3K2PA

Hiv-1 reverse transcriptase isolated rnaseh domain with the inhibitor beta-thujaplicinol bound at the active site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Reverse Transcriptase
publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3k2pA00
1RDCA 1JL1A 3HL8A 4G1QA 3DOLA 2EX3A 3NE6A 1C1AA 4J2AA 4I7FA 1C0TA 1W9HA 3G10A 4N47A 1KVAA 3DOKA 4CERA 3HM9A 4FLXA 1T03A 2ETJA 3P1GA 5K14A 2HHXA 4RW9A 4RW7A 4FW1A 2B4JA 4FJMA 4JRQA 4CJVA 4R5PA 2P51A 4NCAA 3AO4A 1RTDA 5E41A 1T05A 2IS3A 4J2DA 4N76A 2Z1HA 3SQ4A 4CEEA 1FXXA 3RMCA 5C25A 3KLHA 3LP0A 1Q9YA 4OLBA 4ICLA 4CJFA 4IG3A 3U6FA 4BWJA 2F96A 2HNDA 4RW6A 4Z4HA 1SKRA 4KV8A 4BDZA 5KRSA 5JS1A 3C6UA 1XC9A 3NF8A 4O4GA 3ZT1A 3T1AA 3SQ2A 3S9HA 3O4QA 3V9SA 2VWKA 2RF2A 4XIUA 2IDOA 1EX4A 3I0RA 1BGXT 3K5NA 1RBSA 1NK5A 3JYTA 3KIOA 1IO2A 3LP1A 3DI6A 3IRXA 3EZ5A 1RTJA 4DFKA 1T8EA 3ZT4A 4M3UA 2HVIA 5J1EA 1XHZA 2P5OA 4H4OA 1UOCA 1ASVA 3VQDA 4CFAA 2HNZA 1NK7A 1FKOA 3K5OA 2AJQA 5HRNA 3QEIA 4B8AB 4I9LA 5DMRA 1B9FA 4CE9A 2GUIA 3QEPA 1RT5A 3OVNA 3KLFA 4M42A 1LWEA 3I0SA 4ELVA 4CFDA 3ZSRA 4CESA 3AO5A 3ZSOA 5CY4A 5CYMA 2QKKA 4F8RA 1KVBA 4E1MA 1XHXA 1JXBA 5J2QA 1GOCA 1VSMA 3QEVA 3K57A 3KK1A 4GMJB 1RDDA 4ZHRA 1JLCA 3OYFA 1ZBHA 5T7BA 2OPRA 3OYKA 3KD1E 3SUOA 3SQ0A 1S9EA 1JKHA 1TAQA 3EY1A 4OPJA 4BE1A 4FCYA 4ELUA 4FJ5A 1ZBLA 4FK2A 2HB5A 3LPTA 1A5WA 1QQCA 2FBVA 3HXMA 2VG7A 5EU7A 4DFPA 3VQ7A 3KD5E 3LDSA 4FJJA 4C8NA 3AA5X 1RT1A 4BDYA 1RDAA 3IS9A 2X6SA 2KQ2A 4DU1A 4KHYA 2R7YA 3L2RA 3V81A 1LWCA 4DTXA 4B9NA 3O3FA 2G8UA 3OYEA 4FJHA 1B9DA 3VQ6A 2A1RA 4CF1A 1A5XA 4YNQA 5J2MA 3IAYA 4CF9A 3SJJA 3ZT3A 4N5SA 1GOAA 1TGOA 3QEWA 4DF4A 3U3GA 4PY5A 3T3FA 3ITHA 3QERA 1LW0A 4HTUA 1NJXA 4C8KA 4CJPA 3TAEA 1SKWA 4LSNA 1J54A 1WAFA 2YKMA 4DQQA 3L2WA 1BI4A 3SPYA 3OYHA 1JXEA 1WNSA 1MU2A 3K58A 1L5UA 4CF2A 3QNNA 4CJLA 2VWJA 1QSSA 4DSEA 1I39A 4N56A 4MQ3A 3L2QA 3OYMA 1NK4A 2HMIA 2KZZA 3RMBA 2HHSA 2DTUA 1A5VA 3M8SA 1IKWA 1ZBFA 3JSMA 1TK8A 4DQSA 1L3TA 1L3UA 4HUEA 4F2RA 3AO1A 3VA0A 2XY8A 1N5YA 3NF7A 3MEGA 3VN5A 1XI1A 2PYJA 2E6LA 3C95A 4DQIA 3F9KA 5DK5A 2Y1JA 1KFDA 4FYDA 2P5GA 3OYIA 3RMDA 3HO1A 4H8KA 4DLGA 4FLZA 1WSJA 2HW3A 1ASWA 1HMVA 1C0UA 3AV9A 3DRSA 3P83D 4C8OA 4FJKA 1C1BA 4W5OA 3WNHA 1ZYQA 4RG8A 5KRTA 1HRHA 4DTPA 3DLBA 3VQBA 2ZE2A 1HYSA 4LH4A 4CEQA 2ZD1A 1UA1A 2OPPA 4E7LA 4FJXA 1TKZA 1RT7A 3V1QA 4O44A 3VQQA 3DRPA 2D0AA 1J53A 5D3GA 3QETA 4KHNA 3AO2A 3LZJA 3TAFA 4DLEA 2G8WA 1JLFA 3CM6A 3DLRA 3NH1A 3ZSZA 1SL0A 2O4GA 5KI6A 1QTMA 2PYLA 2QXFA 4HCCA 3HT3A 3AVLA 5C42A 3PUFA 4ID1A 1RILA 3PV8A 4CIGA 3THVA 4B9UA 3VA3A 3P5JA 4L8RB 3PO4A 3KTQA 2A1SA 3ZSXA 1SKSA 1D5AA 3HSTB 1QS4A 4M3YA 2YKNA 5HROA 2XHBA 1LWFA 1GOBA 4BE0A 4ELTA 1RBUA 1WAJA 3MEDA 1ITGA 4IKFA 1BISA 3MXJA 1RDBA 4O0IA 3SV3A 1Z26A 4FW2A 1S6PA 1TKTA 2XO7A 2D0BA 2Z1GA 4C8LA 1VSKA 1UA0A 3MECA 1Q9XA 4CIEA 3RTVA 2X78A 3LZIA 2HHUA 2I5JA 3RR8A 4QCLA 4KHSA 3OYNA 3UIQA 1CXQA 4KHUA 3ALYA 3QEXA 3AVHA 3HVRA 1LAWA 3AVCA 4BACA 3SZ2A 2RKIA 1KTQA 4F2SA 1KLNA 1S1UA 2IGIA 3L2UA 1G15A 4CEOA 4HUFA 1BQMA 1VSIA 3CFPA 3U3YA 1NKBA 4AH9A 1RT2A 4E1NA 4F3TA 1VSHA 4BWMA 1WSFA 3K5LA 1DLOA 1JLAA 4AHUA 4DFMA 3B6PA 4O55A 3LWLA 1CXUA 2OPQA 3QIOA 3QESA 1WLJA 3BGRA 1RNHA 1JL2A 3V1OA 2DFFA 1VRUA 4M3RA 3CQ8A 4Q5VA 3AVNA 4CJWA 3OY9A 1EETA 3F73A 4I9QA 1LV5A 4CGFA 4PUOA 1NOZA 1Y97A 3AA4A 4B8CA 4RW8A 4E7KA 2XY5A 1KCFA 2HHWA 2PZSA 3G0ZA 4M3ZA 1NJZA 4NCGA 2WONA 3AVJA 4E89A 3NH0A 3SQ1A 1U04A 2OA8A 4W5NA 5FROA 1LAVA 3ISNC 4OKJA 1VSFA 3DYAA 4CCHA 4FLUA 3HJFA 3NFAA 3T19A 4LD0A 3PX6A 3LANA 1SUQA 3V9XA 4Z0UA 5KGWA 1JLBA 3O3GA 3V9UA 3PO5A 3RRGA 4DSFA 4DMNA 4DS5A 2B5JA 3TAMA 3VQCA 1BCMA 4CJ5A 3NH2A 4OPKA 5HP1A 4E19A 2G8VA 1EP4A 1WSIA 1S6QA 1Z25A 3M8PA 4Y1DA 4CJ3A 4CJEA 4CJQA 1RBTA 4OJRA 4Z4IA 1BI4B 1I3AA 3QO9A 4CEZA 1XWLA 4LH5A 2YNGA 3TWHA 4CJRA 4W5TA 4KAZA 1DTQA 4FXDA 4OLAA 3M8RA 4FM0A 3SUNA 3SV4A 3DLEA 4QOZB 3TI0A 1SL1A 3NBPA 3L2VA 2JGUA 4CGHA 4FM1A 3DRRA 3HPOA 3VQ8A 2F8TA 3I8DA 1D8YA 1D9FA 2OPSA 1D9DA 4K8XA 3NGYA 4CJUA 4PQUA 4JS4A 2Z1IA 5FRNA 4KHQA 4FJ8A 3AVFA 1NK9A 3VQEA 5C24A 3TANA 4B9SA 4F3OA 4FJIA 3AVKA 3M8QA 4OVLA 1NJWA 4EZ9A 3KLEA 4DQRA 3S3MA 3NGIA 3CM5A 1EKEA 4NCBA 1S1TA 3OYAA 1RCHA 3OS1A 2KW4A 4IDKA 3L8BA 3BDPA 3O4NA 4E7JA 1NK0A 2WOMA 1Q8IA 4IFYA 5CZ1A 1S5JA 2D0CA 4KKOA 4BE2A 3QIPA 4Z4CA 1BHLA 2DY4A 1TK0A 4GVMA 3OS0A 3OJUA 5HLFA 1R0AA 2G8FA 4DFJA 4FJ9A 3SCXA 3KLIA 3AA3A 4FZYA 2KFNA 3AVGA 1J5OA 1TL3A 1TL1A 4C8MA 4FLVA 4NYNA 4DU4A 4E7HA 2BANA 1HQUA 3K2PA 4OGEA 4AHCA 3NAEA 1K6YA 3HPGA 4O5BA 3D0PA 2RN2A 3SUPA 1KLMA 3MXMA 3WNGA 2QK9A 3ZSQA 4YFUA 1VSJA 3CYMA 1JLGA 1RT4A 4UQGA 4DWIA 1C0MA 3RRHA 1BQNA 3V9WA 3AVBA 4AHTA 3EYZA 1CZBA 1TKXA 1HJRA 2VG5A 5CYQA 3QNOA 4FK0A 4CGJA 3FFIA 1VSDA 4O0JA 4DSJA 4CGIA 4FJNA 4CFBA 4KTZA 4Z4EA 1REVA 4CF8A 2HHTA 3L3VA 2EHGA 1C6VA 1FKPA 1HNVA 1TV6A 3RMAA 4CHNA 3SI6A 4KPYA 4QAGA 1SV5A 4HUGA 4J2BA 1BL3A 1U45A 5HBMA 4AHSA 3SUQA 1TAUA 2QKBA 1O1WA 5I42A 4OKEA 3QLHA 1HQEA 3OYBA 1HYZA 4CJ4A 2X74A 4KRFA 1NJYA 1CZ9A 3ZCMA 2FBXA 1N6QA 4IG0A 1LW2A 3PX0A 3SNNA 5HRPA 2F8SA 4AILC 1RTIA 4W5RA 4M3XA 3AO3A 4CEDA 4FM2A 5I3UA 4CIFA 4CEAA 3ZT2A 4ZTFA 4CF0A 4B9LA 3LALA 3LPUA 2Z1JA 3ZSVA 1U49A 4FK4A 1DTTA 2GBZA 3OYDA 4KREA 3HVTA 1WN7A 3KK3A 3O3HA 4CK1A 3K59A 4DQPA 4K8ZA 1KRPA 2B6AA 4CEFA 2D5RA 2E4LA 2KTQA 4B08A 1S1WA 5KTQA 1KSPA 4F4KA 1QHTA 1C1CA 2XRIA 3IG1A 4DG1A 4Z4GA 2NUBA 2XY6A 2HNYA 4LSLA 4FLTA 4CHOA 2IOCA 4CGGA 1IKVA 1HNIA 4TSXA 3NCIA 1IKYA 1RT3A 4JLHA 3WNFA 5J2NA 1X9SA 4EZ6A 1CLQA 5JS2A 3MXIA 5KGXA 1W0HA 4FJGA 1WSGA 2ZQBA 4J2EA 4CHZA 5HRSA 2PY5A 4EP5A 2ITGA 4CJTA 1U4BA 4CFCA 1WSEA 4DS4A 3LAMA 2JLEA 3KLGA 3PX4A 2FBTA 2FBYA 4HHTA 4LY7A 3TAGA 2BGGA 3OYGA 2YNHA 1NOYA 4PWDA 3TAQA 4PA1A 3DLGA 3LP3A 1QE1A 4WE1A 4CEBA 5SZTA 3OJSA 3SYZA 4DTUA 1X9WA 4NYFA 1NK6A 4N41A 2YHAA 5FRMA 1RBRA 1IG9A 4ZTJA 3ASMA 4E3SA 3HP6A 1S1VA 1B92A 1ZBIA 4CHQA 3D45A 5HRRA 1J9AA 4B9TA 4IBNA 4DTSA 3LAKA 1T7PA 4CJSA 3SPZA 1TVRA 3MEEA 3NF9A 2Y1IA 3TABA 1IH7A 3S3OA 3HP9A 1TKDA 4KHWA 3C6TA 4KB1A 3OYLA 4E0DA 3LP2A 3PY8A 4BDPA 1RBVA 4JRPA 3V4IA 4H4MA 4DTJA 3VQ9A 3NHGA 1X9MA 4B9MA 1S1XA 2W42A 4M3TA 1L3SA 3VQAA 3ULDA 1JLQA 4FLWA 3NGZA 4OKKA 3KKRA 3K5MA 4DF8A 2BDPA 1ZBUA 2DFEA 3QINA 4I2QA 1ASUA 2IC3A 1QSYA 3V9ZA 5FDLA 4Q0BA 3OYCA 1KFSA 3A2FA 3HYFA 3L3UA 1JLEA 3AVMA 3LWMA 5J2PA 4FJLA 4E7IA 1BCOA 1RT6A 3VQ4A 1YTAA 1VSLA 2X6NA 3MAQA 2VG6A 3C94A 3DLKA 1HPZA 3TR8A 3V1RA 1SL2A 3H08A 1KVCA 5CZ2A 3ZSWA 4M45A 1F21A 3KKSA 1UWBA 3AVAA 3DMJA 3RR7A 2HHQA 3ZT0A 4HVJA 4DSKA 1TK5A 1S9GA 4EP4A 4DTNA 1NKCA 4KO0A 3DM2A 4KFBA 4KI6A 3B6OA 4DSLA 4Y1CA 2OYQA 1YTUA 4FLYA 1QSLA 2P1JA 4KTWA 2G8KA 3OS2A 4B9VA 1L3VA 4CECA 4FVMA 2BE2A 4RW4A 4W5QA 2RPIA 4GW6A 3OYJA 3NF6A 4KB0A 4KI4A 3KJVA 2OZSA 2KZMA 2Q3SA 4FZZA 2G8IA 1BIZA 5SWMA 1UAXA 3AA2A 3CFRA 4DSIA 4M3WA 2HVHA 4CK3A 2YHBA 1YVUA 4I2PA 3KK2A 4FZXC 4CHPA 3AVIA 3TAPA 4CHYA 2YNIA 4KTQA 3HPHA 3CFOA 4MFBA 2ATQA 4DTOA 1NK8A 1VSEA 4AHRA 3TARA 3ZSYA 1RTHA 1VK0A 4M41A 4DTMA 1NKEA 3E01A 4JS5A 3DLHA 2O4IA 1BIUA 3VQ5A 3S3NA 3V6DA 2HHVA 2GV9A 1WSHA 4CGDA 4CJKA 1EXQA 4CK2A 3NDKA 2OZMA 3RWUA 4FJ7A 4DTRA 1FK9A 3VQPA 2LSNA 2YNFA 2IAJA 1IKXA 2DFHA 4Z4FA 2E6MA 3CG7A 2FC0A 1U47A 3WNEA 2G8HA 1HYVA 4OGCA 4DU3A 1U48A 4ID5A 2XY7A 2KFZA 4HCBA 3HK2A 4IFVA 1YT3A 1VRTA 4B3OA 1X1PA 4AHVA 2YV0X
chains in the Genus database with same CATH superfamily
1RDCA 4NLBA 4I7FA 2Q0RA 2E2QA 5K14A 5B8HA 4FW1A 2OTLN 1OKJA 3O1WA 4R5PA 1XUPO 2EWSA 1HX1A 2IS3A 3SQ4A 4K42A 4BRIA 3MN6A 4OLBA 4IG3A 5C2DA 4BWJA 2HNDA 4Z4HA 5AQLA 4KV8A 4BRLA 5KPZA 3ZT1A 3SQ2A 3S9HA 3V9SA 3AY9A 1N32K 3H46O 3I0RA 1BGXT 1WBDA 1NK5A 3LP1A 3DI6A 1RTJA 4FWQA 3F5TA 4M3UA 1XHZA 3IMXA 2P5OA 3F9MA 3LDNA 1ASVA 4CFAA 1YVNA 3OA9A 1NK7A 1FKOA 4ILGB 3I55N 5HRNA 3QBXA 4B8AB 3CJAA 1RT5A 3R6MA 3KLFA 4FWLA 5AQXA 3THYB 2GTDA 3M1FA 2RE2A 1KVBA 4RTFD 1JXBA 1VSMA 3K57A 3CPEA 2YJFA 1JLCA 1J6ZA 3KD1E 4B3TK 4FCYA 3WT0A 3VEXA 4FJ5A 3KD5E 1A5WA 4BRQA 2VG7A 3VQ7A 2NRXA 3CJCA 1RT1A 2X6SA 3MCAB 2KQ2A 3BF3A 2R7YA 5BREA 3CMAN 4DTXA 3BEXA 2GUPA 3VQ6A 2W6LA 3QFPA 4CF9A 3ZT3A 4N5SA 5AQUA 1YXQA 4DF4A 3U3GA 2WUSA 4FWKA 2UUBK 3QERA 1ATRA 4HTUA 3T7ZA 3TAEA 2P9KB 4LSNA 4XH1A 4JYAK 3E1YA 5BRHA 3SPYA 2YJEA 3E9OA 1MU2A 1W97L 4FWOA 1XMOK 4DSEA 4MQ3A 3PIPL 2HMIA 2DTUA 1TK8A 3FGUA 1N5YA 3MEGA 4DV5K 4DQIA 1KFDA 1WB9A 3AV9A 5BN9A 4W5OA 1HRHA 4DTPA 3DLBA 5AQKA 1HYSA 1TKZA 1RT7A 3V1QA 3VQQA 3DRPA 4CZIA 3W0LA 1J53A 4WFBL 5D3GA 4IO9L 3LZJA 1KAXA 4DLEA 1JLFA 3NH1A 3ZSZA 4BROA 4JEPA 1QTMA 3CCMN 3H1VX 4ID1A 3O4WA 4PKGA 4L8RB 3ZSXA 4BRKA 1LWFA 5I9EB 4X62K 5AR0A 4IKFA 3MX2A 4O0IA 4O8UA 4FW2A 3FZLA 2NNWA 4CI6A 4C8LA 1VSKA 3MECA 3O8MA 5GAGP 3RTVA 2X78A 3UIQA 3IUCA 3HVRA 1EQYA 2RKIA 1G15A 4HUFA 4OO1J 3VGMA 5FLXO 2QWMA 4E1NA 1NG9A 1VSHA 1T44A 4ISEA 4C23A 4BRAA 4O55A 3QIOA 5BPLA 4JI1K 3EKUA 3AVNA 3OY9A 1LOTB 1EETA 4I9QA 3A8YA 3W3DA 2V52B 2HHWA 2NRRA 4RW8A 1J5EK 3O1BA 3G0ZA 4M3ZA 1ATNA 2D0PA 2WONA 4HWIA 4NCGA 5JMVA 3NH0A 2OA8A 1U04A 5AQSA 1LAVA 3E9PA 1VSFA 4BC5A 4IEEA 3T19A 3LANA 3CCVN 4DMNA 1VQMN 3R1XA 3TAMA 4BC2A 2A42A 2HBJA 3G71N 1WSIA 3SAHA 1S6QA 1Z25A 3DJCA 1BU6O 4HTLA 4Z4IA 1XWLA 4PKIA 2GWJA 3SV4A 3ZX3A 5LL6Z 1YIJN 1XQSC 1HLUA 4EIAA 2IVOA 4AQYK 1D9DA 3NGYA 4CJUA 5JVHL 3NMUA 1RGIA 1YJNN 4B9SA 4BQLA 4CD1A 1NJWA 5M1OA 4EZ9A 3KLEA 3NGIA 4NCBA 1EKEA 1NGGA 3GOIA 1RCHA 3VETA 3OS1A 2KW4A 4CZMA 4E7JA 1NK0A 1Q8IA 3LDLA 4IFYA 5M1KA 1GLJO 5CZ1A 1S5JA 4BE2A 5C10A 3UB5A 3SAGA 1E3MA 3AA3A 4B1VA 4BG9A 4CZKA 1TL3A 3TSPA 4NYNA 4DU4A 1BWFO 2BANA 1HQUA 3HPGA 3D0PA 4JKEA 4YFUA 3QB0A 1RT4A 4BR4A 3PLAA 4BRHA 4K25A 3V9WA 3IKMA 3AVBA 4H0YB 3EYZA 2GX9A 1HJRA 5AJ3K 1VSDA 1REVA 3RMAA 1C6VA 1FKPA 1HNVA 1Z05A 2NRZA 3SI6A 4KPYA 3SBTA 1BL3A 3EE8A 3HOTA 5HBMA 4DR1K 2P9UA 4H5WA 2QKBA 5I42A 4OKEA 4CJ4A 1NGJA 3MX5A 2F8SA 4W5RA 4FM2A 4CEDA 2Z1JA 3ZX0A 2O8EA 4KREA 4DQPA 5ADXH 1KRPA 5GIOA 4B08A 5CE3A 2XRIA 3IG1A 1M1KO 4WQ4C 4TSXA 1IKYA 1QHAA 3MXIA 1GLEG 4BR5A 2D4WA 2PY5A 3RVCA 4L3QA 3K0SA 2JLEA 1NGAA 1NOYA 3TAQA 3H1QA 1X9WA 3OJSA 3QDKA 1KC8O 2E2NA 2NRHA 2YHWA 4IJAA 1NWKA 1VQNN 1RBRA 4QS7A 1IG9A 4JI8K 1S1VA 4WFNL 3Q7BA 1T3VA 4DTSA 1T7PA 4CJSA 3MEEA 3TABA 2O8FA 3C6TA 5TKYA 3THXA 4BDPA 1RBVA 3NHGA 5EXWA 3ULDA 4FLWA 1ZBUA 2DFEA 2IC3A 4BC4A 3HYFA 3TTFA 1NMDA 4MLEA 1RT6A 2X6NA 4H0OA 4BRDA 5CZ2A 3J81O 3ZSWA 4B1XB 2OCEA 3AVAA 3RR7A 2Q36A 2HBLA 2OYQA 5JVGL 1S72N 3OBWA 2G8KA 4WYBA 1HKCA 1P8ZA 4BR7A 5LMNK 1GLLO 1L3VA 4RW4A 4Z94A 1NGFA 3LL3A 3NF6A 3KJVA 3HOSA 2KZMA 4FZZA 5SWMA 2NRWA 1UAXA 2HVHA 1GLAG 4LF8K 2YHBA 3U4LA 5GIPA 2IVNA 5BN8A 3A0IX 3CFOA 4U7BA 3QICA 2ATQA 4DTOA 3THWA 3VEZA 3ZSYA 5BPNA 1VK0A 2FSJA 4M41A 1NKEA 1HR0K 2P9UB 3VQ5A 5AZIB 2ITMA 3G25A 3NDKA 3CC2N 1IKXA 2E6MA 2FC0A 3FR0A 2G8HA 2O8EB 2KFZA 3HK2A 3L6QA 5AQWA 2EX3A 4JN4A 4J2AA 2F7TA 4R79A 4CERA 3DOKA 2HHXA 2ETJA 3P1GA 4RW9A 4DUZK 2GELA 2O8CA 2P51A 3AO4A 5E41A 4N76A 2Z1HA 5ELZA 1FXXA 3U9ZA 2BUPA 4CJFA 5E26A 4JAXA 1RFQA 5HOOA 5KRSA 5JS1A 4DV7K 4BRMA 3C6UA 3NF8A 3T1AA 2VWKA 3K5NA 4JI6K 3JYTA 3KIOA 1IO2A 4M63C 2O8FB 3IRXA 4DFKA 5CHIA 1HUXA 3THXB 1NGDA 4H4OA 3K5OA 2AJQA 3QEIA 5DMRA 1YF5L 4CE9A 2GUIA 3OVNA 1LWEA 4FPAA 3DWLA 4ELVA 4NLCA 3ZSRA 4CESA 2YI1A 3AO5A 3ZSOA 5CY4A 4F8RA 2ASMA 5J2QA 3QEVA 3KK1A 1RDDA 4YORA 4LFAK 1S9EA 3LPTA 4DFPA 3CJBA 3THYA 4GKKK 3LDSA 4FJJA 3CI5A 3O6WA 3CCQN 5IWAK 1VQON 4BDYA 1RDAA 3IS9A 3SK3A 1LWCA 4B1UB 1VQ6N 1B9DA 2A1RA 5J2MA 4RCHA 5EVZA 4CZLA 3CHWA 3QEWA 3M3ZA 3T3FA 1T6DA 4OX9K 3CXCM 4BRPA 2CH6A 4A59A 1SKWA 4WQ5C 3LDQA 1BI4A 3SBGA 3OYHA 1JXEA 4GV9A 4C1NK 3KZBA 4FPBA 4ISGA 3K58A 4H0VB 1L5UA 4CF2A 3QNNA 4CJLA 2VWJA 1QSSA 1HNWK 2HBKA 1I39A 5AQVA 3HI0A 3OYMA 4LF4K 1NK4A 2YHYA 2I7NA 1DEJA 2KZZA 4B3RK 2IIRA 1NMNA 4B3SK 3EO3A 4XH4A 1BG3A 3JSMA 1L3UA 2CGLA 1YAGA 4FWPA 1KQSM 3VA0A 2XY8A 4IXCA 3F9KA 2ZM6K 3CCRN 2Y1JA 4FYDA 2O8BA 2P5GA 3RMDA 3AARA 2OTJN 2HW3A 3P83D 4C8OA 1Q7YO 3P38A 2FXUA 3VQBA 1NNEA 2QM1A 1NGCA 4FJXA 1UA1A 5AQMA 3AO2A 3OBYA 1YJ9N 3VEOA 3WXJA 2G8WA 3CM6A 2O8CB 2UUCK 3H45C 2QXFA 4HCCA 4CW7B 4BRCA 1JCGA 5C42A 3PUFA 5BR8K 1RILA 3EN9A 3VENA 4BR2A 4O5FA 2QXLA 4CD3A 3MWPA 2A1SA 1SKSA 3KTQA 1BUPA 2YKNA 3VPZA 2XHBA 1GOBA 4BE0A 1RBUA 1WAJA 3MEDA 1ITGA 3SV3A 1Z26A 4WFAL 5AQIA 1EWRA 2D0BA 4YHHK 4FL9A 1Q86O 2HHUA 1CXQA 4KHUA 3QEXA 4H03B 4JKBA 4F2SA 1KLNA 3U3YA 3CFPA 4A57A 2UUAK 1NKBA 1JJ2M 1RT2A 2DPNA 3A5MC 2QI2A 4H0TB 3K9KA 1IJJA 4BWMA 3CJ7A 4DFMA 1JLAA 3MDQA 3B6PA 1XMQK 3QESA 1WLJA 3BGRA 2VGNA 1IV0A 1XNQK 4CJWA 3BZCA 4CZEA 1LV5A 1OVQA 1NOZA 1Y97A 4EFHA 4PUOA 1KCFA 2W41A 2P9IA 1M90O 1ZXOA 2PZSA 3AVJA 4E89A 4JI2K 5FROA 4DV6K 4OKJA 4AM7A 4FLUA 3HJFA 3NFAA 4LD0A 1JLBA 3V9UA 4JI7K 4CJ5A 5LMUK 4E19A 2G8VA 2V7ZA 4CJEA 4CJQA 1RBTA 1BI4B 1I3AA 4CEZA 4XEIA 4KAZA 4FXDA 4OLAA 4QOZB 4KBOA 3ZX2A 4BVPA 2QTDA 2IVPA 1NGHA 2E1ZA 3NBPA 3DRRA 3HPOA 4A61A 3D2FA 3I8DA 1D9FA 4K8XA 2OPSA 2Z1IA 3LM2A 4JI0K 3AVFA 5C24A 3WXLA 4FJIA 1FJGK 2O8BB 1S3XA 3OYAA 5EX5A 3BDPA 3VEVA 2E2OA 1XC3A 2JWLA 3BZKA 2VQFK 4KH5A 3QIPA 4Z4CA 1H1VA 1N33K 4BY9C 3CF5L 4FZYA 4C8MA 4A5AA 2E20A 5AFUH 3K2PA 5AQJA 4OGEA 4AHCA 4E7HA 4W5NA 1K6YA 2E5LK 2RN2A 1KLMA 3PIOL 1C0MA 3RRHA 3SMSA 4AHTA 1CZBA 3FZHA 3J7AP 3FFKB 3FFIA 4O0JA 4NO7A 4FJNA 3MN7A 2HHTA 5GINA 3VEYA 1HKGA 1VQ5N 2A5XA 3SUQA 4LFBK 1O1WA 4ISFA 1HQEA 3OYBA 1N36K 4E1JA 3VTHA 4KRFA 1VQKN 4UY8O 1NJYA 3O80A 1LW2A 3SNNA 4DR5K 1RTIA 2NRTA 3G6EN 4CIFA 3E66A 1HJOA 1U49A 4FK4A 3KK3A 2QWOA 2D5RA 4YDUA 1KSPA 3MCPA 4F4KA 3M6GA 2NUBA 2XY6A 2HNYA 3D2EA 2P9IB 3WQTA 4K41A 4CHOA 4X66K 3J80O 3NCIA 1RT3A 5J2NA 1GLCG 3WNFA 3O9UA 1W0HA 4CHZA 5HRSA 4EP5A 1WSEA 3LAMA 2CH5A 3KLGA 3PX4A 2FBTA 3TAGA 2O8DA 4YOVA 3UKUA 2AP1A 3CCJN 2YHAA 1E4FT 5FRMA 4DV3K 4ZTJA 4CZGA 3HSCA 1WUAA 1B92A 3HP6A 4E3SA 3D45A 1J9AA 4IBNA 3LAKA 1TVRA 1CZAN 1TKDA 3AGKA 3GE1A 4U67L 3V4IA 3D2FB 5DM7L 4DTJA 4B9MA 3ID6A 4BG8A 1L3SA 4OKKA 4DF8A 1DKGD 4I2QA 3WXMB 5FDLA 3OYCA 3L3UA 3VMFB 1JLEA 3LWMA 3R3LA 2D1KA 3K9JA 4I6MA 3DLKA 3TR8A 4DHYA 4V19S 1KVCA 4M45A 1F21A 3ENOA 1I94K 3DMJA 3ZT0A 4DSKA 1NU0A 1S9GA 4DTNA 1NKCA 3OHRA 3DM2A 3UKRA 4H5TA 1YTUA 3CETA 1NLVA 5LY3A 3OS2A 4B9VA 3HRGA 4FWRA 1N34K 3TPQA 4GW6A 4KI4A 4LF9K 3OW2M 2Q3SA 2G8IA 1SAZA 4DSIA 4GNIA 1YVUA 4I2PA 3C7NA 2PAVA 3BF1A 4FVUA 3R8EA 5EY4A 4KTQA 3ULEA 1VSEA 4FWNA 3TARA 1VQPN 1QZ6A 3VERA 5A2QO 3E01A 4JS5A 1QQOA 3S3NA 2GV9A 3MK6A 1TYQA 4CGDA 3NVMA 4CK2A 4DR6K 3VQPA 3AGRA 1X9JA 2LSNA 2YNFA 1VQ9N 4Z4FA 3CG7A 4DB3A 5AQRA 1HYVA 3HM8A 4OGCA 4DU3A 5AZIA 4ID5A 4IOAL 3HTVA 2YCHA 1VRTA 1X1PA 4DQRA 2YV0X 1S1TA 4H5VA 3D2EB 3NE6A 1C1AA 3FLCO 1W9HA 4GY2B 4N47A 3G10A 3KWGA 3O9QA 4F9OA 3I33A 3O08A 1X3MA 4JRQA 4CJVA 4NCAA 1T05A 1W2BM 3LP0A 2O8DB 1KAZA 3UKUB 2F96A 4RW6A 5AQFA 4BDZA 5AZJA 2W6KA 5M1QA 3U9DA 4YY3K 2VQEK 3QFUA 4O4GA 3L0QA 1EX4A 3MMVA 4ILJA 1ZBSA 3EKSA 2A6AA 5BR9A 3EL2A 4MDAA 3VQDA 1U2VA 3CMEN 4GKJK 3TSUA 4JI3K 4JK8A 3QEPA 1VQ7N 2HF4A 3I0SA 3H6EA 4JKCA 2ZJRL 5C12A 4LC9B 4E1MA 1GOCA 1K8KA 1BDGA 4I6MB 4WF9L 4ZHRA 4DV2K 3GBTA 1VQ4N 2OPRA 3OYKA 1BOTO 3C0BA 3SQ0A 1JKHA 1TAQA 5JICA 4OPJA 4BE1A 1ZBLA 4FK2A 2HB5A 2FBVA 5EU7A 4FOEA 4KHPK 4C8NA 2ZJPL 3UKRB 3AA5X 2BTFA 3VOVA 3IDHA 4DU1A 3V81A 4B9NA 3O3FA 4G9ZA 2PFUA 4YOUA 3OYEA 2G8UA 4CF1A 1A5XA 4YNQA 3IAYA 1VAZA 1JCFA 3SJJA 4JHDA 1GOAA 4A62A 4PY5A 3B8AX 5C2FA 3C7NB 5KQDA 1NJXA 2YKMA 1YUWA 3ULEB 1RDUA 1WNSA 4B3MK 4N56A 2HHSA 1TYQB 3M8SA 1IKWA 4NXMK 1L3TA 4DQSA 2PBDA 4JKHA 3VN5A 2PYJA 1XI1A 2E6LA 3C95A 5DK5A 2YX6A 3OYIA 3HO1A 4H8KA 4FLZA 2E8AA 1HMVA 3DRSA 1C0UA 1MWKA 3A5LC 1C1BA 2NZTA 3WNHA 4RG8A 5KRTA 1WBBA 4LH4A 4CEQA 2ZD1A 2OPPA 4E7LA 3NVKA 5GADP 2D0AA 2HBMA 4MO4A 3QETA 4KHNA 4DCHA 1QQMA 1SL0A 4JV5K 2O4GA 3KK7A 1OH8A 3AVLA 3THVA 1FW6A 4B9UA 4JKDA 3VA3A 3P5JA 3PO4A 2P9SA 4OPHA 5AZJB 4BREA 1D5AA 3HSTB 1QS4A 2F9TA 4JKGA 3MXJA 3MN5A 1S6PA 2XO7A 2Z1GA 3VF6A 1Q9XA 4CIEA 1XNRK 2I5JA 5F2RA 3RR8A 3OYNA 1U2VB 1BA0A 3AVHA 3M5RA 4BACA 3SZ2A 4FWSA 1S1UA 2IGIA 4NB4A 3G4SN 2A40A 1R59O 4MLHA 4F3TA 3EE9A 1DLOA 4AHUA 2V7YA 3ENBA 3LWLA 2OPQA 1K8KB 4A2AA 1RNHA 1VRUA 5KPTA 5AQYA 4M3RA 3CQ8A 1U6ZA 3F73A 4PL7A 1WOQA 4CGFA 4E7KA 2XY5A 4B8CA 1V4TA 1TUYA 3J7ZO 2QEXN 3SQ1A 4KH4A 3ISNC 3DYAA 4CCHA 3PX6A 4JHDB 4Y0WA 1SUQA 3V9XA 3FZMA 5KGWA 3RRGA 3PO5A 4DSFA 5IT9O 3U8XA 3LM9A 3VQCA 1BCMA 3LDOA 3NH2A 2ASOA 3CQYA 3EZWA 4CJ3A 4OJRA 4IFEA 3QO9A 2FLOA 4LH5A 2YNGA 3TWHA 3E9LA 1DTQA 3M8RA 4FM0A 3TI0A 1SL1A 3L2VA 3VF2A 3ATVA 4FO0A 4WCEL 3L4QA 1VHXA 4FJ8A 4DQ8A 1YJWN 2ZJQL 3QMLA 3OTOK 2NLXA 3CM5A 2E88A 5AQHA 5F1XA 3L8BA 3O4NA 4IZ9A 3N4QA 3SMPA 4CZFA 2WOMA 4BVOA 3I8BA 3BY5A 3JS6A 4KKOA 2D0CA 2D0OA 1BHLA 2DY4A 1TK0A 3OS0A 5HLFA 2F4VK 4FJ9A 3KLIA 2KLAA 1BO5O 3AVGA 3Q7CA 1J5OA 2KFNA 4FLVA 1OVYA 3KWIA 3DXKA 5LJWA 3SUPA 1UA0A 5M1NA 4O5BA 3MXMA 2QK9A 1QQNA 3WNGA 3TTCA 3A5NC 3ZSQA 2VWBA 1JLGA 4UQGA 2P9SB 3H3NO 5FPMA 2HF3A 1BQNA 5AQNA 4BGBA 1HNZK 4JKGB 2VG5A 3SAFA 3QNOA 4CGJA 2W40A 3HZ6A 1VQLN 4CGIA 4DSJA 4CF8A 1TV6A 4EHTA 5KQ8A 3PSFA 3CJ9A 4QAGA 4HUGA 4J2BA 3CD6N 4AHSA 2Q1NA 3CERA 1TAUA 2VCPA 1HYZA 2WBNA 1K8AO 2FBXA 1N6QA 1QVFM 3PX0A 3LDPA 4CEAA 4YOXA 3ZT2A 4ZTFA 4CF0A 1V4SA 3LPUA 4A2BA 3K59A 4CK1A 2E4LA 3T1HK 2Q0UA 4EHUA 1S1WA 3CPWM 4DG1A 2QWQA 1NGEA 1NBWA 3SLCA 2IOCA 4CGGA 1IKVA 1HNIA 4EZ6A 1X9SA 2H3GX 1CLQA 5KGXA 3EEQA 3P31A 1U4BA 4CJTA 4CFCA 1SQKA 1D4XA 4DV0K 2UXDK 2FBYA 4PWDA 4PA1A 4WE1A 4CEBA 1QE1A 3SYZA 4BRNA 5SZTA 2VGMA 1JCEA 4NYFA 1Y64A 1NK6A 4N41A 3ASMA 1ZBIA 4H0XB 4CHQA 5HRRA 3R9PA 4B9TA 4LF5K 2ZGZA 3SPZA 5E84A 3NF9A 2Y1IA 1IH7A 3HP9A 4KHWA 3FE1A 1OH7A 4KB1A 4E0DA 3LP2A 2A3ZA 3VQ9A 1X9MA 1S1XA 2W42A 4M3TA 3VQAA 1JLQA 1X3NA 4GV6A 3S41A 1QSYA 3V9ZA 4Q0BA 1KFSA 4B1WB 4FJLA 1BCOA 3VGKA 4WQ4A 1YTAA 2FSKA 1VSLA 2VG6A 3C94A 3D6RA 2ZGYA 4IWVA 3V1RA 1SL2A 3H08A 5BRFA 3KKSA 3A5OC 3DXMA 2HHQA 4HVJA 1TK5A 4EP4A 5ADXA 4KO0A 3B6OA 4Y1CA 4FWMA 3DXKB 4FVMA 2BE2A 4M7YA 2HOEA 3OYJA 4KB0A 1C0FA 1SZ2A 4RWTA 3AA2A 4M3WA 1GLDG 4FZXC 1Q82O 4CBWA 2YNIA 3HPHA 1NK8A 3CC4N 4AHRA 2YHXA 4DTMA 4FSVA 3DLHA 2ASPA 1WSHA 5HL7L 1T6CA 2GWKA 4FJ7A 1EXQA 2HHHK 4DTRA 1FK9A 3J7YP 2WC9A 4JKFA 2DFHA 1U47A 1DGKN 3WNEA 1KD1O 3CCEN 2UXCK 3FZFA 4HCBA 3O9RA 4IFVA 1YT3A 4JNEA 3ZYYX 4B3OA 3ID8A 4AHVA 4XH5A 1JL1A 3HL8A 4G1QA 3DOLA 5M1FA 1C0TA 1KVAA 4JK9A 3TU5A 3HM9A 4FLXA 1T03A 5JLFA 4RW7A 2B4JA 4FJMA 1RTDA 4J2DA 4CEEA 3RMCA 5C25A 3KLHA 1OH6A 1Q9YA 3H3OB 4ICLA 3U6FA 1SKRA 4DR4K 1XC9A 4YOTA 3CCLN 3O4QA 4XIUA 2RF2A 4DR3K 1NGIA 2IDOA 1RBSA 3EZ5A 1T8EA 2UXBK 3ZEUA 3ZT4A 2HVIA 5J1EA 2P9NA 4BR0A 1UOCA 1W7AA 5F0XA 2HNZA 4JI4K 1MDUB 4I9LA 1B9FA 5BRDA 3VGLA 4M42A 4ILHA 1Q81O 4CFDA 2WTUA 5CYMA 4IEIA 2QKKA 3O5BA 1ATSA 4CBXA 4H0PA 1XHXA 4IDHA 4GMJB 1ZBHA 3OYFA 5T7BA 3SUOA 1ZC6A 3EY1A 2O4IA 3L4IA 4ELUA 3HXMA 1QQCA 1NGBA 3DXMB 4QS9A 4KHYA 5TKWA 3L2RA 1NJIO 4FJHA 2J4RA 4BR9A 3J8AA 4B1ZA 1TGOA 4CBUA 4CVNE 4DKWA 5AQGA 3ITHA 4H5NA 4JKAA 3CQXA 1LW0A 1GLBG 4C8KA 4CJPA 1J54A 1WAFA 4J8FA 4DQQA 3L2WA 2FF6A 2E2PA 3L2QA 2KHOA 5MLCQ 2QWRA 3RMBA 2AA4A 1A5VA 4HUEA 4F2RA 4DR2K 3AO1A 3NF7A 1HKBA 4DLGA 1WSJA 2I7PA 1ASWA 1O13A 4FJKA 3VF4A 2P9LA 1ZYQA 2VYPA 2ZE2A 2UU9K 1MA9B 4O44A 2P9PA 1IBLK 1YI2N 3CCUN 3TAFA 3DLRA 4GV3A 1LCUA 4NXNK 5KI6A 3KHYA 5H1SQ 2PYLA 3CC7N 5C15A 3HT3A 3VESA 4WQ5A 3PV8A 4CIGA 1GLFO 4PHTX 1QVGM 4JD2A 1TUUA 4BRFA 4M3YA 5HROA 5KPRA 3AAPA 4ELTA 1BISA 1RDBA 3MN9A 3T1YK 1ILYA 1TKTA 1IBKK 4GVEA 3WEEA 2QA4N 3ZEUB 2Q97A 2P9NB 3P4IA 5CR4A 3LZIA 4QCLA 4KHSA 4CJ7A 3ALYA 4H5RA 1LAWA 3AVCA 3CJ1A 5C0YA 1KTQA 3L2UA 3WUHA 4CEOA 1BQMA 1VSIA 2QWLA 4AH9A 4EAHD 1WSFA 3K5LA 5FPEA 5AQQA 1K73O 1KXPA 1CXUA 3RSEA 1JL2A 3V1OA 2DFFA 1OH5A 3GL1A 3C6HA 3BUZB 4Q5VA 2BH1A 3UE5A 3GG4A 1DT9A 3AA4A 1N8RO 2RHKA 1NJZA 1VQ8N 4DR7K 5AQTA 3DLLL 3C6AA 2FF3B 2JWKA 2CGKA 3IFRA 4Z0UA 4MO5A 4B9QA 3O3GA 4DS5A 2B5JA 3VTIA 4OPKA 2CGJA 3WQUA 5HP1A 4JI5K 1EP4A 4DUYK 4PKHA 3M8PA 4Y1DA 4CJRA 4W5TA 3SUNA 4IOXA 3DLEA 2A41A 3T69A 2JGUA 4CGHA 4FM1A 4FOIA 3VQ8A 2F8TA 1D8YA 2ZF5O 5FPNA 4PQUA 4BQZA 4JS4A 5FRNA 4KHQA 1NK9A 3VQEA 4CZHA 3TANA 2Q2RA 4F3OA 3ZETA 3AVKA 3M8QA 4OVLA 4YOYA 4PL8A 3S3MA 1Q18A 4IDKA 2P9LB 3N4PA 3WXIA 1YITN 1K9MO 1E4GT 2P9PB 3CCSN 1YHQN 1NM1A 4GVMA 3OJUA 1R0AA 2G8FA 4DFJA 3SCXA 4BRGA 2KKZA 1TL1A 4O8KA 4YDUC 2QWNA 3NAEA 2V51B 1ESVA 3O9SA 1VSJA 3CYMA 4JD2B 3I56N 4DWIA 3FZKA 1IG8A 1TKXA 5CYQA 4FK0A 3D7EO 4DV4K 1MWMA 4CFBA 4KTZA 4Z4EA 3WEEB 3L3VA 2EHGA 4X64K 3QBWA 4CHNA 1QZ5A 1SV5A 1U45A 2HSTA 1EWQA 2OANA 1G99A 3QLHA 2X74A 1CZ9A 3ZCMA 4IG0A 3KVGA 2QWPA 5HRPA 3MWTA 4AILC 4M3XA 3AO3A 5I3UA 4B9LA 3TSQA 3LALA 3BP8A 3RSEB 3ZSVA 4BC3A 1DTTA 2GBZA 3OYDA 2F9WA 3HVTA 1WN7A 4K8ZA 3O3HA 3GDQA 2B6AA 3AAQA 4CEFA 2KTQA 5FPDA 5KTQA 1QHTA 1C1CA 4QS8A 4Z4GA 2Q31A 4LSLA 4FLTA 3WXKA 2WFBA 4JLHA 4LFCK 5DM6L 1EO1A 1RDWX 4FJGA 1WSGA 2ZQBA 4J2EA 4LF6K 3JXUA 2ITGA 5BPMA 4B1YB 4DS4A 1P90A 3ATUA 3PSIA 4HHTA 4LY7A 2BGGA 3OYGA 2YNHA 3DLGA 3LP3A 2GEMA 4DTUA 5AFUA 2HMPA 4AM6A 3ENHA 4X65K 4IO8A 4IJNA 3S3OA 3C65A 4KH6A 2QW9A 5AQOA 3OYLA 3PY8A 4JRPA 4H4MA 3SJHA 3NGZA 3K5MA 3KKRA 4IOCL 2BDPA 3ZETB 3QINA 4A5BA 4AF1A 4CZJA 1ASUA 3A2FA 3JAMO 3AVMA 1HPMA 1KAYA 5J2PA 4E7IA 3TTDA 4C1NI 3VQ4A 3MAQA 1HPZA 4DV1K 3F2KA 1Z6RA 2NRVA 3DAWA 4BGAA 1UWBA 2UYTA 2ZWHA 4JK7A 3CIPA 5GAEP 1S22A 4KI6A 4KFBA 4DSLA 1SS6A 4FLYA 1QSLA 2P1JA 4KTWA 4CECA 5EOYA 3P39A 1C0GA 4W5QA 2RPIA 2FSNA 3THWB 2OZSA 5M1PA 1BIZA 3CFRA 4CK3A 4MDBA 4YOWA 3KK2A 4CHPA 3AVIA 3TAPA 1BA1A 3VEWA 2P9KA 4M7XA 4OPAA 4CHYA 5JLHA 5LJVA 5GAHP 4K43A 4MFBA 1RTHA 5AQZA 3ZLJA 1BIUA 4LF7K 3V6DA 2HHVA 4K0KK 1IBMK 4CJKA 2OZMA 3RWUA 5AQPA 2IAJA 3HBTA 1HNXK 1U48A 2XY7A 2E1YA 3O9TA 5JS2A 1ZBFA
chains in the Genus database with same CATH topology
1RDCA 1JL1A 3HL8A 4G1QA 3DOLA 2EX3A 3NE6A 1C1AA 4J2AA 4I7FA 1C0TA 1W9HA 3G10A 4N47A 1KVAA 3DOKA 4CERA 3HM9A 4FLXA 1T03A 2ETJA 3P1GA 5K14A 2HHXA 4RW9A 4RW7A 4FW1A 2B4JA 4FJMA 4JRQA 4CJVA 4R5PA 2P51A 4NCAA 3AO4A 1RTDA 5E41A 1T05A 2IS3A 4J2DA 4N76A 2Z1HA 3SQ4A 4CEEA 1FXXA 3RMCA 5C25A 3KLHA 3LP0A 1Q9YA 4OLBA 4ICLA 4CJFA 4IG3A 3U6FA 4BWJA 2F96A 2HNDA 4RW6A 4Z4HA 1SKRA 4KV8A 4BDZA 5KRSA 5JS1A 3C6UA 1XC9A 3NF8A 4O4GA 3ZT1A 3T1AA 3SQ2A 3S9HA 3O4QA 3V9SA 2VWKA 2RF2A 4XIUA 2IDOA 1EX4A 3I0RA 1BGXT 3K5NA 1RBSA 1NK5A 3JYTA 3KIOA 1IO2A 3LP1A 3DI6A 3IRXA 3EZ5A 1RTJA 4DFKA 1T8EA 3ZT4A 4M3UA 2HVIA 5J1EA 1XHZA 2P5OA 4H4OA 1UOCA 1ASVA 3VQDA 4CFAA 2HNZA 1NK7A 1FKOA 3K5OA 2AJQA 5HRNA 3QEIA 4B8AB 4I9LA 5DMRA 1B9FA 4CE9A 2GUIA 3QEPA 1RT5A 3OVNA 3KLFA 4M42A 1LWEA 3I0SA 4ELVA 4CFDA 3ZSRA 4CESA 3AO5A 3ZSOA 5CY4A 5CYMA 2QKKA 4F8RA 1KVBA 4E1MA 1XHXA 1JXBA 5J2QA 1GOCA 1VSMA 3QEVA 3K57A 3KK1A 4GMJB 1RDDA 4ZHRA 1JLCA 3OYFA 1ZBHA 5T7BA 2OPRA 3OYKA 3KD1E 3SUOA 3SQ0A 1S9EA 1JKHA 1TAQA 3EY1A 4OPJA 4BE1A 4FCYA 4ELUA 4FJ5A 1ZBLA 4FK2A 2HB5A 3LPTA 1A5WA 1QQCA 2FBVA 3HXMA 2VG7A 5EU7A 4DFPA 3VQ7A 3KD5E 3LDSA 4FJJA 4C8NA 3AA5X 1RT1A 4BDYA 1RDAA 3IS9A 2X6SA 2KQ2A 4DU1A 4KHYA 2R7YA 3L2RA 3V81A 1LWCA 4DTXA 4B9NA 3O3FA 2G8UA 3OYEA 4FJHA 1B9DA 3VQ6A 2A1RA 4CF1A 1A5XA 4YNQA 5J2MA 3IAYA 4CF9A 3SJJA 3ZT3A 4N5SA 1GOAA 1TGOA 3QEWA 4DF4A 3U3GA 4PY5A 3T3FA 3ITHA 3QERA 1LW0A 4HTUA 1NJXA 4C8KA 4CJPA 3TAEA 1SKWA 4LSNA 1J54A 1WAFA 2YKMA 4DQQA 3L2WA 1BI4A 3SPYA 3OYHA 1JXEA 1WNSA 1MU2A 3K58A 1L5UA 4CF2A 3QNNA 4CJLA 2VWJA 1QSSA 4DSEA 1I39A 4N56A 4MQ3A 3L2QA 3OYMA 1NK4A 2HMIA 2KZZA 3RMBA 2HHSA 2DTUA 1A5VA 3M8SA 1IKWA 1ZBFA 3JSMA 1TK8A 4DQSA 1L3TA 1L3UA 4HUEA 4F2RA 3AO1A 3VA0A 2XY8A 1N5YA 3NF7A 3MEGA 3VN5A 1XI1A 2PYJA 2E6LA 3C95A 4DQIA 3F9KA 5DK5A 2Y1JA 1KFDA 4FYDA 2P5GA 3OYIA 3RMDA 3HO1A 4H8KA 4DLGA 4FLZA 1WSJA 2HW3A 1ASWA 1HMVA 1C0UA 3AV9A 3DRSA 3P83D 4C8OA 4FJKA 1C1BA 4W5OA 3WNHA 1ZYQA 4RG8A 5KRTA 1HRHA 4DTPA 3DLBA 3VQBA 2ZE2A 1HYSA 4LH4A 4CEQA 2ZD1A 1UA1A 2OPPA 4E7LA 4FJXA 1TKZA 1RT7A 3V1QA 4O44A 3VQQA 3DRPA 2D0AA 1J53A 5D3GA 3QETA 4KHNA 3AO2A 3LZJA 3TAFA 4DLEA 2G8WA 1JLFA 3CM6A 3DLRA 3NH1A 3ZSZA 1SL0A 2O4GA 5KI6A 1QTMA 2PYLA 2QXFA 4HCCA 3HT3A 3AVLA 5C42A 3PUFA 4ID1A 1RILA 3PV8A 4CIGA 3THVA 4B9UA 3VA3A 3P5JA 4L8RB 3PO4A 3KTQA 2A1SA 3ZSXA 1SKSA 1D5AA 3HSTB 1QS4A 4M3YA 2YKNA 5HROA 2XHBA 1LWFA 1GOBA 4BE0A 4ELTA 1RBUA 1WAJA 3MEDA 1ITGA 4IKFA 1BISA 3MXJA 1RDBA 4O0IA 3SV3A 1Z26A 4FW2A 1S6PA 1TKTA 2XO7A 2D0BA 2Z1GA 4C8LA 1VSKA 1UA0A 3MECA 1Q9XA 4CIEA 3RTVA 2X78A 3LZIA 2HHUA 2I5JA 3RR8A 4QCLA 4KHSA 3OYNA 3UIQA 1CXQA 4KHUA 3ALYA 3QEXA 3AVHA 3HVRA 1LAWA 3AVCA 4BACA 3SZ2A 2RKIA 1KTQA 4F2SA 1KLNA 1S1UA 2IGIA 3L2UA 1G15A 4CEOA 4HUFA 1BQMA 1VSIA 3CFPA 3U3YA 1NKBA 4AH9A 1RT2A 4E1NA 4F3TA 1VSHA 4BWMA 1WSFA 3K5LA 1DLOA 1JLAA 4AHUA 4DFMA 3B6PA 4O55A 3LWLA 1CXUA 2OPQA 3QIOA 3QESA 1WLJA 3BGRA 1RNHA 1JL2A 3V1OA 2DFFA 1VRUA 4M3RA 3CQ8A 4Q5VA 3AVNA 4CJWA 3OY9A 1EETA 3F73A 4I9QA 1LV5A 4CGFA 4PUOA 1NOZA 1Y97A 3AA4A 4B8CA 4RW8A 4E7KA 2XY5A 1KCFA 2HHWA 2PZSA 3G0ZA 4M3ZA 1NJZA 4NCGA 2WONA 3AVJA 4E89A 3NH0A 3SQ1A 1U04A 2OA8A 4W5NA 5FROA 1LAVA 3ISNC 4OKJA 1VSFA 3DYAA 4CCHA 4FLUA 3HJFA 3NFAA 3T19A 4LD0A 3PX6A 3LANA 1SUQA 3V9XA 4Z0UA 5KGWA 1JLBA 3O3GA 3V9UA 3PO5A 3RRGA 4DSFA 4DMNA 4DS5A 2B5JA 3TAMA 3VQCA 1BCMA 4CJ5A 3NH2A 4OPKA 5HP1A 4E19A 2G8VA 1EP4A 1WSIA 1S6QA 1Z25A 3M8PA 4Y1DA 4CJ3A 4CJEA 4CJQA 1RBTA 4OJRA 4Z4IA 1BI4B 1I3AA 3QO9A 4CEZA 1XWLA 4LH5A 2YNGA 3TWHA 4CJRA 4W5TA 4KAZA 1DTQA 4FXDA 4OLAA 3M8RA 4FM0A 3SUNA 3SV4A 3DLEA 4QOZB 3TI0A 1SL1A 3NBPA 3L2VA 2JGUA 4CGHA 4FM1A 3DRRA 3HPOA 3VQ8A 2F8TA 3I8DA 1D8YA 1D9FA 2OPSA 1D9DA 4K8XA 3NGYA 4CJUA 4PQUA 4JS4A 2Z1IA 5FRNA 4KHQA 4FJ8A 3AVFA 1NK9A 3VQEA 5C24A 3TANA 4B9SA 4F3OA 4FJIA 3AVKA 3M8QA 4OVLA 1NJWA 4EZ9A 3KLEA 4DQRA 3S3MA 3NGIA 3CM5A 1EKEA 4NCBA 1S1TA 3OYAA 1RCHA 3OS1A 2KW4A 4IDKA 3L8BA 3BDPA 3O4NA 4E7JA 1NK0A 2WOMA 1Q8IA 4IFYA 5CZ1A 1S5JA 2D0CA 4KKOA 4BE2A 3QIPA 4Z4CA 1BHLA 2DY4A 1TK0A 4GVMA 3OS0A 3OJUA 5HLFA 1R0AA 2G8FA 4DFJA 4FJ9A 3SCXA 3KLIA 3AA3A 4FZYA 2KFNA 3AVGA 1J5OA 1TL3A 1TL1A 4C8MA 4FLVA 4NYNA 4DU4A 4E7HA 2BANA 1HQUA 3K2PA 4OGEA 4AHCA 3NAEA 1K6YA 3HPGA 4O5BA 3D0PA 2RN2A 3SUPA 1KLMA 3MXMA 3WNGA 2QK9A 3ZSQA 4YFUA 1VSJA 3CYMA 1JLGA 1RT4A 4UQGA 4DWIA 1C0MA 3RRHA 1BQNA 3V9WA 3AVBA 4AHTA 3EYZA 1CZBA 1TKXA 1HJRA 2VG5A 5CYQA 3QNOA 4FK0A 4CGJA 3FFIA 1VSDA 4O0JA 4DSJA 4CGIA 4FJNA 4CFBA 4KTZA 4Z4EA 1REVA 4CF8A 2HHTA 3L3VA 2EHGA 1C6VA 1FKPA 1HNVA 1TV6A 3RMAA 4CHNA 3SI6A 4KPYA 4QAGA 1SV5A 4HUGA 4J2BA 1BL3A 1U45A 5HBMA 4AHSA 3SUQA 1TAUA 2QKBA 1O1WA 5I42A 4OKEA 3QLHA 1HQEA 3OYBA 1HYZA 4CJ4A 2X74A 4KRFA 1NJYA 1CZ9A 3ZCMA 2FBXA 1N6QA 4IG0A 1LW2A 3PX0A 3SNNA 5HRPA 2F8SA 4AILC 1RTIA 4W5RA 4M3XA 3AO3A 4CEDA 4FM2A 5I3UA 4CIFA 4CEAA 3ZT2A 4ZTFA 4CF0A 4B9LA 3LALA 3LPUA 2Z1JA 3ZSVA 1U49A 4FK4A 1DTTA 2GBZA 3OYDA 4KREA 3HVTA 1WN7A 3KK3A 3O3HA 4CK1A 3K59A 4DQPA 4K8ZA 1KRPA 2B6AA 4CEFA 2D5RA 2E4LA 2KTQA 4B08A 1S1WA 5KTQA 1KSPA 4F4KA 1QHTA 1C1CA 2XRIA 3IG1A 4DG1A 4Z4GA 2NUBA 2XY6A 2HNYA 4LSLA 4FLTA 4CHOA 2IOCA 4CGGA 1IKVA 1HNIA 4TSXA 3NCIA 1IKYA 1RT3A 4JLHA 3WNFA 5J2NA 1X9SA 4EZ6A 1CLQA 5JS2A 3MXIA 5KGXA 1W0HA 4FJGA 1WSGA 2ZQBA 4J2EA 4CHZA 5HRSA 2PY5A 4EP5A 2ITGA 4CJTA 1U4BA 4CFCA 1WSEA 4DS4A 3LAMA 2JLEA 3KLGA 3PX4A 2FBTA 2FBYA 4HHTA 4LY7A 3TAGA 2BGGA 3OYGA 2YNHA 1NOYA 4PWDA 3TAQA 4PA1A 3DLGA 3LP3A 1QE1A 4WE1A 4CEBA 5SZTA 3OJSA 3SYZA 4DTUA 1X9WA 4NYFA 1NK6A 4N41A 2YHAA 5FRMA 1RBRA 1IG9A 4ZTJA 3ASMA 4E3SA 3HP6A 1S1VA 1B92A 1ZBIA 4CHQA 3D45A 5HRRA 1J9AA 4B9TA 4IBNA 4DTSA 3LAKA 1T7PA 4CJSA 3SPZA 1TVRA 3MEEA 3NF9A 2Y1IA 3TABA 1IH7A 3S3OA 3HP9A 1TKDA 4KHWA 3C6TA 4KB1A 3OYLA 4E0DA 3LP2A 3PY8A 4BDPA 1RBVA 4JRPA 3V4IA 4H4MA 4DTJA 3VQ9A 3NHGA 1X9MA 4B9MA 1S1XA 2W42A 4M3TA 1L3SA 3VQAA 3ULDA 1JLQA 4FLWA 3NGZA 4OKKA 3KKRA 3K5MA 4DF8A 2BDPA 1ZBUA 2DFEA 3QINA 4I2QA 1ASUA 2IC3A 1QSYA 3V9ZA 5FDLA 4Q0BA 3OYCA 1KFSA 3A2FA 3HYFA 3L3UA 1JLEA 3AVMA 3LWMA 5J2PA 4FJLA 4E7IA 1BCOA 1RT6A 3VQ4A 1YTAA 1VSLA 2X6NA 3MAQA 2VG6A 3C94A 3DLKA 1HPZA 3TR8A 3V1RA 1SL2A 3H08A 1KVCA 5CZ2A 3ZSWA 4M45A 1F21A 3KKSA 1UWBA 3AVAA 3DMJA 3RR7A 2HHQA 3ZT0A 4HVJA 4DSKA 1TK5A 1S9GA 4EP4A 4DTNA 1NKCA 4KO0A 3DM2A 4KFBA 4KI6A 3B6OA 4DSLA 4Y1CA 2OYQA 1YTUA 4FLYA 1QSLA 2P1JA 4KTWA 2G8KA 3OS2A 4B9VA 1L3VA 4CECA 4FVMA 2BE2A 4RW4A 4W5QA 2RPIA 4GW6A 3OYJA 3NF6A 4KB0A 4KI4A 3KJVA 2OZSA 2KZMA 2Q3SA 4FZZA 2G8IA 1BIZA 5SWMA 1UAXA 3AA2A 3CFRA 4DSIA 4M3WA 2HVHA 4CK3A 2YHBA 1YVUA 4I2PA 3KK2A 4FZXC 4CHPA 3AVIA 3TAPA 4CHYA 2YNIA 4KTQA 3HPHA 3CFOA 4MFBA 2ATQA 4DTOA 1NK8A 1VSEA 4AHRA 3TARA 3ZSYA 1RTHA 1VK0A 4M41A 4DTMA 1NKEA 3E01A 4JS5A 3DLHA 2O4IA 1BIUA 3VQ5A 3S3NA 3V6DA 2HHVA 2GV9A 1WSHA 4CGDA 4CJKA 1EXQA 4CK2A 3NDKA 2OZMA 3RWUA 4FJ7A 4DTRA 1FK9A 3VQPA 2LSNA 2YNFA 2IAJA 1IKXA 2DFHA 4Z4FA 2E6MA 3CG7A 2FC0A 1U47A 3WNEA 2G8HA 1HYVA 4OGCA 4DU3A 1U48A 4ID5A 2XY7A 2KFZA 4HCBA 3HK2A 4IFVA 1YT3A 1VRTA 4B3OA 1X1PA 4AHVA 2YV0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDC A;  1JL1 A;  3HL8 A;  4G1Q A;  3DOL A;  2EX3 A;  3NE6 A;  1C1A A;  4J2A A;  4I7F A;  1C0T A;  1W9H A;  3G10 A;  4N47 A;  1KVA A;  3DOK A;  4CER A;  3HM9 A;  4FLX A;  1T03 A;  2ETJ A;  3P1G A;  5K14 A;  2HHX A;  4RW9 A;  4RW7 A;  4FW1 A;  2B4J A;  4FJM A;  4JRQ A;  4CJV A;  4R5P A;  2P51 A;  4NCA A;  3AO4 A;  1RTD A;  5E41 A;  1T05 A;  2IS3 A;  4J2D A;  4N76 A;  2Z1H A;  3SQ4 A;  4CEE A;  1FXX A;  3RMC A;  5C25 A;  3KLH A;  3LP0 A;  1Q9Y A;  4OLB A;  4ICL A;  4CJF A;  4IG3 A;  3U6F A;  4BWJ A;  2F96 A;  2HND A;  4RW6 A;  4Z4H A;  1SKR A;  4KV8 A;  4BDZ A;  5KRS A;  5JS1 A;  3C6U A;  1XC9 A;  3NF8 A;  4O4G A;  3ZT1 A;  3T1A A;  3SQ2 A;  3S9H A;  3O4Q A;  3V9S A;  2VWK A;  2RF2 A;  4XIU A;  2IDO A;  1EX4 A;  3I0R A;  1BGX T;  3K5N A;  1RBS A;  1NK5 A;  3JYT A;  3KIO A;  1IO2 A;  3LP1 A;  3DI6 A;  3IRX A;  3EZ5 A;  1RTJ A;  4DFK A;  1T8E A;  3ZT4 A;  4M3U A;  2HVI A;  5J1E A;  1XHZ A;  2P5O A;  4H4O A;  1UOC A;  1ASV A;  3VQD A;  4CFA A;  2HNZ A;  1NK7 A;  1FKO A;  3K5O A;  2AJQ A;  5HRN A;  3QEI A;  4B8A B;  4I9L A;  5DMR A;  1B9F A;  4CE9 A;  2GUI A;  3QEP A;  1RT5 A;  3OVN A;  3KLF A;  4M42 A;  1LWE A;  3I0S A;  4ELV A;  4CFD A;  3ZSR A;  4CES A;  3AO5 A;  3ZSO A;  5CY4 A;  5CYM A;  2QKK A;  4F8R A;  1KVB A;  4E1M A;  1XHX A;  1JXB A;  5J2Q A;  1GOC A;  1VSM A;  3QEV A;  3K57 A;  3KK1 A;  4GMJ B;  1RDD A;  4ZHR A;  1JLC A;  3OYF A;  1ZBH A;  5T7B A;  2OPR A;  3OYK A;  3KD1 E;  3SUO A;  3SQ0 A;  1S9E A;  1JKH A;  1TAQ A;  3EY1 A;  4OPJ A;  4BE1 A;  4FCY A;  4ELU A;  4FJ5 A;  1ZBL A;  4FK2 A;  2HB5 A;  3LPT A;  1A5W A;  1QQC A;  2FBV A;  3HXM A;  2VG7 A;  5EU7 A;  4DFP A;  3VQ7 A;  3KD5 E;  3LDS A;  4FJJ A;  4C8N A;  3AA5 X;  1RT1 A;  4BDY A;  1RDA A;  3IS9 A;  2X6S A;  2KQ2 A;  4DU1 A;  4KHY A;  2R7Y A;  3L2R A;  3V81 A;  1LWC A;  4DTX A;  4B9N A;  3O3F A;  2G8U A;  3OYE A;  4FJH A;  1B9D A;  3VQ6 A;  2A1R A;  4CF1 A;  1A5X A;  4YNQ A;  5J2M A;  3IAY A;  4CF9 A;  3SJJ A;  3ZT3 A;  4N5S A;  1GOA A;  1TGO A;  3QEW A;  4DF4 A;  3U3G A;  4PY5 A;  3T3F A;  3ITH A;  3QER A;  1LW0 A;  4HTU A;  1NJX A;  4C8K A;  4CJP A;  3TAE A;  1SKW A;  4LSN A;  1J54 A;  1WAF A;  2YKM A;  4DQQ A;  3L2W A;  1BI4 A;  3SPY A;  3OYH A;  1JXE A;  1WNS A;  1MU2 A;  3K58 A;  1L5U A;  4CF2 A;  3QNN A;  4CJL A;  2VWJ A;  1QSS A;  4DSE A;  1I39 A;  4N56 A;  4MQ3 A;  3L2Q A;  3OYM A;  1NK4 A;  2HMI A;  2KZZ A;  3RMB A;  2HHS A;  2DTU A;  1A5V A;  3M8S A;  1IKW A;  1ZBF A;  3JSM A;  1TK8 A;  4DQS A;  1L3T A;  1L3U A;  4HUE A;  4F2R A;  3AO1 A;  3VA0 A;  2XY8 A;  1N5Y A;  3NF7 A;  3MEG A;  3VN5 A;  1XI1 A;  2PYJ A;  2E6L A;  3C95 A;  4DQI A;  3F9K A;  5DK5 A;  2Y1J A;  1KFD A;  4FYD A;  2P5G A;  3OYI A;  3RMD A;  3HO1 A;  4H8K A;  4DLG A;  4FLZ A;  1WSJ A;  2HW3 A;  1ASW A;  1HMV A;  1C0U A;  3AV9 A;  3DRS A;  3P83 D;  4C8O A;  4FJK A;  1C1B A;  4W5O A;  3WNH A;  1ZYQ A;  4RG8 A;  5KRT A;  1HRH A;  4DTP A;  3DLB A;  3VQB A;  2ZE2 A;  1HYS A;  4LH4 A;  4CEQ A;  2ZD1 A;  1UA1 A;  2OPP A;  4E7L A;  4FJX A;  1TKZ A;  1RT7 A;  3V1Q A;  4O44 A;  3VQQ A;  3DRP A;  2D0A A;  1J53 A;  5D3G A;  3QET A;  4KHN A;  3AO2 A;  3LZJ A;  3TAF A;  4DLE A;  2G8W A;  1JLF A;  3CM6 A;  3DLR A;  3NH1 A;  3ZSZ A;  1SL0 A;  2O4G A;  5KI6 A;  1QTM A;  2PYL A;  2QXF A;  4HCC A;  3HT3 A;  3AVL A;  5C42 A;  3PUF A;  4ID1 A;  1RIL A;  3PV8 A;  4CIG A;  3THV A;  4B9U A;  3VA3 A;  3P5J A;  4L8R B;  3PO4 A;  3KTQ A;  2A1S A;  3ZSX A;  1SKS A;  1D5A A;  3HST B;  1QS4 A;  4M3Y A;  2YKN A;  5HRO A;  2XHB A;  1LWF A;  1GOB A;  4BE0 A;  4ELT A;  1RBU A;  1WAJ A;  3MED A;  1ITG A;  4IKF A;  1BIS A;  3MXJ A;  1RDB A;  4O0I A;  3SV3 A;  1Z26 A;  4FW2 A;  1S6P A;  1TKT A;  2XO7 A;  2D0B A;  2Z1G A;  4C8L A;  1VSK A;  1UA0 A;  3MEC A;  1Q9X A;  4CIE A;  3RTV A;  2X78 A;  3LZI A;  2HHU A;  2I5J A;  3RR8 A;  4QCL A;  4KHS A;  3OYN A;  3UIQ A;  1CXQ A;  4KHU A;  3ALY A;  3QEX A;  3AVH A;  3HVR A;  1LAW A;  3AVC A;  4BAC A;  3SZ2 A;  2RKI A;  1KTQ A;  4F2S A;  1KLN A;  1S1U A;  2IGI A;  3L2U A;  1G15 A;  4CEO A;  4HUF A;  1BQM A;  1VSI A;  3CFP A;  3U3Y A;  1NKB A;  4AH9 A;  1RT2 A;  4E1N A;  4F3T A;  1VSH A;  4BWM A;  1WSF A;  3K5L A;  1DLO A;  1JLA A;  4AHU A;  4DFM A;  3B6P A;  4O55 A;  3LWL A;  1CXU A;  2OPQ A;  3QIO A;  3QES A;  1WLJ A;  3BGR A;  1RNH A;  1JL2 A;  3V1O A;  2DFF A;  1VRU A;  4M3R A;  3CQ8 A;  4Q5V A;  3AVN A;  4CJW A;  3OY9 A;  1EET A;  3F73 A;  4I9Q A;  1LV5 A;  4CGF A;  4PUO A;  1NOZ A;  1Y97 A;  3AA4 A;  4B8C A;  4RW8 A;  4E7K A;  2XY5 A;  1KCF A;  2HHW A;  2PZS A;  3G0Z A;  4M3Z A;  1NJZ A;  4NCG A;  2WON A;  3AVJ A;  4E89 A;  3NH0 A;  3SQ1 A;  1U04 A;  2OA8 A;  4W5N A;  5FRO A;  1LAV A;  3ISN C;  4OKJ A;  1VSF A;  3DYA A;  4CCH A;  4FLU A;  3HJF A;  3NFA A;  3T19 A;  4LD0 A;  3PX6 A;  3LAN A;  1SUQ A;  3V9X A;  4Z0U A;  5KGW A;  1JLB A;  3O3G A;  3V9U A;  3PO5 A;  3RRG A;  4DSF A;  4DMN A;  4DS5 A;  2B5J A;  3TAM A;  3VQC A;  1BCM A;  4CJ5 A;  3NH2 A;  4OPK A;  5HP1 A;  4E19 A;  2G8V A;  1EP4 A;  1WSI A;  1S6Q A;  1Z25 A;  3M8P A;  4Y1D A;  4CJ3 A;  4CJE A;  4CJQ A;  1RBT A;  4OJR A;  4Z4I A;  1BI4 B;  1I3A A;  3QO9 A;  4CEZ A;  1XWL A;  4LH5 A;  2YNG A;  3TWH A;  4CJR A;  4W5T A;  4KAZ A;  1DTQ A;  4FXD A;  4OLA A;  3M8R A;  4FM0 A;  3SUN A;  3SV4 A;  3DLE A;  4QOZ B;  3TI0 A;  1SL1 A;  3NBP A;  3L2V A;  2JGU A;  4CGH A;  4FM1 A;  3DRR A;  3HPO A;  3VQ8 A;  2F8T A;  3I8D A;  1D8Y A;  1D9F A;  2OPS A;  1D9D A;  4K8X A;  3NGY A;  4CJU A;  4PQU A;  4JS4 A;  2Z1I A;  5FRN A;  4KHQ A;  4FJ8 A;  3AVF A;  1NK9 A;  3VQE A;  5C24 A;  3TAN A;  4B9S A;  4F3O A;  4FJI A;  3AVK A;  3M8Q A;  4OVL A;  1NJW A;  4EZ9 A;  3KLE A;  4DQR A;  3S3M A;  3NGI A;  3CM5 A;  1EKE A;  4NCB A;  1S1T A;  3OYA A;  1RCH A;  3OS1 A;  2KW4 A;  4IDK A;  3L8B A;  3BDP A;  3O4N A;  4E7J A;  1NK0 A;  2WOM A;  1Q8I A;  4IFY A;  5CZ1 A;  1S5J A;  2D0C A;  4KKO A;  4BE2 A;  3QIP A;  4Z4C A;  1BHL A;  2DY4 A;  1TK0 A;  4GVM A;  3OS0 A;  3OJU A;  5HLF A;  1R0A A;  2G8F A;  4DFJ A;  4FJ9 A;  3SCX A;  3KLI A;  3AA3 A;  4FZY A;  2KFN A;  3AVG A;  1J5O A;  1TL3 A;  1TL1 A;  4C8M A;  4FLV A;  4NYN A;  4DU4 A;  4E7H A;  2BAN A;  1HQU A;  3K2P A;  4OGE A;  4AHC A;  3NAE A;  1K6Y A;  3HPG A;  4O5B A;  3D0P A;  2RN2 A;  3SUP A;  1KLM A;  3MXM A;  3WNG A;  2QK9 A;  3ZSQ A;  4YFU A;  1VSJ A;  3CYM A;  1JLG A;  1RT4 A;  4UQG A;  4DWI A;  1C0M A;  3RRH A;  1BQN A;  3V9W A;  3AVB A;  4AHT A;  3EYZ A;  1CZB A;  1TKX A;  1HJR A;  2VG5 A;  5CYQ A;  3QNO A;  4FK0 A;  4CGJ A;  3FFI A;  1VSD A;  4O0J A;  4DSJ A;  4CGI A;  4FJN A;  4CFB A;  4KTZ A;  4Z4E A;  1REV A;  4CF8 A;  2HHT A;  3L3V A;  2EHG A;  1C6V A;  1FKP A;  1HNV A;  1TV6 A;  3RMA A;  4CHN A;  3SI6 A;  4KPY A;  4QAG A;  1SV5 A;  4HUG A;  4J2B A;  1BL3 A;  1U45 A;  5HBM A;  4AHS A;  3SUQ A;  1TAU A;  2QKB A;  1O1W A;  5I42 A;  4OKE A;  3QLH A;  1HQE A;  3OYB A;  1HYZ A;  4CJ4 A;  2X74 A;  4KRF A;  1NJY A;  1CZ9 A;  3ZCM A;  2FBX A;  1N6Q A;  4IG0 A;  1LW2 A;  3PX0 A;  3SNN A;  5HRP A;  2F8S A;  4AIL C;  1RTI A;  4W5R A;  4M3X A;  3AO3 A;  4CED A;  4FM2 A;  5I3U A;  4CIF A;  4CEA A;  3ZT2 A;  4ZTF A;  4CF0 A;  4B9L A;  3LAL A;  3LPU A;  2Z1J A;  3ZSV A;  1U49 A;  4FK4 A;  1DTT A;  2GBZ A;  3OYD A;  4KRE A;  3HVT A;  1WN7 A;  3KK3 A;  3O3H A;  4CK1 A;  3K59 A;  4DQP A;  4K8Z A;  1KRP A;  2B6A A;  4CEF A;  2D5R A;  2E4L A;  2KTQ A;  4B08 A;  1S1W A;  5KTQ A;  1KSP A;  4F4K A;  1QHT A;  1C1C A;  2XRI A;  3IG1 A;  4DG1 A;  4Z4G A;  2NUB A;  2XY6 A;  2HNY A;  4LSL A;  4FLT A;  4CHO A;  2IOC A;  4CGG A;  1IKV A;  1HNI A;  4TSX A;  3NCI A;  1IKY A;  1RT3 A;  4JLH A;  3WNF A;  5J2N A;  1X9S A;  4EZ6 A;  1CLQ A;  5JS2 A;  3MXI A;  5KGX A;  1W0H A;  4FJG A;  1WSG A;  2ZQB A;  4J2E A;  4CHZ A;  5HRS A;  2PY5 A;  4EP5 A;  2ITG A;  4CJT A;  1U4B A;  4CFC A;  1WSE A;  4DS4 A;  3LAM A;  2JLE A;  3KLG A;  3PX4 A;  2FBT A;  2FBY A;  4HHT A;  4LY7 A;  3TAG A;  2BGG A;  3OYG A;  2YNH A;  1NOY A;  4PWD A;  3TAQ A;  4PA1 A;  3DLG A;  3LP3 A;  1QE1 A;  4WE1 A;  4CEB A;  5SZT A;  3OJS A;  3SYZ A;  4DTU A;  1X9W A;  4NYF A;  1NK6 A;  4N41 A;  2YHA A;  5FRM A;  1RBR A;  1IG9 A;  4ZTJ A;  3ASM A;  4E3S A;  3HP6 A;  1S1V A;  1B92 A;  1ZBI A;  4CHQ A;  3D45 A;  5HRR A;  1J9A A;  4B9T A;  4IBN A;  4DTS A;  3LAK A;  1T7P A;  4CJS A;  3SPZ A;  1TVR A;  3MEE A;  3NF9 A;  2Y1I A;  3TAB A;  1IH7 A;  3S3O A;  3HP9 A;  1TKD A;  4KHW A;  3C6T A;  4KB1 A;  3OYL A;  4E0D A;  3LP2 A;  3PY8 A;  4BDP A;  1RBV A;  4JRP A;  3V4I A;  4H4M A;  4DTJ A;  3VQ9 A;  3NHG A;  1X9M A;  4B9M A;  1S1X A;  2W42 A;  4M3T A;  1L3S A;  3VQA A;  3ULD A;  1JLQ A;  4FLW A;  3NGZ A;  4OKK A;  3KKR A;  3K5M A;  4DF8 A;  2BDP A;  1ZBU A;  2DFE A;  3QIN A;  4I2Q A;  1ASU A;  2IC3 A;  1QSY A;  3V9Z A;  5FDL A;  4Q0B A;  3OYC A;  1KFS A;  3A2F A;  3HYF A;  3L3U A;  1JLE A;  3AVM A;  3LWM A;  5J2P A;  4FJL A;  4E7I A;  1BCO A;  1RT6 A;  3VQ4 A;  1YTA A;  1VSL A;  2X6N A;  3MAQ A;  2VG6 A;  3C94 A;  3DLK A;  1HPZ A;  3TR8 A;  3V1R A;  1SL2 A;  3H08 A;  1KVC A;  5CZ2 A;  3ZSW A;  4M45 A;  1F21 A;  3KKS A;  1UWB A;  3AVA A;  3DMJ A;  3RR7 A;  2HHQ A;  3ZT0 A;  4HVJ A;  4DSK A;  1TK5 A;  1S9G A;  4EP4 A;  4DTN A;  1NKC A;  4KO0 A;  3DM2 A;  4KFB A;  4KI6 A;  3B6O A;  4DSL A;  4Y1C A;  2OYQ A;  1YTU A;  4FLY A;  1QSL A;  2P1J A;  4KTW A;  2G8K A;  3OS2 A;  4B9V A;  1L3V A;  4CEC A;  4FVM A;  2BE2 A;  4RW4 A;  4W5Q A;  2RPI A;  4GW6 A;  3OYJ A;  3NF6 A;  4KB0 A;  4KI4 A;  3KJV A;  2OZS A;  2KZM A;  2Q3S A;  4FZZ A;  2G8I A;  1BIZ A;  5SWM A;  1UAX A;  3AA2 A;  3CFR A;  4DSI A;  4M3W A;  2HVH A;  4CK3 A;  2YHB A;  1YVU A;  4I2P A;  3KK2 A;  4FZX C;  4CHP A;  3AVI A;  3TAP A;  4CHY A;  2YNI A;  4KTQ A;  3HPH A;  3CFO A;  4MFB A;  2ATQ A;  4DTO A;  1NK8 A;  1VSE A;  4AHR A;  3TAR A;  3ZSY A;  1RTH A;  1VK0 A;  4M41 A;  4DTM A;  1NKE A;  3E01 A;  4JS5 A;  3DLH A;  2O4I A;  1BIU A;  3VQ5 A;  3S3N A;  3V6D A;  2HHV A;  2GV9 A;  1WSH A;  4CGD A;  4CJK A;  1EXQ A;  4CK2 A;  3NDK A;  2OZM A;  3RWU A;  4FJ7 A;  4DTR A;  1FK9 A;  3VQP A;  2LSN A;  2YNF A;  2IAJ A;  1IKX A;  2DFH A;  4Z4F A;  2E6M A;  3CG7 A;  2FC0 A;  1U47 A;  3WNE A;  2G8H A;  1HYV A;  4OGC A;  4DU3 A;  1U48 A;  4ID5 A;  2XY7 A;  2KFZ A;  4HCB A;  3HK2 A;  4IFV A;  1YT3 A;  1VRT A;  4B3O A;  1X1P A;  4AHV A;  2YV0 X; 
#chains in the Genus database with same CATH topology
 1RDC A;  4NLB A;  4I7F A;  2Q0R A;  2E2Q A;  5K14 A;  5B8H A;  4FW1 A;  2OTL N;  1OKJ A;  3O1W A;  4R5P A;  1XUP O;  2EWS A;  1HX1 A;  2IS3 A;  3SQ4 A;  4K42 A;  4BRI A;  3MN6 A;  4OLB A;  4IG3 A;  5C2D A;  4BWJ A;  2HND A;  4Z4H A;  5AQL A;  4KV8 A;  4BRL A;  5KPZ A;  3ZT1 A;  3SQ2 A;  3S9H A;  3V9S A;  3AY9 A;  1N32 K;  3H46 O;  3I0R A;  1BGX T;  1WBD A;  1NK5 A;  3LP1 A;  3DI6 A;  1RTJ A;  4FWQ A;  3F5T A;  4M3U A;  1XHZ A;  3IMX A;  2P5O A;  3F9M A;  3LDN A;  1ASV A;  4CFA A;  1YVN A;  3OA9 A;  1NK7 A;  1FKO A;  4ILG B;  3I55 N;  5HRN A;  3QBX A;  4B8A B;  3CJA A;  1RT5 A;  3R6M A;  3KLF A;  4FWL A;  5AQX A;  3THY B;  2GTD A;  3M1F A;  2RE2 A;  1KVB A;  4RTF D;  1JXB A;  1VSM A;  3K57 A;  3CPE A;  2YJF A;  1JLC A;  1J6Z A;  3KD1 E;  4B3T K;  4FCY A;  3WT0 A;  3VEX A;  4FJ5 A;  3KD5 E;  1A5W A;  4BRQ A;  2VG7 A;  3VQ7 A;  2NRX A;  3CJC A;  1RT1 A;  2X6S A;  3MCA B;  2KQ2 A;  3BF3 A;  2R7Y A;  5BRE A;  3CMA N;  4DTX A;  3BEX A;  2GUP A;  3VQ6 A;  2W6L A;  3QFP A;  4CF9 A;  3ZT3 A;  4N5S A;  5AQU A;  1YXQ A;  4DF4 A;  3U3G A;  2WUS A;  4FWK A;  2UUB K;  3QER A;  1ATR A;  4HTU A;  3T7Z A;  3TAE A;  2P9K B;  4LSN A;  4XH1 A;  4JYA K;  3E1Y A;  5BRH A;  3SPY A;  2YJE A;  3E9O A;  1MU2 A;  1W97 L;  4FWO A;  1XMO K;  4DSE A;  4MQ3 A;  3PIP L;  2HMI A;  2DTU A;  1TK8 A;  3FGU A;  1N5Y A;  3MEG A;  4DV5 K;  4DQI A;  1KFD A;  1WB9 A;  3AV9 A;  5BN9 A;  4W5O A;  1HRH A;  4DTP A;  3DLB A;  5AQK A;  1HYS A;  1TKZ A;  1RT7 A;  3V1Q A;  3VQQ A;  3DRP A;  4CZI A;  3W0L A;  1J53 A;  4WFB L;  5D3G A;  4IO9 L;  3LZJ A;  1KAX A;  4DLE A;  1JLF A;  3NH1 A;  3ZSZ A;  4BRO A;  4JEP A;  1QTM A;  3CCM N;  3H1V X;  4ID1 A;  3O4W A;  4PKG A;  4L8R B;  3ZSX A;  4BRK A;  1LWF A;  5I9E B;  4X62 K;  5AR0 A;  4IKF A;  3MX2 A;  4O0I A;  4O8U A;  4FW2 A;  3FZL A;  2NNW A;  4CI6 A;  4C8L A;  1VSK A;  3MEC A;  3O8M A;  5GAG P;  3RTV A;  2X78 A;  3UIQ A;  3IUC A;  3HVR A;  1EQY A;  2RKI A;  1G15 A;  4HUF A;  4OO1 J;  3VGM A;  5FLX O;  2QWM A;  4E1N A;  1NG9 A;  1VSH A;  1T44 A;  4ISE A;  4C23 A;  4BRA A;  4O55 A;  3QIO A;  5BPL A;  4JI1 K;  3EKU A;  3AVN A;  3OY9 A;  1LOT B;  1EET A;  4I9Q A;  3A8Y A;  3W3D A;  2V52 B;  2HHW A;  2NRR A;  4RW8 A;  1J5E K;  3O1B A;  3G0Z A;  4M3Z A;  1ATN A;  2D0P A;  2WON A;  4HWI A;  4NCG A;  5JMV A;  3NH0 A;  2OA8 A;  1U04 A;  5AQS A;  1LAV A;  3E9P A;  1VSF A;  4BC5 A;  4IEE A;  3T19 A;  3LAN A;  3CCV N;  4DMN A;  1VQM N;  3R1X A;  3TAM A;  4BC2 A;  2A42 A;  2HBJ A;  3G71 N;  1WSI A;  3SAH A;  1S6Q A;  1Z25 A;  3DJC A;  1BU6 O;  4HTL A;  4Z4I A;  1XWL A;  4PKI A;  2GWJ A;  3SV4 A;  3ZX3 A;  5LL6 Z;  1YIJ N;  1XQS C;  1HLU A;  4EIA A;  2IVO A;  4AQY K;  1D9D A;  3NGY A;  4CJU A;  5JVH L;  3NMU A;  1RGI A;  1YJN N;  4B9S A;  4BQL A;  4CD1 A;  1NJW A;  5M1O A;  4EZ9 A;  3KLE A;  3NGI A;  4NCB A;  1EKE A;  1NGG A;  3GOI A;  1RCH A;  3VET A;  3OS1 A;  2KW4 A;  4CZM A;  4E7J A;  1NK0 A;  1Q8I A;  3LDL A;  4IFY A;  5M1K A;  1GLJ O;  5CZ1 A;  1S5J A;  4BE2 A;  5C10 A;  3UB5 A;  3SAG A;  1E3M A;  3AA3 A;  4B1V A;  4BG9 A;  4CZK A;  1TL3 A;  3TSP A;  4NYN A;  4DU4 A;  1BWF O;  2BAN A;  1HQU A;  3HPG A;  3D0P A;  4JKE A;  4YFU A;  3QB0 A;  1RT4 A;  4BR4 A;  3PLA A;  4BRH A;  4K25 A;  3V9W A;  3IKM A;  3AVB A;  4H0Y B;  3EYZ A;  2GX9 A;  1HJR A;  5AJ3 K;  1VSD A;  1REV A;  3RMA A;  1C6V A;  1FKP A;  1HNV A;  1Z05 A;  2NRZ A;  3SI6 A;  4KPY A;  3SBT A;  1BL3 A;  3EE8 A;  3HOT A;  5HBM A;  4DR1 K;  2P9U A;  4H5W A;  2QKB A;  5I42 A;  4OKE A;  4CJ4 A;  1NGJ A;  3MX5 A;  2F8S A;  4W5R A;  4FM2 A;  4CED A;  2Z1J A;  3ZX0 A;  2O8E A;  4KRE A;  4DQP A;  5ADX H;  1KRP A;  5GIO A;  4B08 A;  5CE3 A;  2XRI A;  3IG1 A;  1M1K O;  4WQ4 C;  4TSX A;  1IKY A;  1QHA A;  3MXI A;  1GLE G;  4BR5 A;  2D4W A;  2PY5 A;  3RVC A;  4L3Q A;  3K0S A;  2JLE A;  1NGA A;  1NOY A;  3TAQ A;  3H1Q A;  1X9W A;  3OJS A;  3QDK A;  1KC8 O;  2E2N A;  2NRH A;  2YHW A;  4IJA A;  1NWK A;  1VQN N;  1RBR A;  4QS7 A;  1IG9 A;  4JI8 K;  1S1V A;  4WFN L;  3Q7B A;  1T3V A;  4DTS A;  1T7P A;  4CJS A;  3MEE A;  3TAB A;  2O8F A;  3C6T A;  5TKY A;  3THX A;  4BDP A;  1RBV A;  3NHG A;  5EXW A;  3ULD A;  4FLW A;  1ZBU A;  2DFE A;  2IC3 A;  4BC4 A;  3HYF A;  3TTF A;  1NMD A;  4MLE A;  1RT6 A;  2X6N A;  4H0O A;  4BRD A;  5CZ2 A;  3J81 O;  3ZSW A;  4B1X B;  2OCE A;  3AVA A;  3RR7 A;  2Q36 A;  2HBL A;  2OYQ A;  5JVG L;  1S72 N;  3OBW A;  2G8K A;  4WYB A;  1HKC A;  1P8Z A;  4BR7 A;  5LMN K;  1GLL O;  1L3V A;  4RW4 A;  4Z94 A;  1NGF A;  3LL3 A;  3NF6 A;  3KJV A;  3HOS A;  2KZM A;  4FZZ A;  5SWM A;  2NRW A;  1UAX A;  2HVH A;  1GLA G;  4LF8 K;  2YHB A;  3U4L A;  5GIP A;  2IVN A;  5BN8 A;  3A0I X;  3CFO A;  4U7B A;  3QIC A;  2ATQ A;  4DTO A;  3THW A;  3VEZ A;  3ZSY A;  5BPN A;  1VK0 A;  2FSJ A;  4M41 A;  1NKE A;  1HR0 K;  2P9U B;  3VQ5 A;  5AZI B;  2ITM A;  3G25 A;  3NDK A;  3CC2 N;  1IKX A;  2E6M A;  2FC0 A;  3FR0 A;  2G8H A;  2O8E B;  2KFZ A;  3HK2 A;  3L6Q A;  5AQW A;  2EX3 A;  4JN4 A;  4J2A A;  2F7T A;  4R79 A;  4CER A;  3DOK A;  2HHX A;  2ETJ A;  3P1G A;  4RW9 A;  4DUZ K;  2GEL A;  2O8C A;  2P51 A;  3AO4 A;  5E41 A;  4N76 A;  2Z1H A;  5ELZ A;  1FXX A;  3U9Z A;  2BUP A;  4CJF A;  5E26 A;  4JAX A;  1RFQ A;  5HOO A;  5KRS A;  5JS1 A;  4DV7 K;  4BRM A;  3C6U A;  3NF8 A;  3T1A A;  2VWK A;  3K5N A;  4JI6 K;  3JYT A;  3KIO A;  1IO2 A;  4M63 C;  2O8F B;  3IRX A;  4DFK A;  5CHI A;  1HUX A;  3THX B;  1NGD A;  4H4O A;  3K5O A;  2AJQ A;  3QEI A;  5DMR A;  1YF5 L;  4CE9 A;  2GUI A;  3OVN A;  1LWE A;  4FPA A;  3DWL A;  4ELV A;  4NLC A;  3ZSR A;  4CES A;  2YI1 A;  3AO5 A;  3ZSO A;  5CY4 A;  4F8R A;  2ASM A;  5J2Q A;  3QEV A;  3KK1 A;  1RDD A;  4YOR A;  4LFA K;  1S9E A;  3LPT A;  4DFP A;  3CJB A;  3THY A;  4GKK K;  3LDS A;  4FJJ A;  3CI5 A;  3O6W A;  3CCQ N;  5IWA K;  1VQO N;  4BDY A;  1RDA A;  3IS9 A;  3SK3 A;  1LWC A;  4B1U B;  1VQ6 N;  1B9D A;  2A1R A;  5J2M A;  4RCH A;  5EVZ A;  4CZL A;  3CHW A;  3QEW A;  3M3Z A;  3T3F A;  1T6D A;  4OX9 K;  3CXC M;  4BRP A;  2CH6 A;  4A59 A;  1SKW A;  4WQ5 C;  3LDQ A;  1BI4 A;  3SBG A;  3OYH A;  1JXE A;  4GV9 A;  4C1N K;  3KZB A;  4FPB A;  4ISG A;  3K58 A;  4H0V B;  1L5U A;  4CF2 A;  3QNN A;  4CJL A;  2VWJ A;  1QSS A;  1HNW K;  2HBK A;  1I39 A;  5AQV A;  3HI0 A;  3OYM A;  4LF4 K;  1NK4 A;  2YHY A;  2I7N A;  1DEJ A;  2KZZ A;  4B3R K;  2IIR A;  1NMN A;  4B3S K;  3EO3 A;  4XH4 A;  1BG3 A;  3JSM A;  1L3U A;  2CGL A;  1YAG A;  4FWP A;  1KQS M;  3VA0 A;  2XY8 A;  4IXC A;  3F9K A;  2ZM6 K;  3CCR N;  2Y1J A;  4FYD A;  2O8B A;  2P5G A;  3RMD A;  3AAR A;  2OTJ N;  2HW3 A;  3P83 D;  4C8O A;  1Q7Y O;  3P38 A;  2FXU A;  3VQB A;  1NNE A;  2QM1 A;  1NGC A;  4FJX A;  1UA1 A;  5AQM A;  3AO2 A;  3OBY A;  1YJ9 N;  3VEO A;  3WXJ A;  2G8W A;  3CM6 A;  2O8C B;  2UUC K;  3H45 C;  2QXF A;  4HCC A;  4CW7 B;  4BRC A;  1JCG A;  5C42 A;  3PUF A;  5BR8 K;  1RIL A;  3EN9 A;  3VEN A;  4BR2 A;  4O5F A;  2QXL A;  4CD3 A;  3MWP A;  2A1S A;  1SKS A;  3KTQ A;  1BUP A;  2YKN A;  3VPZ A;  2XHB A;  1GOB A;  4BE0 A;  1RBU A;  1WAJ A;  3MED A;  1ITG A;  3SV3 A;  1Z26 A;  4WFA L;  5AQI A;  1EWR A;  2D0B A;  4YHH K;  4FL9 A;  1Q86 O;  2HHU A;  1CXQ A;  4KHU A;  3QEX A;  4H03 B;  4JKB A;  4F2S A;  1KLN A;  3U3Y A;  3CFP A;  4A57 A;  2UUA K;  1NKB A;  1JJ2 M;  1RT2 A;  2DPN A;  3A5M C;  2QI2 A;  4H0T B;  3K9K A;  1IJJ A;  4BWM A;  3CJ7 A;  4DFM A;  1JLA A;  3MDQ A;  3B6P A;  1XMQ K;  3QES A;  1WLJ A;  3BGR A;  2VGN A;  1IV0 A;  1XNQ K;  4CJW A;  3BZC A;  4CZE A;  1LV5 A;  1OVQ A;  1NOZ A;  1Y97 A;  4EFH A;  4PUO A;  1KCF A;  2W41 A;  2P9I A;  1M90 O;  1ZXO A;  2PZS A;  3AVJ A;  4E89 A;  4JI2 K;  5FRO A;  4DV6 K;  4OKJ A;  4AM7 A;  4FLU A;  3HJF A;  3NFA A;  4LD0 A;  1JLB A;  3V9U A;  4JI7 K;  4CJ5 A;  5LMU K;  4E19 A;  2G8V A;  2V7Z A;  4CJE A;  4CJQ A;  1RBT A;  1BI4 B;  1I3A A;  4CEZ A;  4XEI A;  4KAZ A;  4FXD A;  4OLA A;  4QOZ B;  4KBO A;  3ZX2 A;  4BVP A;  2QTD A;  2IVP A;  1NGH A;  2E1Z A;  3NBP A;  3DRR A;  3HPO A;  4A61 A;  3D2F A;  3I8D A;  1D9F A;  4K8X A;  2OPS A;  2Z1I A;  3LM2 A;  4JI0 K;  3AVF A;  5C24 A;  3WXL A;  4FJI A;  1FJG K;  2O8B B;  1S3X A;  3OYA A;  5EX5 A;  3BDP A;  3VEV A;  2E2O A;  1XC3 A;  2JWL A;  3BZK A;  2VQF K;  4KH5 A;  3QIP A;  4Z4C A;  1H1V A;  1N33 K;  4BY9 C;  3CF5 L;  4FZY A;  4C8M A;  4A5A A;  2E20 A;  5AFU H;  3K2P A;  5AQJ A;  4OGE A;  4AHC A;  4E7H A;  4W5N A;  1K6Y A;  2E5L K;  2RN2 A;  1KLM A;  3PIO L;  1C0M A;  3RRH A;  3SMS A;  4AHT A;  1CZB A;  3FZH A;  3J7A P;  3FFK B;  3FFI A;  4O0J A;  4NO7 A;  4FJN A;  3MN7 A;  2HHT A;  5GIN A;  3VEY A;  1HKG A;  1VQ5 N;  2A5X A;  3SUQ A;  4LFB K;  1O1W A;  4ISF A;  1HQE A;  3OYB A;  1N36 K;  4E1J A;  3VTH A;  4KRF A;  1VQK N;  4UY8 O;  1NJY A;  3O80 A;  1LW2 A;  3SNN A;  4DR5 K;  1RTI A;  2NRT A;  3G6E N;  4CIF A;  3E66 A;  1HJO A;  1U49 A;  4FK4 A;  3KK3 A;  2QWO A;  2D5R A;  4YDU A;  1KSP A;  3MCP A;  4F4K A;  3M6G A;  2NUB A;  2XY6 A;  2HNY A;  3D2E A;  2P9I B;  3WQT A;  4K41 A;  4CHO A;  4X66 K;  3J80 O;  3NCI A;  1RT3 A;  5J2N A;  1GLC G;  3WNF A;  3O9U A;  1W0H A;  4CHZ A;  5HRS A;  4EP5 A;  1WSE A;  3LAM A;  2CH5 A;  3KLG A;  3PX4 A;  2FBT A;  3TAG A;  2O8D A;  4YOV A;  3UKU A;  2AP1 A;  3CCJ N;  2YHA A;  1E4F T;  5FRM A;  4DV3 K;  4ZTJ A;  4CZG A;  3HSC A;  1WUA A;  1B92 A;  3HP6 A;  4E3S A;  3D45 A;  1J9A A;  4IBN A;  3LAK A;  1TVR A;  1CZA N;  1TKD A;  3AGK A;  3GE1 A;  4U67 L;  3V4I A;  3D2F B;  5DM7 L;  4DTJ A;  4B9M A;  3ID6 A;  4BG8 A;  1L3S A;  4OKK A;  4DF8 A;  1DKG D;  4I2Q A;  3WXM B;  5FDL A;  3OYC A;  3L3U A;  3VMF B;  1JLE A;  3LWM A;  3R3L A;  2D1K A;  3K9J A;  4I6M A;  3DLK A;  3TR8 A;  4DHY A;  4V19 S;  1KVC A;  4M45 A;  1F21 A;  3ENO A;  1I94 K;  3DMJ A;  3ZT0 A;  4DSK A;  1NU0 A;  1S9G A;  4DTN A;  1NKC A;  3OHR A;  3DM2 A;  3UKR A;  4H5T A;  1YTU A;  3CET A;  1NLV A;  5LY3 A;  3OS2 A;  4B9V A;  3HRG A;  4FWR A;  1N34 K;  3TPQ A;  4GW6 A;  4KI4 A;  4LF9 K;  3OW2 M;  2Q3S A;  2G8I A;  1SAZ A;  4DSI A;  4GNI A;  1YVU A;  4I2P A;  3C7N A;  2PAV A;  3BF1 A;  4FVU A;  3R8E A;  5EY4 A;  4KTQ A;  3ULE A;  1VSE A;  4FWN A;  3TAR A;  1VQP N;  1QZ6 A;  3VER A;  5A2Q O;  3E01 A;  4JS5 A;  1QQO A;  3S3N A;  2GV9 A;  3MK6 A;  1TYQ A;  4CGD A;  3NVM A;  4CK2 A;  4DR6 K;  3VQP A;  3AGR A;  1X9J A;  2LSN A;  2YNF A;  1VQ9 N;  4Z4F A;  3CG7 A;  4DB3 A;  5AQR A;  1HYV A;  3HM8 A;  4OGC A;  4DU3 A;  5AZI A;  4ID5 A;  4IOA L;  3HTV A;  2YCH A;  1VRT A;  1X1P A;  4DQR A;  2YV0 X;  1S1T A;  4H5V A;  3D2E B;  3NE6 A;  1C1A A;  3FLC O;  1W9H A;  4GY2 B;  4N47 A;  3G10 A;  3KWG A;  3O9Q A;  4F9O A;  3I33 A;  3O08 A;  1X3M A;  4JRQ A;  4CJV A;  4NCA A;  1T05 A;  1W2B M;  3LP0 A;  2O8D B;  1KAZ A;  3UKU B;  2F96 A;  4RW6 A;  5AQF A;  4BDZ A;  5AZJ A;  2W6K A;  5M1Q A;  3U9D A;  4YY3 K;  2VQE K;  3QFU A;  4O4G A;  3L0Q A;  1EX4 A;  3MMV A;  4ILJ A;  1ZBS A;  3EKS A;  2A6A A;  5BR9 A;  3EL2 A;  4MDA A;  3VQD A;  1U2V A;  3CME N;  4GKJ K;  3TSU A;  4JI3 K;  4JK8 A;  3QEP A;  1VQ7 N;  2HF4 A;  3I0S A;  3H6E A;  4JKC A;  2ZJR L;  5C12 A;  4LC9 B;  4E1M A;  1GOC A;  1K8K A;  1BDG A;  4I6M B;  4WF9 L;  4ZHR A;  4DV2 K;  3GBT A;  1VQ4 N;  2OPR A;  3OYK A;  1BOT O;  3C0B A;  3SQ0 A;  1JKH A;  1TAQ A;  5JIC A;  4OPJ A;  4BE1 A;  1ZBL A;  4FK2 A;  2HB5 A;  2FBV A;  5EU7 A;  4FOE A;  4KHP K;  4C8N A;  2ZJP L;  3UKR B;  3AA5 X;  2BTF A;  3VOV A;  3IDH A;  4DU1 A;  3V81 A;  4B9N A;  3O3F A;  4G9Z A;  2PFU A;  4YOU A;  3OYE A;  2G8U A;  4CF1 A;  1A5X A;  4YNQ A;  3IAY A;  1VAZ A;  1JCF A;  3SJJ A;  4JHD A;  1GOA A;  4A62 A;  4PY5 A;  3B8A X;  5C2F A;  3C7N B;  5KQD A;  1NJX A;  2YKM A;  1YUW A;  3ULE B;  1RDU A;  1WNS A;  4B3M K;  4N56 A;  2HHS A;  1TYQ B;  3M8S A;  1IKW A;  4NXM K;  1L3T A;  4DQS A;  2PBD A;  4JKH A;  3VN5 A;  2PYJ A;  1XI1 A;  2E6L A;  3C95 A;  5DK5 A;  2YX6 A;  3OYI A;  3HO1 A;  4H8K A;  4FLZ A;  2E8A A;  1HMV A;  3DRS A;  1C0U A;  1MWK A;  3A5L C;  1C1B A;  2NZT A;  3WNH A;  4RG8 A;  5KRT A;  1WBB A;  4LH4 A;  4CEQ A;  2ZD1 A;  2OPP A;  4E7L A;  3NVK A;  5GAD P;  2D0A A;  2HBM A;  4MO4 A;  3QET A;  4KHN A;  4DCH A;  1QQM A;  1SL0 A;  4JV5 K;  2O4G A;  3KK7 A;  1OH8 A;  3AVL A;  3THV A;  1FW6 A;  4B9U A;  4JKD A;  3VA3 A;  3P5J A;  3PO4 A;  2P9S A;  4OPH A;  5AZJ B;  4BRE A;  1D5A A;  3HST B;  1QS4 A;  2F9T A;  4JKG A;  3MXJ A;  3MN5 A;  1S6P A;  2XO7 A;  2Z1G A;  3VF6 A;  1Q9X A;  4CIE A;  1XNR K;  2I5J A;  5F2R A;  3RR8 A;  3OYN A;  1U2V B;  1BA0 A;  3AVH A;  3M5R A;  4BAC A;  3SZ2 A;  4FWS A;  1S1U A;  2IGI A;  4NB4 A;  3G4S N;  2A40 A;  1R59 O;  4MLH A;  4F3T A;  3EE9 A;  1DLO A;  4AHU A;  2V7Y A;  3ENB A;  3LWL A;  2OPQ A;  1K8K B;  4A2A A;  1RNH A;  1VRU A;  5KPT A;  5AQY A;  4M3R A;  3CQ8 A;  1U6Z A;  3F73 A;  4PL7 A;  1WOQ A;  4CGF A;  4E7K A;  2XY5 A;  4B8C A;  1V4T A;  1TUY A;  3J7Z O;  2QEX N;  3SQ1 A;  4KH4 A;  3ISN C;  3DYA A;  4CCH A;  3PX6 A;  4JHD B;  4Y0W A;  1SUQ A;  3V9X A;  3FZM A;  5KGW A;  3RRG A;  3PO5 A;  4DSF A;  5IT9 O;  3U8X A;  3LM9 A;  3VQC A;  1BCM A;  3LDO A;  3NH2 A;  2ASO A;  3CQY A;  3EZW A;  4CJ3 A;  4OJR A;  4IFE A;  3QO9 A;  2FLO A;  4LH5 A;  2YNG A;  3TWH A;  3E9L A;  1DTQ A;  3M8R A;  4FM0 A;  3TI0 A;  1SL1 A;  3L2V A;  3VF2 A;  3ATV A;  4FO0 A;  4WCE L;  3L4Q A;  1VHX A;  4FJ8 A;  4DQ8 A;  1YJW N;  2ZJQ L;  3QML A;  3OTO K;  2NLX A;  3CM5 A;  2E88 A;  5AQH A;  5F1X A;  3L8B A;  3O4N A;  4IZ9 A;  3N4Q A;  3SMP A;  4CZF A;  2WOM A;  4BVO A;  3I8B A;  3BY5 A;  3JS6 A;  4KKO A;  2D0C A;  2D0O A;  1BHL A;  2DY4 A;  1TK0 A;  3OS0 A;  5HLF A;  2F4V K;  4FJ9 A;  3KLI A;  2KLA A;  1BO5 O;  3AVG A;  3Q7C A;  1J5O A;  2KFN A;  4FLV A;  1OVY A;  3KWI A;  3DXK A;  5LJW A;  3SUP A;  1UA0 A;  5M1N A;  4O5B A;  3MXM A;  2QK9 A;  1QQN A;  3WNG A;  3TTC A;  3A5N C;  3ZSQ A;  2VWB A;  1JLG A;  4UQG A;  2P9S B;  3H3N O;  5FPM A;  2HF3 A;  1BQN A;  5AQN A;  4BGB A;  1HNZ K;  4JKG B;  2VG5 A;  3SAF A;  3QNO A;  4CGJ A;  2W40 A;  3HZ6 A;  1VQL N;  4CGI A;  4DSJ A;  4CF8 A;  1TV6 A;  4EHT A;  5KQ8 A;  3PSF A;  3CJ9 A;  4QAG A;  4HUG A;  4J2B A;  3CD6 N;  4AHS A;  2Q1N A;  3CER A;  1TAU A;  2VCP A;  1HYZ A;  2WBN A;  1K8A O;  2FBX A;  1N6Q A;  1QVF M;  3PX0 A;  3LDP A;  4CEA A;  4YOX A;  3ZT2 A;  4ZTF A;  4CF0 A;  1V4S A;  3LPU A;  4A2B A;  3K59 A;  4CK1 A;  2E4L A;  3T1H K;  2Q0U A;  4EHU A;  1S1W A;  3CPW M;  4DG1 A;  2QWQ A;  1NGE A;  1NBW A;  3SLC A;  2IOC A;  4CGG A;  1IKV A;  1HNI A;  4EZ6 A;  1X9S A;  2H3G X;  1CLQ A;  5KGX A;  3EEQ A;  3P31 A;  1U4B A;  4CJT A;  4CFC A;  1SQK A;  1D4X A;  4DV0 K;  2UXD K;  2FBY A;  4PWD A;  4PA1 A;  4WE1 A;  4CEB A;  1QE1 A;  3SYZ A;  4BRN A;  5SZT A;  2VGM A;  1JCE A;  4NYF A;  1Y64 A;  1NK6 A;  4N41 A;  3ASM A;  1ZBI A;  4H0X B;  4CHQ A;  5HRR A;  3R9P A;  4B9T A;  4LF5 K;  2ZGZ A;  3SPZ A;  5E84 A;  3NF9 A;  2Y1I A;  1IH7 A;  3HP9 A;  4KHW A;  3FE1 A;  1OH7 A;  4KB1 A;  4E0D A;  3LP2 A;  2A3Z A;  3VQ9 A;  1X9M A;  1S1X A;  2W42 A;  4M3T A;  3VQA A;  1JLQ A;  1X3N A;  4GV6 A;  3S41 A;  1QSY A;  3V9Z A;  4Q0B A;  1KFS A;  4B1W B;  4FJL A;  1BCO A;  3VGK A;  4WQ4 A;  1YTA A;  2FSK A;  1VSL A;  2VG6 A;  3C94 A;  3D6R A;  2ZGY A;  4IWV A;  3V1R A;  1SL2 A;  3H08 A;  5BRF A;  3KKS A;  3A5O C;  3DXM A;  2HHQ A;  4HVJ A;  1TK5 A;  4EP4 A;  5ADX A;  4KO0 A;  3B6O A;  4Y1C A;  4FWM A;  3DXK B;  4FVM A;  2BE2 A;  4M7Y A;  2HOE A;  3OYJ A;  4KB0 A;  1C0F A;  1SZ2 A;  4RWT A;  3AA2 A;  4M3W A;  1GLD G;  4FZX C;  1Q82 O;  4CBW A;  2YNI A;  3HPH A;  1NK8 A;  3CC4 N;  4AHR A;  2YHX A;  4DTM A;  4FSV A;  3DLH A;  2ASP A;  1WSH A;  5HL7 L;  1T6C A;  2GWK A;  4FJ7 A;  1EXQ A;  2HHH K;  4DTR A;  1FK9 A;  3J7Y P;  2WC9 A;  4JKF A;  2DFH A;  1U47 A;  1DGK N;  3WNE A;  1KD1 O;  3CCE N;  2UXC K;  3FZF A;  4HCB A;  3O9R A;  4IFV A;  1YT3 A;  4JNE A;  3ZYY X;  4B3O A;  3ID8 A;  4AHV A;  4XH5 A;  1JL1 A;  3HL8 A;  4G1Q A;  3DOL A;  5M1F A;  1C0T A;  1KVA A;  4JK9 A;  3TU5 A;  3HM9 A;  4FLX A;  1T03 A;  5JLF A;  4RW7 A;  2B4J A;  4FJM A;  1RTD A;  4J2D A;  4CEE A;  3RMC A;  5C25 A;  3KLH A;  1OH6 A;  1Q9Y A;  3H3O B;  4ICL A;  3U6F A;  1SKR A;  4DR4 K;  1XC9 A;  4YOT A;  3CCL N;  3O4Q A;  4XIU A;  2RF2 A;  4DR3 K;  1NGI A;  2IDO A;  1RBS A;  3EZ5 A;  1T8E A;  2UXB K;  3ZEU A;  3ZT4 A;  2HVI A;  5J1E A;  2P9N A;  4BR0 A;  1UOC A;  1W7A A;  5F0X A;  2HNZ A;  4JI4 K;  1MDU B;  4I9L A;  1B9F A;  5BRD A;  3VGL A;  4M42 A;  4ILH A;  1Q81 O;  4CFD A;  2WTU A;  5CYM A;  4IEI A;  2QKK A;  3O5B A;  1ATS A;  4CBX A;  4H0P A;  1XHX A;  4IDH A;  4GMJ B;  1ZBH A;  3OYF A;  5T7B A;  3SUO A;  1ZC6 A;  3EY1 A;  2O4I A;  3L4I A;  4ELU A;  3HXM A;  1QQC A;  1NGB A;  3DXM B;  4QS9 A;  4KHY A;  5TKW A;  3L2R A;  1NJI O;  4FJH A;  2J4R A;  4BR9 A;  3J8A A;  4B1Z A;  1TGO A;  4CBU A;  4CVN E;  4DKW A;  5AQG A;  3ITH A;  4H5N A;  4JKA A;  3CQX A;  1LW0 A;  1GLB G;  4C8K A;  4CJP A;  1J54 A;  1WAF A;  4J8F A;  4DQQ A;  3L2W A;  2FF6 A;  2E2P A;  3L2Q A;  2KHO A;  5MLC Q;  2QWR A;  3RMB A;  2AA4 A;  1A5V A;  4HUE A;  4F2R A;  4DR2 K;  3AO1 A;  3NF7 A;  1HKB A;  4DLG A;  1WSJ A;  2I7P A;  1ASW A;  1O13 A;  4FJK A;  3VF4 A;  2P9L A;  1ZYQ A;  2VYP A;  2ZE2 A;  2UU9 K;  1MA9 B;  4O44 A;  2P9P A;  1IBL K;  1YI2 N;  3CCU N;  3TAF A;  3DLR A;  4GV3 A;  1LCU A;  4NXN K;  5KI6 A;  3KHY A;  5H1S Q;  2PYL A;  3CC7 N;  5C15 A;  3HT3 A;  3VES A;  4WQ5 A;  3PV8 A;  4CIG A;  1GLF O;  4PHT X;  1QVG M;  4JD2 A;  1TUU A;  4BRF A;  4M3Y A;  5HRO A;  5KPR A;  3AAP A;  4ELT A;  1BIS A;  1RDB A;  3MN9 A;  3T1Y K;  1ILY A;  1TKT A;  1IBK K;  4GVE A;  3WEE A;  2QA4 N;  3ZEU B;  2Q97 A;  2P9N B;  3P4I A;  5CR4 A;  3LZI A;  4QCL A;  4KHS A;  4CJ7 A;  3ALY A;  4H5R A;  1LAW A;  3AVC A;  3CJ1 A;  5C0Y A;  1KTQ A;  3L2U A;  3WUH A;  4CEO A;  1BQM A;  1VSI A;  2QWL A;  4AH9 A;  4EAH D;  1WSF A;  3K5L A;  5FPE A;  5AQQ A;  1K73 O;  1KXP A;  1CXU A;  3RSE A;  1JL2 A;  3V1O A;  2DFF A;  1OH5 A;  3GL1 A;  3C6H A;  3BUZ B;  4Q5V A;  2BH1 A;  3UE5 A;  3GG4 A;  1DT9 A;  3AA4 A;  1N8R O;  2RHK A;  1NJZ A;  1VQ8 N;  4DR7 K;  5AQT A;  3DLL L;  3C6A A;  2FF3 B;  2JWK A;  2CGK A;  3IFR A;  4Z0U A;  4MO5 A;  4B9Q A;  3O3G A;  4DS5 A;  2B5J A;  3VTI A;  4OPK A;  2CGJ A;  3WQU A;  5HP1 A;  4JI5 K;  1EP4 A;  4DUY K;  4PKH A;  3M8P A;  4Y1D A;  4CJR A;  4W5T A;  3SUN A;  4IOX A;  3DLE A;  2A41 A;  3T69 A;  2JGU A;  4CGH A;  4FM1 A;  4FOI A;  3VQ8 A;  2F8T A;  1D8Y A;  2ZF5 O;  5FPN A;  4PQU A;  4BQZ A;  4JS4 A;  5FRN A;  4KHQ A;  1NK9 A;  3VQE A;  4CZH A;  3TAN A;  2Q2R A;  4F3O A;  3ZET A;  3AVK A;  3M8Q A;  4OVL A;  4YOY A;  4PL8 A;  3S3M A;  1Q18 A;  4IDK A;  2P9L B;  3N4P A;  3WXI A;  1YIT N;  1K9M O;  1E4G T;  2P9P B;  3CCS N;  1YHQ N;  1NM1 A;  4GVM A;  3OJU A;  1R0A A;  2G8F A;  4DFJ A;  3SCX A;  4BRG A;  2KKZ A;  1TL1 A;  4O8K A;  4YDU C;  2QWN A;  3NAE A;  2V51 B;  1ESV A;  3O9S A;  1VSJ A;  3CYM A;  4JD2 B;  3I56 N;  4DWI A;  3FZK A;  1IG8 A;  1TKX A;  5CYQ A;  4FK0 A;  3D7E O;  4DV4 K;  1MWM A;  4CFB A;  4KTZ A;  4Z4E A;  3WEE B;  3L3V A;  2EHG A;  4X64 K;  3QBW A;  4CHN A;  1QZ5 A;  1SV5 A;  1U45 A;  2HST A;  1EWQ A;  2OAN A;  1G99 A;  3QLH A;  2X74 A;  1CZ9 A;  3ZCM A;  4IG0 A;  3KVG A;  2QWP A;  5HRP A;  3MWT A;  4AIL C;  4M3X A;  3AO3 A;  5I3U A;  4B9L A;  3TSQ A;  3LAL A;  3BP8 A;  3RSE B;  3ZSV A;  4BC3 A;  1DTT A;  2GBZ A;  3OYD A;  2F9W A;  3HVT A;  1WN7 A;  4K8Z A;  3O3H A;  3GDQ A;  2B6A A;  3AAQ A;  4CEF A;  2KTQ A;  5FPD A;  5KTQ A;  1QHT A;  1C1C A;  4QS8 A;  4Z4G A;  2Q31 A;  4LSL A;  4FLT A;  3WXK A;  2WFB A;  4JLH A;  4LFC K;  5DM6 L;  1EO1 A;  1RDW X;  4FJG A;  1WSG A;  2ZQB A;  4J2E A;  4LF6 K;  3JXU A;  2ITG A;  5BPM A;  4B1Y B;  4DS4 A;  1P90 A;  3ATU A;  3PSI A;  4HHT A;  4LY7 A;  2BGG A;  3OYG A;  2YNH A;  3DLG A;  3LP3 A;  2GEM A;  4DTU A;  5AFU A;  2HMP A;  4AM6 A;  3ENH A;  4X65 K;  4IO8 A;  4IJN A;  3S3O A;  3C65 A;  4KH6 A;  2QW9 A;  5AQO A;  3OYL A;  3PY8 A;  4JRP A;  4H4M A;  3SJH A;  3NGZ A;  3K5M A;  3KKR A;  4IOC L;  2BDP A;  3ZET B;  3QIN A;  4A5B A;  4AF1 A;  4CZJ A;  1ASU A;  3A2F A;  3JAM O;  3AVM A;  1HPM A;  1KAY A;  5J2P A;  4E7I A;  3TTD A;  4C1N I;  3VQ4 A;  3MAQ A;  1HPZ A;  4DV1 K;  3F2K A;  1Z6R A;  2NRV A;  3DAW A;  4BGA A;  1UWB A;  2UYT A;  2ZWH A;  4JK7 A;  3CIP A;  5GAE P;  1S22 A;  4KI6 A;  4KFB A;  4DSL A;  1SS6 A;  4FLY A;  1QSL A;  2P1J A;  4KTW A;  4CEC A;  5EOY A;  3P39 A;  1C0G A;  4W5Q A;  2RPI A;  2FSN A;  3THW B;  2OZS A;  5M1P A;  1BIZ A;  3CFR A;  4CK3 A;  4MDB A;  4YOW A;  3KK2 A;  4CHP A;  3AVI A;  3TAP A;  1BA1 A;  3VEW A;  2P9K A;  4M7X A;  4OPA A;  4CHY A;  5JLH A;  5LJV A;  5GAH P;  4K43 A;  4MFB A;  1RTH A;  5AQZ A;  3ZLJ A;  1BIU A;  4LF7 K;  3V6D A;  2HHV A;  4K0K K;  1IBM K;  4CJK A;  2OZM A;  3RWU A;  5AQP A;  2IAJ A;  3HBT A;  1HNX K;  1U48 A;  2XY7 A;  2E1Y A;  3O9T A;  5JS2 A;  1ZBF A; 
#chains in the Genus database with same CATH homology
 1RDC A;  1JL1 A;  3HL8 A;  4G1Q A;  3DOL A;  2EX3 A;  3NE6 A;  1C1A A;  4J2A A;  4I7F A;  1C0T A;  1W9H A;  3G10 A;  4N47 A;  1KVA A;  3DOK A;  4CER A;  3HM9 A;  4FLX A;  1T03 A;  2ETJ A;  3P1G A;  5K14 A;  2HHX A;  4RW9 A;  4RW7 A;  4FW1 A;  2B4J A;  4FJM A;  4JRQ A;  4CJV A;  4R5P A;  2P51 A;  4NCA A;  3AO4 A;  1RTD A;  5E41 A;  1T05 A;  2IS3 A;  4J2D A;  4N76 A;  2Z1H A;  3SQ4 A;  4CEE A;  1FXX A;  3RMC A;  5C25 A;  3KLH A;  3LP0 A;  1Q9Y A;  4OLB A;  4ICL A;  4CJF A;  4IG3 A;  3U6F A;  4BWJ A;  2F96 A;  2HND A;  4RW6 A;  4Z4H A;  1SKR A;  4KV8 A;  4BDZ A;  5KRS A;  5JS1 A;  3C6U A;  1XC9 A;  3NF8 A;  4O4G A;  3ZT1 A;  3T1A A;  3SQ2 A;  3S9H A;  3O4Q A;  3V9S A;  2VWK A;  2RF2 A;  4XIU A;  2IDO A;  1EX4 A;  3I0R A;  1BGX T;  3K5N A;  1RBS A;  1NK5 A;  3JYT A;  3KIO A;  1IO2 A;  3LP1 A;  3DI6 A;  3IRX A;  3EZ5 A;  1RTJ A;  4DFK A;  1T8E A;  3ZT4 A;  4M3U A;  2HVI A;  5J1E A;  1XHZ A;  2P5O A;  4H4O A;  1UOC A;  1ASV A;  3VQD A;  4CFA A;  2HNZ A;  1NK7 A;  1FKO A;  3K5O A;  2AJQ A;  5HRN A;  3QEI A;  4B8A B;  4I9L A;  5DMR A;  1B9F A;  4CE9 A;  2GUI A;  3QEP A;  1RT5 A;  3OVN A;  3KLF A;  4M42 A;  1LWE A;  3I0S A;  4ELV A;  4CFD A;  3ZSR A;  4CES A;  3AO5 A;  3ZSO A;  5CY4 A;  5CYM A;  2QKK A;  4F8R A;  1KVB A;  4E1M A;  1XHX A;  1JXB A;  5J2Q A;  1GOC A;  1VSM A;  3QEV A;  3K57 A;  3KK1 A;  4GMJ B;  1RDD A;  4ZHR A;  1JLC A;  3OYF A;  1ZBH A;  5T7B A;  2OPR A;  3OYK A;  3KD1 E;  3SUO A;  3SQ0 A;  1S9E A;  1JKH A;  1TAQ A;  3EY1 A;  4OPJ A;  4BE1 A;  4FCY A;  4ELU A;  4FJ5 A;  1ZBL A;  4FK2 A;  2HB5 A;  3LPT A;  1A5W A;  1QQC A;  2FBV A;  3HXM A;  2VG7 A;  5EU7 A;  4DFP A;  3VQ7 A;  3KD5 E;  3LDS A;  4FJJ A;  4C8N A;  3AA5 X;  1RT1 A;  4BDY A;  1RDA A;  3IS9 A;  2X6S A;  2KQ2 A;  4DU1 A;  4KHY A;  2R7Y A;  3L2R A;  3V81 A;  1LWC A;  4DTX A;  4B9N A;  3O3F A;  2G8U A;  3OYE A;  4FJH A;  1B9D A;  3VQ6 A;  2A1R A;  4CF1 A;  1A5X A;  4YNQ A;  5J2M A;  3IAY A;  4CF9 A;  3SJJ A;  3ZT3 A;  4N5S A;  1GOA A;  1TGO A;  3QEW A;  4DF4 A;  3U3G A;  4PY5 A;  3T3F A;  3ITH A;  3QER A;  1LW0 A;  4HTU A;  1NJX A;  4C8K A;  4CJP A;  3TAE A;  1SKW A;  4LSN A;  1J54 A;  1WAF A;  2YKM A;  4DQQ A;  3L2W A;  1BI4 A;  3SPY A;  3OYH A;  1JXE A;  1WNS A;  1MU2 A;  3K58 A;  1L5U A;  4CF2 A;  3QNN A;  4CJL A;  2VWJ A;  1QSS A;  4DSE A;  1I39 A;  4N56 A;  4MQ3 A;  3L2Q A;  3OYM A;  1NK4 A;  2HMI A;  2KZZ A;  3RMB A;  2HHS A;  2DTU A;  1A5V A;  3M8S A;  1IKW A;  1ZBF A;  3JSM A;  1TK8 A;  4DQS A;  1L3T A;  1L3U A;  4HUE A;  4F2R A;  3AO1 A;  3VA0 A;  2XY8 A;  1N5Y A;  3NF7 A;  3MEG A;  3VN5 A;  1XI1 A;  2PYJ A;  2E6L A;  3C95 A;  4DQI A;  3F9K A;  5DK5 A;  2Y1J A;  1KFD A;  4FYD A;  2P5G A;  3OYI A;  3RMD A;  3HO1 A;  4H8K A;  4DLG A;  4FLZ A;  1WSJ A;  2HW3 A;  1ASW A;  1HMV A;  1C0U A;  3AV9 A;  3DRS A;  3P83 D;  4C8O A;  4FJK A;  1C1B A;  4W5O A;  3WNH A;  1ZYQ A;  4RG8 A;  5KRT A;  1HRH A;  4DTP A;  3DLB A;  3VQB A;  2ZE2 A;  1HYS A;  4LH4 A;  4CEQ A;  2ZD1 A;  1UA1 A;  2OPP A;  4E7L A;  4FJX A;  1TKZ A;  1RT7 A;  3V1Q A;  4O44 A;  3VQQ A;  3DRP A;  2D0A A;  1J53 A;  5D3G A;  3QET A;  4KHN A;  3AO2 A;  3LZJ A;  3TAF A;  4DLE A;  2G8W A;  1JLF A;  3CM6 A;  3DLR A;  3NH1 A;  3ZSZ A;  1SL0 A;  2O4G A;  5KI6 A;  1QTM A;  2PYL A;  2QXF A;  4HCC A;  3HT3 A;  3AVL A;  5C42 A;  3PUF A;  4ID1 A;  1RIL A;  3PV8 A;  4CIG A;  3THV A;  4B9U A;  3VA3 A;  3P5J A;  4L8R B;  3PO4 A;  3KTQ A;  2A1S A;  3ZSX A;  1SKS A;  1D5A A;  3HST B;  1QS4 A;  4M3Y A;  2YKN A;  5HRO A;  2XHB A;  1LWF A;  1GOB A;  4BE0 A;  4ELT A;  1RBU A;  1WAJ A;  3MED A;  1ITG A;  4IKF A;  1BIS A;  3MXJ A;  1RDB A;  4O0I A;  3SV3 A;  1Z26 A;  4FW2 A;  1S6P A;  1TKT A;  2XO7 A;  2D0B A;  2Z1G A;  4C8L A;  1VSK A;  1UA0 A;  3MEC A;  1Q9X A;  4CIE A;  3RTV A;  2X78 A;  3LZI A;  2HHU A;  2I5J A;  3RR8 A;  4QCL A;  4KHS A;  3OYN A;  3UIQ A;  1CXQ A;  4KHU A;  3ALY A;  3QEX A;  3AVH A;  3HVR A;  1LAW A;  3AVC A;  4BAC A;  3SZ2 A;  2RKI A;  1KTQ A;  4F2S A;  1KLN A;  1S1U A;  2IGI A;  3L2U A;  1G15 A;  4CEO A;  4HUF A;  1BQM A;  1VSI A;  3CFP A;  3U3Y A;  1NKB A;  4AH9 A;  1RT2 A;  4E1N A;  4F3T A;  1VSH A;  4BWM A;  1WSF A;  3K5L A;  1DLO A;  1JLA A;  4AHU A;  4DFM A;  3B6P A;  4O55 A;  3LWL A;  1CXU A;  2OPQ A;  3QIO A;  3QES A;  1WLJ A;  3BGR A;  1RNH A;  1JL2 A;  3V1O A;  2DFF A;  1VRU A;  4M3R A;  3CQ8 A;  4Q5V A;  3AVN A;  4CJW A;  3OY9 A;  1EET A;  3F73 A;  4I9Q A;  1LV5 A;  4CGF A;  4PUO A;  1NOZ A;  1Y97 A;  3AA4 A;  4B8C A;  4RW8 A;  4E7K A;  2XY5 A;  1KCF A;  2HHW A;  2PZS A;  3G0Z A;  4M3Z A;  1NJZ A;  4NCG A;  2WON A;  3AVJ A;  4E89 A;  3NH0 A;  3SQ1 A;  1U04 A;  2OA8 A;  4W5N A;  5FRO A;  1LAV A;  3ISN C;  4OKJ A;  1VSF A;  3DYA A;  4CCH A;  4FLU A;  3HJF A;  3NFA A;  3T19 A;  4LD0 A;  3PX6 A;  3LAN A;  1SUQ A;  3V9X A;  4Z0U A;  5KGW A;  1JLB A;  3O3G A;  3V9U A;  3PO5 A;  3RRG A;  4DSF A;  4DMN A;  4DS5 A;  2B5J A;  3TAM A;  3VQC A;  1BCM A;  4CJ5 A;  3NH2 A;  4OPK A;  5HP1 A;  4E19 A;  2G8V A;  1EP4 A;  1WSI A;  1S6Q A;  1Z25 A;  3M8P A;  4Y1D A;  4CJ3 A;  4CJE A;  4CJQ A;  1RBT A;  4OJR A;  4Z4I A;  1BI4 B;  1I3A A;  3QO9 A;  4CEZ A;  1XWL A;  4LH5 A;  2YNG A;  3TWH A;  4CJR A;  4W5T A;  4KAZ A;  1DTQ A;  4FXD A;  4OLA A;  3M8R A;  4FM0 A;  3SUN A;  3SV4 A;  3DLE A;  4QOZ B;  3TI0 A;  1SL1 A;  3NBP A;  3L2V A;  2JGU A;  4CGH A;  4FM1 A;  3DRR A;  3HPO A;  3VQ8 A;  2F8T A;  3I8D A;  1D8Y A;  1D9F A;  2OPS A;  1D9D A;  4K8X A;  3NGY A;  4CJU A;  4PQU A;  4JS4 A;  2Z1I A;  5FRN A;  4KHQ A;  4FJ8 A;  3AVF A;  1NK9 A;  3VQE A;  5C24 A;  3TAN A;  4B9S A;  4F3O A;  4FJI A;  3AVK A;  3M8Q A;  4OVL A;  1NJW A;  4EZ9 A;  3KLE A;  4DQR A;  3S3M A;  3NGI A;  3CM5 A;  1EKE A;  4NCB A;  1S1T A;  3OYA A;  1RCH A;  3OS1 A;  2KW4 A;  4IDK A;  3L8B A;  3BDP A;  3O4N A;  4E7J A;  1NK0 A;  2WOM A;  1Q8I A;  4IFY A;  5CZ1 A;  1S5J A;  2D0C A;  4KKO A;  4BE2 A;  3QIP A;  4Z4C A;  1BHL A;  2DY4 A;  1TK0 A;  4GVM A;  3OS0 A;  3OJU A;  5HLF A;  1R0A A;  2G8F A;  4DFJ A;  4FJ9 A;  3SCX A;  3KLI A;  3AA3 A;  4FZY A;  2KFN A;  3AVG A;  1J5O A;  1TL3 A;  1TL1 A;  4C8M A;  4FLV A;  4NYN A;  4DU4 A;  4E7H A;  2BAN A;  1HQU A;  3K2P A;  4OGE A;  4AHC A;  3NAE A;  1K6Y A;  3HPG A;  4O5B A;  3D0P A;  2RN2 A;  3SUP A;  1KLM A;  3MXM A;  3WNG A;  2QK9 A;  3ZSQ A;  4YFU A;  1VSJ A;  3CYM A;  1JLG A;  1RT4 A;  4UQG A;  4DWI A;  1C0M A;  3RRH A;  1BQN A;  3V9W A;  3AVB A;  4AHT A;  3EYZ A;  1CZB A;  1TKX A;  1HJR A;  2VG5 A;  5CYQ A;  3QNO A;  4FK0 A;  4CGJ A;  3FFI A;  1VSD A;  4O0J A;  4DSJ A;  4CGI A;  4FJN A;  4CFB A;  4KTZ A;  4Z4E A;  1REV A;  4CF8 A;  2HHT A;  3L3V A;  2EHG A;  1C6V A;  1FKP A;  1HNV A;  1TV6 A;  3RMA A;  4CHN A;  3SI6 A;  4KPY A;  4QAG A;  1SV5 A;  4HUG A;  4J2B A;  1BL3 A;  1U45 A;  5HBM A;  4AHS A;  3SUQ A;  1TAU A;  2QKB A;  1O1W A;  5I42 A;  4OKE A;  3QLH A;  1HQE A;  3OYB A;  1HYZ A;  4CJ4 A;  2X74 A;  4KRF A;  1NJY A;  1CZ9 A;  3ZCM A;  2FBX A;  1N6Q A;  4IG0 A;  1LW2 A;  3PX0 A;  3SNN A;  5HRP A;  2F8S A;  4AIL C;  1RTI A;  4W5R A;  4M3X A;  3AO3 A;  4CED A;  4FM2 A;  5I3U A;  4CIF A;  4CEA A;  3ZT2 A;  4ZTF A;  4CF0 A;  4B9L A;  3LAL A;  3LPU A;  2Z1J A;  3ZSV A;  1U49 A;  4FK4 A;  1DTT A;  2GBZ A;  3OYD A;  4KRE A;  3HVT A;  1WN7 A;  3KK3 A;  3O3H A;  4CK1 A;  3K59 A;  4DQP A;  4K8Z A;  1KRP A;  2B6A A;  4CEF A;  2D5R A;  2E4L A;  2KTQ A;  4B08 A;  1S1W A;  5KTQ A;  1KSP A;  4F4K A;  1QHT A;  1C1C A;  2XRI A;  3IG1 A;  4DG1 A;  4Z4G A;  2NUB A;  2XY6 A;  2HNY A;  4LSL A;  4FLT A;  4CHO A;  2IOC A;  4CGG A;  1IKV A;  1HNI A;  4TSX A;  3NCI A;  1IKY A;  1RT3 A;  4JLH A;  3WNF A;  5J2N A;  1X9S A;  4EZ6 A;  1CLQ A;  5JS2 A;  3MXI A;  5KGX A;  1W0H A;  4FJG A;  1WSG A;  2ZQB A;  4J2E A;  4CHZ A;  5HRS A;  2PY5 A;  4EP5 A;  2ITG A;  4CJT A;  1U4B A;  4CFC A;  1WSE A;  4DS4 A;  3LAM A;  2JLE A;  3KLG A;  3PX4 A;  2FBT A;  2FBY A;  4HHT A;  4LY7 A;  3TAG A;  2BGG A;  3OYG A;  2YNH A;  1NOY A;  4PWD A;  3TAQ A;  4PA1 A;  3DLG A;  3LP3 A;  1QE1 A;  4WE1 A;  4CEB A;  5SZT A;  3OJS A;  3SYZ A;  4DTU A;  1X9W A;  4NYF A;  1NK6 A;  4N41 A;  2YHA A;  5FRM A;  1RBR A;  1IG9 A;  4ZTJ A;  3ASM A;  4E3S A;  3HP6 A;  1S1V A;  1B92 A;  1ZBI A;  4CHQ A;  3D45 A;  5HRR A;  1J9A A;  4B9T A;  4IBN A;  4DTS A;  3LAK A;  1T7P A;  4CJS A;  3SPZ A;  1TVR A;  3MEE A;  3NF9 A;  2Y1I A;  3TAB A;  1IH7 A;  3S3O A;  3HP9 A;  1TKD A;  4KHW A;  3C6T A;  4KB1 A;  3OYL A;  4E0D A;  3LP2 A;  3PY8 A;  4BDP A;  1RBV A;  4JRP A;  3V4I A;  4H4M A;  4DTJ A;  3VQ9 A;  3NHG A;  1X9M A;  4B9M A;  1S1X A;  2W42 A;  4M3T A;  1L3S A;  3VQA A;  3ULD A;  1JLQ A;  4FLW A;  3NGZ A;  4OKK A;  3KKR A;  3K5M A;  4DF8 A;  2BDP A;  1ZBU A;  2DFE A;  3QIN A;  4I2Q A;  1ASU A;  2IC3 A;  1QSY A;  3V9Z A;  5FDL A;  4Q0B A;  3OYC A;  1KFS A;  3A2F A;  3HYF A;  3L3U A;  1JLE A;  3AVM A;  3LWM A;  5J2P A;  4FJL A;  4E7I A;  1BCO A;  1RT6 A;  3VQ4 A;  1YTA A;  1VSL A;  2X6N A;  3MAQ A;  2VG6 A;  3C94 A;  3DLK A;  1HPZ A;  3TR8 A;  3V1R A;  1SL2 A;  3H08 A;  1KVC A;  5CZ2 A;  3ZSW A;  4M45 A;  1F21 A;  3KKS A;  1UWB A;  3AVA A;  3DMJ A;  3RR7 A;  2HHQ A;  3ZT0 A;  4HVJ A;  4DSK A;  1TK5 A;  1S9G A;  4EP4 A;  4DTN A;  1NKC A;  4KO0 A;  3DM2 A;  4KFB A;  4KI6 A;  3B6O A;  4DSL A;  4Y1C A;  2OYQ A;  1YTU A;  4FLY A;  1QSL A;  2P1J A;  4KTW A;  2G8K A;  3OS2 A;  4B9V A;  1L3V A;  4CEC A;  4FVM A;  2BE2 A;  4RW4 A;  4W5Q A;  2RPI A;  4GW6 A;  3OYJ A;  3NF6 A;  4KB0 A;  4KI4 A;  3KJV A;  2OZS A;  2KZM A;  2Q3S A;  4FZZ A;  2G8I A;  1BIZ A;  5SWM A;  1UAX A;  3AA2 A;  3CFR A;  4DSI A;  4M3W A;  2HVH A;  4CK3 A;  2YHB A;  1YVU A;  4I2P A;  3KK2 A;  4FZX C;  4CHP A;  3AVI A;  3TAP A;  4CHY A;  2YNI A;  4KTQ A;  3HPH A;  3CFO A;  4MFB A;  2ATQ A;  4DTO A;  1NK8 A;  1VSE A;  4AHR A;  3TAR A;  3ZSY A;  1RTH A;  1VK0 A;  4M41 A;  4DTM A;  1NKE A;  3E01 A;  4JS5 A;  3DLH A;  2O4I A;  1BIU A;  3VQ5 A;  3S3N A;  3V6D A;  2HHV A;  2GV9 A;  1WSH A;  4CGD A;  4CJK A;  1EXQ A;  4CK2 A;  3NDK A;  2OZM A;  3RWU A;  4FJ7 A;  4DTR A;  1FK9 A;  3VQP A;  2LSN A;  2YNF A;  2IAJ A;  1IKX A;  2DFH A;  4Z4F A;  2E6M A;  3CG7 A;  2FC0 A;  1U47 A;  3WNE A;  2G8H A;  1HYV A;  4OGC A;  4DU3 A;  1U48 A;  4ID5 A;  2XY7 A;  2KFZ A;  4HCB A;  3HK2 A;  4IFV A;  1YT3 A;  1VRT A;  4B3O A;  1X1P A;  4AHV A;  2YV0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...