1C6VA

Siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
148
Chain Sequence
b'NSDLGTWQMDCTHLEGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSVETIVLMAVHCMNHKRRGGIGDMTPAERLINMITTEQEIQFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SIV INTEGRASE)
publication title X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues 50-293)--an initial glance of the viral DNA binding platform.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Dna binding protein
total genus 42
structure length 148
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c6vA00
5SWMA 1WSFA 3AO1A 2RPIA 4OKEA 3VA3A 1IKXA 1F21A 1HMVA 1RBVA 3NE6A 4DTPA 3SNNA 4NCGA 3LAMA 3RRHA 3KLHA 3PX4A 3B6PA 3VQ6A 4E7IA 1QSSA 2KW4A 3M8RA 4FJJA 3SYZA 4DU1A 3ZSYA 4DFPA 3C6UA 3AVMA 1I3AA 3NAEA 1KRPA 1L3VA 5HBMA 3T19A 2HHWA 2KQ2A 1WAJA 3AVJA 4H4MA 3VQ7A 4QOZB 1JXBA 3HPHA 3NF6A 2Z1HA 3OJUA 3NGYA 1Q8IA 2EX3A 1ASVA 4CECA 4CFDA 1L3TA 1EP4A 4DQSA 1JLCA 4E1NA 1TKTA 1Q9XA 4FW1A 4BDYA 1TK8A 4DG1A 2Z1IA 1KVAA 2HHTA 4FZXC 2JLEA 4ELUA 2O4GA 3KK1A 3VQDA 4CIEA 3LP3A 4CJRA 1RBRA 3U6FA 1UA1A 1Z26A 2Y1JA 2PYLA 1YTUA 4O0JA 1KFSA 1NJXA 1S1XA 3U3YA 4PWDA 1NJZA 3L2UA 4IFYA 1SKWA 3DI6A 3VQ8A 1C0TA 4M3ZA 2F8SA 5HROA 4LD0A 3EYZA 1WSHA 4FJIA 1SUQA 1A5WA 3ZT3A 4FZYA 3G10A 4JS5A 3QIOA 1L3SA 3K5MA 4IFVA 1XHZA 4KB0A 5FDLA 3AVNA 3KD5E 3O3HA 4W5OA 4OJRA 3PY8A 1U04A 2DFEA 1C1BA 3RMAA 1BGXT 4AHUA 4CHPA 2JGUA 4OPKA 1TVRA 4FJMA 3TI0A 3NH2A 3HP9A 1LAWA 4I9QA 1L3UA 2B5JA 1FKOA 5T7BA 3NF9A 5KGWA 3AVLA 5CYMA 4B8CA 2VWJA 4DU3A 1RT4A 2HMIA 2VG5A 4M45A 3CFOA 3RMDA 4W5RA 4M3WA 5I42A 4RW8A 2BANA 3VQCA 1I39A 3DOLA 3MXJA 4RW6A 3HT3A 3OYHA 3V9SA 4N41A 3LZIA 4CGDA 4HCCA 3QO9A 3K57A 4FLYA 4E7LA 2QK9A 2KFNA 1GOCA 4OLBA 3DLRA 2ZQBA 4C8MA 3TR8A 2OPPA 3LWMA 1WLJA 2G8VA 2FC0A 4CJ5A 3CQ8A 4O0IA 3ITHA 2OYQA 3DRRA 1VSFA 3TWHA 4LH5A 1CZBA 1HQEA 4DTUA 4FK0A 2XY7A 4O4GA 3P83D 3PX0A 3SUNA 1U45A 3PO4A 3VQ9A 4DSJA 4C8LA 4HCBA 4PY5A 1JLEA 2OPSA 1R0AA 3P1GA 4O55A 4CJ3A 3OYGA 4F3OA 3K5OA 2QXFA 4M3RA 1G15A 4ZTJA 4JRQA 1NK8A 1NKEA 1QTMA 2BGGA 3V9ZA 2DY4A 3QETA 4JRPA 4CEBA 3KLIA 5HRRA 1A5VA 2FBYA 4Z0UA 1S9EA 3HK2A 1VSDA 4YNQA 4NCBA 2GBZA 4CJKA 5KRTA 2HHQA 1VSKA 3SUPA 4N76A 3DLKA 1NOYA 1XC9A 1U48A 4FJNA 3QESA 4CJ4A 1JL1A 4F8RA 4OKKA 1KTQA 1SV5A 2YKMA 4CJSA 3LP1A 2PZSA 1CLQA 1QSYA 2VWKA 4F4KA 1SL0A 1RT1A 5KTQA 1VK0A 4IG3A 3HXMA 2G8HA 4KHYA 2HHSA 1VRTA 1RBSA 4YFUA 3OYIA 3ZSXA 4DSKA 1NK5A 3DLHA 4DSIA 4FJ9A 1QHTA 1EX4A 4FW2A 1QE1A 4AHRA 3V9XA 3HYFA 1WSEA 2QKBA 3ALYA 3ISNC 1WN7A 2Y1IA 2PYJA 1IKVA 2OZSA 3AV9A 1BI4A 1BIZA 3ASMA 4CCHA 4F2RA 5C24A 4GW6A 3RTVA 5J2MA 3AO2A 1U4BA 4ID5A 3OS1A 3QINA 2DFFA 3BGRA 4LSLA 4JLHA 4OGCA 1BISA 3OYEA 4CK3A 3CFPA 4CJQA 3O3GA 1X9SA 3AVCA 2KZZA 5CZ2A 2Z1GA 1J54A 3PUFA 4ID1A 4AH9A 4N5SA 4FCYA 4J2EA 5FROA 4AILC 3SJJA 1FXXA 1EXQA 2IDOA 4B08A 4W5TA 3RRGA 2HNYA 4J2AA 1TKDA 4F2SA 1Z25A 1EETA 1RTHA 3AVHA 3K2PA 3TAGA 1SKRA 3OY9A 3ULDA 1KCFA 2X78A 4B9TA 4Z4GA 1RILA 3L2WA 3E01A 1NK7A 4KHQA 1JLBA 1YVUA 4IKFA 2D0AA 3NCIA 2RF2A 4GVMA 3V9UA 4DF4A 3FFIA 3ZT1A 3AVBA 4M41A 4CF9A 4Q5VA 4E7HA 5I3UA 3THVA 1T7PA 1K6YA 4DS5A 2OZMA 3TANA 4NYNA 4FJ7A 1KFDA 4E89A 4C8NA 4I2PA 4RW7A 3QIPA 2ITGA 2XRIA 3S3MA 4OPJA 3L2VA 3ZSVA 3OYKA 3C95A 4CEOA 4KV8A 3KLEA 2O4IA 2D0CA 1T03A 3QERA 3L3VA 1IH7A 3UIQA 1YT3A 3KKRA 3PX6A 2YHBA 3BDPA 1NK4A 4J2BA 3ZSZA 3C94A 3KD1E 1X1PA 3P5JA 3TAPA 1FK9A 4E7JA 3WNGA 3EZ5A 4CHYA 5HRPA 5HLFA 4KI4A 3SPYA 3QEPA 3SQ0A 2HB5A 3HVRA 4DSLA 4Z4IA 3HM9A 2YHAA 2XY5A 1D9DA 4FJ5A 4FJGA 1J53A 4DMNA 3ZSQA 4B9SA 3IRXA 2DFHA 3KIOA 2NUBA 3OYNA 1RBTA 4N47A 4Y1DA 4CFCA 3MAQA 3CFRA 3V81A 3RMBA 4DTRA 1ASWA 2RN2A 3V1RA 3O4NA 1SKSA 3KLGA 1LWEA 1TAQA 3AVGA 3MXMA 4OLAA 4FK4A 4B9MA 2KFZA 2DTUA 1S1TA 3JYTA 2A1SA 4H8KA 4BE2A 1W9HA 3LPTA 1C1CA 3MEDA 2IC3A 3OYCA 4DTSA 1WSJA 1KLNA 2G8UA 4KHNA 4E19A 3WNHA 3LP2A 1D8YA 1UA0A 2F8TA 1S9GA 4BE1A 3MXIA 5HRNA 2P5GA 4M3UA 2P51A 4WE1A 4CEQA 3TAMA 3OS0A 3S3OA 4LY7A 4CF0A 3QNNA 1DTQA 3SQ4A 4QAGA 4IDKA 3V1OA 3KLFA 3V9WA 4CHOA 3B6OA 3VQEA 3ZSOA 2PY5A 2GV9A 1B9DA 1LW0A 3DLEA 4E1MA 4CE9A 3F73A 3AA2A 1IKWA 3NFAA 3V6DA 2B6AA 5E41A 4BDZA 1U47A 4I2QA 3LP0A 4BWJA 3AVKA 1RT3A 3MECA 1NK9A 4E3SA 2X6NA 1CZ9A 1XHXA 4W5NA 4ZHRA 1SL2A 4DQQA 4KB1A 3I8DA 2IAJA 2B4JA 4HUFA 5C25A 2X74A 4CEAA 1HNIA 4AHTA 1YTAA 4F3TA 4PUOA 1HYVA 1QQCA 2HNZA 3DLGA 5DK5A 1MU2A 4CHZA 1TK0A 3WNEA 4B9LA 2YKNA 4DTNA 3V4IA 2A1RA 4UQGA 2ZE2A 4QCLA 3AO4A 3D0PA 4C8KA 4B3OA 2W42A 2WONA 1UWBA 4LSNA 3OYBA 1NJYA 4I7FA 3HPGA 3G0ZA 2OA8A 4K8ZA 3M8QA 1D5AA 1HRHA 4KKOA 1ZYQA 1NKCA 1S5JA 3PV8A 3CYMA 4KFBA 3HL8A 3DLBA 3KJVA 4TSXA 3HPOA 4FXDA 3O4QA 3K5NA 3DMJA 4CJWA 1NK6A 2EHGA 3TARA 4DWIA 1RDBA 4DTMA 1KSPA 1C1AA 5KI6A 4CF2A 1UAXA 1DLOA 3TAEA 3OJSA 1BL3A 1J9AA 3HVTA 2XO7A 4FJXA 3KK3A 4CGIA 4C8OA 4EZ9A 1CXQA 3T1AA 1S1UA 2IOCA 3AVIA 3MEGA 3WNFA 5SZTA 3SUOA 4AHVA 3SCXA 1Q9YA 1BQNA 2HHUA 4DTJA 1JLAA 3KTQA 2LSNA 4RG8A 4Q0BA 2AJQA 3ZCMA 3HSTB 3AA4A 3KKSA 2ETJA 4M42A 2ZD1A 3SI6A 4NYFA 2YV0X 4CEDA 4JS4A 3NBPA 1RBUA 3OYFA 3QEXA 1VSHA 3ZSWA 3SQ2A 2GUIA 3VQ5A 3HP6A 1C0MA 1D9FA 1C6VA 2R7YA 1ASUA 2FBVA 1XWLA 2IS3A 5CY4A 3L3UA 5EU7A 5KGXA 4I9LA 1VSIA 1QSLA 1HQUA 1BI4B 2E6LA 3JSMA 4FJ8A 5J1EA 4MQ3A 1N6QA 3VQAA 4FLWA 2E4LA 4CIFA 1IKYA 2VG6A 3AO5A 3TAFA 1UOCA 1NOZA 3PO5A 3OYJA 3RWUA 1SL1A 2HW3A 3SV3A 1JXEA 1TV6A 1NJWA 1HYZA 2D0BA 4PA1A 4CJUA 4M3XA 4ELTA 3OYAA 2HVIA 1REVA 2XY8A 1NK0A 4CHNA 4W5QA 3K5LA 4IBNA 4PQUA 1ITGA 4DTOA 1A5XA 1LW2A 4K8XA 1B92A 4M3TA 4DLGA 3IG1A 1S1WA 3DRSA 1HPZA 4FVMA 3DRPA 3IS9A 3OYDA 1WSIA 3NHGA 4FLXA 1Y97A 1W0HA 2XY6A 1X9MA 4CJPA 4FJKA 1RTJA 4HUGA 4BACA 2XHBA 2OPQA 1S1VA 1VSEA 4FLVA 1RT5A 3LAKA 3O3FA 4M3YA 4IG0A 4FJLA 1LWFA 3AA5X 3EY1A 4FLZA 1RT6A 2RKIA 4RW9A 4CFAA 3ZT0A 4FJHA 1TK5A 3VQ4A 1TGOA 3AVAA 3VQPA 1VRUA 4B9VA 1ZBLA 1L5UA 5CYQA 4KRFA 4CJLA 1RNHA 3L2RA 5C42A 3HJFA 2YNFA 2KTQA 4NCAA 3LALA 1GOBA 3CM5A 1BIUA 1VSMA 4OGEA 1WAFA 4AHCA 2G8IA 3DM2A 4DFJA 3LDSA 4FM1A 1HNVA 2YNIA 5J2NA 4ZTFA 1RDDA 1WNSA 3I0RA 3L8BA 1KLMA 1S6QA 2HHXA 3K58A 1JLQA 1N5YA 3OVNA 4FLUA 5HP1A 2BE2A 2HNDA 3QEIA 1KVCA 1VSJA 1HYSA 2WOMA 1ZBIA 3IAYA 4EZ6A 5HRSA 4DS4A 4KI6A 3OYMA 4DFMA 4BE0A 1JKHA 2VG7A 2E6MA 4CGGA 4CIGA 4CF1A 4KHUA 1RDCA 1ZBUA 5J2PA 3NGZA 2FBXA 3OYLA 4Y1CA 3KK2A 3VA0A 1GOAA 4ELVA 4CJFA 4FM0A 4DQIA 2Z1JA 1RT2A 2F96A 2IGIA 4E0DA 4BWMA 3SZ2A 2BDPA 1TKXA 3U3GA 3S3NA 1HJRA 4CJVA 3QEWA 3NF7A 3S9HA 1CXUA 3D45A 1XI1A 4J2DA 1T8EA 4KHWA 4AHSA 4GMJB 4FYDA 4DSFA 3ZT4A 4DFKA 2X6SA 1TKZA 1RDAA 4B9NA 1NKBA 4CHQA 5D3GA 4O44A 2HHVA 1IO2A 1RT7A 2P5OA 1U49A 4CERA 1C0UA 4KO0A 4DF8A 3VQBA 1LWCA 3AA3A 1DTTA 2KZMA 1BHLA 3RMCA 3F9KA 1QS4A 1TL1A 4CESA 1LAVA 1VSLA 4H4OA 1IG9A 3NF8A 3LZJA 1JLFA 3SUQA 4HHTA 3L2QA 3A2FA 1O1WA 3AO3A 4CGJA 4KTWA 1WSGA 3OS2A 3MEEA 4CEFA 3SQ1A 1LV5A 3T3FA 4Z4CA 5K14A 3DYAA 4FM2A 4KPYA 5FRNA 4ICLA 3AVFA 4G1QA 2I5JA 1ZBHA 4KREA 3QNOA 4FLTA 3CM6A 4XIUA 1T05A 2YNGA 4DSEA 4KAZA 1RTDA 5JS1A 3I0SA 1S6PA 4CEZA 2ATQA 5DMRA 4CFBA 5KRSA 5CZ1A 4N56A 4FK2A 1BCMA 4BDPA 5FRMA 4CK1A 4OVLA 4CEEA 2D5RA 1RCHA 4OKJA 2G8WA 2QKKA 4KHSA 1EKEA 1J5OA 4R5PA 4CGHA 3M8PA 4B8AB 2G8KA 1X9WA 3ZT2A 2P1JA 4HUEA 3HO1A 2Q3SA 1TL3A 3M8SA 1JLGA 3TAQA 4L8RB 5J2QA 4Z4FA 1B9FA 3C6TA 4LH4A 1ZBFA 4O5BA 4DU4A 1TAUA 2FBTA 3LWLA 3LANA 4DQPA 3NH0A 4CGFA 2OPRA 3SV4A 4E7KA 2G8FA 3VN5A 4KTQA 3QLHA 4DTXA 4Z4EA 3ZSRA 4FZZA 1BQMA 4EP4A 3H08A 3RR7A 3VQQA 4HVJA 3CG7A 4DLEA 4DQRA 3NDKA 3RR8A 3V1QA 4RW4A 4CJTA 3K59A 3DOKA 2YNHA 5JS2A 3NGIA 4MFBA 4B9UA 4CJEA 1FKPA 4HTUA 3SPZA 4CK2A 3NH1A 3TABA 4EP5A 1JL2A 1KVBA 4Z4HA 4CF8A 1RTIA 2HVHA 4KTZA 3QEVA 3LPUA 1BCOA
chains in the Genus database with same CATH superfamily
3CPEA 1XNQK 1WSFA 3WXIA 1GLBG 3Q7CA 4DTPA 4JNEA 3PX4A 4FJJA 3KLHA 4E7IA 4M63C 3FLCO 4YOUA 3AVMA 3NAEA 3T19A 2HHWA 2KQ2A 3VEYA 4GKKK 3HPHA 5C2FA 1Q8IA 3CCEN 4CECA 3LDLA 1EP4A 1XMOK 4V19S 1TKTA 4FW1A 1TK8A 4DG1A 2HHTA 4NXMK 1BA1A 4I6MB 2YX6A 4FZXC 4JK8A 2JLEA 4ELUA 1QVFM 3VEZA 3ID6A 4DV5K 4PWDA 1NJZA 4ISGA 3I33A 1SKWA 1TUYA 3IFRA 4IEIA 2NRWA 4IOXA 2A5XA 2BUPA 5HROA 3EYZA 1WSHA 1A5WA 1IG8A 1ATSA 1OKJA 4WFNL 3G10A 4WF9L 3KK7A 3K5MA 3HRGA 3UE5A 2P9SB 4IFVA 4KB0A 3AVNA 3KD5E 4OJRA 4DUYK 4WQ5A 5I9EB 4FWLA 4BC3A 4AHUA 4CHPA 4OPKA 3QFUA 1TVRA 2QM1A 3TI0A 1LAWA 3NF9A 2WTUA 5KGWA 2HMIA 5CYMA 5KQ8A 4LFBK 2ZJQL 3V9SA 4N41A 4HCCA 3QO9A 3K57A 4UY8O 1GLDG 2KFNA 2OPPA 1NGIA 1IBMK 3DRRA 3EZWA 4LH5A 1CZBA 5A2QO 1X3NA 3O9UA 4FK0A 3P83D 1U45A 2P9UA 4C8LA 2OPSA 4LF9K 2QXFA 4C1NI 5EXWA 1NKEA 3V9ZA 4X64K 4CEBA 3KLIA 4PKGA 4LF7K 3SBTA 3HK2A 4JI1K 4YNQA 1HLUA 4N76A 3DLKA 1S3XA 4OKKA 2YKMA 1U2VA 4BRCA 4RWTA 1VK0A 4IG3A 3HXMA 1VRTA 1RBSA 5LY3A 3CIPA 2I7PA 3ZSXA 4CZJA 3DLHA 2P9LA 3GE1A 3J7YP 3V9XA 1X9JA 1S72N 2E2OA 3AV9A 4JD2A 2YJFA 3CCJN 4YY3K 2F9WA 4GW6A 3RTVA 3AO2A 1U4BA 2ASMA 3QINA 4F3OA 4JLHA 3JXUA 3O3GA 3AVCA 3CHWA 5CZ2A 2AA4A 1J54A 3PUFA 3GL1A 4J2EA 5FROA 4DR3K 1TKDA 2QWRA 3ULDA 1KCFA 2X78A 1RILA 2E1YA 3E01A 4G9ZA 2IVNA 4M41A 4CF9A 4Q5VA 3W3DA 1KFDA 5AQIA 4RW7A 4FO0A 4DV3K 4FOEA 1X3MA 1C0FA 4X66K 2H3GX 3C95A 3THYB 1HUXA 4IJNA 3K0SA 1T03A 4F9OA 3VETA 3MMVA 1HPMA 3PX6A 3PIPL 1NK4A 4FWMA 1X1PA 1FK9A 5LJVA 1NU0A 4E7JA 4Z4IA 3SPYA 2HB5A 3HM9A 4MO5A 3ZX0A 3CJAA 2DFHA 3KIOA 2NUBA 4Y1DA 1I94K 4DTRA 3V1RA 4B1WB 3O4NA 1LWEA 3MXMA 4BRQA 3NMUA 1W9HA 3LPTA 3OYCA 4DTSA 4DR6K 2HF3A 5AQLA 2F8TA 3WXMB 2UXCK 2CGJA 4BRIA 3L4IA 4JYAK 5HRNA 3ZETA 3S3OA 3T7ZA 3QNNA 4YOXA 5AQMA 4CHOA 5C10A 3ZSOA 1K8KB 1LW0A 4E1MA 3A5NC 4CE9A 1V4SA 3AA2A 3V6DA 5KQDA 4PKHA 5AQUA 4BR7A 3EKSA 1CZ9A 3THWA 4WQ4C 2IAJA 2B4JA 4HUFA 5EY4A 1NGFA 1YTAA 3KVGA 1HYVA 3DLGA 2ZGZA 4QS8A 5DK5A 1XMQK 4UQGA 2ZE2A 3AO4A 3DXKB 3D0PA 3CI5A 4C8KA 1NGJA 2W42A 1UWBA 4DQ8A 1NJYA 4K8ZA 3G0ZA 5AQJA 2P9KB 5FLXO 1HRHA 4C23A 4NO7A 3HL8A 3U9ZA 3KJVA 4JHDA 1P8ZA 2EHGA 5C12A 4JI4K 5GIOA 4DV1K 5KI6A 1UAXA 3HOTA 1J9AA 1Q86O 2XO7A 2F4VK 4BGBA 4JI5K 4EZ9A 3SUOA 2HHUA 4RG8A 4Q0BA 4AQYK 2A3ZA 3KKSA 4WFBL 3SI6A 2YV0X 1RBUA 2RHKA 2HBMA 5F1XA 1ASUA 2VQEK 5KGXA 4I9LA 1VSIA 1QSLA 2HMPA 1BI4B 2UUBK 1N32K 2V52B 2E4LA 1IKYA 2VG6A 3ZYYX 2A6AA 1UOCA 4DHYA 1O13A 4ILGB 3BZKA 4M3XA 4HTLA 4ELTA 4CHNA 4IBNA 2GWJA 3GBTA 2E2PA 4DTOA 3SK3A 3MN9A 1S1WA 3IS9A 4FLXA 2D0OA 1W0HA 1X9MA 4HUGA 4JKGA 2XHBA 1S1VA 1VQON 3U4LA 1ATRA 4FLZA 1KAYA 4CFAA 1TK5A 3VQ4A 1TGOA 1HX1A 2W41A 1VRUA 4B9VA 5ADXA 3RSEB 4CJLA 3L2RA 2YNFA 4NCAA 1VQ8N 2YHWA 4OGEA 1WAFA 2UU9K 3CXCM 3DM2A 2GUPA 3LDSA 4DFJA 2UUAK 3EE9A 5FPMA 1KLMA 4BR4A 4DR4K 1D4XA 3QEIA 2WOMA 4GV6A 2P9NA 4FL9A 3FZFA 3O9RA 1NNEA 2GTDA 1ZBUA 4BRLA 1YJWN 1GOAA 3VGLA 2UXDK 2P9IB 1RT2A 3TTCA 4BWMA 1VQKN 2BDPA 1HJRA 3ZX2A 3UKUB 1T8EA 3JS6A 3W0LA 4AHSA 5AR0A 3E1YA 2X6SA 1TKZA 3AAPA 2NRZA 4O44A 5D3GA 2HHVA 4IFEA 3C6AA 4CD1A 1OVQA 1C0UA 4KO0A 3SBGA 3C65A 2NZTA 1JCGA 1QS4A 1IG9A 3H6EA 4R79A 3C7NA 4RCHA 1JLFA 3KWIA 5JLHA 3MEEA 3LDOA 2WC9A 2OTLN 4B1UB 3G6EN 4FLTA 2YNGA 4DSEA 4DCHA 4CFBA 2ATQA 5FRMA 5CZ1A 4N56A 4OVLA 5E26A 3AARA 4R5PA 3D6RA 4EIAA 4FWSA 4HUEA 2Q3SA 3OTOK 1TL3A 4L8RB 5J2QA 3E9LA 1W97L 5JVGL 3EL2A 3VF6A 3VTHA 3VGMA 3SV4A 4E7KA 3O9QA 4DTXA 3H08A 3CG7A 1NJIO 2ZM6K 3MN7A 2Q31A 3DWLA 4YDUC 3WQTA 4B9UA 1FKPA 3NH1A 3TABA 4CF8A 3LP0A 1XQSC 1NK9A 5GINA 2FLOA 2YCHA 4OKEA 1IKXA 3MX5A 3RRHA 4KBOA 3J8AA 4YOTA 1N36K 3CPWM 1NGDA 5HBMA 4H4MA 3IMXA 1JXBA 1EO1A 2CGKA 3NGYA 1L3TA 4DKWA 5C2DA 4DQSA 4E1NA 1Q9XA 3CC2N 4BVPA 1KVAA 5AQFA 1K9MO 3B8AX 1DT9A 2O4GA 4IJAA 3UKRB 4CIEA 3KHYA 2ZJPL 2PFUA 2O8FB 1Z26A 1NJXA 3U3YA 2A42A 4IFYA 3AGKA 3DI6A 1GLJO 4CJ7A 3NVMA 3QIOA 4DR1K 2VYPA 1IJJA 3O3HA 3PY8A 1YJ9N 4B1YB 1OH7A 3NH2A 3ID8A 3AVLA 4B8CA 4DU3A 3VESA 1YITN 4M3WA 4M45A 1E4GT 5LJWA 2E88A 3BP8A 3HT3A 4RW6A 4IOCL 4B3MK 3ZLJA 4CGDA 2QK9A 4E7LA 4OLBA 3DLRA 2ZQBA 1WLJA 3ZEUB 2OYQA 4JK7A 5AQRA 1VQ9N 4PY5A 4IO8A 2FF3B 3P1GA 3OYGA 4M3RA 4ISFA 1NK8A 1QTMA 3MCAB 2DY4A 2FBYA 2PBDA 3MDQA 4MLEA 1VSDA 5KRTA 5AZIA 3TSPA 3SUPA 2O8BB 3LDPA 4H5TA 1NGCA 1JL1A 4XH4A 3QBXA 1OH6A 5BR8K 5H1SQ 1CLQA 2YI1A 1QSYA 2VWKA 4F4KA 5KTQA 2HHSA 1SS6A 4YFUA 1W2BM 3CCRN 4DSKA 1CZAN 3N4PA 4DR7K 3QMLA 5M1NA 3WEEB 3ULEB 4AHRA 2QKBA 4IWVA 3LDQA 3ATUA 5AQZA 4FWQA 3ASMA 5C24A 2BTFA 2O8DA 4BRMA 4ID5A 3BGRA 4OGCA 1Q81O 2KZZA 3ENOA 2FSJA 2Z1GA 4ID1A 4FCYA 3EN9A 1FXXA 1EXQA 2GEMA 3RRGA 2HNYA 1Z25A 4JKEA 4Z4GA 3OY9A 2I7NA 3L2WA 5BRFA 1JLBA 4BC4A 1KD1O 1NGGA 3NCIA 4E0DA 4DF4A 3FFIA 3AVBA 1N8RO 3TANA 4FJ7A 4E89A 4I2PA 4ISEA 3CQXA 3QIPA 2XRIA 3VERA 4HWIA 3CMAN 2WFBA 2D0CA 2GELA 3L3VA 1IH7A 3UIQA 3BDPA 1MWMA 1JJ2M 2GX9A 3ZSZA 1H1VA 3J80O 4JEPA 1YJNN 3CCQN 3WNGA 3EZ5A 4PKIA 2CH6A 3GDQA 2XY5A 4FJGA 4DMNA 3IRXA 3MAQA 1RBTA 3RMBA 1SKSA 3KLGA 4BREA 1TAQA 4OLAA 2KFZA 2DTUA 4H8KA 3FZHA 1C1CA 3MEDA 2IC3A 2G8UA 4KHNA 1HKGA 3CCVN 3P39A 4BE1A 2W6LA 4M3UA 3OS0A 5CR4A 4CF0A 1DTQA 4A57A 4QAGA 3CERA 5AFUA 3VQEA 4GV3A 2GV9A 3ATVA 4JKBA 1K73O 2B6AA 5E41A 1SQKA 4I2QA 3VGKA 4BWJA 2VGNA 3CD6N 4DV6K 1XHXA 4ZHRA 1SL2A 1SZ2A 4KB1A 3I8DA 3CMEN 1KC8O 2ZGYA 2X74A 4X65K 1ESVA 3J81O 5AQNA 1TK0A 2P9UB 4B9LA 2YKNA 4DTNA 3V4IA 4QCLA 2OTJN 4QS9A 1KAZA 2WONA 1KXPA 3A5OC 3M8QA 4KKOA 5BREA 1NKCA 4KFBA 3T1YK 3HPOA 1C0GA 2FSKA 4CJWA 3K5NA 4DWIA 3TARA 2QEXN 4DTMA 1C1AA 4CF2A 1E4FT 1DLOA 3E9PA 3OJSA 3HVTA 3K9KA 1U2VB 4M7XA 4JI2K 5ADXH 3CCMN 3SCXA 3R8EA 3EO3A 1BQNA 3P4IA 4BY9C 2AJQA 2QWNA 3IUCA 2P9LB 4CEDA 3OYFA 5AZJA 3VQ5A 3E66A 2R7YA 2FBVA 1ATNA 5CY4A 4JD2B 5C0YA 4PL7A 3H45C 4MQ3A 1N6QA 3BF3A 3WXLA 3VMFB 3TAFA 3S41A 3OYJA 3SV3A 1RDWX 1TV6A 1HYZA 2D0BA 4PA1A 4CJUA 2XY8A 3MK6A 1ITGA 2HBJA 1B92A 4M3TA 3OYDA 1HPZA 3TTFA 3HZ6A 4A61A 1Y97A 1VQ5N 4FJKA 4BACA 2OPQA 4FLVA 1RT5A 3O3FA 4IG0A 4FJLA 5AQWA 1LWFA 3CCLN 4XH1A 2RKIA 3D2EA 4RW9A 1BOTO 4IDHA 4DV2K 5IT9O 3R1XA 3VQPA 3VEVA 5C42A 1QZ6A 3HJFA 2KTQA 1NMDA 3LALA 1GOBA 3FFKB 1VSMA 2E2NA 4AHCA 3VEOA 3R6MA 5J2NA 1LOTB 2YNIA 3VENA 3I0RA 1S6QA 5E84A 4JI6K 1JLQA 4JV5K 3OVNA 2BE2A 3N4QA 2DPNA 5CHIA 4H5RA 1ZBIA 3IAYA 3H46O 4EZ6A 5HRSA 1NGEA 4KI6A 1JCEA 4BE0A 5C15A 2VG7A 2E6MA 3THXA 4YHHK 4CF1A 2QWLA 1RDCA 5J2PA 1YF5L 4BC2A 4FM0A 2Z1JA 1K8AO 2F96A 4DV0K 1P90A 4PHTX 1HNWK 3FZMA 1NBWA 1U6ZA 3BZCA 1RT7A 4DF8A 1J6ZA 4O5FA 1DTTA 1BHLA 3RMCA 3F9KA 1TL1A 1LAVA 1VSLA 4H4OA 2NRTA 5AQPA 3NF8A 3U8XA 4LF6K 4K25A 3L2QA 1MWKA 2WBNA 3IKMA 3AO3A 4KTWA 4BRAA 3OS2A 4FVUA 1M1KO 1NLVA 1LV5A 3THWB 3DXKA 3T3FA 1V4TA 3O08A 5FRNA 4KPYA 3D2FA 4ICLA 4BC5A 1XC3A 2I5JA 4KREA 4GVEA 3QNOA 2P9KA 3CM6A 1T05A 4DR2K 4DV7K 1RTDA 3I0SA 1SAZA 4CEZA 1ZBSA 4FK2A 4BDPA 3ENBA 4CEEA 2D5RA 2HHHK 3M3ZA 2QKKA 4KHSA 1EKEA 2E8AA 2O8CA 4QS7A 4CGHA 4B8AB 1X9WA 3ZT2A 4B1VA 5FPDA 4Z4FA 1B9FA 4DU4A 1ZBFA 2FBTA 4KH5A 3H3OB 4DQPA 4FWRA 4KTQA 3MN5A 4EP4A 3RR7A 1GLCG 3VQQA 4MLHA 4DLEA 4BVOA 4RW4A 3K59A 3TU5A 5JS2A 3NGIA 1NGBA 4CJEA 4HTUA 1HR0K 5AJ3K 4JKFA 2W6KA 4CK2A 5M1FA 4EP5A 3EEQA 2HVHA 1QQOA 5M1KA 2Q2RA 4JKHA 4KTZA 4A62A 5DM6L 3QEVA 1BCOA 4OX9K 3AO1A 3MWPA 3VA3A 4CZGA 1YVNA 3LAMA 1QSSA 3B6PA 2KW4A 4YOWA 3M8RA 4EAHD 1YHQN 1VQMN 2Q97A 3SYZA 4DU1A 3ZSYA 4BRPA 1R59O 4IEEA 1QQNA 1KRPA 1WAJA 3FR0A 2A40A 5BRDA 3AVJA 1YUWA 4OPHA 3NF6A 3CC7N 2Z1HA 3MN6A 4CFDA 4H5WA 4BDYA 4H03B 5JMVA 3KK1A 4CJRA 3LP3A 3BEXA 1RBRA 3U6FA 4O0JA 3FE1A 3H1QA 4FWKA 3J7AP 3T1HK 3T69A 5KPTA 5GIPA 3VQ8A 1C0TA 4M3ZA 4FJIA 1SUQA 1L3SA 3NVKA 1XHZA 3DJCA 5GAGP 5FDLA 3FGUA 3WXJA 4W5OA 2AP1A 1Q7YO 3O6WA 3M6GA 1U04A 2DFEA 1C1BA 5ELZA 3RMAA 2P9IA 1BGXT 2OANA 4NB4A 4FJMA 5AQQA 3HP9A 5AQVA 4BR0A 2B5JA 1L3UA 2VWJA 3GG4A 4B3OA 3SAFA 3RMDA 3CFOA 2BANA 3VQCA 1I39A 3LZIA 2YJEA 3TR8A 2G8VA 2QXLA 4CJ5A 3ITHA 2HF4A 1KQSM 3TWHA 1HQEA 3DAWA 3PO4A 4DSJA 3VQ9A 1R0AA 4O55A 4CJ3A 1BA0A 4JRQA 2BGGA 3I8BA 1DKGD 4JRPA 4BROA 1VHXA 2NLXA 3F9MA 1A5VA 3C7NB 4NCBA 2GBZA 4CJKA 2HHQA 1VSKA 4GNIA 4KH4A 5FPNA 4BRDA 5AQHA 1NOYA 1XC9A 1U48A 1QZ5A 2D0PA 3QESA 4FJNA 4F8RA 4Z94A 1QHAA 3A0IX 4K42A 3GOIA 3QDKA 3BY5A 1RT1A 4KHYA 3SLCA 2G8HA 3OYIA 5FPEA 3O5BA 4DUZK 4H0XB 3FZLA 1QHTA 1EWQA 4FW2A 3A5MC 3ALYA 5CE3A 3ISNC 1WN7A 3IDHA 2PYJA 1IKVA 2HBLA 3PSFA 1IBLK 5AQYA 2QW9A 1BIZA 4CCHA 4F2RA 4K41A 3CQYA 3OS1A 3OYEA 1VQNN 4AH9A 1QVGM 4KHPK 4B08A 4BG8A 1EETA 2NRVA 3TAGA 3K2PA 1SKRA 2O4IA 2IVPA 2D0AA 3V9UA 4H0YB 1HNXK 3THVA 3ZT1A 4E7HA 4MDAA 3WT0A 4FSVA 1K6YA 2OZMA 2YHXA 4C8NA 2ITGA 2VCPA 3L2VA 4AF1A 2F7TA 4IOAL 2GWKA 2P9PA 3QERA 1TYQA 1YT3A 3KKRA 2YHBA 3WXKA 4J2BA 1WUAA 3C94A 3KD1E 3P5JA 3G4SN 3TAPA 3CJCA 5GAEP 5HRPA 5HLFA 4KI4A 3QEPA 4MO4A 3SQ0A 3HVRA 4DSLA 4FJ5A 1BUPA 2Q36A 3ZSQA 1ILYA 4B9SA 3OYNA 4N47A 3CFRA 2RN2A 2PAVA 3AVGA 3QB0A 4B9MA 4FK4A 3DLLL 1S1TA 3JYTA 2A1SA 1NGAA 4BE2A 1RGIA 3CJ7A 3R3LA 3TTDA 3WNHA 2O8EA 1D8YA 1S9GA 3HM8A 1BO5O 4AM7A 4CEQA 1WB9A 3SQ4A 2A41A 3V9WA 3MX2A 4Y0WA 3QICA 4DR5K 3F73A 1IKWA 4BDZA 1U47A 2V7ZA 4BG9A 4E3SA 3D7EO 1T44A 2ZWHA 5JVHL 4DQQA 1FW6A 4A5AA 4BRKA 5C25A 3VOVA 4CEAA 2NRHA 4F3TA 5HOOA 1QQCA 2HNZA 4OPAA 4J8FA 4CHZA 3O9TA 3DXMB 2KLAA 5AQOA 1JCFA 4LSNA 3HPGA 1D5AA 2HBKA 2JWKA 1S5JA 3PV8A 3DLBA 4TSXA 5AZIB 1KSPA 4EFHA 4CZKA 3TAEA 1BL3A 4CGIA 4C8OA 3CCUN 3HTVA 5EOYA 3L6QA 1CXQA 3T1AA 3WNFA 3TSUA 3MEGA 1JLAA 3KTQA 5AQTA 3ZCMA 2ETJA 4AM6A 2ZD1A 3NBPA 1WOQA 3QEXA 1VSHA 2NNWA 2CGLA 2GUIA 3HP6A 3F5TA 1C6VA 1BDGA 3RVCA 1XWLA 5EU7A 3L3UA 2E6LA 5J1EA 3VQAA 4BQLA 3PO5A 3RWUA 2E5LK 2UUCK 1SL1A 2HW3A 1JXEA 1NJWA 3OYAA 2OCEA 1NK0A 4O8UA 4W5QA 3K5LA 3M5RA 1LW2A 4L3QA 4K8XA 4DLGA 1G99A 3DRSA 4FVMA 5KPZA 2QWOA 3A5LC 5BN9A 1WSIA 5AQXA 4YOYA 4I6MA 2XY6A 4CJPA 1RTJA 1VSEA 4KH6A 3AA5X 3ZX3A 3EY1A 4JI3K 1NGHA 5KPRA 3ZT0A 4FJHA 1Z05A 4LC9B 5CYQA 1RNHA 1NG9A 4WQ4A 1HNZK 3CM5A 1BIUA 2G8IA 4ZTFA 4FM1A 1HNVA 1WNSA 2P9SA 1HJOA 3L8BA 4FPBA 2HHXA 3HSCA 1OH8A 1KVCA 1HYSA 2ASOA 4BR5A 1XUPO 3H1VX 4DS4A 3OYMA 4DFMA 1JKHA 3UB5A 4CGGA 4CIGA 4KHUA 2FBXA 3OYLA 4Y1CA 3QFPA 4DQIA 4CVNE 2IGIA 1J5EK 1N34K 3SZ2A 4FPAA 3U3GA 1LCUA 4CJVA 1YIJN 3QEWA 3S9HA 3D45A 4J2DA 4KHWA 4GMJB 4FYDA 4DSFA 3ZT4A 4JN4A 4CW7B 3CCSN 3WQUA 1ZC6A 5AQSA 2IVOA 3O9SA 1LWCA 1NMNA 1BG3A 4CESA 5IWAK 3LZJA 4HHTA 3VPZA 4CGJA 4C1NK 4CEFA 3SQ1A 3A8YA 3CF5L 4Z4CA 3DYAA 3H3NO 4ILJA 3AVFA 4G1QA 1ZBHA 4XIUA 4KAZA 5JS1A 5KRSA 4FWOA 4DV4K 2E2QA 4EHTA 2G8WA 1J5OA 4BR2A 4WYBA 1HKCA 2P1JA 3M8SA 1JLGA 4K43A 4CD3A 3OA9A 4LFAK 3VN5A 4Z4EA 4FZZA 1BQMA 1EWRA 3LL3A 4DQRA 3NDKA 4CJTA 2YNHA 2ZJRL 3SPZA 2KHOA 2WUSA 1Z6RA 4A59A 1HKBA 4Z4HA 1RTIA 3LM9A 3LPUA 1VQ4N 5AZJB 4B1XB 5SWMA 3I56N 2RPIA 1F21A 1RBVA 1HMVA 3SNNA 3NE6A 2NRXA 1T6DA 4NCGA 3VQ6A 3F2KA 4K0KK 4DFPA 3C6UA 3THYA 1I3AA 2ASPA 1WBBA 1L3VA 5BPLA 3VQ7A 4QOZB 3OJUA 1RFQA 1ASVA 2EX3A 4OO1J 1JLCA 1VAZA 3TPQA 2Z1IA 3QBWA 3VQDA 4CZMA 1UA1A 2PYLA 2Y1JA 1YTUA 5BRHA 3D2EB 1KFSA 4FOIA 1S1XA 3HOSA 3L2UA 2F8SA 3MCPA 3C6HA 4LD0A 4FZYA 1EQYA 4JS5A 2ZF5O 4PL8A 2E1ZA 3OHRA 3HI0A 1ZXOA 5MLCQ 2JGUA 1K8KA 4I9QA 1FKOA 5T7BA 1RT4A 3I55N 2VG5A 4M7YA 4W5RA 3ZETB 3THXB 3FZKA 5I42A 4RW8A 3AY9A 3MXJA 3DOLA 3OYHA 2FSNA 3AAQA 4FLYA 1GOCA 4C8MA 3ENHA 3LWMA 4B1ZA 2FC0A 3CQ8A 5DM7L 4O0IA 3SMPA 3HBTA 1VSFA 1N33K 5F0XA 4JI8K 1RDUA 4DTUA 2XY7A 4YDUA 4O4GA 3PX0A 3SUNA 4HCBA 3R9PA 4X62K 1JLEA 3K5OA 1G15A 4ZTJA 3KZBA 3EE8A 3QETA 5HRRA 4O8KA 1KAXA 1S9EA 4Z0UA 3CETA 3AGRA 4WQ5C 5LL6Z 3VF4A 4LF4K 4WCEL 3SMSA 4MDBA 1YXQA 4CJ4A 4IO9L 1KTQA 1SV5A 3CJ9A 4A2BA 4CJSA 3LP1A 2PZSA 2V51B 1XNRK 3D2FB 1SL0A 1BU6O 4B3TK 3WUHA 4JHDB 2QWQA 1NK5A 4DSIA 3C0BA 4JK9A 5JICA 4FJ9A 4BRHA 1EX4A 4B3SK 2O8CB 2VQFK 5BN8A 1QE1A 3HYFA 1WSEA 2HSTA 1MA9B 4FWPA 4GY2B 2Y1IA 2OZSA 5LMUK 1BI4A 2NRRA 4LF8K 5J2MA 2DFFA 1YAGA 4LSLA 1X9SA 1BISA 4ELVA 4CK3A 3CFPA 4CJQA 1VQPN 1OVYA 3K9JA 4CZFA 4N5SA 4BRFA 3P38A 4AILC 3SJJA 2IDOA 4W5TA 1MDUB 2D4WA 1WBDA 1Q82O 4J2AA 1W7AA 4F2SA 1RTHA 3AVHA 4B9TA 3OW2M 4EHUA 1NK7A 4KHQA 1YVUA 3OBWA 4IKFA 2RF2A 4GVMA 5AQKA 4A5BA 4H0VB 5I3UA 1T7PA 1VQ6N 2VWBA 1GLAG 4DS5A 3PLAA 4NYNA 4XH5A 3O80A 4B9QA 4YORA 3RSEA 4LF5K 4XEIA 3PSIA 2CH5A 4OPJA 3S3MA 3ZSVA 3OYKA 4JKGB 4CEOA 4KV8A 3KLEA 3L0QA 3G71N 1GLFO 2QWPA 4CBWA 2D1KA 5M1QA 2IIRA 4WFAL 3PIOL 3BF1A 2F9TA 4JAXA 1NWKA 4CHYA 1YI2N 5BPNA 5GAHP 2YHAA 1D9DA 1J53A 4CFCA 3V81A 1ASWA 3VF2A 3VEWA 1IBKK 3SQ2A 3JAMO 3Q7BA 1WSJA 1KLNA 1IV0A 3UKUA 4E19A 2BH1A 3LP2A 4B3RK 1UA0A 2P9NB 4RTFD 3MXIA 2P5GA 2P51A 4WE1A 3TAMA 4LY7A 4IXCA 4BR9A 5TKYA 4IDKA 3V1OA 3KLFA 3B6OA 2Q0RA 4CBUA 2PY5A 1B9DA 3DLEA 1GLEG 4BRNA 3NFAA 3BUZB 3L4QA 3AVKA 1RT3A 5BR9A 3MECA 2X6NA 4W5NA 2QTDA 3MWTA 1VQ7N 5B8HA 4GV9A 1HNIA 2E20A 4NLCA 4AHTA 4PUOA 5GADP 3SAGA 1MU2A 3WNEA 2J4RA 2A1RA 2VGMA 4JKAA 3KWGA 2W40A 3OYBA 4I7FA 5M1PA 2OA8A 1ZYQA 2FF6A 3CYMA 4CBXA 4FXDA 3O4QA 1E3MA 3DMJA 1NK6A 1RDBA 1BWFO 4BGAA 4FJXA 3KK3A 5SZTA 1GLLO 1S1UA 2IOCA 3AVIA 4H5VA 1Q9YA 2HOEA 4AHVA 1FJGK 4DTJA 2LSNA 3HSTB 3AA4A 4YOVA 4M42A 4JI0K 4NYFA 4JS4A 1Y64A 3ZSWA 1C0MA 3O1BA 3LM2A 1D9FA 4GKJK 2IS3A 1HQUA 3JSMA 4FJ8A 4IZ9A 4FLWA 4CIFA 4E1JA 3AO5A 1NOZA 3E9OA 1S22A 2HVIA 4U7BA 1REVA 2UYTA 2RE2A 4H0PA 1M90O 3O1WA 4PQUA 1DEJA 2Q1NA 5AFUH 1A5XA 5EVZA 3IG1A 1DGKN 3NHGA 3DRPA 3CJ1A 5TKWA 3UKRA 3LAKA 4M3YA 1VQLN 1TUUA 2EWSA 2O8FA 1RT6A 4H0OA 4H5NA 3AVAA 3SJHA 5LMNK 1ZBLA 1L5UA 3CJBA 4KRFA 3G25A 1T3VA 3M1FA 4NLBA 2P9PB 1RDDA 1TYQB 3K58A 4CZLA 4H0TB 3VTIA 5BPMA 3J7ZO 1N5YA 4FLUA 5HP1A 1T6CA 2HNDA 4U67L 4CZIA 1VSJA 4FWNA 3TSQA 4CI6A 1NM1A 2KKZA 2ITMA 2FXUA 3NGZA 3KK2A 3VA0A 4CJFA 3ZEUA 1TKXA 3SAHA 3S3NA 4A2AA 3NF7A 2YHYA 1CXUA 1XI1A 2O8EB 4DFKA 4DB3A 1RDAA 4B9NA 1NKBA 4CHQA 2QWMA 1IO2A 2P5OA 1U49A 4CERA 5M1OA 1OH5A 5F2RA 3U9DA 3VQBA 3AA3A 2KZMA 2QA4N 3SUQA 2O8BA 3A2FA 1O1WA 3CC4N 3EKUA 4CZEA 4NXNK 1WSGA 3DXMA 4FM2A 5K14A 5JLFA 3O8MA 1S6PA 5DMRA 4JKDA 4CZHA 1BCMA 4CK1A 1RCHA 4LFCK 3P31A 4OKJA 3WEEA 5AQGA 3ULEA 4JI7K 3M8PA 2G8KA 5HL7L 3HO1A 3O4WA 5EX5A 3TAQA 3C6TA 4LH4A 4O5BA 1TAUA 4ILHA 3LWLA 3LANA 1Q18A 3NH0A 4CGFA 2OPRA 2G8FA 3QLHA 3ZSRA 3OBYA 4JKCA 2JWLA 4HVJA 3RR8A 3V1QA 4BQZA 2V7YA 4BRGA 3DOKA 4MFBA 3LDNA 2Q0UA 2QI2A 1JL2A 1KVBA 2O8DB 2UXBK 1QQMA 3VEXA 3ZT3A
chains in the Genus database with same CATH topology
5SWMA 1WSFA 3AO1A 2RPIA 4OKEA 3VA3A 1IKXA 1F21A 1HMVA 1RBVA 3NE6A 4DTPA 3SNNA 4NCGA 3LAMA 3RRHA 3KLHA 3PX4A 3B6PA 3VQ6A 4E7IA 1QSSA 2KW4A 3M8RA 4FJJA 3SYZA 4DU1A 3ZSYA 4DFPA 3C6UA 3AVMA 1I3AA 3NAEA 1KRPA 1L3VA 5HBMA 3T19A 2HHWA 2KQ2A 1WAJA 3AVJA 4H4MA 3VQ7A 4QOZB 1JXBA 3HPHA 3NF6A 2Z1HA 3OJUA 3NGYA 1Q8IA 2EX3A 1ASVA 4CECA 4CFDA 1L3TA 1EP4A 4DQSA 1JLCA 4E1NA 1TKTA 1Q9XA 4FW1A 4BDYA 1TK8A 4DG1A 2Z1IA 1KVAA 2HHTA 4FZXC 2JLEA 4ELUA 2O4GA 3KK1A 3VQDA 4CIEA 3LP3A 4CJRA 1RBRA 3U6FA 1UA1A 1Z26A 2Y1JA 2PYLA 1YTUA 4O0JA 1KFSA 1NJXA 1S1XA 3U3YA 4PWDA 1NJZA 3L2UA 4IFYA 1SKWA 3DI6A 3VQ8A 1C0TA 4M3ZA 2F8SA 5HROA 4LD0A 3EYZA 1WSHA 4FJIA 1SUQA 1A5WA 3ZT3A 4FZYA 3G10A 4JS5A 3QIOA 1L3SA 3K5MA 4IFVA 1XHZA 4KB0A 5FDLA 3AVNA 3KD5E 3O3HA 4W5OA 4OJRA 3PY8A 1U04A 2DFEA 1C1BA 3RMAA 1BGXT 4AHUA 4CHPA 2JGUA 4OPKA 1TVRA 4FJMA 3TI0A 3NH2A 3HP9A 1LAWA 4I9QA 1L3UA 2B5JA 1FKOA 5T7BA 3NF9A 5KGWA 3AVLA 5CYMA 4B8CA 2VWJA 4DU3A 1RT4A 2HMIA 2VG5A 4M45A 3CFOA 3RMDA 4W5RA 4M3WA 5I42A 4RW8A 2BANA 3VQCA 1I39A 3DOLA 3MXJA 4RW6A 3HT3A 3OYHA 3V9SA 4N41A 3LZIA 4CGDA 4HCCA 3QO9A 3K57A 4FLYA 4E7LA 2QK9A 2KFNA 1GOCA 4OLBA 3DLRA 2ZQBA 4C8MA 3TR8A 2OPPA 3LWMA 1WLJA 2G8VA 2FC0A 4CJ5A 3CQ8A 4O0IA 3ITHA 2OYQA 3DRRA 1VSFA 3TWHA 4LH5A 1CZBA 1HQEA 4DTUA 4FK0A 2XY7A 4O4GA 3P83D 3PX0A 3SUNA 1U45A 3PO4A 3VQ9A 4DSJA 4C8LA 4HCBA 4PY5A 1JLEA 2OPSA 1R0AA 3P1GA 4O55A 4CJ3A 3OYGA 4F3OA 3K5OA 2QXFA 4M3RA 1G15A 4ZTJA 4JRQA 1NK8A 1NKEA 1QTMA 2BGGA 3V9ZA 2DY4A 3QETA 4JRPA 4CEBA 3KLIA 5HRRA 1A5VA 2FBYA 4Z0UA 1S9EA 3HK2A 1VSDA 4YNQA 4NCBA 2GBZA 4CJKA 5KRTA 2HHQA 1VSKA 3SUPA 4N76A 3DLKA 1NOYA 1XC9A 1U48A 4FJNA 3QESA 4CJ4A 1JL1A 4F8RA 4OKKA 1KTQA 1SV5A 2YKMA 4CJSA 3LP1A 2PZSA 1CLQA 1QSYA 2VWKA 4F4KA 1SL0A 1RT1A 5KTQA 1VK0A 4IG3A 3HXMA 2G8HA 4KHYA 2HHSA 1VRTA 1RBSA 4YFUA 3OYIA 3ZSXA 4DSKA 1NK5A 3DLHA 4DSIA 4FJ9A 1QHTA 1EX4A 4FW2A 1QE1A 4AHRA 3V9XA 3HYFA 1WSEA 2QKBA 3ALYA 3ISNC 1WN7A 2Y1IA 2PYJA 1IKVA 2OZSA 3AV9A 1BI4A 1BIZA 3ASMA 4CCHA 4F2RA 5C24A 4GW6A 3RTVA 5J2MA 3AO2A 1U4BA 4ID5A 3OS1A 3QINA 2DFFA 3BGRA 4LSLA 4JLHA 4OGCA 1BISA 3OYEA 4CK3A 3CFPA 4CJQA 3O3GA 1X9SA 3AVCA 2KZZA 5CZ2A 2Z1GA 1J54A 3PUFA 4ID1A 4AH9A 4N5SA 4FCYA 4J2EA 5FROA 4AILC 3SJJA 1FXXA 1EXQA 2IDOA 4B08A 4W5TA 3RRGA 2HNYA 4J2AA 1TKDA 4F2SA 1Z25A 1EETA 1RTHA 3AVHA 3K2PA 3TAGA 1SKRA 3OY9A 3ULDA 1KCFA 2X78A 4B9TA 4Z4GA 1RILA 3L2WA 3E01A 1NK7A 4KHQA 1JLBA 1YVUA 4IKFA 2D0AA 3NCIA 2RF2A 4GVMA 3V9UA 4DF4A 3FFIA 3ZT1A 3AVBA 4M41A 4CF9A 4Q5VA 4E7HA 5I3UA 3THVA 1T7PA 1K6YA 4DS5A 2OZMA 3TANA 4NYNA 4FJ7A 1KFDA 4E89A 4C8NA 4I2PA 4RW7A 3QIPA 2ITGA 2XRIA 3S3MA 4OPJA 3L2VA 3ZSVA 3OYKA 3C95A 4CEOA 4KV8A 3KLEA 2O4IA 2D0CA 1T03A 3QERA 3L3VA 1IH7A 3UIQA 1YT3A 3KKRA 3PX6A 2YHBA 3BDPA 1NK4A 4J2BA 3ZSZA 3C94A 3KD1E 1X1PA 3P5JA 3TAPA 1FK9A 4E7JA 3WNGA 3EZ5A 4CHYA 5HRPA 5HLFA 4KI4A 3SPYA 3QEPA 3SQ0A 2HB5A 3HVRA 4DSLA 4Z4IA 3HM9A 2YHAA 2XY5A 1D9DA 4FJ5A 4FJGA 1J53A 4DMNA 3ZSQA 4B9SA 3IRXA 2DFHA 3KIOA 2NUBA 3OYNA 1RBTA 4N47A 4Y1DA 4CFCA 3MAQA 3CFRA 3V81A 3RMBA 4DTRA 1ASWA 2RN2A 3V1RA 3O4NA 1SKSA 3KLGA 1LWEA 1TAQA 3AVGA 3MXMA 4OLAA 4FK4A 4B9MA 2KFZA 2DTUA 1S1TA 3JYTA 2A1SA 4H8KA 4BE2A 1W9HA 3LPTA 1C1CA 3MEDA 2IC3A 3OYCA 4DTSA 1WSJA 1KLNA 2G8UA 4KHNA 4E19A 3WNHA 3LP2A 1D8YA 1UA0A 2F8TA 1S9GA 4BE1A 3MXIA 5HRNA 2P5GA 4M3UA 2P51A 4WE1A 4CEQA 3TAMA 3OS0A 3S3OA 4LY7A 4CF0A 3QNNA 1DTQA 3SQ4A 4QAGA 4IDKA 3V1OA 3KLFA 3V9WA 4CHOA 3B6OA 3VQEA 3ZSOA 2PY5A 2GV9A 1B9DA 1LW0A 3DLEA 4E1MA 4CE9A 3F73A 3AA2A 1IKWA 3NFAA 3V6DA 2B6AA 5E41A 4BDZA 1U47A 4I2QA 3LP0A 4BWJA 3AVKA 1RT3A 3MECA 1NK9A 4E3SA 2X6NA 1CZ9A 1XHXA 4W5NA 4ZHRA 1SL2A 4DQQA 4KB1A 3I8DA 2IAJA 2B4JA 4HUFA 5C25A 2X74A 4CEAA 1HNIA 4AHTA 1YTAA 4F3TA 4PUOA 1HYVA 1QQCA 2HNZA 3DLGA 5DK5A 1MU2A 4CHZA 1TK0A 3WNEA 4B9LA 2YKNA 4DTNA 3V4IA 2A1RA 4UQGA 2ZE2A 4QCLA 3AO4A 3D0PA 4C8KA 4B3OA 2W42A 2WONA 1UWBA 4LSNA 3OYBA 1NJYA 4I7FA 3HPGA 3G0ZA 2OA8A 4K8ZA 3M8QA 1D5AA 1HRHA 4KKOA 1ZYQA 1NKCA 1S5JA 3PV8A 3CYMA 4KFBA 3HL8A 3DLBA 3KJVA 4TSXA 3HPOA 4FXDA 3O4QA 3K5NA 3DMJA 4CJWA 1NK6A 2EHGA 3TARA 4DWIA 1RDBA 4DTMA 1KSPA 1C1AA 5KI6A 4CF2A 1UAXA 1DLOA 3TAEA 3OJSA 1BL3A 1J9AA 3HVTA 2XO7A 4FJXA 3KK3A 4CGIA 4C8OA 4EZ9A 1CXQA 3T1AA 1S1UA 2IOCA 3AVIA 3MEGA 3WNFA 5SZTA 3SUOA 4AHVA 3SCXA 1Q9YA 1BQNA 2HHUA 4DTJA 1JLAA 3KTQA 2LSNA 4RG8A 4Q0BA 2AJQA 3ZCMA 3HSTB 3AA4A 3KKSA 2ETJA 4M42A 2ZD1A 3SI6A 4NYFA 2YV0X 4CEDA 4JS4A 3NBPA 1RBUA 3OYFA 3QEXA 1VSHA 3ZSWA 3SQ2A 2GUIA 3VQ5A 3HP6A 1C0MA 1D9FA 1C6VA 2R7YA 1ASUA 2FBVA 1XWLA 2IS3A 5CY4A 3L3UA 5EU7A 5KGXA 4I9LA 1VSIA 1QSLA 1HQUA 1BI4B 2E6LA 3JSMA 4FJ8A 5J1EA 4MQ3A 1N6QA 3VQAA 4FLWA 2E4LA 4CIFA 1IKYA 2VG6A 3AO5A 3TAFA 1UOCA 1NOZA 3PO5A 3OYJA 3RWUA 1SL1A 2HW3A 3SV3A 1JXEA 1TV6A 1NJWA 1HYZA 2D0BA 4PA1A 4CJUA 4M3XA 4ELTA 3OYAA 2HVIA 1REVA 2XY8A 1NK0A 4CHNA 4W5QA 3K5LA 4IBNA 4PQUA 1ITGA 4DTOA 1A5XA 1LW2A 4K8XA 1B92A 4M3TA 4DLGA 3IG1A 1S1WA 3DRSA 1HPZA 4FVMA 3DRPA 3IS9A 3OYDA 1WSIA 3NHGA 4FLXA 1Y97A 1W0HA 2XY6A 1X9MA 4CJPA 4FJKA 1RTJA 4HUGA 4BACA 2XHBA 2OPQA 1S1VA 1VSEA 4FLVA 1RT5A 3LAKA 3O3FA 4M3YA 4IG0A 4FJLA 1LWFA 3AA5X 3EY1A 4FLZA 1RT6A 2RKIA 4RW9A 4CFAA 3ZT0A 4FJHA 1TK5A 3VQ4A 1TGOA 3AVAA 3VQPA 1VRUA 4B9VA 1ZBLA 1L5UA 5CYQA 4KRFA 4CJLA 1RNHA 3L2RA 5C42A 3HJFA 2YNFA 2KTQA 4NCAA 3LALA 1GOBA 3CM5A 1BIUA 1VSMA 4OGEA 1WAFA 4AHCA 2G8IA 3DM2A 4DFJA 3LDSA 4FM1A 1HNVA 2YNIA 5J2NA 4ZTFA 1RDDA 1WNSA 3I0RA 3L8BA 1KLMA 1S6QA 2HHXA 3K58A 1JLQA 1N5YA 3OVNA 4FLUA 5HP1A 2BE2A 2HNDA 3QEIA 1KVCA 1VSJA 1HYSA 2WOMA 1ZBIA 3IAYA 4EZ6A 5HRSA 4DS4A 4KI6A 3OYMA 4DFMA 4BE0A 1JKHA 2VG7A 2E6MA 4CGGA 4CIGA 4CF1A 4KHUA 1RDCA 1ZBUA 5J2PA 3NGZA 2FBXA 3OYLA 4Y1CA 3KK2A 3VA0A 1GOAA 4ELVA 4CJFA 4FM0A 4DQIA 2Z1JA 1RT2A 2F96A 2IGIA 4E0DA 4BWMA 3SZ2A 2BDPA 1TKXA 3U3GA 3S3NA 1HJRA 4CJVA 3QEWA 3NF7A 3S9HA 1CXUA 3D45A 1XI1A 4J2DA 1T8EA 4KHWA 4AHSA 4GMJB 4FYDA 4DSFA 3ZT4A 4DFKA 2X6SA 1TKZA 1RDAA 4B9NA 1NKBA 4CHQA 5D3GA 4O44A 2HHVA 1IO2A 1RT7A 2P5OA 1U49A 4CERA 1C0UA 4KO0A 4DF8A 3VQBA 1LWCA 3AA3A 1DTTA 2KZMA 1BHLA 3RMCA 3F9KA 1QS4A 1TL1A 4CESA 1LAVA 1VSLA 4H4OA 1IG9A 3NF8A 3LZJA 1JLFA 3SUQA 4HHTA 3L2QA 3A2FA 1O1WA 3AO3A 4CGJA 4KTWA 1WSGA 3OS2A 3MEEA 4CEFA 3SQ1A 1LV5A 3T3FA 4Z4CA 5K14A 3DYAA 4FM2A 4KPYA 5FRNA 4ICLA 3AVFA 4G1QA 2I5JA 1ZBHA 4KREA 3QNOA 4FLTA 3CM6A 4XIUA 1T05A 2YNGA 4DSEA 4KAZA 1RTDA 5JS1A 3I0SA 1S6PA 4CEZA 2ATQA 5DMRA 4CFBA 5KRSA 5CZ1A 4N56A 4FK2A 1BCMA 4BDPA 5FRMA 4CK1A 4OVLA 4CEEA 2D5RA 1RCHA 4OKJA 2G8WA 2QKKA 4KHSA 1EKEA 1J5OA 4R5PA 4CGHA 3M8PA 4B8AB 2G8KA 1X9WA 3ZT2A 2P1JA 4HUEA 3HO1A 2Q3SA 1TL3A 3M8SA 1JLGA 3TAQA 4L8RB 5J2QA 4Z4FA 1B9FA 3C6TA 4LH4A 1ZBFA 4O5BA 4DU4A 1TAUA 2FBTA 3LWLA 3LANA 4DQPA 3NH0A 4CGFA 2OPRA 3SV4A 4E7KA 2G8FA 3VN5A 4KTQA 3QLHA 4DTXA 4Z4EA 3ZSRA 4FZZA 1BQMA 4EP4A 3H08A 3RR7A 3VQQA 4HVJA 3CG7A 4DLEA 4DQRA 3NDKA 3RR8A 3V1QA 4RW4A 4CJTA 3K59A 3DOKA 2YNHA 5JS2A 3NGIA 4MFBA 4B9UA 4CJEA 1FKPA 4HTUA 3SPZA 4CK2A 3NH1A 3TABA 4EP5A 1JL2A 1KVBA 4Z4HA 4CF8A 1RTIA 2HVHA 4KTZA 3QEVA 3LPUA 1BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SWM A;  1WSF A;  3AO1 A;  2RPI A;  4OKE A;  3VA3 A;  1IKX A;  1F21 A;  1HMV A;  1RBV A;  3NE6 A;  4DTP A;  3SNN A;  4NCG A;  3LAM A;  3RRH A;  3KLH A;  3PX4 A;  3B6P A;  3VQ6 A;  4E7I A;  1QSS A;  2KW4 A;  3M8R A;  4FJJ A;  3SYZ A;  4DU1 A;  3ZSY A;  4DFP A;  3C6U A;  3AVM A;  1I3A A;  3NAE A;  1KRP A;  1L3V A;  5HBM A;  3T19 A;  2HHW A;  2KQ2 A;  1WAJ A;  3AVJ A;  4H4M A;  3VQ7 A;  4QOZ B;  1JXB A;  3HPH A;  3NF6 A;  2Z1H A;  3OJU A;  3NGY A;  1Q8I A;  2EX3 A;  1ASV A;  4CEC A;  4CFD A;  1L3T A;  1EP4 A;  4DQS A;  1JLC A;  4E1N A;  1TKT A;  1Q9X A;  4FW1 A;  4BDY A;  1TK8 A;  4DG1 A;  2Z1I A;  1KVA A;  2HHT A;  4FZX C;  2JLE A;  4ELU A;  2O4G A;  3KK1 A;  3VQD A;  4CIE A;  3LP3 A;  4CJR A;  1RBR A;  3U6F A;  1UA1 A;  1Z26 A;  2Y1J A;  2PYL A;  1YTU A;  4O0J A;  1KFS A;  1NJX A;  1S1X A;  3U3Y A;  4PWD A;  1NJZ A;  3L2U A;  4IFY A;  1SKW A;  3DI6 A;  3VQ8 A;  1C0T A;  4M3Z A;  2F8S A;  5HRO A;  4LD0 A;  3EYZ A;  1WSH A;  4FJI A;  1SUQ A;  1A5W A;  3ZT3 A;  4FZY A;  3G10 A;  4JS5 A;  3QIO A;  1L3S A;  3K5M A;  4IFV A;  1XHZ A;  4KB0 A;  5FDL A;  3AVN A;  3KD5 E;  3O3H A;  4W5O A;  4OJR A;  3PY8 A;  1U04 A;  2DFE A;  1C1B A;  3RMA A;  1BGX T;  4AHU A;  4CHP A;  2JGU A;  4OPK A;  1TVR A;  4FJM A;  3TI0 A;  3NH2 A;  3HP9 A;  1LAW A;  4I9Q A;  1L3U A;  2B5J A;  1FKO A;  5T7B A;  3NF9 A;  5KGW A;  3AVL A;  5CYM A;  4B8C A;  2VWJ A;  4DU3 A;  1RT4 A;  2HMI A;  2VG5 A;  4M45 A;  3CFO A;  3RMD A;  4W5R A;  4M3W A;  5I42 A;  4RW8 A;  2BAN A;  3VQC A;  1I39 A;  3DOL A;  3MXJ A;  4RW6 A;  3HT3 A;  3OYH A;  3V9S A;  4N41 A;  3LZI A;  4CGD A;  4HCC A;  3QO9 A;  3K57 A;  4FLY A;  4E7L A;  2QK9 A;  2KFN A;  1GOC A;  4OLB A;  3DLR A;  2ZQB A;  4C8M A;  3TR8 A;  2OPP A;  3LWM A;  1WLJ A;  2G8V A;  2FC0 A;  4CJ5 A;  3CQ8 A;  4O0I A;  3ITH A;  2OYQ A;  3DRR A;  1VSF A;  3TWH A;  4LH5 A;  1CZB A;  1HQE A;  4DTU A;  4FK0 A;  2XY7 A;  4O4G A;  3P83 D;  3PX0 A;  3SUN A;  1U45 A;  3PO4 A;  3VQ9 A;  4DSJ A;  4C8L A;  4HCB A;  4PY5 A;  1JLE A;  2OPS A;  1R0A A;  3P1G A;  4O55 A;  4CJ3 A;  3OYG A;  4F3O A;  3K5O A;  2QXF A;  4M3R A;  1G15 A;  4ZTJ A;  4JRQ A;  1NK8 A;  1NKE A;  1QTM A;  2BGG A;  3V9Z A;  2DY4 A;  3QET A;  4JRP A;  4CEB A;  3KLI A;  5HRR A;  1A5V A;  2FBY A;  4Z0U A;  1S9E A;  3HK2 A;  1VSD A;  4YNQ A;  4NCB A;  2GBZ A;  4CJK A;  5KRT A;  2HHQ A;  1VSK A;  3SUP A;  4N76 A;  3DLK A;  1NOY A;  1XC9 A;  1U48 A;  4FJN A;  3QES A;  4CJ4 A;  1JL1 A;  4F8R A;  4OKK A;  1KTQ A;  1SV5 A;  2YKM A;  4CJS A;  3LP1 A;  2PZS A;  1CLQ A;  1QSY A;  2VWK A;  4F4K A;  1SL0 A;  1RT1 A;  5KTQ A;  1VK0 A;  4IG3 A;  3HXM A;  2G8H A;  4KHY A;  2HHS A;  1VRT A;  1RBS A;  4YFU A;  3OYI A;  3ZSX A;  4DSK A;  1NK5 A;  3DLH A;  4DSI A;  4FJ9 A;  1QHT A;  1EX4 A;  4FW2 A;  1QE1 A;  4AHR A;  3V9X A;  3HYF A;  1WSE A;  2QKB A;  3ALY A;  3ISN C;  1WN7 A;  2Y1I A;  2PYJ A;  1IKV A;  2OZS A;  3AV9 A;  1BI4 A;  1BIZ A;  3ASM A;  4CCH A;  4F2R A;  5C24 A;  4GW6 A;  3RTV A;  5J2M A;  3AO2 A;  1U4B A;  4ID5 A;  3OS1 A;  3QIN A;  2DFF A;  3BGR A;  4LSL A;  4JLH A;  4OGC A;  1BIS A;  3OYE A;  4CK3 A;  3CFP A;  4CJQ A;  3O3G A;  1X9S A;  3AVC A;  2KZZ A;  5CZ2 A;  2Z1G A;  1J54 A;  3PUF A;  4ID1 A;  4AH9 A;  4N5S A;  4FCY A;  4J2E A;  5FRO A;  4AIL C;  3SJJ A;  1FXX A;  1EXQ A;  2IDO A;  4B08 A;  4W5T A;  3RRG A;  2HNY A;  4J2A A;  1TKD A;  4F2S A;  1Z25 A;  1EET A;  1RTH A;  3AVH A;  3K2P A;  3TAG A;  1SKR A;  3OY9 A;  3ULD A;  1KCF A;  2X78 A;  4B9T A;  4Z4G A;  1RIL A;  3L2W A;  3E01 A;  1NK7 A;  4KHQ A;  1JLB A;  1YVU A;  4IKF A;  2D0A A;  3NCI A;  2RF2 A;  4GVM A;  3V9U A;  4DF4 A;  3FFI A;  3ZT1 A;  3AVB A;  4M41 A;  4CF9 A;  4Q5V A;  4E7H A;  5I3U A;  3THV A;  1T7P A;  1K6Y A;  4DS5 A;  2OZM A;  3TAN A;  4NYN A;  4FJ7 A;  1KFD A;  4E89 A;  4C8N A;  4I2P A;  4RW7 A;  3QIP A;  2ITG A;  2XRI A;  3S3M A;  4OPJ A;  3L2V A;  3ZSV A;  3OYK A;  3C95 A;  4CEO A;  4KV8 A;  3KLE A;  2O4I A;  2D0C A;  1T03 A;  3QER A;  3L3V A;  1IH7 A;  3UIQ A;  1YT3 A;  3KKR A;  3PX6 A;  2YHB A;  3BDP A;  1NK4 A;  4J2B A;  3ZSZ A;  3C94 A;  3KD1 E;  1X1P A;  3P5J A;  3TAP A;  1FK9 A;  4E7J A;  3WNG A;  3EZ5 A;  4CHY A;  5HRP A;  5HLF A;  4KI4 A;  3SPY A;  3QEP A;  3SQ0 A;  2HB5 A;  3HVR A;  4DSL A;  4Z4I A;  3HM9 A;  2YHA A;  2XY5 A;  1D9D A;  4FJ5 A;  4FJG A;  1J53 A;  4DMN A;  3ZSQ A;  4B9S A;  3IRX A;  2DFH A;  3KIO A;  2NUB A;  3OYN A;  1RBT A;  4N47 A;  4Y1D A;  4CFC A;  3MAQ A;  3CFR A;  3V81 A;  3RMB A;  4DTR A;  1ASW A;  2RN2 A;  3V1R A;  3O4N A;  1SKS A;  3KLG A;  1LWE A;  1TAQ A;  3AVG A;  3MXM A;  4OLA A;  4FK4 A;  4B9M A;  2KFZ A;  2DTU A;  1S1T A;  3JYT A;  2A1S A;  4H8K A;  4BE2 A;  1W9H A;  3LPT A;  1C1C A;  3MED A;  2IC3 A;  3OYC A;  4DTS A;  1WSJ A;  1KLN A;  2G8U A;  4KHN A;  4E19 A;  3WNH A;  3LP2 A;  1D8Y A;  1UA0 A;  2F8T A;  1S9G A;  4BE1 A;  3MXI A;  5HRN A;  2P5G A;  4M3U A;  2P51 A;  4WE1 A;  4CEQ A;  3TAM A;  3OS0 A;  3S3O A;  4LY7 A;  4CF0 A;  3QNN A;  1DTQ A;  3SQ4 A;  4QAG A;  4IDK A;  3V1O A;  3KLF A;  3V9W A;  4CHO A;  3B6O A;  3VQE A;  3ZSO A;  2PY5 A;  2GV9 A;  1B9D A;  1LW0 A;  3DLE A;  4E1M A;  4CE9 A;  3F73 A;  3AA2 A;  1IKW A;  3NFA A;  3V6D A;  2B6A A;  5E41 A;  4BDZ A;  1U47 A;  4I2Q A;  3LP0 A;  4BWJ A;  3AVK A;  1RT3 A;  3MEC A;  1NK9 A;  4E3S A;  2X6N A;  1CZ9 A;  1XHX A;  4W5N A;  4ZHR A;  1SL2 A;  4DQQ A;  4KB1 A;  3I8D A;  2IAJ A;  2B4J A;  4HUF A;  5C25 A;  2X74 A;  4CEA A;  1HNI A;  4AHT A;  1YTA A;  4F3T A;  4PUO A;  1HYV A;  1QQC A;  2HNZ A;  3DLG A;  5DK5 A;  1MU2 A;  4CHZ A;  1TK0 A;  3WNE A;  4B9L A;  2YKN A;  4DTN A;  3V4I A;  2A1R A;  4UQG A;  2ZE2 A;  4QCL A;  3AO4 A;  3D0P A;  4C8K A;  4B3O A;  2W42 A;  2WON A;  1UWB A;  4LSN A;  3OYB A;  1NJY A;  4I7F A;  3HPG A;  3G0Z A;  2OA8 A;  4K8Z A;  3M8Q A;  1D5A A;  1HRH A;  4KKO A;  1ZYQ A;  1NKC A;  1S5J A;  3PV8 A;  3CYM A;  4KFB A;  3HL8 A;  3DLB A;  3KJV A;  4TSX A;  3HPO A;  4FXD A;  3O4Q A;  3K5N A;  3DMJ A;  4CJW A;  1NK6 A;  2EHG A;  3TAR A;  4DWI A;  1RDB A;  4DTM A;  1KSP A;  1C1A A;  5KI6 A;  4CF2 A;  1UAX A;  1DLO A;  3TAE A;  3OJS A;  1BL3 A;  1J9A A;  3HVT A;  2XO7 A;  4FJX A;  3KK3 A;  4CGI A;  4C8O A;  4EZ9 A;  1CXQ A;  3T1A A;  1S1U A;  2IOC A;  3AVI A;  3MEG A;  3WNF A;  5SZT A;  3SUO A;  4AHV A;  3SCX A;  1Q9Y A;  1BQN A;  2HHU A;  4DTJ A;  1JLA A;  3KTQ A;  2LSN A;  4RG8 A;  4Q0B A;  2AJQ A;  3ZCM A;  3HST B;  3AA4 A;  3KKS A;  2ETJ A;  4M42 A;  2ZD1 A;  3SI6 A;  4NYF A;  2YV0 X;  4CED A;  4JS4 A;  3NBP A;  1RBU A;  3OYF A;  3QEX A;  1VSH A;  3ZSW A;  3SQ2 A;  2GUI A;  3VQ5 A;  3HP6 A;  1C0M A;  1D9F A;  1C6V A;  2R7Y A;  1ASU A;  2FBV A;  1XWL A;  2IS3 A;  5CY4 A;  3L3U A;  5EU7 A;  5KGX A;  4I9L A;  1VSI A;  1QSL A;  1HQU A;  1BI4 B;  2E6L A;  3JSM A;  4FJ8 A;  5J1E A;  4MQ3 A;  1N6Q A;  3VQA A;  4FLW A;  2E4L A;  4CIF A;  1IKY A;  2VG6 A;  3AO5 A;  3TAF A;  1UOC A;  1NOZ A;  3PO5 A;  3OYJ A;  3RWU A;  1SL1 A;  2HW3 A;  3SV3 A;  1JXE A;  1TV6 A;  1NJW A;  1HYZ A;  2D0B A;  4PA1 A;  4CJU A;  4M3X A;  4ELT A;  3OYA A;  2HVI A;  1REV A;  2XY8 A;  1NK0 A;  4CHN A;  4W5Q A;  3K5L A;  4IBN A;  4PQU A;  1ITG A;  4DTO A;  1A5X A;  1LW2 A;  4K8X A;  1B92 A;  4M3T A;  4DLG A;  3IG1 A;  1S1W A;  3DRS A;  1HPZ A;  4FVM A;  3DRP A;  3IS9 A;  3OYD A;  1WSI A;  3NHG A;  4FLX A;  1Y97 A;  1W0H A;  2XY6 A;  1X9M A;  4CJP A;  4FJK A;  1RTJ A;  4HUG A;  4BAC A;  2XHB A;  2OPQ A;  1S1V A;  1VSE A;  4FLV A;  1RT5 A;  3LAK A;  3O3F A;  4M3Y A;  4IG0 A;  4FJL A;  1LWF A;  3AA5 X;  3EY1 A;  4FLZ A;  1RT6 A;  2RKI A;  4RW9 A;  4CFA A;  3ZT0 A;  4FJH A;  1TK5 A;  3VQ4 A;  1TGO A;  3AVA A;  3VQP A;  1VRU A;  4B9V A;  1ZBL A;  1L5U A;  5CYQ A;  4KRF A;  4CJL A;  1RNH A;  3L2R A;  5C42 A;  3HJF A;  2YNF A;  2KTQ A;  4NCA A;  3LAL A;  1GOB A;  3CM5 A;  1BIU A;  1VSM A;  4OGE A;  1WAF A;  4AHC A;  2G8I A;  3DM2 A;  4DFJ A;  3LDS A;  4FM1 A;  1HNV A;  2YNI A;  5J2N A;  4ZTF A;  1RDD A;  1WNS A;  3I0R A;  3L8B A;  1KLM A;  1S6Q A;  2HHX A;  3K58 A;  1JLQ A;  1N5Y A;  3OVN A;  4FLU A;  5HP1 A;  2BE2 A;  2HND A;  3QEI A;  1KVC A;  1VSJ A;  1HYS A;  2WOM A;  1ZBI A;  3IAY A;  4EZ6 A;  5HRS A;  4DS4 A;  4KI6 A;  3OYM A;  4DFM A;  4BE0 A;  1JKH A;  2VG7 A;  2E6M A;  4CGG A;  4CIG A;  4CF1 A;  4KHU A;  1RDC A;  1ZBU A;  5J2P A;  3NGZ A;  2FBX A;  3OYL A;  4Y1C A;  3KK2 A;  3VA0 A;  1GOA A;  4ELV A;  4CJF A;  4FM0 A;  4DQI A;  2Z1J A;  1RT2 A;  2F96 A;  2IGI A;  4E0D A;  4BWM A;  3SZ2 A;  2BDP A;  1TKX A;  3U3G A;  3S3N A;  1HJR A;  4CJV A;  3QEW A;  3NF7 A;  3S9H A;  1CXU A;  3D45 A;  1XI1 A;  4J2D A;  1T8E A;  4KHW A;  4AHS A;  4GMJ B;  4FYD A;  4DSF A;  3ZT4 A;  4DFK A;  2X6S A;  1TKZ A;  1RDA A;  4B9N A;  1NKB A;  4CHQ A;  5D3G A;  4O44 A;  2HHV A;  1IO2 A;  1RT7 A;  2P5O A;  1U49 A;  4CER A;  1C0U A;  4KO0 A;  4DF8 A;  3VQB A;  1LWC A;  3AA3 A;  1DTT A;  2KZM A;  1BHL A;  3RMC A;  3F9K A;  1QS4 A;  1TL1 A;  4CES A;  1LAV A;  1VSL A;  4H4O A;  1IG9 A;  3NF8 A;  3LZJ A;  1JLF A;  3SUQ A;  4HHT A;  3L2Q A;  3A2F A;  1O1W A;  3AO3 A;  4CGJ A;  4KTW A;  1WSG A;  3OS2 A;  3MEE A;  4CEF A;  3SQ1 A;  1LV5 A;  3T3F A;  4Z4C A;  5K14 A;  3DYA A;  4FM2 A;  4KPY A;  5FRN A;  4ICL A;  3AVF A;  4G1Q A;  2I5J A;  1ZBH A;  4KRE A;  3QNO A;  4FLT A;  3CM6 A;  4XIU A;  1T05 A;  2YNG A;  4DSE A;  4KAZ A;  1RTD A;  5JS1 A;  3I0S A;  1S6P A;  4CEZ A;  2ATQ A;  5DMR A;  4CFB A;  5KRS A;  5CZ1 A;  4N56 A;  4FK2 A;  1BCM A;  4BDP A;  5FRM A;  4CK1 A;  4OVL A;  4CEE A;  2D5R A;  1RCH A;  4OKJ A;  2G8W A;  2QKK A;  4KHS A;  1EKE A;  1J5O A;  4R5P A;  4CGH A;  3M8P A;  4B8A B;  2G8K A;  1X9W A;  3ZT2 A;  2P1J A;  4HUE A;  3HO1 A;  2Q3S A;  1TL3 A;  3M8S A;  1JLG A;  3TAQ A;  4L8R B;  5J2Q A;  4Z4F A;  1B9F A;  3C6T A;  4LH4 A;  1ZBF A;  4O5B A;  4DU4 A;  1TAU A;  2FBT A;  3LWL A;  3LAN A;  4DQP A;  3NH0 A;  4CGF A;  2OPR A;  3SV4 A;  4E7K A;  2G8F A;  3VN5 A;  4KTQ A;  3QLH A;  4DTX A;  4Z4E A;  3ZSR A;  4FZZ A;  1BQM A;  4EP4 A;  3H08 A;  3RR7 A;  3VQQ A;  4HVJ A;  3CG7 A;  4DLE A;  4DQR A;  3NDK A;  3RR8 A;  3V1Q A;  4RW4 A;  4CJT A;  3K59 A;  3DOK A;  2YNH A;  5JS2 A;  3NGI A;  4MFB A;  4B9U A;  4CJE A;  1FKP A;  4HTU A;  3SPZ A;  4CK2 A;  3NH1 A;  3TAB A;  4EP5 A;  1JL2 A;  1KVB A;  4Z4H A;  4CF8 A;  1RTI A;  2HVH A;  4KTZ A;  3QEV A;  3LPU A;  1BCO A; 
#chains in the Genus database with same CATH topology
 3CPE A;  1XNQ K;  1WSF A;  3WXI A;  1GLB G;  3Q7C A;  4DTP A;  4JNE A;  3PX4 A;  4FJJ A;  3KLH A;  4E7I A;  4M63 C;  3FLC O;  4YOU A;  3AVM A;  3NAE A;  3T19 A;  2HHW A;  2KQ2 A;  3VEY A;  4GKK K;  3HPH A;  5C2F A;  1Q8I A;  3CCE N;  4CEC A;  3LDL A;  1EP4 A;  1XMO K;  4V19 S;  1TKT A;  4FW1 A;  1TK8 A;  4DG1 A;  2HHT A;  4NXM K;  1BA1 A;  4I6M B;  2YX6 A;  4FZX C;  4JK8 A;  2JLE A;  4ELU A;  1QVF M;  3VEZ A;  3ID6 A;  4DV5 K;  4PWD A;  1NJZ A;  4ISG A;  3I33 A;  1SKW A;  1TUY A;  3IFR A;  4IEI A;  2NRW A;  4IOX A;  2A5X A;  2BUP A;  5HRO A;  3EYZ A;  1WSH A;  1A5W A;  1IG8 A;  1ATS A;  1OKJ A;  4WFN L;  3G10 A;  4WF9 L;  3KK7 A;  3K5M A;  3HRG A;  3UE5 A;  2P9S B;  4IFV A;  4KB0 A;  3AVN A;  3KD5 E;  4OJR A;  4DUY K;  4WQ5 A;  5I9E B;  4FWL A;  4BC3 A;  4AHU A;  4CHP A;  4OPK A;  3QFU A;  1TVR A;  2QM1 A;  3TI0 A;  1LAW A;  3NF9 A;  2WTU A;  5KGW A;  2HMI A;  5CYM A;  5KQ8 A;  4LFB K;  2ZJQ L;  3V9S A;  4N41 A;  4HCC A;  3QO9 A;  3K57 A;  4UY8 O;  1GLD G;  2KFN A;  2OPP A;  1NGI A;  1IBM K;  3DRR A;  3EZW A;  4LH5 A;  1CZB A;  5A2Q O;  1X3N A;  3O9U A;  4FK0 A;  3P83 D;  1U45 A;  2P9U A;  4C8L A;  2OPS A;  4LF9 K;  2QXF A;  4C1N I;  5EXW A;  1NKE A;  3V9Z A;  4X64 K;  4CEB A;  3KLI A;  4PKG A;  4LF7 K;  3SBT A;  3HK2 A;  4JI1 K;  4YNQ A;  1HLU A;  4N76 A;  3DLK A;  1S3X A;  4OKK A;  2YKM A;  1U2V A;  4BRC A;  4RWT A;  1VK0 A;  4IG3 A;  3HXM A;  1VRT A;  1RBS A;  5LY3 A;  3CIP A;  2I7P A;  3ZSX A;  4CZJ A;  3DLH A;  2P9L A;  3GE1 A;  3J7Y P;  3V9X A;  1X9J A;  1S72 N;  2E2O A;  3AV9 A;  4JD2 A;  2YJF A;  3CCJ N;  4YY3 K;  2F9W A;  4GW6 A;  3RTV A;  3AO2 A;  1U4B A;  2ASM A;  3QIN A;  4F3O A;  4JLH A;  3JXU A;  3O3G A;  3AVC A;  3CHW A;  5CZ2 A;  2AA4 A;  1J54 A;  3PUF A;  3GL1 A;  4J2E A;  5FRO A;  4DR3 K;  1TKD A;  2QWR A;  3ULD A;  1KCF A;  2X78 A;  1RIL A;  2E1Y A;  3E01 A;  4G9Z A;  2IVN A;  4M41 A;  4CF9 A;  4Q5V A;  3W3D A;  1KFD A;  5AQI A;  4RW7 A;  4FO0 A;  4DV3 K;  4FOE A;  1X3M A;  1C0F A;  4X66 K;  2H3G X;  3C95 A;  3THY B;  1HUX A;  4IJN A;  3K0S A;  1T03 A;  4F9O A;  3VET A;  3MMV A;  1HPM A;  3PX6 A;  3PIP L;  1NK4 A;  4FWM A;  1X1P A;  1FK9 A;  5LJV A;  1NU0 A;  4E7J A;  4Z4I A;  3SPY A;  2HB5 A;  3HM9 A;  4MO5 A;  3ZX0 A;  3CJA A;  2DFH A;  3KIO A;  2NUB A;  4Y1D A;  1I94 K;  4DTR A;  3V1R A;  4B1W B;  3O4N A;  1LWE A;  3MXM A;  4BRQ A;  3NMU A;  1W9H A;  3LPT A;  3OYC A;  4DTS A;  4DR6 K;  2HF3 A;  5AQL A;  2F8T A;  3WXM B;  2UXC K;  2CGJ A;  4BRI A;  3L4I A;  4JYA K;  5HRN A;  3ZET A;  3S3O A;  3T7Z A;  3QNN A;  4YOX A;  5AQM A;  4CHO A;  5C10 A;  3ZSO A;  1K8K B;  1LW0 A;  4E1M A;  3A5N C;  4CE9 A;  1V4S A;  3AA2 A;  3V6D A;  5KQD A;  4PKH A;  5AQU A;  4BR7 A;  3EKS A;  1CZ9 A;  3THW A;  4WQ4 C;  2IAJ A;  2B4J A;  4HUF A;  5EY4 A;  1NGF A;  1YTA A;  3KVG A;  1HYV A;  3DLG A;  2ZGZ A;  4QS8 A;  5DK5 A;  1XMQ K;  4UQG A;  2ZE2 A;  3AO4 A;  3DXK B;  3D0P A;  3CI5 A;  4C8K A;  1NGJ A;  2W42 A;  1UWB A;  4DQ8 A;  1NJY A;  4K8Z A;  3G0Z A;  5AQJ A;  2P9K B;  5FLX O;  1HRH A;  4C23 A;  4NO7 A;  3HL8 A;  3U9Z A;  3KJV A;  4JHD A;  1P8Z A;  2EHG A;  5C12 A;  4JI4 K;  5GIO A;  4DV1 K;  5KI6 A;  1UAX A;  3HOT A;  1J9A A;  1Q86 O;  2XO7 A;  2F4V K;  4BGB A;  4JI5 K;  4EZ9 A;  3SUO A;  2HHU A;  4RG8 A;  4Q0B A;  4AQY K;  2A3Z A;  3KKS A;  4WFB L;  3SI6 A;  2YV0 X;  1RBU A;  2RHK A;  2HBM A;  5F1X A;  1ASU A;  2VQE K;  5KGX A;  4I9L A;  1VSI A;  1QSL A;  2HMP A;  1BI4 B;  2UUB K;  1N32 K;  2V52 B;  2E4L A;  1IKY A;  2VG6 A;  3ZYY X;  2A6A A;  1UOC A;  4DHY A;  1O13 A;  4ILG B;  3BZK A;  4M3X A;  4HTL A;  4ELT A;  4CHN A;  4IBN A;  2GWJ A;  3GBT A;  2E2P A;  4DTO A;  3SK3 A;  3MN9 A;  1S1W A;  3IS9 A;  4FLX A;  2D0O A;  1W0H A;  1X9M A;  4HUG A;  4JKG A;  2XHB A;  1S1V A;  1VQO N;  3U4L A;  1ATR A;  4FLZ A;  1KAY A;  4CFA A;  1TK5 A;  3VQ4 A;  1TGO A;  1HX1 A;  2W41 A;  1VRU A;  4B9V A;  5ADX A;  3RSE B;  4CJL A;  3L2R A;  2YNF A;  4NCA A;  1VQ8 N;  2YHW A;  4OGE A;  1WAF A;  2UU9 K;  3CXC M;  3DM2 A;  2GUP A;  3LDS A;  4DFJ A;  2UUA K;  3EE9 A;  5FPM A;  1KLM A;  4BR4 A;  4DR4 K;  1D4X A;  3QEI A;  2WOM A;  4GV6 A;  2P9N A;  4FL9 A;  3FZF A;  3O9R A;  1NNE A;  2GTD A;  1ZBU A;  4BRL A;  1YJW N;  1GOA A;  3VGL A;  2UXD K;  2P9I B;  1RT2 A;  3TTC A;  4BWM A;  1VQK N;  2BDP A;  1HJR A;  3ZX2 A;  3UKU B;  1T8E A;  3JS6 A;  3W0L A;  4AHS A;  5AR0 A;  3E1Y A;  2X6S A;  1TKZ A;  3AAP A;  2NRZ A;  4O44 A;  5D3G A;  2HHV A;  4IFE A;  3C6A A;  4CD1 A;  1OVQ A;  1C0U A;  4KO0 A;  3SBG A;  3C65 A;  2NZT A;  1JCG A;  1QS4 A;  1IG9 A;  3H6E A;  4R79 A;  3C7N A;  4RCH A;  1JLF A;  3KWI A;  5JLH A;  3MEE A;  3LDO A;  2WC9 A;  2OTL N;  4B1U B;  3G6E N;  4FLT A;  2YNG A;  4DSE A;  4DCH A;  4CFB A;  2ATQ A;  5FRM A;  5CZ1 A;  4N56 A;  4OVL A;  5E26 A;  3AAR A;  4R5P A;  3D6R A;  4EIA A;  4FWS A;  4HUE A;  2Q3S A;  3OTO K;  1TL3 A;  4L8R B;  5J2Q A;  3E9L A;  1W97 L;  5JVG L;  3EL2 A;  3VF6 A;  3VTH A;  3VGM A;  3SV4 A;  4E7K A;  3O9Q A;  4DTX A;  3H08 A;  3CG7 A;  1NJI O;  2ZM6 K;  3MN7 A;  2Q31 A;  3DWL A;  4YDU C;  3WQT A;  4B9U A;  1FKP A;  3NH1 A;  3TAB A;  4CF8 A;  3LP0 A;  1XQS C;  1NK9 A;  5GIN A;  2FLO A;  2YCH A;  4OKE A;  1IKX A;  3MX5 A;  3RRH A;  4KBO A;  3J8A A;  4YOT A;  1N36 K;  3CPW M;  1NGD A;  5HBM A;  4H4M A;  3IMX A;  1JXB A;  1EO1 A;  2CGK A;  3NGY A;  1L3T A;  4DKW A;  5C2D A;  4DQS A;  4E1N A;  1Q9X A;  3CC2 N;  4BVP A;  1KVA A;  5AQF A;  1K9M O;  3B8A X;  1DT9 A;  2O4G A;  4IJA A;  3UKR B;  4CIE A;  3KHY A;  2ZJP L;  2PFU A;  2O8F B;  1Z26 A;  1NJX A;  3U3Y A;  2A42 A;  4IFY A;  3AGK A;  3DI6 A;  1GLJ O;  4CJ7 A;  3NVM A;  3QIO A;  4DR1 K;  2VYP A;  1IJJ A;  3O3H A;  3PY8 A;  1YJ9 N;  4B1Y B;  1OH7 A;  3NH2 A;  3ID8 A;  3AVL A;  4B8C A;  4DU3 A;  3VES A;  1YIT N;  4M3W A;  4M45 A;  1E4G T;  5LJW A;  2E88 A;  3BP8 A;  3HT3 A;  4RW6 A;  4IOC L;  4B3M K;  3ZLJ A;  4CGD A;  2QK9 A;  4E7L A;  4OLB A;  3DLR A;  2ZQB A;  1WLJ A;  3ZEU B;  2OYQ A;  4JK7 A;  5AQR A;  1VQ9 N;  4PY5 A;  4IO8 A;  2FF3 B;  3P1G A;  3OYG A;  4M3R A;  4ISF A;  1NK8 A;  1QTM A;  3MCA B;  2DY4 A;  2FBY A;  2PBD A;  3MDQ A;  4MLE A;  1VSD A;  5KRT A;  5AZI A;  3TSP A;  3SUP A;  2O8B B;  3LDP A;  4H5T A;  1NGC A;  1JL1 A;  4XH4 A;  3QBX A;  1OH6 A;  5BR8 K;  5H1S Q;  1CLQ A;  2YI1 A;  1QSY A;  2VWK A;  4F4K A;  5KTQ A;  2HHS A;  1SS6 A;  4YFU A;  1W2B M;  3CCR N;  4DSK A;  1CZA N;  3N4P A;  4DR7 K;  3QML A;  5M1N A;  3WEE B;  3ULE B;  4AHR A;  2QKB A;  4IWV A;  3LDQ A;  3ATU A;  5AQZ A;  4FWQ A;  3ASM A;  5C24 A;  2BTF A;  2O8D A;  4BRM A;  4ID5 A;  3BGR A;  4OGC A;  1Q81 O;  2KZZ A;  3ENO A;  2FSJ A;  2Z1G A;  4ID1 A;  4FCY A;  3EN9 A;  1FXX A;  1EXQ A;  2GEM A;  3RRG A;  2HNY A;  1Z25 A;  4JKE A;  4Z4G A;  3OY9 A;  2I7N A;  3L2W A;  5BRF A;  1JLB A;  4BC4 A;  1KD1 O;  1NGG A;  3NCI A;  4E0D A;  4DF4 A;  3FFI A;  3AVB A;  1N8R O;  3TAN A;  4FJ7 A;  4E89 A;  4I2P A;  4ISE A;  3CQX A;  3QIP A;  2XRI A;  3VER A;  4HWI A;  3CMA N;  2WFB A;  2D0C A;  2GEL A;  3L3V A;  1IH7 A;  3UIQ A;  3BDP A;  1MWM A;  1JJ2 M;  2GX9 A;  3ZSZ A;  1H1V A;  3J80 O;  4JEP A;  1YJN N;  3CCQ N;  3WNG A;  3EZ5 A;  4PKI A;  2CH6 A;  3GDQ A;  2XY5 A;  4FJG A;  4DMN A;  3IRX A;  3MAQ A;  1RBT A;  3RMB A;  1SKS A;  3KLG A;  4BRE A;  1TAQ A;  4OLA A;  2KFZ A;  2DTU A;  4H8K A;  3FZH A;  1C1C A;  3MED A;  2IC3 A;  2G8U A;  4KHN A;  1HKG A;  3CCV N;  3P39 A;  4BE1 A;  2W6L A;  4M3U A;  3OS0 A;  5CR4 A;  4CF0 A;  1DTQ A;  4A57 A;  4QAG A;  3CER A;  5AFU A;  3VQE A;  4GV3 A;  2GV9 A;  3ATV A;  4JKB A;  1K73 O;  2B6A A;  5E41 A;  1SQK A;  4I2Q A;  3VGK A;  4BWJ A;  2VGN A;  3CD6 N;  4DV6 K;  1XHX A;  4ZHR A;  1SL2 A;  1SZ2 A;  4KB1 A;  3I8D A;  3CME N;  1KC8 O;  2ZGY A;  2X74 A;  4X65 K;  1ESV A;  3J81 O;  5AQN A;  1TK0 A;  2P9U B;  4B9L A;  2YKN A;  4DTN A;  3V4I A;  4QCL A;  2OTJ N;  4QS9 A;  1KAZ A;  2WON A;  1KXP A;  3A5O C;  3M8Q A;  4KKO A;  5BRE A;  1NKC A;  4KFB A;  3T1Y K;  3HPO A;  1C0G A;  2FSK A;  4CJW A;  3K5N A;  4DWI A;  3TAR A;  2QEX N;  4DTM A;  1C1A A;  4CF2 A;  1E4F T;  1DLO A;  3E9P A;  3OJS A;  3HVT A;  3K9K A;  1U2V B;  4M7X A;  4JI2 K;  5ADX H;  3CCM N;  3SCX A;  3R8E A;  3EO3 A;  1BQN A;  3P4I A;  4BY9 C;  2AJQ A;  2QWN A;  3IUC A;  2P9L B;  4CED A;  3OYF A;  5AZJ A;  3VQ5 A;  3E66 A;  2R7Y A;  2FBV A;  1ATN A;  5CY4 A;  4JD2 B;  5C0Y A;  4PL7 A;  3H45 C;  4MQ3 A;  1N6Q A;  3BF3 A;  3WXL A;  3VMF B;  3TAF A;  3S41 A;  3OYJ A;  3SV3 A;  1RDW X;  1TV6 A;  1HYZ A;  2D0B A;  4PA1 A;  4CJU A;  2XY8 A;  3MK6 A;  1ITG A;  2HBJ A;  1B92 A;  4M3T A;  3OYD A;  1HPZ A;  3TTF A;  3HZ6 A;  4A61 A;  1Y97 A;  1VQ5 N;  4FJK A;  4BAC A;  2OPQ A;  4FLV A;  1RT5 A;  3O3F A;  4IG0 A;  4FJL A;  5AQW A;  1LWF A;  3CCL N;  4XH1 A;  2RKI A;  3D2E A;  4RW9 A;  1BOT O;  4IDH A;  4DV2 K;  5IT9 O;  3R1X A;  3VQP A;  3VEV A;  5C42 A;  1QZ6 A;  3HJF A;  2KTQ A;  1NMD A;  3LAL A;  1GOB A;  3FFK B;  1VSM A;  2E2N A;  4AHC A;  3VEO A;  3R6M A;  5J2N A;  1LOT B;  2YNI A;  3VEN A;  3I0R A;  1S6Q A;  5E84 A;  4JI6 K;  1JLQ A;  4JV5 K;  3OVN A;  2BE2 A;  3N4Q A;  2DPN A;  5CHI A;  4H5R A;  1ZBI A;  3IAY A;  3H46 O;  4EZ6 A;  5HRS A;  1NGE A;  4KI6 A;  1JCE A;  4BE0 A;  5C15 A;  2VG7 A;  2E6M A;  3THX A;  4YHH K;  4CF1 A;  2QWL A;  1RDC A;  5J2P A;  1YF5 L;  4BC2 A;  4FM0 A;  2Z1J A;  1K8A O;  2F96 A;  4DV0 K;  1P90 A;  4PHT X;  1HNW K;  3FZM A;  1NBW A;  1U6Z A;  3BZC A;  1RT7 A;  4DF8 A;  1J6Z A;  4O5F A;  1DTT A;  1BHL A;  3RMC A;  3F9K A;  1TL1 A;  1LAV A;  1VSL A;  4H4O A;  2NRT A;  5AQP A;  3NF8 A;  3U8X A;  4LF6 K;  4K25 A;  3L2Q A;  1MWK A;  2WBN A;  3IKM A;  3AO3 A;  4KTW A;  4BRA A;  3OS2 A;  4FVU A;  1M1K O;  1NLV A;  1LV5 A;  3THW B;  3DXK A;  3T3F A;  1V4T A;  3O08 A;  5FRN A;  4KPY A;  3D2F A;  4ICL A;  4BC5 A;  1XC3 A;  2I5J A;  4KRE A;  4GVE A;  3QNO A;  2P9K A;  3CM6 A;  1T05 A;  4DR2 K;  4DV7 K;  1RTD A;  3I0S A;  1SAZ A;  4CEZ A;  1ZBS A;  4FK2 A;  4BDP A;  3ENB A;  4CEE A;  2D5R A;  2HHH K;  3M3Z A;  2QKK A;  4KHS A;  1EKE A;  2E8A A;  2O8C A;  4QS7 A;  4CGH A;  4B8A B;  1X9W A;  3ZT2 A;  4B1V A;  5FPD A;  4Z4F A;  1B9F A;  4DU4 A;  1ZBF A;  2FBT A;  4KH5 A;  3H3O B;  4DQP A;  4FWR A;  4KTQ A;  3MN5 A;  4EP4 A;  3RR7 A;  1GLC G;  3VQQ A;  4MLH A;  4DLE A;  4BVO A;  4RW4 A;  3K59 A;  3TU5 A;  5JS2 A;  3NGI A;  1NGB A;  4CJE A;  4HTU A;  1HR0 K;  5AJ3 K;  4JKF A;  2W6K A;  4CK2 A;  5M1F A;  4EP5 A;  3EEQ A;  2HVH A;  1QQO A;  5M1K A;  2Q2R A;  4JKH A;  4KTZ A;  4A62 A;  5DM6 L;  3QEV A;  1BCO A;  4OX9 K;  3AO1 A;  3MWP A;  3VA3 A;  4CZG A;  1YVN A;  3LAM A;  1QSS A;  3B6P A;  2KW4 A;  4YOW A;  3M8R A;  4EAH D;  1YHQ N;  1VQM N;  2Q97 A;  3SYZ A;  4DU1 A;  3ZSY A;  4BRP A;  1R59 O;  4IEE A;  1QQN A;  1KRP A;  1WAJ A;  3FR0 A;  2A40 A;  5BRD A;  3AVJ A;  1YUW A;  4OPH A;  3NF6 A;  3CC7 N;  2Z1H A;  3MN6 A;  4CFD A;  4H5W A;  4BDY A;  4H03 B;  5JMV A;  3KK1 A;  4CJR A;  3LP3 A;  3BEX A;  1RBR A;  3U6F A;  4O0J A;  3FE1 A;  3H1Q A;  4FWK A;  3J7A P;  3T1H K;  3T69 A;  5KPT A;  5GIP A;  3VQ8 A;  1C0T A;  4M3Z A;  4FJI A;  1SUQ A;  1L3S A;  3NVK A;  1XHZ A;  3DJC A;  5GAG P;  5FDL A;  3FGU A;  3WXJ A;  4W5O A;  2AP1 A;  1Q7Y O;  3O6W A;  3M6G A;  1U04 A;  2DFE A;  1C1B A;  5ELZ A;  3RMA A;  2P9I A;  1BGX T;  2OAN A;  4NB4 A;  4FJM A;  5AQQ A;  3HP9 A;  5AQV A;  4BR0 A;  2B5J A;  1L3U A;  2VWJ A;  3GG4 A;  4B3O A;  3SAF A;  3RMD A;  3CFO A;  2BAN A;  3VQC A;  1I39 A;  3LZI A;  2YJE A;  3TR8 A;  2G8V A;  2QXL A;  4CJ5 A;  3ITH A;  2HF4 A;  1KQS M;  3TWH A;  1HQE A;  3DAW A;  3PO4 A;  4DSJ A;  3VQ9 A;  1R0A A;  4O55 A;  4CJ3 A;  1BA0 A;  4JRQ A;  2BGG A;  3I8B A;  1DKG D;  4JRP A;  4BRO A;  1VHX A;  2NLX A;  3F9M A;  1A5V A;  3C7N B;  4NCB A;  2GBZ A;  4CJK A;  2HHQ A;  1VSK A;  4GNI A;  4KH4 A;  5FPN A;  4BRD A;  5AQH A;  1NOY A;  1XC9 A;  1U48 A;  1QZ5 A;  2D0P A;  3QES A;  4FJN A;  4F8R A;  4Z94 A;  1QHA A;  3A0I X;  4K42 A;  3GOI A;  3QDK A;  3BY5 A;  1RT1 A;  4KHY A;  3SLC A;  2G8H A;  3OYI A;  5FPE A;  3O5B A;  4DUZ K;  4H0X B;  3FZL A;  1QHT A;  1EWQ A;  4FW2 A;  3A5M C;  3ALY A;  5CE3 A;  3ISN C;  1WN7 A;  3IDH A;  2PYJ A;  1IKV A;  2HBL A;  3PSF A;  1IBL K;  5AQY A;  2QW9 A;  1BIZ A;  4CCH A;  4F2R A;  4K41 A;  3CQY A;  3OS1 A;  3OYE A;  1VQN N;  4AH9 A;  1QVG M;  4KHP K;  4B08 A;  4BG8 A;  1EET A;  2NRV A;  3TAG A;  3K2P A;  1SKR A;  2O4I A;  2IVP A;  2D0A A;  3V9U A;  4H0Y B;  1HNX K;  3THV A;  3ZT1 A;  4E7H A;  4MDA A;  3WT0 A;  4FSV A;  1K6Y A;  2OZM A;  2YHX A;  4C8N A;  2ITG A;  2VCP A;  3L2V A;  4AF1 A;  2F7T A;  4IOA L;  2GWK A;  2P9P A;  3QER A;  1TYQ A;  1YT3 A;  3KKR A;  2YHB A;  3WXK A;  4J2B A;  1WUA A;  3C94 A;  3KD1 E;  3P5J A;  3G4S N;  3TAP A;  3CJC A;  5GAE P;  5HRP A;  5HLF A;  4KI4 A;  3QEP A;  4MO4 A;  3SQ0 A;  3HVR A;  4DSL A;  4FJ5 A;  1BUP A;  2Q36 A;  3ZSQ A;  1ILY A;  4B9S A;  3OYN A;  4N47 A;  3CFR A;  2RN2 A;  2PAV A;  3AVG A;  3QB0 A;  4B9M A;  4FK4 A;  3DLL L;  1S1T A;  3JYT A;  2A1S A;  1NGA A;  4BE2 A;  1RGI A;  3CJ7 A;  3R3L A;  3TTD A;  3WNH A;  2O8E A;  1D8Y A;  1S9G A;  3HM8 A;  1BO5 O;  4AM7 A;  4CEQ A;  1WB9 A;  3SQ4 A;  2A41 A;  3V9W A;  3MX2 A;  4Y0W A;  3QIC A;  4DR5 K;  3F73 A;  1IKW A;  4BDZ A;  1U47 A;  2V7Z A;  4BG9 A;  4E3S A;  3D7E O;  1T44 A;  2ZWH A;  5JVH L;  4DQQ A;  1FW6 A;  4A5A A;  4BRK A;  5C25 A;  3VOV A;  4CEA A;  2NRH A;  4F3T A;  5HOO A;  1QQC A;  2HNZ A;  4OPA A;  4J8F A;  4CHZ A;  3O9T A;  3DXM B;  2KLA A;  5AQO A;  1JCF A;  4LSN A;  3HPG A;  1D5A A;  2HBK A;  2JWK A;  1S5J A;  3PV8 A;  3DLB A;  4TSX A;  5AZI B;  1KSP A;  4EFH A;  4CZK A;  3TAE A;  1BL3 A;  4CGI A;  4C8O A;  3CCU N;  3HTV A;  5EOY A;  3L6Q A;  1CXQ A;  3T1A A;  3WNF A;  3TSU A;  3MEG A;  1JLA A;  3KTQ A;  5AQT A;  3ZCM A;  2ETJ A;  4AM6 A;  2ZD1 A;  3NBP A;  1WOQ A;  3QEX A;  1VSH A;  2NNW A;  2CGL A;  2GUI A;  3HP6 A;  3F5T A;  1C6V A;  1BDG A;  3RVC A;  1XWL A;  5EU7 A;  3L3U A;  2E6L A;  5J1E A;  3VQA A;  4BQL A;  3PO5 A;  3RWU A;  2E5L K;  2UUC K;  1SL1 A;  2HW3 A;  1JXE A;  1NJW A;  3OYA A;  2OCE A;  1NK0 A;  4O8U A;  4W5Q A;  3K5L A;  3M5R A;  1LW2 A;  4L3Q A;  4K8X A;  4DLG A;  1G99 A;  3DRS A;  4FVM A;  5KPZ A;  2QWO A;  3A5L C;  5BN9 A;  1WSI A;  5AQX A;  4YOY A;  4I6M A;  2XY6 A;  4CJP A;  1RTJ A;  1VSE A;  4KH6 A;  3AA5 X;  3ZX3 A;  3EY1 A;  4JI3 K;  1NGH A;  5KPR A;  3ZT0 A;  4FJH A;  1Z05 A;  4LC9 B;  5CYQ A;  1RNH A;  1NG9 A;  4WQ4 A;  1HNZ K;  3CM5 A;  1BIU A;  2G8I A;  4ZTF A;  4FM1 A;  1HNV A;  1WNS A;  2P9S A;  1HJO A;  3L8B A;  4FPB A;  2HHX A;  3HSC A;  1OH8 A;  1KVC A;  1HYS A;  2ASO A;  4BR5 A;  1XUP O;  3H1V X;  4DS4 A;  3OYM A;  4DFM A;  1JKH A;  3UB5 A;  4CGG A;  4CIG A;  4KHU A;  2FBX A;  3OYL A;  4Y1C A;  3QFP A;  4DQI A;  4CVN E;  2IGI A;  1J5E K;  1N34 K;  3SZ2 A;  4FPA A;  3U3G A;  1LCU A;  4CJV A;  1YIJ N;  3QEW A;  3S9H A;  3D45 A;  4J2D A;  4KHW A;  4GMJ B;  4FYD A;  4DSF A;  3ZT4 A;  4JN4 A;  4CW7 B;  3CCS N;  3WQU A;  1ZC6 A;  5AQS A;  2IVO A;  3O9S A;  1LWC A;  1NMN A;  1BG3 A;  4CES A;  5IWA K;  3LZJ A;  4HHT A;  3VPZ A;  4CGJ A;  4C1N K;  4CEF A;  3SQ1 A;  3A8Y A;  3CF5 L;  4Z4C A;  3DYA A;  3H3N O;  4ILJ A;  3AVF A;  4G1Q A;  1ZBH A;  4XIU A;  4KAZ A;  5JS1 A;  5KRS A;  4FWO A;  4DV4 K;  2E2Q A;  4EHT A;  2G8W A;  1J5O A;  4BR2 A;  4WYB A;  1HKC A;  2P1J A;  3M8S A;  1JLG A;  4K43 A;  4CD3 A;  3OA9 A;  4LFA K;  3VN5 A;  4Z4E A;  4FZZ A;  1BQM A;  1EWR A;  3LL3 A;  4DQR A;  3NDK A;  4CJT A;  2YNH A;  2ZJR L;  3SPZ A;  2KHO A;  2WUS A;  1Z6R A;  4A59 A;  1HKB A;  4Z4H A;  1RTI A;  3LM9 A;  3LPU A;  1VQ4 N;  5AZJ B;  4B1X B;  5SWM A;  3I56 N;  2RPI A;  1F21 A;  1RBV A;  1HMV A;  3SNN A;  3NE6 A;  2NRX A;  1T6D A;  4NCG A;  3VQ6 A;  3F2K A;  4K0K K;  4DFP A;  3C6U A;  3THY A;  1I3A A;  2ASP A;  1WBB A;  1L3V A;  5BPL A;  3VQ7 A;  4QOZ B;  3OJU A;  1RFQ A;  1ASV A;  2EX3 A;  4OO1 J;  1JLC A;  1VAZ A;  3TPQ A;  2Z1I A;  3QBW A;  3VQD A;  4CZM A;  1UA1 A;  2PYL A;  2Y1J A;  1YTU A;  5BRH A;  3D2E B;  1KFS A;  4FOI A;  1S1X A;  3HOS A;  3L2U A;  2F8S A;  3MCP A;  3C6H A;  4LD0 A;  4FZY A;  1EQY A;  4JS5 A;  2ZF5 O;  4PL8 A;  2E1Z A;  3OHR A;  3HI0 A;  1ZXO A;  5MLC Q;  2JGU A;  1K8K A;  4I9Q A;  1FKO A;  5T7B A;  1RT4 A;  3I55 N;  2VG5 A;  4M7Y A;  4W5R A;  3ZET B;  3THX B;  3FZK A;  5I42 A;  4RW8 A;  3AY9 A;  3MXJ A;  3DOL A;  3OYH A;  2FSN A;  3AAQ A;  4FLY A;  1GOC A;  4C8M A;  3ENH A;  3LWM A;  4B1Z A;  2FC0 A;  3CQ8 A;  5DM7 L;  4O0I A;  3SMP A;  3HBT A;  1VSF A;  1N33 K;  5F0X A;  4JI8 K;  1RDU A;  4DTU A;  2XY7 A;  4YDU A;  4O4G A;  3PX0 A;  3SUN A;  4HCB A;  3R9P A;  4X62 K;  1JLE A;  3K5O A;  1G15 A;  4ZTJ A;  3KZB A;  3EE8 A;  3QET A;  5HRR A;  4O8K A;  1KAX A;  1S9E A;  4Z0U A;  3CET A;  3AGR A;  4WQ5 C;  5LL6 Z;  3VF4 A;  4LF4 K;  4WCE L;  3SMS A;  4MDB A;  1YXQ A;  4CJ4 A;  4IO9 L;  1KTQ A;  1SV5 A;  3CJ9 A;  4A2B A;  4CJS A;  3LP1 A;  2PZS A;  2V51 B;  1XNR K;  3D2F B;  1SL0 A;  1BU6 O;  4B3T K;  3WUH A;  4JHD B;  2QWQ A;  1NK5 A;  4DSI A;  3C0B A;  4JK9 A;  5JIC A;  4FJ9 A;  4BRH A;  1EX4 A;  4B3S K;  2O8C B;  2VQF K;  5BN8 A;  1QE1 A;  3HYF A;  1WSE A;  2HST A;  1MA9 B;  4FWP A;  4GY2 B;  2Y1I A;  2OZS A;  5LMU K;  1BI4 A;  2NRR A;  4LF8 K;  5J2M A;  2DFF A;  1YAG A;  4LSL A;  1X9S A;  1BIS A;  4ELV A;  4CK3 A;  3CFP A;  4CJQ A;  1VQP N;  1OVY A;  3K9J A;  4CZF A;  4N5S A;  4BRF A;  3P38 A;  4AIL C;  3SJJ A;  2IDO A;  4W5T A;  1MDU B;  2D4W A;  1WBD A;  1Q82 O;  4J2A A;  1W7A A;  4F2S A;  1RTH A;  3AVH A;  4B9T A;  3OW2 M;  4EHU A;  1NK7 A;  4KHQ A;  1YVU A;  3OBW A;  4IKF A;  2RF2 A;  4GVM A;  5AQK A;  4A5B A;  4H0V B;  5I3U A;  1T7P A;  1VQ6 N;  2VWB A;  1GLA G;  4DS5 A;  3PLA A;  4NYN A;  4XH5 A;  3O80 A;  4B9Q A;  4YOR A;  3RSE A;  4LF5 K;  4XEI A;  3PSI A;  2CH5 A;  4OPJ A;  3S3M A;  3ZSV A;  3OYK A;  4JKG B;  4CEO A;  4KV8 A;  3KLE A;  3L0Q A;  3G71 N;  1GLF O;  2QWP A;  4CBW A;  2D1K A;  5M1Q A;  2IIR A;  4WFA L;  3PIO L;  3BF1 A;  2F9T A;  4JAX A;  1NWK A;  4CHY A;  1YI2 N;  5BPN A;  5GAH P;  2YHA A;  1D9D A;  1J53 A;  4CFC A;  3V81 A;  1ASW A;  3VF2 A;  3VEW A;  1IBK K;  3SQ2 A;  3JAM O;  3Q7B A;  1WSJ A;  1KLN A;  1IV0 A;  3UKU A;  4E19 A;  2BH1 A;  3LP2 A;  4B3R K;  1UA0 A;  2P9N B;  4RTF D;  3MXI A;  2P5G A;  2P51 A;  4WE1 A;  3TAM A;  4LY7 A;  4IXC A;  4BR9 A;  5TKY A;  4IDK A;  3V1O A;  3KLF A;  3B6O A;  2Q0R A;  4CBU A;  2PY5 A;  1B9D A;  3DLE A;  1GLE G;  4BRN A;  3NFA A;  3BUZ B;  3L4Q A;  3AVK A;  1RT3 A;  5BR9 A;  3MEC A;  2X6N A;  4W5N A;  2QTD A;  3MWT A;  1VQ7 N;  5B8H A;  4GV9 A;  1HNI A;  2E20 A;  4NLC A;  4AHT A;  4PUO A;  5GAD P;  3SAG A;  1MU2 A;  3WNE A;  2J4R A;  2A1R A;  2VGM A;  4JKA A;  3KWG A;  2W40 A;  3OYB A;  4I7F A;  5M1P A;  2OA8 A;  1ZYQ A;  2FF6 A;  3CYM A;  4CBX A;  4FXD A;  3O4Q A;  1E3M A;  3DMJ A;  1NK6 A;  1RDB A;  1BWF O;  4BGA A;  4FJX A;  3KK3 A;  5SZT A;  1GLL O;  1S1U A;  2IOC A;  3AVI A;  4H5V A;  1Q9Y A;  2HOE A;  4AHV A;  1FJG K;  4DTJ A;  2LSN A;  3HST B;  3AA4 A;  4YOV A;  4M42 A;  4JI0 K;  4NYF A;  4JS4 A;  1Y64 A;  3ZSW A;  1C0M A;  3O1B A;  3LM2 A;  1D9F A;  4GKJ K;  2IS3 A;  1HQU A;  3JSM A;  4FJ8 A;  4IZ9 A;  4FLW A;  4CIF A;  4E1J A;  3AO5 A;  1NOZ A;  3E9O A;  1S22 A;  2HVI A;  4U7B A;  1REV A;  2UYT A;  2RE2 A;  4H0P A;  1M90 O;  3O1W A;  4PQU A;  1DEJ A;  2Q1N A;  5AFU H;  1A5X A;  5EVZ A;  3IG1 A;  1DGK N;  3NHG A;  3DRP A;  3CJ1 A;  5TKW A;  3UKR A;  3LAK A;  4M3Y A;  1VQL N;  1TUU A;  2EWS A;  2O8F A;  1RT6 A;  4H0O A;  4H5N A;  3AVA A;  3SJH A;  5LMN K;  1ZBL A;  1L5U A;  3CJB A;  4KRF A;  3G25 A;  1T3V A;  3M1F A;  4NLB A;  2P9P B;  1RDD A;  1TYQ B;  3K58 A;  4CZL A;  4H0T B;  3VTI A;  5BPM A;  3J7Z O;  1N5Y A;  4FLU A;  5HP1 A;  1T6C A;  2HND A;  4U67 L;  4CZI A;  1VSJ A;  4FWN A;  3TSQ A;  4CI6 A;  1NM1 A;  2KKZ A;  2ITM A;  2FXU A;  3NGZ A;  3KK2 A;  3VA0 A;  4CJF A;  3ZEU A;  1TKX A;  3SAH A;  3S3N A;  4A2A A;  3NF7 A;  2YHY A;  1CXU A;  1XI1 A;  2O8E B;  4DFK A;  4DB3 A;  1RDA A;  4B9N A;  1NKB A;  4CHQ A;  2QWM A;  1IO2 A;  2P5O A;  1U49 A;  4CER A;  5M1O A;  1OH5 A;  5F2R A;  3U9D A;  3VQB A;  3AA3 A;  2KZM A;  2QA4 N;  3SUQ A;  2O8B A;  3A2F A;  1O1W A;  3CC4 N;  3EKU A;  4CZE A;  4NXN K;  1WSG A;  3DXM A;  4FM2 A;  5K14 A;  5JLF A;  3O8M A;  1S6P A;  5DMR A;  4JKD A;  4CZH A;  1BCM A;  4CK1 A;  1RCH A;  4LFC K;  3P31 A;  4OKJ A;  3WEE A;  5AQG A;  3ULE A;  4JI7 K;  3M8P A;  2G8K A;  5HL7 L;  3HO1 A;  3O4W A;  5EX5 A;  3TAQ A;  3C6T A;  4LH4 A;  4O5B A;  1TAU A;  4ILH A;  3LWL A;  3LAN A;  1Q18 A;  3NH0 A;  4CGF A;  2OPR A;  2G8F A;  3QLH A;  3ZSR A;  3OBY A;  4JKC A;  2JWL A;  4HVJ A;  3RR8 A;  3V1Q A;  4BQZ A;  2V7Y A;  4BRG A;  3DOK A;  4MFB A;  3LDN A;  2Q0U A;  2QI2 A;  1JL2 A;  1KVB A;  2O8D B;  2UXB K;  1QQM A;  3VEX A;  3ZT3 A; 
#chains in the Genus database with same CATH homology
 5SWM A;  1WSF A;  3AO1 A;  2RPI A;  4OKE A;  3VA3 A;  1IKX A;  1F21 A;  1HMV A;  1RBV A;  3NE6 A;  4DTP A;  3SNN A;  4NCG A;  3LAM A;  3RRH A;  3KLH A;  3PX4 A;  3B6P A;  3VQ6 A;  4E7I A;  1QSS A;  2KW4 A;  3M8R A;  4FJJ A;  3SYZ A;  4DU1 A;  3ZSY A;  4DFP A;  3C6U A;  3AVM A;  1I3A A;  3NAE A;  1KRP A;  1L3V A;  5HBM A;  3T19 A;  2HHW A;  2KQ2 A;  1WAJ A;  3AVJ A;  4H4M A;  3VQ7 A;  4QOZ B;  1JXB A;  3HPH A;  3NF6 A;  2Z1H A;  3OJU A;  3NGY A;  1Q8I A;  2EX3 A;  1ASV A;  4CEC A;  4CFD A;  1L3T A;  1EP4 A;  4DQS A;  1JLC A;  4E1N A;  1TKT A;  1Q9X A;  4FW1 A;  4BDY A;  1TK8 A;  4DG1 A;  2Z1I A;  1KVA A;  2HHT A;  4FZX C;  2JLE A;  4ELU A;  2O4G A;  3KK1 A;  3VQD A;  4CIE A;  3LP3 A;  4CJR A;  1RBR A;  3U6F A;  1UA1 A;  1Z26 A;  2Y1J A;  2PYL A;  1YTU A;  4O0J A;  1KFS A;  1NJX A;  1S1X A;  3U3Y A;  4PWD A;  1NJZ A;  3L2U A;  4IFY A;  1SKW A;  3DI6 A;  3VQ8 A;  1C0T A;  4M3Z A;  2F8S A;  5HRO A;  4LD0 A;  3EYZ A;  1WSH A;  4FJI A;  1SUQ A;  1A5W A;  3ZT3 A;  4FZY A;  3G10 A;  4JS5 A;  3QIO A;  1L3S A;  3K5M A;  4IFV A;  1XHZ A;  4KB0 A;  5FDL A;  3AVN A;  3KD5 E;  3O3H A;  4W5O A;  4OJR A;  3PY8 A;  1U04 A;  2DFE A;  1C1B A;  3RMA A;  1BGX T;  4AHU A;  4CHP A;  2JGU A;  4OPK A;  1TVR A;  4FJM A;  3TI0 A;  3NH2 A;  3HP9 A;  1LAW A;  4I9Q A;  1L3U A;  2B5J A;  1FKO A;  5T7B A;  3NF9 A;  5KGW A;  3AVL A;  5CYM A;  4B8C A;  2VWJ A;  4DU3 A;  1RT4 A;  2HMI A;  2VG5 A;  4M45 A;  3CFO A;  3RMD A;  4W5R A;  4M3W A;  5I42 A;  4RW8 A;  2BAN A;  3VQC A;  1I39 A;  3DOL A;  3MXJ A;  4RW6 A;  3HT3 A;  3OYH A;  3V9S A;  4N41 A;  3LZI A;  4CGD A;  4HCC A;  3QO9 A;  3K57 A;  4FLY A;  4E7L A;  2QK9 A;  2KFN A;  1GOC A;  4OLB A;  3DLR A;  2ZQB A;  4C8M A;  3TR8 A;  2OPP A;  3LWM A;  1WLJ A;  2G8V A;  2FC0 A;  4CJ5 A;  3CQ8 A;  4O0I A;  3ITH A;  2OYQ A;  3DRR A;  1VSF A;  3TWH A;  4LH5 A;  1CZB A;  1HQE A;  4DTU A;  4FK0 A;  2XY7 A;  4O4G A;  3P83 D;  3PX0 A;  3SUN A;  1U45 A;  3PO4 A;  3VQ9 A;  4DSJ A;  4C8L A;  4HCB A;  4PY5 A;  1JLE A;  2OPS A;  1R0A A;  3P1G A;  4O55 A;  4CJ3 A;  3OYG A;  4F3O A;  3K5O A;  2QXF A;  4M3R A;  1G15 A;  4ZTJ A;  4JRQ A;  1NK8 A;  1NKE A;  1QTM A;  2BGG A;  3V9Z A;  2DY4 A;  3QET A;  4JRP A;  4CEB A;  3KLI A;  5HRR A;  1A5V A;  2FBY A;  4Z0U A;  1S9E A;  3HK2 A;  1VSD A;  4YNQ A;  4NCB A;  2GBZ A;  4CJK A;  5KRT A;  2HHQ A;  1VSK A;  3SUP A;  4N76 A;  3DLK A;  1NOY A;  1XC9 A;  1U48 A;  4FJN A;  3QES A;  4CJ4 A;  1JL1 A;  4F8R A;  4OKK A;  1KTQ A;  1SV5 A;  2YKM A;  4CJS A;  3LP1 A;  2PZS A;  1CLQ A;  1QSY A;  2VWK A;  4F4K A;  1SL0 A;  1RT1 A;  5KTQ A;  1VK0 A;  4IG3 A;  3HXM A;  2G8H A;  4KHY A;  2HHS A;  1VRT A;  1RBS A;  4YFU A;  3OYI A;  3ZSX A;  4DSK A;  1NK5 A;  3DLH A;  4DSI A;  4FJ9 A;  1QHT A;  1EX4 A;  4FW2 A;  1QE1 A;  4AHR A;  3V9X A;  3HYF A;  1WSE A;  2QKB A;  3ALY A;  3ISN C;  1WN7 A;  2Y1I A;  2PYJ A;  1IKV A;  2OZS A;  3AV9 A;  1BI4 A;  1BIZ A;  3ASM A;  4CCH A;  4F2R A;  5C24 A;  4GW6 A;  3RTV A;  5J2M A;  3AO2 A;  1U4B A;  4ID5 A;  3OS1 A;  3QIN A;  2DFF A;  3BGR A;  4LSL A;  4JLH A;  4OGC A;  1BIS A;  3OYE A;  4CK3 A;  3CFP A;  4CJQ A;  3O3G A;  1X9S A;  3AVC A;  2KZZ A;  5CZ2 A;  2Z1G A;  1J54 A;  3PUF A;  4ID1 A;  4AH9 A;  4N5S A;  4FCY A;  4J2E A;  5FRO A;  4AIL C;  3SJJ A;  1FXX A;  1EXQ A;  2IDO A;  4B08 A;  4W5T A;  3RRG A;  2HNY A;  4J2A A;  1TKD A;  4F2S A;  1Z25 A;  1EET A;  1RTH A;  3AVH A;  3K2P A;  3TAG A;  1SKR A;  3OY9 A;  3ULD A;  1KCF A;  2X78 A;  4B9T A;  4Z4G A;  1RIL A;  3L2W A;  3E01 A;  1NK7 A;  4KHQ A;  1JLB A;  1YVU A;  4IKF A;  2D0A A;  3NCI A;  2RF2 A;  4GVM A;  3V9U A;  4DF4 A;  3FFI A;  3ZT1 A;  3AVB A;  4M41 A;  4CF9 A;  4Q5V A;  4E7H A;  5I3U A;  3THV A;  1T7P A;  1K6Y A;  4DS5 A;  2OZM A;  3TAN A;  4NYN A;  4FJ7 A;  1KFD A;  4E89 A;  4C8N A;  4I2P A;  4RW7 A;  3QIP A;  2ITG A;  2XRI A;  3S3M A;  4OPJ A;  3L2V A;  3ZSV A;  3OYK A;  3C95 A;  4CEO A;  4KV8 A;  3KLE A;  2O4I A;  2D0C A;  1T03 A;  3QER A;  3L3V A;  1IH7 A;  3UIQ A;  1YT3 A;  3KKR A;  3PX6 A;  2YHB A;  3BDP A;  1NK4 A;  4J2B A;  3ZSZ A;  3C94 A;  3KD1 E;  1X1P A;  3P5J A;  3TAP A;  1FK9 A;  4E7J A;  3WNG A;  3EZ5 A;  4CHY A;  5HRP A;  5HLF A;  4KI4 A;  3SPY A;  3QEP A;  3SQ0 A;  2HB5 A;  3HVR A;  4DSL A;  4Z4I A;  3HM9 A;  2YHA A;  2XY5 A;  1D9D A;  4FJ5 A;  4FJG A;  1J53 A;  4DMN A;  3ZSQ A;  4B9S A;  3IRX A;  2DFH A;  3KIO A;  2NUB A;  3OYN A;  1RBT A;  4N47 A;  4Y1D A;  4CFC A;  3MAQ A;  3CFR A;  3V81 A;  3RMB A;  4DTR A;  1ASW A;  2RN2 A;  3V1R A;  3O4N A;  1SKS A;  3KLG A;  1LWE A;  1TAQ A;  3AVG A;  3MXM A;  4OLA A;  4FK4 A;  4B9M A;  2KFZ A;  2DTU A;  1S1T A;  3JYT A;  2A1S A;  4H8K A;  4BE2 A;  1W9H A;  3LPT A;  1C1C A;  3MED A;  2IC3 A;  3OYC A;  4DTS A;  1WSJ A;  1KLN A;  2G8U A;  4KHN A;  4E19 A;  3WNH A;  3LP2 A;  1D8Y A;  1UA0 A;  2F8T A;  1S9G A;  4BE1 A;  3MXI A;  5HRN A;  2P5G A;  4M3U A;  2P51 A;  4WE1 A;  4CEQ A;  3TAM A;  3OS0 A;  3S3O A;  4LY7 A;  4CF0 A;  3QNN A;  1DTQ A;  3SQ4 A;  4QAG A;  4IDK A;  3V1O A;  3KLF A;  3V9W A;  4CHO A;  3B6O A;  3VQE A;  3ZSO A;  2PY5 A;  2GV9 A;  1B9D A;  1LW0 A;  3DLE A;  4E1M A;  4CE9 A;  3F73 A;  3AA2 A;  1IKW A;  3NFA A;  3V6D A;  2B6A A;  5E41 A;  4BDZ A;  1U47 A;  4I2Q A;  3LP0 A;  4BWJ A;  3AVK A;  1RT3 A;  3MEC A;  1NK9 A;  4E3S A;  2X6N A;  1CZ9 A;  1XHX A;  4W5N A;  4ZHR A;  1SL2 A;  4DQQ A;  4KB1 A;  3I8D A;  2IAJ A;  2B4J A;  4HUF A;  5C25 A;  2X74 A;  4CEA A;  1HNI A;  4AHT A;  1YTA A;  4F3T A;  4PUO A;  1HYV A;  1QQC A;  2HNZ A;  3DLG A;  5DK5 A;  1MU2 A;  4CHZ A;  1TK0 A;  3WNE A;  4B9L A;  2YKN A;  4DTN A;  3V4I A;  2A1R A;  4UQG A;  2ZE2 A;  4QCL A;  3AO4 A;  3D0P A;  4C8K A;  4B3O A;  2W42 A;  2WON A;  1UWB A;  4LSN A;  3OYB A;  1NJY A;  4I7F A;  3HPG A;  3G0Z A;  2OA8 A;  4K8Z A;  3M8Q A;  1D5A A;  1HRH A;  4KKO A;  1ZYQ A;  1NKC A;  1S5J A;  3PV8 A;  3CYM A;  4KFB A;  3HL8 A;  3DLB A;  3KJV A;  4TSX A;  3HPO A;  4FXD A;  3O4Q A;  3K5N A;  3DMJ A;  4CJW A;  1NK6 A;  2EHG A;  3TAR A;  4DWI A;  1RDB A;  4DTM A;  1KSP A;  1C1A A;  5KI6 A;  4CF2 A;  1UAX A;  1DLO A;  3TAE A;  3OJS A;  1BL3 A;  1J9A A;  3HVT A;  2XO7 A;  4FJX A;  3KK3 A;  4CGI A;  4C8O A;  4EZ9 A;  1CXQ A;  3T1A A;  1S1U A;  2IOC A;  3AVI A;  3MEG A;  3WNF A;  5SZT A;  3SUO A;  4AHV A;  3SCX A;  1Q9Y A;  1BQN A;  2HHU A;  4DTJ A;  1JLA A;  3KTQ A;  2LSN A;  4RG8 A;  4Q0B A;  2AJQ A;  3ZCM A;  3HST B;  3AA4 A;  3KKS A;  2ETJ A;  4M42 A;  2ZD1 A;  3SI6 A;  4NYF A;  2YV0 X;  4CED A;  4JS4 A;  3NBP A;  1RBU A;  3OYF A;  3QEX A;  1VSH A;  3ZSW A;  3SQ2 A;  2GUI A;  3VQ5 A;  3HP6 A;  1C0M A;  1D9F A;  1C6V A;  2R7Y A;  1ASU A;  2FBV A;  1XWL A;  2IS3 A;  5CY4 A;  3L3U A;  5EU7 A;  5KGX A;  4I9L A;  1VSI A;  1QSL A;  1HQU A;  1BI4 B;  2E6L A;  3JSM A;  4FJ8 A;  5J1E A;  4MQ3 A;  1N6Q A;  3VQA A;  4FLW A;  2E4L A;  4CIF A;  1IKY A;  2VG6 A;  3AO5 A;  3TAF A;  1UOC A;  1NOZ A;  3PO5 A;  3OYJ A;  3RWU A;  1SL1 A;  2HW3 A;  3SV3 A;  1JXE A;  1TV6 A;  1NJW A;  1HYZ A;  2D0B A;  4PA1 A;  4CJU A;  4M3X A;  4ELT A;  3OYA A;  2HVI A;  1REV A;  2XY8 A;  1NK0 A;  4CHN A;  4W5Q A;  3K5L A;  4IBN A;  4PQU A;  1ITG A;  4DTO A;  1A5X A;  1LW2 A;  4K8X A;  1B92 A;  4M3T A;  4DLG A;  3IG1 A;  1S1W A;  3DRS A;  1HPZ A;  4FVM A;  3DRP A;  3IS9 A;  3OYD A;  1WSI A;  3NHG A;  4FLX A;  1Y97 A;  1W0H A;  2XY6 A;  1X9M A;  4CJP A;  4FJK A;  1RTJ A;  4HUG A;  4BAC A;  2XHB A;  2OPQ A;  1S1V A;  1VSE A;  4FLV A;  1RT5 A;  3LAK A;  3O3F A;  4M3Y A;  4IG0 A;  4FJL A;  1LWF A;  3AA5 X;  3EY1 A;  4FLZ A;  1RT6 A;  2RKI A;  4RW9 A;  4CFA A;  3ZT0 A;  4FJH A;  1TK5 A;  3VQ4 A;  1TGO A;  3AVA A;  3VQP A;  1VRU A;  4B9V A;  1ZBL A;  1L5U A;  5CYQ A;  4KRF A;  4CJL A;  1RNH A;  3L2R A;  5C42 A;  3HJF A;  2YNF A;  2KTQ A;  4NCA A;  3LAL A;  1GOB A;  3CM5 A;  1BIU A;  1VSM A;  4OGE A;  1WAF A;  4AHC A;  2G8I A;  3DM2 A;  4DFJ A;  3LDS A;  4FM1 A;  1HNV A;  2YNI A;  5J2N A;  4ZTF A;  1RDD A;  1WNS A;  3I0R A;  3L8B A;  1KLM A;  1S6Q A;  2HHX A;  3K58 A;  1JLQ A;  1N5Y A;  3OVN A;  4FLU A;  5HP1 A;  2BE2 A;  2HND A;  3QEI A;  1KVC A;  1VSJ A;  1HYS A;  2WOM A;  1ZBI A;  3IAY A;  4EZ6 A;  5HRS A;  4DS4 A;  4KI6 A;  3OYM A;  4DFM A;  4BE0 A;  1JKH A;  2VG7 A;  2E6M A;  4CGG A;  4CIG A;  4CF1 A;  4KHU A;  1RDC A;  1ZBU A;  5J2P A;  3NGZ A;  2FBX A;  3OYL A;  4Y1C A;  3KK2 A;  3VA0 A;  1GOA A;  4ELV A;  4CJF A;  4FM0 A;  4DQI A;  2Z1J A;  1RT2 A;  2F96 A;  2IGI A;  4E0D A;  4BWM A;  3SZ2 A;  2BDP A;  1TKX A;  3U3G A;  3S3N A;  1HJR A;  4CJV A;  3QEW A;  3NF7 A;  3S9H A;  1CXU A;  3D45 A;  1XI1 A;  4J2D A;  1T8E A;  4KHW A;  4AHS A;  4GMJ B;  4FYD A;  4DSF A;  3ZT4 A;  4DFK A;  2X6S A;  1TKZ A;  1RDA A;  4B9N A;  1NKB A;  4CHQ A;  5D3G A;  4O44 A;  2HHV A;  1IO2 A;  1RT7 A;  2P5O A;  1U49 A;  4CER A;  1C0U A;  4KO0 A;  4DF8 A;  3VQB A;  1LWC A;  3AA3 A;  1DTT A;  2KZM A;  1BHL A;  3RMC A;  3F9K A;  1QS4 A;  1TL1 A;  4CES A;  1LAV A;  1VSL A;  4H4O A;  1IG9 A;  3NF8 A;  3LZJ A;  1JLF A;  3SUQ A;  4HHT A;  3L2Q A;  3A2F A;  1O1W A;  3AO3 A;  4CGJ A;  4KTW A;  1WSG A;  3OS2 A;  3MEE A;  4CEF A;  3SQ1 A;  1LV5 A;  3T3F A;  4Z4C A;  5K14 A;  3DYA A;  4FM2 A;  4KPY A;  5FRN A;  4ICL A;  3AVF A;  4G1Q A;  2I5J A;  1ZBH A;  4KRE A;  3QNO A;  4FLT A;  3CM6 A;  4XIU A;  1T05 A;  2YNG A;  4DSE A;  4KAZ A;  1RTD A;  5JS1 A;  3I0S A;  1S6P A;  4CEZ A;  2ATQ A;  5DMR A;  4CFB A;  5KRS A;  5CZ1 A;  4N56 A;  4FK2 A;  1BCM A;  4BDP A;  5FRM A;  4CK1 A;  4OVL A;  4CEE A;  2D5R A;  1RCH A;  4OKJ A;  2G8W A;  2QKK A;  4KHS A;  1EKE A;  1J5O A;  4R5P A;  4CGH A;  3M8P A;  4B8A B;  2G8K A;  1X9W A;  3ZT2 A;  2P1J A;  4HUE A;  3HO1 A;  2Q3S A;  1TL3 A;  3M8S A;  1JLG A;  3TAQ A;  4L8R B;  5J2Q A;  4Z4F A;  1B9F A;  3C6T A;  4LH4 A;  1ZBF A;  4O5B A;  4DU4 A;  1TAU A;  2FBT A;  3LWL A;  3LAN A;  4DQP A;  3NH0 A;  4CGF A;  2OPR A;  3SV4 A;  4E7K A;  2G8F A;  3VN5 A;  4KTQ A;  3QLH A;  4DTX A;  4Z4E A;  3ZSR A;  4FZZ A;  1BQM A;  4EP4 A;  3H08 A;  3RR7 A;  3VQQ A;  4HVJ A;  3CG7 A;  4DLE A;  4DQR A;  3NDK A;  3RR8 A;  3V1Q A;  4RW4 A;  4CJT A;  3K59 A;  3DOK A;  2YNH A;  5JS2 A;  3NGI A;  4MFB A;  4B9U A;  4CJE A;  1FKP A;  4HTU A;  3SPZ A;  4CK2 A;  3NH1 A;  3TAB A;  4EP5 A;  1JL2 A;  1KVB A;  4Z4H A;  4CF8 A;  1RTI A;  2HVH A;  4KTZ A;  3QEV A;  3LPU A;  1BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...