2VG5A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
557
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 144
structure length 551
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg5A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg5A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg5A05
4FJ8A 4K4ZA 4Z4GA 3D45A 3T5HA 1BQMB 2PYLA 1Y97A 3IRXB 1CXUA 2QV6A 1J5OA 4C8LA 1LW0B 1FXXA 4N47A 2FVCA 4XIUA 5I42A 4KREA 4J9OA 1C1CA 4NLUA 2OZMA 2HNYB 1HRHA 1EXQA 4LSNB 2AGPA 4CGFA 3MAQA 4KHUA 2FBXA 4K8XA 1RDCA 3NL0A 5KFMA 3H59A 1JXEA 4BWJA 2KFNA 4WXWA 4OLAA 4CEOA 4QWBA 4JV2A 3NH1A 1WAFA 2BQRA 5KFIA 2WONA 4B3OA 3SFGA 4DSJA 1BCOA 4HCBA 2YHAA 1Q9YA 4E7JA 1L3UA 4TYBA 3PW0A 3C95A 1RT1A 1I3AA 4Q5VA 1ZTTA 4WFYA 3H2LA 2AX1A 2OPSB 3CJ3A 4KI4A 4H54A 4MKBA 5D3GB 3M8QA 2FLPA 4RW4A 3MR3A 1SH0A 3PZPA 3QEWA 3O4NA 3MXJA 2QKBA 2VG5B 2GIQA 3DLEA 2FBYA 2VWKA 2J6SA 2AU0A 1RBTA 2AQ4A 2JEIA 3MEGA 4F4WA 1TKXB 3UDLA 3SYZA 2IOCA 1ZBUA 4AH9A 4EYHB 4ECZA 3B6OA 4FZXC 3CJ4A 3KHHA 4F2SA 2ETJA 4E7HA 3QNOA 1NOZA 4ECUA 5L9XA 2G8UA 3OHBA 3ITHB 3SZ2A 2E6MA 2XWYA 1ITGA 4HUEA 1JLBB 3B6PA 3QZ7A 2ASDA 2R2SA 3PY8A 4OL8A 3RWUA 3CFRA 3OYAA 2YNGB 1JKHB 2J6UA 2ZE2A 5CYMB 1B9DA 2YNHB 4YMEA 2ASJA 1RT7B 3NF9A 2AWZA 5SWMA 3ULDA 4KB0A 1UWBA 1EKEA 3P5JA 4CK2A 4YNQA 1K6YA 4CF1A 5K14A 2ZE2B 4GC7A 3I8DA 3RRHA 4G1QA 4KTWA 5EWFA 3F73A 4FLYA 1ZETA 3OSPA 1GOBA 3FDSA 4HHTA 3DI6B 3KIOA 1VSKA 2ALZA 3L2RA 4FXDA 2W7OA 1X1PA 1CZBA 1NHUA 3AA3A 3DMJA 1TAQA 4F8RA 4DQPA 3G0ZA 3PUFA 5KRSA 2ZQBA 1WNEA 1VSFA 2X78A 1HNVA 2HHVA 3LAMA 3RTVA 4CHZA 4QPXA 1RTDA 4TY9A 2R2TA 1ZBIA 3RMDA 3VQBA 1LWCA 3FFIA 1RTJB 1CZ9A 1NK5A 3EZ5A 1KTQA 2YNIA 1D8YA 1IKVA 4CJSA 3SQ2A 4FBUA 3KK3A 2R8GA 4JS4A 4DTSA 3DLHA 4KB1A 3THVA 3DM2A 4IG3A 4NCGA 2O5DA 4CGIA 4EP5A 3VQDA 4IH6A 5KG6A 3ZT0A 3MF5A 1QUVA 3VN5A 4DSFA 1DTQB 3K5MA 3KMQA 3NMAA 3IG1A 1S9FA 2VWJA 3KK2B 2R7YA 3K2PA 5KFBA 2UUWA 5FRNA 5EU7A 2P51A 2OPPA 1QAIA 1HARA 2ATLA 4CFDA 3QLHB 3NAEA 3HSTB 3VQ9A 3QIDA 4IH7A 4R8UA 4TQSA 3VQAA 4F4XA 3HPHA 3AV9A 1JLAB 3S9HA 4FZYA 1HYSB 5KFGA 4CESA 4Q0BA 1QSLA 3H5YA 5KFHA 5T7BA 4NYZA 5FROA 2A1RA 4X2BA 1TL3B 1QHTA 2Z1GA 3OYNA 1T03B 2YNGA 5HRNA 3GV8B 4K4VA 2F96A 4IBNA 4KHSA 5DQGA 2DY4A 1RILA 1TKDA 3CM6A 5E41A 3GIKA 5DLFA 1SUQB 3ITHA 4Y3CA 4ZTJA 3K57A 1C0UB 1BQNA 2XI2A 2C28A 4IOBA 1SV5B 5C24B 5KG7A 1J53A 3VQ8A 1VSDA 5DK5A 3RB6A 3HK2A 2R2UA 1DTTB 2WOMA 3UQSA 2HNDA 1LWEA 1KVAA 3AVJA 4OGCA 1EP4B 1TL1A 4O44B 1SUQA 2FC0A 3NCIA 4I2QB 4HCCA 4LQ9A 3QIPA 3MEGB 5KFSA 4KBIA 5KFRA 4NLPA 4KRFA 5F9LA 3LP0A 1BI4A 3KLHB 1R0AB 1MU2A 4RNHA 2XRIA 1CLQA 5HP1B 4N41A 5F8MA 4TXSA 3MR6A 3LPTA 3V6HA 4O4GB 4JV1A 3ZSVA 4JV0A 1N56A 4BDZA 1RTHA 4ED2A 5J1EA 1X9WA 3V1RA 3CM5A 4CJFA 3AO3A 3KJVA 5KFKA 4KFBA 2LSNA 1ASVA 2XCAA 4DF4A 2XY6A 4NLDA 5DGAA 2IJFA 2RKIA 4F2RA 2KQ2A 1DTQA 1TGOA 4NLRA 3RBDA 3CWJA 1WAJA 5KFXA 4FCYA 1NOYA 4WE1A 3CJ2A 1D9DA 5FRMA 4KB7A 1KFDA 1RYSA 1IKXB 3QINA 1CSJA 1TP7A 1XR7A 3OL8A 1N5YA 3AVLA 5HBMB 3GQCA 4ID5A 4R0EA 3H98A 3AVMA 3RMAA 4OPKA 1MMLA 4XPEA 5KG1A 3AVIA 1WSHA 4Z4HA 4ECSA 3QGHA 5KFVA 2D5RA 2IS3A 2IBKA 4FYDA 2JGUA 4CGHA 2I5JB 3OY9A 2VG6B 4B9VA 4EZ9A 2KW4A 4QWAA 4NLYA 5EWGA 4CFAA 3S3MA 3PVXA 1JL2A 1U04A 1NJZA 3DRSA 4H8KA 4YR3A 1RDBA 3OS2A 4ZTFA 4WXOA 4FK2A 5C42A 2XCPA 1RT3B 1IH7A 3T5JA 4NLTA 4NLWA 3ISNC 3KLVA 3VQPA 4LQ3A 3OYKA 3SQ0A 3HVWA 2HW3A 4DSIA 3V6JA 1S1UB 1TV6A 2F8TA 5CZ2A 3T19A 3L3VA 3LDSA 3CYMA 1RT7A 3NH0A 4KKOB 4K4XA 4NRUA 3M9OB 4DL4A 4B9NA 1LW2B 5J2PB 4AHSA 2ZD1A 3PW4A 2B6AA 4DEZA 2Y1JA 1SKRA 5J2QA 4CERA 2B5JB 3RBEA 2IC3B 3CFOA 4CJ5A 1T8EA 4TLRA 3HKWA 1RBVA 4DTNA 1A5VA 3SPZA 3BSNA 5JS1A 1N48A 4FLWA 3DRSB 4CGGA 5KFLA 1S0OA 3M8QB 3MECA 3NAHA 3LAKA 2QK9A 1C0TB 4RUAA 2EHGA 2F8EX 3LALA 4ZMMA 2OPRB 4IG3B 3TWHA 4IFVA 1VSEA 1GX6A 4CF2A 3NKYA 3TAQA 2Z1IA 5HLFA 3O3HA 1D9FA 2IAJB 1S5JA 4DG1B 3M8SA 3C94A 2V9WA 3TAEA 1YT3A 4WE1B 3KNAA 4RW6A 3D0PA 3ZT4A 4ZHRB 3AO1A 4FJJA 3QEIA 2IM1A 2I1RA 3LWMA 1NK6A 4EBCA 3HYFA 2QE5A 1VK0A 1LWCB 2FBVA 4FJKA 1S48A 2OPQA 4GW6A 2Q3SA 3MEEB 2XHBA 4FJIA 4H4MA 5J2NA 4AILC 4O3QA 3HPOA 3WNHA 3K5NA 5KT7A 2BE2A 4FVMA 1D1UA 1S1TB 1BL3A 4CF9A 1IKYB 4RNOA 5KT2A 3K58A 2IM3A 4JRPA 4ECWA 5L1LA 1S97A 3LANA 1IM4A 1KRPA 4LH5A 4FLXA 4KAZA 1JLEB 3QESA 3OHAA 1EP4A 2BDPA 2P5GA 1WSEA 3DI6A 3V9SA 3NHGA 1UWBB 3KK1B 3M9MB 3ZSZA 4QWEA 4R5PB 3OL6A 3MXMA 2FVQA 1VSMA 4OKJA 4ED1A 5CYMA 1DTTA 3RAQA 4E7IA 1KLMA 4GMJB 2W9CA 2D3ZA 4KTZA 3VQCA 5CYQB 3SPYA 4ELVA 2BE2B 3AA4A 4MFBA 1UA0A 2R8HA 2D0CA 4FM0A 1QAJA 1JL1A 4DTXA 2HMIA 3LP2A 3NF8A 4F3TA 1S4FA 5KT6A 4BE2A 4TY8B 3KMSA 3DDKA 4DTPA 1IKYA 4YQWA 3HXMA 2DPIA 3VQ7A 4CIFA 3CJ0A 4W5QA 2O4IA 3GIJA 1FKOB 5KFCA 4M3YA 3EPIA 4J2BA 3V4IA 4PWDB 4CHNA 1EX4A 2R8IA 3OYIA 3A2FA 2ZKUA 3T5LA 4CJKA 5HLFB 1GOAA 3KK2A 1NJXA 4FM2A 3V9UA 3V6DA 3DLKB 3G6XA 1Z25A 1Q8IA 1U09A 4C8OA 1KFSA 3KHGA 3Q8QB 3IS9B 5HP1A 3HHKA 4KTQA 4Q43A 4IR9A 2WK4A 4PUOA 4GC6A 4RW7B 2D3UA 1S49A 3ALYA 4DG1A 4FS1A 4CJLA 3OJSA 1W25A 1UA1A 2YV0X 5DQIA 4ED3A 2HNDB 2YNFB 3H5SA 4O55A 1FKPB 1RBSA 4LY7A 3HJFA 1NK8A 2R8JA 4J9KA 1C1BA 3KK3B 3DMJB 3V4IB 4PWDA 3M8PB 4YFUA 4RUCA 4CJTA 1YVFA 3OYCA 4DSKA 4BE1A 2YKMA 4AHRA 1RTDB 5J2PA 3PJXA 1BIUA 4TSXA 4Y1DA 4I2QA 3KK1A 1QTMA 4I7FA 3TANA 2IC3A 4N5SA 4CEBA 4ECRA 1HMVB 2C2DA 1QQCA 4FJ5A 1VSLA 5EUHA 4KHMA 5KFAA 3BGRA 2UUTA 1LW0A 1QSYA 1LW2A 2KZMA 2FJXA 4F50A 1K1SA 4O3RA 2F8SA 1WSFA 3PO5A 4O3PA 3DLGA 3QO9B 3DOKB 4M3TA 4R5PA 1W0HA 4C8NA 3DOLA 4H4OA 3EY1A 3I0RB 1BQMA 4DL6A 1HYSA 4CJWA 3M8RA 4O0JA 4DQSA 4BDPA 3MEDB 1JLBA 4QAGA 3KLGA 1DLOA 1TL3A 3HT3A 4Z4FA 3BREA 3ZT3A 2VA3A 2G8WA 4R8UB 4J9NA 2AGOA 2VG5A 3H4BA 1GX5A 1JXLA 4TN2A 1F21A 2OZSA 2BANB 3T5KA 3QNNA 5KGWA 3LZJA 3OS1A 4MK8A 4CHOA 2GIRA 3ZSWA 5HRPA 1NK7A 1IKWA 4ZPDA 1QS4A 1RNHA 1L3TA 3PJWA 4FW2A 4I2PB 1ZTWA 3D28A 1S0MA 2UVVA 3NE6A 1TKTB 1JLQB 4DF8A 3V6DB 3LP2B 4NCBA 4TYAA 4LD0A 4IFVB 3CIZA 3OL7A 5I3UA 3AVKA 3MFIA 2ASLA 5KG3A 2W42A 4FLUA 3G10A 2KTQA 1JX4A 4IG0A 3VQEA 4OKKA 4DFKA 2E4LA 3SI6A 2YNIB 1BISA 1YTUA 3ZSXA 3L2VA 4J9LA 1VSJA 1WNSA 3BDPA 4IFYA 3H4DA 3HM9A 2E6LA 3VA3A 1UAXA 4QWCA 4FM1A 1REVB 3O3FA 4QW8A 3GV7B 4J2AA 3MTKA 3OYHA 4M3RA 2BQUA 3RB3A 2W8LA 4RG8A 1C0UA 5J2QB 1Z4UA 1ASWA 1TV6B 2HMIB 4FLVA 4WFZA 2GUIA 3LPUA 2BQ3A 4KKOA 3ZCMA 4ZVFA 3V81A 3V1OA 1ZBHA 1RT5A 1TKZB 3KLIA 4DMNA 4CK1A 4M41A 1SKSA 5KFEA 2D0BA 1HPZA 4RU9A 4E0DA 4CIGA 1HJRA 3BJYA 3QGGA 2EC0A 4JLHA 3I0SB 4KO0A 3NBPA 4KE5A 5HBMA 4IG0B 4LSLA 3FQLA 3ICLA 1XHXA 3ZT2A 1XHZA 5F8NA 1TKXA 4HTUA 1NKBA 4RW8B 2HHTA 2FLNA 3PR5B 1NK4A 3QLHA 1REVA 3VQQA 1RT2B 3UPFA 3ZSYA 4W5TA 4IDKB 1S9GB 1TK0A 4J2EA 4ECTA 4PUOB 5C25A 3JYTB 2WHOA 3H5UA 3VA0A 4CEAA 3AA5X 4IR1A 1OS5A 1B9FA 4EP4A 3JSMB 3HPGA 1N5YB 4O4GA 3GYNA 5KT3A 3DLRA 5HRSA 4ED8A 2J6TA 1C0MA 3QGIA 1DLOB 4KV8B 5KFTA 3FFIB 3DLKA 1C6VA 3E01B 1A5XA 3M9NB 4RW6B 3HL8A 4FJ7A 4CEFA 1BI4B 1RT2A 5KG0A 4Z4CA 4MIBA 3KKSA 4CF8A 4CIEA 3KLGB 2HAIA 5C24A 1IG9A 2IM0A 4DQIA 5EDWA 2IGIA 3Q8SB 4ZP8A 2XY5A 2ILZA 3C6UB 1RCHA 3P83D 1TL1B 4LSLB 2V4QA 3CJ5A 4RNMA 3QIPB 1KHVA 1NNDA 1XI1A 2V0NA 4Z4IA 2W8KA 5KI6A 1ZBLA 4Q8FA 4AHUA 3OYLA 1LV5A 4NYNA 2UVWA 2B4JA 3KD5E 2FJWA 3V9WA 5KFJA 3HVAA 2YKNB 1HYZA 4IRCA 4PQUB 3I5AA 2P1JA 3VQ4A 3OYMA 2BRLA 3RAXA 1RT4A 3OLAA 1B92A 3CO9A 4UQGA 2RN2A 1D0EA 3E51A 1FK9A 4YP3A 1HQUB 1S1VA 3DRRB 1WSGA 4Z0UA 1U47A 4CEDA 2V4RA 4DL7A 1ASUA 1TAUA 4CECA 1JKHA 1EETB 2I5JA 3QEXA 4IQXA 2W9AA 3OJUA 1JLAA 4KHNA 4O0IA 4HUGA 4ELUA 4ED7A 3CQ8A 4Q0BB 1RYRA 4M3UA 3DYAB 2E9TA 4KSEB 5FDLA 2KFZA 5L1KA 4YR0A 4FK0A 3QYYA 4NLGA 5C5JA 5F8GA 4I9QA 3NDKA 3BSOA 4NCGB 4FLTA 5DGBA 2YNFA 2ATQA 3T1AA 2HHQA 4CHQA 4I2PA 3ZSQA 2HNZA 3TAMB 3I5BA 5KFOA 1RTHB 4Y34A 2PZSA 2VG7A 3OYGA 4ECQA 1WLJA 1N6QA 3BSCA 1MU2B 1KSPA 4WZMA 4IRDA 1S6PB 4EBEA 1WN7A 2XY7A 4KO0B 4CGJA 4FLZA 4DTJA 3L3UA 4FJXA 2IAJA 3Q8RB 3PV8A 1RTJA 4B8CA 4CGDA 2HWHA 4KAIA 5KG2A 3NH2A 2RKIB 3MR5A 3KLHA 2G8FA 2D0AA 4ED0A 1U49A 3EYZA 1S1VB 1UOCA 3PX0A 1NK0A 2DTUA 1SL2A 4FW1A 1XR5A 3AVGA 4KHYA 2AGQA 4K4SA 4CEEA 3O3GA 4XO0A 5C42B 3DLGB 1S1WB 5KFUA 4NLXA 3RR7A 4MIAA 4DSEA 4O44A 4W5RA 1RBUA 3KKRA 3ASMA 3PW5A 1BIZA 4M3WA 5T14A 4ZP7A 1T3NA 4LH4A 3PX6A 3N6LA 2E9RX 3PW2A 2GV9A 1SV5A 3K5LA 4B9MA 2R2RA 3TI0A 3ZT1A 2RF2A 4HUFA 5JS2A 3N6NA 1J9AA 1BCMA 4NLVA 2C2EA 4U7CA 4OJRA 1X9MA 4K4YA 4ZP9A 4H4MB 5J2NB 2BGGA 5JXSA 1LWFA 4MKAA 2GBZA 2OPPB 3PR4A 5KFPA 3SV3A 4M3XA 1IO2A 3KD1E 5DG9A 1RT6A 2OPSA 4AHVA 4BDYA 3OYBA 3DLEB 4ZVGA 3LP1A 3NAIA 3OYJA 3RMBA 1U4BA 2NUBA 2OPQB 3V9ZA 3E01A 1C1AA 1SL1A 4IH5A 1TKTA 4BE0A 4F4ZA 4XPCA 4TQRA 4DL5A 2FJVA 2JEFA 2UVRA 3SUQA 4RW9A 3OYEA 4KHWA 5C25B 2ITGA 5KTQA 3H08A 1NHVA 3KTQA 5HROB 4DU1A 4JS5A 3TAFA 1IKVB 2YHBA 4M42A 3LP0B 4OKEA 4RW8A 3BSAA 3P1GA 2JC0A 3O4QA 4OPJA 3QZ8A 1S10A 2JLEA 4J9PA 1FK9B 4CJ3A 2WCXA 2G8IA 5KFYA 2OA8A 4J2DA 3TVKA 1JXBA 4DTUA 3RMCA 3DRPA 3H40A 3NBPB 4KI6A 3FQKA 2IJNA 4FJLA 1VRUB 4ZPBA 4O3SA 5EWEA 4M94A 3MEDA 2YKNA 3PO4A 4B9UA 4DFMA 2WRMA 4CE9A 3ZSRA 3K59A 2OH2A 3LWLA 1LWFB 1R0AA 3G6VA 3TAGA 2RDIA 1HQEA 4O3OA 1RT5B 1TKZA 5KFFA 3HVTA 5DG8A 1LWEB 3I0SA 3SUOA 4J9MA 1C2PA 4E89A 2QXFA 4M3ZA 4Y2AA 4CF0A 1VSIA 3SUPA 3CVKA 4BACA 3Q8PB 4DTMA 4WZQA 2DPJA 2RF2B 3C6UA 3IN5A 2G8KA 4CEQA 1S1TA 1QE1B 1YTAA 2FLLA 5F8LA 4O5BA 4U6PA 4I7FB 4B9SA 4HYKA 4FJ9A 4Y1CA 5KFDA 1S1WA 3CDEA 1T05B 3AVBA 1K1QA 3L2QA 1RBRA 2XI3A 2FBTA 5SZTA 1FKPA 1NKCA 3HO1A 1VRUA 3QEPA 4E3SA 5KFNA 4RW7A 1T94A 2X74A 4DTOA 1NJWA 4CK3A 1JLQA 4KV8A 4ZHRA 4Q8EA 3SQ1A 2HVHA 4MQ3A 3AVCA 4NCAA 3DRPB 4DFJA 4NLOA 4ED6A 3NF7A 1I39A 2UVUA 4W5OA 1SL0A 2AJQA 4GVMA 3RB4A 4ZVHA 1IKXA 3CDUA 1N6QB 3QIOA 1ZYQA 3LZIA 3KHRA 4ZPAA 4ZVEA 4DLGA 3UR0A 1G15A 5FDLB 4ICLB 2RPIA 3L8BA 1KCFA 4OGEA 3NFAA 1JLGA 1HNIA 2JC1A 4CEZA 1C0TA 3DOLB 4H4OB 4URSA 3BR9A 2HB5A 1RT4B 3NGZA 2EX3A 2DFEA 5HRRA 2IMWP 1LAWA 3KLFA 3HVRA 4CFBA 2E9ZA 3QETA 4E1NA 1HPZB 4F3OA 5DG7A 3KJVB 5KFQA 4M95A 3OYFA 2GC8A 5CY4A 3AO5A 4M45A 4ID1A 2W7PA 1J54A 1JLFA 1JLEA 1NJYA 1WSJA 5KT5A 3SCXA 5KG4A 3SUNA 4K4TA 3QERA 1BQNB 1W9HA 4QW9A 4E7KA 5F8IA 3CG7A 4EO6A 3G6YA 2HNYA 5KRTA 1HYVA 1JLFB 1KVCA 4NLSA 4DWIA 3HVTB 1VSHA 3NF6A 3BQ2A 3MR2A 1C1BB 2XGQA 3EPGA 3IAYA 5J2MB 4EYIB 3HP9A 1SH3A 4DL3A 4CFCA 2VG6A 5I3UB 1RDRA 2YKMB 3SV4A 1KLNA 5DLGA 2Z1JA 3LP3A 2HHUA 1XC9A 4ICLA 1TVRA 4F4KA 1JLCB 4URGA 3WNFA 4C8KA 4DTRA 2BR0A 3V6KA 4MK7A 1VRTA 4C8MA 1RA7A 5CZ1A 1TQLA 4E1MA 5HROA 2FVSA 4DFPA 4MH8A 3DM2B 3MEEA 1IKWB 5L1IA 3AVAA 4J9QA 3C6TA 2OPRA 3ISND 4CHPA 1O1WA 4RW9B 2HHXA 3IG1B 3VQSA 3S3OA 4K4UA 3LP1B 1RAJA 3SFUA 4CJPA 2BRKA 3ZSOA 3OS0A 3IGNA 4CJEA 2HWIA 1S9EA 4NRTA 3PW7A 4F4YA 4DU4A 3DOKA 4NZ0A 1T05A 1RT1B 1S1XA 4FBTA 4B9LA 2WOMB 1TK5A 4DQQA 1RA6A 3RRGA 2W9BB 4J9SA 5KGXA 2O4GA 4QCLA 3NGDA 3PHEA 2ZD1B 1NKEA 3OVNA 3DRRA 4K50A 4MK9A 3K5OA 5J2MA 3PX4A 3OSNA 3MXIA 3NGYA 4JUZA 4O4RA 2YNHA 3RB0A 1HQEB 4LSNA 4IKFA 2IM2A 2WB4A 3AVNA 3HP6A 1RTIA 4WFXA 4NYFA 1C1CB 2DFFA 1S0NA 4DL2A 2IA6A 4QWDA 1GOCA 1Q9XA 1YVUA 4JRQA 3FSIA 3V81B 3G86A 1L5UA 3AA2A 4Z4EA 1I6JA 3KOAA 2W9BA 5I42B 2FVPA 1A5WA 4WYLA 4CJUA 3SJJA 3IGVA 1HMVA 5F8HA 2HVIA 4CJRA 4B08A 3M8PA 4RNFA 3TAPA 2HHWA 4ID5B 4K4WA 4IKAA 2A1SA 4N56A 3I5CA 2VA2A 3WNGA 3TARA 1N4LA 2CKWA 4ELTA 2D41A 3KLEA 4EO8A 1S9EB 4RW4B 4DU3A 3UIQA 1BHLA 4DS4A 4FJNA 4I9LA 2C2RA 2CJQA 3GIIA 4OVLA 1U45A 2HNZB 4QOZB 2WONB 4B3OB 1L3VA 1LAVA 3TABA 4N76A 4DSLA 1HNVB 3JSMA 1S6PA 2RDJA 4CHYA 4OLBA 3TQ1A 3DYAA 4ECYA 4B8AB 5J1EB 4L8RB 3JYTA 4O3NA 3AVHA 5F9NA 3MECB 3T3FA 1JLCA 3TR8A 2AX0A 4E19A 3N6MA 2X6NA 4CJQA 1QSSA 1RT6B 3VQ6A 3U3YA 1S9GA 4IDKA 1VRTB 1SH2A 2PY5A 2B6AB 1RDAA 5KFWA 1BGXT 1U48A 1FKOA 5KT4A 2DFHA 4PA1A 3FRZA 2OYQA 4AHCA 3IRXA 3H5XA 2W9CB 3I0RA 4ZP6A 3AO2A 4J9RA 3SQ4A 1KHWA 1CXQA 1QE1A 1TK8A 4CCHA 3F9KA 4PY5A 5L1JA 2XO7A 4B9TA 1D5AA 4FJMA 3BQ1A 4K8ZA 3QO9A 4IFYB 2Z1HA 5F8JA 3BGRB 4G1QB 3OYDA 1KLMB 4G3IA 3KLFB 3KLIB 2G8HA 4MFBB 3RR8A 3WNEA 4ZPCA 2QKKA 1T03A 1S1UA 4NLQA 4EBDA 4PQUA 2ILYA 4KHRA 3NGIA 3CDWA 1S1XB 1RT3A 1XR6A 4URQU 3V1QA 4EEYA 4EZ6A 2WTFA 4KHQA 3OLBA 1SKWA 1XWLA 4W5NA 1RTIB 2Y1IA 3SI8A 5D3GA 3MFHA 5JUMA 1L3SA 2VG7B 1S6QA 4HVJA 4FK4A 1JLGB 1HNIB 2IDOA 4HKQA 3VQ5A 1RDDA 1KVBA 4CJ4A 3C6TB 2C22A 4FJGA 4Q45A 2XGPA 4RNNA 3AVFA 3U6FA 3GV5B 3CFPA 2BANA 5DMRA 5KG5A 4FS2A 3OL9A 1ZBFA 3S3NA 2P5OA 2XC9A 3U3GA 4ECVA 2X6SA 4WYWA 4IRKA 1WSIA 3L2UA 3IS9A 1JIHA 2PYJA 2JEJA 3AO4A 3L2WA 2G8VA 3TAMA 2FVRA 4DLEA 3SNNA 1NK9A 3KLEB 4KPYA 4DS5A 3GIMA 4YR2A 1TVRB 2B43A 4BWMA 1EETA 4TY8A 2KZZA 4ECXA 4CJVA 3BQ0A 2HHSA 4FJHA 1T7PA 2R8KA 4E7LA 1HQUA 2XY8A 3V9XA 1S6QB 2D7SA 2B5JA 3GILA 3KHLA 4RZRA 4KFBB 5DQHA 4DQRA 1Z26A 2JEGA 3QEVA 5K14B 3EZUA 4FZZA 3DLBA 1J5OB 5CYQA 4Y2CA 4Q44A 4AHTA 1X9SA 5KFZA 3D5MA
chains in the Genus database with same CATH superfamily
2GVZB 2YKAA 5AQIA 4K4ZA 3T5HA 2ZBRA 1BQMB 4FYWB 3DU5A 1X4BA 3DAWA 3I82A 1FXXA 4N47A 3TOQA 4J9OA 1FWLA 2EFOA 2OZMA 3VZHA 2UXCK 1RP5A 1UEUA 2HNYB 1BDGA 4OHVA 2O8CA 3LPYA 3UFCX 3EM1A 3MMVA 1Q86T 2ZH8A 3MMCA 4B1WB 3PJ9A 3ILIA 4WXWA 4OLAA 3AGRA 4U95A 4CEOA 3VAFA 3NH1A 4WFBQ 3RU0A 4DZ6A 3TUZC 2BQRA 4B3SF 4CLFA 2JWLA 4JI2K 1KQSM 5HI7A 3C8YA 3U1MA 1ROFA 4DPYA 4P2MA 5AXMA 4H54A 2IVNA 2E88A 2FLPA 1FTCA 4OZLA 2QKBA 3DLEA 2C1EB 1RBTA 3QRPA 2HVDA 3N5BA 3HMJG 1ATRA 5IM0A 4F4WA 1TKXB 4CDIA 1FT8A 2P2CB 4AH9A 3MM5B 4CYUB 2C3OA 3B6OA 2DNLA 3CJ4A 3KHHA 2ETJA 2R7UA 5L9XA 1FI4A 3M30A 2XWYA 5K8MA 2HZCA 3B6PA 3K8VA 2R2SA 3DRXA 1QVGM 4OL8A 3AJ1A 3A3OB 2LQJA 2ZE2A 2CG4A 4NMLA 1B9DA 2ASJA 4DCHA 5CE3A 2Z2MA 2I9SA 5SWMA 4PZVA 1YJ9N 4DUZJ 1UWAA 4KB0A 3CEDA 3ZTPA 2FSJA 1VS3A 2GFFA 2VBXA 3P5JA 4CK2A 4YNQA 1K6YA 3CMES 1B7YB 3ZZRA 4DR4F 4C7QA 3I8DA 3HCXA 3D4JA 4KTWA 5EWFA 2R9LA 1ZETA 4C11A 4HH0A 2CQ2A 3KIOA 5RUBA 5BR8K 1MWQA 2W7OA 3CETA 5CABA 2NRTA 1BY9A 2C42A 4GKJF 1NHUA 4WCEL 3R5BA 1TAQA 1SIZA 4DQPA 3G0ZA 5KRSA 1VSFA 3A13A 4JI1J 2M70A 3LAMA 4CHZA 1ZBIA 2GHWA 4HDHA 3WQUA 2WVBA 1GTEA 4FKXA 3IMXA 1WBDA 3VQBA 3FFIA 1NK5A 1CZ9A 2D74B 3EZ5A 2YNIA 2PE8A 3DLHA 1CPZA 1ZOTA 4A59A 4NCGA 2WBMA 5AZJA 1R31A 2BV3A 2PD1A 2CQPA 1OIAA 3ZZTA 1VRQC 4TU7A 2XQCA 3HFVA 3N4PA 2WVFA 5AQXA 4OHWA 4FYYB 2CPXA 4NXNJ 1WSRA 2ATLA 2BW2A 4CFDA 3QLHB 2OO4A 3GDQA 3M1VB 3NAEA 4IH7A 3GG1A 4MLHA 5J1NA 3TSPA 1U1MA 2BM1A 3HPHA 4DR2J 5FJ4A 4HVZA 2KRBA 1VQNS 3V4MA 3F9MA 4FZYA 1HYSB 2JX2A 5KFGA 4CESA 4Q0BA 5LMUF 5HN0A 4NYZA 2GHPA 5FROA 4F67A 4X2BA 2GVDA 2YNGA 2PAVA 5GADI 3GV8B 1J5EJ 1KP6A 1HKCA 5GMKa 4IBNA 2NXUA 5BYRA 3MPDA 3UR3C 5DQGA 5MLCQ 1RILA 2DGQA 2SXLA 5IV3A 2VQFJ 2K7KA 5DLFA 2CXEA 3VHQA 3K57A 1CJKA 1BQNA 3HD2A 2KM8C 5DM7L 1RAGB 2HNDA 1LWEA 1EP4B 1Q18A 2FC0A 5IQQA 3VEZA 4DR5J 2RILA 3CE8A 2AIRB 5KFRA 4NLPA 3ZNJ1 4KRFA 5F9LA 1RKJA 2XRIA 5HP1B 4HHJA 5F8MA 4TXSA 2ZKTA 2CADA 4JV1A 4JV0A 5KPTA 3NGRA 4ED2A 5J1EA 3VEYA 3V1RA 2F4VJ 1WACA 2VPZB 4CZIA 2LSNA 1ASVA 2XY6A 4NLDA 5SUHA 4OX9F 1FRLA 2PGCA 1FTRA 2KQ2A 1IXKA 2JFDA 3I87A 1TGOA 4WTYA 2F7TA 4JD2A 5KFXA 1W7WA 1IBMF 2H48B 3JTPA 4DV3J 1HNZK 3EE3A 1CSJA 1MWKA 5GAEI 2BXJA 2B4UA 5HBMB 2YJEA 2GMLA 5A8WA 3C7NA 4O8UA 2V68A 1GLAG 1U2CA 4OPKA 4FNHA 4JD2B 1MMLA 2H4WB 5KG1A 1WSHA 3TZXA 4OQJA 5KFVA 2D5RA 2IS3A 3AQPA 4FYDA 2JGUA 4CGHA 5I3QA 2VCPA 2HAFA 3OY9A 4B9VA 1B99A 2KW4A 1N54B 2CQGA 4NLYA 4NZ7A 2XLKA 1N0VC 4YR3A 4H8KA 2C3PA 5A6PA 3PCOB 1YRXA 5B0DA 1NB7A 1KAZA 2XCPA 1GEHA 2RS2A 5AZIB 3ISNC 3OBIA 3PLAA 2NUUG 3C14B 1WTFA 3GJQB 3HVWA 1KEKA 3OR2B 3GBTA 3V6JA 2CQCA 3MMBA 1ZH5A 1LWXA 3CCJS 3T19A 3NH0A 1XNQF 4KKOB 1XNRJ 4BC2A 3M9OB 3OTBA 1LW2B 5J2PB 4CZMA 1VQKS 2CRLA 1V3SA 1Y3KA 1SKRA 3T1HJ 3NVMA 3RBEA 1MWZA 2J0QD 4CJ5A 2APOA 2P9LA 1HBNA 4DTNA 3B54A 3BSNA 3CJAA 5HVGA 4X62K 1N48A 2J7UA 2GIFA 4CH1A 3TZZA 1PO6A 4WBFA 3LAKA 4OYZA 1C0TB 5CXTA 4OI6A 2EHGA 2F8EX 2OPRB 4IFVA 3NKYA 3TAQA 5CHIA 1ZM4A 3W9IA 1UW9A 1RK8A 1D9FA 4DR3F 2LLZA 4LF5J 3M8SA 3TAEA 3ZT4A 3AO1A 2MSSA 3QEIA 2AKWB 2DBBA 3VGMA 2FBVA 5F1XA 1H3DA 2OPQA 1S48A 4PKDB 4GVEA 4Q2LA 2DH7A 4IFEA 2XS7A 1VLOA 4X4TA 4AILC 4P72A 1SVDA 1Q16B 2BACA 3SCKE 3WNHA 1VCTA 2PA8D 1VJQA 2FZKB 3FBCA 5KT2A 3K58A 4JRPA 3LANA 1OO0B 2GO8A 1KRPA 2H51B 4KAZA 3OHAA 1NPRA 2P5GA 1U26A 2CPZA 3DI6A 3NHGA 4JI7F 4FXVA 4I6YA 1UWBB 4JV5J 1SJ4P 3CD6N 1LQ9A 3WXIA 2DNOA 1VSMA 3THTA 3MDFA 1ZPVA 4LF1A 1S6UA 3O5TB 1MMDA 4NEZA 2MZQA 4FPAA 3HF5A 5B8HA 2RU3A 4Y00A 4DTXA 2MY8A 1QY7A 3HHLC 4A8QA 1VISA 4R0JA 3KMSA 1IBMJ 3FSYA 4DR5F 3MM8B 4YQWA 1MROA 3VQ7A 1JCFA 5GAGU 2NYHA 4CIFA 2EEYA 2VJVA 3GIJA 2CGKA 1FKOB 3M5RA 1G4CA 1S6OA 3T1YK 1HJOA 1EX4A 2R8IA 1TUVA 4BREA 3LTOA 1VQ8N 1P27B 3BYRA 4CJKA 2HSTA 2DNQA 3RSEB 1RHMB 3V9UA 3ZNUA 4DV1F 4FWPA 3KHGA 3WEEA 1RBAA 1G2EA 2UXDK 1Y11A 4H4KA 4CD1A 3PTWA 2NRRA 4RW7B 4JKHA 4FWQA 1RXOB 4DG1A 4CJLA 4DUYJ 3H45C 3JSBA 3QDKA 3ZETB 4O55A 2V2VA 1RAHB 4UY85 1FKPB 4WWSA 1M1KO 4X66K 3RW6A 4LY7A 1U6BA 1FERA 3NVKA 1EQMA 4YFUA 3ENAA 4RUCA 1KC8O 2PA3A 4JYAK 3R1XA 4E98A 4DSKA 1V5VA 5HJYA 1FE0A 1RTDB 4NX9A 4I7FA 4N5SA 4QR0A 1YITS 4ECRA 1HMVB 2C2DA 4MYUA 1QQCA 1VSLA 5EUHA 5KFAA 1SJFA 4FPIA 1CZAN 4OI3A 3VQTA 2YKOA 3UE2A 3VCDA 3I56S 4O3RA 2QC3A 2WBNA 1WSFA 3PO5A 5AQMA 3QO9B 5AQTA 1N8RT 4M3TA 4R5PA 3FZKA 2Z4PA 3GFZA 3EY1A 3I0RB 4DL6A 2AYGA 1UPMB 4WJBA 1CEZA 1SKUB 1UEVA 5I9EB 3TP2A 4C0OC 3KLGA 1SC4B 1KDNA 1XEZA 4J90A 4OYMA 1VQPN 4KGZB 4UF4A 1FJCA 4Y2MA 2C2KB 2WSEC 3TA1A 3VENA 3H7HB 2G0IA 3A8EA 1F21A 2DGWA 3GL1A 3LA0A 3T5KA 5KGWA 3LZJA 4CZJA 4MK8A 4IOAL 4CM2A 1SC1B 3PJWA 1N33J 2CJKA 1KD1O 4FW2A 3ZLJA 4I2PB 2XZDB 4AYBD 2QT7A 1XMQK 4USTA 1T9XA 2MTLA 5AJ3K 3NGSA 1NNEA 4FL9A 4IZ9A 4HH1A 2UVVA 3Q23A 1TKTB 3H20A 4DF8A 1IG8A 2HMPA 3LP2B 4CH0S 4JYAF 4DOZA 1SQEA 3Q22A 5KG3A 2JDJA 1GT8A 3QFWA 2HBYB 4DFKA 3ILOA 4RBVA 1U8WA 2GQ2A 1YTUA 3L2VA 1RU1A 1WNSA 3H4DA 2GELA 2L41A 5GAEU 3O3FA 4QW8A 1DQ9A 3MTKA 4DR6F 4A46A 4AM7A 2CDRB 1Z4UA 1ASWA 1I94K 1TV6B 2GHVC 2E2NA 5EHHA 4IOXA 1APSA 3ZCMA 1FRHA 3I55S 4ZLJA 3V1OA 3M6VA 2FSKA 4DMNA 4CK1A 4OZ0A 2BEFA 2D0BA 4O8KA 3NOGA 4O0NA 4TKTA 3EMTA 1OH7A 2QGFB 2GJIA 1BA0A 4CIGA 3QGGA 3PIPL 2P9EA 2G9OA 3SJHA 3FCHA 4DR4K 5HBMA 4IG0B 3R7NB 1K47A 1XHXA 2R7OA 4WIIA 3I56N 4K5SA 4GNIA 4HTUA 5BXIA 2VPXB 2HHTA 4YHHK 1NK4A 3R5AA 3ZSYA 4LSZB 3A8JA 1TK0A 2FSNA 3JYTB 3EVWA 2J9EA 2DXEA 4EIAA 3VVTA 2CPYA 1N5YB 2ZM6F 3GG4A 3DLRA 4ED8A 1T6CA 5AQGA 3QGIA 4KV8B 5KFTA 3MCSA 3M9NB 5GADU 3HL8A 3IDHA 3MK6A 4W98A 4ANCA 2XLJA 4YDDB 3G9CA 1PC4A 4PYDA 3N0VA 4UUXA 3KKSA 1VHIA 2FGCA 4M5LA 2HAIA 2YXLA 5G4DA 3W5XA 2ZHOA 2IM0A 4BGBA 4ZP8A 2CA9A 2ILZA 2H5EA 2OHDA 3HJVA 4OV6A 2FDNA 3TEGA 3DLLQ 2O8DB 4FF2A 1XI1A 2MQOA 5D78A 1CC8A 2V7ZA 5HO4A 4JKBA 4CO3A 5HSPA 4AHUA 2UVWA 2B4JA 3ADAC 4F9OA 3V9WA 3HVAA 3CCVS 2QWMA 2M4MA 3I5AA 2P1JA 3VQ4A 2QIFA 3O9RA 3OFFA 2DYAA 2DJWA 4A8MP 3E51A 4YP3A 1U47A 2HZAA 1DQAA 2HURA 2LCWA 4JI8K 3L09A 4Z7CA 2I5JA 3GFXA 5B08A 3O08A 3QEXA 3OJUA 3IWNC 1JLAA 2L48A 4OPAA 2AJ2A 3IBWA 4ED7A 4BRIA 2YWFA 2QZ8A 1RYRA 4M3UA 4JK9A 2UU9K 4KSEB 4DX8H 5AFUA 5L1KA 2E5LJ 2V8HA 4EUVA 4FK0A 3QYYA 2HKEA 5C5JA 3M2RB 3CCTA 3NDKA 1ZZFA 1F9EB 2QLBB 2HHQA 4JK8A 3ZSQA 5KFOA 3I5BA 1RTHB 1AT1B 3TNVA 5IT0A 3UO0A 3DGPA 1PKUA 3O9UA 4LF8J 1W2BR 4GMKA 3OW2M 3PFOA 1H38A 4CGJA 4FLZA 3D0IE 1U2VB 5E7OB 3Q8RB 2BABA 2V2ZA 1F2HA 4CTAB 2M7SA 5KG2A 1JJ2M 4WQ5C 3MR5A 5HATA 1OSDA 1QVGR 4BG8A 3CD0A 2GX9A 3FEYB 2V51B 2E2QA 1VC6A 3ENBA 1FE4A 1PJ5A 3CD6S 2ASPA 4FW1A 2AGQA 5FLXO 2YCHA 3DLGB 1S1WB 4F0KA 4BR7A 2QA4N 5KFUA 2HWTA 4NLXA 2A0FB 2MKIA 1FVQA 5A76A 3M7VA 3ASMA 3QFHA 1VHFA 4ZP7A 2HBKA 4JI6K 3Q8YA 3PX6A 2JVRA 1E6YB 4OYPA 2GV9A 1SV5A 5LMNF 1HD1A 2ZOFA 3TI0A 3U8XA 1YX2A 2IBOA 3MMJA 4OZ3A 4DQ8A 5JMNA 4JI4F 2GMJA 3LW5C 2VUGA 5B0GA 5ETRA 3W9JA 1SAZA 3DLJA 2C2EA 3FE1A 4H4MB 4BR0A 4LF9F 1LWFA 1YJWS 3E9PA 4JKCA 4QS8A 3SV3A 1PBUA 1AB8A 2GEMA 4DV7K 1TTHB 2Q2RA 4BDYA 4X62J 3DLEB 4ZVGA 3U02A 3EE8A 3NAIA 1YHQS 1UVKA 2OPQB 1FXLA 3K89A 4PG6A 3UN2A 2PMHA 4F4ZA 2OLWA 4CJ7A 3M6XA 3H42A 5E5NA 4RW9A 4IO9Q 2PFUA 2KN4A 2ITGA 4J7CA 2RHKA 3H08A 3KTQA 2UUAJ 1OY9A 1LFWA 1BD6A 3UNGC 1IKVB 1NH7A 1LK5A 3DGPB 4RW8A 4C23A 4OPJA 3QMLA 1HLUA 2LEAA 3EXYA 2EKNA 4I1TA 3KYLA 3P39A 5KFYA 4JKGB 4A4JA 3PNIA 4OZ5A 4P7TA 2I7PA 3MMCB 5A6WA 3SIPB 2WSCC 1JXBA 2E5GA 1VQ8S 2VQEK 3H40A 2MSTA 1RHRB 4KI6A 3MN6A 4C11B 5M1PA 1VRUB 1FDAA 3MX2A 1LOUA 1Q4RA 3PO4A 2KJVA 2HG4A 3ZSRA 3PIPQ 2M8HA 1LWFB 1R0AA 3G6VA 3IWXA 3FVYA 2JHEA 2MJNA 2VD3A 2XB2D 1LWEB 1IWAA 2B7BB 2UXDJ 1VBXA 4M3ZA 3LF0A 3OUYB 2V8PA 3D2EB 4EHTA 4WZQA 1YWXA 4WQ5A 3SLCA 1YTAA 4L73A 4I7FB 4AT1B 1ACMB 4OZNA 2YX4A 5KFDA 1S1WA 1XBWA 1T05B 5E3CA 4B1VA 2AA4A 2M2BA 8ATCB 2FLOA 2FBTA 2M52A 2F4VF 1I1GA 5SZTA 2A18A 1NKCA 1VRUA 2V4JA 1VFJA 1U1OA 2BX6A 5KFNA 4ZJLA 4RW7A 1C4AA 1S12A 3NY0A 2E1RA 5T7LB 3AB2B 5M2PA 4USHA 1X9JA 4OHYA 4CZLA 2QYGA 4ED6A 2QLXA 3ZTRA 3FBEA 2J0XA 1RWPB 1BQXA 3UVJA 3LDQA 2UYTA 2WVCA 2A3ZA 3MPYA 2K1RA 5K8PA 1QQNA 3R6MA 4JI5F 5BRDA 4F4AA 2DCLA 1VQ4N 4H0XB 3AA9A 2QL9B 5C2CA 2CUYA 4DLGA 1RBLA 3L8BA 2VFVA 3DOLB 4H4OB 4ERDA 2Q43A 2WC9A 1RT4B 1TELA 2EG2A 2DFEA 5HRRA 3KLFA 2O8CB 4HTIA 3B4DA 2LQ9A 3QETA 3MOZA 1V6HA 1R8HA 5KFQA 4DN0A 1XNRK 4M95A 3OYFA 1CC7A 1Y5LB 2AYEA 2W7PA 1JLFA 5A2QY 2V4JB 1J6ZA 1WSJA 3SCXA 2E5JA 2QLJB 3OR2A 2CH6A 4CW7B 1BQNB 1W9HA 5GAEP 5F8IA 3CG7A 2Y8YA 4DV2K 4J37A 2E7VA 3G8TA 3OD2A 1JLFB 1KVCA 4NLSA 2HBZB 2DCUB 3CIPA 3PXGa 4HACA 3NF6A 4EFHA 3EPGA 3C16A 5GVQA 4EYIB 2EFNA 3FCVA 4DL3A 2JH3A 1UTAA 2F7VA 4O23A 1RDRA 2YKMB 5BJRA 3R27A 2D3OR 4F25A 4DU7A 2B9WA 4JI1F 1RISA 4CLUA 3QMQA 4CBWA 3R5GA 4DTRA 3M1VA 4OYIA 1WDTA 1VRTA 3A3PB 1TQLA 4LIWA 4MH8A 3BV8A 4GKKF 5GAHU 5L1IA 1M90T 4X84A 2XSJA 4ZPTR 4RW9B 2DY9A 2RHSB 2HHXA 3IG1B 3R3LA 1YZ6A 3LP1B 4OFZA 2G2OA 3C15B 4ZJQA 3SFUA 4IO9L 4CLYA 1JK9B 3PW7A 4DU4A 1OH8A 1S1XA 4B9LA 4FBTA 4DQQA 2CPDA 4BS2A 2V2KA 5KGXA 1TR0A 3CI5A 3QT8A 4IQMA 3OVNA 4BHQA 3TJ9A 4MK9A 2JWNA 5J2MA 5AQQA 3PX4A 3OSNA 2MQMA 5AR0A 3MXIA 3NGYA 4JUZA 4O4RA 2H3GX 1HQEB 4MKVA 1UEKA 3ENWA 2LQBA 1RTIA 2LDYA 4CZCA 1NDKA 2JOQA 5FPNA 1H7WA 1C1CB 5AQJA 3ENVA 2HGMA 5BR8F 4K8RA 3FSIA 3V81B 3R1HA 2OTLN 1L5UA 4JI0F 3I33A 3P5TL 4JOUA 3CCZA 3CJKA 4DV0J 3FC9A 1E6YA 2OIHA 3CJ9A 3M8PA 2A6MA 1QLNA 4IKAA 1BXNA 3BZCA 3HI0A 2FF3B 3I5CA 3C15A 2CKWA 1HW9A 2D41A 2C3UA 4UZCA 3NCQA 1DURA 4RW4B 3UIQA 3KVGA 5AZJB 4FJNA 4DI6A 2HPUA 4K0KF 4N8OA 2CJQA 2P9GA 2VOOA 3WXJA 3DN9A 2HNZB 2HIQA 1V5IB 3R97A 2RS8A 3P49B 3D67A 4N76A 4X66J 3THXB 2G1HA 2RDJA 4CI6A 1WC0A 3TQEA 3S1TA 3GLJA 3SDEA 2K1RB 1IJJA 5ETSA 3TR8A 2LFVA 3J80U 4E19A 3THXA 4CZKA 2EW9A 5HVFA 4CJQA 2ZJPQ 4WF9L 2DVIA 1SH2A 3PACA 2B6AB 1F5BA 4RWTA 4FP9A 3UN3A 3CCQS 3OW2R 4LC9B 5A2QU 4XH1A 3DFEA 1WUUA 2Q1NA 1VQMN 2UXBF 1WKJA 4M5DB 1TUYA 4PA1A 3BBCA 5BREA 4AHCA 9RUBA 1FNMA 2DEJA 1OMSA 4BRDA 4V1Ak 1X3MA 1NPKA 1CXQA 1TK8A 3CMAN 2O66A 1YF5L 4YB7A 1P9YA 3QB0A 3QO9A 5L9NA 2Z1HA 2MKCA 2RH3A 1D9AA 4QBUA 2VGMA 4G1QB 4DN9A 3OYDA 1KLMB 2N7YA 3KLIB 5CCMA 3D7EO 1RWWB 3CPEA 3RR8A 2HQIA 2RJZA 4ZPCA 3NEKA 1T03A 4MO4A 4EBDA 1QUPA 3MM7B 2ILYA 2POKA 4C3MA 3NGIA 2N3OA 1H73A 1RT3A 1GXLA 4MMOA 3S01A 4EEYA 1S3XA 1ZBSA 4MJKA 1VMBA 4W5NA 1RTIB 2Y1IA 2VYPA 1MG7A 3MCNA 1M1HA 2IDOA 4HKQA 3VQ5A 1CULB 4PL7A 3C6TB 3BGFA 4FJGA 4Q45A 3M1FA 2BYCA 2XGPA 5ETOA 3HHDA 3UDCA 3U6FA 5BN9A 5DMRA 3OL9A 4OI4A 4YOEA 3S3NA 2P5OA 4M5HA 2XULA 2X6SA 4O5FA 3CB4A 2L08A 2AEFA 3IS9A 1JIHA 2ZOMA 4CZFA 1WEZA 3LOUA 2V63A 4HHUA 3AH6A 4DLEA 3SNNA 1VBZA 1HNWF 3GIMA 2B43A 3NCPA 3Q8VA 5HMXA 3AAPA 3WQPA 4OJHA 3G87A 1RAIB 2HVEA 3HHLA 1FWKA 3BQ0A 4E7LA 2HQCA 4M7XA 1HQUA 2XY8A 2B5JA 4R25A 5M1NA 3RVCA 5DQHA 3C46A 3UNYA 4C2MA 4DQRA 1Z26A 3MZIA 2FZGB 3OT9A 3DLBA 1P6TA 2LA6A 1YAGA 4AHTA 4KHPK 5KFZA 1MN7A 2Z2ZA 4AUKA 1FRIA 1H7XA 4PL8A 1UL3A 1NSAA 4PQAA 2PYLA 2K3IA 2XS2A 1Y97A 3M8ZA 1CXUA 2QV6A 4C8LA 3DOMB 3ENHA 4I56A 4XIUA 2DHHA 4C98A 4KREA 2AHOB 1SBRA 1V4SA 4LF6F 3BGUA 4CQ1A 2GWJA 4USJC 2RQMA 2F5GA 2H54B 1EXQA 4LSNB 4MDAA 2OFGX 3ZETA 1MWMA 4KHUA 2VQEJ 1RQ0A 1RDCA 1F5CA 3AJDA 3J81O 3RYLA 5AQSA 2CQDA 4BWJA 4CYUA 1S72N 5D4NA 4FKYA 5CA5A 3RW7A 5A8KA 1WAFA 2E1YA 1ELOA 5KFIA 2HGNA 1VJWA 3CSKA 4LFCF 2LU2A 1L3UA 3PW0A 3C95A 2NLWA 1RHUB 4OX9K 4G1PA 4FSVA 5EX5A 4BRFA 3H2LA 1T9UA 4I69A 3CJ3A 1U8SA 3MPWA 5D3GB 3HULA 3M8QA 2WZ1A 2KI2A 2H5JB 1CULA 3MR7A 4C1NK 1ITPA 3CJCA 3PZPA 5AQVA 5IC6B 4HDGA 1RWXB 2GIQA 1EIYB 2FBYA 4ZIWA 2J6SA 4MT1A 1M90O 4NL5A 1FWPA 2AQ4A 4ZCIA 2JEIA 1VI7A 3MEGA 1Q0NA 4E1JA 3UDLA 3SYZA 2KVQE 2IOCA 1ZBUA 4DPTA 2I38A 3MAHA 4F2SA 4OHXA 3QNOA 3QAEA 2G8UA 1KN6A 2NRXA 3OHBA 3MM8A 4JI3F 2LU1A 1ITGA 1JLBB 3VEWA 2NRZA 3CXCM 1Y4ZB 3EO3A 4AL7A 2DXDA 3W5YA 1JKHB 2J6UA 1OYDA 1HNWJ 5AQWA 4C97A 4YMEA 1CG2A 4JHDA 2OP5A 4F3QA 4NZ6A 2ZC3A 2ZF5O 3ULDA 1DGKN 2MZ1A 2Y1RI 4DV3K 1NDCA 5AE1A 3WX4A 2BH1A 3GB0A 3RRHA 2UU9J 2XO6A 4FLYA 3F73A 2AEJA 3OSPA 2E5LK 4ED4A 3DI6B 2AYBA 4QJVA 4FXDA 2FPHX 4OJ3A 5A0YB 4XEIA 3H6EA 3O2IA 2E44A 3AA3A 3DMJA 4DR1K 4LRCA 4RWXA 3PUFA 2X51A 3QT6A 2X78A 4H5RA 1KR4A 2R2TA 2M9KA 2MQLA 3O3LA 4DV4F 1RTJB 2KHDA 2VBZA 2W4DA 4IOAQ 4NMXA 4FBUA 2R8GA 2F65A 2UXDF 4QS7A 1HFEL 3THVA 4KB1A 5AQPA 4IG3A 4DX7A 2O5DA 2EG1A 2ZEJA 4JV5K 2MKSA 4DR2K 1N36F 4IH6A 3MF5A 4EGLA 1DTQB 3K5MA 3KMQA 2W2MP 3IG1A 1JJHA 2N4DA 5AQNA 3KK2B 1R0BG 3EZOA 2ABYA 3IUCA 4XH5A 1RUSA 4L3NA 4ZA1A 2UUWA 3C65A 5EU7A 2RE2A 2OPPA 1HBOB 3HSTB 2BOAA 3QIDA 4R8UA 3GE9A 2Q97A 3VQAA 4F4XA 4H5NA 1XERA 3VAJA 3JSYA 4OX6A 3AV9A 1NJIT 3LGNA 5JLFA 4OI0A 1K44A 4ES1A 1WOQA 3H5YA 5T7BA 4BVOA 1D09B 4JB8B 3WQTA 3OYNA 1T03B 5HRNA 2VWBA 4LRBA 4DR5K 4PEOA 1TKDA 3ZC4A 4FWMA 5E41A 3GIKA 1H1VA 2IA0A 1U2FA 4Y3CA 3H1QA 4ZTJA 4CO2A 2XI2A 1BWFO 1SI9A 3W1YC 4OMFG 1J53A 5DK5A 3RB6A 4P75A 2IVYA 3AVJA 1RSCA 2IVPA 4CVNE 4YY3F 3VMFB 3BF3A 4LQ9A 3CCLS 1NB2A 2J8SA 3N5FA 3QIPA 2KU7A 2QLWA 4DV5J 1RHQB 5KFSA 4DCPB 2VGNA 3KLHB 3EZWA 3WEEB 4N41A 3IO1A 1I5OB 1U0HB 2G2ZA 3LPTA 4O4GB 2Z8QA 1VAZA 3CM5A 4CJFA 5KFKA 4PPZA 1NAQA 3OV7A 5HQ8A 5DGAA 2IJFA 5D4PA 1KVIA 4K59A 4NLRA 3DDNA 1OH5A 4WP8A 1WAJA 4ILGB 4Y28C 4WE1A 3TTFA 3N79A 5FRMA 5ETTA 4ZVUB 1IKXB 1XR7A 1WC3A 1N5YA 3AVLA 2F8MA 4ZVOB 3GQCA 1XC3A 2E66A 2GNKA 3RMAA 2JWKA 1SQGA 2GMHA 3AVIA 3QATA 1Q7YO 3QBXA 4Z4HA 3KG4A 3QGHA 1YIJS 2I5JB 2VG6B 4EZ9A 2V69A 4QWAA 5EWGA 5HAOA 3J7YI 1JL2A 1NJZA 4Y6IA 3OS2A 1RAEB 3EEQA 4ZTFA 4QS9A 4NLTA 4NLWA 2YH0A 4IO8A 1DRZA 1KVJA 3LGHA 3HSZA 2HW3A 1NEEA 4DSIA 2RT3A 1Q7YT 3JSRA 2YHWA 2LQ8A 1K73T 3LDSA 2O8EB 3CYMA 2NS1B 5AJ3J 4NRUA 4YDUC 2P9IB 4B9NA 4DR7J 1MSWD 1FEHA 4AHSA 1FDNA 4WFAQ 4G6VB 3SMZA 1T8EA 3GP9A 3FEZA 3AGKA 1VQMS 1EQYA 1RBVA 5A2QO 3SPZA 3VF6A 1Q1KA 3OQ2A 4ISGA 5JS1A 2NRVA 2ROGA 3AXKA 4USMA 4FO0A 1S22A 3M8QB 2QK9A 2BA9A 4ZMMA 1IQZA 4C8ZA 2Z1IA 3EICA 4PXEA 3O3HA 2UXBJ 1EHWA 2QO3A 1U2VA 2E1CA 2ZDPA 4A57A 4DG1B 3KG0A 4JI0K 3SAFA 1IBKJ 3D0PA 4ZHRB 9ATCB 4FJJA 4ZN1A 4QZVB 5D6GA 3GFYA 3HYFA 3O1WA 4IYQA 5D0HA 2VFTA 2QE5A 3KXDA 3VV2B 1LWCB 4FJKA 4ZS6A 2Q3SA 2KVIA 5AXLA 2XHBA 2LP4A 4H4MA 1WTBA 3HPOA 2BE2A 4FVMA 4P74A 3QBCA 3ZZ0A 1FRKA 1G7CB 1VBKA 1VDHA 4OO1J 2G0CA 3FSXA 4LH5A 2IYIA 3QESA 1EP4A 2PIIA 1B4SA 8AT1B 1WSEA 1DT9A 2HQFA 5IOLA 3M9MB 2O3DA 1LKZA 2ZVSA 2ACYA 4FNIA 1ZC6A 1J5EK 3D54A 1AFIA 2AEMA 2O8EA 1IUJA 2MKKA 3BBBA 1DTTA 3RAQA 4WIQA 3HHLD 1KLMA 2IVOA 4D3HA 3R9LA 3VQCA 5CYQB 3SPYA 2NXNA 4MFBA 3AA4A 1YJVA 2D0CA 2QFJA 1ZM2A 4FM0A 1JL1A 2Q0UA 2HMIA 4F3TA 4BE2A 4TY8B 3DDKA 3VOVA 1VQKN 4B3RJ 4DR4J 1OQ3A 3FBFA 4W5QA 2O4IA 4ITSA 3CC2S 4LBPA 3EPIA 4AL6A 5LMUK 4PWDB 1KQFB 1UZHA 3OYIA 3A2FA 2UUCK 3J7AP 1MWYA 2FUG9 3R5DA 1NJXA 4DUYK 2Z2LA 1M0SA 2RIJA 4UOCA 3V6DA 2CPJA 4QIWD 1Z25A 2CJAA 1Q8IA 3A5OC 1K73O 2KJWA 2JSXA 3IS9B 1C0GA 2ZM6K 4Q43A 4QU6A 4GC6A 4PWUA 3ALYA 2DGTA 3M2RA 1PGZA 3D0GE 4F7VA 2YV0X 5DM6Q 4ZLPA 2XLIA 1GLLO 4ED3A 2HNDB 2VV5A 1WC1A 2MMYA 3H5SA 4GV6A 4DR1F 3OTOK 5LM7E 2XMJA 1M5VC 4CLKA 4FF1A 2GV1A 1NK8A 2C2ZB 2NZ4A 1UVNA 1M5PC 4PWDA 2CNNB 2B8PA 2ZHAA 4B3MK 5L8RC 5H9EJ 2YKMA 3T6JA 2OTJN 4Y1DA 4KHPJ 5E0OA 4JI8F 2IFXA 1QTMA 2R7VA 3VGUA 2YY3A 4U67Q 3TANA 4MLEA 3SCIE 3J81j 1SS6A 4LREA 4FJ5A 1N36K 4YY3J 3L3CA 4B3SJ 4A48A 4KHMA 4FPBA 4JNEA 4WFNL 3DJCA 3PM9A 3ISZA 4C9DA 4ZITA 1WB9A 4WPAA 3DLGA 3DOKB 2HVZA 3W62A 5FPMA 2KL8A 3BZKA 4CJWA 2HQDA 4IUFA 4DQSA 4Z94A 5BRHA 1H2UX 2XMAA 1TFWA 1JLBA 2PC6A 4LF9J 1TL3A 1RWOB 2BW7A 4P52A 1NMEB 3A4TA 2IYGA 2NPIA 2CVIA 4WP3A 3P31A 3ZT3A 4J9NA 2AGOA 4A5AA 3KUHA 1IR1A 4TN2A 1RBOB 2QSWA 4UY8O 4M1KA 4F04B 4C0HA 4ISEA 2GIRA 4CHOA 5HRPA 1IKWA 4ZPDA 5IXUA 2MHNA 2HFOA 2HQGA 2AJ4A 3WIVA 2YWKA 2HS0A 5M1OA 1VQ9S 3Q7CA 1JLQB 2MZTA 4U7UD 4J9VA 2CVEA 4NCBA 5K9FA 4TYAA 5DZ7A 4F26A 4LD0A 4IDHA 3AVKA 2W42A 2BM0A 4WK3A 4IG0A 3CXCR 1NMNA 2KLAA 1RWNB 4CM0A 2YNIB 1BISA 4USVA 1PCAA 1EJ7L 1BMQB 2E6LA 1UAXA 1X4EA 1REVB 3K2YA 4PG4A 4BC9A 3RB3A 3C66A 2W8LA 5AQYA 5HOOA 5J2QB 3UW1A 5JICA 7AT1B 1MNEA 4J9UE 1JJ4A 3W8PA 3ID8A 3LPUA 4B3MF 1WC6A 1HR0J 4KKOA 4LR7A 2B4PA 1SIWB 2BE9B 3V81A 1ZBHA 1HWKA 1RT5A 1TKZB 3OTOJ 2PT0A 2DNZA 4M41A 5AQLA 4ZVPB 1SKSA 3PEJA 5D8HB 5IWAF 2HK3A 1HJRA 3BJYA 3KUEA 2MHEA 4JLHA 4U7BA 4KO0A 3NBPA 3D3CJ 4LSLA 3ICLA 2DNHA 1TZ0A 2Z58B 1WHWA 1TKXA 2LEBA 4JI2J 2H9ZA 2DNRA 3TO8A 3R6LB 4MIWA 3PR5B 2GA7A 3QLHA 2YJFA 1REVA 5H9FJ 4UTGA 3UPFA 4IDKB 2ZUAA 3H3OB 5C25A 4ZDNA 3H5UA 3W65A 4OI1A 2JRSA 3AA5X 4IR1A 3WBZA 3HFKA 1K9MO 2QA4S 4CO4A 5IWAJ 2YX6A 4NXMK 2AV5A 4O4GA 3GYNA 5KT3A 5LMNK 2DGXA 2ASMA 5BYSA 2J6TA 1C0MA 2P9PA 4OIXA 3FFIB 3E01B 3JQMA 4F02A 2HHHK 4I68A 3F2KA 4CEFA 3PYGA 1OH6A 1FFWB 1KAYA 2H5IB 1H98A 5KG0A 3QRQA 3G6EN 3DCAA 1S59A 1NU0A 2F9WA 1UW4A 3L6QA 1IG9A 2KDOA 3Q8SB 3DC2A 2OMOA 3I9V9 3EJMA 3P83D 2G4BA 3CJ5A 4BR5A 4KPCA 3IFEA 4C3LA 1W2BM 1ZBLA 3HSDA 4DPUA 4Q8FA 3PG9A 3UKUA 4N77A 3G8SA 2PMZD 4LT6A 2ZH6A 1I51B 2YKNB 3QFPA 1HYZA 4IRCA 4PQUB 1GFWB 4JI7K 2CNOB 2CQ4A 2BRLA 1Y5IB 1RWUA 4NYOA 2IRUA 1AUSL 3KG1A 1T95A 3P4UB 2Q79A 1FK9A 2UXCF 4IOCL 4I6AA 4CEDA 3R2DJ 1TAUA 4PG8A 1SJ3P 1KTVA 3ZEUB 1RLDA 2W9AA 1VQON 3O9QA 4X64F 2X7IA 2KFZA 2R7QA 4YR0A 1ZXOA 3HHEA 1VBYA 4YOYA 4ZJOA 2PI5A 2HSEB 5DGBA 2XBPA 5GADP 4CHQA 2ZZTA 2HNZA 5LY3A 1ZPWX 4L76A 4Y34A 3OYGA 4TNOA 4ECQA 5FPEA 2XTJP 1HHTP 2MJUA 1N6QA 4CBUA 1GLEG 3KWIA 1W26A 3CJRA 4NO7A 3AXMA 2KG1A 1G99A 3HHNB 4U67L 3L3UA 2G13A 4GVLA 2IAJA 4PPDA 2QRRA 3H8YA 5EX0A 4CGDA 2CGJA 5L46A 2HWHA 1E6VA 2RSQA 4USKA 2RKIB 2G8FA 1R8BA 2N82B 2VASA 3BEXA 3JXUA 4OX9J 5BPNA 3PX0A 2N3LA 4E2FB 1KOOA 2DTUA 4GKKJ 1XR5A 4DDFA 2LECA 4CO1A 4DKWA 1HBNB 3RR7A 1VQYA 2QI2A 1WG5A 1X4FA 4YORA 1YZ7A 1JNZB 1VQ5S 3DOMA 2YWHA 1KWMA 3V5RA 4FVUA 1CBKA 1Q8KA 1HI1A 1T3NA 4LH4A 2AYMA 3N6LA 3THYB 4B9MA 1VIXA 5LOQA 5IT9U 4FOEA 3ZT1A 4LF7J 2PEBA 2XZTB 3N6NA 1A6LA 3SK3A 1J9AA 1P9QC 1BCMA 4HT5A 4NLVA 2ALYB 2QWNA 1RWMB 4ZP9A 1E4FT 2B9EA 5JXSA 4L75A 4MKAA 4M3XA 5KFPA 1IO2A 1HI0P 1K0TA 1M5SA 2OPSA 3G96A 3OYBA 5B0BA 2RRNA 3LP1A 3RMBA 5K5MA 2YPZA 4KT0C 1U4BA 2IIHA 1RJJA 2ZITA 4X4QA 4X64J 4TQRA 2KXNB 3WXMB 3ZXWA 4RR5A 2DHSA 3C0BA 2JEFA 2WSFC 2OD6A 4KHWA 5C25B 5KTQA 2DR5A 1NHVA 3MWBA 1SB6A 2CPIA 4JKGA 5HROB 3EDRB 4M42A 4ER8A 1NMDA 2NLXA 3P1GA 3BF1A 1X5TA 1IBLJ 4J9PA 5TKYA 2ZGYA 4CJ3A 2G8IA 2OA8A 3US5A 3UKRA 3O80A 3DRPA 2L9WA 1WKLA 4ZPBA 4CH7A 4EU0A 4O3SA 5EWEA 4M94A 1AFJA 2E7XA 3K59A 3LWLA 1ICEB 5E3RA 2AJFE 2Z2YB 4KJIA 5CYJA 2RDIA 3HVTA 4RL1A 4H5VA 3I0SA 1R8CA 1C2PA 4E89A 1OKJA 2Q1LA 4WFAL 2J9CA 2CQ3A 2HOEA 4PKGA 1HLWA 3CVKA 5AQKA 2A5XA 4QQBA 3C6UA 4BRCA 4CEQA 5KOWA 1DY3A 1S1TA 5BR8J 2YTCA 5F8LA 4CLZA 3BN7A 4HYKA 1N32K 5E26A 3ULEB 3CDEA 2DNYA 1K1QA 3J80O 3O1LA 1WUAA 3HO1A 1SPBP 4E3SA 2H65B 3L4QA 1RE1B 2RAQA 3CJ1A 2X74A 1NJWA 2LXIA 2R3VA 4Q8EA 1YJWN 3ELHA 4BVPA 4NLOA 1S72S 2Y3YA 2UVUA 1NSQA 4GVMA 3RB4A 3MGJA 4ISFA 4I4BA 5B0AA 3QIOA 2IIRA 4PR6A 5DRKA 1U2RA 2CJBA 3NNHA 1DEJA 3J7YP 3UR0A 1K8KA 3OTEA 3Q8UA 2FJBB 2RPIA 3CC4N 4OGEA 1HNIA 4CEZA 2GWKA 2ZJPL 1C0TA 2IMWP 4FXWA 5DZ6A 3HVRA 4CFBA 2RU9A 2NREA 4DR6K 5DG7A 3KJVB 1HNXF 3BY5A 2GC8A 3MM7A 1ESVA 5CY4A 2YX1A 4C48A 1H72C 3MWPA 4M45A 3CJSA 1RACB 1FFSB 1J54A 4K2JA 3THWA 2HBRB 3BEGB 1GMUA 1JLEA 4CT9A 5KT5A 3SUNA 2DEIA 1X5SA 4RTFD 3QERA 1UFLA 2BJDA 2C3MA 2OKQA 3FZLA 4ALZA 3GCWP 3T7ZA 4DWIA 1X5PA 2YVSA 5LJ3Y 1M5KC 2R7TA 1U1PA 4AXIA 1C1BB 4HEA9 2XGQA 2WW4A 1N52B 4MDBA 3IAYA 2Z56B 5FIIA 3HP9A 3JAMO 3G4SS 2AJ1A 4CFCA 2FQQB 5I3UB 3A1YG 3ZTSA 3CD7A 2Z1JA 4BBYA 3GZ7A 3LP3A 3SBTA 2VPWB 5LJVA 4URGA 3VAGA 2LXUA 3MI7X 4HTLA 3U9DA 1RDUA 4JBCA 4C8MA 1RA7A 2YH1A 1U25A 2LA4A 2FVSA 3ZZZA 3MEEA 3CCWA 1IKWB 3KUGA 3AVAA 4J9QA 1UFKA 1O1WA 2ROPA 4DV7J 1F60B 3A3NB 4Y0WA 3SMPA 3MCAB 4CJPA 3ZSOA 1T05A 1RT1B 4EAHD 2DIUA 2WOMB 1CVJA 4B9QA 1WHVA 2W9BB 4LF9K 1A7GE 3CJBA 2DR9A 4LR9A 3PHEA 1XNQJ 4FF4A 4K50A 2EFVA 1NO8A 3DU6A 3BGLA 1QM9A 3RB0A 1NM1A 3VEXA 1CJTB 4LSNA 4IKFA 1H74A 3EX7B 3G2XA 5CQGA 2WB4A 3FMWA 3AVNA 3HP6A 1S57A 2XSFA 4WFXA 3B8AX 2FJDB 2R7XA 4FN5A 3J80Y 2HLUA 4USUA 1YVUA 5BR9A 3A8IA 1R0CB 4Z4EA 3UDEA 4CZGA 4X65K 4XK8C 2DGUA 4QIGA 4HACB 5D77A 3UD4P 2FVPA 1A5WA 4IEEA 5I4MA 3IGVA 2VDHA 2QA4G 3TUPA 2HVIA 4WP9A 5HMZA 4LJMA 4B08A 4RNFA 1YQHA 3TAPA 2HBJA 3THWB 3OXFA 4QIEA 4JHDB 4G1IA 2FZCB 2AT1B 2BBEA 5TKWA 3OR1B 2EKYA 1AROP 1HI8A 4ELTA 1WOOA 3JAMU 5CZXA 5HMWA 4DU3A 3GONA 2E5LF 1BHLA 3GCXP 5AXNA 4I9LA 4NYPA 3AFGA 3TUJC 2J4RA 2X3DA 1H0HB 1U45A 2XYPB 4JI6F 1XQIA 2E29A 3TABA 1KAXA 3O9SA 5C2FA 4B1ZA 3JSMA 1S6PA 4ETXA 1PAEX 1HBOA 3SAGA 1HNZF 1BE4A 4CHYA 3TQ1A 4IWVA 3UVJB 2K7JA 3EKSA 1PYOB 3I6PA 4B8AB 1N32F 4L8RB 3JYTA 3AVHA 4O3NA 1X4CA 2M0GB 3O44A 1L3KA 1JLCA 3T3FA 3A8YA 3LO3A 3E1YA 2X6NA 4NEYA 3W2VB 5LMUJ 1RT6B 3RAMA 3W7BA 4IDKA 2JVOA 4LVOP 2PY5A 2M5YA 1RDAA 1YSJA 5KFWA 4N7TA 2X1BA 1FKOA 5KT4A 3CJKB 3SCJE 3MX5A 3AB4B 4DR3J 3FRZA 1NHKL 1NGBA 2OYQA 3M2UA 2UUCF 3I0RA 1FJGF 2QA2A 5EVZA 4CD3A 3AO2A 4J9RA 3AARA 3SQ4A 2B51A 3BH6B 2ZM6J 2W2QP 1QE1A 3VTHA 2GX8A 2DGVA 1LXJA 3P5BP 4YUDA 4B9TA 4FJMA 3BQ1A 4K25A 3OUYA 4K8ZA 4IFYB 5D4LA 5LSRA 4HI1A 3M4XA 4P71A 5BPLA 4CLLA 2BUPA 2NZTA 4MFBB 2DO4A 3UWTA 1S77D 2QKKA 1K9MT 4MO5A 4PQUA 4M5JA 3NLCA 1TUGB 3JS6A 1Q8BA 2YX7A 5ETVA 1R59O 1JJCB 1XR6A 1B0VA 2QLFB 3V1QA 2CPHA 2OTLS 3CDAA 3CT9A 3OLBA 2RQCA 1BWVA 1XWLA 3THPA 3R6GB 1QQOA 1S7HA 2GO9A 3SI8A 5D3GA 4DV0F 3K9KA 3MFHA 5JUMA 1X4DA 5GINA 4M63C 4FK4A 2HRUA 1RDDA 1ILYA 3FK4A 1B3TA 5C15A 2VZ9A 1R6YA 5E33A 4RNNA 3AVFA 3AT1B 3GV5B 4FWNA 4FZVA 4FS2A 1NGCA 1ZBFA 4P2XA 2XC9A 2HBQB 3U3GA 4ECVA 2OSQA 3FLCO 2A41A 1WI8A 4JI0J 3L2UA 1IBKK 2PYJA 4WTOB 2JEJA 1NGHA 3BH7B 2J9DA 3KKFA 3L2WA 2HF4A 3TAMA 1ZA1B 2V5HG 3QICA 2BJEA 3GSDA 1NK9A 3KLEB 4YR2A 2O8BA 1TVRB 4BWMA 1EETA 3TSUA 4PCQA 4ECXA 1UJ5A 4ZPVR 2HHSA 5G0RA 1T7PA 1SXLA 1RTZA 3A8KA 4B3TK 3V9XA 5IS2A 1S6QB 4B3TF 2NXJA 2YPYA 2DO0A 4WK1A 1CQNA 3OFEA 3QEVA 3EZUA 3T1HK 1NGFA 5CYQA 4Y2CA 2AP6A 1BOTO 2DR6A 5A0YA 1C4CA 4JI3K 4YEAA 2NUHA 4OJ1A 4BY9C 2O01C 3K0SA 3IRXB 2K3KA 3TUIC 4A8SA 2FVCA 3S7RA 5I42A 5EOYA 4FWKA 1C1CA 4HHHA 3U9ZA 3G71N 5C2GA 3J81U 5IV4A 1T02A 2DISA 4QIFA 2AGPA 2E2PA 2CJYB 2FBXA 4K8XA 3HBTA 5KFMA 3H59A 4X64K 2F9JA 2I0XA 1JXEA 1OPZA 2KFNA 1XMQJ 4QWBA 1J5EF 4DU8A 3C19A 1QJHA 1YJ9S 3IMQJ 5JLHA 3FEXB 2P9KA 4B3OA 3SFGA 4DV0K 4I6WA 4HCBA 2YHAA 5C10A 4LF8K 4DB3A 3C6HA 1RT1A 4EWTA 2MY7A 4Q5VA 2HS4A 4WFYA 3HRGA 4ETZA 4KI4A 3CCSN 3MR3A 1SH0A 3QEWA 3O4NA 3IA0A 2QWPA 2DR7A 2GS8A 2VG5B 1K8AT 1LNQA 2FHKA 1FX2A 3CTRA 3A12A 3MM9A 4NI2B 4ECZA 1NOZA 2BJ8A 3GR0A 1Q82O 2X1FA 4DUTA 2D3O1 1RAFB 2NRWA 1NGEA 2Y0SD 2ASDA 3PY8A 3C16B 3RWUA 1P8GA 2ZH4A 3CFRA 3OYAA 3HLUA 5CYMB 2YNHB 1QZ6A 1XNQK 1RT7B 3NF9A 2P6TA 3KDOA 1PSDA 1KQGB 3QSYB 5T41A 5ETKA 2W25A 2D9OA 3CCMN 3W64A 5B0CA 1UWBA 3OFGA 1YDLA 2OJ3A 1FD2A 1X31C 1R6VA 3EL2A 1HNZJ 4CF1A 4WFNQ 4G1QA 2G0JA 2EFGA 2VKRA 3FDSA 4HHTA 2YQ0A 2ALZA 2ZJRQ 1BG3A 3MPVA 2LVWA 2ZH9A 4F8RA 2YWGA 2ZWOA 1H6KX 3GTYX 1HNVA 4B1UB 2MZRA 4DX5A 2DR8A 4QPXA 1FJ7A 5C0YA 1QVFR 1CJVA 3QWUA 4PRFA 3RMDA 1MMNA 1KTQA 1D8YA 2KHCA 1IKVA 5LT5A 3NOCA 3SQ2A 1G3OA 1SC6A 3ZT0A 3UD3P 3VN5A 1KONA 3HZGA 3NMAA 3LPEA 2CIMA 1YJUA 5KFBA 3PEHA 4IXCA 3CCJN 1HARA 3I55N 3VQ9A 3T1YF 5E84A 4TQSA 2ZWHA 1MROB 3JAMY 1WJ9A 1YI2N 2ZBIA 4PYAA 3MPUB 3Q86A 4WYBA 3S9HA 1NZ8A 3CC7N 4JKAA 2GW8A 3BB5A 2ZH5A 2Y8WA 1LFPA 4UQTA 1QHTA 1TL3B 1ATNA 2DHGA 1FKAF 4K4VA 3D1OA 2G1DA 2PMWA 2JJ4D 2XMTA 4KHSA 3WXKA 3VF2A 2X1AA 5EXWA 2D0PA 3CM6A 5E3QA 2PEHA 2UXBK 1IN0A 2UV8G 3ITHA 3O8WA 3A0IX 4LF5K 1XUPO 5C2DA 5DDOC 2R4FA 2C28A 1SV5B 5C24B 5KG7A 2GAHC 3SSSA 2RRBA 4YDUA 2LEPA 3HK2A 2VQEF 3EE9A 2DNGA 3I96A 2BOPA 3CCRS 3UQSA 1KVAA 2VOPA 1SUQA 4I2QB 3GJTB 3BKUA 2Q3PA 2JLFA 3CCUN 3AHPA 4CI0B 4KBIA 5FLXU 4QOTA 3LP0A 4LVNP 4YS2A 1BI4A 2ZH3A 4RNHA 4UY8T 4YOVA 1CLQA 3MR6A 3M32B 3V6HA 3ZSVA 1N56A 4BDZA 4JI1K 3FGUA 3AO3A 1QHAA 4KFBA 1ZAXA 4BQLA 2HGLA 2WAQD 1Y3JA 2XCAA 4FDFA 2RKIA 4LBIA 3CC7S 1DTQA 4ATNA 2Z57B 3CCMS 1M5HA 3RBDA 3DXSX 3CWJA 4X65J 3Q83A 3NRBA 3CJ2A 1D9DA 1KFDA 4KB7A 1RYSA 3MWTA 3MCMA 3QINA 1TP7A 3OL8A 3JB9k 4RWWA 4YN3B 1HWJA 1YRTA 3H98A 4FVCA 4A8FA 1UETA 5ETNA 4CNZA 3M2VB 1RZMA 4ECSA 1PBAA 3KZBA 2C2OB 2GGPB 4ZVQB 2LYVA 2L9DA 2CH5A 2IDEA 4LF8F 4K2XA 4CFAA 1HIYA 2CNKB 3PVXA 2VL1A 1JQGA 4GKJK 4WXOA 4KR0B 3OVSA 2DH8A 1IH7A 1RT3B 1VQNN 3IR7B 3KLVA 3ZFVA 2U1AA 3BPDA 3OYKA 3HT0A 3SQ0A 1U0SA 3EGZA 3QWPA 1URNA 2UP1A 2FHJA 3CULA 4RKUC 1Q81T 1TV6A 2F8TA 5CZ2A 4ZKAA 2V9KA 2ZOGA 1RT7A 1FX4A 5JVGQ 2GAGC 3MHYA 1Q81O 2ZD1A 2HFNA 3PW4A 2B6AA 4DEZA 2I7NA 5J2QA 4CERA 4KH5A 5LSLA 4KYZA 2IC3B 4M5GA 1MLAA 2A3JA 4M5DA 4EMDA 2RUSA 1VK8A 4CGGA 5KFLA 1S0OA 3J7ZT 3ETOA 4LFBF 2VB6A 5HQMA 3H1VX 1ZS6A 3J7Z5 4OYXA 3BZQA 2NSCA 4UOGA 2YKQA 3TWHA 2NQPA 1Q86O 5H9EK 4ZVTB 4YOTA 4PG7A 5HLFA 2FIUA 3BYPA 4DX6A 2IAJB 4U7UK 1RWVB 4BCAA 4YOUA 4KGKA 4WE1B 3L4IA 2CWXA 3OVBA 3CCRN 2I1RA 3LWMA 1NK6A 3PDNA 1FHTA 2E20A 3TX8A 5IZHA 1VK0A 2IPOB 4GW6A 3MEEB 4J5OA 4JN4A 4FJIA 3CC2N 4P2FA 1S4EA 3WXLA 1DAXA 4O3QA 3K5NA 4UUWA 5KT7A 2XHCA 5DO2A 4FYVB 1D1UA 3U1LA 1S1TB 2W2NP 2BTFA 5HK4A 2B9XA 2FC9A 3C6AA 3LDPA 5L1LA 1S97A 3KWMA 1O0PA 3BR8A 1JLEB 5KPRA 4RBUA 2BDPA 3LL3A 3V9SA 1O13A 2GTDA 1FXDA 1YJ7A 3KK1B 3OBWA 5H1SV 1RU2A 2EK6A 4KIAA 4QWEA 4R5PB 3MXMA 2FVQA 4C4WA 4B3RK 2L3MA 4ED1A 5CYMA 2GJ2A 2VFUA 5E3AA 3HZ6A 4GMJB 2W9CA 2D3ZA 2W4CA 4KTZA 1RAAB 4ELVA 3H2VE 1F5AA 4JAXA 1BO5O 3KJNB 1VC0A 3PYEA 1VQ9N 3NF8A 1FNOA 2XS5A 4DTPA 2YKPA 1HW8A 3HXMA 4AL5A 3Q2SC 3NS5A 4J2BA 3ZZUA 1GK8A 4CHNA 3SQGA 2ZKUA 3T5LA 5DS7A 1EX8A 5HLFB 1GOAA 4LFAF 4GV3A 2R7WA 4FWRA 5LMNJ 3QPIA 3J7ZO 5J1PA 2DRAA 3E3XA 3DLKB 2KKZA 4OX8A 3G6XA 3PKMA 4DR7F 2W40A 2KT2A 1KFSA 3G8QA 3IAM9 5D15A 3HHKA 3MAAA 2A2CA 4B1XB 4PUOA 2OEKA 1IJFB 4NXMJ 2R7SA 1S49A 3MD1A 4FS1A 2H1YA 2JL9A 3OJSA 1W25A 1UA1A 2W01A 3CMEN 2XMVA 5JMVA 2GQQA 4K7QA 3AD9C 4JI6J 2ZFHA 2E7WA 3M8WA 4ILRA 4V19J 3HJFA 3T1YJ 1YLXA 2P9KB 2R8JA 3LH2S 4J9KA 1C1BA 3KK3B 3DMJB 3M8PB 1ZM3A 3D2FB 1WBBA 2AZ3A 1N5QA 3RBXA 4BLGA 1YVFA 1X60A 4BE1A 1Z1ZA 5J2PA 1BIUA 3C14A 1VIOA 2MDAA 4TSXA 5B0EA 2QMXA 2DHXA 3QAUA 4I2QA 3OTDA 3U7JA 1LOTB 4P2SA 8RUCA 5IT9Y 2MKHA 3MUTP 3BGRA 2MQNA 4XDCA 1LW0A 1QSYA 4DBQA 1LW2A 1K1SA 2F8SA 1WDDA 4O3PA 1RCOB 1XIQA 4KY3A 2WB1D 1U1QA 4C8NA 3DOLA 4H4OA 1BQMA 2BVZA 3EXCX 3UCGA 4UW2A 4O0JA 2KB2A 4YHHJ 1FD8A 5AQFA 1DLOA 2J7WA 4WU2A 5IT9O 4EHUA 2UXCJ 1NSKL 3BREA 3O1BA 5KPZA 4BQZA 4R8UB 2G8WA 4WKYA 1GX5A 2JNJA 4X4VA 1JXLA 1YJRA 2BANB 3QNNA 2DGSA 1TMJA 1VOMA 5H1SQ 3OS1A 3ZSWA 3BF4A 3W3DA 5L38A 1RNHA 5MLCV 2HIYA 4KBOA 5F3ZA 5THWA 3BO2A 3F5TA 3G6ES 4DV6J 1FF2A 2DHAA 1HKGA 2A6AA 5F41A 5I3UA 1RABB 2ASLA 1VQ4S 1CQMA 1FESA 4FLUA 2KTQA 3G10A 3QSIA 3DXKA 2P9SA 3C2PA 3CJQA 3PIOL 4DV4J 3HTVA 1VSJA 4R79A 3VESA 4IFYA 3HM9A 2D9PA 3HSCA 3VA3A 1FW6A 1HHSA 3GV7B 4KGVB 1VR6A 5FD1A 3OYHA 4M3RA 1RHJB 4RG8A 4CRJA 1C0UA 1E3MA 3CJ8A 1KKHA 4H0VB 1JNRB 4FLVA 4L3QA 2GUIA 2BQ3A 4ZVFA 5CD4A 1RB0A 3KLIA 2QXLA 2WFBA 5KFEA 1D4XA 3LDNA 4LUBA 2P9UA 4K42A 1HPZA 2HQ3A 4RU9A 4P6QA 2NXCA 2V7YA 4E0DA 4IO1A 3RZAA 1WOPA 4F3MA 4ILJA 4L72B 3F0NA 3I0SB 4WFBL 4I6MB 3FQLA 1SC3B 3JTOA 4L74A 4OI2A 1HKBA 3HD1A 3F41A 4RW8B 2FLNA 2LQ5A 3ATUA 5F3TA 2Q31A 1RT2B 4W5TA 1S9GB 4J2EA 2EFQA 2WHOA 1YITN 3L7PA 5AQHA 1BUXA 3JTNA 3CF5Q 4EP4A 3JSMB 5KQDA 2YBVA 1GXTA 5I3PA 4LR8A 4ES3A 4B3MJ 4OPHA 2K8GA 1DLOB 1HWLA 1C6VA 3DLKA 1XMOK 1HQ2A 5A8RA 4YDXA 3DRYA 4FJ7A 4JV5F 4QR1A 3IBFB 4BC4A 5HVHA 2MZJA 2QL5B 4MIBA 1U02A 2QA1A 3KLGB 3IBCB 1WG1A 5C24A 3PYDA 2EBGA 2WVEA 2IGIA 2ASYA 4U8VA 2XY5A 2FXUA 5AQUA 3IR6B 3C6UB 3L0QA 3IXQA 4LSLB 2V4QA 3VGSA 4WCEQ 3HX9A 3QIPB 1NNDA 4YOXA 2P9LB 4MAKA 2KRRA 4JP8A 3DHXA 1X4HA 2CZVC 5KI6A 4P7VA 2O67A 1LV5A 4AF1A 4NYNA 2E5IA 1T9VA 2V6AA 5KFJA 2XMUA 3D2EA 3OYMA 1NXIA 3RAXA 1B92A 1Y7PA 3OLAA 4QYZK 1FVSA 2RN2A 3TZWA 1P1LA 1D0EA 2HFVA 1S1VA 2RHQB 3DRRB 3DHWC 1WSGA 4JEPA 2V4RA 4DL7A 1Y10A 1MA9B 1VC5A 4CECA 1XMOJ 2Y1LB 2HZVA 1EETB 4IQXA 4KHNA 4O0IA 4ELUA 3VF4A 1X5OA 2C3YA 1NGAA 4Q0BB 2CGLA 2E9TA 2OGUA 5ETPA 1NGDA 5K8OA