2E2NA

Crystal structure of sulfolobus tokodaii hexokinase in the apo form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
298
structure length
298
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 109
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2nA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2nA01
1GLCG 5JLHA 2NZTA 3H45C 3J8AA 3M1FA 4BQLA 2GWJA 5BN9A 4BR0A 4B1UB 3CJ1A 4J8FA 2HOEA 5FPDA 3VF4A 5AQJA 3BF3A 3VETA 4BR7A 1NMDA 3LDQA 3O1BA 3DAWA 4HWIA 4EIAA 5BPLA 1TUYA 3FE1A 4WQ4C 2AP1A 3UKUA 1NGEA 3MN9A 3DXMA 4A61A 5AQLA 2IVNA 2I7PA 1YUWA 3ZEUB 2FF6A 3VENA 3WXIA 4E1JA 3HI0A 3A0IX 3QB0A 4FWPA 4F9OA 1U2VA 3WXKA 3GE1A 3LDOA 4BRIA 3GOIA 2GWKA 5AQKA 3U9DA 3C0BA 3FZHA 5BRHA 2IVPA 2Q1NA 4CI6A 2CGJA 3UKUB 4BC3A 3WQTA 2V7YA 2ZWHA 5AQRA 2A42A 1V4TA 2Q0RA 3CJ7A 3U9ZA 4PL7A 2P9LA 4BG9A 5AZJA 5JICA 4EFHA 1JCGA 4A62A 5ADXH 2A5XA 1U2VB 4BRQA 4CZMA 3D7EO 2Q31A 2QW9A 3QDKA 4XH5A 3VGKA 4A2BA 2EWSA 4CD3A 1E4GT 4PL8A 3MMVA 4BVPA 5AQVA 1RDWX 5AQGA 2QWOA 3VEOA 1KAYA 3I33A 4JN4A 3CI5A 1HKCA 4YDUC 5AQHA 1BA1A 1NM1A 4CZEA 4CZKA 5LJVA 4FOIA 1NGCA 1BWFO 5AR0A 1RFQA 5AZIA 4L3QA 4K42A 3LM9A 4DHYA 2QXLA 3VERA 1NGBA 1MWKA 1J6ZA 5AQSA 2WUSA 4RCHA 3EKUA 2V52B 3UE5A 3CJAA 1BO5O 2P9PB 3O4WA 3S41A 4FWRA 1HKGA 4BRMA 2GEMA 5ELZA 3GBTA 3OHRA 4FWLA 5KPRA 3QBWA 1YXQA 1GLLO 3FZLA 1HLUA 5AZIB 1NGIA 1G99A 4H0TB 1QZ5A 5AFUH 5JMVA 3WEEB 3MCPA 1GLFO 3DXKB 1NGJA 4IO8A 3GDQA 4NB4A 1ZBSA 4BGAA 4EHUA 3EKSA 4M63C 5F0XA 1NLVA 1S3XA 2CGLA 4Z94A 3AARA 1NGDA 4JNEA 2W41A 3O80A 4B1ZA 3FZMA 2Q2RA 2YHYA 2CGKA 2F9WA 2CH6A 4WQ4A 1QQOA 3ENHA 2ITMA 2D4WA 2QWPA 1MDUB 5KPTA 2ASOA 1QHAA 3WXJA 2E8AA 3ZX2A 3L6QA 4WYBA 1SQKA 3P4IA 4EHTA 1IJJA 2NRHA 3VEZA 3ID8A 3ATVA 4CZHA 4A2AA 4CBWA 1GLBG 3ZETB 3R8EA 4DB3A 5LY3A 3CJ9A 4JD2A 3VEXA 2FSJA 3MN7A 5AQXA 4M7YA 3EZWA 1X9JA 4KBOA 4BREA 1ZXOA 5BREA 2ZGZA 1SZ2A 1MA9B 3HSCA 3CJBA 4CZFA 2P9NA 3KVGA 4FWMA 3SMPA 3H1VX 2E2NA 4BRHA 3O08A 3CHWA 2E20A 1OKJA 5FPEA 3D2EA 3CERA 4Y0WA 5AQTA 3AY9A 1V4SA 4H0YB 3UKRA 3KZBA 1T44A 2P9IA 4QS7A 4BRDA 4CZGA 2CH5A 2KHOA 4B1XB 4RWTA 2D0OA 2FXUA 4B9QA 1LCUA 5AQZA 3RSEA 2A3ZA 2HF3A 3B8AX 3C7NA 4FL9A 5BR9A 5JLFA 2VCPA 1XQSC 3DXMB 4JHDA 4MLHA 2IIRA 1NBWA 1SAZA 2DPNA 4FPAA 3CETA 4IJNA 2PBDA 4BVOA 2BUPA 3EL2A 4MLEA 3VEYA 4B1WB 4WQ5A 3MDQA 3A5LC 3MN6A 2I7NA 3QMLA 1C0FA 2E1YA 2P9IB 5LJWA 4BR9A 2GELA 5E84A 3VEVA 2P9KA 2Q0UA 3W0LA 4QS9A 5AQQA 4HTLA 2ZF5O 3FZFA 4XH4A 3LDPA 1GLAG 3KHYA 4JAXA 3D2FA 3O5BA 2P9LB 5I9EB 5AZJB 1BOTO 1BA0A 5AQNA 3ZX0A 3JXUA 4BRFA 1ATSA 1MWMA 2V51B 3AAPA 2A40A 5FPMA 3R6MA 1H1VA 1DGKN 3VESA 5E26A 2P9KB 1K8KA 3JS6A 5F2RA 4PKHA 1R59O 2E2QA 3VF6A 1KAXA 4IJAA 3VGLA 3VOVA 3O1WA 3D2FB 2J4RA 4FWSA 3SMSA 3WUHA 1NGHA 3WQUA 1YVNA 1BG3A 1TYQA 2D0PA 4DCHA 3FLCO 3H3OB 5KQ8A 4EAHD 1NGGA 3I8BA 2P9SA 2A6AA 1QQMA 5AQPA 2F9TA 2AA4A 3CQYA 1K8KB 2HMPA 4BROA 3LDNA 4FPBA 4BRCA 2W40A 2P9UA 2Q36A 5AQMA 1Z6RA 3CQXA 4CJ7A 4ISEA 5B8HA 4PKGA 4FO0A 4O8KA 1ATNA 3ULEA 4O5FA 2ASPA 3O6WA 4H5WA 5AQIA 4B1VA 2FSNA 5KQDA 4PKIA 1BU6O 1JCEA 2HF4A 3BEXA 1D4XA 2E2PA 3H46O 5ADXA 3GL1A 4M7XA 4H5RA 1ESVA 3U8XA 2V7ZA 1BDGA 3UB5A 1HUXA 1T6DA 2FSKA 4BRGA 4ISGA 4GY2B 2BTFA 5AQWA 1YAGA 4XEIA 3SLCA 3ZX3A 5AQFA 5BRFA 2QWRA 3F9MA 4GNIA 4CZLA 2E2OA 1HPMA 3ULEB 1WOQA 5FPNA 1U6ZA 3VPZA 5BPMA 1GLJO 4BRPA 3IUCA 4BC4A 4H03B 2QM1A 1NGFA 2QWNA 1NWKA 3ZEUA 4MO4A 4BRLA 3FZKA 4K43A 4FOEA 4DQ8A 3VEWA 2QWMA 4ISFA 2VWBA 2NLXA 2YJFA 1IG8A 2YI1A 1GLEG 5EXWA 1Q18A 4BG8A 3ATUA 3HM8A 4JD2B 4XH1A 2ASMA 3HTVA 4IXCA 3SJHA 5BN8A 5AFUA 4AM7A 4YDUA 5KPZA 3QBXA 1JCFA 2P9NB 2PAVA 3M6GA 4H0PA 1X3MA 3FFKB 1EQYA 4BR5A 2FF3B 1X3NA 3D2EB 2A41A 4H0VB 4C23A 1RGIA 4NO7A 1HKBA 3UKRB 3EO3A 2FLOA 3GG4A 4QS8A 1KAZA 1HX1A 2YHWA 1C0GA 2E88A 3RSEB 3R9PA 3C7NB 3HZ6A 4BGBA 1QZ6A 1HJOA 4JHDB 3W3DA 2QWQA 4I6MA 3VF2A 4AM6A 1P8ZA 3LM2A 5EOYA 3WT0A 3WXLA 4CZJA 1BUPA 2OANA 2H3GX 1QQNA 3FR0A 2D1KA 5CE3A 1Y64A 3CIPA 4CBUA 4LC9B 5BPNA 4BQZA 3BF1A 3A5OC 3O8MA 3M3ZA 2YHXA 1TUUA 4K41A 3TU5A 3U4LA 2GUPA 2P9PA 3CJCA 1ATRA 1KXPA 3G25A 3LL3A 1CZAN 3VGMA 1DEJA 1WUAA 4I6MB 3IFRA 3QFUA 2IVOA 4BRKA 4CBXA 1LOTB 3A5MC 4WQ5C 2VYPA 4BC5A 2E1ZA 3AAQA 3H1QA 5EY4A 3WEEA 2YCHA 4FSVA 5AQYA 3HBTA 3A8YA 3DXKA 3DJCA 5BRDA 3H3NO 3BP8A 5EVZA 4H5NA 1XC3A 1GLDG 3ENOA 4IWVA 2UYTA 4B1YB 3EN9A 4MO5A 3FGUA 3A5NC 4H0XB 3MN5A 4BC2A 4BR2A 5AQUA 2GTDA 1TYQB 1E4FT 2Q97A 4BRAA 3QFPA 4FWQA 1T6CA 1NGAA 2ZGYA 3L0QA 2P9SB 2YJEA 3TPQA 5F1XA 3L4IA 4K25A 2QWLA 4IZ9A 4H5VA 3BUZB 4RTFD 3ZETA 2P9UB 5TKYA 3SK3A 5EX5A 4H5TA 1DKGD 1S22A 3H6EA 1Z05A 4BRNA 3IMXA 1ZC6A 3DWLA 4FWKA 4FWOA 4H0OA 5AQOA 1XUPO 3IDHA 4CZIA 4CD1A 4FWNA 3QICA 4BR4A 3MK6A 3LDLA
chains in the Genus database with same CATH superfamily
1S9GA 4YY3K 1E3MA 4FJMA 4BQLA 2GWJA 4BR0A 4F2SA 3CJ1A 3V81A 3VETA 4ILHA 1T03A 1VQ4N 1NU0A 1VQ8N 3LDQA 3O1BA 3DAWA 4EIAA 1TUYA 3FE1A 3CC7N 3UKUA 3MN9A 3DXMA 3LAMA 3SUQA 2I7PA 1YUWA 4FJJA 3ZEUB 4E0DA 1S1WA 5IT9O 1JLGA 4E7LA 4I2QA 3AGKA 2OPPA 4U67L 1NK6A 2FBTA 2KZZA 3LP1A 3ALYA 3U9DA 3OS0A 3FZHA 3LP3A 5C0YA 2P5OA 5M1NA 2G8HA 1J53A 5GINA 3WQTA 1C1BA 2GV9A 4B3OA 2A42A 4BWJA 3AGRA 5AZJA 5ADXH 3SAGA 4KFBA 2A5XA 1U2VB 4BRQA 4W5NA 1NK9A 4CZMA 2QW9A 2NRVA 4XH5A 3VGKA 3V9SA 4FZZA 4GVEA 4CD3A 1J5OA 2KLAA 5AQVA 3SI6A 4ILGB 3PX0A 4DTPA 1RILA 3ZSWA 3TWHA 1KAYA 3I33A 4I7FA 1HKCA 4YDUC 1U4BA 5MLCQ 3CFOA 2OZMA 4B3MK 3E9OA 3RVCA 3TTFA 4LF8K 1IKWA 4K42A 4KTWA 3LM9A 4E89A 2QXLA 3VERA 1O1WA 3ZSRA 3JSMA 4KKOA 5DM6L 1J6ZA 3EKUA 4E1MA 4FLUA 4DFPA 1VQ9N 2I5JA 3RMDA 1QSYA 4BRMA 1HNIA 4CEZA 1TK8A 1RTDA 3V9WA 3GBTA 1YXQA 1GLLO 4F8RA 3FZLA 5AZIB 1G99A 4GVMA 5AFUH 2X74A 4KRFA 4LH5A 3MCPA 3O9SA 2F96A 1NGJA 4Y1DA 3I0SA 4N56A 3E66A 5C25A 3EKSA 4FJ9A 1J54A 1XHZA 4LH4A 3BDPA 1DLOA 1S3XA 3AARA 2F8SA 3ZCMA 1KD1O 1QSSA 2CH6A 4ICLA 1K8AO 1QQOA 2QWPA 4CIGA 2ASOA 1QHAA 4FLTA 2E8AA 2HHTA 2EX3A 4WYBA 1SQKA 2PYLA 3ZSQA 3RMBA 4CFAA 4EHTA 1RBUA 3E9LA 4JKBA 4CZHA 4A2AA 4Z0UA 4CBWA 3T3FA 3EEQA 3TR8A 4FLVA 1BHLA 1S1UA 3R8EA 2YNIA 1HJRA 1VRTA 2E6LA 3VEXA 3MN7A 5AQXA 3EZWA 1X9JA 4LSNA 4ID1A 3NGYA 4EP5A 4CESA 1SZ2A 3HSCA 4CZFA 5FLXO 4FWMA 3SMPA 3RR8A 1HNZK 1OKJA 1NG9A 1D9FA 4LFBK 4H0YB 4CEDA 4QS7A 1FKOA 2D0OA 1OVQA 4JI4K 1EX4A 3HJFA 4JV5K 4YOXA 1NOZA 1XQSC 3DXMB 4JHDA 4OX9K 2G8IA 4IJNA 3NBPA 1TAUA 4FJLA 2IDOA 4JI5K 4DF8A 3SCXA 4BVOA 2RN2A 3AVGA 4BE0A 4IFEA 4WE1A 4JRPA 3A5LC 3QMLA 4KH4A 2GUIA 4ZHRA 2E1YA 1RNHA 3VEVA 1TL1A 1ZBHA 2AJQA 4I2PA 3W0LA 4QS9A 4XH4A 2HHVA 3LDPA 1GLAG 4DFJA 3F9KA 5AZJB 2UXDK 3JAMO 1HNXK 3CCJN 1BA0A 3JXUA 1VQKN 4IOXA 4CHOA 3AAPA 1IBKK 3T7ZA 1N34K 3THXA 2P9KB 3JS6A 5F2RA 3KJVA 3TAMA 3PUFA 4O0JA 1IG9A 4F2RA 5J2PA 3VGLA 3VOVA 1TKTA 2J4RA 1X9MA 3VA0A 1NK7A 1DT9A 1YVNA 4O8UA 1M1KO 4HCBA 2D0PA 4FVUA 2HMIA 3ZT4A 2YX6A 2HW3A 3FLCO 3H3OB 1YITN 5KQ8A 2OPQA 4EAHD 2P9SA 3KLFA 2QKKA 1IKYA 3F5TA 1K8KB 4BROA 2W40A 1VQ6N 1ATNA 1VSIA 4O5FA 4H5WA 5AQIA 1BL3A 4I9QA 4C8OA 4OJRA 3KIOA 1D4XA 4KHNA 4WFNL 1ESVA 3O9QA 3U8XA 4J2AA 2VQFK 3UB5A 1VQON 1BISA 1UOCA 4GY2B 3PO4A 1VSKA 1VQNN 1JLAA 4Z4HA 2BGGA 2BE2A 4KHQA 3J80O 1LV5A 4ILJA 1HPMA 1LWFA 2UXCK 3OYEA 4BRPA 4CHYA 1XNRK 3IUCA 4BC4A 2QM1A 1NWKA 1HNWK 3KTQA 4WCEL 1B9FA 3VQ7A 3FZKA 3IAYA 2XY8A 4LFAK 4DQ8A 2QWMA 4DFKA 4ISFA 2D5RA 2VWBA 1NOYA 2YJFA 2YI1A 3EYZA 1GLEG 3IRXA 3ATUA 4OKKA 3NGZA 2OTLN 4JI6K 3HO1A 2G8UA 4IXCA 5BN8A 1QVGM 1RBRA 4AM7A 4CF9A 4OLBA 3WNFA 3SBTA 4FW2A 3CFPA 1EQYA 1J5EK 3F73A 2A41A 1W97L 4CGGA 4DTSA 3B6PA 4H0VB 1IBMK 3SZ2A 3DLKA 4KREA 3GG4A 5JS1A 4OPHA 1N6QA 2YHWA 4MFBA 4JKHA 3R9PA 2O8EA 3HZ6A 4BGBA 3C6UA 1QZ6A 1HJOA 4JHDB 3W3DA 3PO5A 1P8ZA 3WT0A 3WXLA 2W6LA 3AVNA 5KGXA 1LW0A 4CF1A 3MAQA 4W5QA 4DR6K 1Y64A 3CIPA 4CBUA 3I56N 1L3UA 2F8TA 3A5OC 4JKGA 3M3ZA 2VGMA 4K41A 2FBXA 3P5JA 2QKBA 3EE8A 4C8NA 3HK2A 1NK5A 3NMUA 1CZAN 3V9UA 1W7AA 1VQPN 1DEJA 4I6MB 3QFUA 1ITGA 3UIQA 3CFRA 1LOTB 1L3SA 2W42A 5C15A 3SYZA 2O4GA 2VYPA 4BC5A 3KK3A 2Y1IA 4JK7A 1S1XA 4DF4A 3THYA 3DXKA 4R79A 3BP8A 4A5BA 1NJYA 3HP6A 1XC3A 3THXB 5KI6A 1W2BM 3ZT1A 2RKIA 2UYTA 2Z1IA 2KKZA 4X65K 3FGUA 3RTVA 4CJ4A 4BDZA 3AA2A 3TAQA 3AO4A 3KLGA 4BR2A 3ZSZA 2HBJA 3BZCA 1E4FT 2Q97A 4WFAL 1IBLK 2P9SB 5F1XA 4O55A 2QWLA 3K5OA 4H8KA 4BE2A 5SWMA 4IFYA 3OYMA 5GAHP 1U04A 1XMQK 2HVIA 2HBMA 4DQIA 4DV4K 4AQYK 1DKGD 1GOAA 1KVBA 4CGIA 4FW1A 4BRNA 1REVA 1ZC6A 4U7BA 5M1OA 4Y1CA 2HNZA 2D0AA 3QINA 3KLHA 4M3WA 5JLHA 2NZTA 4IG0A 1A5WA 1TVRA 4A5AA 4B1UB 4J8FA 5FPDA 2EHGA 2HOEA 2Z1JA 1TKDA 1ILYA 3BF3A 4BR7A 3S3MA 2O4IA 4LF6K 1EWRA 5BPLA 4WQ4C 1NJZA 1SV5A 1N5YA 4BWMA 1JLQA 2FF6A 4BY9C 3HI0A 2HHUA 1U2VA 3WXKA 2HHSA 3OTOK 3LDOA 3QERA 4PUOA 4FCYA 4B3TK 3C0BA 1S9EA 4DR3K 3SQ2A 3CCEN 2IVPA 3KK1A 1NJIO 4CI6A 2E6MA 4BC3A 1O13A 1V4TA 2Q0RA 4OLAA 3KK7A 3AVHA 4JK9A 5JICA 1UAXA 1NJWA 3HRGA 4DV3K 3KK2A 2DFEA 1QTMA 2Q31A 2ZJQL 2EWSA 3KKSA 3B6OA 3R3LA 3HOSA 1BI4A 5AQGA 1C1CA 2QWOA 4RW8A 3OYCA 3U3GA 4OPAA 1NM1A 2IGIA 2O8EB 1XC9A 4WFBL 4Z4IA 2Q3SA 1C0MA 5AZIA 4FLXA 2YKNA 1TK0A 4L3QA 4CVNE 5KRSA 1JXEA 3TAPA 4RG8A 4JS4A 5J2QA 4JKGB 4RCHA 1OH5A 3LWLA 5LMNK 3N4QA 3UE5A 3CJAA 3HT3A 2D0CA 4FWRA 3LWMA 2Y1JA 3L3VA 3SBGA 5K14A 5ELZA 3C6HA 1OH7A 3QBWA 1S1TA 5DMRA 4BACA 3CD6N 3MCAB 3P39A 1EO1A 2RF2A 4H0TB 3DRPA 4FJ7A 1SUQA 1VSEA 3L2UA 3TANA 1GLFO 1ASVA 3THYB 3DXKB 3VQ5A 1KCFA 4IO8A 1JXBA 4HUEA 1RDUA 1ZBSA 1KQSM 4FM2A 4F3OA 3MWTA 5F0XA 3TSQA 3OYIA 3TAEA 2CGLA 4AHCA 4Z94A 4KHSA 3DI6A 3WNEA 1NGDA 4JNEA 3AVFA 1WAFA 1FKPA 5CYQA 3L3UA 2CGKA 2F9WA 3NHGA 2D4WA 5HP1A 3V9ZA 1T3VA 3L6QA 4LD0A 3VQ9A 5CZ2A 3P4IA 1JLCA 1D8YA 3O9RA 4DV6K 2NRHA 3ENBA 3VEZA 4CGHA 1T05A 3O3FA 1IKVA 4YOTA 1EWQA 3I8DA 1HQEA 3E1YA 2JGUA 1QSLA 4BREA 1RDAA 2ZGZA 5J2MA 3SAFA 1SL1A 3KVGA 1NKCA 3H1VX 5EU7A 2E2NA 3G4SN 2O8CB 3CHWA 1KVAA 1RDDA 4CJEA 3N4PA 4OVLA 1V4SA 3KZBA 1T44A 4W5TA 4BDYA 3ZSYA 4BRDA 2KHOA 4B1XB 3KWIA 4RWTA 3J7YP 4M3ZA 3H08A 5AQZA 4GKKK 4MDBA 3NF9A 1VSDA 3AO2A 5BR9A 5JLFA 3NDKA 3CQ8A 2VCPA 4MLHA 4M3YA 3DLHA 2G8FA 2IIRA 2DPNA 4FPAA 4CJSA 2HHQA 4C8MA 1FJGK 1TV6A 2PBDA 3EL2A 3SUPA 3VEYA 3KD1E 2P9IB 3O3HA 2YNGA 2GELA 4BR9A 4B9MA 2YNHA 2P9KA 2Q0UA 3CC2N 5AQQA 4HTLA 3I55N 2YHAA 4J2BA 4DTRA 4B9UA 3OYGA 3ZSXA 2P1JA 1NK4A 3SUNA 1BOTO 1MU2A 4K8ZA 2HBLA 1ZYQA 3M8SA 5AQNA 2UUBK 2WBNA 4BRFA 4C1NK 3D45A 4IO9L 1H1VA 1DGKN 1BI4B 1K8KA 5D3GA 4FLYA 3TAGA 3OVNA 3I0RA 3VF6A 1LWEA 4IJAA 3O1WA 3IS9A 5C24A 3PLAA 3TI0A 3KLIA 4B9NA 3SNNA 4KH6A 4CJ5A 4DCHA 3I8BA 3RWUA 3OYBA 4N5SA 2F9TA 2WC9A 5J2NA 3TTCA 4CIFA 4FPBA 5FRNA 2ZJPL 4CJ7A 4CIEA 4HUGA 4YNQA 2ASPA 4OGCA 5I3UA 1IKXA 1WSEA 1NK8A 1JCEA 1LW2A 1VK0A 3Q7BA 4DFMA 4CF8A 4KHYA 2E2PA 5ADXA 3RRHA 3GL1A 1ZBFA 1M90O 2QK9A 1Z26A 1BIUA 3S3NA 1BDGA 1Q9XA 2Z1GA 1HUXA 1T6DA 2FSKA 3TAFA 3L8BA 2BTFA 5JVHL 3OBWA 3Q7CA 4XEIA 3AVAA 3SLCA 5GIPA 3F9MA 4DTNA 4CZLA 4FM0A 4ZTJA 4MQ3A 1U6ZA 4LFCK 4O44A 3KLEA 5CHIA 4AHUA 4KPYA 2HHHK 4B9VA 3L2VA 2XY6A 2GBZA 4YOVA 3CCUN 2HSTA 3LPUA 4BRLA 1VAZA 3PV8A 4E7JA 1FW6A 4X66K 2A1SA 1S6QA 4IBNA 3HP9A 1QVFM 4RW4A 1Q18A 4DV2K 4B9LA 4XH1A 2ASMA 1JJ2M 4CJPA 2ETJA 5AFUA 3DLGA 2PAVA 3DLBA 4PQUA 4FK0A 1JL1A 3HOTA 3IG1A 4CFCA 1YT3A 2BDPA 4HTUA 3FFKB 4CK3A 3HVRA 2XO7A 3DOKA 5KGWA 4QOZB 4KB0A 3AA3A 4DS5A 1TGOA 4NO7A 1HKBA 1RT6A 3PSIA 1WN7A 2UXBK 1WNSA 4I6MA 3LM2A 5EOYA 4JS5A 4CZJA 3WNGA 1JLEA 2A1RA 3CCSN 5JS2A 4F4KA 4LC9B 5BPNA 3O8MA 1C6VA 2YHXA 2WOMA 3TU5A 3TTDA 4CFBA 2GUPA 2P9PA 1U48A 1ATRA 4FVMA 1KXPA 1OH6A 3G25A 3LL3A 1S5JA 4DQRA 1N32K 1KRPA 4GKJK 3OBYA 1WUAA 3IFRA 4E3SA 2IVOA 4BRKA 4CBXA 3A5MC 1VSLA 2DTUA 3PX4A 5EY4A 3WEEA 2YCHA 3BY5A 3VMFB 3A8YA 1RT1A 3H3NO 3MXIA 1LAVA 4JI3K 3ENOA 4M3XA 4CHZA 1S1VA 4CJTA 3IKMA 1VQ5N 2VG5A 1NMNA 4DTJA 5AQUA 3OJUA 2VWKA 3T1HK 1T6CA 3MEEA 2ZGYA 2YJEA 2O8DA 4AHTA 3AVJA 4IZ9A 4CECA 4KTZA 3KD5E 1KFDA 3BUZB 4BDPA 1CXQA 3AVLA 3NVKA 4TSXA 1WBDA 2X6NA 4H5TA 2HBKA 1S22A 4CHNA 1C0TA 2YNFA 1Z05A 1W0HA 4O4GA 3AVMA 3IMXA 3DWLA 1XUPO 5CR4A 4BR4A 3QICA 3LDLA 5T7BA 2F4VK 3H45C 3J8AA 4O5BA 3M1FA 5BN9A 1YI2N 5C2DA 3VF4A 5M1KA 3P38A 3TSUA 1YJ9N 4DSEA 3NFAA 3QO9A 2AP1A 1NGEA 4KHPK 5AQLA 1QS4A 3LALA 3VQBA 3VENA 3WXIA 4E1JA 3A0IX 2LSNA 3RRGA 3ZT3A 3GE1A 1RCHA 4LSLA 4BRIA 5AQKA 1XNQK 3SUOA 3V4IA 1JLFA 4RW9A 4JKDA 1P90A 4DTUA 4DS4A 1QE1A 3EE9A 1ASWA 5HLFA 2V7YA 3VQ8A 1U45A 3U9ZA 1YJWN 3CJ7A 4N41A 2KQ2A 4BG9A 1Q8IA 3VTHA 1JCGA 4EFHA 4FM1A 3PY8A 1N33K 1F21A 3K5LA 4JI7K 1BQNA 3AA5X 3D7EO 4IFVA 2BANA 4DV7K 2RE2A 4A2BA 3L2RA 1E4GT 4CJRA 4PL8A 3MMVA 4ZTFA 4BVPA 4E7KA 1RDWX 3VEOA 3OYHA 2VG6A 4JN4A 4NYNA 5AQHA 1BA1A 4CZKA 4C8KA 5E41A 5LJVA 3C94A 3HM9A 2ZJRL 4FYDA 5C10A 1RT5A 4MDAA 4DHYA 4DLEA 1NGBA 4CEOA 2B5JA 3BGRA 2V52B 2P51A 3ULDA 4W5OA 1VQMN 4CF2A 2OA8A 1BO5O 2P9PB 3O4WA 4JEPA 3S41A 1KLNA 3G10A 1HKGA 5IWAK 3DM2A 3NH1A 2OTJN 2IOCA 3M5RA 4FWLA 1NGIA 4QAGA 3FFIA 3NH0A 1IH7A 5JMVA 3WEEB 2HB5A 4FJ8A 3OYLA 2PFUA 3K9JA 1GOBA 1Q7YO 1EP4A 4BGAA 4YORA 3K9KA 3WXMB 3QEXA 4EHUA 1RTJA 1G15A 2NNWA 2XY7A 4B9SA 3OW2M 2B6AA 2Q2RA 1RT7A 3ENHA 2ITMA 3SV4A 3J7ZO 4X62K 1X1PA 3WXJA 2O8CA 2O8DB 3VQEA 4L8RB 2WTUA 3ID8A 4LF9K 3ATVA 3QNNA 3QNOA 2OPRA 1SKRA 1YVUA 4CJVA 5C42A 3C65A 4Q0BA 3CJ9A 3K57A 1HRHA 1T7PA 5BR8K 3K59A 3OYAA 1Q82O 4KBOA 1ZXOA 5BREA 4CEBA 2HVHA 1MA9B 2P9NA 4ELVA 4HVJA 3VQDA 3O4NA 3O08A 4A59A 1XWLA 1VSJA 2PY5A 2E20A 4A57A 3J81O 3D2EA 4Y0WA 3AY9A 3T1AA 2P9IA 1XI1A 2CH5A 2FXUA 4B9QA 4EZ6A 1LCUA 1WSGA 3DLRA 2A3ZA 2HF3A 2X6SA 3B8AX 3C7NA 4Z4FA 4YOWA 4I9LA 3CPWM 3S3OA 3CETA 1DTTA 3OYKA 4LF4K 2O8FB 2JLEA 4GW6A 4JLHA 4JI2K 4MLEA 4B1WB 4WQ5A 1K9MO 3G71N 3MDQA 3PIPL 2I7NA 5LJWA 3DRSA 4JKEA 1NKEA 3FZFA 3E01A 2NRZA 2OPSA 3VA3A 5I9EB 3RR7A 3CCVN 1C1AA 1ATSA 1VSFA 2V51B 3TSPA 4DTOA 5FPMA 3NF8A 3R6MA 5E26A 1RBVA 3QLHA 2E2QA 4DQQA 3D2FB 1K73O 1QQCA 3WUHA 3SMSA 1UA1A 4IEEA 4IEIA 1BG3A 2G8VA 1KLMA 1VQLN 4ELTA 4IDHA 1J9AA 4DSKA 2A6AA 1QQMA 5DK5A 3THVA 5DM7L 2AA4A 2HMPA 4Z4CA 3V6DA 3LDNA 3CMEN 2Q36A 5AQMA 5M1QA 3AV9A 1OVYA 4DR1K 3HL8A 2QEXN 4PKGA 4FO0A 4RW6A 3E9PA 2KFNA 2UU9K 1BU6O 3LP0A 3LP2A 3H46O 2WFBA 1JKHA 5GIOA 4M7XA 1RT4A 3L4QA 1UA0A 2V7ZA 4JI0K 4DQPA 1FXXA 3P1GA 1KFSA 2QA4N 4BRGA 4ISGA 4M3RA 4CGDA 2HHXA 4LY7A 1YAGA 1XMOK 4X64K 3ZX3A 5AQFA 5BRFA 1CLQA 2QWRA 3NAEA 1HPZA 2E2OA 4CJ3A 3ULEB 1YIJN 1TAQA 4RW7A 3VQ6A 4IOCL 3VPZA 1GLJO 3OYFA 1HYVA 3ISNC 4DUYK 4E7IA 4C1NI 1NGFA 2ZE2A 1BQMA 3CXCM 2VQEK 4K43A 4UQGA 4QCLA 3VEWA 5GAEP 3SPYA 1Q86O 2NLXA 3C95A 1QHTA 3CCMN 5EXWA 5GAGP 4BG8A 1HQUA 4E1NA 2QXFA 1S72N 1ZBLA 4CHPA 3SJHA 4YHHK 3LPTA 1NKBA 4DU3A 2P9NB 4NXMK 4NLCA 3MECA 1X3MA 1EKEA 4BR5A 1X3NA 3D2EB 1RGIA 1XHXA 2ZD1A 1BGXT 2FLOA 5M1FA 3M8QA 1HX1A 2GX9A 3V9XA 3OYNA 3C7NB 3QIPA 3AO5A 2QWQA 3VF2A 4EP4A 4AM6A 3MX2A 4DTXA 4FZYA 5CYMA 4DV5K 2OANA 4B9TA 1QQNA 1WBBA 4OO1J 5CE3A 1C0UA 3RMAA 4FLWA 3SV3A 1TUUA 3U4LA 3MXJA 1L3VA 2ZQBA 1L3TA 4KAZA 4DG1A 5CZ1A 1SS6A 4DV0K 3VGMA 1JL2A 1YHQN 3ITHA 3CPEA 1W9HA 4CE9A 2BH1A 3CCLN 4WQ5C 3MXMA 4M42A 3SQ4A 2E1ZA 4F3TA 4M3UA 4OKEA 3H1QA 4BE1A 4DKWA 4ELUA 4FSVA 2JWKA 1NJXA 3HBTA 3PIOL 5BRDA 3K58A 4KB1A 5EVZA 1VSHA 1N36K 3DOLA 1SKWA 4B1YB 4CK1A 3EN9A 4MO5A 2FBYA 4PA1A 4PY5A 4YOUA 3VTIA 2B4JA 3ZLJA 1CZ9A 3NF6A 5A2QO 4BRAA 5FDLA 3O3GA 5I42A 3V1RA 4FXDA 2DY4A 4FWQA 3K2PA 1D5AA 3T69A 3TPQA 1Q81O 3L4IA 1B92A 3F2KA 1U47A 2FC0A 3HPGA 4H4MA 4RTFD 5LL6Z 3ZETA 3SK3A 5EX5A 5HROA 1EXQA 3C6AA 3K5NA 1ZBIA 3NVMA 3H6EA 4E19A 4G9ZA 5AQOA 4FWOA 4M3TA 3J7AP 4CD1A 1GLCG 5SZTA 2YV0X 4XIUA 5HOOA 3KKRA 3EY1A 5AQJA 3SJJA 1NMDA 4HWIA 4DV1K 3PSFA 1I39A 3M8PA 3DLLL 4C8LA 1A5VA 3CC4N 1YTAA 4A61A 2IVNA 3L2QA 3G0ZA 1TKXA 5FRMA 4CJKA 4JYAK 3QB0A 3CYMA 4FWPA 4F9OA 4GV6A 5HRSA 3O9TA 3VN5A 2ITGA 2HNDA 4NXNK 3GOIA 4DMNA 2GWKA 2UUAK 4DR7K 3ZSVA 5BRHA 2Q1NA 1EETA 2CGJA 3UKUB 2R7YA 2ZWHA 5AQRA 4PL7A 2P9LA 2KTQA 3CM5A 2P5GA 3OY9A 4Q5VA 4NCBA 1N8RO 4A62A 4KO0A 3R1XA 4FJ5A 4AHRA 2QI2A 1WAJA 4M41A 3AVIA 4J2DA 3QDKA 3QESA 1NK0A 1TK5A 3BZKA 1RBSA 1RTIA 4DLGA 1I3AA 4CCHA 3CI5A 3V1QA 2XHBA 3D6RA 4CZEA 4FOIA 1SL2A 1NGCA 1BWFO 5AR0A 3VQCA 1RFQA 4Z4GA 3ZT0A 3DRRA 4CJUA 3VQPA 5KRTA 1YJNN 1MWKA 3JYTA 1D9DA 5AQSA 3ZSOA 2WUSA 4PHTX 4OPKA 5HL7L 1A5XA 1RBTA 3LZIA 3M8RA 2UUCK 4B8CA 4IKFA 4DWIA 4FJHA 4LF7K 4UY8O 4B08A 2GEMA 4AHSA 4CJFA 5H1SQ 1L5UA 5JVGL 4CFDA 3ASMA 3CCRN 2OCEA 1SKSA 1VRUA 3OHRA 5KPRA 1HLUA 1R0AA 1QZ5A 3CM6A 1KTQA 3AVKA 3OYDA 3NGIA 4CGFA 3QEVA 4JKFA 3GDQA 1HR0K 4NB4A 3LAKA 4OKJA 1GOCA 2DFHA 4M63C 3U6FA 2XY5A 3THWA 2HHWA 1NLVA 4NCAA 4B3RK 4JKCA 2RPIA 2NRWA 2W41A 3O80A 4B1ZA 4G1QA 2OZSA 2E4LA 2VWJA 3FZMA 2YHYA 4WQ4A 2X78A 3MEGA 4K0KK 4KTQA 1WSIA 2NRXA 1MDUB 5KPTA 2F7TA 3ZX2A 4OGEA 1IJJA 1Y97A 2WONA 1TL3A 4W5RA 4DUZK 1GLBG 3TABA 3AVBA 3ZETB 2ATQA 2YHBA 2O8BA 4DB3A 5LY3A 3HPOA 4JD2A 2FSJA 3G6EN 4M7YA 4NYFA 3VQQA 4FJIA 3CJBA 3TARA 4ID5A 2RHKA 1OH8A 3MWPA 2O8FA 4BRHA 4CF0A 4LF5K 4CERA 4JI8K 5FPEA 4FJGA 4JRQA 3CERA 4IOAL 4CK2A 5AQTA 3HSTB 1Q9YA 1X9SA 3UKRA 5FROA 4CZGA 4FK4A 4JKAA 1HYSA 4AHVA 5GADP 3AO1A 3RSEA 4FL9A 3MX5A 2NRTA 1NBWA 1SAZA 3D0PA 2KFZA 2BUPA 3SQ1A 3QEPA 2DFFA 3QIOA 4R5PA 3MN6A 1NNEA 1C0FA 5E84A 3CMAN 2NRRA 1CXUA 4KH5A 2ZF5O 4DU4A 1WSHA 4FK2A 1DTQA 4CHQA 3KHYA 4JAXA 3D2FA 3O5BA 2P9LB 4YFUA 4YOYA 3SQ0A 1T8EA 1HMVA 3WNHA 3ZX0A 3O9UA 3ZYYX 1MWMA 2A40A 4DSJA 3O4QA 3S9HA 3VESA 4DU1A 4PKHA 1R59O 5AJ3K 1BCMA 1KAXA 2NUBA 3A2FA 4CGJA 3K5MA 4KHUA 4FZXC 5LMUK 4DR4K 4FWSA 2VGNA 1SL0A 1NGHA 3LZJA 1HNVA 1VSMA 3WQUA 1TYQA 3T1YK 4CJQA 4DR2K 2PZSA 1VHXA 3HYFA 3AO3A 1NGGA 5C2FA 5AQPA 4DSFA 3OS1A 3CQYA 3LANA 4BRCA 1WSFA 2P9UA 1Z6RA 3CQXA 5B8HA 4ISEA 4O8KA 3ULEA 4NLBA 4WF9L 1WSJA 4KI6A 4Z4EA 1TKZA 3O6WA 2OYQA 4B1VA 3U3YA 2FSNA 5KQDA 4PKIA 2YKMA 4FLZA 4N47A 1HYZA 2HF4A 3BEXA 2JWLA 5HRNA 4JI1K 3OYJA 4HCCA 4V19S 1YF5L 3QETA 5CY4A 1IV0A 4H5RA 4AF1A 3K0SA 4NCGA 1ASUA 4FJNA 5AQWA 4GNIA 1S6PA 1UWBA 1WOQA 5FPNA 3THWB 1LAWA 3T19A 1RDCA 5BPMA 3VQ4A 4GV9A 3MEDA 5TKWA 4H03B 1KC8O 3DLEA 4CJWA 2QWNA 3ZEUA 3AVCA 4KHWA 5HBMA 4MO4A 4B8AB 4KV8A 4FOEA 3P83D 4B3SK 1FK9A 1JLBA 3OJSA 2KZMA 1IG8A 2O8BB 2IC3A 3CF5L 3HM8A 4JD2B 4CEAA 4FJKA 4H4OA 3HTVA 4YDUA 5KPZA 3QBXA 1JCFA 1WLJA 3M6GA 4H0PA 4DSLA 1KVCA 2FF3B 4DR5K 2VG7A 1I94K 2PYJA 2G8KA 4C23A 4DSIA 3UKRB 3EO3A 2Z1HA 4PWDA 5C12A 4QS8A 1KAZA 4KI4A 4DTMA 4IG3A 5HRRA 4GV3A 1Z25A 4AH9A 1C0GA 2E88A 3RSEB 1RTHA 3OA9A 4HUFA 3QEIA 3C6TA 3RMCA 1BUPA 3SPZA 1CZBA 2H3GX 4HHTA 4EZ9A 3FR0A 2D1KA 3DMJA 4CW7B 3NF7A 5J1EA 2W6KA 4BQZA 3BF1A 3DYAA 3P31A 1YTUA 3V1OA 1RT3A 4E7HA 1IO2A 3CJCA 4AILC 1RT2A 3CG7A 2KW4A 3QEWA 3HXMA 1VQ7N 1U49A 3AA4A 2IAJA 1KSPA 4FJXA 4OPJA 3AAQA 4GMJB 1BCOA 5AQYA 3DJCA 2XRIA 4J2EA 4H5NA 3LDSA 2G8WA 1B9DA 1GLDG 4IWVA 1LWCA 3OS2A 1X9WA 3CCQN 3EZ5A 2FBVA 3HPHA 5M1PA 3A5NC 4H0XB 2QTDA 1WB9A 3KWGA 4IDKA 3HVTA 3MN5A 4BC2A 4CEEA 4K8XA 2GTDA 1TYQB 3NCIA 3QFPA 2HNYA 3VQAA 1NGAA 1RDBA 3L0QA 4JK8A 4M45A 4K25A 4N76A 2IS3A 4CEFA 4H5VA 3PX6A 2P9UB 3ID6A 5TKYA 3NE6A 3NH2A 4O0IA 2ZM6K 5KTQA 4DQSA 3ZT2A 2D0BA 2E5LK 3SAHA 4CZIA 4FWKA 4H0OA 4CJLA 3L2WA 3IDHA 4CEQA 1ZBUA 1BIZA 4FWNA 1K6YA 5HRPA 3MK6A
chains in the Genus database with same CATH topology
1GLCG 5JLHA 2NZTA 5HOOA 3H45C 3J8AA 3M1FA 4BQLA 2GWJA 5BN9A 1YI2N 4A5AA 4BR0A 4B1UB 5C2DA 3CJ1A 4J8FA 2HOEA 5FPDA 1ILYA 3VF4A 5AQJA 3BF3A 3VETA 4ILHA 1NMDA 4BR7A 1VQ8N 1VQ4N 3LDQA 3O1BA 3DAWA 4HWIA 4EIAA 3P38A 3TSUA 5M1KA 1YJ9N 5BPLA 1TUYA 3FE1A 4WQ4C 3DLLL 3CC7N 2AP1A 3CC4N 3UKUA 1NGEA 3MN9A 3DXMA 4A61A 5AQLA 2IVNA 2I7PA 1YUWA 3ZEUB 2FF6A 3VENA 3WXIA 4E1JA 4BY9C 3HI0A 3A0IX 3QB0A 4FWPA 4F9OA 1U2VA 3WXKA 4GV6A 3AGKA 3GE1A 3LDOA 3O9TA 4U67L 4BRIA 3GOIA 2GWKA 5AQKA 3U9DA 3C0BA 3CCEN 3FZHA 5BRHA 5C0YA 4JKDA 1P90A 2IVPA 5M1NA 2Q1NA 4CI6A 5GINA 1NJIO 2CGJA 3UKUB 3EE9A 4BC3A 3WQTA 2V7YA 1O13A 2ZWHA 5AQRA 2A42A 1V4TA 2Q0RA 3AGRA 3CJ7A 3U9ZA 4PL7A 2P9LA 1YJWN 4BG9A 5AZJA 3KK7A 4JK9A 3VTHA 1JCGA 4EFHA 5JICA 1N8RO 4A62A 3R1XA 3HRGA 5ADXH 3SAGA 2A5XA 1U2VB 4BRQA 2QI2A 4CZMA 3D7EO 2Q31A 2QW9A 2NRVA 3QDKA 4XH5A 3VGKA 2RE2A 4A2BA 2ZJQL 2EWSA 4GVEA 4CD3A 1E4GT 4PL8A 3MMVA 3R3LA 4BVPA 2KLAA 1RDWX 5AQVA 3HOSA 4ILGB 5AQGA 2QWOA 3VEOA 4OPAA 1KAYA 3I33A 4JN4A 3CI5A 1HKCA 4YDUC 5AQHA 1BA1A 1NM1A 3D6RA 5MLCQ 4CZEA 4CZKA 4WFBL 5LJVA 4FOIA 2ZJRL 3E9OA 1NGCA 1BWFO 5AR0A 3RVCA 1RFQA 5AZIA 3TTFA 5C10A 4MDAA 4L3QA 4K42A 3LM9A 4DHYA 2QXLA 3VERA 1YJNN 1NGBA 1MWKA 5DM6L 1J6ZA 4JKGB 5AQSA 2WUSA 4RCHA 4PHTX 3EKUA 5HL7L 2V52B 3N4QA 1VQMN 3UE5A 3CJAA 1BO5O 2P9PB 3O4WA 4JEPA 3S41A 1VQ9N 4FWRA 1HKGA 4UY8O 4BRMA 2GEMA 5H1SQ 5JVGL 3SBGA 3CCRN 5ELZA 2OTJN 3M5RA 3GBTA 3C6HA 3OHRA 4FWLA 5KPRA 3QBWA 1YXQA 1GLLO 3CD6N 1HLUA 3FZLA 3MCAB 3P39A 5AZIB 1NGIA 1G99A 4H0TB 1QZ5A 1EO1A 5AFUH 5JMVA 3WEEB 3MCPA 1GLFO 3DXKB 3O9SA 1NGJA 4IO8A 4JKFA 2PFUA 3GDQA 1RDUA 3K9JA 4NB4A 1Q7YO 1ZBSA 4BGAA 1KQSM 4YORA 3K9KA 3WXMB 3E66A 4EHUA 3EKSA 4M63C 3MWTA 5F0XA 3TSQA 1NLVA 1S3XA 2CGLA 2NNWA 4JKCA 3AARA 4Z94A 1NGDA 4JNEA 2NRWA 1KD1O 2W41A 3O80A 4B1ZA 3OW2M 3FZMA 2Q2RA 2YHYA 2CGKA 2F9WA 2CH6A 4WQ4A 1K8AO 1QQOA 3ENHA 2ITMA 2D4WA 2QWPA 2NRXA 1MDUB 5KPTA 3J7ZO 2ASOA 1QHAA 2F7TA 3WXJA 2E8AA 3ZX2A 1T3VA 3L6QA 4WYBA 1SQKA 3P4IA 3O9RA 4EHTA 1IJJA 2NRHA 3ENBA 3VEZA 3ID8A 3ATVA 3E9LA 4JKBA 4CZHA 4A2AA 4CBWA 1GLBG 3ZETB 4YOTA 3R8EA 3C65A 4DB3A 5LY3A 3CJ9A 4JD2A 3E1YA 3VEXA 2FSJA 3G6EN 3MN7A 5AQXA 4M7YA 1Q82O 3EZWA 1X9JA 4KBOA 4BREA 1ZXOA 5BREA 2ZGZA 1SZ2A 3SAFA 1MA9B 3HSCA 3CJBA 4CZFA 2P9NA 3KVGA 4FWMA 3SMPA 3H1VX 2RHKA 3MWPA 2E2NA 4BRHA 3O08A 4A59A 3G4SN 3CHWA 3ZYYX 2E20A 1OKJA 4A57A 5FPEA 3D2EA 3CERA 4IOAL 4Y0WA 5AQTA 3N4PA 3AY9A 1V4SA 4H0YB 3UKRA 3KZBA 1T44A 2P9IA 4QS7A 4BRDA 4CZGA 2CH5A 2KHOA 4JKAA 3KWIA 4B1XB 2D0OA 4RWTA 2FXUA 4B9QA 1LCUA 5GADP 5AQZA 3RSEA 4MDBA 2A3ZA 2HF3A 3B8AX 3C7NA 4FL9A 5BR9A 5JLFA 4YOXA 4YOWA 3MX5A 2VCPA 1XQSC 3DXMB 4JHDA 4MLHA 2IIRA 2NRTA 1NBWA 1SAZA 2DPNA 4FPAA 3CETA 4IJNA 3CPWM 2PBDA 4BVOA 2BUPA 3EL2A 4MLEA 4IFEA 3VEYA 4B1WB 4WQ5A 1K9MO 3G71N 3MDQA 3A5LC 3MN6A 2I7NA 3QMLA 1C0FA 2E1YA 2P9IB 4KH4A 3PIPL 5LJWA 4BR9A 2GELA 5E84A 3CMAN 3VEVA 2NRRA 2P9KA 2Q0UA 3CC2N 3W0LA 4QS9A 4JKEA 4KH5A 5AQQA 4HTLA 3I55N 2ZF5O 3FZFA 2NRZA 4XH4A 3LDPA 1GLAG 3KHYA 4JAXA 3D2FA 3O5BA 2P9LB 5I9EB 5AZJB 1BOTO 4YOYA 2HBLA 3CCJN 1BA0A 5AQNA 3ZX0A 3JXUA 3CCVN 1VQKN 3O9UA 2WBNA 4IOXA 1ATSA 1MWMA 2V51B 3AAPA 3TSPA 2A40A 5FPMA 3T7ZA 4C1NK 4IO9L 3R6MA 1H1VA 1DGKN 3VESA 5E26A 2P9KB 1K8KA 3JS6A 5F2RA 4PKHA 1R59O 2E2QA 3VF6A 1KAXA 4IJAA 3VGLA 3VOVA 3O1WA 3D2FB 3PLAA 1K73O 2J4RA 4FWSA 2VGNA 3SMSA 3WUHA 4IEEA 1NGHA 3WQUA 1DT9A 1YVNA 1BG3A 1TYQA 4IEIA 2D0PA 4KH6A 4O8UA 1M1KO 4FVUA 1VQLN 2YX6A 4DCHA 3FLCO 3H3OB 1YITN 5KQ8A 4IDHA 4EAHD 1NGGA 3I8BA 5C2FA 2P9SA 2A6AA 1QQMA 5AQPA 2F9TA 3F5TA 2WC9A 5DM7L 2AA4A 3TTCA 3CQYA 1K8KB 2HMPA 4BROA 3LDNA 3CMEN 4FPBA 4BRCA 2W40A 2P9UA 2ZJPL 2Q36A 5AQMA 1Z6RA 3CQXA 5M1QA 4ISEA 1OVYA 4CJ7A 5B8HA 2QEXN 4PKGA 4FO0A 4NLBA 1ATNA 4O8KA 3ULEA 3E9PA 4O5FA 2ASPA 3O6WA 4H5WA 5AQIA 4B1VA 4WF9L 2FSNA 5KQDA 4PKIA 1BU6O 1JCEA 2HF4A 3BEXA 2JWLA 3Q7BA 1D4XA 2E2PA 3H46O 5ADXA 3GL1A 2WFBA 4WFNL 1M90O 1YF5L 5GIOA 4M7XA 4H5RA 1ESVA 4AF1A 3L4QA 3O9QA 2V7ZA 3U8XA 1BDGA 3UB5A 2QA4N 1VQON 1HUXA 1T6DA 2FSKA 4BRGA 4ISGA 4GY2B 2BTFA 5AQWA 5JVHL 3OBWA 1YAGA 3Q7CA 4XEIA 1VQNN 3SLCA 3ZX3A 5AQFA 5BRFA 5GIPA 2QWRA 3F9MA 4GNIA 4U7BA 4CZLA 2E2OA 4ILJA 1HPMA 3ULEB 1YIJN 1WOQA 5FPNA 1U6ZA 4IOCL 3VPZA 5BPMA 1GLJO 4GV9A 4BRPA 3IUCA 4BC4A 5TKWA 4H03B 5CHIA 1KC8O 2QM1A 4C1NI 1NGFA 2QWNA 1NWKA 3ZEUA 4YOVA 4WCEL 3CXCM 4MO4A 3CCUN 2HSTA 4BRLA 1VAZA 3FZKA 4K43A 4BRFA 4FOEA 4DQ8A 3VEWA 5GAEP 2QWMA 4ISFA 1Q86O 1QVFM 2VWBA 2NLXA 2YJFA 1IG8A 2YI1A 3CCMN 1GLEG 5EXWA 1Q18A 4BG8A 5GAGP 3CF5L 3ATUA 3HM8A 4JD2B 1S72N 2OTLN 4XH1A 2ASMA 3HTVA 4IXCA 3SJHA 5BN8A 1JJ2M 1QVGM 5AFUA 4AM7A 4YDUA 5KPZA 3QBXA 1JCFA 2P9NB 2PAVA 4NLCA 3M6GA 4H0PA 3HOTA 1X3MA 3SBTA 3FFKB 1EQYA 4BR5A 2FF3B 1X3NA 3D2EB 2A41A 1W97L 4H0VB 4C23A 1RGIA 4NO7A 1HKBA 3UKRB 3EO3A 2FLOA 3GG4A 5M1FA 5C12A 4QS8A 1KAZA 4OPHA 1HX1A 2GX9A 2YHWA 4GV3A 1C0GA 2E88A 4JKHA 3RSEB 3R9PA 3C7NB 3OA9A 3HZ6A 4BGBA 1QZ6A 1HJOA 4JHDB 3W3DA 2QWQA 4I6MA 3VF2A 4AM6A 3MX2A 1P8ZA 3LM2A 5EOYA 3WT0A 3WXLA 4CZJA 1BUPA 2OANA 2H3GX 1QQNA 3CCSN 3FR0A 4OO1J 2D1KA 5CE3A 1Y64A 3CIPA 4CBUA 4LC9B 3I56N 5BPNA 4BQZA 3BF1A 3A5OC 3O8MA 3P31A 4JKGA 3M3ZA 2VGMA 2YHXA 1TUUA 4K41A 3TU5A 3U4LA 3TTDA 2GUPA 2P9PA 3CJCA 3EE8A 1ATRA 1KXPA 3G25A 3LL3A 3NMUA 1SS6A 1CZAN 3VGMA 1YHQN 1VQ7N 3OBYA 1VQPN 1DEJA 1WUAA 3CPEA 3IFRA 3QFUA 2IVOA 4I6MB 4BRKA 4CBXA 1LOTB 2BH1A 3A5MC 3CCLN 4WQ5C 5C15A 2VYPA 4BC5A 2E1ZA 3AAQA 3H1QA 5EY4A 4DKWA 3WEEA 2YCHA 4JK7A 4FSVA 5AQYA 2JWKA 3VMFB 3HBTA 3A8YA 3DXKA 3PIOL 3DJCA 5BRDA 3H3NO 3BP8A 4A5BA 4R79A 5EVZA 4H5NA 1XC3A 1GLDG 3ENOA 4IWVA 1W2BM 2UYTA 3CCQN 2KKZA 4B1YB 5M1PA 3EN9A 4MO5A 3FGUA 3A5NC 4H0XB 2QTDA 3KWGA 3IKMA 1VQ5N 4YOUA 3MN5A 4BC2A 4BR2A 3VTIA 2HBJA 2GTDA 5AQUA 1TYQB 1E4FT 2Q97A 4BRAA 3QFPA 4FWQA 4WFAL 1T6CA 4JK8A 1NGAA 2ZGYA 3L0QA 2P9SB 2YJEA 3T69A 3TPQA 5F1XA 1Q81O 3L4IA 4K25A 2QWLA 3F2KA 4IZ9A 4H5VA 5GAHP 3BUZB 4RTFD 3ZETA 2P9UB 3ID6A 5TKYA 2HBMA 3SK3A 5EX5A 3NVKA 3C6AA 1VQ6N 4H5TA 1DKGD 3NVMA 2HBKA 1S22A 3H6EA 1Z05A 3SAHA 4BRNA 4G9ZA 3IMXA 1ZC6A 3DWLA 4FWKA 4FWOA 4H0OA 5AQOA 1XUPO 3IDHA 4CZIA 5CR4A 4CD1A 4FWNA 3QICA 4BR4A 3MK6A 5M1OA 3LDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GLC G;  5JLH A;  2NZT A;  3H45 C;  3J8A A;  3M1F A;  4BQL A;  2GWJ A;  5BN9 A;  4BR0 A;  4B1U B;  3CJ1 A;  4J8F A;  2HOE A;  5FPD A;  3VF4 A;  5AQJ A;  3BF3 A;  3VET A;  4BR7 A;  1NMD A;  3LDQ A;  3O1B A;  3DAW A;  4HWI A;  4EIA A;  5BPL A;  1TUY A;  3FE1 A;  4WQ4 C;  2AP1 A;  3UKU A;  1NGE A;  3MN9 A;  3DXM A;  4A61 A;  5AQL A;  2IVN A;  2I7P A;  1YUW A;  3ZEU B;  2FF6 A;  3VEN A;  3WXI A;  4E1J A;  3HI0 A;  3A0I X;  3QB0 A;  4FWP A;  4F9O A;  1U2V A;  3WXK A;  3GE1 A;  3LDO A;  4BRI A;  3GOI A;  2GWK A;  5AQK A;  3U9D A;  3C0B A;  3FZH A;  5BRH A;  2IVP A;  2Q1N A;  4CI6 A;  2CGJ A;  3UKU B;  4BC3 A;  3WQT A;  2V7Y A;  2ZWH A;  5AQR A;  2A42 A;  1V4T A;  2Q0R A;  3CJ7 A;  3U9Z A;  4PL7 A;  2P9L A;  4BG9 A;  5AZJ A;  5JIC A;  4EFH A;  1JCG A;  4A62 A;  5ADX H;  2A5X A;  1U2V B;  4BRQ A;  4CZM A;  3D7E O;  2Q31 A;  2QW9 A;  3QDK A;  4XH5 A;  3VGK A;  4A2B A;  2EWS A;  4CD3 A;  1E4G T;  4PL8 A;  3MMV A;  4BVP A;  5AQV A;  1RDW X;  5AQG A;  2QWO A;  3VEO A;  1KAY A;  3I33 A;  4JN4 A;  3CI5 A;  1HKC A;  4YDU C;  5AQH A;  1BA1 A;  1NM1 A;  4CZE A;  4CZK A;  5LJV A;  4FOI A;  1NGC A;  1BWF O;  5AR0 A;  1RFQ A;  5AZI A;  4L3Q A;  4K42 A;  3LM9 A;  4DHY A;  2QXL A;  3VER A;  1NGB A;  1MWK A;  1J6Z A;  5AQS A;  2WUS A;  4RCH A;  3EKU A;  2V52 B;  3UE5 A;  3CJA A;  1BO5 O;  2P9P B;  3O4W A;  3S41 A;  4FWR A;  1HKG A;  4BRM A;  2GEM A;  5ELZ A;  3GBT A;  3OHR A;  4FWL A;  5KPR A;  3QBW A;  1YXQ A;  1GLL O;  3FZL A;  1HLU A;  5AZI B;  1NGI A;  1G99 A;  4H0T B;  1QZ5 A;  5AFU H;  5JMV A;  3WEE B;  3MCP A;  1GLF O;  3DXK B;  1NGJ A;  4IO8 A;  3GDQ A;  4NB4 A;  1ZBS A;  4BGA A;  4EHU A;  3EKS A;  4M63 C;  5F0X A;  1NLV A;  1S3X A;  2CGL A;  4Z94 A;  3AAR A;  1NGD A;  4JNE A;  2W41 A;  3O80 A;  4B1Z A;  3FZM A;  2Q2R A;  2YHY A;  2CGK A;  2F9W A;  2CH6 A;  4WQ4 A;  1QQO A;  3ENH A;  2ITM A;  2D4W A;  2QWP A;  1MDU B;  5KPT A;  2ASO A;  1QHA A;  3WXJ A;  2E8A A;  3ZX2 A;  3L6Q A;  4WYB A;  1SQK A;  3P4I A;  4EHT A;  1IJJ A;  2NRH A;  3VEZ A;  3ID8 A;  3ATV A;  4CZH A;  4A2A A;  4CBW A;  1GLB G;  3ZET B;  3R8E A;  4DB3 A;  5LY3 A;  3CJ9 A;  4JD2 A;  3VEX A;  2FSJ A;  3MN7 A;  5AQX A;  4M7Y A;  3EZW A;  1X9J A;  4KBO A;  4BRE A;  1ZXO A;  5BRE A;  2ZGZ A;  1SZ2 A;  1MA9 B;  3HSC A;  3CJB A;  4CZF A;  2P9N A;  3KVG A;  4FWM A;  3SMP A;  3H1V X;  2E2N A;  4BRH A;  3O08 A;  3CHW A;  2E20 A;  1OKJ A;  5FPE A;  3D2E A;  3CER A;  4Y0W A;  5AQT A;  3AY9 A;  1V4S A;  4H0Y B;  3UKR A;  3KZB A;  1T44 A;  2P9I A;  4QS7 A;  4BRD A;  4CZG A;  2CH5 A;  2KHO A;  4B1X B;  4RWT A;  2D0O A;  2FXU A;  4B9Q A;  1LCU A;  5AQZ A;  3RSE A;  2A3Z A;  2HF3 A;  3B8A X;  3C7N A;  4FL9 A;  5BR9 A;  5JLF A;  2VCP A;  1XQS C;  3DXM B;  4JHD A;  4MLH A;  2IIR A;  1NBW A;  1SAZ A;  2DPN A;  4FPA A;  3CET A;  4IJN A;  2PBD A;  4BVO A;  2BUP A;  3EL2 A;  4MLE A;  3VEY A;  4B1W B;  4WQ5 A;  3MDQ A;  3A5L C;  3MN6 A;  2I7N A;  3QML A;  1C0F A;  2E1Y A;  2P9I B;  5LJW A;  4BR9 A;  2GEL A;  5E84 A;  3VEV A;  2P9K A;  2Q0U A;  3W0L A;  4QS9 A;  5AQQ A;  4HTL A;  2ZF5 O;  3FZF A;  4XH4 A;  3LDP A;  1GLA G;  3KHY A;  4JAX A;  3D2F A;  3O5B A;  2P9L B;  5I9E B;  5AZJ B;  1BOT O;  1BA0 A;  5AQN A;  3ZX0 A;  3JXU A;  4BRF A;  1ATS A;  1MWM A;  2V51 B;  3AAP A;  2A40 A;  5FPM A;  3R6M A;  1H1V A;  1DGK N;  3VES A;  5E26 A;  2P9K B;  1K8K A;  3JS6 A;  5F2R A;  4PKH A;  1R59 O;  2E2Q A;  3VF6 A;  1KAX A;  4IJA A;  3VGL A;  3VOV A;  3O1W A;  3D2F B;  2J4R A;  4FWS A;  3SMS A;  3WUH A;  1NGH A;  3WQU A;  1YVN A;  1BG3 A;  1TYQ A;  2D0P A;  4DCH A;  3FLC O;  3H3O B;  5KQ8 A;  4EAH D;  1NGG A;  3I8B A;  2P9S A;  2A6A A;  1QQM A;  5AQP A;  2F9T A;  2AA4 A;  3CQY A;  1K8K B;  2HMP A;  4BRO A;  3LDN A;  4FPB A;  4BRC A;  2W40 A;  2P9U A;  2Q36 A;  5AQM A;  1Z6R A;  3CQX A;  4CJ7 A;  4ISE A;  5B8H A;  4PKG A;  4FO0 A;  4O8K A;  1ATN A;  3ULE A;  4O5F A;  2ASP A;  3O6W A;  4H5W A;  5AQI A;  4B1V A;  2FSN A;  5KQD A;  4PKI A;  1BU6 O;  1JCE A;  2HF4 A;  3BEX A;  1D4X A;  2E2P A;  3H46 O;  5ADX A;  3GL1 A;  4M7X A;  4H5R A;  1ESV A;  3U8X A;  2V7Z A;  1BDG A;  3UB5 A;  1HUX A;  1T6D A;  2FSK A;  4BRG A;  4ISG A;  4GY2 B;  2BTF A;  5AQW A;  1YAG A;  4XEI A;  3SLC A;  3ZX3 A;  5AQF A;  5BRF A;  2QWR A;  3F9M A;  4GNI A;  4CZL A;  2E2O A;  1HPM A;  3ULE B;  1WOQ A;  5FPN A;  1U6Z A;  3VPZ A;  5BPM A;  1GLJ O;  4BRP A;  3IUC A;  4BC4 A;  4H03 B;  2QM1 A;  1NGF A;  2QWN A;  1NWK A;  3ZEU A;  4MO4 A;  4BRL A;  3FZK A;  4K43 A;  4FOE A;  4DQ8 A;  3VEW A;  2QWM A;  4ISF A;  2VWB A;  2NLX A;  2YJF A;  1IG8 A;  2YI1 A;  1GLE G;  5EXW A;  1Q18 A;  4BG8 A;  3ATU A;  3HM8 A;  4JD2 B;  4XH1 A;  2ASM A;  3HTV A;  4IXC A;  3SJH A;  5BN8 A;  5AFU A;  4AM7 A;  4YDU A;  5KPZ A;  3QBX A;  1JCF A;  2P9N B;  2PAV A;  3M6G A;  4H0P A;  1X3M A;  3FFK B;  1EQY A;  4BR5 A;  2FF3 B;  1X3N A;  3D2E B;  2A41 A;  4H0V B;  4C23 A;  1RGI A;  4NO7 A;  1HKB A;  3UKR B;  3EO3 A;  2FLO A;  3GG4 A;  4QS8 A;  1KAZ A;  1HX1 A;  2YHW A;  1C0G A;  2E88 A;  3RSE B;  3R9P A;  3C7N B;  3HZ6 A;  4BGB A;  1QZ6 A;  1HJO A;  4JHD B;  3W3D A;  2QWQ A;  4I6M A;  3VF2 A;  4AM6 A;  1P8Z A;  3LM2 A;  5EOY A;  3WT0 A;  3WXL A;  4CZJ A;  1BUP A;  2OAN A;  2H3G X;  1QQN A;  3FR0 A;  2D1K A;  5CE3 A;  1Y64 A;  3CIP A;  4CBU A;  4LC9 B;  5BPN A;  4BQZ A;  3BF1 A;  3A5O C;  3O8M A;  3M3Z A;  2YHX A;  1TUU A;  4K41 A;  3TU5 A;  3U4L A;  2GUP A;  2P9P A;  3CJC A;  1ATR A;  1KXP A;  3G25 A;  3LL3 A;  1CZA N;  3VGM A;  1DEJ A;  1WUA A;  4I6M B;  3IFR A;  3QFU A;  2IVO A;  4BRK A;  4CBX A;  1LOT B;  3A5M C;  4WQ5 C;  2VYP A;  4BC5 A;  2E1Z A;  3AAQ A;  3H1Q A;  5EY4 A;  3WEE A;  2YCH A;  4FSV A;  5AQY A;  3HBT A;  3A8Y A;  3DXK A;  3DJC A;  5BRD A;  3H3N O;  3BP8 A;  5EVZ A;  4H5N A;  1XC3 A;  1GLD G;  3ENO A;  4IWV A;  2UYT A;  4B1Y B;  3EN9 A;  4MO5 A;  3FGU A;  3A5N C;  4H0X B;  3MN5 A;  4BC2 A;  4BR2 A;  5AQU A;  2GTD A;  1TYQ B;  1E4F T;  2Q97 A;  4BRA A;  3QFP A;  4FWQ A;  1T6C A;  1NGA A;  2ZGY A;  3L0Q A;  2P9S B;  2YJE A;  3TPQ A;  5F1X A;  3L4I A;  4K25 A;  2QWL A;  4IZ9 A;  4H5V A;  3BUZ B;  4RTF D;  3ZET A;  2P9U B;  5TKY A;  3SK3 A;  5EX5 A;  4H5T A;  1DKG D;  1S22 A;  3H6E A;  1Z05 A;  4BRN A;  3IMX A;  1ZC6 A;  3DWL A;  4FWK A;  4FWO A;  4H0O A;  5AQO A;  1XUP O;  3IDH A;  4CZI A;  4CD1 A;  4FWN A;  3QIC A;  4BR4 A;  3MK6 A;  3LDL A; 
#chains in the Genus database with same CATH topology
 1S9G A;  4YY3 K;  1E3M A;  4FJM A;  4BQL A;  2GWJ A;  4BR0 A;  4F2S A;  3CJ1 A;  3V81 A;  3VET A;  4ILH A;  1T03 A;  1VQ4 N;  1NU0 A;  1VQ8 N;  3LDQ A;  3O1B A;  3DAW A;  4EIA A;  1TUY A;  3FE1 A;  3CC7 N;  3UKU A;  3MN9 A;  3DXM A;  3LAM A;  3SUQ A;  2I7P A;  1YUW A;  4FJJ A;  3ZEU B;  4E0D A;  1S1W A;  5IT9 O;  1JLG A;  4E7L A;  4I2Q A;  3AGK A;  2OPP A;  4U67 L;  1NK6 A;  2FBT A;  2KZZ A;  3LP1 A;  3ALY A;  3U9D A;  3OS0 A;  3FZH A;  3LP3 A;  5C0Y A;  2P5O A;  5M1N A;  2G8H A;  1J53 A;  5GIN A;  3WQT A;  1C1B A;  2GV9 A;  4B3O A;  2A42 A;  4BWJ A;  3AGR A;  5AZJ A;  5ADX H;  3SAG A;  4KFB A;  2A5X A;  1U2V B;  4BRQ A;  4W5N A;  1NK9 A;  4CZM A;  2QW9 A;  2NRV A;  4XH5 A;  3VGK A;  3V9S A;  4FZZ A;  4GVE A;  4CD3 A;  1J5O A;  2KLA A;  5AQV A;  3SI6 A;  4ILG B;  3PX0 A;  4DTP A;  1RIL A;  3ZSW A;  3TWH A;  1KAY A;  3I33 A;  4I7F A;  1HKC A;  4YDU C;  1U4B A;  5MLC Q;  3CFO A;  2OZM A;  4B3M K;  3E9O A;  3RVC A;  3TTF A;  4LF8 K;  1IKW A;  4K42 A;  4KTW A;  3LM9 A;  4E89 A;  2QXL A;  3VER A;  1O1W A;  3ZSR A;  3JSM A;  4KKO A;  5DM6 L;  1J6Z A;  3EKU A;  4E1M A;  4FLU A;  4DFP A;  1VQ9 N;  2I5J A;  3RMD A;  1QSY A;  4BRM A;  1HNI A;  4CEZ A;  1TK8 A;  1RTD A;  3V9W A;  3GBT A;  1YXQ A;  1GLL O;  4F8R A;  3FZL A;  5AZI B;  1G99 A;  4GVM A;  5AFU H;  2X74 A;  4KRF A;  4LH5 A;  3MCP A;  3O9S A;  2F96 A;  1NGJ A;  4Y1D A;  3I0S A;  4N56 A;  3E66 A;  5C25 A;  3EKS A;  4FJ9 A;  1J54 A;  1XHZ A;  4LH4 A;  3BDP A;  1DLO A;  1S3X A;  3AAR A;  2F8S A;  3ZCM A;  1KD1 O;  1QSS A;  2CH6 A;  4ICL A;  1K8A O;  1QQO A;  2QWP A;  4CIG A;  2ASO A;  1QHA A;  4FLT A;  2E8A A;  2HHT A;  2EX3 A;  4WYB A;  1SQK A;  2PYL A;  3ZSQ A;  3RMB A;  4CFA A;  4EHT A;  1RBU A;  3E9L A;  4JKB A;  4CZH A;  4A2A A;  4Z0U A;  4CBW A;  3T3F A;  3EEQ A;  3TR8 A;  4FLV A;  1BHL A;  1S1U A;  3R8E A;  2YNI A;  1HJR A;  1VRT A;  2E6L A;  3VEX A;  3MN7 A;  5AQX A;  3EZW A;  1X9J A;  4LSN A;  4ID1 A;  3NGY A;  4EP5 A;  4CES A;  1SZ2 A;  3HSC A;  4CZF A;  5FLX O;  4FWM A;  3SMP A;  3RR8 A;  1HNZ K;  1OKJ A;  1NG9 A;  1D9F A;  4LFB K;  4H0Y B;  4CED A;  4QS7 A;  1FKO A;  2D0O A;  1OVQ A;  4JI4 K;  1EX4 A;  3HJF A;  4JV5 K;  4YOX A;  1NOZ A;  1XQS C;  3DXM B;  4JHD A;  4OX9 K;  2G8I A;  4IJN A;  3NBP A;  1TAU A;  4FJL A;  2IDO A;  4JI5 K;  4DF8 A;  3SCX A;  4BVO A;  2RN2 A;  3AVG A;  4BE0 A;  4IFE A;  4WE1 A;  4JRP A;  3A5L C;  3QML A;  4KH4 A;  2GUI A;  4ZHR A;  2E1Y A;  1RNH A;  3VEV A;  1TL1 A;  1ZBH A;  2AJQ A;  4I2P A;  3W0L A;  4QS9 A;  4XH4 A;  2HHV A;  3LDP A;  1GLA G;  4DFJ A;  3F9K A;  5AZJ B;  2UXD K;  3JAM O;  1HNX K;  3CCJ N;  1BA0 A;  3JXU A;  1VQK N;  4IOX A;  4CHO A;  3AAP A;  1IBK K;  3T7Z A;  1N34 K;  3THX A;  2P9K B;  3JS6 A;  5F2R A;  3KJV A;  3TAM A;  3PUF A;  4O0J A;  1IG9 A;  4F2R A;  5J2P A;  3VGL A;  3VOV A;  1TKT A;  2J4R A;  1X9M A;  3VA0 A;  1NK7 A;  1DT9 A;  1YVN A;  4O8U A;  1M1K O;  4HCB A;  2D0P A;  4FVU A;  2HMI A;  3ZT4 A;  2YX6 A;  2HW3 A;  3FLC O;  3H3O B;  1YIT N;  5KQ8 A;  2OPQ A;  4EAH D;  2P9S A;  3KLF A;  2QKK A;  1IKY A;  3F5T A;  1K8K B;  4BRO A;  2W40 A;  1VQ6 N;  1ATN A;  1VSI A;  4O5F A;  4H5W A;  5AQI A;  1BL3 A;  4I9Q A;  4C8O A;  4OJR A;  3KIO A;  1D4X A;  4KHN A;  4WFN L;  1ESV A;  3O9Q A;  3U8X A;  4J2A A;  2VQF K;  3UB5 A;  1VQO N;  1BIS A;  1UOC A;  4GY2 B;  3PO4 A;  1VSK A;  1VQN N;  1JLA A;  4Z4H A;  2BGG A;  2BE2 A;  4KHQ A;  3J80 O;  1LV5 A;  4ILJ A;  1HPM A;  1LWF A;  2UXC K;  3OYE A;  4BRP A;  4CHY A;  1XNR K;  3IUC A;  4BC4 A;  2QM1 A;  1NWK A;  1HNW K;  3KTQ A;  4WCE L;  1B9F A;  3VQ7 A;  3FZK A;  3IAY A;  2XY8 A;  4LFA K;  4DQ8 A;  2QWM A;  4DFK A;  4ISF A;  2D5R A;  2VWB A;  1NOY A;  2YJF A;  2YI1 A;  3EYZ A;  1GLE G;  3IRX A;  3ATU A;  4OKK A;  3NGZ A;  2OTL N;  4JI6 K;  3HO1 A;  2G8U A;  4IXC A;  5BN8 A;  1QVG M;  1RBR A;  4AM7 A;  4CF9 A;  4OLB A;  3WNF A;  3SBT A;  4FW2 A;  3CFP A;  1EQY A;  1J5E K;  3F73 A;  2A41 A;  1W97 L;  4CGG A;  4DTS A;  3B6P A;  4H0V B;  1IBM K;  3SZ2 A;  3DLK A;  4KRE A;  3GG4 A;  5JS1 A;  4OPH A;  1N6Q A;  2YHW A;  4MFB A;  4JKH A;  3R9P A;  2O8E A;  3HZ6 A;  4BGB A;  3C6U A;  1QZ6 A;  1HJO A;  4JHD B;  3W3D A;  3PO5 A;  1P8Z A;  3WT0 A;  3WXL A;  2W6L A;  3AVN A;  5KGX A;  1LW0 A;  4CF1 A;  3MAQ A;  4W5Q A;  4DR6 K;  1Y64 A;  3CIP A;  4CBU A;  3I56 N;  1L3U A;  2F8T A;  3A5O C;  4JKG A;  3M3Z A;  2VGM A;  4K41 A;  2FBX A;  3P5J A;  2QKB A;  3EE8 A;  4C8N A;  3HK2 A;  1NK5 A;  3NMU A;  1CZA N;  3V9U A;  1W7A A;  1VQP N;  1DEJ A;  4I6M B;  3QFU A;  1ITG A;  3UIQ A;  3CFR A;  1LOT B;  1L3S A;  2W42 A;  5C15 A;  3SYZ A;  2O4G A;  2VYP A;  4BC5 A;  3KK3 A;  2Y1I A;  4JK7 A;  1S1X A;  4DF4 A;  3THY A;  3DXK A;  4R79 A;  3BP8 A;  4A5B A;  1NJY A;  3HP6 A;  1XC3 A;  3THX B;  5KI6 A;  1W2B M;  3ZT1 A;  2RKI A;  2UYT A;  2Z1I A;  2KKZ A;  4X65 K;  3FGU A;  3RTV A;  4CJ4 A;  4BDZ A;  3AA2 A;  3TAQ A;  3AO4 A;  3KLG A;  4BR2 A;  3ZSZ A;  2HBJ A;  3BZC A;  1E4F T;  2Q97 A;  4WFA L;  1IBL K;  2P9S B;  5F1X A;  4O55 A;  2QWL A;  3K5O A;  4H8K A;  4BE2 A;  5SWM A;  4IFY A;  3OYM A;  5GAH P;  1U04 A;  1XMQ K;  2HVI A;  2HBM A;  4DQI A;  4DV4 K;  4AQY K;  1DKG D;  1GOA A;  1KVB A;  4CGI A;  4FW1 A;  4BRN A;  1REV A;  1ZC6 A;  4U7B A;  5M1O A;  4Y1C A;  2HNZ A;  2D0A A;  3QIN A;  3KLH A;  4M3W A;  5JLH A;  2NZT A;  4IG0 A;  1A5W A;  1TVR A;  4A5A A;  4B1U B;  4J8F A;  5FPD A;  2EHG A;  2HOE A;  2Z1J A;  1TKD A;  1ILY A;  3BF3 A;  4BR7 A;  3S3M A;  2O4I A;  4LF6 K;  1EWR A;  5BPL A;  4WQ4 C;  1NJZ A;  1SV5 A;  1N5Y A;  4BWM A;  1JLQ A;  2FF6 A;  4BY9 C;  3HI0 A;  2HHU A;  1U2V A;  3WXK A;  2HHS A;  3OTO K;  3LDO A;  3QER A;  4PUO A;  4FCY A;  4B3T K;  3C0B A;  1S9E A;  4DR3 K;  3SQ2 A;  3CCE N;  2IVP A;  3KK1 A;  1NJI O;  4CI6 A;  2E6M A;  4BC3 A;  1O13 A;  1V4T A;  2Q0R A;  4OLA A;  3KK7 A;  3AVH A;  4JK9 A;  5JIC A;  1UAX A;  1NJW A;  3HRG A;  4DV3 K;  3KK2 A;  2DFE A;  1QTM A;  2Q31 A;  2ZJQ L;  2EWS A;  3KKS A;  3B6O A;  3R3L A;  3HOS A;  1BI4 A;  5AQG A;  1C1C A;  2QWO A;  4RW8 A;  3OYC A;  3U3G A;  4OPA A;  1NM1 A;  2IGI A;  2O8E B;  1XC9 A;  4WFB L;  4Z4I A;  2Q3S A;  1C0M A;  5AZI A;  4FLX A;  2YKN A;  1TK0 A;  4L3Q A;  4CVN E;  5KRS A;  1JXE A;  3TAP A;  4RG8 A;  4JS4 A;  5J2Q A;  4JKG B;  4RCH A;  1OH5 A;  3LWL A;  5LMN K;  3N4Q A;  3UE5 A;  3CJA A;  3HT3 A;  2D0C A;  4FWR A;  3LWM A;  2Y1J A;  3L3V A;  3SBG A;  5K14 A;  5ELZ A;  3C6H A;  1OH7 A;  3QBW A;  1S1T A;  5DMR A;  4BAC A;  3CD6 N;  3MCA B;  3P39 A;  1EO1 A;  2RF2 A;  4H0T B;  3DRP A;  4FJ7 A;  1SUQ A;  1VSE A;  3L2U A;  3TAN A;  1GLF O;  1ASV A;  3THY B;  3DXK B;  3VQ5 A;  1KCF A;  4IO8 A;  1JXB A;  4HUE A;  1RDU A;  1ZBS A;  1KQS M;  4FM2 A;  4F3O A;  3MWT A;  5F0X A;  3TSQ A;  3OYI A;  3TAE A;  2CGL A;  4AHC A;  4Z94 A;  4KHS A;  3DI6 A;  3WNE A;  1NGD A;  4JNE A;  3AVF A;  1WAF A;  1FKP A;  5CYQ A;  3L3U A;  2CGK A;  2F9W A;  3NHG A;  2D4W A;  5HP1 A;  3V9Z A;  1T3V A;  3L6Q A;  4LD0 A;  3VQ9 A;  5CZ2 A;  3P4I A;  1JLC A;  1D8Y A;  3O9R A;  4DV6 K;  2NRH A;  3ENB A;  3VEZ A;  4CGH A;  1T05 A;  3O3F A;  1IKV A;  4YOT A;  1EWQ A;  3I8D A;  1HQE A;  3E1Y A;  2JGU A;  1QSL A;  4BRE A;  1RDA A;  2ZGZ A;  5J2M A;  3SAF A;  1SL1 A;  3KVG A;  1NKC A;  3H1V X;  5EU7 A;  2E2N A;  3G4S N;  2O8C B;  3CHW A;  1KVA A;  1RDD A;  4CJE A;  3N4P A;  4OVL A;  1V4S A;  3KZB A;  1T44 A;  4W5T A;  4BDY A;  3ZSY A;  4BRD A;  2KHO A;  4B1X B;  3KWI A;  4RWT A;  3J7Y P;  4M3Z A;  3H08 A;  5AQZ A;  4GKK K;  4MDB A;  3NF9 A;  1VSD A;  3AO2 A;  5BR9 A;  5JLF A;  3NDK A;  3CQ8 A;  2VCP A;  4MLH A;  4M3Y A;  3DLH A;  2G8F A;  2IIR A;  2DPN A;  4FPA A;  4CJS A;  2HHQ A;  4C8M A;  1FJG K;  1TV6 A;  2PBD A;  3EL2 A;  3SUP A;  3VEY A;  3KD1 E;  2P9I B;  3O3H A;  2YNG A;  2GEL A;  4BR9 A;  4B9M A;  2YNH A;  2P9K A;  2Q0U A;  3CC2 N;  5AQQ A;  4HTL A;  3I55 N;  2YHA A;  4J2B A;  4DTR A;  4B9U A;  3OYG A;  3ZSX A;  2P1J A;  1NK4 A;  3SUN A;  1BOT O;  1MU2 A;  4K8Z A;  2HBL A;  1ZYQ A;  3M8S A;  5AQN A;  2UUB K;  2WBN A;  4BRF A;  4C1N K;  3D45 A;  4IO9 L;  1H1V A;  1DGK N;  1BI4 B;  1K8K A;  5D3G A;  4FLY A;  3TAG A;  3OVN A;  3I0R A;  3VF6 A;  1LWE A;  4IJA A;  3O1W A;  3IS9 A;  5C24 A;  3PLA A;  3TI0 A;  3KLI A;  4B9N A;  3SNN A;  4KH6 A;  4CJ5 A;  4DCH A;  3I8B A;  3RWU A;  3OYB A;  4N5S A;  2F9T A;  2WC9 A;  5J2N A;  3TTC A;  4CIF A;  4FPB A;  5FRN A;  2ZJP L;  4CJ7 A;  4CIE A;  4HUG A;  4YNQ A;  2ASP A;  4OGC A;  5I3U A;  1IKX A;  1WSE A;  1NK8 A;  1JCE A;  1LW2 A;  1VK0 A;  3Q7B A;  4DFM A;  4CF8 A;  4KHY A;  2E2P A;  5ADX A;  3RRH A;  3GL1 A;  1ZBF A;  1M90 O;  2QK9 A;  1Z26 A;  1BIU A;  3S3N A;  1BDG A;  1Q9X A;  2Z1G A;  1HUX A;  1T6D A;  2FSK A;  3TAF A;  3L8B A;  2BTF A;  5JVH L;  3OBW A;  3Q7C A;  4XEI A;  3AVA A;  3SLC A;  5GIP A;  3F9M A;  4DTN A;  4CZL A;  4FM0 A;  4ZTJ A;  4MQ3 A;  1U6Z A;  4LFC K;  4O44 A;  3KLE A;  5CHI A;  4AHU A;  4KPY A;  2HHH K;  4B9V A;  3L2V A;  2XY6 A;  2GBZ A;  4YOV A;  3CCU N;  2HST A;  3LPU A;  4BRL A;  1VAZ A;  3PV8 A;  4E7J A;  1FW6 A;  4X66 K;  2A1S A;  1S6Q A;  4IBN A;  3HP9 A;  1QVF M;  4RW4 A;  1Q18 A;  4DV2 K;  4B9L A;  4XH1 A;  2ASM A;  1JJ2 M;  4CJP A;  2ETJ A;  5AFU A;  3DLG A;  2PAV A;  3DLB A;  4PQU A;  4FK0 A;  1JL1 A;  3HOT A;  3IG1 A;  4CFC A;  1YT3 A;  2BDP A;  4HTU A;  3FFK B;  4CK3 A;  3HVR A;  2XO7 A;  3DOK A;  5KGW A;  4QOZ B;  4KB0 A;  3AA3 A;  4DS5 A;  1TGO A;  4NO7 A;  1HKB A;  1RT6 A;  3PSI A;  1WN7 A;  2UXB K;  1WNS A;  4I6M A;  3LM2 A;  5EOY A;  4JS5 A;  4CZJ A;  3WNG A;  1JLE A;  2A1R A;  3CCS N;  5JS2 A;  4F4K A;  4LC9 B;  5BPN A;  3O8M A;  1C6V A;  2YHX A;  2WOM A;  3TU5 A;  3TTD A;  4CFB A;  2GUP A;  2P9P A;  1U48 A;  1ATR A;  4FVM A;  1KXP A;  1OH6 A;  3G25 A;  3LL3 A;  1S5J A;  4DQR A;  1N32 K;  1KRP A;  4GKJ K;  3OBY A;  1WUA A;  3IFR A;  4E3S A;  2IVO A;  4BRK A;  4CBX A;  3A5M C;  1VSL A;  2DTU A;  3PX4 A;  5EY4 A;  3WEE A;  2YCH A;  3BY5 A;  3VMF B;  3A8Y A;  1RT1 A;  3H3N O;  3MXI A;  1LAV A;  4JI3 K;  3ENO A;  4M3X A;  4CHZ A;  1S1V A;  4CJT A;  3IKM A;  1VQ5 N;  2VG5 A;  1NMN A;  4DTJ A;  5AQU A;  3OJU A;  2VWK A;  3T1H K;  1T6C A;  3MEE A;  2ZGY A;  2YJE A;  2O8D A;  4AHT A;  3AVJ A;  4IZ9 A;  4CEC A;  4KTZ A;  3KD5 E;  1KFD A;  3BUZ B;  4BDP A;  1CXQ A;  3AVL A;  3NVK A;  4TSX A;  1WBD A;  2X6N A;  4H5T A;  2HBK A;  1S22 A;  4CHN A;  1C0T A;  2YNF A;  1Z05 A;  1W0H A;  4O4G A;  3AVM A;  3IMX A;  3DWL A;  1XUP O;  5CR4 A;  4BR4 A;  3QIC A;  3LDL A;  5T7B A;  2F4V K;  3H45 C;  3J8A A;  4O5B A;  3M1F A;  5BN9 A;  1YI2 N;  5C2D A;  3VF4 A;  5M1K A;  3P38 A;  3TSU A;  1YJ9 N;  4DSE A;  3NFA A;  3QO9 A;  2AP1 A;  1NGE A;  4KHP K;  5AQL A;  1QS4 A;  3LAL A;  3VQB A;  3VEN A;  3WXI A;  4E1J A;  3A0I X;  2LSN A;  3RRG A;  3ZT3 A;  3GE1 A;  1RCH A;  4LSL A;  4BRI A;  5AQK A;  1XNQ K;  3SUO A;  3V4I A;  1JLF A;  4RW9 A;  4JKD A;  1P90 A;  4DTU A;  4DS4 A;  1QE1 A;  3EE9 A;  1ASW A;  5HLF A;  2V7Y A;  3VQ8 A;  1U45 A;  3U9Z A;  1YJW N;  3CJ7 A;  4N41 A;  2KQ2 A;  4BG9 A;  1Q8I A;  3VTH A;  1JCG A;  4EFH A;  4FM1 A;  3PY8 A;  1N33 K;  1F21 A;  3K5L A;  4JI7 K;  1BQN A;  3AA5 X;  3D7E O;  4IFV A;  2BAN A;  4DV7 K;  2RE2 A;  4A2B A;  3L2R A;  1E4G T;  4CJR A;  4PL8 A;  3MMV A;  4ZTF A;  4BVP A;  4E7K A;  1RDW X;  3VEO A;  3OYH A;  2VG6 A;  4JN4 A;  4NYN A;  5AQH A;  1BA1 A;  4CZK A;  4C8K A;  5E41 A;  5LJV A;  3C94 A;  3HM9 A;  2ZJR L;  4FYD A;  5C10 A;  1RT5 A;  4MDA A;  4DHY A;  4DLE A;  1NGB A;  4CEO A;  2B5J A;  3BGR A;  2V52 B;  2P51 A;  3ULD A;  4W5O A;  1VQM N;  4CF2 A;  2OA8 A;  1BO5 O;  2P9P B;  3O4W A;  4JEP A;  3S41 A;  1KLN A;  3G10 A;  1HKG A;  5IWA K;  3DM2 A;  3NH1 A;  2OTJ N;  2IOC A;  3M5R A;  4FWL A;  1NGI A;  4QAG A;  3FFI A;  3NH0 A;  1IH7 A;  5JMV A;  3WEE B;  2HB5 A;  4FJ8 A;  3OYL A;  2PFU A;  3K9J A;  1GOB A;  1Q7Y O;  1EP4 A;  4BGA A;  4YOR A;  3K9K A;  3WXM B;  3QEX A;  4EHU A;  1RTJ A;  1G15 A;  2NNW A;  2XY7 A;  4B9S A;  3OW2 M;  2B6A A;  2Q2R A;  1RT7 A;  3ENH A;  2ITM A;  3SV4 A;  3J7Z O;  4X62 K;  1X1P A;  3WXJ A;  2O8C A;  2O8D B;  3VQE A;  4L8R B;  2WTU A;  3ID8 A;  4LF9 K;  3ATV A;  3QNN A;  3QNO A;  2OPR A;  1SKR A;  1YVU A;  4CJV A;  5C42 A;  3C65 A;  4Q0B A;  3CJ9 A;  3K57 A;  1HRH A;  1T7P A;  5BR8 K;  3K59 A;  3OYA A;  1Q82 O;  4KBO A;  1ZXO A;  5BRE A;  4CEB A;  2HVH A;  1MA9 B;  2P9N A;  4ELV A;  4HVJ A;  3VQD A;  3O4N A;  3O08 A;  4A59 A;  1XWL A;  1VSJ A;  2PY5 A;  2E20 A;  4A57 A;  3J81 O;  3D2E A;  4Y0W A;  3AY9 A;  3T1A A;  2P9I A;  1XI1 A;  2CH5 A;  2FXU A;  4B9Q A;  4EZ6 A;  1LCU A;  1WSG A;  3DLR A;  2A3Z A;  2HF3 A;  2X6S A;  3B8A X;  3C7N A;  4Z4F A;  4YOW A;  4I9L A;  3CPW M;  3S3O A;  3CET A;  1DTT A;  3OYK A;  4LF4 K;  2O8F B;  2JLE A;  4GW6 A;  4JLH A;  4JI2 K;  4MLE A;  4B1W B;  4WQ5 A;  1K9M O;  3G71 N;  3MDQ A;  3PIP L;  2I7N A;  5LJW A;  3DRS A;  4JKE A;  1NKE A;  3FZF A;  3E01 A;  2NRZ A;  2OPS A;  3VA3 A;  5I9E B;  3RR7 A;  3CCV N;  1C1A A;  1ATS A;  1VSF A;  2V51 B;  3TSP A;  4DTO A;  5FPM A;  3NF8 A;  3R6M A;  5E26 A;  1RBV A;  3QLH A;  2E2Q A;  4DQQ A;  3D2F B;  1K73 O;  1QQC A;  3WUH A;  3SMS A;  1UA1 A;  4IEE A;  4IEI A;  1BG3 A;  2G8V A;  1KLM A;  1VQL N;  4ELT A;  4IDH A;  1J9A A;  4DSK A;  2A6A A;  1QQM A;  5DK5 A;  3THV A;  5DM7 L;  2AA4 A;  2HMP A;  4Z4C A;  3V6D A;  3LDN A;  3CME N;  2Q36 A;  5AQM A;  5M1Q A;  3AV9 A;  1OVY A;  4DR1 K;  3HL8 A;  2QEX N;  4PKG A;  4FO0 A;  4RW6 A;  3E9P A;  2KFN A;  2UU9 K;  1BU6 O;  3LP0 A;  3LP2 A;  3H46 O;  2WFB A;  1JKH A;  5GIO A;  4M7X A;  1RT4 A;  3L4Q A;  1UA0 A;  2V7Z A;  4JI0 K;  4DQP A;  1FXX A;  3P1G A;  1KFS A;  2QA4 N;  4BRG A;  4ISG A;  4M3R A;  4CGD A;  2HHX A;  4LY7 A;  1YAG A;  1XMO K;  4X64 K;  3ZX3 A;  5AQF A;  5BRF A;  1CLQ A;  2QWR A;  3NAE A;  1HPZ A;  2E2O A;  4CJ3 A;  3ULE B;  1YIJ N;  1TAQ A;  4RW7 A;  3VQ6 A;  4IOC L;  3VPZ A;  1GLJ O;  3OYF A;  1HYV A;  3ISN C;  4DUY K;  4E7I A;  4C1N I;  1NGF A;  2ZE2 A;  1BQM A;  3CXC M;  2VQE K;  4K43 A;  4UQG A;  4QCL A;  3VEW A;  5GAE P;  3SPY A;  1Q86 O;  2NLX A;  3C95 A;  1QHT A;  3CCM N;  5EXW A;  5GAG P;  4BG8 A;  1HQU A;  4E1N A;  2QXF A;  1S72 N;  1ZBL A;  4CHP A;  3SJH A;  4YHH K;  3LPT A;  1NKB A;  4DU3 A;  2P9N B;  4NXM K;  4NLC A;  3MEC A;  1X3M A;  1EKE A;  4BR5 A;  1X3N A;  3D2E B;  1RGI A;  1XHX A;  2ZD1 A;  1BGX T;  2FLO A;  5M1F A;  3M8Q A;  1HX1 A;  2GX9 A;  3V9X A;  3OYN A;  3C7N B;  3QIP A;  3AO5 A;  2QWQ A;  3VF2 A;  4EP4 A;  4AM6 A;  3MX2 A;  4DTX A;  4FZY A;  5CYM A;  4DV5 K;  2OAN A;  4B9T A;  1QQN A;  1WBB A;  4OO1 J;  5CE3 A;  1C0U A;  3RMA A;  4FLW A;  3SV3 A;  1TUU A;  3U4L A;  3MXJ A;  1L3V A;  2ZQB A;  1L3T A;  4KAZ A;  4DG1 A;  5CZ1 A;  1SS6 A;  4DV0 K;  3VGM A;  1JL2 A;  1YHQ N;  3ITH A;  3CPE A;  1W9H A;  4CE9 A;  2BH1 A;  3CCL N;  4WQ5 C;  3MXM A;  4M42 A;  3SQ4 A;  2E1Z A;  4F3T A;  4M3U A;  4OKE A;  3H1Q A;  4BE1 A;  4DKW A;  4ELU A;  4FSV A;  2JWK A;  1NJX A;  3HBT A;  3PIO L;  5BRD A;  3K58 A;  4KB1 A;  5EVZ A;  1VSH A;  1N36 K;  3DOL A;  1SKW A;  4B1Y B;  4CK1 A;  3EN9 A;  4MO5 A;  2FBY A;  4PA1 A;  4PY5 A;  4YOU A;  3VTI A;  2B4J A;  3ZLJ A;  1CZ9 A;  3NF6 A;  5A2Q O;  4BRA A;  5FDL A;  3O3G A;  5I42 A;  3V1R A;  4FXD A;  2DY4 A;  4FWQ A;  3K2P A;  1D5A A;  3T69 A;  3TPQ A;  1Q81 O;  3L4I A;  1B92 A;  3F2K A;  1U47 A;  2FC0 A;  3HPG A;  4H4M A;  4RTF D;  5LL6 Z;  3ZET A;  3SK3 A;  5EX5 A;  5HRO A;  1EXQ A;  3C6A A;  3K5N A;  1ZBI A;  3NVM A;  3H6E A;  4E19 A;  4G9Z A;  5AQO A;  4FWO A;  4M3T A;  3J7A P;  4CD1 A;  1GLC G;  5SZT A;  2YV0 X;  4XIU A;  5HOO A;  3KKR A;  3EY1 A;  5AQJ A;  3SJJ A;  1NMD A;  4HWI A;  4DV1 K;  3PSF A;  1I39 A;  3M8P A;  3DLL L;  4C8L A;  1A5V A;  3CC4 N;  1YTA A;  4A61 A;  2IVN A;  3L2Q A;  3G0Z A;  1TKX A;  5FRM A;  4CJK A;  4JYA K;  3QB0 A;  3CYM A;  4FWP A;  4F9O A;  4GV6 A;  5HRS A;  3O9T A;  3VN5 A;  2ITG A;  2HND A;  4NXN K;  3GOI A;  4DMN A;  2GWK A;  2UUA K;  4DR7 K;  3ZSV A;  5BRH A;  2Q1N A;  1EET A;  2CGJ A;  3UKU B;  2R7Y A;  2ZWH A;  5AQR A;  4PL7 A;  2P9L A;  2KTQ A;  3CM5 A;  2P5G A;  3OY9 A;  4Q5V A;  4NCB A;  1N8R O;  4A62 A;  4KO0 A;  3R1X A;  4FJ5 A;  4AHR A;  2QI2 A;  1WAJ A;  4M41 A;  3AVI A;  4J2D A;  3QDK A;  3QES A;  1NK0 A;  1TK5 A;  3BZK A;  1RBS A;  1RTI A;  4DLG A;  1I3A A;  4CCH A;  3CI5 A;  3V1Q A;  2XHB A;  3D6R A;  4CZE A;  4FOI A;  1SL2 A;  1NGC A;  1BWF O;  5AR0 A;  3VQC A;  1RFQ A;  4Z4G A;  3ZT0 A;  3DRR A;  4CJU A;  3VQP A;  5KRT A;  1YJN N;  1MWK A;  3JYT A;  1D9D A;  5AQS A;  3ZSO A;  2WUS A;  4PHT X;  4OPK A;  5HL7 L;  1A5X A;  1RBT A;  3LZI A;  3M8R A;  2UUC K;  4B8C A;  4IKF A;  4DWI A;  4FJH A;  4LF7 K;  4UY8 O;  4B08 A;  2GEM A;  4AHS A;  4CJF A;  5H1S Q;  1L5U A;  5JVG L;  4CFD A;  3ASM A;  3CCR N;  2OCE A;  1SKS A;  1VRU A;  3OHR A;  5KPR A;  1HLU A;  1R0A A;  1QZ5 A;  3CM6 A;  1KTQ A;  3AVK A;  3OYD A;  3NGI A;  4CGF A;  3QEV A;  4JKF A;  3GDQ A;  1HR0 K;  4NB4 A;  3LAK A;  4OKJ A;  1GOC A;  2DFH A;  4M63 C;  3U6F A;  2XY5 A;  3THW A;  2HHW A;  1NLV A;  4NCA A;  4B3R K;  4JKC A;  2RPI A;  2NRW A;  2W41 A;  3O80 A;  4B1Z A;  4G1Q A;  2OZS A;  2E4L A;  2VWJ A;  3FZM A;  2YHY A;  4WQ4 A;  2X78 A;  3MEG A;  4K0K K;  4KTQ A;  1WSI A;  2NRX A;  1MDU B;  5KPT A;  2F7T A;  3ZX2 A;  4OGE A;  1IJJ A;  1Y97 A;  2WON A;  1TL3 A;  4W5R A;  4DUZ K;  1GLB G;  3TAB A;  3AVB A;  3ZET B;  2ATQ A;  2YHB A;  2O8B A;  4DB3 A;  5LY3 A;  3HPO A;  4JD2 A;  2FSJ A;  3G6E N;  4M7Y A;  4NYF A;  3VQQ A;  4FJI A;  3CJB A;  3TAR A;  4ID5 A;  2RHK A;  1OH8 A;  3MWP A;  2O8F A;  4BRH A;  4CF0 A;  4LF5 K;  4CER A;  4JI8 K;  5FPE A;  4FJG A;  4JRQ A;  3CER A;  4IOA L;  4CK2 A;  5AQT A;  3HST B;  1Q9Y A;  1X9S A;  3UKR A;  5FRO A;  4CZG A;  4FK4 A;  4JKA A;  1HYS A;  4AHV A;  5GAD P;  3AO1 A;  3RSE A;  4FL9 A;  3MX5 A;  2NRT A;  1NBW A;  1SAZ A;  3D0P A;  2KFZ A;  2BUP A;  3SQ1 A;  3QEP A;  2DFF A;  3QIO A;  4R5P A;  3MN6 A;  1NNE A;  1C0F A;  5E84 A;  3CMA N;  2NRR A;  1CXU A;  4KH5 A;  2ZF5 O;  4DU4 A;  1WSH A;  4FK2 A;  1DTQ A;  4CHQ A;  3KHY A;  4JAX A;  3D2F A;  3O5B A;  2P9L B;  4YFU A;  4YOY A;  3SQ0 A;  1T8E A;  1HMV A;  3WNH A;  3ZX0 A;  3O9U A;  3ZYY X;  1MWM A;  2A40 A;  4DSJ A;  3O4Q A;  3S9H A;  3VES A;  4DU1 A;  4PKH A;  1R59 O;  5AJ3 K;  1BCM A;  1KAX A;  2NUB A;  3A2F A;  4CGJ A;  3K5M A;  4KHU A;  4FZX C;  5LMU K;  4DR4 K;  4FWS A;  2VGN A;  1SL0 A;  1NGH A;  3LZJ A;  1HNV A;  1VSM A;  3WQU A;  1TYQ A;  3T1Y K;  4CJQ A;  4DR2 K;  2PZS A;  1VHX A;  3HYF A;  3AO3 A;  1NGG A;  5C2F A;  5AQP A;  4DSF A;  3OS1 A;  3CQY A;  3LAN A;  4BRC A;  1WSF A;  2P9U A;  1Z6R A;  3CQX A;  5B8H A;  4ISE A;  4O8K A;  3ULE A;  4NLB A;  4WF9 L;  1WSJ A;  4KI6 A;  4Z4E A;  1TKZ A;  3O6W A;  2OYQ A;  4B1V A;  3U3Y A;  2FSN A;  5KQD A;  4PKI A;  2YKM A;  4FLZ A;  4N47 A;  1HYZ A;  2HF4 A;  3BEX A;  2JWL A;  5HRN A;  4JI1 K;  3OYJ A;  4HCC A;  4V19 S;  1YF5 L;  3QET A;  5CY4 A;  1IV0 A;  4H5R A;  4AF1 A;  3K0S A;  4NCG A;  1ASU A;  4FJN A;  5AQW A;  4GNI A;  1S6P A;  1UWB A;  1WOQ A;  5FPN A;  3THW B;  1LAW A;  3T19 A;  1RDC A;  5BPM A;  3VQ4 A;  4GV9 A;  3MED A;  5TKW A;  4H03 B;  1KC8 O;  3DLE A;  4CJW A;  2QWN A;  3ZEU A;  3AVC A;  4KHW A;  5HBM A;  4MO4 A;  4B8A B;  4KV8 A;  4FOE A;  3P83 D;  4B3S K;  1FK9 A;  1JLB A;  3OJS A;  2KZM A;  1IG8 A;  2O8B B;  2IC3 A;  3CF5 L;  3HM8 A;  4JD2 B;  4CEA A;  4FJK A;  4H4O A;  3HTV A;  4YDU A;  5KPZ A;  3QBX A;  1JCF A;  1WLJ A;  3M6G A;  4H0P A;  4DSL A;  1KVC A;  2FF3 B;  4DR5 K;  2VG7 A;  1I94 K;  2PYJ A;  2G8K A;  4C23 A;  4DSI A;  3UKR B;  3EO3 A;  2Z1H A;  4PWD A;  5C12 A;  4QS8 A;  1KAZ A;  4KI4 A;  4DTM A;  4IG3 A;  5HRR A;  4GV3 A;  1Z25 A;  4AH9 A;  1C0G A;  2E88 A;  3RSE B;  1RTH A;  3OA9 A;  4HUF A;  3QEI A;  3C6T A;  3RMC A;  1BUP A;  3SPZ A;  1CZB A;  2H3G X;  4HHT A;  4EZ9 A;  3FR0 A;  2D1K A;  3DMJ A;  4CW7 B;  3NF7 A;  5J1E A;  2W6K A;  4BQZ A;  3BF1 A;  3DYA A;  3P31 A;  1YTU A;  3V1O A;  1RT3 A;  4E7H A;  1IO2 A;  3CJC A;  4AIL C;  1RT2 A;  3CG7 A;  2KW4 A;  3QEW A;  3HXM A;  1VQ7 N;  1U49 A;  3AA4 A;  2IAJ A;  1KSP A;  4FJX A;  4OPJ A;  3AAQ A;  4GMJ B;  1BCO A;  5AQY A;  3DJC A;  2XRI A;  4J2E A;  4H5N A;  3LDS A;  2G8W A;  1B9D A;  1GLD G;  4IWV A;  1LWC A;  3OS2 A;  1X9W A;  3CCQ N;  3EZ5 A;  2FBV A;  3HPH A;  5M1P A;  3A5N C;  4H0X B;  2QTD A;  1WB9 A;  3KWG A;  4IDK A;  3HVT A;  3MN5 A;  4BC2 A;  4CEE A;  4K8X A;  2GTD A;  1TYQ B;  3NCI A;  3QFP A;  2HNY A;  3VQA A;  1NGA A;  1RDB A;  3L0Q A;  4JK8 A;  4M45 A;  4K25 A;  4N76 A;  2IS3 A;  4CEF A;  4H5V A;  3PX6 A;  2P9U B;  3ID6 A;  5TKY A;  3NE6 A;  3NH2 A;  4O0I A;  2ZM6 K;  5KTQ A;  4DQS A;  3ZT2 A;  2D0B A;  2E5L K;  3SAH A;  4CZI A;  4FWK A;  4H0O A;  4CJL A;  3L2W A;  3IDH A;  4CEQ A;  1ZBU A;  1BIZ A;  4FWN A;  1K6Y A;  5HRP A;  3MK6 A; 
#chains in the Genus database with same CATH homology
 1GLC G;  5JLH A;  2NZT A;  5HOO A;  3H45 C;  3J8A A;  3M1F A;  4BQL A;  2GWJ A;  5BN9 A;  1YI2 N;  4A5A A;  4BR0 A;  4B1U B;  5C2D A;  3CJ1 A;  4J8F A;  2HOE A;  5FPD A;  1ILY A;  3VF4 A;  5AQJ A;  3BF3 A;  3VET A;  4ILH A;  1NMD A;  4BR7 A;  1VQ8 N;  1VQ4 N;  3LDQ A;  3O1B A;  3DAW A;  4HWI A;  4EIA A;  3P38 A;  3TSU A;  5M1K A;  1YJ9 N;  5BPL A;  1TUY A;  3FE1 A;  4WQ4 C;  3DLL L;  3CC7 N;  2AP1 A;  3CC4 N;  3UKU A;  1NGE A;  3MN9 A;  3DXM A;  4A61 A;  5AQL A;  2IVN A;  2I7P A;  1YUW A;  3ZEU B;  2FF6 A;  3VEN A;  3WXI A;  4E1J A;  4BY9 C;  3HI0 A;  3A0I X;  3QB0 A;  4FWP A;  4F9O A;  1U2V A;  3WXK A;  4GV6 A;  3AGK A;  3GE1 A;  3LDO A;  3O9T A;  4U67 L;  4BRI A;  3GOI A;  2GWK A;  5AQK A;  3U9D A;  3C0B A;  3CCE N;  3FZH A;  5BRH A;  5C0Y A;  4JKD A;  1P90 A;  2IVP A;  5M1N A;  2Q1N A;  4CI6 A;  5GIN A;  1NJI O;  2CGJ A;  3UKU B;  3EE9 A;  4BC3 A;  3WQT A;  2V7Y A;  1O13 A;  2ZWH A;  5AQR A;  2A42 A;  1V4T A;  2Q0R A;  3AGR A;  3CJ7 A;  3U9Z A;  4PL7 A;  2P9L A;  1YJW N;  4BG9 A;  5AZJ A;  3KK7 A;  4JK9 A;  3VTH A;  1JCG A;  4EFH A;  5JIC A;  1N8R O;  4A62 A;  3R1X A;  3HRG A;  5ADX H;  3SAG A;  2A5X A;  1U2V B;  4BRQ A;  2QI2 A;  4CZM A;  3D7E O;  2Q31 A;  2QW9 A;  2NRV A;  3QDK A;  4XH5 A;  3VGK A;  2RE2 A;  4A2B A;  2ZJQ L;  2EWS A;  4GVE A;  4CD3 A;  1E4G T;  4PL8 A;  3MMV A;  3R3L A;  4BVP A;  2KLA A;  1RDW X;  5AQV A;  3HOS A;  4ILG B;  5AQG A;  2QWO A;  3VEO A;  4OPA A;  1KAY A;  3I33 A;  4JN4 A;  3CI5 A;  1HKC A;  4YDU C;  5AQH A;  1BA1 A;  1NM1 A;  3D6R A;  5MLC Q;  4CZE A;  4CZK A;  4WFB L;  5LJV A;  4FOI A;  2ZJR L;  3E9O A;  1NGC A;  1BWF O;  5AR0 A;  3RVC A;  1RFQ A;  5AZI A;  3TTF A;  5C10 A;  4MDA A;  4L3Q A;  4K42 A;  3LM9 A;  4DHY A;  2QXL A;  3VER A;  1YJN N;  1NGB A;  1MWK A;  5DM6 L;  1J6Z A;  4JKG B;  5AQS A;  2WUS A;  4RCH A;  4PHT X;  3EKU A;  5HL7 L;  2V52 B;  3N4Q A;  1VQM N;  3UE5 A;  3CJA A;  1BO5 O;  2P9P B;  3O4W A;  4JEP A;  3S41 A;  1VQ9 N;  4FWR A;  1HKG A;  4UY8 O;  4BRM A;  2GEM A;  5H1S Q;  5JVG L;  3SBG A;  3CCR N;  5ELZ A;  2OTJ N;  3M5R A;  3GBT A;  3C6H A;  3OHR A;  4FWL A;  5KPR A;  3QBW A;  1YXQ A;  1GLL O;  3CD6 N;  1HLU A;  3FZL A;  3MCA B;  3P39 A;  5AZI B;  1NGI A;  1G99 A;  4H0T B;  1QZ5 A;  1EO1 A;  5AFU H;  5JMV A;  3WEE B;  3MCP A;  1GLF O;  3DXK B;  3O9S A;  1NGJ A;  4IO8 A;  4JKF A;  2PFU A;  3GDQ A;  1RDU A;  3K9J A;  4NB4 A;  1Q7Y O;  1ZBS A;  4BGA A;  1KQS M;  4YOR A;  3K9K A;  3WXM B;  3E66 A;  4EHU A;  3EKS A;  4M63 C;  3MWT A;  5F0X A;  3TSQ A;  1NLV A;  1S3X A;  2CGL A;  2NNW A;  4JKC A;  3AAR A;  4Z94 A;  1NGD A;  4JNE A;  2NRW A;  1KD1 O;  2W41 A;  3O80 A;  4B1Z A;  3OW2 M;  3FZM A;  2Q2R A;  2YHY A;  2CGK A;  2F9W A;  2CH6 A;  4WQ4 A;  1K8A O;  1QQO A;  3ENH A;  2ITM A;  2D4W A;  2QWP A;  2NRX A;  1MDU B;  5KPT A;  3J7Z O;  2ASO A;  1QHA A;  2F7T A;  3WXJ A;  2E8A A;  3ZX2 A;  1T3V A;  3L6Q A;  4WYB A;  1SQK A;  3P4I A;  3O9R A;  4EHT A;  1IJJ A;  2NRH A;  3ENB A;  3VEZ A;  3ID8 A;  3ATV A;  3E9L A;  4JKB A;  4CZH A;  4A2A A;  4CBW A;  1GLB G;  3ZET B;  4YOT A;  3R8E A;  3C65 A;  4DB3 A;  5LY3 A;  3CJ9 A;  4JD2 A;  3E1Y A;  3VEX A;  2FSJ A;  3G6E N;  3MN7 A;  5AQX A;  4M7Y A;  1Q82 O;  3EZW A;  1X9J A;  4KBO A;  4BRE A;  1ZXO A;  5BRE A;  2ZGZ A;  1SZ2 A;  3SAF A;  1MA9 B;  3HSC A;  3CJB A;  4CZF A;  2P9N A;  3KVG A;  4FWM A;  3SMP A;  3H1V X;  2RHK A;  3MWP A;  2E2N A;  4BRH A;  3O08 A;  4A59 A;  3G4S N;  3CHW A;  3ZYY X;  2E20 A;  1OKJ A;  4A57 A;  5FPE A;  3D2E A;  3CER A;  4IOA L;  4Y0W A;  5AQT A;  3N4P A;  3AY9 A;  1V4S A;  4H0Y B;  3UKR A;  3KZB A;  1T44 A;  2P9I A;  4QS7 A;  4BRD A;  4CZG A;  2CH5 A;  2KHO A;  4JKA A;  3KWI A;  4B1X B;  2D0O A;  4RWT A;  2FXU A;  4B9Q A;  1LCU A;  5GAD P;  5AQZ A;  3RSE A;  4MDB A;  2A3Z A;  2HF3 A;  3B8A X;  3C7N A;  4FL9 A;  5BR9 A;  5JLF A;  4YOX A;  4YOW A;  3MX5 A;  2VCP A;  1XQS C;  3DXM B;  4JHD A;  4MLH A;  2IIR A;  2NRT A;  1NBW A;  1SAZ A;  2DPN A;  4FPA A;  3CET A;  4IJN A;  3CPW M;  2PBD A;  4BVO A;  2BUP A;  3EL2 A;  4MLE A;  4IFE A;  3VEY A;  4B1W B;  4WQ5 A;  1K9M O;  3G71 N;  3MDQ A;  3A5L C;  3MN6 A;  2I7N A;  3QML A;  1C0F A;  2E1Y A;  2P9I B;  4KH4 A;  3PIP L;  5LJW A;  4BR9 A;  2GEL A;  5E84 A;  3CMA N;  3VEV A;  2NRR A;  2P9K A;  2Q0U A;  3CC2 N;  3W0L A;  4QS9 A;  4JKE A;  4KH5 A;  5AQQ A;  4HTL A;  3I55 N;  2ZF5 O;  3FZF A;  2NRZ A;  4XH4 A;  3LDP A;  1GLA G;  3KHY A;  4JAX A;  3D2F A;  3O5B A;  2P9L B;  5I9E B;  5AZJ B;  1BOT O;  4YOY A;  2HBL A;  3CCJ N;  1BA0 A;  5AQN A;  3ZX0 A;  3JXU A;  3CCV N;  1VQK N;  3O9U A;  2WBN A;  4IOX A;  1ATS A;  1MWM A;  2V51 B;  3AAP A;  3TSP A;  2A40 A;  5FPM A;  3T7Z A;  4C1N K;  4IO9 L;  3R6M A;  1H1V A;  1DGK N;  3VES A;  5E26 A;  2P9K B;  1K8K A;  3JS6 A;  5F2R A;  4PKH A;  1R59 O;  2E2Q A;  3VF6 A;  1KAX A;  4IJA A;  3VGL A;  3VOV A;  3O1W A;  3D2F B;  3PLA A;  1K73 O;  2J4R A;  4FWS A;  2VGN A;  3SMS A;  3WUH A;  4IEE A;  1NGH A;  3WQU A;  1DT9 A;  1YVN A;  1BG3 A;  1TYQ A;  4IEI A;  2D0P A;  4KH6 A;  4O8U A;  1M1K O;  4FVU A;  1VQL N;  2YX6 A;  4DCH A;  3FLC O;  3H3O B;  1YIT N;  5KQ8 A;  4IDH A;  4EAH D;  1NGG A;  3I8B A;  5C2F A;  2P9S A;  2A6A A;  1QQM A;  5AQP A;  2F9T A;  3F5T A;  2WC9 A;  5DM7 L;  2AA4 A;  3TTC A;  3CQY A;  1K8K B;  2HMP A;  4BRO A;  3LDN A;  3CME N;  4FPB A;  4BRC A;  2W40 A;  2P9U A;  2ZJP L;  2Q36 A;  5AQM A;  1Z6R A;  3CQX A;  5M1Q A;  4ISE A;  1OVY A;  4CJ7 A;  5B8H A;  2QEX N;  4PKG A;  4FO0 A;  4NLB A;  1ATN A;  4O8K A;  3ULE A;  3E9P A;  4O5F A;  2ASP A;  3O6W A;  4H5W A;  5AQI A;  4B1V A;  4WF9 L;  2FSN A;  5KQD A;  4PKI A;  1BU6 O;  1JCE A;  2HF4 A;  3BEX A;  2JWL A;  3Q7B A;  1D4X A;  2E2P A;  3H46 O;  5ADX A;  3GL1 A;  2WFB A;  4WFN L;  1M90 O;  1YF5 L;  5GIO A;  4M7X A;  4H5R A;  1ESV A;  4AF1 A;  3L4Q A;  3O9Q A;  2V7Z A;  3U8X A;  1BDG A;  3UB5 A;  2QA4 N;  1VQO N;  1HUX A;  1T6D A;  2FSK A;  4BRG A;  4ISG A;  4GY2 B;  2BTF A;  5AQW A;  5JVH L;  3OBW A;  1YAG A;  3Q7C A;  4XEI A;  1VQN N;  3SLC A;  3ZX3 A;  5AQF A;  5BRF A;  5GIP A;  2QWR A;  3F9M A;  4GNI A;  4U7B A;  4CZL A;  2E2O A;  4ILJ A;  1HPM A;  3ULE B;  1YIJ N;  1WOQ A;  5FPN A;  1U6Z A;  4IOC L;  3VPZ A;  5BPM A;  1GLJ O;  4GV9 A;  4BRP A;  3IUC A;  4BC4 A;  5TKW A;  4H03 B;  5CHI A;  1KC8 O;  2QM1 A;  4C1N I;  1NGF A;  2QWN A;  1NWK A;  3ZEU A;  4YOV A;  4WCE L;  3CXC M;  4MO4 A;  3CCU N;  2HST A;  4BRL A;  1VAZ A;  3FZK A;  4K43 A;  4BRF A;  4FOE A;  4DQ8 A;  3VEW A;  5GAE P;  2QWM A;  4ISF A;  1Q86 O;  1QVF M;  2VWB A;  2NLX A;  2YJF A;  1IG8 A;  2YI1 A;  3CCM N;  1GLE G;  5EXW A;  1Q18 A;  4BG8 A;  5GAG P;  3CF5 L;  3ATU A;  3HM8 A;  4JD2 B;  1S72 N;  2OTL N;  4XH1 A;  2ASM A;  3HTV A;  4IXC A;  3SJH A;  5BN8 A;  1JJ2 M;  1QVG M;  5AFU A;  4AM7 A;  4YDU A;  5KPZ A;  3QBX A;  1JCF A;  2P9N B;  2PAV A;  4NLC A;  3M6G A;  4H0P A;  3HOT A;  1X3M A;  3SBT A;  3FFK B;  1EQY A;  4BR5 A;  2FF3 B;  1X3N A;  3D2E B;  2A41 A;  1W97 L;  4H0V B;  4C23 A;  1RGI A;  4NO7 A;  1HKB A;  3UKR B;  3EO3 A;  2FLO A;  3GG4 A;  5M1F A;  5C12 A;  4QS8 A;  1KAZ A;  4OPH A;  1HX1 A;  2GX9 A;  2YHW A;  4GV3 A;  1C0G A;  2E88 A;  4JKH A;  3RSE B;  3R9P A;  3C7N B;  3OA9 A;  3HZ6 A;  4BGB A;  1QZ6 A;  1HJO A;  4JHD B;  3W3D A;  2QWQ A;  4I6M A;  3VF2 A;  4AM6 A;  3MX2 A;  1P8Z A;  3LM2 A;  5EOY A;  3WT0 A;  3WXL A;  4CZJ A;  1BUP A;  2OAN A;  2H3G X;  1QQN A;  3CCS N;  3FR0 A;  4OO1 J;  2D1K A;  5CE3 A;  1Y64 A;  3CIP A;  4CBU A;  4LC9 B;  3I56 N;  5BPN A;  4BQZ A;  3BF1 A;  3A5O C;  3O8M A;  3P31 A;  4JKG A;  3M3Z A;  2VGM A;  2YHX A;  1TUU A;  4K41 A;  3TU5 A;  3U4L A;  3TTD A;  2GUP A;  2P9P A;  3CJC A;  3EE8 A;  1ATR A;  1KXP A;  3G25 A;  3LL3 A;  3NMU A;  1SS6 A;  1CZA N;  3VGM A;  1YHQ N;  1VQ7 N;  3OBY A;  1VQP N;  1DEJ A;  1WUA A;  3CPE A;  3IFR A;  3QFU A;  2IVO A;  4I6M B;  4BRK A;  4CBX A;  1LOT B;  2BH1 A;  3A5M C;  3CCL N;  4WQ5 C;  5C15 A;  2VYP A;  4BC5 A;  2E1Z A;  3AAQ A;  3H1Q A;  5EY4 A;  4DKW A;  3WEE A;  2YCH A;  4JK7 A;  4FSV A;  5AQY A;  2JWK A;  3VMF B;  3HBT A;  3A8Y A;  3DXK A;  3PIO L;  3DJC A;  5BRD A;  3H3N O;  3BP8 A;  4A5B A;  4R79 A;  5EVZ A;  4H5N A;  1XC3 A;  1GLD G;  3ENO A;  4IWV A;  1W2B M;  2UYT A;  3CCQ N;  2KKZ A;  4B1Y B;  5M1P A;  3EN9 A;  4MO5 A;  3FGU A;  3A5N C;  4H0X B;  2QTD A;  3KWG A;  3IKM A;  1VQ5 N;  4YOU A;  3MN5 A;  4BC2 A;  4BR2 A;  3VTI A;  2HBJ A;  2GTD A;  5AQU A;  1TYQ B;  1E4F T;  2Q97 A;  4BRA A;  3QFP A;  4FWQ A;  4WFA L;  1T6C A;  4JK8 A;  1NGA A;  2ZGY A;  3L0Q A;  2P9S B;  2YJE A;  3T69 A;  3TPQ A;  5F1X A;  1Q81 O;  3L4I A;  4K25 A;  2QWL A;  3F2K A;  4IZ9 A;  4H5V A;  5GAH P;  3BUZ B;  4RTF D;  3ZET A;  2P9U B;  3ID6 A;  5TKY A;  2HBM A;  3SK3 A;  5EX5 A;  3NVK A;  3C6A A;  1VQ6 N;  4H5T A;  1DKG D;  3NVM A;  2HBK A;  1S22 A;  3H6E A;  1Z05 A;  3SAH A;  4BRN A;  4G9Z A;  3IMX A;  1ZC6 A;  3DWL A;  4FWK A;  4FWO A;  4H0O A;  5AQO A;  1XUP O;  3IDH A;  4CZI A;  5CR4 A;  4CD1 A;  4FWN A;  3QIC A;  4BR4 A;  3MK6 A;  5M1O A;  3LDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...