3CERA 2F4VK 1C0FA 3TARA 4IWVA 1RBSA 1GLCG 2FSKA 3EKSA 4DS4A 2ZQBA 3TTFA 5CY4A 2OZMA 5HP1A 1NWKA 2OA8A 2OPRA 1I39A 2Z1HA 3NE6A 1WOQA 1IG9A 3VQDA 1BQMA 4K25A 2P9KB 4FVMA 2FF3B 1X9MA 3B8AX 4M45A 3LWLA 4RW7A 3THWB 1WSEA 3V4IA 4DV6K 3MEDA 5HOOA 1NK6A 2OPQA 2P9LA 3P38A 4FW1A 4YDUA 1HR0K 4BE0A 1VSJA 2JLEA 5AQYA 4X65K 3J7ZO 3CI5A 2R7YA 2YX6A 4CJ7A 3DRPA 3VQEA 4X64K 4B1UB 4CZGA 4CJ4A 4KREA 4DR1K 4DQQA 3WXIA 1QVGM 4DQIA 1WN7A 4DFPA 2HF3A 2KQ2A 4FLVA 4RW4A 1OVQA 3D7EO 4W5QA 3TR8A 1VQ8N 4G1QA 1BI4B 4B9SA 4A2AA 1TV6A 4KHWA 3BGRA 1XMQK 3HSTB 3TSPA 4E7HA 1ZBIA 1BU6O 3QO9A 3NDKA 1IBLK 5GADP 1YUWA 3I8BA 4IOAL 1TKXA 4F2RA 3K2PA 2W41A 1YTAA 4CJEA 4LY7A 1ITGA 5HRPA 4JHDB 2IVOA 1Q86O 1IV0A 3THYB 4DSKA 1QQMA 2PYLA 2F7TA 1Q82O 3LP3A 4J2DA 2YHAA 3NFAA 4H5TA 4C8LA 2OANA 2PFUA 3EYZA 5KTQA 2D0CA 4BDZA 4DTRA 3FLCO 3JS6A 2YNIA 1HYZA 3OYMA 4FK0A 3KK1A 4FWOA 3VQ7A 2NRXA 3ATVA 2ZD1A 1HYVA 4E7IA 4KHSA 4CZFA 4H8KA 3QEVA 1Q8IA 3H08A 3WNFA 3KLHA 2HNDA 3ASMA 2P1JA 3T19A 4KH6A 4TSXA 3OYIA 3OYJA 5FPMA 4QAGA 3QMLA 3F5TA 3LP1A 2ZJQL 3ZT4A 5JS1A 4K8ZA 1KFSA 3CCSN 4DFKA 4DR5K 3WXJA 1KVCA 1FW6A 4DSIA 1HJOA 1MWMA 4YFUA 2Z1JA 5CE3A 4N5SA 2FLOA 3ALYA 1B9FA 5CR4A 5DM6L 3MAQA 4CECA 3AVKA 4CHZA 4C8MA 2Q2RA 3R3LA 1C0MA 3AGKA 2ATQA 5GAHP 2E8AA 2P9SA 4XEIA 2O8CA 4FLWA 4BRFA 4K42A 4W5NA 3FZKA 3CCVN 1T03A 1QHAA 3AARA 3MK6A 3C7NA 1UOCA 2P9IB 4AHSA 3O4WA 1T05A 3CQYA 3HJFA 1EP4A 2CGKA 1VQ7N 4ELVA 3QEPA 5AQQA 4AM6A 4EFHA 3N4QA 4BC2A 4B9NA 3S3NA 5AQVA 1NMDA 5AQSA 5KRSA 1Z6RA 4O55A 4JI0K 4NCBA 1RT5A 4I2QA 4AHUA 1WSHA 2IGIA 1N8RO 2BUPA 5C2FA 5AQGA 3A5NC 3NH1A 3H46O 1C0UA 1NGCA 3DLLL 4CZLA 1TL1A 1TYQA 3L2UA 4IFYA 1VQON 4I7FA 3JSMA 2DY4A 4F9OA 3VGLA 4IEIA 4CJSA 1N34K 1HNVA 1QQNA 3T69A 4DQRA 5C2DA 2B5JA 1L3TA 4E1NA 3BF1A 5HRSA 3IMXA 1IKXA 4OPKA 4CJKA 1CZ9A 2VYPA 1XHZA 1QSYA 3HM8A 3FR0A 3DWLA 1KTQA 3OHRA 1HPZA 3AVJA 1NJIO 4O8UA 1NU0A 1S6PA 3KLGA 2UU9K 1X1PA 4DTJA 2GTDA 2HMPA 4DB3A 1GLDG 4Z4FA 4BRHA 4AF1A 2IOCA 3AVMA 2D0BA 1P90A 3AVNA 5F1XA 4WE1A 3NVKA 5DM7L 1NGIA 2HHXA 4F3TA 4I9LA 5GINA 5M1FA 4IO8A 4BRMA 3HT3A 3RR8A 3VQCA 3M8RA 1LAWA 2EX3A 2O4GA 4W5RA 3QBWA 4C1NK 2AJQA 3TU5A 4PKIA 3RMCA 1A5VA 3NGIA 3IS9A 4EP5A 1LCUA 4B08A 4B1ZA 4GMJB 4YDUC 3K5OA 3KKSA 4H0TB 5AQHA 3AY9A 5AQXA 5EXWA 5BRHA 2QXFA 1OH8A 2ITMA 1HX1A 3VF2A 2PAVA 1SZ2A 3R9PA 3KLIA 1ZYQA 4CFBA 4FYDA 2Q31A 3S3MA 3O3GA 3AA4A 1ZC6A 4JNEA 3GDQA 5ADXH 2P9KA 3LDPA 1JL1A 4IDKA 4JD2B 4DTMA 1YITN 1FJGK 1Y64A 3THWA 3QDKA 3VPZA 1NKBA 1QZ6A 2Q0UA 4CJ5A 4DR4K 2X6SA 3VQQA 4LH5A 4H0XB 5FLXO 1NMNA 4YOYA 3M8QA 4KRFA 1RT2A 3TSUA 1WBBA 1NGHA 3BUZB 1GLBG 3AVGA 3NF8A 1EWQA 1EETA 3ISNC 4KV8A 3DLHA 2ZGYA 2W6KA 1R0AA 5KPZA 5BREA 3CFOA 3L8BA 4JKBA 2FSJA 4NLBA 3ZETB 2QEXN 3L2WA 1CXQA 3F2KA 1BL3A 3F9MA 4DG1A 1RDWX 3C6TA 1C0TA 4KBOA 5M1NA 4FPAA 1BI4A 3KHYA 3J7YP 1M1KO 4V19S 4JKFA 3TPQA 4CD3A 3QETA 3PY8A 3SUNA 4DQSA 1BIZA 3DLBA 4BRIA 3H3OB 4WCEL 4A5BA 3WNHA 4IKFA 4B9LA 4Y0WA 1YT3A 4E1MA 5FDLA 1C1CA 3NGZA 2D0PA 3MECA 4CW7B 4DV0K 3HM9A 1RBRA 5BRDA 1L3UA 3KKRA 5BPLA 4E7LA 4FJIA 3VERA 4FWPA 1S1XA 3HTVA 4CIEA 4H5RA 3OYHA 4ILGB 3CXCM 1E3MA 4JHDA 3LP2A 3NHGA 4JEPA 4NO7A 3THYA 3SPYA 1XC3A 1G99A 1ZBHA 3CMAN 4GV3A 1RCHA 4FWLA 1YF5L 2F8TA 2V7YA 3C6AA 1N32K 2Y1IA 3P5JA 2E1YA 3OYDA 4JI7K 4BRNA 4YOVA 3NF6A 3QNOA 4DSFA 4OGEA 1NJYA 4K8XA 4EAHD 1X9WA 2O8DB 1VSIA 5IWAK 4CEOA 1NGBA 1DGKN 2E2NA 1YXQA 4A5AA 4OPHA 1JJ2M 4LFBK 3AA5X 4IEEA 4XIUA 1FXXA 3VQ8A 2D0OA 1QTMA 4X66K 1JKHA 1OKJA 5KGWA 1TL3A 2G8WA 4B9MA 1K8KB 2YHXA 2IAJA 3H6EA 1JXEA 2WC9A 4CGFA 4ZTFA 4RTFD 3CC4N 4DTUA 4FCYA 4AHCA 3L0QA 1SKRA 2FBYA 1D4XA 1JLGA 3G6EN 3MWPA 5DK5A 1A5XA 2PYJA 4FVUA 4PY5A 4CJTA 2QXLA 3LZIA 3QERA 3VF6A 4DTOA 4AQYK 2NRRA 3VEXA 1XNQK 3O1BA 1NG9A 4DUYK 5E26A 4M3RA 1D9DA 2P9IA 4DHYA 2KFZA 5FPNA 3PV8A 3M8SA 3D2FB 4KHPK 1XC9A 4CEDA 3IRXA 4M7YA 3E9PA 1HLUA 3SAGA 3PUFA 2YV0X 4CBXA 3DRSA 4B9UA 4DFMA 3SMPA 3PX6A 2IC3A 1NOZA 3O4NA 4DTSA 1Y97A 3AVCA 3J7AP 4CZJA 5BR9A 3DYAA 3TTDA 4B1WB 1EKEA 1QQCA 2Q1NA 2QA4N 3VA3A 4LF4K 3OYAA 3HOSA 5HBMA 4KI4A 3P31A 1BCMA 1RTIA 3SMSA 4BR5A 1ZBLA 4F2SA 3FFKB 1QVFM 4A62A 4CEEA 3MMVA 3C6UA 1HNXK 3ZLJA 4Z94A 1CXUA 3DLKA 1GLEG 4CGJA 4NCGA 5GIPA 4IBNA 3NVMA 4FLTA 5KQDA 3MXJA 4DS5A 2ITGA 1S3XA 1K9MO 2ASOA 2KW4A 5H1SQ 5HLFA 1RT7A 4LF8K 1WSIA 4FWRA 1IKVA 4BROA 1C1BA 5M1OA 2GX9A 3CCRN 4PQUA 2UUAK 3HP9A 2VQEK 1E4GT 1JLAA 3C65A 4IOXA 4RCHA 4BR0A 2FSNA 3A8YA 3T1AA 2FC0A 3ZSOA 1BA0A 2B6AA 3LDNA 4FL9A 3KK3A 4Y1DA 4BC5A 1RNHA 3O9TA 1NGAA 1ATNA 1YIJN 4NCAA 1HMVA 2JGUA 1HQEA 3WEEB 4DFJA 1WAFA 3E66A 3P39A 1JXBA 3WQUA 4KKOA 2GUPA 4J2BA 3MN5A 1XQSC 2WBNA 5EX5A 4UY8O 4EP4A 1WUAA 1Q81O 1RDAA 4B8AB 4JKAA 3O08A 3SUPA 5AQWA 2PBDA 3HPHA 1BGXT 3LPTA 4IG3A 2VG6A 2KZZA 3KVGA 4MO4A 4JI8K 2RPIA 4DMNA 1G15A 2IVPA 1B92A 2E2QA 4AHTA 2HHSA 4CZHA 2VG5A 2IIRA 1BISA 1BOTO 5I42A 4BDYA 4BDPA 3J81O 2G8UA 4C8KA 2KKZA 1KRPA 5BN8A 4OLBA 1HNZK 3RRGA 4DUZK 5AZIB 1S9EA 4JD2A 1U04A 3G4SN 5E84A 3EY1A 1ILYA 2X78A 1VSLA 2V52B 3ZT1A 3IAYA 3QEIA 4FJGA 1S1UA 4OJRA 1L3VA 1J9AA 1J5OA 4J2EA 5SWMA 4BG9A 4FZYA 3ZX0A 4YOTA 5LJVA 1XMOK 5B8HA 4K41A 2I7NA 2YNGA 1V4SA 3GOIA 1XNRK 2XY5A 3OY9A 3EE9A 4F4KA 2UYTA 2RE2A 4WQ5C 5C42A 3SAHA 4FJ9A 3ZSZA 1NK0A 4KH4A 5I9EB 2FBTA 3SAFA 2GBZA 3ZSWA 3RRHA 4PL8A 4ID5A 3P4IA 5F0XA 4FK2A 1E4FT 3FZMA 1T44A 1RT6A 1IO2A 5TKYA 2QWRA 4CHYA 3VMFB 4BR4A 4E89A 1FKPA 2H3GX 4CHPA 3W0LA 3KK7A 3K57A 3A5MC 3VQ9A 1VK0A 4KTZA 1TK0A 3RSEB 4OPJA 3CM5A 1HKCA 1OH7A 3WXMB 4BG8A 4HTLA 4JK8A 3UB5A 2BTFA 1IJJA 4ICLA 4OKEA 3CC7N 3NAEA 1U2VA 3DXKB 3ZT0A 2CGLA 5AFUA 1TK5A 3CIPA 1S6QA 1VQPN 1U45A 3HVTA 1LOTB 4BC4A 5CYMA 3L4QA 3AO2A 1U49A 2KZMA 3TAFA 4BGBA 1W9HA 4CF0A 3U4LA 2DFHA 2UXBK 1Q9YA 3I0RA 3PSFA 3HBTA 4KHYA 3SQ0A 3PO5A 4FWSA 3QEXA 1QS4A 4WQ4A 1NGFA 3ZEUA 4BVPA 4CEZA 1YJ9N 2KTQA 4Z4CA 5TKWA 4H4OA 3EO3A 3QESA 1VQ6N 1W0HA 3K5NA 1KC8O 1K8KA 3VQ4A 4DSJA 4H5VA 3CJ1A 4XH4A 3VTIA 1RDCA 4XH5A 3V9XA 3S3OA 4AH9A 3VETA 3U3YA 5AR0A 3CQXA 3OA9A 4CJVA 2ZGZA 1KCFA 4CK3A 4CBWA 1BHLA 3QIOA 4BWMA 3CFPA 3DOKA 3VQBA 2E88A 1HKGA 4ZHRA 3LWMA 2E6MA 3G71N 4DR2K 1DTTA 2FXUA 4MLEA 4DR6K 4EZ6A 3KZBA 4KH5A 1XI1A 3U6FA 2F8SA 5AZJB 4DTPA 4JKEA 4QS9A 1SQKA 3TANA 3OYBA 4IZ9A 1YI2N 4ISEA 3D2FA 1UA0A 3CCQN 4QS8A 2F96A 3LALA 3AO4A 2NRZA 3QIPA 3OYEA 4DQPA 4CFDA 4JRPA 3PX0A 2ZE2A 2RKIA 3TABA 4KPYA 4FJXA 5J2QA 3NGYA 3CCMN 5LMUK 4M3ZA 2QWLA 3L2RA 3O5BA 3SV4A 4JI2K 1NK8A 4K0KK 1HQUA 2I7PA 2NRHA 3V9SA 1TK8A 1Q18A 1O1WA 1XUPO 4BRCA 2O4IA 1O13A 1VRUA 4CZEA 4DCHA 5J2MA 2P5GA 1DTQA 5SZTA 1HNIA 3MDQA 2O8FA 2P9UB 1SL1A 2LSNA 5JMVA 1X9JA 3OYFA 1Q9XA 2UXCK 2ZWHA 3BZCA 1J6ZA 3CQ8A 5BRFA 1EWRA 3SJHA 3PIPL 5EVZA 4E7KA 2PY5A 4WF9L 1IBMK 4HHTA 2VWKA 5HRRA 4C1NI 4FWQA 3WXLA 1GOBA 2BH1A 1H1VA 3DXMB 4FOIA 5DMRA 4CGIA 1RFQA 2E5LK 4DSLA 5JS2A 1MDUB 2P5OA 3EZ5A 3FZFA 1QQOA 2W6LA 4WFNL 2BANA 1KVBA 1RT1A 1FK9A 3C94A 1WNSA 3P1GA 3ITHA 3VEZA 5AQRA 2CH5A 1UWBA 3O9SA 3ENBA 3BZKA 4R79A 4CBUA 4O0IA 2VCPA 3FGUA 3H45C 2HBKA 1NOYA 1BIUA 2D5RA 3EN9A 2UUBK 4E3SA 2X6NA 3VGMA 3ULEB 4HWIA 4JI3K 3QBXA 3ULDA 4JS5A 3WEEA 2QWQA 1R59O 2KHOA 2Q97A 1FKOA 4M63C 3WUHA 3E1YA 4DWIA 1MA9B 5CZ2A 3TTCA 5AQKA 1L5UA 4AILC 4MLHA 4JKGB 4H0VB 5C10A 1I94K 3AA2A 3IKMA 4JYAK 4PL7A 1LAVA 1NLVA 3PIOL 1WSGA 4FLYA 3RMAA 1VSEA 5I3UA 4BRAA 4H03B 2WOMA 1ASVA 2ZJRL 1OVYA 3CHWA 3ZT2A 1ASUA 4H4MA 5C25A 1S9GA 2G8HA 4DKWA 3I8DA 4PWDA 2YCHA 4CVNE 3AVLA 3CJBA 4BE2A 3MX2A 4RWTA 4Z4HA 2OYQA 1Z25A 5AZIA 1HRHA 2ZF5O 3U9DA 3ENHA 1SV5A 5ELZA 1GLFO 4FLUA 3RMDA 4LF6K 1S1WA 3TAGA 5JICA 3LZJA 2VWJA 3NF9A 4RG8A 4FZZA 4LH4A 4O5BA 2HVHA 3SQ2A 3AVFA 4KB1A 1TKDA 4BRLA 3HZ6A 3LAKA 4E1JA 1L3SA 2QKKA 1HYSA 1VQNN 4CJWA 4UQGA 2HHUA 1T6CA 3ZSYA 4DV7K 2WONA 1X9SA 5FRMA 2B4JA 1EQYA 3LANA 3U3GA 4M3UA 3DAWA 1NKEA 3CCLN 3C6HA 3VEYA 3VQAA 2Y1JA 1QZ5A 4KAZA 3KD1E 1WSJA 2ZM6K 4ID1A 4FM0A 4AHVA 1LWFA 4B1XB 2A5XA 3OVNA 4MO5A 1SL0A 3SBGA 2QWPA 4Y1CA 3KD5E 1ESVA 4WQ5A 1SAZA 2QTDA 1DKGD 3OS0A 1JCEA 1GLAG 5AQUA 1RT3A 4WQ4C 3RSEA 1TAQA 5C12A 5AQJA 4LD0A 2HSTA 4KHQA 1QSLA 3IG1A 4CIFA 1RDBA 3SZ2A 4PHTX 5AQIA 1CZBA 4CGHA 4CJ3A 1JLCA 3DXKA 3NH0A 5KPRA 3CJAA 3CCUN 3WQTA 3AV9A 4IFEA 3DLEA 2HBLA 3E01A 2CH6A 3HL8A 4NXMK 5M1KA 3CPWM 2YJEA 3D0PA 4FZXC 2E20A 1LWEA 1BA1A 4CCHA 3KTQA 3SNNA 1Z26A 3TAPA 4G9ZA 4IO9L 3HPGA 3CETA 4PKHA 1W2BM 4YNQA 3DRRA 2ZJPL 1LWCA 1NM1A 4YOUA 4Q0BA 4IXCA 1T6DA 4FJ7A 4LSLA 3K58A 3M1FA 4FK4A 3CD6N 5LJWA 1XHXA 3ZX3A 3AVIA 2YNHA 1UA1A 3L2VA 4B8CA 1BDGA 2IVNA 3CYMA 4BVOA 1SUQA 2DFFA 3KIOA 4JLHA 3K0SA 4B9QA 1JLBA 3TWHA 1A5WA 4FW2A
chains in the Genus database with same CATH topology
5LL6Z 1HNZK 4JV5K 1HNWK 4DUZK 3J80O 1N36K 4LF4K 5AJ3K 5LMNK 2E5LK 2UUCK 4JI5K 2ZM6K 1XMQK 4JI1K 2VQFK 4JI4K 4NXNK 3JAMO 4LFCK 1HNXK 1XMOK 1IBLK 1XNRK 1N32K 3OTOK 4JI0K 4B3RK 4JI7K 4GKJK 2UUBK 4B3TK 4DV3K 5IWAK 4DR3K 4JI3K 4LF7K 4LF8K 4B3SK 1FJGK 2F4VK 5IT9O 4DV1K 4LF5K 4LFBK 4DR2K 4DR6K 1N34K 4DR4K 4X62K 2UUAK 4X66K 2VQEK 5FLXO 4DV4K 1I94K 4JYAK 4B3MK 1J5EK 4DV2K 3T1HK 4LF9K 1N33K 4NXMK 4OX9K 2UU9K 5LMUK 4AQYK 1XNQK 1IBKK 4CVNE 4DR7K 4DUYK 4DV6K 4JI2K 4GKKK 4K0KK 5BR8K 1HR0K 3J7YP 4LF6K 4JI6K 4V19S 4X65K 4DR5K 4YY3K 4YHHK 4JI8K 4KHPK 2HHHK 4LFAK 4X64K 2UXDK 4DV5K 2UXCK 4CW7B 3T1YK 4DV0K 5A2QO 2UXBK 3J81O 3J7AP 4DR1K 4DV7K 1IBMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Z;  1HNZ K;  4JV5 K;  1HNW K;  4DUZ K;  3J80 O;  1N36 K;  4LF4 K;  5AJ3 K;  5LMN K;  2E5L K;  2UUC K;  4JI5 K;  2ZM6 K;  1XMQ K;  4JI1 K;  2VQF K;  4JI4 K;  4NXN K;  3JAM O;  4LFC K;  1HNX K;  1XMO K;  1IBL K;  1XNR K;  1N32 K;  3OTO K;  4JI0 K;  4B3R K;  4JI7 K;  4GKJ K;  2UUB K;  4B3T K;  4DV3 K;  5IWA K;  4DR3 K;  4JI3 K;  4LF7 K;  4LF8 K;  4B3S K;  1FJG K;  2F4V K;  5IT9 O;  4DV1 K;  4LF5 K;  4LFB K;  4DR2 K;  4DR6 K;  1N34 K;  4DR4 K;  4X62 K;  2UUA K;  4X66 K;  2VQE K;  5FLX O;  4DV4 K;  1I94 K;  4JYA K;  4B3M K;  1J5E K;  4DV2 K;  3T1H K;  4LF9 K;  1N33 K;  4NXM K;  4OX9 K;  2UU9 K;  5LMU K;  4AQY K;  1XNQ K;  1IBK K;  4CVN E;  4DR7 K;  4DUY K;  4DV6 K;  4JI2 K;  4GKK K;  4K0K K;  5BR8 K;  1HR0 K;  3J7Y P;  4LF6 K;  4JI6 K;  4V19 S;  4X65 K;  4DR5 K;  4YY3 K;  4YHH K;  4JI8 K;  4KHP K;  2HHH K;  4LFA K;  4X64 K;  2UXD K;  4DV5 K;  2UXC K;  4CW7 B;  3T1Y K;  4DV0 K;  5A2Q O;  2UXB K;  3J81 O;  3J7A P;  4DR1 K;  4DV7 K;  1IBM K; 
#chains in the Genus database with same CATH topology
 4N41 A;  4CEF A;  1BQN A;  1C1A A;  5HL7 L;  4PUO A;  4CF9 A;  4JK7 A;  4BRP A;  2DTU A;  5CHI A;  5AJ3 K;  3O4Q A;  4EZ9 A;  4K43 A;  1JL2 A;  4FJL A;  5BN9 A;  4FM2 A;  4HUF A;  1IKW A;  4E19 A;  4PKG A;  4M41 A;  5HRO A;  1HPM A;  4CZM A;  5AZJ A;  4OVL A;  4JK9 A;  4FJJ A;  2A40 A;  1C0G A;  1WBD A;  3DLG A;  3L6Q A;  3TAM A;  4Z0U A;  1J53 A;  3WNG A;  4BQZ A;  1D8Y A;  2AA4 A;  5FPE A;  3CCE N;  4B3T K;  3ZCM A;  3QFP A;  2HF4 A;  3RWU A;  3MWT A;  4CK2 A;  2QWO A;  2W40 A;  3MXM A;  4A61 A;  1TYQ B;  3TAE A;  4GVE A;  4MDB A;  2P9N B;  3WT0 A;  5J2N A;  1VSF A;  1NNE A;  1VQM N;  2A42 A;  3OYN A;  4R5P A;  3T7Z A;  1K8A O;  1TKT A;  4O4G A;  1CLQ A;  2P9P B;  4DTN A;  3LL3 A;  4FWM A;  1KD1 O;  2P9U A;  3VES A;  4LF9 K;  1N33 K;  4B1V A;  2G8V A;  5FPD A;  1U48 A;  2RHK A;  3A5O C;  2IDO A;  3KWG A;  4IG0 A;  3MEE A;  4KTW A;  4BR7 A;  2O8B B;  1C6V A;  1X3N A;  2O8E B;  1NGD A;  3LM2 A;  2Q36 A;  4QOZ B;  2E6L A;  3M8P A;  3BP8 A;  3DXM A;  3UKU B;  2EHG A;  4Z4E A;  3DLR A;  1MU2 A;  3V1O A;  4YY3 K;  5GAE P;  4YHH K;  4JN4 A;  1DLO A;  2NRV A;  3MX5 A;  4FLX A;  4M3W A;  1Z05 A;  4FJH A;  3NMU A;  5AQN A;  4GW6 A;  4HCB A;  1SL2 A;  4IFV A;  4B1Y B;  4BY9 C;  4BRK A;  4IDH A;  3DMJ A;  3E9O A;  4BGA A;  3QIN A;  1HNW K;  3S41 A;  1YJN N;  3SQ1 A;  1VRT A;  4FWN A;  3ULE A;  3C0B A;  1KAX A;  2A3Z A;  2E1Z A;  2IS3 A;  4B9T A;  2QK9 A;  3SI6 A;  3V9Z A;  4RW9 A;  1N5Y A;  3K9J A;  1V4T A;  1EO1 A;  4JKG A;  3NCI A;  4LFC K;  3D2E B;  1KLM A;  1IG8 A;  1UAX A;  3FZH A;  5JVG L;  4M3X A;  2OTJ N;  2J4R A;  1TAU A;  1TKZ A;  4LSN A;  4DSE A;  4KHN A;  2HHW A;  2JWK A;  1S1T A;  4WFA L;  4JRQ A;  5BPM A;  4N47 A;  4L3Q A;  3ID6 A;  4JKC A;  3EL2 A;  1WAJ A;  4CEQ A;  4YOX A;  4DV3 K;  3CFR A;  4CFA A;  2FBX A;  3ID8 A;  3OBY A;  4OKJ A;  2ETJ A;  4CJR A;  3S9H A;  1BWF O;  2QW9 A;  3O9R A;  3UE5 A;  1VSM A;  3HK2 A;  3HI0 A;  4HCC A;  3LDL A;  4H0O A;  2QWN A;  2NRW A;  2Z1G A;  3CM6 A;  3LDO A;  4DV4 K;  4B3M K;  4KHU A;  3PO4 A;  4BQL A;  5M1P A;  1J5E K;  4BWJ A;  5JLH A;  2HVI A;  3IDH A;  4OO1 J;  2OCE A;  2YKN A;  4F8R A;  2AP1 A;  1X3M A;  3OBW A;  4OX9 K;  1MWK A;  2XY7 A;  1YJW N;  5M1Q A;  5EOY A;  1U4B A;  4FJN A;  3ZET A;  1GOA A;  5CZ1 A;  1TGO A;  5JLF A;  3L3V A;  4HVJ A;  4NLC A;  3FZL A;  3IFR A;  5BR8 K;  4I6M B;  3QNN A;  3CJ7 A;  2G8K A;  4BR9 A;  1W97 L;  4HUG A;  2KLA A;  4NB4 A;  3AAP A;  3CG7 A;  3BF3 A;  3KWI A;  3T3F A;  2DFE A;  4CF1 A;  4KO0 A;  3U8X A;  1RDD A;  2PZS A;  5KQ8 A;  5FRN A;  4H0Y B;  3QIC A;  2NRT A;  4KB0 A;  3ATU A;  4BR2 A;  5LY3 A;  4CEA A;  1K73 O;  1VQK N;  3JYT A;  4EIA A;  2NLX A;  3F9K A;  4JV5 K;  4ILJ A;  3OYK A;  3V9W A;  2GWJ A;  3DI6 A;  2NNW A;  2BE2 A;  2F9W A;  3LPU A;  2EWS A;  4FJ5 A;  1REV A;  1NBW A;  2HOE A;  1J54 A;  3HP6 A;  4A2B A;  1JCG A;  1VHX A;  1ASW A;  3VA0 A;  4GVM A;  1YVU A;  3SBT A;  5ADX A;  3HOT A;  4B3R K;  4DQ8 A;  3HXM A;  2G8I A;  2GEL A;  1TVR A;  2X74 A;  2O8D A;  5AQO A;  4GKJ K;  3VN5 A;  3OYG A;  3B6P A;  5GIO A;  4J8F A;  2YHY A;  5J1E A;  4DR3 K;  1BG3 A;  3O3H A;  3VEO A;  4CHN A;  2Q3S A;  3CJ9 A;  2E2P A;  4O0J A;  4E7J A;  4CFC A;  1VSK A;  5T7B A;  4GV6 A;  3LAM A;  4QS7 A;  1D5A A;  4B3O A;  4OGC A;  3DM2 A;  2XO7 A;  4FPB A;  3HVR A;  2Z1I A;  3U9Z A;  4DV2 K;  1OH6 A;  2CGJ A;  4W5T A;  2YKM A;  1NGG A;  5D3G A;  4J2A A;  3OS2 A;  1JLF A;  3RR7 A;  2D1K A;  2YHW A;  3ZSR A;  2HMI A;  2YJF A;  2RF2 A;  1U47 A;  1T3V A;  3L2Q A;  3AVA A;  3V6D A;  3CME N;  1ZXO A;  3THX B;  1F21 A;  3V1R A;  4IOC L;  4CD1 A;  3HSC A;  3VQ5 A;  4CI6 A;  1LW2 A;  4H0P A;  1RTD A;  4DU4 A;  3SPZ A;  2A1S A;  4CJQ A;  1RBT A;  2FBV A;  2I5J A;  4CK1 A;  3O9Q A;  3HPO A;  3FE1 A;  3SUQ A;  4AHR A;  3OS1 A;  4N76 A;  3A2F A;  2V7Z A;  5KPT A;  4DV5 K;  3T1Y K;  1KQS M;  2BGG A;  3GBT A;  3VTH A;  2GEM A;  1RGI A;  1VAZ A;  2Q0R A;  3O80 A;  3CC2 N;  4BRE A;  1KLN A;  2A41 A;  1GLJ O;  3NH2 A;  1N36 K;  4FJM A;  5LMN K;  2F9T A;  4JI5 K;  3K5L A;  4A57 A;  1ZBU A;  4MQ3 A;  4Z4I A;  3HRG A;  4CZI A;  4JI1 K;  3QLH A;  4HTU A;  1KXP A;  1NJZ A;  5J2P A;  4O8K A;  3W3D A;  2P9N A;  4CHO A;  2WTU A;  3G10 A;  1T8E A;  3LDS A;  1JCF A;  3DOL A;  1SKW A;  3HO1 A;  3G0Z A;  3H1V X;  2P9P A;  4OKK A;  1KSP A;  3DJC A;  1EX4 A;  3VEV A;  4KI6 A;  3EKU A;  2DPN A;  5AQP A;  4CF2 A;  3K9K A;  3AVB A;  3MN6 A;  3D6R A;  4BC3 A;  2HNY A;  1BCO A;  2O8B A;  4DV1 K;  4JKH A;  2O8E A;  1OH5 A;  5K14 A;  4DF4 A;  4WYB A;  3UKU A;  1VQ9 N;  3M6G A;  3HYF A;  3UKR B;  3GL1 A;  1VSH A;  2NZT A;  4EHT A;  3O9U A;  4JAX A;  5C0Y A;  3VQP A;  3L3U A;  4I9Q A;  3SJJ A;  1QSS A;  3LP0 A;  3E9L A;  1RTH A;  1TUU A;  1D9F A;  4F3O A;  3TAQ A;  1RBU A;  2D0A A;  4YOW A;  3SYZ A;  1SS6 A;  1YAG A;  1IBK K;  4RW6 A;  4CEB A;  3RVC A;  4DLG A;  3VQ6 A;  3ZSX A;  3H1Q A;  3K5M A;  4L8R B;  1GOC A;  3EZW A;  4GKK K;  2QWM A;  2V51 B;  5MLC Q;  5F2R A;  1KVA A;  4CGG A;  3RMB A;  4NYF A;  2YHB A;  3FFI A;  3KK2 A;  2D4W A;  3AGR A;  3SUO A;  1N6Q A;  1ZBF A;  3Q7C A;  3V9U A;  1JLQ A;  4KTQ A;  4FO0 A;  5E41 A;  1S1V A;  1LV5 A;  5AFU H;  1K6Y A;  4FXD A;  3D2E A;  3PLA A;  1NK9 A;  5C24 A;  3N4P A;  3V81 A;  2FF6 A;  2YI1 A;  4CE9 A;  2E4L A;  4W5O A;  3AO1 A;  4OLA A;  2KFN A;  2HHT A;  4JKD A;  4CJP A;  4DLE A;  1NJX A;  3MN9 A;  1TUY A;  2P9L B;  4FJ8 A;  5KGX A;  2G8F A;  2UUC K;  3GE1 A;  5BPN A;  3KJV A;  1VQ5 N;  2XHB A;  4U67 L;  2VQF K;  1M90 O;  3AA3 A;  3AO5 A;  3R1X A;  3OYC A;  4B9V A;  3A5L C;  3F73 A;  2JWL A;  1XWL A;  4ILH A;  3OW2 M;  1QHT A;  3AAQ A;  3CPE A;  4MDA A;  4BE1 A;  1LW0 A;  4CER A;  2ASP A;  3MEG A;  3PSI A;  3ZYY X;  2WUS A;  3MN7 A;  3BY5 A;  3AVH A;  4FWK A;  1WSF A;  2E2O A;  4IJN A;  4FSV A;  3GG4 A;  4M3Y A;  3C95 A;  1NJW A;  1I3A A;  1YTU A;  4I6M A;  3R6M A;  3D45 A;  2VGN A;  4PA1 A;  3O3F A;  1BO5 O;  2ASM A;  2XY8 A;  2QI2 A;  3WXK A;  1QE1 A;  2XRI A;  1JLE A;  5AQM A;  3T1H K;  4I2P A;  2OZS A;  2XY6 A;  1IH7 A;  2P51 A;  2OPP A;  1S5J A;  4GY2 B;  3OYL A;  1VSD A;  4FOE A;  4CGD A;  3VOV A;  3I56 N;  4DR7 K;  2QKB A;  3ZX2 A;  2HW3 A;  4DF8 A;  3R8E A;  3NF7 A;  3SCX A;  2YNF A;  1YHQ N;  3OJS A;  1RBV A;  2HNZ A;  4BAC A;  1U2V B;  2GUI A;  4JI6 K;  2HHV A;  5AQZ A;  4BRD A;  4KFB A;  2HHH K;  5AQL A;  3SQ4 A;  2OTL N;  4BRQ A;  3I0S A;  2W42 A;  3MCA B;  1EXQ A;  4M3T A;  4M7X A;  3O8M A;  3WNE A;  2VWB A;  4RW8 A;  2GV9 A;  3V1Q A;  4Z4G A;  3KLF A;  5LL6 Z;  3LM9 A;  3K59 A;  3UIQ A;  1NGJ A;  4ELT A;  2HB5 A;  3M5R A;  1HUX A;  5FRO A;  3THV A;  1NGE A;  1S22 A;  4M42 A;  3ZEU B;  1DT9 A;  4ISF A;  3VF4 A;  2QM1 A;  4NXN K;  2RN2 A;  3B6O A;  4CJF A;  1NKC A;  1NK7 A;  1BUP A;  1NK4 A;  4CZK A;  4JS4 A;  4DTX A;  2HBJ A;  4GV9 A;  3OTO K;  4CHQ A;  2HHQ A;  1ZBS A;  1U6Z A;  2P9S B;  1RT4 A;  1B9D A;  2O8C B;  4OPA A;  5HRN A;  5JVH L;  3ENO A;  1SKS A;  4LC9 B;  3OJU A;  3C7N B;  3JXU A;  3AO3 A;  3BEX A;  4LF7 K;  2VGM A;  3L4I A;  2HBM A;  5AQT A;  4B3S K;  3QEW A;  3CF5 L;  5IT9 O;  4ZTJ A;  4LF5 K;  4GNI A;  3THX A;  2GWK A;  4FJK A;  1CZA N;  4X62 K;  3CJC A;  1KAY A;  4H5W A;  1HKB A;  3P83 D;  2NUB A;  5KI6 A;  3O1W A;  2OPS A;  3M3Z A;  3MXI A;  5KRT A;  1RDU A;  1ATS A;  4IJA A;  1W7A A;  1WB9 A;  1DEJ A;  2VG7 A;  3TI0 A;  4U7B A;  1VQ4 N;  3A0I X;  1IKY A;  4FM1 A;  3H3N O;  3IUC A;  3EEQ A;  3VEW A;  4CIG A;  4WFB L;  3J8A A;  1T7P A;  3G25 A;  1KFD A;  3NBP A;  1WLJ A;  3SLC A;  4AM7 A;  4DU1 A;  4BRG A;  1S72 N;  4LFA K;  3KLE A;  1P8Z A;  3ZSQ A;  4E0D A;  2O8F B;  1NK5 A;  3VGK A;  4CES A;  3BDP A;  4O5F A;  1RIL A;  2A6A A;  3ZSV A;  1Q7Y O;  4C8O A;  2UXD K;  3CCJ N;  3I33 A;  4C8N A;  3MCP A;  4ISG A;  5A2Q O;  4C23 A;  3PX4 A;  4N56 A;  4Q5V A;  5C15 A;  4O44 A;  5AQF A;  4ELU A;  3EE8 A;  4FLZ A;  5CYQ A;  3J80 O;  1VQL N;  3ZT3 A;  5EY4 A;  4NYN A;  1HJR A;  4HUE A;  3QB0 A;  3LDQ A;  2A1R A;  5GAG P;  4CJU A;  3SV3 A;  1RTJ A;  4JI4 K;  1GLL O;  3JAM O;  3Q7B A;  3RTV A;  4CJL A;  4QCL A;  3UKR A;  4EHU A;  1YVN A;  3TSQ A;  3VEN A;  4DU3 A;  4H5N A;  4A59 A;  4XH1 A;  3QFU A;  2WFB A;  4MFB A;  4YOR A;  1ATR A;  1KAZ A;  4CF8 A;  3I55 N;  2BDP A;  3O6W A;  3SK3 A;  5EU7 A;  3CER A;  2F4V K;  1C0F A;  3TAR A;  4IWV A;  1RBS A;  1GLC G;  2FSK A;  3EKS A;  4DS4 A;  2ZQB A;  3TTF A;  5CY4 A;  2OZM A;  5HP1 A;  1NWK A;  2OA8 A;  2OPR A;  1I39 A;  2Z1H A;  3NE6 A;  1WOQ A;  1IG9 A;  3VQD A;  1BQM A;  4K25 A;  2P9K B;  4FVM A;  2FF3 B;  1X9M A;  3B8A X;  4M45 A;  3LWL A;  4RW7 A;  3THW B;  1WSE A;  3V4I A;  4DV6 K;  3MED A;  5HOO A;  1NK6 A;  2OPQ A;  2P9L A;  3P38 A;  4FW1 A;  4YDU A;  1HR0 K;  4BE0 A;  1VSJ A;  2JLE A;  5AQY A;  4X65 K;  3J7Z O;  3CI5 A;  2R7Y A;  2YX6 A;  4CJ7 A;  3DRP A;  3VQE A;  4X64 K;  4B1U B;  4CZG A;  4CJ4 A;  4KRE A;  4DR1 K;  4DQQ A;  3WXI A;  1QVG M;  4DQI A;  1WN7 A;  4DFP A;  2HF3 A;  2KQ2 A;  4FLV A;  4RW4 A;  1OVQ A;  3D7E O;  4W5Q A;  3TR8 A;  1VQ8 N;  4G1Q A;  1BI4 B;  4B9S A;  4A2A A;  1TV6 A;  4KHW A;  3BGR A;  1XMQ K;  3HST B;  3TSP A;  4E7H A;  1ZBI A;  1BU6 O;  3QO9 A;  3NDK A;  1IBL K;  5GAD P;  1YUW A;  3I8B A;  4IOA L;  1TKX A;  4F2R A;  3K2P A;  2W41 A;  1YTA A;  4CJE A;  4LY7 A;  1ITG A;  5HRP A;  4JHD B;  2IVO A;  1Q86 O;  1IV0 A;  3THY B;  4DSK A;  1QQM A;  2PYL A;  2F7T A;  1Q82 O;  3LP3 A;  4J2D A;  2YHA A;  3NFA A;  4H5T A;  4C8L A;  2OAN A;  2PFU A;  3EYZ A;  5KTQ A;  2D0C A;  4BDZ A;  4DTR A;  3FLC O;  3JS6 A;  2YNI A;  1HYZ A;  3OYM A;  4FK0 A;  3KK1 A;  4FWO A;  3VQ7 A;  2NRX A;  3ATV A;  2ZD1 A;  1HYV A;  4E7I A;  4KHS A;  4CZF A;  4H8K A;  3QEV A;  1Q8I A;  3H08 A;  3WNF A;  3KLH A;  2HND A;  3ASM A;  2P1J A;  3T19 A;  4KH6 A;  4TSX A;  3OYI A;  3OYJ A;  5FPM A;  4QAG A;  3QML A;  3F5T A;  3LP1 A;  2ZJQ L;  3ZT4 A;  5JS1 A;  4K8Z A;  1KFS A;  3CCS N;  4DFK A;  4DR5 K;  3WXJ A;  1KVC A;  1FW6 A;  4DSI A;  1HJO A;  1MWM A;  4YFU A;  2Z1J A;  5CE3 A;  4N5S A;  2FLO A;  3ALY A;  1B9F A;  5CR4 A;  5DM6 L;  3MAQ A;  4CEC A;  3AVK A;  4CHZ A;  4C8M A;  2Q2R A;  3R3L A;  1C0M A;  3AGK A;  2ATQ A;  5GAH P;  2E8A A;  2P9S A;  4XEI A;  2O8C A;  4FLW A;  4BRF A;  4K42 A;  4W5N A;  3FZK A;  3CCV N;  1T03 A;  1QHA A;  3AAR A;  3MK6 A;  3C7N A;  1UOC A;  2P9I B;  4AHS A;  3O4W A;  1T05 A;  3CQY A;  3HJF A;  1EP4 A;  2CGK A;  1VQ7 N;  4ELV A;  3QEP A;  5AQQ A;  4AM6 A;  4EFH A;  3N4Q A;  4BC2 A;  4B9N A;  3S3N A;  5AQV A;  1NMD A;  5AQS A;  5KRS A;  1Z6R A;  4O55 A;  4JI0 K;  4NCB A;  1RT5 A;  4I2Q A;  4AHU A;  1WSH A;  2IGI A;  1N8R O;  2BUP A;  5C2F A;  5AQG A;  3A5N C;  3NH1 A;  3H46 O;  1C0U A;  1NGC A;  3DLL L;  4CZL A;  1TL1 A;  1TYQ A;  3L2U A;  4IFY A;  1VQO N;  4I7F A;  3JSM A;  2DY4 A;  4F9O A;  3VGL A;  4IEI A;  4CJS A;  1N34 K;  1HNV A;  1QQN A;  3T69 A;  4DQR A;  5C2D A;  2B5J A;  1L3T A;  4E1N A;  3BF1 A;  5HRS A;  3IMX A;  1IKX A;  4OPK A;  4CJK A;  1CZ9 A;  2VYP A;  1XHZ A;  1QSY A;  3HM8 A;  3FR0 A;  3DWL A;  1KTQ A;  3OHR A;  1HPZ A;  3AVJ A;  1NJI O;  4O8U A;  1NU0 A;  1S6P A;  3KLG A;  2UU9 K;  1X1P A;  4DTJ A;  2GTD A;  2HMP A;  4DB3 A;  1GLD G;  4Z4F A;  4BRH A;  4AF1 A;  2IOC A;  3AVM A;  2D0B A;  1P90 A;  3AVN A;  5F1X A;  4WE1 A;  3NVK A;  5DM7 L;  1NGI A;  2HHX A;  4F3T A;  4I9L A;  5GIN A;  5M1F A;  4IO8 A;  4BRM A;  3HT3 A;  3RR8 A;  3VQC A;  3M8R A;  1LAW A;  2EX3 A;  2O4G A;  4W5R A;  3QBW A;  4C1N K;  2AJQ A;  3TU5 A;  4PKI A;  3RMC A;  1A5V A;  3NGI A;  3IS9 A;  4EP5 A;  1LCU A;  4B08 A;  4B1Z A;  4GMJ B;  4YDU C;  3K5O A;  3KKS A;  4H0T B;  5AQH A;  3AY9 A;  5AQX A;  5EXW A;  5BRH A;  2QXF A;  1OH8 A;  2ITM A;  1HX1 A;  3VF2 A;  2PAV A;  1SZ2 A;  3R9P A;  3KLI A;  1ZYQ A;  4CFB A;  4FYD A;  2Q31 A;  3S3M A;  3O3G A;  3AA4 A;  1ZC6 A;  4JNE A;  3GDQ A;  5ADX H;  2P9K A;  3LDP A;  1JL1 A;  4IDK A;  4JD2 B;  4DTM A;  1YIT N;  1FJG K;  1Y64 A;  3THW A;  3QDK A;  3VPZ A;  1NKB A;  1QZ6 A;  2Q0U A;  4CJ5 A;  4DR4 K;  2X6S A;  3VQQ A;  4LH5 A;  4H0X B;  5FLX O;  1NMN A;  4YOY A;  3M8Q A;  4KRF A;  1RT2 A;  3TSU A;  1WBB A;  1NGH A;  3BUZ B;  1GLB G;  3AVG A;  3NF8 A;  1EWQ A;  1EET A;  3ISN C;  4KV8 A;  3DLH A;  2ZGY A;  2W6K A;  1R0A A;  5KPZ A;  5BRE A;  3CFO A;  3L8B A;  4JKB A;  2FSJ A;  4NLB A;  3ZET B;  2QEX N;  3L2W A;  1CXQ A;  3F2K A;  1BL3 A;  3F9M A;  4DG1 A;  1RDW X;  3C6T A;  1C0T A;  4KBO A;  5M1N A;  4FPA A;  1BI4 A;  3KHY A;  3J7Y P;  1M1K O;  4V19 S;  4JKF A;  3TPQ A;  4CD3 A;  3QET A;  3PY8 A;  3SUN A;  4DQS A;  1BIZ A;  3DLB A;  4BRI A;  3H3O B;  4WCE L;  4A5B A;  3WNH A;  4IKF A;  4B9L A;  4Y0W A;  1YT3 A;  4E1M A;  5FDL A;  1C1C A;  3NGZ A;  2D0P A;  3MEC A;  4CW7 B;  4DV0 K;  3HM9 A;  1RBR A;  5BRD A;  1L3U A;  3KKR A;  5BPL A;  4E7L A;  4FJI A;  3VER A;  4FWP A;  1S1X A;  3HTV A;  4CIE A;  4H5R A;  3OYH A;  4ILG B;  3CXC M;  1E3M A;  4JHD A;  3LP2 A;  3NHG A;  4JEP A;  4NO7 A;  3THY A;  3SPY A;  1XC3 A;  1G99 A;  1ZBH A;  3CMA N;  4GV3 A;  1RCH A;  4FWL A;  1YF5 L;  2F8T A;  2V7Y A;  3C6A A;  1N32 K;  2Y1I A;  3P5J A;  2E1Y A;  3OYD A;  4JI7 K;  4BRN A;  4YOV A;  3NF6 A;  3QNO A;  4DSF A;  4OGE A;  1NJY A;  4K8X A;  4EAH D;  1X9W A;  2O8D B;  1VSI A;  5IWA K;  4CEO A;  1NGB A;  1DGK N;  2E2N A;  1YXQ A;  4A5A A;  4OPH A;  1JJ2 M;  4LFB K;  3AA5 X;  4IEE A;  4XIU A;  1FXX A;  3VQ8 A;  2D0O A;  1QTM A;  4X66 K;  1JKH A;  1OKJ A;  5KGW A;  1TL3 A;  2G8W A;  4B9M A;  1K8K B;  2YHX A;  2IAJ A;  3H6E A;  1JXE A;  2WC9 A;  4CGF A;  4ZTF A;  4RTF D;  3CC4 N;  4DTU A;  4FCY A;  4AHC A;  3L0Q A;  1SKR A;  2FBY A;  1D4X A;  1JLG A;  3G6E N;  3MWP A;  5DK5 A;  1A5X A;  2PYJ A;  4FVU A;  4PY5 A;  4CJT A;  2QXL A;  3LZI A;  3QER A;  3VF6 A;  4DTO A;  4AQY K;  2NRR A;  3VEX A;  1XNQ K;  3O1B A;  1NG9 A;  4DUY K;  5E26 A;  4M3R A;  1D9D A;  2P9I A;  4DHY A;  2KFZ A;  5FPN A;  3PV8 A;  3M8S A;  3D2F B;  4KHP K;  1XC9 A;  4CED A;  3IRX A;  4M7Y A;  3E9P A;  1HLU A;  3SAG A;  3PUF A;  2YV0 X;  4CBX A;  3DRS A;  4B9U A;  4DFM A;  3SMP A;  3PX6 A;  2IC3 A;  1NOZ A;  3O4N A;  4DTS A;  1Y97 A;  3AVC A;  3J7A P;  4CZJ A;  5BR9 A;  3DYA A;  3TTD A;  4B1W B;  1EKE A;  1QQC A;  2Q1N A;  2QA4 N;  3VA3 A;  4LF4 K;  3OYA A;  3HOS A;  5HBM A;  4KI4 A;  3P31 A;  1BCM A;  1RTI A;  3SMS A;  4BR5 A;  1ZBL A;  4F2S A;  3FFK B;  1QVF M;  4A62 A;  4CEE A;  3MMV A;  3C6U A;  1HNX K;  3ZLJ A;  4Z94 A;  1CXU A;  3DLK A;  1GLE G;  4CGJ A;  4NCG A;  5GIP A;  4IBN A;  3NVM A;  4FLT A;  5KQD A;  3MXJ A;  4DS5 A;  2ITG A;  1S3X A;  1K9M O;  2ASO A;  2KW4 A;  5H1S Q;  5HLF A;  1RT7 A;  4LF8 K;  1WSI A;  4FWR A;  1IKV A;  4BRO A;  1C1B A;  5M1O A;  2GX9 A;  3CCR N;  4PQU A;  2UUA K;  3HP9 A;  2VQE K;  1E4G T;  1JLA A;  3C65 A;  4IOX A;  4RCH A;  4BR0 A;  2FSN A;  3A8Y A;  3T1A A;  2FC0 A;  3ZSO A;  1BA0 A;  2B6A A;  3LDN A;  4FL9 A;  3KK3 A;  4Y1D A;  4BC5 A;  1RNH A;  3O9T A;  1NGA A;  1ATN A;  1YIJ N;  4NCA A;  1HMV A;  2JGU A;  1HQE A;  3WEE B;  4DFJ A;  1WAF A;  3E66 A;  3P39 A;  1JXB A;  3WQU A;  4KKO A;  2GUP A;  4J2B A;  3MN5 A;  1XQS C;  2WBN A;  5EX5 A;  4UY8 O;  4EP4 A;  1WUA A;  1Q81 O;  1RDA A;  4B8A B;  4JKA A;  3O08 A;  3SUP A;  5AQW A;  2PBD A;  3HPH A;  1BGX T;  3LPT A;  4IG3 A;  2VG6 A;  2KZZ A;  3KVG A;  4MO4 A;  4JI8 K;  2RPI A;  4DMN A;  1G15 A;  2IVP A;  1B92 A;  2E2Q A;  4AHT A;  2HHS A;  4CZH A;  2VG5 A;  2IIR A;  1BIS A;  1BOT O;  5I42 A;  4BDY A;  4BDP A;  3J81 O;  2G8U A;  4C8K A;  2KKZ A;  1KRP A;  5BN8 A;  4OLB A;  1HNZ K;  3RRG A;  4DUZ K;  5AZI B;  1S9E A;  4JD2 A;  1U04 A;  3G4S N;  5E84 A;  3EY1 A;  1ILY A;  2X78 A;  1VSL A;  2V52 B;  3ZT1 A;  3IAY A;  3QEI A;  4FJG A;  1S1U A;  4OJR A;  1L3V A;  1J9A A;  1J5O A;  4J2E A;  5SWM A;  4BG9 A;  4FZY A;  3ZX0 A;  4YOT A;  5LJV A;  1XMO K;  5B8H A;  4K41 A;  2I7N A;  2YNG A;  1V4S A;  3GOI A;  1XNR K;  2XY5 A;  3OY9 A;  3EE9 A;  4F4K A;  2UYT A;  2RE2 A;  4WQ5 C;  5C42 A;  3SAH A;  4FJ9 A;  3ZSZ A;  1NK0 A;  4KH4 A;  5I9E B;  2FBT A;  3SAF A;  2GBZ A;  3ZSW A;  3RRH A;  4PL8 A;  4ID5 A;  3P4I A;  5F0X A;  4FK2 A;  1E4F T;  3FZM A;  1T44 A;  1RT6 A;  1IO2 A;  5TKY A;  2QWR A;  4CHY A;  3VMF B;  4BR4 A;  4E89 A;  1FKP A;  2H3G X;  4CHP A;  3W0L A;  3KK7 A;  3K57 A;  3A5M C;  3VQ9 A;  1VK0 A;  4KTZ A;  1TK0 A;  3RSE B;  4OPJ A;  3CM5 A;  1HKC A;  1OH7 A;  3WXM B;  4BG8 A;  4HTL A;  4JK8 A;  3UB5 A;  2BTF A;  1IJJ A;  4ICL A;  4OKE A;  3CC7 N;  3NAE A;  1U2V A;  3DXK B;  3ZT0 A;  2CGL A;  5AFU A;  1TK5 A;  3CIP A;  1S6Q A;  1VQP N;  1U45 A;  3HVT A;  1LOT B;  4BC4 A;  5CYM A;  3L4Q A;  3AO2 A;  1U49 A;  2KZM A;  3TAF A;  4BGB A;  1W9H A;  4CF0 A;  3U4L A;  2DFH A;  2UXB K;  1Q9Y A;  3I0R A;  3PSF A;  3HBT A;  4KHY A;  3SQ0 A;  3PO5 A;  4FWS A;  3QEX A;  1QS4 A;  4WQ4 A;  1NGF A;  3ZEU A;  4BVP A;  4CEZ A;  1YJ9 N;  2KTQ A;  4Z4C A;  5TKW A;  4H4O A;  3EO3 A;  3QES A;  1VQ6 N;  1W0H A;  3K5N A;  1KC8 O;  1K8K A;  3VQ4 A;  4DSJ A;  4H5V A;  3CJ1 A;  4XH4 A;  3VTI A;  1RDC A;  4XH5 A;  3V9X A;  3S3O A;  4AH9 A;  3VET A;  3U3Y A;  5AR0 A;  3CQX A;  3OA9 A;  4CJV A;  2ZGZ A;  1KCF A;  4CK3 A;  4CBW A;  1BHL A;  3QIO A;  4BWM A;  3CFP A;  3DOK A;  3VQB A;  2E88 A;  1HKG A;  4ZHR A;  3LWM A;  2E6M A;  3G71 N;  4DR2 K;  1DTT A;  2FXU A;  4MLE A;  4DR6 K;  4EZ6 A;  3KZB A;  4KH5 A;  1XI1 A;  3U6F A;  2F8S A;  5AZJ B;  4DTP A;  4JKE A;  4QS9 A;  1SQK A;  3TAN A;  3OYB A;  4IZ9 A;  1YI2 N;  4ISE A;  3D2F A;  1UA0 A;  3CCQ N;  4QS8 A;  2F96 A;  3LAL A;  3AO4 A;  2NRZ A;  3QIP A;  3OYE A;  4DQP A;  4CFD A;  4JRP A;  3PX0 A;  2ZE2 A;  2RKI A;  3TAB A;  4KPY A;  4FJX A;  5J2Q A;  3NGY A;  3CCM N;  5LMU K;  4M3Z A;  2QWL A;  3L2R A;  3O5B A;  3SV4 A;  4JI2 K;  1NK8 A;  4K0K K;  1HQU A;  2I7P A;  2NRH A;  3V9S A;  1TK8 A;  1Q18 A;  1O1W A;  1XUP O;  4BRC A;  2O4I A;  1O13 A;  1VRU A;  4CZE A;  4DCH A;  5J2M A;  2P5G A;  1DTQ A;  5SZT A;  1HNI A;  3MDQ A;  2O8F A;  2P9U B;  1SL1 A;  2LSN A;  5JMV A;  1X9J A;  3OYF A;  1Q9X A;  2UXC K;  2ZWH A;  3BZC A;  1J6Z A;  3CQ8 A;  5BRF A;  1EWR A;  3SJH A;  3PIP L;  5EVZ A;  4E7K A;  2PY5 A;  4WF9 L;  1IBM K;  4HHT A;  2VWK A;  5HRR A;  4C1N I;  4FWQ A;  3WXL A;  1GOB A;  2BH1 A;  1H1V A;  3DXM B;  4FOI A;  5DMR A;  4CGI A;  1RFQ A;  2E5L K;  4DSL A;  5JS2 A;  1MDU B;  2P5O A;  3EZ5 A;  3FZF A;  1QQO A;  2W6L A;  4WFN L;  2BAN A;  1KVB A;  1RT1 A;  1FK9 A;  3C94 A;  1WNS A;  3P1G A;  3ITH A;  3VEZ A;  5AQR A;  2CH5 A;  1UWB A;  3O9S A;  3ENB A;  3BZK A;  4R79 A;  4CBU A;  4O0I A;  2VCP A;  3FGU A;  3H45 C;  2HBK A;  1NOY A;  1BIU A;  2D5R A;  3EN9 A;  2UUB K;  4E3S A;  2X6N A;  3VGM A;  3ULE B;  4HWI A;  4JI3 K;  3QBX A;  3ULD A;  4JS5 A;  3WEE A;  2QWQ A;  1R59 O;  2KHO A;  2Q97 A;  1FKO A;  4M63 C;  3WUH A;  3E1Y A;  4DWI A;  1MA9 B;  5CZ2 A;  3TTC A;  5AQK A;  1L5U A;  4AIL C;  4MLH A;  4JKG B;  4H0V B;  5C10 A;  1I94 K;  3AA2 A;  3IKM A;  4JYA K;  4PL7 A;  1LAV A;  1NLV A;  3PIO L;  1WSG A;  4FLY A;  3RMA A;  1VSE A;  5I3U A;  4BRA A;  4H03 B;  2WOM A;  1ASV A;  2ZJR L;  1OVY A;  3CHW A;  3ZT2 A;  1ASU A;  4H4M A;  5C25 A;  1S9G A;  2G8H A;  4DKW A;  3I8D A;  4PWD A;  2YCH A;  4CVN E;  3AVL A;  3CJB A;  4BE2 A;  3MX2 A;  4RWT A;  4Z4H A;  2OYQ A;  1Z25 A;  5AZI A;  1HRH A;  2ZF5 O;  3U9D A;  3ENH A;  1SV5 A;  5ELZ A;  1GLF O;  4FLU A;  3RMD A;  4LF6 K;  1S1W A;  3TAG A;  5JIC A;  3LZJ A;  2VWJ A;  3NF9 A;  4RG8 A;  4FZZ A;  4LH4 A;  4O5B A;  2HVH A;  3SQ2 A;  3AVF A;  4KB1 A;  1TKD A;  4BRL A;  3HZ6 A;  3LAK A;  4E1J A;  1L3S A;  2QKK A;  1HYS A;  1VQN N;  4CJW A;  4UQG A;  2HHU A;  1T6C A;  3ZSY A;  4DV7 K;  2WON A;  1X9S A;  5FRM A;  2B4J A;  1EQY A;  3LAN A;  3U3G A;  4M3U A;  3DAW A;  1NKE A;  3CCL N;  3C6H A;  3VEY A;  3VQA A;  2Y1J A;  1QZ5 A;  4KAZ A;  3KD1 E;  1WSJ A;  2ZM6 K;  4ID1 A;  4FM0 A;  4AHV A;  1LWF A;  4B1X B;  2A5X A;  3OVN A;  4MO5 A;  1SL0 A;  3SBG A;  2QWP A;  4Y1C A;  3KD5 E;  1ESV A;  4WQ5 A;  1SAZ A;  2QTD A;  1DKG D;  3OS0 A;  1JCE A;  1GLA G;  5AQU A;  1RT3 A;  4WQ4 C;  3RSE A;  1TAQ A;  5C12 A;  5AQJ A;  4LD0 A;  2HST A;  4KHQ A;  1QSL A;  3IG1 A;  4CIF A;  1RDB A;  3SZ2 A;  4PHT X;  5AQI A;  1CZB A;  4CGH A;  4CJ3 A;  1JLC A;  3DXK A;  3NH0 A;  5KPR A;  3CJA A;  3CCU N;  3WQT A;  3AV9 A;  4IFE A;  3DLE A;  2HBL A;  3E01 A;  2CH6 A;  3HL8 A;  4NXM K;  5M1K A;  3CPW M;  2YJE A;  3D0P A;  4FZX C;  2E20 A;  1LWE A;  1BA1 A;  4CCH A;  3KTQ A;  3SNN A;  1Z26 A;  3TAP A;  4G9Z A;  4IO9 L;  3HPG A;  3CET A;  4PKH A;  1W2B M;  4YNQ A;  3DRR A;  2ZJP L;  1LWC A;  1NM1 A;  4YOU A;  4Q0B A;  4IXC A;  1T6D A;  4FJ7 A;  4LSL A;  3K58 A;  3M1F A;  4FK4 A;  3CD6 N;  5LJW A;  1XHX A;  3ZX3 A;  3AVI A;  2YNH A;  1UA1 A;  3L2V A;  4B8C A;  1BDG A;  2IVN A;  3CYM A;  4BVO A;  1SUQ A;  2DFF A;  3KIO A;  4JLH A;  3K0S A;  4B9Q A;  1JLB A;  3TWH A;  1A5W A;  4FW2 A; 
#chains in the Genus database with same CATH homology
 5LL6 Z;  1HNZ K;  4JV5 K;  1HNW K;  4DUZ K;  3J80 O;  1N36 K;  4LF4 K;  5AJ3 K;  5LMN K;  2E5L K;  2UUC K;  4JI5 K;  2ZM6 K;  1XMQ K;  4JI1 K;  2VQF K;  4JI4 K;  4NXN K;  3JAM O;  4LFC K;  1HNX K;  1XMO K;  1IBL K;  1XNR K;  1N32 K;  3OTO K;  4JI0 K;  4B3R K;  4JI7 K;  4GKJ K;  2UUB K;  4B3T K;  4DV3 K;  5IWA K;  4DR3 K;  4JI3 K;  4LF7 K;  4LF8 K;  4B3S K;  1FJG K;  2F4V K;  5IT9 O;  4DV1 K;  4LF5 K;  4LFB K;  4DR2 K;  4DR6 K;  1N34 K;  4DR4 K;  4X62 K;  2UUA K;  4X66 K;  2VQE K;  5FLX O;  4DV4 K;  1I94 K;  4JYA K;  4B3M K;  1J5E K;  4DV2 K;  3T1H K;  4LF9 K;  1N33 K;  4NXM K;  4OX9 K;  2UU9 K;  5LMU K;  4AQY K;  1XNQ K;  1IBK K;  4CVN E;  4DR7 K;  4DUY K;  4DV6 K;  4JI2 K;  4GKK K;  4K0K K;  5BR8 K;  1HR0 K;  3J7Y P;  4LF6 K;  4JI6 K;  4V19 S;  4X65 K;  4DR5 K;  4YY3 K;  4YHH K;  4JI8 K;  4KHP K;  2HHH K;  4LFA K;  4X64 K;  2UXD K;  4DV5 K;  2UXC K;  4CW7 B;  3T1Y K;  4DV0 K;  5A2Q O;  2UXB K;  3J81 O;  3J7A P;  4DR1 K;  4DV7 K;  1IBM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...