1J5OA

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j5oA05
4HUFA 4DTOA 4KV8A 3ZSZA 1NJYA 2IGIA 3KNAA 1JL2A 3AA4A 3ZSQA 4CF0A 4DQIA 5KFPA 4CEOA 1CXQA 4IG3A 3CVKA 3P83D 1RILA 3KLVA 4YNQA 4CK3A 1S9EB 1RNHA 5KFNA 3WNEA 5KT7A 2W9AA 4ED7A 3SI6A 1KLNA 2VWJA 5L1LA 1HNIA 3D45A 2HVIA 4ZPCA 2B43A 4NLGA 3M9NB 3FRZA 3UDLA 4F4YA 2E9TA 4CJ4A 4KTQA 1QAIA 4GW6A 2HNDA 4DTRA 3T19A 1R0AB 3ALYA 4CFCA 3OY9A 3K5NA 4DFMA 1HYSB 1SKWA 1HQUA 3RBEA 4O3PA 1CLQA 4I2PB 1RTJA 2OPQB 5SWMA 3AVJA 1HARA 5HLFA 3I5AA 4LH5A 3CFPA 4K4XA 5KFHA 2BANB 3LP0A 1HQEA 4E7IA 5KT6A 1J5OB 1Z26A 5J1EB 5SZTA 1JXLA 1KTQA 2B6AB 4FJHA 3D28A 2F96A 3NBPB 3SFGA 4FK0A 2YNHB 1G15A 1TKXB 3OYCA 2BQUA 1JLCB 4CE9A 4ELVA 3TQ1A 3IG1B 1RT1B 3P1GA 3RBDA 3K5MA 3CJ3A 4G1QB 4GMJB 3UIQA 1S6PA 3AA2A 4XPEA 4CEEA 2D41A 4RG8A 1L3VA 4I2PA 5KFUA 2I5JB 4KHRA 1X9WA 3GV5B 3VQ6A 5KFSA 3NGYA 3DLKA 4BE1A 1U47A 2ITGA 4FW1A 5C24A 2QE5A 4AHVA 4PUOB 4OKEA 3DMJB 2HHSA 1W9HA 2P5OA 3M8SA 4DU3A 4QW9A 4K4UA 2V9WA 2BANA 3LP0B 4DTMA 2EHGA 4WXOA 1J5OA 1S6QA 3V81B 1S6PB 2RKIA 4ECYA 5KT5A 4FJIA 2IS3A 5KFVA 4W5NA 3DM2B 5CYQB 2YKNB 4AILC 4KI6A 4H54A 2AGPA 3IG1A 2X6NA 4RW6B 3MR5A 4DQSA 4ZVEA 1S1XA 4BWJA 2BE2B 3TR8A 3TAGA 4CFDA 5FRMA 1MU2A 2HW3A 1VRUB 4DS4A 2Y1JA 4Q0BA 1TVRB 2IM2A 4WYWA 4HVJA 1NK6A 4ZVHA 5E41A 4KO0A 2F8SA 4B9NA 1JX4A 3V81A 2IM1A 1SH3A 5KFCA 3OHAA 2YKNA 1IG9A 1D9FA 2ILZA 2OZMA 4FJXA 4C8LA 3FDSA 3DOLB 1IKWA 3OYBA 4FLWA 1TL1A 3Q8SB 1BI4B 4KFBB 4CFAA 1LWCB 4J9NA 4PWDA 3CJ0A 3QETA 3KLEB 3TAMB 2XRIA 3QZ8A 4URQU 3DLEB 1RTDB 5KRTA 4J9KA 3BREA 3IN5A 4R0EA 2ATLA 1DTTB 5L1IA 3AO3A 1WAJA 3I0SA 4ZTJA 1EX4A 4EZ6A 3H98A 2XGQA 1S97A 3M8PB 1MMLA 3VQ9A 4CEDA 5CYMB 2FLPA 2WONB 3HM9A 4IH5A 2XCPA 3TARA 5J2MA 3IS9A 1FK9A 5FDLB 3QZ7A 4DQQA 2IMWP 4FCYA 1HMVA 5I42B 4ZP7A 2DTUA 1DTQA 1ZETA 4OPKA 5KG6A 4TQRA 1VSIA 2D0CA 1RCHA 2HHTA 3QO9B 5HRRA 4KKOA 1JLGA 2HNZA 3DYAA 4ED1A 1ZBUA 3OLAA 4IDKA 4NYFA 2YNGA 4B9TA 1IKVB 2AGQA 3Q8RB 1Z4UA 3PX0A 1QAJA 1QHTA 2IOCA 4FXDA 4DU1A 1SKRA 2XWYA 1NKCA 2WONA 4LD0A 2R8HA 4JV0A 4ZP8A 3V4IB 1J53A 3C95A 3ZT2A 5L1KA 1BQNA 1DTTA 1JLFA 3GIIA 1S1WB 4J2BA 1X1PA 3AA3A 3AO4A 1VSLA 3NF7A 4E89A 3MXIA 2QV6A 1U4BA 2VG6A 1S9EA 3NGZA 1JKHB 4JRQA 4O3NA 5JUMA 4CJTA 3ZSRA 1S1TB 4ZMMA 1NKBA 4TN2A 2W9BA 3GIJA 3B6PA 4RW8A 3IAYA 2E4LA 3CM6A 3TANA 3RAQA 1C1CA 4Q8FA 4CHZA 4ED8A 3DI6B 1R0AA 1HYSA 4DL4A 3PR4A 3LALA 2BQRA 2VG5A 4CJKA 3ZT4A 5F8IA 4XO0A 5J2PA 4KPYA 3LAKA 5DGBA 4QPXA 3KIOA 5DQHA 2C2RA 3S9HA 3QNOA 2W42A 3SQ1A 5KG7A 3VQPA 1T05A 3OJSA 4I7FA 1B9DA 1RBVA 3L8BA 1S1WA 1RT5B 4TLRA 4DWIA 4K8ZA 4EO8A 3OJUA 3JYTB 3KLHB 2C22A 4LSLB 3SJJA 2HMIA 4IFVB 4HYKA 4IG0B 4ID5A 2R8KA 4CF1A 1S9FA 4YR3A 2ZKUA 2LSNA 4Z4HA 1X9MA 4KB1A 2E6MA 1HYZA 4IG3B 2E9RX 3QIOA 4J2DA 5D3GA 4EP4A 3NMAA 4J9RA 3PW4A 3Q8QB 5DQIA 4JS4A 1REVA 1ZTTA 2VG5B 1JIHA 2BRLA 1VSEA 2D7SA 3ZSXA 2W8LA 1LAWA 1QUVA 1CZBA 4Z4IA 2WCXA 4B8AB 4E7JA 2G8WA 1ZBLA 4EO6A 2HMIB 3LPTA 3HVRA 3T5JA 4CHOA 3VA3A 3RMDA 4DTUA 1UWBB 2X78A 3PW2A 3L3VA 2WOMA 3CDWA 1FKPB 2RF2B 4MIBA 5F9LA 4NLXA 3MECA 4NZ0A 4CEAA 3HK2A 4M3TA 2DFEA 3K58A 4ECXA 3KKSA 1HYVA 4E7LA 4YMEA 2F8TA 4WFXA 2XHBA 4F2SA 2P5GA 1REVB 4O3QA 4F3TA 3AVIA 2Y1IA 5HRPA 1ZBFA 4CGIA 3EPIA 1LWFB 3QEXA 4Q0BB 1RBTA 3ZSYA 1JLAB 1NJWA 3ITHA 1HQEB 4DG1B 2HB5A 4G1QA 3UR0A 3LPUA 2GBZA 3N6LA 1GX6A 2RN2A 3MEGA 4RNMA 4OPJA 4H4OA 1K1QA 3NBPA 1IM4A 3F73A 1FKPA 2RF2A 2IJNA 3CFOA 4DSIA 4NYZA 1D1UA 5HBMA 3HT3A 3AO5A 1JLQA 2XC9A 2JGUA 5KFFA 3M8QA 5C24B 4O5BA 2KTQA 3EZUA 3NF6A 4AHSA 4FM2A 3MTKA 3C6TA 2XY6A 1FKOB 1Q9XA 4FZZA 1T7PA 4BE2A 2I5JA 3CDUA 4DSEA 3PY8A 3MFIA 4CGGA 1BL3A 4CERA 1F21A 4DSLA 5K14A 2KFZA 3IGNA 4W5RA 4B9UA 2JEIA 5KTQA 1HNVA 4RNOA 4CIGA 4KRFA 5FROA 2Z1JA 1S1UA 4EZ9A 4OKKA 3NDKA 3IGVA 5HBMB 3M8PA 1NK4A 4Y3CA 4YP3A 4KTZA 4DMNA 3NL0A 1TKZA 3M8RA 3S3NA 3V6JA 2JEGA 1L3SA 1U04A 4E3SA 1DTQB 3MFHA 4PQUB 4CIEA 3KHGA 1I6JA 3KLIB 1HPZA 2AX1A 4BWMA 1RYRA 3M8QB 4PY5A 4ZPBA 3OVNA 3KMSA 3KK2B 3L2VA 2YHBA 3SUOA 1RYSA 4M3YA 3RB6A 2J6UA 3KD1E 2HHQA 4DL7A 3GQCA 3T5LA 3V1RA 3H4DA 1VRTA 1C1AA 4U7CA 1ASVA 1EKEA 5DQGA 1KVCA 2XI3A 4RU9A 1A5VA 3QIDA 2HHXA 5KFJA 3M9OB 3QEPA 4QCLA 3V1QA 4FZYA 2IA6A 4KHWA 3H4BA 3AVHA 3DLEA 1RDDA 3VQQA 1S1VB 1TK5A 3OLBA 4MFBB 2BR0A 4DFJA 4J9QA 5KFIA 1ITGA 2WB4A 4KHUA 1B92A 1WSGA 4DSJA 3K59A 3MXJA 4I9LA 5HP1B 3MR3A 4OGCA 2PYJA 3AO1A 1QQCA 4FZXC 4DSKA 2P51A 4TY8B 2VA3A 4YQWA 4WXWA 3PVXA 4J9SA 1HNIB 4N47A 4IBNA 1NKEA 4NLUA 3AO2A 3V6DA 2B5JA 4ZPDA 3NCIA 3HVWA 5FDLA 4URSA 1S1VA 4FJKA 1RT5A 2YHAA 1QE1A 4EBCA 2OA8A 3C6UA 4DL3A 4IQXA 1CSJA 3CG7A 2IC3A 4NLDA 4MH8A 3EZ5A 2D5RA 4N76A 4KREA 5DLGA 5C42B 3KHRA 1IO2A 4MFBA 3HKWA 2D3ZA 1N48A 3DLHA 3KK3A 4ECTA 2D0AA 4CF8A 4B9SA 3TAFA 3LP3A 3KLFB 2V0NA 3H5XA 1JLEA 5KFTA 1ZBIA 3OYAA 4ZHRA 3O3GA 4ZPAA 2IM0A 4CJLA 1C1BB 4FJ8A 4W5OA 1RA7A 4LH4A 4NRUA 2WRMA 4CF9A 4F4ZA 4NLOA 5DG8A 4ZP9A 2FBXA 2KFNA 1S1TA 4FJGA 4GVMA 2DPJA 2C2DA 4FJ9A 1GX5A 3WNFA 3LZIA 3VQBA 4R5PA 2W8KA 2WOMB 3K57A 3JSMB 3BQ0A 3HVAA 4RW4B 5KG0A 4AH9A 4IRDA 1VSHA 4FJ5A 3I0RA 1RTHA 4CEFA 4KV8B 3DRRB 3DMJA 2KZMA 4CF2A 5DGAA 1LWFA 4BDYA 3RRHA 3I5CA 4ECSA 3ZT0A 3OL8A 2ILYA 3GIMA 3JYTA 4IKFA 4M3ZA 2IJFA 1LAVA 4Y1DA 3SQ4A 3OYLA 2J6TA 4KAZA 2JLEA 2XY8A 4MKBA 4TQSA 1TKTA 1RTJB 2KQ2A 2OPQA 3OL9A 3JSMA 1XC9A 1KVAA 4F4KA 1JLQB 4LSLA 5DMRA 3RMAA 3H5YA 4IOBA 5HROB 3AVAA 4DU4A 1RTIA 2Q3SA 1B9FA 4IR1A 2FBVA 4YR0A 4R5PB 4HHTA 1N5YB 4NYNA 1JXBA 5CZ1A 1W25A 2J6SA 4ED2A 4CJWA 4KB0A 3B6OA 4Q8EA 1NJXA 2GC8A 2RDJA 3G6XA 1RDRA 3I0RB 4Q43A 1S10A 5J1EA 1NOZA 2FC0A 2IBKA 1YTUA 2B6AA 1YVUA 3OYMA 4R8UB 3DRPB 1KCFA 4ELUA 4QWEA 3VQEA 3VQ7A 2RDIA 1Q9YA 5F8MA 3DOLA 1IKWB 5KFBA 3PX4A 1IKXA 4FM0A 5F8LA 4FJJA 1S49A 1I3AA 1WSIA 5KFKA 1N56A 3VA0A 4B8CA 2ETJA 1KRPA 3O4QA 2HNYB 5KGXA 3DLGA 2E9ZA 3RWUA 4DG1A 1JXEA 4PUOA 2DY4A 1BHLA 5HRSA 2XO7A 3LP2B 4QAGA 4MK8A 4DLGA 2ZE2B 3N6MA 4J2EA 2XCAA 3TAQA 1VSDA 2O5DA 3OL7A 4DTXA 4DQRA 3GYNA 3QEVA 3GV8B 1C0UA 1DLOA 1NK9A 3NHGA 3KHHA 4NLPA 1FK9B 4O3OA 2FVQA 4O4GB 4Z4CA 5KFEA 4X2BA 4RUCA 1EP4B 5I3UB 3BR9A 1SL0A 1IKYA 4ED6A 1TK0A 4BDPA 5EU7A 3V9UA 3PO4A 2R8GA 4ECWA 1KVBA 1WSFA 5CY4A 3BQ1A 4CJEA 3OYNA 1ZTWA 4M94A 4DTNA 5EWGA 3N6NA 1S48A 3C6TB 4K4TA 3TAEA 3L2RA 4DF4A 3PUFA 3P5JA 4KHSA 1U49A 1K1SA 3QIPA 4DEZA 4N5SA 4FLVA 4ED0A 3PW7A 1S9GA 4KO0B 5K14B 5L9XA 3RB4A 4CGHA 4E19A 3L3UA 4FLTA 2HHUA 3LP2A 4Y2CA 3L2WA 2Z1IA 3MEDA 1N6QA 4YFUA 4MKAA 3OYEA 2ZE2A 1QS4A 2VG7A 2VG6B 2OZSA 4DTJA 3NH2A 4DFKA 1VSMA 2O4GA 1C0UB 3PV8A 3KLEA 1Q8IA 3TAMA 4OGEA 2OPSA 4K4VA 2ASJA 3PHEA 1TKZB 3DLRA 4KAIA 5DLFA 1U09A 3K5LA 3D0PA 4E7KA 4KFBA 1TV6A 5KT3A 4PQUA 4IKAA 3SYZA 4ECZA 3VN5A 2G8FA 1EETB 1BCOA 3NE6A 1HPZB 1KHVA 4OLBA 1KLMA 4KHNA 3OYHA 1LW0B 3T1AA 5F8GA 1ZYQA 4RW7B 5DG9A 5T14A 3IS9B 5EDWA 4AHCA 4GC6A 1RT3A 3CO9A 5KFWA 5KFGA 2GIQA 2G8IA 1WLJA 4H4MB 3QIPB 3VQ8A 1ZBHA 1XR5A 1L3UA 3ZT3A 3LAMA 1NK8A 2R7YA 5J2MB 1TKDA 3WNGA 1RA6A 2W9CB 3RMBA 3CFRA 4HUEA 1VSKA 4CJRA 3DLBA 3NGIA 1SH0A 4AHUA 1JLGB 2HNZB 4FYDA 1O1WA 2GIRA 1NK7A 3OSPA 4Q5VA 3SPZA 1WSJA 1RAJA 4ECRA 3L2UA 1IKVA 1QTMA 1TV6B 4E7HA 1BQNB 1L3TA 5HP1A 3ICLA 3AVLA 1RBUA 3V9XA 4LSNA 4PA1A 4O44B 2A1SA 2O4IA 1LW0A 2KZZA 4WE1A 4RW7A 1U48A 3T3FA 3TWHA 3BSCA 4NLSA 3VQ4A 2GUIA 4FJLA 3BSOA 1UAXA 1I39A 4Y34A 2W9CA 5KFRA 3NF8A 1RT6B 4YR2A 2R8IA 3DI6A 4NCAA 4XPCA 5KT2A 1T3NA 2UVVA 4EP5A 2YNIB 1TL3A 4RW9B 4CHQA 4W5TA 2PZSA 5KG3A 3MEEA 1BGXT 3LP1B 1TKTB 4O55A 1QE1B 1C2PA 1LWEB 4CJ3A 3CJ2A 2ATQA 1SL2A 1RTIB 3AVKA 3D5MA 4MK7A 3E51A 4FBUA 4FLUA 5J2PB 4F8RA 1C0MA 1NK5A 4CCHA 2JC1A 3KK3B 5KFYA 4KTWA 4J2AA 1TL3B 2XI2A 2HVHA 3OS2A 3M9MB 5EWEA 4J9MA 3OYIA 4FK4A 2JC0A 3FQLA 3E01B 4RNNA 4H4OB 1NK0A 1K6YA 4DL5A 1L5UA 3G10A 2QKKA 2YNIA 3BQ2A 1NHUA 1BISA 4ID5B 4IG0A 1D0EA 1YTAA 2WK4A 3ISNC 4LQ9A 3MR2A 2R2RA 3BSAA 3ZCMA 4ECUA 5HLFB 1EXQA 1A5XA 4FJNA 1KFDA 3PX6A 4CIFA 3CJ4A 3SNNA 2FVRA 3DOKA 2PY5A 1D5AA 2RPIA 4DTSA 4CHYA 4JV1A 2OPRA 2JEFA 4DSFA 4F4XA 4TSXA 1HNVB 4QWBA 3BGRA 5J2QB 3KK1B 2YNHA 3V6KA 3SZ2A 1JLCA 3O3FA 4CJFA 1RT7A 3RMCA 3MECB 1RT1A 2FVCA 3DLKB 5JS1A 4MQ3A 3HVTB 3EYZA 4LQ3A 3QEIA 5J2NB 3E01A 1N5YA 3TAPA 4F2RA 3OYJA 5KFQA 4K8XA 1D9DA 1LW2B 5C25B 5EWFA 2C28A 1U45A 3DOKB 1QSSA 1TP7A 4RUAA 3CQ8A 3KK2A 3VQCA 5KFXA 3BSNA 3HO1A 3ISND 4ICLA 3VQDA 1OS5A 4CESA 2DFHA 3QNNA 3OYFA 2G8KA 4FM1A 3DM2A 3NH1A 4E1NA 2QXFA 1JLAA 1YVFA 1XR6A 4IFYB 1RT2A 5KG1A 3DRSA 3VQAA 1WSEA 1GOBA 3NFAA 4HCBA 1S6QB 5KFOA 2IDOA 1CZ9A 3ULDA 3KMQA 3RB0A 2HHWA 1ASWA 5KG2A 3MEDB 2R2SA 3ZSOA 4R8UA 4XIUA 2IAJA 4M95A 2I1RA 4GC7A 4G3IA 4DTPA 3PO5A 4Z4FA 3HPOA 4CHPA 2BQ3A 3QYYA 1IKXB 4OL8A 4DL2A 3HPGA 3V6HA 3KTQA 3L2QA 4F50A 4FVMA 3QERA 2XGPA 3SUNA 5J2NA 1C0TB 4DLEA 3S3MA 3TVKA 2B4JA 3AVFA 4HUGA 2ASDA 4B9LA 4H8KA 5F9NA 4QOZB 5L1JA 5F8JA 1LW2A 5C25A 1RDBA 4WFZA 1TGOA 4CK1A 4M42A 3H59A 1TL1B 2HAIA 1RDCA 2VA2A 4CJSA 1S0NA 3KLGA 2XY7A 3TI0A 1W0HA 2V4RA 4H4MA 4K4YA 3HSTB 4PWDB 4CHNA 3G86A 2UVUA 2YV0X 4JUZA 1RT2B 4I9QA 2R2UA 2YKMA 2F8EX 5KT4A 4EBDA 3ZSVA 3G0ZA 1RDAA 3QGHA 2X74A 2FVPA 4IRKA 4O4GA 3SV4A 4ECQA 3SUPA 1LWCA 1SUQB 3RR7A 4EYIB 1J54A 2XY5A 4CJQA 4C8OA 1C0TA 1XR7A 3ZSWA 4Y2AA 4CJPA 1HMVB 5I42A 2UVRA 2VG7B 5CYQA 3QEWA 3KJVA 3AVCA 4TYBA 4KHQA 2EX3A 4QW8A 3OS1A 2YNFA 4DL6A 2BE2A 4IDKB 4IR9A 2BGGA 4NLTA 4W5QA 1XHXA 4OKJA 2HWIA 3KOAA 1SUQA 4K4ZA 4ZP6A 3CDEA 1TVRA 4CEZA 1WNEA 3QESA 1NJZA 3U6FA 3DYAB 1BQMB 4KHMA 3F9KA 3T5KA 2NUBA 3FFIA 4KB7A 3V4IA 4NCBA 3H40A 3QGGA 1NNDA 4OLAA 3RTVA 3NAIA 3AVGA 3SCXA 3RAXA 3LDSA 2X6SA 3NAEA 3G6VA 2EC0A 1WN7A 1T03A 4KE5A 1RTHB 3SV3A 2IM3A 2ASLA 3DRRA 5KFLA 1HJRA 1JLFB 1BI4A 4FW2A 1VSJA 4J9OA 1VK0A 4F4WA 4JRPA 1XHZA 1SV5A 2IC3B 4TY8A 4TY9A 4WZQA 1JLBB 3PJWA 2BRKA 3SQ2A 4RW8B 1RTDA 1KFSA 3V1OA 4N41A 4HCCA 4AHRA 1C1CB 4IH7A 4Z0UA 3HP6A 4QWDA 4O4RA 4WZMA 4O0JA 3OS0A 1S4FA 4NLRA 4E0DA 5HROA 4FLYA 3KLFA 3OYGA 2DPIA 1C6VA 1T05B 2WHOA 4B3OA 2PYLA 1BIUA 3AVMA 3C94A 4FS2A 4NLVA 4ELTA 2BDPA 4ED3A 1RT6A 3QGIA 2HNDB 4Z4EA 3FQKA 4O44A 2AQ4A 3KLHA 4Q45A 2AX0A 1HQUB 1JLBA 4WE1B 3PW0A 3OYKA 4KKOB 1JLEB 4CECA 2E6LA 3LP1A 2R8JA 2OPPB 3KK1A 3TABA 1RT4A 4TYAA 4TXSA 3LZJA 3KHLA 3CIZA 4IRCA 3MF5A 3S3OA 4M3XA 3QLHA 3ASMA 5KFAA 3BJYA 3DDKA 4OVLA 1TK8A 4M41A 5KI6A 3NH0A 3OSNA 5KGWA 5D3GB 1HRHA 3AA5X 4JS5A 3V9SA 1JKHA 1LWEA 4KHYA 3PJXA 4M3RA 2HNYA 4B3OB 4E1MA 4ICLB 4NLYA 2OPPA 4DFPA 3U3YA 1SKSA 4L8RB 1RT4B 3OL6A 4OJRA 3CYMA 3OHBA 1TKXA 1WNSA 4FS1A 4KI4A 2ZD1B 3T5HA 3V9ZA 3IRXB 2W7PA 1S0MA 4M45A 1UA0A 4B9MA 3LWLA 4HKQA 4CEQA 2AU0A 1CXUA 1JL1A 3O4NA 2D3UA 3SQ0A 4NLQA 4CJVA 5I3UA 3O3HA 4CJ5A 4CFBA 4FLXA 2R2TA 3QLHB 4ECVA 5F8NA 3GV7B 3ITHB 5EUHA 4JV2A 3SUQA 2V4QA 2OPRB 4CK2A 2W7OA 5J2QA 3H08A 3EY1A 4O3SA 5KRSA 2ZQBA 3BDPA 1TAUA 3ZT1A 3U3GA 2ZD1A 1BIZA 4QWAA 3RRGA 4RW6A 3GIKA 2ALZA 3H2LA 2FLNA 1S1XB 4Q44A 3Q8PB 1X9SA 3A2FA 3MXMA 3HL8A 2OYQA 3MEGB 4EYHB 1FKOA 3DRPA 5KFZA 1MU2B 1RT7B 1VRUA 3H5UA 1N4LA 3RB3A 1QSYA 4EEYA 3IRXA 3NF9A 3HVTA 2YKMB 2G8HA 2OPSB 4WYLA 1S0OA 2UVWA 2FJXA 1XWLA 3HJFA 4WFYA 4J9PA 2CKWA 1S1UB 3HYFA 1EETA 1SL1A 2P1JA 1Y97A 2FJWA 3VQSA 3RR8A 1KLMB 1YT3A 4O3RA 1DLOB 3DLGB 3AVNA 3UQSA 2Z1GA 2FLLA 1UWBA 1RT3B 3WNHA 3THVA 1VSFA 1FXXA 4EBEA 1EP4A 1IKYB 1RBSA 4CGDA 2FBTA 4C8MA 4J9LA 4IFYA 3DRSB 3VQ5A 5KFMA 3I8DA 2DFFA 4I2QA 3H5SA 4KSEB 3K2PA 2QK9A 2IAJB 2HWHA 4MIAA 4CGJA 4FLZA 4BE0A 4LY7A 1GOCA 3HP9A 4UQGA 2FVSA 1GOAA 4RZRA 1KHWA 4K4SA 1BQMA 1S9GB 2Z1HA 5CYMA 2UUWA 5KG5A 2WTFA 2FBYA 3NKYA 3V9WA 3CWJA 4K50A 1J9AA 2RKIB 1N6QB 3KKRA 4B9VA 3EPGA 1RBRA 3MR6A 1UA1A 2C2EA 1LV5A 2OH2A 3LANA 1QSLA 1VRTB 4QWCA 3HHKA 1SH2A 4ZTFA 3KLGB 3NGDA 1A5WA 4ZVFA 4C8KA 2UUTA 4FJ7A 4M3WA 2HHVA 3K5OA 4HTUA 4NLWA 1TQLA 4FBTA 3MEEB 3QO9A 1BCMA 3NAHA 4I2QB 5F8HA 4CJUA 2FJVA 2AJQA 1NOYA 3CJ5A 3AV9A 3KD5E 4BDZA 4IH6A 2D0BA 1T8EA 3KJVB 4U6PA 3PR5B 4DQPA 4RNHA 4B08A 3SI8A 1UOCA 2W9BB 5JXSA 2A1RA 2B5JB 2YNFB 1XI1A 3PW5A 4C8NA 4DF8A 4Y1CA 2G8VA 3FSIA 1NHVA 2JEJA 4FJMA 3UPFA 2KW4A 3G6YA 1IH7A 1WAFA 4ID1A 2GV9A 4K4WA 3KLIA 2CJQA 3LWMA 5FRNA 3SFUA 3CM5A 2AWZA 3V6DB 5DK5A 4NCGB 4CEBA 5C42A 3GILA 1TAQA 3I5BA 3I0SB 5KFDA 1S5JA 4URGA 5CZ2A 3C6UB 3QINA 5JS2A 3MAQA 2G8UA 4KBIA 4MK9A 1D8YA 1KSPA 2VWKA 1T03B 3FFIB 1T94A 5C5JA 4I7FB 4NRTA 4ZHRB 3PZPA 5T7BA 4CGFA 4DS5A 3SPYA 5HRNA 1C1BA 4ZVGA 1WSHA 4LSNB 4Z4GA 4RW9A 1ASUA 4FK2A 5KG4A 3HXMA 4N56A 4NCGA 4BACA 2YNGB 4JLHA 4M3UA 4AHTA 3BGRB 5DG7A 2QKBA 4O0IA 3AVBA 2AGOA 3OYDA 1SV5B 4RW4A 1Z25A 4F3OA 4IFVA 4RNFA 3HPHA
chains in the Genus database with same CATH superfamily
2QWOA 1OSCA 5BRDA 2KXHA 4HUFA 4DTOA 1NJYA 3BS9A 2NRHA 4DQIA 1VQSA 4X62K 5BR9A 2VFTA 3P83D 1RILA 4YNQA 1X4HA 4CLPA 4CK3A 4RU2A 1TFWA 3LGMA 5KFNA 3WNEA 3U9DA 2VWJA 1WG5A 2B4UA 3QSYB 2B43A 3OXFA 1SJQA 2RT3A 5A8KB 3FRZA 2E9TA 1UVNA 2QWMA 3T19A 3ALYA 2ABYA 2X7IA 3TQEA 1SKWA 4YOTA 3WT0A 2JLGA 2J0SD 4C8YA 1U0HB 4O3PA 1UVKA 4OX7A 2LQBA 2WSCC 1CS4A 3AVJA 4B3TK 2AHOB 3JAMU 3BF3A 4LH5A 1KVJA 2CZVC 3GIRA 3VGUA 5AE3A 2MQNA 1J5OB 1UW9A 5CQGA 3OFEA 5K8MA 1Z26A 4A62A 4DR1F 1F9FA 2B6AB 3D28A 2F96A 2CQIA 1FWPA 2NRTA 3FMWA 3TEHB 3RBDA 3UR3C 2Z57B 5EN1A 1I3OB 2QA4N 5GAGP 4KQZA 2G1HA 3TZZA 4XPEA 1WC4A 1L3VA 3PXGa 2VBYA 2I5JB 4J5OA 1FO1A 4KHRA 3S1TA 1XNRJ 1X9WA 3GV5B 3WZ0A 5ITHA 1DJ0A 4FW1A 2R7UA 3BGLA 4H5WA 4HTLA 4ZDNA 1YZ7A 3IWLA 1W9HA 3W3DA 2P5OA 4UQTA 5HMWA 1R27B 3TJ8A 2V9WA 1F2GA 3LP0B 2AYEA 2P9UB 1S6QA 4JI7F 3NS6A 2NRRA 4X64F 2VB6A 4W5NA 1VHIA 2LEAA 3CCQS 1IM6A 3TA2A 4AILC 5HMYA 4GKKJ 2X6NA 5BREA 4RW6B 4H0PA 3MR5A 4ZVEA 1QHAA 4B3SK 1LK5A 3TR8A 3D2WA 1OJ4A 3LUYA 3TAGA 2BJ9A 4CFDA 4DUZJ 2DCUB 1KQGB 1FXDA 5D4NA 3W2WB 3KXDA 2Q66A 1NJIO 4HVJA 4ZVHA 4GV3A 1DKGD 4KO0A 3QBWA 1JX4A 3PFEA 4DBQA 2QJ3A 2ZH7A 1SH3A 3MCSA 5EX3A 4PZVA 1IKWA 4DB3A 3R5CA 2VKZG 4DR6F 1QLNA 3CJTA 2NZTA 4C48A 1X4AA 1YQHA 3LGNA 3A12A 3R3LA 4A8YA 4PWDA 3B54A 3QETA 2DH9A 4L74A 1YHQS 4CDIA 3K0JA 2BM0A 1B0PA 4R0EA 1P8ZA 3JTPA 2ATLA 3AO3A 3I0SA 2MKCA 4QYRA 4ZTJA 3POTB 5A8WA 2X1BA 3TU5A 1MSWD 1ZM9A 1IBLJ 4MDAA 1NLVA 1MMLA 3VQ9A 2WONB 4UZBA 4IH5A 4M5GA 2ZJPL 3FSYA 4FCYA 1HMVA 1Q78A 5IFMA 5C0YA 2QSWA 2DIUA 4A48A 2QGFB 2YX6A 4KKOA 1JLGA 3DYAA 4ED1A 1KKHA 2ALYB 1GQEA 3DOMA 4AUKA 2AGQA 1NGAA 4A8QA 3D2EA 3NCQA 4DN0A 2A0FB 2NLWA 2EK1A 2XWYA 2WONA 4PG8A 2N7YA 4OLPA 5L1KA 3CCTA 3CEDA 4E89A 3NF7A 2W7AA 1OY8A 2JWNA 3THWB 2QV6A 2VG6A 4MYTA 3U7JA 4DMZA 4JRQA 5JUMA 2J9DE 1NKBA 4RW8A 1FRMA 3DOMB 5AZJA 1ILYA 1Y4ZB 2P8IA 3CM6A 3TANA 5GAGU 1TUVA 5E2QA 2VF3A 1PC5A 2VODA 4ED8A 4DR4F 4ILMA 4PL8A 1JJ2R 3EE9A 2R7OA 3HSJA 5GAHU 5HI7A 4LF6F 3LALA 2BQRA 5AQQA 4CJKA 1KAYA 3LAKA 2NZCA 3QGPA 3W0LA 5D6GA 2J7KA 4F0MA 3C14A 2BJ7A 1AZSA 1IBLK 2PT0A 3OQ2A 3OJSA 5LOQA 4I7FA 3AD7C 3L8BA 3B6BA 1S1WA 1KVIA 1RT5B 1NEEA 2ZC4A 2A5XA 3O1LA 4TLRA 1XC3A 4EO8A 3OJUA 4GKKF 4CZIA 1AB8A 1X4DA 2C22A 4LSLB 4IFVB 4IG0B 1WC3A 2R8KA 2KHDA 4O23A 4CF1A 3N0VA 3L7UA 2LP4A 2ZKUA 4BCAA 2XS7A 1X9MA 4Z4HA 2UUBJ 3C0BA 1HYZA 3QIOA 4J2DA 5D3GA 4WWSA 2OANA 2BABA 4J9RA 3JQJA 4OHZA 2FC9A 2GVZB 3MWBA 2LXIA 1REVA 3RBZA 1VSEA 3CCRN 1ZC6A 3ZSXA 1LAWA 2H5JB 2XTJP 4ZPWR 1N0UA 1ZAWA 4H5VA 1CZBA 4WYBA 2PI4A 4C7QA 2WCXA 1FE4A 3OTOF 2HMIB 4PAAA 3HVRA 4FWQA 4RUBA 3GDQA 1HLWA 3L3VA 2ZBCA 1NHKL 4PL7A 1FKPB 2RF2B 2ZWOA 3G82B 4NZ0A 4Y6IA 2DGUA 3K58A 4ECXA 3HSGA 2F8TA 4ILHA 4WFXA 3WQTA 4A8KA 4USVA 1REVB 4DXLA 5HRPA 4CGIA 1GXTA 3EPIA 4DV2J 1LWFB 4CNYA 4B3RK 2DNLA 3CCJS 2ROEA 2HB5A 5LL6Z 3O9UA 3UR0A 2DNPA 2GBZA 1GX6A 3MEGA 1ICEB 4FN5A 1K1QA 2KO1A 1AFIA 3F73A 1FKPA 2RF2A 1PYSB 3CFOA 3MMCB 4NYZA 2QTDA 1D1UA 5IT4A 4NWBA 5KFFA 4TU8A 3BO3A 3EZUA 3ZX3A 2GCFA 3J81j 2E2OA 1N33F 3TTCA 3HI9A 2ZUGA 2VU5A 3EEQA 4FZZA 3EZOA 1T7PA 4BE2A 1N34F 3PY8A 4BC5A 1HBOB 2QZ8A 5GAEI 3MFIA 4CJ7A 1OPZA 3CMES 4CW7B 5K14A 2V8VA 2KFZA 1GLFO 1TMJA 3CDAA 4W5RA 1N36F 2FGOA 1F6TA 1K0VA 2MB0B 2YWWA 3TSUA 2CPXA 3CC4S 3M8PA 2BJ3A 2MTLA 3VAKA 1NK4A 1I94K 3K89A 1YF5L 1YITS 2BOPA 4KTZA 4DMNA 4OZLA 2QLFB 3NL0A 4OMFG 3S3NA 2LYVA 5AJ3J 5DM6Q 1JJ2M 2VC1A 2Z0GA 4XAKA 4E3SA 5F0XA 3PYGA 3R8EA 2HQDA 1MWYA 4DU7A 1V4TA 1ROFA 2YHBA 2ZH8A 3EMTA 2E5LJ 4DCJB 3J7AN 3T5LA 5E84A 1NAQA 3H4DA 3QRPA 1DURA 3HFKA 2V7YA 2AYMA 4YB5A 3QPIA 5DQGA 1EKEA 2O8CB 3A0IX 2GJ2A 2XI3A 5GMKa 3SDEB 2KKHA 5AQWA 3QEPA 1UEVA 3AB2B 4FZYA 4LSZB 1HKAA 4PWUA 4M63C 3DLEA 2J9DA 3U1NA 4PG6A 4O0NA 2CRLA 1TK5A 2WW4A 2Z2MA 3OTOJ 4DFJA 4J9QA 2DGVA 4MJKA 3Q22A 3AA9A 1WDTA 1WSGA 2Q97A 4DSJA 3MXJA 4I9LA 5LSLA 1KAXA 4JD2B 4OGCA 3PHTA 3AO1A 4DSKA 2MSSA 1DGKN 5AT1B 4IBNA 5FLXU 3JXOA 5K9FA 3T9NA 3V6DA 1U2CA 3DNCA 2IPOB 3HVWA 1I94J 1T9XA 4URSA 1RT5A 3K9KA 1QE1A 4X64J 3IP0A 2PMHA 1HNZK 2CQ1A 3MPUB 2IC3A 4JI1J 5DM6L 3BM7A 1AXQA 2D69A 1NPPA 3EZ5A 4ZVUB 4N76A 2WSEC 3KHRA 2LA4A 1QTNB 3GP9A 3OTCA 4GV6A 1N48A 3KK3A 4KH4A 4ZPVR 4IO9L 1PSDA 1NGCA 3LH2S 3LP3A 1O0PA 3ATUA 1YBTA 3ZEUA 6FD1A 1ZBIA 2H4YB 4KC5A 1FDBA 3FLCO 4GY2B 1J27A 1C1BB 4FJ8A 4W5OA 4LH4A 3GSDA 3TA0A 3U9ZA 4JP8A 4ZP9A 2FBXA 2MGZB 4LFCF 4FJGA 2OP5A 3UN3A 4FJ9A 3HRGA 3EVWA 4IOAL 1C4CA 2Y3YA 4DR7K 1JNRB 3BQ0A 1HBNB 5ETNA 4DR1J 3FJ2A 3BUZB 5KG0A 4XH5A 3GPAA 3TTFA 4FJ5A 1RTHA 1YJ7A 3A3PB 2HQ3A 3MN6A 2HKEA 4DV4K 3R9PA 2GVDA 2GO9A 4ECSA 3ZT0A 1WKLA 1KQSM 3GIMA 4IKFA 1LAVA 4Y1DA 2WVBA 5MLCV 2F4VF 3SQ4A 1U1OA 2MJUA 4WFBQ 3MZIA 3RYLA 1QY7A 2FHMA 4MKBA 4LF4J 1TKTA 1RTJB 2OPQA 2Z58B 1FDDA 2JHEA 5IC6B 1HLUA 4F4KA 1OQ6A 3CMQA 3H5YA 1ELOA 3CERA 3MM8B 2HFNA 1VQNN 4IR1A 3SBGA 4R5PB 1X5SA 2H1YA 3IR7B 2ZNZA 3R5JB 1F9EB 3B6OA 3OBWA 1YI2N 1NJXA 1YHQN 2QTWA 1HKGA 3I0RB 1K8KB 3EWGA 1RHQB 2VCPA 2YH1A 3BZKA 5J1EA 2NSCA 2NYIA 1NOZA 1OQ3A 2FC0A 4A8MP 2B9YA 5SUHA 3OYMA 4KYZA 2AT1B 1KCFA 1WOSA 2IYGA 3VQEA 4OZJA 2RDIA 5IXUA 2DITA 3DOLA 3M1VA 2O1PA 2CA9A 3PX4A 1VC5A 2KDOA 1VHXA 1S49A 4A8SA 1WSIA 4DR2K 1KTVA 3MGJA 5AXLA 2UP1A 4LF9F 5M1OA 3OR2A 3KHYA 2ETJA 5JLFA 1KRPA 3O4QA 5KGXA 2VZ9A 3DLGA 2E9ZA 2JRSA 2DY4A 5HRSA 2XO7A 1WHVA 4J9UE 1F5CA 4MK8A 2Q2RA 2Z2LA 2VQEJ 3EDRB 2KN4A 2XCAA 2O5DA 3OL7A 4JI3F 4DTXA 4DQRA 3GYNA 3QEVA 2W24A 1C0UA 3AFGA 2J4RA 3CJ8A 3FZKA 4NLPA 2P9SA 2BBEA 2IRUA 2BM1A 5HANA 1NSPA 2OTJS 5BPLA 4OJHA 4X2BA 3ET6B 1CJTA 2BACA 1BY9A 1IV0A 3HKZD 2KB2A 3W61A 1IR2A 3OYNA 2V2QA 3VPZA 3E66A 4M94A 1G6BA 2ZJPQ 5D8HB 2DGXA 1IBKK 3C6TB 4K4TA 2XBPA 2QRRA 1B3TA 5E3RA 3LPEA 4BRFA 2CPDA 4N5SA 4DV3J 2GMLA 4B1WB 4BGBA 5DJBA 5L9XA 4E19A 5B0FA 3RW7A 3CCMN 3LP2A 3L2WA 2IVFB 2XM3A 5FIIA 3MMVA 3MWTA 3THWA 2VPWB 1Y10A 4DTJA 1S72N 3L3CA 2Y8WA 3TAMA 3G8QA 2ZITA 4K4VA 4C2MA 3BZQA 3IR5B 5AZJB 1SJ1A 4DL0C 5KT3A 2QWRA 1BXNA 4P73A 4ECZA 2AF6A 2F9WA 4LF2A 1KHVA 2UUCF 3IRWP 3OYHA 7AT1B 3CXCR 1LKZA 2ASOA 1GTEA 4YB7A 5T14A 5AQFA 3D0IE 1RT3A 3M6WA 2YWGA 3GL1A 4L3KA 2G8IA 2CPIA 3FR0A 2DEJA 1L3UA 5C2FA 2NRZA 4Y2IA 3FVYA 1S72S 1RABB 1F3VA 2HFVA 5HQ8A 2MZSA 3CFRA 3HZ6A 1VSKA 1NH7A 4Y0FA 3DLBA 1EHWA 4AHUA 3I8BA 3G25A 1KXPA 4JYAF 3KDNA 4ECRA 1XJWB 1QTMA 1TV6B 4E7HA 1IQTA 3WC0A 5HP1A 3ICLA 3BO2A 4ZS6A 2FYXA 1T9YA 1MWQA 2PMZD 4Y2KA 4O44B 2CQGA 4A8XA 1BUXA 4NO7A 2C3PA 4RW7A 4HDHA 4D3GA 3T3FA 3BSCA 4NLSA 3VGSA 3VQ4A 5CE3A 4P9SA 1SJ3P 1RT6B 3AAQA 4YR2A 3FRYA 3NF8A 1RWPB 5KT2A 1VS3A 4EP5A 1NZ8A 5KG3A 1BGXT 4YEAA 2YWHA 2DNGA 3GWCA 3TJ9A 4DPWA 3LP1B 3E9OA 5JJBA 3DLLL 3LL3A 1TKTB 1VHFA 1UVIA 1X9JA 4EFHA 1QAYA 1LWEB 3WIVA 4CJ3A 1NPKA 2GWKA 3PIPL 5A8KA 3FCVA 1N33K 1WSVA 1YDLA 1CBKA 2A6MA 1S79A 2CNNB 1HD0A 5ETVA 1WG1A 4J2AA 4UT4A 2PMWA 2XI2A 2HVHA 2DGQA 3OS2A 4GVBA 2IIHA 1T6CA 1LWXA 3ZZ0A 1TL7B 4C0OC 3E01B 4H4OB 3GLJA 4ZITA 1K6YA 1L5UA 1UPPA 5L8RC 3G10A 3ETOA 3QWUA 3BQ2A 1NHUA 1BISA 3ULHA 1OSDA 4LQ9A 1ULRA 4ECUA 3BH7B 7FDRA 4YOEA 1EXQA 5AQNA 2WW8A 4A5AA 4FJNA 4CIFA 2OTLN 2FVRA 2V9KA 2RPIA 2L9WA 4CHYA 5DETA 1K9MT 4CI0B 2OPRA 1Q86T 1HNVB 3A8EA 3BGRA 1HI8A 1CLFA 1P8GA 2OLWA 2YNHA 5ETKA 4AM7A 6FDRA 1BA0A 1VQ4N 3FZHA 3DLKB 5JS1A 1M1HA 3QWPA 3QEIA 4ZJOA 1UP1A 3Q2TC 5DM7Q 3R2DJ 2YCHA 3AOBA 3TAPA 4K0KK 1EARA 3D4JA 5C25B 5EWFA 2A1BA 4ZJLA 3TX0A 4RUAA 3FZ2A 3CB4A 3CQ8A 4CZEA 2X1GA 3HO1A 3ISND 2HBJA 2PBDA 2DFHA 3D0GE 4NXNF 3TOQA 4FM1A 3Q7BA 1RB0A 1HNWF 1JLAA 1YVFA 1PILA 1Y5IB 5KG1A 1WSEA 2F9DA 1OMSA 3RB0A 4K8RA 1ASWA 5AE1A 2ZH4A 4R8UA 4XIUA 4DPXA 4GC7A 4KH5A 3HPOA 4DV7J 1WOPA 1JCEA 2BXJA 3NY0A 4CHPA 4OPAA 4KHPJ 1IKXB 3HPGA 2CJ9A 2Q3PA 5DDOC 3V6HA 3S3MA 5B0AA 3TVKA 1U2VA 1YJ9N 2E1RA 5F8JA 5B09A 5GAEP 4WFZA 4M42A 5FPNA 3HMJG 1TL1B 3M2RA 2RUGA 4WQ5C 1W97L 3FEZA 4CJSA 3AD8C 3HZGA 1NWKA 2FSKA 1W0HA 1RBLA 4H4MA 1WBBA 3HSTB 3ET6A 4A46A 2EFGA 1SQKA 2YV0X 4JUZA 1EX8A 1GXUA 1WTFA 2UYTA 4LVOP 3N5BA 4PABA 1FJGF 4BREA 3HT0A 2VYPA 1RDAA 1NGHA 4USJC 4ECQA 1WHXA 1VK3A 2HQCA 1SUQB 2QWNA 5M2PA 2HZVA 3DXBA 4CJQA 4A2AA 4Y2AA 3UKUA 3W8GA 2ZH5A 2HPUA 2ASMA 3AH6A 3LO3A 2ZHOA 1Y0HA 2DNYA 3HSCA 1W7WA 1F5AA 4BS2A 1B0VA 3CHWA 5AQHA 4DL6A 4LMZA 2BE2A 4IDKB 3P5BP 5DS7A 4NLTA 2E88A 1T6DA 1HHTP 2D74B 1F2HA 3KOAA 1SUQA 4DKWA 2AKWB 5ADZA 3ENVA 4C1NI 3WEEB 1W7AA 4KHMA 1UTAA 3F9KA 2NUBA 2B9EA 3FFIA 3UWTA 4DPOA 3R5DA 1Q82O 3G8SA 3TZYA 4OLAA 3TUPA 1YJUA 2QIFA 1HBNA 2UU9F 3NAIA 1VBZA 1JNZB 3ZZOA 3MURP 4CLKA 1WN7A 3NNCA 4UOGA 1RTHB 1IBMK 2IM3A 4P7TA 4DR3J 4PWWA 2ROPA 5GINA 5KFLA 4CTAB 1HJRA 1JLFB 1HQ2A 4OYBA 4IYQA 1XHZA 3RU0A 1WACA 3AJ2A 3VENA 2XMWA 2IC3B 4TY9A 1R59O 3PJWA 2BRKA 3CC4N 3SQ2A 3I4HX 1RTDA 2IFXA 2F9TA 4C11B 3ENAA 3DU5A 4X4TA 4L3QA 2FJAB 1C1CB 1S5ZA 4HVZA 4X4VA 4QWDA 3SAHA 1QUPA 3P45B 1ZBTA 4WZMA 3OS0A 4DR5F 1SQFA 2W2PP 2GX9A 3SXLA 2GIFA 5HROA 1YRXA 4FLYA 2DPIA 1C6VA 2QLJB 1NGBA 4B3OA 1KDNA 5MAOA 1D4XA 1VIXA 4FS2A 2V2ZA 4ELTA 3M4XA 1RT6A 3FQKA 1RBAA 4FYXB 4CECA 4DCHA 3LP1A 3VGTA 2OPPB 4TYAA 1R6VA 4TXSA 2FIUA 3LZJA 4BC9A 2EC2A 1S7IA 1Q82T 1FVSA 3BJYA 5M1FA 4OX8A 4IOAQ 3CJQA 4OJ1A 4QIWD 1NNEA 4OVLA 1TK8A 5KI6A 2M9KA 3TW0A 3NH0A 1WHWA 2I0XA 1HRHA 4AD6A 1SQEA 3V5RA 4M3RA 2HNYA 1RWWB 3I33A 1JJHA 2RHSB 3H0PA 2AP6A 2OPPA 3U3YA 1U0SA 1RT4B 2VQFJ 3OHBA 1B64A 3G6ES 3WIUA 3WDOA 1Y7PA 3QICA 1YJRA 2W7PA 2AP1A 3G96A 1WOQA 3LWLA 4QR1A 4H03B 2B4VA 5E3AA 2AU0A 1JL1A 3O4NA 1UZHA 2D3UA 2BW7A 4NLQA 3QMLA 2LQ5A 1BQXA 1TR0A 1Q5YA 4CFBA 1FE0A 2ZJRL 4LUBA 3FSXA 1RAGB 5EUHA 4KH0B 2FHKA 2OPRB 5C10A 3GE9A 3J81U 2W7OA 3OVBA 2E5JA 3EY1A 3O1BA 1SIZA 1Q81O 2FJBB 1MNEA 1SVDA 3ZT1A 4JI8K 4PRFA 4H5NA 3EKSA 4RW6A 2ALZA 3H2LA 4E2FB 2V68A 3W5YA 3RRKA 4Q44A 3Q8PB 3MXMA 2OI2A 2YJEA 2VQEK 1HW8A 3IFRA 4DV0F 1VRUA 5DZ6A 3OW2M 4JI8F 3RB3A 4EEYA 1IJEB 3IRXA 3NF9A 3HVTA 3BYRA 4C23A 4WYLA 2UVWA 1DHMA 1H1VA 1NGJA 2P1JA 1Y97A 4JAXA 1DLOB 3HFVA 3UQSA 2F4FA 1PYOB 3PRDA 3O1WA 1UWBA 1RT3B 1NDPA 4M8LA 2C2NA 1EP4A 3WXLA 1UFWA 3CF5Q 4CGDA 4LVNP 2FBTA 2E5HA 1RE1B 3DRSB 2LEPA 2XQCA 4IZ9A 3VQ5A 2CPZA 3I8DA 4I2QA 3H5SA 1F1BB 1QZ5A 4WTOB 1XUPO 2IAJB 4MIAA 5ETRA 2ZM6K 3HP9A 2VKRA 1VQ8N 3MAAA 2WC9A 2DKOB 1BQMA 2FBYA 3MM5B 1S99A 4RWXA 5TKYA 4A57A 3T6JA 3LDLA 2ZOFA 1FT8A 1N6QB 4EI2A 3J81Y 2WVCA 3MR6A 1EJ7L 1ZM2A 4HR2A 3P96A 3HHKA 1SH2A 2AEMA 2V5HG 3PM9A 3NNAA 2RMLA 3NGDA 4LBIA 3UDVA 3CE8A 5ETQA 2E8AA 4MDBA 4HTUA 4NLWA 1TQLA 4H4KC 4J8FA 1BCMA 2DGOA 5M1QA 3I82A 2AJQA 3GYGA 1NOYA 3CJRA 4I6WA 4CLWA 3ZETA 1GLEG 3LW5C 4ZVSB 4DX6A 3THXB 2CG4A 3DHWC 1VQYA 2N7CA 2A1RA 3M2VA 4USUA 1XI1A 2C2ZB 3HSDA 1NHVA 4LBHA 3D54A 2KW4A 5HATA 3G6YA 2GUPA 3ZTPA 1IH7A 1XNQK 2V8HA 2GV9A 4LF8J 5FRNA 2LXUA 3O9TA 1K8AT 5DK5A 2Y9HA 3H25A 1TAQA 1D09B 1YGYA 5A2QU 3QINA 5JS2A 2G8UA 1KC8T 3THXA 3W60A 5AZIB 3SMSA 3D2FA 2FF3B 1QQNA 2H9ZA 3C3LA 1N32J 1T94A 3DDNA 2I7PA 2FY1A 1QVGM 5C2CA 4USKA 2YKAA 3PZPA 5T7BA 3SPYA 2LU1A 1C1BA 1LOTB 2KKZA 4U9RA 2CYYA 3N4WA 1VOMA 4FK2A 1X60A 3H46O 4N56A 4BACA 4JLHA 4M3UA 2R42A 3BGRB 1ZA2B 3QB0A 3MN5A 5LSRA 4LFBF 1XMOJ 4RBVA 2AGOA 3S41A 4F3OA 3HPHA 5EX5A 5FD1A 3D6RA 4ILJA 3CC7S 1SIWB 1JL2A 1UL3A 4CF0A 5LSOA 4J7CA 2H4WB 5KAKA 5KFPA 4CEOA 3W64A 2VL1A 1S76D 4N7TA 5D4PA 1B7FA 5IC4B 1S9EB 2JFDA 2R7XA 4EHTA 5KT7A 2O8EA 1KLNA 1QVGR 1HNIA 3D45A 2HVIA 4OYAA 3R7NB 4NLGA 5A8RB 3M9NB 3UDLA 2OD6A 3H7HB 4L3NA 1B70B 5M1KA 1HHQA 4HTJA 2MEWA 3K5NA 5HMZA 3W62A 3UCGA 1HQUA 3K8WA 4Z7CA 1WWHA 4NXMJ 4QBUA 1VQPN 1CLQA 3KFWX 1N54B 1Y11A 3Q2SC 1CULB 2IBOA 4MMOA 5CHIA 5GVQA 2FGCA 1HARA 4OZ2A 4CBWA 4RO0A 3M1FA 5KFHA 1HQEA 4E7IA 4G1PA 1GEHA 5J1EB 1N88A 2G2YA 1JXLA 2DH7A 4FK0A 4QIEA 3OYCA 4CE9A 4ELVA 2LDIA 4LT6A 4DHVA 4DV5K 4F0HA 3CJ3A 2CPHA 4GMJB 2DYAA 1S6PA 3ILOA 3UFCX 2KJWA 4CEEA 4I2PA 2KVIA 2F5GA 3CC2S 3CQXA 3TEGA 7FD1A 4LFAJ 2AZ3A 5KFSA 4M5IA 2VDIA 1FTCA 4BE1A 4FDFA 1NSQA 5E7OB 3UB5A 3CCVN 2VJVA 4OKEA 4BRPA 3A1YG 3HULA 2DGTA 1HWKA 4DV7K 4BRQA 3PLAA 1DFDA 2BANA 1A9NB 2KG1A 3J7YP 3CJ1A 1S6PB 4P10A 5J1NA 1VQMN 4FJIA 5KT5A 2ZNYA 3HDSA 3BV8A 3IG1A 2YKPA 1SS6A 3MAHA 1S1XA 2ZVSA 3UNYA 4LF1A 3D1OA 5ETLA 4O5FA 4ZLPA 2HHHK 1JB0C 2G13A 2R7WA 3IUCA 3AA8A 5B08A 1TVRB 4WYWA 3P8BB 2FSNA 3IKMA 5E41A 2MQMA 4B9NA 1JCFA 2IM1A 2OUGA 1AROP 4PYDA 2HHHF 1KVKA 1AUDA 1ZS6A 1PAEX 4ZVQB 1ZXOA 2OZMA 4C8LA 1UFKA 2FPHX 4WQ5A 2DD8S 2DVIA 4CT9A 4LF7K 4DR1K 2G4BA 2B9WA 3LDOA 4KFBB 4CFAA 4X4NA 2XSJA 1LWCB 4BR4A 4K25A 3CJ0A 3PYEA 4LFAK 2MZRA 2XHCA 3SQGA 3UNGC 2C2OB 2CQHA 3PIPQ 4J9KA 2WBNA 3B78A 1TTHB 2FJEB 3J80U 3KVGA 4N8NA 4PCQA 4EZ6A 2XGQA 8ATCB 1S97A 4JNEA 1U24A 4LF4K 2FLPA 1UVMA 1BLUA 3TARA 1FNXH 4YDUA 3O4WA 3IS9A 2ADCA 4DZDA 3QZ7A 4DQQA 3BF1A 1PJ7A 5I42B 1DTQA 4OPKA 5KG6A 2J9EA 1VSIA 1QD1A 5LM7E 2M8HA 3QO9B 4CBXA 2VPZB 4PG4A 1D3WA 2CJYB 2YNGA 1IKVB 4ZA1A 1Z05A 4UY8T 3J7YU 3Q8RB 1SZ2A 1QAJA 1GLAG 3VVTA 4FXDA 3ETMA 4CO0A 2ZUAA 1ZZFA 2MY8A 4JI6F 1K0TA 4JV0A 3ZEUB 1J53A 1W26A 1YK9A 3C95A 1DTTA 3NGKA 4J2BA 1WTBA 1X1PA 3AA3A 4GKJF 1RLDA 2W25A 2CPFA 1VQ6N 1S0VA 1S1TB 4ZMMA 3QRQA 3TX8A 2N3OA 2MPUA 2MKJA 2E4LA 3TO8A 2IMOA 3RAQA 2Q6CA 1C1CA 2IHR1 4ZCIA 3A8IA 4GO7X 3DI6B 3CCQN 1SJ4P 4X62F 2CQCA 3MMBB 3VF0B 3NWRA 2POKA 5DGBA 3VAIA 3P31A 3KIOA 2C2RA 4B1XB 2W42A 2EFVA 2UUCJ 3FZMA 1R0BG 2VH7A 1CJVA 1ATNA 3FGVA 2GAHC 1D8ZA 1Y3KA 2HURA 4WF9Q 4ES2A 4ID5A 1JCGA 1M90T 5LL6d 1S9FA 4PG7A 4DV3K 2IVNA 5CCMA 2KM8B 4KB1A 2E6MA 4IG3B 2E9RX 4K0KF 4EP4A 2CDRB 3NMAA 4FWOA 5JVHQ 2XNRA 3CCZA 2QSFA 3HLUA 3Q24A 2A6OA 2D7SA 2W8LA 3TUIC 4KH6A 4BR5A 1QUVA 3VMFB 2RHQB 1Y64A 5U47A 2GJIA 1N0VC 3QJPA 4LRFA 3LPTA 4CHOA 2DH8A 4FWRA 1UWBB 1R31A 1H98A 4MIBA 4BRIA 3MECA 5BJRA 3L6QA 3O5BA 3MPDA 3CT9A 4E7LA 3KKSA 1HYVA 4LIWA 4YMEA 3ADAC 3JSRA 5GADI 2MXYA 5A0YA 1OH6A 4LRAA 3UO0A 1VQOS 3QT6A 1N5VA 2VQEF 2V8DA 2CQBA 4TVAB 2AYGA 3VVUA 4OX9F 3QEXA 3CNQP 1RBTA 3ZSYA 2W2QP 5AQGA 1HBMB 2RN2A 4RNMA 1ZAXA 2HIQA 4JI2K 2DY1A 2Q1NA 4LFCK 4DV6K 1JLQA 2XC9A 5BRHA 2PEBA 4B3SF 3JS9A 3M8QA 5C24B 4O5BA 1MN9A 2COLA 3I32A 1FRKA 3K2YA 2JDJA 4PXCA 2X1FA 3N28A 2XY6A 1H7WA 2E5LF 2I5JA 3CDUA 4DSEA 4C8ZA 5JMNA 3DU6A 2P9GA 4F25A 3SSRA 1FFSB 3IGNA 2UXBF 2GHVC 2MKHA 3WHIA 3PRVA 1JJ4A 3IGVA 2YHXA 3R5GA 2SXLA 1HNWK 3TR5A 1R43A 4CLYA 4Y3CA 1TKZA 3M8RA 2MLYA 1L3SA 5IWAJ 1DTQB 4PQUB 3L7OA 4K7QA 5K8OA 1S3XA 5DRKA 2GO8A 4BWMA 1U1QA 2GGPB 2H48B 2E1ZA 2BE7D 1IBLF 4ENOA 4JB8B 2R9LA 3J7ZT 4LR7A 3SUOA 1AT1B 1RYSA 5CH7B 3RB6A 4W92B 2HHQA 4DL7A 2MMYA 4FYYB 4OQJA 2XMKA 1J6ZA 1ASVA 2M8DB 4H0YB 1KVCA 1TL5A 4X4OA 4OPHA 4V1Ak 2P2CB 4RU9A 2ZH3A 3QIDA 2L08A 2AJ1A 1R8CA 2QYCA 3V1QA 2IA6A 4JI2J 4B3RF 4LFCJ 1RDDA 2A2CA 1VBYA 1NGGA 1GLLO 4IO8A 4MFBB 3W3SA 3CIMA 5GAEU 1GLJO 1KQFB 3PSFA 1XNRK 1H7XA 4AQYJ 3K59A 4ED5A 2P9IA 3R1HA 2PYJA 4IWVA 1YSJA 4H5RA 2CVEA 4TY8B 4I56A 4J9SA 1NKEA 5G0RB 4NLUA 4HT7A 3R1XA 1M5SA 3KUEA 2YY3A 2RU9A 5FDLA 2VIHA 3WC2A 4FJKA 2RAQA 3C6UA 1HWUA 3M5RA 3CG7A 3DXKA 1FRXA 4NLDA 4IUFA 3TTDA 3J7ZO 3M7VA 4OLOA 3OUYB 2CWXA 1FWLA 2HBYB 3DJCA 1K8AO 1IO2A 2D3ZA 2HF3A 3DLHA 1HUXA 4CF8A 2XLKA 3TAFA 1VQ7N 2JFKA 2V0NA 3H5XA 1JLEA 5KFTA 3M8YA 3FMBA 3OYAA 5FPDA 5M2RA 3TYTA 1XERA 5LMUF 2KFNA 2PEHA 2C2DA 1GX5A 1FD8A 2WOMB 3MMBA 3JSMB 4JI3J 3HVAA 2XMJA 1YRUA 4AH9A 1HWJA 1VSHA 1M5HA 3QATA 3HF5A 3IM8A 2VONA 3R6LB 2K7KA 1DEJA 4X4QA 2KZMA 1W2IA 3HM8A 4EGLA 3ZZPA 2WSFC 1U1LA 2YPYA 4JI5J 5M2UA 2IJFA 4KGXB 2K2PA 2HIYA 3OYLA 4N8OA 1REGX 2J6TA 2JLEA 3PSIA 3SEOA 2C3MA 4TQSA 2E2PA 3OL9A 3JSMA 1CVJA 1LFWA 2YHWA 4FVUA 1Q1KA 1JLQB 4LSLA 2EFPA 3RMAA 1U1MA 1C0FA 4IOBA 3AVAA 1RTIA 1B9FA 1VQNS 2A6AA 1N5YB 3OR1B 3HCXA 4ED2A 4CJWA 4KB0A 4A8FA 4Q8EA 3SCIE 3TPQA 2ZH2A 3I87A 5IWAF 2B0GA 4Q43A 1S10A 3SBTA 3KNGA 5AR0A 1YTUA 2B6AA 1YVUA 4R8UB 2EVZA 2BX6A 4QWEA 3AQPA 3VQ7A 2W40A 2LECA 2JNJA 2XZWA 4LF4F 1GK8A 1IR0A 2MQQA 3E3XA 1MWKA 4BC4A 5AQOA 2VOOA 1X3MA 2XSFA 3A13A 4OZ1A 1YTYA 1NDKA 2EWSA 4QU7A 2ZF5O 3MD1A 4P2SA 4A47A 4PUOA 1WEXA 4PEOA 3MM6B 3LP2B 4QAGA 2KT5A 5BPNA 4JV5F 3LM9A 3N6MA 4QR2A 3THYA 1NLKL 2DNQA 4U7BA 3EUNA 3BZCA 1NK9A 3NHGA 3QBCA 4DR6J 2YXLA 4QIVA 1FK9B 4O3OA 4IOCQ 2J76E 2FVQA 4Z4CA 1T9UA 3PG9A 2FQQB 3BR9A 2ZBQA 4HDGA 1IKYA 4ED6A 5A2QY 4JKEA 5EU7A 4RWTA 3V9UA 3AXKA 3PYFA 2H5IB 1KS2A 1WHYA 1WSFA 3BQ1A 4CJEA 2IVMA 1ZTWA 1B99A 2GS8A 1WD6A 3N6NA 4F02A 2DK2A 2CQPA 1JMTA 3PNIA 1CQMA 3H1VX 4DF4A 3PUFA 2CZ4A 4KHSA 1U49A 2LQJA 1HR0K 4JK9A 3P49B 5ELZA 4BRNA 4KO0B 1PKUA 5K14B 3RB4A 2BVZA 4YOYA 3QJJA 3MEDA 3VTIA 1YVNA 4YFUA 4XDCA 3OYEA 1QS4A 3NH2A 1VSMA 1Q8IA 2G9OA 3HSZA 2ASJA 3DLRA 4KAIA 5DLFA 1U09A 2JH3A 3D0PA 3NS7B 4PQAA 4JI1K 1LCUA 1EETB 3M8ZA 3DXKB 2B8PA 1HPZB 3ID6A 1KLMA 2DRDA 3CCUN 1LW0B 4RW7B 3M2VB 3IS9B 5EDWA 4AHCA 5KFWA 1TZ0A 3R2CJ 1WLJA 1Y5LB 3QIPB 1QDUB 3SSQA 3VQ8A 3G6EN 1JQGA 1CJUB 2RRNA 2DR8A 3RZAA 4DV2K 3ULEA 1VJWA 2YI1A 1FRLA 4C11A 2XYHB 4B3RJ 1TKDA 3FZBA 3RMBA 2MJNA 2V52B 1ZH5A 4HUEA 4OI6A 2BJDA 2BMBA 2O8DA 4CJRA 4K59A 1SH0A 1JLGB 4FYDA 1O1WA 2I6WA 1RACB 4Q5VA 3SPZA 3I55S 3O5TB 1GMWD 1S22A 3BF4A 3FNNA 3IFEA 1SBRA 4LSNA 2AEJA 2A1SA 2O4IA 4B1YB 2N4DA 1XEZA 2M88A 2MZ1A 3TWHA 4D3HA 4FJLA 4F04B 5AQUA 2MQPA 3MMJA 3CULA 3DI6A 4X65K 2PFDA 4XPCA 5AQYA 2O66A 2YNIB 1TL3A 4RW9B 4W5TA 1YIJN 3WX8A 3OUYA 3J80O 2EXUA 3AHPA 3R6MA 4O55A 4JI6J 1QE1B 5K8NA 3F0NA 3UW1A 3GG0A 2UXBJ 2ATQA 5H9EJ 2ZZTA 4FBUA 1N36K 5J2PB 2H3GX 2P6SA 2M2BA 4EU0A 3AD9C 1Q86O 1TL3B 5IT9U 4JKCA 4L73A 2W6LA 3CCES 3TSPA 3CCJN 2JC0A 1FTRA 1FX4A 4RNNA 1NK0A 4DL5A 4LRCA 5GAGI 1HNXF 1DQAA 4NE9C 1X4GA 1M5OC 1I5OB 1EAYC 2GMJA 4B3MK 1D0EA 3LGHA 4Q2LA 5FJ4A 2WK4A 3ISNC 1VQ9N 1M90O 3BSAA 1N52B 4X65F 5GIOA 4R79A 2YWEA 1LFPA 2FUG9 2PY5A 1QQOA 5BR8K 3FK4A 2APOA 3P5TL 4DSFA 1KEKA 2VJUA 4TSXA 5J2QB 3KK1B 3V6KA 3THYB 4A4JA 4CLSA 3SZ2A 3O3FA 1K44A 1OVYA 3MECB 1PO6A 2XZTB 3HVTB 5A76A 2DPNA 3PKYA 1FA0A 4NLCA 3MCPA 5KFQA 1FW6A 4OJ3A 1TELA 4JI6K 4J90A 2JLFA 2G1DA 1HBMA 1WC6A 2RILA 3AODA 3OD2A 4I69A 3BSNA 5D4LA 2PA3A 5HK4A 4CESA 2FC8A 3OYFA 4NMLA 3NH1A 4E1NA 1E6YB 3R8YA 2A10A 4M5MA 1WB9A 3H3NO 4FWPA 2VASA 3CMEN 3ZTRA 1S6QB 2IDOA 1CZ9A 1KQSR 4NMXA 2F7VA 5KG2A 3MEDB 2E1CA 4M5KA 3ZSOA 3L4IA 4IO9Q 2FZKB 3DKDA 5LY3A 1X4BA 1EIYB 5THWA 2F8HA 4F67A 4OL8A 1LXNA 2DEIA 2LVWA 3KTQA 3L2QA 2E44A 5J2NA 4ZCLA 4HUGA 3FEYB 1CJKA 5C25A 2A3ZA 4GKKK 5B0EA 2DJWA 1RAIB 2CQ0A 1RDCA 5KPZA 2RH3A 1A0OB 1UVLA 3KLGA 1NJIT 3JSYA 2VPYB 1ZM3A 3W9IA 2DHSA 4C9DA 2M70A 1JXVA 1S12A 1RT2B 2YKMA 3U1LA 2I7NA 5KT4A 2LQ9A 5EVZA 1SJRA 1J5EF 3G0ZA 3QGHA 2X74A 2FVPA 4IRKA 2JWKA 3SV4A 2RHKA 3SUPA 3D6FB 3LA0A 5AFUA 4WK1A 3C8YA 3AOCA 1NH8A 4MAKA 2XY5A 4X66K 3ZSWA 1U1RA 1SC6A 3DLLQ 4CTAA 4ETXA 5I42A 3ENQA 2UVRA 5C7PA 4ES1A 4NXMK 1M1GA 2EEYA 2OGUA 2YVSA 5D4OA 3J7Z5 2X51A 3Q83A 3D7SB 4WF9L 5A2QO 4IR9A 3MN9A 4W5QA 1P6TA 1H2UX 1XHXA 4OKJA 2QLBB 3B8AX 1GXLA 4K4ZA 4ZP6A 3CDEA 4NASA 4LRDA 3DYAB 1FDAA 3FCHA 4KB7A 4ANCA 3A8KA 3G71N 1NNDA 2EFOA 5LMUK 1WOOA 2RQCA 2X6SA 5L38A 2IDLA 4DR2J 5BPMA 2I38A 3QRRA 2JWLA 2L3MA 2ASLA 3ISZA 4FW2A 1WKKA 4DDFA 1VSJA 1VK0A 4F4WA 3NEKA 3MD3A 3B4DA 2ASPA 3US5A 2KRBA 3ZZZA 4WZQA 1JLBB 3T1YK 4RW8B 1QM9A 4N41A 4AHRA 1XBWA 4U95A 4RL1A 3HP6A 3KJFB 3CQYA 4E0DA 2O8EB 2V2KA 4OX6A 1HWLA 4F9OA 2P9PB 1T05B 1IJJA 4QYZK 1BIUA 3C94A 2BDPA 1XQIA 2L48A 2HNDB 4HT5A 1IBKJ 4Z4EA 3X3UA 1RFQA 4CM0A 4DUZF 3KLHA 4BRLA 3GOIA 1HQUB 1JLBA 4WE1B 3PW0A 3OYKA 1VQMS 4YHHJ 1HIYA 1UWAA 2B7CB 2M0GB 1NGDA 2OCEA 2RSQA 3KK1A 4P7VA 1QQMA 3OW2R 1HA1A 2JX2A 2B3TB 4G9ZA 4HI1A 1FEHA 4IRCA 4A8WA 1PBUA 3QLHA 3AT1B 4JHDA 4C3LA 1RAOA 5D0RA 3GU0A 1RDWX 1R6YA 2WBRA 2P9PA 2B56A 2HAFA 4M41A 3HI0A 1IR1A 1VJQA 3OSNA 3BR8A 4NI2B 4PG5A 1SXLA 2VC0A 3JAMY 5D3GB 1L3KA 3AA5X 2HF4A 4M7YA 2LDYA 4LF7J 1LWEA 4KHYA 2CQ3A 2OTLS 4LF5K 4PR6A 4DUYK 2IA0A 3VGKA 1RGVA 4DFPA 2PDAA 3G87A 2H51B 1TKXA 2GVDB 1KN6A 1K9MO 4CO2A 2ZD1B 2LMIA 3IRXB 4KT0C 3A3OB 4DR3F 1VCTA 4B9MA 1HL6A 1URNA 3NLCA 1V3RA 1NSAA 2DNOA 2DIVA 4OJGA 4RLEA 3SQ0A 3CCSS 2QEXS 1N8RO 4OZNA 3TVYA 4KHPK 4FLXA 1RBOB 2ZZNA 1DAXA 4JV2A 4GVLA 4CK2A 3TUJC 3VHQA 3UE5A 4FPRA 1TAUA 1HNZF 4CZLA 3RSEA 4YN3B 3U3GA 2ZD1A 3GIKA 4C98A 1YXQA 4LR9A 4BY9C 1F3FA 3SQOP 1JWWA 3A2FA 1FRIA 1GLDG 3HL8A 3MEGB 3CUNA 1TYQA 1P9QC 3FGUA 5KFZA 1MU2B 1J5EJ 1IQZA 4DV4F 1RT7B 4MKYA 3UI3A 1N4LA 3CO0P 3Q8VA 2IRYA 5AE2A 2YKMB 2N3LA 4DR6K 1UEUA 3OBIA 3MM6A 1R8AA 2CKWA 2VBWA 1GAOA 1S1UB 3R7SB 3GJSB 3T1HJ 3U8XA 1KLMB 4KR0B 3M2UA 3VAMA 5AQLA 3DLGB 5CCLA 4DV5J 2FF6A 2NZ4A 2Z1GA 3FBEA 1XMQJ 5AQMA 4JOUA 4AXIA 4BG8A 4OI1A 1VSFA 1HR0J 1FXXA 4KPCA 5HVFA 3J81O 3S7RA 1EQYA 1BUPA 1WUUA 4M63A 2DFFA 3U27A 2HOEA 3K2PA 4UOHA 4NYPA 4I67A 2QC3A 1N8RT 2FB0A 4CGJA 2O8FA 4ISFA 2QA4G 4OIXA 4JK8A 2AA4A 1KHWA 3M2UB 1S9GB 5CYMA 2V51B 3NKYA 1NSKL 4PXDA 1W2BR 4M5HA 4K2JA 1NU4A 3CWJA 3D7EO 5AJ3K 2RKIB 3CCLN 2EK6A 4KGKA 3UD3P 1S6UA 1RBRA 5EY4A 1UA1A 1LV5A 3LANA 2BUNA 3MM9B 1U8SA 2MY7A 3C15A 4ZTFA 1HW9A 4CBUA 3T69A 3QAEA 3VERA 1XIQA 4FWMA 1HD1A 3NAHA 3CI5A 2I9SA 3H2VE 5L39A 1T11A 3FCWA 2FJVA 1AYEA 4CIOA 3CJ5A 3AV9A 2MQLA 5TKWA 2DO4A 4IH6A 3R9LA 3C2PA 3EGNA 3KJVB 4WKRA 4DQ8A 1RAHB 3TRGA 3VESA 4RNHA 3L09A 4B08A 3SI8A 3ULEB 4B3MF 2YNFB 3PW5A 2R7RA 3K0SA 3VEOA 4Y1CA 3GR1A 2XLIA 3FSIA 4FJMA 3CCEN 2HRTA 4ID1A 5HOOA 3KLIA 3TJAA 3CM5A 2ZDPA 4WFAL 2E66A 1HNXJ 3R27A 1BMQB 4F0KA 1FI4A 4ZK7M 5KFDA 3I0SB 3EVOA 1Q0NA 3MMAA 4URGA 2KYXA 3IM9A 2HRYA 1WI6A 2VWKA 4JBCA 1WJ9A 4PKDB 4ZHRB 2VDHA 3NNHA 4CGFA 3NCPA 1MDUB 4I0WA 3SMZA 1ASUA 3F41A 1RI7A 2D3OR 1SC1B 4NCGA 3LPYA 2QWPA 5DG7A 3AVBA 3OYDA 1SV5B 3MTJA 4RNFA 1RWNB 2QWQA 4FF1A 5AQSA 1F5BA 1LK7A 2WFBA 3J8AA 3AA4A 4ANDA 1CXQA 2BKNA 3W2VA 4IJAA 2VFUA 4QIGA 3FUYA 1X7VA 5L1LA 2Z2YB 3UD5A 3M32B 5IWAK 4ZPCA 3PEJA 3BPSP 4F4YA 2FHJA 1EQMA 6AT1B 4JI8J 4GW6A 4DR7J 3BBCA 3H42A 1P1TA 4B3SJ 4DFMA 1Q4RA 9ATCB 1HYSB 1P90A 1T44A 1RWKB 2Q0RA 1QJHA 3RBEA 1TL7A 2ZEJA 1PGZA 1RTJA 2OPQB 3QSIA 1HI0P 3C46A 3QT8A 5HLFA 2W4CA 3W2VB 4CI6A 1NBEB 2ZBRA 4K4XA 3CCUS 2BANB 2GMHA 2P9NB 3O2IA 3NG8A 3D0HE 4DPUA 5SZTA 4HHHA 2BA9A 3SFGA 1TKXB 2BQUA 1JLCB 3TQ1A 3IG1B 3P1GA 1OYEA 1UETA 4X84A 4LFBJ 1VQ8S 3CIPA 4DX5A 3AA2A 4UY85 1H2VZ 2QMUB 2D41A 3KWMA 1VBXA 4RG8A 2FTRA 1Q5VA 5KFUA 2ERRA 3VQ6A 4USIA 3DLKA 1KP6A 1S59A 2ITGA 2KXFA 2QE5A 4Q2MA 2HBKA 4PUOB 4E1JA 5BXIA 3LDNA 4I4BA 3E1YA 4P2XA 1RUSA 2HHSA 1LQ9A 2O8FB 4CYUB 1DARA 4DV7F 1F9HA 2M4MA 4CRJA 4K4UA 4WXOA 3V81B 2HRUA 2RKIA 4CP5A 2IS3A 2WAQD 3DM2B 4P75A 5CYQB 2YKNB 1F60B 2I2YA 3K5PA 3EL2A 4KI6A 4H54A 1N5QA 4GVEA 3KWIA 2VD3A 2DO0A 4DQSA 1VIOA 1X4CA 2B4OA 4DV3F 2QFIA 3A4TA 2HW3A 1VRUB 4BR9A 3SBMA 4DS4A 4YDXA 2KXNB 3JTNA 1NK6A 4NB4A 2GW8A 1WEZA 3K7RA 3V81A 3ATVA 2KT3A 4DHYA 2KM8C 4U8VA 2YKNA 2Z2ZA 2QG9B 1D9FA 2ILZA 1IG9A 1Q95G 3DOLB 3M1VB 2R7TA 3OYBA 4FLWA 1TL1A 4DUTA 4AE5A 2VPXB 2RB7A 3Q8SB 4DV6J 2HQIA 4PXBA 2CADA 2J0WA 2CWKA 1CC7A 2VV5A 4A8OA 3SDEA 1VQ4S 3MPVA 4J9NA 5LXYA 1O51A 2YQ0A 3T9ZA 1M5VC 4KIAA 3TA1A 3KLEB 3TAMB 2NLXA 3QZ8A 3HX9A 3DLEB 3W9HA 4F4AA 3ENHA 4RBTA 3BREA 3MR7A 2C3OA 1IUJA 3MCOA 1DTTB 5L1IA 4RCHA 2NYHA 1S57A 3AOAA 2MZJA 3H98A 1VC6A 1YJNN 3IC1A 4L76A 4I6YA 3M8PB 3HM9A 1B7YB 2OIHA 4NYOA 4JI0K 5FDLB 2V69A 2IMWP 4ZP7A 1RWUA 1ZETA 1H2TZ 4TQRA 2D0CA 1RCHA 1SC3B 4FWKA 5HRRA 2HNZA 2DRAA 3E2EA 4X66F 5KOWA 4IDKA 4AF1A 4B9TA 4W98A 2AIRB 4NXNK 1Z4UA 1MWMA 1QHTA 1HBUA 4DUZK 1NM1A 3T1HF 4DU1A 4RTFD 2ZVIA 1SKRA 1EO1A 1RZMA 4JI5F 3T1YJ 1NKCA 1Q8BA 2O8CA 1BQNA 3GIIA 1VSLA 1U4BA 5C12A 1JKHB 5IOLA 3EZWA 4O3NA 3WBZA 2D1KA 3RVCA 4CJTA 3ZSRA 2CG8A 4TN2A 3QFHA 2F4VJ 3IMXA 3TSQA 2O8BB 4E98A 4Q8FA 1F0XA 4O8KA 3FZLA 2W4PA 1RCXB 3OXGA 1HYSA 1P27B 1HBUB 5ETTA 1SCJB 4H0OA 3PR4A 4QZVB 4JYAK 4KGZB 3KG4A 2ZJRQ 4IEEA 3KYLA 5IV4A 3ZT4A 2NPIA 4XO0A 5J2PA 1T0TV 4ZPTR 4KPYA 3HHLB 4UUWA 5F3TA 4LJMA 3L7PA 3EE8A 4QPXA 1UEKA 1WELA 5GIPA 3S9HA 2DBBA 4G6VB 3QNOA 4IQMA 3MM7B 3R6GB 1CPZA 2DNMA 5EHHA 3PEHA 2GTDA 4DWIA 2QMXA 2WBMA 3SJJA 2HMIA 4QIFA 5HJYA 5A6WA 2PFUA 2UXCK 2LSNA 2QA1A 2DHAA 4NXNJ 1YKWA 4HHJA 2RVJA 5LJ5Y 1PIEA 5LJVA 3PW4A 1KOOA 3Q8QB 5DQIA 4JS4A 2CFXA 2VG5B 1JIHA 3CJKA 3X1LB 3CCRS 4AQYF 1KR4A 2P9LB 3P4UB 1I94F 3DGVA 4LFAF 1ZBLA 4EO6A 2D4WA 2NRVA 4JKFA 5A8RA 4CD3A 2XG8A 4V19X 3VA3A 2ZBIA 2X78A 2GWJA 3PW2A 4OI0A 5F9LA 2OEKA 5KQDA 2OMLA 4CEAA 4JI3K 4M3TA 1RLCL 2CIMA 2DFEA 1NZAA 2BH1A 2P5VA 3SAFA 2V6AA 4C3MA 1XNQJ 2P9EA 2YPZA 4O3QA 2EKNA 3AVIA 4F3TA 1VRQC 3IAS9 1ZBFA 1T9TA 4EWTA 2MDAA 4OX9K 1NDLA 1SI9A 4WJBA 2O01C 1HQEB 2OD4A 3A5OC 2HVEA 3N6LA 4FOEA 4OPJA 2EPIA 4H4OA 3NBPA 2IJNA 3EVMA 3IWNC 1N32K 4DV1K 1MLAA 4OV6A 4OYZA 5HBMA 5B0BA 2R3VA 3AO5A 3UVJB 1N5TA 3NS5A 4XTTA 4DPYA 2QXLA 4MLHA 1OY9A 4FM2A 4ILLA 1Q9XA 4ZVPB 2O3DA 3PRBA 4KY3A 1Y00A 2HGMA 4CGGA 2A40A 4CERA 2HFSA 4C6AA 2CNLB 2WB1D 5HN0A 3C19A 1EWRA 4WPAA 5A0YB 3IWXA 3PJ9A 4B9UA 2JEIA 1M5PC 4J91A 1G4CA 1HNVA 2KRRA 3M6GA 2EWHA 4KRFA 5FROA 4EZ9A 2HMPA 4OKKA 3NDKA 5HBMB 2G0IA 4O8UA 3BGFA 3N9UC 1GMVA 2J0XA 1XMOF 2ATCB 3V6JA 2JEGA 1WI8A 4DU8A 5EOYA 1M1KT 2QM1A 4CIEA 1XK8A 3GE1A 4PKHA 3KHGA 2MHEA 3KLIB 1HPZA 1GT8A 1N36J 1RYRA 3M8QB 2QX0A 3R7BB 1PJ5A 3OVNA 1X5PA 3I55N 3KK2B 2K3IA 4PKGA 1AUSL 4BVOA 5F0UA 3FBBA 1N32F 1D9AA 4M3YA 2J6UA 3L95X 3KD1E 3CC2N 3GQCA 1HKCA 3V1RA 1C1AA 1VRTA 4U7CA 4OX9J 2CGKA 1FEEA 3RJMB 3UKUB 5KFJA 4QCLA 4RPFA 4CO1A 1X4FA 2A41A 2HGLA 2CZ9A 2GQCA 3AVHA 4CZJA 2BUPA 1B0TA 2A42A 2NS1B 3VQQA 1R8HA 1SB6A 2XSJB 5HVGA 4BRKA 2BR0A 4Q7AA 3RW6A 1ITGA 2WB4A 4KHUA 3GTYX 1VFJA 1FFGB 5HP1B 3MR3A 1APSA 3EXCX 1FDNA 4FZXC 2J8AA 1NRKA 3SIPB 4C97A 2M3DA 4YQWA 1ZAVA 4WXWA 3PVXA 1H38A 1Q16B 2QMWA 1PAUB 3AO2A 1VAZA 4OO1J 4A61A 2BKOA 2YHAA 3D66A 4BG9A 2NCKL 4EBCA 1UJ6A 2V7ZA 2OA8A 4IQXA 3KG0A 2V34A 2PN6A 5GAHI 2NXCA 3GJTB 3H6EA 3W5ZA 4BC7A 4CLUA 5DLGA 5C42B 5BN8A 3VALA 5IT9O 2F9JA 4MFBA 2HEKA 3EGVA 2UUBF 1NDCA 4ECTA 5JVHL 3PDNA 4JKAA 3V2UC 4K43A 4B9SA 3G8TA 5CABA 3KLFB 1HI1A 3W1YC 4X62J 4CJLA 4P71A 3ILJA 1WC1A 1RWXB 1R8PA 2LCWA 2WRMA 4MTPA 1VQ5S 2P9LA 4NLOA 3ZLJA 1S1TA 4GVMA 4FWSA 2DPJA 3MOJB 3FZFA 5BRFA 2U2FA 3VQBA 2Y0BB 2W8KA 3ZNJ1 3K57A 4XDDA 1FJCA 5HL7L 1R7IA 2N4CA 5F0WA 4Y65A 4TU7A 3QNWB 1BU6O 1FJEB 3OTOK 1BDGA 4UY8O 2V63A 4CEFA 4QOTA 2PA8D 4KV8B 2BW2A 3GMGA 4CF2A 5DGAA 1LWFA 3RRHA 3LQVA 3U1MA 4BDYA 2OSQA 3I5CA 3CDBA 3CCSN 2ILYA 2JOQA 4M3ZA 3MHYA 3O6QA 1MMNA 2DNKA 3M6UA 5CA5A 2BJEA 2ZFHA 1CS4B 1NGFA 1YUWA 3IBCB 4X66J 1XC9A 4NL5A 1DBDA 1KVAA 4IXCA 3TVZA 5ETSA 2IY5B 5IM0A 5DMRA 1HNZJ 4HWIA 5JVGQ 1RJJA 4DU4A 5HROB 3NWGA 4IEIA 3C7NB 2Q3SA 1SC4B 2FBVA 4YR0A 3RBXA 2RQMA 4HHTA 4EK2A 2HGNA 2VGNA 5CZ1A 3MXHP 2J6SA 3CCMS 1U25A 3W2WA 4U67Q 2UU9K 4HH1A 2AYBA 3BY5A 2GC8A 1AA1B 4RBUA 3ENBA 3OV7A 4FZVA 1GNKA 3EJMA 1B4SA 4OFZA 2CH6A 3DRPB 4ELUA 2PE8A 2CQ4A 2XMMA 1IKWB 5KFBA 4CH1A 2WTUA 1A6LA 5JLHA 2CJAA 4FM0A 5F8LA 4FJJA 1I3AA 5CD4A 3M6XA 4B8CA 4J37A 2MHNA 2BYCA 2YX1A 4WFBL 3HHNB 2HNYB 5H1SV 2KG0A 3DXMB 5BR8J 1H6KX 3RUBL 3CMAS 4CLZA 4ZIVA 4DLGA 5BYSA 1OY6A 4J2EA 4FO0A 3IBWA 3GV8B 3I9ZA 5AQXA 3I96A 1DLOA 2K1RB 1T02A 4O4GB 5I3PA 1EP4B 5I3UB 4JEPA 4YHHF 3NGUA 4NLBA 2OEJA 2GAGC 1TK0A 1HBOA 4WP3A 4YOWA 4H4KA 5GAHP 3NRBA 3LF0A 3DXMA 1U26A 1EZZB 1S48A 2QLXA 5AQVA 1K1SA 4YHHK 3QIPA 4DEZA 4FLVA 3PW7A 2RU3A 1R3NA 3L3UA 1BA1A 4FLTA 5H9FJ 3D6MB 4Y2CA 2Z1IA 1Q18A 1N6QA 1RHRB 2DXEA 3OFFA 2ZE2A 1RGIA 2VG6B 2OZSA 3NP5A 4DFKA 2O4GA 3PV8A 3KLEA 4JI7J 4OGEA 1ZPWX 1TKZB 3AJDA 4OYIA 4E7KA 5GMEA 4KFBA 3NGSA 4PQUA 3GZ7A 4H0XB 5A8WB 4LF9K 2YKOA 3VN5A 2QEXN 4OLBA 3WEEA 2RIJA 2YBVA 2HK3A 5DG9A 2OJ3A 2RUSA 1VMBA 3SCLE 4GC6A 2NRWA 1U1PA 3CO9A 4AL5A 2GIQA 4WIQA 4H4MB 3CETA 1OYDA 3T41A 1UJ4A 3ZT3A 1AZSB 2KJVA 1NK8A 5J2MB 4AM6A 1RHKB 3WNGA 1ZOTA 2QN6B 2W9CB 3EDQB 2HG4A 5JMVA 1LXJA 4ZLJA 4PPDA 3Q23A 2V67A 2XO6A 1NK7A 2GIRA 3DGPB 2F4VK 3OSPA 3MM5A 1V3ZA 1FRHA 1WSJA 4Z2XA 2XNQA 2IRXA 3L2UA 1IKVA 1BQNB 1L3TA 4JD2A 2UV8A 3PACA 2L41A 4FKXA 3V9XA 5K20B 4QJVA 4PA1A 1G2EA 1VQ7S 1LW0A 4WE1A 1NB7A 4ILRA 1RWMB 1U48A 1HWIA 3LM2A 3BSOA 1UAXA 1I39A 4Y34A 2W9CA 1NMDA 5KFRA 4NEZA 2V2VA 1FJGJ 4NCAA 2EFNA 1T3NA 3ENWA 4CHQA 2PZSA 5F2RA 3MEEA <