1J5OA

Crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*
publication title Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 121
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1j5oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1j5oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j5oA05
3OS0A 1RTDA 3KLEA 2HB5A 3NGDA 1SUQB 4OVLA 2E9RX 3S3NA 5KFHA 4CESA 3KHHA 1EX4A 1JLEA 4NLTA 3ZT2A 1KVBA 1MU2B 2RPIA 3RMDA 5E41A 2VG7A 4TQRA 1ASUA 3AV9A 3O3FA 1RBSA 1VSHA 1C6VA 3D28A 5EUHA 2BRLA 4K4TA 4IKFA 2HMIB 2JGUA 4M45A 3RR8A 3QIPA 5DLGA 3PX4A 2FVPA 3RAXA 4ZMMA 5KFLA 1RYSA 4FJNA 4O3RA 1S6PA 3PO4A 3IS9A 1NHVA 4E89A 4Z4FA 2IGIA 4KHMA 1RT4B 1VRTB 1RT6B 1NJZA 4RW6B 1XHXA 4M3RA 1N6QA 5CZ1A 3CJ5A 3QNNA 4FK4A 4H54A 3QGGA 3THVA 4Q8FA 4E7LA 2VWKA 2HHWA 3WNHA 4IRKA 3CIZA 2E9ZA 3EY1A 3NDKA 3AVCA 1TV6A 2GUIA 1WSIA 2LSNA 2QE5A 4KRFA 4CFDA 4RZRA 3V9ZA 3HVTA 3MR2A 2ZE2A 2FJXA 4CJQA 3SUOA 3HO1A 3IN5A 3VQPA 1NNDA 2VG5B 4KKOA 4FLWA 3QZ7A 4FM0A 2F8TA 5DK5A 4TYBA 4RW4B 2HHTA 4FYDA 4QW9A 5KFPA 3SQ2A 5KFEA 1EETB 4FLTA 2B43A 3C94A 1NK5A 4DL5A 4EO8A 3BREA 4FLZA 1JLBB 4YP3A 1LV5A 1S1TB 5C5JA 4QWDA 5HRSA 5J2PA 1JXBA 3BDPA 4M42A 1RTJA 3ZSOA 3VQAA 3KK2B 2XC9A 1OS5A 3AVIA 5DQGA 4ED2A 4R8UA 2G8WA 2OA8A 1ASVA 4ECSA 3NHGA 3KLIB 1WNEA 4M41A 1KRPA 4B9NA 1RT1B 4KB0A 4IDKB 4IFVA 1WAFA 1JLGA 3KJVB 3GYNA 2R8HA 3IRXB 3V6DB 2VG6B 2DFFA 2X78A 4ZTJA 3RBDA 4FJHA 1DTTB 3ZSVA 4KHNA 4DL2A 4DMNA 3IAYA 3PW2A 4XPEA 4ZP7A 4F3OA 3FFIA 3OYLA 1LW2B 4NYFA 3DRRA 3DLEB 3MAQA 3VA0A 5DGBA 5HROB 4ZP9A 3CJ3A 1LAWA 5KFSA 1YTUA 1QTMA 4GVMA 4BWJA 3EPGA 5KFMA 4PQUA 4NCGB 4RNNA 4PUOB 3QIOA 1U09A 1BCMA 5JS2A 1EKEA 4CGHA 3OSPA 2I5JB 1VSEA 2VA3A 1B92A 3T3FA 3DOLA 3ISND 5C25A 3SQ4A 3C6TB 3B6OA 4Z4GA 2WONB 1S9EB 1QE1B 4GMJB 4DQSA 2IJFA 2QK9A 3HM9A 4AHTA 3K58A 3CFRA 3AVAA 1CXQA 4PWDA 2IM2A 4TN2A 3UR0A 4I2QA 2XCPA 1WSFA 3KLGA 4TY8B 4KHUA 1JIHA 3G10A 1DTQB 4AHVA 3OYJA 4CE9A 1S97A 5C24A 2BQ3A 1RBRA 4DG1B 4F4YA 4CF8A 4XO0A 4AHSA 3NBPA 3ALYA 3L2QA 5KFXA 3HYFA 2HHQA 1K1QA 1T8EA 4H4MA 2WOMA 4J9LA 2JEFA 3PUFA 2C28A 5KFDA 1BQMB 5KFUA 1I3AA 5KFNA 1HPZB 3KIOA 3M8SA 4FJKA 4FK0A 3VQ5A 4F2SA 1SUQA 3H5XA 4ZTFA 1HYSB 4DL4A 4EZ9A 4CCHA 2OPPB 3SFUA 3PW5A 3NH0A 3KMSA 3SQ1A 1NOYA 3KHGA 3BR9A 4K4WA 4K4UA 1TKTB 4NLGA 1W9HA 1C0TA 2V4QA 2A1SA 1UA1A 4DU3A 4E1NA 4DF4A 3OL9A 3D45A 1KHWA 4RW7B 4ECWA 4CEZA 1JL1A 4DFJA 4NLVA 4ECRA 2UUWA 1ZBHA 3OYEA 2YNFB 1TKZB 2JEJA 1HQUB 2VA2A 4Z4HA 1A5WA 1EP4A 4KHQA 1Y97A 5KFQA 3G6YA 4CIGA 3HXMA 4J2DA 1RT4A 4WE1B 4EP5A 3Q8QB 1VRTA 1RT6A 4RW6A 3T19A 3LDSA 3MR5A 4C8LA 3OHAA 4FLXA 3RBEA 1YVFA 4C8KA 4XIUA 4MQ3A 4Q43A 5CYMB 4QOZB 1LWFA 3P1GA 2UVRA 3Q8RB 4NLXA 4O0IA 2ASDA 4RUAA 2XGQA 4FM2A 1T7PA 1HRHA 5HBMB 4B3OB 3KHLA 1RBVA 4ECQA 4DF8A 4IH7A 2OPQB 2FC0A 4FJGA 3U3YA 1W0HA 3NCIA 1C1BB 3O3HA 4CIFA 3MR6A 4FJXA 4FS2A 3QNOA 3SYZA 2VG5A 2J6TA 4RW8B 4CJKA 4DU4A 3H08A 4DSEA 5HRPA 2UVWA 1XR7A 4RW4A 4CHQA 3M8RA 1JXEA 5KFWA 2FVSA 4QWEA 2XGPA 1HJRA 4TYAA 4URGA 1EETA 3AVKA 4FJLA 5EWEA 2DPIA 4K4SA 3RR7A 3DYAB 5KGWA 1JLBA 3NGZA 5HP1A 2R8GA 2YNIB 4ID5B 3KK2A 1NK7A 5KFJA 3TQ1A 4RNFA 4G3IA 3RTVA 4FBUA 4B8CA 1IKVB 5DLFA 3KLIA 3MECB 4OPJA 3BJYA 3KD5E 4X2BA 3DMJB 3LZIA 3OYIA 1RT1A 4Y2AA 1NJWA 4IDKA 1NK4A 4IH6A 4CF0A 4FXDA 3BSOA 3BGRB 3KJVA 4GC7A 1T3NA 1YTAA 4O3SA 2OPRB 3LAMA 3RB4A 3O4QA 4B9MA 3IRXA 1IM4A 3V6DA 4Z4EA 2VG6A 3AO1A 1X9WA 5KTQA 4ECUA 1DTTA 1NJYA 4M3ZA 3SUNA 1HYVA 4C8NA 1C2PA 4B9VA 1LW2A 4BDPA 1RT7B 2P51A 4JS4A 1Z25A 5HROA 3RMAA 4FJ5A 2AX1A 4KHYA 1N5YB 4DS4A 3N6NA 3NH1A 3GIMA 4FJ8A 4CK3A 1HNVB 4RNHA 2I5JA 3QEPA 3K57A 2HVIA 1LWEB 2X74A 3VA3A 2QV6A 3M8PB 1ZBFA 1BQNB 3C6TA 3LZJA 1TKXB 4Q45A 4ED8A 4E1MA 1QE1A 2O5DA 4F50A 4ECZA 4FJ7A 1JX4A 1KHVA 2OH2A 2GV9A 5F8NA 4CECA 3OYMA 2XRIA 3LAKA 4YR2A 3CJ4A 1S4FA 3HP6A 1VSFA 3F73A 4K4ZA 2E6LA 3PR4A 2D3ZA 4CFBA 4IFYB 2KTQA 4M3XA 1U48A 3MEGB 2AU0A 2IM0A 1KTQA 1DTQA 5F9NA 3P83D 3BSCA 1DLOB 5J1EA 4EYIB 4DG1A 3L2RA 3SNNA 4FJIA 3AO2A 4DTOA 1NK9A 1D0EA 2JEGA 5KFZA 4C8MA 4N76A 1Z26A 5KG7A 1BI4B 1BQMA 2R2SA 3PW7A 1A5VA 1WN7A 2P1JA 3MTKA 3TAEA 1LW0B 4QWAA 4CEOA 3MF5A 3IG1B 4LSNB 4J2AA 4BDYA 1Q9XA 2B5JB 2FVRA 1TL3B 1KLMB 5KGXA 4EP4A 3L3UA 2OPPA 4O44B 3OL6A 3BSNA 2E6MA 3QETA 1G15A 2HNYB 2HW3A 4J9NA 2GIQA 4CJUA 2CJQA 1TKTA 2HHVA 3DRSB 4RW9B 1SL2A 4C8OA 4R0EA 1I6JA 3QYYA 4CEQA 4MKAA 3LP1B 4KPYA 3AVHA 4RW7A 1UAXA 4IH5A 2GIRA 5KFAA 3ZSWA 3OS2A 4KV8B 3HKWA 4LH5A 2YNFA 2W9AA 4KTQA 1TKZA 4FZXC 2B6AB 4KO0B 3CO9A 3OHBA 3CDUA 3HVRA 3NH2A 1HQUA 4WXOA 4CJSA 2FBVA 3OYCA 3V1RA 3V4IB 5KI6A 3LP0B 2C22A 1FKPA 1C1CB 2V9WA 3QLHB 3LWMA 2Z1JA 4KI4A 3EZ5A 3WNFA 3KMQA 4NCBA 3DLKB 4CJPA 4DTNA 1S1UB 5CYMA 3TARA 3NF6A 4BDZA 2IMWP 3AO4A 2YNGA 4TLRA 4CHOA 4PY5A 3NGYA 2NUBA 3DI6B 3I5CA 1S0MA 3NGIA 2XY6A 4TQSA 1SH0A 5HBMA 3PJXA 4JV1A 3JSMB 4DTMA 1TAUA 2HAIA 2OPQA 1D5AA 4W5NA 3LP2A 1HQEA 4F3TA 3CM5A 3G6VA 5KRSA 2FVCA 1NOZA 3BQ2A 4RW8A 1IKWB 3NAEA 4Q0BB 4IG0B 2HWIA 4W5RA 3KNAA 4ECXA 2YHBA 4KBIA 2R8IA 3HPHA 3VQ6A 4CJEA 4RG8A 2BRKA 3V9SA 4E3SA 1MMLA 4RNMA 1TK0A 4DTPA 4KHWA 4O3PA 1RA6A 2QKKA 3DYAA 5J2NB 1XWLA 4DFMA 1S6QB 4I2PB 2FLPA 4LSLB 4ECYA 1ZTWA 1VRUB 3CYMA 2YNIA 4ID5A 2J6UA 1IKYB 1VSMA 5F9LA 3M9OB 3PZPA 1ZYQA 5EU7A 3UDLA 1WNSA 1S48A 3I8DA 2AGPA 3AVNA 4RUCA 3T1AA 5KFBA 1IKVA 3JYTB 1TVRB 2RKIB 4DSJA 1JKHA 4ELVA 4DWIA 5KFFA 4LQ3A 1TL1B 3PX0A 4FVMA 3BGRA 4Y3CA 4N56A 3HVWA 2OPRA 3CDWA 1XHZA 4O4RA 2ATQA 2R7YA 4CJFA 1XI1A 4MKBA 5KG6A 1LWCB 1VK0A 4E0DA 3AO3A 2UUTA 3CFOA 1RT7A 4QAGA 4Z4CA 2YV0X 2AQ4A 3QERA 2QKBA 1S1VA 2BANB 1N5YA 2IDOA 4N47A 4YNQA 2AWZA 4CF2A 3WNEA 3KK3B 4M3WA 3PY8A 1HNVA 4CK1A 3ZT3A 1LWEA 1RDRA 3SUQA 5CZ2A 4G1QB 1TP7A 1BQNA 4WYWA 3LANA 1TKXA 4F8RA 1S1XB 2A1RA 5KFOA 2RF2B 1SKSA 4MH8A 3QEIA 1CLQA 2FBTA 4DQIA 2XY7A 4IFYA 1S9GB 1L5UA 4O3OA 4IRCA 5FRMA 4J9MA 3MEGA 4NLUA 5HLFB 2EX3A 3KK1B 3IGVA 1U4BA 2R8JA 1HARA 3GIIA 3V6HA 2BQUA 3TAPA 3K5NA 1C0UB 3RMCA 2PY5A 5DQIA 2Y1IA 5KRTA 3K59A 3QO9A 1D1UA 2O4IA 1RT2B 2V0NA 1LAVA 1BI4A 3RWUA 1B9DA 3AVMA 5DGAA 4B9TA 4LQ9A 2ILZA 1XC9A 3IG1A 4LSNA 3OLBA 3K5LA 4KHSA 3I0SA 3FQLA 3MFHA 3OL7A 3I0RB 1TL3A 2ETJA 4FW2A 1KLMA 4FJMA 3PX6A 3TI0A 3VQBA 3KLVA 4IG3B 4Q8EA 3VQEA 1VSDA 3OYKA 3DRSA 5KG5A 4RW9A 2HVHA 4J9QA 2EHGA 2IAJB 3LP1A 4FK2A 3PO5A 1RDDA 4DEZA 1SV5B 4ICLB 3DOKA 1VSIA 4KV8A 3CJ0A 1S10A 3SV4A 4KO0A 3AVGA 4W5TA 3LALA 3E51A 3NF8A 4DSLA 1QAJA 2G8KA 2HHSA 3V4IA 3LP0A 4N41A 1C1CA 4DFPA 3QLHA 4ZPDA 1MU2A 3GV8B 1BL3A 3DLKA 1RA7A 3TAQA 1JLAB 1S1UA 4B8AB 2YKMB 3I5BA 4WYLA 1T05B 3ITHB 4CGFA 4M3YA 2G8IA 3DI6A 2HMIA 4HUGA 2YNHB 3V9XA 3BQ0A 1KVAA 4E7KA 3L2VA 3JSMA 5HRRA 4M95A 3MXIA 1GOAA 5F8GA 5KG4A 4DTSA 4U7CA 1F21A 4DL3A 3VQ7A 4B9SA 1QUVA 3MFIA 2G8UA 3DDKA 4CEDA 4CJTA 1IKWA 5J2MB 1IKXB 4IG0A 2FBYA 2XO7A 4OLAA 1U47A 4B9UA 3AVFA 3RB3A 4CJ3A 1NK0A 4O55A 4WZQA 2AGOA 2F96A 3SQ0A 3ZT0A 3CM6A 2Z1HA 5CY4A 3SZ2A 3PW0A 2ALZA 3H40A 5J2NA 4TSXA 2IS3A 4FJ9A 1S6QA 2BE2B 4LSLA 2HHXA 4O3NA 3I5AA 1VRUA 3VQ8A 1IKYA 4U6PA 2V4RA 4H4OB 1R0AB 3GV5B 3ZSZA 2C2RA 3DLRA 3JYTA 3F9KA 1TVRA 2YKNB 2D7SA 2IA6A 2RKIA 4KFBB 4JRPA 3ZT1A 4L8RB 4KE5A 1TL1A 4HHTA 4MFBB 4QPXA 4GC6A 4CEBA 3BQ1A 4DSKA 1JLCB 3HSTB 4URQU 1J54A 1KFSA 1HYZA 1S6PB 4MK9A 2DPJA 1WLJA 3EPIA 5KFGA 1GX6A 1LWCA 1D9DA 2WB4A 3CVKA 3V9WA 1S1TA 2F8EX 3MXMA 3HL8A 5L1JA 2BANA 3OYGA 3OYNA 2XI2A 5F8HA 5KT6A 1XR6A 1L3UA 3OJSA 4CJLA 3KK3A 3MXJA 1X1PA 1TK5A 3SPZA 2WTFA 4J9SA 2PYJA 5KG0A 1RT3B 4G1QA 1ZTTA 4KAIA 3NF9A 4I9QA 4PA1A 4M94A 3K2PA 3ICLA 4O3QA 3QGIA 5KT2A 4ZVEA 1U49A 1N48A 4CGDA 4ELUA 1Q8IA 2ZE2B 4W5QA 3CJ2A 2RF2A 1QAIA 2W8KA 2WCXA 3DLEA 3ZSQA 1T94A 3OYBA 2HNDB 1L3SA 1RT5B 4CJ4A 1S9GA 2XY8A 5KFKA 3MEEB 4ED6A 3KK1A 4IR9A 4NCGA 5L9XA 5JXSA 4IR1A 4PUOA 4K8XA 3H2LA 4IKAA 3GIJA 1C0UA 4FLYA 1X9MA 1RTJB 5K14B 3ZSRA 3CWJA 1RT2A 4FZYA 1L3VA 3D5MA 2Z1GA 1RDAA 2WONA 4M3UA 4E7JA 1S9EA 2DTUA 2D0BA 4R8UB 4CGGA 3AVBA 4MK7A 4ZHRB 2FLNA 4KSEB 3V1OA 1CZBA 2FLLA 4DLEA 4IFVB 3H59A 4HKQA 3KLHB 4TY9A 2R2UA 1KLNA 1U04A 2XY5A 4NCAA 4TY8A 2D0AA 1KCFA 3CQ8A 1KSPA 4IG3A 4QW8A 4DQQA 2FJWA 3O3GA 4OKKA 2D3UA 4BACA 4ZPCA 1REVB 4K50A 3N6LA 3U6FA 2IAJA 3QINA 3DRRB 4OGEA 3FQKA 4NLQA 5T7BA 3TAFA 2KZZA 5HRNA 1SV5A 4ICLA 1N56A 4O5BA 5KG2A 1HPZA 3G0ZA 3OL8A 2KQ2A 3TANA 3PV8A 4K4YA 1J5OB 3HJFA 4CEEA 2HHUA 1HYSA 3NL0A 3L2UA 4JV0A 5C25B 1UWBB 3QESA 1FK9B 4DSFA 3DLGB 4ZVHA 4DTRA 5KT5A 4HYKA 3KLFB 4Q5VA 5I42B 4KAZA 2YKMA 4OKEA 3C95A 4WFYA 4CHNA 3QEXA 1T05A 3ITHA 4PWDB 4ID1A 1S9FA 1FXXA 4AH9A 2YNHA 3C6UB 1GOCA 2ZKUA 3QGHA 3SI6A 2FVQA 4ED1A 3V81B 3DLBA 3GQCA 4BE2A 4NZ0A 4NYNA 1HNIB 4Y34A 1TQLA 3LWLA 3ULDA 3PR5B 1BGXT 4IOBA 3VQCA 2IBKA 2F8SA 4WE1A 1IKXA 3OYFA 1L3TA 2KFNA 1JLQB 2RN2A 2G8HA 1Z4UA 4OPKA 1TKDA 1RILA 1QSSA 4K4VA 3AO5A 2ASLA 3SI8A 2KZMA 4ZVGA 4FZZA 4QCLA 4QWCA 3G86A 2KW4A 2ZQBA 3M9NB 3T5LA 3U3GA 2BE2A 4ZPBA 3PJWA 3NAIA 2W7PA 4B3OA 4AHUA 3ZSYA 4YR0A 4K4XA 3CG7A 3QEWA 4CGJA 3V6KA 4Y1DA 4H4OA 4NLSA 3SCXA 1SKRA 2OPSB 1R0AA 1C1BA 2X6NA 1C0TB 4EO6A 3DRPB 2YKNA 3EZUA 1NJXA 3VQ9A 4KFBA 1FKOB 2DFHA 1QS4A 1D9FA 4MFBA 3RB6A 2Z1IA 4FLVA 4AILC 4E19A 4RNOA 3B6PA 1JLCA 3N6MA 3TVKA 2OZMA 5JUMA 4WXWA 1EP4B 2IC3B 3H5UA 2AX0A 4DQPA 4JV2A 2IOCA 4YMEA 4MIBA 1WSJA 3OYAA 3E01B 3OJUA 2UVVA 3M8QB 5DG7A 2KFZA 1LWFB 2JLEA 3WNGA 3MECA 4CEFA 4YFUA 3Q8PB 4EYHB 3DMJA 3VQ4A 4HVJA 3Q8SB 3LPTA 3TR8A 1RT3A 2W9BB 3A2FA 4WZMA 4O4GB 4R5PB 3SUPA 2OZSA 1NKEA 4Y2CA 4OKJA 4DLGA 5CYQB 1WSGA 1BHLA 3L8BA 4M3TA 1BIZA 3UPFA 4YR3A 5DMRA 3MEDB 3L3VA 3K5MA 5L1IA 1IH7A 2HNDA 4NLDA 1RT5A 1K6YA 4Z0UA 1ZBUA 3PHEA 3CFPA 1JL2A 3MEEA 1GOBA 5JS1A 2XHBA 3NMAA 3K5OA 2FJVA 3HHKA 3GILA 4FBTA 5FDLB 4EZ6A 4FCYA 5DG9A 4EEYA 3HPGA 4DTXA 4HUEA 2D41A 3AVLA 5HP1B 4CJVA 3M8PA 2O4GA 5K14A 1C1AA 4ZVFA 3EYZA 3ISNC 3H4BA 4H8KA 4ZHRA 2DY4A 4Y1CA 3V1QA 3GIKA 4ZP8A 3RRGA 2IM1A 3KLHA 5D3GB 3RAQA 3ASMA 3KOAA 4E7IA 3HVAA 3NF7A 4CF1A 4BE0A 1DLOA 2W9CB 3PVXA 3TAMB 1REVA 1RTHB 1VSLA 5KFIA 3SJJA 4FJJA 3OS1A 3S3MA 4CFCA 4KTWA 2R8KA 1RTIB 3HT3A 4N5SA 2GC8A 4BE1A 3UQSA 2X6SA 5KT7A 1RBUA 1LW0A 1SH2A 1TK8A 1K1SA 2BDPA 3DM2B 4ECVA 1NK8A 1J5OA 4DQRA 2B5JA 2VWJA 4TXSA 1T03B 4OJRA 1UWBA 3LPUA 4E7HA 2AGQA 4O44A 4Z4IA 1S1WB 1FK9A 3DLGA 2HNYA 2HNZB 3KLFA 4DL7A 4DTJA 2C2DA 5I42A 1HMVB 4HCBA 5EDWA 3KKSA 3BSAA 2RDIA 1EXQA 1W25A 5KFYA 3C6UA 1S0NA 2E9TA 4NRUA 4I7FB 2HWHA 4OLBA 3V81A 5F8MA 3S9HA 2W42A 5J1EB 4MK8A 2B6AA 1WSHA 4ED3A 1NHUA 3L2WA 1HNIA 2BR0A 4IRDA 5KG1A 2DFEA 3OLAA 3OVNA 5KFTA 1JLQA 4ED0A 1SL0A 1RDCA 1QHTA 5SWMA 5J2QB 1UOCA 1TAQA 2W8LA 2BGGA 5T14A 3OSNA 4HTUA 1X9SA 2ILYA 4JS5A 4J2BA 2GBZA 2JC0A 3NFAA 2PYLA 4NLRA 4NLWA 1JLFB 5C42B 2P5GA 2ZD1B 3H5SA 5FROA 4EBEA 2Q3SA 1ZBLA 1RYRA 2OPSA 5I3UB 4RU9A 3SV3A 1XR5A 4W5OA 3DRPA 1O1WA 3VN5A 1FKOA 2UVUA 1ZBIA 4CHZA 4Q0BA 3CDEA 4J9KA 4IBNA 5KFVA 3VQDA 2AJQA 4AHCA 3GV7B 4CIEA 1YVUA 3NKYA 1RTDB 3KLEB 2IC3A 1WSEA 4FLUA 1ITGA 2PZSA 2FBXA 1RNHA 4DFKA 1VSJA 4JUZA 4IQXA 3KD1E 4F4WA 4I2PA 1FKPB 1JLEB 4ZP6A 5KG3A 4KTZA 2CKWA 3E01A 2WHOA 2G8FA 4CERA 4DS5A 4WFZA 4O0JA 3M8QA 1BIUA 2QXFA 3H4DA 4NLPA 2VG7B 1I39A 5FRNA 4DU1A 3ZT4A 5DQHA 4CGIA 4KHRA 2YNGB 4KB7A 2ATLA 4AHRA 1RBTA 4F2RA 3QIDA 3P5JA 2XCAA 3OY9A 2W9BA 3QIPB 4O4GA 4R5PA 1CZ9A 3LP2B 1HQEB 2W7OA 4CFAA 5EWFA 1CSJA 2WRMA 5CYQA 4DSIA 3RB0A 1N4LA 5KFRA 2B4JA 3IS9B 4FS1A 3TAGA 2EC0A 2ITGA 4ZPAA 1TGOA 1KFDA 3DLHA 3MEDA 1BISA 2IM3A 1NKBA 4URSA 3H5YA 1N6QB 4CK2A 3KHRA 4JRQA 4CHYA 4WFXA 3S3OA 4CEAA 5FDLA 3TABA 2IJNA 2R2TA 3HK2A 4JLHA 5L1LA 3V6JA 3SFGA 3KTQA 4NRTA 4OGCA 1RDBA 1A5XA 4CF9A 1SL1A 1TV6B 1SKWA 3M9MB 5KT3A 1ZETA 1S1XA 2E4LA 3VQQA 4NLOA 2P5OA 3HVTB 3NE6A 1CXUA 1WAJA 1S49A 2D0CA 4FW1A 4EBDA 4CJRA 1JKHB 4KKOB 3AA3A 2XI3A 5D3GA 4B08A 3HP9A 2JC1A 4CJWA 5HLFA 2OYQA 4QWBA 4UQGA 1S0OA 1YT3A 4ELTA 2WK4A 2W9CA 1J53A 3T5KA 3TAMA 4OL8A 1RTHA 3IGNA 4YQWA 2I1RA 1GX5A 3NAHA 1U45A 1RTIA 5J2PB 5L1KA 2JEIA 4B9LA 1S1VB 3AA5X 3AA4A 4CHPA 2R2RA 3OYHA 4K8ZA 1Q9YA 1QSYA 3DM2A 5KFCA 3RMBA 3D0PA 4KB1A 1IO2A 1SH3A 1NK6A 3G6XA 4J9OA 1KVCA 3I0RA 2Y1JA 3FDSA 1T03A 4J9RA 3TWHA 1JLGB 5F8JA 4MIAA 3KKRA 3H98A 4GW6A 1S1WA 3VQSA 2YHAA 5EWGA 2G8VA 2HNZA 1HMVA 4J2EA 3OYDA 3FRZA 2D5RA 1RCHA 3FFIB 3PW4A 1NKCA 5F8LA 4CJ5A 5DG8A 3O4NA 3UIQA 2ASJA 4I7FA 4J9PA 5F8IA 4F4XA 3QEVA 4HCCA 4PQUB 1J9AA 3ZCMA 4LD0A 3QZ8A 1RAJA 5KT4A 4BWMA 4Q44A 3DOLB 4KI6A 4KREA 3QO9B 1QQCA 1D8YA 5J2QA 3AVJA 1JXLA 4DL6A 4DTUA 3AA2A 4HUFA 3HPOA 4NLYA 1JLAA 1BCOA 3T5JA 3FSIA 3V9UA 3I0SB 3T5HA 1ASWA 4XPCA 2BQRA 4I9LA 1JLFA 5C42A 4I2QB 4LH4A 1VSKA 2ZD1A 3KLGB 1IG9A 4LY7A 4NYZA 4EBCA 4ED7A 1S5JA 1UA0A 5C24B 3MR3A 4F4ZA 3ZSXA 5SZTA 5I3UA 1QSLA 4FM1A 2XWYA 3NBPB 2RDJA 3SPYA 5J2MA 2C2EA 4ECTA 4H4MB 3RRHA 2WOMB 4F4KA 1B9FA 3DOKB 1C0MA 3LP3A 2J6SA
chains in the Genus database with same CATH superfamily
3G87A 1QY7A 3NNAA 5JLFA 2RQCA 3ZLJA 3QT6A 5G0RA 4JI3K 4OVLA 4CESA 1EX4A 1MROA 3U1MA 5A0YA 3ZT2A 4RWXA 3J7AN 4N77A 1YI2N 2IIHA 3ZNJ1 3RMDA 5E41A 1VHFA 1Y5LB 2W2OP 2W6KA 3D7EO 4UUWA 3D6MB 1VSHA 1HLUA 4QR2A 4IKFA 2YWFA 3S8SA 2HWTA 2VDHA 1LK7A 5LMNK 5DLGA 1R0CB 3PX4A 4DPXA 5KFLA 2QEXS 4QIVA 2R7UA 3CI5A 1UJ6A 4OZLA 4BQLA 3MDFA 4JI0K 2E5LJ 1RSCA 1RT6B 2HFNA 4RW6B 4DQ8A 2Q36A 1XHXA 2KHOA 2AYGA 3C14A 3UE2A 5CZ1A 3CJ5A 2KYXA 4H54A 3U4LA 1RWMB 1NGBA 1F5AA 4Q8FA 2Z30B 5CH7B 3IR5B 3M1FA 2HHWA 3WNHA 3CIZA 2E9ZA 5L9NA 1TFYA 1HKBA 1AROP 1WSIA 2CJYB 2LSNA 3JSYA 1WBBA 5J1NA 3CCRN 4RZRA 1KD1T 2A6OA 3MR2A 2FJXA 5K8OA 5K5MA 5K20B 3IN5A 3VQPA 1NNDA 2IYIA 4MDBA 1TUGB 2AJ0A 2G0CA 1IR2A 2X7IA 2Z2LA 1HX1A 3O6WA 3SQ2A 2Z2YB 1BMQB 4P10A 1UJ4A 1EETB 2B43A 2XTJP 1Y3JA 4DL5A 2J8AA 3BO2A 5U47A 4YP3A 5J2PA 2LLZA 2XMUA 3BDPA 4M42A 3ZSOA 1R8PA 2XC9A 5IZHA 3AVIA 3AQOA 3BV8A 1WG1A 1OMSA 4OIXA 2UUAJ 1ASVA 3NHGA 2VQEK 1R31A 2RQKA 1YDLA 4DR7K 1RT1B 1DQ9A 3D2FB 1WAFA 3C6HA 4UTGA 3PIOQ 2ZH6A 1YTYA 4ZTJA 4FWNA 2B8PA 1OVYA 2PDAA 3OYLA 4NYFA 4CO5A 3RSEA 1YTUA 1NBWA 2LKZA 4BWJA 5KFMA 1VIXA 3MM6B 3MN6A 1IN0A 4ZJLA 4USHA 1A9NB 1B92A 4I56A 4HWIA 4QU7A 2X1BA 4P72A 3VGVA 1F9FA 2AMCB 4MMOA 1U8WA 2QK9A 3HM9A 4AHTA 2N7YA 3AVAA 3CJ7A 3RU0A 4NE9C 3DNCA 2MZRA 4LF6J 2JH3A 3IBCB 1WSFA 4CIOA 5AQOA 4OI0A 3AAPA 2QT7A 1X4GA 5JMNA 3OYJA 1Q81O 3R1HA 5AQFA 2AEFA 1S97A 5C24A 4AHSA 3GPAA 1YJTA 5D77A 4WKRA 2HHQA 1G6BA 2XZTB 2R7RA 1NO8A 2WOMA 2JEFA 1I3AA 3QMQA 4RBTA 2FD2A 4MYUA 2OGUA 2ALYB 1OO0B 1M90O 1M5KC 4AM7A 3ZX3A 1NXIA 2EK6A 1XMBA 4BC5A 5LOQA 3PW5A 3NCRA 5GAGP 3NH0A 3SQ1A 2WUSA 2HBMA 1TKTB 3THTA 4NLGA 1W9HA 1C0TA 2IIRA 4DCOB 4Z7YA 2VD3A 2UV8A 2VGNA 4CDIA 3OL9A 1HKCA 2Z58B 1KHWA 2AT1B 2IMOA 4ECRA 1PKUA 4ZVRB 1T3OA 1KAZA 1TKZB 4Z4HA 2CZ4A 4DX5A 3HXMA 1RT4A 4ZN1A 5ETQA 1VRTA 1TUUA 3T19A 3LDSA 2HZCA 1N33J 2MLYA 1CG2A 2KJVA 2PMHA 3RBEA 2CYYA 5CYMB 4EWTA 4WJBA 1WC5A 3P1GA 3Q8RB 2NREA 2RQ4A 4EIAA 3CPWR 2XGQA 2GJIA 4CO4A 3VV2B 5HBMB 1PO6A 2MPUA 3ZZ0A 3FZMA 4G6VB 7FD1A 1NPPA 3U3YA 1AT1B 1C1BB 4OYOA 3MR6A 4QYRA 2E2QA 3VR1A 3IWNC 2J6TA 1BWVA 2UVWA 4DV2K 2GA7A 5FIIA 3ZTQA 4ENOA 2RS8A 4M5DA 2YKOA 4ES3A 2XMVA 3UDVA 4UOGA 3A3NB 4CLZA 4B3SJ 2ZJPL 1YHQS 2DPIA 1WF2A 3H2UB 1TL7A 3N28A 4OZNA 3EL2A 4JKEA 4JK9A 2KXHA 5GADP 1AZSB 4BRPA 5DZ6A 1WC3A 3KK2A 1YWXA 4AUKA 2Q97A 1Z1ZA 3QBXA 4WFBL 4OLPA 4CZMA 5AQIA 4OPJA 1Q1KA 2KLAA 2MGZB 4I6AA 1M1KT 3KD5E 3LZIA 4DV4K 4RBUA 4X66J 4IDKA 4GVLA 5GMDA 4FXDA 4GC7A 2E5GA 4O3SA 3RB4A 2DNYA 3PFOA 3SCJE 3V6DA 1Y4ZB 1X9WA 3AO1A 5LY3A 5LJ3Y 2Q0UA 4CTAB 4ECUA 3MMJA 3QJLA 1N52B 2CVIA 3R7NB 3LGMA 4RBVA 3CCSN 1ZAXA 5HROA 3HD1A 3OXFA 1Q8KA 3CCMS 2IVNA 4FJ5A 2LEBA 2OP5A 4DS4A 3M2VA 2H3GX 3P4UB 1H0HB 1BD6A 2QIFA 4CK3A 3S41A 3BR8A 3C66A 1SJ3P 1KONA 3QMLA 4NXNK 2QV6A 3M8PB 1E6VA 1ZBFA 1VQ9N 3DLLL 2KXFA 2QX0A 3PEJA 4Q45A 1F6TA 4ED4A 4ED8A 2DR6A 4E1MA 2O5DA 4FJ7A 1JX4A 2OH2A 1S3XA 3OYMA 4JI8K 2MY7A 3SAFA 4M5HA 1HKAA 2ZH5A 1FRJA 4TU9A 2D3ZA 3PEHA 4DV4F 2IA0A 4IFYB 2KO1A 4WTYA 4M3XA 3MEGB 2MSTA 5GAEI 3CULA 2ITMA 4F04B 1XEZA 1DLOB 4DG1A 4ZVQB 3NY0A 2K7JA 3TO8A 4YDXA 4DR6F 3CD6S 5D8HB 2K1RB 2WVDA 3UFCX 5KG7A 5IV4A 3J81U 3LDNA 2R2SA 2V34A 1A5VA 3MUVP 4DUYF 2P1JA 3BGLA 4JI5J 3VAHA 2A3ZA 2CG4A 1BQXA 2H1YA 3QT5A 4BDYA 5AQTA 2HQ3A 1NZAA 4EP4A 5SUHA 2OPPA 1WB9A 4K7QA 3OL6A 3QETA 4PWUA 3THWB 1S72N 2GIQA 3FJ2A 2CJQA 2J7WA 3B4DA 4RW9B 1SL2A 2UUCK 2P2CB 3QAEA 3QYYA 1RB0A 2CQ0A 1ZA1B 4JI8F 3OVBA 3AVHA 1XMQK 1LQ9A 3O6QA 4LH5A 3J7YU 5CE3A 3OHBA 2RE2A 3CDUA 1YIJS 2PFDA 2VPZB 2W2QP 4B3MJ 4EMDA 2FBVA 3V1RA 2CZ9A 3V4IB 3NCPA 3G71S 5KI6A 3LP0B 2V9WA 2O8EB 2Z1JA 1FTRA 3VPZA 3DLKB 3DJCA 2IMWP 5HK4A 2ZNYA 1ELOA 2YX6A 4UZBA 2DH9A 3DI6B 4CYUA 1S0MA 1YRUA 4TQSA 3PKYA 1TAUA 1Q82O 1NH7A 1YUWA 2C3YA 4FWMA 2DD8S 3O8WA 2LFVA 3G6VA 1TU0B 3KKFA 1IKWB 3BKTA 4DV7J 4KGXB 3CJCA 4WU2A 1B7YB 2R8IA 2P9UA 3HPHA 3MDQA 3VQ6A 3MMVA 3RW6A 2E7WA 2BRKA 4I6MB 4O3PA 1ATNA 4ZJQA 4DFMA 1NU0A 1S6QB 2FLPA 3THYA 2E2PA 3CYMA 2J6UA 1VSMA 5F9LA 3HKZD 4QR1A 3I8DA 4M7YA 4RUCA 1IKVA 4K5SA 1N36F 1FXLA 3FMWA 3VEOA 5F3TA 1JKHA 4ELVA 3CJKA 2HRYA 5KFFA 4X4QA 4LQ3A 3MM5A 3KDNA 2MHEA 3OW2R 3Q8YA 1XMOK 3PIPL 4A8QA 4HVZA 2Y0BB 1LWCB 4PL7A 3N4PA 3U7JA 3NMUA 1K73O 3R5BA 3CCEN 4USMA 4Z4CA 3J80Y 2D74B 3NCQA 4CF2A 3WNEA 1SVDA 5JVHL 5AQNA 1HNVA 2KVIA 3N01A 4CLUA 2CGLA 1RDRA 3ZEUB 1XUPO 3D66A 1CC8A 1TP7A 1W2BR 2BXJA 4ZJOA 5EN1A 3LANA 3R9PA 2QJ3A 1N32J 2O8CB 2EFPA 2RF2B 3I6PA 3MCOA 2W24A 4MH8A 1CLQA 4ZCLA 3EM1A 4DQIA 1K8AO 3SDEA 1S9GB 1RDWX 1L5UA 5FRMA 1WORA 2JX2A 3HZGA 1VMBA 3G25A 3V6HA 5DDQC 3R5DA 3ZZZA 2IRYA 5HL7Q 3G6EN 3UN2A 2QN6B 4FYWB 3VVUA 2R7SA 1FXRA 2J0WA 4CJ7A 1CJVB 2N3LA 2NXCA 4DV5J 4FVCA 1O0PA 2HPUA 5D4NA 3AVMA 4KGKA 4LQ9A 2ILZA 1XC9A 5ETOA 3MFHA 1CS4B 4ID8A 3OL7A 1TL3A 3D0GE 5H1SV 3M8WA 5GAHP 3TI0A 3KLVA 4A4JA 1U26A 3VQEA 5E3RA 3AT1B 3DRSA 4E8UA 4J9QA 4AXJA 4HDGA 3Q2SC 1VBZA 3ZZRA 4DV1K 2M5YA 3QGPA 4LF4K 3T41A 2CUYA 1P1LA 3H2VE 3K8WA 5B0GA 2W6LA 3KWGA 2QWRA 4ZLJA 2RIJA 4ILRA 1ICEB 3SV4A 3PYEA 3THPA 2P9IA 4KO0A 3AVGA 4X64K 3BKUA 1RBAA 2HRTA 3IR7B 4OYBA 2BKPA 3LPEA 4YOXA 3KG1A 3UR3C 3ZFVA 3GLJA 2CDQA 4USWA 1BL3A 2LQJA 2UYTA 2HZVA 1S1UA 2AW0A 3N0VA 2YKMB 3I5BA 1T05B 2ACYA 1BWFO 2Q79A 2IVPA 1PIEA 1HHSA 4OFZA 3V9XA 1Y3KA 2ZEJA 3MX2A 2FPHX 4QU6A 5E84A 2FSJA 4M95A 3BPSP 5KG4A 5H9FK 3DGPB 1UW9A 5HI7A 3AHPA 1QUVA 4OI3A 2NNWA 1NNEA 1U2CA 4F67A 1QJHA 5J2MB 5CAAA 3TSUA 2FBYA 3C15B 2QTWA 4OO1J 1NGGA 4OLAA 4J5OA 2V52B 4CJ3A 4O55A 3FVYA 3JSBA 4DX8H 1R0BG 5CY4A 3HFVA 4TSXA 4FJ9A 4LVNP 3QJJA 1V3SA 1Q0NA 2HHXA 3VETA 4PXCA 3S6EA 3I5AA 5IS2A 1IBLK 1IKYA 4NLBA 3W9HA 2V4RA 3EZWA 3KK7A 2Y1LB 4DCJB 4FOEA 3ZSZA 1U1QA 3JYTA 2QWMA 4FYVB 1IQTA 3NMRA 4F7VA 3ZT1A 2YX4A 2J0SD 4QPXA 5KQ8A 3Q0AA 1FFSB 1TMJA 4I69A 1KFSA 3O4WA 4MK9A 4QQBA 3D67A 2HFVA 3PKMA 3CMEN 4C2MA 3V9WA 1NPRA 5AT1B 1I94F 1RBOB 5DM6L 3CC7N 2MKKA 1R8BA 3HL8A 3WQUA 1J5EK 5L1JA 3D0HE 3MAAB 2FB0A 4UUXA 3W7BA 1L3UA 3Q7BA 3RVCA 3GCXP 3S1TA 3SPZA 4BC7A 2HBLA 4QIFA 3EVWA 2XHWA 3MPYA 4I9QA 4LFCK 4HACA 4LRDA 1RE1B 2B9XA 3TZYA 5G4DA 1WOPA 1N48A 2CQBA 3VF6A 1C4CA 2YY3A 5ETNA 4OJHA 2QLBB 4CZFA 2MKYA 1YVNA 2EXUA 3H0PA 2BMBA 3DLEA 2P9LA 3OYBA 3MEEB 1G7CB 4A8XA 4NCGA 3VEXA 5L9XA 1WKLA 3H2LA 1BO5O 3DU5A 2BYCA 4IOAL 1C0UA 1B0VA 3B8AX 1SKUB 1HBNB 1X9MA 2PE8A 1RT2A 3DC2A 2QWNA 4FZYA 3D5MA 1S9EA 4PWWA 3OFGA 3IKMA 3NGUA 1TFWA 2V8VA 4MK7A 4JAXA 3HHLA 4AT1B 1G3OA 1CZBA 4DLEA 4HKQA 4TY9A 2QA4S 4TY8A 1U24A 2ROPA 4DR2K 3J7AP 2D3UA 2IBOA 5FJ4A 3O9SA 1VQMS 4K50A 3DAWA 4FPAA 3TZXA 3SCIE 3TP2A 3IMXA 4U95A 2XS2A 3VTIA 3FQKA 4NLQA 5K8NA 2KZZA 1N5VA 5J1PA 4QIWD 4ICLA 1Q95G 4O5BA 4YHHK 4DPUA 4A48A 3M4XA 4ANDA 4IO8A 1FXDA 2KQ2A 3TANA 8ATCB 4FPIA 1J5OB 4CEEA 5KPRA 4JV0A 5JJBA 3BBCA 3UKUA 1FK9B 4XDDA 3KLFB 4Q5VA 1T3VA 5I42B 1FI4A 3CIMA 4WFYA 1A6LA 3ITHA 2FTRA 2UXDJ 3H8YA 4AH9A 3HX9A 3JAMU 1GOCA 3C16B 3SI6A 2PBDA 2I9SA 5B0EA 2FHJA 4Y0FA 2PI4A 2H51B 5M1QA 1QVFR 3P96A 2E1YA 2CPXA 4NYNA 4NEYA 1YXQA 1BGXT 3PR5B 4IOBA 1K9MO 5F1XA 2F8SA 2XLJA 4WE1A 1IKXA 2QLFB 2KB2A 3OYFA 1XTZA 1RHJB 2RDDA 2F7TA 2RN2A 2G8HA 1Z4UA 4RUBA 3PG9A 3AO5A 3LF0A 3CTRA 4P75A 5D0RA 1E6YA 5EOYA 4YHHF 3IP0A 4A8WA 2CVEA 3R9LA 1DAXA 4DV0F 1Q79A 2BE2A 1HBOA 3US5A 4B3OA 4K4XA 1QZ6A 2VB6A 3T6BA 3M32B 4DR3F 2PMZD 1NWKA 2X6NA 1C0TB 5FLXY 2HQCA 2YKNA 1FKOB 1WWHA 3WQPA 2NRXA 1QS4A 4HTIA 1U2FA 2Z1IA 4HDHA 4FLVA 5I3PA 1D4XA 3FSYA 2XEXA 4LBHA 4CBXA 3VGMA 4WXWA 5K9FA 4A61A 2P6SA 4DQPA 4KBOA 1H2UX 3OYAA 2K3KA 3FEZA 4AXIA 4CLKA 3M8QB 1O51A 1BE4A 1FHTA 1UFLA 3T9NA 2HHHK 1R8HA 4YFUA 4BRNA 3DMJA 1EKRA 3VQ4A 1HNXK 1U2VB 4CNYA 1RT3A 2VUGA 1RLDA 2V8PA 4ILJA 4IZ9A 4C98A 3DHXA 3EICA 3SUPA 1M5PC 2YWGA 1P6TA 1EQ0A 2NSBA 4WIQA 4M3TA 3UPFA 4YR3A 3HZEA 3MEDB 4HH1A 2HNDA 1RT5A 2QG9B 2W01A 1JL2A 1RWUA 2XHBA 3NMAA 3K5OA 4K8RA 3HHKA 4FBTA 4OHYA 3T1HJ 1E4FT 4GKJK 5CR4A 3SEOA 1YRTA 3H45C 4EZ6A 4EFAC 2NRZA 1TL7B 3HCXA 4HR2A 1UFKA 2ZUAA 4P6QA 4M8LA 1CULB 4KHPK 4CJVA 3KUHA 5K14A 5LL6Z 2GJFA 2FSNA 3ISNC 3MN7A 4J7CA 4ZHRA 4L75A 5E0OA 3GIKA 2QGFB 4FN5A 2HHHF 4ZP8A 3OTEA 4TU7A 3EVMA 2IM1A 4CLFA 3FUYA 3CC4S 1NSPA 3HOTA 3HVAA 3BF4A 2E5LK 3PSIA 3PVXA 4B1ZA 4D3HA 5KFIA 3KNGA 4KTWA 1RTIB 3LDQA 2C3MA 4XTTA 4OJ3A 3TZWA 2C3OA 3OR2B 2BJ9A 5LSLA 2H5JB 1RBUA 1LW0A 2HLTA 3W2VA 2BDPA 1R59O 3R6LB 5AZIA 5C12A 1P27B 2BM0A 1ZBSA 4DQRA 5I9EB 2H4YB 3OR1B 1DEJA 1UWBA 5HMZA 4E7HA 2AGQA 4Z4IA 3OQ2A 2ABYA 4BC3A 2OJ3A 4DL7A 2BM1A 5JLHA 1HMVB 4HCBA 2GQQA 1F3FA 3BSAA 2E20A 2ZDPA 3R2DJ 4GVBA 1EXQA 2YX7A 3KWMA 4OZ1A 1EARA 1REGX 4JK7A 4PXEA 4DB3A 4NRUA 3ZTOA 1YJNS 3AJ1A 1RHKB 4OLBA 2O8FA 4TNOA 5IT9Y 1YQHA 3E9PA 3AA9A 2E5LF 2BR0A 1GT8A 4BR9A 3OVNA 4CLTA 1HJOA 2J5AA 4DJBA 2Z8QA 4ED0A 1SL0A 5SWMA 5J2QB 1UOCA 1TAQA 2LEAA 4F26A 3CCJS 4IOCL 2ZBPA 1TL5A 2W8LA 2BGGA 5T14A 4HTUA 1CJUA 2ILYA 2BJ8A 3KUEA 4OX9K 2CQHA 4YOYA 2ZOFA 1ZBLA 2D9PA 4RU9A 4F25A 3DRPA 1SC4B 2NUUG 1RQ0A 4Q0BA 1S59A 3CDEA 1W26A 4NA1A 4IBNA 1SQEA 3BS9A 3GV7B 4FF4A 5DRKA 2X3DA 1RTDB 3KLEB 2PMWA 3MMAA 4FLUA 2FBXA 1RNHA 1VSJA 4JUZA 4C11A 1FVQA 3KD1E 2CPDA 4ZP6A 2QA4N 2BEFA 3KG4A 1YJRA 2G8FA 3TRGA 4WFZA 2VWBA 1OYDA 3H4DA 4NLPA 2VG7B 2UUAF 2PA3A 1VBXA 5BREA 4CGIA 2KHCA 1W7AA 1DBDA 4F2RA 4LRFA 2F4VJ 1FFWB 4H0YB 1FVSA 1IWGA 3WHIA 5AE3A 2W7OA 4AL7A 2DR7A 1CSJA 1RU2A 1X5SA 3RB0A 5K8MA 2ASOA 1KNZA 2MYFA 3TAGA 2EC0A 2ITGA 2DRDA 3DLHA 3SK3A 1HFEL 2IM3A 1VHXA 4BREA 2CQGA 1N6QB 4CK2A 3KHRA 1R8CA 4JRQA 4CHYA 3LM9A 4R0JA 1LEOA 1WHYA 5FDLA 2IJNA 2EFVA 4CD3A 3SFGA 4NRTA 4H0TB 2QLWA 1RDBA 1BOTO 3I8BA 1IBKJ 4K59A 3LOUA 3LUYA 4JK8A 4CF9A 3JQKA 2Q66A 4KT0C 4FXVA 2ZJQL 3M9MB 3OVAA 3C3LA 2OANA 1QUPA 1IBMK 1T11A 3HVTB 4C3MA 3FZLA 1FKAF 1NBEB 1CXUA 4LF6F 1OJ4A 3W5YA 4A8OA 4EBDA 1JKHB 4KKOB 1ZZNA 3MM5B 4O5FA 1WTBA 1FFGB 4OV6A 3OTCA 4FWKA 2MHNA 3QSIA 4UQGA 3GONA 8AT1B 3WBZA 2WBNA 1RTHA 2M4MA 4YQWA 2WB1D 4M63A 4CNZA 1BA1A 2IPOB 5A6WA 5KQDA 5CZVA 3AA4A 4CHPA 2R2RA 4C48A 5F0UA 2BUNA 4JBCA 2RU9A 5BRHA 3D0PA 3GIRA 4B3TF 3J81O 4KB1A 3M6VA 3FDSA 5IQQA 1RAOA 3H98A 3LQVA 3ZX0A 4GW6A 2FDNA 5LMUJ 2YHAA 2QL7B 5BXIA 5F0XA 3S01A 2VCPA 1GLFO 1GTEA 1RCHA 4WQ5A 3D54A 1E3MA 1TELA 3P45B 1PYSB 2ASJA 4C97A 4I7FA 4DDFA 5F8IA 2CQCA 2EK1A 3VEYA 3NWGA 4JI6J 1J9AA 4LD0A 4Q44A 1B0PA 2QA4G 1N33F 2FF6A 3DFEA 3BF1A 2WSFC 1YBTA 4BR4A 1SC3B 2GCFA 1FRKA 5IT0A 4NLYA 1JLAA 3FSIA 3VTHA 2QWQA 3T5HA 3QRRA 2C1EB 2B4PA 4C23A 3D2EB 2NCKL 1JLFA 2DXEA 4I2QB 2J4RA 1VSKA 2ZD1A 1IG9A 5A2QU 3UN5A 3FZKA 3OV7A 1QD1A 5SZTA 1YZ6A 1QSLA 3POTB 2GELA 2NRRA 2IDEA 1HWLA 2GHWA 2H5EA 3GTYX 1X9JA 4ECTA 4B17A 4H4MB 1PYOB 1VK3A 1C0MA 4B3SF 1S12A 4AF1A 2E9RX 2P9GA 3O9TA 4FPBA 3N5FA 2HBZB 2GS8A 1JLEA 4OLOA 4CLLA 1VQ8S 3F56A 4TQRA 4N7TA 2UXBJ 1ASUA 4LFAK 1RBSA 2BRLA 4DI6A 1OIAA 4ZVUB 4K4TA 4X66F 3FEYB 3GR1A 1BUPA 1GLDG 4M45A 1D3WA 2FVPA 3RAXA 1SS6A 3PYFA 5AQYA 4ZMMA 1C4AA 4NI2A 3PO4A 5A8WA 4E89A 4Z4FA 4CM2A 2F9DA 3AGRA 1F9EB 3MCAB 5ELZA 3UKRA 4WFNQ 4M3RA 4JI5K 3QGGA 4CZJA 1J2VA 1WG5A 3TA0A 1SC1B 3NS6A 2VPWB 2VWKA 2ZHOA 1EIYB 4IRKA 3NDKA 1OWXA 4RKUC 3LDPA 3CMAS 2GUIA 3A0IX 2JWLA 1B0TA 1Q7YT 4CLSA 3KXDA 5LSOA 2Z56B 2VG5B 3IO1A 1H73A 4X4VA 1LNQA 1GTHA 2EFGA 2M3DA 4RW4B 2HHTA 4FYDA 4ILMA 4Y65A 2CQ1A 2UUBJ 2NRHA 2O8DB 2OEJA 4UF4A 3QFUA 4EO8A 4ZLPA 3BREA 1JLBB 5C5JA 2NYIA 3UWTA 5HRSA 3TX8A 3FEXB 2ZH9A 1XN9A 4OI2A 1ZM2A 2HBQB 1VQKS 1WG4A 1KD1O 4JYAJ 2GTDA 4ED2A 4P74A 2VBWA 2GFFA 4F9OA 5E26A 5CA5A 2DNMA 4AYBD 3FMBA 3SQOP 4A62A 3W60A 4M41A 3MM7A 4HI2A 4L3KA 1YJWN 4IFVA 1H38A 2PO4A 4DL0C 2KG1A 2OTLN 4HACB 3IRXB 2NXEA 3K8VA 2DFFA 1WKKA 2X78A 5GMEA 4OJ1A 1FO1A 3IAYA 1FRXA 3PW2A 4XPEA 4ZP7A 4F3OA 1LW2B 3DRRA 3DLEB 3ET6A 5E2QA 1LAWA 3WC0A 4Q2LA 1ZPVA 1DARA 3WDOA 2AJ1A 4PQUA 4JHDB 4NCGB 4B3MF 3GG4A 5JS2A 3GFZA 1RAFB 4H0VB 3OSPA 1VSEA 2ZM6K 2ZDOA 2VA3A 2YHWA 5CD4A 3T3FA 3DOLA 3RUBL 3U1LA 4DR4J 1SIWB 3C6TB 3B6OA 2DHSA 1S9EB 4EGLA 2DNGA 4WBFA 1HNWJ 3MN9A 3CFRA 2EKYA 3WXKA 1CXQA 4FKYA 3CF5Q 3O1LA 2LDIA 2JLFA 4MLHA 3UR0A 3KLGA 4TY8B 3CERA 4AHVA 3WXIA 3BF3A 3GE9A 5BN8A 4F4YA 4CF8A 3N79A 5CYJA 3NBPA 3CD0A 3L2QA 4DV7F 1K1QA 3ENBA 3HDSA 2CA9A 1VAZA 4J9LA 3PUFA 2C28A 1BQMB 1TL4A 3DOMB 5KFNA 4WCEQ 3VENA 5CD4H 3V4MA 2CAJA 2JLGA 3P4IA 4DL4A 3OFHA 2HRUA 4CCHA 1VQ6N 1NM2A 1N32K 3UKUB 4HEA9 2RHSB 1K8KB 2QWPA 4PG4A 3BP8A 4K4UA 2V4QA 1DQAA 3RZAA 2A1SA 1UA1A 2PA8D 2GVDB 3O1WA 1OPIA 3EDRB 1N34K 4RW7B 4ECWA 1JL1A 2LU1A 3QWPA 5IC6B 3NXZA 3TQEA 2AJ2A 1ZBHA 3WT0A 3OYEA 2YNFB 1H98A 1HQUB 1LKZA 1A5WA 4KHQA 3G6YA 3HBTA 1IWAA 1X31C 4KC5A 5GAEP 4WE1B 2RH3A 1RT6A 3WZ0A 4RW6A 2RILA 3MR5A 1RKJA 1X4FA 2J0QD 4DR6J 4Z94A 4QPTA 5E3QA 2LXIA 3MPWA 3C8YA 4XIUA 3S7RA 4MQ3A 2V51B 3P31A 4HL9A 1LWFA 2DBBA 4FDFA 5CQGA 3DRYA 2QLXA 2ASDA 4RUAA 3IRWP 4EUVA 4R25A 2F8HA 2WW4A 2GWKA 2CFXA 4B3OB 3DN9A 5E33A 4ECQA 1PYTA 3JS9A 4IH7A 3M8ZA 2P9KB 4FJGA 4YB5A 1N32F 3NCIA 4CIFA 4FJXA 1RTZA 3OTOJ 4BRAA 2OFHX 3SYZA 3R97A 4KQZA 1XNQJ 4RW8B 1NEEA 2VU5A 1XR7A 4CHQA 5LJWA 4RWTA 4QWEA 2VDIA 4CO2A 4URGA 1EETA 4FJLA 4USJC 1OSCA 2X1AA 3CMQA 4K4SA 4BBYA 3DYAB 9ATCB 5KGWA 2M0GB 1N5TA 2R7WA 2VPYB 2R8GA 4DV5F 1GXTA 4ID5B 1XERA 4EI2A 3HTVA 1QQMA 3Q2TC 1Y64A 4OPHA 3W9JA 4FBUA 4IO9Q 1U1PA 1G4CA 4CO0A 3DMJB 1V5IB 5DDPC 3FCHA 3OYIA 1RT1A 4Y2AA 2V9KA 4IH6A 4O23A 4ZCIA 2OPRB 3LAMA 1FNXH 2BABA 3O4QA 1RI7A 1HW9A 4Z4EA 2LXFA 4M3ZA 4DR1J 4FSVA 3EUNA 3C0BA 2F7VA 2W4CA 1C2PA 1RT7B 2P51A 3VAFA 1LK5A 2AX1A 1VFJA 3RYLA 4KHYA 1X4DA 3GIMA 3Q22A 4FJ8A 3VOVA 3OBWA 5AQRA 2HQGA 3W3DA 3M2UB 1M1KO 3QEPA 2HVIA 2IHR1 5L38A 1LWEB 3CXCM 3A5MC 2QYGA 1VQLS 1W97L 1FJ7A 1BQNB 4PG6A 5E3PA 5AQGA 4RL1A 4OHWA 1X4CA 1KHVA 2GV9A 1UP1A 2GMLA 5F8NA 2ZUGA 1KBRA 1N36J 1S99A 3PR4A 2DCUB 2KXNB 2CRLA 4UOCA 1YLXA 4NYOA 4JI7J 3P83D 3ZC4A 4LRAA 5J1EA 3L2RA 3SNNA 2ZVSA 3LL3A 4CWBA 1D0EA 4X4SA 5KFZA 2ERRA 2J8SA 1QQOA 1M5OC 3I31A 2VPXB 2U1AA 1DZ5A 1BI4B 2ZGZA 3QB0A 4X65J 2AYEA 1LW0B 1ZPWX 3MF5A 4LSNB 4DR5K 4DPWA 1Q9XA 2Z57B 1VQOS 1RWKB 1G15A 2B9WA 1IJFB 3UO0A 3JSRA 3GP9A 4O0NA 1TKTA 2FXUA 4DV3J 1FDAA 4C8OA 4BGBA 3IUCA 4DUZK 4GMKA 2A6AA 1VLYA 3J7YI 1U1KA 4KPYA 3IWXA 2HAFA 3I4HX 2GIRA 5KFAA 1RABB 4KV8B 3HKWA 5M1FA 1FDNA 2W9AA 4KTQA 1TKZA 1PJ6A 3HVRA 4L3QA 4WXOA 4WK1A 3CJRA 3OYCA 1BLUA 5HL7L 2GNKA 1JMTA 1GH8A 2C22A 3KWIA 1FKPA 4WF9Q 2YPZA 2J9DE 4NXMJ 2I7NA 3D6FB 3KMQA 2F9JA 4ISFA 4CJPA 4DTNA 5AXMA 5CYMA 2DNLA 3TARA 3TPQA 1X5PA 2FC9A 1UAWA 2KT5A 4PY5A 3NGYA 3I5CA 3TOQA 5IXUA 2XY6A 2HF3A 5HBMA 4JV1A 4DTMA 2AEJA 2E7VA 4W5NA 3LP2A 4P2FA 3AB2B 3HLUA 2VOPA 7AT1B 1NB2A 4NWBA 3BQ2A 2FY1A 3NAEA 4OHZA 4Q0BB 3M3ZA 4IG0B 4D3GA 2HWIA 3KNAA 5A8KB 4DZ6A 2V8HA 1MMLA 3R6MA 1O6XA 3FR0A 5LXRA 4KHWA 2SXLA 3KG0A 5J2NB 4P2SA 2BJ1A 2VYPA 4LF5K 2MZ1A 1H6KX 2DNKA 1VRUB 3IM9A 2Y9HA 3ATUA 2PFFB 2HQDA 2E44A 3ZZOA 3UDLA 1WNSA 2DNOA 2AGPA 2ZOGA 2UXDK 2E1MC 1D09B 1HD0A 2MGZA 1VQ7S 2GUPA 1NLKL 1EB0A 4NEZA 3SSRA 2YQ0A 4N56A 3F0NA 3CDWA 1N0VC 1XHZA 3AOCA 1EQYA 3LW5C 3GDQA 5F0WA 1M5VC 4CTAA 2I38A 4MKBA 4J9VA 2QM1A 2LQ5A 4BS2A 2UUTA 4C1NK 1HR0J 2CH6A 2AQ4A 4RPFA 2EFOA 1YG0A 2BANB 1O5JA 1UW4A 3OBIA 2YKQA 4YNQA 3CCLS 4M3WA 4CK1A 3CCQN 3A12A 4QIEA 1JK9B 1VJWA 1BG3A 3TU5A 3RAMA 4G1QB 2QLJB 2UU9K 2CQ3A 4PPDA 4LF9J 2CADA 1DQ8A 2D0PA 3CCZA 5C2GA 1XK8A 2C2ZB 2UXDF 2XZDB 1PCAA 1ATSA 2G1DA 4LF8K 5IWAK 2F63A 2FBTA 2XY7A 4IFYA 3MEGA 4NLUA 2EX3A 3GYXB 2P9SB 2D3O1 4OYPA 1Q81T 1QHAA 1JQGA 4NO7A 3TAPA 5ADXA 3RMCA 2MB0B 2QL5B 5KRTA 3K59A 2O4IA 2Y8YA 2EFQA 2K1RA 2BW2A 1LAVA 1B7FA 2LCWA 5DGAA 4FF1A 2C42A 4KHSA 2LXUA 5AQHA 2RHQB 2MLXA 2W7AA 4FJMA 4JKGB 3PX6A 3Q23A 5D0HA 2CQDA 5B8HA 3THWA 4IG3B 4Q8EA 3WX4A 3G96A 1TYQB 4RW9A 2HFSA 1T02A 2IAJB 1VQ4S 2XM3A 4FK2A 3PO5A 3OHRA 1SV5B 1T9WA 3DOKA 3CJ0A 3O5BA 5ADXH 4LIRA 3VAIA 2NRTA 1HBUB 2FF3B 3NG8A 4ANEA 4W5TA 1KVJA 2B7CB 2HHSA 3V4IA 1SI9A 3LP0A 2G2YA 2KN4A 4B1XB 4GO7X 2O8EA 2DGVA 4ZPDA 1MU2A 4BR0A 4F0KA 1WACA 3DLKA 4GV3A 3TAQA 1JLAB 1NB7A 3W2WB 1VISA 2BACA 5E7OB 4CGFA 5ETTA 2MXYA 4M3YA 1RAEB 3DI6A 2V5HG 7FDRA 3DDIA 4LFBJ 4JKFA 3BQ0A 4E7KA 2ZOMA 2BTFA 4BG9A 1H74A 5F8GA 1HW8A 3R1LA 2HFUA 4DL3A 4B9SA 2G8UA 3DDKA 2EI5A 3BN7A 1IKWA 2FHMA 2NRVA 3GZ7A 2FHOB 4Z2XA 4YDUA 1ESVA 4B9UA 4PEOA 3T1HF 4OI6A 1VC6A 4I6MA 5A8RB 2A6MA 4GO5X 3NOGA 2ALZA 3H40A 3QICA 4FWRA 1S6QA 4LJMA 2W25A 3RG6A 4FWQA 1BA0A 5F3ZA 3FZHA 4U6PA 2VONA 1KOHA 4LBIA 4H4OB 2DITA 1AUDA 2C2RA 4G1IA 2WSEC 2D7SA 2Y1RI 3NNCA 2M88A 4KE5A 2NS1B 4L8RB 2VFVA 3MM9B 2WSCC 2BOAA 5AQKA 1JLCB 4URQU 3H90A 3FBBA 1GX6A 1LWCA 1D9DA 3CVKA 4YOVA 1S1TA 1IVZA 4WFAQ 2DO0A 2GGPB 4ZA1A 3OYGA 2XI2A 5F8HA 2F65A 4OZJA 3OJSA 1U7LA 4K0KK 1S22A 3CJ8A 1T9VA 2ZBIA 3EKSA 3QPIA 3ZEUA 2PYJA 4BR5A 1ZTTA 3IXQA 5MLCQ 4M94A 2HF4A 2MKJA 1OH5A 4ELUA 4W5QA 2O8CA 3CJ2A 3UW1A 2RF2A 1QAIA 1VK8A 3IBFB 2W8KA 2WCXA 4CZCA 3ENQA 1K47A 2JDJA 1T94A 1PAEX 4WTOB 4CJ4A 1S9GA 2GZOA 3G2XA 3HSZA 1UZHA 4L3NA 1KC8T 1SQKA 2WVEA 3EO3A 2E1AA 1NGCA 4IR9A 2HLUA 3ZETB 2YHXA 4AQYJ 4YOTA 4IR1A 2J7KA 4JKCA 3SBMA 4IKAA 1SCJB 3GIJA 2P9PA 3K5PA 2BE9B 4JI3J 1KOOA 2AZ1A 3CWJA 3D2WA 3GSDA 1L3VA 4IOCQ 2POKA 2DTUA 2BUPA 2D0BA 4CGGA 4PG5A 3V1OA 3KDOA 1CS4A 3MM7B 2FLLA 4HHUA 4IFVB 2K06A 3D9BA 2D0AA 4QOTA 1KCFA 3CQ8A 3GCWP 5LMNJ 4BACA 3ENHA 1REVB 3GOIA 4YY3J 1V3ZA 3B4MA 3MM8A 3U6FA 5A2QO 3DRRB 4MDAA 1YKWA 4OGEA 4JI0J 1V3RA 3W63A 1ZBTA 1XJWB 1HPZA 1OSDA 1IBKK 4K4YA 3HJFA 2CQPA 3T1YF 2HHUA 1HYSA 4H5VA 3QESA 1WUUA 1T0TV 3AH6A 4F36A 3DLGB 5KT5A 4KAZA 3MD1A 2YKMA 4Y28C 1T05A 3H20A 2F4VF 4X4PA 1S9FA 2XZWA 3SLCA 2F4FA 2FVQA 1T9TA 4X4UA 3CCLN 2MZJA 2QSWA 1HNIB 1TQLA 3CJAA 2Q1NA 1M1GA 4ERDA 2IBKA 3BB5A 5AFUA 1JLQB 3C15A 1ZA2B 2LMIA 2RRBA 1TKDA 1UL3A 3E2EA 2FJEB 4JB8B 2ASLA 3ZZPA 2KZMA 5THWA 2DH7A 4U7UD 2V2ZA 3G86A 1QQNA 1IBKF 4NLCA 2O8BB 2VQEJ 3M9NB 3U3GA 4ZPBA 3PJWA 4GV9A 3ZSYA 2BJ7A 2ZJQQ 3TWZA 4DR7J 1S57A 4LF2A 3CG7A 3SAHA 4JI4J 3WXMB 4CGJA 3V6KA 4NLSA 3AY9A 1SKRA 1U1RA 2KYZA 2DFHA 5M1NA 5DETA 1D9FA 1LOUA 4A47A 4ES1A 5HN0A 4RNOA 1YITN 2OZMA 4JI6K 2E88A 4RTFD 2LA6A 3Q83A 2AYBA 5AFUH 2XSJB 2IC3B 3H5UA 2AX0A 2DNPA 3L09A 4JV2A 3M6UA 1GLEG 4RLEA 3L0QA 1Q86T 4IXCA 3L7PA 2DR5A 3OJUA 3MAAA 2UVVA 3PFEA 4MT1A 2Q31A 1LWFB 3MECA 1U8SA 1WOSA 3KJQB 4RWWA 3D0IE 3O44A 3T6JA 3Q8SB 1VQ4N 4FF3A 2MZTA 3TR8A 5HMWA 2W9BB 2NQPA 4O4GB 5LMUF 1UTAA 3DKDA 2MLZA 3GU0A 2OZSA 1NKEA 1OPZA 2OCEA 1JNZB 2MKCA 4OKJA 5AQQA 2B9EA 1MDUB 4M63C 4KH4A 3QBCA 3L8BA 4PAAA 4TLQA 1BIZA 3AQPA 3L3VA 1IH7A 4NLDA 4H5NA 3GSIA 3MEEA 2KRRA 4MO4A 2QO3A 4BCAA 4JI6F 5AR0A 2W4PA 1ZC6A 5B0CA 3P3DA 4EEYA 1RWVB 5HVFA 1KXPA 4HUEA 3VESA 2DGOA 2J76E 3AVLA 3U27A 3BZKA 1HBNA 1NUEA 2O4GA 5B09A 1YJ9N 1U6ZA 1RK8A 1UFWA 3EYZA 5AE1A 2R9LA 4WQ5C 4JN4A 4H8KA 2R7XA 4C6AA 3HZ6A 1H72C 3WQTA 5KPZA 2HFOA 5D3GB 5EGYA 1CBKA 3R5GA 1YK9A 3NF7A 3D68A 1UCNA 4BE0A 3TSQA 4FJJA 3OS1A 3S3MA 4CFCA 4DOZA 2R8KA 3TTFA 6FD1A 3HT3A 4A8FA 1I5OB 3CSKA 4ZVSB 4N5SA 1VJQA 1K0VA 4BE1A 2CJXB 2OFGX 4WWSA 1Q78A 3KYLA 1RU1A 1TK8A 3BGFA 3DM2B 1NRKA 4ECVA 4OX7A 1NK8A 1RWPB 1J5OA 2Y0SD 2VFSA 4A57A 1T6CA 2QRRA 4C0OC 4O44A 1S1WB 1GLAG 5L39A 1FK9A 4QS7A 2UXBF 3BKFA 2HNYA 2HNZB 3KLFA 1EQMA 2CNOB 1U1OA 1S76D 2C2DA 5I42A 2OTJN 1UZDA 5KFYA 4GY2B 1PJ5A 3C16A 1S0NA 1KN6A 2HWHA 1RCOB 4DV2J 3F41A 5M1OA 3S9HA 5J1EB 3VQTA 2B6AA 4ED3A 1NHUA 2NXJA 3HRGA 5I4MA 5KG1A 4IRDA 2DFEA 4PABA 3TSPA 5KFTA 4BRLA 5K8PA 5DO2A 3JB9k 3B8HA 4JEPA 4JYAK 5BYQA 1RDCA 2R42A 2CJKA 3R3TA 4NASA 3OSNA 5IC4B 1X9SA 2P9CA 4Q2MA 4JS5A 3ETOA 2PYLA 4NLWA 3QAUA 3MOZA 4B3TJ 2XSFA 2DPNA 4X62J 3H5SA 2LVWA 1Y5NB 2O67A 4LF7J 3M32A 1RYRA 2DRAA 3M6GA 3CUNA 1FKOA 4CBUA 2UVUA 3I4PA 1N8RT 3JTOA 4J9KA 4HLBA 5IFMA 3T9ZA 1HIYA 1BDGA 5KFVA 2UUBF 1YX2A 3R6GB 2A42A 2AJQA 1FNOA 1RKIA 2A3JA 1YVUA 3CHWA 3NKYA 2W1BA 1Q5VA 1WSEA 3NRBA 1ITGA 5HJXA 4DR4K 3I56N 2M9KA 2RU3A 4I2PA 1FKPB 5KG3A 1VQNS 2CKWA 2WHOA 4CERA 4NXNJ 4JYAF 3MTJA 1QM9A 3M8QA 1BIUA 4FYYB 3ZT4A 1CJTB 3U1NA 1MWQA 2CIMA 2ATLA 4KB7A 1P9QC 2Q1LA 3QIDA 3P5JA 3LPYA 3OY9A 1U2VA 4L76A 3QIPB 2GHVC 3LP2B 2WW8A 2W41A 1HWKA 3FBEA 4JV5J 5KFRA 2B4JA 3IS9B 2MQOA 3TUZC 2HK3A 1B3TA 2GEMA 3MEDA 1BISA 3EGZA 1KVKA 4FOIA 2OHDA 1Y11A 5LL6d 1JCFA 1MNEA 4K42A 3I55S 1FD8A 2OSQA 4G65A 4WFXA 2GAGC 2AZ3A 1PC4A 3TABA 2WBMA 1VI7A 3HK2A 1ULRA 4JLHA 5L1LA 3KTQA 3MWTA 3G4SS 3EVOA 1A5XA 4DR4F 1CULA 2X1GA 3CC2N 1TV6B 2NZTA 1ZETA 3MCMA 1UVMA 2E4LA 3VQQA 5BR8J 1HNWF 2E2NA 1K44A 2HKEA 3NE6A 3SMPA 2NLXA 4GRSA 4FW1A 1S49A 3CPWM 3M1VB 4CJRA 3AA3A 3QDKA 3EMTA 2RAQA 4WQ4A 1S6UA 2MEWA 3R7BB 3JTPA 2OYQA 4QWBA 1QTNB 1S0OA 1XMQJ 2E66A 3NS7B 3T5KA 4RO0A 2MQ8A 1U25A 1JJHA 3HT0A 3M30A 4DR6K 3VGUA 5LM7E 2E8AA 1RTIA 4OJGA 4GKKJ 4WFNL 3AA5X 4DUYK 4K8ZA 3L95X 3N4WA 3OR2A 3CCUS 4CT9A 1V6HA 1Q9YA 3Q8VA 3OBYA 3A4TA 3LTOA 5KFCA 4A5AA 4F3QA 4X84A 4LT6A 3HSGA 3OR1A 4J9OA 3I0RA 4J9RA 3TWHA 2QWOA 1JLGB 1SJRA 2XHCA 3U9DA 3OTOK 5EWGA 2QEXN 1XNQK 5C2DA 3VF2A 1HMVA 4J2EA 1HD1A 1WC0A 4WYBA 3FRZA 3OYDA 3K0SA 4YS2A 4RCHA 3ID8A 3FFIB 4K2XA 3PW4A 1NKCA 5F8LA 4CJ5A 4ZVPB 1R89A 2D69A 4PCQA 3P39A 2DO4A 3UIQA 3LM2A 4ILLA 3F44A 2ZH4A 3ZYYX 4J9PA 1NSKL 4F4XA 1SIZA 4PKHA 2FC8A 3BUZB 3LDOA 1ZOTA 1OY8A 2YCHA 1SC6A 3QZ8A 5KT4A 4BG8A 3DXSX 3BN4A 1QQCA 5J2QA 3AVJA 1JXLA 4KGMA 4DL6A 4DTUA 4HUFA 4GVEA 4IWVA 3UN3A 4J91A 3HMJG 3T5JA 3VF4A 3V9UA 3CCVS 3AAQA 3VHQA 4XH1A 4YUDA 3CD5A 1ASWA 2CQIA 3E66A 2VQFJ 3FNNA 2ROEA 3AB4B 4LY7A 4DR1K 2F5GA 4EBCA 1XMOJ 1FE4A 2MQLA 3ZSXA 3OTOF 3MK6A 4FM1A 1IJJA 1XNQF 5M2RA 4K5RA 2YVSA 2DY9A 3Q86A 4LMZA 1FD2A 3BH7B 3LGHA 4CI0B 3DOKB 1BUXA 3LP3A 2HGMA 2HVEA 2YWKA 1RTDA 3KLEA 2HB5A 3NGDA 1SUQB 1H7XA 3HHEA 3S3NA 5KFHA 1NG9A 4A8MP 3FBCA 3O1BA 1UVLA 3L3CA 1MU2B 5D15A 5CCMA 2RPIA 2YBVA 2HGNA 1FDDA 1DGKN 2EW9A 4OHVA 3AOAA 3MUTP 5HO4A 2XG8A 2VG7A 1N36K 3AV9A 2DNZA 3O3FA 5C15A 3D28A 1NMDA 3CF5L 2HZAA 3DWLA 2JGUA 4JI7K 1TZ0A 5T7LA 4DV6J 3H3NO 2KT2A 1WF0A 2RHKA 1EKSA 1RYSA 4O3RA 4DR1F 4C1NI 3G82B 2RUSA 5ITHA 2IGIA 1SJQA 1NJZA 1WBDA 2KKZA 4X65K 3CEDA 1N6QA 3O3LA 2V69A 3QNNA 4WCEL 1HBMB 1H1VA 3UCGA 3NGTA 2HYIB 2F9TA 3EY1A 1G1XA 2L9NA 3D4JA 5B0BA 4DV3K 3Q24A 4CFDA 3WX8A 1CVJA 3V9ZA 3GWCA 3HVTA 2ZE2A 4CJQA 3SUOA 3HO1A 4KKOA 4FLWA 1WSRA 4TYBA 2BA9A 2N4DA 4JI7F 5KFPA 2CJBA 2YKPA 5KFEA 5KAKA 1AW0A 4LF4J 4FLTA 1HI0P 2XWXA 3HI9A 3FCVA 4FLZA 1S1TB 4X64J 3DXBA 2VBZA 1YJUA 1OS5A 1Q7YO 1EO1A 4X65F 2Q2RA 1MW7A 4R8UA 2QSFA 4ECSA 3KLIB 3RGIA 3THXA 2CPIA 2ZC4A 1Z05A 1X4HA 2P5VA 1KRPA 4B9NA 2HURA 3KJVB 2R8HA 1AYEA 3B82A 2VASA 2VG6B 4F0HA 4FJHA 1DTTB 4KH1B 4DV3F 1VLOA 3KVGA 3ZSVA 4DL2A 3PNIA 1BY9A 3ILOA 3IDHA 3HHLD 3OW2M 3VA0A 2AP6A 1VQNN 4ZP9A 1SBRA 4KYZA 2MKHA 1QTMA 5DS7A 4GVMA 2AJFE 1H7WA 4RNNA 2CPZA 3QIOA 1BCMA 2HS0A 1ROFA 3SBGA 2I5JB 2P9PB 5D78A 3BYRA 3O80A 5C25A 1FJGJ 4NXMF 3SQ4A 4Z4GA 3J7ZT 1NU4A 3E1YA 1QE1B 4GMJB 2IJFA 4OYAA 1IBLJ 3K58A 4IO9L 1OY6A 3CJSA 4PWDA 1HNZJ 2EEYA 2BVZA 2IM2A 3TTCA 5RUBA 2CGJA 3D2EA 3NLCA 4P2MA 1W2BM 4CW7B 4I2QA 2K2PA 1JIHA 1ZH5A 3G10A 1DTQB 4CE9A 3CCRS 2BQ3A 1DKGD 2ZBQA 4ES2A 2XLIA 3POTA 4XO0A 1YHQN 2ZWOA 4ISGA 2YQ3A 3MM8B 4CM0A 1X4EA 3G4SN 1X4AA 4H4MA 4CQ1A 4W92B 2NXNA 2NSCA 5KFUA 2MQNA 3CD7A 4OQJA 2FHJD 1J5EJ 1OH7A 1HPZB 3KIOA 3H1QA 3JXUA 3M8SA 2DT9A 3VQ5A 4F2SA 4P2XA 2ZHAA 1KS2A 2WVFA 4NX9A 3H5XA 1OQ3A 4ZTFA 1HYSB 3EXYA 4OMFG 4EZ9A 3LGNA 3F9MA 2HOEA 4DU7A 3E3XA 3FGVA 2IFXA 3KMSA 3BR9A 3E9LA 4LFCJ 2VKRA 1WEZA 4PG8A 1IR1A 3HHDA 2X1FA 4K25A 2YTCA 3RW7A 4CO1A 4E1NA 4DF4A 1EHWA 2IYGA 4ER8A 4CEZA 3CCMN 1NLVA 4NLVA 3IAS9 4CRJA 2ZWPA 1Q8LA 1P9YA 2C2OB 2V67A 2JEJA 2AHOB 1I94K 5KFQA 1HR0F 1F0XA 4M5MA 3DGVA 3Q8QB 4KGVB 5FPMA 4C8LA 3BBBA 2XB2D 3PJ9A 4USKA 3OHAA 1U02A 1YVFA 3L7OA 2HQIA 1UMJA 3DDNA 4Q43A 1I51B 1X5OA 4O0IA 1HHTP 2VKZG 2DGQA 3CDBA 4BR2A 3CGIA 4UY8T 1T7PA 4J90A 6FDRA 4MYTA 2GMJA 4LF9F 3KHLA 1AB8A 2OPQB 5ETRA 2JOQA 4LF1A 4BRMA 1ZXOA 4U9RA 3QRPA 1W0HA 2DNRA 3O3HA 4FS2A 1VS3A 2VG5A 4DR2J 2CZVC 4HT7A 4DU4A 3H08A 3OFEA 3LH2S 2EC2A 2PI5A 4RW4A 3CD6N 3M8RA 4J9UE 2FVSA 1VCTA 1HJRA 2O8DA 2CH5A 4CZHA 4KGZB 3J7YP 1XC3A 3IAM9 1JLBA 4JD2B 2RRAA 3NGZA 5HP1A 2UV8G 4WF9L 4L6V3 4KY3A 2YNIB 1NK7A 1CJKB 3RTVA 3PTWA 4B8CA 3EDQB 5DLFA 3MECB 2ZZNA 4X2BA 1KP6A 4USIA 2ATCB 1NK4A 3BSOA 3BGRB 1T3NA 1YTAA 4B9MA 3IRXA 1IM4A 3JTNA 3FC9A 2IY5B 1YIJN 3K9KA 1NJYA 3SUNA 3L7UA 4UOFA 1JB0C 1F2HA 3G71N 1LW2A 3D6RA 2H9ZA 1NJIO 4JKAA 3AD7C 3RMAA 1P90A 1N5YB 3N6NA 3NH1A 1B70B 4JHDA 3SBTA 4RNHA 1OY9A 1HKGA 3K57A 4OPAA 1FWPA 1TTHB 5GAGU 3C6TA 1UJ5A 1TKXB 1NCLA 1YGYA 2OMLA 2WVBA 1X60A 3J81j 3IFEA 1KQSR 4ECZA 3AOBA 2XRIA 4YB7A 4LFBF 3F73A 2E6LA 3QBWA 2VZ9A 4H5RA 3HSJA 2AF6A 3VZHA 2KTQA 2XYGB 1KTQA 5F9NA 1FEEA 4C7QA 3MPUB 2G4BA 2CPFA 2DB1A 3DU6A 4CVNE 4FJIA 3AO2A 1NK9A 1NDKA 4N76A 5EXWA 4ZITA 1L3KA 3G8SA 2DNNA 1BQMA 3PW7A 1WN7A 3DOMA 3VF0B 2BJEA 1RHRB 4QWAA 5EY4A 2EWSA 3IG1B 1RAIB 4A59A 4DV0K 2BZ2A 1KLMB 5KGXA 2NLWA 1HNXJ 4O44B 1Z2LA 4DR3K 4YOUA 2HNYB 4J9NA 4CJUA 1K8KA 2GAHC 4NYPA 2GVZA 4H4KC 1R43A 2HHVA 3A8JA 2GVDA 3QATA 4R0EA 1I6JA 4YDUC 3LP1B 4RW7A 4MKYA 1MWZA 5ETKA 3OS2A 4AQYK 2ZITA 1WOQA 2YNFA 4ETZA 3HFZB 2B6AB 5ETSA 3GJQB 2WFBA 3NH2A 1HQUA 2EG1A 4CJSA 2I6WA 4GKJJ 5GADU 3CCSS 1C1CB 3QLHB 4KHPJ 2E5IA 4UZCA 2XNQA 3NF6A 4FWSA 5CABA 2QC3A 4BY9C 3CIPA 4TLRA 4CHOA 3H3OB 2NUBA 1FX4A 3QSYB 4CH7A 1VQ9S 3JSMB 2CQ4A 1QVGR 2HAIA 3HOSA 2P9KA 1HQEA 1B64A 2C2KB 3NVMA 4YY3K 2KT3A 4F3TA 1FA0A 3CM5A 2GIFA 2FVCA 1M0SA 2XQCA 4RW8A 1LWXA 3K2YA 3BPDA 1U0HA 4W5RA 2KM8B 4B3RF 4FP9A 5M1PA 4CJEA 1QVFM 1MG7A 4AQYF 3V9SA 4RNMA 1TK0A 4DTPA 1SB6A 4C3LA 4K43A 2QKKA 2CQ2A 3DYAA 2ROGA 3AGKA 1XWLA 2RNEA 4JI3F 4I2PB 4OV1A 1IR0A 4LSLB 1VYAA 1JJ4A 4ID5A 3E9OA 3M9OB 4ZLLA 1ZYQA 1SJ1A 5EU7A 1S48A 3AVNA 2DK2A 5KFBA 4A5BA 1P1TA 4QIGA 1TVRB 2RKIB 2L9WA 3I33A 4PKIA 4FWPA 1TL1B 4YOWA 2CPEA 2XO6A 3PX0A 2NRWA 2KH9A 4FVMA 4QR0A 1QVGM 3HVWA 2OPRA 4O4RA 3IMQJ 5LMNF 1RXOB 2R7YA 2ZNZA 1S72S 1XI1A 1KR4A 1NH8A 4YY3F 1VK0A 1UWAA 2ZH7A 1IBCB 4E0DA 3AO3A 3CFOA 1JWWA 1RT7A 4JI0F 4QAGA 2YV0X 3QERA 1RWWB 2AWZA 2NXUA 3TUJC 3KK3B 4BR7A 3MMBB 3DXMA 3J81Y 3M2UA 1RWNB 1LWEA 2ACMA 2DJWA 4N8OA 3SUQA 3VGSA 2BX6A 5CZ2A 3W62A 5LJ5Y 4JI4K 1BQNA 4WYWA 2A2CA 4F8RA 2B51A 2A1RA 4OX9J 4IDHA 4HHJA 1SKSA 1Q7LB 3W8GA 1RHUB 5I3QA 1T9UA 4C0BA 3ONQA 3MWBA 1LCUA 3LDLA 4O3OA 4J9MA 4ZK7M 3KK1B 3IGVA 3PRBA 3VEWA 1GLCG 3M30B 3K5NA 2ZF5O 2PY5A 5DQIA 4WFAL 2GQCA 3QO9A 4BLGA 2HHPA 2V7YA 2V0NA 1BI4A 4XEIA 3RWUA 2DYAA 4JNEA 4B9TA 3O5TB 2YWHA 1SQFA 4LSNA 1XNRJ 1NM1A 1GMWA 3I0SA 3FQLA 4BVPA 3VALA 3D3BJ 2B3TB 2VQEF 3I0RB 2ETJA 1IXKA 4FO0A 5M1KA 1U2RA 4DR7F 2E1RA 1QDUB 1UEVA 4JI4F 3GJSB 3ETMA 1PJ7A 3OT9A 3JS6A 4OZ3A 2HVHA 2W2MP 3TVYA 3FGUA 3DLJA 4JI1J 3A8YA 3A3OB 4DCPB 4NMXA 4Z7CA 1KTVA 1MMDA 2G13A 4AFFA 1S10A 2AA4A 4KV8A 1VSIA 4PRFA 4BRIA 2ZZMA 3J8AA 4KPCA 2A18A 3VAJA 1HWIA 3LALA 2QFIA 4QZVB 3BO4A 1QAJA 2E7XA 1S4EA 2G8KA 3D3CJ 3CCES 1WDDA 2UUAK 2A1BA 3GV8B 2IRUA 1Y5IB 4IJNA 4WYLA 4BRDA 4CLPA 3AJ2A 1IBMJ 2YQ1A 4LREA 3SQGA 5E3CA 2HMIA 2YNHB 1KVAA 1BXNA 4F0MA 5HRRA 4HH0A 4X4TA 3MXHP 2LP4A 4BRCA 4DTSA 5B08A 4CEDA 5FPDA 4IYQA 4IG0A 3DHWC 3C7NB 2XO7A 1U47A 5A8KA 3RB3A 1NK0A 4F4AA 4WZQA 1KQKA 2F8MA 2AKWB 2F96A 3CM6A 4B1UB 4RU2A 5J2NA 2VF3A 2F3JA 3G6ES 3T1YJ 4O3NA 5TKWA 1VRUA 4OZ5A 5L46A 3R8YA 5T41A 3M7VA 2EG2A 2BJ3A 1R0AB 4LF6K 3GV5B 2Q43A 1VQMN 4TKTA 2A40A 3F9KA 1VBYA 4DHYA 4KFBB 2V8GA 1WJ9A 4JRPA 1RFQA 4USTA 4MFBB 4HHTA 4GC6A 3P8BB 5T7LB 4CEBA 4DSKA 1JCGA 1RWOB 3HSTB 2DNHA 1J54A 2DPJA 1WLJA 4WPAA 2HBJA 4BROA 2WB4A 2F40A 2Y3YA 5MLCV 4P7VA 2F8EX 3MXMA 2LA4A 1N54B 1DURA 2MKSA 1CC7A 4A8KA 1MWMA 4DU8A 2BANA 1PBAA 3OYNA 5KT6A 1XR6A 3PCOB 1YF5L 3MXJA 1Z2ZA 1TK5A 1X1PA 2M8HA 4B3TK 2ZH3A 2WTFA 1X0FA 3ZTRA 1Y7PA 4X62K 5GAHU 3WEEA 4LF7K 4G1QA 2XMAA 4KAIA 5AJ3J 2PIIA 5FLXU 2V4JB 3T69A 2Q6CA 3MOJB 4I6WA 4O3QA 5KT2A 4CGDA 3A8EA 1Q8IA 2ZE2B 2L48A 4NA2A 3MMCB 2GWJA 4QYZJ 3PXGa 1F1BB 4DV2F 1BHNA 2QA2A 2C2NA 4ED6A 1CEZA 2P9SA 2YWWA 3O9UA 3X3UA 4B1YB 3OD2A 5DM7L 3MWPA 3GG1A 4NZ7A 4PUOA 4K8XA 1N33K 3CB4A 4H0PA 2QMUB 5CHCB