2VG5A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
557
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 144
structure length 551
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg5A05
4EO8A 3OYLA 1TAQA 1LAVA 2OPPB 3IS9B 2X78A 3H5SA 1KLNA 2HNDB 4Y2AA 3OYAA 1W0HA 3BSNA 2P5OA 4FJ5A 1GX5A 3PVXA 1VSLA 3KK2B 4DTPA 1QSSA 4I9LA 3NKYA 2EC0A 4CCHA 5F8LA 1ZBIA 3AVFA 2FBVA 4M3TA 2I1RA 3VQEA 3ITHA 3Q8PB 1LWEB 4RW8A 2D3UA 3HVTB 3V81B 3SQ1A 4J9LA 4I9QA 1BI4B 1VSDA 1NNDA 4CJRA 3VA3A 4RU9A 2DTUA 4CEBA 1BQMB 1O1WA 3NGDA 2HHVA 4O4GB 3N6MA 4Z4GA 1FXXA 1BIUA 1NJZA 3ZSVA 5DGBA 5I3UB 1K1SA 3TR8A 2FVCA 4E7JA 1KRPA 2YKMA 4IG0B 3VQ6A 3HVRA 4H4OB 2OPRB 4E1NA 4E89A 3OHAA 4DSIA 3ISNC 3HPOA 3KLEB 5KFWA 2IGIA 5KT2A 3IRXB 2D5RA 1QAJA 4OKKA 3NAEA 2F96A 4KV8B 1LW2B 1S4FA 5KFMA 4KBIA 1Q9XA 5KFLA 2F8SA 2AX1A 3TVKA 4X2BA 4FZZA 5L1IA 5FROA 1S49A 2XWYA 4IH7A 3VQ5A 1RNHA 4RNMA 1RTDA 1C1CB 2JEJA 4CFAA 4CF2A 2JLEA 3QEPA 4KKOA 5CZ2A 4RNHA 4AILC 4LQ9A 1RDBA 2YNIA 1HJRA 4F3OA 4Q5VA 3PX6A 1X9WA 2WOMB 4DFPA 1S1WA 5KT3A 2W8LA 4CJLA 4IH6A 3BGRB 4ZHRA 3DI6A 4KTZA 3OYCA 4XPCA 3ULDA 4RW4A 1RDDA 1HYZA 3O4NA 1NKBA 4FJIA 4CJ3A 2HHQA 2JC1A 3CFPA 1FK9A 3NH0A 2O5DA 5KFNA 4Q8EA 2EHGA 3KKRA 3SPZA 4LSLB 4IR1A 4EYIB 4M94A 3QIPB 3T3FA 2VG7B 3DLKA 1X9SA 3N6NA 3K5LA 2W9CA 4ZVEA 1SKRA 1LWFB 3OYHA 5DLGA 3V6HA 5KT5A 3ITHB 4NYNA 4Z4FA 5K14A 4RW8B 1IO2A 2YNGA 2BQRA 4O3SA 3PJXA 4J2DA 4NLOA 4IG3A 4PA1A 1TK5A 3FSIA 2QV6A 3QO9B 4FW2A 2WCXA 1I39A 2PY5A 3M9OB 3QGHA 2R2RA 5L1KA 1I3AA 4FJHA 5F8GA 2R2SA 3MEDA 3V9UA 2AX0A 4ED1A 4NLSA 3RAXA 1TVRA 4F4ZA 4BDYA 4F2RA 4IR9A 2E6MA 4M3WA 4CGIA 5KG0A 2XI2A 4CF9A 4R8UB 4DWIA 4FK0A 1R0AA 2HNZA 3AO2A 4J9KA 4CJ4A 1KFSA 2C2DA 3NCIA 3SJJA 2ZE2A 1T03B 1NKCA 3MXMA 2ASDA 4CEAA 4Y3CA 1XWLA 2OPSA 4CHNA 5KG4A 3SI6A 2XCAA 3OYBA 1WLJA 3DRRB 4NLRA 1QAIA 3RBDA 1IH7A 1D9DA 1NK0A 3HSTB 1NK8A 4B8AB 3SQ0A 2QKBA 4WZMA 3CQ8A 4R5PB 2WK4A 4KAIA 3LANA 4QWBA 4OVLA 2FJXA 3V6KA 1NJYA 1C0UA 4DL7A 4GVMA 2WRMA 5HRNA 2FBTA 3SUQA 3RMAA 2KZMA 3Q8RB 3VQPA 4JUZA 3MEEB 3HK2A 2D0AA 1UA0A 4ZHRB 4ZPBA 2EX3A 4FW1A 1RBSA 4RW4B 1ZETA 3H5XA 1QS4A 5HBMA 5J2PB 2E9ZA 3DRPB 5EWFA 4ED8A 3OL6A 4EBCA 3T5LA 1YVFA 5JUMA 1QSYA 5KG1A 1FK9B 3NAIA 2W7PA 1EP4B 2Y1IA 1WAFA 1Z4UA 3IGVA 4G1QA 2R8GA 3LP0A 1D8YA 4XPEA 3T5KA 2G8WA 4CGJA 3HKWA 4DL3A 5KFEA 2W9CB 4MFBA 2BDPA 4MQ3A 3AVBA 3HXMA 4JRPA 4BWJA 4YP3A 4YR3A 4KB7A 5SZTA 1KLMA 2HW3A 4KAZA 2YNGB 4B9LA 3V6DB 2X74A 3ZT3A 2FLNA 2B43A 4KE5A 1BCOA 3OS1A 4FK2A 2R8IA 4AHCA 3I0RA 4CHQA 5J2MA 4CK2A 2B5JA 4DSFA 4CERA 2GC8A 2XI3A 1D1UA 1YT3A 1L5UA 3SNNA 1TVRB 5KFGA 4IRKA 2VG6B 1SL1A 4F4YA 3LP3A 1G15A 4C8LA 1RBTA 5J1EB 2YNFB 2RKIB 4H4MA 3KLGB 4K4VA 1R0AB 1ASVA 3MR2A 1RT3A 1QQCA 2IBKA 4QCLA 3QERA 1ZBFA 1GOCA 4KO0B 4IFYB 4KPYA 4HTUA 4CHPA 4XO0A 4IFVB 1T7PA 4PUOA 5HRPA 1DTTA 4M3YA 4Q44A 4QW8A 4F50A 3O3GA 4CEZA 2D41A 1TV6A 3NDKA 1EXQA 2V4RA 5KG5A 4NCAA 1CLQA 4KRFA 2P1JA 3LWLA 3BSCA 3FQLA 5HLFB 3AV9A 2G8HA 2F8EX 2UUTA 1TKZA 4FCYA 5KG2A 4DFMA 1XI1A 2QXFA 1DTQB 2ETJA 4K8XA 1JLFA 3I8DA 4EP4A 1HNVA 3FFIA 1S6QA 4YMEA 1BHLA 3TI0A 1UOCA 1ZYQA 1J54A 2W42A 4C8OA 5KRTA 3MXIA 3TAMA 3KJVA 3TABA 1TK0A 3DLEA 4RW9A 4ID1A 4J2EA 4FBUA 1LWCB 3PHEA 3KLHA 5C42A 1QTMA 4QOZB 3GIIA 4RW6A 4OGCA 1RDAA 4BDPA 2HHTA 3K5MA 4C8NA 3EPGA 2FJVA 4CIFA 3KHRA 4NLVA 3VA0A 3O4QA 4U7CA 1SKWA 1QE1B 4IDKA 5EWGA 1CXUA 3SUOA 3I5AA 1SL0A 4JV1A 1WSHA 1S1UB 1HMVA 1C0TA 3I0RB 3NAHA 2HNYA 3IG1A 2XC9A 4DSJA 4NLDA 2B5JB 4B9TA 3DRSA 3QETA 4NLUA 3NF7A 3PX4A 2WONA 3DYAA 2UVWA 2DY4A 2R7YA 4FS2A 5DLFA 3LP2B 2PZSA 3CIZA 1MU2A 4FJKA 4H4MB 1WSGA 4FLZA 5C24A 4B9NA 3KMQA 3L2RA 1IKVA 4G3IA 1HARA 1SUQA 4B3OA 3PZPA 4J9PA 3OYDA 2HWIA 4Z4CA 3F9KA 3GYNA 1HPZB 1NK9A 2E9TA 1RAJA 1RTHA 3H59A 3SI8A 4ZMMA 4PUOB 2BANB 1TKTA 3LPUA 2FVQA 3O3FA 2HWHA 1NK6A 3MEGB 4Z0UA 3KLFB 1JLCA 4KFBA 4ED2A 3V6JA 1XR6A 1JLBA 2BE2A 3KHHA 1SH2A 4DQSA 1S9GB 3TAFA 2RN2A 1WNSA 3QLHA 1GOBA 3AA2A 1TV6B 2W9BB 5DMRA 2IAJB 1N56A 2XGPA 4N5SA 2Z1HA 3VQ4A 1RTJA 4Y1DA 3GV7B 3ISND 4DL5A 4I7FA 3HVAA 4K4SA 4FLVA 5C25B 4K4UA 1HRHA 3E01A 2IM0A 1NHUA 3C95A 4RW7A 4L8RB 1J53A 1S6QB 1EETB 3JYTB 2B6AB 2E4LA 4MK8A 4CJUA 3QZ7A 1RA7A 5J2NB 1K1QA 2RF2B 3VQBA 3KLHB 5C42B 2J6SA 1JXBA 4GW6A 3GV5B 1T05A 2VWKA 3AVGA 1U48A 2JEGA 3CM6A 3BQ2A 5HP1A 3PO4A 4FJLA 4ZP7A 1JXEA 4E3SA 1RT6B 3NGYA 3G6YA 3KOAA 4GC7A 4IDKB 3KHLA 1ITGA 1OS5A 3IAYA 2AGQA 1F21A 4NLTA 1TQLA 2D3ZA 3O3HA 3NGZA 4IBNA 1JKHA 2DPJA 1N6QB 3CJ5A 5DQHA 4NLQA 2FBYA 4Z4EA 3DRSB 1C1BA 1HNIA 4DTJA 3DYAB 4Y1CA 5JS1A 2ALZA 2OZMA 3SV4A 3ASMA 4E0DA 2XO7A 4NYZA 3KKSA 4QPXA 4CGHA 4ELTA 3KD1E 4ECXA 3SUNA 4WE1B 3QEIA 5KG3A 3BQ1A 3PR5B 3H4DA 3OYJA 4J2BA 1T3NA 3K2PA 4BE1A 4O0IA 4FM1A 4TYBA 4HHTA 3L3UA 1XHZA 3LP1B 1XHXA 2AQ4A 4MIAA 1BISA 5KFYA 1RT7A 3L2UA 4I2QA 4DQPA 1MMLA 1RTHB 2HVHA 2XCPA 4QWCA 3SPYA 3K5NA 3DMJB 4YR0A 4DFKA 4KFBB 4R0EA 4W5OA 4ELUA 1UA1A 2BE2B 4Q45A 4HYKA 1DLOA 2E9RX 1S1VB 5F8NA 1QHTA 1LW0A 3VQ8A 4HUGA 4IOBA 2AU0A 4I7FB 3H2LA 4M3RA 3MF5A 3CDUA 1IKWA 4DF4A 1TK8A 3E01B 4O55A 3KNAA 3ZSQA 3SUPA 1C1AA 1W25A 2UVVA 2HHUA 4IQXA 1YTUA 3B6OA 4DSEA 4IRDA 2IC3B 3RAQA 3NBPA 2QKKA 4O44A 4NRTA 4URGA 4BDZA 3KK3A 4CK1A 4LQ3A 5T7BA 3FDSA 3GIJA 3AO5A 1L3UA 4FJ7A 2G8VA 5L9XA 4FS1A 2D0BA 5HP1B 4BACA 2R8KA 4FXDA 1REVB 4K50A 5KFBA 1FKOA 4KHYA 2B4JA 5JS2A 1D5AA 3LZJA 4PQUA 4YQWA 2XHBA 4RNFA 5KG7A 1FKPA 3C6TA 4OKEA 1HQUA 5KFVA 1LAWA 2O4GA 4GMJB 3SZ2A 3H98A 3NF8A 1N4LA 3OSNA 3H08A 3CM5A 4O3OA 2XGQA 4EZ6A 3THVA 5KFRA 1S1XA 3MTKA 2KTQA 2JEIA 4CFBA 1NHVA 4FJMA 3GILA 4WFYA 3RB0A 1B92A 4M95A 3G6XA 4W5NA 3OHBA 4I2QB 3T19A 3JSMA 4CF0A 3DOLA 4DG1A 1JLGA 3AVJA 2PYLA 4IKAA 2D0CA 2IM3A 3PJWA 4JS4A 3DLRA 4CF8A 5FDLA 1NJXA 3GV8B 4FLXA 1U09A 3NH2A 1VRTA 1JIHA 3KLIA 2YNHA 4RNOA 2ILZA 3B6PA 4B08A 3L8BA 1NKEA 2IM1A 4CESA 2FVSA 4WXWA 4ED7A 4ECWA 2YKMB 3DOKA 4CEDA 3NFAA 4IKFA 1RT1A 1QUVA 1LW0B 4E19A 3AVNA 4CJSA 3QIDA 4ICLA 3SQ4A 1A5WA 3HL8A 1NJWA 4HKQA 4ECZA 3ZSXA 4FJXA 2WTFA 4LD0A 3PX0A 4NCGA 1S97A 1S9FA 2FVPA 3RR8A 4F8RA 2G8FA 5FRNA 4QWAA 3NBPB 3VQCA 3ZSZA 2BR0A 4YR2A 1S1TA 5CYQA 3G6VA 4TLRA 3HM9A 5KFUA 4KI6A 5KGWA 4AH9A 1RTDB 3EY1A 1RYSA 3I5BA 4KKOB 3PV8A 1TL3A 5KTQA 3AA3A 3UPFA 2YNIB 3GIKA 4O3PA 1RBRA 1A5VA 4TN2A 4MKAA 1WSIA 1S1WB 4KTWA 3ZCMA 5J2QA 4FLYA 2C22A 3M8PA 3AA5X 1Z25A 1HQEA 3DI6B 4PQUB 4M3ZA 5DG9A 3T5HA 2YV0X 1D0EA 1RYRA 4KHQA 4KHRA 5EU7A 1FKPB 3C6TB 4O0JA 4DL6A 1JXLA 4ECVA 2Q3SA 1HYVA 4NLPA 1UWBA 3QGGA 2WB4A 5SWMA 3M8RA 4DQRA 3DM2A 5E41A 3HO1A 4OGEA 4CIGA 3S3MA 2DFFA 1JLEA 3DLKB 1S1XB 2G8KA 4CHZA 4EO6A 1BGXT 2WHOA 3TAEA 1S6PA 3OJUA 1S0NA 4WXOA 5HROA 5K14B 2IOCA 4TY9A 2XY8A 3OSPA 3DOLB 4DG1B 1N48A 3TWHA 4IG3B 3TAQA 3VN5A 5FDLB 5L1JA 2R2UA 1VRTB 4CE9A 2YNHB 5L1LA 4CJQA 3MEDB 3TQ1A 3HHKA 3D5MA 4O4RA 3QESA 3U3YA 4GC6A 3DOKB 4DQIA 1T8EA 3PY8A 2KW4A 4N41A 2ZQBA 4K4XA 2HNZB 3ZSOA 4J9MA 5I42A 4OLBA 4FM2A 4H8KA 3OS2A 2ZE2B 5DK5A 4Q8FA 4BE0A 1C6VA 4CK3A 3CJ4A 3CG7A 2OPSB 4DTUA 3M8QA 4CGGA 5KGXA 5CYMA 2YKNA 1YTAA 5CYQB 5KT7A 4DSLA 1RDCA 4KHNA 4OL8A 4DF8A 3L3VA 3DLGA 3AO3A 5DQIA 1TL3B 2GIRA 2KFZA 1C0UB 2UVUA 5CZ1A 4EZ9A 3SFUA 4Q43A 2ZD1A 4TQRA 4H54A 3HYFA 1KSPA 3QNOA 2JGUA 2V0NA 3SQ2A 1IKYA 4CGDA 4FJ8A 2PYJA 1HYSA 3BR9A 5HBMB 4ECUA 1TL1A 4ZP9A 2RDJA 3RRGA 3V1OA 4LSNA 3DM2B 1TKXA 1N5YA 4HUFA 1GX6A 3HP6A 1VRUA 4G1QB 3LP0B 5C5JA 4DL4A 1JLEB 2I5JA 2HMIA 4MFBB 3UQSA 2HB5A 4DTXA 4ZTJA 1KVCA 2VG5A 3BSAA 5DG8A 3KK1A 1SH0A 3IGNA 4F3TA 1KLMB 1RTIA 4JS5A 3SV3A 1VSJA 1WSFA 4M3UA 4AHTA 3GIMA 5J2MB 1RCHA 3M9MB 1JLQA 2FLLA 3LAMA 5KFKA 3C6UA 4HVJA 3LPTA 4JV0A 1J5OA 3V9ZA 4URSA 4O3QA 5HRRA 4U6PA 4WYLA 2G8IA 3IS9A 3MXJA 1RT3B 4AHSA 3AVHA 5KFJA 4WFXA 4OJRA 3OYNA 5KFHA 3FQKA 3M8QB 3P83D 3WNFA 4FVMA 4DFJA 4E7IA 3KK2A 1DTTB 1U4BA 3KHGA 2BQUA 1VK0A 5KFAA 4CJVA 5DQGA 2C28A 3CJ0A 2FC0A 1IKXA 1U49A 1I6JA 1ASWA 1ZBHA 3CWJA 3HVTA 3V81A 3SYZA 4DU3A 4TQSA 1BI4A 3AVMA 3TANA 4NRUA 1Z26A 4NYFA 2ZD1B 1TGOA 4O4GA 3ZT2A 2NUBA 3RMCA 1QSLA 1TKZB 3D0PA 1JLFB 4ECSA 1HNVB 3FFIB 3CFRA 1X9MA 2D7SA 1K6YA 4IG0A 3PR4A 4HUEA 4MKBA 1SKSA 3TAMB 3KJVB 3PW4A 3MR6A 1N5YB 5KRSA 3DLEB 2X6NA 4RW9B 5JXSA 3BJYA 4FM0A 4FBTA 3KLEA 3MAQA 3IRXA 4RW6B 2I5JB 4KV8A 2HMIB 2F8TA 5KI6A 4ECQA 2VG5B 2A1RA 4J9QA 4CHOA 2A1SA 1CXQA 4I2PA 3RMDA 4YNQA 4ZPAA 4CJKA 1C1CA 2IA6A 1HMVB 1C0TB 4EEYA 1ZBUA 4WFZA 1KHVA 2HNYB 3IG1B 1WNEA 1JLQB 4M41A 3SFGA 1Q8IA 4FK4A 4RNNA 2WONB 2FLPA 1ZBLA 3C6UB 3ZT0A 3NF9A 3ZSRA 4ECRA 3A2FA 3QZ8A 3BGRA 2YHAA 5KT4A 1BCMA 1MU2B 4CECA 5C24B 3G86A 3GQCA 4RUAA 1IKVB 1SUQB 5KFQA 2BQ3A 4B3OB 4KHMA 1S9EA 3QEWA 4E7LA 1NK5A 4LH5A 4M45A 3NF6A 3VQ9A 4ZVGA 4O5BA 2P51A 2JC0A 3OYEA 4LSLA 4K8ZA 3DDKA 3RRHA 4KI4A 3QIPA 2ASJA 2Z1GA 1TKTB 2VG7A 4TYAA 3KMSA 1KFDA 2FBXA 1JLCB 4CJFA 2QE5A 1LWFA 1JLBB 4JV2A 4F4KA 3NH1A 3ZSYA 3QLHB 1IKXB 3H40A 1GOAA 2GBZA 3MECA 4CGFA 1RTJB 2HHWA 4K4ZA 3PW0A 3QO9A 2QK9A 4MK9A 4ECTA 1XR7A 1U45A 4CEEA 4RW7B 3V9SA 4AHUA 4R8UA 1U47A 4QW9A 3TAGA 4WZQA 3AVCA 3MR3A 1NOZA 2FVRA 2J6TA 3S9HA 4K4TA 1WN7A 2IM2A 2GUIA 1T03A 3RR7A 3CDEA 3TAPA 2DFHA 4W5TA 1NK4A 5F9NA 3BDPA 3QEXA 1VSKA 5CY4A 1T05B 4E1MA 4B9VA 4NCBA 3DRRA 4HCBA 4CJTA 4N76A 3OYFA 3Q8SB 4I2PB 1JX4A 3KD5E 1RILA 4R5PA 3EPIA 1SV5A 1JKHB 1CZ9A 3HJFA 4JLHA 2ATQA 1U04A 1L3TA 1KVBA 4KHUA 1C1BB 2YHBA 1HNIB 1S0MA 1BIZA 1KTQA 3I0SA 3QEVA 3MEEA 5KFDA 3AVIA 3VQ7A 1C0MA 3OL9A 5HRSA 5F8HA 4EP5A 3LZIA 5J2PA 4FYDA 4DLGA 4KTQA 1D9FA 3DRPA 4ZVHA 4E7KA 1TKDA 5EUHA 1S9EB 1RA6A 1IG9A 1VSIA 3K59A 3V4IA 3RB4A 3NMAA 4XIUA 1EP4A 4RZRA 4OKJA 2R8JA 1RT7B 2XRIA 3VQDA 4KB0A 3HT3A 4FLTA 3QYYA 3ZT4A 4JRQA 4CJWA 3Q8QB 4DEZA 3AA4A 4Q0BA 2KFNA 3MR5A 4EBDA 5EDWA 4M42A 5KG6A 2BRLA 4DTNA 4B9UA 3SCXA 3S3OA 1X1PA 3H5UA 4Z4HA 4KHWA 2CJQA 3H5YA 1DLOB 1RT5A 4RG8A 3AVKA 3V6DA 5KFCA 3MECB 2DPIA 3TARA 3LDSA 4M3XA 1KHWA 3M8SA 2Z1JA 2OZSA 4LY7A 3M9NB 1B9FA 3LALA 4ELVA 4ED3A 4DQQA 1JL1A 3KIOA 4F2SA 1IKWB 3N6LA 4CJ5A 5KFFA 4ID5A 2VG6A 2BRKA 2LSNA 2XY6A 1RDRA 4BWMA 3P1GA 5J1EA 2YNFA 2RKIA 3KLGA 5KFIA 4ED6A 3ALYA 4BE2A 4O44B 3CJ2A 4CEQA 5KFPA 3KK3B 4NLXA 5D3GA 3BQ0A 1RT4A 1EX4A 4KO0A 4IFYA 4LH4A 4DL2A 5F8JA 4F4WA 2P5GA 2OH2A 4W5RA 4NZ0A 3RMBA 3S3NA 1NOYA 4IFVA 4CJEA 2VA2A 1FKOB 1KVAA 4E7HA 4AHVA 4QWEA 2R2TA 1EKEA 1SV5B 3VQSA 3RTVA 4DMNA 3CO9A 5T14A 1B9DA 2OA8A 2ZKUA 3OYIA 3C94A 3EZ5A 1HQUB 2IS3A 3OYMA 3K58A 3I0SB 3U3GA 3MFHA 4J9RA 1S48A 3HPGA 4ZVFA 5HLFA 3UR0A 3V1RA 1RT2A 4ZPDA 3QINA 1DTQA 1TAUA 5KFXA 1L3SA 4FJGA 3AO4A 4C8MA 5KT6A 3U6FA 3V4IB 4CHYA 2HHXA 3V1QA 3MFIA 3OVNA 3DLBA 2RDIA 3JSMB 3ZSWA 2Y1JA 1JLGB 4DU4A 1LWCA 4EYHB 4KSEB 4Q0BB 4DLEA 4ECYA 4DS4A 5F8MA 3KLIB 2XY5A 3V9WA 3PW5A 3CYMA 2ASLA 2Z1IA 5KFSA 5F8IA 3OL7A 4OPKA 3WNGA 1QE1A 1RT5B 4CEOA 4J9OA 2FJWA 4KHSA 3RB6A 1WSEA 1S1UA 2ITGA 1RT1B 3D45A 3WNEA 3OYKA 2OPQA 3K57A 4CEFA 2HVIA 3ICLA 4ICLB 4F4XA 4O3RA 3FRZA 1KCFA 4NCGB 3L2VA 3LP2A 4ID5B 4TY8A 2E6LA 2ATLA 1TP7A 4FLWA 1RBVA 5DGAA 2BGGA 3OL8A 4PWDA 1XR5A 3T5JA 3WNHA 2OYQA 4UQGA 4DS5A 1S1TB 5DG7A 3G10A 1BQNA 4EBEA 4Y34A 2V4QA 5D3GB 1RT4B 2GIQA 2IJFA 1HPZA 2V9WA 4KB1A 4ZPCA 2R8HA 4J9NA 2G8UA 2BANA 2ILYA 4N47A 1NK7A 5J2QB 5KFOA 3MEGA 2W8KA 3PW2A 3KLFA 3M8PB 4IRCA 2UVRA 1HQEB 2HHSA 1S9GA 4QAGA 4AHRA 3VQQA 2W9BA 2IAJA 4B9SA 4J2AA 4FLUA 4OLAA 2X6SA 2UUWA 1UWBB 2O4IA 3LWMA 3OLAA 4FZYA 4FJ9A 4DTOA 5C25A 3CVKA 1ZTWA 3QNNA 5EWEA 1RT2B 4DTSA 2RPIA 1EETA 4DU1A 2AWZA 1XC9A 3CDWA 3JYTA 3LAKA 4NLYA 2VA3A 2W7OA 1UAXA 3P5JA 1S6PB 2B6AA 2J6UA 5HROB 1VSMA 1VSHA 1WAJA 3L2WA 4J9SA 2CKWA 2AJQA 1ASUA 5J2NA 3L2QA 2RF2A 4CFCA 4CF1A 1ZTTA 3K5OA 4QWDA 1VSEA 1LV5A 2C2RA 3AVAA 3OY9A 3OLBA 1JLAA 4ZP6A 3QIOA 1RT6A 4MK7A 4C8KA 1A5XA 4CFDA 3DLHA 4CIEA 1SH3A 3AVLA 3PO5A 3NL0A 3NHGA 1Q9YA 4MIBA 1Y97A 3HVWA 3HPHA 2OPQB 1N6QA 3H4BA 3RBEA 2C2EA 3RWUA 2HAIA 1S10A 1W9HA 5I42B 4CJPA 3OS0A 1VSFA 2OPPA 2KZZA 1T94A 4K4YA 4B8CA 3UIQA 2HNDA 4OPJA 4TY8B 3HP9A 3EZUA 4NLGA 4DTRA 4Y2CA 2AGPA 4RUCA 2W9AA 5CYMB 4PWDB 2YKNB 4WE1A 1S0OA 3AO1A 3RB3A 1BQNB 4FZXC 4ZP8A 3NGIA 3D28A 3CJ3A 2DFEA 3LP1A 3DLGB 1CSJA 3V9XA 4PY5A 5F9LA 1LWEA 3OJSA 5KFTA 2GV9A 1JL2A 4FJNA 1BL3A 1L3VA 3DMJA 1BQMA 2IMWP 4TXSA 3BREA 3KTQA 1SL2A 1IKYB 2IJNA 4DTMA 1HYSB 3ZT1A 3NE6A 5I3UA 4YFUA 1RBUA 2IDOA 1TL1B 2KQ2A 1S1VA 4NLWA 3PW7A 5KFZA 4H4OA 4ZTFA 2OPRA 4K4WA 4LSNB 3PUFA 3QGIA 1IM4A 1TKXB 3EYZA 3G0ZA 1VRUB 2XY7A 3E51A 1CZBA 1WSJA 4W5QA 3UDLA 4Z4IA 2AGOA 1J9AA 1LW2A 1YVUA 1C2PA 5FRMA 3CFOA 4N56A 3BSOA 3KK1B 2IC3A 1RTIB 4TSXA 4MH8A 4B9MA 4IH5A 2VWJA 2JEFA 3KLVA 3IN5A 4KREA 1JLAB 3OYGA 2WOMA 1REVA 4ED0A 3F73A 3VQAA 4O3NA 4FJJA 4URQU 1S5JA 4HCCA 3T1AA 1J5OB 4DSKA 3I5CA 4WYWA
chains in the Genus database with same CATH superfamily
3MUVP 3UWTA 5HK4A 2PGCA 2NREA 1TAQA 4N8OA 1LWXA 2OPPB 2CA9A 3TJ8A 4B17A 1S99A 1WUUA 3JSBA 5F3TA 3T6BA 2HNDB 4A8SA 4WFBQ 3BSNA 2HBJA 4FJ5A 1HHQA 2PFDA 5HN0A 1GX5A 3LDOA 3OR1A 1QSSA 4I9LA 1WOOA 3UKRB 4CCHA 2FBVA 3VQEA 2CPZA 3HVTB 2MXYA 1PC4A 2RNEA 3SQ1A 2AZ1A 1QHAA 1NNDA 2YXLA 4RU9A 1RAIB 4CEBA 3MAAB 4HT7A 1B0TA 3MI7X 2HHVA 4O4GB 2EBGA 2G2ZA 4DV2J 8AT1B 1BG3A 1FXXA 4Z4GA 4YB5A 4FOIA 1Z2ZA 3AY0A 4AQYK 2UUCF 5I3UB 5LJ3Y 3HSDA 2J9DA 3AB2B 5H9FJ 2D3O1 2YKMA 3VQ6A 3HVRA 3M2VA 4E1NA 3BGOP 4GKKK 4PYAA 3GOIA 7AT1B 4DSIA 3PJ9A 4LFBF 3IRXB 3FJ2A 1NBWA 4OKKA 5LMNK 3WXJA 4GV6A 5BPMA 4KBIA 2K1RA 3ENAA 2IDLA 1FFSB 4C11B 2AX1A 3TVKA 2CJ9A 4X2BA 2FZGB 1S49A 4I6YA 1OPIA 1RTDA 1C1CB 1QM9A 2JEJA 3ADAC 5GAHI 2HBRB 2YNIA 4YOYA 1FE0A 5AXKA 3FBFA 3DLLL 1VQKN 1X9WA 4DFPA 2R7VA 4Y6IA 4OJHA 3J8AA 4CJLA 5K8MA 2D9PA 3VV2B 3O4WA 3UCZP 2E5LJ 4ED5A 3EKSA 4U9RA 4ZHRA 3DI6A 1BHNA 3OYCA 4MO4A 4RW4A 3J7YI 1X3NA 1HYZA 3O4NA 2MZTA 1FDNA 2JC1A 1FK9A 1FJGJ 2DR7A 1NB2A 5K20B 4LSLB 4LUBA 2Z2ZA 4M94A 4JYAK 3A4TA 2VG7B 3JSYA 4OX7A 5L39A 1SKRA 1QQNA 3EWGA 2FJBB 3ITHB 4RW8B 2ZH6A 4A62A 1K8KB 4YOUA 4O3SA 3PJXA 3K2YA 4J2DA 2PEBA 4PA1A 3IP0A 3QO9B 2WCXA 2PY5A 3VF0B 4DV5K 3CJKB 4DV6J 2O8DA 4ED1A 2YJEA 3UDCA 1CLFA 4BDYA 2CRLA 2E6MA 4MYTA 2HVZA 1PIEA 2E2QA 3HFKA 3R27A 1K0TA 5AQPA 3UDEA 2HNZA 1YLXA 1QLNA 1KFSA 3D54A 2ZE2A 4JKCA 4CEAA 2XB2D 2HAFA 1YGYA 2JWNA 1ZA1B 4NLRA 2QM1A 1QAIA 1CJUB 4LRDA 1U0HB 4JI3K 4R5PB 4I4BA 4KAIA 3ZTSA 4H0TB 4DQ8A 3LANA 2BJDA 2CQCA 4QWBA 4OVLA 4WCEQ 4K0KF 2FJXA 1T9TA 4ZS6A 4OZ2A 1FT8A 3QAEA 3TR5A 2VFVA 2WBMA 4G6VB 3DU5A 1MW7A 3MMVA 3ENHA 2FBTA 3SUQA 3RMAA 5IM0A 4NLBA 3MEEB 1UA0A 2D0AA 1FX4A 2EX3A 3M1VA 2V2QA 1L3KA 3H5XA 3M2UA 3O1WA 4CO5A 3AXMA 3O5TB 3NAIA 9RUBA 2C1EB 1Z4UA 3IGVA 2QWRA 4G1QA 1TFWA 3ETMA 3FR0A 3CMEN 3A5OC 5BR9A 2QRRA 3TUZC 2B7CB 2VC0A 3HKWA 3IR5B 3JAMY 1XNQJ 9ATCB 2W9CB 4JI6F 2B4UA 1AT1B 4KB7A 1KLMA 3MOZA 4BQLA 3V6DB 3OFEA 2B43A 4KE5A 1BCOA 2R8IA 2VU5A 1MWYA 2VD3A 4CRJA 3BZQA 1NGGA 4CHQA 3Q8VA 4CERA 4OPAA 2IVNA 2GC8A 4X65F 1UP1A 1D1UA 2W2MP 3SNNA 4PG8A 2CDRB 2V67A 2P9SA 1VC0A 3G9CA 4XDCA 3CCRS 1TELA 1NLVA 3SBGA 1RBTA 2P9LB 2YNFB 3DHXA 4P7TA 1ASVA 3MR2A 2N4CA 4PYDA 3X3UA 4ZVSB 3R6MA 3KK7A 2C2NA 2BZ2A 4M7XA 2WB1D 2RH3A 2AW0A 1MLAA 4PUOA 2QYCA 1SJ3P 2DRAA 1JCEA 4QW8A 3O3GA 2EKNA 3EL2A 2M2BA 5DS7A 2Y9HA 3OW2M 3KWMA 1ZH5A 3CCSN 1OJ4A 4CBWA 2VFTA 4M5MA 4NCAA 1S79A 1FERA 3MPUB 4A8MP 1ZOTA 3LWLA 3FQLA 3CUNA 2RE1A 1ZAVA 3G2XA 1Y5NB 2UUTA 1NNEA 2V7YA 4K8XA 2ETJA 2AHOB 5HQLA 3GZ7A 4EP4A 1HNVA 1BHLA 3TI0A 1UOCA 4DR2F 4QS7A 5I3PA 3TAMA 3TABA 2C2OB 4J2EA 1ZPVA 4QOZB 3ZEUA 4RW6A 2BABA 1Y0HA 4DV1K 2Q0UA 2E1ZA 3VA0A 5CHCB 4DPYA 3O4QA 4ZA1A 1RXOB 4DR1K 3I5AA 1VS3A 6AT1B 1NCLA 3NAHA 4OI0A 4DSJA 3C66A 4CO2A 3NF7A 2R7YA 3LP2B 1LFPA 1OYEA 3FZKA 1G4CA 3PNIA 3A8KA 3IBCB 1IJFB 1ZM3A 2ZF5O 1MU2A 3BY5A 3AFGA 5F3ZA 2BJ8A 4YDXA 2MJNA 4J9PA 5BRFA 1OQ3A 3C2PA 5AQNA 3T1HJ 1HPZB 1NK9A 2E9TA 1U2FA 3H59A 4ZMMA 1YITS 2BANB 3QRQA 3AQPA 2HZAA 3IAS9 1NK6A 4JV5K 4FZVA 4FPIA 1VAZA 1SXLA 7FD1A 3H46O 3KHHA 1S9GB 3QLHA 5B0AA 2W9BB 1YG0A 4Y65A 1N56A 4DR7F 1RTJA 3CJRA 4C6AA 3MDQA 3ISND 2B4PA 3IMXA 1VQ6S 1HRHA 2HQCA 2HWTA 2FSJA 2Z58B 1S6QB 2QXLA 1X4DA 2ADCA 1IBKF 4BG8A 3I56S 3OVAA 5GAGP 4JI7F 3KZBA 4C0BA 2E4LA 4MK8A 1KD1O 3QZ7A 1W2BM 4RBTA 5EX3A 3VQBA 1P9YA 4DMZA 3KLHB 2PFFB 1JXBA 1YBTA 1OQ6A 2VWKA 3TEHB 2WTUA 3BQ2A 2LEBA 4P52A 2VHGA 4ZP7A 4IDKB 4CO0A 3D2FB 3IAYA 2VCPA 2QO3A 1BA1A 5E84A 1PJ5A 1JKHA 1N6QB 5BR8K 5AXMA 2HVDA 4QZVB 1C1BA 1FWPA 1R8PA 3L95X 4OLOA 4M8LA 2RSQA 1J5EJ 3DYAB 3CCZA 2QWQA 2M3DA 2QMUB 4JI1F 1C0GA 1FEHA 3MM7B 5E3RA 3CCEN 2FPHX 3R5DA 4E0DA 1SPBP 3L3CA 3KKSA 2SXLA 3I87A 4ECXA 3SUNA 4WE1B 3QEIA 5KG3A 3LP1B 4MIAA 3FFKB 1S72N 1MMLA 4DX5A 2ZVIA 2DY1A 4BR2A 1VJQA 3O44A 3GFZA 1RTZA 2IIHA 4R0EA 1FJGK 2WSCC 1UJ6A 2DK2A 5A8RB 3MWTA 4DR3J 5DM7Q 4TNOA 1KN6A 3J7AN 5DZ6A 3S41A 4OYXA 3CC4N 4IOBA 1QQMA 2H48B 4KGVB 1RBAA 2DGWA 4M3RA 3GCXP 4DX6A 3MF5A 4DF4A 3E01B 1LK5A 2EWHA 1W7WA 4WQ4A 1W25A 3Q89A 2UVVA 4IQXA 1X7VA 2W4DA 3RAQA 3NBPA 3R7SB 4X4SA 2QKKA 3A3PB 4O44A 2HYIB 2VONA 4DV6K 3ZO7A 1WHYA 4GKJJ 4CK1A 5DETA 4LQ3A 5T7BA 4C7QA 1CJTA 2EK1A 3HSCA 4FJ7A 1HA1A 1EZZB 1RWMB 3C7NB 2W40A 2RB7A 2FC8A 2CZVC 4FXDA 5B0FA 3E3XA 3MN5A 1M90O 3H0PA 4OYBA 1YUWA 5JS2A 3OBWA 1SC3B 4PQUA 3D0HE 3LO3A 2IJRA 2XLJA 1FI4A 4AM6A 3HHNB 1HQUA 5M1NA 4GMJB 3A13A 2BX6A 3NF8A 1RBLA 2FTRA 5GAHU 3ETOA 3CM5A 3J81O 1VCTA 4EZ6A 2XULA 1MROA 4WP8A 2J8AA 1RCOB 4NB4A 4WFYA 2V8PA 1B92A 3G6XA 2Z30B 2GMHA 2F7TA 4W5NA 3J7YU 4I2QB 1PBAA 2WUSA 2QYGA 3DOLA 4DG1A 2G2OA 3WIVA 1BA0A 3CPWM 4OHYA 2MYFA 2IM3A 2HBLA 2B8QA 4JS4A 3NH2A 3R7NB 4RNOA 1PAEX 1XMBA 3B6PA 4LIWA 3L8BA 1Y5LB 2FVSA 1IBLF 2I7PA 4CEDA 3DOKA 1XNQK 4Z7YA 3ZZZA 1HWLA 4CJSA 1A5WA 3HL8A 1NJWA 4GVBA 5A8WB 3SCKE 2WTFA 1BLUA 4NCGA 1HPMA 1S9FA 4ILGB 2M8DB 3QNWB 2L08A 3RR8A 5HVFA 4K5SA 4DL0C 3I8BA 3P31A 4DV0J 1S1TA 1M5KC 3HM9A 5KFUA 4KI6A 2PMWA 3EY1A 1Q82O 1RWUA 3LDNA 5KTQA 4OFZA 4O3PA 3PYGA 4C8YA 4FPBA 3U9DA 4QU7A 3KUGA 1YKWA 4KTWA 2X7IA 5J2QA 1RACB 2OD4A 4FLYA 2C22A 2QLWA 3AA5X 2COLA 1Z25A 4I6MB 1SCJB 2YV0X 4KHQA 3C6TB 4LRFA 4ECVA 3IR7B 2Q3SA 1WG5A 4X62F 1UWBA 4Y00A 1ZAXA 2MQOA 3M8RA 5E41A 3HO1A 2VF3A 4KHPK 1H2UX 4MTPA 1DQ8A 1JLEA 4DV4K 4CWBA 5CE3A 5GIPA 4OI2A 4OHXA 1S0NA 5K14B 2V8VA 4WIIA 3ZX0A 4Y0FA 4OZ3A 5CZXA 3C16A 4ZVRB 3OSPA 1VBXA 1N48A 1R3NA 1R0CB 3TAQA 1EO1A 2R2UA 4F25A 5F1XA 4A8QA 2YH0A 2AYMA 3QESA 3SJHA 3HZEA 2RU9A 2P9NB 1WC6A 3LGHA 4IOCQ 4N41A 2KW4A 2ZH7A 3QGPA 2AP1A 3ZSOA 1HNZJ 4UZCA 5I42A 4CTAB 4J9MA 1G2EA 4UOCA 1VQYA 4FM2A 5DK5A 4RLEA 3CDBA 3DCAA 4H0OA 1VRQC 2OPSB 4DTUA 3CJCA 5KGXA 2DNRA 3GIRA 3RBZA 1Q5VA 4J37A 1ZBSA 5KOXA 2V4JB 1RDCA 1CG2A 4U67L 2KM8C 2ROGA 1KOOA 3AO3A 2BA9A 1TL3B 4M5HA 1UEVA 4DV7F 2UVUA 3QATA 3DLJA 4EZ9A 4V1Ak 1XERA 2XSJB 3LPEA 2O66A 4Q43A 4TQRA 4H54A 1RJJA 2KRRA 2AKWB 2JGUA 1U7LA 3M8WA 4CGDA 3VGKA 2RDJA 3RRGA 3B8AX 3V1OA 4LSNA 4X64F 1AFJA 1RK8A 4M5GA 4FSVA 1RWKB 1BC6A 1ATSA 5C5JA 2BJ3A 2DGTA 2LQ5A 4NOHA 3N4WA 3VENA 2CNNB 4F67A 5D4OA 1P1TA 1KVCA 4B3MK 1SH0A 3IGNA 4F3TA 3ENQA 4K5RA 4JS5A 3SV3A 4LF6J 3MAHA 1RAOA 1NDLA 4ZJOA 4TU7A 3GJRB 3QB0A 5A2QO 3M9MB 2MQNA 1NGEA 1VMBA 4W98A 2EFGA 5KFKA 3C6UA 3G6EN 2Q1NA 4HVJA 1UL3A 2MZ1A 3IR6B 5ETNA 5AQXA 1D9AA 2PI4A 3V2UC 3TP2A 4URSA 2YY3A 4O3QA 4BBYA 1SB6A 3R5CA 1O6XA 5KFJA 1H2VZ 5T7LB 5I3QA 4WFXA 4OJRA 2J7WA 1RHKB 2EFNA 4RUHA 3FCVA 3O9QA 2QMWA 1NGFA 4Z94A 3M8QB 3P83D 3CD6S 2C3OA 5CYJA 1M1KO 4FVMA 3MPYA 4E7IA 3KK2A 1DTTB 1U4BA 2E1YA 5CCMA 1B7FA 3H8YA 2BQUA 4F0HA 2V8DA 3CJ0A 1ASWA 4RCHA 4DU3A 4TQSA 4CLZA 4NYFA 3A1YG 3ZT2A 3D2WA 3MPWA 2NUBA 1XEZA 3BGUA 3RMCA 2Q36A 3SQOP 4ECSA 4CLYA 2XZDB 3KVGA 3CFRA 1K6YA 3VESA 3ATVA 1HLWA 5BXIA 2VBWA 2DXDA 3J7AP 2K3IA 4LFBJ 1X5PA 1V9OA 3DLEB 4KJIA 4RW9B 3BJYA 3CCJN 2B8PA 3JTOA 3H1VX 1FRMA 1RBOB 3VEVA 4WTOB 4MMOA 3CJ1A 4KGKA 1TMJA 4KV8A 1K47A 5FPDA 5DDOC 2CGJA 2F8TA 5B0CA 2A1RA 3Q2TC 2A1SA 3EVOA 2VOOA 2MKSA 5A8KA 3RMDA 5D77A 4DR5J 1ZZFA 3TSQA 3PIOL 2IIRA 2D74B 1ZBUA 2ROEA 5GAEP 2ZJQQ 1E6VB 1WNEA 4FK4A 2WONB 3MMAB 3ZT0A 4HLBA 3A2FA 2KVIA 2EEYA 4XH5A 4M5KA 4AL5A 5KT4A 4GVEA 2IYGA 2RQ4A 3KHYA 3MCAB 1Y00A 1YJ9S 3CJAA 1GTEA 1IKVB 4A57A 2I9SA 4B3OB 4LF4J 4E7LA 4M45A 1RE1B 2BKPA 4LFCF 4O5BA 1EHWA 1SJQA 4ZVTB 4JI4J 1BO5O 2DYAA 3DDNA 1K44A 4X4RA 2JFDA 1LWFA 1JLBB 3LA0A 1XMOK 4U8VA 4DR4F 3DXMA 2O8BB 1M1GA 4UY8O 2E44A 3UNYA 4CH7A 3VERA 2GBZA 4NZ7A 3EGVA 1Q81O 3HBTA 3M6UA 2HHWA 4MLEA 3CIMA 3QDKA 1YZ7A 4FF4A 1HWKA 4B9QA 3SSSA 2BOPA 4JOUA 2HBQB 1Q4RA 4G1PA 2FYXA 1KVIA 2QX0A 4DXLA 1R7IA 4ZK7M 1ESVA 1CVJA 4R8UA 2KHCA 4ZCKA 3AA8A 4WZQA 1KP6A 4I69A 2VDHA 3S9HA 3W5YA 3TO8A 3WEEA 3VAKA 3CD5A 3RR7A 2GUIA 1NK4A 1B99A 2DFHA 1WUAA 4YOTA 2M8HA 4OYOA 5CY4A 4CYUB 3CTRA 1XQIA 3H90A 2MZSA 3Q8SB 3W62A 4M7YA 3GFHA 3LW5C 4X4PA 4K0KJ 3MM6A 3EPIA 5KPRA 2J8SA 2GQQA 1VHXA 1SV5A 4JLHA 2KT5A 2ATQA 1U04A 1KVBA 3G8TA 3C46A 1S0MA 1BIZA 1KTQA 3FLCO 2BW7A 3FEZA 2ZEJA 1B0PA 3S1TA 1K0VA 1GMWD 3WQTA 3ISZA 3OL9A 3LZIA 1O0PA 5AQLA 5J2PA 4KTQA 3CJ7A 4E7KA 1GT8A 1S9EB 2A2DA 2JH3A 3HHLA 4KH1B 3W5XA 4F36A 4XIUA 1UJ4A 4OKJA 1G6BA 4WK3A 3VGMA 3GFYA 5THWA 2XG8A 3MUTP 4IO9Q 2YPZA 4U7UK 4Q0BA 4KT0C 2BJ7A 2PD1A 5E3CA 5GADP 4M42A 3JS6A 1MN9A 2BRLA 2Y1LB 4B9UA 4LF7F 3SCXA 3H5UA 5CABA 3H5YA 3CMQA 4WBFA 1DLOB 4RJVA 5KFCA 3MECB 3TARA 1NRKA 3LDSA 1RAHB 2ZKTA 3K0JA 4WQ4C 4ZN3A 1YJTA 1Y7PA 4F2SA 4IUFA 4MO5A 1Q86O 5KFFA 4G9ZA 2X1FA 2OFGX 4BRCA 2BRKA 2XY6A 3MK6A 2QGFB 4E98A 4YEAA 2GW8A 5KFIA 2ROPA 3CJ2A 4MT1A 3BQ0A 4FYVB 1EX4A 4LH4A 1TYQA 2P5GA 4W5RA 4NMXA 4NZ0A 3S3NA 1NOYA 3NVKA 4UQTA 3O1LA 2BM1A 4E7HA 2XMWA 2IRUA 3O80A 1EKEA 4KY3A 3CO9A 3RAMA 3IC1A 2OA8A 1GLEG 2CGLA 3EZ5A 3FUYA 3U3GA 1S48A 3UR0A 1YTYA 1RT2A 1Z2LA 3DN9A 5FLXY 2Q66A 4DR2J 3DFEA 4IOAQ 4MJKA 5KFXA 1TAUA 4C8MA 4ZOSA 3TWZA 1KC8T 4CHYA 4W92B 4IOXA 2BYCA 4GV9A 2XS2A 3MFIA 2RT3A 4JKGA 2B4VA 2RDIA 3JSMB 1YK9A 1IQZA 1NGDA 1LWCA 1H7XA 5F0XA 1AXQA 4ECYA 4H03B 4DS4A 3DXBA 3PW5A 5KFSA 1WWHA 1QE1A 2FJWA 3RB6A 3BH7B 2JOQA 3DU6A 2XZWA 3CGIA 1LOTB 3K57A 3N01A 3M6WA 2NYHA 2ITMA 4OX9F 4AXJA 5H1SQ 4L76A 3L2VA 1DT9A 4XAKA 4FLWA 2IRXA 3HSGA 5DGAA 4CNYA 1M5HA 4WFAQ 2OYQA 2Y3YA 4DS5A 2V4QA 1GMVA 3EDQB 3D1HA 3HMJG 2FHMA 5HL7Q 4BR0A 2YQ3A 3RGIA 2ZVSA 2V2VA 5GINA 4ZPCA 1R8AA 2M5YA 2Q6CA 3W8PA 3ZETB 2GHPA 3MEGA 3P8BB 3KLFA 3QSIA 3M8PB 2H5JB 4WYBA 2HRUA 5HMYA 1H1VA 2CQ0A 2HHSA 3F5TA 2EFVA 3VQQA 4B9SA 1YITN 2Q1LA 2UUWA 3VMFB 2FHKA 2O4IA 2KHOA 4DTOA 4IZ9A 3GB0A 4OO1J 4ANEA 3D3BJ 2H1YA 5EWEA 1IBKJ 4DTSA 2GWKA 3FMBA 2DNGA 5D15A 1XMQF 2GA7A 3FZ2A 3A5LC 2P9UA 3CDWA 3L4BC 3HI9A 4NX9A 1UAXA 1S6PB 3G87A 5HROB 2CZ4A 1VSMA 4AL6A 4JBCA 1XUPO 1B64A 4J9SA 2AJQA 1VQ6N 5J2NA 3L2QA 2RF2A 1QJHA 4M5NA 3PYFA 1RKIA 4ZLPA 4QWDA 2W6KA 1LV5A 4LFBK 2F5GA 3UVJB 3QIOA 1RT6A 2LXIA 3IXQA 4RL1A 5AQFA 3NL0A 3QBXA 4P2FA 1Q9YA 3J7ZO 2L41A 3VZHA 1DJ0A 2M4MA 3NMUA 3H4BA 2C2EA 1B70B 2P8IA 1S10A 4KRWA 4CJPA 2FZKB 1FXDA 2OPPA 4JI1J 2KZZA 1T94A 4DR5K 3Q7CA 4K4YA 4B8CA 2LQ8A 1P6TA 2HNDA 1TL7B 3HP9A 3BO4A 3U8XA 4Y2CA 4USVA 5D6GA 2XQCA 2RDDA 1PC5A 4ERDA 3Q8YA 4IXCA 1VJWA 1BQNB 4FZXC 3NGIA 3D28A 3GYGA 1J27A 4RTFD 3TYTA 3HHDA 5F9LA 5EOYA 3OJSA 1KVKA 4OX8A 3BBFA 3EVWA 1JL2A 4LF4K 3DMJA 4LF9F 2CADA 2ZWPA 4JKFA 2GX9A 2NRWA 4JI4K 1IKYB 1HYSB 2EVZA 5I3UA 4FNHA 4YFUA 4N8NA 1RBUA 2KQ2A 3TQEA 2DT9A 5BJRA 4ZPWR 3M7VA 3MN7A 3PUFA 1IM4A 4YB7A 2PI5A 2BV3A 1VRUB 2YWEA 1K73O 3OFGA 3E51A 1N5TA 2VDIA 2BOAA 4OI1A 3HKZD 4X4TA 1WSJA 1J9AA 1IWAA 1VQNN 2OUGA 3BKFA 3THYB 4ZKAA 1C2PA 2LFVA 4TVAB 4CT8A 5B08A 1T3OA 3KK1B 1WHXA 1RTIB 4MH8A 2HHPA 1MWZA 3J80Y 2KG1A 3KLVA 3IN5A 4KREA 3FBCA 1U2CA 1N0UA 2OTJS 3OYGA 1REVA 4O3NA 4FJJA 4NA3A 1M5PC 1J5OB 4DSKA 1RAJA 3WXIA 2JZ5A 2ZGYA 3LL3A 1CPZA 3OYLA 4F04B 4NXNF 2X78A 3H5SA 1GLCG 4OZ5A 4UY85 4K0KK 2J9EA 5BN8A 4XH1A 1VQOS 3SCLE 3ZXWA 1KBRA 4DTPA 2RU3A 3ZTQA 1N33F 5F8LA 1ZBIA 3AQOA 3ITHA 3H3NO 1UVKA 3Q8PB 4RW8A 4ES3A 2YX1A 1K8KA 4DUYK 1U1LA 1BI4B 3UI3A 4CJRA 3VA3A 1BQMB 1O1WA 2LKZA 3IO1A 3N6MA 1BIUA 1Z6RA 2IPOB 3CD0A 2GV1A 2CQ2A 3JQJA 1HWJA 1KRPA 4IG0B 4FYXB 4H4OB 2OPRB 3C19A 2HBKA 1VQ4N 3QPIA 3P96A 4PQAA 3TZXA 4P73A 2P9IA 3HPOA 4C2MA 1Q78A 3HRGA 2IGIA 4X66F 1NDCA 3THXB 5LSRA 4B3RJ 3NAEA 5KFMA 5KFLA 3UDVA 1CJUA 2GMLA 3MD1A 2CPEA 4LMZA 1BMQB 3UB5A 1Q79A 4CF2A 4FXVA 2JLEA 4IQMA 1CJKB 2Z8QA 4AILC 4LR8A 3DLLQ 2F9TA 5IZHA 1VHFA 5D0GA 2QT7A 1HJRA 1T3VA 4BRKA 3VPZA 2OO4A 3W2VB 3PX6A 1KQSR 4USIA 3BGFA 1S1WA 4ZVOB 3THTA 2M0GB 2LLZA 3DOMB 4LBIA 1YVNA 4HH0A 2LQJA 4XPCA 5AQQA 3ULDA 5ETVA 4JI5F 4X62J 1RDDA 1GNKA 5EXWA 3SAHA 4FJIA 2OMLA 2KKHA 3ZNJ1 1E6YA 4QIGA 2B51A 5C12A 4LRAA 2CQIA 1U2RA 3ULHA 3NH0A 2AYEA 2O5DA 5KFNA 3FZLA 1U1QA 1GK8A 4IR1A 3TJ9A 2B56A 2QLBB 4G1IA 2V69A 5AT1B 3T3FA 4JNEA 4CZCA 1AB8A 2W9CA 4ZVEA 1KOHA 3F9MA 3V6HA 3MN6A 1NAQA 1IO2A 4DR2K 2BQRA 1KKHA 2K8GA 2D0OA 4IG3A 1EIYB 2QV6A 3RYLA 1U24A 1I39A 4H5NA 5AE2A 2WVDA 2Z57B 2R2SA 3V9UA 3I32A 4CZJA 4NLSA 3RAXA 3CCUN 4F4ZA 3M3ZA 4F2RA 3TTDA 4L74A 5KG0A 3OXFA 2F8MA 1Y64A 3L7OA 4B1XB 1DZ5A 2UXBF 2O1PA 3NCIA 3SJJA 3MXMA 4Y3CA 4B1YB 3Q24A 1ZPWX 4LJMA 1GH8A 3D1QA 2XCAA 3OYBA 1WLJA 3DRRB 2FGOA 2EK6A 3EM1A 1D9DA 1NK8A 5AJ3J 3OTEA 3MX5A 1RAFB 4XK8C 3CQ8A 2WK4A 4DV7J 3C65A 3GG4A 2L3MA 1IG8A 4PPDA 3V6KA 4PXCA 1MMNA 1NJYA 1C0UA 3JSRA 3A0IX 4DL7A 2WRMA 1T02A 4DUZF 3HHLC 5H9EK 3VQPA 5FPNA 2R7QA 1QS4A 2GQ2A 3OD2A 1QZ6A 3LOUA 2E9ZA 3DRPB 3OL6A 4I64A 5JVHL 5JUMA 1QSYA 1EP4B 5JLFA 1JJCB 4NXMJ 2OEMA 1UVJA 2EFPA 3LP0A 3P5TL 1I3OB 3T5KA 2G8WA 2G0CA 1NUEA 4PWUA 4DL3A 1U1MA 3M30B 5KFEA 5ETRA 5HSPA 3AVBA 1N54B 3HXMA 3OVSA 2I2YA 4BWJA 2PE8A 2HW3A 1IBKK 2YNGB 3ULEB 3DGVA 3FKBA 4BRPA 4FK2A 3BPDA 4CP5A 3TNVA 3UR3C 4J90A 3OV7A 2JNJA 4DSFA 2KO1A 1EKRA 2XI3A 4BRLA 1H7WA 1YT3A 4S0MA 2MKKA 3JTNA 1SL1A 1FJEB 5IT0A 4C8LA 3T9NA 4KH0B 2Z4PA 1BQXA 4CNZA 1RT3A 2POKA 2IBKA 2V68A 3K9KA 2A40A 5DO2A 3QERA 1O5JA 4QPTA 3D7SB 1CS4B 1WORA 4ED4A 4Y28C 2ZFHA 1T7PA 4YHHF 5HRPA 4JI1K 1U26A 3WUHA 4DZDA 4C3KA 1Z05A 2HFZA 4EK2A 3M4XA 3IM9A 4F50A 3H6EA 3M2RB 5JICA 1NGAA 5EX0A 4E8UA 5M1PA 2MLZA 3CD6N 3NDKA 4E2FB 4KBOA 1Q53A 2NPIA 4KRFA 2J5AA 5HLFB 3AV9A 2ZH1A 1N5VA 1ZM9A 2G8HA 2F8EX 3AA9A 1TKZA 3CMES 5KG2A 4DFMA 2GVZB 4HHHA 1S6QA 4FO0A 2NXUA 4AFFA 3TX8A 1FKAF 2DIVA 2MSTA 1V5VA 5KPZA 1TK0A 2C2KB 3D67A 5LJ5Y 3N4QA 1S6UA 2AJFE 4FBUA 3GL1A 3KLHA 4CLWA 1QTMA 4OGCA 1RDAA 3MMJA 1OVYA 5G0RA 2N3LA 2FJVA 1QVGM 3KHRA 2HSEB 3RW6A 2WVCA 2BEFA 4IJNA 2Z56B 4IDKA 3SUOA 4BROA 1OSCA 4CDIA 1S1UB 1HMVA 1C0TA 2W2NP 4DUTA 4EMDA 1JXVA 3I0RB 2L9NA 1HNXJ 3MM8B 2R7WA 2E29A 2UU9F 1MNEA 3DYAA 4H0YB 2UVWA 5B0GA 4FS2A 3QBCA 2GZOA 2PZSA 1HIYA 5ETLA 4H4MB 1WSGA 2N7CA 3P38A 5C24A 2OANA 3PRVA 3VTHA 4LFCJ 4BRAA 4CW7B 3W2WB 1SQEA 3F9KA 2V34A 2ZBRA 4F7VA 1QZ5A 1JCGA 2QIFA 2MGZA 3CCSS 2VQFJ 1SBRA 2E7WA 4DR4J 4Z0UA 2LA6A 4EFAC 2W2QP 3P6YC 3TAFA 5A8RA 3F44A 3I6PA 2A6MA 1K9MO 1ZXOA 1GEHA 3LPYA 4Y1DA 1HBMA 1QQOA 2FF3B 1JK9B 3L4QA 2C3PA 2E5IA 1U8WA 2GO8A 5C25B 2CWKA 3E01A 3C95A 4RW7A 1KDNA 4CLLA 1MDUB 3OTBA 4NE9C 2YTCA 3JYTB 3IA0A 2B6AB 4CJUA 4CM2A 2MHNA 3QRRA 3WHIA 5C42B 5ETKA 3UNGC 3RRKA 2J0WA 4IO1A 2ZJRL 3C7NA 3AVGA 2JEGA 2V2ZA 4FJLA 1JXEA 1X3MA 3G6YA 3KOAA 5IT9Y 1OS5A 2K06A 4B3RK 1F21A 4NLTA 1TQLA 3R8EA 2OI2A 2NLWA 3NGZA 1NWKA 4CLTA 2AJ0A 4HHUA 5D4LA 5DQHA 1PO6A 4TU8A 3NCRA 4NLQA 2FBYA 4Z4EA 2C2ZB 3DRSB 2YPYA 1HNIA 3E1YA 2W7AA 2EI5A 4EIAA 4DTJA 4Y1CA 4P72A 3DNCA 1JJHA 5JS1A 1TZ0A 2OZMA 1XNRF 2Z0GA 3ASMA 3QRPA 2RVJA 4ENOA 5B0BA 4JKEA 2HKEA 4NYZA 4QPXA 3BB5A 3BQ1A 2ZOFA 5IT4A 2XBPA 3K2PA 1TUYA 4X4UA 1XHZA 3PKMA 1IXKA 3ZZYA 3QSYB 1NJIT 1BISA 3H45C 2ZC3A 5KFYA 1RT7A 4Z2XA 4I2QA 3UKUA 2UUBK 1RTHB 2HVHA 4GRSA 5D0RA 5I4MA 1VK3A 4ZVUB 4LF7J 4YR0A 3R9LA 4KFBB 4W5OA 4Q45A 5BPLA 3GJQB 3A8EA 4HYKA 3E9OA 2QWLA 2WZ1A 2HS0A 2E9RX 1S1VB 3AJ1A 1QHTA 2UYTA 1H0HB 2WBNA 1YJRA 4I1TA 3VQ8A 3BDEA 1M90T 1X4EA 4I7FB 3BGLA 3AHPA 1FDAA 4I6AA 3CNQP 2ZUGA 1IKWA 1TK8A 2ASPA 5GAEI 4FWOA 1R59O 3TA1A 2YCHA 3L4IA 2HHUA 5JMNA 4ISFA 2IC3B 4LFAJ 2WW4A 2VYPA 4ANCA 3KK3A 4R0JA 2DEIA 3C14A 3CI5A 5L9XA 5LT5A 4YN3B 2D0BA 3AXKA 5HP1B 3CJ9A 5IWAF 4BACA 4K50A 4FWMA 1C4AA 3KFWX 5SUHA 2IVMA 3CCES 3VEOA 3VWSA 2XHBA 2R42A 2UUAJ 4I6MA 2YWHA 4ZN1A 3C6TA 3CCTA 3PM9A 5AJ3K 4PKIA 2AEMA 2O4GA 2B3TB 2P9PB 1S72S 3OSNA 3CJ8A 1RAAB 2GJ2A 1JCFA 2XGQA 3OR1B 5KFRA 1IBCB 2BACA 3LTOA 2VJVA 1V4SA 1ZS6A 1R0BG 1G7CB 4FJMA 4RU2A 4DX7A 3RB0A 2BVZA 2YKPA 3VEYA 2YX7A 1JLGA 3HT0A 5CA5A 4IKAA 4NEYA 3DLRA 2YHYA 1RAEB 4FLXA 1JIHA 3KLIA 4NXMK 2ILZA 2JL9A 1NKEA 4BG9A 4L72B 4CESA 2MDAA 4AUKA 4HWIA 4ED7A 1MA9B 1CEZA 2YKMB 1I94K 3M2VB 2Q79A 2FSKA 5M1OA 4E19A 3US5A 4LC9B 2MKJA 1W26A 1RADB 4ICLA 3SQ4A 4ECZA 1HBUA 2VL1A 4PG5A 1DRZA 2FVPA 4CO3A 5FRNA 5HOOA 2K1RB 1YI2N 2NS1B 3LF0A 3OBYA 4YR2A 4TLRA 5KGWA 1RTDB 1DGKN 3AD9C 4MKVA 5LOQA 1NPRA 1TL3A 2VZ9A 2YNIB 2XS5A 4WCEL 4TN2A 5EGYA 3D6HB 3NNCA 2CPDA 3O9SA 1PYSB 3CERA 3DI6B 1HR0J 4M3ZA 1XK8A 3T5HA 5GADI 4B3SJ 1FKPB 1ROFA 3QGGA 3ILJA 4N77A 2LQBA 2E7VA 3E9LA 3S3MA 5TKYA 1KS2A 4JI2F 2G8KA 4YORA 4CHZA 3CC2N 3GR1A 4EO6A 5U47A 1S4EA 3MCPA 3TAEA 3OJUA 1Q8BA 2VJUA 3CJTA 4GKKF 2X1GA 3WC0A 2IOCA 1N32K 2QFIA 2MSSA 2XY8A 2LCWA 3D0IE 3VN5A 5FDLB 2YNHB 1FTRA 4OYAA 5LMNF 2ZH4A 5L1LA 3NMRA 2PA3A 4Q7AA 1Y3JA 3TQ1A 2O8DB 3BF3A 5L9NA 4GC6A 1A9NB 2CXEA 1HBNA 3PY8A 4TLQA 2CPFA 4LRCA 3FBBA 5JVGL 2ZQBA 2YQ0A 3SDEA 2HNZB 2V8GA 2DNMA 2D4WA 2AJ4A 3OS2A 2ZE2B 4HACA 2CDQA 2NRVA 1C6VA 3BBCA 2BE7D 3CJ4A 2MQQA 2DO4A 1VQSA 3M8QA 1HNXK 3W63A 2O8CA 2QLJB 4LRBA 4QS9A 5CYQB 2E2PA 2CAJA 4U67Q 2FIUA 2DNKA 1RHJB 4KHNA 4OL8A 4DF8A 2IVFB 3L3VA 2Q0RA 3NOGA 2KFZA 4DHVA 2P9GA 4J91A 4UF4A 3SFUA 1YSJA 3T41A 5IM0B 5E33A 2VGMA 2KM8B 3O6QA 2F65A 2WAQD 3VGVA 4CI6A 2HVEA 4FJ8A 4QR2A 4OJ1A 2PYJA 3BR9A 4K2XA 3MXHP 4YB1P 2VQFK 1V4TA 3PCOB 4J9VA 3P3DA 2KXNB 4CM0A 3LGNA 1TKXA 1RSCA 2HEKA 4HUFA 3HP6A 4YY3J 4G1QB 4ITSA 1OY6A 4DV5F 2D3OR 5AFUH 1F60B 1VI7A 3UQSA 2Y8YA 3CIPA 5AQZA 4RBUA 2HGLA 3KJNB 1KLMB 2DHAA 1VSJA 2CNOB 4M3UA 4ZPTR 1XBWA 3CQXA 5C0YA 2WVFA 3GIMA 1RCHA 3E9PA 3UN2A 3TOQA 3W66A 2P9SB 4BREA 3LPTA 4JV0A 4JI3F 4FYWB 1MSWD 4NXNJ 5DDQC 3F2KA 1WJ9A 5HRRA 4DV3K 1XTZA 3RJMB 4F3MA 1H38A 2G8IA 3IS9A 4AHSA 3AVHA 2O8FA 1FF2A 3OYNA 3QICA 4FDFA 3WNFA 4DFJA 2KDOA 2MQLA 1N33J 1DY3A 1B3TA 3KHGA 3UO0A 2JDJA 3Q22A 3HSZA 2O8BA 4A46A 1I6JA 3ZX2A 2GNKA 3CWJA 3V81A 1RDUA 4YDUA 3AVMA 3TANA 5E5NA 3L6QA 2NXCA 1U6FA 4NRUA 1Z26A 1X5TA 1TGOA 1Q95G 2NRTA 1N88A 3JQMA 3HCXA 4KC5A 1VR6A 4ZCIA 2DNHA 2RRAA 3MM9A 1HNVB 3OTOJ 4LF7K 3PR4A 4F02A 2CNLB 4CD3A 1SKSA 3TAMB 5AQWA 3PW4A 4X66J 3EEQA 1N5YB 2X6NA 5BPNA 1YJUA 3TSPA 8ATCB 4ANDA 4FBTA 3KLEA 3N9UC 4HI1A 3ZEUB 4M63C 4RW6B 2I5JB 1WC1A 3O5BA 1B0VA 2VG5B 4NI2B 4J9QA 1SQKA 4J5OA 4CHOA 2FUG9 3PIOQ 3Q2SC 3G6ES 2VFUA 1CULA 4EEYA 2DGSA 2ZDOA 2EFQA 4RR5A 4LFAK 3CCQN 3SFGA 1Q8IA 4USHA 2FLPA 3M32A 3G82A 4JI5J 1WC0A 3BGRA 1U1NA 3S01A 3TRGA 5AXLA 1MU2B 4AYBD 4MLHA 3K8VA 3GQCA 3BZCA 2E2NA 1KQSM 1QTNB 2YJFA 3HZ6A 1S9EA 5GAHP 3CMAS 4LH5A 1V3ZA 5HO4A 3NF6A 3VQ9A 4OHWA 3OYEA 2UUAK 3DDKA 1RAGB 2YKQA 4KI4A 2PMZD 3QIPA 2ASJA 2KH9A 2H4YB 1Q8KA 2YWWA 2QE5A 4JV2A 2O3DA 4LR7A 2R7SA 2EG2A 3GSDA 3LH2S 4K2JA 3QLHB 1IKXB 2GAGC 1GOAA 4DOZA 2EWSA 2NUUG 3MECA 1RTJB 4K4ZA 1YRUA 1FXRA 2UV8A 1UFLA 1Y3KA 3GG1A 3TZYA 4ECTA 4DV1F 1XR7A 3CCJS 3MOJB 1U45A 4CEEA 1X4FA 2WSFC 4DR1F 2UXBJ 1U47A 3QJJA 4AHUA 1X5OA 1F1BB 1IQTA 3MR3A 5D0EA 1GQEA 1RWWB 2KJWA 2YX4A 4OZNA 2J6TA 4DPOA 4K4TA 3LUYA 1WN7A 1T03A 3CDEA 2HF4A 3BDPA 2PMHA 2A41A 4FWNA 3QEXA 1VSKA 3HZGA 3SIPB 3MM5B 4M5DA 3J81Y 4ES1A 4B9VA 2RILA 2GFFA 4ETZA 2VUGA 4LSZB 4USKA 3OYFA 2F4VK 4I2PB 5GAEU 1JX4A 2DRBA 3FGVA 3NG8A 1R6VA 4B1WB 1JKHB 1CZ9A 2CVIA 2KYZA 4DUZJ 2VQEK 1AUSL 3X1LB 1L3TA 4KHUA 1C1BB 2DGXA 5GMEA 3AVIA 3W61A 4JV5F 1C0MA 1YX2A 2NZ4A 1D09B 5F8HA 2E88A 4FYDA 4ZVHA 1TKDA 5EUHA 1IG9A 3NOCA 1VSIA 3RB4A 2NRXA 3FVYA 1HR0K 3E8OA 3HFVA 1FDDA 2R8JA 5KOWA 5JJBA 3J81j 4BRHA 2BW2A 4B3SK 4FLTA 3B54A 3ZT4A 2OJ3A 4JRQA 2XZTB 3DC2A 3Q8QB 2XMMA 3T6JA 4EBDA 4OJ3A 1JJ2R 1HWIA 3ZFVA 2F63A 1NEEA 5KG6A 1UCNA 4Z4HA 2J4RA 2CJQA 1MWQA 2VB6A 3CB4A 2MTLA 1MN7A 3NRBA 3U4LA 2HHHK 2WSEC 4CVNE 4U95A 1WB9A 3M9NB 1B9FA 3TX0A 3LALA 4BVOA 2HFSA 2AYBA 4DQQA 1M5OC 4E1JA 3N6LA 2B9EA 2FY8A 4CJ5A 3W64A 3VCDA 1WD6A 4NASA 2VG6A 2LSNA 4ZDNA 5J1EA 2RKIA 3KLGA 3ALYA 1D4XA 1X60A 1FNMA 4BE2A 4O44B 5KFPA 2NSBA 5HANA 5BR8F 2Y0BB 3A3NB 1LQ9A 4YOXA 1VQ5N 1VQ9N 1CJTB 4KO0A 4IFYA 4YHHJ 4DL2A 4FVUA 2HIYA 3BP8A 4FPRA 4IFVA 1W97L 3ELHA 1KVAA 4LF5J 2CJXB 3RTVA 2GIFA 3VAHA 1F9EB 3C8YA 3C94A 2OAUA 1HQUB 2IS3A 1P8ZA 3I0SB 1OH8A 1G1XA 3MFHA 4J9RA 1DQ9A 4ZVFA 3ET6A 2WVEA 3M05A 1YJWN 1FJGF 3JXOA 3HLUA 3NWRA 2GX8A 4YS2A 4PL8A 1DTQA 2LMIA 3AJDA 1MROB 4FJGA 2E7XA 3U6FA 2UXCF 3D4JA 2HHXA 3V1QA 2CPXA 2OSQA 1CC8A 3T1YJ 5GADU 2Y1JA 2QLXA 4DU4A 5K8PA 5AQUA 5F8MA 2XY5A 2RIJA 3V9WA 2BJEA 4YY3K 3OL7A 4OPKA 4OV1A 1RGVA 4CEOA 3CULA 5A0YA 2ITGA 3VZIA 5ETSA 1OPZA 4B3TF 2R9LA 1HFEL 3TJAA 1FE4A 3ICLA 2XSFA 4LREA 4CLFA 2GJFA 4GVBB 2OKQA 2R7RA 4NCGB 3MCSA 3P5BP 3JTPA 1XJWB 1Q8LA 3OL8A 2GVDB 2CQ4A 2FDNA 1UEKA 1XR5A 3T5JA 3WNHA 1DFDA 1S1TB 3G10A 1BQNA 3GR0A 3AH6A 1NGHA 3EDRB 2H5IB 3E66A 1RT4B 3MMCA 4PKGA 1RDWX 2V9WA 2ZZTA 4FF2A 1Q5YA 2G8UA 2ILYA 5J2QB 2MQMA 2KT3A 2DJWA 2UVRA 4RX6A 4QAGA 4AHRA 2DISA 2VPXB 2IAJA 2KXFA 4J2AA 3CF5L 4FLUA 4P71A 1UWBB 5A2QY 2X3GA 3OLAA 1S12A 1BUPA 3CD7A 3J7ZT 1ZTWA 1R8BA 2CQPA 1AZSB 4L3QA 4UOGA 1WG4A 2MZQA 2YBVA 4FWLA 1EETA 2AWZA 3UN5A 1XC9A 3I82A 2VA3A 1DAXA 2W7OA 1XNQF 4NA1A 2CKWA 2ZGZA 4JI0J 1ASUA 1X4CA 2MLYA 3H3OB 3OTOK 4CLKA 4CF1A 3WQPA 1ZTTA 3R5GA 1VGYA 3WZ0A 4I68A 1TFYA 1CBKA 2L9DA 2ZZMA 1X4GA 4MK7A 4M5LA 1FA0A 3DLHA 4R79A 4CIEA 3PO5A 3AVLA 3L09A 2AMCB 2E5JA 3R6LB 4H5VA 2PO4A 4USMA 2V94A 2OPQB 3RG6A 3TPQA 2DCLA 3RBEA 2EKYA 4YOVA 1WF1A 2HAIA 1W9HA 1NPPA 5I42B 1XNRJ 4Y2KA 2QZ8A 1ZC6A 3S8SA 4Q2MA 2V52B 2ZITA 1FFGB 4TY8B 2FQQB 3EZUA 4RUCA 3HSJA 2W9AA 2RQMA 4BS2A 4PWDB 1S0OA 3RB3A 2CIMA 2V9KA 3SMPA 4TKTA 4ATNA 1UW4A 3B82A 1BWEA 4PCQA 2ZBPA 4KHPF 2ZJPQ 4JK7A 1VIXA 2MZJA 2ALYB 2GV9A 1Q7YT 2Z2LA 1BQMA 1NDKA 4JD2B 4TXSA 4J9UE 4DV4F 1SL2A 4QIVA 2IJNA 4DTMA 2QTWA 3ZT1A 4CZKA 2EG1A 2OEKA 2R4FA 3NP5A 2IDOA 4U8YA 4H4OA 4AL7A 2OPRA 3A8YA 1WOSA 5ITHA 4LSNB 1OIAA 1VC5A 2BJ1A 2FC9A 3QGIA 3QBWA 3G0ZA 2XMJA 4ZJQA 5JMVA 5AQIA 2AGOA 1EX8A 4UZBA 2DR5A 1YVUA 3QT7A 4WF9L 2F8HA 4DV2K 2BUNA 3H20A 3OT9A 3DGPB 4DN0A 4P2XA 4TSXA 4BC3A 2WW8A 3R5JB 4B9MA 5H9FK 4DDFA 1CJKA 3P4IA 4IH5A 2XTJP 5IWAJ 2JEFA 3WBZA 4BC5A 1JLAB 1HBOA 1Q1KA 2ZJQL 5AE1A 5HVHA 3F73A 4PZVA 5IC4B 3VQAA 2G2YA 4OHVA 5D4NA 3KNGA 1FFWB 4URQU 3DOMA 3W7BA 3ZTPA 5B7WA 5EN1A 5BRDA 3I5CA 5LJVA 3O2IA 3CW2C 3VTIA 3NGTA 5MAOA 1SC6A 1FRXA 3DHWC 1S5ZA 4PABA 2P5OA 1WDTA 4DCPB 2V2KA 2JHEA 1U8SA 3ONQA 4ZIWA 4FOEA 4YDUC 5CH7B 2E5GA 2QW9A 3KK2B 5LJWA 3NKYA 2EC0A 3CETA 2E5LK 3AVFA 2LEAA 3IMQJ 1LWEB 3TUIC 1HNWJ 4PWWA 2QMXA 4J9LA 4I9QA 2FZCB 4B1VA 2KT2A 2RUSA 1NXIA 1LNQA 1NJZA 3BYRA 2ZBCA 5DGBA 4B3MF 1W2BR 3TR8A 3KG1A 3ZZTA 4E7JA 1VQNS 2HK2A 2K3KA 3ENVA 3NGRA 3ZZUA 2M52A 4E89A 3IUCA 1FVQA 4OPHA 5LL6Z 3ISNC 5FIIA 3DJCA 5AQYA 1UPPA 1RWNB 5IQQA 4BRDA 2W01A 4KV8B 2DPNA 1UJ5A 1S4FA 1Q9XA 4WJBA 5A8KB 4IH7A 3VQ5A 4RNMA 4CFAA 1E3MA 4ZLLA 3QEPA 1X4AA 4KKOA 1VFJA 4A5AA 4LQ9A 1RDBA 1RLCL 2FGCA 4F3OA 4HDGA 5KT3A 2W8LA 4IH6A 5HVGA 1RZMA 3H1QA 4CJ7A 4I67A 4K59A 2AYGA 1H3DA 1S59A 5ADZA 4BR7A 1NKBA 4JKAA 1BUXA 2OCEA 4CJ3A 5DJBA 4BLGA 2HHQA 2IY5B 4LF5K 2YI1A 2QWPA 1YBUA 2EHGA 1HD1A 4JI2J 1RWPB 2PEHA 4EYIB 4AE5A 3EZWA 3HM8A 3DLKA 3N6NA 3M30A 1OH5A 1LWFB 1WBDA 4GKKJ 3GWCA 3DXMB 5DLGA 5C7PA 5KT5A 3MUMP 5A6PA 2VWBA 4KH6A 4NYNA 5RUBA 2YNGA 2UXDJ 3L7UA 4PKDB 4JKBA 4NLOA 5LMNJ 3THWB 1TK5A 4HVZA 1GMWA 2H51B 2PN6A 2R7OA 1VQ4S 3M9OB 5L1KA 4FJHA 3MEDA 2AX0A 3T1YK 1TUWA 3JAMU 3PKYA 4CZIA 4CGIA 2XI2A 4CF9A 2L48A 4R8UB 3KXDA 2NLXA 3D6RA 3PIPQ 1QVFM 4J9KA 2C2DA 5AQRA 3PDNA 4JHDA 2GGPA 3PRDA 1CS4A 1BDGA 4CHNA 2J7UA 3SI6A 2H5EA 2MKCA 3BKUA 3VAFA 1AW0A 4B8AB 2QKBA 4WZMA 5LY3A 3MM6B 4LF8F 2JJ4D 4DPWA 5B0DA 1VQLS 4GVMA 4QR1A 4Y0WA 4BCAA 1KEKA 1Y10A 2MQ8A 3HK2A 3NCPA 5DZ7A 4ZPBA 1U6BA 4O8KA 1R8HA 4CZHA 1ZETA 3D68A 1XMOF 3O6WA 5HBMA 3CCVN 5J2PB 5JVHQ 2ZM6J 3NNAA 3MWBA 1YJVA 2ACYA 5EWFA 4ED8A 3CPWR 1E4GT 3TTCA 1NM2A 2N82B 4IOAL 4DHYA 2CQGA 3UN3A 5M2RA 4OZ0A 2W7PA 2W41A 2KU7A 2V51B 2Q31A 1UVIA 2R8GA 1C0FA 3Q7BA 4BGBA 3GE1A 3VEWA 1FRLA 4UTGA 3PEJA 4MFBA 4MQ3A 3BN7A 4JRPA 3PLAA 1LEOA 3R97A 5SZTA 2CH6A 1PG5B 1RWVB 3GPAA 4KAZA 2ZDPA 4B9LA 3ZT3A 3CCUS 1SQGA 1VOMA 4OQJA 4ZIVA 3I0RA 5J2MA 3WXLA 3D6MB 2QL7B 3TVYA 3RSEA 4JI0K 3Q8UA 3MEKA 5D0HA 1TVRB 4F4YA 3C15A 4OYIA 2K7KA 4H4MA 1R0AB 3ZZ0A 1DKGD 2XHCA 4Y2IA 5GIOA 1QQCA 4K7QA 4BRGA 3W2WA 2ZH9A 4V19J 4KPYA 3KDOA 4XO0A 3W1YC 3CCWA 1UZDA 4Q44A 4FKXA 3GSIA 2D41A 2W4CA 5IS2A 1KVJA 2V4RA 4J8FA 5KG5A 3HF5A 1ZBTA 2V6AA 3BSCA 3NVMA 2W2OP 1N34J 1HX1A 3T1HK 4A2BA 4FCYA 3U1MA 1XI1A 2QXFA 5AQOA 1JLFA 2GQCA 5EHHA 3FFIA 1U1OA 3AGKA 1WTFA 5KRTA 3KJVA 1Q7LB 1NM1A 4ID1A 3PSFA 4OZJA 1LWCB 3R7BB 3PHEA 5C42A 4WPAA 1HWUA 2MY7A 1ZZNA 4BDPA 3EPGA 1RU2A 4CIFA 4NLVA 2EFOA 2D9OA 1SKWA 1QE1B 5EWGA 1CXUA 1SL0A 1V3RA 4C9DA 3SSQA 1RHQB 2CJYB 1NU0A 2HNYA 3IG1A 1IV0A 2O01C 4NLDA 3I55S 2B5JB 4B9TA 3DRSA 3QETA 4NLUA 1VQPN 5CCLA 3PX4A 4KH5A 2FB0A 2DY4A 5AZIA 3AODA 4QS8A 3FMWA 4IEEA 5IWAK 3W9IA 2NXNA 4FJKA 3SSRA 3KMQA 5EVZA 3J7A1 3L2RA 1O8BA 1SUQA 2WBRA 4CIOA 1PCAA 3PZPA 5EX5A 1FVSA 4Z4CA 3GYNA 3O3LA 3R6GB 1F5BA 3BKTA 3THPA 1RTHA 1VBYA 4UOFA 1TKTA 3LPUA 2FVQA 1J5EK 2HWHA 4B1UB 3MEGB 3KLFB 1JLCA 4KFBA 4ED2A 2V7ZA 3CMAN 4A8OA 2J7KA 4XDDA 2I8EA 1SH2A 4DQSA 2RN2A 1WNSA 2BXJA 4FPAA 5K5MA 3AA2A 1TV6B 2HQ3A 3GJTB 2DGOA 2QL5B 2Z1HA 3BM7A 3GV7B 4KH4A 3OR2A 4I7FA 3BPSP 3HVAA 2UUCJ 4ZVPB 4K4SA 4FLVA 4M1KA 3EMTA 4K4UA 1HNWK 3HOTA 1NHUA 4DR1J 1J53A 2P9CA 2P9UB 2DITA 1HL6A 3OA9A 1SIWB 3ILOA 3R3LA 5AFUA 4BC2A 4DR3K 1RA7A 2E1RA 2PDAA 5J2NB 1RWOB 2RF2B 2ZJRQ 2J6SA 2ACMA 3AAPA 3UD4P 5DDRC 2CJBA 1T05A 1OSDA 3CM6A 2DH9A 3PO4A 5HP1A 4E3SA 1RT6B 3KHLA 1ITGA 2HFOA 2AGQA 3SK3A 2DVIA 4QYRA 4LR9A 4IBNA 1PILA 3B78A 5ADXA 1RFQA 2CQBA 5AQTA 3POTB 4GKJK 2ALZA 4JV5J 3SV4A 1Y11A 3HOSA 1IR0A 2VIHA 2P9PA 2XO7A 4JI8F 4ELTA 4CGHA 5KAKA 2DNZA 3PR5B 3TA2A 2QTDA 2VPWB 4J2BA 5IT9O 1U02A 1P1LA 3I33A 4HHTA 1XHXA 2DHHA 2GCFA 2AQ4A 5ELZA 1UWAA 5FPEA 4RWXA 1BU6O 3L2UA 1SC4B 4DQPA 1WHVA 4QWCA 3SPYA 3ILLA 4DU8A 1T44A 3DMJB 2LXFA 2OMOA 4PXEA 3TVZA 4ELUA 1PYTA 5IC6B 2BE2B 2QA4N 2Y0SD 1WKLA 4JI2K 1K8AO 2BJ9A 2O67A 4PG4A 1A7GE 1LCUA 5F8NA 3FSXA 1JJ2M 3GP9A 6FDRA 1EQYA 2RHKA 3QAUA 2NZTA 1LOUA 1T0TV 3UFCX 3H2LA 4H4KA 1WOQA 3CDUA 3MURP 2UXDK 2B9YA 1CJVA 1KAYA 4O55A 3VOVA 3ZSQA 2B7BB 3FCWA 2MQPA 3W60A 3SUPA 1UVLA 1C1AA 3IFEA 3B4DA 3GJSB 4DSEA 5BR8J 4W90B 1UVNA 1SJRA 4IRDA 3B6OA 2VH7A 2A18A 4BDZA 3SBTA 2D69A 3W8GA 4DR5F 3GIJA 1L3UA 3AO5A 4FP9A 2G8VA 3C6HA 1FO1A 2ZWOA 2IMOA 1REVB 2HLUA 2VPZB 1FKOA 4KHYA 2VASA 4Z7CA 3VF6A 5M1FA 4W4MA 3O9TA 2GS8A 2DGUA 5KG7A 4QIWD 4ZCMA 1FKPA 1FX2A 4DV0K 4OKEA 5LMUF 5FJ4A 4JEPA 4C98A 4LF4F 5M1KA 1VQ8N 4JI4F 3H08A 2UXCJ 2OTLN 2FSNA 2KTQA 1WG1A 4CFBA 2QG9B 1NHVA 4QIEA 3GILA 1NGIA 3M1FA 3OHBA 2HG4A 2ZM6K 2XNRA 3IRWP 4JI6J 1UEUA 2D0CA 4LIRA 3VGTA 4CF8A 5FDLA 1U09A 2NUHA 2YNHA 1R27B 2GELA 4HTIA 4B08A 1UFWA 5ETOA 4XH4A 3ZX3A 1PAUB 4B3TJ 4WXWA 4ECWA 1VIOA 3NFAA 1U1PA 1VC6A 2HOEA 1RT1A 1QUVA 3D9BA 1LW0B 3DXKA 1NU4A 4X65J 3QIDA 2P9IB 4HKQA 4FJXA 1T95A 3PX0A 1URNA 3VF2A 2G8FA 2AD9A 2N7YA 1FJCA 2ZOMA 2HBYB 3VQCA 4IYQA 3ZSZA 5AQVA 2BR0A 3SAFA 5CYQA 4HT5A 3G6VA 1DBDA 4AH9A 1B7YB 3I5BA 3P39A 3A12A 3CQYA 1SKUB 3PV8A 2KYXA 1VQMS 3AA3A 3FZBA 4CO4A 1OKJA 1RBRA 1HNZK 1PBUA 1YRTA 2ADBA 1WSIA 1S1WB 1EWRA 2GTDA 2V5HG 1HQEA 1F0XA 1RU1A 4QBUA 4EUVA 3TUPA 5DG9A 1RYRA 4KHRA 5EU7A 4O0JA 1V6HA 1JXLA 1E6YB 4MIWA 2WB4A 4DUYF 4KIAA 2RHQB 4D3GA 1YIJN 4NWBA 4DR6F 4CIGA 4ZCLA 2ASYA 5CQGA 1KQKA 2DFFA 4FVCA 1S1XB 3QWUA 2DNLA 1S22A 2E66A 2GO9A 2A10A 1BGXT 4P75A 1N34K 3BO2A 3G8SA 4I0WA 1PJ7A 2XHWA 3EKUA 3H2UB 3I9V9 3Q23A 1KONA 4IG3B 1SQFA 3HULA 5B09A 5L1JA 5LM7E 4HTJA 1VRTB 3D2EB 1WKKA 2G0IA 1IVZA 2JVRA 3BUZB 4O4RA 3PRBA 2KKZA 3CCMN 4OIXA 3Q86A 5JVGQ 4DQIA 1T8EA 4ZLNA 1AUDA 4DJBA 4K4XA 1YI2S 3EE8A 2ZNZA 4C4WA 2LU1A 5CXTA 4LF6K 3FNNA 4K41A 3EJMA 4Q8FA 4NLCA 3BF1A 3CG7A 1GXUA 4BC7A 3GONA 3O9RA 1W2IA 1D8ZA 5IQ6A 4YUDA 5CYMA 5C2CA 2YKNA 2P5VA 2RMLA 5KT7A 2QJ3A 5DM6L 2VKRA 4KHPJ 3DLGA 2C42A 3IFRA 3MMBA 5JLHA 3N5BA 3D6TB 1C0UB 4YOEA 5CZ1A 2FHJD 4DV4J 2X51A 1YHQN 2CFXA 3PYDA 2QL9B 1HW8A 3VGUA 4DR7J 2NPFA 1I1GA 4ILRA 4ECUA 3VF4A 1TL1A 4ZP9A 3EUNA 2XMUA 3CC2S 2AZ3A 3K9JA 3DM2B 1N5YA 1GX6A 3LP0B 4X4OA 1KR4A 2I5JA 4JI7J 2LDIA 1SAZA 1I5OB 2UUCK 2VG5A 3BSAA 4NI2A 3DKDA 5DG8A 3BF4A 4QIFA 3CC7N 4P6QA 4UOHA 3ZTOA 4MAKA 2CGKA 2Z2YB 2FLLA 3LAMA 2ASMA 3QQCD 1TR0A 2HQIA 4CBXA 2G1DA 3O8MA 3M5RA 3VGLA 4BRMA 3EGNA 1V3SA