1C6VA

Siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
148
Chain Sequence
NSDLGTWQMDCTHLEGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSVETIVLMAVHCMNHKRRGGIGDMTPAERLINMITTEQEIQFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (SIV INTEGRASE)
publication title X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues 50-293)--an initial glance of the viral DNA binding platform.
pubmed doi rcsb
source organism Simian immunodeficiency virus
total genus 42
structure length 148
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c6vA00
2QXFA 4RW9A 1HNVA 3AVNA 3CFPA 3S3OA 4FJJA 3HK2A 3P5JA 3ZT2A 3MEGA 5FROA 1L5UA 3B6OA 3HP6A 2HHTA 1TK0A 3K2PA 3I0SA 2PY5A 3KJVA 3AVMA 1B9FA 1F21A 1CLQA 2B5JA 2Z1GA 3VQ8A 5HROA 3CM6A 1KLMA 2XY7A 4PWDA 4O44A 2B4JA 3K5NA 4BWMA 2O4IA 3O4QA 3RRHA 1D9DA 4H4OA 4CJUA 3ZSQA 3SQ1A 5KRTA 1J53A 2YNIA 3WNHA 1WSFA 1D9FA 4CJ5A 1RTJA 1LWFA 1QTMA 4KREA 4FCYA 1B9DA 3V9UA 4CERA 4DFMA 4DFPA 4LH5A 5HRPA 3QIPA 4CGJA 4FJXA 3M8QA 3VQBA 3CM5A 4CF9A 3OYGA 4O5BA 1QSSA 3HSTB 4ID1A 4DTRA 3K5LA 3OJUA 3SV3A 4E7LA 1JLGA 3ASMA 3LZJA 3TARA 3OYFA 1UA0A 4FJKA 4KRFA 3OS1A 5HBMA 2XY5A 1TKXA 4FK4A 3TAMA 1L3UA 4E7KA 3VA0A 1YVUA 4CGGA 3V1QA 4FW1A 3QERA 4B9MA 3SV4A 3OYEA 2P1JA 1KCFA 4CIEA 3V6DA 2KQ2A 2HW3A 5DK5A 1VSEA 2X74A 4ICLA 3NDKA 1EX4A 4FM1A 2D0AA 3C6TA 3PO5A 1XHZA 2HB5A 3AA4A 5J1EA 4DLEA 3L2WA 4Z4HA 3ZSOA 1VK0A 1C6VA 2ZQBA 4BDPA 2P51A 3EY1A 4KB0A 5FRMA 2HVIA 4FW2A 1GOAA 4HVJA 3KK1A 4BE0A 4B9NA 1VSMA 4DQPA 4GMJB 2QK9A 1KVCA 3CQ8A 1I39A 3EZ5A 4FXDA 2HHUA 3DYAA 1JLCA 3LWMA 3QNOA 1T8EA 1WAJA 4ID5A 2P5GA 4M3ZA 1EETA 3VQCA 1VSIA 4WE1A 1KFSA 5CYMA 1HQUA 4Q0BA 2JGUA 2PYJA 3RWUA 1T03A 4B8CA 3KK3A 3AO1A 4E1MA 1JLAA 2E6LA 4DTNA 3QEIA 4ZTFA 4AHUA 4CEOA 1VSLA 1BIUA 3L3VA 3LP1A 5JS1A 1X1PA 4DF4A 4Z4EA 4KTQA 1VRTA 1RT3A 1LV5A 4CGHA 4DU4A 1YTUA 4BDYA 2YNFA 2KZZA 3AVIA 1HYZA 1S6PA 4DTOA 1TK8A 4OLBA 4YFUA 4Z4CA 2F8SA 4B9TA 2HNDA 3AVGA 1JLEA 4I7FA 3K58A 1SKSA 1W0HA 4AHVA 4I2PA 1IKXA 4BWJA 1TAQA 4J2DA 4EP5A 3NCIA 4DQSA 1HNIA 5FDLA 3NE6A 4FLTA 4KB1A 4OPJA 3ZSZA 4HCCA 1TVRA 4RW6A 4PY5A 1K6YA 1WSEA 1UOCA 1X9WA 4CE9A 4CJPA 4DSFA 4FLZA 2IC3A 3NAEA 3ZSYA 3QESA 2OA8A 4XIUA 2X6NA 1JXEA 1CXUA 2OPRA 2HMIA 2E6MA 1IKWA 2VG6A 4E3SA 3DLBA 3V1OA 3V9SA 3SPZA 4FLYA 3OYNA 3V4IA 4F8RA 1O1WA 1TKZA 4B8AB 1CZ9A 4CFCA 4CJRA 3NHGA 1NOZA 1BIZA 4J2BA 3KIOA 3NFAA 1RT1A 1VSHA 1JL1A 1D8YA 3TABA 4K8ZA 2KFNA 4FZZA 4I2QA 3WNFA 3CFOA 2X6SA 2VG5A 3S3MA 1VRUA 4DG1A 3KLHA 3AVAA 2Q3SA 3G0ZA 3U6FA 5C24A 3MAQA 3DI6A 1I3AA 2VG7A 3H08A 3TWHA 3RR8A 4JRQA 4IG3A 3QINA 4CJQA 3SCXA 1U49A 3L2QA 2RPIA 3M8PA 4J2AA 2XHBA 4K8XA 4CF8A 5J2PA 3G10A 1HJRA 1RILA 3NGZA 4CCHA 3NF6A 1LAVA 4PA1A 4AHSA 5T7BA 3LZIA 5HRNA 4CEBA 4CHOA 4JRPA 3SPYA 2G8FA 3V9ZA 2G8KA 1NK5A 3VN5A 3DRSA 2OPQA 4CK2A 2D0BA 3O3HA 1S1UA 3KLGA 4HUEA 3MEEA 4CK3A 3OYDA 3ALYA 4RW4A 2Y1JA 1UA1A 3B6PA 1U45A 4W5TA 2DFFA 3P1GA 4MFBA 3AVKA 1CXQA 4CIGA 4KHUA 3DMJA 4FK2A 2GV9A 2OZSA 5KI6A 3S9HA 3P83D 1RDBA 1FXXA 1FKPA 3NF7A 1REVA 3UIQA 3VQAA 2GBZA 3DLRA 3I8DA 4G1QA 4CF1A 1NJYA 2XO7A 5I3UA 2WOMA 4CJTA 4CFDA 3ZT0A 2ZE2A 4H8KA 2OZMA 2X78A 1WSHA 4Z0UA 3PX6A 3VQ4A 1NK0A 1N5YA 3V1RA 2G8WA 3LANA 3LPUA 4DWIA 4O55A 4FJIA 2HHSA 3AVHA 2HHXA 2PYLA 3VQ7A 4NYNA 2DFHA 1QS4A 4LSLA 4O4GA 1W9HA 2HNYA 5HP1A 3SQ0A 4ZTJA 1ZYQA 3HT3A 4LSNA 1SL1A 4DTUA 1QSLA 4AH9A 1X9SA 3OVNA 4HCBA 4CGFA 3VQEA 4M3XA 1NJXA 2DFEA 4CJLA 2YKMA 4FJLA 1EKEA 1RTDA 4CJVA 1VSJA 1TGOA 5CY4A 2IOCA 3VQDA 3L2UA 5J2NA 5CZ1A 1QE1A 3DLHA 4CJ3A 3KK2A 3ZT4A 3K57A 3CYMA 3IAYA 2HHQA 4LD0A 5D3GA 1WAFA 1G15A 4BE2A 1WSGA 1VSFA 5E41A 3DLEA 3ZCMA 2KTQA 4CK1A 3AO3A 3OYIA 2QKBA 1YTAA 3LP2A 3BGRA 4J2EA 5CYQA 1NKEA 4F3TA 4KFBA 2ETJA 1BI4B 4F2RA 1HPZA 1B92A 1KTQA 1S9GA 3CFRA 3DOLA 4N76A 3HPHA 2IDOA 4C8OA 2VWJA 3QNNA 4DTXA 3THVA 4H4MA 4CHNA 3S3NA 2AJQA 4IBNA 1RBVA 3SUPA 3OYKA 1S1VA 1SKWA 4AHRA 4DF8A 3U3YA 1J5OA 3EYZA 3OYLA 2YKNA 1KSPA 4DTPA 4CIFA 4N5SA 1TK5A 3SUOA 3OS2A 5C42A 3HPOA 1Y97A 3VQ9A 1NJZA 3C95A 3OY9A 1NOYA 1XC9A 3OYBA 1NKCA 3WNGA 3WNEA 4Y1DA 3ZT1A 1RDDA 3AVBA 3RTVA 2YHBA 4M3RA 4NYFA 3E01A 3FFIA 2FBVA 2ITGA 1JXBA 4CEDA 1U47A 3ISNC 4OJRA 4KHQA 4FLUA 1KVAA 4Y1CA 2Z1JA 2D0CA 1Q8IA 4UQGA 1LWCA 3M8RA 3K5MA 3TAFA 4RW8A 1TV6A 4B9SA 4CJSA 4M3WA 1UAXA 1L3VA 2FBTA 2XY8A 4CJ4A 3OYAA 3O4NA 1XHXA 4BACA 3TI0A 4M3TA 4IFVA 1EP4A 4DTMA 2G8VA 3C6UA 4EZ9A 3QEVA 3PV8A 2XY6A 4HUFA 4TSXA 3LAKA 4CHYA 3OYMA 3HJFA 3OJSA 4CHQA 1A5VA 5CZ2A 3F73A 4NCAA 4OKJA 3MXMA 2G8IA 2JLEA 2B6AA 3SQ2A 2G8UA 3U3GA 1S1TA 2BANA 3SNNA 1C0TA 4ELUA 4IDKA 3SUQA 4M41A 3TAEA 4IG0A 1LW2A 3AVCA 4KI6A 4W5QA 2F8TA 4DLGA 3VQ5A 1WSJA 4KTWA 2DTUA 1RT4A 1IH7A 2OPPA 1SKRA 3TR8A 1RT6A 4KHYA 4FYDA 4E1NA 2Z1IA 2IAJA 1BISA 3AVLA 4C8NA 4IKFA 4AHTA 4NCBA 4BE1A 4HHTA 4F2SA 4BDZA 1C1CA 4CECA 1NK7A 2NUBA 3IS9A 1ITGA 1JLBA 1QQCA 4Z4FA 1S9EA 3DLKA 1J54A 2P5OA 1A5WA 3KLEA 4RG8A 3ZSRA 4CEEA 4M3UA 4I9LA 1KFDA 4CGIA 4Z4GA 5HRRA 4DU1A 1HMVA 4LH4A 3RMDA 1SL0A 3NGIA 3KD1E 3LP3A 1L3TA 5HRSA 1L3SA 1HYVA 1ZBFA 2IS3A 2Y1IA 1D5AA 1TKDA 2GUIA 3MXIA 4OGEA 2RKIA 3HXMA 4W5NA 3MEDA 1EXQA 1RDAA 5I42A 3VQPA 1RT7A 4CF2A 1S1XA 2Z1HA 3LWLA 1U48A 4EZ6A 3TANA 3ZSWA 1LWEA 1X9MA 3AV9A 4FJ8A 4KHSA 4OLAA 1TAUA 5FRNA 4QAGA 3LPTA 1T7PA 4F4KA 1FKOA 4OPKA 3HYFA 3PX0A 2O4GA 4KPYA 3QLHA 4E19A 2A1RA 1RBRA 5SWMA 1Q9YA 4FJNA 2G8HA 3MXJA 3RMBA 4KAZA 4CJWA 1UWBA 1WLJA 3D0PA 1ZBLA 1ZBUA 2EX3A 3DRPA 3K5OA 3LDSA 4ELTA 3KKRA 3RMAA 4DSJA 1C1AA 3L3UA 5J2QA 4F3OA 4FK0A 1VSDA 3V9XA 4PQUA 4B9LA 3ULDA 1BHLA 2OPSA 3HPGA 4ZHRA 1SUQA 1C1BA 4FZXC 3NF8A 4DMNA 3VA3A 3DM2A 4KHNA 3PX4A 1KRPA 3QIOA 3O3GA 2OYQA 4JS5A 4FLWA 2VWKA 3PUFA 3T3FA 4DS5A 1DLOA 1U04A 2EHGA 3LALA 4CF0A 3AA3A 1WNSA 4DQQA 1TL1A 1S6QA 1VSKA 4OVLA 3VQ6A 3O3FA 1RNHA 3SYZA 3V81A 1Z26A 3LAMA 4DTJA 3PO4A 4PUOA 2KZMA 2HHWA 1U4BA 1IO2A 1ASUA 2QKKA 1BCOA 4KTZA 1QHTA 3D45A 1C0UA 4CFBA 5C25A 3QEXA 4FJ9A 1JL2A 1IKYA 2FBXA 1A5XA 5KGWA 2I5JA 3PY8A 3HVTA 3F9KA 4KO0A 1DTQA 3MECA 1R0AA 4CHZA 1BCMA 4JLHA 3NH1A 3SZ2A 4NCGA 4B3OA 3IRXA 3T1AA 1NKBA 4IFYA 3OYHA 4C8LA 3C94A 2YV0X 4FM2A 1BQNA 1ASWA 2W42A 4E89A 3QEPA 4FZYA 3JSMA 2FC0A 1RT5A 3AA2A 3AO4A 1FK9A 1NK4A 1MU2A 3AVJA 3K59A 4MQ3A 4CJKA 3OYJA 3SQ4A 4GW6A 3NF9A 1ZBHA 2BE2A 2ZD1A 4FLVA 3OS0A 1RT2A 4N56A 4N41A 1GOCA 3T19A 4CGDA 3QETA 3QO9A 2RN2A 4CEQA 1QSYA 5KGXA 4DQRA 4DSEA 3HVRA 4FVMA 4KKOA 3KTQA 5J2MA 1IG9A 3I0RA 3SI6A 4CJEA 2E4LA 3LP0A 4Z4IA 4B9VA 4N47A 3KLIA 3AVFA 3ZSXA 4KV8A 3NGYA 3BDPA 4DSLA 4C8MA 3NH2A 1SL2A 4YNQA 1Z25A 1Q9XA 1BI4A 2A1SA 4R5PA 1J9AA 3AO2A 4ELVA 1RTIA 1ASVA 4FJMA 4CESA 4OKEA 3OYCA 4FJGA 4FJ7A 4FJ5A 4DQIA 4GVMA 1BQMA 3L8BA 4HTUA 4RW7A 2YNGA 4B08A 3ITHA 1S5JA 4C8KA 4DSIA 3CG7A 3JYTA 1RTHA 4CJFA 4M3YA 4OKKA 4HUGA 3ZSVA 2FBYA 1YT3A 5KTQA 3L2RA 1RBTA 3V9WA 3A2FA 4O0JA 5KRSA 4CHPA 4I9QA 3HO1A 1NK8A 4OGCA 4DS4A 3RR7A 2F96A 3L2VA 2ATQA 4KHWA 4DFKA 1LAWA 4E7HA 3NH0A 1WN7A 2LSNA 3NBPA 4FLXA 4E7IA 3HP9A 2YHAA 4DTSA 3TAQA 1NK6A 1HYSA 3HM9A 1JKHA 1S1WA 1RCHA 4FJHA 4L8RB 3AO5A 4B9UA 1RDCA 1CZBA 4E0DA 2IGIA 4CEFA 1KVBA 3AA5X 2RF2A 1RBUA 5K14A 4O0IA 2D5RA 5EU7A 3ZT3A 3SJJA 3RMCA 3KD5E 1BGXT 1C0MA 1GOBA 1SV5A 3DLGA 3TAPA 2HHVA 4M45A 4E7JA 2DY4A 2HVHA 3M8SA 3DOKA 5SZTA 2R7YA 4LY7A 1TKTA 1IKVA 1LW0A 3VQQA 1DTTA 1TL3A 4CEZA 4AILC 4QOZB 5JS2A 2WONA 1BL3A 3QEWA 3IG1A 3SUNA 1NJWA 4EP4A 1KLNA 4JS4A 2BGGA 2YNHA 1XI1A 4CFAA 2KFZA 1NK9A 3HL8A 4DFJA 2XRIA 5DMRA 4KI4A 1ZBIA 3KLFA 3KKSA 4W5OA 3RRGA 1JLFA 3TAGA 1RBSA 1HRHA 1T05A 2PZSA 4Q5VA 4M42A 1HQEA 1N6QA 4DU3A 4FM0A 4DSKA 1XWLA 1JLQA 4AHCA 5HLFA 2BDPA 1WSIA 4CEAA 4QCLA 3DRRA 2KW4A 4W5RA 2HNZA
chains in the Genus database with same CATH superfamily
2QXFA 3L4IA 5JLHA 3HP6A 3KJVA 2HMPA 3AVMA 1B9FA 2IVPA 1HJOA 4ILGB 2QWOA 2Z1GA 4O44A 3C65A 5C2DA 5F2RA 1D9DA 4H4OA 2YHYA 1WSFA 4G9ZA 2ZGYA 4CGJA 1Q86O 4O5BA 4ID1A 3VEZA 3RSEA 3BP8A 3O9SA 2WTUA 3OJUA 2GEMA 1UA0A 2HHHK 1TKXA 1QQNA 1DKGD 3V1QA 1VHXA 4PL7A 3H3NO 4GKJK 1VSEA 3MN7A 3PO5A 2HF4A 1QVFM 1KD1O 3ZSOA 1VK0A 3OTOK 4KB0A 4HVJA 4B9NA 4DQPA 4EHUA 1KVCA 2NNWA 1I39A 2HHUA 3FR0A 5B8HA 1EWQA 3LWMA 4M3ZA 4WE1A 4Q0BA 4CVNE 4B8CA 3KK3A 4E1MA 3ZETA 1C0GA 3LM9A 1VSLA 3LP1A 4H5RA 4YOWA 5AQGA 2ZGZA 3VGLA 4DF4A 4Z4EA 4CI6A 4KTQA 2E1ZA 2VCPA 2YNFA 4IEIA 4GKKK 1HYZA 1TK8A 4OLBA 1MDUB 5AFUA 4B9TA 1E4GT 4MLEA 4DQ8A 3K58A 3CPWM 2A40A 4BWJA 1TAQA 3NE6A 4OPJA 1TYQB 1GLBG 1NGIA 4CJ7A 4HCCA 1K6YA 3MN5A 1WSEA 2YCHA 4B3RK 1Y64A 4CJPA 4DSFA 3SK3A 3NAEA 4YOUA 2E6MA 4LF5K 1VQ5N 3DLBA 4JI2K 3V1OA 3M6GA 3C0BA 3OYNA 4CJRA 3VEVA 3NHGA 1RT1A 3SBTA 1JL1A 1YUWA 1JCEA 2KFNA 1OH6A 4FZZA 3CFOA 1X9JA 3VF6A 3G0ZA 5FLXO 1YF5L 5C24A 2VG7A 2VQFK 4CJQA 3L6QA 3KK7A 3SCXA 1U49A 3M8PA 4K8XA 3DXMA 1HJRA 3NGZA 4DV5K 3NF6A 4JRPA 3P39A 2G8KA 2F9TA 4DHYA 1NK5A 2P9IB 3KLGA 2DFFA 3A5OC 3N4QA 3EZWA 4CIGA 2OZSA 3THYA 1FKPA 1SZ2A 3ID8A 2GBZA 1NJYA 2XO7A 5I3UA 4WQ5C 4YOXA 1NK0A 3VQ4A 3VMFB 3LANA 4O55A 3WXIA 1K9MO 3M3ZA 3VQ7A 3L0QA 2DFHA 4O4GA 2QA4N 5HP1A 3SQ0A 1ZYQA 3RVCA 4LSNA 3OHRA 4LF6K 1VQMN 3OVNA 4HCBA 5AQPA 2D1KA 1U2VB 1YJ9N 1NJXA 2DFEA 4CJLA 1TGOA 5CY4A 1W2BM 2IOCA 5J2NA 3KK2A 3ZT4A 3K57A 3C6HA 5ADXH 1G15A 4BR0A 1VSFA 5E41A 3DLEA 3ZCMA 2KTQA 1BA1A 3LP2A 1WOQA 4J2EA 1IJJA 4A2BA 4BR5A 2ETJA 1HPZA 1B92A 5F0XA 2ZF5O 3HPHA 2IDOA 2VWJA 3THVA 4H0OA 5BN9A 3W3DA 1RBVA 3SUPA 1S1VA 1SKWA 2Q2RA 4AHRA 3J7YP 3HM8A 3EYZA 1VQ8N 4DTPA 3VTIA 1Y97A 4FWSA 1QHAA 4KH6A 4Y1DA 3ZT1A 4BGAA 3QB0A 3E01A 4NYFA 2FBVA 4CEDA 1U47A 4KHQA 2WC9A 2HOEA 3CI5A 4Y1CA 2D0CA 3TAFA 4X66K 4CJSA 3O9UA 2FBTA 4CJ4A 3HRGA 3OYAA 4UY8O 3EE8A 4DTMA 2G8VA 4EZ9A 3BF3A 1WBBA 4TSXA 4IFEA 4Y0WA 4DV2K 3OJSA 4CHQA 4JI7K 1A5VA 5CZ2A 1VQLN 2B6AA 3SQ2A 1S1TA 2BANA 4B9QA 1GLLO 3SNNA 3O4WA 4PKIA 2RHKA 1LW2A 5TKWA 4DLGA 1HKBA 4DUZK 3VQ5A 5KQDA 4K25A 3TR8A 1KQSM 4E1NA 2A3ZA 1EO1A 2NUBA 1QQCA 3DLKA 3TSQA 4JKFA 4CEEA 5HRRA 1TYQA 1HMVA 4FOIA 3RMDA 1SL0A 3SAHA 3IFRA 4FPBA 4AQYK 1L3TA 5HRSA 4V19S 2FF3B 1ZBFA 3OBWA 3PIOL 1D5AA 3CETA 1Q18A 2RKIA 4OPAA 3T1HK 1EXQA 3A5LC 3H6EA 5I42A 1U48A 4CF2A 2Z1HA 3AV9A 1SS6A 4OLAA 5FRNA 2RE2A 4JI1K 4BRHA 4H5TA 4OPKA 1XNQK 5LJVA 3QLHA 4FWPA 3MXJA 3RMBA 5C15A 1UWBA 1KAYA 4DKWA 4F3OA 3V9XA 2IIRA 3ULDA 3HPGA 1C1BA 3VA3A 3DM2A 4MO5A 4KHNA 1KRPA 1VQNN 4QS7A 3PUFA 2P9IA 4LC9B 1HNXK 1U04A 4O8UA 4OVLA 3SYZA 4PUOA 4DTJA 4BR4A 1U4BA 2UXBK 5IWAK 4RWTA 4KTZA 2OTLN 1C0UA 4BR2A 1IKYA 3MECA 3NH1A 1NGBA 4NCGA 1S3XA 2YV0X 5AQYA 4FM2A 2CH5A 4LFCK 3O80A 3QEPA 1ESVA 1HKGA 3H45C 3K59A 1U2VA 2BE2A 3O9QA 2F4VK 4N56A 4GY2B 4ISGA 4CGDA 3CJ7A 3BF1A 5KGXA 2UUAK 4M7XA 3CCSN 1IG9A 4Z4IA 4CJEA 2WBNA 4JN4A 4JK7A 4CZKA 4KH5A 3ZSXA 1WBDA 4C8MA 2GELA 2QWQA 4YY3K 3R6MA 3U9ZA 1ASVA 1VQ7N 5M1NA 4FJMA 4FJ5A 4GVMA 3P31A 2UYTA 3J81O 1S5JA 4FWLA 2GTDA 4C8KA 4DSIA 1BDGA 1RTHA 3V9WA 2OTJN 5AQWA 4CHPA 4OGCA 3L2VA 3VEXA 3CC7N 4BY9C 3E1YA 4NLCA 4E7HA 4K42A 5M1QA 4E7IA 2YHAA 1Z6RA 3TAQA 3HM9A 3AO5A 5LY3A 1ZBHA 2RF2A 1RBUA 3CCRN 3KD5E 3SJJA 1NGJA 4BC3A 4BREA 5SZTA 4LF4K 2Q1NA 3EN9A 3CMAN 1BL3A 1NJWA 4EP4A 3ENHA 2FSJA 4CFAA 2KFZA 3HL8A 4DFJA 2XRIA 3BEXA 4CBUA 4W5OA 3KLFA 1JLFA 2Q36A 1RBSA 4IO9L 4A2AA 4Q5VA 1HQEA 1N6QA 4DSKA 1J6ZA 3ENBA 3DRRA 4RW9A 1HNVA 3CFPA 4FJJA 3HK2A 3UE5A 4LF8K 1R59O 4DR6K 1NGCA 2B5JA 4DV0K 4YHHK 3VQ8A 1KLMA 4BWMA 2NRWA 2W40A 3RRHA 1X3MA 3DXKB 3SQ1A 1D9FA 4YOVA 4CJ5A 4FCYA 1B9DA 3W0LA 4CERA 3VQBA 3CM5A 1NLVA 1NGFA 2V7YA 1VQON 1QSSA 1MWKA 5BR8K 3K5LA 4A61A 3ZETB 1JLGA 1YXQA 3OYFA 4FJKA 3CCEN 1YI2N 3O5BA 3FE1A 5CHIA 4OX9K 3VA0A 3ZLJA 4ICLA 3SJHA 4DR1K 4FM1A 3C6TA 4IWVA 2HB5A 3AA4A 3L2WA 4Z4HA 2O8FB 3K9KA 3J80O 2P51A 5FRMA 2HVIA 2H3GX 2HF3A 1GOAA 4FW2A 1VSMA 4GMJB 3EZ5A 5JICA 5AQMA 1T8EA 1WAJA 3QMLA 4FWOA 3THXB 1HQUA 3RWUA 1T03A 3AO1A 5GAHP 1BIUA 3KWGA 4FOEA 4YDUC 1ATNA 2Q0UA 1KXPA 1X1PA 1FW6A 5AQKA 4R79A 2W41A 3C7NB 1YTUA 4BDYA 2KZZA 3R9PA 4YFUA 4Z4CA 2F8SA 3AVGA 4B1WB 4WQ4A 4K0KK 4I2PA 5GAGP 4HTLA 4DUYK 4DQSA 4JEPA 2ZJPL 1TVRA 4RW6A 4PY5A 2FXUA 1UOCA 1X9WA 3WQUA 2QWMA 3QESA 3MN6A 3SBGA 3BY5A 3MX5A 1JXEA 1CXUA 2HMIA 2BUPA 3V9SA 3SPZA 1WUAA 5E84A 4F8RA 5C10A 1NOZA 1BIZA 3LDOA 3KIOA 2QEXN 1D8YA 4IEEA 3TABA 1HPMA 4K8ZA 3CJ1A 5AQFA 2VG5A 3KLHA 2Q3SA 3IMXA 2I7NA 1N36K 1I3AA 3H08A 5EOYA 1RGIA 3QINA 2VGMA 4J2AA 4JKEA 2XHBA 5J2PA 1P8ZA 4CCHA 4PA1A 5T7BA 3SPYA 3WQTA 3VEWA 4CK2A 3DRSA 3U6FA 2D0BA 3RR8A 4XEIA 4RW4A 2AP1A 4JAXA 3P1GA 4KHUA 3I33A 5KI6A 4CZFA 4GNIA 1RDBA 3PSIA 3VQAA 5AFUH 3I8DA 4CF1A 2P9LB 3GOIA 4CFDA 2X78A 1WSHA 1N5YA 4CD3A 3AVHA 4LSLA 3Q7CA 2YX6A 4AH9A 4JKCA 4U7BA 5HL7L 3DLLL 3H1QA 3CC4N 1QE1A 3IAYA 4NLBA 3KWIA 3OYIA 1YTAA 5EVZA 3DXKA 5AQIA 4F2RA 1KTQA 3CFRA 1VQ6N 3QFUA 3QNNA 4H0YB 3HOTA 4ILHA 3HOSA 3U4LA 2PAVA 3SUOA 2VQEK 2DPNA 4KHPK 3VQ9A 3TU5A 3WNEA 3RTVA 1GLFO 3ISNC 4OJRA 1NGGA 1KVAA 4UQGA 2Z1JA 4RW8A 1TV6A 2O8FA 2XY8A 3EKUA 4M3TA 1XHXA 1D4XA 1EP4A 1ILYA 4L3QA 4JD2B 4DV3K 5AQUA 3D2EB 4CHYA 3LAKA 1NM1A 3ID6A 4OKJA 3THXA 2JLEA 3CIPA 3E9PA 2GUPA 2G8UA 1V4TA 5E26A 3ATVA 3G71N 2YHWA 2HBMA 3SUQA 4M41A 4IG0A 4JKDA 1NGDA 3AVCA 4KI6A 1OVQA 2F8TA 5CR4A 4KTWA 2DTUA 3A8YA 2OPPA 2GWKA 1RT6A 3C7NA 1E3MA 1M1KO 3LL3A 3P38A 3CJCA 4YORA 3CQYA 4ILJA 4Z4FA 4MLHA 4JV5K 1S9EA 3CXCM 3KLEA 1BG3A 1KFDA 1O13A 4Z4GA 3QFPA 2QTDA 4DU1A 4BVOA 3ZEUB 4YOYA 4JKGB 4H5NA 4AM6A 4MO4A 5LJWA 4OGEA 4W5NA 4MDAA 3MEDA 2P9PB 3EKSA 3VQPA 3TANA 1X9MA 3HZ6A 3O9RA 4DR4K 4QAGA 4B3MK 1NU0A 4CBWA 1FKOA 1I94K 3HYFA 1N33K 2A1RA 2ZJRL 4FJNA 1ZBLA 1ZBUA 2EX3A 3I55N 3H1VX 1VSDA 4A5AA 1TUUA 4KBOA 4B9LA 1BHLA 2NRXA 2OPSA 4FZXC 3QIOA 2OYQA 1NGEA 2QWLA 3T3FA 1IBKK 3TSUA 4DS5A 3NVKA 4XH5A 4DQQA 1S6QA 4H03B 3V81A 4WQ5A 3LDPA 4XH4A 1IO2A 1Z05A 1BCOA 4CFBA 3QEXA 2P9LA 2W6KA 4J8FA 2J4RA 3HVTA 2HBLA 3F9KA 1DTQA 2E8AA 3Q7BA 4BRQA 1NKBA 3N4PA 4IFYA 3OYHA 3J7ZO 3C94A 3K0SA 4C8LA 3AGRA 2W42A 2Q31A 3T1YK 2FC0A 3AA2A 3AO4A 1MU2A 4MQ3A 3NMUA 4FWMA 4NXNK 2ZD1A 3F5TA 3J8AA 1RFQA 3HI0A 2RN2A 3F2KA 1QSYA 4DQRA 5J2MA 3I0RA 2E4LA 1RDWX 3O08A 4B9VA 5JLFA 1FJGK 1KC8O 3BDPA 4JKHA 4CZLA 3NH2A 1SL2A 1Z25A 1S72N 3TTFA 4IXCA 1RTIA 5LL6Z 4QS8A 4OKEA 4A62A 3OYCA 4FJ7A 4DQIA 3SLCA 5EY4A 5F1XA 1BQMA 2BH1A 2YNGA 3ITHA 1XMQK 1VQKN 4OKKA 3ZSVA 3L2RA 1RBTA 3A2FA 5KRSA 3SAGA 4DS4A 1VAZA 2ATQA 3D6RA 5KPTA 4DFKA 3C6AA 4LFAK 4FWNA 3HP9A 2QI2A 4E0DA 4CEFA 3AGKA 3RMCA 1GOBA 1T44A 3DLGA 2DY4A 2HVHA 3M8SA 1HLUA 3DOKA 2R7YA 2KHOA 2HSTA 4JD2A 3VQQA 1IKVA 1K8AO 3D2EA 1TL3A 3IDHA 4QOZB 4GV9A 1MA9B 2WONA 3QEWA 1QQOA 2YNHA 1XI1A 2UXDK 3I56N 5DMRA 5A2QO 1ZBIA 3KKSA 3RRGA 1W97L 2F7TA 3D7EO 4M42A 1IBMK 4AHCA 5HLFA 2BDPA 4QCLA 2KW4A 1OH7A 1XNRK 5BRDA 1TK0A 3CJAA 3I0SA 2A41A 3MCPA 1CZAN 4EFHA 4CZMA 2BTFA 2XY7A 4PWDA 4DR7K 2O4IA 3ZEUA 4CJUA 5KRTA 4KREA 1QTMA 1RTJA 1LWFA 4JKGA 3V9UA 5HRPA 3QIPA 2KLAA 4CF9A 3AY9A 3OYGA 2P9PA 2FSNA 4U67L 3LZJA 3TARA 3EO3A 4KRFA 4WFBL 4MDBA 1T6DA 1EWRA 3TAMA 4FK4A 2ZWHA 1YVUA 3QERA 4FW1A 4B9MA 3V6DA 2I7PA 2HW3A 2E2PA 5M1OA 1K73O 1U6ZA 2UU9K 1NGAA 4JK9A 5J1EA 4DLEA 2NRZA 1IG8A 4BDPA 3AARA 4C23A 4DR3K 3KK1A 4WF9L 4BE0A 5BPLA 2QK9A 4JI8K 4JNEA 4FXDA 2WUSA 1JLCA 4BG9A 3QNOA 2P5GA 2YI1A 1ATSA 1VSIA 5LMUK 4Z94A 2JGUA 2PYJA 3R8EA 4DTNA 1JLAA 2E6LA 4OO1J 4AHUA 3GG4A 4B1YB 4M63C 2P9SB 3LM2A 2D0OA 5GADP 1VRTA 1BUPA 1RT3A 2YJFA 1LV5A 3AAQA 3AVIA 1K8KB 1JLEA 4I7FA 1YAGA 3KVGA 1IKXA 4EP5A 2F9WA 1HNIA 5FDLA 4FLTA 3ZSZA 2AA4A 5GINA 4WCEL 4BR9A 4FVUA 2IC3A 4DV1K 2OA8A 4WFAL 2X6NA 1GLAG 3QICA 2OPRA 4X62K 2VG6A 4FLYA 3V4IA 4QS9A 2HHTA 1CZ9A 3OA9A 3NFAA 3ZX3A 3B8AX 3MMVA 3AVAA 3H46O 3MAQA 3DI6A 3CHWA 3I8BA 4IG3A 2RPIA 3EE9A 4CF8A 3G10A 3LZIA 1LAVA 4AHSA 2G8FA 5HRNA 4CHOA 5M1FA 4BC5A 4WFNL 2OPQA 1S1UA 2Y1JA 4H0XB 3OYDA 1YHQN 3B6PA 1UA1A 4W5TA 2O8EB 4MFBA 3AVKA 3DMJA 2GV9A 1GLDG 3P83D 1REVA 3PSFA 4DB3A 5AQRA 4G1QA 1HNWK 1V4SA 2WOMA 4CJTA 3ZT0A 2ZE2A 2OZMA 3HJFA 4Z0UA 5AQTA 1H1VA 3V1RA 3LPUA 4FJIA 2HHSA 3E66A 2PYLA 3HT3A 1X9SA 1GLCG 4CGFA 4M3XA 1X3NA 1KAZA 1VSJA 3VQDA 3L2UA 2JWKA 4LD0A 1WAFA 4BE2A 4B3SK 2ASMA 4EAHD 3AO3A 2QKBA 5CYQA 4CW7B 3THWB 4DR5K 4F3TA 3UKRB 4KFBA 1BI4B 3DOLA 3WXLA 4N76A 3IKMA 5AQHA 4C8OA 4DTXA 3S3NA 3FZKA 3OYKA 1HUXA 4DF8A 1J5OA 3OYLA 2P9UB 3GL1A 4FWQA 4CZJA 3OS2A 4BG8A 1LOTB 5C42A 3HPOA 1NJZA 3C95A 4JHDB 3OY9A 1NKCA 2OCEA 4IOCL 3LDNA 3MK6A 2ITGA 2EWSA 3TTCA 3J7AP 1Q8IA 1LWCA 3M8RA 4GVEA 3VF4A 3WXJA 4BACA 3O4NA 4IFVA 3QEVA 3PV8A 2XY6A 1OVYA 1YVNA 4HUFA 3OYMA 4DV7K 4DR2K 1BOTO 4YDUA 3O1BA 2D4WA 2ASPA 2W6LA 1N8RO 4ELUA 4IDKA 4FWKA 2PFUA 3TAEA 2P9SA 2UXCK 1SKRA 5KQ8A 2VWBA 4JI5K 4FYDA 5EXWA 2Z1IA 4WYBA 3LDLA 3FGUA 3AVLA 4AHTA 2P9NB 1K8KA 4BDZA 1C1CA 4BRKA 3ZYYX 4CECA 1NK7A 5C0YA 3IS9A 1J54A 5AQOA 1YITN 4RG8A 4CGIA 3GBTA 2O8CB 4B1VA 3MX2A 3NGIA 4FPAA 1DT9A 3LP3A 1L3SA 2QM1A 2IS3A 5KPZA 1NWKA 3MXIA 1RT7A 3LWLA 1S1XA 2V51B 3ZSWA 1LWEA 4FJ8A 4JI0K 3LPTA 4CZHA 1T7PA 4F4KA 5BPNA 2O4GA 2G8HA 4CBXA 1WLJA 3D0PA 5AQVA 3K5OA 4DSJA 3RMAA 4FK0A 5J2QA 1GLJO 2V7ZA 4ZHRA 5AQLA 4OPHA 1OKJA 2HBJA 4JS5A 3MWPA 2VWKA 4FLWA 4H0TB 3GDQA 1DLOA 2O8EA 2EHGA 4CF0A 3AA3A 1WNSA 3MN9A 3VQ6A 1VSKA 3O3FA 1Z26A 3LAMA 2KZMA 2HHWA 3LDQA 1IV0A 1ASUA 2QKKA 5C25A 3D45A 4FJ9A 4BR7A 2FBXA 1A5XA 5KGWA 4LF7K 2P9KB 5ELZA 4KO0A 4A5BA 1R0AA 1BCMA 4JLHA 3SZ2A 3S41A 3K9JA 4B3OA 1HNZK 5BPMA 1ASWA 4E89A 3CD6N 3JSMA 2VGNA 5BRHA 1YJWN 1NK4A 3NF9A 4FLVA 4H5VA 3OS0A 3FZMA 4N41A 1GOCA 3T19A 3FFKB 4BRLA 3QETA 1LCUA 3DAWA 4CEQA 4FVMA 2E2OA 3VTHA 3SI6A 5BN8A 4E1JA 2E88A 3AVFA 4FO0A 3NGYA 1HR0K 4DSLA 3THWA 3UKRA 4BC2A 1BI4A 4PKGA 2A1SA 4EIAA 3AO2A 4ELVA 3VF2A 1G99A 4I6MB 4FJGA 3AAPA 4A59A 4A57A 3L8BA 4HTUA 1VQ4N 4B08A 2O8DB 3JS6A 4M7YA 4CJFA 5FPDA 1YT3A 5KTQA 2P9UA 1E4FT 3R1XA 5C12A 4I9QA 1NK8A 4JHDA 3RR7A 2F96A 3MCAB 4FJXA 3NH0A 1WN7A 3ENOA 3EL2A 1JKHA 1RCHA 4B1UB 4B9UA 1CZBA 3ZX0A 4O0IA 1KVBA 3AA5X 2QXLA 2D5RA 1JCGA 3ZT3A 3VEYA 1BGXT 1C0MA 1SV5A 3TAPA 2HHVA 4M45A 4E7JA 4B1XB 4LY7A 2YHXA 1LW0A 5EX5A 1DTTA 3BZKA 4CEZA 4AILC 5JS2A 4B1ZA 3IG1A 3SUNA 4JS4A 3QBWA 3TTDA 3WXKA 5AZJB 3P4IA 4KI4A 1T05A 3TAGA 2PZSA 1HRHA 4FM0A 3CC2N 4CEAA 4IOAL 1ATRA 4ELTA 4W5RA 1KLNA 3AVNA 1OH8A 3S3OA 4IJNA 3P5JA 3PLAA 3ZT2A 3D2FB 3MEGA 5FROA 1L5UA 3B6OA 4DV4K 4FWRA 3K2PA 3JAMO 2P9NA 3HTVA 4HWIA 2PY5A 4JI3K 2KKZA 3NVMA 5LMNK 1F21A 1CLQA 5HROA 3KZBA 3CM6A 2B4JA 3K5NA 3CF5L 2O8CA 3O4QA 5TKYA 3ZSQA 1OH5A 1J53A 2YNIA 3WNHA 5CE3A 3U9DA 4DFMA 4DFPA 4LH5A 4RCHA 3T69A 3M8QA 2QWNA 3HSTB 3VOVA 4DTRA 3DWLA 3SV3A 4E7LA 3VPZA 3ASMA 3OS1A 5HBMA 2XY5A 1L3UA 3VETA 4E7KA 4CGGA 3SV4A 3OYEA 2P1JA 1KCFA 4CIEA 3VEOA 1YIJN 2KQ2A 5DK5A 2X74A 3NDKA 1EX4A 2D0AA 1XHZA 4LF9K 1C6VA 2ZQBA 3SAFA 3WEEB 3EY1A 3O8MA 4K43A 4YOTA 2A6AA 3A0IX 2JWLA 3CQ8A 2UUBK 3KHYA 3DYAA 4ID5A 5M1KA 5JVGL 1EETA 3VQCA 1KFSA 5CYMA 4PKHA 3QEIA 4X65K 4ZTFA 4CEOA 3L3VA 3O6WA 5JS1A 2P9KA 3DJCA 5KPRA 3L4QA 4XH1A 4NXMK 4CGHA 4DU4A 1S6PA 4DTOA 1QZ6A 5JMVA 2HNDA 1SKSA 1W0HA 4AHVA 1JJ2M 3FLCO 3ZX2A 3E9LA 4J2DA 3NCIA 4KB1A 1EQYA 2OANA 3CPEA 4CE9A 4FLZA 4JYAK 3ZSYA 3M5RA 3CJBA 4XIUA 1HX1A 4AF1A 1W7AA 2Q97A 2ITMA 1IKWA 5GIPA 4X64K 4E3SA 2FF6A 4PHTX 1O1WA 1TKZA 4B8AB 3H3OB 4CFCA 4J2BA 2ZM6K 3FZHA 4BRDA 1VSHA 5H1SQ 4CZGA 5ADXA 4I2QA 3WNFA 4I6MA 2X6SA 4BRIA 3S3MA 1VRUA 1S22A 4DG1A 5AZIB 4BRFA 2O8DA 5MLCQ 3TWHA 4JRQA 3VENA 3L2QA 1ZBSA 3MDQA 4BRCA 1RILA 1VQ9N 3VGMA 3M1FA 4CEBA 3V9ZA 3VN5A 4HUEA 3O3HA 3JXUA 4JKBA 3MEEA 1KAXA 4CK3A 3ALYA 1U45A 3OW2M 2P5OA 1RDUA 1CXQA 4FK2A 3S9HA 2YJEA 1FXXA 3NF7A 3UIQA 3DLRA 2CH6A 3CMEN 1SAZA 4H8KA 3PX6A 2G8WA 2NZTA 1XUPO 5AZJA 4DWIA 2E5LK 5HOOA 3O9TA 2HHXA 4NYNA 3ATUA 1QS4A 4ZTJA 1W9HA 2HNYA 1IBLK 5I9EB 1SL1A 4DTUA 1QSLA 3G25A 3VQEA 5BR9A 4FJLA 2YKMA 3D2FA 1EKEA 2CGKA 1RTDA 4CJVA 4NO7A 1J5EK 4IZ9A 4FSVA 5FPMA 3DLHA 5CZ1A 4CJ3A 2HHQA 3CYMA 5D3GA 2NRTA 1WSGA 4CK1A 1BU6O 4EHTA 3BGRA 2D0PA 1NKEA 3CCVN 3QBXA 1MWMA 4H0PA 4GV3A 1S9GA 2O8BB 3R3LA 4ISFA 5AQSA 4DV6K 3QDKA 4H4MA 4CHNA 2AJQA 4IBNA 5BRFA 3TSPA 3BUZB 4NB4A 3U3YA 2A42A 2YKNA 1KSPA 3BZCA 4CIFA 5AQNA 4BC4A 1DEJA 4N5SA 1TK5A 2GX9A 1NOYA 2FLOA 3WUHA 4ISEA 2E1YA 3WNGA 3OYBA 1XC9A 2NRRA 3CCLN 1RDDA 3AVBA 2YHBA 4M3RA 4BQZA 3FFIA 1JXBA 4FL9A 4FLUA 3K5MA 4B9SA 2HBKA 4M3WA 1UAXA 1L3VA 5GIOA 3WEEA 3TI0A 3CCJN 1DGKN 1ZC6A 3C6UA 4B3TK 4JI4K 3F73A 4NCAA 1NGHA 4H5WA 3MXMA 2G8IA 2FSKA 1M90O 2CGJA 3U3GA 4IDHA 5DM7L 1C0TA 2E20A 3O1WA 3ULEB 3A5NC 1QZ5A 4W5QA 4AM7A 3UKUB 4K41A 4RTFD 4CZIA 1WSJA 4DCHA 1RT4A 1N32K 1IH7A 3E9OA 1NMDA 5AQZA 4BQLA 1BWFO 4KHYA 2IAJA 4O8KA 1BISA 4C8NA 4IKFA 1SQKA 4NCBA 4BE1A 4HHTA 1ITGA 1JLBA 2Q0RA 2IVNA 5C2FA 1A5WA 3ZSRA 1C0FA 4M3UA 1XC3A 4I9LA 1BA0A 4LH4A 1Q7YO 3CCUN 2E2NA 3KD1E 1NNEA 1HYVA 2QWPA 2Y1IA 1TKDA 2GUIA 2QW9A 3HXMA 1WB9A 1RDAA 2NRHA 4EZ6A 3U8XA 3FZFA 4KHSA 4BROA 3RSEB 1TAUA 1N34K 3F9MA 5AQJA 4JI6K 3PIPL 4IJAA 3PX0A 4KPYA 5M1PA 4E19A 1RBRA 5SWMA 1Q9YA 5AZIA 4KAZA 3FZLA 4CJWA 5GAEP 5DM6L 2GWJA 3MWTA 3DRPA 3LDSA 3KKRA 1C1AA 1XQSC 3HSCA 3L3UA 4PQUA 3A5MC 5FPNA 1SUQA 1P90A 2ASOA 3NF8A 4DMNA 3VERA 3PX4A 3O3GA 3G6EN 1NBWA 3CJ9A 4JKAA 3SMSA 4BRPA 5JVHL 3LALA 1TL1A 1QQMA 3PO4A 1RNHA 4BGBA 5FPEA 4BRGA 1GLEG 1T6CA 1QHTA 1QVGM 2CGLA 4BRNA 4O5FA 1NMNA 1JL2A 3VGKA 1VQPN 2I5JA 3PY8A 3SMPA 3EEQA 4CHZA 5IT9O 3IRXA 3T1AA 1NJIO 3T7ZA 1BQNA 4BRAA 1TUYA 4FZYA 3G4SN 1RT5A 1FK9A 3AVJA 4CJKA 4BRMA 3OYJA 3SQ4A 4GW6A 3VESA 4PL8A 4CZEA 1RT2A 3CQXA 4WQ4C 4C1NI 3QO9A 3UB5A 5BREA 4DSEA 3HVRA 4KKOA 3KTQA 3LP0A 4IOXA 4N47A 2UUCK 5AJ3K 3KLIA 4KV8A 2WFBA 4GV6A 4YNQA 1Q9XA 3HBTA 2IVOA 5AQXA 4R5PA 1J9AA 2O8BA 2ZJQL 3CCMN 4CESA 4RW7A 2VYPA 3CG7A 3JYTA 2PBDA 1Q81O 4M3YA 4HUGA 2FBYA 4O0JA 3GE1A 3DXMB 3HO1A 1JCFA 3IUCA 1YJNN 4KHWA 4KH4A 2V52B 1T3VA 1LAWA 2NLXA 2LSNA 3NBPA 4FLXA 4DTSA 1NK6A 1HYSA 1S1WA 1NG9A 1HKCA 4FJHA 4L8RB 4C1NK 1RDCA 2IGIA 4LFBK 5K14A 3OBYA 4IO8A 5EU7A 1Q82O 2A5XA 3THYB 4BVPA 3WXMB 1XMOK 1TKTA 4H0VB 2BGGA 3WT0A 2E2QA 1NK9A 5AR0A 2NRVA 4JK8A 3CERA 1BO5O 4CD1A 4DU3A 4F9OA 3ULEA 1XWLA 5AQQA 1JLQA 2QWRA 3CCQN 1WSIA 1ZXOA 3UKUA 4F2SA 2HNZA 3TPQA
chains in the Genus database with same CATH topology
2QXFA 4RW9A 1HNVA 3AVNA 3CFPA 3S3OA 4FJJA 3HK2A 3P5JA 3ZT2A 3MEGA 5FROA 1L5UA 3B6OA 3HP6A 2HHTA 1TK0A 3K2PA 3I0SA 2PY5A 3KJVA 3AVMA 1B9FA 1F21A 1CLQA 2B5JA 2Z1GA 3VQ8A 5HROA 3CM6A 1KLMA 2XY7A 4PWDA 4O44A 2B4JA 3K5NA 4BWMA 2O4IA 3O4QA 3RRHA 1D9DA 4H4OA 4CJUA 3ZSQA 3SQ1A 5KRTA 1J53A 2YNIA 3WNHA 1WSFA 1D9FA 4CJ5A 1RTJA 1LWFA 1QTMA 4KREA 4FCYA 1B9DA 3V9UA 4CERA 4DFMA 4DFPA 4LH5A 5HRPA 3QIPA 4CGJA 4FJXA 3M8QA 3VQBA 3CM5A 4CF9A 3OYGA 4O5BA 1QSSA 3HSTB 4ID1A 4DTRA 3K5LA 3OJUA 3SV3A 4E7LA 1JLGA 3ASMA 3LZJA 3TARA 3OYFA 1UA0A 4FJKA 4KRFA 3OS1A 5HBMA 2XY5A 1TKXA 4FK4A 3TAMA 1L3UA 4E7KA 3VA0A 1YVUA 4CGGA 3V1QA 4FW1A 3QERA 4B9MA 3SV4A 3OYEA 2P1JA 1KCFA 4CIEA 3V6DA 2KQ2A 2HW3A 5DK5A 1VSEA 2X74A 4ICLA 3NDKA 1EX4A 4FM1A 2D0AA 3C6TA 3PO5A 1XHZA 2HB5A 3AA4A 5J1EA 4DLEA 3L2WA 4Z4HA 3ZSOA 1VK0A 1C6VA 2ZQBA 4BDPA 2P51A 3EY1A 4KB0A 5FRMA 2HVIA 4FW2A 1GOAA 4HVJA 3KK1A 4BE0A 4B9NA 1VSMA 4DQPA 4GMJB 2QK9A 1KVCA 3CQ8A 1I39A 3EZ5A 4FXDA 2HHUA 3DYAA 1JLCA 3LWMA 3QNOA 1T8EA 1WAJA 4ID5A 2P5GA 4M3ZA 1EETA 3VQCA 1VSIA 4WE1A 1KFSA 5CYMA 1HQUA 4Q0BA 2JGUA 2PYJA 3RWUA 1T03A 4B8CA 3KK3A 3AO1A 4E1MA 1JLAA 2E6LA 4DTNA 3QEIA 4ZTFA 4AHUA 4CEOA 1VSLA 1BIUA 3L3VA 3LP1A 5JS1A 1X1PA 4DF4A 4Z4EA 4KTQA 1VRTA 1RT3A 1LV5A 4CGHA 4DU4A 1YTUA 4BDYA 2YNFA 2KZZA 3AVIA 1HYZA 1S6PA 4DTOA 1TK8A 4OLBA 4YFUA 4Z4CA 2F8SA 4B9TA 2HNDA 3AVGA 1JLEA 4I7FA 3K58A 1SKSA 1W0HA 4AHVA 4I2PA 1IKXA 4BWJA 1TAQA 4J2DA 4EP5A 3NCIA 4DQSA 1HNIA 5FDLA 3NE6A 4FLTA 4KB1A 4OPJA 3ZSZA 4HCCA 1TVRA 4RW6A 4PY5A 1K6YA 1WSEA 1UOCA 1X9WA 4CE9A 4CJPA 4DSFA 4FLZA 2IC3A 3NAEA 3ZSYA 3QESA 2OA8A 4XIUA 2X6NA 1JXEA 1CXUA 2OPRA 2HMIA 2E6MA 1IKWA 2VG6A 4E3SA 3DLBA 3V1OA 3V9SA 3SPZA 4FLYA 3OYNA 3V4IA 4F8RA 1O1WA 1TKZA 4B8AB 1CZ9A 4CFCA 4CJRA 3NHGA 1NOZA 1BIZA 4J2BA 3KIOA 3NFAA 1RT1A 1VSHA 1JL1A 1D8YA 3TABA 4K8ZA 2KFNA 4FZZA 4I2QA 3WNFA 3CFOA 2X6SA 2VG5A 3S3MA 1VRUA 4DG1A 3KLHA 3AVAA 2Q3SA 3G0ZA 3U6FA 5C24A 3MAQA 3DI6A 1I3AA 2VG7A 3H08A 3TWHA 3RR8A 4JRQA 4IG3A 3QINA 4CJQA 3SCXA 1U49A 3L2QA 2RPIA 3M8PA 4J2AA 2XHBA 4K8XA 4CF8A 5J2PA 3G10A 1HJRA 1RILA 3NGZA 4CCHA 3NF6A 1LAVA 4PA1A 4AHSA 5T7BA 3LZIA 5HRNA 4CEBA 4CHOA 4JRPA 3SPYA 2G8FA 3V9ZA 2G8KA 1NK5A 3VN5A 3DRSA 2OPQA 4CK2A 2D0BA 3O3HA 1S1UA 3KLGA 4HUEA 3MEEA 4CK3A 3OYDA 3ALYA 4RW4A 2Y1JA 1UA1A 3B6PA 1U45A 4W5TA 2DFFA 3P1GA 4MFBA 3AVKA 1CXQA 4CIGA 4KHUA 3DMJA 4FK2A 2GV9A 2OZSA 5KI6A 3S9HA 3P83D 1RDBA 1FXXA 1FKPA 3NF7A 1REVA 3UIQA 3VQAA 2GBZA 3DLRA 3I8DA 4G1QA 4CF1A 1NJYA 2XO7A 5I3UA 2WOMA 4CJTA 4CFDA 3ZT0A 2ZE2A 4H8KA 2OZMA 2X78A 1WSHA 4Z0UA 3PX6A 3VQ4A 1NK0A 1N5YA 3V1RA 2G8WA 3LANA 3LPUA 4DWIA 4O55A 4FJIA 2HHSA 3AVHA 2HHXA 2PYLA 3VQ7A 4NYNA 2DFHA 1QS4A 4LSLA 4O4GA 1W9HA 2HNYA 5HP1A 3SQ0A 4ZTJA 1ZYQA 3HT3A 4LSNA 1SL1A 4DTUA 1QSLA 4AH9A 1X9SA 3OVNA 4HCBA 4CGFA 3VQEA 4M3XA 1NJXA 2DFEA 4CJLA 2YKMA 4FJLA 1EKEA 1RTDA 4CJVA 1VSJA 1TGOA 5CY4A 2IOCA 3VQDA 3L2UA 5J2NA 5CZ1A 1QE1A 3DLHA 4CJ3A 3KK2A 3ZT4A 3K57A 3CYMA 3IAYA 2HHQA 4LD0A 5D3GA 1WAFA 1G15A 4BE2A 1WSGA 1VSFA 5E41A 3DLEA 3ZCMA 2KTQA 4CK1A 3AO3A 3OYIA 2QKBA 1YTAA 3LP2A 3BGRA 4J2EA 5CYQA 1NKEA 4F3TA 4KFBA 2ETJA 1BI4B 4F2RA 1HPZA 1B92A 1KTQA 1S9GA 3CFRA 3DOLA 4N76A 3HPHA 2IDOA 4C8OA 2VWJA 3QNNA 4DTXA 3THVA 4H4MA 4CHNA 3S3NA 2AJQA 4IBNA 1RBVA 3SUPA 3OYKA 1S1VA 1SKWA 4AHRA 4DF8A 3U3YA 1J5OA 3EYZA 3OYLA 2YKNA 1KSPA 4DTPA 4CIFA 4N5SA 1TK5A 3SUOA 3OS2A 5C42A 3HPOA 1Y97A 3VQ9A 1NJZA 3C95A 3OY9A 1NOYA 1XC9A 3OYBA 1NKCA 3WNGA 3WNEA 4Y1DA 3ZT1A 1RDDA 3AVBA 3RTVA 2YHBA 4M3RA 4NYFA 3E01A 3FFIA 2FBVA 2ITGA 1JXBA 4CEDA 1U47A 3ISNC 4OJRA 4KHQA 4FLUA 1KVAA 4Y1CA 2Z1JA 2D0CA 1Q8IA 4UQGA 1LWCA 3M8RA 3K5MA 3TAFA 4RW8A 1TV6A 4B9SA 4CJSA 4M3WA 1UAXA 1L3VA 2FBTA 2XY8A 4CJ4A 3OYAA 3O4NA 1XHXA 4BACA 3TI0A 4M3TA 4IFVA 1EP4A 4DTMA 2G8VA 3C6UA 4EZ9A 3QEVA 3PV8A 2XY6A 4HUFA 4TSXA 3LAKA 4CHYA 3OYMA 3HJFA 3OJSA 4CHQA 1A5VA 5CZ2A 3F73A 4NCAA 4OKJA 3MXMA 2G8IA 2JLEA 2B6AA 3SQ2A 2G8UA 3U3GA 1S1TA 2BANA 3SNNA 1C0TA 4ELUA 4IDKA 3SUQA 4M41A 3TAEA 4IG0A 1LW2A 3AVCA 4KI6A 4W5QA 2F8TA 4DLGA 3VQ5A 1WSJA 4KTWA 2DTUA 1RT4A 1IH7A 2OPPA 1SKRA 3TR8A 1RT6A 4KHYA 4FYDA 4E1NA 2Z1IA 2IAJA 1BISA 3AVLA 4C8NA 4IKFA 4AHTA 4NCBA 4BE1A 4HHTA 4F2SA 4BDZA 1C1CA 4CECA 1NK7A 2NUBA 3IS9A 1ITGA 1JLBA 1QQCA 4Z4FA 1S9EA 3DLKA 1J54A 2P5OA 1A5WA 3KLEA 4RG8A 3ZSRA 4CEEA 4M3UA 4I9LA 1KFDA 4CGIA 4Z4GA 5HRRA 4DU1A 1HMVA 4LH4A 3RMDA 1SL0A 3NGIA 3KD1E 3LP3A 1L3TA 5HRSA 1L3SA 1HYVA 1ZBFA 2IS3A 2Y1IA 1D5AA 1TKDA 2GUIA 3MXIA 4OGEA 2RKIA 3HXMA 4W5NA 3MEDA 1EXQA 1RDAA 5I42A 3VQPA 1RT7A 4CF2A 1S1XA 2Z1HA 3LWLA 1U48A 4EZ6A 3TANA 3ZSWA 1LWEA 1X9MA 3AV9A 4FJ8A 4KHSA 4OLAA 1TAUA 5FRNA 4QAGA 3LPTA 1T7PA 4F4KA 1FKOA 4OPKA 3HYFA 3PX0A 2O4GA 4KPYA 3QLHA 4E19A 2A1RA 1RBRA 5SWMA 1Q9YA 4FJNA 2G8HA 3MXJA 3RMBA 4KAZA 4CJWA 1UWBA 1WLJA 3D0PA 1ZBLA 1ZBUA 2EX3A 3DRPA 3K5OA 3LDSA 4ELTA 3KKRA 3RMAA 4DSJA 1C1AA 3L3UA 5J2QA 4F3OA 4FK0A 1VSDA 3V9XA 4PQUA 4B9LA 3ULDA 1BHLA 2OPSA 3HPGA 4ZHRA 1SUQA 1C1BA 4FZXC 3NF8A 4DMNA 3VA3A 3DM2A 4KHNA 3PX4A 1KRPA 3QIOA 3O3GA 2OYQA 4JS5A 4FLWA 2VWKA 3PUFA 3T3FA 4DS5A 1DLOA 1U04A 2EHGA 3LALA 4CF0A 3AA3A 1WNSA 4DQQA 1TL1A 1S6QA 1VSKA 4OVLA 3VQ6A 3O3FA 1RNHA 3SYZA 3V81A 1Z26A 3LAMA 4DTJA 3PO4A 4PUOA 2KZMA 2HHWA 1U4BA 1IO2A 1ASUA 2QKKA 1BCOA 4KTZA 1QHTA 3D45A 1C0UA 4CFBA 5C25A 3QEXA 4FJ9A 1JL2A 1IKYA 2FBXA 1A5XA 5KGWA 2I5JA 3PY8A 3HVTA 3F9KA 4KO0A 1DTQA 3MECA 1R0AA 4CHZA 1BCMA 4JLHA 3NH1A 3SZ2A 4NCGA 4B3OA 3IRXA 3T1AA 1NKBA 4IFYA 3OYHA 4C8LA 3C94A 2YV0X 4FM2A 1BQNA 1ASWA 2W42A 4E89A 3QEPA 4FZYA 3JSMA 2FC0A 1RT5A 3AA2A 3AO4A 1FK9A 1NK4A 1MU2A 3AVJA 3K59A 4MQ3A 4CJKA 3OYJA 3SQ4A 4GW6A 3NF9A 1ZBHA 2BE2A 2ZD1A 4FLVA 3OS0A 1RT2A 4N56A 4N41A 1GOCA 3T19A 4CGDA 3QETA 3QO9A 2RN2A 4CEQA 1QSYA 5KGXA 4DQRA 4DSEA 3HVRA 4FVMA 4KKOA 3KTQA 5J2MA 1IG9A 3I0RA 3SI6A 4CJEA 2E4LA 3LP0A 4Z4IA 4B9VA 4N47A 3KLIA 3AVFA 3ZSXA 4KV8A 3NGYA 3BDPA 4DSLA 4C8MA 3NH2A 1SL2A 4YNQA 1Z25A 1Q9XA 1BI4A 2A1SA 4R5PA 1J9AA 3AO2A 4ELVA 1RTIA 1ASVA 4FJMA 4CESA 4OKEA 3OYCA 4FJGA 4FJ7A 4FJ5A 4DQIA 4GVMA 1BQMA 3L8BA 4HTUA 4RW7A 2YNGA 4B08A 3ITHA 1S5JA 4C8KA 4DSIA 3CG7A 3JYTA 1RTHA 4CJFA 4M3YA 4OKKA 4HUGA 3ZSVA 2FBYA 1YT3A 5KTQA 3L2RA 1RBTA 3V9WA 3A2FA 4O0JA 5KRSA 4CHPA 4I9QA 3HO1A 1NK8A 4OGCA 4DS4A 3RR7A 2F96A 3L2VA 2ATQA 4KHWA 4DFKA 1LAWA 4E7HA 3NH0A 1WN7A 2LSNA 3NBPA 4FLXA 4E7IA 3HP9A 2YHAA 4DTSA 3TAQA 1NK6A 1HYSA 3HM9A 1JKHA 1S1WA 1RCHA 4FJHA 4L8RB 3AO5A 4B9UA 1RDCA 1CZBA 4E0DA 2IGIA 4CEFA 1KVBA 3AA5X 2RF2A 1RBUA 5K14A 4O0IA 2D5RA 5EU7A 3ZT3A 3SJJA 3RMCA 3KD5E 1BGXT 1C0MA 1GOBA 1SV5A 3DLGA 3TAPA 2HHVA 4M45A 4E7JA 2DY4A 2HVHA 3M8SA 3DOKA 5SZTA 2R7YA 4LY7A 1TKTA 1IKVA 1LW0A 3VQQA 1DTTA 1TL3A 4CEZA 4AILC 4QOZB 5JS2A 2WONA 1BL3A 3QEWA 3IG1A 3SUNA 1NJWA 4EP4A 1KLNA 4JS4A 2BGGA 2YNHA 1XI1A 4CFAA 2KFZA 1NK9A 3HL8A 4DFJA 2XRIA 5DMRA 4KI4A 1ZBIA 3KLFA 3KKSA 4W5OA 3RRGA 1JLFA 3TAGA 1RBSA 1HRHA 1T05A 2PZSA 4Q5VA 4M42A 1HQEA 1N6QA 4DU3A 4FM0A 4DSKA 1XWLA 1JLQA 4AHCA 5HLFA 2BDPA 1WSIA 4CEAA 4QCLA 3DRRA 2KW4A 4W5RA 2HNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXF A;  4RW9 A;  1HNV A;  3AVN A;  3CFP A;  3S3O A;  4FJJ A;  3HK2 A;  3P5J A;  3ZT2 A;  3MEG A;  5FRO A;  1L5U A;  3B6O A;  3HP6 A;  2HHT A;  1TK0 A;  3K2P A;  3I0S A;  2PY5 A;  3KJV A;  3AVM A;  1B9F A;  1F21 A;  1CLQ A;  2B5J A;  2Z1G A;  3VQ8 A;  5HRO A;  3CM6 A;  1KLM A;  2XY7 A;  4PWD A;  4O44 A;  2B4J A;  3K5N A;  4BWM A;  2O4I A;  3O4Q A;  3RRH A;  1D9D A;  4H4O A;  4CJU A;  3ZSQ A;  3SQ1 A;  5KRT A;  1J53 A;  2YNI A;  3WNH A;  1WSF A;  1D9F A;  4CJ5 A;  1RTJ A;  1LWF A;  1QTM A;  4KRE A;  4FCY A;  1B9D A;  3V9U A;  4CER A;  4DFM A;  4DFP A;  4LH5 A;  5HRP A;  3QIP A;  4CGJ A;  4FJX A;  3M8Q A;  3VQB A;  3CM5 A;  4CF9 A;  3OYG A;  4O5B A;  1QSS A;  3HST B;  4ID1 A;  4DTR A;  3K5L A;  3OJU A;  3SV3 A;  4E7L A;  1JLG A;  3ASM A;  3LZJ A;  3TAR A;  3OYF A;  1UA0 A;  4FJK A;  4KRF A;  3OS1 A;  5HBM A;  2XY5 A;  1TKX A;  4FK4 A;  3TAM A;  1L3U A;  4E7K A;  3VA0 A;  1YVU A;  4CGG A;  3V1Q A;  4FW1 A;  3QER A;  4B9M A;  3SV4 A;  3OYE A;  2P1J A;  1KCF A;  4CIE A;  3V6D A;  2KQ2 A;  2HW3 A;  5DK5 A;  1VSE A;  2X74 A;  4ICL A;  3NDK A;  1EX4 A;  4FM1 A;  2D0A A;  3C6T A;  3PO5 A;  1XHZ A;  2HB5 A;  3AA4 A;  5J1E A;  4DLE A;  3L2W A;  4Z4H A;  3ZSO A;  1VK0 A;  1C6V A;  2ZQB A;  4BDP A;  2P51 A;  3EY1 A;  4KB0 A;  5FRM A;  2HVI A;  4FW2 A;  1GOA A;  4HVJ A;  3KK1 A;  4BE0 A;  4B9N A;  1VSM A;  4DQP A;  4GMJ B;  2QK9 A;  1KVC A;  3CQ8 A;  1I39 A;  3EZ5 A;  4FXD A;  2HHU A;  3DYA A;  1JLC A;  3LWM A;  3QNO A;  1T8E A;  1WAJ A;  4ID5 A;  2P5G A;  4M3Z A;  1EET A;  3VQC A;  1VSI A;  4WE1 A;  1KFS A;  5CYM A;  1HQU A;  4Q0B A;  2JGU A;  2PYJ A;  3RWU A;  1T03 A;  4B8C A;  3KK3 A;  3AO1 A;  4E1M A;  1JLA A;  2E6L A;  4DTN A;  3QEI A;  4ZTF A;  4AHU A;  4CEO A;  1VSL A;  1BIU A;  3L3V A;  3LP1 A;  5JS1 A;  1X1P A;  4DF4 A;  4Z4E A;  4KTQ A;  1VRT A;  1RT3 A;  1LV5 A;  4CGH A;  4DU4 A;  1YTU A;  4BDY A;  2YNF A;  2KZZ A;  3AVI A;  1HYZ A;  1S6P A;  4DTO A;  1TK8 A;  4OLB A;  4YFU A;  4Z4C A;  2F8S A;  4B9T A;  2HND A;  3AVG A;  1JLE A;  4I7F A;  3K58 A;  1SKS A;  1W0H A;  4AHV A;  4I2P A;  1IKX A;  4BWJ A;  1TAQ A;  4J2D A;  4EP5 A;  3NCI A;  4DQS A;  1HNI A;  5FDL A;  3NE6 A;  4FLT A;  4KB1 A;  4OPJ A;  3ZSZ A;  4HCC A;  1TVR A;  4RW6 A;  4PY5 A;  1K6Y A;  1WSE A;  1UOC A;  1X9W A;  4CE9 A;  4CJP A;  4DSF A;  4FLZ A;  2IC3 A;  3NAE A;  3ZSY A;  3QES A;  2OA8 A;  4XIU A;  2X6N A;  1JXE A;  1CXU A;  2OPR A;  2HMI A;  2E6M A;  1IKW A;  2VG6 A;  4E3S A;  3DLB A;  3V1O A;  3V9S A;  3SPZ A;  4FLY A;  3OYN A;  3V4I A;  4F8R A;  1O1W A;  1TKZ A;  4B8A B;  1CZ9 A;  4CFC A;  4CJR A;  3NHG A;  1NOZ A;  1BIZ A;  4J2B A;  3KIO A;  3NFA A;  1RT1 A;  1VSH A;  1JL1 A;  1D8Y A;  3TAB A;  4K8Z A;  2KFN A;  4FZZ A;  4I2Q A;  3WNF A;  3CFO A;  2X6S A;  2VG5 A;  3S3M A;  1VRU A;  4DG1 A;  3KLH A;  3AVA A;  2Q3S A;  3G0Z A;  3U6F A;  5C24 A;  3MAQ A;  3DI6 A;  1I3A A;  2VG7 A;  3H08 A;  3TWH A;  3RR8 A;  4JRQ A;  4IG3 A;  3QIN A;  4CJQ A;  3SCX A;  1U49 A;  3L2Q A;  2RPI A;  3M8P A;  4J2A A;  2XHB A;  4K8X A;  4CF8 A;  5J2P A;  3G10 A;  1HJR A;  1RIL A;  3NGZ A;  4CCH A;  3NF6 A;  1LAV A;  4PA1 A;  4AHS A;  5T7B A;  3LZI A;  5HRN A;  4CEB A;  4CHO A;  4JRP A;  3SPY A;  2G8F A;  3V9Z A;  2G8K A;  1NK5 A;  3VN5 A;  3DRS A;  2OPQ A;  4CK2 A;  2D0B A;  3O3H A;  1S1U A;  3KLG A;  4HUE A;  3MEE A;  4CK3 A;  3OYD A;  3ALY A;  4RW4 A;  2Y1J A;  1UA1 A;  3B6P A;  1U45 A;  4W5T A;  2DFF A;  3P1G A;  4MFB A;  3AVK A;  1CXQ A;  4CIG A;  4KHU A;  3DMJ A;  4FK2 A;  2GV9 A;  2OZS A;  5KI6 A;  3S9H A;  3P83 D;  1RDB A;  1FXX A;  1FKP A;  3NF7 A;  1REV A;  3UIQ A;  3VQA A;  2GBZ A;  3DLR A;  3I8D A;  4G1Q A;  4CF1 A;  1NJY A;  2XO7 A;  5I3U A;  2WOM A;  4CJT A;  4CFD A;  3ZT0 A;  2ZE2 A;  4H8K A;  2OZM A;  2X78 A;  1WSH A;  4Z0U A;  3PX6 A;  3VQ4 A;  1NK0 A;  1N5Y A;  3V1R A;  2G8W A;  3LAN A;  3LPU A;  4DWI A;  4O55 A;  4FJI A;  2HHS A;  3AVH A;  2HHX A;  2PYL A;  3VQ7 A;  4NYN A;  2DFH A;  1QS4 A;  4LSL A;  4O4G A;  1W9H A;  2HNY A;  5HP1 A;  3SQ0 A;  4ZTJ A;  1ZYQ A;  3HT3 A;  4LSN A;  1SL1 A;  4DTU A;  1QSL A;  4AH9 A;  1X9S A;  3OVN A;  4HCB A;  4CGF A;  3VQE A;  4M3X A;  1NJX A;  2DFE A;  4CJL A;  2YKM A;  4FJL A;  1EKE A;  1RTD A;  4CJV A;  1VSJ A;  1TGO A;  5CY4 A;  2IOC A;  3VQD A;  3L2U A;  5J2N A;  5CZ1 A;  1QE1 A;  3DLH A;  4CJ3 A;  3KK2 A;  3ZT4 A;  3K57 A;  3CYM A;  3IAY A;  2HHQ A;  4LD0 A;  5D3G A;  1WAF A;  1G15 A;  4BE2 A;  1WSG A;  1VSF A;  5E41 A;  3DLE A;  3ZCM A;  2KTQ A;  4CK1 A;  3AO3 A;  3OYI A;  2QKB A;  1YTA A;  3LP2 A;  3BGR A;  4J2E A;  5CYQ A;  1NKE A;  4F3T A;  4KFB A;  2ETJ A;  1BI4 B;  4F2R A;  1HPZ A;  1B92 A;  1KTQ A;  1S9G A;  3CFR A;  3DOL A;  4N76 A;  3HPH A;  2IDO A;  4C8O A;  2VWJ A;  3QNN A;  4DTX A;  3THV A;  4H4M A;  4CHN A;  3S3N A;  2AJQ A;  4IBN A;  1RBV A;  3SUP A;  3OYK A;  1S1V A;  1SKW A;  4AHR A;  4DF8 A;  3U3Y A;  1J5O A;  3EYZ A;  3OYL A;  2YKN A;  1KSP A;  4DTP A;  4CIF A;  4N5S A;  1TK5 A;  3SUO A;  3OS2 A;  5C42 A;  3HPO A;  1Y97 A;  3VQ9 A;  1NJZ A;  3C95 A;  3OY9 A;  1NOY A;  1XC9 A;  3OYB A;  1NKC A;  3WNG A;  3WNE A;  4Y1D A;  3ZT1 A;  1RDD A;  3AVB A;  3RTV A;  2YHB A;  4M3R A;  4NYF A;  3E01 A;  3FFI A;  2FBV A;  2ITG A;  1JXB A;  4CED A;  1U47 A;  3ISN C;  4OJR A;  4KHQ A;  4FLU A;  1KVA A;  4Y1C A;  2Z1J A;  2D0C A;  1Q8I A;  4UQG A;  1LWC A;  3M8R A;  3K5M A;  3TAF A;  4RW8 A;  1TV6 A;  4B9S A;  4CJS A;  4M3W A;  1UAX A;  1L3V A;  2FBT A;  2XY8 A;  4CJ4 A;  3OYA A;  3O4N A;  1XHX A;  4BAC A;  3TI0 A;  4M3T A;  4IFV A;  1EP4 A;  4DTM A;  2G8V A;  3C6U A;  4EZ9 A;  3QEV A;  3PV8 A;  2XY6 A;  4HUF A;  4TSX A;  3LAK A;  4CHY A;  3OYM A;  3HJF A;  3OJS A;  4CHQ A;  1A5V A;  5CZ2 A;  3F73 A;  4NCA A;  4OKJ A;  3MXM A;  2G8I A;  2JLE A;  2B6A A;  3SQ2 A;  2G8U A;  3U3G A;  1S1T A;  2BAN A;  3SNN A;  1C0T A;  4ELU A;  4IDK A;  3SUQ A;  4M41 A;  3TAE A;  4IG0 A;  1LW2 A;  3AVC A;  4KI6 A;  4W5Q A;  2F8T A;  4DLG A;  3VQ5 A;  1WSJ A;  4KTW A;  2DTU A;  1RT4 A;  1IH7 A;  2OPP A;  1SKR A;  3TR8 A;  1RT6 A;  4KHY A;  4FYD A;  4E1N A;  2Z1I A;  2IAJ A;  1BIS A;  3AVL A;  4C8N A;  4IKF A;  4AHT A;  4NCB A;  4BE1 A;  4HHT A;  4F2S A;  4BDZ A;  1C1C A;  4CEC A;  1NK7 A;  2NUB A;  3IS9 A;  1ITG A;  1JLB A;  1QQC A;  4Z4F A;  1S9E A;  3DLK A;  1J54 A;  2P5O A;  1A5W A;  3KLE A;  4RG8 A;  3ZSR A;  4CEE A;  4M3U A;  4I9L A;  1KFD A;  4CGI A;  4Z4G A;  5HRR A;  4DU1 A;  1HMV A;  4LH4 A;  3RMD A;  1SL0 A;  3NGI A;  3KD1 E;  3LP3 A;  1L3T A;  5HRS A;  1L3S A;  1HYV A;  1ZBF A;  2IS3 A;  2Y1I A;  1D5A A;  1TKD A;  2GUI A;  3MXI A;  4OGE A;  2RKI A;  3HXM A;  4W5N A;  3MED A;  1EXQ A;  1RDA A;  5I42 A;  3VQP A;  1RT7 A;  4CF2 A;  1S1X A;  2Z1H A;  3LWL A;  1U48 A;  4EZ6 A;  3TAN A;  3ZSW A;  1LWE A;  1X9M A;  3AV9 A;  4FJ8 A;  4KHS A;  4OLA A;  1TAU A;  5FRN A;  4QAG A;  3LPT A;  1T7P A;  4F4K A;  1FKO A;  4OPK A;  3HYF A;  3PX0 A;  2O4G A;  4KPY A;  3QLH A;  4E19 A;  2A1R A;  1RBR A;  5SWM A;  1Q9Y A;  4FJN A;  2G8H A;  3MXJ A;  3RMB A;  4KAZ A;  4CJW A;  1UWB A;  1WLJ A;  3D0P A;  1ZBL A;  1ZBU A;  2EX3 A;  3DRP A;  3K5O A;  3LDS A;  4ELT A;  3KKR A;  3RMA A;  4DSJ A;  1C1A A;  3L3U A;  5J2Q A;  4F3O A;  4FK0 A;  1VSD A;  3V9X A;  4PQU A;  4B9L A;  3ULD A;  1BHL A;  2OPS A;  3HPG A;  4ZHR A;  1SUQ A;  1C1B A;  4FZX C;  3NF8 A;  4DMN A;  3VA3 A;  3DM2 A;  4KHN A;  3PX4 A;  1KRP A;  3QIO A;  3O3G A;  2OYQ A;  4JS5 A;  4FLW A;  2VWK A;  3PUF A;  3T3F A;  4DS5 A;  1DLO A;  1U04 A;  2EHG A;  3LAL A;  4CF0 A;  3AA3 A;  1WNS A;  4DQQ A;  1TL1 A;  1S6Q A;  1VSK A;  4OVL A;  3VQ6 A;  3O3F A;  1RNH A;  3SYZ A;  3V81 A;  1Z26 A;  3LAM A;  4DTJ A;  3PO4 A;  4PUO A;  2KZM A;  2HHW A;  1U4B A;  1IO2 A;  1ASU A;  2QKK A;  1BCO A;  4KTZ A;  1QHT A;  3D45 A;  1C0U A;  4CFB A;  5C25 A;  3QEX A;  4FJ9 A;  1JL2 A;  1IKY A;  2FBX A;  1A5X A;  5KGW A;  2I5J A;  3PY8 A;  3HVT A;  3F9K A;  4KO0 A;  1DTQ A;  3MEC A;  1R0A A;  4CHZ A;  1BCM A;  4JLH A;  3NH1 A;  3SZ2 A;  4NCG A;  4B3O A;  3IRX A;  3T1A A;  1NKB A;  4IFY A;  3OYH A;  4C8L A;  3C94 A;  2YV0 X;  4FM2 A;  1BQN A;  1ASW A;  2W42 A;  4E89 A;  3QEP A;  4FZY A;  3JSM A;  2FC0 A;  1RT5 A;  3AA2 A;  3AO4 A;  1FK9 A;  1NK4 A;  1MU2 A;  3AVJ A;  3K59 A;  4MQ3 A;  4CJK A;  3OYJ A;  3SQ4 A;  4GW6 A;  3NF9 A;  1ZBH A;  2BE2 A;  2ZD1 A;  4FLV A;  3OS0 A;  1RT2 A;  4N56 A;  4N41 A;  1GOC A;  3T19 A;  4CGD A;  3QET A;  3QO9 A;  2RN2 A;  4CEQ A;  1QSY A;  5KGX A;  4DQR A;  4DSE A;  3HVR A;  4FVM A;  4KKO A;  3KTQ A;  5J2M A;  1IG9 A;  3I0R A;  3SI6 A;  4CJE A;  2E4L A;  3LP0 A;  4Z4I A;  4B9V A;  4N47 A;  3KLI A;  3AVF A;  3ZSX A;  4KV8 A;  3NGY A;  3BDP A;  4DSL A;  4C8M A;  3NH2 A;  1SL2 A;  4YNQ A;  1Z25 A;  1Q9X A;  1BI4 A;  2A1S A;  4R5P A;  1J9A A;  3AO2 A;  4ELV A;  1RTI A;  1ASV A;  4FJM A;  4CES A;  4OKE A;  3OYC A;  4FJG A;  4FJ7 A;  4FJ5 A;  4DQI A;  4GVM A;  1BQM A;  3L8B A;  4HTU A;  4RW7 A;  2YNG A;  4B08 A;  3ITH A;  1S5J A;  4C8K A;  4DSI A;  3CG7 A;  3JYT A;  1RTH A;  4CJF A;  4M3Y A;  4OKK A;  4HUG A;  3ZSV A;  2FBY A;  1YT3 A;  5KTQ A;  3L2R A;  1RBT A;  3V9W A;  3A2F A;  4O0J A;  5KRS A;  4CHP A;  4I9Q A;  3HO1 A;  1NK8 A;  4OGC A;  4DS4 A;  3RR7 A;  2F96 A;  3L2V A;  2ATQ A;  4KHW A;  4DFK A;  1LAW A;  4E7H A;  3NH0 A;  1WN7 A;  2LSN A;  3NBP A;  4FLX A;  4E7I A;  3HP9 A;  2YHA A;  4DTS A;  3TAQ A;  1NK6 A;  1HYS A;  3HM9 A;  1JKH A;  1S1W A;  1RCH A;  4FJH A;  4L8R B;  3AO5 A;  4B9U A;  1RDC A;  1CZB A;  4E0D A;  2IGI A;  4CEF A;  1KVB A;  3AA5 X;  2RF2 A;  1RBU A;  5K14 A;  4O0I A;  2D5R A;  5EU7 A;  3ZT3 A;  3SJJ A;  3RMC A;  3KD5 E;  1BGX T;  1C0M A;  1GOB A;  1SV5 A;  3DLG A;  3TAP A;  2HHV A;  4M45 A;  4E7J A;  2DY4 A;  2HVH A;  3M8S A;  3DOK A;  5SZT A;  2R7Y A;  4LY7 A;  1TKT A;  1IKV A;  1LW0 A;  3VQQ A;  1DTT A;  1TL3 A;  4CEZ A;  4AIL C;  4QOZ B;  5JS2 A;  2WON A;  1BL3 A;  3QEW A;  3IG1 A;  3SUN A;  1NJW A;  4EP4 A;  1KLN A;  4JS4 A;  2BGG A;  2YNH A;  1XI1 A;  4CFA A;  2KFZ A;  1NK9 A;  3HL8 A;  4DFJ A;  2XRI A;  5DMR A;  4KI4 A;  1ZBI A;  3KLF A;  3KKS A;  4W5O A;  3RRG A;  1JLF A;  3TAG A;  1RBS A;  1HRH A;  1T05 A;  2PZS A;  4Q5V A;  4M42 A;  1HQE A;  1N6Q A;  4DU3 A;  4FM0 A;  4DSK A;  1XWL A;  1JLQ A;  4AHC A;  5HLF A;  2BDP A;  1WSI A;  4CEA A;  4QCL A;  3DRR A;  2KW4 A;  4W5R A;  2HNZ A; 
#chains in the Genus database with same CATH topology
 2QXF A;  3L4I A;  5JLH A;  3HP6 A;  3KJV A;  2HMP A;  3AVM A;  1B9F A;  2IVP A;  1HJO A;  4ILG B;  2QWO A;  2Z1G A;  4O44 A;  3C65 A;  5C2D A;  5F2R A;  1D9D A;  4H4O A;  2YHY A;  1WSF A;  4G9Z A;  2ZGY A;  4CGJ A;  1Q86 O;  4O5B A;  4ID1 A;  3VEZ A;  3RSE A;  3BP8 A;  3O9S A;  2WTU A;  3OJU A;  2GEM A;  1UA0 A;  2HHH K;  1TKX A;  1QQN A;  1DKG D;  3V1Q A;  1VHX A;  4PL7 A;  3H3N O;  4GKJ K;  1VSE A;  3MN7 A;  3PO5 A;  2HF4 A;  1QVF M;  1KD1 O;  3ZSO A;  1VK0 A;  3OTO K;  4KB0 A;  4HVJ A;  4B9N A;  4DQP A;  4EHU A;  1KVC A;  2NNW A;  1I39 A;  2HHU A;  3FR0 A;  5B8H A;  1EWQ A;  3LWM A;  4M3Z A;  4WE1 A;  4Q0B A;  4CVN E;  4B8C A;  3KK3 A;  4E1M A;  3ZET A;  1C0G A;  3LM9 A;  1VSL A;  3LP1 A;  4H5R A;  4YOW A;  5AQG A;  2ZGZ A;  3VGL A;  4DF4 A;  4Z4E A;  4CI6 A;  4KTQ A;  2E1Z A;  2VCP A;  2YNF A;  4IEI A;  4GKK K;  1HYZ A;  1TK8 A;  4OLB A;  1MDU B;  5AFU A;  4B9T A;  1E4G T;  4MLE A;  4DQ8 A;  3K58 A;  3CPW M;  2A40 A;  4BWJ A;  1TAQ A;  3NE6 A;  4OPJ A;  1TYQ B;  1GLB G;  1NGI A;  4CJ7 A;  4HCC A;  1K6Y A;  3MN5 A;  1WSE A;  2YCH A;  4B3R K;  1Y64 A;  4CJP A;  4DSF A;  3SK3 A;  3NAE A;  4YOU A;  2E6M A;  4LF5 K;  1VQ5 N;  3DLB A;  4JI2 K;  3V1O A;  3M6G A;  3C0B A;  3OYN A;  4CJR A;  3VEV A;  3NHG A;  1RT1 A;  3SBT A;  1JL1 A;  1YUW A;  1JCE A;  2KFN A;  1OH6 A;  4FZZ A;  3CFO A;  1X9J A;  3VF6 A;  3G0Z A;  5FLX O;  1YF5 L;  5C24 A;  2VG7 A;  2VQF K;  4CJQ A;  3L6Q A;  3KK7 A;  3SCX A;  1U49 A;  3M8P A;  4K8X A;  3DXM A;  1HJR A;  3NGZ A;  4DV5 K;  3NF6 A;  4JRP A;  3P39 A;  2G8K A;  2F9T A;  4DHY A;  1NK5 A;  2P9I B;  3KLG A;  2DFF A;  3A5O C;  3N4Q A;  3EZW A;  4CIG A;  2OZS A;  3THY A;  1FKP A;  1SZ2 A;  3ID8 A;  2GBZ A;  1NJY A;  2XO7 A;  5I3U A;  4WQ5 C;  4YOX A;  1NK0 A;  3VQ4 A;  3VMF B;  3LAN A;  4O55 A;  3WXI A;  1K9M O;  3M3Z A;  3VQ7 A;  3L0Q A;  2DFH A;  4O4G A;  2QA4 N;  5HP1 A;  3SQ0 A;  1ZYQ A;  3RVC A;  4LSN A;  3OHR A;  4LF6 K;  1VQM N;  3OVN A;  4HCB A;  5AQP A;  2D1K A;  1U2V B;  1YJ9 N;  1NJX A;  2DFE A;  4CJL A;  1TGO A;  5CY4 A;  1W2B M;  2IOC A;  5J2N A;  3KK2 A;  3ZT4 A;  3K57 A;  3C6H A;  5ADX H;  1G15 A;  4BR0 A;  1VSF A;  5E41 A;  3DLE A;  3ZCM A;  2KTQ A;  1BA1 A;  3LP2 A;  1WOQ A;  4J2E A;  1IJJ A;  4A2B A;  4BR5 A;  2ETJ A;  1HPZ A;  1B92 A;  5F0X A;  2ZF5 O;  3HPH A;  2IDO A;  2VWJ A;  3THV A;  4H0O A;  5BN9 A;  3W3D A;  1RBV A;  3SUP A;  1S1V A;  1SKW A;  2Q2R A;  4AHR A;  3J7Y P;  3HM8 A;  3EYZ A;  1VQ8 N;  4DTP A;  3VTI A;  1Y97 A;  4FWS A;  1QHA A;  4KH6 A;  4Y1D A;  3ZT1 A;  4BGA A;  3QB0 A;  3E01 A;  4NYF A;  2FBV A;  4CED A;  1U47 A;  4KHQ A;  2WC9 A;  2HOE A;  3CI5 A;  4Y1C A;  2D0C A;  3TAF A;  4X66 K;  4CJS A;  3O9U A;  2FBT A;  4CJ4 A;  3HRG A;  3OYA A;  4UY8 O;  3EE8 A;  4DTM A;  2G8V A;  4EZ9 A;  3BF3 A;  1WBB A;  4TSX A;  4IFE A;  4Y0W A;  4DV2 K;  3OJS A;  4CHQ A;  4JI7 K;  1A5V A;  5CZ2 A;  1VQL N;  2B6A A;  3SQ2 A;  1S1T A;  2BAN A;  4B9Q A;  1GLL O;  3SNN A;  3O4W A;  4PKI A;  2RHK A;  1LW2 A;  5TKW A;  4DLG A;  1HKB A;  4DUZ K;  3VQ5 A;  5KQD A;  4K25 A;  3TR8 A;  1KQS M;  4E1N A;  2A3Z A;  1EO1 A;  2NUB A;  1QQC A;  3DLK A;  3TSQ A;  4JKF A;  4CEE A;  5HRR A;  1TYQ A;  1HMV A;  4FOI A;  3RMD A;  1SL0 A;  3SAH A;  3IFR A;  4FPB A;  4AQY K;  1L3T A;  5HRS A;  4V19 S;  2FF3 B;  1ZBF A;  3OBW A;  3PIO L;  1D5A A;  3CET A;  1Q18 A;  2RKI A;  4OPA A;  3T1H K;  1EXQ A;  3A5L C;  3H6E A;  5I42 A;  1U48 A;  4CF2 A;  2Z1H A;  3AV9 A;  1SS6 A;  4OLA A;  5FRN A;  2RE2 A;  4JI1 K;  4BRH A;  4H5T A;  4OPK A;  1XNQ K;  5LJV A;  3QLH A;  4FWP A;  3MXJ A;  3RMB A;  5C15 A;  1UWB A;  1KAY A;  4DKW A;  4F3O A;  3V9X A;  2IIR A;  3ULD A;  3HPG A;  1C1B A;  3VA3 A;  3DM2 A;  4MO5 A;  4KHN A;  1KRP A;  1VQN N;  4QS7 A;  3PUF A;  2P9I A;  4LC9 B;  1HNX K;  1U04 A;  4O8U A;  4OVL A;  3SYZ A;  4PUO A;  4DTJ A;  4BR4 A;  1U4B A;  2UXB K;  5IWA K;  4RWT A;  4KTZ A;  2OTL N;  1C0U A;  4BR2 A;  1IKY A;  3MEC A;  3NH1 A;  1NGB A;  4NCG A;  1S3X A;  2YV0 X;  5AQY A;  4FM2 A;  2CH5 A;  4LFC K;  3O80 A;  3QEP A;  1ESV A;  1HKG A;  3H45 C;  3K59 A;  1U2V A;  2BE2 A;  3O9Q A;  2F4V K;  4N56 A;  4GY2 B;  4ISG A;  4CGD A;  3CJ7 A;  3BF1 A;  5KGX A;  2UUA K;  4M7X A;  3CCS N;  1IG9 A;  4Z4I A;  4CJE A;  2WBN A;  4JN4 A;  4JK7 A;  4CZK A;  4KH5 A;  3ZSX A;  1WBD A;  4C8M A;  2GEL A;  2QWQ A;  4YY3 K;  3R6M A;  3U9Z A;  1ASV A;  1VQ7 N;  5M1N A;  4FJM A;  4FJ5 A;  4GVM A;  3P31 A;  2UYT A;  3J81 O;  1S5J A;  4FWL A;  2GTD A;  4C8K A;  4DSI A;  1BDG A;  1RTH A;  3V9W A;  2OTJ N;  5AQW A;  4CHP A;  4OGC A;  3L2V A;  3VEX A;  3CC7 N;  4BY9 C;  3E1Y A;  4NLC A;  4E7H A;  4K42 A;  5M1Q A;  4E7I A;  2YHA A;  1Z6R A;  3TAQ A;  3HM9 A;  3AO5 A;  5LY3 A;  1ZBH A;  2RF2 A;  1RBU A;  3CCR N;  3KD5 E;  3SJJ A;  1NGJ A;  4BC3 A;  4BRE A;  5SZT A;  4LF4 K;  2Q1N A;  3EN9 A;  3CMA N;  1BL3 A;  1NJW A;  4EP4 A;  3ENH A;  2FSJ A;  4CFA A;  2KFZ A;  3HL8 A;  4DFJ A;  2XRI A;  3BEX A;  4CBU A;  4W5O A;  3KLF A;  1JLF A;  2Q36 A;  1RBS A;  4IO9 L;  4A2A A;  4Q5V A;  1HQE A;  1N6Q A;  4DSK A;  1J6Z A;  3ENB A;  3DRR A;  4RW9 A;  1HNV A;  3CFP A;  4FJJ A;  3HK2 A;  3UE5 A;  4LF8 K;  1R59 O;  4DR6 K;  1NGC A;  2B5J A;  4DV0 K;  4YHH K;  3VQ8 A;  1KLM A;  4BWM A;  2NRW A;  2W40 A;  3RRH A;  1X3M A;  3DXK B;  3SQ1 A;  1D9F A;  4YOV A;  4CJ5 A;  4FCY A;  1B9D A;  3W0L A;  4CER A;  3VQB A;  3CM5 A;  1NLV A;  1NGF A;  2V7Y A;  1VQO N;  1QSS A;  1MWK A;  5BR8 K;  3K5L A;  4A61 A;  3ZET B;  1JLG A;  1YXQ A;  3OYF A;  4FJK A;  3CCE N;  1YI2 N;  3O5B A;  3FE1 A;  5CHI A;  4OX9 K;  3VA0 A;  3ZLJ A;  4ICL A;  3SJH A;  4DR1 K;  4FM1 A;  3C6T A;  4IWV A;  2HB5 A;  3AA4 A;  3L2W A;  4Z4H A;  2O8F B;  3K9K A;  3J80 O;  2P51 A;  5FRM A;  2HVI A;  2H3G X;  2HF3 A;  1GOA A;  4FW2 A;  1VSM A;  4GMJ B;  3EZ5 A;  5JIC A;  5AQM A;  1T8E A;  1WAJ A;  3QML A;  4FWO A;  3THX B;  1HQU A;  3RWU A;  1T03 A;  3AO1 A;  5GAH P;  1BIU A;  3KWG A;  4FOE A;  4YDU C;  1ATN A;  2Q0U A;  1KXP A;  1X1P A;  1FW6 A;  5AQK A;  4R79 A;  2W41 A;  3C7N B;  1YTU A;  4BDY A;  2KZZ A;  3R9P A;  4YFU A;  4Z4C A;  2F8S A;  3AVG A;  4B1W B;  4WQ4 A;  4K0K K;  4I2P A;  5GAG P;  4HTL A;  4DUY K;  4DQS A;  4JEP A;  2ZJP L;  1TVR A;  4RW6 A;  4PY5 A;  2FXU A;  1UOC A;  1X9W A;  3WQU A;  2QWM A;  3QES A;  3MN6 A;  3SBG A;  3BY5 A;  3MX5 A;  1JXE A;  1CXU A;  2HMI A;  2BUP A;  3V9S A;  3SPZ A;  1WUA A;  5E84 A;  4F8R A;  5C10 A;  1NOZ A;  1BIZ A;  3LDO A;  3KIO A;  2QEX N;  1D8Y A;  4IEE A;  3TAB A;  1HPM A;  4K8Z A;  3CJ1 A;  5AQF A;  2VG5 A;  3KLH A;  2Q3S A;  3IMX A;  2I7N A;  1N36 K;  1I3A A;  3H08 A;  5EOY A;  1RGI A;  3QIN A;  2VGM A;  4J2A A;  4JKE A;  2XHB A;  5J2P A;  1P8Z A;  4CCH A;  4PA1 A;  5T7B A;  3SPY A;  3WQT A;  3VEW A;  4CK2 A;  3DRS A;  3U6F A;  2D0B A;  3RR8 A;  4XEI A;  4RW4 A;  2AP1 A;  4JAX A;  3P1G A;  4KHU A;  3I33 A;  5KI6 A;  4CZF A;  4GNI A;  1RDB A;  3PSI A;  3VQA A;  5AFU H;  3I8D A;  4CF1 A;  2P9L B;  3GOI A;  4CFD A;  2X78 A;  1WSH A;  1N5Y A;  4CD3 A;  3AVH A;  4LSL A;  3Q7C A;  2YX6 A;  4AH9 A;  4JKC A;  4U7B A;  5HL7 L;  3DLL L;  3H1Q A;  3CC4 N;  1QE1 A;  3IAY A;  4NLB A;  3KWI A;  3OYI A;  1YTA A;  5EVZ A;  3DXK A;  5AQI A;  4F2R A;  1KTQ A;  3CFR A;  1VQ6 N;  3QFU A;  3QNN A;  4H0Y B;  3HOT A;  4ILH A;  3HOS A;  3U4L A;  2PAV A;  3SUO A;  2VQE K;  2DPN A;  4KHP K;  3VQ9 A;  3TU5 A;  3WNE A;  3RTV A;  1GLF O;  3ISN C;  4OJR A;  1NGG A;  1KVA A;  4UQG A;  2Z1J A;  4RW8 A;  1TV6 A;  2O8F A;  2XY8 A;  3EKU A;  4M3T A;  1XHX A;  1D4X A;  1EP4 A;  1ILY A;  4L3Q A;  4JD2 B;  4DV3 K;  5AQU A;  3D2E B;  4CHY A;  3LAK A;  1NM1 A;  3ID6 A;  4OKJ A;  3THX A;  2JLE A;  3CIP A;  3E9P A;  2GUP A;  2G8U A;  1V4T A;  5E26 A;  3ATV A;  3G71 N;  2YHW A;  2HBM A;  3SUQ A;  4M41 A;  4IG0 A;  4JKD A;  1NGD A;  3AVC A;  4KI6 A;  1OVQ A;  2F8T A;  5CR4 A;  4KTW A;  2DTU A;  3A8Y A;  2OPP A;  2GWK A;  1RT6 A;  3C7N A;  1E3M A;  1M1K O;  3LL3 A;  3P38 A;  3CJC A;  4YOR A;  3CQY A;  4ILJ A;  4Z4F A;  4MLH A;  4JV5 K;  1S9E A;  3CXC M;  3KLE A;  1BG3 A;  1KFD A;  1O13 A;  4Z4G A;  3QFP A;  2QTD A;  4DU1 A;  4BVO A;  3ZEU B;  4YOY A;  4JKG B;  4H5N A;  4AM6 A;  4MO4 A;  5LJW A;  4OGE A;  4W5N A;  4MDA A;  3MED A;  2P9P B;  3EKS A;  3VQP A;  3TAN A;  1X9M A;  3HZ6 A;  3O9R A;  4DR4 K;  4QAG A;  4B3M K;  1NU0 A;  4CBW A;  1FKO A;  1I94 K;  3HYF A;  1N33 K;  2A1R A;  2ZJR L;  4FJN A;  1ZBL A;  1ZBU A;  2EX3 A;  3I55 N;  3H1V X;  1VSD A;  4A5A A;  1TUU A;  4KBO A;  4B9L A;  1BHL A;  2NRX A;  2OPS A;  4FZX C;  3QIO A;  2OYQ A;  1NGE A;  2QWL A;  3T3F A;  1IBK K;  3TSU A;  4DS5 A;  3NVK A;  4XH5 A;  4DQQ A;  1S6Q A;  4H03 B;  3V81 A;  4WQ5 A;  3LDP A;  4XH4 A;  1IO2 A;  1Z05 A;  1BCO A;  4CFB A;  3QEX A;  2P9L A;  2W6K A;  4J8F A;  2J4R A;  3HVT A;  2HBL A;  3F9K A;  1DTQ A;  2E8A A;  3Q7B A;  4BRQ A;  1NKB A;  3N4P A;  4IFY A;  3OYH A;  3J7Z O;  3C94 A;  3K0S A;  4C8L A;  3AGR A;  2W42 A;  2Q31 A;  3T1Y K;  2FC0 A;  3AA2 A;  3AO4 A;  1MU2 A;  4MQ3 A;  3NMU A;  4FWM A;  4NXN K;  2ZD1 A;  3F5T A;  3J8A A;  1RFQ A;  3HI0 A;  2RN2 A;  3F2K A;  1QSY A;  4DQR A;  5J2M A;  3I0R A;  2E4L A;  1RDW X;  3O08 A;  4B9V A;  5JLF A;  1FJG K;  1KC8 O;  3BDP A;  4JKH A;  4CZL A;  3NH2 A;  1SL2 A;  1Z25 A;  1S72 N;  3TTF A;  4IXC A;  1RTI A;  5LL6 Z;  4QS8 A;  4OKE A;  4A62 A;  3OYC A;  4FJ7 A;  4DQI A;  3SLC A;  5EY4 A;  5F1X A;  1BQM A;  2BH1 A;  2YNG A;  3ITH A;  1XMQ K;  1VQK N;  4OKK A;  3ZSV A;  3L2R A;  1RBT A;  3A2F A;  5KRS A;  3SAG A;  4DS4 A;  1VAZ A;  2ATQ A;  3D6R A;  5KPT A;  4DFK A;  3C6A A;  4LFA K;  4FWN A;  3HP9 A;  2QI2 A;  4E0D A;  4CEF A;  3AGK A;  3RMC A;  1GOB A;  1T44 A;  3DLG A;  2DY4 A;  2HVH A;  3M8S A;  1HLU A;  3DOK A;  2R7Y A;  2KHO A;  2HST A;  4JD2 A;  3VQQ A;  1IKV A;  1K8A O;  3D2E A;  1TL3 A;  3IDH A;  4QOZ B;  4GV9 A;  1MA9 B;  2WON A;  3QEW A;  1QQO A;  2YNH A;  1XI1 A;  2UXD K;  3I56 N;  5DMR A;  5A2Q O;  1ZBI A;  3KKS A;  3RRG A;  1W97 L;  2F7T A;  3D7E O;  4M42 A;  1IBM K;  4AHC A;  5HLF A;  2BDP A;  4QCL A;  2KW4 A;  1OH7 A;  1XNR K;  5BRD A;  1TK0 A;  3CJA A;  3I0S A;  2A41 A;  3MCP A;  1CZA N;  4EFH A;  4CZM A;  2BTF A;  2XY7 A;  4PWD A;  4DR7 K;  2O4I A;  3ZEU A;  4CJU A;  5KRT A;  4KRE A;  1QTM A;  1RTJ A;  1LWF A;  4JKG A;  3V9U A;  5HRP A;  3QIP A;  2KLA A;  4CF9 A;  3AY9 A;  3OYG A;  2P9P A;  2FSN A;  4U67 L;  3LZJ A;  3TAR A;  3EO3 A;  4KRF A;  4WFB L;  4MDB A;  1T6D A;  1EWR A;  3TAM A;  4FK4 A;  2ZWH A;  1YVU A;  3QER A;  4FW1 A;  4B9M A;  3V6D A;  2I7P A;  2HW3 A;  2E2P A;  5M1O A;  1K73 O;  1U6Z A;  2UU9 K;  1NGA A;  4JK9 A;  5J1E A;  4DLE A;  2NRZ A;  1IG8 A;  4BDP A;  3AAR A;  4C23 A;  4DR3 K;  3KK1 A;  4WF9 L;  4BE0 A;  5BPL A;  2QK9 A;  4JI8 K;  4JNE A;  4FXD A;  2WUS A;  1JLC A;  4BG9 A;  3QNO A;  2P5G A;  2YI1 A;  1ATS A;  1VSI A;  5LMU K;  4Z94 A;  2JGU A;  2PYJ A;  3R8E A;  4DTN A;  1JLA A;  2E6L A;  4OO1 J;  4AHU A;  3GG4 A;  4B1Y B;  4M63 C;  2P9S B;  3LM2 A;  2D0O A;  5GAD P;  1VRT A;  1BUP A;  1RT3 A;  2YJF A;  1LV5 A;  3AAQ A;  3AVI A;  1K8K B;  1JLE A;  4I7F A;  1YAG A;  3KVG A;  1IKX A;  4EP5 A;  2F9W A;  1HNI A;  5FDL A;  4FLT A;  3ZSZ A;  2AA4 A;  5GIN A;  4WCE L;  4BR9 A;  4FVU A;  2IC3 A;  4DV1 K;  2OA8 A;  4WFA L;  2X6N A;  1GLA G;  3QIC A;  2OPR A;  4X62 K;  2VG6 A;  4FLY A;  3V4I A;  4QS9 A;  2HHT A;  1CZ9 A;  3OA9 A;  3NFA A;  3ZX3 A;  3B8A X;  3MMV A;  3AVA A;  3H46 O;  3MAQ A;  3DI6 A;  3CHW A;  3I8B A;  4IG3 A;  2RPI A;  3EE9 A;  4CF8 A;  3G10 A;  3LZI A;  1LAV A;  4AHS A;  2G8F A;  5HRN A;  4CHO A;  5M1F A;  4BC5 A;  4WFN L;  2OPQ A;  1S1U A;  2Y1J A;  4H0X B;  3OYD A;  1YHQ N;  3B6P A;  1UA1 A;  4W5T A;  2O8E B;  4MFB A;  3AVK A;  3DMJ A;  2GV9 A;  1GLD G;  3P83 D;  1REV A;  3PSF A;  4DB3 A;  5AQR A;  4G1Q A;  1HNW K;  1V4S A;  2WOM A;  4CJT A;  3ZT0 A;  2ZE2 A;  2OZM A;  3HJF A;  4Z0U A;  5AQT A;  1H1V A;  3V1R A;  3LPU A;  4FJI A;  2HHS A;  3E66 A;  2PYL A;  3HT3 A;  1X9S A;  1GLC G;  4CGF A;  4M3X A;  1X3N A;  1KAZ A;  1VSJ A;  3VQD A;  3L2U A;  2JWK A;  4LD0 A;  1WAF A;  4BE2 A;  4B3S K;  2ASM A;  4EAH D;  3AO3 A;  2QKB A;  5CYQ A;  4CW7 B;  3THW B;  4DR5 K;  4F3T A;  3UKR B;  4KFB A;  1BI4 B;  3DOL A;  3WXL A;  4N76 A;  3IKM A;  5AQH A;  4C8O A;  4DTX A;  3S3N A;  3FZK A;  3OYK A;  1HUX A;  4DF8 A;  1J5O A;  3OYL A;  2P9U B;  3GL1 A;  4FWQ A;  4CZJ A;  3OS2 A;  4BG8 A;  1LOT B;  5C42 A;  3HPO A;  1NJZ A;  3C95 A;  4JHD B;  3OY9 A;  1NKC A;  2OCE A;  4IOC L;  3LDN A;  3MK6 A;  2ITG A;  2EWS A;  3TTC A;  3J7A P;  1Q8I A;  1LWC A;  3M8R A;  4GVE A;  3VF4 A;  3WXJ A;  4BAC A;  3O4N A;  4IFV A;  3QEV A;  3PV8 A;  2XY6 A;  1OVY A;  1YVN A;  4HUF A;  3OYM A;  4DV7 K;  4DR2 K;  1BOT O;  4YDU A;  3O1B A;  2D4W A;  2ASP A;  2W6L A;  1N8R O;  4ELU A;  4IDK A;  4FWK A;  2PFU A;  3TAE A;  2P9S A;  2UXC K;  1SKR A;  5KQ8 A;  2VWB A;  4JI5 K;  4FYD A;  5EXW A;  2Z1I A;  4WYB A;  3LDL A;  3FGU A;  3AVL A;  4AHT A;  2P9N B;  1K8K A;  4BDZ A;  1C1C A;  4BRK A;  3ZYY X;  4CEC A;  1NK7 A;  5C0Y A;  3IS9 A;  1J54 A;  5AQO A;  1YIT N;  4RG8 A;  4CGI A;  3GBT A;  2O8C B;  4B1V A;  3MX2 A;  3NGI A;  4FPA A;  1DT9 A;  3LP3 A;  1L3S A;  2QM1 A;  2IS3 A;  5KPZ A;  1NWK A;  3MXI A;  1RT7 A;  3LWL A;  1S1X A;  2V51 B;  3ZSW A;  1LWE A;  4FJ8 A;  4JI0 K;  3LPT A;  4CZH A;  1T7P A;  4F4K A;  5BPN A;  2O4G A;  2G8H A;  4CBX A;  1WLJ A;  3D0P A;  5AQV A;  3K5O A;  4DSJ A;  3RMA A;  4FK0 A;  5J2Q A;  1GLJ O;  2V7Z A;  4ZHR A;  5AQL A;  4OPH A;  1OKJ A;  2HBJ A;  4JS5 A;  3MWP A;  2VWK A;  4FLW A;  4H0T B;  3GDQ A;  1DLO A;  2O8E A;  2EHG A;  4CF0 A;  3AA3 A;  1WNS A;  3MN9 A;  3VQ6 A;  1VSK A;  3O3F A;  1Z26 A;  3LAM A;  2KZM A;  2HHW A;  3LDQ A;  1IV0 A;  1ASU A;  2QKK A;  5C25 A;  3D45 A;  4FJ9 A;  4BR7 A;  2FBX A;  1A5X A;  5KGW A;  4LF7 K;  2P9K B;  5ELZ A;  4KO0 A;  4A5B A;  1R0A A;  1BCM A;  4JLH A;  3SZ2 A;  3S41 A;  3K9J A;  4B3O A;  1HNZ K;  5BPM A;  1ASW A;  4E89 A;  3CD6 N;  3JSM A;  2VGN A;  5BRH A;  1YJW N;  1NK4 A;  3NF9 A;  4FLV A;  4H5V A;  3OS0 A;  3FZM A;  4N41 A;  1GOC A;  3T19 A;  3FFK B;  4BRL A;  3QET A;  1LCU A;  3DAW A;  4CEQ A;  4FVM A;  2E2O A;  3VTH A;  3SI6 A;  5BN8 A;  4E1J A;  2E88 A;  3AVF A;  4FO0 A;  3NGY A;  1HR0 K;  4DSL A;  3THW A;  3UKR A;  4BC2 A;  1BI4 A;  4PKG A;  2A1S A;  4EIA A;  3AO2 A;  4ELV A;  3VF2 A;  1G99 A;  4I6M B;  4FJG A;  3AAP A;  4A59 A;  4A57 A;  3L8B A;  4HTU A;  1VQ4 N;  4B08 A;  2O8D B;  3JS6 A;  4M7Y A;  4CJF A;  5FPD A;  1YT3 A;  5KTQ A;  2P9U A;  1E4F T;  3R1X A;  5C12 A;  4I9Q A;  1NK8 A;  4JHD A;  3RR7 A;  2F96 A;  3MCA B;  4FJX A;  3NH0 A;  1WN7 A;  3ENO A;  3EL2 A;  1JKH A;  1RCH A;  4B1U B;  4B9U A;  1CZB A;  3ZX0 A;  4O0I A;  1KVB A;  3AA5 X;  2QXL A;  2D5R A;  1JCG A;  3ZT3 A;  3VEY A;  1BGX T;  1C0M A;  1SV5 A;  3TAP A;  2HHV A;  4M45 A;  4E7J A;  4B1X B;  4LY7 A;  2YHX A;  1LW0 A;  5EX5 A;  1DTT A;  3BZK A;  4CEZ A;  4AIL C;  5JS2 A;  4B1Z A;  3IG1 A;  3SUN A;  4JS4 A;  3QBW A;  3TTD A;  3WXK A;  5AZJ B;  3P4I A;  4KI4 A;  1T05 A;  3TAG A;  2PZS A;  1HRH A;  4FM0 A;  3CC2 N;  4CEA A;  4IOA L;  1ATR A;  4ELT A;  4W5R A;  1KLN A;  3AVN A;  1OH8 A;  3S3O A;  4IJN A;  3P5J A;  3PLA A;  3ZT2 A;  3D2F B;  3MEG A;  5FRO A;  1L5U A;  3B6O A;  4DV4 K;  4FWR A;  3K2P A;  3JAM O;  2P9N A;  3HTV A;  4HWI A;  2PY5 A;  4JI3 K;  2KKZ A;  3NVM A;  5LMN K;  1F21 A;  1CLQ A;  5HRO A;  3KZB A;  3CM6 A;  2B4J A;  3K5N A;  3CF5 L;  2O8C A;  3O4Q A;  5TKY A;  3ZSQ A;  1OH5 A;  1J53 A;  2YNI A;  3WNH A;  5CE3 A;  3U9D A;  4DFM A;  4DFP A;  4LH5 A;  4RCH A;  3T69 A;  3M8Q A;  2QWN A;  3HST B;  3VOV A;  4DTR A;  3DWL A;  3SV3 A;  4E7L A;  3VPZ A;  3ASM A;  3OS1 A;  5HBM A;  2XY5 A;  1L3U A;  3VET A;  4E7K A;  4CGG A;  3SV4 A;  3OYE A;  2P1J A;  1KCF A;  4CIE A;  3VEO A;  1YIJ N;  2KQ2 A;  5DK5 A;  2X74 A;  3NDK A;  1EX4 A;  2D0A A;  1XHZ A;  4LF9 K;  1C6V A;  2ZQB A;  3SAF A;  3WEE B;  3EY1 A;  3O8M A;  4K43 A;  4YOT A;  2A6A A;  3A0I X;  2JWL A;  3CQ8 A;  2UUB K;  3KHY A;  3DYA A;  4ID5 A;  5M1K A;  5JVG L;  1EET A;  3VQC A;  1KFS A;  5CYM A;  4PKH A;  3QEI A;  4X65 K;  4ZTF A;  4CEO A;  3L3V A;  3O6W A;  5JS1 A;  2P9K A;  3DJC A;  5KPR A;  3L4Q A;  4XH1 A;  4NXM K;  4CGH A;  4DU4 A;  1S6P A;  4DTO A;  1QZ6 A;  5JMV A;  2HND A;  1SKS A;  1W0H A;  4AHV A;  1JJ2 M;  3FLC O;  3ZX2 A;  3E9L A;  4J2D A;  3NCI A;  4KB1 A;  1EQY A;  2OAN A;  3CPE A;  4CE9 A;  4FLZ A;  4JYA K;  3ZSY A;  3M5R A;  3CJB A;  4XIU A;  1HX1 A;  4AF1 A;  1W7A A;  2Q97 A;  2ITM A;  1IKW A;  5GIP A;  4X64 K;  4E3S A;  2FF6 A;  4PHT X;  1O1W A;  1TKZ A;  4B8A B;  3H3O B;  4CFC A;  4J2B A;  2ZM6 K;  3FZH A;  4BRD A;  1VSH A;  5H1S Q;  4CZG A;  5ADX A;  4I2Q A;  3WNF A;  4I6M A;  2X6S A;  4BRI A;  3S3M A;  1VRU A;  1S22 A;  4DG1 A;  5AZI B;  4BRF A;  2O8D A;  5MLC Q;  3TWH A;  4JRQ A;  3VEN A;  3L2Q A;  1ZBS A;  3MDQ A;  4BRC A;  1RIL A;  1VQ9 N;  3VGM A;  3M1F A;  4CEB A;  3V9Z A;  3VN5 A;  4HUE A;  3O3H A;  3JXU A;  4JKB A;  3MEE A;  1KAX A;  4CK3 A;  3ALY A;  1U45 A;  3OW2 M;  2P5O A;  1RDU A;  1CXQ A;  4FK2 A;  3S9H A;  2YJE A;  1FXX A;  3NF7 A;  3UIQ A;  3DLR A;  2CH6 A;  3CME N;  1SAZ A;  4H8K A;  3PX6 A;  2G8W A;  2NZT A;  1XUP O;  5AZJ A;  4DWI A;  2E5L K;  5HOO A;  3O9T A;  2HHX A;  4NYN A;  3ATU A;  1QS4 A;  4ZTJ A;  1W9H A;  2HNY A;  1IBL K;  5I9E B;  1SL1 A;  4DTU A;  1QSL A;  3G25 A;  3VQE A;  5BR9 A;  4FJL A;  2YKM A;  3D2F A;  1EKE A;  2CGK A;  1RTD A;  4CJV A;  4NO7 A;  1J5E K;  4IZ9 A;  4FSV A;  5FPM A;  3DLH A;  5CZ1 A;  4CJ3 A;  2HHQ A;  3CYM A;  5D3G A;  2NRT A;  1WSG A;  4CK1 A;  1BU6 O;  4EHT A;  3BGR A;  2D0P A;  1NKE A;  3CCV N;  3QBX A;  1MWM A;  4H0P A;  4GV3 A;  1S9G A;  2O8B B;  3R3L A;  4ISF A;  5AQS A;  4DV6 K;  3QDK A;  4H4M A;  4CHN A;  2AJQ A;  4IBN A;  5BRF A;  3TSP A;  3BUZ B;  4NB4 A;  3U3Y A;  2A42 A;  2YKN A;  1KSP A;  3BZC A;  4CIF A;  5AQN A;  4BC4 A;  1DEJ A;  4N5S A;  1TK5 A;  2GX9 A;  1NOY A;  2FLO A;  3WUH A;  4ISE A;  2E1Y A;  3WNG A;  3OYB A;  1XC9 A;  2NRR A;  3CCL N;  1RDD A;  3AVB A;  2YHB A;  4M3R A;  4BQZ A;  3FFI A;  1JXB A;  4FL9 A;  4FLU A;  3K5M A;  4B9S A;  2HBK A;  4M3W A;  1UAX A;  1L3V A;  5GIO A;  3WEE A;  3TI0 A;  3CCJ N;  1DGK N;  1ZC6 A;  3C6U A;  4B3T K;  4JI4 K;  3F73 A;  4NCA A;  1NGH A;  4H5W A;  3MXM A;  2G8I A;  2FSK A;  1M90 O;  2CGJ A;  3U3G A;  4IDH A;  5DM7 L;  1C0T A;  2E20 A;  3O1W A;  3ULE B;  3A5N C;  1QZ5 A;  4W5Q A;  4AM7 A;  3UKU B;  4K41 A;  4RTF D;  4CZI A;  1WSJ A;  4DCH A;  1RT4 A;  1N32 K;  1IH7 A;  3E9O A;  1NMD A;  5AQZ A;  4BQL A;  1BWF O;  4KHY A;  2IAJ A;  4O8K A;  1BIS A;  4C8N A;  4IKF A;  1SQK A;  4NCB A;  4BE1 A;  4HHT A;  1ITG A;  1JLB A;  2Q0R A;  2IVN A;  5C2F A;  1A5W A;  3ZSR A;  1C0F A;  4M3U A;  1XC3 A;  4I9L A;  1BA0 A;  4LH4 A;  1Q7Y O;  3CCU N;  2E2N A;  3KD1 E;  1NNE A;  1HYV A;  2QWP A;  2Y1I A;  1TKD A;  2GUI A;  2QW9 A;  3HXM A;  1WB9 A;  1RDA A;  2NRH A;  4EZ6 A;  3U8X A;  3FZF A;  4KHS A;  4BRO A;  3RSE B;  1TAU A;  1N34 K;  3F9M A;  5AQJ A;  4JI6 K;  3PIP L;  4IJA A;  3PX0 A;  4KPY A;  5M1P A;  4E19 A;  1RBR A;  5SWM A;  1Q9Y A;  5AZI A;  4KAZ A;  3FZL A;  4CJW A;  5GAE P;  5DM6 L;  2GWJ A;  3MWT A;  3DRP A;  3LDS A;  3KKR A;  1C1A A;  1XQS C;  3HSC A;  3L3U A;  4PQU A;  3A5M C;  5FPN A;  1SUQ A;  1P90 A;  2ASO A;  3NF8 A;  4DMN A;  3VER A;  3PX4 A;  3O3G A;  3G6E N;  1NBW A;  3CJ9 A;  4JKA A;  3SMS A;  4BRP A;  5JVH L;  3LAL A;  1TL1 A;  1QQM A;  3PO4 A;  1RNH A;  4BGB A;  5FPE A;  4BRG A;  1GLE G;  1T6C A;  1QHT A;  1QVG M;  2CGL A;  4BRN A;  4O5F A;  1NMN A;  1JL2 A;  3VGK A;  1VQP N;  2I5J A;  3PY8 A;  3SMP A;  3EEQ A;  4CHZ A;  5IT9 O;  3IRX A;  3T1A A;  1NJI O;  3T7Z A;  1BQN A;  4BRA A;  1TUY A;  4FZY A;  3G4S N;  1RT5 A;  1FK9 A;  3AVJ A;  4CJK A;  4BRM A;  3OYJ A;  3SQ4 A;  4GW6 A;  3VES A;  4PL8 A;  4CZE A;  1RT2 A;  3CQX A;  4WQ4 C;  4C1N I;  3QO9 A;  3UB5 A;  5BRE A;  4DSE A;  3HVR A;  4KKO A;  3KTQ A;  3LP0 A;  4IOX A;  4N47 A;  2UUC K;  5AJ3 K;  3KLI A;  4KV8 A;  2WFB A;  4GV6 A;  4YNQ A;  1Q9X A;  3HBT A;  2IVO A;  5AQX A;  4R5P A;  1J9A A;  2O8B A;  2ZJQ L;  3CCM N;  4CES A;  4RW7 A;  2VYP A;  3CG7 A;  3JYT A;  2PBD A;  1Q81 O;  4M3Y A;  4HUG A;  2FBY A;  4O0J A;  3GE1 A;  3DXM B;  3HO1 A;  1JCF A;  3IUC A;  1YJN N;  4KHW A;  4KH4 A;  2V52 B;  1T3V A;  1LAW A;  2NLX A;  2LSN A;  3NBP A;  4FLX A;  4DTS A;  1NK6 A;  1HYS A;  1S1W A;  1NG9 A;  1HKC A;  4FJH A;  4L8R B;  4C1N K;  1RDC A;  2IGI A;  4LFB K;  5K14 A;  3OBY A;  4IO8 A;  5EU7 A;  1Q82 O;  2A5X A;  3THY B;  4BVP A;  3WXM B;  1XMO K;  1TKT A;  4H0V B;  2BGG A;  3WT0 A;  2E2Q A;  1NK9 A;  5AR0 A;  2NRV A;  4JK8 A;  3CER A;  1BO5 O;  4CD1 A;  4DU3 A;  4F9O A;  3ULE A;  1XWL A;  5AQQ A;  1JLQ A;  2QWR A;  3CCQ N;  1WSI A;  1ZXO A;  3UKU A;  4F2S A;  2HNZ A;  3TPQ A; 
#chains in the Genus database with same CATH homology
 2QXF A;  4RW9 A;  1HNV A;  3AVN A;  3CFP A;  3S3O A;  4FJJ A;  3HK2 A;  3P5J A;  3ZT2 A;  3MEG A;  5FRO A;  1L5U A;  3B6O A;  3HP6 A;  2HHT A;  1TK0 A;  3K2P A;  3I0S A;  2PY5 A;  3KJV A;  3AVM A;  1B9F A;  1F21 A;  1CLQ A;  2B5J A;  2Z1G A;  3VQ8 A;  5HRO A;  3CM6 A;  1KLM A;  2XY7 A;  4PWD A;  4O44 A;  2B4J A;  3K5N A;  4BWM A;  2O4I A;  3O4Q A;  3RRH A;  1D9D A;  4H4O A;  4CJU A;  3ZSQ A;  3SQ1 A;  5KRT A;  1J53 A;  2YNI A;  3WNH A;  1WSF A;  1D9F A;  4CJ5 A;  1RTJ A;  1LWF A;  1QTM A;  4KRE A;  4FCY A;  1B9D A;  3V9U A;  4CER A;  4DFM A;  4DFP A;  4LH5 A;  5HRP A;  3QIP A;  4CGJ A;  4FJX A;  3M8Q A;  3VQB A;  3CM5 A;  4CF9 A;  3OYG A;  4O5B A;  1QSS A;  3HST B;  4ID1 A;  4DTR A;  3K5L A;  3OJU A;  3SV3 A;  4E7L A;  1JLG A;  3ASM A;  3LZJ A;  3TAR A;  3OYF A;  1UA0 A;  4FJK A;  4KRF A;  3OS1 A;  5HBM A;  2XY5 A;  1TKX A;  4FK4 A;  3TAM A;  1L3U A;  4E7K A;  3VA0 A;  1YVU A;  4CGG A;  3V1Q A;  4FW1 A;  3QER A;  4B9M A;  3SV4 A;  3OYE A;  2P1J A;  1KCF A;  4CIE A;  3V6D A;  2KQ2 A;  2HW3 A;  5DK5 A;  1VSE A;  2X74 A;  4ICL A;  3NDK A;  1EX4 A;  4FM1 A;  2D0A A;  3C6T A;  3PO5 A;  1XHZ A;  2HB5 A;  3AA4 A;  5J1E A;  4DLE A;  3L2W A;  4Z4H A;  3ZSO A;  1VK0 A;  1C6V A;  2ZQB A;  4BDP A;  2P51 A;  3EY1 A;  4KB0 A;  5FRM A;  2HVI A;  4FW2 A;  1GOA A;  4HVJ A;  3KK1 A;  4BE0 A;  4B9N A;  1VSM A;  4DQP A;  4GMJ B;  2QK9 A;  1KVC A;  3CQ8 A;  1I39 A;  3EZ5 A;  4FXD A;  2HHU A;  3DYA A;  1JLC A;  3LWM A;  3QNO A;  1T8E A;  1WAJ A;  4ID5 A;  2P5G A;  4M3Z A;  1EET A;  3VQC A;  1VSI A;  4WE1 A;  1KFS A;  5CYM A;  1HQU A;  4Q0B A;  2JGU A;  2PYJ A;  3RWU A;  1T03 A;  4B8C A;  3KK3 A;  3AO1 A;  4E1M A;  1JLA A;  2E6L A;  4DTN A;  3QEI A;  4ZTF A;  4AHU A;  4CEO A;  1VSL A;  1BIU A;  3L3V A;  3LP1 A;  5JS1 A;  1X1P A;  4DF4 A;  4Z4E A;  4KTQ A;  1VRT A;  1RT3 A;  1LV5 A;  4CGH A;  4DU4 A;  1YTU A;  4BDY A;  2YNF A;  2KZZ A;  3AVI A;  1HYZ A;  1S6P A;  4DTO A;  1TK8 A;  4OLB A;  4YFU A;  4Z4C A;  2F8S A;  4B9T A;  2HND A;  3AVG A;  1JLE A;  4I7F A;  3K58 A;  1SKS A;  1W0H A;  4AHV A;  4I2P A;  1IKX A;  4BWJ A;  1TAQ A;  4J2D A;  4EP5 A;  3NCI A;  4DQS A;  1HNI A;  5FDL A;  3NE6 A;  4FLT A;  4KB1 A;  4OPJ A;  3ZSZ A;  4HCC A;  1TVR A;  4RW6 A;  4PY5 A;  1K6Y A;  1WSE A;  1UOC A;  1X9W A;  4CE9 A;  4CJP A;  4DSF A;  4FLZ A;  2IC3 A;  3NAE A;  3ZSY A;  3QES A;  2OA8 A;  4XIU A;  2X6N A;  1JXE A;  1CXU A;  2OPR A;  2HMI A;  2E6M A;  1IKW A;  2VG6 A;  4E3S A;  3DLB A;  3V1O A;  3V9S A;  3SPZ A;  4FLY A;  3OYN A;  3V4I A;  4F8R A;  1O1W A;  1TKZ A;  4B8A B;  1CZ9 A;  4CFC A;  4CJR A;  3NHG A;  1NOZ A;  1BIZ A;  4J2B A;  3KIO A;  3NFA A;  1RT1 A;  1VSH A;  1JL1 A;  1D8Y A;  3TAB A;  4K8Z A;  2KFN A;  4FZZ A;  4I2Q A;  3WNF A;  3CFO A;  2X6S A;  2VG5 A;  3S3M A;  1VRU A;  4DG1 A;  3KLH A;  3AVA A;  2Q3S A;  3G0Z A;  3U6F A;  5C24 A;  3MAQ A;  3DI6 A;  1I3A A;  2VG7 A;  3H08 A;  3TWH A;  3RR8 A;  4JRQ A;  4IG3 A;  3QIN A;  4CJQ A;  3SCX A;  1U49 A;  3L2Q A;  2RPI A;  3M8P A;  4J2A A;  2XHB A;  4K8X A;  4CF8 A;  5J2P A;  3G10 A;  1HJR A;  1RIL A;  3NGZ A;  4CCH A;  3NF6 A;  1LAV A;  4PA1 A;  4AHS A;  5T7B A;  3LZI A;  5HRN A;  4CEB A;  4CHO A;  4JRP A;  3SPY A;  2G8F A;  3V9Z A;  2G8K A;  1NK5 A;  3VN5 A;  3DRS A;  2OPQ A;  4CK2 A;  2D0B A;  3O3H A;  1S1U A;  3KLG A;  4HUE A;  3MEE A;  4CK3 A;  3OYD A;  3ALY A;  4RW4 A;  2Y1J A;  1UA1 A;  3B6P A;  1U45 A;  4W5T A;  2DFF A;  3P1G A;  4MFB A;  3AVK A;  1CXQ A;  4CIG A;  4KHU A;  3DMJ A;  4FK2 A;  2GV9 A;  2OZS A;  5KI6 A;  3S9H A;  3P83 D;  1RDB A;  1FXX A;  1FKP A;  3NF7 A;  1REV A;  3UIQ A;  3VQA A;  2GBZ A;  3DLR A;  3I8D A;  4G1Q A;  4CF1 A;  1NJY A;  2XO7 A;  5I3U A;  2WOM A;  4CJT A;  4CFD A;  3ZT0 A;  2ZE2 A;  4H8K A;  2OZM A;  2X78 A;  1WSH A;  4Z0U A;  3PX6 A;  3VQ4 A;  1NK0 A;  1N5Y A;  3V1R A;  2G8W A;  3LAN A;  3LPU A;  4DWI A;  4O55 A;  4FJI A;  2HHS A;  3AVH A;  2HHX A;  2PYL A;  3VQ7 A;  4NYN A;  2DFH A;  1QS4 A;  4LSL A;  4O4G A;  1W9H A;  2HNY A;  5HP1 A;  3SQ0 A;  4ZTJ A;  1ZYQ A;  3HT3 A;  4LSN A;  1SL1 A;  4DTU A;  1QSL A;  4AH9 A;  1X9S A;  3OVN A;  4HCB A;  4CGF A;  3VQE A;  4M3X A;  1NJX A;  2DFE A;  4CJL A;  2YKM A;  4FJL A;  1EKE A;  1RTD A;  4CJV A;  1VSJ A;  1TGO A;  5CY4 A;  2IOC A;  3VQD A;  3L2U A;  5J2N A;  5CZ1 A;  1QE1 A;  3DLH A;  4CJ3 A;  3KK2 A;  3ZT4 A;  3K57 A;  3CYM A;  3IAY A;  2HHQ A;  4LD0 A;  5D3G A;  1WAF A;  1G15 A;  4BE2 A;  1WSG A;  1VSF A;  5E41 A;  3DLE A;  3ZCM A;  2KTQ A;  4CK1 A;  3AO3 A;  3OYI A;  2QKB A;  1YTA A;  3LP2 A;  3BGR A;  4J2E A;  5CYQ A;  1NKE A;  4F3T A;  4KFB A;  2ETJ A;  1BI4 B;  4F2R A;  1HPZ A;  1B92 A;  1KTQ A;  1S9G A;  3CFR A;  3DOL A;  4N76 A;  3HPH A;  2IDO A;  4C8O A;  2VWJ A;  3QNN A;  4DTX A;  3THV A;  4H4M A;  4CHN A;  3S3N A;  2AJQ A;  4IBN A;  1RBV A;  3SUP A;  3OYK A;  1S1V A;  1SKW A;  4AHR A;  4DF8 A;  3U3Y A;  1J5O A;  3EYZ A;  3OYL A;  2YKN A;  1KSP A;  4DTP A;  4CIF A;  4N5S A;  1TK5 A;  3SUO A;  3OS2 A;  5C42 A;  3HPO A;  1Y97 A;  3VQ9 A;  1NJZ A;  3C95 A;  3OY9 A;  1NOY A;  1XC9 A;  3OYB A;  1NKC A;  3WNG A;  3WNE A;  4Y1D A;  3ZT1 A;  1RDD A;  3AVB A;  3RTV A;  2YHB A;  4M3R A;  4NYF A;  3E01 A;  3FFI A;  2FBV A;  2ITG A;  1JXB A;  4CED A;  1U47 A;  3ISN C;  4OJR A;  4KHQ A;  4FLU A;  1KVA A;  4Y1C A;  2Z1J A;  2D0C A;  1Q8I A;  4UQG A;  1LWC A;  3M8R A;  3K5M A;  3TAF A;  4RW8 A;  1TV6 A;  4B9S A;  4CJS A;  4M3W A;  1UAX A;  1L3V A;  2FBT A;  2XY8 A;  4CJ4 A;  3OYA A;  3O4N A;  1XHX A;  4BAC A;  3TI0 A;  4M3T A;  4IFV A;  1EP4 A;  4DTM A;  2G8V A;  3C6U A;  4EZ9 A;  3QEV A;  3PV8 A;  2XY6 A;  4HUF A;  4TSX A;  3LAK A;  4CHY A;  3OYM A;  3HJF A;  3OJS A;  4CHQ A;  1A5V A;  5CZ2 A;  3F73 A;  4NCA A;  4OKJ A;  3MXM A;  2G8I A;  2JLE A;  2B6A A;  3SQ2 A;  2G8U A;  3U3G A;  1S1T A;  2BAN A;  3SNN A;  1C0T A;  4ELU A;  4IDK A;  3SUQ A;  4M41 A;  3TAE A;  4IG0 A;  1LW2 A;  3AVC A;  4KI6 A;  4W5Q A;  2F8T A;  4DLG A;  3VQ5 A;  1WSJ A;  4KTW A;  2DTU A;  1RT4 A;  1IH7 A;  2OPP A;  1SKR A;  3TR8 A;  1RT6 A;  4KHY A;  4FYD A;  4E1N A;  2Z1I A;  2IAJ A;  1BIS A;  3AVL A;  4C8N A;  4IKF A;  4AHT A;  4NCB A;  4BE1 A;  4HHT A;  4F2S A;  4BDZ A;  1C1C A;  4CEC A;  1NK7 A;  2NUB A;  3IS9 A;  1ITG A;  1JLB A;  1QQC A;  4Z4F A;  1S9E A;  3DLK A;  1J54 A;  2P5O A;  1A5W A;  3KLE A;  4RG8 A;  3ZSR A;  4CEE A;  4M3U A;  4I9L A;  1KFD A;  4CGI A;  4Z4G A;  5HRR A;  4DU1 A;  1HMV A;  4LH4 A;  3RMD A;  1SL0 A;  3NGI A;  3KD1 E;  3LP3 A;  1L3T A;  5HRS A;  1L3S A;  1HYV A;  1ZBF A;  2IS3 A;  2Y1I A;  1D5A A;  1TKD A;  2GUI A;  3MXI A;  4OGE A;  2RKI A;  3HXM A;  4W5N A;  3MED A;  1EXQ A;  1RDA A;  5I42 A;  3VQP A;  1RT7 A;  4CF2 A;  1S1X A;  2Z1H A;  3LWL A;  1U48 A;  4EZ6 A;  3TAN A;  3ZSW A;  1LWE A;  1X9M A;  3AV9 A;  4FJ8 A;  4KHS A;  4OLA A;  1TAU A;  5FRN A;  4QAG A;  3LPT A;  1T7P A;  4F4K A;  1FKO A;  4OPK A;  3HYF A;  3PX0 A;  2O4G A;  4KPY A;  3QLH A;  4E19 A;  2A1R A;  1RBR A;  5SWM A;  1Q9Y A;  4FJN A;  2G8H A;  3MXJ A;  3RMB A;  4KAZ A;  4CJW A;  1UWB A;  1WLJ A;  3D0P A;  1ZBL A;  1ZBU A;  2EX3 A;  3DRP A;  3K5O A;  3LDS A;  4ELT A;  3KKR A;  3RMA A;  4DSJ A;  1C1A A;  3L3U A;  5J2Q A;  4F3O A;  4FK0 A;  1VSD A;  3V9X A;  4PQU A;  4B9L A;  3ULD A;  1BHL A;  2OPS A;  3HPG A;  4ZHR A;  1SUQ A;  1C1B A;  4FZX C;  3NF8 A;  4DMN A;  3VA3 A;  3DM2 A;  4KHN A;  3PX4 A;  1KRP A;  3QIO A;  3O3G A;  2OYQ A;  4JS5 A;  4FLW A;  2VWK A;  3PUF A;  3T3F A;  4DS5 A;  1DLO A;  1U04 A;  2EHG A;  3LAL A;  4CF0 A;  3AA3 A;  1WNS A;  4DQQ A;  1TL1 A;  1S6Q A;  1VSK A;  4OVL A;  3VQ6 A;  3O3F A;  1RNH A;  3SYZ A;  3V81 A;  1Z26 A;  3LAM A;  4DTJ A;  3PO4 A;  4PUO A;  2KZM A;  2HHW A;  1U4B A;  1IO2 A;  1ASU A;  2QKK A;  1BCO A;  4KTZ A;  1QHT A;  3D45 A;  1C0U A;  4CFB A;  5C25 A;  3QEX A;  4FJ9 A;  1JL2 A;  1IKY A;  2FBX A;  1A5X A;  5KGW A;  2I5J A;  3PY8 A;  3HVT A;  3F9K A;  4KO0 A;  1DTQ A;  3MEC A;  1R0A A;  4CHZ A;  1BCM A;  4JLH A;  3NH1 A;  3SZ2 A;  4NCG A;  4B3O A;  3IRX A;  3T1A A;  1NKB A;  4IFY A;  3OYH A;  4C8L A;  3C94 A;  2YV0 X;  4FM2 A;  1BQN A;  1ASW A;  2W42 A;  4E89 A;  3QEP A;  4FZY A;  3JSM A;  2FC0 A;  1RT5 A;  3AA2 A;  3AO4 A;  1FK9 A;  1NK4 A;  1MU2 A;  3AVJ A;  3K59 A;  4MQ3 A;  4CJK A;  3OYJ A;  3SQ4 A;  4GW6 A;  3NF9 A;  1ZBH A;  2BE2 A;  2ZD1 A;  4FLV A;  3OS0 A;  1RT2 A;  4N56 A;  4N41 A;  1GOC A;  3T19 A;  4CGD A;  3QET A;  3QO9 A;  2RN2 A;  4CEQ A;  1QSY A;  5KGX A;  4DQR A;  4DSE A;  3HVR A;  4FVM A;  4KKO A;  3KTQ A;  5J2M A;  1IG9 A;  3I0R A;  3SI6 A;  4CJE A;  2E4L A;  3LP0 A;  4Z4I A;  4B9V A;  4N47 A;  3KLI A;  3AVF A;  3ZSX A;  4KV8 A;  3NGY A;  3BDP A;  4DSL A;  4C8M A;  3NH2 A;  1SL2 A;  4YNQ A;  1Z25 A;  1Q9X A;  1BI4 A;  2A1S A;  4R5P A;  1J9A A;  3AO2 A;  4ELV A;  1RTI A;  1ASV A;  4FJM A;  4CES A;  4OKE A;  3OYC A;  4FJG A;  4FJ7 A;  4FJ5 A;  4DQI A;  4GVM A;  1BQM A;  3L8B A;  4HTU A;  4RW7 A;  2YNG A;  4B08 A;  3ITH A;  1S5J A;  4C8K A;  4DSI A;  3CG7 A;  3JYT A;  1RTH A;  4CJF A;  4M3Y A;  4OKK A;  4HUG A;  3ZSV A;  2FBY A;  1YT3 A;  5KTQ A;  3L2R A;  1RBT A;  3V9W A;  3A2F A;  4O0J A;  5KRS A;  4CHP A;  4I9Q A;  3HO1 A;  1NK8 A;  4OGC A;  4DS4 A;  3RR7 A;  2F96 A;  3L2V A;  2ATQ A;  4KHW A;  4DFK A;  1LAW A;  4E7H A;  3NH0 A;  1WN7 A;  2LSN A;  3NBP A;  4FLX A;  4E7I A;  3HP9 A;  2YHA A;  4DTS A;  3TAQ A;  1NK6 A;  1HYS A;  3HM9 A;  1JKH A;  1S1W A;  1RCH A;  4FJH A;  4L8R B;  3AO5 A;  4B9U A;  1RDC A;  1CZB A;  4E0D A;  2IGI A;  4CEF A;  1KVB A;  3AA5 X;  2RF2 A;  1RBU A;  5K14 A;  4O0I A;  2D5R A;  5EU7 A;  3ZT3 A;  3SJJ A;  3RMC A;  3KD5 E;  1BGX T;  1C0M A;  1GOB A;  1SV5 A;  3DLG A;  3TAP A;  2HHV A;  4M45 A;  4E7J A;  2DY4 A;  2HVH A;  3M8S A;  3DOK A;  5SZT A;  2R7Y A;  4LY7 A;  1TKT A;  1IKV A;  1LW0 A;  3VQQ A;  1DTT A;  1TL3 A;  4CEZ A;  4AIL C;  4QOZ B;  5JS2 A;  2WON A;  1BL3 A;  3QEW A;  3IG1 A;  3SUN A;  1NJW A;  4EP4 A;  1KLN A;  4JS4 A;  2BGG A;  2YNH A;  1XI1 A;  4CFA A;  2KFZ A;  1NK9 A;  3HL8 A;  4DFJ A;  2XRI A;  5DMR A;  4KI4 A;  1ZBI A;  3KLF A;  3KKS A;  4W5O A;  3RRG A;  1JLF A;  3TAG A;  1RBS A;  1HRH A;  1T05 A;  2PZS A;  4Q5V A;  4M42 A;  1HQE A;  1N6Q A;  4DU3 A;  4FM0 A;  4DSK A;  1XWL A;  1JLQ A;  4AHC A;  5HLF A;  2BDP A;  1WSI A;  4CEA A;  4QCL A;  3DRR A;  2KW4 A;  4W5R A;  2HNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...