1J5OA

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j5oA05
5KRSA 1RNHA 1C2PA 1CLQA 1JX4A 4PA1A 4RW8B 3OJSA 4JS4A 1SKSA 4RW7A 1CZ9A 3CYMA 4CK2A 4IH6A 3QETA 5J2NB 4OVLA 1JLFB 1A5XA 3L3UA 1RT6A 4FLTA 4FJMA 3KK1A 4ID1A 1A5VA 4KTQA 4EBDA 4O3SA 3Q8SB 2R8GA 5J1EA 4LH5A 3ZSYA 2R8HA 3TAPA 5KFXA 5KFQA 4CERA 1GOBA 5I42A 5L1IA 4ECXA 2I1RA 3UIQA 4W5TA 1S0MA 2W42A 2GUIA 2X74A 4DF8A 3AVMA 3BSOA 4LQ3A 4NLTA 5HP1A 4DTMA 1D9FA 3HPGA 2W8KA 1F21A 1QTMA 1K6YA 3SI6A 4PQUB 2IC3A 3MR3A 3K5NA 5DLFA 1OS5A 3RMAA 1N6QB 2HHTA 3LP1B 1S1TA 1C0MA 1DLOB 2UUWA 4KI4A 5E41A 3G6VA 3PUFA 5L1KA 2YHBA 3QLHB 1RA7A 1SH3A 2FJXA 4DFMA 2VA3A 3CDWA 4NZ0A 4ECSA 2O5DA 2HHQA 3VQCA 2WONB 2B43A 3SUQA 3GV7B 4KHRA 1WSIA 4GC6A 4CJLA 3DOKA 1S9GA 4ZPDA 4CJSA 5CZ1A 2DFEA 3OYDA 3JYTB 1WAFA 1KHVA 4OGCA 4F2SA 4HUGA 1I3AA 3BSAA 2Y1IA 3UDLA 3E01B 4B3OA 3QGIA 3UR0A 3BJYA 3KKSA 3O4NA 1LAVA 5KG6A 4KAIA 3CJ4A 1JIHA 3BDPA 2D3UA 3U3YA 4DTXA 1BQNA 5CY4A 3KHGA 1BIUA 2R8KA 4H4MA 3CM6A 4FW2A 4X2BA 4TSXA 4N5SA 3DOLB 1BCMA 3RB3A 1IKYA 4CFDA 1BQMA 5HROA 1S5JA 5HLFB 3KLFB 3M8SA 2IDOA 5I3UA 4JV2A 1QE1B 3DLEB 4FW1A 4TY8B 3KD1E 2XY7A 2BR0A 1T03B 4M3XA 4CJTA 1DTQB 4RU9A 4DSLA 4RW8A 4ECQA 4QW9A 4Z4GA 2WB4A 1WSHA 4Q0BB 4E1NA 3QEWA 5J2NA 4QWCA 1JLFA 2HHXA 1KVCA 3OYLA 2UVUA 4M42A 4Z4IA 4O44B 1WSFA 4O0IA 3DM2B 4CJUA 3V9ZA 5D3GB 4DEZA 3OJUA 1NK0A 2AX1A 3NDKA 2IM2A 4CHZA 4FK4A 2CJQA 4ZPAA 4JLHA 4DTNA 4YQWA 1VK0A 4B9MA 2ATLA 3OLAA 4DSFA 1NJYA 3QIPB 4FJKA 4QWBA 3CFOA 3ZSVA 1GOAA 3I0RB 2W7OA 3AVFA 1ZTWA 3DI6B 4PQUA 3CWJA 3RBDA 2AGQA 2HNYB 1N6QA 2ZE2B 3LP1A 1XHXA 4FJLA 4DSEA 1RT1B 3U6FA 4ZP6A 2G8HA 1LW0B 5J2PB 1DLOA 5HBMB 2X6SA 2EC0A 3PVXA 1SKRA 3N6LA 1TKZB 1N5YB 5CYMB 3MECB 1WSGA 1NK6A 3PY8A 3QLHA 1U47A 5KG5A 4DL3A 4E1MA 4CJ5A 1U48A 1QS4A 4CJFA 3TQ1A 1BGXT 2X6NA 3NE6A 2KZMA 1NOYA 3SUPA 1C0UB 2WONA 1JLQB 1S1VB 1YT3A 2OPPB 2JC1A 5KFTA 3TAEA 5JXSA 3OYIA 3VQ4A 3ZSQA 2ITGA 3ZSWA 3JYTA 4WZQA 4ZP9A 2IM0A 1JKHB 2Q3SA 4RNFA 2WCXA 3HYFA 2VWJA 2VG6B 4FLYA 2VG5B 4EZ9A 1NK5A 1MMLA 3RBEA 1QSYA 3AA2A 3E01A 2FLLA 4ELUA 4QCLA 4Y3CA 4AHRA 4DLGA 1IG9A 2ILZA 3LAKA 3H5YA 4H54A 3BR9A 4KI6A 2G8VA 3ISNC 3CJ5A 2O4GA 1U45A 5KG3A 3H08A 4LY7A 2XHBA 5C24B 1TP7A 3DOLA 3NMAA 3NBPB 1TAQA 1HJRA 1L3TA 4QWDA 3H2LA 3AVJA 5C5JA 3KMSA 3GIJA 4ED2A 5HLFA 5KFUA 3KLFA 2IMWP 4E0DA 2HVIA 1S10A 5DQIA 1QE1A 3DLEA 4TY8A 3LP3A 4NCGB 4O55A 3E51A 2HWIA 1T03A 4IG0B 1DTQA 4FZZA 1ZBFA 2XCPA 3H98A 2OZSA 3F9KA 1FKOB 4Q0BA 4M3YA 4DQSA 4DG1B 5J2MB 4CFBA 4RW4B 3VN5A 4R0EA 4HUFA 4O44A 3NGYA 1RTJB 1QHTA 1VSHA 3ITHB 3LP0B 3DM2A 5D3GA 3NAEA 1IKXB 1ZYQA 1RTIB 4KBIA 2EX3A 4CF9A 1XC9A 1NJZA 3LAMA 1IH7A 4OL8A 2C2DA 2OZMA 2JC0A 2ALZA 4ECZA 4O3QA 1HRHA 4LD0A 3BSNA 1KLMB 1RTDB 3QIPA 1RCHA 3KHRA 2BQRA 3I0RA 4RUAA 2E9TA 4OPJA 3HP6A 1NJXA 3TAMB 3G86A 1RILA 3NH2A 4TYAA 3CO9A 2FBTA 3O4QA 4H4OB 4BDZA 3DI6A 4W5OA 3EY1A 4KPYA 3QO9B 3K5LA 3V6JA 4Y1CA 2HNYA 2ZE2A 1RT1A 4FK0A 4DQRA 1FK9B 1LW0A 5J2PA 4B9NA 5HBMA 3V4IB 2YHAA 1TKZA 3V81B 4JV1A 1N5YA 1KSPA 5CYMA 3MECA 1KTQA 4IFVB 1HYSB 2HW3A 1U4BA 1TAUA 4ELTA 4TQRA 4BDYA 4HCCA 3BREA 5J2QB 3D28A 2R2SA 4I2QB 4TN2A 2XI2A 4TQSA 3SV4A 1ZBUA 1C0UA 5T7BA 3V6DB 4ZTJA 1S1VA 3MXIA 5F8IA 2OPPA 4E7IA 3MR5A 1HNIB 2FBVA 4NLOA 4EP5A 4OPKA 4XO0A 4NRTA 1JKHA 5EUHA 4FM0A 4NCAA 3PJWA 5K14B 3BQ0A 1TV6B 2VG6A 3RWUA 4KREA 2VG5A 3AA4A 4RW7B 4EBCA 2BGGA 5HRNA 5DMRA 4CK3A 3SQ1A 4K8XA 2ETJA 1T8EA 2HVHA 3LWMA 3THVA 3BSCA 3SPZA 3KK1B 4CECA 3K5MA 3PO4A 4W5RA 3OLBA 1KFSA 3V6KA 4KHWA 4I9QA 4KHMA 3LPUA 3V1RA 5C24A 2AX0A 3S3MA 4KTZA 1JLBB 3NBPA 4DU1A 3OYAA 1BI4B 2IBKA 1T94A 4M3UA 4QWEA 1S1UB 3HM9A 1KCFA 1HARA 3V6HA 4RZRA 4CJQA 1ZBLA 1S4FA 3NF7A 3OYKA 4NCGA 4YMEA 1NK9A 3H5SA 4FJ9A 2RF2B 1W0HA 1CZBA 3LPTA 4IG0A 1EX4A 2Y1JA 1FXXA 4GC7A 4ZVFA 2QKBA 2FC0A 1FKOA 5DK5A 4DG1A 3DLGB 5J2MA 3NFAA 1NKEA 2B5JB 4RW4A 4ZPBA 4M94A 3AVIA 2E4LA 5KFLA 4C8KA 1RTJA 3OYFA 4M45A 2HNDB 3OYMA 1A5WA 3ITHA 3LP0A 4R5PB 5KFDA 4ED8A 3G10A 1RDBA 4O3PA 1IKXA 2HWHA 2GC8A 1BISA 4CGHA 1RTIA 1Q8IA 2GV9A 1IKWB 2G8WA 5JUMA 3OYBA 2HHSA 4NLWA 4CCHA 1K1SA 1S9EB 4TYBA 1KLMA 1RTDA 5KGXA 2X78A 3KK3B 2R2RA 2WHOA 3TI0A 1VSIA 4I7FB 3TAMA 3CJ0A 4ECWA 2XC9A 3SJJA 1HYVA 3NGDA 4H4OA 3KTQA 4KKOB 1RT7B 3QO9A 4DFPA 3L2WA 3I5AA 3SQ4A 3ULDA 3ISND 3BQ1A 4ED6A 2JEJA 4CF8A 3NKYA 1FK9A 3OSNA 1J54A 4I2PB 3V4IA 2VG7B 4LSNB 4KHNA 3V81A 5CZ2A 1VSEA 3MEDB 2C2RA 4OJRA 3QIOA 4IFVA 1HYSA 3SCXA 1TGOA 4JRPA 4CJKA 2V9WA 5J2QA 4I2QA 2DFHA 3HT3A 3HPHA 3DRSB 5EWFA 3GIMA 3K58A 1RYRA 3V6DA 1UAXA 2QV6A 1ZBIA 1HNIA 3KLVA 3OYNA 4CGIA 3SNNA 3H40A 3T3FA 3NH1A 3H59A 4EO8A 4YNQA 4FLUA 1U49A 5K14A 3O3FA 1TV6A 3Q8PB 1QAIA 1RTHB 1L5UA 4DTOA 4O5BA 1HNVB 5KT7A 2FJVA 1N48A 5SZTA 3RB6A 4ID5B 4NLYA 1Q9YA 3VQQA 3OSPA 2B6AB 3DLKB 4Z0UA 1VSKA 3VQSA 4C8LA 1SKWA 4OKEA 1N4LA 1JLBA 1BI4A 3RB4A 2J6TA 1S1UA 4OLBA 4B8CA 2XY5A 4QPXA 4CESA 3RAQA 1C1AA 4CJ4A 4C8MA 3GYNA 4RW9B 1EP4B 2IA6A 2RF2A 2AU0A 1JLAB 5KFNA 2V4QA 1RBUA 4CIEA 4B9SA 1WSJA 4ED1A 2FVRA 2J6SA 2ZD1B 5KFBA 5KTQA 1NK4A 3DLGA 2DTUA 4DQQA 3IAYA 2B5JA 5DG9A 3GQCA 4IRDA 3SYZA 2UUTA 4CHYA 1NK7A 4H8KA 2HNDA 4R5PA 4WYWA 5KFOA 4MKAA 1LW2B 2D41A 3T5KA 4URQU 4M41A 1IKWA 2QXFA 1D9DA 1CXQA 4F2RA 4IR9A 4F4KA 1B9FA 4MFBB 4L8RB 5KFAA 2C28A 4Q8FA 1YVUA 1S9EA 4ED0A 2W9AA 3KK3A 2JEFA 1ITGA 4FXDA 1D5AA 2AGOA 2RDIA 3NAIA 2KFNA 1SUQB 4HTUA 4CEEA 4I7FA 4DTPA 3I5BA 2EHGA 4EBEA 3LALA 4FJXA 4KKOA 2FLPA 1LAWA 5KT3A 2WK4A 1RT7A 1NJWA 3T1AA 3HPOA 4R8UB 3ASMA 3EPGA 2YNHB 4FZXC 2G8UA 4E7KA 2ILYA 1VSMA 4I2PA 2VG7A 4LSNA 3MEDA 3M9MB 4MK9A 3M9NB 3JSMB 1TKXB 2BRLA 3PW2A 2YKMB 4RG8A 1L3UA 3DRSA 4CK1A 2RPIA 4FCYA 1QUVA 5DGBA 2NUBA 3EPIA 1ASUA 2DY4A 2ASDA 4PWDB 2WRMA 1RTHA 4ZTFA 1UA1A 2HNZB 3GILA 4FJIA 4MK7A 4JRQA 1HNVA 4ZPCA 4AHSA 4RNOA 3WNEA 4IR1A 4ID5A 3LP2B 5FROA 2B6AA 3DLKA 1BL3A 1J53A 3VQ7A 3T5JA 3QERA 1QAJA 4ELVA 1IO2A 3SQ2A 3AVGA 3G6YA 2XCAA 2GIRA 3OYJA 4K4SA 4DS5A 4F3OA 1DTTB 1HMVB 5KFYA 3KNAA 1RDDA 1NKCA 3V9SA 4DTUA 1RDRA 4G1QB 4XIUA 3NGIA 3PJXA 2WTFA 5F8LA 3IGVA 3T5LA 1Z26A 2FBXA 5CYQB 1ASVA 2YV0X 4CEDA 2QE5A 4CFCA 4Z4EA 2PZSA 4RW9A 1EP4A 3L2QA 3LDSA 1JLAA 3OYEA 4F4WA 4U7CA 4ZP7A 2XGPA 3NAHA 1VRTB 3LZIA 3EYZA 2ZD1A 1VSFA 1LWEB 3IRXB 3QNOA 3PV8A 4DU4A 4KHSA 4FJ8A 3MEEB 3PHEA 4N56A 1NHUA 3AVKA 1LW2A 4OKKA 4DTJA 1FKPB 3CM5A 4F4ZA 4DSIA 2W7PA 4RNHA 4MFBA 4MKBA 1ZETA 4J2AA 4FJHA 5HRSA 2JGUA 4CHPA 4FJGA 1UOCA 3IG1B 1SUQA 5KG2A 1S6QB 4RNNA 4BWJA 2BANB 3MXJA 3AO4A 4O4GB 1L3VA 2HHWA 4R8UA 4CEZA 1UA0A 2YNHA 4IRKA 3KHLA 1YTUA 4DFKA 4WXWA 3AVBA 4DS4A 2G8FA 4ZVEA 1SL1A 2YKNB 3JSMA 4CJVA 1TKXA 4CFAA 4CHQA 2UVRA 2YKMA 1D1UA 4DLEA 2WOMB 3GV8B 4Z4HA 3M9OB 4AHCA 3OL7A 3HK2A 2ASJA 1TKTB 3PW0A 4E89A 3OY9A 3KK2B 3RR7A 4PWDA 3AV9A 2HNZA 5KFZA 4Q44A 2D0AA 3BGRB 3ZT2A 3QYYA 2KW4A 4MH8A 2Z1HA 4C8NA 3VQ8A 3LP2A 4EYIB 4ED7A 2JEGA 4GVMA 3H4DA 2LSNA 4NLDA 2OPSB 2HAIA 2A1SA 2JEIA 3L2VA 4RUCA 1DTTA 1HMVA 4KB7A 5C42A 3AO1A 4QWAA 3SZ2A 4IDKB 3ZT4A 3PO5A 3DMJB 1C1BB 4G1QA 5C25B 1W9HA 1MU2B 2V4RA 3WNGA 5CYQA 1RBVA 3VQAA 3P1GA 2D0BA 4F50A 1NK8A 1RT5A 4M3TA 3MR6A 1NNDA 4B8AB 4NLXA 2OH2A 3QEVA 4M3RA 4DMNA 1VRTA 1LWEA 4FS2A 4TXSA 2OYQA 3IRXA 4O3RA 4KTWA 1WNEA 4DQPA 4ZHRB 1QSSA 4DTRA 1SH2A 3MEEA 3FQLA 4BE1A 5L1LA 4URSA 3D5MA 4KHUA 3MFHA 1S49A 4LSLB 1FKPA 1C1CB 1KRPA 5FRNA 4O0JA 4WYLA 4ZVGA 1HPZB 3FRZA 2FVCA 3IG1A 1R0AB 2JLEA 1QSLA 4NRUA 4CEQA 1S6QA 1SV5B 5DGAA 2BANA 3CIZA 4IFYB 4CIGA 4RW6B 2C2EA 4O4GA 5DQGA 4CEOA 1C6VA 4IG3B 5DG8A 4OKJA 4ZVHA 2OA8A 4OLAA 4CF0A 1T05B 2XO7A 2FVQA 3VA0A 1JLGB 3SQ0A 3P5JA 4ECYA 2E6LA 3AO2A 3GIKA 2YKNA 4ECUA 3EZUA 1RAJA 3C6UB 5EWGA 3OS0A 2WOMA 4W5QA 4YR3A 3NL0A 4AH9A 4MK8A 1XR7A 1TL1B 4DQIA 3TANA 2OPQB 2RKIB 1TKTA 4J2EA 5KFVA 3PR4A 3KK2A 2W8LA 3QGGA 3RMBA 4QAGA 4KE5A 4Y34A 1YTAA 2IM1A 5KI6A 3BGRA 3N6NA 3V9WA 2IAJB 3KHHA 4HUEA 3IN5A 3SUNA 3G0ZA 1WNSA 3HVAA 4YR2A 1VSJA 3ZSZA 4NLSA 2OPSA 3D0PA 2CKWA 3MTKA 3KLHB 3G6XA 4J9PA 3AVAA 3MF5A 5FRMA 4IDKA 3DMJA 1C1BA 5C25A 3HL8A 3KLIB 4DWIA 1MU2A 3AVCA 4GMJB 3QZ8A 4ZP8A 4WXOA 2C22A 1HYZA 1LWFB 1VRUB 2FVPA 4FVMA 2F8SA 3M8QB 3L2RA 4IH5A 1JXLA 3NHGA 4FLVA 4Y2AA 2YNFB 5KFIA 2W9CB 1RA6A 2PYLA 2R2TA 3QEXA 3T19A 1UWBB 4ZHRA 1RBRA 4HKQA 3BQ2A 1NKBA 4FM1A 3L8BA 4MQ3A 4LSLA 1C1CA 1J5OB 5L9XA 1XI1A 1TK0A 2O4IA 4I9LA 5FDLB 3RRHA 1HPZA 3MAQA 3TAQA 3AO5A 1R0AA 4KSEB 1WAJA 1REVB 3PW4A 1SV5A 4NLRA 2PY5A 3KOAA 4IFYA 2IJNA 4RW6A 4IOBA 1KVBA 4IG3A 4FZYA 3UPFA 4YP3A 4IBNA 1T05A 2E6MA 1JLGA 3T5HA 3KMQA 1J9AA 2QK9A 2RN2A 3VQEA 1SL0A 3K5OA 4WFZA 3ZSOA 3GIIA 2E9ZA 4O3OA 3C6UA 1YVFA 3K59A 3C94A 2R7YA 4PUOB 4EO6A 1Z25A 3V9XA 2YNIB 3M8RA 4KHQA 4DSKA 1TK5A 1EXQA 3OYCA 2Z1JA 3K2PA 3OVNA 4E7LA 3KLEB 1TL1A 4WFYA 2D0CA 2OPQA 2RKIA 5F9LA 3NF9A 4URGA 2AJQA 4J2BA 2ATQA 3HKWA 4M3ZA 4KV8B 2IAJA 3PR5B 4CJ3A 3ZT0A 3MEGB 3OHBA 3NCIA 2OPRB 5KT2A 4DTSA 1EETB 1BHLA 4TY9A 1W25A 3C6TB 5KFKA 4J9NA 4J9OA 1S0OA 4FJ5A 3KLHA 5KFPA 1RT4B 2QKKA 3VQ6A 1TK8A 1TVRB 2F8EX 1RT2B 2Z1IA 3L3VA 3KLIA 1XR6A 2AGPA 3OHAA 3OL8A 4E3SA 3MR2A 1RDCA 1I39A 4FM2A 3LZJA 4Q45A 1LWFA 4CHNA 1VRUA 4WZMA 3DLRA 4WE1B 4CGFA 3OS2A 3M8QA 1SL2A 3Q8QB 1B92A 1JXEA 3HVRA 4XPEA 1RT3B 2P5OA 5KFEA 3HJFA 3KLGB 4OGEA 3B6PA 1S6PB 4CJWA 1CSJA 2YNFA 1EKEA 5KFHA 4AILC 2W9CA 3OYGA 3AVNA 1U04A 3RMDA 2AQ4A 1WSEA 2XGQA 3VQBA 2FJWA 5KT4A 2HHUA 3HXMA 1UWBA 4TLRA 4F8RA 3TR8A 4UQGA 2VWKA 2BDPA 1XR5A 3DYAB 4YR0A 5KG7A 4HVJA 3MFIA 1Q9XA 1GX5A 1J5OA 4O4RA 1D8YA 4NLPA 3TVKA 2HMIB 4JS5A 5FDLA 3CJ2A 1N56A 3NF8A 4CEFA 4CF1A 3PX0A 4N47A 2GIQA 3ZSXA 1REVA 4CEBA 1TL3B 1X9WA 4NLVA 4NLUA 5KFSA 1WLJA 5EU7A 2XY6A 3S3OA 3DRPB 4BE2A 4CJRA 2R8JA 3D45A 5F8HA 4J9SA 2DPJA 3O3GA 2I5JB 3GV5B 2IJFA 4DL6A 1X9SA 4Z4FA 1S97A 1BIZA 1QQCA 3V1QA 5C42B 3IGNA 3NF6A 4J9LA 3AA5X 2UVWA 4BWMA 1ZBHA 4JV0A 3LWLA 4PUOA 2R8IA 2YNIA 4E19A 3SPYA 2A1RA 4IKFA 1RT5B 3KLEA 3L2UA 4KB1A 4KO0B 4KHYA 4FYDA 4CHOA 3FQKA 3QINA 3QIDA 5KT5A 3TABA 4FLWA 4U6PA 4DSJA 2KFZA 3A2FA 4B9VA 3OYHA 2GBZA 5KFFA 4KV8A 5KFWA 1BCOA 3VQ9A 4J2DA 3MEGA 1K1QA 2OPRA 1L3SA 5T14A 1HQEB 3CFRA 1EETA 1VSDA 3C6TA 3CQ8A 1VSLA 3HVTB 2ASLA 4CGGA 3QZ7A 3SFUA 1RT4A 4FLZA 2UVVA 1TVRA 1RYSA 5KG4A 1RT2A 3I8DA 3I0SB 5KFGA 2F8TA 1NOZA 3SI8A 3AA3A 4G3IA 4AHTA 4J9MA 3VA3A 3DLBA 2IOCA 3PW5A 2FLNA 2D5RA 4W5NA 1RDAA 1KHWA 4WE1A 3RTVA 3ICLA 4CGJA 2BRKA 2PYJA 4F3TA 1C0TB 1RT3A 4B08A 3PX6A 3KLGA 3KKRA 1S6PA 4B9LA 3IS9B 3FFIB 1JXBA 3KIOA 1RBSA 5EDWA 2R2UA 1U09A 1IM4A 1S0NA 4F4XA 4Q8EA 1IKVB 4K4TA 4QOZB 4AHVA 3DYAA 5KG1A 3M8PB 1S1WB 5KFRA 1CXUA 1T7PA 4ZMMA 3QESA 4K4WA 4IH7A 2HMIA 4KAZA 4IKAA 3C95A 3EZ5A 1KLNA 2G8KA 1TL3A 1O1WA 4MIAA 4NCBA 3V9UA 3UQSA 3VQ5A 3DRPA 4CEAA 4DFJA 2D7SA 2BE2B 3N6MA 4NYNA 4K4VA 2D3ZA 4FJNA 2XWYA 2HB5A 3FDSA 3KJVB 1TKDA 2I5JA 4QW8A 5DQHA 1NHVA 1LV5A 1LWCB 1HQUB 2Z1GA 3K57A 1JLCB 1D0EA 2P1JA 5DLGA 3RB0A 2YNGB 4CF2A 5F8NA 2E9RX 3DRRB 4KFBB 4IRCA 4E7HA 4DF4A 3WNFA 3I5CA 4KO0A 4DL2A 4J9RA 1X1PA 2V0NA 3SUOA 4HHTA 3RRGA 4Z4CA 3OL6A 4DU3A 3QEIA 1JLEB 1KFDA 1S1XB 4Y1DA 3TARA 2IGIA 3QNNA 4IQXA 5KRTA 1HQEA 2W9BB 2XI3A 3WNHA 3AO3A 1S48A 4CGDA 3LANA 3HVTA 1S9FA 4FK2A 3CFPA 4BDPA 3O3HA 4DL5A 1X9MA 2KTQA 4K50A 3H5UA 4ICLB 4KB0A 3SFGA 3RMCA 5KT6A 4K4XA 1I6JA 4CE9A 2FBYA 4C8OA 3I0SA 3H4BA 4K4ZA 3S3NA 5KGWA 4ED3A 1JLQA 3CDUA 4FJ7A 4LH4A 3CVKA 3ZCMA 3MXMA 3AVLA 4K4UA 3TWHA 4KRFA 3ZSRA 2DPIA 2BQ3A 1C0TA 3NGZA 4Y2CA 1SH0A 1WN7A 3OL9A 5KFCA 3IS9A 2AWZA 3FFIA 3QGHA 4AHUA 4NYFA 4FS1A 2F96A 5KFJA 3H5XA 4E7JA 1RT6B 3ALYA 1XHZA 5EWEA 4M95A 1JL2A 4K4YA 1IKVA 1ZTTA 4FBTA 1RBTA 4GW6A 4EZ6A 5J1EB 4B9UA 1GX6A 4BE0A 3CG7A 2IM3A 4FBUA 3M8PA 4K8ZA 1S1WA 5HRPA 3PZPA 3V1OA 5I42B 4NYZA 4M3WA 2BQUA 1G15A 1Y97A 3ZT1A 2P5GA 3DDKA 4J9KA 4ECRA 3P83D 4N76A 5HP1B 2ZKUA 3NH0A 1T3NA 5HRRA 3OS1A 5F9NA 3RR8A 3CJ3A 2IC3B 2BE2A 4RNMA 5JS1A 3HO1A 3SV3A 2KZZA 1S1TB 4XPCA 3KJVA 3KD5E 2DFFA 2KQ2A 3HHKA 3HSTB 5KFMA 4N41A 4DL7A 4HYKA 3PW7A 1LWCA 3AVHA 1XWLA 5SWMA 4EEYA 4Q43A 1HQUA 4CIFA 5F8GA 1JLCA 4CJPA 1ASWA 4ECTA 3FSIA 1GOCA 2XY8A 4DL4A 4B9TA 2YNGA 3DRRA 2RDJA 2XRIA 4HCBA 3DOKB 4KFBA 1S9GB 3RAXA 4F4YA 4O3NA 3B6OA 4Q5VA 3U3GA 2ZQBA 4ECVA 2IS3A 2G8IA 1JL1A 4NLQA 5F8MA 1B9DA 3HVWA 5JS2A 4FLXA 1JLEA 1TQLA 3F73A 1S1XA 4B3OB 4WFXA 2B4JA 5L1JA 2VA2A 4CJEA 3PX4A 4NLGA 3S9HA 1KVAA 2W9BA 3DLHA 4PY5A 3QEPA 2HHVA 4EP4A 1BQNB 5F8JA 4H4MB 3ZT3A 3TAFA 4FJJA 4LQ9A 4ICLA 3VQPA 1IKYB 3TAGA 2P51A 1BQMB 5HROB 4MIBA 4EYHB 1Z4UA 4BACA 3VQDA 4J9QA 5DG7A 2FVSA 4JUZA 3Q8RB 3HP9A 5I3UB 3CDEA 5KG0A 2J6UA 4YFUA
chains in the Genus database with same CATH superfamily
1UVJA 1RNHA 3J7ZO 1QUPA 2QSWA 1OKJA 3LDQA 1JX4A 4LF4K 3H20A 2PGCA 2AEFA 2EFVA 1N0VC 1CZ9A 5J2NB 1JLFB 1RT6A 4N8NA 4OI6A 4B3TK 1GMWD 4FJMA 3TRGA 3VGTA 3OD2A 3WQTA 4FF2A 3MM7B 4KTQA 3W9IA 4O3SA 3KWIA 2CQ1A 3TAPA 1URNA 1WG1A 1WEZA 1GLJO 2YQ3A 1CZAN 4LRDA 3QRQA 2D4WA 3QWPA 1NUEA 1L3KA 3HHLB 2QMXA 1OJ4A 4AD6A 3S7RA 1SJRA 4CP5A 3CB4A 4JKGB 2UZAA 1OS5A 1X4EA 3LP1B 5AQWA 1EQYA 1DLOB 2UUWA 1Q82O 2VQEK 3Q86A 3VGSA 3CC7N 4CT8A 4X84A 3LTOA 1WC0A 2XNRA 2YKOA 4DFMA 3CDWA 3D6FB 4NZ0A 4ECSA 1NEEA 5F0XA 2HHQA 2RT3A 4YB7A 2X3GA 1N5VA 5A6WA 3DXKB 3KG0A 1QAYA 4DBQA 2DFEA 1QHAA 1WAFA 1U1KA 5D78A 3GOIA 3GTYX 3UR0A 4I6AA 3BJYA 3PCOB 2VIHA 3KXDA 3BDPA 3U3YA 3W66A 3GB0A 1RABB 4D3HA 1HQ2A 4Z2XA 5CY4A 3MM9A 1BIUA 4H4MA 3VEOA 3CM6A 4TSXA 4CO2A 2QA4N 2Q79A 4ATNA 4JOUA 3C7NB 2W25A 5HROA 4B3MF 2V2VA 4U96A 1RI7A 3MN5A 3G2XA 2CIMA 3S8SA 4NLCA 5I3UA 2KKHA 1XNRK 3KD1E 4JI4J 1VYAA 2XY7A 2QLWA 5JMVA 2KHCA 2APOA 2DIVA 1OQ3A 4RW8A 2FJEB 2R3VA 4QW9A 4A59A 4Z4GA 2WB4A 3UNYA 4Q0BB 4E1NA 3T1YK 1U1PA 3QEWA 3R6GB 1XMQK 3OYLA 2UVUA 3MOJB 5EHHA 2DK2A 1S22A 1WSFA 4O0IA 2AV5A 3TO8A 1T6DA 4DEZA 2HLUA 2YX1A 2AX1A 4FK4A 3P5TL 4B9MA 3OVSA 1DGKN 2B4PA 2ZITA 4DSFA 4NZ7A 4QWBA 3CFOA 1FNXH 2IBOA 4TKTA 3G82A 3AVFA 3UN2A 3RBDA 1BOTO 4DSEA 2C3MA 2G8HA 1LW0B 5GAGP 3CDAA 5AQRA 2EC0A 3DDIA 3MECB 3MM5B 4C8ZA 2DXFA 1Q8LA 1LK7A 3TQ1A 6AT1B 3AA8A 2V94A 1C0UB 2WONA 1FF2A 3V4MA 4AF1A 1HL6A 2GJFA 3CMES 1JLQB 2HS0A 1FI4A 4CTAA 5C10A 3TA1A 4C6AA 5DM6Q 4KJIA 2ITGA 2WSFC 4GNIA 1EJ7L 5GAGI 2DNYA 3JYTA 2EI5A 1JKHB 2WCXA 4FLYA 4EZ9A 2Y8WA 4ZVSB 3CCQN 3E01A 4QCLA 2WW4A 2P5VA 2RVJA 1HW8A 3H5YA 3VV2B 4WP9A 4KI6A 2G8VA 4PG8A 1TR0A 1NSAA 2CPFA 2O4GA 3FZFA 5IOLA 5KG3A 2QXLA 1FJCA 3NMAA 1TAQA 2OSRA 4JI2J 4CZJA 3H2LA 3EICA 3ISZA 3MPUB 1X4HA 2BE7D 2W24A 4ED2A 1N34F 3GE1A 2QWOA 3KLFA 4E0DA 2HVIA 1IBMF 1QE1A 3DLEA 2ZGYA 4J90A 2ABYA 2HWIA 3BM7A 3MM6B 3MPDA 1T03A 2NLXA 4D3GA 1HNZF 3K17A 1JQGA 4FZZA 4LFCK 3UN3A 3GG4A 3F9KA 1HNWF 4DQSA 2CQDA 3HOTA 2B9WA 1KKHA 2KYXA 3B8AX 3RSEB 2HVDA 4QU7A 1RTJB 2FSKA 3LP0B 2B7CB 1JJ2R 3UKRB 3UB5A 1ZYQA 2LCWA 2DNZA 1YI2S 4CF9A 1XC9A 4F4AA 1NJZA 2VBXA 3VAJA 2P9SA 1TL7B 2ALZA 1HRHA 4BRHA 1FWLA 3N79A 4AXJA 4X65F 2HBZB 4RUAA 1WC3A 2E9TA 1VQON 1RWVB 3NH2A 3HJVA 1OYEA 3DU6A 2Y1RI 4CLKA 1B4SA 4W5OA 4KHPF 4LF1A 2EKYA 2HNYA 2ZE2A 4DQRA 3O1LA 1FK9B 4UT4A 1OQ6A 3V4IB 5F1XA 5ETQA 5CYMA 3KJNB 4KYZA 2HW3A 2DNGA 3PEJA 4ELTA 1TUGB 3E9LA 1OIAA 3D28A 2R2SA 3TUZC 4DR6F 5T7BA 1X3NA 4ZTJA 5LSOA 2RU9A 3CXCR 1ZC6A 4FOIA 4E7IA 3DOMA 2OD6A 1XEZA 3U1MA 1C4CA 5KPZA 4XO0A 4NRTA 4AXIA 1N33J 1N33F 2J4RA 3RWUA 3O1WA 4HWIA 4A5BA 2VG5A 1K9MT 2BGGA 5HRNA 5DMRA 1XBWA 3KHYA 3SQ1A 2WZ1A 4BVPA 3HKZD 5K5MA 3SPZA 3KK1B 5AQSA 4CECA 5CHIA 3K5MA 1EIYB 4CBWA 1RGIA 3OLBA 1KFSA 4LF4F 3ULHA 3AODA 4A5AA 1RAFB 1NLVA 3V1RA 4LF8K 5C24A 4XK8C 4KTZA 1JLBB 4B3TF 3NBPA 2QG9B 4DU1A 1YJVA 1NRKA 4IO1A 1YUWA 4USJC 2IBKA 4OFZA 3CMAS 5HMYA 1VQ5N 1GLCG 3THTA 4C7QA 3HM9A 1U26A 5AQTA 4RZRA 4OJHA 2R7TA 3OYKA 3OFHA 4NCGA 1RB0A 3A1YG 2RF2B 3R5GA 3R9LA 3SSRA 2C2KB 3M1VA 2ALYB 3GMGA 3VWSA 5KOWA 5DK5A 4DG1A 2B5JB 1X4BA 5U47A 1KTVA 2CQHA 4PYDA 3EKUA 4M45A 3ITHA 4R5PB 4B9QA 3I33A 2HWHA 1BISA 2VQEJ 4F02A 2ACMA 4OYBA 2PE8A 3U27A 1KR4A 5LOQA 1FRIA 2Z2YB 1K1SA 1S9EB 3MCPA 2WHOA 1VBKA 1RFQA 1VBYA 4NMLA 4ISFA 1VSIA 4I7FB 2D1CA 3CJ0A 3OXLA 4H4OA 1DY3A 4KRWA 4CZIA 1UWAA 3VPZA 1GTHA 3L2WA 3DC2A 1XK8A 3SQ4A 3ISND 4CF8A 3CJTA 2WUSA 1J54A 3R3LA 4CYUA 5HL7L 4LSNB 4KHNA 3V81A 3W61A 5CZ2A 1P27B 1HYSA 4FVCA 5CA5A 4JRPA 2E1PA 1X5SA 4I2QA 8ATCB 3VTHA 5EWFA 4FYYB 4G1PA 2QV6A 3Q8YA 4ILJA 2J9DA 3GP9A 2KKZA 2WTUA 1NAQA 5H9FK 2GUPA 1V5VA 3SNNA 3EDQB 3CCSN 3CDBA 3NH1A 4LT6A 1YITN 4EO8A 4RBTA 2A10A 3DAWA 4O5BA 4CO5A 1RWOB 2LDYA 3ULEA 1XNRF 1KVJA 4IWVA 5KT7A 1MWMA 1I94K 4JV5F 2R7UA 5CR4A 5SZTA 3RB6A 4JEPA 4ID5B 4EMDA 3DLKB 3JSBA 3H1VX 4IFEA 3T1YF 1VK3A 4L3QA 1XMQF 1N4LA 1YBTA 4Y2IA 3HSGA 1S0VA 3UN5A 2YX7A 1P1LA 3NOCA 2W4CA 2GVZA 1S1UA 2QRRA 4OHVA 3CUNA 2ZH8A 1C1AA 2CJKA 3IC1A 4OPHA 4RW9B 1EB0A 4MKVA 3ET6A 1JLAB 4DV5F 2O8EA 3IFEA 2BOAA 2FVRA 2NXUA 2BXJA 5KTQA 1KD1T 3IAYA 3GQCA 4CHYA 1NK7A 2QTWA 2B3TB 2KYZA 3NGSA 4WYWA 5LMUK 1T9UA 2X1AA 4MKAA 3WBZA 2ZM6K 1LW2B 1B70B 2KLAA 2W41A 1U0HB 2V8GA 1D9DA 4F2RA 4NLBA 2YVSA 4L8RB 2W9AA 2NRRA 4WFNL 5THWA 4FXDA 2AGOA 2GCFA 4CEEA 2P9UA 1UW9A 1WUUA 3P39A 1RT7A 1VR6A 2XHCA 4R8UB 3GIRA 3MDQA 1NG9A 3MEDA 1UAWA 2V7ZA 3JSMB 4HL9A 1WC6A 3LM2A 2QGFB 5AQJA 1HIYA 1F9EB 1Q7LB 1KXPA 5KQ8A 2UUCK 4IO8A 2XSFA 4OV6A 2FZGB 3CPWR 5DGBA 1UFLA 2JLFA 4ED4A 3EPIA 4PG4A 1M90T 2ASDA 2WRMA 3FR0A 1DQAA 4MKYA 3GILA 2OMOA 2UXDJ 2B9XA 2F8MA 2YPZA 2LXIA 4A8FA 5E2QA 5HVHA 3J81Y 3A3NB 4LFCJ 1SPBP 1CJVA 2CQ4A 4I67A 3CCQS 2IRUA 3SMPA 1HD1A 3OYJA 4DS5A 4F3OA 1HMVB 2VBYA 3AJ1A 4QS9A 3KNAA 1U1QA 1WOQA 2WTFA 5DRKA 2W40A 4M5JA 3T5LA 3RYLA 5M2RA 4GKKJ 5CYQB 4JI7J 1ASVA 4CEDA 4GMKA 2ZH6A 2QE5A 4Z4EA 4B1ZA 2PZSA 3IP0A 2N7CA 3L2QA 4U7CA 3FZLA 1R8PA 4LF5K 1PILA 3LZIA 1LWEB 1HBNA 2MKHA 2UUBJ 5LJWA 3IRXB 1Q95G 3L0QA 2JVOA 4N8OA 4NPOA 4Z7YA 5LT5A 2K06A 2MZQA 2JLGA 3MEEB 1SJ1A 2O8DA 3AVKA 3LOUA 3W65A 3EJMA 3CCJS 4DSIA 2OTLN 2AHOB 4CHPA 4FJGA 1UOCA 4ZIVA 1G7CB 1SUQA 4XEIA 2QT7A 2WW8A 5CD4A 3G87A 1U1NA 3VETA 2E2OA 4Y0FA 5GMDA 4IZ9A 1NXIA 1UA0A 2YNHA 2QL7B 1SJ4P 3KHLA 1HKGA 4X4NA 3C15B 2G8FA 2K3KA 1TKXA 1NSKL 4M5DB 2UVRA 2UU9J 2WVEA 2F7TA 4LF8F 1UETA 4Z4HA 2ZOGA 3M9OB 7FD1A 1VQYA 4AHCA 4CH1A 4R25A 3JAMO 2DGTA 2GJIA 2ASJA 1TKTB 3O9QA 3TEGA 2ZH9A 5GADP 3RR7A 3EXCX 2HNZA 5KFZA 2DR5A 3BGRB 2V68A 3FCWA 2EW9A 3LDPA 5EVZA 2D3OR 3LP2A 3DKDA 3H4DA 4AM7A 3NMRA 2LSNA 3W1YC 4NLDA 2UP1A 5LY3A 2NRZA 4CLPA 5GADI 4NXNK 2VBWA 1ESVA 3L2VA 2C2NA 3CJKA 3AO1A 2JZ5A 2KN4A 4QWAA 3HBTA 1WBDA 5C25B 4OZ2A 3THPA 4UZBA 1K47A 3WNGA 1CS4A 1RBVA 2D0BA 3NWGA 3QFUA 2CGKA 3AGRA 1WELA 4DR1K 1VQ5S 2B56A 3F0NA 2N3LA 3MEKA 4NB4A 4LF9K 3EM1A 4FS2A 4OQJA 2XTJP 1RK8A 3W9JA 3L95X 1C0FA 4DV7K 3D1HA 4JI0J 1SH2A 3R5JB 3D5MA 5E26A 3MFHA 1VQ7S 3KJQB 1S49A 4LSLB 1TL4A 2MHEA 4C0OC 2CJBA 1R27B 1IG8A 2NXJA 1RAOA 2R42A 4K5RA 1R6VA 3J7YU 1FKAF 3FZBA 5H9FJ 2BANA 2J0QD 4IFYB 5JLFA 4O4GA 3TZXA 4CEOA 5IWAJ 2G1DA 4C9DA 4BLGA 1Z2LA 3WDOA 4OLAA 3A12A 3AH6A 1T05B 2XO7A 2VONA 2V52B 1I94F 3GFZA 2E6LA 1U1RA 3UO0A 2YKNA 4JP8A 3SBMA 1RAJA 5EWGA 4CNYA 3FZMA 2R4FA 3NL0A 4AH9A 1DRZA 1TL1B 2DGSA 2OPQB 4ZLPA 4L73A 3CJ9A 3M8ZA 3PR4A 1IQZA 3IMXA 3ZTOA 4Y34A 1YTAA 5KI6A 3BN7A 3V9WA 4HUEA 4WU2A 1B3TA 2FC9A 1QD1A 2NRHA 2HK2A 2XNQA 3SUNA 3G0ZA 3L4BC 3HVAA 1H98A 2BOPA 1VSJA 2OPSA 4M1KA 3VGKA 5GAEI 2Q6CA 5IT9Y 3HSDA 2I9SA 3G6XA 2HFZA 3AVAA 1EQ0A 2I2YA 1RDUA 4IDKA 5LMUF 3DMJA 1C1BA 2FSJA 3VF6A 3M7VA 2ZJQQ 4OO1J 2ZM6F 4BRGA 3BDEA 4F25A 3C14A 2C2ZB 3OQ2A 5CXTA 3M8QB 2FB0A 1S59A 2HIQA 4QYRA 1MLAA 3BR8A 5E3RA 1KDNA 3GJTB 9RUBA 2EXUA 1TU0B 1RA6A 5IM0A 1U6BA 5FLXU 4JI6K 1NBWA 4ZS6A 2P9KB 1T3VA 3QWUA 4QIFA 4FM1A 3D54A 3K8WA 4DDFA 3LUYA 4K2JA 2KB2A 1C1CA 4M63A 4DQ8A 1YJTA 2HQDA 2U2FA 4E2FB 1TK0A 2O4IA 9ATCB 5DDPC 4FYWB 1P8GA 2UUCF 1MWKA 2RQ4A 3PW4A 1SV5A 4QU6A 4UQTA 4YDUA 4ZCKA 4RW6A 3ZTPA 4GV9A 4B02A 4I68A 1T9VA 2J5AA 2VFRA 3FLCO 4ANCA 2E8AA 1SL0A 2HBKA 4WFZA 3SQGB 1WC1A 4RUHA 5K8MA 2GAGC 2R7YA 3AOCA 4PUOB 4MDAA 2YNIB 4Q2LA 2OI2A 3P4UB 3W5XA 7AT1B 1PJ7A 3AY9A 3K2PA 1RBOB 4NMXA 4WFYA 4O5FA 2RKIA 2IYIA 2CZVC 4XAKA 1J6ZA 3VEYA 2AJQA 2HGNA 3HKWA 4TNOA 3SDEA 3PR5B 4CJ3A 2OPRB 3CETA 5HQ8A 8AT1B 4H0YB 4HVZA 4LF5J 4LF5F 1XMOK 3C6TB 3NS7B 5HMXA 3H2VE 5KFKA 4NL5A 2L9NA 3IWNC 1S0OA 3W5YA 3T6JA 3VQ6A 1TVRB 2OFHX 4GVBB 4QR0A 2DH7A 4BCAA 4RTFD 2F4FA 4RLEA 1X4AA 4PXDA 1XR6A 1BQXA 2V8HA 3OHAA 3MR2A 2E5LK 2MPUA 4M5HA 2KM8C 2KDOA 3DLRA 2YWEA 1ZPVA 2D9OA 4G65A 3JXOA 3K8VA 4CJWA 1CSJA 4DPYA 5KFHA 3VAHA 3EX7B 8RUCA 2AQ4A 3VQBA 2FJWA 2AJ2A 1XC3A 4OYZA 4F8RA 4UQGA 1MWZA 3TR8A 2BDPA 3DYAB 4HVJA 4JHDA 1Q9XA 3UI3A 1RAEB 3PDNA 4ZVPB 1D8YA 3TVKA 3AD8C 3T1HK 3BH7B 3CC4S 4FKYA 4ZCIA 3NF8A 3CJ1A 3ZSXA 1REVA 1UEKA 1X9WA 4I1TA 4KH1B 2OTLS 2A2CA 3DLLQ 4U8YA 5DO2A 4BE2A 1H73A 1T9XA 2R8JA 4NA3A 4IOXA 4OZ0A 2CPZA 3GZ7A 2M3DA 2XEXA 4DCOB 2IVYA 4FPBA 3GV5B 5AZJB 4P7VA 4ES1A 4OZNA 1QQCA 3V1QA 2MKCA 2ZBPA 4J9LA 3J7YP 4X4RA 5G4DA 2OFGX 3NLCA 3MWPA 4EK2A 2EBEA 3M2VB 3M8WA 4NXNF 2HBRB 1FNMA 2CG4A 1XIQA 4ES3A 3KLEA 2C1EB 3Q24A 2D74B 1U24A 5KT5A 1DT9A 3US5A 4FLWA 4A61A 2CQIA 3A0IX 1IR0A 3OYHA 2GBZA 1NSPA 2GX9A 3J7YI 1DZ5A 4RJVA 2I7NA 1K1QA 2HBLA 3P45B 4DR1F 4DPXA 1L3SA 2D0OA 2EWSA 1U2CA 1EETA 2RRAA 2IVNA 4CO4A 4LF9J 4ZN3A 4LF9F 5C2GA 3M3ZA 2LFVA 3SFUA 2UVVA 1LCUA 4DV7J 4DV7F 1KAYA 3I0SB 2E2QA 2B51A 5DM7Q 3SI8A 4G3IA 4LVOP 1N8RO 1W97L 1WHWA 2CQPA 3VA3A 5CCLA 3DLBA 2D5RA 1YJ7A 1Y5IB 2BRKA 1CJTB 1T3OA 2BA9A 3CCEN 3KLGA 1ICEB 3O8MA 5AE3A 3KKRA 1JXBA 2GFFA 4YOTA 4RX6A 5EDWA 2ZKTA 3CF5L 3TU5A 4PQAA 3CCUS 4F4XA 4DR4K 2E5IA 2GHWA 2IIHA 4NEYA 4BG8A 3AD7C 3M30A 2BABA 5KG1A 4YOEA 1FD8A 4QOTA 4ZMMA 2HMIA 2MGZB 1VLYA 1VQLN 3EZ5A 1KLNA 3D2FB 3HFKA 1HI8A 2G13A 2G8KA 1YF5L 2VQFJ 1Y3KA 3HI9A 1T11A 3UQSA 2FXUA 4W4MA 2D7SA 1K0TA 3N6MA 1G99A 1HWJA 3M6VA 3I82A 2HQ3A 1IBCB 1EAYC 2N82B 1V3ZA 1TKDA 4MLHA 4QW8A 4IOCL 4IXCA 1YIJN 5DDRC 1JLCB 1D0EA 3KWMA 5T7LA 5DLGA 2O3DA 5B0AA 2RIJA 1U1MA 1NGIA 2YNGB 5F8NA 1YVNA 3DRRB 4B1VA 4BQZA 3W2VA 3I5CA 3M6UA 1RHJB 2O8FB 2AW0A 2V0NA 5AQMA 5D0HA 4KPCA 2F9WA 4DU3A 3QEIA 5HMZA 4LF6K 5H9EK 5B8HA 1S1XB 2IGIA 4P75A 1HQEA 5GAHP 1S6UA 2XI3A 3WNHA 3OW2R 4LRAA 1HHQA 4LIRA 1NM1A 3SMSA 3KKFA 4F0MA 1S9FA 3LM9A 3O3HA 4JI6F 1K44A 2BW2A 3SFGA 5KT6A 2EWHA 5FJ4A 3H4BA 2O66A 1RWKB 2J7KA 4UOCA 2YCHA 2ZH1A 5GAHI 5KGWA 4ED3A 3CO0P 4FJ7A 1A9NB 3X3UA 1WG4A 1RXOB 1FX4A 3AVLA 3OR2A 2F7VA 2FF3B 1C0TA 4K2XA 1AB8A 1NGFA 4X4VA 4ZJQA 5KFCA 3IS9A 3VF0B 4BRCA 4NYFA 2YHXA 4E7JA 3ALYA 4E1JA 3BH6B 4FOEA 1JL2A 1IKVA 1ZTTA 4FBTA 2ZFHA 4F3QA 5I3QA 1QAXA 3CG7A 4FBUA 3M8PA 1ACMB 4K8ZA 5I42B 3OR1B 4X64J 3PRBA 4ALZA 1NZ8A 1Y97A 1HWKA 1X3MA 1VIXA 2LQJA 4QJVA 3P83D 1DURA 5HP1B 2J9EA 4XTTA 3OS1A 4LFBJ 1YBUA 5F9NA 1IWAA 5JS1A 4YS2A 4DI6A 1S1TB 1M5PC 3WZ0A 4NOHA 1F9HA 2CADA 3PW7A 1LWCA 3AVHA 1XWLA 4I0WA 3P3DA 2JFKA 1XMOF 4CJPA 5ETLA 1WF2A 3FSIA 3ZETA 2YX4A 2XY8A 4DL4A 2PBDA 1M5HA 3DOKB 4KFBA 2B8PA 3RAXA 3O9UA 5C7PA 4Q5VA 1WKJA 3FJ2A 2IS3A 5DJBA 2G8IA 4PWUA 5F8MA 4NXMF 3AOAA 5A8WA 2BKNA 1B9DA 2DR9A 1KOHA 2E5LF 3NXZA 1JLEA 1ZZNA 4U67Q 4CQ1A 2BJ3A 1RTZA 5DETA 1QTNB 2VA2A 1KVAA 2W9BA 4LBIA 3CCTA 2XQCA 3QEPA 1LKZA 2P9IB 2DNPA 4H5TA 1F0XA 2LQ9A 1D09B 3CT9A 1HW9A 1SS6A 2GS8A 1GXLA 1OH6A 4YUDA 3ZTSA 1NGHA 1E6VB 4M5MA 4EYHB 1Z4UA 3VESA 4USIA 2GGPA 3VQDA 3SLCA 3BBCA 3Q8RB 2WB1D 4C11B 4C3LA 4JKEA 4YFUA 3M5RA 4Q7AA 3T1HF 1C2PA 1CLQA 4PKDB 1AT1B 4RW7A 3MPVA 3CYMA 5F41A 5B08A 3QFWA 1A5XA 3CCMS 1Q18A 1TUUA 3PYDA 3MMCA 3W63A 4EHTA 1RAHB 4AQYJ 2R8HA 1CJUA 1GXTA 4Z7CA 1RP5A 4Z37A 4WTYA 4CERA 2RU3A 3EN9A 5M1NA 2YQ0A 5AR0A 2VC0A 2CGLA 1N36K 1NJIT 1QTMA 2HKEA 3G71S 2H51B 2LQ5A 2XG8A 3O9RA 3FBEA 2MQPA 2BVZA 2J9DE 1FVQA 1VQ8N 3G6VA 2XMMA 5L1KA 3QLHB 2HBMA 2WSEC 1SVDA 2VA3A 4X4UA 3JXUA 2CRLA 4DX6A 3VQCA 2B43A 3SUQA 4L6V3 3GV7B 1C0GA 2KVIA 3W0LA 3NCQA 3VENA 1S9GA 1HBOA 4AL7A 2M4MA 3HSZA 2V50A 3QAUA 1CULA 4FPIA 4YOXA 1UJ5A 3IKMA 4OGCA 1EWRA 2WAQD 1CC7A 2ZVSA 3BSAA 3UDLA 2M7SA 1AFJA 3HM8A 4TU9A 3OUYB 3AJDA 1NMDA 1YJNN 2O8BB 2AJ0A 1S79A 2QX0A 3CJ4A 2R7RA 1UVKA 1B7YB 4DHVA 2D3UA 5A8KA 3KHGA 5CYJA 3ZC4A 2E44A 2IHR1 1BCMA 4DV1K 4DR3J 1IKYA 3C8YA 2J76E 2A41A 4DR4J 3KUGA 3TTDA 1S5JA 4LBPA 1H7XA 4KC5A 2HEKA 3K0SA 2VKRA 4JV2A 3G6EN 4HH0A 2ZUGA 1FJGJ 2XYHB 4M3XA 4ILGB 4CZCA 3QAEA 3OTCA 5AJ3K 1RWXB 1QLNA 1WSHA 4A48A 1NSQA 1RKIA 4WCEL 2PEHA 3MMAB 5J2NA 1JLFA 1VQ6N 3ENVA 4O44B 4GVLA 3CCES 3MM7A 5D3GB 1VCTA 4QIVA 3NDKA 4YHHK 4CHZA 4JI8K 5HOOA 3G9CA 1UCNA 3RAMA 3QIPB 2DXEA 4QQBA 2EFPA 3BY5A 1JB0C 3HHLA 2ZOFA 3MCMA 2VL1A 4OJ3A 1ZBTA 3DI6B 2V2KA 1NGCA 4WIIA 2LLZA 2E88A 2GWKA 2EG2A 4JKGA 5BYSA 3LP1A 4A8SA 1RBLA 3AQPA 1AROP 4LF6F 5L39A 1DLOA 3SIPB 1SKRA 1TKZB 1HPMA 1HR0K 5KG5A 2MKIA 3HOSA 4LRCA 1QS4A 2Q0RA 4CJFA 2KZMA 4CZHA 5HANA 1WKLA 5MLCV 1S1VB 1VJWA 5FPNA 3SCLE 2OPPB 2JC1A 3DXKA 1GNKA 3VQ4A 3ZSQA 3ZSWA 3JAMY 4WZQA 2Q3SA 2KHDA 2VG6B 1MMLA 3TW0A 3RBEA 1QSYA 3OTOJ 1BA1A 2FLLA 4IEEA 4Y3CA 4DLGA 5C2CA 3ZX3A 2MY8A 3LAKA 4H54A 1VRQC 2EFNA 3BR9A 4BRLA 1E4FT 1GTEA 1O6XA 3VALA 3PXGa 3S41A 1KWMA 1U45A 4WFBL 4LY7A 4M5GA 4CWBA 1AW0A 1TYQB 4DR5K 1L3TA 2NNWA 3C7NA 1KAZA 3V5RA 2PN6A 1HBMB 5D77A 1U2FA 4DOZA 4WF9L 4OI2A 5KFUA 2IMWP 2V4JB 4ZVRB 3O8WA 4O55A 3E51A 1XQSC 1OH7A 1RUSA 5A2QU 1FWPA 1S7IA 1QY7A 4GY2B 3AAPA 3H98A 3AA9A 4GV6A 3QJJA 1FKOB 4Q0BA 4ZLJA 3I31A 2FHKA 3H7HB 2B4VA 4RW4B 1TZ0A 3OTDA 4HUFA 3IBWA 1I51B 3MM8B 3NGYA 1QHTA 2AP6A 1GT8A 2GTDA 1RTIB 3GG1A 3CCVS 2EX3A 2RRBA 3H45C 3DGPB 2ZJPQ 1KLMB 1RTDB 3VVTA 5JMNA 3KHRA 4OPJA 1PG5B 1NJXA 3TAMB 1Z1ZA 4FWLA 3A8JA 2MEWA 3PSFA 1P9YA 2QIFA 4KPYA 3QO9B 3K5LA 2XMAA 3V6JA 4FWMA 4Y1CA 4JKDA 1LW0A 4IO9Q 4B9NA 2HQIA 3SAHA 5E0OA 2G0IA 1NH7A 3ILOA 4JV1A 1E6YB 2GQQA 3MECA 2CNOB 3MM5A 3UD4P 4IFVB 1U4BA 2V5HG 3CD6S 4BDYA 2CWXA 3BREA 3M2RB 5AQUA 3QT8A 4TN2A 2XI2A 3GCXP 1C0UA 4PG7A 3VF2A 3DRXA 5F8IA 2RUGA 3MR5A 1HNIB 1N52B 5KQDA 1JKHA 5EUHA 3BQ0A 1TV6B 3O9TA 4EBCA 3OPKA 2FIUA 3VCDA 2EBGA 3L4QA 3OFEA 3PO4A 4W5RA 2QWRA 4OYIA 3O3LA 4I9QA 4CZGA 1WHVA 4KHMA 1ZAVA 1DARA 3I9ZA 1AXQA 3S3MA 2GQCA 1NGGA 2OHDA 5IS2A 1ELOA 1BI4B 2DXDA 4IEIA 2CQBA 2KT2A 1T94A 4M3UA 2BUNA 2XYGB 3SCIE 4A8YA 4WFAL 4DV3J 1IR1A 2A6MA 1HARA 4P2FA 3V6HA 3VEZA 1S4FA 4YMEA 2AYMA 3MZIA 1NK9A 3MM6A 1O8BA 5MLCQ 2OSQA 2CAJA 1CZBA 3FRYA 2WBRA 2HZCA 1N36J 1N36F 5ELZA 2YTCA 2QKBA 3VAFA 3UW1A 3DLGB 3R8EA 4ZPBA 3J80U 1X0FA 3AVIA 3RSEA 3N5BA 1RTJA 1Q8KA 2Q0UA 2G0CA 2HNDB 3LP0A 2FYXA 2OTJS 3UKRA 2GC8A 2H5JB 1HLWA 1Q8IA 2GV9A 5FPDA 1IKWB 4NI2B 3OYBA 2GX8A 2DY1A 1TL7A 4U8VA 2X78A 3KK3B 2F4VK 4QR2A 2MJNA 1X0PA 4WP3A 2ZC3A 4DU8A 4JD2B 4DFPA 1QJHA 3I5AA 4DX5A 1U7LA 4ED6A 4Y65A 1FK9A 4OYOA 5HQLA 4I2PB 3V4IA 1VISA 1AFIA 4EGLA 3SCXA 4CJKA 2CDRB 2GMLA 3LF0A 2DFHA 3HZ6A 3DRSB 3K58A 3GIMA 1BWFO 3R6MA 2RAQA 1HNXJ 4DV1J 4DV1F 1ZBIA 4B1UB 3KLVA 4NZ6A 3OYNA 4YNQA 1IBKJ 1RTHB 3ONQA 2EFOA 3L7OA 1HNVB 3MN9A 3AARA 1VHIA 4LVNP 2MSTA 3FC9A 2GNKA 1Q9YA 3OSPA 5AJ3F 2B6AB 1SC4B 2QYGA 1VSKA 3JQKA 2P6SA 5IZHA 2PMZD 4OKEA 4M5LA 1JLBA 3RB4A 3D66A 1HHSA 3CI5A 2VZ9A 2QM1A 1YJUA 2Z4PA 4BC4A 4YHHF 4OLBA 2PI4A 4JI8J 3N01A 4CJ4A 1ILYA 4RO0A 2W2QP 2YKPA 4OLOA 2PO4A 2RF2A 2IA6A 4OI3A 5KFNA 4CIEA 1P1TA 4ED1A 2ZD1B 3IA0A 2W2PP 3TP2A 5KFBA 3G6ES 4KH6A 4DQQA 2AZ3A 2B5JA 5DG9A 4IRDA 4DN0A 5D0RA 4I69A 4R5PA 3ZFVA 2P9PB 1O13A 3T5KA 1HR0F 1VQ6S 4HI1A 4IR9A 4F4KA 3ENHA 3NGRA 1S9EA 2BM0A 3U1LA 4ED0A 1JCFA 3HHDA 1TFWA 3NNAA 4BG9A 2JEFA 1ITGA 2DITA 1D5AA 3PIPL 3IAM9 1ZBSA 1YQHA 2BJ9A 4HTUA 4I7FA 4C1NI 1ZS6A 3I5BA 2EHGA 4EBEA 4FJXA 2QO3A 4CDIA 2QFJA 3HPOA 3LA0A 3MCSA 4OYAA 2W4PA 4FZXC 2G8UA 4E7KA 1NU4A 3BP8A 1R59O 4LSNA 1Q7YT 2XO6A 5I4MA 3M9MB 4BREA 2IDLA 2DEIA 1RHRB 2YH0A 4UZCA 3MX2A 4RG8A 1L3UA 3B78A 2VBZA 2QLFB 2JH3A 4DR5F 4WU3A 4FCYA 4C0HA 2FUG9 1MG7A 1X4GA 1ASUA 2X1BA 2HAFA 2I6WA 4ZTFA 2FHJD 2KI2A 4FJIA 2AYEA 3MUMP 3EGWB 5KOXA 1NZAA 4CLYA 4OPAA 5CABA 4ID5A 3CCLN 1FE0A 3A5NC 1YLXA 5FROA 1UMJA 3HFZB 3DLKA 3G25A 1BY9A 3T5JA 1R7IA 3ZZUA 2OEJA 4ER8A 4J5OA 3TZYA 3ENWA 1RU2A 1KNZA 5BN9A 2PEBA 5AQXA 3GG0A 2EFGA 3EL2A 1RDDA 1NKCA 4XH4A 4J9UE 1RDRA 5FPMA 2HRTA 2FBXA 1K8AT 2G9OA 3THXB 2YV0X 4CFCA 1S57A 4RW9A 4Y2MA 3PIOQ 1JLAA 2XGPA 3CE8A 1WORA 4CZLA 1VRTB 1Z2ZA 1RSCA 4BRNA 1DQ9A 5A0YB 4MIWA 1R8CA 5E7OB 1IBLJ 4KT0C 4JYAJ 4R79A 4IOAQ 4MO4A 3EKSA 3CD5A 3PV8A 1YRXA 3J7ZT 2M8DB 3DXBA 2Q66A 5E3PA 2BACA 3R97A 1LW2A 4DTJA 5D0GA 2Q1NA 1YZ6A 1U0HA 1FKPB 4F4ZA 2IRXA 2OCEA 1FRKA 4J2AA 4FJHA 1LOUA 5KG2A 1S6QB 4RNNA 4BWJA 1UFKA 3MXJA 3AO4A 5LL6Z 3ZO7A 1L3VA 4R8UA 4UOFA 4IRKA 2Q3PA 4C3KA 2QWQA 2DEJA 4PKIA 1GEHA 4HTLA 3JSMA 4CFAA 1M5SA 4J7CA 2X1GA 1OSDA 1D1UA 1FRLA 3IRWP 3M2UB 5K20B 3KVGA 1SZ2A 1Q86O 2WVBA 3OL7A 3ZZTA 5M1QA 1VBZA 1FE4A 3OY9A 1OVQA 2MZSA 4BRQA 4Q44A 2D0AA 2YJFA 3ZT2A 1K73O 4BRPA 2A0FB 4GO7X 2LU2A 2KW4A 1YSJA 4YB6A 4CI6A 1S5ZA 1FWKA 4ED7A 4RBUA 4BGBA 3DCAA 3GCWP 1B99A 1PYTA 4DV4J 2A1SA 2Y0SD 4PABA 2JEIA 1H0HB 1T95A 1HMVA 2QEXN 4KB7A 2HVEA 5C42A 2VOOA 3PO5A 3ZT4A 1QVGR 2XBPA 3THYB 3D6MB 2QYCA 5I9EB 1MMDA 5CYQA 5AQKA 1NK8A 5AQFA 4EIAA 1H2TZ 1HFEL 2F4VF 2Z2ZA 3N4WA 4NLXA 4F67A 1H74A 4PEOA 1LWEA 1SIWB 3U4LA 2OYQA 3IRXA 4GV3A 3O6QA 2FQQB 1WSRA 2CUYA 4ZHRB 3MEEA 1T6CA 3HT0A 5L1LA 4URSA 4YDXA 4USTA 3IO1A 3RZAA 1KRPA 1FT8A 1AZSB 2DHGA 2AEMA 4ZVGA 2Z0GA 1HPZB 3NCPA 3FRZA 1FDBA 4OYMA 5D15A 2PD1A 1R0AB 3F9MA 2L48A 2R7SA 1X4FA 1N32J 5DGAA 4H0XB 2FJBB 2W6KA 3TTFA 4LC9B 3ZZRA 5DG8A 2PA3A 4ZVHA 3O5BA 1HUXA 2FZKB 2FVQA 1D3WA 1JLGB 2R7OA 4ILRA 3C15A 3AO2A 3LW5C 4U7UK 3GIKA 1WSVA 4ECUA 3POTB 3C19A 4JI2K 2OKQA 4M5DA 2ADCA 2H5EA 3CC2S 3FMBA 1KQGB 3I56N 3OS0A 2OAUA 1VC6A 2PFDA 1XR7A 4DQIA 1Q79A 3HHLC 3FZ2A 2HHHJ 4UOHA 1TKTA 4B1WB 1TL5A 4P74A 2O01C 2W8LA 3RMBA 4KE5A 2V8DA 3BGRA 3N6NA 2DYAA 3B4DA 3W2WB 3U9DA 4HTIA 1JNRB 3C0BA 3R1LA 4DPTA 3L09A 4BQLA 3BO4A 3TZZA 4DUYJ 4DR2J 2A1BA 4CJ7A 2WFBA 2Q43A 4KIAA 3FGUA 4J9PA 4HACB 4A8QA 5C25A 5JVGQ 1BWVA 3HL8A 1D4XA 3Q83A 4DWIA 4L3NA 3AVCA 2V63A 3N4PA 2OELA 4ZP8A 2IVFB 3IBFB 4WXOA 2VCPA 2C22A 3UE5A 4CH0S 2FVPA 2X1FA 4FVMA 2CGJA 4YOVA 4A46A 2PT0A 1JXLA 3NHGA 1GAOA 4FLVA 4CZKA 1Q53A 2YX6A 1UVMA 1TELA 1F1BB 5KFIA 2W9CB 3SBTA 2PYLA 3BN4A 1VQNS 3MMVA 1ZA2B 3CJQA 3OVAA 1UWBB 4OMFG 1M1GA 1JJ2M 2EK6A 2KVQE 2HPUA 2NUHA 3BQ2A 1UP1A 3C3LA 3L8BA 1BU6O 2OO4A 2ZGZA 3UDCA 4LSLA 1J5OB 1SBRA 5L9XA 1XI1A 2XZWA 4OI4A 4I9LA 3RRHA 3VMFB 4DZDA 5GMEA 2Z58B 4HTJA 4KSEB 4NYPA 3QB0A 4DR7F 1EZZB 4DN9A 1IR2A 3KOAA 4IFYA 3H0PA 3H25A 2DB1A 4MLEA 2JOQA 4IOBA 2W2MP 4IBNA 1T05A 2E6MA 1KVKA 4YOUA 1FXLA 3T5HA 3KMQA 3UDVA 2RN2A 2NSBA 1RISA 3K5OA 3ZSOA 2DNLA 3GIIA 4O3OA 5BRFA 3C94A 4EO6A 4KHQA 4ZCLA 3R7SB 4DSKA 2DH9A 3RGIA 2HS3A 3CXCM 1EXQA 2HFUA 2Z1JA 2ZC4A 1BDGA 1TL1A 2VGNA 4OX9J 4I6YA 1S76D 2OPQA 4FWNA 5F9LA 4ILHA 4CBUA 3NF9A 2DGWA 1TUYA 4FVUA 1BXNA 6FD1A 4J2BA 2AYBA 1V3SA 4NO7A 5HI7A 4KV8B 5BN8A 2LVWA 5KT2A 3M1FA 5A8RB 2CNKB 4TY9A 4QS7A 3UKUB 3JQMA 1TTHB 4PKHA 3TJAA 4CO3A 1GLFO 4FJ5A 4ZJOA 1KBRA 2MLYA 3CCLS 4G9ZA 2QKKA 1PO6A 2F8EX 1VAZA 3IM9A 4ETXA 1RT2B 2HFNA 3L3VA 4DV0J 3H1QA 4BGAA 1HBUB 3TSPA 1I39A 2JRSA 4FM2A 4IUFA 2BMBA 2LA6A 4Q45A 4CHNA 3TOQA 4KR0B 3DJCA 3PHTA 4WE1B 2DR6A 3MCNA 1SL2A 3M8QA 3Q8QB 3HVRA 4XPEA 1RT3B 2V8PA 4ES2A 3RBXA 5ITHA 5DM6L 3B6PA 3MDFA 1S6PB 1O0PA 2NPFA 3MURP 2KJWA 1IQTA 1EKEA 4Y2KA 4AILC 2RHKA 1Y0HA 3D2EB 3OYGA 3AVNA 2M70A 4K7QA 2P9LB 3J81U 3DNCA 2ZZTA 2P9KA 4TLRA 4A8OA 1NBEB 1XR5A 3TVZA 2NS1B 5ETTA 3ZXWA 1GX5A 3BF1A 3GJQB 1FW6A 1Q16B 2PMHA 4CLTA 4BS2A 2LA4A 4UTGA 4CEFA 3PX0A 4N47A 2DGUA 2HIYA 1TL3B 4LFAJ 4NLUA 4YY3K 4LMZA 4PG6A 4X66K 1WLJA 2XY6A 4JI4F 2FHOB 3DRPB 4FWPA 4CJRA 3DXMB 5F8HA 4X4OA 1Z6RA 4JI1K 4J9SA 4BVOA 3O3GA 1EKSA 3OTEA 4PWWA 3P38A 2XMKA 4BC2A 2IJFA 2IVMA 3V2UC 1X9SA 3SQGA 3QFHA 2UVWA 1ZBHA 3LWLA 4PUOA 2YNIA 4E19A 2OLWA 1XERA 2E20A 3SPYA 1MSWD 5LJ3Y 1KVIA 1FNOA 1H38A 3L2UA 1JJHA 4KB1A 2QL5B 3OBYA 4KHYA 1SIZA 4CHOA 3QINA 2XLJA 4U6PA 4DSJA 3QBWA 1WUAA 4CH7A 2UXBK 1YHQN 3FEZA 4I4BA 3Q8VA 5BJRA 4J2DA 1JWWA 2OPRA 1KEKA 1NH8A 3PSIA 1VJQA 1VSDA 3GL1A 3C6TA 3KDNA 1VSLA 3CULA 4CGGA 2IJRA 3QZ7A 2XLKA 4FNHA 2YQ1A 5AQHA 3H46O 2A5XA 3D6HB 1TVRA 1PC4A 2RUSA 4GVBA 5KG4A 1CJKB 4KBOA 3WXLA 2A3JA 3DU5A 2F9JA 1NOZA 5I3PA 3ZNJ1 5HQMA 2FGOA 1XNQK 3EWGA 2QEXS 3PW5A 2FLNA 2CQ0A 1RDAA 3ICLA 1CQMA 2MZ1A 1HD0A 4DV6J 5K8PA 2O67A 3MR7A 1VC0A 1K8KB 3KIOA 2PMWA 3MMBB 2VF3A 3L9ZA 4A8KA 4MMOA 2WBMA 3KYLA 1BLUA 3AAQA 3DYAA 3DHWC 4FWQA 1S1WB 5KFRA 1CXUA 3RBZA 3QESA 4IH7A 4LF2A 4KAZA 4JI2F 4WCEQ 1S72S 3WXJA 1VQ4N 1JJCB 4WPAA 4JKCA 3VOVA 4NCBA 2UXDK 4RKUC 3D1OA 2BE2B 3K9KA 3T7ZA 4G1IA 2BYCA 2D3ZA 4FJNA 1WWHA 4ZLLA 3KJVB 4OZJA 5AZJA 1N5SA 2E29A 1C4AA 5DQHA 1LV5A 1H2VZ 2EK1A 4XH5A 2LXUA 2Z1GA 3CCRN 3K57A 1ITPA 3RB0A 4YB1P 3M2VA 3CPWM 4GKKK 3WNFA 1WG5A 3NY0A 4JI7K 1Y00A 4PXCA 4DL2A 1X1PA 1VI7A 2F65A 3D9BA 2VODA 2DGOA 3I56S 4UY85 3HF5A 1Y4ZB 1KFDA 2GELA 3WIVA 1RAGB 2UUBK 3QNNA 4HDHA 4DHYA 2LU1A 3LANA 1NJIO 4BDPA 2XMVA 2KTQA 1F9FA 3D4JA 5ADZA 4DL5A 1X9MA 4OYXA 5BREA 3FZHA 3RMCA 5IT4A 4F0HA 3I0SA 2CG8A 2DVIA 2FBYA 4K4ZA 3S3NA 1YAGA 3CJ8A 1VS3A 3F41A 1CQNA 4TVAB 1UKUA 1FEEA 3OTBA 3CVKA 3MXMA 4AE5A 4ZITA 3TWHA 2DPIA 1CJTA 1LK5A 2BQ3A 1FHTA 1UJ4A 1SH0A 1M1HA 1UW4A 2Q97A 1NDPA 3QGHA 3ENBA 2V2ZA 2F96A 4F36A 3D68A 1NMNA 5EWEA 2QSFA 4ZOSA 4EAHD 4OX7A 1RADB 4GW6A 2L9DA 4QZVB 5J1EB 2EVZA 1GX6A 5C15A 2GJ2A 2UU9K 2DNOA 3RU0A 2G2ZA 2DISA 4RWXA 3BF4A 5EXWA 3BPDA 4NYZA 2BQUA 3R1HA 5IT9U 4ERDA 3EGZA 3F2KA 4A4JA 2MGZA 1G15A 4O0NA 2JHEA 4OZLA 4FZVA 2P5GA 3D2FA 2OANA 4J9KA 4ECRA 4QIEA 4A62A 2MKKA 5CD4H 1T3NA 2EEYA 1W2BR 3RR8A 3CJ3A 2IC3B 2NRXA 3JS9A 3HO1A 2QZ8A 2KZZA 4YOWA 1U2RA 2VUGA 2A3ZA 1QDUB 3VERA 3WT0A 1OMSA 2DFFA 2RRNA 4TLQA 4N41A 1YBAA 3ETOA 4EEYA 4Q43A 4CIFA 1JLCA 1ASWA 4PZVA 4B9TA 2YNGA 2DGVA 2VQEF 3DRRA 2XRIA 5ETNA 2UYTA 2ROGA 3B6OA 3U3GA 2O8FA 2ZQBA 5AXNA 4USUA 4ECVA 3MK6A 3R8YA 1QQNA 2QL9B 3GSIA 1DHMA 3N4QA 3F73A 1BA0A 1S1XA 4B3OB 4WFXA 2H3GX 2B4JA 3UD5A 1MA9B 4P2MA 4OLPA 3M6XA 4FXVA 3DLHA 1RWWB 2HHVA 1BQNB 5GADU 5F8JA 5LSLA 2YWKA 4JI0K 3ZT3A 3TAFA 2MMYA 4P72A 7FDRA 3QSYB 1S99A 2QLJB 2V9KA 4K0KK 3G4SN 1HI0P 1BQMB 4M5NA 1Q8BA 4RL1A 1G1XA 4J9QA 5AXMA 2FVSA 3CC7S 1R8HA 5KG0A 1QQMA 5KRSA 2GQ2A 1LOTB 3OJSA 5IWAK 2RQCA 1SKSA 4X66J 4YY3J 4YY3F 1Q78A 4CK2A 4ID8A 4IH6A 1V4TA 1ULRA 4A47A 3QETA 3L3UA 2N7YA 4FLTA 2ROEA 4ZKAA 5LL6d 5GIOA 4JI1J 3CD7A 4JI1F 1SB6A 3Q8SB 4FSVA 3GJRB 4WKRA 3VAIA 3LQVA 2VDHA 2VJVA 3D6RA 5KFQA 4EU0A 1OY6A 5CQGA 5I42A 3OR1A 3UIQA 2F5GA 1NGDA 4C4WA 1S0MA 2X74A 4DF8A 3AVMA 3UCZP 2OIHA 4NLTA 4KGZB 5HP1A 4DTMA 2QA4S 1D9FA 3HPGA 2W8KA 1F21A 2PA8D 3I8BA 1LWXA 1N5TA 1K6YA 5E3QA 3SI6A 4PQUB 3GYGA 4BRIA 1N6QB 2W6LA 2Q2RA 1S1TA 2UXBJ 2GAHC 1NPRA 4W98A 4KI4A 5E41A 4LREA 1CVJA 1RA7A 2R7XA 4FL9A 1KQKA 4B3SJ 2VICA 2O5DA 5HO4A 4X4SA 1AUDA 2JL9A 4GC6A 4CJLA 3DOKA 1MNEA 2E5JA 2N4CA 2Y9HA 3A8KA 4CJSA 2DIUA 1NDCA 5CZ1A 2L41A 4LIWA 4PRFA 2YJEA 5E5NA 3OYDA 1KHVA 2E1ZA 4F2SA 1KQSR 1E3MA 3H2UB 1OH8A 3NOGA 1XNQJ 2CPDA 2Y1LB 2RS2A 4JI3J 4MT1A 4QYZK 1PAEX 3UNGC 2HYIB 3BGLA 1Y64A 1YZ7A 4DTXA 2P9IA 3IXQA 2ZBRA 5GAEU 1YHQS 3ZX2A 3GWCA 2R8KA 4UOGA 4X2BA 3CGIA 1LEOA 4N5SA 3DOLB 3RB3A 2HF3A 3QPIA 1KS2A 4CFDA 1WOSA 1AUSL 5A6PA 1E6VA 3BEGB 3RJMB 4R0JA 1RU1A 1EX8A 2JNJA 5HLFB 1SJ3P 3M8SA 4ILLA 2MQQA 2IDOA 3K7RA 4C11A 4TY8B 4YB5A 5B0FA 1NO8A 3EE3A 1P90A 2J7WA 1IXKA 4CJTA 2OP5A 1DTQB 2MDAA 4RU9A 4ECQA 1RLCL 3OXFA 3UVJB 2UXDF 2DCUB 1KC8O 4QWCA 4OHWA 2HHXA 1KVCA 5B7WA 3NS5A 4JI5J 4M42A 1BC6A 2XS2A 3DM2B 4LFCF 4CJUA 3V9ZA 3ZNUA 3WEEB 3OJUA 4A8XA 3T9NA 5EX3A 1YTYA 2CJQA 3M32B 4ZPAA 4DUZJ 5ETOA 4LF7J 2FF6A 4YQWA 3R1XA 5IC4B 3EZWA 3MI7X 2QI2A 2ATLA 2XB2D 4H0VB 2VFSA 1NJYA 2OMLA 1ZZFA 4ZVQB 1GOAA 4KY3A 3I0RB 2CPEA 2W7OA 4K8RA 3UR3C 4GKKF 4JI7F 2CQGA 1ZTWA 2HBYB 3CJAA 3F44A 3VGUA 3D0HE 3IBCB 2AGQA 1XHXA 1RT1B 3EUNA 3U6FA 5J2PB 5HBMB 2V7YA 3PVXA 1IUJA 3N6LA 3TYTA 1N5YB 5FPEA 2UUBF 3PY8A 3QLHA 3H3NO 1U47A 5CZXA 4GKJJ 3NE6A 4GO5X 4FXWA 4FF4A 2UV8G 3LL3A 1JNZB 5FIIA 2YI1A 3TA0A 3TAEA 3OYIA 3CCRS 2IM0A 2IVPA 4LRFA 4RNFA 4KGVB 1NK5A 3AA2A 4ELUA 3OUYA 2UUAJ 4AHRA 1IG9A 1S4EA 2O8BA 2D0PA 4FPAA 4NYOA 4LUBA 4FP9A 3SBGA 3ISNC 2QC3A 3W8GA 1OH5A 1ROFA 2IDEA 1VQOS 3N5FA 1V5IB 2AEJA 1TP7A 2QN6B 1HJRA 5JICA 2VHGA 3AVJA 3KMSA 2NZ4A 1BUPA 2UU9F 1V6HA 5LMNJ 3AHPA 1M0SA 2VASA 1GLDG 1S10A 5DQIA 4FF1A 1WHXA 5AQOA 4IG0B 3UE2A 1S3XA 1ZBFA 3CMEN 4I56A 4ZVTB 2IPOB 5J2MB 4CFBA 3MMAA 3C66A 4AL5A 2QLBB 3VN5A 4R0EA 4O44A 2PSZA 5D3GA 3NAEA 1FDDA 1IKXB 2CFXA 2FHMA 2L08A 5TKYA 4DKWA 2GV1A 3HMJG 4O23A 4BC3A 2HMPA 1WACA 2RDDA 3QBXA 3LAMA 1IH7A 4OL8A 2C2DA 2OZMA 5JVHQ 4L3KA 4ECZA 4O3QA 4LD0A 2GO9A 2JVRA 3K5PA 3QIPA 4B1YB 1WC5A 1RILA 1WKKA 3CJ7A 1G6BA 2FBTA 1R43A 3OVBA 2ZJQL 3DI6A 5HJYA 3EY1A 2ZH4A 3PLAA 3MUTP 3AOBA 2M0GB 4FK0A 3RW6A 1P8ZA 2AYGA 2YHAA 4JN4A 3BBBA 1TKZA 1KSPA 5GMKa 3G8TA 2BZ2A 4TQRA 2EFQA 1U0SA 2J0WA 4BRDA 5J2QB 4WQ5A 4JI0F 2NUUG 3V6DB 3I96A 4U7BA 1S1VA 5ADXA 5EOYA 2OPPA 3ZZYA 4K0KJ 3IM8A 1U8SA 1Y5NB 5K14B 2VG6A 1FEHA 4RW7B 2LQBA 4K8XA 2ETJA 2BJ8A 2KO1A 3LGMA 1ZAXA 3WX4A 4RWTA 5IWAF 4KHWA 3MD3A 2E66A 3EXYA 3LPUA 3Q7BA 2AX0A 3GBTA 1VDHA 4YOYA 2K3IA 5HN0A 2I0XA 3RG6A 3N9UC 1YKWA 4E8UA 5D4OA 1HBMA 4BRKA 3W3DA 4IDHA 1Q7YO 5EX5A 3JQJA 5F3TA 2V4JA 2BJ1A 3H5SA 4FJ9A 2VQFK 2O8CB 2RB7A 2J0SD 2Y1JA 5GAEP 1FXXA 3GPAA 2PI5A 4GC7A 4ZVFA 2ZBQA 2FC0A 1FKOA 1FJ7A 1N8RT 3NFAA 3ID6A 4RW4A 2DHXA 3CCSS 3MM8A 4YEAA 1YITS 3OYMA 2GZOA 1A5WA 1Q81O 5KFDA 3S01A 4ED8A 2ZZMA 1FVSA 1RDBA 2K1RB 1RTIA 2DY9A 4NE9C 1CG2A 3B82A 2LP4A 3NP5A 2HHSA 2Y3YA 3DGPA 4NLWA 4CCHA 2A40A 4TYBA 1KLMA 1RTDA 3FMWA 5KGXA 5AFUA 4GVEA 4X62J 3H90A 3TAMA 3OBIA 5RUBA 1NPPA 2XC9A 1WTFA 4ECWA 1HYVA 3SJJA 3NGDA 4ZVUB 2FJAB 4KKOB 4B3RJ 3QO9A 3CMAN 1S7HA 1RWPB 4UY8O 3BQ1A 3NKYA 5M1PA 3OSNA 3W64A 3ZEUB 1VBXA 2YWFA 2ZNZA 2JFDA 2VG7B 4QYZJ 1E6YA 1VSEA 2C2RA 2MYFA 5L9NA 4JKFA 4OJRA 3QIOA 4IFVA 3QT5A 3M2RA 3CCWA 2KH9A 2ZJRQ 2V9WA 4DPUA 3P5BP 3NVKA 1FRMA 1RYRA 1LQ9A 1UAXA 4KQZA 1HNIA 2ROPA 4CGIA 2LDIA 3T3FA 2MY7A 4ZVOB 3H59A 3MPWA 4RBVA 1U49A 3DLJA 2NYIA 1TV6A 2Q1LA 1QAIA 3Q89A 3Q8PB 3O3FA 1L5UA 2YPYA 3ID8A 4DTOA 2M52A 4CBXA 2QTDA 3R5BA 4HI2A 1LXJA 3FBCA 3I4PA 1NGEA 4PL7A 3OW2M 1IJEB 5M2PA 2P2CB 3FEYB 1QVFR 3DLLL 4Z0UA 2HWTA 3WXMB 2FDNA 4C8LA 2IMOA 1SKWA 1N5QA 4EFAC 1R8BA 1BI4A 1NCLA 1BO5O 3Q8UA 2J6TA 5GAHU 4X64K 1M1KO 3G8QA 1R0CB 4B8CA 2C3YA 2XY5A 3MWBA 2J9CA 3RAQA 2PFFB 3JTNA 3GYNA 1HKAA 1EP4B 4LFBK 2AU0A 3AXMA 4EHUA 4B9SA 1WSJA 2J6SA 4Q2MA 2GWJA 3AJ2A 1NK4A 3DLGA 2DTUA 3SYZA 2C42A 4H8KA 4OYWA 2HNDA 4FYVB 2DT9A 3D67A 4DJBA 5KFOA 3HHNB 1A7GE 4V19S 4URQU 1IKWA 4DUTA 4NI2A 4DZ6A 2QXFA 3TJ8A 1LXNA 4BR7A 4MFBB 3ETMA 5KFAA 2D9PA 2M9KA 2C28A 4Q8FA 3A4TA 4XH1A 4V1Ak 3J7AN 3KK3A 2ZH3A 2AF6A 1IM6A 2RDIA 3NAIA 2KFNA 4MDBA 2H48B 4DTPA 2WBNA 5LXRA 5DM7L 1U8WA 1LAWA 5KT3A 4JD2A 3T41A 3T1AA 4LSZB 4UUXA 3ASMA 3EPGA 3TNVA 2ILYA 4I2PA 3OXGA 2ZDPA 3TEHB 3O2IA 3TUJC 2M2BA 4MK9A 2HLTA 1SJQA 3M9NB 1PJ5A 4B3MJ 2BRLA 3PW2A 2YKMB 4BHQA 3DRSA 2H65B 3IR5B 2RPIA 1U1LA 4ISEA 3BZQA 1NM2A 4JV5K 1GQEA 1QUVA 3MN7A 4PWDB 4CRJA 1RTHA 3R3TA 1UVLA 1N0UA 3J7AP 3HRGA 3SAFA 2KT3A 1FA0A 4MK7A 3A13A 4JRQA 1HNVA 4AHSA 4RNOA 2E2PA 4H0OA 3FEXB 3DHXA 3QATA 2IYGA 2NREA 2B6AA 1H7WA 3VQ7A 1QAJA 4ELVA 4HDGA 3AVGA 2XCAA 4AQYK 1RWMB 4UF4A 1YJ9N 1DTTB 1YJRA 5BR8K 3V9SA 4DTUA 1FXRA 4G1QB 2MKJA 3NGIA 5DS7A 4DV5K 5F8LA 4PAAA 1RAIB 1Z26A 4AM6A 1H72C 1Q4RA 1U2VB 2XZDB 1SCJB 1NPKA 5C2DA 2F9TA 1FESA 3P96A 2GVDB 1PJ6A 2VPYB 3PACA 3JAMU 4ZP7A 1V3RA 5BRDA 3EYZA 2ZD1A 4F3MA 3ILJA 2JWNA 2QA2A 5AZIB 1BUXA 2M8HA 2OEKA 4USMA 5KAKA 3KFWX 3EVOA 1TFYA 4DU4A 4KHSA 4N56A 1NHUA 2P9PA 1DAXA 4BBYA 1XQIA 4CLWA 4OKKA 3KDOA 4RNHA 1ZETA 2AA4A 4HT5A 2J7UA 3IG1B 1Y3JA 4HLBA 3TX8A 2XMJA 3R7NB 3VF4A 1CBKA 3HLUA 3P4IA 3VEXA 2NLWA 2FSNA 3HD2A 3WX8A 2HHWA 4CEZA 3HHEA 2F63A 3PKYA 1YTUA 2BKPA 4DFKA 1ATSA 4WXWA 3AVBA 3P8BB 2ZWHA 1SL1A 4DR3K 4MO5A 1N34J 3BBFA 4ZK7M 2WOMB 2YKQA 2AT1B 3P6YC 3GV8B 2MSSA 1IBMJ 2KRRA 2JWLA 3VGVA 3HK2A 2G2OA 5IV4A 3CPEA 4A2AA 5M1FA 2O1PA 1HNZJ 1JJ4A 1FJGK 3KK2B 3CD0A 3AV9A 2P6TA 2CQ3A 1MROB 2MKYA 1HNWJ 4X4PA 1VHXA 1ZA1B 1YRTA 2VQFF 4MH8A 3VQ8A 4C8NA 3CCJN 4V19J 5C2FA 2JEGA 2Z2LA 2AMCB 2HAIA 1CLFA 1GLLO 3QJLA 3BYRA 1S6OA 5E3AA 2NYHA 2E7XA 1TUVA 3EE9A 4X65J 3U9ZA 3D0GE 1MU2B 2V4RA 3THXA 3CMQA 1HA1A 3UDEA 1RT5A 1SQEA 3QGPA 4KHPJ 1D8ZA 4M3TA 3MR6A 1NNDA 3VHQA 3FCHA 2OD4A 2OH2A 3QEVA 5K9FA 4M3RA 1LFPA 4UW2A 5ETKA 1MWQA 4DMNA 1VRTA 3Q22A 4FWRA 2GA7A 4TXSA 2XM3A 5A0YA 4O3RA 4KTWA 1UPMB 5LJ5Y 3JB9k 1EWQA 3VZIA 1PGZA 1Y9OA 4U67L 1QSSA 3UWTA 4DR6J 1HWUA 3FQLA 4BE1A 3KUEA 1WOPA 1FKPA 3L7UA 2NRTA 1MW7A 3O08A 2QLXA 5FRNA 5F0WA 4USKA