2VG5A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
557
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 144
structure length 551
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg5A05
2W9AA 4F50A 1T94A 5D3GB 5EWEA 4WZQA 4B9LA 1OS5A 2P51A 3QO9B 2W7PA 4MK9A 2YKMB 4WFYA 2IJFA 4RU9A 2B43A 1TAUA 3THVA 3ALYA 1QQCA 3H5XA 3QGIA 3K59A 4M95A 5KFQA 3NKYA 3QEVA 5T7BA 4URQU 4FS1A 1RBSA 3RR7A 2UUWA 3PX6A 4FJXA 4DL4A 4J2AA 4CJQA 1RAJA 4IKAA 3LZIA 4TYBA 4DL5A 4NLWA 2BDPA 1S6PB 3GV5B 3PR4A 4CF2A 3RB6A 3L2QA 4KB0A 4O55A 4FJ8A 1KFDA 5C24A 2QV6A 2WONB 2E9TA 4YR2A 3EY1A 4WXOA 2OPPA 3V9UA 1KVBA 4R0EA 4IH7A 5KFXA 1HRHA 2JEIA 4Y2CA 4E7KA 1SUQA 3JYTA 4IG0B 3O3HA 3VQ4A 2AGPA 4IRKA 4YNQA 2YNHB 3G10A 4M3WA 1WSIA 1BQNB 3WNFA 1ZTWA 3E01A 2Q3SA 1RT3A 3L3UA 1UA1A 4BE1A 1C0UA 3M8QB 4K50A 1CSJA 4Z4EA 4NLVA 2IM1A 4ECUA 4C8MA 3K5NA 4RUAA 3MECA 4E7IA 4M3ZA 3BDPA 4E0DA 3LP2B 3K5LA 3SQ2A 4DTNA 3ZT3A 2HNYA 4IKFA 3SV3A 2XY5A 5KFWA 1HNIA 3MECB 3CJ3A 2DFFA 3ZT0A 1Z26A 3PW5A 1LV5A 4CJRA 4DG1B 5F8LA 2O5DA 1FXXA 3TANA 4RNNA 4EEYA 5E41A 2HNYB 4CJVA 1IM4A 3V81B 1TKXB 1LWCB 1EXQA 4G1QA 3OYJA 4M45A 4K4ZA 4LH5A 1RTIB 2XC9A 4CK3A 3KK1A 2XI2A 2FLNA 2DFEA 4FW1A 4QW9A 4DF8A 3M8QA 2D5RA 4IRDA 4ZPDA 1SKRA 4KHSA 5HLFB 2X78A 3AVKA 1IKVA 3K2PA 3MR3A 1W25A 4Q0BA 1S1VA 1S1VB 3KK3A 2ILZA 1S49A 3KKRA 3VQ6A 5KFAA 4IRCA 3I5AA 5KT4A 1LW2B 4RNMA 1TL1B 1B92A 3DRSA 1D9DA 3TARA 5KFYA 4ELUA 2B6AA 4BE2A 1RT1A 4EP4A 3NBPA 5HP1A 1F21A 1IKVB 3MEDB 3TR8A 2UVRA 3RBEA 1TKXA 1KCFA 4O5BA 4CECA 3GIIA 1ASVA 4G3IA 4NLQA 3D45A 4N5SA 2Y1IA 4FJ5A 4CEZA 2YKMA 4PUOB 4Y1CA 3VQ9A 3AVFA 4KKOB 4F4WA 1EP4B 3UQSA 1S1XA 4NRUA 2V0NA 3NGIA 1QE1B 5L1IA 1S4FA 1VSEA 3N6LA 4IFVA 4DG1A 3H40A 4ID5B 3AO4A 5JXSA 2IM2A 4KHNA 2R8HA 2OPSA 3MXJA 2KW4A 4CF0A 5C25B 1RTDA 5DQHA 4Z0UA 4WYLA 3SPYA 5J2PA 1D5AA 3RMAA 1UA0A 4ED0A 2JLEA 1LWFA 3DLEB 4RW9B 3V1RA 4N47A 2G8WA 3PW0A 3IG1A 4IFYA 3ZSOA 2UUTA 3MAQA 4CEBA 4FM1A 2AJQA 1LWEA 4LQ9A 4DU3A 3CJ0A 4C8OA 4M3UA 4GMJB 5CYMB 4J9LA 5C24B 3D5MA 4MKBA 4FBTA 1VSFA 3O4NA 3DYAA 1NJZA 4DTMA 2BQRA 4FCYA 4DTUA 3CYMA 3OS1A 2BANA 1S9EA 1QTMA 2XRIA 3DOKB 1TP7A 4K4WA 3SV4A 5KRSA 4EBCA 2JEFA 3OS2A 3DLHA 2BRLA 4AHTA 3HPOA 1FKOA 2HMIB 3LP0A 4DTJA 4R8UB 1JLEB 5KTQA 1HQUA 2RKIB 1NJXA 3NDKA 4HHTA 3MEGB 2VWKA 3QZ8A 4AHSA 5HP1B 3CO9A 4LSNA 3P83D 4Q5VA 3WNEA 3H59A 4PQUA 4XPEA 3ASMA 3KOAA 4JLHA 3DDKA 3RAXA 1D8YA 3DLGB 4CEEA 4QWCA 4M3XA 4FZXC 4B9UA 3KHRA 4N41A 2BRKA 3KK3B 3SI6A 1JLGB 2O4GA 2YKNB 1ASWA 1WN7A 4IG3B 1IKYA 3ZT2A 4CK2A 1HQEB 3CJ5A 3DI6B 5KT6A 4DTRA 2GIQA 4MFBA 4CHZA 1C0TA 4ECXA 1MU2A 3KK1B 4URGA 4O3OA 3MR2A 3NAEA 4GC7A 4FK4A 5J1EA 2IDOA 4ZTJA 3V6JA 1HYSB 4JRPA 5HRNA 4DS4A 3LP1A 1U49A 3BQ0A 4KO0B 3UPFA 3AVGA 2WTFA 3NH0A 2RPIA 4CGDA 5DG7A 1U04A 1RTJB 1C0MA 3TWHA 3UR0A 1VRTA 4M3YA 2PYJA 3BSAA 2YV0X 2X74A 5DQIA 1HQEA 4CEAA 2OPRA 3OYAA 3TAFA 3HHKA 1TVRA 2WRMA 3NAHA 5KG4A 4JS5A 4O4GA 5SZTA 5EWGA 1SH0A 4FJNA 2Z1IA 3BQ1A 3OSNA 3E01B 3PX4A 2IJNA 2RF2A 3LPUA 3S3NA 3IRXB 1DTTB 4NLPA 3LP0B 3DMJB 4NCAA 2ALZA 3DM2B 1IKXA 3QIPA 5KFBA 4IR9A 3E51A 2BGGA 3TVKA 4XO0A 4FJ9A 3EZUA 3DOKA 1VRUA 4J9RA 2FVQA 2ETJA 3RWUA 4CEOA 1WNSA 5F8HA 1KRPA 4X2BA 1VRUB 4ZHRB 2VG6B 2FVPA 4TQRA 2B4JA 2IC3A 2R8GA 1NKCA 1CLQA 1HNVB 3VQ8A 3QEXA 5L1JA 3CG7A 1S6QA 2R2RA 5F8NA 4DQPA 4K8XA 1JKHB 1L3UA 1DLOB 2ZQBA 4W5TA 3IGVA 1KFSA 4DSEA 4CJEA 3K5OA 3DMJA 2VA3A 2CJQA 4F8RA 1N6QB 3OLBA 4CJTA 3OVNA 4ZVHA 1T7PA 3MEEB 3BSNA 3ZT1A 1NJYA 4ID5A 4O4RA 5D3GA 3PUFA 4KHYA 3AVLA 3OY9A 2G8KA 3AVNA 1RBTA 4B8CA 1U4BA 3SJJA 4DQIA 1HARA 1GX6A 4CHNA 4O3QA 3QNOA 4ICLA 3KIOA 1TL3A 1XHZA 4DSLA 2AQ4A 4Q8EA 3ISND 3KLGA 1XHXA 2VG5B 1GOBA 4J2BA 1RT6A 4I2PB 5CZ1A 4FLUA 5KGWA 4QAGA 4XPCA 4KBIA 3HM9A 4DU1A 2E6LA 1J53A 3HVWA 1QSLA 4EO8A 2HHVA 4Z4HA 4NYFA 4B9VA 2FBVA 1RT1B 3QEIA 3CFRA 2HWIA 4TN2A 3OJUA 4KAZA 4KHWA 4L8RB 3C6TA 3GV7B 1BHLA 4CEFA 4AHRA 2QKBA 4DSKA 4CE9A 2HNZA 2P5OA 4WE1B 2G8IA 1I6JA 2AGQA 1BQMB 1RT4B 4BE0A 4PY5A 4YMEA 1ZETA 2QKKA 3AV9A 3OYDA 4AILC 4K4XA 3V6DB 1BIUA 3V4IA 3AA4A 2WK4A 3NH1A 1JLFA 3I0RB 1XWLA 3OYMA 4E7HA 3KLIA 2XO7A 3QIDA 2GUIA 2FVCA 3U3YA 1ZBHA 4R5PB 5KFKA 3RMCA 1S1WA 2ASJA 1N4LA 1JX4A 4CHQA 2RDIA 4IR1A 1QS4A 3PW2A 1HQUB 3AA2A 5JS2A 2G8UA 4C8KA 4R8UA 5KFEA 1IH7A 1TVRB 2JEJA 3MXIA 3TAMA 5KG2A 4TYAA 4ZPCA 1N48A 3CFOA 1RTIA 4KHMA 4FYDA 3JSMA 1TK0A 3AO5A 2E9RX 4O0JA 2B5JB 3OYLA 3CDEA 3LP2A 3HP6A 1C1BA 4MIAA 1VSIA 3GIKA 1SL1A 3KK2A 2YHAA 1KVCA 3AVCA 3T19A 4KO0A 4CF8A 5KFVA 4ECVA 4ZP7A 4FK2A 3QIOA 2XY6A 4F3TA 4CJUA 4CGJA 2VG7A 1TKDA 1LWEB 4I7FA 4BDZA 5F9NA 3HO1A 3EPGA 2BR0A 3QYYA 3OS0A 3KKSA 3AVJA 1IKWB 1CZ9A 1T03B 4ZVEA 3RRGA 2YNGA 2ZD1A 3KJVB 4HVJA 3RTVA 4DTXA 3OYKA 3OYGA 3IS9A 2D3UA 4ZMMA 4FVMA 1A5XA 4HTUA 5J2PB 1S5JA 2AGOA 3FFIA 2WONA 3O3FA 4RW9A 1HYVA 2YKNA 1T03A 4DQSA 3G6VA 4F4KA 3TAGA 2OPSB 4H4OB 5KG0A 5C42B 2HHTA 1FK9A 1WAFA 4IG0A 5KT2A 3SUOA 1S6PA 4ZP8A 5KG7A 3NH2A 3DLGA 3GYNA 4M42A 4EP5A 4KKOA 4PUOA 4F3OA 4LH4A 3ZT4A 3RRHA 1S1UA 1BISA 2GC8A 2VWJA 1W0HA 4KB1A 1WAJA 3VQQA 4KI4A 4XIUA 1QE1A 1Y97A 2B5JA 4FM0A 1X9SA 1NKBA 1S1XB 4FLZA 1WSGA 1JLCA 2HVHA 4DF4A 3CWJA 2RKIA 3VQEA 4YQWA 3ULDA 3MEDA 3S3OA 4DTSA 3NBPB 2B6AB 3ZSRA 3TAPA 1VSDA 1S1WB 1GX5A 5J2QB 3OJSA 2R2SA 3H4DA 4DSIA 1KLNA 4C8NA 1JL2A 3DYAB 1JL1A 4Q0BB 4MK8A 4FXDA 2G8HA 3DOLB 1L5UA 3KLEA 1RNHA 2UVVA 4HCCA 4ED8A 3VQ5A 1TL1A 1D9FA 1LW2A 1EETB 4QWAA 3IG1B 4IFYB 2I1RA 5JUMA 1L3SA 1QSSA 3VN5A 4BDYA 4QWDA 4DLGA 2XGPA 4K4VA 4QPXA 4W5OA 1SV5B 4DSFA 1KLMB 4DL6A 1D0EA 3IS9B 5CY4A 3NF9A 1UAXA 3HP9A 1WNEA 3TI0A 2IBKA 5KFMA 3T5JA 1LAWA 1VSHA 1HNIB 1RDCA 2WOMA 3QGGA 1NJWA 5K14A 3H5YA 3BR9A 1TKZA 1VSLA 3KLGB 3ITHB 1EP4A 1TL3B 3HPHA 5F8MA 4ZP6A 2E9ZA 4N56A 3CM5A 2YNIB 4RW8A 3KHGA 4O44A 5J2NB 2J6TA 2OZMA 1R0AA 5K14B 3M8PB 3JSMB 3GQCA 4CF1A 4YR3A 4Z4FA 2KZMA 2IMWP 4R5PA 4YFUA 2C22A 1G15A 3GIJA 4NCGA 1SH2A 1UWBA 5DGBA 3M9OB 5KT3A 5KG5A 4RW4B 3NE6A 5EDWA 3I0RA 4K4TA 4KV8A 3ICLA 2IAJA 4ZP9A 1QAJA 1CXUA 1XC9A 2FLLA 4FM2A 3KLFB 4I9LA 3NMAA 1RTHA 3C6UA 4O3NA 5KT7A 4K4SA 2DY4A 1K1QA 3V4IB 4CJ5A 4OL8A 4IOBA 2ZKUA 1NOYA 4J9QA 2OPQA 2GIRA 3CM6A 3S9HA 2R2UA 2Z1GA 4NZ0A 2E6MA 5C5JA 1HJRA 1TK5A 3SUNA 4KTQA 4EZ9A 2KFZA 1BQMA 4CCHA 2OH2A 4NCBA 3SQ1A 4ZTFA 4CERA 1LWCA 3HT3A 1RDAA 4CJLA 3QEPA 5KFOA 3G6YA 4EBEA 3TAEA 3HKWA 1RA7A 4FJKA 2WHOA 2F8EX 5KFGA 3SYZA 3IRXA 3QO9A 2PYLA 1JLCB 1J9AA 4J9NA 4NRTA 1X9MA 4H4MB 4RW6B 5KFUA 2AU0A 5KFCA 4ECZA 3EZ5A 2VG5A 3VA0A 2ATQA 2D0CA 3I8DA 5KFZA 1QHTA 3OYEA 3LWMA 1U09A 2FJWA 4ZVFA 1Z4UA 4CIGA 2QXFA 1YTAA 3KHHA 4OKEA 2W9CB 4CFCA 1ZBFA 1NK8A 3DLKB 5KFDA 3QZ7A 3VQ7A 1RBUA 4HUGA 1RTJA 4RW6A 3ZCMA 3AVBA 3MF5A 1N6QA 1NK4A 1VSKA 5KFFA 3SUQA 4I7FB 1RT5A 1SUQB 3JYTB 5HBMA 4WYWA 2GBZA 3LP1B 3MR5A 1QSYA 2OPPB 4DTOA 3VQBA 2XI3A 3H5SA 3RB0A 3BQ2A 4EYIB 5CYQA 3NL0A 1KTQA 3O4QA 3RMBA 5HROA 3P5JA 4OGCA 3SZ2A 4W5NA 1CZBA 4TY8A 1MU2B 3M8RA 2XY8A 4CFAA 3LWLA 2IOCA 4Y3CA 1VSJA 3C95A 4Q44A 1IKXB 4QOZB 4FW2A 3AVIA 2DTUA 3AO2A 4KHRA 2HHQA 2F8SA 1NHVA 2RN2A 4M3RA 2E4LA 4IG3A 4Y34A 2XY7A 2I5JB 4IQXA 3WNGA 1DTTA 3OL9A 1RTHB 4DSJA 1ZBIA 4LSLA 4ZVGA 3NF6A 5KFTA 3T3FA 4JS4A 1JLBA 3V1QA 4RNHA 1X1PA 4MQ3A 2DPJA 3DM2A 3N6NA 5KI6A 2FJVA 2IAJB 4ED3A 1EKEA 1B9DA 2J6UA 5DGAA 3PR5B 4DTPA 3VA3A 3HPGA 2EC0A 2Z1HA 1REVB 1S0NA 3BSCA 3L2UA 1RYRA 4EYHB 2W7OA 4DL7A 3CQ8A 2BQ3A 4LSLB 4O4GB 4JRQA 4CFBA 4N76A 3BSOA 2FVSA 1JXBA 1IO2A 2HW3A 4KFBA 2HMIA 1C2PA 5KFPA 4CGIA 1T8EA 3VQCA 1S0OA 2HWHA 1I39A 3G6XA 3OHAA 3OYFA 3MTKA 5F9LA 1Q9XA 4LQ3A 4O3RA 4HUFA 5L1LA 2HVIA 5KFIA 1FKPB 3BGRB 3OSPA 1T05B 4OPKA 1TV6B 3OHBA 1C1CB 3QGHA 1C1CA 2D3ZA 4W5QA 4BWJA 4J2EA 2W42A 4I9QA 4ECYA 4CJ4A 2YNFB 4KAIA 3HVTB 5KFJA 3PJWA 1RT2A 4RW7B 3PY8A 3BJYA 2R8IA 3LP3A 4DL2A 5DMRA 1KLMA 3LZJA 2G8VA 3GV8B 4QWEA 3KMQA 4IH6A 4ED1A 1TV6A 3SFUA 2GV9A 1BI4A 3L2WA 4MFBB 3FQKA 4ELTA 3HL8A 4WFZA 3LDSA 4TSXA 3PVXA 3MFIA 5C25A 2Z1JA 4CF9A 3UIQA 4KTZA 1ZYQA 1JLGA 1S97A 4CHYA 2BE2B 3KNAA 4ED7A 4CHPA 2G8FA 3QLHA 3MEEA 1ZBLA 1RILA 3VQPA 3P1GA 4RZRA 2OZSA 3QETA 4Z4GA 1S6QB 4E19A 5EWFA 5I42A 4FZZA 1YVFA 4IH5A 2X6SA 3IAYA 4RUCA 2KTQA 3FSIA 5KG3A 2RDJA 3CIZA 2ZE2B 2R8KA 4J9MA 1JLBB 3OYNA 5J2MA 4F4XA 3TAQA 1TGOA 4O3PA 3LPTA 3PV8A 2QE5A 4FLWA 1JLEA 4MK7A 4KHQA 5JS1A 2XWYA 1GOAA 4B9MA 3QINA 3D0PA 3F9KA 2XCPA 4CESA 4NYNA 5CYMA 5DLFA 4HYKA 2VG6A 2IM3A 2W9BA 1FK9B 3A2FA 3QEWA 3T1AA 3CDWA 1SL2A 3AVHA 4PWDB 4FLTA 4CEQA 3ZSQA 2ATLA 4U6PA 3TABA 1ASUA 1S1TB 3QERA 4GC6A 3KD5E 4HCBA 4MIBA 1JLAA 3BREA 3SI8A 5KFHA 4B9SA 4RW8B 2P1JA 2ZD1B 5KGXA 1RTDB 2ASLA 3DLEA 4O0IA 5DG9A 4NCGB 3CJ4A 2XHBA 1LWFB 4NLXA 2HNDB 1WLJA 4AH9A 4JV0A 3Q8RB 2A1SA 4J9PA 1ZBUA 3V9WA 4WFXA 4O44B 2WOMB 1S10A 3PZPA 4CGHA 3K58A 3AO3A 2OPRB 3KK2B 4FJHA 3KLHA 1NOZA 4FJ7A 5CZ2A 3T5LA 4DQRA 4B08A 4FLXA 4ID1A 1J54A 1RYSA 2W8KA 1WSJA 2KZZA 3AA5X 4DL3A 5KG6A 4FBUA 3CDUA 3AA3A 4OKJA 1S9GB 5DLGA 3U3GA 4FS2A 3DI6A 4OLBA 3K57A 3I0SB 2IM0A 4FJJA 2FVRA 4NYZA 2NUBA 1RBVA 3DOLA 3OLAA 1JXEA 3LAKA 4CIEA 2ITGA 5FRMA 3FDSA 4O3SA 1TKTB 5HLFA 3V9ZA 4U7CA 4CEDA 4Y2AA 5FRNA 1TKTA 3KD1E 5F8IA 5T14A 4RW4A 4OKKA 1TK8A 1WSFA 3Q8SB 3OL8A 3PO5A 4BDPA 4KSEB 4AHVA 5EU7A 1HMVB 1I3AA 4WXWA 4NLOA 5J2QA 3NFAA 1YTUA 4I2QA 4KPYA 2YHBA 5J2NA 3V9XA 1HPZA 4DEZA 4DFPA 3C94A 4CIFA 1CXQA 3QNNA 1RBRA 1UWBB 4E7JA 3D28A 1NK9A 1S1UB 5SWMA 2OYQA 4NLUA 4BWMA 1NK0A 3SFGA 4G1QB 4FK0A 4TXSA 3FQLA 1R0AB 1S9EB 5HROB 3I5CA 2FBYA 4URSA 1FKOB 4CJFA 3EPIA 2ASDA 2Y1JA 3NCIA 2FJXA 5HRSA 4QCLA 3DLBA 2AX0A 1S9FA 2BANB 5KT5A 4B3OA 2DPIA 1S1TA 2X6NA 3CJ2A 3L3VA 3HK2A 4H4OA 4NLTA 1RDRA 3HJFA 4HUEA 3AO1A 3DLKA 4OVLA 1LW0B 1O1WA 4YR0A 3KLEB 1KSPA 4OPJA 2R8JA 3L8BA 4IBNA 2YNHA 4IFVB 4B3OB 4OLAA 4NLDA 1EETA 1YT3A 3V6HA 2VG7B 4W5RA 4E1NA 2R2TA 2KFNA 4H4MA 2IC3B 4GW6A 3OYIA 4IDKA 3ZSYA 3PX0A 4CJSA 4NLRA 1W9HA 3V9SA 1HPZB 2W8LA 1Q8IA 1B9FA 4CJ3A 1X9WA 3PW7A 1QAIA 2A1RA 1HMVA 2ZE2A 5FROA 3PHEA 1BCMA 2V4QA 1SL0A 3LALA 1TAQA 3TAMB 4IDKB 4JV1A 3HYFA 3VQDA 3Q8PB 3WNHA 4B9NA 4Z4IA 4B9TA 3OYHA 1NK6A 2FBXA 2IGIA 1YVUA 5C42A 4TLRA 3NGDA 1RT4A 2VA2A 3KLFA 4JUZA 2HNZB 2UVUA 1XR5A 4M41A 1L3TA 3V6KA 4F4YA 3V6DA 4H54A 4H8KA 3SUPA 1LW0A 4E89A 3DLRA 4DWIA 4KHUA 1SKWA 1VSMA 3AVAA 1BI4B 4CGFA 5FDLB 3KLVA 1U48A 4ED2A 3SCXA 3PO4A 3OL6A 1IKWA 4M3TA 4WE1A 1IG9A 2LSNA 2XCAA 3RR8A 3G86A 4AHUA 2AX1A 5L9XA 3KMSA 5I3UA 4QWBA 5HRRA 5DG8A 3L2VA 4JV2A 4RW7A 3Q8QB 1NNDA 2O4IA 3NF7A 1S9GA 3O3GA 3HVTA 2YNFA 4C8LA 2HHXA 2FLPA 4CFDA 4NLSA 1EX4A 4KI6A 5DK5A 1NK7A 1SH3A 1L3VA 3V81A 4ECSA 4E1MA 1XR6A 3SQ0A 3ZSXA 3GIMA 2HNDA 4QW8A 3HXMA 3SNNA 1NKEA 2C2DA 1C1BB 2CKWA 4K4YA 3FRZA 2AWZA 3ZSVA 1BGXT 4DFKA 3ISNC 4I2QB 1C1AA 5KFSA 1JLAB 3CVKA 4M94A 3H4BA 3DRPB 1DLOA 1REVA 1BL3A 1HYZA 2EX3A 4J2DA 1BQNA 4RNFA 4PWDA 4J9SA 3H2LA 3KTQA 4OJRA 4LSNB 2C2RA 1S0MA 1N5YA 1JLFB 1HNVA 4ZPAA 4FJMA 3NHGA 2PZSA 5KRTA 4UQGA 2HHSA 4RG8A 4CJKA 4KTWA 4BACA 4ECRA 3PW4A 3MFHA 4AHCA 3KLIB 1S48A 2I5JA 4NLGA 1KHWA 5KG1A 4ED6A 2XGQA 2W9BB 5EUHA 2F96A 2D0AA 2C28A 3C6TB 1A5WA 3I0SA 2PY5A 4YP3A 3KHLA 3VQAA 3EYZA 2UVWA 5HBMB 4ZHRA 1GOCA 1XR7A 3MR6A 3NGZA 3F73A 3VQSA 5I42B 4DFMA 2V9WA 4LD0A 1A5VA 4E7LA 3QLHB 4CJWA 4DS5A 3QIPB 1RT7A 1RCHA 2BE2A 2D7SA 2D0BA 2W9CA 3I5BA 3KLHB 3RBDA 4GVMA 1JLQA 1K1SA 4F4ZA 3T5HA 3QESA 2JGUA 3B6PA 2RF2B 1K6YA 4DMNA 2IS3A 4DLEA 1BIZA 1U45A 4FJLA 1RT6B 4I2PA 3DRPA 1ZTTA 3PJXA 1VRTB 3OYBA 5F8GA 3IN5A 4FJIA 4FLVA 3RB3A 1JXLA 3L2RA 3HVRA 3ZSWA 3FFIB 2BQUA 1BCOA 2OA8A 2IA6A 1NHUA 1RT2B 5KFLA 1RT7B 4FZYA 4LY7A 2YNGB 3KJVA 2F8TA 1JKHA 4Q43A 4HKQA 2V4RA 4J9OA 1T05A 3M8SA 5L1KA 1JLQB 1DTQB 1C0TB 2JC0A 3AVMA 3LANA 4F2SA 4B8AB 4MKAA 1UOCA 4Q45A 2KQ2A 2OPQB 4DU4A 5F8JA 3NGYA 2JC1A 3G0ZA 1IKYB 2JEGA 3SPZA 4MH8A 4ECQA 1FKPA 3BGRA 1JIHA 4KRFA 4TY9A 5J2MB 5FDLA 4DFJA 4OGEA 1QUVA 2EHGA 3DRSB 3K5MA 3HVAA 4KV8B 4KB7A 2C2EA 2HHUA 2DFHA 4F2RA 3GILA 1N5YB 3M9NB 1LAVA 3S3MA 4PQUB 2R7YA 2D41A 3C6UB 4DQQA 3CFPA 3LAMA 2WCXA 4K4UA 4K8ZA 4Z4CA 2ILYA 5KFNA 3MEGA 3M8PA 4RNOA 3N6MA 3DRRA 1J5OB 1WSHA 3MXMA 4J9KA 3UDLA 1ITGA 2YNIA 4EO6A 4CK1A 3H5UA 1Q9YA 2FBTA 3DRRB 1J5OA 4WZMA 1WSEA 4Y1DA 3V1OA 3B6OA 1KHVA 1TQLA 4KE5A 1VK0A 4ECWA 1NK5A 3ITHA 5HRPA 1RDDA 1TKZB 4TQSA 4PA1A 4CHOA 3NF8A 2HAIA 3RB4A 3RMDA 4CJPA 2FC0A 3SQ4A 1SKSA 2QK9A 3U6FA 2HB5A 2HHWA 1D1UA 1XI1A 1RT5B 2WB4A 1T3NA 4KREA 1SV5A 4FLYA 5I3UB 4TY8B 3M9MB 2J6SA 1RA6A 3H08A 4E3SA 5DQGA 1KVAA 3IGNA 3OYCA 5CYQB 1N56A 1U47A 3ZSZA 4EBDA 4NLYA 4EZ6A 1C6VA 5KFRA 1HYSA 1DTQA 3HSTB 4ICLB 1C0UB 4Q8FA 1RDBA 3RAQA 4ECTA 4FJGA 4KFBB 3NAIA 1RT3B 3H98A 4ZPBA 5J1EB 4CGGA 1MMLA 3OL7A 3TQ1A 2P5GA 1Z25A 3T5KA 4ELVA
chains in the Genus database with same CATH superfamily
2W9AA 3D1HA 4F50A 5K20B 5D3GB 4C4WA 2FZKB 4DI6A 4JI5J 2E2QA 2P51A 2W7PA 4BR2A 3I55S 3FR0A 4PAAA 3R8EA 2YQ0A 4I6MB 4CBUA 1N54B 1N5VA 3GG1A 1MROA 2Q1LA 2UUBJ 4OYMA 2CPDA 1DRZA 4YY3J 1YHQN 4P9SA 5HQLA 3QEVA 2IJRA 1FJ7A 2LA6A 2H65B 3M30B 2XB2D 3ZNJ1 2UUWA 1C0GA 4DCHA 1IBKF 4DL4A 1IBKJ 1VQKS 2PN6A 3C19A 3NP5A 4J2AA 3D3BJ 4MTPA 4DL5A 3PR4A 1PYSB 3L0QA 5HOOA 4GKJF 3ZC4A 4E8UA 4PG6A 4FJ8A 2PEHA 1XBWA 4WXOA 1HRHA 3K89A 1SUQA 4IG0B 3VQ4A 4OJHA 2YNHB 3W62A 2DNPA 2BKNA 1KXPA 4USJC 3AODA 1HNXJ 4HH1A 3M8QB 2R7OA 2MQ8A 3RSEB 3CCUS 4NLVA 4O8KA 1TUVA 4USVA 1QZ6A 2EK6A 4M3ZA 4USTA 2HRYA 1Y5LB 3LP2B 3IKMA 4A2BA 3T1HK 2EFNA 4GVEA 3MEKA 1YJWS 5ETKA 4CZGA 3CJ3A 2P9NB 2UUBF 2L9WA 1VLOA 2D9PA 1FXXA 2IVNA 3VZHA 3HHEA 4FL9A 2HNYB 4OMFG 4CJVA 1IM4A 2B9EA 1VQ5N 1TKXB 4CLPA 4P73A 1WUUA 1FTRA 2EFOA 2XI2A 4LF4K 2GIFA 4M5IA 2L48A 2DFEA 1EO1A 4P74A 4DF8A 4U95A 2UXDK 4CZCA 2YWHA 1SKRA 2DJWA 1XNQJ 4K0KK 2CA9A 3K2PA 1W25A 1K0TA 2NYIA 1S1VA 4A47A 2HFVA 4BRPA 1S49A 3VQ6A 4L76A 2QFIA 1T0TV 5KT4A 2YHWA 4BRCA 3DRSA 3NWRA 4ELUA 2OP5A 2HHPA 3L6QA 2QSFA 5FJ4A 1ZH5A 5HP1A 1F21A 3MEDB 1X3MA 3RBEA 3H42A 1X5SA 4OYZA 1KCFA 4JN4A 4X4QA 2V2VA 4RU2A 2P6TA 4WYBA 1ASVA 3F2KA 4ZPTR 4G3IA 1QJHA 5FPDA 4BG9A 1EWRA 1WG4A 4PXDA 3S01A 4WP8A 1PSDA 5C10A 4CLTA 4DV4K 2V0NA 4OYWA 3NGIA 1VSEA 1GXUA 2GHWA 4ID5B 3MN5A 1M1HA 4DR5F 3E2EA 3MXJA 1KD1T 2E2OA 1RTDA 5DQHA 2ZM6F 5ETTA 2JZ5A 3QT6A 4QR0A 1P90A 1LOUA 4RW9B 2F5GA 2G8WA 1PKUA 4IFYA 3UCUP 4FM1A 1LWEA 4LQ9A 4DOZA 1XUPO 4GMJB 5AQOA 2VPYB 2DR6A 2V51B 4NLCA 3EE3A 3KG4A 3DYAA 1RWUA 1FKAF 2BQRA 4FCYA 4DTUA 3CYMA 1BQXA 1QTMA 1X4AA 1N88A 3DOKB 4DJBA 1TP7A 3HM8A 1OMSA 1UETA 4EBCA 1EAYC 2GJIA 1LFWA 2BRLA 4QYZJ 5A8KA 4AHTA 1HNWJ 3EWGA 1Z2LA 3MWBA 4FWLA 4JV5K 2EFGA 3LP0A 4CI6A 4DTJA 4IOAL 3JXOA 4UOGA 3R1XA 3US5A 1NJXA 2BM0A 3VV2B 2CQIA 3SQOP 2GW8A 3DC2A 2DHHA 3NCPA 2C2KB 5HJXA 2DEJA 1NAQA 3OD2A 3UCZP 2QX0A 1NPRA 5D6GA 4CEEA 4FZXC 1WI6A 2HF3A 1NSAA 1YGYA 1F9FA 3TO8A 1O8BA 2VZ9A 2XTJP 4IG3B 1IKYA 4CK2A 3QJJA 5E0OA 1Q18A 1NDPA 3UNYA 2FY1A 4O3OA 3NAEA 3SIPB 5HANA 2DNOA 2B9WA 4JKFA 3WUHA 4ZTJA 1HD0A 5L38A 5LSRA 1ZAWA 4L3QA 1R89A 1YZ7A 2AV5A 4ZITA 4DS4A 2VL1A 5HRNA 4JRPA 2H48B 3LP1A 1DHMA 1FWPA 3T41A 4KO0B 2G2OA 3LUYA 2RPIA 3DWLA 4PYDA 3I8BA 2UXCK 3T69A 4WPAA 5BRDA 3UR0A 2YBVA 2PYJA 2YV0X 3GJRB 5DQIA 4EHTA 3HHKA 2VBXA 1TVRA 1JNZB 3M6WA 1I94F 2B9XA 4A8XA 2FZGB 3G87A 5EWGA 3TUZC 1N8RT 3BQ1A 3R9LA 3E01B 3PX4A 2NRWA 1YI2S 2RF2A 3LPUA 5M2UA 3VERA 3D6MB 3DMJB 3OW2R 1KEKA 2ALZA 3DM2B 3OHRA 1IKXA 5A0YB 1YHQS 3TVKA 2G13A 2EBGA 3EZUA 2X1GA 1VRUA 3O44A 4J9RA 2FVQA 3DRYA 4CLZA 3LM9A 4ZHRB 2CQ3A 2VG6B 2DHGA 1ILYA 4WP9A 2YX6A 1X5OA 2DH7A 1URRA 3OT9A 1NBEB 2DHAA 1W2BR 2E5IA 4DV0J 1X4GA 1HNVB 2JX2A 5AXKA 4FO0A 5L1JA 1RGIA 2XSFA 4DU8A 1IBLF 2NRXA 4K8XA 2E7WA 1L3UA 2Q3PA 5LL6d 3TSPA 1M90T 1RXOB 3DMJA 5AE3A 2VA3A 1CULA 1UJ5A 3AARA 3U9DA 2BKPA 3OVNA 3ILLA 4PXCA 2E2PA 3PDNA 5D3GA 4C48A 2UUCJ 3AJ1A 3PUFA 1J6ZA 1K9MO 2AKWB 4CZHA 3Q2SC 2YWFA 4B8CA 3UB5A 1GLAG 3H1VX 4I1TA 4PQAA 5MLCQ 3HSCA 1TL3A 1XHZA 1VMBA 4C0OC 4Q8EA 3GMGA 4CLFA 2VG5B 1QAYA 2LDYA 3J7AN 5CZ1A 2O8BA 3R6LB 1IUJA 3ZZOA 4KBIA 3HM9A 4DR3J 1X5PA 1VHFA 4OZ3A 2YJFA 3O8WA 4B9VA 2DGVA 2IVMA 2FBVA 1UW9A 2HWIA 3OFHA 1B0TA 3C6TA 1XNRK 1BHLA 4WFBL 2EVZA 3VALA 4DSKA 1FRJA 3O1BA 4AFFA 3CMES 2HG4A 3OYDA 4X62J 3OTOF 3J7ZO 1XNQF 1BWFO 1BIUA 3V6DB 3Q2TC 2UXDF 3RBZA 3PTWA 2WK4A 4DV5K 3OYMA 1VFJA 3KLIA 4DR1K 2YKOA 2WSCC 4U96A 2OMOA 1Q79A 1KNZA 1G6BA 2J0QD 3HD1A 3BDEA 3RUBL 2Y0SD 2ASJA 1M5OC 1FI4A 5AQZA 2RDIA 5JS2A 2M3DA 4C8KA 5KFEA 3MXIA 1TVRB 3TAMA 2HGLA 5KG2A 4ZPCA 2KT2A 4DV3K 1N48A 4KHMA 4OI6A 1TK0A 2EBEA 2E9RX 2VONA 3F44A 3HP6A 1UZDA 1N32K 3CNQP 3GWCA 1SL1A 3KK2A 3T19A 3NGKA 4I69A 4WKYA 1N52B 1CC7A 4JI4F 2OANA 2XY6A 4YHHF 4CGJA 3E8OA 2DH8A 4X4PA 2BR0A 4PCQA 4DHYA 1XTZA 4JI3F 3RRGA 3KJVB 2KXNB 5AR0A 3G71N 4ZMMA 4FVMA 4U8YA 5J2PB 1FFWB 1CJVB 4AYBD 2AGOA 4RW9A 1HYVA 3GTYX 4H4OB 4LBHA 1WAFA 2MSSA 3I32A 4ZN1A 4LFAF 4A8OA 1NDLA 3J7YP 2QRRA 4EP5A 4KKOA 3AY9A 4PUOA 4F3OA 3ULHA 1C4CA 2PMHA 1KQFB 4KI4A 1X9SA 1UVLA 1NGGA 4PG8A 2A42A 1JLCA 3VQEA 3OTOK 1RABB 3ISZA 5B0BA 1PJ6A 4C1NK 4PPZA 1CVJA 1K8KA 3KYLA 2GVDB 2K1RA 5BN9A 1YLXA 3ZSRA 5AJ3K 2BKOA 1VR6A 1TMMA 3OJSA 5DDRC 2HVDA 1OJ4A 1WTBA 1MN9A 3AB2B 4C8NA 4O23A 2KN4A 3DYAB 1F3VA 2QIFA 3D6TB 3UN2A 1RAIB 3DOLB 1V9OA 1BLUA 3MDQA 4HCCA 6FD1A 2QJ3A 1SC6A 2YKAA 1D9FA 1NDKA 1H72C 1Q81O 3IP0A 1U7LA 3HI0A 3R7BB 1RE1B 4G1PA 2QXLA 4QPXA 1CJVA 4W5OA 1SV5B 1KLMB 3IS9B 5CY4A 2GA7A 2P9SB 1WNEA 2A40A 2YH0A 2E1ZA 2BJEA 4DV7J 1GTHA 1KD1O 1LAWA 1R27B 1HNIB 3TA2A 3P5TL 1NJWA 3H5YA 3QT8A 1YG0A 1TKZA 4FN5A 1N0VC 4RKUC 1N34K 1EP4A 3A12A 4ER8A 3HPHA 3B4MA 2UU9J 4ZP6A 1DGKN 3IR6B 4RR5A 2QL5B 4FOIA 3PACA 2L9NA 3N5FA 4BR4A 2O8FA 5K14B 2EWHA 3BYPA 3GQCA 4CF1A 2KZMA 2Q66A 1GEHA 3LOUA 4F0KA 5DGBA 3M9OB 5KT3A 4B3RK 1Q5VA 3VR1A 5EDWA 1GXLA 2Q79A 4KV8A 2BABA 2IAJA 3ZEUA 3C7NA 1XC9A 5HSPA 4X65J 1KQKA 2YWKA 3VZIA 2DNMA 3C6UA 3F9MA 4O3NA 4A8WA 1YRXA 1YUWA 1TL7B 4IOBA 3N4PA 3CM6A 3S9HA 3GONA 5C5JA 2CJXB 4NZ7A 4KTQA 5H9EK 2CNNB 2KFZA 1BQMA 1B7FA 2KHOA 1G1XA 2CRLA 5KPRA 3GFHA 4OYIA 4F04B 2DGUA 4JD2B 2KHDA 3G6YA 3AOBA 1K8KB 4M5HA 3EXCX 3SYZA 2KJVA 3O80A 5F3ZA 1TUGB 2XMUA 1JLCB 4NRTA 5KFUA 1XMQF 2OEJA 3EZ5A 2VG5A 2E7XA 5ADXH 5A6PA 2YHXA 4EWTA 3CF5L 2P2CB 1CBKA 1AFIA 3I8DA 1BHNA 1Y5IB 4ES1A 3OPKA 4EAHD 1Z4UA 4FDFA 1RAAB 4HTIA 3RSEA 2V6AA 5G4DA 4IQMA 4W98A 3WHIA 5HN0A 4LF5K 2Q6CA 2OCEA 4LF7K 1RTJA 4RW6A 3ZCMA 3D7EO 1U0HA 3AVBA 4DR6F 3MF5A 1NK4A 5KFFA 1SUQB 5HBMA 1QVGM 3NLCA 3MR5A 1QSYA 2FHJD 2NPIA 3A5OC 2EK1A 3JTPA 3RB0A 5KOWA 4EYIB 5CYQA 3O4QA 1Z2ZA 3RAMA 3S8SA 3GZ7A 1QVFM 4CFAA 4H0XB 2QWQA 1N8RO 1S76D 1VSJA 4Q44A 2Q1NA 4BQLA 3NVKA 4IXCA 2H54B 4KHPK 3AVIA 2F8HA 2DTUA 3W3DA 4KHRA 2HHQA 3MGJA 2RN2A 2XY7A 3WNGA 1DTTA 3PYDA 1RTHB 1AT1B 2J8AA 5KFTA 1FDDA 1T9XA 4RNHA 4MQ3A 2KFYA 3DM2A 1O6XA 5KI6A 1EKEA 5CABA 2J6UA 4JYAJ 4K25A 5DM6L 1W26A 3TP2A 1IQTA 2K06A 4DR1F 1S0NA 3OFFA 4FPRA 1GTEA 4DL7A 3CQ8A 1RUSA 4J91A 5EY4A 4LSLB 1YJUA 3FUYA 4DUTA 3BSOA 1JXBA 1E4FT 1U1RA 4KFBA 3CC2N 2IVPA 2WVFA 5GAEU 5TKYA 4BRMA 5AZJA 3IBWA 1I39A 5J1PA 4DV2J 4HHJA 5F9LA 1Q9XA 3FLCO 5L1LA 3TVYA 3OSPA 1TV6B 1C1CB 3GR1A 1RK8A 1ZA1B 2MLZA 3QGHA 4BWJA 3AD8C 2UXCF 2VQFJ 4DQ8A 5CCMA 4HTLA 4FP9A 1RI7A 4RW7B 4OI2A 1LWXA 3AFGA 2R8IA 1Q86T 3PSIA 5AE2A 2PFUA 5L39A 3GV8B 4QWEA 3EZWA 4IH6A 2I6WA 3AOCA 2V67A 4N7TA 2OKQA 1UEVA 3UDVA 3KDNA 2CWKA 1U25A 2LU1A 4RUBA 3FQKA 4ELTA 3LDOA 3HL8A 2KG1A 8RUCA 5K8OA 2DISA 2YCHA 1D09B 3CCTA 4M5DB 2VU5A 4UOCA 4ZCLA 2Z57B 1S97A 4XH5A 5D77A 4I64A 2HFSA 1CLFA 1FRXA 1FFSB 4KGMA 4ED7A 3KNAA 5ETOA 2EWSA 2AJ1A 1LKZA 3VQPA 1V3SA 2OZSA 3KJFB 1SJFA 3QWUA 1YVFA 5E7OB 3VAMA 5KG3A 4WCEL 2R8KA 5AQUA 3J7ZT 2I7PA 1XK8A 5J2MA 2CH6A 3M2VB 4F4XA 3EGVA 3SLCA 4PKDB 5HO4A 1DT9A 3O3LA 1GOAA 1HWJA 4W4MA 2LXUA 3ZETB 3C6AA 2XCPA 4FWRA 4NYNA 5LJWA 4L74A 2W9BA 4YDUA 1FK9B 2KVQE 4FLTA 4BR0A 2V2QA 2FF6A 2Q97A 3NS5A 5F3TA 1ASUA 3QERA 4JV5J 3BREA 5KFHA 3O6QA 1RFQA 1HW9A 5AQJA 3DLEA 1UKUA 5GADP 4NLXA 3FMWA 1P1LA 1ZOTA 3CHWA 1WLJA 2OFHX 4QYZK 4JV0A 3UKUB 3V9WA 4WFXA 1A9NB 3BF4A 2VJVA 3PZPA 1ZM3A 3K58A 4CZLA 4RTFD 5IT0A 1WOSA 2PE8A 5AQFA 2YX1A 4HVZA 3DNCA 4B08A 2P9KB 4X62K 4IO8A 1WSVA 2GS8A 2P9SA 5M1OA 5D4OA 1S9GB 3U3GA 4FS2A 2J9DA 3DI6A 1HBOB 2IM0A 4FJJA 2HHHJ 5E3QA 5GVQA 3DXSX 3OW2M 2ITGA 3V9ZA 1B0VA 3PCOB 4Y2AA 2QA2A 3QT7A 1TKTA 3KD1E 2LA4A 2ZBPA 2GVZA 4OKKA 1WSFA 2W4DA 3PO5A 4KSEB 2Y0BB 2ZJPQ 2XWXA 4I2QA 1UW4A 3O6WA 2YHBA 4BC4A 2GGPB 1HPZA 4DEZA 5GAGP 3WC0A 5DRKA 1ATSA 3H8YA 2K1RB 4QPTA 3AXKA 4DB3A 1NK9A 1S1UB 1N5SA 2BV3A 4NLUA 4G1QB 2FQQB 5IQ6A 4H0YB 3NEKA 2EFPA 1FE0A 1P27B 4ILGB 3I5CA 1FKOB 4Z94A 1PGZA 4B3SF 1HKCA 3JQKA 2Y1JA 4KT0C 3NCIA 4C6AA 3GBTA 1S9FA 3O08A 1HIYA 5A76A 1Q0NA 3HZ6A 3L3VA 4H4OA 4NLTA 4C8ZA 3TYTA 1CQMA 2M88A 1RACB 1XMQJ 3HJFA 1I5OB 4HUEA 3DLKA 2BJ1A 4OVLA 1GNKA 1YI2N 2GO9A 4OV1A 3D67A 3KLEB 4I6AA 4LUBA 4IO1A 3DXBA 2YNHA 4OLAA 4AL6A 3ET6B 2QA1A 4E1NA 2V5HG 1BO5O 4FF2A 1YRUA 3OYIA 2QL7B 1FJGF 2L3MA 5CHCB 1HPZB 1PAUB 1B9FA 3TJ9A 3FCVA 2B4VA 4UW2A 2OD4A 1SIWB 3PIPQ 3R1HA 5HVFA 4JYAK 2W2MP 3TTFA 3LALA 2UZAA 3VQDA 4GV3A 2CJAA 2XZDB 3QPIA 5BPNA 1Z1ZA 4AUKA 2ZUGA 3TWZA 4USIA 1NPPA 4YDDB 1MWZA 1NK6A 2IGIA 3R5AA 4TLRA 2FY8A 4DR4J 2NCKL 2LDIA 1R8BA 5DS7A 1MNEA 2GNKA 3V6KA 4F4YA 4M5NA 2DR8A 3V6DA 4H54A 4ES3A 1OH6A 1HBOA 4EU0A 1QQOA 2N7YA 1SKWA 1U48A 3R6MA 1VC0A 2RNEA 2RHSB 2B8PA 1HNZK 2XCAA 3EN9A 3QAEA 3CD7A 4QWBA 5HRRA 5E3CA 1RU1A 2O4IA 2YY3A 1GLJO 1S9GA 4C8LA 1Q5YA 1UVNA 1NK7A 5IFMA 1SH3A 4O5FA 1VQ7N 3HHLA 5IM0B 1L3VA 1VQ9S 5T7LA 4E1MA 3SQ0A 1H0HB 3GIMA 3HXMA 3SNNA 3VGMA 3M05A 3VETA 3O9RA 4LRBA 2C2DA 2CKWA 1W2IA 2PC6A 2VFTA 5D0EA 4YOTA 2AWZA 2H5EA 4DFKA 2AJFE 2O67A 4LIRA 3DRPB 1DLOA 1NGFA 4B1UB 4JI0J 2EX3A 4N8NA 3OUYB 2RIJA 3H2LA 3BM7A 3SBTA 3A8JA 3MWPA 4OJRA 4LSNB 1K44A 1N5YA 1JLFB 1PC4A 1AUDA 3BPDA 1MW7A 4DR7K 2HYIB 4UQGA 2X51A 5JLFA 1FJGK 2AD9A 3K2YA 4E98A 1YJ7A 4XAKA 4JKEA 1T9TA 4IYQA 3CC7S 1IBCB 2QLWA 3PW4A 3U8XA 2OMLA 1S48A 5AXMA 4NLGA 1KHWA 3VAJA 2V4JB 2XGQA 2ZDOA 3C6TB 2O1PA 4Y28C 2FTRA 2WBNA 2UVWA 3UDCA 4ZHRA 5IWAF 2NRHA 2MDAA 2W2OP 5I42B 4X4TA 4LR7A 4OX8A 4F7VA 4LD0A 3BBBA 3MMBB 1A5VA 2IVYA 2HK2A 2GWJA 3NVMA 4DS5A 1RCHA 2D0BA 2HBZB 2D3O1 4C1NI 2W9CA 3I5BA 4H03B 2WVBA 3KLHB 2DHSA 3RBDA 1HX1A 1YBAA 3M30A 3WQTA 2RF2B 1K6YA 3KWMA 3UKRA 4I2PA 1ZBSA 1ZTTA 4X66K 2CPZA 2EXUA 1RU2A 1KAYA 2NSCA 5F8GA 8AT1B 3ZSWA 5EVZA 1FWKA 3CCSN 4CW7B 2OA8A 1G4CA 2CPYA 1R59O 4G65A 4OV6A 2AT1B 4LY7A 3KJVA 3J81j 4U9RA 4UY8T 1O5JA 1TFYA 3CULA 2ZJRQ 5GMDA 4RWXA 2JC0A 1IV0A 3LANA 1MWKA 5AQTA 2J9DE 4Q45A 2OPQB 3HZGA 4WCEQ 1Q53A 2V4JA 3SPZA 9ATCB 5AXNA 2DD8S 3W9IA 4BROA 2HF4A 3ENVA 4TY9A 5J2MB 5FDLA 2VBYA 4CBXA 1FDBA 3KUEA 3AOAA 1EARA 1S7IA 2DNRA 1URNA 3K5MA 3MM5A 4KB7A 2MZSA 4JKAA 2HHUA 2DFHA 4F2RA 3V5RA 3M9NB 4PQUB 2R7YA 3C6UB 2WCXA 3C16B 4ANCA 2ZWOA 4V19X 4PKGA 5C2CA 4K8ZA 4Z4CA 1GLCG 4DZ6A 3MEGA 2Y1LB 2VQEK 1HBMB 5M1FA 1YKWA 2NPFA 1ITGA 1S5ZA 4B17A 3OTBA 5T41A 2MZTA 1J5OA 3FSXA 1D3WA 1EZZB 3V1OA 3B6OA 4KE5A 2P9PB 2CXEA 1NK5A 1U1NA 3AB4B 1M90O 1WC5A 4KY3A 3C46A 4PA1A 2HAIA 3W3SA 4CJPA 2FC0A 2W24A 2RS2A 3FBBA 2QLFB 4X65K 3W66A 3D1OA 4I6WA 3ZTRA 2ZNYA 2GO8A 1RA6A 1AZSA 1KVAA 2ZDPA 5CYQB 3CMAS 4EBDA 3SCLE 2AYBA 5KFRA 4PG5A 2FIUA 2GJFA 3RAQA 1X8DA 3J80U 3CXCR 3OL7A 3MUVP 2H5IB 4DUYK 2GMHA 5B09A 3BKTA 2FSKA 3GE9A 7FD1A 5EWEA 4X4VA 4WZQA 1J2VA 4B3RF 3SDEB 3VCDA 4YOUA 4ZOSA 3IMQJ 4WF9L 2YKMB 5M1PA 4CM2A 2MKIA 2QL9B 3ALYA 2HFOA 1QQCA 1FD8A 1X4FA 3PHTA 3K59A 2HVZA 4M95A 3ENWA 1P6TA 2CZ4A 1VQNN 4A57A 3N01A 4URQU 4FS1A 2ZOMA 4DCJB 3RR7A 5F2RA 3P39A 2PA8D 3AY0A 4OHWA 4CJQA 4UUWA 1NGDA 5K8PA 4NLWA 5IS2A 4ILJA 2BDPA 1S7HA 4H0TB 1IQZA 4QZVB 2BMBA 2GQQA 3ZZZA 4U67Q 1T44A 3GB0A 2YJEA 3L2QA 1S72N 4KB0A 4NO7A 4GRSA 2WONB 2HK3A 3C7NB 1KVBA 3SJHA 4IH7A 4KYZA 2ACYA 2JEIA 2AGPA 4IRKA 1U26A 4ERDA 4YNQA 2QI2A 3G10A 4DV6K 3J81Y 3E01A 2Q3SA 3L3UA 1OH8A 2V52B 4M5GA 1C0UA 1LCUA 2R7SA 5A8RB 3THWA 3UVJA 3SCKE 4X65F 1JCEA 3K5NA 3WZ0A 3MECA 3BDPA 4E0DA 3VEXA 2VYPA 3MK6A 2WC9A 2VQEJ 2XY5A 4YB6A 4RJVA 5KFWA 4B1WB 1HNIA 2XG8A 5C2FA 3MECB 3ZT0A 4PL7A 1H73A 1FJGJ 4DG1B 3CT9A 3TANA 4RNNA 4GKKJ 4EEYA 2GGPA 5E41A 1EXQA 4G1QA 2XLIA 1XNRJ 3OYJA 4CTAA 4LFBJ 2BA9A 4JI7J 2XC9A 1MWYA 4FW1A 2BVZA 4QW9A 3THWB 2QA4N 3M8QA 2KRBA 3ILIA 4CLLA 2D5RA 4IRDA 3GCWP 2K8GA 2X78A 5FD1A 3MOJB 3DHWC 3AVKA 2ACMA 3MR3A 4ID8A 4Q0BA 4X62F 3OTOJ 4KH4A 1S1VB 3KK3A 4JP8A 3U9ZA 2CQDA 5KFAA 1SB6A 1FCAA 3D6RA 4H5NA 3EVMA 4F25A 2X1AA 1D9DA 4DR7F 1HL6A 1RT1A 3BEGB 4EP4A 1WEYA 2HBJA 1IKVB 2EFQA 2UVRA 1OKJA 3AQOA 1VI7A 2A2DA 1TKXA 2QWMA 1XIQA 2KM8B 1WJ9A 1Q81T 4M5LA 3D45A 4N5SA 2Y1IA 4FJ5A 1UEKA 3ID6A 2YKMA 1Y0HA 4KHPJ 4PUOB 4Y1CA 2EW9A 4KKOB 4F4WA 1VQPS 1EP4B 5AQYA 3PRBA 2QWNA 1VLYA 4P2XA 2FF3B 2VC1A 1S4FA 1REGX 3N6LA 4DPXA 2PAVA 4I6MA 2IM2A 2GMLA 4KHNA 4DHVA 3G2XA 1YTYA 5DO2A 4IO9Q 4UY85 3IM8A 3MM8B 4WYLA 3SPYA 1UA0A 3WT0A 3LO3A 4EUVA 4ILRA 2W2QP 3MX5A 2ROPA 3HKZD 3DLEB 4BRGA 3CO0P 3ZSOA 2UUTA 2A1BA 4FWMA 1Q95G 2VHGA 3FNNA 3J81O 1Y10A 3CJ0A 4K7QA 4C8OA 2QWPA 1A6LA 3L4IA 4J9LA 2I9SA 3D5MA 2IA0A 1NJZA 3FRYA 2KRRA 3Q23A 1JJHA 3CJ7A 4BC9A 4K4WA 1UP1A 2MZJA 3OS2A 5F0UA 3HPOA 4FKXA 4IZ9A 5EXWA 1UJ4A 5DM7L 5KTQA 1FNXH 1NJIT 1Y5NB 2DCUB 4ZCIA 1F60B 3ILJA 1NZAA 2VWKA 1HR0K 4Z2XA 4GKJK 1KVKA 4DR3K 5HP1B 4YOYA 4PEOA 4LSNA 3P83D 1TMJA 3WNEA 3FC9A 4PQUA 2CPHA 3ASMA 4X4RA 4ETZA 5FPNA 2D9OA 3DLGB 3QRRA 3NGTA 3K5PA 4QWCA 2GV1A 3B6BA 3NCRA 4JBCA 4N41A 3TZXA 3VEOA 4L73A 4LFCK 4P2FA 2I7NA 3EDRB 3LPEA 3MUTP 1RCOB 3VGSA 3DI6B 3BV8A 2GIQA 4MFBA 4CHZA 2UXBJ 2O3DA 2DXEA 2VPZB 2OO4A 3CJ1A 2IDOA 2MXYA 4QS8A 2J8SA 3MN9A 1ZM2A 1V5VA 3G9CA 1HYSB 2JJ4D 2HWTA 4EGLA 1VQPN 1H3DA 3UPFA 2NUHA 3O2IA 1Q16B 5DG7A 2HLUA 1RTJB 2WB1D 1H2VZ 1Y64A 2Q31A 3CCUN 1VRTA 3GFZA 4M3YA 3BSAA 4QU7A 2DGWA 5AXLA 4CEAA 2OPRA 3OYAA 5B0DA 4E1JA 2WRMA 3NAHA 1J5EF 5KG4A 4IOCQ 3QJLA 3IO1A 4FJNA 5H9FJ 1NU0A 1P1TA 1WHYA 3HSZA 2VD3A 1RBAA 4JKGB 3IRXB 4A61A 2B51A 4RWWA 2A3ZA 3WQUA 3E51A 2BGGA 4NA2A 3R1LA 1U1KA 5KAKA 3RWUA 1IBLK 1VRUB 1PAEX 4BRAA 3CF5Q 5A8KB 1GQEA 4MAKA 2MHEA 4RO0A 3BYRA 3MD1A 1V4SA 4CZIA 1CLQA 5JVHQ 2KU7A 2A10A 2CQ4A 1YJVA 3CG7A 2KXFA 4Y0FA 1S6QA 5F8NA 1DLOB 1MMDA 4W5TA 5FPMA 2G2YA 3MXHP 4GVBB 2EG1A 4DSEA 4CJEA 3GE1A 2CJQA 2MKCA 4ZJOA 1N6QB 3TW0A 3SSRA 3OFGA 4ZVHA 3OXGA 3MEEB 2G0JA 3RVCA 1YITS 2BEFA 3ZT1A 1GLEG 2E1CA 3LM2A 4O8UA 3HRGA 3AVNA 1U2FA 3NRBA 1HJOA 3DXMB 1HARA 4FPBA 4CHNA 1T02A 3FVYA 2ZZMA 4ICLA 3KIOA 1YIJN 1YJRA 1TUUA 4LBPA 2AQ4A 3KLGA 1XHXA 2C2NA 4X66F 1UEUA 2BZ2A 4NWBA 1GOBA 1VS3A 4DR5J 3F0NA 5KGWA 1P8ZA 4QAGA 4OZ5A 4DU1A 3J81U 4KC5A 3ID8A 3HVWA 2HHVA 4OO1J 2ZKTA 3I4HX 4NYFA 1Q1KA 2OI2A 1RT1B 3QEIA 3VVTA 3CFRA 5CXTA 3OJUA 4KAZA 2QT7A 4KHWA 3D0IE 3MM9A 3ETMA 4ZJLA 4CEFA 2C42A 4JI8J 2QKBA 4CE9A 2P5OA 4WE1B 2G8IA 2AGQA 1BQMB 1RT4B 4MKYA 3WX8A 1FRLA 2QKKA 3HHDA 3AV9A 2RU3A 4U67L 3WXLA 2MGZA 1H1VA 2DXFA 4J7CA 2RT3A 1JLFA 2KL8A 4DU7A 3QBWA 1SQFA 2DVIA 2GUIA 5A8WB 1ZBHA 4WFNQ 4AL5A 3NGRA 1MMNA 5KFKA 2K7JA 3RMCA 1EJ7L 1JX4A 2FUG9 2O8FB 4CHQA 1YF5L 3O5TB 4OI4A 1MWMA 3AHPA 1WF0A 5CE3A 1IH7A 2GVDA 4WIQA 1X9JA 2XMTA 4CQ1A 4KGKA 2I38A 4JI0K 3I9ZA 4NXNK 3FZFA 3AO5A 4O0JA 3OYLA 3CDEA 3MMAB 4OYAA 1A7GE 2YHAA 1KVCA 3AVCA 1XJWB 4KO0A 4GKKF 2A41A 4DR6J 1JK9B 3D6HB 3UD3P 4L3KA 4CJUA 3NNCA 2YQ1A 2WTUA 4DUYJ 2DRBA 1U02A 3HO1A 3CC4N 4JI6F 4KJIA 5EOYA 3AVJA 2J5AA 2LVWA 1T03B 2YNGA 3I96A 3SMSA 3ENOA 3IS9A 2D3UA 4ETXA 4HTUA 1S5JA 4YOXA 2JVRA 3MPVA 2QWLA 2WONA 1YSJA 1T03A 3MCNA 1RAHB 2G1HA 1FK9A 3GFYA 3TSUA 5B0GA 4F4AA 2W40A 4H5WA 4IG0A 3SUOA 2AJ0A 5KG7A 3GYNA 4Z7YA 1BISA 2GC8A 4ES2A 1W0HA 4KB1A 1WAJA 1FD2A 2W01A 3CC7N 5EX3A 1O0PA 3FKBA 2KKZA 1NKBA 3A3PB 3CCVS 2XMAA 5GAHI 3D3CJ 2HVHA 2RKIA 1ZZNA 1TTHB 1PJ5A 3ULDA 2W1BA 4DTSA 4MDBA 3PFEA 2MMYA 1E6VA 4V1Ak 2BACA 3KXDA 3JQJA 1T3VA 2KT5A 2XMKA 1GX5A 4BBYA 3E1YA 3TJ8A 2ZH9A 3WBZA 2CVIA 3H4DA 3P5BP 2FPHX 1Y3KA 1KLNA 1S72S 1R6VA 4Q0BB 4QYRA 4FXDA 4OHVA 2VGNA 3KLEA 1RWNB 3H45C 2DNGA 3R9PA 2G9OA 4ED8A 4A8FA 1LW2A 3MOZA 3I56N 4IFYB 2I1RA 3TRGA 1SXLA 4JI0F 1WEZA 1L3SA 1QSSA 3H3OB 1YITN 3VN5A 1VQ8N 2XGPA 4K4VA 3BGLA 2OFGX 4DSFA 4DL6A 2EC2A 2MY7A 4AM7A 1UAXA 3MCOA 2HIYA 2IBKA 4PYAA 5KFMA 2CWXA 3UE5A 3T5JA 3CIPA 3CGIA 3MMAA 1VQ6S 3G4SN 2EPIA 1A0OB 1OO0B 2YPZA 4R0JA 2ERRA 3KLGB 3ITHB 3G82B 5CZXA 2FHOB 1EIYB 2VBZA 1BD6A 2P9GA 2CPFA 2E9ZA 4ED5A 2YNIB 3QMQA 3Q22A 5CYJA 4I0WA 5DJBA 2J6TA 2VQFF 2OZMA 1R0AA 1HBMA 4J90A 4Z4FA 3ZO7A 5LOQA 2OLWA 3CW2C 3GIJA 1QD1A 4IDHA 5KG5A 2NUUG 1PO6A 3EL2A 1HD1A 1FWLA 3VVUA 5LSLA 5FPEA 3MM5B 1KR4A 4ZP9A 1QAJA 4B9QA 3C2PA 3ULEA 1RTHA 4L3NA 1NJIO 4BQZA 1YJ9S 5LJ5Y 5KT7A 4K4SA 2DY4A 1K1QA 4JOUA 3LW5C 4LF8K 2ZKUA 2OPQA 2R2UA 4M1KA 2Z1GA 4NZ0A 2F4VF 2E6MA 2DNHA 4K2XA 1HJRA 4EZ9A 3LTOA 2DO4A 3M2VA 1RDAA 4GY2B 4CJLA 1QM9A 1BWVA 3S41A 2FGOA 3TAEA 3MMCB 3ENAA 1VQMN 2WHOA 3IRXA 3NY0A 5K5MA 2OAUA 3CQYA 2PYLA 1J9AA 4J9NA 4YHHK 4H4MB 4RW6B 2RQCA 2PFFB 2AU0A 1JXVA 4ECZA 2GZOA 4OJ3A 3CB4A 1MROB 2NRRA 2DIUA 2ATQA 2HVEA 4RPFA 1JB0C 2R4FA 2D0CA 3VEVA 1U8WA 4CLKA 4CZEA 2E5LF 3TUJC 1U09A 4ZVFA 3I4PA 2V8DA 3ADAC 4CIGA 2NXJA 1WC3A 4JI3J 4YN3B 3KHHA 5AQQA 4GVBA 1ZBFA 3BBCA 5FIIA 3QZ7A 5K9FA 3NGUA 1O13A 1S3XA 4LF7J 3UR3C 1IJEB 1RZMA 2A2CA 2CQBA 1RT5A 3G96A 1OPZA 2OPPB 4G6VB 4DTOA 2XI3A 2CJKA 1KTQA 4WFAQ 2CYYA 3SZ2A 3P5JA 3SEOA 1CZBA 4TY8A 4ZVSB 1ESVA 3M8RA 5HK4A 2XY8A 1AUSL 5LMUF 3LWLA 3O4WA 3P6YC 4CO1A 1B3TA 4FW2A 3AO2A 3BZKA 3TPQA 1NHVA 2E4LA 2H9ZA 2LU2A 3EUNA 1WB9A 1HBNA 5F41A 3K0JA 3LF0A 1GFWB 3IWLA 3W5YA 4LSLA 4DV4J 1ITPA 1I94J 3T3FA 4MIWA 4JS4A 3V1QA 2DPJA 1HKGA 2FJVA 4LIWA 5I9EB 2C2MB 1WF2A 4FOEA 1PG5B 5LJ3Y 5DGAA 1VQKN 4B3TJ 2F7TA 1C4AA 3VA3A 3FBEA 3HPGA 2XYHB 2E1RA 4ILLA 3IRWP 3W0LA 2Z1HA 1REVB 2HQCA 3L2UA 3QBXA 2BQ3A 5DDOC 1Y7PA 4IO9L 2KM8C 1WD6A 4JRQA 4CFBA 3PFOA 4N76A 5C2DA 2RD5C 4AQYF 4CGIA 4MJKA 3P31A 2NZ4A 2HPUA 1S0OA 4LR8A 3OHAA 1IR2A 4ZPWR 3MTKA 3TZWA 4O3RA 4J9VA 3A5MC 2UV8A 1FKPB 1T05B 3OHBA 1Q7YT 3BN7A 3Q86A 1C1CA 2D3ZA 3JSYA 4W5QA 4WQ4C 3CCMN 3CE8A 2V69A 2W42A 4I9QA 3R5DA 5GAHU 4CWBA 1RT2A 2P9UA 2LXIA 1RAEB 5EX5A 3N0VA 3DU6A 3LP3A 5DMRA 5BR8K 2XSJA 3QJPA 1IXKA 4ISFA 2CQGA 3SFUA 2K2PA 2CADA 2M8DB 1BI4A 1YJWN 3OXLA 4ZPVR 1NGHA 4WFZA 4CH7A 5IXUA 4TSXA 3MFIA 4CF9A 3PG9A 1JLGA 1M5SA 2IRUA 1F2GA 1YJNN 4I68A 3LDPA 3P45B 4B02A 1ZBLA 2ZJRL 4E19A 1BA1A 5I42A 2X6SA 1GLLO 3FSIA 5CZVA 1YJTA 3O9QA 3CIZA 2ZE2B 3S6EA 1E6YB 3C6HA 3HTVA 1FNMA 1IVZA 1JLBB 5HVGA 2PI5A 1W7AA 4IOXA 4X64F 1N36J 4CRJA 1TGOA 4O3PA 3PV8A 1UVKA 1JLEA 4YDUC 4KHQA 1U8SA 2DNZA 3W64A 4MLHA 3FBCA 4AE5A 3CD5A 4OZLA 4FNHA 1M1KO 3P8BB 1N33F 4HYKA 4R79A 3ET6A 2QMWA 3T1YJ 5BR9A 3QEWA 1SL2A 3VTHA 5KOXA 3ZSQA 2ATLA 1RHKB 3TABA 2YX7A 1TUWA 1QY7A 2IFXA 2BW2A 2RVJA 4LRFA 3ZEUB 3MPDA 3SI8A 3VPZA 4FXWA 2CJBA 2Z58B 3K8VA 5KQDA 1RTDB 3OR2A 2ASLA 4O0IA 2VFVA 4DV3J 2F9TA 4U7UD 2XHBA 1S6OA 2V2ZA 3T1HJ 2AEJA 3K9KA 4AH9A 1ZBUA 4G9ZA 4HI2A 4O44B 2YXLA 4TNOA 1HNZJ 2RHQB 3EKUA 1S10A 4BVOA 3D54A 3ENBA 1ZA2B 4L75A 3KK2B 1SQEA 1NGEA 3MI7X 4OHYA 2R9LA 2EKNA 3T5LA 1NH7A 3KKFA 1F9EB 2ZC3A 4OFZA 4NEZA 2ZFHA 1QTNB 3EGZA 1RYSA 4A4JA 2W8KA 1WSJA 4HT7A 4F0HA 2V50A 4DL3A 2Q2RA 3ATUA 5KG6A 2X1BA 2MJNA 4FBUA 4OKJA 4ANDA 4DPYA 3BKUA 5DLGA 3QATA 1HFEL 4A8QA 1UFLA 1GLFO 3I0SB 2FVRA 4BHQA 4EI2A 2AYGA 3CPWR 3DOLA 3OXFA 2IMOA 5ETVA 4QIGA 3CDAA 1GMWD 2QSWA 1TKTB 2LEAA 4B1VA 4DR3F 2IYGA 4CEDA 4PG7A 1X4EA 1WDDA 2FJEB 4NX9A 1TK8A 2XZWA 5ETMA 2MZ1A 3KHYA 3RU0A 1KC8T 4BDPA 2HFNA 4BRFA 3TUPA 3J80O 4KPYA 3V9XA 1SAZA 3HHLC 5AQWA 4DFPA 4DR4F 1CXQA 3QNNA 1RBRA 1UWBB 5SWMA 1YBTA 4H4KC 3ZX0A 2DHXA 2QEXN 5JJBA 4F0MA 4YY3K 1NK0A 3SFGA 3Q7BA 4UOFA 3UKUA 4FYVB 2VPXB 4CIOA 5HROB 3QNWB 3HJVA 4CJFA 4W90B 2ASDA 1YDLA 1SVDA 1RQ0A 4CO2A 2FJXA 5B8HA 4QCLA 1IBMK 3TU5A 3IC1A 2FD2A 3DCAA 4B3OA 4RWTA 3D6FB 4CP5A 1WC6A 3EMTA 3FZHA 2AP6A 3A8KA 3BY5A 1WSRA 2VH7A 5B7WA 3PXGa 1XMOJ 2O8EA 2C1EB 4DZDA 1O1WA 2XMVA 1DY3A 5C2GA 1HUXA 4IFVB 3FZ2A 4NLDA 2XQCA 1EETA 1YT3A 3V6HA 1RB0A 2NXUA 2VG7B 4UOHA 4JKHA 2KFNA 3L7UA 3MZIA 5IWAJ 3ZSYA 3N4WA 4U7BA 3PX0A 4CJSA 3R27A 3V9SA 3CCVN 3ZZTA 1VC6A 3PW7A 1QAIA 1HMVA 4ZIVA 3M1VB 1SL0A 2HBYB 1HWUA 4Y65A 3TAMB 4LFBK 4IDKB 5MLCV 2ZHAA 4CLWA 4DV6J 3SDEA 1FRKA 3GR0A 4K2JA 3FE1A 3VGLA 4O0NA 5DDQC 1ZZFA 4MMOA 3OYHA 2FBXA 3G8SA 2A5XA 3R2CJ 3NGDA 4WK3A 4DV1F 5ITHA 3HFZB 1RT4A 4CLYA 4JUZA 2A0FB 1XR5A 1L3TA 2MKYA 1SJ4P 1LW0A 1LNQA 4KHUA 3GU0A 2DY1A 2UXBF 5FDLB 4ED2A 3PO4A 3MHYA 3ZLJA 4M3TA 2OTLS 1IG9A 3W65A 3RR8A 2LSNA 2OTLN 2J7KA 1AZSB 3G86A 3KMSA 5L9XA 1X4CA 3OTEA 5DG8A 2X7IA 4RW7A 4JV2A 2P9KA 4NI2A 4PL8A 3M6VA 3O3GA 4R25A 5RUBA 2YNFA 1U6BA 1UJ6A 4KI6A 3V81A 2FHKA 2E5HA 4FYWB 1NDCA 4HR2A 1QAXA 4AXJA 1TFWA 4QW8A 4RBVA 2MQMA 1IN0A 2B4OA 5D0RA 1NKEA 1TZ0A 1C1BB 4K4YA 2RS8A 4A5BA 2XNRA 1ZC6A 3P49B 3ZSVA 1BGXT 3ISNC 4FWNA 2OIHA 3CVKA 3CSKA 4M94A 3H4BA 3U1MA 1VQSA 4CM0A 1BL3A 2LQBA 4J2DA 2J9EA 4RNFA 4PWDA 1NGAA 2F9DA 4JKDA 4B1XB 4DN0A 4M63A 4BR9A 2RB7A 4ZPAA 4FJMA 3NHGA 4MLEA 2PZSA 2HHSA 3SBMA 4RG8A 2FGCA 2L41A 2M8HA 3QSIA 2YI1A 3MFHA 4AHCA 2M5YA 1RADB 2I5JA 2LXFA 2ZH5A 4USUA 2GQ2A 5EUHA 4I4BA 4K59A 4CH1A 2KDOA 5AQNA 3PKMA 3EYZA 1HQ2A 5HBMB 1XR7A 3NGZA 4X64K 2RRNA 1DQ9A 4RCHA 2O8BB 5BN8A 2POKA 1RLCL 4E7LA 4LF8F 4H0PA 4CJWA 4A8KA 3CQXA 2X3DA 5GAGI 3CCQS 4GVMA 1JLQA 3N9UC 2AIRB 3HFKA 2NXNA 5IWAK 2KJWA 4CLUA 3ENQA 3EE9A 1VIXA 2IS3A 4DLEA 1FX2A 1U45A 1RT6B 3DRPA 3PJXA 4ITSA 4JI8K 1VRTB 3L7PA 4ISEA 3UN3A 3OYBA 4TU9A 2ROGA 4JB8B 2KH9A 4M63C 4FJIA 3RB3A 3NNAA 2LEPA 4JI1K 4BC3A 3FFIB 1FXRA 2AMCB 2OSRA 4A8SA 5I4MA 4ED4A 3A1YG 2E1AA 3RBXA 3GSDA 2IA6A 1NHUA 5IT4A 4OI0A 3QRQA 3VGVA 1JKHA 4Q43A 4JD2A 2NZTA 4HKQA 2YWWA 1YVNA 2IHR1 6FDRA 3M8SA 3D68A 2QO3A 3UWTA 3SAHA 1DTQB 1MN7A 3CJSA 4B8AB 2KQ2A 4DU4A 3TQEA 5E5NA 4WQ4A 3G0ZA 1EKRA 2JEGA 1EQMA 3BGRA 3BF1A 3KUGA 1JIHA 3ZTOA 2WVEA 3DGPA 2XHWA 5CH7B 1U2VB 5BRFA 3M2UB 1GMWA 4OGEA 1QUVA 1TL7A 1I1GA 4KV8B 1NRKA 2D1CA 2C2EA 1XNRF 5BRHA 3GILA 1N5YB 1LAVA 3BN4A 1VBXA 2QYGA 3N28A 3MAAB 4MT1A 2AEMA 2PIIA 1U24A 1KAXA 5AQVA 3SSSA 4OX9J 4XH1A 5KFNA 2XS5A 1S99A 3N6MA 4ZVOB 1WSHA 1WELA 1HNWF 4J9KA 2YNIA 4C0HA 3DRRB 1N5QA 4LF6J 1WSEA 2XS7A 2APOA 1HI8A 4C0BA 3ITHA 3G82A 3PEJA 1RDDA 1TKZB 4ALZA 4TQSA 4CHOA 4P7VA 3GJQB 3TTCA 1NPKA 3B8HA 4JI2F 4LVOP 3Q8YA 2QK9A 2IY5B 4KH1B 3W63A 3FMBA 2HB5A 5KPZA 1D1UA 1XMQK 4KREA 2YVSA 5BXIA 5I3UB 1IR1A 3H08A 3EEQA 4E3SA 1HWIA 3KDOA 4DUYF 1N32F 1CJTB 4EZ6A 4NLYA 1X4BA 4A5AA 3M32B 1DTQA 1C0UB 1RDBA 4FJGA 3H98A 5J1EB 2F3JA 1MMLA 3WX4A 4A8YA 5AT1B 4LJMA 3BZCA 4AM6A 2RUGA 3VF6A 1T94A 2BH1A 3D2FB 4B9LA 4UZCA 1M5PC 1FEHA 2QLJB 2FDNA 3QFWA 3ENHA 3SQGB 4WFYA 4C2MA 4RU9A 2B43A 1NG9A 2XS2A 1TAUA 4ZLLA 3L9ZA 2ZJQL 2R7RA 1OH7A 4NOHA 1N33J 1HLWA 2XMMA 2B7CB 2IPOB 1NU4A 1K8AO 1EB0A 3OFEA 2HGMA 3D2WA 3PX6A 1RSCA 5ETRA 4BGBA 1WG1A 2F4VK 3CJ9A 4OI3A 3CXCM 4KGZB 1RAJA 4IKAA 1AXQA 2YWGA 1RWVB 3GV5B 3M1FA 4CF2A 4O55A 1KFDA 3L09A 3CDBA 1IM6A 2QTDA 2NYHA 3EY1A 3CCQN 2MKJA 1VK8A 4Y2CA 4E7KA 3JYTA 2LQ5A 3ZXWA 1X0PA 2QM1A 4B3MF 2DPNA 7FDRA 2BE9B 3AJ2A 4M3WA 2R7QA 3WNFA 4OIXA 2P9LB 5F1XA 2QC3A 1RT3A 4BE1A 3R6GB 1T9WA 2E5LK 4ZLJA 2DR7A 2IM1A 4XTTA 4ECUA 3UDEA 5IC4B 4C8MA 2ZM6K 4ZK7M 3TSQA 1QQMA 4PWWA 2NNWA 4E2FB 3K5LA 2PMZD 1GLBG 5B0AA 1HW8A 3SQ2A 4DTNA 1S79A 2HNYA 4IKFA 2MQLA 3SV3A 3WIVA 2NR0A 2GAHC 1YX2A 2Y1RI 2DFFA 2CVEA 3PW5A 2VICA 1KOHA 3CCLS 4LF6K 4IJNA 5F8LA 2O5DA 4LMZA 2NLXA 3V81B 1LWCB 1VQYA 4M45A 4K4ZA 1ICEB 3THXB 1N34F 2E8AA 3W60A 2H3GX 5G0RB 2DH9A 2BJ8A 1FRMA 4KHSA 1QUPA 1NGIA 2LFVA 5E3AA 1UVMA 1RKIA 4JEPA 4DV2K 3KKRA 4WWSA 4IRCA 2C3UA 1T9VA 3I5AA 1NH8A 4K5SA 1B92A 3ZX3A 2B6AA 4BE2A 5AQXA 1D9AA 1MDUB 4YY3F 4CJ7A 1XMOF 1E3MA 1WC1A 1JJCB 2YKPA 4O5BA 4CECA 2MJUA 4HI1A 4JHDA 4XDDA 5ETLA 2A18A 4ZVPB 4CEZA 3HHNB 2HFUA 3VQ9A 4JI4K 4FWKA 2PT0A 1S1XA 4NRUA 1VQ4N 3CJKB 1QE1B 2UV8G 1JWWA 4LF7F 3AO4A 5JXSA 4DR4K 3LL3A 2DBBA 2OPSA 3OBIA 2VPWB 2KW4A 1PCAA 4L72B 4Z0UA 3QMLA 5J2PA 4WF9Q 1D5AA 1UCNA 3RMAA 4JI8F 4ED0A 3CI5A 2JLEA 2OTJS 5AQSA 3TA0A 3MAQA 2AJQA 3M2RB 3D4JA 1RKJA 4M3UA 5CYMB 2KT3A 5C24B 1RWOB 4DX6A 2V2KA 4MKBA 4LR9A 4FBTA 5ETSA 4DTMA 1DQAA 4OZ0A 2ZOFA 2BANA 3ZTQA 2V34A 4A59A 3SV4A 2JEFA 5IT9O 3MUMP 5LJVA 5HMZA 2NRVA 2LP4A 3DHXA 1JCFA 1HQUA 3UO0A 1NHKL 3NDKA 4HHTA 2ZZNA 3OV7A 3MEGB 3I87A 1NSQA 4JAXA 1CS4B 1ZM9A 3BUZB 2XMWA 4Q5VA 4M5DA 3H59A 3WEEB 3KOAA 1L3KA 1D8YA 3RAXA 2WW8A 2EFVA 2UU9F 2HGNA 4WP3A 5U47A 3GOIA 2FC8A 4B9UA 3KHRA 3TZZA 2BRKA 1JJ2M 1SPBP 3UW1A 3DAWA 2QN6B 4JK7A 3DXKA 3ZT2A 3QDKA 2E1PA 5M1NA 3A8EA 2VF3A 4BGAA 1R3NA 3GLJA 1WC4A 2JDJA 5E2QA 4HACA 4ECXA 3IWXA 1MU2A 3KK1B 4URGA 2BUNA 3AAWB 3MR2A 5ADXA 5J1EA 4A2AA 3PYEA 4LF1A 3MM7B 2E44A 3ZZPA 1M5HA 5EN1A 3DFEA 3B54A 1U49A 4LVNP 3BQ0A 2PGCA 1B99A 2C2ZB 2WTFA 4WTYA 4BVPA 3NH0A 2F9WA 9RUBA 2PMWA 3Q7CA 1U04A 3TWHA 3H1QA 1HR0J 3ZTPA 1VAZA 2DRDA 1KWMA 1FVSA 3Q89A 2OUGA 2FSJA 2Q6BA 5SZTA 5L8RC 4YS2A 2Z1IA 1VQ5S 1ZM4A 4YOWA 3O1WA 4OYBA 3M3ZA 3HSJA 4DV7K 2RDDA 5LMNK 1UFKA 2RRAA 1DTTB 1UFWA 4NLPA 3CCJN 3MPWA 2LQJA 2Y3YA 2O8CB 2PI4A 1H7XA 4IR9A 5D4NA 4FJ9A 2VFRA 5A2QU 2G2ZA 3DOKA 2YPYA 2Z2MA 4K5RA 2HQFA 1WNSA 1D8ZA 1KRPA 2J4RA 2JLFA 1TL5A 2BOPA 2BX6A 2DIVA 4QR2A 3DGPB 2OGUA 4JI5K 2ZVIA 2W4PA 3AD7C 4CZJA 4KBOA 3QEXA 2LEBA 1T9UA 3CCWA 4HTJA 3GL1A 4DQPA 3L7OA 2ZQBA 1R8CA 4X84A 2ZJPL 4F8RA 2JNJA 1FF2A 4CJTA 1U1PA 3DRXA 1T7PA 2O8DB 3RW7A 1NJYA 4ID5A 4O4RA 1R8PA 5FLXU 1SZ2A 3RYLA 4OQJA 4NL5A 3OY9A 1Q86O 5T7LB 1RBTA 3DGVA 2O66A 4DR6K 3T6BA 3SJJA 1GX6A 3QNOA 1YXQA 3SSQA 1MLAA 2UUAK 4DX5A 4J2BA 4GNIA 2MQOA 1RT6A 1BA0A 4FLUA 3IFEA 2KO1A 1XQIA 2JWLA 2HRUA 1J53A 1QSLA 4EO8A 4Z4HA 2L9DA 1H2TZ 1I94K 1RWKB 1CQNA 3UI3A 1LFPA 4CNYA 3GV7B 2EEYA 2D0OA 4AHRA 3ZZRA 5EGYA 2C3PA 3W2VB 2HNZA 1I6JA 1VJQA 4BE0A 4YMEA 1ZETA 5LY3A 2SXLA 4KIAA 4AILC 4K4XA 5C15A 4N8OA 3V4IA 3AA4A 3FBFA 2BW7A 3I0RB 1U6FA 4E7HA 1V6HA 3JAMU 2XO7A 4B1ZA 4CZKA 2ZNZA 3U3YA 2HS0A 3A0IX 3KUHA 2XULA 4FKYA 4OX6A 2PEBA 5A2QY 4IR1A 3AA2A 5B08A 4R8UA 2JEJA 4TYAA 2P9NA 1PYOB 3RGIA 3CFOA 1R8HA 1RTIA 4FYDA 4CVNE 3JSMA 2C2OB 5TKWA 1WC0A 2GHPA 1Q82O 2VDIA 4TLQA 4NPOA 2XM3A 1C1BA 4MIAA 2ZC4A 3CCMS 3I82A 1M1GA 1FXLA 5KFVA 1DJ0A 3QIOA 2ZBIA 1UAWA 4IFEA 4F3TA 1TKDA 1DFDA 1LWEB 4I7FA 1WEXA 1FA0A 4H5TA 3OS0A 1IKWB 4NZ6A 3TR5A 3JSBA 3RTVA 4DTXA 3OYKA 2HBMA 2OSQA 2XO6A 3GIRA 4YOVA 2B0GA 4QBUA 1SJRA 2Y9HA 3FFIA 3TA1A 2YKNA 4F4KA 3G6VA 3K7RA 2MB0B 1RDUA 4K41A 2MZQA 5KG0A 3QFPA 5C42B 2I2YA 3CCRN 2UUCK 5KT2A 2V68A 2WSEC 4ZP8A 3VAFA 3R2DJ 3J8AA 5AQRA 4LH4A 3ZT4A 3ZETA 1S1UA 1GMVA 3RZAA 2K3IA 4LF5J 4CD3A 3VQQA 4ZJQA 3U1LA 4XIUA 2MKSA 1Y97A 2B5JA 1YZ6A 1YWXA 1S1XB 4FLZA 4ATNA 1WSGA 4YQWA 2HEKA 3MEDA 3S3OA 2R7WA 2AEFA 3S7RA 2F9JA 3MMCA 2E7VA 1QQNA 4NXMF 5HL7L 3TAPA 4ZCMA 1SQGA 3BP8A 4J5OA 5GAGU 2VOOA 4C11A 4DSIA 1JL2A 4DBQA 3CTRA 4JK9A 1JL1A 4MK8A 1FXDA 4YDXA 1L5UA 1BUXA 5ELZA 2UVVA 2ZH8A 3VQ5A 1TL1A 4DUZJ 5AFUH 4QWAA 3IG1B 2HBKA 2VCPA 4DLGA 4ZA1A 2E1YA 3WDOA 2HAFA 3U7JA 2DO0A 3M6XA 2YKQA 1F2HA 2ZHBA 3P38A 3NF9A 5B0EA 1VYAA 3FFKB 4P71A 3TI0A 5H1SQ 4OYPA 4EFAC 2K7KA 5JVGQ 3U4LA 2B9YA 2NSBA 3BR9A 3V4MA 3LA0A 1VSLA 5M1QA 2QG9B 3W7BA 1TL3B 2VFSA 3GSIA 5HQ8A 1GH8A 1NGBA 5F8MA 5BR8F 2D74B 1V3ZA 4N56A 4RW8A 3KHGA 3Q8UA 4NLBA 2HQGA 1FW6A 5J2NB 4CO3A 2HMPA 3M8PB 3JSMB 1G3OA 4YR3A 2IMWP 2C22A 4NCGA 4DUZF 3EKSA 1N0UA 1G99A 2BJ3A 4ZLPA 3HZEA 5CA5A 2WFBA 4C3MA 2KG0A 1KS2A 3AA9A 1CXUA 1XERA 2MQPA 3KLFB 4I9LA 1AROP 1HA1A 2DGXA 4X4SA 4F26A 3A4TA 3V4IB 4CJ5A 4OL8A 4J9QA 2GIRA 2BOAA 4LBIA 1J27A 2CAJA 1S6UA 1W7WA 1TK5A 2MZRA 2OJ3A 3SUNA 2HZCA 1RBLA 1VQON 5AQIA 2OH2A 3SQ1A 1B0PA 5L46A 4EFHA 1B64A 1BOTO 5E3PA 1LWCA 1VQ4S 3HT3A 5A0YA 2W41A 4XEIA 2FB0A 4K42A 1RA7A 1JJ2R 4XH4A 4FJKA 2F8EX 3C15B 1SC3B 4GKKK 1OIAA 2F63A 3QO9A 1WKLA 5KFCA 3E9LA 3Q83A 4JI7K 3VA0A 4CO5A 4WKRA 1VJWA 3M6GA 3CC2S 5AZIB 4PZVA 1QHTA 3OYEA 4ANEA 2FJWA 1HI1A 3PKYA 2ZM6J 3CD6S 2QXFA 2B3TB 3CJTA 4OKEA 2W9CB 1NMNA 4CFCA 1NK8A 3G4SS 2F40A 1NUEA 1RBUA 4HUGA 4PKHA 1KAZA 1SJ3P 2PBDA 3W1YC 3UFCX 4KPCA 4NEYA 3JYTB 1RHJB 2QMXA 1EX8A 3LP1B 1OQ3A 4MKVA 3NS7B 3QAUA 3QICA 2CUYA 3BQ2A 3RMBA 1MG7A 1E4GT 3FCWA 4OGCA 4W5NA 4OZ1A 2CQPA 3FGVA 2M52A 1KQGB 2ASOA 4JI1J 2IOCA 3C95A 1IKXB 2M2BA 4JYAF 1SC4B 1S12A 2F8SA 4C3KA 3H90A 4IG3A 3CCZA 2QGFB 3OL9A 3HT0A 3PEHA 1ZBIA 3NF6A 3POTB 1JLBA 1X1PA 4EK2A 4ISGA 1HLUA 3N6NA 1HKBA 1LXNA 2IAJB 2C3MA 5JLHA 3FZMA 2VBWA 4JV5F 3PR5B 2EC0A 3H46O 3LDNA 4DN9A 2JSXA 2AA4A 1VISA 1RYRA 1BDGA 4B3MK 4QS7A 4DMZA 5IV4A 2FHJA 2XMJA 4O4GB 1UWAA 1WI8A 3W2VA 2FVSA 1IBLJ 3VEYA 2HMIA 5KFPA 4J9UE 2Z4PA 2R7VA 3IM9A 3M32A 3N4QA 3VQCA 2ZBRA 3FEYB 2HWHA 5GADI 3S1TA 3G6XA 3OYFA 3IBFB 4LQ3A 3P4UB 5M2PA 5KFIA 1VQ8S 4OPKA 2M70A 2RJZA 4CYUB 3VF2A 4ECYA 3SBGA 4KAIA 5KFJA 3PJWA