2E2NA

Crystal structure of sulfolobus tokodaii hexokinase in the apo form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
298
structure length
298
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 109
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2nA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2nA01
4IZ9A 1E4GT 4FOIA 3RSEA 5AQJA 2W40A 2HF3A 1GLDG 2PBDA 5FPDA 3FZKA 3ULEB 2YI1A 3WXJA 4EHUA 2E2OA 3U8XA 2PAVA 3A0IX 2E20A 1ZC6A 2Q0UA 2P9LA 1X3NA 3CI5A 4CZHA 4RTFD 4O8KA 2P9SB 1NGJA 1SZ2A 2QWMA 3M6GA 4BRGA 4F9OA 3H6EA 4JAXA 3SMPA 3F9MA 3O1WA 1BDGA 2P9KB 2YJEA 4J8FA 1XQSC 2P9IB 4FL9A 1Q18A 2HF4A 2Q1NA 3CJ1A 1JCFA 3WQTA 1QQMA 2DPNA 2YHYA 1SAZA 2D1KA 5KPZA 3GE1A 1TYQB 3G25A 4CZIA 5BN8A 4JD2B 1BUPA 4KBOA 1QZ6A 1YVNA 4B1VA 3KHYA 2FXUA 1MDUB 1NGBA 2GWJA 2A40A 2FF3B 4GNIA 4JHDB 3LDNA 4H0VB 3CERA 4FWNA 4B9QA 2CH5A 3H1VX 4EHTA 2VCPA 2AA4A 3ULEA 5AFUH 3WQUA 5F1XA 4Y0WA 2D0PA 3CJ7A 3W3DA 4H0OA 1MA9B 4BRHA 4FO0A 4BC3A 2A5XA 3H3OB 4H5RA 4YDUA 4BG9A 4CZJA 2P9SA 3FLCO 4BC2A 4K43A 4FWKA 3H1QA 4A2AA 2P9KA 1Z05A 2P9IA 1D4XA 4CZFA 1V4TA 2ZGYA 4K41A 1GLFO 4DHYA 3BF1A 3WT0A 2ASPA 1GLEG 1TYQA 4BR9A 3O4WA 4FWLA 3HZ6A 4A61A 2KHOA 4JD2A 3SK3A 4RWTA 4O5FA 3J8AA 5KPRA 4ISFA 2D0OA 2Q36A 5BPNA 3GBTA 2E8AA 4JHDA 3FE1A 3AAPA 5AQIA 1C0GA 2ZF5O 4PKIA 4QS9A 5AQOA 1QQOA 4A62A 5AQRA 2VYPA 3QBWA 5EVZA 3GG4A 1LOTB 4CBXA 3SMSA 5ELZA 5AQWA 4PKGA 1C0FA 1NGDA 3S41A 3B8AX 5TKYA 3WXLA 4MO4A 3VEVA 4BRNA 3O08A 1HKBA 4QS7A 3U9ZA 3AY9A 2YHXA 3LDOA 4CJ7A 4K25A 5AR0A 2QWNA 1Y64A 5AQMA 4L3QA 1X9JA 2ZGZA 1NM1A 4LC9B 1GLCG 4B1WB 3C7NB 3UKUB 3HM8A 4BC4A 3JXUA 4B1YB 3A5MC 5AQHA 4CD3A 4BQLA 3FZLA 3HBTA 4FWRA 4BG8A 4XH5A 4EAHD 5AQGA 3BUZB 3H3NO 3VF4A 1QQNA 2CGKA 3I33A 3O1BA 3R8EA 3DXMB 4BRIA 2EWSA 2QWOA 3EN9A 5EOYA 3FZFA 3VGMA 2P9UB 1WOQA 5AQZA 1DEJA 4AM7A 2FSJA 3SJHA 3ZX2A 5AQPA 2CH6A 3QDKA 1MWKA 3U4LA 3ID8A 5AQFA 4FWOA 3CQYA 1S22A 2YHWA 1OKJA 3W0LA 1ZBSA 5E26A 3LM9A 4BREA 2YJFA 1U2VB 4H5WA 3VEZA 1DGKN 1NGEA 1JCEA 5E84A 5EX5A 4C23A 4FWMA 3C7NA 4BQZA 3UKUA 3AAQA 1R59O 5KPTA 4FSVA 2A6AA 4A2BA 3O5BA 4HTLA 2E1YA 3AARA 2YCHA 4BVOA 5BN9A 5BRDA 4I6MB 1KAZA 3DXMA 3HTVA 3VEYA 3ZX3A 1ATNA 5KQ8A 1NLVA 4XH4A 3VEOA 4EFHA 2GTDA 4AM6A 1KXPA 2P9UA 4CD1A 4JN4A 1H1VA 4YDUC 3HI0A 3TPQA 3R6MA 3CJ9A 1TUYA 5AZIB 3BP8A 3JS6A 4CBUA 4IO8A 4WQ4A 3VESA 3DAWA 5AQKA 1U2VA 4CI6A 4Z94A 3IDHA 2E2PA 2UYTA 1BA1A 2V7YA 5AQYA 1T6DA 3M3ZA 3UKRB 3IUCA 4H0PA 4BRQA 1BG3A 4H03B 3U9DA 4BR4A 1HUXA 3GDQA 2FF6A 1WUAA 3LDPA 2HOEA 3ZETB 3FZMA 2Q0RA 2GEMA 1ATSA 3VENA 2E1ZA 1ZXOA 4I6MA 4MLEA 1K8KB 4BROA 3DJCA 4IWVA 3ZEUB 1ATRA 4WQ5C 1NBWA 2NLXA 3O80A 4WQ5A 3CHWA 1BWFO 4BRPA 3LDQA 3KZBA 1X3MA 2A42A 2CGJA 4CZMA 5AZIA 1HKCA 4BRKA 2V51B 3CJBA 1KAXA 4IJAA 3OHRA 2GUPA 5FPNA 2E88A 5AZJB 3IMXA 2CGLA 3MDQA 2P9NB 3H45C 1JCGA 1QZ5A 2NRHA 5BR9A 2FSKA 1HJOA 3QFUA 4CZKA 1CZAN 3L6QA 1YAGA 3UKRA 2QWLA 3CJCA 1ESVA 3VOVA 5AQLA 1DKGD 2GELA 3D2EB 4GY2B 3ZETA 1NMDA 2J4RA 4PKHA 3LL3A 5FPMA 5AQUA 1NGAA 2QWPA 3A5OC 3CJAA 4CZLA 4BRMA 1E4FT 4NO7A 2HMPA 4HWIA 1K8KA 1XC3A 2E2NA 2ASOA 3MN7A 3EO3A 4FPAA 1BO5O 3ZEUA 1LCUA 2E2QA 2BTFA 3WXKA 1NGGA 2Q31A 5ADXA 5I9EB 4B1UB 3UE5A 4H0YB 2ASMA 3FFKB 2IIRA 2GWKA 2FSNA 2P9PB 3DXKB 4FWQA 4PL7A 5AZJA 3M1FA 2I7NA 3EKUA 4FPBA 2P9NA 4BR5A 3MN9A 4XEIA 5ADXH 3VERA 2F9WA 3D2FB 2QXLA 1NGHA 1NGIA 5B8HA 4BR0A 3CQXA 4H5NA 2I7PA 5EY4A 2D4WA 1GLAG 2WUSA 4RCHA 3VEWA 3D2EA 3QICA 3MN6A 2IVNA 5AQSA 3VF2A 2H3GX 4DB3A 3A5LC 4B1ZA 1HX1A 1RDWX 2VWBA 1T44A 3MMVA 3QMLA 1P8ZA 3ENOA 3QB0A 2IVPA 2QM1A 2BUPA 4IJNA 4BGBA 4MO5A 3QBXA 4H0XB 1YUWA 4BR7A 2FLOA 4BRLA 4BGAA 5LJWA 5CE3A 1BOTO 3VETA 5LJVA 2F9TA 4H0TB 5AQNA 3ZX0A 5KQDA 3CIPA 1HLUA 5AFUA 3EZWA 2P9PA 3DXKA 1KAYA 1NWKA 1GLLO 3EL2A 4WYBA 5F0XA 3FGUA 1NGCA 4WQ4C 4H5VA 4JNEA 5AQTA 3VF6A 1V4SA 3D2FA 5EXWA 3ATVA 2Q97A 2QW9A 3SLCA 3WUHA 2Q2RA 3QFPA 4FOEA 3O8MA 2QWRA 3CETA 3A5NC 3IFRA 3I8BA 3HSCA 5FPEA 1MWMA 4FWPA 2QWQA 5AQXA 1GLBG 3L4IA 3BEXA 3GOIA 5F2RA 4E1JA 1TUUA 1GLJO 4M63C 5BRHA 4QS8A 4H5TA 3GL1A 1BA0A 4ISEA 4ISGA 4M7YA 1IG8A 5BPMA 1S3XA 4B1XB 2NZTA 4M7XA 4BR2A 4BC5A 4EIAA 1G99A 4MLHA 4FWSA 3WEEB 5JICA 5JLFA 1HPMA 3LM2A 5BRFA 5BREA 4K42A 3LDLA 4XH1A 3RSEB 4PL8A 3MK6A 4NB4A 1BU6O 3FR0A 5AQQA 4CZGA 1Z6RA 4BRAA 2OANA 1QHAA 4BRDA 1U6ZA 2P9LB 4DQ8A 4BVPA 1EQYA 3BF3A 5LY3A 5BPLA 2AP1A 1RFQA 3UB5A 3D7EO 3VGKA 3MN5A 3FZHA 3L0QA 2IVOA 3ATUA 3VEXA 3ENHA 3H46O 1XUPO 3R9PA 2ZWHA 3VGLA 3WXIA 2ITMA 1HKGA 2A41A 3C0BA 2V7ZA 3O6WA 2W41A 5AQVA 2V52B 3A8YA 4CBWA 4BRFA 3KVGA 3VPZA 1T6CA 1YXQA 3P4IA 1NGFA 5JLHA 5JMVA 3MCPA 3WEEA 3EKSA 4IXCA 1RGIA 1SQKA 1IJJA 1J6ZA 3DWLA 4DCHA 4BRCA 2A3ZA 3TU5A 4CZEA
chains in the Genus database with same CATH superfamily
1NJZA 3KLIA 1EO1A 3J7YP 3NFAA 2E6LA 3RSEA 3LPUA 5AQJA 2W40A 4LF6K 5FPDA 1YTAA 4HVJA 2PAVA 3A0IX 4CJSA 3KWIA 4M3UA 3BGRA 1K73O 1KC8O 1X3NA 3CI5A 4CZHA 4DTRA 5C0YA 1SL0A 2JWLA 1VSFA 1WN7A 1ZBUA 4JKGA 4CGGA 3SMPA 2VQFK 2RHKA 4CF9A 1BDGA 2O8CA 2P9IB 1Q18A 2DFFA 3CJ1A 3AVJA 1JCFA 3WQTA 3AV9A 4CESA 4BY9C 2DPNA 2YHYA 1SAZA 4DS4A 3GE1A 1GOCA 3G25A 1IV0A 2WFBA 3RRGA 1U4BA 3G6EN 3CQ8A 2XY8A 4KBOA 4B1VA 4UQGA 1CLQA 1MDUB 1RCHA 2A40A 3VN5A 5J1EA 2FF3B 4JHDB 5LMUK 3VQBA 4EHTA 4FJLA 2HVIA 2AA4A 3V1OA 4DQIA 3MEGA 1A5XA 4H0OA 4BC3A 3H3OB 2UXDK 4H5RA 4YDUA 4BG9A 3TI0A 4FWKA 3ZCMA 1W0HA 3SCXA 1V4TA 1KVAA 5C24A 4MFBA 3CCVN 4FK4A 4CEDA 1N8RO 2D5RA 5BR8K 2WBNA 4FW1A 4BR9A 3O4WA 4FJIA 2VG5A 3HZ6A 3L4QA 4A61A 3O3GA 4RWTA 2EX3A 4O5FA 2HHVA 3WNHA 1YJ9N 3LP3A 3DM2A 4DTOA 1SL2A 1WBBA 4I2PA 4CIGA 1N6QA 1D8YA 5AQIA 4KAZA 4PKIA 4FYDA 4JI1K 4CJ3A 4QS9A 1QQOA 3GG4A 1LOTB 3IKMA 2G8WA 3CF5L 3K59A 1BCOA 4DUYK 4JKDA 3RR8A 4J2EA 3CFRA 2NRTA 1NGDA 3B8AX 3WXLA 4E7KA 4MO4A 4BRNA 1KTQA 1OH6A 4IOAL 3O08A 1IH7A 3U9ZA 1VQ7N 4FJXA 2ETJA 2B5JA 1SKRA 4JKAA 3PLAA 1S72N 4Z4EA 5H1SQ 5J2PA 1LWFA 1N34K 1KLNA 4CJFA 1X9JA 3PX4A 5HROA 3C94A 1Z26A 1GLCG 5FRNA 3UKUB 1IBMK 5HL7L 2UU9K 3EZ5A 4CEFA 3A5MC 2D0AA 4BQLA 1L3TA 4FWRA 4DV2K 3HO1A 4JKHA 4EAHD 3LDSA 3K58A 3VQAA 1QQNA 4BWJA 3O1BA 1TV6A 1NK6A 2QWOA 1YF5L 3NH2A 4OVLA 1WOQA 1DEJA 4KRFA 2X78A 5AQPA 2CH6A 3U4LA 2F96A 2NRVA 3OYNA 1OKJA 3OA9A 3W0LA 1CZBA 1W9HA 2YJFA 3QEWA 5M1KA 2ZQBA 1NGEA 5E84A 5EX5A 4R79A 3PIOL 2NUBA 3C7NA 3CYMA 2ZJRL 1R59O 3THYA 4A2BA 3O5BA 1QTMA 4AHTA 3AARA 2YCHA 5BRDA 1RBRA 4I6MB 3DXMA 1NKBA 4CJUA 5KQ8A 2VWJA 4GKJK 1NLVA 1DT9A 2IC3A 2P51A 4FJ5A 2PFUA 3NGYA 1H1VA 2ZJPL 3N4PA 3TPQA 4H8KA 3CJ9A 2GV9A 5AZIB 5JS1A 3F9KA 3JS6A 1S9EA 1KQSM 4IO8A 2O8DA 4WQ4A 3ZSYA 3THVA 1U2VA 2UYTA 3V9SA 2RF2A 1B9FA 1BA1A 2V7YA 4E7IA 5AQYA 3UKRB 4O4GA 4BR4A 1EWRA 3ASMA 3LDPA 4LF8K 4DF4A 1HQUA 1JKHA 4EZ6A 3ZETB 1S1WA 3OS0A 1RT7A 2Q0RA 2GEMA 4I7FA 3VENA 1ZXOA 2EHGA 4ELVA 3ID6A 4IDHA 3DJCA 4IWVA 3ZEUB 1ATRA 4OKEA 1OVQA 4WQ5C 5EU7A 3PIPL 1VQON 1BWFO 4F2SA 4BRPA 1NJYA 4A5AA 2A42A 1TK5A 4ILGB 1M1KO 4B3OA 3ZSQA 3FFIA 1OVYA 4B3MK 4B9LA 1SUQA 3G0ZA 3CJBA 4CEQA 2GUPA 4NXMK 1NJIO 5HRSA 3HPGA 2NRHA 3QFUA 2VG7A 2XRIA 3HPHA 4DQPA 2QWLA 2W42A 4W5RA 4IEIA 1ESVA 1LAVA 3D2EB 4NCGA 4GY2B 1WSFA 4PKHA 1RBUA 1KD1O 5FPMA 3CJAA 2HMPA 3KIOA 1K8KA 2E2NA 3V4IA 2PYJA 3EO3A 3CFOA 1LCUA 4KHWA 2BTFA 1NGGA 2Q31A 5I9EB 2HW3A 2X6SA 3QEVA 4H0YB 2YHBA 3HT3A 2DTUA 5I3UA 2G8IA 2HHXA 3DXKB 2KFZA 4DU3A 4Z0UA 4KV8A 4BR5A 4YOVA 2E6MA 1QSSA 1IKVA 1HYZA 2F9WA 3D2FB 2QXLA 2XY7A 1C1CA 3AVLA 3OYJA 4DFMA 3CQXA 3A2FA 4PA1A 1TVRA 5EY4A 2D4WA 3T1HK 3QINA 2YKNA 4RCHA 3VEWA 4FLYA 4FLVA 1R0AA 1O1WA 1HX1A 1RDWX 5C10A 2VWBA 3OYCA 3OBYA 1T44A 4JKFA 4IDKA 1P8ZA 1XI1A 3ENOA 2F8TA 2QM1A 2O8BB 1ZBHA 3AGRA 4H0XB 3SV4A 2OPQA 1YUWA 4RW7A 3OYDA 4BGAA 4IFYA 3EYZA 4CW7B 2XHBA 2HHSA 4DTXA 3R3LA 1J53A 4CEAA 4KFBA 5J2NA 1KAYA 2QXFA 1T8EA 3ISNC 4B3SK 1WLJA 3FGUA 3M8PA 3VF6A 1VHXA 2JWKA 3ATVA 4DWIA 1WSJA 2ZJQL 3WUHA 1JL1A 1XHZA 4CF0A 4FLXA 3KD1E 1X9SA 3CETA 3A5NC 3EEQA 4AQYK 4IFEA 3DMJA 3T1YK 4BE1A 3IRXA 3NMUA 1JLGA 1VRUA 3J80O 1GLBG 3V9ZA 5GADP 4M63C 4RW9A 1ITGA 4QS8A 5BRHA 4IEEA 2KW4A 3VQPA 1TKDA 2NZTA 3HYFA 4YY3K 4JI5K 4BR2A 4YOWA 4DQQA 3L3UA 4EIAA 4LFAK 1ZBFA 3C95A 1KCFA 1RT6A 5JICA 2O4GA 1J5EK 4XIUA 1ASVA 3NF8A 5GIOA 5BRFA 4K42A 2A1SA 4XH1A 4PL8A 3MK6A 4KHNA 4KKOA 3ZT2A 5AQQA 3TSPA 1BI4A 1O13A 2HHTA 1QHAA 1S9GA 4BRDA 2P9LB 1IKXA 3DI6A 4RW6A 5C2DA 5BPLA 2ITGA 3O4QA 4Z4HA 3MN5A 3ENHA 4O5BA 4WFNL 4ELTA 3S3OA 4DTMA 4CJLA 2ITMA 1HKGA 2UXBK 3J7ZO 4CECA 5AQVA 2V52B 1B92A 3LZIA 1REVA 4FCYA 1NG9A 5CZ2A 3P4IA 1JL2A 3AVCA 3HVRA 4DR7K 3D6RA 2RE2A 4WF9L 4DU1A 4HUEA 4CEBA 3MCPA 2Z1HA 3WEEA 3EKSA 1SQKA 3HXMA 4BRCA 3CM6A 4IZ9A 4GV3A 4CJ4A 4N5SA 1J5OA 4F3TA 5GAHP 3V9XA 2HF3A 3WXJA 1U04A 2E20A 1ZC6A 3DRSA 3LP1A 1RT4A 2Z1JA 4O8KA 3L2WA 2Z1IA 1NGJA 4BRGA 4F9OA 3EE8A 5GINA 4OPHA 3OJUA 4J8FA 1XQSC 2Q1NA 3SJJA 3T1AA 4JV5K 1QQMA 4I9QA 4OPJA 4HCCA 2D1KA 4FJHA 2JLEA 4F3OA 1TYQB 1E3MA 4GKKK 2HBLA 1L3SA 3CC4N 1BCMA 1BUPA 4CIFA 1T05A 4CJ5A 4ELUA 3QIPA 3OYLA 4ZTJA 3LDNA 4B8CA 1BHLA 2CH5A 3H1VX 3AVBA 4QAGA 3TAPA 3ULEA 5E41A 4Y0WA 3CJ7A 3R1XA 1ZYQA 4BRHA 1NNEA 2A5XA 3NH1A 4CZJA 2P9SA 3FLCO 3LANA 4K43A 4B9TA 2P9KA 1D4XA 4K41A 3V9WA 2NRWA 3DLKA 4FJKA 3SUOA 1HPZA 3VQEA 2ASPA 5JVHL 3CD6N 3HM9A 2FC0A 4LFBK 4FWLA 4DR3K 4DSKA 3D0PA 2KHOA 4JD2A 3SK3A 3J8AA 1VQLN 4ISFA 5M1NA 3SAHA 2D0CA 3OYGA 5BPNA 3GBTA 2WC9A 2E8AA 2WOMA 3DLLL 1S5JA 3V81A 3AVGA 3HPOA 3QEPA 3LAMA 2ZF5O 1A5VA 5C25A 2NRXA 1TKXA 2VYPA 4RG8A 4O55A 1QQCA 4LF5K 1L3UA 1KLMA 1D9FA 3SV3A 1XNRK 1I39A 1KFSA 4OKKA 5TKYA 3VEVA 4JI7K 5KI6A 4KH5A 2ZD1A 3PV8A 4EZ9A 4CJRA 3QO9A 3LDOA 5AR0A 5AQMA 5AJ3K 2ZGZA 3CMAN 2YNIA 5DM7L 2HBMA 4FJ8A 3NF9A 4B1WB 4WE1A 2G8UA 5CZ1A 4B1YB 2IDOA 1JLCA 1GOBA 3TANA 4DSIA 1SKSA 3OYHA 3SUQA 4B08A 3VF4A 4CHOA 4FLUA 4FJGA 4IG0A 4A5BA 3BZCA 4FZYA 3SNNA 3O9SA 2FSJA 2HBKA 3AA4A 3O9QA 3SJHA 4HUFA 2DY4A 1NJXA 1MWKA 3JAMO 3ID8A 3VA3A 1YJWN 4FWOA 1VSDA 3CCLN 3T7ZA 5E26A 3N4QA 4LF4K 4JRQA 3I56N 3U6FA 1P90A 4B9VA 4BQZA 2HNZA 2QA4N 3LAKA 3TTDA 4CK2A 4QOZB 3THWA 1U49A 1LW2A 3VEYA 4N41A 3B6PA 3ZX3A 4XH4A 2A1RA 3OVNA 1J9AA 2HHHK 4Y1CA 4AM6A 2E5LK 2P9UA 4G9ZA 3QEXA 3HI0A 4DFPA 4MDBA 4TSXA 2FBYA 3P1GA 3LPTA 4JI2K 5DM6L 4O44A 4CBUA 3ITHA 3VESA 5AQKA 4NLBA 3CCUN 3TSUA 2IGIA 2YHAA 1T6DA 3TAFA 1IBKK 1EETA 3AVFA 1W7AA 3GDQA 1WUAA 4FVUA 3VQ8A 1ATSA 2E1ZA 2RN2A 1S1TA 4MLEA 3S3MA 4OPAA 3OY9A 4FLTA 2O8FA 1D5AA 2GUIA 1LWCA 1QSLA 3F2KA 3LDQA 3I0RA 3KZBA 1Q7YO 3CPWM 3DLBA 4I2QA 1I3AA 5HBMA 2V51B 5JVGL 2R7YA 4IJAA 1M90O 1K9MO 3KTQA 3OHRA 5FPNA 3G4SN 2OZMA 2E88A 2P9NB 4W5TA 4JI0K 4CJKA 2FSKA 1HJOA 1FW6A 4B9UA 4KHYA 3L6QA 3ZT3A 4JK7A 1BQMA 4GW6A 1UA1A 3CJCA 3O9RA 2W6KA 1KVCA 4LSLA 4F4KA 1FKPA 3NVMA 4NCAA 2GELA 3RMAA 1S1XA 4X64K 5M1FA 1NK5A 5AQUA 3PX0A 3QERA 4DQSA 3PO4A 4CZLA 3D45A 1RBTA 4BE2A 3ZSWA 4HWIA 1XC3A 3TAQA 1VSHA 3O9UA 1BIUA 3WXKA 4M41A 1OH7A 4B1UB 1BGXT 3UE5A 2ASMA 4YOYA 3E66A 4LH4A 2FSNA 3RTVA 3ZSRA 2P9PB 4PL7A 5AZJA 3SUPA 3RR7A 1KFDA 2ATQA 1QVGM 4XEIA 1QE1A 3THXB 3VERA 3QNNA 1HNIA 2IAJA 2UUAK 3EE9A 5FDLA 3CCSN 1RDDA 2I7PA 3TARA 3VTHA 3G10A 2HNDA 3DLGA 1OH5A 1QVFM 1X9WA 3BY5A 2IVNA 2H3GX 2O8EB 2KQ2A 4FZXC 1J54A 1VK0A 4AH9A 4DLGA 4RW8A 2OTJN 3AO5A 2Q3SA 4MO5A 3QBXA 5C15A 1RDBA 1VQ4N 2FLOA 4BRLA 5LJWA 1TK8A 3VETA 5LJVA 2F9TA 5CHIA 3NDKA 3Q7BA 1QHTA 3HL8A 5AQNA 1Z25A 1HLUA 2P5GA 3WNEA 1BL3A 4NLCA 1UOCA 4RW4A 4JNEA 1KSPA 3KK1A 5CY4A 1V4SA 3I0SA 1IO2A 3VQ5A 5EXWA 4CEOA 2Q97A 2QW9A 3TTCA 1GOAA 1SKWA 3QFPA 2OPPA 3G71N 4Y1DA 4C1NK 2YX6A 3LALA 4FW2A 2QI2A 5FPEA 1MWMA 3OYBA 3AVHA 2QWQA 3L2UA 3OYKA 4KI6A 3BEXA 5CYQA 4EP4A 1TUUA 1GLJO 3KD5E 4ISEA 1IG9A 5BPMA 1JLAA 3VQ9A 2KZMA 4M7XA 3SBGA 4BC5A 4H4MA 3AO4A 1G99A 4FWSA 5KRTA 2XY5A 1KRPA 1LAWA 2WONA 4ICLA 1IKWA 5BREA 4W5QA 3LDLA 4IBNA 3AA2A 3RSEB 4CJQA 1Q9YA 1NJWA 2Y1JA 4M3RA 2OANA 4KO0A 4DQ8A 1EQYA 2BGGA 3NF7A 1VQ8N 4R5PA 4DV4K 2P5OA 4OLBA 4JKGB 3H46O 1XUPO 2O8CB 5HRRA 3WXIA 2A41A 4BRFA 3VPZA 1T6CA 5JLHA 1NGFA 1VAZA 5JMVA 4F2RA 1XNQK 1W2BM 4FK0A 1BIZA 2F4VK 3DOLA 1J6ZA 4DCHA 3TU5A 4YOUA 4CZEA 4DR2K 2Y1IA 2G8VA 4KHQA 1E4GT 4FOIA 2PZSA 3K5LA 1GLDG 2YI1A 5HRPA 3CMEN 4JK9A 1VQMN 3TAMA 5IT9O 4YORA 1ZBLA 2BANA 3SZ2A 4DTSA 5HP1A 4RTFD 2QWMA 3JSMA 3H6EA 4JAXA 3CCRN 4DU4A 3O1WA 3E1YA 1N36K 2HF4A 3F73A 3F5TA 3E9PA 3CCQN 4ILHA 2QKKA 4Z4CA 5KPZA 5MLCQ 3IS9A 4BACA 1U47A 4CZIA 1JLEA 4ZHRA 4PHTX 2QTDA 3KHYA 1IKYA 2HBJA 3SQ0A 1NGBA 4N47A 3SYZA 4FZZA 3K0SA 2NRRA 5AFUH 3WQUA 5F1XA 3HP6A 2D0PA 5D3GA 3W3DA 1G15A 5FLXO 1MA9B 4FO0A 4KH6A 5HOOA 3KK2A 4CEZA 3RMBA 4JK8A 3H1QA 2W6LA 4A2AA 4AHSA 3DLHA 4JKCA 2P9IA 2ZGYA 1GLFO 4CFAA 4NXNK 1JJ2M 4N76A 2OCEA 3V1RA 3BF1A 3QIOA 4YNQA 3WT0A 1GLEG 4JYAK 3SBTA 2G8FA 4PQUA 4Q0BA 1HMVA 1HNXK 5KPRA 4C8KA 2RPIA 2G8HA 2Q36A 5A2QO 4JHDA 3ZYYX 5CYMA 2B6AA 1JLBA 4CGFA 3MX2A 3MXMA 4DFJA 3AAPA 2B4JA 1N32K 4IKFA 3SUNA 4NYNA 3AA5X 1NK9A 5AQOA 4KREA 4A62A 5AQRA 1NK7A 5EVZA 4JS5A 4Z4GA 3CG7A 1N33K 3MECA 3SMSA 2HMIA 1X9MA 1FJGK 2FBXA 2O4IA 1YITN 5ELZA 2F7TA 5AQWA 3S41A 1NU0A 4FJ9A 4B9MA 3OBWA 2YNGA 4QS7A 1YIJN 3AY9A 4KTQA 4I9LA 4K25A 3TAGA 1Q81O 3NH0A 1HQEA 2I5JA 4FLZA 3C7NB 4BC4A 3HM8A 3JXUA 4CCHA 3THYB 1I94K 3SAFA 4DFKA 3FZLA 4X62K 3NVKA 3HBTA 3C65A 3QNOA 3BUZB 1EXQA 3H3NO 4CF8A 4PY5A 3I33A 3R8EA 2YV0X 3DXMB 4BRIA 3EN9A 3ZSVA 4OO1J 3P83D 2YKMA 3FZFA 3VGMA 3J81O 3NE6A 5J2QA 3VQ4A 3L2QA 4AM7A 4M42A 4GV9A 3OS2A 4CFBA 2ZE2A 3QEIA 1YVUA 1S22A 3HRGA 3ENBA 2YHWA 4CIEA 2UUBK 4K0KK 4C8OA 2O8DB 1JLFA 3LM9A 4BREA 3M8SA 1WBDA 4KB1A 4O0IA 1U2VB 1C1AA 1DGKN 1VQ5N 5K14A 1JCEA 4C23A 2VGMA 4FWMA 3UKUA 5HRNA 3DOKA 1UAXA 3AAQA 4FJ7A 5KPTA 3K9JA 4HTLA 4E7JA 2E1YA 4CJWA 4YOTA 5BN9A 2XY6A 1KAZA 2P1JA 1ATNA 3VEOA 4FJJA 4JN4A 1W97L 3E9OA 4YDUC 2D0BA 3PSFA 3R6MA 4BE0A 2GBZA 1TUYA 3NBPA 3ZSXA 4JS4A 2OPRA 3TABA 1VQ9N 1T7PA 3OW2M 3DAWA 1RT5A 2E4LA 4N56A 1YT3A 1RDUA 3SQ2A 3VA0A 3NCIA 1MU2A 1S6PA 1NOZA 1BG3A 4H03B 3U9DA 1HUXA 4OGEA 2FF6A 2HOEA 3AO2A 5FROA 4GMJB 4JI8K 1TAQA 4MQ3A 4I6MA 3MX5A 4DV7K 1C0MA 3K5OA 1K8KB 4BROA 3ZT4A 2QEXN 4DMNA 1YJNN 1NBWA 2NLXA 3O80A 4Q5VA 3CHWA 4CHYA 2VQEK 5SWMA 3C6AA 1X3MA 2CGJA 2VG6A 4CZMA 5AZIA 1HKCA 1WSHA 5T7BA 1TK0A 1T3VA 1KAXA 1HNZK 1QS4A 3MWTA 1RDCA 2CGLA 3I8DA 2VGNA 4DV1K 4CE9A 1D9DA 1QZ5A 4CZKA 4JEPA 1N5YA 4A57A 1ZBIA 3UKRA 4DV3K 1UWBA 4GVMA 3KLGA 2OYQA 4LFCK 3VOVA 2HVHA 4NYFA 3AVNA 3Q7CA 3ZETA 1NMDA 2J4RA 3OYEA 1EX4A 3A5OC 4IG3A 1RBSA 4BRMA 4NO7A 3MN7A 4KHSA 1EWQA 4FPAA 3ZEUA 2E2QA 1FKOA 3M5RA 1WSGA 5ADXA 1Y97A 3NGZA 4DTNA 4CFDA 4W5OA 3FFKB 3OYIA 2GWKA 4YFUA 4AILC 3V9UA 3OTOK 1VQ6N 1RTDA 4JI4K 2PYLA 5KGWA 4FM2A 4FXDA 3EKUA 4C8LA 3MN9A 4OKJA 5LMNK 3U3GA 3KKRA 4HTUA 3L3VA 1NGHA 4AHVA 2DFHA 3CCMN 1YTUA 4H5NA 3ZT0A 3V1QA 1SV5A 1Q82O 4IFVA 3D2EA 3QICA 3MN6A 5AQSA 1NKCA 3VF2A 4DB3A 3A5LC 2KFNA 3MMVA 3QMLA 3VQQA 1HR0K 2IVPA 2BUPA 4FJMA 2FBTA 3AVMA 3RMCA 1KVBA 4BR7A 4PWDA 4E89A 1BOTO 1HNWK 4OGCA 4DSJA 3ZX0A 1WSEA 3O4NA 3PSIA 3WXMB 3DXKA 4CF2A 1L5UA 1NWKA 1RTJA 4E1NA 4ILJA 1OH8A 3AVAA 3E9LA 3EL2A 4OPKA 4WQ4C 1NGCA 3DLRA 4BDYA 4J2DA 4H5VA 2KKZA 4KPYA 3D2FA 3AVIA 4DKWA 4ID5A 2OZSA 4IO9L 3SLCA 2Q2RA 3LP2A 5KTQA 4FOEA 5TKWA 1A5WA 3O8MA 3DLEA 2QWRA 4B8AB 4CERA 3RWUA 1BI4B 3SQ1A 3I8BA 4OX9K 4DTUA 2NRZA 1EKEA 3BZKA 3RRHA 2O8BA 2IS3A 4FWPA 5AQXA 4E7HA 3J7AP 1TKZA 1HRHA 4M45A 3L4IA 1C1BA 2JGUA 4B9NA 4FLWA 1B9DA 5C2FA 3AO3A 4UY8O 2BH1A 3GL1A 1BA0A 4M7YA 1HJRA 3P39A 1S3XA 4G1QA 4B1XB 1S1VA 4O8UA 4FJNA 4L8RB 3RMDA 3BDPA 3WEEB 2UXCK 4LH5A 3CCEN 3K2PA 1HPMA 3LM2A 4OJRA 3CC2N 3FR0A 1K6YA 3AO1A 3KLEA 3LWLA 3S9HA 3JYTA 4CJPA 3TAEA 1XWLA 4LF9K 4BVPA 1VQNN 2AP1A 3VGKA 1RFQA 1HNVA 4C1NI 4CHNA 3FZHA 4DSLA 3L0QA 2IVOA 3VEXA 4DSFA 4K8ZA 4JKBA 4BDPA 3R9PA 2ZWHA 3P38A 2V7ZA 3O6WA 2W41A 2IOCA 3A8YA 4B3RK 1RBVA 4CBWA 4DQRA 3WNGA 1YXQA 4LY7A 3K5NA 4FM1A 1JXEA 4JI3K 4B9SA 1VQPN 3VQDA 3EY1A 4JLHA 3MWPA 1F21A 5I42A 1XHXA 1K8AO 4IXCA 4DV5K 4M3TA 4V19S 4M3ZA 2A3ZA 2HHUA 2PBDA 2KTQA 3FZKA 3ULEB 4EHUA 2OPSA 2E2OA 3U8XA 4DSEA 5GAEP 4CHPA 2Q0UA 2P9LA 3K57A 2OTLN 4CHZA 3CPEA 3QETA 2P9SB 1SZ2A 3NF6A 2HHWA 3M6GA 3PY8A 2DFEA 3F9MA 2P9KB 2YJEA 4GVEA 1SL1A 1TGOA 4FL9A 1LW0A 4BDZA 4DR1K 4E19A 4FK2A 3ZLJA 4X66K 1WNSA 4CJVA 4WFBL 4ZTFA 5BN8A 1RT3A 4JD2B 1QZ6A 1YVNA 4LD0A 3MXIA 3ZT1A 2FXUA 2GWJA 3OYMA 3KKSA 3O9TA 4GNIA 3ZSOA 4H0VB 4PUOA 3CERA 4FWNA 4B9QA 4E0DA 2VCPA 3HK2A 4W5NA 4DS5A 4JKEA 3VQ6A 3TWHA 2YNFA 4DV6K 4HUGA 2HSTA 4KH4A 4BC2A 5M1PA 1Z05A 4J2BA 4CZFA 3WNFA 4DHYA 3M8RA 3KJVA 1TYQA 3MCAB 1NK0A 1DLOA 2ZM6K 2QKBA 1FXXA 1JXBA 1DTQA 4CEEA 3MAQA 3S3NA 1U45A 3CM5A 1SS6A 2D0OA 1C0UA 3DRRA 4IOCL 1RT1A 3FE1A 2YNHA 4JI6K 2HNYA 1C0GA 3AA3A 3L2VA 4DUZK 4FVMA 5CR4A 3T3FA 5GAGP 3QBWA 4CBXA 3B6OA 1TL3A 1LWEA 4PKGA 1C0FA 2AJQA 1RDAA 2Z1GA 4ID1A 1VSEA 1HKBA 2YHXA 4E1MA 3SPYA 4WFAL 4CJ7A 2QWNA 1Y64A 4L3QA 4CGJA 3T69A 1NOYA 1NM1A 4LC9B 4AHCA 2GX9A 4CVNE 3HVTA 1HYSA 5AQHA 4CD3A 1RTHA 1C0TA 3HOSA 3CCJN 2RKIA 4BG8A 1UA0A 4XH5A 5C12A 4CK3A 1VSJA 5AQGA 4DR6K 5JS2A 1C6VA 3THWB 4Z4FA 2CGKA 2EWSA 1NK8A 3AGKA 2HB5A 5EOYA 2P9UB 3O3FA 5AQZA 2VWKA 3KLHA 4J2AA 2LSNA 3ZX2A 5M1OA 3QESA 3QDKA 4KTZA 5AQFA 4CK1A 2BDPA 3CQYA 5J2MA 4OLAA 5HLFA 5M1QA 5KGXA 1RTIA 3T19A 1ZBSA 1S1UA 1T03A 1RNHA 5SZTA 3CXCM 1VRTA 4H5WA 3H08A 3VEZA 4DV0K 1L3VA 2QK9A 3NHGA 3KK3A 4H4OA 1BQNA 3VMFB 5IWAK 1RT2A 4M3WA 4FSVA 2A6AA 4DR5K 3DYAA 4BVOA 3IAYA 3L2RA 4K8XA 1XMOK 3HTVA 1ASUA 2FBVA 4EFHA 2GTDA 2G8KA 1KXPA 2O8FB 4CD1A 3LP0A 1WSIA 4CHQA 2WTUA 3P5JA 3ZSZA 3BP8A 4GV6A 3PUFA 3CFPA 4HCBA 3VQCA 1TAUA 2X6NA 1TKTA 3M8QA 4DF8A 4CJEA 3MEDA 4CI6A 4Z94A 3IDHA 2E2PA 3V6DA 3VTIA 3M3ZA 3IUCA 4H0PA 1X1PA 4BRQA 1TL1A 4DG1A 3FZMA 4DTJA 5GIPA 3HSTB 4O0JA 3PO5A 3AVKA 1WAJA 3P31A 4WQ5A 3UIQA 2NNWA 5KRSA 4U7BA 4BRKA 4KHUA 3U3YA 2BE2A 5AZJB 3HJFA 3IMXA 2OA8A 3MDQA 3H45C 3VQ7A 1JCGA 4HHTA 1LV5A 5BR9A 3ULDA 1CZAN 3MXJA 1YAGA 2KZZA 3QLHA 1NKEA 5AQLA 4FM0A 1DKGD 4E3SA 3LL3A 4EP5A 1NGAA 2QWPA 3OS1A 1E4FT 2ASOA 3HP9A 4MDAA 1BO5O 4QCLA 3LZJA 2XO7A 3PX6A 4M3XA 3SI6A 4NCBA 2IIRA 1ASWA 1CZ9A 4YOXA 4FWQA 3M1FA 3TTFA 2I7NA 4FPBA 2P9NA 5LL6Z 3MEEA 4DLEA 5ADXH 1NGIA 5B8HA 4BR0A 4Z4IA 4JRPA 1QSYA 3OYAA 1JLQA 3RVCA 3O3HA 1GLAG 2WUSA 4CGIA 4KB0A 3K9KA 1YHQN 3KLFA 3ALYA 4B1ZA 2F8SA 3L8BA 3C6TA 3QB0A 4IJNA 4BGBA 4AF1A 3K5MA 1WAFA 5DK5A 1IBLK 3IG1A 5CE3A 4C8MA 4H0TB 4CJTA 5KQDA 3CIPA 2KLAA 3LWMA 2HHQA 5AFUA 3EZWA 1S6QA 4LF7K 2P9PA 1GLLO 4WYBA 5F0XA 4E7LA 1RILA 1XC9A 5AQTA 1VSKA 3THXA 1WB9A 1U48A 4C8NA 4AHUA 3SAGA 2O8EA 1DTTA 1CXUA 3IFRA 4A59A 4YHHK 1YI2N 3TSQA 3HSCA 4DR4K 3C6UA 2X74A 1BISA 3GOIA 5F2RA 3OJSA 4E1JA 3I55N 3SQ4A 3SPZA 2PY5A 3CC7N 3NAEA 1CXQA 1VSMA 4AHRA 3DRPA 4H5TA 4ISGA 1IG8A 1Q86O 4MLHA 4WCEL 5DMRA 3E01A 5JLFA 4KHPK 3KWGA 1EP4A 3HOTA 4M3YA 4CFCA 3C6HA 1NMNA 4NB4A 1BU6O 1ILYA 1Q9XA 1VSIA 4CZGA 1Z6RA 4BRAA 1VSLA 1XMQK 4U67L 1Q8IA 1HYVA 1U6ZA 3BF3A 5LY3A 3UB5A 4LSNA 3D7EO 3NGIA 3KK7A 3OYFA 4BWMA 3ATUA 4B3TK 4CGHA 3VGLA 4DTPA 2UUCK 1VQKN 3C0BA 4IOXA 4F8RA 4CGDA 5C42A 3KVGA 1NK4A 4CF1A 4KTWA 4X65K 3TR8A 5FRMA 1FK9A 1RGIA 4KI4A 1IJJA 3DWLA
chains in the Genus database with same CATH topology
4IZ9A 4GV3A 1EO1A 1E4GT 4FOIA 3RSEA 5AQJA 2W40A 5GAHP 2HF3A 1GLDG 2PBDA 5FPDA 3FZKA 3ULEB 2YI1A 3WXJA 4EHUA 3CMEN 2E2OA 3U8XA 4JK9A 2PAVA 3A0IX 1VQMN 4YORA 5GAEP 2E20A 1ZC6A 3KWIA 2Q0UA 2P9LA 1KC8O 1K73O 1X3NA 3CI5A 4CZHA 2OTLN 5C0YA 3CPEA 2JWLA 4RTFD 4O8KA 2P9SB 1NGJA 1SZ2A 2QWMA 3M6GA 4BRGA 4F9OA 3EE8A 3H6EA 4JKGA 4JAXA 3SMPA 2RHKA 5GINA 3CCRN 3F9MA 4OPHA 3O1WA 1BDGA 2P9KB 2YJEA 4GVEA 1XQSC 3E1YA 2P9IB 4J8FA 4FL9A 1Q18A 2HF4A 2Q1NA 3CJ1A 3F5TA 3E9PA 1JCFA 3WQTA 1QQMA 4BY9C 2DPNA 2YHYA 1SAZA 3CCQN 4ILHA 2D1KA 5KPZA 3GE1A 5MLCQ 1TYQB 3G25A 4CZIA 4WFBL 2HBLA 5BN8A 4JD2B 2WFBA 3CC4N 3G6EN 1BUPA 4KBOA 4PHTX 2QTDA 1QZ6A 1YVNA 4B1VA 3KHYA 2HBJA 2FXUA 1MDUB 1NGBA 2GWJA 2A40A 2FF3B 3O9TA 4GNIA 4JHDB 3LDNA 4H0VB 3CERA 4FWNA 4B9QA 2CH5A 3H1VX 4EHTA 2VCPA 2AA4A 2NRRA 3ULEA 5AFUH 4JKEA 3WQUA 5F1XA 4Y0WA 2D0PA 3CJ7A 3W3DA 3R1XA 4H0OA 1MA9B 4BRHA 4FO0A 4BC3A 2A5XA 4KH6A 3H3OB 4H5RA 4YDUA 4BG9A 5HOOA 4CZJA 2P9SA 2HSTA 4KH4A 3FLCO 4BC2A 4K43A 4FWKA 3H1QA 4JK8A 4A2AA 5M1PA 2P9KA 1Z05A 4JKCA 2P9IA 1D4XA 4CZFA 1V4TA 2ZGYA 4K41A 1GLFO 2NRWA 3CCVN 4DHYA 1N8RO 1JJ2M 2WBNA 3BF1A 3WT0A 2ASPA 1GLEG 1TYQA 3MCAB 3SBTA 4BR9A 5JVHL 3CD6N 3O4WA 4FWLA 3TU5A 3HZ6A 4A61A 3L4QA 2KHOA 4JD2A 3SK3A 4RWTA 4O5FA 3J8AA 5KPRA 1VQLN 4ISFA 1YJ9N 1SS6A 2D0OA 5M1NA 3SAHA 2Q36A 5BPNA 3GBTA 2WC9A 2E8AA 4JHDA 3ZYYX 3DLLL 4IOCL 3FE1A 3MX2A 3AAPA 5AQIA 1C0GA 2ZF5O 4PKIA 4QS9A 5AQOA 5CR4A 1QQOA 2NRXA 4A62A 5AQRA 5GAGP 2VYPA 3QBWA 5EVZA 3GG4A 1LOTB 3IKMA 3CF5L 4CBXA 4JKDA 3SMSA 1YITN 5ELZA 2F7TA 5AQWA 4PKGA 1C0FA 1NGDA 2NRTA 3B8AX 5TKYA 3S41A 3WXLA 4MO4A 3VEVA 3OBWA 4BRNA 4IOAL 4KH5A 3O08A 1HKBA 4QS7A 3U9ZA 1VQ7N 1YIJN 3AY9A 4JKAA 2YHXA 3PLAA 1S72N 4WFAL 5H1SQ 3LDOA 4CJ7A 4K25A 5AR0A 2QWNA 1Y64A 5AQMA 4L3QA 1Q81O 1X9JA 3T69A 2ZGZA 1NM1A 3CMAN 4LC9B 5DM7L 2HBMA 2GX9A 1GLCG 4B1WB 3C7NB 3UKUB 3HM8A 4BC4A 5HL7L 3JXUA 4B1YB 3A5MC 5AQHA 4CD3A 4BQLA 3SAFA 3FZLA 3NVKA 3HOSA 3HBTA 3C65A 4FWRA 3CCJN 4BG8A 4JKHA 4XH5A 4EAHD 5C12A 5AQGA 3BUZB 3H3NO 3VF4A 1QQNA 2CGKA 3I33A 3O1BA 3R8EA 3DXMB 4BRIA 2EWSA 3AGKA 2QWOA 3EN9A 4OO1J 5EOYA 1YF5L 4A5BA 3FZFA 3VGMA 2P9UB 1WOQA 5AQZA 1DEJA 3O9SA 4AM7A 2FSJA 2HBKA 3SJHA 3O9QA 3ZX2A 4GV9A 5M1OA 5AQPA 2CH6A 3QDKA 1MWKA 3U4LA 3ID8A 5AQFA 1YJWN 4FWOA 2NRVA 3CQYA 1S22A 3HRGA 3ENBA 5M1QA 2YHWA 1OKJA 3OA9A 3W0LA 3CCLN 1ZBSA 5E26A 3LM9A 3N4QA 2YJFA 3T7ZA 4BREA 3I56N 3CXCM 1U2VB 4H5WA 3VEZA 5M1KA 1DGKN 1P90A 1VQ5N 1NGEA 1JCEA 5E84A 2VGMA 5EX5A 4FWMA 4C23A 4R79A 3PIOL 3C7NA 4BQZA 3UKUA 3VMFB 2QA4N 2ZJRL 3AAQA 1R59O 5KPTA 3TTDA 4FSVA 2A6AA 4A2BA 3K9JA 3O5BA 4HTLA 2E1YA 3AARA 2YCHA 4BVOA 4YOTA 5BN9A 5BRDA 4I6MB 1KAZA 3DXMA 3HTVA 3VEYA 3ZX3A 1ATNA 5KQ8A 1NLVA 4XH4A 1DT9A 3VEOA 4EFHA 2GTDA 4AM6A 1KXPA 2P9UA 2PFUA 4CD1A 4JN4A 1W97L 3E9OA 1H1VA 4YDUC 4G9ZA 2ZJPL 3HI0A 3N4PA 3R6MA 3TPQA 4MDBA 3CJ9A 1TUYA 5AZIB 3BP8A 3JS6A 5DM6L 4GV6A 1VQ9N 4CBUA 1KQSM 3OW2M 4IO8A 4WQ4A 3VESA 3DAWA 5AQKA 4NLBA 1U2VA 3CCUN 4CI6A 4Z94A 3IDHA 2E2PA 2UYTA 3TSUA 1BA1A 2V7YA 5AQYA 3VTIA 1T6DA 1RDUA 3M3ZA 3UKRB 3IUCA 4H0PA 4BRQA 1BG3A 4H03B 3U9DA 4BR4A 1HUXA 3GDQA 2FF6A 1WUAA 3LDPA 2HOEA 3ZETB 3FZMA 2Q0RA 2GEMA 4FVUA 1ATSA 3VENA 2E1ZA 1ZXOA 5GIPA 4I6MA 3MX5A 4MLEA 1K8KB 3ID6A 4IDHA 4BROA 3DJCA 4IWVA 2QEXN 4OPAA 3ZEUB 1ATRA 1YJNN 4WQ5C 1NBWA 2NLXA 3O80A 3P31A 3PIPL 4WQ5A 3CHWA 1VQON 1BWFO 2NNWA 3F2KA 3LDQA 4BRPA 3C6AA 1X3MA 2A42A 2CGJA 3KZBA 4A5AA 4CZMA 1Q7YO 5AZIA 1HKCA 4ILGB 1M1KO 3CPWM 4U7BA 1OVYA 1T3VA 2V51B 4BRKA 5JVGL 3CJBA 1KAXA 4IJAA 1M90O 1K9MO 3OHRA 2GUPA 5FPNA 3G4SN 2E88A 3MWTA 5AZJB 3IMXA 1NJIO 2CGLA 3MDQA 2P9NB 2VGNA 3H45C 1JCGA 1QZ5A 2NRHA 5BR9A 2FSKA 1HJOA 3QFUA 4JEPA 1CZAN 3L6QA 4A57A 4CZKA 4JK7A 1YAGA 3UKRA 2QWLA 3CJCA 3O9RA 4IEIA 1ESVA 3VOVA 5AQLA 1DKGD 3NVMA 2GELA 3D2EB 3Q7CA 4GY2B 3ZETA 1NMDA 2J4RA 4PKHA 3LL3A 5M1FA 1KD1O 5FPMA 5AQUA 1NGAA 2QWPA 3A5OC 3CJAA 4CZLA 4BRMA 1E4FT 4NO7A 2HMPA 4HWIA 1K8KA 1XC3A 2E2NA 2ASOA 3MN7A 3EO3A 4FPAA 1BO5O 4MDAA 3ZEUA 3O9UA 1LCUA 2E2QA 2BTFA 3WXKA 1NGGA 3M5RA 2Q31A 5ADXA 5I9EB 4B1UB 3UE5A 4H0YB 2ASMA 3FFKB 4YOYA 2IIRA 2GWKA 3E66A 2FSNA 1VQ6N 4YOXA 2P9PB 3DXKB 4FWQA 4PL7A 5AZJA 3M1FA 3TTFA 2I7NA 3EKUA 4FPBA 2P9NA 4BR5A 3MN9A 4YOVA 1QVGM 4XEIA 5ADXH 3VERA 2F9WA 3D2FB 2QXLA 1NGHA 1NGIA 5B8HA 4BR0A 3EE9A 3CCMN 3CCSN 3CQXA 4H5NA 2I7PA 5EY4A 3RVCA 3VTHA 2D4WA 1GLAG 2WUSA 1QVFM 1Q82O 4RCHA 3K9KA 3VEWA 1YHQN 3D2EA 3QICA 3MN6A 2IVNA 5AQSA 3VF2A 2H3GX 4DB3A 3A5LC 4B1ZA 1HX1A 1RDWX 5C10A 2VWBA 3OBYA 1T44A 3MMVA 3QMLA 4JKFA 1P8ZA 2OTJN 3ENOA 3QB0A 2IVPA 2QM1A 2BUPA 4IJNA 4BGBA 4AF1A 3AGRA 4MO5A 1VQ8N 3QBXA 4H0XB 5C15A 1YUWA 4BR7A 1VQ4N 2FLOA 4BRLA 4BGAA 5LJWA 5CE3A 1BOTO 3VETA 5LJVA 2F9TA 5CHIA 3Q7BA 4H0TB 5AQNA 3ZX0A 5KQDA 3CIPA 1HLUA 2KLAA 3R3LA 5AFUA 3EZWA 3WXMB 2P9PA 3DXKA 1KAYA 1NWKA 4ILJA 3E9LA 1GLLO 3EL2A 4WYBA 5F0XA 4NLCA 3FGUA 1NGCA 4WQ4C 4H5VA 4JNEA 2KKZA 5AQTA 3VF6A 1V4SA 3D2FA 2JWKA 4DKWA 5EXWA 3ATVA 2Q97A 4IO9L 2QW9A 3SLCA 3TTCA 3WUHA 2ZJQL 2Q2RA 3QFPA 4FOEA 5TKWA 3SAGA 3O8MA 3G71N 2QWRA 3CETA 3A5NC 4C1NK 4IFEA 2YX6A 3IFRA 4A59A 3I8BA 2QI2A 3TSQA 1YI2N 3HSCA 5FPEA 2NRZA 1MWMA 3NMUA 4FWPA 2QWQA 5AQXA 1GLBG 3L4IA 3BEXA 3GOIA 5F2RA 4E1JA 3I55N 3CC7N 5C2FA 1TUUA 5GADP 1GLJO 4UY8O 4M63C 5BRHA 4QS8A 2BH1A 4H5TA 3GL1A 1BA0A 4ISEA 4ISGA 4M7YA 4IEEA 1IG8A 3P39A 5BPMA 1S3XA 4B1XB 2NZTA 4O8UA 4M7XA 1Q86O 3SBGA 4BR2A 4BC5A 4YOWA 4EIAA 1G99A 4MLHA 4WCEL 4FWSA 3WEEB 5JICA 5JLFA 3KWGA 3HOTA 3CCEN 1HPMA 3LM2A 5GIOA 5BRFA 5BREA 4K42A 3C6HA 3LDLA 4XH1A 3RSEB 4PL8A 3CC2N 3MK6A 4NB4A 1BU6O 1ILYA 3FR0A 5AQQA 3TSPA 4CZGA 1Z6RA 4BRAA 1O13A 2OANA 4U67L 5LY3A 1QHAA 4BRDA 1U6ZA 2P9LB 4DQ8A 4BVPA 1EQYA 3BF3A 1VQNN 5C2DA 5BPLA 2AP1A 1RFQA 3UB5A 3D7EO 3VGKA 3KK7A 4C1NI 3MN5A 3FZHA 3L0QA 2IVOA 3ATUA 3VEXA 4JKGB 3ENHA 3H46O 4JKBA 4WFNL 1XUPO 3R9PA 2ZWHA 3VGLA 3WXIA 3P38A 2ITMA 1HKGA 2A41A 1VQKN 3C0BA 2V7ZA 3O6WA 2W41A 5AQVA 2V52B 3A8YA 4IOXA 3J7ZO 4CBWA 4BRFA 3KVGA 3VPZA 1T6CA 1YXQA 3P4IA 1NGFA 1VAZA 5JLHA 5JMVA 3D6RA 1VQPN 2RE2A 4WF9L 1W2BM 3MCPA 3MWPA 1K8AO 3WEEA 3EKSA 4IXCA 1RGIA 1SQKA 1IJJA 1J6ZA 3DWLA 4DCHA 4BRCA 2A3ZA 4YOUA 4CZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZ9 A;  1E4G T;  4FOI A;  3RSE A;  5AQJ A;  2W40 A;  2HF3 A;  1GLD G;  2PBD A;  5FPD A;  3FZK A;  3ULE B;  2YI1 A;  3WXJ A;  4EHU A;  2E2O A;  3U8X A;  2PAV A;  3A0I X;  2E20 A;  1ZC6 A;  2Q0U A;  2P9L A;  1X3N A;  3CI5 A;  4CZH A;  4RTF D;  4O8K A;  2P9S B;  1NGJ A;  1SZ2 A;  2QWM A;  3M6G A;  4BRG A;  4F9O A;  3H6E A;  4JAX A;  3SMP A;  3F9M A;  3O1W A;  1BDG A;  2P9K B;  2YJE A;  4J8F A;  1XQS C;  2P9I B;  4FL9 A;  1Q18 A;  2HF4 A;  2Q1N A;  3CJ1 A;  1JCF A;  3WQT A;  1QQM A;  2DPN A;  2YHY A;  1SAZ A;  2D1K A;  5KPZ A;  3GE1 A;  1TYQ B;  3G25 A;  4CZI A;  5BN8 A;  4JD2 B;  1BUP A;  4KBO A;  1QZ6 A;  1YVN A;  4B1V A;  3KHY A;  2FXU A;  1MDU B;  1NGB A;  2GWJ A;  2A40 A;  2FF3 B;  4GNI A;  4JHD B;  3LDN A;  4H0V B;  3CER A;  4FWN A;  4B9Q A;  2CH5 A;  3H1V X;  4EHT A;  2VCP A;  2AA4 A;  3ULE A;  5AFU H;  3WQU A;  5F1X A;  4Y0W A;  2D0P A;  3CJ7 A;  3W3D A;  4H0O A;  1MA9 B;  4BRH A;  4FO0 A;  4BC3 A;  2A5X A;  3H3O B;  4H5R A;  4YDU A;  4BG9 A;  4CZJ A;  2P9S A;  3FLC O;  4BC2 A;  4K43 A;  4FWK A;  3H1Q A;  4A2A A;  2P9K A;  1Z05 A;  2P9I A;  1D4X A;  4CZF A;  1V4T A;  2ZGY A;  4K41 A;  1GLF O;  4DHY A;  3BF1 A;  3WT0 A;  2ASP A;  1GLE G;  1TYQ A;  4BR9 A;  3O4W A;  4FWL A;  3HZ6 A;  4A61 A;  2KHO A;  4JD2 A;  3SK3 A;  4RWT A;  4O5F A;  3J8A A;  5KPR A;  4ISF A;  2D0O A;  2Q36 A;  5BPN A;  3GBT A;  2E8A A;  4JHD A;  3FE1 A;  3AAP A;  5AQI A;  1C0G A;  2ZF5 O;  4PKI A;  4QS9 A;  5AQO A;  1QQO A;  4A62 A;  5AQR A;  2VYP A;  3QBW A;  5EVZ A;  3GG4 A;  1LOT B;  4CBX A;  3SMS A;  5ELZ A;  5AQW A;  4PKG A;  1C0F A;  1NGD A;  3S41 A;  3B8A X;  5TKY A;  3WXL A;  4MO4 A;  3VEV A;  4BRN A;  3O08 A;  1HKB A;  4QS7 A;  3U9Z A;  3AY9 A;  2YHX A;  3LDO A;  4CJ7 A;  4K25 A;  5AR0 A;  2QWN A;  1Y64 A;  5AQM A;  4L3Q A;  1X9J A;  2ZGZ A;  1NM1 A;  4LC9 B;  1GLC G;  4B1W B;  3C7N B;  3UKU B;  3HM8 A;  4BC4 A;  3JXU A;  4B1Y B;  3A5M C;  5AQH A;  4CD3 A;  4BQL A;  3FZL A;  3HBT A;  4FWR A;  4BG8 A;  4XH5 A;  4EAH D;  5AQG A;  3BUZ B;  3H3N O;  3VF4 A;  1QQN A;  2CGK A;  3I33 A;  3O1B A;  3R8E A;  3DXM B;  4BRI A;  2EWS A;  2QWO A;  3EN9 A;  5EOY A;  3FZF A;  3VGM A;  2P9U B;  1WOQ A;  5AQZ A;  1DEJ A;  4AM7 A;  2FSJ A;  3SJH A;  3ZX2 A;  5AQP A;  2CH6 A;  3QDK A;  1MWK A;  3U4L A;  3ID8 A;  5AQF A;  4FWO A;  3CQY A;  1S22 A;  2YHW A;  1OKJ A;  3W0L A;  1ZBS A;  5E26 A;  3LM9 A;  4BRE A;  2YJF A;  1U2V B;  4H5W A;  3VEZ A;  1DGK N;  1NGE A;  1JCE A;  5E84 A;  5EX5 A;  4C23 A;  4FWM A;  3C7N A;  4BQZ A;  3UKU A;  3AAQ A;  1R59 O;  5KPT A;  4FSV A;  2A6A A;  4A2B A;  3O5B A;  4HTL A;  2E1Y A;  3AAR A;  2YCH A;  4BVO A;  5BN9 A;  5BRD A;  4I6M B;  1KAZ A;  3DXM A;  3HTV A;  3VEY A;  3ZX3 A;  1ATN A;  5KQ8 A;  1NLV A;  4XH4 A;  3VEO A;  4EFH A;  2GTD A;  4AM6 A;  1KXP A;  2P9U A;  4CD1 A;  4JN4 A;  1H1V A;  4YDU C;  3HI0 A;  3TPQ A;  3R6M A;  3CJ9 A;  1TUY A;  5AZI B;  3BP8 A;  3JS6 A;  4CBU A;  4IO8 A;  4WQ4 A;  3VES A;  3DAW A;  5AQK A;  1U2V A;  4CI6 A;  4Z94 A;  3IDH A;  2E2P A;  2UYT A;  1BA1 A;  2V7Y A;  5AQY A;  1T6D A;  3M3Z A;  3UKR B;  3IUC A;  4H0P A;  4BRQ A;  1BG3 A;  4H03 B;  3U9D A;  4BR4 A;  1HUX A;  3GDQ A;  2FF6 A;  1WUA A;  3LDP A;  2HOE A;  3ZET B;  3FZM A;  2Q0R A;  2GEM A;  1ATS A;  3VEN A;  2E1Z A;  1ZXO A;  4I6M A;  4MLE A;  1K8K B;  4BRO A;  3DJC A;  4IWV A;  3ZEU B;  1ATR A;  4WQ5 C;  1NBW A;  2NLX A;  3O80 A;  4WQ5 A;  3CHW A;  1BWF O;  4BRP A;  3LDQ A;  3KZB A;  1X3M A;  2A42 A;  2CGJ A;  4CZM A;  5AZI A;  1HKC A;  4BRK A;  2V51 B;  3CJB A;  1KAX A;  4IJA A;  3OHR A;  2GUP A;  5FPN A;  2E88 A;  5AZJ B;  3IMX A;  2CGL A;  3MDQ A;  2P9N B;  3H45 C;  1JCG A;  1QZ5 A;  2NRH A;  5BR9 A;  2FSK A;  1HJO A;  3QFU A;  4CZK A;  1CZA N;  3L6Q A;  1YAG A;  3UKR A;  2QWL A;  3CJC A;  1ESV A;  3VOV A;  5AQL A;  1DKG D;  2GEL A;  3D2E B;  4GY2 B;  3ZET A;  1NMD A;  2J4R A;  4PKH A;  3LL3 A;  5FPM A;  5AQU A;  1NGA A;  2QWP A;  3A5O C;  3CJA A;  4CZL A;  4BRM A;  1E4F T;  4NO7 A;  2HMP A;  4HWI A;  1K8K A;  1XC3 A;  2E2N A;  2ASO A;  3MN7 A;  3EO3 A;  4FPA A;  1BO5 O;  3ZEU A;  1LCU A;  2E2Q A;  2BTF A;  3WXK A;  1NGG A;  2Q31 A;  5ADX A;  5I9E B;  4B1U B;  3UE5 A;  4H0Y B;  2ASM A;  3FFK B;  2IIR A;  2GWK A;  2FSN A;  2P9P B;  3DXK B;  4FWQ A;  4PL7 A;  5AZJ A;  3M1F A;  2I7N A;  3EKU A;  4FPB A;  2P9N A;  4BR5 A;  3MN9 A;  4XEI A;  5ADX H;  3VER A;  2F9W A;  3D2F B;  2QXL A;  1NGH A;  1NGI A;  5B8H A;  4BR0 A;  3CQX A;  4H5N A;  2I7P A;  5EY4 A;  2D4W A;  1GLA G;  2WUS A;  4RCH A;  3VEW A;  3D2E A;  3QIC A;  3MN6 A;  2IVN A;  5AQS A;  3VF2 A;  2H3G X;  4DB3 A;  3A5L C;  4B1Z A;  1HX1 A;  1RDW X;  2VWB A;  1T44 A;  3MMV A;  3QML A;  1P8Z A;  3ENO A;  3QB0 A;  2IVP A;  2QM1 A;  2BUP A;  4IJN A;  4BGB A;  4MO5 A;  3QBX A;  4H0X B;  1YUW A;  4BR7 A;  2FLO A;  4BRL A;  4BGA A;  5LJW A;  5CE3 A;  1BOT O;  3VET A;  5LJV A;  2F9T A;  4H0T B;  5AQN A;  3ZX0 A;  5KQD A;  3CIP A;  1HLU A;  5AFU A;  3EZW A;  2P9P A;  3DXK A;  1KAY A;  1NWK A;  1GLL O;  3EL2 A;  4WYB A;  5F0X A;  3FGU A;  1NGC A;  4WQ4 C;  4H5V A;  4JNE A;  5AQT A;  3VF6 A;  1V4S A;  3D2F A;  5EXW A;  3ATV A;  2Q97 A;  2QW9 A;  3SLC A;  3WUH A;  2Q2R A;  3QFP A;  4FOE A;  3O8M A;  2QWR A;  3CET A;  3A5N C;  3IFR A;  3I8B A;  3HSC A;  5FPE A;  1MWM A;  4FWP A;  2QWQ A;  5AQX A;  1GLB G;  3L4I A;  3BEX A;  3GOI A;  5F2R A;  4E1J A;  1TUU A;  1GLJ O;  4M63 C;  5BRH A;  4QS8 A;  4H5T A;  3GL1 A;  1BA0 A;  4ISE A;  4ISG A;  4M7Y A;  1IG8 A;  5BPM A;  1S3X A;  4B1X B;  2NZT A;  4M7X A;  4BR2 A;  4BC5 A;  4EIA A;  1G99 A;  4MLH A;  4FWS A;  3WEE B;  5JIC A;  5JLF A;  1HPM A;  3LM2 A;  5BRF A;  5BRE A;  4K42 A;  3LDL A;  4XH1 A;  3RSE B;  4PL8 A;  3MK6 A;  4NB4 A;  1BU6 O;  3FR0 A;  5AQQ A;  4CZG A;  1Z6R A;  4BRA A;  2OAN A;  1QHA A;  4BRD A;  1U6Z A;  2P9L B;  4DQ8 A;  4BVP A;  1EQY A;  3BF3 A;  5LY3 A;  5BPL A;  2AP1 A;  1RFQ A;  3UB5 A;  3D7E O;  3VGK A;  3MN5 A;  3FZH A;  3L0Q A;  2IVO A;  3ATU A;  3VEX A;  3ENH A;  3H46 O;  1XUP O;  3R9P A;  2ZWH A;  3VGL A;  3WXI A;  2ITM A;  1HKG A;  2A41 A;  3C0B A;  2V7Z A;  3O6W A;  2W41 A;  5AQV A;  2V52 B;  3A8Y A;  4CBW A;  4BRF A;  3KVG A;  3VPZ A;  1T6C A;  1YXQ A;  3P4I A;  1NGF A;  5JLH A;  5JMV A;  3MCP A;  3WEE A;  3EKS A;  4IXC A;  1RGI A;  1SQK A;  1IJJ A;  1J6Z A;  3DWL A;  4DCH A;  4BRC A;  2A3Z A;  3TU5 A;  4CZE A; 
#chains in the Genus database with same CATH topology
 1NJZ A;  3KLI A;  1EO1 A;  3J7Y P;  3NFA A;  2E6L A;  3RSE A;  3LPU A;  5AQJ A;  2W40 A;  4LF6 K;  5FPD A;  1YTA A;  4HVJ A;  2PAV A;  3A0I X;  4CJS A;  3KWI A;  4M3U A;  3BGR A;  1K73 O;  1KC8 O;  1X3N A;  3CI5 A;  4CZH A;  4DTR A;  5C0Y A;  1SL0 A;  2JWL A;  1VSF A;  1WN7 A;  1ZBU A;  4JKG A;  4CGG A;  3SMP A;  2VQF K;  2RHK A;  4CF9 A;  1BDG A;  2O8C A;  2P9I B;  1Q18 A;  2DFF A;  3CJ1 A;  3AVJ A;  1JCF A;  3WQT A;  3AV9 A;  4CES A;  4BY9 C;  2DPN A;  2YHY A;  1SAZ A;  4DS4 A;  3GE1 A;  1GOC A;  3G25 A;  1IV0 A;  2WFB A;  3RRG A;  1U4B A;  3G6E N;  3CQ8 A;  2XY8 A;  4KBO A;  4B1V A;  4UQG A;  1CLQ A;  1MDU B;  1RCH A;  2A40 A;  3VN5 A;  5J1E A;  2FF3 B;  4JHD B;  5LMU K;  3VQB A;  4EHT A;  4FJL A;  2HVI A;  2AA4 A;  3V1O A;  4DQI A;  3MEG A;  1A5X A;  4H0O A;  4BC3 A;  3H3O B;  2UXD K;  4H5R A;  4YDU A;  4BG9 A;  3TI0 A;  4FWK A;  3ZCM A;  1W0H A;  3SCX A;  1V4T A;  1KVA A;  5C24 A;  4MFB A;  3CCV N;  4FK4 A;  4CED A;  1N8R O;  2D5R A;  5BR8 K;  2WBN A;  4FW1 A;  4BR9 A;  3O4W A;  4FJI A;  2VG5 A;  3HZ6 A;  3L4Q A;  4A61 A;  3O3G A;  4RWT A;  2EX3 A;  4O5F A;  2HHV A;  3WNH A;  1YJ9 N;  3LP3 A;  3DM2 A;  4DTO A;  1SL2 A;  1WBB A;  4I2P A;  4CIG A;  1N6Q A;  1D8Y A;  5AQI A;  4KAZ A;  4PKI A;  4FYD A;  4JI1 K;  4CJ3 A;  4QS9 A;  1QQO A;  3GG4 A;  1LOT B;  3IKM A;  2G8W A;  3CF5 L;  3K59 A;  1BCO A;  4DUY K;  4JKD A;  3RR8 A;  4J2E A;  3CFR A;  2NRT A;  1NGD A;  3B8A X;  3WXL A;  4E7K A;  4MO4 A;  4BRN A;  1KTQ A;  1OH6 A;  4IOA L;  3O08 A;  1IH7 A;  3U9Z A;  1VQ7 N;  4FJX A;  2ETJ A;  2B5J A;  1SKR A;  4JKA A;  3PLA A;  1S72 N;  4Z4E A;  5H1S Q;  5J2P A;  1LWF A;  1N34 K;  1KLN A;  4CJF A;  1X9J A;  3PX4 A;  5HRO A;  3C94 A;  1Z26 A;  1GLC G;  5FRN A;  3UKU B;  1IBM K;  5HL7 L;  2UU9 K;  3EZ5 A;  4CEF A;  3A5M C;  2D0A A;  4BQL A;  1L3T A;  4FWR A;  4DV2 K;  3HO1 A;  4JKH A;  4EAH D;  3LDS A;  3K58 A;  3VQA A;  1QQN A;  4BWJ A;  3O1B A;  1TV6 A;  1NK6 A;  2QWO A;  1YF5 L;  3NH2 A;  4OVL A;  1WOQ A;  1DEJ A;  4KRF A;  2X78 A;  5AQP A;  2CH6 A;  3U4L A;  2F96 A;  2NRV A;  3OYN A;  1OKJ A;  3OA9 A;  3W0L A;  1CZB A;  1W9H A;  2YJF A;  3QEW A;  5M1K A;  2ZQB A;  1NGE A;  5E84 A;  5EX5 A;  4R79 A;  3PIO L;  2NUB A;  3C7N A;  3CYM A;  2ZJR L;  1R59 O;  3THY A;  4A2B A;  3O5B A;  1QTM A;  4AHT A;  3AAR A;  2YCH A;  5BRD A;  1RBR A;  4I6M B;  3DXM A;  1NKB A;  4CJU A;  5KQ8 A;  2VWJ A;  4GKJ K;  1NLV A;  1DT9 A;  2IC3 A;  2P51 A;  4FJ5 A;  2PFU A;  3NGY A;  1H1V A;  2ZJP L;  3N4P A;  3TPQ A;  4H8K A;  3CJ9 A;  2GV9 A;  5AZI B;  5JS1 A;  3F9K A;  3JS6 A;  1S9E A;  1KQS M;  4IO8 A;  2O8D A;  4WQ4 A;  3ZSY A;  3THV A;  1U2V A;  2UYT A;  3V9S A;  2RF2 A;  1B9F A;  1BA1 A;  2V7Y A;  4E7I A;  5AQY A;  3UKR B;  4O4G A;  4BR4 A;  1EWR A;  3ASM A;  3LDP A;  4LF8 K;  4DF4 A;  1HQU A;  1JKH A;  4EZ6 A;  3ZET B;  1S1W A;  3OS0 A;  1RT7 A;  2Q0R A;  2GEM A;  4I7F A;  3VEN A;  1ZXO A;  2EHG A;  4ELV A;  3ID6 A;  4IDH A;  3DJC A;  4IWV A;  3ZEU B;  1ATR A;  4OKE A;  1OVQ A;  4WQ5 C;  5EU7 A;  3PIP L;  1VQO N;  1BWF O;  4F2S A;  4BRP A;  1NJY A;  4A5A A;  2A42 A;  1TK5 A;  4ILG B;  1M1K O;  4B3O A;  3ZSQ A;  3FFI A;  1OVY A;  4B3M K;  4B9L A;  1SUQ A;  3G0Z A;  3CJB A;  4CEQ A;  2GUP A;  4NXM K;  1NJI O;  5HRS A;  3HPG A;  2NRH A;  3QFU A;  2VG7 A;  2XRI A;  3HPH A;  4DQP A;  2QWL A;  2W42 A;  4W5R A;  4IEI A;  1ESV A;  1LAV A;  3D2E B;  4NCG A;  4GY2 B;  1WSF A;  4PKH A;  1RBU A;  1KD1 O;  5FPM A;  3CJA A;  2HMP A;  3KIO A;  1K8K A;  2E2N A;  3V4I A;  2PYJ A;  3EO3 A;  3CFO A;  1LCU A;  4KHW A;  2BTF A;  1NGG A;  2Q31 A;  5I9E B;  2HW3 A;  2X6S A;  3QEV A;  4H0Y B;  2YHB A;  3HT3 A;  2DTU A;  5I3U A;  2G8I A;  2HHX A;  3DXK B;  2KFZ A;  4DU3 A;  4Z0U A;  4KV8 A;  4BR5 A;  4YOV A;  2E6M A;  1QSS A;  1IKV A;  1HYZ A;  2F9W A;  3D2F B;  2QXL A;  2XY7 A;  1C1C A;  3AVL A;  3OYJ A;  4DFM A;  3CQX A;  3A2F A;  4PA1 A;  1TVR A;  5EY4 A;  2D4W A;  3T1H K;  3QIN A;  2YKN A;  4RCH A;  3VEW A;  4FLY A;  4FLV A;  1R0A A;  1O1W A;  1HX1 A;  1RDW X;  5C10 A;  2VWB A;  3OYC A;  3OBY A;  1T44 A;  4JKF A;  4IDK A;  1P8Z A;  1XI1 A;  3ENO A;  2F8T A;  2QM1 A;  2O8B B;  1ZBH A;  3AGR A;  4H0X B;  3SV4 A;  2OPQ A;  1YUW A;  4RW7 A;  3OYD A;  4BGA A;  4IFY A;  3EYZ A;  4CW7 B;  2XHB A;  2HHS A;  4DTX A;  3R3L A;  1J53 A;  4CEA A;  4KFB A;  5J2N A;  1KAY A;  2QXF A;  1T8E A;  3ISN C;  4B3S K;  1WLJ A;  3FGU A;  3M8P A;  3VF6 A;  1VHX A;  2JWK A;  3ATV A;  4DWI A;  1WSJ A;  2ZJQ L;  3WUH A;  1JL1 A;  1XHZ A;  4CF0 A;  4FLX A;  3KD1 E;  1X9S A;  3CET A;  3A5N C;  3EEQ A;  4AQY K;  4IFE A;  3DMJ A;  3T1Y K;  4BE1 A;  3IRX A;  3NMU A;  1JLG A;  1VRU A;  3J80 O;  1GLB G;  3V9Z A;  5GAD P;  4M63 C;  4RW9 A;  1ITG A;  4QS8 A;  5BRH A;  4IEE A;  2KW4 A;  3VQP A;  1TKD A;  2NZT A;  3HYF A;  4YY3 K;  4JI5 K;  4BR2 A;  4YOW A;  4DQQ A;  3L3U A;  4EIA A;  4LFA K;  1ZBF A;  3C95 A;  1KCF A;  1RT6 A;  5JIC A;  2O4G A;  1J5E K;  4XIU A;  1ASV A;  3NF8 A;  5GIO A;  5BRF A;  4K42 A;  2A1S A;  4XH1 A;  4PL8 A;  3MK6 A;  4KHN A;  4KKO A;  3ZT2 A;  5AQQ A;  3TSP A;  1BI4 A;  1O13 A;  2HHT A;  1QHA A;  1S9G A;  4BRD A;  2P9L B;  1IKX A;  3DI6 A;  4RW6 A;  5C2D A;  5BPL A;  2ITG A;  3O4Q A;  4Z4H A;  3MN5 A;  3ENH A;  4O5B A;  4WFN L;  4ELT A;  3S3O A;  4DTM A;  4CJL A;  2ITM A;  1HKG A;  2UXB K;  3J7Z O;  4CEC A;  5AQV A;  2V52 B;  1B92 A;  3LZI A;  1REV A;  4FCY A;  1NG9 A;  5CZ2 A;  3P4I A;  1JL2 A;  3AVC A;  3HVR A;  4DR7 K;  3D6R A;  2RE2 A;  4WF9 L;  4DU1 A;  4HUE A;  4CEB A;  3MCP A;  2Z1H A;  3WEE A;  3EKS A;  1SQK A;  3HXM A;  4BRC A;  3CM6 A;  4IZ9 A;  4GV3 A;  4CJ4 A;  4N5S A;  1J5O A;  4F3T A;  5GAH P;  3V9X A;  2HF3 A;  3WXJ A;  1U04 A;  2E20 A;  1ZC6 A;  3DRS A;  3LP1 A;  1RT4 A;  2Z1J A;  4O8K A;  3L2W A;  2Z1I A;  1NGJ A;  4BRG A;  4F9O A;  3EE8 A;  5GIN A;  4OPH A;  3OJU A;  4J8F A;  1XQS C;  2Q1N A;  3SJJ A;  3T1A A;  4JV5 K;  1QQM A;  4I9Q A;  4OPJ A;  4HCC A;  2D1K A;  4FJH A;  2JLE A;  4F3O A;  1TYQ B;  1E3M A;  4GKK K;  2HBL A;  1L3S A;  3CC4 N;  1BCM A;  1BUP A;  4CIF A;  1T05 A;  4CJ5 A;  4ELU A;  3QIP A;  3OYL A;  4ZTJ A;  3LDN A;  4B8C A;  1BHL A;  2CH5 A;  3H1V X;  3AVB A;  4QAG A;  3TAP A;  3ULE A;  5E41 A;  4Y0W A;  3CJ7 A;  3R1X A;  1ZYQ A;  4BRH A;  1NNE A;  2A5X A;  3NH1 A;  4CZJ A;  2P9S A;  3FLC O;  3LAN A;  4K43 A;  4B9T A;  2P9K A;  1D4X A;  4K41 A;  3V9W A;  2NRW A;  3DLK A;  4FJK A;  3SUO A;  1HPZ A;  3VQE A;  2ASP A;  5JVH L;  3CD6 N;  3HM9 A;  2FC0 A;  4LFB K;  4FWL A;  4DR3 K;  4DSK A;  3D0P A;  2KHO A;  4JD2 A;  3SK3 A;  3J8A A;  1VQL N;  4ISF A;  5M1N A;  3SAH A;  2D0C A;  3OYG A;  5BPN A;  3GBT A;  2WC9 A;  2E8A A;  2WOM A;  3DLL L;  1S5J A;  3V81 A;  3AVG A;  3HPO A;  3QEP A;  3LAM A;  2ZF5 O;  1A5V A;  5C25 A;  2NRX A;  1TKX A;  2VYP A;  4RG8 A;  4O55 A;  1QQC A;  4LF5 K;  1L3U A;  1KLM A;  1D9F A;  3SV3 A;  1XNR K;  1I39 A;  1KFS A;  4OKK A;  5TKY A;  3VEV A;  4JI7 K;  5KI6 A;  4KH5 A;  2ZD1 A;  3PV8 A;  4EZ9 A;  4CJR A;  3QO9 A;  3LDO A;  5AR0 A;  5AQM A;  5AJ3 K;  2ZGZ A;  3CMA N;  2YNI A;  5DM7 L;  2HBM A;  4FJ8 A;  3NF9 A;  4B1W B;  4WE1 A;  2G8U A;  5CZ1 A;  4B1Y B;  2IDO A;  1JLC A;  1GOB A;  3TAN A;  4DSI A;  1SKS A;  3OYH A;  3SUQ A;  4B08 A;  3VF4 A;  4CHO A;  4FLU A;  4FJG A;  4IG0 A;  4A5B A;  3BZC A;  4FZY A;  3SNN A;  3O9S A;  2FSJ A;  2HBK A;  3AA4 A;  3O9Q A;  3SJH A;  4HUF A;  2DY4 A;  1NJX A;  1MWK A;  3JAM O;  3ID8 A;  3VA3 A;  1YJW N;  4FWO A;  1VSD A;  3CCL N;  3T7Z A;  5E26 A;  3N4Q A;  4LF4 K;  4JRQ A;  3I56 N;  3U6F A;  1P90 A;  4B9V A;  4BQZ A;  2HNZ A;  2QA4 N;  3LAK A;  3TTD A;  4CK2 A;  4QOZ B;  3THW A;  1U49 A;  1LW2 A;  3VEY A;  4N41 A;  3B6P A;  3ZX3 A;  4XH4 A;  2A1R A;  3OVN A;  1J9A A;  2HHH K;  4Y1C A;  4AM6 A;  2E5L K;  2P9U A;  4G9Z A;  3QEX A;  3HI0 A;  4DFP A;  4MDB A;  4TSX A;  2FBY A;  3P1G A;  3LPT A;  4JI2 K;  5DM6 L;  4O44 A;  4CBU A;  3ITH A;  3VES A;  5AQK A;  4NLB A;  3CCU N;  3TSU A;  2IGI A;  2YHA A;  1T6D A;  3TAF A;  1IBK K;  1EET A;  3AVF A;  1W7A A;  3GDQ A;  1WUA A;  4FVU A;  3VQ8 A;  1ATS A;  2E1Z A;  2RN2 A;  1S1T A;  4MLE A;  3S3M A;  4OPA A;  3OY9 A;  4FLT A;  2O8F A;  1D5A A;  2GUI A;  1LWC A;  1QSL A;  3F2K A;  3LDQ A;  3I0R A;  3KZB A;  1Q7Y O;  3CPW M;  3DLB A;  4I2Q A;  1I3A A;  5HBM A;  2V51 B;  5JVG L;  2R7Y A;  4IJA A;  1M90 O;  1K9M O;  3KTQ A;  3OHR A;  5FPN A;  3G4S N;  2OZM A;  2E88 A;  2P9N B;  4W5T A;  4JI0 K;  4CJK A;  2FSK A;  1HJO A;  1FW6 A;  4B9U A;  4KHY A;  3L6Q A;  3ZT3 A;  4JK7 A;  1BQM A;  4GW6 A;  1UA1 A;  3CJC A;  3O9R A;  2W6K A;  1KVC A;  4LSL A;  4F4K A;  1FKP A;  3NVM A;  4NCA A;  2GEL A;  3RMA A;  1S1X A;  4X64 K;  5M1F A;  1NK5 A;  5AQU A;  3PX0 A;  3QER A;  4DQS A;  3PO4 A;  4CZL A;  3D45 A;  1RBT A;  4BE2 A;  3ZSW A;  4HWI A;  1XC3 A;  3TAQ A;  1VSH A;  3O9U A;  1BIU A;  3WXK A;  4M41 A;  1OH7 A;  4B1U B;  1BGX T;  3UE5 A;  2ASM A;  4YOY A;  3E66 A;  4LH4 A;  2FSN A;  3RTV A;  3ZSR A;  2P9P B;  4PL7 A;  5AZJ A;  3SUP A;  3RR7 A;  1KFD A;  2ATQ A;  1QVG M;  4XEI A;  1QE1 A;  3THX B;  3VER A;  3QNN A;  1HNI A;  2IAJ A;  2UUA K;  3EE9 A;  5FDL A;  3CCS N;  1RDD A;  2I7P A;  3TAR A;  3VTH A;  3G10 A;  2HND A;  3DLG A;  1OH5 A;  1QVF M;  1X9W A;  3BY5 A;  2IVN A;  2H3G X;  2O8E B;  2KQ2 A;  4FZX C;  1J54 A;  1VK0 A;  4AH9 A;  4DLG A;  4RW8 A;  2OTJ N;  3AO5 A;  2Q3S A;  4MO5 A;  3QBX A;  5C15 A;  1RDB A;  1VQ4 N;  2FLO A;  4BRL A;  5LJW A;  1TK8 A;  3VET A;  5LJV A;  2F9T A;  5CHI A;  3NDK A;  3Q7B A;  1QHT A;  3HL8 A;  5AQN A;  1Z25 A;  1HLU A;  2P5G A;  3WNE A;  1BL3 A;  4NLC A;  1UOC A;  4RW4 A;  4JNE A;  1KSP A;  3KK1 A;  5CY4 A;  1V4S A;  3I0S A;  1IO2 A;  3VQ5 A;  5EXW A;  4CEO A;  2Q97 A;  2QW9 A;  3TTC A;  1GOA A;  1SKW A;  3QFP A;  2OPP A;  3G71 N;  4Y1D A;  4C1N K;  2YX6 A;  3LAL A;  4FW2 A;  2QI2 A;  5FPE A;  1MWM A;  3OYB A;  3AVH A;  2QWQ A;  3L2U A;  3OYK A;  4KI6 A;  3BEX A;  5CYQ A;  4EP4 A;  1TUU A;  1GLJ O;  3KD5 E;  4ISE A;  1IG9 A;  5BPM A;  1JLA A;  3VQ9 A;  2KZM A;  4M7X A;  3SBG A;  4BC5 A;  4H4M A;  3AO4 A;  1G99 A;  4FWS A;  5KRT A;  2XY5 A;  1KRP A;  1LAW A;  2WON A;  4ICL A;  1IKW A;  5BRE A;  4W5Q A;  3LDL A;  4IBN A;  3AA2 A;  3RSE B;  4CJQ A;  1Q9Y A;  1NJW A;  2Y1J A;  4M3R A;  2OAN A;  4KO0 A;  4DQ8 A;  1EQY A;  2BGG A;  3NF7 A;  1VQ8 N;  4R5P A;  4DV4 K;  2P5O A;  4OLB A;  4JKG B;  3H46 O;  1XUP O;  2O8C B;  5HRR A;  3WXI A;  2A41 A;  4BRF A;  3VPZ A;  1T6C A;  5JLH A;  1NGF A;  1VAZ A;  5JMV A;  4F2R A;  1XNQ K;  1W2B M;  4FK0 A;  1BIZ A;  2F4V K;  3DOL A;  1J6Z A;  4DCH A;  3TU5 A;  4YOU A;  4CZE A;  4DR2 K;  2Y1I A;  2G8V A;  4KHQ A;  1E4G T;  4FOI A;  2PZS A;  3K5L A;  1GLD G;  2YI1 A;  5HRP A;  3CME N;  4JK9 A;  1VQM N;  3TAM A;  5IT9 O;  4YOR A;  1ZBL A;  2BAN A;  3SZ2 A;  4DTS A;  5HP1 A;  4RTF D;  2QWM A;  3JSM A;  3H6E A;  4JAX A;  3CCR N;  4DU4 A;  3O1W A;  3E1Y A;  1N36 K;  2HF4 A;  3F73 A;  3F5T A;  3E9P A;  3CCQ N;  4ILH A;  2QKK A;  4Z4C A;  5KPZ A;  5MLC Q;  3IS9 A;  4BAC A;  1U47 A;  4CZI A;  1JLE A;  4ZHR A;  4PHT X;  2QTD A;  3KHY A;  1IKY A;  2HBJ A;  3SQ0 A;  1NGB A;  4N47 A;  3SYZ A;  4FZZ A;  3K0S A;  2NRR A;  5AFU H;  3WQU A;  5F1X A;  3HP6 A;  2D0P A;  5D3G A;  3W3D A;  1G15 A;  5FLX O;  1MA9 B;  4FO0 A;  4KH6 A;  5HOO A;  3KK2 A;  4CEZ A;  3RMB A;  4JK8 A;  3H1Q A;  2W6L A;  4A2A A;  4AHS A;  3DLH A;  4JKC A;  2P9I A;  2ZGY A;  1GLF O;  4CFA A;  4NXN K;  1JJ2 M;  4N76 A;  2OCE A;  3V1R A;  3BF1 A;  3QIO A;  4YNQ A;  3WT0 A;  1GLE G;  4JYA K;  3SBT A;  2G8F A;  4PQU A;  4Q0B A;  1HMV A;  1HNX K;  5KPR A;  4C8K A;  2RPI A;  2G8H A;  2Q36 A;  5A2Q O;  4JHD A;  3ZYY X;  5CYM A;  2B6A A;  1JLB A;  4CGF A;  3MX2 A;  3MXM A;  4DFJ A;  3AAP A;  2B4J A;  1N32 K;  4IKF A;  3SUN A;  4NYN A;  3AA5 X;  1NK9 A;  5AQO A;  4KRE A;  4A62 A;  5AQR A;  1NK7 A;  5EVZ A;  4JS5 A;  4Z4G A;  3CG7 A;  1N33 K;  3MEC A;  3SMS A;  2HMI A;  1X9M A;  1FJG K;  2FBX A;  2O4I A;  1YIT N;  5ELZ A;  2F7T A;  5AQW A;  3S41 A;  1NU0 A;  4FJ9 A;  4B9M A;  3OBW A;  2YNG A;  4QS7 A;  1YIJ N;  3AY9 A;  4KTQ A;  4I9L A;  4K25 A;  3TAG A;  1Q81 O;  3NH0 A;  1HQE A;  2I5J A;  4FLZ A;  3C7N B;  4BC4 A;  3HM8 A;  3JXU A;  4CCH A;  3THY B;  1I94 K;  3SAF A;  4DFK A;  3FZL A;  4X62 K;  3NVK A;  3HBT A;  3C65 A;  3QNO A;  3BUZ B;  1EXQ A;  3H3N O;  4CF8 A;  4PY5 A;  3I33 A;  3R8E A;  2YV0 X;  3DXM B;  4BRI A;  3EN9 A;  3ZSV A;  4OO1 J;  3P83 D;  2YKM A;  3FZF A;  3VGM A;  3J81 O;  3NE6 A;  5J2Q A;  3VQ4 A;  3L2Q A;  4AM7 A;  4M42 A;  4GV9 A;  3OS2 A;  4CFB A;  2ZE2 A;  3QEI A;  1YVU A;  1S22 A;  3HRG A;  3ENB A;  2YHW A;  4CIE A;  2UUB K;  4K0K K;  4C8O A;  2O8D B;  1JLF A;  3LM9 A;  4BRE A;  3M8S A;  1WBD A;  4KB1 A;  4O0I A;  1U2V B;  1C1A A;  1DGK N;  1VQ5 N;  5K14 A;  1JCE A;  4C23 A;  2VGM A;  4FWM A;  3UKU A;  5HRN A;  3DOK A;  1UAX A;  3AAQ A;  4FJ7 A;  5KPT A;  3K9J A;  4HTL A;  4E7J A;  2E1Y A;  4CJW A;  4YOT A;  5BN9 A;  2XY6 A;  1KAZ A;  2P1J A;  1ATN A;  3VEO A;  4FJJ A;  4JN4 A;  1W97 L;  3E9O A;  4YDU C;  2D0B A;  3PSF A;  3R6M A;  4BE0 A;  2GBZ A;  1TUY A;  3NBP A;  3ZSX A;  4JS4 A;  2OPR A;  3TAB A;  1VQ9 N;  1T7P A;  3OW2 M;  3DAW A;  1RT5 A;  2E4L A;  4N56 A;  1YT3 A;  1RDU A;  3SQ2 A;  3VA0 A;  3NCI A;  1MU2 A;  1S6P A;  1NOZ A;  1BG3 A;  4H03 B;  3U9D A;  1HUX A;  4OGE A;  2FF6 A;  2HOE A;  3AO2 A;  5FRO A;  4GMJ B;  4JI8 K;  1TAQ A;  4MQ3 A;  4I6M A;  3MX5 A;  4DV7 K;  1C0M A;  3K5O A;  1K8K B;  4BRO A;  3ZT4 A;  2QEX N;  4DMN A;  1YJN N;  1NBW A;  2NLX A;  3O80 A;  4Q5V A;  3CHW A;  4CHY A;  2VQE K;  5SWM A;  3C6A A;  1X3M A;  2CGJ A;  2VG6 A;  4CZM A;  5AZI A;  1HKC A;  1WSH A;  5T7B A;  1TK0 A;  1T3V A;  1KAX A;  1HNZ K;  1QS4 A;  3MWT A;  1RDC A;  2CGL A;  3I8D A;  2VGN A;  4DV1 K;  4CE9 A;  1D9D A;  1QZ5 A;  4CZK A;  4JEP A;  1N5Y A;  4A57 A;  1ZBI A;  3UKR A;  4DV3 K;  1UWB A;  4GVM A;  3KLG A;  2OYQ A;  4LFC K;  3VOV A;  2HVH A;  4NYF A;  3AVN A;  3Q7C A;  3ZET A;  1NMD A;  2J4R A;  3OYE A;  1EX4 A;  3A5O C;  4IG3 A;  1RBS A;  4BRM A;  4NO7 A;  3MN7 A;  4KHS A;  1EWQ A;  4FPA A;  3ZEU A;  2E2Q A;  1FKO A;  3M5R A;  1WSG A;  5ADX A;  1Y97 A;  3NGZ A;  4DTN A;  4CFD A;  4W5O A;  3FFK B;  3OYI A;  2GWK A;  4YFU A;  4AIL C;  3V9U A;  3OTO K;  1VQ6 N;  1RTD A;  4JI4 K;  2PYL A;  5KGW A;  4FM2 A;  4FXD A;  3EKU A;  4C8L A;  3MN9 A;  4OKJ A;  5LMN K;  3U3G A;  3KKR A;  4HTU A;  3L3V A;  1NGH A;  4AHV A;  2DFH A;  3CCM N;  1YTU A;  4H5N A;  3ZT0 A;  3V1Q A;  1SV5 A;  1Q82 O;  4IFV A;  3D2E A;  3QIC A;  3MN6 A;  5AQS A;  1NKC A;  3VF2 A;  4DB3 A;  3A5L C;  2KFN A;  3MMV A;  3QML A;  3VQQ A;  1HR0 K;  2IVP A;  2BUP A;  4FJM A;  2FBT A;  3AVM A;  3RMC A;  1KVB A;  4BR7 A;  4PWD A;  4E89 A;  1BOT O;  1HNW K;  4OGC A;  4DSJ A;  3ZX0 A;  1WSE A;  3O4N A;  3PSI A;  3WXM B;  3DXK A;  4CF2 A;  1L5U A;  1NWK A;  1RTJ A;  4E1N A;  4ILJ A;  1OH8 A;  3AVA A;  3E9L A;  3EL2 A;  4OPK A;  4WQ4 C;  1NGC A;  3DLR A;  4BDY A;  4J2D A;  4H5V A;  2KKZ A;  4KPY A;  3D2F A;  3AVI A;  4DKW A;  4ID5 A;  2OZS A;  4IO9 L;  3SLC A;  2Q2R A;  3LP2 A;  5KTQ A;  4FOE A;  5TKW A;  1A5W A;  3O8M A;  3DLE A;  2QWR A;  4B8A B;  4CER A;  3RWU A;  1BI4 B;  3SQ1 A;  3I8B A;  4OX9 K;  4DTU A;  2NRZ A;  1EKE A;  3BZK A;  3RRH A;  2O8B A;  2IS3 A;  4FWP A;  5AQX A;  4E7H A;  3J7A P;  1TKZ A;  1HRH A;  4M45 A;  3L4I A;  1C1B A;  2JGU A;  4B9N A;  4FLW A;  1B9D A;  5C2F A;  3AO3 A;  4UY8 O;  2BH1 A;  3GL1 A;  1BA0 A;  4M7Y A;  1HJR A;  3P39 A;  1S3X A;  4G1Q A;  4B1X B;  1S1V A;  4O8U A;  4FJN A;  4L8R B;  3RMD A;  3BDP A;  3WEE B;  2UXC K;  4LH5 A;  3CCE N;  3K2P A;  1HPM A;  3LM2 A;  4OJR A;  3CC2 N;  3FR0 A;  1K6Y A;  3AO1 A;  3KLE A;  3LWL A;  3S9H A;  3JYT A;  4CJP A;  3TAE A;  1XWL A;  4LF9 K;  4BVP A;  1VQN N;  2AP1 A;  3VGK A;  1RFQ A;  1HNV A;  4C1N I;  4CHN A;  3FZH A;  4DSL A;  3L0Q A;  2IVO A;  3VEX A;  4DSF A;  4K8Z A;  4JKB A;  4BDP A;  3R9P A;  2ZWH A;  3P38 A;  2V7Z A;  3O6W A;  2W41 A;  2IOC A;  3A8Y A;  4B3R K;  1RBV A;  4CBW A;  4DQR A;  3WNG A;  1YXQ A;  4LY7 A;  3K5N A;  4FM1 A;  1JXE A;  4JI3 K;  4B9S A;  1VQP N;  3VQD A;  3EY1 A;  4JLH A;  3MWP A;  1F21 A;  5I42 A;  1XHX A;  1K8A O;  4IXC A;  4DV5 K;  4M3T A;  4V19 S;  4M3Z A;  2A3Z A;  2HHU A;  2PBD A;  2KTQ A;  3FZK A;  3ULE B;  4EHU A;  2OPS A;  2E2O A;  3U8X A;  4DSE A;  5GAE P;  4CHP A;  2Q0U A;  2P9L A;  3K57 A;  2OTL N;  4CHZ A;  3CPE A;  3QET A;  2P9S B;  1SZ2 A;  3NF6 A;  2HHW A;  3M6G A;  3PY8 A;  2DFE A;  3F9M A;  2P9K B;  2YJE A;  4GVE A;  1SL1 A;  1TGO A;  4FL9 A;  1LW0 A;  4BDZ A;  4DR1 K;  4E19 A;  4FK2 A;  3ZLJ A;  4X66 K;  1WNS A;  4CJV A;  4WFB L;  4ZTF A;  5BN8 A;  1RT3 A;  4JD2 B;  1QZ6 A;  1YVN A;  4LD0 A;  3MXI A;  3ZT1 A;  2FXU A;  2GWJ A;  3OYM A;  3KKS A;  3O9T A;  4GNI A;  3ZSO A;  4H0V B;  4PUO A;  3CER A;  4FWN A;  4B9Q A;  4E0D A;  2VCP A;  3HK2 A;  4W5N A;  4DS5 A;  4JKE A;  3VQ6 A;  3TWH A;  2YNF A;  4DV6 K;  4HUG A;  2HST A;  4KH4 A;  4BC2 A;  5M1P A;  1Z05 A;  4J2B A;  4CZF A;  3WNF A;  4DHY A;  3M8R A;  3KJV A;  1TYQ A;  3MCA B;  1NK0 A;  1DLO A;  2ZM6 K;  2QKB A;  1FXX A;  1JXB A;  1DTQ A;  4CEE A;  3MAQ A;  3S3N A;  1U45 A;  3CM5 A;  1SS6 A;  2D0O A;  1C0U A;  3DRR A;  4IOC L;  1RT1 A;  3FE1 A;  2YNH A;  4JI6 K;  2HNY A;  1C0G A;  3AA3 A;  3L2V A;  4DUZ K;  4FVM A;  5CR4 A;  3T3F A;  5GAG P;  3QBW A;  4CBX A;  3B6O A;  1TL3 A;  1LWE A;  4PKG A;  1C0F A;  2AJQ A;  1RDA A;  2Z1G A;  4ID1 A;  1VSE A;  1HKB A;  2YHX A;  4E1M A;  3SPY A;  4WFA L;  4CJ7 A;  2QWN A;  1Y64 A;  4L3Q A;  4CGJ A;  3T69 A;  1NOY A;  1NM1 A;  4LC9 B;  4AHC A;  2GX9 A;  4CVN E;  3HVT A;  1HYS A;  5AQH A;  4CD3 A;  1RTH A;  1C0T A;  3HOS A;  3CCJ N;  2RKI A;  4BG8 A;  1UA0 A;  4XH5 A;  5C12 A;  4CK3 A;  1VSJ A;  5AQG A;  4DR6 K;  5JS2 A;  1C6V A;  3THW B;  4Z4F A;  2CGK A;  2EWS A;  1NK8 A;  3AGK A;  2HB5 A;  5EOY A;  2P9U B;  3O3F A;  5AQZ A;  2VWK A;  3KLH A;  4J2A A;  2LSN A;  3ZX2 A;  5M1O A;  3QES A;  3QDK A;  4KTZ A;  5AQF A;  4CK1 A;  2BDP A;  3CQY A;  5J2M A;  4OLA A;  5HLF A;  5M1Q A;  5KGX A;  1RTI A;  3T19 A;  1ZBS A;  1S1U A;  1T03 A;  1RNH A;  5SZT A;  3CXC M;  1VRT A;  4H5W A;  3H08 A;  3VEZ A;  4DV0 K;  1L3V A;  2QK9 A;  3NHG A;  3KK3 A;  4H4O A;  1BQN A;  3VMF B;  5IWA K;  1RT2 A;  4M3W A;  4FSV A;  2A6A A;  4DR5 K;  3DYA A;  4BVO A;  3IAY A;  3L2R A;  4K8X A;  1XMO K;  3HTV A;  1ASU A;  2FBV A;  4EFH A;  2GTD A;  2G8K A;  1KXP A;  2O8F B;  4CD1 A;  3LP0 A;  1WSI A;  4CHQ A;  2WTU A;  3P5J A;  3ZSZ A;  3BP8 A;  4GV6 A;  3PUF A;  3CFP A;  4HCB A;  3VQC A;  1TAU A;  2X6N A;  1TKT A;  3M8Q A;  4DF8 A;  4CJE A;  3MED A;  4CI6 A;  4Z94 A;  3IDH A;  2E2P A;  3V6D A;  3VTI A;  3M3Z A;  3IUC A;  4H0P A;  1X1P A;  4BRQ A;  1TL1 A;  4DG1 A;  3FZM A;  4DTJ A;  5GIP A;  3HST B;  4O0J A;  3PO5 A;  3AVK A;  1WAJ A;  3P31 A;  4WQ5 A;  3UIQ A;  2NNW A;  5KRS A;  4U7B A;  4BRK A;  4KHU A;  3U3Y A;  2BE2 A;  5AZJ B;  3HJF A;  3IMX A;  2OA8 A;  3MDQ A;  3H45 C;  3VQ7 A;  1JCG A;  4HHT A;  1LV5 A;  5BR9 A;  3ULD A;  1CZA N;  3MXJ A;  1YAG A;  2KZZ A;  3QLH A;  1NKE A;  5AQL A;  4FM0 A;  1DKG D;  4E3S A;  3LL3 A;  4EP5 A;  1NGA A;  2QWP A;  3OS1 A;  1E4F T;  2ASO A;  3HP9 A;  4MDA A;  1BO5 O;  4QCL A;  3LZJ A;  2XO7 A;  3PX6 A;  4M3X A;  3SI6 A;  4NCB A;  2IIR A;  1ASW A;  1CZ9 A;  4YOX A;  4FWQ A;  3M1F A;  3TTF A;  2I7N A;  4FPB A;  2P9N A;  5LL6 Z;  3MEE A;  4DLE A;  5ADX H;  1NGI A;  5B8H A;  4BR0 A;  4Z4I A;  4JRP A;  1QSY A;  3OYA A;  1JLQ A;  3RVC A;  3O3H A;  1GLA G;  2WUS A;  4CGI A;  4KB0 A;  3K9K A;  1YHQ N;  3KLF A;  3ALY A;  4B1Z A;  2F8S A;  3L8B A;  3C6T A;  3QB0 A;  4IJN A;  4BGB A;  4AF1 A;  3K5M A;  1WAF A;  5DK5 A;  1IBL K;  3IG1 A;  5CE3 A;  4C8M A;  4H0T B;  4CJT A;  5KQD A;  3CIP A;  2KLA A;  3LWM A;  2HHQ A;  5AFU A;  3EZW A;  1S6Q A;  4LF7 K;  2P9P A;  1GLL O;  4WYB A;  5F0X A;  4E7L A;  1RIL A;  1XC9 A;  5AQT A;  1VSK A;  3THX A;  1WB9 A;  1U48 A;  4C8N A;  4AHU A;  3SAG A;  2O8E A;  1DTT A;  1CXU A;  3IFR A;  4A59 A;  4YHH K;  1YI2 N;  3TSQ A;  3HSC A;  4DR4 K;  3C6U A;  2X74 A;  1BIS A;  3GOI A;  5F2R A;  3OJS A;  4E1J A;  3I55 N;  3SQ4 A;  3SPZ A;  2PY5 A;  3CC7 N;  3NAE A;  1CXQ A;  1VSM A;  4AHR A;  3DRP A;  4H5T A;  4ISG A;  1IG8 A;  1Q86 O;  4MLH A;  4WCE L;  5DMR A;  3E01 A;  5JLF A;  4KHP K;  3KWG A;  1EP4 A;  3HOT A;  4M3Y A;  4CFC A;  3C6H A;  1NMN A;  4NB4 A;  1BU6 O;  1ILY A;  1Q9X A;  1VSI A;  4CZG A;  1Z6R A;  4BRA A;  1VSL A;  1XMQ K;  4U67 L;  1Q8I A;  1HYV A;  1U6Z A;  3BF3 A;  5LY3 A;  3UB5 A;  4LSN A;  3D7E O;  3NGI A;  3KK7 A;  3OYF A;  4BWM A;  3ATU A;  4B3T K;  4CGH A;  3VGL A;  4DTP A;  2UUC K;  1VQK N;  3C0B A;  4IOX A;  4F8R A;  4CGD A;  5C42 A;  3KVG A;  1NK4 A;  4CF1 A;  4KTW A;  4X65 K;  3TR8 A;  5FRM A;  1FK9 A;  1RGI A;  4KI4 A;  1IJJ A;  3DWL A; 
#chains in the Genus database with same CATH homology
 4IZ9 A;  4GV3 A;  1EO1 A;  1E4G T;  4FOI A;  3RSE A;  5AQJ A;  2W40 A;  5GAH P;  2HF3 A;  1GLD G;  2PBD A;  5FPD A;  3FZK A;  3ULE B;  2YI1 A;  3WXJ A;  4EHU A;  3CME N;  2E2O A;  3U8X A;  4JK9 A;  2PAV A;  3A0I X;  1VQM N;  4YOR A;  5GAE P;  2E20 A;  1ZC6 A;  3KWI A;  2Q0U A;  2P9L A;  1KC8 O;  1K73 O;  1X3N A;  3CI5 A;  4CZH A;  2OTL N;  5C0Y A;  3CPE A;  2JWL A;  4RTF D;  4O8K A;  2P9S B;  1NGJ A;  1SZ2 A;  2QWM A;  3M6G A;  4BRG A;  4F9O A;  3EE8 A;  3H6E A;  4JKG A;  4JAX A;  3SMP A;  2RHK A;  5GIN A;  3CCR N;  3F9M A;  4OPH A;  3O1W A;  1BDG A;  2P9K B;  2YJE A;  4GVE A;  1XQS C;  3E1Y A;  2P9I B;  4J8F A;  4FL9 A;  1Q18 A;  2HF4 A;  2Q1N A;  3CJ1 A;  3F5T A;  3E9P A;  1JCF A;  3WQT A;  1QQM A;  4BY9 C;  2DPN A;  2YHY A;  1SAZ A;  3CCQ N;  4ILH A;  2D1K A;  5KPZ A;  3GE1 A;  5MLC Q;  1TYQ B;  3G25 A;  4CZI A;  4WFB L;  2HBL A;  5BN8 A;  4JD2 B;  2WFB A;  3CC4 N;  3G6E N;  1BUP A;  4KBO A;  4PHT X;  2QTD A;  1QZ6 A;  1YVN A;  4B1V A;  3KHY A;  2HBJ A;  2FXU A;  1MDU B;  1NGB A;  2GWJ A;  2A40 A;  2FF3 B;  3O9T A;  4GNI A;  4JHD B;  3LDN A;  4H0V B;  3CER A;  4FWN A;  4B9Q A;  2CH5 A;  3H1V X;  4EHT A;  2VCP A;  2AA4 A;  2NRR A;  3ULE A;  5AFU H;  4JKE A;  3WQU A;  5F1X A;  4Y0W A;  2D0P A;  3CJ7 A;  3W3D A;  3R1X A;  4H0O A;  1MA9 B;  4BRH A;  4FO0 A;  4BC3 A;  2A5X A;  4KH6 A;  3H3O B;  4H5R A;  4YDU A;  4BG9 A;  5HOO A;  4CZJ A;  2P9S A;  2HST A;  4KH4 A;  3FLC O;  4BC2 A;  4K43 A;  4FWK A;  3H1Q A;  4JK8 A;  4A2A A;  5M1P A;  2P9K A;  1Z05 A;  4JKC A;  2P9I A;  1D4X A;  4CZF A;  1V4T A;  2ZGY A;  4K41 A;  1GLF O;  2NRW A;  3CCV N;  4DHY A;  1N8R O;  1JJ2 M;  2WBN A;  3BF1 A;  3WT0 A;  2ASP A;  1GLE G;  1TYQ A;  3MCA B;  3SBT A;  4BR9 A;  5JVH L;  3CD6 N;  3O4W A;  4FWL A;  3TU5 A;  3HZ6 A;  4A61 A;  3L4Q A;  2KHO A;  4JD2 A;  3SK3 A;  4RWT A;  4O5F A;  3J8A A;  5KPR A;  1VQL N;  4ISF A;  1YJ9 N;  1SS6 A;  2D0O A;  5M1N A;  3SAH A;  2Q36 A;  5BPN A;  3GBT A;  2WC9 A;  2E8A A;  4JHD A;  3ZYY X;  3DLL L;  4IOC L;  3FE1 A;  3MX2 A;  3AAP A;  5AQI A;  1C0G A;  2ZF5 O;  4PKI A;  4QS9 A;  5AQO A;  5CR4 A;  1QQO A;  2NRX A;  4A62 A;  5AQR A;  5GAG P;  2VYP A;  3QBW A;  5EVZ A;  3GG4 A;  1LOT B;  3IKM A;  3CF5 L;  4CBX A;  4JKD A;  3SMS A;  1YIT N;  5ELZ A;  2F7T A;  5AQW A;  4PKG A;  1C0F A;  1NGD A;  2NRT A;  3B8A X;  5TKY A;  3S41 A;  3WXL A;  4MO4 A;  3VEV A;  3OBW A;  4BRN A;  4IOA L;  4KH5 A;  3O08 A;  1HKB A;  4QS7 A;  3U9Z A;  1VQ7 N;  1YIJ N;  3AY9 A;  4JKA A;  2YHX A;  3PLA A;  1S72 N;  4WFA L;  5H1S Q;  3LDO A;  4CJ7 A;  4K25 A;  5AR0 A;  2QWN A;  1Y64 A;  5AQM A;  4L3Q A;  1Q81 O;  1X9J A;  3T69 A;  2ZGZ A;  1NM1 A;  3CMA N;  4LC9 B;  5DM7 L;  2HBM A;  2GX9 A;  1GLC G;  4B1W B;  3C7N B;  3UKU B;  3HM8 A;  4BC4 A;  5HL7 L;  3JXU A;  4B1Y B;  3A5M C;  5AQH A;  4CD3 A;  4BQL A;  3SAF A;  3FZL A;  3NVK A;  3HOS A;  3HBT A;  3C65 A;  4FWR A;  3CCJ N;  4BG8 A;  4JKH A;  4XH5 A;  4EAH D;  5C12 A;  5AQG A;  3BUZ B;  3H3N O;  3VF4 A;  1QQN A;  2CGK A;  3I33 A;  3O1B A;  3R8E A;  3DXM B;  4BRI A;  2EWS A;  3AGK A;  2QWO A;  3EN9 A;  4OO1 J;  5EOY A;  1YF5 L;  4A5B A;  3FZF A;  3VGM A;  2P9U B;  1WOQ A;  5AQZ A;  1DEJ A;  3O9S A;  4AM7 A;  2FSJ A;  2HBK A;  3SJH A;  3O9Q A;  3ZX2 A;  4GV9 A;  5M1O A;  5AQP A;  2CH6 A;  3QDK A;  1MWK A;  3U4L A;  3ID8 A;  5AQF A;  1YJW N;  4FWO A;  2NRV A;  3CQY A;  1S22 A;  3HRG A;  3ENB A;  5M1Q A;  2YHW A;  1OKJ A;  3OA9 A;  3W0L A;  3CCL N;  1ZBS A;  5E26 A;  3LM9 A;  3N4Q A;  2YJF A;  3T7Z A;  4BRE A;  3I56 N;  3CXC M;  1U2V B;  4H5W A;  3VEZ A;  5M1K A;  1DGK N;  1P90 A;  1VQ5 N;  1NGE A;  1JCE A;  5E84 A;  2VGM A;  5EX5 A;  4FWM A;  4C23 A;  4R79 A;  3PIO L;  3C7N A;  4BQZ A;  3UKU A;  3VMF B;  2QA4 N;  2ZJR L;  3AAQ A;  1R59 O;  5KPT A;  3TTD A;  4FSV A;  2A6A A;  4A2B A;  3K9J A;  3O5B A;  4HTL A;  2E1Y A;  3AAR A;  2YCH A;  4BVO A;  4YOT A;  5BN9 A;  5BRD A;  4I6M B;  1KAZ A;  3DXM A;  3HTV A;  3VEY A;  3ZX3 A;  1ATN A;  5KQ8 A;  1NLV A;  4XH4 A;  1DT9 A;  3VEO A;  4EFH A;  2GTD A;  4AM6 A;  1KXP A;  2P9U A;  2PFU A;  4CD1 A;  4JN4 A;  1W97 L;  3E9O A;  1H1V A;  4YDU C;  4G9Z A;  2ZJP L;  3HI0 A;  3N4P A;  3R6M A;  3TPQ A;  4MDB A;  3CJ9 A;  1TUY A;  5AZI B;  3BP8 A;  3JS6 A;  5DM6 L;  4GV6 A;  1VQ9 N;  4CBU A;  1KQS M;  3OW2 M;  4IO8 A;  4WQ4 A;  3VES A;  3DAW A;  5AQK A;  4NLB A;  1U2V A;  3CCU N;  4CI6 A;  4Z94 A;  3IDH A;  2E2P A;  2UYT A;  3TSU A;  1BA1 A;  2V7Y A;  5AQY A;  3VTI A;  1T6D A;  1RDU A;  3M3Z A;  3UKR B;  3IUC A;  4H0P A;  4BRQ A;  1BG3 A;  4H03 B;  3U9D A;  4BR4 A;  1HUX A;  3GDQ A;  2FF6 A;  1WUA A;  3LDP A;  2HOE A;  3ZET B;  3FZM A;  2Q0R A;  2GEM A;  4FVU A;  1ATS A;  3VEN A;  2E1Z A;  1ZXO A;  5GIP A;  4I6M A;  3MX5 A;  4MLE A;  1K8K B;  3ID6 A;  4IDH A;  4BRO A;  3DJC A;  4IWV A;  2QEX N;  4OPA A;  3ZEU B;  1ATR A;  1YJN N;  4WQ5 C;  1NBW A;  2NLX A;  3O80 A;  3P31 A;  3PIP L;  4WQ5 A;  3CHW A;  1VQO N;  1BWF O;  2NNW A;  3F2K A;  3LDQ A;  4BRP A;  3C6A A;  1X3M A;  2A42 A;  2CGJ A;  3KZB A;  4A5A A;  4CZM A;  1Q7Y O;  5AZI A;  1HKC A;  4ILG B;  1M1K O;  3CPW M;  4U7B A;  1OVY A;  1T3V A;  2V51 B;  4BRK A;  5JVG L;  3CJB A;  1KAX A;  4IJA A;  1M90 O;  1K9M O;  3OHR A;  2GUP A;  5FPN A;  3G4S N;  2E88 A;  3MWT A;  5AZJ B;  3IMX A;  1NJI O;  2CGL A;  3MDQ A;  2P9N B;  2VGN A;  3H45 C;  1JCG A;  1QZ5 A;  2NRH A;  5BR9 A;  2FSK A;  1HJO A;  3QFU A;  4JEP A;  1CZA N;  3L6Q A;  4A57 A;  4CZK A;  4JK7 A;  1YAG A;  3UKR A;  2QWL A;  3CJC A;  3O9R A;  4IEI A;  1ESV A;  3VOV A;  5AQL A;  1DKG D;  3NVM A;  2GEL A;  3D2E B;  3Q7C A;  4GY2 B;  3ZET A;  1NMD A;  2J4R A;  4PKH A;  3LL3 A;  5M1F A;  1KD1 O;  5FPM A;  5AQU A;  1NGA A;  2QWP A;  3A5O C;  3CJA A;  4CZL A;  4BRM A;  1E4F T;  4NO7 A;  2HMP A;  4HWI A;  1K8K A;  1XC3 A;  2E2N A;  2ASO A;  3MN7 A;  3EO3 A;  4FPA A;  1BO5 O;  4MDA A;  3ZEU A;  3O9U A;  1LCU A;  2E2Q A;  2BTF A;  3WXK A;  1NGG A;  3M5R A;  2Q31 A;  5ADX A;  5I9E B;  4B1U B;  3UE5 A;  4H0Y B;  2ASM A;  3FFK B;  4YOY A;  2IIR A;  2GWK A;  3E66 A;  2FSN A;  1VQ6 N;  4YOX A;  2P9P B;  3DXK B;  4FWQ A;  4PL7 A;  5AZJ A;  3M1F A;  3TTF A;  2I7N A;  3EKU A;  4FPB A;  2P9N A;  4BR5 A;  3MN9 A;  4YOV A;  1QVG M;  4XEI A;  5ADX H;  3VER A;  2F9W A;  3D2F B;  2QXL A;  1NGH A;  1NGI A;  5B8H A;  4BR0 A;  3EE9 A;  3CCM N;  3CCS N;  3CQX A;  4H5N A;  2I7P A;  5EY4 A;  3RVC A;  3VTH A;  2D4W A;  1GLA G;  2WUS A;  1QVF M;  1Q82 O;  4RCH A;  3K9K A;  3VEW A;  1YHQ N;  3D2E A;  3QIC A;  3MN6 A;  2IVN A;  5AQS A;  3VF2 A;  2H3G X;  4DB3 A;  3A5L C;  4B1Z A;  1HX1 A;  1RDW X;  5C10 A;  2VWB A;  3OBY A;  1T44 A;  3MMV A;  3QML A;  4JKF A;  1P8Z A;  2OTJ N;  3ENO A;  3QB0 A;  2IVP A;  2QM1 A;  2BUP A;  4IJN A;  4BGB A;  4AF1 A;  3AGR A;  4MO5 A;  1VQ8 N;  3QBX A;  4H0X B;  5C15 A;  1YUW A;  4BR7 A;  1VQ4 N;  2FLO A;  4BRL A;  4BGA A;  5LJW A;  5CE3 A;  1BOT O;  3VET A;  5LJV A;  2F9T A;  5CHI A;  3Q7B A;  4H0T B;  5AQN A;  3ZX0 A;  5KQD A;  3CIP A;  1HLU A;  2KLA A;  3R3L A;  5AFU A;  3EZW A;  3WXM B;  2P9P A;  3DXK A;  1KAY A;  1NWK A;  4ILJ A;  3E9L A;  1GLL O;  3EL2 A;  4WYB A;  5F0X A;  4NLC A;  3FGU A;  1NGC A;  4WQ4 C;  4H5V A;  4JNE A;  2KKZ A;  5AQT A;  3VF6 A;  1V4S A;  3D2F A;  2JWK A;  4DKW A;  5EXW A;  3ATV A;  2Q97 A;  4IO9 L;  2QW9 A;  3SLC A;  3TTC A;  3WUH A;  2ZJQ L;  2Q2R A;  3QFP A;  4FOE A;  5TKW A;  3SAG A;  3O8M A;  3G71 N;  2QWR A;  3CET A;  3A5N C;  4C1N K;  4IFE A;  2YX6 A;  3IFR A;  4A59 A;  3I8B A;  2QI2 A;  3TSQ A;  1YI2 N;  3HSC A;  5FPE A;  2NRZ A;  1MWM A;  3NMU A;  4FWP A;  2QWQ A;  5AQX A;  1GLB G;  3L4I A;  3BEX A;  3GOI A;  5F2R A;  4E1J A;  3I55 N;  3CC7 N;  5C2F A;  1TUU A;  5GAD P;  1GLJ O;  4UY8 O;  4M63 C;  5BRH A;  4QS8 A;  2BH1 A;  4H5T A;  3GL1 A;  1BA0 A;  4ISE A;  4ISG A;  4M7Y A;  4IEE A;  1IG8 A;  3P39 A;  5BPM A;  1S3X A;  4B1X B;  2NZT A;  4O8U A;  4M7X A;  1Q86 O;  3SBG A;  4BR2 A;  4BC5 A;  4YOW A;  4EIA A;  1G99 A;  4MLH A;  4WCE L;  4FWS A;  3WEE B;  5JIC A;  5JLF A;  3KWG A;  3HOT A;  3CCE N;  1HPM A;  3LM2 A;  5GIO A;  5BRF A;  5BRE A;  4K42 A;  3C6H A;  3LDL A;  4XH1 A;  3RSE B;  4PL8 A;  3CC2 N;  3MK6 A;  4NB4 A;  1BU6 O;  1ILY A;  3FR0 A;  5AQQ A;  3TSP A;  4CZG A;  1Z6R A;  4BRA A;  1O13 A;  2OAN A;  4U67 L;  5LY3 A;  1QHA A;  4BRD A;  1U6Z A;  2P9L B;  4DQ8 A;  4BVP A;  1EQY A;  3BF3 A;  1VQN N;  5C2D A;  5BPL A;  2AP1 A;  1RFQ A;  3UB5 A;  3D7E O;  3VGK A;  3KK7 A;  4C1N I;  3MN5 A;  3FZH A;  3L0Q A;  2IVO A;  3ATU A;  3VEX A;  4JKG B;  3ENH A;  3H46 O;  4JKB A;  4WFN L;  1XUP O;  3R9P A;  2ZWH A;  3VGL A;  3WXI A;  3P38 A;  2ITM A;  1HKG A;  2A41 A;  1VQK N;  3C0B A;  2V7Z A;  3O6W A;  2W41 A;  5AQV A;  2V52 B;  3A8Y A;  4IOX A;  3J7Z O;  4CBW A;  4BRF A;  3KVG A;  3VPZ A;  1T6C A;  1YXQ A;  3P4I A;  1NGF A;  1VAZ A;  5JLH A;  5JMV A;  3D6R A;  1VQP N;  2RE2 A;  4WF9 L;  1W2B M;  3MCP A;  3MWP A;  1K8A O;  3WEE A;  3EKS A;  4IXC A;  1RGI A;  1SQK A;  1IJJ A;  1J6Z A;  3DWL A;  4DCH A;  4BRC A;  2A3Z A;  4YOU A;  4CZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...