3C65A

Crystal structure of bacillus stearothermophilus uvrc 5' endonuclease domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
152
Chain Sequence
GSHMLGERLGIPAPRRIEAFDNSNIYGADPVSALVVFLDGKPAKKEYRKYKVKTVAGPNDYETMREVVRRRYTRVLKEGLPLPDLIIIDGGKGHLSAVRDVLENELGLDVPLAGLSELLAGDPPDVVPLDRQSQEFYLLQRIQDEVHRFAVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords UvrABC system protein C
publication title Crystal Structure of Bacillus stearothermophilus UvrC 5' endonuclease domain
rcsb
source organism Bacillus stearothermophilus
total genus 44
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c65A00
2NRRA 2NRZA 2NRXA 2NRTA 2NRVA 3C65A 2NRWA
chains in the Genus database with same CATH superfamily
3ZSZA 1F21A 1ZBHA 3OYIA 3HOTA 3M3ZA 1K8AO 1RDUA 3SQ2A 1RT2A 5FROA 3S3MA 3V9WA 1C0FA 3HZ6A 2NRWA 2A3ZA 2V52B 5J2PA 2QWMA 5M1QA 3VEXA 4BC2A 1FXXA 5E84A 1HKCA 2FBVA 1V4SA 3I0RA 1YXQA 4C1NK 3O9UA 3ZYYX 4FLYA 3CCQN 4YDUC 5CZ1A 4CHZA 1TGOA 5AQLA 3M5RA 4IG3A 4DFPA 5JMVA 3O4NA 1EQYA 4Z0UA 4K0KK 2JGUA 4IO9L 1NM1A 3L4IA 3VEWA 5AQNA 2FSNA 4C23A 3KLEA 4JKGB 3VA0A 3R8EA 1QE1A 3P1GA 3AVIA 3KLIA 2WFBA 4PKGA 4CZEA 1S3XA 1VSDA 2P9IB 3AA4A 5CYQA 3OYMA 3KJVA 4FVMA 3F9MA 3GOIA 2OYQA 4CECA 1NGFA 3MX2A 4OPJA 3VGMA 3J8AA 3PX0A 1IJJA 1SKSA 4QAGA 2YNIA 2FSJA 4DR4K 4JKGA 5I9EB 3TPQA 1IKVA 3MCPA 4BVOA 1S9EA 4CK2A 1U47A 1HR0K 4B08A 1WSIA 1VSMA 3EL2A 1HNWK 4DV2K 1JJ2M 4YOUA 5C15A 2GTDA 4DFJA 1BI4B 1K8KB 4KI4A 3HVRA 3D7EO 5LMNK 3SI6A 1JLGA 2UXCK 4FVUA 1HYZA 3UB5A 4BR7A 1YAGA 2YV0X 3DAWA 3DYAA 5GINA 1KXPA 5HOOA 3CJBA 2G8HA 2A6AA 4NLBA 5BRHA 2P5OA 4DSFA 2Y1JA 1Q8IA 4XH4A 4I7FA 2UU9K 3OBWA 5AJ3K 3B6PA 4EHUA 1X9SA 4FWKA 1NJZA 4F2RA 4B3MK 2YHXA 1LWCA 1QHTA 1ILYA 2XHBA 3C0BA 3ENOA 3VOVA 4FWRA 4HVJA 3A5OC 5JVGL 5AQKA 2P9PB 3AY9A 5EVZA 3ZSQA 5AFUH 4YFUA 4FOEA 4BRDA 3A5LC 1TYQB 1U49A 2HF3A 4B8CA 1NGJA 1VQ5N 1DTTA 5AQOA 3M8RA 4OKKA 2DFEA 3NVMA 2GWKA 1SKWA 3AAPA 3WNFA 3H46O 3QIPA 3CYMA 5EOYA 3RSEB 4CEQA 3AO5A 4B9UA 3A2FA 1ASVA 3SAFA 3WUHA 3QERA 2D0BA 3MWTA 3WXKA 4M45A 4KB0A 2GX9A 5BR8K 3ZSWA 3CJCA 3KWIA 3OJUA 1CXQA 3NMUA 5BREA 2QWOA 2LSNA 3OYKA 3SAGA 4H0VB 3AO1A 4H0TB 4H0XB 4AM6A 5AZJB 4EIAA 1T7PA 3FE1A 1VQPN 3CJ1A 5HP1A 4UY8O 3HT3A 1I3AA 1IBMK 2P9SB 3V1RA 3FZKA 5CYMA 4M7XA 1ZBLA 1BQMA 3QEVA 3VQEA 2KFZA 4BR4A 2FF6A 4LSLA 3OYEA 3ISNC 4M41A 3AVGA 4CJUA 3MWPA 2HHWA 2H3GX 5AZJA 2BUPA 3OYAA 4W5OA 2HVIA 1YI2N 3O8MA 4DTXA 2HSTA 4ZHRA 3V4IA 5KRTA 4NCBA 5C12A 1Q86O 1L3VA 4ISEA 4AF1A 3MDQA 1X9WA 4CZHA 3L2WA 1S72N 2P9SA 2IVOA 3CCUN 4DFMA 3RR7A 3MX5A 1VQ6N 1X3NA 4H5NA 3SV3A 3AVBA 2F7TA 4I2PA 1FKPA 4CJQA 1S5JA 4BR5A 3IFRA 4CJFA 3VTHA 1L3TA 3M8SA 4BRCA 4NXNK 4FWPA 2OCEA 4A61A 3ULEB 4DTRA 4B9NA 1XMQK 4BE2A 2QI2A 3KKRA 3DRPA 2E1YA 3ZETA 3TAEA 2GEMA 1T44A 4BACA 5C2DA 4O5FA 1X9MA 1KAZA 2YHBA 3VESA 2O8CB 2E8AA 2QW9A 5AQUA 4DQIA 4O4GA 2ASPA 4X64K 4CF1A 3VGLA 3DLBA 4BWMA 3VENA 4IG0A 3U6FA 4R5PA 3ULEA 2Q1NA 3VQAA 1LW2A 2NRTA 4AHVA 3SCXA 1LAVA 5GADP 3CETA 2ZJRL 1QSLA 1WSJA 3WQUA 4BRMA 2UYTA 2O8DB 3JXUA 3F5TA 2O8CA 4DSJA 2Z1GA 3J7ZO 4BR2A 5B8HA 3I56N 3G6EN 1VK0A 1VHXA 3EKUA 4ZTJA 3MN6A 1I94K 3O08A 3AVNA 1BISA 5TKWA 2UXDK 3T3FA 4XH5A 4ID1A 2O4GA 1J5EK 2O8DA 2VGMA 1SAZA 2HHSA 2UXBK 3K5MA 1KFDA 4G1QA 1SZ2A 2FBYA 3CF5L 4CHOA 4IOAL 5KGXA 5F0XA 1E4GT 3MN9A 3S3NA 2F8SA 3VQ5A 3EYZA 4FJ7A 3SJJA 4CFAA 2D1KA 3VQ6A 1W7AA 4B9LA 3AA2A 2NNWA 3SBGA 1WB9A 3FZHA 1LAWA 1BL3A 4DU3A 2A5XA 1NK9A 4KAZA 3CFRA 4YNQA 3EEQA 4DFKA 3WQTA 4BROA 2YI1A 3R1XA 3K9JA 4C8MA 3OS2A 2QM1A 2HW3A 3ZT4A 3LPUA 4PHTX 2D0CA 3EO3A 3ZX2A 2VQFK 1K73O 1VQ4N 4DMNA 4LY7A 1WBBA 1NKCA 2F96A 3RMCA 4JK7A 3OS0A 2A1RA 5AQHA 3RMBA 2DFFA 4JI7K 2QEXN 3PX6A 2FXUA 3K58A 1JLEA 1C0TA 4M3TA 3HK2A 1BIUA 3D2FB 2ATQA 3L4QA 2WUSA 3DLRA 3OY9A 1BCMA 4ID5A 1GLJO 3TAFA 4WYBA 3C94A 4JAXA 4OPHA 4BC5A 3SUQA 4Z4EA 4BRHA 4AILC 4M7YA 3O3HA 2UUBK 1XQSC 4M42A 1RBRA 5AZIB 3NGZA 3CC7N 3QESA 4LF4K 1BDGA 1W9HA 4E1NA 2QWLA 3D2FA 4AHTA 1VSIA 3C6HA 3TSQA 2ASOA 4DUYK 3B6OA 4BQLA 4O55A 5BPLA 4JI5K 4M3RA 2O8FB 5ADXH 5A2QO 4BC3A 3QEXA 4CE9A 1E4FT 1Q7YO 1XC9A 3FZMA 5AZIA 4CW7B 2YJEA 4B9SA 3AVMA 1L3SA 2HBLA 4F4KA 4OJRA 1L5UA 2OPQA 2VG7A 4AHUA 4DU4A 4KHWA 3R3LA 4CEDA 2HVHA 2KTQA 4C1NI 3AVAA 5HRSA 1S6PA 3CHWA 2O8FA 1KAXA 3MAQA 2IAJA 3EZ5A 4BG8A 1W2BM 3EE9A 1SKRA 3DOKA 3O4QA 1YJ9N 3AVFA 3OVNA 5KGWA 3SUNA 3VGKA 1Q81O 4DQSA 3KIOA 4B3TK 2IS3A 3ULDA 4C8LA 4HUGA 1CXUA 3MK6A 5M1KA 2GUPA 4JI2K 3M8QA 3ZX3A 2A40A 4O0JA 1BA0A 3ZEUB 2QXLA 2XRIA 5GIOA 3M6GA 1LWFA 2RHKA 3ZSOA 4WQ4A 4BDZA 3QFPA 3CM6A 3O1WA 4CF9A 4WFAL 1NG9A 5I42A 1GLAG 3QIOA 2NZTA 3KK7A 1RT4A 3HPOA 5TKYA 4B8AB 3TSUA 4H4OA 1VSHA 3HSTB 3V9UA 4KHUA 4E89A 1LCUA 3ZEUA 3OYGA 4X66K 1DT9A 3CCJN 1VSFA 1I39A 4LF6K 1UAXA 1Q18A 2E2OA 3VQ7A 1KVCA 1D9FA 3O3FA 2FLOA 3VQ8A 4JI3K 2A41A 3QLHA 3FZFA 3HTVA 3N4PA 1XHZA 2IC3A 1J6ZA 1VAZA 4C8KA 3H6EA 5JS2A 3J7YP 3KK2A 1VSJA 3L8BA 2PYJA 3L3UA 5HLFA 3AVJA 4B3RK 4E19A 4YOWA 2DTUA 2VYPA 4LF9K 1HNVA 3O9TA 4M3ZA 2E2QA 3VEVA 3VQDA 1ATNA 4FLWA 4IJAA 3FFIA 3MCAB 3HPHA 1NGDA 1YUWA 1IG9A 2QK9A 3PSFA 1HKGA 4A59A 4LH4A 4PL8A 4EP5A 1E3MA 3G71N 4DWIA 1B9DA 1NWKA 5BN8A 2P51A 3QINA 4JN4A 1QSSA 1GLFO 4JD2A 4OPKA 2Q2RA 4Q0BA 1TAUA 3OYDA 3ZT2A 1EX4A 1HYVA 4ELTA 2YJFA 1QSYA 4CHQA 1RTDA 4B9QA 1GLLO 2OANA 4CEEA 3DXKB 2YKMA 4FOIA 3CCEN 2CH5A 2IVPA 1RDBA 4DR2K 2VWJA 4DSLA 4NCGA 4M63C 4F2SA 1WSHA 4CJ5A 3QMLA 1YVUA 3N4QA 5FPEA 1VQLN 1HQUA 3W3DA 1A5VA 4DV6K 4Z94A 1HKBA 1KC8O 2RF2A 1RT1A 2W41A 4QS8A 4Z4GA 4AH9A 4V19S 1P90A 2HB5A 4B9MA 3BF3A 4MFBA 3DXKA 2HHVA 3ALYA 3HRGA 1BIZA 3QO9A 4K43A 4A5AA 3CQXA 2E5LK 1HNXK 1K9MO 1JLAA 4ILGB 5HROA 3CM5A 4M3WA 3C6UA 1QS4A 4K41A 4MO4A 2P1JA 2HHTA 4IOCL 3JYTA 4CEOA 3F9KA 2ZGYA 1HX1A 3MN5A 4AM7A 4DF8A 3E9OA 3VQQA 4WFNL 1W97L 3VF6A 1YF5L 3CG7A 4IZ9A 4O8UA 5KPRA 1EO1A 3LP3A 4WFBL 3C6TA 2HF4A 1NU0A 4OLBA 5IT9O 4FXDA 1HQEA 5AQMA 3CJAA 4Y1DA 2KZZA 3RVCA 3LZJA 3PY8A 4HCCA 3L2UA 4FW2A 4IJNA 4M3YA 4MQ3A 3VQBA 4FO0A 2EX3A 2HBJA 3DRRA 3IKMA 5LJVA 1N8RO 2AJQA 4W5NA 3DLEA 2EHGA 2EWSA 2E6MA 3TTDA 3I55N 4J2DA 1YT3A 3LPTA 3U9DA 3QBXA 4A2BA 5D3GA 4FLVA 3CJ7A 5CHIA 1KD1O 1N6QA 4JK9A 5F1XA 3H1VX 3GBTA 2HNYA 2ZQBA 4DSEA 4IFEA 1RDDA 4JI0K 2VG6A 2FBTA 1A5XA 4DTMA 4Y0WA 2I5JA 1XUPO 1H1VA 1KAYA 4CBWA 3NF7A 4FJHA 1HJRA 1C1AA 1WSFA 2VG5A 4J2BA 4MO5A 3LP2A 3MEDA 4M3UA 3VTIA 3E01A 1RT6A 4BWJA 3WNEA 2XY5A 4I9QA 4KREA 3SMPA 1QHAA 3LL3A 3KWGA 1IKXA 3MEGA 4KH6A 3O5BA 5BPMA 2E2PA 3SYZA 4JKCA 3U3YA 1HUXA 3FZLA 4CCHA 3UKUB 3AVLA 1OKJA 1NOZA 3MN7A 3W0LA 1WLJA 4BG9A 3D0PA 3SBTA 2X6NA 3SQ4A 1D5AA 1C1CA 3AGKA 4LFCK 1X3MA 5HRRA 3CFOA 1S1VA 3BUZB 1SS6A 3F2KA 2R7YA 4CJLA 1D9DA 1BOTO 1SQKA 1RDCA 3OA9A 5IWAK 1RDAA 3ID6A 3KLHA 2YNGA 4KTWA 4CFCA 4LF5K 3VEYA 4GV9A 3DWLA 4FK4A 3FR0A 3UKUA 5BRDA 5BRFA 1GOCA 1IO2A 5AQTA 1NKEA 2VQEK 1S22A 1T8EA 2AP1A 4CGJA 1FW6A 3BZKA 3QB0A 1XNRK 3VF2A 1K6YA 2I7PA 2NRRA 4OGCA 1T3VA 3G0ZA 5FRMA 3CD6N 4BRAA 4YOYA 4YHHK 5AR0A 4CJTA 3O1BA 3NAEA 5HRPA 4DLEA 3LALA 5EXWA 4EZ9A 3AA5X 2V7ZA 3C95A 3MXJA 4WQ5A 4C8NA 3SMSA 4DTSA 5KTQA 3OYCA 3IUCA 4FZZA 4H03B 4RW4A 1HLUA 1JCEA 3THWA 3HM8A 1Q9YA 4I6MB 3EZWA 4NO7A 2G8UA 1Q9XA 1HMVA 5GAEP 1U48A 3CMAN 4NYFA 3OTOK 3RMAA 1VSLA 1BO5O 3RR8A 5GAGP 3LZIA 1HJOA 1NGBA 3L2VA 2RE2A 4B1WB 4HUEA 3TAGA 3UKRB 5J1EA 3QNNA 4FCYA 2GBZA 3RRGA 1N34K 3KD1E 3OHRA 1CZBA 4CJWA 1JKHA 4GNIA 4GV3A 4TSXA 3ZETB 4KH4A 4I6MA 4FJNA 4U67L 4CERA 1ZYQA 4W5TA 2G8FA 2BE2A 4WE1A 4DSIA 4JKFA 1TKZA 2HMPA 4ISGA 3UKRA 3HP6A 1BHLA 1T6CA 3ZCMA 1S1XA 3CCVN 1LW0A 2ITGA 3ZSYA 5AQWA 3KVGA 4BRIA 3H3NO 4Y1CA 3AO2A 3KK1A 1JL1A 4MLHA 3HVTA 1A5WA 3OYHA 1NJWA 2KW4A 1ZBSA 1DEJA 1KVAA 3PIOL 2PY5A 4LC9B 1GLCG 2CH6A 4K25A 4PKIA 1NKBA 2QKBA 4DR5K 1J53A 5KPZA 1P8ZA 4FZYA 1WOQA 3WNHA 3CCLN 4OO1J 3K9KA 4OPAA 1CZ9A 1Y97A 2FC0A 4FWQA 4E7IA 3SK3A 1NOYA 1WAFA 4IWVA 3NH2A 4O44A 4H0PA 1DGKN 1NGEA 4KHSA 3CERA 4CJEA 4DTPA 4EZ6A 2FSKA 1XWLA 4FJJA 1J9AA 1U2VB 2QWNA 3DOLA 5CZ2A 4EP4A 3OS1A 3VF4A 4W5RA 3BF1A 2F4VK 1VRTA 3G10A 4RTFD 4N47A 1MWMA 3BZCA 1ATSA 5M1FA 1R0AA 5AQQA 2RPIA 3T1AA 3SZ2A 5JLHA 1C6VA 1W0HA 4RW8A 4RW9A 2OPSA 2BH1A 3MXIA 1TK0A 3T69A 4IKFA 4YOTA 2ZD1A 3VN5A 2E6LA 1U2VA 1GLEG 3BY5A 4IXCA 3AGRA 3HBTA 3OYFA 4FJ9A 1RNHA 4O5BA 3LDSA 4FWOA 1KQSM 2NRVA 1NJXA 4Z4CA 5M1OA 3CC2N 1VQ9N 4X62K 2XY7A 4DSKA 1N33K 2IDOA 4AHCA 2OTJN 1S9GA 1C0UA 1JLFA 3CI5A 3QFUA 3ZT1A 3NE6A 3HL8A 1X9JA 4N76A 3TAQA 4CGIA 1J5OA 2G8KA 3LDPA 1EWRA 4BREA 3E66A 1RT3A 2XO7A 3ENBA 2OPPA 2O8EB 4CJVA 1YHQN 1O1WA 4K8ZA 3HYFA 1LWEA 3T7ZA 2Z1JA 1T6DA 3H45C 5LMUK 1TUUA 3SUOA 3L0QA 3PX4A 1ZBFA 4DQRA 1ASUA 4C8OA 1MA9B 4RG8A 3TTFA 3TTCA 3EE8A 3MMVA 2O8EA 1CZAN 3O4WA 1YITN 4J2AA 3LANA 5CR4A 2QA4N 4CGHA 3L3VA 3CFPA 3PUFA 5FDLA 1RILA 3NF6A 4H0OA 4BE1A 3QEPA 1M1KO 4FYDA 4QS7A 2UUAK 1KFSA 1VRUA 3HO1A 5FPNA 4BRFA 4JEPA 1VQNN 4A5BA 4KTZA 4WCEL 4CI6A 3O9RA 3NGYA 1CLQA 4JI4K 1VQON 4CZJA 1QZ5A 4CEAA 3FLCO 2QWPA 4DTOA 1NK5A 1TL1A 1WBDA 1MU2A 2I7NA 4JYAK 3V9XA 4E1JA 3OYLA 5LL6Z 4DR3K 3WEEB 3NVKA 3DLGA 2D0OA 3P39A 2E4LA 5F2RA 4CFBA 3TANA 1IV0A 4JKHA 4DV5K 3IS9A 1TL3A 4DV0K 2ITMA 5C0YA 3P38A 4F8RA 3V1OA 5AQVA 3LAMA 3A8YA 1NGAA 3V1QA 3C6AA 5FRNA 3CCSN 3DM2A 3V9SA 5SWMA 3P4IA 3WEEA 3IMXA 1R59O 4LSNA 1UWBA 1GOAA 1BWFO 4KTQA 3GL1A 5FLXO 3AVHA 3ZSVA 1NGCA 4CZFA 2B6AA 5AQSA 4Q5VA 3SV4A 4E7LA 2XY6A 3K5OA 1EWQA 3EY1A 4G9ZA 2E20A 2GWJA 5CY4A 4PA1A 4FLTA 1M90O 1UOCA 4EHTA 1YJNN 2E1ZA 4FZXC 4CZGA 1L3UA 1VQ8N 4H4MA 1QQOA 1RTIA 4GY2B 3KKSA 3QEIA 3JSMA 4IFYA 1QTMA 3G4SN 3LAKA 3IG1A 4JRPA 3DMJA 1IKWA 4YORA 4JHDB 2DY4A 3P31A 5AQYA 2O8BB 1YTAA 2X6SA 3S41A 1LOTB 2ZF5O 4KHNA 1Z26A 3OYNA 3MXMA 3DLKA 5EU7A 4K8XA 1JXEA 4BDYA 3WXJA 3O3GA 3CCRN 1NGHA 4XEIA 4JD2B 1NK4A 1TK8A 3CQ8A 4JHDA 2O8BA 4HTUA 1N5YA 3E9PA 1B92A 1BCOA 3R9PA 5J2QA 1IH7A 2NRHA 4JLHA 1S1WA 3C7NB 3RWUA 2D0AA 1RBVA 5C24A 1NK0A 2A1SA 1HPMA 4K42A 1YJWN 2P5GA 3J7AP 4BR0A 1XMOK 3R6MA 1RGIA 1ZC6A 4W5QA 5GIPA 1JLBA 4RW6A 3SJHA 5E26A 1RT7A 3H3OB 4R79A 4IFVA 1TKTA 3VEOA 1HNIA 4LF8K 3C7NA 4E7KA 4DU1A 1OH6A 1NGIA 3TAMA 2NRXA 3PIPL 4NYNA 2WTUA 1QQNA 3P5JA 3L2QA 5FPMA 1KRPA 4DTJA 1Z6RA 2JWLA 2YHWA 2WBNA 4CZLA 3HI0A 3AA3A 3O80A 3LP0A 1OVYA 4MDBA 5AFUA 1V4TA 4FJGA 2OZMA 3L2RA 4FL9A 3NBPA 1TKXA 4CEZA 4PUOA 3TWHA 4JRQA 1RFQA 2PFUA 4BRLA 4AHRA 1RCHA 3VMFB 3UE5A 2G8IA 3LWLA 5J2MA 4J2EA 1TK5A 4DV1K 2P9KA 2RN2A 1C0MA 1ATRA 3LWMA 3VERA 3M1FA 1JCGA 4FM1A 4JNEA 1RDWX 1VQKN 1Q82O 2B4JA 1FJGK 2ZWHA 5C25A 1TVRA 4FWSA 3ZSRA 4B3SK 4B1VA 3VQPA 5SZTA 1FKOA 5GAHP 2KQ2A 2BDPA 4GVEA 5JVHL 4AQYK 3WXIA 2ZE2A 4A62A 3AO4A 1YTUA 2QKKA 1U4BA 4DUZK 4QOZB 1WAJA 4O8KA 3NF9A 3O9SA 1U04A 2D5RA 2E2NA 1NNEA 4KBOA 3VQCA 3SQ1A 4FK2A 4JKBA 2JWKA 3ASMA 1S1UA 4CIGA 1KLNA 5CE3A 3T1YK 4DHYA 2Q0UA 3V9ZA 1WUAA 2PZSA 4B1UB 1X1PA 4CBUA 4CIEA 4YOXA 1MWKA 2X74A 5AQJA 1UA1A 2Z1IA 4JV5K 2BANA 1TV6A 1S1TA 4CIFA 3QEWA 3NGIA 1G15A 4KH5A 4YY3K 2FF3B 1SL2A 3K5NA 4DR6K 4BRKA 4CD3A 1GLDG 1G99A 4Z4HA 4FJLA 3HM9A 3ENHA 4CHNA 1EXQA 4OLAA 4JS5A 4RW7A 1N32K 4OGEA 1C1BA 5HL7L 3FGUA 3U3GA 4ILJA 2OA8A 1JLQA 5ELZA 2CGJA 1VQ7N 1IG8A 1EETA 3ZT3A 4YDUA 4H0YB 4CVNE 4DQQA 4JKEA 4J8FA 3KLGA 1GLBG 5AQFA 5AQPA 2P9IA 4BRQA 3Q7BA 2IGIA 3LDNA 5DK5A 3DRSA 1Y64A 3ZX0A 3THVA 3CIPA 4FJKA 3E1YA 3ATVA 1NGGA 1RTJA 2YHAA 3T19A 1JXBA 2PAVA 3O9QA 3D45A 2HOEA 2J4RA 1HNZK 3NF8A 4FM2A 1T05A 4WQ5C 4FJXA 1IKYA 1BUPA 2JLEA 1U6ZA 4CK1A 4LF7K 3ID8A 1BI4A 1K8KA 4H5WA 3U9ZA 3SQ0A 2NRZA 4DV7K 4MDAA 3SPYA 5K14A 1REVA 5J2NA 3LDLA 3VQ4A 4BE0A 4BDPA 3VETA 5KQ8A 1SL0A 2NLXA 2G8WA 1JLCA 4NCAA 3THWB 2ZJQL 4JKAA 3ZSXA 3CJ9A 4BQZA 2PYLA 3AAQA 3K2PA 1OH8A 4PQUA 3K59A 1HYSA 4EFHA 4Z4FA 3GE1A 4DV4K 2P9PA 1FK9A 2WC9A 3VQ9A 1TYQA 4RWTA 2Q97A 3PSIA 2QWQA 4DS5A 4KKOA 1VSKA 4H5TA 3UIQA 3HPGA 4FK0A 4BRPA 4DR7K 3AARA 2P9NB 4NB4A 3EN9A 2Q36A 3HXMA 2KLAA 3GDQA 3WNGA 4FLXA 1WN7A 4OVLA 2WOMA 3WT0A 2VWBA 3RSEA 1T03A 1NLVA 3VA3A 4HCBA 2F9WA 4B9TA 5I3UA 4ISFA 1SL1A 5JICA 3OJSA 4GKJK 3IDHA 2W6KA 5E41A 4IBNA 3DI6A 4LFBK 3NDKA 4B9VA 2CGLA 3QDKA 2P9NA 3P83D 4N41A 2GELA 4AHSA 3F73A 2HNZA 1NMNA 4IEIA 5AQRA 4OX9K 3OW2M 4KHQA 3H08A 4DV3K 4GVMA 4BRNA 4JS4A 5JLFA 1D4XA 4CHPA 1JCFA 2GUIA 4DR1K 1NJIO 1B9FA 3KZBA 3JAMO 4IOXA 4CF2A 1JL2A 2F9TA 3NH0A 3S3OA 2YNHA 3V81A 3B8AX 4IDKA 3U4LA 4F3OA 5ADXA 3LM2A 3BP8A 4WF9L 5FPDA 1ESVA 3LM9A 2PBDA 1KVBA 2P9LB 1TKDA 2V7YA 1RBTA 4DB3A 3TABA 4JI8K 5DM6L 1ZBUA 3QICA 3NCIA 4DKWA 3HOSA 2HBKA 3D6RA 2YCHA 3SPZA 4B3OA 2A42A 5EY4A 1Z05A 3TAPA 3PLAA 2P9LA 3CPEA 1DLOA 5H1SQ 4FWLA 4PY5A 3BDPA 1N36K 2DPNA 4FW1A 3I8DA 4FWMA 5EX5A 1UA0A 4E7JA 4IO8A 2QWRA 3CC4N 1TUYA 3O6WA 4CHYA 2DFHA 1HRHA 1KLMA 3DXMB 5KRSA 1KSPA 2BGGA 4JK8A 1DKGD 4U7BA 5LY3A 1XHXA 2OZSA 1J54A 3DLLL 1VQMN 4CGFA 2QTDA 4CGDA 3AO3A 3J80O 2BTFA 1GOBA 3A5MC 5AQGA 3MECA 1EP4A 1VSEA 4DS4A 3THYB 4E0DA 4CJ3A 1OVQA 3DXMA 1WNSA 4B1YB 4L3QA 3AVCA 5JS1A 1C0GA 1TAQA 3OYJA 4PKHA 3WXLA 4DF4A 2P9UB 1NJYA 2Q0RA 4DTUA 4O0IA 5BR9A 3K5LA 4CZKA 2D0PA 2HBMA 4KHYA 4ZTFA 4CFDA 4BVPA 3THYA 3C65A 3J81O 2V51B 2ZM6K 5C10A 1KCFA 4BGAA 4ICLA 3CMEN 3TR8A 5KI6A 4A2AA 4CJPA 2AA4A 1RTHA 2P9UA 3RMDA 1BGXT 5KPTA 3SUPA 4B1ZA 3AVKA 4BGBA 4FPBA 1WSEA 4NLCA 1O13A 3DLHA 4FJ5A 4KHPK 4OKEA 2ZGZA 4BY9C 3I33A 4BR9A 4CZMA 4H5RA 4CF0A 3NH1A 2VGNA 3K57A 4CK3A 4I9LA 3OYBA 4L8RB 2HNDA 2WONA 1BG3A 1NBWA 3TI0A 3JS6A 4XIUA 4LD0A 4WQ4C 1OH5A 4N5SA 2W42A 3AV9A 5AQZA 3DJCA 3IAYA 3NFAA 1RT5A 1QVGM 4EAHD 2ZJPL 2KHOA 2HHHK 1RBSA 1XNQK 1S6QA 4ELVA 3RRHA 4NXMK 3VPZA 5KQDA 3THXB 2GV9A 3KTQA 3L6QA 3M8PA 3KLFA 4M3XA 5HBMA 5MLCQ 4KV8A 2FBXA 3TSPA 4H8KA 4CBXA 4QCLA 1OH7A 1SUQA 5M1NA 5T7BA 2IOCA 2IIRA 1RBUA 4CGGA 4LH5A 4KB1A 2VWKA 4JI1K 4YOVA 4DQ8A 4FJIA 1XC3A 2KZMA 2KKZA 3ITHA 4QS9A 4RCHA 4B1XB 3ZT0A 2HHUA 2HMIA 2ASMA 1SV5A 3TARA 3CQYA 3THXA 4GV6A 2XY8A 4CJ4A 5M1PA 5C2FA 3GG4A 1YVNA 3S9HA 4KI6A 3FFKB 4FLZA 4FJMA 1IBKK 3U8XA 4CJRA 2NUBA 3BEXA 4KPYA 3HJFA 1HPZA 4BC4A 2E88A 1BQNA 4CJSA 4FM0A 3G25A 3PO4A 4HHTA 4XH1A 2YNFA 4A57A 3V6DA 4H5VA 4CJKA 3CCMN 2W6LA 3BGRA 3SNNA 4JI6K 3SAHA 4DG1A 1NMDA 1LV5A 2YX6A 1WSGA 2YKNA 4ELUA 2RKIA 3LDOA 4CJ7A 1BA1A 1ZBIA 1IBLK 5LJWA 5BN9A 1QVFM 3QETA 1NK8A 1NK7A 2OPRA 4F3TA 4X65K 1KTQA 4ILHA 3WXMB 4CD1A 3TU5A 4FSVA 4DLGA 4HTLA 3SLCA 2B5JA 1QQCA 1D8YA 4CZIA 4FWNA 4OKJA 3A5NC 4FLUA 4KO0A 4MLEA 1ITGA 2YHYA 2G8VA 3T1HK 4E3SA 3HP9A 4KFBA 2D4WA 1EKEA 4HWIA 3QBWA 4PL7A 3OBYA 2CGKA 4HUFA 4DQPA 4F9OA 3QNOA 2KFNA 3CPWM 4KRFA 3MEEA 4UQGA 3EKSA 1XI1A 4GMJB 4E7HA 1MDUB 3KK3A 4BRGA 4IEEA 3ZLJA 3I0SA 4CEBA 4IDHA 5HRNA 2O4IA 3CXCM 2Q31A 1Z25A 2IVNA 2HHQA 4DTNA 2W40A 3HSCA 3LP1A 1U45A 1YIJN 1NK6A 1QZ6A 2P9KB 4Z4IA 4E1MA 3Q7CA 4GW6A 4I2QA 4N56A 3E9LA 1QQMA 5DMRA 5AQIA 2Q3SA 4CESA 4DCHA 3NHGA 2Y1IA 2QXFA 3KHYA 5C42A 4CF8A 3D2EB 4LFAK 3K0SA 1DTQA 5DM7L 4FPAA 3RTVA 2HHXA 2VCPA 1ZXOA 3IRXA 1ASWA 5BPNA 4JKDA 4PWDA 2UUCK 1BU6O 3KD5E 3A0IX 3I8BA 2X78A 3VEZA 2F8TA 4FJ8A 2OTLN 3ATUA 2ETJA 3H1QA 4GKKK 4CEFA 3PO5A 3D2EA 5AQXA 3PV8A 3LDQA 2Z1HA
chains in the Genus database with same CATH topology
4WFAL 4YOTA 4EFHA 1U2VA 1GLEG 3HOTA 1GLAG 3M3ZA 3GE1A 4IXCA 1K8AO 3AGRA 2P9PA 3HBTA 1RDUA 2NZTA 2WC9A 3KK7A 1TYQA 5TKYA 4RWTA 2Q97A 3TSUA 2QWQA 4FWOA 1C0FA 3HZ6A 2NRVA 1KQSM 5M1OA 2NRWA 2A3ZA 2V52B 4H5TA 2QWMA 5M1QA 1VQ9N 3CC2N 3VEXA 4BC2A 4BRPA 1LCUA 5E84A 3AARA 1HKCA 3ZEUA 2P9NB 4NB4A 2OTJN 1V4SA 3EN9A 1DT9A 2Q36A 2KLAA 3CCJN 3CI5A 3GDQA 3QFUA 1YXQA 1Q18A 3WT0A 1X9JA 2E2OA 4C1NK 2VWBA 3O9UA 3LDPA 3RSEA 3ZYYX 1NLVA 4BREA 3CCQN 3E66A 4YDUC 2F9WA 5AQLA 4ISFA 3ENBA 3M5RA 5JMVA 5JICA 2FLOA 3IDHA 1YHQN 2A41A 1EQYA 3FZFA 3HTVA 3N4PA 4IO9L 1NM1A 3L4IA 3T7ZA 1J6ZA 1VAZA 1T6DA 2CGLA 3H45C 3H6EA 3QDKA 2P9NA 5AQNA 2FSNA 2GELA 3VEWA 4C23A 4JKGB 1TUUA 3R8EA 3L0QA 4IEIA 5AQRA 3OW2M 2WFBA 4PKGA 1MA9B 4CZEA 1S3XA 4YOWA 2P9IB 4BRNA 3TTFA 5JLFA 2VYPA 3TTCA 1D4XA 3EE8A 3MMVA 1CZAN 1JCFA 3O9TA 3F9MA 3GOIA 2E2QA 3O4WA 5CR4A 3VEVA 2QA4N 1YITN 1NJIO 1ATNA 1NGFA 3MX2A 4IJAA 3KZBA 3MCAB 3VGMA 1NGDA 1YUWA 3J8AA 4H0OA 1IJJA 1HKGA 1Q7YO 4IOXA 2FSJA 4A59A 1M1KO 4JKGA 5I9EB 2F9TA 3TPQA 4QS7A 3MCPA 4PL8A 4BVOA 3B8AX 3U4LA 5FPNA 4BRFA 3G71N 5ADXA 1NWKA 3EL2A 3LM2A 4JEPA 5BN8A 1VQNN 1JJ2M 3BP8A 4YOUA 5C15A 4A5BA 2GTDA 4WF9L 1K8KB 4JN4A 5FPDA 1ESVA 1GLFO 2PBDA 3LM9A 4WCEL 4JD2A 3D7EO 3O9RA 4CI6A 2P9LB 2Q2RA 2V7YA 4FVUA 3UB5A 4DB3A 4BR7A 1YAGA 3DAWA 4CZJA 5GINA 1KXPA 1QZ5A 5HOOA 5DM6L 1VQON 3CJBA 3QICA 3FLCO 2QWPA 2A6AA 4NLBA 5BRHA 4DKWA 2YJFA 4XH4A 3HOSA 4B9QA 3OBWA 2I7NA 2HBKA 3D6RA 4EHUA 1GLLO 2YCHA 4FWKA 4E1JA 2OANA 2A42A 3WEEB 3NVKA 2YHXA 5EY4A 1Z05A 3DXKB 2D0OA 3P39A 4FOIA 3CCEN 1ILYA 5F2RA 3C0BA 2CH5A 2IVPA 3ENOA 4FWRA 3VOVA 3PLAA 2P9LA 3CPEA 4JKHA 3A5OC 5H1SQ 4FWLA 5JVGL 4M63C 2ITMA 5C0YA 3P38A 3QMLA 5AQKA 2P9PB 3AY9A 5EVZA 5AFUH 3N4QA 4FOEA 5FPEA 5AQVA 4BRDA 1VQLN 3A5LC 1TYQB 2DPNA 2HF3A 3W3DA 3A8YA 1NGJA 1NGAA 4FWMA 3C6AA 4Z94A 1HKBA 3CCSN 5EX5A 1VQ5N 1KC8O 4BROA 2W41A 4QS8A 4IO8A 2QWRA 5AQOA 1TUYA 3O6WA 3CC4N 3P4IA 1P90A 3WEEA 3BF3A 3IMXA 2GWKA 3DXMB 3DXKA 3NVMA 3AAPA 1R59O 3HRGA 4JK8A 1DKGD 3H46O 4K43A 4A5AA 1BWFO 3RSEB 3CQXA 5EOYA 4U7BA 5LY3A 3GL1A 3DLLL 1K9MO 4ILGB 1VQMN 1NGCA 4CZFA 2QTDA 5AQSA 3SAFA 3WUHA 4K41A 3MWTA 3WXKA 4MO4A 2BTFA 2GX9A 4IOCL 3A5MC 5AQGA 4G9ZA 2E20A 3MN5A 2ZGYA 1HX1A 3CJCA 2GWJA 3KWIA 4AM7A 3E9OA 3NMUA 5BREA 2QWOA 1M90O 3DXMA 4EHTA 1YJNN 4WFNL 3SAGA 1W97L 2E1ZA 3VF6A 4B1YB 4CZGA 4H0VB 1VQ8N 1YF5L 4IZ9A 4L3QA 4O8UA 5KPRA 1EO1A 4H0TB 4H0XB 4AM6A 4WFBL 1QQOA 1C0GA 4GY2B 5AZJB 4PKHA 3WXLA 2HF4A 3G4SN 2P9UB 2Q0RA 4EIAA 4YORA 5BR9A 3FE1A 1VQPN 4JHDB 3CJ1A 3P31A 5AQYA 4CZKA 5AQMA 2D0PA 2HBMA 4UY8O 3CJAA 3RVCA 2P9SB 3S41A 1LOTB 4BVPA 3FZKA 2ZF5O 4M7XA 3C65A 4IJNA 2V51B 5C10A 4BGAA 4BR4A 2FF6A 4FO0A 3CMEN 3WXJA 5LJVA 2HBJA 3IKMA 1N8RO 3MWPA 2H3GX 2EWSA 5AZJA 2BUPA 4A2AA 3CCRN 1NGHA 4XEIA 3TTDA 3I55N 2AA4A 1YI2N 4JD2B 2P9UA 3O8MA 3U9DA 2HSTA 3QBXA 4A2BA 5C12A 4JHDA 1Q86O 3CJ7A 4ISEA 4AF1A 5CHIA 3MDQA 5KPTA 1KD1O 4CZHA 3E9PA 4B1ZA 2P9SA 1S72N 4JK9A 4BGBA 5F1XA 4FPBA 3H1VX 2IVOA 1O13A 3GBTA 4NLCA 3R9PA 3CCUN 3MX5A 2NRHA 1VQ6N 1X3NA 2ZGZA 4IFEA 4BY9C 4H5NA 3C7NB 3I33A 4BR9A 2F7TA 4CZMA 4H5RA 1HPMA 4K42A 1YJWN 2VGNA 4BR5A 3IFRA 4Y0WA 1XUPO 3VTHA 4BR0A 3R6MA 4BRCA 1RGIA 1H1VA 1KAYA 1ZC6A 4CBWA 4FWPA 4A61A 5GIPA 3ULEB 1BG3A 1NBWA 3JS6A 2QI2A 2E1YA 4WQ4C 3SJHA 5E26A 3ZETA 2GEMA 1T44A 4MO5A 5C2DA 3H3OB 4R79A 4O5FA 1KAZA 3VEOA 3VTIA 3VESA 5AQZA 2E8AA 3C7NA 2QW9A 3DJCA 5AQUA 3SMPA 1QHAA 1NGIA 3LL3A 2NRXA 3PIPL 3KWGA 4KH6A 2ASPA 4EAHD 2ZJPL 1QVGM 3O5BA 1QQNA 5BPMA 2E2PA 5FPMA 3VGLA 1VQ7N 4JKCA 2KHOA 1Z6RA 2JWLA 1HUXA 3VENA 3FZLA 2YHWA 2WBNA 4CZLA 3HI0A 3UKUB 1OKJA 3ULEA 2Q1NA 3MN7A 3O80A 2NRTA 3W0LA 5GADP 4BG9A 3CETA 3SBTA 3VPZA 5KQDA 1OVYA 3AGKA 4MDBA 5AFUA 2ZJRL 1X3MA 3WQUA 4BRMA 2UYTA 3L6QA 1V4TA 3JXUA 4FL9A 3BUZB 1SS6A 3F2KA 3F5TA 5MLCQ 3J7ZO 3TSPA 4BR2A 4CBXA 1BOTO 5B8HA 1SQKA 3I56N 3OA9A 5M1NA 2IIRA 3G6EN 3ID6A 4YOVA 3EKUA 4DQ8A 1XC3A 3MN6A 3VEYA 1RFQA 4GV9A 2KKZA 2PFUA 3DWLA 4BRLA 3VMFB 4QS9A 4RCHA 3UE5A 4B1XB 3FR0A 3UKUA 3O08A 5BRDA 2ASMA 5BRFA 2P9KA 5TKWA 5AQTA 4XH5A 1S22A 3CQYA 2AP1A 1ATRA 4GV6A 5M1PA 3QB0A 2VGMA 1YVNA 3GG4A 3VERA 5C2FA 3VF2A 2I7PA 3M1FA 1SAZA 3FFKB 2NRRA 1JCGA 1SZ2A 3CF5L 1T3VA 4IOAL 3CD6N 4JNEA 1E4GT 1RDWX 3U8XA 4BRAA 5F0XA 4YOYA 1VQKN 1Q82O 3BEXA 5AR0A 3MN9A 2ZWHA 3O1BA 4BC4A 4FWSA 2E88A 3G25A 4B1VA 4XH1A 2D1KA 5EXWA 5GAHP 4A57A 4H5VA 3CCMN 2V7ZA 2NNWA 3SAHA 4GVEA 3SBGA 4WQ5A 5JVHL 3FZHA 3WXIA 1NMDA 3SMSA 4A62A 2YX6A 3IUCA 2A5XA 4CJ7A 3LDOA 1BA1A 4H03B 1HLUA 4O8KA 3O9SA 1JCEA 2E2NA 3HM8A 5AQXA 3WQTA 4I6MB 2YI1A 3EZWA 3K9JA 3R1XA 4KBOA 2QM1A 4JKBA 4NO7A 5BN9A 5LJWA 1QVFM 2JWKA 5GAEP 5CE3A 4PHTX 3CMAN 4DHYA 3EO3A 2Q0UA 3ZX2A 1K73O 1WUAA 1VQ4N 4B1UB 1BO5O 4ILHA 3WXMB 4CD1A 4CBUA 5GAGP 1HJOA 1NGBA 4YOXA 1MWKA 4JK7A 2RE2A 3TU5A 4B1WB 4FSVA 5AQHA 4HTLA 5AQJA 3UKRB 2QEXN 3SLCA 2FXUA 3OHRA 4CZIA 4FWNA 3D2FB 4GNIA 3A5NC 4MLEA 4GV3A 3L4QA 3ZETB 2YHYA 4KH4A 2WUSA 4I6MA 4U67L 4KH5A 1GLJO 2FF3B 4WYBA 2D4WA 4JAXA 4HWIA 4OPHA 4BRKA 4CD3A 1GLDG 1G99A 4BC5A 3QBWA 4PL7A 3OBYA 3ENHA 2CGKA 4JKFA 4BRHA 4M7YA 2HMPA 4F9OA 1XQSC 4ISGA 5AZIB 3UKRA 3CC7N 3CPWM 5HL7L 1T6CA 3FGUA 1BDGA 4ILJA 2QWLA 3D2FA 3EKSA 3CCVN 5ELZA 5AQWA 2CGJA 3KVGA 1IG8A 1MDUB 4BRIA 3C6HA 3H3NO 3TSQA 2ASOA 4IEEA 4BRGA 4YDUA 4BQLA 4H0YB 4MLHA 4IDHA 3CXCM 4JKEA 2Q31A 4J8FA 5BPLA 1GLBG 1ZBSA 5AQFA 5AQPA 2IVNA 1DEJA 2P9IA 4BRQA 5ADXH 3PIOL 4BC3A 2W40A 1E4FT 3HSCA 1GLCG 2CH6A 4K25A 4LC9B 4PKIA 3Q7BA 3FZMA 5AZIA 3LDNA 1YIJN 2YJEA 1Y64A 5KPZA 1P8ZA 1QZ6A 1WOQA 3ZX0A 2P9KB 2HBLA 3CCLN 4OO1J 3K9KA 4OPAA 3CIPA 3Q7CA 3E1YA 3ATVA 1NGGA 3E9LA 1QQMA 3R3LA 4FWQA 2PAVA 5AQIA 3O9QA 3SK3A 2HOEA 2J4RA 4C1NI 4IWVA 4DCHA 3CHWA 4WQ5C 1BUPA 4H0PA 1DGKN 1KAXA 1NGEA 1U6ZA 3KHYA 3ID8A 3CERA 3D2EB 1K8KA 4BG8A 2FSKA 4H5WA 3U9ZA 2NRZA 4FPAA 5DM7L 1W2BM 3EE9A 4MDAA 1U2VB 2QWNA 1YJ9N 2VCPA 1ZXOA 3LDLA 5BPNA 3VF4A 3BF1A 4JKDA 3VGKA 1Q81O 1BU6O 3VETA 3A0IX 5KQ8A 4RTFD 3MK6A 5M1KA 3I8BA 1MWMA 3VEZA 1ATSA 2GUPA 2NLXA 5M1FA 5AQQA 3ZX3A 2OTLN 2A40A 3ATUA 5JLHA 1BA0A 3ZEUB 2QXLA 3H1QA 5GIOA 3M6GA 2RHKA 2ZJQL 4JKAA 4WQ4A 2BH1A 3CJ9A 3QFPA 4BQZA 3D2EA 3T69A 3AAQA 3LDQA 3O1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRR A;  2NRZ A;  2NRX A;  2NRT A;  2NRV A;  3C65 A;  2NRW A; 
#chains in the Genus database with same CATH topology
 3ZSZ A;  1F21 A;  1ZBH A;  3OYI A;  3HOT A;  3M3Z A;  1K8A O;  1RDU A;  3SQ2 A;  1RT2 A;  5FRO A;  3S3M A;  3V9W A;  1C0F A;  3HZ6 A;  2NRW A;  2A3Z A;  2V52 B;  5J2P A;  2QWM A;  5M1Q A;  3VEX A;  4BC2 A;  1FXX A;  5E84 A;  1HKC A;  2FBV A;  1V4S A;  3I0R A;  1YXQ A;  4C1N K;  3O9U A;  3ZYY X;  4FLY A;  3CCQ N;  4YDU C;  5CZ1 A;  4CHZ A;  1TGO A;  5AQL A;  3M5R A;  4IG3 A;  4DFP A;  5JMV A;  3O4N A;  1EQY A;  4Z0U A;  4K0K K;  2JGU A;  4IO9 L;  1NM1 A;  3L4I A;  3VEW A;  5AQN A;  2FSN A;  4C23 A;  3KLE A;  4JKG B;  3VA0 A;  3R8E A;  1QE1 A;  3P1G A;  3AVI A;  3KLI A;  2WFB A;  4PKG A;  4CZE A;  1S3X A;  1VSD A;  2P9I B;  3AA4 A;  5CYQ A;  3OYM A;  3KJV A;  4FVM A;  3F9M A;  3GOI A;  2OYQ A;  4CEC A;  1NGF A;  3MX2 A;  4OPJ A;  3VGM A;  3J8A A;  3PX0 A;  1IJJ A;  1SKS A;  4QAG A;  2YNI A;  2FSJ A;  4DR4 K;  4JKG A;  5I9E B;  3TPQ A;  1IKV A;  3MCP A;  4BVO A;  1S9E A;  4CK2 A;  1U47 A;  1HR0 K;  4B08 A;  1WSI A;  1VSM A;  3EL2 A;  1HNW K;  4DV2 K;  1JJ2 M;  4YOU A;  5C15 A;  2GTD A;  4DFJ A;  1BI4 B;  1K8K B;  4KI4 A;  3HVR A;  3D7E O;  5LMN K;  3SI6 A;  1JLG A;  2UXC K;  4FVU A;  1HYZ A;  3UB5 A;  4BR7 A;  1YAG A;  2YV0 X;  3DAW A;  3DYA A;  5GIN A;  1KXP A;  5HOO A;  3CJB A;  2G8H A;  2A6A A;  4NLB A;  5BRH A;  2P5O A;  4DSF A;  2Y1J A;  1Q8I A;  4XH4 A;  4I7F A;  2UU9 K;  3OBW A;  5AJ3 K;  3B6P A;  4EHU A;  1X9S A;  4FWK A;  1NJZ A;  4F2R A;  4B3M K;  2YHX A;  1LWC A;  1QHT A;  1ILY A;  2XHB A;  3C0B A;  3ENO A;  3VOV A;  4FWR A;  4HVJ A;  3A5O C;  5JVG L;  5AQK A;  2P9P B;  3AY9 A;  5EVZ A;  3ZSQ A;  5AFU H;  4YFU A;  4FOE A;  4BRD A;  3A5L C;  1TYQ B;  1U49 A;  2HF3 A;  4B8C A;  1NGJ A;  1VQ5 N;  1DTT A;  5AQO A;  3M8R A;  4OKK A;  2DFE A;  3NVM A;  2GWK A;  1SKW A;  3AAP A;  3WNF A;  3H46 O;  3QIP A;  3CYM A;  5EOY A;  3RSE B;  4CEQ A;  3AO5 A;  4B9U A;  3A2F A;  1ASV A;  3SAF A;  3WUH A;  3QER A;  2D0B A;  3MWT A;  3WXK A;  4M45 A;  4KB0 A;  2GX9 A;  5BR8 K;  3ZSW A;  3CJC A;  3KWI A;  3OJU A;  1CXQ A;  3NMU A;  5BRE A;  2QWO A;  2LSN A;  3OYK A;  3SAG A;  4H0V B;  3AO1 A;  4H0T B;  4H0X B;  4AM6 A;  5AZJ B;  4EIA A;  1T7P A;  3FE1 A;  1VQP N;  3CJ1 A;  5HP1 A;  4UY8 O;  3HT3 A;  1I3A A;  1IBM K;  2P9S B;  3V1R A;  3FZK A;  5CYM A;  4M7X A;  1ZBL A;  1BQM A;  3QEV A;  3VQE A;  2KFZ A;  4BR4 A;  2FF6 A;  4LSL A;  3OYE A;  3ISN C;  4M41 A;  3AVG A;  4CJU A;  3MWP A;  2HHW A;  2H3G X;  5AZJ A;  2BUP A;  3OYA A;  4W5O A;  2HVI A;  1YI2 N;  3O8M A;  4DTX A;  2HST A;  4ZHR A;  3V4I A;  5KRT A;  4NCB A;  5C12 A;  1Q86 O;  1L3V A;  4ISE A;  4AF1 A;  3MDQ A;  1X9W A;  4CZH A;  3L2W A;  1S72 N;  2P9S A;  2IVO A;  3CCU N;  4DFM A;  3RR7 A;  3MX5 A;  1VQ6 N;  1X3N A;  4H5N A;  3SV3 A;  3AVB A;  2F7T A;  4I2P A;  1FKP A;  4CJQ A;  1S5J A;  4BR5 A;  3IFR A;  4CJF A;  3VTH A;  1L3T A;  3M8S A;  4BRC A;  4NXN K;  4FWP A;  2OCE A;  4A61 A;  3ULE B;  4DTR A;  4B9N A;  1XMQ K;  4BE2 A;  2QI2 A;  3KKR A;  3DRP A;  2E1Y A;  3ZET A;  3TAE A;  2GEM A;  1T44 A;  4BAC A;  5C2D A;  4O5F A;  1X9M A;  1KAZ A;  2YHB A;  3VES A;  2O8C B;  2E8A A;  2QW9 A;  5AQU A;  4DQI A;  4O4G A;  2ASP A;  4X64 K;  4CF1 A;  3VGL A;  3DLB A;  4BWM A;  3VEN A;  4IG0 A;  3U6F A;  4R5P A;  3ULE A;  2Q1N A;  3VQA A;  1LW2 A;  2NRT A;  4AHV A;  3SCX A;  1LAV A;  5GAD P;  3CET A;  2ZJR L;  1QSL A;  1WSJ A;  3WQU A;  4BRM A;  2UYT A;  2O8D B;  3JXU A;  3F5T A;  2O8C A;  4DSJ A;  2Z1G A;  3J7Z O;  4BR2 A;  5B8H A;  3I56 N;  3G6E N;  1VK0 A;  1VHX A;  3EKU A;  4ZTJ A;  3MN6 A;  1I94 K;  3O08 A;  3AVN A;  1BIS A;  5TKW A;  2UXD K;  3T3F A;  4XH5 A;  4ID1 A;  2O4G A;  1J5E K;  2O8D A;  2VGM A;  1SAZ A;  2HHS A;  2UXB K;  3K5M A;  1KFD A;  4G1Q A;  1SZ2 A;  2FBY A;  3CF5 L;  4CHO A;  4IOA L;  5KGX A;  5F0X A;  1E4G T;  3MN9 A;  3S3N A;  2F8S A;  3VQ5 A;  3EYZ A;  4FJ7 A;  3SJJ A;  4CFA A;  2D1K A;  3VQ6 A;  1W7A A;  4B9L A;  3AA2 A;  2NNW A;  3SBG A;  1WB9 A;  3FZH A;  1LAW A;  1BL3 A;  4DU3 A;  2A5X A;  1NK9 A;  4KAZ A;  3CFR A;  4YNQ A;  3EEQ A;  4DFK A;  3WQT A;  4BRO A;  2YI1 A;  3R1X A;  3K9J A;  4C8M A;  3OS2 A;  2QM1 A;  2HW3 A;  3ZT4 A;  3LPU A;  4PHT X;  2D0C A;  3EO3 A;  3ZX2 A;  2VQF K;  1K73 O;  1VQ4 N;  4DMN A;  4LY7 A;  1WBB A;  1NKC A;  2F96 A;  3RMC A;  4JK7 A;  3OS0 A;  2A1R A;  5AQH A;  3RMB A;  2DFF A;  4JI7 K;  2QEX N;  3PX6 A;  2FXU A;  3K58 A;  1JLE A;  1C0T A;  4M3T A;  3HK2 A;  1BIU A;  3D2F B;  2ATQ A;  3L4Q A;  2WUS A;  3DLR A;  3OY9 A;  1BCM A;  4ID5 A;  1GLJ O;  3TAF A;  4WYB A;  3C94 A;  4JAX A;  4OPH A;  4BC5 A;  3SUQ A;  4Z4E A;  4BRH A;  4AIL C;  4M7Y A;  3O3H A;  2UUB K;  1XQS C;  4M42 A;  1RBR A;  5AZI B;  3NGZ A;  3CC7 N;  3QES A;  4LF4 K;  1BDG A;  1W9H A;  4E1N A;  2QWL A;  3D2F A;  4AHT A;  1VSI A;  3C6H A;  3TSQ A;  2ASO A;  4DUY K;  3B6O A;  4BQL A;  4O55 A;  5BPL A;  4JI5 K;  4M3R A;  2O8F B;  5ADX H;  5A2Q O;  4BC3 A;  3QEX A;  4CE9 A;  1E4F T;  1Q7Y O;  1XC9 A;  3FZM A;  5AZI A;  4CW7 B;  2YJE A;  4B9S A;  3AVM A;  1L3S A;  2HBL A;  4F4K A;  4OJR A;  1L5U A;  2OPQ A;  2VG7 A;  4AHU A;  4DU4 A;  4KHW A;  3R3L A;  4CED A;  2HVH A;  2KTQ A;  4C1N I;  3AVA A;  5HRS A;  1S6P A;  3CHW A;  2O8F A;  1KAX A;  3MAQ A;  2IAJ A;  3EZ5 A;  4BG8 A;  1W2B M;  3EE9 A;  1SKR A;  3DOK A;  3O4Q A;  1YJ9 N;  3AVF A;  3OVN A;  5KGW A;  3SUN A;  3VGK A;  1Q81 O;  4DQS A;  3KIO A;  4B3T K;  2IS3 A;  3ULD A;  4C8L A;  4HUG A;  1CXU A;  3MK6 A;  5M1K A;  2GUP A;  4JI2 K;  3M8Q A;  3ZX3 A;  2A40 A;  4O0J A;  1BA0 A;  3ZEU B;  2QXL A;  2XRI A;  5GIO A;  3M6G A;  1LWF A;  2RHK A;  3ZSO A;  4WQ4 A;  4BDZ A;  3QFP A;  3CM6 A;  3O1W A;  4CF9 A;  4WFA L;  1NG9 A;  5I42 A;  1GLA G;  3QIO A;  2NZT A;  3KK7 A;  1RT4 A;  3HPO A;  5TKY A;  4B8A B;  3TSU A;  4H4O A;  1VSH A;  3HST B;  3V9U A;  4KHU A;  4E89 A;  1LCU A;  3ZEU A;  3OYG A;  4X66 K;  1DT9 A;  3CCJ N;  1VSF A;  1I39 A;  4LF6 K;  1UAX A;  1Q18 A;  2E2O A;  3VQ7 A;  1KVC A;  1D9F A;  3O3F A;  2FLO A;  3VQ8 A;  4JI3 K;  2A41 A;  3QLH A;  3FZF A;  3HTV A;  3N4P A;  1XHZ A;  2IC3 A;  1J6Z A;  1VAZ A;  4C8K A;  3H6E A;  5JS2 A;  3J7Y P;  3KK2 A;  1VSJ A;  3L8B A;  2PYJ A;  3L3U A;  5HLF A;  3AVJ A;  4B3R K;  4E19 A;  4YOW A;  2DTU A;  2VYP A;  4LF9 K;  1HNV A;  3O9T A;  4M3Z A;  2E2Q A;  3VEV A;  3VQD A;  1ATN A;  4FLW A;  4IJA A;  3FFI A;  3MCA B;  3HPH A;  1NGD A;  1YUW A;  1IG9 A;  2QK9 A;  3PSF A;  1HKG A;  4A59 A;  4LH4 A;  4PL8 A;  4EP5 A;  1E3M A;  3G71 N;  4DWI A;  1B9D A;  1NWK A;  5BN8 A;  2P51 A;  3QIN A;  4JN4 A;  1QSS A;  1GLF O;  4JD2 A;  4OPK A;  2Q2R A;  4Q0B A;  1TAU A;  3OYD A;  3ZT2 A;  1EX4 A;  1HYV A;  4ELT A;  2YJF A;  1QSY A;  4CHQ A;  1RTD A;  4B9Q A;  1GLL O;  2OAN A;  4CEE A;  3DXK B;  2YKM A;  4FOI A;  3CCE N;  2CH5 A;  2IVP A;  1RDB A;  4DR2 K;  2VWJ A;  4DSL A;  4NCG A;  4M63 C;  4F2S A;  1WSH A;  4CJ5 A;  3QML A;  1YVU A;  3N4Q A;  5FPE A;  1VQL N;  1HQU A;  3W3D A;  1A5V A;  4DV6 K;  4Z94 A;  1HKB A;  1KC8 O;  2RF2 A;  1RT1 A;  2W41 A;  4QS8 A;  4Z4G A;  4AH9 A;  4V19 S;  1P90 A;  2HB5 A;  4B9M A;  3BF3 A;  4MFB A;  3DXK A;  2HHV A;  3ALY A;  3HRG A;  1BIZ A;  3QO9 A;  4K43 A;  4A5A A;  3CQX A;  2E5L K;  1HNX K;  1K9M O;  1JLA A;  4ILG B;  5HRO A;  3CM5 A;  4M3W A;  3C6U A;  1QS4 A;  4K41 A;  4MO4 A;  2P1J A;  2HHT A;  4IOC L;  3JYT A;  4CEO A;  3F9K A;  2ZGY A;  1HX1 A;  3MN5 A;  4AM7 A;  4DF8 A;  3E9O A;  3VQQ A;  4WFN L;  1W97 L;  3VF6 A;  1YF5 L;  3CG7 A;  4IZ9 A;  4O8U A;  5KPR A;  1EO1 A;  3LP3 A;  4WFB L;  3C6T A;  2HF4 A;  1NU0 A;  4OLB A;  5IT9 O;  4FXD A;  1HQE A;  5AQM A;  3CJA A;  4Y1D A;  2KZZ A;  3RVC A;  3LZJ A;  3PY8 A;  4HCC A;  3L2U A;  4FW2 A;  4IJN A;  4M3Y A;  4MQ3 A;  3VQB A;  4FO0 A;  2EX3 A;  2HBJ A;  3DRR A;  3IKM A;  5LJV A;  1N8R O;  2AJQ A;  4W5N A;  3DLE A;  2EHG A;  2EWS A;  2E6M A;  3TTD A;  3I55 N;  4J2D A;  1YT3 A;  3LPT A;  3U9D A;  3QBX A;  4A2B A;  5D3G A;  4FLV A;  3CJ7 A;  5CHI A;  1KD1 O;  1N6Q A;  4JK9 A;  5F1X A;  3H1V X;  3GBT A;  2HNY A;  2ZQB A;  4DSE A;  4IFE A;  1RDD A;  4JI0 K;  2VG6 A;  2FBT A;  1A5X A;  4DTM A;  4Y0W A;  2I5J A;  1XUP O;  1H1V A;  1KAY A;  4CBW A;  3NF7 A;  4FJH A;  1HJR A;  1C1A A;  1WSF A;  2VG5 A;  4J2B A;  4MO5 A;  3LP2 A;  3MED A;  4M3U A;  3VTI A;  3E01 A;  1RT6 A;  4BWJ A;  3WNE A;  2XY5 A;  4I9Q A;  4KRE A;  3SMP A;  1QHA A;  3LL3 A;  3KWG A;  1IKX A;  3MEG A;  4KH6 A;  3O5B A;  5BPM A;  2E2P A;  3SYZ A;  4JKC A;  3U3Y A;  1HUX A;  3FZL A;  4CCH A;  3UKU B;  3AVL A;  1OKJ A;  1NOZ A;  3MN7 A;  3W0L A;  1WLJ A;  4BG9 A;  3D0P A;  3SBT A;  2X6N A;  3SQ4 A;  1D5A A;  1C1C A;  3AGK A;  4LFC K;  1X3M A;  5HRR A;  3CFO A;  1S1V A;  3BUZ B;  1SS6 A;  3F2K A;  2R7Y A;  4CJL A;  1D9D A;  1BOT O;  1SQK A;  1RDC A;  3OA9 A;  5IWA K;  1RDA A;  3ID6 A;  3KLH A;  2YNG A;  4KTW A;  4CFC A;  4LF5 K;  3VEY A;  4GV9 A;  3DWL A;  4FK4 A;  3FR0 A;  3UKU A;  5BRD A;  5BRF A;  1GOC A;  1IO2 A;  5AQT A;  1NKE A;  2VQE K;  1S22 A;  1T8E A;  2AP1 A;  4CGJ A;  1FW6 A;  3BZK A;  3QB0 A;  1XNR K;  3VF2 A;  1K6Y A;  2I7P A;  2NRR A;  4OGC A;  1T3V A;  3G0Z A;  5FRM A;  3CD6 N;  4BRA A;  4YOY A;  4YHH K;  5AR0 A;  4CJT A;  3O1B A;  3NAE A;  5HRP A;  4DLE A;  3LAL A;  5EXW A;  4EZ9 A;  3AA5 X;  2V7Z A;  3C95 A;  3MXJ A;  4WQ5 A;  4C8N A;  3SMS A;  4DTS A;  5KTQ A;  3OYC A;  3IUC A;  4FZZ A;  4H03 B;  4RW4 A;  1HLU A;  1JCE A;  3THW A;  3HM8 A;  1Q9Y A;  4I6M B;  3EZW A;  4NO7 A;  2G8U A;  1Q9X A;  1HMV A;  5GAE P;  1U48 A;  3CMA N;  4NYF A;  3OTO K;  3RMA A;  1VSL A;  1BO5 O;  3RR8 A;  5GAG P;  3LZI A;  1HJO A;  1NGB A;  3L2V A;  2RE2 A;  4B1W B;  4HUE A;  3TAG A;  3UKR B;  5J1E A;  3QNN A;  4FCY A;  2GBZ A;  3RRG A;  1N34 K;  3KD1 E;  3OHR A;  1CZB A;  4CJW A;  1JKH A;  4GNI A;  4GV3 A;  4TSX A;  3ZET B;  4KH4 A;  4I6M A;  4FJN A;  4U67 L;  4CER A;  1ZYQ A;  4W5T A;  2G8F A;  2BE2 A;  4WE1 A;  4DSI A;  4JKF A;  1TKZ A;  2HMP A;  4ISG A;  3UKR A;  3HP6 A;  1BHL A;  1T6C A;  3ZCM A;  1S1X A;  3CCV N;  1LW0 A;  2ITG A;  3ZSY A;  5AQW A;  3KVG A;  4BRI A;  3H3N O;  4Y1C A;  3AO2 A;  3KK1 A;  1JL1 A;  4MLH A;  3HVT A;  1A5W A;  3OYH A;  1NJW A;  2KW4 A;  1ZBS A;  1DEJ A;  1KVA A;  3PIO L;  2PY5 A;  4LC9 B;  1GLC G;  2CH6 A;  4K25 A;  4PKI A;  1NKB A;  2QKB A;  4DR5 K;  1J53 A;  5KPZ A;  1P8Z A;  4FZY A;  1WOQ A;  3WNH A;  3CCL N;  4OO1 J;  3K9K A;  4OPA A;  1CZ9 A;  1Y97 A;  2FC0 A;  4FWQ A;  4E7I A;  3SK3 A;  1NOY A;  1WAF A;  4IWV A;  3NH2 A;  4O44 A;  4H0P A;  1DGK N;  1NGE A;  4KHS A;  3CER A;  4CJE A;  4DTP A;  4EZ6 A;  2FSK A;  1XWL A;  4FJJ A;  1J9A A;  1U2V B;  2QWN A;  3DOL A;  5CZ2 A;  4EP4 A;  3OS1 A;  3VF4 A;  4W5R A;  3BF1 A;  2F4V K;  1VRT A;  3G10 A;  4RTF D;  4N47 A;  1MWM A;  3BZC A;  1ATS A;  5M1F A;  1R0A A;  5AQQ A;  2RPI A;  3T1A A;  3SZ2 A;  5JLH A;  1C6V A;  1W0H A;  4RW8 A;  4RW9 A;  2OPS A;  2BH1 A;  3MXI A;  1TK0 A;  3T69 A;  4IKF A;  4YOT A;  2ZD1 A;  3VN5 A;  2E6L A;  1U2V A;  1GLE G;  3BY5 A;  4IXC A;  3AGR A;  3HBT A;  3OYF A;  4FJ9 A;  1RNH A;  4O5B A;  3LDS A;  4FWO A;  1KQS M;  2NRV A;  1NJX A;  4Z4C A;  5M1O A;  3CC2 N;  1VQ9 N;  4X62 K;  2XY7 A;  4DSK A;  1N33 K;  2IDO A;  4AHC A;  2OTJ N;  1S9G A;  1C0U A;  1JLF A;  3CI5 A;  3QFU A;  3ZT1 A;  3NE6 A;  3HL8 A;  1X9J A;  4N76 A;  3TAQ A;  4CGI A;  1J5O A;  2G8K A;  3LDP A;  1EWR A;  4BRE A;  3E66 A;  1RT3 A;  2XO7 A;  3ENB A;  2OPP A;  2O8E B;  4CJV A;  1YHQ N;  1O1W A;  4K8Z A;  3HYF A;  1LWE A;  3T7Z A;  2Z1J A;  1T6D A;  3H45 C;  5LMU K;  1TUU A;  3SUO A;  3L0Q A;  3PX4 A;  1ZBF A;  4DQR A;  1ASU A;  4C8O A;  1MA9 B;  4RG8 A;  3TTF A;  3TTC A;  3EE8 A;  3MMV A;  2O8E A;  1CZA N;  3O4W A;  1YIT N;  4J2A A;  3LAN A;  5CR4 A;  2QA4 N;  4CGH A;  3L3V A;  3CFP A;  3PUF A;  5FDL A;  1RIL A;  3NF6 A;  4H0O A;  4BE1 A;  3QEP A;  1M1K O;  4FYD A;  4QS7 A;  2UUA K;  1KFS A;  1VRU A;  3HO1 A;  5FPN A;  4BRF A;  4JEP A;  1VQN N;  4A5B A;  4KTZ A;  4WCE L;  4CI6 A;  3O9R A;  3NGY A;  1CLQ A;  4JI4 K;  1VQO N;  4CZJ A;  1QZ5 A;  4CEA A;  3FLC O;  2QWP A;  4DTO A;  1NK5 A;  1TL1 A;  1WBD A;  1MU2 A;  2I7N A;  4JYA K;  3V9X A;  4E1J A;  3OYL A;  5LL6 Z;  4DR3 K;  3WEE B;  3NVK A;  3DLG A;  2D0O A;  3P39 A;  2E4L A;  5F2R A;  4CFB A;  3TAN A;  1IV0 A;  4JKH A;  4DV5 K;  3IS9 A;  1TL3 A;  4DV0 K;  2ITM A;  5C0Y A;  3P38 A;  4F8R A;  3V1O A;  5AQV A;  3LAM A;  3A8Y A;  1NGA A;  3V1Q A;  3C6A A;  5FRN A;  3CCS N;  3DM2 A;  3V9S A;  5SWM A;  3P4I A;  3WEE A;  3IMX A;  1R59 O;  4LSN A;  1UWB A;  1GOA A;  1BWF O;  4KTQ A;  3GL1 A;  5FLX O;  3AVH A;  3ZSV A;  1NGC A;  4CZF A;  2B6A A;  5AQS A;  4Q5V A;  3SV4 A;  4E7L A;  2XY6 A;  3K5O A;  1EWQ A;  3EY1 A;  4G9Z A;  2E20 A;  2GWJ A;  5CY4 A;  4PA1 A;  4FLT A;  1M90 O;  1UOC A;  4EHT A;  1YJN N;  2E1Z A;  4FZX C;  4CZG A;  1L3U A;  1VQ8 N;  4H4M A;  1QQO A;  1RTI A;  4GY2 B;  3KKS A;  3QEI A;  3JSM A;  4IFY A;  1QTM A;  3G4S N;  3LAK A;  3IG1 A;  4JRP A;  3DMJ A;  1IKW A;  4YOR A;  4JHD B;  2DY4 A;  3P31 A;  5AQY A;  2O8B B;  1YTA A;  2X6S A;  3S41 A;  1LOT B;  2ZF5 O;  4KHN A;  1Z26 A;  3OYN A;  3MXM A;  3DLK A;  5EU7 A;  4K8X A;  1JXE A;  4BDY A;  3WXJ A;  3O3G A;  3CCR N;  1NGH A;  4XEI A;  4JD2 B;  1NK4 A;  1TK8 A;  3CQ8 A;  4JHD A;  2O8B A;  4HTU A;  1N5Y A;  3E9P A;  1B92 A;  1BCO A;  3R9P A;  5J2Q A;  1IH7 A;  2NRH A;  4JLH A;  1S1W A;  3C7N B;  3RWU A;  2D0A A;  1RBV A;  5C24 A;  1NK0 A;  2A1S A;  1HPM A;  4K42 A;  1YJW N;  2P5G A;  3J7A P;  4BR0 A;  1XMO K;  3R6M A;  1RGI A;  1ZC6 A;  4W5Q A;  5GIP A;  1JLB A;  4RW6 A;  3SJH A;  5E26 A;  1RT7 A;  3H3O B;  4R79 A;  4IFV A;  1TKT A;  3VEO A;  1HNI A;  4LF8 K;  3C7N A;  4E7K A;  4DU1 A;  1OH6 A;  1NGI A;  3TAM A;  2NRX A;  3PIP L;  4NYN A;  2WTU A;  1QQN A;  3P5J A;  3L2Q A;  5FPM A;  1KRP A;  4DTJ A;  1Z6R A;  2JWL A;  2YHW A;  2WBN A;  4CZL A;  3HI0 A;  3AA3 A;  3O80 A;  3LP0 A;  1OVY A;  4MDB A;  5AFU A;  1V4T A;  4FJG A;  2OZM A;  3L2R A;  4FL9 A;  3NBP A;  1TKX A;  4CEZ A;  4PUO A;  3TWH A;  4JRQ A;  1RFQ A;  2PFU A;  4BRL A;  4AHR A;  1RCH A;  3VMF B;  3UE5 A;  2G8I A;  3LWL A;  5J2M A;  4J2E A;  1TK5 A;  4DV1 K;  2P9K A;  2RN2 A;  1C0M A;  1ATR A;  3LWM A;  3VER A;  3M1F A;  1JCG A;  4FM1 A;  4JNE A;  1RDW X;  1VQK N;  1Q82 O;  2B4J A;  1FJG K;  2ZWH A;  5C25 A;  1TVR A;  4FWS A;  3ZSR A;  4B3S K;  4B1V A;  3VQP A;  5SZT A;  1FKO A;  5GAH P;  2KQ2 A;  2BDP A;  4GVE A;  5JVH L;  4AQY K;  3WXI A;  2ZE2 A;  4A62 A;  3AO4 A;  1YTU A;  2QKK A;  1U4B A;  4DUZ K;  4QOZ B;  1WAJ A;  4O8K A;  3NF9 A;  3O9S A;  1U04 A;  2D5R A;  2E2N A;  1NNE A;  4KBO A;  3VQC A;  3SQ1 A;  4FK2 A;  4JKB A;  2JWK A;  3ASM A;  1S1U A;  4CIG A;  1KLN A;  5CE3 A;  3T1Y K;  4DHY A;  2Q0U A;  3V9Z A;  1WUA A;  2PZS A;  4B1U B;  1X1P A;  4CBU A;  4CIE A;  4YOX A;  1MWK A;  2X74 A;  5AQJ A;  1UA1 A;  2Z1I A;  4JV5 K;  2BAN A;  1TV6 A;  1S1T A;  4CIF A;  3QEW A;  3NGI A;  1G15 A;  4KH5 A;  4YY3 K;  2FF3 B;  1SL2 A;  3K5N A;  4DR6 K;  4BRK A;  4CD3 A;  1GLD G;  1G99 A;  4Z4H A;  4FJL A;  3HM9 A;  3ENH A;  4CHN A;  1EXQ A;  4OLA A;  4JS5 A;  4RW7 A;  1N32 K;  4OGE A;  1C1B A;  5HL7 L;  3FGU A;  3U3G A;  4ILJ A;  2OA8 A;  1JLQ A;  5ELZ A;  2CGJ A;  1VQ7 N;  1IG8 A;  1EET A;  3ZT3 A;  4YDU A;  4H0Y B;  4CVN E;  4DQQ A;  4JKE A;  4J8F A;  3KLG A;  1GLB G;  5AQF A;  5AQP A;  2P9I A;  4BRQ A;  3Q7B A;  2IGI A;  3LDN A;  5DK5 A;  3DRS A;  1Y64 A;  3ZX0 A;  3THV A;  3CIP A;  4FJK A;  3E1Y A;  3ATV A;  1NGG A;  1RTJ A;  2YHA A;  3T19 A;  1JXB A;  2PAV A;  3O9Q A;  3D45 A;  2HOE A;  2J4R A;  1HNZ K;  3NF8 A;  4FM2 A;  1T05 A;  4WQ5 C;  4FJX A;  1IKY A;  1BUP A;  2JLE A;  1U6Z A;  4CK1 A;  4LF7 K;  3ID8 A;  1BI4 A;  1K8K A;  4H5W A;  3U9Z A;  3SQ0 A;  2NRZ A;  4DV7 K;  4MDA A;  3SPY A;  5K14 A;  1REV A;  5J2N A;  3LDL A;  3VQ4 A;  4BE0 A;  4BDP A;  3VET A;  5KQ8 A;  1SL0 A;  2NLX A;  2G8W A;  1JLC A;  4NCA A;  3THW B;  2ZJQ L;  4JKA A;  3ZSX A;  3CJ9 A;  4BQZ A;  2PYL A;  3AAQ A;  3K2P A;  1OH8 A;  4PQU A;  3K59 A;  1HYS A;  4EFH A;  4Z4F A;  3GE1 A;  4DV4 K;  2P9P A;  1FK9 A;  2WC9 A;  3VQ9 A;  1TYQ A;  4RWT A;  2Q97 A;  3PSI A;  2QWQ A;  4DS5 A;  4KKO A;  1VSK A;  4H5T A;  3UIQ A;  3HPG A;  4FK0 A;  4BRP A;  4DR7 K;  3AAR A;  2P9N B;  4NB4 A;  3EN9 A;  2Q36 A;  3HXM A;  2KLA A;  3GDQ A;  3WNG A;  4FLX A;  1WN7 A;  4OVL A;  2WOM A;  3WT0 A;  2VWB A;  3RSE A;  1T03 A;  1NLV A;  3VA3 A;  4HCB A;  2F9W A;  4B9T A;  5I3U A;  4ISF A;  1SL1 A;  5JIC A;  3OJS A;  4GKJ K;  3IDH A;  2W6K A;  5E41 A;  4IBN A;  3DI6 A;  4LFB K;  3NDK A;  4B9V A;  2CGL A;  3QDK A;  2P9N A;  3P83 D;  4N41 A;  2GEL A;  4AHS A;  3F73 A;  2HNZ A;  1NMN A;  4IEI A;  5AQR A;  4OX9 K;  3OW2 M;  4KHQ A;  3H08 A;  4DV3 K;  4GVM A;  4BRN A;  4JS4 A;  5JLF A;  1D4X A;  4CHP A;  1JCF A;  2GUI A;  4DR1 K;  1NJI O;  1B9F A;  3KZB A;  3JAM O;  4IOX A;  4CF2 A;  1JL2 A;  2F9T A;  3NH0 A;  3S3O A;  2YNH A;  3V81 A;  3B8A X;  4IDK A;  3U4L A;  4F3O A;  5ADX A;  3LM2 A;  3BP8 A;  4WF9 L;  5FPD A;  1ESV A;  3LM9 A;  2PBD A;  1KVB A;  2P9L B;  1TKD A;  2V7Y A;  1RBT A;  4DB3 A;  3TAB A;  4JI8 K;  5DM6 L;  1ZBU A;  3QIC A;  3NCI A;  4DKW A;  3HOS A;  2HBK A;  3D6R A;  2YCH A;  3SPZ A;  4B3O A;  2A42 A;  5EY4 A;  1Z05 A;  3TAP A;  3PLA A;  2P9L A;  3CPE A;  1DLO A;  5H1S Q;  4FWL A;  4PY5 A;  3BDP A;  1N36 K;  2DPN A;  4FW1 A;  3I8D A;  4FWM A;  5EX5 A;  1UA0 A;  4E7J A;  4IO8 A;  2QWR A;  3CC4 N;  1TUY A;  3O6W A;  4CHY A;  2DFH A;  1HRH A;  1KLM A;  3DXM B;  5KRS A;  1KSP A;  2BGG A;  4JK8 A;  1DKG D;  4U7B A;  5LY3 A;  1XHX A;  2OZS A;  1J54 A;  3DLL L;  1VQM N;  4CGF A;  2QTD A;  4CGD A;  3AO3 A;  3J80 O;  2BTF A;  1GOB A;  3A5M C;  5AQG A;  3MEC A;  1EP4 A;  1VSE A;  4DS4 A;  3THY B;  4E0D A;  4CJ3 A;  1OVQ A;  3DXM A;  1WNS A;  4B1Y B;  4L3Q A;  3AVC A;  5JS1 A;  1C0G A;  1TAQ A;  3OYJ A;  4PKH A;  3WXL A;  4DF4 A;  2P9U B;  1NJY A;  2Q0R A;  4DTU A;  4O0I A;  5BR9 A;  3K5L A;  4CZK A;  2D0P A;  2HBM A;  4KHY A;  4ZTF A;  4CFD A;  4BVP A;  3THY A;  3C65 A;  3J81 O;  2V51 B;  2ZM6 K;  5C10 A;  1KCF A;  4BGA A;  4ICL A;  3CME N;  3TR8 A;  5KI6 A;  4A2A A;  4CJP A;  2AA4 A;  1RTH A;  2P9U A;  3RMD A;  1BGX T;  5KPT A;  3SUP A;  4B1Z A;  3AVK A;  4BGB A;  4FPB A;  1WSE A;  4NLC A;  1O13 A;  3DLH A;  4FJ5 A;  4KHP K;  4OKE A;  2ZGZ A;  4BY9 C;  3I33 A;  4BR9 A;  4CZM A;  4H5R A;  4CF0 A;  3NH1 A;  2VGN A;  3K57 A;  4CK3 A;  4I9L A;  3OYB A;  4L8R B;  2HND A;  2WON A;  1BG3 A;  1NBW A;  3TI0 A;  3JS6 A;  4XIU A;  4LD0 A;  4WQ4 C;  1OH5 A;  4N5S A;  2W42 A;  3AV9 A;  5AQZ A;  3DJC A;  3IAY A;  3NFA A;  1RT5 A;  1QVG M;  4EAH D;  2ZJP L;  2KHO A;  2HHH K;  1RBS A;  1XNQ K;  1S6Q A;  4ELV A;  3RRH A;  4NXM K;  3VPZ A;  5KQD A;  3THX B;  2GV9 A;  3KTQ A;  3L6Q A;  3M8P A;  3KLF A;  4M3X A;  5HBM A;  5MLC Q;  4KV8 A;  2FBX A;  3TSP A;  4H8K A;  4CBX A;  4QCL A;  1OH7 A;  1SUQ A;  5M1N A;  5T7B A;  2IOC A;  2IIR A;  1RBU A;  4CGG A;  4LH5 A;  4KB1 A;  2VWK A;  4JI1 K;  4YOV A;  4DQ8 A;  4FJI A;  1XC3 A;  2KZM A;  2KKZ A;  3ITH A;  4QS9 A;  4RCH A;  4B1X B;  3ZT0 A;  2HHU A;  2HMI A;  2ASM A;  1SV5 A;  3TAR A;  3CQY A;  3THX A;  4GV6 A;  2XY8 A;  4CJ4 A;  5M1P A;  5C2F A;  3GG4 A;  1YVN A;  3S9H A;  4KI6 A;  3FFK B;  4FLZ A;  4FJM A;  1IBK K;  3U8X A;  4CJR A;  2NUB A;  3BEX A;  4KPY A;  3HJF A;  1HPZ A;  4BC4 A;  2E88 A;  1BQN A;  4CJS A;  4FM0 A;  3G25 A;  3PO4 A;  4HHT A;  4XH1 A;  2YNF A;  4A57 A;  3V6D A;  4H5V A;  4CJK A;  3CCM N;  2W6L A;  3BGR A;  3SNN A;  4JI6 K;  3SAH A;  4DG1 A;  1NMD A;  1LV5 A;  2YX6 A;  1WSG A;  2YKN A;  4ELU A;  2RKI A;  3LDO A;  4CJ7 A;  1BA1 A;  1ZBI A;  1IBL K;  5LJW A;  5BN9 A;  1QVF M;  3QET A;  1NK8 A;  1NK7 A;  2OPR A;  4F3T A;  4X65 K;  1KTQ A;  4ILH A;  3WXM B;  4CD1 A;  3TU5 A;  4FSV A;  4DLG A;  4HTL A;  3SLC A;  2B5J A;  1QQC A;  1D8Y A;  4CZI A;  4FWN A;  4OKJ A;  3A5N C;  4FLU A;  4KO0 A;  4MLE A;  1ITG A;  2YHY A;  2G8V A;  3T1H K;  4E3S A;  3HP9 A;  4KFB A;  2D4W A;  1EKE A;  4HWI A;  3QBW A;  4PL7 A;  3OBY A;  2CGK A;  4HUF A;  4DQP A;  4F9O A;  3QNO A;  2KFN A;  3CPW M;  4KRF A;  3MEE A;  4UQG A;  3EKS A;  1XI1 A;  4GMJ B;  4E7H A;  1MDU B;  3KK3 A;  4BRG A;  4IEE A;  3ZLJ A;  3I0S A;  4CEB A;  4IDH A;  5HRN A;  2O4I A;  3CXC M;  2Q31 A;  1Z25 A;  2IVN A;  2HHQ A;  4DTN A;  2W40 A;  3HSC A;  3LP1 A;  1U45 A;  1YIJ N;  1NK6 A;  1QZ6 A;  2P9K B;  4Z4I A;  4E1M A;  3Q7C A;  4GW6 A;  4I2Q A;  4N56 A;  3E9L A;  1QQM A;  5DMR A;  5AQI A;  2Q3S A;  4CES A;  4DCH A;  3NHG A;  2Y1I A;  2QXF A;  3KHY A;  5C42 A;  4CF8 A;  3D2E B;  4LFA K;  3K0S A;  1DTQ A;  5DM7 L;  4FPA A;  3RTV A;  2HHX A;  2VCP A;  1ZXO A;  3IRX A;  1ASW A;  5BPN A;  4JKD A;  4PWD A;  2UUC K;  1BU6 O;  3KD5 E;  3A0I X;  3I8B A;  2X78 A;  3VEZ A;  2F8T A;  4FJ8 A;  2OTL N;  3ATU A;  2ETJ A;  3H1Q A;  4GKK K;  4CEF A;  3PO5 A;  3D2E A;  5AQX A;  3PV8 A;  3LDQ A;  2Z1H A; 
#chains in the Genus database with same CATH homology
 4WFA L;  4YOT A;  4EFH A;  1U2V A;  1GLE G;  3HOT A;  1GLA G;  3M3Z A;  3GE1 A;  4IXC A;  1K8A O;  3AGR A;  2P9P A;  3HBT A;  1RDU A;  2NZT A;  2WC9 A;  3KK7 A;  1TYQ A;  5TKY A;  4RWT A;  2Q97 A;  3TSU A;  2QWQ A;  4FWO A;  1C0F A;  3HZ6 A;  2NRV A;  1KQS M;  5M1O A;  2NRW A;  2A3Z A;  2V52 B;  4H5T A;  2QWM A;  5M1Q A;  1VQ9 N;  3CC2 N;  3VEX A;  4BC2 A;  4BRP A;  1LCU A;  5E84 A;  3AAR A;  1HKC A;  3ZEU A;  2P9N B;  4NB4 A;  2OTJ N;  1V4S A;  3EN9 A;  1DT9 A;  2Q36 A;  2KLA A;  3CCJ N;  3CI5 A;  3GDQ A;  3QFU A;  1YXQ A;  1Q18 A;  3WT0 A;  1X9J A;  2E2O A;  4C1N K;  2VWB A;  3O9U A;  3LDP A;  3RSE A;  3ZYY X;  1NLV A;  4BRE A;  3CCQ N;  3E66 A;  4YDU C;  2F9W A;  5AQL A;  4ISF A;  3ENB A;  3M5R A;  5JMV A;  5JIC A;  2FLO A;  3IDH A;  1YHQ N;  2A41 A;  1EQY A;  3FZF A;  3HTV A;  3N4P A;  4IO9 L;  1NM1 A;  3L4I A;  3T7Z A;  1J6Z A;  1VAZ A;  1T6D A;  2CGL A;  3H45 C;  3H6E A;  3QDK A;  2P9N A;  5AQN A;  2FSN A;  2GEL A;  3VEW A;  4C23 A;  4JKG B;  1TUU A;  3R8E A;  3L0Q A;  4IEI A;  5AQR A;  3OW2 M;  2WFB A;  4PKG A;  1MA9 B;  4CZE A;  1S3X A;  4YOW A;  2P9I B;  4BRN A;  3TTF A;  5JLF A;  2VYP A;  3TTC A;  1D4X A;  3EE8 A;  3MMV A;  1CZA N;  1JCF A;  3O9T A;  3F9M A;  3GOI A;  2E2Q A;  3O4W A;  5CR4 A;  3VEV A;  2QA4 N;  1YIT N;  1NJI O;  1ATN A;  1NGF A;  3MX2 A;  4IJA A;  3KZB A;  3MCA B;  3VGM A;  1NGD A;  1YUW A;  3J8A A;  4H0O A;  1IJJ A;  1HKG A;  1Q7Y O;  4IOX A;  2FSJ A;  4A59 A;  1M1K O;  4JKG A;  5I9E B;  2F9T A;  3TPQ A;  4QS7 A;  3MCP A;  4PL8 A;  4BVO A;  3B8A X;  3U4L A;  5FPN A;  4BRF A;  3G71 N;  5ADX A;  1NWK A;  3EL2 A;  3LM2 A;  4JEP A;  5BN8 A;  1VQN N;  1JJ2 M;  3BP8 A;  4YOU A;  5C15 A;  4A5B A;  2GTD A;  4WF9 L;  1K8K B;  4JN4 A;  5FPD A;  1ESV A;  1GLF O;  2PBD A;  3LM9 A;  4WCE L;  4JD2 A;  3D7E O;  3O9R A;  4CI6 A;  2P9L B;  2Q2R A;  2V7Y A;  4FVU A;  3UB5 A;  4DB3 A;  4BR7 A;  1YAG A;  3DAW A;  4CZJ A;  5GIN A;  1KXP A;  1QZ5 A;  5HOO A;  5DM6 L;  1VQO N;  3CJB A;  3QIC A;  3FLC O;  2QWP A;  2A6A A;  4NLB A;  5BRH A;  4DKW A;  2YJF A;  4XH4 A;  3HOS A;  4B9Q A;  3OBW A;  2I7N A;  2HBK A;  3D6R A;  4EHU A;  1GLL O;  2YCH A;  4FWK A;  4E1J A;  2OAN A;  2A42 A;  3WEE B;  3NVK A;  2YHX A;  5EY4 A;  1Z05 A;  3DXK B;  2D0O A;  3P39 A;  4FOI A;  3CCE N;  1ILY A;  5F2R A;  3C0B A;  2CH5 A;  2IVP A;  3ENO A;  4FWR A;  3VOV A;  3PLA A;  2P9L A;  3CPE A;  4JKH A;  3A5O C;  5H1S Q;  4FWL A;  5JVG L;  4M63 C;  2ITM A;  5C0Y A;  3P38 A;  3QML A;  5AQK A;  2P9P B;  3AY9 A;  5EVZ A;  5AFU H;  3N4Q A;  4FOE A;  5FPE A;  5AQV A;  4BRD A;  1VQL N;  3A5L C;  1TYQ B;  2DPN A;  2HF3 A;  3W3D A;  3A8Y A;  1NGJ A;  1NGA A;  4FWM A;  3C6A A;  4Z94 A;  1HKB A;  3CCS N;  5EX5 A;  1VQ5 N;  1KC8 O;  4BRO A;  2W41 A;  4QS8 A;  4IO8 A;  2QWR A;  5AQO A;  1TUY A;  3O6W A;  3CC4 N;  3P4I A;  1P90 A;  3WEE A;  3BF3 A;  3IMX A;  2GWK A;  3DXM B;  3DXK A;  3NVM A;  3AAP A;  1R59 O;  3HRG A;  4JK8 A;  1DKG D;  3H46 O;  4K43 A;  4A5A A;  1BWF O;  3RSE B;  3CQX A;  5EOY A;  4U7B A;  5LY3 A;  3GL1 A;  3DLL L;  1K9M O;  4ILG B;  1VQM N;  1NGC A;  4CZF A;  2QTD A;  5AQS A;  3SAF A;  3WUH A;  4K41 A;  3MWT A;  3WXK A;  4MO4 A;  2BTF A;  2GX9 A;  4IOC L;  3A5M C;  5AQG A;  4G9Z A;  2E20 A;  3MN5 A;  2ZGY A;  1HX1 A;  3CJC A;  2GWJ A;  3KWI A;  4AM7 A;  3E9O A;  3NMU A;  5BRE A;  2QWO A;  1M90 O;  3DXM A;  4EHT A;  1YJN N;  4WFN L;  3SAG A;  1W97 L;  2E1Z A;  3VF6 A;  4B1Y B;  4CZG A;  4H0V B;  1VQ8 N;  1YF5 L;  4IZ9 A;  4L3Q A;  4O8U A;  5KPR A;  1EO1 A;  4H0T B;  4H0X B;  4AM6 A;  4WFB L;  1QQO A;  1C0G A;  4GY2 B;  5AZJ B;  4PKH A;  3WXL A;  2HF4 A;  3G4S N;  2P9U B;  2Q0R A;  4EIA A;  4YOR A;  5BR9 A;  3FE1 A;  1VQP N;  4JHD B;  3CJ1 A;  3P31 A;  5AQY A;  4CZK A;  5AQM A;  2D0P A;  2HBM A;  4UY8 O;  3CJA A;  3RVC A;  2P9S B;  3S41 A;  1LOT B;  4BVP A;  3FZK A;  2ZF5 O;  4M7X A;  3C65 A;  4IJN A;  2V51 B;  5C10 A;  4BGA A;  4BR4 A;  2FF6 A;  4FO0 A;  3CME N;  3WXJ A;  5LJV A;  2HBJ A;  3IKM A;  1N8R O;  3MWP A;  2H3G X;  2EWS A;  5AZJ A;  2BUP A;  4A2A A;  3CCR N;  1NGH A;  4XEI A;  3TTD A;  3I55 N;  2AA4 A;  1YI2 N;  4JD2 B;  2P9U A;  3O8M A;  3U9D A;  2HST A;  3QBX A;  4A2B A;  5C12 A;  4JHD A;  1Q86 O;  3CJ7 A;  4ISE A;  4AF1 A;  5CHI A;  3MDQ A;  5KPT A;  1KD1 O;  4CZH A;  3E9P A;  4B1Z A;  2P9S A;  1S72 N;  4JK9 A;  4BGB A;  5F1X A;  4FPB A;  3H1V X;  2IVO A;  1O13 A;  3GBT A;  4NLC A;  3R9P A;  3CCU N;  3MX5 A;  2NRH A;  1VQ6 N;  1X3N A;  2ZGZ A;  4IFE A;  4BY9 C;  4H5N A;  3C7N B;  3I33 A;  4BR9 A;  2F7T A;  4CZM A;  4H5R A;  1HPM A;  4K42 A;  1YJW N;  2VGN A;  4BR5 A;  3IFR A;  4Y0W A;  1XUP O;  3VTH A;  4BR0 A;  3R6M A;  4BRC A;  1RGI A;  1H1V A;  1KAY A;  1ZC6 A;  4CBW A;  4FWP A;  4A61 A;  5GIP A;  3ULE B;  1BG3 A;  1NBW A;  3JS6 A;  2QI2 A;  2E1Y A;  4WQ4 C;  3SJH A;  5E26 A;  3ZET A;  2GEM A;  1T44 A;  4MO5 A;  5C2D A;  3H3O B;  4R79 A;  4O5F A;  1KAZ A;  3VEO A;  3VTI A;  3VES A;  5AQZ A;  2E8A A;  3C7N A;  2QW9 A;  3DJC A;  5AQU A;  3SMP A;  1QHA A;  1NGI A;  3LL3 A;  2NRX A;  3PIP L;  3KWG A;  4KH6 A;  2ASP A;  4EAH D;  2ZJP L;  1QVG M;  3O5B A;  1QQN A;  5BPM A;  2E2P A;  5FPM A;  3VGL A;  1VQ7 N;  4JKC A;  2KHO A;  1Z6R A;  2JWL A;  1HUX A;  3VEN A;  3FZL A;  2YHW A;  2WBN A;  4CZL A;  3HI0 A;  3UKU B;  1OKJ A;  3ULE A;  2Q1N A;  3MN7 A;  3O80 A;  2NRT A;  3W0L A;  5GAD P;  4BG9 A;  3CET A;  3SBT A;  3VPZ A;  5KQD A;  1OVY A;  3AGK A;  4MDB A;  5AFU A;  2ZJR L;  1X3M A;  3WQU A;  4BRM A;  2UYT A;  3L6Q A;  1V4T A;  3JXU A;  4FL9 A;  3BUZ B;  1SS6 A;  3F2K A;  3F5T A;  5MLC Q;  3J7Z O;  3TSP A;  4BR2 A;  4CBX A;  1BOT O;  5B8H A;  1SQK A;  3I56 N;  3OA9 A;  5M1N A;  2IIR A;  3G6E N;  3ID6 A;  4YOV A;  3EKU A;  4DQ8 A;  1XC3 A;  3MN6 A;  3VEY A;  1RFQ A;  4GV9 A;  2KKZ A;  2PFU A;  3DWL A;  4BRL A;  3VMF B;  4QS9 A;  4RCH A;  3UE5 A;  4B1X B;  3FR0 A;  3UKU A;  3O08 A;  5BRD A;  2ASM A;  5BRF A;  2P9K A;  5TKW A;  5AQT A;  4XH5 A;  1S22 A;  3CQY A;  2AP1 A;  1ATR A;  4GV6 A;  5M1P A;  3QB0 A;  2VGM A;  1YVN A;  3GG4 A;  3VER A;  5C2F A;  3VF2 A;  2I7P A;  3M1F A;  1SAZ A;  3FFK B;  2NRR A;  1JCG A;  1SZ2 A;  3CF5 L;  1T3V A;  4IOA L;  3CD6 N;  4JNE A;  1E4G T;  1RDW X;  3U8X A;  4BRA A;  5F0X A;  4YOY A;  1VQK N;  1Q82 O;  3BEX A;  5AR0 A;  3MN9 A;  2ZWH A;  3O1B A;  4BC4 A;  4FWS A;  2E88 A;  3G25 A;  4B1V A;  4XH1 A;  2D1K A;  5EXW A;  5GAH P;  4A57 A;  4H5V A;  3CCM N;  2V7Z A;  2NNW A;  3SAH A;  4GVE A;  3SBG A;  4WQ5 A;  5JVH L;  3FZH A;  3WXI A;  1NMD A;  3SMS A;  4A62 A;  2YX6 A;  3IUC A;  2A5X A;  4CJ7 A;  3LDO A;  1BA1 A;  4H03 B;  1HLU A;  4O8K A;  3O9S A;  1JCE A;  2E2N A;  3HM8 A;  5AQX A;  3WQT A;  4I6M B;  2YI1 A;  3EZW A;  3K9J A;  3R1X A;  4KBO A;  2QM1 A;  4JKB A;  4NO7 A;  5BN9 A;  5LJW A;  1QVF M;  2JWK A;  5GAE P;  5CE3 A;  4PHT X;  3CMA N;  4DHY A;  3EO3 A;  2Q0U A;  3ZX2 A;  1K73 O;  1WUA A;  1VQ4 N;  4B1U B;  1BO5 O;  4ILH A;  3WXM B;  4CD1 A;  4CBU A;  5GAG P;  1HJO A;  1NGB A;  4YOX A;  1MWK A;  4JK7 A;  2RE2 A;  3TU5 A;  4B1W B;  4FSV A;  5AQH A;  4HTL A;  5AQJ A;  3UKR B;  2QEX N;  3SLC A;  2FXU A;  3OHR A;  4CZI A;  4FWN A;  3D2F B;  4GNI A;  3A5N C;  4MLE A;  4GV3 A;  3L4Q A;  3ZET B;  2YHY A;  4KH4 A;  2WUS A;  4I6M A;  4U67 L;  4KH5 A;  1GLJ O;  2FF3 B;  4WYB A;  2D4W A;  4JAX A;  4HWI A;  4OPH A;  4BRK A;  4CD3 A;  1GLD G;  1G99 A;  4BC5 A;  3QBW A;  4PL7 A;  3OBY A;  3ENH A;  2CGK A;  4JKF A;  4BRH A;  4M7Y A;  2HMP A;  4F9O A;  1XQS C;  4ISG A;  5AZI B;  3UKR A;  3CC7 N;  3CPW M;  5HL7 L;  1T6C A;  3FGU A;  1BDG A;  4ILJ A;  2QWL A;  3D2F A;  3EKS A;  3CCV N;  5ELZ A;  5AQW A;  2CGJ A;  3KVG A;  1IG8 A;  1MDU B;  4BRI A;  3C6H A;  3H3N O;  3TSQ A;  2ASO A;  4IEE A;  4BRG A;  4YDU A;  4BQL A;  4H0Y B;  4MLH A;  4IDH A;  3CXC M;  4JKE A;  2Q31 A;  4J8F A;  5BPL A;  1GLB G;  1ZBS A;  5AQF A;  5AQP A;  2IVN A;  1DEJ A;  2P9I A;  4BRQ A;  5ADX H;  3PIO L;  4BC3 A;  2W40 A;  1E4F T;  3HSC A;  1GLC G;  2CH6 A;  4K25 A;  4LC9 B;  4PKI A;  3Q7B A;  3FZM A;  5AZI A;  3LDN A;  1YIJ N;  2YJE A;  1Y64 A;  5KPZ A;  1P8Z A;  1QZ6 A;  1WOQ A;  3ZX0 A;  2P9K B;  2HBL A;  3CCL N;  4OO1 J;  3K9K A;  4OPA A;  3CIP A;  3Q7C A;  3E1Y A;  3ATV A;  1NGG A;  3E9L A;  1QQM A;  3R3L A;  4FWQ A;  2PAV A;  5AQI A;  3O9Q A;  3SK3 A;  2HOE A;  2J4R A;  4C1N I;  4IWV A;  4DCH A;  3CHW A;  4WQ5 C;  1BUP A;  4H0P A;  1DGK N;  1KAX A;  1NGE A;  1U6Z A;  3KHY A;  3ID8 A;  3CER A;  3D2E B;  1K8K A;  4BG8 A;  2FSK A;  4H5W A;  3U9Z A;  2NRZ A;  4FPA A;  5DM7 L;  1W2B M;  3EE9 A;  4MDA A;  1U2V B;  2QWN A;  1YJ9 N;  2VCP A;  1ZXO A;  3LDL A;  5BPN A;  3VF4 A;  3BF1 A;  4JKD A;  3VGK A;  1Q81 O;  1BU6 O;  3VET A;  3A0I X;  5KQ8 A;  4RTF D;  3MK6 A;  5M1K A;  3I8B A;  1MWM A;  3VEZ A;  1ATS A;  2GUP A;  2NLX A;  5M1F A;  5AQQ A;  3ZX3 A;  2OTL N;  2A40 A;  3ATU A;  5JLH A;  1BA0 A;  3ZEU B;  2QXL A;  3H1Q A;  5GIO A;  3M6G A;  2RHK A;  2ZJQ L;  4JKA A;  4WQ4 A;  2BH1 A;  3CJ9 A;  3QFP A;  4BQZ A;  3D2E A;  3T69 A;  3AAQ A;  3LDQ A;  3O1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...