3C65A

Crystal structure of bacillus stearothermophilus uvrc 5' endonuclease domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
152
Chain Sequence
GSHMLGERLGIPAPRRIEAFDNSNIYGADPVSALVVFLDGKPAKKEYRKYKVKTVAGPNDYETMREVVRRRYTRVLKEGLPLPDLIIIDGGKGHLSAVRDVLENELGLDVPLAGLSELLAGDPPDVVPLDRQSQEFYLLQRIQDEVHRFAVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Crystal Structure of Bacillus stearothermophilus UvrC 5' endonuclease domain
rcsb
source organism Bacillus stearothermophilus
molecule tags Hydrolase
total genus 44
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c65A00
2NRZA 2NRVA 3C65A 2NRTA 2NRRA 2NRWA 2NRXA
chains in the Genus database with same CATH superfamily
4FJ8A 1VSFA 2O8DA 4DTSA 4BDZA 3HO1A 3O9RA 3HT3A 1K9MO 1RT4A 3C7NA 3J81O 4DUYK 2YHBA 1V4TA 4CEDA 3HOSA 4E7KA 3DLEA 5CR4A 3TTDA 5JVHL 2O8BB 3GDQA 4Z94A 3LDLA 3LANA 1HYSA 2YNGA 5KPZA 3T1HK 3VEVA 3CD6N 2VGMA 1SUQA 4XH5A 2IVNA 3AO3A 1JLCA 4FK4A 1BGXT 3AVKA 4IO9L 3AA4A 4BC2A 4M3TA 4Z4FA 3PO4A 4I6MA 4CD1A 2HBLA 3OYNA 3TSPA 4BRGA 3SUQA 4CHYA 1FW6A 3FZKA 3RMAA 3P1GA 2HHHK 1T44A 5EOYA 4LSNA 3D2FA 1VHXA 1TGOA 3AVMA 5BPMA 2F9WA 4JI0K 1S3XA 4GMJB 1VAZA 4CEEA 3HVRA 3NHGA 1TKDA 4W5OA 1GLDG 3ZSWA 5CYQA 1S1TA 4K42A 3DMJA 2XY7A 1QHTA 4OO1J 1DGKN 2QWPA 4BGBA 4U67L 3SMPA 4QOZB 1LAVA 1ZXOA 1FK9A 3JAMO 5FROA 1TKTA 1X3MA 4QAGA 4RW7A 3U9DA 4EZ9A 1HKGA 4GKKK 1BI4B 4WQ5A 3S41A 2CGJA 3U4LA 1HNVA 2P9UB 3RWUA 1RBVA 3CQ8A 3KWIA 4DHYA 4KV8A 1LWFA 5AQMA 2HBMA 4G1QA 4DTJA 3MX2A 3ITHA 1S5JA 1KVAA 4LSLA 2A42A 4IWVA 3KLEA 1XI1A 3RVCA 1C0FA 2CGLA 4AQYK 4YFUA 3AO1A 4LH5A 4BROA 4YHHK 4JI8K 3EYZA 1YJ9N 3S3NA 3VQ9A 3NAEA 5AQWA 3M1FA 1I39A 2YKMA 4FWQA 2D0AA 2OPQA 2QWRA 3SQ2A 3D2EA 3TPQA 1IH7A 4FJKA 5I9EB 1RDDA 4FVUA 1X1PA 4C8OA 2YNIA 3LM9A 3VQPA 2QWQA 4WQ4A 1QTMA 2YCHA 3PV8A 3DXKB 5SZTA 4DSIA 3EE9A 4DQIA 1NGJA 5J2QA 3ZEUA 3MWPA 2BUPA 3O1WA 2OYQA 1U49A 3QICA 4AHSA 1QSSA 2KFNA 5AQYA 2I7NA 3TAEA 3A5LC 2H3GX 5KRSA 2FSJA 1NGHA 1P8ZA 3V1OA 1Q18A 4H5TA 1WBDA 1VSHA 4PL8A 4O55A 3CM6A 4CF0A 4BRKA 2F8SA 4RWTA 1A5WA 1YJNN 3LAMA 2D5RA 3EKUA 3THWB 4KTZA 3T3FA 4BGAA 4B9LA 2QKBA 4M3WA 1NM1A 4JI2K 5LMNK 1EETA 1HQEA 4AHUA 3VGMA 4CF9A 5LL6Z 4H8KA 3F9KA 4DTUA 2HOEA 1GLJO 3SZ2A 2HVHA 5C0YA 3E9OA 4NYFA 2NRHA 2E8AA 1OKJA 3NE6A 4H0VB 1BO5O 5C2DA 3J7AP 1IG8A 2EHGA 5ELZA 1X9JA 4CJQA 3OYDA 3RMCA 4GNIA 3MN5A 1KQSM 4KKOA 3FFKB 1T8EA 1J5OA 5H1SQ 3L2WA 3H3OB 1ITGA 5GINA 3NBPA 3VEWA 1I94K 3WNEA 4C8NA 1Z6RA 1E4FT 4CFCA 3ID8A 1MWMA 1GLBG 1NK7A 4IG3A 3HZ6A 1QSLA 3CMEN 4ELTA 1DT9A 1SAZA 1X9SA 1MDUB 1J5EK 4B3TK 4BR2A 3VF6A 3BDPA 2A1RA 3WQUA 4HCBA 4ZTJA 1B9DA 5FRNA 1E4GT 1LW2A 4B08A 3OY9A 1ATSA 2RHKA 4W5NA 3I0RA 3ID6A 1UAXA 3CJBA 3OYKA 3L3UA 1RBTA 3O3HA 1S6QA 5HRPA 3ZX0A 2Q0UA 4BE0A 1N33K 1BWFO 1G99A 3SCXA 1RT3A 4BC5A 2ZM6K 4JKDA 3SAGA 3CMAN 4Y1DA 5AQOA 5KGWA 4CJSA 2XRIA 3A8YA 1IBKK 3QINA 4EZ6A 5EU7A 3VTHA 4DTMA 1K8AO 2HHQA 3KWGA 5AQTA 4WFNL 4B1UB 4A5BA 4X64K 4FYDA 3EN9A 1KFDA 4IEIA 3A0IX 1TVRA 3PX4A 1TAUA 2NRXA 4YOXA 3SPZA 5AQPA 2P9IA 2HHXA 1T3VA 1Z26A 4E0DA 4EAHD 5KQ8A 4C23A 1IG9A 1YJWN 4KO0A 1NK9A 2RE2A 3AVGA 4EFHA 5MLCQ 2UUAK 2D4WA 3EKSA 2X78A 1T6DA 3DAWA 1U04A 4OLAA 4DU3A 4BVPA 1L5UA 2FBXA 3U3YA 4H0PA 1NJYA 1S1UA 2A3ZA 5DM7L 3SLCA 4CGFA 1NK6A 3UB5A 4JKGB 4CZEA 2FSNA 1BCMA 3HL8A 2RPIA 2WONA 5FPDA 2HNZA 3KK3A 5KRTA 1YAGA 4A5AA 4JK9A 4MQ3A 4OPJA 4J2EA 3RSEA 3DRSA 3AO4A 3OTOK 2GEMA 3J8AA 5AQGA 4YDUA 1NGFA 4CGIA 1BL3A 1C1AA 1RDCA 1WUAA 3HXMA 1OVYA 3ZSXA 2OZSA 2DTUA 5CZ2A 3LZJA 3OYGA 3HM9A 4O8UA 4A59A 1M90O 1LWCA 2O8DB 1YTAA 1FKOA 1GLLO 4M7XA 3C6UA 2FC0A 3NF6A 3NDKA 3HP6A 3WQTA 3C7NB 2IAJA 3NVKA 4K43A 4KH6A 3VQ5A 4DV7K 4DQRA 1WB9A 3CCLN 3VF2A 1HKBA 3K5LA 3TAFA 4EHUA 3TTFA 4YORA 3VENA 1JLAA 3OYMA 3ULEA 2A5XA 1BIUA 1ESVA 4B8AB 3H46O 2VQFK 3E01A 4DSEA 2HB5A 4JKEA 4QCLA 1NGCA 3VQQA 5AQJA 2HHSA 3HOTA 1TYQB 4F3TA 4JKCA 3LPUA 4BE2A 1C0MA 4I6MB 3O4NA 4MLHA 1VRUA 1NJZA 3KTQA 4EHTA 1TK0A 1OH7A 1O13A 4Z0UA 4KTWA 4E7LA 1ZBSA 3D2FB 1X9WA 1VQ6N 4OGEA 4CVNE 3H1QA 3DOLA 4LD0A 4H03B 3M8SA 3F5TA 2P9SA 3SUOA 4N47A 1TKZA 5FRMA 2BGGA 1UA0A 4CERA 1N36K 2ZGZA 3HPHA 3MX5A 2GELA 3CETA 2AP1A 5BR9A 1LWEA 5HLFA 4YOYA 2P9LA 2VWJA 1KAYA 1Q7YO 1JLEA 1RT1A 4B9MA 4ILGB 1XUPO 4W5QA 3V1QA 2HSTA 5EX5A 2YNFA 3WEEA 4F9OA 3P38A 1B9FA 3VEOA 4B1ZA 3C0BA 4J2BA 1O1WA 1BA0A 3AA5X 3MK6A 4WFBL 2VG7A 4CZIA 3QEVA 3WNGA 4B3MK 2KZZA 4O0IA 3NFAA 5E41A 3LALA 3JXUA 4WE1A 3E9LA 3AY9A 2KKZA 5A2QO 3MECA 3E66A 2QM1A 4MO4A 3G0ZA 1VSLA 3R3LA 1SKSA 4CGGA 1ZBLA 4DR3K 3WXLA 2G8KA 4LF6K 3O5BA 5AQIA 1CXUA 2I5JA 3D2EB 3MDQA 2GWJA 4J2DA 1JKHA 4PKIA 2VWKA 3D0PA 2QWOA 1ZBUA 4H5WA 2B6AA 4FVMA 3U6FA 3O4WA 3UKRA 2BDPA 4IFYA 1EWQA 2W40A 4E7HA 3TSQA 1KAZA 2PYJA 4J2AA 3O9UA 1BCOA 3TAGA 1NJWA 4CJEA 4BVOA 1IV0A 1TK5A 3NGIA 3IFRA 3IAYA 5GIOA 3AVFA 1EO1A 4FJ9A 1RDWX 1RDAA 4CEAA 2FXUA 3QB0A 5KTQA 2ASMA 4M3RA 1CZAN 3AGRA 1DKGD 4TSXA 2IDOA 3THXA 1LOTB 1VSKA 1HX1A 2QXFA 3O9SA 1JLGA 3B6PA 2VYPA 1NNEA 4B3OA 5M1NA 2VGNA 4Y0WA 1KSPA 3WXKA 1HJOA 3H1VX 1NGBA 4HTUA 2HF4A 4AH9A 1RBSA 1ZYQA 3FFIA 5J1EA 1TV6A 5AQUA 4JI3K 4M3XA 1NOYA 3IS9A 4DG1A 3UKUA 1WSJA 2O8EA 3WUHA 3RRHA 5GAHP 3NH0A 4CFBA 4IOCL 4BY9C 3T1YK 1DTQA 2Q97A 2UXBK 4EP4A 4PY5A 1M1KO 1CXQA 3AVJA 4CHOA 2ZD1A 3M5RA 5BPLA 3MN9A 4YOUA 3P4IA 2QWMA 3HJFA 1KC8O 4BR5A 4K25A 3MXJA 2HBKA 2HHVA 3RR8A 3NMUA 4JHDA 4OKJA 3CCEN 1NGGA 3EO3A 4U7BA 1D9FA 1S9EA 5JLFA 3K0SA 3K5MA 3KZBA 5ADXA 2QXLA 3D45A 3SPYA 3K57A 4WYBA 3IRXA 3QO9A 4DR4K 3TU5A 4H5RA 4IDHA 1JXEA 4MO5A 3VQ4A 4DSJA 3I55N 5AQZA 2O8FA 4DU1A 4LFAK 5TKWA 5C42A 4B3SK 2D0OA 1K73O 3OS0A 3OYCA 3QIPA 4BG8A 4NO7A 4CGHA 5HRRA 2E2QA 5AQLA 4FXDA 3ZYYX 4JI5K 1VSDA 3K5OA 4JI7K 4M7YA 2CGKA 2P9IB 5AFUA 4FM0A 2ASPA 3OYAA 4BC3A 3ZCMA 4BRLA 4FWPA 4CZLA 1BOTO 1RBRA 1WSFA 4OGCA 3PO5A 3LAKA 1ZBIA 1C0GA 4BREA 3SV3A 3VQBA 4KI6A 3LM2A 3OBWA 3R9PA 4LY7A 3DRPA 1S6PA 2O8CA 3IUCA 3TAQA 5AQSA 2E4LA 3KD5E 2VQEK 4B9TA 2GX9A 3TAPA 3OYEA 3SQ0A 1NBWA 3T69A 1D4XA 3AO5A 3ASMA 3RSEB 5CY4A 3HSTB 3HSCA 4WQ5C 4PKGA 1K8KA 4M3YA 3SBTA 2G8VA 1YHQN 3O08A 1WAJA 5FLXO 2Q0RA 2F9TA 1U2VA 3A5OC 4CEZA 2UUCK 1KXPA 3CJAA 3QETA 4FPBA 3CFPA 2V7ZA 2P51A 3AARA 1U45A 4B9QA 3OYJA 4CEOA 3SQ1A 4KH4A 4G9ZA 4DR6K 1JCFA 2W6LA 1QSYA 4DQ8A 1VQKN 1SKWA 3K5NA 3L4IA 4C8KA 1F21A 5FPNA 3R1XA 3SNNA 3F2KA 3SJHA 1WSEA 1RNHA 3K9KA 3EE8A 3VQ6A 1YF5L 3OYIA 2EX3A 2GUIA 3WXIA 3ULEB 1U6ZA 4QS8A 4E3SA 3ENOA 1SZ2A 4LH4A 2HNYA 1XNQK 3HYFA 2P9NA 4LC9B 3QFUA 2YV0X 1OH8A 3KLHA 3THYA 4WQ4C 1VQ9N 3ENHA 3V9XA 3ATVA 3VPZA 4ID5A 2BH1A 3DLHA 3VQ8A 1OH5A 5KPTA 3QEPA 2VG5A 1V4SA 3B6OA 3ZSOA 1JLQA 1N6QA 5HRNA 3O6WA 4CZGA 4PUOA 1XNRK 3MN7A 3OJUA 3TARA 3PX0A 4FJXA 3V1RA 2IS3A 2P9SB 2E5LK 2PBDA 1GOCA 4DF8A 1WSGA 1N8RO 4MDBA 4BRPA 4CJ7A 1IKVA 4PA1A 4FLWA 4KREA 3IG1A 4ZHRA 4KAZA 3VERA 3SBGA 4H0TB 3MEDA 1QZ6A 3AV9A 3EEQA 4CE9A 1BQMA 3ZSQA 3CJ9A 4BG9A 1W9HA 2P9LB 2NNWA 1RCHA 3SYZA 2FF6A 3H45C 5JS1A 1VQPN 4IDKA 4FL9A 4GKJK 1BUPA 3QLHA 3VQCA 5D3GA 1CZBA 4Z4HA 4OPAA 1HJRA 4A2BA 4CK3A 3WEEB 2WUSA 3CC7N 1UWBA 1LCUA 4DCHA 2KHOA 3D7EO 3ENBA 4DV5K 1BHLA 1I3AA 4DLEA 2P9KA 4BRIA 4FJMA 3NH2A 3J80O 4OLBA 4CEBA 2BTFA 1ILYA 4M3UA 4JK8A 4RW4A 3DLBA 3EY1A 1SS6A 1KRPA 3OVNA 4JRPA 3C95A 1XQSC 3M3ZA 2QWLA 2UUBK 3IKMA 5M1KA 3KJVA 4JEPA 5HOOA 1L3SA 3I8BA 4N56A 4KB0A 2YHAA 2PFUA 5F2RA 2ZJRL 4F2RA 2UYTA 3C6HA 4NCGA 2NRRA 4IOXA 5J2PA 3AVIA 4IOAL 4DUZK 3M8PA 3HM8A 3B8AX 1NMDA 1RDBA 1YXQA 3J7ZO 3CIPA 4M63C 2XY5A 4CF8A 3PIPL 5F0XA 4BWMA 3UKRB 2PZSA 5HL7L 5J2MA 2OPSA 4FWNA 2AA4A 2WOMA 3I56N 4KFBA 4CJVA 5AQQA 3ZX2A 1QHAA 1SL1A 4B9VA 4IXCA 1T6CA 4FWOA 3MEGA 3K58A 4JI1K 2CH6A 3FLCO 3I0SA 4E19A 2D0CA 3I8DA 3MAQA 3L2UA 3CXCM 1YI2N 3S3MA 3FZLA 4AF1A 3VQAA 2KZMA 1U47A 4UY8O 3KIOA 4CIEA 4NCBA 1UA1A 2E2NA 1KTQA 3QMLA 4DMNA 4N76A 2IC3A 4CFAA 1VSJA 4FZZA 2F7TA 5E26A 4H5NA 3BY5A 2UXDK 2A1SA 5BN8A 4OKEA 2E2OA 3OBYA 4CJ5A 3ULDA 5T7BA 1S22A 3NGYA 3CQYA 1WN7A 3AVAA 3AAQA 4WFAL 4ELVA 5GADP 1NK5A 1ZBFA 4YOVA 4BWJA 4GV9A 4X65K 3CG7A 5F1XA 3OYLA 3DYAA 3NVMA 3BF1A 2P9UA 4EIAA 4F4KA 2I7PA 3UKUB 2O8EB 1SL0A 3TTCA 3VEXA 1HQUA 3LP3A 1HYVA 4BR7A 2QW9A 4ICLA 5AQHA 3PIOL 1HPMA 5HBMA 3BP8A 2OPPA 1XHZA 2ZWHA 2D0PA 2CH5A 3TR8A 2OCEA 4YDUC 4CZMA 3QERA 3FZMA 3OYBA 4XH1A 2P9PA 2D0BA 3CYMA 3GE1A 2UU9K 3GG4A 3QESA 4JHDB 3VQ7A 2IVOA 4CJKA 4RCHA 2R7YA 1Q8IA 3J7YP 3I33A 4JN4A 1Y64A 4NLBA 4AHCA 1R0AA 1B92A 4ILHA 4KRFA 1CLQA 1BIZA 4DV3K 3VEYA 1LV5A 2ZQBA 5EVZA 4DQPA 3EZWA 3DRRA 3OHRA 5EY4A 2Z1HA 1YVUA 1HNWK 4DR1K 1JL1A 2IGIA 1XWLA 3PLAA 4DWIA 3W3DA 1HNZK 3AA2A 4FJJA 3DLKA 4OJRA 4CJ3A 5AZJA 1EP4A 3CM5A 2O8FB 4KI4A 1NJIO 2ATQA 1ASVA 1R59O 3VA0A 1NK8A 5LY3A 3QBWA 1TL1A 2YHYA 3MCAB 5BN9A 4BDYA 2XY8A 4AM6A 3SI6A 4BQLA 3ISNC 5M1PA 2PAVA 4C1NK 1IKWA 5AZIA 5FPEA 3RRGA 1N32K 1VQ5N 3VMFB 1NMNA 1RT2A 3AA3A 4DKWA 2IOCA 1L3UA 3N4QA 2QK9A 4FPAA 3O3GA 2X6SA 1KAXA 3RMBA 1Q81O 2G8IA 1X3NA 4HCCA 3FE1A 4DTNA 3PSIA 3L2VA 1GLEG 2V52B 3M6GA 4DV2K 3BF3A 2XO7A 5HRSA 3BZCA 3F9MA 2YHXA 1YUWA 3VGKA 1KFSA 3QFPA 2RN2A 2OANA 4DR7K 3IDHA 1TL3A 1WSHA 3SMSA 4CHNA 2O8CB 2GBZA 2E1YA 2PYLA 3JS6A 2Y1IA 1D9DA 1TKXA 2A6AA 3M8QA 4W5TA 3V4IA 4DV1K 3QDKA 4LFCK 3JYTA 3O4QA 1BQNA 1QE1A 2Q31A 1RTDA 3F73A 1QQCA 4KHNA 1K8KB 1L3TA 2FBYA 3P31A 3AVLA 2P5OA 3FGUA 1J6ZA 1U2VB 1JCEA 5I42A 5CHIA 4FWSA 4C1NI 4BRDA 4FJNA 5BRFA 4KBOA 2HF3A 4JKFA 2YJEA 5LJWA 1XC3A 3DM2A 4GV3A 4FZYA 3H3NO 3WT0A 3QEXA 4FM2A 5BR8K 3LDOA 1WAFA 1JCGA 4B3RK 3ZSYA 4Q5VA 3DLRA 4B9NA 1E3MA 1VQLN 4CJLA 1A5VA 1S1VA 5AQRA 4IO8A 4KH5A 3V81A 5ADXH 4LF5K 4I9LA 4KHPK 4R5PA 3ZEUB 3VQEA 3JSMA 3AVBA 1BA1A 4CZHA 5BRDA 4PL7A 3S9HA 1HYZA 4AM7A 2P9NB 4YNQA 4UQGA 5M1QA 3V6DA 1T7PA 3KHYA 4JNEA 1NK4A 3O8MA 3NCIA 3EL2A 3O3FA 1RT5A 4K8XA 1GOBA 3WNFA 4CEFA 1P90A 3CF5L 1Z25A 5FPMA 3OA9A 1S9GA 4JK7A 1REVA 2E88A 2KQ2A 3GL1A 4O44A 3G25A 1TUUA 3K9JA 3K59A 2QI2A 2WBNA 3E1YA 4DFPA 4DR5K 2E2PA 3CCJN 4BRHA 5AFUH 5LMUK 4FM1A 1QVGM 4E1MA 1J54A 3UIQA 4DR2K 4E1JA 5DK5A 2JLEA 1NG9A 4RW9A 2XY6A 1IJJA 1ZBHA 4CZKA 5C10A 1YTUA 5LJVA 4CHPA 4CBUA 2YJFA 3CCSN 4CESA 2QTDA 1ZC6A 1S1XA 3VQDA 1YITN 4KTQA 1Q9YA 3CHWA 1TAQA 4LFBK 4O5FA 2WTUA 4CFDA 2E1ZA 3ALYA 4N41A 4QS7A 3CQXA 4FJIA 4FW2A 2NRZA 4ELUA 2F96A 2YHWA 2P9KB 4DSLA 2D1KA 1C1CA 1IBLK 2AJQA 4C8LA 3PY8A 3EZ5A 4KPYA 3AAPA 1D5AA 3A5MC 4CJ4A 4CIGA 4BE1A 3KKSA 1VSIA 2KFZA 3CPWM 2YX6A 4KHYA 2E6LA 2UXCK 2B5JA 2Z1GA 3AO2A 4M45A 3VTIA 4CD3A 1C6VA 2NRWA 2OTLN 2G8FA 3K2PA 1NGEA 4MLEA 2FBTA 2DFHA 2YNHA 4CJUA 4BQZA 4CF1A 3ZT2A 4HUGA 3G71N 1HLUA 1N34K 2WC9A 4PKHA 4JAXA 4CBXA 4JI4K 4HUEA 1J9AA 3P39A 3VETA 3C6TA 4GVEA 4JLHA 2QWNA 1NKEA 1QZ5A 5J2NA 1TYQA 2YKNA 4RW6A 3SUPA 1RFQA 2NUBA 4W5RA 3CC4N 2RKIA 2V51B 1RGIA 1SL2A 4IG0A 3RR7A 4FW1A 4V19S 2HBJA 4ISGA 4Z4EA 4CZFA 2GV9A 2DFEA 4KHWA 2ZF5O 1J53A 1RTIA 3CI5A 5I3UA 4KHSA 1VSMA 2ZE2A 4RG8A 1WSIA 3FZHA 4L3QA 4FJHA 4F3OA 3MEEA 5KGXA 2XHBA 5JS2A 3SV4A 3V9SA 1JLBA 4FLZA 3HPOA 4YOTA 5C15A 4BR0A 1NGDA 5AQNA 5IT9O 1RDUA 3LP1A 1NKBA 2OTJN 1NOZA 4OKKA 3QIOA 2A41A 2BE2A 3KLIA 2ZGYA 4GW6A 2P5GA 1JLFA 3SUNA 1WOQA 1C1BA 4E7IA 1HNXK 1BU6O 2DFFA 3MWTA 4YOWA 3ZT4A 3KK7A 1LAWA 3VEZA 4DU4A 4O4GA 3RTVA 1GLFO 4GY2B 2VG6A 3MN6A 2FF3B 2P9PB 2O4GA 2ITGA 4K8ZA 1KD1O 4ID1A 4MDAA 3LPTA 4FLYA 2WFBA 1VQNN 2KTQA 1FXXA 3U3GA 4FCYA 1HRHA 1OH6A 1VQMN 4IFEA 1IO2A 4BC4A 4YY3K 5KPRA 4DF4A 3OW2M 1TUYA 4NCAA 3ZX3A 4BDPA 4NXNK 5AZJB 4AHTA 2B4JA 3U9ZA 4IBNA 2F4VK 4CGJA 2QKKA 3ATUA 4ISEA 4ZTFA 4CJPA 3ZSZA 2IIRA 2Q36A 3MXMA 4BRFA 2X74A 3QNNA 3KD1E 3CC2N 1NK0A 4B9UA 4FK2A 3NF9A 3P5JA 4H0OA 5AZIB 4CJTA 3L4QA 3PX6A 1WLJA 1HUXA 4FJ7A 4I2PA 3HRGA 4FLUA 1VQ4N 1GLCG 3NF7A 1Y97A 1K6YA 3CCMN 3C94A 3WXMB 4I7FA 3CJ1A 4BRCA 2PY5A 4GV6A 2EWSA 3O1BA 2Q3SA 3Q7BA 3DLGA 2RF2A 3T7ZA 1ATRA 1T05A 4A57A 1KVBA 4OX9K 5FDLA 4JKAA 3LZIA 4JD2A 5JVGL 1EQYA 4BRQA 2QEXN 3LP0A 1RTJA 3CFOA 3FZFA 1JJ2M 3L8BA 1MA9B 4FJ5A 1XC9A 1X9MA 4CK2A 4DS5A 4NLCA 2DPNA 2GTDA 3DXMA 3LDPA 5CE3A 4CW7B 1ASWA 4CGDA 3T19A 2NRVA 4KB1A 1VQ7N 4BRNA 3U8XA 4DTPA 1FKPA 2A40A 5HROA 1OVQA 4DLGA 3THVA 5K14A 1JL2A 3D6RA 4BRAA 4K0KK 2G8HA 3MMVA 5AJ3K 3SQ4A 2J4RA 1WBBA 4AHVA 5EXWA 3VOVA 4LF8K 4DS4A 3ZETA 5JLHA 4BRMA 4DQQA 3VGLA 1N5YA 1DEJA 4FOEA 2ITMA 1SQKA 3V9ZA 3CPEA 3HVTA 2HVIA 5C2FA 1VSEA 4O0JA 2E6MA 3C65A 3ZT3A 3L2RA 4CECA 4CBWA 4FOIA 3L0QA 4IZ9A 2Z1JA 5KI6A 2O8BA 2KW4A 3H6EA 4CZJA 3OJSA 5HP1A 1MWKA 3R6MA 4OVLA 2GWKA 4RW8A 4DV6K 5AQVA 4KHQA 3KLFA 3ZSVA 1KLMA 4B1YB 4LF4K 1S72N 2VCPA 4FO0A 3P83D 4CJFA 1HR0K 2P1JA 3WXJA 1Q9XA 1EX4A 3KKRA 3LWMA 2FSKA 2IVPA 1ATNA 5AQFA 3L3VA 2E20A 3THXB 4JI6K 1XMQK 4GVMA 1JXBA 5BREA 3L2QA 4XH4A 4I2QA 4RTFD 5IWAK 3N4PA 3DLLL 2HMIA 5JMVA 1VRTA 3M8RA 2KLAA 4HWIA 3L6QA 3BEXA 4FSVA 1HNIA 1D8YA 3A5NC 3BGRA 3LDQA 4CF2A 5GAGP 5SWMA 3S3OA 3CCVN 4DSFA 2Y1JA 2Q1NA 3G4SN 4CIFA 1BI4A 4L8RB 2OPRA 3BUZB 5C24A 3AVCA 4OPKA 2G8UA 5M1FA 1TK8A 2Z1IA 2ETJA 3HI0A 1QQOA 4CEQA 4NXMK 3CERA 4Z4GA 3QNOA 3CCRN 3O9TA 1NJXA 1KLNA 2BANA 3H08A 2W42A 3V9UA 4B1VA 2JWLA 4H0XB 1G15A 4DV0K 1ASUA 4LF9K 4PHTX 3SK3A 1NU0A 2OZMA 2VWBA 5CZ1A 3CCQN 5BPNA 2V7YA 1Z05A 4Y1CA 1YVNA 1QQMA 3O9QA 4N5SA 5DM6L 2NLXA 3ZLJA 3TWHA 1BDGA 1H1VA 3DXKA 5BRHA 4HHTA 1W7AA 3GBTA 1W97L 3NGZA 1RILA 4HTLA 4I9QA 4NYNA 3TABA 1QS4A 3TANA 4B9SA 3CJ7A 1XMOK 3KLGA 1FJGK 4FLXA 1RBUA 4DTOA 1VQON 4B1WB 3KVGA 3LDSA 3MXIA 3OS1A 4E1NA 3V9WA 3DWLA 1SV5A 4O5BA 3UE5A 1DLOA 3PSFA 1Q86O 3QEWA 1LW0A 1UOCA 1SKRA 4HVJA 3TI0A 4DTXA 3RMDA 4XEIA 1NGIA 3THWA 1EXQA 3MCPA 4JS4A 1RTHA 3HPGA 1NLVA 1BISA 2HHWA 1Q82O 4Z4IA 4QS9A 1KCFA 3GOIA 4X66K 3LWLA 4DFMA 4IFVA 5B8HA 4CJRA 1L3VA 3AGKA 3VF4A 4CHZA 3C6AA 1YT3A 1C0TA 1YIJN 4Q0BA 5C25A 5M1OA 3QEIA 3LL3A 4H5VA 5DMRA 4DB3A 3SAFA 2JGUA 4H4OA 4IKFA 2HHUA 3ZSRA 1NKCA 2O4IA 3SAHA 3OS2A 5AQKA 4JS5A 4FWMA 5GAEP 3LDNA 4FWRA 4C8MA 3KK1A 1EKEA 1VK0A 4Z4CA 3NF8A 4DFKA 4PWDA 1DTTA 4EP5A 1NGAA 2ZJQL 2YI1A 4FZXC 4IEEA 1W2BM 4CI6A 2W41A 5CYMA 2GUPA 1U4BA 3R8EA 4CJWA 4A62A 3DOKA 3G10A 2HNDA 3Q7CA 3W0LA 5C12A 1QQNA 4CHQA 4DTRA 4R79A 4WF9L 3DJCA 4JV5K 3TSUA 1EWRA 5KQDA 3E9PA 4M42A 4E89A 2DY4A 4ILJA 3IMXA 4FJLA 3HP9A 2HHTA 4JRQA 4J8FA 4AHRA 3G6EN 4F2SA 3HK2A 4WCEL 3QBXA 1QVFM 1W0HA 3AVNA 2X6NA 4FJGA 2F8TA 1MU2A 4IJAA 2FLOA 1IKXA 4E7JA 1RT6A 3PUFA 2QA4N 4A61A 4XIUA 3FR0A 2G8WA 1S1WA 3THYB 1IKYA 3DI6A 3HBTA 1VQ8N 2HMPA 4DFJA 4A2AA 3KK2A 3OYHA 3HTVA 3CCUN 1BG3A 1CZ9A 2LSNA 4BR4A 2NZTA 4H0YB 4FWKA 1U48A 4O8KA 4LF7K 4FWLA 2W6KA 2Q2RA 4ISFA 3CFRA 4DSKA 4BR9A 1RT7A 4DQSA 3T1AA 4B8CA 5AR0A 4PQUA 3SJJA 4FLTA 4FK0A 1T03A 3O80A 4OPHA 1NWKA 3ZT0A 2NRTA 4M41A 4FLVA 1GLAG 4M3ZA 4X62K 1IBMK 3ZT1A 3VESA 4KHUA 1HMVA 3OYFA 4JD2B 3WNHA 5E84A 1C0UA 4IJNA 4F8RA 1GOAA 5GIPA 4B1XB 5JICA 2JWKA 4JKGA 5AQXA 2FBVA 3DXMB 3LP2A 4H4MA 4K41A 1WNSA 4MFBA 4BACA 1HPZA 3AVHA 2OA8A 3CJCA 4CCHA 5TKYA 4DV4K 3NH1A 3A2FA 3BZKA 3VA3A 4AILC 2ASOA 4JKHA 4NB4A 1HKCA 1XHXA 2HW3A 3VN5A 4HUFA 1A5XA 1KVCA 3TAMA 2ZJPL 4CK1A 4JKBA 4JYAK 3ZETB
chains in the Genus database with same CATH topology
3ZX3A 1KAYA 1Q7YO 4UY8O 2E2NA 3QMLA 4ILGB 5AZJB 1XUPO 2F7TA 5E26A 3U9ZA 2HSTA 3O9RA 5EX5A 4H5NA 3ATUA 4ISEA 3WEEA 4F9OA 1K9MO 3P38A 3VEOA 4B1ZA 3C0BA 3C7NA 2IIRA 5BN8A 2Q36A 3MK6A 1BA0A 2E2OA 1V4TA 4BRFA 3OBYA 4CZIA 4WFBL 3CC2N 3HOSA 1S22A 3JXUA 3CQYA 5CR4A 3TTDA 4H0OA 5JVHL 3E9LA 3GDQA 3AAQA 2KKZA 3AY9A 5AZIB 4Z94A 4WFAL 3LDLA 5GADP 3L4QA 5KPZA 1HUXA 3VEVA 4YOVA 3CD6N 2VGMA 4XH5A 3E66A 2QM1A 4MO4A 2IVNA 3HRGA 3R3LA 1GLCG 1VQ4N 4GV9A 5F1XA 3NVMA 4IO9L 3CCMN 3WXMB 3CJ1A 3BF1A 2P9UA 4BC2A 4BRCA 4EIAA 3WXLA 4I6MA 4CD1A 2HBLA 3O5BA 2I7PA 5AQIA 3TSPA 3UKUB 4GV6A 4BRGA 2EWSA 3TTCA 3O1BA 3VEXA 3D2EB 3Q7BA 3MDQA 3FZKA 3T7ZA 1ATRA 2GWJA 4A57A 4JKAA 2QW9A 4JD2A 5AQHA 4BR7A 1T44A 5EOYA 5JVGL 1EQYA 3D2FA 4BRQA 3PIOL 4PKIA 2QEXN 1HPMA 2F9WA 5BPMA 3BP8A 1JJ2M 3FZFA 2QWOA 1S3XA 1MA9B 2ZWHA 4H5WA 1VAZA 2D0PA 4NLCA 2CH5A 3O4WA 2DPNA 2GTDA 3DXMA 3UKRA 1GLDG 3LDPA 4YDUC 4CZMA 5CE3A 3FZMA 2W40A 4XH1A 2P9PA 3GE1A 2NRVA 4K42A 3GG4A 4JHDB 1VQ7N 4BRNA 3TSQA 3U8XA 2IVOA 1KAZA 2A40A 4RCHA 4OO1J 1DGKN 2QWPA 3O9UA 3I33A 3SMPA 4JN4A 1Y64A 4NLBA 1ZXOA 4BGBA 4U67L 4BVOA 4ILHA 1X3MA 3IFRA 3D6RA 4BRAA 5GIOA 3VEYA 3U9DA 3MMVA 1EO1A 1HKGA 2J4RA 5EVZA 1RDWX 3EZWA 4WQ5A 5EXWA 2CGJA 2FXUA 3OHRA 2ASMA 3QB0A 5EY4A 1CZAN 3S41A 3U4LA 3VOVA 3ZETA 5JLHA 4BRMA 3AGRA 1DKGD 3PLAA 2P9UB 3VGLA 3W3DA 1DEJA 4FOEA 5AZJA 2ITMA 3KWIA 1NJIO 1R59O 4DHYA 1LOTB 1SQKA 5LY3A 5AQMA 3CPEA 3QBWA 1HX1A 2HBMA 3O9SA 5C2FA 2YHYA 2VYPA 3C65A 3MX2A 3MCAB 5BN9A 5M1NA 4AM6A 2VGNA 4Y0WA 4FOIA 4BQLA 3L0QA 4CBWA 4IZ9A 1HJOA 3WXKA 3H1VX 2A42A 4IWVA 5M1PA 2PAVA 4C1NK 5FPEA 1NGBA 5AZIA 3H6EA 4CZJA 1VQ5N 3RVCA 1C0FA 3VMFB 2CGLA 4DKWA 1MWKA 4BROA 2HF4A 3R6MA 3N4QA 1YJ9N 2GWKA 4FPAA 1KAXA 5AQVA 1Q81O 1X3NA 4B1YB 3FE1A 2VCPA 5AQWA 1S72N 4FO0A 3M1FA 5AQUA 4FWQA 2QWRA 3WXJA 1GLEG 2V52B 3M6GA 3UKUA 3BF3A 3WUHA 2FSKA 5GAHP 2IVPA 3F9MA 3D2EA 1ATNA 2YHXA 1YUWA 5AQFA 4IOCL 3TPQA 3VGKA 4BY9C 3QFPA 2OANA 5I9EB 2Q97A 3IDHA 4FVUA 2E20A 3SMSA 1M1KO 3LM9A 2QWQA 5BPLA 3M5RA 4WQ4A 2E1YA 2YCHA 3DXKB 3MN9A 3JS6A 4YOUA 3P4IA 5BREA 2QWMA 1KC8O 4BR5A 4K25A 2A6AA 4XH4A 3EE9A 3QDKA 4RTFD 1NGJA 3N4PA 2HBKA 3DLLL 2Q31A 3MWPA 3ZEUA 2BUPA 5JMVA 3NMUA 4JHDA 3O1WA 1K8KB 2KLAA 3CCEN 4HWIA 3L6QA 1NGGA 3EO3A 4U7BA 3BEXA 3P31A 3QICA 4FSVA 5JLFA 3FGUA 3A5NC 1J6ZA 2I7NA 3KZBA 3A5LC 3LDQA 1U2VB 1JCEA 2H3GX 2QXLA 5ADXA 5GAGP 2FSJA 1NGHA 1P8ZA 3CCVN 5CHIA 4WYBA 1Q18A 2Q1NA 4FWSA 4H5TA 4C1NI 3G4SN 4PL8A 4BRDA 4BRKA 3TU5A 4RWTA 4H5RA 3BUZB 4IDHA 1YJNN 5BRFA 4KBOA 2HF3A 3EKUA 4JKFA 4MO5A 2YJEA 5M1FA 3I55N 5LJWA 4BGAA 1XC3A 5AQZA 3HI0A 1QQOA 1NM1A 4GV3A 5TKWA 3CERA 2D0OA 3H3NO 3WT0A 1K73O 3VGMA 3LDOA 3CCRN 4BG8A 1JCGA 3O9TA 2HOEA 4NO7A 1GLJO 5C0YA 1VQLN 3E9OA 2NRHA 2E2QA 4B1VA 5AQLA 2E8AA 5AQRA 3ZYYX 1OKJA 4IO8A 4KH5A 4H0VB 1BO5O 5ADXH 2JWLA 5C2DA 4H0XB 4M7YA 1IG8A 2CGKA 2P9IB 1X9JA 5ELZA 3ZEUB 5AFUA 4GNIA 2ASPA 3MN5A 1KQSM 4BC3A 1BA1A 3FFKB 4BRLA 4CZHA 4PHTX 5BRDA 4FWPA 3SK3A 4CZLA 4PL7A 4AM7A 2P9NB 5H1SQ 1BOTO 5M1QA 2VWBA 3KHYA 3CCQN 4JNEA 5BPNA 3O8MA 2V7YA 3H3OB 1Z05A 3EL2A 1YVNA 1C0GA 1P90A 1QQMA 3CF5L 5GINA 3O9QA 5DM6L 3VEWA 4BREA 2NLXA 3LM2A 3OBWA 5FPMA 3R9PA 1Z6RA 1E4FT 3OA9A 4JK7A 2E88A 3ID8A 3IUCA 3GL1A 1MWMA 5AQSA 1BDGA 1GLBG 3G25A 1H1VA 3DXKA 1TUUA 3HZ6A 3K9JA 5BRHA 3CMEN 3GBTA 2GX9A 2QI2A 2WBNA 1W97L 1DT9A 1SAZA 3E1YA 1NBWA 3T69A 4HTLA 2E2PA 3CCJN 1MDUB 1D4XA 4BR2A 4BRHA 3VF6A 5AFUH 3RSEB 1QVGM 3CJ7A 3HSCA 4WQ5C 4PKGA 3WQUA 4E1JA 1K8KA 3SBTA 1VQON 4B1WB 1YHQN 1E4GT 3KVGA 3O08A 1ATSA 2Q0RA 2F9TA 1U2VA 2RHKA 3A5OC 3ID6A 1IJJA 3CJBA 3DWLA 1KXPA 4CZKA 5C10A 3CJAA 3UE5A 4FPBA 1Q86O 3ZX0A 5LJVA 2V7ZA 3AARA 4CBUA 2Q0UA 2YJFA 1BWFO 3CCSN 1G99A 4B9QA 4XEIA 2QTDA 4BC5A 1NGIA 3MCPA 1ZC6A 4KH4A 1NLVA 4JKDA 1YITN 4G9ZA 1Q82O 3CHWA 4QS9A 3SAGA 3CMAN 5AQOA 4O5FA 1JCFA 3GOIA 5B8HA 3A8YA 2E1ZA 4DQ8A 3AGKA 4QS7A 3VF4A 1VQKN 3CQXA 3L4IA 5FPNA 2NRZA 3R1XA 3VTHA 2YHWA 2P9KB 3F2KA 3SJHA 1K8AO 3C6AA 3KWGA 3K9KA 5AQTA 4WFNL 1YIJN 4B1UB 3EE8A 4A5BA 5M1OA 1YF5L 3EN9A 3LL3A 4IEIA 2D1KA 3A0IX 4H5VA 3WXIA 3ULEB 2NRXA 1U6ZA 4DB3A 3SAFA 4QS8A 4YOXA 3ENOA 5AQPA 1SZ2A 2P9IA 1T3VA 3AAPA 3A5MC 4EAHD 5KQ8A 4C23A 3SAHA 1YJWN 5AQKA 2RE2A 4FWMA 2P9NA 4LC9B 2YX6A 4EFHA 3QFUA 5GAEP 5MLCQ 3CPWM 3LDNA 4FWRA 2D4WA 3EKSA 4WQ4C 1VQ9N 3ENHA 3VTIA 3ATVA 4CD3A 1T6DA 3VPZA 3DAWA 2BH1A 2NRWA 2OTLN 4BVPA 1NGAA 5KPTA 2ZJQL 1V4SA 2YI1A 4H0PA 1NGEA 2A3ZA 4MLEA 5DM7L 4IEEA 1W2BM 4CI6A 2W41A 3SLCA 3O6WA 3UB5A 4BQZA 4CZGA 2GUPA 4JKGB 4CZEA 3MN7A 3R8EA 4A62A 3G71N 3ZETB 2FSNA 2P9SB 1HLUA 2WC9A 4PKHA 2PBDA 3Q7CA 4JAXA 4CBXA 3W0LA 5C12A 1N8RO 4MDBA 5FPDA 1QQNA 4R79A 3P39A 4BRPA 4CJ7A 3VETA 1YAGA 3DJCA 4GVEA 4JK9A 4A5AA 4WF9L 2QWNA 3RSEA 3TSUA 5KQDA 3E9PA 3VERA 1QZ5A 1TYQA 3SBGA 4H0TB 2GEMA 3J8AA 3IMXA 4ILJA 5AQGA 1QZ6A 4YDUA 1NGFA 1WUAA 1RFQA 4J8FA 3CC4N 3CJ9A 1OVYA 3G6EN 4BG9A 4WCEL 3QBXA 1QVFM 2P9LB 2V51B 1RGIA 2NNWA 2FF6A 3H45C 2FLOA 4IJAA 4O8UA 4A59A 1VQPN 4FL9A 1M90O 1BUPA 2QA4N 4A61A 2HBJA 4OPAA 3FR0A 1GLLO 4A2BA 4ISGA 4M7XA 3WEEB 4CZFA 2WUSA 3HBTA 3CC7N 1VQ8N 1LCUA 2HMPA 4DCHA 3WQTA 3C7NB 2ZF5O 4A2AA 2KHOA 3D7EO 3CCUN 3HTVA 3NVKA 3ENBA 4K43A 1BG3A 3CI5A 4KH6A 3CCLN 4BR4A 2NZTA 4H0YB 3VF2A 1HKBA 2P9KA 4FWKA 4BRIA 3FZHA 4O8KA 4EHUA 4FWLA 4L3QA 3TTFA 4YORA 2Q2RA 3VENA 4ISFA 2BTFA 1ILYA 3ULEA 4JK8A 2A5XA 4BR9A 1ESVA 3H46O 1SS6A 4JKEA 5AR0A 1NGCA 5AQJA 4YOTA 3HOTA 5C15A 1XQSC 3M3ZA 2QWLA 1TYQB 4BR0A 4JKCA 3O80A 1NGDA 4OPHA 5AQNA 3IKMA 1NWKA 1RDUA 4I6MB 5M1KA 2NRTA 2OTJN 4JEPA 1GLAG 5HOOA 3I8BA 4MLHA 5AQYA 5F2RA 2A41A 2PFUA 2ZJRL 4EHTA 3VESA 2UYTA 3C6HA 2ZGYA 2NRRA 1WOQA 4IOXA 4JD2B 1O13A 5E84A 4IOAL 1BU6O 1ZBSA 3D2FB 3HM8A 3B8AX 4IJNA 1VQ6N 1NMDA 3MWTA 4YOWA 3KK7A 1YXQA 3H1QA 3VEZA 5GIPA 3J7ZO 3CIPA 4B1XB 5JICA 4M63C 2JWKA 4JKGA 3PIPL 1GLFO 5AQXA 5F0XA 4GY2B 4H03B 3DXMB 3F5TA 3UKRB 2P9SA 3MN6A 4K41A 5HL7L 4FWNA 2FF3B 2AA4A 2P9PB 3I56N 3CJCA 1KD1O 5TKYA 4MDAA 5AQQA 3ZX2A 1QHAA 2ZGZA 2WFBA 4IXCA 2ASOA 3MX5A 1T6CA 1HKCA 4JKHA 2GELA 4NB4A 1VQNN 3CETA 4FWOA 2AP1A 2CH6A 3FLCO 1VQMN 5BR9A 4IFEA 2ZJPL 4BC4A 4YOYA 2P9LA 5KPRA 3CXCM 4JKBA 3OW2M 1YI2N 1TUYA 3FZLA 4AF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRZ A;  2NRV A;  3C65 A;  2NRT A;  2NRR A;  2NRW A;  2NRX A; 
#chains in the Genus database with same CATH topology
 4FJ8 A;  1VSF A;  2O8D A;  4DTS A;  4BDZ A;  3HO1 A;  3O9R A;  3HT3 A;  1K9M O;  1RT4 A;  3C7N A;  3J81 O;  4DUY K;  2YHB A;  1V4T A;  4CED A;  3HOS A;  4E7K A;  3DLE A;  5CR4 A;  3TTD A;  5JVH L;  2O8B B;  3GDQ A;  4Z94 A;  3LDL A;  3LAN A;  1HYS A;  2YNG A;  5KPZ A;  3T1H K;  3VEV A;  3CD6 N;  2VGM A;  1SUQ A;  4XH5 A;  2IVN A;  3AO3 A;  1JLC A;  4FK4 A;  1BGX T;  3AVK A;  4IO9 L;  3AA4 A;  4BC2 A;  4M3T A;  4Z4F A;  3PO4 A;  4I6M A;  4CD1 A;  2HBL A;  3OYN A;  3TSP A;  4BRG A;  3SUQ A;  4CHY A;  1FW6 A;  3FZK A;  3RMA A;  3P1G A;  2HHH K;  1T44 A;  5EOY A;  4LSN A;  3D2F A;  1VHX A;  1TGO A;  3AVM A;  5BPM A;  2F9W A;  4JI0 K;  1S3X A;  4GMJ B;  1VAZ A;  4CEE A;  3HVR A;  3NHG A;  1TKD A;  4W5O A;  1GLD G;  3ZSW A;  5CYQ A;  1S1T A;  4K42 A;  3DMJ A;  2XY7 A;  1QHT A;  4OO1 J;  1DGK N;  2QWP A;  4BGB A;  4U67 L;  3SMP A;  4QOZ B;  1LAV A;  1ZXO A;  1FK9 A;  3JAM O;  5FRO A;  1TKT A;  1X3M A;  4QAG A;  4RW7 A;  3U9D A;  4EZ9 A;  1HKG A;  4GKK K;  1BI4 B;  4WQ5 A;  3S41 A;  2CGJ A;  3U4L A;  1HNV A;  2P9U B;  3RWU A;  1RBV A;  3CQ8 A;  3KWI A;  4DHY A;  4KV8 A;  1LWF A;  5AQM A;  2HBM A;  4G1Q A;  4DTJ A;  3MX2 A;  3ITH A;  1S5J A;  1KVA A;  4LSL A;  2A42 A;  4IWV A;  3KLE A;  1XI1 A;  3RVC A;  1C0F A;  2CGL A;  4AQY K;  4YFU A;  3AO1 A;  4LH5 A;  4BRO A;  4YHH K;  4JI8 K;  3EYZ A;  1YJ9 N;  3S3N A;  3VQ9 A;  3NAE A;  5AQW A;  3M1F A;  1I39 A;  2YKM A;  4FWQ A;  2D0A A;  2OPQ A;  2QWR A;  3SQ2 A;  3D2E A;  3TPQ A;  1IH7 A;  4FJK A;  5I9E B;  1RDD A;  4FVU A;  1X1P A;  4C8O A;  2YNI A;  3LM9 A;  3VQP A;  2QWQ A;  4WQ4 A;  1QTM A;  2YCH A;  3PV8 A;  3DXK B;  5SZT A;  4DSI A;  3EE9 A;  4DQI A;  1NGJ A;  5J2Q A;  3ZEU A;  3MWP A;  2BUP A;  3O1W A;  2OYQ A;  1U49 A;  3QIC A;  4AHS A;  1QSS A;  2KFN A;  5AQY A;  2I7N A;  3TAE A;  3A5L C;  2H3G X;  5KRS A;  2FSJ A;  1NGH A;  1P8Z A;  3V1O A;  1Q18 A;  4H5T A;  1WBD A;  1VSH A;  4PL8 A;  4O55 A;  3CM6 A;  4CF0 A;  4BRK A;  2F8S A;  4RWT A;  1A5W A;  1YJN N;  3LAM A;  2D5R A;  3EKU A;  3THW B;  4KTZ A;  3T3F A;  4BGA A;  4B9L A;  2QKB A;  4M3W A;  1NM1 A;  4JI2 K;  5LMN K;  1EET A;  1HQE A;  4AHU A;  3VGM A;  4CF9 A;  5LL6 Z;  4H8K A;  3F9K A;  4DTU A;  2HOE A;  1GLJ O;  3SZ2 A;  2HVH A;  5C0Y A;  3E9O A;  4NYF A;  2NRH A;  2E8A A;  1OKJ A;  3NE6 A;  4H0V B;  1BO5 O;  5C2D A;  3J7A P;  1IG8 A;  2EHG A;  5ELZ A;  1X9J A;  4CJQ A;  3OYD A;  3RMC A;  4GNI A;  3MN5 A;  1KQS M;  4KKO A;  3FFK B;  1T8E A;  1J5O A;  5H1S Q;  3L2W A;  3H3O B;  1ITG A;  5GIN A;  3NBP A;  3VEW A;  1I94 K;  3WNE A;  4C8N A;  1Z6R A;  1E4F T;  4CFC A;  3ID8 A;  1MWM A;  1GLB G;  1NK7 A;  4IG3 A;  3HZ6 A;  1QSL A;  3CME N;  4ELT A;  1DT9 A;  1SAZ A;  1X9S A;  1MDU B;  1J5E K;  4B3T K;  4BR2 A;  3VF6 A;  3BDP A;  2A1R A;  3WQU A;  4HCB A;  4ZTJ A;  1B9D A;  5FRN A;  1E4G T;  1LW2 A;  4B08 A;  3OY9 A;  1ATS A;  2RHK A;  4W5N A;  3I0R A;  3ID6 A;  1UAX A;  3CJB A;  3OYK A;  3L3U A;  1RBT A;  3O3H A;  1S6Q A;  5HRP A;  3ZX0 A;  2Q0U A;  4BE0 A;  1N33 K;  1BWF O;  1G99 A;  3SCX A;  1RT3 A;  4BC5 A;  2ZM6 K;  4JKD A;  3SAG A;  3CMA N;  4Y1D A;  5AQO A;  5KGW A;  4CJS A;  2XRI A;  3A8Y A;  1IBK K;  3QIN A;  4EZ6 A;  5EU7 A;  3VTH A;  4DTM A;  1K8A O;  2HHQ A;  3KWG A;  5AQT A;  4WFN L;  4B1U B;  4A5B A;  4X64 K;  4FYD A;  3EN9 A;  1KFD A;  4IEI A;  3A0I X;  1TVR A;  3PX4 A;  1TAU A;  2NRX A;  4YOX A;  3SPZ A;  5AQP A;  2P9I A;  2HHX A;  1T3V A;  1Z26 A;  4E0D A;  4EAH D;  5KQ8 A;  4C23 A;  1IG9 A;  1YJW N;  4KO0 A;  1NK9 A;  2RE2 A;  3AVG A;  4EFH A;  5MLC Q;  2UUA K;  2D4W A;  3EKS A;  2X78 A;  1T6D A;  3DAW A;  1U04 A;  4OLA A;  4DU3 A;  4BVP A;  1L5U A;  2FBX A;  3U3Y A;  4H0P A;  1NJY A;  1S1U A;  2A3Z A;  5DM7 L;  3SLC A;  4CGF A;  1NK6 A;  3UB5 A;  4JKG B;  4CZE A;  2FSN A;  1BCM A;  3HL8 A;  2RPI A;  2WON A;  5FPD A;  2HNZ A;  3KK3 A;  5KRT A;  1YAG A;  4A5A A;  4JK9 A;  4MQ3 A;  4OPJ A;  4J2E A;  3RSE A;  3DRS A;  3AO4 A;  3OTO K;  2GEM A;  3J8A A;  5AQG A;  4YDU A;  1NGF A;  4CGI A;  1BL3 A;  1C1A A;  1RDC A;  1WUA A;  3HXM A;  1OVY A;  3ZSX A;  2OZS A;  2DTU A;  5CZ2 A;  3LZJ A;  3OYG A;  3HM9 A;  4O8U A;  4A59 A;  1M90 O;  1LWC A;  2O8D B;  1YTA A;  1FKO A;  1GLL O;  4M7X A;  3C6U A;  2FC0 A;  3NF6 A;  3NDK A;  3HP6 A;  3WQT A;  3C7N B;  2IAJ A;  3NVK A;  4K43 A;  4KH6 A;  3VQ5 A;  4DV7 K;  4DQR A;  1WB9 A;  3CCL N;  3VF2 A;  1HKB A;  3K5L A;  3TAF A;  4EHU A;  3TTF A;  4YOR A;  3VEN A;  1JLA A;  3OYM A;  3ULE A;  2A5X A;  1BIU A;  1ESV A;  4B8A B;  3H46 O;  2VQF K;  3E01 A;  4DSE A;  2HB5 A;  4JKE A;  4QCL A;  1NGC A;  3VQQ A;  5AQJ A;  2HHS A;  3HOT A;  1TYQ B;  4F3T A;  4JKC A;  3LPU A;  4BE2 A;  1C0M A;  4I6M B;  3O4N A;  4MLH A;  1VRU A;  1NJZ A;  3KTQ A;  4EHT A;  1TK0 A;  1OH7 A;  1O13 A;  4Z0U A;  4KTW A;  4E7L A;  1ZBS A;  3D2F B;  1X9W A;  1VQ6 N;  4OGE A;  4CVN E;  3H1Q A;  3DOL A;  4LD0 A;  4H03 B;  3M8S A;  3F5T A;  2P9S A;  3SUO A;  4N47 A;  1TKZ A;  5FRM A;  2BGG A;  1UA0 A;  4CER A;  1N36 K;  2ZGZ A;  3HPH A;  3MX5 A;  2GEL A;  3CET A;  2AP1 A;  5BR9 A;  1LWE A;  5HLF A;  4YOY A;  2P9L A;  2VWJ A;  1KAY A;  1Q7Y O;  1JLE A;  1RT1 A;  4B9M A;  4ILG B;  1XUP O;  4W5Q A;  3V1Q A;  2HST A;  5EX5 A;  2YNF A;  3WEE A;  4F9O A;  3P38 A;  1B9F A;  3VEO A;  4B1Z A;  3C0B A;  4J2B A;  1O1W A;  1BA0 A;  3AA5 X;  3MK6 A;  4WFB L;  2VG7 A;  4CZI A;  3QEV A;  3WNG A;  4B3M K;  2KZZ A;  4O0I A;  3NFA A;  5E41 A;  3LAL A;  3JXU A;  4WE1 A;  3E9L A;  3AY9 A;  2KKZ A;  5A2Q O;  3MEC A;  3E66 A;  2QM1 A;  4MO4 A;  3G0Z A;  1VSL A;  3R3L A;  1SKS A;  4CGG A;  1ZBL A;  4DR3 K;  3WXL A;  2G8K A;  4LF6 K;  3O5B A;  5AQI A;  1CXU A;  2I5J A;  3D2E B;  3MDQ A;  2GWJ A;  4J2D A;  1JKH A;  4PKI A;  2VWK A;  3D0P A;  2QWO A;  1ZBU A;  4H5W A;  2B6A A;  4FVM A;  3U6F A;  3O4W A;  3UKR A;  2BDP A;  4IFY A;  1EWQ A;  2W40 A;  4E7H A;  3TSQ A;  1KAZ A;  2PYJ A;  4J2A A;  3O9U A;  1BCO A;  3TAG A;  1NJW A;  4CJE A;  4BVO A;  1IV0 A;  1TK5 A;  3NGI A;  3IFR A;  3IAY A;  5GIO A;  3AVF A;  1EO1 A;  4FJ9 A;  1RDW X;  1RDA A;  4CEA A;  2FXU A;  3QB0 A;  5KTQ A;  2ASM A;  4M3R A;  1CZA N;  3AGR A;  1DKG D;  4TSX A;  2IDO A;  3THX A;  1LOT B;  1VSK A;  1HX1 A;  2QXF A;  3O9S A;  1JLG A;  3B6P A;  2VYP A;  1NNE A;  4B3O A;  5M1N A;  2VGN A;  4Y0W A;  1KSP A;  3WXK A;  1HJO A;  3H1V X;  1NGB A;  4HTU A;  2HF4 A;  4AH9 A;  1RBS A;  1ZYQ A;  3FFI A;  5J1E A;  1TV6 A;  5AQU A;  4JI3 K;  4M3X A;  1NOY A;  3IS9 A;  4DG1 A;  3UKU A;  1WSJ A;  2O8E A;  3WUH A;  3RRH A;  5GAH P;  3NH0 A;  4CFB A;  4IOC L;  4BY9 C;  3T1Y K;  1DTQ A;  2Q97 A;  2UXB K;  4EP4 A;  4PY5 A;  1M1K O;  1CXQ A;  3AVJ A;  4CHO A;  2ZD1 A;  3M5R A;  5BPL A;  3MN9 A;  4YOU A;  3P4I A;  2QWM A;  3HJF A;  1KC8 O;  4BR5 A;  4K25 A;  3MXJ A;  2HBK A;  2HHV A;  3RR8 A;  3NMU A;  4JHD A;  4OKJ A;  3CCE N;  1NGG A;  3EO3 A;  4U7B A;  1D9F A;  1S9E A;  5JLF A;  3K0S A;  3K5M A;  3KZB A;  5ADX A;  2QXL A;  3D45 A;  3SPY A;  3K57 A;  4WYB A;  3IRX A;  3QO9 A;  4DR4 K;  3TU5 A;  4H5R A;  4IDH A;  1JXE A;  4MO5 A;  3VQ4 A;  4DSJ A;  3I55 N;  5AQZ A;  2O8F A;  4DU1 A;  4LFA K;  5TKW A;  5C42 A;  4B3S K;  2D0O A;  1K73 O;  3OS0 A;  3OYC A;  3QIP A;  4BG8 A;  4NO7 A;  4CGH A;  5HRR A;  2E2Q A;  5AQL A;  4FXD A;  3ZYY X;  4JI5 K;  1VSD A;  3K5O A;  4JI7 K;  4M7Y A;  2CGK A;  2P9I B;  5AFU A;  4FM0 A;  2ASP A;  3OYA A;  4BC3 A;  3ZCM A;  4BRL A;  4FWP A;  4CZL A;  1BOT O;  1RBR A;  1WSF A;  4OGC A;  3PO5 A;  3LAK A;  1ZBI A;  1C0G A;  4BRE A;  3SV3 A;  3VQB A;  4KI6 A;  3LM2 A;  3OBW A;  3R9P A;  4LY7 A;  3DRP A;  1S6P A;  2O8C A;  3IUC A;  3TAQ A;  5AQS A;  2E4L A;  3KD5 E;  2VQE K;  4B9T A;  2GX9 A;  3TAP A;  3OYE A;  3SQ0 A;  1NBW A;  3T69 A;  1D4X A;  3AO5 A;  3ASM A;  3RSE B;  5CY4 A;  3HST B;  3HSC A;  4WQ5 C;  4PKG A;  1K8K A;  4M3Y A;  3SBT A;  2G8V A;  1YHQ N;  3O08 A;  1WAJ A;  5FLX O;  2Q0R A;  2F9T A;  1U2V A;  3A5O C;  4CEZ A;  2UUC K;  1KXP A;  3CJA A;  3QET A;  4FPB A;  3CFP A;  2V7Z A;  2P51 A;  3AAR A;  1U45 A;  4B9Q A;  3OYJ A;  4CEO A;  3SQ1 A;  4KH4 A;  4G9Z A;  4DR6 K;  1JCF A;  2W6L A;  1QSY A;  4DQ8 A;  1VQK N;  1SKW A;  3K5N A;  3L4I A;  4C8K A;  1F21 A;  5FPN A;  3R1X A;  3SNN A;  3F2K A;  3SJH A;  1WSE A;  1RNH A;  3K9K A;  3EE8 A;  3VQ6 A;  1YF5 L;  3OYI A;  2EX3 A;  2GUI A;  3WXI A;  3ULE B;  1U6Z A;  4QS8 A;  4E3S A;  3ENO A;  1SZ2 A;  4LH4 A;  2HNY A;  1XNQ K;  3HYF A;  2P9N A;  4LC9 B;  3QFU A;  2YV0 X;  1OH8 A;  3KLH A;  3THY A;  4WQ4 C;  1VQ9 N;  3ENH A;  3V9X A;  3ATV A;  3VPZ A;  4ID5 A;  2BH1 A;  3DLH A;  3VQ8 A;  1OH5 A;  5KPT A;  3QEP A;  2VG5 A;  1V4S A;  3B6O A;  3ZSO A;  1JLQ A;  1N6Q A;  5HRN A;  3O6W A;  4CZG A;  4PUO A;  1XNR K;  3MN7 A;  3OJU A;  3TAR A;  3PX0 A;  4FJX A;  3V1R A;  2IS3 A;  2P9S B;  2E5L K;  2PBD A;  1GOC A;  4DF8 A;  1WSG A;  1N8R O;  4MDB A;  4BRP A;  4CJ7 A;  1IKV A;  4PA1 A;  4FLW A;  4KRE A;  3IG1 A;  4ZHR A;  4KAZ A;  3VER A;  3SBG A;  4H0T B;  3MED A;  1QZ6 A;  3AV9 A;  3EEQ A;  4CE9 A;  1BQM A;  3ZSQ A;  3CJ9 A;  4BG9 A;  1W9H A;  2P9L B;  2NNW A;  1RCH A;  3SYZ A;  2FF6 A;  3H45 C;  5JS1 A;  1VQP N;  4IDK A;  4FL9 A;  4GKJ K;  1BUP A;  3QLH A;  3VQC A;  5D3G A;  1CZB A;  4Z4H A;  4OPA A;  1HJR A;  4A2B A;  4CK3 A;  3WEE B;  2WUS A;  3CC7 N;  1UWB A;  1LCU A;  4DCH A;  2KHO A;  3D7E O;  3ENB A;  4DV5 K;  1BHL A;  1I3A A;  4DLE A;  2P9K A;  4BRI A;  4FJM A;  3NH2 A;  3J80 O;  4OLB A;  4CEB A;  2BTF A;  1ILY A;  4M3U A;  4JK8 A;  4RW4 A;  3DLB A;  3EY1 A;  1SS6 A;  1KRP A;  3OVN A;  4JRP A;  3C95 A;  1XQS C;  3M3Z A;  2QWL A;  2UUB K;  3IKM A;  5M1K A;  3KJV A;  4JEP A;  5HOO A;  1L3S A;  3I8B A;  4N56 A;  4KB0 A;  2YHA A;  2PFU A;  5F2R A;  2ZJR L;  4F2R A;  2UYT A;  3C6H A;  4NCG A;  2NRR A;  4IOX A;  5J2P A;  3AVI A;  4IOA L;  4DUZ K;  3M8P A;  3HM8 A;  3B8A X;  1NMD A;  1RDB A;  1YXQ A;  3J7Z O;  3CIP A;  4M63 C;  2XY5 A;  4CF8 A;  3PIP L;  5F0X A;  4BWM A;  3UKR B;  2PZS A;  5HL7 L;  5J2M A;  2OPS A;  4FWN A;  2AA4 A;  2WOM A;  3I56 N;  4KFB A;  4CJV A;  5AQQ A;  3ZX2 A;  1QHA A;  1SL1 A;  4B9V A;  4IXC A;  1T6C A;  4FWO A;  3MEG A;  3K58 A;  4JI1 K;  2CH6 A;  3FLC O;  3I0S A;  4E19 A;  2D0C A;  3I8D A;  3MAQ A;  3L2U A;  3CXC M;  1YI2 N;  3S3M A;  3FZL A;  4AF1 A;  3VQA A;  2KZM A;  1U47 A;  4UY8 O;  3KIO A;  4CIE A;  4NCB A;  1UA1 A;  2E2N A;  1KTQ A;  3QML A;  4DMN A;  4N76 A;  2IC3 A;  4CFA A;  1VSJ A;  4FZZ A;  2F7T A;  5E26 A;  4H5N A;  3BY5 A;  2UXD K;  2A1S A;  5BN8 A;  4OKE A;  2E2O A;  3OBY A;  4CJ5 A;  3ULD A;  5T7B A;  1S22 A;  3NGY A;  3CQY A;  1WN7 A;  3AVA A;  3AAQ A;  4WFA L;  4ELV A;  5GAD P;  1NK5 A;  1ZBF A;  4YOV A;  4BWJ A;  4GV9 A;  4X65 K;  3CG7 A;  5F1X A;  3OYL A;  3DYA A;  3NVM A;  3BF1 A;  2P9U A;  4EIA A;  4F4K A;  2I7P A;  3UKU B;  2O8E B;  1SL0 A;  3TTC A;  3VEX A;  1HQU A;  3LP3 A;  1HYV A;  4BR7 A;  2QW9 A;  4ICL A;  5AQH A;  3PIO L;  1HPM A;  5HBM A;  3BP8 A;  2OPP A;  1XHZ A;  2ZWH A;  2D0P A;  2CH5 A;  3TR8 A;  2OCE A;  4YDU C;  4CZM A;  3QER A;  3FZM A;  3OYB A;  4XH1 A;  2P9P A;  2D0B A;  3CYM A;  3GE1 A;  2UU9 K;  3GG4 A;  3QES A;  4JHD B;  3VQ7 A;  2IVO A;  4CJK A;  4RCH A;  2R7Y A;  1Q8I A;  3J7Y P;  3I33 A;  4JN4 A;  1Y64 A;  4NLB A;  4AHC A;  1R0A A;  1B92 A;  4ILH A;  4KRF A;  1CLQ A;  1BIZ A;  4DV3 K;  3VEY A;  1LV5 A;  2ZQB A;  5EVZ A;  4DQP A;  3EZW A;  3DRR A;  3OHR A;  5EY4 A;  2Z1H A;  1YVU A;  1HNW K;  4DR1 K;  1JL1 A;  2IGI A;  1XWL A;  3PLA A;  4DWI A;  3W3D A;  1HNZ K;  3AA2 A;  4FJJ A;  3DLK A;  4OJR A;  4CJ3 A;  5AZJ A;  1EP4 A;  3CM5 A;  2O8F B;  4KI4 A;  1NJI O;  2ATQ A;  1ASV A;  1R59 O;  3VA0 A;  1NK8 A;  5LY3 A;  3QBW A;  1TL1 A;  2YHY A;  3MCA B;  5BN9 A;  4BDY A;  2XY8 A;  4AM6 A;  3SI6 A;  4BQL A;  3ISN C;  5M1P A;  2PAV A;  4C1N K;  1IKW A;  5AZI A;  5FPE A;  3RRG A;  1N32 K;  1VQ5 N;  3VMF B;  1NMN A;  1RT2 A;  3AA3 A;  4DKW A;  2IOC A;  1L3U A;  3N4Q A;  2QK9 A;  4FPA A;  3O3G A;  2X6S A;  1KAX A;  3RMB A;  1Q81 O;  2G8I A;  1X3N A;  4HCC A;  3FE1 A;  4DTN A;  3PSI A;  3L2V A;  1GLE G;  2V52 B;  3M6G A;  4DV2 K;  3BF3 A;  2XO7 A;  5HRS A;  3BZC A;  3F9M A;  2YHX A;  1YUW A;  3VGK A;  1KFS A;  3QFP A;  2RN2 A;  2OAN A;  4DR7 K;  3IDH A;  1TL3 A;  1WSH A;  3SMS A;  4CHN A;  2O8C B;  2GBZ A;  2E1Y A;  2PYL A;  3JS6 A;  2Y1I A;  1D9D A;  1TKX A;  2A6A A;  3M8Q A;  4W5T A;  3V4I A;  4DV1 K;  3QDK A;  4LFC K;  3JYT A;  3O4Q A;  1BQN A;  1QE1 A;  2Q31 A;  1RTD A;  3F73 A;  1QQC A;  4KHN A;  1K8K B;  1L3T A;  2FBY A;  3P31 A;  3AVL A;  2P5O A;  3FGU A;  1J6Z A;  1U2V B;  1JCE A;  5I42 A;  5CHI A;  4FWS A;  4C1N I;  4BRD A;  4FJN A;  5BRF A;  4KBO A;  2HF3 A;  4JKF A;  2YJE A;  5LJW A;  1XC3 A;  3DM2 A;  4GV3 A;  4FZY A;  3H3N O;  3WT0 A;  3QEX A;  4FM2 A;  5BR8 K;  3LDO A;  1WAF A;  1JCG A;  4B3R K;  3ZSY A;  4Q5V A;  3DLR A;  4B9N A;  1E3M A;  1VQL N;  4CJL A;  1A5V A;  1S1V A;  5AQR A;  4IO8 A;  4KH5 A;  3V81 A;  5ADX H;  4LF5 K;  4I9L A;  4KHP K;  4R5P A;  3ZEU B;  3VQE A;  3JSM A;  3AVB A;  1BA1 A;  4CZH A;  5BRD A;  4PL7 A;  3S9H A;  1HYZ A;  4AM7 A;  2P9N B;  4YNQ A;  4UQG A;  5M1Q A;  3V6D A;  1T7P A;  3KHY A;  4JNE A;  1NK4 A;  3O8M A;  3NCI A;  3EL2 A;  3O3F A;  1RT5 A;  4K8X A;  1GOB A;  3WNF A;  4CEF A;  1P90 A;  3CF5 L;  1Z25 A;  5FPM A;  3OA9 A;  1S9G A;  4JK7 A;  1REV A;  2E88 A;  2KQ2 A;  3GL1 A;  4O44 A;  3G25 A;  1TUU A;  3K9J A;  3K59 A;  2QI2 A;  2WBN A;  3E1Y A;  4DFP A;  4DR5 K;  2E2P A;  3CCJ N;  4BRH A;  5AFU H;  5LMU K;  4FM1 A;  1QVG M;  4E1M A;  1J54 A;  3UIQ A;  4DR2 K;  4E1J A;  5DK5 A;  2JLE A;  1NG9 A;  4RW9 A;  2XY6 A;  1IJJ A;  1ZBH A;  4CZK A;  5C10 A;  1YTU A;  5LJV A;  4CHP A;  4CBU A;  2YJF A;  3CCS N;  4CES A;  2QTD A;  1ZC6 A;  1S1X A;  3VQD A;  1YIT N;  4KTQ A;  1Q9Y A;  3CHW A;  1TAQ A;  4LFB K;  4O5F A;  2WTU A;  4CFD A;  2E1Z A;  3ALY A;  4N41 A;  4QS7 A;  3CQX A;  4FJI A;  4FW2 A;  2NRZ A;  4ELU A;  2F96 A;  2YHW A;  2P9K B;  4DSL A;  2D1K A;  1C1C A;  1IBL K;  2AJQ A;  4C8L A;  3PY8 A;  3EZ5 A;  4KPY A;  3AAP A;  1D5A A;  3A5M C;  4CJ4 A;  4CIG A;  4BE1 A;  3KKS A;  1VSI A;  2KFZ A;  3CPW M;  2YX6 A;  4KHY A;  2E6L A;  2UXC K;  2B5J A;  2Z1G A;  3AO2 A;  4M45 A;  3VTI A;  4CD3 A;  1C6V A;  2NRW A;  2OTL N;  2G8F A;  3K2P A;  1NGE A;  4MLE A;  2FBT A;  2DFH A;  2YNH A;  4CJU A;  4BQZ A;  4CF1 A;  3ZT2 A;  4HUG A;  3G71 N;  1HLU A;  1N34 K;  2WC9 A;  4PKH A;  4JAX A;  4CBX A;  4JI4 K;  4HUE A;  1J9A A;  3P39 A;  3VET A;  3C6T A;  4GVE A;  4JLH A;  2QWN A;  1NKE A;  1QZ5 A;  5J2N A;  1TYQ A;  2YKN A;  4RW6 A;  3SUP A;  1RFQ A;  2NUB A;  4W5R A;  3CC4 N;  2RKI A;  2V51 B;  1RGI A;  1SL2 A;  4IG0 A;  3RR7 A;  4FW1 A;  4V19 S;  2HBJ A;  4ISG A;  4Z4E A;  4CZF A;  2GV9 A;  2DFE A;  4KHW A;  2ZF5 O;  1J53 A;  1RTI A;  3CI5 A;  5I3U A;  4KHS A;  1VSM A;  2ZE2 A;  4RG8 A;  1WSI A;  3FZH A;  4L3Q A;  4FJH A;  4F3O A;  3MEE A;  5KGX A;  2XHB A;  5JS2 A;  3SV4 A;  3V9S A;  1JLB A;  4FLZ A;  3HPO A;  4YOT A;  5C15 A;  4BR0 A;  1NGD A;  5AQN A;  5IT9 O;  1RDU A;  3LP1 A;  1NKB A;  2OTJ N;  1NOZ A;  4OKK A;  3QIO A;  2A41 A;  2BE2 A;  3KLI A;  2ZGY A;  4GW6 A;  2P5G A;  1JLF A;  3SUN A;  1WOQ A;  1C1B A;  4E7I A;  1HNX K;  1BU6 O;  2DFF A;  3MWT A;  4YOW A;  3ZT4 A;  3KK7 A;  1LAW A;  3VEZ A;  4DU4 A;  4O4G A;  3RTV A;  1GLF O;  4GY2 B;  2VG6 A;  3MN6 A;  2FF3 B;  2P9P B;  2O4G A;  2ITG A;  4K8Z A;  1KD1 O;  4ID1 A;  4MDA A;  3LPT A;  4FLY A;  2WFB A;  1VQN N;  2KTQ A;  1FXX A;  3U3G A;  4FCY A;  1HRH A;  1OH6 A;  1VQM N;  4IFE A;  1IO2 A;  4BC4 A;  4YY3 K;  5KPR A;  4DF4 A;  3OW2 M;  1TUY A;  4NCA A;  3ZX3 A;  4BDP A;  4NXN K;  5AZJ B;  4AHT A;  2B4J A;  3U9Z A;  4IBN A;  2F4V K;  4CGJ A;  2QKK A;  3ATU A;  4ISE A;  4ZTF A;  4CJP A;  3ZSZ A;  2IIR A;  2Q36 A;  3MXM A;  4BRF A;  2X74 A;  3QNN A;  3KD1 E;  3CC2 N;  1NK0 A;  4B9U A;  4FK2 A;  3NF9 A;  3P5J A;  4H0O A;  5AZI B;  4CJT A;  3L4Q A;  3PX6 A;  1WLJ A;  1HUX A;  4FJ7 A;  4I2P A;  3HRG A;  4FLU A;  1VQ4 N;  1GLC G;  3NF7 A;  1Y97 A;  1K6Y A;  3CCM N;  3C94 A;  3WXM B;  4I7F A;  3CJ1 A;  4BRC A;  2PY5 A;  4GV6 A;  2EWS A;  3O1B A;  2Q3S A;  3Q7B A;  3DLG A;  2RF2 A;  3T7Z A;  1ATR A;  1T05 A;  4A57 A;  1KVB A;  4OX9 K;  5FDL A;  4JKA A;  3LZI A;  4JD2 A;  5JVG L;  1EQY A;  4BRQ A;  2QEX N;  3LP0 A;  1RTJ A;  3CFO A;  3FZF A;  1JJ2 M;  3L8B A;  1MA9 B;  4FJ5 A;  1XC9 A;  1X9M A;  4CK2 A;  4DS5 A;  4NLC A;  2DPN A;  2GTD A;  3DXM A;  3LDP A;  5CE3 A;  4CW7 B;  1ASW A;  4CGD A;  3T19 A;  2NRV A;  4KB1 A;  1VQ7 N;  4BRN A;  3U8X A;  4DTP A;  1FKP A;  2A40 A;  5HRO A;  1OVQ A;  4DLG A;  3THV A;  5K14 A;  1JL2 A;  3D6R A;  4BRA A;  4K0K K;  2G8H A;  3MMV A;  5AJ3 K;  3SQ4 A;  2J4R A;  1WBB A;  4AHV A;  5EXW A;  3VOV A;  4LF8 K;  4DS4 A;  3ZET A;  5JLH A;  4BRM A;  4DQQ A;  3VGL A;  1N5Y A;  1DEJ A;  4FOE A;  2ITM A;  1SQK A;  3V9Z A;  3CPE A;  3HVT A;  2HVI A;  5C2F A;  1VSE A;  4O0J A;  2E6M A;  3C65 A;  3ZT3 A;  3L2R A;  4CEC A;  4CBW A;  4FOI A;  3L0Q A;  4IZ9 A;  2Z1J A;  5KI6 A;  2O8B A;  2KW4 A;  3H6E A;  4CZJ A;  3OJS A;  5HP1 A;  1MWK A;  3R6M A;  4OVL A;  2GWK A;  4RW8 A;  4DV6 K;  5AQV A;  4KHQ A;  3KLF A;  3ZSV A;  1KLM A;  4B1Y B;  4LF4 K;  1S72 N;  2VCP A;  4FO0 A;  3P83 D;  4CJF A;  1HR0 K;  2P1J A;  3WXJ A;  1Q9X A;  1EX4 A;  3KKR A;  3LWM A;  2FSK A;  2IVP A;  1ATN A;  5AQF A;  3L3V A;  2E20 A;  3THX B;  4JI6 K;  1XMQ K;  4GVM A;  1JXB A;  5BRE A;  3L2Q A;  4XH4 A;  4I2Q A;  4RTF D;  5IWA K;  3N4P A;  3DLL L;  2HMI A;  5JMV A;  1VRT A;  3M8R A;  2KLA A;  4HWI A;  3L6Q A;  3BEX A;  4FSV A;  1HNI A;  1D8Y A;  3A5N C;  3BGR A;  3LDQ A;  4CF2 A;  5GAG P;  5SWM A;  3S3O A;  3CCV N;  4DSF A;  2Y1J A;  2Q1N A;  3G4S N;  4CIF A;  1BI4 A;  4L8R B;  2OPR A;  3BUZ B;  5C24 A;  3AVC A;  4OPK A;  2G8U A;  5M1F A;  1TK8 A;  2Z1I A;  2ETJ A;  3HI0 A;  1QQO A;  4CEQ A;  4NXM K;  3CER A;  4Z4G A;  3QNO A;  3CCR N;  3O9T A;  1NJX A;  1KLN A;  2BAN A;  3H08 A;  2W42 A;  3V9U A;  4B1V A;  2JWL A;  4H0X B;  1G15 A;  4DV0 K;  1ASU A;  4LF9 K;  4PHT X;  3SK3 A;  1NU0 A;  2OZM A;  2VWB A;  5CZ1 A;  3CCQ N;  5BPN A;  2V7Y A;  1Z05 A;  4Y1C A;  1YVN A;  1QQM A;  3O9Q A;  4N5S A;  5DM6 L;  2NLX A;  3ZLJ A;  3TWH A;  1BDG A;  1H1V A;  3DXK A;  5BRH A;  4HHT A;  1W7A A;  3GBT A;  1W97 L;  3NGZ A;  1RIL A;  4HTL A;  4I9Q A;  4NYN A;  3TAB A;  1QS4 A;  3TAN A;  4B9S A;  3CJ7 A;  1XMO K;  3KLG A;  1FJG K;  4FLX A;  1RBU A;  4DTO A;  1VQO N;  4B1W B;  3KVG A;  3LDS A;  3MXI A;  3OS1 A;  4E1N A;  3V9W A;  3DWL A;  1SV5 A;  4O5B A;  3UE5 A;  1DLO A;  3PSF A;  1Q86 O;  3QEW A;  1LW0 A;  1UOC A;  1SKR A;  4HVJ A;  3TI0 A;  4DTX A;  3RMD A;  4XEI A;  1NGI A;  3THW A;  1EXQ A;  3MCP A;  4JS4 A;  1RTH A;  3HPG A;  1NLV A;  1BIS A;  2HHW A;  1Q82 O;  4Z4I A;  4QS9 A;  1KCF A;  3GOI A;  4X66 K;  3LWL A;  4DFM A;  4IFV A;  5B8H A;  4CJR A;  1L3V A;  3AGK A;  3VF4 A;  4CHZ A;  3C6A A;  1YT3 A;  1C0T A;  1YIJ N;  4Q0B A;  5C25 A;  5M1O A;  3QEI A;  3LL3 A;  4H5V A;  5DMR A;  4DB3 A;  3SAF A;  2JGU A;  4H4O A;  4IKF A;  2HHU A;  3ZSR A;  1NKC A;  2O4I A;  3SAH A;  3OS2 A;  5AQK A;  4JS5 A;  4FWM A;  5GAE P;  3LDN A;  4FWR A;  4C8M A;  3KK1 A;  1EKE A;  1VK0 A;  4Z4C A;  3NF8 A;  4DFK A;  4PWD A;  1DTT A;  4EP5 A;  1NGA A;  2ZJQ L;  2YI1 A;  4FZX C;  4IEE A;  1W2B M;  4CI6 A;  2W41 A;  5CYM A;  2GUP A;  1U4B A;  3R8E A;  4CJW A;  4A62 A;  3DOK A;  3G10 A;  2HND A;  3Q7C A;  3W0L A;  5C12 A;  1QQN A;  4CHQ A;  4DTR A;  4R79 A;  4WF9 L;  3DJC A;  4JV5 K;  3TSU A;  1EWR A;  5KQD A;  3E9P A;  4M42 A;  4E89 A;  2DY4 A;  4ILJ A;  3IMX A;  4FJL A;  3HP9 A;  2HHT A;  4JRQ A;  4J8F A;  4AHR A;  3G6E N;  4F2S A;  3HK2 A;  4WCE L;  3QBX A;  1QVF M;  1W0H A;  3AVN A;  2X6N A;  4FJG A;  2F8T A;  1MU2 A;  4IJA A;  2FLO A;  1IKX A;  4E7J A;  1RT6 A;  3PUF A;  2QA4 N;  4A61 A;  4XIU A;  3FR0 A;  2G8W A;  1S1W A;  3THY B;  1IKY A;  3DI6 A;  3HBT A;  1VQ8 N;  2HMP A;  4DFJ A;  4A2A A;  3KK2 A;  3OYH A;  3HTV A;  3CCU N;  1BG3 A;  1CZ9 A;  2LSN A;  4BR4 A;  2NZT A;  4H0Y B;  4FWK A;  1U48 A;  4O8K A;  4LF7 K;  4FWL A;  2W6K A;  2Q2R A;  4ISF A;  3CFR A;  4DSK A;  4BR9 A;  1RT7 A;  4DQS A;  3T1A A;  4B8C A;  5AR0 A;  4PQU A;  3SJJ A;  4FLT A;  4FK0 A;  1T03 A;  3O80 A;  4OPH A;  1NWK A;  3ZT0 A;  2NRT A;  4M41 A;  4FLV A;  1GLA G;  4M3Z A;  4X62 K;  1IBM K;  3ZT1 A;  3VES A;  4KHU A;  1HMV A;  3OYF A;  4JD2 B;  3WNH A;  5E84 A;  1C0U A;  4IJN A;  4F8R A;  1GOA A;  5GIP A;  4B1X B;  5JIC A;  2JWK A;  4JKG A;  5AQX A;  2FBV A;  3DXM B;  3LP2 A;  4H4M A;  4K41 A;  1WNS A;  4MFB A;  4BAC A;  1HPZ A;  3AVH A;  2OA8 A;  3CJC A;  4CCH A;  5TKY A;  4DV4 K;  3NH1 A;  3A2F A;  3BZK A;  3VA3 A;  4AIL C;  2ASO A;  4JKH A;  4NB4 A;  1HKC A;  1XHX A;  2HW3 A;  3VN5 A;  4HUF A;  1A5X A;  1KVC A;  3TAM A;  2ZJP L;  4CK1 A;  4JKB A;  4JYA K;  3ZET B; 
#chains in the Genus database with same CATH homology
 3ZX3 A;  1KAY A;  1Q7Y O;  4UY8 O;  2E2N A;  3QML A;  4ILG B;  5AZJ B;  1XUP O;  2F7T A;  5E26 A;  3U9Z A;  2HST A;  3O9R A;  5EX5 A;  4H5N A;  3ATU A;  4ISE A;  3WEE A;  4F9O A;  1K9M O;  3P38 A;  3VEO A;  4B1Z A;  3C0B A;  3C7N A;  2IIR A;  5BN8 A;  2Q36 A;  3MK6 A;  1BA0 A;  2E2O A;  1V4T A;  4BRF A;  3OBY A;  4CZI A;  4WFB L;  3CC2 N;  3HOS A;  1S22 A;  3JXU A;  3CQY A;  5CR4 A;  3TTD A;  4H0O A;  5JVH L;  3E9L A;  3GDQ A;  3AAQ A;  2KKZ A;  3AY9 A;  5AZI B;  4Z94 A;  4WFA L;  3LDL A;  5GAD P;  3L4Q A;  5KPZ A;  1HUX A;  3VEV A;  4YOV A;  3CD6 N;  2VGM A;  4XH5 A;  3E66 A;  2QM1 A;  4MO4 A;  2IVN A;  3HRG A;  3R3L A;  1GLC G;  1VQ4 N;  4GV9 A;  5F1X A;  3NVM A;  4IO9 L;  3CCM N;  3WXM B;  3CJ1 A;  3BF1 A;  2P9U A;  4BC2 A;  4BRC A;  4EIA A;  3WXL A;  4I6M A;  4CD1 A;  2HBL A;  3O5B A;  2I7P A;  5AQI A;  3TSP A;  3UKU B;  4GV6 A;  4BRG A;  2EWS A;  3TTC A;  3O1B A;  3VEX A;  3D2E B;  3Q7B A;  3MDQ A;  3FZK A;  3T7Z A;  1ATR A;  2GWJ A;  4A57 A;  4JKA A;  2QW9 A;  4JD2 A;  5AQH A;  4BR7 A;  1T44 A;  5EOY A;  5JVG L;  1EQY A;  3D2F A;  4BRQ A;  3PIO L;  4PKI A;  2QEX N;  1HPM A;  2F9W A;  5BPM A;  3BP8 A;  1JJ2 M;  3FZF A;  2QWO A;  1S3X A;  1MA9 B;  2ZWH A;  4H5W A;  1VAZ A;  2D0P A;  4NLC A;  2CH5 A;  3O4W A;  2DPN A;  2GTD A;  3DXM A;  3UKR A;  1GLD G;  3LDP A;  4YDU C;  4CZM A;  5CE3 A;  3FZM A;  2W40 A;  4XH1 A;  2P9P A;  3GE1 A;  2NRV A;  4K42 A;  3GG4 A;  4JHD B;  1VQ7 N;  4BRN A;  3TSQ A;  3U8X A;  2IVO A;  1KAZ A;  2A40 A;  4RCH A;  4OO1 J;  1DGK N;  2QWP A;  3O9U A;  3I33 A;  3SMP A;  4JN4 A;  1Y64 A;  4NLB A;  1ZXO A;  4BGB A;  4U67 L;  4BVO A;  4ILH A;  1X3M A;  3IFR A;  3D6R A;  4BRA A;  5GIO A;  3VEY A;  3U9D A;  3MMV A;  1EO1 A;  1HKG A;  2J4R A;  5EVZ A;  1RDW X;  3EZW A;  4WQ5 A;  5EXW A;  2CGJ A;  2FXU A;  3OHR A;  2ASM A;  3QB0 A;  5EY4 A;  1CZA N;  3S41 A;  3U4L A;  3VOV A;  3ZET A;  5JLH A;  4BRM A;  3AGR A;  1DKG D;  3PLA A;  2P9U B;  3VGL A;  3W3D A;  1DEJ A;  4FOE A;  5AZJ A;  2ITM A;  3KWI A;  1NJI O;  1R59 O;  4DHY A;  1LOT B;  1SQK A;  5LY3 A;  5AQM A;  3CPE A;  3QBW A;  1HX1 A;  2HBM A;  3O9S A;  5C2F A;  2YHY A;  2VYP A;  3C65 A;  3MX2 A;  3MCA B;  5BN9 A;  5M1N A;  4AM6 A;  2VGN A;  4Y0W A;  4FOI A;  4BQL A;  3L0Q A;  4CBW A;  4IZ9 A;  1HJO A;  3WXK A;  3H1V X;  2A42 A;  4IWV A;  5M1P A;  2PAV A;  4C1N K;  5FPE A;  1NGB A;  5AZI A;  3H6E A;  4CZJ A;  1VQ5 N;  3RVC A;  1C0F A;  3VMF B;  2CGL A;  4DKW A;  1MWK A;  4BRO A;  2HF4 A;  3R6M A;  3N4Q A;  1YJ9 N;  2GWK A;  4FPA A;  1KAX A;  5AQV A;  1Q81 O;  1X3N A;  4B1Y B;  3FE1 A;  2VCP A;  5AQW A;  1S72 N;  4FO0 A;  3M1F A;  5AQU A;  4FWQ A;  2QWR A;  3WXJ A;  1GLE G;  2V52 B;  3M6G A;  3UKU A;  3BF3 A;  3WUH A;  2FSK A;  5GAH P;  2IVP A;  3F9M A;  3D2E A;  1ATN A;  2YHX A;  1YUW A;  5AQF A;  4IOC L;  3TPQ A;  3VGK A;  4BY9 C;  3QFP A;  2OAN A;  5I9E B;  2Q97 A;  3IDH A;  4FVU A;  2E20 A;  3SMS A;  1M1K O;  3LM9 A;  2QWQ A;  5BPL A;  3M5R A;  4WQ4 A;  2E1Y A;  2YCH A;  3DXK B;  3MN9 A;  3JS6 A;  4YOU A;  3P4I A;  5BRE A;  2QWM A;  1KC8 O;  4BR5 A;  4K25 A;  2A6A A;  4XH4 A;  3EE9 A;  3QDK A;  4RTF D;  1NGJ A;  3N4P A;  2HBK A;  3DLL L;  2Q31 A;  3MWP A;  3ZEU A;  2BUP A;  5JMV A;  3NMU A;  4JHD A;  3O1W A;  1K8K B;  2KLA A;  3CCE N;  4HWI A;  3L6Q A;  1NGG A;  3EO3 A;  4U7B A;  3BEX A;  3P31 A;  3QIC A;  4FSV A;  5JLF A;  3FGU A;  3A5N C;  1J6Z A;  2I7N A;  3KZB A;  3A5L C;  3LDQ A;  1U2V B;  1JCE A;  2H3G X;  2QXL A;  5ADX A;  5GAG P;  2FSJ A;  1NGH A;  1P8Z A;  3CCV N;  5CHI A;  4WYB A;  1Q18 A;  2Q1N A;  4FWS A;  4H5T A;  4C1N I;  3G4S N;  4PL8 A;  4BRD A;  4BRK A;  3TU5 A;  4RWT A;  4H5R A;  3BUZ B;  4IDH A;  1YJN N;  5BRF A;  4KBO A;  2HF3 A;  3EKU A;  4JKF A;  4MO5 A;  2YJE A;  5M1F A;  3I55 N;  5LJW A;  4BGA A;  1XC3 A;  5AQZ A;  3HI0 A;  1QQO A;  1NM1 A;  4GV3 A;  5TKW A;  3CER A;  2D0O A;  3H3N O;  3WT0 A;  1K73 O;  3VGM A;  3LDO A;  3CCR N;  4BG8 A;  1JCG A;  3O9T A;  2HOE A;  4NO7 A;  1GLJ O;  5C0Y A;  1VQL N;  3E9O A;  2NRH A;  2E2Q A;  4B1V A;  5AQL A;  2E8A A;  5AQR A;  3ZYY X;  1OKJ A;  4IO8 A;  4KH5 A;  4H0V B;  1BO5 O;  5ADX H;  2JWL A;  5C2D A;  4H0X B;  4M7Y A;  1IG8 A;  2CGK A;  2P9I B;  1X9J A;  5ELZ A;  3ZEU B;  5AFU A;  4GNI A;  2ASP A;  3MN5 A;  1KQS M;  4BC3 A;  1BA1 A;  3FFK B;  4BRL A;  4CZH A;  4PHT X;  5BRD A;  4FWP A;  3SK3 A;  4CZL A;  4PL7 A;  4AM7 A;  2P9N B;  5H1S Q;  1BOT O;  5M1Q A;  2VWB A;  3KHY A;  3CCQ N;  4JNE A;  5BPN A;  3O8M A;  2V7Y A;  3H3O B;  1Z05 A;  3EL2 A;  1YVN A;  1C0G A;  1P90 A;  1QQM A;  3CF5 L;  5GIN A;  3O9Q A;  5DM6 L;  3VEW A;  4BRE A;  2NLX A;  3LM2 A;  3OBW A;  5FPM A;  3R9P A;  1Z6R A;  1E4F T;  3OA9 A;  4JK7 A;  2E88 A;  3ID8 A;  3IUC A;  3GL1 A;  1MWM A;  5AQS A;  1BDG A;  1GLB G;  3G25 A;  1H1V A;  3DXK A;  1TUU A;  3HZ6 A;  3K9J A;  5BRH A;  3CME N;  3GBT A;  2GX9 A;  2QI2 A;  2WBN A;  1W97 L;  1DT9 A;  1SAZ A;  3E1Y A;  1NBW A;  3T69 A;  4HTL A;  2E2P A;  3CCJ N;  1MDU B;  1D4X A;  4BR2 A;  4BRH A;  3VF6 A;  5AFU H;  3RSE B;  1QVG M;  3CJ7 A;  3HSC A;  4WQ5 C;  4PKG A;  3WQU A;  4E1J A;  1K8K A;  3SBT A;  1VQO N;  4B1W B;  1YHQ N;  1E4G T;  3KVG A;  3O08 A;  1ATS A;  2Q0R A;  2F9T A;  1U2V A;  2RHK A;  3A5O C;  3ID6 A;  1IJJ A;  3CJB A;  3DWL A;  1KXP A;  4CZK A;  5C10 A;  3CJA A;  3UE5 A;  4FPB A;  1Q86 O;  3ZX0 A;  5LJV A;  2V7Z A;  3AAR A;  4CBU A;  2Q0U A;  2YJF A;  1BWF O;  3CCS N;  1G99 A;  4B9Q A;  4XEI A;  2QTD A;  4BC5 A;  1NGI A;  3MCP A;  1ZC6 A;  4KH4 A;  1NLV A;  4JKD A;  1YIT N;  4G9Z A;  1Q82 O;  3CHW A;  4QS9 A;  3SAG A;  3CMA N;  5AQO A;  4O5F A;  1JCF A;  3GOI A;  5B8H A;  3A8Y A;  2E1Z A;  4DQ8 A;  3AGK A;  4QS7 A;  3VF4 A;  1VQK N;  3CQX A;  3L4I A;  5FPN A;  2NRZ A;  3R1X A;  3VTH A;  2YHW A;  2P9K B;  3F2K A;  3SJH A;  1K8A O;  3C6A A;  3KWG A;  3K9K A;  5AQT A;  4WFN L;  1YIJ N;  4B1U B;  3EE8 A;  4A5B A;  5M1O A;  1YF5 L;  3EN9 A;  3LL3 A;  4IEI A;  2D1K A;  3A0I X;  4H5V A;  3WXI A;  3ULE B;  2NRX A;  1U6Z A;  4DB3 A;  3SAF A;  4QS8 A;  4YOX A;  3ENO A;  5AQP A;  1SZ2 A;  2P9I A;  1T3V A;  3AAP A;  3A5M C;  4EAH D;  5KQ8 A;  4C23 A;  3SAH A;  1YJW N;  5AQK A;  2RE2 A;  4FWM A;  2P9N A;  4LC9 B;  2YX6 A;  4EFH A;  3QFU A;  5GAE P;  5MLC Q;  3CPW M;  3LDN A;  4FWR A;  2D4W A;  3EKS A;  4WQ4 C;  1VQ9 N;  3ENH A;  3VTI A;  3ATV A;  4CD3 A;  1T6D A;  3VPZ A;  3DAW A;  2BH1 A;  2NRW A;  2OTL N;  4BVP A;  1NGA A;  5KPT A;  2ZJQ L;  1V4S A;  2YI1 A;  4H0P A;  1NGE A;  2A3Z A;  4MLE A;  5DM7 L;  4IEE A;  1W2B M;  4CI6 A;  2W41 A;  3SLC A;  3O6W A;  3UB5 A;  4BQZ A;  4CZG A;  2GUP A;  4JKG B;  4CZE A;  3MN7 A;  3R8E A;  4A62 A;  3G71 N;  3ZET B;  2FSN A;  2P9S B;  1HLU A;  2WC9 A;  4PKH A;  2PBD A;  3Q7C A;  4JAX A;  4CBX A;  3W0L A;  5C12 A;  1N8R O;  4MDB A;  5FPD A;  1QQN A;  4R79 A;  3P39 A;  4BRP A;  4CJ7 A;  3VET A;  1YAG A;  3DJC A;  4GVE A;  4JK9 A;  4A5A A;  4WF9 L;  2QWN A;  3RSE A;  3TSU A;  5KQD A;  3E9P A;  3VER A;  1QZ5 A;  1TYQ A;  3SBG A;  4H0T B;  2GEM A;  3J8A A;  3IMX A;  4ILJ A;  5AQG A;  1QZ6 A;  4YDU A;  1NGF A;  1WUA A;  1RFQ A;  4J8F A;  3CC4 N;  3CJ9 A;  1OVY A;  3G6E N;  4BG9 A;  4WCE L;  3QBX A;  1QVF M;  2P9L B;  2V51 B;  1RGI A;  2NNW A;  2FF6 A;  3H45 C;  2FLO A;  4IJA A;  4O8U A;  4A59 A;  1VQP N;  4FL9 A;  1M90 O;  1BUP A;  2QA4 N;  4A61 A;  2HBJ A;  4OPA A;  3FR0 A;  1GLL O;  4A2B A;  4ISG A;  4M7X A;  3WEE B;  4CZF A;  2WUS A;  3HBT A;  3CC7 N;  1VQ8 N;  1LCU A;  2HMP A;  4DCH A;  3WQT A;  3C7N B;  2ZF5 O;  4A2A A;  2KHO A;  3D7E O;  3CCU N;  3HTV A;  3NVK A;  3ENB A;  4K43 A;  1BG3 A;  3CI5 A;  4KH6 A;  3CCL N;  4BR4 A;  2NZT A;  4H0Y B;  3VF2 A;  1HKB A;  2P9K A;  4FWK A;  4BRI A;  3FZH A;  4O8K A;  4EHU A;  4FWL A;  4L3Q A;  3TTF A;  4YOR A;  2Q2R A;  3VEN A;  4ISF A;  2BTF A;  1ILY A;  3ULE A;  4JK8 A;  2A5X A;  4BR9 A;  1ESV A;  3H46 O;  1SS6 A;  4JKE A;  5AR0 A;  1NGC A;  5AQJ A;  4YOT A;  3HOT A;  5C15 A;  1XQS C;  3M3Z A;  2QWL A;  1TYQ B;  4BR0 A;  4JKC A;  3O80 A;  1NGD A;  4OPH A;  5AQN A;  3IKM A;  1NWK A;  1RDU A;  4I6M B;  5M1K A;  2NRT A;  2OTJ N;  4JEP A;  1GLA G;  5HOO A;  3I8B A;  4MLH A;  5AQY A;  5F2R A;  2A41 A;  2PFU A;  2ZJR L;  4EHT A;  3VES A;  2UYT A;  3C6H A;  2ZGY A;  2NRR A;  1WOQ A;  4IOX A;  4JD2 B;  1O13 A;  5E84 A;  4IOA L;  1BU6 O;  1ZBS A;  3D2F B;  3HM8 A;  3B8A X;  4IJN A;  1VQ6 N;  1NMD A;  3MWT A;  4YOW A;  3KK7 A;  1YXQ A;  3H1Q A;  3VEZ A;  5GIP A;  3J7Z O;  3CIP A;  4B1X B;  5JIC A;  4M63 C;  2JWK A;  4JKG A;  3PIP L;  1GLF O;  5AQX A;  5F0X A;  4GY2 B;  4H03 B;  3DXM B;  3F5T A;  3UKR B;  2P9S A;  3MN6 A;  4K41 A;  5HL7 L;  4FWN A;  2FF3 B;  2AA4 A;  2P9P B;  3I56 N;  3CJC A;  1KD1 O;  5TKY A;  4MDA A;  5AQQ A;  3ZX2 A;  1QHA A;  2ZGZ A;  2WFB A;  4IXC A;  2ASO A;  3MX5 A;  1T6C A;  1HKC A;  4JKH A;  2GEL A;  4NB4 A;  1VQN N;  3CET A;  4FWO A;  2AP1 A;  2CH6 A;  3FLC O;  1VQM N;  5BR9 A;  4IFE A;  2ZJP L;  4BC4 A;  4YOY A;  2P9L A;  5KPR A;  3CXC M;  4JKB A;  3OW2 M;  1YI2 N;  1TUY A;  3FZL A;  4AF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...