3K2PA

Hiv-1 reverse transcriptase isolated rnaseh domain with the inhibitor beta-thujaplicinol bound at the active site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase
molecule keywords Reverse Transcriptase
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3k2pA00
4FJKA 1RT6A 2BGGA 3IRXA 4DMNA 3H08A 3OYMA 3UIQA 3AVNA 3ZCMA 3VA0A 1NJXA 3WNGA 2XY5A 4GW6A 2OPSA 3OYJA 4JRPA 4KTZA 1TGOA 4LSNA 3JYTA 4PY5A 3DRRA 3KLHA 1ASVA 4IFYA 5HP1A 3BGRA 4QAGA 4FJXA 3QIOA 1UAXA 1YT3A 4DU4A 4JS4A 3C94A 4L8RB 3QESA 1QSSA 1FXXA 4FLYA 1QSLA 3M8SA 3VQ6A 3CFPA 2W42A 1IKWA 1JKHA 4DG1A 4M3XA 3CFRA 5J2QA 1W9HA 3AVHA 4CCHA 1GOAA 1REVA 1SKSA 3HP6A 4EZ9A 3RWUA 4Z4FA 3QETA 2QKKA 1GOCA 4AHCA 1C1CA 3SQ4A 2KFZA 3MEDA 4FZZA 4IKFA 1BGXT 3ULDA 1LW2A 2HNDA 5K14A 2HNYA 3T1AA 4CERA 4QCLA 4KAZA 1NK5A 1RBVA 1ZYQA 1IKXA 3NBPA 1RTDA 4O55A 2HHUA 3V9ZA 4KHUA 1XHXA 1TL3A 3VQ5A 1XWLA 2Z1GA 2ZE2A 4BE1A 3L2WA 1QQCA 3AVCA 4KV8A 1A5VA 3AVFA 4Z4IA 1HYSA 3PX4A 4TSXA 1C6VA 1Z26A 3RR7A 5JS2A 1ASUA 2YHAA 1LW0A 1RBUA 4I9QA 4PA1A 4CJ3A 1D5AA 1JL1A 3VQAA 1DTQA 4IG0A 4LSLA 3T19A 5SWMA 1EXQA 4Z4HA 3KJVA 2HHWA 4DQPA 4M3TA 3AO2A 3RRHA 5FRNA 1VSEA 1QE1A 3VQCA 4FJJA 4DSJA 3LZJA 2QK9A 4OGCA 2RKIA 4FLXA 1RDDA 1K6YA 1YTAA 3AVJA 3QEXA 3S3NA 3QEIA 2HW3A 2QXFA 5CZ2A 4N56A 1JXBA 3DM2A 4YFUA 2OA8A 3KKRA 2ATQA 4DSEA 1CXQA 5I42A 4K8ZA 4HUEA 4AH9A 4CECA 4E7HA 4DSFA 4FW2A 3NH0A 1D8YA 3SUQA 1NK6A 2RN2A 4CK1A 1ZBLA 2GUIA 4BWJA 3ZSZA 3BDPA 4WE1A 4CEBA 1NKEA 3NGZA 2B5JA 1L3SA 4IDKA 2EX3A 4BACA 1EETA 4CIGA 1NK9A 4OKKA 3SUPA 3M8PA 3VQBA 1BCMA 3PO5A 1WSJA 4CK2A 2OZMA 1KCFA 1O1WA 3ZT4A 3CQ8A 2D0CA 4CJVA 4RW7A 1W0HA 2WONA 1C0UA 4CEAA 4H8KA 4DTRA 4Z4GA 4FLWA 5FRMA 4C8KA 4DTUA 1I39A 2D5RA 4BE2A 4CHPA 1QSYA 2IS3A 4W5NA 3NF7A 1KVCA 4Z0UA 3HM9A 2DTUA 1S1UA 3T3FA 2F96A 4CGGA 3L2VA 3PO4A 1J9AA 3HT3A 3DMJA 5C42A 4M3WA 4J2EA 3SNNA 1JLAA 4KTQA 4RW9A 4E3SA 3PX6A 2G8WA 1TAUA 1RTHA 3AVMA 1X9MA 3HSTB 1BCOA 3NDKA 1NOZA 1VK0A 1RT4A 3V9SA 3SI6A 2HHVA 1IH7A 5HROA 2KW4A 1RDCA 3HK2A 1BQNA 3HL8A 3KLFA 3SV3A 4DQIA 4EZ6A 4DWIA 3AV9A 3D0PA 4IFVA 1HPZA 3KIOA 4O4GA 4GVMA 1RBSA 1T03A 4Q5VA 2YNGA 4FLVA 4M3UA 3V4IA 3CM6A 3QIPA 1HJRA 3C95A 3MEGA 3VQPA 5KTQA 3TAGA 4CGFA 4Q0BA 4DQSA 1N5YA 1RDAA 2E4LA 2RF2A 1TKZA 4CJKA 2KZMA 2YKMA 2HB5A 3OS1A 4O5BA 5C24A 3QNOA 3AA3A 3DLEA 2VWKA 3G10A 3IG1A 3NFAA 4W5QA 4H4MA 3OYKA 2F8SA 2OZSA 2O4IA 1TL1A 4AHVA 1QTMA 2VG7A 4Z4EA 1QHTA 3ALYA 1DLOA 4CEEA 2OYQA 2FBTA 2FBYA 4O0JA 1LAWA 3V1OA 1L3VA 2YNIA 4CHZA 2X6SA 3U3GA 1CXUA 3HVTA 4HHTA 3LP2A 1ZBUA 1KVAA 2YV0X 3RMBA 4AHTA 1KTQA 3M8RA 4FZXC 2RPIA 3KLIA 3DYAA 3U6FA 4KKOA 3HO1A 1ASWA 2O4GA 2YHBA 5CZ1A 1Q8IA 2I5JA 3ZSOA 3WNEA 4DQQA 4DS5A 4DU1A 4AHRA 4MQ3A 4E0DA 4NCAA 3TAMA 1S1XA 3CFOA 3QEWA 1J5OA 2G8HA 3I0RA 4F3OA 4KB0A 4B9LA 1HMVA 3HPOA 3AA4A 2OPPA 1HYZA 3NCIA 4HVJA 3TANA 4RG8A 4PQUA 1NJZA 3L2QA 4CGDA 2D0BA 4I2PA 3JSMA 4FK2A 4RW8A 4CFBA 3KLGA 3VN5A 4BWMA 1TK5A 2P5GA 1BL3A 1TKTA 3EYZA 3LANA 1HQUA 4CEDA 4EP5A 3KK1A 3MAQA 1TAQA 3THVA 5D3GA 1C0TA 4J2AA 4W5RA 4B8CA 1IKVA 4DFPA 1Q9XA 3V9UA 1RT2A 2VWJA 5T7BA 2PYLA 3AO4A 4CF1A 1NKBA 3ZT3A 2G8UA 4RW6A 2KFNA 3DLRA 3NH2A 1U48A 1A5WA 3ZSQA 4B9VA 1HRHA 2FC0A 4W5OA 4FJMA 3TAFA 3V81A 3OYAA 4KHYA 4DTMA 1B9FA 3LALA 3MXJA 4FJGA 1IO2A 3ZSXA 3SZ2A 1S6PA 1Y97A 4R5PA 1X9WA 2JLEA 2OPQA 1T7PA 1VSMA 5KRTA 2Y1JA 1KLMA 3V9XA 2R7YA 1J54A 1WAJA 1TK0A 1MU2A 4N41A 3LP1A 3ZSYA 4CHYA 3OJSA 4DTPA 4DFMA 3V6DA 3LZIA 4JLHA 1RCHA 2VG6A 1FKPA 3ISNC 3OYFA 1KFSA 4ELUA 3CG7A 4LY7A 3QNNA 2HHXA 2BE2A 4FM1A 1S1VA 1CZ9A 3KK2A 5KGWA 3L3UA 4DU3A 4CJFA 1R0AA 3I0SA 5J1EA 4KO0A 2HHTA 2HHQA 4CEZA 4KREA 4LH5A 3S3MA 4CEFA 4E1MA 1ZBIA 2G8IA 4BDYA 3TAPA 1RILA 4E7KA 5DMRA 4E7JA 3HPGA 4KPYA 1XHZA 3KK3A 3SCXA 1JLGA 3B6PA 4OGEA 5HBMA 3K58A 3VQ9A 2DFHA 4FW1A 4CJSA 4YNQA 3LDSA 1BQMA 4NCBA 1LAVA 4CJQA 4FXDA 2AJQA 4DS4A 3QERA 3TABA 3DI6A 3FFIA 3RMDA 2ETJA 3AVAA 2ITGA 1SKWA 3VQQA 1RT3A 1VSHA 5FROA 4M41A 3ZT2A 4CIFA 1JL2A 2DFEA 3O3HA 4M45A 1X9SA 3OYEA 3VA3A 1C1BA 1Z25A 5J2MA 4LH4A 4JS5A 4OLAA 3OYCA 4KRFA 1FKOA 4K8XA 3K5MA 4OKEA 4DF8A 1UA1A 1T05A 4AILC 4KB1A 4QOZB 3QINA 1UOCA 3SJJA 2Y1IA 2VG5A 4H4OA 3ZT0A 3L2UA 3VQDA 3EY1A 4DLGA 4CK3A 4OKJA 4CESA 3DRSA 1WNSA 2G8KA 4NYNA 4CFAA 4CJUA 3MXIA 3OYDA 3C6TA 4JRQA 3ZSRA 4CEQA 4CIEA 3SQ2A 4M42A 1SL2A 2E6MA 3LP0A 4FM0A 4KI4A 3OVNA 3SV4A 3ASMA 4B08A 3EZ5A 1XC9A 1KFDA 1U45A 1KLNA 2PZSA 4C8LA 3SUNA 3OJUA 1VSKA 1B92A 2B4JA 4N5SA 3AO5A 4B9TA 1NJWA 1WSEA 3NH1A 2GBZA 3NE6A 3AVIA 4N47A 3AO1A 1IG9A 1TV6A 3NF9A 3ZSWA 4F2RA 4DLEA 1EX4A 2PYJA 3TAQA 1TVRA 1BIUA 2IOCA 4CF9A 2XHBA 4C8NA 4C8MA 4CHNA 1LWCA 1TK8A 4FJ5A 2HVIA 4CF8A 2Q3SA 1WSIA 3ZT1A 4O0IA 3HP9A 3LPUA 4Y1DA 5HRSA 4W5TA 3OYBA 3O3FA 3OYHA 4F4KA 3S3OA 3NHGA 1RT1A 4AHSA 4FJ8A 3K2PA 4OLBA 3KLEA 5CY4A 4I2QA 4FJ9A 4CJRA 1HNVA 1WN7A 2YKNA 1VSIA 3LAKA 5KI6A 1T8EA 4FYDA 2F8TA 1YVUA 3K5OA 4I9LA 4UQGA 4FM2A 3NGIA 4CEOA 4ELTA 3KD5E 3RR8A 4BE0A 3SQ0A 4I7FA 3AA5X 1S5JA 1SL0A 3KD1E 4FLUA 3AVLA 4E19A 4E7LA 1G15A 3K5LA 2XY7A 4FK4A 4KHWA 3SQ1A 2XRIA 1BI4A 1LWFA 4PUOA 4IG3A 3CM5A 2EHGA 1KSPA 2FBXA 4J2DA 1WSFA 3NGYA 4DTSA 1GOBA 4E89A 4CF2A 4FJNA 1BIZA 5SZTA 3E01A 4ELVA 4J2BA 3AVKA 3TAEA 5I3UA 1ITGA 2A1RA 3K57A 4HTUA 1KRPA 4FJ7A 2QKBA 5KGXA 4FLZA 4CJEA 3TR8A 1NJYA 1HNIA 4MFBA 3OYIA 1NK7A 3DOKA 1L5UA 4CGHA 4XIUA 1JLFA 2IC3A 2LSNA 1Q9YA 4N76A 4CHQA 3A2FA 3HPHA 3IAYA 3ITHA 3B6OA 3NF8A 4Y1CA 2G8FA 2X78A 2E6LA 4ID1A 4HCBA 1YTUA 2HNZA 2P1JA 4KHNA 1ZBFA 3LPTA 3V9WA 4NCGA 3OS0A 2BANA 1U04A 3SUOA 4FJLA 2Z1IA 3QLHA 1I3AA 4DSKA 3AVBA 5JS1A 4DFKA 4KHQA 1U47A 1HQEA 1JXEA 1LWEA 5E41A 3LWMA 4FJIA 3MEEA 1L3UA 4CHOA 1UWBA 3VQ8A 1RT5A 1RTIA 2YNHA 3HVRA 4E7IA 3PV8A 1NK8A 3SYZA 2P51A 3VQEA 1RT7A 1SV5A 1WSGA 2Z1JA 1D9FA 2Z1HA 1EP4A 4Z4CA 1NK0A 4ICLA 4B9MA 1VRUA 2XY6A 2KZZA 1RBTA 3NF6A 2OPRA 3OS2A 3VQ7A 3TWHA 1RBRA 1C0MA 1CZBA 3LP3A 4O44A 3PUFA 4M3RA 4CE9A 4ZHRA 4GMJB 2HHSA 1L3TA 1JLEA 3QO9A 1C1AA 5DK5A 2A1SA 3V1QA 4DFJA 2PY5A 3PY8A 5HRPA 4ZTJA 3L3VA 1U4BA 4CFDA 1HYVA 2WOMA 3L8BA 3RMAA 1NKCA 1NK4A 4FK0A 1BISA 3M8QA 1XI1A 1WAFA 4AHUA 2XO7A 1D9DA 4CJTA 4B9UA 4OJRA 4F3TA 1SL1A 3WNHA 3OYGA 4KHSA 4KI6A 2X74A 4E1NA 1TKXA 1EKEA 5FDLA 4DTOA 3AA2A 1TKDA 2DY4A 3PX0A 4DSLA 1RNHA 4KFBA 4DF4A 2G8VA 3CYMA 1SUQA 3OYNA 3HJFA 1BI4B 1RDBA 2IAJA 2HMIA 3AVGA 3WNFA 1UA0A 3LWLA 2IGIA 4DTJA 5C25A 3V1RA 4OVLA 4CJWA 2HVHA 3MXMA 3DLGA 1CLQA 2DFFA 1S1TA 3DRPA 1WSHA 1VSDA 2ZQBA 1A5XA 1KVBA 4KTWA 5EU7A 4CFCA 5CYQA 4CJPA 3RMCA 2KQ2A 4RW4A 3DOLA 2NUBA 1S9GA 3F9KA 3I8DA 4BDZA 3AO3A 4DQRA 4FCYA 4FLTA 1LV5A 4NYFA 3VQ4A 5KRSA 3SPYA 3HXMA 5J2PA 1NOYA 3K5NA 3DLKA 4FVMA 4LD0A 3SPZA 5HLFA 1VSJA 5J2NA 4CGJA 4CF0A 4CJ5A 1S1WA 4EP4A 3RTVA 1U49A 2BDPA 3G0ZA 3NAEA 3MECA 3S9HA 4DSIA 4FZYA 1VRTA 4IBNA 4ID5A 3O3GA 3U3YA 3IS9A 4M3ZA 1S6QA 1VSLA 4G1QA 3QEPA 3OYLA 3TI0A 1FK9A 1VSFA 2D0AA 4C8OA 4FJHA 3K59A 3QEVA 1SKRA 3KTQA 3C6UA 2FBVA 4B8AB 3TARA 4B3OA 1X1PA 4DTNA 4OPJA 4BDPA 1ZBHA 1S9EA 4CJLA 1JLBA 3HYFA 2P5OA 2ZD1A 2JGUA 1BHLA 3LAMA 4CJ4A 4B9SA 2IDOA 3P83D 3L2RA 1QS4A 1IKYA 3RRGA 4OPKA 1DTTA 1JLQA 3D45A 3ZSVA 4HCCA 1J53A 3DLHA 1RTJA 3F73A 4F2SA 2YNFA 4M3YA 2X6NA 1N6QA 3P1GA 2XY8A 4HUGA 3P5JA 5HRNA 1JLCA 2B6AA 3O4QA 4B9NA 2KTQA 4CGIA 4HUFA 1F21A 3KKSA 4PWDA 2GV9A 5CYMA 5HRRA 3OY9A 4F8RA 4ZTFA 4DTXA 1WLJA 3O4NA 3DLBA 1B9DA
chains in the Genus database with same CATH superfamily
4JK7A 4IXCA 4GNIA 2H3GX 2XY5A 3OYJA 4JRPA 3D2FA 3DRRA 5HP1A 3O9SA 4K43A 4Z94A 3CCSN 1YT3A 5JVGL 2V51B 3MX5A 2UXCK 1VHXA 5AQSA 2W42A 1JKHA 4M3XA 3CFRA 1TYQA 5J2QA 2RHKA 5KPRA 1GOAA 1REVA 2GELA 4BC4A 4EHUA 5C12A 3QETA 1GOCA 3IMXA 1LW2A 3T1AA 2HNYA 4QCLA 1DEJA 4WFBL 4O8UA 4DR7K 1RTDA 2HHUA 3VQ5A 1XWLA 3W3DA 3JS6A 3ULEA 1A5VA 1BOTO 4TSXA 1C6VA 1Z26A 3CHWA 3WEEB 1LW0A 1JL1A 2HHWA 4DQPA 5AQZA 3RRHA 5B8HA 1Z6RA 4JI1K 5AQFA 3RSEB 1YTAA 3TTFA 2ZJPL 2HW3A 2OA8A 4Y0WA 4NLBA 2D0OA 4DSEA 2GWKA 3FZKA 4AH9A 3D2EB 1HLUA 2F4VK 3JXUA 4DSFA 4FW2A 1VQ7N 1ZBLA 2E2QA 1S72N 3CD6N 1KXPA 3RRGA 1MDUB 1EETA 1NK9A 4IO9L 3M8PA 2FF6A 4CK2A 1O1WA 2A5XA 4FL9A 2QWMA 2D0CA 4CJVA 4CEAA 4DTRA 2ZM6K 3SK3A 3HM9A 2GEMA 3WXMB 3I33A 4AQYK 4JI2K 3SNNA 4LFCK 1J6ZA 2G8WA 4GKJK 1RTHA 3AVMA 3HSTB 3ZX3A 1T6DA 2GX9A 2YJFA 3KK7A 3NDKA 4DV7K 3V9SA 5C2FA 3SI6A 1YJWN 4BR2A 4DKWA 3CCEN 3I8BA 3O9QA 3HZ6A 4DWIA 4YOXA 3D0PA 4IFVA 4O4GA 3HM8A 4M3UA 4FLVA 3C95A 4BR9A 2FF3B 4DQSA 1ESVA 5BR9A 4DUZK 1P90A 2F9TA 3OS1A 2RE2A 5C24A 1JJ2M 3NFAA 3DLEA 3D7EO 3G10A 4W5QA 1YJ9N 2OZSA 5AQJA 3CCRN 3H3OB 3CJCA 2A40A 2FBTA 2FBYA 2J4RA 1LAWA 2YNIA 4CHZA 5EVZA 3U3GA 1U6ZA 2YV0X 4BRGA 3RMBA 4YOYA 1WB9A 5BN9A 3DYAA 3U6FA 4DR1K 1DT9A 2I7NA 4DQQA 3VEZA 4H5VA 4MQ3A 1S1XA 4YY3K 3AA4A 4LFAK 4JKAA 3O8MA 4BRLA 3GE1A 4CFBA 3VN5A 4BWMA 1BG3A 1MWKA 4E1JA 1YITN 3MAQA 1KC8O 3J81O 4W5RA 1Q9XA 3Q7BA 4JNEA 2GTDA 3M3ZA 1NWKA 3DLRA 2YI1A 2ZJRL 4BR4A 1HRHA 3G25A 2Q97A 4DTMA 1GLDG 3MXJA 1IO2A 3ZSXA 1QQNA 4X64K 1S6PA 4FWKA 3BY5A 2QTDA 1V4SA 1KLMA 1TK0A 3CCQN 4CHYA 3THWB 2Q31A 3CETA 1YI2N 3QFPA 4H5WA 3QNNA 4LY7A 4FM1A 2W40A 4DU3A 1R0AA 1XNRK 4KO0A 3EL2A 4KREA 3S3MA 4FWQA 4E1MA 5AQRA 2O8CB 2NRZA 4QS9A 3CMAN 4FVUA 1GLCG 4KPYA 5AQNA 4OGEA 3LDSA 4DS4A 3TABA 1VQ5N 1VQON 1QVGM 3AVAA 1RT3A 2E2PA 4M41A 4M45A 1GLEG 4DR2K 3OYEA 3VA3A 3F9MA 1OVQA 4JS5A 3PSFA 2Y1IA 1NGGA 4CK3A 4DLGA 3IFRA 4OKJA 4H5RA 2G8KA 5M1KA 3DXKA 4CJUA 1HJOA 3OYDA 3ZSRA 4M42A 3FE1A 1GLJO 3LP0A 1HNXK 1GLBG 5AQVA 2ZJQL 4WFNL 3SJHA 3EZ5A 1XC9A 2PZSA 4NXNK 4N5SA 4OPAA 1S3XA 3AVIA 4B3RK 4N47A 3AO1A 3J7ZO 1IG9A 2PYJA 5JLHA 5AFUH 4C8MA 1T6CA 1LWCA 4FJ5A 2HVIA 1JCEA 2Q3SA 4UY8O 3OYBA 4W5TA 4B1WB 1K8KB 1TAUA 4F4KA 1CZAN 3NHGA 4FJ8A 1VQPN 4MO5A 3KLEA 1HNVA 2P9LB 5KI6A 2HBKA 5KQDA 4M7XA 1YVUA 4UQGA 3KD5E 4CEOA 1NG9A 4I7FA 4E19A 1G15A 1SQKA 3ULEB 3K5LA 3CCVN 4IG3A 3E9PA 1KSPA 2FBXA 3LDOA 3QICA 3E01A 4J2BA 1ITGA 1X3MA 4X66K 4LF4K 3K57A 4HTUA 1KRPA 4JYAK 1HNWK 3VETA 4A61A 4MFBA 1KD1O 3SMPA 3U9DA 1NK7A 4FOIA 1OH5A 2CH6A 1E4FT 3B6OA 3ID8A 2X78A 3EE8A 2HNZA 3F5TA 4KHNA 4LF9K 1ZBFA 3LPTA 3V9WA 3VF6A 3CJ9A 3SUOA 2QM1A 1FW6A 2NLXA 4DSKA 3ZEUA 2O8FA 1U47A 1TUYA 5E41A 4NXMK 4OPHA 4CD1A 4CHOA 3C7NA 4E7IA 3HVRA 3OA9A 4PL7A 2E1ZA 5MLCQ 1RBTA 2OPRA 1C0MA 3EE9A 3LDPA 4M3RA 2UUAK 4ZHRA 1L3TA 1JLEA 1C1AA 2A1SA 3V1QA 5AQGA 4ZTJA 1U4BA 2WOMA 1BWFO 1NK4A 3M8QA 2XO7A 4KH5A 2NRWA 4LC9B 2E20A 5A2QO 1LOTB 1TKDA 1ZXOA 2G8VA 3CYMA 1BI4B 3VESA 3AVGA 4CD3A 1EWRA 1C0FA 2OCEA 2HVHA 4GY2B 1CLQA 5AZIA 3TSUA 3ZETA 3MX2A 4KTWA 5EU7A 3HOTA 5E26A 2NNWA 2P9KA 4BDZA 3AO3A 4DQRA 1YIJN 5KRSA 2P9UA 3A5NC 1K8KA 2YHYA 1NOYA 1YVNA 4CJ5A 4EP4A 3J7AP 1U49A 4IBNA 4ID5A 3U3YA 3VOVA 1FK9A 2D0AA 3QEVA 1SKRA 3KTQA 5BREA 3TARA 4OPJA 1ZBSA 2E8AA 2P5OA 2ZD1A 1BHLA 1IBMK 1IKYA 4HCCA 5C15A 5LMNK 3DLHA 4M3YA 5ELZA 4HUGA 5HRNA 1JLCA 2B6AA 2JWLA 5ADXA 4B9NA 4HUFA 2NRTA 5HRRA 4H03B 4I6MA 4BR0A 4YDUC 5AQYA 3P4IA 3DLBA 3IRXA 4DMNA 2E2OA 3ZCMA 3VA0A 1NJXA 3WNGA 1NGBA 3O5BA 4GW6A 4X62K 3EKSA 5F1XA 3BGRA 4QAGA 3C7NB 3QIOA 4JS4A 2BH1A 1FXXA 2QI2A 3R8EA 1NGEA 2CGKA 1IKWA 2QA4N 3LM2A 3PLAA 3SAFA 5GIPA 2P9NB 2CGLA 4AHCA 3M6GA 1BGXT 3ULDA 5FPDA 3ATUA 4B1ZA 5F0XA 4BRIA 4KHUA 1XHXA 5KQ8A 3KWIA 4IOXA 4JI4K 3AAQA 2Z1GA 4JEPA 3L2WA 4Z4IA 3RR7A 5EX5A 4WYBA 1RBUA 4I9QA 4N56A 5SWMA 3VQAA 4IG0A 1EXQA 5FRNA 4FJJA 4K42A 4DSJA 2YJEA 3C6HA 1RDDA 3VTHA 3QEIA 2QXFA 3H6EA 3T69A 2VWBA 2ATQA 5HOOA 2VQEK 1CXQA 1KAXA 4HUEA 2ASOA 4H0OA 2NRRA 3IUCA 1NM1A 4FOEA 3SUQA 1VQNN 2GUIA 4CI6A 2NRXA 3O9RA 3BUZB 4IDKA 4CZLA 4NB4A 4CIGA 4KH4A 3SUPA 1HKCA 3SAHA 4EHTA 3DXMA 1KCFA 4K25A 2HMPA 3VEXA 1W0HA 2VQFK 2KHOA 3CC4N 1C0UA 4M7YA 5FRMA 4C8KA 1I39A 1QSYA 4CHPA 1KVCA 2DTUA 1S1UA 4JD2A 3T3FA 3L2VA 4JK8A 3P38A 3QMLA 5IWAK 3DMJA 5C42A 1K8AO 4M3WA 4E3SA 5AQKA 2HHHK 5JLFA 3EO3A 1RT4A 4BG8A 1IH7A 2ZGZA 3HK2A 2KW4A 3HL8A 1U2VB 3NVKA 4EZ6A 3M5RA 3CJ7A 4L3QA 4Q5VA 3TAGA 3VQPA 1HJRA 3MEGA 1RDAA 2E4LA 2RF2A 4CJKA 3OW2M 2KZMA 2HB5A 4WF9L 3IG1A 3CQXA 4H4MA 4FSVA 4B3MK 4JKCA 2OYQA 1L3VA 2X6SA 3THWA 5EXWA 1ZBUA 1KVAA 3KZBA 3M8RA 4FZXC 4KKOA 3HO1A 1ASWA 1J5EK 1HPMA 1Q8IA 2JWKA 4DS5A 4E0DA 2Q36A 1IV0A 1J5OA 4KB0A 1HMVA 2QWPA 2FSKA 2OPPA 1HYZA 4O5FA 4WQ4C 5BPNA 4RG8A 3NCIA 5ADXH 3THXA 4PQUA 1NJZA 3MCAB 3JSMA 4RW8A 3N4PA 3O1BA 1TKTA 3EYZA 3LANA 4V19S 4EIAA 4EP5A 3L6QA 3THVA 1C0TA 1KQSM 4BGBA 5T7BA 4ISGA 3ZT3A 3IDHA 2G8UA 4RW6A 2KFNA 2FC0A 5AFUA 4W5OA 3TAFA 4KHYA 3LALA 4K0KK 4R5PA 2OPQA 1T7PA 3V9XA 1J54A 1WAJA 3C6AA 1MU2A 5AQMA 3LP1A 3FLCO 1YAGA 4DR6K 1FKPA 2HHXA 3I0SA 4CVNE 4FWMA 3SMSA 4DQ8A 3TAPA 4E7KA 4ISFA 1IBKK 4BRPA 3B6PA 1EO1A 3H1VX 1MA9B 4NCBA 1LAVA 4BC5A 3DI6A 3FFIA 3RMDA 5CHIA 2PAVA 2ITGA 1V4TA 3ZT2A 1I94K 3IKMA 1IBLK 2CGJA 2Q1NA 2F7TA 3CERA 4OKEA 4HTLA 3QINA 1UOCA 1ATNA 4JD2B 3ZT0A 3VQDA 3L2UA 3CJAA 4CESA 3DRSA 1WNSA 2A41A 4DR4K 4J8FA 3MXIA 4JRQA 1N34K 1SL2A 3JAMO 3OVNA 3HSCA 1RGIA 3ASMA 2W41A 4JI7K 5KPZA 1NMDA 1KLNA 4C8LA 4MLHA 1NJWA 1K9MO 3NF9A 3GL1A 2IOCA 3H46O 4CF9A 1TK8A 5LL6Z 2UXDK 3O08A 4MDBA 1HUXA 1BA1A 3ZT1A 4O0IA 3LPUA 3O3FA 3BF1A 4RWTA 4AHSA 3R1XA 4OLBA 2E2NA 5CY4A 3R6MA 1T8EA 1VSIA 4FYDA 3SBGA 2O8EA 5GAGP 2ZWHA 3WEEA 2FSNA 4FLUA 4FWRA 4OX9K 4PUOA 3CM5A 4G9ZA 1WSFA 3AVKA 2A1RA 1NGIA 3VEYA 4JHDB 4FJ7A 2QKBA 3VGLA 3TR8A 1NJYA 3OYIA 4JI0K 1XUPO 3DOKA 4CGHA 3CXCM 1JLFA 2IC3A 1N32K 2LSNA 1Q9YA 3A2FA 3NF8A 4ID1A 1TYQB 3FZMA 3LL3A 2Z1IA 3SBTA 1I3AA 1QQOA 4DFKA 3ZX2A 4BR7A 3DWLA 3FZLA 3LWMA 3CCMN 2HBJA 3VQ8A 1RT5A 1RTIA 1NK8A 3L4IA 4RCHA 2P51A 1RT7A 3UE5A 2Z1HA 4Z4CA 1NK0A 4B9MA 4ICLA 1VRUA 1W97L 2VCPA 4IEIA 4PKHA 3ENHA 1CZBA 3LP3A 3PUFA 4CE9A 1BO5O 5DK5A 5LY3A 3O9TA 2PY5A 3L3VA 4CFDA 1RFQA 3RMAA 1NKCA 4FK0A 1BISA 4NO7A 4YHHK 2KKZA 2KLAA 4CJTA 1D9DA 4F3TA 4CBWA 4AM6A 4C23A 4KI6A 2BTFA 4PKIA 1TKXA 4XH5A 3GDQA 4JI8K 2DY4A 4DSLA 5E84A 4DF4A 3WNFA 4F9OA 4CZKA 5C25A 3V1RA 4OVLA 2DFFA 1S1TA 1RDWX 1T3VA 1VSDA 5AQPA 4YOVA 2E1YA 2KQ2A 4RW4A 4XH1A 3DOLA 2IIRA 4CBUA 3VQ4A 3HXMA 3K5NA 4FVMA 4LD0A 2DPNA 3SPZA 4H0YB 1VSJA 4IFEA 3RTVA 2UU9K 4JI6K 2BDPA 3G0ZA 4C1NI 3NAEA 3MECA 1ATSA 3ZETB 1VRTA 3EN9A 4K41A 3IS9A 4B1UB 1VSLA 3QEPA 1G99A 3OYLA 4C8OA 1BA0A 4B8AB 1ZBHA 1JLBA 4CZGA 2JGUA 3VERA 4CJ4A 5BR8K 3P83D 2HF3A 1QS4A 1NGCA 3D45A 4QS8A 1SZ2A 3G4SN 2XY8A 1QQMA 5FPMA 3O4QA 3U9ZA 1K73O 5BPMA 1NGFA 4WFAL 3KKSA 2O8DB 2GV9A 2QWNA 3OY9A 3B8AX 4ZTFA 1WLJA 2UXBK 4M3ZA 4DG1A 4WCEL 3LDNA 3AY9A 3H08A 2E88A 4JK9A 5AQQA 2YHWA 1TGOA 3JYTA 4PY5A 3O6WA 2WUSA 1ASVA 4IFYA 2E5LK 1UAXA 4DU4A 5F2RA 4L8RB 3QESA 3MWPA 4FLYA 3M8SA 3VQ6A 4IJAA 1EQYA 3CPWM 4BC2A 3F2KA 1SKSA 4EZ9A 3R3LA 3RWUA 4Z4FA 5AQLA 1NNEA 3GOIA 3CQYA 3SQ4A 1M1KO 4FZZA 4H5TA 5K14A 3ZX0A 4CERA 4JHDA 1N33K 1ZYQA 1GLLO 1IKXA 1E4GT 3KHYA 4YOUA 3NBPA 4JKGB 4O55A 4A5AA 3AARA 3V9ZA 1TL3A 1Q82O 1SS6A 2ZE2A 4BE1A 4KV8A 3AVFA 5LJWA 1HYSA 3BZCA 2O8EB 4CJ3A 1D5AA 3KJVA 3C0BA 3T19A 2IVOA 1W2BM 1XC3A 2QK9A 4OGCA 2RKIA 4FLXA 1K6YA 3S3NA 3QEXA 4BQLA 1JXBA 3DM2A 2W6LA 2QWOA 4FWPA 5I42A 4K8ZA 2O8BB 4BC3A 4E7HA 4CECA 4IOCL 3SLCA 3NH0A 1NK6A 4CK1A 3CIPA 3HI0A 3BDPA 4CEBA 4BACA 4OKKA 1GLFO 3VQBA 1BCMA 3ZT4A 4RW7A 4U67L 4Z4GA 4BREA 4H8KA 1SAZA 3J8AA 2HOEA 4W5NA 4H0TB 2P9SB 2WC9A 3NF7A 4Z0UA 3UKUA 4MLEA 3H3NO 3H45C 1J9AA 3P31A 2HSTA 3EZWA 3PX6A 3DAWA 3SAGA 1BCOA 3A8YA 2HHVA 5HROA 1RDCA 1BQNA 3VPZA 3DJCA 1HPZA 3KIOA 1U2VA 4GVMA 1T03A 2YNGA 2W6KA 1OH7A 4IZ9A 3V4IA 3CM6A 3M1FA 4Q0BA 1N5YA 1NMNA 1TKZA 4CZHA 4O5BA 3QNOA 2O4IA 3OYKA 3WQUA 4AHVA 1QTMA 1QHTA 3ALYA 1DLOA 4CEEA 4BY9C 4O0JA 2F9WA 1NGAA 3V1OA 1Z05A 4HHTA 3CMEN 1Q7YO 5AR0A 3TSPA 3TTCA 4AHTA 1KTQA 3KWGA 4JI3K 1BUPA 4A57A 5AQIA 2RPIA 3EKUA 3DXMB 3FZFA 2O4GA 5CZ1A 4DV0K 3BF3A 1VQ6N 2I5JA 3WNEA 2VGMA 4DU1A 4AHRA 3QEWA 3VTIA 3I0RA 5AJ3K 4B3SK 4H0PA 4HVJA 1OH8A 2GUPA 4IWVA 3L2QA 2D0BA 4FO0A 1XQSC 2P5GA 3RSEA 3WXLA 3KK1A 1TAQA 5D3GA 4XEIA 5BPLA 4B8CA 2YCHA 1RT2A 1NKBA 3HOSA 2BUPA 3NH2A 1A5WA 4BVOA 5EY4A 1BDGA 3E9OA 3OYAA 4JN4A 1B9FA 3SZ2A 1Y97A 2JLEA 1QHAA 4JKGA 4FWLA 2Y1JA 2UUBK 3FR0A 4N41A 4KH6A 3OJSA 4DTPA 4DUYK 1QZ6A 2NZTA 4DFMA 2VG6A 3ISNC 3OYFA 3U4LA 3UKRA 3VEOA 3KK2A 1CZ9A 5KGWA 3RVCA 4LF6K 4FWOA 5J1EA 4YOWA 1ZBIA 2G8IA 4AF1A 3OBYA 4DV1K 1NLVA 5DMRA 4NLCA 5FPEA 3HPGA 3SCXA 1JLGA 5HBMA 3BP8A 3VQ9A 2DFHA 4YNQA 4FXDA 2AJQA 2FLOA 3QERA 2ETJA 3MN7A 1SKWA 3VQQA 5BN8A 4CIFA 1JL2A 1OH6A 1MWMA 1Z25A 1QZ5A 5J2MA 4OLAA 4KRFA 3OYCA 4K8XA 4LF5K 3K5MA 4DF8A 1UA1A 1T05A 4KB1A 4BRNA 3SJJA 4BR5A 2VG5A 3LM9A 3EY1A 3O1WA 3CCUN 4BGAA 2UYTA 3ZLJA 2WBNA 4NYNA 4CFAA 1TUUA 3NMUA 4CEQA 4CIEA 3SQ2A 2PBDA 4MDAA 3E1YA 3SV4A 1U45A 3SUNA 1VSKA 2B4JA 3AO5A 4B9TA 1N8RO 3NH1A 3NE6A 3T1HK 3ZSWA 4F2RA 4DLEA 5I9EB 3TAQA 1TVRA 5FLXO 1BIUA 2Q2RA 1NGJA 2XHBA 3QBXA 4C8NA 4CF8A 1WSIA 4Y1DA 1X9JA 4I2QA 1WN7A 2YKNA 2P9KB 3HBTA 4I9LA 4BROA 4FM2A 3RR8A 3SQ0A 3OTOK 4A2BA 1S5JA 3TSQA 2WTUA 3KD1E 4ISEA 4E7LA 3VENA 4FK4A 2XY7A 2XRIA 1LWFA 4DTSA 3NGYA 4E89A 4FJNA 2ASPA 5SZTA 4ELVA 4FPAA 3TAEA 3WXKA 5I3UA 3N4QA 4IOAL 5KGXA 3GBTA 2YHXA 4CJEA 4YDUA 3THYB 3J7YP 4N76A 4CHQA 2I7PA 1R59O 3EEQA 2E6LA 3QDKA 1YTUA 5HL7L 2P1JA 4DV5K 4NCGA 3OS0A 4BG9A 3AVBA 4KHQA 4JKHA 1HQEA 1JXEA 5M1QA 4FJIA 1EWQA 3MEEA 5AQUA 4CJ7A 3O4WA 2YNHA 3PV8A 1M90O 3SYZA 4JKEA 3VQEA 3D2FB 1SV5A 2Z1JA 1EP4A 3W0LA 2XY6A 2KZZA 3ZEUB 3NF6A 3OS2A 3VQ7A 3TU5A 5BRFA 3HRGA 4O44A 1OKJA 1Y64A 3QO9A 4DFJA 3PY8A 4B1YB 4ILHA 3L8BA 1XI1A 2CH5A 1WAFA 4LFBK 3LDLA 1IG8A 4CZEA 5LJVA 3D6RA 3OYGA 5TKYA 4H0XB 1OVYA 1EKEA 5FDLA 5GIOA 3E9LA 4GV6A 4BRQA 3OYNA 3HJFA 2IAJA 1XNQK 4CW7B 1UA0A 1S22A 4IO8A 4CJWA 3MXMA 3DLGA 3DRPA 2ZQBA 1KVBA 3RMCA 3AAPA 3QB0A 4JAXA 1LV5A 4FCYA 4FLTA 2P9UB 5J2PA 2GWJA 5J2NA 4CGJA 4CF0A 1VAZA 1S1WA 3WT0A 4YORA 1ATRA 3S9HA 4FZYA 5AZIB 3O3GA 1S6QA 3GG4A 1HX1A 4FJHA 3I56N 4KHPK 3MN5A 4B3OA 3VF4A 3WXJA 4BDPA 4GV3A 1S9EA 1T44A 4CJLA 4OPKA 1DTTA 3ZSVA 3DXKB 3F73A 4F2SA 5H1SQ 2X6NA 1VQ9N 3P1GA 1JCGA 3VGKA 3P5JA 2A6AA 2KTQA 5JMVA 1F21A 2NRHA 3O80A 4F8RA 3R9PA 4DTXA 3O4NA 3CQ8A 4FJKA 1RT6A 2BGGA 3OYMA 3UIQA 3AVNA 5LMUK 2OPSA 3MN9A 4KTZA 4LSNA 3KLHA 5GAHP 4FJXA 3L0QA 2VYPA 3QFUA 2V7ZA 3CC7N 3C94A 1QSSA 3MDQA 4KBOA 5FPNA 1QSLA 3CFPA 3VMFB 4ILJA 1W9HA 3AVHA 4CCHA 4DCHA 5M1FA 3HP6A 2QKKA 1C1CA 2KFZA 1HKBA 3MEDA 3VF2A 1QVFM 1NGDA 3OHRA 4IKFA 2HNDA 3S41A 4KAZA 1NK5A 1RBVA 5DM6L 4DR5K 3MWTA 1HKGA 4FWNA 1QQCA 3AVCA 3PX4A 4DV6K 2AP1A 5JS2A 1ASUA 2YHAA 4PA1A 1DTQA 4LSLA 2V7YA 4BRKA 5CE3A 4Z4HA 2AA4A 3AO2A 4M3TA 3ENOA 1VSEA 1QE1A 3VQCA 4RTFD 4BRDA 3LZJA 4BRFA 3AVJA 1HR0K 1NU0A 2QWLA 5CZ2A 4YFUA 3KKRA 1GLAG 4LF8K 3VGMA 3THXB 3P39A 5GADP 1D8YA 5BRDA 2RN2A 4U7BA 2P9IB 4BWJA 3ZSZA 4EFHA 4WE1A 1NKEA 3NGZA 2B5JA 1L3SA 2EX3A 3FGUA 2HBMA 5C10A 3PO5A 1WSJA 2OZMA 1NBWA 2WONA 4FLWA 4O8KA 4DTUA 2D5RA 4BE2A 2IS3A 4GKKK 4OO1J 2F96A 4CGGA 3PO4A 3HT3A 3NVMA 4J2EA 4KTQA 1JLAA 4RW9A 5AQXA 4XH4A 4EAHD 4GV9A 1X9MA 4H5NA 5CR4A 1NOZA 1VK0A 1ILYA 4DV4K 5M1OA 3KLFA 3SV3A 4DQIA 3WUHA 3T1YK 3AV9A 3TPQA 1RBSA 5AZJB 3J80O 3QIPA 5C2DA 5KTQA 3A5OC 4CGFA 2FXUA 2O8CA 2YKMA 3G71N 3CCJN 3AA3A 2VWKA 5TKWA 2F8SA 3CJ1A 3UKUB 4B3TK 1TL1A 2VG7A 4Z4EA 1BU6O 3UKRB 2PFUA 2QWRA 2QXLA 4BRCA 1CXUA 3HVTA 3LP2A 5M1PA 3MN6A 4A59A 3KLIA 4BRAA 2YHBA 3ZSOA 4NCAA 3OBWA 3TAMA 3CFOA 3G6EN 4F3OA 2G8HA 3PIPL 3HPOA 3H1QA 4DV2K 3TANA 4CZMA 3D2EA 2O8BA 4CGDA 2V52B 4I2PA 1DKGD 4FK2A 3KLGA 1HNZK 1TK5A 1BL3A 1RDUA 3BEXA 5AQTA 1HQUA 4CEDA 1WBDA 5GINA 4J2AA 1IKVA 4DFPA 3V9UA 2VWJA 2PYLA 3AO4A 4CF1A 3WXIA 4JV5K 3O9UA 1U48A 5GAEP 3ZSQA 4B9VA 4R79A 3MCPA 4FJMA 3V81A 4FJGA 3Q7CA 4X65K 4CBXA 2A3ZA 1X9WA 1VSMA 1NGHA 5KRTA 2YX6A 2R7YA 2EWSA 4A5BA 4IJNA 2ASMA 3ZSYA 1WBBA 1YUWA 3V6DA 4B9QA 3LZIA 4JLHA 1RCHA 3FZHA 5KPTA 1KFSA 4ELUA 3CG7A 2BE2A 1S1VA 3L3UA 3E66A 4CJFA 2QWQA 2ITMA 2HHTA 2HHQA 4CEZA 4LH5A 1WOQA 4DR3K 4CEFA 4CZIA 4BDYA 4AM7A 1RILA 4E7JA 1XHZA 3KK3A 2D0PA 5AZJA 3K58A 4FW1A 4CJSA 1BQMA 4GVEA 4CJQA 1VSHA 5FROA 3O3HA 2DFEA 1X9SA 2ZGYA 1C1BA 1JCFA 4JKBA 4LH4A 1FKOA 4IEEA 4AILC 4QOZB 1YF5L 4BQZA 2O8DA 4H4OA 1WUAA 1LCUA 2P9SA 4IDHA 4PL8A 3K0SA 1VQ8N 3PSIA 3CI5A 3C6TA 3AGRA 5AQHA 4BRMA 2E6MA 4FM0A 4KI4A 4B08A 1KFDA 4JKDA 1O13A 3I55N 3OJUA 1B92A 2P9IA 1WSEA 2ZF5O 2HBLA 2GBZA 1TV6A 2Q0UA 1NJIO 1EX4A 3VEWA 4CHNA 3TTDA 4BRHA 1YHQN 3HP9A 4B1XB 5HRSA 3OYHA 3S3OA 1RT1A 3K2PA 1VQLN 4FWSA 4FJ9A 4CJRA 2VGNA 3LAKA 1KAYA 2F8TA 3K5OA 4ELTA 1H1VA 3NGIA 4BE0A 3ATVA 3AA5X 1SL0A 2IVNA 3ID6A 2D4WA 3AVLA 3L4QA 4KHWA 4MO4A 3SQ1A 1BI4A 2EHGA 4FPBA 4J2DA 1GOBA 4CF2A 1BIZA 1W7AA 4ILGB 5AQOA 4A2AA 2IVPA 4FLZA 3CCLN 1HNIA 3C65A 1L5UA 5C0YA 2WFBA 4XIUA 1D4XA 4PKGA 4QS7A 2OTJN 2P9NA 3HPHA 3DLLL 3IAYA 3A5LC 3ITHA 4Y1CA 2G8FA 3K9JA 1VQ4N 4HCBA 3QBWA 1Q81O 3KVGA 1X3NA 2BANA 2P9PA 1U04A 4FJLA 3QLHA 2UUCK 5JS1A 2Q0RA 1LWEA 1L3UA 1UWBA 4CZJA 1WSGA 1D9FA 1N36K 3LDQA 3ZYYX 2O8FB 2NRVA 3U8XA 3TWHA 5JVHL 1RBRA 2P9PB 4GMJB 4I6MB 2HHSA 4WQ5C 5HRPA 1HYVA 5IT9O 3THYA 3CJBA 3K9KA 4M63C 1C0GA 4AHUA 1E3MA 1KAZA 3A5MC 3BZKA 4B1VA 4DHYA 1FJGK 4B9UA 4OJRA 3T7ZA 1IJJA 1SL1A 3WNHA 4KHSA 2X74A 3CPEA 4E1NA 1Q18A 4DTOA 3AA2A 2A42A 3UB5A 3PX0A 1RNHA 4KFBA 1SUQA 3FFKB 1RDBA 2HMIA 1ZC6A 3AGKA 3LWLA 2IGIA 4DTJA 1VQKN 3WQTA 4HWIA 1WSHA 4CFCA 1A5XA 3PIOL 4CJPA 4LF7K 5CYQA 4BVPA 2NUBA 3CC2N 1S9GA 2P9LA 3A0IX 3F9KA 3I8DA 2QW9A 4NYFA 1YXQA 3SPYA 1YJNN 5HLFA 3DLKA 4CZFA 5DM7L 2QEXN 2D1KA 4JI5K 3VEVA 3MK6A 5M1NA 4DSIA 4DV3K 2OANA 2HF4A 3MMVA 4G1QA 3TI0A 1VSFA 1Q86O 3K59A 4YOTA 3C6UA 2FBVA 1X1PA 4DTNA 3CF5L 5EOYA 1P8ZA 4B9LA 3HYFA 4B9SA 3LAMA 2IDOA 3L2RA 5BRHA 1JLQA 5JICA 1J53A 4JKFA 1RTJA 3ENBA 2YNFA 2FSJA 3HTVA 4DB3A 1N6QA 4C1NK 4H0VB 4WQ5A 1XMOK 4CGIA 4WQ4A 4A62A 4PHTX 1VQMN 4PWDA 5CYMA 1XMQK 2OTLN 1DGKN 5AQWA 1B9DA
chains in the Genus database with same CATH topology
4FJKA 1RT6A 2BGGA 3IRXA 4DMNA 3H08A 3OYMA 3UIQA 3AVNA 3ZCMA 3VA0A 1NJXA 3WNGA 2XY5A 4GW6A 2OPSA 3OYJA 4JRPA 4KTZA 1TGOA 4LSNA 3JYTA 4PY5A 3DRRA 3KLHA 1ASVA 4IFYA 5HP1A 3BGRA 4QAGA 4FJXA 3QIOA 1UAXA 1YT3A 4DU4A 4JS4A 3C94A 4L8RB 3QESA 1QSSA 1FXXA 4FLYA 1QSLA 3M8SA 3VQ6A 3CFPA 2W42A 1IKWA 1JKHA 4DG1A 4M3XA 3CFRA 5J2QA 1W9HA 3AVHA 4CCHA 1GOAA 1REVA 1SKSA 3HP6A 4EZ9A 3RWUA 4Z4FA 3QETA 2QKKA 1GOCA 4AHCA 1C1CA 3SQ4A 2KFZA 3MEDA 4FZZA 4IKFA 1BGXT 3ULDA 1LW2A 2HNDA 5K14A 2HNYA 3T1AA 4CERA 4QCLA 4KAZA 1NK5A 1RBVA 1ZYQA 1IKXA 3NBPA 1RTDA 4O55A 2HHUA 3V9ZA 4KHUA 1XHXA 1TL3A 3VQ5A 1XWLA 2Z1GA 2ZE2A 4BE1A 3L2WA 1QQCA 3AVCA 4KV8A 1A5VA 3AVFA 4Z4IA 1HYSA 3PX4A 4TSXA 1C6VA 1Z26A 3RR7A 5JS2A 1ASUA 2YHAA 1LW0A 1RBUA 4I9QA 4PA1A 4CJ3A 1D5AA 1JL1A 3VQAA 1DTQA 4IG0A 4LSLA 3T19A 5SWMA 1EXQA 4Z4HA 3KJVA 2HHWA 4DQPA 4M3TA 3AO2A 3RRHA 5FRNA 1VSEA 1QE1A 3VQCA 4FJJA 4DSJA 3LZJA 2QK9A 4OGCA 2RKIA 4FLXA 1RDDA 1K6YA 1YTAA 3AVJA 3QEXA 3S3NA 3QEIA 2HW3A 2QXFA 5CZ2A 4N56A 1JXBA 3DM2A 4YFUA 2OA8A 3KKRA 2ATQA 4DSEA 1CXQA 5I42A 4K8ZA 4HUEA 4AH9A 4CECA 4E7HA 4DSFA 4FW2A 3NH0A 1D8YA 3SUQA 1NK6A 2RN2A 4CK1A 1ZBLA 2GUIA 4BWJA 3ZSZA 3BDPA 4WE1A 4CEBA 1NKEA 3NGZA 2B5JA 1L3SA 4IDKA 2EX3A 4BACA 1EETA 4CIGA 1NK9A 4OKKA 3SUPA 3M8PA 3VQBA 1BCMA 3PO5A 1WSJA 4CK2A 2OZMA 1KCFA 1O1WA 3ZT4A 3CQ8A 2D0CA 4CJVA 4RW7A 1W0HA 2WONA 1C0UA 4CEAA 4H8KA 4DTRA 4Z4GA 4FLWA 5FRMA 4C8KA 4DTUA 1I39A 2D5RA 4BE2A 4CHPA 1QSYA 2IS3A 4W5NA 3NF7A 1KVCA 4Z0UA 3HM9A 2DTUA 1S1UA 3T3FA 2F96A 4CGGA 3L2VA 3PO4A 1J9AA 3HT3A 3DMJA 5C42A 4M3WA 4J2EA 3SNNA 1JLAA 4KTQA 4RW9A 4E3SA 3PX6A 2G8WA 1TAUA 1RTHA 3AVMA 1X9MA 3HSTB 1BCOA 3NDKA 1NOZA 1VK0A 1RT4A 3V9SA 3SI6A 2HHVA 1IH7A 5HROA 2KW4A 1RDCA 3HK2A 1BQNA 3HL8A 3KLFA 3SV3A 4DQIA 4EZ6A 4DWIA 3AV9A 3D0PA 4IFVA 1HPZA 3KIOA 4O4GA 4GVMA 1RBSA 1T03A 4Q5VA 2YNGA 4FLVA 4M3UA 3V4IA 3CM6A 3QIPA 1HJRA 3C95A 3MEGA 3VQPA 5KTQA 3TAGA 4CGFA 4Q0BA 4DQSA 1N5YA 1RDAA 2E4LA 2RF2A 1TKZA 4CJKA 2KZMA 2YKMA 2HB5A 3OS1A 4O5BA 5C24A 3QNOA 3AA3A 3DLEA 2VWKA 3G10A 3IG1A 3NFAA 4W5QA 4H4MA 3OYKA 2F8SA 2OZSA 2O4IA 1TL1A 4AHVA 1QTMA 2VG7A 4Z4EA 1QHTA 3ALYA 1DLOA 4CEEA 2OYQA 2FBTA 2FBYA 4O0JA 1LAWA 3V1OA 1L3VA 2YNIA 4CHZA 2X6SA 3U3GA 1CXUA 3HVTA 4HHTA 3LP2A 1ZBUA 1KVAA 2YV0X 3RMBA 4AHTA 1KTQA 3M8RA 4FZXC 2RPIA 3KLIA 3DYAA 3U6FA 4KKOA 3HO1A 1ASWA 2O4GA 2YHBA 5CZ1A 1Q8IA 2I5JA 3ZSOA 3WNEA 4DQQA 4DS5A 4DU1A 4AHRA 4MQ3A 4E0DA 4NCAA 3TAMA 1S1XA 3CFOA 3QEWA 1J5OA 2G8HA 3I0RA 4F3OA 4KB0A 4B9LA 1HMVA 3HPOA 3AA4A 2OPPA 1HYZA 3NCIA 4HVJA 3TANA 4RG8A 4PQUA 1NJZA 3L2QA 4CGDA 2D0BA 4I2PA 3JSMA 4FK2A 4RW8A 4CFBA 3KLGA 3VN5A 4BWMA 1TK5A 2P5GA 1BL3A 1TKTA 3EYZA 3LANA 1HQUA 4CEDA 4EP5A 3KK1A 3MAQA 1TAQA 3THVA 5D3GA 1C0TA 4J2AA 4W5RA 4B8CA 1IKVA 4DFPA 1Q9XA 3V9UA 1RT2A 2VWJA 5T7BA 2PYLA 3AO4A 4CF1A 1NKBA 3ZT3A 2G8UA 4RW6A 2KFNA 3DLRA 3NH2A 1U48A 1A5WA 3ZSQA 4B9VA 1HRHA 2FC0A 4W5OA 4FJMA 3TAFA 3V81A 3OYAA 4KHYA 4DTMA 1B9FA 3LALA 3MXJA 4FJGA 1IO2A 3ZSXA 3SZ2A 1S6PA 1Y97A 4R5PA 1X9WA 2JLEA 2OPQA 1T7PA 1VSMA 5KRTA 2Y1JA 1KLMA 3V9XA 2R7YA 1J54A 1WAJA 1TK0A 1MU2A 4N41A 3LP1A 3ZSYA 4CHYA 3OJSA 4DTPA 4DFMA 3V6DA 3LZIA 4JLHA 1RCHA 2VG6A 1FKPA 3ISNC 3OYFA 1KFSA 4ELUA 3CG7A 4LY7A 3QNNA 2HHXA 2BE2A 4FM1A 1S1VA 1CZ9A 3KK2A 5KGWA 3L3UA 4DU3A 4CJFA 1R0AA 3I0SA 5J1EA 4KO0A 2HHTA 2HHQA 4CEZA 4KREA 4LH5A 3S3MA 4CEFA 4E1MA 1ZBIA 2G8IA 4BDYA 3TAPA 1RILA 4E7KA 5DMRA 4E7JA 3HPGA 4KPYA 1XHZA 3KK3A 3SCXA 1JLGA 3B6PA 4OGEA 5HBMA 3K58A 3VQ9A 2DFHA 4FW1A 4CJSA 4YNQA 3LDSA 1BQMA 4NCBA 1LAVA 4CJQA 4FXDA 2AJQA 4DS4A 3QERA 3TABA 3DI6A 3FFIA 3RMDA 2ETJA 3AVAA 2ITGA 1SKWA 3VQQA 1RT3A 1VSHA 5FROA 4M41A 3ZT2A 4CIFA 1JL2A 2DFEA 3O3HA 4M45A 1X9SA 3OYEA 3VA3A 1C1BA 1Z25A 5J2MA 4LH4A 4JS5A 4OLAA 3OYCA 4KRFA 1FKOA 4K8XA 3K5MA 4OKEA 4DF8A 1UA1A 1T05A 4AILC 4KB1A 4QOZB 3QINA 1UOCA 3SJJA 2Y1IA 2VG5A 4H4OA 3ZT0A 3L2UA 3VQDA 3EY1A 4DLGA 4CK3A 4OKJA 4CESA 3DRSA 1WNSA 2G8KA 4NYNA 4CFAA 4CJUA 3MXIA 3OYDA 3C6TA 4JRQA 3ZSRA 4CEQA 4CIEA 3SQ2A 4M42A 1SL2A 2E6MA 3LP0A 4FM0A 4KI4A 3OVNA 3SV4A 3ASMA 4B08A 3EZ5A 1XC9A 1KFDA 1U45A 1KLNA 2PZSA 4C8LA 3SUNA 3OJUA 1VSKA 1B92A 2B4JA 4N5SA 3AO5A 4B9TA 1NJWA 1WSEA 3NH1A 2GBZA 3NE6A 3AVIA 4N47A 3AO1A 1IG9A 1TV6A 3NF9A 3ZSWA 4F2RA 4DLEA 1EX4A 2PYJA 3TAQA 1TVRA 1BIUA 2IOCA 4CF9A 2XHBA 4C8NA 4C8MA 4CHNA 1LWCA 1TK8A 4FJ5A 2HVIA 4CF8A 2Q3SA 1WSIA 3ZT1A 4O0IA 3HP9A 3LPUA 4Y1DA 5HRSA 4W5TA 3OYBA 3O3FA 3OYHA 4F4KA 3S3OA 3NHGA 1RT1A 4AHSA 4FJ8A 3K2PA 4OLBA 3KLEA 5CY4A 4I2QA 4FJ9A 4CJRA 1HNVA 1WN7A 2YKNA 1VSIA 3LAKA 5KI6A 1T8EA 4FYDA 2F8TA 1YVUA 3K5OA 4I9LA 4UQGA 4FM2A 3NGIA 4CEOA 4ELTA 3KD5E 3RR8A 4BE0A 3SQ0A 4I7FA 3AA5X 1S5JA 1SL0A 3KD1E 4FLUA 3AVLA 4E19A 4E7LA 1G15A 3K5LA 2XY7A 4FK4A 4KHWA 3SQ1A 2XRIA 1BI4A 1LWFA 4PUOA 4IG3A 3CM5A 2EHGA 1KSPA 2FBXA 4J2DA 1WSFA 3NGYA 4DTSA 1GOBA 4E89A 4CF2A 4FJNA 1BIZA 5SZTA 3E01A 4ELVA 4J2BA 3AVKA 3TAEA 5I3UA 1ITGA 2A1RA 3K57A 4HTUA 1KRPA 4FJ7A 2QKBA 5KGXA 4FLZA 4CJEA 3TR8A 1NJYA 1HNIA 4MFBA 3OYIA 1NK7A 3DOKA 1L5UA 4CGHA 4XIUA 1JLFA 2IC3A 2LSNA 1Q9YA 4N76A 4CHQA 3A2FA 3HPHA 3IAYA 3ITHA 3B6OA 3NF8A 4Y1CA 2G8FA 2X78A 2E6LA 4ID1A 4HCBA 1YTUA 2HNZA 2P1JA 4KHNA 1ZBFA 3LPTA 3V9WA 4NCGA 3OS0A 2BANA 1U04A 3SUOA 4FJLA 2Z1IA 3QLHA 1I3AA 4DSKA 3AVBA 5JS1A 4DFKA 4KHQA 1U47A 1HQEA 1JXEA 1LWEA 5E41A 3LWMA 4FJIA 3MEEA 1L3UA 4CHOA 1UWBA 3VQ8A 1RT5A 1RTIA 2YNHA 3HVRA 4E7IA 3PV8A 1NK8A 3SYZA 2P51A 3VQEA 1RT7A 1SV5A 1WSGA 2Z1JA 1D9FA 2Z1HA 1EP4A 4Z4CA 1NK0A 4ICLA 4B9MA 1VRUA 2XY6A 2KZZA 1RBTA 3NF6A 2OPRA 3OS2A 3VQ7A 3TWHA 1RBRA 1C0MA 1CZBA 3LP3A 4O44A 3PUFA 4M3RA 4CE9A 4ZHRA 4GMJB 2HHSA 1L3TA 1JLEA 3QO9A 1C1AA 5DK5A 2A1SA 3V1QA 4DFJA 2PY5A 3PY8A 5HRPA 4ZTJA 3L3VA 1U4BA 4CFDA 1HYVA 2WOMA 3L8BA 3RMAA 1NKCA 1NK4A 4FK0A 1BISA 3M8QA 1XI1A 1WAFA 4AHUA 2XO7A 1D9DA 4CJTA 4B9UA 4OJRA 4F3TA 1SL1A 3WNHA 3OYGA 4KHSA 4KI6A 2X74A 4E1NA 1TKXA 1EKEA 5FDLA 4DTOA 3AA2A 1TKDA 2DY4A 3PX0A 4DSLA 1RNHA 4KFBA 4DF4A 2G8VA 3CYMA 1SUQA 3OYNA 3HJFA 1BI4B 1RDBA 2IAJA 2HMIA 3AVGA 3WNFA 1UA0A 3LWLA 2IGIA 4DTJA 5C25A 3V1RA 4OVLA 4CJWA 2HVHA 3MXMA 3DLGA 1CLQA 2DFFA 1S1TA 3DRPA 1WSHA 1VSDA 2ZQBA 1A5XA 1KVBA 4KTWA 5EU7A 4CFCA 5CYQA 4CJPA 3RMCA 2KQ2A 4RW4A 3DOLA 2NUBA 1S9GA 3F9KA 3I8DA 4BDZA 3AO3A 4DQRA 4FCYA 4FLTA 1LV5A 4NYFA 3VQ4A 5KRSA 3SPYA 3HXMA 5J2PA 1NOYA 3K5NA 3DLKA 4FVMA 4LD0A 3SPZA 5HLFA 1VSJA 5J2NA 4CGJA 4CF0A 4CJ5A 1S1WA 4EP4A 3RTVA 1U49A 2BDPA 3G0ZA 3NAEA 3MECA 3S9HA 4DSIA 4FZYA 1VRTA 4IBNA 4ID5A 3O3GA 3U3YA 3IS9A 4M3ZA 1S6QA 1VSLA 4G1QA 3QEPA 3OYLA 3TI0A 1FK9A 1VSFA 2D0AA 4C8OA 4FJHA 3K59A 3QEVA 1SKRA 3KTQA 3C6UA 2FBVA 4B8AB 3TARA 4B3OA 1X1PA 4DTNA 4OPJA 4BDPA 1ZBHA 1S9EA 4CJLA 1JLBA 3HYFA 2P5OA 2ZD1A 2JGUA 1BHLA 3LAMA 4CJ4A 4B9SA 2IDOA 3P83D 3L2RA 1QS4A 1IKYA 3RRGA 4OPKA 1DTTA 1JLQA 3D45A 3ZSVA 4HCCA 1J53A 3DLHA 1RTJA 3F73A 4F2SA 2YNFA 4M3YA 2X6NA 1N6QA 3P1GA 2XY8A 4HUGA 3P5JA 5HRNA 1JLCA 2B6AA 3O4QA 4B9NA 2KTQA 4CGIA 4HUFA 1F21A 3KKSA 4PWDA 2GV9A 5CYMA 5HRRA 3OY9A 4F8RA 4ZTFA 4DTXA 1WLJA 3O4NA 3DLBA 1B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJK A;  1RT6 A;  2BGG A;  3IRX A;  4DMN A;  3H08 A;  3OYM A;  3UIQ A;  3AVN A;  3ZCM A;  3VA0 A;  1NJX A;  3WNG A;  2XY5 A;  4GW6 A;  2OPS A;  3OYJ A;  4JRP A;  4KTZ A;  1TGO A;  4LSN A;  3JYT A;  4PY5 A;  3DRR A;  3KLH A;  1ASV A;  4IFY A;  5HP1 A;  3BGR A;  4QAG A;  4FJX A;  3QIO A;  1UAX A;  1YT3 A;  4DU4 A;  4JS4 A;  3C94 A;  4L8R B;  3QES A;  1QSS A;  1FXX A;  4FLY A;  1QSL A;  3M8S A;  3VQ6 A;  3CFP A;  2W42 A;  1IKW A;  1JKH A;  4DG1 A;  4M3X A;  3CFR A;  5J2Q A;  1W9H A;  3AVH A;  4CCH A;  1GOA A;  1REV A;  1SKS A;  3HP6 A;  4EZ9 A;  3RWU A;  4Z4F A;  3QET A;  2QKK A;  1GOC A;  4AHC A;  1C1C A;  3SQ4 A;  2KFZ A;  3MED A;  4FZZ A;  4IKF A;  1BGX T;  3ULD A;  1LW2 A;  2HND A;  5K14 A;  2HNY A;  3T1A A;  4CER A;  4QCL A;  4KAZ A;  1NK5 A;  1RBV A;  1ZYQ A;  1IKX A;  3NBP A;  1RTD A;  4O55 A;  2HHU A;  3V9Z A;  4KHU A;  1XHX A;  1TL3 A;  3VQ5 A;  1XWL A;  2Z1G A;  2ZE2 A;  4BE1 A;  3L2W A;  1QQC A;  3AVC A;  4KV8 A;  1A5V A;  3AVF A;  4Z4I A;  1HYS A;  3PX4 A;  4TSX A;  1C6V A;  1Z26 A;  3RR7 A;  5JS2 A;  1ASU A;  2YHA A;  1LW0 A;  1RBU A;  4I9Q A;  4PA1 A;  4CJ3 A;  1D5A A;  1JL1 A;  3VQA A;  1DTQ A;  4IG0 A;  4LSL A;  3T19 A;  5SWM A;  1EXQ A;  4Z4H A;  3KJV A;  2HHW A;  4DQP A;  4M3T A;  3AO2 A;  3RRH A;  5FRN A;  1VSE A;  1QE1 A;  3VQC A;  4FJJ A;  4DSJ A;  3LZJ A;  2QK9 A;  4OGC A;  2RKI A;  4FLX A;  1RDD A;  1K6Y A;  1YTA A;  3AVJ A;  3QEX A;  3S3N A;  3QEI A;  2HW3 A;  2QXF A;  5CZ2 A;  4N56 A;  1JXB A;  3DM2 A;  4YFU A;  2OA8 A;  3KKR A;  2ATQ A;  4DSE A;  1CXQ A;  5I42 A;  4K8Z A;  4HUE A;  4AH9 A;  4CEC A;  4E7H A;  4DSF A;  4FW2 A;  3NH0 A;  1D8Y A;  3SUQ A;  1NK6 A;  2RN2 A;  4CK1 A;  1ZBL A;  2GUI A;  4BWJ A;  3ZSZ A;  3BDP A;  4WE1 A;  4CEB A;  1NKE A;  3NGZ A;  2B5J A;  1L3S A;  4IDK A;  2EX3 A;  4BAC A;  1EET A;  4CIG A;  1NK9 A;  4OKK A;  3SUP A;  3M8P A;  3VQB A;  1BCM A;  3PO5 A;  1WSJ A;  4CK2 A;  2OZM A;  1KCF A;  1O1W A;  3ZT4 A;  3CQ8 A;  2D0C A;  4CJV A;  4RW7 A;  1W0H A;  2WON A;  1C0U A;  4CEA A;  4H8K A;  4DTR A;  4Z4G A;  4FLW A;  5FRM A;  4C8K A;  4DTU A;  1I39 A;  2D5R A;  4BE2 A;  4CHP A;  1QSY A;  2IS3 A;  4W5N A;  3NF7 A;  1KVC A;  4Z0U A;  3HM9 A;  2DTU A;  1S1U A;  3T3F A;  2F96 A;  4CGG A;  3L2V A;  3PO4 A;  1J9A A;  3HT3 A;  3DMJ A;  5C42 A;  4M3W A;  4J2E A;  3SNN A;  1JLA A;  4KTQ A;  4RW9 A;  4E3S A;  3PX6 A;  2G8W A;  1TAU A;  1RTH A;  3AVM A;  1X9M A;  3HST B;  1BCO A;  3NDK A;  1NOZ A;  1VK0 A;  1RT4 A;  3V9S A;  3SI6 A;  2HHV A;  1IH7 A;  5HRO A;  2KW4 A;  1RDC A;  3HK2 A;  1BQN A;  3HL8 A;  3KLF A;  3SV3 A;  4DQI A;  4EZ6 A;  4DWI A;  3AV9 A;  3D0P A;  4IFV A;  1HPZ A;  3KIO A;  4O4G A;  4GVM A;  1RBS A;  1T03 A;  4Q5V A;  2YNG A;  4FLV A;  4M3U A;  3V4I A;  3CM6 A;  3QIP A;  1HJR A;  3C95 A;  3MEG A;  3VQP A;  5KTQ A;  3TAG A;  4CGF A;  4Q0B A;  4DQS A;  1N5Y A;  1RDA A;  2E4L A;  2RF2 A;  1TKZ A;  4CJK A;  2KZM A;  2YKM A;  2HB5 A;  3OS1 A;  4O5B A;  5C24 A;  3QNO A;  3AA3 A;  3DLE A;  2VWK A;  3G10 A;  3IG1 A;  3NFA A;  4W5Q A;  4H4M A;  3OYK A;  2F8S A;  2OZS A;  2O4I A;  1TL1 A;  4AHV A;  1QTM A;  2VG7 A;  4Z4E A;  1QHT A;  3ALY A;  1DLO A;  4CEE A;  2OYQ A;  2FBT A;  2FBY A;  4O0J A;  1LAW A;  3V1O A;  1L3V A;  2YNI A;  4CHZ A;  2X6S A;  3U3G A;  1CXU A;  3HVT A;  4HHT A;  3LP2 A;  1ZBU A;  1KVA A;  2YV0 X;  3RMB A;  4AHT A;  1KTQ A;  3M8R A;  4FZX C;  2RPI A;  3KLI A;  3DYA A;  3U6F A;  4KKO A;  3HO1 A;  1ASW A;  2O4G A;  2YHB A;  5CZ1 A;  1Q8I A;  2I5J A;  3ZSO A;  3WNE A;  4DQQ A;  4DS5 A;  4DU1 A;  4AHR A;  4MQ3 A;  4E0D A;  4NCA A;  3TAM A;  1S1X A;  3CFO A;  3QEW A;  1J5O A;  2G8H A;  3I0R A;  4F3O A;  4KB0 A;  4B9L A;  1HMV A;  3HPO A;  3AA4 A;  2OPP A;  1HYZ A;  3NCI A;  4HVJ A;  3TAN A;  4RG8 A;  4PQU A;  1NJZ A;  3L2Q A;  4CGD A;  2D0B A;  4I2P A;  3JSM A;  4FK2 A;  4RW8 A;  4CFB A;  3KLG A;  3VN5 A;  4BWM A;  1TK5 A;  2P5G A;  1BL3 A;  1TKT A;  3EYZ A;  3LAN A;  1HQU A;  4CED A;  4EP5 A;  3KK1 A;  3MAQ A;  1TAQ A;  3THV A;  5D3G A;  1C0T A;  4J2A A;  4W5R A;  4B8C A;  1IKV A;  4DFP A;  1Q9X A;  3V9U A;  1RT2 A;  2VWJ A;  5T7B A;  2PYL A;  3AO4 A;  4CF1 A;  1NKB A;  3ZT3 A;  2G8U A;  4RW6 A;  2KFN A;  3DLR A;  3NH2 A;  1U48 A;  1A5W A;  3ZSQ A;  4B9V A;  1HRH A;  2FC0 A;  4W5O A;  4FJM A;  3TAF A;  3V81 A;  3OYA A;  4KHY A;  4DTM A;  1B9F A;  3LAL A;  3MXJ A;  4FJG A;  1IO2 A;  3ZSX A;  3SZ2 A;  1S6P A;  1Y97 A;  4R5P A;  1X9W A;  2JLE A;  2OPQ A;  1T7P A;  1VSM A;  5KRT A;  2Y1J A;  1KLM A;  3V9X A;  2R7Y A;  1J54 A;  1WAJ A;  1TK0 A;  1MU2 A;  4N41 A;  3LP1 A;  3ZSY A;  4CHY A;  3OJS A;  4DTP A;  4DFM A;  3V6D A;  3LZI A;  4JLH A;  1RCH A;  2VG6 A;  1FKP A;  3ISN C;  3OYF A;  1KFS A;  4ELU A;  3CG7 A;  4LY7 A;  3QNN A;  2HHX A;  2BE2 A;  4FM1 A;  1S1V A;  1CZ9 A;  3KK2 A;  5KGW A;  3L3U A;  4DU3 A;  4CJF A;  1R0A A;  3I0S A;  5J1E A;  4KO0 A;  2HHT A;  2HHQ A;  4CEZ A;  4KRE A;  4LH5 A;  3S3M A;  4CEF A;  4E1M A;  1ZBI A;  2G8I A;  4BDY A;  3TAP A;  1RIL A;  4E7K A;  5DMR A;  4E7J A;  3HPG A;  4KPY A;  1XHZ A;  3KK3 A;  3SCX A;  1JLG A;  3B6P A;  4OGE A;  5HBM A;  3K58 A;  3VQ9 A;  2DFH A;  4FW1 A;  4CJS A;  4YNQ A;  3LDS A;  1BQM A;  4NCB A;  1LAV A;  4CJQ A;  4FXD A;  2AJQ A;  4DS4 A;  3QER A;  3TAB A;  3DI6 A;  3FFI A;  3RMD A;  2ETJ A;  3AVA A;  2ITG A;  1SKW A;  3VQQ A;  1RT3 A;  1VSH A;  5FRO A;  4M41 A;  3ZT2 A;  4CIF A;  1JL2 A;  2DFE A;  3O3H A;  4M45 A;  1X9S A;  3OYE A;  3VA3 A;  1C1B A;  1Z25 A;  5J2M A;  4LH4 A;  4JS5 A;  4OLA A;  3OYC A;  4KRF A;  1FKO A;  4K8X A;  3K5M A;  4OKE A;  4DF8 A;  1UA1 A;  1T05 A;  4AIL C;  4KB1 A;  4QOZ B;  3QIN A;  1UOC A;  3SJJ A;  2Y1I A;  2VG5 A;  4H4O A;  3ZT0 A;  3L2U A;  3VQD A;  3EY1 A;  4DLG A;  4CK3 A;  4OKJ A;  4CES A;  3DRS A;  1WNS A;  2G8K A;  4NYN A;  4CFA A;  4CJU A;  3MXI A;  3OYD A;  3C6T A;  4JRQ A;  3ZSR A;  4CEQ A;  4CIE A;  3SQ2 A;  4M42 A;  1SL2 A;  2E6M A;  3LP0 A;  4FM0 A;  4KI4 A;  3OVN A;  3SV4 A;  3ASM A;  4B08 A;  3EZ5 A;  1XC9 A;  1KFD A;  1U45 A;  1KLN A;  2PZS A;  4C8L A;  3SUN A;  3OJU A;  1VSK A;  1B92 A;  2B4J A;  4N5S A;  3AO5 A;  4B9T A;  1NJW A;  1WSE A;  3NH1 A;  2GBZ A;  3NE6 A;  3AVI A;  4N47 A;  3AO1 A;  1IG9 A;  1TV6 A;  3NF9 A;  3ZSW A;  4F2R A;  4DLE A;  1EX4 A;  2PYJ A;  3TAQ A;  1TVR A;  1BIU A;  2IOC A;  4CF9 A;  2XHB A;  4C8N A;  4C8M A;  4CHN A;  1LWC A;  1TK8 A;  4FJ5 A;  2HVI A;  4CF8 A;  2Q3S A;  1WSI A;  3ZT1 A;  4O0I A;  3HP9 A;  3LPU A;  4Y1D A;  5HRS A;  4W5T A;  3OYB A;  3O3F A;  3OYH A;  4F4K A;  3S3O A;  3NHG A;  1RT1 A;  4AHS A;  4FJ8 A;  3K2P A;  4OLB A;  3KLE A;  5CY4 A;  4I2Q A;  4FJ9 A;  4CJR A;  1HNV A;  1WN7 A;  2YKN A;  1VSI A;  3LAK A;  5KI6 A;  1T8E A;  4FYD A;  2F8T A;  1YVU A;  3K5O A;  4I9L A;  4UQG A;  4FM2 A;  3NGI A;  4CEO A;  4ELT A;  3KD5 E;  3RR8 A;  4BE0 A;  3SQ0 A;  4I7F A;  3AA5 X;  1S5J A;  1SL0 A;  3KD1 E;  4FLU A;  3AVL A;  4E19 A;  4E7L A;  1G15 A;  3K5L A;  2XY7 A;  4FK4 A;  4KHW A;  3SQ1 A;  2XRI A;  1BI4 A;  1LWF A;  4PUO A;  4IG3 A;  3CM5 A;  2EHG A;  1KSP A;  2FBX A;  4J2D A;  1WSF A;  3NGY A;  4DTS A;  1GOB A;  4E89 A;  4CF2 A;  4FJN A;  1BIZ A;  5SZT A;  3E01 A;  4ELV A;  4J2B A;  3AVK A;  3TAE A;  5I3U A;  1ITG A;  2A1R A;  3K57 A;  4HTU A;  1KRP A;  4FJ7 A;  2QKB A;  5KGX A;  4FLZ A;  4CJE A;  3TR8 A;  1NJY A;  1HNI A;  4MFB A;  3OYI A;  1NK7 A;  3DOK A;  1L5U A;  4CGH A;  4XIU A;  1JLF A;  2IC3 A;  2LSN A;  1Q9Y A;  4N76 A;  4CHQ A;  3A2F A;  3HPH A;  3IAY A;  3ITH A;  3B6O A;  3NF8 A;  4Y1C A;  2G8F A;  2X78 A;  2E6L A;  4ID1 A;  4HCB A;  1YTU A;  2HNZ A;  2P1J A;  4KHN A;  1ZBF A;  3LPT A;  3V9W A;  4NCG A;  3OS0 A;  2BAN A;  1U04 A;  3SUO A;  4FJL A;  2Z1I A;  3QLH A;  1I3A A;  4DSK A;  3AVB A;  5JS1 A;  4DFK A;  4KHQ A;  1U47 A;  1HQE A;  1JXE A;  1LWE A;  5E41 A;  3LWM A;  4FJI A;  3MEE A;  1L3U A;  4CHO A;  1UWB A;  3VQ8 A;  1RT5 A;  1RTI A;  2YNH A;  3HVR A;  4E7I A;  3PV8 A;  1NK8 A;  3SYZ A;  2P51 A;  3VQE A;  1RT7 A;  1SV5 A;  1WSG A;  2Z1J A;  1D9F A;  2Z1H A;  1EP4 A;  4Z4C A;  1NK0 A;  4ICL A;  4B9M A;  1VRU A;  2XY6 A;  2KZZ A;  1RBT A;  3NF6 A;  2OPR A;  3OS2 A;  3VQ7 A;  3TWH A;  1RBR A;  1C0M A;  1CZB A;  3LP3 A;  4O44 A;  3PUF A;  4M3R A;  4CE9 A;  4ZHR A;  4GMJ B;  2HHS A;  1L3T A;  1JLE A;  3QO9 A;  1C1A A;  5DK5 A;  2A1S A;  3V1Q A;  4DFJ A;  2PY5 A;  3PY8 A;  5HRP A;  4ZTJ A;  3L3V A;  1U4B A;  4CFD A;  1HYV A;  2WOM A;  3L8B A;  3RMA A;  1NKC A;  1NK4 A;  4FK0 A;  1BIS A;  3M8Q A;  1XI1 A;  1WAF A;  4AHU A;  2XO7 A;  1D9D A;  4CJT A;  4B9U A;  4OJR A;  4F3T A;  1SL1 A;  3WNH A;  3OYG A;  4KHS A;  4KI6 A;  2X74 A;  4E1N A;  1TKX A;  1EKE A;  5FDL A;  4DTO A;  3AA2 A;  1TKD A;  2DY4 A;  3PX0 A;  4DSL A;  1RNH A;  4KFB A;  4DF4 A;  2G8V A;  3CYM A;  1SUQ A;  3OYN A;  3HJF A;  1BI4 B;  1RDB A;  2IAJ A;  2HMI A;  3AVG A;  3WNF A;  1UA0 A;  3LWL A;  2IGI A;  4DTJ A;  5C25 A;  3V1R A;  4OVL A;  4CJW A;  2HVH A;  3MXM A;  3DLG A;  1CLQ A;  2DFF A;  1S1T A;  3DRP A;  1WSH A;  1VSD A;  2ZQB A;  1A5X A;  1KVB A;  4KTW A;  5EU7 A;  4CFC A;  5CYQ A;  4CJP A;  3RMC A;  2KQ2 A;  4RW4 A;  3DOL A;  2NUB A;  1S9G A;  3F9K A;  3I8D A;  4BDZ A;  3AO3 A;  4DQR A;  4FCY A;  4FLT A;  1LV5 A;  4NYF A;  3VQ4 A;  5KRS A;  3SPY A;  3HXM A;  5J2P A;  1NOY A;  3K5N A;  3DLK A;  4FVM A;  4LD0 A;  3SPZ A;  5HLF A;  1VSJ A;  5J2N A;  4CGJ A;  4CF0 A;  4CJ5 A;  1S1W A;  4EP4 A;  3RTV A;  1U49 A;  2BDP A;  3G0Z A;  3NAE A;  3MEC A;  3S9H A;  4DSI A;  4FZY A;  1VRT A;  4IBN A;  4ID5 A;  3O3G A;  3U3Y A;  3IS9 A;  4M3Z A;  1S6Q A;  1VSL A;  4G1Q A;  3QEP A;  3OYL A;  3TI0 A;  1FK9 A;  1VSF A;  2D0A A;  4C8O A;  4FJH A;  3K59 A;  3QEV A;  1SKR A;  3KTQ A;  3C6U A;  2FBV A;  4B8A B;  3TAR A;  4B3O A;  1X1P A;  4DTN A;  4OPJ A;  4BDP A;  1ZBH A;  1S9E A;  4CJL A;  1JLB A;  3HYF A;  2P5O A;  2ZD1 A;  2JGU A;  1BHL A;  3LAM A;  4CJ4 A;  4B9S A;  2IDO A;  3P83 D;  3L2R A;  1QS4 A;  1IKY A;  3RRG A;  4OPK A;  1DTT A;  1JLQ A;  3D45 A;  3ZSV A;  4HCC A;  1J53 A;  3DLH A;  1RTJ A;  3F73 A;  4F2S A;  2YNF A;  4M3Y A;  2X6N A;  1N6Q A;  3P1G A;  2XY8 A;  4HUG A;  3P5J A;  5HRN A;  1JLC A;  2B6A A;  3O4Q A;  4B9N A;  2KTQ A;  4CGI A;  4HUF A;  1F21 A;  3KKS A;  4PWD A;  2GV9 A;  5CYM A;  5HRR A;  3OY9 A;  4F8R A;  4ZTF A;  4DTX A;  1WLJ A;  3O4N A;  3DLB A;  1B9D A; 
#chains in the Genus database with same CATH topology
 4JK7 A;  4IXC A;  4GNI A;  2H3G X;  2XY5 A;  3OYJ A;  4JRP A;  3D2F A;  3DRR A;  5HP1 A;  3O9S A;  4K43 A;  4Z94 A;  3CCS N;  1YT3 A;  5JVG L;  2V51 B;  3MX5 A;  2UXC K;  1VHX A;  5AQS A;  2W42 A;  1JKH A;  4M3X A;  3CFR A;  1TYQ A;  5J2Q A;  2RHK A;  5KPR A;  1GOA A;  1REV A;  2GEL A;  4BC4 A;  4EHU A;  5C12 A;  3QET A;  1GOC A;  3IMX A;  1LW2 A;  3T1A A;  2HNY A;  4QCL A;  1DEJ A;  4WFB L;  4O8U A;  4DR7 K;  1RTD A;  2HHU A;  3VQ5 A;  1XWL A;  3W3D A;  3JS6 A;  3ULE A;  1A5V A;  1BOT O;  4TSX A;  1C6V A;  1Z26 A;  3CHW A;  3WEE B;  1LW0 A;  1JL1 A;  2HHW A;  4DQP A;  5AQZ A;  3RRH A;  5B8H A;  1Z6R A;  4JI1 K;  5AQF A;  3RSE B;  1YTA A;  3TTF A;  2ZJP L;  2HW3 A;  2OA8 A;  4Y0W A;  4NLB A;  2D0O A;  4DSE A;  2GWK A;  3FZK A;  4AH9 A;  3D2E B;  1HLU A;  2F4V K;  3JXU A;  4DSF A;  4FW2 A;  1VQ7 N;  1ZBL A;  2E2Q A;  1S72 N;  3CD6 N;  1KXP A;  3RRG A;  1MDU B;  1EET A;  1NK9 A;  4IO9 L;  3M8P A;  2FF6 A;  4CK2 A;  1O1W A;  2A5X A;  4FL9 A;  2QWM A;  2D0C A;  4CJV A;  4CEA A;  4DTR A;  2ZM6 K;  3SK3 A;  3HM9 A;  2GEM A;  3WXM B;  3I33 A;  4AQY K;  4JI2 K;  3SNN A;  4LFC K;  1J6Z A;  2G8W A;  4GKJ K;  1RTH A;  3AVM A;  3HST B;  3ZX3 A;  1T6D A;  2GX9 A;  2YJF A;  3KK7 A;  3NDK A;  4DV7 K;  3V9S A;  5C2F A;  3SI6 A;  1YJW N;  4BR2 A;  4DKW A;  3CCE N;  3I8B A;  3O9Q A;  3HZ6 A;  4DWI A;  4YOX A;  3D0P A;  4IFV A;  4O4G A;  3HM8 A;  4M3U A;  4FLV A;  3C95 A;  4BR9 A;  2FF3 B;  4DQS A;  1ESV A;  5BR9 A;  4DUZ K;  1P90 A;  2F9T A;  3OS1 A;  2RE2 A;  5C24 A;  1JJ2 M;  3NFA A;  3DLE A;  3D7E O;  3G10 A;  4W5Q A;  1YJ9 N;  2OZS A;  5AQJ A;  3CCR N;  3H3O B;  3CJC A;  2A40 A;  2FBT A;  2FBY A;  2J4R A;  1LAW A;  2YNI A;  4CHZ A;  5EVZ A;  3U3G A;  1U6Z A;  2YV0 X;  4BRG A;  3RMB A;  4YOY A;  1WB9 A;  5BN9 A;  3DYA A;  3U6F A;  4DR1 K;  1DT9 A;  2I7N A;  4DQQ A;  3VEZ A;  4H5V A;  4MQ3 A;  1S1X A;  4YY3 K;  3AA4 A;  4LFA K;  4JKA A;  3O8M A;  4BRL A;  3GE1 A;  4CFB A;  3VN5 A;  4BWM A;  1BG3 A;  1MWK A;  4E1J A;  1YIT N;  3MAQ A;  1KC8 O;  3J81 O;  4W5R A;  1Q9X A;  3Q7B A;  4JNE A;  2GTD A;  3M3Z A;  1NWK A;  3DLR A;  2YI1 A;  2ZJR L;  4BR4 A;  1HRH A;  3G25 A;  2Q97 A;  4DTM A;  1GLD G;  3MXJ A;  1IO2 A;  3ZSX A;  1QQN A;  4X64 K;  1S6P A;  4FWK A;  3BY5 A;  2QTD A;  1V4S A;  1KLM A;  1TK0 A;  3CCQ N;  4CHY A;  3THW B;  2Q31 A;  3CET A;  1YI2 N;  3QFP A;  4H5W A;  3QNN A;  4LY7 A;  4FM1 A;  2W40 A;  4DU3 A;  1R0A A;  1XNR K;  4KO0 A;  3EL2 A;  4KRE A;  3S3M A;  4FWQ A;  4E1M A;  5AQR A;  2O8C B;  2NRZ A;  4QS9 A;  3CMA N;  4FVU A;  1GLC G;  4KPY A;  5AQN A;  4OGE A;  3LDS A;  4DS4 A;  3TAB A;  1VQ5 N;  1VQO N;  1QVG M;  3AVA A;  1RT3 A;  2E2P A;  4M41 A;  4M45 A;  1GLE G;  4DR2 K;  3OYE A;  3VA3 A;  3F9M A;  1OVQ A;  4JS5 A;  3PSF A;  2Y1I A;  1NGG A;  4CK3 A;  4DLG A;  3IFR A;  4OKJ A;  4H5R A;  2G8K A;  5M1K A;  3DXK A;  4CJU A;  1HJO A;  3OYD A;  3ZSR A;  4M42 A;  3FE1 A;  1GLJ O;  3LP0 A;  1HNX K;  1GLB G;  5AQV A;  2ZJQ L;  4WFN L;  3SJH A;  3EZ5 A;  1XC9 A;  2PZS A;  4NXN K;  4N5S A;  4OPA A;  1S3X A;  3AVI A;  4B3R K;  4N47 A;  3AO1 A;  3J7Z O;  1IG9 A;  2PYJ A;  5JLH A;  5AFU H;  4C8M A;  1T6C A;  1LWC A;  4FJ5 A;  2HVI A;  1JCE A;  2Q3S A;  4UY8 O;  3OYB A;  4W5T A;  4B1W B;  1K8K B;  1TAU A;  4F4K A;  1CZA N;  3NHG A;  4FJ8 A;  1VQP N;  4MO5 A;  3KLE A;  1HNV A;  2P9L B;  5KI6 A;  2HBK A;  5KQD A;  4M7X A;  1YVU A;  4UQG A;  3KD5 E;  4CEO A;  1NG9 A;  4I7F A;  4E19 A;  1G15 A;  1SQK A;  3ULE B;  3K5L A;  3CCV N;  4IG3 A;  3E9P A;  1KSP A;  2FBX A;  3LDO A;  3QIC A;  3E01 A;  4J2B A;  1ITG A;  1X3M A;  4X66 K;  4LF4 K;  3K57 A;  4HTU A;  1KRP A;  4JYA K;  1HNW K;  3VET A;  4A61 A;  4MFB A;  1KD1 O;  3SMP A;  3U9D A;  1NK7 A;  4FOI A;  1OH5 A;  2CH6 A;  1E4F T;  3B6O A;  3ID8 A;  2X78 A;  3EE8 A;  2HNZ A;  3F5T A;  4KHN A;  4LF9 K;  1ZBF A;  3LPT A;  3V9W A;  3VF6 A;  3CJ9 A;  3SUO A;  2QM1 A;  1FW6 A;  2NLX A;  4DSK A;  3ZEU A;  2O8F A;  1U47 A;  1TUY A;  5E41 A;  4NXM K;  4OPH A;  4CD1 A;  4CHO A;  3C7N A;  4E7I A;  3HVR A;  3OA9 A;  4PL7 A;  2E1Z A;  5MLC Q;  1RBT A;  2OPR A;  1C0M A;  3EE9 A;  3LDP A;  4M3R A;  2UUA K;  4ZHR A;  1L3T A;  1JLE A;  1C1A A;  2A1S A;  3V1Q A;  5AQG A;  4ZTJ A;  1U4B A;  2WOM A;  1BWF O;  1NK4 A;  3M8Q A;  2XO7 A;  4KH5 A;  2NRW A;  4LC9 B;  2E20 A;  5A2Q O;  1LOT B;  1TKD A;  1ZXO A;  2G8V A;  3CYM A;  1BI4 B;  3VES A;  3AVG A;  4CD3 A;  1EWR A;  1C0F A;  2OCE A;  2HVH A;  4GY2 B;  1CLQ A;  5AZI A;  3TSU A;  3ZET A;  3MX2 A;  4KTW A;  5EU7 A;  3HOT A;  5E26 A;  2NNW A;  2P9K A;  4BDZ A;  3AO3 A;  4DQR A;  1YIJ N;  5KRS A;  2P9U A;  3A5N C;  1K8K A;  2YHY A;  1NOY A;  1YVN A;  4CJ5 A;  4EP4 A;  3J7A P;  1U49 A;  4IBN A;  4ID5 A;  3U3Y A;  3VOV A;  1FK9 A;  2D0A A;  3QEV A;  1SKR A;  3KTQ A;  5BRE A;  3TAR A;  4OPJ A;  1ZBS A;  2E8A A;  2P5O A;  2ZD1 A;  1BHL A;  1IBM K;  1IKY A;  4HCC A;  5C15 A;  5LMN K;  3DLH A;  4M3Y A;  5ELZ A;  4HUG A;  5HRN A;  1JLC A;  2B6A A;  2JWL A;  5ADX A;  4B9N A;  4HUF A;  2NRT A;  5HRR A;  4H03 B;  4I6M A;  4BR0 A;  4YDU C;  5AQY A;  3P4I A;  3DLB A;  3IRX A;  4DMN A;  2E2O A;  3ZCM A;  3VA0 A;  1NJX A;  3WNG A;  1NGB A;  3O5B A;  4GW6 A;  4X62 K;  3EKS A;  5F1X A;  3BGR A;  4QAG A;  3C7N B;  3QIO A;  4JS4 A;  2BH1 A;  1FXX A;  2QI2 A;  3R8E A;  1NGE A;  2CGK A;  1IKW A;  2QA4 N;  3LM2 A;  3PLA A;  3SAF A;  5GIP A;  2P9N B;  2CGL A;  4AHC A;  3M6G A;  1BGX T;  3ULD A;  5FPD A;  3ATU A;  4B1Z A;  5F0X A;  4BRI A;  4KHU A;  1XHX A;  5KQ8 A;  3KWI A;  4IOX A;  4JI4 K;  3AAQ A;  2Z1G A;  4JEP A;  3L2W A;  4Z4I A;  3RR7 A;  5EX5 A;  4WYB A;  1RBU A;  4I9Q A;  4N56 A;  5SWM A;  3VQA A;  4IG0 A;  1EXQ A;  5FRN A;  4FJJ A;  4K42 A;  4DSJ A;  2YJE A;  3C6H A;  1RDD A;  3VTH A;  3QEI A;  2QXF A;  3H6E A;  3T69 A;  2VWB A;  2ATQ A;  5HOO A;  2VQE K;  1CXQ A;  1KAX A;  4HUE A;  2ASO A;  4H0O A;  2NRR A;  3IUC A;  1NM1 A;  4FOE A;  3SUQ A;  1VQN N;  2GUI A;  4CI6 A;  2NRX A;  3O9R A;  3BUZ B;  4IDK A;  4CZL A;  4NB4 A;  4CIG A;  4KH4 A;  3SUP A;  1HKC A;  3SAH A;  4EHT A;  3DXM A;  1KCF A;  4K25 A;  2HMP A;  3VEX A;  1W0H A;  2VQF K;  2KHO A;  3CC4 N;  1C0U A;  4M7Y A;  5FRM A;  4C8K A;  1I39 A;  1QSY A;  4CHP A;  1KVC A;  2DTU A;  1S1U A;  4JD2 A;  3T3F A;  3L2V A;  4JK8 A;  3P38 A;  3QML A;  5IWA K;  3DMJ A;  5C42 A;  1K8A O;  4M3W A;  4E3S A;  5AQK A;  2HHH K;  5JLF A;  3EO3 A;  1RT4 A;  4BG8 A;  1IH7 A;  2ZGZ A;  3HK2 A;  2KW4 A;  3HL8 A;  1U2V B;  3NVK A;  4EZ6 A;  3M5R A;  3CJ7 A;  4L3Q A;  4Q5V A;  3TAG A;  3VQP A;  1HJR A;  3MEG A;  1RDA A;  2E4L A;  2RF2 A;  4CJK A;  3OW2 M;  2KZM A;  2HB5 A;  4WF9 L;  3IG1 A;  3CQX A;  4H4M A;  4FSV A;  4B3M K;  4JKC A;  2OYQ A;  1L3V A;  2X6S A;  3THW A;  5EXW A;  1ZBU A;  1KVA A;  3KZB A;  3M8R A;  4FZX C;  4KKO A;  3HO1 A;  1ASW A;  1J5E K;  1HPM A;  1Q8I A;  2JWK A;  4DS5 A;  4E0D A;  2Q36 A;  1IV0 A;  1J5O A;  4KB0 A;  1HMV A;  2QWP A;  2FSK A;  2OPP A;  1HYZ A;  4O5F A;  4WQ4 C;  5BPN A;  4RG8 A;  3NCI A;  5ADX H;  3THX A;  4PQU A;  1NJZ A;  3MCA B;  3JSM A;  4RW8 A;  3N4P A;  3O1B A;  1TKT A;  3EYZ A;  3LAN A;  4V19 S;  4EIA A;  4EP5 A;  3L6Q A;  3THV A;  1C0T A;  1KQS M;  4BGB A;  5T7B A;  4ISG A;  3ZT3 A;  3IDH A;  2G8U A;  4RW6 A;  2KFN A;  2FC0 A;  5AFU A;  4W5O A;  3TAF A;  4KHY A;  3LAL A;  4K0K K;  4R5P A;  2OPQ A;  1T7P A;  3V9X A;  1J54 A;  1WAJ A;  3C6A A;  1MU2 A;  5AQM A;  3LP1 A;  3FLC O;  1YAG A;  4DR6 K;  1FKP A;  2HHX A;  3I0S A;  4CVN E;  4FWM A;  3SMS A;  4DQ8 A;  3TAP A;  4E7K A;  4ISF A;  1IBK K;  4BRP A;  3B6P A;  1EO1 A;  3H1V X;  1MA9 B;  4NCB A;  1LAV A;  4BC5 A;  3DI6 A;  3FFI A;  3RMD A;  5CHI A;  2PAV A;  2ITG A;  1V4T A;  3ZT2 A;  1I94 K;  3IKM A;  1IBL K;  2CGJ A;  2Q1N A;  2F7T A;  3CER A;  4OKE A;  4HTL A;  3QIN A;  1UOC A;  1ATN A;  4JD2 B;  3ZT0 A;  3VQD A;  3L2U A;  3CJA A;  4CES A;  3DRS A;  1WNS A;  2A41 A;  4DR4 K;  4J8F A;  3MXI A;  4JRQ A;  1N34 K;  1SL2 A;  3JAM O;  3OVN A;  3HSC A;  1RGI A;  3ASM A;  2W41 A;  4JI7 K;  5KPZ A;  1NMD A;  1KLN A;  4C8L A;  4MLH A;  1NJW A;  1K9M O;  3NF9 A;  3GL1 A;  2IOC A;  3H46 O;  4CF9 A;  1TK8 A;  5LL6 Z;  2UXD K;  3O08 A;  4MDB A;  1HUX A;  1BA1 A;  3ZT1 A;  4O0I A;  3LPU A;  3O3F A;  3BF1 A;  4RWT A;  4AHS A;  3R1X A;  4OLB A;  2E2N A;  5CY4 A;  3R6M A;  1T8E A;  1VSI A;  4FYD A;  3SBG A;  2O8E A;  5GAG P;  2ZWH A;  3WEE A;  2FSN A;  4FLU A;  4FWR A;  4OX9 K;  4PUO A;  3CM5 A;  4G9Z A;  1WSF A;  3AVK A;  2A1R A;  1NGI A;  3VEY A;  4JHD B;  4FJ7 A;  2QKB A;  3VGL A;  3TR8 A;  1NJY A;  3OYI A;  4JI0 K;  1XUP O;  3DOK A;  4CGH A;  3CXC M;  1JLF A;  2IC3 A;  1N32 K;  2LSN A;  1Q9Y A;  3A2F A;  3NF8 A;  4ID1 A;  1TYQ B;  3FZM A;  3LL3 A;  2Z1I A;  3SBT A;  1I3A A;  1QQO A;  4DFK A;  3ZX2 A;  4BR7 A;  3DWL A;  3FZL A;  3LWM A;  3CCM N;  2HBJ A;  3VQ8 A;  1RT5 A;  1RTI A;  1NK8 A;  3L4I A;  4RCH A;  2P51 A;  1RT7 A;  3UE5 A;  2Z1H A;  4Z4C A;  1NK0 A;  4B9M A;  4ICL A;  1VRU A;  1W97 L;  2VCP A;  4IEI A;  4PKH A;  3ENH A;  1CZB A;  3LP3 A;  3PUF A;  4CE9 A;  1BO5 O;  5DK5 A;  5LY3 A;  3O9T A;  2PY5 A;  3L3V A;  4CFD A;  1RFQ A;  3RMA A;  1NKC A;  4FK0 A;  1BIS A;  4NO7 A;  4YHH K;  2KKZ A;  2KLA A;  4CJT A;  1D9D A;  4F3T A;  4CBW A;  4AM6 A;  4C23 A;  4KI6 A;  2BTF A;  4PKI A;  1TKX A;  4XH5 A;  3GDQ A;  4JI8 K;  2DY4 A;  4DSL A;  5E84 A;  4DF4 A;  3WNF A;  4F9O A;  4CZK A;  5C25 A;  3V1R A;  4OVL A;  2DFF A;  1S1T A;  1RDW X;  1T3V A;  1VSD A;  5AQP A;  4YOV A;  2E1Y A;  2KQ2 A;  4RW4 A;  4XH1 A;  3DOL A;  2IIR A;  4CBU A;  3VQ4 A;  3HXM A;  3K5N A;  4FVM A;  4LD0 A;  2DPN A;  3SPZ A;  4H0Y B;  1VSJ A;  4IFE A;  3RTV A;  2UU9 K;  4JI6 K;  2BDP A;  3G0Z A;  4C1N I;  3NAE A;  3MEC A;  1ATS A;  3ZET B;  1VRT A;  3EN9 A;  4K41 A;  3IS9 A;  4B1U B;  1VSL A;  3QEP A;  1G99 A;  3OYL A;  4C8O A;  1BA0 A;  4B8A B;  1ZBH A;  1JLB A;  4CZG A;  2JGU A;  3VER A;  4CJ4 A;  5BR8 K;  3P83 D;  2HF3 A;  1QS4 A;  1NGC A;  3D45 A;  4QS8 A;  1SZ2 A;  3G4S N;  2XY8 A;  1QQM A;  5FPM A;  3O4Q A;  3U9Z A;  1K73 O;  5BPM A;  1NGF A;  4WFA L;  3KKS A;  2O8D B;  2GV9 A;  2QWN A;  3OY9 A;  3B8A X;  4ZTF A;  1WLJ A;  2UXB K;  4M3Z A;  4DG1 A;  4WCE L;  3LDN A;  3AY9 A;  3H08 A;  2E88 A;  4JK9 A;  5AQQ A;  2YHW A;  1TGO A;  3JYT A;  4PY5 A;  3O6W A;  2WUS A;  1ASV A;  4IFY A;  2E5L K;  1UAX A;  4DU4 A;  5F2R A;  4L8R B;  3QES A;  3MWP A;  4FLY A;  3M8S A;  3VQ6 A;  4IJA A;  1EQY A;  3CPW M;  4BC2 A;  3F2K A;  1SKS A;  4EZ9 A;  3R3L A;  3RWU A;  4Z4F A;  5AQL A;  1NNE A;  3GOI A;  3CQY A;  3SQ4 A;  1M1K O;  4FZZ A;  4H5T A;  5K14 A;  3ZX0 A;  4CER A;  4JHD A;  1N33 K;  1ZYQ A;  1GLL O;  1IKX A;  1E4G T;  3KHY A;  4YOU A;  3NBP A;  4JKG B;  4O55 A;  4A5A A;  3AAR A;  3V9Z A;  1TL3 A;  1Q82 O;  1SS6 A;  2ZE2 A;  4BE1 A;  4KV8 A;  3AVF A;  5LJW A;  1HYS A;  3BZC A;  2O8E B;  4CJ3 A;  1D5A A;  3KJV A;  3C0B A;  3T19 A;  2IVO A;  1W2B M;  1XC3 A;  2QK9 A;  4OGC A;  2RKI A;  4FLX A;  1K6Y A;  3S3N A;  3QEX A;  4BQL A;  1JXB A;  3DM2 A;  2W6L A;  2QWO A;  4FWP A;  5I42 A;  4K8Z A;  2O8B B;  4BC3 A;  4E7H A;  4CEC A;  4IOC L;  3SLC A;  3NH0 A;  1NK6 A;  4CK1 A;  3CIP A;  3HI0 A;  3BDP A;  4CEB A;  4BAC A;  4OKK A;  1GLF O;  3VQB A;  1BCM A;  3ZT4 A;  4RW7 A;  4U67 L;  4Z4G A;  4BRE A;  4H8K A;  1SAZ A;  3J8A A;  2HOE A;  4W5N A;  4H0T B;  2P9S B;  2WC9 A;  3NF7 A;  4Z0U A;  3UKU A;  4MLE A;  3H3N O;  3H45 C;  1J9A A;  3P31 A;  2HST A;  3EZW A;  3PX6 A;  3DAW A;  3SAG A;  1BCO A;  3A8Y A;  2HHV A;  5HRO A;  1RDC A;  1BQN A;  3VPZ A;  3DJC A;  1HPZ A;  3KIO A;  1U2V A;  4GVM A;  1T03 A;  2YNG A;  2W6K A;  1OH7 A;  4IZ9 A;  3V4I A;  3CM6 A;  3M1F A;  4Q0B A;  1N5Y A;  1NMN A;  1TKZ A;  4CZH A;  4O5B A;  3QNO A;  2O4I A;  3OYK A;  3WQU A;  4AHV A;  1QTM A;  1QHT A;  3ALY A;  1DLO A;  4CEE A;  4BY9 C;  4O0J A;  2F9W A;  1NGA A;  3V1O A;  1Z05 A;  4HHT A;  3CME N;  1Q7Y O;  5AR0 A;  3TSP A;  3TTC A;  4AHT A;  1KTQ A;  3KWG A;  4JI3 K;  1BUP A;  4A57 A;  5AQI A;  2RPI A;  3EKU A;  3DXM B;  3FZF A;  2O4G A;  5CZ1 A;  4DV0 K;  3BF3 A;  1VQ6 N;  2I5J A;  3WNE A;  2VGM A;  4DU1 A;  4AHR A;  3QEW A;  3VTI A;  3I0R A;  5AJ3 K;  4B3S K;  4H0P A;  4HVJ A;  1OH8 A;  2GUP A;  4IWV A;  3L2Q A;  2D0B A;  4FO0 A;  1XQS C;  2P5G A;  3RSE A;  3WXL A;  3KK1 A;  1TAQ A;  5D3G A;  4XEI A;  5BPL A;  4B8C A;  2YCH A;  1RT2 A;  1NKB A;  3HOS A;  2BUP A;  3NH2 A;  1A5W A;  4BVO A;  5EY4 A;  1BDG A;  3E9O A;  3OYA A;  4JN4 A;  1B9F A;  3SZ2 A;  1Y97 A;  2JLE A;  1QHA A;  4JKG A;  4FWL A;  2Y1J A;  2UUB K;  3FR0 A;  4N41 A;  4KH6 A;  3OJS A;  4DTP A;  4DUY K;  1QZ6 A;  2NZT A;  4DFM A;  2VG6 A;  3ISN C;  3OYF A;  3U4L A;  3UKR A;  3VEO A;  3KK2 A;  1CZ9 A;  5KGW A;  3RVC A;  4LF6 K;  4FWO A;  5J1E A;  4YOW A;  1ZBI A;  2G8I A;  4AF1 A;  3OBY A;  4DV1 K;  1NLV A;  5DMR A;  4NLC A;  5FPE A;  3HPG A;  3SCX A;  1JLG A;  5HBM A;  3BP8 A;  3VQ9 A;  2DFH A;  4YNQ A;  4FXD A;  2AJQ A;  2FLO A;  3QER A;  2ETJ A;  3MN7 A;  1SKW A;  3VQQ A;  5BN8 A;  4CIF A;  1JL2 A;  1OH6 A;  1MWM A;  1Z25 A;  1QZ5 A;  5J2M A;  4OLA A;  4KRF A;  3OYC A;  4K8X A;  4LF5 K;  3K5M A;  4DF8 A;  1UA1 A;  1T05 A;  4KB1 A;  4BRN A;  3SJJ A;  4BR5 A;  2VG5 A;  3LM9 A;  3EY1 A;  3O1W A;  3CCU N;  4BGA A;  2UYT A;  3ZLJ A;  2WBN A;  4NYN A;  4CFA A;  1TUU A;  3NMU A;  4CEQ A;  4CIE A;  3SQ2 A;  2PBD A;  4MDA A;  3E1Y A;  3SV4 A;  1U45 A;  3SUN A;  1VSK A;  2B4J A;  3AO5 A;  4B9T A;  1N8R O;  3NH1 A;  3NE6 A;  3T1H K;  3ZSW A;  4F2R A;  4DLE A;  5I9E B;  3TAQ A;  1TVR A;  5FLX O;  1BIU A;  2Q2R A;  1NGJ A;  2XHB A;  3QBX A;  4C8N A;  4CF8 A;  1WSI A;  4Y1D A;  1X9J A;  4I2Q A;  1WN7 A;  2YKN A;  2P9K B;  3HBT A;  4I9L A;  4BRO A;  4FM2 A;  3RR8 A;  3SQ0 A;  3OTO K;  4A2B A;  1S5J A;  3TSQ A;  2WTU A;  3KD1 E;  4ISE A;  4E7L A;  3VEN A;  4FK4 A;  2XY7 A;  2XRI A;  1LWF A;  4DTS A;  3NGY A;  4E89 A;  4FJN A;  2ASP A;  5SZT A;  4ELV A;  4FPA A;  3TAE A;  3WXK A;  5I3U A;  3N4Q A;  4IOA L;  5KGX A;  3GBT A;  2YHX A;  4CJE A;  4YDU A;  3THY B;  3J7Y P;  4N76 A;  4CHQ A;  2I7P A;  1R59 O;  3EEQ A;  2E6L A;  3QDK A;  1YTU A;  5HL7 L;  2P1J A;  4DV5 K;  4NCG A;  3OS0 A;  4BG9 A;  3AVB A;  4KHQ A;  4JKH A;  1HQE A;  1JXE A;  5M1Q A;  4FJI A;  1EWQ A;  3MEE A;  5AQU A;  4CJ7 A;  3O4W A;  2YNH A;  3PV8 A;  1M90 O;  3SYZ A;  4JKE A;  3VQE A;  3D2F B;  1SV5 A;  2Z1J A;  1EP4 A;  3W0L A;  2XY6 A;  2KZZ A;  3ZEU B;  3NF6 A;  3OS2 A;  3VQ7 A;  3TU5 A;  5BRF A;  3HRG A;  4O44 A;  1OKJ A;  1Y64 A;  3QO9 A;  4DFJ A;  3PY8 A;  4B1Y B;  4ILH A;  3L8B A;  1XI1 A;  2CH5 A;  1WAF A;  4LFB K;  3LDL A;  1IG8 A;  4CZE A;  5LJV A;  3D6R A;  3OYG A;  5TKY A;  4H0X B;  1OVY A;  1EKE A;  5FDL A;  5GIO A;  3E9L A;  4GV6 A;  4BRQ A;  3OYN A;  3HJF A;  2IAJ A;  1XNQ K;  4CW7 B;  1UA0 A;  1S22 A;  4IO8 A;  4CJW A;  3MXM A;  3DLG A;  3DRP A;  2ZQB A;  1KVB A;  3RMC A;  3AAP A;  3QB0 A;  4JAX A;  1LV5 A;  4FCY A;  4FLT A;  2P9U B;  5J2P A;  2GWJ A;  5J2N A;  4CGJ A;  4CF0 A;  1VAZ A;  1S1W A;  3WT0 A;  4YOR A;  1ATR A;  3S9H A;  4FZY A;  5AZI B;  3O3G A;  1S6Q A;  3GG4 A;  1HX1 A;  4FJH A;  3I56 N;  4KHP K;  3MN5 A;  4B3O A;  3VF4 A;  3WXJ A;  4BDP A;  4GV3 A;  1S9E A;  1T44 A;  4CJL A;  4OPK A;  1DTT A;  3ZSV A;  3DXK B;  3F73 A;  4F2S A;  5H1S Q;  2X6N A;  1VQ9 N;  3P1G A;  1JCG A;  3VGK A;  3P5J A;  2A6A A;  2KTQ A;  5JMV A;  1F21 A;  2NRH A;  3O80 A;  4F8R A;  3R9P A;  4DTX A;  3O4N A;  3CQ8 A;  4FJK A;  1RT6 A;  2BGG A;  3OYM A;  3UIQ A;  3AVN A;  5LMU K;  2OPS A;  3MN9 A;  4KTZ A;  4LSN A;  3KLH A;  5GAH P;  4FJX A;  3L0Q A;  2VYP A;  3QFU A;  2V7Z A;  3CC7 N;  3C94 A;  1QSS A;  3MDQ A;  4KBO A;  5FPN A;  1QSL A;  3CFP A;  3VMF B;  4ILJ A;  1W9H A;  3AVH A;  4CCH A;  4DCH A;  5M1F A;  3HP6 A;  2QKK A;  1C1C A;  2KFZ A;  1HKB A;  3MED A;  3VF2 A;  1QVF M;  1NGD A;  3OHR A;  4IKF A;  2HND A;  3S41 A;  4KAZ A;  1NK5 A;  1RBV A;  5DM6 L;  4DR5 K;  3MWT A;  1HKG A;  4FWN A;  1QQC A;  3AVC A;  3PX4 A;  4DV6 K;  2AP1 A;  5JS2 A;  1ASU A;  2YHA A;  4PA1 A;  1DTQ A;  4LSL A;  2V7Y A;  4BRK A;  5CE3 A;  4Z4H A;  2AA4 A;  3AO2 A;  4M3T A;  3ENO A;  1VSE A;  1QE1 A;  3VQC A;  4RTF D;  4BRD A;  3LZJ A;  4BRF A;  3AVJ A;  1HR0 K;  1NU0 A;  2QWL A;  5CZ2 A;  4YFU A;  3KKR A;  1GLA G;  4LF8 K;  3VGM A;  3THX B;  3P39 A;  5GAD P;  1D8Y A;  5BRD A;  2RN2 A;  4U7B A;  2P9I B;  4BWJ A;  3ZSZ A;  4EFH A;  4WE1 A;  1NKE A;  3NGZ A;  2B5J A;  1L3S A;  2EX3 A;  3FGU A;  2HBM A;  5C10 A;  3PO5 A;  1WSJ A;  2OZM A;  1NBW A;  2WON A;  4FLW A;  4O8K A;  4DTU A;  2D5R A;  4BE2 A;  2IS3 A;  4GKK K;  4OO1 J;  2F96 A;  4CGG A;  3PO4 A;  3HT3 A;  3NVM A;  4J2E A;  4KTQ A;  1JLA A;  4RW9 A;  5AQX A;  4XH4 A;  4EAH D;  4GV9 A;  1X9M A;  4H5N A;  5CR4 A;  1NOZ A;  1VK0 A;  1ILY A;  4DV4 K;  5M1O A;  3KLF A;  3SV3 A;  4DQI A;  3WUH A;  3T1Y K;  3AV9 A;  3TPQ A;  1RBS A;  5AZJ B;  3J80 O;  3QIP A;  5C2D A;  5KTQ A;  3A5O C;  4CGF A;  2FXU A;  2O8C A;  2YKM A;  3G71 N;  3CCJ N;  3AA3 A;  2VWK A;  5TKW A;  2F8S A;  3CJ1 A;  3UKU B;  4B3T K;  1TL1 A;  2VG7 A;  4Z4E A;  1BU6 O;  3UKR B;  2PFU A;  2QWR A;  2QXL A;  4BRC A;  1CXU A;  3HVT A;  3LP2 A;  5M1P A;  3MN6 A;  4A59 A;  3KLI A;  4BRA A;  2YHB A;  3ZSO A;  4NCA A;  3OBW A;  3TAM A;  3CFO A;  3G6E N;  4F3O A;  2G8H A;  3PIP L;  3HPO A;  3H1Q A;  4DV2 K;  3TAN A;  4CZM A;  3D2E A;  2O8B A;  4CGD A;  2V52 B;  4I2P A;  1DKG D;  4FK2 A;  3KLG A;  1HNZ K;  1TK5 A;  1BL3 A;  1RDU A;  3BEX A;  5AQT A;  1HQU A;  4CED A;  1WBD A;  5GIN A;  4J2A A;  1IKV A;  4DFP A;  3V9U A;  2VWJ A;  2PYL A;  3AO4 A;  4CF1 A;  3WXI A;  4JV5 K;  3O9U A;  1U48 A;  5GAE P;  3ZSQ A;  4B9V A;  4R79 A;  3MCP A;  4FJM A;  3V81 A;  4FJG A;  3Q7C A;  4X65 K;  4CBX A;  2A3Z A;  1X9W A;  1VSM A;  1NGH A;  5KRT A;  2YX6 A;  2R7Y A;  2EWS A;  4A5B A;  4IJN A;  2ASM A;  3ZSY A;  1WBB A;  1YUW A;  3V6D A;  4B9Q A;  3LZI A;  4JLH A;  1RCH A;  3FZH A;  5KPT A;  1KFS A;  4ELU A;  3CG7 A;  2BE2 A;  1S1V A;  3L3U A;  3E66 A;  4CJF A;  2QWQ A;  2ITM A;  2HHT A;  2HHQ A;  4CEZ A;  4LH5 A;  1WOQ A;  4DR3 K;  4CEF A;  4CZI A;  4BDY A;  4AM7 A;  1RIL A;  4E7J A;  1XHZ A;  3KK3 A;  2D0P A;  5AZJ A;  3K58 A;  4FW1 A;  4CJS A;  1BQM A;  4GVE A;  4CJQ A;  1VSH A;  5FRO A;  3O3H A;  2DFE A;  1X9S A;  2ZGY A;  1C1B A;  1JCF A;  4JKB A;  4LH4 A;  1FKO A;  4IEE A;  4AIL C;  4QOZ B;  1YF5 L;  4BQZ A;  2O8D A;  4H4O A;  1WUA A;  1LCU A;  2P9S A;  4IDH A;  4PL8 A;  3K0S A;  1VQ8 N;  3PSI A;  3CI5 A;  3C6T A;  3AGR A;  5AQH A;  4BRM A;  2E6M A;  4FM0 A;  4KI4 A;  4B08 A;  1KFD A;  4JKD A;  1O13 A;  3I55 N;  3OJU A;  1B92 A;  2P9I A;  1WSE A;  2ZF5 O;  2HBL A;  2GBZ A;  1TV6 A;  2Q0U A;  1NJI O;  1EX4 A;  3VEW A;  4CHN A;  3TTD A;  4BRH A;  1YHQ N;  3HP9 A;  4B1X B;  5HRS A;  3OYH A;  3S3O A;  1RT1 A;  3K2P A;  1VQL N;  4FWS A;  4FJ9 A;  4CJR A;  2VGN A;  3LAK A;  1KAY A;  2F8T A;  3K5O A;  4ELT A;  1H1V A;  3NGI A;  4BE0 A;  3ATV A;  3AA5 X;  1SL0 A;  2IVN A;  3ID6 A;  2D4W A;  3AVL A;  3L4Q A;  4KHW A;  4MO4 A;  3SQ1 A;  1BI4 A;  2EHG A;  4FPB A;  4J2D A;  1GOB A;  4CF2 A;  1BIZ A;  1W7A A;  4ILG B;  5AQO A;  4A2A A;  2IVP A;  4FLZ A;  3CCL N;  1HNI A;  3C65 A;  1L5U A;  5C0Y A;  2WFB A;  4XIU A;  1D4X A;  4PKG A;  4QS7 A;  2OTJ N;  2P9N A;  3HPH A;  3DLL L;  3IAY A;  3A5L C;  3ITH A;  4Y1C A;  2G8F A;  3K9J A;  1VQ4 N;  4HCB A;  3QBW A;  1Q81 O;  3KVG A;  1X3N A;  2BAN A;  2P9P A;  1U04 A;  4FJL A;  3QLH A;  2UUC K;  5JS1 A;  2Q0R A;  1LWE A;  1L3U A;  1UWB A;  4CZJ A;  1WSG A;  1D9F A;  1N36 K;  3LDQ A;  3ZYY X;  2O8F B;  2NRV A;  3U8X A;  3TWH A;  5JVH L;  1RBR A;  2P9P B;  4GMJ B;  4I6M B;  2HHS A;  4WQ5 C;  5HRP A;  1HYV A;  5IT9 O;  3THY A;  3CJB A;  3K9K A;  4M63 C;  1C0G A;  4AHU A;  1E3M A;  1KAZ A;  3A5M C;  3BZK A;  4B1V A;  4DHY A;  1FJG K;  4B9U A;  4OJR A;  3T7Z A;  1IJJ A;  1SL1 A;  3WNH A;  4KHS A;  2X74 A;  3CPE A;  4E1N A;  1Q18 A;  4DTO A;  3AA2 A;  2A42 A;  3UB5 A;  3PX0 A;  1RNH A;  4KFB A;  1SUQ A;  3FFK B;  1RDB A;  2HMI A;  1ZC6 A;  3AGK A;  3LWL A;  2IGI A;  4DTJ A;  1VQK N;  3WQT A;  4HWI A;  1WSH A;  4CFC A;  1A5X A;  3PIO L;  4CJP A;  4LF7 K;  5CYQ A;  4BVP A;  2NUB A;  3CC2 N;  1S9G A;  2P9L A;  3A0I X;  3F9K A;  3I8D A;  2QW9 A;  4NYF A;  1YXQ A;  3SPY A;  1YJN N;  5HLF A;  3DLK A;  4CZF A;  5DM7 L;  2QEX N;  2D1K A;  4JI5 K;  3VEV A;  3MK6 A;  5M1N A;  4DSI A;  4DV3 K;  2OAN A;  2HF4 A;  3MMV A;  4G1Q A;  3TI0 A;  1VSF A;  1Q86 O;  3K59 A;  4YOT A;  3C6U A;  2FBV A;  1X1P A;  4DTN A;  3CF5 L;  5EOY A;  1P8Z A;  4B9L A;  3HYF A;  4B9S A;  3LAM A;  2IDO A;  3L2R A;  5BRH A;  1JLQ A;  5JIC A;  1J53 A;  4JKF A;  1RTJ A;  3ENB A;  2YNF A;  2FSJ A;  3HTV A;  4DB3 A;  1N6Q A;  4C1N K;  4H0V B;  4WQ5 A;  1XMO K;  4CGI A;  4WQ4 A;  4A62 A;  4PHT X;  1VQM N;  4PWD A;  5CYM A;  1XMQ K;  2OTL N;  1DGK N;  5AQW A;  1B9D A; 
#chains in the Genus database with same CATH homology
 4FJK A;  1RT6 A;  2BGG A;  3IRX A;  4DMN A;  3H08 A;  3OYM A;  3UIQ A;  3AVN A;  3ZCM A;  3VA0 A;  1NJX A;  3WNG A;  2XY5 A;  4GW6 A;  2OPS A;  3OYJ A;  4JRP A;  4KTZ A;  1TGO A;  4LSN A;  3JYT A;  4PY5 A;  3DRR A;  3KLH A;  1ASV A;  4IFY A;  5HP1 A;  3BGR A;  4QAG A;  4FJX A;  3QIO A;  1UAX A;  1YT3 A;  4DU4 A;  4JS4 A;  3C94 A;  4L8R B;  3QES A;  1QSS A;  1FXX A;  4FLY A;  1QSL A;  3M8S A;  3VQ6 A;  3CFP A;  2W42 A;  1IKW A;  1JKH A;  4DG1 A;  4M3X A;  3CFR A;  5J2Q A;  1W9H A;  3AVH A;  4CCH A;  1GOA A;  1REV A;  1SKS A;  3HP6 A;  4EZ9 A;  3RWU A;  4Z4F A;  3QET A;  2QKK A;  1GOC A;  4AHC A;  1C1C A;  3SQ4 A;  2KFZ A;  3MED A;  4FZZ A;  4IKF A;  1BGX T;  3ULD A;  1LW2 A;  2HND A;  5K14 A;  2HNY A;  3T1A A;  4CER A;  4QCL A;  4KAZ A;  1NK5 A;  1RBV A;  1ZYQ A;  1IKX A;  3NBP A;  1RTD A;  4O55 A;  2HHU A;  3V9Z A;  4KHU A;  1XHX A;  1TL3 A;  3VQ5 A;  1XWL A;  2Z1G A;  2ZE2 A;  4BE1 A;  3L2W A;  1QQC A;  3AVC A;  4KV8 A;  1A5V A;  3AVF A;  4Z4I A;  1HYS A;  3PX4 A;  4TSX A;  1C6V A;  1Z26 A;  3RR7 A;  5JS2 A;  1ASU A;  2YHA A;  1LW0 A;  1RBU A;  4I9Q A;  4PA1 A;  4CJ3 A;  1D5A A;  1JL1 A;  3VQA A;  1DTQ A;  4IG0 A;  4LSL A;  3T19 A;  5SWM A;  1EXQ A;  4Z4H A;  3KJV A;  2HHW A;  4DQP A;  4M3T A;  3AO2 A;  3RRH A;  5FRN A;  1VSE A;  1QE1 A;  3VQC A;  4FJJ A;  4DSJ A;  3LZJ A;  2QK9 A;  4OGC A;  2RKI A;  4FLX A;  1RDD A;  1K6Y A;  1YTA A;  3AVJ A;  3QEX A;  3S3N A;  3QEI A;  2HW3 A;  2QXF A;  5CZ2 A;  4N56 A;  1JXB A;  3DM2 A;  4YFU A;  2OA8 A;  3KKR A;  2ATQ A;  4DSE A;  1CXQ A;  5I42 A;  4K8Z A;  4HUE A;  4AH9 A;  4CEC A;  4E7H A;  4DSF A;  4FW2 A;  3NH0 A;  1D8Y A;  3SUQ A;  1NK6 A;  2RN2 A;  4CK1 A;  1ZBL A;  2GUI A;  4BWJ A;  3ZSZ A;  3BDP A;  4WE1 A;  4CEB A;  1NKE A;  3NGZ A;  2B5J A;  1L3S A;  4IDK A;  2EX3 A;  4BAC A;  1EET A;  4CIG A;  1NK9 A;  4OKK A;  3SUP A;  3M8P A;  3VQB A;  1BCM A;  3PO5 A;  1WSJ A;  4CK2 A;  2OZM A;  1KCF A;  1O1W A;  3ZT4 A;  3CQ8 A;  2D0C A;  4CJV A;  4RW7 A;  1W0H A;  2WON A;  1C0U A;  4CEA A;  4H8K A;  4DTR A;  4Z4G A;  4FLW A;  5FRM A;  4C8K A;  4DTU A;  1I39 A;  2D5R A;  4BE2 A;  4CHP A;  1QSY A;  2IS3 A;  4W5N A;  3NF7 A;  1KVC A;  4Z0U A;  3HM9 A;  2DTU A;  1S1U A;  3T3F A;  2F96 A;  4CGG A;  3L2V A;  3PO4 A;  1J9A A;  3HT3 A;  3DMJ A;  5C42 A;  4M3W A;  4J2E A;  3SNN A;  1JLA A;  4KTQ A;  4RW9 A;  4E3S A;  3PX6 A;  2G8W A;  1TAU A;  1RTH A;  3AVM A;  1X9M A;  3HST B;  1BCO A;  3NDK A;  1NOZ A;  1VK0 A;  1RT4 A;  3V9S A;  3SI6 A;  2HHV A;  1IH7 A;  5HRO A;  2KW4 A;  1RDC A;  3HK2 A;  1BQN A;  3HL8 A;  3KLF A;  3SV3 A;  4DQI A;  4EZ6 A;  4DWI A;  3AV9 A;  3D0P A;  4IFV A;  1HPZ A;  3KIO A;  4O4G A;  4GVM A;  1RBS A;  1T03 A;  4Q5V A;  2YNG A;  4FLV A;  4M3U A;  3V4I A;  3CM6 A;  3QIP A;  1HJR A;  3C95 A;  3MEG A;  3VQP A;  5KTQ A;  3TAG A;  4CGF A;  4Q0B A;  4DQS A;  1N5Y A;  1RDA A;  2E4L A;  2RF2 A;  1TKZ A;  4CJK A;  2KZM A;  2YKM A;  2HB5 A;  3OS1 A;  4O5B A;  5C24 A;  3QNO A;  3AA3 A;  3DLE A;  2VWK A;  3G10 A;  3IG1 A;  3NFA A;  4W5Q A;  4H4M A;  3OYK A;  2F8S A;  2OZS A;  2O4I A;  1TL1 A;  4AHV A;  1QTM A;  2VG7 A;  4Z4E A;  1QHT A;  3ALY A;  1DLO A;  4CEE A;  2OYQ A;  2FBT A;  2FBY A;  4O0J A;  1LAW A;  3V1O A;  1L3V A;  2YNI A;  4CHZ A;  2X6S A;  3U3G A;  1CXU A;  3HVT A;  4HHT A;  3LP2 A;  1ZBU A;  1KVA A;  2YV0 X;  3RMB A;  4AHT A;  1KTQ A;  3M8R A;  4FZX C;  2RPI A;  3KLI A;  3DYA A;  3U6F A;  4KKO A;  3HO1 A;  1ASW A;  2O4G A;  2YHB A;  5CZ1 A;  1Q8I A;  2I5J A;  3ZSO A;  3WNE A;  4DQQ A;  4DS5 A;  4DU1 A;  4AHR A;  4MQ3 A;  4E0D A;  4NCA A;  3TAM A;  1S1X A;  3CFO A;  3QEW A;  1J5O A;  2G8H A;  3I0R A;  4F3O A;  4KB0 A;  4B9L A;  1HMV A;  3HPO A;  3AA4 A;  2OPP A;  1HYZ A;  3NCI A;  4HVJ A;  3TAN A;  4RG8 A;  4PQU A;  1NJZ A;  3L2Q A;  4CGD A;  2D0B A;  4I2P A;  3JSM A;  4FK2 A;  4RW8 A;  4CFB A;  3KLG A;  3VN5 A;  4BWM A;  1TK5 A;  2P5G A;  1BL3 A;  1TKT A;  3EYZ A;  3LAN A;  1HQU A;  4CED A;  4EP5 A;  3KK1 A;  3MAQ A;  1TAQ A;  3THV A;  5D3G A;  1C0T A;  4J2A A;  4W5R A;  4B8C A;  1IKV A;  4DFP A;  1Q9X A;  3V9U A;  1RT2 A;  2VWJ A;  5T7B A;  2PYL A;  3AO4 A;  4CF1 A;  1NKB A;  3ZT3 A;  2G8U A;  4RW6 A;  2KFN A;  3DLR A;  3NH2 A;  1U48 A;  1A5W A;  3ZSQ A;  4B9V A;  1HRH A;  2FC0 A;  4W5O A;  4FJM A;  3TAF A;  3V81 A;  3OYA A;  4KHY A;  4DTM A;  1B9F A;  3LAL A;  3MXJ A;  4FJG A;  1IO2 A;  3ZSX A;  3SZ2 A;  1S6P A;  1Y97 A;  4R5P A;  1X9W A;  2JLE A;  2OPQ A;  1T7P A;  1VSM A;  5KRT A;  2Y1J A;  1KLM A;  3V9X A;  2R7Y A;  1J54 A;  1WAJ A;  1TK0 A;  1MU2 A;  4N41 A;  3LP1 A;  3ZSY A;  4CHY A;  3OJS A;  4DTP A;  4DFM A;  3V6D A;  3LZI A;  4JLH A;  1RCH A;  2VG6 A;  1FKP A;  3ISN C;  3OYF A;  1KFS A;  4ELU A;  3CG7 A;  4LY7 A;  3QNN A;  2HHX A;  2BE2 A;  4FM1 A;  1S1V A;  1CZ9 A;  3KK2 A;  5KGW A;  3L3U A;  4DU3 A;  4CJF A;  1R0A A;  3I0S A;  5J1E A;  4KO0 A;  2HHT A;  2HHQ A;  4CEZ A;  4KRE A;  4LH5 A;  3S3M A;  4CEF A;  4E1M A;  1ZBI A;  2G8I A;  4BDY A;  3TAP A;  1RIL A;  4E7K A;  5DMR A;  4E7J A;  3HPG A;  4KPY A;  1XHZ A;  3KK3 A;  3SCX A;  1JLG A;  3B6P A;  4OGE A;  5HBM A;  3K58 A;  3VQ9 A;  2DFH A;  4FW1 A;  4CJS A;  4YNQ A;  3LDS A;  1BQM A;  4NCB A;  1LAV A;  4CJQ A;  4FXD A;  2AJQ A;  4DS4 A;  3QER A;  3TAB A;  3DI6 A;  3FFI A;  3RMD A;  2ETJ A;  3AVA A;  2ITG A;  1SKW A;  3VQQ A;  1RT3 A;  1VSH A;  5FRO A;  4M41 A;  3ZT2 A;  4CIF A;  1JL2 A;  2DFE A;  3O3H A;  4M45 A;  1X9S A;  3OYE A;  3VA3 A;  1C1B A;  1Z25 A;  5J2M A;  4LH4 A;  4JS5 A;  4OLA A;  3OYC A;  4KRF A;  1FKO A;  4K8X A;  3K5M A;  4OKE A;  4DF8 A;  1UA1 A;  1T05 A;  4AIL C;  4KB1 A;  4QOZ B;  3QIN A;  1UOC A;  3SJJ A;  2Y1I A;  2VG5 A;  4H4O A;  3ZT0 A;  3L2U A;  3VQD A;  3EY1 A;  4DLG A;  4CK3 A;  4OKJ A;  4CES A;  3DRS A;  1WNS A;  2G8K A;  4NYN A;  4CFA A;  4CJU A;  3MXI A;  3OYD A;  3C6T A;  4JRQ A;  3ZSR A;  4CEQ A;  4CIE A;  3SQ2 A;  4M42 A;  1SL2 A;  2E6M A;  3LP0 A;  4FM0 A;  4KI4 A;  3OVN A;  3SV4 A;  3ASM A;  4B08 A;  3EZ5 A;  1XC9 A;  1KFD A;  1U45 A;  1KLN A;  2PZS A;  4C8L A;  3SUN A;  3OJU A;  1VSK A;  1B92 A;  2B4J A;  4N5S A;  3AO5 A;  4B9T A;  1NJW A;  1WSE A;  3NH1 A;  2GBZ A;  3NE6 A;  3AVI A;  4N47 A;  3AO1 A;  1IG9 A;  1TV6 A;  3NF9 A;  3ZSW A;  4F2R A;  4DLE A;  1EX4 A;  2PYJ A;  3TAQ A;  1TVR A;  1BIU A;  2IOC A;  4CF9 A;  2XHB A;  4C8N A;  4C8M A;  4CHN A;  1LWC A;  1TK8 A;  4FJ5 A;  2HVI A;  4CF8 A;  2Q3S A;  1WSI A;  3ZT1 A;  4O0I A;  3HP9 A;  3LPU A;  4Y1D A;  5HRS A;  4W5T A;  3OYB A;  3O3F A;  3OYH A;  4F4K A;  3S3O A;  3NHG A;  1RT1 A;  4AHS A;  4FJ8 A;  3K2P A;  4OLB A;  3KLE A;  5CY4 A;  4I2Q A;  4FJ9 A;  4CJR A;  1HNV A;  1WN7 A;  2YKN A;  1VSI A;  3LAK A;  5KI6 A;  1T8E A;  4FYD A;  2F8T A;  1YVU A;  3K5O A;  4I9L A;  4UQG A;  4FM2 A;  3NGI A;  4CEO A;  4ELT A;  3KD5 E;  3RR8 A;  4BE0 A;  3SQ0 A;  4I7F A;  3AA5 X;  1S5J A;  1SL0 A;  3KD1 E;  4FLU A;  3AVL A;  4E19 A;  4E7L A;  1G15 A;  3K5L A;  2XY7 A;  4FK4 A;  4KHW A;  3SQ1 A;  2XRI A;  1BI4 A;  1LWF A;  4PUO A;  4IG3 A;  3CM5 A;  2EHG A;  1KSP A;  2FBX A;  4J2D A;  1WSF A;  3NGY A;  4DTS A;  1GOB A;  4E89 A;  4CF2 A;  4FJN A;  1BIZ A;  5SZT A;  3E01 A;  4ELV A;  4J2B A;  3AVK A;  3TAE A;  5I3U A;  1ITG A;  2A1R A;  3K57 A;  4HTU A;  1KRP A;  4FJ7 A;  2QKB A;  5KGX A;  4FLZ A;  4CJE A;  3TR8 A;  1NJY A;  1HNI A;  4MFB A;  3OYI A;  1NK7 A;  3DOK A;  1L5U A;  4CGH A;  4XIU A;  1JLF A;  2IC3 A;  2LSN A;  1Q9Y A;  4N76 A;  4CHQ A;  3A2F A;  3HPH A;  3IAY A;  3ITH A;  3B6O A;  3NF8 A;  4Y1C A;  2G8F A;  2X78 A;  2E6L A;  4ID1 A;  4HCB A;  1YTU A;  2HNZ A;  2P1J A;  4KHN A;  1ZBF A;  3LPT A;  3V9W A;  4NCG A;  3OS0 A;  2BAN A;  1U04 A;  3SUO A;  4FJL A;  2Z1I A;  3QLH A;  1I3A A;  4DSK A;  3AVB A;  5JS1 A;  4DFK A;  4KHQ A;  1U47 A;  1HQE A;  1JXE A;  1LWE A;  5E41 A;  3LWM A;  4FJI A;  3MEE A;  1L3U A;  4CHO A;  1UWB A;  3VQ8 A;  1RT5 A;  1RTI A;  2YNH A;  3HVR A;  4E7I A;  3PV8 A;  1NK8 A;  3SYZ A;  2P51 A;  3VQE A;  1RT7 A;  1SV5 A;  1WSG A;  2Z1J A;  1D9F A;  2Z1H A;  1EP4 A;  4Z4C A;  1NK0 A;  4ICL A;  4B9M A;  1VRU A;  2XY6 A;  2KZZ A;  1RBT A;  3NF6 A;  2OPR A;  3OS2 A;  3VQ7 A;  3TWH A;  1RBR A;  1C0M A;  1CZB A;  3LP3 A;  4O44 A;  3PUF A;  4M3R A;  4CE9 A;  4ZHR A;  4GMJ B;  2HHS A;  1L3T A;  1JLE A;  3QO9 A;  1C1A A;  5DK5 A;  2A1S A;  3V1Q A;  4DFJ A;  2PY5 A;  3PY8 A;  5HRP A;  4ZTJ A;  3L3V A;  1U4B A;  4CFD A;  1HYV A;  2WOM A;  3L8B A;  3RMA A;  1NKC A;  1NK4 A;  4FK0 A;  1BIS A;  3M8Q A;  1XI1 A;  1WAF A;  4AHU A;  2XO7 A;  1D9D A;  4CJT A;  4B9U A;  4OJR A;  4F3T A;  1SL1 A;  3WNH A;  3OYG A;  4KHS A;  4KI6 A;  2X74 A;  4E1N A;  1TKX A;  1EKE A;  5FDL A;  4DTO A;  3AA2 A;  1TKD A;  2DY4 A;  3PX0 A;  4DSL A;  1RNH A;  4KFB A;  4DF4 A;  2G8V A;  3CYM A;  1SUQ A;  3OYN A;  3HJF A;  1BI4 B;  1RDB A;  2IAJ A;  2HMI A;  3AVG A;  3WNF A;  1UA0 A;  3LWL A;  2IGI A;  4DTJ A;  5C25 A;  3V1R A;  4OVL A;  4CJW A;  2HVH A;  3MXM A;  3DLG A;  1CLQ A;  2DFF A;  1S1T A;  3DRP A;  1WSH A;  1VSD A;  2ZQB A;  1A5X A;  1KVB A;  4KTW A;  5EU7 A;  4CFC A;  5CYQ A;  4CJP A;  3RMC A;  2KQ2 A;  4RW4 A;  3DOL A;  2NUB A;  1S9G A;  3F9K A;  3I8D A;  4BDZ A;  3AO3 A;  4DQR A;  4FCY A;  4FLT A;  1LV5 A;  4NYF A;  3VQ4 A;  5KRS A;  3SPY A;  3HXM A;  5J2P A;  1NOY A;  3K5N A;  3DLK A;  4FVM A;  4LD0 A;  3SPZ A;  5HLF A;  1VSJ A;  5J2N A;  4CGJ A;  4CF0 A;  4CJ5 A;  1S1W A;  4EP4 A;  3RTV A;  1U49 A;  2BDP A;  3G0Z A;  3NAE A;  3MEC A;  3S9H A;  4DSI A;  4FZY A;  1VRT A;  4IBN A;  4ID5 A;  3O3G A;  3U3Y A;  3IS9 A;  4M3Z A;  1S6Q A;  1VSL A;  4G1Q A;  3QEP A;  3OYL A;  3TI0 A;  1FK9 A;  1VSF A;  2D0A A;  4C8O A;  4FJH A;  3K59 A;  3QEV A;  1SKR A;  3KTQ A;  3C6U A;  2FBV A;  4B8A B;  3TAR A;  4B3O A;  1X1P A;  4DTN A;  4OPJ A;  4BDP A;  1ZBH A;  1S9E A;  4CJL A;  1JLB A;  3HYF A;  2P5O A;  2ZD1 A;  2JGU A;  1BHL A;  3LAM A;  4CJ4 A;  4B9S A;  2IDO A;  3P83 D;  3L2R A;  1QS4 A;  1IKY A;  3RRG A;  4OPK A;  1DTT A;  1JLQ A;  3D45 A;  3ZSV A;  4HCC A;  1J53 A;  3DLH A;  1RTJ A;  3F73 A;  4F2S A;  2YNF A;  4M3Y A;  2X6N A;  1N6Q A;  3P1G A;  2XY8 A;  4HUG A;  3P5J A;  5HRN A;  1JLC A;  2B6A A;  3O4Q A;  4B9N A;  2KTQ A;  4CGI A;  4HUF A;  1F21 A;  3KKS A;  4PWD A;  2GV9 A;  5CYM A;  5HRR A;  3OY9 A;  4F8R A;  4ZTF A;  4DTX A;  1WLJ A;  3O4N A;  3DLB A;  1B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...