2VG5A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
557
structure length
551
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 144
structure length 551
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg5A05
3CIZA 2J6UA 1CZBA 4CJTA 2FLNA 2AU0A 1NK4A 2B43A 3LP0A 4M45A 4ZPBA 4WYWA 3RWUA 4Z4CA 3AV9A 3WNHA 4IFVB 2UVWA 1DTTB 4B9UA 3MAQA 1NK8A 4TYAA 1TVRA 4OGEA 3ZSWA 4KB0A 4FK2A 3PY8A 3SQ0A 1HPZB 1IKWA 3EYZA 2C2RA 1SH3A 4E7KA 2BQRA 4O3QA 2FVRA 1UAXA 3T19A 4Q45A 1HMVA 2RDIA 1S97A 2X6SA 4ECZA 4M94A 3RBEA 5F8GA 3TAPA 3PJWA 1MU2B 1N5YA 1WSJA 3SPYA 3OYCA 1KHWA 3NGDA 3HVWA 3H98A 5J2PB 4ED0A 2BANA 4RNMA 2YNIB 3DOKA 1TK5A 4ELTA 5CZ1A 4K4YA 4FM0A 3TAEA 1IKVA 2FJWA 4DSKA 1C1AA 4RW7B 2D7SA 4OGCA 4TLRA 5EDWA 1ZBHA 4TXSA 4IDKB 5J2NB 4CEAA 4M42A 1J5OA 4O3OA 3H40A 3BQ2A 3IN5A 1LAVA 3BSOA 1VSHA 4ZP7A 4NZ0A 4NLDA 2OPQB 4FM2A 4WFXA 3HPGA 2HVHA 3KLVA 1C1CB 3H5UA 1WSEA 2AX0A 1LWEA 4DWIA 2JC1A 4J9KA 2X6NA 1NKEA 2IJNA 3NL0A 4CHNA 4BWMA 3NKYA 1T8EA 1R0AA 1RILA 1ZBLA 5HLFA 1T03A 4TY8A 4FLZA 4I7FB 1ITGA 3MEEB 5KFDA 3E51A 2CJQA 4O5BA 4MK8A 4QWAA 2YHBA 4KHMA 3RTVA 5HROA 1TP7A 2XGPA 4KHRA 3NH0A 1QSSA 3NBPB 4Z4IA 5C5JA 3H5XA 2WB4A 3MECA 3VQ9A 3WNGA 4NCAA 4JLHA 2QXFA 3T5LA 2FVCA 4CJ4A 4MIBA 3SFGA 3HPOA 5L1JA 2C28A 2DPJA 1WSGA 4J2EA 2DFHA 5SWMA 1NNDA 1NK0A 3NH1A 1RDDA 4MK7A 3G6YA 1WSHA 4CJKA 1S1WA 3VQ4A 4IH7A 1S1XB 1J53A 3PW7A 3CJ4A 4IG3B 2BRKA 2AGQA 3AA3A 4DEZA 4RU9A 1HQEA 3RB0A 3AO2A 3OYLA 2YNHA 1GOAA 4XIUA 4F4WA 1IKYB 1T3NA 4Q8FA 2WCXA 1Q8IA 1RA6A 2ZD1A 2FLPA 4DU3A 3OYIA 5KFQA 3QYYA 4DFJA 3P83D 3C6TB 3OYJA 1RT2A 4NLUA 3RR7A 2JC0A 3T5JA 4W5OA 4M3XA 3OVNA 1BISA 3CM6A 2ZE2B 3QIPB 3EPGA 1RT7A 2BQ3A 2ZKUA 5F8HA 3KK1B 3PW4A 1RT4B 2OPPA 5FDLA 4XPCA 4WXWA 1VSLA 2WONA 4JS5A 3RMBA 4K50A 4KO0A 2UVRA 4K8ZA 1SKWA 4LH4A 4B9LA 1RTHB 4KREA 1RT3A 4JRPA 1RBTA 3SQ2A 3SUOA 2OPSB 5L1IA 3GV8B 3KK2B 2G8UA 1C0UB 3UDLA 4DSLA 2WOMA 3VQCA 4DSJA 1RTDA 4R8UA 3CQ8A 3SQ1A 2ITGA 2YNFA 1YTAA 3CJ2A 4RNOA 4J9MA 3VQDA 4CGFA 3QEXA 4B8CA 5DG9A 2W9CA 4KFBB 1TQLA 1S5JA 4QWDA 2R2TA 3DLGB 3QNNA 3TWHA 3K5NA 1S6QA 4ID5A 5D3GB 4F50A 3AVNA 3DYAB 3F9KA 3OYBA 5KFKA 4IQXA 1DTQA 4Y1DA 1L3UA 4RW4A 3NF6A 1X9MA 4TSXA 4H54A 3ULDA 3CFPA 2DFEA 1XHZA 4ZHRB 3QESA 3FDSA 3DI6A 3V6DB 4EBDA 2B5JB 2FVSA 4K4UA 1JXBA 5KG7A 1RNHA 3V81B 1VSJA 3V1RA 3OJSA 5KFHA 4NCGB 2G8VA 3TANA 3C6UA 4IG0B 3EZUA 4X2BA 5KTQA 4PWDB 4FJGA 4I2QA 5HP1B 4AHUA 4OJRA 4CJ5A 1NHVA 1S9GA 3OS2A 3U3YA 3AO5A 2OPRA 3H59A 5C25A 5JXSA 3KLIB 4N56A 4ED8A 2IBKA 3KJVA 4IR1A 4IRDA 2VWKA 1C0MA 4ZP8A 1BCOA 5F8LA 2EX3A 4B3OB 3T3FA 2G8KA 2XY6A 2YKNB 4YR2A 2AWZA 5JS1A 5C24A 3PW5A 2ETJA 5CYMA 1KVCA 1ZBFA 3ZSQA 1IKXB 3QEPA 2BRLA 3GIMA 2QKBA 2ATQA 3OS0A 3VQSA 4DL3A 4YFUA 5CZ2A 3I0SA 4CEQA 3H5SA 3E01A 3AVLA 1LW2A 1FKPB 1JLFA 1GX6A 4IFVA 3KKRA 1DTTA 4CK1A 5KRSA 2BE2B 1TKXA 2G8IA 4DFKA 4CGGA 4CGHA 1U49A 3AA2A 1LW0A 5KFBA 1RT6A 5EWFA 3CDUA 1QAIA 4BDPA 4B9NA 3IS9A 4CJEA 2DPIA 5SZTA 1KLMB 4E7IA 2F8SA 1S0NA 1S1UB 4HCCA 4FK0A 4EBCA 1CXUA 2Y1JA 1HRHA 2F8EX 3HHKA 2IM3A 3KK3B 4Q0BA 1JLCB 1LV5A 3LZJA 3QNOA 4Y1CA 1NK9A 4E89A 3FQLA 1JLGA 5KFIA 2FC0A 4PUOB 2WK4A 2E9ZA 1SV5B 1UWBA 3DRPA 3KIOA 4IH6A 1ZETA 3SYZA 3SFUA 4RW7A 1S1TB 3UQSA 5F8IA 3OHBA 5J2NA 3KLEB 3V9UA 1REVA 2I1RA 4M3UA 4RUCA 3AVBA 4KSEB 3DRRB 4K4SA 3N6NA 4MKBA 4E19A 3V9XA 3LWLA 2OPQA 2D0AA 3DRSA 1C1CA 3SUQA 3O4NA 3QETA 1XR5A 3KLHB 1HNVB 1RBUA 4GVMA 2HHWA 3NE6A 5KI6A 1XR6A 2NUBA 3HVAA 3U6FA 4Q5VA 4I2PB 3NGYA 3U3GA 4FXDA 2XI2A 3PX0A 4EO6A 1HQUB 5DQHA 3CVKA 4CFCA 3CM5A 1ZTTA 3VA0A 5J2QB 2UVVA 4C8LA 3TAGA 2HHVA 1SKRA 1NHUA 4RNNA 3KLGA 4CK2A 1VSIA 3NF9A 3NFAA 4YQWA 1EX4A 4NLPA 2AGPA 5L1LA 1BI4B 5KFFA 5KFEA 4F2RA 1U48A 3T5KA 2HNYB 4J9PA 4KI6A 1ASVA 2E6LA 1BIZA 3G10A 4LSLA 1SH0A 2GIQA 1NJZA 4AHVA 4ECYA 2FBYA 5JS2A 3RR8A 1N4LA 1BIUA 4ICLB 3JYTB 3ZT3A 4FW1A 3I8DA 4IG3A 4OKJA 3THVA 4RW8A 5J2MB 4DQSA 3DM2B 3AA4A 1RBRA 3AO1A 2QE5A 1ASUA 5FRMA 3OYNA 1KFSA 2VG5A 2WTFA 3QO9B 2G8WA 4C8KA 4E7LA 1BHLA 4MFBA 2JEIA 1EP4A 3MFHA 1U04A 3CFRA 3ZSVA 1RDAA 4DL4A 1S0MA 4KV8B 4TQRA 4DTMA 2FJVA 3K2PA 3QINA 2HHXA 2ZE2A 3QIPA 3NAIA 1S9FA 4FW2A 4HUFA 3AO3A 4MQ3A 2JGUA 3ZCMA 3ZSRA 4FS2A 2XWYA 1LWCB 3TABA 3LP2A 4GW6A 3QEVA 5KT2A 4KTWA 4N5SA 1U09A 3T5HA 1RYRA 4YR3A 1GOCA 1EETB 4CK3A 3AVKA 1TL1B 1VRTA 4NLQA 3OYMA 1QE1A 2IGIA 4CFDA 4L8RB 4EZ6A 4DTUA 3DMJB 1RCHA 4K4XA 3L3VA 1C0UA 3ZT0A 2O4IA 4UQGA 4QWBA 3MXIA 2PYJA 3MEGA 3L3UA 4ZVGA 1BGXT 3VQ8A 3PO4A 4J9NA 3L2VA 3DDKA 3VQBA 4FLXA 5CYQA 3KLFB 3N6MA 1YTUA 1WLJA 1D5AA 5D3GA 1TV6B 5FRNA 2VG6B 4N47A 5K14B 3RMDA 2IAJB 1ASWA 4WFYA 2Z1HA 4HVJA 4DU4A 3DYAA 4F4XA 4O0JA 3LPUA 3MR5A 3NF8A 4FK4A 1TKTB 3T1AA 2XCAA 2R2RA 2IM0A 5DLGA 5KFSA 4CHZA 4RW6B 4HCBA 3KTQA 3AVMA 3MEDA 1C0TB 3MR3A 2CKWA 1KCFA 4C8OA 3V4IA 1A5XA 4B9SA 2KFZA 1RT5B 3DLKB 5DK5A 5KG5A 4KAZA 1LAWA 1NKBA 1YT3A 4R0EA 1VSKA 4QWCA 3ZSYA 4OLAA 1LWFA 4KKOB 5J1EB 4FVMA 2KW4A 3I0RB 1JL2A 1IH7A 3BQ0A 4EEYA 3OSPA 5HRRA 1RTIA 3QZ8A 3KLIA 4CHQA 4KHWA 4WZQA 1JLAB 4EO8A 3Q8RB 4TQSA 4ZP9A 4CF2A 4CJ3A 4O4GA 4HKQA 4CFBA 4RNHA 4DF8A 1FKOB 2V0NA 2JEGA 4IFYA 4CF9A 1KTQA 2XGQA 4KHNA 1D1UA 3LP1B 4H4MB 3ISND 4GMJB 1RDBA 5KRTA 1KLNA 3QLHA 4B9VA 3OHAA 4DL2A 4IKAA 2HB5A 2I5JA 1RYSA 5C42A 3VQ7A 2E6MA 4QOZB 1CLQA 3HVTB 5KFUA 1S1VB 4ECSA 5F9NA 4B08A 1Z25A 1TK0A 2BE2A 5DGAA 3BREA 2D3ZA 1S9EB 4FJLA 4BDZA 4J9LA 4NLGA 1S10A 4DFMA 5HRSA 3TAQA 3OY9A 4KHYA 2D41A 1JKHB 4K4WA 4RZRA 2E9RX 4EBEA 3KNAA 3L2QA 4XPEA 4LY7A 1WNSA 1F21A 4NLXA 4WE1B 1TKDA 4NYFA 1JLCA 3KKSA 3B6PA 3OYFA 4LQ3A 2HMIB 4B9MA 1SL1A 1W0HA 2BQUA 1IM4A 1GOBA 3IRXB 3HKWA 1T05A 4PUOA 3M8PA 3ZSZA 4G1QA 2FBXA 2UVUA 3OL8A 2V9WA 5KGXA 1JLBB 2G8FA 4F3OA 3RB4A 2YNGB 3NDKA 3KLEA 4FJ5A 3DOLA 4H8KA 2XHBA 4DG1A 1VK0A 3VA3A 3DRRA 4CGIA 5KFNA 1BQMA 2P1JA 3AA5X 2B6AB 1DLOB 1TKZB 3SPZA 3ITHB 3A2FA 4DTJA 4B9TA 3HO1A 3K5MA 3KLHA 4Z4FA 3M8QB 4AHTA 2VWJA 5JUMA 3Q8QB 3DLRA 5HRNA 4CF0A 3RRGA 4DS4A 4I2PA 3JSMA 1RT1B 4NRUA 4TYBA 4LSNA 3PW0A 2Z1JA 3HK2A 2GC8A 5I42B 4KTQA 1U45A 2W9AA 1T94A 3BJYA 3FRZA 4M3RA 4NLSA 4ZPDA 4F2SA 4ECWA 1KHVA 3KHLA 3CDWA 4J2BA 2JEJA 2AGOA 4ZPCA 1U47A 4KPYA 1BI4A 2LSNA 3QERA 2HNYA 1KSPA 4ZVFA 2J6TA 3TAMB 3M8SA 2XO7A 5I3UA 4CHPA 1I3AA 4KHSA 2V4RA 3UPFA 5KFAA 3BGRB 3V6JA 4IH5A 1JXEA 5EWEA 4DSIA 1IKWB 4KI4A 2QK9A 3JYTA 1D8YA 2GV9A 2J6SA 4KAIA 1HMVB 2C22A 1N5YB 2G8HA 3P5JA 1QQCA 3K58A 2BANB 4K4ZA 3DOKB 4H4OA 4CJSA 1RDCA 4FLUA 3HXMA 3Q8SB 4K4TA 3V6HA 4CFAA 1TL3B 3LAMA 3GV7B 1OS5A 3OSNA 2C2EA 4MK9A 3H2LA 1K1SA 4DLEA 2ZQBA 3M9MB 4K4VA 4IR9A 3IG1A 3BSCA 3HL8A 1XR7A 2RF2A 4ED2A 4IKFA 3I5CA 3KD1E 4YNQA 3V9WA 1NK7A 4Y34A 3RB6A 1HJRA 1UA1A 1J54A 1EETA 1GX5A 4GC6A 1TL1A 5DQGA 3V1OA 4O4RA 2C2DA 4FLYA 2A1RA 4KTZA 1LWEB 2Z1IA 3DMJA 3H4BA 3NH2A 4CJLA 3TAFA 4DSEA 1SL2A 4HTUA 1T03B 1D0EA 4EP5A 5KG3A 4YMEA 3OL7A 4BDYA 4CEZA 3QGGA 3KLFA 4PA1A 5HROB 3L2RA 1HPZA 3ASMA 4QPXA 1TV6A 3MECB 3LANA 5K14A 2VA3A 2XY8A 4OPKA 1B9DA 1QAJA 4QW8A 3KHGA 4CEBA 2YV0X 1S4FA 4CJFA 1T7PA 2VA2A 1CSJA 1L5UA 2YKMB 1NOYA 1MU2A 3SQ4A 4J2DA 5J2PA 4N41A 3EY1A 2IDOA 1S6PB 2YNIA 1S1WB 4NYZA 1G15A 1L3VA 3QZ7A 1JLQB 2OZMA 4E1NA 1C0TA 4CHOA 2RDJA 1KFDA 5KFMA 1HQEB 3AO4A 4U6PA 3C94A 1RT5A 2YNHB 4FS1A 4OKEA 4IDKA 1JL1A 1SKSA 1HYSB 4C8MA 1BCMA 3NAEA 5KT7A 2R2UA 4R5PB 2HHTA 4DLGA 3VQQA 2QV6A 2ZD1B 2PYLA 4KRFA 3GQCA 3RBDA 3D5MA 4FJ7A 3O3FA 1RT2B 4FJIA 4JV2A 4AHSA 3QEWA 4NLYA 2FVPA 1WNEA 1RT7B 1VSEA 1RTJB 3CJ5A 2R2SA 5FDLB 2YHAA 3BSNA 1UA0A 1NK5A 4I9QA 2EC0A 4DFPA 4CJUA 4IRKA 1A5WA 3UR0A 1NK6A 1Z4UA 4ZPAA 3LPTA 4DL5A 2OH2A 2FBVA 4I7FA 3MEEA 4ED7A 3LP1A 4Y2CA 5KFLA 3CYMA 4DF4A 1RT3B 4Q8EA 4CJWA 2DTUA 3NBPA 1W9HA 4DTSA 2O5DA 2XRIA 3HP9A 4M3TA 2W7PA 2WOMB 2IJFA 4ED6A 4CEOA 1RTDB 4R8UB 5KFXA 1WSIA 1Z26A 3DLEB 5KG0A 4W5RA 1TGOA 1VSDA 2Q3SA 4DL7A 2W9CB 1WSFA 4F3TA 3PW2A 4CEEA 4DMNA 1S1XA 1S6QB 4ID5B 3ALYA 2PZSA 1C2PA 1VRUB 2HWIA 3SJJA 3M9NB 3NHGA 3PUFA 2A1SA 1DTQB 2QKKA 4JRQA 3ICLA 3SNNA 4J2AA 4CIGA 4CJVA 4WE1A 2ILYA 3ZT2A 1IKYA 4WFZA 3SI6A 1XWLA 3HVRA 3IGVA 1B92A 4IRCA 2V4QA 3NGZA 4N76A 3DI6B 4O3PA 1FXXA 3IRXA 2GIRA 3C6TA 3OYAA 3MXMA 4J9RA 1Y97A 3C6UB 4ID1A 1TAUA 2Y1IA 3FSIA 2BDPA 3KK1A 4I9LA 4KB7A 1RT4A 4KB1A 1CXQA 3EPIA 3F73A 1L3TA 3IGNA 4E7JA 3CG7A 2E4LA 5KG2A 4ZP6A 5FROA 1RTHA 1S9GB 4DSFA 2ASJA 3M8QA 2OPRB 4O44B 3DLHA 5C25B 4NLTA 2OPSA 3VQPA 3KK2A 5F8JA 3L2UA 4NLOA 3CFOA 3VQ5A 4FJJA 3KOAA 4EYIB 3OLBA 4CJPA 3NAHA 4M3ZA 5I42A 4JUZA 2W9BB 5HBMB 4CIEA 1K6YA 5KG6A 3HYFA 5CYMB 3OLAA 1C1BB 1CZ9A 3NF7A 4KFBA 4WXOA 3MXJA 4M3WA 4OVLA 3DLGA 4NLWA 1ZTWA 1JLEB 4PQUB 4ECUA 3I0SB 3AVAA 3E01B 1LW2B 1QHTA 2W42A 4FCYA 4HUGA 1S0OA 1JLFB 2P5OA 1RA7A 4OL8A 5T14A 3TAMA 3I5AA 3PZPA 4ZMMA 2KQ2A 3C95A 1TKXB 3BGRA 2FLLA 4OKKA 3I5BA 1HNIB 1LW0B 1RT6B 1NJYA 4O55A 4ZHRA 4Q44A 4ZTFA 2HNDB 4RW9B 3V6DA 1SUQB 3IS9B 2W8KA 2B5JA 4LQ9A 4ZVEA 3V81A 1I39A 1FK9B 4J9OA 1BQNB 3CJ0A 3KMSA 5DLFA 4NCGA 2HNZB 4IG0A 2R8HA 1XHXA 4CERA 4Q0BB 4PWDA 3AVJA 4F4KA 3M9OB 4FJ8A 3GIJA 4Y3CA 5HP1A 4ECVA 1JLGB 3EZ5A 1UWBB 3DRPB 4FZXC 2KFNA 1TL3A 1IG9A 4FLVA 2AX1A 1L3SA 4Z4EA 5DG8A 4FYDA 3ISNC 4MKAA 3RMAA 4DQQA 1QUVA 3N6LA 4KHUA 3AVHA 3L2WA 4FLWA 1REVB 3QGHA 1W25A 3NCIA 3QGIA 4B3OA 3CO9A 3ZSXA 3DRSB 2YKNA 5KG1A 3IAYA 4BWJA 2Z1GA 3G86A 4KHQA 1IKXA 4HYKA 3AVIA 3OYGA 3BR9A 2IM2A 1BL3A 4G3IA 2RKIB 2AQ4A 2IS3A 3K57A 1KVAA 1FKPA 3L8BA 1D9DA 4DTRA 5KFZA 3KHHA 4FJXA 2XY5A 4AILC 2D0CA 1JIHA 3KLGB 4CEFA 1KRPA 5DMRA 3SUPA 2VG7B 2OA8A 3H5YA 3TQ1A 3AVFA 1KLMA 2F8TA 1S1UA 4KE5A 4O3RA 3OJUA 2JLEA 2YKMA 1N56A 4QW9A 4RUAA 4LSLB 4BE1A 4EP4A 3KK3A 4FZZA 1S6PA 3BDPA 3MF5A 3OYHA 4BE2A 1JLQA 1C6VA 4NRTA 4RW8B 4Z4HA 3K5OA 3OS1A 3SUNA 3GIKA 3M8RA 1SV5A 3FFIB 3RMCA 4DTNA 3K5LA 2VG5B 3GYNA 2P51A 1X9WA 4ECTA 2IC3B 1S1TA 3HP6A 4MFBB 1HYSA 2BR0A 2HHQA 1EP4B 4IBNA 3SCXA 1JXLA 4R5PA 4ED3A 3VN5A 4FBUA 4M41A 1QS4A 2ALZA 3KHRA 3OYEA 4F8RA 5KT5A 3WNEA 4FM1A 3PV8A 2KZZA 1HNVA 1TAQA 1N6QB 1RBVA 3PO5A 4OPJA 4CESA 4ED1A 1RTJA 3LP2B 4ECRA 4DL6A 2R7YA 2ASDA 5F8NA 4WYLA 1IO2A 1QTMA 5KT6A 3PJXA 1EKEA 2XY7A 4WZMA 4ELVA 2E9TA 2D0BA 1HQUA 1WAJA 4NYNA 4CGDA 3TI0A 3V9ZA 4AHRA 5DG7A 3BQ1A 1J9AA 1VRTB 3V1QA 5EU7A 4O3NA 1QE1B 2WHOA 5J2QA 1A5VA 3MR2A 3VQ6A 4HUEA 3LP0B 3H4DA 2R8GA 1X1PA 3B6OA 5KT3A 2R8KA 4YR0A 1K1QA 1UOCA 4W5NA 4NLVA 1VSMA 3MEGB 3V9SA 5DGBA 1X9SA 3DLEA 5CYQB 4FJKA 1TVRB 3HPHA 2UUTA 3VQEA 3CJ3A 4CF8A 5KFVA 4ICLA 1Q9XA 3ZSOA 2DY4A 3KD5E 3LWMA 1VRUA 5J2MA 3OL9A 4JV0A 4FJMA 3DM2A 1HARA 3P1GA 4W5QA 3MFIA 2X78A 4CE9A 4B8AB 5KFOA 3QO9A 2D5RA 3S9HA 2OYQA 4J9QA 2XCPA 4F4YA 1XI1A 4DQRA 4XO0A 3MEDB 2OZSA 4OLBA 1RAJA 1IKVB 4KV8A 3V4IB 4W5TA 4ELUA 5EWGA 4ZTJA 2ATLA 4M3YA 4ECXA 4C8NA 5T7BA 4LH5A 2IM1A 1LWCA 3MTKA 4M95A 5KFTA 1J5OB 3LZIA 2FJXA 1LWFB 3MR6A 2UUWA 4LD0A 4DTXA 4QCLA 4YP3A 1HYZA 4CCHA 4E3SA 3SI8A 3Q8PB 4DQIA 4O44A 3V6KA 1RTIB 4CIFA 2HWHA 3HSTB 3G6XA 2HVIA 4O4GB 1ZYQA 1R0AB 4E7HA 5HLFB 2XI3A 4TY8B 2R8IA 1QSYA 2W9BA 4MH8A 5KG4A 4FZYA 5HBMA 4IFYB 3OYDA 3D0PA 2ILZA 2HHUA 3HJFA 5L9XA 5KFYA 4Q43A 3QEIA 1NOZA 4K8XA 1C1BA 4E1MA 4AH9A 4RNFA 4EYHB 1D9FA 1U4BA 2KZMA 3QLHB 4URQU 5CY4A 4JS4A 1RBSA 2BGGA 4CEDA 1NKCA 1JLEA 1MMLA 2I5JB 4PQUA 2VG6A 1NJWA 3PX4A 4DTOA 2IAJA 5C42B 4RG8A 4O0IA 5DQIA 1SL0A 1TKTA 3TVKA 1N48A 1O1WA 3S3OA 4CJRA 3ZT4A 3RAQA 2EHGA 3GILA 1HNIA 4RW6A 2GUIA 4MIAA 2HNDA 4RW9A 1YVUA 1SUQA 2WRMA 5L1KA 5KGWA 4URSA 1SH2A 2FVQA 1FK9A 1BQNA 4JV1A 3DLKA 4AHCA 2HNZA 3K59A 2W7OA 2PY5A 3AVGA 3HM9A 2IA6A 3OYKA 3O4QA 2R8JA 2KTQA 4KKOA 3AVCA 1T05B 5KFWA 3M8PB 5J1EA 4E0DA 4DTPA 4J9SA 4CECA 3PX6A 3I0RA 4BE0A 4G1QB 3DLBA 1I6JA 1S49A 1RDRA 4QWEA 3OL6A 4PY5A 4DS5A 3KMQA 2AJQA 1JLAA 3DOLB 4BACA 3S3NA 2OPPB 2X74A 4FBTA 2WONB 4DG1B 3PVXA 5HRPA 3PR5B 4ZVHA 4Y2AA 3H08A 4KO0B 4FJHA 1BQMB 3O3GA 2HW3A 4FLTA 1FKOA 4HHTA 2HHSA 3RB3A 3G6VA 1ZBIA 3SZ2A 4H4MA 4CJQA 3WNFA 2HAIA 1XC9A 4CGJA 3GIIA 1YVFA 5F8MA 3LAKA 4CF1A 2RKIA 3JSMB 2XC9A 4DU1A 4FJ9A 4LSNB 4DQPA 3HVTA 4QAGA 3VQAA 4U7CA 1S1VA 4O3SA 2YNFB 3QIDA 4Z0UA 5KFGA 1WAFA 3D28A 3GV5B 3ZT1A 2FBTA 1S9EA 3FQKA 3RAXA 3RRHA 1KVBA 2VG7A 1WN7A 4FJNA 5E41A 4TY9A 1JKHA 4KBIA 1TK8A 1Q9YA 4GC7A 2D3UA 4RW4B 4URGA 5I3UB 3G0ZA 3TR8A 3LP3A 3PHEA 2GBZA 4IOBA 3NGIA 3PR4A 2W8LA 2HMIA 3TARA 5KFPA 3CDEA 2P5GA 3BSAA 2RN2A 4EZ9A 1ZBUA 3SV4A 3FFIA 3CWJA 4NLRA 2ASLA 3HT3A 5F9LA 3QIOA 2IC3A 1JLBA 2JEFA 4Z4GA 2YNGA 5EUHA 2IOCA 1NJXA 4CHYA 2IMWP 1HYVA 2F96A 4H4OB 5KT4A 4I2QB 3NMAA 2B6AA 3LDSA 1DLOA 1TKZA 2RPIA 3O3HA 1JX4A 3ITHA 1VSFA 4TN2A 3D45A 1EXQA 1S48A 1N6QA 1B9FA 4F4ZA 5KFJA 4ECQA 3KJVB 2DFFA 3IG1B 1RT1A 2RF2B 5KFRA 5KFCA 2B4JA 4NCBA 3S3MA 1QSLA 2O4GA 3SV3A 3UIQA 3LALA 5C24B
chains in the Genus database with same CATH superfamily
1CZBA 3MN5A 3GSDA 2FLNA 2F9JA 5A0YA 1AUSL 4M45A 2D69A 1KOOA 4WYWA 2KG1A 4Z4CA 4DV7K 3WNHA 3SMPA 4DV2J 1NGCA 1RHQB 3OTOF 4TYAA 4WQ4A 4KB0A 4FK2A 3PY8A 3SQ0A 3L09A 1IKWA 2EK1A 2D3OR 1SH3A 2BQRA 1NBEB 5A8WB 1FXLA 4DHVA 1UAXA 2Q3PA 3T19A 2RDIA 1S97A 2X6SA 2YWFA 2MZSA 3UR3C 3CCQN 4JP8A 4LF9F 3RBEA 3PJWA 1N5YA 4FKXA 3ENVA 1BHNA 1KHWA 1OPZA 6AT1B 4XH5A 4NYPA 5EVZA 1MWQA 2HK2A 4LFCK 4OV1A 4M5DB 4K4YA 3R6GB 4JYAF 2O8CA 3W5YA 3ZX0A 4TLRA 4I68A 3EICA 1ZBHA 4IDKB 3QSIA 4YOUA 4CEAA 1IBMJ 4O3OA 2GA7A 2CPEA 1XNRF 5AQUA 3CF5L 3QWPA 3HPGA 3KLVA 2UXDJ 5GMEA 4DL0C 2B7CB 1TZ0A 1NKEA 2BZ2A 4CHNA 1ZM4A 2GGPB 3NKYA 3VETA 2YY3A 2HQDA 4TY8A 2EWSA 3MEEB 2HQCA 3UVJB 4JHDB 1DHMA 2WSCC 1TFWA 3BEGB 3W3DA 1QVGR 4KHMA 4KHRA 1QSSA 4CD1A 3H5XA 3D0HE 1E6YB 3MECA 1NUEA 3O4WA 4NCAA 3R6LB 1GMUA 3CQXA 1N52B 2DK2A 3SFGA 4EUVA 3HPOA 4JI1F 2DFHA 3AODA 3G25A 2BJEA 3UDEA 2OFHX 3NH1A 1TMJA 1RDDA 1RKIA 4WQ5A 4CJKA 5IT9O 2KJWA 3S01A 4C23A 4IH7A 7FDRA 3TYTA 4EU0A 1OJ4A 1Y64A 1UW9A 1QLNA 1U2RA 5D77A 2FSNA 3M6VA 3Q89A 5DM6Q 1HQEA 3RB0A 4JI5J 1JWWA 5GIPA 3UE2A 2YNHA 4M8LA 1IKYB 1T3NA 3NGKA 2OIHA 1I94J 1RA6A 2WBMA 4YY3J 2ZD1A 1VQOS 2FLPA 3BGOP 5KFQA 2WVEA 4CLFA 1Q81O 1RT2A 3T5JA 1WJ9A 5GADU 4M3XA 1RAHB 1Q86O 2E1YA 1OSCA 4JN4A 2BQ3A 3UWTA 3PW4A 1RT4B 2NRVA 5HOOA 5IT0A 3DXKB 4LF5F 3IKMA 5AQTA 4JS5A 3RMBA 1MWYA 1TFYA 5FIIA 1CBKA 4FYWB 1S57A 1SKWA 4ANDA 2J76E 4I6WA 4LH4A 5BR8J 4B9LA 3MDQA 2E2OA 2O8DB 3MPVA 2E7VA 4CZCA 4IO8A 3CD7A 1C0UB 2FB0A 5HANA 3VERA 1VQKS 2YNFA 1YTAA 4JV5J 3HX9A 3VF4A 3UKUB 4JKHA 3QEXA 4ZOSA 4B8CA 4MYUA 5DG9A 2PMWA 1S5JA 2IVPA 4QWDA 1FRXA 3QNNA 1H0HB 1F5CA 4ID5A 5D3GB 1V9OA 5E7OB 4M63C 4F26A 3F9KA 3OYBA 1VQNN 4IQXA 1DTQA 1GQEA 3O08A 4A8OA 3HFVA 4J7CA 4ZPWR 3NMUA 4ZJQA 1Z2LA 5AXKA 4C4WA 3CETA 1KEKA 1GLCG 2DFEA 3VAKA 4ZHRB 3QESA 4ZVRB 4DV7F 2FVSA 4K4UA 1VQ4S 1JXBA 3C14B 4NCGB 3C6UA 4JKBA 2CH5A 3EZUA 4X2BA 4FJGA 1X3MA 5HP1B 1SJFA 4CJ5A 3SCJE 1OMSA 1FXDA 1K73O 2QEXS 3H2VE 3H1VX 1RGVA 3JSRA 1C4AA 4ZA1A 2OPRA 4ED8A 4IRDA 4IR1A 4LFCF 5IZHA 5KQDA 1FDDA 4P9SA 4ZP8A 3G71N 2ZH8A 4PWUA 3CMAS 3T3FA 2Q79A 2XY6A 4A59A 4YR2A 1FESA 3PW5A 1EQYA 3FEXB 1KVCA 3ZSQA 2Q66A 1NGFA 1K9MO 1T44A 2BRLA 2ZWOA 2M88A 1Y3JA 3VQSA 2V63A 4YFUA 2HGNA 1KXPA 4RO0A 3H5SA 3AVLA 3O9QA 1JLFA 3CJ9A 4IFVA 3KKRA 1DTTA 2ZHBA 3BB5A 2V7ZA 2G8IA 2D1KA 4DFKA 1U49A 1BE4A 3J7Z5 3IMQJ 4ZJOA 5EWFA 3BP8A 2E8AA 1Q79A 4BDPA 2NRZA 5B0GA 1MROB 2DPIA 5SZTA 2XMUA 2E5HA 4OYWA 1J6ZA 5AQGA 3ET6B 3THTA 3GSIA 4EBCA 2Y1JA 1CXUA 3MPWA 4BRQA 4KGXB 1Y00A 3MM6B 3HHKA 2IM3A 4MDAA 1JLCB 3MX2A 2QM1A 2IRUA 3LZJA 3QNOA 5BREA 4E89A 2FC0A 4ISEA 4H0VB 1SV5B 4IH6A 3SFUA 4RW7A 1OY6A 3UQSA 4FKYA 1BQXA 4HR2A 1IM6A 2QA4G 4M3UA 4RUCA 4P2MA 2FHKA 2Y8WA 3N9UC 5K8NA 5GAGU 4X64J 2HQ3A 1S6OA 2OPQA 3DRSA 3WXLA 2ZKTA 1BA1A 1C1CA 3UCGA 3G8TA 4Y65A 3NE6A 4DX7A 3NEKA 4PKIA 3HVAA 5B0AA 3B8AX 3R1XA 3M8ZA 4Q5VA 4FXDA 3BF3A 1UJ4A 2I7PA 4BS2A 4EO6A 5IV3A 4X4VA 3CVKA 1R3NA 4ZK7M 3CXCR 3VA0A 1Z6RA 3C19A 3M8YA 2UVVA 2C3MA 1SKRA 1NHUA 1VI7A 4LF8J 1VSIA 3NF9A 3NFAA 3IUCA 4NEYA 5L1LA 1U48A 3CCVN 3C2PA 1ZS6A 3CPEA 4PHTX 4KJIA 4JAXA 4LSLA 2BACA 3IWLA 2GIQA 4FWKA 4E98A 4ECYA 2CJBA 2FBYA 3DCAA 4B3MF 4X4OA 1NSAA 2MKHA 4ICLB 3CCES 4FL9A 2IMOA 2A2CA 2FYXA 4JI2J 3THVA 4OYAA 3AOAA 3P4UB 3AO1A 1AW0A 1ASUA 3MDFA 2HHPA 3JQJA 2A41A 2HF4A 3B8HA 3DXMB 2EXUA 3WT0A 4L74A 4CLTA 1EB0A 1U04A 1X9JA 4DV1K 4CZEA 3M1VB 1U0HA 1NGBA 5AE3A 2BV3A 2ZE2A 4IXCA 1FHTA 3PSFA 3EE3A 4OZJA 1T9VA 3CSKA 1N36K 2YX4A 1LWCB 1DKGD 1QHAA 4LVOP 4GW6A 1B7FA 3N4WA 2C2KB 4FWLA 3T5HA 1RYRA 4JI4J 3L9ZA 3VF0B 1TR0A 2YVSA 3BKFA 1WF1A 1EETB 1Q82T 1RHUB 3UE5A 1TL1B 1SBRA 3OYMA 1QE1A 4C3KA 4CTAB 2IGIA 4CFDA 4L8RB 4DTUA 1RCHA 1JQGA 3H3OB 3ZT0A 5C7PA 1WC1A 1ATRA 2O4IA 2PYJA 1T9XA 3L3UA 4LBIA 4ZVGA 3J81Y 1BGXT 4RU2A 1NGIA 3PO4A 3DDKA 1FXRA 2FQQB 2K7JA 3KLFB 1PAEX 1CJTA 2RH3A 4PYAA 1TV6B 2RRBA 4XDDA 2VG6B 3CNQP 4N47A 3S41A 5FLXO 1ASWA 4KR0B 4OJHA 1IXKA 4DOZA 3MR5A 3NF8A 3ZETB 2XCAA 3A3PB 2N7YA 3MUVP 1GNKA 2NQPA 5HMWA 2IM0A 5KFSA 4NXNJ 1PKUA 4USJC 4RW6B 2YQ3A 3BV8A 3KTQA 3MM5A 1TL7B 3U1MA 2HHHF 4PWWA 1UEKA 2YHYA 4KHPK 1KCFA 3HOTA 1FDNA 1CEZA 4F4AA 3VESA 3BF1A 2F7TA 2AW0A 2CNKB 1VSKA 2XSJA 1GK8A 1JJ2M 4FVMA 1T3OA 3I0RB 2G2OA 3QRRA 1IH7A 2O8EB 3GONA 4EEYA 4CHQA 2CUYA 4MDBA 2E20A 3HSGA 4HKQA 2IA0A 3M6XA 5B0EA 2LQ8A 4CJ7A 4A8QA 3MM9B 2B7BB 1KTQA 1SJ3P 4KHNA 5B0CA 2QJ3A 2P8IA 2E5LJ 1RDBA 3GFHA 3NOCA 3OFGA 3OHAA 3MMJA 5AQKA 2ZVSA 1RYSA 4GV3A 3VQ7A 2E6MA 4QOZB 4OQJA 5CYJA 3MM7B 5KFUA 2L41A 5F9NA 3TSQA 4AQYK 3IXQA 4Y00A 2BE2A 3GYGA 5B09A 2QSFA 1QTNB 4P74A 2CQGA 1SQEA 3CW2C 1FRLA 1CQMA 4LF1A 1S10A 1WEYA 3QWUA 2PMZD 3PNIA 1YITN 1LNQA 3HLUA 1JKHB 1Y9OA 4K4WA 2VICA 1PO6A 2E9RX 3L2QA 4KH5A 2L48A 7AT1B 1ATNA 1YJRA 2A6MA 2E1MC 4NYFA 5C2DA 4LQ3A 5B0FA 3GE9A 1FRJA 1C0FA 4ANEA 1ICEB 3CT9A 3IBWA 2FBXA 1NMNA 3Q8UA 3PIPQ 2G8FA 3WXMB 3U02A 2GMJA 2XHBA 4DG1A 1VK0A 3VA3A 3DRRA 4CGIA 1TKZB 3SPZA 3O3LA 1RHJB 3SDEB 3M8QB 3UN3A 3IR5B 4WK3A 5ETSA 4FYVB 1OWXA 2ZH9A 2ZBPA 4QR2A 1X4GA 2KKHA 2L3MA 3DDIA 2HYIB 4DV1F 2F9WA 5GAHP 4DKWA 2X3DA 4ZCMA 4JI7F 3SSSA 4FYXB 3GLJA 3L3CA 1N36F 2VIHA 1SB6A 1KHVA 3DN9A 2AGOA 2FGCA 1U47A 4DR4J 1BI4A 2LSNA 4BGBA 4A2AA 1U0SA 1KWMA 4AUKA 3D6RA 2ZF5O 2R7OA 4DV3J 3M8SA 1FWKA 3OW2R 1S7IA 3WBZA 3G8QA 4DSIA 1KOHA 3KVGA 3VEVA 3GG1A 1NG9A 3JYTA 1D8YA 2QN6B 3GPAA 2J6SA 3J7AN 1VQLN 1N34J 2RS8A 3CCJS 3FR0A 4L76A 2ACYA 4DCJB 1QQCA 4MT1A 4YOYA 3HFKA 3DOKB 4H4OA 2A1BA 1ZM2A 2GQQA 4FLUA 2ZC4A 3Q8SB 1JJ4A 1MWZA 3V6HA 4CFAA 3E2EA 5K9FA 2DT9A 4PKDB 1X4DA 4I6AA 2YKQA 1O13A 2AYMA 2G1HA 3BBFA 3M9MB 3IG1A 2A3ZA 3HL8A 4ED2A 4IKFA 4YNQA 3HBTA 2VH7A 1UA1A 4KHPF 1J54A 1VQ9N 1Q8BA 1ZAXA 4FLYA 1R8CA 4KTZA 3FSYA 1LWEB 4LREA 1OQ6A 3W3SA 3DMJA 2OANA 5LMNJ 1S7HA 4ATNA 4DSEA 3P5TL 2HS4A 4EP5A 4CEZA 2JWKA 1APSA 3BYPA 5HMXA 4PA1A 3TOQA 3LO3A 1B0PA 3BF4A 3BS9A 1MLAA 5A8WA 3B4DA 4BREA 4QW8A 1HNZK 3IMXA 5JLFA 1Q16B 4CJFA 1T7PA 1CSJA 2MLYA 3C46A 4HT7A 2YWGA 2V67A 1YHQN 4J2DA 4N41A 2IDOA 4AL5A 1F0XA 1JLQB 1FNMA 2CPIA 1GLJO 2DXDA 1C0TA 3DGPB 1HBMB 4B02A 5J1NA 2RDJA 4AQYF 3C94A 1RT5A 5LMUK 2P9EA 4IDKA 5MLCQ 1M90T 1HYSB 2KG0A 4WPAA 2NLXA 2PYLA 4KRFA 1WSVA 1OYEA 2H54B 4FJ7A 3H46O 3QEWA 4NLYA 4RTFD 1HI0P 1WNEA 2W2MP 2O1PA 3A3NB 3PSIA 3VGSA 3BSNA 4JI0J 2GGPA 4BG8A 2MZ1A 3U9DA 3KJQB 2HZAA 4DFPA 2CJAA 2MMYA 5GMKa 4B3SK 1WC5A 1E4FT 1U25A 3LDQA 3DAWA 3MEEA 5AQRA 4JHDA 5DO2A 4Y2CA 2VOOA 1RT3B 4C0OC 3R9PA 2EFVA 2BM1A 2ZH2A 1T3VA 4CJWA 2VZ9A 4EIAA 3D6MB 4BRGA 1NU4A 1W9HA 2QWRA 1GAOA 9RUBA 3VF6A 4WFAQ 1Q0NA 2WOMB 1E6YA 4NYOA 2MHEA 4F67A 3J81j 2PC6A 5E2QA 2WSFC 5KFXA 3O80A 1SZ2A 3JAMO 2FUG9 4W5RA 2DRBA 3D7EO 1VSDA 1B7YB 2HWTA 2DTJA 1VK3A 2Q3SA 1BD6A 4CW7B 2GNKA 4CEEA 4DMNA 3CCRN 2CJXB 4LSZB 1V5VA 1IBLJ 4NMLA 2UV8G 1X8DA 3M9NB 1VK8A 3PUFA 2QKKA 2KKZA 3MK6A 4CIGA 1FVSA 3GMGA 4BC9A 3IWNC 3ZT2A 2VD3A 1IKYA 1N0UA 1MMDA 3AGKA 1RU2A 3DI6B 5K8PA 5DDRC 3NS5A 1AFJA 5L46A 3IR7B 3S8SA 4XTTA 4K2XA 2YX1A 3BGLA 1M5VC 4ID1A 1TAUA 4YDUA 3VGUA 3CJ8A 2BDPA 5IQQA 1RT4A 1OO0B 2EC2A 3DXKA 3EPIA 3F73A 1YIJN 1L3TA 2E5GA 4U96A 3CG7A 4Q2MA 1RB0A 2VJVA 4ZP6A 2HFZA 2PT0A 3PFOA 1DQ8A 1V4SA 4DSFA 2QMXA 4O44B 2BE9B 3TWZA 3M3ZA 1CQNA 5E33A 5C25B 5AFUA 3W0LA 5F8JA 2PSZA 4NLOA 2ZNYA 4QPTA 4ZPTR 4CZJA 4FJJA 4X4TA 3KUGA 1K6YA 5KG6A 3VGMA 2EFNA 1C1BB 3UKUA 3QB0A 4BRFA 3NF7A 4DV0J 3CMQA 2FIUA 4ZS6A 4OVLA 2XG8A 3CJ1A 1SQFA 1ZTWA 3CGIA 4F0KA 1BUPA 2HAFA 1VBZA 5JICA 3CC4S 1LW2B 2W42A 2VQFK 4HUGA 2P5OA 4OL8A 3R5AA 4UOHA 3I5AA 4ED5A 3PZPA 4B3RK 2KQ2A 3HM8A 1TKXB 3BGRA 3UD4P 4OKKA 1PJ5A 3I5BA 3F2KA 4FF2A 2H3EB 4O55A 1YJNN 4ZHRA 4IUFA 2CJ9A 3IS9B 2W8KA 3R9LA 3MXHP 3J8AA 1I39A 4J9OA 3KMSA 4NCGA 2BBEA 2EBGA 1CULB 3M9OB 4HEA9 3GIJA 3TSUA 2HIYA 5HP1A 5AE2A 2HVZA 3NOGA 4JKCA 1JLGB 2IBOA 2XS2A 2QLWA 3TEHB 2GQ2A 3EZ5A 1UWBB 4FLVA 2AX1A 3ZZPA 1RBLA 4RR5A 3ISNC 1QUPA 1RXOB 2QMWA 1ZPVA 3O9RA 1PAUB 1QUVA 2F65A 4KHUA 1VQ6N 4ENOA 5MAOA 3MCPA 2R7SA 1IWGA 2VOPA 2GQCA 2GJ2A 1WC6A 1UJ5A 4G6VB 2VF3A 4FPAA 5A2QY 2ZM6K 2HRUA 1S5ZA 4G3IA 1VQPN 4HI2A 3NXZA 2AQ4A 3H90A 4KH0B 3L8BA 4LF7K 4OFZA 4X66K 4DTRA 1AZSB 1S3XA 2V51B 1RDUA 4DR6K 2QIFA 4CZFA 2QC3A 3KLGB 1VQ5S 2ZJPL 2XEXA 3LDOA 3ZZYA 1MROA 2KHDA 4B3SF 1AROP 3ET6A 1N56A 4A57A 4BRPA 4ZLPA 1H2UX 1HL6A 5D6GA 4DR2K 3BDPA 3BR8A 4B3TJ 2Q97A 6FDRA 4DX8H 3D6TB 5BN9A 4NRTA 1CC8A 3K5OA 3SUNA 1SV5A 1WOSA 3S7RA 1X9WA 1KVIA 1UFWA 2LEPA 2D0OA 4JOUA 5B7WA 3A5MC 2QWQA 3RZAA 4MFBB 3SQGB 2BR0A 1EP4B 4IBNA 2XZWA 2QT7A 1M1GA 5M2UA 1U2FA 3KHRA 1VIOA 1RWXB 3QJJA 5KT5A 2Z0GA 1IBKF 3NGRA 1N6QB 3PO5A 4OPJA 4WTOB 4CESA 4ED1A 3J7A1 2CXEA 5GADI 3LP2B 2R7YA 3O5TB 2ASDA 3GFXA 1IO2A 2VBXA 2XLKA 2Z8QA 5KT6A 2ZZMA 4WZMA 1XQIA 4FPRA 2E9TA 4CGDA 5DDQC 3OTCA 3E1YA 4LF4F 2DBBA 5AQIA 2I7NA 3IBFB 4HUEA 2VV5A 3TR5A 1X1PA 1K44A 2E5JA 3CCSN 2HPUA 1YBUA 4YR0A 3QFHA 4TKTA 1UOCA 4NLVA 3HFZB 1FDBA 4BROA 5DGBA 3CIPA 5U47A 3MZIA 2RS2A 5CYQB 3I55S 3MOZA 2F9DA 4E1JA 3CJ3A 3KNGA 4CF8A 5HN0A 4ICLA 2E1ZA 3SMZA 3KD5E 1VRUA 3W2WB 4FWNA 3MFIA 3HI0A 2X78A 3DXMA 1A0OB 4FVCA 2RNEA 1HD0A 4J9QA 3M2RB 3VAIA 4CBXA 5K8OA 2EI5A 1HWUA 3M1VA 2KI2A 2FPHX 1V6HA 3MEDB 5E5NA 4DR5J 3WIVA 3V4IB 3PEJA 4ELUA 2HBKA 4W5TA 4B3RF 5ADXH 1BO5O 1XMQK 2KLAA 2P5VA 1BWVA 1LWCA 1YWXA 2CPZA 2G1DA 4FZVA 3W60A 1IR1A 5KFTA 4JI3F 3C3LA 4DTXA 4K42A 4QCLA 3TTFA 1WTBA 3SI8A 3TNVA 2P9KB 2FHOB 4DQIA 4CTAA 2BW7A 2Q1LA 2HWHA 4OI6A 2FD2A 4O4GB 1WG4A 4G65A 1R0AB 1ZYQA 4PZVA 4E7HA 3EGWB 2R8IA 2J4RA 2W9BA 4MH8A 4IFYB 1FFWB 3OYDA 3D0PA 5L9XA 2CWKA 5KFYA 2L08A 2GEMA 3QEIA 2B9WA 4RNFA 2JVRA 2I8EA 2KZMA 1RGIA 3QLHB 4URQU 4JS4A 3GCXP 2A3JA 1JLEA 4PQUA 3T1YJ 2VG6A 4XH1A 3O44A 2EKNA 5EHHA 1SL0A 1N48A 1HJOA 2K7KA 4HH0A 2ZM6F 1HNIA 1OPIA 1D8ZA 4LFBJ 2C3OA 2LQJA 4RW6A 4CO0A 4CRJA 3OUYB 2XB2D 4B1WB 4OZ2A 1RACB 2PAVA 1SH2A 4KPCA 4LF7F 2A0FB 2FVQA 1NDKA 2AZ1A 4HTIA 2UU9J 5AQLA 1XMOK 3K59A 4P10A 3E8OA 2RQKA 2ZBIA 2IYGA 2H4YB 5BN8A 3J80Y 3OYKA 4NPOA 1YBTA 4OX9F 1FJGK 3AVCA 4XEIA 1T05B 5KFWA 1P9YA 4E0DA 4DTPA 2DY9A 1JMTA 3I0RA 3DLBA 3BZKA 2O8EA 1RDRA 3K8WA 1Q8LA 3OL6A 3LL3A 4DR2F 2DR9A 2OPPB 4FBTA 4ZVPB 3PVXA 4NLCA 4ZVHA 1BQMB 1MDUB 3O3GA 1M5SA 3JS6A 3B54A 3RB3A 3CCWA 3UN2A 4K8RA 4N8NA 5L8RC 5GAGI 4TU9A 1QQOA 3WNFA 4AD6A 3D68A 5TKYA 5F8MA 2V4JB 2Z58B 5C2GA 5AJ3K 2NREA 1CC7A 2R7UA 3MM7A 4JD2B 4O3SA 4Z0UA 5KFGA 3QRQA 3ZT1A 4HLBA 2X51A 5EXWA 4OX8A 3G4SS 2HBJA 1JKHA 2E88A 1LOUA 4KBIA 1Q9YA 2G9OA 2XHCA 2LU2A 3AQOA 1SC3B 2M5YA 4M63A 5CH7B 2WFBA 4ZLJA 2ZHOA 1NDLA 1NDPA 1JJCB 1GMVA 3RBZA 4CZIA 4IOBA 3G6EN 2F5GA 2QMUB 1K0TA 3MHYA 3CDEA 2O8FB 2RN2A 1HUXA 3R27A 2ASLA 1DQAA 1VBXA 3QIOA 3SMSA 2NYHA 2H9ZA 2HLUA 2YPZA 2F4VK 4CHYA 1TTHB 2F96A 5BYQA 4I2QB 3CI5A 4W90B 2LQ5A 2K3IA 1TKZA 4OLPA 3G96A 2PI5A 2DGVA 2V8DA 4TN2A 4UQTA 2A18A 2AEFA 4F4ZA 5KFJA 3UFCX 5A8RB 1P8ZA 2DFFA 2PGCA 1R6YA 2WW4A 3DRXA 4F3MA 2VYPA 4CLSA 3K9KA 1VJWA 8AT1B 2GWKA 5LT5A 1QSLA 1X5TA 1O0PA 2O4GA 3UIQA 1YAGA 1T9YA 5C24B 2YWWA 3Q8YA 2A6OA 3CIZA 2J6UA 3ULHA 1T6DA 2AU0A 2B43A 3ZTRA 3NVMA 2XMVA 1CZAN 3R2CJ 3QSYB 4QZVB 5L38A 2FC8A 2DGUA 1Y4ZB 5JLHA 3L95X 3TUPA 2LKZA 2M2BA 2VPYB 4B9UA 3L7OA 3MAQA 2DEJA 1NK8A 1U1MA 1T9UA 2J8SA 4U8YA 5JMVA 4IJAA 4ZVTB 1O6XA 3IM9A 2BMBA 1F9EB 4CI0B 2MQMA 3GYXB 5F8GA 1MU2B 1WSJA 1ELOA 3HVWA 3H98A 4A5BA 2YNIB 3DOKA 1VQ7S 1YX2A 1HR0K 5BRDA 1U8WA 4FM0A 1IKVA 4K25A 4X4SA 1Y0HA 4DSKA 4HHJA 1HKBA 1C1AA 1SQGA 2D7SA 4DR7J 2YHWA 2ROPA 5J2NB 2YX6A 3CIMA 1J5OA 3H40A 1YRTA 4D3HA 3IN5A 1SIZA 4DCOB 4P75A 3MMAA 2XMWA 4MO4A 2B56A 4NZ0A 2V8PA 1A9NB 1RI7A 4WFBL 4A5AA 5HQMA 1M1KO 4M5MA 1Q81T 1OYDA 4X65J 2HVHA 2RRAA 2MKYA 5E3PA 5CHCB 3L4QA 1XMOF 1LWEA 4DWIA 2JC1A 4J9KA 2X6NA 3NL0A 1BWEA 1T8EA 3D2FB 1MN9A 1FJGF 1MWMA 1ZBLA 5HLFA 3FMBA 3OVBA 1N32J 4OX7A 5KFDA 2XLJA 4MK8A 4WFBQ 5LL6Z 3N4PA 2F3JA 2XGPA 2RD5C 3AHPA 2NXEA 3M7VA 1ZAWA 4YDDB 3WNGA 1X4BA 2FVCA 4AT1B 2AIRB 2VGMA 3AAWB 3VGLA 2C28A 2ZGZA 5KOWA 1U1OA 3FE1A 4CI6A 1QVFR 2J0XA 4MK7A 4FWQA 1SQKA 4DV4J 3QBCA 1S22A 5AJ3F 2A42A 2KDOA 3WIUA 3DGPA 1HBMA 1TUUA 3MMBA 2Z57B 1JB0C 4RU9A 3AO2A 1KD1T 4PCQA 1F6TA 3TZWA 1WC3A 2KYXA 3TVYA 3CPWM 1Q8IA 2D74B 1VQMN 1RKJA 3QYYA 4WKYA 1HBNB 4GO5X 3C6TB 3OYJA 4DV2K 2V68A 3QIPB 2DY1A 3IM8A 3THXA 3BBBA 4ZLNA 1N5VA 1JJHA 2WONA 1V3RA 2B51A 4YHHK 1YJ9S 4KO0A 2UVRA 4ISGA 1FE4A 3F0NA 2JOQA 3FKBA 4U7UK 1RT3A 4JRPA 3BKUA 1RBTA 3UCUP 2KT5A 3SUOA 2RU3A 2OPSB 2CQ1A 1N33F 4NZ7A 4W98A 3UDLA 4DSLA 2WOMA 3HD1A 3EXYA 3N79A 1GXUA 2QL9B 4BR2A 3VGVA 3CQ8A 3CJ2A 5AQJA 3L0QA 4LR7A 2GAHC 2BVZA 3BH6B 1U2VB 1MW7A 4NXMK 1IBMK 1TQLA 1J27A 1TUYA 3DLGB 3TWHA 4F50A 3SCIE 3CC7N 2RT3A 3W9HA 3DYAB 4UW2A 5KFKA 3W5XA 1BLUA 3G9CA 4RW4A 3MN9A 2CQCA 4J91A 4JI1J 2FJAB 1WC4A 2QYCA 1E4GT 2XWXA 1KC8O 2CYYA 2QA4N 3ULDA 1RWMB 3FDSA 3DI6A 1N5SA 1KONA 3FZHA 4GKKK 1KP6A 3QMQA 1ZH5A 3B78A 2DGQA 4FNHA 1TL4A 4HT5A 3M2UA 2J9DA 3JTPA 2OEKA 3QDKA 5HQ8A 2QWMA 2F40A 4OJRA 1LXNA 1H98A 1F5BA 2C2OB 5L9NA 3R5GA 2UUBK 3JS9A 3AO5A 3T6JA 1ZOTA 4CLYA 5C25A 5JXSA 4N56A 2IBKA 3KJVA 4LBHA 2VWKA 3SLCA 4Z7CA 1BCOA 1X4EA 1HR0F 2N3OA 2CPJA 4B3OB 2G8KA 2AWZA 2FDNA 1HNWJ 2JHEA 2G2YA 1TU0B 1ZBFA 4PEOA 2Z2MA 1IKXB 3J7ZO 4QU7A 3GIMA 2VKRA 1PYSB 1YXQA 1I94K 4YY3K 1LW2A 2CNLB 1FKPB 2H65B 2VPZB 4DV6J 1TKXA 2ZOFA 5SUHA 3H25A 1F3FA 4BGAA 2JL9A 3A8YA 1Q53A 1MN7A 3CDUA 5LM7E 1QAIA 2HFNA 4B9NA 3IS9A 4CJEA 2F4FA 1SS6A 3WQUA 1N5TA 2PN6A 4E7IA 2V5HG 2F8SA 2W2QP 3VCDA 3O8WA 1B3TA 1FFSB 1CLFA 3I6PA 2ADBA 1CULA 1Q7YO 2F8EX 2VFUA 2FF3B 2E66A 2VQEK 4TNOA 4V19X 1LV5A 2XMJA 4DUTA 1ATSA 3FQLA 3K0SA 1JLGA 3FZKA 4DV7J 1UWBA 4PG5A 2HGMA 2IVFB 1K8KB 3OHBA 5CQGA 4RWWA 1FA0A 3N6NA 1WKLA 3VAHA 1EAYC 2CQIA 4PKGA 2MQPA 3LPEA 4HL9A 2HZCA 3SUQA 3N0VA 2LEAA 2VC0A 3KLHB 1HNVB 4GVMA 3BPDA 4I67A 1XR6A 2NUBA 5D4PA 2ZJRL 2JX2A 4LFCJ 3NGYA 1Y5NB 4DV2F 5HK4A 1HQUB 1LCUA 3CM5A 1ZTTA 1RABB 5EX0A 4C8LA 3TAGA 2MKJA 4AYBD 3ZZ0A 3A8KA 3KLGA 1OSDA 1EX4A 5G0RA 2W7AA 3DXSX 1W2BR 1U7LA 2FSJA 2VU5A 2AGPA 2O3DA 3M5RA 3NG8A 2XMMA 4BRLA 1ASVA 1BIZA 3G10A 4XK8C 3S6EA 1NJZA 3Q2SC 2F1FA 2DO4A 2WZ1A 3G71S 4IG3A 4M5GA 3T69A 4ERDA 3DM2B 3AA4A 3OYNA 1NXIA 5AQYA 3QO9B 1Q78A 5LJWA 2FZCB 4E7LA 4MFBA 2IRYA 1IBMF 3UD5A 1EP4A 2NXNA 1WSRA 1R0BG 3UKRB 3MFHA 3CFRA 3ZZUA 1RDAA 3QAUA 4YOXA 3P45B 4RBTA 4KV8B 1R8HA 4DTMA 2UXDF 1S9FA 3J80U 4HUFA 2FJBB 1SI9A 2JGUA 4FDFA 1QVGM 2L9DA 3LP2A 2DGXA 4B1YB 5AQQA 2IIHA 2M52A 2UYTA 4N5SA 1U09A 4YR3A 1GOCA 4H5VA 5AXMA 4X62K 1YUWA 1FX2A 3I9V9 1Z05A 4CYUB 1H3DA 1JCEA 2UXCJ 1TYQA 3HCXA 4K4XA 3L3VA 1F3VA 3IRWP 2LFVA 4P71A 3KFWX 2VFTA 1YJUA 4QWBA 2GHWA 2L9NA 3SCLE 4K41A 1X31C 2POKA 5CYQA 4M5LA 3TTDA 3OPKA 3U4LA 5FRNA 3RMDA 4HVJA 2XQCA 4WCEL 3H3NO 4F4XA 3LPUA 5THWA 2OMLA 1TKTB 2GV1A 2HFSA 2DGOA 3KG0A 2W2OP 2CJKA 2EFPA 3AH6A 5DLGA 1I94F 4YY3F 4BC4A 3M2RA 4HCBA 4X4QA 3MCOA 3AVMA 5DDPC 3MEDA 2Z2YB 3V4IA 1X5SA 3I96A 1VQKN 3T6BA 5DK5A 4F9OA 3CDBA 4FOEA 5B08A 4OLAA 1NSKL 3R2DJ 2N3LA 4KKOB 4PL8A 3RVCA 3CCVS 1KQKA 5BR8F 1LK5A 5E3QA 3KG4A 5CZVA 2KW4A 1JL2A 2P9KA 2C1EB 2DPNA 3QZ8A 3EGZA 3KLIA 2VQEF 4KHWA 1FCAA 2YQ1A 4WZQA 4J8FA 1JLAB 1DBDA 1E6VA 4IQMA 4EO8A 4CJ3A 2GTDA 4O4GA 2ADCA 5M1QA 5C12A 3RG6A 2KU7A 4RNHA 4DF8A 3BUZB 4CFBA 1YRUA 4J37A 1FKOB 2V0NA 2JEGA 4IFYA 4CF9A 4JV5F 1VQ4N 2UZAA 1SJQA 2YKPA 5D4NA 1NWKA 2VC1A 4ILLA 4GMJB 2G13A 3QLHA 4CO1A 4B9VA 4K5RA 1B0TA 4DL2A 3OR2B 3RW7A 4K2JA 3BO4A 3HVTB 4BR0A 4BRCA 5D0GA 4B1XB 1Z25A 2PFDA 3WXIA 3W64A 1PC4A 3GOIA 2LXUA 3BREA 1URNA 2V2QA 1ACMB 4DFMA 3T9ZA 3OY9A 3FSXA 2D41A 3N01A 1NCLA 3CMAN 3KNAA 4LY7A 3RW6A 2WAQD 4KGZB 2DHXA 2D1CA 4DUZK 3RUBL 3OYFA 2HMIB 3FCVA 1GOBA 1T05A 4PUOA 2BYCA 3BPSP 4USMA 4L3KA 1Q5YA 3OL8A 5KGXA 1JLBB 1HBOB 4F3OA 3RB4A 1Y7PA 4NWBA 2MY7A 3KLEA 4FJ5A 4H8KA 4C6AA 2COLA 4BG9A 1BQMA 3AA5X 3L7PA 3EJMA 1FT8A 4DUYK 4CLWA 1GT8A 1HWIA 4Z4FA 4RUHA 4U7UD 3Q8QB 3L4BC 3RRGA 3EKSA 4DS4A 4I2PA 2V4JA 2ZOMA 3C6HA 3GBTA 4OIXA 2IYIA 4JD2A 2QO3A 4KTQA 1XK8A 5LJVA 2W9AA 4E2FB 1H7XA 4ZPDA 4F2SA 3CDWA 3MMVA 2JEJA 4CZGA 4ZPCA 3TUZC 2OTLN 4UUWA 1YJ7A 2MQLA 3JSYA 2HNYA 1G7CB 2B0GA 4ZVFA 1BMQB 1W2IA 3V4MA 2J6TA 3TAMB 2ZZNA 4LBPA 3D67A 4RX6A 3T41A 3V6JA 4YORA 1JXEA 2KN4A 4OPHA 3HRGA 4KI4A 2QK9A 3UW1A 2O66A 1GH8A 2GV9A 3TX0A 4UF4A 1YZ6A 3D0IE 3M8WA 1HMVB 2ZGYA 4ZCIA 4JK7A 4JI6J 2W25A 2C22A 3P5JA 4D3GA 2E5LK 1PG5B 1VGYA 4DB3A 2BANB 3ULEB 2DISA 4K4ZA 2YJFA 3DC2A 3LM9A 4GY2B 3EL2A 4B17A 4CJSA 2K8GA 4X64F 1WHYA 5I4MA 1SCJB 5T41A 1TL3B 3GV7B 3OSNA 1E3MA 3CXCM 2HBMA 4J90A 1URRA 4IJNA 2RUGA 4LUBA 2DNQA 4K4VA 1VC6A 2QTDA 3KG1A 3BSCA 1YITS 7FD1A 4CP5A 3I5CA 3VV2B 1NK7A 4H0XB 5B0DA 3PHTA 4GC6A 3V1OA 3OTOK 4O4RA 2C2DA 3FBFA 2Z1IA 5ETPA 4QYZK 3H4BA 2ZUGA 3NH2A 4ES3A 3ILIA 4CJLA 1YVNA 5C0YA 4DV1J 3VZIA 4HACB 1D0EA 2QW9A 2VHGA 3BDEA 1OVQA 5KG3A 1NZAA 3OBYA 4QYRA 2W4CA 3QGGA 4FXVA 2WB1D 5GAEP 1N36J 5HROB 1BUXA 1FEEA 1A6LA 2MYFA 4QPXA 4JI2F 5IC4B 2K06A 5K14A 2VA3A 1HWLA 2XY8A 2P9LB 4CEBA 2YV0X 3VMFB 4C98A 2VA2A 1L5UA 2DH7A 2CJYB 3GJSB 5DRKA 1MU2A 2DVIA 5E3RA 1S6PB 2YNIA 4NYZA 4K7QA 1G15A 4JKDA 1NSQA 1EX8A 1XNRK 4OI2A 4CHOA 1KFDA 2ZBQA 4ZDNA 3ZO7A 4AXIA 2OD4A 1DT9A 4Z94A 1JL1A 1BCMA 3HHLB 2ZH7A 1N8RT 4DLGA 1K47A 9ATCB 2QV6A 3VQQA 5GAHU 3GQCA 3CDAA 1VCTA 3D5MA 2AEJA 2J9DE 5CD4A 2RQ4A 1VDHA 3C15A 3BH7B 4BR9A 5KQ8A 1RT7B 3F5TA 1UP1A 2MZTA 4DUZF 1KQSR 1U1PA 1VSEA 4U8VA 5FDLB 3QBXA 3X3UA 1UA0A 1VYAA 2D9OA 2GVDB 3R8EA 3OTBA 2AP1A 1VQLS 3UR0A 4DL5A 2OH2A 2DO0A 2DNYA 2CQ4A 4CT9A 1Y11A 3IR6B 3LP1A 1X0PA 1VHFA 2KM8C 4OHVA 3POTB 4BBYA 4BVOA 2J5AA 4DTSA 2XRIA 1HI8A 2IJFA 1YBAA 4ZVUB 4CEOA 4F04B 2ZDPA 1AT1B 2U1AA 1IR0A 1WSIA 1Z26A 5ADZA 2NZCA 4DUYF 5KG0A 2FY8A 1TGOA 3A8JA 3LM2A 4DL7A 2W9CB 3TJ8A 3PW2A 2VUGA 3FJ2A 3CEDA 2A40A 4NZ6A 2HWIA 3SJJA 1GLFO 2A1SA 2M8HA 2OHDA 3ICLA 4WE1A 4CQ1A 2GAGC 2ILYA 4N8OA 4C0HA 1B92A 3BGUA 4LF5K 3TQEA 4IRCA 2V4QA 4N76A 3NGZA 3IRXA 3L7UA 3C6TA 2GX8A 4DX6A 1GXTA 4AQYJ 3C16A 1BA0A 1MWKA 1FJEB 3HHNB 4KB1A 2YX7A 2BKNA 5FPNA 3IGNA 2BA9A 3WXJA 2CH6A 2E4LA 2BH1A 3PRVA 3R5DA 3HHLD 3Q8VA 4K59A 1XNQJ 1S9GB 2ASJA 2O01C 2E5LF 1MG7A 1YHQS 3P5BP 3ZYYX 3NRBA 2OPSA 3FEZA 5C2FA 4CIOA 4PXEA 3L2UA 3GIRA 3CFOA 4BRKA 2H48B 3OLBA 1LFPA 5I42A 3NS6A 5IFMA 5HBMB 3KDNA 5CYMB 3OLAA 4V19S 2V9KA 1CZ9A 4DCPB 2MKIA 2QLXA 3DLGA 4NOHA 2GO9A 2NLWA 2L9WA 4ECUA 3PM9A 2NR0A 2GMLA 4EFAC 3AVAA 3E01B 1QHTA 4FCYA 1B70B 4ZPVR 1KBRA 2APOA 2P9GA 3THYB 3W62A 1T0TV 4NA1A 3WC2A 1VJQA 1LW0B 2OSRA 1RISA 3BGFA 1NJYA 3PDNA 3P96A 2HNDB 4RW9B 4EAHD 3AJDA 4DBQA 1EJ7L 2VPXB 3PRBA 2W6LA 3O1WA 3QFPA 1RAIB 3AA8A 3ENOA 1FK9B 1BQNB 1V3ZA 2HNZB 1XHXA 4QIVA 3AVJA 4F4KA 4FJ8A 4P72A 2DNGA 4MAKA 4ECVA 4QQBA 1AXQA 4UUXA 1N88A 4FZXC 2KFNA 1IG9A 2VB6A 3OHRA 4HVZA 3EVMA 1ZZFA 1SC6A 1N0VC 3RMAA 4FF1A 2RU9A 1WUUA 3CCZA 3QGHA 2V8HA 3CCRS 1Z2ZA 1W25A 3BO2A 3QGIA 4B3OA 1EZZB 3ZSXA 3E9PA 3IAYA 1GTHA 1REGX 1WHWA 4QU6A 2HBLA 3G86A 2MPUA 4M7XA 1IKXA 4HYKA 3MN7A 4OI4A 1YI2N 3OW2M 1Q1KA 2YXLA 3BR9A 4LRCA 2IM2A 4H4KC 2RKIB 3K57A 3NWGA 1FKPA 1ZM9A 4DV3F 5D0HA 5KFZA 1UVKA 3CF5Q 1FD2A 1ZPWX 3F9MA 4FJXA 3MUMP 2D0CA 1PYOB 4CEFA 1YIJS 2VG7B 4KBOA 1UPPA 2HBYB 3UB5A 4WFNL 1V5IB 4IO9L 4WKRA 2YKMA 2Y8YA 3W7BA 2IFXA 3LOUA 3MWPA 2P9PB 4FZZA 3MF5A 2EFGA 3OYHA 4WWSA 5DZ7A 4Y2MA 1VR6A 4Z37A 2NZTA 1C6VA 1G1XA 2M7SA 1WI8A 1NH8A 2QA2A 2Q36A 3PG9A 4ES2A 2VG5B 2HEKA 4WFNQ 2P51A 4ECTA 2IC3B 4IO9Q 2IY5B 1U8SA 3ATVA 1SIWB 3N4QA 4R5PA 1M5PC 3OYEA 3EZOA 1F1BB 1WELA 4OZ5A 2C3PA 1HNZJ 2BX6A 4PG6A 1R8BA 2OO4A 2KZZA 1HNVA 1VAZA 1HLUA 1AB8A 1RTJA 1YDLA 3OFFA 1YJNS 2BKOA 1FE0A 3PJXA 2XY7A 1IJJA 4IOAL 2D0BA 1HQUA 2GCFA 4NYNA 2XBPA 3V9ZA 5AQFA 4AHRA 3BQ1A 3J81O 3FNNA 1J9AA 5M2PA 1BC6A 1Y5LB 1A5VA 5LMUJ 5F0WA 5BYSA 2JVOA 3QT5A 2R8GA 3H4DA 4B3MK 2MXYA 4AE5A 1VSMA 3MEGB 5LXYA 3DLEA 4FJKA 3FRYA 3THWA 1VQ6S 2LECA 3VQEA 5DZ6A 4ES1A 3VGKA 5KFVA 4JKEA 1Q9XA 2DY4A 2DKOB 5CAAA 4OYZA 3O9SA 3SAFA 1YRXA 1RWUA 3OL9A 2Q2RA 4FJMA 1V4TA 3DM2A 4W5QA 1EQ0A 3EGVA 2ASMA 1KQFB 4B3SJ 2BJ7A 3EN9A 3QO9A 4OYPA 1RUSA 1X4HA 3PYFA 3UKRA 3HZGA 5KAKA 2PBDA 1W97L 2MTLA 4LMZA 4XO0A 4DR1K 4TLQA 4QS7A 2MKSA 4KV8A 1HW8A 5EWGA 2ATLA 1KAXA 2ASYA 4B1ZA 4M3YA 2DRDA 2O8CB 1C4CA 2IM1A 4U67L 5FPEA 2XMAA 3OXGA 3MTKA 3K0JA 1YJWN 2FJXA 1S76D 4FVUA 1LWFB 2UUWA 4ZVSB 3MWTA 4YP3A 4CBUA 3D1HA 1WACA 1KTVA 2JJ4D 4CIFA 4CYUA 3NP5A 4B3TK 3PIOL 4LR9A 3G6XA 3A13A 2IIRA 5M1PA 4TY8B 2UV8A 1WHXA 2HHUA 1SAZA 2ILZA 4I1TA 3MPDA 5F1XA 2YWHA 4UZBA 2BXJA 5A6WA 4EYHB 4A4JA 1D9FA 4I6MB 5LOQA 4LRDA 5CY4A 5T7LB 1RBSA 2KM8B 3IP0A 2I5JB 5CZXA 1NJWA 3PIOQ 3PX4A 4DTOA 2HHHK 1KN6A 4IEEA 4L75A 4USIA 4IOCL 4KQZA 1TKTA 4OZLA 4DU7A 5FJ4A 3TVKA 3PYGA 1PILA 4CJRA 1D9AA 4QIWD 2NRHA 2GWJA 2RJZA 3HOSA 2AV5A 3H42A 1RLCL 4DV5K 3CD0A 1YVUA 4BC2A 1SUQA 2LP4A 2WRMA 2J8AA 2EFOA 2AJ4A 3QJPA 3D3CJ 1V3SA 3R5CA 4JV1A 3UCZP 4I56A 3IBCB 4DZ6A 3VEXA 1FVQA 4OJ1A 4AL7A 3CCSS 2I0XA 2LEBA 4JKAA 4FPIA 1R27B 4NX9A 4KKOA 3M8PB 3PRDA 4JB8B 3C0BA 2VQFJ 4RWTA 3PX6A 4BE0A 4G1QB 1VQ8N 1S49A 1H74A 3VOVA 1R43A 1YKWA 3EE8A 2AJQA 1JLAA 3DOLB 4BACA 4HTLA 1NGDA 1VC5A 4FJHA 1WBDA 2HW3A 1FKOA 4HHTA 3LH2S 2CVEA 3QPIA 2HHSA 1WKJA 1ZBIA 2XZDB 1RBAA 4DV0F 2I9SA 1Q4RA 1NU0A 1Y3KA 3MAAB 3OR2A 4X4PA 4MKVA 5BRFA 2XC9A 2V34A 3W2VB 4DR5K 2VL1A 4DQPA 3HVTA 2QX0A 3VQAA 3AB4B 1GEHA 1SC4B 2UXBK 1WDDA 3D4JA 2BE7D 2YNFB 5C15A 2PA8D 1HKCA 1WAFA 3GV5B 3UN5A 2Z2ZA 2FBTA 2R7XA 5C10A 4A8MP 3FZFA 3FQKA 2DB1A 1KVBA 3ENAA 1UAWA 1FNOA 4ETXA 4LC9B 2O8BA 4YB5A 1FNXH 4URGA 5I3UB 3LP3A 3PHEA 2GBZA 2AJFE 2KT3A 4PXCA 4NO7A 3NGIA 3PR4A 2W8LA 2ZH5A 4IYQA 2HMIA 2H3GX 5E0OA 3FFIA 3NNAA 3SBMA 5JJBA 3HT3A 1HNXJ 1X4AA 5E26A 3T7ZA 4LF7J 4X66J 1JLBA 1HBOA 2JEFA 4Z4GA 3NCPA 2IOCA 3CCLS 4PPDA 2YKOA 4DR6J 3AOCA 3VAMA 1HYVA 5KT4A 2NRTA 4QOTA 4JI7K 4OYOA 1JX4A 2EK6A 2Q6BA 2FC9A 3I56S 2HLTA 4PG7A 4ECQA 2UP1A 2BUPA 4DR1F 1RE1B 1C0GA 4NCBA 2CPDA 3MN6A 4GRSA 5F0XA 2XZTB 2RDDA 1PJ7A 4GKJK 3LP0A 3UNGC 2GHPA 3HJVA 4ZPBA 2PDAA 4YS2A 3AV9A 2LDYA 3ILJA 4KGMA 3W63A 4IFVB 3GP9A 1DTTB 1PJ6A 1UL3A 1TVRA 2G2ZA 3JSBA 4B3TF 2Q0UA 3ZSWA 2W4PA 1HPZB 2RILA 3EYZA 2C2RA 3T1HJ 2FVRA 2BJ9A 1U1LA 2R7VA 3R1HA 2NS1B 1XERA 4JI8J 5A76A 4Q45A 1HMVA 4ECZA 2VPWB 3OYCA 3ELHA 1SJRA 4ED0A 2BANA 2JNJA 2DRAA 3HSDA 1ZAVA 3ZX2A 3IA0A 5CZ1A 3AAQA 4YDXA 4RJVA 1XC3A 4OI3A 2FJWA 2ZDOA 4RW7B 3TEGA 1KR4A 1RP5A 1YF5L 1FO1A 4CZMA 5AR0A 3W1YC 2JFDA 4DV5F 3TW0A 3ENHA 3BSOA 2LLZA 4S0MA 2OPQB 1C1CB 3CE8A 3IAM9 3H5UA 2XS5A 1WSEA 2AX0A 3EUNA 4QR1A 2IJNA 3G6ES 4IO1A 4BWMA 4UOFA 1RILA 3H2UB 4HACA 5KPZA 3HF5A 4DPUA 4FLZA 4UT4A 5CABA 4I7FB 3C6AA 1ITGA 3EO3A 3EMTA 1YJVA 2CJQA 3VGTA 2J7WA 1XMQJ 4PXBA 5HROA 5HVFA 4IDHA 3NH0A 4HHHA 3NBPB 3NLCA 2WB4A 2FZGB 3VQ9A 4JLHA 3T5LA 2P9LA 3ID6A 4LFAK 3VVUA 2DPJA 5SWMA 1NK0A 4CNZA 2DCUB 2GVZB 2R9LA 1RK8A 2JWNA 1S1XB 3ZTOA 3CJ4A 4BR7A 2BRKA 2RQMA 4RBUA 4DR5F 2AGQA 3AA3A 2CGKA 2UXBF 4DEZA 4A8FA 5LSRA 1TL5A 4JEPA 1M0SA 2HIQA 4JK9A 4CO4A 1ZM3A 4Q8FA 3PXGa 1KC8T 3P83D 2QWPA 3H7HB 4NLUA 1H2VZ 3VEWA 1K0VA 4W5OA 2YI1A 3OVNA 3CM6A 2ZE2B 3NCRA 5M1KA 1U6BA 1RT7A 4ZN1A 5HI7A 2UUAK 2MZJA 2I2YA 5F8HA 3KK1B 5FDLA 4XPCA 4WXWA 4DX5A 1VSLA 2PI4A 3ZEUA 3G2XA 4YOWA 2MKKA 2CGLA 3ZZRA 2ZEJA 1PSDA 2DXEA 1VHIA 1J5EK 2XLIA 1RTHB 2AHOB 3POTA 3SQ2A 5AZJB 2VFVA 5ETVA 3KK2B 4UY8T 2G8UA 1YLXA 3VQCA 2KH9A 4DSJA 5IM0B 4P73A 3OT9A 4JKGA 4FSVA 3SQ1A 1RAAB 2ITGA 5ITHA 3J7YP 4L6V3 1MA9B 4J9MA 4CGFA 1CJTB 4P6QA 2W9CA 4EHTA 4KFBB 3W9IA 2R2TA 3K5NA 4HTJA 2LXFA 5C2CA 1HW9A 3AVNA 4ZCKA 2UU9F 4CLUA 4Y1DA 2P9UA 3WC0A 3NF6A 3HKZD 2N4CA 4GKJF 3WHIA 3I82A 2VWBA 3BZCA 5AJ3J 2B5JB 3PKYA 1N32K 3LUYA 2P9IB 2DHGA 1RNHA 3V81B 1S79A 3V1RA 5KFHA 2CNOB 2G8VA 1QDUB 1UZHA 2MLXA 3TANA 4IG0B 1GLAG 3LGMA 3WX4A 2J9CA 4B1UB 3VHQA 4DPXA 1EIYB 4Z2XA 4AHUA 2ZH6A 5FPDA 1S9GA 3US5A 1FJ7A 5B0BA 2AP6A 5A2QO 3UDVA 1C0MA 2WVDA 4GNIA 1RLDA 3HT0A 2EX3A 3T9NA 2M3DA 2YKNB 3AXMA 4BR4A 3CCMN 5JS1A 2C2ZB 5CYMA 4MO5A 3JB9k 3DU5A 3QEPA 2BEFA 4EFHA 4DL3A 2FLOA 1VQMS 2B4VA 2F4VJ 3TJ9A 3E01A 1NSPA 4P7VA 5HL7L 3QATA 1GX6A 2KRBA 2AMCB 2BE2B 3OD2A 1RAGB 5DETA 2V7YA 4CGHA 3AA2A 3EDRB 1LW0A 3O6QA 4E8UA 1DAXA 2JSXA 2CADA 4FF3A 2HBZB 5H1SQ 1G99A 1S0NA 4O8KA 4EWTA 1PC5A 4BHQA 2IDEA 5AE1A 4H0YB 4USKA 2AYEA 2MJUA 4M5DA 1NK9A 2J0WA 4Y1CA 4W92B 3CMES 4C48A 1H73A 5IXUA 4LFAF 2FHJD 2WK4A 2E9ZA 1XJWB 1DURA 3OA9A 1HD1A 3SYZA 1ZETA 2NZ4A 5D0EA 2W01A 3Q22A 1S1TB 2HK3A 3V9UA 2I1RA 3AVBA 2E5IA 1QAYA 3DRRB 3CC7S 3EM1A 4MKBA 4E19A 2D0AA 3PCOB 1NGEA 3JXOA 5GAHI 2Q6CA 4F36A 1RHKB 4M1KA 2IVYA 2E7XA 2QA4S 3I87A 4I4BA 3PYEA 4GVLA 1HR0J 2QZ8A 3PX0A 5ETTA 3UVJA 3KHYA 1FDAA 1TELA 2UUCK 2FJDB 2UUAF 5J2QB 3CJKB 5AQSA 4F3QA 5ETLA 2HHVA 4CK2A 3DDNA 5AXNA 5K8MA 4YQWA 1UETA 4NLPA 3TUJC 4QBUA 3VEYA 1BI4B 2HFVA 5KFFA 1DZ5A 4F2RA 1J5EF 2R42A 4KI6A 1BWFO 2E6LA 5A8KB 2ITMA 1FTCA 4LIRA 3O5BA 2HG4A 4ZIWA 1Q95G 4OMFG 2P9PA 3RR8A 1BDGA 3DLLL 1BIUA 3JYTB 5D4LA 3I8DA 4OKJA 5J2MB 1T9TA 4DQSA 4OO1J 2QE5A 4A8XA 1X0FA 1KFSA 1IBKK 2VG5A 2WTFA 2BKPA 4DPYA 1XBWA 2JEIA 2MDAA 5AQOA 4IZ9A 2OEMA 5J1PA 5IWAK 1NBWA 1S0MA 2VASA 2OGUA 4X65F 2V2VA 4GVEA 1EKRA 2Y3YA 2HHXA 1LEOA 4FW2A 2AEMA 5M1OA 1NO8A 4A2BA 4LF4K 5ETOA 3ZSRA 4FS2A 1ZZNA 3QEVA 4YB1P 3FFKB 4GO7X 1N32F 2P6TA 3RJMB 4OV6A 3AVKA 1YSJA 1QVFM 2O8DA 3MAHA 3DMJB 1C0UA 3DFEA 2GELA 4XAKA 2ZH4A 3OV7A 4UQGA 3MCNA 1UTAA 3MEGA 3A4TA 3LDPA 1BXNA 3VQ8A 4J9NA 4FLXA 3VTHA 3N6MA 4O23A 3CCTA 4DV4F 2LU1A 3DGVA 2QL7B 4PRFA 1WLJA 5FPMA 3WXKA 5D3GA 2QLBB 2QWNA 4YHHJ 1FW6A 1YJ9N 4WFYA 4DU4A 4O0JA 2HZVA 1TUVA 3CD6S 4FK4A 2ZJQL 3K17A 4MYTA 1NPRA 4QIGA 2BJDA 2R2RA 4JI3K 3J80O 1H2TZ 3NGTA 4X4UA 1C0TB 5CHIA 2CKWA 4C8OA 3I31A 1A5XA 1X4FA 1U6ZA 3C14A 4B9SA 4C9DA 1RT5B 5F2RA 3D2WA 5KG5A 2ZJQQ 4KAZA 4L72B 1NKBA 1LAWA 4NXMJ 4R0EA 3EWGA 4OHWA 1LWFA 2XM3A 3M4XA 3R1LA 5J1EB 3G82B 1P1LA 1RJJA 1KQGB 2HS3A 1K8AT 1GTEA 3OSPA 5HRRA 3RU0A 2FHMA 2Q31A 2BUNA 2QFIA 4DR3K 5AQNA 4F25A 2ASOA 1YK9A 2OMOA 3UNYA 4TQSA 4ZVOB 3E9LA 2NXJA 3Q7CA 1XIQA 4GKKJ 2XGQA 3TVZA 2X1GA 3UDCA 4I6MA 2JH3A 5GVQA 5T7LA 4ILRA 4IKAA 2I5JA 5DM6L 1NB7A 1OVYA 4DDFA 1YJTA 1UVLA 2J7UA 4ECSA 1P6TA 1TK0A 5DGAA 2ZC3A 2UUBJ 2D3ZA 1S9EB 4FJLA 1WB9A 2DNMA 2MKCA 4OZNA 2CG4A 3W61A 4J9LA 5D78A 5EN1A 2QLJB 4OX9K 4KGVB 2GJIA 2PE8A 4XPEA 1WNSA 1F21A 2UUCF 2LMIA 4NLXA 2HQGA 1TKDA 3MM6A 4J9UE 2UXCK 2GZOA 1WWHA 1JLCA 5IC6B 3KKSA 3B6PA 3CERA 5L39A 1SL1A 2BQUA 3HKWA 3M8PA 2ZJPQ 3P3DA 1X60A 4G1QA 2V9WA 2AA4A 2EG2A 2YNGB 4G9ZA 4N7TA 1CPZA 3NDKA 2AT1B 2NUUG 3DOLA 2HVEA 2E7WA 4FO0A 4OI1A 4ZLLA 5KFNA 3FZMA 1S59A 2B6AB 1ZBTA 3NCQA 1HNWF 1DLOB 3DHXA 4B9TA 3HO1A 3K5MA 1HHSA 2DCLA 2VCPA 4AHTA 1NHKL 3P39A 2VWJA 2RAQA 2VQEJ 4ITSA 5JUMA 5AFUH 3MAAA 3DLRA 5HRNA 2XYHB 4ISFA 1RT1B 1FF2A 5IWAF 3W2VA 1CG2A 1XTZA 4TYBA 5CA5A 3PW0A 2Z1JA 3EGNA 3HK2A 3BJYA 3FRZA 4DV6F 2X1BA 3GL1A 4NLSA 4ECWA 3KHLA 2EBEA 1UKUA 3GDQA 3WEEB 4ANCA 1NPPA 4X4RA 4HWIA 4KPYA 1KD1O 1NGGA 1HBUB 2A2DA 2C42A 3Q2TC 2XO7A 1CJUB 5I3UA 4KHSA 1I3AA 2V4RA 3UPFA 2KJVA 3BGRB 4IH5A 3X1LB 3KKFA 3MPYA 5EWEA 1S0VA 3N5FA 2VFSA 5KPTA 5ELZA 1VLOA 4OYBA 3QBWA 3CJAA 4KAIA 3ISZA 2Z4PA 3LGNA 5AXLA 2N7CA 4H0OA 2G8HA 5H9FJ 3K58A 2YPYA 2B9YA 2JZ5A 8ATCB 3HXMA 4K4TA 1U24A 4USWA 3UO0A 2Q43A 1OS5A 4X4NA 4AM6A 3ZNUA 5B8HA 3ZZTA 4CLPA 2ZQBA 1ITPA 4NI2B 2G4BA 4O5FA 3QT7A 3H8YA 1XR7A 3VEOA 1W2BM 1U6FA 3KD1E 3V9WA 3RB6A 1HJRA 1EETA 2RHQB 1TL1A 1R89A 4UY85 3D6FB 2ROGA 1HWKA 5ETQA 3TAFA 1SL2A 2K3KA 1T03B 1XMBA 2HBQB 2ROEA 4YMEA 2C3YA 4H4KA 2CZ4A 3KLFA 4DR3F 5JVGL 5H9EK 3L2RA 1HPZA 4NLBA 5D4OA 3A5OC 3ASMA 1TV6A 1LFWA 3LANA 4OPKA 1QAJA 3KHGA 1H1VA 3ZETA 4X62J 3QT6A 3TX8A 4UOCA 4F02A 3SQ4A 1UVIA 2DR5A 3PKMA 3EY1A 4NA3A 1S1WB 5JVGQ 1WBBA 3QZ7A 1TL7A 4E1NA 2P9NB 5EY4A 2MQQA 3SBGA 3AO4A 4C3LA 3I8BA 1F9FA 3FBBA 1I1GA 4C8MA 5CXTA 3NAEA 2ZBRA 2BOAA 1NJIT 2ACMA 1HIYA 3ZTPA 1XQSC 4DI6A 2HHTA 1S72N 1RCOB 2OTLS 1Q18A 3UI3A 2F8HA 4C8ZA 2BJ8A 1G2EA 3BN4A 1UWAA 1I51B 4CO2A 4FF4A 3DNCA 4JV2A 2FVPA 2UXCF 3P8BB 1R0CB 3DU6A 2R2SA 2YHAA 1NK5A 2G0JA 2VFRA 4