3K2PA

Hiv-1 reverse transcriptase isolated rnaseh domain with the inhibitor beta-thujaplicinol bound at the active site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase
molecule keywords Reverse Transcriptase
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3k2pA00
2D5RA 4B08A 4C8KA 2XHBA 4KKOA 4E1MA 3HL8A 3ZSWA 4KTWA 4FLWA 1NK6A 4DG1A 3IAYA 4EZ9A 1BIZA 3DYAA 1I39A 3KLEA 4BE2A 2XY5A 4F3TA 5FROA 4CIGA 4W5QA 2XY7A 2OZSA 4DFKA 2VG7A 2QKBA 4W5RA 3MXIA 4PWDA 2BE2A 3AVCA 3CM6A 4Z4EA 2YNGA 5KI6A 1A5XA 4CK1A 3L2RA 4DTXA 1WLJA 2HHTA 1NOYA 2P51A 1SV5A 4NCAA 3CFRA 1ASVA 1NK0A 5J2PA 1JXBA 2OYQA 4JRPA 1QSYA 1ZBFA 2ZE2A 4OKKA 1BQNA 2XY8A 4N41A 1TGOA 1T8EA 2FBVA 1J54A 3ZT1A 3LZIA 2X74A 3AO4A 3NE6A 4FJKA 4FZZA 2HNZA 2GBZA 4O44A 4M3TA 1QSSA 3OS2A 1ZBIA 3QLHA 2IS3A 3K5NA 3OYAA 4E7KA 2KZZA 4CJLA 5FRNA 3ZSYA 5CY4A 4C8MA 2Z1IA 1X1PA 4RW6A 1HYVA 2G8IA 3DRPA 1QQCA 1WN7A 1JLBA 4I2PA 4O0IA 1SKRA 4DSLA 4J2AA 3ASMA 3ZSZA 4CEZA 4RW9A 1SL0A 4H4OA 3OYMA 1SUQA 1KCFA 1S6PA 2IC3A 1KLMA 3V1QA 3MAQA 3KD5E 3DMJA 4RW7A 2NUBA 4E0DA 3C94A 4HUFA 4IKFA 3L2VA 4CEQA 1CZBA 3O3HA 1U04A 4KPYA 3VQEA 1KVCA 3DLHA 4BDZA 1S1UA 3O4NA 4C8NA 3OVNA 4OPJA 2R7YA 1TV6A 3SUQA 2X6SA 3AVHA 4JLHA 5KRTA 1ZBUA 3S9HA 3QEIA 3MXMA 4DFJA 3CFOA 4R5PA 1CZ9A 3KJVA 4FM2A 3ZSOA 4GMJB 2HHWA 1C0UA 3TAEA 2D0CA 3QIPA 1IH7A 1L5UA 2HVIA 4OKJA 3OS1A 4FJIA 4DF8A 4M3UA 1O1WA 5KGWA 3VQAA 3C95A 4MQ3A 4FVMA 3CQ8A 3IS9A 2XY6A 1NK9A 3RR8A 2PZSA 1RT5A 3OYJA 3V81A 1WSJA 3AV9A 4G1QA 4CJSA 4M3YA 4CGJA 3OJSA 4DSFA 1REVA 4KTZA 4ICLA 4CJQA 4M3WA 4EZ6A 2DFEA 4FJNA 5CYMA 3OYGA 2Z1GA 3WNEA 3L2WA 1UAXA 3PV8A 3SI6A 1NKEA 1HMVA 3MEGA 5C25A 2ZD1A 4E7JA 4KB1A 3LDSA 1WSGA 1B9FA 1R0AA 3PX4A 1JL2A 1NJXA 2G8VA 3HSTB 5DMRA 1ZBHA 2KQ2A 1RT1A 1JLCA 1HNIA 5EU7A 3I0RA 3EZ5A 5T7BA 1ZBLA 3NF9A 2P5GA 4CK2A 4DU1A 4HHTA 3QEWA 1IKVA 4CGGA 4N5SA 4CK3A 3SV3A 4UQGA 4FLZA 1NK4A 3HM9A 2ATQA 3LAKA 1RBUA 4N76A 4FJ5A 3ZSVA 3MXJA 3ISNC 4GVMA 2PY5A 3PX6A 3AA5X 4KAZA 1LWFA 1TKZA 1TK0A 1KRPA 3IRXA 1RBRA 2KW4A 3AVJA 4RG8A 1EXQA 3V1OA 1BCOA 4CF9A 3OYDA 2IGIA 3HYFA 1CXUA 3RMAA 4H8KA 3JYTA 4QOZB 1WNSA 3IG1A 3EY1A 1DTTA 3G0ZA 3I0SA 4FJ9A 5JS1A 3NF6A 1LW0A 1RDCA 2BANA 2DY4A 4JS4A 4F3OA 2WONA 3HK2A 1BHLA 1T7PA 4Z4HA 4Z4FA 3ZCMA 3BDPA 2HHXA 1D8YA 4FXDA 2DFHA 3LANA 4DMNA 1C1AA 5KGXA 1K6YA 3MECA 4CJVA 2RPIA 4N56A 3HP6A 3K5LA 4CJ5A 1YTAA 4O55A 1ZYQA 2BGGA 3NGIA 1U4BA 4IFVA 4E1NA 4OGEA 4E89A 4DS4A 3PX0A 3DLRA 3HT3A 3RMCA 3QETA 3SPZA 4DFMA 2OPPA 3RMBA 1KTQA 4CHZA 1XI1A 4IG3A 3OY9A 4B9MA 4CE9A 1U45A 5J2QA 4MFBA 2IAJA 3ZSQA 4KHWA 1ASUA 1BIUA 5KTQA 1LWEA 1VSEA 1IO2A 2YV0X 1XC9A 1GOBA 3CG7A 3HVRA 2YNHA 3L8BA 2A1RA 3NBPA 3HVTA 4O5BA 1L3UA 3NH1A 4CJUA 2EX3A 1HPZA 4FM0A 3AVAA 4DTNA 4K8XA 3D45A 3SQ2A 1RBVA 3SUPA 2YKNA 3LWLA 1L3TA 3L3UA 4FM1A 3KLHA 5J1EA 3RTVA 4AHSA 1LAVA 3D0PA 3T3FA 5E41A 4NCGA 4FCYA 3SJJA 4M42A 3L2UA 3PO4A 3PUFA 3SV4A 1NK7A 2EHGA 5HRSA 4DQPA 2QXFA 3ZSRA 3TWHA 1IKYA 4CJRA 2OA8A 3E01A 4KFBA 3HO1A 4KV8A 4AHVA 4FJGA 1LWCA 1ITGA 4HUEA 3V9ZA 2F96A 4CEFA 4E7LA 4Z0UA 3LP1A 4CECA 4CEAA 3NCIA 1UWBA 3S3OA 3LPTA 3M8RA 4BDPA 4QAGA 3QNNA 3AO3A 1TKTA 4DU4A 1Z26A 2OPQA 4YNQA 3AVLA 4DTOA 4B8AB 3SQ0A 1WAFA 3B6PA 3K58A 2GUIA 3KK3A 4DQRA 4CF8A 4F4KA 4ZTJA 1T05A 2PYLA 5CZ2A 3KK1A 3V1RA 3O3GA 1RBTA 1D9DA 1J5OA 3DRRA 3V9SA 4CGDA 4B9UA 2HW3A 4I9LA 3JSMA 2F8TA 4CJEA 1JLFA 3LP2A 3V9UA 3OYNA 4EP4A 2I5JA 5C24A 3OJUA 3THVA 1VSMA 2ETJA 3A2FA 3AVGA 3OS0A 1X9WA 2HNDA 5HP1A 1NK5A 1NKBA 1WSEA 3SYZA 4CFAA 3ZT4A 3NGZA 3VQ7A 3MEDA 1D5AA 4CJPA 4ZHRA 3SCXA 1SL1A 1LV5A 4FJMA 1J53A 1JLGA 3V4IA 4DQIA 3AVMA 4KREA 4JRQA 4FJXA 1IKXA 1ASWA 4CEBA 4B9VA 1XWLA 1HJRA 1N5YA 3NGYA 4FLUA 4DTMA 3LPUA 3P83D 2G8HA 3HXMA 4KI4A 2GV9A 3SUNA 3OYEA 4DQQA 1B92A 4LD0A 1KFSA 1RBSA 1J9AA 3AVBA 1EKEA 3SQ1A 1IKWA 2B6AA 2P1JA 5HRNA 3KTQA 5I3UA 3VQ9A 3AA4A 4KB0A 4FYDA 4OGCA 1C1CA 4B8CA 4DTSA 1GOCA 4DSIA 4RW8A 2QK9A 4IBNA 2Y1IA 2E6LA 3HPGA 2Q3SA 4DSJA 2W42A 4E7IA 5DK5A 3RR7A 3AVFA 3VQ6A 4LH4A 3SQ4A 4PY5A 3NH0A 1NKCA 2YNFA 4CFDA 3M8PA 5CYQA 3U3YA 1RT6A 3RRHA 3LALA 2HHUA 4CHOA 3T1AA 3ITHA 3G10A 1A5WA 3K2PA 2RKIA 4B9SA 4DU3A 3M8SA 4J2BA 1RILA 1DLOA 3OYIA 1VSHA 4CFBA 3NF8A 4CEDA 3RWUA 4KHSA 3B6OA 2KFZA 3NH2A 4NCBA 2RF2A 4ELTA 3U6FA 3OYCA 3O3FA 1S9EA 4LH5A 2D0AA 1RT7A 2X6NA 4E19A 4CF0A 4CHPA 1WAJA 4ZTFA 2HB5A 3DRSA 3TABA 3UIQA 3AVNA 4DF4A 1C0MA 4B9LA 1JLAA 3H08A 4BACA 4PA1A 3VQBA 2JGUA 4CJ4A 2DTUA 1W9HA 3S3MA 1TL3A 3EYZA 4OJRA 3O4QA 3C6UA 1S6QA 4J2EA 2B4JA 5KRSA 4L8RB 3LZJA 4DTJA 3AVIA 5SZTA 1S5JA 4N47A 3VN5A 1RT2A 3VQ8A 1IG9A 4C8LA 4FJJA 3DM2A 4OPKA 3HPHA 4O0JA 2X78A 3AO5A 5JS2A 3TAPA 3RRGA 4BWMA 4KHQA 1EETA 1TL1A 4FK2A 4CHNA 3PY8A 2B5JA 3NDKA 3ZSXA 4CJWA 3K57A 3M8QA 1T03A 2YHAA 1N6QA 3QERA 3QINA 2HHQA 1EX4A 3KLFA 4DSKA 3ZT0A 1VRTA 4F2RA 1C1BA 4FJLA 2XRIA 3KIOA 5SWMA 1BISA 1I3AA 4FLTA 1RTHA 2KFNA 2HHVA 1RTDA 5HRPA 4TSXA 5HRRA 4M41A 1UOCA 5J2MA 5CZ1A 1VSDA 3VQQA 3KD1E 1WSIA 3NAEA 2E4LA 3K5OA 1L3SA 1S1WA 4M45A 3QO9A 4FZYA 1JKHA 4DWIA 3V9WA 1HNVA 2YHBA 2FC0A 4CJTA 3LP0A 4OVLA 4EP5A 1VRUA 1DTQA 4CJFA 4CHQA 4E7HA 1RDBA 1RTIA 2JLEA 1VSIA 4RW4A 3NHGA 4CF1A 4AHUA 4CEOA 3K59A 4BDYA 4LSNA 2HMIA 3PO5A 4FLYA 4PUOA 1JL1A 2G8WA 3TAMA 3VQDA 4DSEA 4HCBA 4CF2A 1HQEA 1NJYA 2F8SA 2ZQBA 2FBYA 1F21A 1SL2A 1W0HA 4WE1A 4K8ZA 1X9SA 4ID5A 4IFYA 4HCCA 4FJ8A 1KSPA 1BCMA 2OPRA 1FKPA 3TANA 1BGXT 3I8DA 1MU2A 3DLGA 3DLKA 3VA3A 4F2SA 3C6TA 4Y1CA 4YFUA 1UA0A 2HHSA 1LAWA 2AJQA 3TARA 3VQCA 1JXEA 4W5OA 1HQUA 1FKOA 2IDOA 4ELUA 2QKKA 4KHYA 2KZMA 1QSLA 2FBTA 3DLEA 5HBMA 3TAQA 2HNYA 1KVBA 3BGRA 1VSJA 2VG6A 4B9NA 4Q5VA 3WNGA 1YVUA 4OKEA 3P5JA 3KK2A 1SKWA 4Q0BA 3AO2A 1QE1A 1QHTA 2DFFA 4ELVA 1Q8IA 3WNHA 4CERA 1UA1A 1QS4A 5J2NA 4M3RA 1VSLA 1JLEA 1S9GA 2FBXA 4HTUA 5K14A 1FXXA 4LY7A 2PYJA 4DTRA 3ZT3A 4E3SA 4CGIA 3SPYA 4DS5A 1NJZA 2HVHA 3OYBA 3QEPA 4DFPA 2O4GA 1RT4A 4IDKA 5D3GA 1VK0A 3QEXA 1RT3A 3ZT2A 1U49A 4HVJA 4M3XA 3VQPA 1C6VA 4GW6A 3WNFA 4AHCA 3F9KA 3ULDA 2OPSA 3OYLA 3K5MA 1HYZA 3AVKA 4KRFA 1BI4A 4I2QA 3DOKA 4AHRA 1YT3A 4W5TA 3DI6A 4C8OA 1G15A 1QTMA 4DLGA 1CLQA 1C0TA 5FDLA 5C42A 4AILC 1TAUA 3HP9A 2BDPA 2OZMA 3QESA 4BE0A 2Y1JA 1A5VA 2KTQA 4FK4A 3LP3A 1RDDA 3TI0A 4O4GA 1CXQA 1WSFA 3V6DA 3DLBA 1JLQA 4W5NA 4HUGA 3FFIA 1Z25A 3TR8A 2D0BA 4NYNA 4Y1DA 4FJ7A 4Z4GA 1Q9XA 1WSHA 4BWJA 2RN2A 2A1SA 3VQ5A 1RTJA 4LSLA 2E6MA 2Z1JA 4H4MA 4FW1A 4AH9A 4DQSA 3HJFA 4KO0A 3HPOA 4FLVA 1EP4A 4CHYA 1RNHA 4KHNA 3TAGA 4CESA 1BQMA 1S1TA 1NJWA 1U48A 4M3ZA 1KFDA 3AA3A 4IG0A 2XO7A 5HLFA 4FK0A 4CCHA 3AA2A 3QNOA 3S3NA 2VWKA 3VQ4A 4CJ3A 3TAFA 4AHTA 4B3OA 3MEEA 1YTUA 4CGHA 3DOLA 3F73A 1X9MA 5FRMA 2LSNA 3NFAA 4I9QA 5I42A 1TK5A 2Z1HA 1TKDA 4CGFA 4PQUA 2ITGA 1Q9YA 1HYSA 1S1VA 4FJHA 4KTQA 4ID1A 1KVAA 1FK9A 2G8FA 3CYMA 3SZ2A 1TK8A 3QEVA 1LW2A 1HRHA 1RDAA 3T19A 3AO1A 1NK8A 2WOMA 4CIFA 3KKRA 1S1XA 2YNIA 3VA0A 2P5OA 1BI4B 1RCHA 3LAMA 4FW2A 3OYHA 4BE1A 4CJKA 3OYFA 4B9TA 3RMDA 4KHUA 4DTUA 4OLBA 1XHZA 3L3VA 1VSKA 3LWMA 4KI6A 4FLXA 1KLNA 1B9DA 2G8KA 1XHXA 3NF7A 1TAQA 2YKMA 4Z4IA 1GOAA 3KLGA 1U47A 3QIOA 4J2DA 4FZXC 2VG5A 1VSFA 4CFCA 3KKSA 4I7FA 2VWJA 1SKSA 1NOZA 1Y97A 4DTPA 4JS5A 1BL3A 4DLEA 3CFPA 4OLAA 3SUOA 3SNNA 1TKXA 3U3GA 3KLIA 1L3VA 1D9FA 3P1GA 4XIUA 2G8UA 5HROA 2O4IA 4F8RA 4Z4CA 3CM5A 1TVRA 3L2QA 3V9XA 4NYFA 4CIEA 4QCLA 3OYKA 2IOCA 4CEEA 3ALYA
chains in the Genus database with same CATH superfamily
4YY3K 4C8KA 4KKOA 4E1MA 1M1KO 4EZ9A 1QHAA 2EWSA 4KTWA 1OH7A 1KAXA 1BIZA 1I39A 3DJCA 4CIGA 3FZFA 4RTFD 4B1UB 4W5RA 3AVCA 4Z4EA 2YNGA 1A5XA 1EQYA 3M5RA 4DTXA 2HHTA 4BROA 4DR7K 2HMPA 5J2PA 1GLEG 1BO5O 1QSYA 4N41A 4B1ZA 1BQNA 2XY8A 2FBVA 3ZT1A 4FZZA 3AO4A 4FJKA 2E2NA 2GBZA 5LL6Z 3QLHA 3K5NA 2YHXA 2W6LA 3ZSYA 3QBXA 3JAMO 4RW6A 1QQCA 3H3NO 4O0IA 1C0FA 3ZSZA 4RW9A 1VQ5N 2IC3A 3MAQA 3M1FA 4A2AA 1W2BM 4KPYA 1KVCA 2WBNA 4OPJA 3OVNA 2E1YA 5BRFA 2HHWA 1C0UA 3EKUA 3O6WA 3QIPA 1IH7A 1L5UA 3OS1A 3ID6A 3C95A 3LDNA 4FVMA 2XY6A 3V81A 3AV9A 4G1QA 2GUPA 4CGJA 4DSFA 1QZ6A 4FSVA 4C1NI 1TYQB 4FJNA 3MCAB 3RSEA 5AQHA 3PV8A 3SI6A 3MEGA 2ZD1A 4JD2A 4X66K 1WSGA 4IEEA 3PX4A 1JL2A 3N4PA 3VEXA 1NGCA 1HNIA 3I0RA 5T7BA 2O8BA 2H3GX 4CBUA 3QEWA 4JKDA 4CGGA 5AQSA 4NXMK 4N5SA 3VEOA 3HM9A 2ATQA 4N76A 1NBWA 4A62A 5AQXA 4IO9L 3ISNC 4FWKA 3PX6A 4KAZA 1LWFA 4B1YB 1YXQA 1RBRA 4WYBA 4EHUA 1Z6RA 2O8EA 4DR4K 2KW4A 3V1OA 1BCOA 4CF9A 2IGIA 3RMAA 2P9NB 3CD6N 3P4IA 4A5AA 3G0ZA 1XC3A 1RDCA 4H0PA 4Z4FA 3ZCMA 4PL7A 1KQSM 4FXDA 5CR4A 2DFHA 2HHHK 3MECA 3ENOA 4N56A 3HP6A 1MWMA 4BRDA 4IZ9A 1N34K 4PKHA 3NGIA 5AQLA 3SBTA 4E1NA 4DS4A 4BR9A 3RMCA 3Q7BA 3SPZA 1OVYA 1KTQA 4CHZA 1ATNA 4IG3A 3OY9A 4MLEA 1U45A 2IAJA 1BIUA 1VSEA 2YV0X 1GOBA 3HVRA 4CJUA 2V7YA 3VEZA 1YITN 2NRXA 1VQ9N 3J81O 3SUPA 3LWLA 5EOYA 1YUWA 4YDUA 4WFAL 4AHSA 3T3FA 4M42A 4DV1K 3L2UA 2EHGA 3FR0A 4JI7K 5AQRA 3EKSA 4NO7A 4LF6K 4KV8A 4YOTA 5BPLA 3QFUA 5BR9A 2P9NA 3S3OA 4CD1A 4GVEA 4ELUA 3QNNA 5JICA 3CERA 4BRPA 3ATVA 3KK3A 4CF8A 2FLOA 3V1RA 1RBTA 1ATSA 3V9SA 4CGDA 3JSMA 1JLFA 1VSMA 5AQYA 2F4VK 1P90A 3NGZA 1OVQA 4ZHRA 1SL1A 2GTDA 4DQIA 4KREA 3WUHA 4FWMA 4GV9A 4DTMA 3B8AX 1KFSA 1RBSA 1J9AA 5AQGA 3O4WA 5HRNA 4IDHA 5I3UA 2D4WA 5EXWA 3AA4A 3F2KA 4OGCA 3OBWA 1KXPA 4RW8A 2QK9A 4K0KK 1VQ4N 2E6LA 1GLJO 2YNFA 3LALA 2HHUA 3MMVA 4PKIA 3GL1A 3T1AA 3ITHA 5JLHA 3P31A 5LMUK 3K2PA 2RKIA 4DU3A 2JWKA 4KHSA 3ZX3A 3CC4N 1K9MO 3O5BA 4JI2K 2A42A 1RT7A 4CHPA 1RDWX 3RVCA 3A5MC 5AZJA 3TTCA 1NWKA 3S3MA 4AM7A 1WB9A 3C6UA 1S6QA 4JKGB 4EFHA 4L8RB 5F2RA 3MN6A 3KWGA 1NGDA 4N47A 3VQ8A 4CZIA 3KK7A 4FWNA 3DM2A 3HPHA 4CZMA 3C7NA 1TL1A 3PY8A 2B5JA 3ZSXA 1W97L 4F2RA 5AZIB 4JK9A 4FVUA 4IOCL 4CJ7A 2P9SA 4JKEA 1RTHA 4JK8A 1BU6O 3T69A 1RTDA 4V19S 4LC9B 4JAXA 1L3SA 1HNZK 1S1WA 1O13A 3QO9A 4DWIA 1HNVA 4PKGA 2YHBA 4OVLA 4CJFA 4CHQA 1RDBA 4BDYA 3NHGA 4AHUA 3PO5A 3P38A 2HMIA 5KPZA 2IIRA 3VQDA 4HCBA 1NU0A 1NJYA 2F8SA 1NGFA 4WE1A 4K8ZA 2PAVA 1KSPA 2OPRA 4NLCA 4IO8A 1S72N 3IKMA 3NVKA 4M7XA 3DLKA 2HHSA 3C6TA 1Z05A 1JXEA 4W5OA 1FKOA 3O1WA 2NRTA 1K73O 3WNGA 3QMLA 1IV0A 1YVUA 4Q0BA 3E1YA 3FZHA 4BQLA 3WQUA 4H0OA 1JLEA 2FF6A 2PYJA 4LY7A 3BZCA 1ILYA 4CGIA 3SPYA 4JK7A 1NJZA 4R79A 3QEPA 4FWPA 4NB4A 3C65A 4WCEL 5D3GA 3QEXA 4WFBL 4HVJA 5IWAK 3ZX0A 2VCPA 3AVKA 3VGKA 1BI4A 4AHRA 3DOKA 1NLVA 4DV6K 1YT3A 3MK6A 4W5TA 4C8OA 5FPEA 4DLGA 2QWMA 3HP9A 2BDPA 2OZMA 3QESA 2IVNA 4BRFA 5ADXH 3CMEN 4FK4A 2E2OA 2P9UB 4O4GA 1CXQA 4B1XB 3O9UA 3EL2A 2D0BA 4NYNA 3FFKB 4FJ7A 4WF9L 4FOIA 1Q9XA 1WSHA 4IFEA 1BDGA 4XEIA 4LSLA 4BRNA 4FW1A 5AQPA 1QZ5A 4JNEA 1BQMA 1OKJA 1NJWA 1U48A 5HLFA 4KBOA 4FK0A 3UB5A 3CCVN 4KH5A 3O9QA 3EE9A 2VWKA 1S3XA 5AQKA 3THXA 4CGHA 1X9MA 2LSNA 2Q0UA 4PQUA 2Z1HA 1Q9YA 1DKGD 3VF6A 4KTQA 4ID1A 3VTIA 2G8FA 1N33K 1LW2A 3AAQA 1RDAA 3AO1A 2WOMA 3LM9A 4CZFA 4CIFA 3KKRA 3CCLN 4FL9A 3SAGA 3RMDA 4DTUA 4OLBA 1XHZA 1N36K 1VSKA 3ZEUB 1KLNA 2RE2A 3ZLJA 2YCHA 4Z4IA 3IFRA 4FZXC 2PBDA 2VG5A 3UKRB 3KKSA 2D0PA 1GLCG 1NOZA 2D0OA 4KHPK 4OLAA 4PHTX 3SNNA 3AARA 3ID8A 3KLIA 3CM5A 1TVRA 5AQVA 4CIEA 4QCLA 4CHOA 3PLAA 2XHBA 4O5FA 3HL8A 1XNQK 3ZSWA 3IUCA 3KLEA 1ZXOA 2F9WA 2O8FB 3TTFA 3J7ZO 2OZSA 2VG7A 4BRCA 2BE2A 3CM6A 4FPBA 3FGUA 3L2RA 3D7EO 4LF5K 2NRVA 1NOYA 3A8YA 3CFRA 1ASVA 1JXBA 1FJGK 2ZE2A 5JLFA 1TGOA 4XH4A 3LZIA 3OS2A 1EWRA 2RHKA 4E7KA 1XQSC 4CJLA 4O8KA 1U2VA 2O8CB 5FLXO 4J2AA 3CCQN 4I2PA 1SKRA 4WQ4C 5LY3A 1SUQA 1YVNA 2NUBA 4HUFA 4CEQA 1G99A 3VGLA 1U04A 3W3DA 1QVFM 1TV6A 3S9HA 1ZBUA 1IJJA 3CFOA 1CZ9A 4FM2A 3VGMA 3TAEA 4B1VA 2HVIA 4LF9K 4DF8A 3OA9A 3ULEA 3Q7CA 4MQ3A 4A59A 3IS9A 1K8KB 2PZSA 1T6DA 4BC2A 3THYA 3CJ7A 4CJSA 4U7BA 3OJSA 4M3YA 3LL3A 2QEXN 4EZ6A 2GWJA 2FXUA 2VGMA 2Z1GA 3L2WA 2OTJN 4KB1A 3LDSA 3U8XA 1HPMA 1VQPN 3HSTB 2KQ2A 1RT1A 3ZETA 3VESA 4A2BA 1VQNN 1ZBLA 3NF9A 2P5GA 4DU1A 4HHTA 1IKVA 3SV3A 4FLZA 4I6MB 4JI1K 4LFCK 3LAKA 1RBUA 4WQ5A 3MXJA 4GVMA 4JHDB 2PY5A 2FF3B 2QWPA 3IRXA 2A6AA 4IOAL 4AQYK 3HYFA 4H8KA 3SMPA 4DV3K 3JYTA 5GAHP 4QOZB 3EY1A 5JS1A 3NF6A 4O8UA 2DY4A 4JS4A 4JEPA 1Q82O 4Z4HA 1D8YA 3LANA 4YHHK 5KGXA 1K6YA 2I7NA 4CI6A 1YTAA 2BGGA 1U4BA 2KKZA 4ILHA 3N4QA 3ZX2A 3EZWA 1HKCA 3QETA 4DFMA 1XI1A 3R9PA 4B9MA 1YAGA 3CJ1A 4MFBA 5KTQA 1XC9A 1E4FT 2YNHA 3NBPA 2FSJA 3D2EB 5GAGP 3NH1A 1HPZA 3AVAA 4GKJK 3D45A 2YKNA 2ASPA 3L3UA 2GELA 5J1EA 3SJJA 1LAVA 5E41A 4NCGA 3SV4A 5HRSA 5M1OA 1IKYA 5LJWA 4KFBA 4AHVA 5AQZA 3GBTA 1QVGM 4CEAA 3M8RA 3GOIA 4YNQA 3AVLA 4B8AB 3I56N 3GG4A 2VYPA 3K58A 2GUIA 4DQRA 4ZTJA 3KK1A 3O3GA 2GEMA 1J5OA 3DRRA 4B9UA 3CCJN 4I9LA 2F8TA 3V9UA 3DLBA 2I5JA 4RCHA 4CBXA 3THVA 3AVGA 5HP1A 4CFAA 3BF3A 1D5AA 2YJFA 5BR8K 4DV0K 3VETA 5F1XA 1NGAA 5LJVA 4FJMA 1J53A 1JLGA 5AZJB 2NRZA 1HJRA 4EAHD 2OANA 3P83D 4ILJA 2G8HA 4KI4A 2GV9A 3SUNA 4DQQA 4LD0A 3OHRA 3THWB 3AVBA 3W0LA 2QWNA 3SQ1A 3KTQA 3VQ9A 4KB0A 4FYDA 5F0XA 4DTSA 2V7ZA 4GNIA 2Y1IA 3HPGA 4JKCA 2E20A 5DK5A 3RR7A 5M1KA 2AP1A 1Y64A 3EEQA 3M8PA 5CYQA 4GKKK 1QQMA 1E3MA 3G10A 1A5WA 3O9SA 1VSHA 4CFBA 4CEDA 3RWUA 3C0BA 3KVGA 2NRWA 3H6EA 1U6ZA 4NCBA 4ELTA 3U6FA 3OYCA 5CHIA 3CC7N 4JI0K 4X64K 4CF0A 3FLCO 1I94K 2HB5A 3AVNA 3ZEUA 2V51B 4DF4A 3P39A 2GX9A 3UE5A 5C12A 4BACA 3VQBA 3DAWA 2QWOA 2V52B 4J2EA 1NGEA 3AVIA 3VN5A 1IG9A 1RT2A 5M1QA 3E9OA 1GLAG 1RDUA 3D6RA 1J6ZA 3AO5A 4BWMA 4CHNA 1IBKK 3K57A 2YHAA 2HHQA 1EX4A 4DSKA 1VRTA 4FJLA 1OH5A 4DUYK 3KIOA 4FLTA 1I3AA 1M90O 1MWKA 2JWLA 5AQWA 1UOCA 1VSDA 3M3ZA 3KD1E 1YJ9N 3NAEA 3LDQA 1NNEA 4FZYA 1H1VA 4CJTA 4EP5A 1DTQA 3A5NC 2JLEA 2O4IA 3K59A 4DCHA 4CF1A 2FSNA 4FLYA 4PUOA 1JL1A 2G8WA 4B3TK 4CF2A 1HQEA 1D4XA 4ISEA 2ZQBA 4JKHA 4FJ8A 1E4GT 4HCCA 3WXKA 4LFAK 1BGXT 3I8DA 3A5LC 5BN8A 1ZC6A 4Y1CA 5ELZA 2IDOA 4KHYA 3I55N 2VWBA 2ZJPL 1VQON 2FBTA 3HOTA 4B9NA 5ADXA 4OKEA 3KK2A 4BR0A 2ASMA 3T7ZA 1UA1A 1QS4A 4M3RA 1Q7YO 3WXJA 3WXIA 3R6MA 4AM6A 1FXXA 4K41A 5AQJA 3ZT3A 4DS5A 2HVHA 1LCUA 3HZ6A 4M3XA 2BH1A 2OPSA 3OYLA 1YI2N 3K5MA 2A40A 2FSKA 4I2QA 3E9PA 2ZJRL 3DI6A 1G15A 1QTMA 1C0TA 5C42A 3ENHA 2QWQA 4CZKA 4HUGA 3FFIA 5JMVA 4Y1DA 4Z4GA 1IBMK 2A1SA 5M1FA 1TYQA 5HL7L 4AH9A 5BN9A 3HPOA 4BR7A 4CHYA 1S1TA 2IVOA 4JD2B 4IG0A 3AA3A 4NLBA 3S41A 4CCHA 4H0TB 4KH4A 4BRIA 4CJ3A 3MWTA 3TAFA 4AHTA 1DT9A 2O8CA 3DOLA 3F73A 5FRMA 1RGIA 5I42A 1TK5A 1TKDA 1S1VA 4FJHA 1KVAA 1FK9A 4BG9A 1HRHA 3T19A 3KZBA 1NK8A 3F9MA 3TSPA 3J8AA 2NNWA 2YNIA 3VA0A 1RCHA 3LAMA 4FW2A 4K25A 1XMOK 4J8FA 4KHUA 1N32K 3KHYA 4MLHA 2YX6A 3LWMA 4KI6A 2O8FA 3CXCM 3VEYA 3R3LA 3NF7A 1TAQA 1U47A 3QIOA 1WBBA 1VSFA 4CFCA 2UXDK 4JS5A 1BL3A 2A41A 1OH8A 3P1GA 1JJ2M 4XIUA 5C0YA 5HROA 3OTOK 2Q31A 4F8RA 1XMQK 3V9XA 4NYFA 2D5RA 4B08A 5EVZA 4FLWA 3IAYA 5HOOA 2A5XA 4BE2A 2Q36A 2XY5A 4F3TA 4W5QA 2XY7A 3THXB 2QKBA 4PWDA 3EO3A 5KI6A 4A61A 3PIPL 3CQXA 4MDAA 1V4SA 1HX1A 2P51A 1SV5A 3QICA 1IBLK 1TUYA 4MO5A 1SS6A 3MDQA 5AQFA 2OYQA 1ZBFA 3O1BA 1T8EA 3T1YK 1NGBA 4M3TA 2HNZA 4O44A 4H0VB 1QSSA 1JCEA 1ATRA 2IS3A 2HBLA 5CY4A 2P9PB 2Z1IA 3BUZB 3C6HA 1HYVA 5DM7L 2G8IA 3ASMA 4DKWA 4HWIA 1SL0A 4H4OA 3OYMA 2WUSA 1S6PA 3THYB 4E0DA 3V1QA 1CLQA 3DMJA 4RW7A 3C94A 3L2VA 3CPEA 3O3HA 3DLHA 3SUQA 2R7YA 2ZGZA 2X6SA 3AVHA 4BVOA 5KRTA 3CJAA 4DFJA 4R5PA 3CMAN 2D0CA 1CZAN 4M3UA 3VQAA 4H0YB 2D1KA 5AQNA 3WEEB 5GIOA 4BRKA 1RT5A 1YF5L 4KTZA 4ICLA 4M3WA 2YJEA 3VOVA 2E2QA 5H1SQ 4JI8K 3WNEA 3J7YP 1HNXK 1UAXA 1BA1A 1HLUA 1NKEA 1HMVA 3VEWA 4E7JA 3A5OC 1GLDG 1NJXA 5DMRA 3CJBA 1ZBHA 1X3NA 3EZ5A 5FPMA 3TU5A 2F9TA 4C1NK 1YHQN 4CK3A 4UQGA 4GV6A 2GWKA 3DXKB 4FJ5A 3AA5X 4IWVA 3VF2A 1TKZA 1TK0A 3SK3A 2NRHA 1EXQA 3OYDA 5BRDA 2E5LK 5TKWA 1WNSA 4IJAA 1NGHA 3I0SA 1LW0A 2BANA 3SJHA 2KLAA 2WONA 3HK2A 1BHLA 3LDOA 1T7PA 2HHXA 3T1HK 3HM8A 3K5LA 4CJ5A 5CE3A 5M1NA 4O55A 1ZYQA 4OGEA 5I9EB 4K43A 3PX0A 5TKYA 2YHYA 3CI5A 3HT3A 2E1ZA 3ZSQA 5AZIA 1ASUA 3U9ZA 4KHWA 1LWEA 1IO2A 1NM1A 3L8BA 3FE1A 5AQOA 4O5BA 2EX3A 4BC5A 4FM0A 4K8XA 4DTNA 2CGKA 3SQ2A 1RBVA 4BGAA 4FM1A 3QBWA 1T6CA 3J80O 4FCYA 2WFBA 4FO0A 1VQMN 3ZSRA 3TWHA 3BY5A 1IG8A 3HO1A 4FJGA 4B1WB 3U9DA 4HUEA 2P9IB 4CEFA 4E7LA 4CECA 3LP1A 3M6GA 3NCIA 1UWBA 3U4LA 3AO3A 3O9TA 1Z26A 2OPQA 4BREA 4DTOA 3SQ0A 1WAFA 3MN7A 3B6PA 3BF1A 1R59O 1D9DA 5AQMA 3D2FA 1BWFO 3LP2A 4BC3A 2QI2A 3OJUA 5C24A 1X9WA 2ETJA 3A2FA 1NK5A 3ZYYX 5LMNK 1YIJN 3MEDA 1U2VB 4JRQA 1MDUB 3LDPA 4B9VA 1XWLA 3NGYA 4CW7B 3BZKA 4FLUA 4BRHA 4DR3K 2OTLN 2B6AA 2P1JA 1NGGA 2QW9A 3JS6A 3NVMA 4B8CA 4DSIA 2QXLA 3MX5A 1VQ6N 4IBNA 4M63C 2Q3SA 2W42A 3QFPA 4E7IA 3L0QA 3AVFA 3VQ6A 3SQ4A 4B3RK 4PY5A 3NH0A 1NKCA 4CFDA 3A0IX 3DWLA 4YOWA 3RRHA 3CHWA 2ZM6K 2J4RA 4DB3A 3UKRA 4B9SA 4J2BA 1DLOA 2E2PA 3OYIA 3NF8A 4DHYA 1DEJA 3B6OA 2KFZA 3NH2A 1OH6A 1NJIO 5GADP 3O3FA 3RSEB 4LH5A 2D0AA 2ZGYA 4BR2A 4E19A 2CGLA 4ZTFA 5JVHL 1VAZA 3CCRN 3H08A 5KQDA 4IOXA 3NMUA 4CJ4A 2JGUA 5M1PA 3EYZA 4DR5K 4OJRA 2YI1A 3O4QA 4BC4A 4JKBA 2B4JA 5KRSA 5AQQA 3LZJA 1N8RO 5SZTA 4QS9A 3CC2N 1S5JA 3MN9A 4C8LA 4FJJA 3CIPA 4OPKA 3TAPA 2X78A 3RRGA 5JS2A 4KHQA 4FK2A 4JYAK 3M8QA 1T03A 4JI3K 3QINA 4IEIA 3ZT0A 1C1BA 5AR0A 2NLXA 2XRIA 5SWMA 1FW6A 5GINA 2OCEA 4TSXA 5HRRA 4M41A 2P9KA 3K0SA 5J2MA 2F7TA 3O8MA 1WSIA 3K5OA 4M45A 4BRMA 3LDLA 1JKHA 2ZJQL 1P8ZA 3AGKA 1VRUA 3HTVA 5BPNA 1WBDA 4BDPA 1SQKA 4BRGA 4DSEA 2ZF5O 5C10A 3SMSA 1F21A 5FPNA 4ID5A 5A2QO 4H03B 2HBKA 4JN4A 1FKPA 3TTDA 2PFUA 1MU2A 3DLGA 4F2SA 1UA0A 3TARA 3VQCA 4CZEA 1HQUA 2KZMA 1QSLA 4YORA 5KPTA 2HBJA 3DLEA 5HBMA 3BGRA 1KVBA 3AAPA 1VSJA 2VG6A 4Q5VA 3VF4A 3J7AP 3P5JA 1SKWA 4BGBA 1QE1A 5E84A 1QHTA 2CH6A 4ELVA 3WNHA 3L6QA 3ZETB 1VSLA 4CZLA 2FBXA 5K14A 4DTRA 4L3QA 4MO4A 3SAHA 4DFPA 4CVNE 4CD3A 2O4GA 4IDKA 3DXKA 1VK0A 3SAFA 4OPAA 4DR1K 2BTFA 4B9QA 1C6VA 4GW6A 4JHDA 3F9KA 4XH5A 4KRFA 1EWQA 1TAUA 5FDLA 2E8AA 4BE0A 1A5VA 3VPZA 5GIPA 3TI0A 3VENA 4JKFA 1WSFA 3V6DA 4JKAA 3WXMB 3I33A 1Z25A 2HOEA 3TR8A 4BVPA 2P9KB 4BRQA 2UU9K 2RN2A 2UUBK 3VQ5A 2VQFK 4H4MA 1NG9A 4DQSA 3HJFA 4KO0A 1EP4A 1RNHA 2CGJA 4C23A 1LOTB 3L4IA 2XO7A 2O8EB 1ZBSA 3AA2A 4B3SK 3MEEA 1K8AO 2ZWHA 2P9PA 3GE1A 3CQYA 3HOSA 3NFAA 4I9QA 4CGFA 5DM6L 1HYSA 3HBTA 5EX5A 4JKGA 3CYMA 1TK8A 3QEVA 5BREA 2WC9A 1XNRK 4FWRA 3DXMA 1S1XA 2P5OA 1SZ2A 1BI4B 3OYHA 1B9DA 1XHXA 4DR6K 1KC8O 3HI0A 3KLGA 1RFQA 4EIAA 4I7FA 2O8DB 3WEEA 4OO1J 4DTPA 4FWQA 3SUOA 5B8HA 3U3GA 1L3VA 2ASOA 4OPHA 3L2QA 4LF4K 3CCEN 3CETA 3OYKA 1RDDA 3CCMN 1JCGA 3PSFA 1NK6A 4DG1A 3DYAA 4CZGA 5FROA 4BQZA 4DFKA 2P9SB 3MXIA 2QWRA 3L4QA 3IMXA 3VMFB 4X62K 4CK1A 2HF4A 4Y0WA 4E1JA 1WLJA 2HBMA 2UUCK 1SAZA 4NCAA 1NK0A 3CCSN 3BP8A 4JRPA 1HR0K 4NXNK 4OKKA 4WFNL 4IXCA 1J54A 4B3MK 2HF3A 2X74A 3NE6A 5KPRA 1ZBIA 4BR4A 1BA0A 4HTLA 3OYAA 2KZZA 5FRNA 4C8MA 4K42A 3OW2M 3FZLA 1X1PA 5AFUA 1WN7A 3DRPA 1JLBA 4DSLA 4H5NA 3O80A 4CEZA 4UY8O 2O8DA 1KCFA 3THWA 1KLMA 2AJQA 3KD5E 3IDHA 4IKFA 3D2FB 1CZBA 5C15A 3VQEA 4BDZA 3K9KA 1S1UA 3O4NA 4C8NA 4LFBK 4JLHA 3QEIA 3MXMA 2QTDA 4BR5A 3KJVA 4JI5K 3ZSOA 4GMJB 1W7AA 3ENBA 4OKJA 4FJIA 1O1WA 5KGWA 3CQ8A 2BUPA 3VEVA 3K9JA 3O9RA 1NK9A 3RR8A 3OYJA 1WSJA 1REVA 4CJQA 2DFEA 5CYMA 4GV3A 3OYGA 1VQ7N 2UYTA 5C25A 3MX2A 4KH6A 1B9FA 3CF5L 1R0AA 3E66A 2G8VA 4CZJA 1JLCA 5EU7A 3DLLL 4CK2A 4H5TA 1NK4A 3ZSVA 3C6AA 1KRPA 2YHWA 3AVJA 4RG8A 5AQUA 2UUAK 1CXUA 3IG1A 3F5TA 1DTTA 3EN9A 4FJ9A 4DR2K 4BRLA 3HSCA 3TSUA 4F3OA 1J5EK 2Q2RA 3BDPA 3G25A 4DMNA 1C1AA 4CJVA 2RPIA 1T3VA 4IFVA 4E89A 2NRRA 3DLRA 3ATUA 4FPAA 3CJ9A 1HJOA 2OPPA 3RMBA 1VQKN 4FWLA 4CE9A 2VQEK 5J2QA 3FZMA 3O08A 4JI4K 3CG7A 2A1RA 1L3UA 3HVTA 3LM2A 3H1QA 3QDKA 1L3TA 3KLHA 3RTVA 3D0PA 3SBGA 3PO4A 3PUFA 1NK7A 3QB0A 4DQPA 2QXFA 2Q97A 3OBYA 4CJRA 1NGIA 2OA8A 3E01A 1V4TA 1LWCA 3CCUN 1ITGA 2P9LA 3V9ZA 4CBWA 2F96A 4Z0UA 3LPTA 4QAGA 1TKTA 4DU4A 1VHXA 5AFUH 4AF1A 3E9LA 4F4KA 1T05A 2PYLA 5CZ2A 5AQIA 2HW3A 5IT9O 4CJEA 3OYNA 4EP4A 2UXCK 3AGRA 1NKBA 3OS0A 4JI6K 2HNDA 3G71N 1WSEA 3SYZA 4QS8A 1DGKN 3ZT4A 1WUAA 3VQ7A 4CJPA 4DV2K 3SCXA 1LV5A 3UKUA 3V4IA 3AVMA 4H5VA 1IKXA 1ASWA 4CEBA 4FJXA 1N5YA 3GDQA 3LPUA 3MN5A 4LF7K 3HXMA 3OYEA 1B92A 1EKEA 1IKWA 1VQ8N 3H1VX 1HUXA 2AA4A 3DXMB 1C1CA 1ESVA 1GOCA 5AQTA 2Q0RA 3C7NB 2Q1NA 3FZKA 4ISFA 2I7PA 4DSJA 4LH4A 2P9LB 2P9IA 3AY9A 3WXLA 3U3YA 1RT6A 3UKUB 4WQ5C 2O8BB 3WT0A 3M8SA 1RILA 5GAEP 4QS7A 5EY4A 2RF2A 1S9EA 4RWTA 4YOXA 2X6NA 1WAJA 3DRSA 3TABA 3UIQA 1C0MA 4DV7K 4B9LA 1JLAA 3G6EN 4PL8A 4PA1A 2DTUA 1W9HA 1TL3A 3PIOL 1X3MA 1K8KA 4EHTA 3EE8A 4DTJA 2DPNA 4WQ4A 4H0XB 3R1XA 4O0JA 1HNWK 5KQ8A 1T44A 1EETA 3NDKA 1QQOA 4CJWA 1N6QA 3QERA 3KLFA 4Z94A 1HKBA 2A3ZA 1XUPO 1JCFA 3TPQA 1BISA 1KD1O 4LF8K 2KFNA 1BG3A 1S22A 1KAYA 4F9OA 2WTUA 2HHVA 1MA9B 5HRPA 4YOVA 3KWIA 3PSIA 5CZ1A 4I6MA 3VQQA 4DV4K 1HKGA 2E4LA 4ILGB 3V9WA 3TSQA 2FC0A 3LP0A 4E7HA 1RTIA 4RW4A 1VSIA 1WOQA 4CEOA 1BUPA 2VGNA 4LSNA 3HRGA 3TAMA 4BG8A 3H3OB 2FBYA 1SL2A 1GLBG 1W0HA 1GLLO 3D2EA 1X9SA 4IFYA 1BCMA 4OX9K 3R8EA 3TANA 4A57A 3VA3A 5E26A 4DV5K 2KHOA 4YFUA 1X9JA 1LAWA 2W6KA 2QKKA 1NMNA 3VERA 2IVPA 2E88A 1BOTO 3TAQA 2HNYA 4YOUA 4GY2B 1VQLN 1EO1A 3AO2A 3MWPA 2DFFA 1Q8IA 4CERA 5FPDA 3ULEB 5J2NA 5MLCQ 1S9GA 4HTUA 2W40A 4E3SA 3OYBA 1RT4A 2QA4N 1U49A 1RT3A 3ZT2A 3VQPA 3WNFA 4AHCA 2NZTA 1TUUA 3ULDA 4G9ZA 1HYZA 5C2FA 2UXBK 4AILC 3JXUA 3MCPA 2Y1JA 4FWSA 2KTQA 4DQ8A 3LP3A 4MDBA 4W5NA 1JLQA 1Q18A 1QQNA 4FWOA 4A5BA 4BWJA 4JV5K 1RTJA 2E6MA 2Z1JA 2HSTA 3H46O 1Q81O 4FLVA 2QWLA 4KHNA 3TAGA 4CESA 4YDUC 2CH5A 4M3ZA 1KFDA 4XH1A 3BEXA 3QNOA 3S3NA 3WQTA 4YOYA 3VQ4A 4B3OA 1YTUA 2P9UA 4BY9C 2ITGA 4H5WA 4FOEA 3SZ2A 3CPWM 5C2DA 3H45C 3I8BA 1NMDA 4IJNA 1KAZA 4ISGA 4BE1A 4CJKA 3OYFA 1YJWN 4B9TA 4BRAA 1Q86O 3L3VA 3CJCA 1YJNN 4FLXA 5BRHA 2QM1A 3SLCA 2G8KA 3G4SN 4H5RA 5BPMA 2YKMA 1GOAA 4DUZK 1C0GA 1GLFO 2W41A 4U67L 1NGJA 4J2DA 4M7YA 4CZHA 2VWJA 1SKSA 1Y97A 2ITMA 4X65K 4DLEA 3CFPA 1TKXA 1D9FA 2G8UA 5JVGL 4Z4CA 5AJ3K 2IOCA 3VTHA 4CEEA 3ALYA
chains in the Genus database with same CATH topology
2D5RA 4B08A 4C8KA 2XHBA 4KKOA 4E1MA 3HL8A 3ZSWA 4KTWA 4FLWA 1NK6A 4DG1A 3IAYA 4EZ9A 1BIZA 3DYAA 1I39A 3KLEA 4BE2A 2XY5A 4F3TA 5FROA 4CIGA 4W5QA 2XY7A 2OZSA 4DFKA 2VG7A 2QKBA 4W5RA 3MXIA 4PWDA 2BE2A 3AVCA 3CM6A 4Z4EA 2YNGA 5KI6A 1A5XA 4CK1A 3L2RA 4DTXA 1WLJA 2HHTA 1NOYA 2P51A 1SV5A 4NCAA 3CFRA 1ASVA 1NK0A 5J2PA 1JXBA 2OYQA 4JRPA 1QSYA 1ZBFA 2ZE2A 4OKKA 1BQNA 2XY8A 4N41A 1TGOA 1T8EA 2FBVA 1J54A 3ZT1A 3LZIA 2X74A 3AO4A 3NE6A 4FJKA 4FZZA 2HNZA 2GBZA 4O44A 4M3TA 1QSSA 3OS2A 1ZBIA 3QLHA 2IS3A 3K5NA 3OYAA 4E7KA 2KZZA 4CJLA 5FRNA 3ZSYA 5CY4A 4C8MA 2Z1IA 1X1PA 4RW6A 1HYVA 2G8IA 3DRPA 1QQCA 1WN7A 1JLBA 4I2PA 4O0IA 1SKRA 4DSLA 4J2AA 3ASMA 3ZSZA 4CEZA 4RW9A 1SL0A 4H4OA 3OYMA 1SUQA 1KCFA 1S6PA 2IC3A 1KLMA 3V1QA 3MAQA 3KD5E 3DMJA 4RW7A 2NUBA 4E0DA 3C94A 4HUFA 4IKFA 3L2VA 4CEQA 1CZBA 3O3HA 1U04A 4KPYA 3VQEA 1KVCA 3DLHA 4BDZA 1S1UA 3O4NA 4C8NA 3OVNA 4OPJA 2R7YA 1TV6A 3SUQA 2X6SA 3AVHA 4JLHA 5KRTA 1ZBUA 3S9HA 3QEIA 3MXMA 4DFJA 3CFOA 4R5PA 1CZ9A 3KJVA 4FM2A 3ZSOA 4GMJB 2HHWA 1C0UA 3TAEA 2D0CA 3QIPA 1IH7A 1L5UA 2HVIA 4OKJA 3OS1A 4FJIA 4DF8A 4M3UA 1O1WA 5KGWA 3VQAA 3C95A 4MQ3A 4FVMA 3CQ8A 3IS9A 2XY6A 1NK9A 3RR8A 2PZSA 1RT5A 3OYJA 3V81A 1WSJA 3AV9A 4G1QA 4CJSA 4M3YA 4CGJA 3OJSA 4DSFA 1REVA 4KTZA 4ICLA 4CJQA 4M3WA 4EZ6A 2DFEA 4FJNA 5CYMA 3OYGA 2Z1GA 3WNEA 3L2WA 1UAXA 3PV8A 3SI6A 1NKEA 1HMVA 3MEGA 5C25A 2ZD1A 4E7JA 4KB1A 3LDSA 1WSGA 1B9FA 1R0AA 3PX4A 1JL2A 1NJXA 2G8VA 3HSTB 5DMRA 1ZBHA 2KQ2A 1RT1A 1JLCA 1HNIA 5EU7A 3I0RA 3EZ5A 5T7BA 1ZBLA 3NF9A 2P5GA 4CK2A 4DU1A 4HHTA 3QEWA 1IKVA 4CGGA 4N5SA 4CK3A 3SV3A 4UQGA 4FLZA 1NK4A 3HM9A 2ATQA 3LAKA 1RBUA 4N76A 4FJ5A 3ZSVA 3MXJA 3ISNC 4GVMA 2PY5A 3PX6A 3AA5X 4KAZA 1LWFA 1TKZA 1TK0A 1KRPA 3IRXA 1RBRA 2KW4A 3AVJA 4RG8A 1EXQA 3V1OA 1BCOA 4CF9A 3OYDA 2IGIA 3HYFA 1CXUA 3RMAA 4H8KA 3JYTA 4QOZB 1WNSA 3IG1A 3EY1A 1DTTA 3G0ZA 3I0SA 4FJ9A 5JS1A 3NF6A 1LW0A 1RDCA 2BANA 2DY4A 4JS4A 4F3OA 2WONA 3HK2A 1BHLA 1T7PA 4Z4HA 4Z4FA 3ZCMA 3BDPA 2HHXA 1D8YA 4FXDA 2DFHA 3LANA 4DMNA 1C1AA 5KGXA 1K6YA 3MECA 4CJVA 2RPIA 4N56A 3HP6A 3K5LA 4CJ5A 1YTAA 4O55A 1ZYQA 2BGGA 3NGIA 1U4BA 4IFVA 4E1NA 4OGEA 4E89A 4DS4A 3PX0A 3DLRA 3HT3A 3RMCA 3QETA 3SPZA 4DFMA 2OPPA 3RMBA 1KTQA 4CHZA 1XI1A 4IG3A 3OY9A 4B9MA 4CE9A 1U45A 5J2QA 4MFBA 2IAJA 3ZSQA 4KHWA 1ASUA 1BIUA 5KTQA 1LWEA 1VSEA 1IO2A 2YV0X 1XC9A 1GOBA 3CG7A 3HVRA 2YNHA 3L8BA 2A1RA 3NBPA 3HVTA 4O5BA 1L3UA 3NH1A 4CJUA 2EX3A 1HPZA 4FM0A 3AVAA 4DTNA 4K8XA 3D45A 3SQ2A 1RBVA 3SUPA 2YKNA 3LWLA 1L3TA 3L3UA 4FM1A 3KLHA 5J1EA 3RTVA 4AHSA 1LAVA 3D0PA 3T3FA 5E41A 4NCGA 4FCYA 3SJJA 4M42A 3L2UA 3PO4A 3PUFA 3SV4A 1NK7A 2EHGA 5HRSA 4DQPA 2QXFA 3ZSRA 3TWHA 1IKYA 4CJRA 2OA8A 3E01A 4KFBA 3HO1A 4KV8A 4AHVA 4FJGA 1LWCA 1ITGA 4HUEA 3V9ZA 2F96A 4CEFA 4E7LA 4Z0UA 3LP1A 4CECA 4CEAA 3NCIA 1UWBA 3S3OA 3LPTA 3M8RA 4BDPA 4QAGA 3QNNA 3AO3A 1TKTA 4DU4A 1Z26A 2OPQA 4YNQA 3AVLA 4DTOA 4B8AB 3SQ0A 1WAFA 3B6PA 3K58A 2GUIA 3KK3A 4DQRA 4CF8A 4F4KA 4ZTJA 1T05A 2PYLA 5CZ2A 3KK1A 3V1RA 3O3GA 1RBTA 1D9DA 1J5OA 3DRRA 3V9SA 4CGDA 4B9UA 2HW3A 4I9LA 3JSMA 2F8TA 4CJEA 1JLFA 3LP2A 3V9UA 3OYNA 4EP4A 2I5JA 5C24A 3OJUA 3THVA 1VSMA 2ETJA 3A2FA 3AVGA 3OS0A 1X9WA 2HNDA 5HP1A 1NK5A 1NKBA 1WSEA 3SYZA 4CFAA 3ZT4A 3NGZA 3VQ7A 3MEDA 1D5AA 4CJPA 4ZHRA 3SCXA 1SL1A 1LV5A 4FJMA 1J53A 1JLGA 3V4IA 4DQIA 3AVMA 4KREA 4JRQA 4FJXA 1IKXA 1ASWA 4CEBA 4B9VA 1XWLA 1HJRA 1N5YA 3NGYA 4FLUA 4DTMA 3LPUA 3P83D 2G8HA 3HXMA 4KI4A 2GV9A 3SUNA 3OYEA 4DQQA 1B92A 4LD0A 1KFSA 1RBSA 1J9AA 3AVBA 1EKEA 3SQ1A 1IKWA 2B6AA 2P1JA 5HRNA 3KTQA 5I3UA 3VQ9A 3AA4A 4KB0A 4FYDA 4OGCA 1C1CA 4B8CA 4DTSA 1GOCA 4DSIA 4RW8A 2QK9A 4IBNA 2Y1IA 2E6LA 3HPGA 2Q3SA 4DSJA 2W42A 4E7IA 5DK5A 3RR7A 3AVFA 3VQ6A 4LH4A 3SQ4A 4PY5A 3NH0A 1NKCA 2YNFA 4CFDA 3M8PA 5CYQA 3U3YA 1RT6A 3RRHA 3LALA 2HHUA 4CHOA 3T1AA 3ITHA 3G10A 1A5WA 3K2PA 2RKIA 4B9SA 4DU3A 3M8SA 4J2BA 1RILA 1DLOA 3OYIA 1VSHA 4CFBA 3NF8A 4CEDA 3RWUA 4KHSA 3B6OA 2KFZA 3NH2A 4NCBA 2RF2A 4ELTA 3U6FA 3OYCA 3O3FA 1S9EA 4LH5A 2D0AA 1RT7A 2X6NA 4E19A 4CF0A 4CHPA 1WAJA 4ZTFA 2HB5A 3DRSA 3TABA 3UIQA 3AVNA 4DF4A 1C0MA 4B9LA 1JLAA 3H08A 4BACA 4PA1A 3VQBA 2JGUA 4CJ4A 2DTUA 1W9HA 3S3MA 1TL3A 3EYZA 4OJRA 3O4QA 3C6UA 1S6QA 4J2EA 2B4JA 5KRSA 4L8RB 3LZJA 4DTJA 3AVIA 5SZTA 1S5JA 4N47A 3VN5A 1RT2A 3VQ8A 1IG9A 4C8LA 4FJJA 3DM2A 4OPKA 3HPHA 4O0JA 2X78A 3AO5A 5JS2A 3TAPA 3RRGA 4BWMA 4KHQA 1EETA 1TL1A 4FK2A 4CHNA 3PY8A 2B5JA 3NDKA 3ZSXA 4CJWA 3K57A 3M8QA 1T03A 2YHAA 1N6QA 3QERA 3QINA 2HHQA 1EX4A 3KLFA 4DSKA 3ZT0A 1VRTA 4F2RA 1C1BA 4FJLA 2XRIA 3KIOA 5SWMA 1BISA 1I3AA 4FLTA 1RTHA 2KFNA 2HHVA 1RTDA 5HRPA 4TSXA 5HRRA 4M41A 1UOCA 5J2MA 5CZ1A 1VSDA 3VQQA 3KD1E 1WSIA 3NAEA 2E4LA 3K5OA 1L3SA 1S1WA 4M45A 3QO9A 4FZYA 1JKHA 4DWIA 3V9WA 1HNVA 2YHBA 2FC0A 4CJTA 3LP0A 4OVLA 4EP5A 1VRUA 1DTQA 4CJFA 4CHQA 4E7HA 1RDBA 1RTIA 2JLEA 1VSIA 4RW4A 3NHGA 4CF1A 4AHUA 4CEOA 3K59A 4BDYA 4LSNA 2HMIA 3PO5A 4FLYA 4PUOA 1JL1A 2G8WA 3TAMA 3VQDA 4DSEA 4HCBA 4CF2A 1HQEA 1NJYA 2F8SA 2ZQBA 2FBYA 1F21A 1SL2A 1W0HA 4WE1A 4K8ZA 1X9SA 4ID5A 4IFYA 4HCCA 4FJ8A 1KSPA 1BCMA 2OPRA 1FKPA 3TANA 1BGXT 3I8DA 1MU2A 3DLGA 3DLKA 3VA3A 4F2SA 3C6TA 4Y1CA 4YFUA 1UA0A 2HHSA 1LAWA 2AJQA 3TARA 3VQCA 1JXEA 4W5OA 1HQUA 1FKOA 2IDOA 4ELUA 2QKKA 4KHYA 2KZMA 1QSLA 2FBTA 3DLEA 5HBMA 3TAQA 2HNYA 1KVBA 3BGRA 1VSJA 2VG6A 4B9NA 4Q5VA 3WNGA 1YVUA 4OKEA 3P5JA 3KK2A 1SKWA 4Q0BA 3AO2A 1QE1A 1QHTA 2DFFA 4ELVA 1Q8IA 3WNHA 4CERA 1UA1A 1QS4A 5J2NA 4M3RA 1VSLA 1JLEA 1S9GA 2FBXA 4HTUA 5K14A 1FXXA 4LY7A 2PYJA 4DTRA 3ZT3A 4E3SA 4CGIA 3SPYA 4DS5A 1NJZA 2HVHA 3OYBA 3QEPA 4DFPA 2O4GA 1RT4A 4IDKA 5D3GA 1VK0A 3QEXA 1RT3A 3ZT2A 1U49A 4HVJA 4M3XA 3VQPA 1C6VA 4GW6A 3WNFA 4AHCA 3F9KA 3ULDA 2OPSA 3OYLA 3K5MA 1HYZA 3AVKA 4KRFA 1BI4A 4I2QA 3DOKA 4AHRA 1YT3A 4W5TA 3DI6A 4C8OA 1G15A 1QTMA 4DLGA 1CLQA 1C0TA 5FDLA 5C42A 4AILC 1TAUA 3HP9A 2BDPA 2OZMA 3QESA 4BE0A 2Y1JA 1A5VA 2KTQA 4FK4A 3LP3A 1RDDA 3TI0A 4O4GA 1CXQA 1WSFA 3V6DA 3DLBA 1JLQA 4W5NA 4HUGA 3FFIA 1Z25A 3TR8A 2D0BA 4NYNA 4Y1DA 4FJ7A 4Z4GA 1Q9XA 1WSHA 4BWJA 2RN2A 2A1SA 3VQ5A 1RTJA 4LSLA 2E6MA 2Z1JA 4H4MA 4FW1A 4AH9A 4DQSA 3HJFA 4KO0A 3HPOA 4FLVA 1EP4A 4CHYA 1RNHA 4KHNA 3TAGA 4CESA 1BQMA 1S1TA 1NJWA 1U48A 4M3ZA 1KFDA 3AA3A 4IG0A 2XO7A 5HLFA 4FK0A 4CCHA 3AA2A 3QNOA 3S3NA 2VWKA 3VQ4A 4CJ3A 3TAFA 4AHTA 4B3OA 3MEEA 1YTUA 4CGHA 3DOLA 3F73A 1X9MA 5FRMA 2LSNA 3NFAA 4I9QA 5I42A 1TK5A 2Z1HA 1TKDA 4CGFA 4PQUA 2ITGA 1Q9YA 1HYSA 1S1VA 4FJHA 4KTQA 4ID1A 1KVAA 1FK9A 2G8FA 3CYMA 3SZ2A 1TK8A 3QEVA 1LW2A 1HRHA 1RDAA 3T19A 3AO1A 1NK8A 2WOMA 4CIFA 3KKRA 1S1XA 2YNIA 3VA0A 2P5OA 1BI4B 1RCHA 3LAMA 4FW2A 3OYHA 4BE1A 4CJKA 3OYFA 4B9TA 3RMDA 4KHUA 4DTUA 4OLBA 1XHZA 3L3VA 1VSKA 3LWMA 4KI6A 4FLXA 1KLNA 1B9DA 2G8KA 1XHXA 3NF7A 1TAQA 2YKMA 4Z4IA 1GOAA 3KLGA 1U47A 3QIOA 4J2DA 4FZXC 2VG5A 1VSFA 4CFCA 3KKSA 4I7FA 2VWJA 1SKSA 1NOZA 1Y97A 4DTPA 4JS5A 1BL3A 4DLEA 3CFPA 4OLAA 3SUOA 3SNNA 1TKXA 3U3GA 3KLIA 1L3VA 1D9FA 3P1GA 4XIUA 2G8UA 5HROA 2O4IA 4F8RA 4Z4CA 3CM5A 1TVRA 3L2QA 3V9XA 4NYFA 4CIEA 4QCLA 3OYKA 2IOCA 4CEEA 3ALYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5R A;  4B08 A;  4C8K A;  2XHB A;  4KKO A;  4E1M A;  3HL8 A;  3ZSW A;  4KTW A;  4FLW A;  1NK6 A;  4DG1 A;  3IAY A;  4EZ9 A;  1BIZ A;  3DYA A;  1I39 A;  3KLE A;  4BE2 A;  2XY5 A;  4F3T A;  5FRO A;  4CIG A;  4W5Q A;  2XY7 A;  2OZS A;  4DFK A;  2VG7 A;  2QKB A;  4W5R A;  3MXI A;  4PWD A;  2BE2 A;  3AVC A;  3CM6 A;  4Z4E A;  2YNG A;  5KI6 A;  1A5X A;  4CK1 A;  3L2R A;  4DTX A;  1WLJ A;  2HHT A;  1NOY A;  2P51 A;  1SV5 A;  4NCA A;  3CFR A;  1ASV A;  1NK0 A;  5J2P A;  1JXB A;  2OYQ A;  4JRP A;  1QSY A;  1ZBF A;  2ZE2 A;  4OKK A;  1BQN A;  2XY8 A;  4N41 A;  1TGO A;  1T8E A;  2FBV A;  1J54 A;  3ZT1 A;  3LZI A;  2X74 A;  3AO4 A;  3NE6 A;  4FJK A;  4FZZ A;  2HNZ A;  2GBZ A;  4O44 A;  4M3T A;  1QSS A;  3OS2 A;  1ZBI A;  3QLH A;  2IS3 A;  3K5N A;  3OYA A;  4E7K A;  2KZZ A;  4CJL A;  5FRN A;  3ZSY A;  5CY4 A;  4C8M A;  2Z1I A;  1X1P A;  4RW6 A;  1HYV A;  2G8I A;  3DRP A;  1QQC A;  1WN7 A;  1JLB A;  4I2P A;  4O0I A;  1SKR A;  4DSL A;  4J2A A;  3ASM A;  3ZSZ A;  4CEZ A;  4RW9 A;  1SL0 A;  4H4O A;  3OYM A;  1SUQ A;  1KCF A;  1S6P A;  2IC3 A;  1KLM A;  3V1Q A;  3MAQ A;  3KD5 E;  3DMJ A;  4RW7 A;  2NUB A;  4E0D A;  3C94 A;  4HUF A;  4IKF A;  3L2V A;  4CEQ A;  1CZB A;  3O3H A;  1U04 A;  4KPY A;  3VQE A;  1KVC A;  3DLH A;  4BDZ A;  1S1U A;  3O4N A;  4C8N A;  3OVN A;  4OPJ A;  2R7Y A;  1TV6 A;  3SUQ A;  2X6S A;  3AVH A;  4JLH A;  5KRT A;  1ZBU A;  3S9H A;  3QEI A;  3MXM A;  4DFJ A;  3CFO A;  4R5P A;  1CZ9 A;  3KJV A;  4FM2 A;  3ZSO A;  4GMJ B;  2HHW A;  1C0U A;  3TAE A;  2D0C A;  3QIP A;  1IH7 A;  1L5U A;  2HVI A;  4OKJ A;  3OS1 A;  4FJI A;  4DF8 A;  4M3U A;  1O1W A;  5KGW A;  3VQA A;  3C95 A;  4MQ3 A;  4FVM A;  3CQ8 A;  3IS9 A;  2XY6 A;  1NK9 A;  3RR8 A;  2PZS A;  1RT5 A;  3OYJ A;  3V81 A;  1WSJ A;  3AV9 A;  4G1Q A;  4CJS A;  4M3Y A;  4CGJ A;  3OJS A;  4DSF A;  1REV A;  4KTZ A;  4ICL A;  4CJQ A;  4M3W A;  4EZ6 A;  2DFE A;  4FJN A;  5CYM A;  3OYG A;  2Z1G A;  3WNE A;  3L2W A;  1UAX A;  3PV8 A;  3SI6 A;  1NKE A;  1HMV A;  3MEG A;  5C25 A;  2ZD1 A;  4E7J A;  4KB1 A;  3LDS A;  1WSG A;  1B9F A;  1R0A A;  3PX4 A;  1JL2 A;  1NJX A;  2G8V A;  3HST B;  5DMR A;  1ZBH A;  2KQ2 A;  1RT1 A;  1JLC A;  1HNI A;  5EU7 A;  3I0R A;  3EZ5 A;  5T7B A;  1ZBL A;  3NF9 A;  2P5G A;  4CK2 A;  4DU1 A;  4HHT A;  3QEW A;  1IKV A;  4CGG A;  4N5S A;  4CK3 A;  3SV3 A;  4UQG A;  4FLZ A;  1NK4 A;  3HM9 A;  2ATQ A;  3LAK A;  1RBU A;  4N76 A;  4FJ5 A;  3ZSV A;  3MXJ A;  3ISN C;  4GVM A;  2PY5 A;  3PX6 A;  3AA5 X;  4KAZ A;  1LWF A;  1TKZ A;  1TK0 A;  1KRP A;  3IRX A;  1RBR A;  2KW4 A;  3AVJ A;  4RG8 A;  1EXQ A;  3V1O A;  1BCO A;  4CF9 A;  3OYD A;  2IGI A;  3HYF A;  1CXU A;  3RMA A;  4H8K A;  3JYT A;  4QOZ B;  1WNS A;  3IG1 A;  3EY1 A;  1DTT A;  3G0Z A;  3I0S A;  4FJ9 A;  5JS1 A;  3NF6 A;  1LW0 A;  1RDC A;  2BAN A;  2DY4 A;  4JS4 A;  4F3O A;  2WON A;  3HK2 A;  1BHL A;  1T7P A;  4Z4H A;  4Z4F A;  3ZCM A;  3BDP A;  2HHX A;  1D8Y A;  4FXD A;  2DFH A;  3LAN A;  4DMN A;  1C1A A;  5KGX A;  1K6Y A;  3MEC A;  4CJV A;  2RPI A;  4N56 A;  3HP6 A;  3K5L A;  4CJ5 A;  1YTA A;  4O55 A;  1ZYQ A;  2BGG A;  3NGI A;  1U4B A;  4IFV A;  4E1N A;  4OGE A;  4E89 A;  4DS4 A;  3PX0 A;  3DLR A;  3HT3 A;  3RMC A;  3QET A;  3SPZ A;  4DFM A;  2OPP A;  3RMB A;  1KTQ A;  4CHZ A;  1XI1 A;  4IG3 A;  3OY9 A;  4B9M A;  4CE9 A;  1U45 A;  5J2Q A;  4MFB A;  2IAJ A;  3ZSQ A;  4KHW A;  1ASU A;  1BIU A;  5KTQ A;  1LWE A;  1VSE A;  1IO2 A;  2YV0 X;  1XC9 A;  1GOB A;  3CG7 A;  3HVR A;  2YNH A;  3L8B A;  2A1R A;  3NBP A;  3HVT A;  4O5B A;  1L3U A;  3NH1 A;  4CJU A;  2EX3 A;  1HPZ A;  4FM0 A;  3AVA A;  4DTN A;  4K8X A;  3D45 A;  3SQ2 A;  1RBV A;  3SUP A;  2YKN A;  3LWL A;  1L3T A;  3L3U A;  4FM1 A;  3KLH A;  5J1E A;  3RTV A;  4AHS A;  1LAV A;  3D0P A;  3T3F A;  5E41 A;  4NCG A;  4FCY A;  3SJJ A;  4M42 A;  3L2U A;  3PO4 A;  3PUF A;  3SV4 A;  1NK7 A;  2EHG A;  5HRS A;  4DQP A;  2QXF A;  3ZSR A;  3TWH A;  1IKY A;  4CJR A;  2OA8 A;  3E01 A;  4KFB A;  3HO1 A;  4KV8 A;  4AHV A;  4FJG A;  1LWC A;  1ITG A;  4HUE A;  3V9Z A;  2F96 A;  4CEF A;  4E7L A;  4Z0U A;  3LP1 A;  4CEC A;  4CEA A;  3NCI A;  1UWB A;  3S3O A;  3LPT A;  3M8R A;  4BDP A;  4QAG A;  3QNN A;  3AO3 A;  1TKT A;  4DU4 A;  1Z26 A;  2OPQ A;  4YNQ A;  3AVL A;  4DTO A;  4B8A B;  3SQ0 A;  1WAF A;  3B6P A;  3K58 A;  2GUI A;  3KK3 A;  4DQR A;  4CF8 A;  4F4K A;  4ZTJ A;  1T05 A;  2PYL A;  5CZ2 A;  3KK1 A;  3V1R A;  3O3G A;  1RBT A;  1D9D A;  1J5O A;  3DRR A;  3V9S A;  4CGD A;  4B9U A;  2HW3 A;  4I9L A;  3JSM A;  2F8T A;  4CJE A;  1JLF A;  3LP2 A;  3V9U A;  3OYN A;  4EP4 A;  2I5J A;  5C24 A;  3OJU A;  3THV A;  1VSM A;  2ETJ A;  3A2F A;  3AVG A;  3OS0 A;  1X9W A;  2HND A;  5HP1 A;  1NK5 A;  1NKB A;  1WSE A;  3SYZ A;  4CFA A;  3ZT4 A;  3NGZ A;  3VQ7 A;  3MED A;  1D5A A;  4CJP A;  4ZHR A;  3SCX A;  1SL1 A;  1LV5 A;  4FJM A;  1J53 A;  1JLG A;  3V4I A;  4DQI A;  3AVM A;  4KRE A;  4JRQ A;  4FJX A;  1IKX A;  1ASW A;  4CEB A;  4B9V A;  1XWL A;  1HJR A;  1N5Y A;  3NGY A;  4FLU A;  4DTM A;  3LPU A;  3P83 D;  2G8H A;  3HXM A;  4KI4 A;  2GV9 A;  3SUN A;  3OYE A;  4DQQ A;  1B92 A;  4LD0 A;  1KFS A;  1RBS A;  1J9A A;  3AVB A;  1EKE A;  3SQ1 A;  1IKW A;  2B6A A;  2P1J A;  5HRN A;  3KTQ A;  5I3U A;  3VQ9 A;  3AA4 A;  4KB0 A;  4FYD A;  4OGC A;  1C1C A;  4B8C A;  4DTS A;  1GOC A;  4DSI A;  4RW8 A;  2QK9 A;  4IBN A;  2Y1I A;  2E6L A;  3HPG A;  2Q3S A;  4DSJ A;  2W42 A;  4E7I A;  5DK5 A;  3RR7 A;  3AVF A;  3VQ6 A;  4LH4 A;  3SQ4 A;  4PY5 A;  3NH0 A;  1NKC A;  2YNF A;  4CFD A;  3M8P A;  5CYQ A;  3U3Y A;  1RT6 A;  3RRH A;  3LAL A;  2HHU A;  4CHO A;  3T1A A;  3ITH A;  3G10 A;  1A5W A;  3K2P A;  2RKI A;  4B9S A;  4DU3 A;  3M8S A;  4J2B A;  1RIL A;  1DLO A;  3OYI A;  1VSH A;  4CFB A;  3NF8 A;  4CED A;  3RWU A;  4KHS A;  3B6O A;  2KFZ A;  3NH2 A;  4NCB A;  2RF2 A;  4ELT A;  3U6F A;  3OYC A;  3O3F A;  1S9E A;  4LH5 A;  2D0A A;  1RT7 A;  2X6N A;  4E19 A;  4CF0 A;  4CHP A;  1WAJ A;  4ZTF A;  2HB5 A;  3DRS A;  3TAB A;  3UIQ A;  3AVN A;  4DF4 A;  1C0M A;  4B9L A;  1JLA A;  3H08 A;  4BAC A;  4PA1 A;  3VQB A;  2JGU A;  4CJ4 A;  2DTU A;  1W9H A;  3S3M A;  1TL3 A;  3EYZ A;  4OJR A;  3O4Q A;  3C6U A;  1S6Q A;  4J2E A;  2B4J A;  5KRS A;  4L8R B;  3LZJ A;  4DTJ A;  3AVI A;  5SZT A;  1S5J A;  4N47 A;  3VN5 A;  1RT2 A;  3VQ8 A;  1IG9 A;  4C8L A;  4FJJ A;  3DM2 A;  4OPK A;  3HPH A;  4O0J A;  2X78 A;  3AO5 A;  5JS2 A;  3TAP A;  3RRG A;  4BWM A;  4KHQ A;  1EET A;  1TL1 A;  4FK2 A;  4CHN A;  3PY8 A;  2B5J A;  3NDK A;  3ZSX A;  4CJW A;  3K57 A;  3M8Q A;  1T03 A;  2YHA A;  1N6Q A;  3QER A;  3QIN A;  2HHQ A;  1EX4 A;  3KLF A;  4DSK A;  3ZT0 A;  1VRT A;  4F2R A;  1C1B A;  4FJL A;  2XRI A;  3KIO A;  5SWM A;  1BIS A;  1I3A A;  4FLT A;  1RTH A;  2KFN A;  2HHV A;  1RTD A;  5HRP A;  4TSX A;  5HRR A;  4M41 A;  1UOC A;  5J2M A;  5CZ1 A;  1VSD A;  3VQQ A;  3KD1 E;  1WSI A;  3NAE A;  2E4L A;  3K5O A;  1L3S A;  1S1W A;  4M45 A;  3QO9 A;  4FZY A;  1JKH A;  4DWI A;  3V9W A;  1HNV A;  2YHB A;  2FC0 A;  4CJT A;  3LP0 A;  4OVL A;  4EP5 A;  1VRU A;  1DTQ A;  4CJF A;  4CHQ A;  4E7H A;  1RDB A;  1RTI A;  2JLE A;  1VSI A;  4RW4 A;  3NHG A;  4CF1 A;  4AHU A;  4CEO A;  3K59 A;  4BDY A;  4LSN A;  2HMI A;  3PO5 A;  4FLY A;  4PUO A;  1JL1 A;  2G8W A;  3TAM A;  3VQD A;  4DSE A;  4HCB A;  4CF2 A;  1HQE A;  1NJY A;  2F8S A;  2ZQB A;  2FBY A;  1F21 A;  1SL2 A;  1W0H A;  4WE1 A;  4K8Z A;  1X9S A;  4ID5 A;  4IFY A;  4HCC A;  4FJ8 A;  1KSP A;  1BCM A;  2OPR A;  1FKP A;  3TAN A;  1BGX T;  3I8D A;  1MU2 A;  3DLG A;  3DLK A;  3VA3 A;  4F2S A;  3C6T A;  4Y1C A;  4YFU A;  1UA0 A;  2HHS A;  1LAW A;  2AJQ A;  3TAR A;  3VQC A;  1JXE A;  4W5O A;  1HQU A;  1FKO A;  2IDO A;  4ELU A;  2QKK A;  4KHY A;  2KZM A;  1QSL A;  2FBT A;  3DLE A;  5HBM A;  3TAQ A;  2HNY A;  1KVB A;  3BGR A;  1VSJ A;  2VG6 A;  4B9N A;  4Q5V A;  3WNG A;  1YVU A;  4OKE A;  3P5J A;  3KK2 A;  1SKW A;  4Q0B A;  3AO2 A;  1QE1 A;  1QHT A;  2DFF A;  4ELV A;  1Q8I A;  3WNH A;  4CER A;  1UA1 A;  1QS4 A;  5J2N A;  4M3R A;  1VSL A;  1JLE A;  1S9G A;  2FBX A;  4HTU A;  5K14 A;  1FXX A;  4LY7 A;  2PYJ A;  4DTR A;  3ZT3 A;  4E3S A;  4CGI A;  3SPY A;  4DS5 A;  1NJZ A;  2HVH A;  3OYB A;  3QEP A;  4DFP A;  2O4G A;  1RT4 A;  4IDK A;  5D3G A;  1VK0 A;  3QEX A;  1RT3 A;  3ZT2 A;  1U49 A;  4HVJ A;  4M3X A;  3VQP A;  1C6V A;  4GW6 A;  3WNF A;  4AHC A;  3F9K A;  3ULD A;  2OPS A;  3OYL A;  3K5M A;  1HYZ A;  3AVK A;  4KRF A;  1BI4 A;  4I2Q A;  3DOK A;  4AHR A;  1YT3 A;  4W5T A;  3DI6 A;  4C8O A;  1G15 A;  1QTM A;  4DLG A;  1CLQ A;  1C0T A;  5FDL A;  5C42 A;  4AIL C;  1TAU A;  3HP9 A;  2BDP A;  2OZM A;  3QES A;  4BE0 A;  2Y1J A;  1A5V A;  2KTQ A;  4FK4 A;  3LP3 A;  1RDD A;  3TI0 A;  4O4G A;  1CXQ A;  1WSF A;  3V6D A;  3DLB A;  1JLQ A;  4W5N A;  4HUG A;  3FFI A;  1Z25 A;  3TR8 A;  2D0B A;  4NYN A;  4Y1D A;  4FJ7 A;  4Z4G A;  1Q9X A;  1WSH A;  4BWJ A;  2RN2 A;  2A1S A;  3VQ5 A;  1RTJ A;  4LSL A;  2E6M A;  2Z1J A;  4H4M A;  4FW1 A;  4AH9 A;  4DQS A;  3HJF A;  4KO0 A;  3HPO A;  4FLV A;  1EP4 A;  4CHY A;  1RNH A;  4KHN A;  3TAG A;  4CES A;  1BQM A;  1S1T A;  1NJW A;  1U48 A;  4M3Z A;  1KFD A;  3AA3 A;  4IG0 A;  2XO7 A;  5HLF A;  4FK0 A;  4CCH A;  3AA2 A;  3QNO A;  3S3N A;  2VWK A;  3VQ4 A;  4CJ3 A;  3TAF A;  4AHT A;  4B3O A;  3MEE A;  1YTU A;  4CGH A;  3DOL A;  3F73 A;  1X9M A;  5FRM A;  2LSN A;  3NFA A;  4I9Q A;  5I42 A;  1TK5 A;  2Z1H A;  1TKD A;  4CGF A;  4PQU A;  2ITG A;  1Q9Y A;  1HYS A;  1S1V A;  4FJH A;  4KTQ A;  4ID1 A;  1KVA A;  1FK9 A;  2G8F A;  3CYM A;  3SZ2 A;  1TK8 A;  3QEV A;  1LW2 A;  1HRH A;  1RDA A;  3T19 A;  3AO1 A;  1NK8 A;  2WOM A;  4CIF A;  3KKR A;  1S1X A;  2YNI A;  3VA0 A;  2P5O A;  1BI4 B;  1RCH A;  3LAM A;  4FW2 A;  3OYH A;  4BE1 A;  4CJK A;  3OYF A;  4B9T A;  3RMD A;  4KHU A;  4DTU A;  4OLB A;  1XHZ A;  3L3V A;  1VSK A;  3LWM A;  4KI6 A;  4FLX A;  1KLN A;  1B9D A;  2G8K A;  1XHX A;  3NF7 A;  1TAQ A;  2YKM A;  4Z4I A;  1GOA A;  3KLG A;  1U47 A;  3QIO A;  4J2D A;  4FZX C;  2VG5 A;  1VSF A;  4CFC A;  3KKS A;  4I7F A;  2VWJ A;  1SKS A;  1NOZ A;  1Y97 A;  4DTP A;  4JS5 A;  1BL3 A;  4DLE A;  3CFP A;  4OLA A;  3SUO A;  3SNN A;  1TKX A;  3U3G A;  3KLI A;  1L3V A;  1D9F A;  3P1G A;  4XIU A;  2G8U A;  5HRO A;  2O4I A;  4F8R A;  4Z4C A;  3CM5 A;  1TVR A;  3L2Q A;  3V9X A;  4NYF A;  4CIE A;  4QCL A;  3OYK A;  2IOC A;  4CEE A;  3ALY A; 
#chains in the Genus database with same CATH topology
 4YY3 K;  4C8K A;  4KKO A;  4E1M A;  1M1K O;  4EZ9 A;  1QHA A;  2EWS A;  4KTW A;  1OH7 A;  1KAX A;  1BIZ A;  1I39 A;  3DJC A;  4CIG A;  3FZF A;  4RTF D;  4B1U B;  4W5R A;  3AVC A;  4Z4E A;  2YNG A;  1A5X A;  1EQY A;  3M5R A;  4DTX A;  2HHT A;  4BRO A;  4DR7 K;  2HMP A;  5J2P A;  1GLE G;  1BO5 O;  1QSY A;  4N41 A;  4B1Z A;  1BQN A;  2XY8 A;  2FBV A;  3ZT1 A;  4FZZ A;  3AO4 A;  4FJK A;  2E2N A;  2GBZ A;  5LL6 Z;  3QLH A;  3K5N A;  2YHX A;  2W6L A;  3ZSY A;  3QBX A;  3JAM O;  4RW6 A;  1QQC A;  3H3N O;  4O0I A;  1C0F A;  3ZSZ A;  4RW9 A;  1VQ5 N;  2IC3 A;  3MAQ A;  3M1F A;  4A2A A;  1W2B M;  4KPY A;  1KVC A;  2WBN A;  4OPJ A;  3OVN A;  2E1Y A;  5BRF A;  2HHW A;  1C0U A;  3EKU A;  3O6W A;  3QIP A;  1IH7 A;  1L5U A;  3OS1 A;  3ID6 A;  3C95 A;  3LDN A;  4FVM A;  2XY6 A;  3V81 A;  3AV9 A;  4G1Q A;  2GUP A;  4CGJ A;  4DSF A;  1QZ6 A;  4FSV A;  4C1N I;  1TYQ B;  4FJN A;  3MCA B;  3RSE A;  5AQH A;  3PV8 A;  3SI6 A;  3MEG A;  2ZD1 A;  4JD2 A;  4X66 K;  1WSG A;  4IEE A;  3PX4 A;  1JL2 A;  3N4P A;  3VEX A;  1NGC A;  1HNI A;  3I0R A;  5T7B A;  2O8B A;  2H3G X;  4CBU A;  3QEW A;  4JKD A;  4CGG A;  5AQS A;  4NXM K;  4N5S A;  3VEO A;  3HM9 A;  2ATQ A;  4N76 A;  1NBW A;  4A62 A;  5AQX A;  4IO9 L;  3ISN C;  4FWK A;  3PX6 A;  4KAZ A;  1LWF A;  4B1Y B;  1YXQ A;  1RBR A;  4WYB A;  4EHU A;  1Z6R A;  2O8E A;  4DR4 K;  2KW4 A;  3V1O A;  1BCO A;  4CF9 A;  2IGI A;  3RMA A;  2P9N B;  3CD6 N;  3P4I A;  4A5A A;  3G0Z A;  1XC3 A;  1RDC A;  4H0P A;  4Z4F A;  3ZCM A;  4PL7 A;  1KQS M;  4FXD A;  5CR4 A;  2DFH A;  2HHH K;  3MEC A;  3ENO A;  4N56 A;  3HP6 A;  1MWM A;  4BRD A;  4IZ9 A;  1N34 K;  4PKH A;  3NGI A;  5AQL A;  3SBT A;  4E1N A;  4DS4 A;  4BR9 A;  3RMC A;  3Q7B A;  3SPZ A;  1OVY A;  1KTQ A;  4CHZ A;  1ATN A;  4IG3 A;  3OY9 A;  4MLE A;  1U45 A;  2IAJ A;  1BIU A;  1VSE A;  2YV0 X;  1GOB A;  3HVR A;  4CJU A;  2V7Y A;  3VEZ A;  1YIT N;  2NRX A;  1VQ9 N;  3J81 O;  3SUP A;  3LWL A;  5EOY A;  1YUW A;  4YDU A;  4WFA L;  4AHS A;  3T3F A;  4M42 A;  4DV1 K;  3L2U A;  2EHG A;  3FR0 A;  4JI7 K;  5AQR A;  3EKS A;  4NO7 A;  4LF6 K;  4KV8 A;  4YOT A;  5BPL A;  3QFU A;  5BR9 A;  2P9N A;  3S3O A;  4CD1 A;  4GVE A;  4ELU A;  3QNN A;  5JIC A;  3CER A;  4BRP A;  3ATV A;  3KK3 A;  4CF8 A;  2FLO A;  3V1R A;  1RBT A;  1ATS A;  3V9S A;  4CGD A;  3JSM A;  1JLF A;  1VSM A;  5AQY A;  2F4V K;  1P90 A;  3NGZ A;  1OVQ A;  4ZHR A;  1SL1 A;  2GTD A;  4DQI A;  4KRE A;  3WUH A;  4FWM A;  4GV9 A;  4DTM A;  3B8A X;  1KFS A;  1RBS A;  1J9A A;  5AQG A;  3O4W A;  5HRN A;  4IDH A;  5I3U A;  2D4W A;  5EXW A;  3AA4 A;  3F2K A;  4OGC A;  3OBW A;  1KXP A;  4RW8 A;  2QK9 A;  4K0K K;  1VQ4 N;  2E6L A;  1GLJ O;  2YNF A;  3LAL A;  2HHU A;  3MMV A;  4PKI A;  3GL1 A;  3T1A A;  3ITH A;  5JLH A;  3P31 A;  5LMU K;  3K2P A;  2RKI A;  4DU3 A;  2JWK A;  4KHS A;  3ZX3 A;  3CC4 N;  1K9M O;  3O5B A;  4JI2 K;  2A42 A;  1RT7 A;  4CHP A;  1RDW X;  3RVC A;  3A5M C;  5AZJ A;  3TTC A;  1NWK A;  3S3M A;  4AM7 A;  1WB9 A;  3C6U A;  1S6Q A;  4JKG B;  4EFH A;  4L8R B;  5F2R A;  3MN6 A;  3KWG A;  1NGD A;  4N47 A;  3VQ8 A;  4CZI A;  3KK7 A;  4FWN A;  3DM2 A;  3HPH A;  4CZM A;  3C7N A;  1TL1 A;  3PY8 A;  2B5J A;  3ZSX A;  1W97 L;  4F2R A;  5AZI B;  4JK9 A;  4FVU A;  4IOC L;  4CJ7 A;  2P9S A;  4JKE A;  1RTH A;  4JK8 A;  1BU6 O;  3T69 A;  1RTD A;  4V19 S;  4LC9 B;  4JAX A;  1L3S A;  1HNZ K;  1S1W A;  1O13 A;  3QO9 A;  4DWI A;  1HNV A;  4PKG A;  2YHB A;  4OVL A;  4CJF A;  4CHQ A;  1RDB A;  4BDY A;  3NHG A;  4AHU A;  3PO5 A;  3P38 A;  2HMI A;  5KPZ A;  2IIR A;  3VQD A;  4HCB A;  1NU0 A;  1NJY A;  2F8S A;  1NGF A;  4WE1 A;  4K8Z A;  2PAV A;  1KSP A;  2OPR A;  4NLC A;  4IO8 A;  1S72 N;  3IKM A;  3NVK A;  4M7X A;  3DLK A;  2HHS A;  3C6T A;  1Z05 A;  1JXE A;  4W5O A;  1FKO A;  3O1W A;  2NRT A;  1K73 O;  3WNG A;  3QML A;  1IV0 A;  1YVU A;  4Q0B A;  3E1Y A;  3FZH A;  4BQL A;  3WQU A;  4H0O A;  1JLE A;  2FF6 A;  2PYJ A;  4LY7 A;  3BZC A;  1ILY A;  4CGI A;  3SPY A;  4JK7 A;  1NJZ A;  4R79 A;  3QEP A;  4FWP A;  4NB4 A;  3C65 A;  4WCE L;  5D3G A;  3QEX A;  4WFB L;  4HVJ A;  5IWA K;  3ZX0 A;  2VCP A;  3AVK A;  3VGK A;  1BI4 A;  4AHR A;  3DOK A;  1NLV A;  4DV6 K;  1YT3 A;  3MK6 A;  4W5T A;  4C8O A;  5FPE A;  4DLG A;  2QWM A;  3HP9 A;  2BDP A;  2OZM A;  3QES A;  2IVN A;  4BRF A;  5ADX H;  3CME N;  4FK4 A;  2E2O A;  2P9U B;  4O4G A;  1CXQ A;  4B1X B;  3O9U A;  3EL2 A;  2D0B A;  4NYN A;  3FFK B;  4FJ7 A;  4WF9 L;  4FOI A;  1Q9X A;  1WSH A;  4IFE A;  1BDG A;  4XEI A;  4LSL A;  4BRN A;  4FW1 A;  5AQP A;  1QZ5 A;  4JNE A;  1BQM A;  1OKJ A;  1NJW A;  1U48 A;  5HLF A;  4KBO A;  4FK0 A;  3UB5 A;  3CCV N;  4KH5 A;  3O9Q A;  3EE9 A;  2VWK A;  1S3X A;  5AQK A;  3THX A;  4CGH A;  1X9M A;  2LSN A;  2Q0U A;  4PQU A;  2Z1H A;  1Q9Y A;  1DKG D;  3VF6 A;  4KTQ A;  4ID1 A;  3VTI A;  2G8F A;  1N33 K;  1LW2 A;  3AAQ A;  1RDA A;  3AO1 A;  2WOM A;  3LM9 A;  4CZF A;  4CIF A;  3KKR A;  3CCL N;  4FL9 A;  3SAG A;  3RMD A;  4DTU A;  4OLB A;  1XHZ A;  1N36 K;  1VSK A;  3ZEU B;  1KLN A;  2RE2 A;  3ZLJ A;  2YCH A;  4Z4I A;  3IFR A;  4FZX C;  2PBD A;  2VG5 A;  3UKR B;  3KKS A;  2D0P A;  1GLC G;  1NOZ A;  2D0O A;  4KHP K;  4OLA A;  4PHT X;  3SNN A;  3AAR A;  3ID8 A;  3KLI A;  3CM5 A;  1TVR A;  5AQV A;  4CIE A;  4QCL A;  4CHO A;  3PLA A;  2XHB A;  4O5F A;  3HL8 A;  1XNQ K;  3ZSW A;  3IUC A;  3KLE A;  1ZXO A;  2F9W A;  2O8F B;  3TTF A;  3J7Z O;  2OZS A;  2VG7 A;  4BRC A;  2BE2 A;  3CM6 A;  4FPB A;  3FGU A;  3L2R A;  3D7E O;  4LF5 K;  2NRV A;  1NOY A;  3A8Y A;  3CFR A;  1ASV A;  1JXB A;  1FJG K;  2ZE2 A;  5JLF A;  1TGO A;  4XH4 A;  3LZI A;  3OS2 A;  1EWR A;  2RHK A;  4E7K A;  1XQS C;  4CJL A;  4O8K A;  1U2V A;  2O8C B;  5FLX O;  4J2A A;  3CCQ N;  4I2P A;  1SKR A;  4WQ4 C;  5LY3 A;  1SUQ A;  1YVN A;  2NUB A;  4HUF A;  4CEQ A;  1G99 A;  3VGL A;  1U04 A;  3W3D A;  1QVF M;  1TV6 A;  3S9H A;  1ZBU A;  1IJJ A;  3CFO A;  1CZ9 A;  4FM2 A;  3VGM A;  3TAE A;  4B1V A;  2HVI A;  4LF9 K;  4DF8 A;  3OA9 A;  3ULE A;  3Q7C A;  4MQ3 A;  4A59 A;  3IS9 A;  1K8K B;  2PZS A;  1T6D A;  4BC2 A;  3THY A;  3CJ7 A;  4CJS A;  4U7B A;  3OJS A;  4M3Y A;  3LL3 A;  2QEX N;  4EZ6 A;  2GWJ A;  2FXU A;  2VGM A;  2Z1G A;  3L2W A;  2OTJ N;  4KB1 A;  3LDS A;  3U8X A;  1HPM A;  1VQP N;  3HST B;  2KQ2 A;  1RT1 A;  3ZET A;  3VES A;  4A2B A;  1VQN N;  1ZBL A;  3NF9 A;  2P5G A;  4DU1 A;  4HHT A;  1IKV A;  3SV3 A;  4FLZ A;  4I6M B;  4JI1 K;  4LFC K;  3LAK A;  1RBU A;  4WQ5 A;  3MXJ A;  4GVM A;  4JHD B;  2PY5 A;  2FF3 B;  2QWP A;  3IRX A;  2A6A A;  4IOA L;  4AQY K;  3HYF A;  4H8K A;  3SMP A;  4DV3 K;  3JYT A;  5GAH P;  4QOZ B;  3EY1 A;  5JS1 A;  3NF6 A;  4O8U A;  2DY4 A;  4JS4 A;  4JEP A;  1Q82 O;  4Z4H A;  1D8Y A;  3LAN A;  4YHH K;  5KGX A;  1K6Y A;  2I7N A;  4CI6 A;  1YTA A;  2BGG A;  1U4B A;  2KKZ A;  4ILH A;  3N4Q A;  3ZX2 A;  3EZW A;  1HKC A;  3QET A;  4DFM A;  1XI1 A;  3R9P A;  4B9M A;  1YAG A;  3CJ1 A;  4MFB A;  5KTQ A;  1XC9 A;  1E4F T;  2YNH A;  3NBP A;  2FSJ A;  3D2E B;  5GAG P;  3NH1 A;  1HPZ A;  3AVA A;  4GKJ K;  3D45 A;  2YKN A;  2ASP A;  3L3U A;  2GEL A;  5J1E A;  3SJJ A;  1LAV A;  5E41 A;  4NCG A;  3SV4 A;  5HRS A;  5M1O A;  1IKY A;  5LJW A;  4KFB A;  4AHV A;  5AQZ A;  3GBT A;  1QVG M;  4CEA A;  3M8R A;  3GOI A;  4YNQ A;  3AVL A;  4B8A B;  3I56 N;  3GG4 A;  2VYP A;  3K58 A;  2GUI A;  4DQR A;  4ZTJ A;  3KK1 A;  3O3G A;  2GEM A;  1J5O A;  3DRR A;  4B9U A;  3CCJ N;  4I9L A;  2F8T A;  3V9U A;  3DLB A;  2I5J A;  4RCH A;  4CBX A;  3THV A;  3AVG A;  5HP1 A;  4CFA A;  3BF3 A;  1D5A A;  2YJF A;  5BR8 K;  4DV0 K;  3VET A;  5F1X A;  1NGA A;  5LJV A;  4FJM A;  1J53 A;  1JLG A;  5AZJ B;  2NRZ A;  1HJR A;  4EAH D;  2OAN A;  3P83 D;  4ILJ A;  2G8H A;  4KI4 A;  2GV9 A;  3SUN A;  4DQQ A;  4LD0 A;  3OHR A;  3THW B;  3AVB A;  3W0L A;  2QWN A;  3SQ1 A;  3KTQ A;  3VQ9 A;  4KB0 A;  4FYD A;  5F0X A;  4DTS A;  2V7Z A;  4GNI A;  2Y1I A;  3HPG A;  4JKC A;  2E20 A;  5DK5 A;  3RR7 A;  5M1K A;  2AP1 A;  1Y64 A;  3EEQ A;  3M8P A;  5CYQ A;  4GKK K;  1QQM A;  1E3M A;  3G10 A;  1A5W A;  3O9S A;  1VSH A;  4CFB A;  4CED A;  3RWU A;  3C0B A;  3KVG A;  2NRW A;  3H6E A;  1U6Z A;  4NCB A;  4ELT A;  3U6F A;  3OYC A;  5CHI A;  3CC7 N;  4JI0 K;  4X64 K;  4CF0 A;  3FLC O;  1I94 K;  2HB5 A;  3AVN A;  3ZEU A;  2V51 B;  4DF4 A;  3P39 A;  2GX9 A;  3UE5 A;  5C12 A;  4BAC A;  3VQB A;  3DAW A;  2QWO A;  2V52 B;  4J2E A;  1NGE A;  3AVI A;  3VN5 A;  1IG9 A;  1RT2 A;  5M1Q A;  3E9O A;  1GLA G;  1RDU A;  3D6R A;  1J6Z A;  3AO5 A;  4BWM A;  4CHN A;  1IBK K;  3K57 A;  2YHA A;  2HHQ A;  1EX4 A;  4DSK A;  1VRT A;  4FJL A;  1OH5 A;  4DUY K;  3KIO A;  4FLT A;  1I3A A;  1M90 O;  1MWK A;  2JWL A;  5AQW A;  1UOC A;  1VSD A;  3M3Z A;  3KD1 E;  1YJ9 N;  3NAE A;  3LDQ A;  1NNE A;  4FZY A;  1H1V A;  4CJT A;  4EP5 A;  1DTQ A;  3A5N C;  2JLE A;  2O4I A;  3K59 A;  4DCH A;  4CF1 A;  2FSN A;  4FLY A;  4PUO A;  1JL1 A;  2G8W A;  4B3T K;  4CF2 A;  1HQE A;  1D4X A;  4ISE A;  2ZQB A;  4JKH A;  4FJ8 A;  1E4G T;  4HCC A;  3WXK A;  4LFA K;  1BGX T;  3I8D A;  3A5L C;  5BN8 A;  1ZC6 A;  4Y1C A;  5ELZ A;  2IDO A;  4KHY A;  3I55 N;  2VWB A;  2ZJP L;  1VQO N;  2FBT A;  3HOT A;  4B9N A;  5ADX A;  4OKE A;  3KK2 A;  4BR0 A;  2ASM A;  3T7Z A;  1UA1 A;  1QS4 A;  4M3R A;  1Q7Y O;  3WXJ A;  3WXI A;  3R6M A;  4AM6 A;  1FXX A;  4K41 A;  5AQJ A;  3ZT3 A;  4DS5 A;  2HVH A;  1LCU A;  3HZ6 A;  4M3X A;  2BH1 A;  2OPS A;  3OYL A;  1YI2 N;  3K5M A;  2A40 A;  2FSK A;  4I2Q A;  3E9P A;  2ZJR L;  3DI6 A;  1G15 A;  1QTM A;  1C0T A;  5C42 A;  3ENH A;  2QWQ A;  4CZK A;  4HUG A;  3FFI A;  5JMV A;  4Y1D A;  4Z4G A;  1IBM K;  2A1S A;  5M1F A;  1TYQ A;  5HL7 L;  4AH9 A;  5BN9 A;  3HPO A;  4BR7 A;  4CHY A;  1S1T A;  2IVO A;  4JD2 B;  4IG0 A;  3AA3 A;  4NLB A;  3S41 A;  4CCH A;  4H0T B;  4KH4 A;  4BRI A;  4CJ3 A;  3MWT A;  3TAF A;  4AHT A;  1DT9 A;  2O8C A;  3DOL A;  3F73 A;  5FRM A;  1RGI A;  5I42 A;  1TK5 A;  1TKD A;  1S1V A;  4FJH A;  1KVA A;  1FK9 A;  4BG9 A;  1HRH A;  3T19 A;  3KZB A;  1NK8 A;  3F9M A;  3TSP A;  3J8A A;  2NNW A;  2YNI A;  3VA0 A;  1RCH A;  3LAM A;  4FW2 A;  4K25 A;  1XMO K;  4J8F A;  4KHU A;  1N32 K;  3KHY A;  4MLH A;  2YX6 A;  3LWM A;  4KI6 A;  2O8F A;  3CXC M;  3VEY A;  3R3L A;  3NF7 A;  1TAQ A;  1U47 A;  3QIO A;  1WBB A;  1VSF A;  4CFC A;  2UXD K;  4JS5 A;  1BL3 A;  2A41 A;  1OH8 A;  3P1G A;  1JJ2 M;  4XIU A;  5C0Y A;  5HRO A;  3OTO K;  2Q31 A;  4F8R A;  1XMQ K;  3V9X A;  4NYF A;  2D5R A;  4B08 A;  5EVZ A;  4FLW A;  3IAY A;  5HOO A;  2A5X A;  4BE2 A;  2Q36 A;  2XY5 A;  4F3T A;  4W5Q A;  2XY7 A;  3THX B;  2QKB A;  4PWD A;  3EO3 A;  5KI6 A;  4A61 A;  3PIP L;  3CQX A;  4MDA A;  1V4S A;  1HX1 A;  2P51 A;  1SV5 A;  3QIC A;  1IBL K;  1TUY A;  4MO5 A;  1SS6 A;  3MDQ A;  5AQF A;  2OYQ A;  1ZBF A;  3O1B A;  1T8E A;  3T1Y K;  1NGB A;  4M3T A;  2HNZ A;  4O44 A;  4H0V B;  1QSS A;  1JCE A;  1ATR A;  2IS3 A;  2HBL A;  5CY4 A;  2P9P B;  2Z1I A;  3BUZ B;  3C6H A;  1HYV A;  5DM7 L;  2G8I A;  3ASM A;  4DKW A;  4HWI A;  1SL0 A;  4H4O A;  3OYM A;  2WUS A;  1S6P A;  3THY B;  4E0D A;  3V1Q A;  1CLQ A;  3DMJ A;  4RW7 A;  3C94 A;  3L2V A;  3CPE A;  3O3H A;  3DLH A;  3SUQ A;  2R7Y A;  2ZGZ A;  2X6S A;  3AVH A;  4BVO A;  5KRT A;  3CJA A;  4DFJ A;  4R5P A;  3CMA N;  2D0C A;  1CZA N;  4M3U A;  3VQA A;  4H0Y B;  2D1K A;  5AQN A;  3WEE B;  5GIO A;  4BRK A;  1RT5 A;  1YF5 L;  4KTZ A;  4ICL A;  4M3W A;  2YJE A;  3VOV A;  2E2Q A;  5H1S Q;  4JI8 K;  3WNE A;  3J7Y P;  1HNX K;  1UAX A;  1BA1 A;  1HLU A;  1NKE A;  1HMV A;  3VEW A;  4E7J A;  3A5O C;  1GLD G;  1NJX A;  5DMR A;  3CJB A;  1ZBH A;  1X3N A;  3EZ5 A;  5FPM A;  3TU5 A;  2F9T A;  4C1N K;  1YHQ N;  4CK3 A;  4UQG A;  4GV6 A;  2GWK A;  3DXK B;  4FJ5 A;  3AA5 X;  4IWV A;  3VF2 A;  1TKZ A;  1TK0 A;  3SK3 A;  2NRH A;  1EXQ A;  3OYD A;  5BRD A;  2E5L K;  5TKW A;  1WNS A;  4IJA A;  1NGH A;  3I0S A;  1LW0 A;  2BAN A;  3SJH A;  2KLA A;  2WON A;  3HK2 A;  1BHL A;  3LDO A;  1T7P A;  2HHX A;  3T1H K;  3HM8 A;  3K5L A;  4CJ5 A;  5CE3 A;  5M1N A;  4O55 A;  1ZYQ A;  4OGE A;  5I9E B;  4K43 A;  3PX0 A;  5TKY A;  2YHY A;  3CI5 A;  3HT3 A;  2E1Z A;  3ZSQ A;  5AZI A;  1ASU A;  3U9Z A;  4KHW A;  1LWE A;  1IO2 A;  1NM1 A;  3L8B A;  3FE1 A;  5AQO A;  4O5B A;  2EX3 A;  4BC5 A;  4FM0 A;  4K8X A;  4DTN A;  2CGK A;  3SQ2 A;  1RBV A;  4BGA A;  4FM1 A;  3QBW A;  1T6C A;  3J80 O;  4FCY A;  2WFB A;  4FO0 A;  1VQM N;  3ZSR A;  3TWH A;  3BY5 A;  1IG8 A;  3HO1 A;  4FJG A;  4B1W B;  3U9D A;  4HUE A;  2P9I B;  4CEF A;  4E7L A;  4CEC A;  3LP1 A;  3M6G A;  3NCI A;  1UWB A;  3U4L A;  3AO3 A;  3O9T A;  1Z26 A;  2OPQ A;  4BRE A;  4DTO A;  3SQ0 A;  1WAF A;  3MN7 A;  3B6P A;  3BF1 A;  1R59 O;  1D9D A;  5AQM A;  3D2F A;  1BWF O;  3LP2 A;  4BC3 A;  2QI2 A;  3OJU A;  5C24 A;  1X9W A;  2ETJ A;  3A2F A;  1NK5 A;  3ZYY X;  5LMN K;  1YIJ N;  3MED A;  1U2V B;  4JRQ A;  1MDU B;  3LDP A;  4B9V A;  1XWL A;  3NGY A;  4CW7 B;  3BZK A;  4FLU A;  4BRH A;  4DR3 K;  2OTL N;  2B6A A;  2P1J A;  1NGG A;  2QW9 A;  3JS6 A;  3NVM A;  4B8C A;  4DSI A;  2QXL A;  3MX5 A;  1VQ6 N;  4IBN A;  4M63 C;  2Q3S A;  2W42 A;  3QFP A;  4E7I A;  3L0Q A;  3AVF A;  3VQ6 A;  3SQ4 A;  4B3R K;  4PY5 A;  3NH0 A;  1NKC A;  4CFD A;  3A0I X;  3DWL A;  4YOW A;  3RRH A;  3CHW A;  2ZM6 K;  2J4R A;  4DB3 A;  3UKR A;  4B9S A;  4J2B A;  1DLO A;  2E2P A;  3OYI A;  3NF8 A;  4DHY A;  1DEJ A;  3B6O A;  2KFZ A;  3NH2 A;  1OH6 A;  1NJI O;  5GAD P;  3O3F A;  3RSE B;  4LH5 A;  2D0A A;  2ZGY A;  4BR2 A;  4E19 A;  2CGL A;  4ZTF A;  5JVH L;  1VAZ A;  3CCR N;  3H08 A;  5KQD A;  4IOX A;  3NMU A;  4CJ4 A;  2JGU A;  5M1P A;  3EYZ A;  4DR5 K;  4OJR A;  2YI1 A;  3O4Q A;  4BC4 A;  4JKB A;  2B4J A;  5KRS A;  5AQQ A;  3LZJ A;  1N8R O;  5SZT A;  4QS9 A;  3CC2 N;  1S5J A;  3MN9 A;  4C8L A;  4FJJ A;  3CIP A;  4OPK A;  3TAP A;  2X78 A;  3RRG A;  5JS2 A;  4KHQ A;  4FK2 A;  4JYA K;  3M8Q A;  1T03 A;  4JI3 K;  3QIN A;  4IEI A;  3ZT0 A;  1C1B A;  5AR0 A;  2NLX A;  2XRI A;  5SWM A;  1FW6 A;  5GIN A;  2OCE A;  4TSX A;  5HRR A;  4M41 A;  2P9K A;  3K0S A;  5J2M A;  2F7T A;  3O8M A;  1WSI A;  3K5O A;  4M45 A;  4BRM A;  3LDL A;  1JKH A;  2ZJQ L;  1P8Z A;  3AGK A;  1VRU A;  3HTV A;  5BPN A;  1WBD A;  4BDP A;  1SQK A;  4BRG A;  4DSE A;  2ZF5 O;  5C10 A;  3SMS A;  1F21 A;  5FPN A;  4ID5 A;  5A2Q O;  4H03 B;  2HBK A;  4JN4 A;  1FKP A;  3TTD A;  2PFU A;  1MU2 A;  3DLG A;  4F2S A;  1UA0 A;  3TAR A;  3VQC A;  4CZE A;  1HQU A;  2KZM A;  1QSL A;  4YOR A;  5KPT A;  2HBJ A;  3DLE A;  5HBM A;  3BGR A;  1KVB A;  3AAP A;  1VSJ A;  2VG6 A;  4Q5V A;  3VF4 A;  3J7A P;  3P5J A;  1SKW A;  4BGB A;  1QE1 A;  5E84 A;  1QHT A;  2CH6 A;  4ELV A;  3WNH A;  3L6Q A;  3ZET B;  1VSL A;  4CZL A;  2FBX A;  5K14 A;  4DTR A;  4L3Q A;  4MO4 A;  3SAH A;  4DFP A;  4CVN E;  4CD3 A;  2O4G A;  4IDK A;  3DXK A;  1VK0 A;  3SAF A;  4OPA A;  4DR1 K;  2BTF A;  4B9Q A;  1C6V A;  4GW6 A;  4JHD A;  3F9K A;  4XH5 A;  4KRF A;  1EWQ A;  1TAU A;  5FDL A;  2E8A A;  4BE0 A;  1A5V A;  3VPZ A;  5GIP A;  3TI0 A;  3VEN A;  4JKF A;  1WSF A;  3V6D A;  4JKA A;  3WXM B;  3I33 A;  1Z25 A;  2HOE A;  3TR8 A;  4BVP A;  2P9K B;  4BRQ A;  2UU9 K;  2RN2 A;  2UUB K;  3VQ5 A;  2VQF K;  4H4M A;  1NG9 A;  4DQS A;  3HJF A;  4KO0 A;  1EP4 A;  1RNH A;  2CGJ A;  4C23 A;  1LOT B;  3L4I A;  2XO7 A;  2O8E B;  1ZBS A;  3AA2 A;  4B3S K;  3MEE A;  1K8A O;  2ZWH A;  2P9P A;  3GE1 A;  3CQY A;  3HOS A;  3NFA A;  4I9Q A;  4CGF A;  5DM6 L;  1HYS A;  3HBT A;  5EX5 A;  4JKG A;  3CYM A;  1TK8 A;  3QEV A;  5BRE A;  2WC9 A;  1XNR K;  4FWR A;  3DXM A;  1S1X A;  2P5O A;  1SZ2 A;  1BI4 B;  3OYH A;  1B9D A;  1XHX A;  4DR6 K;  1KC8 O;  3HI0 A;  3KLG A;  1RFQ A;  4EIA A;  4I7F A;  2O8D B;  3WEE A;  4OO1 J;  4DTP A;  4FWQ A;  3SUO A;  5B8H A;  3U3G A;  1L3V A;  2ASO A;  4OPH A;  3L2Q A;  4LF4 K;  3CCE N;  3CET A;  3OYK A;  1RDD A;  3CCM N;  1JCG A;  3PSF A;  1NK6 A;  4DG1 A;  3DYA A;  4CZG A;  5FRO A;  4BQZ A;  4DFK A;  2P9S B;  3MXI A;  2QWR A;  3L4Q A;  3IMX A;  3VMF B;  4X62 K;  4CK1 A;  2HF4 A;  4Y0W A;  4E1J A;  1WLJ A;  2HBM A;  2UUC K;  1SAZ A;  4NCA A;  1NK0 A;  3CCS N;  3BP8 A;  4JRP A;  1HR0 K;  4NXN K;  4OKK A;  4WFN L;  4IXC A;  1J54 A;  4B3M K;  2HF3 A;  2X74 A;  3NE6 A;  5KPR A;  1ZBI A;  4BR4 A;  1BA0 A;  4HTL A;  3OYA A;  2KZZ A;  5FRN A;  4C8M A;  4K42 A;  3OW2 M;  3FZL A;  1X1P A;  5AFU A;  1WN7 A;  3DRP A;  1JLB A;  4DSL A;  4H5N A;  3O80 A;  4CEZ A;  4UY8 O;  2O8D A;  1KCF A;  3THW A;  1KLM A;  2AJQ A;  3KD5 E;  3IDH A;  4IKF A;  3D2F B;  1CZB A;  5C15 A;  3VQE A;  4BDZ A;  3K9K A;  1S1U A;  3O4N A;  4C8N A;  4LFB K;  4JLH A;  3QEI A;  3MXM A;  2QTD A;  4BR5 A;  3KJV A;  4JI5 K;  3ZSO A;  4GMJ B;  1W7A A;  3ENB A;  4OKJ A;  4FJI A;  1O1W A;  5KGW A;  3CQ8 A;  2BUP A;  3VEV A;  3K9J A;  3O9R A;  1NK9 A;  3RR8 A;  3OYJ A;  1WSJ A;  1REV A;  4CJQ A;  2DFE A;  5CYM A;  4GV3 A;  3OYG A;  1VQ7 N;  2UYT A;  5C25 A;  3MX2 A;  4KH6 A;  1B9F A;  3CF5 L;  1R0A A;  3E66 A;  2G8V A;  4CZJ A;  1JLC A;  5EU7 A;  3DLL L;  4CK2 A;  4H5T A;  1NK4 A;  3ZSV A;  3C6A A;  1KRP A;  2YHW A;  3AVJ A;  4RG8 A;  5AQU A;  2UUA K;  1CXU A;  3IG1 A;  3F5T A;  1DTT A;  3EN9 A;  4FJ9 A;  4DR2 K;  4BRL A;  3HSC A;  3TSU A;  4F3O A;  1J5E K;  2Q2R A;  3BDP A;  3G25 A;  4DMN A;  1C1A A;  4CJV A;  2RPI A;  1T3V A;  4IFV A;  4E89 A;  2NRR A;  3DLR A;  3ATU A;  4FPA A;  3CJ9 A;  1HJO A;  2OPP A;  3RMB A;  1VQK N;  4FWL A;  4CE9 A;  2VQE K;  5J2Q A;  3FZM A;  3O08 A;  4JI4 K;  3CG7 A;  2A1R A;  1L3U A;  3HVT A;  3LM2 A;  3H1Q A;  3QDK A;  1L3T A;  3KLH A;  3RTV A;  3D0P A;  3SBG A;  3PO4 A;  3PUF A;  1NK7 A;  3QB0 A;  4DQP A;  2QXF A;  2Q97 A;  3OBY A;  4CJR A;  1NGI A;  2OA8 A;  3E01 A;  1V4T A;  1LWC A;  3CCU N;  1ITG A;  2P9L A;  3V9Z A;  4CBW A;  2F96 A;  4Z0U A;  3LPT A;  4QAG A;  1TKT A;  4DU4 A;  1VHX A;  5AFU H;  4AF1 A;  3E9L A;  4F4K A;  1T05 A;  2PYL A;  5CZ2 A;  5AQI A;  2HW3 A;  5IT9 O;  4CJE A;  3OYN A;  4EP4 A;  2UXC K;  3AGR A;  1NKB A;  3OS0 A;  4JI6 K;  2HND A;  3G71 N;  1WSE A;  3SYZ A;  4QS8 A;  1DGK N;  3ZT4 A;  1WUA A;  3VQ7 A;  4CJP A;  4DV2 K;  3SCX A;  1LV5 A;  3UKU A;  3V4I A;  3AVM A;  4H5V A;  1IKX A;  1ASW A;  4CEB A;  4FJX A;  1N5Y A;  3GDQ A;  3LPU A;  3MN5 A;  4LF7 K;  3HXM A;  3OYE A;  1B92 A;  1EKE A;  1IKW A;  1VQ8 N;  3H1V X;  1HUX A;  2AA4 A;  3DXM B;  1C1C A;  1ESV A;  1GOC A;  5AQT A;  2Q0R A;  3C7N B;  2Q1N A;  3FZK A;  4ISF A;  2I7P A;  4DSJ A;  4LH4 A;  2P9L B;  2P9I A;  3AY9 A;  3WXL A;  3U3Y A;  1RT6 A;  3UKU B;  4WQ5 C;  2O8B B;  3WT0 A;  3M8S A;  1RIL A;  5GAE P;  4QS7 A;  5EY4 A;  2RF2 A;  1S9E A;  4RWT A;  4YOX A;  2X6N A;  1WAJ A;  3DRS A;  3TAB A;  3UIQ A;  1C0M A;  4DV7 K;  4B9L A;  1JLA A;  3G6E N;  4PL8 A;  4PA1 A;  2DTU A;  1W9H A;  1TL3 A;  3PIO L;  1X3M A;  1K8K A;  4EHT A;  3EE8 A;  4DTJ A;  2DPN A;  4WQ4 A;  4H0X B;  3R1X A;  4O0J A;  1HNW K;  5KQ8 A;  1T44 A;  1EET A;  3NDK A;  1QQO A;  4CJW A;  1N6Q A;  3QER A;  3KLF A;  4Z94 A;  1HKB A;  2A3Z A;  1XUP O;  1JCF A;  3TPQ A;  1BIS A;  1KD1 O;  4LF8 K;  2KFN A;  1BG3 A;  1S22 A;  1KAY A;  4F9O A;  2WTU A;  2HHV A;  1MA9 B;  5HRP A;  4YOV A;  3KWI A;  3PSI A;  5CZ1 A;  4I6M A;  3VQQ A;  4DV4 K;  1HKG A;  2E4L A;  4ILG B;  3V9W A;  3TSQ A;  2FC0 A;  3LP0 A;  4E7H A;  1RTI A;  4RW4 A;  1VSI A;  1WOQ A;  4CEO A;  1BUP A;  2VGN A;  4LSN A;  3HRG A;  3TAM A;  4BG8 A;  3H3O B;  2FBY A;  1SL2 A;  1GLB G;  1W0H A;  1GLL O;  3D2E A;  1X9S A;  4IFY A;  1BCM A;  4OX9 K;  3R8E A;  3TAN A;  4A57 A;  3VA3 A;  5E26 A;  4DV5 K;  2KHO A;  4YFU A;  1X9J A;  1LAW A;  2W6K A;  2QKK A;  1NMN A;  3VER A;  2IVP A;  2E88 A;  1BOT O;  3TAQ A;  2HNY A;  4YOU A;  4GY2 B;  1VQL N;  1EO1 A;  3AO2 A;  3MWP A;  2DFF A;  1Q8I A;  4CER A;  5FPD A;  3ULE B;  5J2N A;  5MLC Q;  1S9G A;  4HTU A;  2W40 A;  4E3S A;  3OYB A;  1RT4 A;  2QA4 N;  1U49 A;  1RT3 A;  3ZT2 A;  3VQP A;  3WNF A;  4AHC A;  2NZT A;  1TUU A;  3ULD A;  4G9Z A;  1HYZ A;  5C2F A;  2UXB K;  4AIL C;  3JXU A;  3MCP A;  2Y1J A;  4FWS A;  2KTQ A;  4DQ8 A;  3LP3 A;  4MDB A;  4W5N A;  1JLQ A;  1Q18 A;  1QQN A;  4FWO A;  4A5B A;  4BWJ A;  4JV5 K;  1RTJ A;  2E6M A;  2Z1J A;  2HST A;  3H46 O;  1Q81 O;  4FLV A;  2QWL A;  4KHN A;  3TAG A;  4CES A;  4YDU C;  2CH5 A;  4M3Z A;  1KFD A;  4XH1 A;  3BEX A;  3QNO A;  3S3N A;  3WQT A;  4YOY A;  3VQ4 A;  4B3O A;  1YTU A;  2P9U A;  4BY9 C;  2ITG A;  4H5W A;  4FOE A;  3SZ2 A;  3CPW M;  5C2D A;  3H45 C;  3I8B A;  1NMD A;  4IJN A;  1KAZ A;  4ISG A;  4BE1 A;  4CJK A;  3OYF A;  1YJW N;  4B9T A;  4BRA A;  1Q86 O;  3L3V A;  3CJC A;  1YJN N;  4FLX A;  5BRH A;  2QM1 A;  3SLC A;  2G8K A;  3G4S N;  4H5R A;  5BPM A;  2YKM A;  1GOA A;  4DUZ K;  1C0G A;  1GLF O;  2W41 A;  4U67 L;  1NGJ A;  4J2D A;  4M7Y A;  4CZH A;  2VWJ A;  1SKS A;  1Y97 A;  2ITM A;  4X65 K;  4DLE A;  3CFP A;  1TKX A;  1D9F A;  2G8U A;  5JVG L;  4Z4C A;  5AJ3 K;  2IOC A;  3VTH A;  4CEE A;  3ALY A; 
#chains in the Genus database with same CATH homology
 2D5R A;  4B08 A;  4C8K A;  2XHB A;  4KKO A;  4E1M A;  3HL8 A;  3ZSW A;  4KTW A;  4FLW A;  1NK6 A;  4DG1 A;  3IAY A;  4EZ9 A;  1BIZ A;  3DYA A;  1I39 A;  3KLE A;  4BE2 A;  2XY5 A;  4F3T A;  5FRO A;  4CIG A;  4W5Q A;  2XY7 A;  2OZS A;  4DFK A;  2VG7 A;  2QKB A;  4W5R A;  3MXI A;  4PWD A;  2BE2 A;  3AVC A;  3CM6 A;  4Z4E A;  2YNG A;  5KI6 A;  1A5X A;  4CK1 A;  3L2R A;  4DTX A;  1WLJ A;  2HHT A;  1NOY A;  2P51 A;  1SV5 A;  4NCA A;  3CFR A;  1ASV A;  1NK0 A;  5J2P A;  1JXB A;  2OYQ A;  4JRP A;  1QSY A;  1ZBF A;  2ZE2 A;  4OKK A;  1BQN A;  2XY8 A;  4N41 A;  1TGO A;  1T8E A;  2FBV A;  1J54 A;  3ZT1 A;  3LZI A;  2X74 A;  3AO4 A;  3NE6 A;  4FJK A;  4FZZ A;  2HNZ A;  2GBZ A;  4O44 A;  4M3T A;  1QSS A;  3OS2 A;  1ZBI A;  3QLH A;  2IS3 A;  3K5N A;  3OYA A;  4E7K A;  2KZZ A;  4CJL A;  5FRN A;  3ZSY A;  5CY4 A;  4C8M A;  2Z1I A;  1X1P A;  4RW6 A;  1HYV A;  2G8I A;  3DRP A;  1QQC A;  1WN7 A;  1JLB A;  4I2P A;  4O0I A;  1SKR A;  4DSL A;  4J2A A;  3ASM A;  3ZSZ A;  4CEZ A;  4RW9 A;  1SL0 A;  4H4O A;  3OYM A;  1SUQ A;  1KCF A;  1S6P A;  2IC3 A;  1KLM A;  3V1Q A;  3MAQ A;  3KD5 E;  3DMJ A;  4RW7 A;  2NUB A;  4E0D A;  3C94 A;  4HUF A;  4IKF A;  3L2V A;  4CEQ A;  1CZB A;  3O3H A;  1U04 A;  4KPY A;  3VQE A;  1KVC A;  3DLH A;  4BDZ A;  1S1U A;  3O4N A;  4C8N A;  3OVN A;  4OPJ A;  2R7Y A;  1TV6 A;  3SUQ A;  2X6S A;  3AVH A;  4JLH A;  5KRT A;  1ZBU A;  3S9H A;  3QEI A;  3MXM A;  4DFJ A;  3CFO A;  4R5P A;  1CZ9 A;  3KJV A;  4FM2 A;  3ZSO A;  4GMJ B;  2HHW A;  1C0U A;  3TAE A;  2D0C A;  3QIP A;  1IH7 A;  1L5U A;  2HVI A;  4OKJ A;  3OS1 A;  4FJI A;  4DF8 A;  4M3U A;  1O1W A;  5KGW A;  3VQA A;  3C95 A;  4MQ3 A;  4FVM A;  3CQ8 A;  3IS9 A;  2XY6 A;  1NK9 A;  3RR8 A;  2PZS A;  1RT5 A;  3OYJ A;  3V81 A;  1WSJ A;  3AV9 A;  4G1Q A;  4CJS A;  4M3Y A;  4CGJ A;  3OJS A;  4DSF A;  1REV A;  4KTZ A;  4ICL A;  4CJQ A;  4M3W A;  4EZ6 A;  2DFE A;  4FJN A;  5CYM A;  3OYG A;  2Z1G A;  3WNE A;  3L2W A;  1UAX A;  3PV8 A;  3SI6 A;  1NKE A;  1HMV A;  3MEG A;  5C25 A;  2ZD1 A;  4E7J A;  4KB1 A;  3LDS A;  1WSG A;  1B9F A;  1R0A A;  3PX4 A;  1JL2 A;  1NJX A;  2G8V A;  3HST B;  5DMR A;  1ZBH A;  2KQ2 A;  1RT1 A;  1JLC A;  1HNI A;  5EU7 A;  3I0R A;  3EZ5 A;  5T7B A;  1ZBL A;  3NF9 A;  2P5G A;  4CK2 A;  4DU1 A;  4HHT A;  3QEW A;  1IKV A;  4CGG A;  4N5S A;  4CK3 A;  3SV3 A;  4UQG A;  4FLZ A;  1NK4 A;  3HM9 A;  2ATQ A;  3LAK A;  1RBU A;  4N76 A;  4FJ5 A;  3ZSV A;  3MXJ A;  3ISN C;  4GVM A;  2PY5 A;  3PX6 A;  3AA5 X;  4KAZ A;  1LWF A;  1TKZ A;  1TK0 A;  1KRP A;  3IRX A;  1RBR A;  2KW4 A;  3AVJ A;  4RG8 A;  1EXQ A;  3V1O A;  1BCO A;  4CF9 A;  3OYD A;  2IGI A;  3HYF A;  1CXU A;  3RMA A;  4H8K A;  3JYT A;  4QOZ B;  1WNS A;  3IG1 A;  3EY1 A;  1DTT A;  3G0Z A;  3I0S A;  4FJ9 A;  5JS1 A;  3NF6 A;  1LW0 A;  1RDC A;  2BAN A;  2DY4 A;  4JS4 A;  4F3O A;  2WON A;  3HK2 A;  1BHL A;  1T7P A;  4Z4H A;  4Z4F A;  3ZCM A;  3BDP A;  2HHX A;  1D8Y A;  4FXD A;  2DFH A;  3LAN A;  4DMN A;  1C1A A;  5KGX A;  1K6Y A;  3MEC A;  4CJV A;  2RPI A;  4N56 A;  3HP6 A;  3K5L A;  4CJ5 A;  1YTA A;  4O55 A;  1ZYQ A;  2BGG A;  3NGI A;  1U4B A;  4IFV A;  4E1N A;  4OGE A;  4E89 A;  4DS4 A;  3PX0 A;  3DLR A;  3HT3 A;  3RMC A;  3QET A;  3SPZ A;  4DFM A;  2OPP A;  3RMB A;  1KTQ A;  4CHZ A;  1XI1 A;  4IG3 A;  3OY9 A;  4B9M A;  4CE9 A;  1U45 A;  5J2Q A;  4MFB A;  2IAJ A;  3ZSQ A;  4KHW A;  1ASU A;  1BIU A;  5KTQ A;  1LWE A;  1VSE A;  1IO2 A;  2YV0 X;  1XC9 A;  1GOB A;  3CG7 A;  3HVR A;  2YNH A;  3L8B A;  2A1R A;  3NBP A;  3HVT A;  4O5B A;  1L3U A;  3NH1 A;  4CJU A;  2EX3 A;  1HPZ A;  4FM0 A;  3AVA A;  4DTN A;  4K8X A;  3D45 A;  3SQ2 A;  1RBV A;  3SUP A;  2YKN A;  3LWL A;  1L3T A;  3L3U A;  4FM1 A;  3KLH A;  5J1E A;  3RTV A;  4AHS A;  1LAV A;  3D0P A;  3T3F A;  5E41 A;  4NCG A;  4FCY A;  3SJJ A;  4M42 A;  3L2U A;  3PO4 A;  3PUF A;  3SV4 A;  1NK7 A;  2EHG A;  5HRS A;  4DQP A;  2QXF A;  3ZSR A;  3TWH A;  1IKY A;  4CJR A;  2OA8 A;  3E01 A;  4KFB A;  3HO1 A;  4KV8 A;  4AHV A;  4FJG A;  1LWC A;  1ITG A;  4HUE A;  3V9Z A;  2F96 A;  4CEF A;  4E7L A;  4Z0U A;  3LP1 A;  4CEC A;  4CEA A;  3NCI A;  1UWB A;  3S3O A;  3LPT A;  3M8R A;  4BDP A;  4QAG A;  3QNN A;  3AO3 A;  1TKT A;  4DU4 A;  1Z26 A;  2OPQ A;  4YNQ A;  3AVL A;  4DTO A;  4B8A B;  3SQ0 A;  1WAF A;  3B6P A;  3K58 A;  2GUI A;  3KK3 A;  4DQR A;  4CF8 A;  4F4K A;  4ZTJ A;  1T05 A;  2PYL A;  5CZ2 A;  3KK1 A;  3V1R A;  3O3G A;  1RBT A;  1D9D A;  1J5O A;  3DRR A;  3V9S A;  4CGD A;  4B9U A;  2HW3 A;  4I9L A;  3JSM A;  2F8T A;  4CJE A;  1JLF A;  3LP2 A;  3V9U A;  3OYN A;  4EP4 A;  2I5J A;  5C24 A;  3OJU A;  3THV A;  1VSM A;  2ETJ A;  3A2F A;  3AVG A;  3OS0 A;  1X9W A;  2HND A;  5HP1 A;  1NK5 A;  1NKB A;  1WSE A;  3SYZ A;  4CFA A;  3ZT4 A;  3NGZ A;  3VQ7 A;  3MED A;  1D5A A;  4CJP A;  4ZHR A;  3SCX A;  1SL1 A;  1LV5 A;  4FJM A;  1J53 A;  1JLG A;  3V4I A;  4DQI A;  3AVM A;  4KRE A;  4JRQ A;  4FJX A;  1IKX A;  1ASW A;  4CEB A;  4B9V A;  1XWL A;  1HJR A;  1N5Y A;  3NGY A;  4FLU A;  4DTM A;  3LPU A;  3P83 D;  2G8H A;  3HXM A;  4KI4 A;  2GV9 A;  3SUN A;  3OYE A;  4DQQ A;  1B92 A;  4LD0 A;  1KFS A;  1RBS A;  1J9A A;  3AVB A;  1EKE A;  3SQ1 A;  1IKW A;  2B6A A;  2P1J A;  5HRN A;  3KTQ A;  5I3U A;  3VQ9 A;  3AA4 A;  4KB0 A;  4FYD A;  4OGC A;  1C1C A;  4B8C A;  4DTS A;  1GOC A;  4DSI A;  4RW8 A;  2QK9 A;  4IBN A;  2Y1I A;  2E6L A;  3HPG A;  2Q3S A;  4DSJ A;  2W42 A;  4E7I A;  5DK5 A;  3RR7 A;  3AVF A;  3VQ6 A;  4LH4 A;  3SQ4 A;  4PY5 A;  3NH0 A;  1NKC A;  2YNF A;  4CFD A;  3M8P A;  5CYQ A;  3U3Y A;  1RT6 A;  3RRH A;  3LAL A;  2HHU A;  4CHO A;  3T1A A;  3ITH A;  3G10 A;  1A5W A;  3K2P A;  2RKI A;  4B9S A;  4DU3 A;  3M8S A;  4J2B A;  1RIL A;  1DLO A;  3OYI A;  1VSH A;  4CFB A;  3NF8 A;  4CED A;  3RWU A;  4KHS A;  3B6O A;  2KFZ A;  3NH2 A;  4NCB A;  2RF2 A;  4ELT A;  3U6F A;  3OYC A;  3O3F A;  1S9E A;  4LH5 A;  2D0A A;  1RT7 A;  2X6N A;  4E19 A;  4CF0 A;  4CHP A;  1WAJ A;  4ZTF A;  2HB5 A;  3DRS A;  3TAB A;  3UIQ A;  3AVN A;  4DF4 A;  1C0M A;  4B9L A;  1JLA A;  3H08 A;  4BAC A;  4PA1 A;  3VQB A;  2JGU A;  4CJ4 A;  2DTU A;  1W9H A;  3S3M A;  1TL3 A;  3EYZ A;  4OJR A;  3O4Q A;  3C6U A;  1S6Q A;  4J2E A;  2B4J A;  5KRS A;  4L8R B;  3LZJ A;  4DTJ A;  3AVI A;  5SZT A;  1S5J A;  4N47 A;  3VN5 A;  1RT2 A;  3VQ8 A;  1IG9 A;  4C8L A;  4FJJ A;  3DM2 A;  4OPK A;  3HPH A;  4O0J A;  2X78 A;  3AO5 A;  5JS2 A;  3TAP A;  3RRG A;  4BWM A;  4KHQ A;  1EET A;  1TL1 A;  4FK2 A;  4CHN A;  3PY8 A;  2B5J A;  3NDK A;  3ZSX A;  4CJW A;  3K57 A;  3M8Q A;  1T03 A;  2YHA A;  1N6Q A;  3QER A;  3QIN A;  2HHQ A;  1EX4 A;  3KLF A;  4DSK A;  3ZT0 A;  1VRT A;  4F2R A;  1C1B A;  4FJL A;  2XRI A;  3KIO A;  5SWM A;  1BIS A;  1I3A A;  4FLT A;  1RTH A;  2KFN A;  2HHV A;  1RTD A;  5HRP A;  4TSX A;  5HRR A;  4M41 A;  1UOC A;  5J2M A;  5CZ1 A;  1VSD A;  3VQQ A;  3KD1 E;  1WSI A;  3NAE A;  2E4L A;  3K5O A;  1L3S A;  1S1W A;  4M45 A;  3QO9 A;  4FZY A;  1JKH A;  4DWI A;  3V9W A;  1HNV A;  2YHB A;  2FC0 A;  4CJT A;  3LP0 A;  4OVL A;  4EP5 A;  1VRU A;  1DTQ A;  4CJF A;  4CHQ A;  4E7H A;  1RDB A;  1RTI A;  2JLE A;  1VSI A;  4RW4 A;  3NHG A;  4CF1 A;  4AHU A;  4CEO A;  3K59 A;  4BDY A;  4LSN A;  2HMI A;  3PO5 A;  4FLY A;  4PUO A;  1JL1 A;  2G8W A;  3TAM A;  3VQD A;  4DSE A;  4HCB A;  4CF2 A;  1HQE A;  1NJY A;  2F8S A;  2ZQB A;  2FBY A;  1F21 A;  1SL2 A;  1W0H A;  4WE1 A;  4K8Z A;  1X9S A;  4ID5 A;  4IFY A;  4HCC A;  4FJ8 A;  1KSP A;  1BCM A;  2OPR A;  1FKP A;  3TAN A;  1BGX T;  3I8D A;  1MU2 A;  3DLG A;  3DLK A;  3VA3 A;  4F2S A;  3C6T A;  4Y1C A;  4YFU A;  1UA0 A;  2HHS A;  1LAW A;  2AJQ A;  3TAR A;  3VQC A;  1JXE A;  4W5O A;  1HQU A;  1FKO A;  2IDO A;  4ELU A;  2QKK A;  4KHY A;  2KZM A;  1QSL A;  2FBT A;  3DLE A;  5HBM A;  3TAQ A;  2HNY A;  1KVB A;  3BGR A;  1VSJ A;  2VG6 A;  4B9N A;  4Q5V A;  3WNG A;  1YVU A;  4OKE A;  3P5J A;  3KK2 A;  1SKW A;  4Q0B A;  3AO2 A;  1QE1 A;  1QHT A;  2DFF A;  4ELV A;  1Q8I A;  3WNH A;  4CER A;  1UA1 A;  1QS4 A;  5J2N A;  4M3R A;  1VSL A;  1JLE A;  1S9G A;  2FBX A;  4HTU A;  5K14 A;  1FXX A;  4LY7 A;  2PYJ A;  4DTR A;  3ZT3 A;  4E3S A;  4CGI A;  3SPY A;  4DS5 A;  1NJZ A;  2HVH A;  3OYB A;  3QEP A;  4DFP A;  2O4G A;  1RT4 A;  4IDK A;  5D3G A;  1VK0 A;  3QEX A;  1RT3 A;  3ZT2 A;  1U49 A;  4HVJ A;  4M3X A;  3VQP A;  1C6V A;  4GW6 A;  3WNF A;  4AHC A;  3F9K A;  3ULD A;  2OPS A;  3OYL A;  3K5M A;  1HYZ A;  3AVK A;  4KRF A;  1BI4 A;  4I2Q A;  3DOK A;  4AHR A;  1YT3 A;  4W5T A;  3DI6 A;  4C8O A;  1G15 A;  1QTM A;  4DLG A;  1CLQ A;  1C0T A;  5FDL A;  5C42 A;  4AIL C;  1TAU A;  3HP9 A;  2BDP A;  2OZM A;  3QES A;  4BE0 A;  2Y1J A;  1A5V A;  2KTQ A;  4FK4 A;  3LP3 A;  1RDD A;  3TI0 A;  4O4G A;  1CXQ A;  1WSF A;  3V6D A;  3DLB A;  1JLQ A;  4W5N A;  4HUG A;  3FFI A;  1Z25 A;  3TR8 A;  2D0B A;  4NYN A;  4Y1D A;  4FJ7 A;  4Z4G A;  1Q9X A;  1WSH A;  4BWJ A;  2RN2 A;  2A1S A;  3VQ5 A;  1RTJ A;  4LSL A;  2E6M A;  2Z1J A;  4H4M A;  4FW1 A;  4AH9 A;  4DQS A;  3HJF A;  4KO0 A;  3HPO A;  4FLV A;  1EP4 A;  4CHY A;  1RNH A;  4KHN A;  3TAG A;  4CES A;  1BQM A;  1S1T A;  1NJW A;  1U48 A;  4M3Z A;  1KFD A;  3AA3 A;  4IG0 A;  2XO7 A;  5HLF A;  4FK0 A;  4CCH A;  3AA2 A;  3QNO A;  3S3N A;  2VWK A;  3VQ4 A;  4CJ3 A;  3TAF A;  4AHT A;  4B3O A;  3MEE A;  1YTU A;  4CGH A;  3DOL A;  3F73 A;  1X9M A;  5FRM A;  2LSN A;  3NFA A;  4I9Q A;  5I42 A;  1TK5 A;  2Z1H A;  1TKD A;  4CGF A;  4PQU A;  2ITG A;  1Q9Y A;  1HYS A;  1S1V A;  4FJH A;  4KTQ A;  4ID1 A;  1KVA A;  1FK9 A;  2G8F A;  3CYM A;  3SZ2 A;  1TK8 A;  3QEV A;  1LW2 A;  1HRH A;  1RDA A;  3T19 A;  3AO1 A;  1NK8 A;  2WOM A;  4CIF A;  3KKR A;  1S1X A;  2YNI A;  3VA0 A;  2P5O A;  1BI4 B;  1RCH A;  3LAM A;  4FW2 A;  3OYH A;  4BE1 A;  4CJK A;  3OYF A;  4B9T A;  3RMD A;  4KHU A;  4DTU A;  4OLB A;  1XHZ A;  3L3V A;  1VSK A;  3LWM A;  4KI6 A;  4FLX A;  1KLN A;  1B9D A;  2G8K A;  1XHX A;  3NF7 A;  1TAQ A;  2YKM A;  4Z4I A;  1GOA A;  3KLG A;  1U47 A;  3QIO A;  4J2D A;  4FZX C;  2VG5 A;  1VSF A;  4CFC A;  3KKS A;  4I7F A;  2VWJ A;  1SKS A;  1NOZ A;  1Y97 A;  4DTP A;  4JS5 A;  1BL3 A;  4DLE A;  3CFP A;  4OLA A;  3SUO A;  3SNN A;  1TKX A;  3U3G A;  3KLI A;  1L3V A;  1D9F A;  3P1G A;  4XIU A;  2G8U A;  5HRO A;  2O4I A;  4F8R A;  4Z4C A;  3CM5 A;  1TVR A;  3L2Q A;  3V9X A;  4NYF A;  4CIE A;  4QCL A;  3OYK A;  2IOC A;  4CEE A;  3ALY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...