2VG5A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
557
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 144
structure length 551
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg5A05
4DFKA 3C6TA 4KTQA 1C0UB 1ZTTA 3EZUA 3DOKA 4MKAA 3HK2A 4CIEA 1KLNA 2J6SA 1HQUB 3BJYA 2G8WA 4FLUA 4CFCA 2AX0A 1WSIA 3RMCA 4KB1A 4MFBA 4NLQA 4EBEA 1HNVB 2R8IA 3MEEB 4E7IA 4IFVB 5KG7A 1RTDB 4IDKB 2HMIA 2HHTA 1JLFB 2KQ2A 2VG7B 1SUQA 4J9OA 4EZ9A 4PQUA 1IG9A 4NLDA 3KLVA 4NYNA 4M3RA 4JS5A 4BACA 5HBMB 2XGQA 4FW1A 4B3OB 4Z4IA 3EPIA 3KK2B 3QIOA 5KFYA 2RF2A 4N47A 2ASJA 1ZBLA 2IM0A 4CEZA 4C8OA 4QW8A 3NDKA 4ZPDA 2G8IA 4EEYA 3NKYA 1IKWB 1TKTA 3MAQA 3A2FA 3OHBA 4CHOA 2FVSA 2OPQA 3B6OA 4O44B 2W8KA 3SJJA 1BQMA 3OL6A 4CEDA 1IKYA 2D41A 4ZPBA 1TQLA 1RA6A 2V4QA 3VQQA 2I5JB 1WLJA 2OPRB 4ICLB 3BQ0A 4MKBA 1TV6A 3GIIA 2P51A 3KKSA 3G6XA 1S10A 2BR0A 1HRHA 3UR0A 4LD0A 3NBPA 3DYAB 5KFTA 5C42A 3LPUA 1EETB 4B8AB 4CIFA 5KRTA 3AO2A 4ECQA 5KT5A 1BIZA 4NCBA 3LAKA 1XR6A 4N76A 1SH0A 4B8CA 2D0CA 5JXSA 3SUOA 3BDPA 4RUCA 1RT6A 4Z4CA 1J54A 4NCAA 1S0OA 1IKVA 4ED2A 1RTIB 1JLEA 2PY5A 2E6MA 2OZMA 3BSAA 2HB5A 2FLLA 4DQRA 5KFIA 3PO5A 4B9SA 2D7SA 2RDIA 2GC8A 2O4GA 4CJ4A 3DMJA 4WZMA 4TQSA 5HLFA 3CO9A 1KSPA 1BCMA 4DSIA 3DI6B 3NAIA 4HKQA 3OL8A 4RW4B 3ASMA 5E41A 1TKDA 3TR8A 4FLWA 4Q0BA 1U04A 4CHYA 3LANA 3PW4A 1HJRA 4EP4A 1U09A 2B6AA 3PW5A 4EO8A 4ECYA 3I5BA 3AO5A 1KHVA 3V6HA 3JSMB 1ZBHA 4ZVGA 5DG7A 1ASWA 4Y1DA 1RTHA 1JL1A 4KHSA 4O4GA 4DTNA 3QGIA 1TL3A 1T7PA 4O3QA 4QWDA 2PZSA 1RT5B 1U49A 3S3OA 3IS9B 1RT7B 3H08A 4FCYA 2VG6B 3AVHA 3AVKA 2BANB 1WSGA 3H4DA 1LWFB 4DFMA 3OLBA 3FFIA 3NGZA 3DLBA 2ZE2A 1BISA 3RMBA 4CECA 1OS5A 2EC0A 1NHVA 3MXIA 2HNZB 4IOBA 1RBUA 3O3HA 5KRSA 3I0RA 4NRTA 3NL0A 4CJWA 4CGFA 4CGIA 1N48A 4FJXA 2QE5A 3LP0B 3I0SB 2W9CA 2JEGA 1TVRB 4E89A 4IRCA 5K14B 2B5JB 2CKWA 1DLOA 1ASVA 4KBIA 4IG3B 4KHNA 1HQEA 4KFBA 3VQAA 1CZ9A 5JS2A 2WB4A 4WYWA 3TAEA 4ED8A 5CYMB 2YNGA 1S97A 4FBUA 4QWEA 1J9AA 4KI6A 1Q9XA 4KO0B 3ZSVA 3QYYA 1JL2A 2YNHA 1FK9B 3DRPA 4H4MA 4I7FA 5J2NB 3K5MA 4BDPA 1KRPA 2KZZA 2LSNA 4FK4A 1JIHA 4B9TA 2B4JA 3CJ3A 1RT2B 4NLPA 4KHUA 3VQDA 1GX5A 1N56A 4ZP6A 1JKHB 3KMSA 2QKKA 3AVAA 1K1QA 3CJ0A 2Q3SA 3GV8B 3DRSB 4K8ZA 4DL3A 1BQNB 3UIQA 2R8HA 2E4LA 2HHQA 4FVMA 1UWBB 2IDOA 5EDWA 1TL1A 4RW6B 3BSOA 3LAMA 3NF8A 1NKEA 3OSNA 4ZHRA 3P5JA 2IGIA 5FDLB 4ELVA 4E7JA 2HNDA 1JLAA 3DLEB 4M3TA 4AHUA 3OYHA 2RDJA 3SUNA 2JC0A 4O5BA 4M95A 2FVRA 2J6UA 4OLBA 3V9ZA 4FJIA 2ETJA 1XR5A 3FSIA 5J1EB 3M8PB 3RB6A 3WNHA 3HPOA 3NFAA 3SQ1A 3N6MA 3RWUA 4FZXC 1HYZA 3KLIB 2YKMB 2F8EX 1RDBA 1S6PB 3JYTA 3CWJA 3PR5B 2JLEA 4C8MA 2E9ZA 1FKOA 2Z1IA 2FJXA 3G6VA 2GV9A 4E19A 1F21A 4J9PA 4ED7A 1XHXA 4DS5A 3KTQA 3KK1B 3T1AA 3QIDA 4O0JA 4CJLA 1VSFA 4GC7A 3V9WA 4NRUA 4ID5B 3MEGB 3KLFA 3IG1B 4EYHB 2FJVA 2WHOA 3V9UA 2JEFA 1VRUB 4ELTA 1LAWA 3QETA 4KAZA 4CJVA 1C1BA 3PV8A 1JLCB 4IDKA 5L1JA 1Y97A 1JLFA 1QAIA 2WCXA 2ASDA 3O3FA 2VG7A 4RG8A 4NCGB 3SFGA 3KLGB 5F8GA 5HBMA 5J2QA 4XO0A 3LWMA 4LSNB 4B3OA 3O4NA 4ZVHA 4F4KA 3D0PA 4FJJA 5JUMA 3ICLA 3L2WA 3AA2A 2GIRA 4NLRA 2AU0A 1B9FA 3PJWA 4Q8FA 1A5WA 1YVFA 2OPPB 4FW2A 3WNFA 2KFZA 4BDZA 3OJUA 3Q8SB 4FJMA 3TVKA 2IC3A 3SI8A 2I5JA 4DTRA 1QSLA 1UA0A 2OPRA 4CF1A 4ICLA 4OL8A 4TQRA 1I3AA 4R5PB 5F8MA 3RB3A 4EP5A 4ZMMA 4LQ9A 1WSEA 1QQCA 3BSCA 1J5OB 3NE6A 3RRGA 1A5VA 4DL7A 5KFBA 1S6QB 4PUOA 4DG1A 4J2BA 4OKKA 2HAIA 4DSFA 4MK9A 3ZT1A 3PHEA 2R2SA 1S5JA 1NJXA 4Z4HA 3FRZA 4KKOA 4GMJB 5DG8A 4M94A 4F4XA 5EWGA 3QEWA 4DSLA 3H5SA 3KLEB 2W9BB 5CYQB 4F2RA 1S9EA 1DTTB 5KFPA 3N6LA 3CJ2A 1ZBFA 3AO1A 4ZPCA 2BQUA 3PX0A 4DTUA 5KFFA 1T05B 3H5XA 4XPCA 4FJKA 4F8RA 3PY8A 1RT4B 2FVPA 3CFRA 5F8IA 2RKIA 1CZBA 5DGBA 1SL1A 2AJQA 1C2PA 2BE2A 5I42B 3L2UA 2CJQA 1NK8A 4QOZB 4CK2A 5KT6A 4IG0A 2HWIA 3OYNA 4NLTA 1RYSA 1LWCB 5J2MA 4M41A 5KGWA 3HVTB 4LSLB 4K4YA 3D45A 2VWJA 4QWCA 1RT5A 1S0MA 3KLHB 4DF4A 4CGDA 4U7CA 3IS9A 1RT7A 1KCFA 4Q43A 3OYEA 5I3UB 2BANA 5HP1A 1LWFA 4IR1A 1YTUA 2XCAA 3CJ5A 1GOAA 3V1RA 3F73A 3RB0A 2IBKA 2WTFA 3K5OA 3S3NA 5KFDA 1WSHA 5HRPA 3BQ2A 4RW7B 3B6PA 4N41A 4KB7A 4O4RA 3L8BA 3I0SA 2Y1IA 1U47A 1LW0B 2IAJA 4BE2A 2R2TA 3QNNA 2B43A 1WNEA 3AO4A 1L3TA 3QERA 3L2VA 1NK6A 2XY5A 4G1QB 3GIKA 4HUEA 1RAJA 1VRTB 5KFOA 4OLAA 1RBRA 2ATLA 2UVUA 5JS1A 1REVB 4CHQA 4KTWA 4HTUA 3BGRA 4OPJA 5D3GA 1Z25A 3K58A 3ULDA 2QK9A 1D8YA 5J2NA 2UVVA 3BQ1A 3QINA 4RW8B 2HHUA 4IRKA 2KFNA 3NGIA 1K6YA 3QGHA 4FK2A 3LP1B 4NYFA 1DTQB 5EWFA 3AA4A 3DOLB 1FKPB 4QWBA 4ZP7A 4KHRA 3NF7A 1NHUA 1JKHA 2J6TA 2UVWA 3EYZA 2QXFA 3GYNA 5F8NA 1LWEB 4HUFA 1BQNA 5EUHA 4OVLA 3TAMA 4TY8B 4BDYA 4DFJA 4FJLA 2ILZA 4M3UA 4Y1CA 3TAQA 1X9SA 4DEZA 3M8RA 4RW6A 4F50A 3NHGA 3HKWA 3OVNA 4Q45A 1S1WB 2ZD1B 3E01B 4I2PB 3RBDA 4N5SA 4AHCA 4MK8A 2D3UA 1BI4B 5FDLA 3V6DB 2UUWA 5SZTA 3V81B 4QWAA 3CM6A 1S1VA 5KG1A 3MECA 3T5HA 3OYJA 3OL9A 4J2AA 1RDAA 1S1TB 4CESA 2XI3A 1C6VA 1ZBUA 3PZPA 3ZCMA 4ED1A 4J9LA 4CGHA 3E51A 1EP4A 3M8PA 2VA3A 1C1AA 4IH6A 3PX4A 1UOCA 3NAHA 4BE0A 1YTAA 1JXBA 2P1JA 2UVRA 1QUVA 1HMVA 5EWEA 4ECSA 4RNOA 3VQ7A 4W5QA 4MH8A 4TY9A 5KFNA 3ISNC 3NH1A 3H40A 1I6JA 4YR0A 1WNSA 1N5YB 2E6LA 3HVWA 4ECTA 2OPSB 1LW2B 2GUIA 3OYDA 3WNGA 2IJNA 3OYMA 1L3VA 5KG0A 5KT2A 3T5KA 4CJKA 4NZ0A 1BIUA 1VRUA 3LZIA 3U3YA 1R0AB 1S9GA 5KFMA 1HPZA 1JLCA 4W5NA 3CDEA 3T3FA 2YV0X 3HPGA 3MF5A 3MEDB 4J9MA 1MU2A 1RT1B 3SI6A 5DG9A 5HROB 1RDCA 3MTKA 3CIZA 1NJWA 1SKRA 2JGUA 5C25B 2R2RA 1ZYQA 3SUQA 4FJNA 2QV6A 1TK5A 4CJRA 2WRMA 1QE1B 3K2PA 4KV8A 4GVMA 3OS2A 4Y2CA 2OA8A 1HNIB 4ED3A 1RBSA 1JLBA 3O4QA 2C28A 4M45A 4ZVFA 4K4UA 3TWHA 1Z26A 2D3ZA 1VK0A 3QGGA 5C24A 4YFUA 3QEIA 5HRSA 4R8UB 1VSDA 4FK0A 1VSIA 1TKXB 4YQWA 1T03B 4Z4GA 1S1XB 4QW9A 5F9LA 5KG2A 1TKZA 4F4WA 4B9LA 4CEAA 1RT3B 3TANA 4KI4A 2W9BA 4CJUA 1DTTA 1HYSB 3GV7B 3CFOA 2XCPA 1WAFA 2RN2A 2YNIA 1KLMA 3ZT3A 4PWDB 3V9XA 4ZPAA 3DRRB 3AVLA 2XI2A 4AH9A 2IOCA 1D1UA 1RT4A 1N6QA 1GOCA 4FJ7A 4WE1A 4QAGA 3DOKB 4Z4FA 1NK4A 3KHGA 2R8JA 4CJ3A 3TAFA 3QZ8A 3DM2B 2IM2A 2Y1JA 3CDWA 2JC1A 2HNYB 4CJ5A 2X6NA 4B9MA 1KFSA 1GX6A 4MFBB 1JLGA 1B9DA 4OKJA 2G8UA 2AGOA 4KTZA 1KVBA 3RTVA 5FRNA 4C8NA 4B08A 2XHBA 3C6UB 1VSJA 2GBZA 2WONA 3KOAA 2X74A 2KZMA 4Y34A 4KHMA 3AVMA 4TYBA 4ED0A 1XR7A 2Z1GA 1B92A 2Z1JA 3IRXB 3SZ2A 1IKXA 5KG6A 3D28A 3KJVA 3DLGB 3MR6A 4CE9A 5DGAA 4DLEA 3BSNA 3Q8QB 3TARA 5KFSA 4IH5A 2YHAA 4IKAA 5J2PB 3G86A 1W0HA 3T5JA 4Q44A 4DQIA 4DSJA 3QIPB 4CHPA 3RAXA 3HVRA 2D0AA 4CFAA 1IKYB 2OZSA 4YP3A 1LW0A 1S9FA 4HHTA 2OH2A 4RW9A 3CDUA 4CF9A 4KRFA 3ZSZA 4BWJA 4JUZA 4CFBA 4ELUA 2XC9A 4O3RA 4OGCA 2XY8A 1JX4A 1TV6B 3NF6A 1C0UA 4ZP9A 4G1QA 2G8FA 4EBCA 4WZQA 2HHWA 1REVA 1IM4A 4TLRA 4NLUA 1HQUA 3L3VA 4J9KA 2HVHA 4FXDA 4DL2A 1C0MA 3DLKB 4RW8A 1HNVA 3MEEA 3RBEA 4O3NA 2AQ4A 4AHSA 2W42A 3TAGA 4IFVA 2ALZA 5KFWA 3KHRA 2FLPA 3LP1A 2Z1HA 1ZBIA 1Q8IA 1RTDA 3N6NA 3DOLA 3VQBA 3CFPA 3HT3A 1IKVB 3VN5A 3QO9B 3DLRA 1X1PA 3M8SA 3SPYA 2GIQA 4HCCA 4IFYB 4CF2A 3QESA 1LWEA 4K8XA 1W25A 3KK2A 3EPGA 3CG7A 5HLFB 4TY8A 5KFEA 4W5RA 4K4XA 5KFGA 4KSEB 1WAJA 3TI0A 3HO1A 1IKWA 2FBXA 4I2PA 4NYZA 4O44A 4URSA 3LP2B 4I9QA 1T8EA 4Y3CA 2B6AB 3V1QA 3CQ8A 1NOYA 4CEFA 1D9DA 1S1TA 4DL4A 4DU4A 3KIOA 2VG5B 1UAXA 4O3SA 4CF0A 4M3ZA 3O3GA 3DYAA 1QHTA 4YNQA 3ZSQA 1EETA 4E7KA 4CIGA 3ZSRA 2FBYA 4CHNA 2KTQA 4E0DA 3NGYA 3VQSA 3OYCA 5FRMA 2RPIA 2WOMB 2G8HA 4NLSA 4ID1A 4PA1A 4DSKA 3FFIB 2ZKUA 4JS4A 2ZE2B 1S48A 4W5TA 1TAUA 3S9HA 2AX1A 4AHVA 4RNNA 1N5YA 3HL8A 3M9MB 1RTIA 4EO6A 3V6JA 3VQ4A 3SNNA 1RA7A 1RBTA 4PY5A 3I0RB 4CJEA 1EKEA 1SL0A 4HYKA 4CEQA 4CJSA 1R0AA 2V9WA 2W9CB 1S0NA 1U4BA 2DTUA 3VA0A 1DLOB 3DI6A 2IM3A 1KVCA 4LQ3A 4RW4A 1RTJB 4KFBB 1QAJA 1NK7A 3NH2A 3MEDA 1HYVA 4JRQA 1RT1A 2JEJA 2BDPA 4FM2A 3MR5A 1TK8A 5KG3A 3V4IB 2HWHA 4I9LA 3DRPB 4H4MB 3SCXA 1YVUA 4DMNA 1NJZA 1SL2A 3CVKA 1QS4A 3ITHB 4O3OA 5T14A 3JSMA 4CK1A 2P5OA 4FM0A 1RBVA 1QE1A 3M9OB 3V6KA 4IH7A 3PX6A 3OLAA 4AILC 1HNIA 4X2BA 4YR3A 2YNFB 3RB4A 1CXQA 2VG6A 2W7PA 1C0TB 3IGVA 1RYRA 4EZ6A 4BWMA 2FLNA 3PW2A 3ZSOA 1RCHA 4R8UA 4FJGA 2HNZA 4H8KA 1JLQB 2YKNB 4KAIA 2C22A 3QEPA 5KFZA 4K4SA 4O55A 1NJYA 2ATQA 4B9VA 4KB0A 4C8LA 3LP0A 4EBDA 3OYBA 1TVRA 3LZJA 5K14A 4NLYA 2B5JA 2XGPA 2G8VA 4IG3A 1GOBA 1KFDA 1CSJA 1ZETA 2R8KA 3LDSA 3K5NA 4M3WA 5KFQA 2ASLA 5CYMA 2XO7A 3LALA 3SV4A 4KO0A 3U6FA 4PWDA 1FK9A 1WSJA 3VQ8A 5KFJA 3ZSXA 3JYTB 3QLHB 4J9SA 1O1WA 1WN7A 2G8KA 4J2EA 5FROA 1FKOB 3HSTB 1L5UA 4LH5A 1XWLA 1KHWA 3I5CA 1RT2A 3QNOA 3DM2A 3VA3A 3G6YA 3AVJA 3AO3A 3PJXA 3VQ6A 3OYGA 2HNYA 3M9NB 4DQQA 5KG4A 4Z4EA 4DU1A 3KLFB 4WXWA 2XRIA 1C1CB 3DRSA 1BCOA 3HXMA 2A1SA 3C6UA 2W7OA 1C1BB 2VA2A 4JV2A 1QSYA 4K50A 4H54A 1UWBA 5C5JA 5KT3A 4YMEA 3EZ5A 4EYIB 4LH4A 4KPYA 1FXXA 1KTQA 5J2QB 3V9SA 2NUBA 1S4FA 4IR9A 3SUPA 4ZTFA 3IRXA 4FBTA 3KHLA 3DLEA 3TAPA 2YHBA 1UA1A 4ZP8A 2C2EA 3DLGA 4F2SA 4H4OB 2FBVA 4I2QB 5J2PA 1RDRA 1VSHA 4MIAA 4NLOA 5J1EA 4DL6A 3QIPA 2WK4A 3AVCA 4CJFA 2IC3B 3KLIA 3WNEA 2YKMA 5L9XA 1S6PA 4L8RB 3GV5B 3ISND 1BHLA 1NKCA 2FVQA 2W9AA 2E9TA 1SV5B 4AHTA 3CYMA 3KK1A 4CK3A 4FLTA 2V4RA 3QEXA 4ECUA 1RNHA 2DFEA 4PUOB 2BQ3A 5L1KA 3KKRA 4ID5A 3MEGA 4DG1B 3FDSA 3DLKA 3IG1A 3SQ0A 4ED6A 4DFPA 3SQ2A 1S1UB 4WYLA 3IN5A 4KHQA 3K57A 4IKFA 4KKOB 1SKSA 4URGA 2IM1A 3H4BA 3QO9A 3I5AA 4RNHA 4Y2AA 2XY6A 1U48A 4NCGA 1L3SA 1S9EB 5KG5A 3HP6A 1U45A 3SFUA 3KLGA 2HHXA 3H2LA 4DTSA 1JXLA 4IFYA 3GILA 4LSNA 1EXQA 1NOZA 3LP3A 3M8QB 2FBTA 5KFCA 4FLYA 4ECZA 2VWKA 4CEBA 1QTMA 2F96A 4K4TA 3PVXA 4CJTA 4FM1A 4OKEA 2RKIB 4FJ5A 4AHRA 4B9NA 2OPPA 3LP2A 2BE2B 3QZ7A 3C95A 3ALYA 5DQHA 2IJFA 3IAYA 1BGXT 3D5MA 4IG0B 4CF8A 3PW7A 4JV1A 4DLGA 4IQXA 1K1SA 3NMAA 1TAQA 3OL7A 2BRKA 5J2MB 5KFHA 4R5PA 1SH2A 1ITGA 3AVGA 2VG5A 4K4WA 3UPFA 2R2UA 1BL3A 4FLVA 1J5OA 5KFVA 4NLXA 1XC9A 4UQGA 2X6SA 2D0BA 1S6QA 4QCLA 2AGPA 4FLXA 3H59A 3DDKA 3RMAA 2WOMA 5HP1B 1MMLA 5DQGA 4FYDA 3RAQA 4RU9A 3DLHA 3AVBA 2HHVA 2C2RA 1WSFA 4WFYA 3MFIA 4E1MA 2F8TA 2JEIA 1D0EA 2E9RX 3AA3A 3KLEA 1JXEA 5CYQA 1SH3A 5KGXA 5F8LA 4K4ZA 1L3UA 2BRLA 3L2RA 4HCBA 1IO2A 4IRDA 1TGOA 3HM9A 5DLFA 3KK3B 4XIUA 4CCHA 3VQEA 4DQPA 1HARA 3NH0A 2IAJB 4W5OA 4FZZA 3P1GA 3KD1E 1T05A 2ILYA 3OS0A 5CZ2A 4RUAA 1VSMA 3I8DA 1RTJA 3F9KA 4RZRA 4K4VA 1NK5A 4J2DA 3C6TB 5DK5A 3G0ZA 5CY4A 2W8LA 1J53A 3VQ9A 5I42A 5L1IA 4M3YA 4HUGA 3BGRB 2IMWP 5D3GB 3V4IA 4ZVEA 3LWLA 3PUFA 3ZSWA 3VQPA 1QSSA 1LWCA 3ITHA 4WFXA 2ITGA 3HVTA 2BQRA 3OYLA 5KTQA 4LSLA 2HMIB 3PW0A 4CFDA 4NLGA 1T3NA 1SUQB 4ZTJA 4PQUB 3KLHA 2YNFA 3AVNA 4OJRA 5I3UA 3H98A 4DQSA 1C0TA 5KFKA 1A5XA 4O3PA 3ZT2A 3RMDA 3HHKA 4LY7A 3K5LA 4DS4A 4KHWA 3OYAA 3TAMB 2QKBA 2RF2B 4JV0A 3LPTA 3VQCA 4CJQA 4ECVA 2O4IA 4CHZA 2R7YA 1TKTB 3GIMA 3ZSYA 4RW7A 2XWYA 1JLQA 4R0EA 2YKNA 2OPQB 4J9QA 1BQMB 1CXUA 1NK0A 1Q9YA 1S1VB 3UQSA 5KFLA 3TABA 4F4YA 3MFHA 4M42A 4CEEA 4ECRA 3MECB 1CLQA 1VSLA 4DWIA 3KMQA 4KE5A 3T5LA 4FJ8A 4Z0UA 3MR3A 3BR9A 4TXSA 2C2DA 4DTPA 3MXJA 4ECXA 1Z4UA 2AWZA 1X9MA 5DLGA 1VRTA 4CEOA 1EP4B 1G15A 4GC6A 3T19A 4OPKA 4U6PA 3RRHA 3S3MA 3NBPB 2ZQBA 4CERA 4DTJA 5C42B 3CM5A 3GIJA 3V1OA 1HMVB 2A1RA 3KHHA 3OS1A 5HRRA 1S49A 4XPEA 3QLHA 3EY1A 1XI1A 2AGQA 1W9HA 1NK9A 5SWMA 2D5RA 1DTQA 1RT6B 3Q8RB 4CGGA 1FKPA 3KNAA 1ZTWA 4KREA 1JLEB 4RNFA 1IH7A 5DQIA 4ECWA 4F4ZA 3OSPA 4DTMA 3FQKA 4KHYA 4E1NA 2DFFA 1C1CA 2EHGA 5KFAA 2UUTA 1S9GB 3G10A 3DMJB 3K59A 1HPZB 4RNMA 3HPHA 4C8KA 4CJPA 3HYFA 4DF8A 1LV5A 2I1RA 4Q0BB 2R8GA 4GW6A 1S1WA 2ZD1A 3E01A 1SKWA 3Q8PB 1MU2B 1VSEA 1I39A 1BI4A 3V6DA 3V81A 2O5DA 5KFRA 4FS2A 1EX4A 3CJ4A 3OYKA 2FJWA 3H5UA 4H4OA 4CGJA 1VSKA 3NCIA 4DTXA 3NAEA 3SPZA 4I2QA 4QPXA 1RILA 3RR8A 1X9WA 3AVIA 5KFUA 3TQ1A 3QEVA 3KD5E 1RTHB 4FS1A 4O4GB 1TL3B 4KV8B 1LAVA 2V0NA 1D5AA 4O0IA 4HVJA 5F9NA 4YR2A 3C94A 1TP7A 5KT4A 2HW3A 2BGGA 1JLBB 3OHAA 5CZ1A 4Q5VA 4WXOA 4FJHA 3FQLA 2EX3A 1ASUA 5C24B 1SV5A 2IS3A 2IA6A 3MR2A 2FVCA 4E7LA 5F8HA 2OPSA 1LW2A 3P83D 3U3GA 1XHZA 3L2QA 4JRPA 1S1UA 2PYJA 1TKZB 3AVFA 1D9FA 1T94A 5F8JA 4MK7A 4FLZA 3HJFA 3RR7A 2F8SA 3VQ5A 1HQEB 4G3IA 3PR4A 4MIBA 1NNDA 5L1LA 4Q8EA 3SV3A 4NLWA 4IBNA 2YNGB 5HROA 2YNIB 4JLHA 3M8QA 1KLMB 4WFZA 4B9UA 2YNHB 2FC0A 4I7FB 3IGNA 5C25A 4BE1A 3BREA 3OYFA 1N6QB 3THVA 4WE1B 3HVAA 1YT3A 2XY7A 3OJSA 1NKBA 4F3OA 5HRNA 5T7BA 2X78A 1TK0A 3SYZA 1JLGB 4FJ9A 4M3XA 3AA5X 3PO4A 1KVAA 4DTOA 4TN2A 4FZYA 4J9NA 3H5YA 2DFHA 5KFXA 4URQU 3L3UA 2WONB 4DU3A 1RDDA 3MXMA 1TL1B 5DMRA 1TKXA 1N4LA 5KT7A 2PYLA 2DPIA 3SQ4A 4N56A 1T03A 3NF9A 4ZHRB 3ZT4A 1S1XA 3GQCA 3HP9A 2DY4A 1IKXB 2HNDB 1JLAB 3UDLA 4E7HA 4NLVA 2OYQA 3KJVB 2HHSA 1RT3A 5EU7A 2P5GA 4F3TA 4DL5A 4TSXA 3ZT0A 4TYAA 1HYSA 5KI6A 4DSEA 3OY9A 3NGDA 4MQ3A 4OGEA 3OYIA 2HVIA 2DPJA 3KK3A 4RW9B 4E3SA 4J9RA 3DRRA 3AV9A 2KW4A
chains in the Genus database with same CATH superfamily
2FTRA 1B99A 3CJRA 1KOOA 2DHGA 3D2WA 1ZTTA 3DOKA 1OH8A 4PG6A 4MKAA 2E2PA 3BZQA 2P9LA 2D3OR 1VQ5S 1HNXK 1VQNS 3G8TA 1WDTA 1HQUB 4MIWA 1NWKA 3VTHA 4QYZK 2MHEA 3RMCA 2XS7A 4KB1A 4MFBA 1YQHA 2R8IA 1VC6A 1UPMB 2KKZA 3ENWA 1RTDB 2ZOGA 2HHTA 1JLFB 4H4KA 2E1PA 4LRFA 1Q5YA 2CPXA 1SIWB 4PQUA 1FERA 4NXNJ 1XNRK 4BACA 3CCJN 4B3OB 1ZOTA 4Z4IA 3EPIA 2BJ9A 2OSQA 3TO8A 4OHVA 1YITS 3OTCA 4C8OA 2G8IA 4C2MA 3NKYA 2QTDA 2KN4A 1IKWB 4FPIA 4L3NA 3MAQA 4TVAB 2Z8QA 4MO4A 4CEDA 1IKYA 1VISA 1TQLA 1S72S 2I5JB 2V4JB 5HVGA 2O8EB 2P51A 3EE8A 5JJBA 1BUPA 4NE9C 1UJ5A 3Q8YA 2BR0A 1S10A 1HRHA 3HSJA 2ACMA 1KQKA 1TMMA 4FWOA 1H2VZ 1T6DA 3ZFVA 3RJMB 3LPUA 3Q8VA 4CZIA 1P8ZA 1YJWN 1YIJS 4ECQA 4OYAA 1XR6A 4FWLA 1YKWA 1QJHA 1GTEA 3SUOA 3HHLC 1RT6A 3E9LA 3GIRA 4Z4CA 1J54A 2E66A 1RTIB 2VPZB 1JLEA 3DXMA 1GK8A 5A8KA 1UP1A 1KC8T 3THXB 1NGIA 3A8KA 3QT8A 1DT9A 2M3DA 2RS2A 2RDIA 2O4GA 3DMJA 1VLOA 4TQSA 4RWWA 1BCMA 4DSIA 1UEKA 3DI6B 3NAIA 5M1NA 4DR1J 4LIRA 1RAEB 3UCGA 1M5KC 1HBUB 2J8AA 1KAXA 4CHYA 4HTIA 4HT7A 4FXVA 2DGSA 2KI2A 2KJWA 1L3KA 3PSFA 3E9OA 1AFIA 1YRXA 2OEKA 4ECYA 5M1QA 2EK1A 4IJNA 1DRZA 3I5BA 3AO5A 3DDIA 1RCXB 1MWQA 3TP2A 4WFBL 2O8BA 2FF6A 4CLZA 1OH5A 4Y1DA 1RTHA 4MT1A 1RT5B 5AZIA 4ES1A 2YH0A 1WSGA 3H4DA 3I55N 4CLUA 2LECA 3U7JA 4DFMA 4DR5F 4EHTA 1Q8LA 3DLBA 2L41A 1HI8A 3RMBA 2EC0A 4OLOA 5B0BA 2ZH1A 4ZVSB 2UXCK 2G2OA 2HNZB 4IOBA 1TUYA 2G0JA 2ADCA 4CGIA 1W26A 3CCQN 1YI2S 4AD6A 2AKWB 3CPEA 3LW5C 2QE5A 3UKUA 4OHWA 1GLBG 4LT6A 4IRCA 4CYUA 2W2NP 3QATA 4WP8A 1I94F 1T0TV 1F9HA 2A40A 1PC4A 1RBLA 5CZXA 4KFBA 1KQSM 4QWEA 3QQCD 1Q9XA 4KO0B 3KJFB 4KH6A 4B3MF 3DRPA 4X64K 5J2NB 2RMLA 4AXIA 3UE2A 1OPZA 4WFBQ 9ATCB 3EWGA 1TFWA 1DKGD 1MWZA 3BGOP 3SK3A 2MMYA 4NLPA 3SXLA 3H46O 4F04B 3UI3A 1WELA 4F0HA 2VC1A 1EWQA 1NGGA 1K1QA 3R9LA 4DHVA 4WPAA 3CD0A 3O8WA 3DRSB 2W1BA 5IQ6A 4NZ7A 2HQDA 1CG2A 2V34A 4NO7A 3LAMA 3MMJA 3G71N 2KVQE 1IBKJ 4IXCA 5FDLB 4ELVA 3BY5A 4M3TA 3HSDA 1FTRA 2QWPA 2OTLS 2DVIA 2PMHA 3I33A 3CHWA 2Z57B 2W2QP 3OT9A 3PIPL 4OX9K 2LCWA 3IWNC 3SQ1A 4P2MA 4RBTA 3KLIB 2YKMB 3K89A 1N33J 1MSWD 2XMVA 3AJ2A 1S6PB 5GAHU 2B4VA 4PQAA 2EPIA 5AQNA 4C8MA 1FVQA 3OUYB 3GG4A 3G6VA 3IP0A 4JKAA 1XHXA 3K8VA 3KTQA 1CULB 4CO0A 3QBXA 2I6WA 1VSFA 4GC7A 4ID5B 3IG1B 3GR1A 4EYHB 2WHOA 2MJUA 5A8RB 1GXLA 1LAWA 4KAZA 4CJVA 2GJIA 4IDKA 3BP8A 3CPWR 1UW4A 4FKYA 3O3FA 2VG7A 1IM6A 2DD8S 1VDHA 3P38A 2UXDF 1RZMA 2D69A 5F8GA 5HBMA 2APOA 4E1JA 3DXKA 3M5RA 3MEKA 4LSNB 3J7A1 4QR0A 4YOXA 3O4NA 1D8ZA 4NMXA 2UZAA 4F4KA 5HQMA 2YWWA 4ZVUB 5JUMA 3ETMA 3L2WA 3PIPQ 3U1MA 3W0LA 2CG8A 2FJBB 1B9FA 4DPWA 4X66K 3LDQA 4CW7B 4FW2A 5GMDA 1S99A 3OJUA 3MMCB 2MGZB 3H1QA 1U0HA 4WFNL 4NLBA 1UA0A 2O67A 1WJ9A 3CJKB 4DV2F 2D4WA 2GVDA 4TQRA 1I3AA 1BC6A 4DV7K 4EP5A 1FX2A 2F9TA 4LQ9A 5JLHA 1WSEA 2QN6B 2K06A 3RRGA 3NE6A 2QMUB 1A5VA 2YJFA 1S6QB 5K9FA 4WQ4A 2LQBA 1FDBA 2HAIA 1Z05A 3PHEA 2R2SA 1S5JA 1Q86T 4Z4HA 5LSRA 3FRZA 1MNEA 5EY4A 1RBOB 4KKOA 1FO1A 3TTFA 3OBIA 4M94A 2EBEA 2OMOA 3QEWA 3BB5A 4K59A 3OR2B 2B9XA 3KLEB 2ACYA 3JSYA 3O80A 1K9MT 2CJ9A 4I56A 1ZBFA 4ZPCA 2JFDA 1ITPA 4YOEA 3P31A 3H5XA 5GAHP 2DXDA 4LF8J 2NRZA 4NLCA 5LMNF 1HBOB 4ZDNA 1RT4B 4WTYA 4C4WA 2F4VJ 1IBMK 2MB0B 2E7WA 1FE4A 5DGBA 4WFNQ 5I42B 4P72A 5E0OA 1X4HA 2BMBA 1Q7LB 4FYWB 2VQFK 2V50A 2QA1A 1YLXA 1WEYA 1O6XA 1XJWB 1YF5L 2G4BA 3G82B 5SUHA 2YX1A 1E4FT 5L46A 3M6XA 3A5OC 3N5FA 4QWCA 1S0MA 4DF4A 4CGDA 3D54A 4U7CA 3G8SA 2VODA 4AL7A 1ULRA 4Q43A 3FEXB 3OYEA 5I3UB 3UFCX 4IR1A 2XCAA 2O66A 1XMBA 3FC9A 2WTFA 2DHAA 3EE3A 5IT9U 3X3UA 2XLJA 4NXMF 3O9QA 3B6PA 1PBUA 2QMWA 2KH9A 2CNOB 4UTGA 3CMAN 4H4KC 2YWHA 2WFBA 2VICA 2GAHC 4ANEA 3L7UA 1Q8KA 3H6EA 1RACB 1V4SA 1JB0C 3FBEA 2QWOA 1WNEA 2IVOA 4YY3J 2A3JA 2B7BB 3NS6A 2E20A 1RUSA 3Q24A 2XY5A 1T6CA 5BN8A 4G1QB 2LU1A 4X65F 3GIKA 1RAJA 1R31A 5E2QA 1JCFA 5JS1A 2EFOA 2E1CA 2FQQB 3BN7A 1Z25A 2QK9A 3QINA 1F9FA 3BKFA 3UO0A 3NGIA 2GMLA 3UDVA 2C42A 4NYFA 1RABB 2BUNA 2ZNYA 3J81O 1BXNA 2CPHA 2UVWA 3H90A 3HDSA 4HHUA 1R8AA 3R8YA 1HNXJ 5AQKA 2MLYA 3EYZA 2IVYA 2QLFB 3HT0A 5HO4A 4KH5A 4QYZJ 5F8NA 4JI6K 1RKJA 4G9ZA 1BQNA 4OVLA 4FJLA 2ILZA 4NX9A 4M3UA 1Y11A 1XMQF 2KU7A 3QSIA 2YHYA 1FXDA 5DS7A 3OVNA 3R2DJ 4JP8A 1M90O 1BI4B 1XNRJ 5HATA 1OQ6A 4QWAA 2OMLA 1S1VA 3WQUA 3POTA 3T5HA 3VF2A 3M6GA 3OL9A 2RDDA 1T3OA 9RUBA 1VQSA 2Q0RA 3MX2A 3SBTA 4CGHA 1C1AA 4BVOA 3MPVA 3QJPA 1UOCA 4IO9L 2H5JB 1QUVA 1HMVA 4ECSA 2QWMA 3ATUA 1AUDA 4B3TK 1BUXA 4MH8A 2Q36A 4YOVA 2QJ3A 3O1BA 1N5YB 3F56A 3HVWA 2N4DA 2GUIA 3OYDA 5DM7L 4DXLA 3LZIA 3U3YA 3R5GA 5KFMA 4H03B 1KQSR 2BJDA 2GEMA 2V8DA 1X3NA 3DFEA 3HPGA 1H3DA 2GQQA 1RBAA 4BS2A 1RT1B 1W7WA 3LGNA 4C98A 5DG9A 1RDCA 2QLXA 3CIZA 1NM2A 1MN9A 3GMGA 4Q2MA 2JGUA 4DR2K 2P9EA 4FWNA 4FJNA 2HF3A 2QV6A 3SDEB 2G0IA 4DI6A 5LJ5Y 2GFFA 2HYIB 2WRMA 5E3PA 3DXSX 3E9PA 4IO9Q 2V8GA 4B1XB 3VZHA 4ZCLA 2GV1A 1Q82O 3AB2B 1ZAVA 4B9QA 3FRYA 1YJRA 2EG1A 2C28A 4ZVFA 3QDKA 1Z26A 3EVOA 2AV5A 1RKIA 1M1KO 2RHSB 4QU7A 2X51A 4DCJB 3QEIA 4NEZA 3JSRA 5DM7Q 1VSIA 1TKXB 4CM2A 2XSJA 4X4QA 1T03B 1WC1A 2B0GA 2C2MB 2KL8A 5KG2A 2O01C 1EWRA 4KHPF 5DDOC 4KI4A 2W9BA 3O5TB 3W2VA 1HNZF 3NMRA 2UXCJ 2FYXA 3MM6A 2HSTA 3AXMA 1WUAA 3ZT3A 2POKA 2H4YB 1CQMA 2OLWA 3M2RA 3CC2N 1FRJA 2KG0A 2IOCA 1DZ5A 1X4BA 1XUPO 4QAGA 3J81j 2OIHA 3KHGA 2R8JA 5BJRA 2ZM6K 4V19S 3TAFA 1XNQF 3DM2B 2Y1JA 1YJVA 2XMTA 3GCXP 4A59A 1BA0A 3SMZA 1VBZA 3CQYA 4B3SK 1XK8A 2AGOA 1Y0HA 1NMEB 3UN2A 3FMWA 4M5MA 2PN6A 3ULEA 2KJVA 4X64J 5FRNA 1FRKA 4B08A 3OFGA 2MZQA 2P9UB 4WK1A 2GBZA 1CJUA 2WONA 2NYHA 2CQBA 1BO5O 1WOPA 4I68A 3TOQA 3G6ES 4JV5K 2RUGA 4BG9A 1OVQA 1IKXA 3D28A 2HQ3A 1UVKA 3AA9A 3DLGB 3FJ2A 1G4CA 1YXQA 4LBHA 3ZTOA 2IYIA 3TARA 2YHAA 3MN6A 3FLCO 3OQ2A 4PG5A 1MA9B 4DSJA 4JD2B 1LW0A 3OVBA 2HBJA 1HW8A 4DV5K 4DPTA 4Z2XA 4MDBA 5ADXH 4O3RA 4JI2K 4LF7K 3ZETB 2G8FA 2NLXA 4H5TA 3SSQA 1QQOA 4J9VA 1Y64A 2B8PA 1REVA 1C4CA 2L9WA 1OO0B 4NLUA 1HQUA 4OX9J 2CG4A 3EE9A 4J9KA 5AZJB 5BRHA 2AP1A 2H51B 4FXDA 1C0MA 4F25A 3H7HB 4RW8A 1TL7B 3TRGA 1KAYA 4O3NA 4AHSA 2RNEA 5KFWA 1ZBSA 1ZBIA 1RTDA 2VJUA 1VQ7S 1OY9A 2A10A 2YPZA 3VN5A 3QO9B 5LMUF 1NDKA 1FVSA 3U9ZA 1NBWA 4DUZF 4HCCA 4IFYB 4CF2A 8ATCB 2AEFA 4ZVRB 5KFEA 4L3QA 4W5RA 3H8YA 3T1YF 3TI0A 4B3RK 2M4MA 1AA1B 5LL6Z 1IKWA 1N34F 1MWMA 4M5IA 3VEOA 1N36K 1G7CB 2EWHA 3U1LA 2GQ2A 2B6AB 3D7EO 4CEFA 5C2GA 3JTNA 2V4JA 3W8PA 2HVEA 3J7ZO 2PE8A 3LDNA 4DU4A 2O8EA 5CE3A 3CMEN 3S6EA 2D0PA 4YNQA 4X66J 5BXIA 4BRCA 4E7KA 5AQYA 3ZSRA 3VOVA 3HD2A 3NGYA 3OYCA 5FRMA 1X7VA 3CD6S 2P9PB 2GO8A 4WTOB 2ZKUA 3D2EB 4GKJF 1X4DA 1S48A 4W5TA 3ENOA 1TAUA 2WBNA 5CHCB 2PT0A 4DV7J 3HL8A 1YGYA 1RTIA 4EO6A 1F3FA 3WC2A 4PY5A 3PNIA 3VETA 5ADXA 3THXA 2MHNA 5IS2A 4DBQA 1DQAA 1G2EA 2ASYA 3TTDA 4CJSA 1R0AA 1X4GA 5ETRA 2DTUA 3J80O 3VA0A 3DI6A 4USIA 1KVCA 3C6HA 3CCWA 3KUHA 3TA0A 3MEDA 1CC7A 2FZCB 3FZKA 3AJ1A 2HWHA 4H4MB 3L4IA 4GVLA 3QBWA 2WB1D 3TQEA 2D9OA 4DMNA 1UETA 1QS4A 3ITHB 2P5OA 3M05A 1RBVA 4OMFG 1R59O 1AT1B 3FUYA 1WKKA 4K5SA 1IBMJ 1D9AA 2CQPA 2DHSA 2UV8G 3RB4A 2N3LA 5ELZA 2VQFJ 1RYRA 3EJMA 4BWMA 2FLNA 1RCHA 2QEXN 3AOBA 3IC1A 2CDRB 2HNZA 1NGHA 1T9XA 1UJ4A 3JXUA 1UZDA 4KAIA 2C22A 5IQQA 3CC4S 1NJYA 3K17A 4KB0A 1KONA 4NXNF 4GY2B 2M70A 2XGPA 4EI2A 3OXFA 4TKTA 4KPCA 4M3WA 5KFQA 2HRYA 3KJNB 3SV4A 3CCRS 1N52B 4KO0A 1ELOA 4PWDA 5M2RA 5KFJA 3JYTB 4J9SA 4HH1A 1WN7A 5AQGA 2BX6A 3VGLA 1M90T 5HI7A 3I4PA 5FROA 2P9IA 1FKOB 3VV2B 1L5UA 1SJQA 2V67A 1XWLA 3R5AA 3F44A 1AZSB 3TWZA 3QNOA 4M5HA 3LDLA 3PJXA 3VQ6A 4WU3A 1RWUA 4DQQA 4OYBA 2OFHX 4YHHK 2HGLA 2XRIA 3I87A 3DRSA 1BCOA 3IFEA 3HXMA 3CW2C 1RWWB 2NUUG 3C6UA 3ETOA 2QWNA 2W7OA 1VQKN 2VA2A 4K50A 3M2UA 4ENOA 2DRBA 5KT3A 4YMEA 1U6BA 3EZ5A 3H2VE 4KPYA 3ZTQA 2DJWA 1SC3B 4IR9A 1Q53A 4XK8C 3TAPA 1UPPA 2YHBA 4Y6IA 4ALZA 4JI6J 4X4RA 3WXIA 3CDBA 1JNRB 3FZFA 2J9DA 1ILYA 2HFUA 2B9YA 2E5LK 2Q0UA 4A2AA 4IOAL 4DR1F 4EK2A 4DL6A 1KNZA 2P5VA 2YXLA 3MM8B 3OXLA 2IC3B 3KLIA 3I96A 4W4MA 2YKMA 1R27B 2W2MP 2C2KB 5L9XA 5BR8K 1S6PA 3VCDA 3WXLA 3GV5B 1FRMA 3ISND 3UR3C 2EFNA 2FVQA 3OUYA 4AHTA 1CULA 4FLTA 2V4RA 3QEXA 1RNHA 3FCWA 3B6BA 1NZAA 1GAOA 4ID5A 3ULHA 4DG1B 3RZAA 3NVMA 3IG1A 4CZGA 5H1SQ 4RPFA 3A13A 4MKYA 2LQJA 5A8RA 4B3TJ 2MZRA 1WF0A 2IM1A 1Q82T 4D3HA 4LR7A 1RLCL 4B1WB 2PO4A 5KG5A 4CWBA 1PJ6A 2M8DB 1VQ6S 3VAGA 3H2LA 5CYJA 1IUJA 1EXQA 2FSNA 4LSNA 3BKTA 1M1KT 4CZLA 2R7TA 3M8QB 3MCPA 1N0UA 5HQLA 1P9QC 4ECZA 3RBZA 1KD1O 1LOTB 1RHKB 1F3VA 4IOAQ 3TPQA 3D3BJ 5IM0B 4QOTA 1RDUA 4ZN1A 2OJ3A 4JHDB 2RKIB 4A62A 3EDQB 1Y10A 3LP2A 3TUPA 4JK9A 3C95A 5D78A 3MMCA 2Z2LA 4OI3A 2MGZA 2QX0A 3VEXA 1HWUA 3JQMA 5E26A 1K1SA 3MPDA 3CJKA 4DR2J 1HHTP 3MK6A 3AVGA 2FC9A 4FLVA 3AD9C 3FBBA 1S6QA 1TTHB 3FGUA 3J80Y 4USTA 1H2UX 4ZJLA 4PYAA 1VC5A 4BQLA 4QIVA 1VYAA 2WTUA 2L08A 4WFYA 3MFIA 4RKUC 4E1MA 3GJRB 3OR2A 3I31A 3KLEA 1JXEA 1SH3A 5ETLA 3JTOA 2C2NA 3CCZA 3FSXA 4ZLNA 1Z6RA 3AD7C 3T1HK 4A8QA 3HM9A 4XIUA 3M6VA 3NH0A 3KD1E 5AQIA 3EO3A 3OS0A 5CZ2A 1IBKF 1D4XA 3ENBA 1Q95G 3QT5A 1HBOA 3CCUN 4JI8K 5DK5A 3G0ZA 4QS9A 1J53A 1RB0A 4YUDA 5I42A 3O3LA 4M3YA 1U2FA 2NR0A 2IMWP 3W1YC 5D3GB 2A18A 3VAMA 2RB7A 3ZSWA 5B0FA 2ITGA 2OD4A 5KTQA 4JI1K 1N33F 3B4DA 1SUQB 2ZM6J 1DFDA 3T6JA 2ZVSA 3LGHA 4UOCA 4OJRA 5I3UA 5KFKA 1A5XA 4NPOA 2FSKA 4KHWA 4LY7A 4B3SJ 2OKQA 4M7XA 1AW0A 3LPTA 3HD1A 2CPFA 4C3LA 4LF4K 2DCUB 2J76E 1TYQB 3GIMA 1UJ6A 2OPQB 1ZM9A 2EKYA 1HIYA 5JMNA 3TZZA 3WIVA 2I8EA 1VLYA 1BQMB 3W64A 1S22A 1Q9YA 3UQSA 4JV5J 3N5BA 1EIYB 2FUG9 2ROPA 1CLQA 4A57A 2YI1A 4DWIA 2R7SA 3KMQA 4KE5A 3T5LA 3DGPA 3MUVP 1VJQA 2XWXA 8AT1B 1WKJA 2I7PA 1P8GA 2AWZA 1X9MA 5HK4A 1G15A 1CZAN 1CJKB 3RRHA 3S3MA 3NBPB 1Y00A 3M30B 5JVGL 1WDDA 4I4BA 1AUSL 5B0DA 3QLHA 4DV5J 3AOCA 2AGQA 3EZWA 2YWEA 1YTYA 4JI2J 5SWMA 2D5RA 5BPLA 4B1UB 4LF7J 3A12A 4CGGA 3BEGB 1AYEA 3J7ZT 1IH7A 5DQIA 3OV7A 4KHYA 3O08A 1VQ5N 3A8IA 1S9GB 5AXMA 3K59A 1HPZB 3H1VX 2V52B 4CJPA 3HYFA 1U6ZA 2VFUA 3X1LB 4Q0BB 2ZZTA 2BOPA 4I0WA 1BI4A 4I6MA 4CTAB 3CJ4A 3BN4A 2FJWA 3RYLA 3BGLA 3R5BA 3PXGa 1K8AO 4H4OA 3NAEA 3SPZA 4I2QA 1YITN 3RR8A 2EW9A 4B3RJ 1X9WA 2ATCB 3TQ1A 5JVGQ 4LF8F 4FS1A 1T9WA 4O4GB 2R3VA 1N36J 1NNEA 4HVJA 5F9NA 2O8FB 2F4VF 4L75A 1O51A 2V51B 5CD4H 1S72N 4C23A 4FJHA 1GLFO 1GLCG 1FRXA 1GLAG 5C24B 5FPEA 2IA6A 3RRKA 4C8YA 4CLLA 5JVHL 2FVCA 2ZWPA 1URRA 3R7SB 2DO0A 3DXBA 3TA1A 3CCVN 1U1KA 2HQCA 2PYJA 2QGFB 2I38A 1D9FA 4IDHA 2XMAA 1VCTA 5F8JA 2GUPA 1QVGM 2RSQA 4F67A 2CJAA 1HWKA 1HQEB 1N5VA 1HKGA 3QT6A 4G3IA 4MIBA 1NNDA 2MKIA 4IBNA 1Y5LB 2GMJA 2HZAA 3MMAB 2YNIB 4WFZA 4B9UA 2YNHB 4BC3A 3AJDA 4I7FB 1HLWA 4BGAA 4DPYA 2KG1A 3THVA 4WE1B 2XY7A 3OJSA 3K9KA 3CJCA 5HRNA 4YY3F 4TLQA 2NRVA 3P5TL 1NGFA 2J4RA 1BLUA 3DC2A 4BRHA 1WACA 1Q5VA 4GMKA 4M3XA 3J7YP 3MGJA 1N54B 2YCHA 3CJ9A 2YQ3A 1U1NA 5HL7L 5JVHQ 2OGUA 3H5YA 3ZNJ1 4DU3A 1RDDA 4WP3A 1PC5A 1CQNA 1TL1B 2P9CA 1G99A 3CERA 1TKXA 1N4LA 3IA0A 2ZH7A 4A5AA 2PYLA 3SQ4A 1T03A 3NF9A 2XZTB 3GQCA 2DY4A 3GG0A 4QJVA 1KVKA 5A76A 2HNDB 4MLHA 1Q16B 2V94A 1HNXF 1U24A 2K1RB 5CHIA 2CVIA 3MM9A 2KRRA 4ZVPB 2P5GA 3DLLL 5CD4A 3B82A 5D8HB 4OGEA 2MZ1A 3OYIA 2DNMA 3BYRA 4LJMA 2VQEK 5AR0A 5F2RA 4E3SA 1MWKA 1YI2N 3AB4B 3AV9A 1UMJA 3T5KA 2HHHK 2IPOB 1XNRF 3O9SA 3C6TA 2DIVA 4ES2A 1NB7A 4KTQA 3UKRB 2AJFE 3EZUA 4P7TA 3F9MA 1CS4A 2N3OA 4CIEA 2ZEJA 2BJ3A 3PHTA 4G1PA 4OLPA 4ZK7M 4MO5A 3Q2SC 4CFCA 2AX0A 5HL7Q 4EBEA 1HNVB 2BM0A 4QU6A 5B08A 3TJAA 1R8HA 1RHMB 2HFZA 1XN9A 4LBPA 2ZH6A 4EZ9A 5KOWA 1CJVB 4NLDA 1YG0A 3KLVA 2VFVA 2WVFA 4JS5A 2XB2D 2XGQA 2X1FA 3TEHB 2PA3A 4KH4A 4YHHJ 3MDFA 4N47A 3DLLQ 3K5PA 1IQTA 2IM0A 1GQEA 3NDKA 4ZPDA 3LO3A 1S76D 2VOPA 5CXTA 1TKTA 3OHBA 4CHOA 2MPUA 3B6OA 4O44B 2W8KA 3P49B 4JD2A 3SJJA 2YBVA 2V4QA 1Y4ZB 4RJVA 3R27A 5CQGA 1WLJA 2OPRB 4ICLB 1QUPA 3AGRA 2NQPA 4A8MP 3KKSA 3ZETA 4CBXA 5C12A 2CJXB 3UR0A 4DR6K 3C0BA 2E5LJ 5AQPA 5AZJA 4B8AB 1TL7A 2FLOA 4ETZA 5BR8J 2D0CA 5JXSA 3GTYX 1FD8A 2GGPB 1YHQS 1YDLA 3QAUA 4USWA 3D1QA 3U4LA 2PY5A 3BSAA 3IAS9 4DV4K 2FLLA 5HAOA 2ZKTA 4X4SA 4B02A 3PO5A 2D7SA 4CJ4A 5LL6d 4WZMA 1T95A 3TSPA 4HKQA 3I32A 1QD1A 4OIXA 3RSEA 2FF3B 2WBRA 4LRAA 3TR8A 3VEZA 4QS7A 1GMUA 1KTVA 1HJRA 1S12A 2GCFA 1PBAA 2B6AA 3PW5A 3ZZYA 5B0AA 2F3JA 2UXCF 4KGKA 3DOMB 3BYPA 3V6HA 1UVNA 2CWXA 2I7NA 5M2PA 5DG7A 1RWNB 4K0KK 2J0SD 1T7PA 1J27A 4QWDA 4A8KA 2PZSA 1U49A 2OTJS 3S3OA 4LVOP 1RT7B 3H08A 3AVHA 3AVKA 2BANB 2P9PA 2KT5A 1RE1B 2GHWA 2C3UA 2GHPA 1TUUA 3IKMA 2DGOA 4A5BA 4USKA 1NHVA 3MXIA 5BYSA 3EM1A 4X64F 3PDNA 4CH7A 3O3HA 1JXVA 3GG1A 4NRTA 2E7VA 3NL0A 4BHQA 2LKZA 2Y1RI 2A41A 5IV3A 4FJXA 3LP0B 1YAGA 4MLEA 4FKXA 5ETQA 3S1TA 3ZX3A 2CKWA 5B0CA 3ENAA 3ILOA 1CZ9A 4Z37A 5JS2A 2R7QA 4HHJA 4OYWA 4ED8A 5CYMB 1E6YB 4HTLA 1S97A 4FBUA 3MURP 4KI6A 3ZZ0A 1K73O 4H4MA 3T1HJ 3IRWP 5GIPA 2HKEA 2KZZA 2Q66A 4FK4A 3VR1A 4JKDA 4HEA9 4JI8J 3HRGA 3MCOA 3UCZP 3VQDA 1GX5A 1JKHB 2QWLA 3KMSA 2QKKA 1VQMS 3GV8B 4K8ZA 4N8OA 2AYGA 4DL3A 1EB0A 4OX9F 2JWLA 5B09A 1S7IA 4WWSA 4J91A 2R8HA 2E4LA 2HHQA 2IDOA 4JI1J 3KWGA 1RADB 4RW6B 3NF8A 2IMOA 2X1GA 3KYLA 2CPZA 1GMVA 5AJ3K 2BABA 3DLEB 4FWKA 5IC6B 3BH7B 3SMSA 5M1KA 2N7YA 3U9DA 2I2YA 4ZPTR 3DHWC 2HURA 2FVRA 4OLBA 3R2CJ 4LF4J 1EARA 1B64A 4PRFA 3M8PB 3WNHA 4FZXC 2DTJA 5ETKA 5HSPA 4MTPA 2F8EX 3JYTA 5JICA 3PR5B 1FKOA 2H3GX 4DMZA 2P9GA 4E19A 3VAFA 4DS5A 1KWMA 2ABYA 3KWMA 4WKRA 4ZCMA 2GVZB 1K8AT 3V9WA 5AXKA 2B7CB 2KHCA 3MEGB 1LNQA 4K2JA 1QVGR 1IJJA 1NH8A 4X66F 1VRUB 4ELTA 2EC2A 3KG4A 3LL3A 5L1JA 1OVYA 1BE4A 1QAIA 1Q7YT 4LF1A 2ZUGA 2ASDA 5BRFA 2F9DA 4RG8A 1A7GE 4NCGB 1VQPS 3SFGA 5AQVA 1IQZA 3KLGB 4DPXA 3LWMA 2BKPA 2YWFA 4DCHA 4OYZA 4DV7F 1K8KB 2YKQA 1R8BA 4FDFA 5BRDA 4GVEA 3SQGB 1WI6A 3ICLA 3Q2TC 4CO3A 1FJEB 4NA2A 2KXHA 2IIRA 1VQOS 2R7VA 4EFAC 4CM0A 2OPPB 4FNIA 3C7NB 3WNFA 2KFZA 3CCLS 1UFWA 3MM8A 2IC3A 1YRTA 3SI8A 1VS3A 1B4SA 2B3TB 1QSLA 4CF1A 2EWSA 4ZIVA 4IWVA 1WG4A 5F8MA 2Q1NA 3RB3A 4WU2A 5GADP 4ZMMA 3BSCA 1J5OB 3THWA 5LM7E 2YX7A 5KFBA 4DG1A 4J2BA 1QQNA 4NI2A 4OKKA 4K7QA 2GJ2A 4DSFA 1IBMF 2OI2A 1AROP 1NJXA 2WSEC 4FF4A 4QQBA 2AP6A 1KBRA 2GO9A 5DG8A 1U2VB 2VQFF 2XNQA 4U96A 4YDDB 5KFPA 2Y3YA 3AO1A 1ZXOA 3PRBA 3DDNA 1J5EK 2V7ZA 3QWUA 3QT7A 1O13A 5IM0A 2NRHA 2FC8A 4JHDA 2RKIA 1SJ4P 1C2PA 2JRSA 4ZITA 2Z2YB 5GMEA 2HWIA 3FNNA 2MKKA 2C2ZB 1ZAXA 1TUGB 2QWRA 2AZ1A 1LWCB 4DB3A 4OI0A 2BJ1A 3VERA 4CT9A 2VWJA 4RUHA 3PKYA 1F5BA 4FF1A 3IS9A 5C10A 5IT9O 4XDDA 3LM9A 1LWFA 1YTUA 1SPBP 2CZVC 1QTNB 1VIOA 3CJ5A 1GOAA 3S3NA 4CO2A 2QI2A 1VK8A 5BYRA 1LWXA 3BQ2A 1EX8A 1S57A 2H3EB 4N41A 1UFKA 2DBBA 3I0SA 2XQCA 2Y1IA 1U47A 2U1AA 4BE2A 5DZ6A 2MQ8A 1X3MA 1NK6A 4PKGA 1U8SA 4JI6F 1C0GA 4OLAA 2ATLA 2V8PA 2GIFA 4CHQA 1TFYA 4C97A 1A0OB 4ZA1A 5D3GA 1D8YA 1QAYA 3VEWA 4CLWA 2VQEJ 4NL5A 3FR0A 2KFNA 3LA0A 2HHHJ 1NDCA 3QWPA 4UT4A 2PI5A 3DOLB 4KHRA 1NHUA 2J6TA 1WHWA 1U0SA 3VGTA 2QXFA 3GYNA 2VV5A 4FYXB 4CD3A 4HUFA 3TX8A 2F7TA 5BR9A 4AE5A 4BDYA 3D7SB 1M1HA 3TAQA 1X9SA 2OELA 4DEZA 1APSA 2QLWA 1NH7A 1TYQA 3HKWA 2AYBA 4B3TF 3E01B 4ISEA 2CPDA 2W2OP 4N5SA 5SZTA 3G6EN 3CM6A 3D6RA 3IWXA 1TL4A 3LOUA 4FWRA 1DARA 2A42A 4J2AA 1V5IB 3A5NC 1S1TB 4CESA 4HL9A 2XI3A 1RU2A 4P2XA 2MSSA 2VBXA 3DGVA 1VC0A 1CJKA 5EWEA 3S41A 3QFWA 1T9TA 4TY9A 3PRDA 4X4VA 3Q7CA 3OA9A 2VPWB 4DR2F 2RS8A 4KQZA 2OPSB 2DNPA 4DR6J 3WNGA 3FEYB 4CJKA 1BIUA 1S79A 1P90A 1S9GA 3O4WA 1ZA2B 1HPZA 1JLCA 2YQ0A 4W5NA 3L4BC 3CDEA 2FGCA 3T3FA 4AL6A 1KXPA 2M88A 1VQ7N 2MQPA 3SI6A 1MROB 3MMBB 3OTBA 4DV4J 4DZ6A 2FZKB 4CTAA 3U02A 2R2RA 3SUQA 4UY8T 4RR5A 3MM7B 2Q43A 4CJRA 1YBTA 2IVMA 1QE1B 2MXYA 4AF1A 3CD5A 4LRDA 3VENA 2UU9K 3OS2A 4LREA 4JK8A 2XZWA 2O8FA 4W90B 3L9ZA 1WSVA 3M8YA 1PAUB 4M45A 3BO3A 4K4UA 3QGGA 1GH8A 5C24A 2BOAA 1K73T 3GFZA 4R8UB 4K0KJ 1S6UA 4BR5A 2EFQA 5AT1B 1I51B 4YQWA 1RHUB 5F9LA 2ZGYA 4DUYK 2HVZA 4NOHA 1WUUA 4QPTA 3WDOA 2ZM6F 4F4WA 3LPEA 3CD6N 1RT3B 2RH3A 4GO7X 3TANA 5E3AA 3IM9A 3THTA 3GL1A 1R0BG 4B3SF 5T41A 3CIMA 3L3CA 1DTTA 3CFOA 3GV7B 3LDPA 1H98A 4LFBK 3MHYA 5L38A 2KM8B 1DBDA 3MMAA 2YNIA 1Q8BA 3AVLA 3DRRB 3DCAA 3BF1A 4OHZA 1GOCA 1KQFB 4JV5F 4WE1A 2E88A 2M5YA 4ILJA 5IT9Y 3SAGA 2DNRA 2WC9A 1S7HA 4OZ0A 2XM3A 2VUGA 4WQ5A 3EL2A 4YOYA 3HFVA 4B9MA 2YPYA 1GX6A 4OKJA 1NMDA 2LQ5A 1FNOA 1RTZA 1JJHA 3ILIA 4F36A 4CLPA 4EU0A 4A61A 1NEEA 4O8UA 2XHBA 3NNHA 4M5GA 3EGNA 2EFVA 2NREA 3QICA 4NA1A 4DV5F 4C0HA 3AQOA 1TMJA 3RGIA 4JI2F 3AVMA 2E7XA 1ESVA 4ED0A 4LF7F 2Z1GA 3PEJA 3TSUA 2Z1JA 5MLCV 3IRXB 4HDGA 1U1RA 2A6MA 2HBKA 3TNVA 3MR6A 3R5JB 5DGAA 2K1RA 1PG5B 1WHVA 5GAGI 4JYAK 4IKAA 4QR1A 2RT3A 1FCAA 4Q44A 1ZM2A 2B9WA 5HVHA 3QIPB 4CHPA 2D0AA 4CFAA 3O9UA 4BWJA 5AJ3J 2CQDA 3CC4N 5D15A 3GE1A 4ELUA 2XC9A 5AE3A 3UKRA 4USVA 4EBCA 1U2RA 2W4PA 3W60A 5FPNA 1IM4A 3M7VA 1B7FA 3BF3A 3L3VA 2DT9A 4B3RF 5AQWA 2CA9A 3CCRN 4CI6A 1FDAA 3GJTB 4CQ1A 1HNVA 2AJ4A 3UN3A 3NLCA 1N36F 4LF5K 2ALZA 4ZIWA 4ZCKA 3KHRA 3LP1A 2Z1HA 1Q8IA 1RGIA 3VQBA 3AODA 1HBMA 4CLYA 3DLRA 3MWPA 3M8SA 3SPYA 1EKSA 3IBFB 2GIQA 3QESA 1VQLN 1LWEA 3MN5A 3EDRB 3EPGA 2NNWA 5HLFB 4TY8A 5FPMA 3SAFA 4K4XA 3P45B 4KSEB 4CJ7A 5DM6L 1NXIA 3HO1A 4OYIA 3OHRA 4I2PA 4O44A 5CABA 4KJIA 1KQGB 4I9QA 1T8EA 2CQ0A 5EVZA 4LF6K 3B54A 3KG0A 3J7AN 4A8OA 4U9RA 2NXEA 3HHLB 4K8RA 3N28A 3BBCA 2G9OA 2WSFC 2HLTA 5K8NA 3E8OA 3TEGA 3AAQA 4ED5A 4A47A 1UAXA 4M3ZA 2DNHA 1ZS6A 3GCWP 3O2IA 2FBYA 3VQSA 3EGWB 4J90A 5DDQC 2RPIA 3WX8A 1KP6A 1NRKA 2DXFA 1PGZA 4WF9L 4UOHA 4BR9A 5B7WA 5AQQA 2CPYA 4OHYA 2GGPA 4AHVA 4CZCA 3V6JA 2HZVA 1RBTA 3I0RB 2JSXA 2NRRA 3SMPA 4BRIA 5T7LB 1U4BA 3CXCM 5DM6Q 2BVZA 2HOEA 3AY0A 1DLOB 2IM3A 1X8DA 1RTJB 3MM5B 2CQ4A 1QAJA 3IBCB 1NK7A 1HWIA 3NH2A 2DHXA 2ZNZA 2JEJA 5KG3A 1SQEA 3V4IB 1HD0A 4I9LA 3DOMA 1H74A 1S5ZA 1J5EJ 2Z2ZA 4CK1A 4FPBA 2WZ1A 2HFOA 3OPKA 3V6KA 1H7WA 2EKNA 4IH7A 2BEFA 2E44A 2R4FA 3OLAA 4AILC 2EI5A 1HNIA 2YNFB 3T7ZA 3W63A 5D0GA 4WF9Q 1IWAA 1VHXA 5F1XA 3H42A 2WBMA 3PW2A 1EKRA 4PR6A 3P6YC 1RSCA 4W92B 4FJGA 4H8KA 5AFUH 1NJIO 2YKNB 2LU2A 4B9VA 1BQXA 3LP0A 2LYVA 3AARA 4IOXA 3OYBA 1B70B 3VF4A 4NLYA 4RBVA 2G8VA 3ID8A 1XIQA 1GOBA 1REGX 5E3RA 1ZETA 4YHHF 7FD1A 2R8KA 3CUNA 3RW7A 4YS2A 5KQDA 5CYMA 3LH2S 2QFJA 4XEIA 2RQ4A 1WSJA 1LQ9A 4DR7K 4LR8A 2DIUA 1O1WA 4J2EA 2Y8YA 5AXLA 3WUHA 4UOFA 2RQMA 4LH5A 1OY8A 3W65A 1VAZA 3G6YA 3AVJA 3AO3A 2NLWA 2ZBIA 2HNYA 4K42A 1FT8A 3M9NB 4MMOA 5KG4A 4DU1A 2PEBA 1EO1A 1C1CB 2WAQD 3JQKA 2E5LF 4ID8A 2BKOA 2HIYA 4JI7K 3H2UB 1QSYA 4WCEL 4BRMA 2VONA 2FPHX 2DNYA 5A0YB 5AQLA 1HFEL 3AT1B 4C1NK 5AQOA 1KEKA 5K8MA 5BR8F 4GVBB 2QO3A 3M6WA 5J2QB 2NUBA 5J1PA 4CDIA 5D4NA 4ZTFA 3G8QA 2P9KA 4FBTA 3HSGA 3DLEA 4BRDA 3ZEUB 1UA1A 4ZP8A 2C2EA 1X0FA 4RWTA 1VOMA 5J2PA 2C1EB 4HVZA 3U27A 4ETXA 3CCES 3KFWX 2UV8A 4ZJOA 2IFXA 3AVCA 1HR0J 5AFUA 3R6MA 1BHLA 2AMCB 5D4OA 3SQOP 2E9TA 1PSDA 3KJQB 1FA0A 4ILHA 3PLAA 2LEBA 1SXLA 4YDUA 2DFEA 3IO1A 4AM6A 5L1KA 3KKRA 3FDSA 3MEGA 3DLKA 3SQ0A 4HACB 4ED6A 4DFPA 2VFRA 4FPAA 2KB2A 4WCEQ 2JH3A 5I3QA 4IEEA 3H4BA 2P9NB 2DR8A 3I5AA 2XY6A 4Y2AA 3KK7A 1L3SA 4NCGA 1S9EB 1E3MA 4Y2KA 3KLGA 3GILA 1NOZA 3PYFA 2FBTA 5AQZA 5IWAK 2NSCA 4OZ5A 3SQGA 2VWKA 4V19J 3ADAC 2BZ2A 1YWXA 2VCPA 3O6QA 4PKDB 3PVXA 1DHMA 1N8RT 2OPPA 1WEXA 2Y8WA 1YX2A 3C7NA 3W61A 3HLUA 5DQHA 1BGXT 2J0WA 2BJ8A 4DV6K 1BHNA 4DLGA 4BROA 2CADA 4IQXA 3NMAA 1TAQA 2VHGA 1FDNA 2BRKA 4V1Ak 1SH2A 4NWBA 2VG5A 3T1HF 3MOZA 3M1VA 1BL3A 1J5OA 1XC9A 5BPNA 4OO1J 3PACA 2EFPA 2UU9J 4JI8F 3RMAA 2WOMA 5HP1B 1MMLA 3RAQA 1QVFM 1IJFB 2BTFA 1WSFA 2UXBK 3H3NO 2H54B 3KXDA 3AA3A 3M8ZA 2VL1A 4K4ZA 2BRLA 1IO2A 4JI1F 5GIOA 4IRDA 4DQPA 1HARA 4W5OA 4FZZA 3P1GA 4DUYJ 1RXOB 8RUCA 4PKHA 3ZYYX 4NA3A 1VSMA 3F9KA 1RWXB 4J2DA 2KVIA 3T9NA 1T3VA 1Y5NB 4LFBJ 4KHPK 2MQNA 3E66A 2G1HA 3G9CA 4LF4F 3VF0B 2HF4A 3LWLA 2W01A 1QSSA 1JMTA 1LWCA 3SCIE 4WFXA 3MI7X 4JAXA 2HBQB 2DH9A 4CVNE 2MQLA 1PYOB 1F5AA 2ZHOA 3DKDA 4OFZA 4PQUB 1FD2A 3S8SA 3R3LA 4OYPA 1IBLK 1C0TA 3ZT2A 3K5LA 3BEXA 3ZZTA 4EIAA 3K9JA 3TAMB 2LXFA 3R1LA 4JKGB 1S0VA 2W6KA 4CJQA 2OSRA 3CCMS 4CHZA 3ZSYA 1JLQA 4J9QA 2FJEB 1EQYA 3TU5A 5F41A 2VF3A 4PXCA 4M42A 3MECB 1W2IA 5DJBA 2QSFA 2R9LA 5FLXY 4FJ8A 1SZ2A 2PFFB 2CQIA 3BR9A 4TXSA 2BM1A 4ECXA 4NYOA 1EP4B 1FNMA 4JYAJ 3T19A 1FHTA 4CERA 3CM5A 2W24A 3FFKB 3HI9A 1VMBA 2PD1A 4XPEA 1PJ5A 4CZKA 3EY1A 3UN5A 5ETOA 4HR2A 1NK9A 1RT6B 4CO1A 4FZVA 1ZTWA 4OJGA 1JLEB 3D2FB 3DXMB 1M5HA 3CXCR 5A8KB 1RLDA 4F4ZA 3BH6B 2YTCA 4ZVOB 3FQKA 3W8GA 1XTZA 2DNOA 3DMJB 4RNMA 2BUPA 5K5MA 1T11A 4OQJA 1WOSA 4LF5J 4CZJA 3TVYA 2I1RA 2C2OB 2J9CA 4OHXA 4L73A 3E01A 2X3DA 3R6GB 2Y9HA 1LCUA 2XNRA 4RBUA 2O5DA 4OI6A 4U7UK 4CT8A 3EGVA 3DHXA 2DNKA 4CGJA 5LXYA 4QPXA 3AVIA 5KFUA 3QEVA 1RTHB 1JJ4A 2RAQA 2F8HA 2HK3A 1N88A 4KV8B 1S59A 3GONA 1LAVA 3AHPA 1D5AA 2YX6A 5AZIB 3JXOA 5KT4A 1T02A 2RHQB 2V69A 1X4AA 4LF6J 4Q5VA 1OQ3A 4WXOA 3EVWA 5DZ7A 4BVPA 3Q83A 2HGNA 2D9PA 1SV5A 2IS3A 3BO4A 1FXLA 4Y28C 2BJEA 3HHDA 2OPSA 4MYTA 3PCOB 3U3GA 3L2QA 2W41A 5AQFA 1S1UA 2GNKA 2BE9B 4JI0K 1XQIA 1TKZB 4CYUB 5GAGU 4JNEA 3JAMU 3WT0A 1XMOK 4FLZA 4Z7YA 3GOIA 1HBNB 3VQ5A 2IDEA 3W66A 4BR7A 4YB7A 2DGTA 4CBUA 4Q8EA 1OKJA 3HCXA 4NLWA 1MROA 2VKRA 1RHJB 4JLHA 1KLMB 4NB4A 4FWSA 2FC0A 3FEZA 1NJIT 4BE1A 5CAAA 3BREA 3I9V9 1WWHA 1N6QB 1FESA 3WXKA 3GZ7A 1ZZFA 3KUGA 3MM7A 3J7AP 4F3OA 4WK3A 5IT4A 1RI7A 5T7BA 2X78A 4A8YA 1JLGB 1W7AA 1JQGA 1PCAA 4PXEA 3PO4A 1KVAA 3NWGA 2K8GA 4PG7A 4FZYA 3I82A 4J9NA 2KHDA 2DFHA 3L3UA 2VQEF 3BF4A 1U8WA 5B0GA 1LFWA 1ZH5A 5DMRA 4RCHA 3D6MB 2EVZA 2HHHF 4N56A 2NZ4A 3UD3P 3ZT4A 1VR6A 1V3ZA 1G6BA 2UYTA 5TKWA 2YWGA 4YB6A 3UDLA 4NLVA 3KJVB 3HZGA 1IXKA 5KPTA 1RT3A 5EU7A 2IRUA 1R6VA 4TSXA 3GP9A 3OW2M 1M5VC 1WOOA 1WKLA 2M0GB 4F9OA 3NGDA 4MQ3A 4Y2MA 3KK3A 4RW9B 1FJGK 3DRRA 3MXHP 1VBYA 3UWTA 3W2WB 4DFKA 1YZ6A 2DR7A 3DU5A 3HK2A 1KLNA 3TJ9A 3BJYA 2G8WA 2RQCA 4FLUA 4X4NA 3UDEA 5HJYA 3ZTSA 2AA4A 4DR7J 1NB2A 5GAGP 4FWPA 4IDKB 2HMIA 4IUFA 4X4PA 2KQ2A 2VG7B 4J9OA 3CJ7A 3B8HA 4DU8A 4XH1A 4M3RA 5HBMB 1R89A 4USMA 4FW1A 1U1LA 1U25A 1IBCB 2HS3A 1U1PA 3OTDA 3KK2B 4DHYA 3ZNUA 3QIOA 4X4OA 2V2VA 4DR6F 5KFYA 2RF2A 1ZBLA 4CEZA 3CMES 1KR4A 5KPRA 3G96A 2MYFA 3THYA 3M3ZA 4JI7J 3A2FA 1V6HA 2Q6CA 3WQPA 3CIPA 3OL6A 2D41A 3FBFA 1U0HB 5DRKA 5E84A 1RA6A 3VQQA 3CSKA 3GPAA 4ED4A 1FTCA 2UUAK 2H1YA 4DV4F 2XMMA 3G6XA 2QM1A 4QBUA 5THWA 4LD0A 3DYAB 1Q0NA 1RWKB 5C42A 1QVFR 1EETB 4ZKAA 2E1RA 1UVMA 4DX6A 3AO2A 5KT5A 1YSJA 4NCBA 2AEJA 4UUWA 4N76A 2CUYA 3IAM9 2BW2A 4RUCA 3D66A 4NCAA 4WIIA 4H5VA 4ED2A 3H45C 2ZVIA 1VQ9S 4DKWA 2JZ5A 2PIIA 3ENHA 5KFIA 3FZBA 3KUEA 1GT8A 4ZLPA 4UOGA 1HNWK 4K0KF 3D68A 3PJ9A 5HLFA 3CO9A 2XEXA 3OL8A 4RW4B 3ASMA 5E41A 1TKDA 4E8UA 3FZ2A 4FLWA 4DCPB 3LANA 1NPKA 4B1ZA 5L9NA 4DV1K 3NXZA 3EZOA 2AYMA 3P39A 3HHLA 4F7VA 3UW1A 1KHVA 5IWAJ 5GAHI 3JSMB 2JDJA 5LSOA 4ZVGA 1B0VA 1ASWA 1R6YA 1D3WA 2QYCA 3TW0A 4KHSA 4DPUA 1HX1A 2J0QD 1TL3A 1VQON 2Y0SD 5AQXA 1SKUB 2YVSA 5ETMA 2VG6B 3CCLN 2VBWA 2LLZA 1RJJA 3CB4A 4DV6J 3NGZA 1RK8A 3M8WA 1BISA 1SQKA 1OS5A 2YQ1A 2KKHA 4J5OA 2AYEA 1RBUA 2DISA 5KRSA 3I0RA 2HFVA 4CJWA 4CGFA 2B9EA 4IEIA 5RUBA 4E89A 2E1AA 4JKFA 5K14B 1SAZA 2B5JB 1DLOA 1ASVA 1FXRA 4KHNA 3GB0A 3MM5A 3IXQA 2UXBJ 3SSSA 2RHKA 3VQAA 2RE2A 4I67A 1DGKN 2YNGA 4NYPA 1OWXA 2ASPA 4GO5X 1WG1A 4F4AA 4OX8A 3ZSVA 3QYYA 1UEVA 1JL2A 4P9SA 2PMWA 4FOEA 2CPEA 3K5MA 2KYXA 1IVZA 4BDPA 2LSNA 4X62K 5AJ3F 5D4PA 3C15A 3EXCX 1JCGA 1FW6A 3CJ3A 1B3TA 1WTFA 2RU9A 1OSDA 4KHUA 1N56A 5DO2A 2HQIA 2CRLA 3BS9A 3CJ0A 4KHPJ 2Q3SA 3PM9A 4XDCA 3ZZRA 3L7PA 5AQUA 1NSAA 1BQNB 2JJ4D 5A2QU 4FVMA 1J2VA 4LF9K 1UWBB 5EDWA 2P8IA 1NKEA 3CC7S 3EKUA 4ZHRA 2XMUA 2IGIA 4E7JA 1JLAA 3OBYA 2E5HA 3OYHA 1IBLJ 2XYHB 4TNOA 2R7XA 2RDJA 2BYCA 4BC7A 4HLBA 3W9HA 1XR5A 3FSIA 2LP4A 1RFQA 3RWUA 3HPOA 3NFAA 3N6MA 1HYZA 2KT3A 3BZCA 4FYYB 3FGVA 4FL9A 3W5ZA 4ANDA 5HMXA 1FFWB 2FJXA 1FE0A 1F21A 4J9PA 3C6AA 2RUSA 3T1AA 2XULA 2OP5A 3P4UB 4CJLA 4M8LA 4NRUA 4A8SA 2CH5A 2FJVA 3HBTA 3V9UA 2YX4A 1YK9A 3H20A 5C2DA 2MKYA 3AD8C 3BGFA 3LGMA 3G4SS 3QETA 3PV8A 1Y97A 1JLFA 2WCXA 2QL9B 2X3GA 3QNWB 3CJBA 3WQTA 3NVKA 3VAKA 4GVBA 4OZJA 5J2QA 1QM9A 5F3TA 2DGWA 2NSBA 1BWEA 4B3OA 4ZVHA 3ZEUA 3CJ8A 4WQ4C 1NBEB 3JS9A 2DCLA 5F0UA 1A6LA 4Y0WA 2X1BA 5H1SV 3PJWA 1ROFA 4UF4A 4Q8FA 1A5WA 1YVFA 1NSKL 1VQ4N 2DNNA 3V4MA 4C3MA 4BDZA 4FJMA 1YJUA 2I5JA 4U8YA 4DTRA 3IFRA 2UUCF 2PGCA 1V3RA 5M1OA 4OL8A 4Q2LA 2DYAA 2P2CB 1J5EF 3L4QA 4EMDA 3FE1A 1OH7A 4F02A 4OYXA 4BRKA 4HACA 4MK9A 3ZT1A 3SJHA 3OW2R 2AD9A 4CNYA 2HZCA 3T9ZA 3NGUA 2ZHAA 4PZVA 4DN0A 3HHNB 2AJ1A 2W9BB 3L0QA 1S9EA 4PKIA 3N6LA 3AAWB 3JS6A 4O5FA 3SEOA 2LA4A 4PL8A 4PG4A 3NGTA 3GYXB 4DTUA 2L48A 4TU8A 4F0KA 2F8MA 5KFFA 1T05B 4JI4K 4JI0J 4XPCA 4FJKA 4H5NA 2QL5B 3PY8A 1HBUA 2FVPA 1XMOJ 3CFRA 4NZ6A 2IY5B 5AQTA 1PAEX 2ITMA 1CZBA 1FRIA 2FHJD 2RRAA 3L2UA 4QOZB 1NK8A 5I9EB 2GX9A 4CK2A 4DV0K 3BBFA 4NLTA 1FDDA 3CT9A 3MD3A 3HI0A 3NEKA 1RYSA 1BMQB 5KGWA 3HVTB 3HFKA 1CJUB 1NCLA 4YB1P 1NLVA 2HRTA 1LK7A 1RT5A 4P10A 2L9DA 1C4AA 2GAGC 3SSRA 1M1GA 2WSCC 1UL3A 5HP1A 2VPYB 3H25A 4U95A 3F73A 2QLBB 4LSZB 3K5OA 2AZ3A 1WSHA 5HRPA 4RW7B 2V63A 2B4UA 3ZZOA 1TZ0A 4CH1A 2W2PP 1RQ0A 4KB7A 4O4RA 3L8BA 5HQ8A 3RUBL 3CE8A 1LW0B 3QNNA 4CLSA 2B43A 3AO4A 1A9NB 3L2VA 1JJCB 5MLCQ 3QMLA 4HUEA 1VRTB 5KFOA 2ZOFA 5EX5A 4C3KA 1REVB 4JKEA 4HTUA 3VVUA 4B1YB 4OPJA 3ULDA 4FVCA 5J2NA 4LMZA 1HKCA 4RW8B 2HG4A 1FJGJ 2HHUA 1FJ7A 1RHQB 4MKVA 3FBCA 1HR0F 2Q97A 3MMVA 3NMUA 3MAHA 3AA4A 3EICA 3R8EA 4QWBA 4ZP7A 3NF7A 3ILLA 3C2PA 1LOUA 4RWXA 3VGMA 2R7OA 1W97L 3MPWA 4JBCA 4PXDA 5FLXU 1HKAA 3PKMA 1SC6A 4O0NA 4PHTX 3TAMA 1KDNA 4JKGA 4Y1CA 4K25A 4FYVB 3NHGA 3P8BB 4Q45A 1S1WB 3HZEA 1VQ8S 2G2ZA 2PSZA 4MK8A 4AHCA 1WI8A 2D3UA 5FDLA 2UUWA 3QRPA 3V81B 1NO8A 2OO4A 5KG1A 2DNQA 2YKPA 7FDRA 3BDEA 3MECA 2AEMA 3P5BP 1RDAA 3C16B 4WKYA 3OFEA 1HW9A 1ZBUA 4L76A 1P6TA 4J9LA 3E51A 1EP4A 2M9KA 2VA3A 2ZHBA 5C7PA 1U02A 5EX3A 2RD5C 3CCVS 1MMDA 3NAHA 4BE0A 1YTAA 1JXBA 3A3OB 2UVRA 2YKOA 2IDLA 3VQ7A 1XC3A 4Y2IA 3HHLD 3OVSA 1X60A 4RX6A 5KFNA 2UUAJ 3ISNC 3NY0A 3H40A 3C65A 1I6JA 2Z56B 1WNSA 1XEZA 2E6LA 4OPHA 3D2FA 1RAFB 1LW2B 4O23A 1ZZNA 4O8KA 3M2VB 2MY8A 4NZ0A 1HJOA 1R0AB 4U7BA 2YHWA 2UU9F 3QFPA 2NXCA 3GSDA 2VYPA 1PO6A 2V8VA 2YV0X 3MEDB 4ZVTB 4GV9A 3KDOA 4IOCL 3MTKA 1NSQA 2PMZD 1D09B 3PIOL 3N4WA 1GLJO 1HNWJ 2FHKA 1ZYQA 2DNGA 2KDOA 2JLGA 2ALYB 5EHHA 3I4HX 1TK5A 1NGCA 1R0CB 4DUYF 1CPZA 2Y0BB 4PWUA 4KV8A 4GVMA 4DN9A 2FB0A 3VHQA 4Y2CA 2OA8A 3MPUB 1XQSC 3C8YA 3TTCA 4DV1J 3O4QA 1MG7A 2NCKL 4LFBF 5FJ4A 3TWHA 1VK0A 5A6PA 4YFUA 3HSZA 5FD1A 3AFGA 2VC0A 4Z4GA 1S1XB 4QW9A 4XH5A 3TUJC 1TKZA 4B9LA 2JVRA 2J9EA 1HBNA 5ETSA 4OX7A 1HYSB 4IOCQ 1WAFA 3PIOQ 1WG5A 4OYOA 1KLMA 4PWDB 2ZH5A 3V9XA 3A8YA 4AH9A 1RT4A 1N6QA 1T9VA 2ZOMA 2P9IB 1TR0A 3HZ6A 4Z4FA 1NK4A 7AT1B 1HI1A 4JEPA 3CDWA 2H5IB 3D6FB 3GDQA 2JC1A 3OTOK 1VGYA 3ZTPA 2X6NA 5GVQA 1KFSA 1JLGA 5HN0A 3PFEA 4YOWA 4JYAF 4KBOA 3AH6A 1KVBA 1WHXA 1OMSA 3G82A 3C6UB 3MR7A 4BREA 1X5SA 1O0PA 5GINA 5MAOA 3S01A 2KZMA 4X62J 2VFSA 3M2UB 3CULA 3HTVA 3O9RA 3F5TA 2E5JA 4Y34A 4ZPWR 4TYBA 1B92A 2GMHA 2FJDB 4IJAA 5KG6A 3KJVA 2M52A 3UCUP 2F4FA 4FOIA 3BSNA 3Q8QB 4LFCK 1NGAA 4DR4K 3G86A 4LF9J 5E33A 3T5JA 1LXJA 1O8BA 4LF5F 4BG8A 3RAXA 1G1XA 2OZSA 4YP3A 2FD2A 4FSVA 4HHTA 2OH2A 4RW9A 3CDUA 4KRFA 3SBGA 3ZSZA 1GLDG 4BR0A 3M32B 3HULA 3W2WA 4CO5A 1JX4A 1TV6B 5G0RB 3VTIA 4G1QA 3EUNA 1MDUB 3C46A 4DL0C 2HHWA 3I9ZA 2HHPA 2VH7A 5HANA 4TLRA 3LQVA 1J6ZA 4DL2A 3RU0A 4AQYK 1WTBA 2AQ4A 2W42A 5D0RA 2FLPA 1NHKL 1JCEA 4LF6F 3V2UC 1IKVB 4DR3K 3ET6B 4WYBA 2D0OA 5D0HA 4JKBA 2ZBCA 1IV0A 4WJBA 1VQNN 4UQTA 4K8XA 1W25A 1Y3JA 3NOGA 3KK2A 1NDPA 1GLLO 4JN4A 3KZBA 5HVFA 1WAJA 2HMPA 1HD1A 1DJ0A 3SCKE 3CCTA 4JB8B 3C19A 4URSA 3BR8A 3LP2B 3VF6A 4AUKA 4Y3CA 1NU4A 3CQ8A 2ROGA 1NOYA 5K20B 4GNIA 1D9DA 2U2FA 3MN7A 1MN7A 2CJYB 3KIOA 4B1VA 1JWWA 3OFHA 1V9OA 4KIAA 2BBEA 2VGMA 2KT2A 3DYAA 2DPNA 1H72C 1EETA 4OZ3A 1LKZA 4KH1B 1UAWA 3CCEN 3KVGA 1BOTO 1BY9A 4PCQA 4ID1A 4BY9C 4DSKA 3FFIB 4JS4A 2ZE2B 2PI4A 2OANA 4BRLA 2AX1A 3S9HA 2RVJA 2NRXA 4RNNA 3IUCA 4CZHA 1N5YA 3M9MB 3SNNA 2IVFB 1RA7A 4P74A 3V5RA 3QSYB 1H1VA 5F0XA 4CJEA 3CJTA 1SL0A 1FRHA 2W9CB 6FDRA 1YIJN 1QHAA 3EGZA 1UKUA 1GNKA 4F3QA 4LQ3A