1C6VA

Siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
148
Chain Sequence
NSDLGTWQMDCTHLEGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSVETIVLMAVHCMNHKRRGGIGDMTPAERLINMITTEQEIQFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of simian immunodeficiency virus integrase containing the core and C-terminal domain (residues 50-293)--an initial glance of the viral DNA binding platform.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Dna binding protein
molecule keywords PROTEIN (SIV INTEGRASE)
total genus 42
structure length 148
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c6vA00
2NUBA 1HPZA 5JS2A 4ZHRA 3HK2A 2KZMA 4CJWA 5KRTA 1DTTA 3NCIA 3B6OA 3IRXA 2PYLA 4IFVA 3G10A 3M8SA 2HHWA 4J2BA 2XO7A 1D9DA 4CIFA 3ZT2A 4CHOA 4FJXA 1C0UA 1WAJA 3QEPA 1X9WA 1YTUA 4F4KA 4E1NA 1S9EA 1K6YA 2OPPA 4BE1A 1BIZA 3VQBA 3ZSRA 2XHBA 3QEXA 2IAJA 3AO2A 2HW3A 3HO1A 3L8BA 4B9LA 3CYMA 1Z26A 4NCBA 1HJRA 1U49A 5KTQA 1S6QA 1YTAA 2IGIA 3ZSVA 1L5UA 4FJLA 3MXJA 2F8SA 4RW8A 4DTPA 1LWEA 3AO3A 3L3UA 2P1JA 4W5RA 1TKDA 4E7KA 3RRHA 4H4OA 5KRSA 5HRNA 4NYFA 3NDKA 1SL2A 4KTZA 1LAWA 2F96A 1KVAA 2Z1JA 4CE9A 3RTVA 3KLHA 5CYMA 3H08A 5EU7A 2ITGA 4E7HA 1TVRA 3V81A 3JYTA 2Z1GA 1ZBUA 4FK0A 4PY5A 1RT1A 1VSFA 1KLMA 2VG7A 3F9KA 1NOYA 4FJHA 3QESA 2ZQBA 1NKEA 1C6VA 4OVLA 5KGWA 1RTDA 3LP2A 3KK1A 2Y1IA 3AV9A 3RWUA 1UOCA 3CFOA 4FM0A 4CJEA 3LP0A 3WNFA 4E7IA 3S3OA 2HMIA 3S3MA 4HUEA 1ITGA 3E01A 3RMAA 3EZ5A 3T3FA 1VRTA 1GOAA 4DQQA 4E3SA 1S5JA 1WSEA 1ZBFA 3AVAA 3MEGA 3TWHA 2KQ2A 1BIUA 3NF6A 4CJLA 4CJSA 4XIUA 4W5TA 3RR8A 4KFBA 4LSLA 4FJNA 3P5JA 3KLIA 3VQAA 4C8KA 3NH2A 4HUFA 4KB0A 2X6NA 1BHLA 3C6UA 3KK2A 2HVIA 4C8NA 1UA1A 3AVFA 3QIOA 2KZZA 1KSPA 1C0TA 4JS4A 4EP5A 3O4NA 4FZXC 4PUOA 3OY9A 4CJQA 4J2EA 4M3YA 4CIEA 3KKRA 3ZSZA 3NE6A 4DSFA 3SPZA 2D0BA 4OLAA 1RBTA 2D0CA 3CQ8A 1TL1A 4DTOA 1NKCA 4CJ3A 3IAYA 5D3GA 1EKEA 1RDCA 1J5OA 1A5XA 2RN2A 3AVLA 1VSMA 2XRIA 4QAGA 4LH4A 3I0RA 3LZJA 5HROA 3RRGA 3MXIA 2VWJA 3OJUA 4DU1A 3DM2A 4KRFA 5SWMA 3I8DA 3PY8A 3U6FA 2OPSA 4KHUA 1A5VA 1BI4A 4CJTA 1EP4A 4CFCA 4DFPA 4G1QA 3TR8A 2DTUA 2HNZA 2AJQA 4DFJA 4CGHA 1JLAA 4Q5VA 4CFDA 1RDDA 3K5LA 4RW6A 4CCHA 1VSLA 1GOBA 3ZSYA 3AVBA 4DFKA 3SCXA 2ATQA 2ZD1A 3ZSXA 3OYHA 4BE2A 1EX4A 4Z4FA 4Z4EA 3EYZA 3AVMA 4RG8A 4CHYA 3VA0A 3DRRA 3TAQA 1IKXA 3IS9A 1T05A 3K59A 2OA8A 4Z0UA 4OPJA 3DOKA 1R0AA 1IKYA 3M8PA 4KV8A 3WNEA 1J53A 2ETJA 4KTQA 1BL3A 3KTQA 3CFRA 3UIQA 4NYNA 4Z4HA 3DRPA 3AA3A 3AVJA 3L2UA 1NK6A 4FJ5A 3CG7A 3HP9A 3QERA 4EZ9A 1S1UA 4CJUA 4FK2A 2JGUA 5E41A 2PZSA 4O4GA 1I39A 2OYQA 4NCGA 4CF2A 4CJRA 4DTXA 2F8TA 1VSJA 1WN7A 2XY5A 4O5BA 1FK9A 4OJRA 2DY4A 1JXEA 1KVCA 4JRPA 1L3SA 1JL1A 3LP1A 2DFEA 1J9AA 1S1VA 3NF8A 4FW2A 4CJFA 3OYLA 3OS2A 2LSNA 1W9HA 1IO2A 3TAFA 4CJVA 3KJVA 1D5AA 3U3YA 4BACA 1RDBA 4DSJA 2QXFA 5KI6A 2HHUA 4JS5A 4J2DA 3ZSOA 4CESA 4IG0A 2KFZA 3LANA 3VQ9A 4CHQA 3SQ4A 4FLWA 1D8YA 1SUQA 3VQPA 4FK4A 1UA0A 4IDKA 4DTNA 4BWMA 4DTUA 4E0DA 2YV0X 3PX6A 2D5RA 4KB1A 1HNVA 4OGCA 1JLGA 1TKTA 3SNNA 4DU3A 3L2WA 5CY4A 4FM2A 3TANA 3QINA 1TKZA 1T03A 2RF2A 1L3VA 3VQ7A 4E19A 3M8QA 4LY7A 3B6PA 3OVNA 2YNIA 1MU2A 1S1WA 3QIPA 1S1XA 2G8HA 3KKSA 4QOZB 3PO5A 3CFPA 4FJ9A 4QCLA 4E7JA 3QEWA 1JLBA 1TGOA 3NH1A 2W42A 1QTMA 2IC3A 4DG1A 4TSXA 2Y1JA 3THVA 4H8KA 3CM5A 2OZMA 4DQIA 4M3ZA 1CZBA 2GBZA 3KLEA 1RNHA 3BGRA 3PUFA 3VQ4A 3VQDA 1HQEA 3PO4A 4KI6A 3MAQA 3HJFA 2B6AA 4KO0A 4N47A 3U3GA 4HVJA 1BQNA 3KLGA 3D0PA 1C0MA 3LZIA 4BE0A 4ZTJA 1XHZA 3O4QA 4NCAA 4HHTA 1RBSA 1VRUA 4DLGA 3V4IA 1VSEA 2PY5A 3L3VA 2HHXA 1RT5A 1TL3A 4CECA 1RT3A 3DLEA 4O44A 3DLKA 4HUGA 3SUOA 1TK5A 3V9ZA 3V1OA 3HXMA 3SZ2A 4I2QA 1JKHA 4E1MA 1KFSA 4B9TA 3OYIA 1LV5A 3OYGA 4DMNA 3V1RA 1KFDA 3MECA 4OPKA 1L3UA 4C8LA 2DFHA 1ZYQA 1D9FA 3AA4A 2HNDA 4FLYA 1CLQA 1JLQA 1ASWA 1IH7A 1ZBHA 1F21A 1BCOA 3V9UA 5I3UA 3OYBA 1VSHA 4M3WA 3AVCA 4RW7A 4JRQA 1FKOA 4CEBA 3DMJA 4CEFA 5FDLA 4DSLA 2HB5A 1S1TA 3VN5A 3V6DA 3PX4A 3PV8A 4F3TA 3C95A 3TARA 2HHQA 2GV9A 1C1BA 4O0JA 4IKFA 3VQ6A 2FBTA 1ASVA 4ELTA 5HRSA 1I3AA 2XY8A 1WSGA 1REVA 1WAFA 2B5JA 2JLEA 1BISA 4CK2A 4PWDA 4CGGA 1NK0A 4FJIA 3HPHA 3QETA 4E89A 3V9XA 1T8EA 1TKXA 3LAMA 4CJPA 3K57A 4DQSA 4CGJA 2A1RA 5DMRA 2YNHA 1CZ9A 4F2SA 4C8MA 2EX3A 4I2PA 3ASMA 4B9SA 3L2QA 2EHGA 3SI6A 2HHSA 3HVTA 2KFNA 5HLFA 3TAPA 1QSLA 1LW0A 1CXQA 4FZZA 1U04A 1KLNA 4I9QA 2OPQA 4FLTA 4CK3A 1WSHA 3O3GA 1JLFA 3TAGA 4KHYA 4PQUA 3RMCA 3I0SA 1RDAA 4CEQA 5HRPA 4FJ7A 1TV6A 1RBUA 2YNFA 3AO4A 3AVGA 2G8IA 1B92A 4M3XA 4KKOA 3OYCA 1KVBA 4LSNA 4Z4GA 1XC9A 3K5MA 3MEEA 3F73A 3RR7A 3ZSWA 1SKWA 4ELVA 4O0IA 4J2AA 1W0HA 4M42A 4CHNA 5FRMA 3NGIA 3G0ZA 3SJJA 3VQ5A 1GOCA 1WSIA 4B3OA 3AO1A 4DTMA 4OLBA 2G8VA 2Q3SA 2KTQA 4DF4A 1L3TA 3NGYA 4WE1A 4LD0A 2G8UA 1NJZA 3ALYA 4CFAA 4FCYA 2G8FA 2VG6A 2Z1IA 2VG5A 3ISNC 3OYEA 4RW9A 3K5NA 1Q9XA 2R7YA 3KD1E 4F3OA 3NHGA 1TAQA 1DLOA 2YHAA 2BANA 1RTJA 4IBNA 2PYJA 4LH5A 5I42A 2QKBA 1FKPA 4Z4IA 1TK8A 3QLHA 4EZ6A 1BQMA 1ASUA 3LAKA 2B4JA 1T7PA 4K8XA 4DQPA 4GMJB 2A1SA 4AHVA 3QNOA 3AA2A 2E4LA 4CERA 2KW4A 4YFUA 4AHSA 4YNQA 4CGDA 2FBYA 3FFIA 5DK5A 1HRHA 4AILC 4H4MA 1KTQA 4KHSA 3NBPA 1XI1A 2P51A 3SV3A 2VWKA 3OYDA 4B9VA 1RT6A 3T1AA 3TAMA 4CIGA 3HT3A 2FC0A 4MFBA 3PX0A 1NK5A 3HSTB 3WNHA 3TABA 4M3UA 3OYKA 3WNGA 4DTSA 3OS0A 2OZSA 2O4IA 1UWBA 1S6PA 3L2VA 1WSJA 2BDPA 4DS5A 5J2PA 3SV4A 2RKIA 4OKEA 3MXMA 4DU4A 5KGXA 4K8ZA 2WOMA 3S9HA 3K58A 4CJKA 1HNIA 3EY1A 2HHTA 4B9NA 2WONA 4HTUA 3C94A 4N41A 3NF7A 1O1WA 3NH0A 1VSDA 3ZSQA 4KAZA 3HVRA 2X74A 3AVHA 1NJYA 2X6SA 3VQQA 3OYAA 4W5QA 1Q8IA 3LWLA 5CZ2A 4UQGA 3JSMA 1RTHA 1QE1A 3ULDA 3ZT4A 4DS4A 1ZBLA 2BGGA 4Q0BA 3TI0A 4CHPA 4KPYA 4KHQA 3P83D 5J2MA 1HYVA 2XY7A 1VSIA 4FLVA 4AHRA 4CGFA 4B9UA 4FJGA 1HYSA 4M41A 4ID5A 4CJ5A 1U4BA 1SV5A 4ID1A 3SUQA 4F8RA 3DYAA 4HCCA 4FLUA 1B9FA 1TK0A 2P5GA 2HVHA 3BDPA 5FROA 3A2FA 1U48A 1NK9A 4AHUA 4B8AB 2FBVA 1UAXA 1EETA 3HPGA 1QQCA 1N5YA 4OGEA 4CF8A 1SL1A 2G8KA 4CF1A 4MQ3A 3OYNA 3KLFA 2ZE2A 2E6LA 1SL0A 2P5OA 1C1AA 3HYFA 3LPTA 1KRPA 1EXQA 4FYDA 1RILA 4PA1A 3VQEA 2Z1HA 4CFBA 3K5OA 5C42A 1BCMA 1RBVA 4JLHA 3TAEA 1RT7A 2E6MA 3C6TA 3ZCMA 4CEEA 4ZTFA 3NFAA 4DF8A 2I5JA 4N76A 1FXXA 4Z4CA 4M3RA 2YNGA 1QSSA 1JLEA 3V9SA 4CHZA 1RTIA 1Z25A 4CEOA 3M8RA 1JLCA 1LWFA 4AH9A 1X9MA 1IKWA 2QKKA 4FW1A 2YKMA 1NJWA 3VQCA 4FJMA 2OPRA 1VK0A 2QK9A 3K2PA 5HP1A 4BDZA 1HMVA 3ITHA 1LAVA 3QEIA 4ICLA 3AVIA 3VA3A 1WSFA 1XWLA 5T7BA 3LWMA 2BE2A 4FJKA 3NF9A 2HHVA 3DOLA 4DFMA 3OYFA 3P1GA 1BGXT 1YT3A 3HL8A 1A5WA 3V1QA 1LWCA 3AA5X 3DLRA 5FRNA 1IG9A 4DQRA 4CGIA 3AVNA 3LALA 4FVMA 4Y1DA 3VQ8A 3RMBA 4AHTA 4OKJA 3V9WA 1X9SA 3DLGA 4FZYA 4N5SA 3SUNA 1Q9YA 4I7FA 4KHWA 1WNSA 4EP4A 1NKBA 4DTRA 3QO9A 4FLXA 1DTQA 1CXUA 4R5PA 3HPOA 1SKSA 2D0AA 4OKKA 1VSKA 3QEVA 5HBMA 3SQ2A 3SYZA 1NJXA 4B08A 3SQ0A 5C24A 4CF0A 4DWIA 1NK4A 4AHCA 1J54A 1RBRA 4GVMA 2IDOA 4BDYA 1RT2A 3S3NA 5J2NA 1U45A 4B9MA 2HNYA 1B9DA 2YHBA 4GW6A 1HYZA 4M3TA 5HRRA 1N6QA 1IKVA 3O3HA 1RT4A 5CYQA 4KREA 4HCBA 1NOZA 2GUIA 3L2RA 3QNNA 1NK7A 4DSIA 4RW4A 4CEDA 3DI6A 4KI4A 2FBXA 1JXBA 4E7LA 1SKRA 3O3FA 2IOCA 3SUPA 4KHNA 3MEDA 2RPIA 4CEAA 3NGZA 1QS4A 3DLBA 1WLJA 4Y1CA 3OS1A 4N56A 4DSEA 4FLZA 5J1EA 3OYMA 1LW2A 1YVUA 3ZT1A 4FJJA 5JS1A 2XY6A 1JL2A 4W5NA 1HQUA 3AVKA 2IS3A 3ZT3A 3OJSA 4F2RA 1Y97A 3KIOA 1X1PA 3SPYA 1S9GA 3KK3A 2G8WA 3LP3A 4CEZA 5C25A 2DFFA 4DSKA 4CF9A 3D45A 4CJ4A 1KCFA 5SZTA 2X78A 4IFYA 4FM1A 4FXDA 3CM6A 5K14A 3DRSA 4FJ8A 1U47A 4KTWA 4O55A 4DTJA 1RCHA 4C8OA 2YKNA 1QHTA 1NK8A 3LPUA 1C1CA 4I9LA 4ELUA 4B8CA 1BI4B 3NAEA 1QSYA 4M45A 1ZBIA 1TAUA 1G15A 3OYJA 1XHXA 4BDPA 3DLHA 4L8RB 4BWJA 4CK1A 2O4GA 5CZ1A 3HM9A 5J2QA 3LDSA 3SQ1A 4DLEA 3HP6A 3ZT0A 3IG1A 3T19A 4IG3A 4W5OA 3KD5E 3AO5A 3RMDA
chains in the Genus database with same CATH superfamily
4ZHRA 2KZMA 3NMUA 1DTTA 3NCIA 3B6OA 3IRXA 2PYLA 4IOAL 2XO7A 4CIFA 3ZT2A 3QEPA 3CCRN 1X9WA 4F4KA 2OPPA 3TSPA 1BIZA 5JICA 2AA4A 2IAJA 3AO2A 1IBKK 2A41A 5GIPA 3THXB 4NCBA 2VCPA 1S6QA 1YTAA 4FJLA 1W2BM 3MXJA 2D4WA 5BR8K 4H4OA 2ITMA 1JCGA 5HRNA 3U9DA 3O5BA 2VQEK 2ITGA 4HWIA 4FWOA 4BROA 3WXKA 4XH1A 3JYTA 3LDNA 2Q2RA 1R59O 1VSFA 4FPBA 4FJHA 3QESA 2NNWA 1C6VA 3ULEB 5DM7L 1VQ6N 4BR5A 2WUSA 3S3OA 3MCPA 3E01A 4MDAA 5M1NA 4LFAK 4H5NA 3AVAA 1KXPA 3TWHA 2KQ2A 4XIUA 4KH6A 1M90O 5AZJA 3RR8A 4LSLA 4FJNA 4KB0A 2V7ZA 3KLIA 3NH2A 3D2EA 1NGHA 2X6NA 5GIOA 2VYPA 3KK2A 5AQZA 4F9OA 3QIOA 1KSPA 1YIJN 3OY9A 4CIEA 3KKRA 1V4TA 3CQ8A 3L4IA 3LDOA 3U4LA 4Z94A 3D6RA 4LH4A 3HZ6A 2VWJA 1KAZA 5SWMA 3I8DA 3IFRA 1N33K 4DFPA 1EP4A 4CFCA 4G1QA 2BH1A 3CCVN 4CGHA 4RW6A 4CCHA 3THXA 3ZSYA 4JI8K 3AVBA 3SCXA 4JD2A 3F5TA 2NRRA 1SS6A 3DXKA 4H0YB 3DXKB 3I55N 4Z4EA 2O8EA 4OX9K 3G25A 3EEQA 5GAHP 4PKGA 4H03B 3TAQA 3IS9A 1T05A 3K59A 1WOQA 2ZGZA 4OPJA 1S22A 3VESA 1BL3A 3UIQA 4JYAK 3FZHA 4EZ9A 3QERA 1MDUB 5E41A 2I7PA 2OTLN 2OYQA 2F8TA 4DTXA 3THYA 4JKDA 1KVCA 4U67L 1X9JA 5EY4A 5BN9A 5CR4A 3TAFA 1IO2A 3HOTA 3U3YA 4BACA 3HM8A 4CHQA 4FK4A 3VTIA 4FLWA 3VQPA 4IDKA 2HOEA 4DTNA 2QW9A 2YV0X 3VF6A 3CJCA 3RSEA 4OGCA 1JLGA 4A2BA 1G99A 3FE1A 5BRDA 1JCFA 3WXLA 2W41A 1L3VA 3VF4A 4LY7A 2YNIA 1S1XA 3KKSA 2GWKA 1JLBA 5BPMA 4H0PA 4XH5A 1QTMA 2YCHA 4CZHA 4H8KA 3H1QA 1CZBA 2NRXA 2AP1A 3BGRA 4KI6A 3Q7CA 3MAQA 3HJFA 3U3GA 1XHZA 4BE0A 2PAVA 2D0OA 1RBSA 3TTFA 1VRUA 2PY5A 2HHXA 4B3SK 4FWMA 3DLEA 4HUGA 1TK5A 3WT0A 1JKHA 2W40A 1VAZA 1LV5A 3OYGA 1KFDA 3MECA 1FJGK 3CXCM 4LF4K 1ASWA 1VSHA 2ZJQL 2GX9A 2YHXA 2YHYA 4FL9A 4JAXA 3PV8A 2WBNA 3C95A 4DV3K 2ASMA 2GV9A 1ESVA 2HHQA 4O0JA 5AQPA 4IKFA 3ZEUB 1S72N 1NK0A 2HHHK 4E89A 5BPNA 3K57A 4JK7A 4CGJA 5AQFA 5DMRA 2YNHA 3T1YK 1NGGA 1CZ9A 4C8MA 2EX3A 4DV2K 2KHOA 3L2QA 2HHSA 4DUZK 4FZZA 1U04A 3HI0A 4CK3A 5MLCQ 4KHYA 3RMCA 2W6KA 4CBWA 1JJ2M 4RWTA 1RBUA 2ZJRL 1NLVA 2O8CA 1BDGA 3R6MA 2O8BA 4C23A 5E84A 3K5MA 3ZX2A 1O13A 4J2AA 4M42A 2O8DA 1GLBG 4DTMA 2Q3SA 5LJVA 4BREA 3GOIA 2G8FA 3GBTA 3ISNC 1Q7YO 3E9LA 4FPAA 1GLAG 1YF5L 3NHGA 3J8AA 1DLOA 2YHAA 4JD2B 5I42A 1FKPA 1RDWX 2NRHA 1TK8A 1HNWK 2B4JA 3J7ZO 4DQPA 1E3MA 4GMJB 2A1SA 1BG3A 4AHVA 3OHRA 4PL8A 3ZEUA 4CERA 4AHSA 3SV3A 2VWKA 3NVKA 3PX0A 2HVIA 2FC0A 4O8KA 3WNHA 2O4IA 3O4WA 5TKYA 5J2PA 2Q36A 3NVMA 4OKEA 3JAMO 3MXMA 3P38A 2JWKA 3CJBA 4MDBA 3K58A 2HHTA 2CGKA 4HTUA 4QS7A 3NH0A 4ISEA 4J8FA 3HVRA 2X74A 1Q8IA 3JSMA 1RTHA 3LM9A 4JI2K 4KHQA 1HYVA 2VGMA 4YDUA 4FOEA 1OH7A 5JVGL 2VQFK 4MO4A 4K43A 2UUBK 4B9UA 4H0TB 5FLXO 5AQHA 1HYSA 1SV5A 4ID1A 4BQLA 4F8RA 3DYAA 4HCCA 4FLUA 5FPEA 1SZ2A 1NMDA 3VEXA 1Z05A 1MA9B 4AHUA 2FBVA 1UAXA 1EETA 4CF8A 3VEZA 2G8KA 3LPTA 1KRPA 4JHDA 3VQEA 4CFBA 5C42A 1BCMA 1RBVA 4JLHA 1RT7A 1K8KB 2VWBA 4CEEA 3K0SA 2I5JA 4AF1A 4GV9A 3IMXA 1JLEA 5FPDA 4CHZA 1Z25A 2P9SA 4CEOA 1LWFA 1X9MA 2QKKA 4BRQA 3CCUN 1VK0A 1YUWA 1GLEG 3QEIA 1NG9A 5LL6Z 5GINA 3NF9A 5DM6L 5HL7L 3P1GA 1YT3A 3HL8A 3V1QA 4DQRA 2UYTA 3VQ8A 4AHTA 1X9SA 4FZYA 3SUNA 4I7FA 4KHWA 1WNSA 1VQ9N 2D1KA 1CXUA 3CJ9A 3QEVA 3BP8A 4BG9A 3SQ0A 4FJMA 1QVFM 2Q1NA 1J54A 4AHCA 4B9MA 5HRRA 3J7YP 1N6QA 3CJAA 4KREA 1NOZA 1Z6RA 3L2RA 5LMUK 3KWGA 4KI4A 3EE8A 1JXBA 1OKJA 4E7LA 1QS4A 3DLBA 2UXDK 5JS1A 2QM1A 4U7BA 5F0XA 3OJSA 2IS3A 4H0OA 4F2RA 1NGAA 3KK3A 1KD1O 2G8WA 4H5RA 3CQXA 4CJ4A 3R3LA 4IFYA 4DR1K 4FO0A 4FM1A 1BA0A 1T6DA 2V7YA 4BR9A 3DRSA 4FJ8A 4B1ZA 4O55A 2ZF5O 1QHTA 4K0KK 1H1VA 1Q86O 4B8CA 4LF8K 3OYJA 5J2QA 3HM9A 4DLEA 1D4XA 4IEEA 3ZT0A 1U2VA 3KD5E 4IG3A 3SBGA 3O6WA 4A57A 3R1XA 3RMDA 5JS2A 4BRNA 3O1WA 5M1QA 3G10A 3M8SA 2E1YA 1VQ7N 2HHWA 1D9DA 2KLAA 3I8BA 3VF2A 3CCMN 1YTUA 3O08A 3ENBA 2E1ZA 4OPAA 1S9EA 3VQBA 3ZSRA 3QEXA 4CD1A 4B9LA 4JV5K 3ZSVA 2IGIA 1L5UA 4BY9C 5EX5A 5AQKA 3MX2A 4BC2A 1LWEA 3AO3A 1ATSA 5KRSA 4YOXA 5JMVA 1W7AA 4NYFA 2ZWHA 3NDKA 1LAWA 2F96A 1KVAA 2Z1JA 3RTVA 2V52B 5CYMA 3H08A 1GLLO 4E7HA 2Z1GA 3IUCA 4BRLA 3U8XA 1RT1A 3IDHA 4WF9L 3CCEN 5AQXA 2ZQBA 3LP2A 3I56N 1UOCA 3CFOA 4FM0A 4CZKA 2HMIA 4A62A 1GLJO 5M1OA 3EZ5A 1VRTA 1GOAA 4DQQA 4DR7K 3LL3A 1S5JA 1WSEA 4CJSA 1BIUA 3EN9A 2UXBK 1CZAN 4KFBA 3VQAA 4HUFA 1NGIA 4GNIA 3QFUA 3AVFA 1QQMA 4IFEA 3O4NA 2RE2A 4DSFA 3ZSZA 3FR0A 3NE6A 2A5XA 2D0BA 4OLAA 5D3GA 3SJHA 1N34K 1K8KA 1RDCA 2QWPA 5M1FA 1VSMA 3I0RA 2P9LB 1EWQA 3MXIA 3CI5A 2KKZA 4BVOA 2OPSA 4EFHA 4FWQA 3KZBA 3O80A 3H1VX 4WFAL 3L0QA 1IJJA 1JLAA 5GADP 1YJNN 1RDDA 3K5LA 1GOBA 3EKUA 2F9TA 5KPTA 4Z4FA 1EX4A 3O9RA 1YI2N 3AVMA 1P90A 3K9JA 4RG8A 3VA0A 4BRKA 1IKXA 2OA8A 4Z0UA 4R79A 1IKYA 3M8PA 4K25A 4KV8A 2WC9A 3WNEA 1VQ4N 1J53A 4FVUA 3KTQA 4Z4HA 4FJ5A 3DRPA 1NK6A 3CHWA 2FF3B 1S1UA 4CJUA 1I39A 3TSUA 2XY5A 1TYQA 4JKBA 4B3RK 4O5BA 1FK9A 4OJRA 2QWQA 4JRPA 1L3SA 1VQON 2DFEA 4IXCA 4XEIA 1NWKA 3NF8A 3OYLA 3FZMA 3OS2A 3GL1A 2LSNA 3VTHA 4DV1K 3R8EA 1RDBA 5KI6A 4JS5A 4O5FA 3MK6A 4OPHA 3SQ4A 3CIPA 1QZ6A 1SUQA 3N4QA 4E0DA 1HKBA 3SBTA 4DKWA 1T03A 3VQ7A 4CZJA 3OVNA 1QVGM 2O8DB 3CCLN 4FWRA 4E7JA 2V51B 2F9WA 3QEWA 1TGOA 4DR6K 3NH1A 5GAGP 2W42A 1BO5O 2D0PA 4TSXA 4DG1A 1YVNA 3TPQA 3CM5A 3AARA 4M3ZA 2GBZA 3KLEA 3T69A 1HQEA 4KO0A 4N47A 4LF6K 4DV5K 3O4QA 1TUYA 3G4SN 3SUOA 3V1OA 3O1BA 4E1MA 3FLCO 5AQLA 4X62K 3V1RA 5AQQA 5AQSA 1ZYQA 5CE3A 1D9FA 3TU5A 2HNDA 3CJ1A 4JI4K 1HNZK 1ZBHA 3T1HK 4L3QA 2Q0UA 3AVCA 4JRQA 1IV0A 2GWJA 2IVOA 2YJEA 5AQYA 4CEFA 1DEJA 4LF7K 2FBTA 4ELTA 5JLFA 1LOTB 1WSGA 1WAFA 3MCAB 2NRVA 4CGGA 1DGKN 1E4FT 1W97L 1TKXA 2FLOA 4DQSA 3AAQA 1NGJA 5AQRA 4K41A 1XQSC 4JK8A 3QBWA 2KFNA 1U2VB 1OH5A 3TAPA 1KAYA 1LW0A 3MN6A 4WQ5A 2OPQA 4JI7K 1WSHA 4JN4A 1Q82O 4BVPA 5AFUH 1JCEA 4FJ7A 1TUUA 3C6AA 2YNFA 3AO4A 1B92A 4GVEA 4JHDB 1T44A 4M3XA 3OYCA 1KVBA 3N4PA 4LSNA 1XC9A 1Q18A 1SKWA 4O0IA 3NGIA 3U9ZA 3SJJA 5BPLA 3THWB 3CF5L 1HJOA 4DF4A 4LF9K 1XNRK 2G8UA 2VG6A 5BRFA 2VG5A 3WUHA 4RW9A 4F3OA 1TAQA 3PSFA 2BANA 4IBNA 4LH5A 4Z4IA 3QLHA 1T7PA 3EKSA 4M7YA 4IJNA 4YY3K 3A5OC 3ID8A 2P9IB 4IOXA 4YNQA 3O9QA 1HRHA 4AILC 4H4MA 3E66A 3NBPA 1XI1A 1RT6A 3HRGA 3IAYA 1NK5A 1GLFO 3TABA 4M3UA 3WNGA 3SAFA 1WSJA 4BRDA 3PIOL 4DU4A 1ZXOA 4B9NA 4H0VB 1WUAA 2A6AA 3NF7A 1O1WA 2CGJA 4BRCA 4B1UB 5CHIA 4EHUA 3OYAA 4W5QA 3P39A 5CZ2A 1I94K 3ULDA 4DS4A 5J2MA 3UB5A 4NLCA 1IG8A 5C12A 4FJGA 2HMPA 4M41A 4ID5A 1XC3A 3SUQA 3C6HA 1B9FA 2P5GA 2YX6A 3A2FA 3VEVA 1N5YA 4CZEA 1NGDA 4OGEA 2HSTA 1DKGD 4CF1A 1WBDA 1IBLK 2ZE2A 2E6LA 1C1AA 3HYFA 1EXQA 2E2PA 3TAEA 2E6MA 4PKIA 3NFAA 1FXXA 4M3RA 2YNGA 4ISFA 1Q81O 1RTIA 3M8RA 3WXJA 3T7ZA 1OH8A 3VERA 3WEEB 4C1NI 3VQCA 4BRHA 2OPRA 2QK9A 2QA4N 5HP1A 2F4VK 3WXMB 4A2AA 2CH5A 3AVIA 4CBXA 1ZC6A 3ENOA 3DOLA 4CZFA 3A8YA 1NMNA 3DLRA 2P9PB 1IG9A 4CGIA 3RMBA 4FVMA 4OKJA 3OBWA 4N5SA 5LMNK 2IVPA 2O8BB 1NKBA 2VGNA 2QWRA 4R5PA 3UKUA 3BZKA 3SYZA 3MN5A 3S3NA 4GVMA 2IDOA 2YHBA 4GW6A 1IBMK 3BZCA 4NO7A 1IKVA 4HCBA 2GUIA 4DSIA 4RW4A 3DI6A 3O3FA 2IOCA 3MEDA 2RPIA 1WLJA 4Y1CA 3H3NO 3HTVA 4N56A 3OYMA 1YVUA 1VQKN 4YOWA 2XY6A 4W5NA 3ZT3A 1Y97A 1ATRA 3SPYA 3H46O 4DV7K 2FSKA 4CEZA 3DXMA 4DR5K 1M1KO 3D45A 1KCFA 5SZTA 3WEEA 4FXDA 4H5TA 5K14A 2BTFA 3C0BA 1U47A 2QI2A 4DTJA 2YKNA 1NK8A 3LPUA 4ELUA 5F2RA 1QSYA 1ZBIA 3IKMA 1G15A 1XHXA 3DLHA 4BWJA 3LDSA 3SQ1A 5AQJA 3AO5A 2CH6A 2NUBA 4A5AA 3ZYYX 4CJWA 2HBKA 4IFVA 2E2OA 3MDQA 3VEWA 2JWLA 4J2BA 4CHOA 4FJXA 1C0UA 4BE1A 1K6YA 1R0AA 2HW3A 3FZLA 5AQMA 3F9MA 3OBYA 1Z26A 1U49A 1BA1A 4DR3K 1XMQK 4WQ5C 2F8SA 4DTPA 1TKDA 1NGEA 3SK3A 3RRHA 2OCEA 4Z4GA 4KTZA 4CE9A 3KLHA 4X66K 1TVRA 1HX1A 4JEPA 3F9KA 4BR7A 3CC7N 1QQOA 1NKEA 4OVLA 2HBMA 2FSJA 1RTDA 3KK1A 2P9IA 4O8UA 3RWUA 1HKGA 2FF6A 4CJEA 4RCHA 4E7IA 1ITGA 3RMAA 3BEXA 3T3FA 4E3SA 4ILHA 3MEGA 1YITN 3KHYA 3NF6A 4CJLA 3C65A 2UUAK 4JKGA 3CQYA 2QTDA 5KQ8A 3C6UA 4C8NA 2KZZA 3SMSA 4FZXC 1MWMA 2E2QA 4M3YA 4A59A 1GLDG 1RBTA 1XNQK 1TL1A 1NKCA 5AQTA 1A5XA 2RN2A 3AVLA 2E8AA 4NLBA 4QAGA 4BRGA 4BR4A 5HROA 3OJUA 5BRHA 1YXQA 4KRFA 3PY8A 3U6FA 3O9SA 1A5VA 1BI4A 4CJTA 3ZLJA 3JS6A 1RDUA 3TR8A 5I9EB 2HNZA 5A2QO 2DTUA 4DFJA 4CZMA 4Q5VA 1VSLA 2QEXN 1J5EK 2QWNA 2OTJN 2YI1A 3ZSXA 5AZIB 3OYHA 4BE2A 4UY8O 2P9KA 4IO8A 3DRRA 3FZFA 1K9MO 4KTQA 2O8FA 3CC4N 3M1FA 4NYNA 3K9KA 3AVJA 3Q7BA 1N36K 4KHPK 3CG7A 3HP9A 5ADXH 4FK2A 2JGUA 3A5MC 2PZSA 1VSJA 1WN7A 3ZX0A 3QB0A 5TKWA 2J4RA 2DY4A 5AQVA 4JKAA 2E88A 3LP1A 1S1VA 4FW2A 1W9HA 3KJVA 4DSJA 4WYBA 2HHUA 3ZSOA 4IG0A 3LANA 1D8YA 2GUPA 3PX6A 2D5RA 2O8CB 1OVYA 3L2WA 5CY4A 4FM2A 4DU3A 1N32K 2HF4A 4E19A 3M8QA 1MU2A 1S1WA 4QOZB 3GG4A 3KVGA 2IC3A 2OANA 3ID6A 2NRZA 3BF1A 2OZMA 5BREA 4DQIA 1X3MA 3QFPA 3PUFA 3VQDA 3VQ4A 4BGAA 4LFBK 4LF5K 2B6AA 3D0PA 4HHTA 4GKJK 4BR2A 3V4IA 3L3VA 1TL3A 4O44A 3DLKA 5F1XA 2YJFA 4FSVA 3VENA 3HXMA 4BQZA 3SZ2A 5EVZA 4I2QA 4B9TA 1RFQA 2HBJA 3L6QA 4DMNA 1L3UA 3CD6N 4C8LA 2DFHA 3R9PA 4FLYA 3VPZA 1CLQA 1JLQA 1IH7A 1NGBA 3V9UA 1BU6O 4M3WA 3A0IX 1FKOA 4DSLA 1S1TA 2GTDA 3PX4A 2ASPA 3O8MA 3TARA 4FWSA 3MN9A 1ASVA 5HRSA 1I3AA 1REVA 2JLEA 4PL7A 4BR0A 4PWDA 3FFKB 4FJIA 4X65K 4ISGA 3V9XA 1VQMN 3RSEB 4CJPA 5JLHA 3CC2N 3CPEA 4JI5K 2I7NA 1K73O 2W6LA 2EWSA 4I2PA 3ASMA 4B9SA 3EZWA 1QSLA 1CXQA 1KLNA 4BRIA 4FLTA 1QHAA 4BC3A 4IZ9A 4BC4A 4WFNL 3O3GA 3TAGA 4K42A 2HBLA 3VGMA 1ATNA 5HRPA 1TV6A 4DCHA 4G9ZA 3AVGA 2G8IA 4CZIA 4KKOA 3O9UA 2UUCK 3RR7A 4ELVA 3ZETB 4BGBA 3VEYA 3VQ5A 1WSIA 3CCQN 1L3TA 3NGYA 4WE1A 3ALYA 4FCYA 2Z1IA 3K5NA 2R7YA 3KD1E 1SQKA 3ZX3A 1RTJA 1NJIO 1BQMA 1ASUA 2H3GX 3CJ7A 3LAKA 4K8XA 3WXIA 2ZJPL 3QNOA 3AA2A 4CI6A 4FWPA 3UKUB 5E26A 3FFIA 4PHTX 5DK5A 1KTQA 4NXNK 4MLEA 4WQ4A 3OYDA 5C10A 4B9VA 3T1AA 4MFBA 2FSNA 4OO1J 3HSTB 4DTSA 3OS0A 2OZSA 3L4QA 1UWBA 1S6PA 4DS5A 4BRMA 4JKCA 2WONA 4XH4A 3C94A 1VSDA 4DHYA 4WCEL 1NJYA 2X6SA 3D2FB 3LWLA 1T6CA 1QE1A 3ZT4A 2BGGA 2E20A 3P4IA 4CHPA 3TI0A 3CMAN 3P83D 3TTCA 3JXUA 1VSIA 4FLVA 5C2FA 4KH4A 4IWVA 4BRFA 4B3MK 5LJWA 1U4BA 3ULEA 4YOYA 3THYB 1TK0A 2HVHA 3DLLL 5FROA 1QQNA 1U48A 1NK9A 1OVQA 3CMEN 4DUYK 3EO3A 1RGIA 3OYNA 3OTOK 1SL0A 5HOOA 2P5OA 4PA1A 5BN8A 2Z1HA 4JI1K 4BC5A 3C6TA 3M3ZA 1WBBA 4ZTFA 2E5LK 4N76A 3D2FA 3BF3A 1T3VA 4AH9A 1GLCG 4FW1A 1P8ZA 5AR0A 1HPMA 4DV6K 3ITHA 4JI3K 4ICLA 1WSFA 1XWLA 5T7BA 3LWMA 2BE2A 4DFMA 1HUXA 3OYFA 1BGXT 5AFUA 1A5WA 2O8EB 2P9NB 3AVNA 4Y1DA 2GEMA 3V9WA 3DLGA 4EP4A 3MX5A 1VQPN 3QO9A 4FLXA 1DTQA 3EL2A 4QS9A 3H3OB 5HBMA 3SQ2A 1NJXA 4CF0A 5AQWA 1NK4A 1RBRA 3UKRB 3LDLA 1BWFO 1RT2A 5J2NA 3ATUA 1U45A 2HNYA 1HYZA 5CYQA 3C7NA 4CEDA 4BRAA 3RVCA 4DR2K 1SKRA 4EIAA 3SUPA 2Q31A 3LDPA 4DSEA 5AQIA 1LW2A 3ZT1A 1XMOK 4JKEA 1S9GA 4DSKA 4IEIA 3CM6A 1YJ9N 3BY5A 2P9LA 4DB3A 5AZJB 4I6MA 1RCHA 4C8OA 3H45C 2QXLA 1BI4B 3NAEA 4M45A 1TAUA 1VHXA 4BDPA 4KHSA 4B1WB 4IOCL 2YHWA 3HP6A 3IG1A 2P9UB 3T19A 5KPRA 2P9NA 1HPZA 3O9TA 3HK2A 5KRTA 2Q0RA 5LY3A 1OH6A 3QDKA 3E1YA 1WAJA 5AJ3K 4E1NA 4LC9B 2XHBA 3HO1A 3L8BA 3CYMA 5ELZA 5KPZA 1HJRA 3C7NB 5KTQA 4PKHA 2FXUA 4WFBL 3SAHA 4RW8A 5AQNA 1NBWA 3D2EB 3HBTA 3L3UA 4W5RA 2P1JA 4E7KA 4JKGB 1HNXK 4YORA 3TTDA 1SL2A 5EU7A 5H1SQ 3V81A 4X64K 1ZBUA 4FK0A 3J7AP 4PY5A 1KLMA 2VG7A 1NOYA 5KGWA 3GDQA 2Y1IA 3AV9A 5IT9O 4E1JA 3LP0A 3WNFA 3H6EA 3S3MA 4HUEA 2QWMA 2DPNA 3MN7A 1ZBFA 2A40A 3W0LA 4W5TA 3VEOA 3P5JA 4C8KA 1BHLA 2QWLA 1UA1A 1C0TA 4JS4A 4EP5A 3PIPL 4PUOA 4CJQA 4J2EA 3KK7A 1EWRA 4FOIA 3SPZA 2D0CA 4DTOA 4CJ3A 1EKEA 1ZBSA 2P9UA 3D7EO 1J5OA 1E4GT 4WQ4C 2XRIA 4DR4K 3LZJA 3RRGA 2WFBA 4GV3A 4DU1A 3DM2A 4FWKA 1BUPA 4KHUA 3SAGA 3DAWA 1NGFA 4RTFD 2AJQA 4CFDA 1EQYA 4DFKA 3CCJN 2ATQA 2ZD1A 5EOYA 2P9PA 3SMPA 3EYZA 4ILJA 4CHYA 2A42A 4C1NK 1BOTO 3DOKA 1LCUA 4M63C 2ETJA 3ENHA 4IDHA 3CFRA 3AY9A 3DXMB 1QZ5A 2NRTA 1J6ZA 3L2UA 1NU0A 3AA3A 2Q97A 4M7XA 4CD3A 2NZTA 4JI0K 2IVNA 4O4GA 4NCGA 4CF2A 4CJRA 4B1VA 1JXEA 1JL1A 1EO1A 1J9AA 3CCSN 4YOTA 4CJFA 5ADXA 1K8AO 4CJVA 1D5AA 2QXFA 4BG8A 3B8AX 3GE1A 3LM2A 3AGRA 4J2DA 4CESA 2KFZA 3VQ9A 4NXMK 4B1YB 1UA0A 1NNEA 4BWMA 1HKCA 4DTUA 4KB1A 2BUPA 1HNVA 1TKTA 3SNNA 2UU9K 3WQUA 3TANA 3QINA 1TKZA 5M1KA 2RF2A 1SAZA 3UKRA 3B6PA 4I6MB 3QIPA 2G8HA 2E2NA 1TYQB 3PO5A 3J80O 3CFPA 4FJ9A 4QCLA 1C0GA 1VQLN 2P9KB 4EAHD 2Y1JA 3P31A 3THVA 4GV6A 2CGLA 1KC8O 1RNHA 3PO4A 3FZKA 4HVJA 1BQNA 2F7TA 3KLGA 1C0MA 3LZIA 4ZTJA 4NCAA 3TSQA 4DLGA 1VSEA 5AQUA 5B8HA 1RT5A 4CECA 1RT3A 4V19S 2O8FB 4MLHA 3V9ZA 5M1PA 4CZLA 5IWAK 3HSCA 1KFSA 3OYIA 4DV0K 4OPKA 1KAXA 4YOUA 3VGLA 3AA4A 4FWLA 4H0XB 4NB4A 2GELA 1F21A 1BCOA 5I3UA 3OYBA 3PLAA 4RW7A 3MWTA 4CEBA 3DMJA 5FDLA 2A3ZA 2HB5A 3V6DA 3VN5A 1YJWN 4F3TA 5C2DA 1YHQN 4FWNA 1C1BA 3E9PA 4JKHA 3W3DA 3VQ6A 5BR9A 2B5JA 2XY8A 4CK2A 1BISA 1V4SA 2RHKA 3HPHA 3QETA 1T8EA 2ZGYA 3LAMA 3M5RA 3THWA 2A1RA 1ILYA 4AQYK 3QICA 4DV4K 4F2SA 4KBOA 2EHGA 1NM1A 2NRWA 3HVTA 3SI6A 5HLFA 4GY2B 4CVNE 4LFCK 5C15A 2IIRA 4I9QA 1Y64A 1C0FA 1JLFA 4CJ7A 1HR0K 3A5LC 4PQUA 3I0SA 1RDAA 4CEQA 4YDUC 1YAGA 4JKFA 5GAEP 1S3XA 4YHHK 4B3TK 3MEEA 3F73A 3ZSWA 1W0HA 4CHNA 5FRMA 3QBXA 3G0ZA 4B3OA 1GOCA 3AO1A 3CETA 4OLBA 2G8VA 4JK9A 2KTQA 4LD0A 1NJZA 4CFAA 1DT9A 3OYEA 1Q9XA 3S41A 4IO9L 2PYJA 1FW6A 2QKBA 2PBDA 4Y0WA 4EZ6A 3MWPA 3G71N 3WQTA 2ASOA 2P9SB 2E4LA 5JVHL 2HF3A 3CERA 2KW4A 4YFUA 4CGDA 2FBYA 2P51A 3TAMA 4CIGA 3HT3A 5KQDA 3OYKA 3MMVA 3L2VA 2BDPA 4QS8A 3SV4A 3ATVA 2RKIA 5KGXA 3FGUA 4K8ZA 2WOMA 3S9HA 4CJKA 1HNIA 3EY1A 1N8RO 5FPMA 4GKKK 4N41A 4EHTA 3ZSQA 4KAZA 3AVHA 3VQQA 4UQGA 3VMFB 1ZBLA 4Q0BA 4KPYA 4CBUA 2XY7A 4AHRA 4CGFA 4B1XB 3CPWM 4CJ5A 3QMLA 3BDPA 4H5VA 4B8AB 1MWKA 1QQCA 3HPGA 1SL1A 3VETA 3I33A 4AM7A 4MQ3A 4AM6A 3KWIA 3KLFA 1VQ8N 1WB9A 4A61A 3BUZB 5AQGA 4FYDA 1RILA 4IJAA 1X3NA 3K5OA 5FPNA 4HTLA 4KH5A 3ZCMA 3SLCA 4DQ8A 4DF8A 5AQOA 4Z4CA 1QSSA 3V9SA 3DJCA 1JLCA 1IKWA 2YKMA 1NJWA 3VOVA 3K2PA 4BDZA 1HMVA 4H5WA 1LAVA 3VA3A 1HLUA 3LDQA 4FJKA 2HHVA 4CZGA 3G6EN 4CW7B 1LWCA 3AA5X 5FRNA 2PFUA 3LALA 1VQ5N 3EE9A 1Q9YA 1XUPO 4DTRA 2QWOA 3HPOA 1SKSA 2D0AA 4OKKA 1VSKA 3VGKA 4B08A 5C24A 4DWIA 4YOVA 4BDYA 3F2KA 1B9DA 1NGCA 3OA9A 4JNEA 4M3TA 4ILGB 3A5NC 3O3HA 1VQNN 1RT4A 4MO5A 3E9OA 4JI6K 3QNNA 1NK7A 4B9QA 3DWLA 2FBXA 5EXWA 3PSIA 5AZIA 4KHNA 5C0YA 4CEAA 3NGZA 3OS1A 3J81O 3HOSA 5J1EA 2WTUA 2NLXA 4FLZA 4FJJA 1JL2A 3AGKA 1HQUA 3AVKA 1U6ZA 3KIOA 1X1PA 2UXCK 3ZETA 3LP3A 5C25A 3OW2M 2DFFA 4CF9A 2X78A 3UE5A 2ZM6K 3M6GA 4KTWA 4A5BA 3AAPA 1C1CA 4I9LA 4BRPA 4L8RB 4CK1A 2O4GA 5CZ1A 1KQSM 4W5OA
chains in the Genus database with same CATH topology
2NUBA 1HPZA 5JS2A 4ZHRA 3HK2A 2KZMA 4CJWA 5KRTA 1DTTA 3NCIA 3B6OA 3IRXA 2PYLA 4IFVA 3G10A 3M8SA 2HHWA 4J2BA 2XO7A 1D9DA 4CIFA 3ZT2A 4CHOA 4FJXA 1C0UA 1WAJA 3QEPA 1X9WA 1YTUA 4F4KA 4E1NA 1S9EA 1K6YA 2OPPA 4BE1A 1BIZA 3VQBA 3ZSRA 2XHBA 3QEXA 2IAJA 3AO2A 2HW3A 3HO1A 3L8BA 4B9LA 3CYMA 1Z26A 4NCBA 1HJRA 1U49A 5KTQA 1S6QA 1YTAA 2IGIA 3ZSVA 1L5UA 4FJLA 3MXJA 2F8SA 4RW8A 4DTPA 1LWEA 3AO3A 3L3UA 2P1JA 4W5RA 1TKDA 4E7KA 3RRHA 4H4OA 5KRSA 5HRNA 4NYFA 3NDKA 1SL2A 4KTZA 1LAWA 2F96A 1KVAA 2Z1JA 4CE9A 3RTVA 3KLHA 5CYMA 3H08A 5EU7A 2ITGA 4E7HA 1TVRA 3V81A 3JYTA 2Z1GA 1ZBUA 4FK0A 4PY5A 1RT1A 1VSFA 1KLMA 2VG7A 3F9KA 1NOYA 4FJHA 3QESA 2ZQBA 1NKEA 1C6VA 4OVLA 5KGWA 1RTDA 3LP2A 3KK1A 2Y1IA 3AV9A 3RWUA 1UOCA 3CFOA 4FM0A 4CJEA 3LP0A 3WNFA 4E7IA 3S3OA 2HMIA 3S3MA 4HUEA 1ITGA 3E01A 3RMAA 3EZ5A 3T3FA 1VRTA 1GOAA 4DQQA 4E3SA 1S5JA 1WSEA 1ZBFA 3AVAA 3MEGA 3TWHA 2KQ2A 1BIUA 3NF6A 4CJLA 4CJSA 4XIUA 4W5TA 3RR8A 4KFBA 4LSLA 4FJNA 3P5JA 3KLIA 3VQAA 4C8KA 3NH2A 4HUFA 4KB0A 2X6NA 1BHLA 3C6UA 3KK2A 2HVIA 4C8NA 1UA1A 3AVFA 3QIOA 2KZZA 1KSPA 1C0TA 4JS4A 4EP5A 3O4NA 4FZXC 4PUOA 3OY9A 4CJQA 4J2EA 4M3YA 4CIEA 3KKRA 3ZSZA 3NE6A 4DSFA 3SPZA 2D0BA 4OLAA 1RBTA 2D0CA 3CQ8A 1TL1A 4DTOA 1NKCA 4CJ3A 3IAYA 5D3GA 1EKEA 1RDCA 1J5OA 1A5XA 2RN2A 3AVLA 1VSMA 2XRIA 4QAGA 4LH4A 3I0RA 3LZJA 5HROA 3RRGA 3MXIA 2VWJA 3OJUA 4DU1A 3DM2A 4KRFA 5SWMA 3I8DA 3PY8A 3U6FA 2OPSA 4KHUA 1A5VA 1BI4A 4CJTA 1EP4A 4CFCA 4DFPA 4G1QA 3TR8A 2DTUA 2HNZA 2AJQA 4DFJA 4CGHA 1JLAA 4Q5VA 4CFDA 1RDDA 3K5LA 4RW6A 4CCHA 1VSLA 1GOBA 3ZSYA 3AVBA 4DFKA 3SCXA 2ATQA 2ZD1A 3ZSXA 3OYHA 4BE2A 1EX4A 4Z4FA 4Z4EA 3EYZA 3AVMA 4RG8A 4CHYA 3VA0A 3DRRA 3TAQA 1IKXA 3IS9A 1T05A 3K59A 2OA8A 4Z0UA 4OPJA 3DOKA 1R0AA 1IKYA 3M8PA 4KV8A 3WNEA 1J53A 2ETJA 4KTQA 1BL3A 3KTQA 3CFRA 3UIQA 4NYNA 4Z4HA 3DRPA 3AA3A 3AVJA 3L2UA 1NK6A 4FJ5A 3CG7A 3HP9A 3QERA 4EZ9A 1S1UA 4CJUA 4FK2A 2JGUA 5E41A 2PZSA 4O4GA 1I39A 2OYQA 4NCGA 4CF2A 4CJRA 4DTXA 2F8TA 1VSJA 1WN7A 2XY5A 4O5BA 1FK9A 4OJRA 2DY4A 1JXEA 1KVCA 4JRPA 1L3SA 1JL1A 3LP1A 2DFEA 1J9AA 1S1VA 3NF8A 4FW2A 4CJFA 3OYLA 3OS2A 2LSNA 1W9HA 1IO2A 3TAFA 4CJVA 3KJVA 1D5AA 3U3YA 4BACA 1RDBA 4DSJA 2QXFA 5KI6A 2HHUA 4JS5A 4J2DA 3ZSOA 4CESA 4IG0A 2KFZA 3LANA 3VQ9A 4CHQA 3SQ4A 4FLWA 1D8YA 1SUQA 3VQPA 4FK4A 1UA0A 4IDKA 4DTNA 4BWMA 4DTUA 4E0DA 2YV0X 3PX6A 2D5RA 4KB1A 1HNVA 4OGCA 1JLGA 1TKTA 3SNNA 4DU3A 3L2WA 5CY4A 4FM2A 3TANA 3QINA 1TKZA 1T03A 2RF2A 1L3VA 3VQ7A 4E19A 3M8QA 4LY7A 3B6PA 3OVNA 2YNIA 1MU2A 1S1WA 3QIPA 1S1XA 2G8HA 3KKSA 4QOZB 3PO5A 3CFPA 4FJ9A 4QCLA 4E7JA 3QEWA 1JLBA 1TGOA 3NH1A 2W42A 1QTMA 2IC3A 4DG1A 4TSXA 2Y1JA 3THVA 4H8KA 3CM5A 2OZMA 4DQIA 4M3ZA 1CZBA 2GBZA 3KLEA 1RNHA 3BGRA 3PUFA 3VQ4A 3VQDA 1HQEA 3PO4A 4KI6A 3MAQA 3HJFA 2B6AA 4KO0A 4N47A 3U3GA 4HVJA 1BQNA 3KLGA 3D0PA 1C0MA 3LZIA 4BE0A 4ZTJA 1XHZA 3O4QA 4NCAA 4HHTA 1RBSA 1VRUA 4DLGA 3V4IA 1VSEA 2PY5A 3L3VA 2HHXA 1RT5A 1TL3A 4CECA 1RT3A 3DLEA 4O44A 3DLKA 4HUGA 3SUOA 1TK5A 3V9ZA 3V1OA 3HXMA 3SZ2A 4I2QA 1JKHA 4E1MA 1KFSA 4B9TA 3OYIA 1LV5A 3OYGA 4DMNA 3V1RA 1KFDA 3MECA 4OPKA 1L3UA 4C8LA 2DFHA 1ZYQA 1D9FA 3AA4A 2HNDA 4FLYA 1CLQA 1JLQA 1ASWA 1IH7A 1ZBHA 1F21A 1BCOA 3V9UA 5I3UA 3OYBA 1VSHA 4M3WA 3AVCA 4RW7A 4JRQA 1FKOA 4CEBA 3DMJA 4CEFA 5FDLA 4DSLA 2HB5A 1S1TA 3VN5A 3V6DA 3PX4A 3PV8A 4F3TA 3C95A 3TARA 2HHQA 2GV9A 1C1BA 4O0JA 4IKFA 3VQ6A 2FBTA 1ASVA 4ELTA 5HRSA 1I3AA 2XY8A 1WSGA 1REVA 1WAFA 2B5JA 2JLEA 1BISA 4CK2A 4PWDA 4CGGA 1NK0A 4FJIA 3HPHA 3QETA 4E89A 3V9XA 1T8EA 1TKXA 3LAMA 4CJPA 3K57A 4DQSA 4CGJA 2A1RA 5DMRA 2YNHA 1CZ9A 4F2SA 4C8MA 2EX3A 4I2PA 3ASMA 4B9SA 3L2QA 2EHGA 3SI6A 2HHSA 3HVTA 2KFNA 5HLFA 3TAPA 1QSLA 1LW0A 1CXQA 4FZZA 1U04A 1KLNA 4I9QA 2OPQA 4FLTA 4CK3A 1WSHA 3O3GA 1JLFA 3TAGA 4KHYA 4PQUA 3RMCA 3I0SA 1RDAA 4CEQA 5HRPA 4FJ7A 1TV6A 1RBUA 2YNFA 3AO4A 3AVGA 2G8IA 1B92A 4M3XA 4KKOA 3OYCA 1KVBA 4LSNA 4Z4GA 1XC9A 3K5MA 3MEEA 3F73A 3RR7A 3ZSWA 1SKWA 4ELVA 4O0IA 4J2AA 1W0HA 4M42A 4CHNA 5FRMA 3NGIA 3G0ZA 3SJJA 3VQ5A 1GOCA 1WSIA 4B3OA 3AO1A 4DTMA 4OLBA 2G8VA 2Q3SA 2KTQA 4DF4A 1L3TA 3NGYA 4WE1A 4LD0A 2G8UA 1NJZA 3ALYA 4CFAA 4FCYA 2G8FA 2VG6A 2Z1IA 2VG5A 3ISNC 3OYEA 4RW9A 3K5NA 1Q9XA 2R7YA 3KD1E 4F3OA 3NHGA 1TAQA 1DLOA 2YHAA 2BANA 1RTJA 4IBNA 2PYJA 4LH5A 5I42A 2QKBA 1FKPA 4Z4IA 1TK8A 3QLHA 4EZ6A 1BQMA 1ASUA 3LAKA 2B4JA 1T7PA 4K8XA 4DQPA 4GMJB 2A1SA 4AHVA 3QNOA 3AA2A 2E4LA 4CERA 2KW4A 4YFUA 4AHSA 4YNQA 4CGDA 2FBYA 3FFIA 5DK5A 1HRHA 4AILC 4H4MA 1KTQA 4KHSA 3NBPA 1XI1A 2P51A 3SV3A 2VWKA 3OYDA 4B9VA 1RT6A 3T1AA 3TAMA 4CIGA 3HT3A 2FC0A 4MFBA 3PX0A 1NK5A 3HSTB 3WNHA 3TABA 4M3UA 3OYKA 3WNGA 4DTSA 3OS0A 2OZSA 2O4IA 1UWBA 1S6PA 3L2VA 1WSJA 2BDPA 4DS5A 5J2PA 3SV4A 2RKIA 4OKEA 3MXMA 4DU4A 5KGXA 4K8ZA 2WOMA 3S9HA 3K58A 4CJKA 1HNIA 3EY1A 2HHTA 4B9NA 2WONA 4HTUA 3C94A 4N41A 3NF7A 1O1WA 3NH0A 1VSDA 3ZSQA 4KAZA 3HVRA 2X74A 3AVHA 1NJYA 2X6SA 3VQQA 3OYAA 4W5QA 1Q8IA 3LWLA 5CZ2A 4UQGA 3JSMA 1RTHA 1QE1A 3ULDA 3ZT4A 4DS4A 1ZBLA 2BGGA 4Q0BA 3TI0A 4CHPA 4KPYA 4KHQA 3P83D 5J2MA 1HYVA 2XY7A 1VSIA 4FLVA 4AHRA 4CGFA 4B9UA 4FJGA 1HYSA 4M41A 4ID5A 4CJ5A 1U4BA 1SV5A 4ID1A 3SUQA 4F8RA 3DYAA 4HCCA 4FLUA 1B9FA 1TK0A 2P5GA 2HVHA 3BDPA 5FROA 3A2FA 1U48A 1NK9A 4AHUA 4B8AB 2FBVA 1UAXA 1EETA 3HPGA 1QQCA 1N5YA 4OGEA 4CF8A 1SL1A 2G8KA 4CF1A 4MQ3A 3OYNA 3KLFA 2ZE2A 2E6LA 1SL0A 2P5OA 1C1AA 3HYFA 3LPTA 1KRPA 1EXQA 4FYDA 1RILA 4PA1A 3VQEA 2Z1HA 4CFBA 3K5OA 5C42A 1BCMA 1RBVA 4JLHA 3TAEA 1RT7A 2E6MA 3C6TA 3ZCMA 4CEEA 4ZTFA 3NFAA 4DF8A 2I5JA 4N76A 1FXXA 4Z4CA 4M3RA 2YNGA 1QSSA 1JLEA 3V9SA 4CHZA 1RTIA 1Z25A 4CEOA 3M8RA 1JLCA 1LWFA 4AH9A 1X9MA 1IKWA 2QKKA 4FW1A 2YKMA 1NJWA 3VQCA 4FJMA 2OPRA 1VK0A 2QK9A 3K2PA 5HP1A 4BDZA 1HMVA 3ITHA 1LAVA 3QEIA 4ICLA 3AVIA 3VA3A 1WSFA 1XWLA 5T7BA 3LWMA 2BE2A 4FJKA 3NF9A 2HHVA 3DOLA 4DFMA 3OYFA 3P1GA 1BGXT 1YT3A 3HL8A 1A5WA 3V1QA 1LWCA 3AA5X 3DLRA 5FRNA 1IG9A 4DQRA 4CGIA 3AVNA 3LALA 4FVMA 4Y1DA 3VQ8A 3RMBA 4AHTA 4OKJA 3V9WA 1X9SA 3DLGA 4FZYA 4N5SA 3SUNA 1Q9YA 4I7FA 4KHWA 1WNSA 4EP4A 1NKBA 4DTRA 3QO9A 4FLXA 1DTQA 1CXUA 4R5PA 3HPOA 1SKSA 2D0AA 4OKKA 1VSKA 3QEVA 5HBMA 3SQ2A 3SYZA 1NJXA 4B08A 3SQ0A 5C24A 4CF0A 4DWIA 1NK4A 4AHCA 1J54A 1RBRA 4GVMA 2IDOA 4BDYA 1RT2A 3S3NA 5J2NA 1U45A 4B9MA 2HNYA 1B9DA 2YHBA 4GW6A 1HYZA 4M3TA 5HRRA 1N6QA 1IKVA 3O3HA 1RT4A 5CYQA 4KREA 4HCBA 1NOZA 2GUIA 3L2RA 3QNNA 1NK7A 4DSIA 4RW4A 4CEDA 3DI6A 4KI4A 2FBXA 1JXBA 4E7LA 1SKRA 3O3FA 2IOCA 3SUPA 4KHNA 3MEDA 2RPIA 4CEAA 3NGZA 1QS4A 3DLBA 1WLJA 4Y1CA 3OS1A 4N56A 4DSEA 4FLZA 5J1EA 3OYMA 1LW2A 1YVUA 3ZT1A 4FJJA 5JS1A 2XY6A 1JL2A 4W5NA 1HQUA 3AVKA 2IS3A 3ZT3A 3OJSA 4F2RA 1Y97A 3KIOA 1X1PA 3SPYA 1S9GA 3KK3A 2G8WA 3LP3A 4CEZA 5C25A 2DFFA 4DSKA 4CF9A 3D45A 4CJ4A 1KCFA 5SZTA 2X78A 4IFYA 4FM1A 4FXDA 3CM6A 5K14A 3DRSA 4FJ8A 1U47A 4KTWA 4O55A 4DTJA 1RCHA 4C8OA 2YKNA 1QHTA 1NK8A 3LPUA 1C1CA 4I9LA 4ELUA 4B8CA 1BI4B 3NAEA 1QSYA 4M45A 1ZBIA 1TAUA 1G15A 3OYJA 1XHXA 4BDPA 3DLHA 4L8RB 4BWJA 4CK1A 2O4GA 5CZ1A 3HM9A 5J2QA 3LDSA 3SQ1A 4DLEA 3HP6A 3ZT0A 3IG1A 3T19A 4IG3A 4W5OA 3KD5E 3AO5A 3RMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUB A;  1HPZ A;  5JS2 A;  4ZHR A;  3HK2 A;  2KZM A;  4CJW A;  5KRT A;  1DTT A;  3NCI A;  3B6O A;  3IRX A;  2PYL A;  4IFV A;  3G10 A;  3M8S A;  2HHW A;  4J2B A;  2XO7 A;  1D9D A;  4CIF A;  3ZT2 A;  4CHO A;  4FJX A;  1C0U A;  1WAJ A;  3QEP A;  1X9W A;  1YTU A;  4F4K A;  4E1N A;  1S9E A;  1K6Y A;  2OPP A;  4BE1 A;  1BIZ A;  3VQB A;  3ZSR A;  2XHB A;  3QEX A;  2IAJ A;  3AO2 A;  2HW3 A;  3HO1 A;  3L8B A;  4B9L A;  3CYM A;  1Z26 A;  4NCB A;  1HJR A;  1U49 A;  5KTQ A;  1S6Q A;  1YTA A;  2IGI A;  3ZSV A;  1L5U A;  4FJL A;  3MXJ A;  2F8S A;  4RW8 A;  4DTP A;  1LWE A;  3AO3 A;  3L3U A;  2P1J A;  4W5R A;  1TKD A;  4E7K A;  3RRH A;  4H4O A;  5KRS A;  5HRN A;  4NYF A;  3NDK A;  1SL2 A;  4KTZ A;  1LAW A;  2F96 A;  1KVA A;  2Z1J A;  4CE9 A;  3RTV A;  3KLH A;  5CYM A;  3H08 A;  5EU7 A;  2ITG A;  4E7H A;  1TVR A;  3V81 A;  3JYT A;  2Z1G A;  1ZBU A;  4FK0 A;  4PY5 A;  1RT1 A;  1VSF A;  1KLM A;  2VG7 A;  3F9K A;  1NOY A;  4FJH A;  3QES A;  2ZQB A;  1NKE A;  1C6V A;  4OVL A;  5KGW A;  1RTD A;  3LP2 A;  3KK1 A;  2Y1I A;  3AV9 A;  3RWU A;  1UOC A;  3CFO A;  4FM0 A;  4CJE A;  3LP0 A;  3WNF A;  4E7I A;  3S3O A;  2HMI A;  3S3M A;  4HUE A;  1ITG A;  3E01 A;  3RMA A;  3EZ5 A;  3T3F A;  1VRT A;  1GOA A;  4DQQ A;  4E3S A;  1S5J A;  1WSE A;  1ZBF A;  3AVA A;  3MEG A;  3TWH A;  2KQ2 A;  1BIU A;  3NF6 A;  4CJL A;  4CJS A;  4XIU A;  4W5T A;  3RR8 A;  4KFB A;  4LSL A;  4FJN A;  3P5J A;  3KLI A;  3VQA A;  4C8K A;  3NH2 A;  4HUF A;  4KB0 A;  2X6N A;  1BHL A;  3C6U A;  3KK2 A;  2HVI A;  4C8N A;  1UA1 A;  3AVF A;  3QIO A;  2KZZ A;  1KSP A;  1C0T A;  4JS4 A;  4EP5 A;  3O4N A;  4FZX C;  4PUO A;  3OY9 A;  4CJQ A;  4J2E A;  4M3Y A;  4CIE A;  3KKR A;  3ZSZ A;  3NE6 A;  4DSF A;  3SPZ A;  2D0B A;  4OLA A;  1RBT A;  2D0C A;  3CQ8 A;  1TL1 A;  4DTO A;  1NKC A;  4CJ3 A;  3IAY A;  5D3G A;  1EKE A;  1RDC A;  1J5O A;  1A5X A;  2RN2 A;  3AVL A;  1VSM A;  2XRI A;  4QAG A;  4LH4 A;  3I0R A;  3LZJ A;  5HRO A;  3RRG A;  3MXI A;  2VWJ A;  3OJU A;  4DU1 A;  3DM2 A;  4KRF A;  5SWM A;  3I8D A;  3PY8 A;  3U6F A;  2OPS A;  4KHU A;  1A5V A;  1BI4 A;  4CJT A;  1EP4 A;  4CFC A;  4DFP A;  4G1Q A;  3TR8 A;  2DTU A;  2HNZ A;  2AJQ A;  4DFJ A;  4CGH A;  1JLA A;  4Q5V A;  4CFD A;  1RDD A;  3K5L A;  4RW6 A;  4CCH A;  1VSL A;  1GOB A;  3ZSY A;  3AVB A;  4DFK A;  3SCX A;  2ATQ A;  2ZD1 A;  3ZSX A;  3OYH A;  4BE2 A;  1EX4 A;  4Z4F A;  4Z4E A;  3EYZ A;  3AVM A;  4RG8 A;  4CHY A;  3VA0 A;  3DRR A;  3TAQ A;  1IKX A;  3IS9 A;  1T05 A;  3K59 A;  2OA8 A;  4Z0U A;  4OPJ A;  3DOK A;  1R0A A;  1IKY A;  3M8P A;  4KV8 A;  3WNE A;  1J53 A;  2ETJ A;  4KTQ A;  1BL3 A;  3KTQ A;  3CFR A;  3UIQ A;  4NYN A;  4Z4H A;  3DRP A;  3AA3 A;  3AVJ A;  3L2U A;  1NK6 A;  4FJ5 A;  3CG7 A;  3HP9 A;  3QER A;  4EZ9 A;  1S1U A;  4CJU A;  4FK2 A;  2JGU A;  5E41 A;  2PZS A;  4O4G A;  1I39 A;  2OYQ A;  4NCG A;  4CF2 A;  4CJR A;  4DTX A;  2F8T A;  1VSJ A;  1WN7 A;  2XY5 A;  4O5B A;  1FK9 A;  4OJR A;  2DY4 A;  1JXE A;  1KVC A;  4JRP A;  1L3S A;  1JL1 A;  3LP1 A;  2DFE A;  1J9A A;  1S1V A;  3NF8 A;  4FW2 A;  4CJF A;  3OYL A;  3OS2 A;  2LSN A;  1W9H A;  1IO2 A;  3TAF A;  4CJV A;  3KJV A;  1D5A A;  3U3Y A;  4BAC A;  1RDB A;  4DSJ A;  2QXF A;  5KI6 A;  2HHU A;  4JS5 A;  4J2D A;  3ZSO A;  4CES A;  4IG0 A;  2KFZ A;  3LAN A;  3VQ9 A;  4CHQ A;  3SQ4 A;  4FLW A;  1D8Y A;  1SUQ A;  3VQP A;  4FK4 A;  1UA0 A;  4IDK A;  4DTN A;  4BWM A;  4DTU A;  4E0D A;  2YV0 X;  3PX6 A;  2D5R A;  4KB1 A;  1HNV A;  4OGC A;  1JLG A;  1TKT A;  3SNN A;  4DU3 A;  3L2W A;  5CY4 A;  4FM2 A;  3TAN A;  3QIN A;  1TKZ A;  1T03 A;  2RF2 A;  1L3V A;  3VQ7 A;  4E19 A;  3M8Q A;  4LY7 A;  3B6P A;  3OVN A;  2YNI A;  1MU2 A;  1S1W A;  3QIP A;  1S1X A;  2G8H A;  3KKS A;  4QOZ B;  3PO5 A;  3CFP A;  4FJ9 A;  4QCL A;  4E7J A;  3QEW A;  1JLB A;  1TGO A;  3NH1 A;  2W42 A;  1QTM A;  2IC3 A;  4DG1 A;  4TSX A;  2Y1J A;  3THV A;  4H8K A;  3CM5 A;  2OZM A;  4DQI A;  4M3Z A;  1CZB A;  2GBZ A;  3KLE A;  1RNH A;  3BGR A;  3PUF A;  3VQ4 A;  3VQD A;  1HQE A;  3PO4 A;  4KI6 A;  3MAQ A;  3HJF A;  2B6A A;  4KO0 A;  4N47 A;  3U3G A;  4HVJ A;  1BQN A;  3KLG A;  3D0P A;  1C0M A;  3LZI A;  4BE0 A;  4ZTJ A;  1XHZ A;  3O4Q A;  4NCA A;  4HHT A;  1RBS A;  1VRU A;  4DLG A;  3V4I A;  1VSE A;  2PY5 A;  3L3V A;  2HHX A;  1RT5 A;  1TL3 A;  4CEC A;  1RT3 A;  3DLE A;  4O44 A;  3DLK A;  4HUG A;  3SUO A;  1TK5 A;  3V9Z A;  3V1O A;  3HXM A;  3SZ2 A;  4I2Q A;  1JKH A;  4E1M A;  1KFS A;  4B9T A;  3OYI A;  1LV5 A;  3OYG A;  4DMN A;  3V1R A;  1KFD A;  3MEC A;  4OPK A;  1L3U A;  4C8L A;  2DFH A;  1ZYQ A;  1D9F A;  3AA4 A;  2HND A;  4FLY A;  1CLQ A;  1JLQ A;  1ASW A;  1IH7 A;  1ZBH A;  1F21 A;  1BCO A;  3V9U A;  5I3U A;  3OYB A;  1VSH A;  4M3W A;  3AVC A;  4RW7 A;  4JRQ A;  1FKO A;  4CEB A;  3DMJ A;  4CEF A;  5FDL A;  4DSL A;  2HB5 A;  1S1T A;  3VN5 A;  3V6D A;  3PX4 A;  3PV8 A;  4F3T A;  3C95 A;  3TAR A;  2HHQ A;  2GV9 A;  1C1B A;  4O0J A;  4IKF A;  3VQ6 A;  2FBT A;  1ASV A;  4ELT A;  5HRS A;  1I3A A;  2XY8 A;  1WSG A;  1REV A;  1WAF A;  2B5J A;  2JLE A;  1BIS A;  4CK2 A;  4PWD A;  4CGG A;  1NK0 A;  4FJI A;  3HPH A;  3QET A;  4E89 A;  3V9X A;  1T8E A;  1TKX A;  3LAM A;  4CJP A;  3K57 A;  4DQS A;  4CGJ A;  2A1R A;  5DMR A;  2YNH A;  1CZ9 A;  4F2S A;  4C8M A;  2EX3 A;  4I2P A;  3ASM A;  4B9S A;  3L2Q A;  2EHG A;  3SI6 A;  2HHS A;  3HVT A;  2KFN A;  5HLF A;  3TAP A;  1QSL A;  1LW0 A;  1CXQ A;  4FZZ A;  1U04 A;  1KLN A;  4I9Q A;  2OPQ A;  4FLT A;  4CK3 A;  1WSH A;  3O3G A;  1JLF A;  3TAG A;  4KHY A;  4PQU A;  3RMC A;  3I0S A;  1RDA A;  4CEQ A;  5HRP A;  4FJ7 A;  1TV6 A;  1RBU A;  2YNF A;  3AO4 A;  3AVG A;  2G8I A;  1B92 A;  4M3X A;  4KKO A;  3OYC A;  1KVB A;  4LSN A;  4Z4G A;  1XC9 A;  3K5M A;  3MEE A;  3F73 A;  3RR7 A;  3ZSW A;  1SKW A;  4ELV A;  4O0I A;  4J2A A;  1W0H A;  4M42 A;  4CHN A;  5FRM A;  3NGI A;  3G0Z A;  3SJJ A;  3VQ5 A;  1GOC A;  1WSI A;  4B3O A;  3AO1 A;  4DTM A;  4OLB A;  2G8V A;  2Q3S A;  2KTQ A;  4DF4 A;  1L3T A;  3NGY A;  4WE1 A;  4LD0 A;  2G8U A;  1NJZ A;  3ALY A;  4CFA A;  4FCY A;  2G8F A;  2VG6 A;  2Z1I A;  2VG5 A;  3ISN C;  3OYE A;  4RW9 A;  3K5N A;  1Q9X A;  2R7Y A;  3KD1 E;  4F3O A;  3NHG A;  1TAQ A;  1DLO A;  2YHA A;  2BAN A;  1RTJ A;  4IBN A;  2PYJ A;  4LH5 A;  5I42 A;  2QKB A;  1FKP A;  4Z4I A;  1TK8 A;  3QLH A;  4EZ6 A;  1BQM A;  1ASU A;  3LAK A;  2B4J A;  1T7P A;  4K8X A;  4DQP A;  4GMJ B;  2A1S A;  4AHV A;  3QNO A;  3AA2 A;  2E4L A;  4CER A;  2KW4 A;  4YFU A;  4AHS A;  4YNQ A;  4CGD A;  2FBY A;  3FFI A;  5DK5 A;  1HRH A;  4AIL C;  4H4M A;  1KTQ A;  4KHS A;  3NBP A;  1XI1 A;  2P51 A;  3SV3 A;  2VWK A;  3OYD A;  4B9V A;  1RT6 A;  3T1A A;  3TAM A;  4CIG A;  3HT3 A;  2FC0 A;  4MFB A;  3PX0 A;  1NK5 A;  3HST B;  3WNH A;  3TAB A;  4M3U A;  3OYK A;  3WNG A;  4DTS A;  3OS0 A;  2OZS A;  2O4I A;  1UWB A;  1S6P A;  3L2V A;  1WSJ A;  2BDP A;  4DS5 A;  5J2P A;  3SV4 A;  2RKI A;  4OKE A;  3MXM A;  4DU4 A;  5KGX A;  4K8Z A;  2WOM A;  3S9H A;  3K58 A;  4CJK A;  1HNI A;  3EY1 A;  2HHT A;  4B9N A;  2WON A;  4HTU A;  3C94 A;  4N41 A;  3NF7 A;  1O1W A;  3NH0 A;  1VSD A;  3ZSQ A;  4KAZ A;  3HVR A;  2X74 A;  3AVH A;  1NJY A;  2X6S A;  3VQQ A;  3OYA A;  4W5Q A;  1Q8I A;  3LWL A;  5CZ2 A;  4UQG A;  3JSM A;  1RTH A;  1QE1 A;  3ULD A;  3ZT4 A;  4DS4 A;  1ZBL A;  2BGG A;  4Q0B A;  3TI0 A;  4CHP A;  4KPY A;  4KHQ A;  3P83 D;  5J2M A;  1HYV A;  2XY7 A;  1VSI A;  4FLV A;  4AHR A;  4CGF A;  4B9U A;  4FJG A;  1HYS A;  4M41 A;  4ID5 A;  4CJ5 A;  1U4B A;  1SV5 A;  4ID1 A;  3SUQ A;  4F8R A;  3DYA A;  4HCC A;  4FLU A;  1B9F A;  1TK0 A;  2P5G A;  2HVH A;  3BDP A;  5FRO A;  3A2F A;  1U48 A;  1NK9 A;  4AHU A;  4B8A B;  2FBV A;  1UAX A;  1EET A;  3HPG A;  1QQC A;  1N5Y A;  4OGE A;  4CF8 A;  1SL1 A;  2G8K A;  4CF1 A;  4MQ3 A;  3OYN A;  3KLF A;  2ZE2 A;  2E6L A;  1SL0 A;  2P5O A;  1C1A A;  3HYF A;  3LPT A;  1KRP A;  1EXQ A;  4FYD A;  1RIL A;  4PA1 A;  3VQE A;  2Z1H A;  4CFB A;  3K5O A;  5C42 A;  1BCM A;  1RBV A;  4JLH A;  3TAE A;  1RT7 A;  2E6M A;  3C6T A;  3ZCM A;  4CEE A;  4ZTF A;  3NFA A;  4DF8 A;  2I5J A;  4N76 A;  1FXX A;  4Z4C A;  4M3R A;  2YNG A;  1QSS A;  1JLE A;  3V9S A;  4CHZ A;  1RTI A;  1Z25 A;  4CEO A;  3M8R A;  1JLC A;  1LWF A;  4AH9 A;  1X9M A;  1IKW A;  2QKK A;  4FW1 A;  2YKM A;  1NJW A;  3VQC A;  4FJM A;  2OPR A;  1VK0 A;  2QK9 A;  3K2P A;  5HP1 A;  4BDZ A;  1HMV A;  3ITH A;  1LAV A;  3QEI A;  4ICL A;  3AVI A;  3VA3 A;  1WSF A;  1XWL A;  5T7B A;  3LWM A;  2BE2 A;  4FJK A;  3NF9 A;  2HHV A;  3DOL A;  4DFM A;  3OYF A;  3P1G A;  1BGX T;  1YT3 A;  3HL8 A;  1A5W A;  3V1Q A;  1LWC A;  3AA5 X;  3DLR A;  5FRN A;  1IG9 A;  4DQR A;  4CGI A;  3AVN A;  3LAL A;  4FVM A;  4Y1D A;  3VQ8 A;  3RMB A;  4AHT A;  4OKJ A;  3V9W A;  1X9S A;  3DLG A;  4FZY A;  4N5S A;  3SUN A;  1Q9Y A;  4I7F A;  4KHW A;  1WNS A;  4EP4 A;  1NKB A;  4DTR A;  3QO9 A;  4FLX A;  1DTQ A;  1CXU A;  4R5P A;  3HPO A;  1SKS A;  2D0A A;  4OKK A;  1VSK A;  3QEV A;  5HBM A;  3SQ2 A;  3SYZ A;  1NJX A;  4B08 A;  3SQ0 A;  5C24 A;  4CF0 A;  4DWI A;  1NK4 A;  4AHC A;  1J54 A;  1RBR A;  4GVM A;  2IDO A;  4BDY A;  1RT2 A;  3S3N A;  5J2N A;  1U45 A;  4B9M A;  2HNY A;  1B9D A;  2YHB A;  4GW6 A;  1HYZ A;  4M3T A;  5HRR A;  1N6Q A;  1IKV A;  3O3H A;  1RT4 A;  5CYQ A;  4KRE A;  4HCB A;  1NOZ A;  2GUI A;  3L2R A;  3QNN A;  1NK7 A;  4DSI A;  4RW4 A;  4CED A;  3DI6 A;  4KI4 A;  2FBX A;  1JXB A;  4E7L A;  1SKR A;  3O3F A;  2IOC A;  3SUP A;  4KHN A;  3MED A;  2RPI A;  4CEA A;  3NGZ A;  1QS4 A;  3DLB A;  1WLJ A;  4Y1C A;  3OS1 A;  4N56 A;  4DSE A;  4FLZ A;  5J1E A;  3OYM A;  1LW2 A;  1YVU A;  3ZT1 A;  4FJJ A;  5JS1 A;  2XY6 A;  1JL2 A;  4W5N A;  1HQU A;  3AVK A;  2IS3 A;  3ZT3 A;  3OJS A;  4F2R A;  1Y97 A;  3KIO A;  1X1P A;  3SPY A;  1S9G A;  3KK3 A;  2G8W A;  3LP3 A;  4CEZ A;  5C25 A;  2DFF A;  4DSK A;  4CF9 A;  3D45 A;  4CJ4 A;  1KCF A;  5SZT A;  2X78 A;  4IFY A;  4FM1 A;  4FXD A;  3CM6 A;  5K14 A;  3DRS A;  4FJ8 A;  1U47 A;  4KTW A;  4O55 A;  4DTJ A;  1RCH A;  4C8O A;  2YKN A;  1QHT A;  1NK8 A;  3LPU A;  1C1C A;  4I9L A;  4ELU A;  4B8C A;  1BI4 B;  3NAE A;  1QSY A;  4M45 A;  1ZBI A;  1TAU A;  1G15 A;  3OYJ A;  1XHX A;  4BDP A;  3DLH A;  4L8R B;  4BWJ A;  4CK1 A;  2O4G A;  5CZ1 A;  3HM9 A;  5J2Q A;  3LDS A;  3SQ1 A;  4DLE A;  3HP6 A;  3ZT0 A;  3IG1 A;  3T19 A;  4IG3 A;  4W5O A;  3KD5 E;  3AO5 A;  3RMD A; 
#chains in the Genus database with same CATH topology
 4ZHR A;  2KZM A;  3NMU A;  1DTT A;  3NCI A;  3B6O A;  3IRX A;  2PYL A;  4IOA L;  2XO7 A;  4CIF A;  3ZT2 A;  3QEP A;  3CCR N;  1X9W A;  4F4K A;  2OPP A;  3TSP A;  1BIZ A;  5JIC A;  2AA4 A;  2IAJ A;  3AO2 A;  1IBK K;  2A41 A;  5GIP A;  3THX B;  4NCB A;  2VCP A;  1S6Q A;  1YTA A;  4FJL A;  1W2B M;  3MXJ A;  2D4W A;  5BR8 K;  4H4O A;  2ITM A;  1JCG A;  5HRN A;  3U9D A;  3O5B A;  2VQE K;  2ITG A;  4HWI A;  4FWO A;  4BRO A;  3WXK A;  4XH1 A;  3JYT A;  3LDN A;  2Q2R A;  1R59 O;  1VSF A;  4FPB A;  4FJH A;  3QES A;  2NNW A;  1C6V A;  3ULE B;  5DM7 L;  1VQ6 N;  4BR5 A;  2WUS A;  3S3O A;  3MCP A;  3E01 A;  4MDA A;  5M1N A;  4LFA K;  4H5N A;  3AVA A;  1KXP A;  3TWH A;  2KQ2 A;  4XIU A;  4KH6 A;  1M90 O;  5AZJ A;  3RR8 A;  4LSL A;  4FJN A;  4KB0 A;  2V7Z A;  3KLI A;  3NH2 A;  3D2E A;  1NGH A;  2X6N A;  5GIO A;  2VYP A;  3KK2 A;  5AQZ A;  4F9O A;  3QIO A;  1KSP A;  1YIJ N;  3OY9 A;  4CIE A;  3KKR A;  1V4T A;  3CQ8 A;  3L4I A;  3LDO A;  3U4L A;  4Z94 A;  3D6R A;  4LH4 A;  3HZ6 A;  2VWJ A;  1KAZ A;  5SWM A;  3I8D A;  3IFR A;  1N33 K;  4DFP A;  1EP4 A;  4CFC A;  4G1Q A;  2BH1 A;  3CCV N;  4CGH A;  4RW6 A;  4CCH A;  3THX A;  3ZSY A;  4JI8 K;  3AVB A;  3SCX A;  4JD2 A;  3F5T A;  2NRR A;  1SS6 A;  3DXK A;  4H0Y B;  3DXK B;  3I55 N;  4Z4E A;  2O8E A;  4OX9 K;  3G25 A;  3EEQ A;  5GAH P;  4PKG A;  4H03 B;  3TAQ A;  3IS9 A;  1T05 A;  3K59 A;  1WOQ A;  2ZGZ A;  4OPJ A;  1S22 A;  3VES A;  1BL3 A;  3UIQ A;  4JYA K;  3FZH A;  4EZ9 A;  3QER A;  1MDU B;  5E41 A;  2I7P A;  2OTL N;  2OYQ A;  2F8T A;  4DTX A;  3THY A;  4JKD A;  1KVC A;  4U67 L;  1X9J A;  5EY4 A;  5BN9 A;  5CR4 A;  3TAF A;  1IO2 A;  3HOT A;  3U3Y A;  4BAC A;  3HM8 A;  4CHQ A;  4FK4 A;  3VTI A;  4FLW A;  3VQP A;  4IDK A;  2HOE A;  4DTN A;  2QW9 A;  2YV0 X;  3VF6 A;  3CJC A;  3RSE A;  4OGC A;  1JLG A;  4A2B A;  1G99 A;  3FE1 A;  5BRD A;  1JCF A;  3WXL A;  2W41 A;  1L3V A;  3VF4 A;  4LY7 A;  2YNI A;  1S1X A;  3KKS A;  2GWK A;  1JLB A;  5BPM A;  4H0P A;  4XH5 A;  1QTM A;  2YCH A;  4CZH A;  4H8K A;  3H1Q A;  1CZB A;  2NRX A;  2AP1 A;  3BGR A;  4KI6 A;  3Q7C A;  3MAQ A;  3HJF A;  3U3G A;  1XHZ A;  4BE0 A;  2PAV A;  2D0O A;  1RBS A;  3TTF A;  1VRU A;  2PY5 A;  2HHX A;  4B3S K;  4FWM A;  3DLE A;  4HUG A;  1TK5 A;  3WT0 A;  1JKH A;  2W40 A;  1VAZ A;  1LV5 A;  3OYG A;  1KFD A;  3MEC A;  1FJG K;  3CXC M;  4LF4 K;  1ASW A;  1VSH A;  2ZJQ L;  2GX9 A;  2YHX A;  2YHY A;  4FL9 A;  4JAX A;  3PV8 A;  2WBN A;  3C95 A;  4DV3 K;  2ASM A;  2GV9 A;  1ESV A;  2HHQ A;  4O0J A;  5AQP A;  4IKF A;  3ZEU B;  1S72 N;  1NK0 A;  2HHH K;  4E89 A;  5BPN A;  3K57 A;  4JK7 A;  4CGJ A;  5AQF A;  5DMR A;  2YNH A;  3T1Y K;  1NGG A;  1CZ9 A;  4C8M A;  2EX3 A;  4DV2 K;  2KHO A;  3L2Q A;  2HHS A;  4DUZ K;  4FZZ A;  1U04 A;  3HI0 A;  4CK3 A;  5MLC Q;  4KHY A;  3RMC A;  2W6K A;  4CBW A;  1JJ2 M;  4RWT A;  1RBU A;  2ZJR L;  1NLV A;  2O8C A;  1BDG A;  3R6M A;  2O8B A;  4C23 A;  5E84 A;  3K5M A;  3ZX2 A;  1O13 A;  4J2A A;  4M42 A;  2O8D A;  1GLB G;  4DTM A;  2Q3S A;  5LJV A;  4BRE A;  3GOI A;  2G8F A;  3GBT A;  3ISN C;  1Q7Y O;  3E9L A;  4FPA A;  1GLA G;  1YF5 L;  3NHG A;  3J8A A;  1DLO A;  2YHA A;  4JD2 B;  5I42 A;  1FKP A;  1RDW X;  2NRH A;  1TK8 A;  1HNW K;  2B4J A;  3J7Z O;  4DQP A;  1E3M A;  4GMJ B;  2A1S A;  1BG3 A;  4AHV A;  3OHR A;  4PL8 A;  3ZEU A;  4CER A;  4AHS A;  3SV3 A;  2VWK A;  3NVK A;  3PX0 A;  2HVI A;  2FC0 A;  4O8K A;  3WNH A;  2O4I A;  3O4W A;  5TKY A;  5J2P A;  2Q36 A;  3NVM A;  4OKE A;  3JAM O;  3MXM A;  3P38 A;  2JWK A;  3CJB A;  4MDB A;  3K58 A;  2HHT A;  2CGK A;  4HTU A;  4QS7 A;  3NH0 A;  4ISE A;  4J8F A;  3HVR A;  2X74 A;  1Q8I A;  3JSM A;  1RTH A;  3LM9 A;  4JI2 K;  4KHQ A;  1HYV A;  2VGM A;  4YDU A;  4FOE A;  1OH7 A;  5JVG L;  2VQF K;  4MO4 A;  4K43 A;  2UUB K;  4B9U A;  4H0T B;  5FLX O;  5AQH A;  1HYS A;  1SV5 A;  4ID1 A;  4BQL A;  4F8R A;  3DYA A;  4HCC A;  4FLU A;  5FPE A;  1SZ2 A;  1NMD A;  3VEX A;  1Z05 A;  1MA9 B;  4AHU A;  2FBV A;  1UAX A;  1EET A;  4CF8 A;  3VEZ A;  2G8K A;  3LPT A;  1KRP A;  4JHD A;  3VQE A;  4CFB A;  5C42 A;  1BCM A;  1RBV A;  4JLH A;  1RT7 A;  1K8K B;  2VWB A;  4CEE A;  3K0S A;  2I5J A;  4AF1 A;  4GV9 A;  3IMX A;  1JLE A;  5FPD A;  4CHZ A;  1Z25 A;  2P9S A;  4CEO A;  1LWF A;  1X9M A;  2QKK A;  4BRQ A;  3CCU N;  1VK0 A;  1YUW A;  1GLE G;  3QEI A;  1NG9 A;  5LL6 Z;  5GIN A;  3NF9 A;  5DM6 L;  5HL7 L;  3P1G A;  1YT3 A;  3HL8 A;  3V1Q A;  4DQR A;  2UYT A;  3VQ8 A;  4AHT A;  1X9S A;  4FZY A;  3SUN A;  4I7F A;  4KHW A;  1WNS A;  1VQ9 N;  2D1K A;  1CXU A;  3CJ9 A;  3QEV A;  3BP8 A;  4BG9 A;  3SQ0 A;  4FJM A;  1QVF M;  2Q1N A;  1J54 A;  4AHC A;  4B9M A;  5HRR A;  3J7Y P;  1N6Q A;  3CJA A;  4KRE A;  1NOZ A;  1Z6R A;  3L2R A;  5LMU K;  3KWG A;  4KI4 A;  3EE8 A;  1JXB A;  1OKJ A;  4E7L A;  1QS4 A;  3DLB A;  2UXD K;  5JS1 A;  2QM1 A;  4U7B A;  5F0X A;  3OJS A;  2IS3 A;  4H0O A;  4F2R A;  1NGA A;  3KK3 A;  1KD1 O;  2G8W A;  4H5R A;  3CQX A;  4CJ4 A;  3R3L A;  4IFY A;  4DR1 K;  4FO0 A;  4FM1 A;  1BA0 A;  1T6D A;  2V7Y A;  4BR9 A;  3DRS A;  4FJ8 A;  4B1Z A;  4O55 A;  2ZF5 O;  1QHT A;  4K0K K;  1H1V A;  1Q86 O;  4B8C A;  4LF8 K;  3OYJ A;  5J2Q A;  3HM9 A;  4DLE A;  1D4X A;  4IEE A;  3ZT0 A;  1U2V A;  3KD5 E;  4IG3 A;  3SBG A;  3O6W A;  4A57 A;  3R1X A;  3RMD A;  5JS2 A;  4BRN A;  3O1W A;  5M1Q A;  3G10 A;  3M8S A;  2E1Y A;  1VQ7 N;  2HHW A;  1D9D A;  2KLA A;  3I8B A;  3VF2 A;  3CCM N;  1YTU A;  3O08 A;  3ENB A;  2E1Z A;  4OPA A;  1S9E A;  3VQB A;  3ZSR A;  3QEX A;  4CD1 A;  4B9L A;  4JV5 K;  3ZSV A;  2IGI A;  1L5U A;  4BY9 C;  5EX5 A;  5AQK A;  3MX2 A;  4BC2 A;  1LWE A;  3AO3 A;  1ATS A;  5KRS A;  4YOX A;  5JMV A;  1W7A A;  4NYF A;  2ZWH A;  3NDK A;  1LAW A;  2F96 A;  1KVA A;  2Z1J A;  3RTV A;  2V52 B;  5CYM A;  3H08 A;  1GLL O;  4E7H A;  2Z1G A;  3IUC A;  4BRL A;  3U8X A;  1RT1 A;  3IDH A;  4WF9 L;  3CCE N;  5AQX A;  2ZQB A;  3LP2 A;  3I56 N;  1UOC A;  3CFO A;  4FM0 A;  4CZK A;  2HMI A;  4A62 A;  1GLJ O;  5M1O A;  3EZ5 A;  1VRT A;  1GOA A;  4DQQ A;  4DR7 K;  3LL3 A;  1S5J A;  1WSE A;  4CJS A;  1BIU A;  3EN9 A;  2UXB K;  1CZA N;  4KFB A;  3VQA A;  4HUF A;  1NGI A;  4GNI A;  3QFU A;  3AVF A;  1QQM A;  4IFE A;  3O4N A;  2RE2 A;  4DSF A;  3ZSZ A;  3FR0 A;  3NE6 A;  2A5X A;  2D0B A;  4OLA A;  5D3G A;  3SJH A;  1N34 K;  1K8K A;  1RDC A;  2QWP A;  5M1F A;  1VSM A;  3I0R A;  2P9L B;  1EWQ A;  3MXI A;  3CI5 A;  2KKZ A;  4BVO A;  2OPS A;  4EFH A;  4FWQ A;  3KZB A;  3O80 A;  3H1V X;  4WFA L;  3L0Q A;  1IJJ A;  1JLA A;  5GAD P;  1YJN N;  1RDD A;  3K5L A;  1GOB A;  3EKU A;  2F9T A;  5KPT A;  4Z4F A;  1EX4 A;  3O9R A;  1YI2 N;  3AVM A;  1P90 A;  3K9J A;  4RG8 A;  3VA0 A;  4BRK A;  1IKX A;  2OA8 A;  4Z0U A;  4R79 A;  1IKY A;  3M8P A;  4K25 A;  4KV8 A;  2WC9 A;  3WNE A;  1VQ4 N;  1J53 A;  4FVU A;  3KTQ A;  4Z4H A;  4FJ5 A;  3DRP A;  1NK6 A;  3CHW A;  2FF3 B;  1S1U A;  4CJU A;  1I39 A;  3TSU A;  2XY5 A;  1TYQ A;  4JKB A;  4B3R K;  4O5B A;  1FK9 A;  4OJR A;  2QWQ A;  4JRP A;  1L3S A;  1VQO N;  2DFE A;  4IXC A;  4XEI A;  1NWK A;  3NF8 A;  3OYL A;  3FZM A;  3OS2 A;  3GL1 A;  2LSN A;  3VTH A;  4DV1 K;  3R8E A;  1RDB A;  5KI6 A;  4JS5 A;  4O5F A;  3MK6 A;  4OPH A;  3SQ4 A;  3CIP A;  1QZ6 A;  1SUQ A;  3N4Q A;  4E0D A;  1HKB A;  3SBT A;  4DKW A;  1T03 A;  3VQ7 A;  4CZJ A;  3OVN A;  1QVG M;  2O8D B;  3CCL N;  4FWR A;  4E7J A;  2V51 B;  2F9W A;  3QEW A;  1TGO A;  4DR6 K;  3NH1 A;  5GAG P;  2W42 A;  1BO5 O;  2D0P A;  4TSX A;  4DG1 A;  1YVN A;  3TPQ A;  3CM5 A;  3AAR A;  4M3Z A;  2GBZ A;  3KLE A;  3T69 A;  1HQE A;  4KO0 A;  4N47 A;  4LF6 K;  4DV5 K;  3O4Q A;  1TUY A;  3G4S N;  3SUO A;  3V1O A;  3O1B A;  4E1M A;  3FLC O;  5AQL A;  4X62 K;  3V1R A;  5AQQ A;  5AQS A;  1ZYQ A;  5CE3 A;  1D9F A;  3TU5 A;  2HND A;  3CJ1 A;  4JI4 K;  1HNZ K;  1ZBH A;  3T1H K;  4L3Q A;  2Q0U A;  3AVC A;  4JRQ A;  1IV0 A;  2GWJ A;  2IVO A;  2YJE A;  5AQY A;  4CEF A;  1DEJ A;  4LF7 K;  2FBT A;  4ELT A;  5JLF A;  1LOT B;  1WSG A;  1WAF A;  3MCA B;  2NRV A;  4CGG A;  1DGK N;  1E4F T;  1W97 L;  1TKX A;  2FLO A;  4DQS A;  3AAQ A;  1NGJ A;  5AQR A;  4K41 A;  1XQS C;  4JK8 A;  3QBW A;  2KFN A;  1U2V B;  1OH5 A;  3TAP A;  1KAY A;  1LW0 A;  3MN6 A;  4WQ5 A;  2OPQ A;  4JI7 K;  1WSH A;  4JN4 A;  1Q82 O;  4BVP A;  5AFU H;  1JCE A;  4FJ7 A;  1TUU A;  3C6A A;  2YNF A;  3AO4 A;  1B92 A;  4GVE A;  4JHD B;  1T44 A;  4M3X A;  3OYC A;  1KVB A;  3N4P A;  4LSN A;  1XC9 A;  1Q18 A;  1SKW A;  4O0I A;  3NGI A;  3U9Z A;  3SJJ A;  5BPL A;  3THW B;  3CF5 L;  1HJO A;  4DF4 A;  4LF9 K;  1XNR K;  2G8U A;  2VG6 A;  5BRF A;  2VG5 A;  3WUH A;  4RW9 A;  4F3O A;  1TAQ A;  3PSF A;  2BAN A;  4IBN A;  4LH5 A;  4Z4I A;  3QLH A;  1T7P A;  3EKS A;  4M7Y A;  4IJN A;  4YY3 K;  3A5O C;  3ID8 A;  2P9I B;  4IOX A;  4YNQ A;  3O9Q A;  1HRH A;  4AIL C;  4H4M A;  3E66 A;  3NBP A;  1XI1 A;  1RT6 A;  3HRG A;  3IAY A;  1NK5 A;  1GLF O;  3TAB A;  4M3U A;  3WNG A;  3SAF A;  1WSJ A;  4BRD A;  3PIO L;  4DU4 A;  1ZXO A;  4B9N A;  4H0V B;  1WUA A;  2A6A A;  3NF7 A;  1O1W A;  2CGJ A;  4BRC A;  4B1U B;  5CHI A;  4EHU A;  3OYA A;  4W5Q A;  3P39 A;  5CZ2 A;  1I94 K;  3ULD A;  4DS4 A;  5J2M A;  3UB5 A;  4NLC A;  1IG8 A;  5C12 A;  4FJG A;  2HMP A;  4M41 A;  4ID5 A;  1XC3 A;  3SUQ A;  3C6H A;  1B9F A;  2P5G A;  2YX6 A;  3A2F A;  3VEV A;  1N5Y A;  4CZE A;  1NGD A;  4OGE A;  2HST A;  1DKG D;  4CF1 A;  1WBD A;  1IBL K;  2ZE2 A;  2E6L A;  1C1A A;  3HYF A;  1EXQ A;  2E2P A;  3TAE A;  2E6M A;  4PKI A;  3NFA A;  1FXX A;  4M3R A;  2YNG A;  4ISF A;  1Q81 O;  1RTI A;  3M8R A;  3WXJ A;  3T7Z A;  1OH8 A;  3VER A;  3WEE B;  4C1N I;  3VQC A;  4BRH A;  2OPR A;  2QK9 A;  2QA4 N;  5HP1 A;  2F4V K;  3WXM B;  4A2A A;  2CH5 A;  3AVI A;  4CBX A;  1ZC6 A;  3ENO A;  3DOL A;  4CZF A;  3A8Y A;  1NMN A;  3DLR A;  2P9P B;  1IG9 A;  4CGI A;  3RMB A;  4FVM A;  4OKJ A;  3OBW A;  4N5S A;  5LMN K;  2IVP A;  2O8B B;  1NKB A;  2VGN A;  2QWR A;  4R5P A;  3UKU A;  3BZK A;  3SYZ A;  3MN5 A;  3S3N A;  4GVM A;  2IDO A;  2YHB A;  4GW6 A;  1IBM K;  3BZC A;  4NO7 A;  1IKV A;  4HCB A;  2GUI A;  4DSI A;  4RW4 A;  3DI6 A;  3O3F A;  2IOC A;  3MED A;  2RPI A;  1WLJ A;  4Y1C A;  3H3N O;  3HTV A;  4N56 A;  3OYM A;  1YVU A;  1VQK N;  4YOW A;  2XY6 A;  4W5N A;  3ZT3 A;  1Y97 A;  1ATR A;  3SPY A;  3H46 O;  4DV7 K;  2FSK A;  4CEZ A;  3DXM A;  4DR5 K;  1M1K O;  3D45 A;  1KCF A;  5SZT A;  3WEE A;  4FXD A;  4H5T A;  5K14 A;  2BTF A;  3C0B A;  1U47 A;  2QI2 A;  4DTJ A;  2YKN A;  1NK8 A;  3LPU A;  4ELU A;  5F2R A;  1QSY A;  1ZBI A;  3IKM A;  1G15 A;  1XHX A;  3DLH A;  4BWJ A;  3LDS A;  3SQ1 A;  5AQJ A;  3AO5 A;  2CH6 A;  2NUB A;  4A5A A;  3ZYY X;  4CJW A;  2HBK A;  4IFV A;  2E2O A;  3MDQ A;  3VEW A;  2JWL A;  4J2B A;  4CHO A;  4FJX A;  1C0U A;  4BE1 A;  1K6Y A;  1R0A A;  2HW3 A;  3FZL A;  5AQM A;  3F9M A;  3OBY A;  1Z26 A;  1U49 A;  1BA1 A;  4DR3 K;  1XMQ K;  4WQ5 C;  2F8S A;  4DTP A;  1TKD A;  1NGE A;  3SK3 A;  3RRH A;  2OCE A;  4Z4G A;  4KTZ A;  4CE9 A;  3KLH A;  4X66 K;  1TVR A;  1HX1 A;  4JEP A;  3F9K A;  4BR7 A;  3CC7 N;  1QQO A;  1NKE A;  4OVL A;  2HBM A;  2FSJ A;  1RTD A;  3KK1 A;  2P9I A;  4O8U A;  3RWU A;  1HKG A;  2FF6 A;  4CJE A;  4RCH A;  4E7I A;  1ITG A;  3RMA A;  3BEX A;  3T3F A;  4E3S A;  4ILH A;  3MEG A;  1YIT N;  3KHY A;  3NF6 A;  4CJL A;  3C65 A;  2UUA K;  4JKG A;  3CQY A;  2QTD A;  5KQ8 A;  3C6U A;  4C8N A;  2KZZ A;  3SMS A;  4FZX C;  1MWM A;  2E2Q A;  4M3Y A;  4A59 A;  1GLD G;  1RBT A;  1XNQ K;  1TL1 A;  1NKC A;  5AQT A;  1A5X A;  2RN2 A;  3AVL A;  2E8A A;  4NLB A;  4QAG A;  4BRG A;  4BR4 A;  5HRO A;  3OJU A;  5BRH A;  1YXQ A;  4KRF A;  3PY8 A;  3U6F A;  3O9S A;  1A5V A;  1BI4 A;  4CJT A;  3ZLJ A;  3JS6 A;  1RDU A;  3TR8 A;  5I9E B;  2HNZ A;  5A2Q O;  2DTU A;  4DFJ A;  4CZM A;  4Q5V A;  1VSL A;  2QEX N;  1J5E K;  2QWN A;  2OTJ N;  2YI1 A;  3ZSX A;  5AZI B;  3OYH A;  4BE2 A;  4UY8 O;  2P9K A;  4IO8 A;  3DRR A;  3FZF A;  1K9M O;  4KTQ A;  2O8F A;  3CC4 N;  3M1F A;  4NYN A;  3K9K A;  3AVJ A;  3Q7B A;  1N36 K;  4KHP K;  3CG7 A;  3HP9 A;  5ADX H;  4FK2 A;  2JGU A;  3A5M C;  2PZS A;  1VSJ A;  1WN7 A;  3ZX0 A;  3QB0 A;  5TKW A;  2J4R A;  2DY4 A;  5AQV A;  4JKA A;  2E88 A;  3LP1 A;  1S1V A;  4FW2 A;  1W9H A;  3KJV A;  4DSJ A;  4WYB A;  2HHU A;  3ZSO A;  4IG0 A;  3LAN A;  1D8Y A;  2GUP A;  3PX6 A;  2D5R A;  2O8C B;  1OVY A;  3L2W A;  5CY4 A;  4FM2 A;  4DU3 A;  1N32 K;  2HF4 A;  4E19 A;  3M8Q A;  1MU2 A;  1S1W A;  4QOZ B;  3GG4 A;  3KVG A;  2IC3 A;  2OAN A;  3ID6 A;  2NRZ A;  3BF1 A;  2OZM A;  5BRE A;  4DQI A;  1X3M A;  3QFP A;  3PUF A;  3VQD A;  3VQ4 A;  4BGA A;  4LFB K;  4LF5 K;  2B6A A;  3D0P A;  4HHT A;  4GKJ K;  4BR2 A;  3V4I A;  3L3V A;  1TL3 A;  4O44 A;  3DLK A;  5F1X A;  2YJF A;  4FSV A;  3VEN A;  3HXM A;  4BQZ A;  3SZ2 A;  5EVZ A;  4I2Q A;  4B9T A;  1RFQ A;  2HBJ A;  3L6Q A;  4DMN A;  1L3U A;  3CD6 N;  4C8L A;  2DFH A;  3R9P A;  4FLY A;  3VPZ A;  1CLQ A;  1JLQ A;  1IH7 A;  1NGB A;  3V9U A;  1BU6 O;  4M3W A;  3A0I X;  1FKO A;  4DSL A;  1S1T A;  2GTD A;  3PX4 A;  2ASP A;  3O8M A;  3TAR A;  4FWS A;  3MN9 A;  1ASV A;  5HRS A;  1I3A A;  1REV A;  2JLE A;  4PL7 A;  4BR0 A;  4PWD A;  3FFK B;  4FJI A;  4X65 K;  4ISG A;  3V9X A;  1VQM N;  3RSE B;  4CJP A;  5JLH A;  3CC2 N;  3CPE A;  4JI5 K;  2I7N A;  1K73 O;  2W6L A;  2EWS A;  4I2P A;  3ASM A;  4B9S A;  3EZW A;  1QSL A;  1CXQ A;  1KLN A;  4BRI A;  4FLT A;  1QHA A;  4BC3 A;  4IZ9 A;  4BC4 A;  4WFN L;  3O3G A;  3TAG A;  4K42 A;  2HBL A;  3VGM A;  1ATN A;  5HRP A;  1TV6 A;  4DCH A;  4G9Z A;  3AVG A;  2G8I A;  4CZI A;  4KKO A;  3O9U A;  2UUC K;  3RR7 A;  4ELV A;  3ZET B;  4BGB A;  3VEY A;  3VQ5 A;  1WSI A;  3CCQ N;  1L3T A;  3NGY A;  4WE1 A;  3ALY A;  4FCY A;  2Z1I A;  3K5N A;  2R7Y A;  3KD1 E;  1SQK A;  3ZX3 A;  1RTJ A;  1NJI O;  1BQM A;  1ASU A;  2H3G X;  3CJ7 A;  3LAK A;  4K8X A;  3WXI A;  2ZJP L;  3QNO A;  3AA2 A;  4CI6 A;  4FWP A;  3UKU B;  5E26 A;  3FFI A;  4PHT X;  5DK5 A;  1KTQ A;  4NXN K;  4MLE A;  4WQ4 A;  3OYD A;  5C10 A;  4B9V A;  3T1A A;  4MFB A;  2FSN A;  4OO1 J;  3HST B;  4DTS A;  3OS0 A;  2OZS A;  3L4Q A;  1UWB A;  1S6P A;  4DS5 A;  4BRM A;  4JKC A;  2WON A;  4XH4 A;  3C94 A;  1VSD A;  4DHY A;  4WCE L;  1NJY A;  2X6S A;  3D2F B;  3LWL A;  1T6C A;  1QE1 A;  3ZT4 A;  2BGG A;  2E20 A;  3P4I A;  4CHP A;  3TI0 A;  3CMA N;  3P83 D;  3TTC A;  3JXU A;  1VSI A;  4FLV A;  5C2F A;  4KH4 A;  4IWV A;  4BRF A;  4B3M K;  5LJW A;  1U4B A;  3ULE A;  4YOY A;  3THY B;  1TK0 A;  2HVH A;  3DLL L;  5FRO A;  1QQN A;  1U48 A;  1NK9 A;  1OVQ A;  3CME N;  4DUY K;  3EO3 A;  1RGI A;  3OYN A;  3OTO K;  1SL0 A;  5HOO A;  2P5O A;  4PA1 A;  5BN8 A;  2Z1H A;  4JI1 K;  4BC5 A;  3C6T A;  3M3Z A;  1WBB A;  4ZTF A;  2E5L K;  4N76 A;  3D2F A;  3BF3 A;  1T3V A;  4AH9 A;  1GLC G;  4FW1 A;  1P8Z A;  5AR0 A;  1HPM A;  4DV6 K;  3ITH A;  4JI3 K;  4ICL A;  1WSF A;  1XWL A;  5T7B A;  3LWM A;  2BE2 A;  4DFM A;  1HUX A;  3OYF A;  1BGX T;  5AFU A;  1A5W A;  2O8E B;  2P9N B;  3AVN A;  4Y1D A;  2GEM A;  3V9W A;  3DLG A;  4EP4 A;  3MX5 A;  1VQP N;  3QO9 A;  4FLX A;  1DTQ A;  3EL2 A;  4QS9 A;  3H3O B;  5HBM A;  3SQ2 A;  1NJX A;  4CF0 A;  5AQW A;  1NK4 A;  1RBR A;  3UKR B;  3LDL A;  1BWF O;  1RT2 A;  5J2N A;  3ATU A;  1U45 A;  2HNY A;  1HYZ A;  5CYQ A;  3C7N A;  4CED A;  4BRA A;  3RVC A;  4DR2 K;  1SKR A;  4EIA A;  3SUP A;  2Q31 A;  3LDP A;  4DSE A;  5AQI A;  1LW2 A;  3ZT1 A;  1XMO K;  4JKE A;  1S9G A;  4DSK A;  4IEI A;  3CM6 A;  1YJ9 N;  3BY5 A;  2P9L A;  4DB3 A;  5AZJ B;  4I6M A;  1RCH A;  4C8O A;  3H45 C;  2QXL A;  1BI4 B;  3NAE A;  4M45 A;  1TAU A;  1VHX A;  4BDP A;  4KHS A;  4B1W B;  4IOC L;  2YHW A;  3HP6 A;  3IG1 A;  2P9U B;  3T19 A;  5KPR A;  2P9N A;  1HPZ A;  3O9T A;  3HK2 A;  5KRT A;  2Q0R A;  5LY3 A;  1OH6 A;  3QDK A;  3E1Y A;  1WAJ A;  5AJ3 K;  4E1N A;  4LC9 B;  2XHB A;  3HO1 A;  3L8B A;  3CYM A;  5ELZ A;  5KPZ A;  1HJR A;  3C7N B;  5KTQ A;  4PKH A;  2FXU A;  4WFB L;  3SAH A;  4RW8 A;  5AQN A;  1NBW A;  3D2E B;  3HBT A;  3L3U A;  4W5R A;  2P1J A;  4E7K A;  4JKG B;  1HNX K;  4YOR A;  3TTD A;  1SL2 A;  5EU7 A;  5H1S Q;  3V81 A;  4X64 K;  1ZBU A;  4FK0 A;  3J7A P;  4PY5 A;  1KLM A;  2VG7 A;  1NOY A;  5KGW A;  3GDQ A;  2Y1I A;  3AV9 A;  5IT9 O;  4E1J A;  3LP0 A;  3WNF A;  3H6E A;  3S3M A;  4HUE A;  2QWM A;  2DPN A;  3MN7 A;  1ZBF A;  2A40 A;  3W0L A;  4W5T A;  3VEO A;  3P5J A;  4C8K A;  1BHL A;  2QWL A;  1UA1 A;  1C0T A;  4JS4 A;  4EP5 A;  3PIP L;  4PUO A;  4CJQ A;  4J2E A;  3KK7 A;  1EWR A;  4FOI A;  3SPZ A;  2D0C A;  4DTO A;  4CJ3 A;  1EKE A;  1ZBS A;  2P9U A;  3D7E O;  1J5O A;  1E4G T;  4WQ4 C;  2XRI A;  4DR4 K;  3LZJ A;  3RRG A;  2WFB A;  4GV3 A;  4DU1 A;  3DM2 A;  4FWK A;  1BUP A;  4KHU A;  3SAG A;  3DAW A;  1NGF A;  4RTF D;  2AJQ A;  4CFD A;  1EQY A;  4DFK A;  3CCJ N;  2ATQ A;  2ZD1 A;  5EOY A;  2P9P A;  3SMP A;  3EYZ A;  4ILJ A;  4CHY A;  2A42 A;  4C1N K;  1BOT O;  3DOK A;  1LCU A;  4M63 C;  2ETJ A;  3ENH A;  4IDH A;  3CFR A;  3AY9 A;  3DXM B;  1QZ5 A;  2NRT A;  1J6Z A;  3L2U A;  1NU0 A;  3AA3 A;  2Q97 A;  4M7X A;  4CD3 A;  2NZT A;  4JI0 K;  2IVN A;  4O4G A;  4NCG A;  4CF2 A;  4CJR A;  4B1V A;  1JXE A;  1JL1 A;  1EO1 A;  1J9A A;  3CCS N;  4YOT A;  4CJF A;  5ADX A;  1K8A O;  4CJV A;  1D5A A;  2QXF A;  4BG8 A;  3B8A X;  3GE1 A;  3LM2 A;  3AGR A;  4J2D A;  4CES A;  2KFZ A;  3VQ9 A;  4NXM K;  4B1Y B;  1UA0 A;  1NNE A;  4BWM A;  1HKC A;  4DTU A;  4KB1 A;  2BUP A;  1HNV A;  1TKT A;  3SNN A;  2UU9 K;  3WQU A;  3TAN A;  3QIN A;  1TKZ A;  5M1K A;  2RF2 A;  1SAZ A;  3UKR A;  3B6P A;  4I6M B;  3QIP A;  2G8H A;  2E2N A;  1TYQ B;  3PO5 A;  3J80 O;  3CFP A;  4FJ9 A;  4QCL A;  1C0G A;  1VQL N;  2P9K B;  4EAH D;  2Y1J A;  3P31 A;  3THV A;  4GV6 A;  2CGL A;  1KC8 O;  1RNH A;  3PO4 A;  3FZK A;  4HVJ A;  1BQN A;  2F7T A;  3KLG A;  1C0M A;  3LZI A;  4ZTJ A;  4NCA A;  3TSQ A;  4DLG A;  1VSE A;  5AQU A;  5B8H A;  1RT5 A;  4CEC A;  1RT3 A;  4V19 S;  2O8F B;  4MLH A;  3V9Z A;  5M1P A;  4CZL A;  5IWA K;  3HSC A;  1KFS A;  3OYI A;  4DV0 K;  4OPK A;  1KAX A;  4YOU A;  3VGL A;  3AA4 A;  4FWL A;  4H0X B;  4NB4 A;  2GEL A;  1F21 A;  1BCO A;  5I3U A;  3OYB A;  3PLA A;  4RW7 A;  3MWT A;  4CEB A;  3DMJ A;  5FDL A;  2A3Z A;  2HB5 A;  3V6D A;  3VN5 A;  1YJW N;  4F3T A;  5C2D A;  1YHQ N;  4FWN A;  1C1B A;  3E9P A;  4JKH A;  3W3D A;  3VQ6 A;  5BR9 A;  2B5J A;  2XY8 A;  4CK2 A;  1BIS A;  1V4S A;  2RHK A;  3HPH A;  3QET A;  1T8E A;  2ZGY A;  3LAM A;  3M5R A;  3THW A;  2A1R A;  1ILY A;  4AQY K;  3QIC A;  4DV4 K;  4F2S A;  4KBO A;  2EHG A;  1NM1 A;  2NRW A;  3HVT A;  3SI6 A;  5HLF A;  4GY2 B;  4CVN E;  4LFC K;  5C15 A;  2IIR A;  4I9Q A;  1Y64 A;  1C0F A;  1JLF A;  4CJ7 A;  1HR0 K;  3A5L C;  4PQU A;  3I0S A;  1RDA A;  4CEQ A;  4YDU C;  1YAG A;  4JKF A;  5GAE P;  1S3X A;  4YHH K;  4B3T K;  3MEE A;  3F73 A;  3ZSW A;  1W0H A;  4CHN A;  5FRM A;  3QBX A;  3G0Z A;  4B3O A;  1GOC A;  3AO1 A;  3CET A;  4OLB A;  2G8V A;  4JK9 A;  2KTQ A;  4LD0 A;  1NJZ A;  4CFA A;  1DT9 A;  3OYE A;  1Q9X A;  3S41 A;  4IO9 L;  2PYJ A;  1FW6 A;  2QKB A;  2PBD A;  4Y0W A;  4EZ6 A;  3MWP A;  3G71 N;  3WQT A;  2ASO A;  2P9S B;  2E4L A;  5JVH L;  2HF3 A;  3CER A;  2KW4 A;  4YFU A;  4CGD A;  2FBY A;  2P51 A;  3TAM A;  4CIG A;  3HT3 A;  5KQD A;  3OYK A;  3MMV A;  3L2V A;  2BDP A;  4QS8 A;  3SV4 A;  3ATV A;  2RKI A;  5KGX A;  3FGU A;  4K8Z A;  2WOM A;  3S9H A;  4CJK A;  1HNI A;  3EY1 A;  1N8R O;  5FPM A;  4GKK K;  4N41 A;  4EHT A;  3ZSQ A;  4KAZ A;  3AVH A;  3VQQ A;  4UQG A;  3VMF B;  1ZBL A;  4Q0B A;  4KPY A;  4CBU A;  2XY7 A;  4AHR A;  4CGF A;  4B1X B;  3CPW M;  4CJ5 A;  3QML A;  3BDP A;  4H5V A;  4B8A B;  1MWK A;  1QQC A;  3HPG A;  1SL1 A;  3VET A;  3I33 A;  4AM7 A;  4MQ3 A;  4AM6 A;  3KWI A;  3KLF A;  1VQ8 N;  1WB9 A;  4A61 A;  3BUZ B;  5AQG A;  4FYD A;  1RIL A;  4IJA A;  1X3N A;  3K5O A;  5FPN A;  4HTL A;  4KH5 A;  3ZCM A;  3SLC A;  4DQ8 A;  4DF8 A;  5AQO A;  4Z4C A;  1QSS A;  3V9S A;  3DJC A;  1JLC A;  1IKW A;  2YKM A;  1NJW A;  3VOV A;  3K2P A;  4BDZ A;  1HMV A;  4H5W A;  1LAV A;  3VA3 A;  1HLU A;  3LDQ A;  4FJK A;  2HHV A;  4CZG A;  3G6E N;  4CW7 B;  1LWC A;  3AA5 X;  5FRN A;  2PFU A;  3LAL A;  1VQ5 N;  3EE9 A;  1Q9Y A;  1XUP O;  4DTR A;  2QWO A;  3HPO A;  1SKS A;  2D0A A;  4OKK A;  1VSK A;  3VGK A;  4B08 A;  5C24 A;  4DWI A;  4YOV A;  4BDY A;  3F2K A;  1B9D A;  1NGC A;  3OA9 A;  4JNE A;  4M3T A;  4ILG B;  3A5N C;  3O3H A;  1VQN N;  1RT4 A;  4MO5 A;  3E9O A;  4JI6 K;  3QNN A;  1NK7 A;  4B9Q A;  3DWL A;  2FBX A;  5EXW A;  3PSI A;  5AZI A;  4KHN A;  5C0Y A;  4CEA A;  3NGZ A;  3OS1 A;  3J81 O;  3HOS A;  5J1E A;  2WTU A;  2NLX A;  4FLZ A;  4FJJ A;  1JL2 A;  3AGK A;  1HQU A;  3AVK A;  1U6Z A;  3KIO A;  1X1P A;  2UXC K;  3ZET A;  3LP3 A;  5C25 A;  3OW2 M;  2DFF A;  4CF9 A;  2X78 A;  3UE5 A;  2ZM6 K;  3M6G A;  4KTW A;  4A5B A;  3AAP A;  1C1C A;  4I9L A;  4BRP A;  4L8R B;  4CK1 A;  2O4G A;  5CZ1 A;  1KQS M;  4W5O A; 
#chains in the Genus database with same CATH homology
 2NUB A;  1HPZ A;  5JS2 A;  4ZHR A;  3HK2 A;  2KZM A;  4CJW A;  5KRT A;  1DTT A;  3NCI A;  3B6O A;  3IRX A;  2PYL A;  4IFV A;  3G10 A;  3M8S A;  2HHW A;  4J2B A;  2XO7 A;  1D9D A;  4CIF A;  3ZT2 A;  4CHO A;  4FJX A;  1C0U A;  1WAJ A;  3QEP A;  1X9W A;  1YTU A;  4F4K A;  4E1N A;  1S9E A;  1K6Y A;  2OPP A;  4BE1 A;  1BIZ A;  3VQB A;  3ZSR A;  2XHB A;  3QEX A;  2IAJ A;  3AO2 A;  2HW3 A;  3HO1 A;  3L8B A;  4B9L A;  3CYM A;  1Z26 A;  4NCB A;  1HJR A;  1U49 A;  5KTQ A;  1S6Q A;  1YTA A;  2IGI A;  3ZSV A;  1L5U A;  4FJL A;  3MXJ A;  2F8S A;  4RW8 A;  4DTP A;  1LWE A;  3AO3 A;  3L3U A;  2P1J A;  4W5R A;  1TKD A;  4E7K A;  3RRH A;  4H4O A;  5KRS A;  5HRN A;  4NYF A;  3NDK A;  1SL2 A;  4KTZ A;  1LAW A;  2F96 A;  1KVA A;  2Z1J A;  4CE9 A;  3RTV A;  3KLH A;  5CYM A;  3H08 A;  5EU7 A;  2ITG A;  4E7H A;  1TVR A;  3V81 A;  3JYT A;  2Z1G A;  1ZBU A;  4FK0 A;  4PY5 A;  1RT1 A;  1VSF A;  1KLM A;  2VG7 A;  3F9K A;  1NOY A;  4FJH A;  3QES A;  2ZQB A;  1NKE A;  1C6V A;  4OVL A;  5KGW A;  1RTD A;  3LP2 A;  3KK1 A;  2Y1I A;  3AV9 A;  3RWU A;  1UOC A;  3CFO A;  4FM0 A;  4CJE A;  3LP0 A;  3WNF A;  4E7I A;  3S3O A;  2HMI A;  3S3M A;  4HUE A;  1ITG A;  3E01 A;  3RMA A;  3EZ5 A;  3T3F A;  1VRT A;  1GOA A;  4DQQ A;  4E3S A;  1S5J A;  1WSE A;  1ZBF A;  3AVA A;  3MEG A;  3TWH A;  2KQ2 A;  1BIU A;  3NF6 A;  4CJL A;  4CJS A;  4XIU A;  4W5T A;  3RR8 A;  4KFB A;  4LSL A;  4FJN A;  3P5J A;  3KLI A;  3VQA A;  4C8K A;  3NH2 A;  4HUF A;  4KB0 A;  2X6N A;  1BHL A;  3C6U A;  3KK2 A;  2HVI A;  4C8N A;  1UA1 A;  3AVF A;  3QIO A;  2KZZ A;  1KSP A;  1C0T A;  4JS4 A;  4EP5 A;  3O4N A;  4FZX C;  4PUO A;  3OY9 A;  4CJQ A;  4J2E A;  4M3Y A;  4CIE A;  3KKR A;  3ZSZ A;  3NE6 A;  4DSF A;  3SPZ A;  2D0B A;  4OLA A;  1RBT A;  2D0C A;  3CQ8 A;  1TL1 A;  4DTO A;  1NKC A;  4CJ3 A;  3IAY A;  5D3G A;  1EKE A;  1RDC A;  1J5O A;  1A5X A;  2RN2 A;  3AVL A;  1VSM A;  2XRI A;  4QAG A;  4LH4 A;  3I0R A;  3LZJ A;  5HRO A;  3RRG A;  3MXI A;  2VWJ A;  3OJU A;  4DU1 A;  3DM2 A;  4KRF A;  5SWM A;  3I8D A;  3PY8 A;  3U6F A;  2OPS A;  4KHU A;  1A5V A;  1BI4 A;  4CJT A;  1EP4 A;  4CFC A;  4DFP A;  4G1Q A;  3TR8 A;  2DTU A;  2HNZ A;  2AJQ A;  4DFJ A;  4CGH A;  1JLA A;  4Q5V A;  4CFD A;  1RDD A;  3K5L A;  4RW6 A;  4CCH A;  1VSL A;  1GOB A;  3ZSY A;  3AVB A;  4DFK A;  3SCX A;  2ATQ A;  2ZD1 A;  3ZSX A;  3OYH A;  4BE2 A;  1EX4 A;  4Z4F A;  4Z4E A;  3EYZ A;  3AVM A;  4RG8 A;  4CHY A;  3VA0 A;  3DRR A;  3TAQ A;  1IKX A;  3IS9 A;  1T05 A;  3K59 A;  2OA8 A;  4Z0U A;  4OPJ A;  3DOK A;  1R0A A;  1IKY A;  3M8P A;  4KV8 A;  3WNE A;  1J53 A;  2ETJ A;  4KTQ A;  1BL3 A;  3KTQ A;  3CFR A;  3UIQ A;  4NYN A;  4Z4H A;  3DRP A;  3AA3 A;  3AVJ A;  3L2U A;  1NK6 A;  4FJ5 A;  3CG7 A;  3HP9 A;  3QER A;  4EZ9 A;  1S1U A;  4CJU A;  4FK2 A;  2JGU A;  5E41 A;  2PZS A;  4O4G A;  1I39 A;  2OYQ A;  4NCG A;  4CF2 A;  4CJR A;  4DTX A;  2F8T A;  1VSJ A;  1WN7 A;  2XY5 A;  4O5B A;  1FK9 A;  4OJR A;  2DY4 A;  1JXE A;  1KVC A;  4JRP A;  1L3S A;  1JL1 A;  3LP1 A;  2DFE A;  1J9A A;  1S1V A;  3NF8 A;  4FW2 A;  4CJF A;  3OYL A;  3OS2 A;  2LSN A;  1W9H A;  1IO2 A;  3TAF A;  4CJV A;  3KJV A;  1D5A A;  3U3Y A;  4BAC A;  1RDB A;  4DSJ A;  2QXF A;  5KI6 A;  2HHU A;  4JS5 A;  4J2D A;  3ZSO A;  4CES A;  4IG0 A;  2KFZ A;  3LAN A;  3VQ9 A;  4CHQ A;  3SQ4 A;  4FLW A;  1D8Y A;  1SUQ A;  3VQP A;  4FK4 A;  1UA0 A;  4IDK A;  4DTN A;  4BWM A;  4DTU A;  4E0D A;  2YV0 X;  3PX6 A;  2D5R A;  4KB1 A;  1HNV A;  4OGC A;  1JLG A;  1TKT A;  3SNN A;  4DU3 A;  3L2W A;  5CY4 A;  4FM2 A;  3TAN A;  3QIN A;  1TKZ A;  1T03 A;  2RF2 A;  1L3V A;  3VQ7 A;  4E19 A;  3M8Q A;  4LY7 A;  3B6P A;  3OVN A;  2YNI A;  1MU2 A;  1S1W A;  3QIP A;  1S1X A;  2G8H A;  3KKS A;  4QOZ B;  3PO5 A;  3CFP A;  4FJ9 A;  4QCL A;  4E7J A;  3QEW A;  1JLB A;  1TGO A;  3NH1 A;  2W42 A;  1QTM A;  2IC3 A;  4DG1 A;  4TSX A;  2Y1J A;  3THV A;  4H8K A;  3CM5 A;  2OZM A;  4DQI A;  4M3Z A;  1CZB A;  2GBZ A;  3KLE A;  1RNH A;  3BGR A;  3PUF A;  3VQ4 A;  3VQD A;  1HQE A;  3PO4 A;  4KI6 A;  3MAQ A;  3HJF A;  2B6A A;  4KO0 A;  4N47 A;  3U3G A;  4HVJ A;  1BQN A;  3KLG A;  3D0P A;  1C0M A;  3LZI A;  4BE0 A;  4ZTJ A;  1XHZ A;  3O4Q A;  4NCA A;  4HHT A;  1RBS A;  1VRU A;  4DLG A;  3V4I A;  1VSE A;  2PY5 A;  3L3V A;  2HHX A;  1RT5 A;  1TL3 A;  4CEC A;  1RT3 A;  3DLE A;  4O44 A;  3DLK A;  4HUG A;  3SUO A;  1TK5 A;  3V9Z A;  3V1O A;  3HXM A;  3SZ2 A;  4I2Q A;  1JKH A;  4E1M A;  1KFS A;  4B9T A;  3OYI A;  1LV5 A;  3OYG A;  4DMN A;  3V1R A;  1KFD A;  3MEC A;  4OPK A;  1L3U A;  4C8L A;  2DFH A;  1ZYQ A;  1D9F A;  3AA4 A;  2HND A;  4FLY A;  1CLQ A;  1JLQ A;  1ASW A;  1IH7 A;  1ZBH A;  1F21 A;  1BCO A;  3V9U A;  5I3U A;  3OYB A;  1VSH A;  4M3W A;  3AVC A;  4RW7 A;  4JRQ A;  1FKO A;  4CEB A;  3DMJ A;  4CEF A;  5FDL A;  4DSL A;  2HB5 A;  1S1T A;  3VN5 A;  3V6D A;  3PX4 A;  3PV8 A;  4F3T A;  3C95 A;  3TAR A;  2HHQ A;  2GV9 A;  1C1B A;  4O0J A;  4IKF A;  3VQ6 A;  2FBT A;  1ASV A;  4ELT A;  5HRS A;  1I3A A;  2XY8 A;  1WSG A;  1REV A;  1WAF A;  2B5J A;  2JLE A;  1BIS A;  4CK2 A;  4PWD A;  4CGG A;  1NK0 A;  4FJI A;  3HPH A;  3QET A;  4E89 A;  3V9X A;  1T8E A;  1TKX A;  3LAM A;  4CJP A;  3K57 A;  4DQS A;  4CGJ A;  2A1R A;  5DMR A;  2YNH A;  1CZ9 A;  4F2S A;  4C8M A;  2EX3 A;  4I2P A;  3ASM A;  4B9S A;  3L2Q A;  2EHG A;  3SI6 A;  2HHS A;  3HVT A;  2KFN A;  5HLF A;  3TAP A;  1QSL A;  1LW0 A;  1CXQ A;  4FZZ A;  1U04 A;  1KLN A;  4I9Q A;  2OPQ A;  4FLT A;  4CK3 A;  1WSH A;  3O3G A;  1JLF A;  3TAG A;  4KHY A;  4PQU A;  3RMC A;  3I0S A;  1RDA A;  4CEQ A;  5HRP A;  4FJ7 A;  1TV6 A;  1RBU A;  2YNF A;  3AO4 A;  3AVG A;  2G8I A;  1B92 A;  4M3X A;  4KKO A;  3OYC A;  1KVB A;  4LSN A;  4Z4G A;  1XC9 A;  3K5M A;  3MEE A;  3F73 A;  3RR7 A;  3ZSW A;  1SKW A;  4ELV A;  4O0I A;  4J2A A;  1W0H A;  4M42 A;  4CHN A;  5FRM A;  3NGI A;  3G0Z A;  3SJJ A;  3VQ5 A;  1GOC A;  1WSI A;  4B3O A;  3AO1 A;  4DTM A;  4OLB A;  2G8V A;  2Q3S A;  2KTQ A;  4DF4 A;  1L3T A;  3NGY A;  4WE1 A;  4LD0 A;  2G8U A;  1NJZ A;  3ALY A;  4CFA A;  4FCY A;  2G8F A;  2VG6 A;  2Z1I A;  2VG5 A;  3ISN C;  3OYE A;  4RW9 A;  3K5N A;  1Q9X A;  2R7Y A;  3KD1 E;  4F3O A;  3NHG A;  1TAQ A;  1DLO A;  2YHA A;  2BAN A;  1RTJ A;  4IBN A;  2PYJ A;  4LH5 A;  5I42 A;  2QKB A;  1FKP A;  4Z4I A;  1TK8 A;  3QLH A;  4EZ6 A;  1BQM A;  1ASU A;  3LAK A;  2B4J A;  1T7P A;  4K8X A;  4DQP A;  4GMJ B;  2A1S A;  4AHV A;  3QNO A;  3AA2 A;  2E4L A;  4CER A;  2KW4 A;  4YFU A;  4AHS A;  4YNQ A;  4CGD A;  2FBY A;  3FFI A;  5DK5 A;  1HRH A;  4AIL C;  4H4M A;  1KTQ A;  4KHS A;  3NBP A;  1XI1 A;  2P51 A;  3SV3 A;  2VWK A;  3OYD A;  4B9V A;  1RT6 A;  3T1A A;  3TAM A;  4CIG A;  3HT3 A;  2FC0 A;  4MFB A;  3PX0 A;  1NK5 A;  3HST B;  3WNH A;  3TAB A;  4M3U A;  3OYK A;  3WNG A;  4DTS A;  3OS0 A;  2OZS A;  2O4I A;  1UWB A;  1S6P A;  3L2V A;  1WSJ A;  2BDP A;  4DS5 A;  5J2P A;  3SV4 A;  2RKI A;  4OKE A;  3MXM A;  4DU4 A;  5KGX A;  4K8Z A;  2WOM A;  3S9H A;  3K58 A;  4CJK A;  1HNI A;  3EY1 A;  2HHT A;  4B9N A;  2WON A;  4HTU A;  3C94 A;  4N41 A;  3NF7 A;  1O1W A;  3NH0 A;  1VSD A;  3ZSQ A;  4KAZ A;  3HVR A;  2X74 A;  3AVH A;  1NJY A;  2X6S A;  3VQQ A;  3OYA A;  4W5Q A;  1Q8I A;  3LWL A;  5CZ2 A;  4UQG A;  3JSM A;  1RTH A;  1QE1 A;  3ULD A;  3ZT4 A;  4DS4 A;  1ZBL A;  2BGG A;  4Q0B A;  3TI0 A;  4CHP A;  4KPY A;  4KHQ A;  3P83 D;  5J2M A;  1HYV A;  2XY7 A;  1VSI A;  4FLV A;  4AHR A;  4CGF A;  4B9U A;  4FJG A;  1HYS A;  4M41 A;  4ID5 A;  4CJ5 A;  1U4B A;  1SV5 A;  4ID1 A;  3SUQ A;  4F8R A;  3DYA A;  4HCC A;  4FLU A;  1B9F A;  1TK0 A;  2P5G A;  2HVH A;  3BDP A;  5FRO A;  3A2F A;  1U48 A;  1NK9 A;  4AHU A;  4B8A B;  2FBV A;  1UAX A;  1EET A;  3HPG A;  1QQC A;  1N5Y A;  4OGE A;  4CF8 A;  1SL1 A;  2G8K A;  4CF1 A;  4MQ3 A;  3OYN A;  3KLF A;  2ZE2 A;  2E6L A;  1SL0 A;  2P5O A;  1C1A A;  3HYF A;  3LPT A;  1KRP A;  1EXQ A;  4FYD A;  1RIL A;  4PA1 A;  3VQE A;  2Z1H A;  4CFB A;  3K5O A;  5C42 A;  1BCM A;  1RBV A;  4JLH A;  3TAE A;  1RT7 A;  2E6M A;  3C6T A;  3ZCM A;  4CEE A;  4ZTF A;  3NFA A;  4DF8 A;  2I5J A;  4N76 A;  1FXX A;  4Z4C A;  4M3R A;  2YNG A;  1QSS A;  1JLE A;  3V9S A;  4CHZ A;  1RTI A;  1Z25 A;  4CEO A;  3M8R A;  1JLC A;  1LWF A;  4AH9 A;  1X9M A;  1IKW A;  2QKK A;  4FW1 A;  2YKM A;  1NJW A;  3VQC A;  4FJM A;  2OPR A;  1VK0 A;  2QK9 A;  3K2P A;  5HP1 A;  4BDZ A;  1HMV A;  3ITH A;  1LAV A;  3QEI A;  4ICL A;  3AVI A;  3VA3 A;  1WSF A;  1XWL A;  5T7B A;  3LWM A;  2BE2 A;  4FJK A;  3NF9 A;  2HHV A;  3DOL A;  4DFM A;  3OYF A;  3P1G A;  1BGX T;  1YT3 A;  3HL8 A;  1A5W A;  3V1Q A;  1LWC A;  3AA5 X;  3DLR A;  5FRN A;  1IG9 A;  4DQR A;  4CGI A;  3AVN A;  3LAL A;  4FVM A;  4Y1D A;  3VQ8 A;  3RMB A;  4AHT A;  4OKJ A;  3V9W A;  1X9S A;  3DLG A;  4FZY A;  4N5S A;  3SUN A;  1Q9Y A;  4I7F A;  4KHW A;  1WNS A;  4EP4 A;  1NKB A;  4DTR A;  3QO9 A;  4FLX A;  1DTQ A;  1CXU A;  4R5P A;  3HPO A;  1SKS A;  2D0A A;  4OKK A;  1VSK A;  3QEV A;  5HBM A;  3SQ2 A;  3SYZ A;  1NJX A;  4B08 A;  3SQ0 A;  5C24 A;  4CF0 A;  4DWI A;  1NK4 A;  4AHC A;  1J54 A;  1RBR A;  4GVM A;  2IDO A;  4BDY A;  1RT2 A;  3S3N A;  5J2N A;  1U45 A;  4B9M A;  2HNY A;  1B9D A;  2YHB A;  4GW6 A;  1HYZ A;  4M3T A;  5HRR A;  1N6Q A;  1IKV A;  3O3H A;  1RT4 A;  5CYQ A;  4KRE A;  4HCB A;  1NOZ A;  2GUI A;  3L2R A;  3QNN A;  1NK7 A;  4DSI A;  4RW4 A;  4CED A;  3DI6 A;  4KI4 A;  2FBX A;  1JXB A;  4E7L A;  1SKR A;  3O3F A;  2IOC A;  3SUP A;  4KHN A;  3MED A;  2RPI A;  4CEA A;  3NGZ A;  1QS4 A;  3DLB A;  1WLJ A;  4Y1C A;  3OS1 A;  4N56 A;  4DSE A;  4FLZ A;  5J1E A;  3OYM A;  1LW2 A;  1YVU A;  3ZT1 A;  4FJJ A;  5JS1 A;  2XY6 A;  1JL2 A;  4W5N A;  1HQU A;  3AVK A;  2IS3 A;  3ZT3 A;  3OJS A;  4F2R A;  1Y97 A;  3KIO A;  1X1P A;  3SPY A;  1S9G A;  3KK3 A;  2G8W A;  3LP3 A;  4CEZ A;  5C25 A;  2DFF A;  4DSK A;  4CF9 A;  3D45 A;  4CJ4 A;  1KCF A;  5SZT A;  2X78 A;  4IFY A;  4FM1 A;  4FXD A;  3CM6 A;  5K14 A;  3DRS A;  4FJ8 A;  1U47 A;  4KTW A;  4O55 A;  4DTJ A;  1RCH A;  4C8O A;  2YKN A;  1QHT A;  1NK8 A;  3LPU A;  1C1C A;  4I9L A;  4ELU A;  4B8C A;  1BI4 B;  3NAE A;  1QSY A;  4M45 A;  1ZBI A;  1TAU A;  1G15 A;  3OYJ A;  1XHX A;  4BDP A;  3DLH A;  4L8R B;  4BWJ A;  4CK1 A;  2O4G A;  5CZ1 A;  3HM9 A;  5J2Q A;  3LDS A;  3SQ1 A;  4DLE A;  3HP6 A;  3ZT0 A;  3IG1 A;  3T19 A;  4IG3 A;  4W5O A;  3KD5 E;  3AO5 A;  3RMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...