1J5OA

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j5oA05
4DSJA 5I42A 3FFIA 1EKEA 3KKSA 5KGXA 3OYMA 4OKEA 1NOZA 4XO0A 2ILZA 3S9HA 3EZ5A 1JLFA 5J2MA 1Q9YA 1S1TB 3K58A 1WSGA 1TK0A 4DSIA 3RRGA 4OVLA 1SUQA 4WFYA 4EYHB 1W0HA 3IGNA 2PZSA 5KTQA 2BRKA 3OS2A 1CZ9A 2YNIB 4U7CA 1JKHB 3NAHA 2YNGA 4K4UA 1KLMB 1N5YB 3G10A 1ZBLA 5FROA 1NK7A 2QXFA 4ECUA 3H4BA 3NF9A 2W42A 4BWJA 2F96A 4XPCA 3HPGA 4FJHA 4KE5A 1JLQA 3NHGA 1C0UA 5J2QA 4HUFA 3PZPA 4CF0A 4NLYA 4DFMA 1X9WA 2FJXA 2I5JA 5FRNA 1VRTA 1EETA 4F4YA 4XPEA 1QS4A 2D5RA 2WCXA 3M9NB 1NHVA 1NJWA 4FBUA 4ED3A 2YNIA 3DLEA 4DL5A 3BQ0A 3B6OA 1NK4A 3C6TA 3QIPB 2O5DA 4O4RA 4CJ5A 4Z0UA 4CJRA 1LW0A 1YTAA 1LWEA 2FVRA 3ALYA 3QEPA 4B9UA 1ZBHA 3OLAA 2F8SA 1DTTA 1IO2A 3C6UB 2ZQBA 3AVCA 2D3ZA 2FC0A 3GV5B 2HHWA 4N56A 3OJSA 3AVMA 3VQ7A 4LY7A 2FVCA 1S1UA 3GYNA 3K5MA 2KZZA 2R8KA 4CHYA 1HPZA 4IKAA 4NCAA 1DLOA 2X74A 1TKTA 4EZ9A 1KCFA 5K14A 2AGPA 4URQU 2B4JA 1JLBB 4C8KA 5KFKA 1Q8IA 3H5YA 4QWDA 1TP7A 4EYIB 1TV6B 3I5CA 3HVRA 3OJUA 4ECYA 4M3TA 1X9MA 1RT7B 5DG7A 4FBTA 4MFBA 2IAJA 1A5WA 2E9TA 1UA1A 1IKWA 2NUBA 3F9KA 4FXDA 2E9RX 2UVVA 4Y1DA 1XHXA 3GIMA 2HNYB 2BDPA 3IAYA 4Z4GA 1SL0A 5HROB 2OPRB 2IBKA 4E7HA 3ZT4A 3NFAA 1LV5A 5F8LA 3NGYA 4BACA 4I7FB 3G86A 2G8WA 3CJ3A 4FK4A 4HYKA 3H5XA 2XY7A 5KFOA 3G6YA 4KI4A 1NKEA 5EUHA 3PX6A 4BDZA 4IRCA 3QGIA 5DGAA 2C2RA 2C22A 1NOYA 1QAJA 1T03A 3N6LA 1JLCA 2FBYA 3VQCA 2IJNA 3KJVB 3ICLA 4ECZA 3DLKB 4DEZA 1C1AA 3AV9A 4CHQA 5D3GA 3ZCMA 1W9HA 3BSAA 2FBVA 3VQ5A 4KO0A 4ID5B 3NBPA 3T1AA 4J9SA 4FZYA 3O4QA 1W25A 4LQ3A 4OGCA 1VSMA 1ZYQA 5EDWA 1S1VB 3LDSA 1FKOB 4RW9A 5KRSA 2YNFB 1S1UB 5KG6A 4AHVA 1EP4A 3HVTA 1S9GB 4L8RB 3Q8RB 2PYJA 3SJJA 2XRIA 4MIBA 3QINA 3AVAA 3IG1A 2R8HA 3KLIB 2ITGA 1HNIB 4ECWA 4DTPA 4QW8A 2Y1JA 4DTSA 1VSLA 4CF1A 1MU2B 2B43A 4EEYA 4QPXA 3PHEA 4PUOA 1TKXB 1HNVB 3QERA 4E1NA 1Y97A 4QW9A 1HJRA 1VSEA 4Q43A 2XY6A 1S0MA 2VG5B 4IKFA 1RT1B 4CHNA 2VWJA 1VSKA 4ZHRA 4FVMA 1IG9A 3OSNA 1A5VA 3GIJA 3AO1A 3NBPB 1KFDA 3V6DA 3SI8A 4DMNA 4IFYA 3I0SA 1NJYA 4GMJB 2O4IA 1JLEB 4DQRA 1FKPB 3VQDA 3QO9A 2R8JA 2RPIA 1RBSA 4BE1A 4B8CA 2OPQA 4YNQA 2UUWA 4JV2A 3I8DA 4LSLB 5C42B 1S1WB 1J5OA 1KHVA 1S48A 4E1MA 1WAJA 2C28A 3VQ8A 2A1RA 3VQPA 3PX0A 3OS0A 1L5UA 3KHLA 5KFUA 1CSJA 1QSLA 4ZP6A 3PO5A 3MXJA 1KTQA 1XI1A 2B6AA 1RT4B 2CKWA 4CJTA 4RW4B 4J2AA 3QLHA 3QLHB 1RT6B 2XWYA 1RNHA 4KHYA 2YNHB 3DYAB 1JLBA 4ECQA 4KPYA 1REVA 4KAIA 3I0SB 2RDIA 4FS1A 3TARA 2HHUA 3OYGA 4MQ3A 4NLRA 3SV4A 3MEEB 3V1OA 5KFMA 4ICLB 4Z4EA 3ZT3A 1HPZB 4Z4HA 1TL3B 3HVAA 3FRZA 4CEFA 2ZD1A 3V81A 1KFSA 3OYFA 5KFXA 1UWBB 4TYBA 3PR4A 4KFBA 3H40A 4F3TA 1FKPA 2YKNA 1SKWA 5KFBA 4EP5A 4RNOA 3Q8QB 3LWLA 3ZSOA 1DLOB 5FRMA 3HSTB 3K5OA 1BISA 5F8JA 2RF2B 1S9EB 3AVIA 4FJ7A 3DLHA 3SNNA 1C0MA 3NGZA 2RDJA 1EP4B 3HVTB 3BR9A 4DSFA 3CDEA 3TWHA 2EX3A 4RNFA 5F8IA 4FLXA 3DI6A 4F4WA 1Q9XA 1GOCA 4M3XA 3V9UA 2WHOA 4CJQA 3HP9A 1KVAA 2FBXA 1L3TA 5CYQB 4JV0A 5C5JA 5J2QB 4IBNA 1RT5A 4CJ4A 3QETA 4RZRA 1D8YA 3QIDA 3PJXA 4G1QA 3V1QA 3L2UA 4ELUA 3L2QA 2F8TA 4YP3A 1N4LA 1S1VA 4NLDA 1U4BA 2B6AB 2UVUA 3CFOA 4C8MA 3HL8A 2AGQA 4M42A 1VSFA 3L2WA 4JUZA 4KHNA 4MFBB 2DPJA 3DLKA 2UVRA 4RG8A 2YNGB 3KK1A 2HVHA 2BQRA 4M3UA 3BQ2A 3ZSVA 1B9FA 2VG6B 3RRHA 3CFPA 1KHWA 1BQNA 3ZSYA 4XIUA 4IFVB 1NK6A 3RB0A 3PW5A 2D0BA 3AA4A 1YTUA 4ID1A 1IKYB 4CHPA 3HK2A 2HHXA 2W9AA 2ETJA 2AJQA 3C95A 4KHMA 1HARA 3K5LA 2A1SA 3CIZA 2DFFA 4Q0BB 5KG3A 4B3OA 4O3NA 4JRPA 4CK1A 1S9FA 4DG1A 5J2PA 1RYSA 4X2BA 1RILA 4HKQA 2I1RA 4H54A 1LWCA 3LPUA 4RW8B 5HBMA 3FDSA 1ZTTA 1JLGA 4UQGA 3V4IB 3V9XA 4J2DA 4E0DA 4ECVA 3ZSWA 1WSFA 2QE5A 3V1RA 3LZIA 3HXMA 5KG7A 4NCGB 4DTUA 4FJGA 4FLWA 3TQ1A 3KLHA 4ZTFA 2HHQA 1QAIA 3D45A 4TQSA 1TL1A 4Y34A 3QYYA 1Z25A 1D9DA 4CHZA 3NCIA 4J9OA 4PQUB 4B8AB 1BCMA 2IOCA 5L1IA 4OKJA 4OLBA 2HNDA 3O4NA 4ELTA 4FM1A 3GILA 1J54A 2YNFA 1S6QA 5SWMA 1HMVB 2HVIA 2HNZA 1FKOA 3MF5A 4IR9A 4CEAA 4KKOB 1S0NA 4FJMA 3MEDA 3DOLB 4Z4CA 3MXIA 4I7FA 4DFJA 2I5JB 1T05A 3MEGB 2Z1IA 1N6QB 4HUGA 1SH2A 3S3OA 4NLVA 4CHOA 1T03B 1YT3A 2W8KA 3QZ7A 1IKYA 1XR7A 3NGIA 2P1JA 3AA3A 3AVJA 3LPTA 3CJ4A 4O3RA 4CIEA 5EU7A 4YR0A 4ZMMA 1ASVA 2RN2A 3RB3A 3M8QB 5F8HA 2VG6A 2R8IA 1T05B 1F21A 2QKBA 2WRMA 4W5QA 4DQPA 4DLGA 1SV5A 3DM2B 3KHHA 4DU1A 1L3UA 4ECTA 5KGWA 2HNZB 2JC1A 4CJVA 5FDLA 4CCHA 3D5MA 3OYCA 1S1TA 1GX5A 1RTJB 3SFUA 4TSXA 1KLMA 3SUNA 2W8LA 1N48A 4F50A 2KW4A 4KTWA 4O44A 5HLFA 4TY8A 1JIHA 3IRXA 5C25B 1NJZA 4FLZA 1S9EA 5KFGA 1I6JA 4RW8A 5HBMB 2HMIB 2LSNA 4CGGA 3S3MA 3OYBA 2ZE2A 5KFEA 1A5XA 2F8EX 3TABA 4WE1A 4AHUA 4WXOA 3PY8A 2IJFA 2JEGA 3KD1E 4DLEA 3SQ0A 3OL7A 2G8IA 3QNNA 3UPFA 3RR8A 3ZSQA 1FK9A 1K1SA 3NGDA 4GC6A 3NMAA 4DL3A 3KLEB 2ZKUA 3KIOA 3BGRA 5F8GA 3OYKA 1RT2A 4CECA 3KK2A 4LH5A 3Q8SB 4J9LA 4CEEA 3T5KA 2BANB 4CEOA 4MK9A 1BQNB 2JC0A 4ZP8A 5KFHA 4Q0BA 4TY8B 1JLQB 2QKKA 2YKMB 1KLNA 3TAMB 3AA5X 1Z26A 3WNEA 4Q45A 3LP2A 4K4ZA 1XWLA 4QWCA 1EETB 4O3QA 4KHQA 3KK1B 4DTJA 3KK3B 3G6XA 4H8KA 4I9LA 4FLVA 4AH9A 3EPIA 2W7OA 4FZZA 2OA8A 4NLGA 1T3NA 3BDPA 2VG7B 5CYQA 4WXWA 1XR6A 4ZPCA 1VSHA 4KKOA 2R2RA 3HHKA 1S6PA 2C2DA 2IM3A 5KFSA 5DGBA 2E6MA 2C2EA 1N5YA 4FLYA 2P5OA 1HYSB 1EXQA 4U6PA 2W9CB 4QCLA 1S1XA 1C1BB 2BQ3A 2Z1HA 3NF8A 1N6QA 4DTMA 4IQXA 2IC3A 1QQCA 4F8RA 2VA2A 1UOCA 4IG0A 5KT5A 2XO7A 1IKVB 4TY9A 5L1LA 3MAQA 5CYMA 1RDCA 5KG4A 1ZETA 3MXMA 3T5LA 3SPYA 5J1EA 3T5JA 3DOKA 2J6TA 2WONB 2BQUA 3PJWA 4R8UA 4QWBA 5JS2A 2D0CA 4HHTA 1NKCA 3VQQA 3FFIB 3U3GA 1QSYA 1BGXT 3ZT1A 1X1PA 2OPPA 2QK9A 1C0TA 3KOAA 2R8GA 4KV8A 4ID5A 3SCXA 3QEIA 4DS5A 3QEXA 5KFCA 3T5HA 3TAFA 4G3IA 4IRDA 3ITHB 2E4LA 2QV6A 3DRPB 4IH6A 4CGFA 2R2UA 4F2SA 4M3ZA 1TGOA 3LP3A 4FM2A 1MMLA 2IM0A 2OPSA 1TAQA 4B08A 4FYDA 4HTUA 2XI3A 3MR3A 3DDKA 4CF8A 4CK3A 5KT7A 2HHTA 4KFBB 4CF2A 3VQEA 5KFPA 4OJRA 3JYTB 4H4MA 1ITGA 4QWEA 3BSCA 1VSDA 3DRSB 5E41A 3K2PA 2DTUA 2YNHA 4DSLA 3AVHA 4J9PA 4Z4FA 2O4GA 4CFDA 4O4GA 3NH1A 1TKZA 2KFNA 4CERA 2HNYA 3QESA 2G8FA 2IMWP 4FS2A 3SZ2A 5C24A 3T19A 3P83D 3AVFA 4ECRA 2HW3A 5K14B 4FM0A 4FJNA 3M8RA 1C6VA 1ASWA 2HHSA 3NDKA 4HCBA 1RTDA 1GX6A 4NRTA 4CJWA 4J9KA 4OGEA 4ECXA 1BQMB 5KFNA 3KMSA 4FW2A 2FJVA 2OPQB 4YMEA 1ZBIA 4KV8B 2AWZA 4J9QA 1VRUA 1MU2A 4W5RA 3K5NA 3QZ8A 4PA1A 2OZSA 1CXUA 4GW6A 3G6VA 3OSPA 5KFQA 1JXBA 4WFZA 1JXEA 2WOMB 4RUCA 1ZBFA 5DMRA 1J9AA 1NK0A 3RAQA 3UDLA 3MR5A 4KTZA 1RT5B 3DLBA 2UVWA 4DS4A 4KAZA 3H2LA 1DTTB 5KFJA 4Q8EA 4Q44A 1LWEB 1HNIA 4KB1A 4OLAA 4B9SA 3MECB 1B92A 4WZMA 2RF2A 4IDKB 3IGVA 4ED0A 1WNEA 2ASJA 2X6NA 3Q8PB 4YR2A 3K59A 1RDRA 5KFTA 1TL3A 1L3VA 4YR3A 4O55A 4WYWA 3LWMA 2XI2A 3OYDA 3OYJA 1VRTB 2OPPB 1JX4A 2E6LA 4URGA 2KZMA 4E7KA 3ISNC 4DF4A 4DTXA 4NYNA 1UWBA 1S1XB 2BGGA 4JS4A 4URSA 3KKRA 2KQ2A 1HRHA 3CQ8A 4QWAA 5CZ1A 4Y2CA 3OVNA 4JS5A 1RTDB 2J6UA 1RDAA 3E01A 3ZSXA 4DTOA 3NKYA 3DMJA 5JUMA 4J2BA 3ASMA 2IC3B 1C2PA 3JYTA 1BQMA 3N6MA 4JLHA 5C24B 1RDDA 4OPKA 4KRFA 5C42A 3MR2A 3KLFB 4FLUA 1SKRA 3KD5E 1HQEA 3HKWA 4NLOA 2OPSB 2YHBA 1U04A 3DYAA 5F9LA 4C8NA 3DLGB 5EWEA 2V9WA 4NLWA 4HUEA 4DSEA 5DG8A 4K8XA 3GIKA 3AO3A 4CJLA 3GV7B 4CJPA 1RT6A 5J2NA 3OHBA 2JEJA 3EYZA 3U3YA 5KT6A 4EO6A 1RTIB 3H59A 4ZPBA 4CJEA 3LANA 2IA6A 2W9BB 4I2PB 4PWDB 4EO8A 3HT3A 4B9MA 1LW2A 5DLFA 4IG3A 4ZPDA 2X6SA 2HNDB 3THVA 3ITHA 1WN7A 3H5SA 2D0AA 4HCCA 4W5TA 1BCOA 2FVSA 5CY4A 4Q8FA 5KFFA 3PW4A 1S9GA 1NK9A 1S4FA 2IM2A 3OYAA 3RMAA 1TQLA 4DL2A 4MH8A 1QUVA 4YFUA 3AVGA 4R8UB 4DQQA 3C6TB 2BE2B 3QIPA 4TLRA 5J2NB 4E7IA 5DQHA 4I9QA 1N56A 2GIRA 3TI0A 4FK2A 4W5OA 2DFHA 1HQUB 1C0TB 4CESA 4IFVA 4BDPA 3QGHA 5F9NA 2FJWA 2XCPA 3KMQA 3GIIA 1HYVA 4K4YA 3RR7A 1CZBA 3KHRA 1D9FA 3IS9A 3MEGA 3RB6A 1RT3A 1NKBA 2IS3A 4CJKA 1QE1A 4DL6A 2CJQA 4N47A 3M9MB 2OH2A 4ED7A 1WLJA 1JLAB 3PUFA 1HMVA 3OY9A 4LSNB 4BE2A 1QTMA 3KJVA 1G15A 4AILC 3SI6A 1JKHA 4RU9A 3M8PA 4IOBA 3LP2B 3IS9B 1RTHB 4CEDA 4FJ9A 5KFZA 3PW0A 2AGOA 3LP1B 3HP6A 2FBTA 5I3UA 3NAIA 3DLRA 4F2RA 3RB4A 3KLEA 1BIUA 1FXXA 3SUPA 2EHGA 3VQSA 1RT7A 3AO2A 3L2RA 2ILYA 4O3SA 2W7PA 1NK8A 4LD0A 4PQUA 3DOLA 1DTQB 3V4IA 4N41A 1SH3A 5KFRA 5KT4A 1IKWB 4CF9A 2GV9A 1LW2B 1IKXA 5KG1A 2Y1IA 3AA2A 4PWDA 1S6QB 3TAEA 3BREA 1FK9B 3NF6A 3U6FA 5HRRA 5KFWA 1RBTA 1JLFB 5J2MB 5CZ2A 3AVNA 3CWJA 3NAEA 3VA0A 3RMCA 4FJ5A 1QHTA 4O3OA 3V6KA 2BANA 3OL6A 3I0RA 4WZQA 2WK4A 3GQCA 3BSNA 4M3RA 4M3YA 2W9BA 3L3UA 3RBEA 5T7BA 1WSIA 3B6PA 4TXSA 3V6JA 4RUAA 4TYAA 4DSKA 4KHSA 1TAUA 4IRKA 5T14A 4ELVA 4IR1A 4CJFA 1RAJA 2PY5A 3PV8A 4IH5A 2DY4A 2RKIB 1NJXA 3CG7A 4KB7A 5I3UB 3C6UA 3H08A 3DMJB 4FJLA 3P1GA 4NLPA 3VQAA 5DQIA 4BWMA 4FJ8A 3DLGA 1X9SA 4F4KA 4B3OB 2JGUA 1LW0B 1IKVA 3CJ2A 3UR0A 3MFHA 1LAVA 2DFEA 4C8LA 4NRUA 3LALA 1TK8A 3SUQA 1TK5A 4I2QA 4G1QB 3BQ1A 2G8KA 1SV5B 2AX1A 4DU3A 1TVRB 4ZPAA 4BDYA 1ZTWA 3TAGA 3O3FA 3VA3A 3M9OB 1REVB 2E9ZA 5KI6A 3V9WA 3OYHA 3N6NA 4DL7A 1BHLA 2GC8A 4F4XA 5HP1A 2JLEA 3VQBA 3AO5A 1S1WA 4M41A 4FJJA 2EC0A 2XGQA 3V9SA 3G0ZA 3EPGA 4AHSA 1U49A 4R0EA 1U45A 3M8SA 1JLAA 4IDKA 3E01B 3V6HA 2R2TA 4KHWA 5L1KA 3CDUA 4B9TA 3DRPA 4LH4A 1IM4A 1OS5A 3TAPA 4ED2A 3QEWA 3TAMA 1RT1A 4NLUA 3CFRA 4ECSA 5SZTA 2FVPA 3OS1A 3ZT2A 1SUQB 2PYLA 3MECA 4CGDA 1JL1A 5KT2A 1BIZA 4M3WA 4K4SA 5KG0A 4F3OA 1LWCB 3ZT0A 5DG9A 5HRNA 1R0AB 4ZP7A 4E7JA 4KI6A 3CJ0A 3H5UA 1S0OA 3A2FA 3OYEA 3D28A 3BGRB 1S10A 2X78A 3C94A 1RTIA 4ZHRB 3V81B 1VSIA 3TVKA 1XHZA 4RNNA 1UA0A 5KFYA 5KFAA 3PR5B 5J1EB 2AU0A 1RYRA 4I2PA 5DLGA 5EWGA 1BL3A 2WOMA 4NYZA 4DG1B 5J2PB 3PX4A 1CXQA 3RWUA 4IG3B 4NCGA 2AQ4A 4AHTA 3VN5A 3GV8B 1LWFB 3VQ4A 3OYLA 3LAMA 2HMIA 1I3AA 3QEVA 2HHVA 2ZD1B 1U09A 4J9MA 4AHCA 2ALZA 2BR0A 4KB0A 3M8PB 1HYSA 3PW7A 3UIQA 2HAIA 4R5PB 3AVLA 3H98A 4F4ZA 5KRTA 3CM5A 3IN5A 3OLBA 1B9DA 4Y3CA 1RBRA 4DFKA 4H4OA 1D1UA 5L9XA 4CE9A 3L8BA 3EY1A 1QSSA 3RAXA 3UQSA 4CGHA 4KHUA 1NHUA 3PO4A 4R5PA 2B5JB 4O3PA 1NNDA 3CYMA 2YV0X 4O4GB 4N76A 2Q3SA 4ZP9A 3KTQA 1YVFA 4CIGA 4LSNA 4QAGA 1U47A 1RT4A 1S97A 4YQWA 1C1CA 4CJUA 4H4MB 3DRRA 3KLFA 1J5OB 4CFBA 3ZSRA 4BE0A 4LSLA 2IM1A 2ATLA 4CEZA 4KTQA 3OL8A 3KLGA 3TAQA 1TKDA 4DL4A 1JLEA 1RBVA 1NK5A 1KRPA 4JV1A 2KFZA 5KT3A 2R2SA 4CFAA 4KREA 3FQLA 1TKXA 4WFXA 1EX4A 4ED8A 4C8OA 3H4DA 4H4OB 4DWIA 4OPJA 5L1JA 1ASUA 4MIAA 2FLLA 1RDBA 2AX0A 2BRLA 4CK2A 1BI4B 4EP4A 4GVMA 2D3UA 2Z1GA 2HWIA 2VG5A 4B9LA 2D41A 3I5AA 3NE6A 4ZTJA 4CGIA 4RNHA 3SQ1A 3TANA 2WTFA 4IFYB 1K1QA 2BE2A 4OL8A 5JXSA 1HNVA 2OZMA 1TL1B 2XGPA 4EBEA 4K4TA 4PY5A 1CLQA 3I5BA 3PW2A 3CDWA 4MKAA 3QIOA 1ZBUA 4O0JA 4NLQA 2D7SA 3CM6A 4J2EA 2HWHA 4PUOB 4DFPA 3VQ6A 5FDLB 1C1CB 3JSMB 4IG0B 3V9ZA 5D3GB 4RW6A 3IG1B 1HQEB 5DK5A 4FZXC 4AHRA 2FLPA 4M94A 4FLTA 1KVBA 3NH0A 3PVXA 4M45A 2JEFA 4K4WA 2ASLA 4OKKA 3DOKB 3ZSZA 2WB4A 4NYFA 4Y1CA 3ISND 1RA6A 1SL2A 2G8HA 1GOBA 4RW4A 1WAFA 1XR5A 4ICLA 3MEEA 4IH7A 3FSIA 1HYZA 1WSHA 1K6YA 3OYIA 4FJKA 3DRSA 2IAJB 2OYQA 4TN2A 4EZ6A 3KK3A 3LP0B 4DTNA 4CGJA 3OYNA 4E19A 3OL9A 1TKZB 2GIQA 5DQGA 3QGGA 2OPRA 1D5AA 4NLXA 2YKMA 3EZUA 2VG7A 4CJ3A 3JSMA 3RTVA 1S5JA 1YVUA 3OHAA 2P51A 4E7LA 1TVRA 1O1WA 1LAWA 1D0EA 5JS1A 4ZVEA 2B5JA 3WNGA 3AVBA 3NH2A 4I2QB 3CVKA 4QOZB 5KFVA 4E89A 3LP0A 4EBCA 3AVKA 4NLTA 5HROA 3QNOA 3SYZA 3AO4A 3QO9B 4ZVHA 2J6SA 1RCHA 4RW6B 4NLSA 3E51A 4FJXA 4O5BA 1TKTB 3L2VA 3WNHA 3RMDA 4FCYA 3HJFA 3SFGA 1DTQA 4DQIA 5KFDA 2FVQA 4KHRA 1WNSA 4ED6A 2DPIA 4E3SA 4J9RA 3WNFA 3RMBA 3S3NA 4FJIA 4O0IA 4Z4IA 1UAXA 4CEQA 3MTKA 1R0AA 2P5GA 4RW9B 3O3HA 4MKBA 3F73A 4GC7A 4CIFA 3SPZA 4Y2AA 4NZ0A 1RT2B 1S49A 5HRSA 4WYLA 5HRPA 2V4RA 1RBUA 4RNMA 4NCBA 3I0RB 4KSEB 5KG5A 1GOAA 3LP1A 4MK7A 3HYFA 1IH7A 3SV3A 4DQSA 2V4QA 3BSOA 3DM2A 3FQKA 1C1BA 4CJSA 2UUTA 1JLCB 2VA3A 1L3SA 1KSPA 1RTJA 3CJ5A 3DLEB 2V0NA 5HP1B 4FK0A 4M95A 2YHAA 1U48A 3NL0A 1T7PA 3KLIA 1VRUB 1RA7A 1RTHA 5KG2A 4CFCA 3O3GA 5F8NA 3ULDA 4DU4A 4CEBA 2XHBA 2WONA 1SKSA 2XY5A 3SQ4A 5KFIA 4K4XA 1BI4A 4DTRA 4KBIA 1J53A 4ED1A 3M8QA 4MK8A 1QE1B 1WSJA 1KVCA 4KO0B 1RT3B 1I39A 5EWFA 3HPOA 1HQUA 2RKIA 1VSJA 3SQ2A 2XCAA 3KLGB 2KTQA 1C0UB 2W9CA 3KLVA 1SL1A 3MR6A 4Q5VA 2XC9A 3NF7A 3DRRB 2JEIA 1T94A 2Z1JA 3HM9A 1S6PB 1LWFA 2GUIA 1T8EA 4EBDA 3KK2B 2GBZA 2IDOA 4N5SA 4HVJA 4B9NA 3DI6B 4K4VA 1XC9A 2ATQA 4DF8A 5I42B 3T3FA 4FW1A 3VQ9A 3L3VA 3K57A 3SUOA 2G8VA 2ASDA 3MEDB 3KLHB 1JLGB 4TQRA 3HO1A 1JL2A 2ZE2B 3KHGA 1WSEA 4RW7A 3TR8A 3HVWA 2IGIA 4LQ9A 3V6DB 1JXLA 3KNAA 4ZVFA 3P5JA 3IRXB 5C25A 1Z4UA 4ZVGA 3BJYA 4J9NA 2G8UA 3LAKA 4B9VA 4O44B 1TV6A 5HLFB 2R7YA 5F8MA 1VK0A 2YKNB 3CO9A 2XY8A 4K50A 5KFLA 3MFIA 3RBDA 2FLNA 3LZJA 3D0PA 4RW7B 2VWKA 2HB5A 4WE1B 5CYMB 3HPHA 4W5NA 1SH0A 4JRQA 1IKXB 4K8ZA
chains in the Genus database with same CATH superfamily
1IBMF 4CZHA 3A4TA 1WELA 5I42A 3FFIA 4F0KA 2ILZA 4IEEA 3EZ5A 5J2MA 2D3OR 3CPEA 3CF5L 1SC4B 2MGZB 3DN9A 1J6ZA 2JFKA 4OVLA 1BU6O 4EYHB 3OS2A 3DDIA 2YNIB 3L4IA 5CD4A 5E3CA 5LL6Z 2GGPB 2GAGC 3WUHA 1N32F 2YNGA 1OH8A 3SXLA 1KLMB 4CH0S 1BQXA 5FROA 1KC8O 4E8UA 2XS5A 2QXFA 4ECUA 3VGMA 2IIHA 1F2GA 4JN4A 3NHGA 1ZAVA 1QLNA 1WHXA 4AYBD 4HTIA 1X9WA 2NXCA 2FJXA 2I5JA 5CXTA 4XPEA 2E1AA 3NCPA 2WCXA 3BO2A 1RGIA 1NHVA 4FBUA 1RLDA 2CYYA 4ED3A 3QQCD 2XM3A 3K8VA 3FLCO 3FR0A 3DLEA 5HVHA 2HBLA 2O5DA 4V19X 4CJ5A 4Z0UA 4P2XA 4DR7F 4ZA1A 2B4VA 4QS9A 4H4KC 1AA1B 1LWEA 4B9UA 3ALYA 1ZBHA 3C6UB 5ETKA 3AVCA 2D3ZA 3R3TA 5C7PA 2JDJA 3EXCX 1R31A 4BRMA 1R6VA 3VQ7A 2FVCA 4JI1J 1S1UA 3CQYA 3K5MA 3I9ZA 4YHHF 2WTUA 2L41A 2OSQA 1NM1A 2DH9A 1M1KO 5GAGU 1UW9A 4PABA 4U9RA 4EZ9A 5C10A 5K14A 2B4JA 1Q5YA 5KFKA 4JKCA 3H90A 3G4SS 3H5YA 1IWAA 2AP1A 2CQ3A 2XWXA 4NA2A 3AD8C 3FBFA 4FBTA 4MFBA 3PEHA 3R9PA 1ZH5A 2YH1A 1UPMB 2E9TA 3NY0A 1UA1A 5AQXA 4OX9J 1RHKB 2JNJA 2FGCA 2GJFA 2D9OA 1SL0A 5HROB 2OPRB 3VEWA 2IBKA 1MG7A 1LV5A 4FPRA 4WKYA 2NZ4A 1FTRA 3NGYA 4BACA 2VB6A 2G8WA 3CJ3A 1WC5A 3H5XA 5C2GA 2DGXA 3PX6A 4IRCA 4G65A 4PCQA 3ENOA 3WQUA 1NOYA 3W9JA 3NGRA 4XH1A 1Q0NA 3VZIA 2IJNA 2RIJA 4ZCMA 5D3GA 4BR5A 3WQPA 2BJ1A 2PMHA 4WP3A 4KO0A 3Q83A 2IVNA 3T1AA 5GAEU 4J9SA 4FZYA 3O4QA 2CPXA 4ED4A 5ETTA 4LQ3A 4V19J 5ETPA 2J0XA 3ZZ0A 1R59O 1NHKL 1OY9A 2J8AA 1S1UB 1RWMB 3FCVA 2P9PB 1EP4A 3WEEB 1UKUA 2EI5A 3EJMA 1NGJA 4MIBA 3QINA 3KLIB 1GEHA 2ZJRQ 2ITGA 3FRYA 2LDIA 1RWOB 4DTSA 1KQFB 1VSLA 1MU2B 2B43A 3ISZA 4UY8T 3PHEA 1HNVB 4A8SA 1B0TA 3FCWA 1QVGR 4ZLLA 1XNQF 1TUUA 4M7YA 4FVMA 2GZOA 2C3OA 2WVFA 2PSZA 5FLXY 4TNOA 3TW0A 1RAIB 3VETA 5GVQA 1BXNA 4EWTA 1NSAA 3QO9A 2R8JA 3I31A 4B8CA 4YNQA 2UUWA 3I4HX 5C42B 2EG2A 3VALA 3WXJA 1S1WB 1S48A 1WAJA 2BZ2A 3OS0A 1PAUB 2QYCA 3KHLA 4M5MA 1V5IB 4ZP6A 4X84A 3PO5A 3SAGA 1RAHB 1QQOA 4ANCA 4CJTA 2XSJB 2VZ9A 2KN4A 2VICA 3CGIA 3EWGA 2GW8A 3IFEA 2F40A 1VMBA 4ECQA 1DY3A 1M5VC 3LOUA 1REVA 3I0SB 2RDIA 4MQ3A 1OY8A 4NLRA 4J5OA 1Z6RA 5KFMA 1FE4A 2ASYA 4Z4EA 3ZT3A 1BMQB 3C19A 2ZD1A 5H1SQ 3TYTA 4PKHA 5IWAK 1CULB 3V81A 3OT9A 2MZSA 3EN9A 3NCQA 4TYBA 2CPJA 4CWBA 4F3TA 4W92B 1FKPA 2GUPA 2BW7A 4DR1F 1U6FA 2YKNA 5KFBA 2R7SA 1YJNS 2IVPA 4RNOA 3AARA 4LFBK 3AT1B 1N32K 2AEJA 3D6RA 3W2WB 2N3LA 1CJTB 3AVIA 4USTA 1T9TA 1EQ0A 4HTLA 3VGTA 4HACB 1ZXOA 1EP4B 3BR9A 1TL7A 3A3OB 1Q95G 4LR8A 2EX3A 4RNFA 1SJQA 3JSRA 1GOCA 4M3XA 4HH1A 2V9KA 2WHOA 4CJQA 3W65A 2Z2LA 3HP9A 3U4LA 4OZ3A 3ZTPA 1KVAA 2FBXA 3OV7A 5CYQB 5J2QB 2PD1A 4IBNA 3QETA 4P73A 1NH8A 3QIDA 2FLOA 4W98A 3HSDA 3V1QA 4AQYJ 3ZEUB 2FHKA 3O80A 2F8TA 3R6MA 1N4LA 4DUYJ 4C8MA 1OQ6A 4M42A 3VEYA 3L2WA 4MFBB 1FERA 2DPJA 4PZVA 4M3UA 3E8OA 3BQ2A 3RRHA 2QLFB 3CFPA 1KHWA 3KDNA 4JYAK 1QAYA 4EFHA 1CEZA 5A8WB 2QWLA 4CTAB 1R7IA 1WKKA 3SSQA 4DV4J 3C95A 4KHMA 3PLAA 4Q0BB 1HFEL 3NVMA 5JLHA 5J2PA 4A48A 1RYSA 3CNQP 4HKQA 2I1RA 1Q81O 3CD6N 4OX9K 4LBHA 1KNZA 1ZTTA 1FJ7A 4UQGA 4C23A 4K41A 3V4IB 4I64A 1SZ2A 3CCTA 3OUYB 4ECVA 1WUAA 3K9KA 1A9NB 2QE5A 3D67A 3LZIA 2UUAJ 3HHLA 5ETMA 4FJGA 4DTUA 3TQ1A 4ZTFA 2HHQA 2DNMA 3MN9A 1FRXA 1TL1A 1D9DA 2LKZA 5HL7Q 3MN5A 1FRLA 3WQTA 1MN9A 3NCIA 4J9OA 2IOCA 2F9JA 4FM1A 3P45B 2HVIA 2HNZA 1FKOA 3I9V9 2MLXA 4CEAA 4KKOB 3CCMS 4FJMA 3UI3A 2E20A 1F0XA 3H45C 4Z4CA 3LO3A 3A8YA 4I7FA 2RAQA 4DFJA 4WFBQ 1K0TA 1N6QB 4ENOA 2R7UA 4JI7K 4F9OA 4HHUA 1YT3A 5LMNF 3QZ7A 4I69A 1UJ6A 1ZA1B 3AA3A 4WFNQ 3LPTA 3OR2A 1H0HB 4O3RA 2PDAA 1N5QA 4YR0A 4FVUA 1OMSA 3U1NA 2VH7A 3AA8A 2WRMA 4W5QA 4DQPA 3G25A 2HF4A 4CJ7A 1SV5A 3DM2B 1REGX 2MYFA 2W7AA 4M5JA 2XS2A 2W2OP 4JI6K 4DU1A 2VYPA 4ECTA 2AJ0A 3ENWA 3N0VA 2E8AA 2JC1A 3SDEB 1GX5A 4TSXA 3PSFA 2W8LA 1HR0J 3JXUA 1WJ9A 3CMES 3ZTRA 3ATVA 3M30A 1NGDA 4O44A 5B8HA 4TY8A 5C25B 2QI2A 4FLZA 1H3DA 1I6JA 2AJFE 1YAGA 3KG1A 2LSNA 2YX1A 3OYBA 1YIJN 4EIAA 5J1PA 3F5TA 4WE1A 4WXOA 1YLXA 2QGFB 4C11B 2JEGA 4DLEA 4RKUC 4X62K 3HHNB 4NMXA 3OL7A 3US5A 1RLCL 3BZCA 2MXYA 2ZKUA 3BGRA 4LH5A 2QW9A 3T5KA 2N7YA 2JC0A 5FLXU 2KLAA 3GR0A 3CMAN 1JLQB 3ZLJA 1WI8A 1BHNA 2ZH9A 3CC2N 4DL0C 4Q45A 2BJ8A 4BBYA 5BPNA 4JI3K 4BR7A 4H8KA 3CJ8A 3DXKA 2MJUA 5BXIA 2R7RA 2IRUA 1HNWF 2XYHB 2KI2A 2W7OA 4IXCA 2E7XA 4U8VA 4LREA 4WXWA 4ZPCA 4KKOA 3CCWA 4L74A 3HRGA 2DNYA 1S7HA 1T3VA 4FWRA 3M2RA 3R7BB 1N5YA 3NGUA 2LFVA 4FLYA 1PGZA 4JI2J 1KOOA 2MQLA 2Z1HA 1N6QA 1VQON 5CABA 5K5MA 1K9MO 1KQSR 2IC3A 1SJRA 4OI4A 5RUBA 3HFZB 4IG0A 1GTEA 1FJGF 4HEA9 4FO0A 3O9QA 3MAQA 1ROFA 3T1YK 1RDCA 1UEVA 3SBMA 4USVA 1WC0A 4YHHK 1VHFA 1VLYA 2WONB 1KOHA 2ZBPA 3AQPA 4DHYA 3TJAA 1WOQA 4HHTA 3VQQA 2NYIA 3M8YA 2B8PA 2QMUB 1BGXT 1VQYA 4FWPA 1X1PA 3I4PA 2OPPA 4CIOA 3O08A 4CBXA 1C0TA 3D9BA 2C3PA 3TZZA 4DR2J 2VPXB 3HTVA 4U7UD 3LGMA 4YUDA 3QEXA 3T5HA 1QVFR 4PL8A 3MURP 3UD3P 2NPIA 5C15A 4NXNF 3W5YA 2QV6A 1TUWA 5F0UA 1QHAA 3EXYA 3LP3A 2CH6A 4FM2A 4DV0F 2IM0A 2QXLA 2BOPA 2XI3A 3THYB 3DDKA 5KT7A 5EX5A 2DT9A 2HFUA 4RLEA 1KXPA 2PC6A 1VQ9S 1N33K 3MCPA 4IFEA 1XUPO 3JYTB 2DIVA 5C2CA 2G13A 4ZVQB 5L38A 4P52A 1VSDA 4I6MB 5E41A 2UUCJ 3K2PA 2B8QA 3QJLA 1NGGA 2F4VF 2W40A 2GIFA 4B3SF 4J9PA 2UUCK 1WKLA 4O4GA 3NH1A 4C2MA 2KL8A 5HANA 3D2WA 4G9ZA 2RILA 2XMUA 4CERA 2V67A 4OHWA 3PKYA 3T19A 3PNIA 3P6YC 4ECRA 2ZH2A 2NYHA 5LMUF 2VQEK 1C6VA 1ASWA 4F3MA 1EWQA 3IFRA 4HCBA 1RTDA 4FXVA 2EWSA 1SXLA 5LL6d 3Q2SC 3UO0A 4J9KA 1LEOA 4OGEA 1FWPA 2CJYB 3OBIA 4CP5A 3ZNJ1 5GMKa 4ZJOA 1GAOA 3D0IE 3O6QA 2GJIA 3C8YA 2O8EB 4J9QA 1VRUA 2MZ1A 3CJ7A 1NUEA 4WCEL 4BROA 4PA1A 1W2BR 2OZSA 2WOMB 4RUCA 4OI1A 3THTA 3MR5A 3P96A 2UVWA 4IO8A 3TVZA 2C2NA 4KB1A 4X4VA 2CQ2A 1B92A 1HKAA 2RF2A 4ED0A 2JJ4D 1AZSB 2VHGA 1HI0P 4P10A 1RDRA 2FHJD 3ZTQA 5HVGA 5U47A 2GVDB 3HFKA 1SJ4P 1YWXA 3OYJA 1VRTB 2OPPB 1YQHA 2KJWA 2E6LA 4OX6A 3OTOF 4DF4A 3HULA 3QFWA 4I6AA 1AT1B 2ATCB 2EKYA 4DTXA 2DJWA 3W62A 4M5IA 1HWLA 5CCMA 4BR0A 2KXNB 4WF9Q 4QWAA 2BABA 1IBKJ 4WYBA 2CQIA 1RTDB 1OSDA 2E5HA 4M5LA 4C6AA 4JI8F 3UFCX 1S4EA 1HD0A 3NKYA 1S77D 4J2BA 2DNQA 1IBCB 2N82B 1C2PA 4USHA 5C24B 4KRFA 1FFSB 3N01A 4Y28C 4LF7F 3RSEB 1D4XA 1PC4A 1HQEA 2R7WA 3R97A 2XMMA 4E2FB 1NJIT 3HLUA 4CLSA 4J90A 4LSZB 3AO3A 4CJPA 1RT6A 5A6WA 1C0GA 4EO6A 2W2QP 3OVSA 4PG4A 4CJEA 5HOOA 3LANA 4H5TA 3MK6A 5F0XA 1LW2A 3N4QA 1KR4A 4CRJA 2CADA 4W5TA 4EHTA 1XNRJ 3DRYA 2QMXA 4PWUA 1P6TA 3UN3A 4HH0A 2UUAK 2IM2A 1WBDA 3QFHA 5AJ3J 1TQLA 3A3NB 4DL2A 9RUBA 4NOHA 2R3VA 4MAKA 3AVGA 4P2FA 1X8DA 3ELHA 4R8UB 4DQQA 3ET6A 2YTCA 4M7XA 2HFNA 4CM0A 3F44A 5DDOC 1N56A 4LF4J 1URNA 2QMWA 4USJC 1FXDA 2UU9J 2VQEF 2C3YA 2GAHC 3W66A 3DHWC 1EB0A 1GFWB 2ASMA 2W6KA 1Y5NB 1RTZA 3HD1A 4EU0A 4DR5F 3UDVA 3IS9A 2Q0RA 3EZOA 4JYAJ 3MEGA 4WU3A 3RB6A 2IS3A 2AHOB 2ZM6F 1QE1A 2UXDK 2CJQA 2D0PA 2ROGA 5ETRA 4FL9A 5BRDA 3OY9A 2AW0A 3AY9A 2O8CA 2MKKA 4WU2A 1WHYA 4YDUC 1UVIA 2K1RA 1G15A 2IIRA 2GGPA 3LP2B 4CEDA 1RTHB 3MR7A 1JMTA 1Q86T 2ZGZA 4DV1J 4CLUA 1SB6A 5HK4A 4F2RA 2VJUA 3KLEA 4P2SA 2QEXS 2EHGA 1B64A 2DNPA 3L2RA 2VQFJ 5LMUJ 1NK8A 1XQIA 4LD0A 1RABB 3DOLA 1DTQB 5KFRA 2F7VA 5KT4A 1IKWB 1Q7LB 1LW2B 2K06A 2FY8A 5KG1A 2Y1IA 2P9NA 3DLLQ 3BREA 1FK9B 3U6FA 5HRRA 5KFWA 1RBTA 1XEZA 1EIYB 3NAEA 4K7QA 3VA0A 2E5LF 4KH4A 3V6KA 3OUYA 1VQPS 4WZQA 4Z7YA 3BSNA 3J7A1 2BXJA 1M5PC 3RBEA 2ZVIA 4PG6A 1O5JA 4KRWA 2DRAA 1WDTA 3GFHA 4OX9F 3M6GA 3GPAA 4OYPA 4CH7A 1VC5A 1PO6A 1W2IA 4DV0J 4YY3F 3PV8A 1RGVA 1Y10A 1ULRA 2BUNA 1NJXA 4KB7A 5I3UB 3WT0A 3H46O 3DMJB 4FJLA 3OPKA 4HT7A 3VQAA 2VBZA 4FJ8A 3DLGA 4B3OB 4K5SA 3ENQA 3D3BJ 2F9DA 3MFHA 1B70B 2PI4A 2LU1A 4USKA 1BE4A 2G8KA 4DU3A 1V6HA 1TVRB 4BDYA 3O3FA 2F1FA 2E5LJ 2J4RA 1MN7A 1UVMA 4YOWA 4F4XA 1HI8A 3ZETA 4C3MA 2XGQA 3MDQA 1RADB 4KGMA 3V9SA 4GVBB 3CCUS 3EPGA 3M2UB 1U45A 3V6HA 2R2TA 1UMJA 1GLCG 1NRKA 3FBEA 5L1KA 1Z1ZA 4U95A 2VWBA 1RT1A 3CFRA 2OMOA 4F0HA 4ECSA 1TL7B 3E1YA 4H5WA 5JVHQ 3PEJA 3OS1A 5D15A 3MECA 5KT2A 1IQTA 1RFQA 5EVZA 1RXOB 3UN5A 4NX9A 1R0AB 4QOTA 4KI6A 4H0VB 3OYEA 2GMHA 4DJBA 3FGVA 1S10A 3K7RA 4ZHRB 1XHZA 1FDDA 1D9AA 5G0RB 1W7AA 1Q82T 1RYRA 4DR5J 1M5KC 1CXQA 2WB1D 1CPZA 2AQ4A 3K0JA 3OYLA 3K9JA 4AHCA 5D8HB 2ALZA 3UIQA 3PW7A 4R5PB 2COLA 1P1TA 3H98A 5DO2A 4B17A 3D1HA 4IO1A 4J8FA 3CM5A 5JLFA 3IN5A 1B9DA 3RG6A 4KHPK 1RBRA 3C14A 4H4OA 3EGVA 3QNWB 2WVEA 1O8BA 4JI0J 4U67L 1QSSA 3UQSA 5IWAF 3AH6A 3TOQA 3TWZA 2B5JB 3MPDA 5AJ3F 2WBNA 4O3PA 3FFKB 3MM8B 2YV0X 4QR1A 2MKHA 2D4WA 4N76A 4ZP9A 3WIUA 4NB4A 3KTQA 3IAS9 5B7WA 3M6XA 3HHDA 1C1CA 4CJUA 3DRRA 2VJVA 1G6BA 5BYRA 2YPYA 3ZSRA 1O13A 2IM1A 2R7XA 4KTQA 4OJ1A 4OV6A 3OL8A 3DXBA 4JKDA 4Y2MA 4BCAA 4JI5F 3I6PA 3SSRA 3THXB 4B1UB 4WCEQ 3FZHA 3JTNA 4JV1A 3P4UB 4FF1A 3G96A 1RHUB 1EX4A 4ED8A 1Q53A 3CETA 1N36K 5L1JA 4MIAA 2BRLA 3CC4N 3I32A 2Z1GA 1VLOA 2HWIA 3CD5A 5LMNK 4CT9A 2J7WA 3KWMA 1SIWB 4CGIA 4RNHA 2MSTA 4AM7A 2Q66A 4ETZA 3CIPA 4BRCA 2WTFA 4IFYB 1CJUB 5LSRA 4OL8A 4LBPA 1LK5A 4MO5A 4ZPWR 2L3MA 2O8EA 5CE3A 2ZJRL 2Q31A 1CLQA 3I5BA 3CDWA 4OYXA 5KQ8A 3IR6B 1F1BB 3WXKA 2YPZA 2HWHA 4DFPA 3VAJA 1VK8A 4GV6A 1YF5L 5BPLA 2JVOA 2KRBA 3IXQA 1VQ9N 1ZM2A 1F2HA 3UD4P 3L09A 3M1VB 3ISND 1SL2A 4YY3J 3O4WA 4RW4A 5EHHA 3GJTB 1NGAA 1WAFA 1R43A 1WSHA 3G87A 3EKSA 1K6YA 3A0IX 3KJFB 3MM8A 4CGJA 1CS4A 2P9LA 4ILJA 2OPRA 1MROA 2CPEA 4CM2A 1VOMA 5ITHA 1P9QC 4C98A 3O8MA 1X0FA 4E7LA 1TVRA 1LAWA 5BR8J 3NH2A 4J7CA 3CVKA 3VAFA 4E89A 3LP0A 2Q3PA 4EBCA 3AVKA 4MMOA 1VQ7N 2H48B 1F3FA 4DV7F 2DHGA 3RU0A 1CG2A 3QO9B 1X0PA 5K8MA 2E1MC 2U2FA 2YJFA 1YI2N 2WVDA 2F9TA 2JH3A 3BKFA 2FVQA 1G99A 4O0IA 2ACYA 4CEQA 5LOQA 3MWTA 2P5GA 3DGPA 3F73A 1S7IA 2L08A 1SC6A 4CIFA 1RT2B 2QSWA 3J81j 2P9SA 3OXLA 3KK7A 2YWGA 1RBUA 4NCBA 3RJMB 3SV3A 4DQSA 3O44A 5F0WA 2J0WA 3DM2A 3S41A 1VFJA 3RZAA 4FSVA 4FK0A 1U48A 4JI5K 3NL0A 1X3NA 4KGVB 3QBWA 3O5BA 4P2MA 2YX7A 4HDGA 5F8NA 3D7SB 1WDDA 1SKSA 1VCTA 1YITN 1WEZA 3O8WA 4MK8A 1MWZA 4KO0B 2CQDA 3C2PA 2IRYA 4Y0FA 1HQUA 1VSJA 2H3GX 3UVJA 4DR1J 2DNZA 1P9YA 2P9UB 1SL1A 3H2VE 2FB0A 1YUWA 1UZHA 1NDPA 4JI3J 3J7AN 1O0PA 2MZTA 2B9YA 1BG3A 4DR5K 3JAMU 3I8BA 4LT6A 2YCHA 4B9NA 3GFYA 4JKEA 5I42B 4FW1A 3K57A 1VHIA 1ZBSA 2RQCA 5AE1A 3A3PB 3J7YU 4EI2A 1YVNA 4P74A 1JLGB 4TQRA 2KHOA 1VQNS 1WSEA 2I7PA 4RW7A 4ILGB 1KN6A 2KJVA 2QA4N 4DV6J 4UW2A 3HVWA 4IOCQ 4LQ9A 2ZUGA 3LTOA 3IRXB 3BJYA 2G8UA 3LAKA 4O44B 5EX3A 4FF3A 1XMOJ 3OR1A 1VK0A 2XY8A 3W64A 3LZJA 4RW7B 2HB5A 3T9ZA 5DZ6A 1T3OA 3HPHA 3PIPQ 3ZZRA 4W5NA 5CAAA 4WFBL 5BREA 4JI1K 1EZZB 2DYAA 5HMXA 3LM2A 5D77A 4DSJA 5ADXH 1W2BM 2XLIA 4OHYA 5KGXA 1QJHA 4CD3A 3QDKA 4XO0A 4NI2A 4WFNL 3I82A 3K58A 1X5TA 1RHQB 3B78A 3GBTA 1NU0A 4A4JA 3RRGA 1JJ2R 1SUQA 4Q7AA 5HMZA 4WFYA 3MPUB 2CPZA 1H73A 5IZHA 2E29A 2A18A 2J7UA 3UN2A 2B56A 3MCMA 2HQFA 3NAHA 2GQCA 3J81O 3G10A 1UJ5A 3H4BA 4KE5A 4ILRA 2QA4S 1WSVA 3QAUA 1RUSA 1UZDA 3R27A 3LGNA 4ILMA 4HUFA 1F60B 4DFMA 3PRBA 1U1PA 1CJVA 1VQPN 5FRNA 4TLQA 1VRTA 2DXEA 3OHRA 1MMNA 3EGNA 3TZXA 3M9NB 4CZMA 5LY3A 4I1TA 2YNIA 2VPWB 4MKVA 3BQ0A 3B6OA 3C6TA 1F9FA 4O4RA 2ZH1A 4JKFA 1YTAA 1Q82O 3DU6A 2W2NP 3OLAA 3VGVA 1IO2A 4HWIA 3Q22A 3K8WA 2FC0A 2FSNA 2ZDOA 2Y8WA 2MEWA 4XK8C 4MIWA 3X1LB 4EFAC 2QLJB 3AVMA 4LY7A 2BKPA 4PPZA 4ZIWA 3KJNB 3RGIA 5AXNA 1HPZA 1T9XA 4NCAA 4HLBA 2P9IA 5HQ8A 3CC4S 4URQU 4B3SJ 2B9EA 4DV2K 4K25A 2X51A 1Q8IA 4QWDA 3W3DA 4EYIB 3MM7A 2BTFA 3O9SA 2AYBA 1ZBTA 4L75A 4WFAL 4ECYA 4ZCIA 3BGLA 2HK3A 2IPOB 3R5AA 2MJNA 7FDRA 4B3TK 1Q18A 4KIAA 2ITMA 2NUBA 2BVZA 2E9RX 1HX1A 2UVVA 2QWNA 4X64J 4UOCA 4Y1DA 3IAYA 4X65F 1JNRB 4PRFA 2Q36A 3KDOA 4E7HA 3NFAA 4RCHA 4CO5A 3UE5A 2LEBA 2HZCA 5E3PA 1U02A 4CZJA 4FK4A 4KBOA 4HYKA 1N5VA 3G6YA 2YHXA 4KI4A 2Z0GA 3GMGA 2J9DE 4NXNK 4F26A 3QGIA 4CZEA 2C2RA 2HRYA 2R9LA 1QAJA 4O23A 3MUVP 3M2VA 2FBYA 3KJVB 4ECZA 3DLKB 1R3NA 2FJDB 1C1AA 4CHQA 3ZX0A 4BC5A 1Q8KA 3C15A 1AW0A 3VQ5A 1VQMS 4ID5B 4F25A 1VQ7S 3OTDA 5AQOA 4JI5J 1GLDG 4OGCA 1ZYQA 3ETMA 3LDSA 1FKOB 2JRSA 5KRSA 2IVFB 1S9GB 1RBAA 3FMWA 2PYJA 5B0AA 4BRDA 4A5AA 5AQRA 1BLUA 3IG1A 5EGYA 3D0HE 2ZM6J 2Y1JA 3W2WA 3ZZTA 1B99A 3GB0A 4CF1A 2FC8A 2CQGA 1TKXB 4OI6A 3QERA 4QW9A 1RHRB 3DGPB 2KB2A 1FFGB 1S0MA 5K20B 4IKFA 2A1BA 1RT1B 2DHSA 4CHNA 2H5JB 2VWJA 4ZHRA 3DFEA 3HBTA 1Y64A 3OSNA 1HW9A 1RSCA 1HLWA 4IQMA 3KYLA 2HBZB 3GIJA 3M2RB 2ZJPL 1KFDA 3V6DA 2R7OA 3SI8A 4IFYA 2O4IA 3VQDA 5LJVA 3P3DA 1RBSA 3TU5A 4BE1A 3U27A 4JV2A 2ZZMA 2CDQA 5AQPA 1N0UA 2FD2A 1KHVA 1ZZNA 2UXBJ 2C28A 2A1RA 1NPKA 3VQPA 1L5UA 5KFUA 1CSJA 2R42A 2A6OA 1KTQA 2W2MP 2DVIA 2B6AA 1HNZK 3S01A 4H0YB 2G0CA 2A42A 3QLHA 2IVOA 1T6CA 2C2OB 3CTRA 4LRCA 4KHYA 1K8KB 3BPSP 3CT9A 3DYAB 4JKGA 4CZFA 4ILHA 3HZGA 3LH2S 4FS1A 2VFTA 1NNEA 4AQYK 3GYXB 4X66J 3TR5A 1HPZB 4Z4HA 3FRZA 4KH1B 4CEFA 1U6ZA 1E6YA 3SAFA 1KFSA 3EDRB 1RAOA 1CJTA 2QWQA 3AAPA 4NZ7A 1VQNN 2IDLA 3L6QA 4ZVSB 1NZAA 2B3TB 3LWLA 1IR2A 3CC2S 1LOTB 1F9HA 2OMLA 3MI7X 4H0TB 4EHUA 1RDWX 2HZAA 5F8JA 1RACB 1S9EB 4UZBA 4YOEA 3HSCA 2LU2A 4Z94A 3SNNA 2QN6B 4RWTA 2XO6A 1N36F 1LWXA 3CDEA 4JK8A 1M90T 3DI6A 2NQPA 4A8MP 4A46A 3TJ8A 4C8ZA 4ITSA 4I6YA 2H3EB 3V9UA 1YZ6A 1D8ZA 4TKTA 1BWEA 2QEXN 1AB8A 2PBDA 4QYZJ 3OTBA 3V4MA 2O8DB 3BY5A 2OELA 4G1QA 3RW7A 3HD2A 4YP3A 1N54B 4NLDA 2QIFA 4LF9F 3CFOA 3G82A 2V8DA 4EGLA 2LXUA 3DGVA 2G2OA 3MDFA 3S8SA 4JUZA 1KD1O 1T02A 4JI7J 4Z2XA 5IV3A 3DLKA 1KD1T 2UVRA 1EJ7L 4JI4K 2HVHA 2VOPA 2NXNA 3ZSVA 3W2VA 2LDYA 4QJVA 2ASOA 3ZSYA 4BRHA 3R5CA 4IFVB 1HWKA 5ETOA 3RB0A 1YTUA 4DR3J 4CHPA 3TA0A 1Y3KA 3GJSB 3AB4B 1KQKA 3QRQA 1U2FA 1RDUA 4IZ9A 4IOAL 1ACMB 3CIZA 2B51A 1QQNA 3H1QA 1S9FA 1RILA 4DV4F 4B1YB 2N4DA 3LPUA 2B7BB 4RW8B 5HBMA 2Z57B 3QMLA 4NE9C 4WK3A 2UV8A 3TA2A 2M8DB 2F4FA 2HGNA 2ZZNA 3V1RA 3CCEN 2BX6A 1GH8A 1HR0K 1P1LA 3HHLD 3PYFA 4RBTA 3D45A 4Y34A 2R4FA 3TTFA 5F3TA 3UE2A 1PILA 4CHZA 3CF5Q 3TRGA 1KP6A 4GVBA 4PQUB 1MLAA 1U2RA 2M2BA 4PAAA 2BJ9A 2HNDA 3O4NA 2PT0A 4FKXA 5M1OA 4PKIA 1S6QA 1M0SA 1S0NA 5EOYA 1H2UX 3MEDA 3DOLB 4Y2KA 1KAXA 3MXIA 4BG9A 1M1KT 1R0BG 1YSJA 2Y0BB 3G8TA 3OTOK 3P4IA 2NUUG 2D3O1 4NA3A 1T03B 5F3ZA 3SBGA 1XR7A 3CW2C 3HT0A 3SJHA 1VI7A 3DC2A 4CIEA 4LMZA 4ZCKA 3FCHA 3TPQA 1X60A 5GAEI 2NRWA 4YOVA 4C9DA 3ENHA 5E3RA 1R8CA 1T05B 4H4KA 4YOUA 1EHWA 1I3OB 2IJRA 3BKTA 3WXLA 1S6OA 2HNZB 4CJVA 2QSFA 3D5MA 5DM7L 2MKCA 3SFUA 4I4BA 2EFOA 4QQBA 3MM6B 2CPYA 4ZITA 4QPTA 3NMUA 3LDQA 1JIHA 3QSYB 1S9EA 2CQ1A 4OZ1A 2HMIB 2XZTB 5E3QA 1NDKA 4CGGA 3S3MA 5KFEA 1A5XA 2F8EX 2XMWA 1HWIA 3FVYA 3P31A 5A2QY 3PY8A 3R2CJ 3HHLB 3S7RA 4U7BA 4LIWA 3UPFA 3RR8A 1K1SA 3NGDA 2KVQE 4GC6A 3BN7A 2QLWA 3KLEB 5CZXA 3KIOA 3EE8A 3T1HK 3CJKA 1CZAN 4Q2LA 2DD8S 2YWWA 3UR3C 3CJ9A 1AUDA 2GWJA 3IWXA 3D3CJ 2XBPA 4ZP8A 2MZQA 1B3TA 4AT1B 4TY8B 2NXEA 5I4MA 5ADZA 4ZOSA 4BRNA 3C16B 2QKKA 2YKMB 4AE5A 1KLNA 2CVEA 4CD1A 2YKOA 2VODA 4DV1K 1YI2S 1OPIA 4MKYA 1YJNN 3BGUA 4JKAA 4KHQA 3IDHA 2QLXA 3Q8YA 1RJJA 4NYOA 4AH9A 1MA9B 3EPIA 1BY9A 4LF2A 3CDBA 3CCZA 1ZAWA 1BWVA 4FZZA 3ID6A 1T3NA 2VG7B 1XR6A 1PAEX 3HHKA 5GADU 1DGKN 3M6UA 2VV5A 2MHNA 4OI2A 3JXOA 2E6MA 4NO7A 4PYDA 2C2EA 4ISFA 1HYSB 4U6PA 3RW6A 1S1XA 4GKKJ 1AYEA 2BQ3A 2RRBA 2VFVA 5EN1A 4OI0A 1QQCA 2VA2A 2K3IA 3HF5A 5KT5A 2XO7A 3UB5A 1FW6A 3MN6A 2QA2A 1HBUB 3W9IA 2H51B 4U96A 1V3ZA 2A10A 2FUG9 5EX0A 5KOXA 3P5TL 2RSQA 3DOKA 2J6TA 2ZFHA 3ET6B 4R8UA 5JS2A 5LSOA 1NKCA 1NJIO 5D0GA 4L6V3 1QSYA 2UXDF 1HNXJ 2ZM6K 1PYSB 3ZT1A 3R8EA 3KOAA 4F4AA 2YWEA 4CT8A 1RWUA 1U2VA 4PKGA 3SCXA 3QEIA 1SQGA 4OI3A 5KFCA 3TAFA 4G3IA 1BWFO 3ITHB 2E4LA 3VWSA 5H9FJ 4P6QA 1T9YA 3G8QA 4CGFA 1NAQA 2U1AA 1NLKL 1TGOA 2V2VA 3ULEB 3AJ1A 2OPSA 4B08A 4CK3A 3W9HA 1M5OC 3W0LA 4KFBB 3B54A 3AJ2A 2CJXB 1HBOB 4H4MA 3UD5A 1ITGA 3OVAA 4K59A 2DGOA 2KH9A 2MKYA 2UUAF 2DTUA 4NXNJ 5GIPA 3IC1A 3BB5A 3NXZA 4DSLA 1N8RT 4Z4FA 2O4GA 4FWQA 2AEFA 1TKZA 2D74B 3D0GE 2FZCB 2HNYA 3MMAB 3T69A 3J7ZT 4ES3A 3P83D 2HW3A 2CJBA 3M8RA 3I55N 3PACA 4O5FA 1GX6A 5IC6B 4CJWA 4ZPVR 3OW2M 1BQMB 5KFNA 2FJVA 3VR1A 3M32A 3FZ2A 1EKSA 2OPQB 3O2IA 2GMLA 1FX4A 4UOHA 3UKRB 5IQQA 2FF3B 3K5NA 3KG0A 3QZ8A 1CXUA 4GW6A 1JXEA 4WFZA 5DMRA 1J9AA 1NK0A 4DR2K 2Y1RI 3A8IA 3HZEA 1RT5B 3DLBA 1M90O 3GTYX 1J27A 1DTTB 5KFJA 1G1XA 3MD3A 4LBIA 4IDHA 1LWEB 4OLAA 2GV1A 2YWHA 3F41A 3A12A 1WNEA 4OV1A 3KJQB 5E33A 4YR2A 2A6AA 5E84A 1IN0A 1N32J 2Z58B 3R6LB 4O55A 1RCOB 3LWMA 3C7NA 1FNOA 1FNMA 2VF3A 3BYRA 4CLTA 4KQZA 1ITPA 1Z2ZA 4KY3A 1YJRA 2H5EA 3FEXB 1T11A 4NYNA 1UWBA 4EK2A 2LLZA 3M6WA 2CNKB 2BGGA 3KG4A 5HJYA 2VQEJ 1H38A 3I55S 3K17A 2P9EA 5CZ1A 3ZZOA 2O67A 2C2MB 4LFCK 3GE9A 2E7VA 2NRXA 5HVFA 4DTOA 2P6TA 4DR4F 5JUMA 4ZIVA 3ASMA 5FPMA 2IC3B 3X3UA 3JYTA 4L3QA 3N6MA 1RDDA 5C42A 3ZX2A 2LQ8A 3MR2A 1SKRA 4FLUA 3HKWA 5GINA 3DYAA 3R6GB 4JKGB 3VENA 3KUHA 5F9LA 3H0PA 4DV2F 1NWKA 5EWEA 2V9WA 5DG8A 1SCJB 3MM7B 1FEHA 3GIKA 3GV7B 2OHDA 4QBUA 1U1OA 3OHBA 3OVBA 2VONA 1FO1A 4OYIA 1U0SA 2ZJQL 2EFGA 2IA6A 2W9BB 4I2PB 5CYJA 2K3KA 4H03B 4EO8A 3WXIA 5J1NA 3PXGa 2X6SA 2E66A 3ENAA 3ITHA 1RE1B 2O01C 2D0AA 3JQMA 4WJBA 2HQIA 1S4FA 1N33J 3OYAA 4IOAQ 3WZ0A 3ULEA 4MH8A 3VZHA 3RRKA 3SQGA 2DR9A 4TLRA 3TQEA 3JSBA 2R7QA 2CRLA 3Q24A 2VC1A 2PIIA 1HPMA 3TI0A 5DM6Q 4CBWA 2DFHA 5AZIB 5A6PA 5AQTA 1OVQA 4A8KA 2UXCJ 4BDPA 2GO8A 5AXLA 2FJWA 1QQMA 4F36A 3OTOJ 1CZBA 4QS8A 1D9FA 1TZ0A 1U2CA 2I7NA 1RT3A 1NKBA 3W3SA 3DU5A 3M9MB 2HOEA 4FYXB 1JLAB 2AT1B 3VEVA 4IYQA 3G4SN 4B3TJ 4C1NK 4GKJK 3SSSA 5DRKA 3JS6A 4AILC 4HR2A 3M8PA 2W6LA 5AR0A 4IOBA 4BG8A 2KRRA 3PW0A 2AGOA 3LP1B 5AZJA 3TSQA 3QJJA 2ZVSA 3J7YP 1VIOA 3BZKA 2AYGA 4NI2B 4C7QA 2NR0A 4LFBJ 2FF6A 1NMEB 2FDNA 1BIUA 5BR8F 1ZS6A 1RT7A 2F3JA 4Y00A 3GDQA 4A57A 3NLCA 1FDAA 4DCPB 1XMOK 3V4IA 2QG9B 3MMVA 3DHXA 1SH3A 5CQGA 4PWDA 4P9SA 2B4OA 2DGWA 5J2MB 5CZ2A 4WWSA 3AVNA 3U02A 2H4YB 1WWHA 2ZNZA 4O3OA 2QYGA 4R0JA 3GQCA 2W9BA 3L3UA 3B6PA 1RWXB 2E1RA 3VAKA 3V6JA 2OD4A 4RUAA 1TAUA 4KHSA 4X4TA 4IRKA 5T14A 2UUCF 2PY5A 1R8AA 1FA0A 1WC4A 2JVRA 4X4RA 2XHWA 5M1KA 4DU8A 3C6UA 4BWMA 2RS2A 3ZX3A 2PA8D 1X9SA 1GQEA 4F4KA 2HPUA 2BOAA 2RS8A 2HBJA 2P9KB 2IY5B 3SDEA 3UR0A 2OD6A 4YB7A 1TK8A 3SUQA 4BRLA 2YH0A 4OMFG 2M9KA 2AX1A 5IS2A 2OTJS 4ZPAA 4C4WA 4X4PA 4E98A 2ZH8A 1REVB 2LQ5A 3V9WA 3N6NA 4DL7A 1TL4A 1PIEA 2FHMA 1S1WA 3N5BA 2OIHA 2AJ1A 4LRBA 2LECA 2Q2RA 3SBTA 4K2XA 1YRUA 3AFGA 4BRGA 1X4FA 5AQFA 3E01B 3WHIA 3N5FA 2CPHA 2B9XA 4DBQA 3CDUA 4KH5A 1UFKA 3DRPA 4LH4A 1RCXB 1IM4A 3FBBA 3THPA 1ESVA 3QEWA 1ATNA 4OX8A 3FNNA 5SZTA 2ZH4A 2RUGA 4HVZA 5D4OA 3N4PA 4CGDA 1JL1A 2FZGB 2LEPA 1DEJA 4OYMA 4F3OA 1LWCB 3ZT0A 5HRNA 4ZP7A 4JI2F 4E7JA 3CJ0A 1NSQA 3VEOA 4ZVPB 1U6BA 4A2AA 3BGRB 2X78A 4XH5A 1RTIA 1VSIA 3V81B 4PWWA 4RNNA 1UA0A 1U24A 4ATNA 4X66K 3H25A 3VVTA 1Q5VA 4AUKA 1HNWJ 5MAOA 5DLGA 1BA1A 2WOMA 4DG1B 2BKOA 3PX4A 3SIPB 4HDHA 1FJCA 4BRKA 1DFDA 4DN9A 2AMCB 1LFPA 3VQ4A 3U8XA 3EGZA 1JK9B 2HMIA 1I3AA 4USIA 4NASA 1U09A 1IBMJ 4J9MA 2YWKA 4KB0A 2ABYA 2HVZA 3AVLA 4PL7A 3PCOB 4JK9A 3OLBA 3VTHA 1S57A 5HN0A 3VF4A 1CJKB 2CNLB 5IT9Y 1D1UA 5L9XA 3JS9A 2ZC4A 4FNIA 3W61A 3UNYA 4MTPA 4ERDA 3CQXA 1CVJA 2ZZTA 4KHUA 2DHHA 5CR4A 2GMJA 4A8XA 2DNOA 2X1AA 4QYRA 3MMCB 3CJQA 4F02A 3NEKA 2F5GA 1YVFA 3FK4A 2OGUA 1DQAA 3CCJN 4PPDA 1J5OB 4BE0A 4NWBA 4KPCA 3V5RA 1TKDA 4DL4A 1NH7A 4N8NA 3SQOP 5KT3A 2R2SA 3BF3A 1ATSA 3FQLA 1TKXA 4WFXA 2M5YA 2G4BA 1YIJS 4OPJA 1ASUA 4CK2A 2AX0A 2MQQA 1YITS 1Y3JA 4GVMA 2D3UA 1PKUA 2RQMA 2VG5A 4B9LA 2D41A 2MQNA 3TX0A 5ETSA 4M8LA 3K0SA 1MWQA 3DJCA 4K5RA 4QIVA 4MLEA 3NE6A 4ZTJA 3B8AX 2KYXA 3OXGA 2M52A 2IFXA 2BE2A 4A8YA 4QIWD 4K42A 4FPIA 5JXSA 1HNVA 2N7CA 3IP0A 2ERRA 2XGPA 4DI6A 4DR4J 2ROPA 4PY5A 4MKAA 3C15B 3W1YC 3S1TA 1ZBUA 3CJAA 2DHXA 1SIZA 4LF9K 1H2VZ 5A2QO 2FQQB 1TUVA 4PUOB 2P9PA 3CCLS 2HFOA 2P9GA 3W63A 4Y2IA 4IG0B 4JI6J 1YKWA 4FWNA 3V9ZA 5D3GB 4FZXC 2BJEA 1K8KA 1OVYA 2FLPA 4M94A 4NLCA 1KVBA 3VAMA 2X1BA 5E2QA 1ZPWX 3H2UB 3PVXA 2JEFA 4K4WA 2AKWB 4Y1CA 1RA6A 2QWOA 1KC8T 4YHHJ 4YORA 4UF4A 1NGBA 4IH7A 3EE9A 3OYIA 2PFFB 3DRSA 3JQKA 4TN2A 4EZ6A 3KK3A 3LP0B 3ILJA 3EX7B 2K7KA 4E19A 1UVJA 1TKZB 5DQGA 3H8YA 3OL9A 3DCAA 2XMAA 2V63A 3QGGA 2CJ9A 1YG0A 2IHR1 1D5AA 3FZMA 4I6MA 2YKQA 4CJ3A 2VQFF 3JSMA 1YVUA 1HHQA 2P51A 4H5VA 3MXHP 3JTPA 2LP4A 2B5JA 2CVIA 4I2QB 2DGQA 4W4MA 3GSIA 1R8HA 3IAM9 4NLTA 2XSJA 1AZSA 4QIEA 2DO4A 3QNOA 4CZGA 4FYYB 5FPEA 2Z2MA 2E2OA 2G1DA 4ZVHA 3ILIA 2J6SA 1JCGA 1NB7A 4RW6B 4DV3F 5JVHL 3VHQA 2PEHA 1GLFO 2A41A 3U7JA 3L2VA 1T6DA 2H54B 5GAHU 4DQIA 3R7NB 5KFDA 2V50A 5D4PA 2W2PP 3WNFA 1NSPA 4FJIA 4FVCA 2E7WA 4AL7A 3MTKA 1R0AA 4GC7A 2HFZA 3KFWX 4NZ0A 3CXCM 3ZZZA 4WYLA 2RB7A 2YKPA 4V1Ak 1RQ0A 4RNMA 5KG5A 2NRZA 4CO3A 3TUZC 3TTDA 4CJSA 1IJEB 1UVNA 3FBCA 1KSPA 1RTJA 3KUEA 4LF1A 4CH1A 1HBUA 4YOTA 2QM1A 2HEKA 4DX5A 1VRUB 3M3ZA 3O3GA 3CO0P 3OQ2A 4BR4A 3GU0A 3UVJB 3UNGC 1FRJA 3SQ4A 5KFIA 2RNEA 2AYMA 1J53A 2LQBA 4RWXA 2BMBA 4ED1A 4FPBA 1KBRA 7FD1A 3QFPA 1KVCA 1NCLA 3MPYA 2PA3A 1FRHA 3HPOA 1J5EJ 1FDNA 3SQ2A 2GELA 4GKJJ 4ED5A 2MKSA 1YHQN 2UXDJ 2VBXA 3MN7A 3NF7A 3CCVN 2JEIA 1T94A 2Z1JA 3ADAC 2DH7A 1S6PB 1LWFA 2GUIA 2CDRB 1BOTO 2GBZA 4N7TA 1HI1A 4YOYA 3GLJA 4N5SA 3DI6B 2QC3A 4K4VA 4ZVRB 2ATQA 1PBAA 3T3FA 1GLEG 3J80O 3VQ9A 5BRFA 3DNCA 2WC9A 1T0TV 2DEIA 2G8VA 2ASDA 3MEDB 3CPWM 5F41A 8AT1B 4OYWA 3KLHB 1P27B 2HMPA 1JL2A 3HSZA 2KKHA 1N88A 1Q16B 1UETA 2LEAA 4HHHA 3P5JA 1Y9OA 3PYEA 1J5EF 5AXKA 1X5OA 4JV5J 2A5XA 4B9VA 1TV6A 2R7YA 2M0GB 4JI8J 3PKMA 1WEYA 2YKNB 1Q78A 4OHVA 3CO9A 5KFLA 3D0PA 2VWKA 1VYAA 2RUSA 1LKZA 2VC0A 2W4DA 3VOVA 3AOCA 4IJNA 1CBKA 4K0KK 4JRQA 4ZPTR 2Q6BA 4K8ZA 2DPNA 2KXFA 2CGJA 3AY0A 2DGTA 4OKEA 1OH5A 5IM0A 1JLFA 1WF1A 2JSXA 4OZLA 2DY1A 2EBGA 1N34J 2P9CA 3R5BA 1CS4B 3CD6S 1W0HA 4FYWB 2CGLA 3IGNA 1YJ9N 2LXIA 1I94F 3VQTA 4U7CA 2O8CB 2DISA 2CPIA 3OR2B 4K4UA 2D1CA 2O8DA 1N5YB 2V5HG 2Z8QA 9ATCB 4ANEA 1NK7A 4PG8A 3W5ZA 3NVKA 3I33A 4UOGA 2W42A 4BWJA 4A61A 3HPGA 4QR2A 1SVDA 2OFHX 3CCUN 2UXBK 4MDBA 1JLQA 1WC1A 2AEMA 3HOSA 5BR9A 1OY6A 4WBFA 1NMNA 4A5BA 4NLYA 4X64K 1IWGA 4BC2A 1EETA 1QS4A 1ZC6A 2EW9A 1NJWA 3GONA 2N4CA 4RR5A 4X4NA 3I87A 3MM5A 4L73A 1RWPB 3VEZA 1FKAF 2W25A 2MSSA 3QIPB 2AZ1A 4C3LA 4PEOA 4B3RF 1LW0A 2P9SB 3TUJC 2E1CA 3QEPA 2F8SA 1DRZA 4LFCF 2HRUA 3T1HJ 3D6FB 5T7LB 4DV5K 2X3DA 2QZ8A 3OJSA 3D2FA 2MZJA 2HLTA 3GYNA 4MLHA 4CHYA 1DLOA 4ISEA 3WBZA 1VQ6S 1Q8BA 2R7TA 1H98A 2X74A 1TKTA 3TTCA 3J81Y 2AGPA 1H74A 4U8YA 3J81U 5LJ3Y 3NS5A 4KR0B 3D66A 1TP7A 1A6LA 1TV6B 4JI6F 2V7ZA 4CI0B 3T1YF 3EICA 4FWLA 1X9MA 5DG7A 3O1WA 2IAJA 1X4DA 3W5XA 1IKWA 3F9KA 5D4NA 4JNEA 4F0MA 1NO8A 3GIMA 2BDPA 2UUBK 2VUGA 2MMYA 2OTLS 1UFWA 3AJDA 5F8LA 2YKAA 4BC7A 4JKBA 2HHHK 4I7FB 3G86A 2V7YA 3NGSA 4JI1F 3T6BA 2XY7A 2NLXA 1NKEA 2XULA 2YY3A 5EUHA 1S3XA 2HHHJ 4BDZA 3E3XA 4DUZF 4M5DB 4BREA 2OUGA 2KM8B 2C22A 1V3RA 1T03A 1MMDA 4LFCJ 1JLCA 3VQCA 7AT1B 4FZVA 2K1RB 2P6SA 1IQZA 3AV9A 2P2CB 2VDIA 3ZCMA 4DR7J 1W9HA 2O8FB 1VJQA 3O5TB 1HNXK 3IMXA 1XMQK 1S1VB 3Q8UA 1HKCA 2H9ZA 1NGCA 4RW9A 4DMZA 5KPTA 4AHVA 3HVTA 3DKDA 4L8RB 5JICA 3WEEA 2X3GA 3GG1A 2EFQA 4ZLNA 2R8HA 3BO4A 4ECWA 4YS2A 4QW8A 1T9WA 2EK6A 4OPAA 1Y4ZB 4EEYA 4RUBA 3CMQA 4YB6A 4QPXA 5B0FA 1BUPA 4BRQA 2UUBF 1HJRA 3QRRA 3T6JA 1VSEA 1EAYC 1YX2A 4Q43A 4LFAF 2XY6A 2C1EB 4H0PA 3KZBA 2D0OA 3Q7CA 2VG5B 1NEEA 1HA1A 4LF9J 1IG9A 1A5VA 2HG4A 2FIUA 1I94J 3NBPB 4BR2A 1NJYA 4GMJB 1JLEB 3LDLA 1FKPB 2XEXA 2RPIA 2E44A 2OPQA 3F0NA 3I8DA 1R27B 4LSLB 2UU9F 1VAZA 2D1KA 3VQ8A 3LGHA 1EQYA 4DV5F 3NNCA 1S6UA 3NGKA 3MXJA 3G2XA 1XI1A 1RT4B 2CKWA 4RW4B 2C42A 3TEGA 2X1FA 4B3RK 4RUHA 4LR7A 4JB8B 1FRIA 2MDAA 2AF6A 2P8IA 1DHMA 2ZITA 2YNHB 2YXLA 2NXJA 2RHQB 1JLBA 4KPYA 1JJHA 3VGSA 3OYGA 3PYGA 4USWA 3V1OA 4ICLB 4ZKAA 1N34K 1C0FA 3HVAA 4DV2J 3MCOA 5LJ5Y 1UJ4A 1YXQA 2J8SA 4D3GA 5IT4A 3OYFA 5KFXA 1UWBB 3PR4A 4FYVB 4KFBA 1I1GA 3CE8A 4Q2MA 2O66A 2M70A 2QT7A 3H20A 3ZSOA 1QDUB 3HSTB 3Q0AA 1JCEA 5H9FK 2VU5A 4AD6A 2MQPA 1VQSA 4GRSA 3IM8A 4JOUA 2VD3A 2RF2B 4KHPF 4FJ7A 3DLHA 4LF7K 3FZLA 1C0MA 5SUHA 3GYGA 3HVTB 4DSFA 1NSKL 2FC9A 1KAZA 1E6YB 1WACA 2CG4A 3A13A 3DLJA 2IMOA 5F8IA 4FLXA 2J76E 1Q9XA 2V4JB 2OSRA 2DITA 6FDRA 2UXBF 3RBXA 5ETLA 4BRFA 1RT5A 4RO0A 2Y8YA 5DZ7A 4CJ4A 1UAWA 2DNLA 4RZRA 1WORA 1YK9A 3L2UA 3FC9A 4ELUA 4C3KA 3IUCA 3L2QA 3VCDA 4LF5K 2RH3A 3LDNA 1S1VA 8ATCB 2B6AB 2UVUA 1RP5A 1VBZA 1IBKK 2W24A 3HL8A 3GR1A 1J5EK 3WXMB 1U25A 1S79A 5IT9O 2B9WA 1K0VA 3EMTA 4V19S 3KK1A 2VG6B 2RU9A 2DEJA 2ZUAA 3BKUA 3ILLA 3HKZD 3BF4A 4XIUA 5AQVA 4BGAA 4CDIA 3F9MA 1NK6A 3HX9A 3O3LA 5BN9A 2D0BA 3AA4A 4ID1A 1P90A 1NB2A 1SQKA 5KQDA 4DR1K 3MM9B 2FTRA 4B3MJ 3HK2A 4AL6A 4FWMA 2AJQA 1HARA 3K5LA 2M8HA 2DFFA 2HKEA 4HTJA 2M3DA 4M5NA 3G9CA 1JB0C 4O3NA 3T9NA 4CK1A 4DG1A 5IT9U 4X2BA 1IBLJ 5CH7B 4H54A 3LM9A 3VEXA 5BRHA 2ZDPA 4WIIA 1JLGA 2I6WA 3V9XA 4J2DA 2CQHA 2FJEB 3L0QA 5AQLA 3ILOA 3ZSWA 3D2FB 5KG7A 4NCGB 1BD6A 1Y5LB 3MMJA 2N3OA 2YHYA 2HFSA 3KLHA 4TQSA 3R5DA 1Z25A 4ZDNA 4P71A 4CNZA 3L7UA 3KWIA 5FJ4A 4C11A 4B1XB 4B8AB 4FF2A 1BCMA 3M30B 5L1IA 4OKJA 4OLBA 2EK1A 3D6TB 3GILA 1J54A 3DXMA 3CJCA 5SWMA 1HMVB 3MF5A 2Q1LA 1XJWB 4IR9A 2XZDB 1GLBG 5A0YA 3J7AP 4JK7A 5HJXA 1R8BA 2FZKB 2PGCA 2ZHOA 2V51B 2I5JB 1T05A 3MEGB 2Z1IA 4HUGA 5IXUA 3JQJA 3S3OA 4DV0K 2CQ4A 4M5GA 2W8KA 3BBFA 4K0KF 4RTFD 5A0YB 3AVJA 1QD1A 3CJ4A 5TKWA 2E2QA 3CC7N 4ZMMA 1HBMB 2RN2A 2OEMA 5AQKA 3RB3A 3M8QB 5F8HA 1GXUA 3DOMB 2OJ3A 4DLGA 3BEXA 1A0OB 4DPUA 4FP9A 1L3UA 1WHVA 3Q89A 1KONA 1I94K 3OYCA 1VIXA 3JAMY 2Z56B 1LK7A 2XNQA 3M05A 1QM9A 4M1KA 4F50A 3VERA 1RWNB 2KW4A 4KTWA 1FJGJ 5AQMA 5ADXA 1H7WA 2EWHA 2PEBA 3IRXA 1NJZA 4RW8A 5HBMB 3E9LA 1WOSA 2MHEA 1FRMA 2F7TA 2DR8A 5AE3A 1WOOA 3CJTA 3CCRS 2V8GA 3TABA 3E9PA 2AV5A 2PFUA 4A8QA 3KD1E 3A5LC 1FRKA 3SQ0A 3K89A 2NXUA 3ENVA 3MM5B 3ZSQA 2HYIB 4KC5A 3PYDA 5F8GA 4ZS6A 4CECA 3L3CA 1AROP 1VISA 3Q8SB 1YBAA 4UT4A 4O8UA 2BANB 2G2YA 2DTJA 1BO5O 4Q0BA 2XG8A 2QO3A 3MOZA 2B4UA 2ZWPA 4JI4F 2H5IB 4ILLA 3GJQB 5KPZA 3MM9A 4PYAA 2BUPA 3VMFB 3G6EN 2AD9A 2DNNA 1XWLA 4LFAJ 3ETOA 1VDHA 3KK1B 5E7OB 4DTJA 4GO7X 3VF0B 3G6XA 4FLVA 1B4SA 1H6KX 1KEKA 5A8KA 5LSLA 2K8GA 1NGEA 3Q7BA 3MHYA 4QIFA 2ZF5O 3BDPA 1V9OA 5CYQA 3N28A 1HBMA 1T9UA 1UEUA 2R2RA 1DJ0A 1MROB 1S6PA 2DY9A 2OAUA 1Y11A 4TU8A 5C2FA 3Q8VA 2GJ2A 5DGBA 1HNZJ 3B8HA 4WQ4C 2V4JA 3W2VB 2P5OA 4G6VB 2W9CB 5KAKA 4QCLA 2C2KB 1HLUA 4PR6A 3NF8A 2FYXA 4DTMA 4IQXA 4LF6J 1UOCA 1X31C 4TY9A 2JHEA 3AOAA 1ZETA 4KYZA 3SPYA 3CCLN 4FOIA 2V34A 5LJWA 2HHHF 2DKOB 2F65A 3PJWA 4IO9L 4QWBA 1V4SA 4BRIA 2D0CA 3FFIB 2WUSA 1CQMA 4PKDB 5KOWA 1TFWA 1FHTA 2QK9A 2R8GA 3GSDA 4KV8A 1N0VC 3DLLL 2PMWA 2KO1A 5LMNJ 3A5MC 2XS7A 2UZAA 2OCEA 3DRPB 5C0YA 4S0MA 1X7VA 1WG1A 4F2SA 1F3VA 4M3ZA 4C0BA 3G8SA 1OJ4A 1MMLA 5AQWA 1P8GA 1CULA 4HTUA 4CF8A 3C3LA 2HHTA 1FESA 2V2QA 2EC2A 3VQEA 5M2UA 3U1MA 1MW7A 1TUYA 4OJRA 4QWEA 3NOCA 4X4SA 4YY3K 3RUBL 1U1RA 1JXVA 4KH0B 3TP2A 4LRDA 1DARA 2G0JA 4GMKA 2KFNA 5F2RA 2G8FA 2ZBCA 1X4GA 2IMWP 4UY8O 4FS2A 3SZ2A 3CCRN 2HS0A 2W01A 3MGJA 5M2RA 3AVFA 1VBKA 1H1VA 5AQGA 2Y9HA 3NRBA 3NOGA 2MQOA 3WIVA 1URRA 4PG7A 2Q97A 4NRTA 1IUJA 4OJHA 4HI2A 3GG0A 1IBLF 3BR8A 4FN5A 3LL3A 3H3NO 5GADI 2YVSA 3IBFB 4KV8B 2ZWHA 4B3MF 1K44A 3U9ZA 3QT7A 3R3LA 3CJRA 3G6VA 1JXBA 5KFQA 1F5CA 3RAQA 2YI1A 4X65K 4B3SK 1GMWA 2HZVA 2GHPA 3CC7S 3H2LA 5MLCV 4FF4A 2RQ4A 3R8YA 2ZH5A 5HL7L 3MECB 2LXFA 3C66A 2MY7A 3Q23A 4WZMA 2LCWA 4IDKB 2X6NA 3BGFA 4HACA 5KFTA 1RKJA 1L3VA 1NM2A 4YR3A 2E1YA 1MNEA 4WYWA 4GKKK 4LF8K 3HOTA 3ID8A 4URGA 2KZMA 4E7KA 1PYOB 5H1SV 2WAQD 2ZJPQ 2V68A 3FKBA 5H9EJ 4JS4A 1GXLA 2MKJA 2GX9A 3NP5A 4URSA 2AJ4A 2GX8A 3HHEA 1HRHA 2KQ2A 1PJ7A 2NRTA 3BEGB 3C6HA 5HO4A 1HWUA 4JS5A 2JWNA 2DHAA 4WQ5A 1RDAA 3ZSXA 3C14B 2BE7D 3HFVA 4GY2B 3QT5A 1HBOA 2P9LB 5IV4A 3PIOQ 4OPKA 4OYOA 1FXLA 3TO8A 5FIIA 3KLFB 2HQDA 4K8RA 3KD5E 3F2KA 4TU9A 1U04A 1YJUA 1U1MA 2VBWA 4C8NA 3DLGB 1DQ8A 4DSEA 4CJLA 2CAJA 1K9MT 5J2NA 3EYZA 3U3YA 5KT6A 1RTIB 3GCXP 3D1OA 4LF7J 4PWDB 1DKGD 3HT3A 3POTB 4R79A 4FNHA 2CQBA 5LXYA 5AT1B 3WDOA 2B7CB 1IG8A 2FVSA 4Q8FA 3PW4A 1S9GA 1NK9A 2HAFA 3PFOA 2CFXA 1VGYA 1FFWB 4LJMA 2XLJA 5L8RC 2FSKA 1QUVA 3ZZUA 4YFUA 2F8HA 2XYPB 1K47A 1R0CB 3C6TB 1XIQA 3L4BC 4ER8A 3CCVS 3UDEA 2F4VK 4E7IA 4NXMJ 2GIRA 1KVKA 2XSFA 3VGLA 4DV5J 3D54A 1X4BA 4FK2A 1CC7A 4W5OA 4BRPA 4LF6K 3HSJA 4Y6IA 5A76A 1HQUB 4E1JA 3VGUA <