3C65A

Crystal structure of bacillus stearothermophilus uvrc 5' endonuclease domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
152
Chain Sequence
GSHMLGERLGIPAPRRIEAFDNSNIYGADPVSALVVFLDGKPAKKEYRKYKVKTVAGPNDYETMREVVRRRYTRVLKEGLPLPDLIIIDGGKGHLSAVRDVLENELGLDVPLAGLSELLAGDPPDVVPLDRQSQEFYLLQRIQDEVHRFAVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Bacillus stearothermophilus UvrC 5' endonuclease domain
rcsb
source organism Bacillus stearothermophilus
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 44
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c65A00
2NRTA 3C65A 2NRXA 2NRZA 2NRVA 2NRRA 2NRWA
chains in the Genus database with same CATH superfamily
5AQIA 1LWEA 4M3RA 3THXA 2KKZA 5KQ8A 3V9XA 3U6FA 4KV8A 4IG0A 5LL6Z 4JD2B 4DV7K 2P1JA 5C2DA 1VSJA 4DQPA 5CHIA 2ETJA 1QSYA 2CGLA 1BOTO 4IO9L 4BE1A 3S9HA 5CYMA 3LDSA 4LF5K 1VSEA 5KGXA 3DXKA 3DLBA 1BA0A 4GV9A 1UA1A 4OVLA 4B9VA 2D5RA 1JL1A 2HHUA 1GLEG 3ALYA 4B9TA 2E5LK 4IO8A 3VEZA 2FBVA 1VQPN 3ZT1A 3K5LA 1NGJA 3BP8A 3T1AA 2UXDK 4FJGA 2UXBK 1T3VA 3HTVA 4FLVA 3CC4N 3WXJA 4BREA 3SPYA 2W40A 3S3OA 1MU2A 4JI5K 2P9KA 2P9IB 1NOYA 1JCFA 2P9UA 4I2PA 1VQ5N 4CEZA 2P9KB 4LF9K 3AVFA 4ELTA 2BTFA 3AVNA 2O8BB 1J5EK 3O9TA 1DT9A 2E1ZA 1TV6A 5HRNA 4FVMA 3HPGA 3OYCA 1TVRA 4JKGB 2D1KA 3TU5A 2QKBA 4BC4A 3AA2A 3EY1A 2E88A 3E66A 4M41A 3TSQA 4CZIA 1S6QA 4FK0A 4DTPA 4DWIA 5CE3A 4MO5A 1YTAA 3CCQN 3BDPA 1QHAA 1HNVA 4C8NA 4BRAA 2OZSA 2QWRA 4EZ6A 4M63C 3T3FA 4BQZA 3ULEB 3NGIA 4A2AA 4CZGA 1RBRA 4M7XA 1LAWA 4EHUA 5KRSA 5BN9A 4L3QA 3HOTA 1XHZA 3SBTA 3O9UA 1NMNA 3M8QA 3QEXA 4WQ5C 2O8FB 5AJ3K 5I3UA 4NCAA 1KTQA 1WAJA 4IWVA 2Z1IA 4W5NA 2WOMA 4K25A 5EXWA 3AAPA 4JK7A 2OA8A 2A42A 2NRZA 4CECA 3OJSA 2P5GA 4DUYK 2ZJQL 4DSEA 3G0ZA 4DV4K 4NLCA 1RDAA 3RSEA 1HMVA 3KKSA 3RR8A 4A5BA 1QZ6A 2UUAK 1B92A 4OPJA 2GWJA 5AFUA 1NGCA 3VQEA 1HYZA 1T6DA 1FKOA 4FVUA 1B9FA 4LF8K 1NK0A 1RGIA 5ADXA 4DV1K 1X9SA 1N8RO 1HYSA 4CJ3A 2RHKA 3ZYYX 5LJVA 2YCHA 1BL3A 3H45C 2DFFA 3NF8A 4B3OA 4JS4A 4CERA 3SCXA 3Q7CA 1DKGD 4KTWA 2HMIA 4FZZA 3QERA 1QVFM 4ICLA 4BE2A 2JWKA 3ZSVA 1EO1A 4LF7K 5EY4A 1KVBA 4JKDA 2XY8A 2RF2A 4WQ4C 1UOCA 3PX6A 5AQRA 2WC9A 4Z4CA 3BZCA 4DR6K 2P9SA 1NU0A 3ZSXA 2EX3A 3BZKA 3J7YP 5JVGL 2QXFA 2G8HA 1EX4A 2P9SB 2QKKA 2PZSA 1BISA 3KKRA 3RRHA 1IKWA 3D2FB 3A5LC 4FK2A 4FPAA 3C7NA 4CVNE 3V1OA 2NRTA 2AP1A 4AHCA 4FZXC 1DTTA 1HQUA 1W9HA 3DMJA 2O8DB 4AHVA 3HL8A 1HLUA 3KHYA 3DRRA 3F9MA 4IFYA 3SMPA 2F7TA 3CERA 4E7LA 4KHWA 1E4FT 3CF5L 3RR7A 3RMDA 1RBTA 5E26A 4BR2A 4HHTA 1BG3A 1GLJO 2I7NA 2IS3A 2OPSA 1KQSM 4CJWA 3IUCA 5JS2A 3PX4A 3O80A 1SQKA 4LH4A 3N4QA 4OJRA 4OKKA 3V9WA 3WXMB 3CQXA 1U49A 2HHHK 3EE8A 2OPRA 2YNFA 1L5UA 4KTQA 4IBNA 1BQNA 3S41A 2A41A 4CFDA 4QCLA 4YORA 1C1AA 4CHYA 4RW7A 4C1NK 3LWMA 4CHZA 1VQNN 1KVAA 3L2QA 4CF2A 5M1FA 4Z4EA 1HJRA 3FZFA 3L3VA 3SAHA 3IKMA 4KH4A 4O8KA 1A5WA 1C1CA 2GUPA 1WSJA 1LCUA 1S3XA 3UKRB 2YNGA 2DY4A 2FLOA 2HNYA 1DEJA 4A57A 4IJAA 3HSCA 4CJ7A 1C0FA 3F9KA 3KLFA 4QAGA 3EZ5A 1QQCA 1NG9A 1BI4B 2J4RA 4AQYK 4JKAA 4BDZA 1VSDA 2G8FA 1DTQA 3VEVA 3PSFA 1J5OA 1YTUA 1QVGM 4DSFA 4E7HA 3V9SA 1NM1A 3CYMA 4BC2A 2X6NA 4CJRA 3HBTA 4DSIA 3FR0A 4FPBA 4B1XB 1XUPO 1XWLA 4Z4GA 3CD6N 5HRPA 1MWMA 1S1UA 2QM1A 3DLRA 2XY5A 4W5QA 4IOCL 3AO5A 2NRRA 4K42A 5J2MA 3BGRA 1GLBG 4FWRA 2AJQA 2YX6A 4CGDA 3SQ2A 3D0PA 1N33K 3SUNA 4ILJA 4XH1A 4BWMA 4QS9A 1QQNA 4EP5A 4CEFA 3KIOA 1FKPA 1TYQA 4AILC 2EHGA 3KLEA 1HR0K 5J2PA 2YHXA 3CPWM 2O8DA 2FF3B 5AQUA 4BQLA 4OGCA 4CGHA 3VGMA 2OPQA 4A2BA 3IMXA 2YJEA 4CJVA 4BC5A 4N56A 1L3VA 3CIPA 3ISNC 3VTHA 3M1FA 3VENA 1QS4A 2P9LA 1SKSA 4WE1A 2HNZA 2W6KA 4H5WA 3KLGA 5SWMA 3VTIA 4DB3A 1N32K 1IV0A 2GUIA 1TK5A 1HNIA 5GADP 5J1EA 4LH5A 4FJIA 4CHPA 4BWJA 4KHQA 3H08A 3IDHA 5M1OA 2YKNA 2P9NB 4YY3K 5T7BA 3J7ZO 1KD1O 4CJFA 1TUUA 5HROA 4I9QA 4BGAA 4PKIA 1JLGA 3M3ZA 2IC3A 4FWLA 2XRIA 4IXCA 1C0GA 5KRTA 4DTUA 1U47A 1SAZA 2CH5A 1IJJA 1KAXA 1GOAA 3C6HA 4JYAK 3ZSQA 4CGIA 1Z6RA 3EE9A 4DQQA 2O8EA 3VF4A 4R79A 4AHSA 3K5NA 5I9EB 3QICA 1U45A 1K8KB 2VG5A 4H5VA 2HBKA 4CEEA 5LMUK 4J2DA 4QS8A 3WEEB 4H0VB 4JHDB 4WFAL 1OVQA 4DQRA 3O9RA 3GDQA 1ZBUA 3CCVN 5TKYA 5I42A 4DLEA 2B4JA 4GY2B 1OKJA 4TSXA 4CGFA 3AY9A 4B3TK 4IKFA 4F2RA 3OYNA 1NK4A 2Q97A 4J2BA 4IOAL 2BH1A 3P31A 4FWOA 3ATVA 3DXKB 4DFJA 4JI3K 1C0MA 4JEPA 1Q86O 4DV0K 4Q5VA 5KPRA 4XIUA 1ZBIA 3FZMA 4BRKA 2Q0UA 1YXQA 3KD1E 3D7EO 1OH8A 3QINA 5BRHA 5AQHA 1SV5A 3C7NB 3DLGA 3K5OA 3WXLA 4EZ9A 4YOUA 1CZAN 1NK8A 3ASMA 2CH6A 1ZBLA 4JI8K 3F5TA 2PYLA 1S1VA 1F21A 1HQEA 2HB5A 1JCGA 2HNDA 1JLAA 1VQMN 4PWDA 4CZFA 3QEVA 4W5TA 3B8AX 3CCMN 1Q9XA 3ATUA 3VF2A 3O1BA 3OBYA 1WSHA 1RT1A 2E2NA 1YVUA 4H5TA 4BY9C 3D2EA 1FK9A 3AO1A 3D6RA 4O44A 4CD3A 4JKFA 3QB0A 2Y1JA 2IIRA 3V9ZA 1WB9A 5J2QA 4U7BA 1XNQK 4ID5A 1YT3A 4O0JA 2F9TA 4J8FA 1Y64A 4R5PA 3CFPA 3NVKA 3NGZA 3ENHA 4JRQA 3C94A 4KO0A 4B1ZA 3DAWA 4BRIA 3AO4A 4MLEA 3KLIA 2E8AA 3NBPA 2HHXA 1NLVA 2KW4A 3JYTA 1BCMA 3MCPA 3AGKA 1WN7A 5DMRA 4O5BA 1KRPA 3DLHA 5EVZA 3UKUA 3I33A 5D3GA 3EZWA 3OW2M 4E0DA 3QMLA 1ITGA 1K8KA 4E89A 3L8BA 3O5BA 4B3SK 1S22A 3THYB 3OS2A 3P5JA 4CGGA 4K43A 1ESVA 5FDLA 5HL7L 3I0SA 2HHVA 1NGFA 3V1QA 1YF5L 3AVHA 3ZT4A 3LP3A 4IDHA 4LC9B 5AQTA 3ZEUB 4H8KA 2IDOA 3C65A 3ZX2A 5F1XA 1YJWN 3TAPA 4CJSA 5B8HA 2NRHA 4CBUA 4OLAA 1E4GT 3K59A 2W42A 3VQAA 5KTQA 3V81A 3BF1A 1BGXT 2BGGA 3VQ4A 1N36K 4KAZA 2GWKA 3SLCA 2PFUA 3P1GA 2IGIA 3SQ1A 5F0XA 4FM1A 1W0HA 2RKIA 4N76A 2QWQA 4GW6A 4FOEA 4DKWA 2E2OA 3P83D 2E20A 3MEDA 3KLHA 2WFBA 1C0TA 3D45A 1YITN 5AZIB 4CW7B 3NGYA 5GIOA 5EU7A 3VGLA 4ZHRA 2XO7A 3TTCA 1TK0A 3ULEA 4JK8A 3OYIA 4Z0UA 1SKRA 2KZZA 3NDKA 3SAGA 2IVNA 3LZIA 2GELA 4LFBK 1QHTA 3U4LA 2O8CA 2Z1JA 1NJWA 4CF9A 4JI0K 2VCPA 2G8WA 1HKBA 3KZBA 3VF6A 4DLGA 3LPTA 4JKEA 5EX5A 2ZGYA 2P51A 3T69A 1YVNA 2NRVA 5AQYA 4YOWA 4KB0A 1MA9B 3AA4A 4DSKA 2VWJA 4DR4K 4O5FA 3R1XA 4WFNL 4M3WA 1Q81O 1U4BA 3VEXA 4BRGA 4DUZK 1NJZA 3H3OB 3LWLA 2UUCK 3FGUA 4H5RA 4LFCK 1ZC6A 4EFHA 1M90O 3C6AA 4CJPA 1RDWX 4DF4A 4KFBA 1V4SA 3KWGA 1KAZA 1U2VB 5BRDA 2FF6A 4DU3A 1Q9YA 2IOCA 4B8CA 4E1MA 4DR5K 2YI1A 2G8IA 3PV8A 4DQSA 3G10A 4E7IA 2QWPA 2GEMA 3CCLN 1SL1A 2E2PA 3DOKA 2ZJRL 4JS5A 3MX5A 3WXKA 4CHQA 4DV2K 5KPZA 1BIUA 3OVNA 3J81O 5K14A 3SUOA 2YHYA 1Z25A 3K9KA 4KBOA 3T7ZA 1HNXK 2VYPA 3KK7A 3RSEB 3PIPL 3TAEA 3MK6A 1RTHA 3BUZB 4A62A 3O4QA 3CFOA 3D2FA 4Y1CA 4QS7A 3VA0A 1BO5O 5EOYA 3AVAA 4JI4K 2V51B 1TYQB 2Z1HA 4CESA 1RDUA 4O4GA 1KFDA 4JD2A 4B08A 4IEIA 4C1NI 1OVYA 1VSIA 2AA4A 5AQJA 1S1XA 1VQKN 4KH5A 1U6ZA 1Q8IA 5BR9A 4JRPA 4I9LA 1RFQA 2OANA 3B6OA 2D0AA 3IFRA 3OYMA 3QNNA 4BRQA 1T03A 3FLCO 3LAKA 1RTJA 4JKHA 4FM2A 4H0PA 3K9JA 3ZX0A 3VQCA 5JLHA 3MCAB 1RDCA 1IBLK 1L3UA 3TSPA 2ZJPL 4ISFA 1HX1A 3NF7A 5AZIA 3C6TA 4PKGA 4JV5K 3CQ8A 3QNOA 4MDBA 1IG9A 5AQLA 2GX9A 2OZMA 2D0PA 2FBXA 4XH4A 2HVHA 3R9PA 1IG8A 4DR2K 4AHTA 3VQ5A 3NCIA 5ELZA 2A1RA 3WNHA 4JI1K 1D8YA 1REVA 3QEWA 2E1YA 3O3FA 1RT3A 3AVCA 1LV5A 1CZBA 1HYVA 2O8BA 3CC7N 1RDBA 3U9ZA 3E9OA 3TTFA 1VQLN 3C0BA 2XHBA 4QOZB 4LSLA 3SMSA 4Z4FA 3IRXA 1M1KO 3I0RA 5KI6A 4CJLA 2F9WA 1X3NA 3VMFB 4ELUA 3KK2A 1LW2A 3F2KA 3P39A 3ZT0A 5AQMA 2E6LA 5GAHP 1A5XA 3O4WA 1EXQA 3CJ9A 3WQUA 1LWCA 3RMAA 3DLEA 1HNWK 4DV3K 1ATRA 3ID8A 5AQKA 1VSFA 1S1TA 4KKOA 2BDPA 3NVMA 3OYEA 5IWAK 1V4TA 4FLWA 3RMBA 3ULDA 4EP4A 3H3NO 1H1VA 1LWFA 2I7PA 3VQ6A 4OPKA 4DCHA 4ZTFA 4FK4A 2QEXN 1CXUA 5E84A 1HPZA 4RWTA 3WEEA 4F8RA 3L3UA 5C24A 5JS1A 1S72N 1TKTA 4I2QA 4CBXA 4OPHA 2ASPA 3E01A 3ZETA 4LD0A 1D9FA 3PX0A 5KQDA 3DXMA 2VWKA 3MN7A 5FPNA 4AHUA 3LDQA 4DV5K 1L3SA 3O1WA 2QA4N 1KLNA 4B9UA 4X65K 3V4IA 4EIAA 4B9LA 4DR3K 1JL2A 4DFKA 1O13A 1EETA 3CC2N 2QTDA 3VQ8A 2X78A 3LPUA 4CK2A 2ITGA 4RW4A 3OYAA 1K9MO 4JI6K 1W97L 2WTUA 1U48A 4RCHA 1RT5A 4IZ9A 2P5OA 2ASOA 3NHGA 1RT2A 3R3LA 3LANA 2NLXA 1NK6A 3SZ2A 2A1SA 2FBYA 4O8UA 1YI2N 3J8AA 5BPLA 3HVTA 4IDKA 1OH7A 4M42A 2RE2A 1KC8O 3AAQA 4GNIA 3ZSZA 3LDNA 4RW8A 2O8EB 1GLCG 2QWOA 4FLYA 3CG7A 4GVEA 3VEYA 3CJBA 1Z26A 5HOOA 1TGOA 1W7AA 2WUSA 2D0OA 1YUWA 2HW3A 4DU4A 5H1SQ 3TAFA 3ZSRA 3KK3A 4M3ZA 4U67L 3OYBA 3TR8A 4GMJB 5SZTA 2VG6A 3ZEUA 1VRUA 2FSNA 3DM2A 3VN5A 3THWB 1NJYA 2PYJA 4X64K 1YJNN 4F4KA 1LW0A 2Z1GA 4KREA 1ZXOA 2JWLA 3VQ7A 4GV6A 3G25A 3OYHA 4WYBA 1CZ9A 3DLKA 3CCSN 4CEAA 4BACA 1GLLO 4CZLA 1WSIA 3JSMA 2QWNA 4DTRA 3FZLA 3MN5A 4CZMA 4CJ4A 3T1YK 1BCOA 2H3GX 4B9NA 5CZ2A 1B9DA 3PUFA 4MO4A 2BUPA 3TI0A 3IAYA 2G8VA 5BN8A 3V1RA 3LAMA 3VGKA 3WNEA 5MLCQ 3HOSA 1BI4A 1ZYQA 3EKSA 4IFVA 1WSGA 4FJHA 3RTVA 4CF8A 3MXMA 2Q3SA 2RPIA 2HMPA 2V7YA 1GLFO 2Q2RA 3AVBA 4FXDA 4DTXA 1KCFA 1GLDG 3M8SA 5IT9O 2FC0A 3VQQA 1EQYA 1WBBA 4CJKA 1NK5A 4CIGA 1U04A 3SUPA 4FSVA 3D2EB 4A59A 4G1QA 3TARA 2Q31A 4B1VA 2F8SA 2QXLA 1RDDA 3QBWA 5AQVA 4BRNA 4MQ3A 4NCGA 3O6WA 4WF9L 3DJCA 4JK9A 1KAYA 3L2WA 1D4XA 3ZCMA 4ZTJA 1I94K 4H0XB 4F3TA 1YHQN 1ZBFA 1TL1A 4JAXA 5HBMA 3AGRA 3R6MA 4O0IA 1IKYA 4CFAA 4K41A 1IBKK 1X9MA 4HTUA 4CCHA 3L2UA 5FPMA 3CCJN 1Q7YO 1RT4A 4M3UA 2QI2A 4YOVA 3CPEA 3FFIA 4KI4A 3GBTA 1I39A 1HNZK 4WFBL 4KPYA 3ZT3A 4CFBA 2ZWHA 4N5SA 5CR4A 4CJUA 1QSLA 1BIZA 4E7JA 3E9PA 3DLLL 4CGJA 2JGUA 1VSLA 2HHTA 4DTSA 4HTLA 3AV9A 1NGEA 3NF6A 1Q82O 3ZSYA 3CJ1A 5LMNK 3THVA 1WOQA 2Q0RA 3CJAA 3AO3A 2HF3A 3OYLA 3DWLA 1RT7A 1RNHA 4XEIA 1BU6O 3AVIA 3THXB 3HI0A 4BG8A 1GLAG 4AHRA 2HHSA 1RBVA 1J53A 3V9UA 2RN2A 3A0IX 3SBGA 3QEPA 3FE1A 1IKVA 1L3TA 1VHXA 4PL8A 4JI7K 1JLCA 2YHAA 1JLQA 4DV6K 2A6AA 4M3TA 5BPNA 3QETA 3SV3A 1TAQA 1WUAA 4MFBA 3A8YA 1SL0A 1S9GA 2B6AA 3A5NC 4WCEL 1TUYA 3KD5E 4B9MA 3WT0A 5M1NA 2UXCK 4CI6A 1FJGK 3AVMA 1IH7A 1XNRK 4N41A 1HPMA 3TABA 4FO0A 4CIEA 4DR1K 3VESA 4W5RA 1OH6A 4ELVA 3SQ4A 2D0BA 3DXMB 1VQ6N 1XC3A 3TANA 3FFKB 3ENBA 5FRMA 3WXIA 1JCEA 2R7YA 3LDOA 3MXJA 4FJNA 3CM5A 3QFPA 4YNQA 3VEOA 2XY6A 3MDQA 4BDYA 4JI2K 1VQ8N 3SJJA 2KHOA 3K2PA 2VQFK 4BRFA 3U3GA 1J6ZA 2PBDA 1RTDA 4FWSA 4H0TB 2FSKA 2IVPA 4WQ5A 4K8XA 1ATNA 3E1YA 1SKWA 5AFUH 3L0QA 1JLBA 4JKBA 4OLBA 3AVJA 3OBWA 2ASMA 4M3YA 2VG7A 4C23A 4FJLA 2UYTA 3HRGA 3CETA 3CMEN 1ATSA 3HXMA 1OH5A 3QO9A 2E6MA 1EKEA 3VA3A 3MWPA 5JVHL 3K57A 1FXXA 3ZLJA 3MXIA 2PAVA 4N47A 4H4OA 4FJ8A 3QLHA 3ZSWA 1X1PA 4MDAA 4M7YA 4DF8A 1YAGA 3U9DA 1IO2A 2KQ2A 3KTQA 1T6CA 3M5RA 3SAFA 3DRPA 3T19A 4CEOA 4J2AA 3THWA 5HP1A 1C1BA 4JHDA 4EAHD 4DS4A 2G8KA 5C12A 1HRHA 1N34K 4AH9A 4CF0A 5GINA 3O08A 2A3ZA 1Z05A 3U8XA 4XH5A 4YOXA 4G9ZA 4GVMA 1MWKA 4LF4K 5AZJB 2VWBA 3Q7BA 1VSMA 3AVKA 3ENOA 3EEQA 3QBXA 1ASWA 4FJMA 4DTMA 4CZEA 5AZJA 4B9SA 5M1KA 1K73O 1Q18A 3QFUA 5FLXO 3JAMO 1NGDA 5AQOA 2G8UA 4HUFA 1D9DA 2KFNA 5M1QA 2VQEK 4IEEA 5CZ1A 4DTOA 1N5YA 4MLHA 1VQON 2ZF5O 4FW1A 2P9IA 3FZHA 5FRNA 3NH0A 4BGBA 3CM6A 2D4WA 2GBZA 3LALA 3A5MC 1T7PA 4YOYA 4H4MA 4KI6A 2P9PA 1KSPA 3LP0A 3SNNA 2OCEA 4CD1A 4X66K 2YNHA 4NYNA 4YDUA 2HF4A 5HLFA 4CJTA 3MAQA 2ATQA 3O8MA 4V19S 4JKCA 3HYFA 3EYZA 3HP9A 4BRHA 4DFMA 4PA1A 2F96A 4OKEA 1P8ZA 1NWKA 5GAEP 3HP6A 4FYDA 5FPDA 1TL3A 5ADXH 4F2SA 2YHWA 4CEQA 5AQWA 5AQGA 3UB5A 1RCHA 2Q36A 4BG9A 3RWUA 4I7FA 3ITHA 5BREA 3VETA 3PY8A 4GKJK 3HPHA 1ASUA 4FWQA 3BEXA 3UKUB 4DFPA 4FJKA 4PL7A 4M3XA 2V7ZA 3CFRA 1TKDA 2GTDA 2VGMA 3W0LA 3H46O 1BQMA 4FL9A 1R59O 4Z4HA 1T8EA 4CK3A 1BUPA 3N4PA 2YHBA 1HKGA 4NB4A 3SQ0A 2GV9A 4B1UB 3UE5A 4CF1A 3DOLA 1KFSA 3IG1A 1C0UA 3SPZA 3M8RA 5AR0A 2BE2A 3J80O 1QTMA 3ZSOA 4Z94A 2OTLN 4K8ZA 3LDLA 2X74A 5KPTA 2KTQA 4RW6A 3CMAN 5C25A 3KVGA 2UUBK 4BR5A 1W2BM 3OS0A 4HUEA 4OX9K 4CEBA 4CHOA 5JMVA 3B6PA 4X62K 1S9EA 4CHNA 3OYDA 3HPOA 3TSUA 1VSKA 3J7AP 4BR9A 3MEGA 3CXCM 3GG4A 5CY4A 4GKKK 3H1QA 2Y1IA 1SS6A 1JKHA 4DR7K 4DQ8A 2HVIA 5AQFA 4B1WB 4IG3A 5LJWA 3TAGA 2KZMA 3CJ7A 3NH1A 1X3MA 3ID6A 5GIPA 3S3NA 1S6PA 5C42A 2W41A 5C15A 2HOEA 4AM7A 3CQYA 4H5NA 3FZKA 3L4IA 4Y0WA 3AARA 3OYKA 3SYZA 2DFHA 4C8OA 2P9PB 3VPZA 4NXNK 1NKCA 3MECA 1BA1A 4DQIA 1UAXA 2E2QA 3NFAA 3WNGA 3OS1A 1VK0A 3OHRA 4ILHA 3WNFA 4FZYA 3AVLA 4F9OA 1NGBA 4KHSA 4JN4A 4ID1A 4EHTA 2UU9K 3S3MA 4LY7A 3EL2A 4CBWA 4KHYA 3JS6A 1KVCA 5J2NA 5AQQA 5F2RA 4JLHA 2CGJA 3G6EN 4AF1A 4B1YB 4FOIA 1HJOA 2ZM6K 2IVOA 3TAQA 3CJCA 3MN9A 2OPPA 2QWLA 3WUHA 1JLFA 2O4IA 3RVCA 2YJFA 1VQ9N 3THYA 3O9SA 4FJXA 4FW2A 2O4GA 4DG1A 3TTDA 3HJFA 4HCCA 1TAUA 2NUBA 3BY5A 4LFAK 4A5AA 3LL3A 1ILYA 1BWFO 3LZJA 4FLXA 2PY5A 2JLEA 3C95A 3DRSA 2Q1NA 3NMUA 1WSFA 5DK5A 4DHYA 3VQBA 1QQOA 3E9LA 4BRCA 2QK9A 4FJ9A 4C8LA 4O55A 3HM8A 4HCBA 2NRXA 2HBJA 4FJ5A 1QQMA 3ZX3A 5TKWA 1LOTB 4AM6A 4BVOA 1XHXA 2B5JA 1T44A 1WLJA 1T05A 3HK2A 1GOCA 3ZT2A 5GAGP 4PUOA 3CCEN 1UA0A 3RMCA 1ZBHA 3PLAA 4CE9A 3U3YA 5BR8K 3VQDA 1RBUA 5C10A 3I55N 5KGWA 4KB1A 2P9NA 3SI6A 1JXEA 3MN6A 3HZ6A 1IBMK 3I8DA 4W5OA 1N6QA 4DTJA 4ILGB 2FBTA 2YKMA 4I6MB 5C0YA 3VQ9A 2ITMA 1YIJN 1NJXA 1NGIA 4IJNA 3ZETB 4UY8O 3LDPA 1XC9A 3CHWA 4BROA 1RILA 4C8KA 5A2QO 3PO5A 1XI1A 3LM2A 4HVJA 3LP1A 4FWMA 3PIOL 1NJIO 4WQ4A 1FW6A 4GV3A 3VQPA 3GOIA 5DM7L 1LAVA 2NRWA 1K8AO 4BE0A 1VQ7N 3O3HA 3AA3A 5C2FA 3G4SN 1G15A 5AQNA 1QSSA 2NZTA 5M1PA 4KHUA 1RTIA 1R0AA 4BR0A 1MDUB 3NF9A 1BDGA 5HRRA 3MWTA 4NCBA 2F8TA 4CEDA 4HUGA 1TKXA 2ZQBA 1G99A 1J9AA 4ISGA 1NKBA 4FWKA 3VERA 4E1NA 4LF6K 5AQXA 3V6DA 4CIFA 1TKZA 4E1JA 5DM6L 2YV0X 2DPNA 2A40A 1EWQA 4CFCA 3W3DA 4E3SA 4NXMK 3K0SA 3L6QA 1C6VA 3JXUA 3HVRA 3MMVA 3M6GA 3QDKA 3K58A 1VSHA 3G71N 1NKEA 1EP4A 1SUQA 3O9QA 1BHLA 1QZ5A 2QWMA 3QIPA 4NO7A 3HO1A 3CCUN 3BF3A 1Y97A 1SL2A 4ISEA 5HRSA 2HBLA 4PY5A 5FPEA 4NLBA 1VQ4N 4B3MK 4FJ7A 1X9JA 3PO4A 3OY9A 3TAMA 1TK8A 1DLOA 3LM9A 3VEWA 4KTZA 4KHPK 5AQPA 4CZHA 1IKXA 1JJ2M 3DYAA 4FLTA 4BR7A 4OGEA 2A5XA 3EN9A 2FSJA 4CK1A 4B9QA 2P9LB 3RRGA 2F4VK 2ZD1A 3L4QA 1NMDA 3EO3A 2YNIA 3OYGA 1ASVA 4KRFA 2ZGZA 3CI5A 4CZKA 3MEEA 3HT3A 4FLZA 4E19A 3TWHA 4BRMA 1EWRA 4DSJA 4OKJA 1DGKN 1KXPA 4FM0A 1NNEA 2P9UB 1O1WA 2HHQA 4F3OA 2O8FA 1NK7A 2I5JA 3O4NA 5FROA 1HKCA 4I6MA 1XMQK 3OYFA 3OA9A 4OPAA 1JLEA 3OJUA 4K0KK 1NGGA 4YFUA 1E3MA 2EWSA 1CXQA 3TPQA 3KWIA 2WONA 4Z4IA 1UWBA 2V52B 1XMOK 3HSTB 2QW9A 4BVPA 4CJ5A 3I56N 4FCYA 3A5OC 3KK1A 3A2FA 4RG8A 4JNEA 3NAEA 3IS9A 4DSLA 4Y1DA 2X6SA 4BC3A 4KH6A 3C6UA 4FJJA 4H03B 4H0OA 2XY7A 4YHHK 3QIOA 4L8RB 3SK3A 3PSIA 1WNSA 1CLQA 1XQSC 3OTOK 1NOZA 1KLMA 2OTJN 2DTUA 4RTFD 3LP2A 4LSNA 1D5AA 1VRTA 2ZE2A 3M8PA 4NYFA 5E41A 2KLAA 1NGAA 3T1HK 2LSNA 4A61A 2HBMA 3VOVA 3I8BA 4BR4A 3MX2A 3NE6A 3UIQA 3CCRN 3AA5X 4DU1A 1RBSA 4RW9A 2FXUA 5BRFA 1S1WA 5LY3A 2BANA 3EKUA 3SV4A 3AVGA 3QESA 5AQZA 1NGHA 4YDUC 1GOBA 3R8EA 2O8CB 4B3RK 3GL1A 4JKGA 4DTNA 4J2EA 4YOTA 3WQTA 4CJEA 1J54A 2VGNA 2DFEA 4CJQA 2KFZA 4B8AB 5BPMA 1SZ2A 3GE1A 1A5VA 5CYQA 4PQUA 3H1VX 3HM9A 4Q0BA 4FWPA 3NH2A 4BRLA 1QE1A 4M45A 4HWIA 4BRPA 4FLUA 1K6YA 2E4LA 1WBDA 3F73A 4IFEA 2HSTA 4BRDA 5JLFA 1HUXA 1S5JA 1U2VA 4IOXA 4KHNA 2IAJA 1RT6A 3L2VA 3QEIA 2D0CA 1JXBA 2CGKA 1P90A 2W6LA 2OYQA 2NNWA 3AO2A 4CZJA 3O3GA 3L2RA 3SUQA 1VAZA 1YJ9N 4H0YB 1NBWA 3DI6A 5AQSA 3SJHA 4DMNA 2HHWA 2WBNA 4BDPA 3KJVA 4PKHA 5JICA 4OO1J 1WAFA 1ZBSA 3UKRA 3K5MA 1WSEA 1NK9A 3OYJA 4PHTX 4DS5A 4C8MA 4E7KA 1X9WA 3P4IA 1I3AA 4FWNA 3H6EA 3P38A 4UQGA
chains in the Genus database with same CATH topology
5AQIA 1YXQA 3GG4A 3H1QA 1SS6A 2KKZA 3D7EO 5KQ8A 4DQ8A 5H1SQ 5AQFA 4B1WB 4U67L 5BRHA 5AQHA 4JD2B 3C7NB 5C2DA 5LJWA 3ZEUA 3WXLA 2FSNA 5CHIA 3CJ7A 4YOUA 1CZAN 1YJNN 1X3MA 2CH6A 2CGLA 3ID6A 3F5TA 5GIPA 1ZXOA 1BOTO 1JCGA 2W41A 4IO9L 2JWLA 5C15A 1VQMN 4GV6A 2HOEA 3G25A 4CZFA 4AM7A 3CQYA 4H5NA 3FZKA 3L4IA 4WYBA 3B8AX 3DXKA 4Y0WA 1BA0A 3CCMN 3CCSN 3ATUA 3VF2A 3AARA 4GV9A 3O1BA 1GLLO 4CZLA 2P9PB 3OBYA 2QWNA 2E2NA 3FZLA 4H5TA 3MN5A 3VPZA 4BY9C 3D2EA 4CZMA 1BA1A 1GLEG 2E2QA 2H3GX 3D6RA 4CD3A 4IO8A 3QB0A 4JKFA 3VEZA 2IIRA 3OHRA 4ILHA 1VQPN 4F9OA 1NGBA 4MO4A 1NGJA 3BP8A 4JN4A 2BUPA 4EHTA 4U7BA 1T3VA 5BN8A 3HTVA 3CC4N 3WXJA 4BREA 2W40A 3EL2A 2F9TA 4CBWA 3VGKA 5MLCQ 2P9KA 2P9IB 3JS6A 4J8FA 1Y64A 3HOSA 1JCFA 3EKSA 5AQQA 2P9UA 3NVKA 5F2RA 3ENHA 1VQ5N 2P9KB 2CGJA 3G6EN 2BTFA 3DAWA 4AF1A 4B1ZA 4BRIA 2HMPA 4FOIA 4B1YB 3O9TA 4MLEA 1DT9A 2V7YA 2E1ZA 1HJOA 1GLFO 2E8AA 2Q2RA 1NLVA 1GLDG 3MCPA 4JKGB 2IVOA 2D1KA 3AGKA 3TU5A 1EQYA 3CJCA 4BC4A 3MN9A 2E88A 3E66A 2QWLA 5EVZA 4FSVA 3UKUA 3RVCA 3WUHA 2YJFA 3D2EB 3I33A 4A59A 3TSQA 4CZIA 3EZWA 3OW2M 3QMLA 1VQ9N 3O9SA 2Q31A 4B1VA 1K8KA 2QXLA 5CE3A 3O5BA 4MO5A 3QBWA 3TTDA 5AQVA 4BRNA 3CCQN 1S22A 4K43A 4A5AA 3LL3A 1QHAA 1ILYA 1BWFO 1ESVA 3O6WA 5HL7L 4BRAA 4WF9L 3DJCA 4JK9A 3CXCM 1KAYA 2QWRA 1D4XA 2Q1NA 4H0XB 3NMUA 1YHQN 4M63C 1NGFA 4JAXA 4DHYA 1YF5L 3AGRA 3R6MA 1QQOA 4IDHA 4LC9B 5AQTA 3ULEB 3ZEUB 4A2AA 4M7XA 3E9LA 4BRCA 4K41A 4CZGA 4EHUA 5BN9A 3C65A 3HM8A 4L3QA 3SBTA 3HOTA 3O9UA 2NRXA 3ZX2A 5F1XA 1YJWN 2HBJA 5FPMA 3CCJN 1Q7YO 4WQ5C 1QQMA 5B8HA 2NRHA 2QI2A 4YOVA 4CBUA 3CPEA 1E4GT 4IWVA 3GBTA 3ZX3A 5TKWA 1LOTB 3BF1A 4K25A 4WFBL 4AM6A 2GWKA 3SLCA 5EXWA 3AAPA 2ZWHA 4BVOA 2PFUA 4JK7A 2A42A 1T44A 4BQZA 5CR4A 2NRZA 5F0XA 3E9PA 3DLLL 2QWQA 2ZJQL 4FOEA 4DKWA 4NLCA 2E2OA 4HTLA 5GAGP 3CCEN 2E20A 3RSEA 1NGEA 3PLAA 1Q82O 2WFBA 4A5BA 1QZ6A 5C10A 1YITN 5AZIB 2GWJA 3CJ1A 2D0OA 5AFUA 3I55N 1NGCA 1WOQA 2Q0RA 5GIOA 3CJAA 3VGLA 1T6DA 2P9NA 2HF3A 3TTCA 4FVUA 3DWLA 1RGIA 5ADXA 1N8RO 3MN6A 4XEIA 1BU6O 3ULEA 4JK8A 3HZ6A 2RHKA 3ZYYX 2IVNA 5LJVA 3SAGA 3HI0A 2YCHA 4BG8A 1GLAG 2GELA 3H45C 4ILGB 4I6MB 5C0YA 3U4LA 2ITMA 1YIJN 1NGIA 4IJNA 3ZETB 3Q7CA 4UY8O 1DKGD 3LDPA 1QVFM 3A0IX 3CHWA 3SBGA 4BROA 2JWKA 2VCPA 3FE1A 4PL8A 1HKBA 3KZBA 3LM2A 5EY4A 4JKEA 3VF6A 1EO1A 4JKDA 5EX5A 2ZGYA 4FWMA 3T69A 4WQ4C 1YVNA 2A6AA 2NRVA 4WQ4A 5AQYA 5AQRA 2WC9A 5BPNA 3PIOL 4YOWA 1NJIO 1WUAA 1MA9B 3A8YA 4GV3A 3A5NC 4O5FA 3R1XA 2P9SA 3GOIA 1TUYA 4WCEL 4WFNL 5DM7L 1Q81O 3WT0A 2NRWA 3VEXA 1K8AO 4BRGA 5M1NA 3G4SN 5C2FA 5JVGL 1VQ7N 3H3OB 2P9SB 5AQNA 4CI6A 3FGUA 4H5RA 2NZTA 1ZC6A 4EFHA 5M1PA 1HPMA 1M90O 3C6AA 4FO0A 4BR0A 1MDUB 3D2FB 1RDWX 1BDGA 3A5LC 3VESA 3MWTA 1V4SA 3KWGA 1KAZA 3C7NA 4FPAA 1U2VB 2NRTA 2AP1A 5BRDA 2FF6A 1HLUA 3KHYA 3F9MA 1G99A 2YI1A 4ISGA 3SMPA 3DXMB 4FWKA 1VQ6N 2F7TA 1XC3A 3CERA 3FFKB 3ENBA 1E4FT 3VERA 3CF5L 3WXIA 1JCEA 3CCLN 2QWPA 2GEMA 5AQXA 2E2PA 3LDOA 5E26A 4BR2A 2ZJRL 3MX5A 4E1JA 1BG3A 3QFPA 3WXKA 1GLJO 5DM6L 2DPNA 2A40A 2I7NA 5KPZA 3VEOA 3MDQA 3W3DA 1KQSM 1VQ8N 2KHOA 3IUCA 4BRFA 3L6QA 1J6ZA 3O80A 1SQKA 3JXUA 3N4QA 2PBDA 3MMVA 3M6GA 2YHYA 4FWSA 3K9KA 2FSKA 2IVPA 3CQXA 3QDKA 4H0TB 4KBOA 3T7ZA 3WXMB 4WQ5A 3E1YA 1ATNA 3G71N 5AFUH 2VYPA 3KK7A 3EE8A 3L0QA 3RSEB 3PIPL 3MK6A 3O9QA 4JKBA 3BUZB 2A41A 3S41A 4A62A 1QZ5A 2QWMA 3D2FA 4NO7A 4YORA 4QS7A 3CCUN 1BO5O 3BF3A 5EOYA 3OBWA 2ASMA 2V51B 4C23A 1TYQB 4C1NK 4ISEA 2UYTA 3HRGA 3CETA 2HBLA 1ATSA 1RDUA 3CMEN 1VQNN 4JD2A 5FPEA 4NLBA 4IEIA 4C1NI 1OVYA 3MWPA 5M1FA 1VQ4N 5JVHL 1X9JA 2AA4A 5AQJA 1VQKN 4KH5A 1U6ZA 3FZFA 2PAVA 5BR9A 1RFQA 2OANA 3LM9A 3VEWA 3IFRA 5AQPA 4CZHA 3SAHA 3IKMA 4KH4A 4O8KA 1JJ2M 4BRQA 2GUPA 3FLCO 1LCUA 1S3XA 4BR7A 3UKRB 4JKHA 2A5XA 4H0PA 4MDAA 3EN9A 3K9JA 3ZX0A 4M7YA 5JLHA 2FLOA 1DEJA 2FSJA 4B9QA 2P9LB 4IJAA 4A57A 3MCAB 3HSCA 1YAGA 3TSPA 3U9DA 4ISFA 1HX1A 4CJ7A 5AZIA 1C0FA 2ZJPL 4PKGA 3L4QA 1NMDA 3EO3A 4MDBA 1T6CA 3M5RA 2J4RA 3SAFA 5AQLA 2GX9A 4JKAA 2ZGZA 3CI5A 2D0PA 4XH4A 4CZKA 3VEVA 3R9PA 1IG8A 4EAHD 4JHDA 1QVGM 5ELZA 4BRMA 5C12A 1DGKN 1KXPA 1NM1A 5GINA 3O08A 2A3ZA 2E1YA 2P9UB 1Z05A 3U8XA 4BC2A 3HBTA 4XH5A 3FR0A 4YOXA 4FPBA 4B1XB 1XUPO 4G9ZA 1MWKA 5AZJB 2VWBA 3CC7N 3U9ZA 3E9OA 3Q7BA 3TTFA 1VQLN 1HKCA 4I6MA 3CD6N 1MWMA 3C0BA 3ENOA 3QBXA 2QM1A 3OA9A 4OPAA 4CZEA 5AZJA 5M1KA 3SMSA 1K73O 4IOCL 1M1KO 1NGGA 1Q18A 3QFUA 2NRRA 1NGDA 2EWSA 5AQOA 2F9WA 1X3NA 3TPQA 3KWIA 3VMFB 5M1QA 2V52B 3F2KA 4K42A 4IEEA 2QW9A 1GLBG 3P39A 4FWRA 4BVPA 3A5OC 4MLHA 3I56N 2YX6A 1VQON 4JNEA 5AQMA 4ILJA 2ZF5O 2P9IA 3FZHA 4XH1A 5GAHP 3O4WA 4BC3A 4KH6A 4QS9A 1QQNA 4BGBA 4H03B 4H0OA 3CJ9A 2D4WA 3WQUA 1TYQA 3SK3A 1XQSC 3A5MC 4YOYA 2OTJN 2YHXA 4RTFD 2P9PA 1ATRA 3CPWM 3ID8A 5AQKA 2FF3B 5AQUA 4BQLA 3NVMA 2KLAA 4CD1A 3VGMA 1NGAA 4A2BA 1V4TA 3IMXA 4YDUA 2HF4A 3H3NO 1H1VA 2I7PA 4A61A 2HBMA 2YJEA 4BC5A 3VOVA 3CIPA 3I8BA 4DCHA 3O8MA 3VTHA 3M1FA 3VENA 4BR4A 2QEXN 3MX2A 4JKCA 2P9LA 5E84A 3CCRN 4BRHA 2FXUA 5BRFA 4RWTA 5LY3A 4H5WA 3WEEA 3VTIA 4DB3A 1P8ZA 3EKUA 1S72N 1NWKA 5AQZA 1NGHA 4CBXA 4YDUC 4OPHA 5GADP 2ASPA 3R8EA 5GAEP 3IDHA 5M1OA 3ZETA 2P9NB 5FPDA 3GL1A 4JKGA 3J7ZO 1KD1O 5ADXH 2YHWA 4YOTA 3WQTA 1TUUA 5AQWA 5AQGA 5KQDA 3DXMA 4PKIA 3MN7A 2VGNA 3UB5A 4BGAA 5FPNA 3M3ZA 4FWLA 4IXCA 3LDQA 2Q36A 4BG9A 1C0GA 5BREA 3VETA 3O1WA 2QA4N 1SAZA 5BPMA 2CH5A 1IJJA 1KAXA 4EIAA 1SZ2A 3GE1A 4FWQA 3C6HA 3BEXA 3H1VX 1Z6RA 4FWPA 3EE9A 1O13A 3UKUB 4PL7A 3VF4A 4BRLA 3CC2N 2QTDA 4R79A 2V7ZA 5I9EB 3QICA 4HWIA 4BRPA 1K8KB 2GTDA 2VGMA 3W0LA 3H46O 4H5VA 2HBKA 4FL9A 1R59O 4IFEA 2HSTA 4BRDA 1K9MO 1W97L 5JLFA 1HUXA 1U2VA 1BUPA 4QS8A 3WEEB 4IOXA 4H0VB 4JHDB 3N4PA 4RCHA 1HKGA 4NB4A 4WFAL 4IZ9A 3O9RA 2ASOA 3GDQA 4B1UB 3UE5A 3R3LA 3CCVN 5TKYA 2NLXA 2CGKA 4GY2B 1OKJA 1P90A 3AY9A 5AR0A 2NNWA 1YJ9N 4CZJA 4O8UA 1YI2N 1VAZA 4Z94A 3J8AA 2OTLN 5BPLA 2Q97A 3LDLA 5KPTA 4IOAL 2BH1A 4H0YB 3P31A 4FWOA 3ATVA 1NBWA 5AQSA 3SJHA 3CMAN 2WBNA 3DXKB 2RE2A 3KVGA 4BR5A 1W2BM 1KC8O 4PKHA 5JICA 3AAQA 4GNIA 4OO1J 3LDNA 1ZBSA 3UKRA 5JMVA 4JEPA 1GLCG 2QWOA 1Q86O 4PHTX 3P4IA 4GVEA 3VEYA 4FWNA 3CJBA 5KPRA 3TSUA 3H6EA 3FZMA 3P38A 5HOOA 4BRKA 2WUSA 2Q0UA 4BR9A 1YUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRT A;  3C65 A;  2NRX A;  2NRZ A;  2NRV A;  2NRR A;  2NRW A; 
#chains in the Genus database with same CATH topology
 5AQI A;  1LWE A;  4M3R A;  3THX A;  2KKZ A;  5KQ8 A;  3V9X A;  3U6F A;  4KV8 A;  4IG0 A;  5LL6 Z;  4JD2 B;  4DV7 K;  2P1J A;  5C2D A;  1VSJ A;  4DQP A;  5CHI A;  2ETJ A;  1QSY A;  2CGL A;  1BOT O;  4IO9 L;  4BE1 A;  3S9H A;  5CYM A;  3LDS A;  4LF5 K;  1VSE A;  5KGX A;  3DXK A;  3DLB A;  1BA0 A;  4GV9 A;  1UA1 A;  4OVL A;  4B9V A;  2D5R A;  1JL1 A;  2HHU A;  1GLE G;  3ALY A;  4B9T A;  2E5L K;  4IO8 A;  3VEZ A;  2FBV A;  1VQP N;  3ZT1 A;  3K5L A;  1NGJ A;  3BP8 A;  3T1A A;  2UXD K;  4FJG A;  2UXB K;  1T3V A;  3HTV A;  4FLV A;  3CC4 N;  3WXJ A;  4BRE A;  3SPY A;  2W40 A;  3S3O A;  1MU2 A;  4JI5 K;  2P9K A;  2P9I B;  1NOY A;  1JCF A;  2P9U A;  4I2P A;  1VQ5 N;  4CEZ A;  2P9K B;  4LF9 K;  3AVF A;  4ELT A;  2BTF A;  3AVN A;  2O8B B;  1J5E K;  3O9T A;  1DT9 A;  2E1Z A;  1TV6 A;  5HRN A;  4FVM A;  3HPG A;  3OYC A;  1TVR A;  4JKG B;  2D1K A;  3TU5 A;  2QKB A;  4BC4 A;  3AA2 A;  3EY1 A;  2E88 A;  3E66 A;  4M41 A;  3TSQ A;  4CZI A;  1S6Q A;  4FK0 A;  4DTP A;  4DWI A;  5CE3 A;  4MO5 A;  1YTA A;  3CCQ N;  3BDP A;  1QHA A;  1HNV A;  4C8N A;  4BRA A;  2OZS A;  2QWR A;  4EZ6 A;  4M63 C;  3T3F A;  4BQZ A;  3ULE B;  3NGI A;  4A2A A;  4CZG A;  1RBR A;  4M7X A;  1LAW A;  4EHU A;  5KRS A;  5BN9 A;  4L3Q A;  3HOT A;  1XHZ A;  3SBT A;  3O9U A;  1NMN A;  3M8Q A;  3QEX A;  4WQ5 C;  2O8F B;  5AJ3 K;  5I3U A;  4NCA A;  1KTQ A;  1WAJ A;  4IWV A;  2Z1I A;  4W5N A;  2WOM A;  4K25 A;  5EXW A;  3AAP A;  4JK7 A;  2OA8 A;  2A42 A;  2NRZ A;  4CEC A;  3OJS A;  2P5G A;  4DUY K;  2ZJQ L;  4DSE A;  3G0Z A;  4DV4 K;  4NLC A;  1RDA A;  3RSE A;  1HMV A;  3KKS A;  3RR8 A;  4A5B A;  1QZ6 A;  2UUA K;  1B92 A;  4OPJ A;  2GWJ A;  5AFU A;  1NGC A;  3VQE A;  1HYZ A;  1T6D A;  1FKO A;  4FVU A;  1B9F A;  4LF8 K;  1NK0 A;  1RGI A;  5ADX A;  4DV1 K;  1X9S A;  1N8R O;  1HYS A;  4CJ3 A;  2RHK A;  3ZYY X;  5LJV A;  2YCH A;  1BL3 A;  3H45 C;  2DFF A;  3NF8 A;  4B3O A;  4JS4 A;  4CER A;  3SCX A;  3Q7C A;  1DKG D;  4KTW A;  2HMI A;  4FZZ A;  3QER A;  1QVF M;  4ICL A;  4BE2 A;  2JWK A;  3ZSV A;  1EO1 A;  4LF7 K;  5EY4 A;  1KVB A;  4JKD A;  2XY8 A;  2RF2 A;  4WQ4 C;  1UOC A;  3PX6 A;  5AQR A;  2WC9 A;  4Z4C A;  3BZC A;  4DR6 K;  2P9S A;  1NU0 A;  3ZSX A;  2EX3 A;  3BZK A;  3J7Y P;  5JVG L;  2QXF A;  2G8H A;  1EX4 A;  2P9S B;  2QKK A;  2PZS A;  1BIS A;  3KKR A;  3RRH A;  1IKW A;  3D2F B;  3A5L C;  4FK2 A;  4FPA A;  3C7N A;  4CVN E;  3V1O A;  2NRT A;  2AP1 A;  4AHC A;  4FZX C;  1DTT A;  1HQU A;  1W9H A;  3DMJ A;  2O8D B;  4AHV A;  3HL8 A;  1HLU A;  3KHY A;  3DRR A;  3F9M A;  4IFY A;  3SMP A;  2F7T A;  3CER A;  4E7L A;  4KHW A;  1E4F T;  3CF5 L;  3RR7 A;  3RMD A;  1RBT A;  5E26 A;  4BR2 A;  4HHT A;  1BG3 A;  1GLJ O;  2I7N A;  2IS3 A;  2OPS A;  1KQS M;  4CJW A;  3IUC A;  5JS2 A;  3PX4 A;  3O80 A;  1SQK A;  4LH4 A;  3N4Q A;  4OJR A;  4OKK A;  3V9W A;  3WXM B;  3CQX A;  1U49 A;  2HHH K;  3EE8 A;  2OPR A;  2YNF A;  1L5U A;  4KTQ A;  4IBN A;  1BQN A;  3S41 A;  2A41 A;  4CFD A;  4QCL A;  4YOR A;  1C1A A;  4CHY A;  4RW7 A;  4C1N K;  3LWM A;  4CHZ A;  1VQN N;  1KVA A;  3L2Q A;  4CF2 A;  5M1F A;  4Z4E A;  1HJR A;  3FZF A;  3L3V A;  3SAH A;  3IKM A;  4KH4 A;  4O8K A;  1A5W A;  1C1C A;  2GUP A;  1WSJ A;  1LCU A;  1S3X A;  3UKR B;  2YNG A;  2DY4 A;  2FLO A;  2HNY A;  1DEJ A;  4A57 A;  4IJA A;  3HSC A;  4CJ7 A;  1C0F A;  3F9K A;  3KLF A;  4QAG A;  3EZ5 A;  1QQC A;  1NG9 A;  1BI4 B;  2J4R A;  4AQY K;  4JKA A;  4BDZ A;  1VSD A;  2G8F A;  1DTQ A;  3VEV A;  3PSF A;  1J5O A;  1YTU A;  1QVG M;  4DSF A;  4E7H A;  3V9S A;  1NM1 A;  3CYM A;  4BC2 A;  2X6N A;  4CJR A;  3HBT A;  4DSI A;  3FR0 A;  4FPB A;  4B1X B;  1XUP O;  1XWL A;  4Z4G A;  3CD6 N;  5HRP A;  1MWM A;  1S1U A;  2QM1 A;  3DLR A;  2XY5 A;  4W5Q A;  4IOC L;  3AO5 A;  2NRR A;  4K42 A;  5J2M A;  3BGR A;  1GLB G;  4FWR A;  2AJQ A;  2YX6 A;  4CGD A;  3SQ2 A;  3D0P A;  1N33 K;  3SUN A;  4ILJ A;  4XH1 A;  4BWM A;  4QS9 A;  1QQN A;  4EP5 A;  4CEF A;  3KIO A;  1FKP A;  1TYQ A;  4AIL C;  2EHG A;  3KLE A;  1HR0 K;  5J2P A;  2YHX A;  3CPW M;  2O8D A;  2FF3 B;  5AQU A;  4BQL A;  4OGC A;  4CGH A;  3VGM A;  2OPQ A;  4A2B A;  3IMX A;  2YJE A;  4CJV A;  4BC5 A;  4N56 A;  1L3V A;  3CIP A;  3ISN C;  3VTH A;  3M1F A;  3VEN A;  1QS4 A;  2P9L A;  1SKS A;  4WE1 A;  2HNZ A;  2W6K A;  4H5W A;  3KLG A;  5SWM A;  3VTI A;  4DB3 A;  1N32 K;  1IV0 A;  2GUI A;  1TK5 A;  1HNI A;  5GAD P;  5J1E A;  4LH5 A;  4FJI A;  4CHP A;  4BWJ A;  4KHQ A;  3H08 A;  3IDH A;  5M1O A;  2YKN A;  2P9N B;  4YY3 K;  5T7B A;  3J7Z O;  1KD1 O;  4CJF A;  1TUU A;  5HRO A;  4I9Q A;  4BGA A;  4PKI A;  1JLG A;  3M3Z A;  2IC3 A;  4FWL A;  2XRI A;  4IXC A;  1C0G A;  5KRT A;  4DTU A;  1U47 A;  1SAZ A;  2CH5 A;  1IJJ A;  1KAX A;  1GOA A;  3C6H A;  4JYA K;  3ZSQ A;  4CGI A;  1Z6R A;  3EE9 A;  4DQQ A;  2O8E A;  3VF4 A;  4R79 A;  4AHS A;  3K5N A;  5I9E B;  3QIC A;  1U45 A;  1K8K B;  2VG5 A;  4H5V A;  2HBK A;  4CEE A;  5LMU K;  4J2D A;  4QS8 A;  3WEE B;  4H0V B;  4JHD B;  4WFA L;  1OVQ A;  4DQR A;  3O9R A;  3GDQ A;  1ZBU A;  3CCV N;  5TKY A;  5I42 A;  4DLE A;  2B4J A;  4GY2 B;  1OKJ A;  4TSX A;  4CGF A;  3AY9 A;  4B3T K;  4IKF A;  4F2R A;  3OYN A;  1NK4 A;  2Q97 A;  4J2B A;  4IOA L;  2BH1 A;  3P31 A;  4FWO A;  3ATV A;  3DXK B;  4DFJ A;  4JI3 K;  1C0M A;  4JEP A;  1Q86 O;  4DV0 K;  4Q5V A;  5KPR A;  4XIU A;  1ZBI A;  3FZM A;  4BRK A;  2Q0U A;  1YXQ A;  3KD1 E;  3D7E O;  1OH8 A;  3QIN A;  5BRH A;  5AQH A;  1SV5 A;  3C7N B;  3DLG A;  3K5O A;  3WXL A;  4EZ9 A;  4YOU A;  1CZA N;  1NK8 A;  3ASM A;  2CH6 A;  1ZBL A;  4JI8 K;  3F5T A;  2PYL A;  1S1V A;  1F21 A;  1HQE A;  2HB5 A;  1JCG A;  2HND A;  1JLA A;  1VQM N;  4PWD A;  4CZF A;  3QEV A;  4W5T A;  3B8A X;  3CCM N;  1Q9X A;  3ATU A;  3VF2 A;  3O1B A;  3OBY A;  1WSH A;  1RT1 A;  2E2N A;  1YVU A;  4H5T A;  4BY9 C;  3D2E A;  1FK9 A;  3AO1 A;  3D6R A;  4O44 A;  4CD3 A;  4JKF A;  3QB0 A;  2Y1J A;  2IIR A;  3V9Z A;  1WB9 A;  5J2Q A;  4U7B A;  1XNQ K;  4ID5 A;  1YT3 A;  4O0J A;  2F9T A;  4J8F A;  1Y64 A;  4R5P A;  3CFP A;  3NVK A;  3NGZ A;  3ENH A;  4JRQ A;  3C94 A;  4KO0 A;  4B1Z A;  3DAW A;  4BRI A;  3AO4 A;  4MLE A;  3KLI A;  2E8A A;  3NBP A;  2HHX A;  1NLV A;  2KW4 A;  3JYT A;  1BCM A;  3MCP A;  3AGK A;  1WN7 A;  5DMR A;  4O5B A;  1KRP A;  3DLH A;  5EVZ A;  3UKU A;  3I33 A;  5D3G A;  3EZW A;  3OW2 M;  4E0D A;  3QML A;  1ITG A;  1K8K A;  4E89 A;  3L8B A;  3O5B A;  4B3S K;  1S22 A;  3THY B;  3OS2 A;  3P5J A;  4CGG A;  4K43 A;  1ESV A;  5FDL A;  5HL7 L;  3I0S A;  2HHV A;  1NGF A;  3V1Q A;  1YF5 L;  3AVH A;  3ZT4 A;  3LP3 A;  4IDH A;  4LC9 B;  5AQT A;  3ZEU B;  4H8K A;  2IDO A;  3C65 A;  3ZX2 A;  5F1X A;  1YJW N;  3TAP A;  4CJS A;  5B8H A;  2NRH A;  4CBU A;  4OLA A;  1E4G T;  3K59 A;  2W42 A;  3VQA A;  5KTQ A;  3V81 A;  3BF1 A;  1BGX T;  2BGG A;  3VQ4 A;  1N36 K;  4KAZ A;  2GWK A;  3SLC A;  2PFU A;  3P1G A;  2IGI A;  3SQ1 A;  5F0X A;  4FM1 A;  1W0H A;  2RKI A;  4N76 A;  2QWQ A;  4GW6 A;  4FOE A;  4DKW A;  2E2O A;  3P83 D;  2E20 A;  3MED A;  3KLH A;  2WFB A;  1C0T A;  3D45 A;  1YIT N;  5AZI B;  4CW7 B;  3NGY A;  5GIO A;  5EU7 A;  3VGL A;  4ZHR A;  2XO7 A;  3TTC A;  1TK0 A;  3ULE A;  4JK8 A;  3OYI A;  4Z0U A;  1SKR A;  2KZZ A;  3NDK A;  3SAG A;  2IVN A;  3LZI A;  2GEL A;  4LFB K;  1QHT A;  3U4L A;  2O8C A;  2Z1J A;  1NJW A;  4CF9 A;  4JI0 K;  2VCP A;  2G8W A;  1HKB A;  3KZB A;  3VF6 A;  4DLG A;  3LPT A;  4JKE A;  5EX5 A;  2ZGY A;  2P51 A;  3T69 A;  1YVN A;  2NRV A;  5AQY A;  4YOW A;  4KB0 A;  1MA9 B;  3AA4 A;  4DSK A;  2VWJ A;  4DR4 K;  4O5F A;  3R1X A;  4WFN L;  4M3W A;  1Q81 O;  1U4B A;  3VEX A;  4BRG A;  4DUZ K;  1NJZ A;  3H3O B;  3LWL A;  2UUC K;  3FGU A;  4H5R A;  4LFC K;  1ZC6 A;  4EFH A;  1M90 O;  3C6A A;  4CJP A;  1RDW X;  4DF4 A;  4KFB A;  1V4S A;  3KWG A;  1KAZ A;  1U2V B;  5BRD A;  2FF6 A;  4DU3 A;  1Q9Y A;  2IOC A;  4B8C A;  4E1M A;  4DR5 K;  2YI1 A;  2G8I A;  3PV8 A;  4DQS A;  3G10 A;  4E7I A;  2QWP A;  2GEM A;  3CCL N;  1SL1 A;  2E2P A;  3DOK A;  2ZJR L;  4JS5 A;  3MX5 A;  3WXK A;  4CHQ A;  4DV2 K;  5KPZ A;  1BIU A;  3OVN A;  3J81 O;  5K14 A;  3SUO A;  2YHY A;  1Z25 A;  3K9K A;  4KBO A;  3T7Z A;  1HNX K;  2VYP A;  3KK7 A;  3RSE B;  3PIP L;  3TAE A;  3MK6 A;  1RTH A;  3BUZ B;  4A62 A;  3O4Q A;  3CFO A;  3D2F A;  4Y1C A;  4QS7 A;  3VA0 A;  1BO5 O;  5EOY A;  3AVA A;  4JI4 K;  2V51 B;  1TYQ B;  2Z1H A;  4CES A;  1RDU A;  4O4G A;  1KFD A;  4JD2 A;  4B08 A;  4IEI A;  4C1N I;  1OVY A;  1VSI A;  2AA4 A;  5AQJ A;  1S1X A;  1VQK N;  4KH5 A;  1U6Z A;  1Q8I A;  5BR9 A;  4JRP A;  4I9L A;  1RFQ A;  2OAN A;  3B6O A;  2D0A A;  3IFR A;  3OYM A;  3QNN A;  4BRQ A;  1T03 A;  3FLC O;  3LAK A;  1RTJ A;  4JKH A;  4FM2 A;  4H0P A;  3K9J A;  3ZX0 A;  3VQC A;  5JLH A;  3MCA B;  1RDC A;  1IBL K;  1L3U A;  3TSP A;  2ZJP L;  4ISF A;  1HX1 A;  3NF7 A;  5AZI A;  3C6T A;  4PKG A;  4JV5 K;  3CQ8 A;  3QNO A;  4MDB A;  1IG9 A;  5AQL A;  2GX9 A;  2OZM A;  2D0P A;  2FBX A;  4XH4 A;  2HVH A;  3R9P A;  1IG8 A;  4DR2 K;  4AHT A;  3VQ5 A;  3NCI A;  5ELZ A;  2A1R A;  3WNH A;  4JI1 K;  1D8Y A;  1REV A;  3QEW A;  2E1Y A;  3O3F A;  1RT3 A;  3AVC A;  1LV5 A;  1CZB A;  1HYV A;  2O8B A;  3CC7 N;  1RDB A;  3U9Z A;  3E9O A;  3TTF A;  1VQL N;  3C0B A;  2XHB A;  4QOZ B;  4LSL A;  3SMS A;  4Z4F A;  3IRX A;  1M1K O;  3I0R A;  5KI6 A;  4CJL A;  2F9W A;  1X3N A;  3VMF B;  4ELU A;  3KK2 A;  1LW2 A;  3F2K A;  3P39 A;  3ZT0 A;  5AQM A;  2E6L A;  5GAH P;  1A5X A;  3O4W A;  1EXQ A;  3CJ9 A;  3WQU A;  1LWC A;  3RMA A;  3DLE A;  1HNW K;  4DV3 K;  1ATR A;  3ID8 A;  5AQK A;  1VSF A;  1S1T A;  4KKO A;  2BDP A;  3NVM A;  3OYE A;  5IWA K;  1V4T A;  4FLW A;  3RMB A;  3ULD A;  4EP4 A;  3H3N O;  1H1V A;  1LWF A;  2I7P A;  3VQ6 A;  4OPK A;  4DCH A;  4ZTF A;  4FK4 A;  2QEX N;  1CXU A;  5E84 A;  1HPZ A;  4RWT A;  3WEE A;  4F8R A;  3L3U A;  5C24 A;  5JS1 A;  1S72 N;  1TKT A;  4I2Q A;  4CBX A;  4OPH A;  2ASP A;  3E01 A;  3ZET A;  4LD0 A;  1D9F A;  3PX0 A;  5KQD A;  3DXM A;  2VWK A;  3MN7 A;  5FPN A;  4AHU A;  3LDQ A;  4DV5 K;  1L3S A;  3O1W A;  2QA4 N;  1KLN A;  4B9U A;  4X65 K;  3V4I A;  4EIA A;  4B9L A;  4DR3 K;  1JL2 A;  4DFK A;  1O13 A;  1EET A;  3CC2 N;  2QTD A;  3VQ8 A;  2X78 A;  3LPU A;  4CK2 A;  2ITG A;  4RW4 A;  3OYA A;  1K9M O;  4JI6 K;  1W97 L;  2WTU A;  1U48 A;  4RCH A;  1RT5 A;  4IZ9 A;  2P5O A;  2ASO A;  3NHG A;  1RT2 A;  3R3L A;  3LAN A;  2NLX A;  1NK6 A;  3SZ2 A;  2A1S A;  2FBY A;  4O8U A;  1YI2 N;  3J8A A;  5BPL A;  3HVT A;  4IDK A;  1OH7 A;  4M42 A;  2RE2 A;  1KC8 O;  3AAQ A;  4GNI A;  3ZSZ A;  3LDN A;  4RW8 A;  2O8E B;  1GLC G;  2QWO A;  4FLY A;  3CG7 A;  4GVE A;  3VEY A;  3CJB A;  1Z26 A;  5HOO A;  1TGO A;  1W7A A;  2WUS A;  2D0O A;  1YUW A;  2HW3 A;  4DU4 A;  5H1S Q;  3TAF A;  3ZSR A;  3KK3 A;  4M3Z A;  4U67 L;  3OYB A;  3TR8 A;  4GMJ B;  5SZT A;  2VG6 A;  3ZEU A;  1VRU A;  2FSN A;  3DM2 A;  3VN5 A;  3THW B;  1NJY A;  2PYJ A;  4X64 K;  1YJN N;  4F4K A;  1LW0 A;  2Z1G A;  4KRE A;  1ZXO A;  2JWL A;  3VQ7 A;  4GV6 A;  3G25 A;  3OYH A;  4WYB A;  1CZ9 A;  3DLK A;  3CCS N;  4CEA A;  4BAC A;  1GLL O;  4CZL A;  1WSI A;  3JSM A;  2QWN A;  4DTR A;  3FZL A;  3MN5 A;  4CZM A;  4CJ4 A;  3T1Y K;  1BCO A;  2H3G X;  4B9N A;  5CZ2 A;  1B9D A;  3PUF A;  4MO4 A;  2BUP A;  3TI0 A;  3IAY A;  2G8V A;  5BN8 A;  3V1R A;  3LAM A;  3VGK A;  3WNE A;  5MLC Q;  3HOS A;  1BI4 A;  1ZYQ A;  3EKS A;  4IFV A;  1WSG A;  4FJH A;  3RTV A;  4CF8 A;  3MXM A;  2Q3S A;  2RPI A;  2HMP A;  2V7Y A;  1GLF O;  2Q2R A;  3AVB A;  4FXD A;  4DTX A;  1KCF A;  1GLD G;  3M8S A;  5IT9 O;  2FC0 A;  3VQQ A;  1EQY A;  1WBB A;  4CJK A;  1NK5 A;  4CIG A;  1U04 A;  3SUP A;  4FSV A;  3D2E B;  4A59 A;  4G1Q A;  3TAR A;  2Q31 A;  4B1V A;  2F8S A;  2QXL A;  1RDD A;  3QBW A;  5AQV A;  4BRN A;  4MQ3 A;  4NCG A;  3O6W A;  4WF9 L;  3DJC A;  4JK9 A;  1KAY A;  3L2W A;  1D4X A;  3ZCM A;  4ZTJ A;  1I94 K;  4H0X B;  4F3T A;  1YHQ N;  1ZBF A;  1TL1 A;  4JAX A;  5HBM A;  3AGR A;  3R6M A;  4O0I A;  1IKY A;  4CFA A;  4K41 A;  1IBK K;  1X9M A;  4HTU A;  4CCH A;  3L2U A;  5FPM A;  3CCJ N;  1Q7Y O;  1RT4 A;  4M3U A;  2QI2 A;  4YOV A;  3CPE A;  3FFI A;  4KI4 A;  3GBT A;  1I39 A;  1HNZ K;  4WFB L;  4KPY A;  3ZT3 A;  4CFB A;  2ZWH A;  4N5S A;  5CR4 A;  4CJU A;  1QSL A;  1BIZ A;  4E7J A;  3E9P A;  3DLL L;  4CGJ A;  2JGU A;  1VSL A;  2HHT A;  4DTS A;  4HTL A;  3AV9 A;  1NGE A;  3NF6 A;  1Q82 O;  3ZSY A;  3CJ1 A;  5LMN K;  3THV A;  1WOQ A;  2Q0R A;  3CJA A;  3AO3 A;  2HF3 A;  3OYL A;  3DWL A;  1RT7 A;  1RNH A;  4XEI A;  1BU6 O;  3AVI A;  3THX B;  3HI0 A;  4BG8 A;  1GLA G;  4AHR A;  2HHS A;  1RBV A;  1J53 A;  3V9U A;  2RN2 A;  3A0I X;  3SBG A;  3QEP A;  3FE1 A;  1IKV A;  1L3T A;  1VHX A;  4PL8 A;  4JI7 K;  1JLC A;  2YHA A;  1JLQ A;  4DV6 K;  2A6A A;  4M3T A;  5BPN A;  3QET A;  3SV3 A;  1TAQ A;  1WUA A;  4MFB A;  3A8Y A;  1SL0 A;  1S9G A;  2B6A A;  3A5N C;  4WCE L;  1TUY A;  3KD5 E;  4B9M A;  3WT0 A;  5M1N A;  2UXC K;  4CI6 A;  1FJG K;  3AVM A;  1IH7 A;  1XNR K;  4N41 A;  1HPM A;  3TAB A;  4FO0 A;  4CIE A;  4DR1 K;  3VES A;  4W5R A;  1OH6 A;  4ELV A;  3SQ4 A;  2D0B A;  3DXM B;  1VQ6 N;  1XC3 A;  3TAN A;  3FFK B;  3ENB A;  5FRM A;  3WXI A;  1JCE A;  2R7Y A;  3LDO A;  3MXJ A;  4FJN A;  3CM5 A;  3QFP A;  4YNQ A;  3VEO A;  2XY6 A;  3MDQ A;  4BDY A;  4JI2 K;  1VQ8 N;  3SJJ A;  2KHO A;  3K2P A;  2VQF K;  4BRF A;  3U3G A;  1J6Z A;  2PBD A;  1RTD A;  4FWS A;  4H0T B;  2FSK A;  2IVP A;  4WQ5 A;  4K8X A;  1ATN A;  3E1Y A;  1SKW A;  5AFU H;  3L0Q A;  1JLB A;  4JKB A;  4OLB A;  3AVJ A;  3OBW A;  2ASM A;  4M3Y A;  2VG7 A;  4C23 A;  4FJL A;  2UYT A;  3HRG A;  3CET A;  3CME N;  1ATS A;  3HXM A;  1OH5 A;  3QO9 A;  2E6M A;  1EKE A;  3VA3 A;  3MWP A;  5JVH L;  3K57 A;  1FXX A;  3ZLJ A;  3MXI A;  2PAV A;  4N47 A;  4H4O A;  4FJ8 A;  3QLH A;  3ZSW A;  1X1P A;  4MDA A;  4M7Y A;  4DF8 A;  1YAG A;  3U9D A;  1IO2 A;  2KQ2 A;  3KTQ A;  1T6C A;  3M5R A;  3SAF A;  3DRP A;  3T19 A;  4CEO A;  4J2A A;  3THW A;  5HP1 A;  1C1B A;  4JHD A;  4EAH D;  4DS4 A;  2G8K A;  5C12 A;  1HRH A;  1N34 K;  4AH9 A;  4CF0 A;  5GIN A;  3O08 A;  2A3Z A;  1Z05 A;  3U8X A;  4XH5 A;  4YOX A;  4G9Z A;  4GVM A;  1MWK A;  4LF4 K;  5AZJ B;  2VWB A;  3Q7B A;  1VSM A;  3AVK A;  3ENO A;  3EEQ A;  3QBX A;  1ASW A;  4FJM A;  4DTM A;  4CZE A;  5AZJ A;  4B9S A;  5M1K A;  1K73 O;  1Q18 A;  3QFU A;  5FLX O;  3JAM O;  1NGD A;  5AQO A;  2G8U A;  4HUF A;  1D9D A;  2KFN A;  5M1Q A;  2VQE K;  4IEE A;  5CZ1 A;  4DTO A;  1N5Y A;  4MLH A;  1VQO N;  2ZF5 O;  4FW1 A;  2P9I A;  3FZH A;  5FRN A;  3NH0 A;  4BGB A;  3CM6 A;  2D4W A;  2GBZ A;  3LAL A;  3A5M C;  1T7P A;  4YOY A;  4H4M A;  4KI6 A;  2P9P A;  1KSP A;  3LP0 A;  3SNN A;  2OCE A;  4CD1 A;  4X66 K;  2YNH A;  4NYN A;  4YDU A;  2HF4 A;  5HLF A;  4CJT A;  3MAQ A;  2ATQ A;  3O8M A;  4V19 S;  4JKC A;  3HYF A;  3EYZ A;  3HP9 A;  4BRH A;  4DFM A;  4PA1 A;  2F96 A;  4OKE A;  1P8Z A;  1NWK A;  5GAE P;  3HP6 A;  4FYD A;  5FPD A;  1TL3 A;  5ADX H;  4F2S A;  2YHW A;  4CEQ A;  5AQW A;  5AQG A;  3UB5 A;  1RCH A;  2Q36 A;  4BG9 A;  3RWU A;  4I7F A;  3ITH A;  5BRE A;  3VET A;  3PY8 A;  4GKJ K;  3HPH A;  1ASU A;  4FWQ A;  3BEX A;  3UKU B;  4DFP A;  4FJK A;  4PL7 A;  4M3X A;  2V7Z A;  3CFR A;  1TKD A;  2GTD A;  2VGM A;  3W0L A;  3H46 O;  1BQM A;  4FL9 A;  1R59 O;  4Z4H A;  1T8E A;  4CK3 A;  1BUP A;  3N4P A;  2YHB A;  1HKG A;  4NB4 A;  3SQ0 A;  2GV9 A;  4B1U B;  3UE5 A;  4CF1 A;  3DOL A;  1KFS A;  3IG1 A;  1C0U A;  3SPZ A;  3M8R A;  5AR0 A;  2BE2 A;  3J80 O;  1QTM A;  3ZSO A;  4Z94 A;  2OTL N;  4K8Z A;  3LDL A;  2X74 A;  5KPT A;  2KTQ A;  4RW6 A;  3CMA N;  5C25 A;  3KVG A;  2UUB K;  4BR5 A;  1W2B M;  3OS0 A;  4HUE A;  4OX9 K;  4CEB A;  4CHO A;  5JMV A;  3B6P A;  4X62 K;  1S9E A;  4CHN A;  3OYD A;  3HPO A;  3TSU A;  1VSK A;  3J7A P;  4BR9 A;  3MEG A;  3CXC M;  3GG4 A;  5CY4 A;  4GKK K;  3H1Q A;  2Y1I A;  1SS6 A;  1JKH A;  4DR7 K;  4DQ8 A;  2HVI A;  5AQF A;  4B1W B;  4IG3 A;  5LJW A;  3TAG A;  2KZM A;  3CJ7 A;  3NH1 A;  1X3M A;  3ID6 A;  5GIP A;  3S3N A;  1S6P A;  5C42 A;  2W41 A;  5C15 A;  2HOE A;  4AM7 A;  3CQY A;  4H5N A;  3FZK A;  3L4I A;  4Y0W A;  3AAR A;  3OYK A;  3SYZ A;  2DFH A;  4C8O A;  2P9P B;  3VPZ A;  4NXN K;  1NKC A;  3MEC A;  1BA1 A;  4DQI A;  1UAX A;  2E2Q A;  3NFA A;  3WNG A;  3OS1 A;  1VK0 A;  3OHR A;  4ILH A;  3WNF A;  4FZY A;  3AVL A;  4F9O A;  1NGB A;  4KHS A;  4JN4 A;  4ID1 A;  4EHT A;  2UU9 K;  3S3M A;  4LY7 A;  3EL2 A;  4CBW A;  4KHY A;  3JS6 A;  1KVC A;  5J2N A;  5AQQ A;  5F2R A;  4JLH A;  2CGJ A;  3G6E N;  4AF1 A;  4B1Y B;  4FOI A;  1HJO A;  2ZM6 K;  2IVO A;  3TAQ A;  3CJC A;  3MN9 A;  2OPP A;  2QWL A;  3WUH A;  1JLF A;  2O4I A;  3RVC A;  2YJF A;  1VQ9 N;  3THY A;  3O9S A;  4FJX A;  4FW2 A;  2O4G A;  4DG1 A;  3TTD A;  3HJF A;  4HCC A;  1TAU A;  2NUB A;  3BY5 A;  4LFA K;  4A5A A;  3LL3 A;  1ILY A;  1BWF O;  3LZJ A;  4FLX A;  2PY5 A;  2JLE A;  3C95 A;  3DRS A;  2Q1N A;  3NMU A;  1WSF A;  5DK5 A;  4DHY A;  3VQB A;  1QQO A;  3E9L A;  4BRC A;  2QK9 A;  4FJ9 A;  4C8L A;  4O55 A;  3HM8 A;  4HCB A;  2NRX A;  2HBJ A;  4FJ5 A;  1QQM A;  3ZX3 A;  5TKW A;  1LOT B;  4AM6 A;  4BVO A;  1XHX A;  2B5J A;  1T44 A;  1WLJ A;  1T05 A;  3HK2 A;  1GOC A;  3ZT2 A;  5GAG P;  4PUO A;  3CCE N;  1UA0 A;  3RMC A;  1ZBH A;  3PLA A;  4CE9 A;  3U3Y A;  5BR8 K;  3VQD A;  1RBU A;  5C10 A;  3I55 N;  5KGW A;  4KB1 A;  2P9N A;  3SI6 A;  1JXE A;  3MN6 A;  3HZ6 A;  1IBM K;  3I8D A;  4W5O A;  1N6Q A;  4DTJ A;  4ILG B;  2FBT A;  2YKM A;  4I6M B;  5C0Y A;  3VQ9 A;  2ITM A;  1YIJ N;  1NJX A;  1NGI A;  4IJN A;  3ZET B;  4UY8 O;  3LDP A;  1XC9 A;  3CHW A;  4BRO A;  1RIL A;  4C8K A;  5A2Q O;  3PO5 A;  1XI1 A;  3LM2 A;  4HVJ A;  3LP1 A;  4FWM A;  3PIO L;  1NJI O;  4WQ4 A;  1FW6 A;  4GV3 A;  3VQP A;  3GOI A;  5DM7 L;  1LAV A;  2NRW A;  1K8A O;  4BE0 A;  1VQ7 N;  3O3H A;  3AA3 A;  5C2F A;  3G4S N;  1G15 A;  5AQN A;  1QSS A;  2NZT A;  5M1P A;  4KHU A;  1RTI A;  1R0A A;  4BR0 A;  1MDU B;  3NF9 A;  1BDG A;  5HRR A;  3MWT A;  4NCB A;  2F8T A;  4CED A;  4HUG A;  1TKX A;  2ZQB A;  1G99 A;  1J9A A;  4ISG A;  1NKB A;  4FWK A;  3VER A;  4E1N A;  4LF6 K;  5AQX A;  3V6D A;  4CIF A;  1TKZ A;  4E1J A;  5DM6 L;  2YV0 X;  2DPN A;  2A40 A;  1EWQ A;  4CFC A;  3W3D A;  4E3S A;  4NXM K;  3K0S A;  3L6Q A;  1C6V A;  3JXU A;  3HVR A;  3MMV A;  3M6G A;  3QDK A;  3K58 A;  1VSH A;  3G71 N;  1NKE A;  1EP4 A;  1SUQ A;  3O9Q A;  1BHL A;  1QZ5 A;  2QWM A;  3QIP A;  4NO7 A;  3HO1 A;  3CCU N;  3BF3 A;  1Y97 A;  1SL2 A;  4ISE A;  5HRS A;  2HBL A;  4PY5 A;  5FPE A;  4NLB A;  1VQ4 N;  4B3M K;  4FJ7 A;  1X9J A;  3PO4 A;  3OY9 A;  3TAM A;  1TK8 A;  1DLO A;  3LM9 A;  3VEW A;  4KTZ A;  4KHP K;  5AQP A;  4CZH A;  1IKX A;  1JJ2 M;  3DYA A;  4FLT A;  4BR7 A;  4OGE A;  2A5X A;  3EN9 A;  2FSJ A;  4CK1 A;  4B9Q A;  2P9L B;  3RRG A;  2F4V K;  2ZD1 A;  3L4Q A;  1NMD A;  3EO3 A;  2YNI A;  3OYG A;  1ASV A;  4KRF A;  2ZGZ A;  3CI5 A;  4CZK A;  3MEE A;  3HT3 A;  4FLZ A;  4E19 A;  3TWH A;  4BRM A;  1EWR A;  4DSJ A;  4OKJ A;  1DGK N;  1KXP A;  4FM0 A;  1NNE A;  2P9U B;  1O1W A;  2HHQ A;  4F3O A;  2O8F A;  1NK7 A;  2I5J A;  3O4N A;  5FRO A;  1HKC A;  4I6M A;  1XMQ K;  3OYF A;  3OA9 A;  4OPA A;  1JLE A;  3OJU A;  4K0K K;  1NGG A;  4YFU A;  1E3M A;  2EWS A;  1CXQ A;  3TPQ A;  3KWI A;  2WON A;  4Z4I A;  1UWB A;  2V52 B;  1XMO K;  3HST B;  2QW9 A;  4BVP A;  4CJ5 A;  3I56 N;  4FCY A;  3A5O C;  3KK1 A;  3A2F A;  4RG8 A;  4JNE A;  3NAE A;  3IS9 A;  4DSL A;  4Y1D A;  2X6S A;  4BC3 A;  4KH6 A;  3C6U A;  4FJJ A;  4H03 B;  4H0O A;  2XY7 A;  4YHH K;  3QIO A;  4L8R B;  3SK3 A;  3PSI A;  1WNS A;  1CLQ A;  1XQS C;  3OTO K;  1NOZ A;  1KLM A;  2OTJ N;  2DTU A;  4RTF D;  3LP2 A;  4LSN A;  1D5A A;  1VRT A;  2ZE2 A;  3M8P A;  4NYF A;  5E41 A;  2KLA A;  1NGA A;  3T1H K;  2LSN A;  4A61 A;  2HBM A;  3VOV A;  3I8B A;  4BR4 A;  3MX2 A;  3NE6 A;  3UIQ A;  3CCR N;  3AA5 X;  4DU1 A;  1RBS A;  4RW9 A;  2FXU A;  5BRF A;  1S1W A;  5LY3 A;  2BAN A;  3EKU A;  3SV4 A;  3AVG A;  3QES A;  5AQZ A;  1NGH A;  4YDU C;  1GOB A;  3R8E A;  2O8C B;  4B3R K;  3GL1 A;  4JKG A;  4DTN A;  4J2E A;  4YOT A;  3WQT A;  4CJE A;  1J54 A;  2VGN A;  2DFE A;  4CJQ A;  2KFZ A;  4B8A B;  5BPM A;  1SZ2 A;  3GE1 A;  1A5V A;  5CYQ A;  4PQU A;  3H1V X;  3HM9 A;  4Q0B A;  4FWP A;  3NH2 A;  4BRL A;  1QE1 A;  4M45 A;  4HWI A;  4BRP A;  4FLU A;  1K6Y A;  2E4L A;  1WBD A;  3F73 A;  4IFE A;  2HST A;  4BRD A;  5JLF A;  1HUX A;  1S5J A;  1U2V A;  4IOX A;  4KHN A;  2IAJ A;  1RT6 A;  3L2V A;  3QEI A;  2D0C A;  1JXB A;  2CGK A;  1P90 A;  2W6L A;  2OYQ A;  2NNW A;  3AO2 A;  4CZJ A;  3O3G A;  3L2R A;  3SUQ A;  1VAZ A;  1YJ9 N;  4H0Y B;  1NBW A;  3DI6 A;  5AQS A;  3SJH A;  4DMN A;  2HHW A;  2WBN A;  4BDP A;  3KJV A;  4PKH A;  5JIC A;  4OO1 J;  1WAF A;  1ZBS A;  3UKR A;  3K5M A;  1WSE A;  1NK9 A;  3OYJ A;  4PHT X;  4DS5 A;  4C8M A;  4E7K A;  1X9W A;  3P4I A;  1I3A A;  4FWN A;  3H6E A;  3P38 A;  4UQG A; 
#chains in the Genus database with same CATH homology
 5AQI A;  1YXQ A;  3GG4 A;  3H1Q A;  1SS6 A;  2KKZ A;  3D7E O;  5KQ8 A;  4DQ8 A;  5H1S Q;  5AQF A;  4B1W B;  4U67 L;  5BRH A;  5AQH A;  4JD2 B;  3C7N B;  5C2D A;  5LJW A;  3ZEU A;  3WXL A;  2FSN A;  5CHI A;  3CJ7 A;  4YOU A;  1CZA N;  1YJN N;  1X3M A;  2CH6 A;  2CGL A;  3ID6 A;  3F5T A;  5GIP A;  1ZXO A;  1BOT O;  1JCG A;  2W41 A;  4IO9 L;  2JWL A;  5C15 A;  1VQM N;  4GV6 A;  2HOE A;  3G25 A;  4CZF A;  4AM7 A;  3CQY A;  4H5N A;  3FZK A;  3L4I A;  4WYB A;  3B8A X;  3DXK A;  4Y0W A;  1BA0 A;  3CCM N;  3CCS N;  3ATU A;  3VF2 A;  3AAR A;  4GV9 A;  3O1B A;  1GLL O;  4CZL A;  2P9P B;  3OBY A;  2QWN A;  2E2N A;  3FZL A;  4H5T A;  3MN5 A;  3VPZ A;  4BY9 C;  3D2E A;  4CZM A;  1BA1 A;  1GLE G;  2E2Q A;  2H3G X;  3D6R A;  4CD3 A;  4IO8 A;  3QB0 A;  4JKF A;  3VEZ A;  2IIR A;  3OHR A;  4ILH A;  1VQP N;  4F9O A;  1NGB A;  4MO4 A;  1NGJ A;  3BP8 A;  4JN4 A;  2BUP A;  4EHT A;  4U7B A;  1T3V A;  5BN8 A;  3HTV A;  3CC4 N;  3WXJ A;  4BRE A;  2W40 A;  3EL2 A;  2F9T A;  4CBW A;  3VGK A;  5MLC Q;  2P9K A;  2P9I B;  3JS6 A;  4J8F A;  1Y64 A;  3HOS A;  1JCF A;  3EKS A;  5AQQ A;  2P9U A;  3NVK A;  5F2R A;  3ENH A;  1VQ5 N;  2P9K B;  2CGJ A;  3G6E N;  2BTF A;  3DAW A;  4AF1 A;  4B1Z A;  4BRI A;  2HMP A;  4FOI A;  4B1Y B;  3O9T A;  4MLE A;  1DT9 A;  2V7Y A;  2E1Z A;  1HJO A;  1GLF O;  2E8A A;  2Q2R A;  1NLV A;  1GLD G;  3MCP A;  4JKG B;  2IVO A;  2D1K A;  3AGK A;  3TU5 A;  1EQY A;  3CJC A;  4BC4 A;  3MN9 A;  2E88 A;  3E66 A;  2QWL A;  5EVZ A;  4FSV A;  3UKU A;  3RVC A;  3WUH A;  2YJF A;  3D2E B;  3I33 A;  4A59 A;  3TSQ A;  4CZI A;  3EZW A;  3OW2 M;  3QML A;  1VQ9 N;  3O9S A;  2Q31 A;  4B1V A;  1K8K A;  2QXL A;  5CE3 A;  3O5B A;  4MO5 A;  3QBW A;  3TTD A;  5AQV A;  4BRN A;  3CCQ N;  1S22 A;  4K43 A;  4A5A A;  3LL3 A;  1QHA A;  1ILY A;  1BWF O;  1ESV A;  3O6W A;  5HL7 L;  4BRA A;  4WF9 L;  3DJC A;  4JK9 A;  3CXC M;  1KAY A;  2QWR A;  1D4X A;  2Q1N A;  4H0X B;  3NMU A;  1YHQ N;  4M63 C;  1NGF A;  4JAX A;  4DHY A;  1YF5 L;  3AGR A;  3R6M A;  1QQO A;  4IDH A;  4LC9 B;  5AQT A;  3ULE B;  3ZEU B;  4A2A A;  4M7X A;  3E9L A;  4BRC A;  4K41 A;  4CZG A;  4EHU A;  5BN9 A;  3C65 A;  3HM8 A;  4L3Q A;  3SBT A;  3HOT A;  3O9U A;  2NRX A;  3ZX2 A;  5F1X A;  1YJW N;  2HBJ A;  5FPM A;  3CCJ N;  1Q7Y O;  4WQ5 C;  1QQM A;  5B8H A;  2NRH A;  2QI2 A;  4YOV A;  4CBU A;  3CPE A;  1E4G T;  4IWV A;  3GBT A;  3ZX3 A;  5TKW A;  1LOT B;  3BF1 A;  4K25 A;  4WFB L;  4AM6 A;  2GWK A;  3SLC A;  5EXW A;  3AAP A;  2ZWH A;  4BVO A;  2PFU A;  4JK7 A;  2A42 A;  1T44 A;  4BQZ A;  5CR4 A;  2NRZ A;  5F0X A;  3E9P A;  3DLL L;  2QWQ A;  2ZJQ L;  4FOE A;  4DKW A;  4NLC A;  2E2O A;  4HTL A;  5GAG P;  3CCE N;  2E20 A;  3RSE A;  1NGE A;  3PLA A;  1Q82 O;  2WFB A;  4A5B A;  1QZ6 A;  5C10 A;  1YIT N;  5AZI B;  2GWJ A;  3CJ1 A;  2D0O A;  5AFU A;  3I55 N;  1NGC A;  1WOQ A;  2Q0R A;  5GIO A;  3CJA A;  3VGL A;  1T6D A;  2P9N A;  2HF3 A;  3TTC A;  4FVU A;  3DWL A;  1RGI A;  5ADX A;  1N8R O;  3MN6 A;  4XEI A;  1BU6 O;  3ULE A;  4JK8 A;  3HZ6 A;  2RHK A;  3ZYY X;  2IVN A;  5LJV A;  3SAG A;  3HI0 A;  2YCH A;  4BG8 A;  1GLA G;  2GEL A;  3H45 C;  4ILG B;  4I6M B;  5C0Y A;  3U4L A;  2ITM A;  1YIJ N;  1NGI A;  4IJN A;  3ZET B;  3Q7C A;  4UY8 O;  1DKG D;  3LDP A;  1QVF M;  3A0I X;  3CHW A;  3SBG A;  4BRO A;  2JWK A;  2VCP A;  3FE1 A;  4PL8 A;  1HKB A;  3KZB A;  3LM2 A;  5EY4 A;  4JKE A;  3VF6 A;  1EO1 A;  4JKD A;  5EX5 A;  2ZGY A;  4FWM A;  3T69 A;  4WQ4 C;  1YVN A;  2A6A A;  2NRV A;  4WQ4 A;  5AQY A;  5AQR A;  2WC9 A;  5BPN A;  3PIO L;  4YOW A;  1NJI O;  1WUA A;  1MA9 B;  3A8Y A;  4GV3 A;  3A5N C;  4O5F A;  3R1X A;  2P9S A;  3GOI A;  1TUY A;  4WCE L;  4WFN L;  5DM7 L;  1Q81 O;  3WT0 A;  2NRW A;  3VEX A;  1K8A O;  4BRG A;  5M1N A;  3G4S N;  5C2F A;  5JVG L;  1VQ7 N;  3H3O B;  2P9S B;  5AQN A;  4CI6 A;  3FGU A;  4H5R A;  2NZT A;  1ZC6 A;  4EFH A;  5M1P A;  1HPM A;  1M90 O;  3C6A A;  4FO0 A;  4BR0 A;  1MDU B;  3D2F B;  1RDW X;  1BDG A;  3A5L C;  3VES A;  3MWT A;  1V4S A;  3KWG A;  1KAZ A;  3C7N A;  4FPA A;  1U2V B;  2NRT A;  2AP1 A;  5BRD A;  2FF6 A;  1HLU A;  3KHY A;  3F9M A;  1G99 A;  2YI1 A;  4ISG A;  3SMP A;  3DXM B;  4FWK A;  1VQ6 N;  2F7T A;  1XC3 A;  3CER A;  3FFK B;  3ENB A;  1E4F T;  3VER A;  3CF5 L;  3WXI A;  1JCE A;  3CCL N;  2QWP A;  2GEM A;  5AQX A;  2E2P A;  3LDO A;  5E26 A;  4BR2 A;  2ZJR L;  3MX5 A;  4E1J A;  1BG3 A;  3QFP A;  3WXK A;  1GLJ O;  5DM6 L;  2DPN A;  2A40 A;  2I7N A;  5KPZ A;  3VEO A;  3MDQ A;  3W3D A;  1KQS M;  1VQ8 N;  2KHO A;  3IUC A;  4BRF A;  3L6Q A;  1J6Z A;  3O80 A;  1SQK A;  3JXU A;  3N4Q A;  2PBD A;  3MMV A;  3M6G A;  2YHY A;  4FWS A;  3K9K A;  2FSK A;  2IVP A;  3CQX A;  3QDK A;  4H0T B;  4KBO A;  3T7Z A;  3WXM B;  4WQ5 A;  3E1Y A;  1ATN A;  3G71 N;  5AFU H;  2VYP A;  3KK7 A;  3EE8 A;  3L0Q A;  3RSE B;  3PIP L;  3MK6 A;  3O9Q A;  4JKB A;  3BUZ B;  2A41 A;  3S41 A;  4A62 A;  1QZ5 A;  2QWM A;  3D2F A;  4NO7 A;  4YOR A;  4QS7 A;  3CCU N;  1BO5 O;  3BF3 A;  5EOY A;  3OBW A;  2ASM A;  2V51 B;  4C23 A;  1TYQ B;  4C1N K;  4ISE A;  2UYT A;  3HRG A;  3CET A;  2HBL A;  1ATS A;  1RDU A;  3CME N;  1VQN N;  4JD2 A;  5FPE A;  4NLB A;  4IEI A;  4C1N I;  1OVY A;  3MWP A;  5M1F A;  1VQ4 N;  5JVH L;  1X9J A;  2AA4 A;  5AQJ A;  1VQK N;  4KH5 A;  1U6Z A;  3FZF A;  2PAV A;  5BR9 A;  1RFQ A;  2OAN A;  3LM9 A;  3VEW A;  3IFR A;  5AQP A;  4CZH A;  3SAH A;  3IKM A;  4KH4 A;  4O8K A;  1JJ2 M;  4BRQ A;  2GUP A;  3FLC O;  1LCU A;  1S3X A;  4BR7 A;  3UKR B;  4JKH A;  2A5X A;  4H0P A;  4MDA A;  3EN9 A;  3K9J A;  3ZX0 A;  4M7Y A;  5JLH A;  2FLO A;  1DEJ A;  2FSJ A;  4B9Q A;  2P9L B;  4IJA A;  4A57 A;  3MCA B;  3HSC A;  1YAG A;  3TSP A;  3U9D A;  4ISF A;  1HX1 A;  4CJ7 A;  5AZI A;  1C0F A;  2ZJP L;  4PKG A;  3L4Q A;  1NMD A;  3EO3 A;  4MDB A;  1T6C A;  3M5R A;  2J4R A;  3SAF A;  5AQL A;  2GX9 A;  4JKA A;  2ZGZ A;  3CI5 A;  2D0P A;  4XH4 A;  4CZK A;  3VEV A;  3R9P A;  1IG8 A;  4EAH D;  4JHD A;  1QVG M;  5ELZ A;  4BRM A;  5C12 A;  1DGK N;  1KXP A;  1NM1 A;  5GIN A;  3O08 A;  2A3Z A;  2E1Y A;  2P9U B;  1Z05 A;  3U8X A;  4BC2 A;  3HBT A;  4XH5 A;  3FR0 A;  4YOX A;  4FPB A;  4B1X B;  1XUP O;  4G9Z A;  1MWK A;  5AZJ B;  2VWB A;  3CC7 N;  3U9Z A;  3E9O A;  3Q7B A;  3TTF A;  1VQL N;  1HKC A;  4I6M A;  3CD6 N;  1MWM A;  3C0B A;  3ENO A;  3QBX A;  2QM1 A;  3OA9 A;  4OPA A;  4CZE A;  5AZJ A;  5M1K A;  3SMS A;  1K73 O;  4IOC L;  1M1K O;  1NGG A;  1Q18 A;  3QFU A;  2NRR A;  1NGD A;  2EWS A;  5AQO A;  2F9W A;  1X3N A;  3TPQ A;  3KWI A;  3VMF B;  5M1Q A;  2V52 B;  3F2K A;  4K42 A;  4IEE A;  2QW9 A;  1GLB G;  3P39 A;  4FWR A;  4BVP A;  3A5O C;  4MLH A;  3I56 N;  2YX6 A;  1VQO N;  4JNE A;  5AQM A;  4ILJ A;  2ZF5 O;  2P9I A;  3FZH A;  4XH1 A;  5GAH P;  3O4W A;  4BC3 A;  4KH6 A;  4QS9 A;  1QQN A;  4BGB A;  4H03 B;  4H0O A;  3CJ9 A;  2D4W A;  3WQU A;  1TYQ A;  3SK3 A;  1XQS C;  3A5M C;  4YOY A;  2OTJ N;  2YHX A;  4RTF D;  2P9P A;  1ATR A;  3CPW M;  3ID8 A;  5AQK A;  2FF3 B;  5AQU A;  4BQL A;  3NVM A;  2KLA A;  4CD1 A;  3VGM A;  1NGA A;  4A2B A;  1V4T A;  3IMX A;  4YDU A;  2HF4 A;  3H3N O;  1H1V A;  2I7P A;  4A61 A;  2HBM A;  2YJE A;  4BC5 A;  3VOV A;  3CIP A;  3I8B A;  4DCH A;  3O8M A;  3VTH A;  3M1F A;  3VEN A;  4BR4 A;  2QEX N;  3MX2 A;  4JKC A;  2P9L A;  5E84 A;  3CCR N;  4BRH A;  2FXU A;  5BRF A;  4RWT A;  5LY3 A;  4H5W A;  3WEE A;  3VTI A;  4DB3 A;  1P8Z A;  3EKU A;  1S72 N;  1NWK A;  5AQZ A;  1NGH A;  4CBX A;  4YDU C;  4OPH A;  5GAD P;  2ASP A;  3R8E A;  5GAE P;  3IDH A;  5M1O A;  3ZET A;  2P9N B;  5FPD A;  3GL1 A;  4JKG A;  3J7Z O;  1KD1 O;  5ADX H;  2YHW A;  4YOT A;  3WQT A;  1TUU A;  5AQW A;  5AQG A;  5KQD A;  3DXM A;  4PKI A;  3MN7 A;  2VGN A;  3UB5 A;  4BGA A;  5FPN A;  3M3Z A;  4FWL A;  4IXC A;  3LDQ A;  2Q36 A;  4BG9 A;  1C0G A;  5BRE A;  3VET A;  3O1W A;  2QA4 N;  1SAZ A;  5BPM A;  2CH5 A;  1IJJ A;  1KAX A;  4EIA A;  1SZ2 A;  3GE1 A;  4FWQ A;  3C6H A;  3BEX A;  3H1V X;  1Z6R A;  4FWP A;  3EE9 A;  1O13 A;  3UKU B;  4PL7 A;  3VF4 A;  4BRL A;  3CC2 N;  2QTD A;  4R79 A;  2V7Z A;  5I9E B;  3QIC A;  4HWI A;  4BRP A;  1K8K B;  2GTD A;  2VGM A;  3W0L A;  3H46 O;  4H5V A;  2HBK A;  4FL9 A;  1R59 O;  4IFE A;  2HST A;  4BRD A;  1K9M O;  1W97 L;  5JLF A;  1HUX A;  1U2V A;  1BUP A;  4QS8 A;  3WEE B;  4IOX A;  4H0V B;  4JHD B;  3N4P A;  4RCH A;  1HKG A;  4NB4 A;  4WFA L;  4IZ9 A;  3O9R A;  2ASO A;  3GDQ A;  4B1U B;  3UE5 A;  3R3L A;  3CCV N;  5TKY A;  2NLX A;  2CGK A;  4GY2 B;  1OKJ A;  1P90 A;  3AY9 A;  5AR0 A;  2NNW A;  1YJ9 N;  4CZJ A;  4O8U A;  1YI2 N;  1VAZ A;  4Z94 A;  3J8A A;  2OTL N;  5BPL A;  2Q97 A;  3LDL A;  5KPT A;  4IOA L;  2BH1 A;  4H0Y B;  3P31 A;  4FWO A;  3ATV A;  1NBW A;  5AQS A;  3SJH A;  3CMA N;  2WBN A;  3DXK B;  2RE2 A;  3KVG A;  4BR5 A;  1W2B M;  1KC8 O;  4PKH A;  5JIC A;  3AAQ A;  4GNI A;  4OO1 J;  3LDN A;  1ZBS A;  3UKR A;  5JMV A;  4JEP A;  1GLC G;  2QWO A;  1Q86 O;  4PHT X;  3P4I A;  4GVE A;  3VEY A;  4FWN A;  3CJB A;  5KPR A;  3TSU A;  3H6E A;  3FZM A;  3P38 A;  5HOO A;  4BRK A;  2WUS A;  2Q0U A;  4BR9 A;  1YUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...