3K2PA

Hiv-1 reverse transcriptase isolated rnaseh domain with the inhibitor beta-thujaplicinol bound at the active site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse Transcriptase
publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3k2pA00
1XHXA 4FJIA 3L2RA 3HPGA 4OLBA 3NFAA 4OGCA 1VK0A 4FJ5A 4F3TA 4AHCA 3TWHA 4W5TA 3SNNA 3S3NA 4CJ5A 3RRHA 3DOLA 3L3UA 4CJWA 1KTQA 4RW6A 1Z25A 5CZ1A 5DK5A 1C6VA 1NK6A 1MU2A 4ZTFA 4HCBA 1ZBFA 4FJ7A 4Z0UA 4KB1A 3ZSZA 1TKXA 4CEFA 1XI1A 1TK0A 1C0UA 4E3SA 3AA3A 2P1JA 1S6QA 1TAQA 1RDBA 4C8LA 1RT3A 3VA3A 1DLOA 4DU4A 4BDPA 1JKHA 4KHUA 2BDPA 1G15A 2OA8A 4CE9A 4CEOA 1HRHA 1WSGA 3CM6A 3SZ2A 1LAVA 3AVLA 1C0MA 3AV9A 4CHQA 3SPYA 3SJJA 1QS4A 4B9MA 4CGIA 3TAMA 4ELTA 3HK2A 4CGJA 4PY5A 1SV5A 4BE1A 4UQGA 3DLBA 2OPPA 3PX0A 3QINA 1A5WA 4FJGA 4JLHA 1O1WA 3HVRA 4KO0A 4DS5A 3MXMA 4AHVA 1WNSA 4CGDA 4CFBA 5KGXA 2XO7A 1RBUA 1W9HA 1EXQA 5J2NA 3ZSVA 1RT7A 1TL1A 4W5NA 1B9DA 3KK3A 1NK9A 1VRUA 3H08A 4LSNA 3L2QA 2HHWA 1JLAA 1N5YA 4KI6A 3K5MA 5CYMA 1KLMA 1XWLA 1TL3A 4Z4FA 1UOCA 4KI4A 5D3GA 2HW3A 1ASWA 4RW8A 4N56A 4L8RB 2KFZA 4FLZA 2QKKA 4M3UA 3DYAA 1HYSA 5HBMA 3OJUA 2IC3A 2IS3A 4KB0A 4DU1A 1IKWA 2Q3SA 4DSKA 4DQIA 4M3WA 4E1MA 3TAEA 4IFVA 3QEVA 1ITGA 3LPTA 4DTXA 1T8EA 4EZ6A 3ZSWA 4LY7A 1C1AA 4DSJA 1LWEA 4FZZA 3SQ0A 1QE1A 3AA5X 1WAFA 1TK8A 3NE6A 5KRTA 1Z26A 4HVJA 4ELVA 2RKIA 1B9FA 4KFBA 3SUQA 5I42A 1HQEA 4RW4A 3HXMA 2ETJA 4YFUA 3TAQA 2HMIA 4JS5A 3I0RA 1S9EA 1T03A 3DI6A 4E0DA 4KHQA 4DFKA 3VQPA 2X78A 1SL1A 4CK2A 1FK9A 4B8CA 3OYGA 4M3TA 1JLQA 1ZYQA 1RNHA 3VQ9A 4HUGA 3HP9A 3AO5A 4JS4A 2KW4A 4CEQA 3JYTA 3OYDA 1JLEA 4LSLA 3OYLA 4BWJA 3DLGA 4CF2A 3O4NA 4CEEA 3CYMA 3JSMA 4O0IA 2JLEA 5DMRA 4KPYA 3AVKA 3DLKA 4QAGA 4CGHA 3V1OA 2X6NA 1DTQA 1Y97A 1YT3A 2Z1JA 1UWBA 3LPUA 3NF9A 3OYHA 1KFSA 1TKTA 3L3VA 3K58A 4KREA 3QEPA 3U3GA 4XIUA 4DTNA 4OGEA 2DFFA 1HYVA 1KSPA 4F3OA 4DFMA 1VSJA 1JLGA 3AA4A 3LANA 4Y1CA 1D9DA 3RMBA 4B9LA 1QHTA 4DSIA 4CIEA 2G8UA 4OLAA 3NCIA 2O4IA 4CJFA 1BI4B 2VWJA 5JS1A 2D0BA 2XY6A 4CECA 1SL0A 2F8SA 3E01A 4JRPA 3AVFA 4H4OA 3VQ8A 3L2VA 2YKMA 3VQ7A 3WNEA 5KTQA 2F96A 5HLFA 4J2AA 5C42A 3HO1A 3DM2A 1EKEA 3OVNA 4I2QA 3EY1A 1REVA 4AH9A 1X9MA 1A5VA 2O4GA 1KVBA 2B6AA 3AA2A 4FLVA 3V9ZA 3ALYA 1Q9XA 3HSTB 4CJ4A 3QNNA 1NK7A 5FRNA 1DTTA 2EX3A 1RT2A 3ZCMA 5JS2A 4KHYA 2I5JA 3V1RA 4N47A 4B8AB 3V4IA 1C0TA 3ZSQA 2G8WA 4B9UA 4FW2A 1S1VA 1HJRA 1KVCA 3M8PA 3P83D 1Q8IA 4CIGA 3ZSYA 3CM5A 3AVNA 3OYJA 3LDSA 3TABA 2YNGA 3B6OA 1D8YA 4LH4A 4OPJA 5J2PA 3SQ2A 2FBVA 3EZ5A 1IKXA 3T1AA 4IBNA 1X9WA 2Z1IA 4DU3A 2HB5A 4B08A 4IKFA 2PYLA 3QETA 4DF4A 2ITGA 1QSLA 3OY9A 3DLHA 1HNIA 1RCHA 2NUBA 4B9TA 4B3OA 1NK4A 4PQUA 1NK0A 1RDDA 4E19A 4KHSA 1K6YA 3PO4A 3HPHA 1I39A 4CJ3A 3SUNA 2HHVA 3K5OA 1J53A 1HPZA 3ZT1A 1U48A 1L3VA 3RR8A 4TSXA 4CHZA 3WNGA 3CFRA 4O55A 1L3TA 1NOYA 4FZYA 1Q9YA 1ZBHA 4DQPA 1YVUA 3LAMA 3SCXA 3QO9A 2ZQBA 3M8RA 2DTUA 3NHGA 3KD1E 1QSYA 2ZE2A 1WLJA 3O3FA 3OYNA 3MEDA 1IKVA 3O3HA 3M8QA 2E6LA 4CF1A 3V9XA 3MXIA 4FJMA 3OYKA 3RMCA 3VQ4A 4DWIA 4J2DA 3LZJA 1RTDA 4HUFA 1TK5A 1LW0A 3BDPA 2DY4A 2WOMA 1TKDA 3K5NA 1SKRA 3AVAA 1BIUA 4CJEA 4CJVA 4ELUA 2VG6A 4FM1A 4N41A 4GVMA 2G8IA 4OPKA 3TI0A 2X6SA 4C8OA 3WNHA 1BISA 4FLXA 4DSEA 1VSDA 4DFPA 2F8TA 1JXEA 1VSEA 3ZT2A 2D0CA 4FM2A 4DSLA 4BE2A 3RR7A 3LP3A 5HRRA 1S1XA 5EU7A 4FLTA 2KFNA 3RMAA 4OKKA 1UA1A 2AJQA 3VQCA 4CCHA 1X1PA 5K14A 3KLGA 1WSIA 4OKEA 4CJRA 3ZSOA 3S3OA 5J1EA 2OZSA 1EX4A 3RWUA 3DRPA 4E89A 2BGGA 4E7IA 1S6PA 4YNQA 4BDZA 3MXJA 4DMNA 4Q5VA 1RBTA 2IGIA 4I9QA 1RBSA 1WN7A 3DLRA 3VN5A 3ZT3A 3AO3A 3KK1A 1KLNA 1ASVA 3K57A 4QCLA 1BI4A 1HQUA 5KI6A 2FBXA 3QEXA 3QLHA 3T19A 3OYCA 4F8RA 4BE0A 1BQMA 3PO5A 3ZSRA 3QIOA 3NH2A 3TAPA 1IKYA 4KV8A 3NF8A 3OYAA 4BWMA 3NGYA 5CZ2A 2RF2A 3V9SA 1L3UA 3VQQA 2B5JA 2YHBA 3K59A 1RTIA 4O44A 2KQ2A 4O4GA 3LZIA 4I9LA 3TAFA 1RDCA 4I2PA 4AHTA 4CJKA 3O3GA 4CERA 3RRGA 3TANA 4E7JA 4DQRA 2QKBA 3KLHA 4F2RA 3V9UA 3ULDA 1D5AA 1JLFA 2XHBA 3S9HA 2HHSA 4LH5A 3ISNC 3LWMA 2YV0X 3F73A 4FJXA 1BL3A 2QK9A 4FK2A 3C94A 1J5OA 3QNOA 4JRQA 2OYQA 4Z4EA 2BANA 4ICLA 3KIOA 4NCAA 4PWDA 3D0PA 3PV8A 1EP4A 3TARA 1RDAA 1RT6A 3SQ4A 3U6FA 3AVCA 1CZ9A 4DTMA 2IOCA 2A1RA 1IH7A 4W5QA 5KRSA 1IG9A 3SQ1A 3LWLA 1BCOA 2RN2A 3OYFA 4CGFA 3G0ZA 2VWKA 4FJLA 2PZSA 3PY8A 1WSJA 3BGRA 3LP0A 4GMJB 1QQCA 4B9NA 1QTMA 5CYQA 3IAYA 4B9SA 3L2UA 3G10A 2ATQA 4KKOA 3OS1A 4CF9A 4DLEA 2G8FA 4J2BA 3VQ5A 4FLYA 4CJTA 1J9AA 3VA0A 1XHZA 2EHGA 4H4MA 2YNIA 1YTUA 4F4KA 1JL1A 1S5JA 4MQ3A 1KVAA 4NYFA 3VQEA 3KKSA 2D0AA 2WONA 4DF8A 1BHLA 3KJVA 3KKRA 3DMJA 2BE2A 1GOBA 4W5OA 4G1QA 4CJLA 1SKSA 1R0AA 3RTVA 4N76A 2XRIA 2Y1JA 1NJWA 1KFDA 4N5SA 3OYBA 2A1SA 1X9SA 3P5JA 4B9VA 4FJ8A 4EP5A 3K5LA 1TV6A 4CFCA 4O0JA 1BQNA 1RILA 4AHRA 3IG1A 3WNFA 3KLFA 4GW6A 5KGWA 2VG5A 5HRPA 4M3XA 1TVRA 4M3RA 4KAZA 4E7KA 1HNVA 3MEEA 1RT1A 3HP6A 2G8VA 3I0SA 4DQSA 3CQ8A 1LW2A 1B92A 2GBZA 1S1WA 4DTOA 5E41A 1D9FA 4EZ9A 4M3YA 1JLCA 2HVHA 3RMDA 3DRSA 4CF0A 4Z4HA 3ASMA 4DTSA 1JXBA 3V81A 3AVIA 2YKNA 1ZBLA 1VSFA 3NDKA 3DLEA 3SV4A 2E6MA 2QXFA 1T05A 3K2PA 1L5UA 3NGIA 4DTUA 3C6TA 4CF8A 3OJSA 2VG7A 3LP1A 4OVLA 3D45A 1RT5A 2B4JA 1ZBUA 4AHUA 4E7HA 5FROA 4QOZB 4Z4CA 1NOZA 3S3MA 2IAJA 1UAXA 1IO2A 3V1QA 2P51A 3VQBA 5I3UA 3NBPA 4DTJA 2X74A 2Z1GA 3ZT4A 1VRTA 1NJYA 4NCBA 4HCCA 4CFDA 1A5XA 4ID5A 1I3AA 3TR8A 4E1NA 3OYIA 4DS4A 5J2QA 2YHAA 5CY4A 3A2FA 4CK3A 3OS0A 5C25A 4M45A 3ITHA 3KTQA 2HHUA 3IS9A 5J2MA 3PX4A 1WAJA 4RG8A 2IDOA 3AVHA 4CEZA 4CFAA 3CG7A 1FKOA 4NYNA 3PUFA 4AHSA 4CJUA 4K8XA 5HRNA 1U45A 1RT4A 2KTQA 3KK2A 3V9WA 4KHNA 1ZBIA 4CHOA 2W42A 2OPRA 2YNFA 3HT3A 1S1UA 2OPSA 4M41A 4FJJA 2R7YA 1TGOA 3QEIA 3NGZA 3AVGA 5HP1A 1XC9A 4KTQA 1QSSA 4CHPA 1YTAA 1T7PA 3AVJA 4EP4A 3C95A 1LV5A 1CXUA 1CXQA 2Z1HA 2G8HA 1SUQA 2HNDA 4HHTA 3UIQA 2HHQA 4KHWA 1VSLA 4CGGA 4CEBA 4W5RA 3NH1A 5SWMA 4FM0A 2HHTA 1CLQA 1RTHA 1U47A 4PUOA 2HHXA 1VSHA 3LALA 4CJPA 3LAKA 4J2EA 4H8KA 4Z4GA 3QEWA 3HPOA 4DQQA 1WSEA 3L2WA 4Q0BA 4CK1A 3U3YA 4CEDA 1HYZA 4FJKA 4PA1A 1RBRA 5T7BA 1S9GA 3NF7A 3ZT0A 4CESA 1LWFA 4KTZA 4RW9A 4CJQA 4CEAA 4FZXC 2DFEA 1SL2A 4WE1A 4DLGA 2PY5A 2FBYA 4FCYA 2GUIA 1NK5A 4FW1A 3VQ6A 1GOCA 1TKZA 1KRPA 4CJSA 3AVBA 4FXDA 2XY8A 1F21A 2G8KA 4M3ZA 3AO4A 3LP2A 4HTUA 4FJHA 1FXXA 4Z4IA 1L3SA 4E7LA 2OPQA 1BGXT 2HNYA 4ID1A 3DOKA 1FKPA 1VSMA 4DSFA 2XY7A 4DG1A 1EETA 1WSFA 3QERA 3AVMA 4DTPA 2P5OA 4K8ZA 3T3FA 1TAUA 4FLUA 2P5GA 1ASUA 3CFOA 4FJNA 2Y1IA 4KRFA 4FLWA 3VQDA 5HROA 3FFIA 1WSHA 1LWCA 4AILC 3HYFA 4OKJA 3ZSXA 2E4LA 2RPIA 5HRSA 2YNHA 3EYZA 3TAGA 1NK8A 4CHNA 5SZTA 5C24A 1C1BA 3V6DA 1SKWA 3CFPA 4C8MA 2LSNA 2HVIA 5FRMA 3HVTA 2FC0A 3NF6A 4C8NA 3DRRA 1VSIA 3SV3A 2XY5A 3MECA 2KZZA 4ZHRA 2GV9A 1U4BA 2KZMA 4MFBA 5FDLA 4LD0A 1J54A 1JLBA 4FJ9A 4FYDA 4IFYA 4ZTJA 4FK4A 3SI6A 3HJFA 3SPZA 3NH0A 1S1TA 2JGUA 3I8DA 3MAQA 1U04A 1KCFA 4BACA 1RBVA 3P1GA 1U49A 1NKBA 4KTWA 1NJXA 1HMVA 1W0HA 3B6PA 3SYZA 3AO2A 3SUOA 1N6QA 4NCGA 4OJRA 4CIFA 4HUEA 1C1CA 3OYEA 4DFJA 4F2SA 4CHYA 3IRXA 4O5BA 3SUPA 4R5PA 2OZMA 3HL8A 2ZD1A 3OS2A 4RW7A 3QESA 1BIZA 1BCMA 3AO1A 4C8KA 3O4QA 1GOAA 4IG0A 3QIPA 1UA0A 2FBTA 1NKEA 4IG3A 3M8SA 4IDKA 3PX6A 3KLEA 1LAWA 1RTJA 4Y1DA 3VQAA 4FVMA 3L8BA 4FK0A 1VSKA 2D5RA 4I7FA 3KD5E 2HNZA 1NJZA 1CZBA 3C6UA 3NAEA 4BDYA 3THVA 2PYJA 4DTRA 3KLIA 1NKCA 1JL2A 3HM9A 2DFHA 4M42A 3OYMA 3F9KA 3MEGA
chains in the Genus database with same CATH superfamily
1XHXA 3E9PA 4OLBA 3O5BA 3S3NA 3RRHA 3DOLA 5EY4A 1WBBA 1NK6A 4FJ7A 4Z0UA 3ZSZA 1TK0A 1C0UA 1WUAA 2P1JA 1S6QA 1QHAA 1VQNN 4C8LA 3L6QA 1DLOA 1K9MO 1JKHA 3BF3A 3BF1A 3TTFA 2YJEA 3LM2A 1C0MA 3AV9A 4CHQA 4B9MA 3IKMA 3HK2A 4CGJA 1SV5A 1QVFM 4UQGA 3QINA 4FJGA 1VQPN 2O8DA 4CGDA 1WNSA 1GLAG 5J2NA 1W9HA 5LMUK 1TL1A 4W5NA 5F0XA 2P9IA 3KK3A 1VRUA 4BR0A 1JLAA 4ISFA 3O1BA 4LFBK 3K5MA 5CYMA 1TL3A 2HW3A 4N56A 4L8RB 2KFZA 2QKKA 1HYSA 3OJUA 4KB0A 2IC3A 2IS3A 1GLJO 4H0XB 3O9QA 4DU1A 4DSKA 3TAEA 5AQYA 1XMQK 4G9ZA 3JXUA 2JWKA 1TK8A 3J8AA 5AZIA 1B9FA 4RW4A 4YFUA 3TAQA 2HMIA 2O8EB 4ISEA 1WBDA 2GTDA 4KHQA 2QWLA 2X78A 4XH4A 1FK9A 1QQOA 1IBLK 1FW6A 3HP9A 3AO5A 4JI4K 5BRDA 2KW4A 3JYTA 1JLEA 4BWJA 2YJFA 3DLGA 4H5WA 4NLBA 3WQUA 2IVNA 2JLEA 2P9PA 4IOAL 2A5XA 2Z1JA 4A5AA 3CCRN 4DCHA 3K58A 5AQHA 3QEPA 4B1UB 4XIUA 1V4SA 4Y1CA 4DSIA 4B9LA 1D9DA 2P9KB 4CZGA 1KC8O 2D0BA 4CECA 2V7YA 3E01A 4BROA 3AVFA 4H4OA 3VQ8A 3VQ7A 2F96A 2YCHA 3DM2A 2GEMA 3OVNA 4O5FA 1X9MA 3DWLA 2QI2A 5FRNA 1Q9XA 4CJ4A 5GIPA 1NGBA 3J7AP 4FWSA 2HBJA 5C10A 4B8AB 2G8WA 3CPWM 4ISGA 3ZSYA 3CM5A 4CZMA 3H1VX 1CZAN 4OPJA 2FBVA 1IKXA 3VESA 1BO5O 5FLXO 3KK7A 4IKFA 4BR2A 2Q31A 3QETA 2ITGA 3CJAA 1QSLA 3JS6A 1HNIA 1RCHA 4B9TA 2WBNA 3I55N 4KHSA 1K6YA 3D6RA 1HPZA 2VYPA 4CHZA 5KPRA 2E1ZA 1ZBHA 3ZEUA 3SCXA 5AQGA 2ZQBA 4GVEA 1VQON 2ZE2A 1WLJA 4L3QA 3OYNA 3MEDA 1IKVA 4MO4A 3V9XA 2E6LA 3MXIA 4FJMA 5JVHL 4I6MA 3BDPA 1TKDA 1X3NA 4CJVA 3A5OC 2I7NA 3PSIA 2V52B 3WNHA 4BRGA 1VSDA 3HM8A 2F8TA 1JXEA 3OBYA 4JK7A 3ZT2A 4FM2A 1Q81O 1J5EK 4NLCA 3LP3A 1S1XA 5EU7A 2KFNA 3M3ZA 1UA1A 1YITN 3KLGA 5GAEP 4OKEA 2OZSA 5MLCQ 3DRPA 4E89A 4E7IA 1S6PA 3MXJA 3U9ZA 2IGIA 4I9QA 1RBSA 3DLRA 3VN5A 5GAHP 3KK1A 1KLNA 1ASVA 3K57A 4QCLA 4LFAK 2PBDA 1YIJN 4MO5A 3WXIA 2VQEK 2RF2A 3VQQA 2B5JA 4BG8A 4JI5K 2I7PA 4PL8A 4IFEA 4I9LA 3CPEA 4I2PA 4JKAA 3O3GA 4CERA 3CCJN 3TANA 4E7JA 1JLFA 3LWMA 3KWIA 2O8BA 3F73A 5AQMA 2QK9A 5IWAK 4LF4K 2KLAA 3CCLN 3PV8A 1RT6A 1BUPA 3SQ1A 3FLCO 2RN2A 3G0ZA 3G10A 3SBTA 4PKIA 2VQFK 4DR7K 2ATQA 4FLYA 2FF6A 3TPQA 1XHZA 3O9TA 3AAPA 4FVUA 3EL2A 1ZC6A 2YNIA 1JL1A 3VERA 1KVAA 3KKSA 4YOWA 5AZJB 3O9UA 3DXMA 1SQKA 1KFDA 4N5SA 1X9SA 4FJ8A 4O0JA 1RILA 3CCUN 3KLFA 4QS8A 5HRPA 3IUCA 3KWGA 2E2PA 4BC2A 5GADP 1TUUA 1G99A 4IOXA 1LW2A 4DTOA 3WT0A 4EZ9A 3DLLL 4H03B 3DRSA 4CF0A 2H3GX 3J7YP 1JXBA 1DT9A 1YHQN 3NDKA 3DLEA 3SV4A 2E6MA 2V51B 2E88A 4FWQA 1T05A 3QFUA 3C6TA 4B1VA 3LP1A 5ADXA 4OVLA 4BQLA 3VF4A 5AQJA 1UAXA 3O4WA 5I3UA 4WYBA 1HNZK 1NJYA 2WTUA 3H3NO 4B1XB 4ID5A 3OYIA 4E1NA 2GELA 3OS0A 5C25A 3GE1A 4H5TA 5J2MA 4LF8K 3PX4A 2NRXA 4O8KA 1WAJA 4RG8A 3K0SA 3GG4A 3AVHA 3E9LA 5M1FA 1E3MA 4NYNA 3U9DA 3KK2A 4KHNA 2W42A 2YNFA 3HT3A 1S1UA 4WCEL 4BY9C 1IBMK 3AVGA 1XC9A 5FPEA 1N8RO 1YTAA 3AVJA 4EP4A 3THWB 3SJHA 1CXUA 2HNDA 3R1XA 2YHYA 3A5LC 2HHTA 3LAKA 2HSTA 4CZHA 2CH5A 4CEDA 1RBRA 4C1NK 4H0TB 1LWFA 4CJQA 3DJCA 4CEAA 4FZXC 5ELZA 4DLGA 2PY5A 3F5TA 2GUIA 1TKZA 3KHYA 2UYTA 4CJSA 3AVBA 5KQDA 1XNQK 4M3ZA 3TSQA 3HBTA 3S41A 4FJHA 1BGXT 4BVOA 4DG1A 2PAVA 4K8ZA 5M1KA 3QMLA 4FLUA 4KRFA 5HROA 3VQDA 3I33A 3RSEB 3IMXA 2VWBA 1WSHA 4PL7A 4YORA 3HYFA 2AP1A 5BR8K 3ZSXA 2E4LA 4DR5K 5CE3A 2P9IB 4CHNA 1WOQA 2W41A 5C24A 3HTVA 3K9KA 1SKWA 5GAGP 4FOEA 2LSNA 1EWQA 3HVTA 3CERA 2Q97A 3NF6A 4IDHA 1VSIA 4BG9A 2XY5A 3MECA 2KZZA 4FJ9A 4AF1A 3NH0A 1Z6RA 4FWLA 1U04A 3B8AX 5AQWA 1NKBA 3THYA 2ZGZA 4YOUA 3OA9A 1W0HA 3B6PA 1R59O 2FSKA 1N6QA 2HMPA 5AZIB 4O5BA 5M1NA 1HNXK 2F9TA 1W2BM 1BIZA 1BCMA 4C8KA 4IZ9A 1UA0A 2FBTA 5B8HA 4IG3A 3M8SA 1RTJA 1CZBA 3GOIA 4JKDA 3KLIA 1JL2A 1MDUB 4M42A 2P9PB 4FJIA 1GLEG 4OGCA 1VK0A 4RCHA 3SNNA 1Q7YO 3L3UA 4WQ4C 1KTQA 2FSNA 5CZ1A 4FWOA 1EO1A 1MU2A 3HZ6A 4HCBA 4XH5A 4NO7A 4KB1A 1XI1A 4CEFA 5DM7L 2IVPA 3BP8A 3ULEA 1TAQA 4JKHA 4DU4A 4BDPA 2BDPA 4CE9A 4CEOA 3T1HK 3CM6A 3AVLA 3L4QA 4ELTA 1QS4A 4CGIA 4A5BA 3IDHA 4JI0K 3DLBA 2OPPA 3VGLA 4ILGB 1N33K 3CJ7A 3HVRA 1OVYA 3CC2N 1VQ8N 4F9OA 1RT7A 1NK9A 2HHWA 4WFAL 3BUZB 3RVCA 3L4IA 1XWLA 4KI4A 5GINA 1YJ9N 2NRZA 3EO3A 4M3UA 3DYAA 4IOCL 5HBMA 2RHKA 1IKWA 4IFVA 1KQSM 3QEVA 1ITGA 4EZ6A 5HL7L 4XEIA 3ZEUB 4FZZA 4BRIA 1QE1A 2ASPA 1VQ9N 1KD1O 3NE6A 5KRTA 1S22A 2UUAK 2RKIA 5I42A 1HQEA 2ETJA 3I0RA 1S9EA 4BRDA 1T03A 1HKCA 2NRVA 4I6MB 4E0DA 1SL1A 3MN6A 4B8CA 3OYGA 2YI1A 3EEQA 3FE1A 4BC4A 4ILJA 1C0GA 1MWKA 3CYMA 3VF2A 5AQUA 2FSJA 4AQYK 3DLKA 4PKHA 4CGHA 3OYHA 1QQNA 5AQLA 2CGJA 3L3VA 3CJCA 2DFFA 4F3OA 4PQUA 1VSJA 1JLGA 2QWRA 3AA4A 2G8UA 1T6CA 5JVGL 2O4IA 4BRPA 2VWJA 1IJJA 1NGEA 2CGKA 3SAFA 3HRGA 5LL6Z 2YKMA 3WNEA 5KTQA 3CCQN 4I2QA 3CF5L 1EWRA 4DV4K 3EY1A 4FLVA 1KVBA 3IFRA 1NK7A 2NRWA 4B1YB 1DTTA 5BN8A 4JKBA 5JS2A 2I5JA 3V1RA 3H45C 3V4IA 3I8BA 4DR2K 3M8PA 3P83D 3AVNA 3TABA 3B6OA 3NVKA 2FXUA 4WQ5C 5J2PA 2O8BB 1HKBA 3T1AA 1X9WA 2Z1IA 4DU3A 2HB5A 4GV6A 1VQKN 1NK4A 4LF7K 3PO4A 3HPHA 1I39A 4CJ3A 3SUNA 3K5OA 1VAZA 3WNGA 4O55A 1Q9YA 1WB9A 1YVUA 1HPMA 3M8RA 2DTUA 3NHGA 1QSYA 4RWTA 4Z4EA 3O3HA 2VCPA 3AAQA 4XH1A 3OYKA 1H1VA 3VQ4A 3LZJA 1VQ7N 2WOMA 3MN9A 3K5NA 3DXMB 3RSEA 3ZETA 1KAXA 3THXA 2X6SA 1ZXOA 1BISA 4DFPA 1ATNA 1VSEA 2HBMA 4DSLA 4BE2A 3QFPA 3MX2A 3WEEA 4JNEA 2AJQA 3VQCA 1O13A 3BY5A 3S3OA 3MN5A 5H1SQ 3RWUA 3W0LA 1WN7A 3ZT3A 3AO3A 2CH6A 4DR3K 1BI4A 1HQUA 4JYAK 1JCGA 3QLHA 4YDUC 3T19A 1BQMA 3T69A 4B3RK 3GL1A 3TAPA 3NF8A 1NMDA 3NGYA 1NU0A 4GV3A 5BRHA 3QICA 2YHBA 3K59A 4O44A 2KQ2A 3DXKA 1RDCA 4DR1K 3RRGA 1GLBG 3LM9A 2KHOA 1OH8A 3KLHA 4F2RA 3V9UA 3ISNC 1J5OA 4JRQA 3LDQA 4ICLA 5LMNK 1NWKA 4JI6K 4V19S 3TARA 4DV1K 3SQ4A 4DTMA 2IOCA 1IH7A 3EE9A 5KRSA 4W5QA 2AA4A 3LWLA 3N4QA 3MWTA 4MDAA 3PY8A 5CYQA 3FGUA 4K41A 4KKOA 4CF9A 4DLEA 4FSVA 4WFNL 2ITMA 1N36K 1YTUA 4OO1J 4A59A 5JMVA 4DF8A 3KJVA 3KKRA 2NRRA 2EWSA 1GOBA 3ZLJA 4NXNK 1R0AA 3RTVA 2XRIA 2Y1JA 1NJWA 2DPNA 3OYBA 2A1SA 1TV6A 4CFCA 1NGDA 3HSCA 3IG1A 2UU9K 3C7NB 4UY8O 3ZX0A 1K8KA 1TVRA 4M3RA 4CI6A 5LY3A 4E7KA 1U2VA 3MEEA 1RT1A 5AQQA 3I0SA 3ENOA 1B92A 3DAWA 2HVHA 3T7ZA 3ASMA 3AVIA 2YKNA 1YVNA 2QXFA 1NGJA 1L5UA 3NGIA 3E66A 4DTUA 3NVMA 4CF8A 2HBKA 3D45A 2B4JA 1ZBUA 3E1YA 4E1JA 5BREA 1P90A 4Z4CA 4BRAA 4JKGB 1NOZA 3G71N 3VQBA 1IO2A 4YOTA 3NBPA 5AJ3K 2Z1GA 3ZT4A 1VRTA 1BWFO 2UXDK 2E5LK 4GKJK 1A5XA 4DKWA 5C12A 2HHUA 5AQSA 1T6DA 2QM1A 4BRFA 4H5RA 4CEZA 4CFAA 3CG7A 3THYB 3C0BA 3H6EA 1TUYA 4CJUA 3QBWA 2KTQA 4CHOA 2D0PA 4BGBA 5AQXA 5AR0A 2QWQA 3SLCA 1TGOA 3WUHA 4CHPA 4IXCA 3C95A 1CXQA 2Z1HA 5GIOA 1SUQA 2G8HA 3UIQA 4KHWA 4QS9A 5AQPA 2ZF5O 1CLQA 2YHWA 1U47A 2HHXA 3BZKA 4J2EA 4BR4A 3P31A 4FWPA 2UXBK 1HYZA 5T7BA 4FPBA 3NF7A 5KPZA 4KTZA 1JCFA 3CXCM 3O6WA 4WE1A 4LF9K 2FBYA 1RFQA 3OBWA 1QQMA 1X9JA 2XY8A 3ULEB 2G8KA 5AQVA 2E2NA 4OPAA 5FPMA 4JV5K 2Q0RA 1FXXA 2HNYA 2Q2RA 4ID1A 1VSMA 3QERA 3AVMA 3T3FA 2P5GA 3CFOA 3WXLA 1ATRA 4BREA 4AILC 2GWJA 1NGCA 2A40A 4BGAA 4X65K 5LJVA 2IVOA 1ILYA 5HRSA 2YNHA 3TAGA 4A62A 1NK8A 4YY3K 4JKCA 3CHWA 3KVGA 3M1FA 3EE8A 3VEYA 4FOIA 5HOOA 1ATSA 2GV9A 1U4BA 4MFBA 5FDLA 3D2FA 3TSUA 4GKKK 3VEOA 4ZTJA 3D7EO 4FK4A 3SI6A 4BR5A 2JWLA 3I8DA 3P1GA 4KTWA 5EOYA 1HMVA 3VETA 3AO2A 3OYEA 4CHYA 4R5PA 3HL8A 3FR0A 4PKGA 3QIPA 2W40A 1C0FA 4JHDA 4FK0A 4Y1DA 4FVMA 1TYQA 2O8FA 3C6UA 3FZKA 3NAEA 4BDYA 4DTRA 1IG8A 3OYMA 3F9KA 4CCHA 3MEGA 3HPGA 5JICA 4F3TA 4AHCA 3TWHA 4W5TA 5AQZA 4CJ5A 3N4PA 4DR6K 4RW6A 4ZTFA 5E26A 1KXPA 5CHIA 4C23A 3UKUB 3VA3A 3VTIA 4KHUA 1G15A 3WXMB 1WSGA 2WC9A 3SZ2A 2OTLN 3SPYA 1SS6A 3TAMA 1NGFA 1SAZA 3AGRA 2GWKA 5BN9A 1A5WA 4M7YA 4DV6K 4KO0A 3R8EA 4DS5A 4AHVA 4CFBA 3MXMA 2NRTA 3LDNA 3ZSVA 1Q82O 1BOTO 4DV5K 3L2QA 1NMNA 1HJOA 4IEEA 1KLMA 4FWKA 4Z4FA 3G4SN 4FLZA 3CC7N 4CW7B 3WQTA 4B9QA 2Q3SA 1XMOK 4M3WA 4E1MA 3MX5A 4DTXA 3M6GA 3C7NA 1LWEA 4IO8A 3SQ0A 3AA5X 1WAFA 2P9NA 4HVJA 3VF6A 4ELVA 5E84A 4KFBA 1NGHA 5BPMA 4BC3A 4JS5A 3DI6A 3VQPA 4CBWA 1OKJA 4A61A 4M3TA 5A2QO 3H3OB 3ZETB 1ZYQA 1RNHA 3VQ9A 3THXB 1ZBSA 4CEQA 3OYDA 2Q36A 4CEEA 3MWPA 4O0IA 4KPYA 1W97L 4JKGA 3WEEB 1HKGA 3QDKA 1KAYA 2X6NA 1DTQA 1Y97A 3NF9A 1UWBA 1KFSA 1TKTA 1XUPO 2QTDA 3U3GA 4OGEA 1KSPA 1V4TA 4RTFD 5F1XA 3RMBA 4JK8A 1BI4B 2XY6A 2F8SA 5CR4A 4JRPA 2A42A 2WFBA 1BG3A 1YUWA 5C42A 2BUPA 2E2QA 1A5VA 2O4GA 4IEIA 2B6AA 1BU6O 3AA2A 3CQXA 4M7XA 3QNNA 1NGIA 3DXKB 1VQ5N 2EX3A 1XQSC 5M1OA 3ZCMA 4KHYA 4N47A 3ZSQA 4FW2A 1S1VA 1HJRA 3O1WA 4WQ4A 1Q8IA 4CIGA 1W7AA 3OYJA 4YHHK 2YNGA 3SQ2A 3EZ5A 1SZ2A 4IBNA 1RDUA 3G6EN 3D2EA 1GLFO 3GDQA 3OY9A 3DLHA 2E2OA 4B3OA 1ESVA 4IJAA 5FPDA 1NK0A 4E19A 5AQRA 4K43A 1U48A 3ZT1A 1L3VA 3RR8A 4TSXA 3ENBA 3CFRA 1L3TA 4FZYA 5AQFA 4FWMA 3H46O 3QB0A 3J7ZO 4DQPA 3SBGA 3LAMA 3QO9A 1YF5L 3O3FA 2P9LB 1MA9B 2E8AA 3M8QA 4CF1A 4DWIA 1I94K 4DR4K 1BIUA 2VG6A 4FM1A 2QW9A 1NM1A 4N41A 3TI0A 4AM7A 3C6AA 4C8OA 3O8MA 1FJGK 4FWNA 2D0CA 3ATVA 3HOSA 3RR7A 1XNRK 1K8KB 2HHHK 1U2VB 4OKKA 3RMAA 5AFUA 3AARA 4CJRA 2ZGYA 3ZSOA 1OH7A 1EX4A 3MDQA 4DMNA 4Q5VA 1N32K 3CI5A 4CZJA 1T3VA 5KI6A 2FBXA 2YHXA 3OYCA 2GUPA 3NH2A 1IKYA 1X3MA 3OYAA 4BWMA 2D4WA 5CZ2A 3V9SA 1RTIA 3LZIA 5TKYA 3CC4N 4AHTA 5M1QA 4DQRA 2QKBA 1VQMN 3UKRA 3ULDA 2HHSA 2YV0X 3ENHA 3C6HA 4FK2A 3C94A 2BANA 2HF4A 4BRCA 3KIOA 4NCAA 3D0PA 4EHUA 1EP4A 1CZ9A 5AQKA 4Y0WA 1IG9A 1VQ4N 3OYFA 2ASOA 2VWKA 4FJLA 2IIRA 2PZSA 3LP0A 1HX1A 4GMJB 4B9SA 3L2UA 3BEXA 2G8FA 5EXWA 3VQ5A 4CJTA 3UKUA 1YJWN 1J9AA 3VA0A 5BPLA 5TKWA 2ZM6K 4H4MA 1DEJA 4WQ5A 1S5JA 4NYFA 2D0AA 2WONA 3DMJA 3ID6A 1OVQA 3ZX2A 3O08A 4W5OA 4CJLA 1SKSA 4CZEA 4B9VA 4LF5K 4EP5A 1E4GT 3WXJA 1BQNA 4AHRA 3OW2M 5KGWA 4HTLA 1HNVA 2G8VA 4DQSA 2GBZA 1D9FA 1S1WA 5E41A 3WXKA 2P9UB 3RMDA 1KAZA 3A5NC 4Z4HA 3PLAA 3F9MA 2W6LA 3V81A 1RDWX 2HF3A 1VSFA 2A41A 1RT5A 4M63C 4E7HA 2OTJN 5FROA 4QOZB 4B3MK 3S3MA 3V1QA 4KH4A 2X74A 5AQNA 4JD2A 3J81O 4CFDA 1LOTB 4KHPK 3FFKB 3TR8A 4DS4A 2YHAA 5CY4A 3D2FB 3A2FA 4FL9A 3ITHA 5FPNA 3KTQA 3IS9A 3EKSA 2O8CA 1EQYA 1YJNN 4YDUA 3PUFA 2UXCK 4K8XA 3V9WA 2QWOA 3MK6A 3QBXA 2OPRA 4H0YB 1S3XA 2R7YA 4KTQA 3QEIA 3NGZA 2QWNA 1QSSA 2FLOA 5AQIA 1T7PA 4JI3K 1LV5A 3P39A 4JHDB 3O9RA 4CGGA 3PIPL 4CEBA 1TYQB 2O8FB 1BA1A 5F2RA 4FM0A 1RTHA 1VHXA 4PUOA 1VSHA 3L0QA 4H8KA 3TTCA 4X66K 3HPOA 3QEWA 4LFCK 1WSEA 4CK1A 3U3YA 3MMVA 2F4VK 2VGMA 3LDLA 3ZT0A 4CESA 5ADXH 3P38A 4RW9A 1Z05A 2F7TA 1SL2A 4FCYA 4C1NI 1GOCA 2GX9A 4FXDA 4K42A 3AO4A 3LP2A 4Z4IA 1L3SA 5LJWA 2OPQA 4IWVA 2P5OA 4H0OA 4DTPA 3NMUA 4H0PA 1VQLN 2NLXA 3VEXA 1ASUA 1NGGA 3VOVA 1LWCA 2A3ZA 4OKJA 2RPIA 4CBXA 4LC9B 1C1BA 4CZLA 2P9LA 1IBKK 3V6DA 4C8MA 1BDGA 2HVIA 5FRMA 3FZHA 2FC0A 4H0VB 3SV3A 2UUCK 4FYDA 3O80A 1J54A 4LD0A 4IFYA 3HJFA 3SPZA 3MCPA 1S1TA 3MAQA 5EVZA 1KCFA 2J4RA 1RBVA 4BACA 1U49A 4BRKA 4H5NA 1NJXA 4WF9L 2P9NB 3SUOA 4OJRA 4CIFA 3U8XA 1C1CA 4HUEA 4DFJA 3CCSN 3AO1A 3O4QA 1GOAA 3EN9A 4IG0A 2WUSA 3ATUA 5BR9A 1RGIA 4IDKA 3PX6A 3VQAA 4EFHA 1VSKA 2Q0UA 2PYJA 3L2RA 3NFAA 1NLVA 4KH6A 4FJ5A 3FZLA 4CJWA 1Z25A 5DK5A 1C6VA 2QXLA 1ZBFA 1JCEA 3UB5A 1TKXA 4CD3A 4E3SA 3AA3A 4ILHA 1RDBA 1RT3A 4GNIA 5KQ8A 4NXMK 2OA8A 1HRHA 1LAVA 1IV0A 1QZ6A 3SJJA 4PY5A 4CJ7A 4BE1A 2P9SA 4CZIA 3PX0A 4JLHA 1O1WA 2PFUA 5KGXA 2XO7A 4CBUA 1RBUA 1EXQA 1B9DA 3H08A 4LSNA 4MLEA 1GLCG 1N5YA 4BC5A 4JKFA 4KI6A 1K73O 4QS7A 3D2EB 1UOCA 5D3GA 4DB3A 1ASWA 4RW8A 5C0YA 1YI2N 3G25A 2HOEA 5I9EB 2W6KA 4DQIA 1E4FT 4DQ8A 3LPTA 1T8EA 1DKGD 3ZSWA 4LY7A 1C1AA 4DSJA 1GLLO 3A5MC 3CJ1A 1NNEA 1Z26A 3SUQA 3HXMA 3ZYYX 2P9UA 4DFKA 4BRHA 1VQ6N 4J8FA 2QA4N 4CK2A 1D4XA 3SMPA 3VGKA 2YX6A 2FF3B 4CVNE 5IT9O 3CJ9A 5KPTA 3VENA 1JLQA 4YOYA 4HUGA 1S72N 4JS4A 3OYLA 4LSLA 1BA0A 2CGLA 4CF2A 3O4NA 3JSMA 1GLDG 5DMRA 3AVKA 4QAGA 3V1OA 1YT3A 4CZKA 3LPUA 3ID8A 2QEXN 1Q18A 2E1YA 2BTFA 4KREA 4DTNA 1HYVA 4DFMA 3LANA 3Q7BA 1QHTA 4CIEA 4LF6K 5AFUH 2VGNA 4OLAA 3NCIA 4CJFA 5JS1A 3R9PA 1SL0A 2NRHA 3CETA 3L2VA 1HR0K 3R3LA 4BRNA 5HLFA 4J2AA 3HO1A 2ZJPL 4U7BA 1EKEA 1REVA 4AH9A 3V9ZA 3ALYA 3HSTB 3JAMO 2QWPA 4CD1A 1P8ZA 3F2KA 4IO9L 3C65A 1RT2A 2HBLA 1QVGM 3LDPA 4B9UA 1C0TA 4Z94A 4B3SK 3UKRB 4BRMA 1KVCA 3LDSA 1D8YA 4LH4A 3MN7A 1DGKN 3VEZA 4B08A 2PYLA 4DV0K 4DF4A 3SMSA 2NUBA 3U4LA 3R6MA 1N34K 1RDDA 3W3DA 2HHQA 4BR9A 2HHVA 1J53A 3CCEN 1NOYA 3CIPA 4A2BA 3UE5A 3EKUA 3KD1E 1NBWA 1QZ5A 1NGAA 2O8EA 3RMCA 1NG9A 3SAGA 4J2DA 1RTDA 4HUFA 1Q86O 1TK5A 1LW0A 2DY4A 1SKRA 1K8AO 3AVAA 4CJEA 4ELUA 3ZX3A 5BPNA 4GVMA 2G8IA 3SK3A 4OPKA 4IJNA 5AQOA 4DSEA 4FLXA 4B3TK 5C2FA 2OANA 4A2AA 3CCVN 3CCMN 5HRRA 4K0KK 4EHTA 3AY9A 4FLTA 1X1PA 5K14A 1WSIA 3TSPA 5J1EA 4X64K 4JEPA 2BGGA 3VEVA 4YNQA 4BDZA 1RBTA 2P9KA 3CD6N 1OH6A 3QEXA 4F8RA 4BE0A 3PO5A 2A6AA 4PHTX 2QWMA 3ZSRA 3QIOA 4KV8A 4JKEA 1L3UA 2ZWHA 4O4GA 3TAFA 3M5RA 4JD2B 4JK9A 4CJKA 4B1ZA 4MDBA 4B1WB 1D5AA 1LCUA 2XHBA 3S9HA 4LH5A 4O8UA 3MCAB 4CZFA 5C15A 1BL3A 4FJXA 2O8CB 1YAGA 4MLHA 3QNOA 2OYQA 2NNWA 4PWDA 3TU5A 1RDAA 4FPAA 3U6FA 2E20A 3AVCA 2A1RA 1BCOA 3VEWA 4CGFA 3Q7CA 1WSJA 3BGRA 4B9NA 4OX9K 1QQCA 1MWMA 1QTMA 3K9JA 1M1KO 3IAYA 2O8DB 2NZTA 4OPHA 3OS1A 3HOTA 4J2BA 1YXQA 3AGKA 2EHGA 4F4KA 4MQ3A 3VQEA 4DV7K 1BHLA 2BE2A 4G1QA 4DHYA 4N76A 4DV2K 3P5JA 3K5LA 1OH5A 3WNFA 4GW6A 2KKZA 2VG5A 4M3XA 4KAZA 3O9SA 3HP6A 4FWRA 3CQ8A 4M3YA 1JLCA 2BH1A 5BRFA 1J6ZA 3I56N 4DTSA 4NB4A 3EZWA 1ZBLA 2ASMA 3P4IA 4GY2B 3K2PA 3VTHA 3OJSA 2VG7A 5JLFA 4AHUA 3J80O 3H1QA 4K25A 5JLHA 5DM6L 3PIOL 2IAJA 2P51A 4X62K 4DTJA 5M1PA 3BZCA 4NCBA 2RE2A 4HCCA 1HLUA 3VPZA 1I3AA 5J2QA 2ZJRL 4JI8K 4CK3A 2UUBK 4M45A 1JJ2M 2IDOA 4JN4A 1FKOA 4AHSA 3LDOA 3T1YK 5HRNA 1U45A 1RT4A 4KH5A 2ZJQL 1ZBIA 4FO0A 2F9WA 1HUXA 2OPSA 1T44A 4M41A 4BVPA 4FJJA 5HP1A 4YOVA 2D0OA 4GV9A 1XC3A 4HHTA 1VSLA 4HWIA 4W5RA 3NH1A 4EIAA 5SWMA 2D1KA 3LALA 4CJPA 4Z4GA 3PSFA 5AZJA 4DV3K 4DQQA 3A0IX 3L2WA 3VGMA 4Q0BA 2OCEA 1Y64A 4FJKA 4PA1A 1S9GA 2DFEA 4AM6A 1HNWK 4JI2K 1NK5A 4FW1A 3VQ6A 1KRPA 5C2DA 5EX5A 3HI0A 3FZFA 4YOXA 4R79A 1U6ZA 1F21A 3CMAN 4HTUA 4BRLA 4BQZA 4E7LA 3DOKA 1FKPA 4DSFA 2XY7A 1EETA 1WSFA 1TAUA 4EAHD 3CJBA 1NJIO 4FJNA 2P9SB 2Y1IA 4FLWA 3CMEN 4H5VA 3GBTA 3FFIA 4WFBL 2V7ZA 3KZBA 3EYZA 3CQYA 5SZTA 3CFPA 4JAXA 3LL3A 4A57A 3TTDA 4BRQA 4C8NA 3DRRA 4JI7K 4DUYK 4ZHRA 2KZMA 1JLBA 5AQTA 4KBOA 3SAHA 2JGUA 1M90O 3OTOK 3A8YA 3FZMA 3E9OA 4DUZK 3SYZA 4NCGA 4F2SA 3IRXA 3SUPA 4BR7A 2OZMA 2ZD1A 3VMFB 3OS2A 4RW7A 2Q1NA 3QESA 3THWA 1NKEA 3KLEA 3OHRA 1LAWA 4U67L 3L8BA 2D5RA 4I7FA 4JI1K 3KD5E 2HNZA 1NJZA 3THVA 1NKCA 3HM9A 2DFHA
chains in the Genus database with same CATH topology
1XHXA 4FJIA 3L2RA 3HPGA 4OLBA 3NFAA 4OGCA 1VK0A 4FJ5A 4F3TA 4AHCA 3TWHA 4W5TA 3SNNA 3S3NA 4CJ5A 3RRHA 3DOLA 3L3UA 4CJWA 1KTQA 4RW6A 1Z25A 5CZ1A 5DK5A 1C6VA 1NK6A 1MU2A 4ZTFA 4HCBA 1ZBFA 4FJ7A 4Z0UA 4KB1A 3ZSZA 1TKXA 4CEFA 1XI1A 1TK0A 1C0UA 4E3SA 3AA3A 2P1JA 1S6QA 1TAQA 1RDBA 4C8LA 1RT3A 3VA3A 1DLOA 4DU4A 4BDPA 1JKHA 4KHUA 2BDPA 1G15A 2OA8A 4CE9A 4CEOA 1HRHA 1WSGA 3CM6A 3SZ2A 1LAVA 3AVLA 1C0MA 3AV9A 4CHQA 3SPYA 3SJJA 1QS4A 4B9MA 4CGIA 3TAMA 4ELTA 3HK2A 4CGJA 4PY5A 1SV5A 4BE1A 4UQGA 3DLBA 2OPPA 3PX0A 3QINA 1A5WA 4FJGA 4JLHA 1O1WA 3HVRA 4KO0A 4DS5A 3MXMA 4AHVA 1WNSA 4CGDA 4CFBA 5KGXA 2XO7A 1RBUA 1W9HA 1EXQA 5J2NA 3ZSVA 1RT7A 1TL1A 4W5NA 1B9DA 3KK3A 1NK9A 1VRUA 3H08A 4LSNA 3L2QA 2HHWA 1JLAA 1N5YA 4KI6A 3K5MA 5CYMA 1KLMA 1XWLA 1TL3A 4Z4FA 1UOCA 4KI4A 5D3GA 2HW3A 1ASWA 4RW8A 4N56A 4L8RB 2KFZA 4FLZA 2QKKA 4M3UA 3DYAA 1HYSA 5HBMA 3OJUA 2IC3A 2IS3A 4KB0A 4DU1A 1IKWA 2Q3SA 4DSKA 4DQIA 4M3WA 4E1MA 3TAEA 4IFVA 3QEVA 1ITGA 3LPTA 4DTXA 1T8EA 4EZ6A 3ZSWA 4LY7A 1C1AA 4DSJA 1LWEA 4FZZA 3SQ0A 1QE1A 3AA5X 1WAFA 1TK8A 3NE6A 5KRTA 1Z26A 4HVJA 4ELVA 2RKIA 1B9FA 4KFBA 3SUQA 5I42A 1HQEA 4RW4A 3HXMA 2ETJA 4YFUA 3TAQA 2HMIA 4JS5A 3I0RA 1S9EA 1T03A 3DI6A 4E0DA 4KHQA 4DFKA 3VQPA 2X78A 1SL1A 4CK2A 1FK9A 4B8CA 3OYGA 4M3TA 1JLQA 1ZYQA 1RNHA 3VQ9A 4HUGA 3HP9A 3AO5A 4JS4A 2KW4A 4CEQA 3JYTA 3OYDA 1JLEA 4LSLA 3OYLA 4BWJA 3DLGA 4CF2A 3O4NA 4CEEA 3CYMA 3JSMA 4O0IA 2JLEA 5DMRA 4KPYA 3AVKA 3DLKA 4QAGA 4CGHA 3V1OA 2X6NA 1DTQA 1Y97A 1YT3A 2Z1JA 1UWBA 3LPUA 3NF9A 3OYHA 1KFSA 1TKTA 3L3VA 3K58A 4KREA 3QEPA 3U3GA 4XIUA 4DTNA 4OGEA 2DFFA 1HYVA 1KSPA 4F3OA 4DFMA 1VSJA 1JLGA 3AA4A 3LANA 4Y1CA 1D9DA 3RMBA 4B9LA 1QHTA 4DSIA 4CIEA 2G8UA 4OLAA 3NCIA 2O4IA 4CJFA 1BI4B 2VWJA 5JS1A 2D0BA 2XY6A 4CECA 1SL0A 2F8SA 3E01A 4JRPA 3AVFA 4H4OA 3VQ8A 3L2VA 2YKMA 3VQ7A 3WNEA 5KTQA 2F96A 5HLFA 4J2AA 5C42A 3HO1A 3DM2A 1EKEA 3OVNA 4I2QA 3EY1A 1REVA 4AH9A 1X9MA 1A5VA 2O4GA 1KVBA 2B6AA 3AA2A 4FLVA 3V9ZA 3ALYA 1Q9XA 3HSTB 4CJ4A 3QNNA 1NK7A 5FRNA 1DTTA 2EX3A 1RT2A 3ZCMA 5JS2A 4KHYA 2I5JA 3V1RA 4N47A 4B8AB 3V4IA 1C0TA 3ZSQA 2G8WA 4B9UA 4FW2A 1S1VA 1HJRA 1KVCA 3M8PA 3P83D 1Q8IA 4CIGA 3ZSYA 3CM5A 3AVNA 3OYJA 3LDSA 3TABA 2YNGA 3B6OA 1D8YA 4LH4A 4OPJA 5J2PA 3SQ2A 2FBVA 3EZ5A 1IKXA 3T1AA 4IBNA 1X9WA 2Z1IA 4DU3A 2HB5A 4B08A 4IKFA 2PYLA 3QETA 4DF4A 2ITGA 1QSLA 3OY9A 3DLHA 1HNIA 1RCHA 2NUBA 4B9TA 4B3OA 1NK4A 4PQUA 1NK0A 1RDDA 4E19A 4KHSA 1K6YA 3PO4A 3HPHA 1I39A 4CJ3A 3SUNA 2HHVA 3K5OA 1J53A 1HPZA 3ZT1A 1U48A 1L3VA 3RR8A 4TSXA 4CHZA 3WNGA 3CFRA 4O55A 1L3TA 1NOYA 4FZYA 1Q9YA 1ZBHA 4DQPA 1YVUA 3LAMA 3SCXA 3QO9A 2ZQBA 3M8RA 2DTUA 3NHGA 3KD1E 1QSYA 2ZE2A 1WLJA 3O3FA 3OYNA 3MEDA 1IKVA 3O3HA 3M8QA 2E6LA 4CF1A 3V9XA 3MXIA 4FJMA 3OYKA 3RMCA 3VQ4A 4DWIA 4J2DA 3LZJA 1RTDA 4HUFA 1TK5A 1LW0A 3BDPA 2DY4A 2WOMA 1TKDA 3K5NA 1SKRA 3AVAA 1BIUA 4CJEA 4CJVA 4ELUA 2VG6A 4FM1A 4N41A 4GVMA 2G8IA 4OPKA 3TI0A 2X6SA 4C8OA 3WNHA 1BISA 4FLXA 4DSEA 1VSDA 4DFPA 2F8TA 1JXEA 1VSEA 3ZT2A 2D0CA 4FM2A 4DSLA 4BE2A 3RR7A 3LP3A 5HRRA 1S1XA 5EU7A 4FLTA 2KFNA 3RMAA 4OKKA 1UA1A 2AJQA 3VQCA 4CCHA 1X1PA 5K14A 3KLGA 1WSIA 4OKEA 4CJRA 3ZSOA 3S3OA 5J1EA 2OZSA 1EX4A 3RWUA 3DRPA 4E89A 2BGGA 4E7IA 1S6PA 4YNQA 4BDZA 3MXJA 4DMNA 4Q5VA 1RBTA 2IGIA 4I9QA 1RBSA 1WN7A 3DLRA 3VN5A 3ZT3A 3AO3A 3KK1A 1KLNA 1ASVA 3K57A 4QCLA 1BI4A 1HQUA 5KI6A 2FBXA 3QEXA 3QLHA 3T19A 3OYCA 4F8RA 4BE0A 1BQMA 3PO5A 3ZSRA 3QIOA 3NH2A 3TAPA 1IKYA 4KV8A 3NF8A 3OYAA 4BWMA 3NGYA 5CZ2A 2RF2A 3V9SA 1L3UA 3VQQA 2B5JA 2YHBA 3K59A 1RTIA 4O44A 2KQ2A 4O4GA 3LZIA 4I9LA 3TAFA 1RDCA 4I2PA 4AHTA 4CJKA 3O3GA 4CERA 3RRGA 3TANA 4E7JA 4DQRA 2QKBA 3KLHA 4F2RA 3V9UA 3ULDA 1D5AA 1JLFA 2XHBA 3S9HA 2HHSA 4LH5A 3ISNC 3LWMA 2YV0X 3F73A 4FJXA 1BL3A 2QK9A 4FK2A 3C94A 1J5OA 3QNOA 4JRQA 2OYQA 4Z4EA 2BANA 4ICLA 3KIOA 4NCAA 4PWDA 3D0PA 3PV8A 1EP4A 3TARA 1RDAA 1RT6A 3SQ4A 3U6FA 3AVCA 1CZ9A 4DTMA 2IOCA 2A1RA 1IH7A 4W5QA 5KRSA 1IG9A 3SQ1A 3LWLA 1BCOA 2RN2A 3OYFA 4CGFA 3G0ZA 2VWKA 4FJLA 2PZSA 3PY8A 1WSJA 3BGRA 3LP0A 4GMJB 1QQCA 4B9NA 1QTMA 5CYQA 3IAYA 4B9SA 3L2UA 3G10A 2ATQA 4KKOA 3OS1A 4CF9A 4DLEA 2G8FA 4J2BA 3VQ5A 4FLYA 4CJTA 1J9AA 3VA0A 1XHZA 2EHGA 4H4MA 2YNIA 1YTUA 4F4KA 1JL1A 1S5JA 4MQ3A 1KVAA 4NYFA 3VQEA 3KKSA 2D0AA 2WONA 4DF8A 1BHLA 3KJVA 3KKRA 3DMJA 2BE2A 1GOBA 4W5OA 4G1QA 4CJLA 1SKSA 1R0AA 3RTVA 4N76A 2XRIA 2Y1JA 1NJWA 1KFDA 4N5SA 3OYBA 2A1SA 1X9SA 3P5JA 4B9VA 4FJ8A 4EP5A 3K5LA 1TV6A 4CFCA 4O0JA 1BQNA 1RILA 4AHRA 3IG1A 3WNFA 3KLFA 4GW6A 5KGWA 2VG5A 5HRPA 4M3XA 1TVRA 4M3RA 4KAZA 4E7KA 1HNVA 3MEEA 1RT1A 3HP6A 2G8VA 3I0SA 4DQSA 3CQ8A 1LW2A 1B92A 2GBZA 1S1WA 4DTOA 5E41A 1D9FA 4EZ9A 4M3YA 1JLCA 2HVHA 3RMDA 3DRSA 4CF0A 4Z4HA 3ASMA 4DTSA 1JXBA 3V81A 3AVIA 2YKNA 1ZBLA 1VSFA 3NDKA 3DLEA 3SV4A 2E6MA 2QXFA 1T05A 3K2PA 1L5UA 3NGIA 4DTUA 3C6TA 4CF8A 3OJSA 2VG7A 3LP1A 4OVLA 3D45A 1RT5A 2B4JA 1ZBUA 4AHUA 4E7HA 5FROA 4QOZB 4Z4CA 1NOZA 3S3MA 2IAJA 1UAXA 1IO2A 3V1QA 2P51A 3VQBA 5I3UA 3NBPA 4DTJA 2X74A 2Z1GA 3ZT4A 1VRTA 1NJYA 4NCBA 4HCCA 4CFDA 1A5XA 4ID5A 1I3AA 3TR8A 4E1NA 3OYIA 4DS4A 5J2QA 2YHAA 5CY4A 3A2FA 4CK3A 3OS0A 5C25A 4M45A 3ITHA 3KTQA 2HHUA 3IS9A 5J2MA 3PX4A 1WAJA 4RG8A 2IDOA 3AVHA 4CEZA 4CFAA 3CG7A 1FKOA 4NYNA 3PUFA 4AHSA 4CJUA 4K8XA 5HRNA 1U45A 1RT4A 2KTQA 3KK2A 3V9WA 4KHNA 1ZBIA 4CHOA 2W42A 2OPRA 2YNFA 3HT3A 1S1UA 2OPSA 4M41A 4FJJA 2R7YA 1TGOA 3QEIA 3NGZA 3AVGA 5HP1A 1XC9A 4KTQA 1QSSA 4CHPA 1YTAA 1T7PA 3AVJA 4EP4A 3C95A 1LV5A 1CXUA 1CXQA 2Z1HA 2G8HA 1SUQA 2HNDA 4HHTA 3UIQA 2HHQA 4KHWA 1VSLA 4CGGA 4CEBA 4W5RA 3NH1A 5SWMA 4FM0A 2HHTA 1CLQA 1RTHA 1U47A 4PUOA 2HHXA 1VSHA 3LALA 4CJPA 3LAKA 4J2EA 4H8KA 4Z4GA 3QEWA 3HPOA 4DQQA 1WSEA 3L2WA 4Q0BA 4CK1A 3U3YA 4CEDA 1HYZA 4FJKA 4PA1A 1RBRA 5T7BA 1S9GA 3NF7A 3ZT0A 4CESA 1LWFA 4KTZA 4RW9A 4CJQA 4CEAA 4FZXC 2DFEA 1SL2A 4WE1A 4DLGA 2PY5A 2FBYA 4FCYA 2GUIA 1NK5A 4FW1A 3VQ6A 1GOCA 1TKZA 1KRPA 4CJSA 3AVBA 4FXDA 2XY8A 1F21A 2G8KA 4M3ZA 3AO4A 3LP2A 4HTUA 4FJHA 1FXXA 4Z4IA 1L3SA 4E7LA 2OPQA 1BGXT 2HNYA 4ID1A 3DOKA 1FKPA 1VSMA 4DSFA 2XY7A 4DG1A 1EETA 1WSFA 3QERA 3AVMA 4DTPA 2P5OA 4K8ZA 3T3FA 1TAUA 4FLUA 2P5GA 1ASUA 3CFOA 4FJNA 2Y1IA 4KRFA 4FLWA 3VQDA 5HROA 3FFIA 1WSHA 1LWCA 4AILC 3HYFA 4OKJA 3ZSXA 2E4LA 2RPIA 5HRSA 2YNHA 3EYZA 3TAGA 1NK8A 4CHNA 5SZTA 5C24A 1C1BA 3V6DA 1SKWA 3CFPA 4C8MA 2LSNA 2HVIA 5FRMA 3HVTA 2FC0A 3NF6A 4C8NA 3DRRA 1VSIA 3SV3A 2XY5A 3MECA 2KZZA 4ZHRA 2GV9A 1U4BA 2KZMA 4MFBA 5FDLA 4LD0A 1J54A 1JLBA 4FJ9A 4FYDA 4IFYA 4ZTJA 4FK4A 3SI6A 3HJFA 3SPZA 3NH0A 1S1TA 2JGUA 3I8DA 3MAQA 1U04A 1KCFA 4BACA 1RBVA 3P1GA 1U49A 1NKBA 4KTWA 1NJXA 1HMVA 1W0HA 3B6PA 3SYZA 3AO2A 3SUOA 1N6QA 4NCGA 4OJRA 4CIFA 4HUEA 1C1CA 3OYEA 4DFJA 4F2SA 4CHYA 3IRXA 4O5BA 3SUPA 4R5PA 2OZMA 3HL8A 2ZD1A 3OS2A 4RW7A 3QESA 1BIZA 1BCMA 3AO1A 4C8KA 3O4QA 1GOAA 4IG0A 3QIPA 1UA0A 2FBTA 1NKEA 4IG3A 3M8SA 4IDKA 3PX6A 3KLEA 1LAWA 1RTJA 4Y1DA 3VQAA 4FVMA 3L8BA 4FK0A 1VSKA 2D5RA 4I7FA 3KD5E 2HNZA 1NJZA 1CZBA 3C6UA 3NAEA 4BDYA 3THVA 2PYJA 4DTRA 3KLIA 1NKCA 1JL2A 3HM9A 2DFHA 4M42A 3OYMA 3F9KA 3MEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHX A;  4FJI A;  3L2R A;  3HPG A;  4OLB A;  3NFA A;  4OGC A;  1VK0 A;  4FJ5 A;  4F3T A;  4AHC A;  3TWH A;  4W5T A;  3SNN A;  3S3N A;  4CJ5 A;  3RRH A;  3DOL A;  3L3U A;  4CJW A;  1KTQ A;  4RW6 A;  1Z25 A;  5CZ1 A;  5DK5 A;  1C6V A;  1NK6 A;  1MU2 A;  4ZTF A;  4HCB A;  1ZBF A;  4FJ7 A;  4Z0U A;  4KB1 A;  3ZSZ A;  1TKX A;  4CEF A;  1XI1 A;  1TK0 A;  1C0U A;  4E3S A;  3AA3 A;  2P1J A;  1S6Q A;  1TAQ A;  1RDB A;  4C8L A;  1RT3 A;  3VA3 A;  1DLO A;  4DU4 A;  4BDP A;  1JKH A;  4KHU A;  2BDP A;  1G15 A;  2OA8 A;  4CE9 A;  4CEO A;  1HRH A;  1WSG A;  3CM6 A;  3SZ2 A;  1LAV A;  3AVL A;  1C0M A;  3AV9 A;  4CHQ A;  3SPY A;  3SJJ A;  1QS4 A;  4B9M A;  4CGI A;  3TAM A;  4ELT A;  3HK2 A;  4CGJ A;  4PY5 A;  1SV5 A;  4BE1 A;  4UQG A;  3DLB A;  2OPP A;  3PX0 A;  3QIN A;  1A5W A;  4FJG A;  4JLH A;  1O1W A;  3HVR A;  4KO0 A;  4DS5 A;  3MXM A;  4AHV A;  1WNS A;  4CGD A;  4CFB A;  5KGX A;  2XO7 A;  1RBU A;  1W9H A;  1EXQ A;  5J2N A;  3ZSV A;  1RT7 A;  1TL1 A;  4W5N A;  1B9D A;  3KK3 A;  1NK9 A;  1VRU A;  3H08 A;  4LSN A;  3L2Q A;  2HHW A;  1JLA A;  1N5Y A;  4KI6 A;  3K5M A;  5CYM A;  1KLM A;  1XWL A;  1TL3 A;  4Z4F A;  1UOC A;  4KI4 A;  5D3G A;  2HW3 A;  1ASW A;  4RW8 A;  4N56 A;  4L8R B;  2KFZ A;  4FLZ A;  2QKK A;  4M3U A;  3DYA A;  1HYS A;  5HBM A;  3OJU A;  2IC3 A;  2IS3 A;  4KB0 A;  4DU1 A;  1IKW A;  2Q3S A;  4DSK A;  4DQI A;  4M3W A;  4E1M A;  3TAE A;  4IFV A;  3QEV A;  1ITG A;  3LPT A;  4DTX A;  1T8E A;  4EZ6 A;  3ZSW A;  4LY7 A;  1C1A A;  4DSJ A;  1LWE A;  4FZZ A;  3SQ0 A;  1QE1 A;  3AA5 X;  1WAF A;  1TK8 A;  3NE6 A;  5KRT A;  1Z26 A;  4HVJ A;  4ELV A;  2RKI A;  1B9F A;  4KFB A;  3SUQ A;  5I42 A;  1HQE A;  4RW4 A;  3HXM A;  2ETJ A;  4YFU A;  3TAQ A;  2HMI A;  4JS5 A;  3I0R A;  1S9E A;  1T03 A;  3DI6 A;  4E0D A;  4KHQ A;  4DFK A;  3VQP A;  2X78 A;  1SL1 A;  4CK2 A;  1FK9 A;  4B8C A;  3OYG A;  4M3T A;  1JLQ A;  1ZYQ A;  1RNH A;  3VQ9 A;  4HUG A;  3HP9 A;  3AO5 A;  4JS4 A;  2KW4 A;  4CEQ A;  3JYT A;  3OYD A;  1JLE A;  4LSL A;  3OYL A;  4BWJ A;  3DLG A;  4CF2 A;  3O4N A;  4CEE A;  3CYM A;  3JSM A;  4O0I A;  2JLE A;  5DMR A;  4KPY A;  3AVK A;  3DLK A;  4QAG A;  4CGH A;  3V1O A;  2X6N A;  1DTQ A;  1Y97 A;  1YT3 A;  2Z1J A;  1UWB A;  3LPU A;  3NF9 A;  3OYH A;  1KFS A;  1TKT A;  3L3V A;  3K58 A;  4KRE A;  3QEP A;  3U3G A;  4XIU A;  4DTN A;  4OGE A;  2DFF A;  1HYV A;  1KSP A;  4F3O A;  4DFM A;  1VSJ A;  1JLG A;  3AA4 A;  3LAN A;  4Y1C A;  1D9D A;  3RMB A;  4B9L A;  1QHT A;  4DSI A;  4CIE A;  2G8U A;  4OLA A;  3NCI A;  2O4I A;  4CJF A;  1BI4 B;  2VWJ A;  5JS1 A;  2D0B A;  2XY6 A;  4CEC A;  1SL0 A;  2F8S A;  3E01 A;  4JRP A;  3AVF A;  4H4O A;  3VQ8 A;  3L2V A;  2YKM A;  3VQ7 A;  3WNE A;  5KTQ A;  2F96 A;  5HLF A;  4J2A A;  5C42 A;  3HO1 A;  3DM2 A;  1EKE A;  3OVN A;  4I2Q A;  3EY1 A;  1REV A;  4AH9 A;  1X9M A;  1A5V A;  2O4G A;  1KVB A;  2B6A A;  3AA2 A;  4FLV A;  3V9Z A;  3ALY A;  1Q9X A;  3HST B;  4CJ4 A;  3QNN A;  1NK7 A;  5FRN A;  1DTT A;  2EX3 A;  1RT2 A;  3ZCM A;  5JS2 A;  4KHY A;  2I5J A;  3V1R A;  4N47 A;  4B8A B;  3V4I A;  1C0T A;  3ZSQ A;  2G8W A;  4B9U A;  4FW2 A;  1S1V A;  1HJR A;  1KVC A;  3M8P A;  3P83 D;  1Q8I A;  4CIG A;  3ZSY A;  3CM5 A;  3AVN A;  3OYJ A;  3LDS A;  3TAB A;  2YNG A;  3B6O A;  1D8Y A;  4LH4 A;  4OPJ A;  5J2P A;  3SQ2 A;  2FBV A;  3EZ5 A;  1IKX A;  3T1A A;  4IBN A;  1X9W A;  2Z1I A;  4DU3 A;  2HB5 A;  4B08 A;  4IKF A;  2PYL A;  3QET A;  4DF4 A;  2ITG A;  1QSL A;  3OY9 A;  3DLH A;  1HNI A;  1RCH A;  2NUB A;  4B9T A;  4B3O A;  1NK4 A;  4PQU A;  1NK0 A;  1RDD A;  4E19 A;  4KHS A;  1K6Y A;  3PO4 A;  3HPH A;  1I39 A;  4CJ3 A;  3SUN A;  2HHV A;  3K5O A;  1J53 A;  1HPZ A;  3ZT1 A;  1U48 A;  1L3V A;  3RR8 A;  4TSX A;  4CHZ A;  3WNG A;  3CFR A;  4O55 A;  1L3T A;  1NOY A;  4FZY A;  1Q9Y A;  1ZBH A;  4DQP A;  1YVU A;  3LAM A;  3SCX A;  3QO9 A;  2ZQB A;  3M8R A;  2DTU A;  3NHG A;  3KD1 E;  1QSY A;  2ZE2 A;  1WLJ A;  3O3F A;  3OYN A;  3MED A;  1IKV A;  3O3H A;  3M8Q A;  2E6L A;  4CF1 A;  3V9X A;  3MXI A;  4FJM A;  3OYK A;  3RMC A;  3VQ4 A;  4DWI A;  4J2D A;  3LZJ A;  1RTD A;  4HUF A;  1TK5 A;  1LW0 A;  3BDP A;  2DY4 A;  2WOM A;  1TKD A;  3K5N A;  1SKR A;  3AVA A;  1BIU A;  4CJE A;  4CJV A;  4ELU A;  2VG6 A;  4FM1 A;  4N41 A;  4GVM A;  2G8I A;  4OPK A;  3TI0 A;  2X6S A;  4C8O A;  3WNH A;  1BIS A;  4FLX A;  4DSE A;  1VSD A;  4DFP A;  2F8T A;  1JXE A;  1VSE A;  3ZT2 A;  2D0C A;  4FM2 A;  4DSL A;  4BE2 A;  3RR7 A;  3LP3 A;  5HRR A;  1S1X A;  5EU7 A;  4FLT A;  2KFN A;  3RMA A;  4OKK A;  1UA1 A;  2AJQ A;  3VQC A;  4CCH A;  1X1P A;  5K14 A;  3KLG A;  1WSI A;  4OKE A;  4CJR A;  3ZSO A;  3S3O A;  5J1E A;  2OZS A;  1EX4 A;  3RWU A;  3DRP A;  4E89 A;  2BGG A;  4E7I A;  1S6P A;  4YNQ A;  4BDZ A;  3MXJ A;  4DMN A;  4Q5V A;  1RBT A;  2IGI A;  4I9Q A;  1RBS A;  1WN7 A;  3DLR A;  3VN5 A;  3ZT3 A;  3AO3 A;  3KK1 A;  1KLN A;  1ASV A;  3K57 A;  4QCL A;  1BI4 A;  1HQU A;  5KI6 A;  2FBX A;  3QEX A;  3QLH A;  3T19 A;  3OYC A;  4F8R A;  4BE0 A;  1BQM A;  3PO5 A;  3ZSR A;  3QIO A;  3NH2 A;  3TAP A;  1IKY A;  4KV8 A;  3NF8 A;  3OYA A;  4BWM A;  3NGY A;  5CZ2 A;  2RF2 A;  3V9S A;  1L3U A;  3VQQ A;  2B5J A;  2YHB A;  3K59 A;  1RTI A;  4O44 A;  2KQ2 A;  4O4G A;  3LZI A;  4I9L A;  3TAF A;  1RDC A;  4I2P A;  4AHT A;  4CJK A;  3O3G A;  4CER A;  3RRG A;  3TAN A;  4E7J A;  4DQR A;  2QKB A;  3KLH A;  4F2R A;  3V9U A;  3ULD A;  1D5A A;  1JLF A;  2XHB A;  3S9H A;  2HHS A;  4LH5 A;  3ISN C;  3LWM A;  2YV0 X;  3F73 A;  4FJX A;  1BL3 A;  2QK9 A;  4FK2 A;  3C94 A;  1J5O A;  3QNO A;  4JRQ A;  2OYQ A;  4Z4E A;  2BAN A;  4ICL A;  3KIO A;  4NCA A;  4PWD A;  3D0P A;  3PV8 A;  1EP4 A;  3TAR A;  1RDA A;  1RT6 A;  3SQ4 A;  3U6F A;  3AVC A;  1CZ9 A;  4DTM A;  2IOC A;  2A1R A;  1IH7 A;  4W5Q A;  5KRS A;  1IG9 A;  3SQ1 A;  3LWL A;  1BCO A;  2RN2 A;  3OYF A;  4CGF A;  3G0Z A;  2VWK A;  4FJL A;  2PZS A;  3PY8 A;  1WSJ A;  3BGR A;  3LP0 A;  4GMJ B;  1QQC A;  4B9N A;  1QTM A;  5CYQ A;  3IAY A;  4B9S A;  3L2U A;  3G10 A;  2ATQ A;  4KKO A;  3OS1 A;  4CF9 A;  4DLE A;  2G8F A;  4J2B A;  3VQ5 A;  4FLY A;  4CJT A;  1J9A A;  3VA0 A;  1XHZ A;  2EHG A;  4H4M A;  2YNI A;  1YTU A;  4F4K A;  1JL1 A;  1S5J A;  4MQ3 A;  1KVA A;  4NYF A;  3VQE A;  3KKS A;  2D0A A;  2WON A;  4DF8 A;  1BHL A;  3KJV A;  3KKR A;  3DMJ A;  2BE2 A;  1GOB A;  4W5O A;  4G1Q A;  4CJL A;  1SKS A;  1R0A A;  3RTV A;  4N76 A;  2XRI A;  2Y1J A;  1NJW A;  1KFD A;  4N5S A;  3OYB A;  2A1S A;  1X9S A;  3P5J A;  4B9V A;  4FJ8 A;  4EP5 A;  3K5L A;  1TV6 A;  4CFC A;  4O0J A;  1BQN A;  1RIL A;  4AHR A;  3IG1 A;  3WNF A;  3KLF A;  4GW6 A;  5KGW A;  2VG5 A;  5HRP A;  4M3X A;  1TVR A;  4M3R A;  4KAZ A;  4E7K A;  1HNV A;  3MEE A;  1RT1 A;  3HP6 A;  2G8V A;  3I0S A;  4DQS A;  3CQ8 A;  1LW2 A;  1B92 A;  2GBZ A;  1S1W A;  4DTO A;  5E41 A;  1D9F A;  4EZ9 A;  4M3Y A;  1JLC A;  2HVH A;  3RMD A;  3DRS A;  4CF0 A;  4Z4H A;  3ASM A;  4DTS A;  1JXB A;  3V81 A;  3AVI A;  2YKN A;  1ZBL A;  1VSF A;  3NDK A;  3DLE A;  3SV4 A;  2E6M A;  2QXF A;  1T05 A;  3K2P A;  1L5U A;  3NGI A;  4DTU A;  3C6T A;  4CF8 A;  3OJS A;  2VG7 A;  3LP1 A;  4OVL A;  3D45 A;  1RT5 A;  2B4J A;  1ZBU A;  4AHU A;  4E7H A;  5FRO A;  4QOZ B;  4Z4C A;  1NOZ A;  3S3M A;  2IAJ A;  1UAX A;  1IO2 A;  3V1Q A;  2P51 A;  3VQB A;  5I3U A;  3NBP A;  4DTJ A;  2X74 A;  2Z1G A;  3ZT4 A;  1VRT A;  1NJY A;  4NCB A;  4HCC A;  4CFD A;  1A5X A;  4ID5 A;  1I3A A;  3TR8 A;  4E1N A;  3OYI A;  4DS4 A;  5J2Q A;  2YHA A;  5CY4 A;  3A2F A;  4CK3 A;  3OS0 A;  5C25 A;  4M45 A;  3ITH A;  3KTQ A;  2HHU A;  3IS9 A;  5J2M A;  3PX4 A;  1WAJ A;  4RG8 A;  2IDO A;  3AVH A;  4CEZ A;  4CFA A;  3CG7 A;  1FKO A;  4NYN A;  3PUF A;  4AHS A;  4CJU A;  4K8X A;  5HRN A;  1U45 A;  1RT4 A;  2KTQ A;  3KK2 A;  3V9W A;  4KHN A;  1ZBI A;  4CHO A;  2W42 A;  2OPR A;  2YNF A;  3HT3 A;  1S1U A;  2OPS A;  4M41 A;  4FJJ A;  2R7Y A;  1TGO A;  3QEI A;  3NGZ A;  3AVG A;  5HP1 A;  1XC9 A;  4KTQ A;  1QSS A;  4CHP A;  1YTA A;  1T7P A;  3AVJ A;  4EP4 A;  3C95 A;  1LV5 A;  1CXU A;  1CXQ A;  2Z1H A;  2G8H A;  1SUQ A;  2HND A;  4HHT A;  3UIQ A;  2HHQ A;  4KHW A;  1VSL A;  4CGG A;  4CEB A;  4W5R A;  3NH1 A;  5SWM A;  4FM0 A;  2HHT A;  1CLQ A;  1RTH A;  1U47 A;  4PUO A;  2HHX A;  1VSH A;  3LAL A;  4CJP A;  3LAK A;  4J2E A;  4H8K A;  4Z4G A;  3QEW A;  3HPO A;  4DQQ A;  1WSE A;  3L2W A;  4Q0B A;  4CK1 A;  3U3Y A;  4CED A;  1HYZ A;  4FJK A;  4PA1 A;  1RBR A;  5T7B A;  1S9G A;  3NF7 A;  3ZT0 A;  4CES A;  1LWF A;  4KTZ A;  4RW9 A;  4CJQ A;  4CEA A;  4FZX C;  2DFE A;  1SL2 A;  4WE1 A;  4DLG A;  2PY5 A;  2FBY A;  4FCY A;  2GUI A;  1NK5 A;  4FW1 A;  3VQ6 A;  1GOC A;  1TKZ A;  1KRP A;  4CJS A;  3AVB A;  4FXD A;  2XY8 A;  1F21 A;  2G8K A;  4M3Z A;  3AO4 A;  3LP2 A;  4HTU A;  4FJH A;  1FXX A;  4Z4I A;  1L3S A;  4E7L A;  2OPQ A;  1BGX T;  2HNY A;  4ID1 A;  3DOK A;  1FKP A;  1VSM A;  4DSF A;  2XY7 A;  4DG1 A;  1EET A;  1WSF A;  3QER A;  3AVM A;  4DTP A;  2P5O A;  4K8Z A;  3T3F A;  1TAU A;  4FLU A;  2P5G A;  1ASU A;  3CFO A;  4FJN A;  2Y1I A;  4KRF A;  4FLW A;  3VQD A;  5HRO A;  3FFI A;  1WSH A;  1LWC A;  4AIL C;  3HYF A;  4OKJ A;  3ZSX A;  2E4L A;  2RPI A;  5HRS A;  2YNH A;  3EYZ A;  3TAG A;  1NK8 A;  4CHN A;  5SZT A;  5C24 A;  1C1B A;  3V6D A;  1SKW A;  3CFP A;  4C8M A;  2LSN A;  2HVI A;  5FRM A;  3HVT A;  2FC0 A;  3NF6 A;  4C8N A;  3DRR A;  1VSI A;  3SV3 A;  2XY5 A;  3MEC A;  2KZZ A;  4ZHR A;  2GV9 A;  1U4B A;  2KZM A;  4MFB A;  5FDL A;  4LD0 A;  1J54 A;  1JLB A;  4FJ9 A;  4FYD A;  4IFY A;  4ZTJ A;  4FK4 A;  3SI6 A;  3HJF A;  3SPZ A;  3NH0 A;  1S1T A;  2JGU A;  3I8D A;  3MAQ A;  1U04 A;  1KCF A;  4BAC A;  1RBV A;  3P1G A;  1U49 A;  1NKB A;  4KTW A;  1NJX A;  1HMV A;  1W0H A;  3B6P A;  3SYZ A;  3AO2 A;  3SUO A;  1N6Q A;  4NCG A;  4OJR A;  4CIF A;  4HUE A;  1C1C A;  3OYE A;  4DFJ A;  4F2S A;  4CHY A;  3IRX A;  4O5B A;  3SUP A;  4R5P A;  2OZM A;  3HL8 A;  2ZD1 A;  3OS2 A;  4RW7 A;  3QES A;  1BIZ A;  1BCM A;  3AO1 A;  4C8K A;  3O4Q A;  1GOA A;  4IG0 A;  3QIP A;  1UA0 A;  2FBT A;  1NKE A;  4IG3 A;  3M8S A;  4IDK A;  3PX6 A;  3KLE A;  1LAW A;  1RTJ A;  4Y1D A;  3VQA A;  4FVM A;  3L8B A;  4FK0 A;  1VSK A;  2D5R A;  4I7F A;  3KD5 E;  2HNZ A;  1NJZ A;  1CZB A;  3C6U A;  3NAE A;  4BDY A;  3THV A;  2PYJ A;  4DTR A;  3KLI A;  1NKC A;  1JL2 A;  3HM9 A;  2DFH A;  4M42 A;  3OYM A;  3F9K A;  3MEG A; 
#chains in the Genus database with same CATH topology
 1XHX A;  3E9P A;  4OLB A;  3O5B A;  3S3N A;  3RRH A;  3DOL A;  5EY4 A;  1WBB A;  1NK6 A;  4FJ7 A;  4Z0U A;  3ZSZ A;  1TK0 A;  1C0U A;  1WUA A;  2P1J A;  1S6Q A;  1QHA A;  1VQN N;  4C8L A;  3L6Q A;  1DLO A;  1K9M O;  1JKH A;  3BF3 A;  3BF1 A;  3TTF A;  2YJE A;  3LM2 A;  1C0M A;  3AV9 A;  4CHQ A;  4B9M A;  3IKM A;  3HK2 A;  4CGJ A;  1SV5 A;  1QVF M;  4UQG A;  3QIN A;  4FJG A;  1VQP N;  2O8D A;  4CGD A;  1WNS A;  1GLA G;  5J2N A;  1W9H A;  5LMU K;  1TL1 A;  4W5N A;  5F0X A;  2P9I A;  3KK3 A;  1VRU A;  4BR0 A;  1JLA A;  4ISF A;  3O1B A;  4LFB K;  3K5M A;  5CYM A;  1TL3 A;  2HW3 A;  4N56 A;  4L8R B;  2KFZ A;  2QKK A;  1HYS A;  3OJU A;  4KB0 A;  2IC3 A;  2IS3 A;  1GLJ O;  4H0X B;  3O9Q A;  4DU1 A;  4DSK A;  3TAE A;  5AQY A;  1XMQ K;  4G9Z A;  3JXU A;  2JWK A;  1TK8 A;  3J8A A;  5AZI A;  1B9F A;  4RW4 A;  4YFU A;  3TAQ A;  2HMI A;  2O8E B;  4ISE A;  1WBD A;  2GTD A;  4KHQ A;  2QWL A;  2X78 A;  4XH4 A;  1FK9 A;  1QQO A;  1IBL K;  1FW6 A;  3HP9 A;  3AO5 A;  4JI4 K;  5BRD A;  2KW4 A;  3JYT A;  1JLE A;  4BWJ A;  2YJF A;  3DLG A;  4H5W A;  4NLB A;  3WQU A;  2IVN A;  2JLE A;  2P9P A;  4IOA L;  2A5X A;  2Z1J A;  4A5A A;  3CCR N;  4DCH A;  3K58 A;  5AQH A;  3QEP A;  4B1U B;  4XIU A;  1V4S A;  4Y1C A;  4DSI A;  4B9L A;  1D9D A;  2P9K B;  4CZG A;  1KC8 O;  2D0B A;  4CEC A;  2V7Y A;  3E01 A;  4BRO A;  3AVF A;  4H4O A;  3VQ8 A;  3VQ7 A;  2F96 A;  2YCH A;  3DM2 A;  2GEM A;  3OVN A;  4O5F A;  1X9M A;  3DWL A;  2QI2 A;  5FRN A;  1Q9X A;  4CJ4 A;  5GIP A;  1NGB A;  3J7A P;  4FWS A;  2HBJ A;  5C10 A;  4B8A B;  2G8W A;  3CPW M;  4ISG A;  3ZSY A;  3CM5 A;  4CZM A;  3H1V X;  1CZA N;  4OPJ A;  2FBV A;  1IKX A;  3VES A;  1BO5 O;  5FLX O;  3KK7 A;  4IKF A;  4BR2 A;  2Q31 A;  3QET A;  2ITG A;  3CJA A;  1QSL A;  3JS6 A;  1HNI A;  1RCH A;  4B9T A;  2WBN A;  3I55 N;  4KHS A;  1K6Y A;  3D6R A;  1HPZ A;  2VYP A;  4CHZ A;  5KPR A;  2E1Z A;  1ZBH A;  3ZEU A;  3SCX A;  5AQG A;  2ZQB A;  4GVE A;  1VQO N;  2ZE2 A;  1WLJ A;  4L3Q A;  3OYN A;  3MED A;  1IKV A;  4MO4 A;  3V9X A;  2E6L A;  3MXI A;  4FJM A;  5JVH L;  4I6M A;  3BDP A;  1TKD A;  1X3N A;  4CJV A;  3A5O C;  2I7N A;  3PSI A;  2V52 B;  3WNH A;  4BRG A;  1VSD A;  3HM8 A;  2F8T A;  1JXE A;  3OBY A;  4JK7 A;  3ZT2 A;  4FM2 A;  1Q81 O;  1J5E K;  4NLC A;  3LP3 A;  1S1X A;  5EU7 A;  2KFN A;  3M3Z A;  1UA1 A;  1YIT N;  3KLG A;  5GAE P;  4OKE A;  2OZS A;  5MLC Q;  3DRP A;  4E89 A;  4E7I A;  1S6P A;  3MXJ A;  3U9Z A;  2IGI A;  4I9Q A;  1RBS A;  3DLR A;  3VN5 A;  5GAH P;  3KK1 A;  1KLN A;  1ASV A;  3K57 A;  4QCL A;  4LFA K;  2PBD A;  1YIJ N;  4MO5 A;  3WXI A;  2VQE K;  2RF2 A;  3VQQ A;  2B5J A;  4BG8 A;  4JI5 K;  2I7P A;  4PL8 A;  4IFE A;  4I9L A;  3CPE A;  4I2P A;  4JKA A;  3O3G A;  4CER A;  3CCJ N;  3TAN A;  4E7J A;  1JLF A;  3LWM A;  3KWI A;  2O8B A;  3F73 A;  5AQM A;  2QK9 A;  5IWA K;  4LF4 K;  2KLA A;  3CCL N;  3PV8 A;  1RT6 A;  1BUP A;  3SQ1 A;  3FLC O;  2RN2 A;  3G0Z A;  3G10 A;  3SBT A;  4PKI A;  2VQF K;  4DR7 K;  2ATQ A;  4FLY A;  2FF6 A;  3TPQ A;  1XHZ A;  3O9T A;  3AAP A;  4FVU A;  3EL2 A;  1ZC6 A;  2YNI A;  1JL1 A;  3VER A;  1KVA A;  3KKS A;  4YOW A;  5AZJ B;  3O9U A;  3DXM A;  1SQK A;  1KFD A;  4N5S A;  1X9S A;  4FJ8 A;  4O0J A;  1RIL A;  3CCU N;  3KLF A;  4QS8 A;  5HRP A;  3IUC A;  3KWG A;  2E2P A;  4BC2 A;  5GAD P;  1TUU A;  1G99 A;  4IOX A;  1LW2 A;  4DTO A;  3WT0 A;  4EZ9 A;  3DLL L;  4H03 B;  3DRS A;  4CF0 A;  2H3G X;  3J7Y P;  1JXB A;  1DT9 A;  1YHQ N;  3NDK A;  3DLE A;  3SV4 A;  2E6M A;  2V51 B;  2E88 A;  4FWQ A;  1T05 A;  3QFU A;  3C6T A;  4B1V A;  3LP1 A;  5ADX A;  4OVL A;  4BQL A;  3VF4 A;  5AQJ A;  1UAX A;  3O4W A;  5I3U A;  4WYB A;  1HNZ K;  1NJY A;  2WTU A;  3H3N O;  4B1X B;  4ID5 A;  3OYI A;  4E1N A;  2GEL A;  3OS0 A;  5C25 A;  3GE1 A;  4H5T A;  5J2M A;  4LF8 K;  3PX4 A;  2NRX A;  4O8K A;  1WAJ A;  4RG8 A;  3K0S A;  3GG4 A;  3AVH A;  3E9L A;  5M1F A;  1E3M A;  4NYN A;  3U9D A;  3KK2 A;  4KHN A;  2W42 A;  2YNF A;  3HT3 A;  1S1U A;  4WCE L;  4BY9 C;  1IBM K;  3AVG A;  1XC9 A;  5FPE A;  1N8R O;  1YTA A;  3AVJ A;  4EP4 A;  3THW B;  3SJH A;  1CXU A;  2HND A;  3R1X A;  2YHY A;  3A5L C;  2HHT A;  3LAK A;  2HST A;  4CZH A;  2CH5 A;  4CED A;  1RBR A;  4C1N K;  4H0T B;  1LWF A;  4CJQ A;  3DJC A;  4CEA A;  4FZX C;  5ELZ A;  4DLG A;  2PY5 A;  3F5T A;  2GUI A;  1TKZ A;  3KHY A;  2UYT A;  4CJS A;  3AVB A;  5KQD A;  1XNQ K;  4M3Z A;  3TSQ A;  3HBT A;  3S41 A;  4FJH A;  1BGX T;  4BVO A;  4DG1 A;  2PAV A;  4K8Z A;  5M1K A;  3QML A;  4FLU A;  4KRF A;  5HRO A;  3VQD A;  3I33 A;  3RSE B;  3IMX A;  2VWB A;  1WSH A;  4PL7 A;  4YOR A;  3HYF A;  2AP1 A;  5BR8 K;  3ZSX A;  2E4L A;  4DR5 K;  5CE3 A;  2P9I B;  4CHN A;  1WOQ A;  2W41 A;  5C24 A;  3HTV A;  3K9K A;  1SKW A;  5GAG P;  4FOE A;  2LSN A;  1EWQ A;  3HVT A;  3CER A;  2Q97 A;  3NF6 A;  4IDH A;  1VSI A;  4BG9 A;  2XY5 A;  3MEC A;  2KZZ A;  4FJ9 A;  4AF1 A;  3NH0 A;  1Z6R A;  4FWL A;  1U04 A;  3B8A X;  5AQW A;  1NKB A;  3THY A;  2ZGZ A;  4YOU A;  3OA9 A;  1W0H A;  3B6P A;  1R59 O;  2FSK A;  1N6Q A;  2HMP A;  5AZI B;  4O5B A;  5M1N A;  1HNX K;  2F9T A;  1W2B M;  1BIZ A;  1BCM A;  4C8K A;  4IZ9 A;  1UA0 A;  2FBT A;  5B8H A;  4IG3 A;  3M8S A;  1RTJ A;  1CZB A;  3GOI A;  4JKD A;  3KLI A;  1JL2 A;  1MDU B;  4M42 A;  2P9P B;  4FJI A;  1GLE G;  4OGC A;  1VK0 A;  4RCH A;  3SNN A;  1Q7Y O;  3L3U A;  4WQ4 C;  1KTQ A;  2FSN A;  5CZ1 A;  4FWO A;  1EO1 A;  1MU2 A;  3HZ6 A;  4HCB A;  4XH5 A;  4NO7 A;  4KB1 A;  1XI1 A;  4CEF A;  5DM7 L;  2IVP A;  3BP8 A;  3ULE A;  1TAQ A;  4JKH A;  4DU4 A;  4BDP A;  2BDP A;  4CE9 A;  4CEO A;  3T1H K;  3CM6 A;  3AVL A;  3L4Q A;  4ELT A;  1QS4 A;  4CGI A;  4A5B A;  3IDH A;  4JI0 K;  3DLB A;  2OPP A;  3VGL A;  4ILG B;  1N33 K;  3CJ7 A;  3HVR A;  1OVY A;  3CC2 N;  1VQ8 N;  4F9O A;  1RT7 A;  1NK9 A;  2HHW A;  4WFA L;  3BUZ B;  3RVC A;  3L4I A;  1XWL A;  4KI4 A;  5GIN A;  1YJ9 N;  2NRZ A;  3EO3 A;  4M3U A;  3DYA A;  4IOC L;  5HBM A;  2RHK A;  1IKW A;  4IFV A;  1KQS M;  3QEV A;  1ITG A;  4EZ6 A;  5HL7 L;  4XEI A;  3ZEU B;  4FZZ A;  4BRI A;  1QE1 A;  2ASP A;  1VQ9 N;  1KD1 O;  3NE6 A;  5KRT A;  1S22 A;  2UUA K;  2RKI A;  5I42 A;  1HQE A;  2ETJ A;  3I0R A;  1S9E A;  4BRD A;  1T03 A;  1HKC A;  2NRV A;  4I6M B;  4E0D A;  1SL1 A;  3MN6 A;  4B8C A;  3OYG A;  2YI1 A;  3EEQ A;  3FE1 A;  4BC4 A;  4ILJ A;  1C0G A;  1MWK A;  3CYM A;  3VF2 A;  5AQU A;  2FSJ A;  4AQY K;  3DLK A;  4PKH A;  4CGH A;  3OYH A;  1QQN A;  5AQL A;  2CGJ A;  3L3V A;  3CJC A;  2DFF A;  4F3O A;  4PQU A;  1VSJ A;  1JLG A;  2QWR A;  3AA4 A;  2G8U A;  1T6C A;  5JVG L;  2O4I A;  4BRP A;  2VWJ A;  1IJJ A;  1NGE A;  2CGK A;  3SAF A;  3HRG A;  5LL6 Z;  2YKM A;  3WNE A;  5KTQ A;  3CCQ N;  4I2Q A;  3CF5 L;  1EWR A;  4DV4 K;  3EY1 A;  4FLV A;  1KVB A;  3IFR A;  1NK7 A;  2NRW A;  4B1Y B;  1DTT A;  5BN8 A;  4JKB A;  5JS2 A;  2I5J A;  3V1R A;  3H45 C;  3V4I A;  3I8B A;  4DR2 K;  3M8P A;  3P83 D;  3AVN A;  3TAB A;  3B6O A;  3NVK A;  2FXU A;  4WQ5 C;  5J2P A;  2O8B B;  1HKB A;  3T1A A;  1X9W A;  2Z1I A;  4DU3 A;  2HB5 A;  4GV6 A;  1VQK N;  1NK4 A;  4LF7 K;  3PO4 A;  3HPH A;  1I39 A;  4CJ3 A;  3SUN A;  3K5O A;  1VAZ A;  3WNG A;  4O55 A;  1Q9Y A;  1WB9 A;  1YVU A;  1HPM A;  3M8R A;  2DTU A;  3NHG A;  1QSY A;  4RWT A;  4Z4E A;  3O3H A;  2VCP A;  3AAQ A;  4XH1 A;  3OYK A;  1H1V A;  3VQ4 A;  3LZJ A;  1VQ7 N;  2WOM A;  3MN9 A;  3K5N A;  3DXM B;  3RSE A;  3ZET A;  1KAX A;  3THX A;  2X6S A;  1ZXO A;  1BIS A;  4DFP A;  1ATN A;  1VSE A;  2HBM A;  4DSL A;  4BE2 A;  3QFP A;  3MX2 A;  3WEE A;  4JNE A;  2AJQ A;  3VQC A;  1O13 A;  3BY5 A;  3S3O A;  3MN5 A;  5H1S Q;  3RWU A;  3W0L A;  1WN7 A;  3ZT3 A;  3AO3 A;  2CH6 A;  4DR3 K;  1BI4 A;  1HQU A;  4JYA K;  1JCG A;  3QLH A;  4YDU C;  3T19 A;  1BQM A;  3T69 A;  4B3R K;  3GL1 A;  3TAP A;  3NF8 A;  1NMD A;  3NGY A;  1NU0 A;  4GV3 A;  5BRH A;  3QIC A;  2YHB A;  3K59 A;  4O44 A;  2KQ2 A;  3DXK A;  1RDC A;  4DR1 K;  3RRG A;  1GLB G;  3LM9 A;  2KHO A;  1OH8 A;  3KLH A;  4F2R A;  3V9U A;  3ISN C;  1J5O A;  4JRQ A;  3LDQ A;  4ICL A;  5LMN K;  1NWK A;  4JI6 K;  4V19 S;  3TAR A;  4DV1 K;  3SQ4 A;  4DTM A;  2IOC A;  1IH7 A;  3EE9 A;  5KRS A;  4W5Q A;  2AA4 A;  3LWL A;  3N4Q A;  3MWT A;  4MDA A;  3PY8 A;  5CYQ A;  3FGU A;  4K41 A;  4KKO A;  4CF9 A;  4DLE A;  4FSV A;  4WFN L;  2ITM A;  1N36 K;  1YTU A;  4OO1 J;  4A59 A;  5JMV A;  4DF8 A;  3KJV A;  3KKR A;  2NRR A;  2EWS A;  1GOB A;  3ZLJ A;  4NXN K;  1R0A A;  3RTV A;  2XRI A;  2Y1J A;  1NJW A;  2DPN A;  3OYB A;  2A1S A;  1TV6 A;  4CFC A;  1NGD A;  3HSC A;  3IG1 A;  2UU9 K;  3C7N B;  4UY8 O;  3ZX0 A;  1K8K A;  1TVR A;  4M3R A;  4CI6 A;  5LY3 A;  4E7K A;  1U2V A;  3MEE A;  1RT1 A;  5AQQ A;  3I0S A;  3ENO A;  1B92 A;  3DAW A;  2HVH A;  3T7Z A;  3ASM A;  3AVI A;  2YKN A;  1YVN A;  2QXF A;  1NGJ A;  1L5U A;  3NGI A;  3E66 A;  4DTU A;  3NVM A;  4CF8 A;  2HBK A;  3D45 A;  2B4J A;  1ZBU A;  3E1Y A;  4E1J A;  5BRE A;  1P90 A;  4Z4C A;  4BRA A;  4JKG B;  1NOZ A;  3G71 N;  3VQB A;  1IO2 A;  4YOT A;  3NBP A;  5AJ3 K;  2Z1G A;  3ZT4 A;  1VRT A;  1BWF O;  2UXD K;  2E5L K;  4GKJ K;  1A5X A;  4DKW A;  5C12 A;  2HHU A;  5AQS A;  1T6D A;  2QM1 A;  4BRF A;  4H5R A;  4CEZ A;  4CFA A;  3CG7 A;  3THY B;  3C0B A;  3H6E A;  1TUY A;  4CJU A;  3QBW A;  2KTQ A;  4CHO A;  2D0P A;  4BGB A;  5AQX A;  5AR0 A;  2QWQ A;  3SLC A;  1TGO A;  3WUH A;  4CHP A;  4IXC A;  3C95 A;  1CXQ A;  2Z1H A;  5GIO A;  1SUQ A;  2G8H A;  3UIQ A;  4KHW A;  4QS9 A;  5AQP A;  2ZF5 O;  1CLQ A;  2YHW A;  1U47 A;  2HHX A;  3BZK A;  4J2E A;  4BR4 A;  3P31 A;  4FWP A;  2UXB K;  1HYZ A;  5T7B A;  4FPB A;  3NF7 A;  5KPZ A;  4KTZ A;  1JCF A;  3CXC M;  3O6W A;  4WE1 A;  4LF9 K;  2FBY A;  1RFQ A;  3OBW A;  1QQM A;  1X9J A;  2XY8 A;  3ULE B;  2G8K A;  5AQV A;  2E2N A;  4OPA A;  5FPM A;  4JV5 K;  2Q0R A;  1FXX A;  2HNY A;  2Q2R A;  4ID1 A;  1VSM A;  3QER A;  3AVM A;  3T3F A;  2P5G A;  3CFO A;  3WXL A;  1ATR A;  4BRE A;  4AIL C;  2GWJ A;  1NGC A;  2A40 A;  4BGA A;  4X65 K;  5LJV A;  2IVO A;  1ILY A;  5HRS A;  2YNH A;  3TAG A;  4A62 A;  1NK8 A;  4YY3 K;  4JKC A;  3CHW A;  3KVG A;  3M1F A;  3EE8 A;  3VEY A;  4FOI A;  5HOO A;  1ATS A;  2GV9 A;  1U4B A;  4MFB A;  5FDL A;  3D2F A;  3TSU A;  4GKK K;  3VEO A;  4ZTJ A;  3D7E O;  4FK4 A;  3SI6 A;  4BR5 A;  2JWL A;  3I8D A;  3P1G A;  4KTW A;  5EOY A;  1HMV A;  3VET A;  3AO2 A;  3OYE A;  4CHY A;  4R5P A;  3HL8 A;  3FR0 A;  4PKG A;  3QIP A;  2W40 A;  1C0F A;  4JHD A;  4FK0 A;  4Y1D A;  4FVM A;  1TYQ A;  2O8F A;  3C6U A;  3FZK A;  3NAE A;  4BDY A;  4DTR A;  1IG8 A;  3OYM A;  3F9K A;  4CCH A;  3MEG A;  3HPG A;  5JIC A;  4F3T A;  4AHC A;  3TWH A;  4W5T A;  5AQZ A;  4CJ5 A;  3N4P A;  4DR6 K;  4RW6 A;  4ZTF A;  5E26 A;  1KXP A;  5CHI A;  4C23 A;  3UKU B;  3VA3 A;  3VTI A;  4KHU A;  1G15 A;  3WXM B;  1WSG A;  2WC9 A;  3SZ2 A;  2OTL N;  3SPY A;  1SS6 A;  3TAM A;  1NGF A;  1SAZ A;  3AGR A;  2GWK A;  5BN9 A;  1A5W A;  4M7Y A;  4DV6 K;  4KO0 A;  3R8E A;  4DS5 A;  4AHV A;  4CFB A;  3MXM A;  2NRT A;  3LDN A;  3ZSV A;  1Q82 O;  1BOT O;  4DV5 K;  3L2Q A;  1NMN A;  1HJO A;  4IEE A;  1KLM A;  4FWK A;  4Z4F A;  3G4S N;  4FLZ A;  3CC7 N;  4CW7 B;  3WQT A;  4B9Q A;  2Q3S A;  1XMO K;  4M3W A;  4E1M A;  3MX5 A;  4DTX A;  3M6G A;  3C7N A;  1LWE A;  4IO8 A;  3SQ0 A;  3AA5 X;  1WAF A;  2P9N A;  4HVJ A;  3VF6 A;  4ELV A;  5E84 A;  4KFB A;  1NGH A;  5BPM A;  4BC3 A;  4JS5 A;  3DI6 A;  3VQP A;  4CBW A;  1OKJ A;  4A61 A;  4M3T A;  5A2Q O;  3H3O B;  3ZET B;  1ZYQ A;  1RNH A;  3VQ9 A;  3THX B;  1ZBS A;  4CEQ A;  3OYD A;  2Q36 A;  4CEE A;  3MWP A;  4O0I A;  4KPY A;  1W97 L;  4JKG A;  3WEE B;  1HKG A;  3QDK A;  1KAY A;  2X6N A;  1DTQ A;  1Y97 A;  3NF9 A;  1UWB A;  1KFS A;  1TKT A;  1XUP O;  2QTD A;  3U3G A;  4OGE A;  1KSP A;  1V4T A;  4RTF D;  5F1X A;  3RMB A;  4JK8 A;  1BI4 B;  2XY6 A;  2F8S A;  5CR4 A;  4JRP A;  2A42 A;  2WFB A;  1BG3 A;  1YUW A;  5C42 A;  2BUP A;  2E2Q A;  1A5V A;  2O4G A;  4IEI A;  2B6A A;  1BU6 O;  3AA2 A;  3CQX A;  4M7X A;  3QNN A;  1NGI A;  3DXK B;  1VQ5 N;  2EX3 A;  1XQS C;  5M1O A;  3ZCM A;  4KHY A;  4N47 A;  3ZSQ A;  4FW2 A;  1S1V A;  1HJR A;  3O1W A;  4WQ4 A;  1Q8I A;  4CIG A;  1W7A A;  3OYJ A;  4YHH K;  2YNG A;  3SQ2 A;  3EZ5 A;  1SZ2 A;  4IBN A;  1RDU A;  3G6E N;  3D2E A;  1GLF O;  3GDQ A;  3OY9 A;  3DLH A;  2E2O A;  4B3O A;  1ESV A;  4IJA A;  5FPD A;  1NK0 A;  4E19 A;  5AQR A;  4K43 A;  1U48 A;  3ZT1 A;  1L3V A;  3RR8 A;  4TSX A;  3ENB A;  3CFR A;  1L3T A;  4FZY A;  5AQF A;  4FWM A;  3H46 O;  3QB0 A;  3J7Z O;  4DQP A;  3SBG A;  3LAM A;  3QO9 A;  1YF5 L;  3O3F A;  2P9L B;  1MA9 B;  2E8A A;  3M8Q A;  4CF1 A;  4DWI A;  1I94 K;  4DR4 K;  1BIU A;  2VG6 A;  4FM1 A;  2QW9 A;  1NM1 A;  4N41 A;  3TI0 A;  4AM7 A;  3C6A A;  4C8O A;  3O8M A;  1FJG K;  4FWN A;  2D0C A;  3ATV A;  3HOS A;  3RR7 A;  1XNR K;  1K8K B;  2HHH K;  1U2V B;  4OKK A;  3RMA A;  5AFU A;  3AAR A;  4CJR A;  2ZGY A;  3ZSO A;  1OH7 A;  1EX4 A;  3MDQ A;  4DMN A;  4Q5V A;  1N32 K;  3CI5 A;  4CZJ A;  1T3V A;  5KI6 A;  2FBX A;  2YHX A;  3OYC A;  2GUP A;  3NH2 A;  1IKY A;  1X3M A;  3OYA A;  4BWM A;  2D4W A;  5CZ2 A;  3V9S A;  1RTI A;  3LZI A;  5TKY A;  3CC4 N;  4AHT A;  5M1Q A;  4DQR A;  2QKB A;  1VQM N;  3UKR A;  3ULD A;  2HHS A;  2YV0 X;  3ENH A;  3C6H A;  4FK2 A;  3C94 A;  2BAN A;  2HF4 A;  4BRC A;  3KIO A;  4NCA A;  3D0P A;  4EHU A;  1EP4 A;  1CZ9 A;  5AQK A;  4Y0W A;  1IG9 A;  1VQ4 N;  3OYF A;  2ASO A;  2VWK A;  4FJL A;  2IIR A;  2PZS A;  3LP0 A;  1HX1 A;  4GMJ B;  4B9S A;  3L2U A;  3BEX A;  2G8F A;  5EXW A;  3VQ5 A;  4CJT A;  3UKU A;  1YJW N;  1J9A A;  3VA0 A;  5BPL A;  5TKW A;  2ZM6 K;  4H4M A;  1DEJ A;  4WQ5 A;  1S5J A;  4NYF A;  2D0A A;  2WON A;  3DMJ A;  3ID6 A;  1OVQ A;  3ZX2 A;  3O08 A;  4W5O A;  4CJL A;  1SKS A;  4CZE A;  4B9V A;  4LF5 K;  4EP5 A;  1E4G T;  3WXJ A;  1BQN A;  4AHR A;  3OW2 M;  5KGW A;  4HTL A;  1HNV A;  2G8V A;  4DQS A;  2GBZ A;  1D9F A;  1S1W A;  5E41 A;  3WXK A;  2P9U B;  3RMD A;  1KAZ A;  3A5N C;  4Z4H A;  3PLA A;  3F9M A;  2W6L A;  3V81 A;  1RDW X;  2HF3 A;  1VSF A;  2A41 A;  1RT5 A;  4M63 C;  4E7H A;  2OTJ N;  5FRO A;  4QOZ B;  4B3M K;  3S3M A;  3V1Q A;  4KH4 A;  2X74 A;  5AQN A;  4JD2 A;  3J81 O;  4CFD A;  1LOT B;  4KHP K;  3FFK B;  3TR8 A;  4DS4 A;  2YHA A;  5CY4 A;  3D2F B;  3A2F A;  4FL9 A;  3ITH A;  5FPN A;  3KTQ A;  3IS9 A;  3EKS A;  2O8C A;  1EQY A;  1YJN N;  4YDU A;  3PUF A;  2UXC K;  4K8X A;  3V9W A;  2QWO A;  3MK6 A;  3QBX A;  2OPR A;  4H0Y B;  1S3X A;  2R7Y A;  4KTQ A;  3QEI A;  3NGZ A;  2QWN A;  1QSS A;  2FLO A;  5AQI A;  1T7P A;  4JI3 K;  1LV5 A;  3P39 A;  4JHD B;  3O9R A;  4CGG A;  3PIP L;  4CEB A;  1TYQ B;  2O8F B;  1BA1 A;  5F2R A;  4FM0 A;  1RTH A;  1VHX A;  4PUO A;  1VSH A;  3L0Q A;  4H8K A;  3TTC A;  4X66 K;  3HPO A;  3QEW A;  4LFC K;  1WSE A;  4CK1 A;  3U3Y A;  3MMV A;  2F4V K;  2VGM A;  3LDL A;  3ZT0 A;  4CES A;  5ADX H;  3P38 A;  4RW9 A;  1Z05 A;  2F7T A;  1SL2 A;  4FCY A;  4C1N I;  1GOC A;  2GX9 A;  4FXD A;  4K42 A;  3AO4 A;  3LP2 A;  4Z4I A;  1L3S A;  5LJW A;  2OPQ A;  4IWV A;  2P5O A;  4H0O A;  4DTP A;  3NMU A;  4H0P A;  1VQL N;  2NLX A;  3VEX A;  1ASU A;  1NGG A;  3VOV A;  1LWC A;  2A3Z A;  4OKJ A;  2RPI A;  4CBX A;  4LC9 B;  1C1B A;  4CZL A;  2P9L A;  1IBK K;  3V6D A;  4C8M A;  1BDG A;  2HVI A;  5FRM A;  3FZH A;  2FC0 A;  4H0V B;  3SV3 A;  2UUC K;  4FYD A;  3O80 A;  1J54 A;  4LD0 A;  4IFY A;  3HJF A;  3SPZ A;  3MCP A;  1S1T A;  3MAQ A;  5EVZ A;  1KCF A;  2J4R A;  1RBV A;  4BAC A;  1U49 A;  4BRK A;  4H5N A;  1NJX A;  4WF9 L;  2P9N B;  3SUO A;  4OJR A;  4CIF A;  3U8X A;  1C1C A;  4HUE A;  4DFJ A;  3CCS N;  3AO1 A;  3O4Q A;  1GOA A;  3EN9 A;  4IG0 A;  2WUS A;  3ATU A;  5BR9 A;  1RGI A;  4IDK A;  3PX6 A;  3VQA A;  4EFH A;  1VSK A;  2Q0U A;  2PYJ A;  3L2R A;  3NFA A;  1NLV A;  4KH6 A;  4FJ5 A;  3FZL A;  4CJW A;  1Z25 A;  5DK5 A;  1C6V A;  2QXL A;  1ZBF A;  1JCE A;  3UB5 A;  1TKX A;  4CD3 A;  4E3S A;  3AA3 A;  4ILH A;  1RDB A;  1RT3 A;  4GNI A;  5KQ8 A;  4NXM K;  2OA8 A;  1HRH A;  1LAV A;  1IV0 A;  1QZ6 A;  3SJJ A;  4PY5 A;  4CJ7 A;  4BE1 A;  2P9S A;  4CZI A;  3PX0 A;  4JLH A;  1O1W A;  2PFU A;  5KGX A;  2XO7 A;  4CBU A;  1RBU A;  1EXQ A;  1B9D A;  3H08 A;  4LSN A;  4MLE A;  1GLC G;  1N5Y A;  4BC5 A;  4JKF A;  4KI6 A;  1K73 O;  4QS7 A;  3D2E B;  1UOC A;  5D3G A;  4DB3 A;  1ASW A;  4RW8 A;  5C0Y A;  1YI2 N;  3G25 A;  2HOE A;  5I9E B;  2W6K A;  4DQI A;  1E4F T;  4DQ8 A;  3LPT A;  1T8E A;  1DKG D;  3ZSW A;  4LY7 A;  1C1A A;  4DSJ A;  1GLL O;  3A5M C;  3CJ1 A;  1NNE A;  1Z26 A;  3SUQ A;  3HXM A;  3ZYY X;  2P9U A;  4DFK A;  4BRH A;  1VQ6 N;  4J8F A;  2QA4 N;  4CK2 A;  1D4X A;  3SMP A;  3VGK A;  2YX6 A;  2FF3 B;  4CVN E;  5IT9 O;  3CJ9 A;  5KPT A;  3VEN A;  1JLQ A;  4YOY A;  4HUG A;  1S72 N;  4JS4 A;  3OYL A;  4LSL A;  1BA0 A;  2CGL A;  4CF2 A;  3O4N A;  3JSM A;  1GLD G;  5DMR A;  3AVK A;  4QAG A;  3V1O A;  1YT3 A;  4CZK A;  3LPU A;  3ID8 A;  2QEX N;  1Q18 A;  2E1Y A;  2BTF A;  4KRE A;  4DTN A;  1HYV A;  4DFM A;  3LAN A;  3Q7B A;  1QHT A;  4CIE A;  4LF6 K;  5AFU H;  2VGN A;  4OLA A;  3NCI A;  4CJF A;  5JS1 A;  3R9P A;  1SL0 A;  2NRH A;  3CET A;  3L2V A;  1HR0 K;  3R3L A;  4BRN A;  5HLF A;  4J2A A;  3HO1 A;  2ZJP L;  4U7B A;  1EKE A;  1REV A;  4AH9 A;  3V9Z A;  3ALY A;  3HST B;  3JAM O;  2QWP A;  4CD1 A;  1P8Z A;  3F2K A;  4IO9 L;  3C65 A;  1RT2 A;  2HBL A;  1QVG M;  3LDP A;  4B9U A;  1C0T A;  4Z94 A;  4B3S K;  3UKR B;  4BRM A;  1KVC A;  3LDS A;  1D8Y A;  4LH4 A;  3MN7 A;  1DGK N;  3VEZ A;  4B08 A;  2PYL A;  4DV0 K;  4DF4 A;  3SMS A;  2NUB A;  3U4L A;  3R6M A;  1N34 K;  1RDD A;  3W3D A;  2HHQ A;  4BR9 A;  2HHV A;  1J53 A;  3CCE N;  1NOY A;  3CIP A;  4A2B A;  3UE5 A;  3EKU A;  3KD1 E;  1NBW A;  1QZ5 A;  1NGA A;  2O8E A;  3RMC A;  1NG9 A;  3SAG A;  4J2D A;  1RTD A;  4HUF A;  1Q86 O;  1TK5 A;  1LW0 A;  2DY4 A;  1SKR A;  1K8A O;  3AVA A;  4CJE A;  4ELU A;  3ZX3 A;  5BPN A;  4GVM A;  2G8I A;  3SK3 A;  4OPK A;  4IJN A;  5AQO A;  4DSE A;  4FLX A;  4B3T K;  5C2F A;  2OAN A;  4A2A A;  3CCV N;  3CCM N;  5HRR A;  4K0K K;  4EHT A;  3AY9 A;  4FLT A;  1X1P A;  5K14 A;  1WSI A;  3TSP A;  5J1E A;  4X64 K;  4JEP A;  2BGG A;  3VEV A;  4YNQ A;  4BDZ A;  1RBT A;  2P9K A;  3CD6 N;  1OH6 A;  3QEX A;  4F8R A;  4BE0 A;  3PO5 A;  2A6A A;  4PHT X;  2QWM A;  3ZSR A;  3QIO A;  4KV8 A;  4JKE A;  1L3U A;  2ZWH A;  4O4G A;  3TAF A;  3M5R A;  4JD2 B;  4JK9 A;  4CJK A;  4B1Z A;  4MDB A;  4B1W B;  1D5A A;  1LCU A;  2XHB A;  3S9H A;  4LH5 A;  4O8U A;  3MCA B;  4CZF A;  5C15 A;  1BL3 A;  4FJX A;  2O8C B;  1YAG A;  4MLH A;  3QNO A;  2OYQ A;  2NNW A;  4PWD A;  3TU5 A;  1RDA A;  4FPA A;  3U6F A;  2E20 A;  3AVC A;  2A1R A;  1BCO A;  3VEW A;  4CGF A;  3Q7C A;  1WSJ A;  3BGR A;  4B9N A;  4OX9 K;  1QQC A;  1MWM A;  1QTM A;  3K9J A;  1M1K O;  3IAY A;  2O8D B;  2NZT A;  4OPH A;  3OS1 A;  3HOT A;  4J2B A;  1YXQ A;  3AGK A;  2EHG A;  4F4K A;  4MQ3 A;  3VQE A;  4DV7 K;  1BHL A;  2BE2 A;  4G1Q A;  4DHY A;  4N76 A;  4DV2 K;  3P5J A;  3K5L A;  1OH5 A;  3WNF A;  4GW6 A;  2KKZ A;  2VG5 A;  4M3X A;  4KAZ A;  3O9S A;  3HP6 A;  4FWR A;  3CQ8 A;  4M3Y A;  1JLC A;  2BH1 A;  5BRF A;  1J6Z A;  3I56 N;  4DTS A;  4NB4 A;  3EZW A;  1ZBL A;  2ASM A;  3P4I A;  4GY2 B;  3K2P A;  3VTH A;  3OJS A;  2VG7 A;  5JLF A;  4AHU A;  3J80 O;  3H1Q A;  4K25 A;  5JLH A;  5DM6 L;  3PIO L;  2IAJ A;  2P51 A;  4X62 K;  4DTJ A;  5M1P A;  3BZC A;  4NCB A;  2RE2 A;  4HCC A;  1HLU A;  3VPZ A;  1I3A A;  5J2Q A;  2ZJR L;  4JI8 K;  4CK3 A;  2UUB K;  4M45 A;  1JJ2 M;  2IDO A;  4JN4 A;  1FKO A;  4AHS A;  3LDO A;  3T1Y K;  5HRN A;  1U45 A;  1RT4 A;  4KH5 A;  2ZJQ L;  1ZBI A;  4FO0 A;  2F9W A;  1HUX A;  2OPS A;  1T44 A;  4M41 A;  4BVP A;  4FJJ A;  5HP1 A;  4YOV A;  2D0O A;  4GV9 A;  1XC3 A;  4HHT A;  1VSL A;  4HWI A;  4W5R A;  3NH1 A;  4EIA A;  5SWM A;  2D1K A;  3LAL A;  4CJP A;  4Z4G A;  3PSF A;  5AZJ A;  4DV3 K;  4DQQ A;  3A0I X;  3L2W A;  3VGM A;  4Q0B A;  2OCE A;  1Y64 A;  4FJK A;  4PA1 A;  1S9G A;  2DFE A;  4AM6 A;  1HNW K;  4JI2 K;  1NK5 A;  4FW1 A;  3VQ6 A;  1KRP A;  5C2D A;  5EX5 A;  3HI0 A;  3FZF A;  4YOX A;  4R79 A;  1U6Z A;  1F21 A;  3CMA N;  4HTU A;  4BRL A;  4BQZ A;  4E7L A;  3DOK A;  1FKP A;  4DSF A;  2XY7 A;  1EET A;  1WSF A;  1TAU A;  4EAH D;  3CJB A;  1NJI O;  4FJN A;  2P9S B;  2Y1I A;  4FLW A;  3CME N;  4H5V A;  3GBT A;  3FFI A;  4WFB L;  2V7Z A;  3KZB A;  3EYZ A;  3CQY A;  5SZT A;  3CFP A;  4JAX A;  3LL3 A;  4A57 A;  3TTD A;  4BRQ A;  4C8N A;  3DRR A;  4JI7 K;  4DUY K;  4ZHR A;  2KZM A;  1JLB A;  5AQT A;  4KBO A;  3SAH A;  2JGU A;  1M90 O;  3OTO K;  3A8Y A;  3FZM A;  3E9O A;  4DUZ K;  3SYZ A;  4NCG A;  4F2S A;  3IRX A;  3SUP A;  4BR7 A;  2OZM A;  2ZD1 A;  3VMF B;  3OS2 A;  4RW7 A;  2Q1N A;  3QES A;  3THW A;  1NKE A;  3KLE A;  3OHR A;  1LAW A;  4U67 L;  3L8B A;  2D5R A;  4I7F A;  4JI1 K;  3KD5 E;  2HNZ A;  1NJZ A;  3THV A;  1NKC A;  3HM9 A;  2DFH A; 
#chains in the Genus database with same CATH homology
 1XHX A;  4FJI A;  3L2R A;  3HPG A;  4OLB A;  3NFA A;  4OGC A;  1VK0 A;  4FJ5 A;  4F3T A;  4AHC A;  3TWH A;  4W5T A;  3SNN A;  3S3N A;  4CJ5 A;  3RRH A;  3DOL A;  3L3U A;  4CJW A;  1KTQ A;  4RW6 A;  1Z25 A;  5CZ1 A;  5DK5 A;  1C6V A;  1NK6 A;  1MU2 A;  4ZTF A;  4HCB A;  1ZBF A;  4FJ7 A;  4Z0U A;  4KB1 A;  3ZSZ A;  1TKX A;  4CEF A;  1XI1 A;  1TK0 A;  1C0U A;  4E3S A;  3AA3 A;  2P1J A;  1S6Q A;  1TAQ A;  1RDB A;  4C8L A;  1RT3 A;  3VA3 A;  1DLO A;  4DU4 A;  4BDP A;  1JKH A;  4KHU A;  2BDP A;  1G15 A;  2OA8 A;  4CE9 A;  4CEO A;  1HRH A;  1WSG A;  3CM6 A;  3SZ2 A;  1LAV A;  3AVL A;  1C0M A;  3AV9 A;  4CHQ A;  3SPY A;  3SJJ A;  1QS4 A;  4B9M A;  4CGI A;  3TAM A;  4ELT A;  3HK2 A;  4CGJ A;  4PY5 A;  1SV5 A;  4BE1 A;  4UQG A;  3DLB A;  2OPP A;  3PX0 A;  3QIN A;  1A5W A;  4FJG A;  4JLH A;  1O1W A;  3HVR A;  4KO0 A;  4DS5 A;  3MXM A;  4AHV A;  1WNS A;  4CGD A;  4CFB A;  5KGX A;  2XO7 A;  1RBU A;  1W9H A;  1EXQ A;  5J2N A;  3ZSV A;  1RT7 A;  1TL1 A;  4W5N A;  1B9D A;  3KK3 A;  1NK9 A;  1VRU A;  3H08 A;  4LSN A;  3L2Q A;  2HHW A;  1JLA A;  1N5Y A;  4KI6 A;  3K5M A;  5CYM A;  1KLM A;  1XWL A;  1TL3 A;  4Z4F A;  1UOC A;  4KI4 A;  5D3G A;  2HW3 A;  1ASW A;  4RW8 A;  4N56 A;  4L8R B;  2KFZ A;  4FLZ A;  2QKK A;  4M3U A;  3DYA A;  1HYS A;  5HBM A;  3OJU A;  2IC3 A;  2IS3 A;  4KB0 A;  4DU1 A;  1IKW A;  2Q3S A;  4DSK A;  4DQI A;  4M3W A;  4E1M A;  3TAE A;  4IFV A;  3QEV A;  1ITG A;  3LPT A;  4DTX A;  1T8E A;  4EZ6 A;  3ZSW A;  4LY7 A;  1C1A A;  4DSJ A;  1LWE A;  4FZZ A;  3SQ0 A;  1QE1 A;  3AA5 X;  1WAF A;  1TK8 A;  3NE6 A;  5KRT A;  1Z26 A;  4HVJ A;  4ELV A;  2RKI A;  1B9F A;  4KFB A;  3SUQ A;  5I42 A;  1HQE A;  4RW4 A;  3HXM A;  2ETJ A;  4YFU A;  3TAQ A;  2HMI A;  4JS5 A;  3I0R A;  1S9E A;  1T03 A;  3DI6 A;  4E0D A;  4KHQ A;  4DFK A;  3VQP A;  2X78 A;  1SL1 A;  4CK2 A;  1FK9 A;  4B8C A;  3OYG A;  4M3T A;  1JLQ A;  1ZYQ A;  1RNH A;  3VQ9 A;  4HUG A;  3HP9 A;  3AO5 A;  4JS4 A;  2KW4 A;  4CEQ A;  3JYT A;  3OYD A;  1JLE A;  4LSL A;  3OYL A;  4BWJ A;  3DLG A;  4CF2 A;  3O4N A;  4CEE A;  3CYM A;  3JSM A;  4O0I A;  2JLE A;  5DMR A;  4KPY A;  3AVK A;  3DLK A;  4QAG A;  4CGH A;  3V1O A;  2X6N A;  1DTQ A;  1Y97 A;  1YT3 A;  2Z1J A;  1UWB A;  3LPU A;  3NF9 A;  3OYH A;  1KFS A;  1TKT A;  3L3V A;  3K58 A;  4KRE A;  3QEP A;  3U3G A;  4XIU A;  4DTN A;  4OGE A;  2DFF A;  1HYV A;  1KSP A;  4F3O A;  4DFM A;  1VSJ A;  1JLG A;  3AA4 A;  3LAN A;  4Y1C A;  1D9D A;  3RMB A;  4B9L A;  1QHT A;  4DSI A;  4CIE A;  2G8U A;  4OLA A;  3NCI A;  2O4I A;  4CJF A;  1BI4 B;  2VWJ A;  5JS1 A;  2D0B A;  2XY6 A;  4CEC A;  1SL0 A;  2F8S A;  3E01 A;  4JRP A;  3AVF A;  4H4O A;  3VQ8 A;  3L2V A;  2YKM A;  3VQ7 A;  3WNE A;  5KTQ A;  2F96 A;  5HLF A;  4J2A A;  5C42 A;  3HO1 A;  3DM2 A;  1EKE A;  3OVN A;  4I2Q A;  3EY1 A;  1REV A;  4AH9 A;  1X9M A;  1A5V A;  2O4G A;  1KVB A;  2B6A A;  3AA2 A;  4FLV A;  3V9Z A;  3ALY A;  1Q9X A;  3HST B;  4CJ4 A;  3QNN A;  1NK7 A;  5FRN A;  1DTT A;  2EX3 A;  1RT2 A;  3ZCM A;  5JS2 A;  4KHY A;  2I5J A;  3V1R A;  4N47 A;  4B8A B;  3V4I A;  1C0T A;  3ZSQ A;  2G8W A;  4B9U A;  4FW2 A;  1S1V A;  1HJR A;  1KVC A;  3M8P A;  3P83 D;  1Q8I A;  4CIG A;  3ZSY A;  3CM5 A;  3AVN A;  3OYJ A;  3LDS A;  3TAB A;  2YNG A;  3B6O A;  1D8Y A;  4LH4 A;  4OPJ A;  5J2P A;  3SQ2 A;  2FBV A;  3EZ5 A;  1IKX A;  3T1A A;  4IBN A;  1X9W A;  2Z1I A;  4DU3 A;  2HB5 A;  4B08 A;  4IKF A;  2PYL A;  3QET A;  4DF4 A;  2ITG A;  1QSL A;  3OY9 A;  3DLH A;  1HNI A;  1RCH A;  2NUB A;  4B9T A;  4B3O A;  1NK4 A;  4PQU A;  1NK0 A;  1RDD A;  4E19 A;  4KHS A;  1K6Y A;  3PO4 A;  3HPH A;  1I39 A;  4CJ3 A;  3SUN A;  2HHV A;  3K5O A;  1J53 A;  1HPZ A;  3ZT1 A;  1U48 A;  1L3V A;  3RR8 A;  4TSX A;  4CHZ A;  3WNG A;  3CFR A;  4O55 A;  1L3T A;  1NOY A;  4FZY A;  1Q9Y A;  1ZBH A;  4DQP A;  1YVU A;  3LAM A;  3SCX A;  3QO9 A;  2ZQB A;  3M8R A;  2DTU A;  3NHG A;  3KD1 E;  1QSY A;  2ZE2 A;  1WLJ A;  3O3F A;  3OYN A;  3MED A;  1IKV A;  3O3H A;  3M8Q A;  2E6L A;  4CF1 A;  3V9X A;  3MXI A;  4FJM A;  3OYK A;  3RMC A;  3VQ4 A;  4DWI A;  4J2D A;  3LZJ A;  1RTD A;  4HUF A;  1TK5 A;  1LW0 A;  3BDP A;  2DY4 A;  2WOM A;  1TKD A;  3K5N A;  1SKR A;  3AVA A;  1BIU A;  4CJE A;  4CJV A;  4ELU A;  2VG6 A;  4FM1 A;  4N41 A;  4GVM A;  2G8I A;  4OPK A;  3TI0 A;  2X6S A;  4C8O A;  3WNH A;  1BIS A;  4FLX A;  4DSE A;  1VSD A;  4DFP A;  2F8T A;  1JXE A;  1VSE A;  3ZT2 A;  2D0C A;  4FM2 A;  4DSL A;  4BE2 A;  3RR7 A;  3LP3 A;  5HRR A;  1S1X A;  5EU7 A;  4FLT A;  2KFN A;  3RMA A;  4OKK A;  1UA1 A;  2AJQ A;  3VQC A;  4CCH A;  1X1P A;  5K14 A;  3KLG A;  1WSI A;  4OKE A;  4CJR A;  3ZSO A;  3S3O A;  5J1E A;  2OZS A;  1EX4 A;  3RWU A;  3DRP A;  4E89 A;  2BGG A;  4E7I A;  1S6P A;  4YNQ A;  4BDZ A;  3MXJ A;  4DMN A;  4Q5V A;  1RBT A;  2IGI A;  4I9Q A;  1RBS A;  1WN7 A;  3DLR A;  3VN5 A;  3ZT3 A;  3AO3 A;  3KK1 A;  1KLN A;  1ASV A;  3K57 A;  4QCL A;  1BI4 A;  1HQU A;  5KI6 A;  2FBX A;  3QEX A;  3QLH A;  3T19 A;  3OYC A;  4F8R A;  4BE0 A;  1BQM A;  3PO5 A;  3ZSR A;  3QIO A;  3NH2 A;  3TAP A;  1IKY A;  4KV8 A;  3NF8 A;  3OYA A;  4BWM A;  3NGY A;  5CZ2 A;  2RF2 A;  3V9S A;  1L3U A;  3VQQ A;  2B5J A;  2YHB A;  3K59 A;  1RTI A;  4O44 A;  2KQ2 A;  4O4G A;  3LZI A;  4I9L A;  3TAF A;  1RDC A;  4I2P A;  4AHT A;  4CJK A;  3O3G A;  4CER A;  3RRG A;  3TAN A;  4E7J A;  4DQR A;  2QKB A;  3KLH A;  4F2R A;  3V9U A;  3ULD A;  1D5A A;  1JLF A;  2XHB A;  3S9H A;  2HHS A;  4LH5 A;  3ISN C;  3LWM A;  2YV0 X;  3F73 A;  4FJX A;  1BL3 A;  2QK9 A;  4FK2 A;  3C94 A;  1J5O A;  3QNO A;  4JRQ A;  2OYQ A;  4Z4E A;  2BAN A;  4ICL A;  3KIO A;  4NCA A;  4PWD A;  3D0P A;  3PV8 A;  1EP4 A;  3TAR A;  1RDA A;  1RT6 A;  3SQ4 A;  3U6F A;  3AVC A;  1CZ9 A;  4DTM A;  2IOC A;  2A1R A;  1IH7 A;  4W5Q A;  5KRS A;  1IG9 A;  3SQ1 A;  3LWL A;  1BCO A;  2RN2 A;  3OYF A;  4CGF A;  3G0Z A;  2VWK A;  4FJL A;  2PZS A;  3PY8 A;  1WSJ A;  3BGR A;  3LP0 A;  4GMJ B;  1QQC A;  4B9N A;  1QTM A;  5CYQ A;  3IAY A;  4B9S A;  3L2U A;  3G10 A;  2ATQ A;  4KKO A;  3OS1 A;  4CF9 A;  4DLE A;  2G8F A;  4J2B A;  3VQ5 A;  4FLY A;  4CJT A;  1J9A A;  3VA0 A;  1XHZ A;  2EHG A;  4H4M A;  2YNI A;  1YTU A;  4F4K A;  1JL1 A;  1S5J A;  4MQ3 A;  1KVA A;  4NYF A;  3VQE A;  3KKS A;  2D0A A;  2WON A;  4DF8 A;  1BHL A;  3KJV A;  3KKR A;  3DMJ A;  2BE2 A;  1GOB A;  4W5O A;  4G1Q A;  4CJL A;  1SKS A;  1R0A A;  3RTV A;  4N76 A;  2XRI A;  2Y1J A;  1NJW A;  1KFD A;  4N5S A;  3OYB A;  2A1S A;  1X9S A;  3P5J A;  4B9V A;  4FJ8 A;  4EP5 A;  3K5L A;  1TV6 A;  4CFC A;  4O0J A;  1BQN A;  1RIL A;  4AHR A;  3IG1 A;  3WNF A;  3KLF A;  4GW6 A;  5KGW A;  2VG5 A;  5HRP A;  4M3X A;  1TVR A;  4M3R A;  4KAZ A;  4E7K A;  1HNV A;  3MEE A;  1RT1 A;  3HP6 A;  2G8V A;  3I0S A;  4DQS A;  3CQ8 A;  1LW2 A;  1B92 A;  2GBZ A;  1S1W A;  4DTO A;  5E41 A;  1D9F A;  4EZ9 A;  4M3Y A;  1JLC A;  2HVH A;  3RMD A;  3DRS A;  4CF0 A;  4Z4H A;  3ASM A;  4DTS A;  1JXB A;  3V81 A;  3AVI A;  2YKN A;  1ZBL A;  1VSF A;  3NDK A;  3DLE A;  3SV4 A;  2E6M A;  2QXF A;  1T05 A;  3K2P A;  1L5U A;  3NGI A;  4DTU A;  3C6T A;  4CF8 A;  3OJS A;  2VG7 A;  3LP1 A;  4OVL A;  3D45 A;  1RT5 A;  2B4J A;  1ZBU A;  4AHU A;  4E7H A;  5FRO A;  4QOZ B;  4Z4C A;  1NOZ A;  3S3M A;  2IAJ A;  1UAX A;  1IO2 A;  3V1Q A;  2P51 A;  3VQB A;  5I3U A;  3NBP A;  4DTJ A;  2X74 A;  2Z1G A;  3ZT4 A;  1VRT A;  1NJY A;  4NCB A;  4HCC A;  4CFD A;  1A5X A;  4ID5 A;  1I3A A;  3TR8 A;  4E1N A;  3OYI A;  4DS4 A;  5J2Q A;  2YHA A;  5CY4 A;  3A2F A;  4CK3 A;  3OS0 A;  5C25 A;  4M45 A;  3ITH A;  3KTQ A;  2HHU A;  3IS9 A;  5J2M A;  3PX4 A;  1WAJ A;  4RG8 A;  2IDO A;  3AVH A;  4CEZ A;  4CFA A;  3CG7 A;  1FKO A;  4NYN A;  3PUF A;  4AHS A;  4CJU A;  4K8X A;  5HRN A;  1U45 A;  1RT4 A;  2KTQ A;  3KK2 A;  3V9W A;  4KHN A;  1ZBI A;  4CHO A;  2W42 A;  2OPR A;  2YNF A;  3HT3 A;  1S1U A;  2OPS A;  4M41 A;  4FJJ A;  2R7Y A;  1TGO A;  3QEI A;  3NGZ A;  3AVG A;  5HP1 A;  1XC9 A;  4KTQ A;  1QSS A;  4CHP A;  1YTA A;  1T7P A;  3AVJ A;  4EP4 A;  3C95 A;  1LV5 A;  1CXU A;  1CXQ A;  2Z1H A;  2G8H A;  1SUQ A;  2HND A;  4HHT A;  3UIQ A;  2HHQ A;  4KHW A;  1VSL A;  4CGG A;  4CEB A;  4W5R A;  3NH1 A;  5SWM A;  4FM0 A;  2HHT A;  1CLQ A;  1RTH A;  1U47 A;  4PUO A;  2HHX A;  1VSH A;  3LAL A;  4CJP A;  3LAK A;  4J2E A;  4H8K A;  4Z4G A;  3QEW A;  3HPO A;  4DQQ A;  1WSE A;  3L2W A;  4Q0B A;  4CK1 A;  3U3Y A;  4CED A;  1HYZ A;  4FJK A;  4PA1 A;  1RBR A;  5T7B A;  1S9G A;  3NF7 A;  3ZT0 A;  4CES A;  1LWF A;  4KTZ A;  4RW9 A;  4CJQ A;  4CEA A;  4FZX C;  2DFE A;  1SL2 A;  4WE1 A;  4DLG A;  2PY5 A;  2FBY A;  4FCY A;  2GUI A;  1NK5 A;  4FW1 A;  3VQ6 A;  1GOC A;  1TKZ A;  1KRP A;  4CJS A;  3AVB A;  4FXD A;  2XY8 A;  1F21 A;  2G8K A;  4M3Z A;  3AO4 A;  3LP2 A;  4HTU A;  4FJH A;  1FXX A;  4Z4I A;  1L3S A;  4E7L A;  2OPQ A;  1BGX T;  2HNY A;  4ID1 A;  3DOK A;  1FKP A;  1VSM A;  4DSF A;  2XY7 A;  4DG1 A;  1EET A;  1WSF A;  3QER A;  3AVM A;  4DTP A;  2P5O A;  4K8Z A;  3T3F A;  1TAU A;  4FLU A;  2P5G A;  1ASU A;  3CFO A;  4FJN A;  2Y1I A;  4KRF A;  4FLW A;  3VQD A;  5HRO A;  3FFI A;  1WSH A;  1LWC A;  4AIL C;  3HYF A;  4OKJ A;  3ZSX A;  2E4L A;  2RPI A;  5HRS A;  2YNH A;  3EYZ A;  3TAG A;  1NK8 A;  4CHN A;  5SZT A;  5C24 A;  1C1B A;  3V6D A;  1SKW A;  3CFP A;  4C8M A;  2LSN A;  2HVI A;  5FRM A;  3HVT A;  2FC0 A;  3NF6 A;  4C8N A;  3DRR A;  1VSI A;  3SV3 A;  2XY5 A;  3MEC A;  2KZZ A;  4ZHR A;  2GV9 A;  1U4B A;  2KZM A;  4MFB A;  5FDL A;  4LD0 A;  1J54 A;  1JLB A;  4FJ9 A;  4FYD A;  4IFY A;  4ZTJ A;  4FK4 A;  3SI6 A;  3HJF A;  3SPZ A;  3NH0 A;  1S1T A;  2JGU A;  3I8D A;  3MAQ A;  1U04 A;  1KCF A;  4BAC A;  1RBV A;  3P1G A;  1U49 A;  1NKB A;  4KTW A;  1NJX A;  1HMV A;  1W0H A;  3B6P A;  3SYZ A;  3AO2 A;  3SUO A;  1N6Q A;  4NCG A;  4OJR A;  4CIF A;  4HUE A;  1C1C A;  3OYE A;  4DFJ A;  4F2S A;  4CHY A;  3IRX A;  4O5B A;  3SUP A;  4R5P A;  2OZM A;  3HL8 A;  2ZD1 A;  3OS2 A;  4RW7 A;  3QES A;  1BIZ A;  1BCM A;  3AO1 A;  4C8K A;  3O4Q A;  1GOA A;  4IG0 A;  3QIP A;  1UA0 A;  2FBT A;  1NKE A;  4IG3 A;  3M8S A;  4IDK A;  3PX6 A;  3KLE A;  1LAW A;  1RTJ A;  4Y1D A;  3VQA A;  4FVM A;  3L8B A;  4FK0 A;  1VSK A;  2D5R A;  4I7F A;  3KD5 E;  2HNZ A;  1NJZ A;  1CZB A;  3C6U A;  3NAE A;  4BDY A;  3THV A;  2PYJ A;  4DTR A;  3KLI A;  1NKC A;  1JL2 A;  3HM9 A;  2DFH A;  4M42 A;  3OYM A;  3F9K A;  3MEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...