1C6VA

Siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
148
Chain Sequence
NSDLGTWQMDCTHLEGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSVETIVLMAVHCMNHKRRGGIGDMTPAERLINMITTEQEIQFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SIV INTEGRASE)
publication title X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues 50-293)--an initial glance of the viral DNA binding platform.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Dna binding protein
total genus 42
structure length 148
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c6vA00
4FW1A 4FLWA 4M3UA 4M45A 4PUOA 3AVHA 3VA3A 4LH5A 3OYFA 4GVMA 2OA8A 4M3TA 3LP3A 3TARA 1IKWA 3HK2A 1JLQA 3NGIA 2VWKA 4CF1A 1TAUA 4M3ZA 1EKEA 4CJTA 3OVNA 3LANA 3T1AA 2DTUA 3BDPA 4DS4A 3NBPA 2FC0A 3RRGA 1K6YA 4NCGA 3SI6A 3QNNA 4CJPA 3CQ8A 1JLBA 1RT2A 3ZSXA 3EY1A 4CF0A 4DTMA 1VRUA 4PA1A 3LAMA 1EXQA 1W0HA 1B9FA 1SKSA 1QSSA 4BWMA 1WSEA 3AA4A 5FDLA 1TK8A 1IH7A 4CGDA 3MEDA 4CEEA 4DQIA 1CZ9A 3U3GA 2E6LA 2KQ2A 1S6PA 1FXXA 3AVBA 2XRIA 4QAGA 2WOMA 3AVJA 1A5WA 1JLFA 3WNEA 4W5QA 1C0TA 1VSMA 4DQQA 3DLBA 1RT3A 3QO9A 3F73A 3B6PA 3PX4A 4BDYA 4AHUA 1KRPA 1JXEA 4CJ5A 4RW9A 2HNYA 5HRSA 3VQBA 3S9HA 3DI6A 5KGXA 4DU1A 1VSLA 3KK2A 3RMAA 2IC3A 1EETA 4N76A 4CGFA 4CEDA 1NOYA 3OJUA 4MFBA 4O44A 4JS4A 1TGOA 3SQ4A 4B9UA 4CJFA 1N5YA 2G8FA 3LWMA 1IKYA 4DTNA 4B9LA 3EZ5A 4AHCA 4OPJA 1XI1A 1VK0A 4JS5A 4J2DA 2ZD1A 4FLYA 4DQRA 1SUQA 2Y1JA 4LD0A 4WE1A 3TAEA 4CJ4A 3MXMA 1YTAA 2RPIA 1NK4A 2Z1GA 1TVRA 3ISNC 3AA3A 1C0MA 4Y1CA 3NGYA 4OGEA 4M41A 2Z1JA 4HCBA 3DLRA 4GW6A 1NKEA 3NE6A 3D0PA 1QE1A 1N6QA 1T7PA 4BDZA 3SV4A 1JXBA 2HHUA 2F8TA 3O3GA 4DSKA 4KAZA 4IBNA 2YKMA 2Q3SA 3LP1A 3VQ8A 3C6UA 1S6QA 3AVCA 2YNGA 4CK1A 3HL8A 4Q0BA 1J54A 1BQNA 1HQUA 1T03A 2F96A 4AHSA 4H8KA 4NCBA 1NJXA 2PY5A 4CJKA 4N41A 1ITGA 1WSGA 3D45A 2ZQBA 3OYJA 4H4OA 1ZBHA 1KCFA 3K2PA 1REVA 1ASUA 4DMNA 3OY9A 4LY7A 3PX6A 1KFDA 1WAJA 2D5RA 4O0IA 4XIUA 3L2VA 4KHQA 3CM5A 3KKRA 2DFEA 4CJRA 2G8KA 2A1SA 1GOAA 3AVNA 1UA1A 4B9VA 3IAYA 2ETJA 4ICLA 4FYDA 5HLFA 1TV6A 2KW4A 4E89A 1WSHA 3SUNA 1SL1A 3AVKA 4CHOA 3LAKA 1RT1A 1S1XA 1VRTA 1B9DA 1XWLA 1LV5A 4KI6A 3ALYA 5HRPA 4B08A 4E19A 3OYIA 4EP4A 2Z1IA 3AA5X 3HPGA 3T19A 3NAEA 3S3OA 4I2PA 3QEVA 5J2MA 4CHYA 4DSIA 4FJ9A 4CCHA 5D3GA 1LW0A 3BGRA 3HJFA 1L3TA 1CXUA 4FM0A 4CESA 1TK0A 4FJIA 4KHNA 5HRRA 1BGXT 2HHWA 1SV5A 2NUBA 1BI4B 1NK0A 2IDOA 3NF9A 2D0BA 4E1NA 5I3UA 3VQQA 3OYDA 3OYHA 1NK5A 3DOLA 2KZMA 4CHZA 1TKTA 2BANA 4I9LA 4JRQA 1S1WA 4CHPA 2HVHA 1KSPA 3QINA 3SV3A 3MXIA 4E1MA 3OJSA 2KFZA 3HP6A 4HHTA 4CFBA 3MXJA 2HHSA 2JGUA 4EP5A 3SYZA 1TKDA 3NCIA 1BHLA 1RDDA 4FLXA 4CGJA 1DTTA 1TL1A 4BE1A 4EZ9A 4DFJA 2PZSA 4LH4A 1QHTA 4MQ3A 5HBMA 3CFOA 4JRPA 4E7KA 4W5RA 4I7FA 5I42A 5CY4A 1U49A 3TAGA 3QEXA 4CJLA 4DFPA 1JLCA 2O4GA 1T05A 3NH0A 1Y97A 2B4JA 3PO5A 3HO1A 2AJQA 3M8RA 4CK3A 1SKWA 3V4IA 1JLGA 4O55A 3SUPA 2X74A 4FJGA 1X9WA 3P83D 3DYAA 4E7HA 1KFSA 1S9GA 1U45A 1KTQA 1ZYQA 1Z25A 1HNIA 3OYCA 3O4NA 1LWEA 4DSFA 4ID5A 4OKKA 3DLHA 3P5JA 1VSHA 4LSNA 3RR7A 3PY8A 2VG5A 4BE0A 4CF8A 1CLQA 1HYZA 3LZJA 3NFAA 3V9WA 1RT6A 3CG7A 1DLOA 4TSXA 1ASWA 1MU2A 3TAMA 5EU7A 1C0UA 2ZE2A 3PO4A 4M3RA 2OZMA 3HPOA 2QKBA 3QIPA 1HYSA 3AO5A 3JYTA 5SWMA 1RBRA 3P1GA 5CYQA 1LW2A 3K58A 3DM2A 2YNHA 3SQ0A 4CHQA 3VQ9A 1FKPA 1D5AA 4N47A 4DF8A 4Z4GA 4CJSA 3AV9A 4RW7A 4HUEA 3QEWA 3PX0A 4CGIA 1SL0A 4FK2A 4EZ6A 3VQAA 2P1JA 3VQEA 2XY5A 4H4MA 5KGWA 1NKBA 4J2BA 1LAWA 3G10A 3K5OA 1QSYA 1QS4A 4IFYA 3V1QA 3CFPA 5J2QA 4B9TA 4FJJA 4KB1A 3OYGA 3TR8A 1NKCA 1S9EA 3ASMA 4IG0A 4JLHA 1QTMA 4HVJA 3LP0A 3S3NA 1B92A 1WAFA 4DTJA 4Z4EA 4RG8A 3KLFA 3KLHA 3ZSQA 4CEFA 3QIOA 4Q5VA 3OS0A 4F3OA 4CK2A 4DS5A 1JLAA 3I0SA 1VSIA 3AO3A 3AVGA 3KLEA 4FXDA 3TWHA 5CYMA 4FLZA 5FRMA 4KV8A 3AA2A 1C1BA 1ZBUA 3EYZA 5FROA 2B6AA 1XHZA 3IG1A 1SL2A 2HW3A 3HM9A 2GUIA 3E01A 3VQ6A 1KVAA 4B8AB 4O0JA 3LP2A 4CEQA 3LDSA 4M3YA 4AH9A 4DF4A 1HNVA 2YNFA 3MEGA 3C95A 4DTPA 3HYFA 3ZSWA 4I9QA 3ZT3A 1RDBA 2EX3A 4DSJA 2BE2A 5KRSA 3LWLA 3RR8A 4FM2A 5JS2A 4IG3A 4YNQA 3I0RA 4ZHRA 3OS1A 4FLUA 5CZ1A 1NJZA 4K8ZA 2KFNA 2OPSA 4CJVA 3TI0A 4BDPA 1BIUA 2Y1IA 4B9MA 4ELTA 4CFCA 1LWFA 3KJVA 1LWCA 4HTUA 1VSFA 4CJUA 1EP4A 1WSIA 1NJYA 1Q9XA 4C8KA 2IS3A 3AVMA 4Z4CA 1D9DA 1BI4A 3CFRA 4KI4A 3V9XA 3K59A 3WNFA 3KD1E 4HCCA 3MEEA 4CECA 3SPZA 3MAQA 3CM6A 1KVCA 5FRNA 2HHVA 3K5MA 4L8RB 4FJKA 1ZBFA 3ZSRA 4CJ3A 4CGGA 3NH2A 1XC9A 4M3XA 4FK0A 1VSDA 1A5XA 2G8IA 4KHUA 4FJ8A 4KFBA 3QEPA 1X9SA 4KHWA 4B8CA 2YHBA 4Z4IA 3QERA 1RDCA 4DSLA 1C1AA 1CXQA 3I8DA 1TL3A 1UWBA 1A5VA 2RF2A 1WSFA 1RDAA 4CJEA 4CF9A 3OYMA 3V9UA 4C8LA 3VN5A 4Z4FA 3HXMA 2OPQA 4KO0A 2DY4A 1J53A 2FBXA 2YKNA 1RILA 1RT7A 2QKKA 2FBVA 2BGGA 1VSEA 1ZBLA 1HJRA 1YT3A 4Z0UA 4R5PA 4CEOA 3OYKA 3HVRA 4F3TA 1BISA 5KTQA 2E6MA 2RKIA 4DG1A 2ITGA 4E7LA 1KLNA 1GOCA 3NF8A 5CZ2A 5DMRA 4CIGA 2WONA 2Z1HA 4O5BA 4OGCA 2YHAA 4KKOA 1NJWA 3VQ7A 3SQ1A 3LPUA 3H08A 3S3MA 3KTQA 2OYQA 1RTDA 1JLEA 4RW6A 1WLJA 3LALA 3T3FA 3OS2A 4DLGA 3TABA 2GV9A 4OKJA 4F4KA 4OLAA 1YVUA 3C94A 4CFAA 3ZSYA 3AO1A 5E41A 3V9ZA 3SPYA 3TANA 4DSEA 3ULDA 5J2NA 2LSNA 1JL2A 1D9FA 1X1PA 3VQCA 4KPYA 1FKOA 3VQ5A 4FCYA 3RMBA 3M8QA 4W5TA 1VSJA 3QLHA 4BWJA 3JSMA 3THVA 3VQ4A 5J2PA 4KTWA 1I39A 2W42A 4DTOA 5HRNA 3NDKA 1RBVA 3VQDA 1KVBA 3MECA 3OYAA 4F2SA 4KTZA 3WNGA 4DTSA 3F9KA 1BCMA 2D0CA 4HUGA 5C42A 4ZTJA 3NH1A 3RTVA 4DFMA 1NK6A 1U4BA 5J1EA 4F2RA 1VSKA 1GOBA 3SUQA 4ELUA 4C8OA 2KZZA 4AHVA 2HVIA 4FZYA 2OPPA 4FVMA 2VG7A 5C24A 1JL1A 3IRXA 4N56A 3ITHA 3V6DA 4W5NA 3K57A 4FLVA 3RMCA 1F21A 1RTIA 4IDKA 3RWUA 4DTXA 2QK9A 3OYBA 2O4IA 4CEBA 2HHXA 2IGIA 4J2AA 4IFVA 1RT5A 5K14A 3NGZA 4I2QA 3SZ2A 3L3UA 4Y1DA 4OPKA 4DU4A 1D8YA 2R7YA 3IS9A 2E4LA 5JS1A 1Q8IA 2P51A 1RBUA 1TKZA 3L2WA 2ATQA 2D0AA 3CYMA 2HHTA 1KLMA 4BE2A 3DLGA 3QESA 2BDPA 1HYVA 4F8RA 4CHNA 3RMDA 2PYLA 5SZTA 1UAXA 2DFHA 2B5JA 2G8WA 4OVLA 5KI6A 4DWIA 3K5NA 1HQEA 3O3HA 2KTQA 3OYEA 3ZT4A 3QNOA 3SQ2A 3NF7A 1U04A 1DTQA 4DU3A 1BIZA 4E7IA 3U3YA 3O3FA 4CJQA 4CERA 4GMJB 2GBZA 2G8HA 2X6SA 4N5SA 1IO2A 4FJHA 2YV0X 4CE9A 3DLEA 3DRSA 4B9SA 3AVIA 2FBYA 1C1CA 1O1WA 4FW2A 4HUFA 3SNNA 1IG9A 1Z26A 4Z4HA 4UQGA 2HMIA 2HNDA 1RBTA 4AHTA 4DTRA 1QQCA 1W9HA 3DOKA 4CEZA 1UOCA 3AVAA 1NK8A 4FZXC 2HHQA 3L2QA 2EHGA 1I3AA 1L3UA 2X6NA 4C8NA 1UA0A 1S1UA 4KHSA 3KLGA 1L5UA 4FM1A 3KK3A 1EX4A 1FK9A 4AHRA 3ZT0A 3SCXA 4CIEA 2P5OA 3HSTB 3RRHA 2PYJA 3OYLA 2IOCA 4BACA 1L3VA 3KIOA 1RT4A 4FJXA 1QSLA 3ZT2A 4FK4A 3B6OA 3L3VA 1NOZA 3ZT1A 3LPTA 1HMVA 3NHGA 3A2FA 2XO7A 1RCHA 4B9NA 1RTHA 2VG6A 4YFUA 1T8EA 1SKRA 1Q9YA 4J2EA 1CZBA 4DFKA 4KRFA 3M8PA 3UIQA 3ZSVA 2F8SA 3TAQA 2XY6A 3L2UA 3AVLA 2RN2A 1WNSA 2HNZA 2XY7A 1TAQA 4FJNA 3U6FA 1HRHA 4C8MA 1L3SA 1YTUA 4KTQA 4OJRA 4M42A 4KB0A 2A1RA 1X9MA 3AVFA 3QETA 4CJWA 3QEIA 1XHXA 1U47A 1G15A 1IKXA 1BCOA 1U48A 5KRTA 5HP1A 1LAVA 2OPRA 3DLKA 4FJMA 3AO2A 3WNHA 3V81A 1RNHA 4FJ7A 4M3WA 4K8XA 4RW4A 3HT3A 3KKSA 3DRPA 1NK7A 1RTJA 4QOZB 4RW8A 4PQUA 4DQSA 1IKVA 4CFDA 4FLTA 4DLEA 4FJLA 1TKXA 4NYFA 2X78A 3OYNA 2DFFA 3L8BA 3K5LA 1TK5A 4B3OA 4IKFA 3VQPA 4NCAA 1WN7A 3ZCMA 3KK1A 3L2RA 2XY8A 4KREA 5DK5A 2XHBA 4OKEA 1BQMA 4DTUA 4PWDA 4FJ5A 3TAFA 4OLBA 2JLEA 5T7BA 5C25A 3V9SA 3V1RA 2P5GA 3HPHA 4CEAA 4ELVA 1J9AA 3SUOA 5HROA 3VA0A 3O4QA 4ZTFA 1ZBIA 2I5JA 1JKHA 3PUFA 2FBTA 3DRRA 1RBSA 4CIFA 4ID1A 1BL3A 1S1TA 4AILC 3TAPA 4LSLA 3KD5E 2OZSA 4KHYA 1C6VA 4FZZA 2YNIA 4O4GA 3KLIA 3NF6A 3G0ZA 1S5JA 2VWJA 4E7JA 3SJJA 4W5OA 2IAJA 1R0AA 3C6TA 4G1QA 1NK9A 3M8SA 1HPZA 4CGHA 3HVTA 1J5OA 4PY5A 1WSJA 1S1VA 1ASVA 4NYNA 4QCLA 4E3SA 2G8VA 3AO4A 3PV8A 3FFIA 3ZSOA 4DQPA 2HB5A 3DMJA 3LZIA 2QXFA 4E0DA 3ZSZA 3V1OA 4CF2A 3HP9A 2G8UA
chains in the Genus database with same CATH superfamily
1VQ4N 4FLWA 4PUOA 3AVHA 4CBXA 5AQJA 4DUZK 2VWKA 4CJTA 5GAGP 1NBWA 4BGAA 2GTDA 4NCGA 4JKCA 5BR8K 1SKSA 1N36K 3AARA 4BWMA 1WSEA 1TK8A 5LL6Z 4CGDA 4B1XB 3MEDA 4CEEA 4DQIA 3H46O 2WC9A 2O8CB 1NNEA 4ILJA 2XRIA 4QAGA 1A5WA 3AVJA 3WNEA 4W5QA 2YHXA 3FR0A 3LM2A 3VOVA 4DQQA 3QO9A 3PX4A 2O8DB 4BC2A 1KRPA 1VQ9N 1JXEA 3IDHA 3U9ZA 3M1FA 3VQBA 2E88A 3VEVA 5KGXA 3QB0A 3RMAA 1EETA 1NOYA 3OJUA 1VQON 4MFBA 4O44A 4YDUC 4JS4A 3MCPA 3CXCM 2G8FA 1IKYA 2HMPA 4AHCA 4OPJA 4JS5A 4FLYA 3FLCO 1SUQA 3TAEA 1NK4A 4IOAL 1YVNA 1C0MA 3CPWM 3NGYA 1FW6A 1HJOA 4GW6A 3MCAB 3D0PA 1N6QA 2HHUA 2F8TA 1QQNA 3CQXA 2Q0UA 3MWPA 3VQ8A 4CK1A 3HL8A 4Q0BA 1BQNA 4LF6K 1T03A 4NCBA 4FL9A 2PY5A 1NLVA 1X3NA 4H4OA 3OY9A 3PX6A 4DMNA 1WAJA 4BC3A 4O0IA 3CM5A 4B3TK 2ETJA 5KPRA 4E89A 3GG4A 4FWKA 4CHOA 1RT1A 2RHKA 4E19A 3H45C 2Z1IA 3AA5X 3F9MA 3T19A 3WXKA 3C6AA 2P9PA 1K8AO 1L3TA 1TK0A 4KHNA 2HHWA 1BGXT 1BWFO 1NK0A 3VQQA 4DV2K 4CHZA 3WQTA 3C7NA 4CHPA 3SV3A 4E1MA 3ULEB 4CFBA 3MXJA 3ZETB 4EP5A 2GUPA 4A62A 4MQ3A 4DR7K 5HBMA 4JV5K 4E7KA 3R3LA 4XH5A 4H5VA 1JLCA 2AJQA 1Y97A 3PO5A 3HO1A 4FJGA 1X9WA 1U2VA 3P83D 4V19S 3DYAA 4E7HA 5GAEP 4HTLA 1N32K 3L0QA 4DSFA 2ZM6K 2W40A 4IDHA 1Q82O 3PY8A 5AQSA 4CF8A 2Q36A 4BVPA 1RT6A 3CG7A 4YOYA 1MU2A 3TAMA 3FZLA 1C0UA 3EEQA 4M3RA 1I94K 3JYTA 4GV6A 3K58A 4K25A 2Q31A 1FKPA 4Z4GA 3AV9A 4CGIA 1T3VA 1SL0A 3VQAA 1HKBA 4J2BA 4L3QA 1QSYA 2QEXN 2P9SB 3CFPA 4B9TA 1DKGD 2D1KA 4KB1A 3TR8A 4BQZA 1S9EA 1R59O 3ASMA 4JLHA 5AQZA 1B92A 3OS0A 4KH4A 3O1WA 5C12A 4FXDA 4Y0WA 2HBJA 1IBKK 5JLHA 2AA4A 3EYZA 2B6AA 4FVUA 4BR2A 3QDKA 5KPZA 4JKDA 1G99A 3E01A 3VQ6A 4M3YA 4O0JA 3LP2A 4AH9A 2FF6A 4JD2A 3ZSWA 3OBWA 3CCVN 5C0YA 3ZX0A 4I6MB 3LWLA 2KFZA 4ZHRA 4B3RK 5CZ1A 2OPSA 4KBOA 2P9IA 3HZ6A 3SAFA 4CFCA 3KJVA 4HTUA 1RGIA 1VSFA 3VETA 4C8KA 1Q9XA 5AQYA 5M1OA 5GIOA 3CFRA 3ENOA 1T6CA 1IG8A 4ILHA 3V9XA 3Q7CA 4HCCA 5ADXA 3CM6A 1KAZA 4FJKA 2NRVA 4CJ3A 4RTFD 4FJ8A 1QVFM 4Z4IA 3CJBA 2Q2RA 3EE9A 4Z94A 1SZ2A 2Q97A 3ZEUB 1TL3A 4CJEA 4C8LA 3HXMA 1J53A 2YKNA 2QKKA 3R6MA 2FBVA 5AQIA 4JK7A 1YT3A 4R5PA 3MN6A 3OYKA 5KTQA 4JI1K 1KLNA 4IZ9A 3W3DA 2Z1HA 4ISEA 2YHAA 4KKOA 5AQUA 3VQ7A 3H08A 4RW6A 1WLJA 4H5TA 3W0LA 2GV9A 4JI2K 3DAWA 2ZF5O 3SPYA 5AZIA 5E41A 3T69A 3TANA 5J2NA 2LSNA 3VQCA 5CE3A 4JNEA 4FCYA 2QWNA 3M8QA 3JSMA 4C1NK 1I39A 4PKIA 4BROA 2W6LA 5LY3A 3SBTA 1RBVA 4BR5A 3WNGA 3RTVA 5AQKA 1NK6A 3A0IX 1GOBA 3CC7N 4AHVA 4FZYA 5C24A 2VG7A 1JL1A 3IRXA 4CZMA 1F21A 1ESVA 4LF7K 4IDKA 3HM8A 3D2EB 2HHXA 4J2AA 3DXMA 3NGZA 3SZ2A 2CGKA 4MDAA 3J7AP 5LJWA 2R7YA 1IBLK 1XC3A 4FOIA 1RBUA 1TKZA 4CD3A 4DQ8A 3CYMA 3CJ9A 1YIJN 1KLMA 1GLDG 4BE2A 1M90O 2BDPA 2HBKA 5JLFA 2PYLA 3K0SA 5SZTA 2B5JA 2VWBA 5KI6A 3O3HA 3B8AX 3OYEA 5AQFA 1C0FA 1P8ZA 1U04A 3LDLA 2QWPA 4CJQA 2NRRA 4GMJB 3HI0A 2F9WA 1IO2A 4YOWA 4H5RA 1HR0K 2FBYA 2NRXA 4K43A 4HUFA 1WBDA 1RBTA 4H0YB 3WEEB 4CEZA 3MN9A 1EWRA 3L2QA 2EHGA 4KHSA 4JKBA 2CH5A 5EY4A 3KLGA 4FM1A 4IJAA 5BPLA 2P5OA 3J7ZO 2E20A 2H3GX 2PYJA 2VGMA 3BEXA 2PBDA 1L3VA 1RT4A 4FK4A 1WOQA 3ZT2A 3ZT1A 3NHGA 3A2FA 2XO7A 2VG6A 1J5EK 4YFUA 1T8EA 1Q9YA 4J2EA 4BRKA 4JHDA 4DFKA 3ZSVA 2F8SA 3WXLA 3A5MC 1YTUA 3U6FA 1L3SA 2A1RA 4CJWA 1MWKA 3CQYA 3JXUA 3ZX3A 1G15A 1YXQA 5KRTA 4NLBA 3CCJN 4BRAA 4FJMA 3AO2A 1HNXK 3UKUB 2ASPA 4OO1J 4IFEA 4K8XA 4DR6K 4RW4A 3KWGA 2KHOA 4JI4K 1NK7A 4QOZB 3VEYA 4RW8A 4CZHA 3G4SN 1V4SA 4DQSA 4MLHA 4DR3K 4FLTA 3OYNA 4FWMA 4BR7A 4B3OA 4NCAA 5AQVA 3L2RA 5DK5A 5AQRA 3BZCA 4H5WA 1TYQB 2E1ZA 3JS6A 1J9AA 5HROA 3THYA 4CZIA 3PUFA 2YHWA 4AILC 1BL3A 4H0VB 5FPDA 4LF8K 4KHYA 4FZZA 2YNIA 2VWJA 3C0BA 2D4WA 2P9LB 3SJHA 4G1QA 1Z05A 3M8SA 1HPZA 4LF9K 1P90A 1S1VA 4NYNA 4E3SA 2G8VA 3MX5A 3TTDA 5AQOA 2HB5A 2OANA 3HP9A 1W97L 2G8UA 4FW1A 2QXLA 4JAXA 4OX9K 3VA3A 4LH5A 2ZJPL 4IO9L 4GVMA 4M3TA 3LP3A 3TARA 1NGIA 3HTVA 1JLQA 3HOSA 1EKEA 1HKGA 3OVNA 4BRLA 4BG9A 2DTUA 1NGJA 3CJCA 3BDPA 1K6YA 3QNNA 4CJPA 2GEMA 1VRUA 3LAMA 3AA4A 1CZ9A 2KQ2A 1QQOA 3HP6A 4HHTA 1VSMA 1EWQA 3B6PA 3THXA 4BDYA 4AHUA 2FSKA 1VAZA 3DI6A 1VSLA 3KK2A 5AQHA 4EFHA 3CC4N 4CGFA 2IVOA 4CEDA 2EWSA 4IOCL 4GVEA 4B9LA 2O8EA 4JK8A 1XI1A 2YJFA 3O9QA 3F2KA 3F5TA 2BTFA 4O8KA 5AFUA 1JCEA 4CJ4A 3MXMA 1YTAA 3N4QA 4U7BA 1TVRA 3AA3A 4LF4K 4OGEA 4M41A 2Z1JA 3NE6A 4BDZA 3SV4A 3VTHA 5AR0A 4KAZA 2Q3SA 1S6QA 1J54A 5FPEA 3K9KA 2QTDA 4CJKA 4DR2K 4N41A 3OYJA 2ZQBA 4KH5A 1ZBHA 4MO5A 2NLXA 4LY7A 3L2VA 2DFEA 4B9VA 3AVNA 1GOAA 1UA1A 4WQ5A 3IAYA 4FYDA 5HLFA 1TV6A 2KW4A 3SUNA 3AVKA 1LV5A 1B9DA 4KI6A 3ALYA 1NGCA 3OYIA 4EP4A 1KAYA 3QBWA 3QEVA 5J2MA 3THWA 4FJ9A 1LW0A 3BGRA 1RDWX 1CXUA 2NRTA 4CESA 1KC8O 2E2PA 5HRRA 1SV5A 1E4GT 5LMUK 2D0BA 4DCHA 1JJ2M 3OYHA 3DOLA 3GDQA 2NRZA 4I9LA 4JRQA 1S1WA 2HVHA 1KSPA 3MXIA 1YITN 3AY9A 2HHSA 2JGUA 1HUXA 1RDDA 4JI3K 4CGJA 1DTTA 4BE1A 4DFJA 2HF4A 2PZSA 1QHTA 1YF5L 5CY4A 1TUUA 3UE5A 3GOIA 4JN4A 4CJLA 4DFPA 1NWKA 3M8RA 1JLGA 2O8CA 5GIPA 1KFSA 4UY8O 1FJGK 1KTQA 1Z25A 3LDOA 3O4NA 4OKKA 3P5JA 2O8DA 4KH6A 2BUPA 4CI6A 3V9WA 1NMNA 2V52B 1DLOA 1OH6A 2VCPA 4FWOA 4M7XA 4DB3A 3PO4A 1NU0A 4CZEA 3SQ0A 4CHQA 4RW7A 3U8XA 2QWQA 2V7ZA 4ILGB 2P1JA 2XY5A 1EO1A 5KGWA 4IFYA 3V1QA 3UKRB 2QWOA 1KAXA 5AQLA 1RDUA 4DV6K 1J6ZA 1U6ZA 4Z4EA 3O9RA 4RG8A 3U9DA 4Q5VA 3SAGA 5F2RA 4DS5A 1JLAA 1T6DA 3I0SA 3SK3A 3GL1A 3IFRA 5I9EB 5CYMA 4K41A 4FWSA 1C1BA 3MN7A 4BRMA 3HM9A 3FZHA 1VQPN 4CEQA 3LDSA 4DF4A 2YNFA 3MEGA 4DTPA 3HYFA 4I9QA 3ZT3A 2BE2A 3RR8A 4YNQA 2KFNA 1ZXOA 2W41A 3J80O 3FZFA 4BDPA 4ELTA 2Y1IA 1WSIA 5C15A 1T44A 2GWKA 2IS3A 1WBBA 4Z4CA 1D9DA 5AQMA 3WNFA 3KD1E 3SPZA 3MAQA 1KVCA 4CZJA 5FRNA 3EZWA 1ZBFA 3ZSRA 1XC9A 4M3XA 1A5XA 4MDBA 3ZETA 3QEPA 1X9SA 2YHBA 4JKGB 4YOVA 3O4WA 4DV3K 1C0GA 3QICA 4A2BA 3M5RA 1CXQA 3I8DA 5EXWA 3TU5A 1A5VA 2DY4A 3V9UA 4Z4FA 4CBUA 2OPQA 3A8YA 1RILA 1RT7A 1VSEA 1ZBLA 1HJRA 3HVRA 3H3OB 4FSVA 1BISA 2ITMA 4JI8K 5CZ2A 4CIGA 1QHAA 3D2FB 3S3MA 2OYQA 4B3MK 3O80A 4DLGA 3TABA 4OKJA 2Q1NA 1NGHA 2ZWHA 5KQ8A 2E2QA 3VPZA 4MLEA 3O08A 4W5TA 1NGFA 1VSJA 3QLHA 2P9SA 1NG9A 2CH6A 3OYAA 4F2SA 4KTZA 4WQ5C 3F9KA 1BCMA 1CZAN 3NH1A 1TUYA 1U4BA 1VSKA 4C8OA 2ZGYA 1YHQN 4N56A 1RTIA 4DTXA 3T1HK 2O4IA 4PHTX 1HKCA 2IGIA 1RT5A 5BREA 2P9UB 4I2QA 1H1VA 3IS9A 4PL8A 2E4LA 2A5XA 1Q8IA 4B1YB 1BG3A 2HHTA 5BN9A 3DLGA 4A57A 1KQSM 1HYVA 4AM7A 4F8RA 1K9MO 2DFHA 4OVLA 4FWLA 1HQEA 4BRPA 3ZT4A 2O8FB 2IVPA 3NF7A 4B1VA 4DU3A 2UXBK 4CERA 2GBZA 1VHXA 2YV0X 5AQGA 4IXCA 3AVIA 2HMIA 5BPMA 4Z4HA 2FSNA 3ENHA 1W9HA 2CGJA 3AVAA 4IOXA 1UA0A 1DGKN 1VQLN 1FK9A 4CIEA 3TSPA 2I7PA 3OYLA 2IOCA 4FJXA 4A5BA 3L3VA 1NOZA 3LPTA 4B9NA 3LDNA 2OTLN 1SKRA 3IMXA 4KRFA 4DV0K 3TAQA 3L2UA 2RN2A 3AGKA 2HNZA 4BRIA 3MMVA 4C8MA 3SBGA 4KB0A 2A42A 4BRCA 3QEIA 4JYAK 2D0OA 2WBNA 1U47A 1IKXA 1BCOA 3BUZB 2UUAK 1LAVA 3P39A 1RNHA 3HT3A 1BA1A 3FZMA 1VQKN 3A5LC 3DXKB 1RTJA 4CW7B 2F4VK 4YY3K 2FLOA 2P9NB 4NYFA 2DFFA 2P9IB 5BRFA 1BQMA 3VERA 4QS9A 1SAZA 3TAFA 4OLBA 4JKHA 4RCHA 3V1RA 2PAVA 4PL7A 4ELVA 3D2EA 3SUOA 3VA0A 3O4QA 4ZTFA 1ZBIA 3CF5L 2I5JA 1JKHA 3QBXA 3H6EA 4ID1A 1S1TA 1W2BM 3KD5E 3TSUA 2OCEA 3NF6A 4O4GA 3G0ZA 1S5JA 3CCUN 1E4FT 3OA9A 2IAJA 1R0AA 2FSJA 3C6TA 4FWRA 1YJWN 1J5OA 4GV3A 4PY5A 1ASVA 4DR1K 3N4PA 4QCLA 2YJEA 5C2FA 4DQPA 4E0DA 3ID8A 3ZSZA 3ZYYX 3ATVA 4M3UA 4M45A 3HBTA 4A59A 3OYFA 1VQ6N 2W6KA 3NGIA 4WYBA 3CCLN 3DWLA 3LANA 1BO5O 3E9LA 5AQNA 4DS4A 5BR9A 4H0OA 3FE1A 3WEEA 1JLBA 1RT2A 5FPNA 3VF2A 4CF0A 4DTMA 3ZX2A 1X3MA 1W0HA 1B9FA 1JCGA 2NZTA 1QSSA 5FDLA 1IH7A 5EX5A 4A5AA 4H0TB 1S6PA 4F9OA 3AVBA 1YJNN 2WOMA 1JLFA 1QZ5A 1RT3A 3WUHA 3F73A 4RW9A 5HRSA 4G9ZA 4CVNE 2E5LK 2UU9K 3CERA 4B3SK 3MWTA 1TGOA 1S72N 3EZ5A 1XNQK 4BRDA 3UKUA 2UYTA 1NJIO 2ZD1A 1D4XA 3VEZA 4GY2B 2P9KB 3ID6A 4QS8A 4DHYA 4WE1A 4AM6A 2E2OA 4JI6K 4Y1CA 3VGKA 3RSEA 3DLRA 1DEJA 1QE1A 3L4QA 4BRQA 1JXBA 4IBNA 2YKMA 4C23A 3C6UA 3AVCA 1HX1A 3CJ7A 1HQUA 1VQMN 1TYQA 2F96A 5CR4A 1ITGA 1KXPA 1K8KB 3BF1A 1KCFA 4LC9B 4XIUA 1QVGM 2O8BA 5C2DA 4ICLA 5EOYA 3EE8A 3R1XA 1WSHA 1HPMA 1SL1A 2QW9A 4BR9A 3LAKA 1S1XA 1VRTA 1XWLA 5HOOA 5HRPA 5KPTA 4B08A 3TTCA 3I56N 3HPGA 3S3OA 3NAEA 4I2PA 5D3GA 2CGLA 2JWLA 4BR4A 4CCHA 3HJFA 4GKKK 4CJ7A 1EQYA 5BRDA 4FJIA 1KD1O 2NUBA 1BI4B 1OH8A 3OYDA 1NK5A 2KZMA 3H1QA 3QINA 4B1UB 1TKDA 1BOTO 3VGMA 5BPNA 4LH4A 5I42A 3CFOA 2DPNA 5MLCQ 4W5RA 2VGNA 4I7FA 3TAGA 5AQTA 3WT0A 2O4GA 1T05A 3NH0A 1SKWA 3V4IA 3SUPA 4O55A 2X74A 3O9TA 1S9GA 1U45A 1YI2N 1ZYQA 2ZJRL 1HNIA 3OYCA 1LWEA 4ID5A 3VF4A 1VSHA 4EHTA 2VG5A 4A2AA 5F0XA 4TSXA 2YI1A 1ASWA 5B8HA 1N33K 2ZE2A 4GV9A 3HPOA 2QKBA 1HYSA 3GE1A 1RBRA 2A41A 3P1GA 1LW2A 3DM2A 3VQ9A 3K9JA 4DF8A 4CBWA 3PX0A 4FK2A 1OKJA 3VQEA 4YOUA 1NGGA 4DUYK 3G10A 3K5OA 5KQDA 5J2QA 5TKYA 4FJJA 3L6QA 3U4LA 3OYGA 4BVOA 1NKCA 1DT9A 3LP0A 3S3NA 3VESA 3KLFA 4FPBA 3ZSQA 4CEFA 3QIOA 1VSIA 3AO3A 3AVGA 3KLEA 2HBLA 4H0PA 3LM9A 3AA2A 1XHZA 2GUIA 4B8AB 4LF5K 5DM7L 1GLLO 3C95A 4DSJA 3NMUA 3SLCA 2E2NA 5JS2A 4IG3A 4K8ZA 3I0RA 3OS1A 3OTOK 4CJVA 5AZJB 4DR4K 3TI0A 4B9MA 2F7TA 1LWFA 3E66A 4CJUA 1EP4A 3CCQN 3AGRA 4DKWA 4KI4A 1GLFO 5JMVA 3K59A 4LFCK 3MEEA 3A5OC 4BR0A 4CECA 2HHVA 3KK7A 4JK9A 3K5MA 4DV1K 3EKUA 1VSDA 4KHUA 3CETA 2VQEK 4BRHA 1RDCA 3JAMO 1IBMK 2O8EB 1UWBA 1WSFA 1RDAA 1XNRK 4KO0A 2FBXA 1QZ6A 4FWPA 3R8EA 4H5NA 3ATUA 1NMDA 4DG1A 2ITGA 4E7LA 3CHWA 1GOCA 4CZLA 5M1NA 5DMRA 3NVMA 3SQ1A 5IT9O 3KTQA 1IJJA 1RTDA 1JLEA 2QWMA 3E9PA 2BH1A 3T3FA 3OS2A 4OLAA 3T1YK 1YVUA 2QM1A 3AO1A 2VYPA 3ULDA 3O1BA 3I55N 4KPYA 2QI2A 3BF3A 1FKOA 3RMBA 1Q18A 3GBTA 4BG8A 3MDQA 4BWJA 5J2PA 3FFKB 4KTWA 2W42A 3UKRA 4DTOA 4NXNK 5HRNA 3NDKA 3VQDA 3MECA 4X65K 4DTSA 1OVYA 4ZTJA 4DFMA 2IIRA 5J1EA 3TPQA 4ELUA 2KZZA 3THWB 2OPPA 1GLEG 4FVMA 4A61A 1NGEA 4FLVA 3SMPA 1LOTB 3QFUA 2QK9A 3OYBA 5ADXH 1Q81O 4CEBA 1BU6O 4IFVA 5K14A 2GX9A 4DU4A 4CZFA 4RWTA 1D8YA 5C10A 4YHHK 3QESA 2YX6A 4X64K 4CF2A 2G8WA 2HHHK 3D6RA 2FXUA 1BIZA 4E7IA 3O3FA 2ZGZA 2X6SA 3CJAA 4N5SA 4K42A 3DRSA 3M3ZA 4FW2A 1C1CA 1O1WA 2GWJA 1IG9A 1Z26A 4UQGA 3L4IA 3QMLA 4DTRA 5HL7L 1XMQK 1QQCA 3DOKA 4FZXC 1NK8A 2HHQA 4JKGA 1L3UA 2X6NA 2ASOA 3QFPA 1L5UA 3O9SA 3O8MA 1EX4A 2UUBK 4AHRA 2GELA 5GAHP 4X66K 3RRHA 3KIOA 2WTUA 1QSLA 4KTQA 2ZJQL 2NRWA 3Q7BA 3M8PA 3ULEA 3D2FA 3WQUA 4O8UA 1HRHA 1VQ7N 2Q0RA 1NGAA 1K73O 1ATNA 5E84A 3QETA 2A6AA 3TSQA 1U48A 4BC4A 4EIAA 3DLKA 5M1FA 3VEWA 3E9OA 3V81A 4FJ7A 4B1WB 4CD1A 3CD6N 1RFQA 5DM6L 3EO3A 3KKSA 1XMOK 1OVQA 1M1KO 3KZBA 3VTIA 4CFDA 3AAQA 4DLEA 3OBYA 1TKXA 4H0XB 5BN8A 1N34K 4FJLA 5GADP 3L8BA 4BQLA 1TK5A 4WQ4A 4IKFA 1N8RO 1WN7A 2JWKA 4KREA 1HNWK 2XHBA 3WXJA 2HOEA 4DTUA 4PWDA 4FJ5A 2JLEA 5M1QA 5C25A 3V9SA 3HPHA 4CEAA 4JI0K 4WCEL 4JKFA 2FBTA 3DRRA 2P9UA 4CIFA 3C6HA 3TAPA 3KLIA 3OHRA 4E7JA 3SJJA 4BGBA 1NK9A 1WUAA 3HVTA 1ATSA 3TTFA 4CZGA 1WSJA 1S22A 5M1KA 3LDQA 3AO4A 3PV8A 3FFIA 3ZSOA 3I8BA 4EAHD 1VQNN 2P9PB 2NRHA 3LZIA 1ILYA 3KKRA 4C1NI 2O8FA 3DJCA 1WB9A 2OA8A 2HF3A 1IKWA 3HK2A 3C7NB 4CF1A 1TAUA 1OH5A 2WUSA 3BY5A 3VF6A 3T1AA 1MA9B 3NBPA 2FC0A 3RRGA 4KHPK 3SI6A 3CQ8A 1XUPO 2RE2A 3ZSXA 3EY1A 4I6MA 4PA1A 4OPAA 1EXQA 2KKZA 3WXMB 4U67L 3U3GA 2E6LA 1U2VB 2QA4N 4FWQA 1FXXA 4FWNA 5BRHA 3T7ZA 5LMNK 1ATRA 1C0TA 1YUWA 3DLBA 4CJ5A 2HNYA 3S9HA 1HNZK 4DU1A 1GLBG 2IC3A 4GKJK 4N76A 4WF9L 3EL2A 3HSCA 3SQ4A 5F1XA 4B9UA 4CJFA 1Q86O 1N5YA 3CCEN 4BC5A 3LWMA 3ZEUA 4DTNA 5AQQA 1VK0A 4J2DA 1JCFA 4DQRA 5LJVA 3DXKA 2Y1JA 4LD0A 4LFAK 2RPIA 2Z1GA 3ISNC 4IO8A 3A5NC 4HCBA 2P9NA 1NKEA 1T7PA 3O3GA 3PSFA 4DSKA 3LP1A 2YNGA 3CPEA 3P38A 4AHSA 4H8KA 1NJXA 1WSGA 3D45A 3RVCA 4OPHA 2YCHA 3K2PA 1REVA 1ASUA 2A3ZA 1KFDA 2D5RA 4KHQA 3PLAA 1V4TA 2G8KA 4CJRA 2A1SA 3ENBA 3O9UA 4JD2B 3CMEN 3D7EO 4DV7K 1MDUB 5JICA 1BA0A 4M3ZA 3MN5A 4CHYA 4DSIA 4FM0A 3DLLL 3CJ1A 3M6GA 4IJNA 5AQPA 3J8AA 3C65A 2IDOA 1Q7YO 3NF9A 5E26A 4E1NA 3CC2N 5I3UA 1TKTA 2BANA 3EN9A 3OJSA 3UB5A 2HBMA 2ASMA 3SYZA 3NCIA 4YOXA 1BHLA 2V51B 4B1ZA 4FLXA 3ZLJA 1TL1A 4EZ9A 3CIPA 4JI7K 3IKMA 4JRPA 1U49A 3QEXA 3S41A 3I33A 1XQSC 2B4JA 4CK3A 5AFUH 3SAHA 3VEOA 3DLHA 4LSNA 3RR7A 2FF3B 4BE0A 1CLQA 1HYZA 1BDGA 3LZJA 3NFAA 3AAPA 4MO4A 2E1YA 5FLXO 5EU7A 4EHUA 3WXIA 3LDPA 4WQ4C 2A40A 2F9TA 2UUCK 2OZMA 3QIPA 3AO5A 5SWMA 3OW2M 5AZIB 5CYQA 2YNHA 4B9QA 1D5AA 3FGUA 4N47A 4CJSA 4HUEA 3QEWA 4EZ6A 4H4MA 1NKBA 1LAWA 1QS4A 2P9KA 3EKSA 2YHYA 3IUCA 4IG0A 1QTMA 4HVJA 3CCSN 1O13A 1WAFA 5FPMA 3CMAN 4DTJA 3KHYA 3KLHA 4BRGA 3PIPL 4F3OA 4CK2A 4M7YA 4NXMK 4M63C 3TWHA 4FLZA 5FRMA 2HSTA 4KV8A 5GINA 3DXMB 1ZBUA 2KLAA 1ZBSA 5FROA 1SL2A 3IG1A 1K8KA 2HW3A 2NNWA 1KVAA 4IEIA 4DV5K 1HNVA 3R9PA 3PIOL 1RDBA 2EX3A 5JVGL 5KRSA 4FM2A 2E8AA 1NJZA 4FLUA 3HOTA 1BIUA 1LWCA 1E3MA 1NGBA 2UXDK 2QWRA 1NJYA 3AVMA 2V7YA 1BI4A 4JI5K 2J4RA 4IWVA 5CHIA 1Y64A 4R79A 4L8RB 3NH2A 4CGGA 3H1VX 4HWIA 3SMSA 4FK0A 2G8IA 4KFBA 2P9LA 4KHWA 4B8CA 4XH1A 3QERA 4DSLA 4YORA 1C1AA 4GNIA 1ZC6A 3OYMA 2RF2A 3G6EN 4CF9A 3VN5A 3HRGA 4XH4A 4NO7A 2BGGA 4Z0UA 3VEXA 1YJ9N 4F3TA 4CEOA 2E6MA 2RKIA 4JHDB 3NF8A 3RSEB 1NJWA 4OGCA 2WONA 4O5BA 4LFBK 4FO0A 3LPUA 5EVZA 1IV0A 3LALA 4F4KA 3C94A 4CFAA 3ZSYA 3V9ZA 3KWIA 2UXCK 4K0KK 4DSEA 3G25A 1JL2A 1D9FA 1X1PA 4PKGA 1MWMA 3VGLA 3VENA 4NB4A 3VQ5A 2O8BB 4J8FA 3THVA 3O5BA 3VQ4A 5A2QO 4BY9C 1KVBA 2D0CA 4HUGA 5C42A 5IWAK 1QQMA 4YDUA 4F2RA 5AQWA 4ISGA 3SUQA 5AQXA 1VQ8N 2HVIA 3V6DA 4W5NA 3ITHA 5H1SQ 3K57A 3J7YP 3RMCA 4FPAA 3RWUA 5TKWA 3THYB 3P31A 1S3XA 5AJ3K 3L3UA 4Y1DA 4OPKA 3CI5A 5JS1A 2P51A 3L2WA 2ATQA 2D0AA 4BRNA 4CHNA 3RMDA 1UAXA 1LCUA 3O6WA 3BP8A 4X62K 4DWIA 2PFUA 5AZJA 3K5NA 4CZKA 2KTQA 2AP1A 1VQ5N 3QNOA 3SQ2A 3PSIA 1SS6A 1DTQA 1SQKA 4WFBL 3U3YA 3H3NO 1Z6RA 2G8HA 2OTJN 4FJHA 4CE9A 3DLEA 4B9SA 3SNNA 2QWLA 3BZKA 2HNDA 4AHTA 1GLJO 1UOCA 4NLCA 4BREA 4JKAA 1I3AA 4C8NA 1S1UA 4O5FA 3KK3A 2WFBA 4PKHA 2D0PA 4H03B 3ZT0A 3SCXA 3HSTB 4E1JA 4BACA 4YOTA 1W7AA 3B6OA 4JEPA 2VQFK 1HMVA 1RCHA 1RTHA 3THXB 1CZBA 3UIQA 3G71N 2XY6A 3AVLA 1WNSA 2XY7A 1TAQA 4FJNA 1X9JA 4DR5K 4OJRA 4M42A 1X9MA 1NM1A 1GLCG 3AVFA 1XHXA 1YAGA 1HLUA 4WFNL 5HP1A 2OPRA 3NVKA 3E1YA 3VMFB 4WFAL 4DV4K 3WNHA 4M3WA 3DRPA 3MK6A 4JKEA 4ISFA 4PQUA 1IKVA 1GLAG 1NGDA 5JVHL 4IEEA 2X78A 3K5LA 3VQPA 3KK1A 3ZCMA 2XY8A 3J81O 3MX2A 4OKEA 5T7BA 2I7NA 2P5GA 4FOEA 1OH7A 4BRFA 4AQYK 3CCRN 1RBSA 2IVNA 5M1PA 4QS7A 4LSLA 4XEIA 2OZSA 1C6VA 5ELZA 3CCMN 4W5OA 3P4IA 4CGHA 3FZKA 3LL3A 4AF1A 1BUPA 3DMJA 2QXFA 3V1OA 3KVGA
chains in the Genus database with same CATH topology
4FW1A 4FLWA 4M3UA 4M45A 4PUOA 3AVHA 3VA3A 4LH5A 3OYFA 4GVMA 2OA8A 4M3TA 3LP3A 3TARA 1IKWA 3HK2A 1JLQA 3NGIA 2VWKA 4CF1A 1TAUA 4M3ZA 1EKEA 4CJTA 3OVNA 3LANA 3T1AA 2DTUA 3BDPA 4DS4A 3NBPA 2FC0A 3RRGA 1K6YA 4NCGA 3SI6A 3QNNA 4CJPA 3CQ8A 1JLBA 1RT2A 3ZSXA 3EY1A 4CF0A 4DTMA 1VRUA 4PA1A 3LAMA 1EXQA 1W0HA 1B9FA 1SKSA 1QSSA 4BWMA 1WSEA 3AA4A 5FDLA 1TK8A 1IH7A 4CGDA 3MEDA 4CEEA 4DQIA 1CZ9A 3U3GA 2E6LA 2KQ2A 1S6PA 1FXXA 3AVBA 2XRIA 4QAGA 2WOMA 3AVJA 1A5WA 1JLFA 3WNEA 4W5QA 1C0TA 1VSMA 4DQQA 3DLBA 1RT3A 3QO9A 3F73A 3B6PA 3PX4A 4BDYA 4AHUA 1KRPA 1JXEA 4CJ5A 4RW9A 2HNYA 5HRSA 3VQBA 3S9HA 3DI6A 5KGXA 4DU1A 1VSLA 3KK2A 3RMAA 2IC3A 1EETA 4N76A 4CGFA 4CEDA 1NOYA 3OJUA 4MFBA 4O44A 4JS4A 1TGOA 3SQ4A 4B9UA 4CJFA 1N5YA 2G8FA 3LWMA 1IKYA 4DTNA 4B9LA 3EZ5A 4AHCA 4OPJA 1XI1A 1VK0A 4JS5A 4J2DA 2ZD1A 4FLYA 4DQRA 1SUQA 2Y1JA 4LD0A 4WE1A 3TAEA 4CJ4A 3MXMA 1YTAA 2RPIA 1NK4A 2Z1GA 1TVRA 3ISNC 3AA3A 1C0MA 4Y1CA 3NGYA 4OGEA 4M41A 2Z1JA 4HCBA 3DLRA 4GW6A 1NKEA 3NE6A 3D0PA 1QE1A 1N6QA 1T7PA 4BDZA 3SV4A 1JXBA 2HHUA 2F8TA 3O3GA 4DSKA 4KAZA 4IBNA 2YKMA 2Q3SA 3LP1A 3VQ8A 3C6UA 1S6QA 3AVCA 2YNGA 4CK1A 3HL8A 4Q0BA 1J54A 1BQNA 1HQUA 1T03A 2F96A 4AHSA 4H8KA 4NCBA 1NJXA 2PY5A 4CJKA 4N41A 1ITGA 1WSGA 3D45A 2ZQBA 3OYJA 4H4OA 1ZBHA 1KCFA 3K2PA 1REVA 1ASUA 4DMNA 3OY9A 4LY7A 3PX6A 1KFDA 1WAJA 2D5RA 4O0IA 4XIUA 3L2VA 4KHQA 3CM5A 3KKRA 2DFEA 4CJRA 2G8KA 2A1SA 1GOAA 3AVNA 1UA1A 4B9VA 3IAYA 2ETJA 4ICLA 4FYDA 5HLFA 1TV6A 2KW4A 4E89A 1WSHA 3SUNA 1SL1A 3AVKA 4CHOA 3LAKA 1RT1A 1S1XA 1VRTA 1B9DA 1XWLA 1LV5A 4KI6A 3ALYA 5HRPA 4B08A 4E19A 3OYIA 4EP4A 2Z1IA 3AA5X 3HPGA 3T19A 3NAEA 3S3OA 4I2PA 3QEVA 5J2MA 4CHYA 4DSIA 4FJ9A 4CCHA 5D3GA 1LW0A 3BGRA 3HJFA 1L3TA 1CXUA 4FM0A 4CESA 1TK0A 4FJIA 4KHNA 5HRRA 1BGXT 2HHWA 1SV5A 2NUBA 1BI4B 1NK0A 2IDOA 3NF9A 2D0BA 4E1NA 5I3UA 3VQQA 3OYDA 3OYHA 1NK5A 3DOLA 2KZMA 4CHZA 1TKTA 2BANA 4I9LA 4JRQA 1S1WA 4CHPA 2HVHA 1KSPA 3QINA 3SV3A 3MXIA 4E1MA 3OJSA 2KFZA 3HP6A 4HHTA 4CFBA 3MXJA 2HHSA 2JGUA 4EP5A 3SYZA 1TKDA 3NCIA 1BHLA 1RDDA 4FLXA 4CGJA 1DTTA 1TL1A 4BE1A 4EZ9A 4DFJA 2PZSA 4LH4A 1QHTA 4MQ3A 5HBMA 3CFOA 4JRPA 4E7KA 4W5RA 4I7FA 5I42A 5CY4A 1U49A 3TAGA 3QEXA 4CJLA 4DFPA 1JLCA 2O4GA 1T05A 3NH0A 1Y97A 2B4JA 3PO5A 3HO1A 2AJQA 3M8RA 4CK3A 1SKWA 3V4IA 1JLGA 4O55A 3SUPA 2X74A 4FJGA 1X9WA 3P83D 3DYAA 4E7HA 1KFSA 1S9GA 1U45A 1KTQA 1ZYQA 1Z25A 1HNIA 3OYCA 3O4NA 1LWEA 4DSFA 4ID5A 4OKKA 3DLHA 3P5JA 1VSHA 4LSNA 3RR7A 3PY8A 2VG5A 4BE0A 4CF8A 1CLQA 1HYZA 3LZJA 3NFAA 3V9WA 1RT6A 3CG7A 1DLOA 4TSXA 1ASWA 1MU2A 3TAMA 5EU7A 1C0UA 2ZE2A 3PO4A 4M3RA 2OZMA 3HPOA 2QKBA 3QIPA 1HYSA 3AO5A 3JYTA 5SWMA 1RBRA 3P1GA 5CYQA 1LW2A 3K58A 3DM2A 2YNHA 3SQ0A 4CHQA 3VQ9A 1FKPA 1D5AA 4N47A 4DF8A 4Z4GA 4CJSA 3AV9A 4RW7A 4HUEA 3QEWA 3PX0A 4CGIA 1SL0A 4FK2A 4EZ6A 3VQAA 2P1JA 3VQEA 2XY5A 4H4MA 5KGWA 1NKBA 4J2BA 1LAWA 3G10A 3K5OA 1QSYA 1QS4A 4IFYA 3V1QA 3CFPA 5J2QA 4B9TA 4FJJA 4KB1A 3OYGA 3TR8A 1NKCA 1S9EA 3ASMA 4IG0A 4JLHA 1QTMA 4HVJA 3LP0A 3S3NA 1B92A 1WAFA 4DTJA 4Z4EA 4RG8A 3KLFA 3KLHA 3ZSQA 4CEFA 3QIOA 4Q5VA 3OS0A 4F3OA 4CK2A 4DS5A 1JLAA 3I0SA 1VSIA 3AO3A 3AVGA 3KLEA 4FXDA 3TWHA 5CYMA 4FLZA 5FRMA 4KV8A 3AA2A 1C1BA 1ZBUA 3EYZA 5FROA 2B6AA 1XHZA 3IG1A 1SL2A 2HW3A 3HM9A 2GUIA 3E01A 3VQ6A 1KVAA 4B8AB 4O0JA 3LP2A 4CEQA 3LDSA 4M3YA 4AH9A 4DF4A 1HNVA 2YNFA 3MEGA 3C95A 4DTPA 3HYFA 3ZSWA 4I9QA 3ZT3A 1RDBA 2EX3A 4DSJA 2BE2A 5KRSA 3LWLA 3RR8A 4FM2A 5JS2A 4IG3A 4YNQA 3I0RA 4ZHRA 3OS1A 4FLUA 5CZ1A 1NJZA 4K8ZA 2KFNA 2OPSA 4CJVA 3TI0A 4BDPA 1BIUA 2Y1IA 4B9MA 4ELTA 4CFCA 1LWFA 3KJVA 1LWCA 4HTUA 1VSFA 4CJUA 1EP4A 1WSIA 1NJYA 1Q9XA 4C8KA 2IS3A 3AVMA 4Z4CA 1D9DA 1BI4A 3CFRA 4KI4A 3V9XA 3K59A 3WNFA 3KD1E 4HCCA 3MEEA 4CECA 3SPZA 3MAQA 3CM6A 1KVCA 5FRNA 2HHVA 3K5MA 4L8RB 4FJKA 1ZBFA 3ZSRA 4CJ3A 4CGGA 3NH2A 1XC9A 4M3XA 4FK0A 1VSDA 1A5XA 2G8IA 4KHUA 4FJ8A 4KFBA 3QEPA 1X9SA 4KHWA 4B8CA 2YHBA 4Z4IA 3QERA 1RDCA 4DSLA 1C1AA 1CXQA 3I8DA 1TL3A 1UWBA 1A5VA 2RF2A 1WSFA 1RDAA 4CJEA 4CF9A 3OYMA 3V9UA 4C8LA 3VN5A 4Z4FA 3HXMA 2OPQA 4KO0A 2DY4A 1J53A 2FBXA 2YKNA 1RILA 1RT7A 2QKKA 2FBVA 2BGGA 1VSEA 1ZBLA 1HJRA 1YT3A 4Z0UA 4R5PA 4CEOA 3OYKA 3HVRA 4F3TA 1BISA 5KTQA 2E6MA 2RKIA 4DG1A 2ITGA 4E7LA 1KLNA 1GOCA 3NF8A 5CZ2A 5DMRA 4CIGA 2WONA 2Z1HA 4O5BA 4OGCA 2YHAA 4KKOA 1NJWA 3VQ7A 3SQ1A 3LPUA 3H08A 3S3MA 3KTQA 2OYQA 1RTDA 1JLEA 4RW6A 1WLJA 3LALA 3T3FA 3OS2A 4DLGA 3TABA 2GV9A 4OKJA 4F4KA 4OLAA 1YVUA 3C94A 4CFAA 3ZSYA 3AO1A 5E41A 3V9ZA 3SPYA 3TANA 4DSEA 3ULDA 5J2NA 2LSNA 1JL2A 1D9FA 1X1PA 3VQCA 4KPYA 1FKOA 3VQ5A 4FCYA 3RMBA 3M8QA 4W5TA 1VSJA 3QLHA 4BWJA 3JSMA 3THVA 3VQ4A 5J2PA 4KTWA 1I39A 2W42A 4DTOA 5HRNA 3NDKA 1RBVA 3VQDA 1KVBA 3MECA 3OYAA 4F2SA 4KTZA 3WNGA 4DTSA 3F9KA 1BCMA 2D0CA 4HUGA 5C42A 4ZTJA 3NH1A 3RTVA 4DFMA 1NK6A 1U4BA 5J1EA 4F2RA 1VSKA 1GOBA 3SUQA 4ELUA 4C8OA 2KZZA 4AHVA 2HVIA 4FZYA 2OPPA 4FVMA 2VG7A 5C24A 1JL1A 3IRXA 4N56A 3ITHA 3V6DA 4W5NA 3K57A 4FLVA 3RMCA 1F21A 1RTIA 4IDKA 3RWUA 4DTXA 2QK9A 3OYBA 2O4IA 4CEBA 2HHXA 2IGIA 4J2AA 4IFVA 1RT5A 5K14A 3NGZA 4I2QA 3SZ2A 3L3UA 4Y1DA 4OPKA 4DU4A 1D8YA 2R7YA 3IS9A 2E4LA 5JS1A 1Q8IA 2P51A 1RBUA 1TKZA 3L2WA 2ATQA 2D0AA 3CYMA 2HHTA 1KLMA 4BE2A 3DLGA 3QESA 2BDPA 1HYVA 4F8RA 4CHNA 3RMDA 2PYLA 5SZTA 1UAXA 2DFHA 2B5JA 2G8WA 4OVLA 5KI6A 4DWIA 3K5NA 1HQEA 3O3HA 2KTQA 3OYEA 3ZT4A 3QNOA 3SQ2A 3NF7A 1U04A 1DTQA 4DU3A 1BIZA 4E7IA 3U3YA 3O3FA 4CJQA 4CERA 4GMJB 2GBZA 2G8HA 2X6SA 4N5SA 1IO2A 4FJHA 2YV0X 4CE9A 3DLEA 3DRSA 4B9SA 3AVIA 2FBYA 1C1CA 1O1WA 4FW2A 4HUFA 3SNNA 1IG9A 1Z26A 4Z4HA 4UQGA 2HMIA 2HNDA 1RBTA 4AHTA 4DTRA 1QQCA 1W9HA 3DOKA 4CEZA 1UOCA 3AVAA 1NK8A 4FZXC 2HHQA 3L2QA 2EHGA 1I3AA 1L3UA 2X6NA 4C8NA 1UA0A 1S1UA 4KHSA 3KLGA 1L5UA 4FM1A 3KK3A 1EX4A 1FK9A 4AHRA 3ZT0A 3SCXA 4CIEA 2P5OA 3HSTB 3RRHA 2PYJA 3OYLA 2IOCA 4BACA 1L3VA 3KIOA 1RT4A 4FJXA 1QSLA 3ZT2A 4FK4A 3B6OA 3L3VA 1NOZA 3ZT1A 3LPTA 1HMVA 3NHGA 3A2FA 2XO7A 1RCHA 4B9NA 1RTHA 2VG6A 4YFUA 1T8EA 1SKRA 1Q9YA 4J2EA 1CZBA 4DFKA 4KRFA 3M8PA 3UIQA 3ZSVA 2F8SA 3TAQA 2XY6A 3L2UA 3AVLA 2RN2A 1WNSA 2HNZA 2XY7A 1TAQA 4FJNA 3U6FA 1HRHA 4C8MA 1L3SA 1YTUA 4KTQA 4OJRA 4M42A 4KB0A 2A1RA 1X9MA 3AVFA 3QETA 4CJWA 3QEIA 1XHXA 1U47A 1G15A 1IKXA 1BCOA 1U48A 5KRTA 5HP1A 1LAVA 2OPRA 3DLKA 4FJMA 3AO2A 3WNHA 3V81A 1RNHA 4FJ7A 4M3WA 4K8XA 4RW4A 3HT3A 3KKSA 3DRPA 1NK7A 1RTJA 4QOZB 4RW8A 4PQUA 4DQSA 1IKVA 4CFDA 4FLTA 4DLEA 4FJLA 1TKXA 4NYFA 2X78A 3OYNA 2DFFA 3L8BA 3K5LA 1TK5A 4B3OA 4IKFA 3VQPA 4NCAA 1WN7A 3ZCMA 3KK1A 3L2RA 2XY8A 4KREA 5DK5A 2XHBA 4OKEA 1BQMA 4DTUA 4PWDA 4FJ5A 3TAFA 4OLBA 2JLEA 5T7BA 5C25A 3V9SA 3V1RA 2P5GA 3HPHA 4CEAA 4ELVA 1J9AA 3SUOA 5HROA 3VA0A 3O4QA 4ZTFA 1ZBIA 2I5JA 1JKHA 3PUFA 2FBTA 3DRRA 1RBSA 4CIFA 4ID1A 1BL3A 1S1TA 4AILC 3TAPA 4LSLA 3KD5E 2OZSA 4KHYA 1C6VA 4FZZA 2YNIA 4O4GA 3KLIA 3NF6A 3G0ZA 1S5JA 2VWJA 4E7JA 3SJJA 4W5OA 2IAJA 1R0AA 3C6TA 4G1QA 1NK9A 3M8SA 1HPZA 4CGHA 3HVTA 1J5OA 4PY5A 1WSJA 1S1VA 1ASVA 4NYNA 4QCLA 4E3SA 2G8VA 3AO4A 3PV8A 3FFIA 3ZSOA 4DQPA 2HB5A 3DMJA 3LZIA 2QXFA 4E0DA 3ZSZA 3V1OA 4CF2A 3HP9A 2G8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FW1 A;  4FLW A;  4M3U A;  4M45 A;  4PUO A;  3AVH A;  3VA3 A;  4LH5 A;  3OYF A;  4GVM A;  2OA8 A;  4M3T A;  3LP3 A;  3TAR A;  1IKW A;  3HK2 A;  1JLQ A;  3NGI A;  2VWK A;  4CF1 A;  1TAU A;  4M3Z A;  1EKE A;  4CJT A;  3OVN A;  3LAN A;  3T1A A;  2DTU A;  3BDP A;  4DS4 A;  3NBP A;  2FC0 A;  3RRG A;  1K6Y A;  4NCG A;  3SI6 A;  3QNN A;  4CJP A;  3CQ8 A;  1JLB A;  1RT2 A;  3ZSX A;  3EY1 A;  4CF0 A;  4DTM A;  1VRU A;  4PA1 A;  3LAM A;  1EXQ A;  1W0H A;  1B9F A;  1SKS A;  1QSS A;  4BWM A;  1WSE A;  3AA4 A;  5FDL A;  1TK8 A;  1IH7 A;  4CGD A;  3MED A;  4CEE A;  4DQI A;  1CZ9 A;  3U3G A;  2E6L A;  2KQ2 A;  1S6P A;  1FXX A;  3AVB A;  2XRI A;  4QAG A;  2WOM A;  3AVJ A;  1A5W A;  1JLF A;  3WNE A;  4W5Q A;  1C0T A;  1VSM A;  4DQQ A;  3DLB A;  1RT3 A;  3QO9 A;  3F73 A;  3B6P A;  3PX4 A;  4BDY A;  4AHU A;  1KRP A;  1JXE A;  4CJ5 A;  4RW9 A;  2HNY A;  5HRS A;  3VQB A;  3S9H A;  3DI6 A;  5KGX A;  4DU1 A;  1VSL A;  3KK2 A;  3RMA A;  2IC3 A;  1EET A;  4N76 A;  4CGF A;  4CED A;  1NOY A;  3OJU A;  4MFB A;  4O44 A;  4JS4 A;  1TGO A;  3SQ4 A;  4B9U A;  4CJF A;  1N5Y A;  2G8F A;  3LWM A;  1IKY A;  4DTN A;  4B9L A;  3EZ5 A;  4AHC A;  4OPJ A;  1XI1 A;  1VK0 A;  4JS5 A;  4J2D A;  2ZD1 A;  4FLY A;  4DQR A;  1SUQ A;  2Y1J A;  4LD0 A;  4WE1 A;  3TAE A;  4CJ4 A;  3MXM A;  1YTA A;  2RPI A;  1NK4 A;  2Z1G A;  1TVR A;  3ISN C;  3AA3 A;  1C0M A;  4Y1C A;  3NGY A;  4OGE A;  4M41 A;  2Z1J A;  4HCB A;  3DLR A;  4GW6 A;  1NKE A;  3NE6 A;  3D0P A;  1QE1 A;  1N6Q A;  1T7P A;  4BDZ A;  3SV4 A;  1JXB A;  2HHU A;  2F8T A;  3O3G A;  4DSK A;  4KAZ A;  4IBN A;  2YKM A;  2Q3S A;  3LP1 A;  3VQ8 A;  3C6U A;  1S6Q A;  3AVC A;  2YNG A;  4CK1 A;  3HL8 A;  4Q0B A;  1J54 A;  1BQN A;  1HQU A;  1T03 A;  2F96 A;  4AHS A;  4H8K A;  4NCB A;  1NJX A;  2PY5 A;  4CJK A;  4N41 A;  1ITG A;  1WSG A;  3D45 A;  2ZQB A;  3OYJ A;  4H4O A;  1ZBH A;  1KCF A;  3K2P A;  1REV A;  1ASU A;  4DMN A;  3OY9 A;  4LY7 A;  3PX6 A;  1KFD A;  1WAJ A;  2D5R A;  4O0I A;  4XIU A;  3L2V A;  4KHQ A;  3CM5 A;  3KKR A;  2DFE A;  4CJR A;  2G8K A;  2A1S A;  1GOA A;  3AVN A;  1UA1 A;  4B9V A;  3IAY A;  2ETJ A;  4ICL A;  4FYD A;  5HLF A;  1TV6 A;  2KW4 A;  4E89 A;  1WSH A;  3SUN A;  1SL1 A;  3AVK A;  4CHO A;  3LAK A;  1RT1 A;  1S1X A;  1VRT A;  1B9D A;  1XWL A;  1LV5 A;  4KI6 A;  3ALY A;  5HRP A;  4B08 A;  4E19 A;  3OYI A;  4EP4 A;  2Z1I A;  3AA5 X;  3HPG A;  3T19 A;  3NAE A;  3S3O A;  4I2P A;  3QEV A;  5J2M A;  4CHY A;  4DSI A;  4FJ9 A;  4CCH A;  5D3G A;  1LW0 A;  3BGR A;  3HJF A;  1L3T A;  1CXU A;  4FM0 A;  4CES A;  1TK0 A;  4FJI A;  4KHN A;  5HRR A;  1BGX T;  2HHW A;  1SV5 A;  2NUB A;  1BI4 B;  1NK0 A;  2IDO A;  3NF9 A;  2D0B A;  4E1N A;  5I3U A;  3VQQ A;  3OYD A;  3OYH A;  1NK5 A;  3DOL A;  2KZM A;  4CHZ A;  1TKT A;  2BAN A;  4I9L A;  4JRQ A;  1S1W A;  4CHP A;  2HVH A;  1KSP A;  3QIN A;  3SV3 A;  3MXI A;  4E1M A;  3OJS A;  2KFZ A;  3HP6 A;  4HHT A;  4CFB A;  3MXJ A;  2HHS A;  2JGU A;  4EP5 A;  3SYZ A;  1TKD A;  3NCI A;  1BHL A;  1RDD A;  4FLX A;  4CGJ A;  1DTT A;  1TL1 A;  4BE1 A;  4EZ9 A;  4DFJ A;  2PZS A;  4LH4 A;  1QHT A;  4MQ3 A;  5HBM A;  3CFO A;  4JRP A;  4E7K A;  4W5R A;  4I7F A;  5I42 A;  5CY4 A;  1U49 A;  3TAG A;  3QEX A;  4CJL A;  4DFP A;  1JLC A;  2O4G A;  1T05 A;  3NH0 A;  1Y97 A;  2B4J A;  3PO5 A;  3HO1 A;  2AJQ A;  3M8R A;  4CK3 A;  1SKW A;  3V4I A;  1JLG A;  4O55 A;  3SUP A;  2X74 A;  4FJG A;  1X9W A;  3P83 D;  3DYA A;  4E7H A;  1KFS A;  1S9G A;  1U45 A;  1KTQ A;  1ZYQ A;  1Z25 A;  1HNI A;  3OYC A;  3O4N A;  1LWE A;  4DSF A;  4ID5 A;  4OKK A;  3DLH A;  3P5J A;  1VSH A;  4LSN A;  3RR7 A;  3PY8 A;  2VG5 A;  4BE0 A;  4CF8 A;  1CLQ A;  1HYZ A;  3LZJ A;  3NFA A;  3V9W A;  1RT6 A;  3CG7 A;  1DLO A;  4TSX A;  1ASW A;  1MU2 A;  3TAM A;  5EU7 A;  1C0U A;  2ZE2 A;  3PO4 A;  4M3R A;  2OZM A;  3HPO A;  2QKB A;  3QIP A;  1HYS A;  3AO5 A;  3JYT A;  5SWM A;  1RBR A;  3P1G A;  5CYQ A;  1LW2 A;  3K58 A;  3DM2 A;  2YNH A;  3SQ0 A;  4CHQ A;  3VQ9 A;  1FKP A;  1D5A A;  4N47 A;  4DF8 A;  4Z4G A;  4CJS A;  3AV9 A;  4RW7 A;  4HUE A;  3QEW A;  3PX0 A;  4CGI A;  1SL0 A;  4FK2 A;  4EZ6 A;  3VQA A;  2P1J A;  3VQE A;  2XY5 A;  4H4M A;  5KGW A;  1NKB A;  4J2B A;  1LAW A;  3G10 A;  3K5O A;  1QSY A;  1QS4 A;  4IFY A;  3V1Q A;  3CFP A;  5J2Q A;  4B9T A;  4FJJ A;  4KB1 A;  3OYG A;  3TR8 A;  1NKC A;  1S9E A;  3ASM A;  4IG0 A;  4JLH A;  1QTM A;  4HVJ A;  3LP0 A;  3S3N A;  1B92 A;  1WAF A;  4DTJ A;  4Z4E A;  4RG8 A;  3KLF A;  3KLH A;  3ZSQ A;  4CEF A;  3QIO A;  4Q5V A;  3OS0 A;  4F3O A;  4CK2 A;  4DS5 A;  1JLA A;  3I0S A;  1VSI A;  3AO3 A;  3AVG A;  3KLE A;  4FXD A;  3TWH A;  5CYM A;  4FLZ A;  5FRM A;  4KV8 A;  3AA2 A;  1C1B A;  1ZBU A;  3EYZ A;  5FRO A;  2B6A A;  1XHZ A;  3IG1 A;  1SL2 A;  2HW3 A;  3HM9 A;  2GUI A;  3E01 A;  3VQ6 A;  1KVA A;  4B8A B;  4O0J A;  3LP2 A;  4CEQ A;  3LDS A;  4M3Y A;  4AH9 A;  4DF4 A;  1HNV A;  2YNF A;  3MEG A;  3C95 A;  4DTP A;  3HYF A;  3ZSW A;  4I9Q A;  3ZT3 A;  1RDB A;  2EX3 A;  4DSJ A;  2BE2 A;  5KRS A;  3LWL A;  3RR8 A;  4FM2 A;  5JS2 A;  4IG3 A;  4YNQ A;  3I0R A;  4ZHR A;  3OS1 A;  4FLU A;  5CZ1 A;  1NJZ A;  4K8Z A;  2KFN A;  2OPS A;  4CJV A;  3TI0 A;  4BDP A;  1BIU A;  2Y1I A;  4B9M A;  4ELT A;  4CFC A;  1LWF A;  3KJV A;  1LWC A;  4HTU A;  1VSF A;  4CJU A;  1EP4 A;  1WSI A;  1NJY A;  1Q9X A;  4C8K A;  2IS3 A;  3AVM A;  4Z4C A;  1D9D A;  1BI4 A;  3CFR A;  4KI4 A;  3V9X A;  3K59 A;  3WNF A;  3KD1 E;  4HCC A;  3MEE A;  4CEC A;  3SPZ A;  3MAQ A;  3CM6 A;  1KVC A;  5FRN A;  2HHV A;  3K5M A;  4L8R B;  4FJK A;  1ZBF A;  3ZSR A;  4CJ3 A;  4CGG A;  3NH2 A;  1XC9 A;  4M3X A;  4FK0 A;  1VSD A;  1A5X A;  2G8I A;  4KHU A;  4FJ8 A;  4KFB A;  3QEP A;  1X9S A;  4KHW A;  4B8C A;  2YHB A;  4Z4I A;  3QER A;  1RDC A;  4DSL A;  1C1A A;  1CXQ A;  3I8D A;  1TL3 A;  1UWB A;  1A5V A;  2RF2 A;  1WSF A;  1RDA A;  4CJE A;  4CF9 A;  3OYM A;  3V9U A;  4C8L A;  3VN5 A;  4Z4F A;  3HXM A;  2OPQ A;  4KO0 A;  2DY4 A;  1J53 A;  2FBX A;  2YKN A;  1RIL A;  1RT7 A;  2QKK A;  2FBV A;  2BGG A;  1VSE A;  1ZBL A;  1HJR A;  1YT3 A;  4Z0U A;  4R5P A;  4CEO A;  3OYK A;  3HVR A;  4F3T A;  1BIS A;  5KTQ A;  2E6M A;  2RKI A;  4DG1 A;  2ITG A;  4E7L A;  1KLN A;  1GOC A;  3NF8 A;  5CZ2 A;  5DMR A;  4CIG A;  2WON A;  2Z1H A;  4O5B A;  4OGC A;  2YHA A;  4KKO A;  1NJW A;  3VQ7 A;  3SQ1 A;  3LPU A;  3H08 A;  3S3M A;  3KTQ A;  2OYQ A;  1RTD A;  1JLE A;  4RW6 A;  1WLJ A;  3LAL A;  3T3F A;  3OS2 A;  4DLG A;  3TAB A;  2GV9 A;  4OKJ A;  4F4K A;  4OLA A;  1YVU A;  3C94 A;  4CFA A;  3ZSY A;  3AO1 A;  5E41 A;  3V9Z A;  3SPY A;  3TAN A;  4DSE A;  3ULD A;  5J2N A;  2LSN A;  1JL2 A;  1D9F A;  1X1P A;  3VQC A;  4KPY A;  1FKO A;  3VQ5 A;  4FCY A;  3RMB A;  3M8Q A;  4W5T A;  1VSJ A;  3QLH A;  4BWJ A;  3JSM A;  3THV A;  3VQ4 A;  5J2P A;  4KTW A;  1I39 A;  2W42 A;  4DTO A;  5HRN A;  3NDK A;  1RBV A;  3VQD A;  1KVB A;  3MEC A;  3OYA A;  4F2S A;  4KTZ A;  3WNG A;  4DTS A;  3F9K A;  1BCM A;  2D0C A;  4HUG A;  5C42 A;  4ZTJ A;  3NH1 A;  3RTV A;  4DFM A;  1NK6 A;  1U4B A;  5J1E A;  4F2R A;  1VSK A;  1GOB A;  3SUQ A;  4ELU A;  4C8O A;  2KZZ A;  4AHV A;  2HVI A;  4FZY A;  2OPP A;  4FVM A;  2VG7 A;  5C24 A;  1JL1 A;  3IRX A;  4N56 A;  3ITH A;  3V6D A;  4W5N A;  3K57 A;  4FLV A;  3RMC A;  1F21 A;  1RTI A;  4IDK A;  3RWU A;  4DTX A;  2QK9 A;  3OYB A;  2O4I A;  4CEB A;  2HHX A;  2IGI A;  4J2A A;  4IFV A;  1RT5 A;  5K14 A;  3NGZ A;  4I2Q A;  3SZ2 A;  3L3U A;  4Y1D A;  4OPK A;  4DU4 A;  1D8Y A;  2R7Y A;  3IS9 A;  2E4L A;  5JS1 A;  1Q8I A;  2P51 A;  1RBU A;  1TKZ A;  3L2W A;  2ATQ A;  2D0A A;  3CYM A;  2HHT A;  1KLM A;  4BE2 A;  3DLG A;  3QES A;  2BDP A;  1HYV A;  4F8R A;  4CHN A;  3RMD A;  2PYL A;  5SZT A;  1UAX A;  2DFH A;  2B5J A;  2G8W A;  4OVL A;  5KI6 A;  4DWI A;  3K5N A;  1HQE A;  3O3H A;  2KTQ A;  3OYE A;  3ZT4 A;  3QNO A;  3SQ2 A;  3NF7 A;  1U04 A;  1DTQ A;  4DU3 A;  1BIZ A;  4E7I A;  3U3Y A;  3O3F A;  4CJQ A;  4CER A;  4GMJ B;  2GBZ A;  2G8H A;  2X6S A;  4N5S A;  1IO2 A;  4FJH A;  2YV0 X;  4CE9 A;  3DLE A;  3DRS A;  4B9S A;  3AVI A;  2FBY A;  1C1C A;  1O1W A;  4FW2 A;  4HUF A;  3SNN A;  1IG9 A;  1Z26 A;  4Z4H A;  4UQG A;  2HMI A;  2HND A;  1RBT A;  4AHT A;  4DTR A;  1QQC A;  1W9H A;  3DOK A;  4CEZ A;  1UOC A;  3AVA A;  1NK8 A;  4FZX C;  2HHQ A;  3L2Q A;  2EHG A;  1I3A A;  1L3U A;  2X6N A;  4C8N A;  1UA0 A;  1S1U A;  4KHS A;  3KLG A;  1L5U A;  4FM1 A;  3KK3 A;  1EX4 A;  1FK9 A;  4AHR A;  3ZT0 A;  3SCX A;  4CIE A;  2P5O A;  3HST B;  3RRH A;  2PYJ A;  3OYL A;  2IOC A;  4BAC A;  1L3V A;  3KIO A;  1RT4 A;  4FJX A;  1QSL A;  3ZT2 A;  4FK4 A;  3B6O A;  3L3V A;  1NOZ A;  3ZT1 A;  3LPT A;  1HMV A;  3NHG A;  3A2F A;  2XO7 A;  1RCH A;  4B9N A;  1RTH A;  2VG6 A;  4YFU A;  1T8E A;  1SKR A;  1Q9Y A;  4J2E A;  1CZB A;  4DFK A;  4KRF A;  3M8P A;  3UIQ A;  3ZSV A;  2F8S A;  3TAQ A;  2XY6 A;  3L2U A;  3AVL A;  2RN2 A;  1WNS A;  2HNZ A;  2XY7 A;  1TAQ A;  4FJN A;  3U6F A;  1HRH A;  4C8M A;  1L3S A;  1YTU A;  4KTQ A;  4OJR A;  4M42 A;  4KB0 A;  2A1R A;  1X9M A;  3AVF A;  3QET A;  4CJW A;  3QEI A;  1XHX A;  1U47 A;  1G15 A;  1IKX A;  1BCO A;  1U48 A;  5KRT A;  5HP1 A;  1LAV A;  2OPR A;  3DLK A;  4FJM A;  3AO2 A;  3WNH A;  3V81 A;  1RNH A;  4FJ7 A;  4M3W A;  4K8X A;  4RW4 A;  3HT3 A;  3KKS A;  3DRP A;  1NK7 A;  1RTJ A;  4QOZ B;  4RW8 A;  4PQU A;  4DQS A;  1IKV A;  4CFD A;  4FLT A;  4DLE A;  4FJL A;  1TKX A;  4NYF A;  2X78 A;  3OYN A;  2DFF A;  3L8B A;  3K5L A;  1TK5 A;  4B3O A;  4IKF A;  3VQP A;  4NCA A;  1WN7 A;  3ZCM A;  3KK1 A;  3L2R A;  2XY8 A;  4KRE A;  5DK5 A;  2XHB A;  4OKE A;  1BQM A;  4DTU A;  4PWD A;  4FJ5 A;  3TAF A;  4OLB A;  2JLE A;  5T7B A;  5C25 A;  3V9S A;  3V1R A;  2P5G A;  3HPH A;  4CEA A;  4ELV A;  1J9A A;  3SUO A;  5HRO A;  3VA0 A;  3O4Q A;  4ZTF A;  1ZBI A;  2I5J A;  1JKH A;  3PUF A;  2FBT A;  3DRR A;  1RBS A;  4CIF A;  4ID1 A;  1BL3 A;  1S1T A;  4AIL C;  3TAP A;  4LSL A;  3KD5 E;  2OZS A;  4KHY A;  1C6V A;  4FZZ A;  2YNI A;  4O4G A;  3KLI A;  3NF6 A;  3G0Z A;  1S5J A;  2VWJ A;  4E7J A;  3SJJ A;  4W5O A;  2IAJ A;  1R0A A;  3C6T A;  4G1Q A;  1NK9 A;  3M8S A;  1HPZ A;  4CGH A;  3HVT A;  1J5O A;  4PY5 A;  1WSJ A;  1S1V A;  1ASV A;  4NYN A;  4QCL A;  4E3S A;  2G8V A;  3AO4 A;  3PV8 A;  3FFI A;  3ZSO A;  4DQP A;  2HB5 A;  3DMJ A;  3LZI A;  2QXF A;  4E0D A;  3ZSZ A;  3V1O A;  4CF2 A;  3HP9 A;  2G8U A; 
#chains in the Genus database with same CATH topology
 1VQ4 N;  4FLW A;  4PUO A;  3AVH A;  4CBX A;  5AQJ A;  4DUZ K;  2VWK A;  4CJT A;  5GAG P;  1NBW A;  4BGA A;  2GTD A;  4NCG A;  4JKC A;  5BR8 K;  1SKS A;  1N36 K;  3AAR A;  4BWM A;  1WSE A;  1TK8 A;  5LL6 Z;  4CGD A;  4B1X B;  3MED A;  4CEE A;  4DQI A;  3H46 O;  2WC9 A;  2O8C B;  1NNE A;  4ILJ A;  2XRI A;  4QAG A;  1A5W A;  3AVJ A;  3WNE A;  4W5Q A;  2YHX A;  3FR0 A;  3LM2 A;  3VOV A;  4DQQ A;  3QO9 A;  3PX4 A;  2O8D B;  4BC2 A;  1KRP A;  1VQ9 N;  1JXE A;  3IDH A;  3U9Z A;  3M1F A;  3VQB A;  2E88 A;  3VEV A;  5KGX A;  3QB0 A;  3RMA A;  1EET A;  1NOY A;  3OJU A;  1VQO N;  4MFB A;  4O44 A;  4YDU C;  4JS4 A;  3MCP A;  3CXC M;  2G8F A;  1IKY A;  2HMP A;  4AHC A;  4OPJ A;  4JS5 A;  4FLY A;  3FLC O;  1SUQ A;  3TAE A;  1NK4 A;  4IOA L;  1YVN A;  1C0M A;  3CPW M;  3NGY A;  1FW6 A;  1HJO A;  4GW6 A;  3MCA B;  3D0P A;  1N6Q A;  2HHU A;  2F8T A;  1QQN A;  3CQX A;  2Q0U A;  3MWP A;  3VQ8 A;  4CK1 A;  3HL8 A;  4Q0B A;  1BQN A;  4LF6 K;  1T03 A;  4NCB A;  4FL9 A;  2PY5 A;  1NLV A;  1X3N A;  4H4O A;  3OY9 A;  3PX6 A;  4DMN A;  1WAJ A;  4BC3 A;  4O0I A;  3CM5 A;  4B3T K;  2ETJ A;  5KPR A;  4E89 A;  3GG4 A;  4FWK A;  4CHO A;  1RT1 A;  2RHK A;  4E19 A;  3H45 C;  2Z1I A;  3AA5 X;  3F9M A;  3T19 A;  3WXK A;  3C6A A;  2P9P A;  1K8A O;  1L3T A;  1TK0 A;  4KHN A;  2HHW A;  1BGX T;  1BWF O;  1NK0 A;  3VQQ A;  4DV2 K;  4CHZ A;  3WQT A;  3C7N A;  4CHP A;  3SV3 A;  4E1M A;  3ULE B;  4CFB A;  3MXJ A;  3ZET B;  4EP5 A;  2GUP A;  4A62 A;  4MQ3 A;  4DR7 K;  5HBM A;  4JV5 K;  4E7K A;  3R3L A;  4XH5 A;  4H5V A;  1JLC A;  2AJQ A;  1Y97 A;  3PO5 A;  3HO1 A;  4FJG A;  1X9W A;  1U2V A;  3P83 D;  4V19 S;  3DYA A;  4E7H A;  5GAE P;  4HTL A;  1N32 K;  3L0Q A;  4DSF A;  2ZM6 K;  2W40 A;  4IDH A;  1Q82 O;  3PY8 A;  5AQS A;  4CF8 A;  2Q36 A;  4BVP A;  1RT6 A;  3CG7 A;  4YOY A;  1MU2 A;  3TAM A;  3FZL A;  1C0U A;  3EEQ A;  4M3R A;  1I94 K;  3JYT A;  4GV6 A;  3K58 A;  4K25 A;  2Q31 A;  1FKP A;  4Z4G A;  3AV9 A;  4CGI A;  1T3V A;  1SL0 A;  3VQA A;  1HKB A;  4J2B A;  4L3Q A;  1QSY A;  2QEX N;  2P9S B;  3CFP A;  4B9T A;  1DKG D;  2D1K A;  4KB1 A;  3TR8 A;  4BQZ A;  1S9E A;  1R59 O;  3ASM A;  4JLH A;  5AQZ A;  1B92 A;  3OS0 A;  4KH4 A;  3O1W A;  5C12 A;  4FXD A;  4Y0W A;  2HBJ A;  1IBK K;  5JLH A;  2AA4 A;  3EYZ A;  2B6A A;  4FVU A;  4BR2 A;  3QDK A;  5KPZ A;  4JKD A;  1G99 A;  3E01 A;  3VQ6 A;  4M3Y A;  4O0J A;  3LP2 A;  4AH9 A;  2FF6 A;  4JD2 A;  3ZSW A;  3OBW A;  3CCV N;  5C0Y A;  3ZX0 A;  4I6M B;  3LWL A;  2KFZ A;  4ZHR A;  4B3R K;  5CZ1 A;  2OPS A;  4KBO A;  2P9I A;  3HZ6 A;  3SAF A;  4CFC A;  3KJV A;  4HTU A;  1RGI A;  1VSF A;  3VET A;  4C8K A;  1Q9X A;  5AQY A;  5M1O A;  5GIO A;  3CFR A;  3ENO A;  1T6C A;  1IG8 A;  4ILH A;  3V9X A;  3Q7C A;  4HCC A;  5ADX A;  3CM6 A;  1KAZ A;  4FJK A;  2NRV A;  4CJ3 A;  4RTF D;  4FJ8 A;  1QVF M;  4Z4I A;  3CJB A;  2Q2R A;  3EE9 A;  4Z94 A;  1SZ2 A;  2Q97 A;  3ZEU B;  1TL3 A;  4CJE A;  4C8L A;  3HXM A;  1J53 A;  2YKN A;  2QKK A;  3R6M A;  2FBV A;  5AQI A;  4JK7 A;  1YT3 A;  4R5P A;  3MN6 A;  3OYK A;  5KTQ A;  4JI1 K;  1KLN A;  4IZ9 A;  3W3D A;  2Z1H A;  4ISE A;  2YHA A;  4KKO A;  5AQU A;  3VQ7 A;  3H08 A;  4RW6 A;  1WLJ A;  4H5T A;  3W0L A;  2GV9 A;  4JI2 K;  3DAW A;  2ZF5 O;  3SPY A;  5AZI A;  5E41 A;  3T69 A;  3TAN A;  5J2N A;  2LSN A;  3VQC A;  5CE3 A;  4JNE A;  4FCY A;  2QWN A;  3M8Q A;  3JSM A;  4C1N K;  1I39 A;  4PKI A;  4BRO A;  2W6L A;  5LY3 A;  3SBT A;  1RBV A;  4BR5 A;  3WNG A;  3RTV A;  5AQK A;  1NK6 A;  3A0I X;  1GOB A;  3CC7 N;  4AHV A;  4FZY A;  5C24 A;  2VG7 A;  1JL1 A;  3IRX A;  4CZM A;  1F21 A;  1ESV A;  4LF7 K;  4IDK A;  3HM8 A;  3D2E B;  2HHX A;  4J2A A;  3DXM A;  3NGZ A;  3SZ2 A;  2CGK A;  4MDA A;  3J7A P;  5LJW A;  2R7Y A;  1IBL K;  1XC3 A;  4FOI A;  1RBU A;  1TKZ A;  4CD3 A;  4DQ8 A;  3CYM A;  3CJ9 A;  1YIJ N;  1KLM A;  1GLD G;  4BE2 A;  1M90 O;  2BDP A;  2HBK A;  5JLF A;  2PYL A;  3K0S A;  5SZT A;  2B5J A;  2VWB A;  5KI6 A;  3O3H A;  3B8A X;  3OYE A;  5AQF A;  1C0F A;  1P8Z A;  1U04 A;  3LDL A;  2QWP A;  4CJQ A;  2NRR A;  4GMJ B;  3HI0 A;  2F9W A;  1IO2 A;  4YOW A;  4H5R A;  1HR0 K;  2FBY A;  2NRX A;  4K43 A;  4HUF A;  1WBD A;  1RBT A;  4H0Y B;  3WEE B;  4CEZ A;  3MN9 A;  1EWR A;  3L2Q A;  2EHG A;  4KHS A;  4JKB A;  2CH5 A;  5EY4 A;  3KLG A;  4FM1 A;  4IJA A;  5BPL A;  2P5O A;  3J7Z O;  2E20 A;  2H3G X;  2PYJ A;  2VGM A;  3BEX A;  2PBD A;  1L3V A;  1RT4 A;  4FK4 A;  1WOQ A;  3ZT2 A;  3ZT1 A;  3NHG A;  3A2F A;  2XO7 A;  2VG6 A;  1J5E K;  4YFU A;  1T8E A;  1Q9Y A;  4J2E A;  4BRK A;  4JHD A;  4DFK A;  3ZSV A;  2F8S A;  3WXL A;  3A5M C;  1YTU A;  3U6F A;  1L3S A;  2A1R A;  4CJW A;  1MWK A;  3CQY A;  3JXU A;  3ZX3 A;  1G15 A;  1YXQ A;  5KRT A;  4NLB A;  3CCJ N;  4BRA A;  4FJM A;  3AO2 A;  1HNX K;  3UKU B;  2ASP A;  4OO1 J;  4IFE A;  4K8X A;  4DR6 K;  4RW4 A;  3KWG A;  2KHO A;  4JI4 K;  1NK7 A;  4QOZ B;  3VEY A;  4RW8 A;  4CZH A;  3G4S N;  1V4S A;  4DQS A;  4MLH A;  4DR3 K;  4FLT A;  3OYN A;  4FWM A;  4BR7 A;  4B3O A;  4NCA A;  5AQV A;  3L2R A;  5DK5 A;  5AQR A;  3BZC A;  4H5W A;  1TYQ B;  2E1Z A;  3JS6 A;  1J9A A;  5HRO A;  3THY A;  4CZI A;  3PUF A;  2YHW A;  4AIL C;  1BL3 A;  4H0V B;  5FPD A;  4LF8 K;  4KHY A;  4FZZ A;  2YNI A;  2VWJ A;  3C0B A;  2D4W A;  2P9L B;  3SJH A;  4G1Q A;  1Z05 A;  3M8S A;  1HPZ A;  4LF9 K;  1P90 A;  1S1V A;  4NYN A;  4E3S A;  2G8V A;  3MX5 A;  3TTD A;  5AQO A;  2HB5 A;  2OAN A;  3HP9 A;  1W97 L;  2G8U A;  4FW1 A;  2QXL A;  4JAX A;  4OX9 K;  3VA3 A;  4LH5 A;  2ZJP L;  4IO9 L;  4GVM A;  4M3T A;  3LP3 A;  3TAR A;  1NGI A;  3HTV A;  1JLQ A;  3HOS A;  1EKE A;  1HKG A;  3OVN A;  4BRL A;  4BG9 A;  2DTU A;  1NGJ A;  3CJC A;  3BDP A;  1K6Y A;  3QNN A;  4CJP A;  2GEM A;  1VRU A;  3LAM A;  3AA4 A;  1CZ9 A;  2KQ2 A;  1QQO A;  3HP6 A;  4HHT A;  1VSM A;  1EWQ A;  3B6P A;  3THX A;  4BDY A;  4AHU A;  2FSK A;  1VAZ A;  3DI6 A;  1VSL A;  3KK2 A;  5AQH A;  4EFH A;  3CC4 N;  4CGF A;  2IVO A;  4CED A;  2EWS A;  4IOC L;  4GVE A;  4B9L A;  2O8E A;  4JK8 A;  1XI1 A;  2YJF A;  3O9Q A;  3F2K A;  3F5T A;  2BTF A;  4O8K A;  5AFU A;  1JCE A;  4CJ4 A;  3MXM A;  1YTA A;  3N4Q A;  4U7B A;  1TVR A;  3AA3 A;  4LF4 K;  4OGE A;  4M41 A;  2Z1J A;  3NE6 A;  4BDZ A;  3SV4 A;  3VTH A;  5AR0 A;  4KAZ A;  2Q3S A;  1S6Q A;  1J54 A;  5FPE A;  3K9K A;  2QTD A;  4CJK A;  4DR2 K;  4N41 A;  3OYJ A;  2ZQB A;  4KH5 A;  1ZBH A;  4MO5 A;  2NLX A;  4LY7 A;  3L2V A;  2DFE A;  4B9V A;  3AVN A;  1GOA A;  1UA1 A;  4WQ5 A;  3IAY A;  4FYD A;  5HLF A;  1TV6 A;  2KW4 A;  3SUN A;  3AVK A;  1LV5 A;  1B9D A;  4KI6 A;  3ALY A;  1NGC A;  3OYI A;  4EP4 A;  1KAY A;  3QBW A;  3QEV A;  5J2M A;  3THW A;  4FJ9 A;  1LW0 A;  3BGR A;  1RDW X;  1CXU A;  2NRT A;  4CES A;  1KC8 O;  2E2P A;  5HRR A;  1SV5 A;  1E4G T;  5LMU K;  2D0B A;  4DCH A;  1JJ2 M;  3OYH A;  3DOL A;  3GDQ A;  2NRZ A;  4I9L A;  4JRQ A;  1S1W A;  2HVH A;  1KSP A;  3MXI A;  1YIT N;  3AY9 A;  2HHS A;  2JGU A;  1HUX A;  1RDD A;  4JI3 K;  4CGJ A;  1DTT A;  4BE1 A;  4DFJ A;  2HF4 A;  2PZS A;  1QHT A;  1YF5 L;  5CY4 A;  1TUU A;  3UE5 A;  3GOI A;  4JN4 A;  4CJL A;  4DFP A;  1NWK A;  3M8R A;  1JLG A;  2O8C A;  5GIP A;  1KFS A;  4UY8 O;  1FJG K;  1KTQ A;  1Z25 A;  3LDO A;  3O4N A;  4OKK A;  3P5J A;  2O8D A;  4KH6 A;  2BUP A;  4CI6 A;  3V9W A;  1NMN A;  2V52 B;  1DLO A;  1OH6 A;  2VCP A;  4FWO A;  4M7X A;  4DB3 A;  3PO4 A;  1NU0 A;  4CZE A;  3SQ0 A;  4CHQ A;  4RW7 A;  3U8X A;  2QWQ A;  2V7Z A;  4ILG B;  2P1J A;  2XY5 A;  1EO1 A;  5KGW A;  4IFY A;  3V1Q A;  3UKR B;  2QWO A;  1KAX A;  5AQL A;  1RDU A;  4DV6 K;  1J6Z A;  1U6Z A;  4Z4E A;  3O9R A;  4RG8 A;  3U9D A;  4Q5V A;  3SAG A;  5F2R A;  4DS5 A;  1JLA A;  1T6D A;  3I0S A;  3SK3 A;  3GL1 A;  3IFR A;  5I9E B;  5CYM A;  4K41 A;  4FWS A;  1C1B A;  3MN7 A;  4BRM A;  3HM9 A;  3FZH A;  1VQP N;  4CEQ A;  3LDS A;  4DF4 A;  2YNF A;  3MEG A;  4DTP A;  3HYF A;  4I9Q A;  3ZT3 A;  2BE2 A;  3RR8 A;  4YNQ A;  2KFN A;  1ZXO A;  2W41 A;  3J80 O;  3FZF A;  4BDP A;  4ELT A;  2Y1I A;  1WSI A;  5C15 A;  1T44 A;  2GWK A;  2IS3 A;  1WBB A;  4Z4C A;  1D9D A;  5AQM A;  3WNF A;  3KD1 E;  3SPZ A;  3MAQ A;  1KVC A;  4CZJ A;  5FRN A;  3EZW A;  1ZBF A;  3ZSR A;  1XC9 A;  4M3X A;  1A5X A;  4MDB A;  3ZET A;  3QEP A;  1X9S A;  2YHB A;  4JKG B;  4YOV A;  3O4W A;  4DV3 K;  1C0G A;  3QIC A;  4A2B A;  3M5R A;  1CXQ A;  3I8D A;  5EXW A;  3TU5 A;  1A5V A;  2DY4 A;  3V9U A;  4Z4F A;  4CBU A;  2OPQ A;  3A8Y A;  1RIL A;  1RT7 A;  1VSE A;  1ZBL A;  1HJR A;  3HVR A;  3H3O B;  4FSV A;  1BIS A;  2ITM A;  4JI8 K;  5CZ2 A;  4CIG A;  1QHA A;  3D2F B;  3S3M A;  2OYQ A;  4B3M K;  3O80 A;  4DLG A;  3TAB A;  4OKJ A;  2Q1N A;  1NGH A;  2ZWH A;  5KQ8 A;  2E2Q A;  3VPZ A;  4MLE A;  3O08 A;  4W5T A;  1NGF A;  1VSJ A;  3QLH A;  2P9S A;  1NG9 A;  2CH6 A;  3OYA A;  4F2S A;  4KTZ A;  4WQ5 C;  3F9K A;  1BCM A;  1CZA N;  3NH1 A;  1TUY A;  1U4B A;  1VSK A;  4C8O A;  2ZGY A;  1YHQ N;  4N56 A;  1RTI A;  4DTX A;  3T1H K;  2O4I A;  4PHT X;  1HKC A;  2IGI A;  1RT5 A;  5BRE A;  2P9U B;  4I2Q A;  1H1V A;  3IS9 A;  4PL8 A;  2E4L A;  2A5X A;  1Q8I A;  4B1Y B;  1BG3 A;  2HHT A;  5BN9 A;  3DLG A;  4A57 A;  1KQS M;  1HYV A;  4AM7 A;  4F8R A;  1K9M O;  2DFH A;  4OVL A;  4FWL A;  1HQE A;  4BRP A;  3ZT4 A;  2O8F B;  2IVP A;  3NF7 A;  4B1V A;  4DU3 A;  2UXB K;  4CER A;  2GBZ A;  1VHX A;  2YV0 X;  5AQG A;  4IXC A;  3AVI A;  2HMI A;  5BPM A;  4Z4H A;  2FSN A;  3ENH A;  1W9H A;  2CGJ A;  3AVA A;  4IOX A;  1UA0 A;  1DGK N;  1VQL N;  1FK9 A;  4CIE A;  3TSP A;  2I7P A;  3OYL A;  2IOC A;  4FJX A;  4A5B A;  3L3V A;  1NOZ A;  3LPT A;  4B9N A;  3LDN A;  2OTL N;  1SKR A;  3IMX A;  4KRF A;  4DV0 K;  3TAQ A;  3L2U A;  2RN2 A;  3AGK A;  2HNZ A;  4BRI A;  3MMV A;  4C8M A;  3SBG A;  4KB0 A;  2A42 A;  4BRC A;  3QEI A;  4JYA K;  2D0O A;  2WBN A;  1U47 A;  1IKX A;  1BCO A;  3BUZ B;  2UUA K;  1LAV A;  3P39 A;  1RNH A;  3HT3 A;  1BA1 A;  3FZM A;  1VQK N;  3A5L C;  3DXK B;  1RTJ A;  4CW7 B;  2F4V K;  4YY3 K;  2FLO A;  2P9N B;  4NYF A;  2DFF A;  2P9I B;  5BRF A;  1BQM A;  3VER A;  4QS9 A;  1SAZ A;  3TAF A;  4OLB A;  4JKH A;  4RCH A;  3V1R A;  2PAV A;  4PL7 A;  4ELV A;  3D2E A;  3SUO A;  3VA0 A;  3O4Q A;  4ZTF A;  1ZBI A;  3CF5 L;  2I5J A;  1JKH A;  3QBX A;  3H6E A;  4ID1 A;  1S1T A;  1W2B M;  3KD5 E;  3TSU A;  2OCE A;  3NF6 A;  4O4G A;  3G0Z A;  1S5J A;  3CCU N;  1E4F T;  3OA9 A;  2IAJ A;  1R0A A;  2FSJ A;  3C6T A;  4FWR A;  1YJW N;  1J5O A;  4GV3 A;  4PY5 A;  1ASV A;  4DR1 K;  3N4P A;  4QCL A;  2YJE A;  5C2F A;  4DQP A;  4E0D A;  3ID8 A;  3ZSZ A;  3ZYY X;  3ATV A;  4M3U A;  4M45 A;  3HBT A;  4A59 A;  3OYF A;  1VQ6 N;  2W6K A;  3NGI A;  4WYB A;  3CCL N;  3DWL A;  3LAN A;  1BO5 O;  3E9L A;  5AQN A;  4DS4 A;  5BR9 A;  4H0O A;  3FE1 A;  3WEE A;  1JLB A;  1RT2 A;  5FPN A;  3VF2 A;  4CF0 A;  4DTM A;  3ZX2 A;  1X3M A;  1W0H A;  1B9F A;  1JCG A;  2NZT A;  1QSS A;  5FDL A;  1IH7 A;  5EX5 A;  4A5A A;  4H0T B;  1S6P A;  4F9O A;  3AVB A;  1YJN N;  2WOM A;  1JLF A;  1QZ5 A;  1RT3 A;  3WUH A;  3F73 A;  4RW9 A;  5HRS A;  4G9Z A;  4CVN E;  2E5L K;  2UU9 K;  3CER A;  4B3S K;  3MWT A;  1TGO A;  1S72 N;  3EZ5 A;  1XNQ K;  4BRD A;  3UKU A;  2UYT A;  1NJI O;  2ZD1 A;  1D4X A;  3VEZ A;  4GY2 B;  2P9K B;  3ID6 A;  4QS8 A;  4DHY A;  4WE1 A;  4AM6 A;  2E2O A;  4JI6 K;  4Y1C A;  3VGK A;  3RSE A;  3DLR A;  1DEJ A;  1QE1 A;  3L4Q A;  4BRQ A;  1JXB A;  4IBN A;  2YKM A;  4C23 A;  3C6U A;  3AVC A;  1HX1 A;  3CJ7 A;  1HQU A;  1VQM N;  1TYQ A;  2F96 A;  5CR4 A;  1ITG A;  1KXP A;  1K8K B;  3BF1 A;  1KCF A;  4LC9 B;  4XIU A;  1QVG M;  2O8B A;  5C2D A;  4ICL A;  5EOY A;  3EE8 A;  3R1X A;  1WSH A;  1HPM A;  1SL1 A;  2QW9 A;  4BR9 A;  3LAK A;  1S1X A;  1VRT A;  1XWL A;  5HOO A;  5HRP A;  5KPT A;  4B08 A;  3TTC A;  3I56 N;  3HPG A;  3S3O A;  3NAE A;  4I2P A;  5D3G A;  2CGL A;  2JWL A;  4BR4 A;  4CCH A;  3HJF A;  4GKK K;  4CJ7 A;  1EQY A;  5BRD A;  4FJI A;  1KD1 O;  2NUB A;  1BI4 B;  1OH8 A;  3OYD A;  1NK5 A;  2KZM A;  3H1Q A;  3QIN A;  4B1U B;  1TKD A;  1BOT O;  3VGM A;  5BPN A;  4LH4 A;  5I42 A;  3CFO A;  2DPN A;  5MLC Q;  4W5R A;  2VGN A;  4I7F A;  3TAG A;  5AQT A;  3WT0 A;  2O4G A;  1T05 A;  3NH0 A;  1SKW A;  3V4I A;  3SUP A;  4O55 A;  2X74 A;  3O9T A;  1S9G A;  1U45 A;  1YI2 N;  1ZYQ A;  2ZJR L;  1HNI A;  3OYC A;  1LWE A;  4ID5 A;  3VF4 A;  1VSH A;  4EHT A;  2VG5 A;  4A2A A;  5F0X A;  4TSX A;  2YI1 A;  1ASW A;  5B8H A;  1N33 K;  2ZE2 A;  4GV9 A;  3HPO A;  2QKB A;  1HYS A;  3GE1 A;  1RBR A;  2A41 A;  3P1G A;  1LW2 A;  3DM2 A;  3VQ9 A;  3K9J A;  4DF8 A;  4CBW A;  3PX0 A;  4FK2 A;  1OKJ A;  3VQE A;  4YOU A;  1NGG A;  4DUY K;  3G10 A;  3K5O A;  5KQD A;  5J2Q A;  5TKY A;  4FJJ A;  3L6Q A;  3U4L A;  3OYG A;  4BVO A;  1NKC A;  1DT9 A;  3LP0 A;  3S3N A;  3VES A;  3KLF A;  4FPB A;  3ZSQ A;  4CEF A;  3QIO A;  1VSI A;  3AO3 A;  3AVG A;  3KLE A;  2HBL A;  4H0P A;  3LM9 A;  3AA2 A;  1XHZ A;  2GUI A;  4B8A B;  4LF5 K;  5DM7 L;  1GLL O;  3C95 A;  4DSJ A;  3NMU A;  3SLC A;  2E2N A;  5JS2 A;  4IG3 A;  4K8Z A;  3I0R A;  3OS1 A;  3OTO K;  4CJV A;  5AZJ B;  4DR4 K;  3TI0 A;  4B9M A;  2F7T A;  1LWF A;  3E66 A;  4CJU A;  1EP4 A;  3CCQ N;  3AGR A;  4DKW A;  4KI4 A;  1GLF O;  5JMV A;  3K59 A;  4LFC K;  3MEE A;  3A5O C;  4BR0 A;  4CEC A;  2HHV A;  3KK7 A;  4JK9 A;  3K5M A;  4DV1 K;  3EKU A;  1VSD A;  4KHU A;  3CET A;  2VQE K;  4BRH A;  1RDC A;  3JAM O;  1IBM K;  2O8E B;  1UWB A;  1WSF A;  1RDA A;  1XNR K;  4KO0 A;  2FBX A;  1QZ6 A;  4FWP A;  3R8E A;  4H5N A;  3ATU A;  1NMD A;  4DG1 A;  2ITG A;  4E7L A;  3CHW A;  1GOC A;  4CZL A;  5M1N A;  5DMR A;  3NVM A;  3SQ1 A;  5IT9 O;  3KTQ A;  1IJJ A;  1RTD A;  1JLE A;  2QWM A;  3E9P A;  2BH1 A;  3T3F A;  3OS2 A;  4OLA A;  3T1Y K;  1YVU A;  2QM1 A;  3AO1 A;  2VYP A;  3ULD A;  3O1B A;  3I55 N;  4KPY A;  2QI2 A;  3BF3 A;  1FKO A;  3RMB A;  1Q18 A;  3GBT A;  4BG8 A;  3MDQ A;  4BWJ A;  5J2P A;  3FFK B;  4KTW A;  2W42 A;  3UKR A;  4DTO A;  4NXN K;  5HRN A;  3NDK A;  3VQD A;  3MEC A;  4X65 K;  4DTS A;  1OVY A;  4ZTJ A;  4DFM A;  2IIR A;  5J1E A;  3TPQ A;  4ELU A;  2KZZ A;  3THW B;  2OPP A;  1GLE G;  4FVM A;  4A61 A;  1NGE A;  4FLV A;  3SMP A;  1LOT B;  3QFU A;  2QK9 A;  3OYB A;  5ADX H;  1Q81 O;  4CEB A;  1BU6 O;  4IFV A;  5K14 A;  2GX9 A;  4DU4 A;  4CZF A;  4RWT A;  1D8Y A;  5C10 A;  4YHH K;  3QES A;  2YX6 A;  4X64 K;  4CF2 A;  2G8W A;  2HHH K;  3D6R A;  2FXU A;  1BIZ A;  4E7I A;  3O3F A;  2ZGZ A;  2X6S A;  3CJA A;  4N5S A;  4K42 A;  3DRS A;  3M3Z A;  4FW2 A;  1C1C A;  1O1W A;  2GWJ A;  1IG9 A;  1Z26 A;  4UQG A;  3L4I A;  3QML A;  4DTR A;  5HL7 L;  1XMQ K;  1QQC A;  3DOK A;  4FZX C;  1NK8 A;  2HHQ A;  4JKG A;  1L3U A;  2X6N A;  2ASO A;  3QFP A;  1L5U A;  3O9S A;  3O8M A;  1EX4 A;  2UUB K;  4AHR A;  2GEL A;  5GAH P;  4X66 K;  3RRH A;  3KIO A;  2WTU A;  1QSL A;  4KTQ A;  2ZJQ L;  2NRW A;  3Q7B A;  3M8P A;  3ULE A;  3D2F A;  3WQU A;  4O8U A;  1HRH A;  1VQ7 N;  2Q0R A;  1NGA A;  1K73 O;  1ATN A;  5E84 A;  3QET A;  2A6A A;  3TSQ A;  1U48 A;  4BC4 A;  4EIA A;  3DLK A;  5M1F A;  3VEW A;  3E9O A;  3V81 A;  4FJ7 A;  4B1W B;  4CD1 A;  3CD6 N;  1RFQ A;  5DM6 L;  3EO3 A;  3KKS A;  1XMO K;  1OVQ A;  1M1K O;  3KZB A;  3VTI A;  4CFD A;  3AAQ A;  4DLE A;  3OBY A;  1TKX A;  4H0X B;  5BN8 A;  1N34 K;  4FJL A;  5GAD P;  3L8B A;  4BQL A;  1TK5 A;  4WQ4 A;  4IKF A;  1N8R O;  1WN7 A;  2JWK A;  4KRE A;  1HNW K;  2XHB A;  3WXJ A;  2HOE A;  4DTU A;  4PWD A;  4FJ5 A;  2JLE A;  5M1Q A;  5C25 A;  3V9S A;  3HPH A;  4CEA A;  4JI0 K;  4WCE L;  4JKF A;  2FBT A;  3DRR A;  2P9U A;  4CIF A;  3C6H A;  3TAP A;  3KLI A;  3OHR A;  4E7J A;  3SJJ A;  4BGB A;  1NK9 A;  1WUA A;  3HVT A;  1ATS A;  3TTF A;  4CZG A;  1WSJ A;  1S22 A;  5M1K A;  3LDQ A;  3AO4 A;  3PV8 A;  3FFI A;  3ZSO A;  3I8B A;  4EAH D;  1VQN N;  2P9P B;  2NRH A;  3LZI A;  1ILY A;  3KKR A;  4C1N I;  2O8F A;  3DJC A;  1WB9 A;  2OA8 A;  2HF3 A;  1IKW A;  3HK2 A;  3C7N B;  4CF1 A;  1TAU A;  1OH5 A;  2WUS A;  3BY5 A;  3VF6 A;  3T1A A;  1MA9 B;  3NBP A;  2FC0 A;  3RRG A;  4KHP K;  3SI6 A;  3CQ8 A;  1XUP O;  2RE2 A;  3ZSX A;  3EY1 A;  4I6M A;  4PA1 A;  4OPA A;  1EXQ A;  2KKZ A;  3WXM B;  4U67 L;  3U3G A;  2E6L A;  1U2V B;  2QA4 N;  4FWQ A;  1FXX A;  4FWN A;  5BRH A;  3T7Z A;  5LMN K;  1ATR A;  1C0T A;  1YUW A;  3DLB A;  4CJ5 A;  2HNY A;  3S9H A;  1HNZ K;  4DU1 A;  1GLB G;  2IC3 A;  4GKJ K;  4N76 A;  4WF9 L;  3EL2 A;  3HSC A;  3SQ4 A;  5F1X A;  4B9U A;  4CJF A;  1Q86 O;  1N5Y A;  3CCE N;  4BC5 A;  3LWM A;  3ZEU A;  4DTN A;  5AQQ A;  1VK0 A;  4J2D A;  1JCF A;  4DQR A;  5LJV A;  3DXK A;  2Y1J A;  4LD0 A;  4LFA K;  2RPI A;  2Z1G A;  3ISN C;  4IO8 A;  3A5N C;  4HCB A;  2P9N A;  1NKE A;  1T7P A;  3O3G A;  3PSF A;  4DSK A;  3LP1 A;  2YNG A;  3CPE A;  3P38 A;  4AHS A;  4H8K A;  1NJX A;  1WSG A;  3D45 A;  3RVC A;  4OPH A;  2YCH A;  3K2P A;  1REV A;  1ASU A;  2A3Z A;  1KFD A;  2D5R A;  4KHQ A;  3PLA A;  1V4T A;  2G8K A;  4CJR A;  2A1S A;  3ENB A;  3O9U A;  4JD2 B;  3CME N;  3D7E O;  4DV7 K;  1MDU B;  5JIC A;  1BA0 A;  4M3Z A;  3MN5 A;  4CHY A;  4DSI A;  4FM0 A;  3DLL L;  3CJ1 A;  3M6G A;  4IJN A;  5AQP A;  3J8A A;  3C65 A;  2IDO A;  1Q7Y O;  3NF9 A;  5E26 A;  4E1N A;  3CC2 N;  5I3U A;  1TKT A;  2BAN A;  3EN9 A;  3OJS A;  3UB5 A;  2HBM A;  2ASM A;  3SYZ A;  3NCI A;  4YOX A;  1BHL A;  2V51 B;  4B1Z A;  4FLX A;  3ZLJ A;  1TL1 A;  4EZ9 A;  3CIP A;  4JI7 K;  3IKM A;  4JRP A;  1U49 A;  3QEX A;  3S41 A;  3I33 A;  1XQS C;  2B4J A;  4CK3 A;  5AFU H;  3SAH A;  3VEO A;  3DLH A;  4LSN A;  3RR7 A;  2FF3 B;  4BE0 A;  1CLQ A;  1HYZ A;  1BDG A;  3LZJ A;  3NFA A;  3AAP A;  4MO4 A;  2E1Y A;  5FLX O;  5EU7 A;  4EHU A;  3WXI A;  3LDP A;  4WQ4 C;  2A40 A;  2F9T A;  2UUC K;  2OZM A;  3QIP A;  3AO5 A;  5SWM A;  3OW2 M;  5AZI B;  5CYQ A;  2YNH A;  4B9Q A;  1D5A A;  3FGU A;  4N47 A;  4CJS A;  4HUE A;  3QEW A;  4EZ6 A;  4H4M A;  1NKB A;  1LAW A;  1QS4 A;  2P9K A;  3EKS A;  2YHY A;  3IUC A;  4IG0 A;  1QTM A;  4HVJ A;  3CCS N;  1O13 A;  1WAF A;  5FPM A;  3CMA N;  4DTJ A;  3KHY A;  3KLH A;  4BRG A;  3PIP L;  4F3O A;  4CK2 A;  4M7Y A;  4NXM K;  4M63 C;  3TWH A;  4FLZ A;  5FRM A;  2HST A;  4KV8 A;  5GIN A;  3DXM B;  1ZBU A;  2KLA A;  1ZBS A;  5FRO A;  1SL2 A;  3IG1 A;  1K8K A;  2HW3 A;  2NNW A;  1KVA A;  4IEI A;  4DV5 K;  1HNV A;  3R9P A;  3PIO L;  1RDB A;  2EX3 A;  5JVG L;  5KRS A;  4FM2 A;  2E8A A;  1NJZ A;  4FLU A;  3HOT A;  1BIU A;  1LWC A;  1E3M A;  1NGB A;  2UXD K;  2QWR A;  1NJY A;  3AVM A;  2V7Y A;  1BI4 A;  4JI5 K;  2J4R A;  4IWV A;  5CHI A;  1Y64 A;  4R79 A;  4L8R B;  3NH2 A;  4CGG A;  3H1V X;  4HWI A;  3SMS A;  4FK0 A;  2G8I A;  4KFB A;  2P9L A;  4KHW A;  4B8C A;  4XH1 A;  3QER A;  4DSL A;  4YOR A;  1C1A A;  4GNI A;  1ZC6 A;  3OYM A;  2RF2 A;  3G6E N;  4CF9 A;  3VN5 A;  3HRG A;  4XH4 A;  4NO7 A;  2BGG A;  4Z0U A;  3VEX A;  1YJ9 N;  4F3T A;  4CEO A;  2E6M A;  2RKI A;  4JHD B;  3NF8 A;  3RSE B;  1NJW A;  4OGC A;  2WON A;  4O5B A;  4LFB K;  4FO0 A;  3LPU A;  5EVZ A;  1IV0 A;  3LAL A;  4F4K A;  3C94 A;  4CFA A;  3ZSY A;  3V9Z A;  3KWI A;  2UXC K;  4K0K K;  4DSE A;  3G25 A;  1JL2 A;  1D9F A;  1X1P A;  4PKG A;  1MWM A;  3VGL A;  3VEN A;  4NB4 A;  3VQ5 A;  2O8B B;  4J8F A;  3THV A;  3O5B A;  3VQ4 A;  5A2Q O;  4BY9 C;  1KVB A;  2D0C A;  4HUG A;  5C42 A;  5IWA K;  1QQM A;  4YDU A;  4F2R A;  5AQW A;  4ISG A;  3SUQ A;  5AQX A;  1VQ8 N;  2HVI A;  3V6D A;  4W5N A;  3ITH A;  5H1S Q;  3K57 A;  3J7Y P;  3RMC A;  4FPA A;  3RWU A;  5TKW A;  3THY B;  3P31 A;  1S3X A;  5AJ3 K;  3L3U A;  4Y1D A;  4OPK A;  3CI5 A;  5JS1 A;  2P51 A;  3L2W A;  2ATQ A;  2D0A A;  4BRN A;  4CHN A;  3RMD A;  1UAX A;  1LCU A;  3O6W A;  3BP8 A;  4X62 K;  4DWI A;  2PFU A;  5AZJ A;  3K5N A;  4CZK A;  2KTQ A;  2AP1 A;  1VQ5 N;  3QNO A;  3SQ2 A;  3PSI A;  1SS6 A;  1DTQ A;  1SQK A;  4WFB L;  3U3Y A;  3H3N O;  1Z6R A;  2G8H A;  2OTJ N;  4FJH A;  4CE9 A;  3DLE A;  4B9S A;  3SNN A;  2QWL A;  3BZK A;  2HND A;  4AHT A;  1GLJ O;  1UOC A;  4NLC A;  4BRE A;  4JKA A;  1I3A A;  4C8N A;  1S1U A;  4O5F A;  3KK3 A;  2WFB A;  4PKH A;  2D0P A;  4H03 B;  3ZT0 A;  3SCX A;  3HST B;  4E1J A;  4BAC A;  4YOT A;  1W7A A;  3B6O A;  4JEP A;  2VQF K;  1HMV A;  1RCH A;  1RTH A;  3THX B;  1CZB A;  3UIQ A;  3G71 N;  2XY6 A;  3AVL A;  1WNS A;  2XY7 A;  1TAQ A;  4FJN A;  1X9J A;  4DR5 K;  4OJR A;  4M42 A;  1X9M A;  1NM1 A;  1GLC G;  3AVF A;  1XHX A;  1YAG A;  1HLU A;  4WFN L;  5HP1 A;  2OPR A;  3NVK A;  3E1Y A;  3VMF B;  4WFA L;  4DV4 K;  3WNH A;  4M3W A;  3DRP A;  3MK6 A;  4JKE A;  4ISF A;  4PQU A;  1IKV A;  1GLA G;  1NGD A;  5JVH L;  4IEE A;  2X78 A;  3K5L A;  3VQP A;  3KK1 A;  3ZCM A;  2XY8 A;  3J81 O;  3MX2 A;  4OKE A;  5T7B A;  2I7N A;  2P5G A;  4FOE A;  1OH7 A;  4BRF A;  4AQY K;  3CCR N;  1RBS A;  2IVN A;  5M1P A;  4QS7 A;  4LSL A;  4XEI A;  2OZS A;  1C6V A;  5ELZ A;  3CCM N;  4W5O A;  3P4I A;  4CGH A;  3FZK A;  3LL3 A;  4AF1 A;  1BUP A;  3DMJ A;  2QXF A;  3V1O A;  3KVG A; 
#chains in the Genus database with same CATH homology
 4FW1 A;  4FLW A;  4M3U A;  4M45 A;  4PUO A;  3AVH A;  3VA3 A;  4LH5 A;  3OYF A;  4GVM A;  2OA8 A;  4M3T A;  3LP3 A;  3TAR A;  1IKW A;  3HK2 A;  1JLQ A;  3NGI A;  2VWK A;  4CF1 A;  1TAU A;  4M3Z A;  1EKE A;  4CJT A;  3OVN A;  3LAN A;  3T1A A;  2DTU A;  3BDP A;  4DS4 A;  3NBP A;  2FC0 A;  3RRG A;  1K6Y A;  4NCG A;  3SI6 A;  3QNN A;  4CJP A;  3CQ8 A;  1JLB A;  1RT2 A;  3ZSX A;  3EY1 A;  4CF0 A;  4DTM A;  1VRU A;  4PA1 A;  3LAM A;  1EXQ A;  1W0H A;  1B9F A;  1SKS A;  1QSS A;  4BWM A;  1WSE A;  3AA4 A;  5FDL A;  1TK8 A;  1IH7 A;  4CGD A;  3MED A;  4CEE A;  4DQI A;  1CZ9 A;  3U3G A;  2E6L A;  2KQ2 A;  1S6P A;  1FXX A;  3AVB A;  2XRI A;  4QAG A;  2WOM A;  3AVJ A;  1A5W A;  1JLF A;  3WNE A;  4W5Q A;  1C0T A;  1VSM A;  4DQQ A;  3DLB A;  1RT3 A;  3QO9 A;  3F73 A;  3B6P A;  3PX4 A;  4BDY A;  4AHU A;  1KRP A;  1JXE A;  4CJ5 A;  4RW9 A;  2HNY A;  5HRS A;  3VQB A;  3S9H A;  3DI6 A;  5KGX A;  4DU1 A;  1VSL A;  3KK2 A;  3RMA A;  2IC3 A;  1EET A;  4N76 A;  4CGF A;  4CED A;  1NOY A;  3OJU A;  4MFB A;  4O44 A;  4JS4 A;  1TGO A;  3SQ4 A;  4B9U A;  4CJF A;  1N5Y A;  2G8F A;  3LWM A;  1IKY A;  4DTN A;  4B9L A;  3EZ5 A;  4AHC A;  4OPJ A;  1XI1 A;  1VK0 A;  4JS5 A;  4J2D A;  2ZD1 A;  4FLY A;  4DQR A;  1SUQ A;  2Y1J A;  4LD0 A;  4WE1 A;  3TAE A;  4CJ4 A;  3MXM A;  1YTA A;  2RPI A;  1NK4 A;  2Z1G A;  1TVR A;  3ISN C;  3AA3 A;  1C0M A;  4Y1C A;  3NGY A;  4OGE A;  4M41 A;  2Z1J A;  4HCB A;  3DLR A;  4GW6 A;  1NKE A;  3NE6 A;  3D0P A;  1QE1 A;  1N6Q A;  1T7P A;  4BDZ A;  3SV4 A;  1JXB A;  2HHU A;  2F8T A;  3O3G A;  4DSK A;  4KAZ A;  4IBN A;  2YKM A;  2Q3S A;  3LP1 A;  3VQ8 A;  3C6U A;  1S6Q A;  3AVC A;  2YNG A;  4CK1 A;  3HL8 A;  4Q0B A;  1J54 A;  1BQN A;  1HQU A;  1T03 A;  2F96 A;  4AHS A;  4H8K A;  4NCB A;  1NJX A;  2PY5 A;  4CJK A;  4N41 A;  1ITG A;  1WSG A;  3D45 A;  2ZQB A;  3OYJ A;  4H4O A;  1ZBH A;  1KCF A;  3K2P A;  1REV A;  1ASU A;  4DMN A;  3OY9 A;  4LY7 A;  3PX6 A;  1KFD A;  1WAJ A;  2D5R A;  4O0I A;  4XIU A;  3L2V A;  4KHQ A;  3CM5 A;  3KKR A;  2DFE A;  4CJR A;  2G8K A;  2A1S A;  1GOA A;  3AVN A;  1UA1 A;  4B9V A;  3IAY A;  2ETJ A;  4ICL A;  4FYD A;  5HLF A;  1TV6 A;  2KW4 A;  4E89 A;  1WSH A;  3SUN A;  1SL1 A;  3AVK A;  4CHO A;  3LAK A;  1RT1 A;  1S1X A;  1VRT A;  1B9D A;  1XWL A;  1LV5 A;  4KI6 A;  3ALY A;  5HRP A;  4B08 A;  4E19 A;  3OYI A;  4EP4 A;  2Z1I A;  3AA5 X;  3HPG A;  3T19 A;  3NAE A;  3S3O A;  4I2P A;  3QEV A;  5J2M A;  4CHY A;  4DSI A;  4FJ9 A;  4CCH A;  5D3G A;  1LW0 A;  3BGR A;  3HJF A;  1L3T A;  1CXU A;  4FM0 A;  4CES A;  1TK0 A;  4FJI A;  4KHN A;  5HRR A;  1BGX T;  2HHW A;  1SV5 A;  2NUB A;  1BI4 B;  1NK0 A;  2IDO A;  3NF9 A;  2D0B A;  4E1N A;  5I3U A;  3VQQ A;  3OYD A;  3OYH A;  1NK5 A;  3DOL A;  2KZM A;  4CHZ A;  1TKT A;  2BAN A;  4I9L A;  4JRQ A;  1S1W A;  4CHP A;  2HVH A;  1KSP A;  3QIN A;  3SV3 A;  3MXI A;  4E1M A;  3OJS A;  2KFZ A;  3HP6 A;  4HHT A;  4CFB A;  3MXJ A;  2HHS A;  2JGU A;  4EP5 A;  3SYZ A;  1TKD A;  3NCI A;  1BHL A;  1RDD A;  4FLX A;  4CGJ A;  1DTT A;  1TL1 A;  4BE1 A;  4EZ9 A;  4DFJ A;  2PZS A;  4LH4 A;  1QHT A;  4MQ3 A;  5HBM A;  3CFO A;  4JRP A;  4E7K A;  4W5R A;  4I7F A;  5I42 A;  5CY4 A;  1U49 A;  3TAG A;  3QEX A;  4CJL A;  4DFP A;  1JLC A;  2O4G A;  1T05 A;  3NH0 A;  1Y97 A;  2B4J A;  3PO5 A;  3HO1 A;  2AJQ A;  3M8R A;  4CK3 A;  1SKW A;  3V4I A;  1JLG A;  4O55 A;  3SUP A;  2X74 A;  4FJG A;  1X9W A;  3P83 D;  3DYA A;  4E7H A;  1KFS A;  1S9G A;  1U45 A;  1KTQ A;  1ZYQ A;  1Z25 A;  1HNI A;  3OYC A;  3O4N A;  1LWE A;  4DSF A;  4ID5 A;  4OKK A;  3DLH A;  3P5J A;  1VSH A;  4LSN A;  3RR7 A;  3PY8 A;  2VG5 A;  4BE0 A;  4CF8 A;  1CLQ A;  1HYZ A;  3LZJ A;  3NFA A;  3V9W A;  1RT6 A;  3CG7 A;  1DLO A;  4TSX A;  1ASW A;  1MU2 A;  3TAM A;  5EU7 A;  1C0U A;  2ZE2 A;  3PO4 A;  4M3R A;  2OZM A;  3HPO A;  2QKB A;  3QIP A;  1HYS A;  3AO5 A;  3JYT A;  5SWM A;  1RBR A;  3P1G A;  5CYQ A;  1LW2 A;  3K58 A;  3DM2 A;  2YNH A;  3SQ0 A;  4CHQ A;  3VQ9 A;  1FKP A;  1D5A A;  4N47 A;  4DF8 A;  4Z4G A;  4CJS A;  3AV9 A;  4RW7 A;  4HUE A;  3QEW A;  3PX0 A;  4CGI A;  1SL0 A;  4FK2 A;  4EZ6 A;  3VQA A;  2P1J A;  3VQE A;  2XY5 A;  4H4M A;  5KGW A;  1NKB A;  4J2B A;  1LAW A;  3G10 A;  3K5O A;  1QSY A;  1QS4 A;  4IFY A;  3V1Q A;  3CFP A;  5J2Q A;  4B9T A;  4FJJ A;  4KB1 A;  3OYG A;  3TR8 A;  1NKC A;  1S9E A;  3ASM A;  4IG0 A;  4JLH A;  1QTM A;  4HVJ A;  3LP0 A;  3S3N A;  1B92 A;  1WAF A;  4DTJ A;  4Z4E A;  4RG8 A;  3KLF A;  3KLH A;  3ZSQ A;  4CEF A;  3QIO A;  4Q5V A;  3OS0 A;  4F3O A;  4CK2 A;  4DS5 A;  1JLA A;  3I0S A;  1VSI A;  3AO3 A;  3AVG A;  3KLE A;  4FXD A;  3TWH A;  5CYM A;  4FLZ A;  5FRM A;  4KV8 A;  3AA2 A;  1C1B A;  1ZBU A;  3EYZ A;  5FRO A;  2B6A A;  1XHZ A;  3IG1 A;  1SL2 A;  2HW3 A;  3HM9 A;  2GUI A;  3E01 A;  3VQ6 A;  1KVA A;  4B8A B;  4O0J A;  3LP2 A;  4CEQ A;  3LDS A;  4M3Y A;  4AH9 A;  4DF4 A;  1HNV A;  2YNF A;  3MEG A;  3C95 A;  4DTP A;  3HYF A;  3ZSW A;  4I9Q A;  3ZT3 A;  1RDB A;  2EX3 A;  4DSJ A;  2BE2 A;  5KRS A;  3LWL A;  3RR8 A;  4FM2 A;  5JS2 A;  4IG3 A;  4YNQ A;  3I0R A;  4ZHR A;  3OS1 A;  4FLU A;  5CZ1 A;  1NJZ A;  4K8Z A;  2KFN A;  2OPS A;  4CJV A;  3TI0 A;  4BDP A;  1BIU A;  2Y1I A;  4B9M A;  4ELT A;  4CFC A;  1LWF A;  3KJV A;  1LWC A;  4HTU A;  1VSF A;  4CJU A;  1EP4 A;  1WSI A;  1NJY A;  1Q9X A;  4C8K A;  2IS3 A;  3AVM A;  4Z4C A;  1D9D A;  1BI4 A;  3CFR A;  4KI4 A;  3V9X A;  3K59 A;  3WNF A;  3KD1 E;  4HCC A;  3MEE A;  4CEC A;  3SPZ A;  3MAQ A;  3CM6 A;  1KVC A;  5FRN A;  2HHV A;  3K5M A;  4L8R B;  4FJK A;  1ZBF A;  3ZSR A;  4CJ3 A;  4CGG A;  3NH2 A;  1XC9 A;  4M3X A;  4FK0 A;  1VSD A;  1A5X A;  2G8I A;  4KHU A;  4FJ8 A;  4KFB A;  3QEP A;  1X9S A;  4KHW A;  4B8C A;  2YHB A;  4Z4I A;  3QER A;  1RDC A;  4DSL A;  1C1A A;  1CXQ A;  3I8D A;  1TL3 A;  1UWB A;  1A5V A;  2RF2 A;  1WSF A;  1RDA A;  4CJE A;  4CF9 A;  3OYM A;  3V9U A;  4C8L A;  3VN5 A;  4Z4F A;  3HXM A;  2OPQ A;  4KO0 A;  2DY4 A;  1J53 A;  2FBX A;  2YKN A;  1RIL A;  1RT7 A;  2QKK A;  2FBV A;  2BGG A;  1VSE A;  1ZBL A;  1HJR A;  1YT3 A;  4Z0U A;  4R5P A;  4CEO A;  3OYK A;  3HVR A;  4F3T A;  1BIS A;  5KTQ A;  2E6M A;  2RKI A;  4DG1 A;  2ITG A;  4E7L A;  1KLN A;  1GOC A;  3NF8 A;  5CZ2 A;  5DMR A;  4CIG A;  2WON A;  2Z1H A;  4O5B A;  4OGC A;  2YHA A;  4KKO A;  1NJW A;  3VQ7 A;  3SQ1 A;  3LPU A;  3H08 A;  3S3M A;  3KTQ A;  2OYQ A;  1RTD A;  1JLE A;  4RW6 A;  1WLJ A;  3LAL A;  3T3F A;  3OS2 A;  4DLG A;  3TAB A;  2GV9 A;  4OKJ A;  4F4K A;  4OLA A;  1YVU A;  3C94 A;  4CFA A;  3ZSY A;  3AO1 A;  5E41 A;  3V9Z A;  3SPY A;  3TAN A;  4DSE A;  3ULD A;  5J2N A;  2LSN A;  1JL2 A;  1D9F A;  1X1P A;  3VQC A;  4KPY A;  1FKO A;  3VQ5 A;  4FCY A;  3RMB A;  3M8Q A;  4W5T A;  1VSJ A;  3QLH A;  4BWJ A;  3JSM A;  3THV A;  3VQ4 A;  5J2P A;  4KTW A;  1I39 A;  2W42 A;  4DTO A;  5HRN A;  3NDK A;  1RBV A;  3VQD A;  1KVB A;  3MEC A;  3OYA A;  4F2S A;  4KTZ A;  3WNG A;  4DTS A;  3F9K A;  1BCM A;  2D0C A;  4HUG A;  5C42 A;  4ZTJ A;  3NH1 A;  3RTV A;  4DFM A;  1NK6 A;  1U4B A;  5J1E A;  4F2R A;  1VSK A;  1GOB A;  3SUQ A;  4ELU A;  4C8O A;  2KZZ A;  4AHV A;  2HVI A;  4FZY A;  2OPP A;  4FVM A;  2VG7 A;  5C24 A;  1JL1 A;  3IRX A;  4N56 A;  3ITH A;  3V6D A;  4W5N A;  3K57 A;  4FLV A;  3RMC A;  1F21 A;  1RTI A;  4IDK A;  3RWU A;  4DTX A;  2QK9 A;  3OYB A;  2O4I A;  4CEB A;  2HHX A;  2IGI A;  4J2A A;  4IFV A;  1RT5 A;  5K14 A;  3NGZ A;  4I2Q A;  3SZ2 A;  3L3U A;  4Y1D A;  4OPK A;  4DU4 A;  1D8Y A;  2R7Y A;  3IS9 A;  2E4L A;  5JS1 A;  1Q8I A;  2P51 A;  1RBU A;  1TKZ A;  3L2W A;  2ATQ A;  2D0A A;  3CYM A;  2HHT A;  1KLM A;  4BE2 A;  3DLG A;  3QES A;  2BDP A;  1HYV A;  4F8R A;  4CHN A;  3RMD A;  2PYL A;  5SZT A;  1UAX A;  2DFH A;  2B5J A;  2G8W A;  4OVL A;  5KI6 A;  4DWI A;  3K5N A;  1HQE A;  3O3H A;  2KTQ A;  3OYE A;  3ZT4 A;  3QNO A;  3SQ2 A;  3NF7 A;  1U04 A;  1DTQ A;  4DU3 A;  1BIZ A;  4E7I A;  3U3Y A;  3O3F A;  4CJQ A;  4CER A;  4GMJ B;  2GBZ A;  2G8H A;  2X6S A;  4N5S A;  1IO2 A;  4FJH A;  2YV0 X;  4CE9 A;  3DLE A;  3DRS A;  4B9S A;  3AVI A;  2FBY A;  1C1C A;  1O1W A;  4FW2 A;  4HUF A;  3SNN A;  1IG9 A;  1Z26 A;  4Z4H A;  4UQG A;  2HMI A;  2HND A;  1RBT A;  4AHT A;  4DTR A;  1QQC A;  1W9H A;  3DOK A;  4CEZ A;  1UOC A;  3AVA A;  1NK8 A;  4FZX C;  2HHQ A;  3L2Q A;  2EHG A;  1I3A A;  1L3U A;  2X6N A;  4C8N A;  1UA0 A;  1S1U A;  4KHS A;  3KLG A;  1L5U A;  4FM1 A;  3KK3 A;  1EX4 A;  1FK9 A;  4AHR A;  3ZT0 A;  3SCX A;  4CIE A;  2P5O A;  3HST B;  3RRH A;  2PYJ A;  3OYL A;  2IOC A;  4BAC A;  1L3V A;  3KIO A;  1RT4 A;  4FJX A;  1QSL A;  3ZT2 A;  4FK4 A;  3B6O A;  3L3V A;  1NOZ A;  3ZT1 A;  3LPT A;  1HMV A;  3NHG A;  3A2F A;  2XO7 A;  1RCH A;  4B9N A;  1RTH A;  2VG6 A;  4YFU A;  1T8E A;  1SKR A;  1Q9Y A;  4J2E A;  1CZB A;  4DFK A;  4KRF A;  3M8P A;  3UIQ A;  3ZSV A;  2F8S A;  3TAQ A;  2XY6 A;  3L2U A;  3AVL A;  2RN2 A;  1WNS A;  2HNZ A;  2XY7 A;  1TAQ A;  4FJN A;  3U6F A;  1HRH A;  4C8M A;  1L3S A;  1YTU A;  4KTQ A;  4OJR A;  4M42 A;  4KB0 A;  2A1R A;  1X9M A;  3AVF A;  3QET A;  4CJW A;  3QEI A;  1XHX A;  1U47 A;  1G15 A;  1IKX A;  1BCO A;  1U48 A;  5KRT A;  5HP1 A;  1LAV A;  2OPR A;  3DLK A;  4FJM A;  3AO2 A;  3WNH A;  3V81 A;  1RNH A;  4FJ7 A;  4M3W A;  4K8X A;  4RW4 A;  3HT3 A;  3KKS A;  3DRP A;  1NK7 A;  1RTJ A;  4QOZ B;  4RW8 A;  4PQU A;  4DQS A;  1IKV A;  4CFD A;  4FLT A;  4DLE A;  4FJL A;  1TKX A;  4NYF A;  2X78 A;  3OYN A;  2DFF A;  3L8B A;  3K5L A;  1TK5 A;  4B3O A;  4IKF A;  3VQP A;  4NCA A;  1WN7 A;  3ZCM A;  3KK1 A;  3L2R A;  2XY8 A;  4KRE A;  5DK5 A;  2XHB A;  4OKE A;  1BQM A;  4DTU A;  4PWD A;  4FJ5 A;  3TAF A;  4OLB A;  2JLE A;  5T7B A;  5C25 A;  3V9S A;  3V1R A;  2P5G A;  3HPH A;  4CEA A;  4ELV A;  1J9A A;  3SUO A;  5HRO A;  3VA0 A;  3O4Q A;  4ZTF A;  1ZBI A;  2I5J A;  1JKH A;  3PUF A;  2FBT A;  3DRR A;  1RBS A;  4CIF A;  4ID1 A;  1BL3 A;  1S1T A;  4AIL C;  3TAP A;  4LSL A;  3KD5 E;  2OZS A;  4KHY A;  1C6V A;  4FZZ A;  2YNI A;  4O4G A;  3KLI A;  3NF6 A;  3G0Z A;  1S5J A;  2VWJ A;  4E7J A;  3SJJ A;  4W5O A;  2IAJ A;  1R0A A;  3C6T A;  4G1Q A;  1NK9 A;  3M8S A;  1HPZ A;  4CGH A;  3HVT A;  1J5O A;  4PY5 A;  1WSJ A;  1S1V A;  1ASV A;  4NYN A;  4QCL A;  4E3S A;  2G8V A;  3AO4 A;  3PV8 A;  3FFI A;  3ZSO A;  4DQP A;  2HB5 A;  3DMJ A;  3LZI A;  2QXF A;  4E0D A;  3ZSZ A;  3V1O A;  4CF2 A;  3HP9 A;  2G8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...